3WG7H

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3wg7H00
1OCRH 1OCOH 3ASNH 2EINH 3WG7H 2EIKH 3ABKH 1OCZH 3X2QH 3ABMH 3AG3H 1OCCH 3AG1H 1V54H 2EIJH 2EIMH 3ABLH 3AG2H 3ASOH 2DYRH 3AG4H 2ZXWH 5B1AH 2OCCH 5B3SH 1V55H 5IY5H 2EILH 2DYSH 2Y69H 5B1BH
chains in the Genus database with same CATH superfamily
5HLIA 3J80K 1O3QA 4C30A 4UNOA 1ONVA 5J47A 2HXOA 1S7AA 4XONA 2RAEA 2KRHA 5E8GA 3MMYB 1OJLA 3ABMH 2NAZA 3A01A 2LP0A 3GTQJ 1SAXA 1EF4A 2VJ4A 2K9SA 3BG6A 3IUOA 3K70C 3SJMA 1Y8RB 4XLNF 4JX5A 2VKDA 1I6HJ 1T33A 3BR6A 1Y6IA 2BOLA 4HSRA 5B1AH 2F6CA 1OCTC 2MYSA 1P4AA 2PMHA 2VT3A 2WB1N 1MIJA 2YPRA 1YW8A 4HG2A 5KAIC 1XMXA 4EATA 1A04A 2K9QA 5L3CA 5K1YA 2JA6J 3ZOBA 3TP0A 1FTZA 3S2DJ 2L0KA 1XGNA 1ON1A 3IWFA 1WJFA 2H6BA 5EGOA 3OIOA 2UXNA 4A3GJ 1BC7C 3D5RC 5M5WJ 3H3ZA 2CUFA 3OYCA 2OZ6A 4JX4A 4LOCA 1T56A 4EGYA 2XAJA 2P5LC 5M3MJ 2M8EA 4RS8A 1UMQA 4CYCB 5EJCA 5FRNA 4YFKF 1ZRDA 5EDNA 3R6SA 4XQFA 2JMWA 2KZGA 4IVNA 3E97A 1SMYF 3K1MA 3J7AO 1F5TA 2KT0A 1TL8A 1J09A 5KK1A 5LRSA 4BE1A 1E0EA 3MD2A 1A5JA 3L2VA 2JTVA 1GV5A 4F92B 3OWTA 4HF0A 3OY9A 4DW6A 3CLQA 3GFMA 4Q4ZF 2NVYJ 3CJTB 1IJWC 1F43A 5CQEA 4XLCA 4IQJA 2VBWA 3PQKA 4IZZA 2EJRA 2X4HA 1ZK8A 1P4WA 2L9SA 1Z3YA 1YO5C 2FOKA 2PG4A 2RN7A 3OYFA 4UXNA 4OWRB 1RUOA 1T0FC 4U0YA 1WJ5A 3MVPA 4KA4A 1I3QJ 1FY7A 4PGGA 2UWMA 3ZRGA 2Z16A 4I0BA 1XC5A 1K78B 1Q1HA 3HRMA 2IS6A 2CUZA 2H94A 4IRGA 1V5FA 2IGOA 2CFOA 3CCJI 1NH3A 3HOVJ 1XB4A 4LK0F 2QQ8A 4M73A 5DCMB 2NRAC 5DUKA 4RLQA 1BI0A 1LFUP 2QQBA 2FXAA 1VQ7I 1O57A 2P5KA 2HQAA 2QKLB 1P6RA 1IRXA 4MNUA 4B8XA 5B3SH 2QKMB 3DEWA 4KN4X 3HL2A 2AO9A 3HPHA 2CRGA 2DA4A 2QYOA 4PGHA 1LEBA 2Y2ZA 2KIQA 1R5GA 3BCBA 5D5WB 2G7HA 2HKXA 2ZSHB 3FMQA 3IKVA 2HXIA 3O3KA 1I5ZA 3JCUC 4IOAF 1H0MA 1W0UA 3SEQA 2MLGA 5J4VA 1VNDA 1MNEA 1JT0A 3WU1B 2EZLA 2JA2A 2OZUA 4ENKA 3G3ZA 2OBPA 1J59A 2AXTC 2Y30A 2LR8A 1TLHB 4MIMA 1Y0UA 1V55H 4MQ9F 2M0MA 1YIJI 3S17J 3HRSA 4RGUA 2JQ7A 1TWHJ 2QWWA 1SFXA 2VC1A 1JTXA 3H5NA 1BN5A 1G3YA 4KT6A 2A3SA 5B5EC 4AU7A 4YIRX 1MSEC 3F9KA 2D1VA 4RA2A 3J7ZI 5IP7J 3WTUC 3IP4B 4XK4A 1A6QA 1Z0XA 2M3AA 3F8BA 5IYBJ 4O3MA 2FF4A 2CH0A 3GFIA 4HLYA 3ERMA 3CUOA 2BY0A 4HF1A 2C6YA 2EILH 4G9YA 3E5QA 4AIKA 2CUEA 4EM1A 2AQEA 5C4JJ 5E3LA 3OYMA 2A61A 2ESNA 1Y0NA 4A3KJ 3BP8A 3ISPA 4CYCA 3QPHA 3CCLI 4PFOA 3ML6A 4BYYA 2Z3YA 2LOOA 3LWFA 2CWEA 3SZTA 3OYDA 4F91B 2DAOA 5BOXA 5FGMA 5HNFA 2B7EA 2G9WA 3K4NA 4ZZDA 4H4KC 3OIPA 3N05A 2F4OB 2W82A 5DCFA 3VYRB 3GFLA 5A2QK 3OOPA 3DPLC 3MZ8A 2L9RA 2KKOA 1ZG1A 3BR5A 4FETA 4OMZA 2E5NA 4MTDA 2MD5A 2XF7A 5ICFA 1W7PB 1KYZA 1O7LA 3LSPA 2R7XA 3KZYA 4BL0B 1XCVA 3ZQGA 4ENNA 1ZG5A 2VQGA 5EEHA 1X58A 1K78A 3MQ0A 4M71A 3F72A 2R7DA 4BQNA 2F5VA 4HW0A 3DTIA 4UVCA 5DCMA 3ZCOA 2G7UA 1RR8C 1ETWA 1WSUA 2IA0A 3I3LA 2CMPA 3NWSA 3W6VA 2Y75A 5ILSA 2KZVA 3KLOA 4BS9A 2NVUB 5IT3A 1IG7A 3BZCA 3V7RA 1EV7A 2V1NA 4UUTA 3KYDB 4N4NB 2FBHA 4BE2A 2ISYA 2HOAA 3K4KA 3EYYA 1XX5A 2K9LA 2OCEA 1KA8A 4NNJA 1HSTA 3G6EI 2BEOA 1D0XA 4IJAA 4Y17A 2ZXWH 2YSRA 1WJCA 2CGPA 4L0ZB 2GIZA 4BJTA 1YITI 1ZH5A 3OS2A 1XGOA 1BJZA 1YS6A 4HA8A 4D5FA 4E70A 4EQQA 3OIQA 2V79A 4A3LJ 3DPTA 4NC6A 4YIIA 1SEUA 5EF6A 4V2FA 1ZYRF 4AVPA 2E1CA 5LHGA 1Z05A 2WBMA 2EFQA 4M74A 5AIPA 1NK3P 2HR3A 2MC3A 4EJUA 1MD0A 1DPRA 5LGUA 3I4NJ 1KU9A 1S3JA 5IP9J 5E18F 2EQRA 2ID6A 3FX3A 3KCCA 3AG3H 2V26A 1YW7A 4EMSA 3RPQA 2EIMH 2COBA 3ULQB 3UKGA 1OPCA 2ZB9A 4QIWN 4GO1A 2VI6A 4II3A 3AAFA 5D8KB 1FJLA 2GM4A 2P7CB 1ERDA 4NDLA 5CVVA 1VQ5I 4BAYA 4R8HA 4L5EA 3I64A 3ROUA 1VQ6I 2W00A 2DFIA 2HPMA 1XDUA 2K3FA 4M3BA 4U7DA 2K02A 4FE4A 1FBQA 1LVKA 2CQQA 4RGSA 4P9UA 2EINH 4ZDLA 2X1DA 2LF8A 5BPDA 4CZZA 2O0YA 1E17A 1E3HA 1WH5A 1LKXA 2YU3A 4WX9A 4OMYA 4MFEA 4WXDA 3IV5A 1U0JA 1KGSA 3ASOH 4GGGA 3TOAA 1Z7LA 3S1QJ 2J5OA 5TISC 1U6GA 4G7OF 3MKWB 3EPZA 5TRDA 4G94A 4C2TA 2VN2A 1OR7A 2DA1A 2V6EA 2ZJPF 3T5XA 1D1AA 4LLNA 1BI3A 1UCRA 2R7FA 2DA2A 3L9FA 2XGCA 2MC4A 2ETHA 3BC8A 3JAMK 3PM1A 3LSJA 2BY3A 4A3JJ 1GVDA 4CH7A 1O3RA 4HBLA 4I2OA 1X3UA 5B66C 1AU7A 2OD5A 2O61A 1FX7A 4OINF 1TWCJ 3QU6A 2HDCA 1FBSA 2DQRA 4CCKA 1IDYA 5HS8A 4K2EA 2KLOA 2O6GE 1ZGAA 5E17F 3A4CA 4ZDPA 4B3XA 1HW5A 3GVAA 2DPUA 3OSGA 3A0HC 1YHQI 2XAFA 2IGNA 1TWFJ 3MWMA 2QQ9A 3SZGA 1E3OC 1A31A 3FM3A 1F4KA 2Y31A 3PUBA 3ZQQA 2O9LA 4BXXJ 3HTUA 2WTEA 1YJ9I 1IC8A 2ZSIB 2VT2A 2KISA 3CJRB 2ELHA 2VE8A 3MEXA 4XICA 1JHHA 2OCCH 1LPQA 1ZRCA 3H5RA 3WHBA 2EH3A 1ENHA 3HOZJ 1TW2A 1DU0A 4A0XA 1TW3A 1ZLJA 2XGXA 4G7HF 1HA8A 2P6SA 2DLLA 2VE9A 1B72A 2LKXA 2VKEA 3PSIA 3ZMDA 3HOWJ 2P6TA 1U2WA 3ERED 3CESA 3TKYA 1D8KA 2DT6A 1IGNA 2X1EA 2R7RA 3IKTA 3S1RJ 2XASA 3F8FA 4A3IJ 4HYEA 1W1WE 5F64A 3K2AA 3GTLJ 1EKEA 2XPWA 2QQAA 1RZ4A 1ZELA 1SVOA 5EZGA 4G8XA 3VDXA 4RBOA 4M6YA 2IP2A 1KQ0A 2VB6A 3E6CC 4ZTJA 1TWAJ 4JOMA 1R9TJ 3OYHA 1R4NB 1FOXA 2WAFA 3JRCA 4KDPA 3FXUA 2HPIA 4B44A 3DCFA 2I5UA 4WF2A 5HS7A 4D0PA 1B9MA 4XLPF 4PCQA 3KETA 3ZN0A 2JPCA 2VBXA 3HZJA 2W85A 2H27A 3S32A 1TBXA 3BG7A 4RGRA 1O7FA 5F27A 1W5CC 1RETA 4HF2A 1L3LA 5FD5A 2EFWA 2VKHA 3HHHA 4I76A 3KEQA 4CZCA 3CJNA 4GRIA 3CCQI 1PYVA 1FSHA 2IA2A 3CO7C 2VL8A 1FLIA 1I39A 4N0BA 1BIAA 1SD6A 5EYRA 3UR3C 3L2CA 3BR0A 2RVCA 3DEEA 3DEUA 1IXCA 4UB6C 3CMMA 2EV5A 2HWVA 4YRVA 5FD6A 1QU3A 3RYRA 1PP8F 2V1UA 4Q47A 2YR2A 2ZO4A 1DPUA 4W1UA 5IT9K 2P5VA 3DWLE 3K7AJ 3HUGB 2CQ7A 1UHSA 4P9FA 5LHIA 3K9TA 2R5ZB 3KIOA 3L00A 4XN3A 3MFKA 2AQFA 3H36A 2ADUA 3DV8A 2K4JA 4BKXA 2FUG2 2ZXIA 3GO5A 3WTZA 1MJBA 2GIVA 2HVQA 3BZKA 5FKKA 1X4OA 3DU5A 5GTHC 5IOZA 5C44J 4Z2YA 2ICWG 1BIBA 2FNPA 1ZLKA 1ZR4A 2YS9A 1IDZA 3U2RA 4U0VA 1O4XA 1NG6A 3ONQA 4CUGA 2GOXB 2HQRA 2UUZA 2FE3A 3HSFA 2LY2A 5D8LB 3L2RA 2NVQJ 2E7WA 4WXCA 4BBRJ 2BVMA 2EA2A 2Y0SA 4EV0A 1BA5A 3K4JA 2OQRA 3VYUB 1GVJA 1G59A 2NOJB 3ZQCA 3CUQB 2ZJ2A 4EJWA 2EBIA 2K4BA 3EUHA 5D5XB 2PEXA 3QPTA 2DU9A 3BJOA 2DA6A 4M3FA 2FBIA 1QPMA 2VQLA 4XKVA 3COAC 2VIXA 4DZPA 2W1OA 4ZYDA 1MBKA 3LL7A 3TDZC 1R36A 2V4JC 4GYGA 3SQNA 1WZ2A 3K4CA 3VWBA 1B9NA 2LRDA 3BROA 1W36C 4II2A 2RGVA 1MSFC 1LB2A 3JTGA 3BWGA 3L09A 3GZ5A 1QVTA 2W84A 4RGXA 2MGQA 4H0EA 1FOYA 1UZCA 2WB1A 4U87A 4MEXF 2IS2A 3KE2A 3AFHA 4RLFA 3E5XA 1QZYA 1NTCA 1RNLA 4CCLA 2GLOA 4DNCA 2BYVE 2KRCA 3GCMA 4L18B 3TEDA 5JVGF 2XHKA 2DOFA 