3WG7H

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3wg7H00
3AG1H 2EIJH 5B1BH 2Y69H 1V55H 5B3SH 3ASOH 3WG7H 2OCCH 1OCRH 3ABLH 2EIMH 2ZXWH 1V54H 1OCOH 5IY5H 3ABMH 3AG2H 2EIKH 3X2QH 2EINH 2DYRH 2DYSH 1OCZH 2EILH 3ASNH 1OCCH 3ABKH 3AG4H 5B1AH 3AG3H
chains in the Genus database with same CATH superfamily
1AWCA 5H6RA 2EFOA 3FBNB 4Y33A 4RAZA 4UUSA 3E6CC 4FISA 3TO6A 1BJAA 3P9KA 4I7HA 2LVSA 1ON1A 1X1CA 4UY8I 1ETXA 3HDDA 3HZJA 4XKBA 3HOVJ 1I1GA 4OIPF 1HKQA 4BXXJ 1XSDA 2M0CA 2Y9ZA 2MD5A 4L5IA 3CUQB 3S17J 4G7HF 1HKTA 1SFEA 2R5ZB 1SC7A 2MYSA 3VPRA 1TQPA 3K4NA 3DWLE 2P5LC 4F55A 4XOPA 2ISZA 5LBQA 1PUFB 2ZKZA 2DCEA 2DW4A 4A3FJ 3EYYA 2XHKA 4DBQA 5L3GA 2CU7A 1XS9A 3BZKA 4LITA 2WAQA 1RESA 4A6DA 3CJQB 3KETA 2R7SA 3MKWB 2CQQA 4WF2A 3CJNA 4MTDA 4IPAA 4UV8A 2CFXA 1MH4A 3ZOBA 3L2UA 3X2QH 3HUGA 1LEBA 2OBPA 4MFEA 2QVOA 2KL4A 1WJCA 2AO9A 2XSJC 1YQAA 4LIUA 1APLC 1RC9A 1J0RA 2P6TA 3G3ZA 5IP9J 3DTKA 4LG0A 3QYFA 3PL8A 3EUHA 5LRRA 3WTZA 1O7FA 3T0YA 2DA2A 2EFPA 1FOYA 2W00A 1Y1WJ 2VODA 5M5YJ 1Y8RB 1WI3A 5J8FA 4PJJA 3CCRI 3W6VA 3J7AO 2L9NA 2LY1A 2HYJA 4KIBA 4PCQA 4RB0A 2QSGX 1JJ8C 2HOTA 1J7KA 3EETA 1FMWA 1M1EB 4AM3A 3AL0C 2W84A 2K3PA 2GIZA 1TT5B 4UV9A 1R1VA 1RKTA 1P4AA 4CCLA 3OSFA 2B0LA 2KRFA 2M4KA 3WGGA 4KT5C 1UHMA 2KKOA 2MSYA 1F9NA 1V4RA 1XGSA 3DKXA 4WX9A 2LF7A 1CF7A 1DDNA 3OYEA 4HA8A 1U78A 1R71A 1IN4A 3PFYA 3QOPA 1X1BA 5D8LB 3JAMK 2RC4A 5F1JA 2DA7A 4DBRA 3OY9A 5GTIC 2FMYA 4A3MJ 3KZIC 4MO7A 3LSMA 2VBZA 1FOXA 2UUZA 2FUG2 5K7FA 4GDFA 2ZJPF 1XMXA 2CJJA 3A0HC 1S8NA 4FCYA 3FBIB 3HB9A 3WTSC 2CQ7A 1DQUA 2X6XA 5F64A 2JT1A 1AA7A 4Z6YA 2O3FA 2KPMA 5DD8A 4D5FA 4ENJA 2VKHA 4U87A 2DBBA 1EA3A 3FXRA 1K78B 2NS0A 3OYMA 2CV2A 3QPTA 2KJCA 2L2OA 5JR3A 1JJ6C 3I55I 3M1EA 3DFGA 3GW2A 3IH4A 5LRSA 4MEXF 3WTUC 3IL2A 4KDPA 4BE0A 4OU0A 1YJ9I 1MBJA 1H88C 5J3LA 1K4TA 2IAIA 3B73A 1G2HA 2A6TA 4RAYA 1L0OC 2K9SA 3TOBA 4WWCA 2XSDC 2O7OA 4ZDOA 5FRNA 5BOXA 3KLNA 5IYCJ 3K2AA 3J81Z 3E1SA 3MZ8A 3HRTA 1MNMC 1HSTA 2RAEA 3I53A 3K4MA 5E1WA 1F36A 4Y4RA 4A5NA 1WVRA 4PK4A 2EB7A 1D0XA 1OFCX 4F92B 4C2TA 2NNNA 4UVCA 4RS8A 1TL8A 1MKMA 2RDPA 1SD4A 3QPSA 1IV8A 2XKPA 1R4NB 3L7WA 4IHVA 3WTVC 3HYIA 2F5VA 3BPVA 2MW8A 1Z3XA 5EEHA 9ANTA 1U6GA 1P4XA 4YIRX 1BR2A 3F8BA 3CCJI 1JKOC 1FEXA 3WGIA 4LLGF 2WAEA 2A6HF 2DJNA 5FLXZ 1RETA 3GLXA 3TGNA 4XQFA 3K70C 2DI3A 1EV7A 2R3SA 2HU9A 2H6CA 3OL3A 1IRGA 3BROA 4B48A 2K9NA 1ZTRA 1I3AA 4AIDA 1IF1A 1LE8A 4XRSG 1JTXA 1Z77A 4JX5A 3J7YJ 3CUQA 5IP7J 3SFZA 2R5ZA 3HOTA 2XGCA 1XGMA 4Y15A 3H5RA 3ONQA 1PUFA 2ELKA 1OCOH 1R22A 2FRHA 2ZJQF 2LLKA 3VYSB 5DCMB 1D1CA 3HKZA 3I3LA 3PO2J 2XRNA 1LNWA 3QQAA 4C30A 4YFNF 2ECBA 3DEEA 3ERED 1PDNC 1OQYA 3KLOA 1UZCA 4B1RA 1DGWY 2F5CA 3BG7A 3PIOF 1D3YA 3ZQIA 3MFKA 2YS9A 2OZUA 3MAJA 3HOUJ 4E7KA 3MEXA 2NVUB 1GHCA 4CYCA 1XG1A 5DV5A 5IT3A 1TWHJ 1FC3A 4YELA 4C3IJ 3GTPJ 2H8WA 1A04A 4BQOA 5DUIA 4CCNA 2DA4A 3JRCA 1BC7C 4HDVA 3LQQA 1K6YA 3HIFA 1T08B 2R7WA 4W97A 5BQTA 3OMYA 5LGUA 3GX4X 1ZGJA 2VPLA 2AXTC 3ROUA 2DXIA 1QA6A 5JLWA 2ID3A 3LQRA 4XRMA 3FXJA 2HVRA 3E6DA 4RDUA 3D0SA 1G8XA 2HQAA 1R5HA 2CW0F 2EIKH 3F6OA 3K1PA 3BTIA 3M9AA 4XORA 2B63J 4OIQF 3JSPA 4KMFA 1X2NA 2GOXB 3GO5A 1EF4A 4LLNA 3O8GA 2QQBA 3L09A 5M3MJ 4ESJA 5EF6A 2BVLA 2IS4A 2WWYA 1WJ5A 2LYCA 3BTLA 1O3RA 4OMZA 2A68F 5B1BH 5F0FA 5HOOA 5B5EC 2A5YB 2X48A 2NVXJ 4IOCF 2ZXWH 1YRNA 3DBLB 4LIVA 2LD5A 1SFUA 3SYTA 5E3NA 3CD6I 2O9LA 1HC8A 2F4MB 3H0DA 2EZIA 1A6QA 2QM3A 2EZHA 4UVAA 4P96A 5LGNA 1JKRC 1FX7A 4UB8C 1YJWI 1LFUP 3J80Z 4A12A 5F04A 5FFZA 2NAZA 2ZJRF 4D9JA 3GTOJ 4HV5A 2CGPA 1K78A 1SVMA 2PMUA 5D8KB 2ZBKA 4RBOA 5EZGA 1BIAA 2AHQA 5HLHA 2J5OA 4N0BA 2HEOA 4DYQA 4M73A 1U9OA 3Q5FA 3Q9SA 3WU2C 3Q9VA 2BEOA 2MD0A 1UJ8A 1G6NA 1KYZA 3TQNA 2MH2A 1BOAA 4YG2F 1X1PA 4XLFA 1BA5A 3RZDJ 1W5SA 3M4OJ 2BY1A 1RZ4A 1FOWA 2M7BA 1U5TB 3R0JA 1IRZA 1B9MA 1WH5A 2E1OA 3L2RA 3JW4A 3IKVA 1H9GA 2BE5F 3T8TA 1JGGA 2XDVA 3HTSB 2XROA 5ICGA 4AYBA 1H8AC 1BOBA 1DUXC 1MBFA 3ABTA 2K3FA 1BI1A 5K7HA 4OINF 3SHFA 4KNYA 2WAQN 4HSTA 2V6CA 1UCRA 3U1KA 4IVNA 2E36A 5HS8A 3BT9A 3WG9A 3E6BA 3BJAA 3G2BA 5BMZA 1J09A 3BR0A 3FMRA 4AUXA 2KIUA 3K70D 3CLQA 1VQ9I 3SZPA 2IS1A 2ZB9A 1BI0A 2K40A 5J4YA 4JYKA 3RKXA 3CCQI 4XLAA 5JFRA 4I6ZA 1ZG1A 2VPRA 4F52A 5M3FJ 4C2MJ 1W36C 4I2OA 2ESNA 2VBWA 4OMYA 2QBYB 1NK2P 1JHFA 1ZG3A 3I64A 3HBLA 1N77A 3HOWJ 4BJTA 1R7JA 1TW2A 4IHXA 5C44J 3VODA 1OCCH 5DM6F 3DU6A 5E8GA 2HQ5A 3K7AJ 1ZR2A 2HPIA 1HDPA 1B6AA 3GF2A 1ETWA 4L5EA 4EQQA 2OV7A 5F1RA 3S1NJ 4XRSA 4LB5A 1K7AA 5ILUA 4A3DJ 2Y9YA 3BQYA 3RJPA 4KYWA 4KMUX 2HGCA 2MFZA 5IT9K 2IW5A 3P5JA 3BWGA 3LMMA 4NC8A 1IXSB 2NVYJ 3BLYA 2R7FA 3I56I 4LK0F 4M3FA 2L0KA 3VB2A 1O3TA 2D2WA 3LFKA 4BY7J 2X6WA 3F8MA 5FKLA 2DODA 5EGOB 4NDLA 5D4RA 3A2KA 2R7RA 2OU2A 3HJEA 3H36A 1JT6A 4KIFA 2VXDA 2FD5A 2QQ8A 4DW6A 1WFXA 1FJLA 2GZWA 5E3LA 5CYVA 3AG2H 1VQKI 3NARA 4EM0B 4U0WA 4EGZA 1WQ2A 2H1LA 2HTSA 2VXZA 1IXCA 3ZPLA 2CO5A 4BXUA 4IOAF 4R8HA 2PI0A 3K6GA 5ERIA 1QZYA 2VI6A 1WKMA 5HNFA 3GYHX 3PNYA 4J01A 4XR6A 1RUNA 2Y69H 4IL6C 5HS9A 5FD5A 4B47A 3RIRA 3CQZJ 4KN7X 1P92A 2ZMEB 1FSEA 5HNHA 1W7PD 2VBYA 3S16J 2Y0SA 1GDTA 2O8KA 3S1QJ 2F5FA 3DBHB 3DLAA 3K0LA 2AS5F 5HDKA 3FISA 2E2IJ 2RKHA 2ZXHA 1IJWC 1B4AA 1OLTA 4LGWA 2R93J 4PFOA 2BV6A 2M7AA 1V3FA 4HSRA 2LR8A 1Y56A 3DPLC 5FKOA 1UHWA 3F6VA 4ESBA 1SFXA 1LDDA 1QBJA 2G9WA 1Z9CA 2R92J 4A3BJ 3DTEA 3DCFA 2FQ4A 4O6JA 2DMUA 2LKPA 3PUBA 1WHUA 1U8RA 4KUMA 1F4KA 1R1UA 3F8CA 3MZHA 1AKHB 3WODF 2KZVA 4GO1A 4NNJA 3H35A 4B44A 3IKTA 3GTKJ 1J5YA 3JRHA 1ZARA 4O5VA 1HBXG 2QCOA 4E70A 2W4SA 2Z3YA 4BE1A 4OAYA 3ZQQA 2JSCA 2FEZA 5EEGA 3HPGA 4DIQA 3N4MA 1UHSA 2E1MB 1T8IA 1TQIA 1ULYA 2Y0MA 2CYYA 4BBRJ 1RUOA 4M71A 1U5TA 3W6JB 1ZH5A 2Y2ZA 5TJJA 4XRFA 1X58A 2HI3A 1DP7P 1XB4A 4ENMA 2YU9J 2YPRA 1MIJA 3HKZN 3IAM2 5E8IA 3GTLJ 3ERMA 3KZZA 1VZ0A 3IUOA 4HLYA 1R36A 3I4PA 3VFZA 1IAWA 2DMTA 3K4LA 4B4CA 4HV6A 4XONA 3OS2A 3KYCB 3MKYB 2E1CA 4GCVA 2EIJH 3H3ZA 2EV5A 3B6CA 3MD2A 4EMSA 4KFCA 2VJJA 3ABLH 3R0AA 1J75A 3G71I 2HQRA 2BOLA 4XKCA 3CO7C 5FLXK 2VE8A 1NK3P 5D6FA 4XOTA 4XLNF 2YSRA 1I5ZA 1ETYA 4KITB 1EJ9A 2V1XA 4IQJA 3MCZA 2CW8A 2K5CA 3BCAA 1Z21A 4ZTFA 2ZNZA 1CGPA 1YOVB 5C4XJ 2CQKA 2IRFG 2F2EA 2DTRA 