2HDCA

Structure of transcription factor genesis/dna complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein/dna
molecule keywords DNA (5'-D(P*GP*CP*TP*TP*AP*AP*AP*AP*TP*AP*AP*CP*AP*AP*TP*AP*
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1999-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hdcA00
1T6SA 1IN7A 1J0RA 2HYFA 2L4AA 3KETA 2Y48A 4A12A 1L0OC 3FHZA 2CW0F 4ZYGA 4ZH4F 1BI3A 2FNPA 2V6CA 1S7AA 3C1DA 3KZZA 3BPXA 1ZG3A 5D4SA 3CO6C 3KLOA 5ICCA 2PBIA 1W7PA 4G94A 2EWNA 4G7HF 5ICFA 4I2OA 3RYRA 1HKQA 3RPQA 1R7JA 4P55A 1BI2A 3S2WA 3HRTA 1PDNC 1JE8A 3HRUA 4RAYA 1LJ9A 4WK8F 1K78A 1W7PB 4IPAA 2K27A 5ICGA 5BPIA 2RNJA 3GZ6A 1T39A 3DPTA 2Z5UA 4Q5SF 3LFKA 5H6QA 1G6NA 3RPUA 5BOXA 4ENMA 4HX4A 1O3QA 1FWZA 3T0YA 4YFNF 1XGSA 1P92A 1OYYA 3E6DA 4AIHA 1P4AA 2F5CA 4L9NA 2MBFA 1V4RA 3ERED 4YG2F 2PJPA 1ZH5A 4EQQA 5E18F 4WX9A 4MEXF 3DFGA 1XCBA 3BJAA 3LWFA 4KUMA 2WWYA 1FOKA 5K1YA 3GXOA 2QUFA 2PMUA 3ULQB 1RUOA 3IL2A 3ZMDA 5ICEA 2ACJA 4Z2YA 4KIFA 2QBYA 1H9GA 2OQGA 3ZQ7A 3I59A 2Z99A 2COMA 2IW5A 3CUOA 4KNYA 2TDXA 5IT9Z 2HYGD 2FEZA 2QLZA 2FSWA 2KIUA 3LQRA 3O6BB 3GLXA 1A04A 1HW5A 2EFOA 3HUGA 5ILVA 4M9ZA 5FFZA 3SZTA 1ZLJA 5FLXZ 4A6EA 2DPDA 3WTSC 1P4XA 1QGPA 2OU2A 5LLQA 5D8KB 3F8FA 3RYPA 5BS6A 3K9TA 2A07F 2F2EA 3KE2A 2EV5A 3MEXA 4S05A 1R22A 3L9FA 2Q2EA 2ESNA 1ZG1A 5HS9A 4KA4A 4EJVA 2FMYA 2HQRA 4L18B 2XKOA 1BOAA 2EB7A 5H6RA 2HTSA 1G3TA 2HFHA 4HQMA 4O3MA 3P9IA 1TBXA 1YW9A 3F72A 5JR3A 4ZZDA 1XSDA 1KU2A 3MWMA 2MLKA 3RKWA 5KK1A 1IN4A 1S3JA 5DYMA 1TNTA 1Z6TA 5DUKA 4LB5A 1IUYA 3EDPA 4UHTA 2DK8A 1B1BA 5D5VB 2K7LA 5DD8A 3ABUA 3EETA 1K7AA 3MZHA 4YIFA 1FSHA 1FPQA 1K78B 3BY6A 2RGVA 4HDUA 4AIJA 1U5TA 2DK5A 2XASA 2XV4S 1DPRA 1MZBA 2K4JA 3SXYA 1T98A 2H09A 2A3SA 1O7FA 2CYYA 3FM5A 4EJTA 1SD7A 1Z91A 4HF2A 3TDUC 4HF0A 1RI7A 2RVCA 5CVIA 3E3VA 2ZNYA 1UB9A 4Q4ZF 1WSUA 3FXQA 1IF1A 4GGGA 4UVBA 3KLNA 3KFWX 3KP5A 3TQNA 1YLFA 4RB2C 3HTSB 4AIKA 3FXRA 2VODA 1XGNA 3WE3A 3WG9A 1HSJA 3LA7A 3WU0A 2HKXA 1MKMA 4DQ2A 4AD9A 1BIBA 1B4AA 3DP7A 4N0BA 4IXAA 3JSPA 1Z9CA 5DCMA 2YX7A 4ESBA 2LDUA 1S7OA 2BGCA 2ZKZA 5HVQC 2IT0A 1X3UA 2OQRA 3F3XA 2XVCA 4NB5A 3BP8A 2O03A 3I0TA 3EQLF 4MQ9F 1IN5A 2QZ8A 5LHHA 3HHHA 3VFZA 3LA3A 5A2QK 4EMSA 4ZYEA 5E17F 1FLIA 2KJCA 3IRRA 2KIFA 2O0YA 3QU6A 1CF7A 3CJNA 3F8NA 3SQNA 1QZZA 4HAMA 4R1HA 1R5GA 2MD5A 1TW2A 2HKOA 4KT5C 1R1TA 1YS6A 3CO7C 1HSTA 5DV5A 2P7VB 3SHFA 4U0WA 5LHIA 4RGXA 3V8JA 3QP6A 3WTYC 4CO8A 4RGUA 2EFNA 5AIQA 1HBXG 2FNAA 4L9TA 2JSCA 4Y17A 1U6GA 2G7UA 3RI4A 2R3SA 1B59A 4G6QA 3FMQA 2PMHA 4HV6A 3IWFA 1I1SA 2FRHA 2M5WA 3L7WA 3WGIA 1D3YA 1R5HA 4RAZA 1TQPA 2QVOA 5K5RA 2L02A 4BNCA 4RGRA 4M9XA 1ZRCA 2VBWA 3TO9A 2E7XA 2O3FA 1PP8F 4KMFA 3J80Z 1ULYA 3QOPA 4WWCA 4PZJA 4LMYA 3IKVA 1FC3A 2ELHA 3GWZA 2XKPA 5E1ZB 1YO5C 4IF4A 1TNSA 4BYYA 4I0AA 3BWGA 4BHBA 3WTVC 2IA0A 2STWA 1FX7A 4IRIA 4A2UA 2CG4A 3SFZA 2JRTA 2JPCA 4CGZA 1J5YA 1R00A 2GAUA 1Q1HA 1E2XA 2NS0A 3F23A 3CLOA 4U7DA 1P4WA 1FYLA 2F5EA 5L3FA 4OMYA 4CICA 1T0FA 1IRGA 4EVIA 3M9AA 4CHUA 2JT1A 3FWEA 1P2FA 4BQAA 4I0BA 2RDPA 5AONA 2BEOA 4Q47A 3CDHA 1QPMA 4KN4X 3DEUA 4I01A 1UFMA 3FX3A 5KVRA 3HRSA 2AXLA 2HEOA 3P9CA 2JZYA 2QQAA 2CGPA 1R36A 4LLNA 2DTRA 4JBAA 2PLYA 2EFPA 5HS8A 4HW0A 2EV0A 2A68F 1EH8A 3HYIA 1L3LA 4L5IA 5HS7A 4U7BA 4HOBA 4OIOF 4G7ZF 4AVPA 3DXJF 4A5NA 5CLSA 4DNCA 3C3WA 3E5UA 1U2WA 1WWXA 3FM3A 4ESJA 3KEQA 2ESHA 3KZYA 4P9UA 4LK1F 2FF4A 2LF7A 3HRMA 2VE8A 4IRGA 4ZZLA 4EV0A 5JI6A 5IT9K 1Z6RA 1KQ8A 3P7NA 4EM2A 3ECHA 1ZRDA 3I64A 3BOQA 2Z3YA 3COAC 4BH9A 2QYOA 2L54A 2ZCWA 4L5JA 1KYZA 1W5TA 2YPRA 3NQOA 5FB2A 3IHUA 2HGCA 2V1XA 3F6VA 3OV8A 2QQBA 1E17A 2M87A 2DPUA 4EM1A 4KFCA 4UXNA 3QPHA 2P8TA 2EV6A 1FBQA 1FYMA 2FBKA 5DUIA 1Z05A 2K4BA 3EYYA 3V8LA 4N9IA 3HSRA 3ML6A 1ZN2A 1UHWA 4RS8A 5E8IA 1JHFA 2OBPA 4XRFA 4A0XA 1HQCA 1LDJA 1SMYF 5DCFA 1OKRA 1IN6A 3K1PA 3KP7A 1WRJA 1ZREA 3LA2A 1QO0D 1ZARA 4LLLA 1B9NA 3QP5A 3FMSA 1J59A 3VODA 1F4KA 1K79A 2XHKA 4M71A 5D6EA 2XIGA 2B0LA 1AOYA 5LEKA 1XMAA 1UHMA 3GYHX 4P9FA 2EK5A 1YFHA 1YG2A 4HF1A 3Q9VA 4M72A 2D1HA 3O2PE 2MC3A 2DW4A 3GFMA 5TJJA 3EYIA 2UWMA 2AS5F 1V3FA 2V9VA 4JQFA 4YIIA 4GYGA 1S6LA 5J6XA 3MZYA 5ERIA 1G3YA 3HTUA 4LG0A 3KP4A 1O3RA 3JTGA 2OAZA 2J5OA 5H20A 2ISYA 3F8MA 3MFKA 1D5VA 4MNUA 3ROUA 1BN5A 2PEXA 4A5MA 1XD7A 4WF2A 4BAYA 1LDKB 4P96A 1RIOH 3CUQB 4Y13A 4A0ZA 2O61A 3E6CC 1IXSB 4OU0A 2X0LA 4ZYHA 4HV5A 2Y0MA 1IXCA 3RKYA 4MGRA 4KICA 4B09A 2BV6A 4PGGA 3L09A 2DQLA 5EEGA 5CVUA 1TLHB 2H6CA 2ETHA 4LB6B 2IRFG 5F6FA 2C6YA 4MTEA 1YTYA 4O5VA 4EJOA 3HOSA 2F5DA 2LSOA 3T8RA 5E20A 2FMLA 2DO7A 4QLCU 2PQ8A 1FBSA 2W25A 5E8GA 3FMRA 3HSEA 1Y0UA 2W24A 2RV8A 1FBUA 1W7PD 1ODDA 2P6TA 5HDNA 4M74A 1LEAA 2HWVA 1IXRC 3KP3A 2PN6A 4B8XA 1BI1A 3BZ6A 2YSRA 4MQVA 1LB2A 1REPC 2DT5A 1T38A 3C18A 1USSA 4GYIA 1S8NA 2CO5A 3J7AO 1U3EM 3I58A 5JFRA 3TOBA 1ZGAA 2D1VA 2VT2A 2P6SA 1EV7A 1XSXA 1WQ2A 3TO6A 2DBBA 3QRFF 3DQVC 3T5XA 2IJLA 5LGUA 1XGOA 3E6BA 1XB4A 4UNOA 1C0WA 3K1NA 1CGPA 2VC0A 3VEPA 1IZ1A 5LRSA 2W57A 3GFJA 2IP2A 1R58A 4N9HA 5CVJA 2MH2A 1IAWA 1R23A 2OD5A 2XROA 4HZFA 1ON2A 2WC2A 5JHUA 4EGYA 2K02A 1FZPB 3O3KA 1FSEA 2NNYA 5HOOA 1U5TC 5J8FA 3P9KA 2PI0A 1HW1A 3REOA 4I98B 1GVJA 2A6EF 4NQWA 1F5TA 5LGTA 4KDPA 4NHJA 1MDMB 4G6DA 2H94A 3T8TA 4I09A 1HKTA 2BBYA 5D4RA 3ZMUA 1K6OA 1FP2A 2XAJA 1PP7U 4XSZF 3ZN0A 1NHAA 2FQ3A 2ZMEB 3ZMTA 2DI3A 3MAJA 3BJ6A 3I71A 4UVAA 2RKHA 5ILUA 2E1NA 2IA2A 3RJPA 4ETSA 2MLGA 4M9SA 2ZFWA 1B6AA 2OA4A 1HW2A 1AWCA 5JVTA 2GZWA 3FZVA 1WKMA 4LK0F 4HX7A 4M73A 2MA3A 1KU9A 1HXDA 3JAMZ 2FOKA 3V7CA 3R60A 2Y75A 2VONA 2XAFA 2VN2A 2HZTA 4JK1X 1LNWA 2L01A 2Q0OA 2WTEA 1RUNA 4CXFA 3SZPA 1MJAA 1PUEE 1MDMA 4OIRF 1KA8A 2XRNA 2XUBA 4O6JA 3J81K 3K69A 5FD6A 1U5TB 3C7JA 4UVCA 4ENNA 5E1XA 3ZMSA 4WXDA 3R0JA 4TV7A 2QM3A 4H0EA 2YX4A 3QU3A 4FHTA 3LAJA 2WV0A 1H0MA 2GA2A 4Y15A 1IN8A 3WTZA 1U8RA 1USTA 3BJOA 2HDCA 2KJBA 5K5OA 3M8FA 1SMTA 1SAXA 2ISZA 1F1ZA 3H3ZA 4HYEA 4G9YA 5CVVA 4XLPF 1FNNA 2OZ6A 3GZ5A 2HR3A 4YFKF 3JTHA 4OINF 1R1VA 2M45A 2DQRA 2DAOA 3MQ0A 4ZYDA 2ADUA 2QBYB 1KYWA 1STZA 1DPUA 1YW8A 1J2XA 1W5SA 3WODF 1KU7A 3MCZA 1OMIA 2PFBA 4IVNA 2UZKA 1ZRFA 1H9TA 3K0LA 4XSXF 4EGZA 5LHGA 3GUDA 3V8KA 2P5KA 2VBYA 2E1CA 2P5VA 4ENJA 3AAFA 1ZLKA 3CUQA 3QPTA 4G8XA 5D6FA 3NRVA 1KGSA 3ZP5A 5LBQA 1ZAOA 1G3WA 1KQ9A 4KMUX 1FP1D 1Z1DA 4I02A 5AIPA 2H6BA 3WTXC 2VOPA 4HLXA 5LEJA 4EJWA 1EH6A 2D2WA 1BBYA 2KKOA 1BM9A 1OYWA 4RB1A 3T1BA 4PCQA 5FGMA 3B73A 1I27A 1BC8C 1HKSA 3L00A 1ZGJA 3TGNA 3BROA 4L9JA 2LF8A 3RDIA 3WTTC 3CUQC 2V79A 2UXXA 3TKYA 4G7OF 3PQKA 2KIMA 4FX0A 3NEUA 4LFUA 3F8CA 4R79A 3TDZC 3QAHA 3LQQA 2HS5A 4ENKA 1T2KA 3G73A 3HSFA 3V7SA 1P6RA 2XGXA 4HA8A 4HX8A 1O57A 2ZJ2A 1I6XA 4RB0A 2GXGA 3J80K 5BQTA 2FU4A 2EA2A 4CZZA 1XDSA 1FT9A 4F7ZA 4FX4A 2MH9A 1QBJA 4PDKA 4CDGA 2L3DA 4HQEA 1D8KA 2H27A 5LRRA 3D5LA 3ZMVA 4PGHA 4OMZA 2PG4A 2P7CB 2JTVA 1LQ1A 1BIAA 3KP6A 5E1WA 3R61A 1QZYA 1MJBA 1WI9A 2VC1A 1CF7B 1ONVA 1IW7F 3GVAA 3F21A 1UCRA 1S29A 1GHCA 1J7KA 1W4MA 2FA5A 2A69F 3M8EA 2K86A 4BXUA 4CYDA 1SFUA 3F8BA 1ZG5A 3HHGA 3N97A 3F22A 1XMKA 1VTNC 2GWRA 2NAZA 4LD5A 2O6GE 3JW4A 2P5LC 3GF2A 1MD0A 2V1DA 1I1GA 5CYVA 3R4KA 1J9IA 3RIRA 2VBZA 3DPLC 3HOTA 3M1EA 3ABTA 3JSOA 1MJ9A 1YW7A 3IWZA 2W84A 3VOEA 2E7WA 2V1UA 2X4HA 1ON1A 2QWWA 1TTYA 2GA1A 3E5XA 3I5UA 5FD5A 4M6XA 2RN7A 2G9WA 1U78A 4GXOA 2BYVE 4LG0B 4HDVA 1TQIA 2D45A 3IC7A 3K2ZA 5DD4A 5F1RA 3FF5A 1R1UA 3U2RA 3KP2A 2IPQX 3PFIA 1LDDA 1B9MA 5J8CA 2UXNA 2XAHA 1LVAA 4WCGA 4K2EA 2GXBA 2DU9A 3R6SA 4M6YA 5L3DA 2ZXJA 5HDKA 3ISPA 1SFEA 2OZUA 1FY7A 2A61A 2R7FA 4XLNF 5BPDA 3ECOA 3ZPLA 3FXUA 4ESFA 4GCVA 5FLXK 1J75A 1BC7C 4BHCA 2CQKA 2VBXA 3PQJA 4UUVA 5DDGA 5D5WB 1G3SA 5CVRA 4I7HA 3RKXA 1RZ4A 2DLLA 2FBHA 3VB2A 4IJAA 2NYXA 5L3GA 2R7DA 3GX4X 2DFIA 3CTAA 4MEYF 4U0VA 3BPVA 5ILSA 1YYVA 1BJAA 3TOAA 3J81Z 4IHTA 3DF8A 4U88A 3H3UA 4EJUA 3K1MA 3B02A 5K5QA 3L2CA 4LLGF 1G4DA 2ZO4A 3ELKA 2EFQA 4UV8A 1JXSA 2KRFA 5IT3A 4YFXF 5TRDA 3LSTA 1SD6A 4R8HA 5BMZA 3GO5A 2HTJA 4BHPA 1ZYRF 3E97A 2Z33A 1JHHA 1QNTA 5L3BA 1GXQA 2M1BA 2XAGA 1OYIA 1BI0A 2Z9OA 5D5UB 2ZBKA 4KIGA 1D8JA 3JAMK 3V7RA 4LJZF 6PAXA 3WU1B 1I5ZA 2CWEA 2J5PA 1XCVA 5HLHA 1EH7A 3OOPA 3I59B 4A0YA 3I53A 3WTUC 5HLGA 4EM0B 5DEQA 2A6HF 3GFIA 1TQMA 5HDGA 1XDUA 1KU3A 2P4WA 2QENA 2F5FA 3GW2A 2G7HA 2EA4A 3HIFA 3LAPA 2EFWA 2FBIA 4P5OA 5FFXA 1LEBA 2FXAA 1DUXC 5DCMB 4E70A 4L0YB 3I54A 1RNLA 1ZHFA 3GEZA 4WXHA 3GFLA 4ON0A 3ZN1A 1SFXA 1XSVA 5EEHA 1FYKA 2RC4A 2VT3A 4LGWA 1GXPA 1YIOA 3DKWA 4L0ZB 4GO1A 1XN7A 2JPBA 4RGSA 2HQNA 1OR7A 4MTDA 3I4PA 3KCCA 5HLIA 3N4MA 2VOOA 1O7LA 4KYWA 3BDDA 3Q5FA 2O8XA 3TO7A 5L3EA 4ASNA 3D0SA 4A6DA 2M30A 5ED4A 4Q48A 5A2QZ 2YR2A 4HLYA 3IKTA 3WGHA 2IVMA 1XGMA 4OIQF 3E5QA 3V4GA 3RTRA 4L9VA 1OPCA 3E6MA 1IRFA 5CJ9A 3F6OA 4S04A 3EUHA 5D8LB 1YS7A 3KEOA 4QWQA 1DP7P 5D5XB 2GIVA 1QQIA 2A5YB 3W6KB 1O3TA 2STTA 2FE3A 5LGNA 2M8EA 3W6JB 1MGTA 4FT8A 1Z7UA 2VXZA 4RB3C 2HOEA 3Q9SA 5L3CA 5F64A 3G3ZA 3WGGA 3IRQA 1KQ0A 2LNBA 2NNNA 1SD4A 4KN7X 3DV8A 2QQ9A 4IRHA 3U9GA 2CSOA 3U1DA 4HBLA 4OIPF 2ZMEA 2XAQA 2GQQA 4D0PA 4UV9A 1YQAA 2IA1A 2Q8KA 2EJRA 1DDNA 1F9NA 2BE5F 1JGSA 1TW3A 2L4MA 4IHSA 3R0AA 3M7GA 3H92A 4U0YA 2CFXA 2W85A 2ZNZA 5FO5A 4AWXB 2RQPA 1O3SA 2VE9A 4XBFA 4WXCA 4KIBA 4OOIA 2YU3A 3WTWC 1SD5A 3WE2A 3ZMZA 2NRAC 4MHGA 2LKPA
chains in the Genus database with same CATH superfamily
2HOTA 1WH5A 3UNGC 2IXSA 1T6SA 1A6IA 1IN7A 3KEYA 3L2QA 2ZB9A 1J0RA 2HYFA 4XK4A 2L4AA 3KETA 4AYBN 4AM3A 2Y48A 4A12A 2MW8A 2VPLA 1L0OC 1MSEC 2KZGA 3FHZA 2CW0F 1PJRA 4ZYGA 4IO9F 3OWTA 4ZH4F 4OWRB 1BI3A 2H8WA 4XORA 2FNPA 1MMGA 2V6CA 1G59A 1B72A 4DGWB 1S7AA 3C1DA 3KZZA 3BPXA 1NG6A 3SJMA 1MBJA 1ZG3A 5D4SA 2R7XA 3CO6C 3KLOA 1K83J 1OLTA 4XLHA 4B1RA 4BUPA 4CCMA 5ICCA 2PBIA 3A2KA 1ETKA 1W7PA 2EZIA 3RSNA 4G94A 3A1YA 3CD6I 2EWNA 4G7HF 1UJ8A 5ICFA 4I2OA 3RYRA 4IHWA 1HKQA 2EZLA 3RPQA 1R7JA 4P55A 3S15J 4CUGA 1BI2A 1N78A 3OSFA 2O5RA 1EA3A 3S2WA 3CC7I 4IKFA 5BNGA 3HRTA 1PDNC 3S93A 2LG4A 5M3FJ 4BXXJ 1JE8A 1ZKGA 3BR5A 2WV1A 3HRUA 5M3MJ 2Y30A 4RAYA 2E36A 4IHVA 1FOYA 1LJ9A 4WK8F 1K78A 2O8KA 1W7PB 1XG1A 4IPAA 3MKLA 2K27A 2Y0SN 5ICGA 5BPIA 2RNJA 3GZ6A 1T39A 4XKBA 2DFFA 3DPTA 2Z5UA 4Q5SF 4QTRA 3LFKA 5H6QA 4XRSA 2R7RA 1G6NA 3RPUA 1DP3A 5BOXA 4ENMA 4HX4A 1O3QA 3W3CA 1FWZA 3T0YA 1OQYA 1IV8A 2NVQJ 4YFNF 1GUUA 2KMUA 1XGSA 3U21A 1P92A 1OYYA 3E6DA 4BE1A 4AIHA 1JKRC 1P4AA 2F5CA 2M34A 4L9NA 3GTLJ 2MBFA 1OJLA 1V4RA 3ERED 2X6YA 3ZQHA 4YG2F 2PJPA 1P7JA 1ZH5A 4EQQA 5E18F 4WX9A 3MMYB 1X1AA 4MEXF 3DFGA 1SFOJ 1XCBA 1HCRA 3BJAA 2O7OA 2R5YA 3LWFA 5E79C 5KAIC 5IP9J 4KUMA 2WWYA 2KLOA 1FOKA 5K1YA 3GXOA 3ZQGA 2XGDA 3JRFA 4FE4A 2QUFA 3M3YJ 1W36D 2PMUA 5FKOA 3ULQB 2Z16A 1X58A 1RUOA 3IL2A 3ZMDA 4AU7A 3CCEI 4CCOA 5ICEA 1TWHJ 2ACJA 2AXTC 2WB1A 2EPFA 4Z2YA 2I5UA 4KIFA 2QBYA 1H9GA 2OQGA 3PNVA 4BU2A 4PSWA 3HOZJ 1VQKI 1N77A 1QHGA 3ZQ7A 3I59A 3TBIA 2ZSIB 5FKMA 2Z99A 4YRVA 2COMA 1NK3P 2IW5A 1A6QA 3CUOA 1Z3YA 4KNYA 3LMMA 1VQNI 4BDZA 1XS9A 2TDXA 3SZGA 5EGOA 5IT9Z 2HYGD 2FEZA 2QLZA 1VQ5I 2FSWA 3G2BA 3EPZA 2LD5A 1YOVB 2R7QA 2KIUA 3LQRA 3O6BB 3GLXA 3IAM2 1A04A 1HW5A 2D5VA 2EFOA 3HUGA 3FK6A 5ILVA 4M9ZA 5FFZA 1JJ8C 3SZTA 1ZLJA 3O8HA 4NQWB 5FLXZ 4A6EA 2DPDA 2LREA 2K9MA 3WTSC 1P4XA 1QGPA 1MNDA 4OAZA 1Z67A 2OU2A 5LLQA 3CQZJ 5D8KB 3F8FA 3RYPA 3S3OA 1UG2A 3DBRB 5BS6A 3M4OJ 3K9TA 2A07F 2F2EA 3CLQA 3KE2A 2EV5A 4BGDA 1WHUA 3MEXA 3SFIA 2KISA 4XLFA 4S05A 1JUMA 1D1CA 1R22A 3L9FA 2Q2EA 2IGKA 2ESNA 2LY9A 1ZG1A 5HS9A 4KA4A 2KDZA 2BHYA 4EJVA 2FMYA 2QCOA 2HQRA 4L18B 2XKOA 2KFDA 1ORKA 1BOAA 2EB7A 1P9QC 3H0GJ 5H6RA 4RA2A 5FJ8J 2HTSA 5GTIC 2R5YB 3HGGA 4DBQA 1G3TA 2HFHA 4HQMA 1VQ9I 2QEXI 4O3MA 3P9IA 1T0FC 3AG2H 1TBXA 1YW9A 3F72A 5JR3A 4ZZDA 1XSDA 