4F52A 2Q2EB 1IZ1A 5FFXA 4AIJA 4E6KG 2YX7A 2V1XA 3M1CA 3SZPA 3TMOA 2IS4A 2JPBA 3TO9A 1TT0A 4M3EA 3M7GA 4XSZF 4XSXF 1F36A 1GXQA 5LLQA 3KYCB 5ICEA 1Z67A 4S0HB 3DF8A 2M45A 4E7IA 4B1RA 1JKOC 3S14J 2KMUA 4M6XA 4KT5C 2DDBA 1WPKA 4U88A 3S3OA 2LK2A 3CCEI 3SFIA 5LGTA 2K5CA 4MTEA 4BQOA 3KX2A 5BPIA 1KU7A 4EJOA 1ZTRA 1D0ZA 4UV9A 1V54H 2UZKA 2CU7A 4RM3A 3ZP5A 1ZGJA 3AG2H 2GOMA 1VQOI 3VSLA 3F6OA 1I6XA 4DYQA 3KLNA 1UFMA 3CDLA 2R7OA 4IPAA 1LE8B 2QSGX 4HRIA 1ETQA 3SFZA 2STWA 3K1PA 3DLLF 1OCRH 3RKQA 1P9QC 3HUGA 2R5ZA 3GTMJ 1BM9A 1REPC 3K1NA 5JI6A 3KYLA 1FYKA 1G3WA 3N4MA 3HOSA 4A3MJ 2HZDA 3VFZA 4G12A 4Y13A 2PJRB 1J7KA 1BOBA 4FX4A 3E6DA 5D6FA 4IRHA 4HZFA 2DA5A 3CD6I 3BLYA 6PAXA 2YUSA 1POGA 2M9HA 4D5CA 2VQHA 4Y15A 3FK6A 1D5VA 1LDKB 1GUUA 5ICGA 5L3GA 3AL0B 2DPDA 2O5RA 3CQZJ 4LLGF 4U7BA 1AA7A 2K3PA 1KQ9A 3CUQA 1IRFA 2EIKH 3FXLA 3HOXJ 2CG4A 2XV4S 3H3VK 3BTCA 3OYAA 1OLTA 3V42A 3VODA 3BTIA 1F1ZA 4BHCA 1FTTA 3V8LA 3C7JA 3TO7A 1OKRA 2Q8KA 1Y56A 5F1RA 1SFOJ 2KL4A 3OSFA 1QBJA 1X2MA 3GUDA 3G1MA 1TZLA 1ZGWA 2OUMA 3ZMUA 2BHYA 2DJIA 1SVMA 5KVRA 3KP7A 4XLAA 4ZTFA 2STTA 5E1ZB 4X0GA 2O3FA 2DDAA 3JREA 1YIOA 3DKWA 2L7ZA 3Q9VA 2MSYA 1WQ2A 1U9OA 1JGSA 1T6SA 1X3ZB 2XB0X 2FBKA 2E2HJ 4KIBA 4FCYA 1U5TA 3GTGJ 2FMYA 4XL9A 2A5WA 1IN4A 4RB1A 3HRTA 5J1UA 5LEJA 3ZQLA 2JJ7A 4MFDA 2QZ8A 5AIQA 4IHVA 3BG5A 1JJ6C 2Z99A 3RIRA 4A3FJ 4P1WA 4PSWA 2JVHA 4FISA 3W6JB 2CO5A 3HSEA 2ZMEB 3LSHA 4EM2A 2OJED 4A3EJ 1LNWA 4G6DA 5EEAA 3CCSI 1S6LA 2VXDA 3Q3SA 1R7JA 2BY2A 4Q5SF 5JHUA 1WWXA 3SDGA 4ESJA 4S04A 2E2IJ 1MDMB 2LKPA 2X1CA 1MBHA 3FISA 2F5FA 2XC7A 5J1YA 4BHBA 3KFWX 1IN8A 3K4LA 4RM2A 3CLOA 2NNNA 2JRTA 4XMYA 2DFEA 1FMWA 1K79A 2CV2A 2HTSA 2QBYB 2XKOA 4E7SA 2K85A 2M5WA 4NC7A 4A3DJ 3GTKJ 5CVIA 2KJCA 2KQRA 2L7MP 2FMLA 4AYBN 5LHHA 1PUFB 2R93J 3CDHA 2X6XA 4ESFA 3DPUA 3FZVA 2PJRA 4UY8I 1QHHD 2GBYA 4ASNA 5F0HA 3RPUA 3M4OJ 1W36D 5TJJA 1IUFA 3FWEA 4LB6B 2CS3A 3PJRA 2VBYA 1VQ4I 4D7MA 2RREA 4KN7X 1Y1VJ 2TRTA 3PIOF 1FWZA 3QWLA 2M4GA 1BJAA 3J80Z 2LF7A 4NQWB 5HVQC 4C3HJ 4W97A 2V9KA 4XRSG 2ZC2A 1S7OA 2E1MC 3MKLA 3WODF 4WK8F 3LA7A 1BR4A 2DFFA 2D5VA 4A3BJ 4Y7NJ 1DP7P 2W25A 1TNTA 2J5PA 3JRFA 5E1WA 3CMAI 5ILUA 2KP6A 4I0AA 3HGGA 4LITA 1I1SA 3Q9SA 3S8PA 4CYDA 2XF6A 2ME6A 1YG2A 1IO2A 4TV7A 2DCEA 1W5SA 3HPGA 1XSDA 3ZMTA 4YEJA 3L2UA 3GTPJ 1B4AA 3CCYA 3S3NA 2A5YB 5AONA 1X1DA 2DT7B 5FB2A 5E8IA 4EJTA 4JP0A 3PIPF 1UJ8A 1K83J 1G6NA 5J40A 5DM7F 3CZ6A 3ZQFA 3SXYA 5DM6F 2DYRH 2ME0A 5H20A 1BOAA 1QGPA 2EFPA 1XMKA 1Y8QB 2LKSA 1MMSA 5FLVA 2DYSH 1I1GA 1R4MB 3RYPA 2KHMA 5IPAA 1ODDA 3Q0UA 1QVUA 2BZTA 3B02A 1FSEA 2ECCA 2FD5A 2M2EA 3QPLA 3RQ4A 4ETSA 2ZMEA 3H3UA 2X6WA 4CGZA 2DBBA 3MZYA 2PFBA 2FQ4A 3DXJF 2IA1A 2NYXA 3GLLA 1KU3A 2EIJH 1WVRA 5FLMJ 4Y52J 3Q0VA 3OYGA 5JLXA 2KIUA 1OFCX 3K4BA 2X0LA 3FHZA 3JRBA 2DMUA 4GFBA 2RDPA 1YJWI 4MEYF 2L5QA 1N77A 9ANTA 3G4SI 1IUYA 3PNVA 2MLKA 3MKYB 3WG7H 1GHCA 1ITYA 2ZXJA 2PX9A 3D5LA 3P5JA 3M07A 5K7HA 2QBYA 3VPRA 3FF5A 2L54A 3WTXC 2G0EA 3F6VA 3OL4A 3VEPA 2LNBA 3G1OA 3LQRA 1WKMA 1U78A 4DQ2A 3ELKA 1XGSA 1PUFA 3RKXA 3HB9A 5JVTA 5GPCA 2EZIA 1DUXC 3I0TA 5GTIC 2E7XA 2M30A 4KICA 3OYJA 4XORA 3EYIA 4A93J 1MH4A 1QNTA 2EV0A 2LTPA 2JA8J 4BE0A 2FJ1A 1W4MA 3K4MA 2VPRA 1UHWA 4EEFG 2ZCWA 1IN6A 2OQGA 4AC0A 2VJJA 3ZMSA 2OTJI 2XSDC 4NQWA 1N78A 3TP3A 2DMTA 2L01A 1J75A 4L9NA 4LIUA 1D8JA 1X1CA 4HNUA 3U1KA 3H92A 2PJPA 2BVLA 3RCOA 5C4XJ 2DTZA 1S5LC 4PJ0C 1G2HA 2WAQN 3EUAA 5FKOA 1K4TA 4BNCA 1H9GA 1R58A 3Q5FA 2NOGA 5F6FA 3BR1A 4JQFA 3CDIA 1A35A 3CCMI 2WY7Q 3OV8A 1XN7A 1MBJA 1WFXA 1FEXA 2P0WA 3IH2A 2M34A 5CJ9A 3V7CA 4HX7A 1PVEA 3M3YJ 1K6YA 1X1AA 1D5YA 1Z91A 2V6CA 4I98B 2NVTJ 3J81Z 4CICA 5FKLA 2O8KA 3T8RA 1IN7A 3BJ6A 4LG0B 2W57A 4YFNF 1P7IA 2HDWA 4HV6A 3WGIA 3K6GA 1X4PA 1QQIA 1H89C 3VB2A 3IH4A 3S3MA 1RR7A 2BGCA 2CUJA 1RRJA 2XDVA 1OR7C 1L0OC 2WADA 3FBIB 4KJZA 5L3FA 3RPUD 1EH7A 3X2QH 3W2WA 1DDNA 2DXIA 1G3SA 1R22A 5CQGA 2F5DA 1P2FA 3OL3A 3B6AA 4XRFA 3I9V2 2X51A 2QM3A 4M3GA 1VQLI 1Y1WJ 3L2QA 1HW2A 4ABZA 3F0CA 1YW9A 4PDKA 2HNHA 2WV0A 5KNLA 1B6AA 1U8BA 2X85A 4IHWA 2KJBA 3ABTA 2K40A 3R0JA 1Z7UA 2NNYA 1Y39A 5ED4A 5A2QZ 2KDOA 1YQAA 1BR2A 3OYNA 3CCVI 3V4GA 5L3EA 1DP3A 1XS9A 4DBQA 3R4KA 4FT8A 5J1RA 3OS1A 1S9HA 5GAGJ 4OIOF 2VODA 3ZGKA 3GYHX 4A69C 4PJLA 1H8AC 3H9QA 1JXSA 2DT5A 5H6QA 1W7PA 1D3YA 2LDUA 3DBHB 4PUSA 3ZXSA 3KEYA 1W5TA 3ZQ7A 4B47A 1HW1A 4AUXA 1DGWY 1GLNA 4HV5A 1SVLA 2XVCA 3R61A 2RKHA 3WTYC 2CJJA 2CW7A 3V8JA 4OU0A 1HOMA 4JX6A 4P55A 2IW5A 3SEZA 1T95A 4QTRA 3ECHA 3E6BA 1RI7A 1XG1A 4MGRA 2EPFA 3T0YA 5HLGA 4AIHA 3OR1C 1IRZA 4RDUA 3HOTA 1JUSA 1VQMI 1MGTA 2HFHA 3VSKA 3FBNB 1HF0A 3JRGA 1U8RA 4C3IJ 1I27A 3HGYA 3EUKL 1LEAA 2R0QC 4C9YA 1OCCH 4RB2C 2F2EA 3HKZN 4IL6C 2ZFWA 1TC3C 1LVAA 4X1EA 2JWTA 1K61A 4PJMA 5K5RA 1LQ1A 2WV1A 1NHAA 3FIWA 3HJEA 1MH3A 2X6YA 2ACJA 2HKOA 2RQPA 1G4DA 5HDNA 3T8TA 3PUFA 1JTYA 3QYFA 3BG9A 3F8CA 3QAHA 2B9SA 2PMUA 4LG0A 2K86A 2QA4I 1STZA 3MKZA 1GV2A 1WGXA 3TW7A 4L5IA 5GAEJ 5J4YA 1T08B 1CF7B 2MG4A 2FU4A 1XPXA 4F3QA 2D2WA 3PNYA 2E60A 2R7VA 3ZPLA 2XAHA 1ETYA 1XD7A 2BE5F 4LFUA 2VASA 4M72A 2GXBA 2HOEA 2LC2A 1WJAA 3U9GA 1I3AA 1TWGJ 3RJPA 3CCUI 2L4MA 2ZNZA 1PDNC 3JR9A 4LMYA 2Y48A 4JBAA 5CVUA 4ZDOA 3EDPA 1VQPI 2LY9A 4RAGA 1M1EB 3REOA 4XOPA 2ZNYA 3JAMZ 1AOYA 3TO6A 3WGGA 2JZYA 3HSRA 3GLXA 1SFEA 2Q1ZB 1FP1D 3T1BA 5IY5H 2JVGA 2Z5UA 3FXKA 4B48A 4R79A 5FJ8J 1GXPA 1D0YA 1JKQC 2HVRA 3OOUA 2V9PA 5M3FJ 4WXHA 1FZPB 1D1CA 4HPQA 2DJNA 3DFGA 3EUHC 2NXNB 3GXOA 3HIFA 2XUBA 2VJIA 1GT0C 2IVMA 2KRFA 3SDBA 3BDDA 5HODA 1MZBA 2K7LA 1KU2A 3PL8A 5JFRA 4HNTA 2VQCA 1FYLA 4XRMA 4BGDA 3I58A 4BQAA 1MBFA 4RMNA 4F7ZA 2Y0MA 4Q48A 2O03A 2I8DA 3HRUA 3HBLA 2HOSA 4D1QA 1W0TA 3BCAA 2HOTA 2XRLA 4BHPA 3FK7A 1WH7A 1Z1DA 5ILVA 1JKRC 5J3LA 4PK4A 4UHTA 3TDUC 2P7VB 4I02A 3BQYA 3FKIJ 3LQQA 4XKCA 2PQ8A 4KMFA 5EG0B 3OYBA 2K9NA 3H35A 3TGNA 2M8GX 2HYFA 5DTDA 1OYIA 1KZHA 1BL0A 3KP3A 1FOKA 2F5CA 1D1BA 4M9ZA 3A01B 1Z6TA 1ZREA 3F22A 4A6EA 1W7PD 2M4KA 4NHJA 2OA4A 3BR2A 1MMAA 2JK3A 1T98A 3S2WA 3DTKA 3SYTA 5GAHJ 1IXSB 3ZMZA 4FE7A 1T8IA 4AM3A 1ZG3A 2Z9OA 1T2KA 3ESWB 3M8EA 1VQ9I 3OYIA 3LSIA 3GX4X 2DI3A 2WAEA 1CF7A 2LVSA 2M1BA 2CSOA 3FXRA 1HLVA 4KIGA 2OPTA 2M7AA 