1UAAA 4GFBA 2EK5A 3QU3A 2IA2A 3L2WA 2L9SA 1GVJA 3PUFA 5C3EJ 4CCOA 3S8PA 1EH7A 4U7BA 4IO9F 1OYWA 4O3MA 1MNDA 5ICCA 4RLFA 2JUGA 4IZZA 5J8CA 2ZFWA 5K5QA 3TBIA 3WTXC 3TOAA 1T38A 5E20A 1Z7LA 1D1AA 2HNHA 4CHUA 1NG6A 1MMAA 2GQQA 4WXHA 1S7AA 3KP3A 2M8EA 4ITVA 1MGTA 4M6XA 1FOKA 1KQ0A 2FNPA 2XGDA 5LFAA 2JK3A 3EUAA 5IYDJ 2TDXA 1FMVA 1QNTA 3LOCA 4PGGA 4E6KG 3V8LA 3L2CA 4U88A 1L3LA 2DFHA 1C0WA 1WSUA 1AU7A 1Z6RA 2LSOA 5EGOA 3HRSA 1OKRA 1B8IB 1TLHB 1TWAJ 3LSHA 1D1BA 3N05A 1HA8A 4CUGA 5KAIC 2E19A 4S05A 1LE8B 3Q3SA 2Z1DA 1EH8A 3TW7A 1KZHA 1KONA 2XASA 3HOYJ 3GVAA 3K69A 3TW6A 3HGGA 3A0BC 1IDZA 1FYKA 2Q1ZB 3A1YA 3BOQA 1YFHA 3AG4H 3ULQB 1YITI 5FRMA 2EV6A 3AL0B 1A35A 1VFCA 3SDGA 2MC3A 3CCVI 1KU7A 3TKYA 4FASD 3L2VA 2L7ZA 3FF5A 2KJBA 3HG9A 4M3EA 3TP0A 3WGHA 2WY7Q 4CSWA 4LFUA 2QF7A 1HQCA 3F21A 3TP3A 3K1MA 2Z9OA 2Q2EA 3H5AA 2JZYA 3VSKA 2XC7A 2R7QA 2ZMEA 3HSRA 2GXAA 2M8GX 4EM2A 2MLKA 3FDYA 3ABKH 5HDGA 1O4XA 3JREA 5B1AH 3LNQA 1Z67A 1V5GA 3I54A 4CYCB 1YHQI 4EVIA 2IGMA 1YX5A 2JJ7A 2YX4A 3I58A 3GFIA 3KP7A 1I6HJ 1O3QA 2K4JA 2VOPA 5CVVA 1R23A 1LPQA 3OWTA 4F7ZA 3MN2A 3FM3A 5H6QA 3JRDA 2CSOA 5LHHA 1USTA 3DLLF 5K5RA 3G4SI 4AYBN 1MMSA 3FXLA 4NQWB 1ON2A 3V4GA 3KEQA 4EEFG 4Q5SF 2E7XA 2EILH 3KIOA 3J80K 2H8RA 1IDYA 3BR5A 2HKOA 2PMHA 3M8EA 2RGVA 4M72A 4ZYEA 1HW2A 2JVGA 2V79A 1IN6A 3BDDA 1AKHA 4G7ZF 1MH3A 5FLMJ 1FTTA 3ISPA 3U21A 4KICA 1LEAA 3QU6A 1YW9A 1G3SA 1STZA 4YEJA 3BQZA 4ZTJA 3SXYA 1AHDP 3HHGA 3QRFF 1DP3A 3DEUA 4BQAA 3D5SC 3B02A 1P7IA 3KFWX 1A5JA 3PO3J 2BY2A 4BY1J 3TEDA 4HQEA 2H09A 3GTQJ 4BGDA 3QWLA 3DPTA 4LOCA 2ME6A 2IXSA 3L9FA 3CO6C 4CYDA 1R00A 2KLOA 2X1EA 1QZZA 3JRGA 1XDUA 2M3AA 3QAHA 2OC6A 3WHBA 1TNTA 4RGSA 3K10A 1WCMJ 3KYLA 2ZNYA 1E2XA 1YRNB 2OTJI 4B8XA 5E3MA 3CCMI 2IT0A 2YU3A 1ZRCA 1F1ZA 5JVTA 1K79A 1T6SA 2WB1A 1ETKA 3S14J 5H2FC 4UNOA 1SMYF 1ODDA 3GTGJ 1FPQA 4F91B 3W2VA 3SFIA 4C3HJ 2R5YA 2VJ5A 1T33A 2IS2A 2V9KA 3PQKA 1J2XA 1VQ7I 2DMQA 2ID6A 1KU2A 2COMA 1S29A 4BXFA 1KA8A 4BU2A 1X19A 3F72A 3KEOA 4Q4ZF 5J4VA 1LQ1A 4II2A 4BQQA 1H9TA 2D45A 4CCJA 1BIBA 3U2RA 1S6LA 5E1ZB 1J9IA 2DOEA 2LDUA 3V8JA 5CQEA 1ACIA 3HGYA 1FWZA 5JLXA 5FROA 1KYWA 3GFMA 2FU4A 1VNDA 1QO0D 4KJZA 1IN7A 2VLAA 2LY9A 4KISA 3FXKA 3K1NA 3M3YJ 2E7WA 3DV8A 5BPDA 3JRAA 2IVMA 3RQ4A 3U1DA 3S2HJ 3HOZJ 1O7LA 1K6OA 1X1AA 3KCCA 2FXAA 2ICWG 3SQNA 4MNUA 3LA7A 3VWBA 3TL4X 4HNUA 2XF6A 2PEXA 3BP8A 2M0MA 1NG7A 2Y0SN 1B8IA 2KHMA 3CP2A 5H20A 1U3EM 2M30A 3VSLA 2JA7J 2DK5A 2ELJA 3PNVA 1R5ID 3CCEI 1ZR4A 1IO2A 4CO8A 1B9NA 4QIWN 2E71A 3V7SA 4WCGA 1X4OA 3LFUA 4R79A 3F8NA 4HEA2 2HXIA 3HSEA 2VOOA 4XLHA 3FM5A 4ZYGA 4MHGA 3LSKA 1S7EA 1JE8A 1MBHA 4P5OA 5E3OA 4XIDA 1Y1VJ 2I8DA 2DA3A 2VC1A 4HOBA 5DCFA 4YIFA 4HNVA 4RB3C 3UKGA 1Z0XA 3GZ5A 2F6CA 1WPKA 4XN3A 1U8BA 4BL0B 2W25A 2FMLA 2MLGA 4AIHA 2KDOA 3OYNA 1P4WA 5LEKA 4FX4A 3BTJA 4I99C 4I76A 4AVZA 1F5TA 2GIVA 2OPTA 2R4GA 3SEZA 2NVQJ 1XGOA 3IHUA 2AQEA 2JA5J 2EV0A 2XB5A 1YS6A 2EJRA 3KP6A 5CPRB 4ASNA 4D0PA 1ORKA 4IHYA 2IJLA 3A03A 4UB6C 5CJ9A 4KA4A 2GLOA 3VEPA 4U7DA 2OUMA 1LFBA 2OA4A 2EFNA 3WU0A 4AD9A 4RGRA 2L02A 4A3LJ 2BW3B 3GCMA 1BN5A 2EZKA 5IPAA 2QYOA 4MQ9F 5GP9A 4RLQA 2XAHA 3RPQA 4NQWA 1E3HA 1R9TJ 1XCVA 2FA5A 3S93A 1REPC 2XAFA 5A2QZ 2X9DA 3O2PE 2LRDA 2EA2A 2PMZA 1EKEA 4BHPA 1SANA 1MDMB 3HTUA 2X0LA 1RNLA 2QQ9A 3BG5A 1E3OC 3A02A 5D4SA 2VL8A 3QOEA 3LSRA 2CV1A 2R7TA 2QEXI 4CGZA 3BPXA 1FSHA 1YE9A 2ETHA 2X6YA 4A0XA 4MEYF 1X3WB 2FBIA 1XN7A 2H94A 2M34A 1OR7C 1R58A 2RQPA 1R6RA 2Z2SB 2L9RA 5DD4A 1ENHA 2CW7A 2PN6A 3F3XA 1VQ5I 3HC7A 1QHGA 4HF2A 2DTZA 1S5LC 3PIPF 5J1UA 3LA3A 4I09A 3BZCA 5L3BA 4HZFA 3OYBA 3C2BA 3BZ6A 3W2AA 3FMQA 4Y17A 2EFWA 4A3IJ 5J6XA 4IEJA 1E3PA 1XGNA 3CMAI 1MBEA 2YX7A 1D0YA 5K1YA 1FYLA 1SAXA 4GRIA 1MD0A 3FXMA 3I59B 2HYFA 3KEYA 4IRHA 4JX4A 4HYEA 2P5KA 4UUVA 3C3WA 2CWEA 2DOAA 4KIGA 2X51A 3GZ6A 2TCTA 4XSXF 4E4HA 3DXJF 5D5VB 2CV0A 1T0FC 1V54H 2F5EA 3G1LA 3HRMA 1VQLI 5DS9A 5CLSA 2YR2A 2FX0A 5F0CA 4XLCA 3MQ0A 3ZMSA 2IPQX 3OOUA 1WZ2A 2X4HA 2O0YA 2XUBA 1S72I 4I98B 3RYPA 1HW1A 4M9ZA 3RZOJ 5ICEA 3ZR8X 2DA5A 2JQ7A 2L4AA 3C7JA 3T5XA 2B7EA 1ZRFA 3CCSI 4G6DA 5BNGA 2V7FA 1MBGA 2HZTA 2IS6A 3RCOA 4QTRA 5IP6A 3GFJA 4HRIA 4CZCA 3ZMZA 4HPQA 5FJ8J 1W4MA 3VDXA 1DU6A 3ELKA 4PUSA 4M3GA 2QKMB 2NS8A 4RM2A 2VE9A 5J40A 2PFBA 3G6EI 2DAOA 5TRDA 3OSGA 2RREA 1XMAA 3NAUA 3JAMZ 4DJAA 3CMEI 3EYIA 1BC8C 3LAPA 3CC7I 1XX5A 2VUMJ 4ANJA 1X2MA 2CMPA 4UVBA 1KU9A 4JOMA 3HOSA 3ZMDA 4Y7NJ 3S15J 3F0CA 3JCUC 4ON0A 2L9VA 4P55A 3U9GA 3ZQLA 3FXOA 4RAFA 2K9MA 5J1RA 5HLGA 2P8TA 3OYLA 2DFEA 5GAEJ 1SD7A 3L00A 4J00A 1FIAA 2OCEA 1W1WE 3ECOA 4HAMA 3E97A 1ZLKA 2JRMA 2L7FP 1LDJA 4UUTA 5ILVA 3FKIJ 2DQLA 1BJZA 2XIGA 2G0EA 1FBUA 5F27A 2EH3A 4BHCA 2NYXA 3BJ6A 1QPMA 5DM7F 4OWRB 1IRFA 1A6IA 4RB1A 5B3SH 1MSFC 4G12A 3T1BA 3OYHA 2BY3A 2IA0A 3ABUA 2EA4A 2LKXA 2OQGA 2NOJB 1VQ6I 4LMYA 2KP6A 1PYVA 1UG0A 2GA1A 4GYIA 3S2WA 3W6KB 4XICA 5GAGJ 2HR3A 2AQFA 4RGUA 4I0BA 2QGUA 2CG4A 4PFPA 5K5OA 6PAXA 1GVDA 3RKQA 5HLTA 3GUDA 1V5EA 4XKWA 2XB0X 4QPQA 1U9NA 1Y0NA 2P6SA 2BZTA 5D5XB 1F43A 3KE2A 3SJMA 3PSIA 4FX0A 4XSZF 1Y39A 2BW3A 2ESHA 3HPHA 3GTMJ 3CJRB 4H0EA 3KPHA 3HM5A 2KIQA 4AVPA 3ZMUA 3CJTB 5EDNA 2K4BA 2P81A 2WB1N 1QVUA 5LD2C 3BR1A 3IRQA 3OIPA 1RKWA 5L3DA 1QZEA 4CDGA 4NB5A 1MDMA 3ASNH 1ZLJA 3IWFA 3M1CA 1ZAOA 4IKFA 2WA0A 4HQMA 1WI9A 3BY6A 5KK1A 2IGKA 5ED4A 4PJMA 5HVQC 5CVIA 3I0TA 1OYIA 2Q2EB 4NUBA 3DKWA 5LEJA 3IH3A 2P7VB 4CCKA 2LH9A 2V4JC 2DT7B 4B3AA 2ZXIA 2JN6A 4L0YB 3OV8A 5EZHA 4Q47A 5GAHJ 1JGSA 4I01A 2R0QC 1H89C 2KQRA 1I27A 4B09A 2E2HJ 1QQIA 1LVAA 2DK8A 2WY8Q 4RM3A 1NH3A 3GLLA 5AONA 1D8KA 3JTGA 5EYRA 3I59A 3RYRA 1ZK8A 2MG4A 3RPUA 1JI8A 1YLFA 3D5RC 4NC6A 4I0AA 1MW7A 2LNBA 5IOYA 1KQ9A 3FHNA 3JSOA 2XAUA 5J1YA 1W0TA 2OQRA 4BKXA 5D5WB 1D0ZA 1LB2A 3ZXSA 1S9HA 3H92A 4V2GA 4L18B 2DYSH 1RPWA 4M9SA 4NC7A 2L4MA 4G6QA 3TO9A 2PG4A 2TRTA 2CFOA 3ZQ7A 3V7CA 4ZYDA 2CH0A 3E5QA 1MJ9A 2I5UA 2G7UA 2JTVA 2XAGA 5DTDA 1RIOH 1ZN2A 5GTHC 5JHUA 3J81K 3H9JA 2XF5A 5CQGA 2ZSIB 2HQNA 1OCTC 1I1SA 2XRLA 1NHAA 3H0GJ 1G59A 2WV1A 4BH9A 3OYDA 4H4KC 4QPOA 1WRJA 2CUFA 1MBKA 5IYBJ 1UMQA 4IHTA 1B1BA 4WXDA 4CA0A 3LWFA 2Z5UA 4EATA 3D5LA 3OYKA 1BR1A 3RDIA 4IHSA 2O61A 2ECCA 