3BG7A 4EATA 3BCBA 1KU2A 2MGQA 3MWMA 2MLKA 4QPQA 3RKWA 3OYNA 3CCMI 1YJWI 5KK1A 4BBRJ 1IN4A 3PO2J 1S3JA 5DYMA 1EF4A 1YJ9I 2NS7A 1TNTA 3OIQA 1MIJA 3JREA 1BJZA 3DU6A 4CH7A 1Z6TA 5DUKA 4LB5A 1WVRA 1IUYA 4MFEA 3EDPA 4UHTA 1A31A 2DK8A 1B1BA 5D5VB 2EIMH 4M6VA 4V19K 2K7LA 3DWLE 5DD8A 2BHZA 3ABUA 2DYSH 1MBHA 3EETA 1K7AA 3MZHA 2EINH 2W82A 1OCZH 4YIFA 1FSHA 5FKLA 1FPQA 1K78B 1X2MA 3BY6A 2RGVA 4HDUA 3BG6A 2XGCA 4AIJA 1U5TA 2BOLA 2DK5A 2XASA 1DPRA 2XV4S 4B3AA 1MZBA 2K4JA 4XN0A 2ELKA 3SXYA 2JVHA 2BZTA 2QA4I 2DA3A 1T98A 3MD2A 2R7WA 4UY8I 2H09A 4BJTA 3FISA 2VJ5A 2A3SA 3BC8A 4RLQA 5J1UA 2UV1A 1O7FA 3OYFA 1R5ID 1WJBA 2CYYA 3FM5A 4EJTA 4BE0A 1SD7A 1Z91A 1IRXA 2V6EA 4HF2A 2WB1N 3TDUC 4HF0A 1RI7A 2JA8J 2RVCA 1V54H 2HVRA 5CVIA 3E3VA 2ZNYA 1UB9A 4Q4ZF 4FETA 1V5EA 1WSUA 2EZHA 2GXAA 3FXQA 1IF1A 5J4VA 4GGGA 4UVBA 3KLNA 3KFWX 3KP5A 3TQNA 1JI8A 1JT0A 4Y52J 1X1BA 1YLFA 4RB2C 4AIKA 1WJDA 3FXRA 3IH3A 3KIOA 3HTSB 2DTZA 2VODA 2DOEA 1XGNA 3WE3A 3WG9A 1HSJA 3LA7A 3WU0A 2R7UA 1VF9A 2XPUA 3A01A 4QPOA 2HKXA 2NS8A 3CP2A 1MKMA 1SVOA 5C44J 4DQ2A 1QU3A 4AD9A 2GM4A 1BIBA 1B4AA 3DP7A 4N0BA 4MLOA 4BJ6C 4IXAA 2EZKA 3JSPA 1Z9CA 3KZIC 1N25A 2XF5A 5DCMA 2DN0A 3L1PA 4PJ0C 2YX7A 4ESBA 1VQOI 3C2GA 2LDUA 2X1DA 4A3MJ 1S7OA 2BGCA 3HPHA 2ZKZA 5HVQC 2IT0A 1X3UA 3LSPA 4A3LJ 3L2UA 2OQRA 3F3XA 4LIUA 2XVCA 4NB5A 1S9HA 3BP8A 4PJLA 2O03A 3I0TA 3OYEA 3EQLF 4MQ9F 2DT6A 1IN5A 3GCMA 2QZ8A 1A5JA 5LHHA 4RDUA 1BOBA 1ZELA 2XDVA 3P5JA 3K70D 3HHHA 4QIWN 5EZGA 1K4SA 3VFZA 3LA3A 2JVGA 4XOTA 5A2QK 2NVTJ 4EMSA 1BR1A 1GT0C 4ZYEA 5E17F 3DTIA 1FLIA 2KJCA 3IRRA 2B63J 2KIFA 2O0YA 3HOYJ 3QU6A 3TP0A 1UHSA 1CF7A 1HLVA 3CJNA 3F8NA 3SQNA 5M5XJ 4GRIA 3I4NJ 2LOOA 1QZZA 2L7FP 4HAMA 3BR1A 4R1HA 1R5GA 2MD5A 1TW2A 4XICA 2RREA 4JP0A 4XLCA 4FASD 3KYDB 2HKOA 4I76A 4KT5C 1R1TA 3DTKA 1S7EA 2WAQA 2BY0A 1NTCA 1YS6A 3CO7C 1HSTA 5DV5A 2P7VB 3GMEA 3SHFA 2DJIA 3L2RA 3BZKA 4U0WA 5LHIA 4F3QA 3JCUC 4RGXA 3V8JA 2L7MP 3QP6A 1ZGWA 3WTYC 2KP6A 4CO8A 1I3QJ 4RGUA 2EFNA 5AIQA 3DLAA 4AYBA 2FNAA 1HBXG 3RQ4A 4L9TA 2JSCA 4CCLA 4Y17A 1U6GA 2M7AA 5HLTA 2AHQA 4ZTFA 2Y2ZA 2N8GA 1PVEA 2G7UA 2TCTA 2R3SA 1B59A 4G6QA 1Z21A 3FMQA 3RI4A 2DXIA 1E3HA 1R6RA 2PMHA 2PJRB 4I99C 4HV6A 3IWFA 3WHCA 2PX9A 4N4NB 1I1SA 4II3A 2FRHA 2M5WA 1IC8A 5HNHA 3CCVI 3L7WA 2RAEA 1V55H 3WGIA 3S2HJ 1D3YA 2G0EA 1R5HA 2K9SA 3RPUD 3ABMH 4RAZA 1TQPA 2DDAA 2QVOA 5K5RA 2CQQA 2JMWA 2L02A 5J47A 4RGRA 4M9XA 4BNCA 4NNJA 1EJ9A 1ZRCA 2VBWA 4H4KC 3TO9A 3OY9A 2CQNA 1YRNA 2E7XA 3FXKA 1ZTRA 2O3FA 1PP8F 4KMFA 3ZQFA 1H89C 1QHHD 3J80Z 1ULYA 3QOPA 4HNUA 4L5EA 4WWCA 4PZJA 4LMYA 4ZJZA 4FISA 4IX7A 3IKVA 1K6YA 2V7FA 2X85A 1FC3A 5EYRA 2ELHA 2LH9A 3GWZA 4XLEA 2MSYA 4YEJA 2XKPA 3HG9A 3IH4A 5E1ZB 1WJFA 1YO5C 2E1OA 4IF4A 1B72B 1TNSA 1SANA 4BYYA 2VI6A 4I0AA 3BWGA 4BHBA 4ANJA 4E7LA 3WTVC 1WI3A 2IA0A 1RR8C 2STWA 1FX7A 4IRIA 1H8AC 1WCMJ 4A2UA 2CG4A 3SFZA 2JRTA 2BVMA 2QSGX 2JPCA 4CGZA 1J5YA 1R00A 2GAUA 3K4NA 5IOZA 3GLLA 1Q1HA 4PJNA 1OCTC 3OIOA 5FKNA 1E2XA 3CCQI 2NS0A 3F23A 3CLOA 4XN3A 2FQ4A 4U7DA 4KJZA 1P4WA 2NVUB 1FYLA 2F5EA 2L7KA 5L3FA 4OMYA 1OCRH 2WY8Q 1XTAA 2LRDA 4CICA 1T0FA 1IRGA 3HOWJ 3BTJA 3BG3A 4EVIA 3M9AA 4XRMA 3OYAA 3UKGA 1S72I 2LC2A 4CHUA 2R7SA 2JT1A 4Y7NJ 4GFBA 3FWEA 1P2FA 4BQAA 5J1YA 4I0BA 2RDPA 4DJAA 5AONA 2R7OA 2BEOA 2HZDA 1KONA 2CQXA 5TISC 4CA0A 1G2HA 3DTEA 4AIDA 2JK3A 3RQIA 4Q47A 3CDHA 3FXJA 2IS2A 1QPMA 4KN4X 5GPCA 3GTQJ 2VKHA 3DEUA 1LFUP 2EH3A 1I39A 4I01A 4HSRA 1UFMA 3FX3A 3HOVJ 2QKLB 3HKZA 1GLNA 1WJ5A 4MO7A 3OYDA 5KVRA 3HRSA 2AXLA 1U0JA 3WG7H 3P9CA 3VSKA 2HEOA 2JZYA 4ZC3A 2QQAA 2CGPA 3VYRB 3I56I 4J00A 1R36A 1VFCA 4LLNA 4F93B 2VASA 2X1EA 2DTRA 1W0TA 2R7VA 3BR2A 4JBAA 1JKOC 1MMSA 2PLYA 2O9LA 1W1WE 2EFPA 5HS8A 2W7NA 4HW0A 3Q3SA 3OS2A 2VKEA 2DJNA 2DMNA 2EV0A 1HF0A 2DA4A 2YS9A 2A68F 1EH8A 5JHFA 3HYIA 3DKYA 2P0WA 4RM2A 1L3LA 1J09A 1BL0A 4L5IA 4JOMA 5HS7A 2L5QA 4U7BA 4CCKA 5HNFA 2EIKH 3S32A 2QF7A 4HOBA 1GV2A 4OIOF 2Y69H 2KPMA 5JLXA 4G7ZF 2LVSA 4AVPA 4B4CA 3DXJF 4A5NA 4UB6C 4XNFA 2UUZA 4GDFA 5CLSA 2F4IA 1PUFA 2V1NA 4DNCA 1MMAA 2XPWA 3S3MA 2ECBA 4FTHA 3C3WA 4V2FA 2HVQA 2X48A 4RM3A 3E5UA 1Z7LA 3S1RJ 2H1KA 3OYMA 2ME6A 1U2WA 1WWXA 3FM3A 1WJEA 4ESJA 1T33A 1VQMI 2E35A 4BL0B 3VYUB 3KEQA 4E7SA 2ESHA 4PSXA 4P1WA 3OYLA 3KZYA 4E7KA 4P9UA 3DLLF 4LK1F 2FF4A 2LF7A 3HRMA 2ELJA 2VE8A 2F4OB 4IRGA 1I3AA 4E7IA 1ETWA 4ZZLA 4EV0A 2MFZA 4DIQA 5JI6A 5IT9K 3DEWA 1Z6RA 1KQ8A 1R49A 1ZR2A 3P7NA 3FXLA 4EM2A 3ECHA 1DU0A 5K7FA 1Z77A 1ZRDA 3HGYA 3I64A 2LY2A 2M3AA 3H5AA 3BOQA 2Z3YA 3MVPA 3COAC 1F36A 3ZOBA 2IGNA 4BH9A 2QYOA 3J7YJ 5DTDA 3A02A 4ZDOA 2L54A 2ZCWA 2DODA 4L5JA 4XOPA 1YITI 4HEA2 1KYZA 1W5TA 2YPRA 3NQOA 1ENHA 4PJJA 3OYGA 1SAUA 2JN6A 3D5SC 5FB2A 3IHUA 2HGCA 2V1XA 3F6VA 3OV8A 2FX0A 2QQBA 3S2DJ 1E17A 4E6KG 2XC7A 3IP4B 2I8DA 1JTXA 2R92J 2HDWA 2M87A 5IPAA 2VQGA 1D5YA 2DPUA 1OCPA 5GPAA 4EM1A 2IGOA 3PSFA 4KFCA 3BLYA 4B43A 4B48A 2ICWG 4UXNA 3QPHA 3PIPF 1QPIA 2P8TA 2EV6A 3CCRI 1HOMA 1FBQA 1FYMA 2FBKA 2L9SA 5DUIA 3H0DA 1AKHB 1Z05A 2K4BA 2WA0A 3EYYA 2F6CA 5B1BH 3V8LA 4N9IA 2CS3A 3GTKJ 3HKZN 3HSRA 3ML6A 4AVZA 5HODA 1ZN2A 1UHWA 4RS8A 5E8IA 1JHFA 2OBPA 4DZJA 1AKHA 4XRFA 4A0XA 2V9PA 4HNVA 1HQCA 1LDJA 3BR0A 1SMYF 1Z0XA 2EILH 5IY5H 5DCFA 1OKRA 1TL8A 2CJJA 3VSLA 1IN6A 3K1PA 3KP7A 1WRJA 3LA2A 1ZREA 1QO0D 4KT6A 1X4PA 4G6TB 4BKXA 1ZARA 2OUMA 4LLLA 1B9NA 3QP5A 3FMSA 4D7MA 1J59A 3VODA 1F4KA 3FKJA 2KL4A 3M8JA 1OISA 1K79A 3A01B 1VI0A 3LSGA 2X9DA 3CCLI 2JA2A 2XHKA 5EG0B 3TEDA 4M71A 5D6EA 2XIGA 5F08A 2B0LA 1AOYA 4NC7A 5LEKA 2DCEA 1XMAA 5JLWA 1UHMA 5GAEJ 1F43A 1B8IA 3GYHX 4M3EA 3K7AJ 4P9FA 1Y1WJ 1K61A 3A0HC 2EK5A 1YFHA 2XRLA 2X51A 4BY1J 1YG2A 2LK2A 1W0UA 2OPTA 4HF1A 5TGTA 3Q9VA 4M72A 3FXOA 1XPXA 1GDTA 2D1HA 1Y56A 1TZLA 1UG0A 2QSFX 3OYKA 3O2PE 2MC3A 1OFCX 2DA1A 1PYVA 2DW4A 3GFMA 4M3BA 5TJJA 3TW7A 3EYIA 2UWMA 4NUBA 3BTIA 4NDLA 2AS5F 4A3CJ 3JRGA 4X0GA 2DMUA 1V3FA 2V9VA 4PFOA 3FXMA 4JQFA 4PJMA 5M5YJ 4YIIA 3PJRA 2DA2A 1X19A 1IUFA 2CUJA 2WY7Q 3EUAA 4GYGA 2CUEA 2E1MB 1S6LA 4NC6A 5J6XA 3MZYA 5ERIA 3BTLA 1G3YA 3HTUA 4LG0A 2K40A 3ZRGA 3WU2C 4A93J 3KP4A 1O3RA 3S1QJ 4D5CA 3JTGA 2OAZA 4XMYA 2J5OA 5H20A 2ZSHB 1WFXA 2ISYA 3AG4H 3F8MA 3MFKA 2DDBA 3MN2A 3LSHA 3GTGJ 1D5VA 1JKPC 1MNMC 2MG4A 4MNUA 4G12A 3ROUA 1BN5A 2PEXA 5B66C 4A5MA 3LOCA 3M07A 1XD7A 4CYCB 4WF2A 2BXZA 4BAYA 2V9KA 3A0BC 5B5EC 2KIQA 1LDKB 4P96A 2XAUA 2EQRA 3L2WA 1RIOH 3CUQB 4BQQA 4EEFG 4Y13A 4A0ZA 3OYJA 2O61A 3E6CC 1IXSB 4OU0A 1GVDA 1CQTA 2X0LA 4BY7J 3ZXSA 3NWTA 4ZYHA 4IL6C 4HV5A 4FCYA 1JJ6C 2X6OA 2Y0MA 4FE7A 2E1MC 1IXCA 4AUXA 3RKYA 3S3NA 3HM5A 4MGRA 4KICA 4B09A 2BV6A 4PGGA 3LSRA 1AU7A 3A03A 3EUHC 5FROA 3L09A 4A3DJ 3PM1A 4M3DA 1YE9A 2DQLA 2XPVA 5EEGA 5CVUA 1TLHB 3PNTA 2H6CA 2ETHA 4LB6B 2IRFG 2IS1A 5F6FA 4MTEA 2C6YA 2VKDA 1YTYA 3VWBA 4O5VA 3A4CA 4EJOA 3K10A 3HOSA 3OOUA 1LKXA 2F5DA 2LSOA 1D0YA 3DKXA 3T8RA 2VUMJ 5E20A 3AG3H 2FMLA 1FOXA 2DO7A 4QLCU 3KYLA 3IUOA 1X3WB 2PQ8A 1FBSA 1HDPA 1FOWA 2W25A 5E8GA 3C2HA 3FMRA 3IH2A 3HSEA 4C2TA 1Y0UA 3RZDJ 2LYCA 2W24A 3I3LA 2RV8A 1FBUA 1UAAA 2XSJC 3QQAA 2GBYA 4IOAF 1W7PD 2NXNB 1X1DA 4J01A 1QVUA 1IG7A 3GTOJ 1ODDA 2P6TA 2LFBA 5HDNA 1Y1VJ 4M74A 1LEAA 2HWVA 1FTTA 1IXRC 3KP3A 2PN6A 4B8XA 4BDYA 1BI1A 3BZ6A 2YSRA 4MQVA 1LB2A 1REPC 2DT5A 1T38A 3C18A 1USSA 4GYIA 4CYCA 1NG7A 1DU6A 4C3JJ 1S8NA 2CO5A 3J7AO 1E0EA 1ETVA 3GBGA 4DBRA 1U3EM 3I58A 4BBSJ 5JFRA 3TOBA 1D0XA 1ZGAA 2D1VA 4HRIA 4OAYA 1RETA 2VT2A 1IDYA 1EV7A 2P6SA 4CSWA 1OCCH 2ID6A 1XSXA 2XSDC 1WQ2A 1R9TJ 3TO6A 3QYEA 2DBBA 3CCSI 3CCUI 3QRFF 3DQVC 3T5XA 2K9LA 2IJLA 4UUSA 5LGUA 1XGOA 3E6BA 3HL2A 3CP8A 1XB4A 3ESWB 2OCEA 3OS0A 4UNOA 3CJTB 1C0WA 1Y8QB 3K1NA 1CGPA 3DU5A 2VC0A 3HDDA 3VEPA 1IZ1A 3HZJA 3NAUA 4F52A 3MKYB 5LRSA 2W57A 3GFJA 3PFYA 4W1UA 4II2A 2ID3A 2IP2A 4NBQA 5B3SH 2JWTA 1R58A 4N9HA 3BR3A 5CVJA 2MH2A 2VL8A 1WH7A 1R23A 4F55A 1IAWA 1QRYA 2OD5A 2L2OA 1DGWY 2HXIA 2XROA 3JRBA 1T08B 2PJRA 4HZFA 1ON2A 2WC2A 2R0QC 1D0ZA 2ECCA 5IYBJ 3E1SA 1MNEA 3D5RC 5JHUA 4EGYA 2K02A 5F27A 2K9NA 1FZPB 3O3KA 1FSEA 2R93J 2BXYA 2NNYA 1VQPI 2L0KA 4RAFA 5HOOA 1UMQA 1U5TC 5J8FA 1P7IA 1FMVA 2CW8A 3G6EI 2VQLA 2M9HA 2K5CA 3P9KA 1HW1A 3REOA 2PI0A 2WAQN 4UUTA 2Q1ZB 4I98B 1GVJA 2OTLI 2A6EF 4NQWA 3PO3J 4LIVA 2HDDA 2R5ZA 1F5TA 5FLMJ 5DM7F 5LGTA 4KDPA 4NHJA 3S8PA 2CH0A 1MDMB 2CRGA 3BTCA 1V5GA 4G6DA 2H94A 3QOEA 4LOCA 3T8TA 2K3FA 2HPIA 4BS9A 3IAS2 4DW6A 3DEEA 3BG9A 3VYTB 4I09A 1MMDA 5GAHJ 1HKTA 2BBYA 4IHXA 5E3LA 2RQQA 3ZQIA 2HU9A 5D4RA 3SDBA 4N4OB 3ZMUA 2EBIA 4D1QA 1K6OA 1FP2A 2XAJA 1PP7U 4XSZF 3ZN0A 1NHAA 2FQ3A 2ZMEB 4M3GA 3ZMTA 2HOAA 2DI3A 3KPHA 5F04A 2M7BA 2K85A 5FKKA 3MAJA 3G71I 2PMZA 3BJ6A 4BEHA 2HQ5A 4XQFA 2IS6A 3I71A 4UVAA 2RKHA 4XKCA 5ILUA 3I55I 4JYKA 2F5VA 2E1NA 2IA2A 3S1NJ 3RJPA 3H9GA 1K4TA 4ETSA 4Y3OA 1N75A 3FHNA 1SVMA 2MLGA 3MKWB 1FIAA 1EKEA 4M9SA 3MZ8A 2ZFWA 1B6AA 1Z3XA 2OA4A 1VQ6I 2NOGA 4XL9A 1SC7A 1HW2A 4FQGA 3H9QA 2JA5J 1I50J 3JRDA 1AWCA 2E2JJ 4JX4A 4XRSG 2GZWA 2ZC2A 4MFDA 3FZVA 5JVTA 1WKMA 4LK0F 4HX7A 4M73A 2MA3A 1KU9A 1HXDA 2HNHA 3CDLA 3JAMZ 2LBFA 2FOKA 3HEFA 2GIZA 1T95A 3V7CA 3R60A 4F92B 5FLVA 1Y0NA 2Y75A 4DOZA 1A35A 2VONA 2XAFA 2M0MA 3FK7A 2VN2A 2JA7J 3OR2C 2MD0A 5EEAA 2HZTA 5M5WJ 4JK1X 1QA6A 1LNWA 1XC5A 2L01A 2Q0OA 2WTEA 1RPWA 2B7EA 1RUNA 2KT0A 4CXFA 3SZPA 1MJAA 1PUEE 3SEZA 1MDMA 4OIRF 3PNYA 1KA8A 2XUBA 2XRNA 1W36C 2CV1A 5F0FA 4O6JA 3J81K 1WJCA 3ZQCA 3K69A 5FD6A 4C30A 2X1CA 1U5TB 5IP6A 4UUSB 3C7JA 4UVCA 4CCNA 1MH4A 5E1XA 4ENNA 1TWCJ 2ZJRF 1X3ZB 3ZMSA 4WXDA 3ASOH 3VDXA 2BY2A 2CQ7A 1YJNI 2JRMA 2IEKA 3R0JA 4TV7A 1YX5A 4RAGA 3VYSB 2QM3A 4H0EA 3QWLA 3ZR8X 2YX4A 3QU3A 1VQ4I 4FHTA 3LAJA 3CESA 2WV0A 4J19A 2HI3A 2DA6A 1H0MA 5DM6F 2GA2A 4Y15A 3QODA 2A05A 3QYFA 4HNTA 1IN8A 3WTZA 1U8RA 1B8IB 3GTPJ 1OCOH 1USTA 3BJOA 1RESA 5KNLA 2HDCA 2KJBA 1TT0A 5K5OA 2IAIA 3M8FA 1R4NB 1SMTA 1SAXA 2ISZA 3TW6A 1F1ZA 2E71A 3H3ZA 3DCFA 1M1EB 1R4MB 1ETOA 4HYEA 1Q1VA 4G9YA 3QPSA 1BR2A 5CVVA 2V4JC 5K7HA 1ETYA 2QKMB 1I6HJ 4XKVA 3CF2A 3H5NA 2H1LA 4XLPF 2WAFA 1UZCA 1FNNA 2R7TA 2OZ6A 3GZ5A 2KRHA 2EIJH 2HR3A 5GP9A 2LLKA 4YFKF 3CJQB 3TMOA 3JTHA 4OINF 1R1VA 2M45A 2DQRA 2IGMA 4JX6A 1IJWC 2DAOA 3MQ0A 4ZYDA 2ADUA 4A69C 2QBYB 3ONQA 1KYWA 4KITB 1ACIA 1STZA 2BY3A 2L9RA 5CQGA 1DPUA 1YW8A 1J2XA 1W5SA 2PMZN 1YX3A 2HQAA 2W1OA 1MBGA 3WODF 3OSGA 3BG5A 3QPLA 1RR7A 5FRNA 3I4MJ 1KU7A 3MCZA 3GZNB 1OMIA 4D7NA 2PFBA 4IVNA 4BQOA 2UZKA 1ZRFA 4ZTJA 2CFOA 3K4LA 5E3NA 1H9TA 1MMNA 3K0LA 5EZHA 4XSXF 4EGZA 3S1MJ 4C3IJ 1NH3A 1VQ7I 3HUGB 4RMNA 1TWGJ 5LHGA 4E7JA 3GUDA 2MABA 3V8KA 2P5KA 2VBYA 2E1CA 5B1AH 3ABKH 4XR6A 2NOJB 2P5VA 5C3EJ 1A36A 4ENJA 3AAFA 1ZLKA 2HOSA 3HBLA 4RLFA 3CUQA 3QPTA 3WHBA 1LE8B 2COBA 4G8XA 5D6FA 1DQUA 3NRVA 1KGSA 3ZP5A 2ZXHA 5LBQA 1ZAOA 3PL8A 1G3WA 1KQ9A 4KMUX 1FP1D 1Z1DA 4I02A 4ABZA 5AIPA 2H6BA 3WTXC 2VOPA 3U1KA 4HLXA 5LEJA 4EJWA 3HPGA 2KQRA 3D1NI 1EH6A 2D2WA 4XIDA 3J7ZI 2GOMA 3S16J 1BBYA 3HB9A 2KKOA 3M1CA 5J40A 1BM9A 1SFKA 1OYWA 3DPUA 4RB1A 1JKQC 2YUSA 2E34A 3T1BA 4PFPA 2VKVA 5KAFC 4PCQA 1WGXA 5FGMA 1VQLI 2A5WA 1I27A 3B73A 3MKZA 1BC8C 2BW3A 1HKSA 1JTYA 5K7ZA 3L00A 1ZGJA 2LR8A 3I9V2 2FJ1A 3TGNA 1ERDA 1FEXA 3ABLH 3BROA 5GAGJ 4L9JA 4MHGA 2LF8A 3RDIA 3WTTC 3CUQC 2V79A 2UXXA 2OF7A 4RBOA 4E7HA 2JQ7A 3TKYA 3QYBA 1FJLA 4G7OF 3PQKA 2KIMA 4FX0A 3NEUA 1HC8A 4LFUA 3BQYA 3F8CA 4R79A 2Y31A 3C2BA 3H1CA 3CCYA 3CZ6A 1X4OA 3G1OA 3TDZC 1IO2A 2R7ZJ 3QAHA 3LQQA 2HS5A 1Y39A 4ENKA 1T2KA 4ZYAA 2W48A 2VJIA 4NC8A 3G73A 3HSFA 3V7SA 4AC0A 1P6RA 3H5RA 2XGXA 4HA8A 2KDOA 3K4MA 4HX8A 3KX2A 1O57A 2ZJ2A 1I6XA 5J3LA 1U8BA 1IV6A 4RB0A 3OS1A 2GXGA 1TWAJ 2WBMA 4ITVA 2L9VA 5DS9A 1AHDP 3J80K 4D5FA 4Y4RA 3CC2I 2Z1DA 1XX5A 5BQTA 5IOYA 2FU4A 2E19A 2EA2A 4CZZA 3K4JA 1XDSA 