2HDCA

Structure of transcription factor genesis/dna complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*GP*CP*TP*TP*AP*AP*AP*AP*TP*AP*AP*CP*AP*AP*TP*AP*
publication title Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein/dna
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1999-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hdcA00
3PFIA 1MJBA 3I71A 2D1HA 3DKWA 3RPQA 4JBAA 1U78A 3E6CC 5HLIA 3ZMUA 2ISZA 4RB2C 1L0OC 2IVMA 2IP2A 1YG2A 1GVJA 2QENA 4M9ZA 2XAGA 4LG0B 2HGCA 2GA2A 2JPCA 1ZARA 2CGPA 2FA5A 1IRGA 2MH9A 2DK8A 4ON0A 1XCBA 2OA4A 3T1BA 3V8LA 4MTDA 1V4RA 5D4RA 3BOQA 2GA1A 3WTXC 3GW2A 2V1XA 4YFKF 2FXAA 3I5UA 2CO5A 5K5OA 3BJOA 4AD9A 1ZLKA 2QUFA 3KP2A 1XMAA 1D8JA 4L9TA 2M1BA 2IW5A 3RKWA 4IRHA 2D2WA 2RVCA 4S04A 1I5ZA 4GCVA 2G7UA 5CVVA 2BYVE 3FX3A 2W24A 3K1NA 1KQ8A 2HTSA 5EEHA 3QRFF 3I58A 2EV5A 3JSOA 2VT3A 5L3EA 1JGSA 1XSXA 1EV7A 2FRHA 2G7HA 1LNWA 2FU4A 4LLNA 4UHTA 1OYIA 2RNJA 2Q0OA 4UNOA 3DPTA 3E6MA 4G7OF 3I59A 3HRMA 4P96A 1O7LA 1P6RA 3I53A 3V7SA 4H0EA 5ILUA 4HQEA 5AONA 1ZYRF 2IA0A 4UVBA 2P7VB 3CTAA 2DFIA 1HSTA 3MWMA 4B8XA 4WXHA 4HOBA 3M9AA 3F8CA 1XB4A 4GYIA 4MEXF 4G8XA 2Z5UA 4I98B 2VBWA 2L02A 1TW2A 3RJPA 1HKTA 2VXZA 1FBQA 3E5XA 4L9JA 2NNYA 1SFUA 3KEQA 1TW3A 2M8EA 1YQAA 2XUBA 3DFGA 4AIJA 4EJVA 4ZYGA 4LMYA 3RYPA 3WTVC 1W4MA 3BWGA 2EV6A 3DPLC 2OU2A 4Y15A 1QZYA 4N0BA 1FWZA 5CLSA 3EUHA 3LQQA 1O57A 1LDDA 2FBIA 2H94A 5LBQA 3GZ6A 3GVAA 3K9TA 2OQRA 2VONA 2MD5A 2K7LA 3E5UA 2LDUA 2K02A 2XRNA 3V4GA 4A0YA 3ISPA 3F3XA 1SMYF 4JQFA 2DAOA 2F5CA 3JTHA 2RQPA 2ETHA 4FT8A 4K2EA 4KDPA 1ZAOA 4P9FA 3GFMA 2FOKA 4HQMA 3WGIA 3EETA 2Z33A 1WI9A 1FC3A 1R22A 2H09A 1P4WA 4MTEA 5BQTA 4I0BA 4U7BA 3K0LA 3HSRA 1JE8A 4HF2A 4WX9A 3ZN1A 1X3UA 4KN4X 1U8RA 4JK1X 1DDNA 3W6JB 2X4HA 4KIGA 2IJLA 1FYMA 2A6HF 1BJAA 2STTA 2P6SA 4YFNF 1K78B 2XV4S 3F23A 4ZH4F 3WTSC 1MZBA 1WSUA 1T0FA 1DP7P 1SD5A 5F6FA 4ZZDA 2RC4A 1FYLA 4QLCU 2EK5A 2QQBA 3MZYA 4UUVA 1MD0A 2F5EA 3M8FA 3WTZA 1C0WA 1TNTA 3V7CA 1H9TA 1FZPB 4NQWA 3J80K 1XCVA 1YS7A 2XAJA 5D5WB 3ECOA 5TRDA 5D5XB 1U5TC 4XRFA 3SQNA 3LSTA 1ZGAA 3GWZA 2A07F 1ZRCA 2KJCA 4HV6A 2VE8A 3S2WA 1FLIA 1UHWA 1ZRFA 1TQPA 1KQ9A 1G3YA 2L4AA 2CFXA 1LJ9A 3U9GA 4EJUA 3P9CA 1XN7A 3AAFA 1ON1A 1IAWA 3IRQA 3ML6A 1Z91A 4DNCA 2HFHA 4OIQF 2PJPA 4A6EA 1FP1D 5HLHA 2GXGA 3WGHA 3F22A 3FMSA 3REOA 2FMYA 2FMLA 4UXNA 5DCFA 1QQIA 1U5TA 3EQLF 1A04A 1YYVA 5FFXA 2FQ3A 1IF1A 2Y75A 4LD5A 4U0YA 4MQVA 1W7PA 3HUGA 2OZ6A 2E1CA 4L9VA 3LFKA 3R60A 3SZTA 3CUQA 2QYOA 1Z6RA 4G6QA 4LLGF 5H20A 3SFZA 2IRFG 5A2QK 2KIUA 1Q1HA 1YW7A 2HTJA 2JRTA 1RIOH 3ABTA 4L0ZB 2VBYA 3GF2A 1OYWA 2VBZA 2VN2A 4L9NA 4LK0F 2Y48A 5HDGA 2YR2A 3CJNA 3M7GA 3ZMTA 4D0PA 5D6FA 1PDNC 3KE2A 1S6LA 5HVQC 2P5KA 2NS0A 5KVRA 1EH8A 4PGGA 4OMYA 4PZJA 4A0ZA 2ZJ2A 3QAHA 1JHHA 2O3FA 1R36A 2Z3YA 1T39A 3BP8A 4R1HA 4OOIA 1XGNA 5E8GA 1W5TA 2OD5A 4UV9A 3QPTA 1ZLJA 3CUOA 4KFCA 1HW2A 5LRRA 1FP2A 5L3CA 2ZXJA 1YTYA 2COMA 3COAC 3KLOA 5J6XA 1KU7A 4G9YA 1J0RA 2ESHA 3IC7A 1R7JA 2EFWA 4MNUA 2HR3A 2RV8A 3J80Z 1YIOA 2R7FA 4L5IA 1P2FA 5CVUA 2ZMEA 3DF8A 5E1WA 1T2KA 3HHHA 3LAPA 2W85A 3DQVC 2HYFA 1IN4A 3ABUA 2QM3A 4GXOA 3GO5A 3V8KA 3PQKA 3E5QA 3U1DA 4M71A 2QQ9A 1ULYA 1KGSA 2C6YA 1IN7A 4L18B 2HOEA 3VOEA 2EFOA 2NYXA 3TKYA 1GXQA 2OZUA 4EVIA 2BBYA 4Y13A 1P4XA 1JHFA 2XKPA 3JAMZ 1JXSA 1MDMB 3VB2A 2PMHA 4M9SA 1P92A 1IUYA 5HS9A 3IWFA 4OMZA 1IZ1A 5IT3A 3KLNA 2AS5F 2FBKA 5EEGA 1FNNA 3F6OA 5CYVA 4IXAA 4A0XA 4WXDA 2UZKA 5A2QZ 1PP8F 4LB5A 1USTA 2HQRA 5ED4A 5HS7A 3RPUA 3GZ5A 1UHMA 2WV0A 4N9HA 1E2XA 3TDZC 3BY6A 3IKTA 1H9GA 3R6SA 4RGRA 1GXPA 4M6YA 5JR3A 2OBPA 3HIFA 1F9NA 2E7WA 3I54A 3U2RA 4BNCA 1ONVA 3ERED 4ENMA 4ESBA 1IXSB 1LDJA 4RS8A 2DBBA 2YSRA 3IL2A 2L3DA 1RUNA 3GXOA 4PGHA 3FXUA 3WE2A 2XVCA 3WTTC 3TGNA 2CWEA 1SFEA 2F2EA 3C1DA 3RYRA 4EQQA 2BEOA 2EV0A 3IKVA 4WCGA 1IN8A 4BXUA 3WTWC 3VODA 2ZNZA 2HKXA 2MA3A 4IVNA 3B02A 3JTGA 1XSVA 5E8IA 2VC0A 2W84A 3BJ6A 4I2OA 4UVCA 3LAJA 1O3TA 1SD7A 2F5FA 2EFPA 2E1NA 2A68F 3T5XA 1KA8A 1R23A 3ZMDA 4Q48A 2J5OA 4N9IA 4XLPF 4ENKA 5E17F 4HX4A 2BV6A 4E70A 3D5LA 1B4AA 5F1RA 1U6GA 2DQRA 3WODF 4EM0B 4I09A 1EH7A 2H6CA 3BZ6A 2ZCWA 3B73A 4ZYDA 5DV5A 3HRUA 5L3GA 1VTNC 3T0YA 2XGXA 1TTYA 3GFJA 3MFKA 4MEYF 2YU3A 4WWCA 2QBYA 2PMUA 2R3SA 2KJBA 3I59B 4EM2A 1XSDA 4RB1A 1ZG1A 2A6EF 2VBXA 5AIQA 3IRRA 5DYMA 4YFXF 2W57A 5ILSA 1S3JA 4LFUA 2UXXA 3FF5A 3KP5A 4A5NA 3KP7A 1QZZA 3BROA 3V8JA 2Q2EA 4OU0A 3BJAA 3EDPA 3F8FA 2ZFWA 5JVTA 1QO0D 2KIFA 5LLQA 1OPCA 2PQ8A 4ETSA 1IN5A 3GLXA 4RB0A 1J5YA 5CJ9A 5DD4A 3KP6A 3FXRA 1TQMA 2FEZA 4LLLA 2L54A 1HQCA 4HYEA 4CZZA 1CF7A 5BPDA 3HYIA 3FWEA 2LNBA 1ON2A 2Q8KA 2HQNA 1BIAA 2XAFA 3KEOA 4AVPA 4Z2YA 5JHUA 4RGXA 3C18A 1SD6A 1U2WA 4RB3C 4ESFA 2XASA 1R1TA 1I1GA 2GQQA 4XSXF 2YX7A 3O3KA 1IXCA 3FHZA 3M1EA 2QZ8A 4HDVA 5HDNA 4BAYA 1D3YA 1BIBA 2P5VA 3F8MA 3KETA 3J81K 5JFRA 1O7FA 5H6QA 4I01A 4PCQA 2VODA 5IT9K 4GYGA 4LJZF 1Z05A 4IPAA 5LRSA 1O3RA 2A69F 2KKOA 2EA4A 3E97A 2WWYA 3O2PE 2YPRA 5ICCA 2P4WA 2PBIA 4Q47A 2B0LA 3J7AO 1MJ9A 3NRVA 1EH6A 3FMRA 1BBYA 2QQAA 2MC3A 3DP7A 2CW0F 1I1SA 2FNPA 5LEJA 1Y0UA 3L9FA 1YFHA 1QNTA 1FBSA 5LGNA 1ZHFA 1FOKA 4M9XA 2HEOA 3SZPA 4WF2A 3TDUC 2PLYA 4GO1A 2ZBKA 5BMZA 5FLXK 4RAYA 3HHGA 1HKQA 2LF8A 3MZHA 4O6JA 4EJTA 2OAZA 4HV5A 4XSZF 4PDKA 3OV8A 4P55A 4Q4ZF 1WRJA 2MBFA 1ZGJA 4WXCA 3TO6A 3N4MA 1HSJA 3LA3A 2NRAC 1MGTA 5DUKA 3VEPA 3LQRA 2VC1A 4CDGA 1TNSA 4YIIA 4BHBA 3VFZA 3TO9A 1O3QA 1SAXA 4KIBA 5ICEA 3RTRA 1BN5A 3L09A 1J9IA 1R58A 3GFLA 2CYYA 5LEKA 5LGUA 1HBXG 2K27A 2ESNA 1LQ1A 4A5MA 2MLKA 4IJAA 5KK1A 2PI0A 5DCMA 5ILVA 2HZTA 3K1PA 1QPMA 3QP5A 1S29A 3G73A 4KYWA 1FSHA 4CHUA 3EYIA 1R00A 4O5VA 5LHIA 2CG4A 4MQ9F 3CDHA 2PFBA 3K1MA 5D5VB 1G3WA 5FGMA 1S7OA 3CO7C 2G9WA 2KIMA 1XGSA 4ESJA 3N97A 5CVRA 1XDUA 2IA1A 4MGRA 3QU3A 1XD7A 4OIRF 4A12A 1HW5A 2PG4A 5BPIA 3H92A 4ENJA 5E20A 4HDUA 2EJRA 3P9IA 4S05A 5E1ZB 1WWXA 1K7AA 4AIKA 3HRSA 2JZYA 3J81Z 2O61A 3C3WA 4IHSA 1W7PD 1KYWA 4MHGA 5IT9Z 4DQ2A 2RDPA 5DEQA 4LG0A 4I02A 4R8HA 1YW8A 1XGOA 1W7PB 2K86A 3BDDA 1USSA 1LEBA 5K1YA 3DXJF 4LB6B 2KRFA 3CUQB 3K2ZA 2IT0A 2XIGA 3NEUA 2M87A 3MAJA 3HSEA 1K6OA 3L7WA 3R61A 4KMFA 3ZMZA 3H3ZA 1IXRC 1ZH5A 2LSOA 3NQOA 4UV8A 1I6XA 2BE5F 1SD4A 5JI6A 1RI7A 5ERIA 2V6CA 3TO7A 5FFZA 2LF7A 2ELHA 3PQJA 1KU9A 2F5DA 4KA4A 3KZYA 1LB2A 4YG2F 4ENNA 1ZREA 1V3FA 4RGUA 5K5RA 1QGPA 3L00A 4U0WA 1Z9CA 1B9NA 1GHCA 2K4JA 2V1DA 3GFIA 1P4AA 2NNNA 2JPBA 1XGMA 3HTUA 5F64A 2DQLA 1B1BA 3MEXA 1ZG3A 2GAUA 2OQGA 2WC2A 4F7ZA 4XBFA 2A3SA 1B6AA 4WK8F 1S7AA 3T8TA 1BI3A 5DD8A 4OIOF 3WG9A 3ZMSA 2RN7A 4HLXA 1PUEE 2ADUA 3ELKA 1L3LA 1FPQA 4U0VA 3Q9VA 3KCCA 2DTRA 1OYYA 2ZMEB 3C7JA 2RKHA 5L3DA 3RIRA 5H6RA 2ACJA 1FBUA 3SHFA 4HA8A 1WKMA 4ZYHA 5HOOA 3BPVA 3LA7A 4RAZA 5L3FA 2FBHA 3SXYA 1TLHB 1R5GA 2FSWA 2AXLA 2D1VA 1FX7A 3ZMVA 2EA2A 1KQ0A 5D8KB 4KNYA 3I0TA 3MCZA 2DPDA 1CGPA 4YIFA 4L0YB 3GUDA 4HX7A 1T98A 2O0YA 2DO7A 3V7RA 4EJOA 1FYKA 1F5TA 3FM5A 2M5WA 2M45A 5DDGA 2EFQA 3FMQA 2UWMA 2ZO4A 4BHCA 4KN7X 3O6BB 4EMSA 1G3SA 2GXBA 4HZFA 1R1VA 4EM1A 1PP7U 5D4SA 5K5QA 2V79A 1QBJA 4CYDA 3KP4A 5CVIA 5HDKA 1RZ4A 5FD6A 4G6DA 1F1ZA 1R5HA 4Y17A 4IRIA 1S8NA 2TDXA 2XROA 3TOBA 5FD5A 3H3UA 2GIVA 3BPXA 2HKOA 3FM3A 2H6BA 2K4BA 4KIFA 3GX4X 3P7NA 1ODDA 4M74A 2FF4A 4KT5C 5HLGA 1B9MA 1RNLA 3WE3A 3CLOA 3HRTA 4I7HA 4NB5A 4M6XA 3R4KA 3GYHX 3DEUA 3DV8A 5LHGA 1FT9A 1YLFA 2DK5A 2MLGA 4UVAA 5E18F 2XKOA 3RDIA 1YW9A 2V1UA 3JSPA 1Z7UA 2H27A 4FX0A 1F4KA 2DPUA 4OIPF 2ZKZA 1IN6A 4FHTA 2FE3A 2JTVA 3ULQB 4HX8A 3KZZA 2EFNA 1BI0A 3F21A 5D6EA 2A61A 4R79A 3F8NA 3Q5FA 1TQIA 4CGZA 3FXQA 2QVOA 2STWA 1OR7A 1K78A 3P9KA 4EGYA 1KU2A 1U3EM 1WQ2A 5BS6A 1LDKB 3ECHA 1D5VA 1SMTA 3I4PA 4OINF 2PEXA 4A6DA 1MJAA 1G4DA 5FB2A 3T8RA 1ZRDA 3F72A 2QLZA 3LWFA 1W5SA 2QWWA 2V9VA 5J8CA 1ZN2A 4L5JA 2L01A 4LGWA 3F6VA 4HAMA 1E17A 1T38A 4I0AA 3E6DA 2CQKA 4GGGA 1DPRA 3TOAA 2P6TA 3RKYA 3QOPA 2GWRA 1G3TA 2EWNA 4EV0A 3E3VA 3IHUA 1BC7C 2QBYB 2XHKA 3WTYC 1TBXA 6PAXA 1YO5C 1REPC 3OOPA 1HKSA 4KMUX 4EGZA 1XDSA 1FY7A 4HW0A 3CO6C 3MQ0A 1XMKA 4ZYEA 3KFWX 4KUMA 3QP6A 1UB9A 1BI1A 1R1UA 2DLLA 5TJJA 1T6SA 2Z99A 4AWXB 4G7ZF 2IA2A 2J5PA 4NHJA 2WTEA 1AOYA 2HYGD 4M73A 2HS5A 1H0MA 2IPQX 3KP3A 2A5YB 2VOOA 3ZPLA 4CXFA 1BOAA 1LVAA 3I64A 5DUIA 2GZWA 1K79A 2E7XA 4U7DA 5LHHA 3W6KB 1CF7B 4BYYA 4LK1F 3R0JA 4G94A 3M8EA 1J75A 1ZG5A 2XAQA 5FO5A 3LA2A 1I27A 3CUQC 2DW4A 5ICFA 2HWVA 2HDCA 4U88A 1NHAA 2XAHA 1BC8C 4FX4A 1YS6A 3EYYA 4BH9A 1FSEA 2P7CB 4B09A 4IHTA 2ZNYA 5L3BA 3D0SA 1D8KA 2VT2A 3QU6A 1MKMA 2BGCA 1UCRA 3FZVA 3RKXA 1J2XA 2L4MA 3JAMK 1IW7F 1J59A 1O3SA 2DI3A 4O3MA 5HS8A 5LGTA 1OMIA 2X0LA 1B59A 4CO8A 5ICGA 4BQAA 4ZZLA 2P5LC 3ZQ7A 2EB7A 4HF1A 2PN6A 1IRFA 4QWQA 4BHPA 2VE9A 5D8LB 4CICA 3L2CA 5BOXA 3RI4A 3ROUA 2ISYA 2JT1A 3GEZA 3G3ZA 4HBLA 3HOSA 2VOPA 5J8FA 1AWCA 3R0AA 3ZN0A 1BI2A 4Q5SF 3Q9SA 4ASNA 3E6BA 1DPUA 5AIPA 1HXDA 4A2UA 3WU0A 3IWZA 2NAZA 3K69A 3ZP5A 2RGVA 2Z9OA 4XLNF 2O6GE 1OKRA 1J7KA 2D45A 4TV7A 4HLYA 3TQNA 1KU3A 3HOTA 1U5TB 1HW1A 2DT5A 2DU9A 3HTSB 1UFMA 4HF0A 1KYZA 4EJWA 2UXNA 4IRGA 4G7HF 3WU1B 2LKPA 1MDMA 2JSCA 3F8BA 3WGGA 1Z1DA 3QPHA 2P8TA 5DCMB 1SFXA 4RGSA 2O8XA 2W25A 2CSOA 5D5UB 3WTUC 2O03A 1DUXC 2Y0MA 2R7DA 1LEAA 3JW4A 5FLXZ 2YX4A 4KICA 4M72A 4P9UA 1BM9A 4P5OA 2FNAA 2M30A 4AIHA 1RUOA 1STZA 1G6NA 2MH2A 5CVJA 4IF4A 1Z6TA 3HSFA 5E1XA
chains in the Genus database with same CATH superfamily
3PFIA 1MJBA 3I71A 2D1HA 3DKWA 3RPQA 4JBAA 1U78A 3E6CC 1X19A 3LFUA 3OIOA 5EF6A 4Y33A 3QWLA 5HLIA 2R5YA 2EINH 3MZ8A 4MIMA 2NOGA 3ZMUA 2DA6A 1IUFA 5H2FC 2COBA 4RB2C 1L0OC 2ISZA 1NK2P 2IVMA 2IP2A 4XLAA 3A1YA 1YG2A 4CUGA 1GVJA 1GUUA 2QENA 4M9ZA 2MW8A 4E7SA 2XAGA 5K7HA 4LG0B 1OCOH 2HGCA 1MBHA 3FK6A 2GA2A 3IH3A 2DTZA 2JPCA 2F5VA 1ZARA 2CGPA 4XLFA 2FA5A 3ZQIA 1MBEA 1X1PA 1IRGA 3JRCA 3HPGA 2MH9A 2DK8A 4ON0A 1R5ID 5JVGF 2BHYA 1OCRH 1XCBA 2OA4A 3T1BA 4NC7A 3V8LA 4MTDA 1ENHA 3EUAA 2DMPA 1V4RA 5D4RA 3BOQA 1P7IA 4XKCA 2GA1A 5EYRA 2A5WA 4RAFA 1OCZH 3WTXC 4A93J 3GW2A 2V1XA 3TBIA 1HLVA 4YFKF 5F1JA 5FJ8J 2VKHA 3VPRA 2HXIA 2ZJPF 2FXAA 1TWHJ 3OYKA 3HOUJ 3I5UA 4JX5A 2CO5A 5K5OA 3BJOA 1YI2I 1X1BA 4AC0A 3OYBA 3K7AJ 4AD9A 1ZLKA 1K83J 2QUFA 4PSXA 3KP2A 3CCMI 1XMAA 3G1OA 1E0EA 2WAFA 2LRDA 5FKMA 2BW3B 3AL0C 1D8JA 4L9TA 3PO2J 3QYBA 2L9NA 2IW5A 2M1BA 2QKMB 3RKWA 4IRHA 2D2WA 1W1WE 2RVCA 4S04A 3CLQA 1FMWA 3TP0A 5FRMA 1I5ZA 4GCVA 2G7UA 3AKZA 3HZJA 5CVVA 4F3QA 3L2QA 3HXLA 2LY9A 2BYVE 3FX3A 3U21A 2W24A 3AG1H 4AYBA 1ETYA 2KFDA 3K1NA 1T08B 1Y6IA 1KQ8A 2HTSA 5EEHA 2QGUA 3QRFF 3I58A 4BDYA 2EV5A 3JSOA 1LUJB 3S8PA 2VT3A 5L3EA 3CMMA 4ZDPA 1JGSA 4A3EJ 1YIJI 1XSXA 1EV7A 2IGOA 2FRHA 2G7HA 4XRMA 5F0HA 1ZGWA 1LNWA 2AXTC 2F4OB 2LLKA 2DN0A 2CRGA 2FU4A 4X0GA 4CCMA 4LLNA 2WV1A 4UHTA 1OYIA 3ZXSA 2RNJA 4AUXA 2Q0OA 4UNOA 3DPTA 2CU7A 2LR8A 3E6MA 4G7OF 5FKLA 1XTAA 4DYRA 3S1MJ 3I59A 4XLCA 4GDFA 4QIWN 1FJLA 3HRMA 4P96A 1O7LA 3V42A 1P6RA 3I53A 3LSMA 3V7SA 4H0EA 1EJ9A 1SFKA 5ILUA 4HQEA 1BW5A 3QPSA 2R93J 3FK7A 4IEJA 5AONA 1ZYRF 3H35A 1A35A 1TWGJ 1JUMA 3LSPA 2IA0A 2E2JJ 4UVBA 3BLYA 2P7VB 1F36A 4E7ZA 2VLAA 2IGMA 1X2MA 3CTAA 3TEDA 2DFIA 1HSTA 4A3IJ 3MWMA 3ABLH 2H1LA 2VQCA 1VF9A 4B8XA 3HDDA 3KZIC 3G6EI 2M7AA 3DLAA 3HC7A 4WXHA 1R6RA 2EZLA 5J47A 1IV6A 3HBLA 2Y31A 4HOBA 3FIWA 3LMMA 3M9AA 1OCTC 3BQYA 3F8CA 1XB4A 4GYIA 1ZELA 4XN0A 4MEXF 4G8XA 2Z5UA 2EIJH 4I98B 2JA6J 2VBWA 3PNTA 4M6VA 4CA0A 4ITVA 4NNJA 2L02A 2ZJRF 1TW2A 2K3PA 4H4KC 2LD5A 3RJPA 3S3MA 1ZQ3P 1HKTA 2VXZA 3PL8A 1EA3A 2E2IJ 1FBQA 1FOYA 3E5XA 3C2GA 4L9JA 2CQQA 3A4CA 3OS1A 2NNYA 3KEQA 1SFUA 2DOFA 2DYRH 3X2QH 1TW3A 4NDLA 2M8EA 4HSRA 1APLC 1YQAA 2XUBA 4D9JA 5HNHA 3MD2A 3L2WA 3DFGA 4AIJA 4EJVA 4XORA 4ZYGA 4LMYA 3RYPA 4YELA 3WTVC 1W4MA 2XF5A 