4FTHA 4L0ZB 2PX9A 1YG2A 3MWMA 1H0MA 3M8FA 2XVCA 2DFFA 3JRBA 2STTA 2R5YB 4ZZDA 4DNCA 1HF0A 2ME0A 3E3VA 1P9QC 4MGRA 3F9KA 3V7RA 1IN5A 3LSPA 4ZYAA 2COBA 1FTZA 2E2JJ 4JP0A 2ZCWA 3QPLA 5EEAA 2WAFA 3VYRB 1XTAA 3DF8A 3EUHC 4CXFA 1K61A 2M5WA 3FZVA 4MQVA 1T2KA 1E0EA 1SVOA 2FOKA 3H9GA 3BR6A 3ZQFA 2W48A 1Z1DA 3OOPA 3ZN1A 4JX6A 4AIKA 3C18A 3DTIA 5LHIA 2LTPA 2FQ3A 3F23A 1MSEC 4ZJZA 2NRAC 2R7DA 2MGQA 3IWZA 1R5GA 3LSGA 3S1MJ 1K4SA 1ONVA 3G1OA 3ML6A 2L3DA 4A0YA 3I71A 4XNFA 4DYRA 4BJ6C 1YTYA 2FF4A 5CKTA 4EJVA 3RTRA 3ZQCA 3PFIA 1FLIA 3Q0VA 3TO7A 2ZC2A 2JRTA 2KT0A 1U2WA 4G7OF 3J7ZI 1QHHD 1VQPI 1YYVA 2CRGA 3FK7A 1WJFA 5TISC 3RKYA 3WE2A 2OCCH 3H1CA 4G9YA 3CDIA 3OYFA 1ZGAA 4ZDPA 4YFKF 3KZYA 1J59A 1LJ9A 2DMNA 2IGOA 2A61A 3BTCA 4C3JJ 2DOFA 2RN7A 1QPIA 2AXLA 2ZFUA 1SVLA 4ZDLA 2DJIA 3C2HA 2M45A 4U0VA 2KIMA 5M5WJ 1ZREA 5A2QK 3T8RA 1OPCA 2LF8A 3S3NA 4OIOF 1O3SA 4QSHA 2MA3A 1Q1VA 2O5RA 4OOIA 1U0JA 5KAFC 3HOXJ 1HCRA 1HOMA 2DN0A 3HSFA 4KT6A 3RI4A 4LB6B 3EDPA 1ETQA 2FNAA 2M4GA 3PM1A 1R4MB 4XN0A 1FP2A 4M6YA 2K85A 4XKVA 5HODA 1OISA 4A2UA 1HSJA 3GFLA 1I6XA 1P6RA 3CUOA 1UFMA 2KFDA 3G73A 5FO5A 1DPUA 4P1WA 1E17A 1V55H 2GAUA 2Y31A 4BBSJ 1ITYA 2LP0A 4E7JA 4P9FA 5FFXA 4N9HA 3V8KA 1TBXA 2QENA 2K27A 1IXRC 1OCPA 2HOAA 3DP7A 3H5NA 1T39A 4BAYA 1OYYA 1HDDC 5E1XA 2F48A 5IT9Z 1VQOI 2VONA 2E60A 1TWFJ 4HX7A 3M7GA 2JA6J 3OL4A 3L2QA 2VN2A 3CCLI 3OIQA 4D5CA 1DU0A 1SD5A 4L9NA 2L01A 1SMTA 2DMPA 1I39A 3QPHA 3QYBA 2XKOA 3V42A 1DGRM 3LSJA 1FT9A 4BE2A 4ZZLA 3CDLA 5BS6A 2PLYA 3ESWB 2QKLB 2VQCA 4E7ZA 5F08A 4BDZA 3G1MA 3UNGC 3NQOA 3P9CA 3PQJA 4BDYA 3CUQC 2HYGD 3FK6A 4KN4X 4V2FA 3FX3A 4HW0A 2K02A 2W85A 4FT8A 2YUSA 1XPXA 1MJBA 4YIIA 1W5CC 4HBLA 4M3DA 2L7KA 2RNJA 1FZPB 1YJNI 1D8JA 3TDZC 2DFIA 4Y13A 3PJRA 1P2FA 5D5UB 4EJOA 2NS7A 3O3KA 2ZO4A 1ZGWA 1Y8QB 1VQMI 1VQ4I 1ZRDA 2X1CA 2HS5A 1XSVA 2Z99A 1BM9A 2H1KA 1LFPA 4M9XA 1JUPA 4M6VA 2OF7A 3REOA 3IC7A 2Q8KA 1G3WA 3ABMH 1R49A 4GXOA 1KGSA 1X3UA 2EINH 3CZ6A 4XLEA 3O8HA 4D1QA 2GM4A 2K86A 2Q0OA 1IW7F 4X0GA 1POGA 1YIOA 5F6FA 3IAS2 2N8GA 2DO7A 4XM3A 3LAJA 1ZQ3P 4PJ0C 2LBFB 2JMWA 5L3FA 3E6MA 2L54A 2OJED 2A5WA 2DQRA 4HF0A 2LFBA 2BXZA 5GPCA 2UZKA 1QRYA 5FKNA 1HLVA 4AWXB 4F93B 2EZLA 2ISYA 3IRRA 2EQRA 3SZTA 2LK2A 3AAFA 3BG3A 2A6EF 2XAJA 1TC3C 2KMUA 2UWMA 1SEUA 3HRUA 2GWRA 4R1HA 5FKMA 1W5TA 4PDKA 2QWWA 3OYIA 4A3KJ 3S3OA 2XPWA 2W1OA 2KIFA 1IV6A 2IP2A 4MFDA 2XGEA 2KRHA 4OIRF 3ASOH 5E79C 4DGWB 3BC8A 4JBAA 3MKLA 1BW6A 3BJOA 4D7MA 1HW5A 2NOGA 4Q48A 5CVUA 4IHWA 3SEQA 2D5VA 1PP7U 3A01B 2M1BA 2WBMA 4DOZA 1IUFA 2PBIA 3GWZA 4C9YA 3WTYC 1UB9A 3ZCOA 5DDGA 2VKEA 1W0UA 3NWSA 2WC2A 5C4JJ 3OS1A 3AG3H 2HVQA 2IGNA 4YRVA 5L3EA 1G3YA 4A69C 5L3CA 2ELHA 1I50J 1GV2A 1IG7A 4XL9A 1T95A 2P7CB 1A36A 2STWA 1B72B 3CMYA 5EJCA 1ETVA 5FLVA 2JA8J 2NNYA 4IJAA 1Y0UA 1B59A 4Y52J 2V1UA 3I4NJ 2JPCA 2L5QA 3OR2C 3HL2A 2UXNA 4M3BA 3FXUA 1RRJA 4BNCA 3RQIA 5AIQA 3P9IA 2DT5A 4FETA 2ZJ2A 3UR3C 2CQXA 3C1DA 1R1TA 2IEKA 1XDSA 1S7OA 1OMIA 3GXOA 1W7PB 2JVHA 5M5XJ 1PJRA 2IBDA 2OD5A 1TT0A 3NRVA 4JQFA 1D5YA 3OS0A 3GTJJ 2HDWA 2ZSHB 4RB2C 2JSPA 3LA2A 4UXNA 1WJDA 2EPFA 3QODA 4ZH4F 3VYTB 4EV0A 4BUPA 1X3ZB 5EG0B 3BR3A 3VYUB 3FWEA 5FD6A 1I3QJ 3HXLA 4L9TA 3Q0UA 2FBKA 3AG1H 3DPUA 4AIJA 4J19A 4QWQA 1YI2I 2LMDA 3DQVC 5E17F 3CDHA 2K9LA 4RMNA 4MTEA 1V5FA 4N4OB 2BYVE 2RV8A 4XK4A 3E5UA 2KZGA 3I9V2 4PSWA 2X1DA 2VC0A 5DYMA 5ILSA 2PJRB 2V6EA 1TP4A 3I4MJ 3MVPA 1N78A 1ZG5A 1LKXA 2P0WA 1SAUA 2QQAA 5JI6A 3RKWA 2GA2A 3H3UA 4DZJA 2V9PA 1G3TA 3ZMTA 3KP4A 2ZXJA 1ETOA 1BBYA 4WK8F 1VQNI 3QP6A 4FQGA 2VT2A 1GLNA 2CQNA 1MZBA 1JUMA 2VJIA 2XPUA 3IP4B 1DPRA 3K4BA 4WXCA 4E7HA 3ZQHA 3W3CA 2FBHA 2Y30A 3OYJA 1K83J 1BR4A 1Z05A 4LG3A 4ZC3A 4A3GJ 4MLOA 1IUYA 2CS3A 1YW8A 2GXBA 5GPAA 1XC5A 3TMOA 4EM1A 2VQGA 1FBSA 3S32A 4AU7A 4E7IA 2FOWA 4BYYA 3BG6A 2VQLA 1TWGJ 5ICFA 2HDCA 2E5NA 1TWCJ 3P7NA 3RSNA 4DYCA 1O57A 3AFHA 4PJLA 2E35A 4G94A 4OAZA 3OYGA 1WJAA 4L9VA 4A0ZA 1UG2A 1FBQA 1TW3A 4U0YA 1BL0A 3CTAA 2LOOA 2R7ZJ 1KQ8A 1IRXA 2CUZA 2V1NA 2JUCA 4ZYHA 4IRIA 2LBFA 2EBIA 2CUJA 4PGHA 3M07A 5HDNA 2MBFA 2NVTJ 1QGPA 2FE3A 1N75A 1ZKGA 3KP2A 3EQLF 4Z2YA 2A07F 1PP8F 4G6TB 4N9IA 2VKVA 2BHZA 2PJPA 1ZHFA 2ADUA 4LD5A 1Y6IA 2MC4A 3FXQA 4BEHB 4X1EA 5HS7A 3R4KA 4X6AJ 2B9SA 3GMEA 5KNLA 5CVRA 1HKSA 5FB2A 3CESA 3E5XA 4BACA 3WG7H 4YFXF 3BR2A 3ZN0A 2EIMH 5JHFA 2DPUA 2R7XA 2F5DA 2KRCA 2VT3A 4BQNA 2BY0A 3R6SA 5KCMA 2DDAA 3CCYA 4QLCU 4S04A 1Z7UA 3FHZA 4ENKA 2QZ8A 4RA2A 3J7AY 2BHYA 3R60A 1SFOJ 2HPMA 1G4DA 1WGXA 3WE3A 3A01A 3R61A 3ZRGA 3S2DJ 3ZP5A 2H27A 2O03A 4UHTA 1A31A 3JRFA 1OJLA 2IA1A 2O6GE 4EGYA 2DA6A 2VASA 3ECHA 3ZMVA 2LKSA 2VBXA 4MIMA 2X6OA 2BGCA 5JVGF 3GEZA 2HOSA 2O8XA 2HOEA 1IN8A 2XF7A 1XSXA 1Z6TA 1WWXA 3K4CA 4FE7A 2DYRH 4RGXA 1WJBA 2D1HA 2BBYA 2E5ZA 3LL7A 5BPIA 3OR1C 1ZYRF 3SZGA 1B72A 1RR7A 2GOMA 3WTWC 1USSA 3O6BB 2M9HA 3Q0WA 4D7NA 3N97A 1QVTA 2XPVA 2M2EA 2VB6A 3GBGA 5FGMA 2LY2A 3K2ZA 3BCBA 3MMYB 2K9QA 2NXNB 3FKJA 3CMMA 4N4NB 2WV0A 4HNTA 1LVKA 1W7PA 4NHJA 5E18F 1OR7A 5B66C 1KU3A 4B3XA 2A05A 1TNSA 3EPZA 3FIWA 2W24A 2WADA 2MH9A 1U5TC 3K4KA 2XV4S 1FP1D 5DCMA 2VKDA 4G8XA 3DKYA 4A6EA 2RQQA 2VIXA 4ETSA 5CVJA 3IH2A 1GUUA 2RVCA 2W57A 3E7LA 4BHBA 2DA1A 2GXGA 3KYDB 3CF5F 5EG0A 5LHGA 5HLIA 1EH6A 3CLOA 3S3MA 2DPDA 4B43A 2F4OB 1HXDA 4A3EJ 4XLPF 1IZ1A 4Y3OA 1T56A 2V26A 4V19K 2JWTA 1RI7A 2DU9A 2P4WA 2LREA 2P5VA 3WTTC 3C2GA 3KP5A 4EJWA 3W2WA 3DEWA 4UUSB 4L5JA 2QLZA 4ABZA 2L7MP 4E7SA 2KDZA 1BI3A 3F8FA 1T0FA 2PJRA 3PSFA 3A4CA 4II3A 4XBFA 3L1PA 4F3QA 1VTNC 1Z3YA 5LGTA 3CC4I 3TDUC 5DEQA 1PVEA 2EWNA 4I02A 3D1NI 1OCRH 1MMNA 4K2EA 4BJ5C 2HTJA 3HHHA 2I10A 4TV7A 4HX8A 5LLQA 2UV1A 2Y48A 1JHHA 1VF9A 4IF4A 4P9UA 2HDDA 1BW5A 5FKKA 1QU3A 1MNEA 3F22A 4W1UA 2F4IA 2BVMA 4LLLA 4FE4A 4RAGA 1NTCA 1YW7A 2BXYA 3LSIA 1WH7A 3WHCA 5DUKA 3JRIA 1XD7A 1XCBA 3HUGB 4IRGA 4HX4A 4A5MA 3PNTA 2R7VA 1FNNA 2XAQA 3K4JA 2HXOA 1ERDA 1N25A 2VQHA 4ESFA 5KHDA 1T98A 4A3CJ 1JXSA 1S3JA 4S0HB 2C6YA 1IC8A 4LG0B 3MZYA 4A3JJ 1TQMA 2DT6A 3QP5A 2KISA 2X85A 5K7ZA 1VQ8I 2J5PA 3K9TA 1LDKB 4PZJA 3CC2I 3H3VK 2R7OA 2JA2A 5AIPA 1X4PA 2FSWA 3DBRB 4BEHA 2A3SA 4M74A 4XMYA 3KX2A 3ZGKA 1GV5A 5IY5H 4NBQA 4HLXA 4GYGA 4CH7A 1PUEE 