2CV0A 3VPRA 2DA7A 1FT9A 4F7ZA 1ITYA 4FX4A 2MH9A 1QBJA 4PDKA 4CDGA 1JUPA 2L3DA 3FIWA 4LITA 2CUFA 4C3HJ 3OL4A 4HQEA 1D8KA 2H27A 3OYHA 3BT9A 5FRMA 3H3VK 5LRRA 3D5LA 2XGEA 3ZMVA 2TRTA 4B3XA 5IYDJ 4PGHA 2AQEA 4OMZA 3OYIA 2PG4A 2P7CB 5KHDA 2JTVA 1BIAA 1LQ1A 3KP6A 5E1WA 3R61A 1QZYA 1MJBA 3GTMJ 1APLC 4ZDLA 2I10A 2CMPA 1WI9A 2VC1A 1CF7B 1MBEA 1ONVA 1IW7F 2FD5A 5F0HA 3GVAA 4A3BJ 3K2AA 3KYCB 1PUFB 3PIOF 3F21A 4CZCA 3G1LA 3H9JA 1ZK8A 4S0HB 3O8GA 1VQ8I 4IQ4A 1UCRA 2W4SA 1S29A 2NVYJ 4I6ZA 1GHCA 2Y0SA 1J7KA 1W4MA 2Q2EB 2FA5A 1LFBA 2FOWA 2CW7A 2A69F 3M8EA 2QGUA 2K86A 4BXUA 4CYDA 1SFUA 3F8BA 3NARA 1ZG5A 1FIPA 3HHGA 2M4GA 3N97A 3F22A 1XMKA 2GLOA 1R71A 1OR7C 3X2QH 1VTNC 2VQCA 2GWRA 2NAZA 4LD5A 2O6GE 4KISA 3OYBA 3JW4A 2P5LC 3GF2A 1MD0A 2VXDA 2V1DA 2DOFA 1I1GA 5CYVA 3R4KA 1J9IA 4UB8C 3RIRA 2VBZA 3DPLC 3HOTA 2F4MB 1YIJI 3DBLB 3M1EA 2E5NA 2ZJQF 1HA8A 3ABTA 1E3OC 3CMEI 3JSOA 2DMQA 1MJ9A 2ZXWH 1G8XA 1YW7A 3BCAA 3IWZA 1W5CC 2W84A 5EGOB 3BQZA 3PSIA 3ZCOA 4DYCA 3N05A 2VIXA 3VOEA 4BE2A 2ME0A 1Y6IA 3SYTA 2ZXIA 2E7WA 3RCOA 1X1CA 4W97A 2VQHA 2V1UA 2B9SA 3LFUA 2LKSA 1BA5A 1RKWA 2X4HA 1AA7A 1DGRM 1ON1A 3K70C 2QWWA 1TTYA 2GA1A 3SEQA 3E5XA 1YI2I 3I5UA 3HJEA 1YHQI 2OCCH 5FD5A 4A3FJ 4M6XA 2RN7A 4YELA 2G9WA 2YU9J 1U78A 4GXOA 2BYVE 2BVLA 3G1MA 4LG0B 1BR4A 4HDVA 1TQIA 3CMMA 2D45A 2Z2SB 3F0CA 2E5ZA 3IC7A 1RC9A 2DYRH 3K2ZA 5DD4A 2L7ZA 3PUFA 5F1RA 3FF5A 4MIMA 1R1UA 3EUKL 3U2RA 3AKZA 4IOCF 3KP2A 2IPQX 1QVTA 3PFIA 1LDDA 1H88C 2OJED 1B9MA 5J8CA 3ERMA 3F9KA 2UXNA 2DMTA 1V5FA 1VNDA 1LUJB 2XAHA 1LVAA 2WADA 4WCGA 5IP7J 4IHYA 4K2EA 2GXBA 3S17J 2DU9A 4CCJA 2JA6J 2DT7B 3R6SA 4M6YA 5L3DA 2ZXJA 5HDKA 3ISPA 1Y8RB 1SFEA 2OZUA 2XF6A 1FY7A 2A61A 2R7FA 4XLNF 5BPDA 3ECOA 1ETXA 3FXUA 4ESFA 4IZZA 3ZPLA 4GCVA 5FLXK 1J75A 1BC7C 4Z6YA 4BHCA 3OL3A 3OIPA 3K6GA 5LFAA 4A3KJ 2CQKA 3AL0C 3LSKA 2XB0X 2M4KA 2VBXA 2CUZA 3OR1C 2HPMA 3PQJA 4UUVA 1FMWA 5DDGA 5D5WB 2QQ8A 1G3SA 2K9QA 1JUSA 5CPRB 4BXFA 5CVRA 4I7HA 4A3EJ 1YRNB 3RKXA 5EJCA 2X6WA 2E2HJ 3CMAI 1RZ4A 4LG3A 1TP4A 2DLLA 2FBHA 4M3FA 3VB2A 4HG2A 3W2AA 4IJAA 2NYXA 5L3GA 1U9NA 2R7DA 2E60A 2DA5A 2Y9YA 3TP3A 3GX4X 3W2VA 2DFIA 2M0CA 1U9OA 2JSPA 2W00A 3CTAA 4MEYF 3LSIA 4BJ5C 2RNGA 2IBDA 3CF5F 3PUBA 4U0VA 3BPVA 2BY1A 5ILSA 3K4KA 2DMPA 1YYVA 3AFHA 1BJAA 3TOAA 3J81Z 4IHTA 3DF8A 3FDYA 2LMDA 2ZFUA 1X1PA 3W6VA 1GV5A 5F0CA 2LP0A 3H3UA 4U88A 4E4HA 3K1MA 4EJUA 3B02A 5K5QA 3BR6A 3L2CA 4LLGF 4E7ZA 3JRCA 1G4DA 2ZO4A 5EF6A 3ELKA 2EFQA 4UV8A 1JXSA 2KRFA 5IT3A 4ZDPA 4YFXF 1LFPA 1BW6A 4DYQA 1POGA 5TRDA 1WJAA 3J7AY 1LE8A 1WPKA 3HXLA 1SD6A 3LSTA 5EG0A 4R8HA 5F1JA 3HOUJ 4XM3A 5BMZA 3L2VA 4IEJA 3GO5A 2HTJA 1ZQ3P 1ETQA 4BHPA 1ZYRF 3E97A 2L9NA 2Z33A 2OTJI 3K4BA 1JHHA 1QNTA 5L3BA 1GXQA 1LVKA 2M1BA 2XAGA 1OYIA 1BI0A 2Z9OA 2X6XA 5D5UB 2ZBKA 4KIGA 2KZVA 1D8JA 3JAMK 3V7RA 4A3IJ 2BW3B 4LJZF 6PAXA 2LY1A 1VZ0A 3WU1B 5C4XJ 3DBHB 1I5ZA 2CWEA 2J5PA 1XCVA 4PUSA 1D1AA 5HLHA 1EH7A 3OOPA 3I59B 4A0YA 3I53A 4D9JA 3WTUC 5HLGA 4EM0B 3CC4I 5DEQA 4F91B 1JGGA 2P81A 2A6HF 3GFIA 4A3JJ 1TQMA 5HDGA 1XDUA 2E2IJ 1KU3A 2P4WA 1MBFA 4B44A 5LD2C 2QENA 2OC6A 3GW2A 2F5FA 1IGNA 2G7HA 4DZPA 2EA4A 3HIFA 3FKIJ 3FBIB 2LKXA 3LAPA 4BQNA 2EFWA 3H35A 1UELB 2FBIA 4P5OA 1ZR4A 5FFXA 3E0JB 1LEBA 1BW5A 2FXAA 1DUXC 4XONA 5DCMB 4E70A 3JR9A 4L0YB 2MYSA 3E7LA 1IRZA 3I54A 1RNLA 3B6CA 1ZHFA 3GEZA 4WXHA 4IQJA 3GFLA 4ON0A 2R4GA 3ZN1A 2WAEA 4JX5A 2VJ4A 3SDGA 3LSMA 1SFXA 1XSVA 5EEHA 2HYJA 2R5ZB 2VJJA 3K4CA 4B47A 3AG1H 4X1EA 1FYKA 2H8RA 5EDNA 5GADJ 2RC4A 1MSFC 1LPQA 2VT3A 3CMYA 5JVGF 3OMYA 3ZQLA 2KHMA 2V26A 4LGWA 1MH3A 1YIOA 1GXPA 3DKWA 1FTZA 4PK4A 3NWSA 4L0ZB 4GO1A 1XN7A 2JPBA 2VB6A 4RGSA 4A3GJ 2HQNA 1OR7A 1KZHA 3ZGKA 4MTDA 1O4XA 1WZ2A 1SEUA 3I4PA 3KCCA 5HLIA 3N4MA 2VOOA 2XB5A 1T56A 4DYRA 1O7LA 2IS4A 2A6TA 2JUGA 2GOXB 4KYWA 3BDDA 2DFHA 3Q5FA 1XMXA 1S5LC 2O8XA 3TO7A 5L3EA 3ZQQA 3G4SI 3Q0VA 4ASNA 3D0SA 4A6DA 9ANTA 4HSTA 2AO9A 2M30A 3LSJA 3TL4X 1IDZA 4BACA 5ED4A 4Q48A 5A2QZ 1TC3C 2YR2A 4HLYA 2KRCA 1RRJA 1HDDC 3IKTA 2DOAA 3WGHA 2IVMA 3GTJJ 1E3PA 3JRAA 1XGMA 3HOXJ 3LL7A 2OV7A 5J1RA 4OIQF 4Y33A 1MW7A 2M2EA 3BZCA 2ZMEC 3E5QA 3H36A 3V4GA 4YIRX 3RTRA 4L9VA 1OPCA 3E6MA 1IRFA 2JJ7A 5CJ9A 5CQEA 3HC7A 4U87A 5IYCJ 3F6OA 2LBFB 4C2MJ 4S04A 3EUHA 2CV2A 5D8LB 3JRIA 3FBNB 1YS7A 2LTPA 3KEOA 4QWQA 3CDIA 1DP7P 5D5XB 2GIVA 1QQIA 2JUCA 2A5YB 3W6KB 1RKTA 1O3TA 2STTA 2FE3A 5LGNA 3UR3C 2ZJPF 2MC4A 2M8EA 2FUG2 5KCMA 3W6JB 2K3PA 1MGTA 4FT8A 3AL0B 1Z7UA 2VXZA 4RB3C 2HOEA 2Y9ZA 3Q9SA 3RZOJ 5GTHC 2AQFA 5J4YA 5L3CA 4HPQA 5F64A 5E3MA 3G3ZA 1X2NA 3WGGA 3Q0WA 4QSHA 3IRQA 1KQ0A 2XF7A 2LNBA 4C2UA 2NNNA 4C9YA 1SVLA 2HVSA 3CJRB 1MBKA 1SD4A 4BEHB 4KN7X 4V2GA 3DV8A 2QQ9A 4IRHA 2CSOA 3U9GA 3W2WA 3U1DA 4HBLA 4OIPF 1TT5B 3S14J 2ZMEA 2XAQA 3OYCA 3Q0UA 3IV5A 2VLAA 2GQQA 4D0PA 4UV9A 1QZEA 2F48A 2QSHX 1YQAA 2IA1A 2Q8KA 5H2FC 2M8GX 2EJRA 1F9NA 2BE5F 1DDNA 1JGSA 1NK2P 4XLAA 1TW3A 1JT6A 5E3OA 3JRHA 1TWFJ 2VPRA 2L4MA 4IHSA 3R0AA 4XKWA 3M7GA 3H92A 3CCJI 4U0YA 2CFXA 3V42A 1T8IA 2W85A 2ZNZA 3RKQA 5FO5A 2HXOA 4AWXB 2DFEA 2RQPA 3LNQA 3ASNH 1O3SA 2VE9A 1D1BA 4WXCA 4KIBA 4OOIA 4XBFA 5C4JJ 2YU3A 3WTWC 2CU7A 2NVXJ 1SD5A 3WE2A 4X6AJ 3ZMZA 3B6AA 2NRAC 5CKTA 2LKPA
chains in the Genus database with same CATH topology
1T6SA 1IN7A 1J0RA 2HYFA 2L4AA 3KETA 2Y48A 4A12A 1L0OC 3FHZA 2CW0F 4ZYGA 4ZH4F 1BI3A 2FNPA 2V6CA 1S7AA 3C1DA 3KZZA 3BPXA 1ZG3A 5D4SA 3CO6C 3KLOA 5ICCA 2PBIA 1W7PA 4G94A 2EWNA 4G7HF 5ICFA 4I2OA 3RYRA 1HKQA 3RPQA 1R7JA 4P55A 1BI2A 3S2WA 3HRTA 1PDNC 1JE8A 3HRUA 4RAYA 1LJ9A 4WK8F 1K78A 1W7PB 4IPAA 2K27A 5ICGA 5BPIA 2RNJA 3GZ6A 1T39A 3DPTA 2Z5UA 4Q5SF 3LFKA 5H6QA 1G6NA 3RPUA 5BOXA 4ENMA 4HX4A 1O3QA 1FWZA 3T0YA 4YFNF 1XGSA 1P92A 1OYYA 3E6DA 4AIHA 1P4AA 2F5CA 4L9NA 2MBFA 1V4RA 3ERED 4YG2F 2PJPA 1ZH5A 4EQQA 5E18F 4WX9A 4MEXF 3DFGA 1XCBA 3BJAA 3LWFA 4KUMA 2WWYA 1FOKA 5K1YA 3GXOA 2QUFA 2PMUA 3ULQB 1RUOA 3IL2A 3ZMDA 5ICEA 2ACJA 4Z2YA 4KIFA 2QBYA 1H9GA 2OQGA 3ZQ7A 3I59A 2Z99A 2COMA 2IW5A 3CUOA 4KNYA 2TDXA 5IT9Z 2HYGD 2FEZA 2QLZA 2FSWA 2KIUA 3LQRA 3O6BB 3GLXA 1A04A 1HW5A 2EFOA 3HUGA 5ILVA 4M9ZA 5FFZA 3SZTA 1ZLJA 5FLXZ 4A6EA 2DPDA 3WTSC 1P4XA 1QGPA 2OU2A 5LLQA 5D8KB 3F8FA 3RYPA 5BS6A 3K9TA 2A07F 2F2EA 3KE2A 2EV5A 3MEXA 4S05A 1R22A 3L9FA 2Q2EA 2ESNA 1ZG1A 5HS9A 4KA4A 4EJVA 2FMYA 2HQRA 4L18B 2XKOA 1BOAA 2EB7A 5H6RA 2HTSA 1G3TA 2HFHA 4HQMA 4O3MA 3P9IA 1TBXA 1YW9A 3F72A 5JR3A 4ZZDA 1XSDA 1KU2A 3MWMA 2MLKA 3RKWA 5KK1A 1IN4A 1S3JA 5DYMA 1TNTA 1Z6TA 5DUKA 4LB5A 1IUYA 3EDPA 4UHTA 2DK8A 1B1BA 5D5VB 2K7LA 5DD8A 3ABUA 3EETA 1K7AA 3MZHA 4YIFA 1FSHA 1FPQA 1K78B 3BY6A 2RGVA 4HDUA 4AIJA 1U5TA 2DK5A 2XASA 2XV4S 1DPRA 1MZBA 2K4JA 3SXYA 1T98A 2H09A 2A3SA 1O7FA 2CYYA 3FM5A 4EJTA 1SD7A 1Z91A 4HF2A 3TDUC 4HF0A 1RI7A 2RVCA 5CVIA 3E3VA 2ZNYA 1UB9A 4Q4ZF 1WSUA 3FXQA 1IF1A 4GGGA 4UVBA 3KLNA 3KFWX 3KP5A 3TQNA 1YLFA 4RB2C 3HTSB 4AIKA 3FXRA 2VODA 1XGNA 3WE3A 3WG9A 1HSJA 3LA7A 3WU0A 2HKXA 1MKMA 4DQ2A 4AD9A 1BIBA 1B4AA 3DP7A 4N0BA 4IXAA 3JSPA 1Z9CA 5DCMA 2YX7A 4ESBA 2LDUA 1S7OA 2BGCA 2ZKZA 5HVQC 2IT0A 1X3UA 2OQRA 3F3XA 2XVCA 4NB5A 3BP8A 2O03A 3I0TA 3EQLF 4MQ9F 1IN5A 2QZ8A 5LHHA 3HHHA 3VFZA 3LA3A 5A2QK 4EMSA 4ZYEA 5E17F 1FLIA 2KJCA 3IRRA 2KIFA 2O0YA 3QU6A 1CF7A 3CJNA 3F8NA 3SQNA 1QZZA 4HAMA 4R1HA 1R5GA 2MD5A 1TW2A 2HKOA 4KT5C 1R1TA 1YS6A 3CO7C 1HSTA 5DV5A 2P7VB 3SHFA 4U0WA 5LHIA 4RGXA 3V8JA 3QP6A 3WTYC 4CO8A 4RGUA 2EFNA 5AIQA 1HBXG 2FNAA 4L9TA 2JSCA 4Y17A 1U6GA 2G7UA 3RI4A 2R3SA 1B59A 4G6QA 3FMQA 2PMHA 4HV6A 3IWFA 1I1SA 2FRHA 2M5WA 3L7WA 3WGIA 1D3YA 1R5HA 4RAZA 1TQPA 2QVOA 5K5RA 2L02A 4BNCA 4RGRA 4M9XA 1ZRCA 2VBWA 3TO9A 2E7XA 2O3FA 1PP8F 4KMFA 3J80Z 1ULYA 3QOPA 4WWCA 4PZJA 4LMYA 3IKVA 1FC3A 2ELHA 3GWZA 2XKPA 5E1ZB 1YO5C 4IF4A 1TNSA 4BYYA 4I0AA 3BWGA 4BHBA 3WTVC 2IA0A 2STWA 1FX7A 4IRIA 4A2UA 2CG4A 3SFZA 2JRTA 2JPCA 4CGZA 1J5YA 1R00A 2GAUA 1Q1HA 1E2XA 2NS0A 3F23A 3CLOA 4U7DA 1P4WA 1FYLA 2F5EA 5L3FA 4OMYA 4CICA 1T0FA 1IRGA 4EVIA 3M9AA 4CHUA 2JT1A 3FWEA 1P2FA 4BQAA 4I0BA 2RDPA 5AONA 2BEOA 4Q47A 3CDHA 1QPMA 4KN4X 3DEUA 4I01A 1UFMA 3FX3A 5KVRA 3HRSA 2AXLA 2HEOA 3P9CA 2JZYA 2QQAA 2CGPA 1R36A 4LLNA 2DTRA 4JBAA 2PLYA 2EFPA 5HS8A 4HW0A 2EV0A 2A68F 1EH8A 3HYIA 1L3LA 4L5IA 5HS7A 4U7BA 4HOBA 4OIOF 4G7ZF 4AVPA 3DXJF 4A5NA 5CLSA 4DNCA 3C3WA 3E5UA 1U2WA 1WWXA 3FM3A 4ESJA 3KEQA 2ESHA 3KZYA 4P9UA 4LK1F 2FF4A 2LF7A 3HRMA 2VE8A 4IRGA 4ZZLA 4EV0A 5JI6A 5IT9K 1Z6RA 1KQ8A 3P7NA 4EM2A 3ECHA 1ZRDA 3I64A 3BOQA 2Z3YA 3COAC 4BH9A 2QYOA 2L54A 2ZCWA 4L5JA 1KYZA 1W5TA 2YPRA 3NQOA 5FB2A 3IHUA 2HGCA 2V1XA 3F6VA 3OV8A 2QQBA 1E17A 2M87A 2DPUA 4EM1A 4KFCA 4UXNA 3QPHA 2P8TA 2EV6A 1FBQA 1FYMA 2FBKA 5DUIA 1Z05A 2K4BA 3EYYA 3V8LA 4N9IA 3HSRA 3ML6A 1ZN2A 1UHWA 4RS8A 5E8IA 1JHFA 2OBPA 4XRFA 4A0XA 1HQCA 1LDJA 1SMYF 5DCFA 1OKRA 1IN6A 3K1PA 3KP7A 1WRJA 1ZREA 3LA2A 1QO0D 1ZARA 4LLLA 1B9NA 3QP5A 3FMSA 1J59A 3VODA 1F4KA 1K79A 2XHKA 4M71A 5D6EA 2XIGA 2B0LA 1AOYA 5LEKA 1XMAA 1UHMA 3GYHX 4P9FA 2EK5A 1YFHA 1YG2A 4HF1A 3Q9VA 4M72A 2D1HA 3O2PE 2MC3A 2DW4A 3GFMA 5TJJA 3EYIA 2UWMA 2AS5F 1V3FA 2V9VA 4JQFA 4YIIA 4GYGA 1S6LA 5J6XA 3MZYA 5ERIA 1G3YA 3HTUA 4LG0A 3KP4A 1O3RA 3JTGA 2OAZA 2J5OA 5H20A 2ISYA 3F8MA 3MFKA 1D5VA 4MNUA 3ROUA 1BN5A 2PEXA 4A5MA 1XD7A 4WF2A 4BAYA 1LDKB 4P96A 1RIOH 3CUQB 4Y13A 4A0ZA 2O61A 3E6CC 1IXSB 4OU0A 2X0LA 4ZYHA 4HV5A 2Y0MA 1IXCA 3RKYA 4MGRA 4KICA 4B09A 2BV6A 4PGGA 3L09A 2DQLA 5EEGA 5CVUA 1TLHB 2H6CA 2ETHA 4LB6B 2IRFG 5F6FA 2C6YA 4MTEA 1YTYA 4O5VA 4EJOA 3HOSA 2F5DA 2LSOA 3T8RA 5E20A 2FMLA 2DO7A 4QLCU 2PQ8A 1FBSA 2W25A 5E8GA 3FMRA 3HSEA 1Y0UA 2W24A 2RV8A 1FBUA 1W7PD 1ODDA 2P6TA 5HDNA 4M74A 1LEAA 2HWVA 1IXRC 3KP3A 2PN6A 4B8XA 1BI1A 3BZ6A 2YSRA 4MQVA 1LB2A 1REPC 2DT5A 1T38A 3C18A 1USSA 4GYIA 1S8NA 2CO5A 3J7AO 1U3EM 3I58A 5JFRA 3TOBA 1ZGAA 2D1VA 2VT2A 2P6SA 1EV7A 1XSXA 1WQ2A 3TO6A 2DBBA 3QRFF 3DQVC 3T5XA 2IJLA 5LGUA 1XGOA 3E6BA 1XB4A 4UNOA 1C0WA 3K1NA 1CGPA 2VC0A 3VEPA 1IZ1A 5LRSA 2W57A 3GFJA 2IP2A 1R58A 4N9HA 5CVJA 2MH2A 1IAWA 1R23A 2OD5A 2XROA 4HZFA 1ON2A 2WC2A 5JHUA 4EGYA 2K02A 1FZPB 3O3KA 1FSEA 2NNYA 5HOOA 1U5TC 5J8FA 3P9KA 2PI0A 1HW1A 3REOA 4I98B 1GVJA 2A6EF 4NQWA 1F5TA 5LGTA 4KDPA 4NHJA 1MDMB 4G6DA 2H94A 3T8TA 4I09A 1HKTA 2BBYA 5D4RA 3ZMUA 1K6OA 1FP2A 2XAJA 1PP7U 4XSZF 3ZN0A 1NHAA 2FQ3A 2ZMEB 3ZMTA 2DI3A 3MAJA 3BJ6A 3I71A 4UVAA 2RKHA 5ILUA 2E1NA 2IA2A 3RJPA 4ETSA 2MLGA 4M9SA 2ZFWA 1B6AA 2OA4A 1HW2A 1AWCA 5JVTA 2GZWA 3FZVA 1WKMA 4LK0F 4HX7A 4M73A 2MA3A 1KU9A 1HXDA 3JAMZ 2FOKA 3V7CA 3R60A 2Y75A 2VONA 2XAFA 2VN2A 2HZTA 4JK1X 1LNWA 2L01A 2Q0OA 2WTEA 1RUNA 4CXFA 3SZPA 1MJAA 1PUEE 1MDMA 4OIRF 1KA8A 2XRNA 2XUBA 4O6JA 3J81K 3K69A 5FD6A 1U5TB 3C7JA 4UVCA 4ENNA 5E1XA 3ZMSA 4WXDA 3R0JA 4TV7A 2QM3A 4H0EA 2YX4A 3QU3A 4FHTA 3LAJA 2WV0A 1H0MA 2GA2A 4Y15A 1IN8A 3WTZA 1U8RA 1USTA 3BJOA 2HDCA 2KJBA 5K5OA 3M8FA 1SMTA 1SAXA 2ISZA 1F1ZA 3H3ZA 4HYEA 4G9YA 5CVVA 4XLPF 1FNNA 2OZ6A 3GZ5A 2HR3A 4YFKF 3JTHA 4OINF 1R1VA 2M45A 2DQRA 2DAOA 3MQ0A 4ZYDA 2ADUA 2QBYB 1KYWA 1STZA 1DPUA 1YW8A 1J2XA 1W5SA 3WODF 1KU7A 3MCZA 1OMIA 2PFBA 4IVNA 2UZKA 1ZRFA 1H9TA 3K0LA 4XSXF 4EGZA 5LHGA 3GUDA 3V8KA 2P5KA 2VBYA 2E1CA 2P5VA 4ENJA 3AAFA 1ZLKA 3CUQA 3QPTA 4G8XA 5D6FA 3NRVA 1KGSA 3ZP5A 5LBQA 1ZAOA 1G3WA 1KQ9A 4KMUX 1FP1D 1Z1DA 4I02A 5AIPA 2H6BA 3WTXC 2VOPA 4HLXA 5LEJA 4EJWA 1EH6A 2D2WA 1BBYA 2KKOA 1BM9A 1OYWA 4RB1A 3T1BA 4PCQA 5FGMA 3B73A 1I27A 1BC8C 1HKSA 3L00A 1ZGJA 3TGNA 3BROA 4L9JA 2LF8A 3RDIA 3WTTC 3CUQC 2V79A 2UXXA 3TKYA 4G7OF 3PQKA 2KIMA 4FX0A 3NEUA 4LFUA 3F8CA 4R79A 3TDZC 3QAHA 3LQQA 2HS5A 4ENKA 1T2KA 3G73A 3HSFA 3V7SA 1P6RA 2XGXA 4HA8A 4HX8A 1O57A 2ZJ2A 1I6XA 4RB0A 2GXGA 3J80K 5BQTA 2FU4A 2EA2A 4CZZA 1XDSA 1FT9A 4F7ZA 4FX4A 2MH9A 