4IHVA 1MMAA 3BWGA 2EV6A 5B1BH 2DT6A 4M3EA 4IOAF 3DPLC 5KAFC 5FKKA 2OU2A 4LG3A 4Y15A 1QZYA 3BR1A 4LITA 4N0BA 3O8GA 1FWZA 2HVSA 5CLSA 1Z3YA 4HEA2 3EUHA 3LQQA 1O57A 2Y9YA 4G6TB 1N77A 4ZC3A 1LDDA 2FBIA 2H94A 4FISA 4IL6C 5LBQA 3GZ6A 3GVAA 1MBJA 3H9JA 4ABZA 3K9TA 2OQRA 2VONA 2DOEA 2MD5A 2GLOA 2K7LA 3E5UA 3WHCA 2LDUA 2K02A 2XRNA 3V4GA 4F55A 3KYLA 1JI8A 1T0FC 1Z0XA 4A0YA 5J4YA 2VUMJ 5EZHA 3ISPA 3LSKA 2DXIA 3F3XA 1SMYF 4JQFA 1BR4A 2DAOA 4KITB 2F5CA 3JTHA 4F93B 3FBIB 2RQPA 2ETHA 4FT8A 1K4TA 3OR2C 3M4OJ 4K2EA 1XG1A 4KDPA 1ZAOA 4P9FA 3GFMA 2FOKA 4HQMA 2CV0A 3WGIA 5B5EC 3EETA 2K40A 4L5EA 2Z33A 2XF6A 1WI9A 5EJCA 1FC3A 1R22A 2H09A 2NS8A 1P4WA 4MTEA 5BQTA 2LBFA 2ZJQF 4I0BA 1RKWA 3PIOF 4U7BA 5IOYA 3K0LA 3HSRA 3AG4H 4RM2A 2HQAA 1JE8A 1YJ9I 4HF2A 5M5WJ 4WX9A 3ZN1A 4IHWA 4QPQA 2K9NA 2O9LA 1X3UA 4KN4X 1U8RA 4JK1X 1DDNA 4BS9A 1YJNI 3W6JB 5GAHJ 2X4HA 4KIGA 2IJLA 3AG2H 3FXMA 5FLVA 3M3YJ 1FYMA 1FEXA 1WGXA 2A6HF 1BJAA 2M0MA 2XPVA 2P6SA 2STTA 4YFNF 1K78B 1TP4A 2LTPA 2XV4S 3M8JA 3F23A 4ZH4F 3WTSC 1MZBA 1WSUA 1T0FA 2QSHX 3FKIJ 3KIOA 2OV7A 5IP6A 1DP7P 2E36A 3HGYA 4PSWA 2PMZN 4XIDA 9ANTA 3ABMH 2WA0A 1B72A 1VQ9I 1JGGA 2L0KA 1SD5A 5KAIC 3CCVI 5F6FA 2EILH 4ZZDA 2K85A 1YOVB 2HPIA 2RC4A 3UKGA 2W48A 5FKOA 1FYLA 4QLCU 2EK5A 2QQBA 1DGWY 3MZYA 3U1KA 1Y8RB 4UUVA 1MD0A 5IYBJ 3JRAA 2F5EA 3M8FA 1S5LC 3WTZA 1BJZA 3HPHA 3IH4A 2K9MA 1JKOC 1NH3A 3GTMJ 5KHDA 2R0QC 2DA2A 3LSIA 1HF0A 1C0WA 2L7MP 3HEFA 3Q0VA 3TW7A 1TNTA 2FOWA 3V7CA 1H9TA 1BW6A 2ID6A 1VFCA 1FZPB 3QPLA 1MSFC 4NQWA 2PJRA 3J80K 1K6YA 1X2NA 2DODA 1XCVA 1YS7A 3GTPJ 3M1CA 4F52A 3QQAA 2XAJA 5J1YA 5D5WB 3WHBA 3ECOA 5TRDA 3BTJA 2YUSA 3CESA 5D5XB 1U5TC 1JT6A 3S93A 4XRFA 3SQNA 3LSTA 1ZGAA 3GWZA 2VJ4A 2A07F 3P5JA 1YHQI 3DCFA 1AKHA 1ZRCA 2KJCA 4HV6A 3W6VA 4DJAA 4PJMA 5M5YJ 4W1UA 2VE8A 3S2WA 1FLIA 3BR2A 1UHWA 2X6WA 2CQ7A 5F08A 2CV1A 1ZRFA 1TQPA 1KQ9A 1D1AA 1G3YA 2L4AA 4RLQA 2CFXA 1V5EA 2JN6A 3GTQJ 2L7KA 1LJ9A 3U9GA 4EJUA 3P9CA 4IX7A 1XN7A 3AAFA 1Z21A 1ON1A 3JRBA 1IAWA 2L5QA 3IRQA 2QCOA 3ML6A 1QHGA 1Z91A 3KX2A 2AO9A 1DU0A 4DNCA 2HFHA 4OIQF 3ZOBA 4NUBA 2PJPA 2HU9A 3K4BA 4A6EA 1FP1D 2I5UA 5HLHA 2GXGA 4XNFA 1WCMJ 3TW6A 1IJWC 3WGHA 4B4CA 3F22A 4PJJA 3FMSA 3Q0WA 3S17J 3OYLA 3LNQA 3REOA 2CJJA 2FMLA 1W5CC 2FMYA 4UXNA 5DCFA 2E1MC 1QQIA 1U5TA 3EQLF 4C2TA 3CP8A 1A04A 5C4JJ 1YYVA 2R7ZJ 2IS1A 5FFXA 2NVUB 4QTRA 2KQRA 2FQ3A 2VXDA 2F4IA 2WY8Q 3VYTB 2Y75A 1IF1A 3VWBA 4LD5A 4U0YA 1GDTA 4BDZA 4BBSJ 4MQVA 2JRMA 1W7PA 3GBGA 2EZKA 3HUGA 2OTLI 2XSDC 2OZ6A 3QYEA 2E1CA 1R4MB 4L9VA 3OS2A 3LFKA 3R60A 3SZTA 2BXZA 2E1OA 2QYOA 3CUQA 1OLTA 1Z6RA 2MG4A 1X4OA 4G6QA 4LLGF 3C2HA 5H20A 3SFZA 2IRFG 5A2QK 2OPTA 2HYJA 2KIUA 1Q1HA 1X3WB 2LYCA 4XN3A 3ERMA 1YW7A 4XMYA 4P1WA 2HTJA 2JRTA 2P81A 2V9PA 4A3JJ 1RIOH 3K4KA 1RRJA 4PFPA 3ABTA 2JK3A 4UUTA 3OS0A 4L0ZB 2VBYA 2QEXI 3GF2A 1OYWA 2VBZA 2VN2A 4L9NA 3MKLA 5EG0B 2MGQA 4LK0F 2Y48A 1IRXA 3E7LA 2YR2A 3CJNA 5HDGA 3M7GA 3LL7A 3ZMTA 3BTLA 3QYFA 2ECBA 4D0PA 5D6FA 2WAQN 1PDNC 3KE2A 1LVKA 1P9QC 1S6LA 5F04A 2KT0A 3CF5F 3CCEI 3A2KA 2DDAA 5HVQC 2X1EA 4BJTA 1A6IA 1XMXA 2P5KA 2NS0A 5KVRA 1EH8A 3PO3J 3W3CA 4PGGA 4OMYA 4PZJA 1U9NA 1NG7A 3M07A 4A0ZA 4IHYA 2ZJ2A 3QAHA 2Y9ZA 1JHHA 2CS3A 2O3FA 1R36A 3E1SA 2Z3YA 1T39A 3BP8A 4A69C 4R1HA 2I10A 3F9KA 4OOIA 3OYJA 1XGNA 5E8GA 4BY1J 2NVYJ 3GLLA 1W5TA 3L2UA 2IGKA 3O8HA 1Y8QB 2OD5A 3S1QJ 4UV9A 3QPTA 1ZLJA 3CUOA 4KFCA 4A3KJ 4AIDA 3J7ZI 1T33A 1HW2A 1MW7A 5LRRA 3K10A 1FP2A 5L3CA 4YRVA 2ZXJA 5E79C 4D1QA 4D5FA 2LH9A 1QRYA 1JJ6C 1YTYA 2HOAA 2COMA 1YRNB 2GOMA 3COAC 3KLOA 5J6XA 1KU7A 4G9YA 1J0RA 3TP3A 1SVMA 2ESHA 1Z67A 3IC7A 1R7JA 2EFWA 4MNUA 3GTLJ 4D5CA 2HR3A 1XX5A 2RV8A 3J80Z 1YIOA 2E19A 4BJ5C 2EIMH 2R7FA 4J01A 3K2AA 3J7YJ 4L5IA 2DFHA 2VKDA 2CQNA 5M3FJ 1P2FA 1R9TJ 5CVUA 3PSIA 1LE8B 5DM7F 1LFPA 2ZMEA 3DF8A 5E1WA 2B7EA 2HNHA 1T2KA 3SJMA 3HOVJ 5IP7J 3HHHA 3LAPA 2W85A 3H0DA 3DQVC 2HYFA 1IN4A 1D5YA 3ABUA 1RESA 2QM3A 1UJ8A 3GO5A 2CQXA 4GXOA 2BVLA 1FOWA 4M3BA 2V4JC 3V8KA 1Y0NA 4YEJA 3PQKA 3E5QA 3U1DA 4M71A 2DA7A 2M4KA 3OYIA 2QQ9A 2DA4A 1ULYA 1KGSA 2C6YA 3KYCB 1IN7A 2KPMA 2HOEA 3MVPA 3VOEA 4L18B 2EFOA 2NYXA 3TKYA 1GXQA 1E3HA 4D7NA 1X1CA 1GLNA 2OZUA 3IAM2 4EVIA 2BBYA 1U9OA 4Y13A 3ASNH 2CW8A 1WJEA 2R92J 1BR2A 5M5XJ 1IG7A 2XGCA 1V5GA 1P4XA 3K6GA 5EDNA 4E7HA 3OYCA 1JHFA 3UR3C 2XKPA 1ETWA 3JAMZ 1RETA 1JXSA 1MDMB 1ETOA 2Q1ZB 2PMZA 3VB2A 3NWTA 1IDZA 2PMHA 1BA5A 4CSWA 4M9SA 3LSJA 5EZGA 4AM3A 1YX3A 1P92A 3ESWB 3F0CA 3J7AY 1IUYA 1V54H 5HS9A 3BR6A 3IWFA 4OMZA 1IZ1A 5IT3A 3KLNA 4J19A 2AS5F 2FBKA 5EEGA 3A01B 1SVOA 3DEWA 1FNNA 4CCNA 3F6OA 5KNLA 1GV2A 2BZTA 5CYVA 4IXAA 1UAAA 2EPFA 3I4NJ 3LSHA 3ZQLA 2OC6A 4A0XA 1POGA 4WXDA 2UZKA 4II2A 3CJRB 5A2QZ 1PP8F 1JKPC 4LB5A 1USTA 2HQRA 1IRZA 2L7ZA 2W1OA 5ED4A 5HS7A 3RPUA 3FXOA 1WVRA 3GZ5A 1UHSA 1UHMA 3ZRGA 1PYVA 2O7OA 2WV0A 4N9HA 2B9SA 4Z6YA 4IHXA 1E2XA 3TDZC 3BY6A 3CDIA 4NC6A 3IKTA 1H9GA 3DKXA 4I99C 3R6SA 3OYFA 2R7OA 4RGRA 1WPKA 4C2UA 4N4NB 5J40A 1GXPA 4M6YA 5JR3A 3OOUA 2OBPA 3HIFA 1A5JA 1F9NA 2E7WA 4XM3A 3I54A 3I4MJ 3U2RA 2X85A 4BNCA 2KRCA 5J1RA 1ONVA 3ERED 4ESBA 4ENMA 1JT0A 1IXSB 3S16J 2ZC2A 1LDJA 4RS8A 1AA7A 2DBBA 1VI0A 2YSRA 3IL2A 1PVEA 1ZR4A 2L3DA 4RAGA 2XB5A 2VL8A 1RUNA 3GXOA 4PGHA 3FXUA 2R5YB 2ICWG 3SEQA 3WE2A 2XVCA 1YX5A 3WTTC 2R7UA 3TGNA 2CWEA 2RAEA 2RREA 1SFEA 5IY5H 2F2EA 3C1DA 3RYRA 3UNGC 4EQQA 2BEOA 3DU5A 2EV0A 4FE4A 2KZGA 3IKVA 4WCGA 1IN8A 3CCUI 4XQFA 5F0FA 4BXUA 4DIQA 3WTWC 2CUJA 3VODA 1W0UA 3S1NJ 1H8AC 1JJ8C 1QZEA 3CC7I 2ZNZA 2FUG2 2HKXA 2MA3A 3MMYB 4IVNA 3S2DJ 3DPUA 3B02A 3JTGA 1XSVA 5E8IA 2GOXB 4HG2A 4V2FA 4C2MJ 1MNMC 1O4XA 4XL9A 2VC0A 2JSPA 1VQ8I 2W84A 3BJ6A 4I2OA 4UVCA 2WBMA 3LAJA 1QVTA 2DA1A 1O3TA 1SD7A 2F5FA 5CQGA 2EFPA 2E1NA 3KYDB 1HDDC 2A68F 3T5XA 4UUSA 2FD5A 1KA8A 4E7LA 1R23A 3ZMDA 4Q48A 3HOWJ 2J5OA 3JCUC 4N9IA 3OYEA 2Z2SB 2KMUA 2DMUA 4XLPF 5IOZA 4ENKA 5GTHC 5E17F 1OR7C 3OL3A 2L9RA 2BV6A 2CMPA 3BG9A 4HX4A 4E70A 3D5LA 1B4AA 1NTCA 4C3JJ 1SFOJ 1WJAA 2WAQA 1RC9A 1JKQC 4BQOA 2FX0A 5F1RA 1U6GA 2DQRA 2JA2A 3QOEA 2GXAA 4BE2A 3WODF 4EM0B 4I09A 4J00A 1EH7A 4W97A 2H6CA 3BZ6A 4BACA 2DOAA 2ZCWA 3B73A 3HM5A 3ZQCA 2D5VA 2JUGA 4RDUA 3GCMA 4ZYDA 1QU3A 5DV5A 4ZTFA 3HRUA 5L3GA 2H1KA 1VTNC 5IYDJ 1TWCJ 2CUEA 2CUZA 3BCAA 3VSKA 3T0YA 2CV2A 2XGXA 1TTYA 3S3NA 3GFJA 2VIXA 3MFKA 4MEYF 1HCRA 4C9YA 4DOZA 2PX9A 3FDYA 2YU3A 3K70C 4BGDA 2R7SA 3L2RA 3CCSI 4WWCA 3VDXA 3CCYA 2QBYA 2PMUA 2R3SA 2KJBA 3I59B 4DZPA 4EM2A 3GTOJ 1XSDA 2DJIA 4RB1A 1ZG1A 4CYCA 2A6EF 2VBXA 5AIQA 5CKTA 3RKQA 3IRRA 4BE1A 5DYMA 4YFXF 2W57A 4IOCF 5ILSA 4NC8A 1S3JA 2XPUA 4LFUA 2UXXA 3EUKL 1CQTA 4BXXJ 1V55H 3FF5A 3KP5A 3ZCOA 4A5NA 3KP7A 2K9SA 1M1EB 1QZZA 1B8IA 2IS6A 3BROA 2KIQA 3H0GJ 4XKWA 3V8JA 3HOYJ 2Q2EA 2AQFA 4OU0A 5B1AH 3G1MA 3BJAA 3EDPA 3F8FA 2ZFWA 3OSGA 2LKXA 5JVTA 1QO0D 2KIFA 4XKVA 3NAUA 4RMNA 5LLQA 1OPCA 2ZXWH 2PQ8A 4ETSA 1MMSA 1D1CA 1N25A 3MN2A 1VQ4I 1IN5A 3GLXA 4RB0A 1J5YA 5CJ9A 4RLFA 5DD4A 1MBGA 3KP6A 3FXRA 1TQMA 2FEZA 4LLLA 2EQRA 2L54A 3IAS2 1A31A 4RM3A 1HQCA 1Z77A 2ZFUA 4HYEA 3DTKA 5GAEJ 2XGDA 2Y0SN 2XAUA 4CZZA 4A3FJ 1H88C 1CF7A 5BPDA 3BG7A 3HYIA 3FWEA 2LNBA 1ON2A 2HQNA 1BIAA 2Q8KA 3SFIA 2DMTA 3NWSA 2K3FA 4MFDA 3NARA 2XAFA 3KEOA 1KZHA 4AVPA 1OCPA 4Z2YA 5JHUA 4RGXA 3CCQI 2V6EA 4RBOA 3OYGA 3C18A 5K7ZA 1SD6A 1U2WA 4RB3C 4ESFA 4PFOA 2XASA 2JJ7A 3HGGA 1R1TA 1I1GA 1BOBA 2GQQA 4IZZA 4XSXF 2YX7A 3O3KA 1IXCA 3FHZA 3M1EA 1JUSA 1BL0A 2QZ8A 2HPMA 2WB1N 2NVQJ 4A3GJ 4HDVA 5HDNA 5TISC 4BAYA 4E7IA 1ERDA 1D3YA 1BIBA 2B63J 4KJZA 2P5VA 4QSHA 3F8MA 3KETA 3J81K 5JFRA 1HOMA 1O7FA 1D0YA 3ZGKA 5H6QA 4I01A 4PCQA 4HNUA 3ONQA 2VODA 5IT9K 4GYGA 4LJZF 1Z05A 1PUFA 2X6YA 3DKYA 4D7MA 4IPAA 5LRSA 2QA4I 1O3RA 4BEHA 2X6OA 2A69F 2JVGA 2O8KA 5IP9J 2KKOA 2EA4A 3E97A 4FE7A 5CPRB 4ZJZA 3ABKH 2WWYA 3O2PE 2XDVA 2YPRA 5ICCA 2P4WA 4AVZA 2PBIA 4Q47A 2B0LA 3J7AO 3S32A 1MJ9A 3NRVA 1EH6A 2ME0A 3HB9A 4PJLA 3CCLI 4FASD 3FMRA 1QA6A 1BBYA 2QQAA 1MMGA 2MC3A 3DP7A 3WU2C 1LKXA 2CW0F 2VPRA 1NG6A 2FNPA 1I1SA 5LEJA 1Y0UA 3L9FA 1FIAA 1YFHA 1XC5A 1QNTA 1LPQA 1FBSA 5LGNA 1ZHFA 1I6HJ 5IPAA 1FOKA 5EGOA 1IV8A 4M9XA 2HEOA 2BY1A 4HRIA 3LSGA 2LBFB 3SZPA 4WF2A 4V2GA 3TDUC 2PLYA 4GO1A 3SDBA 3TMOA 2ZBKA 5BMZA 3CJQB 5FLXK 4RAYA 2XRLA 3HHGA 1W0TA 1HKQA 2LF8A 3A02A 2LK2A 3MZHA 2JA8J 4O6JA 3VYRB 1SC7A 3S2HJ 1TT5B 4EJTA 3PUBA 3HG9A 2OAZA 4HV5A 2HI3A 1MMNA 4XSZF 4PDKA 1FTTA 4OWRB 4PJ0C 3OV8A 4P55A 3RQ4A 4Q4ZF 1WRJA 3OYAA 2MBFA 2ZXHA 1ZGJA 2KL4A 2N8GA 4WXCA 3TO6A 2M7BA 3N4MA 5DTDA 1DU6A 1T95A 2M3AA 1HSJA 3LA3A 2NRAC 1MGTA 5DUKA 3VEPA 3LQRA 2BVMA 2VC1A 1X3ZB 2OCEA 1B72B 4CDGA 1TNSA 4YIIA 4BHBA 3VFZA 3TO9A 1O3QA 1SAXA 4NBQA 1G8XA 2VKVA 3BTIA 4KIBA 5ICEA 3JREA 1MH4A 5BNGA 2F48A 2Z16A 3RTRA 5DM6F 1BN5A 3L09A 1J9IA 1R58A 3GFLA 2HDWA 2CYYA 2LREA 3I3LA 5LEKA 2IEKA 5LGUA 3DLLF 1HBXG 5C44J 2K27A 2W7NA 5J1UA 1DP3A 2ESNA 1LQ1A 4E7KA 1Z3XA 3RZDJ 4HSTA 4A5MA 5E3NA 2YS9A 2MLKA 2E5NA 3OL4A 4IJAA 5KK1A 2PI0A 4NQWB 2PJRB 1XS9A 5DCMA 5ILVA 2HZTA 2R7RA 4F92B 3K1PA 1QPMA 3DTEA 3FKJA 3QP5A 1S29A 1ETVA 3L1PA 4QPOA 3G73A 2BY2A 4FQGA 4KYWA 1OFCX 2DCEA 2JUCA 2R5ZA 4CHUA 1FSHA 3EYIA 1R00A 2Y30A 4O5VA 5LHIA 1UZCA 3BCBA 3WG7H 2I8DA 2X1DA 4XONA 1AKHB 1X1AA 3ZQGA 2CG4A 4MQ9F 3CDHA 2PFBA 3BG6A 1HC8A 3K1MA 4M3GA 5D5VB 1G3WA 5FGMA 2Y69H 1S7OA 3CO7C 1LE8A 4XKBA 1FTZA 2G9WA 2KIMA 1RPWA 1XGSA 4ESJA 3N97A 5CVRA 3H5AA 1XDUA 2IA1A 2E5ZA 2H8RA 3B6AA 2M34A 4MGRA 1JTXA 3TL4X 3QU3A 1XD7A 3ZQQA 4UB6C 3A0HC 4OIRF 4A12A 1W36D 1DQUA 2G0EA 4B48A 1HW5A 5LD2C 2PG4A 5BPIA 2X6XA 3H92A 5B3SH 3FHNA 4ENJA 1VQOI 5E20A 4LIUA 4HDUA 1Y1VJ 3H5RA 1X1DA 2EJRA 3P9IA 4S05A 4II3A 2NS7A 2DA3A 1LFUP 5E1ZB 2HVRA 1WWXA 3SYTA 4HNTA 3D5SC 1K7AA 1G59A 4UY8I 3FISA 4AIKA 3HRSA 2JZYA 2R7TA 3J81Z 2O61A 2LC2A 3K4JA 3C3WA 1RR7A 2VPLA 4IHSA 1W7PD 1KYWA 4MHGA 2IXSA 4EATA 5IT9Z 4DQ2A 2RDPA 5DEQA 4LG0A 3Q0UA 4I02A 2LY1A 4EEFG 3IP4B 5FLMJ 4R8HA 1ORKA 1OQYA 1MBKA 1YW8A 2OUMA 1XGOA 1W7PB 2VB6A 2K86A 3BDDA 3HUGB 2BY3A 1USSA 4OAZA 1LEBA 2DFFA 3CJTB 2OJED 5K1YA 3DXJF 4LB6B 2NOJB 2KRFA 1WJDA 3CUQB 1PJRA 3K2ZA 2IT0A 4CZCA 2XIGA 4B44A 3A03A 3NEUA 5GTIC 2M87A 2ELJA 2L7FP 3HSEA 3MAJA 4HPQA 4A3BJ 1K6OA 3L7WA 2X1CA 3R61A 1TWAJ 4KMFA 3ZMZA 3S3OA 2DMQA 4DW6A 2WAEA 4X6AJ 3H3ZA 4B1RA 1IXRC 4PK4A 3PNYA 1D0ZA 3RZOJ 2CFOA 2O5RA 2X51A 4MFEA 1ZH5A 2LSOA 3NQOA 1VQ7I 4UV8A 1I6XA 2BE5F 2JVHA 1SD4A 1G2HA 1I3AA 2EZIA 2XSJC 1RR8C 5JI6A 1RI7A 5ERIA 2V26A 2V6CA 2BXYA 3TO7A 3AFHA 2VQGA 1FIPA 2IAIA 2LF7A 2ELHA 2Y0SA 4UB8C 3PQJA 2BW3A 5FFZA 2LKSA 1KU9A 2TCTA 2F5DA 3KZYA 4KA4A 1LB2A 4YG2F 5HLTA 4ENNA 4C30A 2UUZA 2M9HA 1ZK8A 1ZREA 1V3FA 4RGUA 1MBFA 2QSGX 5K5RA 1QGPA 3L00A 2A6TA 4U0WA 3PFYA 1Z9CA 4DBQA 1H89C 3HOZJ 1B9NA 1GHCA 1MSEC 2KDZA 4C3HJ 4HNVA 2K4JA 2V1DA 3EPZA 2VQHA 3GFIA 2WB1A 1P4AA 2EIKH 4AU7A 2NNNA 2JPBA 1XGMA 3HTUA 3IH2A 5F64A 2DQLA 1B1BA 4Y3OA 3HKZN 3DBHB 3MEXA 1S7EA 1ZG3A 3OR1C 1TT0A 3GTJJ 2RQQA 3BC8A 1YJWI 1T56A 2GAUA 2OQGA 2WC2A 3KEYA 4F7ZA 4XBFA 2A3SA 1B6AA 4WK8F 1S7AA 3T8TA 1BI3A 5DD8A 4OIOF 4M3FA 3E0JB 4JP0A 3OYHA 3WG9A 5FROA 3ZMSA 1SAUA 2E60A 2RN7A 4HLXA 1PUEE 2BY0A 2ADUA 3ELKA 1L3LA 3BG5A 1FPQA 4U0VA 5F0CA 3Q9VA 3KCCA 2DTRA 2KHMA 2ECCA 1OYYA 2ZMEB 4JYKA 3C7JA 2RKHA 5L3DA 3RIRA 5H6RA 4CCKA 2ACJA 1FBUA 3SHFA 3HJEA 2QKLB 4I76A 4C3IJ 4HA8A 1X4PA 3CD6I 2M0CA 1WKMA 4ZYHA 3H5NA 5HOOA 3BPVA 3LA7A 4MO7A 4XLHA 1N78A 1TC3C 4RAZA 4B47A 1MNEA 5L3FA 1QPIA 2FBHA 3SXYA 1Y39A 5GAGJ 1TLHB 1R5GA 1WH7A 4XK4A 2FSWA 2AXLA 2D1VA 1JTYA 3JRHA 1FX7A 3BR5A 5FRNA 3DBRB 3ZMVA 2EA2A 1KQ0A 4KISA 1ZR2A 1D0XA 3K4LA 5D8KB 1WJCA 3BR0A 4KNYA 3I0TA 4XLEA 1U8BA 3MCZA 2DPDA 3MKZA 1CGPA 2EZHA 4YIFA 2DYSH 4L0YB 3GUDA 4HX7A 1T98A 1WI3A 2O0YA 2DO7A 3V7RA 4EJOA 3I55I 