4GDFA 2DW4A 3IAM2 2X48A 5HS9A 5EGOB 2XF5A 1XSXA 3WU0A 1VQKI 1P92A 1FIPA 2ZXHA 1XSVA 4DOZA 2CYYA 3GW2A 1VFCA 2JT1A 2R5YB 3WU2C 2OF7A 3LSRA 1EH8A 2CQNA 3KP6A 4B3AA 2EB7A 5F08A 5HOOA 4KISA 5CPRB 5E79C 1ULYA 5LFAA 2ZFUA 4LK1F 1TQMA 1JUMA 3TW6A 3GZ6A 1SMTA 1YLFA 3NARA 5EEGA 3WHCA 5DUIA 1AWCA 2E35A 2JSCA 2L3DA 4DYRA 5IT9Z 4HDVA 5B1BH 2AXLA 3CF2A 5M5YJ 4LJZF 2MH9A 4GXOA 1K6OA 4CCOA 3RQIA 1BW6A 3NWTA 2YU9J 4OOIA 4IRIA 1IV8A 4AYBA 3CTAA 1BI1A 3CUQC 1LDJA 3ZQHA 1ETKA 2COMA 1X2NA 5EZHA 2HTJA 4AIDA 3WTWC 3KP2A 3TBIA 4HAMA 2CQKA 1LDDA 1O3TA 4EM0B 3GZNB 3W2VA 1CQTA 2A6EF 2PMZN 2QLZA 4FASD 4A0ZA 1YI2I 2DODA 3R60A 2HYJA 5CKTA 2NS8A 2LBFB 2ID3A 4MQVA 2RNGA 4HQEA 2XPVA 1MJAA 3KZZA 1UELB 3C18A 3IWZA 2FSWA 4C2UA 4LGWA 2A68F 3B6CA 3H5AA 3RZOJ 4ZZLA 4BH9A 4DIQA 1X3WB 3N97A 1HBXG 1SFKA 1U5TC 3H9GA 4KMUX 1K4SA 3RTRA 1QZZA 2E34A 3P9CA 2TCTA 4ANJA 2F5EA 1QHGA 5EG0A 3FMSA 5F04A 1PP7U 3P7NA 1BBYA 3PFIA 1VF9A 5F0CA 4XLFA 2VJ5A 1YTYA 5TGTA 4UUSB 4G7ZF 1QRYA 3MAJA 1CGPA 1MNMC 3A0BC 1A6IA 2WC2A 4JYKA 2M0CA 2Q2EA 4D7NA 5GP9A 4L9JA 2FOWA 3JRHA 2L7KA 1VQNI 5E20A 3I53A 3LAPA 4BU2A 2E1MB 3OR2C 1V5EA 3PFYA 1R6RA 4Z6YA 2VUMJ 3JSOA 2IJLA 5BQTA 2A07F 2OC6A 4E7HA 3F3XA 4FX0A 5E3NA 1J9IA 3WTSC 3LNQA 4A2UA 1FPQA 4I09A 3QPSA 4UVBA 2H09A 2H1KA 2L9NA 2RQQA 4IX7A 2PLYA 2F4IA 2V9VA 4UUVA 3DP7A 4IHTA 4BJ6C 2R5YA 3O8HA 3EETA 5LRRA 1OCPA 1FNNA 2DOAA 4IF4A 4BACA 1RKTA 1WJBA 4UVAA 2EV6A 4IXAA 3FXMA 1VTNC 1RUNA 2K9MA 3CC2I 3HG9A 1ORKA 1ZARA 1IW7F 1B8IB 3FXQA 1LE8A 1Z77A 4BY1J 4L9VA 2DA3A 2Y9ZA 4XKWA 3QQAA 2KPMA 2QSFX 3FXOA 1LFPA 3AL0C 2E2JJ 4EGZA 3I4MJ 5ERIA 2MBFA 3E3VA 4P96A 2DMQA 5D5VB 2A05A 2XPUA 1V5GA 4ZC3A 2XIGA 1Q1VA 3E5UA 3JW4A 5D4RA 1EA3A 1MW7A 1OYYA 3WE2A 1AHDP 4HSTA 2L7FP 2FNAA 4PSXA 1XGMA 4BDYA 1MNDA 3GEZA 3QOPA 4OAYA 1E2XA 4A12A 4FHTA 1MMNA 5JR3A 5FLXZ 3HDDA 2R92J 1LUJB 5DEQA 3DBLB 3I56I 2XGDA 3ZMVA 2E71A 2LBFA 2QF7A 1JE8A 3C2BA 1R00A 5FRMA 2YX4A 1T0FA 2E1OA 2FX0A 3F8NA 3QU3A 3UNGC 2A6HF 2DO7A 1XDSA 2NS0A 1T38A 2D45A 2EWNA 2MA3A 5H6RA 2WAQA 1RIOH 4LIVA 1SD4A 3JSPA 2Z33A 2QEXI 2XAGA 4KFCA 2LD5A 1ETXA 2IRFG 5LBQA 5IP6A 4M3DA 1SD5A 3DKYA 2CW0F 4XNFA 2IEKA 2ZJQF 2VLAA 1USSA 1EH6A 3FM5A 3CC7I 1JHFA 1R5HA 3G2BA 3H0GJ 4GYIA 3W3CA 1UAAA 4DJAA 4XN0A 5J8FA 2ZMEC 4RAZA 4UUSA 3DBRB 3I59B 2Z2SB 3ECOA 2BHZA 1YJNI 4IHYA 3NEUA 3U21A 3QODA 1JKPC 4A5MA 4S05A 1VQ8I 2K27A 3S16J 1HXDA 3IRQA 2MH2A 1J0RA 1RPWA 1OCOH 2LREA 3H1CA 3P9KA 3ZN1A 1ZN2A 2XRNA 2IS1A 3NQOA 3IH3A 4MLOA 1MMGA 4ON0A 4J19A 3WTTC 4EJVA 3S2HJ 3BY6A 2VBZA 3DKXA 3J81K 2RC4A 1Z21A 4WCGA 4AVZA 4E7KA 1MBEA 3ABUA 3K2ZA 1R1VA 3PO2J 3LMMA 3RDIA 4AWXB 4E7JA 4DGWB 4KIFA 2Y69H 2XKPA 4YIFA 4MHGA 3C2GA 1MDMA 3GF2A 4L0YB 1B1BA 4CHUA 2L9VA 1FT9A 1APLC 5CYVA 4HQMA 2MFZA 5CLSA 3PO3J 2BV6A 4IKFA 2VKVA 1PJRA 1A36A 4ITVA 1B8IA 2IBDA 3S93A 2JUGA 1XMAA 4E7LA 2V7FA 4P5OA 1T39A 4I99C 2CW8A 1R5ID 3HTSB 2DTRA 5FFZA 3IC7A 3PNTA 2H8RA 3FHNA 3LAJA 1MKMA 1JGGA 1UG2A 3RKWA 4RB3C 4BBSJ 4LLLA 5DD4A 4B09A 2JN6A 2BBYA 2UXXA 1USTA 1HQCA 1KQ8A 1TT5B 2DMNA 2HQ5A 5F0FA 2E19A 2O7OA 4XIDA 1DQUA 4OAZA 3OYEA 2ESHA 4BEHB 1X1PA 2HEOA 3QRFF 2XAUA 2VONA 2FRHA 2Q0OA 4GCVA 4Y4RA 3P9IA 1SANA 2OV7A 1U3EM 4HX4A 5HDGA 3K70D 4F55A 2IGKA 1HKSA 2X9DA 2DN0A 3QYEA 2VXZA 2JA5J 3M9AA 2HU9A 3S1MJ 4CA0A 2N8GA 4XRSA 1FMVA 1MMDA 2Y9YA 3HC7A 5IYCJ 2MD0A 3HKZA 1YYVA 1JJ8C 4RAFA 3I71A 3K10A 4HLXA 3OYLA 3JRIA 4UV8A 3H9JA 3PSFA 3O2PE 5K7ZA 1KONA 5FROA 2IT0A 4A6DA 3ZR8X 3OMYA 3F23A 2H6CA 1B72B 2IXSA 3I5UA 5FO5A 4I7HA 5JLWA 2ISZA 3JRAA 2DMPA 3TQNA 4IOCF 3I59A 5C3EJ 1QZEA 2OTLI 4HEA2 3FDYA 3LA3A 4CO8A 4ENJA 2ELKA 1S7EA 5E1XA 1OYWA 1HSJA 4Y3OA 2R7UA 2HVSA 4ZH4F 3HM5A 4CSWA 2IAIA 2BW3B 3RZDJ 1TQPA 4PJJA 1FP2A 5K5OA 5F1JA 2W4SA 1WJEA 3B73A 3D0SA 2LYCA 3BR3A 3QP5A 2LG4A 3F8MA 4CCMA 3J7YJ 4RB0A 4IEJA 1YE9A 4CCNA 2L4AA 2FA5A 4NUBA 3SHFA 1TTYA 4M6VA 1OQYA 4B43A 4PZJA 2WWYA 2AS5F 4FQGA 1B59A 2GXAA 1WCMJ 2NS7A 4A5NA 3WE3A 2ECBA 1NG7A 2R4GA 3LFUA 4G6QA 2R7TA 4CDGA 5KCMA 2ZKZA 4LD5A 3CCRI 2X6OA 1DGRM 5J8CA 4HOBA 4A3CJ 4XLEA 1FC3A 3VYTB 3GTOJ 1SFUA 5L3BA 2GXGA 1R1TA 1FIAA 5GPAA 4BXUA 3IL2A 3ASNH 1VI0A 3O6BB 1ZAOA 2RNJA 1V3FA 4IHSA 2VOOA 2JRMA 1H88C 3L1PA 3HYIA 2GA2A 2HYGD 5D6EA 1UB9A 4ZYHA 2PN6A 2JA7J 2VPLA 2HGCA 1OISA 4F93B 2OU2A 3GWZA 4J01A 1NK2P 5KHDA 2XB5A 1SAUA 1ETOA 2QVOA 3HXLA 4BEHA 3W2AA 1R23A 2JUCA 2TDXA 2A69F 2HS5A 1S8NA 3DLAA 4RAYA 3RKYA 1OMIA 5BMZA 5M5XJ 1R49A 1H9TA 3QOEA 4DZJA 3O8GA 3HHGA 1OCZH 3BPXA 4V2GA 5BS6A 4BY7J 3BT9A 1HDPA 1AKHB 4D9JA 5E3MA 3A03A 1O3SA 3AG1H 3RSNA 1S72I 1X1BA 1XCBA 3LA2A 2QENA 3ABLH 3I4PA 2R7ZJ 3LFKA 3F21A 5DS9A 2IGMA 4IHXA 3U1DA 3K69A 3V7SA 3RI4A 2LFBA 2F48A 1E3PA 4NBQA 2R7SA 3ABKH 1RESA 4O5VA 4BQQA 4FTHA 2DQLA 4R1HA 4XR6A 1KYWA 1HC8A 3CP8A 4JK1X 3BTJA 4C3JJ 4N9HA 1DU6A 2CFXA 2BXYA 4M9SA 5IOYA 4QPOA 3AKZA 4L9TA 1TP4A 5HNHA 2BW3A 1F9NA 1ON2A 4I6ZA 5HLHA 1ZR2A 2CV0A 1MBGA 2DK5A 2B63J 3TOBA 3D1NI 1FYMA 5JHFA 2R7QA 4XOTA 5K7FA 5IYDJ 4XBFA 3S15J 5LD2C 1IRGA 3PQJA 4L5JA 3GMEA 4O6JA 4CCJA 3JRDA 1RKWA 2EZKA 2RV8A 5CVJA 5K5QA 2WY8Q 4I01A 5J6XA 3CC4I 1ZKGA 1ZHFA 3V8KA 4KYWA 3JTHA 2EA4A 2EZHA 1U9NA 4UB8C 1XTAA 5D4SA 2BXZA 2LLKA 3EQLF 3L7WA 3IAS2 2L02A 3E1SA 3IHUA 3NAUA 1RC9A 2LMDA 4MO7A 3C1DA 1YRNB 2VC0A 3LSTA 3Q0WA 3KEOA 1IXRC 5L3DA 2GAUA 4QPQA 3MCZA 1IV6A 2I10A 2E1NA 1MJ9A 4C2MJ 3CMYA 2PMZA 3OS0A 5DD8A 4U0WA 3OYKA 2KIFA 1S29A 3LSGA 5HDKA 3FXJA 5CVRA 1IF1A 1BI2A 3KZIC 3D5SC 1HCRA 1FBUA 2Z1DA 1HDDC 1N75A 1V4RA 3MZHA 2DA7A 4N9IA 3R0AA 1JI8A 4E4HA 1ETVA 4HNVA 4HDUA 4ZYEA 2CV1A 2DOEA 2KIMA 5FKMA 3BZ6A 2DFHA 2V1DA 3WGHA 1J2XA 2GWRA 2QUFA 1WI3A 2LH9A 1G3TA 2DK8A 2GQQA 1LFBA 2M7BA 2M87A 4YELA 1GDTA 1YX3A 2QSHX 1P7JA 2GZWA 4ZYAA 2VOPA 1AKHA 1N25A 1UHMA 3FKJA 1JUPA 4QWQA 3GTJJ 4M9XA 2P8TA 3BG3A 1WRJA 1R1UA 3GFJA 3NRVA 3QYBA 5DV5A 3L2WA 3C3WA 4BJ5C 4V19K 3ZQIA 3WTVC 5DDGA 2D1HA 2W24A 2W48A 1SD7A 3BQZA 2F4MB 3C2HA 3GBGA 4IO9F 2HI3A 1C0WA 3G73A 4QSHA 4YFXF 5LGNA 1HKQA 1WI9A 4XKBA 2PI0A 1HKTA 4DYCA 2ZBKA 1J5YA 2WA0A 4XLHA 3CP2A 3MN2A 1Z3XA 2H1LA 1I50J 2AHQA 4YG2F 2LY1A 2ELJA 4ZYGA 3LOCA 5FKNA 1P4XA 1G8XA 4OIRF 4G6TB 3AG4H 2EK5A 1QPIA 1QA6A 3QP6A 2KDZA 4Y33A 3A1YA 