2HDCA

Structure of transcription factor genesis/dna complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*GP*CP*TP*TP*AP*AP*AP*AP*TP*AP*AP*CP*AP*AP*TP*AP*
publication title Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein/dna
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1999-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hdcA00
1TTYA 1XCVA 5HLHA 3TO7A 1Z6RA 4WXCA 3WGIA 1P4WA 3ECHA 2V1DA 1MGTA 3GYHX 2C6YA 2Q2EA 1B9MA 4IVNA 1IRGA 1ON1A 3C1DA 1IXCA 2EV6A 3ISPA 1B1BA 4FT8A 1LB2A 4R79A 5D4SA 2H6CA 3I59B 5LRRA 4MEXF 2LF7A 2A5YB 2W84A 5D6EA 5LRSA 1QZZA 2EV0A 1O57A 1LEBA 3MZYA 2KIUA 3EUHA 3ABUA 4BH9A 1JHFA 1IZ1A 4L0YB 3KEOA 4UV9A 3MWMA 4FX4A 1T6SA 3K1NA 1U3EM 5LGTA 2KJBA 1SD4A 1QQIA 1FWZA 3CO6C 3QP5A 1U8RA 1J7KA 1F5TA 1HBXG 3KLOA 4GYGA 2D2WA 1DPUA 3ZMSA 2A07F 3BROA 3FXQA 1NHAA 3GXOA 3GFJA 4EJTA 3KEQA 3MAJA 2R7DA 5HS8A 3RTRA 3E3VA 3L9FA 1H0MA 1IF1A 1D8JA 1BJAA 2YX4A 4KN7X 3V7RA 3M9AA 4HW0A 4KMFA 4Q4ZF 1G3SA 1HQCA 3FM5A 5CVUA 2PLYA 2LDUA 3VB2A 3RPQA 2RC4A 2IVMA 5J6XA 2K27A 2M8EA 2Z5UA 2Y0MA 1J2XA 2MH2A 4PCQA 3WTTC 4H0EA 4GYIA 4D0PA 1E2XA 1T2KA 3E5XA 3L09A 1EH8A 1ZG5A 3SHFA 1B9NA 1EH7A 3HOTA 1G3YA 4A0ZA 5H20A 3GF2A 3GVAA 2NNYA 1B59A 4OMYA 2HWVA 3KCCA 1GXPA 2QLZA 1IUYA 4WX9A 5CJ9A 1W5TA 3CJNA 3J7AO 3TKYA 1BM9A 3ZQ7A 2H94A 1FOKA 4EJOA 4EM2A 5DEQA 4MNUA 1HW1A 2Z99A 3BP8A 1BOAA 1HSTA 2HTSA 2OQRA 4IRHA 4EGZA 1F9NA 3IWZA 1XSVA 2VE9A 2W57A 1J0RA 1W4MA 2XIGA 5E20A 1HKSA 2HTJA 5E1WA 4Q47A 2EFPA 3HRMA 2BYVE 5E8GA 3FMRA 4AWXB 3DP7A 4HF0A 5K5QA 4A0YA 2FBHA 4A0XA 5BOXA 1FNNA 2WV0A 4KIFA 1Z9CA 4U0VA 4P5OA 2M5WA 4BYYA 2ISZA 3IWFA 1REPC 3U1DA 5DUKA 2VBZA 5HDNA 2HKOA 1OMIA 3B73A 4RGRA 4CHUA 4NHJA 4ENNA 1P4AA 2HZTA 3ECOA 3V8KA 3K2ZA 2NAZA 2HGCA 2RNJA 3F22A 4LG0B 2KKOA 5DD4A 1D3YA 4BHCA 2DQLA 1T98A 1YYVA 2HYFA 4I0AA 4ON0A 5HOOA 3F8BA 2ACJA 4DQ2A 1QZYA 1K78B 3EETA 3GZ6A 1MDMA 3R6SA 2H09A 3I5UA 1DDNA 1OYWA 2IW5A 3WTUC 4AIJA 2YPRA 2ZKZA 3I58A 5ILVA 1B4AA 3ZMUA 3R0JA 1G3TA 3DFGA 2E1CA 3T8RA 1RZ4A 2O6GE 3OV8A 1ZRDA 3TDZC 1YS6A 1FBSA 3ABTA 1ON2A 4A6DA 2D1HA 4B09A 2DQRA 1KU3A 2TDXA 2HDCA 1QO0D 2MLKA 1YIOA 2ZXJA 1U5TA 3IC7A 2MBFA 4LD5A 3TOBA 1ZRCA 1KQ8A 1AWCA 5LEJA 2F5CA 4P9UA 4G8XA 3QP6A 4RGSA 3F6VA 2HR3A 2EFQA 3QRFF 2VOOA 3HRTA 4L5JA 2O03A 4L9JA 1MZBA 5LGUA 3WE2A 1YW7A 1CF7A 1TQMA 3KETA 1W7PB 1TW3A 2IRFG 5DCMB 5BQTA 4LLNA 4HLXA 1R5HA 4I98B 2X4HA 5LHGA 2ZNZA 2J5OA 4G6DA 1IN6A 3P9IA 1ONVA 4LK1F 1XMKA 5ICGA 1E17A 3NRVA 1FP2A 1KA8A 3VFZA 2NYXA 4OIQF 3ZN1A 2KJCA 3HSFA 3OOPA 3FM3A 3LWFA 3ZMTA 2F5EA 3GUDA 1D5VA 1TNSA 3D0SA 2VONA 1MJAA 1RUNA 5IT3A 3S2WA 3ZMZA 5CYVA 4IXAA 1TQIA 3GO5A 2CWEA 1JE8A 1HSJA 4HV6A 4KYWA 3EQLF 1R7JA 1FT9A 1SAXA 2IA2A 2QBYB 2A61A 4LGWA 1QNTA 5J8CA 3QOPA 3HHHA 1TNTA 3IRRA 3F8MA 4M74A 1XDSA 1FP1D 5K5RA 2FSWA 4MTDA 3FXUA 1TQPA 2R7FA 4KUMA 1R36A 3KZYA 4OOIA 2EFOA 5CVIA 4UVAA 3JAMZ 4HX8A 2CFXA 4KT5C 1T0FA 1UB9A 1KYWA 4KIGA 2EWNA 3TOAA 1DPRA 2P5VA 2UXNA 3HTSB 2VC0A 2STTA 2XKPA 4DNCA 3RIRA 5D4RA 1YG2A 4O6JA 3HSRA 1B6AA 4OMZA 2CQKA 3DXJF 2UZKA 2OBPA 2CSOA 3KZZA 3MEXA 5HS7A 1P92A 5ICCA 1RUOA 1J59A 1I27A 1HXDA 1XSDA 2O8XA 2XAHA 4EVIA 1Q1HA 4WXHA 3NEUA 3W6JB 4UHTA 5LBQA 1FSEA 5LEKA 2CG4A 3Q5FA 3I64A 1ZG1A 1HKTA 3GEZA 2W24A 1XD7A 3J80Z 3BOQA 5DD8A 1FBUA 2QUFA 2G7UA 4ENJA 3HUGA 1IN5A 5DDGA 5L3DA 1BBYA 2GA1A 2GQQA 1S29A 1UHWA 1L0OC 2XUBA 5IT9Z 4L9TA 4ZYHA 2RV8A 3FMSA 3HOSA 1R1TA 3WTXC 2L02A 1VTNC 1R58A 1KU7A 3BJOA 2XVCA 5A2QZ 1Y0UA 3KFWX 4CGZA 2Y75A 2NS0A 2M30A 2JT1A 2XRNA 1IAWA 1YQAA 1GXQA 1USSA 2D1VA 1R23A 2KIMA 5ICEA 1LDJA 2P5KA 2QENA 3V4GA 1G3WA 4IRGA 3O3KA 4ZYGA 2FMYA 2PBIA 4KN4X 2F5FA 2F5DA 2RN7A 1DUXC 2LSOA 1BI2A 3E5UA 1K79A 3FWEA 2L01A 1P2FA 2IJLA 1YTYA 3I4PA 4PZJA 4RAYA 1F4KA 3HSEA 3SQNA 2ZMEA 4N0BA 4A6EA 1PP7U 1FX7A 1ZLJA 3RYRA 1EV7A 2DBBA 3F3XA 3JTGA 3GFLA 3GW2A 3DPTA 1LNWA 4BQAA 4WF2A 1ZYRF 4GO1A 4BHPA 3I53A 1R22A 1WRJA 3HRSA 5D5VB 2HKXA 3T1BA 4MHGA 1ZG3A 2E1NA 1MJ9A 3RDIA 2IA0A 2QYOA 2HQRA 4CO8A 4YFXF 1TLHB 5FD6A 1FZPB 2XKOA 3RI4A 4KDPA 3GWZA 1W7PD 4XLNF 3C3WA 3MCZA 5ED4A 4EJWA 2ZBKA 4HYEA 4N9IA 2V6CA 4HX7A 2GZWA 5D8KB 4M73A 1U78A 5HLGA 5BPDA 1RIOH 5FGMA 1XCBA 2Z9OA 2DI3A 4MQVA 5HS9A 2Q0OA 4UXNA 3FMQA 4UV8A 1BIBA 4M9ZA 1OKRA 3E6MA 2V79A 1H9GA 3F21A 3DKWA 5LHIA 3IKTA 5HVQC 3RJPA 1S7OA 5ILSA 5LGNA 4U7DA 2K02A 3KP4A 2IP2A 1AOYA 4CYDA 4I01A 5LHHA 1PUEE 3J81Z 3JSOA 3TQNA 5JR3A 1P4XA 2EFNA 4G7HF 2YR2A 5D5WB 2PJPA 4EJUA 5AONA 2NRAC 1JHHA 1U2WA 2FNPA 2EK5A 5L3EA 4KNYA 4EJVA 1LVAA 2GWRA 4I2OA 4PGGA 1I5ZA 2XASA 4U88A 3ZMDA 3QPTA 2P7VB 4OIPF 1R5GA 5H6RA 3E6CC 4MQ9F 1UHMA 3I54A 4S05A 4HA8A 1SD5A 4IF4A 3MZHA 4BNCA 2K4BA 4QWQA 4R8HA 1OPCA 2V1XA 3HHGA 3IL2A 4G7OF 3RPUA 4E70A 3JSPA 2WC2A 5DCMA 4XSXF 1I6XA 5F6FA 4AVPA 3FF5A 4G6QA 1GHCA 1BC8C 1O3TA 2OQGA 5E8IA 2MH9A 4NB5A 2VT3A 5FO5A 3F8CA 2ZNYA 1KU9A 3DF8A 1UCRA 4M6YA 2K7LA 1MJBA 2GIVA 2XAFA 3E5QA 2FQ3A 2YX7A 2FA5A 3CUQA 2YU3A 2AS5F 2GAUA 2OAZA 4ESJA 2QQBA 2ZO4A 4ZYEA 3NQOA 4ENKA 1S3JA 3WTYC 4OIRF 2VXZA 2A6HF 1S6LA 2NNNA 2DW4A 5HDGA 2RVCA 1XMAA 5CVRA 5CVVA 2BEOA 5K1YA 4P55A 2FMLA 3HRUA 4WCGA 3PQKA 4M9XA 5H6QA 3ZMVA 2OA4A 3H3UA 1MDMB 1YO5C 2GA2A 2FXAA 4HQEA 3QPHA 4TV7A 3ULQB 1UFMA 1L3LA 3SFZA 4JBAA 4NQWA 2Y48A 2M45A 1YLFA 2CO5A 3GLXA 5TJJA 3FXRA 4PDKA 3L2CA 4L5IA 3W6KB 3TGNA 2ETHA 1O7LA 1CGPA 1XSXA 4Q48A 4A2UA 3T5XA 1O7FA 3M8FA 1T38A 4P96A 2VOPA 3P7NA 3GFIA 2R3SA 1FSHA 2ZJ2A 4FHTA 3D5LA 5ICFA 1ZGJA 4EMSA 2PQ8A 1TBXA 3R4KA 1S8NA 4BAYA 2COMA 4CZZA 3QAHA 1SMTA 1BI3A 4RAZA 4KMUX 2QQ9A 5FLXZ 1J75A 2HOEA 5D5XB 5DUIA 1CF7B 3R61A 2ELHA 3I71A 2QWWA 4U7BA 3WODF 1ZGAA 4LFUA 4LJZF 5K5OA 1ZRFA 3C18A 2G9WA 2XAJA 5IT9K 3E6DA 4Y13A 1WI9A 2PMUA 3E6BA 2XROA 4GCVA 4XSZF 3RYPA 2WWYA 6PAXA 4EQQA 2OZUA 3REOA 1Z6TA 4UNOA 3P9CA 2M1BA 3KP7A 4RB0A 4LLGF 1F1ZA 4HLYA 2VODA 4R1HA 5J8FA 1KQ9A 3RKYA 1BI1A 3RKXA 2VC1A 1KYZA 3LA7A 1G4DA 1U6GA 2J5PA 4BXUA 4L9NA 4PGHA 5DCFA 3FZVA 1P6RA 1IXRC 2PMHA 5D8LB 2L54A 3Q9VA 4I09A 2MLGA 4I7HA 2JRTA 5KVRA 4OINF 3DQVC 3RKWA 3T8TA 4KA4A 2O3FA 2IT0A 1FLIA 5DYMA 3I59A 4HF2A 1Z91A 2P8TA 2E7XA 4IHTA 4HX4A 1K6OA 5EEHA 2F2EA 2L3DA 3CUOA 4Y17A 3WE3A 2A69F 1LQ1A 4FX0A 4M9SA 1WSUA 3P9KA 1BC7C 1BI0A 3N97A 2BBYA 2EB7A 1SD6A 2CYYA 1ZH5A 4LB6B 4M6XA 2LKPA 1XB4A 2FNAA 1XGSA 2HYGD 1SMYF 3FHZA 4RB2C 5D5UB 2P5LC 2AXLA 1YS7A 3PQJA 1ZHFA 3U9GA 4HF1A 3KP3A 2H27A 3LQQA 2VBWA 2V9VA 3GX4X 2QQAA 2P7CB 5JHUA 3IHUA 4IPAA 4IRIA 1GVJA 3AAFA 4XRFA 4HZFA 4EM1A 1FBQA 3BJ6A 3R0AA 4CDGA 2EA2A 2BGCA 2W85A 3HYIA 3F8FA 4Y15A 3F8NA 4EV0A 1OYIA 2G7HA 3DEUA 2ESNA 2DAOA 4WXDA 5TRDA 4AIHA 3IRQA 4IHSA 1IN7A 3KE2A 1OR7A 2DPUA 2RGVA 5FB2A 2LNBA 4KICA 3DPLC 4O5VA 1WQ2A 4AIKA 3J81K 3WTZA 1IW7F 2O0YA 3QU6A 3BZ6A 2P4WA 4L18B 2JPCA 4YFKF 1H9TA 2CGPA 3VODA 2K86A 3HIFA 4ZZDA 3BJAA 3FX3A 3HTUA 4IJAA 4RGUA 1YW9A 1V4RA 1JXSA 3TO9A 5L3CA 2FEZA 4RGXA 1I1GA 2DPDA 2WTEA 2DU9A 3MQ0A 1R1VA 3ERED 4U0WA 1J9IA 4G7ZF 3F6OA 3M8EA 2FRHA 4Z2YA 4A5MA 1FYMA 4GXOA 4RB1A 3SXYA 1Z1DA 4M72A 3C7JA 2QM3A 1W5SA 5L3BA 4M71A 3K1PA 3VEPA 1ULYA 1FY7A 1ZARA 4ZZLA 2BV6A 1KQ0A 3K0LA 3COAC 3PFIA 2L4MA 1O3RA 4BHBA 2EFWA 2ZMEB 4G9YA 4YIIA 4KIBA 4LMYA 5L3GA 4HQMA 4MEYF 1LDDA 4I02A 3WGGA 5E18F 3TDUC 1KU2A 5L3FA 3EYYA 2RDPA 2QVOA 4LG0A 2UWMA 2XAGA 4MTEA 5BS6A 4CXFA 4UUVA 3WTSC 5ILUA 1DP7P 4ZYDA 4HDVA 1K78A 2A6EF 2MC3A 3I0TA 1EH6A 2P6TA 4JK1X 4O3MA 4LK0F 2EA4A 1ZAOA 2KIFA 3M7GA 2XGXA 2BE5F 2IPQX 2A68F 4F7ZA 1O3SA 2PFBA 3L00A 4ZH4F 2YSRA 1USTA 4CICA 3CLOA 2VE8A 2FBIA 2GXGA 1K7AA 3WG9A 3B02A 4LLLA 2PG4A 1FYLA 5FFXA 3VOEA 1IRFA 4OIOF 1A04A 1YFHA 4ETSA 3LA2A 4HOBA 1PP8F 3Q9SA 1PDNC 4ESBA 2DTRA 5D6FA 4P9FA 5E1ZB 4EGYA 1R00A 2EJRA 2FOKA 2PN6A 2JTVA 2LF8A 1BN5A 1QBJA 1IXSB 3ROUA 1SFUA 4Q5SF 1FYKA 2VBYA 1W7PA 4ESFA 1D8KA 3V7SA 3H92A 3WU1B 4U0YA 2HFHA 2Z3YA 3F72A 5BPIA 3JTHA 1QPMA 5EEGA 5JFRA 1G6NA 4YFNF 2JSCA 2JPBA 5FFZA 2ADUA 3H3ZA 3EYIA 2FF4A 2UXXA 3CUQC 3O2PE 4UVBA 3EDPA 1TW2A 1LJ9A 1O3QA 3CDHA 1U5TC 4XBFA 2H6BA 4YG2F 3WU0A 3V8LA 2XV4S 1S7AA 1JGSA 2Z33A 4ASNA 5FLXK 1XGOA 3KLNA 3WTVC 1RI7A 4L0ZB 2X0LA 2DFIA 4HBLA 1LDKB 3SZTA 3KP5A 4MGRA 2K4JA 2DO7A 3BDDA 2A3SA 4KFCA 1RNLA 1MD0A 1WWXA 3BPVA 1IN8A 4XLPF 1XGNA 1OYYA 2XAQA 3WTWC 5FD5A 2RQPA 1IN4A 2HQNA 3CO7C 2QBYA 2QZ8A 5HDKA 4N9HA 3BWGA 3LFKA 4OU0A 3JAMK 2B0LA 2W25A 3LQRA 3K9TA 5JI6A 4HDUA 5F1RA 2DT5A 4S04A 3GFMA 1ZN2A 3R60A 1KGSA 5CVJA 1X3UA 4A12A 1BIAA 4K2EA 2O61A 4LB5A 5DV5A 3ZN0A 3G3ZA 4QLCU 2DK8A 3BY6A 1HKQA 3M1EA 2GXBA 4HAMA 3CUQB 2HS5A 2Q8KA 3MFKA 1ODDA 5CLSA 2ZCWA 3CTAA 1U5TB 3V7CA 4G94A 1XDUA 2FU4A 5E1XA 1R1UA 2L4AA 2EV5A 3E97A 1SD7A 3V8JA 1FPQA 3BPXA 3LAJA 3ML6A 2VT2A 3K1MA 1Z7UA 2DLLA 2JZYA 3J80K 1SFXA 4JQFA 1V3FA 3ZP5A 2OZ6A 3GZ5A 3ELKA 3K69A 5ERIA 2P6SA 3DV8A 1C0WA 3G73A 4RS8A 2IA1A 1XGMA 4HV5A 3WGHA 1LEAA 3KP2A 3U2RA 4EM0B 2V1UA 3LSTA 2M87A 2RKHA 5LLQA 1ZLKA 2VBXA 1HW2A 2D45A 5A2QK 4UVCA 4YIFA 5AIQA 4WK8F 2ESHA 3L7WA 3KP6A 1XN7A 1ZREA 5BMZA 1STZA 1Z05A 3F23A 3ZPLA 2ISYA 3O6BB 5F64A 2ZFWA 4L9VA 4AD9A 5KK1A 1I1SA 4ENMA 2XHKA 3N4MA 1HW5A 1QGPA 2MA3A 3LAPA 2PEXA 2KRFA 2CW0F 2OU2A 4I0BA 2DK5A 2OD5A 3LA3A 5E17F 3TO6A 4A5NA 3IKVA 5AIPA 2VN2A 2STWA 1J5YA 4RB3C 4GGGA 3QU3A 1WKMA 4WWCA 1YW8A 4B8XA 2HEOA 1SFEA 5HLIA 2MD5A 3JW4A 2FBKA 5JVTA 1MKMA 2E7WA 3T0YA 2PI0A 1T39A 2FE3A 1FC3A 3SZPA
chains in the Genus database with same CATH superfamily
2R7VA 1TTYA 1XCVA 5HLHA 3TO7A 1Z6RA 2DODA 3LSMA 5EYRA 4WXCA 4HRIA 1YX3A 3RZOJ 1X58A 2DJIA 1F36A 2CUZA 3WGIA 1P4WA 1R6RA 3ECHA 2V1DA 3B6AA 1MGTA 2JA6J 2VLAA 3GYHX 2C6YA 4M3GA 2Q2EA 1B9MA 3HKZN 1D0XA 2IEKA 2LLKA 4IVNA 4BKXA 4BY1J 1IRGA 1ON1A 5DS9A 3HB9A 3C1DA 1ENHA 1IXCA 1X19A 2EV6A 2ZSIB 3O8HA 3ISPA 4FISA 4HG2A 4Z6YA 5GTIC 3L2RA 1B1BA 4FT8A 1LB2A 3QYFA 3CCEI 1VQMI 3G6EI 3UKGA 4R79A 5D4SA 3D5SC 4DBQA 2H6CA 2JK3A 2X6OA 3S3NA 2OV7A 1VQ8I 2X1EA 3I59B 3ZQQA 3DBRB 5EZGA 3HXLA 1OQYA 5LRRA 2HPIA 1UG0A 5JHFA 3CD6I 2V1NA 1HA8A 4E7IA 4MEXF 2LF7A 2A5YB 2NVUB 3U21A 2W84A 5D6EA 5LRSA 1QZZA 2EV0A 2M7AA 1D1CA 5J3LA 1O57A 2OUMA 1LEBA 3MZYA 3CF5F 2KIUA 2M9HA 3EUHA 3ABUA 4BH9A 1JHFA 3DPUA 4PFPA 1IZ1A 1V5EA 4FQGA 4L0YB 3H36A 4IO9F 3MN2A 3KEOA 4UV9A 3MWMA 4FX4A 1T6SA 4XRMA 3K1NA 1U3EM 5LGTA 2KJBA 1SD4A 2Y9YA 2ECBA 2KISA 4HEA2 1MBJA 1QQIA 1FWZA 3CO6C 3QP5A 2CH0A 1U8RA 4RDUA 4AYBN 3ESWB 1J7KA 1FTZA 4JX4A 1F5TA 1U0JA 3LSGA 1HBXG 2K9MA 3AKZA 1QA6A 3KLOA 4MIMA 2R7UA 4GYGA 5GAGJ 4CCKA 2D2WA 1DPUA 3ZMSA 2LR8A 2A6TA 3OYAA 1NG7A 2A07F 3BROA 3FXQA 3VPRA 2HXOA 2DMPA 3RCOA 1WGXA 2BVLA 3OYNA 3BZKA 1NHAA 4YRVA 5CQGA 4C3IJ 1W36D 3GXOA 3GFJA 2NOJB 4EJTA 1EKEA 2KIQA 2ELJA 3ONQA 3KEQA 1JUSA 1MMNA 2R7DA 3MAJA 5HS8A 3RTRA 4LOCA 1ITYA 2EQRA 4XN3A 2R0QC 3X2QH 3DEWA 1UMQA 1S72I 2P0WA 1OCOH 2E34A 3E3VA 3L9FA 1H0MA 1RKWA 2VL8A 2F4OB 1IF1A 1D8JA 1BJAA 2DDBA 1Q1VA 2YX4A 3Q0VA 4KN7X 3V7RA 1QPIA 3M9AA 4HW0A 3K4NA 4KMFA 4Q4ZF 1G3SA 1HQCA 3FM5A 5CVUA 4PJ0C 4BE2A 2CFOA 3FIWA 2PLYA 2LDUA 1VFCA 3VB2A 5KNLA 3RPQA 2RC4A 2IVMA 5J6XA 2K27A 2M8EA 2Z5UA 1OCRH 3BG7A 2Y0MA 1J2XA 2MH2A 4PCQA 3WTTC 4H0EA 2IGKA 2R7ZJ 4GYIA 4D0PA 1E2XA 1T2KA 1NK3P 2BW3B 3E5XA 2JWTA 3L09A 4NNJA 1EH8A 1ZG5A 3SHFA 3GTQJ 3MKWB 4B48A 1B9NA 2WV1A 1FMVA 4XR6A 4V2GA 1EH7A 3HOTA 1G3YA 4IEJA 4A0ZA 1LFUP 5H20A 2X6WA 2CUJA 3GF2A 3GVAA 1UHSA 4PJMA 2CQXA 4E7JA 2NNYA 1B59A 4G12A 1MBGA 4DBRA 2XGEA 1DU6A 1SVMA 5J40A 1VQOI 4OMYA 2HWVA 3KCCA 2L5QA 3RQ4A 1GXPA 2UUZA 3BQYA 2QLZA 5KAFC 3S2DJ 4C3JJ 1IUYA 4WX9A 4XLFA 4Y3OA 5CJ9A 2GIZA 1W5TA 3CJNA 3J7AO 3TKYA 1BM9A 3ZQ7A 2H94A 4XRSA 4XK4A 5FRNA 1FOKA 4EJOA 1TP4A 4ZJZA 4EM2A 2XB0X 3OMYA 1OISA 4MNUA 5DEQA 1HW1A 2Z99A 3BP8A 1BOAA 1HSTA 1E3OC 2HTSA 2OQRA 4IRHA 2DFFA 4EGZA 1F9NA 3IWZA 2L9NA 