4B43A 1R49A 1FYKA 3PNVA 5E3MA 2LMDA 4PJNA 2HOTA 1VZ0A 1F5TA 1KONA 1WHUA 3FM5A 5JHFA 2E2HJ 4DBRA 2ID3A 4FETA 2M5WA 2M45A 3PUFA 5DDGA 3JRIA 2EFQA 3BT9A 3FMQA 5TGTA 2UWMA 2JA5J 2VKEA 2IS2A 2KLOA 5KCMA 2ZO4A 3N05A 4BHCA 4KN7X 1JUPA 3O6BB 4EMSA 3L2VA 3QODA 3OIQA 1G3SA 2MD0A 2GXBA 4HZFA 1R71A 1R1VA 4EM1A 1PP7U 5D4SA 5K5QA 1E3OC 2V79A 5JLXA 1QBJA 4CYDA 3KP4A 3FXJA 2XB0X 5CVIA 5HDKA 1RZ4A 5FD6A 3D1NI 1MH3A 1P7JA 2V7FA 4G6DA 3RPUD 1UG2A 1F1ZA 1R5HA 4BL0B 4Y17A 4IRIA 3W2VA 3HOXJ 1K4SA 2HXOA 3GZNB 5F27A 2KISA 1S8NA 2TDXA 2XROA 3TOBA 5FD5A 2GBYA 2W4SA 1GT0C 3H3UA 2GIVA 3BPXA 3PIPF 2HKOA 3DEEA 3H3VK 1WJ5A 3FM3A 2H6BA 2K4BA 4KIFA 3GX4X 3P7NA 1ODDA 4M74A 4ZYAA 3PSFA 2FF4A 1FMVA 3ASOH 3G2BA 4KT5C 5HLGA 1B9MA 1RNLA 3WE3A 2EBIA 3CLOA 3HRTA 3RSNA 4I7HA 1I39A 3GTGJ 2CUFA 2EH3A 4M6XA 4NB5A 3R4KA 2OF7A 3VYSB 3GYHX 3OIPA 2DMNA 3DEUA 4FTHA 3DV8A 5LHGA 4BE0A 3EUHC 3BG3A 1FT9A 1YLFA 2DK5A 1X58A 4OAYA 2MLGA 4UVAA 2XKOA 5E18F 1T8IA 3RDIA 2KZVA 4LOCA 1ETKA 1YW9A 3JSPA 4XRSA 2V1UA 1Z7UA 2ZSIB 2H27A 4FX0A 1F4KA 4JX6A 4B3XA 2WADA 3CDLA 1VQKI 2DPUA 1OCCH 4OIPF 2ZKZA 2LVSA 1IN6A 3SDGA 4FHTA 4BKXA 2W00A 3OYNA 2XPWA 5HNFA 2ZSHB 3OWTA 3LSRA 2FE3A 2JTVA 3ULQB 4HX8A 4DZJA 1TZLA 3I9V2 3KZZA 2EFNA 4CH7A 1BI0A 1VNDA 3MKWB 2MC4A 3F21A 5D6EA 4ZTJA 1VQ6I 2A61A 3AL0B 3B6CA 4R79A 3F8NA 5GPCA 2YU9J 2HQ5A 3BR3A 3Q5FA 1TQIA 1ITYA 4CGZA 3FXQA 4IQJA 2QVOA 1GVDA 2VQLA 1OR7A 2STWA 1K78A 2VI6A 5GP9A 3P9KA 3A0BC 4CCJA 2IS4A 4EGYA 1KU2A 1U3EM 1WQ2A 5BS6A 1LDKB 4GFBA 2NXNB 4GRIA 3ECHA 1D5VA 1SMTA 3I4PA 4Y4RA 1TWFJ 4BBRJ 1AHDP 4OINF 3GTKJ 2MFZA 3BTCA 4UUSB 2PEXA 3C2BA 4A6DA 1MJAA 1G4DA 2JA7J 3DTIA 2GIZA 3DWLE 4ANJA 2Y2ZA 4IO9F 4A3LJ 1WJBA 2R4GA 2AHQA 5FB2A 1ACIA 1Y1WJ 3JRDA 3T8RA 1N75A 2NVXJ 4CCOA 4XR6A 5JLWA 3RQIA 3OMYA 1ZRDA 3F72A 1MIJA 2QLZA 3LWFA 1W5SA 2TRTA 2QWWA 1YITI 2V9VA 2DA5A 1RKTA 3OYDA 5J8CA 1ZN2A 4L5JA 4BQQA 2L01A 2DT7B 3GMEA 4XOPA 3VSLA 4BY7J 4BXFA 4LGWA 3F6VA 3ZQFA 4HAMA 2KRHA 1E17A 1T38A 3S14J 2F4MB 4I0AA 1ETQA 3E6DA 2CQKA 1EKEA 5K7FA 4GGGA 1DPRA 3TOAA 2P6TA 2M4GA 3RKYA 1NK3P 3CF2A 3QOPA 2GWRA 1G3TA 4A3DJ 2EWNA 4EV0A 3E3VA 3IHUA 3OYMA 2QSFX 1BC7C 4PUSA 4F91B 2K9QA 3HKZA 4A3CJ 2OTJI 3PJRA 2QBYB 1VQMI 1R4NB 5J3LA 2XHKA 3W2WA 3WTYC 2K5CA 1QHHD 4N4OB 1BR1A 1TBXA 6PAXA 1YO5C 1REPC 3OOPA 1HKSA 4KMUX 2A05A 4CYCB 4M3DA 4EGZA 1XDSA 1FY7A 4E6KG 2ZB9A 4ZDOA 1SVLA 4HW0A 3CO6C 3MQ0A 4I6ZA 1S9HA 1XMKA 2MYSA 4ZYEA 3CMAI 3G1LA 3H36A 3KFWX 4KUMA 3CCJI 2IGNA 3QP6A 1B8IB 2HOSA 3W2AA 1UB9A 3SEZA 1BI1A 1R1UA 2Q2EB 1VQPI 2JWTA 2DLLA 5TJJA 1T6SA 1I3QJ 2JMWA 2E71A 2Z99A 2HZDA 4AWXB 1TL8A 4G7ZF 2IA2A 2J5PA 3DU6A 4NHJA 3K70D 1E3PA 2WTEA 3OY9A 1AOYA 2HYGD 4M73A 2HS5A 1H0MA 2IPQX 2QQ8A 3KP3A 2A5YB 1WJFA 2ZXIA 5FKNA 1JKRC 2VOOA 3BQZA 3ZPLA 4CXFA 2MABA 1W36C 2KDOA 1BOAA 2GM4A 2JQ7A 3JRGA 3RCOA 2LFBA 1LVAA 3I64A 5DUIA 2GZWA 2LY2A 1K79A 2E7XA 4U7DA 5LHHA 3W6KB 1CF7B 3H9QA 1UMQA 3CC4I 2VJIA 1MNDA 4BYYA 4LK1F 3R0JA 2DJNA 1SANA 3CP2A 4G94A 3M8EA 1DGRM 3KPHA 1J75A 2M8GX 5EG0A 1OISA 2E34A 1ZG5A 2DDBA 1XPXA 2XAQA 3I56I 2L2OA 5FO5A 5CQEA 2FQ4A 4AYBN 2XF7A 3LA2A 1I27A 3CUQC 2DW4A 4V19K 4G12A 5ICFA 2HVQA 2HWVA 3VYUB 2HDCA 4U88A 1NHAA 2XAHA 2QF7A 1BC8C 4FX4A 1YS6A 3FXLA 3EYYA 1HDPA 4IKFA 1IDYA 4BH9A 4JOMA 2Z1DA 1FSEA 2P7CB 2CW7A 3SZGA 4B09A 4IHTA 2ZNYA 5L3BA 3D0SA 2P0WA 1D8KA 2VT2A 2K9LA 3Q3SA 2ELKA 1ZKGA 3QU6A 1MKMA 1EF4A 2DFEA 4RA2A 4E7JA 4JX4A 1PUFB 2BGCA 1UCRA 4BU2A 3FZVA 5B66C 3G4SI 3RKXA 1J2XA 1UELB 2L4MA 2V9KA 4BEHB 3JAMK 1IW7F 4DYCA 1J59A 2R7VA 1O3SA 5GADJ 2DI3A 4O3MA 5HS8A 5LGTA 4ZDLA 1OMIA 3MKYB 2X0LA 1B59A 3JRFA 4CO8A 5ICGA 4BQAA 4ZZLA 2P5LC 1YRNA 3ZQ7A 2EB7A 4BJ6C 4HF1A 2PN6A 1UG0A 2E35A 1IRFA 4QWQA 3S15J 4BHPA 2VE9A 1GV5A 1F43A 5D8LB 1VQNI 1K61A 3IUOA 4MLOA 4CICA 2LP0A 3CQZJ 1MMDA 2L9SA 4Y7NJ 4IQ4A 5IYCJ 3L2CA 4XRSG 3JR9A 4LIVA 5EGOB 5BOXA 2NVTJ 1YE9A 3RI4A 3ROUA 5LFAA 2ISYA 2JT1A 3GEZA 4X1EA 3AG3H 3OSFA 2HDDA 3DBLB 3G3ZA 4HBLA 1VQLI 3HOSA 2VOPA 2XGEA 5J8FA 2VJ5A 3BZKA 1AWCA 3R0AA 3ZQHA 3ZN0A 1QVUA 1BI2A 1IGNA 4Q5SF 2BHZA 3Q9SA 4ASNA 2LG4A 4BQNA 2W82A 3E6BA 3FBNB 1Y56A 2AQEA 1DPUA 5AIPA 1HXDA 4A2UA 3PM1A 3WU0A 3IWZA 3CMEI 2X48A 5E3OA 2OCCH 5M3MJ 2NAZA 3K69A 3ZP5A 2WY7Q 4XICA 1IC8A 2RGVA 3D5RC 2LOOA 3CC2I 1A6QA 2X9DA 2Z9OA 2XC7A 1LFBA 3K4NA 4BUPA 4XLNF 2O6GE 1OKRA 1J7KA 3IV5A 2CH0A 2D45A 5C3EJ 3S1RJ 2ZMEC 2R7WA 4TV7A 4HLYA 5DS9A 3TQNA 1KU3A 3HOTA 1U5TB 2BOLA 1HW1A 1FOXA 2M2EA 2DT5A 2DU9A 1ZTRA 3HTSB 1UFMA 4HF0A 5E3LA 1KYZA 3K4CA 1ETXA 2UXNA 4EJWA 2KP6A 1V5FA 4IRGA 4G7HF 3WU1B 1AU7A 2LKPA 1MDMA 2JSCA 1IO2A 2R7QA 4YIRX 1D1BA 2VJJA 3F8BA 1J09A 4U87A 4CCLA 3G71I 2IBDA 5HODA 2RNGA 3WGGA 2ME6A 1Z1DA 3QPHA 2P8TA 5DCMB 4DGWB 1SFXA 4RGSA 1WFXA 3K4MA 2O8XA 4KT6A 3CZ6A 3CCRI 2W25A 1Z7LA 2CSOA 5D5UB 4A3MJ 3WTUC 1VQ5I 3A01A 3CMYA 1S72I 4E4HA 2R5ZB 2O03A 1DUXC 2Y0MA 2R7DA 4FCYA 2FJ1A 5GPAA 3BZCA 2VASA 1SEUA 1LEAA 3H1CA 3JW4A 2V1NA 4XOTA 5FLXZ 2YX4A 3H9GA 4KICA 4M72A 1Q1VA 4P9UA 1WZ2A 3HL2A 4Y52J 3LOCA 2E1MB 1BM9A 5J4VA 4P5OA 1A36A 2FNAA 3ZR8X 4B3AA 1I50J 4DYQA 2R7XA 1HA8A 2M30A 4S0HB 2MSYA 4AIHA 2UV1A 3FXKA 2F6CA 5EEAA 1RUOA 1STZA 1G6NA 2MH2A 5CVJA 1OJLA 1U0JA 1Z6TA 2H8WA 4IF4A 5C4XJ 3HSFA 1WH5A 2L9VA 5E1XA
chains in the Genus database with same CATH topology
3PFIA 1MJBA 3I71A 2D1HA 3DKWA 3RPQA 4JBAA 1U78A 3E6CC 5HLIA 3ZMUA 2ISZA 4RB2C 1L0OC 2IVMA 2IP2A 1YG2A 1GVJA 2QENA 4M9ZA 2XAGA 4LG0B 2HGCA 2GA2A 2JPCA 1ZARA 2CGPA 2FA5A 1IRGA 2MH9A 2DK8A 4ON0A 1XCBA 2OA4A 3T1BA 3V8LA 4MTDA 1V4RA 5D4RA 3BOQA 2GA1A 3WTXC 3GW2A 2V1XA 4YFKF 2FXAA 3I5UA 2CO5A 5K5OA 3BJOA 4AD9A 1ZLKA 2QUFA 3KP2A 1XMAA 1D8JA 4L9TA 2M1BA 2IW5A 3RKWA 4IRHA 2D2WA 2RVCA 4S04A 1I5ZA 4GCVA 2G7UA 5CVVA 2BYVE 3FX3A 2W24A 3K1NA 1KQ8A 2HTSA 5EEHA 3QRFF 3I58A 2EV5A 3JSOA 2VT3A 5L3EA 1JGSA 1XSXA 1EV7A 2FRHA 2G7HA 1LNWA 2FU4A 4LLNA 4UHTA 1OYIA 2RNJA 2Q0OA 4UNOA 3DPTA 3E6MA 4G7OF 3I59A 3HRMA 4P96A 1O7LA 1P6RA 3I53A 3V7SA 4H0EA 5ILUA 4HQEA 5AONA 1ZYRF 2IA0A 4UVBA 2P7VB 3CTAA 2DFIA 1HSTA 3MWMA 4B8XA 4WXHA 4HOBA 3M9AA 3F8CA 1XB4A 4GYIA 4MEXF 4G8XA 2Z5UA 4I98B 2VBWA 2L02A 1TW2A 3RJPA 1HKTA 2VXZA 1FBQA 3E5XA 4L9JA 2NNYA 1SFUA 3KEQA 1TW3A 2M8EA 1YQAA 2XUBA 3DFGA 4AIJA 4EJVA 4ZYGA 4LMYA 3RYPA 3WTVC 1W4MA 3BWGA 2EV6A 3DPLC 2OU2A 4Y15A 1QZYA 4N0BA 1FWZA 5CLSA 3EUHA 3LQQA 1O57A 1LDDA 2FBIA 2H94A 5LBQA 3GZ6A 3GVAA 3K9TA 2OQRA 2VONA 2MD5A 2K7LA 3E5UA 2LDUA 2K02A 2XRNA 3V4GA 4A0YA 3ISPA 3F3XA 1SMYF 4JQFA 2DAOA 2F5CA 3JTHA 2RQPA 2ETHA 4FT8A 4K2EA 4KDPA 1ZAOA 4P9FA 3GFMA 2FOKA 4HQMA 3WGIA 3EETA 2Z33A 1WI9A 1FC3A 1R22A 2H09A 1P4WA 4MTEA 5BQTA 4I0BA 4U7BA 3K0LA 3HSRA 1JE8A 4HF2A 4WX9A 3ZN1A 1X3UA 4KN4X 1U8RA 4JK1X 1DDNA 3W6JB 2X4HA 4KIGA 2IJLA 1FYMA 2A6HF 1BJAA 2STTA 2P6SA 4YFNF 1K78B 2XV4S 3F23A 4ZH4F 3WTSC 1MZBA 1WSUA 1T0FA 1DP7P 1SD5A 5F6FA 4ZZDA 2RC4A 1FYLA 4QLCU 2EK5A 2QQBA 3MZYA 4UUVA 1MD0A 2F5EA 3M8FA 3WTZA 1C0WA 1TNTA 3V7CA 1H9TA 1FZPB 4NQWA 3J80K 1XCVA 1YS7A 2XAJA 5D5WB 3ECOA 5TRDA 5D5XB 1U5TC 4XRFA 3SQNA 3LSTA 1ZGAA 3GWZA 2A07F 1ZRCA 2KJCA 4HV6A 2VE8A 3S2WA 1FLIA 1UHWA 1ZRFA 1TQPA 1KQ9A 1G3YA 2L4AA 2CFXA 1LJ9A 3U9GA 4EJUA 3P9CA 1XN7A 3AAFA 1ON1A 1IAWA 3IRQA 3ML6A 1Z91A 4DNCA 2HFHA 4OIQF 2PJPA 4A6EA 1FP1D 5HLHA 2GXGA 3WGHA 3F22A 3FMSA 3REOA 2FMYA 2FMLA 4UXNA 5DCFA 1QQIA 1U5TA 3EQLF 1A04A 1YYVA 5FFXA 2FQ3A 1IF1A 2Y75A 4LD5A 4U0YA 4MQVA 1W7PA 3HUGA 2OZ6A 2E1CA 4L9VA 3LFKA 3R60A 3SZTA 3CUQA 2QYOA 1Z6RA 4G6QA 4LLGF 5H20A 3SFZA 2IRFG 5A2QK 2KIUA 1Q1HA 1YW7A 2HTJA 2JRTA 1RIOH 3ABTA 4L0ZB 2VBYA 3GF2A 1OYWA 2VBZA 2VN2A 4L9NA 4LK0F 2Y48A 5HDGA 2YR2A 3CJNA 3M7GA 3ZMTA 4D0PA 5D6FA 1PDNC 3KE2A 1S6LA 5HVQC 2P5KA 2NS0A 5KVRA 1EH8A 4PGGA 4OMYA 4PZJA 4A0ZA 2ZJ2A 3QAHA 1JHHA 2O3FA 1R36A 2Z3YA 1T39A 3BP8A 4R1HA 4OOIA 1XGNA 5E8GA 1W5TA 2OD5A 4UV9A 3QPTA 1ZLJA 3CUOA 4KFCA 1HW2A 5LRRA 1FP2A 5L3CA 2ZXJA 1YTYA 2COMA 3COAC 3KLOA 5J6XA 1KU7A 4G9YA 1J0RA 2ESHA 3IC7A 1R7JA 2EFWA 4MNUA 2HR3A 2RV8A 3J80Z 1YIOA 2R7FA 4L5IA 1P2FA 5CVUA 2ZMEA 3DF8A 5E1WA 1T2KA 3HHHA 3LAPA 2W85A 3DQVC 2HYFA 1IN4A 3ABUA 2QM3A 4GXOA 3GO5A 3V8KA 3PQKA 3E5QA 3U1DA 4M71A 2QQ9A 1ULYA 1KGSA 2C6YA 1IN7A 4L18B 2HOEA 3VOEA 2EFOA 2NYXA 3TKYA 1GXQA 2OZUA 4EVIA 2BBYA 4Y13A 1P4XA 1JHFA 2XKPA 3JAMZ 1JXSA 1MDMB 3VB2A 2PMHA 4M9SA 1P92A 1IUYA 5HS9A 3IWFA 4OMZA 1IZ1A 5IT3A 3KLNA 2AS5F 2FBKA 5EEGA 1FNNA 3F6OA 5CYVA 4IXAA 4A0XA 4WXDA 2UZKA 5A2QZ 1PP8F 4LB5A 1USTA 2HQRA 5ED4A 5HS7A 3RPUA 3GZ5A 1UHMA 2WV0A 4N9HA 1E2XA 3TDZC 3BY6A 3IKTA 1H9GA 3R6SA 4RGRA 1GXPA 4M6YA 5JR3A 2OBPA 3HIFA 1F9NA 2E7WA 3I54A 3U2RA 4BNCA 1ONVA 3ERED 4ENMA 4ESBA 1IXSB 1LDJA 4RS8A 2DBBA 2YSRA 3IL2A 2L3DA 1RUNA 3GXOA 4PGHA 3FXUA 3WE2A 2XVCA 3WTTC 3TGNA 2CWEA 1SFEA 2F2EA 3C1DA 3RYRA 4EQQA 2BEOA 2EV0A 3IKVA 4WCGA 1IN8A 4BXUA 3WTWC 3VODA 2ZNZA 2HKXA 2MA3A 4IVNA 3B02A 3JTGA 1XSVA 5E8IA 2VC0A 2W84A 3BJ6A 4I2OA 4UVCA 3LAJA 1O3TA 1SD7A 2F5FA 2EFPA 2E1NA 2A68F 3T5XA 1KA8A 1R23A 3ZMDA 4Q48A 2J5OA 4N9IA 4XLPF 4ENKA 5E17F 4HX4A 2BV6A 4E70A 3D5LA 1B4AA 5F1RA 1U6GA 2DQRA 3WODF 4EM0B 4I09A 1EH7A 2H6CA 3BZ6A 2ZCWA 3B73A 4ZYDA 5DV5A 3HRUA 5L3GA 1VTNC 3T0YA 2XGXA 1TTYA 3GFJA 3MFKA 4MEYF 2YU3A 4WWCA 2QBYA 2PMUA 2R3SA 2KJBA 3I59B 4EM2A 1XSDA 4RB1A 1ZG1A 2A6EF 2VBXA 5AIQA 3IRRA 5DYMA 4YFXF 2W57A 5ILSA 1S3JA 4LFUA 2UXXA 3FF5A 3KP5A 4A5NA 3KP7A 1QZZA 3BROA 3V8JA 2Q2EA 4OU0A 3BJAA 3EDPA 3F8FA 2ZFWA 5JVTA 1QO0D 2KIFA 5LLQA 1OPCA 2PQ8A 4ETSA 1IN5A 3GLXA 4RB0A 1J5YA 5CJ9A 5DD4A 3KP6A 3FXRA 1TQMA 2FEZA 4LLLA 2L54A 1HQCA 4HYEA 4CZZA 1CF7A 5BPDA 3HYIA 3FWEA 2LNBA 1ON2A 2Q8KA 2HQNA 1BIAA 2XAFA 3KEOA 4AVPA 4Z2YA 5JHUA 4RGXA 3C18A 1SD6A 1U2WA 4RB3C 4ESFA 2XASA 1R1TA 1I1GA 2GQQA 4XSXF 2YX7A 3O3KA 1IXCA 3FHZA 3M1EA 2QZ8A 4HDVA 5HDNA 4BAYA 1D3YA 1BIBA 2P5VA 3F8MA 3KETA 3J81K 5JFRA 1O7FA 5H6QA 4I01A 4PCQA 2VODA 5IT9K 4GYGA 4LJZF 1Z05A 4IPAA 5LRSA 1O3RA 2A69F 2KKOA 2EA4A 3E97A 2WWYA 3O2PE 2YPRA 5ICCA 2P4WA 2PBIA 4Q47A 2B0LA 3J7AO 1MJ9A 3NRVA 1EH6A 3FMRA 1BBYA 2QQAA 2MC3A 3DP7A 2CW0F 1I1SA 2FNPA 5LEJA 1Y0UA 3L9FA 1YFHA 1QNTA 1FBSA 5LGNA 1ZHFA 1FOKA 4M9XA 2HEOA 3SZPA 4WF2A 3TDUC 2PLYA 4GO1A 2ZBKA 5BMZA 5FLXK 4RAYA 3HHGA 1HKQA 2LF8A 3MZHA 4O6JA 4EJTA 2OAZA 4HV5A 4XSZF 4PDKA 3OV8A 4P55A 4Q4ZF 1WRJA 2MBFA 1ZGJA 4WXCA 3TO6A 3N4MA 1HSJA 3LA3A 2NRAC 1MGTA 5DUKA 3VEPA 3LQRA 2VC1A 4CDGA 1TNSA 4YIIA 4BHBA 3VFZA 3TO9A 1O3QA 1SAXA 4KIBA 5ICEA 3RTRA 1BN5A 3L09A 1J9IA 1R58A 3GFLA 2CYYA 5LEKA 5LGUA 1HBXG 2K27A 2ESNA 1LQ1A 4A5MA 2MLKA 4IJAA 5KK1A 2PI0A 5DCMA 5ILVA 2HZTA 3K1PA 1QPMA 3QP5A 1S29A 3G73A 4KYWA 1FSHA 4CHUA 3EYIA 1R00A 4O5VA 5LHIA 2CG4A 4MQ9F 3CDHA 2PFBA 3K1MA 5D5VB 1G3WA 5FGMA 1S7OA 3CO7C 2G9WA 2KIMA 1XGSA 4ESJA 3N97A 5CVRA 1XDUA 2IA1A 4MGRA 3QU3A 1XD7A 4OIRF 4A12A 1HW5A 2PG4A 5BPIA 3H92A 4ENJA 5E20A 4HDUA 2EJRA 3P9IA 4S05A 5E1ZB 1WWXA 1K7AA 4AIKA 3HRSA 2JZYA 3J81Z 2O61A 3C3WA 4IHSA 1W7PD 1KYWA 4MHGA 5IT9Z 4DQ2A 2RDPA 5DEQA 4LG0A 4I02A 4R8HA 1YW8A 1XGOA 1W7PB 2K86A 3BDDA 1USSA 1LEBA 5K1YA 3DXJF 4LB6B 2KRFA 3CUQB 3K2ZA 2IT0A 2XIGA 3NEUA 2M87A 3MAJA 3HSEA 1K6OA 3L7WA 3R61A 4KMFA 3ZMZA 3H3ZA 1IXRC 1ZH5A 2LSOA 3NQOA 4UV8A 1I6XA 2BE5F 1SD4A 5JI6A 1RI7A 5ERIA 2V6CA 3TO7A 5FFZA 2LF7A 2ELHA 3PQJA 1KU9A 2F5DA 4KA4A 3KZYA 1LB2A 4YG2F 4ENNA 1ZREA 1V3FA 4RGUA 5K5RA 1QGPA 3L00A 4U0WA 1Z9CA 1B9NA 1GHCA 2K4JA 2V1DA 3GFIA 1P4AA 2NNNA 2JPBA 1XGMA 3HTUA 5F64A 2DQLA 1B1BA 3MEXA 1ZG3A 2GAUA 2OQGA 2WC2A 4F7ZA 4XBFA 2A3SA 1B6AA 4WK8F 1S7AA 3T8TA 1BI3A 5DD8A 4OIOF 3WG9A 3ZMSA 2RN7A 4HLXA 1PUEE 2ADUA 3ELKA 1L3LA 1FPQA 4U0VA 3Q9VA 3KCCA 2DTRA 1OYYA 2ZMEB 3C7JA 2RKHA 5L3DA 3RIRA 5H6RA 2ACJA 1FBUA 3SHFA 4HA8A 1WKMA 4ZYHA 5HOOA 3BPVA 3LA7A 4RAZA 5L3FA 2FBHA 3SXYA 1TLHB 1R5GA 