1QBJA 4PDKA 4CDGA 2L3DA 4HQEA 1D8KA 2H27A 5LRRA 3D5LA 3ZMVA 4PGHA 4OMZA 2PG4A 2P7CB 2JTVA 1LQ1A 1BIAA 3KP6A 5E1WA 3R61A 1QZYA 1MJBA 1WI9A 2VC1A 1CF7B 1ONVA 1IW7F 3GVAA 3F21A 1UCRA 1S29A 1GHCA 1J7KA 1W4MA 2FA5A 2A69F 3M8EA 2K86A 4BXUA 4CYDA 1SFUA 3F8BA 1ZG5A 3HHGA 3N97A 3F22A 1XMKA 1VTNC 2GWRA 2NAZA 4LD5A 2O6GE 3JW4A 2P5LC 3GF2A 1MD0A 2V1DA 1I1GA 5CYVA 3R4KA 1J9IA 3RIRA 2VBZA 3DPLC 3HOTA 3M1EA 3ABTA 3JSOA 1MJ9A 1YW7A 3IWZA 2W84A 3VOEA 2E7WA 2V1UA 2X4HA 1ON1A 2QWWA 1TTYA 2GA1A 3E5XA 3I5UA 5FD5A 4M6XA 2RN7A 2G9WA 1U78A 4GXOA 2BYVE 4LG0B 4HDVA 1TQIA 2D45A 3IC7A 3K2ZA 5DD4A 5F1RA 3FF5A 1R1UA 3U2RA 3KP2A 2IPQX 3PFIA 1LDDA 1B9MA 5J8CA 2UXNA 2XAHA 1LVAA 4WCGA 4K2EA 2GXBA 2DU9A 3R6SA 4M6YA 5L3DA 2ZXJA 5HDKA 3ISPA 1SFEA 2OZUA 1FY7A 2A61A 2R7FA 4XLNF 5BPDA 3ECOA 3ZPLA 3FXUA 4ESFA 4GCVA 5FLXK 1J75A 1BC7C 4BHCA 2CQKA 2VBXA 3PQJA 4UUVA 5DDGA 5D5WB 1G3SA 5CVRA 4I7HA 3RKXA 1RZ4A 2DLLA 2FBHA 3VB2A 4IJAA 2NYXA 5L3GA 2R7DA 3GX4X 2DFIA 3CTAA 4MEYF 4U0VA 3BPVA 5ILSA 1YYVA 1BJAA 3TOAA 3J81Z 4IHTA 3DF8A 4U88A 3H3UA 4EJUA 3K1MA 3B02A 5K5QA 3L2CA 4LLGF 1G4DA 2ZO4A 3ELKA 2EFQA 4UV8A 1JXSA 2KRFA 5IT3A 4YFXF 5TRDA 3LSTA 1SD6A 4R8HA 5BMZA 3GO5A 2HTJA 4BHPA 1ZYRF 3E97A 2Z33A 1JHHA 1QNTA 5L3BA 1GXQA 2M1BA 2XAGA 1OYIA 1BI0A 2Z9OA 5D5UB 2ZBKA 4KIGA 1D8JA 3JAMK 3V7RA 4LJZF 6PAXA 3WU1B 1I5ZA 2CWEA 2J5PA 1XCVA 5HLHA 1EH7A 3OOPA 3I59B 4A0YA 3I53A 3WTUC 5HLGA 4EM0B 5DEQA 2A6HF 3GFIA 1TQMA 5HDGA 1XDUA 1KU3A 2P4WA 2QENA 2F5FA 3GW2A 2G7HA 2EA4A 3HIFA 3LAPA 2EFWA 2FBIA 4P5OA 5FFXA 1LEBA 2FXAA 1DUXC 5DCMB 4E70A 4L0YB 3I54A 1RNLA 1ZHFA 3GEZA 4WXHA 3GFLA 4ON0A 3ZN1A 1SFXA 1XSVA 5EEHA 1FYKA 2RC4A 2VT3A 4LGWA 1GXPA 1YIOA 3DKWA 4L0ZB 4GO1A 1XN7A 2JPBA 4RGSA 2HQNA 1OR7A 4MTDA 3I4PA 3KCCA 5HLIA 3N4MA 2VOOA 1O7LA 4KYWA 3BDDA 3Q5FA 2O8XA 3TO7A 5L3EA 4ASNA 3D0SA 4A6DA 2M30A 5ED4A 4Q48A 5A2QZ 2YR2A 4HLYA 3IKTA 3WGHA 2IVMA 1XGMA 4OIQF 3E5QA 3V4GA 3RTRA 4L9VA 1OPCA 3E6MA 1IRFA 5CJ9A 3F6OA 4S04A 3EUHA 5D8LB 1YS7A 3KEOA 4QWQA 1DP7P 5D5XB 2GIVA 1QQIA 2A5YB 3W6KB 1O3TA 2STTA 2FE3A 5LGNA 2M8EA 3W6JB 1MGTA 4FT8A 1Z7UA 2VXZA 4RB3C 2HOEA 3Q9SA 5L3CA 5F64A 3G3ZA 3WGGA 3IRQA 1KQ0A 2LNBA 2NNNA 1SD4A 4KN7X 3DV8A 2QQ9A 4IRHA 3U9GA 2CSOA 3U1DA 4HBLA 4OIPF 2ZMEA 2XAQA 2GQQA 4D0PA 4UV9A 1YQAA 2IA1A 2Q8KA 2EJRA 1DDNA 1F9NA 2BE5F 1JGSA 1TW3A 2L4MA 4IHSA 3R0AA 3M7GA 3H92A 4U0YA 2CFXA 2W85A 2ZNZA 5FO5A 4AWXB 2RQPA 1O3SA 2VE9A 4XBFA 4WXCA 4KIBA 4OOIA 2YU3A 3WTWC 1SD5A 3WE2A 3ZMZA 2NRAC 4MHGA 2LKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6S A;  1IN7 A;  1J0R A;  2HYF A;  2L4A A;  3KET A;  2Y48 A;  4A12 A;  1L0O C;  3FHZ A;  2CW0 F;  4ZYG A;  4ZH4 F;  1BI3 A;  2FNP A;  2V6C A;  1S7A A;  3C1D A;  3KZZ A;  3BPX A;  1ZG3 A;  5D4S A;  3CO6 C;  3KLO A;  5ICC A;  2PBI A;  1W7P A;  4G94 A;  2EWN A;  4G7H F;  5ICF A;  4I2O A;  3RYR A;  1HKQ A;  3RPQ A;  1R7J A;  4P55 A;  1BI2 A;  3S2W A;  3HRT A;  1PDN C;  1JE8 A;  3HRU A;  4RAY A;  1LJ9 A;  4WK8 F;  1K78 A;  1W7P B;  4IPA A;  2K27 A;  5ICG A;  5BPI A;  2RNJ A;  3GZ6 A;  1T39 A;  3DPT A;  2Z5U A;  4Q5S F;  3LFK A;  5H6Q A;  1G6N A;  3RPU A;  5BOX A;  4ENM A;  4HX4 A;  1O3Q A;  1FWZ A;  3T0Y A;  4YFN F;  1XGS A;  1P92 A;  1OYY A;  3E6D A;  4AIH A;  1P4A A;  2F5C A;  4L9N A;  2MBF A;  1V4R A;  3ERE D;  4YG2 F;  2PJP A;  1ZH5 A;  4EQQ A;  5E18 F;  4WX9 A;  4MEX F;  3DFG A;  1XCB A;  3BJA A;  3LWF A;  4KUM A;  2WWY A;  1FOK A;  5K1Y A;  3GXO A;  2QUF A;  2PMU A;  3ULQ B;  1RUO A;  3IL2 A;  3ZMD A;  5ICE A;  2ACJ A;  4Z2Y A;  4KIF A;  2QBY A;  1H9G A;  2OQG A;  3ZQ7 A;  3I59 A;  2Z99 A;  2COM A;  2IW5 A;  3CUO A;  4KNY A;  2TDX A;  5IT9 Z;  2HYG D;  2FEZ A;  2QLZ A;  2FSW A;  2KIU A;  3LQR A;  3O6B B;  3GLX A;  1A04 A;  1HW5 A;  2EFO A;  3HUG A;  5ILV A;  4M9Z A;  5FFZ A;  3SZT A;  1ZLJ A;  5FLX Z;  4A6E A;  2DPD A;  3WTS C;  1P4X A;  1QGP A;  2OU2 A;  5LLQ A;  5D8K B;  3F8F A;  3RYP A;  5BS6 A;  3K9T A;  2A07 F;  2F2E A;  3KE2 A;  2EV5 A;  3MEX A;  4S05 A;  1R22 A;  3L9F A;  2Q2E A;  2ESN A;  1ZG1 A;  5HS9 A;  4KA4 A;  4EJV A;  2FMY A;  2HQR A;  4L18 B;  2XKO A;  1BOA A;  2EB7 A;  5H6R A;  2HTS A;  1G3T A;  2HFH A;  4HQM A;  4O3M A;  3P9I A;  1TBX A;  1YW9 A;  3F72 A;  5JR3 A;  4ZZD A;  1XSD A;  1KU2 A;  3MWM A;  2MLK A;  3RKW A;  5KK1 A;  1IN4 A;  1S3J A;  5DYM A;  1TNT A;  1Z6T A;  5DUK A;  4LB5 A;  1IUY A;  3EDP A;  4UHT A;  2DK8 A;  1B1B A;  5D5V B;  2K7L A;  5DD8 A;  3ABU A;  3EET A;  1K7A A;  3MZH A;  4YIF A;  1FSH A;  1FPQ A;  1K78 B;  3BY6 A;  2RGV A;  4HDU A;  4AIJ A;  1U5T A;  2DK5 A;  2XAS A;  2XV4 S;  1DPR A;  1MZB A;  2K4J A;  3SXY A;  1T98 A;  2H09 A;  2A3S A;  1O7F A;  2CYY A;  3FM5 A;  4EJT A;  1SD7 A;  1Z91 A;  4HF2 A;  3TDU C;  4HF0 A;  1RI7 A;  2RVC A;  5CVI A;  3E3V A;  2ZNY A;  1UB9 A;  4Q4Z F;  1WSU A;  3FXQ A;  1IF1 A;  4GGG A;  4UVB A;  3KLN A;  3KFW X;  3KP5 A;  3TQN A;  1YLF A;  4RB2 C;  3HTS B;  4AIK A;  3FXR A;  2VOD A;  1XGN A;  3WE3 A;  3WG9 A;  1HSJ A;  3LA7 A;  3WU0 A;  2HKX A;  1MKM A;  4DQ2 A;  4AD9 A;  1BIB A;  1B4A A;  3DP7 A;  4N0B A;  4IXA A;  3JSP A;  1Z9C A;  5DCM A;  2YX7 A;  4ESB A;  2LDU A;  1S7O A;  2BGC A;  2ZKZ A;  5HVQ C;  2IT0 A;  1X3U A;  2OQR A;  3F3X A;  2XVC A;  4NB5 A;  3BP8 A;  2O03 A;  3I0T A;  3EQL F;  4MQ9 F;  1IN5 A;  2QZ8 A;  5LHH A;  3HHH A;  3VFZ A;  3LA3 A;  5A2Q K;  4EMS A;  4ZYE A;  5E17 F;  1FLI A;  2KJC A;  3IRR A;  2KIF A;  2O0Y A;  3QU6 A;  1CF7 A;  3CJN A;  3F8N A;  3SQN A;  1QZZ A;  4HAM A;  4R1H A;  1R5G A;  2MD5 A;  1TW2 A;  2HKO A;  4KT5 C;  1R1T A;  1YS6 A;  3CO7 C;  1HST A;  5DV5 A;  2P7V B;  3SHF A;  4U0W A;  5LHI A;  4RGX A;  3V8J A;  3QP6 A;  3WTY C;  4CO8 A;  4RGU A;  2EFN A;  5AIQ A;  1HBX G;  2FNA A;  4L9T A;  2JSC A;  4Y17 A;  1U6G A;  2G7U A;  3RI4 A;  2R3S A;  1B59 A;  4G6Q A;  3FMQ A;  2PMH A;  4HV6 A;  3IWF A;  1I1S A;  2FRH A;  2M5W A;  3L7W A;  3WGI A;  1D3Y A;  1R5H A;  4RAZ A;  1TQP A;  2QVO A;  5K5R A;  2L02 A;  4BNC A;  4RGR A;  4M9X A;  1ZRC A;  2VBW A;  3TO9 A;  2E7X A;  2O3F A;  1PP8 F;  4KMF A;  3J80 Z;  1ULY A;  3QOP A;  4WWC A;  4PZJ A;  4LMY A;  3IKV A;  1FC3 A;  2ELH A;  3GWZ A;  2XKP A;  5E1Z B;  1YO5 C;  4IF4 A;  1TNS A;  4BYY A;  4I0A A;  3BWG A;  4BHB A;  3WTV C;  2IA0 A;  2STW A;  1FX7 A;  4IRI A;  4A2U A;  2CG4 A;  3SFZ A;  2JRT A;  2JPC A;  4CGZ A;  1J5Y A;  1R00 A;  2GAU A;  1Q1H A;  1E2X A;  2NS0 A;  3F23 A;  3CLO A;  4U7D A;  1P4W A;  1FYL A;  2F5E A;  5L3F A;  4OMY A;  4CIC A;  1T0F A;  1IRG A;  4EVI A;  3M9A A;  4CHU A;  2JT1 A;  3FWE A;  1P2F A;  4BQA A;  4I0B A;  2RDP A;  5AON A;  2BEO A;  4Q47 A;  3CDH A;  1QPM A;  4KN4 X;  3DEU A;  4I01 A;  1UFM A;  3FX3 A;  5KVR A;  3HRS A;  2AXL A;  2HEO A;  3P9C A;  2JZY A;  2QQA A;  2CGP A;  1R36 A;  4LLN A;  2DTR A;  4JBA A;  2PLY A;  2EFP A;  5HS8 A;  4HW0 A;  2EV0 A;  2A68 F;  1EH8 A;  3HYI A;  1L3L A;  4L5I A;  5HS7 A;  4U7B A;  4HOB A;  4OIO F;  4G7Z F;  4AVP A;  3DXJ F;  4A5N A;  5CLS A;  4DNC A;  3C3W A;  3E5U A;  1U2W A;  1WWX A;  3FM3 A;  4ESJ A;  3KEQ A;  2ESH A;  3KZY A;  4P9U A;  4LK1 F;  2FF4 A;  2LF7 A;  3HRM A;  2VE8 A;  4IRG A;  4ZZL A;  4EV0 A;  5JI6 A;  5IT9 K;  1Z6R A;  1KQ8 A;  3P7N A;  4EM2 A;  3ECH A;  1ZRD A;  3I64 A;  3BOQ A;  2Z3Y A;  3COA C;  4BH9 A;  2QYO A;  2L54 A;  2ZCW A;  4L5J A;  1KYZ A;  1W5T A;  2YPR A;  3NQO A;  5FB2 A;  3IHU A;  2HGC A;  2V1X A;  3F6V A;  3OV8 A;  2QQB A;  1E17 A;  2M87 A;  2DPU A;  4EM1 A;  4KFC A;  4UXN A;  3QPH A;  2P8T A;  2EV6 A;  1FBQ A;  1FYM A;  2FBK A;  5DUI A;  1Z05 A;  2K4B A;  3EYY A;  3V8L A;  4N9I A;  3HSR A;  3ML6 A;  1ZN2 A;  1UHW A;  4RS8 A;  5E8I A;  1JHF A;  2OBP A;  4XRF A;  4A0X A;  1HQC A;  1LDJ A;  1SMY F;  5DCF A;  1OKR A;  1IN6 A;  3K1P A;  3KP7 A;  1WRJ A;  1ZRE A;  3LA2 A;  1QO0 D;  1ZAR A;  4LLL A;  1B9N A;  3QP5 A;  3FMS A;  1J59 A;  3VOD A;  1F4K A;  1K79 A;  2XHK A;  4M71 A;  5D6E A;  2XIG A;  2B0L A;  1AOY A;  5LEK A;  1XMA A;  1UHM A;  3GYH X;  4P9F A;  2EK5 A;  1YFH A;  1YG2 A;  4HF1 A;  3Q9V A;  4M72 A;  2D1H A;  3O2P E;  2MC3 A;  2DW4 A;  3GFM A;  5TJJ A;  3EYI A;  2UWM A;  2AS5 F;  1V3F A;  2V9V A;  4JQF A;  4YII A;  4GYG A;  1S6L A;  5J6X A;  3MZY A;  5ERI A;  1G3Y A;  3HTU A;  4LG0 A;  3KP4 A;  1O3R A;  3JTG A;  2OAZ A;  2J5O A;  5H20 A;  2ISY A;  3F8M A;  3MFK A;  1D5V A;  4MNU A;  3ROU A;  1BN5 A;  2PEX A;  4A5M A;  1XD7 A;  4WF2 A;  4BAY A;  1LDK B;  4P96 A;  1RIO H;  3CUQ B;  4Y13 A;  4A0Z A;  2O61 A;  3E6C C;  1IXS B;  4OU0 A;  2X0L A;  4ZYH A;  4HV5 A;  2Y0M A;  1IXC A;  3RKY A;  4MGR A;  4KIC A;  4B09 A;  2BV6 A;  4PGG A;  3L09 A;  2DQL A;  5EEG A;  5CVU A;  1TLH B;  2H6C A;  2ETH A;  4LB6 B;  2IRF G;  5F6F A;  2C6Y A;  4MTE A;  1YTY A;  4O5V A;  4EJO A;  3HOS A;  2F5D A;  2LSO A;  3T8R A;  5E20 A;  2FML A;  2DO7 A;  4QLC U;  2PQ8 A;  1FBS A;  2W25 A;  5E8G A;  3FMR A;  3HSE A;  1Y0U A;  2W24 A;  2RV8 A;  1FBU A;  1W7P D;  1ODD A;  2P6T A;  5HDN A;  4M74 A;  1LEA A;  2HWV A;  1IXR C;  3KP3 A;  2PN6 A;  4B8X A;  1BI1 A;  3BZ6 A;  2YSR A;  4MQV A;  1LB2 A;  1REP C;  2DT5 A;  1T38 A;  3C18 A;  1USS A;  4GYI A;  1S8N A;  2CO5 A;  3J7A O;  1U3E M;  3I58 A;  5JFR A;  3TOB A;  1ZGA A;  2D1V A;  2VT2 A;  2P6S A;  1EV7 A;  1XSX A;  1WQ2 A;  3TO6 A;  2DBB A;  3QRF F;  3DQV C;  3T5X A;  2IJL A;  5LGU A;  1XGO A;  3E6B A;  1XB4 A;  4UNO A;  1C0W A;  3K1N A;  1CGP A;  2VC0 A;  3VEP A;  1IZ1 A;  5LRS A;  2W57 A;  3GFJ A;  2IP2 A;  1R58 A;  4N9H A;  5CVJ A;  2MH2 A;  1IAW A;  1R23 A;  2OD5 A;  2XRO A;  4HZF A;  1ON2 A;  2WC2 A;  5JHU A;  4EGY A;  2K02 A;  1FZP B;  3O3K A;  1FSE A;  2NNY A;  5HOO A;  1U5T C;  5J8F A;  3P9K A;  2PI0 A;  1HW1 A;  3REO A;  4I98 B;  1GVJ A;  2A6E F;  4NQW A;  1F5T A;  5LGT A;  4KDP A;  4NHJ A;  1MDM B;  4G6D A;  2H94 A;  3T8T A;  4I09 A;  1HKT A;  2BBY A;  5D4R A;  3ZMU A;  1K6O A;  1FP2 A;  2XAJ A;  1PP7 U;  4XSZ F;  3ZN0 A;  1NHA A;  2FQ3 A;  2ZME B;  3ZMT A;  2DI3 A;  3MAJ A;  3BJ6 A;  3I71 A;  4UVA A;  2RKH A;  5ILU A;  2E1N A;  2IA2 A;  3RJP A;  4ETS A;  2MLG A;  4M9S A;  2ZFW A;  1B6A A;  2OA4 A;  1HW2 A;  1AWC A;  5JVT A;  2GZW A;  3FZV A;  1WKM A;  4LK0 F;  4HX7 A;  4M73 A;  2MA3 A;  1KU9 A;  1HXD A;  3JAM Z;  2FOK A;  3V7C A;  3R60 A;  2Y75 A;  2VON A;  2XAF A;  2VN2 A;  2HZT A;  4JK1 X;  1LNW A;  2L01 A;  2Q0O A;  2WTE A;  1RUN A;  4CXF A;  3SZP A;  1MJA A;  1PUE E;  1MDM A;  4OIR F;  1KA8 A;  2XRN A;  2XUB A;  4O6J A;  3J81 K;  3K69 A;  5FD6 A;  1U5T B;  3C7J A;  4UVC A;  4ENN A;  5E1X A;  3ZMS A;  4WXD A;  3R0J A;  4TV7 A;  2QM3 A;  4H0E A;  2YX4 A;  3QU3 A;  4FHT A;  3LAJ A;  2WV0 A;  1H0M A;  2GA2 A;  4Y15 A;  1IN8 A;  3WTZ A;  1U8R A;  1UST A;  3BJO A;  2HDC A;  2KJB A;  5K5O A;  3M8F A;  1SMT A;  1SAX A;  2ISZ A;  1F1Z A;  3H3Z A;  4HYE A;  4G9Y A;  5CVV A;  4XLP F;  1FNN A;  2OZ6 A;  3GZ5 A;  2HR3 A;  4YFK F;  3JTH A;  4OIN F;  1R1V A;  2M45 A;  2DQR A;  2DAO A;  3MQ0 A;  4ZYD A;  2ADU A;  2QBY B;  1KYW A;  1STZ A;  1DPU A;  1YW8 A;  1J2X A;  1W5S A;  3WOD F;  1KU7 A;  3MCZ A;  1OMI A;  2PFB A;  4IVN A;  2UZK A;  1ZRF A;  1H9T A;  3K0L A;  4XSX F;  4EGZ A;  5LHG A;  3GUD A;  3V8K A;  2P5K A;  2VBY A;  2E1C A;  2P5V A;  4ENJ A;  3AAF A;  1ZLK A;  3CUQ A;  3QPT A;  4G8X A;  5D6F A;  3NRV A;  1KGS A;  3ZP5 A;  5LBQ A;  1ZAO A;  1G3W A;  1KQ9 A;  4KMU X;  1FP1 D;  1Z1D A;  4I02 A;  5AIP A;  2H6B A;  3WTX C;  2VOP A;  4HLX A;  5LEJ A;  4EJW A;  1EH6 A;  2D2W A;  1BBY A;  2KKO A;  1BM9 A;  1OYW A;  4RB1 A;  3T1B