3DLAA 1XSVA 3QYBA 2VE9A 1FIAA 2W57A 2YUSA 1J0RA 1W4MA 4DIQA 2CQ7A 2XIGA 5E20A 1HKSA 2HTJA 5E1WA 1ERDA 3CCSI 4Q47A 2LK2A 2EFPA 3HRMA 1VNDA 3CCUI 3OY9A 2HQAA 2BYVE 5E8GA 3ABKH 3FMRA 4AWXB 5K7HA 2XAUA 3DP7A 4HF0A 5K5QA 3ASNH 4BBRJ 4A0YA 1X3ZB 4DGWB 1WJEA 2FBHA 4PFOA 4A0XA 5BOXA 1FNNA 5F0FA 1MW7A 2WV0A 1NK2P 2EIMH 4W97A 4KIFA 1Z9CA 4U0VA 4P5OA 2M5WA 2H1LA 4BUPA 4BYYA 1GVDA 2ISZA 3IWFA 3TBIA 1REPC 2K3PA 3U1DA 5HODA 3K4CA 5DUKA 2VBZA 3OR2C 5HDNA 2MFZA 3A0HC 4UUSB 1SEUA 3S17J 2HKOA 2L7KA 2PMZA 1OMIA 2WBMA 3S1RJ 3B73A 4CCJA 4II3A 4RGRA 4XQFA 4CHUA 4NHJA 4ENNA 4ZC3A 1P4AA 2HZTA 3ECOA 3V8KA 4ZDOA 3WU2C 2XPUA 3CCJI 2K9LA 2HVSA 4DOZA 3K2ZA 2NAZA 3QODA 1X4OA 2XC7A 2HGCA 1GT0C 2OTJI 3IAM2 4HSRA 2RNJA 2E36A 3CC2I 3F22A 4LG0B 1MBKA 1Z0XA 3JREA 1SANA 3UR3C 2KKOA 5DD4A 2VI6A 1D3YA 4BHCA 2DQLA 1T98A 1YYVA 3VWBA 1K6YA 2HYFA 4I0AA 4YELA 4ON0A 2FUG2 3F8BA 5HOOA 3S1QJ 2ACJA 4DQ2A 1BR1A 1QZYA 3ZQLA 2CUFA 1MSFC 4M3FA 1VQ9I 1W1WE 1K78B 4A3EJ 3EETA 3GZ6A 3VYRB 4ANJA 1MDMA 3AG4H 4I76A 5EJCA 3R6SA 2QKLB 2H09A 3I5UA 1DDNA 1Y56A 4B1RA 1OYWA 4BS9A 2CMPA 3P5JA 2IGOA 2IW5A 3WTUC 4AIJA 2MW8A 2YPRA 4LITA 5IY5H 1X3WB 1Z77A 3GLLA 2ZKZA 2RREA 2AHQA 4XONA 2HVQA 3I58A 5ILVA 2VJ5A 1B4AA 3ZMUA 3R0JA 4PJLA 1G3TA 3DFGA 3DKXA 1Z3YA 3PNTA 2E1CA 4X1EA 3T8RA 4V19K 1RZ4A 1IV8A 2O6GE 3OL4A 2DA7A 5K7ZA 3OV8A 3G4SI 1VF9A 1ZRDA 3TDZC 1YS6A 3TMOA 2OCEA 4CUGA 1G8XA 1FBSA 3D5RC 4XLAA 1WHUA 1OCTC 3ABTA 1ON2A 4BQOA 1LPQA 4A6DA 2W1OA 2D1HA 2EZIA 4RM2A 4B09A 3DBLB 2DQRA 1KU3A 2TDXA 2HDCA 2TRTA 2KRHA 4NC7A 2KHMA 1QO0D 2VQLA 2ELKA 4RMNA 2MLKA 1YIOA 2ZXJA 3J7YJ 2R5ZA 3LSHA 1U5TA 3IC7A 2MBFA 4LD5A 3TOBA 1ZRCA 1KQ8A 1AWCA 5LEJA 2F5CA 4P9UA 4CZCA 2FD5A 4G8XA 4QTRA 2BHZA 3QP6A 4RGSA 4JYKA 3GTKJ 2L7FP 3PIOF 5EGOB 3G1MA 3F6VA 2HR3A 2EFQA 3QRFF 4KISA 1IJWC 2VOOA 3HRTA 4L5JA 1FOWA 2O03A 4C2TA 4L9JA 3CESA 1MZBA 5LGUA 3WE2A 4LG3A 1YW7A 2O7OA 4BEHA 1CF7A 1TQMA 3A0BC 5J47A 3KETA 1W7PB 1TW3A 2ZJPF 2IRFG 5DCMB 3S14J 2R7QA 5BQTA 4LLNA 4CSWA 4HLXA 1R5HA 3OL3A 4I98B 2X4HA 1AU7A 4BBSJ 4AIDA 5LHGA 2ZNZA 2J5OA 4G6DA 1IN6A 3P9IA 1R5ID 1ONVA 4LK1F 1G59A 1B72A 1D0YA 2BY1A 1XMKA 5ICGA 3HZJA 1E17A 3NRVA 2W00A 3H0DA 5IYBJ 4ITVA 1FP2A 1KA8A 1FJLA 3VFZA 2NYXA 2BY2A 3S8PA 4JX6A 4OIQF 2P81A 1D0ZA 3ZN1A 2KJCA 2X1DA 3HSFA 3OOPA 3V42A 1MIJA 1U8BA 3FM3A 3LWFA 2E5NA 3M4OJ 3ZMTA 2G0EA 2F5EA 3AG2H 4GRIA 2VQHA 2JA2A 3GUDA 2VUMJ 1D5VA 2N8GA 5F04A 1TNSA 3D0SA 4A3IJ 2MGQA 4NUBA 2VONA 1MJAA 1VQ4I 1RUNA 3HC7A 2Q1ZB 5IT3A 3S2WA 3ZMZA 5CYVA 1Y1WJ 2VQGA 1VQ7I 4XKVA 4IXAA 4BU2A 1LKXA 1TQIA 3GO5A 1RR7A 2CWEA 3DTIA 3BTLA 1JE8A 1HSJA 1JT0A 3OS2A 4HV6A 2VKHA 2V26A 3FXMA 3A2KA 3DLLF 4XMYA 4KYWA 3EQLF 1R7JA 1FT9A 1SAXA 2IA2A 1BR4A 4BY7J 2LBFB 2QBYB 1IV6A 2R7SA 2DN0A 2A61A 4E7KA 4F92B 4LGWA 2X9DA 1H89C 2XSJC 4A93J 2XPVA 2HDDA 1QNTA 4Y4RA 5M3FJ 4A3DJ 3BTCA 5J8CA 3QOPA 3HHHA 3IH4A 1HDDC 2DA2A 5FKKA 3SDGA 3SJMA 2BZTA 5B66C 1AKHB 2K85A 3A4CA 1Y39A 1TNTA 3KYLA 3IRRA 3F8MA 4M74A 3GTJJ 1XDSA 5GPCA 1FP1D 1DQUA 2FSWA 5K5RA 2AXTC 1X1CA 4MTDA 4HSTA 3FXUA 5E3OA 1TQPA 5J1UA 5FKNA 4HNVA 2R7FA 4KUMA 1APLC 1W5CC 5B3SH 1R36A 3O8GA 3KZYA 3K10A 4OOIA 2DJNA 4BGDA 2EFOA 5F08A 1Y8QB 2LYCA 3DU5A 2ID6A 5CVIA 5F0HA 3K4JA 4UVAA 4M6VA 3JAMZ 4HX8A 2CFXA 3CDIA 4KT5C 1T0FA 1UB9A 4J00A 1KYWA 2ID3A 4KIGA 2EWNA 3TOAA 1DPRA 2P5VA 2UXNA 3KPHA 3TL4X 3HTSB 2VC0A 2STTA 4M3BA 2XKPA 4B3AA 5FJ8J 4DNCA 3RIRA 5HNFA 5D4RA 2EPFA 2IAIA 1YG2A 4O6JA 4DZPA 1IRZA 3TP3A 2LFBA 3HSRA 2WY8Q 4UB6C 3M07A 1B6AA 2NXNB 4FASD 4OMZA 3OYHA 2CQKA 2OCCH 3DXJF 2RQQA 2UZKA 1IGNA 3CP2A 2OBPA 4PJNA 2W82A 2CSOA 3KZZA 3MEXA 5HS7A 3HL2A 2HPMA 1BL0A 2HVRA 2BY3A 1TT0A 1P92A 2GOMA 1FIPA 2MD0A 2VKEA 4LIUA 4BJ6C 5ICCA 4KJZA 1J59A 2BHYA 5K7FA 1P7IA 4DZJA 4AYBA 1I27A 1HXDA 3S32A 1XSDA 2O8XA 2XAHA 4EVIA 1GDTA 1Q1HA 4WXHA 3NEUA 2F5VA 3W6JB 4UHTA 5LBQA 1WZ2A 3HPGA 1FSEA 5LEKA 2ICWG 2CG4A 2NS8A 2HYJA 3Q5FA 2VIXA 1MSEC 2I8DA 3I64A 4RAGA 1ZG1A 5CPRB 1RC9A 2JUGA 1HKTA 3GEZA 3H3VK 2W24A 1MBEA 1XD7A 3J80Z 5CQEA 3BOQA 1FMWA 5DD8A 2L9SA 1FBUA 2KFDA 2QUFA 3NAUA 2G7UA 4ENJA 3GCMA 5BNGA 3HUGA 1IN5A 1GLNA 2IS6A 1TZLA 3TEDA 5DDGA 5L3DA 5M5WJ 4IZZA 1BBYA 2R7XA 4B44A 2GA1A 2GQQA 1S29A 2LREA 1UHWA 1L0OC 2XUBA 5IT9Z 4L9TA 2QCOA 5KAIC 4ZYHA 1MNEA 2RV8A 4AUXA 3FMSA 3HOSA 1R1TA 4DYCA 3WTXC 1I3QJ 2L02A 1R58A 1VTNC 1DU0A 1SAUA 2DOEA 3AFHA 5TGTA 3ASOH 1KU7A 3BJOA 5F0CA 3Q0UA 2XVCA 5A2QZ 2QSHX 3VYTB 1Y0UA 3KFWX 2XRLA 4CGZA 3WHBA 1JT6A 2Y75A 2CRGA 2JJ7A 3ABLH 4F93B 4DYQA 2NS0A 2M30A 2JT1A 2XRNA 3CCMI 1IAWA 1VQPI 2EZKA 1YQAA 1VQLI 1GXQA 1USSA 2D1VA 2VKDA 1V5GA 1R23A 5GP9A 2PJRB 2KIMA 5ICEA 2I5UA 5IP9J 1LDJA 2V6EA 2P5KA 3UNGC 2QENA 3V4GA 1YJNI 1G3WA 1GV2A 1OR7C 3GTPJ 1X1AA 3E0JB 4IRGA 3SYTA 2E60A 3EUKL 3O3KA 4ZYGA 2KZGA 1V55H 2FMYA 2HOTA 2PBIA 3EUHC 2AQFA 4KN4X 2F5FA 2F5DA 2RN7A 3BG6A 1DUXC 2LSOA 1BI2A 3E5UA 1K79A 3FWEA 2L01A 1P2FA 3OYEA 2IJLA 3OYMA 3G1LA 1YTYA 3I4PA 3Q0WA 4PZJA 3S15J 3B6CA 4RAYA 4RLFA 2ZXWH 3S3MA 1F4KA 1X2NA 3NWSA 3SEQA 3HSEA 5E3LA 4XM3A 2R7OA 3SQNA 2ZMEA 3HOXJ 4N0BA 4A6EA 3S93A 1WJAA 1PP7U 4IOAF 3LL7A 3VSLA 2KDOA 1Z21A 3BR1A 2HU9A 3TP0A 1FX7A 2WY7Q 1ZLJA 2XGDA 3RYRA 1EV7A 1ZTRA 2DBBA 3F3XA 3JTGA 2GLOA 3GFLA 3GW2A 1NH3A 1A35A 3DPTA 1LNWA 2AQEA 3H9QA 4BQAA 4WF2A 1ZYRF 1VZ0A 2JMWA 3VYSB 4GO1A 4BHPA 2W7NA 2VJJA 3I53A 2Q2EB 1R22A 1WRJA 2IS2A 3HRSA 3VYUB 5D5VB 1ZR4A 1JKRC 3BCAA 3BR3A 2HKXA 5FKMA 3T1BA 3BTJA 1PVEA 4MHGA 4E7HA 4RLQA 1ZG3A 2E1NA 1MJ9A 3RDIA 2IA0A 2QYOA 2HQRA 1SFKA 4CO8A 4YFXF 4XLHA 1LFPA 3FXLA 1TLHB 5FD6A 1UJ8A 1FZPB 1R4MB 2X1CA 2D5VA 2XKOA 2ZFUA 3MMYB 5FKLA 3RI4A 3EPZA 4KDPA 3PO3J 1EF4A 1JTXA 4DJAA 2DA3A 1WJ5A 3GWZA 1R4NB 1W7PD 4XLNF 2DCEA 3C3WA 3MCZA 5ED4A 4EJWA 4X0GA 2ZBKA 4XOTA 4HYEA 1SC7A 4N9IA 2V6CA 4HX7A 1HC8A 2GZWA 1IUFA 5D8KB 4M73A 2VKVA 1U78A 1BA5A 1LUJB 5HLGA 2FX0A 4Y33A 1KZHA 1XC5A 2B9SA 5BPDA 4XRSG 1XG1A 2MYSA 3BQZA 4H4KC 1ZKGA 1RIOH 5FGMA 1XCBA 2Z9OA 4BL0B 2DI3A 4MQVA 5HS9A 2Q0OA 2DT7B 3E7LA 4UXNA 5EEAA 3FMQA 2HNHA 2X6YA 4UV8A 1BIBA 4M9ZA 3FKJA 1OKRA 3E6MA 2V79A 4BXFA 3MD2A 1H9GA 2DMTA 3AG1H 3F21A 4QPOA 3DKWA 3J7AY 1TWFJ 5LHIA 3IKTA 4E7LA 5E79C 4A3MJ 5HVQC 2DA5A 1S7OA 3RJPA 5ILSA 2X51A 2JA8J 1WI3A 3W2WA 4CH7A 5LGNA 4U7DA 4A3GJ 2K02A 3OS0A 3KP4A 3OWTA 5DM6F 3OR1C 2IP2A 1AOYA 4CYDA 4I01A 5LHHA 2JUCA 3S16J 2LD5A 1PUEE 3J81Z 1TT5B 3JSOA 1WVRA 2RNGA 4NBQA 3TQNA 5JR3A 4II2A 1P4XA 2EFNA 3BR5A 4G7HF 1PUFA 4HPQA 2OTLI 3FK6A 3N05A 4XKBA 3K2AA 3F0CA 2YR2A 2NVXJ 5D5WB 2PJPA 4EJUA 2Y69H 1YE9A 5AONA 1RKTA 2NRAC 1JHHA 4N4NB 1U2WA 5J4VA 3H9JA 4B47A 2FNPA 2EK5A 3CDLA 4C30A 5L3EA 2MABA 4KNYA 1QVTA 4ZDLA 2E5ZA 3CCVI 4EJVA 3JRCA 1LVAA 4PUSA 2GWRA 2RAEA 4I2OA 4PGGA 1I6HJ 3J7ZI 1MBFA 3CJRB 4U87A 1I5ZA 4BDYA 2XASA 4U88A 2M0CA 3ZMDA 2OJED 3QPTA 2P7VB 4OIPF 2F4MB 3HOUJ 2L2OA 1DGRM 1R5GA 4ABZA 5H6RA 3E6CC 4MQ9F 1UHMA 3I54A 4F52A 4BJTA 1WJBA 2R7TA 1FOYA 2K9QA 4S05A 4HA8A 1SD5A 4IF4A 2IS4A 2LVSA 3MZHA 4CYCA 4BNCA 3OYCA 1I3AA 2K4BA 3G2BA 4QWQA 4R8HA 3I9V2 3TW6A 2KQRA 2EILH 3A01A 1OPCA 2CW7A 2ECCA 2V1XA 3HHGA 3IL2A 4AC0A 2WAQN 4G7OF 1YHQI 5IP7J 1POGA 1S5LC 4FE4A 2ZXIA 3RPUA 1E0EA 2H8RA 1RUOA 4E70A 3JSPA 1T95A 2L7MP 3L1PA 2WC2A 5DCMA 2JSPA 4XSXF 1I6XA 5F6FA 4V2FA 4AVPA 3FF5A 4G6QA 4XORA 1GHCA 1D1BA 1A6QA 1BC8C 1O3TA 2OQGA 3ZCOA 2MH9A 5E8IA 5IYDJ 3FBNB 4ZTJA 4NB5A 1XX5A 2VT3A 3FBIB 5FO5A 3F8CA 2ZNYA 2ME0A 1KU9A 3A1YA 2LMDA 4NDLA 3DF8A 4IKFA 2DDAA 3LNQA 1UCRA 4M6YA 2K7LA 2QF7A 2V4JC 1MJBA 2GIVA 4GFBA 2XAFA 1WJFA 2FQ3A 3E5QA 5GAHJ 5M3MJ 3LSPA 2YX7A 2FA5A 3CUQA 2YU3A 4EATA 1R49A 3PNVA 2AS5F 2GAUA 2OAZA 3K4MA 2GM4A 4ESJA 2QQBA 2WAEA 2ZO4A 4ZYEA 5C44J 3U1KA 3NQOA 4ENKA 3VDXA 1WCMJ 2Y0SN 4XICA 1S3JA 3WTYC 4OIRF 3SDBA 2VXZA 3RZDJ 2A6HF 1S6LA 2NNNA 3ZOBA 1D1AA 3MZ8A 5F1JA 2R5YB 2DW4A 1B8IA 3OYFA 5HDGA 1ETXA 2RVCA 1XMAA 5CVRA 5CVVA 2BEOA 4GDFA 5K1YA 4P55A 4UY8I 2FMLA 3HRUA 4WCGA 3PQKA 4M9XA 5H6QA 3QPSA 3ZMVA 1EA3A 4DW6A 1ETYA 1N75A 4Y52J 2OA4A 4KITB 3H3UA 2ZSHB 2E2HJ 1MDMB 2BVMA 1YO5C 2GA2A 4FTHA 4AU7A 2FXAA 4HQEA 3NWTA 3QPHA 2VQCA 4D5FA 4PSXA 2LBFA 3PIPF 1VQKI 4TV7A 4F91B 3ULQB 1Y8RB 1UFMA 1L3LA 5JVGF 5IOZA 3SFZA 1N77A 3ZQGA 4YIRX 4D9JA 5M5XJ 4JBAA 3KYDB 4NQWA 2Y48A 3H5RA 2M45A 4FETA 2F4IA 3HG9A 1YLFA 3CJQB 1NG6A 2CO5A 2O8KA 3GLXA 2TCTA 5TJJA 3C2GA 3FXRA 1IDYA 2QGUA 1UG2A 2L9VA 4NC8A 4PDKA 3MKZA 3L2CA 3OYGA 2V9PA 1WJCA 4L5IA 3W6KB 3TGNA 2ETHA 1O7LA 5FLVA 1ZELA 3LFUA 1CGPA 1XSXA 4Q48A 2E35A 4A2UA 3T5XA 1O7FA 3M8FA 1T38A 3OOUA 2DYRH 4P96A 2WB1N 1YIJI 2M3AA 2VOPA 3P7NA 3S1MJ 1Y6IA 3GFIA 2R3SA 1FSHA 2MG4A 3ABMH 5J1RA 3VSKA 3JRHA 2ZJ2A 4FHTA 3D5LA 2R5ZB 2K9SA 4XIDA 5ICFA 1ZGJA 3PNYA 3OIQA 4EMSA 2M7BA 2PQ8A 4JX5A 1TBXA 4JOMA 1W0UA 3BT9A 1O4XA 3R4KA 1S8NA 4BAYA 3A02A 2KDZA 2COMA 3IH2A 4CZZA 3QAHA 2VPLA 1YRNA 1SFOJ 3LOCA 3TW7A 1SMTA 1YX5A 1BI3A 3CCYA 4RAZA 1MMDA 3SZGA 3LSIA 4KMUX 2QQ9A 2LKXA 5FLXZ 1A6IA 1J75A 2HOEA 4A3FJ 5D5XB 5DUIA 2WADA 4ZTFA 1YI2I 1CF7B 4BEHB 2K9NA 3R61A 2ELHA 1FOXA 3I71A 3ZR8X 4M3DA 3K4LA 2QWWA 2GXAA 4U7BA 1TWAJ 4RA2A 3OSGA 4PSWA 1N78A 4PJJA 3WODF 5C4XJ 1ZGAA 4LFUA 4LJZF 1QVUA 1TWCJ 5K5OA 1ZRFA 3C18A 2G9WA 2XAJA 4QIWN 3HKZA 2MC4A 3CMEI 4B43A 5IP6A 5IT9K 2COBA 3E6DA 2QKMB 4Y13A 3G71I 1WI9A 2PMUA 4A69C 3E6BA 1BOBA 2XROA 3CQZJ 2M2EA 1T08B 4ZDPA 5B1AH 1B72B 2M4GA 2HOAA 4GCVA 4XSZF 1E3HA 3RYPA 3M3YJ 4E7ZA 3IP4B 2WWYA 2QEXI 3M8JA 6PAXA 4EQQA 3FKIJ 4B4CA 3PO2J 2VJ4A 2OZUA 1T0FC 4UB8C 2HDWA 4XNFA 3DEEA 3REOA 4YEJA 1Z6TA 4UNOA 2Z1DA 3P9CA 2CU7A 2DA6A 3GZNB 2LRDA 5EG0A 2M1BA 5E3MA 3KP7A 4RB0A 4LLGF 1F1ZA 4HLYA 2VODA 1EJ9A 4R1HA 1T8IA 2E71A 5J8FA 1KQ9A 3RKYA 1YOVB 1LE8A 1BI1A 3RKXA 2VC1A 3HGGA 1KYZA 3LA7A 1G4DA 2XF5A 1U6GA 1X2MA 5IYCJ 2CQQA 4HNUA 2J5PA 4BXUA 4G6TB 4L9NA 2O5RA 4PGHA 3JRAA 2FQ4A 2EIKH 1YJ9I 1A31A 1JUPA 1I39A 5DCFA 3FZVA 2Z2SB 1JGGA 4A3LJ 3L2QA 3L2VA 2CV2A 1P6RA 1IXRC 3DBHB 2PMHA 2DTZA 5D8LB 2L54A 2DT6A 1JKQC 3HM5A 3D1NI 2EZHA 3OYBA 3Q9VA 4I09A 2MLGA 4I7HA 2JRTA 5KVRA 1HOMA 4OINF 1QU3A 3DQVC 3I4NJ 3RKWA 3BG5A 3PSFA 3T8TA 3KYCB 4Y7NJ 2O3FA 4KA4A 1T56A 3FDYA 1UAAA 1IG7A 2IT0A 3H1CA 1FLIA 5DYMA 2OC6A 1JKOC 3I59A 1YITI 4HF2A 2PJRA 3DKYA 2KLOA 1W0TA 1Z91A 5IPAA 1RR8C 3W2VA 2P8TA 2E7XA 4IHTA 3QQAA 4HX4A 2XF7A 3CZ6A 4CCNA 1IRXA 4E4HA 1OFCX 1K6OA 5EEHA 4NC6A 4AVZA 1Z3XA 5LFAA 2F2EA 2L3DA 3W3CA 3CUOA 1JKPC 4Y17A 3WE3A 1V54H 3BR2A 1R71A 1FEXA 2A69F 1LQ1A 1LVKA 4FX0A 4M9SA 1PJRA 4S0HB 4X6AJ 4MO7A 1WSUA 3P9KA 3W6VA 1BC7C 1S7EA 1BI0A 3I3LA 3OYKA 2Y31A 3K6GA 2DMQA 2JN6A 2DXIA 3N97A 2BBYA 3PM1A 3OSFA 2EB7A 2NVYJ 1SD6A 3WG7H 2CYYA 2XDVA 4W1UA 1ZH5A 4A3JJ 3ZXSA 4LB6B 4M6XA 2LKPA 1JJ8C 1XB4A 2FNAA 4UUTA 1XGSA 3A03A 3H9GA 2HYGD 4D1QA 1HCRA 1OLTA 1SMYF 3Q3SA 2V9KA 5GTHC 3FHZA 2E1OA 4J19A 1XTAA 3HDDA 4RB2C 5D5UB 3IUOA 2P5LC 2AXLA 1YS7A 3PQJA 1ZHFA 2K40A 3U9GA 4HF1A 3KP3A 5DTDA 5FLMJ 4BE1A 3LQQA 2H27A 2EIJH 3CC4I 2EH3A 2UV1A 2VBWA 2V9VA 3I4MJ 3PFYA 3GX4X 2QQAA 2P7CB 5JHUA 3IHUA 4IPAA 1CQTA 4IRIA 1GVJA 2HZDA 3AAFA 4XRFA 3I56I 4IX7A 4HZFA 4EM1A 1FBQA 3GBGA 3HOWJ 3BJ6A 1X4PA 1PYVA 3R0AA 4QPQA 4CDGA 1IDZA 2AO9A 2EA2A 1ETKA 2BGCA 2W85A 3HYIA 3F8FA 4Y15A 5EDNA 1JUMA 1RPWA 3JRFA 1ACIA 3F8NA 4EV0A 1ETVA 1ETWA 1OJLA 1OYIA 2G7HA 1VQ6I 1BR2A 1SVLA 1ZQ3P 4D5CA 3DEUA 4C2UA 2ESNA 2ZMEC 5DM7F 2DAOA 2DFEA 4WXDA 2BXYA 5TRDA 2E1MC 1ORKA 4AIHA 3IRQA 1HLVA 3BZCA 4FE7A 4IHSA 1IN7A 2CW8A 3KE2A 1OR7A 2DPUA 2RGVA 5FB2A 2BW3A 3CJTB 3ZQHA 3HUGB 2LNBA 4KICA 2LY9A 3DPLC 2QSGX 1T33A 4O5VA 1WQ2A 2E19A 2DMUA 4N4OB 4AIKA 5C4JJ 3J81K 3WTZA 1IW7F 2A05A 2O0YA 3QU6A 3BZ6A 2FOWA 2P4WA 4L18B 1M1EB 3BLYA 4IL6C 2JPCA 4YFKF 1H9TA 2CGPA 3PJRA 1BW5A 3S3OA 3VODA 5KHDA 1K61A 2K86A 3HIFA 2X48A 1WPKA 2GBYA 3BJAA 4ZZDA 2Z16A 1BJZA 2KL4A 