3HEFA 1R71A 4KNYA 1VZ0A 1QO0D 2R3SA 2OAZA 3DQVC 3HOUJ 1ZRFA 1U5TB 5BNGA 2E36A 2EFNA 2NVXJ 1YFHA 3G1LA 4CXFA 3H0DA 1WHUA 3DTEA 1TQIA 2XAQA 4PJNA 1YX5A 2L2OA 3BJAA 2MABA 3KP5A 3E6MA 5ICCA 1BW5A 4XM3A 3I54A 4A0YA 4J00A 1X19A 3WG9A 2EFOA 2UV1A 3BPVA 1Z9CA 3BTLA 1JT6A 4AD9A 3J7AY 1YOVB 5H2FC 3M1EA 1K7AA 4ZJZA 3CO6C 3G71I 4DBRA 2FQ3A 3CMEI 2KFDA 1UG0A 4BXFA 3A02A 1BC8C 2E5ZA 2QCOA 3TL4X 5HLTA 4WWCA 1YRNA 3FMRA 2XSJC 3HOYJ 4PFPA 2LSOA 3M8FA 5GADJ 2CQXA 5KAFC 3E7LA 1IN5A 4LG3A 2R7WA 4NC8A 2O8XA 1Z6RA 4HX8A 2P81A 2HQNA 4EVIA 1FOWA 2XGEA 2MW8A 1ZQ3P 3DU6A 4LB5A 3I55I 2JSPA 4NB5A 3W6KB 4ESBA 4ENMA 5DYMA 4KITB 5E3OA 3S1NJ 3LSKA 4X6AJ 3KPHA 1WJDA 4IQ4A 2ZJRF 3CF5F 4N4OB 1IAWA 2P4WA 3VYSB 4QLCU 2A6TA 2BY1A 3E0JB 4BUPA 4E7ZA 3BOQA 3K0LA 1TNSA 2PBIA 2IPQX 1LJ9A 2HZTA 4KUMA 2H8WA 1SC7A 2GA1A 2HDDA 1ACIA 3IRRA 3KP4A 2QGUA 4OIQF 1PUEE 2Y0SN 4OIPF 3LSMA 1YS7A 3CJQB 4BDZA 5D5UB 5FLXK 1EJ9A 2XROA 1BR1A 3A2KA 2W7NA 3M8JA 4B4CA 5LEKA 3VOEA 2FEZA 2B0LA
chains in the Genus database with same CATH topology
1OCRH 1OCOH 3ASNH 2EINH 3WG7H 2EIKH 3ABKH 1OCZH 3X2QH 3ABMH 3AG3H 1OCCH 3AG1H 1V54H 2EIJH 2EIMH 3ABLH 3AG2H 3ASOH 2DYRH 3AG4H 2ZXWH 5B1AH 2OCCH 5B3SH 1V55H 5IY5H 2EILH 2DYSH 2Y69H 5B1BH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR H;  1OCO H;  3ASN H;  2EIN H;  3WG7 H;  2EIK H;  3ABK H;  1OCZ H;  3X2Q H;  3ABM H;  3AG3 H;  1OCC H;  3AG1 H;  1V54 H;  2EIJ H;  2EIM H;  3ABL H;  3AG2 H;  3ASO H;  2DYR H;  3AG4 H;  2ZXW H;  5B1A H;  2OCC H;  5B3S H;  1V55 H;  5IY5 H;  2EIL H;  2DYS H;  2Y69 H;  5B1B H; 
#chains in the Genus database with same CATH topology
 5HLI A;  3J80 K;  1O3Q A;  4C30 A;  4UNO A;  1ONV A;  5J47 A;  2HXO A;  1S7A A;  4XON A;  2RAE A;  2KRH A;  5E8G A;  3MMY B;  1OJL A;  3ABM H;  2NAZ A;  3A01 A;  2LP0 A;  3GTQ J;  1SAX A;  1EF4 A;  2VJ4 A;  2K9S A;  3BG6 A;  3IUO A;  3K70 C;  3SJM A;  1Y8R B;  4XLN F;  4JX5 A;  2VKD A;  1I6H J;  1T33 A;  3BR6 A;  1Y6I A;  2BOL A;  4HSR A;  5B1A H;  2F6C A;  1OCT C;  2MYS A;  1P4A A;  2PMH A;  2VT3 A;  2WB1 N;  1MIJ A;  2YPR A;  1YW8 A;  4HG2 A;  5KAI C;  1XMX A;  4EAT A;  1A04 A;  2K9Q A;  5L3C A;  5K1Y A;  2JA6 J;  3ZOB A;  3TP0 A;  1FTZ A;  3S2D J;  2L0K A;  1XGN A;  1ON1 A;  3IWF A;  1WJF A;  2H6B A;  5EGO A;  3OIO A;  2UXN A;  4A3G J;  1BC7 C;  3D5R C;  5M5W J;  3H3Z A;  2CUF A;  3OYC A;  2OZ6 A;  4JX4 A;  4LOC A;  1T56 A;  4EGY A;  2XAJ A;  2P5L C;  5M3M J;  2M8E A;  4RS8 A;  1UMQ A;  4CYC B;  5EJC A;  5FRN A;  4YFK F;  1ZRD A;  5EDN A;  3R6S A;  4XQF A;  2JMW A;  2KZG A;  4IVN A;  3E97 A;  1SMY F;  3K1M A;  3J7A O;  1F5T A;  2KT0 A;  1TL8 A;  1J09 A;  5KK1 A;  5LRS A;  4BE1 A;  1E0E A;  3MD2 A;  1A5J A;  3L2V A;  2JTV A;  1GV5 A;  4F92 B;  3OWT A;  4HF0 A;  3OY9 A;  4DW6 A;  3CLQ A;  3GFM A;  4Q4Z F;  2NVY J;  3CJT B;  1IJW C;  1F43 A;  5CQE A;  4XLC A;  4IQJ A;  2VBW A;  3PQK A;  4IZZ A;  2EJR A;  2X4H A;  1ZK8 A;  1P4W A;  2L9S A;  1Z3Y A;  1YO5 C;  2FOK A;  2PG4 A;  2RN7 A;  3OYF A;  4UXN A;  4OWR B;  1RUO A;  1T0F C;  4U0Y A;  1WJ5 A;  3MVP A;  4KA4 A;  1I3Q J;  1FY7 A;  4PGG A;  2UWM A;  3ZRG A;  2Z16 A;  4I0B A;  1XC5 A;  1K78 B;  1Q1H A;  3HRM A;  2IS6 A;  2CUZ A;  2H94 A;  4IRG A;  1V5F A;  2IGO A;  2CFO A;  3CCJ I;  1NH3 A;  3HOV J;  1XB4 A;  4LK0 F;  2QQ8 A;  4M73 A;  5DCM B;  2NRA C;  5DUK A;  4RLQ A;  1BI0 A;  1LFU P;  2QQB A;  2FXA A;  1VQ7 I;  1O57 A;  2P5K A;  2HQA A;  2QKL B;  1P6R A;  1IRX A;  4MNU A;  4B8X A;  5B3S H;  2QKM B;  3DEW A;  4KN4 X;  3HL2 A;  2AO9 A;  3HPH A;  2CRG A;  2DA4 A;  2QYO A;  4PGH A;  1LEB A;  2Y2Z A;  2KIQ A;  1R5G A;  3BCB A;  5D5W B;  2G7H A;  2HKX A;  2ZSH B;  3FMQ A;  3IKV A;  2HXI A;  3O3K A;  1I5Z A;  3JCU C;  4IOA F;  1H0M A;  1W0U A;  3SEQ A;  2MLG A;  5J4V A;  1VND A;  1MNE A;  1JT0 A;  3WU1 B;  2EZL A;  2JA2 A;  2OZU A;  4ENK A;  3G3Z A;  2OBP A;  1J59 A;  2AXT C;  2Y30 A;  2LR8 A;  1TLH B;  4MIM A;  1Y0U A;  1V55 H;  4MQ9 F;  2M0M A;  1YIJ I;  3S17 J;  3HRS A;  4RGU A;  2JQ7 A;  1TWH J;  2QWW A;  1SFX A;  2VC1 A;  1JTX A;  3H5N A;  1BN5 A;  1G3Y A;  4KT6 A;  2A3S A;  5B5E C;  4AU7 A;  4YIR X;  1MSE C;  3F9K A;  2D1V A;  4RA2 A;  3J7Z I;  5IP7 J;  3WTU C;  3IP4 B;  4XK4 A;  1A6Q A;  1Z0X A;  2M3A A;  3F8B A;  5IYB J;  4O3M A;  2FF4 A;  2CH0 A;  3GFI A;  4HLY A;  3ERM A;  3CUO A;  2BY0 A;  4HF1 A;  2C6Y A;  2EIL H;  4G9Y A;  3E5Q A;  4AIK A;  2CUE A;  4EM1 A;  2AQE A;  5C4J J;  5E3L A;  3OYM A;  2A61 A;  2ESN A;  1Y0N A;  4A3K J;  3BP8 A;  3ISP A;  4CYC A;  3QPH A;  3CCL I;  4PFO A;  3ML6 A;  4BYY A;  2Z3Y A;  2LOO A;  3LWF A;  2CWE A;  3SZT A;  3OYD A;  4F91 B;  2DAO A;  5BOX A;  5FGM A;  5HNF A;  2B7E A;  2G9W A;  3K4N A;  4ZZD A;  4H4K C;  3OIP A;  3N05 A;  2F4O B;  2W82 A;  5DCF A;  3VYR B;  3GFL A;  5A2Q K;  3OOP A;  3DPL C;  3MZ8 A;  2L9R A;  2KKO A;  1ZG1 A;  3BR5 A;  4FET A;  4OMZ A;  2E5N A;  4MTD A;  2MD5 A;  2XF7 A;  5ICF A;  1W7P B;  1KYZ A;  1O7L A;  3LSP A;  2R7X A;  3KZY A;  4BL0 B;  1XCV A;  3ZQG A;  4ENN A;  1ZG5 A;  2VQG A;  5EEH A;  1X58 A;  1K78 A;  3MQ0 A;  4M71 A;  3F72 A;  2R7D A;  4BQN A;  2F5V A;  4HW0 A;  3DTI A;  4UVC A;  5DCM A;  3ZCO A;  2G7U A;  1RR8 C;  1ETW A;  1WSU A;  2IA0 A;  3I3L A;  2CMP A;  3NWS A;  3W6V A;  2Y75 A;  5ILS A;  2KZV A;  3KLO A;  4BS9 A;  2NVU B;  5IT3 A;  1IG7 A;  3BZC A;  3V7R A;  1EV7 A;  2V1N A;  4UUT A;  3KYD B;  4N4N B;  2FBH A;  4BE2 A;  2ISY A;  2HOA A;  3K4K A;  3EYY A;  1XX5 A;  2K9L A;  2OCE A;  1KA8 A;  4NNJ A;  1HST A;  3G6E I;  2BEO A;  1D0X A;  4IJA A;  4Y17 A;  2ZXW H;  2YSR A;  1WJC A;  2CGP A;  4L0Z B;  2GIZ A;  4BJT A;  1YIT I;  1ZH5 A;  3OS2 A;  1XGO A;  1BJZ A;  1YS6 A;  4HA8 A;  4D5F A;  4E70 A;  4EQQ A;  3OIQ A;  2V79 A;  4A3L J;  3DPT A;  4NC6 A;  4YII A;  1SEU A;  5EF6 A;  4V2F A;  1ZYR F;  4AVP A;  2E1C A;  5LHG A;  1Z05 A;  2WBM A;  2EFQ A;  4M74 A;  5AIP A;  1NK3 P;  2HR3 A;  2MC3 A;  4EJU A;  1MD0 A;  1DPR A;  5LGU A;  3I4N J;  1KU9 A;  1S3J A;  5IP9 J;  5E18 F;  2EQR A;  2ID6 A;  3FX3 A;  3KCC A;  3AG3 H;  2V26 A;  1YW7 A;  