2FSWA 2AXLA 2D1VA 1FX7A 3ZMVA 2EA2A 1KQ0A 5D8KB 4KNYA 3I0TA 3MCZA 2DPDA 1CGPA 4YIFA 4L0YB 3GUDA 4HX7A 1T98A 2O0YA 2DO7A 3V7RA 4EJOA 1FYKA 1F5TA 3FM5A 2M5WA 2M45A 5DDGA 2EFQA 3FMQA 2UWMA 2ZO4A 4BHCA 4KN7X 3O6BB 4EMSA 1G3SA 2GXBA 4HZFA 1R1VA 4EM1A 1PP7U 5D4SA 5K5QA 2V79A 1QBJA 4CYDA 3KP4A 5CVIA 5HDKA 1RZ4A 5FD6A 4G6DA 1F1ZA 1R5HA 4Y17A 4IRIA 1S8NA 2TDXA 2XROA 3TOBA 5FD5A 3H3UA 2GIVA 3BPXA 2HKOA 3FM3A 2H6BA 2K4BA 4KIFA 3GX4X 3P7NA 1ODDA 4M74A 2FF4A 4KT5C 5HLGA 1B9MA 1RNLA 3WE3A 3CLOA 3HRTA 4I7HA 4NB5A 4M6XA 3R4KA 3GYHX 3DEUA 3DV8A 5LHGA 1FT9A 1YLFA 2DK5A 2MLGA 4UVAA 5E18F 2XKOA 3RDIA 1YW9A 2V1UA 3JSPA 1Z7UA 2H27A 4FX0A 1F4KA 2DPUA 4OIPF 2ZKZA 1IN6A 4FHTA 2FE3A 2JTVA 3ULQB 4HX8A 3KZZA 2EFNA 1BI0A 3F21A 5D6EA 2A61A 4R79A 3F8NA 3Q5FA 1TQIA 4CGZA 3FXQA 2QVOA 2STWA 1OR7A 1K78A 3P9KA 4EGYA 1KU2A 1U3EM 1WQ2A 5BS6A 1LDKB 3ECHA 1D5VA 1SMTA 3I4PA 4OINF 2PEXA 4A6DA 1MJAA 1G4DA 5FB2A 3T8RA 1ZRDA 3F72A 2QLZA 3LWFA 1W5SA 2QWWA 2V9VA 5J8CA 1ZN2A 4L5JA 2L01A 4LGWA 3F6VA 4HAMA 1E17A 1T38A 4I0AA 3E6DA 2CQKA 4GGGA 1DPRA 3TOAA 2P6TA 3RKYA 3QOPA 2GWRA 1G3TA 2EWNA 4EV0A 3E3VA 3IHUA 1BC7C 2QBYB 2XHKA 3WTYC 1TBXA 6PAXA 1YO5C 1REPC 3OOPA 1HKSA 4KMUX 4EGZA 1XDSA 1FY7A 4HW0A 3CO6C 3MQ0A 1XMKA 4ZYEA 3KFWX 4KUMA 3QP6A 1UB9A 1BI1A 1R1UA 2DLLA 5TJJA 1T6SA 2Z99A 4AWXB 4G7ZF 2IA2A 2J5PA 4NHJA 2WTEA 1AOYA 2HYGD 4M73A 2HS5A 1H0MA 2IPQX 3KP3A 2A5YB 2VOOA 3ZPLA 4CXFA 1BOAA 1LVAA 3I64A 5DUIA 2GZWA 1K79A 2E7XA 4U7DA 5LHHA 3W6KB 1CF7B 4BYYA 4LK1F 3R0JA 4G94A 3M8EA 1J75A 1ZG5A 2XAQA 5FO5A 3LA2A 1I27A 3CUQC 2DW4A 5ICFA 2HWVA 2HDCA 4U88A 1NHAA 2XAHA 1BC8C 4FX4A 1YS6A 3EYYA 4BH9A 1FSEA 2P7CB 4B09A 4IHTA 2ZNYA 5L3BA 3D0SA 1D8KA 2VT2A 3QU6A 1MKMA 2BGCA 1UCRA 3FZVA 3RKXA 1J2XA 2L4MA 3JAMK 1IW7F 1J59A 1O3SA 2DI3A 4O3MA 5HS8A 5LGTA 1OMIA 2X0LA 1B59A 4CO8A 5ICGA 4BQAA 4ZZLA 2P5LC 3ZQ7A 2EB7A 4HF1A 2PN6A 1IRFA 4QWQA 4BHPA 2VE9A 5D8LB 4CICA 3L2CA 5BOXA 3RI4A 3ROUA 2ISYA 2JT1A 3GEZA 3G3ZA 4HBLA 3HOSA 2VOPA 5J8FA 1AWCA 3R0AA 3ZN0A 1BI2A 4Q5SF 3Q9SA 4ASNA 3E6BA 1DPUA 5AIPA 1HXDA 4A2UA 3WU0A 3IWZA 2NAZA 3K69A 3ZP5A 2RGVA 2Z9OA 4XLNF 2O6GE 1OKRA 1J7KA 2D45A 4TV7A 4HLYA 3TQNA 1KU3A 3HOTA 1U5TB 1HW1A 2DT5A 2DU9A 3HTSB 1UFMA 4HF0A 1KYZA 4EJWA 2UXNA 4IRGA 4G7HF 3WU1B 2LKPA 1MDMA 2JSCA 3F8BA 3WGGA 1Z1DA 3QPHA 2P8TA 5DCMB 1SFXA 4RGSA 2O8XA 2W25A 2CSOA 5D5UB 3WTUC 2O03A 1DUXC 2Y0MA 2R7DA 1LEAA 3JW4A 5FLXZ 2YX4A 4KICA 4M72A 4P9UA 1BM9A 4P5OA 2FNAA 2M30A 4AIHA 1RUOA 1STZA 1G6NA 2MH2A 5CVJA 4IF4A 1Z6TA 3HSFA 5E1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFI A;  1MJB A;  3I71 A;  2D1H A;  3DKW A;  3RPQ A;  4JBA A;  1U78 A;  3E6C C;  5HLI A;  3ZMU A;  2ISZ A;  4RB2 C;  1L0O C;  2IVM A;  2IP2 A;  1YG2 A;  1GVJ A;  2QEN A;  4M9Z A;  2XAG A;  4LG0 B;  2HGC A;  2GA2 A;  2JPC A;  1ZAR A;  2CGP A;  2FA5 A;  1IRG A;  2MH9 A;  2DK8 A;  4ON0 A;  1XCB A;  2OA4 A;  3T1B A;  3V8L A;  4MTD A;  1V4R A;  5D4R A;  3BOQ A;  2GA1 A;  3WTX C;  3GW2 A;  2V1X A;  4YFK F;  2FXA A;  3I5U A;  2CO5 A;  5K5O A;  3BJO A;  4AD9 A;  1ZLK A;  2QUF A;  3KP2 A;  1XMA A;  1D8J A;  4L9T A;  2M1B A;  2IW5 A;  3RKW A;  4IRH A;  2D2W A;  2RVC A;  4S04 A;  1I5Z A;  4GCV A;  2G7U A;  5CVV A;  2BYV E;  3FX3 A;  2W24 A;  3K1N A;  1KQ8 A;  2HTS A;  5EEH A;  3QRF F;  3I58 A;  2EV5 A;  3JSO A;  2VT3 A;  5L3E A;  1JGS A;  1XSX A;  1EV7 A;  2FRH A;  2G7H A;  1LNW A;  2FU4 A;  4LLN A;  4UHT A;  1OYI A;  2RNJ A;  2Q0O A;  4UNO A;  3DPT A;  3E6M A;  4G7O F;  3I59 A;  3HRM A;  4P96 A;  1O7L A;  1P6R A;  3I53 A;  3V7S A;  4H0E A;  5ILU A;  4HQE A;  5AON A;  1ZYR F;  2IA0 A;  4UVB A;  2P7V B;  3CTA A;  2DFI A;  1HST A;  3MWM A;  4B8X A;  4WXH A;  4HOB A;  3M9A A;  3F8C A;  1XB4 A;  4GYI A;  4MEX F;  4G8X A;  2Z5U A;  4I98 B;  2VBW A;  2L02 A;  1TW2 A;  3RJP A;  1HKT A;  2VXZ A;  1FBQ A;  3E5X A;  4L9J A;  2NNY A;  1SFU A;  3KEQ A;  1TW3 A;  2M8E A;  1YQA A;  2XUB A;  3DFG A;  4AIJ A;  4EJV A;  4ZYG A;  4LMY A;  3RYP A;  3WTV C;  1W4M A;  3BWG A;  2EV6 A;  3DPL C;  2OU2 A;  4Y15 A;  1QZY A;  4N0B A;  1FWZ A;  5CLS A;  3EUH A;  3LQQ A;  1O57 A;  1LDD A;  2FBI A;  2H94 A;  5LBQ A;  3GZ6 A;  3GVA A;  3K9T A;  2OQR A;  2VON A;  2MD5 A;  2K7L A;  3E5U A;  2LDU A;  2K02 A;  2XRN A;  3V4G A;  4A0Y A;  3ISP A;  3F3X A;  1SMY F;  4JQF A;  2DAO A;  2F5C A;  3JTH A;  2RQP A;  2ETH A;  4FT8 A;  4K2E A;  4KDP A;  1ZAO A;  4P9F A;  3GFM A;  2FOK A;  4HQM A;  3WGI A;  3EET A;  2Z33 A;  1WI9 A;  1FC3 A;  1R22 A;  2H09 A;  1P4W A;  4MTE A;  5BQT A;  4I0B A;  4U7B A;  3K0L A;  3HSR A;  1JE8 A;  4HF2 A;  4WX9 A;  3ZN1 A;  1X3U A;  4KN4 X;  1U8R A;  4JK1 X;  1DDN A;  3W6J B;  2X4H A;  4KIG A;  2IJL A;  1FYM A;  2A6H F;  1BJA A;  2STT A;  2P6S A;  4YFN F;  1K78 B;  2XV4 S;  3F23 A;  4ZH4 F;  3WTS C;  1MZB A;  1WSU A;  1T0F A;  1DP7 P;  1SD5 A;  5F6F A;  4ZZD A;  2RC4 A;  1FYL A;  4QLC U;  2EK5 A;  2QQB A;  3MZY A;  4UUV A;  1MD0 A;  2F5E A;  3M8F A;  3WTZ A;  1C0W A;  1TNT A;  3V7C A;  1H9T A;  1FZP B;  4NQW A;  3J80 K;  1XCV A;  1YS7 A;  2XAJ A;  5D5W B;  3ECO A;  5TRD A;  5D5X B;  1U5T C;  4XRF A;  3SQN A;  3LST A;  1ZGA A;  3GWZ A;  2A07 F;  1ZRC A;  2KJC A;  4HV6 A;  2VE8 A;  3S2W A;  1FLI A;  1UHW A;  1ZRF A;  1TQP A;  1KQ9 A;  1G3Y A;  2L4A A;  2CFX A;  1LJ9 A;  3U9G A;  4EJU A;  3P9C A;  1XN7 A;  3AAF A;  1ON1 A;  1IAW A;  3IRQ A;  3ML6 A;  1Z91 A;  4DNC A;  2HFH A;  4OIQ F;  2PJP A;  4A6E A;  1FP1 D;  5HLH A;  2GXG A;  3WGH A;  3F22 A;  3FMS A;  3REO A;  2FMY A;  2FML A;  4UXN A;  5DCF A;  1QQI A;  1U5T A;  3EQL F;  1A04 A;  1YYV A;  5FFX A;  2FQ3 A;  1IF1 A;  2Y75 A;  4LD5 A;  4U0Y A;  4MQV A;  1W7P A;  3HUG A;  2OZ6 A;  2E1C A;  4L9V A;  3LFK A;  3R60 A;  3SZT A;  3CUQ A;  2QYO A;  1Z6R A;  4G6Q A;  4LLG F;  5H20 A;  3SFZ A;  2IRF G;  5A2Q K;  2KIU A;  1Q1H A;  1YW7 A;  2HTJ A;  2JRT A;  1RIO H;  3ABT A;  4L0Z B;  2VBY A;  3GF2 A;  1OYW A;  2VBZ A;  2VN2 A;  4L9N A;  4LK0 F;  2Y48 A;  5HDG A;  2YR2 A;  3CJN A;  3M7G A;  3ZMT A;  4D0P A;  5D6F A;  1PDN C;  3KE2 A;  1S6L A;  5HVQ C;  2P5K A;  2NS0 A;  5KVR A;  1EH8 A;  4PGG A;  4OMY A;  4PZJ A;  4A0Z A;  2ZJ2 A;  3QAH A;  1JHH A;  2O3F A;  1R36 A;  2Z3Y A;  1T39 A;  3BP8 A;  4R1H A;  4OOI A;  1XGN A;  5E8G A;  1W5T A;  2OD5 A;  4UV9 A;  3QPT A;  1ZLJ A;  3CUO A;  4KFC A;  1HW2 A;  5LRR A;  1FP2 A;  5L3C A;  2ZXJ A;  1YTY A;  2COM A;  3COA C;  3KLO A;  5J6X A;  1KU7 A;  4G9Y A;  1J0R A;  2ESH A;  3IC7 A;  1R7J A;  2EFW A;  4MNU A;  2HR3 A;  2RV8 A;  3J80 Z;  1YIO A;  2R7F A;  4L5I A;  1P2F A;  5CVU A;  2ZME A;  3DF8 A;  5E1W A;  1T2K A;  3HHH A;  3LAP A;  2W85 A;  3DQV C;  2HYF A;  1IN4 A;  3ABU A;  2QM3 A;  4GXO A;  3GO5 A;  3V8K A;  3PQK A;  3E5Q A;  3U1D A;  4M71 A;  2QQ9 A;  1ULY A;  1KGS A;  2C6Y A;  1IN7 A;  4L18 B;  2HOE A;  3VOE A;  2EFO A;  2NYX A;  3TKY A;  1GXQ A;  2OZU A;  4EVI A;  2BBY A;  4Y13 A;  1P4X A;  1JHF A;  2XKP A;  3JAM Z;  1JXS A;  1MDM B;  3VB2 A;  2PMH A;  4M9S A;  1P92 A;  1IUY A;  5HS9 A;  3IWF A;  4OMZ A;  1IZ1 A;  5IT3 A;  3KLN A;  2AS5 F;  2FBK A;  5EEG A;  1FNN A;  3F6O A;  5CYV A;  4IXA A;  4A0X A;  4WXD A;  2UZK A;  5A2Q Z;  1PP8 F;  4LB5 A;  1UST A;  2HQR A;  5ED4 A;  5HS7 A;  3RPU A;  3GZ5 A;  1UHM A;  2WV0 A;  4N9H A;  1E2X A;  3TDZ C;  3BY6 A;  3IKT A;  1H9G A;  3R6S A;  4RGR A;  1GXP A;  4M6Y A;  5JR3 A;  2OBP A;  3HIF A;  1F9N A;  2E7W A;  3I54 A;  3U2R A;  4BNC A;  1ONV A;  3ERE D;  4ENM A;  4ESB A;  1IXS B;  1LDJ A;  4RS8 A;  2DBB A;  2YSR A;  3IL2 A;  2L3D A;  1RUN A;  3GXO A;  4PGH A;  3FXU A;  3WE2 A;  2XVC A;  3WTT C;  3TGN A;  2CWE A;  1SFE A;  2F2E A;  3C1D A;  3RYR A;  4EQQ A;  2BEO A;  2EV0 A;  3IKV A;  4WCG A;  1IN8 A;  4BXU A;  3WTW C;  3VOD A;  2ZNZ A;  2HKX A;  2MA3 A;  4IVN A;  3B02 A;  3JTG A;  1XSV A;  5E8I A;  2VC0 A;  2W84 A;  3BJ6 A;  4I2O A;  4UVC A;  3LAJ A;  1O3T A;  1SD7 A;  2F5F A;  2EFP A;  2E1N A;  2A68 F;  3T5X A;  1KA8 A;  1R23 A;  3ZMD A;  4Q48 A;  2J5O A;  4N9I A;  4XLP F;  4ENK A;  5E17 F;  4HX4 A;  2BV6 A;  4E70 A;  3D5L A;  1B4A A;  5F1R A;  1U6G A;  2DQR A;  3WOD F;  4EM0 B;  4I09 A;  1EH7 A;  2H6C A;  3BZ6 A;  2ZCW A;  3B73 A;  4ZYD A;  5DV5 A;  3HRU A;  5L3G A;  1VTN C;  3T0Y A;  2XGX A;  1TTY A;  3GFJ A;  3MFK A;  4MEY F;  2YU3 A;  4WWC A;  2QBY A;  2PMU A;  2R3S A;  2KJB A;  3I59 B;  4EM2 A;  1XSD A;  4RB1 A;  1ZG1 A;  2A6E F;  2VBX A;  5AIQ A;  3IRR A;  5DYM A;  4YFX F;  2W57 A;  5ILS A;  1S3J A;  4LFU A;  2UXX A;  3FF5 A;  3KP5 A;  4A5N A;  3KP7 A;  1QZZ A;  3BRO A;  3V8J A;  2Q2E A;  4OU0 A;  3BJA A;  3EDP A;  3F8F A;  2ZFW A;  5JVT A;  1QO0 D;  2KIF A;  5LLQ A;  1OPC A;  2PQ8 A;  4ETS A;  1IN5 A;  3GLX A;  4RB0 A;  1J5Y A;  5CJ9 A;  5DD4 A;  3KP6 A;  3FXR A;  1TQM A;  2FEZ A;  4LLL A;  2L54 A;  1HQC A;  4HYE A;  4CZZ A;  1CF7 A;  5BPD A;  3HYI A;  3FWE A;  2LNB A;  1ON2 A;  2Q8K A;  2HQN A;  1BIA A;  2XAF A;  3KEO A;  4AVP A;  4Z2Y A;  5JHU A;  4RGX A;  3C18 A;  1SD6 A;  1U2W A;  4RB3 C;  4ESF A;  2XAS A;  1R1T A;  1I1G A;  2GQQ A;  4XSX F;  2YX7 A;  3O3K A;  1IXC A;  3FHZ A;  3M1E A;  2QZ8 A;  4HDV A;  5HDN A;  4BAY A;  1D3Y A;  1BIB A;  2P5V A;  3F8M A;  3KET A;  3J81 K;  5JFR A;  1O7F A;  5H6Q A;  4I01 A;  4PCQ A;  2VOD A;  5IT9 K;  4GYG A;  4LJZ F;  1Z05 A;  4IPA A;  5LRS A;  1O3R A;  2A69 F;  2KKO A;  2EA4 A;  3E97 A;  2WWY A;  3O2P E;  2YPR A;  5ICC A;  2P4W A;  2PBI A;  4Q47 A;  2B0L A;  3J7A O;  1MJ9 A;  3NRV A;  1EH6 A;  3FMR A;  1BBY A;  2QQA A;  2MC3 A;  3DP7 A;  2CW0 F;  1I1S A;  2FNP A;  5LEJ A;  1Y0U A;  3L9F A;  1YFH A;  1QNT A;  1FBS A;  5LGN A;  1ZHF A;  1FOK A;  4M9X A;  2HEO A;  3SZP A;  4WF2 A;  3TDU C;  2PLY A;  4GO1 A;  2ZBK A;  5BMZ A;  5FLX K;  4RAY A;  3HHG A;  1HKQ A;  2LF8 A;  3MZH A;  4O6J A;  4EJT A;  2OAZ A;  4HV5 A;  4XSZ F;  4PDK A;  3OV8 A;  4P55 A;  4Q4Z F;  1WRJ A;  2MBF A;  1ZGJ A;  4WXC A;  3TO6 A;  3N4M A;  1HSJ A;  3LA3 A;  2NRA C;  1MGT A;  5DUK A;  3VEP A;  3LQR A;  2VC1 A;  4CDG A;  1TNS A;  4YII A;  4BHB A;  3VFZ A;  3TO9 A;  1O3Q A;  1SAX A;  4KIB A;  5ICE A;  3RTR A;  1BN5 A;  3L09 A;  1J9I A;  1R58 A;  3GFL A;  2CYY A;  5LEK A;  5LGU A;  1HBX G;  2K27 A;  2ESN A;  1LQ1 A;  4A5M A;  2MLK A;  4IJA A;  5KK1 A;  2PI0 A;  5DCM A;  5ILV A;  2HZT A;  3K1P A;  1QPM A;  3QP5 A;  1S29 A;  3G73 A;  4KYW A;  1FSH A;  4CHU A;  3EYI A;  1R00 A;  4O5V A;  5LHI A;  2CG4 A;  4MQ9 F;  3CDH A;  2PFB A;  3K1M A;  5D5V B;  1G3W A;  5FGM A;  1S7O A;  3CO7 C;  2G9W A;  2KIM A;  1XGS A;  4ESJ A;  3N97 A;  5CVR A;  1XDU A;  2IA1 A;  4MGR A;  3QU3 A;  1XD7 A;  4OIR F;  4A12 A;  1HW5 A;  2PG4 A;  5BPI A;  3H92 A;  4ENJ A;  5E20 A;  4HDU A;  2EJR A;  3P9I A;  4S05 A;  5E1Z B;  1WWX A;  1K7A A;  4AIK A;  3HRS A;  2JZY A;  3J81 Z;  2O61 A;  3C3W A;  4IHS A;  1W7P D;  1KYW A;  4MHG A;  5IT9 Z;  4DQ2 A;  2RDP A;  5DEQ A;  4LG0 A;  4I02 A;  4R8H A;  1YW8 A;  1XGO A;  1W7P B;  2K86 A;  3BDD A;  1USS A;  1LEB A;  5K1Y A;  3DXJ F;  4LB6 B;  2KRF A;  3CUQ B;  3K2Z A;  2IT0 A;  2XIG A;  3NEU A;  2M87 A;  3MAJ A;  3HSE A;  1K6O A;  3L7W A;  3R61 A;  4KMF A;  3ZMZ A;  3H3Z A;  1IXR C;  1ZH5 A;  2LSO A;  3NQO A;  4UV8 A;  1I6X A;  2BE5 F;  1SD4 A;  5JI6 A;  1RI7 A;  5ERI A;  2V6C A;  3TO7 A;  5FFZ A;  2LF7 A;  2ELH A;  3PQJ A;  1KU9 A;  2F5D A;  4KA4 A;  3KZY A;  1LB2 A;  4YG2 F;  4ENN A;  1ZRE A;  1V3F A;  4RGU A;  5K5R A;  1QGP A;  3L00 A;  4U0W A;  1Z9C A;  1B9N A;  1GHC A;  2K4J A;  2V1D A;  3GFI A;  1P4A A;  2NNN A;  2JPB A;  1XGM A;  3HTU A;  