4XKCA 3K70C 3FX3A 4I99C 3HTUA 4IJAA 4RGUA 1YW9A 1V4RA 1QZEA 2XB5A 1XS9A 1D5YA 2R7WA 1JXSA 3TO9A 3S2HJ 2KMUA 5L3CA 3GTGJ 2FEZA 4RGXA 1QHHD 3C2HA 1I1GA 2W4SA 2DPDA 2WTEA 2DU9A 3MQ0A 1R1VA 3ERED 2KZVA 2E2JJ 1K4TA 2ZC2A 4U0WA 1UZCA 2K5CA 2VB6A 5B1BH 3GTMJ 1KONA 1TWGJ 2NOGA 1K4SA 1J9IA 4G7ZF 2R4GA 2CQNA 3F6OA 1TL8A 3CC7I 3M8EA 2FRHA 4CCOA 4Z2YA 4A5MA 1FYMA 1LFBA 4PK4A 4GXOA 2QQ8A 1ETQA 4RB1A 3SXYA 1Y0NA 4C9YA 1Z1DA 4J01A 2R92J 4M72A 3C7JA 2QM3A 3LSKA 1W5SA 2XGCA 2CV0A 5L3BA 3OYLA 4M71A 2CS3A 3K1PA 3VEPA 1ULYA 4A3KJ 1HF0A 1FY7A 3RPUD 1ZARA 4ZZLA 2BV6A 3G1OA 1KQ0A 1R9TJ 3K0LA 3COAC 1X1DA 5FRMA 3PFIA 2H8WA 2L4MA 2WAQA 1O3RA 4BHBA 2EFWA 5B5EC 2ZMEB 4G9YA 4I6ZA 2Y30A 4YIIA 4KIBA 2E1MB 4UUSA 1JTYA 1ZK8A 4LMYA 1Z7LA 2L7ZA 2NS7A 3BCBA 5L3GA 3HGYA 3LMMA 4HQMA 4MEYF 1LDDA 4I02A 4MLOA 1IO2A 2XF6A 3IV5A 3E1SA 3AL0C 2OPTA 3JRBA 5KCMA 3WGGA 5E18F 3TDUC 1KU2A 5L3FA 2DYSH 3EYYA 2RDPA 5E3NA 4RBOA 2IS1A 1HDPA 9ANTA 1OCCH 2QVOA 4LG0A 2UWMA 2XAGA 1RESA 1UELB 2OF7A 4MTEA 5BS6A 2CUEA 1H88C 3MKYB 1VI0A 4CXFA 2YS9A 4UUVA 5HNHA 1DGWY 3WTSC 5ILUA 4OAYA 1DP7P 3OIPA 4ZYDA 4HDVA 3HOYJ 3FHNA 1K78A 1MH4A 2A6EF 3DU6A 2MC3A 3OIOA 3I0TA 1EH6A 3C2BA 2P6TA 4RAFA 5JLXA 4XLEA 4EEFG 1ZGWA 4JK1X 1BW6A 4O3MA 4LK0F 5CKTA 4IQ4A 2B63J 2EA4A 2Y0SA 3KZIC 3K7AJ 4A3BJ 1OCPA 2WAFA 3KIOA 1ZAOA 1QHGA 3CMAI 5H2FC 1I50J 2IGMA 2KIFA 3M7GA 4IQJA 2JVGA 2XGXA 2BE5F 2IPQX 2A68F 4F7ZA 1O3SA 2JA5J 3CLQA 1MMGA 2PFBA 4C2MJ 2Y9ZA 2BOLA 3L00A 4ZYAA 4ZH4F 2QA4I 2YSRA 3KX2A 1USTA 4CICA 3CLOA 4BXXJ 2VE8A 2FBIA 2GXGA 2ZJRF 1K7AA 3WG9A 3HPHA 3B02A 4LLLA 3H5AA 2PG4A 1FYLA 5FFXA 3DWLE 3ERMA 3VOEA 1IRFA 4OIOF 1A04A 5JLWA 1YFHA 3BC8A 1G2HA 4ETSA 3LA2A 1WJDA 3FXOA 4HOBA 3HOVJ 1PP8F 3Q9SA 1PDNC 4AM3A 4ESBA 3WHCA 3HJEA 2M34A 1W36C 2NVTJ 2DTRA 2CJJA 2DA4A 1VQ5I 1AA7A 5D6FA 2PX9A 4LIVA 2MSYA 4P9FA 4XLCA 5M5YJ 3IAS2 1P7JA 5E1ZB 1R00A 4F55A 2EJRA 4EGYA 2FOKA 2PN6A 4L5EA 1K83J 2JTVA 3AL0B 2LF8A 2JA7J 1BN5A 1QBJA 5J1YA 1IXSB 3BTIA 5EGOA 2R5YA 4RM3A 3FXJA 2HQ5A 3ROUA 2DMNA 1SFUA 2W48A 4Q5SF 1FYKA 2KPMA 3CCLI 2WB1A 2DA1A 2VBYA 1WFXA 1W7PA 4D7NA 4ESFA 1PUFB 1D8KA 1RETA 3V7SA 3H92A 3WU1B 3ZGKA 3LSRA 4U0YA 3HEFA 2HFHA 2Z3YA 3F72A 5BPIA 2GOXB 3JTHA 2O9LA 1QPMA 2VJIA 4E7SA 4M3EA 1V5FA 2KP6A 5EEGA 2Y2ZA 5LD2C 3BR6A 5JFRA 2YU9J 1G6NA 4YFNF 2E2IJ 2IXSA 2JSCA 3HOZJ 2JPBA 5FFZA 2ADUA 4B3XA 4DYRA 3H3ZA 3FK7A 4XL9A 3EYIA 2FF4A 2L0KA 2UXXA 3CUQC 3O2PE 1TWHJ 4UVBA 3EDPA 1TW2A 3JRDA 1LJ9A 2DFHA 3PUBA 1O3QA 3CDHA 3ZRGA 2H1KA 1U5TC 2LTPA 2HOSA 3IH3A 4XBFA 1DP3A 2H6BA 4YG2F 3BR0A 2NVQJ 3H35A 3WU0A 3RQIA 3V8LA 1ZR2A 2XV4S 1S7AA 1JGSA 3RSNA 1XPXA 2Z33A 2K3FA 3OYJA 4ASNA 5FLXK 1WH5A 1U9NA 1JJ6C 1XGOA 3KLNA 3RKQA 3FISA 3WTVC 1RI7A 4L0ZB 2X0LA 2DFIA 4HBLA 3W2AA 4D7MA 1LDKB 3SZTA 3KEYA 3KP5A 2KT0A 4MGRA 3OYIA 2K4JA 4CYCB 2DO7A 3BDDA 1VQNI 2A3SA 4KFCA 3JRGA 1RNLA 1MD0A 5EF6A 2XPWA 1S9HA 1WWXA 3NARA 3BPVA 1IN8A 4F3QA 3OS1A 4OAZA 4XLPF 1XGNA 1OYYA 2F6CA 2XAQA 3A01B 3WTWC 1RRJA 5FD5A 3GTLJ 2RQPA 4BQQA 2LP0A 3PSIA 5FROA 1GUUA 1IN4A 2HQNA 2VPRA 3CO7C 4IOCF 2QBYA 2QZ8A 5HDKA 4N9HA 3BWGA 2PMZN 3LFKA 4MFEA 4OU0A 3JAMK 2B0LA 2W25A 3LQRA 3K9TA 3DTEA 5JI6A 4HDUA 5F1RA 2LOOA 2DT5A 2ZXHA 4S04A 3GFMA 1ZN2A 2LC2A 1KGSA 3K4KA 3R60A 5CVJA 1AKHA 1X3UA 1J09A 4BDZA 4A12A 1BIAA 4K2EA 4FCYA 2KRCA 4OWRB 2DOAA 2O61A 4BQNA 4LB5A 5DV5A 1JI8A 2HXIA 3MKLA 3ZN0A 3G3ZA 3ZQCA 4QLCU 2DK8A 3BY6A 1HKQA 3M1EA 2GXBA 1GV5A 4HAMA 3CUQB 2HS5A 2Q8KA 3MFKA 1Y1VJ 3AG3H 1ODDA 3K4BA 3QYEA 4XKWA 4BACA 5CLSA 2ZCWA 3CTAA 1U5TB 1E3PA 3V7CA 1H8AC 1ETOA 2IGNA 4G94A 5IOYA 1XDUA 2FU4A 5E1XA 3S1NJ 1R1UA 2LG4A 5J4YA 2WA0A 2L4AA 3HBLA 5EZHA 2EV5A 3L2WA 1P9QC 3E97A 1SD7A 3F9KA 3V8JA 3BG9A 1X1BA 1B8IB 1FPQA 2X85A 4C3HJ 5HLTA 3BPXA 3LAJA 3ML6A 4CA0A 2VT2A 1A5JA 1OCZH 3K1MA 1YJWI 1Z7UA 1MH3A 4A3CJ 2DLLA 3H0GJ 2JZYA 4IHVA 3J80K 1SFXA 1N25A 4XN0A 4MFDA 4JQFA 1V3FA 1FTTA 3CCRI 2LY2A 2M8GX 3ZP5A 2OZ6A 4E6KG 3GZ5A 2M4KA 3ELKA 3K69A 5ERIA 2P6SA 3DV8A 1C0WA 3G73A 3EUAA 4RS8A 2IA1A 1XGMA 4HV5A 5TISC 3WGHA 3CCQI 1LEAA 2QSFX 3KP2A 4P1WA 3U2RA 4EM0B 2V1UA 1SVOA 3QOEA 3LSTA 2M87A 3PL8A 1MBHA 2RKHA 4NQWB 3FXKA 5LLQA 1ZLKA 2VBXA 1HW2A 4KT6A 2ZJQF 2FJ1A 3M1CA 2BY0A 3CP8A 2D45A 2BXZA 5A2QK 4IHXA 1NTCA 4UVCA 1MMSA 4YIFA 5AIQA 4WK8F 3GTOJ 2ESHA 1Z67A 3L7WA 3KP6A 4BE0A 3I55I 3DCFA 1XN7A 1ZREA 5BMZA 2I10A 1STZA 1Z05A 3H5NA 3F23A 1WH7A 1IC8A 3ZPLA 2R93J 2ISYA 3QPLA 3LSJA 1X1PA 3O6BB 3L2UA 4JP0A 5F64A 2ZFWA 4L9VA 4AD9A 5KK1A 3CMYA 4HNTA 1I1SA 2ZB9A 4ENMA 5GADJ 3SEZA 2DOFA 3MVPA 2XHKA 3CF2A 3N4MA 1U9OA 2EZLA 2JVHA 1HW5A 1QGPA 1YRNB 2MA3A 2JQ7A 2HI3A 1MNMC 4XOPA 3LAPA 2ME6A 2PEXA 3ZQIA 2F48A 2A5WA 4IHWA 2VASA 2LY1A 2KRFA 3GMEA 2CW0F 2M0MA 2IBDA 2OU2A 2EBIA 4I0BA 2DK5A 2OD5A 2LKSA 2LH9A 3LA3A 3K70D 5E17F 1AHDP 3TO6A 4A5NA 4CCLA 2R7RA 1XMXA 5GPAA 3IKVA 5AIPA 3QWLA 2VN2A 2STWA 5F27A 1TC3C 1J5YA 3DTKA 4BJ5C 5FKOA 3ZQFA 3OYDA 2B7EA 4RB3C 4GGGA 1MMAA 3QU3A 5C3EJ 1WKMA 5GAEJ 1YW8A 2VXDA 4WWCA 3PUFA 4B8XA 2HEOA 1SFEA 2X6XA 4QSHA 5HLIA 3JR9A 1QRYA 1A36A 4IHYA 2MD5A 3JW4A 2FBKA 3SFIA 3CMMA 4CCMA 2XSDC 3JCUC 5JVTA 1MNDA 2L9RA 5EG0B 1F43A 1MKMA 2E7WA 3BG3A 3T0YA 2CV1A 1LE8B 2PI0A 2EINH 1T39A 2JRMA 2V7FA 2FE3A 1FC3A 3JRIA 3SZPA
chains in the Genus database with same CATH topology
1TTYA 1XCVA 5HLHA 3TO7A 1Z6RA 4WXCA 3WGIA 1P4WA 3ECHA 2V1DA 1MGTA 3GYHX 2C6YA 2Q2EA 1B9MA 4IVNA 1IRGA 1ON1A 3C1DA 1IXCA 2EV6A 3ISPA 1B1BA 4FT8A 1LB2A 4R79A 5D4SA 2H6CA 3I59B 5LRRA 4MEXF 2LF7A 2A5YB 2W84A 5D6EA 5LRSA 1QZZA 2EV0A 1O57A 1LEBA 3MZYA 2KIUA 3EUHA 3ABUA 4BH9A 1JHFA 1IZ1A 4L0YB 3KEOA 4UV9A 3MWMA 4FX4A 1T6SA 3K1NA 1U3EM 5LGTA 2KJBA 1SD4A 1QQIA 1FWZA 3CO6C 3QP5A 1U8RA 1J7KA 1F5TA 1HBXG 3KLOA 4GYGA 2D2WA 1DPUA 3ZMSA 2A07F 3BROA 3FXQA 1NHAA 3GXOA 3GFJA 4EJTA 3KEQA 3MAJA 2R7DA 5HS8A 3RTRA 3E3VA 3L9FA 1H0MA 1IF1A 1D8JA 1BJAA 2YX4A 4KN7X 3V7RA 3M9AA 4HW0A 4KMFA 4Q4ZF 1G3SA 1HQCA 3FM5A 5CVUA 2PLYA 2LDUA 3VB2A 3RPQA 2RC4A 2IVMA 5J6XA 2K27A 2M8EA 2Z5UA 2Y0MA 1J2XA 2MH2A 4PCQA 3WTTC 4H0EA 4GYIA 4D0PA 1E2XA 1T2KA 3E5XA 3L09A 1EH8A 1ZG5A 3SHFA 1B9NA 1EH7A 3HOTA 1G3YA 4A0ZA 5H20A 3GF2A 3GVAA 2NNYA 1B59A 4OMYA 2HWVA 3KCCA 1GXPA 2QLZA 1IUYA 4WX9A 5CJ9A 1W5TA 3CJNA 3J7AO 3TKYA 1BM9A 3ZQ7A 2H94A 1FOKA 4EJOA 4EM2A 5DEQA 4MNUA 1HW1A 2Z99A 3BP8A 1BOAA 1HSTA 2HTSA 2OQRA 4IRHA 4EGZA 1F9NA 3IWZA 1XSVA 2VE9A 2W57A 1J0RA 1W4MA 2XIGA 5E20A 1HKSA 2HTJA 5E1WA 4Q47A 2EFPA 3HRMA 2BYVE 5E8GA 3FMRA 4AWXB 3DP7A 4HF0A 5K5QA 4A0YA 2FBHA 4A0XA 5BOXA 1FNNA 2WV0A 4KIFA 1Z9CA 4U0VA 4P5OA 2M5WA 4BYYA 2ISZA 3IWFA 1REPC 3U1DA 5DUKA 2VBZA 5HDNA 2HKOA 1OMIA 3B73A 4RGRA 4CHUA 4NHJA 4ENNA 1P4AA 2HZTA 3ECOA 3V8KA 3K2ZA 2NAZA 2HGCA 2RNJA 3F22A 4LG0B 2KKOA 5DD4A 1D3YA 4BHCA 2DQLA 1T98A 1YYVA 2HYFA 4I0AA 4ON0A 5HOOA 3F8BA 2ACJA 4DQ2A 1QZYA 1K78B 3EETA 3GZ6A 1MDMA 3R6SA 2H09A 3I5UA 1DDNA 1OYWA 2IW5A 3WTUC 4AIJA 2YPRA 2ZKZA 3I58A 5ILVA 1B4AA 3ZMUA 3R0JA 1G3TA 3DFGA 2E1CA 3T8RA 1RZ4A 2O6GE 3OV8A 1ZRDA 3TDZC 1YS6A 1FBSA 3ABTA 1ON2A 4A6DA 2D1HA 4B09A 2DQRA 1KU3A 2TDXA 2HDCA 1QO0D 2MLKA 1YIOA 2ZXJA 1U5TA 3IC7A 2MBFA 4LD5A 3TOBA 1ZRCA 1KQ8A 1AWCA 5LEJA 2F5CA 4P9UA 4G8XA 3QP6A 4RGSA 3F6VA 2HR3A 2EFQA 3QRFF 2VOOA 3HRTA 4L5JA 2O03A 4L9JA 1MZBA 5LGUA 3WE2A 1YW7A 1CF7A 1TQMA 3KETA 1W7PB 1TW3A 2IRFG 5DCMB 5BQTA 4LLNA 4HLXA 1R5HA 4I98B 2X4HA 5LHGA 2ZNZA 2J5OA 4G6DA 1IN6A 3P9IA 1ONVA 4LK1F 1XMKA 5ICGA 1E17A 3NRVA 1FP2A 1KA8A 3VFZA 2NYXA 4OIQF 3ZN1A 2KJCA 3HSFA 3OOPA 3FM3A 3LWFA 3ZMTA 2F5EA 3GUDA 1D5VA 1TNSA 3D0SA 2VONA 1MJAA 1RUNA 5IT3A 3S2WA 3ZMZA 5CYVA 4IXAA 1TQIA 3GO5A 2CWEA 1JE8A 1HSJA 4HV6A 4KYWA 3EQLF 1R7JA 1FT9A 1SAXA 2IA2A 2QBYB 2A61A 4LGWA 1QNTA 5J8CA 3QOPA 3HHHA 1TNTA 3IRRA 3F8MA 4M74A 1XDSA 1FP1D 5K5RA 2FSWA 4MTDA 3FXUA 1TQPA 2R7FA 4KUMA 1R36A 3KZYA 4OOIA 2EFOA 5CVIA 4UVAA 3JAMZ 4HX8A 2CFXA 4KT5C 1T0FA 1UB9A 1KYWA 4KIGA 2EWNA 3TOAA 1DPRA 2P5VA 2UXNA 3HTSB 2VC0A 2STTA 2XKPA 4DNCA 3RIRA 5D4RA 1YG2A 4O6JA 3HSRA 1B6AA 4OMZA 2CQKA 3DXJF 2UZKA 2OBPA 2CSOA 3KZZA 3MEXA 5HS7A 1P92A 5ICCA 1RUOA 1J59A 1I27A 1HXDA 1XSDA 2O8XA 2XAHA 4EVIA 1Q1HA 4WXHA 3NEUA 3W6JB 4UHTA 5LBQA 1FSEA 5LEKA 2CG4A 3Q5FA 3I64A 1ZG1A 1HKTA 3GEZA 2W24A 1XD7A 3J80Z 3BOQA 5DD8A 1FBUA 2QUFA 2G7UA 4ENJA 3HUGA 1IN5A 5DDGA 5L3DA 1BBYA 2GA1A 2GQQA 1S29A 1UHWA 1L0OC 2XUBA 5IT9Z 4L9TA 4ZYHA 2RV8A 3FMSA 3HOSA 1R1TA 3WTXC 2L02A 1VTNC 1R58A 1KU7A 3BJOA 2XVCA 5A2QZ 1Y0UA 3KFWX 4CGZA 2Y75A 2NS0A 2M30A 2JT1A 2XRNA 1IAWA 1YQAA 1GXQA 1USSA 2D1VA 1R23A 2KIMA 5ICEA 1LDJA 2P5KA 2QENA 3V4GA 1G3WA 4IRGA 3O3KA 4ZYGA 2FMYA 2PBIA 4KN4X 2F5FA 2F5DA 2RN7A 1DUXC 2LSOA 1BI2A 3E5UA 1K79A 3FWEA 2L01A 1P2FA 2IJLA 1YTYA 3I4PA 4PZJA 4RAYA 1F4KA 3HSEA 3SQNA 2ZMEA 4N0BA 4A6EA 1PP7U 1FX7A 1ZLJA 3RYRA 1EV7A 2DBBA 3F3XA 3JTGA 3GFLA 3GW2A 3DPTA 1LNWA 4BQAA 4WF2A 1ZYRF 4GO1A 4BHPA 3I53A 1R22A 1WRJA 3HRSA 5D5VB 2HKXA 3T1BA 4MHGA 1ZG3A 2E1NA 1MJ9A 3RDIA 2IA0A 2QYOA 2HQRA 4CO8A 4YFXF 1TLHB 5FD6A 1FZPB 2XKOA 3RI4A 4KDPA 3GWZA 1W7PD 4XLNF 3C3WA 3MCZA 5ED4A 4EJWA 2ZBKA 4HYEA 4N9IA 2V6CA 4HX7A 2GZWA 5D8KB 4M73A 1U78A 5HLGA 5BPDA 1RIOH 5FGMA 1XCBA 2Z9OA 2DI3A 4MQVA 5HS9A 2Q0OA 4UXNA 3FMQA 4UV8A 1BIBA 4M9ZA 1OKRA 3E6MA 2V79A 1H9GA 3F21A 3DKWA 5LHIA 3IKTA 5HVQC 3RJPA 1S7OA 5ILSA 5LGNA 4U7DA 2K02A 3KP4A 2IP2A 1AOYA 4CYDA 4I01A 5LHHA 1PUEE 3J81Z 3JSOA 3TQNA 5JR3A 1P4XA 2EFNA 4G7HF 2YR2A 5D5WB 2PJPA 4EJUA 5AONA 2NRAC 1JHHA 1U2WA 2FNPA 2EK5A 5L3EA 4KNYA 4EJVA 1LVAA 2GWRA 4I2OA 4PGGA 1I5ZA 2XASA 4U88A 3ZMDA 3QPTA 2P7VB 4OIPF 1R5GA 5H6RA 3E6CC 4MQ9F 1UHMA 3I54A 4S05A 4HA8A 1SD5A 4IF4A 3MZHA 4BNCA 2K4BA 4QWQA 4R8HA 1OPCA 2V1XA 3HHGA 3IL2A 4G7OF 3RPUA 4E70A 3JSPA 2WC2A 5DCMA 4XSXF 1I6XA 5F6FA 4AVPA 3FF5A 4G6QA 1GHCA 1BC8C 1O3TA 2OQGA 5E8IA 2MH9A 4NB5A 2VT3A 5FO5A 3F8CA 2ZNYA 1KU9A 3DF8A 1UCRA 4M6YA 2K7LA 1MJBA 2GIVA 2XAFA 3E5QA 2FQ3A 2YX7A 2FA5A 3CUQA 2YU3A 2AS5F 2GAUA 2OAZA 4ESJA 2QQBA 2ZO4A 4ZYEA 3NQOA 4ENKA 1S3JA 3WTYC 4OIRF 2VXZA 2A6HF 1S6LA 2NNNA 2DW4A 5HDGA 2RVCA 1XMAA 5CVRA 5CVVA 2BEOA 5K1YA 4P55A 2FMLA 3HRUA 4WCGA 3PQKA 4M9XA 5H6QA 3ZMVA 2OA4A 3H3UA 1MDMB 1YO5C 2GA2A 2FXAA 4HQEA 3QPHA 4TV7A 3ULQB 1UFMA 1L3LA 3SFZA 4JBAA 4NQWA 2Y48A 2M45A 1YLFA 2CO5A 3GLXA 5TJJA 3FXRA 4PDKA 3L2CA 4L5IA 3W6KB 3TGNA 2ETHA 1O7LA 1CGPA 1XSXA 4Q48A 4A2UA 3T5XA 1O7FA 3M8FA 1T38A 4P96A 2VOPA 3P7NA 3GFIA 2R3SA 1FSHA 2ZJ2A 4FHTA 3D5LA 5ICFA 1ZGJA 4EMSA 2PQ8A 1TBXA 3R4KA 1S8NA 4BAYA 2COMA 4CZZA 3QAHA 1SMTA 1BI3A 4RAZA 4KMUX 2QQ9A 5FLXZ 1J75A 2HOEA 5D5XB 5DUIA 1CF7B 3R61A 2ELHA 3I71A 2QWWA 4U7BA 3WODF 1ZGAA 4LFUA 4LJZF 5K5OA 1ZRFA 3C18A 2G9WA 2XAJA 5IT9K 3E6DA 4Y13A 1WI9A 2PMUA 3E6BA 2XROA 4GCVA 4XSZF 3RYPA 2WWYA 6PAXA 4EQQA 2OZUA 3REOA 1Z6TA 4UNOA 3P9CA 2M1BA 3KP7A 4RB0A 4LLGF 1F1ZA 4HLYA 2VODA 4R1HA 5J8FA 1KQ9A 3RKYA 1BI1A 3RKXA 2VC1A 1KYZA 3LA7A 1G4DA 1U6GA 2J5PA 4BXUA 4L9NA 4PGHA 5DCFA 3FZVA 1P6RA 1IXRC 2PMHA 5D8LB 2L54A 3Q9VA 4I09A 2MLGA 4I7HA 2JRTA 5KVRA 4OINF 3DQVC 3RKWA 3T8TA 4KA4A 2O3FA 2IT0A 1FLIA 5DYMA 3I59A 4HF2A 1Z91A 2P8TA 2E7XA 4IHTA 4HX4A 1K6OA 5EEHA 2F2EA 2L3DA 3CUOA 4Y17A 3WE3A 2A69F 1LQ1A 4FX0A 4M9SA 1WSUA 3P9KA 1BC7C 1BI0A 3N97A 2BBYA 2EB7A 1SD6A 2CYYA 1ZH5A 4LB6B 4M6XA 2LKPA 1XB4A 2FNAA 1XGSA 2HYGD 1SMYF 3FHZA 4RB2C 5D5UB 2P5LC 2AXLA 1YS7A 3PQJA 1ZHFA 3U9GA 4HF1A 3KP3A 2H27A 3LQQA 2VBWA 2V9VA 3GX4X 2QQAA 2P7CB 5JHUA 3IHUA 4IPAA 4IRIA 1GVJA 3AAFA 4XRFA 4HZFA 4EM1A 1FBQA 3BJ6A 3R0AA 4CDGA 2EA2A 2BGCA 2W85A 3HYIA 3F8FA 4Y15A 3F8NA 4EV0A 1OYIA 2G7HA 3DEUA 2ESNA 2DAOA 4WXDA 5TRDA 4AIHA 3IRQA 4IHSA 1IN7A 3KE2A 1OR7A 2DPUA 2RGVA 5FB2A 2LNBA 4KICA 3DPLC 4O5VA 1WQ2A 4AIKA 3J81K 3WTZA 1IW7F 2O0YA 3QU6A 3BZ6A 2P4WA 4L18B 2JPCA 4YFKF 1H9TA 2CGPA 3VODA 2K86A 3HIFA 4ZZDA 3BJAA 3FX3A 3HTUA 4IJAA 4RGUA 1YW9A 1V4RA 1JXSA 3TO9A 5L3CA 2FEZA 4RGXA 1I1GA 2DPDA 2WTEA 2DU9A 3MQ0A 1R1VA 3ERED 4U0WA 1J9IA 4G7ZF 3F6OA 3M8EA 2FRHA 4Z2YA 4A5MA 1FYMA 4GXOA 4RB1A 3SXYA 1Z1DA 4M72A 3C7JA 2QM3A 1W5SA 5L3BA 4M71A 3K1PA 3VEPA 1ULYA 1FY7A 1ZARA 4ZZLA 2BV6A 1KQ0A 3K0LA 3COAC 3PFIA 2L4MA 1O3RA 4BHBA 2EFWA 2ZMEB 4G9YA 4YIIA 4KIBA 4LMYA 5L3GA 4HQMA 4MEYF 1LDDA 4I02A 3WGGA 5E18F 3TDUC 1KU2A 5L3FA 3EYYA 2RDPA 2QVOA 4LG0A 2UWMA 2XAGA 4MTEA 5BS6A 4CXFA 4UUVA 3WTSC 5ILUA 1DP7P 4ZYDA 4HDVA 1K78A 2A6EF 2MC3A 3I0TA 1EH6A 2P6TA 4JK1X 4O3MA 4LK0F 2EA4A 1ZAOA 2KIFA 3M7GA 2XGXA 2BE5F 2IPQX 2A68F 4F7ZA 1O3SA 2PFBA 3L00A 4ZH4F 2YSRA 1USTA 4CICA 3CLOA 2VE8A 2FBIA 2GXGA 1K7AA 3WG9A 3B02A 4LLLA 2PG4A 1FYLA 5FFXA 3VOEA 1IRFA 4OIOF 1A04A 1YFHA 4ETSA 3LA2A 4HOBA 1PP8F 3Q9SA 1PDNC 4ESBA 2DTRA 5D6FA 4P9FA 5E1ZB 4EGYA 1R00A 2EJRA 2FOKA 2PN6A 2JTVA 2LF8A 1BN5A 1QBJA 1IXSB 3ROUA 1SFUA 4Q5SF 1FYKA 2VBYA 1W7PA 4ESFA 1D8KA 3V7SA 3H92A 3WU1B 4U0YA 2HFHA 2Z3YA 3F72A 5BPIA 3JTHA 1QPMA 5EEGA 5JFRA 1G6NA 4YFNF 2JSCA 2JPBA 5FFZA 2ADUA 3H3ZA 3EYIA 2FF4A 2UXXA 3CUQC 3O2PE 4UVBA 3EDPA 1TW2A 1LJ9A 1O3QA 3CDHA 1U5TC 4XBFA 2H6BA 4YG2F 3WU0A 3V8LA 2XV4S 1S7AA 1JGSA 2Z33A 4ASNA 5FLXK 1XGOA 3KLNA 3WTVC 1RI7A 4L0ZB 2X0LA 2DFIA 4HBLA 1LDKB 3SZTA 3KP5A 4MGRA 2K4JA 2DO7A 3BDDA 2A3SA 4KFCA 1RNLA 1MD0A 1WWXA 3BPVA 1IN8A 4XLPF 1XGNA 1OYYA 2XAQA 3WTWC 5FD5A 2RQPA 1IN4A 2HQNA 3CO7C 2QBYA 2QZ8A 5HDKA 4N9HA 3BWGA 3LFKA 4OU0A 3JAMK 2B0LA 2W25A 3LQRA 3K9TA 5JI6A 4HDUA 5F1RA 2DT5A 4S04A 3GFMA 1ZN2A 3R60A 1KGSA 5CVJA 1X3UA 4A12A 1BIAA 4K2EA 2O61A 4LB5A 5DV5A 3ZN0A 3G3ZA 4QLCU 2DK8A 3BY6A 1HKQA 3M1EA 2GXBA 4HAMA 3CUQB 2HS5A 2Q8KA 3MFKA 1ODDA 5CLSA 2ZCWA 3CTAA 1U5TB 3V7CA 4G94A 1XDUA 2FU4A 5E1XA 1R1UA 2L4AA 2EV5A 3E97A 1SD7A 3V8JA 1FPQA 3BPXA 3LAJA 3ML6A 2VT2A 3K1MA 1Z7UA 2DLLA 2JZYA 3J80K 1SFXA 4JQFA 1V3FA 3ZP5A 2OZ6A 3GZ5A 3ELKA 3K69A 5ERIA 2P6SA 3DV8A 1C0WA 3G73A 4RS8A 2IA1A 1XGMA 4HV5A 3WGHA 1LEAA 3KP2A 3U2RA 4EM0B 2V1UA 3LSTA 2M87A 2RKHA 5LLQA 1ZLKA 2VBXA 1HW2A 2D45A 5A2QK 4UVCA 4YIFA 5AIQA 4WK8F 2ESHA 3L7WA 3KP6A 1XN7A 1ZREA 5BMZA 1STZA 1Z05A 3F23A 3ZPLA 2ISYA 3O6BB 5F64A 2ZFWA 4L9VA 4AD9A 5KK1A 1I1SA 4ENMA 2XHKA 3N4MA 1HW5A 1QGPA 2MA3A 3LAPA 2PEXA 2KRFA 2CW0F 2OU2A 4I0BA 2DK5A 2OD5A 3LA3A 5E17F 3TO6A 4A5NA 3IKVA 5AIPA 2VN2A 2STWA 1J5YA 4RB3C 4GGGA 3QU3A 1WKMA 4WWCA 1YW8A 4B8XA 2HEOA 1SFEA 5HLIA 2MD5A 3JW4A 2FBKA 5JVTA 1MKMA 2E7WA 3T0YA 2PI0A 1T39A 2FE3A 1FC3A 3SZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTY A;  1XCV A;  5HLH A;  3TO7 A;  1Z6R A;  4WXC A;  3WGI A;  1P4W A;  3ECH A;  2V1D A;  1MGT A;  3GYH X;  2C6Y A;  2Q2E A;  1B9M A;  4IVN A;  1IRG A;  1ON1 A;  3C1D A;  1IXC A;  2EV6 A;  3ISP A;  1B1B A;  4FT8 A;  1LB2 A;  4R79 A;  5D4S A;  2H6C A;  3I59 B;  5LRR A;  4MEX F;  2LF7 A;  2A5Y B;  2W84 A;  5D6E A;  5LRS A;  1QZZ A;  2EV0 A;  1O57 A;  1LEB A;  3MZY A;  2KIU A;  3EUH A;  3ABU A;  4BH9 A;  1JHF A;  1IZ1 A;  4L0Y B;  3KEO A;  4UV9 A;  3MWM A;  4FX4 A;  1T6S A;  3K1N A;  1U3E M;  5LGT A;  2KJB A;  1SD4 A;  1QQI A;  1FWZ A;  3CO6 C;  3QP5 A;  1U8R A;  1J7K A;  1F5T A;  1HBX G;  3KLO A;  4GYG A;  2D2W A;  1DPU A;  3ZMS A;  2A07 F;  3BRO A;  3FXQ A;  1NHA A;  3GXO A;  3GFJ A;  4EJT A;  3KEQ A;  3MAJ A;  2R7D A;  5HS8 A;  3RTR A;  3E3V A;  3L9F A;  1H0M A;  1IF1 A;  1D8J A;  1BJA A;  2YX4 A;  4KN7 X;  3V7R A;  3M9A A;  4HW0 A;  4KMF A;  4Q4Z F;  1G3S A;  1HQC A;  3FM5 A;  5CVU A;  2PLY A;  2LDU A;  3VB2 A;  3RPQ A;  2RC4 A;  2IVM A;  5J6X A;  2K27 A;  2M8E A;  2Z5U A;  2Y0M A;  1J2X A;  2MH2 A;  4PCQ A;  3WTT C;  4H0E A;  4GYI A;  4D0P A;  1E2X A;  1T2K A;  3E5X A;  3L09 A;  1EH8 A;  1ZG5 A;  3SHF A;  1B9N A;  1EH7 A;  3HOT A;  1G3Y A;  4A0Z A;  5H20 A;  3GF2 A;  3GVA A;  2NNY A;  1B59 A;  4OMY A;  2HWV A;  3KCC A;  1GXP A;  2QLZ A;  1IUY A;  4WX9 A;  5CJ9 A;  1W5T A;  3CJN A;  3J7A O;  3TKY A;  1BM9 A;  3ZQ7 A;  2H94 A;  1FOK A;  4EJO A;  4EM2 A;  5DEQ A;  4MNU A;  1HW1 A;  2Z99 A;  3BP8 A;  1BOA A;  1HST A;  2HTS A;  2OQR A;  4IRH A;  4EGZ A;  1F9N A;  3IWZ A;  1XSV A;  2VE9 A;  2W57 A;  1J0R A;  1W4M A;  2XIG A;  5E20 A;  1HKS A;  2HTJ A;  5E1W A;  4Q47 A;  2EFP A;  3HRM A;  2BYV E;  5E8G A;  3FMR A;  4AWX B;  3DP7 A;  4HF0 A;  5K5Q A;  4A0Y A;  2FBH A;  4A0X A;  5BOX A;  1FNN A;  2WV0 A;  4KIF A;  1Z9C A;  4U0V A;  4P5O A;  2M5W A;  4BYY A;  2ISZ A;  3IWF A;  1REP C;  3U1D A;  5DUK A;  2VBZ A;  5HDN A;  2HKO A;  1OMI A;  3B73 A;  4RGR A;  4CHU A;  4NHJ A;  4ENN A;  1P4A A;  2HZT A;  3ECO A;  3V8K A;  3K2Z A;  2NAZ A;  2HGC A;  2RNJ A;  3F22 A;  4LG0 B;  2KKO A;  5DD4 A;  1D3Y A;  4BHC A;  2DQL A;  1T98 A;  1YYV A;  2HYF A;  4I0A A;  4ON0 A;  5HOO A;  3F8B A;  2ACJ A;  4DQ2 A;  1QZY A;  1K78 B;  3EET A;  3GZ6 A;  1MDM A;  3R6S A;  2H09 A;  3I5U A;  1DDN A;  1OYW A;  2IW5 A;  3WTU C;  4AIJ A;  2YPR A;  2ZKZ A;  3I58 A;  5ILV A;  1B4A A;  3ZMU A;  3R0J A;  1G3T A;  3DFG A;  2E1C A;  3T8R A;  1RZ4 A;  2O6G E;  3OV8 A;  1ZRD A;  3TDZ C;  1YS6 A;  1FBS A;  3ABT A;  1ON2 A;  4A6D A;  2D1H A;  4B09 A;  2DQR A;  1KU3 A;  2TDX A;  2HDC A;  1QO0 D;  2MLK A;  1YIO A;  2ZXJ A;  1U5T A;  3IC7 A;  2MBF A;  4LD5 A;  3TOB A;  1ZRC A;  1KQ8 A;  1AWC A;  5LEJ A;  2F5C A;  4P9U A;  4G8X A;  3QP6 A;  4RGS A;  3F6V A;  2HR3 A;  2EFQ A;  3QRF F;  2VOO A;  3HRT A;  4L5J A;  2O03 A;  4L9J A;  1MZB A;  5LGU A;  3WE2 A;  1YW7 A;  1CF7 A;  1TQM A;  3KET A;  1W7P B;  1TW3 A;  2IRF G;  5DCM B;  5BQT A;  4LLN A;  4HLX A;  1R5H A;  4I98 B;  2X4H A;  5LHG A;  2ZNZ A;  2J5O A;  4G6D A;  1IN6 A;  3P9I A;  1ONV A;  4LK1 F;  1XMK A;  5ICG A;  1E17 A;  3NRV A;  1FP2 A;  1KA8 A;  3VFZ A;  2NYX A;  4OIQ F;  3ZN1 A;  2KJC A;  3HSF A;  3OOP A;  3FM3 A;  3LWF A;  3ZMT A;  2F5E A;  3GUD A;  1D5V A;  1TNS A;  3D0S A;  2VON A;  1MJA A;  1RUN A;  5IT3 A;  3S2W A;  3ZMZ A;  5CYV A;  4IXA A;  1TQI A;  3GO5 A;  2CWE A;  1JE8 A;  1HSJ A;  4HV6 A;  4KYW A;  3EQL F;  1R7J A;  1FT9 A;  1SAX A;  2IA2 A;  2QBY B;  2A61 A;  4LGW A;  1QNT A;  5J8C A;  3QOP A;  3HHH A;  1TNT A;  3IRR A;  3F8M A;  4M74 A;  1XDS A;  1FP1 D;  5K5R A;  2FSW A;  4MTD A;  3FXU A;  1TQP A;  2R7F A;  4KUM A;  1R36 A;  3KZY A;  4OOI A;  2EFO A;  5CVI A;  4UVA A;  3JAM Z;  4HX8 A;  2CFX A;  4KT5 C;  1T0F A;  1UB9 A;  1KYW A;  4KIG A;  2EWN A;  3TOA A;  1DPR A;  2P5V A;  2UXN A;  3HTS B;  2VC0 A;  2STT A;  2XKP A;  4DNC A;  3RIR A;  5D4R A;  1YG2 A;  4O6J A;  3HSR A;  1B6A A;  4OMZ A;  2CQK A;  3DXJ F;  2UZK A;  2OBP A;  2CSO A;  3KZZ A;  3MEX A;  5HS7 A;  1P92 A;  5ICC A;  1RUO A;  1J59 A;  1I27 A;  1HXD A;  1XSD A;  2O8X A;  2XAH A;  4EVI A;  1Q1H A;  4WXH A;  3NEU A;  3W6J B;  4UHT A;  5LBQ A;  1FSE A;  5LEK A;  2CG4 A;  3Q5F A;  3I64 A;  1ZG1 A;  1HKT A;  3GEZ A;  2W24 A;  1XD7 A;  3J80 Z;  3BOQ A;  5DD8 A;  1FBU A;  2QUF A;  2G7U A;  4ENJ A;  3HUG A;  1IN5 A;  5DDG A;  5L3D A;  1BBY A;  2GA1 A;  2GQQ A;  1S29 A;  1UHW A;  1L0O C;  2XUB A;  5IT9 Z;  4L9T A;  4ZYH A;  2RV8 A;  3FMS A;  3HOS A;  1R1T A;  3WTX C;  2L02 A;  1VTN C;  1R58 A;  1KU7 A;  3BJO A;  2XVC A;  5A2Q Z;  1Y0U A;  3KFW X;  4CGZ A;  2Y75 A;  2NS0 A;  2M30 A;  2JT1 A;  2XRN A;  1IAW A;  1YQA A;  1GXQ A;  1USS A;  2D1V A;  1R23 A;  2KIM A;  5ICE A;  1LDJ A;  2P5K A;  2QEN A;  3V4G A;  1G3W A;  4IRG A;  3O3K A;  4ZYG A;  2FMY A;  2PBI A;  4KN4 X;  2F5F A;  2F5D A;  2RN7 A;  1DUX C;  2LSO A;  1BI2 A;  3E5U A;  1K79 A;  3FWE A;  2L01 A;  1P2F A;  2IJL A;  1YTY A;  3I4P A;  4PZJ A;  4RAY A;  1F4K A;  3HSE A;  3SQN A;  2ZME A;  4N0B A;  4A6E A;  1PP7 U;  1FX7 A;  1ZLJ A;  3RYR A;  1EV7 A;  2DBB A;  3F3X A;  3JTG A;  3GFL A;  3GW2 A;  3DPT A;  1LNW A;  4BQA A;  4WF2 A;  1ZYR F;  4GO1 A;  4BHP A;  3I53 A;  1R22 A;  1WRJ A;  3HRS A;  5D5V B;  2HKX A;  3T1B A;  4MHG A;  1ZG3 A;  2E1N A;  1MJ9 A;  3RDI A;  2IA0 A;  2QYO A;  2HQR A;  4CO8 A;  4YFX F;  1TLH B;  5FD6 A;  1FZP B;  2XKO A;  3RI4 A;  4KDP A;  3GWZ A;  1W7P D;  4XLN F;  3C3W A;  3MCZ A;  5ED4 A;  4EJW A;  2ZBK A;  4HYE A;  4N9I A;  2V6C A;  4HX7 A;  2GZW A;  5D8K B;  4M73 A;  1U78 A;  5HLG A;  5BPD A;  1RIO H;  5FGM A;  1XCB A;  2Z9O A;  2DI3 A;  4MQV A;  5HS9 A;  2Q0O A;  4UXN A;  3FMQ A;  4UV8 A;  1BIB A;  4M9Z A;  1OKR A;  3E6M A;  2V79 A;  1H9G A;  3F21 A;  3DKW A;  5LHI A;  3IKT A;  5HVQ C;  3RJP A;  1S7O A;  5ILS A;  5LGN A;  4U7D A;  2K02 A;  3KP4 A;  2IP2 A;  1AOY A;  4CYD A;  4I01 A;  5LHH A;  1PUE E;  3J81 Z;  3JSO A;  3TQN A;  5JR3 A;  1P4X A;  2EFN A;  4G7H F;  2YR2 A;  5D5W B;  2PJP A;  4EJU A;  5AON A;  2NRA C;  1JHH A;  1U2W A;  2FNP A;  2EK5 A;  5L3E A;  4KNY A;  4EJV A;  1LVA A;  2GWR A;  4I2O A;  4PGG A;  1I5Z A;  2XAS A;  4U88 A;  3ZMD A;  3QPT A;  2P7V B;  4OIP F;  1R5G A;  5H6R A;  3E6C C;  4MQ9 F;  1UHM A;  3I54 A;  4S05 A;  4HA8 A;  1SD5 A;  4IF4 A;  3MZH A;  4BNC A;  2K4B A;  4QWQ A;  4R8H A;  1OPC A;  2V1X A;  3HHG A;  3IL2 A;  4G7O F;  3RPU A;  4E70 A;  3JSP A;  2WC2 A;  5DCM A;  4XSX F;  1I6X A;  5F6F A;  4AVP A;  3FF5 A;  4G6Q A;  1GHC A;  1BC8 C;  1O3T A;  2OQG A;  5E8I A;  2MH9 A;  4NB5 A;  2VT3 A;  5FO5 A;  3F8C A;  2ZNY A;  1KU9 A;  3DF8 A;  1UCR A;  4M6Y A;  2K7L A;  1MJB A;  2GIV A;  2XAF A;  3E5Q A;  2FQ3 A;  2YX7 A;  2FA5 A;  3CUQ A;  2YU3 A;  2AS5 F;  2GAU A;  2OAZ A;  4ESJ A;  2QQB A;  2ZO4 A;  4ZYE A;  3NQO A;  4ENK A;  1S3J A;  3WTY C;  4OIR F;  2VXZ A;  2A6H F;  1S6L A;  2NNN A;  2DW4 A;  5HDG A;  2RVC A;  1XMA A;  5CVR A;  5CVV A;  2BEO A;  5K1Y A;  4P55 A;  2FML A;  3HRU A;  4WCG A;  3PQK A;  4M9X A;  5H6Q A;  3ZMV A;  2OA4 A;  3H3U A;  1MDM B;  1YO5 C;  2GA2 A;  2FXA A;  4HQE A;  3QPH A;  4TV7 A;  3ULQ B;  1UFM A;  1L3L A;  3SFZ A;  4JBA A;  4NQW A;  2Y48 A;  2M45 A;  1YLF A;  2CO5 A;  3GLX A;  5TJJ A;  3FXR A;  4PDK A;  3L2C A;  4L5I A;  3W6K B;  3TGN A;  2ETH A;  1O7L A;  1CGP A;  1XSX A;  4Q48 A;  4A2U A;  3T5X A;  1O7F A;  3M8F A;  1T38 A;  4P96 A;  2VOP A;  3P7N A;  3GFI A;  2R3S A;  1FSH A;  2ZJ2 A;  4FHT A;  3D5L A;  5ICF A;  1ZGJ A;  4EMS A;  2PQ8 A;  1TBX A;  3R4K A;  1S8N A;  4BAY A;  2COM A;  4CZZ A;  3QAH A;  1SMT A;  1BI3 A;  4RAZ A;  4KMU X;  2QQ9 A;  5FLX Z;  1J75 A;  2HOE A;  5D5X B;  5DUI A;  1CF7 B;  3R61 A;  2ELH A;  3I71 A;  2QWW A;  4U7B A;  3WOD F;  1ZGA A;  4LFU A;  4LJZ F;  5K5O A;  1ZRF A;  3C18 A;  2G9W A;  2XAJ A;  5IT9 K;  3E6D A;  4Y13 A;  1WI9 A;  2PMU A;  3E6B A;  2XRO A;  4GCV A;  4XSZ F;  3RYP A;  2WWY A;  6PAX A;  4EQQ A;  2OZU A;  3REO A;  1Z6T A;  4UNO A;  3P9C A;  2M1B A;  3KP7 A;  4RB0 A;  4LLG F;  1F1Z A;  4HLY A;  2VOD A;  4R1H A;  5J8F A;  1KQ9 A;  3RKY A;  1BI1 A;  3RKX A;  2VC1 A;  1KYZ A;  3LA7 A;  1G4D A;  1U6G A;  2J5P A;  4BXU A;  4L9N A;  4PGH A;  5DCF A;  3FZV A;  1P6R A;  1IXR C;  2PMH A;  5D8L B;  2L54 A;  3Q9V A;  4I09 A;  2MLG A;  4I7H A;  2JRT A;  5KVR A;  4OIN F;  3DQV C;  3RKW A;  3T8T A;  4KA4 A;  2O3F A;  2IT0 A;  1FLI A;  5DYM A;  3I59 A;  4HF2 A;  1Z91 A;  2P8T A;  2E7X A;  4IHT A;  4HX4 A;  1K6O A;  5EEH A;  2F2E A;  2L3D A;  3CUO A;  4Y17 A;  3WE3 A;  2A69 F;  1LQ1 A;  4FX0 A;  4M9S A;  1WSU A;  3P9K A;  1BC7 C;  1BI0 A;  3N97 A;  2BBY A;  2EB7 A;  1SD6 A;  2CYY A;  1ZH5 A;  4LB6 B;  4M6X A;  2LKP A;  1XB4 A;  2FNA A;  1XGS A;  2HYG D;  1SMY F;  3FHZ A;  4RB2 C;  5D5U B;  2P5L C;  2AXL A;  1YS7 A;  3PQJ A;  1ZHF A;  3U9G A;  4HF1 A;  3KP3 A;  2H27 A;  3LQQ A;  2VBW A;  2V9V A;  3GX4 X;  2QQA A;  2P7C B;  5JHU A;  3IHU A;  