2FJ1A 3FMSA 1MMDA 1OCZH 2XGXA 1Z91A 1CQTA 5D6EA 3E0JB 2D1VA 4C2UA 5GADJ 2UXXA 4PJNA 4DQ2A 2H6BA 1CF7B 1YO5C 5TGTA 4HDUA 1BI2A 4JK1X 2G7HA 1XMKA 2RNGA 1WJEA 2ZMEC 3NEUA 3NWTA 3S1RJ 1YX3A 3DU5A 2W82A 2K7LA 4EJUA 1FIPA 3ZQGA 4PSXA 2LC2A 3JR9A 3B6AA 2V1DA 3MKZA 3H9QA 1Q1HA 1D5VA 3OIOA 4IXAA 4CZZA 4ENNA 4HF1A 2HWVA 1X1DA 2Y75A 3COAC 5IOZA 2GBYA 4LK1F 1JKPC 2EFQA 1SFKA 3BG9A 3CCUI 2MABA 3RPUD 4E7LA 1JKQC 1GXQA 1TTYA 4BS9A 4DZPA 4FHTA 4CCMA 1GT0C 1JTYA 2OAZA 3EUKL 2PQ8A 3CP8A 2VJ4A 3HEFA 3M8JA 2M87A 1LUJB 4LJZF 4A93J 3OYAA 1VI0A 4IX7A 2PMZN 5KVRA 1YIJI 1GXPA 1YS7A 2HZDA 4IQ4A 2OTLI 2OZ6A 2W7NA 4CICA 2R7UA 5J47A 1TZLA 1P7JA 2QBYA 1JT0A 2E1MC 2ACJA 3OYCA 4L9JA 1W36D 2Z16A 2WTEA 5F0HA 4HG2A 3JTHA 2QSHX 2HFHA 3IV5A 1MJAA 2QUFA 2E34A 3CF2A 1UELB 2DLLA 3GZNB 1ZELA 2QA4I 3LSTA 1FYMA 2Z33A 1IGNA 2CUEA 1AOYA 2E1NA 2V9VA 2LG4A 3SDBA 4EJTA 3QYEA 1JUSA 3WU1B 4AC0A 2HVSA 3VOEA 2A69F 3I5UA 1MMGA 1RR8C 1SD6A 2HKXA 1FY7A 2QSFX 4GGGA 2DDBA 2JPBA 3AKZA
chains in the Genus database with same CATH topology
3AG1H 2EIJH 5B1BH 2Y69H 1V55H 5B3SH 3ASOH 3WG7H 2OCCH 1OCRH 3ABLH 2EIMH 2ZXWH 1V54H 1OCOH 5IY5H 3ABMH 3AG2H 2EIKH 3X2QH 2EINH 2DYRH 2DYSH 1OCZH 2EILH 3ASNH 1OCCH 3ABKH 3AG4H 5B1AH 3AG3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG1 H;  2EIJ H;  5B1B H;  2Y69 H;  1V55 H;  5B3S H;  3ASO H;  3WG7 H;  2OCC H;  1OCR H;  3ABL H;  2EIM H;  2ZXW H;  1V54 H;  1OCO H;  5IY5 H;  3ABM H;  3AG2 H;  2EIK H;  3X2Q H;  2EIN H;  2DYR H;  2DYS H;  1OCZ H;  2EIL H;  3ASN H;  1OCC H;  3ABK H;  3AG4 H;  5B1A H;  3AG3 H; 
#chains in the Genus database with same CATH topology
 1AWC A;  5H6R A;  2EFO A;  3FBN B;  4Y33 A;  4RAZ A;  4UUS A;  3E6C C;  4FIS A;  3TO6 A;  1BJA A;  3P9K A;  4I7H A;  2LVS A;  1ON1 A;  1X1C A;  4UY8 I;  1ETX A;  3HDD A;  3HZJ A;  4XKB A;  3HOV J;  1I1G A;  4OIP F;  1HKQ A;  4BXX J;  1XSD A;  2M0C A;  2Y9Z A;  2MD5 A;  4L5I A;  3CUQ B;  3S17 J;  4G7H F;  1HKT A;  1SFE A;  2R5Z B;  1SC7 A;  2MYS A;  3VPR A;  1TQP A;  3K4N A;  3DWL E;  2P5L C;  4F55 A;  4XOP A;  2ISZ A;  5LBQ A;  1PUF B;  2ZKZ A;  2DCE A;  2DW4 A;  4A3F J;  3EYY A;  2XHK A;  4DBQ A;  5L3G A;  2CU7 A;  1XS9 A;  3BZK A;  4LIT A;  2WAQ A;  1RES A;  4A6D A;  3CJQ B;  3KET A;  2R7S A;  3MKW B;  2CQQ A;  4WF2 A;  3CJN A;  4MTD A;  4IPA A;  4UV8 A;  2CFX A;  1MH4 A;  3ZOB A;  3L2U A;  3X2Q H;  3HUG A;  1LEB A;  2OBP A;  4MFE A;  2QVO A;  2KL4 A;  1WJC A;  2AO9 A;  2XSJ C;  1YQA A;  4LIU A;  1APL C;  1RC9 A;  1J0R A;  2P6T A;  3G3Z A;  5IP9 J;  3DTK A;  4LG0 A;  3QYF A;  3PL8 A;  3EUH A;  5LRR A;  3WTZ A;  1O7F A;  3T0Y A;  2DA2 A;  2EFP A;  1FOY A;  2W00 A;  1Y1W J;  2VOD A;  5M5Y J;  1Y8R B;  1WI3 A;  5J8F A;  4PJJ A;  3CCR I;  3W6V A;  3J7A O;  2L9N A;  2LY1 A;  2HYJ A;  4KIB A;  4PCQ A;  4RB0 A;  2QSG X;  1JJ8 C;  2HOT A;  1J7K A;  3EET A;  1FMW A;  1M1E B;  4AM3 A;  3AL0 C;  2W84 A;  2K3P A;  2GIZ A;  1TT5 B;  4UV9 A;  1R1V A;  1RKT A;  1P4A A;  4CCL A;  3OSF A;  2B0L A;  2KRF A;  2M4K A;  3WGG A;  4KT5 C;  1UHM A;  2KKO A;  2MSY A;  1F9N A;  1V4R A;  1XGS A;  3DKX A;  4WX9 A;  2LF7 A;  1CF7 A;  1DDN A;  3OYE A;  4HA8 A;  1U78 A;  1R71 A;  1IN4 A;  3PFY A;  3QOP A;  1X1B A;  5D8L B;  3JAM K;  2RC4 A;  5F1J A;  2DA7 A;  4DBR A;  3OY9 A;  5GTI C;  2FMY A;  4A3M J;  3KZI C;  4MO7 A;  3LSM A;  2VBZ A;  1FOX A;  2UUZ A;  2FUG 2;  5K7F A;  4GDF A;  2ZJP F;  1XMX A;  2CJJ A;  3A0H C;  1S8N A;  4FCY A;  3FBI B;  3HB9 A;  3WTS C;  2CQ7 A;  1DQU A;  2X6X A;  5F64 A;  2JT1 A;  1AA7 A;  4Z6Y A;  2O3F A;  2KPM A;  5DD8 A;  4D5F A;  4ENJ A;  2VKH A;  4U87 A;  2DBB A;  1EA3 A;  3FXR A;  1K78 B;  2NS0 A;  3OYM A;  2CV2 A;  3QPT A;  2KJC A;  2L2O A;  5JR3 A;  1JJ6 C;  3I55 I;  3M1E A;  3DFG A;  3GW2 A;  3IH4 A;  5LRS A;  4MEX F;  3WTU C;  3IL2 A;  4KDP A;  4BE0 A;  4OU0 A;  1YJ9 I;  1MBJ A;  1H88 C;  5J3L A;  1K4T A;  2IAI A;  3B73 A;  1G2H A;  2A6T A;  4RAY A;  1L0O C;  2K9S A;  3TOB A;  4WWC A;  2XSD C;  2O7O A;  4ZDO A;  5FRN A;  5BOX A;  3KLN A;  5IYC J;  3K2A A;  3J81 Z;  3E1S A;  3MZ8 A;  3HRT A;  1MNM C;  1HST A;  2RAE A;  3I53 A;  3K4M A;  5E1W A;  1F36 A;  4Y4R A;  4A5N A;  1WVR A;  4PK4 A;  2EB7 A;  1D0X A;  1OFC X;  4F92 B;  4C2T A;  2NNN A;  4UVC A;  4RS8 A;  1TL8 A;  1MKM A;  2RDP A;  1SD4 A;  3QPS A;  1IV8 A;  2XKP A;  1R4N B;  3L7W A;  4IHV A;  3WTV C;  3HYI A;  2F5V A;  3BPV A;  2MW8 A;  1Z3X A;  5EEH A;  9ANT A;  1U6G A;  1P4X A;  4YIR X;  1BR2 A;  3F8B A;  3CCJ I;  1JKO C;  1FEX A;  3WGI A;  4LLG F;  2WAE A;  2A6H F;  2DJN A;  5FLX Z;  1RET A;  3GLX A;  3TGN A;  4XQF A;  3K70 C;  2DI3 A;  1EV7 A;  2R3S A;  2HU9 A;  2H6C A;  3OL3 A;  1IRG A;  3BRO A;  4B48 A;  2K9N A;  1ZTR A;  1I3A A;  4AID A;  1IF1 A;  1LE8 A;  4XRS G;  1JTX A;  1Z77 A;  4JX5 A;  3J7Y J;  3CUQ A;  5IP7 J;  3SFZ A;  2R5Z A;  3HOT A;  2XGC A;  1XGM A;  4Y15 A;  3H5R A;  3ONQ A;  1PUF A;  2ELK A;  1OCO H;  1R22 A;  2FRH A;  2ZJQ F;  2LLK A;  3VYS B;  5DCM B;  1D1C A;  3HKZ A;  3I3L A;  3PO2 J;  2XRN A;  1LNW A;  3QQA A;  4C30 A;  4YFN F;  2ECB A;  3DEE A;  3ERE D;  1PDN C;  1OQY A;  3KLO A;  1UZC A;  4B1R A;  1DGW Y;  2F5C A;  3BG7 A;  3PIO F;  1D3Y A;  3ZQI A;  3MFK A;  2YS9 A;  2OZU A;  3MAJ A;  3HOU J;  4E7K A;  3MEX A;  2NVU B;  1GHC A;  4CYC A;  1XG1 A;  5DV5 A;  5IT3 A;  1TWH J;  1FC3 A;  4YEL A;  4C3I J;  3GTP J;  2H8W A;  1A04 A;  4BQO A;  5DUI A;  4CCN A;  2DA4 A;  3JRC A;  1BC7 C;  4HDV A;  3LQQ A;  1K6Y A;  3HIF A;  1T08 B;  2R7W A;  4W97 A;  5BQT A;  3OMY A;  5LGU A;  3GX4 X;  1ZGJ A;  2VPL A;  2AXT C;  3ROU A;  2DXI A;  1QA6 A;  5JLW A;  2ID3 A;  3LQR A;  4XRM A;  3FXJ A;  2HVR A;  3E6D A;  4RDU A;  3D0S A;  1G8X A;  2HQA A;  1R5H A;  2CW0 F;  2EIK H;  3F6O A;  3K1P A;  3BTI A;  3M9A A;  4XOR A;  2B63 J;  4OIQ F;  3JSP A;  4KMF A;  1X2N A;  2GOX B;  3GO5 A;  1EF4 A;  4LLN A;  3O8G A;  2QQB A;  3L09 A;  5M3M J;  4ESJ A;  5EF6 A;  2BVL A;  2IS4 A;  2WWY A;  1WJ5 A;  2LYC A;  3BTL A;  1O3R A;  4OMZ A;  2A68 F;  5B1B H;  5F0F A;  5HOO A;  5B5E C;  2A5Y B;  2X48 A;  2NVX J;  