5F64 A;  2DQL A;  1B1B A;  3MEX A;  1ZG3 A;  2GAU A;  2OQG A;  2WC2 A;  4F7Z A;  4XBF A;  2A3S A;  1B6A A;  4WK8 F;  1S7A A;  3T8T A;  1BI3 A;  5DD8 A;  4OIO F;  3WG9 A;  3ZMS A;  2RN7 A;  4HLX A;  1PUE E;  2ADU A;  3ELK A;  1L3L A;  1FPQ A;  4U0V A;  3Q9V A;  3KCC A;  2DTR A;  1OYY A;  2ZME B;  3C7J A;  2RKH A;  5L3D A;  3RIR A;  5H6R A;  2ACJ A;  1FBU A;  3SHF A;  4HA8 A;  1WKM A;  4ZYH A;  5HOO A;  3BPV A;  3LA7 A;  4RAZ A;  5L3F A;  2FBH A;  3SXY A;  1TLH B;  1R5G A;  2FSW A;  2AXL A;  2D1V A;  1FX7 A;  3ZMV A;  2EA2 A;  1KQ0 A;  5D8K B;  4KNY A;  3I0T A;  3MCZ A;  2DPD A;  1CGP A;  4YIF A;  4L0Y B;  3GUD A;  4HX7 A;  1T98 A;  2O0Y A;  2DO7 A;  3V7R A;  4EJO A;  1FYK A;  1F5T A;  3FM5 A;  2M5W A;  2M45 A;  5DDG A;  2EFQ A;  3FMQ A;  2UWM A;  2ZO4 A;  4BHC A;  4KN7 X;  3O6B B;  4EMS A;  1G3S A;  2GXB A;  4HZF A;  1R1V A;  4EM1 A;  1PP7 U;  5D4S A;  5K5Q A;  2V79 A;  1QBJ A;  4CYD A;  3KP4 A;  5CVI A;  5HDK A;  1RZ4 A;  5FD6 A;  4G6D A;  1F1Z A;  1R5H A;  4Y17 A;  4IRI A;  1S8N A;  2TDX A;  2XRO A;  3TOB A;  5FD5 A;  3H3U A;  2GIV A;  3BPX A;  2HKO A;  3FM3 A;  2H6B A;  2K4B A;  4KIF A;  3GX4 X;  3P7N A;  1ODD A;  4M74 A;  2FF4 A;  4KT5 C;  5HLG A;  1B9M A;  1RNL A;  3WE3 A;  3CLO A;  3HRT A;  4I7H A;  4NB5 A;  4M6X A;  3R4K A;  3GYH X;  3DEU A;  3DV8 A;  5LHG A;  1FT9 A;  1YLF A;  2DK5 A;  2MLG A;  4UVA A;  5E18 F;  2XKO A;  3RDI A;  1YW9 A;  2V1U A;  3JSP A;  1Z7U A;  2H27 A;  4FX0 A;  1F4K A;  2DPU A;  4OIP F;  2ZKZ A;  1IN6 A;  4FHT A;  2FE3 A;  2JTV A;  3ULQ B;  4HX8 A;  3KZZ A;  2EFN A;  1BI0 A;  3F21 A;  5D6E A;  2A61 A;  4R79 A;  3F8N A;  3Q5F A;  1TQI A;  4CGZ A;  3FXQ A;  2QVO A;  2STW A;  1OR7 A;  1K78 A;  3P9K A;  4EGY A;  1KU2 A;  1U3E M;  1WQ2 A;  5BS6 A;  1LDK B;  3ECH A;  1D5V A;  1SMT A;  3I4P A;  4OIN F;  2PEX A;  4A6D A;  1MJA A;  1G4D A;  5FB2 A;  3T8R A;  1ZRD A;  3F72 A;  2QLZ A;  3LWF A;  1W5S A;  2QWW A;  2V9V A;  5J8C A;  1ZN2 A;  4L5J A;  2L01 A;  4LGW A;  3F6V A;  4HAM A;  1E17 A;  1T38 A;  4I0A A;  3E6D A;  2CQK A;  4GGG A;  1DPR A;  3TOA A;  2P6T A;  3RKY A;  3QOP A;  2GWR A;  1G3T A;  2EWN A;  4EV0 A;  3E3V A;  3IHU A;  1BC7 C;  2QBY B;  2XHK A;  3WTY C;  1TBX A;  6PAX A;  1YO5 C;  1REP C;  3OOP A;  1HKS A;  4KMU X;  4EGZ A;  1XDS A;  1FY7 A;  4HW0 A;  3CO6 C;  3MQ0 A;  1XMK A;  4ZYE A;  3KFW X;  4KUM A;  3QP6 A;  1UB9 A;  1BI1 A;  1R1U A;  2DLL A;  5TJJ A;  1T6S A;  2Z99 A;  4AWX B;  4G7Z F;  2IA2 A;  2J5P A;  4NHJ A;  2WTE A;  1AOY A;  2HYG D;  4M73 A;  2HS5 A;  1H0M A;  2IPQ X;  3KP3 A;  2A5Y B;  2VOO A;  3ZPL A;  4CXF A;  1BOA A;  1LVA A;  3I64 A;  5DUI A;  2GZW A;  1K79 A;  2E7X A;  4U7D A;  5LHH A;  3W6K B;  1CF7 B;  4BYY A;  4LK1 F;  3R0J A;  4G94 A;  3M8E A;  1J75 A;  1ZG5 A;  2XAQ A;  5FO5 A;  3LA2 A;  1I27 A;  3CUQ C;  2DW4 A;  5ICF A;  2HWV A;  2HDC A;  4U88 A;  1NHA A;  2XAH A;  1BC8 C;  4FX4 A;  1YS6 A;  3EYY A;  4BH9 A;  1FSE A;  2P7C B;  4B09 A;  4IHT A;  2ZNY A;  5L3B A;  3D0S A;  1D8K A;  2VT2 A;  3QU6 A;  1MKM A;  2BGC A;  1UCR A;  3FZV A;  3RKX A;  1J2X A;  2L4M A;  3JAM K;  1IW7 F;  1J59 A;  1O3S A;  2DI3 A;  4O3M A;  5HS8 A;  5LGT A;  1OMI A;  2X0L A;  1B59 A;  4CO8 A;  5ICG A;  4BQA A;  4ZZL A;  2P5L C;  3ZQ7 A;  2EB7 A;  4HF1 A;  2PN6 A;  1IRF A;  4QWQ A;  4BHP A;  2VE9 A;  5D8L B;  4CIC A;  3L2C A;  5BOX A;  3RI4 A;  3ROU A;  2ISY A;  2JT1 A;  3GEZ A;  3G3Z A;  4HBL A;  3HOS A;  2VOP A;  5J8F A;  1AWC A;  3R0A A;  3ZN0 A;  1BI2 A;  4Q5S F;  3Q9S A;  4ASN A;  3E6B A;  1DPU A;  5AIP A;  1HXD A;  4A2U A;  3WU0 A;  3IWZ A;  2NAZ A;  3K69 A;  3ZP5 A;  2RGV A;  2Z9O A;  4XLN F;  2O6G E;  1OKR A;  1J7K A;  2D45 A;  4TV7 A;  4HLY A;  3TQN A;  1KU3 A;  3HOT A;  1U5T B;  1HW1 A;  2DT5 A;  2DU9 A;  3HTS B;  1UFM A;  4HF0 A;  1KYZ A;  4EJW A;  2UXN A;  4IRG A;  4G7H F;  3WU1 B;  2LKP A;  1MDM A;  2JSC A;  3F8B A;  3WGG A;  1Z1D A;  3QPH A;  2P8T A;  5DCM B;  1SFX A;  4RGS A;  2O8X A;  2W25 A;  2CSO A;  5D5U B;  3WTU C;  2O03 A;  1DUX C;  2Y0M A;  2R7D A;  1LEA A;  3JW4 A;  5FLX Z;  2YX4 A;  4KIC A;  4M72 A;  4P9U A;  1BM9 A;  4P5O A;  2FNA A;  2M30 A;  4AIH A;  1RUO A;  1STZ A;  1G6N A;  2MH2 A;  5CVJ A;  4IF4 A;  1Z6T A;  3HSF A;  5E1X A; 
#chains in the Genus database with same CATH topology
 3PFI A;  1MJB A;  3I71 A;  2D1H A;  3DKW A;  3RPQ A;  4JBA A;  1U78 A;  3E6C C;  1X19 A;  3LFU A;  3OIO A;  5EF6 A;  4Y33 A;  3QWL A;  5HLI A;  2R5Y A;  2EIN H;  3MZ8 A;  4MIM A;  2NOG A;  3ZMU A;  2DA6 A;  1IUF A;  5H2F C;  2COB A;  4RB2 C;  1L0O C;  2ISZ A;  1NK2 P;  2IVM A;  2IP2 A;  4XLA A;  3A1Y A;  1YG2 A;  4CUG A;  1GVJ A;  1GUU A;  2QEN A;  4M9Z A;  2MW8 A;  4E7S A;  2XAG A;  5K7H A;  4LG0 B;  1OCO H;  2HGC A;  1MBH A;  3FK6 A;  2GA2 A;  3IH3 A;  2DTZ A;  2JPC A;  2F5V A;  1ZAR A;  2CGP A;  4XLF A;  2FA5 A;  3ZQI A;  1MBE A;  1X1P A;  1IRG A;  3JRC A;  3HPG A;  2MH9 A;  2DK8 A;  4ON0 A;  1R5I D;  5JVG F;  2BHY A;  1OCR H;  1XCB A;  2OA4 A;  3T1B A;  4NC7 A;  3V8L A;  4MTD A;  1ENH A;  3EUA A;  2DMP A;  1V4R A;  5D4R A;  3BOQ A;  1P7I A;  4XKC A;  2GA1 A;  5EYR A;  2A5W A;  4RAF A;  1OCZ H;  3WTX C;  4A93 J;  3GW2 A;  2V1X A;  3TBI A;  1HLV A;  4YFK F;  5F1J A;  5FJ8 J;  2VKH A;  3VPR A;  2HXI A;  2ZJP F;  2FXA A;  1TWH J;  3OYK A;  3HOU J;  3I5U A;  4JX5 A;  2CO5 A;  5K5O A;  3BJO A;  1YI2 I;  1X1B A;  4AC0 A;  3OYB A;  3K7A J;  4AD9 A;  1ZLK A;  1K83 J;  2QUF A;  4PSX A;  3KP2 A;  3CCM I;  1XMA A;  3G1O A;  1E0E A;  2WAF A;  2LRD A;  5FKM A;  2BW3 B;  3AL0 C;  1D8J A;  4L9T A;  3PO2 J;  3QYB A;  2L9N A;  2IW5 A;  2M1B A;  2QKM B;  3RKW A;  4IRH A;  2D2W A;  1W1W E;  2RVC A;  4S04 A;  3CLQ A;  1FMW A;  3TP0 A;  5FRM A;  1I5Z A;  4GCV A;  2G7U A;  3AKZ A;  3HZJ A;  5CVV A;  4F3Q A;  3L2Q A;  3HXL A;  2LY9 A;  2BYV E;  3FX3 A;  3U21 A;  2W24 A;  3AG1 H;  4AYB A;  1ETY A;  2KFD A;  3K1N A;  1T08 B;  1Y6I A;  1KQ8 A;  2HTS A;  5EEH A;  2QGU A;  3QRF F;  3I58 A;  4BDY A;  2EV5 A;  3JSO A;  1LUJ B;  3S8P A;  2VT3 A;  5L3E A;  3CMM A;  4ZDP A;  1JGS A;  4A3E J;  1YIJ I;  1XSX A;  1EV7 A;  2IGO A;  2FRH A;  2G7H A;  4XRM A;  5F0H A;  1ZGW A;  1LNW A;  2AXT C;  2F4O B;  2LLK A;  2DN0 A;  2CRG A;  2FU4 A;  4X0G A;  4CCM A;  4LLN A;  2WV1 A;  4UHT A;  1OYI A;  3ZXS A;  2RNJ A;  4AUX A;  2Q0O A;  4UNO A;  3DPT A;  2CU7 A;  2LR8 A;  3E6M A;  4G7O F;  5FKL A;  1XTA A;  4DYR A;  3S1M J;  3I59 A;  4XLC A;  4GDF A;  4QIW N;  1FJL A;  3HRM A;  4P96 A;  1O7L A;  3V42 A;  1P6R A;  3I53 A;  3LSM A;  3V7S A;  4H0E A;  1EJ9 A;  1SFK A;  5ILU A;  4HQE A;  1BW5 A;  3QPS A;  2R93 J;  3FK7 A;  4IEJ A;  5AON A;  1ZYR F;  3H35 A;  1A35 A;  1TWG J;  1JUM A;  3LSP A;  2IA0 A;  2E2J J;  4UVB A;  3BLY A;  2P7V B;  1F36 A;  4E7Z A;  2VLA A;  2IGM A;  1X2M A;  3CTA A;  3TED A;  2DFI A;  1HST A;  4A3I J;  3MWM A;  3ABL H;  2H1L A;  2VQC A;  1VF9 A;  4B8X A;  3HDD A;  3KZI C;  3G6E I;  2M7A A;  3DLA A;  3HC7 A;  4WXH A;  1R6R A;  2EZL A;  5J47 A;  1IV6 A;  3HBL A;  2Y31 A;  4HOB A;  3FIW A;  3LMM A;  3M9A A;  1OCT C;  3BQY A;  3F8C A;  1XB4 A;  4GYI A;  1ZEL A;  4XN0 A;  4MEX F;  4G8X A;  2Z5U A;  2EIJ H;  4I98 B;  2JA6 J;  2VBW A;  3PNT A;  4M6V A;  4CA0 A;  4ITV A;  4NNJ A;  2L02 A;  2ZJR F;  1TW2 A;  2K3P A;  4H4K C;  2LD5 A;  3RJP A;  3S3M A;  1ZQ3 P;  1HKT A;  2VXZ A;  3PL8 A;  1EA3 A;  2E2I J;  1FBQ A;  1FOY A;  3E5X A;  3C2G A;  4L9J A;  2CQQ A;  3A4C A;  3OS1 A;  2NNY A;  3KEQ A;  1SFU A;  2DOF A;  2DYR H;  3X2Q H;  1TW3 A;  4NDL A;  2M8E A;  4HSR A;  1APL C;  1YQA A;  2XUB A;  4D9J A;  5HNH A;  3MD2 A;  3L2W A;  3DFG A;  4AIJ A;  4EJV A;  4XOR A;  4ZYG A;  4LMY A;  3RYP A;  4YEL A;  3WTV C;  1W4M A;  2XF5 A;  4IHV A;  1MMA A;  3BWG A;  2EV6 A;  5B1B H;  2DT6 A;  4M3E A;  4IOA F;  3DPL C;  5KAF C;  5FKK A;  2OU2 A;  4LG3 A;  4Y15 A;  1QZY A;  3BR1 A;  4LIT A;  4N0B A;  3O8G A;  1FWZ A;  2HVS A;  5CLS A;  1Z3Y A;  4HEA 2;  3EUH A;  3LQQ A;  1O57 A;  2Y9Y A;  4G6T B;  1N77 A;  4ZC3 A;  1LDD A;  2FBI A;  2H94 A;  4FIS A;  4IL6 C;  5LBQ A;  3GZ6 A;  3GVA A;  1MBJ A;  3H9J A;  4ABZ A;  3K9T A;  2OQR A;  2VON A;  2DOE A;  2MD5 A;  2GLO A;  2K7L A;  3E5U A;  3WHC A;  2LDU A;  2K02 A;  2XRN A;  3V4G A;  4F55 A;  3KYL A;  1JI8 A;  1T0F C;  1Z0X A;  4A0Y A;  5J4Y A;  2VUM J;  5EZH A;  3ISP A;  3LSK A;  2DXI A;  3F3X A;  1SMY F;  4JQF A;  1BR4 A;  2DAO A;  4KIT B;  2F5C A;  3JTH A;  4F93 B;  3FBI B;  2RQP A;  2ETH A;  4FT8 A;  1K4T A;  3OR2 C;  3M4O J;  4K2E A;  1XG1 A;  4KDP A;  1ZAO A;  4P9F A;  3GFM A;  2FOK A;  4HQM A;  2CV0 A;  3WGI A;  5B5E C;  3EET A;  2K40 A;  4L5E A;  2Z33 A;  2XF6 A;  1WI9 A;  5EJC A;  1FC3 A;  1R22 A;  2H09 A;  2NS8 A;  1P4W A;  4MTE A;  5BQT A;  2LBF A;  2ZJQ F;  4I0B A;  1RKW A;  3PIO F;  4U7B A;  5IOY A;  3K0L A;  3HSR A;  3AG4 H;  4RM2 A;  2HQA A;  1JE8 A;  1YJ9 I;  4HF2 A;  5M5W J;  4WX9 A;  3ZN1 A;  4IHW A;  4QPQ A;  2K9N A;  2O9L A;  1X3U A;  4KN4 X;  1U8R A;  4JK1 X;  1DDN A;  4BS9 A;  1YJN I;  3W6J B;  5GAH J;  2X4H A;  4KIG A;  2IJL A;  3AG2 H;  3FXM A;  5FLV A;  3M3Y J;  1FYM A;  1FEX A;  1WGX A;  2A6H F;  1BJA A;  2M0M A;  2XPV A;  2P6S A;  2STT A;  4YFN F;  1K78 B;  1TP4 A;  2LTP A;  2XV4 S;  3M8J A;  3F23 A;  4ZH4 F;  3WTS C;  1MZB A;  1WSU A;  1T0F A;  2QSH X;  3FKI J;  3KIO A;  2OV7 A;  5IP6 A;  1DP7 P;  2E36 A;  3HGY A;  4PSW A;  2PMZ N;  4XID A;  9ANT A;  3ABM H;  2WA0 A;  1B72 A;  1VQ9 I;  1JGG A;  2L0K A;  1SD5 A;  5KAI C;  3CCV I;  5F6F A;  2EIL H;  4ZZD A;  2K85 A;  1YOV B;  2HPI A;  2RC4 A;  3UKG A;  2W48 A;  5FKO A;  1FYL A;  4QLC U;  2EK5 A;  2QQB A;  1DGW Y;  3MZY A;  3U1K A;  1Y8R B;  4UUV A;  1MD0 A;  5IYB J;  3JRA A;  2F5E A;  3M8F A;  1S5L C;  3WTZ A;  1BJZ A;  3HPH A;  3IH4 A;  2K9M A;  1JKO C;  1NH3 A;  3GTM J;  5KHD A;  2R0Q C;  2DA2 A;  3LSI A;  1HF0 A;  1C0W A;  2L7M P;  3HEF A;  3Q0V A;  3TW7 A;  1TNT A;  2FOW A;  3V7C A;  1H9T A;  1BW6 A;  2ID6 A;  1VFC A;  1FZP B;  3QPL A;  1MSF C;  4NQW A;  2PJR A;  3J80 K;  1K6Y A;  1X2N A;  2DOD A;  1XCV A;  1YS7 A;  3GTP J;  3M1C A;  4F52 A;  3QQA A;  2XAJ A;  5J1Y A;  5D5W B;  3WHB A;  3ECO A;  5TRD A;  3BTJ A;  2YUS A;  3CES A;  5D5X B;  1U5T C;  1JT6 A;  3S93 A;  4XRF A;  3SQN A;  3LST A;  1ZGA A;  3GWZ A;  2VJ4 A;  2A07 F;  3P5J A;  1YHQ I;  3DCF A;  1AKH A;  1ZRC A;  2KJC A;  4HV6 A;  3W6V A;  4DJA A;  4PJM A;  5M5Y J;  4W1U A;  2VE8 A;  3S2W A;  1FLI A;  3BR2 A;  1UHW A;  2X6W A;  2CQ7 A;  5F08 A;  2CV1 A;  1ZRF A;  1TQP A;  1KQ9 A;  1D1A A;  1G3Y A;  2L4A A;  4RLQ A;  2CFX A;  1V5E A;  2JN6 A;  3GTQ J;  2L7K A;  1LJ9 A;  3U9G A;  4EJU A;  3P9C A;  4IX7 A;  1XN7 A;  3AAF A;  1Z21 A;  1ON1 A;  3JRB A;  1IAW A;  2L5Q A;  3IRQ A;  2QCO A;  3ML6 A;  1QHG A;  1Z91 A;  3KX2 A;  2AO9 A;  1DU0 A;  4DNC A;  2HFH A;  4OIQ F;  3ZOB A;  4NUB A;  2PJP A;  2HU9 A;  3K4B A;  4A6E A;  1FP1 D;  2I5U A;  5HLH A;  2GXG A;  4XNF A;  1WCM J;  3TW6 A;  1IJW C;  3WGH A;  4B4C A;  3F22 A;  4PJJ A;  3FMS A;  3Q0W A;  3S17 J;  3OYL A;  3LNQ A;  3REO A;  2CJJ A;  2FML A;  1W5C C;  2FMY A;  4UXN A;  5DCF A;  2E1M C;  1QQI A;  1U5T A;  3EQL F;  4C2T A;  3CP8 A;  1A04 A;  5C4J J;  1YYV A;  2R7Z J;  2IS1 A;  5FFX A;  2NVU B;  4QTR A;  2KQR A;  2FQ3 A;  2VXD A;  2F4I A;  2WY8 Q;  3VYT B;  2Y75 A;  1IF1 A;  3VWB A;  4LD5 A;  4U0Y A;  1GDT A;  4BDZ A;  4BBS J;  4MQV A;  2JRM A;  1W7P A;  3GBG A;  2EZK A;  3HUG A;  2OTL I;  2XSD C;  2OZ6 A;  3QYE A;  2E1C A;  1R4M B;  4L9V A;  3OS2 A;  