4IPA A;  4IRI A;  1GVJ A;  3AAF A;  4XRF A;  4HZF A;  4EM1 A;  1FBQ A;  3BJ6 A;  3R0A A;  4CDG A;  2EA2 A;  2BGC A;  2W85 A;  3HYI A;  3F8F A;  4Y15 A;  3F8N A;  4EV0 A;  1OYI A;  2G7H A;  3DEU A;  2ESN A;  2DAO A;  4WXD A;  5TRD A;  4AIH A;  3IRQ A;  4IHS A;  1IN7 A;  3KE2 A;  1OR7 A;  2DPU A;  2RGV A;  5FB2 A;  2LNB A;  4KIC A;  3DPL C;  4O5V A;  1WQ2 A;  4AIK A;  3J81 K;  3WTZ A;  1IW7 F;  2O0Y A;  3QU6 A;  3BZ6 A;  2P4W A;  4L18 B;  2JPC A;  4YFK F;  1H9T A;  2CGP A;  3VOD A;  2K86 A;  3HIF A;  4ZZD A;  3BJA A;  3FX3 A;  3HTU A;  4IJA A;  4RGU A;  1YW9 A;  1V4R A;  1JXS A;  3TO9 A;  5L3C A;  2FEZ A;  4RGX A;  1I1G A;  2DPD A;  2WTE A;  2DU9 A;  3MQ0 A;  1R1V A;  3ERE D;  4U0W A;  1J9I A;  4G7Z F;  3F6O A;  3M8E A;  2FRH A;  4Z2Y A;  4A5M A;  1FYM A;  4GXO A;  4RB1 A;  3SXY A;  1Z1D A;  4M72 A;  3C7J A;  2QM3 A;  1W5S A;  5L3B A;  4M71 A;  3K1P A;  3VEP A;  1ULY A;  1FY7 A;  1ZAR A;  4ZZL A;  2BV6 A;  1KQ0 A;  3K0L A;  3COA C;  3PFI A;  2L4M A;  1O3R A;  4BHB A;  2EFW A;  2ZME B;  4G9Y A;  4YII A;  4KIB A;  4LMY A;  5L3G A;  4HQM A;  4MEY F;  1LDD A;  4I02 A;  3WGG A;  5E18 F;  3TDU C;  1KU2 A;  5L3F A;  3EYY A;  2RDP A;  2QVO A;  4LG0 A;  2UWM A;  2XAG A;  4MTE A;  5BS6 A;  4CXF A;  4UUV A;  3WTS C;  5ILU A;  1DP7 P;  4ZYD A;  4HDV A;  1K78 A;  2A6E F;  2MC3 A;  3I0T A;  1EH6 A;  2P6T A;  4JK1 X;  4O3M A;  4LK0 F;  2EA4 A;  1ZAO A;  2KIF A;  3M7G A;  2XGX A;  2BE5 F;  2IPQ X;  2A68 F;  4F7Z A;  1O3S A;  2PFB A;  3L00 A;  4ZH4 F;  2YSR A;  1UST A;  4CIC A;  3CLO A;  2VE8 A;  2FBI A;  2GXG A;  1K7A A;  3WG9 A;  3B02 A;  4LLL A;  2PG4 A;  1FYL A;  5FFX A;  3VOE A;  1IRF A;  4OIO F;  1A04 A;  1YFH A;  4ETS A;  3LA2 A;  4HOB A;  1PP8 F;  3Q9S A;  1PDN C;  4ESB A;  2DTR A;  5D6F A;  4P9F A;  5E1Z B;  4EGY A;  1R00 A;  2EJR A;  2FOK A;  2PN6 A;  2JTV A;  2LF8 A;  1BN5 A;  1QBJ A;  1IXS B;  3ROU A;  1SFU A;  4Q5S F;  1FYK A;  2VBY A;  1W7P A;  4ESF A;  1D8K A;  3V7S A;  3H92 A;  3WU1 B;  4U0Y A;  2HFH A;  2Z3Y A;  3F72 A;  5BPI A;  3JTH A;  1QPM A;  5EEG A;  5JFR A;  1G6N A;  4YFN F;  2JSC A;  2JPB A;  5FFZ A;  2ADU A;  3H3Z A;  3EYI A;  2FF4 A;  2UXX A;  3CUQ C;  3O2P E;  4UVB A;  3EDP A;  1TW2 A;  1LJ9 A;  1O3Q A;  3CDH A;  1U5T C;  4XBF A;  2H6B A;  4YG2 F;  3WU0 A;  3V8L A;  2XV4 S;  1S7A A;  1JGS A;  2Z33 A;  4ASN A;  5FLX K;  1XGO A;  3KLN A;  3WTV C;  1RI7 A;  4L0Z B;  2X0L A;  2DFI A;  4HBL A;  1LDK B;  3SZT A;  3KP5 A;  4MGR A;  2K4J A;  2DO7 A;  3BDD A;  2A3S A;  4KFC A;  1RNL A;  1MD0 A;  1WWX A;  3BPV A;  1IN8 A;  4XLP F;  1XGN A;  1OYY A;  2XAQ A;  3WTW C;  5FD5 A;  2RQP A;  1IN4 A;  2HQN A;  3CO7 C;  2QBY A;  2QZ8 A;  5HDK A;  4N9H A;  3BWG A;  3LFK A;  4OU0 A;  3JAM K;  2B0L A;  2W25 A;  3LQR A;  3K9T A;  5JI6 A;  4HDU A;  5F1R A;  2DT5 A;  4S04 A;  3GFM A;  1ZN2 A;  3R60 A;  1KGS A;  5CVJ A;  1X3U A;  4A12 A;  1BIA A;  4K2E A;  2O61 A;  4LB5 A;  5DV5 A;  3ZN0 A;  3G3Z A;  4QLC U;  2DK8 A;  3BY6 A;  1HKQ A;  3M1E A;  2GXB A;  4HAM A;  3CUQ B;  2HS5 A;  2Q8K A;  3MFK A;  1ODD A;  5CLS A;  2ZCW A;  3CTA A;  1U5T B;  3V7C A;  4G94 A;  1XDU A;  2FU4 A;  5E1X A;  1R1U A;  2L4A A;  2EV5 A;  3E97 A;  1SD7 A;  3V8J A;  1FPQ A;  3BPX A;  3LAJ A;  3ML6 A;  2VT2 A;  3K1M A;  1Z7U A;  2DLL A;  2JZY A;  3J80 K;  1SFX A;  4JQF A;  1V3F A;  3ZP5 A;  2OZ6 A;  3GZ5 A;  3ELK A;  3K69 A;  5ERI A;  2P6S A;  3DV8 A;  1C0W A;  3G73 A;  4RS8 A;  2IA1 A;  1XGM A;  4HV5 A;  3WGH A;  1LEA A;  3KP2 A;  3U2R A;  4EM0 B;  2V1U A;  3LST A;  2M87 A;  2RKH A;  5LLQ A;  1ZLK A;  2VBX A;  1HW2 A;  2D45 A;  5A2Q K;  4UVC A;  4YIF A;  5AIQ A;  4WK8 F;  2ESH A;  3L7W A;  3KP6 A;  1XN7 A;  1ZRE A;  5BMZ A;  1STZ A;  1Z05 A;  3F23 A;  3ZPL A;  2ISY A;  3O6B B;  5F64 A;  2ZFW A;  4L9V A;  4AD9 A;  5KK1 A;  1I1S A;  4ENM A;  2XHK A;  3N4M A;  1HW5 A;  1QGP A;  2MA3 A;  3LAP A;  2PEX A;  2KRF A;  2CW0 F;  2OU2 A;  4I0B A;  2DK5 A;  2OD5 A;  3LA3 A;  5E17 F;  3TO6 A;  4A5N A;  3IKV A;  5AIP A;  2VN2 A;  2STW A;  1J5Y A;  4RB3 C;  4GGG A;  3QU3 A;  1WKM A;  4WWC A;  1YW8 A;  4B8X A;  2HEO A;  1SFE A;  5HLI A;  2MD5 A;  3JW4 A;  2FBK A;  5JVT A;  1MKM A;  2E7W A;  3T0Y A;  2PI0 A;  1T39 A;  2FE3 A;  1FC3 A;  3SZP A; 
#chains in the Genus database with same CATH topology
 2R7V A;  1TTY A;  1XCV A;  5HLH A;  3TO7 A;  1Z6R A;  2DOD A;  3LSM A;  5EYR A;  4WXC A;  4HRI A;  1YX3 A;  3RZO J;  1X58 A;  2DJI A;  1F36 A;  2CUZ A;  3WGI A;  1P4W A;  1R6R A;  3ECH A;  2V1D A;  3B6A A;  1MGT A;  2JA6 J;  2VLA A;  3GYH X;  2C6Y A;  4M3G A;  2Q2E A;  1B9M A;  3HKZ N;  1D0X A;  2IEK A;  2LLK A;  4IVN A;  4BKX A;  4BY1 J;  1IRG A;  1ON1 A;  5DS9 A;  3HB9 A;  3C1D A;  1ENH A;  1IXC A;  1X19 A;  2EV6 A;  2ZSI B;  3O8H A;  3ISP A;  4FIS A;  4HG2 A;  4Z6Y A;  5GTI C;  3L2R A;  1B1B A;  4FT8 A;  1LB2 A;  3QYF A;  3CCE I;  1VQM I;  3G6E I;  3UKG A;  4R79 A;  5D4S A;  3D5S C;  4DBQ A;  2H6C A;  2JK3 A;  2X6O A;  3S3N A;  2OV7 A;  1VQ8 I;  2X1E A;  3I59 B;  3ZQQ A;  3DBR B;  5EZG A;  3HXL A;  1OQY A;  5LRR A;  2HPI A;  1UG0 A;  5JHF A;  3CD6 I;  2V1N A;  1HA8 A;  4E7I A;  4MEX F;  2LF7 A;  2A5Y B;  2NVU B;  3U21 A;  2W84 A;  5D6E A;  5LRS A;  1QZZ A;  2EV0 A;  2M7A A;  1D1C A;  5J3L A;  1O57 A;  2OUM A;  1LEB A;  3MZY A;  3CF5 F;  2KIU A;  2M9H A;  3EUH A;  3ABU A;  4BH9 A;  1JHF A;  3DPU A;  4PFP A;  1IZ1 A;  1V5E A;  4FQG A;  4L0Y B;  3H36 A;  4IO9 F;  3MN2 A;  3KEO A;  4UV9 A;  3MWM A;  4FX4 A;  1T6S A;  4XRM A;  3K1N A;  1U3E M;  5LGT A;  2KJB A;  1SD4 A;  2Y9Y A;  2ECB A;  2KIS A;  4HEA 2;  1MBJ A;  1QQI A;  1FWZ A;  3CO6 C;  3QP5 A;  2CH0 A;  1U8R A;  4RDU A;  4AYB N;  3ESW B;  1J7K A;  1FTZ A;  4JX4 A;  1F5T A;  1U0J A;  3LSG A;  1HBX G;  2K9M A;  3AKZ A;  1QA6 A;  3KLO A;  4MIM A;  2R7U A;  4GYG A;  5GAG J;  4CCK A;  2D2W A;  1DPU A;  3ZMS A;  2LR8 A;  2A6T A;  3OYA A;  1NG7 A;  2A07 F;  3BRO A;  3FXQ A;  3VPR A;  2HXO A;  2DMP A;  3RCO A;  1WGX A;  2BVL A;  3OYN A;  3BZK A;  1NHA A;  4YRV A;  5CQG A;  4C3I J;  1W36 D;  3GXO A;  3GFJ A;  2NOJ B;  4EJT A;  1EKE A;  2KIQ A;  2ELJ A;  3ONQ A;  3KEQ A;  1JUS A;  1MMN A;  2R7D A;  3MAJ A;  5HS8 A;  3RTR A;  4LOC A;  1ITY A;  2EQR A;  4XN3 A;  2R0Q C;  3X2Q H;  3DEW A;  1UMQ A;  1S72 I;  2P0W A;  1OCO H;  2E34 A;  3E3V A;  3L9F A;  1H0M A;  1RKW A;  2VL8 A;  2F4O B;  1IF1 A;  1D8J A;  1BJA A;  2DDB A;  1Q1V A;  2YX4 A;  3Q0V A;  4KN7 X;  3V7R A;  1QPI A;  3M9A A;  4HW0 A;  3K4N A;  4KMF A;  4Q4Z F;  1G3S A;  1HQC A;  3FM5 A;  5CVU A;  4PJ0 C;  4BE2 A;  2CFO A;  3FIW A;  2PLY A;  2LDU A;  1VFC A;  3VB2 A;  5KNL A;  3RPQ A;  2RC4 A;  2IVM A;  5J6X A;  2K27 A;  2M8E A;  2Z5U A;  1OCR H;  3BG7 A;  2Y0M A;  1J2X A;  2MH2 A;  4PCQ A;  3WTT C;  4H0E A;  2IGK A;  2R7Z J;  4GYI A;  4D0P A;  1E2X A;  1T2K A;  1NK3 P;  2BW3 B;  3E5X A;  2JWT A;  3L09 A;  4NNJ A;  1EH8 A;  1ZG5 A;  3SHF A;  3GTQ J;  3MKW B;  4B48 A;  1B9N A;  2WV1 A;  1FMV A;  4XR6 A;  4V2G A;  1EH7 A;  3HOT A;  1G3Y A;  4IEJ A;  4A0Z A;  1LFU P;  5H20 A;  2X6W A;  2CUJ A;  3GF2 A;  3GVA A;  1UHS A;  4PJM A;  2CQX A;  4E7J A;  2NNY A;  1B59 A;  4G12 A;  1MBG A;  4DBR A;  2XGE A;  1DU6 A;  1SVM A;  5J40 A;  1VQO I;  4OMY A;  2HWV A;  3KCC A;  2L5Q A;  3RQ4 A;  1GXP A;  2UUZ A;  3BQY A;  2QLZ A;  5KAF C;  3S2D J;  4C3J J;  1IUY A;  4WX9 A;  4XLF A;  4Y3O A;  5CJ9 A;  2GIZ A;  1W5T A;  3CJN A;  3J7A O;  3TKY A;  1BM9 A;  3ZQ7 A;  2H94 A;  4XRS A;  4XK4 A;  5FRN A;  1FOK A;  4EJO A;  1TP4 A;  4ZJZ A;  4EM2 A;  2XB0 X;  3OMY A;  1OIS A;  4MNU A;  5DEQ A;  1HW1 A;  2Z99 A;  3BP8 A;  1BOA A;  1HST A;  1E3O C;  2HTS A;  2OQR A;  4IRH A;  2DFF A;  4EGZ A;  1F9N A;  3IWZ A;  2L9N A;  3DLA A;  1XSV A;  3QYB A;  2VE9 A;  1FIA A;  2W57 A;  2YUS A;  1J0R A;  1W4M A;  4DIQ A;  2CQ7 A;  2XIG A;  5E20 A;  1HKS A;  2HTJ A;  5E1W A;  1ERD A;  3CCS I;  4Q47 A;  2LK2 A;  2EFP A;  3HRM A;  1VND A;  3CCU I;  3OY9 A;  2HQA A;  2BYV E;  5E8G A;  3ABK H;  3FMR A;  4AWX B;  5K7H A;  2XAU A;  3DP7 A;  4HF0 A;  5K5Q A;  3ASN H;  4BBR J;  4A0Y A;  1X3Z B;  4DGW B;  1WJE A;  2FBH A;  4PFO A;  4A0X A;  5BOX A;  1FNN A;  5F0F A;  1MW7 A;  2WV0 A;  1NK2 P;  2EIM H;  4W97 A;  4KIF A;  1Z9C A;  4U0V A;  4P5O A;  2M5W A;  2H1L A;  4BUP A;  4BYY A;  1GVD A;  2ISZ A;  3IWF A;  3TBI A;  1REP C;  2K3P A;  3U1D A;  5HOD A;  3K4C A;  5DUK A;  2VBZ A;  3OR2 C;  5HDN A;  2MFZ A;  3A0H C;  4UUS B;  1SEU A;  3S17 J;  2HKO A;  2L7K A;  2PMZ A;  1OMI A;  2WBM A;  3S1R J;  3B73 A;  4CCJ A;  4II3 A;  4RGR A;  4XQF A;  4CHU A;  4NHJ A;  4ENN A;  4ZC3 A;  1P4A A;  2HZT A;  3ECO A;  3V8K A;  4ZDO A;  3WU2 C;  2XPU A;  3CCJ I;  2K9L A;  2HVS A;  4DOZ A;  3K2Z A;  2NAZ A;  3QOD A;  1X4O A;  2XC7 A;  2HGC A;  1GT0 C;  2OTJ I;  3IAM 2;  4HSR A;  2RNJ A;  2E36 A;  3CC2 I;  3F22 A;  4LG0 B;  1MBK A;  1Z0X A;  3JRE A;  1SAN A;  3UR3 C;  2KKO A;  5DD4 A;  2VI6 A;  1D3Y A;  4BHC A;  2DQL A;  1T98 A;  1YYV A;  3VWB A;  1K6Y A;  2HYF A;  4I0A A;  4YEL A;  4ON0 A;  2FUG 2;  3F8B A;  5HOO A;  3S1Q J;  2ACJ A;  4DQ2 A;  1BR1 A;  1QZY A;  3ZQL A;  2CUF A;  1MSF C;  4M3F A;  1VQ9 I;  1W1W E;  1K78 B;  4A3E J;  3EET A;  3GZ6 A;  3VYR B;  4ANJ A;  1MDM A;  3AG4 H;  4I76 A;  5EJC A;  3R6S A;  2QKL B;  2H09 A;  3I5U A;  1DDN A;  1Y56 A;  4B1R A;  1OYW A;  4BS9 A;  2CMP A;  3P5J A;  2IGO A;  2IW5 A;  3WTU C;  4AIJ A;  2MW8 A;  2YPR A;  4LIT A;  5IY5 H;  1X3W B;  1Z77 A;  3GLL A;  2ZKZ A;  2RRE A;  2AHQ A;  4XON A;  2HVQ A;  3I58 A;  5ILV A;  2VJ5 A;  1B4A A;  3ZMU A;  3R0J A;  4PJL A;  1G3T A;  3DFG A;  3DKX A;  1Z3Y A;  3PNT A;  2E1C A;  4X1E A;  3T8R A;  4V19 K;  1RZ4 A;  1IV8 A;  2O6G E;  3OL4 A;  2DA7 A;  5K7Z A;  3OV8 A;  3G4S I;  1VF9 A;  1ZRD A;  3TDZ C;  1YS6 A;  3TMO A;  2OCE A;  4CUG A;  1G8X A;  1FBS A;  3D5R C;  4XLA A;  1WHU A;  1OCT C;  3ABT A;  1ON2 A;  4BQO A;  1LPQ A;  4A6D A;  2W1O A;  2D1H A;  2EZI A;  4RM2 A;  4B09 A;  3DBL B;  2DQR A;  1KU3 A;  2TDX A;  2HDC A;  2TRT A;  2KRH A;  4NC7 A;  2KHM A;  1QO0 D;  2VQL A;  2ELK A;  4RMN A;  2MLK A;  1YIO A;  2ZXJ A;  3J7Y J;  2R5Z A;  3LSH A;  1U5T A;  3IC7 A;  2MBF A;  4LD5 A;  3TOB A;  1ZRC A;  1KQ8 A;  1AWC A;  5LEJ A;  2F5C A;  4P9U A;  4CZC A;  2FD5 A;  4G8X A;  4QTR A;  2BHZ A;  3QP6 A;  4RGS A;  4JYK A;  3GTK J;  2L7F P;  3PIO F;  5EGO B;  3G1M A;  3F6V A;  2HR3 A;  2EFQ A;  3QRF F;  4KIS A;  1IJW C;  2VOO A;  3HRT A;  4L5J A;  1FOW A;  2O03 A;  4C2T A;  4L9J A;  3CES A;  1MZB A;  5LGU A;  3WE2 A;  4LG3 A;  1YW7 A;  2O7O A;  4BEH A;  1CF7 A;  1TQM A;  3A0B C;  5J47 A;  3KET A;  1W7P B;  1TW3 A;  2ZJP F;  2IRF G;  5DCM B;  3S14 J;  2R7Q A;  5BQT A;  4LLN A;  4CSW A;  4HLX A;  1R5H A;  3OL3 A;  4I98 B;  2X4H A;  1AU7 A;  4BBS J;  4AID A;  5LHG A;  2ZNZ A;  2J5O A;  4G6D A;  1IN6 A;  3P9I A;  1R5I D;  1ONV A;  4LK1 F;  1G59 A;  1B72 A;  1D0Y A;  2BY1 A;  1XMK A;  5ICG A;  3HZJ A;  1E17 A;  3NRV A;  2W00 A;  3H0D A;  5IYB J;  4ITV A;  1FP2 A;  1KA8 A;  1FJL A;  3VFZ A;  2NYX A;  2BY2 A;  3S8P A;  4JX6 A;  4OIQ F;  2P81 A;  1D0Z A;  3ZN1 A;  2KJC A;  2X1D A;  3HSF A;  3OOP A;  3V42 A;  1MIJ A;  1U8B A;  3FM3 A;  3LWF A;  2E5N A;  3M4O J;  3ZMT A;  2G0E A;  2F5E A;  3AG2 H;  4GRI A;  2VQH A;  2JA2 A;  3GUD A;  2VUM J;  1D5V A;  2N8G A;  5F04 A;  1TNS A;  3D0S A;  4A3I J;  2MGQ A;  4NUB A;  2VON A;  1MJA A;  1VQ4 I;  1RUN A;  3HC7 A;  2Q1Z B;  5IT3 A;  3S2W A;  3ZMZ A;  5CYV A;  1Y1W J;  2VQG A;  1VQ7 I;  4XKV A;  4IXA A;  