4EMS A;  3RPQ A;  2EIM H;  2COB A;  3ULQ B;  3UKG A;  1OPC A;  2ZB9 A;  4QIW N;  4GO1 A;  2VI6 A;  4II3 A;  3AAF A;  5D8K B;  1FJL A;  2GM4 A;  2P7C B;  1ERD A;  4NDL A;  5CVV A;  1VQ5 I;  4BAY A;  4R8H A;  4L5E A;  3I64 A;  3ROU A;  1VQ6 I;  2W00 A;  2DFI A;  2HPM A;  1XDU A;  2K3F A;  4M3B A;  4U7D A;  2K02 A;  4FE4 A;  1FBQ A;  1LVK A;  2CQQ A;  4RGS A;  4P9U A;  2EIN H;  4ZDL A;  2X1D A;  2LF8 A;  5BPD A;  4CZZ A;  2O0Y A;  1E17 A;  1E3H A;  1WH5 A;  1LKX A;  2YU3 A;  4WX9 A;  4OMY A;  4MFE A;  4WXD A;  3IV5 A;  1U0J A;  1KGS A;  3ASO H;  4GGG A;  3TOA A;  1Z7L A;  3S1Q J;  2J5O A;  5TIS C;  1U6G A;  4G7O F;  3MKW B;  3EPZ A;  5TRD A;  4G94 A;  4C2T A;  2VN2 A;  1OR7 A;  2DA1 A;  2V6E A;  2ZJP F;  3T5X A;  1D1A A;  4LLN A;  1BI3 A;  1UCR A;  2R7F A;  2DA2 A;  3L9F A;  2XGC A;  2MC4 A;  2ETH A;  3BC8 A;  3JAM K;  3PM1 A;  3LSJ A;  2BY3 A;  4A3J J;  1GVD A;  4CH7 A;  1O3R A;  4HBL A;  4I2O A;  1X3U A;  5B66 C;  1AU7 A;  2OD5 A;  2O61 A;  1FX7 A;  4OIN F;  1TWC J;  3QU6 A;  2HDC A;  1FBS A;  2DQR A;  4CCK A;  1IDY A;  5HS8 A;  4K2E A;  2KLO A;  2O6G E;  1ZGA A;  5E17 F;  3A4C A;  4ZDP A;  4B3X A;  1HW5 A;  3GVA A;  2DPU A;  3OSG A;  3A0H C;  1YHQ I;  2XAF A;  2IGN A;  1TWF J;  3MWM A;  2QQ9 A;  3SZG A;  1E3O C;  1A31 A;  3FM3 A;  1F4K A;  2Y31 A;  3PUB A;  3ZQQ A;  2O9L A;  4BXX J;  3HTU A;  2WTE A;  1YJ9 I;  1IC8 A;  2ZSI B;  2VT2 A;  2KIS A;  3CJR B;  2ELH A;  2VE8 A;  3MEX A;  4XIC A;  1JHH A;  2OCC H;  1LPQ A;  1ZRC A;  3H5R A;  3WHB A;  2EH3 A;  1ENH A;  3HOZ J;  1TW2 A;  1DU0 A;  4A0X A;  1TW3 A;  1ZLJ A;  2XGX A;  4G7H F;  1HA8 A;  2P6S A;  2DLL A;  2VE9 A;  1B72 A;  2LKX A;  2VKE A;  3PSI A;  3ZMD A;  3HOW J;  2P6T A;  1U2W A;  3ERE D;  3CES A;  3TKY A;  1D8K A;  2DT6 A;  1IGN A;  2X1E A;  2R7R A;  3IKT A;  3S1R J;  2XAS A;  3F8F A;  4A3I J;  4HYE A;  1W1W E;  5F64 A;  3K2A A;  3GTL J;  1EKE A;  2XPW A;  2QQA A;  1RZ4 A;  1ZEL A;  1SVO A;  5EZG A;  4G8X A;  3VDX A;  4RBO A;  4M6Y A;  2IP2 A;  1KQ0 A;  2VB6 A;  3E6C C;  4ZTJ A;  1TWA J;  4JOM A;  1R9T J;  3OYH A;  1R4N B;  1FOX A;  2WAF A;  3JRC A;  4KDP A;  3FXU A;  2HPI A;  4B44 A;  3DCF A;  2I5U A;  4WF2 A;  5HS7 A;  4D0P A;  1B9M A;  4XLP F;  4PCQ A;  3KET A;  3ZN0 A;  2JPC A;  2VBX A;  3HZJ A;  2W85 A;  2H27 A;  3S32 A;  1TBX A;  3BG7 A;  4RGR A;  1O7F A;  5F27 A;  1W5C C;  1RET A;  4HF2 A;  1L3L A;  5FD5 A;  2EFW A;  2VKH A;  3HHH A;  4I76 A;  3KEQ A;  4CZC A;  3CJN A;  4GRI A;  3CCQ I;  1PYV A;  1FSH A;  2IA2 A;  3CO7 C;  2VL8 A;  1FLI A;  1I39 A;  4N0B A;  1BIA A;  1SD6 A;  5EYR A;  3UR3 C;  3L2C A;  3BR0 A;  2RVC A;  3DEE A;  3DEU A;  1IXC A;  4UB6 C;  3CMM A;  2EV5 A;  2HWV A;  4YRV A;  5FD6 A;  1QU3 A;  3RYR A;  1PP8 F;  2V1U A;  4Q47 A;  2YR2 A;  2ZO4 A;  1DPU A;  4W1U A;  5IT9 K;  2P5V A;  3DWL E;  3K7A J;  3HUG B;  2CQ7 A;  1UHS A;  4P9F A;  5LHI A;  3K9T A;  2R5Z B;  3KIO A;  3L00 A;  4XN3 A;  3MFK A;  2AQF A;  3H36 A;  2ADU A;  3DV8 A;  2K4J A;  4BKX A;  2FUG 2;  2ZXI A;  3GO5 A;  3WTZ A;  1MJB A;  2GIV A;  2HVQ A;  3BZK A;  5FKK A;  1X4O A;  3DU5 A;  5GTH C;  5IOZ A;  5C44 J;  4Z2Y A;  2ICW G;  1BIB A;  2FNP A;  1ZLK A;  1ZR4 A;  2YS9 A;  1IDZ A;  3U2R A;  4U0V A;  1O4X A;  1NG6 A;  3ONQ A;  4CUG A;  2GOX B;  2HQR A;  2UUZ A;  2FE3 A;  3HSF A;  2LY2 A;  5D8L B;  3L2R A;  2NVQ J;  2E7W A;  4WXC A;  4BBR J;  2BVM A;  2EA2 A;  2Y0S A;  4EV0 A;  1BA5 A;  3K4J A;  2OQR A;  3VYU B;  1GVJ A;  1G59 A;  2NOJ B;  3ZQC A;  3CUQ B;  2ZJ2 A;  4EJW A;  2EBI A;  2K4B A;  3EUH A;  5D5X B;  2PEX A;  3QPT A;  2DU9 A;  3BJO A;  2DA6 A;  4M3F A;  2FBI A;  1QPM A;  2VQL A;  4XKV A;  3COA C;  2VIX A;  4DZP A;  2W1O A;  4ZYD A;  1MBK A;  3LL7 A;  3TDZ C;  1R36 A;  2V4J C;  4GYG A;  3SQN A;  1WZ2 A;  3K4C A;  3VWB A;  1B9N A;  2LRD A;  3BRO A;  1W36 C;  4II2 A;  2RGV A;  1MSF C;  1LB2 A;  3JTG A;  3BWG A;  3L09 A;  3GZ5 A;  1QVT A;  2W84 A;  4RGX A;  2MGQ A;  4H0E A;  1FOY A;  1UZC A;  2WB1 A;  4U87 A;  4MEX F;  2IS2 A;  3KE2 A;  3AFH A;  4RLF A;  3E5X A;  1QZY A;  1NTC A;  1RNL A;  4CCL A;  2GLO A;  4DNC A;  2BYV E;  2KRC A;  3GCM A;  4L18 B;  3TED A;  5JVG F;  2XHK A;  2DOF A;  4F52 A;  2Q2E B;  1IZ1 A;  5FFX A;  4AIJ A;  4E6K G;  2YX7 A;  2V1X A;  3M1C A;  3SZP A;  3TMO A;  2IS4 A;  2JPB A;  3TO9 A;  1TT0 A;  4M3E A;  3M7G A;  4XSZ F;  4XSX F;  1F36 A;  1GXQ A;  5LLQ A;  3KYC B;  5ICE A;  1Z67 A;  4S0H B;  3DF8 A;  2M45 A;  4E7I A;  4B1R A;  1JKO C;  3S14 J;  2KMU A;  4M6X A;  4KT5 C;  2DDB A;  1WPK A;  4U88 A;  3S3O A;  2LK2 A;  3CCE I;  3SFI A;  5LGT A;  2K5C A;  4MTE A;  4BQO A;  3KX2 A;  5BPI A;  1KU7 A;  4EJO A;  1ZTR A;  1D0Z A;  4UV9 A;  1V54 H;  2UZK A;  2CU7 A;  4RM3 A;  3ZP5 A;  1ZGJ A;  3AG2 H;  2GOM A;  1VQO I;  3VSL A;  3F6O A;  1I6X A;  4DYQ A;  3KLN A;  1UFM A;  3CDL A;  2R7O A;  4IPA A;  1LE8 B;  2QSG X;  4HRI A;  1ETQ A;  3SFZ A;  2STW A;  3K1P A;  3DLL F;  1OCR H;  3RKQ A;  1P9Q C;  3HUG A;  2R5Z A;  3GTM J;  1BM9 A;  1REP C;  3K1N A;  5JI6 A;  3KYL A;  1FYK A;  1G3W A;  3N4M A;  3HOS A;  4A3M J;  2HZD A;  3VFZ A;  4G12 A;  4Y13 A;  2PJR B;  1J7K A;  1BOB A;  4FX4 A;  3E6D A;  5D6F A;  4IRH A;  4HZF A;  2DA5 A;  3CD6 I;  3BLY A;  6PAX A;  2YUS A;  1POG A;  2M9H A;  4D5C A;  2VQH A;  4Y15 A;  3FK6 A;  1D5V A;  1LDK B;  1GUU A;  5ICG A;  5L3G A;  3AL0 B;  2DPD A;  2O5R A;  3CQZ J;  4LLG F;  4U7B A;  1AA7 A;  2K3P A;  1KQ9 A;  3CUQ A;  1IRF A;  2EIK H;  3FXL A;  3HOX J;  2CG4 A;  2XV4 S;  3H3V K;  3BTC A;  3OYA A;  1OLT A;  3V42 A;  3VOD A;  3BTI A;  1F1Z A;  4BHC A;  1FTT A;  3V8L A;  3C7J A;  3TO7 A;  1OKR A;  2Q8K A;  1Y56 A;  5F1R A;  1SFO J;  2KL4 A;  3OSF A;  1QBJ A;  1X2M A;  3GUD A;  3G1M A;  1TZL A;  1ZGW A;  2OUM A;  3ZMU A;  2BHY A;  2DJI A;  1SVM A;  5KVR A;  3KP7 A;  4XLA A;  4ZTF A;  2STT A;  5E1Z B;  4X0G A;  2O3F A;  2DDA A;  3JRE A;  1YIO A;  3DKW A;  2L7Z A;  3Q9V A;  2MSY A;  1WQ2 A;  1U9O A;  1JGS A;  1T6S A;  1X3Z B;  2XB0 X;  2FBK A;  2E2H J;  4KIB A;  4FCY A;  1U5T A;  3GTG J;  2FMY A;  4XL9 A;  2A5W A;  1IN4 