A;  4PCQ A;  5FGM A;  3B73 A;  1I27 A;  1BC8 C;  1HKS A;  3L00 A;  1ZGJ A;  3TGN A;  3BRO A;  4L9J A;  2LF8 A;  3RDI A;  3WTT C;  3CUQ C;  2V79 A;  2UXX A;  3TKY A;  4G7O F;  3PQK A;  2KIM A;  4FX0 A;  3NEU A;  4LFU A;  3F8C A;  4R79 A;  3TDZ C;  3QAH A;  3LQQ A;  2HS5 A;  4ENK A;  1T2K A;  3G73 A;  3HSF A;  3V7S A;  1P6R A;  2XGX A;  4HA8 A;  4HX8 A;  1O57 A;  2ZJ2 A;  1I6X A;  4RB0 A;  2GXG A;  3J80 K;  5BQT A;  2FU4 A;  2EA2 A;  4CZZ A;  1XDS A;  1FT9 A;  4F7Z A;  4FX4 A;  2MH9 A;  1QBJ A;  4PDK A;  4CDG A;  2L3D A;  4HQE A;  1D8K A;  2H27 A;  5LRR A;  3D5L A;  3ZMV A;  4PGH A;  4OMZ A;  2PG4 A;  2P7C B;  2JTV A;  1LQ1 A;  1BIA A;  3KP6 A;  5E1W A;  3R61 A;  1QZY A;  1MJB A;  1WI9 A;  2VC1 A;  1CF7 B;  1ONV A;  1IW7 F;  3GVA A;  3F21 A;  1UCR A;  1S29 A;  1GHC A;  1J7K A;  1W4M A;  2FA5 A;  2A69 F;  3M8E A;  2K86 A;  4BXU A;  4CYD A;  1SFU A;  3F8B A;  1ZG5 A;  3HHG A;  3N97 A;  3F22 A;  1XMK A;  1VTN C;  2GWR A;  2NAZ A;  4LD5 A;  2O6G E;  3JW4 A;  2P5L C;  3GF2 A;  1MD0 A;  2V1D A;  1I1G A;  5CYV A;  3R4K A;  1J9I A;  3RIR A;  2VBZ A;  3DPL C;  3HOT A;  3M1E A;  3ABT A;  3JSO A;  1MJ9 A;  1YW7 A;  3IWZ A;  2W84 A;  3VOE A;  2E7W A;  2V1U A;  2X4H A;  1ON1 A;  2QWW A;  1TTY A;  2GA1 A;  3E5X A;  3I5U A;  5FD5 A;  4M6X A;  2RN7 A;  2G9W A;  1U78 A;  4GXO A;  2BYV E;  4LG0 B;  4HDV A;  1TQI A;  2D45 A;  3IC7 A;  3K2Z A;  5DD4 A;  5F1R A;  3FF5 A;  1R1U A;  3U2R A;  3KP2 A;  2IPQ X;  3PFI A;  1LDD A;  1B9M A;  5J8C A;  2UXN A;  2XAH A;  1LVA A;  4WCG A;  4K2E A;  2GXB A;  2DU9 A;  3R6S A;  4M6Y A;  5L3D A;  2ZXJ A;  5HDK A;  3ISP A;  1SFE A;  2OZU A;  1FY7 A;  2A61 A;  2R7F A;  4XLN F;  5BPD A;  3ECO A;  3ZPL A;  3FXU A;  4ESF A;  4GCV A;  5FLX K;  1J75 A;  1BC7 C;  4BHC A;  2CQK A;  2VBX A;  3PQJ A;  4UUV A;  5DDG A;  5D5W B;  1G3S A;  5CVR A;  4I7H A;  3RKX A;  1RZ4 A;  2DLL A;  2FBH A;  3VB2 A;  4IJA A;  2NYX A;  5L3G A;  2R7D A;  3GX4 X;  2DFI A;  3CTA A;  4MEY F;  4U0V A;  3BPV A;  5ILS A;  1YYV A;  1BJA A;  3TOA A;  3J81 Z;  4IHT A;  3DF8 A;  4U88 A;  3H3U A;  4EJU A;  3K1M A;  3B02 A;  5K5Q A;  3L2C A;  4LLG F;  1G4D A;  2ZO4 A;  3ELK A;  2EFQ A;  4UV8 A;  1JXS A;  2KRF A;  5IT3 A;  4YFX F;  5TRD A;  3LST A;  1SD6 A;  4R8H A;  5BMZ A;  3GO5 A;  2HTJ A;  4BHP A;  1ZYR F;  3E97 A;  2Z33 A;  1JHH A;  1QNT A;  5L3B A;  1GXQ A;  2M1B A;  2XAG A;  1OYI A;  1BI0 A;  2Z9O A;  5D5U B;  2ZBK A;  4KIG A;  1D8J A;  3JAM K;  3V7R A;  4LJZ F;  6PAX A;  3WU1 B;  1I5Z A;  2CWE A;  2J5P A;  1XCV A;  5HLH A;  1EH7 A;  3OOP A;  3I59 B;  4A0Y A;  3I53 A;  3WTU C;  5HLG A;  4EM0 B;  5DEQ A;  2A6H F;  3GFI A;  1TQM A;  5HDG A;  1XDU A;  1KU3 A;  2P4W A;  2QEN A;  2F5F A;  3GW2 A;  2G7H A;  2EA4 A;  3HIF A;  3LAP A;  2EFW A;  2FBI A;  4P5O A;  5FFX A;  1LEB A;  2FXA A;  1DUX C;  5DCM B;  4E70 A;  4L0Y B;  3I54 A;  1RNL A;  1ZHF A;  3GEZ A;  4WXH A;  3GFL A;  4ON0 A;  3ZN1 A;  1SFX A;  1XSV A;  5EEH A;  1FYK A;  2RC4 A;  2VT3 A;  4LGW A;  1GXP A;  1YIO A;  3DKW A;  4L0Z B;  4GO1 A;  1XN7 A;  2JPB A;  4RGS A;  2HQN A;  1OR7 A;  4MTD A;  3I4P A;  3KCC A;  5HLI A;  3N4M A;  2VOO A;  1O7L A;  4KYW A;  3BDD A;  3Q5F A;  2O8X A;  3TO7 A;  5L3E A;  4ASN A;  3D0S A;  4A6D A;  2M30 A;  5ED4 A;  4Q48 A;  5A2Q Z;  2YR2 A;  4HLY A;  3IKT A;  3WGH A;  2IVM A;  1XGM A;  4OIQ F;  3E5Q A;  3V4G A;  3RTR A;  4L9V A;  1OPC A;  3E6M A;  1IRF A;  5CJ9 A;  3F6O A;  4S04 A;  3EUH A;  5D8L B;  1YS7 A;  3KEO A;  4QWQ A;  1DP7 P;  5D5X B;  2GIV A;  1QQI A;  2A5Y B;  3W6K B;  1O3T A;  2STT A;  2FE3 A;  5LGN A;  2M8E A;  3W6J B;  1MGT A;  4FT8 A;  1Z7U A;  2VXZ A;  4RB3 C;  2HOE A;  3Q9S A;  5L3C A;  5F64 A;  3G3Z A;  3WGG A;  3IRQ A;  1KQ0 A;  2LNB A;  2NNN A;  1SD4 A;  4KN7 X;  3DV8 A;  2QQ9 A;  4IRH A;  3U9G A;  2CSO A;  3U1D A;  4HBL A;  4OIP F;  2ZME A;  2XAQ A;  2GQQ A;  4D0P A;  4UV9 A;  1YQA A;  2IA1 A;  2Q8K A;  2EJR A;  1DDN A;  1F9N A;  2BE5 F;  1JGS A;  1TW3 A;  2L4M A;  4IHS A;  3R0A A;  3M7G A;  3H92 A;  4U0Y A;  2CFX A;  2W85 A;  2ZNZ A;  5FO5 A;  4AWX B;  2RQP A;  1O3S A;  2VE9 A;  4XBF A;  4WXC A;  4KIB A;  4OOI A;  2YU3 A;  3WTW C;  1SD5 A;  3WE2 A;  3ZMZ A;  2NRA C;  4MHG A;  2LKP A; 
#chains in the Genus database with same CATH topology
 2HOT A;  1WH5 A;  3UNG C;  2IXS A;  1T6S A;  1A6I A;  1IN7 A;  3KEY A;  3L2Q A;  2ZB9 A;  1J0R A;  2HYF A;  4XK4 A;  2L4A A;  3KET A;  4AYB N;  4AM3 A;  2Y48 A;  4A12 A;  2MW8 A;  2VPL A;  1L0O C;  1MSE C;  2KZG A;  3FHZ A;  2CW0 F;  1PJR A;  4ZYG A;  4IO9 F;  3OWT A;  4ZH4 F;  4OWR B;  1BI3 A;  2H8W A;  4XOR A;  2FNP A;  1MMG A;  2V6C A;  1G59 A;  1B72 A;  4DGW B;  1S7A A;  3C1D A;  3KZZ A;  3BPX A;  1NG6 A;  3SJM A;  1MBJ A;  1ZG3 A;  5D4S A;  2R7X A;  3CO6 C;  3KLO A;  1K83 J;  1OLT A;  4XLH A;  4B1R A;  4BUP A;  4CCM A;  5ICC A;  2PBI A;  3A2K A;  1ETK A;  1W7P A;  2EZI A;  3RSN A;  4G94 A;  3A1Y A;  3CD6 I;  2EWN A;  4G7H F;  1UJ8 A;  5ICF A;  4I2O A;  3RYR A;  4IHW A;  1HKQ A;  2EZL A;  3RPQ A;  1R7J A;  4P55 A;  3S15 J;  4CUG A;  1BI2 A;  1N78 A;  3OSF A;  2O5R A;  1EA3 A;  3S2W A;  3CC7 I;  4IKF A;  5BNG A;  3HRT A;  1PDN C;  3S93 A;  2LG4 A;  5M3F J;  4BXX J;  1JE8 A;  1ZKG A;  3BR5 A;  2WV1 A;  3HRU A;  5M3M J;  2Y30 A;  4RAY A;  2E36 A;  4IHV A;  1FOY A;  1LJ9 A;  4WK8 F;  1K78 A;  2O8K A;  1W7P B;  1XG1 A;  4IPA A;  3MKL A;  2K27 A;  2Y0S N;  5ICG A;  5BPI A;  2RNJ A;  3GZ6 A;  1T39 A;  4XKB A;  2DFF A;  3DPT A;  2Z5U A;  4Q5S F;  4QTR A;  3LFK A;  5H6Q A;  4XRS A;  2R7R A;  1G6N A;  3RPU A;  1DP3 A;  5BOX A;  4ENM A;  4HX4 A;  1O3Q A;  3W3C A;  1FWZ A;  3T0Y A;  1OQY A;  1IV8 A;  2NVQ J;  4YFN F;  1GUU A;  2KMU A;  1XGS A;  3U21 A;  1P92 A;  1OYY A;  3E6D A;  4BE1 A;  4AIH A;  1JKR C;  1P4A A;  2F5C A;  2M34 A;  4L9N A;  3GTL J;  2MBF A;  1OJL A;  1V4R A;  3ERE D;  2X6Y A;  3ZQH A;  4YG2 F;  2PJP A;  1P7J A;  1ZH5 A;  4EQQ A;  5E18 F;  4WX9 A;  3MMY B;  1X1A A;  4MEX F;  3DFG A;  1SFO J;  1XCB A;  1HCR A;  3BJA A;  2O7O A;  2R5Y A;  3LWF A;  5E79 C;  5KAI C;  5IP9 J;  4KUM A;  2WWY A;  2KLO A;  1FOK A;  5K1Y A;  3GXO A;  3ZQG A;  2XGD A;  3JRF A;  4FE4 A;  2QUF A;  3M3Y J;  1W36 D;  2PMU A;  5FKO A;  3ULQ B;  2Z16 A;  1X58 A;  1RUO A;  3IL2 A;  3ZMD A;  4AU7 A;  3CCE I;  4CCO A;  5ICE A;  1TWH J;  2ACJ A;  2AXT C;  2WB1 A;  2EPF A;  4Z2Y A;  2I5U A;  4KIF A;  2QBY A;  1H9G A;  2OQG A;  3PNV A;  4BU2 A;  4PSW A;  3HOZ J;  1VQK I;  1N77 A;  1QHG A;  3ZQ7 A;  3I59 A;  3TBI A;  2ZSI B;  5FKM A;  2Z99 A;  4YRV A;  2COM A;  1NK3 P;  2IW5 A;  1A6Q A;  3CUO A;  1Z3Y A;  4KNY A;  3LMM A;  1VQN I;  4BDZ A;  1XS9 A;  2TDX A;  3SZG A;  5EGO A;  5IT9 Z;  2HYG D;  2FEZ A;  2QLZ A;  1VQ5 I;  2FSW A;  3G2B A;  3EPZ A;  2LD5 A;  1YOV B;  2R7Q A;  2KIU A;  3LQR A;  3O6B B;  3GLX A;  3IAM 2;  1A04 A;  1HW5 A;  2D5V A;  2EFO A;  3HUG A;  3FK6 A;  5ILV A;  4M9Z A;  5FFZ A;  1JJ8 C;  3SZT A;  1ZLJ A;  3O8H A;  4NQW B;  5FLX Z;  4A6E A;  2DPD A;  2LRE A;  2K9M A;  3WTS C;  1P4X A;  1QGP A;  1MND A;  4OAZ A;  1Z67 A;  2OU2 A;  5LLQ A;  3CQZ J;  5D8K B;  3F8F A;  3RYP A;  3S3O A;  1UG2 A;  3DBR B;  5BS6 A;  3M4O J;  3K9T A;  2A07 F;  2F2E A;  3CLQ A;  3KE2 A;  2EV5 A;  4BGD A;  1WHU A;  3MEX A;  3SFI A;  2KIS A;  4XLF A;  4S05 A;  1JUM A;  1D1C A;  1R22 A;  3L9F A;  2Q2E A;  2IGK A;  2ESN A;  2LY9 A;  1ZG1 A;  5HS9 A;  4KA4 A;  2KDZ A;  2BHY A;  4EJV A;  2FMY A;  2QCO A;  2HQR A;  4L18 B;  2XKO A;  2KFD A;  1ORK A;  1BOA A;  2EB7 A;  1P9Q C;  3H0G J;  5H6R A;  4RA2 A;  5FJ8 J;  2HTS A;  5GTI C;  2R5Y B;  3HGG A;  4DBQ A;  1G3T A;  2HFH A;  4HQM A;  1VQ9 I;  2QEX I;  4O3M A;  3P9I A;  1T0F C;  3AG2 H;  1TBX A;  1YW9 A;  3F72 A;  5JR3 A;  4ZZD A;  1XSD A;  3BG7 A;  4EAT A;  3BCB A;  1KU2 A;  2MGQ A;  3MWM A;  2MLK A;  4QPQ A;  3RKW A;  3OYN A;  3CCM I;  1YJW I;  5KK1 A;  4BBR J;  1IN4 A;  3PO2 J;  1S3J A;  5DYM A;  1EF4 A;  1YJ9 I;  2NS7 A;  1TNT A;  3OIQ A;  1MIJ A;  3JRE A;  1BJZ A;  3DU6 A;  4CH7 A;  1Z6T A;  5DUK A;  4LB5 A;  1WVR A;  1IUY A;  4MFE A;  3EDP A;  4UHT A;  1A31 A;  2DK8 A;  1B1B A;  5D5V B;  2EIM H;  4M6V A;  4V19 K;  2K7L A;  3DWL E;  5DD8 A;  2BHZ A;  3ABU A;  2DYS H;  1MBH A;  3EET A;  1K7A A;  3MZH A;  2EIN H;  2W82 A;  1OCZ H;  4YIF A;  1FSH A;  5FKL A;  1FPQ A;  1K78 B;  1X2M A;  3BY6 A;  2RGV A;  4HDU A;  3BG6 A;  2XGC A;  4AIJ A;  1U5T A;  2BOL A;  2DK5 A;  2XAS A;  1DPR A;  2XV4 S;  4B3A A;  1MZB A;  2K4J A;  4XN0 A;  2ELK A;  3SXY A;  2JVH A;  2BZT A;  2QA4 I;  2DA3 A;  1T98 A;  3MD2 A;  2R7W A;  4UY8 I;  2H09 A;  4BJT A;  3FIS A;  2VJ5 A;  2A3S A;  3BC8 A;  4RLQ A;  5J1U A;  2UV1 A;  1O7F A;  3OYF A;  1R5I D;  1WJB A;  2CYY A;  3FM5 A;  4EJT A;  4BE0 A;  1SD7 A;  1Z91 A;  1IRX A;  2V6E A;  4HF2 A;  2WB1 N;  3TDU C;  4HF0 A;  1RI7 A;  2JA8 J;  2RVC A;  1V54 H;  2HVR A;  5CVI A;  3E3V A;  2ZNY A;  1UB9 A;  4Q4Z F;  4FET A;  1V5E A;  1WSU A;  2EZH A;  2GXA A;  3FXQ A;  1IF1 A;  5J4V A;  4GGG A;  4UVB A;  3KLN A;  3KFW X;  3KP5 A;  3TQN A;  1JI8 A;  1JT0 A;  4Y52 J;  1X1B A;  1YLF A;  4RB2 C;  4AIK A;  1WJD A;  3FXR A;  3IH3 A;  3KIO A;  3HTS B;  2DTZ A;  2VOD A;  2DOE A;  1XGN A;  3WE3 A;  3WG9 A;  1HSJ A;  3LA7 A;  3WU0 A;  2R7U A;  1VF9 A;  2XPU A;  3A01 A;  4QPO A;  2HKX A;  2NS8 A;  3CP2 A;  1MKM A;  1SVO A;  5C44 J;  4DQ2 A;  1QU3 A;  4AD9 A;  2GM4 A;  1BIB A;  1B4A A;  3DP7 A;  4N0B A;  4MLO A;  4BJ6 C;  4IXA A;  2EZK A;  3JSP A;  1Z9C A;  3KZI C;  1N25 A;  2XF5 A;  5DCM A;  2DN0 A;  3L1P A;  4PJ0 C;  2YX7 A;  4ESB A;  1VQO I;  3C2G A;  2LDU A;  2X1D A;  4A3M J;  1S7O A;  2BGC A;  3HPH A;  2ZKZ A;  5HVQ C;  2IT0 A;  1X3U A;  3LSP A;  4A3L J;  3L2U A;  2OQR A;  3F3X A;  4LIU A;  2XVC A;  4NB5 A;  1S9H A;  3BP8 A;  4PJL A;  2O03 A;  3I0T A;  3OYE A;  3EQL F;  4MQ9 F;  2DT6 A;  1IN5 A;  3GCM A;  2QZ8 A;  1A5J A;  5LHH A;  4RDU A;  1BOB A;  1ZEL A;  2XDV A;  3P5J A;  3K70 D;  3HHH A;  4QIW N;  5EZG A;  1K4S A;  3VFZ A;  3LA3 A;  2JVG A;  4XOT A;  5A2Q K;  2NVT J;  4EMS A;  1BR1 A;  1GT0 C;  4ZYE A;  5E17 F;  3DTI A;  1FLI A;  2KJC A;  3IRR A;  2B63 J;  2KIF A;  2O0Y A;  3HOY J;  3QU6 A;  3TP0 A;  1UHS A;  1CF7 A;  1HLV A;  3CJN A;  3F8N A;  3SQN A;  5M5X J;  4GRI A;  3I4N J;  2LOO A;  1QZZ A;  2L7F P;  4HAM A;  3BR1 A;  4R1H A;  1R5G A;  2MD5 A;  1TW2 A;  4XIC A;  2RRE A;  4JP0 A;  4XLC A;  4FAS D;  3KYD B;  2HKO A;  4I76 A;  4KT5 C;  1R1T A;  3DTK A;  1S7E A;  2WAQ A;  2BY0 A;  1NTC A;  1YS6 A;  3CO7 C;  1HST A;  5DV5 A;  2P7V B;  3GME A;  3SHF A;  2DJI A;  3L2R A;  3BZK A;  4U0W A;  5LHI A;  4F3Q A;  3JCU C;  4RGX A;  3V8J A;  2L7M P;  3QP6 A;  1ZGW A;  3WTY C;  2KP6 A;  4CO8 A;  1I3Q J;  4RGU A;  2EFN A;  5AIQ A;  3DLA A;  4AYB A;  2FNA A;  1HBX G;  3RQ4 A;  4L9T A;  2JSC A;  4CCL A;  4Y17 A;  1U6G A;  2M7A A;  5HLT A;  2AHQ A;  4ZTF A;  2Y2Z A;  2N8G A;  1PVE A;  2G7U A;  2TCT A;  2R3S A;  1B59 A;  4G6Q A;  1Z21 A;  3FMQ A;  3RI4 A;  2DXI A;  1E3H A;  1R6R A;  2PMH A;  2PJR B;  4I99 C;  4HV6 A;  3IWF A;  3WHC A;  2PX9 A;  4N4N B;  1I1S A;  4II3 A;  2FRH A;  2M5W A;  1IC8 A;  5HNH A;  3CCV I;  3L7W A;  2RAE A;  1V55 H;  3WGI A;  3S2H J;  1D3Y A;  2G0E A;  1R5H A;  2K9S A;  3RPU D;  3ABM H;  4RAZ A;  1TQP A;  2DDA A;  2QVO A;  5K5R A;  2CQQ A;  2JMW A;  2L02 A;  5J47 A;  4RGR A;  4M9X A;  4BNC A;  4NNJ A;  1EJ9 A;  1ZRC A;  2VBW A;  4H4K C;  3TO9 A;  3OY9 A;  2CQN A;  1YRN A;  2E7X A;  3FXK A;  1ZTR A;  2O3F A;  1PP8 F;  4KMF A;  