4BU2 A;  1LKX A;  1TQI A;  3GO5 A;  1RR7 A;  2CWE A;  3DTI A;  3BTL A;  1JE8 A;  1HSJ A;  1JT0 A;  3OS2 A;  4HV6 A;  2VKH A;  2V26 A;  3FXM A;  3A2K A;  3DLL F;  4XMY A;  4KYW A;  3EQL F;  1R7J A;  1FT9 A;  1SAX A;  2IA2 A;  1BR4 A;  4BY7 J;  2LBF B;  2QBY B;  1IV6 A;  2R7S A;  2DN0 A;  2A61 A;  4E7K A;  4F92 B;  4LGW A;  2X9D A;  1H89 C;  2XSJ C;  4A93 J;  2XPV A;  2HDD A;  1QNT A;  4Y4R A;  5M3F J;  4A3D J;  3BTC A;  5J8C A;  3QOP A;  3HHH A;  3IH4 A;  1HDD C;  2DA2 A;  5FKK A;  3SDG A;  3SJM A;  2BZT A;  5B66 C;  1AKH B;  2K85 A;  3A4C A;  1Y39 A;  1TNT A;  3KYL A;  3IRR A;  3F8M A;  4M74 A;  3GTJ J;  1XDS A;  5GPC A;  1FP1 D;  1DQU A;  2FSW A;  5K5R A;  2AXT C;  1X1C A;  4MTD A;  4HST A;  3FXU A;  5E3O A;  1TQP A;  5J1U A;  5FKN A;  4HNV A;  2R7F A;  4KUM A;  1APL C;  1W5C C;  5B3S H;  1R36 A;  3O8G A;  3KZY A;  3K10 A;  4OOI A;  2DJN A;  4BGD A;  2EFO A;  5F08 A;  1Y8Q B;  2LYC A;  3DU5 A;  2ID6 A;  5CVI A;  5F0H A;  3K4J A;  4UVA A;  4M6V A;  3JAM Z;  4HX8 A;  2CFX A;  3CDI A;  4KT5 C;  1T0F A;  1UB9 A;  4J00 A;  1KYW A;  2ID3 A;  4KIG A;  2EWN A;  3TOA A;  1DPR A;  2P5V A;  2UXN A;  3KPH A;  3TL4 X;  3HTS B;  2VC0 A;  2STT A;  4M3B A;  2XKP A;  4B3A A;  5FJ8 J;  4DNC A;  3RIR A;  5HNF A;  5D4R A;  2EPF A;  2IAI A;  1YG2 A;  4O6J A;  4DZP A;  1IRZ A;  3TP3 A;  2LFB A;  3HSR A;  2WY8 Q;  4UB6 C;  3M07 A;  1B6A A;  2NXN B;  4FAS D;  4OMZ A;  3OYH A;  2CQK A;  2OCC H;  3DXJ F;  2RQQ A;  2UZK A;  1IGN A;  3CP2 A;  2OBP A;  4PJN A;  2W82 A;  2CSO A;  3KZZ A;  3MEX A;  5HS7 A;  3HL2 A;  2HPM A;  1BL0 A;  2HVR A;  2BY3 A;  1TT0 A;  1P92 A;  2GOM A;  1FIP A;  2MD0 A;  2VKE A;  4LIU A;  4BJ6 C;  5ICC A;  4KJZ A;  1J59 A;  2BHY A;  5K7F A;  1P7I A;  4DZJ A;  4AYB A;  1I27 A;  1HXD A;  3S32 A;  1XSD A;  2O8X A;  2XAH A;  4EVI A;  1GDT A;  1Q1H A;  4WXH A;  3NEU A;  2F5V A;  3W6J B;  4UHT A;  5LBQ A;  1WZ2 A;  3HPG A;  1FSE A;  5LEK A;  2ICW G;  2CG4 A;  2NS8 A;  2HYJ A;  3Q5F A;  2VIX A;  1MSE C;  2I8D A;  3I64 A;  4RAG A;  1ZG1 A;  5CPR B;  1RC9 A;  2JUG A;  1HKT A;  3GEZ A;  3H3V K;  2W24 A;  1MBE A;  1XD7 A;  3J80 Z;  5CQE A;  3BOQ A;  1FMW A;  5DD8 A;  2L9S A;  1FBU A;  2KFD A;  2QUF A;  3NAU A;  2G7U A;  4ENJ A;  3GCM A;  5BNG A;  3HUG A;  1IN5 A;  1GLN A;  2IS6 A;  1TZL A;  3TED A;  5DDG A;  5L3D A;  5M5W J;  4IZZ A;  1BBY A;  2R7X A;  4B44 A;  2GA1 A;  2GQQ A;  1S29 A;  2LRE A;  1UHW A;  1L0O C;  2XUB A;  5IT9 Z;  4L9T A;  2QCO A;  5KAI C;  4ZYH A;  1MNE A;  2RV8 A;  4AUX A;  3FMS A;  3HOS A;  1R1T A;  4DYC A;  3WTX C;  1I3Q J;  2L02 A;  1R58 A;  1VTN C;  1DU0 A;  1SAU A;  2DOE A;  3AFH A;  5TGT A;  3ASO H;  1KU7 A;  3BJO A;  5F0C A;  3Q0U A;  2XVC A;  5A2Q Z;  2QSH X;  3VYT B;  1Y0U A;  3KFW X;  2XRL A;  4CGZ A;  3WHB A;  1JT6 A;  2Y75 A;  2CRG A;  2JJ7 A;  3ABL H;  4F93 B;  4DYQ A;  2NS0 A;  2M30 A;  2JT1 A;  2XRN A;  3CCM I;  1IAW A;  1VQP I;  2EZK A;  1YQA A;  1VQL I;  1GXQ A;  1USS A;  2D1V A;  2VKD A;  1V5G A;  1R23 A;  5GP9 A;  2PJR B;  2KIM A;  5ICE A;  2I5U A;  5IP9 J;  1LDJ A;  2V6E A;  2P5K A;  3UNG C;  2QEN A;  3V4G A;  1YJN I;  1G3W A;  1GV2 A;  1OR7 C;  3GTP J;  1X1A A;  3E0J B;  4IRG A;  3SYT A;  2E60 A;  3EUK L;  3O3K A;  4ZYG A;  2KZG A;  1V55 H;  2FMY A;  2HOT A;  2PBI A;  3EUH C;  2AQF A;  4KN4 X;  2F5F A;  2F5D A;  2RN7 A;  3BG6 A;  1DUX C;  2LSO A;  1BI2 A;  3E5U A;  1K79 A;  3FWE A;  2L01 A;  1P2F A;  3OYE A;  2IJL A;  3OYM A;  3G1L A;  1YTY A;  3I4P A;  3Q0W A;  4PZJ A;  3S15 J;  3B6C A;  4RAY A;  4RLF A;  2ZXW H;  3S3M A;  1F4K A;  1X2N A;  3NWS A;  3SEQ A;  3HSE A;  5E3L A;  4XM3 A;  2R7O A;  3SQN A;  2ZME A;  3HOX J;  4N0B A;  4A6E A;  3S93 A;  1WJA A;  1PP7 U;  4IOA F;  3LL7 A;  3VSL A;  2KDO A;  1Z21 A;  3BR1 A;  2HU9 A;  3TP0 A;  1FX7 A;  2WY7 Q;  1ZLJ A;  2XGD A;  3RYR A;  1EV7 A;  1ZTR A;  2DBB A;  3F3X A;  3JTG A;  2GLO A;  3GFL A;  3GW2 A;  1NH3 A;  1A35 A;  3DPT A;  1LNW A;  2AQE A;  3H9Q A;  4BQA A;  4WF2 A;  1ZYR F;  1VZ0 A;  2JMW A;  3VYS B;  4GO1 A;  4BHP A;  2W7N A;  2VJJ A;  3I53 A;  2Q2E B;  1R22 A;  1WRJ A;  2IS2 A;  3HRS A;  3VYU B;  5D5V B;  1ZR4 A;  1JKR C;  3BCA A;  3BR3 A;  2HKX A;  5FKM A;  3T1B A;  3BTJ A;  1PVE A;  4MHG A;  4E7H A;  4RLQ A;  1ZG3 A;  2E1N A;  1MJ9 A;  3RDI A;  2IA0 A;  2QYO A;  2HQR A;  1SFK A;  4CO8 A;  4YFX F;  4XLH A;  1LFP A;  3FXL A;  1TLH B;  5FD6 A;  1UJ8 A;  1FZP B;  1R4M B;  2X1C A;  2D5V A;  2XKO A;  2ZFU A;  3MMY B;  5FKL A;  3RI4 A;  3EPZ A;  4KDP A;  3PO3 J;  1EF4 A;  1JTX A;  4DJA A;  2DA3 A;  1WJ5 A;  3GWZ A;  1R4N B;  1W7P D;  4XLN F;  2DCE A;  3C3W A;  3MCZ A;  5ED4 A;  4EJW A;  4X0G A;  2ZBK A;  4XOT A;  4HYE A;  1SC7 A;  4N9I A;  2V6C A;  4HX7 A;  1HC8 A;  2GZW A;  1IUF A;  5D8K B;  4M73 A;  2VKV A;  1U78 A;  1BA5 A;  1LUJ B;  5HLG A;  2FX0 A;  4Y33 A;  1KZH A;  1XC5 A;  2B9S A;  5BPD A;  4XRS G;  1XG1 A;  2MYS A;  3BQZ A;  4H4K C;  1ZKG A;  1RIO H;  5FGM A;  1XCB A;  2Z9O A;  4BL0 B;  2DI3 A;  4MQV A;  5HS9 A;  2Q0O A;  2DT7 B;  3E7L A;  4UXN A;  5EEA A;  3FMQ A;  2HNH A;  2X6Y A;  4UV8 A;  1BIB A;  4M9Z A;  3FKJ A;  1OKR A;  3E6M A;  2V79 A;  4BXF A;  3MD2 A;  1H9G A;  2DMT A;  3AG1 H;  3F21 A;  4QPO A;  3DKW A;  3J7A Y;  1TWF J;  5LHI A;  3IKT A;  4E7L A;  5E79 C;  4A3M J;  5HVQ C;  2DA5 A;  1S7O A;  3RJP A;  5ILS A;  2X51 A;  2JA8 J;  1WI3 A;  3W2W A;  4CH7 A;  5LGN A;  4U7D A;  4A3G J;  2K02 A;  3OS0 A;  3KP4 A;  3OWT A;  5DM6 F;  3OR1 C;  2IP2 A;  1AOY A;  4CYD A;  4I01 A;  5LHH A;  2JUC A;  3S16 J;  2LD5 A;  1PUE E;  3J81 Z;  1TT5 B;  3JSO A;  1WVR A;  2RNG A;  4NBQ A;  3TQN A;  5JR3 A;  4II2 A;  1P4X A;  2EFN A;  3BR5 A;  4G7H F;  1PUF A;  4HPQ A;  2OTL I;  3FK6 A;  3N05 A;  4XKB A;  3K2A A;  3F0C A;  2YR2 A;  2NVX J;  5D5W B;  2PJP A;  4EJU A;  2Y69 H;  1YE9 A;  5AON A;  1RKT A;  2NRA C;  1JHH A;  4N4N B;  1U2W A;  5J4V A;  3H9J A;  4B47 A;  2FNP A;  2EK5 A;  3CDL A;  4C30 A;  5L3E A;  2MAB A;  4KNY A;  1QVT A;  4ZDL A;  2E5Z A;  3CCV I;  4EJV A;  3JRC A;  1LVA A;  4PUS A;  2GWR A;  2RAE A;  4I2O A;  4PGG A;  1I6H J;  3J7Z I;  1MBF A;  3CJR B;  4U87 A;  1I5Z A;  4BDY A;  2XAS A;  4U88 A;  2M0C A;  3ZMD A;  2OJE D;  3QPT A;  2P7V B;  4OIP F;  2F4M B;  3HOU J;  2L2O A;  1DGR M;  1R5G A;  4ABZ A;  5H6R A;  3E6C C;  4MQ9 F;  1UHM A;  3I54 A;  4F52 A;  4BJT A;  1WJB A;  2R7T A;  1FOY A;  2K9Q A;  4S05 A;  4HA8 A;  1SD5 A;  4IF4 A;  2IS4 A;  2LVS A;  3MZH A;  4CYC A;  4BNC A;  3OYC A;  1I3A A;  2K4B A;  3G2B A;  4QWQ A;  4R8H A;  3I9V 2;  3TW6 A;  2KQR A;  2EIL H;  3A01 A;  1OPC A;  2CW7 A;  2ECC A;  2V1X A;  3HHG A;  3IL2 A;  4AC0 A;  2WAQ N;  4G7O F;  1YHQ I;  5IP7 J;  1POG A;  1S5L C;  4FE4 A;  2ZXI A;  3RPU A;  1E0E A;  2H8R A;  1RUO A;  4E70 A;  3JSP A;  1T95 A;  2L7M P;  3L1P A;  2WC2 A;  5DCM A;  2JSP A;  4XSX F;  1I6X A;  5F6F A;  4V2F A;  4AVP A;  3FF5 A;  4G6Q A;  4XOR A;  1GHC A;  1D1B A;  1A6Q A;  1BC8 C;  1O3T A;  2OQG A;  3ZCO A;  2MH9 A;  5E8I A;  5IYD J;  3FBN B;  4ZTJ A;  4NB5 A;  1XX5 A;  2VT3 A;  3FBI B;  5FO5 A;  3F8C A;  2ZNY A;  2ME0 A;  1KU9 A;  3A1Y A;  2LMD A;  4NDL A;  3DF8 A;  4IKF A;  2DDA A;  3LNQ A;  1UCR A;  4M6Y A;  2K7L A;  2QF7 A;  2V4J C;  1MJB A;  2GIV A;  4GFB A;  2XAF A;  1WJF A;  2FQ3 A;  3E5Q A;  5GAH J;  5M3M J;  3LSP A;  2YX7 A;  2FA5 A;  3CUQ A;  2YU3 A;  4EAT A;  1R49 A;  3PNV A;  2AS5 F;  2GAU A;  2OAZ A;  3K4M A;  2GM4 A;  4ESJ A;  2QQB A;  2WAE A;  2ZO4 A;  4ZYE A;  5C44 J;  3U1K A;  3NQO A;  4ENK A;  3VDX A;  1WCM J;  2Y0S N;  4XIC A;  1S3J A;  3WTY C;  4OIR F;  3SDB A;  2VXZ A;  3RZD J;  2A6H F;  1S6L A;  2NNN A;  3ZOB A;  1D1A A;  3MZ8 A;  5F1J A;  2R5Y B;  2DW4 A;  1B8I A;  3OYF A;  5HDG A;  1ETX A;  2RVC A;  1XMA A;  5CVR A;  5CVV A;  2BEO A;  4GDF A;  5K1Y A;  4P55 A;  4UY8 I;  2FML A;  3HRU A;  4WCG A;  3PQK A;  4M9X A;  5H6Q A;  3QPS A;  3ZMV A;  1EA3 A;  4DW6 A;  1ETY A;  1N75 A;  4Y52 J;  2OA4 A;  4KIT B;  3H3U A;  2ZSH B;  2E2H J;  1MDM B;  2BVM A;  1YO5 C;  2GA2 A;  4FTH A;  4AU7 A;  2FXA A;  4HQE A;  3NWT A;  3QPH A;  2VQC A;  4D5F A;  4PSX A;  2LBF A;  3PIP F;  1VQK I;  4TV7 A;  4F91 B;  3ULQ B;  1Y8R B;  1UFM A;  1L3L A;  5JVG F;  5IOZ A;  3SFZ A;  1N77 A;  3ZQG A;  4YIR X;  4D9J A;  5M5X J;  4JBA A;  3KYD B;  4NQW A;  2Y48 A;  3H5R A;  2M45 A;  4FET A;  2F4I A;  3HG9 A;  1YLF A;  3CJQ B;  1NG6 A;  2CO5 A;  2O8K A;  3GLX A;  2TCT A;  5TJJ A;  3C2G A;  3FXR A;  1IDY A;  2QGU A;  1UG2 A;  2L9V A;  4NC8 A;  4PDK A;  3MKZ A;  3L2C A;  3OYG A;  2V9P A;  1WJC A;  4L5I A;  3W6K B;  3TGN A;  2ETH A;  1O7L A;  5FLV A;  1ZEL A;  3LFU A;  1CGP A;  1XSX A;  4Q48 A;  2E35 A;  4A2U A;  3T5X A;  1O7F A;  3M8F A;  1T38 A;  3OOU A;  2DYR H;  4P96 A;  2WB1 N;  1YIJ I;  2M3A A;  2VOP A;  3P7N A;  3S1M J;  1Y6I A;  3GFI A;  2R3S A;  1FSH A;  2MG4 A;  3ABM H;  5J1R A;  3VSK A;  3JRH A;  2ZJ2 A;  4FHT A;  3D5L A;  2R5Z B;  2K9S A;  4XID A;  5ICF A;  1ZGJ A;  3PNY A;  3OIQ A;  4EMS A;  2M7B A;  2PQ8 A;  4JX5 A;  1TBX A;  4JOM A;  1W0U A;  3BT9 A;  1O4X A;  3R4K A;  1S8N A;  4BAY A;  3A02 A;  2KDZ A;  2COM A;  3IH2 A;  4CZZ A;  3QAH A;  2VPL A;  1YRN A;  1SFO J;  3LOC A;  3TW7 A;  1SMT A;  1YX5 A;  1BI3 A;  3CCY A;  4RAZ A;  1MMD A;  3SZG A;  3LSI A;  4KMU X;  2QQ9 A;  2LKX A;  5FLX Z;  1A6I A;  1J75 A;  2HOE A;  4A3F J;  5D5X B;  5DUI A;  2WAD A;  4ZTF A;  1YI2 I;  1CF7 B;  4BEH B;  2K9N A;  3R61 A;  2ELH A;  1FOX A;  3I71 A;  3ZR8 X;  4M3D A;  3K4L A;  2QWW A;  2GXA A;  4U7B A;  1TWA J;  4RA2 A;  3OSG A;  4PSW A;  1N78 A;  4PJJ A;  3WOD F;  5C4X J;  1ZGA A;  4LFU A;  4LJZ F;  1QVU A;  1TWC J;  5K5O A;  1ZRF A;  3C18 A;  2G9W A;  2XAJ A;  4QIW N;  3HKZ A;  2MC4 A;  3CME I;  4B43 A;  5IP6 A;  5IT9 K;  2COB A;  3E6D A;  2QKM B;  4Y13 A;  3G71 I;  1WI9 A;  2PMU A;  4A69 C;  3E6B A;  1BOB A;  2XRO A;  3CQZ J;  2M2E A;  1T08 B;  4ZDP A;  5B1A H;  1B72 B;  2M4G A;  2HOA A;  4GCV A;  4XSZ F;  1E3H A;  3RYP A;  3M3Y J;  4E7Z A;  3IP4 B;  2WWY A;  2QEX I;  3M8J A;  6PAX A;  4EQQ A;  3FKI J;  4B4C A;  3PO2 J;  2VJ4 A;  2OZU A;  1T0F C;  4UB8 C;  2HDW A;  4XNF A;  3DEE A;  3REO A;  4YEJ A;  1Z6T A;  4UNO A;  2Z1D A;  3P9C A;  2CU7 A;  2DA6 A;  3GZN B;  2LRD A;  5EG0 A;  2M1B A;  5E3M A;  3KP7 A;  4RB0 A;  4LLG F;  1F1Z A;  4HLY A;  2VOD A;  1EJ9 A;  4R1H A;  1T8I A;  2E71 A;  5J8F A;  1KQ9 A;  3RKY A;  1YOV B;  1LE8 A;  1BI1 A;  3RKX A;  2VC1 A;  3HGG A;  1KYZ A;  3LA7 A;  1G4D A;  2XF5 A;  1U6G A;  1X2M A;  5IYC J;  2CQQ A;  4HNU A;  2J5P A;  4BXU A;  4G6T B;  4L9N A;  2O5R A;  4PGH A;  3JRA A;  2FQ4 A;  2EIK H;  1YJ9 I;  1A31 A;  1JUP A;  1I39 A;  5DCF A;  3FZV A;  2Z2S B;  1JGG A;  4A3L J;  3L2Q A;  3L2V A;  2CV2 A;  1P6R A;  1IXR C;  3DBH B;  2PMH A;  2DTZ A;  5D8L B;  2L54 A;  2DT6 A;  1JKQ C;  3HM5 A;  3D1N I;  2EZH A;  3OYB A;  3Q9V A;  4I09 A;  2MLG A;  4I7H A;  2JRT A;  5KVR A;  1HOM A;  4OIN F;  1QU3 A;  3DQV C;  3I4N J;  3RKW A;  3BG5 A;  3PSF A;  3T8T A;  3KYC B;  4Y7N J;  2O3F A;  4KA4 A;  1T56 A;  3FDY A;  1UAA A;  1IG7 A;  2IT0 A;  3H1C A;  1FLI A;  5DYM A;  2OC6 A;  1JKO C;  3I59 A;  1YIT I;  4HF2 A;  2PJR A;  3DKY A;  2KLO A;  1W0T A;  1Z91 A;  5IPA A;  1RR8 C;  3W2V A;  2P8T A;  2E7X A;  4IHT A;  3QQA A;  4HX4 A;  2XF7 A;  3CZ6 A;  4CCN A;  1IRX A;  4E4H A;  1OFC X;  1K6O A;  5EEH A;  4NC6 A;  4AVZ A;  1Z3X A;  5LFA A;  2F2E A;  2L3D A;  3W3C A;  3CUO A;  1JKP C;  4Y17 A;  3WE3 A;  1V54 H;  3BR2 A;  1R71 A;  1FEX A;  2A69 F;  1LQ1 