A;  4RB1 A;  3HRT A;  5J1U A;  5LEJ A;  3ZQL A;  2JJ7 A;  4MFD A;  2QZ8 A;  5AIQ A;  4IHV A;  3BG5 A;  1JJ6 C;  2Z99 A;  3RIR A;  4A3F J;  4P1W A;  4PSW A;  2JVH A;  4FIS A;  3W6J B;  2CO5 A;  3HSE A;  2ZME B;  3LSH A;  4EM2 A;  2OJE D;  4A3E J;  1LNW A;  4G6D A;  5EEA A;  3CCS I;  1S6L A;  2VXD A;  3Q3S A;  1R7J A;  2BY2 A;  4Q5S F;  5JHU A;  1WWX A;  3SDG A;  4ESJ A;  4S04 A;  2E2I J;  1MDM B;  2LKP A;  2X1C A;  1MBH A;  3FIS A;  2F5F A;  2XC7 A;  5J1Y A;  4BHB A;  3KFW X;  1IN8 A;  3K4L A;  4RM2 A;  3CLO A;  2NNN A;  2JRT A;  4XMY A;  2DFE A;  1FMW A;  1K79 A;  2CV2 A;  2HTS A;  2QBY B;  2XKO A;  4E7S A;  2K85 A;  2M5W A;  4NC7 A;  4A3D J;  3GTK J;  5CVI A;  2KJC A;  2KQR A;  2L7M P;  2FML A;  4AYB N;  5LHH A;  1PUF B;  2R93 J;  3CDH A;  2X6X A;  4ESF A;  3DPU A;  3FZV A;  2PJR A;  4UY8 I;  1QHH D;  2GBY A;  4ASN A;  5F0H A;  3RPU A;  3M4O J;  1W36 D;  5TJJ A;  1IUF A;  3FWE A;  4LB6 B;  2CS3 A;  3PJR A;  2VBY A;  1VQ4 I;  4D7M A;  2RRE A;  4KN7 X;  1Y1V J;  2TRT A;  3PIO F;  1FWZ A;  3QWL A;  2M4G A;  1BJA A;  3J80 Z;  2LF7 A;  4NQW B;  5HVQ C;  4C3H J;  4W97 A;  2V9K A;  4XRS G;  2ZC2 A;  1S7O A;  2E1M C;  3MKL A;  3WOD F;  4WK8 F;  3LA7 A;  1BR4 A;  2DFF A;  2D5V A;  4A3B J;  4Y7N J;  1DP7 P;  2W25 A;  1TNT A;  2J5P A;  3JRF A;  5E1W A;  3CMA I;  5ILU A;  2KP6 A;  4I0A A;  3HGG A;  4LIT A;  1I1S A;  3Q9S A;  3S8P A;  4CYD A;  2XF6 A;  2ME6 A;  1YG2 A;  1IO2 A;  4TV7 A;  2DCE A;  1W5S A;  3HPG A;  1XSD A;  3ZMT A;  4YEJ A;  3L2U A;  3GTP J;  1B4A A;  3CCY A;  3S3N A;  2A5Y B;  5AON A;  1X1D A;  2DT7 B;  5FB2 A;  5E8I A;  4EJT A;  4JP0 A;  3PIP F;  1UJ8 A;  1K83 J;  1G6N A;  5J40 A;  5DM7 F;  3CZ6 A;  3ZQF A;  3SXY A;  5DM6 F;  2DYR H;  2ME0 A;  5H20 A;  1BOA A;  1QGP A;  2EFP A;  1XMK A;  1Y8Q B;  2LKS A;  1MMS A;  5FLV A;  2DYS H;  1I1G A;  1R4M B;  3RYP A;  2KHM A;  5IPA A;  1ODD A;  3Q0U A;  1QVU A;  2BZT A;  3B02 A;  1FSE A;  2ECC A;  2FD5 A;  2M2E A;  3QPL A;  3RQ4 A;  4ETS A;  2ZME A;  3H3U A;  2X6W A;  4CGZ A;  2DBB A;  3MZY A;  2PFB A;  2FQ4 A;  3DXJ F;  2IA1 A;  2NYX A;  3GLL A;  1KU3 A;  2EIJ H;  1WVR A;  5FLM J;  4Y52 J;  3Q0V A;  3OYG A;  5JLX A;  2KIU A;  1OFC X;  3K4B A;  2X0L A;  3FHZ A;  3JRB A;  2DMU A;  4GFB A;  2RDP A;  1YJW I;  4MEY F;  2L5Q A;  1N77 A;  9ANT A;  3G4S I;  1IUY A;  3PNV A;  2MLK A;  3MKY B;  3WG7 H;  1GHC A;  1ITY A;  2ZXJ A;  2PX9 A;  3D5L A;  3P5J A;  3M07 A;  5K7H A;  2QBY A;  3VPR A;  3FF5 A;  2L54 A;  3WTX C;  2G0E A;  3F6V A;  3OL4 A;  3VEP A;  2LNB A;  3G1O A;  3LQR A;  1WKM A;  1U78 A;  4DQ2 A;  3ELK A;  1XGS A;  1PUF A;  3RKX A;  3HB9 A;  5JVT A;  5GPC A;  2EZI A;  1DUX C;  3I0T A;  5GTI C;  2E7X A;  2M30 A;  4KIC A;  3OYJ A;  4XOR A;  3EYI A;  4A93 J;  1MH4 A;  1QNT A;  2EV0 A;  2LTP A;  2JA8 J;  4BE0 A;  2FJ1 A;  1W4M A;  3K4M A;  2VPR A;  1UHW A;  4EEF G;  2ZCW A;  1IN6 A;  2OQG A;  4AC0 A;  2VJJ A;  3ZMS A;  2OTJ I;  2XSD C;  4NQW A;  1N78 A;  3TP3 A;  2DMT A;  2L01 A;  1J75 A;  4L9N A;  4LIU A;  1D8J A;  1X1C A;  4HNU A;  3U1K A;  3H92 A;  2PJP A;  2BVL A;  3RCO A;  5C4X J;  2DTZ A;  1S5L C;  4PJ0 C;  1G2H A;  2WAQ N;  3EUA A;  5FKO A;  1K4T A;  4BNC A;  1H9G A;  1R58 A;  3Q5F A;  2NOG A;  5F6F A;  3BR1 A;  4JQF A;  3CDI A;  1A35 A;  3CCM I;  2WY7 Q;  3OV8 A;  1XN7 A;  1MBJ A;  1WFX A;  1FEX A;  2P0W A;  3IH2 A;  2M34 A;  5CJ9 A;  3V7C A;  4HX7 A;  1PVE A;  3M3Y J;  1K6Y A;  1X1A A;  1D5Y A;  1Z91 A;  2V6C A;  4I98 B;  2NVT J;  3J81 Z;  4CIC A;  5FKL A;  2O8K A;  3T8R A;  1IN7 A;  3BJ6 A;  4LG0 B;  2W57 A;  4YFN F;  1P7I A;  2HDW A;  4HV6 A;  3WGI A;  3K6G A;  1X4P A;  1QQI A;  1H89 C;  3VB2 A;  3IH4 A;  3S3M A;  1RR7 A;  2BGC A;  2CUJ A;  1RRJ A;  2XDV A;  1OR7 C;  1L0O C;  2WAD A;  3FBI B;  4KJZ A;  5L3F A;  3RPU D;  1EH7 A;  3X2Q H;  3W2W A;  1DDN A;  2DXI A;  1G3S A;  1R22 A;  5CQG A;  2F5D A;  1P2F A;  3OL3 A;  3B6A A;  4XRF A;  3I9V 2;  2X51 A;  2QM3 A;  4M3G A;  1VQL I;  1Y1W J;  3L2Q A;  1HW2 A;  4ABZ A;  3F0C A;  1YW9 A;  4PDK A;  2HNH A;  2WV0 A;  5KNL A;  1B6A A;  1U8B A;  2X85 A;  4IHW A;  2KJB A;  3ABT A;  2K40 A;  3R0J A;  1Z7U A;  2NNY A;  1Y39 A;  5ED4 A;  5A2Q Z;  2KDO A;  1YQA A;  1BR2 A;  3OYN A;  3CCV I;  3V4G A;  5L3E A;  1DP3 A;  1XS9 A;  4DBQ A;  3R4K A;  4FT8 A;  5J1R A;  3OS1 A;  1S9H A;  5GAG J;  4OIO F;  2VOD A;  3ZGK A;  3GYH X;  4A69 C;  4PJL A;  1H8A C;  3H9Q A;  1JXS A;  2DT5 A;  5H6Q A;  1W7P A;  1D3Y A;  2LDU A;  3DBH B;  4PUS A;  3ZXS A;  3KEY A;  1W5T A;  3ZQ7 A;  4B47 A;  1HW1 A;  4AUX A;  1DGW Y;  1GLN A;  4HV5 A;  1SVL A;  2XVC A;  3R61 A;  2RKH A;  3WTY C;  2CJJ A;  2CW7 A;  3V8J A;  4OU0 A;  1HOM A;  4JX6 A;  4P55 A;  2IW5 A;  3SEZ A;  1T95 A;  4QTR A;  3ECH A;  3E6B A;  1RI7 A;  1XG1 A;  4MGR A;  2EPF A;  3T0Y A;  5HLG A;  4AIH A;  3OR1 C;  1IRZ A;  4RDU A;  3HOT A;  1JUS A;  1VQM I;  1MGT A;  2HFH A;  3VSK A;  3FBN B;  1HF0 A;  3JRG A;  1U8R A;  4C3I J;  1I27 A;  3HGY A;  3EUK L;  1LEA A;  2R0Q C;  4C9Y A;  1OCC H;  4RB2 C;  2F2E A;  3HKZ N;  4IL6 C;  2ZFW A;  1TC3 C;  1LVA A;  4X1E A;  2JWT A;  1K61 A;  4PJM A;  5K5R A;  1LQ1 A;  2WV1 A;  1NHA A;  3FIW A;  3HJE A;  1MH3 A;  2X6Y A;  2ACJ A;  2HKO A;  2RQP A;  1G4D A;  5HDN A;  3T8T A;  3PUF A;  1JTY A;  3QYF A;  3BG9 A;  3F8C A;  3QAH A;  2B9S A;  2PMU A;  4LG0 A;  2K86 A;  2QA4 I;  1STZ A;  3MKZ A;  1GV2 A;  1WGX A;  3TW7 A;  4L5I A;  5GAE J;  5J4Y A;  1T08 B;  1CF7 B;  2MG4 A;  2FU4 A;  1XPX A;  4F3Q A;  2D2W A;  3PNY A;  2E60 A;  2R7V A;  3ZPL A;  2XAH A;  1ETY A;  1XD7 A;  2BE5 F;  4LFU A;  2VAS A;  4M72 A;  2GXB A;  2HOE A;  2LC2 A;  1WJA A;  3U9G A;  1I3A A;  1TWG J;  3RJP A;  3CCU I;  2L4M A;  2ZNZ A;  1PDN C;  3JR9 A;  4LMY A;  2Y48 A;  4JBA A;  5CVU A;  4ZDO A;  3EDP A;  1VQP I;  2LY9 A;  4RAG A;  1M1E B;  3REO A;  4XOP A;  2ZNY A;  3JAM Z;  1AOY A;  3TO6 A;  3WGG A;  2JZY A;  3HSR A;  3GLX A;  1SFE A;  2Q1Z B;  1FP1 D;  3T1B A;  5IY5 H;  2JVG A;  2Z5U A;  3FXK A;  4B48 A;  4R79 A;  5FJ8 J;  1GXP A;  1D0Y A;  1JKQ C;  2HVR A;  3OOU A;  2V9P