3ZQF A;  1H89 C;  1QHH D;  3J80 Z;  1ULY A;  3QOP A;  4HNU A;  4L5E A;  4WWC A;  4PZJ A;  4LMY A;  4ZJZ A;  4FIS A;  4IX7 A;  3IKV A;  1K6Y A;  2V7F A;  2X85 A;  1FC3 A;  5EYR A;  2ELH A;  2LH9 A;  3GWZ A;  4XLE A;  2MSY A;  4YEJ A;  2XKP A;  3HG9 A;  3IH4 A;  5E1Z B;  1WJF A;  1YO5 C;  2E1O A;  4IF4 A;  1B72 B;  1TNS A;  1SAN A;  4BYY A;  2VI6 A;  4I0A A;  3BWG A;  4BHB A;  4ANJ A;  4E7L A;  3WTV C;  1WI3 A;  2IA0 A;  1RR8 C;  2STW A;  1FX7 A;  4IRI A;  1H8A C;  1WCM J;  4A2U A;  2CG4 A;  3SFZ A;  2JRT A;  2BVM A;  2QSG X;  2JPC A;  4CGZ A;  1J5Y A;  1R00 A;  2GAU A;  3K4N A;  5IOZ A;  3GLL A;  1Q1H A;  4PJN A;  1OCT C;  3OIO A;  5FKN A;  1E2X A;  3CCQ I;  2NS0 A;  3F23 A;  3CLO A;  4XN3 A;  2FQ4 A;  4U7D A;  4KJZ A;  1P4W A;  2NVU B;  1FYL A;  2F5E A;  2L7K A;  5L3F A;  4OMY A;  1OCR H;  2WY8 Q;  1XTA A;  2LRD A;  4CIC A;  1T0F A;  1IRG A;  3HOW J;  3BTJ A;  3BG3 A;  4EVI A;  3M9A A;  4XRM A;  3OYA A;  3UKG A;  1S72 I;  2LC2 A;  4CHU A;  2R7S A;  2JT1 A;  4Y7N J;  4GFB A;  3FWE A;  1P2F A;  4BQA A;  5J1Y A;  4I0B A;  2RDP A;  4DJA A;  5AON A;  2R7O A;  2BEO A;  2HZD A;  1KON A;  2CQX A;  5TIS C;  4CA0 A;  1G2H A;  3DTE A;  4AID A;  2JK3 A;  3RQI A;  4Q47 A;  3CDH A;  3FXJ A;  2IS2 A;  1QPM A;  4KN4 X;  5GPC A;  3GTQ J;  2VKH A;  3DEU A;  1LFU P;  2EH3 A;  1I39 A;  4I01 A;  4HSR A;  1UFM A;  3FX3 A;  3HOV J;  2QKL B;  3HKZ A;  1GLN A;  1WJ5 A;  4MO7 A;  3OYD A;  5KVR A;  3HRS A;  2AXL A;  1U0J A;  3WG7 H;  3P9C A;  3VSK A;  2HEO A;  2JZY A;  4ZC3 A;  2QQA A;  2CGP A;  3VYR B;  3I56 I;  4J00 A;  1R36 A;  1VFC A;  4LLN A;  4F93 B;  2VAS A;  2X1E A;  2DTR A;  1W0T A;  2R7V A;  3BR2 A;  4JBA A;  1JKO C;  1MMS A;  2PLY A;  2O9L A;  1W1W E;  2EFP A;  5HS8 A;  2W7N A;  4HW0 A;  3Q3S A;  3OS2 A;  2VKE A;  2DJN A;  2DMN A;  2EV0 A;  1HF0 A;  2DA4 A;  2YS9 A;  2A68 F;  1EH8 A;  5JHF A;  3HYI A;  3DKY A;  2P0W A;  4RM2 A;  1L3L A;  1J09 A;  1BL0 A;  4L5I A;  4JOM A;  5HS7 A;  2L5Q A;  4U7B A;  4CCK A;  5HNF A;  2EIK H;  3S32 A;  2QF7 A;  4HOB A;  1GV2 A;  4OIO F;  2Y69 H;  2KPM A;  5JLX A;  4G7Z F;  2LVS A;  4AVP A;  4B4C A;  3DXJ F;  4A5N A;  4UB6 C;  4XNF A;  2UUZ A;  4GDF A;  5CLS A;  2F4I A;  1PUF A;  2V1N A;  4DNC A;  1MMA A;  2XPW A;  3S3M A;  2ECB A;  4FTH A;  3C3W A;  4V2F A;  2HVQ A;  2X48 A;  4RM3 A;  3E5U A;  1Z7L A;  3S1R J;  2H1K A;  3OYM A;  2ME6 A;  1U2W A;  1WWX A;  3FM3 A;  1WJE A;  4ESJ A;  1T33 A;  1VQM I;  2E35 A;  4BL0 B;  3VYU B;  3KEQ A;  4E7S A;  2ESH A;  4PSX A;  4P1W A;  3OYL A;  3KZY A;  4E7K A;  4P9U A;  3DLL F;  4LK1 F;  2FF4 A;  2LF7 A;  3HRM A;  2ELJ A;  2VE8 A;  2F4O B;  4IRG A;  1I3A A;  4E7I A;  1ETW A;  4ZZL A;  4EV0 A;  2MFZ A;  4DIQ A;  5JI6 A;  5IT9 K;  3DEW A;  1Z6R A;  1KQ8 A;  1R49 A;  1ZR2 A;  3P7N A;  3FXL A;  4EM2 A;  3ECH A;  1DU0 A;  5K7F A;  1Z77 A;  1ZRD A;  3HGY A;  3I64 A;  2LY2 A;  2M3A A;  3H5A A;  3BOQ A;  2Z3Y A;  3MVP A;  3COA C;  1F36 A;  3ZOB A;  2IGN A;  4BH9 A;  2QYO A;  3J7Y J;  5DTD A;  3A02 A;  4ZDO A;  2L54 A;  2ZCW A;  2DOD A;  4L5J A;  4XOP A;  1YIT I;  4HEA 2;  1KYZ A;  1W5T A;  2YPR A;  3NQO A;  1ENH A;  4PJJ A;  3OYG A;  1SAU A;  2JN6 A;  3D5S C;  5FB2 A;  3IHU A;  2HGC A;  2V1X A;  3F6V A;  3OV8 A;  2FX0 A;  2QQB A;  3S2D J;  1E17 A;  4E6K G;  2XC7 A;  3IP4 B;  2I8D A;  1JTX A;  2R92 J;  2HDW A;  2M87 A;  5IPA A;  2VQG A;  1D5Y A;  2DPU A;  1OCP A;  5GPA A;  4EM1 A;  2IGO A;  3PSF A;  4KFC A;  3BLY A;  4B43 A;  4B48 A;  2ICW G;  4UXN A;  3QPH A;  3PIP F;  1QPI A;  2P8T A;  2EV6 A;  3CCR I;  1HOM A;  1FBQ A;  1FYM A;  2FBK A;  2L9S A;  5DUI A;  3H0D A;  1AKH B;  1Z05 A;  2K4B A;  2WA0 A;  3EYY A;  2F6C A;  5B1B H;  3V8L A;  4N9I A;  2CS3 A;  3GTK J;  3HKZ N;  3HSR A;  3ML6 A;  4AVZ A;  5HOD A;  1ZN2 A;  1UHW A;  4RS8 A;  5E8I A;  1JHF A;  2OBP A;  4DZJ A;  1AKH A;  4XRF A;  4A0X A;  2V9P A;  4HNV A;  1HQC A;  1LDJ A;  3BR0 A;  1SMY F;  1Z0X A;  2EIL H;  5IY5 H;  5DCF A;  1OKR A;  1TL8 A;  2CJJ A;  3VSL A;  1IN6 A;  3K1P A;  3KP7 A;  1WRJ A;  3LA2 A;  1ZRE A;  1QO0 D;  4KT6 A;  1X4P A;  4G6T B;  4BKX A;  1ZAR A;  2OUM A;  4LLL A;  1B9N A;  3QP5 A;  3FMS A;  4D7M A;  1J59 A;  3VOD A;  1F4K A;  3FKJ A;  2KL4 A;  3M8J A;  1OIS A;  1K79 A;  3A01 B;  1VI0 A;  3LSG A;  2X9D A;  3CCL I;  2JA2 A;  2XHK A;  5EG0 B;  3TED A;  4M71 A;  5D6E A;  2XIG A;  5F08 A;  2B0L A;  1AOY A;  4NC7 A;  5LEK A;  2DCE A;  1XMA A;  5JLW A;  1UHM A;  5GAE J;  1F43 A;  1B8I A;  3GYH X;  4M3E A;  3K7A J;  4P9F A;  1Y1W J;  1K61 A;  3A0H C;  2EK5 A;  1YFH A;  2XRL A;  2X51 A;  4BY1 J;  1YG2 A;  2LK2 A;  1W0U A;  2OPT A;  4HF1 A;  5TGT A;  3Q9V A;  4M72 A;  3FXO A;  1XPX A;  1GDT A;  2D1H A;  1Y56 A;  1TZL A;  1UG0 A;  2QSF X;  3OYK A;  3O2P E;  2MC3 A;  1OFC X;  2DA1 A;  1PYV A;  2DW4 A;  3GFM A;  4M3B A;  5TJJ A;  3TW7 A;  3EYI A;  2UWM A;  4NUB A;  3BTI A;  4NDL A;  2AS5 F;  4A3C J;  3JRG A;  4X0G A;  2DMU A;  1V3F A;  2V9V A;  4PFO A;  3FXM A;  4JQF A;  4PJM A;  5M5Y J;  4YII A;  3PJR A;  2DA2 A;  1X19 A;  1IUF A;  2CUJ A;  2WY7 Q;  3EUA A;  4GYG A;  2CUE A;  2E1M B;  1S6L A;  4NC6 A;  5J6X A;  3MZY A;  5ERI A;  3BTL A;  1G3Y A;  3HTU A;  4LG0 A;  2K40 A;  3ZRG A;  3WU2 C;  4A93 J;  3KP4 A;  1O3R A;  3S1Q J;  4D5C A;  3JTG A;  2OAZ A;  4XMY A;  2J5O A;  5H20 A;  2ZSH B;  1WFX A;  2ISY A;  3AG4 H;  3F8M A;  3MFK A;  2DDB A;  3MN2 A;  3LSH A;  3GTG J;  1D5V A;  1JKP C;  1MNM C;  2MG4 A;  4MNU A;  4G12 A;  3ROU A;  1BN5 A;  2PEX A;  5B66 C;  4A5M A;  3LOC A;  3M07 A;  1XD7 A;  4CYC B;  4WF2 A;  2BXZ A;  4BAY A;  2V9K A;  3A0B C;  5B5E C;  2KIQ A;  1LDK B;  4P96 A;  2XAU A;  2EQR A;  3L2W A;  1RIO H;  3CUQ B;  4BQQ A;  4EEF G;  4Y13 A;  4A0Z A;  3OYJ A;  2O61 A;  3E6C C;  1IXS B;  4OU0 A;  1GVD A;  1CQT A;  2X0L A;  4BY7 J;  3ZXS A;  3NWT A;  4ZYH A;  4IL6 C;  4HV5 A;  4FCY A;  1JJ6 C;  2X6O A;  2Y0M A;  4FE7 A;  2E1M C;  1IXC A;  4AUX A;  3RKY A;  3S3N A;  3HM5 A;  4MGR A;  4KIC A;  4B09 A;  2BV6 A;  4PGG A;  3LSR A;  1AU7 A;  3A03 A;  3EUH C;  5FRO A;  3L09 A;  4A3D J;  3PM1 A;  4M3D A;  1YE9 A;  2DQL A;  2XPV A;  5EEG A;  5CVU A;  1TLH B;  3PNT A;  2H6C A;  2ETH A;  4LB6 B;  2IRF G;  2IS1 A;  5F6F A;  4MTE A;  2C6Y A;  2VKD A;  1YTY A;  3VWB A;  4O5V A;  3A4C A;  4EJO A;  3K10 A;  3HOS A;  3OOU A;  1LKX A;  2F5D A;  2LSO A;  1D0Y A;  3DKX A;  3T8R A;  2VUM J;  5E20 A;  3AG3 H;  2FML A;  1FOX A;  2DO7 A;  4QLC U;  3KYL A;  3IUO A;  1X3W B;  2PQ8 A;  1FBS A;  1HDP A;  1FOW A;  2W25 A;  5E8G A;  3C2H A;  3FMR A;  3IH2 A;  3HSE A;  4C2T A;  1Y0U A;  3RZD J;  2LYC A;  2W24 A;  3I3L A;  2RV8 A;  1FBU A;  1UAA A;  2XSJ C;  3QQA A;  2GBY A;  4IOA F;  1W7P D;  2NXN B;  1X1D A;  4J01 A;  1QVU A;  1IG7 A;  3GTO J;  1ODD A;  2P6T A;  2LFB A;  5HDN A;  1Y1V J;  4M74 A;  1LEA A;  2HWV A;  1FTT A;  1IXR C;  3KP3 A;  2PN6 A;  4B8X A;  4BDY A;  1BI1 A;  3BZ6 A;  2YSR A;  4MQV A;  1LB2 A;  1REP C;  2DT5 A;  1T38 A;  3C18 A;  1USS A;  4GYI A;  4CYC A;  1NG7 A;  1DU6 A;  4C3J J;  1S8N A;  2CO5 A;  3J7A O;  1E0E A;  1ETV A;  3GBG A;  4DBR A;  1U3E M;  3I58 A;  4BBS J;  5JFR A;  3TOB A;  1D0X A;  1ZGA A;  2D1V A;  4HRI A;  4OAY A;  1RET A;  2VT2 A;  1IDY A;  1EV7 A;  2P6S A;  4CSW A;  1OCC H;  2ID6 A;  1XSX A;  2XSD C;  1WQ2 A;  1R9T J;  3TO6 A;  3QYE A;  2DBB A;  3CCS I;  3CCU I;  3QRF F;  3DQV C;  3T5X A;  2K9L A;  2IJL A;  4UUS A;  5LGU A;  1XGO A;  3E6B A;  3HL2 A;  3CP8 A;  1XB4 A;  3ESW B;  2OCE A;  3OS0 A;  4UNO A;  3CJT B;  1C0W A;  1Y8Q B;  3K1N A;  1CGP A;  3DU5 A;  2VC0 A;  3HDD A;  3VEP A;  1IZ1 A;  3HZJ A;  3NAU A;  4F52 A;  3MKY B;  5LRS A;  2W57 A;  3GFJ A;  3PFY A;  4W1U A;  4II2 A;  2ID3 A;  2IP2 A;  4NBQ A;  5B3S H;  2JWT A;  1R58 A;  4N9H A;  3BR3 A;  5CVJ A;  2MH2 A;  2VL8 A;  1WH7 A;  1R23 A;  4F55 A;  1IAW A;  1QRY A;  2OD5 A;  2L2O A;  1DGW Y;  2HXI A;  2XRO A;  3JRB A;  1T08 B;  2PJR A;  4HZF A;  1ON2 A;  2WC2 A;  2R0Q C;  1D0Z A;  2ECC A;  5IYB J;  3E1S A;  1MNE A;  3D5R C;  5JHU A;  4EGY A;  2K02 A;  5F27 A;  2K9N A;  1FZP B;  3O3K A;  1FSE A;  2R93 J;  2BXY A;  2NNY A;  1VQP I;  2L0K A;  4RAF A;  5HOO A;  1UMQ A;  1U5T C;  5J8F A;  1P7I A;  1FMV A;  2CW8 A;  3G6E I;  2VQL A;  2M9H A;  2K5C A;  3P9K A;  1HW1 A;  3REO A;  2PI0 A;  2WAQ N;  4UUT A;  2Q1Z B;  4I98 B;  1GVJ A;  2OTL I;  2A6E F;  4NQW A;  3PO3 J;  4LIV A;  2HDD A;  2R5Z A;  1F5T A;  5FLM J;  5DM7 F;  5LGT A;  4KDP A;  4NHJ A;  3S8P A;  2CH0 A;  1MDM B;  2CRG A;  3BTC A;  1V5G A;  4G6D A;  2H94 A;  3QOE A;  4LOC A;  3T8T A;  2K3F A;  2HPI A;  4BS9 A;  3IAS 2;  4DW6 A;  3DEE A;  3BG9 A;  3VYT B;  4I09 A;  1MMD A;  5GAH J;  1HKT A;  2BBY A;  4IHX A;  5E3L A;  2RQQ A;  3ZQI A;  2HU9 A;  5D4R A;  3SDB A;  4N4O B;  3ZMU A;  2EBI A;  4D1Q A;  1K6O A;  1FP2 A;  2XAJ A;  1PP7 U;  4XSZ F;  3ZN0 A;  1NHA A;  2FQ3 A;  2ZME B;  4M3G A;  3ZMT A;  2HOA A;  2DI3 A;  3KPH A;  5F04 A;  2M7B A;  2K85 A;  5FKK A;  3MAJ A;  3G71 I;  2PMZ A;  3BJ6 A;  4BEH A;  2HQ5 A;  4XQF A;  2IS6 A;  3I71 A;  4UVA A;  2RKH A;  4XKC A;  5ILU A;  3I55 I;  4JYK A;  2F5V A;  2E1N A;  2IA2 A;  3S1N J;  3RJP A;  3H9G A;  1K4T A;  4ETS A;  4Y3O A;  1N75 A;  3FHN A;  1SVM A;  2MLG A;  3MKW B;  1FIA A;  1EKE A;  4M9S A;  3MZ8 A;  2ZFW A;  1B6A A;  1Z3X A;  2OA4 A;  1VQ6 I;  2NOG A;  4XL9 A;  1SC7 A;  1HW2 A;  4FQG A;  3H9Q A;  2JA5 J;  1I50 J;  3JRD A;  1AWC A;  2E2J J;  4JX4 A;  4XRS G;  2GZW A;  2ZC2 A;  4MFD A;  3FZV A;  5JVT A;  1WKM A;  4LK0 F;  4HX7 A;  4M73 A;  2MA3 A;  1KU9 A;  1HXD A;  2HNH A;  3CDL A;  3JAM Z;  2LBF A;  2FOK A;  3HEF A;  2GIZ A;  1T95 A;  3V7C A;  3R60 A;  4F92 B;  5FLV A;  1Y0N A;  2Y75 A;  4DOZ A;  1A35 A;  2VON A;  2XAF A;  2M0M A;  3FK7 A;  2VN2 A;  2JA7 J;  3OR2 C;  2MD0 A;  5EEA A;  2HZT A;  5M5W J;  4JK1 X;  1QA6 A;  1LNW A;  1XC5 A;  2L01 A;  2Q0O A;  2WTE A;  1RPW A;  2B7E A;  1RUN A;  2KT0 A;  4CXF A;  3SZP A;  1MJA A;  1PUE E;  3SEZ A;  1MDM A;  4OIR F;  3PNY A;  1KA8 A;  2XUB A;  2XRN A;  1W36 C;  2CV1 A;  5F0F A;  4O6J A;  3J81 K;  1WJC A;  3ZQC A;  3K69 A;  5FD6 A;  4C30 A;  2X1C A;  1U5T B;  5IP6 A;  4UUS B;  3C7J A;  4UVC A;  4CCN A;  1MH4 A;  5E1X A;  4ENN A;  1TWC J;  2ZJR F;  1X3Z B;  3ZMS A;  4WXD A;  3ASO H;  3VDX A;  2BY2 A;  2CQ7 A;  1YJN I;  2JRM A;  2IEK A;  3R0J A;  4TV7 A;  1YX5 A;  4RAG A;  3VYS B;  2QM3 A;  4H0E A;  3QWL A;  3ZR8 X;  2YX4 A;  3QU3 A;  1VQ4 I;  4FHT A;  3LAJ A;  3CES A;  2WV0 A;  4J19 A;  2HI3 A;  2DA6 A;  1H0M A;  5DM6 F;  2GA2 A;  4Y15 A;  3QOD A;  2A05 A;  3QYF A;  4HNT A;  1IN8 A;  3WTZ A;  1U8R A;  1B8I B;  3GTP J;  1OCO H;  1UST A;  3BJO A;  1RES A;  5KNL A;  2HDC A;  2KJB A;  1TT0 A;  5K5O A;  2IAI A;  3M8F A;  1R4N B;  1SMT A;  1SAX A;  2ISZ A;  3TW6 A;  1F1Z A;  2E71 A;  3H3Z A;  3DCF A;  1M1E B;  1R4M B;  1ETO A;  4HYE A;  1Q1V A;  4G9Y A;  3QPS A;  1BR2 A;  5CVV A;  2V4J C;  5K7H A;  1ETY A;  2QKM B;  1I6H J;  4XKV A;  3CF2 A;  3H5N A;  2H1L A;  4XLP F;  2WAF A;  1UZC A;  1FNN A;  2R7T A;  2OZ6 A;  3GZ5 A;  2KRH A;  2EIJ H;  2HR3 A;  5GP9 A;  2LLK A;  4YFK F;  3CJQ B;  3TMO A;  3JTH A;  4OIN F;  1R1V A;  2M45 A;  2DQR A;  2IGM A;  4JX6 A;  1IJW C;  2DAO A;  3MQ0 A;  4ZYD A;  2ADU A;  4A69 C;  2QBY B;  3ONQ A;  1KYW A;  4KIT B;  1ACI A;  1STZ A;  2BY3 A;  2L9R A;  5CQG A;  1DPU A;  1YW8 A;  1J2X A;  1W5S A;  2PMZ N;  1YX3 A;  2HQA A;  2W1O A;  1MBG A;  3WOD F;  3OSG A;  3BG5 A;  3QPL A;  1RR7 A;  5FRN A;  3I4M J;  1KU7 A;  3MCZ A;  3GZN B;  1OMI A;  4D7N A;  2PFB A;  4IVN A;  4BQO A;  2UZK A;  1ZRF A;  4ZTJ A;  2CFO A;  3K4L A;  5E3N A;  1H9T A;  1MMN A;  3K0L A;  5EZH A;  4XSX F;  4EGZ A;  3S1M J;  4C3I J;  1NH3 A;  1VQ7 I;  3HUG B;  4RMN A;  1TWG J;  5LHG A;  4E7J A;  3GUD A;  2MAB A;  3V8K A;  2P5K A;  2VBY A;  2E1C A;  5B1A H;  3ABK H;  4XR6 A;  2NOJ B;  2P5V A;  5C3E J;  1A36 A;  4ENJ A;  3AAF A;  1ZLK A;  2HOS A;  3HBL A;  4RLF A;  3CUQ A;  3QPT A;  3WHB A;  1LE8 B;  2COB A;  4G8X A;  5D6F A;  1DQU A;  3NRV A;  1KGS A;  3ZP5 A;  2ZXH A;  5LBQ A;  1ZAO A;  3PL8 A;  1G3W A;  1KQ9 A;  4KMU X;  1FP1 D;  1Z1D A;  4I02 A;  4ABZ A;  5AIP A;  2H6B A;  3WTX C;  2VOP A;  3U1K A;  4HLX A;  5LEJ A;  4EJW A;  3HPG A;  2KQR A;  3D1N I;  1EH6 A;  2D2W A;  4XID A;  3J7Z I;  2GOM A;  3S16 J;  1BBY A;  3HB9 A;  2KKO A;  3M1C A;  5J40 A;  1BM9 A;  1SFK A;  1OYW A;  3DPU A;  4RB1 A;  1JKQ C;  2YUS A;  2E34 A;  3T1B A;  4PFP A;  2VKV A;  5KAF C;  4PCQ A;  1WGX A;  5FGM A;  1VQL I;  2A5W A;  1I27 A;  3B73 A;  3MKZ A;  1BC8 C;  2BW3 A;  1HKS A;  1JTY A;  5K7Z A;  3L00 A;  1ZGJ A;  2LR8 A;  3I9V 2;  2FJ1 A;  3TGN A;  1ERD A;  1FEX A;  3ABL H;  3BRO A;  5GAG J;  4L9J A;  4MHG A;  2LF8 A;  3RDI A;  3WTT C;  3CUQ C;  2V79 A;  2UXX A;  2OF7 A;  4RBO A;  4E7H A;  2JQ7 A;  3TKY A;  3QYB A;  1FJL A;  4G7O F;  3PQK A;  2KIM A;  4FX0 A;  3NEU A;  1HC8 A;  4LFU A;  3BQY A;  3F8C A;  4R79 A;  2Y31 A;  3C2B A;  3H1C A;  3CCY A;  3CZ6 A;  1X4O A;  3G1O A;  3TDZ C;  1IO2 A;  2R7Z J;  3QAH A;  3LQQ A;  2HS5 A;  1Y39 A;  4ENK A;  1T2K A;  4ZYA A;  2W48 A;  2VJI A;  4NC8 A;  3G73 A;  3HSF A;  3V7S A;  4AC0 A;  1P6R A;  3H5R A;  2XGX A;  4HA8 A;  2KDO A;  3K4M A;  4HX8 A;  3KX2 A;  1O57 A;  2ZJ2 A;  1I6X A;  5J3L A;  1U8B A;  1IV6 A;  4RB0 A;  3OS1 A;  2GXG A;  1TWA J;  2WBM A;  4ITV A;  2L9V A;  5DS9 A;  1AHD P;  3J80 K;  4D5F A;  4Y4R A;  3CC2 I;  2Z1D A;  1XX5 A;  5BQT A;  5IOY A;  2FU4 A;  2E19 A;  2EA2 A;  4CZZ A;  3K4J A;  1XDS A;  2CV0 A;  3VPR A;  2DA7 A;  1FT9 A;  4F7Z A;  1ITY A;  4FX4 A;  2MH9 A;  1QBJ A;  4PDK A;  4CDG A;  1JUP A;  2L3D A;  3FIW A;  4LIT A;  2CUF A;  4C3H J;  3OL4 A;  4HQE A;  1D8K A;  2H27 A;  3OYH A;  3BT9 A;  5FRM A;  3H3V K;  5LRR A;  3D5L A;  2XGE A;  3ZMV A;  2TRT A;  4B3X A;  5IYD J;  4PGH A;  2AQE A;  4OMZ A;  3OYI A;  2PG4 A;  2P7C B;  5KHD A;  2JTV A;  1BIA A;  1LQ1 A;  3KP6 A;  5E1W A;  3R61 A;  1QZY A;  1MJB A;  3GTM J;  1APL C;  4ZDL A;  2I10 A;  2CMP A;  1WI9 A;  2VC1 A;  1CF7 B;  1MBE A;  1ONV A;  1IW7 F;  2FD5 A;  5F0H A;  3GVA A;  4A3B J;  3K2A A;  3KYC B;  1PUF B;  3PIO F;  3F21 A;  4CZC A;  3G1L A;  3H9J A;  1ZK8 A;  4S0H B;  3O8G A;  1VQ8 I;  4IQ4 A;  1UCR A;  2W4S A;  1S29 A;  2NVY J;  4I6Z A;  1GHC A;  2Y0S A;  1J7K A;  1W4M A;  2Q2E B;  2FA5 A;  1LFB A;  2FOW A;  2CW7 A;  2A69 F;  3M8E A;  2QGU A;  2K86 A;  4BXU A;  4CYD A;  1SFU A;  3F8B A;  3NAR A;  1ZG5 A;  1FIP A;  3HHG A;  2M4G A;  3N97 A;  3F22 A;  1XMK A;  2GLO A;  1R71 A;  1OR7 C;  3X2Q H;  1VTN C;  2VQC A;  2GWR A;  2NAZ A;  4LD5 A;  2O6G E;  4KIS A;  3OYB A;  3JW4 A;  2P5L C;  3GF2 A;  1MD0 A;  2VXD A;  2V1D A;  2DOF A;  1I1G A;  5CYV A;  3R4K A;  1J9I A;  4UB8 C;  3RIR A;  2VBZ A;  3DPL C;  3HOT A;  2F4M B;  1YIJ I;  3DBL B;  3M1E A;  2E5N A;  2ZJQ F;  1HA8 A;  3ABT A;  1E3O C;  3CME I;  3JSO A;  2DMQ A;  1MJ9 A;  2ZXW H;  1G8X A;  1YW7 A;  3BCA A;  3IWZ A;  1W5C C;  2W84 A;  5EGO B;  3BQZ A;  3PSI A;  3ZCO A;  4DYC A;  3N05 A;  2VIX A;  3VOE A;  4BE2 A;  2ME0 A;  1Y6I A;  3SYT A;  2ZXI A;  2E7W A;  3RCO A;  1X1C A;  4W97 A;  2VQH A;  2V1U A;  2B9S A;  3LFU A;  2LKS A;  1BA5 A;  1RKW A;  2X4H A;  1AA7 A;  1DGR M;  1ON1 A;  3K70 C;  2QWW A;  1TTY A;  2GA1 A;  3SEQ A;  3E5X A;  1YI2 I;  3I5U A;  3HJE A;  1YHQ I;  2OCC H;  5FD5 A;  4A3F J;  4M6X A;  2RN7 A;  4YEL A;  2G9W A;  2YU9 J;  1U78 A;  4GXO A;  2BYV E;  2BVL A;  3G1M A;  4LG0 B;  1BR4 A;  4HDV A;  1TQI A;  3CMM A;  2D45 A;  2Z2S B;  3F0C A;  2E5Z A;  3IC7 A;  1RC9 A;  2DYR H;  3K2Z A;  5DD4 A;  2L7Z A;  3PUF A;  5F1R A;  3FF5 A;  4MIM A;  1R1U A;  3EUK L;  3U2R A;  3AKZ A;  4IOC F;  3KP2 A;  2IPQ X;  1QVT A;  3PFI A;  1LDD A;  1H88 C;  2OJE D;  1B9M A;  5J8C A;  3ERM A;  3F9K A;  2UXN A;  2DMT A;  1V5F A;  1VND A;  1LUJ B;  2XAH A;  1LVA A;  2WAD A;  4WCG A;  5IP7 J;  4IHY A;  4K2E A;  2GXB A;  3S17 J;  2DU9 A;  4CCJ A;  2JA6 J;  2DT7 B;  3R6S A;  4M6Y A;  5L3D A;  2ZXJ A;  5HDK A;  3ISP A;  1Y8R B;  1SFE A;  2OZU A;  2XF6 A;  1FY7 A;  2A61 A;  2R7F A;  4XLN F;  5BPD A;  3ECO A;  1ETX A;  3FXU A;  4ESF A;  4IZZ A;  3ZPL A;  4GCV A;  5FLX K;  1J75 A;  1BC7 C;  4Z6Y A;  4BHC A;  3OL3 A;  3OIP A;  3K6G A;  5LFA A;  4A3K J;  2CQK A;  3AL0 C;  3LSK A;  2XB0 X;  2M4K A;  2VBX A;  2CUZ A;  3OR1 C;  2HPM A;  3PQJ A;  4UUV A;  1FMW A;  5DDG A;  5D5W B;  2QQ8 A;  1G3S A;  2K9Q A;  1JUS A;  5CPR B;  4BXF A;  5CVR A;  4I7H A;  4A3E J;  1YRN B;  3RKX A;  5EJC A;  2X6W A;  2E2H J;  3CMA I;  1RZ4 A;  4LG3 A;  1TP4 A;  2DLL A;  2FBH A;  4M3F A;  3VB2 A;  4HG2 A;  3W2A A;  4IJA A;  2NYX A;  5L3G A;  1U9N A;  2R7D A;  2E60 A;  2DA5 A;  2Y9Y A;  3TP3 A;  3GX4 X;  3W2V A;  2DFI A;  2M0C A;  1U9O A;  2JSP A;  2W00 A;  3CTA A;  4MEY F;  3LSI A;  4BJ5 C;  2RNG A;  2IBD A;  3CF5 F;  3PUB A;  4U0V A;  3BPV A;  2BY1 A;  5ILS A;  3K4K A;  2DMP A;  1YYV A;  3AFH A;  1BJA A;  3TOA A;  3J81 Z;  4IHT A;  3DF8 A;  3FDY A;  2LMD A;  2ZFU A;  1X1P A;  3W6V A;  1GV5 A;  5F0C A;  2LP0 A;  3H3U A;  4U88 A;  4E4H A;  3K1M A;  4EJU A;  3B02 A;  5K5Q A;  3BR6 A;  3L2C A;  4LLG F;  4E7Z A;  3JRC A;  1G4D A;  2ZO4 A;  5EF6 A;  3ELK A;  2EFQ A;  4UV8 A;  1JXS A;  2KRF A;  5IT3 A;  4ZDP A;  4YFX F;  1LFP A;  1BW6 A;  4DYQ A;  1POG A;  5TRD A;  1WJA A;  3J7A Y;  1LE8 A;  1WPK A;  3HXL A;  1SD6 A;  3LST A;  5EG0 A;  4R8H A;  5F1J A;  3HOU J;  4XM3 A;  5BMZ A;  3L2V A;  4IEJ A;  3GO5 A;  2HTJ A;  1ZQ3 P;  1ETQ A;  4BHP A;  1ZYR F;  3E97 A;  2L9N A;  2Z33 A;  2OTJ I;  3K4B A;  1JHH A;  1QNT A;  5L3B A;  1GXQ A;  1LVK A;  2M1B A;  2XAG A;  1OYI A;  1BI0 A;  2Z9O A;  2X6X A;  5D5U B;  2ZBK A;  4KIG A;  2KZV A;  1D8J A;  3JAM K;  3V7R A;  4A3I J;  2BW3 B;  4LJZ F;  6PAX A;  2LY1 A;  1VZ0 A;  3WU1 B;  5C4X J;  3DBH B;  1I5Z A;  2CWE A;  2J5P A;  1XCV A;  4PUS A;  1D1A A;  5HLH A;  1EH7 A;  3OOP A;  3I59 B;  4A0Y A;  3I53 A;  4D9J A;  3WTU C;  5HLG A;  4EM0 B;  3CC4 I;  5DEQ A;  4F91 B;  1JGG A;  2P81 A;  2A6H F;  3GFI A;  4A3J J;  1TQM A;  5HDG A;  1XDU A;  2E2I J;  1KU3 A;  2P4W A;  1MBF A;  4B44 A;  5LD2 C;  2QEN A;  2OC6 A;  3GW2 A;  2F5F A;  1IGN A;  2G7H A;  4DZP A;  2EA4 A;  3HIF A;  3FKI J;  3FBI B;  2LKX A;  3LAP A;  4BQN A;  2EFW A;  3H35 A;  1UEL B;  2FBI A;  4P5O A;  1ZR4 A;  5FFX A;  3E0J B;  1LEB A;  1BW5 A;  2FXA A;  1DUX C;  4XON A;  5DCM B;  4E70 A;  3JR9 A;  4L0Y B;  2MYS A;  3E7L A;  1IRZ A;  3I54 A;  1RNL A;  3B6C A;  1ZHF A;  3GEZ A;  4WXH A;  4IQJ A;  3GFL A;  4ON0 A;  2R4G A;  3ZN1 A;  2WAE A;  4JX5 A;  2VJ4 A;  3SDG A;  3LSM A;  1SFX A;  1XSV A;  5EEH A;  2HYJ A;  2R5Z B;  2VJJ A;  3K4C A;  4B47 A;  3AG1 H;  4X1E A;  1FYK A;  2H8R A;  5EDN A;  5GAD J;  2RC4 A;  1MSF C;  1LPQ A;  2VT3 A;  3CMY A;  5JVG F;  3OMY A;  3ZQL A;  2KHM A;  2V26 A;  4LGW A;  1MH3 A;  1YIO A;  1GXP A;  3DKW A;  1FTZ A;  4PK4 A;  3NWS A;  4L0Z B;  4GO1 A;  1XN7 A;  2JPB A;  2VB6 A;  4RGS A;  4A3G J;  2HQN A;  1OR7 A;  1KZH A;  3ZGK A;  4MTD A;  1O4X A;  1WZ2 A;  1SEU A;  3I4P A;  3KCC A;  5HLI A;  3N4M A;  2VOO A;  2XB5 A;  1T56 A;  4DYR A;  1O7L A;  2IS4 A;  2A6T A;  2JUG A;  2GOX B;  4KYW A;  3BDD A;  2DFH A;  3Q5F A;  1XMX A;  1S5L C;  2O8X A;  3TO7 A;  5L3E A;  3ZQQ A;  3G4S I;  3Q0V A;  4ASN A;  3D0S A;  4A6D A;  9ANT A;  4HST A;  2AO9 A;  2M30 A;  3LSJ A;  3TL4 X;  1IDZ A;  4BAC A;  5ED4 A;  4Q48 A;  5A2Q Z;  1TC3 C;  2YR2 A;  4HLY A;  2KRC A;  1RRJ A;  1HDD C;  3IKT A;  2DOA A;  3WGH A;  2IVM A;  3GTJ J;  1E3P A;  3JRA A;  1XGM A;  3HOX J;  3LL7 A;  2OV7 A;  5J1R A;  4OIQ F;  4Y33 A;  1MW7 A;  2M2E A;  3BZC A;  2ZME C;  3E5Q A;  3H36 A;  3V4G A;  4YIR X;  3RTR A;  4L9V A;  1OPC A;  3E6M A;  1IRF A;  2JJ7 A;  5CJ9 A;  5CQE A;  3HC7 A;  4U87 A;  5IYC J;  3F6O A;  2LBF B;  4C2M J;  4S04 A;  3EUH A;  2CV2 A;  5D8L B;  3JRI A;  3FBN B;  1YS7 A;  2LTP A;  3KEO A;  4QWQ A;  3CDI A;  1DP7 P;  5D5X B;  2GIV A;  1QQI A;  2JUC A;  2A5Y B;  3W6K B;  1RKT A;  1O3T A;  2STT A;  2FE3 A;  5LGN A;  3UR3 C;  2ZJP F;  2MC4 A;  2M8E A;  2FUG 2;  5KCM A;  3W6J B;  2K3P A;  1MGT A;  4FT8 A;  3AL0 B;  1Z7U A;  2VXZ A;  4RB3 C;  2HOE A;  2Y9Z A;  3Q9S A;  3RZO J;  5GTH C;  2AQF A;  5J4Y A;  5L3C A;  4HPQ A;  5F64 A;  5E3M A;  3G3Z A;  1X2N A;  3WGG A;  3Q0W A;  4QSH A;  3IRQ A;  1KQ0 A;  2XF7 A;  2LNB A;  4C2U A;  2NNN A;  4C9Y A;  1SVL A;  2HVS A;  3CJR B;  1MBK A;  1SD4 A;  4BEH B;  4KN7 X;  4V2G A;  3DV8 A;  2QQ9 A;  4IRH A;  2CSO A;  3U9G A;  3W2W A;  3U1D A;  4HBL A;  4OIP F;  1TT5 B;  3S14 J;  2ZME A;  2XAQ A;  3OYC A;  3Q0U A;  3IV5 A;  2VLA A;  2GQQ A;  4D0P A;  4UV9 A;  1QZE A;  2F48 A;  2QSH X;  1YQA A;  2IA1 A;  2Q8K A;  5H2F C;  2M8G X;  2EJR A;  1F9N A;  2BE5 F;  1DDN A;  1JGS A;  1NK2 P;  4XLA A;  1TW3 A;  1JT6 A;  5E3O A;  3JRH A;  1TWF J;  2VPR A;  2L4M A;  4IHS A;  3R0A A;  4XKW A;  3M7G A;  3H92 A;  3CCJ I;  4U0Y A;  2CFX A;  3V42 A;  1T8I A;  2W85 A;  2ZNZ A;  3RKQ A;  5FO5 A;  2HXO A;  4AWX B;  2DFE A;  2RQP A;  3LNQ A;  3ASN H;  1O3S A;  2VE9 A;  1D1B A;  4WXC A;  4KIB A;  4OOI A;  4XBF A;  5C4J J;  2YU3 A;  3WTW C;  2CU7 A;  2NVX J;  1SD5 A;  3WE2 A;  4X6A J;  3ZMZ A;  3B6A A;  2NRA C;  5CKT A;  2LKP A; 
#chains in the Genus database with same CATH homology
 1T6S A;  1IN7 A;  1J0R A;  2HYF A;  2L4A A;  3KET A;  2Y48 A;  4A12 A;  1L0O C;  3FHZ A;  2CW0 F;  4ZYG A;  4ZH4 F;  1BI3 A;  2FNP A;  2V6C A;  1S7A A;  3C1D A;  3KZZ A;  3BPX A;  1ZG3 A;  5D4S A;  3CO6 C;  3KLO A;  5ICC A;  2PBI A;  1W7P A;  4G94 A;  2EWN A;  4G7H F;  5ICF A;  4I2O A;  3RYR A;  1HKQ A;  3RPQ A;  1R7J A;  4P55 A;  1BI2 A;  3S2W A;  3HRT A;  1PDN C;  1JE8 A;  3HRU A;  4RAY A;  1LJ9 A;  4WK8 F;  1K78 A;  1W7P B;  4IPA A;  2K27 A;  5ICG A;  5BPI A;  2RNJ A;  3GZ6 A;  1T39 A;  3DPT A;  2Z5U A;  4Q5S F;  3LFK A;  5H6Q A;  1G6N A;  3RPU A;  5BOX A;  4ENM A;  4HX4 A;  1O3Q A;  1FWZ A;  3T0Y A;  4YFN F;  1XGS A;  1P92 A;  1OYY A;  3E6D A;  4AIH A;  1P4A A;  2F5C A;  4L9N A;  2MBF A;  1V4R A;  3ERE D;  4YG2 F;  2PJP A;  1ZH5 A;  4EQQ A;  5E18 F;  4WX9 A;  4MEX F;  3DFG A;  1XCB A;  3BJA A;  3LWF A;  4KUM A;  2WWY A;  1FOK A;  5K1Y A;  3GXO A;  2QUF A;  2PMU A;  3ULQ B;  1RUO A;  3IL2 A;  3ZMD A;  5ICE A;  2ACJ A;  4Z2Y A;  4KIF A;  2QBY A;  1H9G A;  2OQG A;  3ZQ7 A;  3I59 A;  2Z99 A;  2COM A;  2IW5 A;  3CUO A;  4KNY A;  2TDX A;  5IT9 Z;  2HYG D;  2FEZ A;  2QLZ A;  2FSW A;  2KIU A;  3LQR A;  3O6B B;  3GLX A;  1A04 A;  1HW5 A;  2EFO A;  3HUG A;  5ILV A;  4M9Z A;  5FFZ A;  3SZT A;  1ZLJ A;  5FLX Z;  4A6E A;  2DPD A;  3WTS C;  1P4X A;  1QGP A;  2OU2 A;  5LLQ A;  5D8K B;  3F8F A;  3RYP A;  5BS6 A;  3K9T A;  2A07 F;  2F2E A;  3KE2 A;  2EV5 A;  3MEX A;  4S05 A;  1R22 A;  3L9F A;  2Q2E A;  2ESN A;  1ZG1 A;  5HS9 A;  4KA4 A;  4EJV A;  2FMY A;  2HQR A;  4L18 B;  2XKO A;  1BOA A;  2EB7 A;  5H6R A;  2HTS A;  1G3T A;  2HFH A;  4HQM A;  4O3M A;  3P9I A;  1TBX A;  1YW9 A;  3F72 A;  5JR3 A;  4ZZD A;  1XSD A;  1KU2 A;  3MWM A;  2MLK A;  3RKW A;  5KK1 A;  