A;  1LVK A;  4FX0 A;  4M9S A;  1PJR A;  4S0H B;  4X6A J;  4MO7 A;  1WSU A;  3P9K A;  3W6V A;  1BC7 C;  1S7E A;  1BI0 A;  3I3L A;  3OYK A;  2Y31 A;  3K6G A;  2DMQ A;  2JN6 A;  2DXI A;  3N97 A;  2BBY A;  3PM1 A;  3OSF A;  2EB7 A;  2NVY J;  1SD6 A;  3WG7 H;  2CYY A;  2XDV A;  4W1U A;  1ZH5 A;  4A3J J;  3ZXS A;  4LB6 B;  4M6X A;  2LKP A;  1JJ8 C;  1XB4 A;  2FNA A;  4UUT A;  1XGS A;  3A03 A;  3H9G A;  2HYG D;  4D1Q A;  1HCR A;  1OLT A;  1SMY F;  3Q3S A;  2V9K A;  5GTH C;  3FHZ A;  2E1O A;  4J19 A;  1XTA A;  3HDD A;  4RB2 C;  5D5U B;  3IUO A;  2P5L C;  2AXL A;  1YS7 A;  3PQJ A;  1ZHF A;  2K40 A;  3U9G A;  4HF1 A;  3KP3 A;  5DTD A;  5FLM J;  4BE1 A;  3LQQ A;  2H27 A;  2EIJ H;  3CC4 I;  2EH3 A;  2UV1 A;  2VBW A;  2V9V A;  3I4M J;  3PFY A;  3GX4 X;  2QQA A;  2P7C B;  5JHU A;  3IHU A;  4IPA A;  1CQT A;  4IRI A;  1GVJ A;  2HZD A;  3AAF A;  4XRF A;  3I56 I;  4IX7 A;  4HZF A;  4EM1 A;  1FBQ A;  3GBG A;  3HOW J;  3BJ6 A;  1X4P A;  1PYV A;  3R0A A;  4QPQ A;  4CDG A;  1IDZ A;  2AO9 A;  2EA2 A;  1ETK A;  2BGC A;  2W85 A;  3HYI A;  3F8F A;  4Y15 A;  5EDN A;  1JUM A;  1RPW A;  3JRF A;  1ACI A;  3F8N A;  4EV0 A;  1ETV A;  1ETW A;  1OJL A;  1OYI A;  2G7H A;  1VQ6 I;  1BR2 A;  1SVL A;  1ZQ3 P;  4D5C A;  3DEU A;  4C2U A;  2ESN A;  2ZME C;  5DM7 F;  2DAO A;  2DFE A;  4WXD A;  2BXY A;  5TRD A;  2E1M C;  1ORK A;  4AIH A;  3IRQ A;  1HLV A;  3BZC A;  4FE7 A;  4IHS A;  1IN7 A;  2CW8 A;  3KE2 A;  1OR7 A;  2DPU A;  2RGV A;  5FB2 A;  2BW3 A;  3CJT B;  3ZQH A;  3HUG B;  2LNB A;  4KIC A;  2LY9 A;  3DPL C;  2QSG X;  1T33 A;  4O5V A;  1WQ2 A;  2E19 A;  2DMU A;  4N4O B;  4AIK A;  5C4J J;  3J81 K;  3WTZ A;  1IW7 F;  2A05 A;  2O0Y A;  3QU6 A;  3BZ6 A;  2FOW A;  2P4W A;  4L18 B;  1M1E B;  3BLY A;  4IL6 C;  2JPC A;  4YFK F;  1H9T A;  2CGP A;  3PJR A;  1BW5 A;  3S3O A;  3VOD A;  5KHD A;  1K61 A;  2K86 A;  3HIF A;  2X48 A;  1WPK A;  2GBY A;  3BJA A;  4ZZD A;  2Z16 A;  1BJZ A;  2KL4 A;  4XKC A;  3K70 C;  3FX3 A;  4I99 C;  3HTU A;  4IJA A;  4RGU A;  1YW9 A;  1V4R A;  1QZE A;  2XB5 A;  1XS9 A;  1D5Y A;  2R7W A;  1JXS A;  3TO9 A;  3S2H J;  2KMU A;  5L3C A;  3GTG J;  2FEZ A;  4RGX A;  1QHH D;  3C2H A;  1I1G A;  2W4S A;  2DPD A;  2WTE A;  2DU9 A;  3MQ0 A;  1R1V A;  3ERE D;  2KZV A;  2E2J J;  1K4T A;  2ZC2 A;  4U0W A;  1UZC A;  2K5C A;  2VB6 A;  5B1B H;  3GTM J;  1KON A;  1TWG J;  2NOG A;  1K4S A;  1J9I A;  4G7Z F;  2R4G A;  2CQN A;  3F6O A;  1TL8 A;  3CC7 I;  3M8E A;  2FRH A;  4CCO A;  4Z2Y A;  4A5M A;  1FYM A;  1LFB A;  4PK4 A;  4GXO A;  2QQ8 A;  1ETQ A;  4RB1 A;  3SXY A;  1Y0N A;  4C9Y A;  1Z1D A;  4J01 A;  2R92 J;  4M72 A;  3C7J A;  2QM3 A;  3LSK A;  1W5S A;  2XGC A;  2CV0 A;  5L3B A;  3OYL A;  4M71 A;  2CS3 A;  3K1P A;  3VEP A;  1ULY A;  4A3K J;  1HF0 A;  1FY7 A;  3RPU D;  1ZAR A;  4ZZL A;  2BV6 A;  3G1O A;  1KQ0 A;  1R9T J;  3K0L A;  3COA C;  1X1D A;  5FRM A;  3PFI A;  2H8W A;  2L4M A;  2WAQ A;  1O3R A;  4BHB A;  2EFW A;  5B5E C;  2ZME B;  4G9Y A;  4I6Z A;  2Y30 A;  4YII A;  4KIB A;  2E1M B;  4UUS A;  1JTY A;  1ZK8 A;  4LMY A;  1Z7L A;  2L7Z A;  2NS7 A;  3BCB A;  5L3G A;  3HGY A;  3LMM A;  4HQM A;  4MEY F;  1LDD A;  4I02 A;  4MLO A;  1IO2 A;  2XF6 A;  3IV5 A;  3E1S A;  3AL0 C;  2OPT A;  3JRB A;  5KCM A;  3WGG A;  5E18 F;  3TDU C;  1KU2 A;  5L3F A;  2DYS H;  3EYY A;  2RDP A;  5E3N A;  4RBO A;  2IS1 A;  1HDP A;  9ANT A;  1OCC H;  2QVO A;  4LG0 A;  2UWM A;  2XAG A;  1RES A;  1UEL B;  2OF7 A;  4MTE A;  5BS6 A;  2CUE A;  1H88 C;  3MKY B;  1VI0 A;  4CXF A;  2YS9 A;  4UUV A;  5HNH A;  1DGW Y;  3WTS C;  5ILU A;  4OAY A;  1DP7 P;  3OIP A;  4ZYD A;  4HDV A;  3HOY J;  3FHN A;  1K78 A;  1MH4 A;  2A6E F;  3DU6 A;  2MC3 A;  3OIO A;  3I0T A;  1EH6 A;  3C2B A;  2P6T A;  4RAF A;  5JLX A;  4XLE A;  4EEF G;  1ZGW A;  4JK1 X;  1BW6 A;  4O3M A;  4LK0 F;  5CKT A;  4IQ4 A;  2B63 J;  2EA4 A;  2Y0S A;  3KZI C;  3K7A J;  4A3B J;  1OCP A;  2WAF A;  3KIO A;  1ZAO A;  1QHG A;  3CMA I;  5H2F C;  1I50 J;  2IGM A;  2KIF A;  3M7G A;  4IQJ A;  2JVG A;  2XGX A;  2BE5 F;  2IPQ X;  2A68 F;  4F7Z A;  1O3S A;  2JA5 J;  3CLQ A;  1MMG A;  2PFB A;  4C2M J;  2Y9Z A;  2BOL A;  3L00 A;  4ZYA A;  4ZH4 F;  2QA4 I;  2YSR A;  3KX2 A;  1UST A;  4CIC A;  3CLO A;  4BXX J;  2VE8 A;  2FBI A;  2GXG A;  2ZJR F;  1K7A A;  3WG9 A;  3HPH A;  3B02 A;  4LLL A;  3H5A A;  2PG4 A;  1FYL A;  5FFX A;  3DWL E;  3ERM A;  3VOE A;  1IRF A;  4OIO F;  1A04 A;  5JLW A;  1YFH A;  3BC8 A;  1G2H A;  4ETS A;  3LA2 A;  1WJD A;  3FXO A;  4HOB A;  3HOV J;  1PP8 F;  3Q9S A;  1PDN C;  4AM3 A;  4ESB A;  3WHC A;  3HJE A;  2M34 A;  1W36 C;  2NVT J;  2DTR A;  2CJJ A;  2DA4 A;  1VQ5 I;  1AA7 A;  5D6F A;  2PX9 A;  4LIV A;  2MSY A;  4P9F A;  4XLC A;  5M5Y J;  3IAS 2;  1P7J A;  5E1Z B;  1R00 A;  4F55 A;  2EJR A;  4EGY A;  2FOK A;  2PN6 A;  4L5E A;  1K83 J;  2JTV A;  3AL0 B;  2LF8 A;  2JA7 J;  1BN5 A;  1QBJ A;  5J1Y A;  1IXS B;  3BTI A;  5EGO A;  2R5Y A;  4RM3 A;  3FXJ A;  2HQ5 A;  3ROU A;  2DMN A;  1SFU A;  2W48 A;  4Q5S F;  1FYK A;  2KPM A;  3CCL I;  2WB1 A;  2DA1 A;  2VBY A;  1WFX A;  1W7P A;  4D7N A;  4ESF A;  1PUF B;  1D8K A;  1RET A;  3V7S A;  3H92 A;  3WU1 B;  3ZGK A;  3LSR A;  4U0Y A;  3HEF A;  2HFH A;  2Z3Y A;  3F72 A;  5BPI A;  2GOX B;  3JTH A;  2O9L A;  1QPM A;  2VJI A;  4E7S A;  4M3E A;  1V5F A;  2KP6 A;  5EEG A;  2Y2Z A;  5LD2 C;  3BR6 A;  5JFR A;  2YU9 J;  1G6N A;  4YFN F;  2E2I J;  2IXS A;  2JSC A;  3HOZ J;  2JPB A;  5FFZ A;  2ADU A;  4B3X A;  4DYR A;  3H3Z A;  3FK7 A;  4XL9 A;  3EYI A;  2FF4 A;  2L0K A;  2UXX A;  3CUQ C;  3O2P E;  1TWH J;  4UVB A;  3EDP A;  1TW2 A;  3JRD A;  1LJ9 A;  2DFH A;  3PUB A;  1O3Q A;  3CDH A;  3ZRG A;  2H1K A;  1U5T C;  2LTP A;  2HOS A;  3IH3 A;  4XBF A;  1DP3 A;  2H6B A;  4YG2 F;  3BR0 A;  2NVQ J;  3H35 A;  3WU0 A;  3RQI A;  3V8L A;  1ZR2 A;  2XV4 S;  1S7A A;  1JGS A;  3RSN A;  1XPX A;  2Z33 A;  2K3F A;  3OYJ A;  4ASN A;  5FLX K;  1WH5 A;  1U9N A;  1JJ6 C;  1XGO A;  3KLN A;  3RKQ A;  3FIS A;  3WTV C;  1RI7 A;  4L0Z B;  2X0L A;  2DFI A;  4HBL A;  3W2A A;  4D7M A;  1LDK B;  3SZT A;  3KEY A;  3KP5 A;  2KT0 A;  4MGR A;  3OYI A;  2K4J A;  4CYC B;  2DO7 A;  3BDD A;  1VQN I;  2A3S A;  4KFC A;  3JRG A;  1RNL A;  1MD0 A;  5EF6 A;  2XPW A;  1S9H A;  1WWX A;  3NAR A;  3BPV A;  1IN8 A;  4F3Q A;  3OS1 A;  4OAZ A;  4XLP F;  1XGN A;  1OYY A;  2F6C A;  2XAQ A;  3A01 B;  3WTW C;  1RRJ A;  5FD5 A;  3GTL J;  2RQP A;  4BQQ A;  2LP0 A;  3PSI A;  5FRO A;  1GUU A;  1IN4 A;  2HQN A;  2VPR A;  3CO7 C;  4IOC F;  2QBY A;  2QZ8 A;  5HDK A;  4N9H A;  3BWG A;  2PMZ N;  3LFK A;  4MFE A;  4OU0 A;  3JAM K;  2B0L A;  2W25 A;  3LQR A;  3K9T A;  3DTE A;  5JI6 A;  4HDU A;  5F1R A;  2LOO A;  2DT5 A;  2ZXH A;  4S04 A;  3GFM A;  1ZN2 A;  2LC2 A;  1KGS A;  3K4K A;  3R60 A;  5CVJ A;  1AKH A;  1X3U A;  1J09 A;  4BDZ A;  4A12 A;  1BIA A;  4K2E A;  4FCY A;  2KRC A;  4OWR B;  2DOA A;  2O61 A;  4BQN A;  4LB5 A;  5DV5 A;  1JI8 A;  2HXI A;  3MKL A;  3ZN0 A;  3G3Z A;  3ZQC A;  4QLC U;  2DK8 A;  3BY6 A;  1HKQ A;  3M1E A;  2GXB A;  1GV5 A;  4HAM A;  3CUQ B;  2HS5 A;  2Q8K A;  3MFK A;  1Y1V J;  3AG3 H;  1ODD A;  3K4B A;  3QYE A;  4XKW A;  4BAC A;  5CLS A;  2ZCW A;  3CTA A;  1U5T B;  1E3P A;  3V7C A;  1H8A C;  1ETO A;  2IGN A;  4G94 A;  5IOY A;  1XDU A;  2FU4 A;  5E1X A;  3S1N J;  1R1U A;  2LG4 A;  5J4Y A;  2WA0 A;  2L4A A;  3HBL A;  5EZH A;  2EV5 A;  3L2W A;  1P9Q C;  3E97 A;  1SD7 A;  3F9K A;  3V8J A;  3BG9 A;  1X1B A;  1B8I B;  1FPQ A;  2X85 A;  4C3H J;  5HLT A;  3BPX A;  3LAJ A;  3ML6 A;  4CA0 A;  2VT2 A;  1A5J A;  1OCZ H;  3K1M A;  1YJW I;  1Z7U A;  1MH3 A;  4A3C J;  2DLL A;  3H0G J;  2JZY A;  4IHV A;  3J80 K;  1SFX A;  1N25 A;  4XN0 A;  4MFD A;  4JQF A;  1V3F A;  1FTT A;  3CCR I;  2LY2 A;  2M8G X;  3ZP5 A;  2OZ6 A;  4E6K G;  3GZ5 A;  2M4K A;  3ELK A;  3K69 A;  5ERI A;  2P6S A;  3DV8 A;  1C0W A;  3G73 A;  3EUA A;  4RS8 A;  2IA1 A;  1XGM A;  4HV5 A;  5TIS C;  3WGH A;  3CCQ I;  1LEA A;  2QSF X;  3KP2 A;  4P1W A;  3U2R A;  4EM0 B;  2V1U A;  1SVO A;  3QOE A;  3LST A;  2M87 A;  3PL8 A;  1MBH A;  2RKH A;  4NQW B;  3FXK A;  5LLQ A;  1ZLK A;  2VBX A;  1HW2 A;  4KT6 A;  2ZJQ F;  2FJ1 A;  3M1C A;  2BY0 A;  3CP8 A;  2D45 A;  2BXZ A;  5A2Q K;  4IHX A;  1NTC A;  4UVC A;  1MMS A;  4YIF A;  5AIQ A;  4WK8 F;  3GTO J;  2ESH A;  1Z67 A;  3L7W A;  3KP6 A;  4BE0 A;  3I55 I;  3DCF A;  1XN7 A;  1ZRE A;  5BMZ A;  2I10 A;  1STZ A;  1Z05 A;  3H5N A;  3F23 A;  1WH7 A;  1IC8 A;  3ZPL A;  2R93 J;  2ISY A;  3QPL A;  3LSJ A;  1X1P A;  3O6B B;  3L2U A;  4JP0 A;  5F64 A;  2ZFW A;  4L9V A;  4AD9 A;  5KK1 A;  3CMY A;  4HNT A;  1I1S A;  2ZB9 A;  4ENM A;  5GAD J;  3SEZ A;  2DOF A;  3MVP A;  2XHK A;  3CF2 A;  3N4M A;  1U9O A;  2EZL A;  2JVH A;  1HW5 A;  1QGP A;  1YRN B;  2MA3 A;  2JQ7 A;  2HI3 A;  1MNM C;  4XOP A;  3LAP A;  2ME6 A;  2PEX A;  3ZQI A;  2F48 A;  2A5W A;  4IHW A;  2VAS A;  2LY1 A;  2KRF A;  3GME A;  2CW0 F;  2M0M A;  2IBD A;  2OU2 A;  2EBI A;  4I0B A;  2DK5 A;  2OD5 A;  2LKS A;  2LH9 A;  3LA3 A;  3K70 D;  5E17 F;  1AHD P;  3TO6 A;  4A5N A;  4CCL A;  2R7R A;  1XMX A;  5GPA A;  3IKV A;  5AIP A;  3QWL A;  2VN2 A;  2STW A;  5F27 A;  1TC3 C;  1J5Y A;  3DTK A;  4BJ5 C;  5FKO A;  3ZQF A;  3OYD A;  2B7E A;  4RB3 C;  4GGG A;  1MMA A;  3QU3 A;  5C3E J;  1WKM A;  5GAE J;  1YW8 A;  2VXD A;  4WWC A;  3PUF A;  4B8X A;  2HEO A;  1SFE A;  2X6X A;  4QSH A;  5HLI A;  3JR9 A;  1QRY A;  1A36 A;  4IHY A;  2MD5 A;  3JW4 A;  2FBK A;  3SFI A;  3CMM A;  4CCM A;  2XSD C;  3JCU C;  5JVT A;  1MND A;  2L9R A;  5EG0 B;  1F43 A;  1MKM A;  2E7W A;  3BG3 A;  3T0Y A;  2CV1 A;  1LE8 B;  2PI0 A;  2EIN H;  1T39 A;  2JRM A;  2V7F A;  2FE3 A;  1FC3 A;  3JRI A;  3SZP A; 
#chains in the Genus database with same CATH homology
 1TTY A;  1XCV A;  5HLH A;  3TO7 A;  1Z6R A;  4WXC A;  3WGI A;  1P4W A;  3ECH A;  2V1D A;  1MGT A;  3GYH X;  2C6Y A;  2Q2E A;  1B9M A;  4IVN A;  1IRG A;  1ON1 A;  3C1D A;  1IXC A;  2EV6 A;  3ISP A;  1B1B A;  4FT8 A;  1LB2 A;  4R79 A;  5D4S A;  2H6C A;  3I59 B;  5LRR A;  4MEX F;  2LF7 A;  2A5Y B;  2W84 A;  5D6E A;  5LRS A;  1QZZ A;  2EV0 A;  1O57 A;  1LEB A;  3MZY A;  2KIU A;  3EUH A;  3ABU A;  4BH9 A;  1JHF A;  1IZ1 A;  4L0Y B;  3KEO A;  4UV9 A;  3MWM A;  4FX4 A;  1T6S A;  3K1N A;  1U3E M;  5LGT A;  2KJB A;  1SD4 A;  1QQI A;  1FWZ A;  3CO6 C;  3QP5 A;  1U8R A;  1J7K A;  1F5T A;  1HBX G;  3KLO A;  4GYG A;  2D2W A;  1DPU A;  3ZMS A;  2A07 F;  3BRO A;  3FXQ A;  1NHA A;  3GXO A;  3GFJ A;  4EJT A;  3KEQ A;  3MAJ A;  2R7D A;  5HS8 A;  3RTR A;  3E3V A;  3L9F A;  1H0M A;  1IF1 A;  1D8J A;  1BJA A;  2YX4 A;  4KN7 X;  3V7R A;  3M9A A;  4HW0 A;  4KMF A;  4Q4Z F;  1G3S A;  1HQC A;  3FM5 A;  5CVU A;  2PLY A;  2LDU A;  3VB2 A;  3RPQ A;  2RC4 A;  2IVM A;  5J6X A;  2K27 A;  2M8E A;  2Z5U A;  2Y0M A;  1J2X A;  2MH2 A;  4PCQ A;  3WTT C;  4H0E A;  4GYI A;  4D0P A;  1E2X A;  1T2K A;  3E5X A;  3L09 A;  1EH8 A;  1ZG5 A;  3SHF A;  1B9N A;  1EH7 A;  3HOT A;  1G3Y A;  4A0Z A;  5H20 A;  3GF2 A;  3GVA A;  2NNY A;  1B59 A;  4OMY A;  2HWV A;  3KCC A;  1GXP A;  2QLZ A;  1IUY A;  4WX9 A;  5CJ9 A;  1W5T A;  3CJN A;  3J7A O;  3TKY A;  1BM9 A;  3ZQ7 A;  2H94 A;  1FOK A;  4EJO A;  4EM2 A;  5DEQ A;  4MNU A;  1HW1 A;  2Z99 A;  3BP8 A;  1BOA A;  1HST A;  2HTS A;  2OQR A;  4IRH A;  4EGZ A;  1F9N A;  3IWZ A;  1XSV A;  2VE9 A;  2W57 A;  1J0R A;  1W4M A;  2XIG A;  5E20 A;  1HKS A;  2HTJ A;  5E1W A;  4Q47 A;  2EFP A;  3HRM A;  2BYV E;  5E8G A;  3FMR A;  4AWX B;  3DP7 A;  4HF0 A;  5K5Q