A;  5M3F J;  4WXH A;  1FZP B;  1D1C A;  4HPQ A;  2DJN A;  3DFG A;  3EUH C;  2NXN B;  3GXO A;  3HIF A;  2XUB A;  2VJI A;  1GT0 C;  2IVM A;  2KRF A;  3SDB A;  3BDD A;  5HOD A;  1MZB A;  2K7L A;  1KU2 A;  3PL8 A;  5JFR A;  4HNT A;  2VQC A;  1FYL A;  4XRM A;  4BGD A;  3I58 A;  4BQA A;  1MBF A;  4RMN A;  4F7Z A;  2Y0M A;  4Q48 A;  2O03 A;  2I8D A;  3HRU A;  3HBL A;  2HOS A;  4D1Q A;  1W0T A;  3BCA A;  2HOT A;  2XRL A;  4BHP A;  3FK7 A;  1WH7 A;  1Z1D A;  5ILV A;  1JKR C;  5J3L A;  4PK4 A;  4UHT A;  3TDU C;  2P7V B;  4I02 A;  3BQY A;  3FKI J;  3LQQ A;  4XKC A;  2PQ8 A;  4KMF A;  5EG0 B;  3OYB A;  2K9N A;  3H35 A;  3TGN A;  2M8G X;  2HYF A;  5DTD A;  1OYI A;  1KZH A;  1BL0 A;  3KP3 A;  1FOK A;  2F5C A;  1D1B A;  4M9Z A;  3A01 B;  1Z6T A;  1ZRE A;  3F22 A;  4A6E A;  1W7P D;  2M4K A;  4NHJ A;  2OA4 A;  3BR2 A;  1MMA A;  2JK3 A;  1T98 A;  3S2W A;  3DTK A;  3SYT A;  5GAH J;  1IXS B;  3ZMZ A;  4FE7 A;  1T8I A;  4AM3 A;  1ZG3 A;  2Z9O A;  1T2K A;  3ESW B;  3M8E A;  1VQ9 I;  3OYI A;  3LSI A;  3GX4 X;  2DI3 A;  2WAE A;  1CF7 A;  2LVS A;  2M1B A;  2CSO A;  3FXR A;  1HLV A;  4KIG A;  2OPT A;  2M7A A;  4GDF A;  2DW4 A;  3IAM 2;  2X48 A;  5HS9 A;  5EGO B;  2XF5 A;  1XSX A;  3WU0 A;  1VQK I;  1P92 A;  1FIP A;  2ZXH A;  1XSV A;  4DOZ A;  2CYY A;  3GW2 A;  1VFC A;  2JT1 A;  2R5Y B;  3WU2 C;  2OF7 A;  3LSR A;  1EH8 A;  2CQN A;  3KP6 A;  4B3A A;  2EB7 A;  5F08 A;  5HOO A;  4KIS A;  5CPR B;  5E79 C;  1ULY A;  5LFA A;  2ZFU A;  4LK1 F;  1TQM A;  1JUM A;  3TW6 A;  3GZ6 A;  1SMT A;  1YLF A;  3NAR A;  5EEG A;  3WHC A;  5DUI A;  1AWC A;  2E35 A;  2JSC A;  2L3D A;  4DYR A;  5IT9 Z;  4HDV A;  5B1B H;  2AXL A;  3CF2 A;  5M5Y J;  4LJZ F;  2MH9 A;  4GXO A;  1K6O A;  4CCO A;  3RQI A;  1BW6 A;  3NWT A;  2YU9 J;  4OOI A;  4IRI A;  1IV8 A;  4AYB A;  3CTA A;  1BI1 A;  3CUQ C;  1LDJ A;  3ZQH A;  1ETK A;  2COM A;  1X2N A;  5EZH A;  2HTJ A;  4AID A;  3WTW C;  3KP2 A;  3TBI A;  4HAM A;  2CQK A;  1LDD A;  1O3T A;  4EM0 B;  3GZN B;  3W2V A;  1CQT A;  2A6E F;  2PMZ N;  2QLZ A;  4FAS D;  4A0Z A;  1YI2 I;  2DOD A;  3R60 A;  2HYJ A;  5CKT A;  2NS8 A;  2LBF B;  2ID3 A;  4MQV A;  2RNG A;  4HQE A;  2XPV A;  1MJA A;  3KZZ A;  1UEL B;  3C18 A;  3IWZ A;  2FSW A;  4C2U A;  4LGW A;  2A68 F;  3B6C A;  3H5A A;  3RZO J;  4ZZL A;  4BH9 A;  4DIQ A;  1X3W B;  3N97 A;  1HBX G;  1SFK A;  1U5T C;  3H9G A;  4KMU X;  1K4S A;  3RTR A;  1QZZ A;  2E34 A;  3P9C A;  2TCT A;  4ANJ A;  2F5E A;  1QHG A;  5EG0 A;  3FMS A;  5F04 A;  1PP7 U;  3P7N A;  1BBY A;  3PFI A;  1VF9 A;  5F0C A;  4XLF A;  2VJ5 A;  1YTY A;  5TGT A;  4UUS B;  4G7Z F;  1QRY A;  3MAJ A;  1CGP A;  1MNM C;  3A0B C;  1A6I A;  2WC2 A;  4JYK A;  2M0C A;  2Q2E A;  4D7N A;  5GP9 A;  4L9J A;  2FOW A;  3JRH A;  2L7K A;  1VQN I;  5E20 A;  3I53 A;  3LAP A;  4BU2 A;  2E1M B;  3OR2 C;  1V5E A;  3PFY A;  1R6R A;  4Z6Y A;  2VUM J;  3JSO A;  2IJL A;  5BQT A;  2A07 F;  2OC6 A;  4E7H A;  3F3X A;  4FX0 A;  5E3N A;  1J9I A;  3WTS C;  3LNQ A;  4A2U A;  1FPQ A;  4I09 A;  3QPS A;  4UVB A;  2H09 A;  2H1K A;  2L9N A;  2RQQ A;  4IX7 A;  2PLY A;  2F4I A;  2V9V A;  4UUV A;  3DP7 A;  4IHT A;  4BJ6 C;  2R5Y A;  3O8H A;  3EET A;  5LRR A;  1OCP A;  1FNN A;  2DOA A;  4IF4 A;  4BAC A;  1RKT A;  1WJB A;  4UVA A;  2EV6 A;  4IXA A;  3FXM A;  1VTN C;  1RUN A;  2K9M A;  3CC2 I;  3HG9 A;  1ORK A;  1ZAR A;  1IW7 F;  1B8I B;  3FXQ A;  1LE8 A;  1Z77 A;  4BY1 J;  4L9V A;  2DA3 A;  2Y9Z A;  4XKW A;  3QQA A;  2KPM A;  2QSF X;  3FXO A;  1LFP A;  3AL0 C;  2E2J J;  4EGZ A;  3I4M J;  5ERI A;  2MBF A;  3E3V A;  4P96 A;  2DMQ A;  5D5V B;  2A05 A;  2XPU A;  1V5G A;  4ZC3 A;  2XIG A;  1Q1V A;  3E5U A;  3JW4 A;  5D4R A;  1EA3 A;  1MW7 A;  1OYY A;  3WE2 A;  1AHD P;  4HST A;  2L7F P;  2FNA A;  4PSX A;  1XGM A;  4BDY A;  1MND A;  3GEZ A;  3QOP A;  4OAY A;  1E2X A;  4A12 A;  4FHT A;  1MMN A;  5JR3 A;  5FLX Z;  3HDD A;  2R92 J;  1LUJ B;  5DEQ A;  3DBL B;  3I56 I;  2XGD A;  3ZMV A;  2E71 A;  2LBF A;  2QF7 A;  1JE8 A;  3C2B A;  1R00 A;  5FRM A;  2YX4 A;  1T0F A;  2E1O A;  2FX0 A;  3F8N A;  3QU3 A;  3UNG C;  2A6H F;  2DO7 A;  1XDS A;  2NS0 A;  1T38 A;  2D45 A;  2EWN A;  2MA3 A;  5H6R A;  2WAQ A;  1RIO H;  4LIV A;  1SD4 A;  3JSP A;  2Z33 A;  2QEX I;  2XAG A;  4KFC A;  2LD5 A;  1ETX A;  2IRF G;  5LBQ A;  5IP6 A;  4M3D A;  1SD5 A;  3DKY A;  2CW0 F;  4XNF A;  2IEK A;  2ZJQ F;  2VLA A;  1USS A;  1EH6 A;  3FM5 A;  3CC7 I;  1JHF A;  1R5H A;  3G2B A;  3H0G J;  4GYI A;  3W3C A;  1UAA A;  4DJA A;  4XN0 A;  5J8F A;  2ZME C;  4RAZ A;  4UUS A;  3DBR B;  3I59 B;  2Z2S B;  3ECO A;  2BHZ A;  1YJN I;  4IHY A;  3NEU A;  3U21 A;  3QOD A;  1JKP C;  4A5M A;  4S05 A;  1VQ8 I;  2K27 A;  3S16 J;  1HXD A;  3IRQ A;  2MH2 A;  1J0R A;  1RPW A;  1OCO H;  2LRE A;  3H1C A;  3P9K A;  3ZN1 A;  1ZN2 A;  2XRN A;  2IS1 A;  3NQO A;  3IH3 A;  4MLO A;  1MMG A;  4ON0 A;  4J19 A;  3WTT C;  4EJV A;  3S2H J;  3BY6 A;  2VBZ A;  3DKX A;  3J81 K;  2RC4 A;  1Z21 A;  4WCG A;  4AVZ A;  4E7K A;  1MBE A;  3ABU A;  3K2Z A;  1R1V A;  3PO2 J;  3LMM A;  3RDI A;  4AWX B;  4E7J A;  4DGW B;  4KIF A;  2Y69 H;  2XKP A;  4YIF A;  4MHG A;  3C2G A;  1MDM A;  3GF2 A;  4L0Y B;  1B1B A;  4CHU A;  2L9V A;  1FT9 A;  1APL C;  5CYV A;  4HQM A;  2MFZ A;  5CLS A;  3PO3 J;  2BV6 A;  4IKF A;  2VKV A;  1PJR A;  1A36 A;  4ITV A;  1B8I A;  2IBD A;  3S93 A;  2JUG A;  1XMA A;  4E7L A;  2V7F A;  4P5O A;  1T39 A;  4I99 C;  2CW8 A;  1R5I D;  3HTS B;  2DTR A;  5FFZ A;  3IC7 A;  3PNT A;  2H8R A;  3FHN A;  3LAJ A;  1MKM A;  1JGG A;  1UG2 A;  3RKW A;  4RB3 C;  4BBS J;  4LLL A;  5DD4 A;  4B09 A;  2JN6 A;  2BBY A;  2UXX A;  1UST A;  1HQC A;  1KQ8 A;  1TT5 B;  2DMN A;  2HQ5 A;  5F0F A;  2E19 A;  2O7O A;  4XID A;  1DQU A;  4OAZ A;  3OYE A;  2ESH A;  4BEH B;  1X1P A;  2HEO A;  3QRF F;  2XAU A;  2VON A;  2FRH A;  2Q0O A;  4GCV A;  4Y4R A;  3P9I A;  1SAN A;  2OV7 A;  1U3E M;  4HX4 A;  5HDG A;  3K70 D;  4F55 A;  2IGK A;  1HKS A;  2X9D A;  2DN0 A;  3QYE A;  2VXZ A;  2JA5 J;  3M9A A;  2HU9 A;  3S1M J;  4CA0 A;  2N8G A;  4XRS A;  1FMV A;  1MMD A;  2Y9Y A;  3HC7 A;  