3LFK A;  3R60 A;  3SZT A;  2BXZ A;  2E1O A;  2QYO A;  3CUQ A;  1OLT A;  1Z6R A;  2MG4 A;  1X4O A;  4G6Q A;  4LLG F;  3C2H A;  5H20 A;  3SFZ A;  2IRF G;  5A2Q K;  2OPT A;  2HYJ A;  2KIU A;  1Q1H A;  1X3W B;  2LYC A;  4XN3 A;  3ERM A;  1YW7 A;  4XMY A;  4P1W A;  2HTJ A;  2JRT A;  2P81 A;  2V9P A;  4A3J J;  1RIO H;  3K4K A;  1RRJ A;  4PFP A;  3ABT A;  2JK3 A;  4UUT A;  3OS0 A;  4L0Z B;  2VBY A;  2QEX I;  3GF2 A;  1OYW A;  2VBZ A;  2VN2 A;  4L9N A;  3MKL A;  5EG0 B;  2MGQ A;  4LK0 F;  2Y48 A;  1IRX A;  3E7L A;  2YR2 A;  3CJN A;  5HDG A;  3M7G A;  3LL7 A;  3ZMT A;  3BTL A;  3QYF A;  2ECB A;  4D0P A;  5D6F A;  2WAQ N;  1PDN C;  3KE2 A;  1LVK A;  1P9Q C;  1S6L A;  5F04 A;  2KT0 A;  3CF5 F;  3CCE I;  3A2K A;  2DDA A;  5HVQ C;  2X1E A;  4BJT A;  1A6I A;  1XMX A;  2P5K A;  2NS0 A;  5KVR A;  1EH8 A;  3PO3 J;  3W3C A;  4PGG A;  4OMY A;  4PZJ A;  1U9N A;  1NG7 A;  3M07 A;  4A0Z A;  4IHY A;  2ZJ2 A;  3QAH A;  2Y9Z A;  1JHH A;  2CS3 A;  2O3F A;  1R36 A;  3E1S A;  2Z3Y A;  1T39 A;  3BP8 A;  4A69 C;  4R1H A;  2I10 A;  3F9K A;  4OOI A;  3OYJ A;  1XGN A;  5E8G A;  4BY1 J;  2NVY J;  3GLL A;  1W5T A;  3L2U A;  2IGK A;  3O8H A;  1Y8Q B;  2OD5 A;  3S1Q J;  4UV9 A;  3QPT A;  1ZLJ A;  3CUO A;  4KFC A;  4A3K J;  4AID A;  3J7Z I;  1T33 A;  1HW2 A;  1MW7 A;  5LRR A;  3K10 A;  1FP2 A;  5L3C A;  4YRV A;  2ZXJ A;  5E79 C;  4D1Q A;  4D5F A;  2LH9 A;  1QRY A;  1JJ6 C;  1YTY A;  2HOA A;  2COM A;  1YRN B;  2GOM A;  3COA C;  3KLO A;  5J6X A;  1KU7 A;  4G9Y A;  1J0R A;  3TP3 A;  1SVM A;  2ESH A;  1Z67 A;  3IC7 A;  1R7J A;  2EFW A;  4MNU A;  3GTL J;  4D5C A;  2HR3 A;  1XX5 A;  2RV8 A;  3J80 Z;  1YIO A;  2E19 A;  4BJ5 C;  2EIM H;  2R7F A;  4J01 A;  3K2A A;  3J7Y J;  4L5I A;  2DFH A;  2VKD A;  2CQN A;  5M3F J;  1P2F A;  1R9T J;  5CVU A;  3PSI A;  1LE8 B;  5DM7 F;  1LFP A;  2ZME A;  3DF8 A;  5E1W A;  2B7E A;  2HNH A;  1T2K A;  3SJM A;  3HOV J;  5IP7 J;  3HHH A;  3LAP A;  2W85 A;  3H0D A;  3DQV C;  2HYF A;  1IN4 A;  1D5Y A;  3ABU A;  1RES A;  2QM3 A;  1UJ8 A;  3GO5 A;  2CQX A;  4GXO A;  2BVL A;  1FOW A;  4M3B A;  2V4J C;  3V8K A;  1Y0N A;  4YEJ A;  3PQK A;  3E5Q A;  3U1D A;  4M71 A;  2DA7 A;  2M4K A;  3OYI A;  2QQ9 A;  2DA4 A;  1ULY A;  1KGS A;  2C6Y A;  3KYC B;  1IN7 A;  2KPM A;  2HOE A;  3MVP A;  3VOE A;  4L18 B;  2EFO A;  2NYX A;  3TKY A;  1GXQ A;  1E3H A;  4D7N A;  1X1C A;  1GLN A;  2OZU A;  3IAM 2;  4EVI A;  2BBY A;  1U9O A;  4Y13 A;  3ASN H;  2CW8 A;  1WJE A;  2R92 J;  1BR2 A;  5M5X J;  1IG7 A;  2XGC A;  1V5G A;  1P4X A;  3K6G A;  5EDN A;  4E7H A;  3OYC A;  1JHF A;  3UR3 C;  2XKP A;  1ETW A;  3JAM Z;  1RET A;  1JXS A;  1MDM B;  1ETO A;  2Q1Z B;  2PMZ A;  3VB2 A;  3NWT A;  1IDZ A;  2PMH A;  1BA5 A;  4CSW A;  4M9S A;  3LSJ A;  5EZG A;  4AM3 A;  1YX3 A;  1P92 A;  3ESW B;  3F0C A;  3J7A Y;  1IUY A;  1V54 H;  5HS9 A;  3BR6 A;  3IWF A;  4OMZ A;  1IZ1 A;  5IT3 A;  3KLN A;  4J19 A;  2AS5 F;  2FBK A;  5EEG A;  3A01 B;  1SVO A;  3DEW A;  1FNN A;  4CCN A;  3F6O A;  5KNL A;  1GV2 A;  2BZT A;  5CYV A;  4IXA A;  1UAA A;  2EPF A;  3I4N J;  3LSH A;  3ZQL A;  2OC6 A;  4A0X A;  1POG A;  4WXD A;  2UZK A;  4II2 A;  3CJR B;  5A2Q Z;  1PP8 F;  1JKP C;  4LB5 A;  1UST A;  2HQR A;  1IRZ A;  2L7Z A;  2W1O A;  5ED4 A;  5HS7 A;  3RPU A;  3FXO A;  1WVR A;  3GZ5 A;  1UHS A;  1UHM A;  3ZRG A;  1PYV A;  2O7O A;  2WV0 A;  4N9H A;  2B9S A;  4Z6Y A;  4IHX A;  1E2X A;  3TDZ C;  3BY6 A;  3CDI A;  4NC6 A;  3IKT A;  1H9G A;  3DKX A;  4I99 C;  3R6S A;  3OYF A;  2R7O A;  4RGR A;  1WPK A;  4C2U A;  4N4N B;  5J40 A;  1GXP A;  4M6Y A;  5JR3 A;  3OOU A;  2OBP A;  3HIF A;  1A5J A;  1F9N A;  2E7W A;  4XM3 A;  3I54 A;  3I4M J;  3U2R A;  2X85 A;  4BNC A;  2KRC A;  5J1R A;  1ONV A;  3ERE D;  4ESB A;  4ENM A;  1JT0 A;  1IXS B;  3S16 J;  2ZC2 A;  1LDJ A;  4RS8 A;  1AA7 A;  2DBB A;  1VI0 A;  2YSR A;  3IL2 A;  1PVE A;  1ZR4 A;  2L3D A;  4RAG A;  2XB5 A;  2VL8 A;  1RUN A;  3GXO A;  4PGH A;  3FXU A;  2R5Y B;  2ICW G;  3SEQ A;  3WE2 A;  2XVC A;  1YX5 A;  3WTT C;  2R7U A;  3TGN A;  2CWE A;  2RAE A;  2RRE A;  1SFE A;  5IY5 H;  2F2E A;  3C1D A;  3RYR A;  3UNG C;  4EQQ A;  2BEO A;  3DU5 A;  2EV0 A;  4FE4 A;  2KZG A;  3IKV A;  4WCG A;  1IN8 A;  3CCU I;  4XQF A;  5F0F A;  4BXU A;  4DIQ A;  3WTW C;  2CUJ A;  3VOD A;  1W0U A;  3S1N J;  1H8A C;  1JJ8 C;  1QZE A;  3CC7 I;  2ZNZ A;  2FUG 2;  2HKX A;  2MA3 A;  3MMY B;  4IVN A;  3S2D J;  3DPU A;  3B02 A;  3JTG A;  1XSV A;  5E8I A;  2GOX B;  4HG2 A;  4V2F A;  4C2M J;  1MNM C;  1O4X A;  4XL9 A;  2VC0 A;  2JSP A;  1VQ8 I;  2W84 A;  3BJ6 A;  4I2O A;  4UVC A;  2WBM A;  3LAJ A;  1QVT A;  2DA1 A;  1O3T A;  1SD7 A;  2F5F A;  5CQG A;  2EFP A;  2E1N A;  3KYD B;  1HDD C;  2A68 F;  3T5X A;  4UUS A;  2FD5 A;  1KA8 A;  4E7L A;  1R23 A;  3ZMD A;  4Q48 A;  3HOW J;  2J5O A;  3JCU C;  4N9I A;  3OYE A;  2Z2S B;  2KMU A;  2DMU A;  4XLP F;  5IOZ A;  4ENK A;  5GTH C;  5E17 F;  1OR7 C;  3OL3 A;  2L9R A;  2BV6 A;  2CMP A;  3BG9 A;  4HX4 A;  4E70 A;  3D5L A;  1B4A A;  1NTC A;  4C3J J;  1SFO J;  1WJA A;  2WAQ A;  1RC9 A;  1JKQ C;  4BQO A;  2FX0 A;  5F1R A;  1U6G A;  2DQR A;  2JA2 A;  3QOE A;  2GXA A;  4BE2 A;  3WOD F;  4EM0 B;  4I09 A;  4J00 A;  1EH7 A;  4W97 A;  2H6C A;  3BZ6 A;  4BAC A;  2DOA A;  2ZCW A;  3B73 A;  3HM5 A;  3ZQC A;  2D5V A;  2JUG A;  4RDU A;  3GCM A;  4ZYD A;  1QU3 A;  5DV5 A;  4ZTF A;  3HRU A;  5L3G A;  2H1K A;  1VTN C;  5IYD J;  1TWC J;  2CUE A;  2CUZ A;  3BCA A;  3VSK A;  3T0Y A;  2CV2 A;  2XGX A;  1TTY A;  3S3N A;  3GFJ A;  2VIX A;  3MFK A;  4MEY F;  1HCR A;  4C9Y A;  4DOZ A;  2PX9 A;  3FDY A;  2YU3 A;  3K70 C;  4BGD A;  2R7S A;  3L2R A;  3CCS I;  4WWC A;  3VDX A;  3CCY A;  2QBY A;  2PMU A;  2R3S A;  2KJB A;  3I59 B;  4DZP A;  4EM2 A;  3GTO J;  1XSD A;  2DJI A;  4RB1 A;  1ZG1 A;  4CYC A;  2A6E F;  2VBX A;  5AIQ A;  5CKT A;  3RKQ A;  3IRR A;  4BE1 A;  5DYM A;  4YFX F;  2W57 A;  4IOC F;  5ILS A;  4NC8 A;  1S3J A;  2XPU A;  4LFU A;  2UXX A;  3EUK L;  1CQT A;  4BXX J;  1V55 H;  3FF5 A;  3KP5 A;  3ZCO A;  4A5N A;  3KP7 A;  2K9S A;  1M1E B;  1QZZ A;  1B8I A;  2IS6 A;  3BRO A;  2KIQ A;  3H0G J;  4XKW A;  3V8J A;  3HOY J;  2Q2E A;  2AQF A;  4OU0 A;  5B1A H;  3G1M A;  3BJA A;  3EDP A;  3F8F A;  2ZFW A;  3OSG A;  2LKX A;  5JVT A;  1QO0 D;  2KIF A;  4XKV A;  3NAU A;  4RMN A;  5LLQ A;  1OPC A;  2ZXW H;  2PQ8 A;  4ETS A;  1MMS A;  1D1C A;  1N25 A;  3MN2 A;  1VQ4 I;  1IN5 A;  3GLX A;  4RB0 A;  1J5Y A;  5CJ9 A;  4RLF A;  5DD4 A;  1MBG A;  3KP6 A;  3FXR A;  1TQM A;  2FEZ A;  4LLL A;  2EQR A;  2L54 A;  3IAS 2;  1A31 A;  4RM3 A;  1HQC A;  1Z77 A;  2ZFU A;  4HYE A;  3DTK A;  5GAE J;  2XGD A;  2Y0S N;  2XAU A;  4CZZ A;  4A3F J;  1H88 C;  1CF7 A;  5BPD A;  3BG7 A;  3HYI A;  3FWE A;  2LNB A;  1ON2 A;  2HQN A;  1BIA A;  2Q8K A;  3SFI A;  2DMT A;  3NWS A;  2K3F A;  4MFD A;  3NAR A;  2XAF A;  3KEO A;  1KZH A;  4AVP A;  1OCP A;  4Z2Y A;  5JHU A;  4RGX A;  3CCQ I;  2V6E A;  4RBO A;  3OYG A;  3C18 A;  5K7Z A;  1SD6 A;  1U2W A;  4RB3 C;  4ESF A;  4PFO A;  2XAS A;  2JJ7 A;  3HGG A;  1R1T A;  1I1G A;  1BOB A;  2GQQ A;  4IZZ A;  4XSX F;  2YX7 A;  3O3K A;  1IXC A;  3FHZ A;  3M1E A;  1JUS A;  1BL0 A;  2QZ8 A;  2HPM A;  2WB1 N;  2NVQ J;  4A3G J;  4HDV A;  5HDN A;  5TIS C;  4BAY A;  4E7I A;  1ERD A;  1D3Y A;  1BIB A;  2B63 J;  4KJZ A;  2P5V A;  4QSH A;  3F8M A;  3KET A;  3J81 K;  5JFR A;  1HOM A;  1O7F A;  1D0Y A;  3ZGK A;  5H6Q A;  4I01 A;  4PCQ A;  4HNU A;  3ONQ A;  2VOD A;  5IT9 K;  4GYG A;  4LJZ F;  1Z05 A;  1PUF A;  2X6Y A;  3DKY A;  4D7M A;  4IPA A;  5LRS A;  2QA4 I;  1O3R A;  4BEH A;  2X6O A;  2A69 F;  2JVG A;  2O8K A;  5IP9 J;  2KKO A;  2EA4 A;  3E97 A;  4FE7 A;  5CPR B;  4ZJZ A;  3ABK H;  2WWY A;  3O2P E;  2XDV A;  2YPR A;  5ICC A;  2P4W A;  4AVZ A;  2PBI A;  4Q47 A;  2B0L A;  3J7A O;  3S32 A;  1MJ9 A;  3NRV A;  1EH6 A;  2ME0 A;  3HB9 A;  4PJL A;  3CCL I;  4FAS D;  3FMR A;  1QA6 A;  1BBY A;  2QQA A;  1MMG A;  2MC3 A;  3DP7 A;  3WU2 C;  1LKX A;  2CW0 F;  2VPR A;  1NG6 A;  2FNP A;  1I1S A;  5LEJ A;  1Y0U A;  3L9F A;  1FIA A;  1YFH A;  1XC5 A;  1QNT A;  1LPQ A;  1FBS A;  5LGN A;  1ZHF A;  1I6H J;  5IPA A;  1FOK A;  5EGO A;  1IV8 A;  4M9X A;  2HEO A;  2BY1 A;  4HRI A;  3LSG A;  2LBF B;  3SZP A;  4WF2 A;  4V2G A;  3TDU C;  2PLY A;  4GO1 A;  3SDB A;  3TMO A;  2ZBK A;  5BMZ A;  3CJQ B;  5FLX K;  4RAY A;  2XRL A;  3HHG A;  1W0T A;  1HKQ A;  2LF8 A;  3A02 A;  2LK2 A;  3MZH A;  2JA8 J;  4O6J A;  3VYR B;  1SC7 A;  3S2H J;  1TT5 B;  4EJT A;  3PUB A;  3HG9 A;  2OAZ A;  4HV5 A;  2HI3 A;  1MMN A;  4XSZ F;  4PDK A;  1FTT A;  4OWR B;  4PJ0 C;  3OV8 A;  4P55 A;  3RQ4 A;  4Q4Z F;  1WRJ A;  3OYA A;  2MBF A;  2ZXH A;  1ZGJ A;  2KL4 A;  2N8G A;  4WXC A;  3TO6 A;  2M7B A;  3N4M A;  5DTD A;  1DU6 A;  1T95 A;  2M3A A;  1HSJ A;  3LA3 A;  2NRA C;  1MGT A;  5DUK A;  3VEP A;  3LQR A;  2BVM A;  2VC1 A;  1X3Z B;  2OCE A;  1B72 B;  4CDG A;  1TNS A;  4YII A;  4BHB A;  3VFZ A;  3TO9 A;  1O3Q A;  1SAX A;  4NBQ A;  1G8X A;  2VKV A;  3BTI A;  4KIB A;  5ICE A;  3JRE A;  1MH4 A;  5BNG A;  2F48 A;  2Z16 A;  3RTR A;  5DM6 F;  1BN5 A;  3L09 A;  1J9I A;  1R58 A;  3GFL A;  2HDW A;  2CYY A;  2LRE A;  3I3L A;  5LEK A;  2IEK A;  5LGU A;  3DLL F;  1HBX G;  5C44 J;  2K27 A;  2W7N A;  5J1U A;  1DP3 A;  2ESN A;  1LQ1 A;  4E7K A;  1Z3X A;  3RZD J;  4HST A;  4A5M A;  5E3N A;  2YS9 A;  2MLK A;  2E5N A;  3OL4 A;  4IJA A;  5KK1 A;  2PI0 A;  4NQW B;  2PJR B;  1XS9 A;  5DCM A;  5ILV A;  2HZT A;  2R7R A;  4F92 B;  3K1P A;  1QPM A;  3DTE A;  3FKJ A;  3QP5 A;  1S29 A;  1ETV A;  3L1P A;  4QPO A;  3G73 A;  2BY2 A;  4FQG A;  4KYW A;  1OFC X;  2DCE A;  2JUC A;  2R5Z A;  4CHU A;  1FSH A;  3EYI A;  1R00 A;  2Y30 A;  4O5V A;  5LHI A;  1UZC A;  3BCB A;  3WG7 H;  2I8D A;  2X1D A;  4XON A;  1AKH B;  1X1A A;  3ZQG A;  2CG4 A;  4MQ9 F;  3CDH A;  2PFB A;  3BG6 A;  1HC8 A;  3K1M A;  4M3G A;  5D5V B;  1G3W A;  5FGM A;  2Y69 H;  1S7O A;  3CO7 C;  1LE8 A;  4XKB A;  1FTZ A;  2G9W A;  2KIM A;  1RPW A;  1XGS A;  4ESJ A;  3N97 A;  5CVR A;  3H5A A;  1XDU A;  2IA1 A;  2E5Z A;  2H8R A;  3B6A A;  2M34 A;  4MGR A;  1JTX A;  3TL4 X;  3QU3 A;  1XD7 A;  3ZQQ A;  4UB6 C;  3A0H C;  4OIR F;  4A12 A;  1W36 D;  1DQU A;  2G0E A;  4B48 A;  1HW5 A;  5LD2 C;  2PG4 A;  5BPI A;  2X6X A;  3H92 A;  5B3S H;  3FHN A;  4ENJ A;  1VQO I;  5E20 A;  4LIU A;  4HDU A;  1Y1V J;  3H5R A;  1X1D A;  2EJR A;  3P9I A;  4S05 A;  4II3 A;  2NS7 A;  2DA3 A;  1LFU P;  5E1Z B;  2HVR A;  1WWX A;  3SYT A;  4HNT A;  3D5S C;  1K7A A;  1G59 A;  4UY8 I;  3FIS A;  4AIK A;  3HRS A;  2JZY A;  2R7T A;  3J81 Z;  2O61 A;  2LC2 A;  3K4J A;  3C3W A;  1RR7 A;  2VPL A;  4IHS A;  1W7P D;  1KYW A;  4MHG A;  2IXS A;  4EAT A;  5IT9 Z;  4DQ2 A;  2RDP A;  5DEQ A;  4LG0 A;  3Q0U A;  4I02 A;  2LY1 A;  4EEF G;  3IP4 B;  5FLM J;  4R8H A;  1ORK A;  1OQY A;  1MBK A;  1YW8 A;  2OUM A;  1XGO A;  1W7P B;  2VB6 A;  2K86 A;  3BDD A;  3HUG B;  2BY3 A;  1USS A;  4OAZ A;  1LEB A;  2DFF A;  3CJT B;  2OJE D;  5K1Y A;  3DXJ F;  4LB6 B;  2NOJ B;  2KRF A;  1WJD A;  3CUQ B;  1PJR A;  3K2Z A;  2IT0 A;  4CZC A;  2XIG A;  4B44 A;  3A03 A;  3NEU A;  5GTI C;  2M87 A;  2ELJ A;  2L7F P;  3HSE A;  3MAJ A;  4HPQ A;  4A3B J;  1K6O A;  3L7W A;  2X1C A;  3R61 A;  1TWA J;  4KMF A;  3ZMZ A;  3S3O A;  2DMQ A;  4DW6 A;  2WAE A;  4X6A J;  3H3Z A;  4B1R A;  1IXR C;  4PK4 A;  3PNY A;  1D0Z A;  3RZO J;  2CFO A;  2O5R A;  2X51 A;  4MFE A;  1ZH5 A;  2LSO A;  3NQO A;  1VQ7 I;  4UV8 A;  1I6X A;  2BE5 F;  2JVH A;  1SD4 A;  1G2H A;  1I3A