4IOC F;  2ZXW H;  1YRN A;  3DBL B;  4LIV A;  2LD5 A;  1SFU A;  3SYT A;  5E3N A;  3CD6 I;  2O9L A;  1HC8 A;  2F4M B;  3H0D A;  2EZI A;  1A6Q A;  2QM3 A;  2EZH A;  4UVA A;  4P96 A;  5LGN A;  1JKR C;  1FX7 A;  4UB8 C;  1YJW I;  1LFU P;  3J80 Z;  4A12 A;  5F04 A;  5FFZ A;  2NAZ A;  2ZJR F;  4D9J A;  3GTO J;  4HV5 A;  2CGP A;  1K78 A;  1SVM A;  2PMU A;  5D8K B;  2ZBK A;  4RBO A;  5EZG A;  1BIA A;  2AHQ A;  5HLH A;  2J5O A;  4N0B A;  2HEO A;  4DYQ A;  4M73 A;  1U9O A;  3Q5F A;  3Q9S A;  3WU2 C;  3Q9V A;  2BEO A;  2MD0 A;  1UJ8 A;  1G6N A;  1KYZ A;  3TQN A;  2MH2 A;  1BOA A;  4YG2 F;  1X1P A;  4XLF A;  1BA5 A;  3RZD J;  1W5S A;  3M4O J;  2BY1 A;  1RZ4 A;  1FOW A;  2M7B A;  1U5T B;  3R0J A;  1IRZ A;  1B9M A;  1WH5 A;  2E1O A;  3L2R A;  3JW4 A;  3IKV A;  1H9G A;  2BE5 F;  3T8T A;  1JGG A;  2XDV A;  3HTS B;  2XRO A;  5ICG A;  4AYB A;  1H8A C;  1BOB A;  1DUX C;  1MBF A;  3ABT A;  2K3F A;  1BI1 A;  5K7H A;  4OIN F;  3SHF A;  4KNY A;  2WAQ N;  4HST A;  2V6C A;  1UCR A;  3U1K A;  4IVN A;  2E36 A;  5HS8 A;  3BT9 A;  3WG9 A;  3E6B A;  3BJA A;  3G2B A;  5BMZ A;  1J09 A;  3BR0 A;  3FMR A;  4AUX A;  2KIU A;  3K70 D;  3CLQ A;  1VQ9 I;  3SZP A;  2IS1 A;  2ZB9 A;  1BI0 A;  2K40 A;  5J4Y A;  4JYK A;  3RKX A;  3CCQ I;  4XLA A;  5JFR A;  4I6Z A;  1ZG1 A;  2VPR A;  4F52 A;  5M3F J;  4C2M J;  1W36 C;  4I2O A;  2ESN A;  2VBW A;  4OMY A;  2QBY B;  1NK2 P;  1JHF A;  1ZG3 A;  3I64 A;  3HBL A;  1N77 A;  3HOW J;  4BJT A;  1R7J A;  1TW2 A;  4IHX A;  5C44 J;  3VOD A;  1OCC H;  5DM6 F;  3DU6 A;  5E8G A;  2HQ5 A;  3K7A J;  1ZR2 A;  2HPI A;  1HDP A;  1B6A A;  3GF2 A;  1ETW A;  4L5E A;  4EQQ A;  2OV7 A;  5F1R A;  3S1N J;  4XRS A;  4LB5 A;  1K7A A;  5ILU A;  4A3D J;  2Y9Y A;  3BQY A;  3RJP A;  4KYW A;  4KMU X;  2HGC A;  2MFZ A;  5IT9 K;  2IW5 A;  3P5J A;  3BWG A;  3LMM A;  4NC8 A;  1IXS B;  2NVY J;  3BLY A;  2R7F A;  3I56 I;  4LK0 F;  4M3F A;  2L0K A;  3VB2 A;  1O3T A;  2D2W A;  3LFK A;  4BY7 J;  2X6W A;  3F8M A;  5FKL A;  2DOD A;  5EGO B;  4NDL A;  5D4R A;  3A2K A;  2R7R A;  2OU2 A;  3HJE A;  3H36 A;  1JT6 A;  4KIF A;  2VXD A;  2FD5 A;  2QQ8 A;  4DW6 A;  1WFX A;  1FJL A;  2GZW A;  5E3L A;  5CYV A;  3AG2 H;  1VQK I;  3NAR A;  4EM0 B;  4U0W A;  4EGZ A;  1WQ2 A;  2H1L A;  2HTS A;  2VXZ A;  1IXC A;  3ZPL A;  2CO5 A;  4BXU A;  4IOA F;  4R8H A;  2PI0 A;  3K6G A;  5ERI A;  1QZY A;  2VI6 A;  1WKM A;  5HNF A;  3GYH X;  3PNY A;  4J01 A;  4XR6 A;  1RUN A;  2Y69 H;  4IL6 C;  5HS9 A;  5FD5 A;  4B47 A;  3RIR A;  3CQZ J;  4KN7 X;  1P92 A;  2ZME B;  1FSE A;  5HNH A;  1W7P D;  2VBY A;  3S16 J;  2Y0S A;  1GDT A;  2O8K A;  3S1Q J;  2F5F A;  3DBH B;  3DLA A;  3K0L A;  2AS5 F;  5HDK A;  3FIS A;  2E2I J;  2RKH A;  2ZXH A;  1IJW C;  1B4A A;  1OLT A;  4LGW A;  2R93 J;  4PFO A;  2BV6 A;  2M7A A;  1V3F A;  4HSR A;  2LR8 A;  1Y56 A;  3DPL C;  5FKO A;  1UHW A;  3F6V A;  4ESB A;  1SFX A;  1LDD A;  1QBJ A;  2G9W A;  1Z9C A;  2R92 J;  4A3B J;  3DTE A;  3DCF A;  2FQ4 A;  4O6J A;  2DMU A;  2LKP A;  3PUB A;  1WHU A;  1U8R A;  4KUM A;  1F4K A;  1R1U A;  3F8C A;  3MZH A;  1AKH B;  3WOD F;  2KZV A;  4GO1 A;  4NNJ A;  3H35 A;  4B44 A;  3IKT A;  3GTK J;  1J5Y A;  3JRH A;  1ZAR A;  4O5V A;  1HBX G;  2QCO A;  4E70 A;  2W4S A;  2Z3Y A;  4BE1 A;  4OAY A;  3ZQQ A;  2JSC A;  2FEZ A;  5EEG A;  3HPG A;  4DIQ A;  3N4M A;  1UHS A;  2E1M B;  1T8I A;  1TQI A;  1ULY A;  2Y0M A;  2CYY A;  4BBR J;  1RUO A;  4M71 A;  1U5T A;  3W6J B;  1ZH5 A;  2Y2Z A;  5TJJ A;  4XRF A;  1X58 A;  2HI3 A;  1DP7 P;  1XB4 A;  4ENM A;  2YU9 J;  2YPR A;  1MIJ A;  3HKZ N;  3IAM 2;  5E8I A;  3GTL J;  3ERM A;  3KZZ A;  1VZ0 A;  3IUO A;  4HLY A;  1R36 A;  3I4P A;  3VFZ A;  1IAW A;  2DMT A;  3K4L A;  4B4C A;  4HV6 A;  4XON A;  3OS2 A;  3KYC B;  3MKY B;  2E1C A;  4GCV A;  2EIJ H;  3H3Z A;  2EV5 A;  3B6C A;  3MD2 A;  4EMS A;  4KFC A;  2VJJ A;  3ABL H;  3R0A A;  1J75 A;  3G71 I;  2HQR A;  2BOL A;  4XKC A;  3CO7 C;  5FLX K;  2VE8 A;  1NK3 P;  5D6F A;  4XOT A;  4XLN F;  2YSR A;  1I5Z A;  1ETY A;  4KIT B;  1EJ9 A;  2V1X A;  4IQJ A;  3MCZ A;  2CW8 A;  2K5C A;  3BCA A;  1Z21 A;  4ZTF A;  2ZNZ A;  1CGP A;  1YOV B;  5C4X J;  2CQK A;  2IRF G;  2F2E A;  2DTR A;  1UAA A;  4GFB A;  2EK5 A;  3QU3 A;  2IA2 A;  3L2W A;  2L9S A;  1GVJ A;  3PUF A;  5C3E J;  4CCO A;  3S8P A;  1EH7 A;  4U7B A;  4IO9 F;  1OYW A;  4O3M A;  1MND A;  5ICC A;  4RLF A;  2JUG A;  4IZZ A;  5J8C A;  2ZFW A;  5K5Q A;  3TBI A;  3WTX C;  3TOA A;  1T38 A;  5E20 A;  1Z7L A;  1D1A A;  2HNH A;  4CHU A;  1NG6 A;  1MMA A;  2GQQ A;  4WXH A;  1S7A A;  3KP3 A;  2M8E A;  4ITV A;  1MGT A;  4M6X A;  1FOK A;  1KQ0 A;  2FNP A;  2XGD A;  5LFA A;  2JK3 A;  3EUA A;  5IYD J;  2TDX A;  1FMV A;  1QNT A;  3LOC A;  4PGG A;  4E6K G;  3V8L A;  3L2C A;  4U88 A;  1L3L A;  2DFH A;  1C0W A;  1WSU A;  1AU7 A;  1Z6R A;  2LSO A;  5EGO A;  3HRS A;  1OKR A;  1B8I B;  1TLH B;  1TWA J;  3LSH A;  1D1B A;  3N05 A;  1HA8 A;  4CUG A;  5KAI C;  2E19 A;  4S05 A;  1LE8 B;  3Q3S A;  2Z1D A;  1EH8 A;  3TW7 A;  1KZH A;  1KON A;  2XAS A;  3HOY J;  3GVA A;  3K69 A;  3TW6 A;  3HGG A;  3A0B C;  1IDZ A;  1FYK A;  2Q1Z B;  3A1Y A;  3BOQ A;  1YFH A;  3AG4 H;  3ULQ B;  1YIT I;  5FRM A;  2EV6 A;  3AL0 B;  1A35 A;  1VFC A;  3SDG A;  2MC3 A;  3CCV I;  1KU7 A;  3TKY A;  4FAS D;  3L2V A;  2L7Z A;  3FF5 A;  2KJB A;  3HG9 A;  4M3E A;  3TP0 A;  3WGH A;  2WY7 Q;  4CSW A;  4LFU A;  2QF7 A;  1HQC A;  3F21 A;  3TP3 A;  3K1M A;  2Z9O A;  2Q2E A;  3H5A A;  2JZY A;  3VSK A;  2XC7 A;  2R7Q A;  2ZME A;  3HSR A;  2GXA A;  2M8G X;  4EM2 A;  2MLK A;  3FDY A;  3ABK H;  5HDG A;  1O4X A;  3JRE A;  5B1A H;  3LNQ A;  1Z67 A;  1V5G A;  3I54 A;  4CYC B;  1YHQ I;  4EVI A;  2IGM A;  1YX5 A;  2JJ7 A;  2YX4 A;  3I58 A;  3GFI A;  3KP7 A;  1I6H J;  1O3Q A;  2K4J A;  2VOP A;  5CVV A;  1R23 A;  1LPQ A;  3OWT A;  4F7Z A;  3MN2 A;  3FM3 A;  5H6Q A;  3JRD A;  2CSO A;  5LHH A;  1UST A;  3DLL F;  5K5R A;  3G4S I;  4AYB N;  1MMS A;  3FXL A;  4NQW B;  1ON2 A;  3V4G A;  3KEQ A;  4EEF G;  4Q5S F;  2E7X A;  2EIL H;  3KIO A;  3J80 K;  2H8R A;  1IDY A;  3BR5 A;  