5IYC J;  2MD0 A;  3HKZ A;  1YYV A;  1JJ8 C;  4RAF A;  3I71 A;  3K10 A;  4HLX A;  3OYL A;  3JRI A;  4UV8 A;  3H9J A;  3PSF A;  3O2P E;  5K7Z A;  1KON A;  5FRO A;  2IT0 A;  4A6D A;  3ZR8 X;  3OMY A;  3F23 A;  2H6C A;  1B72 B;  2IXS A;  3I5U A;  5FO5 A;  4I7H A;  5JLW A;  2ISZ A;  3JRA A;  2DMP A;  3TQN A;  4IOC F;  3I59 A;  5C3E J;  1QZE A;  2OTL I;  4HEA 2;  3FDY A;  3LA3 A;  4CO8 A;  4ENJ A;  2ELK A;  1S7E A;  5E1X A;  1OYW A;  1HSJ A;  4Y3O A;  2R7U A;  2HVS A;  4ZH4 F;  3HM5 A;  4CSW A;  2IAI A;  2BW3 B;  3RZD J;  1TQP A;  4PJJ A;  1FP2 A;  5K5O A;  5F1J A;  2W4S A;  1WJE A;  3B73 A;  3D0S A;  2LYC A;  3BR3 A;  3QP5 A;  2LG4 A;  3F8M A;  4CCM A;  3J7Y J;  4RB0 A;  4IEJ A;  1YE9 A;  4CCN A;  2L4A A;  2FA5 A;  4NUB A;  3SHF A;  1TTY A;  4M6V A;  1OQY A;  4B43 A;  4PZJ A;  2WWY A;  2AS5 F;  4FQG A;  1B59 A;  2GXA A;  1WCM J;  2NS7 A;  4A5N A;  3WE3 A;  2ECB A;  1NG7 A;  2R4G A;  3LFU A;  4G6Q A;  2R7T A;  4CDG A;  5KCM A;  2ZKZ A;  4LD5 A;  3CCR I;  2X6O A;  1DGR M;  5J8C A;  4HOB A;  4A3C J;  4XLE A;  1FC3 A;  3VYT B;  3GTO J;  1SFU A;  5L3B A;  2GXG A;  1R1T A;  1FIA A;  5GPA A;  4BXU A;  3IL2 A;  3ASN H;  1VI0 A;  3O6B B;  1ZAO A;  2RNJ A;  1V3F A;  4IHS A;  2VOO A;  2JRM A;  1H88 C;  3L1P A;  3HYI A;  2GA2 A;  2HYG D;  5D6E A;  1UB9 A;  4ZYH A;  2PN6 A;  2JA7 J;  2VPL A;  2HGC A;  1OIS A;  4F93 B;  2OU2 A;  3GWZ A;  4J01 A;  1NK2 P;  5KHD A;  2XB5 A;  1SAU A;  1ETO A;  2QVO A;  3HXL A;  4BEH A;  3W2A A;  1R23 A;  2JUC A;  2TDX A;  2A69 F;  2HS5 A;  1S8N A;  3DLA A;  4RAY A;  3RKY A;  1OMI A;  5BMZ A;  5M5X J;  1R49 A;  1H9T A;  3QOE A;  4DZJ A;  3O8G A;  3HHG A;  1OCZ H;  3BPX A;  4V2G A;  5BS6 A;  4BY7 J;  3BT9 A;  1HDP A;  1AKH B;  4D9J A;  5E3M A;  3A03 A;  1O3S A;  3AG1 H;  3RSN A;  1S72 I;  1X1B A;  1XCB A;  3LA2 A;  2QEN A;  3ABL H;  3I4P A;  2R7Z J;  3LFK A;  3F21 A;  5DS9 A;  2IGM A;  4IHX A;  3U1D A;  3K69 A;  3V7S A;  3RI4 A;  2LFB A;  2F48 A;  1E3P A;  4NBQ A;  2R7S A;  3ABK H;  1RES A;  4O5V A;  4BQQ A;  4FTH A;  2DQL A;  4R1H A;  4XR6 A;  1KYW A;  1HC8 A;  3CP8 A;  4JK1 X;  3BTJ A;  4C3J J;  4N9H A;  1DU6 A;  2CFX A;  2BXY A;  4M9S A;  5IOY A;  4QPO A;  3AKZ A;  4L9T A;  1TP4 A;  5HNH A;  2BW3 A;  1F9N A;  1ON2 A;  4I6Z A;  5HLH A;  1ZR2 A;  2CV0 A;  1MBG A;  2DK5 A;  2B63 J;  3TOB A;  3D1N I;  1FYM A;  5JHF A;  2R7Q A;  4XOT A;  5K7F A;  5IYD J;  4XBF A;  3S15 J;  5LD2 C;  1IRG A;  3PQJ A;  4L5J A;  3GME A;  4O6J A;  4CCJ A;  3JRD A;  1RKW A;  2EZK A;  2RV8 A;  5CVJ A;  5K5Q A;  2WY8 Q;  4I01 A;  5J6X A;  3CC4 I;  1ZKG A;  1ZHF A;  3V8K A;  4KYW A;  3JTH A;  2EA4 A;  2EZH A;  1U9N A;  4UB8 C;  1XTA A;  5D4S A;  2BXZ A;  2LLK A;  3EQL F;  3L7W A;  3IAS 2;  2L02 A;  3E1S A;  3IHU A;  3NAU A;  1RC9 A;  2LMD A;  4MO7 A;  3C1D A;  1YRN B;  2VC0 A;  3LST A;  3Q0W A;  3KEO A;  1IXR C;  5L3D A;  2GAU A;  4QPQ A;  3MCZ A;  1IV6 A;  2I10 A;  2E1N A;  1MJ9 A;  4C2M J;  3CMY A;  2PMZ A;  3OS0 A;  5DD8 A;  4U0W A;  3OYK A;  2KIF A;  1S29 A;  3LSG A;  5HDK A;  3FXJ A;  5CVR A;  1IF1 A;  1BI2 A;  3KZI C;  3D5S C;  1HCR A;  1FBU A;  2Z1D A;  1HDD C;  1N75 A;  1V4R A;  3MZH A;  2DA7 A;  4N9I A;  3R0A A;  1JI8 A;  4E4H A;  1ETV A;  4HNV A;  4HDU A;  4ZYE A;  2CV1 A;  2DOE A;  2KIM A;  5FKM A;  3BZ6 A;  2DFH A;  2V1D A;  3WGH A;  1J2X A;  2GWR A;  2QUF A;  1WI3 A;  2LH9 A;  1G3T A;  2DK8 A;  2GQQ A;  1LFB A;  2M7B A;  2M87 A;  4YEL A;  1GDT A;  1YX3 A;  2QSH X;  1P7J A;  2GZW A;  4ZYA A;  2VOP A;  1AKH A;  1N25 A;  1UHM A;  3FKJ A;  1JUP A;  4QWQ A;  3GTJ J;  4M9X A;  2P8T A;  3BG3 A;  1WRJ A;  1R1U A;  3GFJ A;  3NRV A;  3QYB A;  5DV5 A;  3L2W A;  3C3W A;  4BJ5 C;  4V19 K;  3ZQI A;  3WTV C;  5DDG A;  2D1H A;  2W24 A;  2W48 A;  1SD7 A;  3BQZ A;  2F4M B;  3C2H A;  3GBG A;  4IO9 F;  2HI3 A;  1C0W A;  3G73 A;  4QSH A;  4YFX F;  5LGN A;  1HKQ A;  1WI9 A;  4XKB A;  2PI0 A;  1HKT A;  4DYC A;  2ZBK A;  1J5Y A;  2WA0 A;  4XLH A;  3CP2 A;  3MN2 A;  1Z3X A;  2H1L A;  1I50 J;  2AHQ A;  4YG2 F;  2LY1 A;  2ELJ A;  4ZYG A;  3LOC A;  5FKN A;  1P4X A;  1G8X A;  4OIR F;  4G6T B;  3AG4 H;  2EK5 A;  1QPI A;  1QA6 A;  3QP6 A;  2KDZ A;  4Y33 A;  3A1Y A;  3HEF A;  1R71 A;  4KNY A;  1VZ0 A;  1QO0 D;  2R3S A;  2OAZ A;  3DQV C;  3HOU J;  1ZRF A;  1U5T B;  5BNG A;  2E36 A;  2EFN A;  2NVX J;  1YFH A;  3G1L A;  4CXF A;  3H0D A;  1WHU A;  3DTE A;  1TQI A;  2XAQ A;  4PJN A;  1YX5 A;  2L2O A;  3BJA A;  2MAB A;  3KP5 A;  3E6M A;  5ICC A;  1BW5 A;  4XM3 A;  3I54 A;  4A0Y A;  4J00 A;  1X19 A;  3WG9 A;  2EFO A;  2UV1 A;  3BPV A;  1Z9C A;  3BTL A;  1JT6 A;  4AD9 A;  3J7A Y;  1YOV B;  5H2F C;  3M1E A;  1K7A A;  4ZJZ A;  3CO6 C;  3G71 I;  4DBR A;  2FQ3 A;  3CME I;  2KFD A;  1UG0 A;  4BXF A;  3A02 A;  1BC8 C;  2E5Z A;  2QCO A;  3TL4 X;  5HLT A;  4WWC A;  1YRN A;  3FMR A;  2XSJ C;  3HOY J;  4PFP A;  2LSO A;  3M8F A;  5GAD J;  2CQX A;  5KAF C;  3E7L A;  1IN5 A;  4LG3 A;  2R7W A;  4NC8 A;  2O8X A;  1Z6R A;  4HX8 A;  2P81 A;  2HQN A;  4EVI A;  1FOW A;  2XGE A;  2MW8 A;  1ZQ3 P;  3DU6 A;  4LB5 A;  3I55 I;  2JSP A;  4NB5 A;  3W6K B;  4ESB A;  4ENM A;  5DYM A;  4KIT B;  5E3O A;  3S1N J;  3LSK A;  4X6A J;  3KPH A;  1WJD A;  4IQ4 A;  2ZJR F;  3CF5 F;  4N4O B;  1IAW A;  2P4W A;  3VYS B;  4QLC U;  2A6T A;  2BY1 A;  3E0J B;  4BUP A;  4E7Z A;  3BOQ A;  3K0L A;  1TNS A;  2PBI A;  2IPQ X;  1LJ9 A;  2HZT A;  4KUM A;  2H8W A;  1SC7 A;  2GA1 A;  2HDD A;  1ACI A;  3IRR A;  3KP4 A;  2QGU A;  4OIQ F;  1PUE E;  2Y0S N;  4OIP F;  3LSM A;  1YS7 A;  3CJQ B;  4BDZ A;  5D5U B;  5FLX K;  1EJ9 A;  2XRO A;  1BR1 A;  3A2K A;  2W7N A;  3M8J A;  4B4C A;  5LEK A;  3VOE A;  2FEZ A;  2B0L A; 
#chains in the Genus database with same CATH homology
 1OCR H;  1OCO H;  3ASN H;  2EIN H;  3WG7 H;  2EIK H;  3ABK H;  1OCZ H;  3X2Q H;  3ABM H;  3AG3 H;  1OCC H;  3AG1 H;  1V54 H;  2EIJ H;  2EIM H;  3ABL H;  3AG2 H;  3ASO H;  2DYR H;  3AG4 H;  2ZXW H;  5B1A H;  2OCC H;  5B3S H;  1V55 H;  5IY5 H;  2EIL H;  2DYS H;  2Y69 H;  5B1B H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...