A;  4A0Y A;  2FBH A;  4A0X A;  5BOX A;  1FNN A;  2WV0 A;  4KIF A;  1Z9C A;  4U0V A;  4P5O A;  2M5W A;  4BYY A;  2ISZ A;  3IWF A;  1REP C;  3U1D A;  5DUK A;  2VBZ A;  5HDN A;  2HKO A;  1OMI A;  3B73 A;  4RGR A;  4CHU A;  4NHJ A;  4ENN A;  1P4A A;  2HZT A;  3ECO A;  3V8K A;  3K2Z A;  2NAZ A;  2HGC A;  2RNJ A;  3F22 A;  4LG0 B;  2KKO A;  5DD4 A;  1D3Y A;  4BHC A;  2DQL A;  1T98 A;  1YYV A;  2HYF A;  4I0A A;  4ON0 A;  5HOO A;  3F8B A;  2ACJ A;  4DQ2 A;  1QZY A;  1K78 B;  3EET A;  3GZ6 A;  1MDM A;  3R6S A;  2H09 A;  3I5U A;  1DDN A;  1OYW A;  2IW5 A;  3WTU C;  4AIJ A;  2YPR A;  2ZKZ A;  3I58 A;  5ILV A;  1B4A A;  3ZMU A;  3R0J A;  1G3T A;  3DFG A;  2E1C A;  3T8R A;  1RZ4 A;  2O6G E;  3OV8 A;  1ZRD A;  3TDZ C;  1YS6 A;  1FBS A;  3ABT A;  1ON2 A;  4A6D A;  2D1H A;  4B09 A;  2DQR A;  1KU3 A;  2TDX A;  2HDC A;  1QO0 D;  2MLK A;  1YIO A;  2ZXJ A;  1U5T A;  3IC7 A;  2MBF A;  4LD5 A;  3TOB A;  1ZRC A;  1KQ8 A;  1AWC A;  5LEJ A;  2F5C A;  4P9U A;  4G8X A;  3QP6 A;  4RGS A;  3F6V A;  2HR3 A;  2EFQ A;  3QRF F;  2VOO A;  3HRT A;  4L5J A;  2O03 A;  4L9J A;  1MZB A;  5LGU A;  3WE2 A;  1YW7 A;  1CF7 A;  1TQM A;  3KET A;  1W7P B;  1TW3 A;  2IRF G;  5DCM B;  5BQT A;  4LLN A;  4HLX A;  1R5H A;  4I98 B;  2X4H A;  5LHG A;  2ZNZ A;  2J5O A;  4G6D A;  1IN6 A;  3P9I A;  1ONV A;  4LK1 F;  1XMK A;  5ICG A;  1E17 A;  3NRV A;  1FP2 A;  1KA8 A;  3VFZ A;  2NYX A;  4OIQ F;  3ZN1 A;  2KJC A;  3HSF A;  3OOP A;  3FM3 A;  3LWF A;  3ZMT A;  2F5E A;  3GUD A;  1D5V A;  1TNS A;  3D0S A;  2VON A;  1MJA A;  1RUN A;  5IT3 A;  3S2W A;  3ZMZ A;  5CYV A;  4IXA A;  1TQI A;  3GO5 A;  2CWE A;  1JE8 A;  1HSJ A;  4HV6 A;  4KYW A;  3EQL F;  1R7J A;  1FT9 A;  1SAX A;  2IA2 A;  2QBY B;  2A61 A;  4LGW A;  1QNT A;  5J8C A;  3QOP A;  3HHH A;  1TNT A;  3IRR A;  3F8M A;  4M74 A;  1XDS A;  1FP1 D;  5K5R A;  2FSW A;  4MTD A;  3FXU A;  1TQP A;  2R7F A;  4KUM A;  1R36 A;  3KZY A;  4OOI A;  2EFO A;  5CVI A;  4UVA A;  3JAM Z;  4HX8 A;  2CFX A;  4KT5 C;  1T0F A;  1UB9 A;  1KYW A;  4KIG A;  2EWN A;  3TOA A;  1DPR A;  2P5V A;  2UXN A;  3HTS B;  2VC0 A;  2STT A;  2XKP A;  4DNC A;  3RIR A;  5D4R A;  1YG2 A;  4O6J A;  3HSR A;  1B6A A;  4OMZ A;  2CQK A;  3DXJ F;  2UZK A;  2OBP A;  2CSO A;  3KZZ A;  3MEX A;  5HS7 A;  1P92 A;  5ICC A;  1RUO A;  1J59 A;  1I27 A;  1HXD A;  1XSD A;  2O8X A;  2XAH A;  4EVI A;  1Q1H A;  4WXH A;  3NEU A;  3W6J B;  4UHT A;  5LBQ A;  1FSE A;  5LEK A;  2CG4 A;  3Q5F A;  3I64 A;  1ZG1 A;  1HKT A;  3GEZ A;  2W24 A;  1XD7 A;  3J80 Z;  3BOQ A;  5DD8 A;  1FBU A;  2QUF A;  2G7U A;  4ENJ A;  3HUG A;  1IN5 A;  5DDG A;  5L3D A;  1BBY A;  2GA1 A;  2GQQ A;  1S29 A;  1UHW A;  1L0O C;  2XUB A;  5IT9 Z;  4L9T A;  4ZYH A;  2RV8 A;  3FMS A;  3HOS A;  1R1T A;  3WTX C;  2L02 A;  1VTN C;  1R58 A;  1KU7 A;  3BJO A;  2XVC A;  5A2Q Z;  1Y0U A;  3KFW X;  4CGZ A;  2Y75 A;  2NS0 A;  2M30 A;  2JT1 A;  2XRN A;  1IAW A;  1YQA A;  1GXQ A;  1USS A;  2D1V A;  1R23 A;  2KIM A;  5ICE A;  1LDJ A;  2P5K A;  2QEN A;  3V4G A;  1G3W A;  4IRG A;  3O3K A;  4ZYG A;  2FMY A;  2PBI A;  4KN4 X;  2F5F A;  2F5D A;  2RN7 A;  1DUX C;  2LSO A;  1BI2 A;  3E5U A;  1K79 A;  3FWE A;  2L01 A;  1P2F A;  2IJL A;  1YTY A;  3I4P A;  4PZJ A;  4RAY A;  1F4K A;  3HSE A;  3SQN A;  2ZME A;  4N0B A;  4A6E A;  1PP7 U;  1FX7 A;  1ZLJ A;  3RYR A;  1EV7 A;  2DBB A;  3F3X A;  3JTG A;  3GFL A;  3GW2 A;  3DPT A;  1LNW A;  4BQA A;  4WF2 A;  1ZYR F;  4GO1 A;  4BHP A;  3I53 A;  1R22 A;  1WRJ A;  3HRS A;  5D5V B;  2HKX A;  3T1B A;  4MHG A;  1ZG3 A;  2E1N A;  1MJ9 A;  3RDI A;  2IA0 A;  2QYO A;  2HQR A;  4CO8 A;  4YFX F;  1TLH B;  5FD6 A;  1FZP B;  2XKO A;  3RI4 A;  4KDP A;  3GWZ A;  1W7P D;  4XLN F;  3C3W A;  3MCZ A;  5ED4 A;  4EJW A;  2ZBK A;  4HYE A;  4N9I A;  2V6C A;  4HX7 A;  2GZW A;  5D8K B;  4M73 A;  1U78 A;  5HLG A;  5BPD A;  1RIO H;  5FGM A;  1XCB A;  2Z9O A;  2DI3 A;  4MQV A;  5HS9 A;  2Q0O A;  4UXN A;  3FMQ A;  4UV8 A;  1BIB A;  4M9Z A;  1OKR A;  3E6M A;  2V79 A;  1H9G A;  3F21 A;  3DKW A;  5LHI A;  3IKT A;  5HVQ C;  3RJP A;  1S7O A;  5ILS A;  5LGN A;  4U7D A;  2K02 A;  3KP4 A;  2IP2 A;  1AOY A;  4CYD A;  4I01 A;  5LHH A;  1PUE E;  3J81 Z;  3JSO A;  3TQN A;  5JR3 A;  1P4X A;  2EFN A;  4G7H F;  2YR2 A;  5D5W B;  2PJP A;  4EJU A;  5AON A;  2NRA C;  1JHH A;  1U2W A;  2FNP A;  2EK5 A;  5L3E A;  4KNY A;  4EJV A;  1LVA A;  2GWR A;  4I2O A;  4PGG A;  1I5Z A;  2XAS A;  4U88 A;  3ZMD A;  3QPT A;  2P7V B;  4OIP F;  1R5G A;  5H6R A;  3E6C C;  4MQ9 F;  1UHM A;  3I54 A;  4S05 A;  4HA8 A;  1SD5 A;  4IF4 A;  3MZH A;  4BNC A;  2K4B A;  4QWQ A;  4R8H A;  1OPC A;  2V1X A;  3HHG A;  3IL2 A;  4G7O F;  3RPU A;  4E70 A;  3JSP A;  2WC2 A;  5DCM A;  4XSX F;  1I6X A;  5F6F A;  4AVP A;  3FF5 A;  4G6Q A;  1GHC A;  1BC8 C;  1O3T A;  2OQG A;  5E8I A;  2MH9 A;  4NB5 A;  2VT3 A;  5FO5 A;  3F8C A;  2ZNY A;  1KU9 A;  3DF8 A;  1UCR A;  4M6Y A;  2K7L A;  1MJB A;  2GIV A;  2XAF A;  3E5Q A;  2FQ3 A;  2YX7 A;  2FA5 A;  3CUQ A;  2YU3 A;  2AS5 F;  2GAU A;  2OAZ A;  4ESJ A;  2QQB A;  2ZO4 A;  4ZYE A;  3NQO A;  4ENK A;  1S3J A;  3WTY C;  4OIR F;  2VXZ A;  2A6H F;  1S6L A;  2NNN A;  2DW4 A;  5HDG A;  2RVC A;  1XMA A;  5CVR A;  5CVV A;  2BEO A;  5K1Y A;  4P55 A;  2FML A;  3HRU A;  4WCG A;  3PQK A;  4M9X A;  5H6Q A;  3ZMV A;  2OA4 A;  3H3U A;  1MDM B;  1YO5 C;  2GA2 A;  2FXA A;  4HQE A;  3QPH A;  4TV7 A;  3ULQ B;  1UFM A;  1L3L A;  3SFZ A;  4JBA A;  4NQW A;  2Y48 A;  2M45 A;  1YLF A;  2CO5 A;  3GLX A;  5TJJ A;  3FXR A;  4PDK A;  3L2C A;  4L5I A;  3W6K B;  3TGN A;  2ETH A;  1O7L A;  1CGP A;  1XSX A;  4Q48 A;  4A2U A;  3T5X A;  1O7F A;  3M8F A;  1T38 A;  4P96 A;  2VOP A;  3P7N A;  3GFI A;  2R3S A;  1FSH A;  2ZJ2 A;  4FHT A;  3D5L A;  5ICF A;  1ZGJ A;  4EMS A;  2PQ8 A;  1TBX A;  3R4K A;  1S8N A;  4BAY A;  2COM A;  4CZZ A;  3QAH A;  1SMT A;  1BI3 A;  4RAZ A;  4KMU X;  2QQ9 A;  5FLX Z;  1J75 A;  2HOE A;  5D5X B;  5DUI A;  1CF7 B;  3R61 A;  2ELH A;  3I71 A;  2QWW A;  4U7B A;  3WOD F;  1ZGA A;  4LFU A;  4LJZ F;  5K5O A;  1ZRF A;  3C18 A;  2G9W A;  2XAJ A;  5IT9 K;  3E6D A;  4Y13 A;  1WI9 A;  2PMU A;  3E6B A;  2XRO A;  4GCV A;  4XSZ F;  3RYP A;  2WWY A;  6PAX A;  4EQQ A;  2OZU A;  3REO A;  1Z6T A;  4UNO A;  3P9C A;  2M1B A;  3KP7 A;  4RB0 A;  4LLG F;  1F1Z A;  4HLY A;  2VOD A;  4R1H A;  5J8F A;  1KQ9 A;  3RKY A;  1BI1 A;  3RKX A;  2VC1 A;  1KYZ A;  3LA7 A;  1G4D A;  1U6G A;  2J5P A;  4BXU A;  4L9N A;  4PGH A;  5DCF A;  3FZV A;  1P6R A;  1IXR C;  2PMH A;  5D8L B;  2L54 A;  3Q9V A;  4I09 A;  2MLG A;  4I7H A;  2JRT A;  5KVR A;  4OIN F;  3DQV C;  3RKW A;  3T8T A;  4KA4 A;  2O3F A;  2IT0 A;  1FLI A;  5DYM A;  3I59 A;  4HF2 A;  1Z91 A;  2P8T A;  2E7X A;  4IHT A;  4HX4 A;  1K6O A;  5EEH A;  2F2E A;  2L3D A;  3CUO A;  4Y17 A;  3WE3 A;  2A69 F;  1LQ1 A;  4FX0 A;  4M9S A;  1WSU A;  3P9K A;  1BC7 C;  1BI0 A;  3N97 A;  2BBY A;  2EB7 A;  1SD6 A;  2CYY A;  1ZH5 A;  4LB6 B;  4M6X A;  2LKP A;  1XB4 A;  2FNA A;  1XGS A;  2HYG D;  1SMY F;  3FHZ A;  4RB2 C;  5D5U B;  2P5L C;  2AXL A;  1YS7 A;  3PQJ A;  1ZHF A;  3U9G A;  4HF1 A;  3KP3 A;  2H27 A;  3LQQ A;  2VBW A;  2V9V A;  3GX4 X;  2QQA A;  2P7C B;  5JHU A;  3IHU A;  4IPA A;  4IRI A;  1GVJ A;  3AAF A;  4XRF A;  4HZF A;  4EM1 A;  1FBQ A;  3BJ6 A;  3R0A A;  4CDG A;  2EA2 A;  2BGC A;  2W85 A;  3HYI A;  3F8F A;  4Y15 A;  3F8N A;  4EV0 A;  1OYI A;  2G7H A;  3DEU A;  2ESN A;  2DAO A;  4WXD A;  5TRD A;  4AIH A;  3IRQ A;  4IHS A;  1IN7 A;  3KE2 A;  1OR7 A;  2DPU A;  2RGV A;  5FB2 A;  2LNB A;  4KIC A;  3DPL C;  4O5V A;  1WQ2 A;  4AIK A;  3J81 K;  3WTZ A;  1IW7 F;  2O0Y A;  3QU6 A;  3BZ6 A;  2P4W A;  4L18 B;  2JPC A;  4YFK F;  1H9T A;  2CGP A;  3VOD A;  2K86 A;  3HIF A;  4ZZD A;  3BJA A;  3FX3 A;  3HTU A;  4IJA A;  4RGU A;  1YW9 A;  1V4R A;  1JXS A;  3TO9 A;  5L3C A;  2FEZ A;  4RGX A;  1I1G A;  2DPD A;  2WTE A;  2DU9 A;  3MQ0 A;  1R1V A;  3ERE D;  4U0W A;  1J9I A;  4G7Z F;  3F6O A;  3M8E A;  2FRH A;  4Z2Y A;  4A5M A;  1FYM A;  4GXO A;  4RB1 A;  3SXY A;  1Z1D A;  4M72 A;  3C7J A;  2QM3 A;  1W5S A;  5L3B A;  4M71 A;  3K1P A;  3VEP A;  1ULY A;  1FY7 A;  1ZAR A;  4ZZL A;  2BV6 A;  1KQ0 A;  3K0L A;  3COA C;  3PFI A;  2L4M A;  1O3R A;  4BHB A;  2EFW A;  2ZME B;  4G9Y A;  4YII A;  4KIB A;  4LMY A;  5L3G A;  4HQM A;  4MEY F;  1LDD A;  4I02 A;  3WGG A;  5E18 F;  3TDU C;  1KU2 A;  5L3F A;  3EYY A;  2RDP A;  2QVO A;  4LG0 A;  2UWM A;  2XAG A;  4MTE A;  5BS6 A;  4CXF A;  4UUV A;  3WTS C;  5ILU A;  1DP7 P;  4ZYD A;  4HDV A;  1K78 A;  2A6E F;  2MC3 A;  3I0T A;  1EH6 A;  2P6T A;  4JK1 X;  4O3M A;  4LK0 F;  2EA4 A;  1ZAO A;  2KIF A;  3M7G A;  2XGX A;  2BE5 F;  2IPQ X;  2A68 F;  4F7Z A;  1O3S A;  2PFB A;  3L00 A;  4ZH4 F;  2YSR A;  1UST A;  4CIC A;  3CLO A;  2VE8 A;  2FBI A;  2GXG A;  1K7A A;  3WG9 A;  3B02 A;  4LLL A;  2PG4 A;  1FYL A;  5FFX A;  3VOE A;  1IRF A;  4OIO F;  1A04 A;  1YFH A;  4ETS A;  3LA2 A;  4HOB A;  1PP8 F;  3Q9S A;  1PDN C;  4ESB A;  2DTR A;  5D6F A;  4P9F A;  5E1Z B;  4EGY A;  1R00 A;  2EJR A;  2FOK A;  2PN6 A;  2JTV A;  2LF8 A;  1BN5 A;  1QBJ A;  1IXS B;  3ROU A;  1SFU A;  4Q5S F;  1FYK A;  2VBY A;  1W7P A;  4ESF A;  1D8K A;  3V7S A;  3H92 A;  3WU1 B;  4U0Y A;  2HFH A;  2Z3Y A;  3F72 A;  5BPI A;  3JTH A;  1QPM A;  5EEG A;  5JFR A;  1G6N A;  4YFN F;  2JSC A;  2JPB A;  5FFZ A;  2ADU A;  3H3Z A;  3EYI A;  2FF4 A;  2UXX A;  3CUQ C;  3O2P E;  4UVB A;  3EDP A;  1TW2 A;  1LJ9 A;  1O3Q A;  3CDH A;  1U5T C;  4XBF A;  2H6B A;  4YG2 F;  3WU0 A;  3V8L A;  2XV4 S;  1S7A A;  1JGS A;  2Z33 A;  4ASN A;  5FLX K;  1XGO A;  3KLN A;  3WTV C;  1RI7 A;  4L0Z B;  2X0L A;  2DFI A;  4HBL A;  1LDK B;  3SZT A;  3KP5 A;  4MGR A;  2K4J A;  2DO7 A;  3BDD A;  2A3S A;  4KFC A;  1RNL A;  1MD0 A;  1WWX A;  3BPV A;  1IN8 A;  4XLP F;  1XGN A;  1OYY A;  2XAQ A;  3WTW C;  5FD5 A;  2RQP A;  1IN4 A;  2HQN A;  3CO7 C;  2QBY A;  2QZ8 A;  5HDK A;  4N9H A;  3BWG A;  3LFK A;  4OU0 A;  3JAM K;  2B0L A;  2W25 A;  3LQR A;  3K9T A;  5JI6 A;  4HDU A;  5F1R A;  2DT5 A;  4S04 A;  3GFM A;  1ZN2 A;  3R60 A;  1KGS A;  5CVJ A;  1X3U A;  4A12 A;  1BIA A;  4K2E A;  2O61 A;  4LB5 A;  5DV5 A;  3ZN0 A;  3G3Z A;  4QLC U;  2DK8 A;  3BY6 A;  1HKQ A;  3M1E A;  2GXB A;  4HAM A;  3CUQ B;  2HS5 A;  2Q8K A;  3MFK A;  1ODD A;  5CLS A;  2ZCW A;  3CTA A;  1U5T B;  3V7C A;  4G94 A;  1XDU A;  2FU4 A;  5E1X A;  1R1U A;  2L4A A;  2EV5 A;  3E97 A;  1SD7 A;  3V8J A;  1FPQ A;  3BPX A;  3LAJ A;  3ML6 A;  2VT2 A;  3K1M A;  1Z7U A;  2DLL A;  2JZY A;  3J80 K;  1SFX A;  4JQF A;  1V3F A;  3ZP5 A;  2OZ6 A;  3GZ5 A;  3ELK A;  3K69 A;  5ERI A;  2P6S A;  3DV8 A;  1C0W A;  3G73 A;  4RS8 A;  2IA1 A;  1XGM A;  4HV5 A;  3WGH A;  1LEA A;  3KP2 A;  3U2R A;  4EM0 B;  2V1U A;  3LST A;  2M87 A;  2RKH A;  5LLQ A;  1ZLK A;  2VBX A;  1HW2 A;  2D45 A;  5A2Q K;  4UVC A;  4YIF A;  5AIQ A;  4WK8 F;  2ESH A;  3L7W A;  3KP6 A;  1XN7 A;  1ZRE A;  5BMZ A;  1STZ A;  1Z05 A;  3F23 A;  3ZPL A;  2ISY A;  3O6B B;  5F64 A;  2ZFW A;  4L9V A;  4AD9 A;  5KK1 A;  1I1S A;  4ENM A;  2XHK A;  3N4M A;  1HW5 A;  1QGP A;  2MA3 A;  3LAP A;  2PEX A;  2KRF A;  2CW0 F;  2OU2 A;  4I0B A;  2DK5 A;  2OD5 A;  3LA3 A;  5E17 F;  3TO6 A;  4A5N A;  3IKV A;  5AIP A;  2VN2 A;  2STW A;  1J5Y A;  4RB3 C;  4GGG A;  3QU3 A;  1WKM A;  4WWC A;  1YW8 A;  4B8X A;  2HEO A;  1SFE A;  5HLI A;  2MD5 A;  3JW4 A;  2FBK A;  5JVT A;  1MKM A;  2E7W A;  3T0Y A;  2PI0 A;  1T39 A;  2FE3 A;  1FC3 A;  3SZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...