1IN4 A;  1S3J A;  5DYM A;  1TNT A;  1Z6T A;  5DUK A;  4LB5 A;  1IUY A;  3EDP A;  4UHT A;  2DK8 A;  1B1B A;  5D5V B;  2K7L A;  5DD8 A;  3ABU A;  3EET A;  1K7A A;  3MZH A;  4YIF A;  1FSH A;  1FPQ A;  1K78 B;  3BY6 A;  2RGV A;  4HDU A;  4AIJ A;  1U5T A;  2DK5 A;  2XAS A;  2XV4 S;  1DPR A;  1MZB A;  2K4J A;  3SXY A;  1T98 A;  2H09 A;  2A3S A;  1O7F A;  2CYY A;  3FM5 A;  4EJT A;  1SD7 A;  1Z91 A;  4HF2 A;  3TDU C;  4HF0 A;  1RI7 A;  2RVC A;  5CVI A;  3E3V A;  2ZNY A;  1UB9 A;  4Q4Z F;  1WSU A;  3FXQ A;  1IF1 A;  4GGG A;  4UVB A;  3KLN A;  3KFW X;  3KP5 A;  3TQN A;  1YLF A;  4RB2 C;  3HTS B;  4AIK A;  3FXR A;  2VOD A;  1XGN A;  3WE3 A;  3WG9 A;  1HSJ A;  3LA7 A;  3WU0 A;  2HKX A;  1MKM A;  4DQ2 A;  4AD9 A;  1BIB A;  1B4A A;  3DP7 A;  4N0B A;  4IXA A;  3JSP A;  1Z9C A;  5DCM A;  2YX7 A;  4ESB A;  2LDU A;  1S7O A;  2BGC A;  2ZKZ A;  5HVQ C;  2IT0 A;  1X3U A;  2OQR A;  3F3X A;  2XVC A;  4NB5 A;  3BP8 A;  2O03 A;  3I0T A;  3EQL F;  4MQ9 F;  1IN5 A;  2QZ8 A;  5LHH A;  3HHH A;  3VFZ A;  3LA3 A;  5A2Q K;  4EMS A;  4ZYE A;  5E17 F;  1FLI A;  2KJC A;  3IRR A;  2KIF A;  2O0Y A;  3QU6 A;  1CF7 A;  3CJN A;  3F8N A;  3SQN A;  1QZZ A;  4HAM A;  4R1H A;  1R5G A;  2MD5 A;  1TW2 A;  2HKO A;  4KT5 C;  1R1T A;  1YS6 A;  3CO7 C;  1HST A;  5DV5 A;  2P7V B;  3SHF A;  4U0W A;  5LHI A;  4RGX A;  3V8J A;  3QP6 A;  3WTY C;  4CO8 A;  4RGU A;  2EFN A;  5AIQ A;  1HBX G;  2FNA A;  4L9T A;  2JSC A;  4Y17 A;  1U6G A;  2G7U A;  3RI4 A;  2R3S A;  1B59 A;  4G6Q A;  3FMQ A;  2PMH A;  4HV6 A;  3IWF A;  1I1S A;  2FRH A;  2M5W A;  3L7W A;  3WGI A;  1D3Y A;  1R5H A;  4RAZ A;  1TQP A;  2QVO A;  5K5R A;  2L02 A;  4BNC A;  4RGR A;  4M9X A;  1ZRC A;  2VBW A;  3TO9 A;  2E7X A;  2O3F A;  1PP8 F;  4KMF A;  3J80 Z;  1ULY A;  3QOP A;  4WWC A;  4PZJ A;  4LMY A;  3IKV A;  1FC3 A;  2ELH A;  3GWZ A;  2XKP A;  5E1Z B;  1YO5 C;  4IF4 A;  1TNS A;  4BYY A;  4I0A A;  3BWG A;  4BHB A;  3WTV C;  2IA0 A;  2STW A;  1FX7 A;  4IRI A;  4A2U A;  2CG4 A;  3SFZ A;  2JRT A;  2JPC A;  4CGZ A;  1J5Y A;  1R00 A;  2GAU A;  1Q1H A;  1E2X A;  2NS0 A;  3F23 A;  3CLO A;  4U7D A;  1P4W A;  1FYL A;  2F5E A;  5L3F A;  4OMY A;  4CIC A;  1T0F A;  1IRG A;  4EVI A;  3M9A A;  4CHU A;  2JT1 A;  3FWE A;  1P2F A;  4BQA A;  4I0B A;  2RDP A;  5AON A;  2BEO A;  4Q47 A;  3CDH A;  1QPM A;  4KN4 X;  3DEU A;  4I01 A;  1UFM A;  3FX3 A;  5KVR A;  3HRS A;  2AXL A;  2HEO A;  3P9C A;  2JZY A;  2QQA A;  2CGP A;  1R36 A;  4LLN A;  2DTR A;  4JBA A;  2PLY A;  2EFP A;  5HS8 A;  4HW0 A;  2EV0 A;  2A68 F;  1EH8 A;  3HYI A;  1L3L A;  4L5I A;  5HS7 A;  4U7B A;  4HOB A;  4OIO F;  4G7Z F;  4AVP A;  3DXJ F;  4A5N A;  5CLS A;  4DNC A;  3C3W A;  3E5U A;  1U2W A;  1WWX A;  3FM3 A;  4ESJ A;  3KEQ A;  2ESH A;  3KZY A;  4P9U A;  4LK1 F;  2FF4 A;  2LF7 A;  3HRM A;  2VE8 A;  4IRG A;  4ZZL A;  4EV0 A;  5JI6 A;  5IT9 K;  1Z6R A;  1KQ8 A;  3P7N A;  4EM2 A;  3ECH A;  1ZRD A;  3I64 A;  3BOQ A;  2Z3Y A;  3COA C;  4BH9 A;  2QYO A;  2L54 A;  2ZCW A;  4L5J A;  1KYZ A;  1W5T A;  2YPR A;  3NQO A;  5FB2 A;  3IHU A;  2HGC A;  2V1X A;  3F6V A;  3OV8 A;  2QQB A;  1E17 A;  2M87 A;  2DPU A;  4EM1 A;  4KFC A;  4UXN A;  3QPH A;  2P8T A;  2EV6 A;  1FBQ A;  1FYM A;  2FBK A;  5DUI A;  1Z05 A;  2K4B A;  3EYY A;  3V8L A;  4N9I A;  3HSR A;  3ML6 A;  1ZN2 A;  1UHW A;  4RS8 A;  5E8I A;  1JHF A;  2OBP A;  4XRF A;  4A0X A;  1HQC A;  1LDJ A;  1SMY F;  5DCF A;  1OKR A;  1IN6 A;  3K1P A;  3KP7 A;  1WRJ A;  1ZRE A;  3LA2 A;  1QO0 D;  1ZAR A;  4LLL A;  1B9N A;  3QP5 A;  3FMS A;  1J59 A;  3VOD A;  1F4K A;  1K79 A;  2XHK A;  4M71 A;  5D6E A;  2XIG A;  2B0L A;  1AOY A;  5LEK A;  1XMA A;  1UHM A;  3GYH X;  4P9F A;  2EK5 A;  1YFH A;  1YG2 A;  4HF1 A;  3Q9V A;  4M72 A;  2D1H A;  3O2P E;  2MC3 A;  2DW4 A;  3GFM A;  5TJJ A;  3EYI A;  2UWM A;  2AS5 F;  1V3F A;  2V9V A;  4JQF A;  4YII A;  4GYG A;  1S6L A;  5J6X A;  3MZY A;  5ERI A;  1G3Y A;  3HTU A;  4LG0 A;  3KP4 A;  1O3R A;  3JTG A;  2OAZ A;  2J5O A;  5H20 A;  2ISY A;  3F8M A;  3MFK A;  1D5V A;  4MNU A;  3ROU A;  1BN5 A;  2PEX A;  4A5M A;  1XD7 A;  4WF2 A;  4BAY A;  1LDK B;  4P96 A;  1RIO H;  3CUQ B;  4Y13 A;  4A0Z A;  2O61 A;  3E6C C;  1IXS B;  4OU0 A;  2X0L A;  4ZYH A;  4HV5 A;  2Y0M A;  1IXC A;  3RKY A;  4MGR A;  4KIC A;  4B09 A;  2BV6 A;  4PGG A;  3L09 A;  2DQL A;  5EEG A;  5CVU A;  1TLH B;  2H6C A;  2ETH A;  4LB6 B;  2IRF G;  5F6F A;  2C6Y A;  4MTE A;  1YTY A;  4O5V A;  4EJO A;  3HOS A;  2F5D A;  2LSO A;  3T8R A;  5E20 A;  2FML A;  2DO7 A;  4QLC U;  2PQ8 A;  1FBS A;  2W25 A;  5E8G A;  3FMR A;  3HSE A;  1Y0U A;  2W24 A;  2RV8 A;  1FBU A;  1W7P D;  1ODD A;  2P6T A;  5HDN A;  4M74 A;  1LEA A;  2HWV A;  1IXR C;  3KP3 A;  2PN6 A;  4B8X A;  1BI1 A;  3BZ6 A;  2YSR A;  4MQV A;  1LB2 A;  1REP C;  2DT5 A;  1T38 A;  3C18 A;  1USS A;  4GYI A;  1S8N A;  2CO5 A;  3J7A O;  1U3E M;  3I58 A;  5JFR A;  3TOB A;  1ZGA A;  2D1V A;  2VT2 A;  2P6S A;  1EV7 A;  1XSX A;  1WQ2 A;  3TO6 A;  2DBB A;  3QRF F;  3DQV C;  3T5X A;  2IJL A;  5LGU A;  1XGO A;  3E6B A;  1XB4 A;  4UNO A;  1C0W A;  3K1N A;  1CGP A;  2VC0 A;  3VEP A;  1IZ1 A;  5LRS A;  2W57 A;  3GFJ A;  2IP2 A;  1R58 A;  4N9H A;  5CVJ A;  2MH2 A;  1IAW A;  1R23 A;  2OD5 A;  2XRO A;  4HZF A;  1ON2 A;  2WC2 A;  5JHU A;  4EGY A;  2K02 A;  1FZP B;  3O3K A;  1FSE A;  2NNY A;  5HOO A;  1U5T C;  5J8F A;  3P9K A;  2PI0 A;  1HW1 A;  3REO A;  4I98 B;  1GVJ A;  2A6E F;  4NQW A;  1F5T A;  5LGT A;  4KDP A;  4NHJ A;  1MDM B;  4G6D A;  2H94 A;  3T8T A;  4I09 A;  1HKT A;  2BBY A;  5D4R A;  3ZMU A;  1K6O A;  1FP2 A;  2XAJ A;  1PP7 U;  4XSZ F;  3ZN0 A;  1NHA A;  2FQ3 A;  2ZME B;  3ZMT A;  2DI3 A;  3MAJ A;  3BJ6 A;  3I71 A;  4UVA A;  2RKH A;  5ILU A;  2E1N A;  2IA2 A;  3RJP A;  4ETS A;  2MLG A;  4M9S A;  2ZFW A;  1B6A A;  2OA4 A;  1HW2 A;  1AWC A;  5JVT A;  2GZW A;  3FZV A;  1WKM A;  4LK0 F;  4HX7 A;  4M73 A;  2MA3 A;  1KU9 A;  1HXD A;  3JAM Z;  2FOK A;  3V7C A;  3R60 A;  2Y75 A;  2VON A;  2XAF A;  2VN2 A;  2HZT A;  4JK1 X;  1LNW A;  2L01 A;  2Q0O A;  2WTE A;  1RUN A;  4CXF A;  3SZP A;  1MJA A;  1PUE E;  1MDM A;  4OIR F;  1KA8 A;  2XRN A;  2XUB A;  4O6J A;  3J81 K;  3K69 A;  5FD6 A;  1U5T B;  3C7J A;  4UVC A;  4ENN A;  5E1X A;  3ZMS A;  4WXD A;  3R0J A;  4TV7 A;  2QM3 A;  4H0E A;  2YX4 A;  3QU3 A;  4FHT A;  3LAJ A;  2WV0 A;  1H0M A;  2GA2 A;  4Y15 A;  1IN8 A;  3WTZ A;  1U8R A;  1UST A;  3BJO A;  2HDC A;  2KJB A;  5K5O A;  3M8F A;  1SMT A;  1SAX A;  2ISZ A;  1F1Z A;  3H3Z A;  4HYE A;  4G9Y A;  5CVV A;  4XLP F;  1FNN A;  2OZ6 A;  3GZ5 A;  2HR3 A;  4YFK F;  3JTH A;  4OIN F;  1R1V A;  2M45 A;  2DQR A;  2DAO A;  3MQ0 A;  4ZYD A;  2ADU A;  2QBY B;  1KYW A;  1STZ A;  1DPU A;  1YW8 A;  1J2X A;  1W5S A;  3WOD F;  1KU7 A;  3MCZ A;  1OMI A;  2PFB A;  4IVN A;  2UZK A;  1ZRF A;  1H9T A;  3K0L A;  4XSX F;  4EGZ A;  5LHG A;  3GUD A;  3V8K A;  2P5K A;  2VBY A;  2E1C A;  2P5V A;  4ENJ A;  3AAF A;  1ZLK A;  3CUQ A;  3QPT A;  4G8X A;  5D6F A;  3NRV A;  1KGS A;  3ZP5 A;  5LBQ A;  1ZAO A;  1G3W A;  1KQ9 A;  4KMU X;  1FP1 D;  1Z1D A;  4I02 A;  5AIP A;  2H6B A;  3WTX C;  2VOP A;  4HLX A;  5LEJ A;  4EJW A;  1EH6 A;  2D2W A;  1BBY A;  2KKO A;  1BM9 A;  1OYW A;  4RB1 A;  3T1B A;  4PCQ A;  5FGM A;  3B73 A;  1I27 A;  1BC8 C;  1HKS A;  3L00 A;  1ZGJ A;  3TGN A;  3BRO A;  4L9J A;  2LF8 A;  3RDI A;  3WTT C;  3CUQ C;  2V79 A;  2UXX A;  3TKY A;  4G7O F;  3PQK A;  2KIM A;  4FX0 A;  3NEU A;  4LFU A;  3F8C A;  4R79 A;  3TDZ C;  3QAH A;  3LQQ A;  2HS5 A;  4ENK A;  1T2K A;  3G73 A;  3HSF A;  3V7S A;  1P6R A;  2XGX A;  4HA8 A;  4HX8 A;  1O57 A;  2ZJ2 A;  1I6X A;  4RB0 A;  2GXG A;  3J80 K;  5BQT A;  2FU4 A;  2EA2 A;  4CZZ A;  1XDS A;  1FT9 A;  4F7Z A;  4FX4 A;  2MH9 A;  1QBJ A;  4PDK A;  4CDG A;  2L3D A;  4HQE A;  1D8K A;  2H27 A;  5LRR A;  3D5L A;  3ZMV A;  4PGH A;  4OMZ A;  2PG4 A;  2P7C B;  2JTV A;  1LQ1 A;  1BIA A;  3KP6 A;  5E1W A;  3R61 A;  1QZY A;  1MJB A;  1WI9 A;  2VC1 A;  1CF7 B;  1ONV A;  1IW7 F;  3GVA A;  3F21 A;  1UCR A;  1S29 A;  1GHC A;  1J7K A;  1W4M A;  2FA5 A;  2A69 F;  3M8E A;  2K86 A;  4BXU A;  4CYD A;  1SFU A;  3F8B A;  1ZG5 A;  3HHG A;  3N97 A;  3F22 A;  1XMK A;  1VTN C;  2GWR A;  2NAZ A;  4LD5 A;  2O6G E;  3JW4 A;  2P5L C;  3GF2 A;  1MD0 A;  2V1D A;  1I1G A;  5CYV A;  3R4K A;  1J9I A;  3RIR A;  2VBZ A;  3DPL C;  3HOT A;  3M1E A;  3ABT A;  3JSO A;  1MJ9 A;  1YW7 A;  3IWZ A;  2W84 A;  3VOE A;  2E7W A;  2V1U A;  2X4H A;  1ON1 A;  2QWW A;  1TTY A;  2GA1 A;  3E5X A;  3I5U A;  5FD5 A;  4M6X A;  2RN7 A;  2G9W A;  1U78 A;  4GXO A;  2BYV E;  4LG0 B;  4HDV A;  1TQI A;  2D45 A;  3IC7 A;  3K2Z A;  5DD4 A;  5F1R A;  3FF5 A;  1R1U A;  3U2R A;  3KP2 A;  2IPQ X;  3PFI A;  1LDD A;  1B9M A;  5J8C A;  2UXN A;  2XAH A;  1LVA A;  4WCG A;  4K2E A;  2GXB A;  2DU9 A;  3R6S A;  4M6Y A;  5L3D A;  2ZXJ A;  5HDK A;  3ISP A;  1SFE A;  2OZU A;  1FY7 A;  2A61 A;  2R7F A;  4XLN F;  5BPD A;  3ECO A;  3ZPL A;  3FXU A;  4ESF A;  4GCV A;  5FLX K;  1J75 A;  1BC7 C;  4BHC A;  2CQK A;  2VBX A;  3PQJ A;  4UUV A;  5DDG A;  5D5W B;  1G3S A;  5CVR A;  4I7H A;  3RKX A;  1RZ4 A;  2DLL A;  2FBH A;  3VB2 A;  4IJA A;  2NYX A;  5L3G A;  2R7D A;  3GX4 X;  2DFI A;  3CTA A;  4MEY F;  4U0V A;  3BPV A;  5ILS A;  1YYV A;  1BJA A;  3TOA A;  3J81 Z;  4IHT A;  3DF8 A;  4U88 A;  3H3U A;  4EJU A;  3K1M A;  3B02 A;  5K5Q A;  3L2C A;  4LLG F;  1G4D A;  2ZO4 A;  3ELK A;  2EFQ A;  4UV8 A;  1JXS A;  2KRF A;  5IT3 A;  4YFX F;  5TRD A;  3LST A;  1SD6 A;  4R8H A;  5BMZ A;  3GO5 A;  2HTJ A;  4BHP A;  1ZYR F;  3E97 A;  2Z33 A;  1JHH A;  1QNT A;  5L3B A;  1GXQ A;  2M1B A;  2XAG A;  1OYI A;  1BI0 A;  2Z9O A;  5D5U B;  2ZBK A;  4KIG A;  1D8J A;  3JAM K;  3V7R A;  4LJZ F;  6PAX A;  3WU1 B;  1I5Z A;  2CWE A;  2J5P A;  1XCV A;  5HLH A;  1EH7 A;  3OOP A;  3I59 B;  4A0Y A;  3I53 A;  3WTU C;  5HLG A;  4EM0 B;  5DEQ A;  2A6H F;  3GFI A;  1TQM A;  5HDG A;  1XDU A;  1KU3 A;  2P4W A;  2QEN A;  2F5F A;  3GW2 A;  2G7H A;  2EA4 A;  3HIF A;  3LAP A;  2EFW A;  2FBI A;  4P5O A;  5FFX A;  1LEB A;  2FXA A;  1DUX C;  5DCM B;  4E70 A;  4L0Y B;  3I54 A;  1RNL A;  1ZHF A;  3GEZ A;  4WXH A;  3GFL A;  4ON0 A;  3ZN1 A;  1SFX A;  1XSV A;  5EEH A;  1FYK A;  2RC4 A;  2VT3 A;  4LGW A;  1GXP A;  1YIO A;  3DKW A;  4L0Z B;  4GO1 A;  1XN7 A;  2JPB A;  4RGS A;  2HQN A;  1OR7 A;  4MTD A;  3I4P A;  3KCC A;  5HLI A;  3N4M A;  2VOO A;  1O7L A;  4KYW A;  3BDD A;  3Q5F A;  2O8X A;  3TO7 A;  5L3E A;  4ASN A;  3D0S A;  4A6D A;  2M30 A;  5ED4 A;  4Q48 A;  5A2Q Z;  2YR2 A;  4HLY A;  3IKT A;  3WGH A;  2IVM A;  1XGM A;  4OIQ F;  3E5Q A;  3V4G A;  3RTR A;  4L9V A;  1OPC A;  3E6M A;  1IRF A;  5CJ9 A;  3F6O A;  4S04 A;  3EUH A;  5D8L B;  1YS7 A;  3KEO A;  4QWQ A;  1DP7 P;  5D5X B;  2GIV A;  1QQI A;  2A5Y B;  3W6K B;  1O3T A;  2STT A;  2FE3 A;  5LGN A;  2M8E A;  3W6J B;  1MGT A;  4FT8 A;  1Z7U A;  2VXZ A;  4RB3 C;  2HOE A;  3Q9S A;  5L3C A;  5F64 A;  3G3Z A;  3WGG A;  3IRQ A;  1KQ0 A;  2LNB A;  2NNN A;  1SD4 A;  4KN7 X;  3DV8 A;  2QQ9 A;  4IRH A;  3U9G A;  2CSO A;  3U1D A;  4HBL A;  4OIP F;  2ZME A;  2XAQ A;  2GQQ A;  4D0P A;  4UV9 A;  1YQA A;  2IA1 A;  2Q8K A;  2EJR A;  1DDN A;  1F9N A;  2BE5 F;  1JGS A;  1TW3 A;  2L4M A;  4IHS A;  3R0A A;  3M7G A;  3H92 A;  4U0Y A;  2CFX A;  2W85 A;  2ZNZ A;  5FO5 A;  4AWX B;  2RQP A;  1O3S A;  2VE9 A;  4XBF A;  4WXC A;  4KIB A;  4OOI A;  2YU3 A;  3WTW C;  1SD5 A;  3WE2 A;  3ZMZ A;  2NRA C;  4MHG A;  2LKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...