2HKO A;  2PMH A;  3M8E A;  2RGV A;  4M72 A;  4ZYE A;  1HW2 A;  2JVG A;  2V79 A;  1IN6 A;  3BDD A;  1AKH A;  4G7Z F;  1MH3 A;  5FLM J;  1FTT A;  3ISP A;  3U21 A;  4KIC A;  1LEA A;  3QU6 A;  1YW9 A;  1G3S A;  1STZ A;  4YEJ A;  3BQZ A;  4ZTJ A;  3SXY A;  1AHD P;  3HHG A;  3QRF F;  1DP3 A;  3DEU A;  4BQA A;  3D5S C;  3B02 A;  1P7I A;  3KFW X;  1A5J A;  3PO3 J;  2BY2 A;  4BY1 J;  3TED A;  4HQE A;  2H09 A;  3GTQ J;  4BGD A;  3QWL A;  3DPT A;  4LOC A;  2ME6 A;  2IXS A;  3L9F A;  3CO6 C;  4CYD A;  1R00 A;  2KLO A;  2X1E A;  1QZZ A;  3JRG A;  1XDU A;  2M3A A;  3QAH A;  2OC6 A;  3WHB A;  1TNT A;  4RGS A;  3K10 A;  1WCM J;  3KYL A;  2ZNY A;  1E2X A;  1YRN B;  2OTJ I;  4B8X A;  5E3M A;  3CCM I;  2IT0 A;  2YU3 A;  1ZRC A;  1F1Z A;  5JVT A;  1K79 A;  1T6S A;  2WB1 A;  1ETK A;  3S14 J;  5H2F C;  4UNO A;  1SMY F;  1ODD A;  3GTG J;  1FPQ A;  4F91 B;  3W2V A;  3SFI A;  4C3H J;  2R5Y A;  2VJ5 A;  1T33 A;  2IS2 A;  2V9K A;  3PQK A;  1J2X A;  1VQ7 I;  2DMQ A;  2ID6 A;  1KU2 A;  2COM A;  1S29 A;  4BXF A;  1KA8 A;  4BU2 A;  1X19 A;  3F72 A;  3KEO A;  4Q4Z F;  5J4V A;  1LQ1 A;  4II2 A;  4BQQ A;  1H9T A;  2D45 A;  4CCJ A;  1BIB A;  3U2R A;  1S6L A;  5E1Z B;  1J9I A;  2DOE A;  2LDU A;  3V8J A;  5CQE A;  1ACI A;  3HGY A;  1FWZ A;  5JLX A;  5FRO A;  1KYW A;  3GFM A;  2FU4 A;  1VND A;  1QO0 D;  4KJZ A;  1IN7 A;  2VLA A;  2LY9 A;  4KIS A;  3FXK A;  3K1N A;  3M3Y J;  2E7W A;  3DV8 A;  5BPD A;  3JRA A;  2IVM A;  3RQ4 A;  3U1D A;  3S2H J;  3HOZ J;  1O7L A;  1K6O A;  1X1A A;  3KCC A;  2FXA A;  2ICW G;  3SQN A;  4MNU A;  3LA7 A;  3VWB A;  3TL4 X;  4HNU A;  2XF6 A;  2PEX A;  3BP8 A;  2M0M A;  1NG7 A;  2Y0S N;  1B8I A;  2KHM A;  3CP2 A;  5H20 A;  1U3E M;  2M30 A;  3VSL A;  2JA7 J;  2DK5 A;  2ELJ A;  3PNV A;  1R5I D;  3CCE I;  1ZR4 A;  1IO2 A;  4CO8 A;  1B9N A;  4QIW N;  2E71 A;  3V7S A;  4WCG A;  1X4O A;  3LFU A;  4R79 A;  3F8N A;  4HEA 2;  2HXI A;  3HSE A;  2VOO A;  4XLH A;  3FM5 A;  4ZYG A;  4MHG A;  3LSK A;  1S7E A;  1JE8 A;  1MBH A;  4P5O A;  5E3O A;  4XID A;  1Y1V J;  2I8D A;  2DA3 A;  2VC1 A;  4HOB A;  5DCF A;  4YIF A;  4HNV A;  4RB3 C;  3UKG A;  1Z0X A;  3GZ5 A;  2F6C A;  1WPK A;  4XN3 A;  1U8B A;  4BL0 B;  2W25 A;  2FML A;  2MLG A;  4AIH A;  2KDO A;  3OYN A;  1P4W A;  5LEK A;  4FX4 A;  3BTJ A;  4I99 C;  4I76 A;  4AVZ A;  1F5T A;  2GIV A;  2OPT A;  2R4G A;  3SEZ A;  2NVQ J;  1XGO A;  3IHU A;  2AQE A;  2JA5 J;  2EV0 A;  2XB5 A;  1YS6 A;  2EJR A;  3KP6 A;  5CPR B;  4ASN A;  4D0P A;  1ORK A;  4IHY A;  2IJL A;  3A03 A;  4UB6 C;  5CJ9 A;  4KA4 A;  2GLO A;  3VEP A;  4U7D A;  2OUM A;  1LFB A;  2OA4 A;  2EFN A;  3WU0 A;  4AD9 A;  4RGR A;  2L02 A;  4A3L J;  2BW3 B;  3GCM A;  1BN5 A;  2EZK A;  5IPA A;  2QYO A;  4MQ9 F;  5GP9 A;  4RLQ A;  2XAH A;  3RPQ A;  4NQW A;  1E3H A;  1R9T J;  1XCV A;  2FA5 A;  3S93 A;  1REP C;  2XAF A;  5A2Q Z;  2X9D A;  3O2P E;  2LRD A;  2EA2 A;  2PMZ A;  1EKE A;  4BHP A;  1SAN A;  1MDM B;  3HTU A;  2X0L A;  1RNL A;  2QQ9 A;  3BG5 A;  1E3O C;  3A02 A;  5D4S A;  2VL8 A;  3QOE A;  3LSR A;  2CV1 A;  2R7T A;  2QEX I;  4CGZ A;  3BPX A;  1FSH A;  1YE9 A;  2ETH A;  2X6Y A;  4A0X A;  4MEY F;  1X3W B;  2FBI A;  1XN7 A;  2H94 A;  2M34 A;  1OR7 C;  1R58 A;  2RQP A;  1R6R A;  2Z2S B;  2L9R A;  5DD4 A;  1ENH A;  2CW7 A;  2PN6 A;  3F3X A;  1VQ5 I;  3HC7 A;  1QHG A;  4HF2 A;  2DTZ A;  1S5L C;  3PIP F;  5J1U A;  3LA3 A;  4I09 A;  3BZC A;  5L3B A;  4HZF A;  3OYB A;  3C2B A;  3BZ6 A;  3W2A A;  3FMQ A;  4Y17 A;  2EFW A;  4A3I J;  5J6X A;  4IEJ A;  1E3P A;  1XGN A;  3CMA I;  1MBE A;  2YX7 A;  1D0Y A;  5K1Y A;  1FYL A;  1SAX A;  4GRI A;  1MD0 A;  3FXM A;  3I59 B;  2HYF A;  3KEY A;  4IRH A;  4JX4 A;  4HYE A;  2P5K A;  4UUV A;  3C3W A;  2CWE A;  2DOA A;  4KIG A;  2X51 A;  3GZ6 A;  2TCT A;  4XSX F;  4E4H A;  3DXJ F;  5D5V B;  2CV0 A;  1T0F C;  1V54 H;  2F5E A;  3G1L A;  3HRM A;  1VQL I;  5DS9 A;  5CLS A;  2YR2 A;  2FX0 A;  5F0C A;  4XLC A;  3MQ0 A;  3ZMS A;  2IPQ X;  3OOU A;  1WZ2 A;  2X4H A;  2O0Y A;  2XUB A;  1S72 I;  4I98 B;  3RYP A;  1HW1 A;  4M9Z A;  3RZO J;  5ICE A;  3ZR8 X;  2DA5 A;  2JQ7 A;  2L4A A;  3C7J A;  3T5X A;  2B7E A;  1ZRF A;  3CCS I;  4G6D A;  5BNG A;  2V7F A;  1MBG A;  2HZT A;  2IS6 A;  3RCO A;  4QTR A;  5IP6 A;  3GFJ A;  4HRI A;  4CZC A;  3ZMZ A;  4HPQ A;  5FJ8 J;  1W4M A;  3VDX A;  1DU6 A;  3ELK A;  4PUS A;  4M3G A;  2QKM B;  2NS8 A;  4RM2 A;  2VE9 A;  5J40 A;  2PFB A;  3G6E I;  2DAO A;  5TRD A;  3OSG A;  2RRE A;  1XMA A;  3NAU A;  3JAM Z;  4DJA A;  3CME I;  3EYI A;  1BC8 C;  3LAP A;  3CC7 I;  1XX5 A;  2VUM J;  4ANJ A;  1X2M A;  2CMP A;  4UVB A;  1KU9 A;  4JOM A;  3HOS A;  3ZMD A;  4Y7N J;  3S15 J;  3F0C A;  3JCU C;  4ON0 A;  2L9V A;  4P55 A;  3U9G A;  3ZQL A;  3FXO A;  4RAF A;  2K9M A;  5J1R A;  5HLG A;  2P8T A;  3OYL A;  2DFE A;  5GAE J;  1SD7 A;  3L00 A;  4J00 A;  1FIA A;  2OCE A;  1W1W E;  3ECO A;  4HAM A;  3E97 A;  1ZLK A;  2JRM A;  2L7F P;  1LDJ A;  4UUT A;  5ILV A;  3FKI J;  2DQL A;  1BJZ A;  2XIG A;  2G0E A;  1FBU A;  5F27 A;  2EH3 A;  4BHC A;  2NYX A;  3BJ6 A;  1QPM A;  5DM7 F;  4OWR B;  1IRF A;  1A6I A;  4RB1 A;  5B3S H;  1MSF C;  4G12 A;  3T1B A;  3OYH A;  2BY3 A;  2IA0 A;  3ABU A;  2EA4 A;  2LKX A;  2OQG A;  2NOJ B;  1VQ6 I;  4LMY A;  2KP6 A;  1PYV A;  1UG0 A;  2GA1 A;  4GYI A;  3S2W A;  3W6K B;  4XIC A;  5GAG J;  2HR3 A;  2AQF A;  4RGU A;  4I0B A;  2QGU A;  2CG4 A;  4PFP A;  5K5O A;  6PAX A;  1GVD A;  3RKQ A;  5HLT A;  3GUD A;  1V5E A;  4XKW A;  2XB0 X;  4QPQ A;  1U9N A;  1Y0N A;  2P6S A;  2BZT A;  5D5X B;  1F43 A;  3KE2 A;  3SJM A;  3PSI A;  4FX0 A;  4XSZ F;  1Y39 A;  2BW3 A;  2ESH A;  3HPH A;  3GTM J;  3CJR B;  4H0E A;  3KPH A;  3HM5 A;  2KIQ A;  4AVP A;  3ZMU A;  3CJT B;  5EDN A;  2K4B A;  2P81 A;  2WB1 N;  1QVU A;  5LD2 C;  3BR1 A;  3IRQ A;  3OIP A;  1RKW A;  5L3D A;  1QZE A;  4CDG A;  4NB5 A;  1MDM A;  3ASN H;  1ZLJ A;  3IWF A;  3M1C A;  1ZAO A;  4IKF A;  2WA0 A;  4HQM A;  1WI9 A;  3BY6 A;  5KK1 A;  2IGK A;  5ED4 A;  4PJM A;  5HVQ C;  5CVI A;  3I0T A;  1OYI A;  2Q2E B;  4NUB A;  3DKW A;  5LEJ A;  3IH3 