A;  2EZI A;  2XSJ C;  1RR8 C;  5JI6 A;  1RI7 A;  5ERI A;  2V26 A;  2V6C A;  2BXY A;  3TO7 A;  3AFH A;  2VQG A;  1FIP A;  2IAI A;  2LF7 A;  2ELH A;  2Y0S A;  4UB8 C;  3PQJ A;  2BW3 A;  5FFZ A;  2LKS A;  1KU9 A;  2TCT A;  2F5D A;  3KZY A;  4KA4 A;  1LB2 A;  4YG2 F;  5HLT A;  4ENN A;  4C30 A;  2UUZ A;  2M9H A;  1ZK8 A;  1ZRE A;  1V3F A;  4RGU A;  1MBF A;  2QSG X;  5K5R A;  1QGP A;  3L00 A;  2A6T A;  4U0W A;  3PFY A;  1Z9C A;  4DBQ A;  1H89 C;  3HOZ J;  1B9N A;  1GHC A;  1MSE C;  2KDZ A;  4C3H J;  4HNV A;  2K4J A;  2V1D A;  3EPZ A;  2VQH A;  3GFI A;  2WB1 A;  1P4A A;  2EIK H;  4AU7 A;  2NNN A;  2JPB A;  1XGM A;  3HTU A;  3IH2 A;  5F64 A;  2DQL A;  1B1B A;  4Y3O A;  3HKZ N;  3DBH B;  3MEX A;  1S7E A;  1ZG3 A;  3OR1 C;  1TT0 A;  3GTJ J;  2RQQ A;  3BC8 A;  1YJW I;  1T56 A;  2GAU A;  2OQG A;  2WC2 A;  3KEY A;  4F7Z A;  4XBF A;  2A3S A;  1B6A A;  4WK8 F;  1S7A A;  3T8T A;  1BI3 A;  5DD8 A;  4OIO F;  4M3F A;  3E0J B;  4JP0 A;  3OYH A;  3WG9 A;  5FRO A;  3ZMS A;  1SAU A;  2E60 A;  2RN7 A;  4HLX A;  1PUE E;  2BY0 A;  2ADU A;  3ELK A;  1L3L A;  3BG5 A;  1FPQ A;  4U0V A;  5F0C A;  3Q9V A;  3KCC A;  2DTR A;  2KHM A;  2ECC A;  1OYY A;  2ZME B;  4JYK A;  3C7J A;  2RKH A;  5L3D A;  3RIR A;  5H6R A;  4CCK A;  2ACJ A;  1FBU A;  3SHF A;  3HJE A;  2QKL B;  4I76 A;  4C3I J;  4HA8 A;  1X4P A;  3CD6 I;  2M0C A;  1WKM A;  4ZYH A;  3H5N A;  5HOO A;  3BPV A;  3LA7 A;  4MO7 A;  4XLH A;  1N78 A;  1TC3 C;  4RAZ A;  4B47 A;  1MNE A;  5L3F A;  1QPI A;  2FBH A;  3SXY A;  1Y39 A;  5GAG J;  1TLH B;  1R5G A;  1WH7 A;  4XK4 A;  2FSW A;  2AXL A;  2D1V A;  1JTY A;  3JRH A;  1FX7 A;  3BR5 A;  5FRN A;  3DBR B;  3ZMV A;  2EA2 A;  1KQ0 A;  4KIS A;  1ZR2 A;  1D0X A;  3K4L A;  5D8K B;  1WJC A;  3BR0 A;  4KNY A;  3I0T A;  4XLE A;  1U8B A;  3MCZ A;  2DPD A;  3MKZ A;  1CGP A;  2EZH A;  4YIF A;  2DYS H;  4L0Y B;  3GUD A;  4HX7 A;  1T98 A;  1WI3 A;  2O0Y A;  2DO7 A;  3V7R A;  4EJO A;  3I55 I;  4B43 A;  1R49 A;  1FYK A;  3PNV A;  5E3M A;  2LMD A;  4PJN A;  2HOT A;  1VZ0 A;  1F5T A;  1KON A;  1WHU A;  3FM5 A;  5JHF A;  2E2H J;  4DBR A;  2ID3 A;  4FET A;  2M5W A;  2M45 A;  3PUF A;  5DDG A;  3JRI A;  2EFQ A;  3BT9 A;  3FMQ A;  5TGT A;  2UWM A;  2JA5 J;  2VKE A;  2IS2 A;  2KLO A;  5KCM A;  2ZO4 A;  3N05 A;  4BHC A;  4KN7 X;  1JUP A;  3O6B B;  4EMS A;  3L2V A;  3QOD A;  3OIQ A;  1G3S A;  2MD0 A;  2GXB A;  4HZF A;  1R71 A;  1R1V A;  4EM1 A;  1PP7 U;  5D4S A;  5K5Q A;  1E3O C;  2V79 A;  5JLX A;  1QBJ A;  4CYD A;  3KP4 A;  3FXJ A;  2XB0 X;  5CVI A;  5HDK A;  1RZ4 A;  5FD6 A;  3D1N I;  1MH3 A;  1P7J A;  2V7F A;  4G6D A;  3RPU D;  1UG2 A;  1F1Z A;  1R5H A;  4BL0 B;  4Y17 A;  4IRI A;  3W2V A;  3HOX J;  1K4S A;  2HXO A;  3GZN B;  5F27 A;  2KIS A;  1S8N A;  2TDX A;  2XRO A;  3TOB A;  5FD5 A;  2GBY A;  2W4S A;  1GT0 C;  3H3U A;  2GIV A;  3BPX A;  3PIP F;  2HKO A;  3DEE A;  3H3V K;  1WJ5 A;  3FM3 A;  2H6B A;  2K4B A;  4KIF A;  3GX4 X;  3P7N A;  1ODD A;  4M74 A;  4ZYA A;  3PSF A;  2FF4 A;  1FMV A;  3ASO H;  3G2B A;  4KT5 C;  5HLG A;  1B9M A;  1RNL A;  3WE3 A;  2EBI A;  3CLO A;  3HRT A;  3RSN A;  4I7H A;  1I39 A;  3GTG J;  2CUF A;  2EH3 A;  4M6X A;  4NB5 A;  3R4K A;  2OF7 A;  3VYS B;  3GYH X;  3OIP A;  2DMN A;  3DEU A;  4FTH A;  3DV8 A;  5LHG A;  4BE0 A;  3EUH C;  3BG3 A;  1FT9 A;  1YLF A;  2DK5 A;  1X58 A;  4OAY A;  2MLG A;  4UVA A;  2XKO A;  5E18 F;  1T8I A;  3RDI A;  2KZV A;  4LOC A;  1ETK A;  1YW9 A;  3JSP A;  4XRS A;  2V1U A;  1Z7U A;  2ZSI B;  2H27 A;  4FX0 A;  1F4K A;  4JX6 A;  4B3X A;  2WAD A;  3CDL A;  1VQK I;  2DPU A;  1OCC H;  4OIP F;  2ZKZ A;  2LVS A;  1IN6 A;  3SDG A;  4FHT A;  4BKX A;  2W00 A;  3OYN A;  2XPW A;  5HNF A;  2ZSH B;  3OWT A;  3LSR A;  2FE3 A;  2JTV A;  3ULQ B;  4HX8 A;  4DZJ A;  1TZL A;  3I9V 2;  3KZZ A;  2EFN A;  4CH7 A;  1BI0 A;  1VND A;  3MKW B;  2MC4 A;  3F21 A;  5D6E A;  4ZTJ A;  1VQ6 I;  2A61 A;  3AL0 B;  3B6C A;  4R79 A;  3F8N A;  5GPC A;  2YU9 J;  2HQ5 A;  3BR3 A;  3Q5F A;  1TQI A;  1ITY A;  4CGZ A;  3FXQ A;  4IQJ A;  2QVO A;  1GVD A;  2VQL A;  1OR7 A;  2STW A;  1K78 A;  2VI6 A;  5GP9 A;  3P9K A;  3A0B C;  4CCJ A;  2IS4 A;  4EGY A;  1KU2 A;  1U3E M;  1WQ2 A;  5BS6 A;  1LDK B;  4GFB A;  2NXN B;  4GRI A;  3ECH A;  1D5V A;  1SMT A;  3I4P A;  4Y4R A;  1TWF J;  4BBR J;  1AHD P;  4OIN F;  3GTK J;  2MFZ A;  3BTC A;  4UUS B;  2PEX A;  3C2B A;  4A6D A;  1MJA A;  1G4D A;  2JA7 J;  3DTI A;  2GIZ A;  3DWL E;  4ANJ A;  2Y2Z A;  4IO9 F;  4A3L J;  1WJB A;  2R4G A;  2AHQ A;  5FB2 A;  1ACI A;  1Y1W J;  3JRD A;  3T8R A;  1N75 A;  2NVX J;  4CCO A;  4XR6 A;  5JLW A;  3RQI A;  3OMY A;  1ZRD A;  3F72 A;  1MIJ A;  2QLZ A;  3LWF A;  1W5S A;  2TRT A;  2QWW A;  1YIT I;  2V9V A;  2DA5 A;  1RKT A;  3OYD A;  5J8C A;  1ZN2 A;  4L5J A;  4BQQ A;  2L01 A;  2DT7 B;  3GME A;  4XOP A;  3VSL A;  4BY7 J;  4BXF A;  4LGW A;  3F6V A;  3ZQF A;  4HAM A;  2KRH A;  1E17 A;  1T38 A;  3S14 J;  2F4M B;  4I0A A;  1ETQ A;  3E6D A;  2CQK A;  1EKE A;  5K7F A;  4GGG A;  1DPR A;  3TOA A;  2P6T A;  2M4G A;  3RKY A;  1NK3 P;  3CF2 A;  3QOP A;  2GWR A;  1G3T A;  4A3D J;  2EWN A;  4EV0 A;  3E3V A;  3IHU A;  3OYM A;  2QSF X;  1BC7 C;  4PUS A;  4F91 B;  2K9Q A;  3HKZ A;  4A3C J;  2OTJ I;  3PJR A;  2QBY B;  1VQM I;  1R4N B;  5J3L A;  2XHK A;  3W2W A;  3WTY C;  2K5C A;  1QHH D;  4N4O B;  1BR1 A;  1TBX A;  6PAX A;  1YO5 C;  1REP C;  3OOP A;  1HKS A;  4KMU X;  2A05 A;  4CYC B;  4M3D A;  4EGZ A;  1XDS A;  1FY7 A;  4E6K G;  2ZB9 A;  4ZDO A;  1SVL A;  4HW0 A;  3CO6 C;  3MQ0 A;  4I6Z A;  1S9H A;  1XMK A;  2MYS A;  4ZYE A;  3CMA I;  3G1L A;  3H36 A;  3KFW X;  4KUM A;  3CCJ I;  2IGN A;  3QP6 A;  1B8I B;  2HOS A;  3W2A A;  1UB9 A;  3SEZ A;  1BI1 A;  1R1U A;  2Q2E B;  1VQP I;  2JWT A;  2DLL A;  5TJJ A;  1T6S A;  1I3Q J;  2JMW A;  2E71 A;  2Z99 A;  2HZD A;  4AWX B;  1TL8 A;  4G7Z F;  2IA2 A;  2J5P A;  3DU6 A;  4NHJ A;  3K70 D;  1E3P A;  2WTE A;  3OY9 A;  1AOY A;  2HYG D;  4M73 A;  2HS5 A;  1H0M A;  2IPQ X;  2QQ8 A;  3KP3 A;  2A5Y B;  1WJF A;  2ZXI A;  5FKN A;  1JKR C;  2VOO A;  3BQZ A;  3ZPL A;  4CXF A;  2MAB A;  1W36 C;  2KDO A;  1BOA A;  2GM4 A;  2JQ7 A;  3JRG A;  3RCO A;  2LFB A;  1LVA A;  3I64 A;  5DUI A;  2GZW A;  2LY2 A;  1K79 A;  2E7X A;  4U7D A;  5LHH A;  3W6K B;  1CF7 B;  3H9Q A;  1UMQ A;  3CC4 I;  2VJI A;  1MND A;  4BYY A;  4LK1 F;  3R0J A;  2DJN A;  1SAN A;  3CP2 A;  4G94 A;  3M8E A;  1DGR M;  3KPH A;  1J75 A;  2M8G X;  5EG0 A;  1OIS A;  2E34 A;  1ZG5 A;  2DDB A;  1XPX A;  2XAQ A;  3I56 I;  2L2O A;  5FO5 A;  5CQE A;  2FQ4 A;  4AYB N;  2XF7 A;  3LA2 A;  1I27 A;  3CUQ C;  2DW4 A;  4V19 K;  4G12 A;  5ICF A;  2HVQ A;  2HWV A;  3VYU B;  2HDC A;  4U88 A;  1NHA A;  2XAH A;  2QF7 A;  1BC8 C;  4FX4 A;  1YS6 A;  3FXL A;  3EYY A;  1HDP A;  4IKF A;  1IDY A;  4BH9 A;  4JOM A;  2Z1D A;  1FSE A;  2P7C B;  2CW7 A;  3SZG A;  4B09 A;  4IHT A;  2ZNY A;  5L3B A;  3D0S A;  2P0W A;  1D8K A;  2VT2 A;  2K9L A;  3Q3S A;  2ELK A;  1ZKG A;  3QU6 A;  1MKM A;  1EF4 A;  2DFE A;  4RA2 A;  4E7J A;  4JX4 A;  1PUF B;  2BGC A;  1UCR A;  4BU2 A;  3FZV A;  5B66 C;  3G4S I;  3RKX A;  1J2X A;  1UEL B;  2L4M A;  2V9K A;  4BEH B;  3JAM K;  1IW7 F;  4DYC A;  1J59 A;  2R7V A;  1O3S A;  5GAD J;  2DI3 A;  4O3M A;  5HS8 A;  5LGT A;  4ZDL A;  1OMI A;  3MKY B;  2X0L A;  1B59 A;  3JRF A;  4CO8 A;  5ICG A;  4BQA A;  4ZZL A;  2P5L C;  1YRN A;  3ZQ7 A;  2EB7 A;  4BJ6 C;  4HF1 A;  2PN6 A;  1UG0 A;  2E35 A;  1IRF A;  4QWQ A;  3S15 J;  4BHP A;  2VE9 A;  1GV5 A;  1F43 A;  5D8L B;  1VQN I;  1K61 A;  3IUO A;  4MLO A;  4CIC A;  2LP0 A;  3CQZ J;  1MMD A;  2L9S A;  4Y7N J;  4IQ4 A;  5IYC J;  3L2C A;  4XRS G;  3JR9 A;  4LIV A;  5EGO B;  5BOX A;  2NVT J;  1YE9 A;  3RI4 A;  3ROU A;  5LFA A;  2ISY A;  2JT1 A;  3GEZ A;  4X1E A;  3AG3 H;  3OSF A;  2HDD A;  3DBL B;  3G3Z A;  4HBL A;  1VQL I;  3HOS A;  2VOP A;  2XGE A;  5J8F A;  2VJ5 A;  3BZK A;  1AWC A;  3R0A A;  3ZQH A;  3ZN0 A;  1QVU A;  1BI2 A;  1IGN A;  4Q5S F;  2BHZ A;  3Q9S A;  4ASN A;  2LG4 A;  4BQN A;  2W82 A;  3E6B A;  3FBN B;  1Y56 A;  2AQE A;  1DPU A;  5AIP A;  1HXD A;  4A2U A;  3PM1 A;  3WU0 A;  3IWZ A;  3CME I;  2X48 A;  5E3O A;  2OCC H;  5M3M J;  2NAZ A;  3K69 A;  3ZP5 A;  2WY7 Q;  4XIC A;  1IC8 A;  2RGV A;  3D5R C;  2LOO A;  3CC2 I;  1A6Q A;  2X9D A;  2Z9O A;  2XC7 A;  1LFB A;  3K4N A;  4BUP A;  4XLN F;  2O6G E;  1OKR A;  1J7K A;  3IV5 A;  2CH0 A;  2D45 A;  5C3E J;  3S1R J;  2ZME C;  2R7W A;  4TV7 A;  4HLY A;  5DS9 A;  3TQN A;  1KU3 A;  3HOT A;  1U5T B;  2BOL A;  1HW1 A;  1FOX A;  2M2E A;  2DT5 A;  2DU9 A;  1ZTR A;  3HTS B;  1UFM A;  4HF0 A;  5E3L A;  1KYZ A;  3K4C A;  1ETX A;  2UXN A;  4EJW A;  2KP6 A;  1V5F A;  4IRG A;  4G7H F;  3WU1 B;  1AU7 A;  2LKP A;  1MDM A;  2JSC A;  1IO2 A;  2R7Q A;  4YIR X;  1D1B A;  2VJJ A;  3F8B A;  1J09 A;  4U87 A;  4CCL A;  3G71 I;  2IBD A;  5HOD A;  2RNG A;  3WGG A;  2ME6 A;  1Z1D A;  3QPH A;  2P8T A;  5DCM B;  4DGW B;  1SFX A;  4RGS A;  1WFX A;  3K4M A;  2O8X A;  4KT6 A;  3CZ6 A;  3CCR I;  2W25 A;  1Z7L A;  2CSO A;  5D5U B;  4A3M J;  3WTU C;  1VQ5 I;  3A01 A;  3CMY A;  1S72 I;  4E4H A;  2R5Z B;  2O03 A;  1DUX C;  2Y0M A;  2R7D A;  4FCY A;  2FJ1 A;  5GPA A;  3BZC A;  2VAS A;  1SEU A;  1LEA A;  3H1C A;  3JW4 A;  2V1N A;  4XOT A;  5FLX Z;  2YX4 A;  3H9G A;  4KIC A;  4M72 A;  1Q1V A;  4P9U A;  1WZ2 A;  3HL2 A;  4Y52 J;  3LOC A;  2E1M B;  1BM9 A;  5J4V A;  4P5O A;  1A36 A;  2FNA A;  3ZR8 X;  4B3A A;  1I50 J;  4DYQ A;  2R7X A;  1HA8 A;  2M30 A;  4S0H B;  2MSY A;  4AIH A;  2UV1 A;  3FXK A;  2F6C A;  5EEA A;  1RUO A;  1STZ A;  1G6N A;  2MH2 A;  5CVJ A;  1OJL A;  1U0J A;  1Z6T A;  2H8W A;  4IF4 A;  5C4X J;  3HSF A;  1WH5 A;  2L9V A;  5E1X A; 
#chains in the Genus database with same CATH homology
 3PFI A;  1MJB A;  3I71 A;  2D1H A;  3DKW A;  3RPQ A;  4JBA A;  1U78 A;  3E6C C;  5HLI A;  3ZMU A;  2ISZ A;  4RB2 C;  1L0O C;  2IVM A;  2IP2 A;  1YG2 A;  1GVJ A;  2QEN A;  4M9Z A;  2XAG A;  4LG0 B;  2HGC A;  2GA2 A;  2JPC A;  1ZAR A;  2CGP A;  2FA5 A;  1IRG A;  2MH9 A;  2DK8 A;  4ON0 A;  1XCB A;  2OA4 A;  3T1B A;  3V8L A;  4MTD A;  1V4R A;  5D4R A;  3BOQ A;  2GA1 A;  3WTX C;  3GW2 A;  2V1X A;  4YFK F;  2FXA A;  3I5U A;  2CO5 A;  5K5O A;  3BJO A;  4AD9 A;  1ZLK A;  2QUF A;  3KP2 A;  1XMA A;  1D8J A;  4L9T A;  2M1B A;  2IW5 A;  3RKW A;  4IRH A;  2D2W A;  2RVC A;  4S04 A;  1I5Z A;  4GCV A;  2G7U A;  5CVV A;  2BYV E;  3FX3 A;  2W24 A;  3K1N A;  1KQ8 A;  2HTS A;  5EEH A;  3QRF F;  3I58 A;  2EV5 A;  3JSO A;  2VT3 A;  5L3E A;  1JGS A;  1XSX A;  1EV7 A;  2FRH A;  2G7H A;  1LNW A;  2FU4 A;  4LLN A;  4UHT A;  1OYI A;  2RNJ A;  2Q0O A;  4UNO A;  3DPT A;  3E6M A;  4G7O F;  3I59 A;  3HRM A;  4P96 A;  1O7L A;  1P6R A;  3I53 A;  3V7S A;  4H0E A;  5ILU A;  4HQE A;  5AON A;  1ZYR F;  2IA0 A;  4UVB A;  2P7V B;  3CTA A;  2DFI A;  1HST A;  3MWM A;  4B8X A;  4WXH A;  4HOB A;  3M9A A;  3F8C A;  1XB4 A;  4GYI A;  4MEX F;  4G8X A;  2Z5U A;  4I98 B;  2VBW A;  2L02 A;  1TW2 A;  3RJP A;  1HKT A;  2VXZ A;  1FBQ A;  3E5X A;  4L9J A;  2NNY A;  1SFU A;  3KEQ A;  1TW3 A;  2M8E A;  1YQA A;  2XUB A;  3DFG A;  4AIJ A;  4EJV A;  4ZYG A;  4LMY A;  3RYP A;  3WTV C;  1W4M A;  3BWG A;  2EV6 A;  3DPL C;  2OU2 A;  4Y15 A;  1QZY A;  4N0B A;  1FWZ A;  5CLS A;  3EUH A;  3LQQ A;  1O57 A;  1LDD A;  2FBI A;  2H94 A;  5LBQ A;  3GZ6 A;  3GVA A;  3K9T A;  2OQR A;  2VON A;  2MD5 A;  2K7L A;  3E5U A;  2LDU A;  2K02 A;  2XRN A;  3V4G A;  4A0Y A;  3ISP A;  3F3X A;  1SMY F;  4JQF A;  2DAO A;  2F5C