A;  2P7V B;  4CCK A;  2LH9 A;  2V4J C;  2DT7 B;  4B3A A;  2ZXI A;  2JN6 A;  4L0Y B;  3OV8 A;  5EZH A;  4Q47 A;  5GAH J;  1JGS A;  4I01 A;  2R0Q C;  1H89 C;  2KQR A;  1I27 A;  4B09 A;  2E2H J;  1QQI A;  1LVA A;  2DK8 A;  2WY8 Q;  4RM3 A;  1NH3 A;  3GLL A;  5AON A;  1D8K A;  3JTG A;  5EYR A;  3I59 A;  3RYR A;  1ZK8 A;  2MG4 A;  3RPU A;  1JI8 A;  1YLF A;  3D5R C;  4NC6 A;  4I0A A;  1MW7 A;  2LNB A;  5IOY A;  1KQ9 A;  3FHN A;  3JSO A;  2XAU A;  5J1Y A;  1W0T A;  2OQR A;  4BKX A;  5D5W B;  1D0Z A;  1LB2 A;  3ZXS A;  1S9H A;  3H92 A;  4V2G A;  4L18 B;  2DYS H;  1RPW A;  4M9S A;  4NC7 A;  2L4M A;  4G6Q A;  3TO9 A;  2PG4 A;  2TRT A;  2CFO A;  3ZQ7 A;  3V7C A;  4ZYD A;  2CH0 A;  3E5Q A;  1MJ9 A;  2I5U A;  2G7U A;  2JTV A;  2XAG A;  5DTD A;  1RIO H;  1ZN2 A;  5GTH C;  5JHU A;  3J81 K;  3H9J A;  2XF5 A;  5CQG A;  2ZSI B;  2HQN A;  1OCT C;  1I1S A;  2XRL A;  1NHA A;  3H0G J;  1G59 A;  2WV1 A;  4BH9 A;  3OYD A;  4H4K C;  4QPO A;  1WRJ A;  2CUF A;  1MBK A;  5IYB J;  1UMQ A;  4IHT A;  1B1B A;  4WXD A;  4CA0 A;  3LWF A;  2Z5U A;  4EAT A;  3D5L A;  3OYK A;  1BR1 A;  3RDI A;  4IHS A;  2O61 A;  2ECC A;  4FTH A;  4L0Z B;  2PX9 A;  1YG2 A;  3MWM A;  1H0M A;  3M8F A;  2XVC A;  2DFF A;  3JRB A;  2STT A;  2R5Y B;  4ZZD A;  4DNC A;  1HF0 A;  2ME0 A;  3E3V A;  1P9Q C;  4MGR A;  3F9K A;  3V7R A;  1IN5 A;  3LSP A;  4ZYA A;  2COB A;  1FTZ A;  2E2J J;  4JP0 A;  2ZCW A;  3QPL A;  5EEA A;  2WAF A;  3VYR B;  1XTA A;  3DF8 A;  3EUH C;  4CXF A;  1K61 A;  2M5W A;  3FZV A;  4MQV A;  1T2K A;  1E0E A;  1SVO A;  2FOK A;  3H9G A;  3BR6 A;  3ZQF A;  2W48 A;  1Z1D A;  3OOP A;  3ZN1 A;  4JX6 A;  4AIK A;  3C18 A;  3DTI A;  5LHI A;  2LTP A;  2FQ3 A;  3F23 A;  1MSE C;  4ZJZ A;  2NRA C;  2R7D A;  2MGQ A;  3IWZ A;  1R5G A;  3LSG A;  3S1M J;  1K4S A;  1ONV A;  3G1O A;  3ML6 A;  2L3D A;  4A0Y A;  3I71 A;  4XNF A;  4DYR A;  4BJ6 C;  1YTY A;  2FF4 A;  5CKT A;  4EJV A;  3RTR A;  3ZQC A;  3PFI A;  1FLI A;  3Q0V A;  3TO7 A;  2ZC2 A;  2JRT A;  2KT0 A;  1U2W A;  4G7O F;  3J7Z I;  1QHH D;  1VQP I;  1YYV A;  2CRG A;  3FK7 A;  1WJF A;  5TIS C;  3RKY A;  3WE2 A;  2OCC H;  3H1C A;  4G9Y A;  3CDI A;  3OYF A;  1ZGA A;  4ZDP A;  4YFK F;  3KZY A;  1J59 A;  1LJ9 A;  2DMN A;  2IGO A;  2A61 A;  3BTC A;  4C3J J;  2DOF A;  2RN7 A;  1QPI A;  2AXL A;  2ZFU A;  1SVL A;  4ZDL A;  2DJI A;  3C2H A;  2M45 A;  4U0V A;  2KIM A;  5M5W J;  1ZRE A;  5A2Q K;  3T8R A;  1OPC A;  2LF8 A;  3S3N A;  4OIO F;  1O3S A;  4QSH A;  2MA3 A;  1Q1V A;  2O5R A;  4OOI A;  1U0J A;  5KAF C;  3HOX J;  1HCR A;  1HOM A;  2DN0 A;  3HSF A;  4KT6 A;  3RI4 A;  4LB6 B;  3EDP A;  1ETQ A;  2FNA A;  2M4G A;  3PM1 A;  1R4M B;  4XN0 A;  1FP2 A;  4M6Y A;  2K85 A;  4XKV A;  5HOD A;  1OIS A;  4A2U A;  1HSJ A;  3GFL A;  1I6X A;  1P6R A;  3CUO A;  1UFM A;  2KFD A;  3G73 A;  5FO5 A;  1DPU A;  4P1W A;  1E17 A;  1V55 H;  2GAU A;  2Y31 A;  4BBS J;  1ITY A;  2LP0 A;  4E7J A;  4P9F A;  5FFX A;  4N9H A;  3V8K A;  1TBX A;  2QEN A;  2K27 A;  1IXR C;  1OCP A;  2HOA A;  3DP7 A;  3H5N A;  1T39 A;  4BAY A;  1OYY A;  1HDD C;  5E1X A;  2F48 A;  5IT9 Z;  1VQO I;  2VON A;  2E60 A;  1TWF J;  4HX7 A;  3M7G A;  2JA6 J;  3OL4 A;  3L2Q A;  2VN2 A;  3CCL I;  3OIQ A;  4D5C A;  1DU0 A;  1SD5 A;  4L9N A;  2L01 A;  1SMT A;  2DMP A;  1I39 A;  3QPH A;  3QYB A;  2XKO A;  3V42 A;  1DGR M;  3LSJ A;  1FT9 A;  4BE2 A;  4ZZL A;  3CDL A;  5BS6 A;  2PLY A;  3ESW B;  2QKL B;  2VQC A;  4E7Z A;  5F08 A;  4BDZ A;  3G1M A;  3UNG C;  3NQO A;  3P9C A;  3PQJ A;  4BDY A;  3CUQ C;  2HYG D;  3FK6 A;  4KN4 X;  4V2F A;  3FX3 A;  4HW0 A;  2K02 A;  2W85 A;  4FT8 A;  2YUS A;  1XPX A;  1MJB A;  4YII A;  1W5C C;  4HBL A;  4M3D A;  2L7K A;  2RNJ A;  1FZP B;  1YJN I;  1D8J A;  3TDZ C;  2DFI A;  4Y13 A;  3PJR A;  1P2F A;  5D5U B;  4EJO A;  2NS7 A;  3O3K A;  2ZO4 A;  1ZGW A;  1Y8Q B;  1VQM I;  1VQ4 I;  1ZRD A;  2X1C A;  2HS5 A;  1XSV A;  2Z99 A;  1BM9 A;  2H1K A;  1LFP A;  4M9X A;  1JUP A;  4M6V A;  2OF7 A;  3REO A;  3IC7 A;  2Q8K A;  1G3W A;  3ABM H;  1R49 A;  4GXO A;  1KGS A;  1X3U A;  2EIN H;  3CZ6 A;  4XLE A;  3O8H A;  4D1Q A;  2GM4 A;  2K86 A;  2Q0O A;  1IW7 F;  4X0G A;  1POG A;  1YIO A;  5F6F A;  3IAS 2;  2N8G A;  2DO7 A;  4XM3 A;  3LAJ A;  1ZQ3 P;  4PJ0 C;  2LBF B;  2JMW A;  5L3F A;  3E6M A;  2L54 A;  2OJE D;  2A5W A;  2DQR A;  4HF0 A;  2LFB A;  2BXZ A;  5GPC A;  2UZK A;  1QRY A;  5FKN A;  1HLV A;  4AWX B;  4F93 B;  2EZL A;  2ISY A;  3IRR A;  2EQR A;  3SZT A;  2LK2 A;  3AAF A;  3BG3 A;  2A6E F;  2XAJ A;  1TC3 C;  2KMU A;  2UWM A;  1SEU A;  3HRU A;  2GWR A;  4R1H A;  5FKM A;  1W5T A;  4PDK A;  2QWW A;  3OYI A;  4A3K J;  3S3O A;  2XPW A;  2W1O A;  2KIF A;  1IV6 A;  2IP2 A;  4MFD A;  2XGE A;  2KRH A;  4OIR F;  3ASO H;  5E79 C;  4DGW B;  3BC8 A;  4JBA A;  3MKL A;  1BW6 A;  3BJO A;  4D7M A;  1HW5 A;  2NOG A;  4Q48 A;  5CVU A;  4IHW A;  3SEQ A;  2D5V A;  1PP7 U;  3A01 B;  2M1B A;  2WBM A;  4DOZ A;  1IUF A;  2PBI A;  3GWZ A;  4C9Y A;  3WTY C;  1UB9 A;  3ZCO A;  5DDG A;  2VKE A;  1W0U A;  3NWS A;  2WC2 A;  5C4J J;  3OS1 A;  3AG3 H;  2HVQ A;  2IGN A;  4YRV A;  5L3E A;  1G3Y A;  4A69 C;  5L3C A;  2ELH A;  1I50 J;  1GV2 A;  1IG7 A;  4XL9 A;  1T95 A;  2P7C B;  1A36 A;  2STW A;  1B72 B;  3CMY A;  5EJC A;  1ETV A;  5FLV A;  2JA8 J;  2NNY A;  4IJA A;  1Y0U A;  1B59 A;  4Y52 J;  2V1U A;  3I4N J;  2JPC A;  2L5Q A;  3OR2 C;  3HL2 A;  2UXN A;  4M3B A;  3FXU A;  1RRJ A;  4BNC A;  3RQI A;  5AIQ A;  3P9I A;  2DT5 A;  4FET A;  2ZJ2 A;  3UR3 C;  2CQX A;  3C1D A;  1R1T A;  2IEK A;  1XDS A;  1S7O A;  1OMI A;  3GXO A;  1W7P B;  2JVH A;  5M5X J;  1PJR A;  2IBD A;  2OD5 A;  1TT0 A;  3NRV A;  4JQF A;  1D5Y A;  3OS0 A;  3GTJ J;  2HDW A;  2ZSH B;  4RB2 C;  2JSP A;  3LA2 A;  4UXN A;  1WJD A;  2EPF A;  3QOD A;  4ZH4 F;  3VYT B;  4EV0 A;  4BUP A;  1X3Z B;  5EG0 B;  3BR3 A;  3VYU B;  3FWE A;  5FD6 A;  1I3Q J;  3HXL A;  4L9T A;  3Q0U A;  2FBK A;  3AG1 H;  3DPU A;  4AIJ A;  4J19 A;  4QWQ A;  1YI2 I;  2LMD A;  3DQV C;  5E17 F;  3CDH A;  2K9L A;  4RMN A;  4MTE A;  1V5F A;  4N4O B;  2BYV E;  2RV8 A;  4XK4 