A;  3JTH A;  2RQP A;  2ETH A;  4FT8 A;  4K2E A;  4KDP A;  1ZAO A;  4P9F A;  3GFM A;  2FOK A;  4HQM A;  3WGI A;  3EET A;  2Z33 A;  1WI9 A;  1FC3 A;  1R22 A;  2H09 A;  1P4W A;  4MTE A;  5BQT A;  4I0B A;  4U7B A;  3K0L A;  3HSR A;  1JE8 A;  4HF2 A;  4WX9 A;  3ZN1 A;  1X3U A;  4KN4 X;  1U8R A;  4JK1 X;  1DDN A;  3W6J B;  2X4H A;  4KIG A;  2IJL A;  1FYM A;  2A6H F;  1BJA A;  2STT A;  2P6S A;  4YFN F;  1K78 B;  2XV4 S;  3F23 A;  4ZH4 F;  3WTS C;  1MZB A;  1WSU A;  1T0F A;  1DP7 P;  1SD5 A;  5F6F A;  4ZZD A;  2RC4 A;  1FYL A;  4QLC U;  2EK5 A;  2QQB A;  3MZY A;  4UUV A;  1MD0 A;  2F5E A;  3M8F A;  3WTZ A;  1C0W A;  1TNT A;  3V7C A;  1H9T A;  1FZP B;  4NQW A;  3J80 K;  1XCV A;  1YS7 A;  2XAJ A;  5D5W B;  3ECO A;  5TRD A;  5D5X B;  1U5T C;  4XRF A;  3SQN A;  3LST A;  1ZGA A;  3GWZ A;  2A07 F;  1ZRC A;  2KJC A;  4HV6 A;  2VE8 A;  3S2W A;  1FLI A;  1UHW A;  1ZRF A;  1TQP A;  1KQ9 A;  1G3Y A;  2L4A A;  2CFX A;  1LJ9 A;  3U9G A;  4EJU A;  3P9C A;  1XN7 A;  3AAF A;  1ON1 A;  1IAW A;  3IRQ A;  3ML6 A;  1Z91 A;  4DNC A;  2HFH A;  4OIQ F;  2PJP A;  4A6E A;  1FP1 D;  5HLH A;  2GXG A;  3WGH A;  3F22 A;  3FMS A;  3REO A;  2FMY A;  2FML A;  4UXN A;  5DCF A;  1QQI A;  1U5T A;  3EQL F;  1A04 A;  1YYV A;  5FFX A;  2FQ3 A;  1IF1 A;  2Y75 A;  4LD5 A;  4U0Y A;  4MQV A;  1W7P A;  3HUG A;  2OZ6 A;  2E1C A;  4L9V A;  3LFK A;  3R60 A;  3SZT A;  3CUQ A;  2QYO A;  1Z6R A;  4G6Q A;  4LLG F;  5H20 A;  3SFZ A;  2IRF G;  5A2Q K;  2KIU A;  1Q1H A;  1YW7 A;  2HTJ A;  2JRT A;  1RIO H;  3ABT A;  4L0Z B;  2VBY A;  3GF2 A;  1OYW A;  2VBZ A;  2VN2 A;  4L9N A;  4LK0 F;  2Y48 A;  5HDG A;  2YR2 A;  3CJN A;  3M7G A;  3ZMT A;  4D0P A;  5D6F A;  1PDN C;  3KE2 A;  1S6L A;  5HVQ C;  2P5K A;  2NS0 A;  5KVR A;  1EH8 A;  4PGG A;  4OMY A;  4PZJ A;  4A0Z A;  2ZJ2 A;  3QAH A;  1JHH A;  2O3F A;  1R36 A;  2Z3Y A;  1T39 A;  3BP8 A;  4R1H A;  4OOI A;  1XGN A;  5E8G A;  1W5T A;  2OD5 A;  4UV9 A;  3QPT A;  1ZLJ A;  3CUO A;  4KFC A;  1HW2 A;  5LRR A;  1FP2 A;  5L3C A;  2ZXJ A;  1YTY A;  2COM A;  3COA C;  3KLO A;  5J6X A;  1KU7 A;  4G9Y A;  1J0R A;  2ESH A;  3IC7 A;  1R7J A;  2EFW A;  4MNU A;  2HR3 A;  2RV8 A;  3J80 Z;  1YIO A;  2R7F A;  4L5I A;  1P2F A;  5CVU A;  2ZME A;  3DF8 A;  5E1W A;  1T2K A;  3HHH A;  3LAP A;  2W85 A;  3DQV C;  2HYF A;  1IN4 A;  3ABU A;  2QM3 A;  4GXO A;  3GO5 A;  3V8K A;  3PQK A;  3E5Q A;  3U1D A;  4M71 A;  2QQ9 A;  1ULY A;  1KGS A;  2C6Y A;  1IN7 A;  4L18 B;  2HOE A;  3VOE A;  2EFO A;  2NYX A;  3TKY A;  1GXQ A;  2OZU A;  4EVI A;  2BBY A;  4Y13 A;  1P4X A;  1JHF A;  2XKP A;  3JAM Z;  1JXS A;  1MDM B;  3VB2 A;  2PMH A;  4M9S A;  1P92 A;  1IUY A;  5HS9 A;  3IWF A;  4OMZ A;  1IZ1 A;  5IT3 A;  3KLN A;  2AS5 F;  2FBK A;  5EEG A;  1FNN A;  3F6O A;  5CYV A;  4IXA A;  4A0X A;  4WXD A;  2UZK A;  5A2Q Z;  1PP8 F;  4LB5 A;  1UST A;  2HQR A;  5ED4 A;  5HS7 A;  3RPU A;  3GZ5 A;  1UHM A;  2WV0 A;  4N9H A;  1E2X A;  3TDZ C;  3BY6 A;  3IKT A;  1H9G A;  3R6S A;  4RGR A;  1GXP A;  4M6Y A;  5JR3 A;  2OBP A;  3HIF A;  1F9N A;  2E7W A;  3I54 A;  3U2R A;  4BNC A;  1ONV A;  3ERE D;  4ENM A;  4ESB A;  1IXS B;  1LDJ A;  4RS8 A;  2DBB A;  2YSR A;  3IL2 A;  2L3D A;  1RUN A;  3GXO A;  4PGH A;  3FXU A;  3WE2 A;  2XVC A;  3WTT C;  3TGN A;  2CWE A;  1SFE A;  2F2E A;  3C1D A;  3RYR A;  4EQQ A;  2BEO A;  2EV0 A;  3IKV A;  4WCG A;  1IN8 A;  4BXU A;  3WTW C;  3VOD A;  2ZNZ A;  2HKX A;  2MA3 A;  4IVN A;  3B02 A;  3JTG A;  1XSV A;  5E8I A;  2VC0 A;  2W84 A;  3BJ6 A;  4I2O A;  4UVC A;  3LAJ A;  1O3T A;  1SD7 A;  2F5F A;  2EFP A;  2E1N A;  2A68 F;  3T5X A;  1KA8 A;  1R23 A;  3ZMD A;  4Q48 A;  2J5O A;  4N9I A;  4XLP F;  4ENK A;  5E17 F;  4HX4 A;  2BV6 A;  4E70 A;  3D5L A;  1B4A A;  5F1R A;  1U6G A;  2DQR A;  3WOD F;  4EM0 B;  4I09 A;  1EH7 A;  2H6C A;  3BZ6 A;  2ZCW A;  3B73 A;  4ZYD A;  5DV5 A;  3HRU A;  5L3G A;  1VTN C;  3T0Y A;  2XGX A;  1TTY A;  3GFJ A;  3MFK A;  4MEY F;  2YU3 A;  4WWC A;  2QBY A;  2PMU A;  2R3S A;  2KJB A;  3I59 B;  4EM2 A;  1XSD A;  4RB1 A;  1ZG1 A;  2A6E F;  2VBX A;  5AIQ A;  3IRR A;  5DYM A;  4YFX F;  2W57 A;  5ILS A;  1S3J A;  4LFU A;  2UXX A;  3FF5 A;  3KP5 A;  4A5N A;  3KP7 A;  1QZZ A;  3BRO A;  3V8J A;  2Q2E A;  4OU0 A;  3BJA A;  3EDP A;  3F8F A;  2ZFW A;  5JVT A;  1QO0 D;  2KIF A;  5LLQ A;  1OPC A;  2PQ8 A;  4ETS A;  1IN5 A;  3GLX A;  4RB0 A;  1J5Y A;  5CJ9 A;  5DD4 A;  3KP6 A;  3FXR A;  1TQM A;  2FEZ A;  4LLL A;  2L54 A;  1HQC A;  4HYE A;  4CZZ A;  1CF7 A;  5BPD A;  3HYI A;  3FWE A;  2LNB A;  1ON2 A;  2Q8K A;  2HQN A;  1BIA A;  2XAF A;  3KEO A;  4AVP A;  4Z2Y A;  5JHU A;  4RGX A;  3C18 A;  1SD6 A;  1U2W A;  4RB3 C;  4ESF A;  2XAS A;  1R1T A;  1I1G A;  2GQQ A;  4XSX F;  2YX7 A;  3O3K A;  1IXC A;  3FHZ A;  3M1E A;  2QZ8 A;  4HDV A;  5HDN A;  4BAY A;  1D3Y A;  1BIB A;  2P5V A;  3F8M A;  3KET A;  3J81 K;  5JFR A;  1O7F A;  5H6Q A;  4I01 A;  4PCQ A;  2VOD A;  5IT9 K;  4GYG A;  4LJZ F;  1Z05 A;  4IPA A;  5LRS A;  1O3R A;  2A69 F;  2KKO A;  2EA4 A;  3E97 A;  2WWY A;  3O2P E;  2YPR A;  5ICC A;  2P4W A;  2PBI A;  4Q47 A;  2B0L A;  3J7A O;  1MJ9 A;  3NRV A;  1EH6 A;  3FMR A;  1BBY A;  2QQA A;  2MC3 A;  3DP7 A;  2CW0 F;  1I1S A;  2FNP A;  5LEJ A;  1Y0U A;  3L9F A;  1YFH A;  1QNT A;  1FBS A;  5LGN A;  1ZHF A;  1FOK A;  4M9X A;  2HEO A;  3SZP A;  4WF2 A;  3TDU C;  2PLY A;  4GO1 A;  2ZBK A;  5BMZ A;  5FLX K;  4RAY A;  3HHG A;  1HKQ A;  2LF8 A;  3MZH A;  4O6J A;  4EJT A;  2OAZ A;  4HV5 A;  4XSZ F;  4PDK A;  3OV8 A;  4P55 A;  4Q4Z F;  1WRJ A;  2MBF A;  1ZGJ A;  4WXC A;  3TO6 A;  3N4M A;  1HSJ A;  3LA3 A;  2NRA C;  1MGT A;  5DUK A;  3VEP A;  3LQR A;  2VC1 A;  4CDG A;  1TNS A;  4YII A;  4BHB A;  3VFZ A;  3TO9 A;  1O3Q A;  1SAX A;  4KIB A;  5ICE A;  3RTR A;  1BN5 A;  3L09 A;  1J9I A;  1R58 A;  3GFL A;  2CYY A;  5LEK A;  5LGU A;  1HBX G;  2K27 A;  2ESN A;  1LQ1 A;  4A5M A;  2MLK A;  4IJA A;  5KK1 A;  2PI0 A;  5DCM A;  5ILV A;  2HZT A;  3K1P A;  1QPM A;  3QP5 A;  1S29 A;  3G73 A;  4KYW A;  1FSH A;  4CHU A;  3EYI A;  1R00 A;  4O5V A;  5LHI A;  2CG4 A;  4MQ9 F;  3CDH A;  2PFB A;  3K1M A;  5D5V B;  1G3W A;  5FGM A;  1S7O A;  3CO7 C;  2G9W A;  2KIM A;  1XGS A;  4ESJ A;  3N97 A;  5CVR A;  1XDU A;  2IA1 A;  4MGR A;  3QU3 A;  1XD7 A;  4OIR F;  4A12 A;  1HW5 A;  2PG4 A;  5BPI A;  3H92 A;  4ENJ A;  5E20 A;  4HDU A;  2EJR A;  3P9I A;  4S05 A;  5E1Z B;  1WWX A;  1K7A A;  4AIK A;  3HRS A;  2JZY A;  3J81 Z;  2O61 A;  3C3W A;  4IHS A;  1W7P D;  1KYW A;  4MHG A;  5IT9 Z;  4DQ2 A;  2RDP A;  5DEQ A;  4LG0 A;  4I02 A;  4R8H A;  1YW8 A;  1XGO A;  1W7P B;  2K86 A;  3BDD A;  1USS A;  1LEB A;  5K1Y A;  3DXJ F;  4LB6 B;  2KRF A;  3CUQ B;  3K2Z A;  2IT0 A;  2XIG A;  3NEU A;  2M87 A;  3MAJ A;  3HSE A;  1K6O A;  3L7W A;  3R61 A;  4KMF A;  3ZMZ A;  3H3Z A;  1IXR C;  1ZH5 A;  2LSO A;  3NQO A;  4UV8 A;  1I6X A;  2BE5 F;  1SD4 A;  5JI6 A;  1RI7 A;  5ERI A;  2V6C A;  3TO7 A;  5FFZ A;  2LF7 A;  2ELH A;  3PQJ A;  1KU9 A;  2F5D A;  4KA4 A;  3KZY A;  1LB2 A;  4YG2 F;  4ENN A;  1ZRE A;  1V3F A;  4RGU A;  5K5R A;  1QGP A;  3L00 A;  4U0W A;  1Z9C A;  1B9N A;  1GHC A;  2K4J A;  2V1D A;  3GFI A;  1P4A A;  2NNN A;  2JPB A;  1XGM A;  3HTU A;  5F64 A;  2DQL A;  1B1B A;  3MEX A;  1ZG3 A;  2GAU A;  2OQG A;  2WC2 A;  4F7Z A;  4XBF A;  2A3S A;  1B6A A;  4WK8 F;  1S7A A;  3T8T A;  1BI3 A;  5DD8 A;  4OIO F;  3WG9 A;  3ZMS A;  2RN7 A;  4HLX A;  1PUE E;  2ADU A;  3ELK A;  1L3L A;  1FPQ A;  4U0V A;  3Q9V A;  3KCC A;  2DTR A;  1OYY A;  2ZME B;  3C7J A;  2RKH A;  5L3D A;  3RIR A;  5H6R A;  2ACJ A;  1FBU A;  3SHF A;  4HA8 A;  1WKM A;  4ZYH A;  5HOO A;  3BPV A;  3LA7 A;  4RAZ A;  5L3F A;  2FBH A;  3SXY A;  1TLH B;  1R5G A;  2FSW A;  2AXL A;  2D1V A;  1FX7 A;  3ZMV A;  2EA2 A;  1KQ0 A;  5D8K B;  4KNY A;  3I0T A;  3MCZ A;  2DPD A;  1CGP A;  4YIF A;  4L0Y B;  3GUD A;  4HX7 A;  1T98 A;  2O0Y A;  2DO7 A;  3V7R A;  4EJO A;  1FYK A;  1F5T A;  3FM5 A;  2M5W A;  2M45 A;  5DDG A;  2EFQ A;  3FMQ A;  2UWM A;  2ZO4 A;  4BHC A;  4KN7 X;  3O6B B;  4EMS A;  1G3S A;  2GXB A;  4HZF A;  1R1V A;  4EM1 A;  1PP7 U;  5D4S A;  5K5Q A;  2V79 A;  1QBJ A;  4CYD A;  3KP4 A;  5CVI A;  5HDK A;  1RZ4 A;  5FD6 A;  4G6D A;  1F1Z A;  1R5H A;  4Y17 A;  4IRI A;  1S8N A;  2TDX A;  2XRO A;  3TOB A;  5FD5 A;  3H3U A;  2GIV A;  3BPX A;  2HKO A;  3FM3 A;  2H6B A;  2K4B A;  4KIF A;  3GX4 X;  3P7N A;  1ODD A;  4M74 A;  2FF4 A;  4KT5 C;  5HLG A;  1B9M A;  1RNL A;  3WE3 A;  3CLO A;  3HRT A;  4I7H A;  4NB5 A;  4M6X A;  3R4K A;  3GYH X;  3DEU A;  3DV8 A;  5LHG A;  1FT9 A;  1YLF A;  2DK5 A;  2MLG A;  4UVA A;  5E18 F;  2XKO A;  3RDI A;  1YW9 A;  2V1U A;  3JSP A;  1Z7U A;  2H27 A;  4FX0 A;  1F4K A;  2DPU A;  4OIP F;  2ZKZ A;  1IN6 A;  4FHT A;  2FE3 A;  2JTV A;  3ULQ B;  4HX8 A;  3KZZ A;  2EFN A;  1BI0 A;  3F21 A;  5D6E A;  2A61 A;  4R79 A;  3F8N A;  3Q5F A;  1TQI A;  4CGZ A;  3FXQ A;  2QVO A;  2STW A;  1OR7 A;  1K78 A;  3P9K A;  4EGY A;  1KU2 A;  1U3E M;  1WQ2 A;  5BS6 A;  1LDK B;  3ECH A;  1D5V A;  1SMT A;  3I4P A;  4OIN F;  2PEX A;  4A6D A;  1MJA A;  1G4D A;  5FB2 A;  3T8R A;  1ZRD A;  3F72 A;  2QLZ A;  3LWF A;  1W5S A;  2QWW A;  2V9V A;  5J8C A;  1ZN2 A;  4L5J A;  2L01 A;  4LGW A;  3F6V A;  4HAM A;  1E17 A;  1T38 A;  4I0A A;  3E6D A;  2CQK A;  4GGG A;  1DPR A;  3TOA A;  2P6T A;  3RKY A;  3QOP A;  2GWR A;  1G3T A;  2EWN A;  4EV0 A;  3E3V A;  3IHU A;  1BC7 C;  2QBY B;  2XHK A;  3WTY C;  1TBX A;  6PAX A;  1YO5 C;  1REP C;  3OOP A;  1HKS A;  4KMU X;  4EGZ A;  1XDS A;  1FY7 A;  4HW0 A;  3CO6 C;  3MQ0 A;  1XMK A;  4ZYE A;  3KFW X;  4KUM A;  3QP6 A;  1UB9 A;  1BI1 A;  1R1U A;  2DLL A;  5TJJ A;  1T6S A;  2Z99 A;  4AWX B;  4G7Z F;  2IA2 A;  2J5P A;  4NHJ A;  2WTE A;  1AOY A;  2HYG D;  4M73 A;  2HS5 A;  1H0M A;  2IPQ X;  3KP3 A;  2A5Y B;  2VOO A;  3ZPL A;  4CXF A;  1BOA A;  1LVA A;  3I64 A;  5DUI A;  2GZW A;  1K79 A;  2E7X A;  4U7D A;  5LHH A;  3W6K B;  1CF7 B;  4BYY A;  4LK1 F;  3R0J A;  4G94 A;  3M8E A;  1J75 A;  1ZG5 A;  2XAQ A;  5FO5 A;  3LA2 A;  1I27 A;  3CUQ C;  2DW4 A;  5ICF A;  2HWV A;  2HDC A;  4U88 A;  1NHA A;  2XAH A;  1BC8 C;  4FX4 A;  1YS6 A;  3EYY A;  4BH9 A;  1FSE A;  2P7C B;  4B09 A;  4IHT A;  2ZNY A;  5L3B A;  3D0S A;  1D8K A;  2VT2 A;  3QU6 A;  1MKM A;  2BGC A;  1UCR A;  3FZV A;  3RKX A;  1J2X A;  2L4M A;  3JAM K;  1IW7 F;  1J59 A;  1O3S A;  2DI3 A;  4O3M A;  5HS8 A;  5LGT A;  1OMI A;  2X0L A;  1B59 A;  4CO8 A;  5ICG A;  4BQA A;  4ZZL A;  2P5L C;  3ZQ7 A;  2EB7 A;  4HF1 A;  2PN6 A;  1IRF A;  4QWQ A;  4BHP A;  2VE9 A;  5D8L B;  4CIC A;  3L2C A;  5BOX A;  3RI4 A;  3ROU A;  2ISY A;  2JT1 A;  3GEZ A;  3G3Z A;  4HBL A;  3HOS A;  2VOP A;  5J8F A;  1AWC A;  3R0A A;  3ZN0 A;  1BI2 A;  4Q5S F;  3Q9S A;  4ASN A;  3E6B A;  1DPU A;  5AIP A;  1HXD A;  4A2U A;  3WU0 A;  3IWZ A;  2NAZ A;  3K69 A;  3ZP5 A;  2RGV A;  2Z9O A;  4XLN F;  2O6G E;  1OKR A;  1J7K A;  2D45 A;  4TV7 A;  4HLY A;  3TQN A;  1KU3 A;  3HOT A;  1U5T B;  1HW1 A;  2DT5 A;  2DU9 A;  3HTS B;  1UFM A;  4HF0 A;  1KYZ A;  4EJW A;  2UXN A;  4IRG A;  4G7H F;  3WU1 B;  2LKP A;  1MDM A;  2JSC A;  3F8B A;  3WGG A;  1Z1D A;  3QPH A;  2P8T A;  5DCM B;  1SFX A;  4RGS A;  2O8X A;  2W25 A;  2CSO A;  5D5U B;  3WTU C;  2O03 A;  1DUX C;  2Y0M A;  2R7D A;  1LEA A;  3JW4 A;  5FLX Z;  2YX4 A;  4KIC A;  4M72 A;  4P9U A;  1BM9 A;  4P5O A;  2FNA A;  2M30 A;  4AIH A;  1RUO A;  1STZ A;  1G6N A;  2MH2 A;  5CVJ A;  4IF4 A;  1Z6T A;  3HSF A;  5E1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...