A;  3E5U A;  2KZG A;  3I9V 2;  4PSW A;  2X1D A;  2VC0 A;  5DYM A;  5ILS A;  2PJR B;  2V6E A;  1TP4 A;  3I4M J;  3MVP A;  1N78 A;  1ZG5 A;  1LKX A;  2P0W A;  1SAU A;  2QQA A;  5JI6 A;  3RKW A;  2GA2 A;  3H3U A;  4DZJ A;  2V9P A;  1G3T A;  3ZMT A;  3KP4 A;  2ZXJ A;  1ETO A;  1BBY A;  4WK8 F;  1VQN I;  3QP6 A;  4FQG A;  2VT2 A;  1GLN A;  2CQN A;  1MZB A;  1JUM A;  2VJI A;  2XPU A;  3IP4 B;  1DPR A;  3K4B A;  4WXC A;  4E7H A;  3ZQH A;  3W3C A;  2FBH A;  2Y30 A;  3OYJ A;  1K83 J;  1BR4 A;  1Z05 A;  4LG3 A;  4ZC3 A;  4A3G J;  4MLO A;  1IUY A;  2CS3 A;  1YW8 A;  2GXB A;  5GPA A;  1XC5 A;  3TMO A;  4EM1 A;  2VQG A;  1FBS A;  3S32 A;  4AU7 A;  4E7I A;  2FOW A;  4BYY A;  3BG6 A;  2VQL A;  1TWG J;  5ICF A;  2HDC A;  2E5N A;  1TWC J;  3P7N A;  3RSN A;  4DYC A;  1O57 A;  3AFH A;  4PJL A;  2E35 A;  4G94 A;  4OAZ A;  3OYG A;  1WJA A;  4L9V A;  4A0Z A;  1UG2 A;  1FBQ A;  1TW3 A;  4U0Y A;  1BL0 A;  3CTA A;  2LOO A;  2R7Z J;  1KQ8 A;  1IRX A;  2CUZ A;  2V1N A;  2JUC A;  4ZYH A;  4IRI A;  2LBF A;  2EBI A;  2CUJ A;  4PGH A;  3M07 A;  5HDN A;  2MBF A;  2NVT J;  1QGP A;  2FE3 A;  1N75 A;  1ZKG A;  3KP2 A;  3EQL F;  4Z2Y A;  2A07 F;  1PP8 F;  4G6T B;  4N9I A;  2VKV A;  2BHZ A;  2PJP A;  1ZHF A;  2ADU A;  4LD5 A;  1Y6I A;  2MC4 A;  3FXQ A;  4BEH B;  4X1E A;  5HS7 A;  3R4K A;  4X6A J;  2B9S A;  3GME A;  5KNL A;  5CVR A;  1HKS A;  5FB2 A;  3CES A;  3E5X A;  4BAC A;  3WG7 H;  4YFX F;  3BR2 A;  3ZN0 A;  2EIM H;  5JHF A;  2DPU A;  2R7X A;  2F5D A;  2KRC A;  2VT3 A;  4BQN A;  2BY0 A;  3R6S A;  5KCM A;  2DDA A;  3CCY A;  4QLC U;  4S04 A;  1Z7U A;  3FHZ A;  4ENK A;  2QZ8 A;  4RA2 A;  3J7A Y;  2BHY A;  3R60 A;  1SFO J;  2HPM A;  1G4D A;  1WGX A;  3WE3 A;  3A01 A;  3R61 A;  3ZRG A;  3S2D J;  3ZP5 A;  2H27 A;  2O03 A;  4UHT A;  1A31 A;  3JRF A;  1OJL A;  2IA1 A;  2O6G E;  4EGY A;  2DA6 A;  2VAS A;  3ECH A;  3ZMV A;  2LKS A;  2VBX A;  4MIM A;  2X6O A;  2BGC A;  5JVG F;  3GEZ A;  2HOS A;  2O8X A;  2HOE A;  1IN8 A;  2XF7 A;  1XSX A;  1Z6T A;  1WWX A;  3K4C A;  4FE7 A;  2DYR H;  4RGX A;  1WJB A;  2D1H A;  2BBY A;  2E5Z A;  3LL7 A;  5BPI A;  3OR1 C;  1ZYR F;  3SZG A;  1B72 A;  1RR7 A;  2GOM A;  3WTW C;  1USS A;  3O6B B;  2M9H A;  3Q0W A;  4D7N A;  3N97 A;  1QVT A;  2XPV A;  2M2E A;  2VB6 A;  3GBG A;  5FGM A;  2LY2 A;  3K2Z A;  3BCB A;  3MMY B;  2K9Q A;  2NXN B;  3FKJ A;  3CMM A;  4N4N B;  2WV0 A;  4HNT A;  1LVK A;  1W7P A;  4NHJ A;  5E18 F;  1OR7 A;  5B66 C;  1KU3 A;  4B3X A;  2A05 A;  1TNS A;  3EPZ A;  3FIW A;  2W24 A;  2WAD A;  2MH9 A;  1U5T C;  3K4K A;  2XV4 S;  1FP1 D;  5DCM A;  2VKD A;  4G8X A;  3DKY A;  4A6E A;  2RQQ A;  2VIX A;  4ETS A;  5CVJ A;  3IH2 A;  1GUU A;  2RVC A;  2W57 A;  3E7L A;  4BHB A;  2DA1 A;  2GXG A;  3KYD B;  3CF5 F;  5EG0 A;  5LHG A;  5HLI A;  1EH6 A;  3CLO A;  3S3M A;  2DPD A;  4B43 A;  2F4O B;  1HXD A;  4A3E J;  4XLP F;  1IZ1 A;  4Y3O A;  1T56 A;  2V26 A;  4V19 K;  2JWT A;  1RI7 A;  2DU9 A;  2P4W A;  2LRE A;  2P5V A;  3WTT C;  3C2G A;  3KP5 A;  4EJW A;  3W2W A;  3DEW A;  4UUS B;  4L5J A;  2QLZ A;  4ABZ A;  2L7M P;  4E7S A;  2KDZ A;  1BI3 A;  3F8F A;  1T0F A;  2PJR A;  3PSF A;  3A4C A;  4II3 A;  4XBF A;  3L1P A;  4F3Q A;  1VTN C;  1Z3Y A;  5LGT A;  3CC4 I;  3TDU C;  5DEQ A;  1PVE A;  2EWN A;  4I02 A;  3D1N I;  1OCR H;  1MMN A;  4K2E A;  4BJ5 C;  2HTJ A;  3HHH A;  2I10 A;  4TV7 A;  4HX8 A;  5LLQ A;  2UV1 A;  2Y48 A;  1JHH A;  1VF9 A;  4IF4 A;  4P9U A;  2HDD A;  1BW5 A;  5FKK A;  1QU3 A;  1MNE A;  3F22 A;  4W1U A;  2F4I A;  2BVM A;  4LLL A;  4FE4 A;  4RAG A;  1NTC A;  1YW7 A;  2BXY A;  3LSI A;  1WH7 A;  3WHC A;  5DUK A;  3JRI A;  1XD7 A;  1XCB A;  3HUG B;  4IRG A;  4HX4 A;  4A5M A;  3PNT A;  2R7V A;  1FNN A;  2XAQ A;  3K4J A;  2HXO A;  1ERD A;  1N25 A;  2VQH A;  4ESF A;  5KHD A;  1T98 A;  4A3C J;  1JXS A;  1S3J A;  4S0H B;  2C6Y A;  1IC8 A;  4LG0 B;  3MZY A;  4A3J J;  1TQM A;  2DT6 A;  3QP5 A;  2KIS A;  2X85 A;  5K7Z A;  1VQ8 I;  2J5P A;  3K9T A;  1LDK B;  4PZJ A;  3CC2 I;  3H3V K;  2R7O A;  2JA2 A;  5AIP A;  1X4P A;  2FSW A;  3DBR B;  4BEH A;  2A3S A;  4M74 A;  4XMY A;  3KX2 A;  3ZGK A;  1GV5 A;  5IY5 H;  4NBQ A;  4HLX A;  4GYG A;  4CH7 A;  1PUE E;  2FJ1 A;  3FMS A;  1MMD A;  1OCZ H;  2XGX A;  1Z91 A;  1CQT A;  5D6E A;  3E0J B;  2D1V A;  4C2U A;  5GAD J;  2UXX A;  4PJN A;  4DQ2 A;  2H6B A;  1CF7 B;  1YO5 C;  5TGT A;  4HDU A;  1BI2 A;  4JK1 X;  2G7H A;  1XMK A;  2RNG A;  1WJE A;  2ZME C;  3NEU A;  3NWT A;  3S1R J;  1YX3 A;  3DU5 A;  2W82 A;  2K7L A;  4EJU A;  1FIP A;  3ZQG A;  4PSX A;  2LC2 A;  3JR9 A;  3B6A A;  2V1D A;  3MKZ A;  3H9Q A;  1Q1H A;  1D5V A;  3OIO A;  4IXA A;  4CZZ A;  4ENN A;  4HF1 A;  2HWV A;  1X1D A;  2Y75 A;  3COA C;  5IOZ A;  2GBY A;  4LK1 F;  1JKP C;  2EFQ A;  1SFK A;  3BG9 A;  3CCU I;  2MAB A;  3RPU D;  4E7L A;  1JKQ C;  1GXQ A;  1TTY A;  4BS9 A;  4DZP A;  4FHT A;  4CCM A;  1GT0 C;  1JTY A;  2OAZ A;  3EUK L;  2PQ8 A;  3CP8 A;  2VJ4 A;  3HEF A;  3M8J A;  2M87 A;  1LUJ B;  4LJZ F;  4A93 J;  3OYA A;  1VI0 A;  4IX7 A;  2PMZ N;  5KVR A;  1YIJ I;  1GXP A;  1YS7 A;  2HZD A;  4IQ4 A;  2OTL I;  2OZ6 A;  2W7N A;  4CIC A;  2R7U A;  5J47 A;  1TZL A;  1P7J A;  2QBY A;  1JT0 A;  2E1M C;  2ACJ A;  3OYC A;  4L9J A;  1W36 D;  2Z16 A;  2WTE A;  5F0H A;  4HG2 A;  3JTH A;  2QSH X;  2HFH A;  3IV5 A;  1MJA A;  2QUF A;  2E34 A;  3CF2 A;  1UEL B;  2DLL A;  3GZN B;  1ZEL A;  2QA4 I;  3LST A;  1FYM A;  2Z33 A;  1IGN A;  2CUE A;  1AOY A;  2E1N A;  2V9V A;  2LG4 A;  3SDB A;  4EJT A;  3QYE A;  1JUS A;  3WU1 B;  4AC0 A;  2HVS A;  3VOE A;  2A69 F;  3I5U A;  1MMG A;  1RR8 C;  1SD6 A;  2HKX A;  1FY7 A;  2QSF X;  4GGG A;  2DDB A;  2JPB A;  3AKZ A; 
#chains in the Genus database with same CATH homology
 3AG1 H;  2EIJ H;  5B1B H;  2Y69 H;  1V55 H;  5B3S H;  3ASO H;  3WG7 H;  2OCC H;  1OCR H;  3ABL H;  2EIM H;  2ZXW H;  1V54 H;  1OCO H;  5IY5 H;  3ABM H;  3AG2 H;  2EIK H;  3X2Q H;  2EIN H;  2DYR H;  2DYS H;  1OCZ H;  2EIL H;  3ASN H;  1OCC H;  3ABK H;  3AG4 H;  5B1A H;  3AG3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...