3WG7H

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3wg7H00
1OCOH 1V54H 1OCRH 3ABKH 3ABLH 5B1AH 1OCZH 3ASNH 5IY5H 2ZXWH 1V55H 3WG7H 2EILH 2DYRH 1OCCH 2OCCH 2EIJH 2EINH 3AG3H 3X2QH 2EIMH 3AG2H 3ASOH 2DYSH 2Y69H 3AG1H 3AG4H 5B3SH 5B1BH 3ABMH 2EIKH
chains in the Genus database with same CATH superfamily
3EYYA 2R7TA 3SDGA 2XB0X 2PJPA 1OYIA 3DQVC 2LOOA 3V7SA 2HQAA 2PX9A 1MJ9A 2BEOA 1ZELA 4HEA2 2O61A 3M07A 4B3AA 1A35A 2NYXA 4ZDOA 1HSJA 2L02A 1IN8A 3GBGA 3TP0A 1E0EA 1HW1A 3I4PA 3O6BB 4NUBA 2Y0SN 2HOEA 4ESBA 4GYGA 4BQAA 2GQQA 2CQKA 4WK8F 3GTLJ 4B1RA 3CCQI 1OPCA 5FD5A 4J01A 1MMAA 3S93A 3FF5A 3FM5A 3F8NA 4MEXF 4PK4A 3NQOA 2VQHA 3COAC 3OL3A 2GBYA 1W36D 3QYFA 3HOVJ 1B9MA 3E6CC 3GUDA 3Q0UA 4XM3A 4MHGA 4BYYA 2ZJQF 2R7QA 1IC8A 4I7HA 1DDNA 2VOPA 5HLTA 4EGZA 5K5RA 3IL2A 3J7AO 3P5JA 2L4AA 3K1PA 4X0GA 3LL7A 1T0FA 4JX5A 1EH8A 1LVAA 1NH3A 3SFZA 2BW3A 4GCVA 2DDAA 4MQ9F 4DIQA 3KCCA 1MZBA 2F5VA 3KIOA 2HI3A 2CG4A 3KEOA 2JQ7A 1Z1DA 1LFPA 4IZZA 3L2CA 1TQMA 3LSRA 2LY1A 4HF0A 4CXFA 3R6SA 3OS0A 4IHVA 5EG0B 2BHZA 3PUBA 4IF4A 2JRMA 5FROA 1UCRA 1D8KA 4OU0A 3L9FA 1PVEA 2HDDA 4P55A 4I0BA 1S29A 1ITYA 4D7MA 4LB5A 3BR1A 3EPZA 3HG9A 3QPTA 3CC7I 3KE2A 1KU9A 1WQ2A 3GTGJ 4JOMA 4BY7J 4P9FA 1U78A 4CYCB 4OMZA 5CJ9A 3LNQA 4EM0B 3EYIA 1UFMA 4CCNA 3JRHA 2UZKA 4HRIA 2BYVE 2A6TA 4HDUA 2HOSA 4DYQA 2X6OA 3GZNB 2QM3A 3I9V2 2HTSA 3RDIA 3KFWX 3G1MA 1V5GA 3V42A 2VBYA 4C2TA 5IT9Z 3S2DJ 1XPXA 2V9VA 4XNFA 2C6YA 4D0PA 4Q47A 3HEFA 5L3GA 4IJAA 5ICEA 1FWZA 3GZ5A 5BPDA 3OIPA 4ZYEA 1FTZA 3ABMH 1K61A 1FYMA 3KYCB 1ZK8A 3KZYA 3OIOA 3IC7A 2OQRA 2BY2A 1R71A 3EUHC 3GFMA 6PAXA 2HKOA 3BY6A 2QF7A 4PGGA 1PUFA 3E5XA 3FXOA 4A3JJ 4N9IA 5JHUA 2EILH 1MDMB 3A0HC 2PBIA 2FOKA 3RJPA 5FKOA 2UV1A 1OR7A 2H1LA 4XKWA 1N25A 3GFLA 2WB1N 1UHSA 3QPLA 1U8RA 3FBNB 4KJZA 1B72A 4Y33A 1WJCA 2E7XA 4XR6A 3HRMA 2FEZA 4UVAA 1R4MB 2XKPA 1TTYA 3QYBA 3EUAA 5IT9K 5KAIC 3TDUC 4LMYA 4Y13A 2K7LA 2ZXIA 3HSEA 2Z5UA 3E3VA 3IHUA 2GA1A 4DOZA 2XAFA 3HXLA 2QWWA 2CRGA 4BACA 1R1VA 2VL8A 3VWBA 4N4NB 4E4HA 4IQJA 1ZHFA 3WTSC 3JTGA 4GYIA 1J09A 1HCRA 3CJNA 2ME0A 1RKWA 1QNTA 3DTIA 2BY0A 3S16J 2J5PA 3LSHA 2ECBA 1D1AA 1Z6RA 3OMYA 5B1BH 5ICGA 4MTDA 1KQ0A 2MW8A 1LB2A 3RZOJ 2KHMA 2JRTA 4LLLA 3H9GA 3CLOA 2LNBA 1NG6A 3GWZA 5LHHA 3CD6I 3L00A 1JHFA 1UG2A 2KDOA 4M3GA 1A04A 3ABUA 3OYHA 1ETOA 4PFPA 3GTQJ 5J4YA 5J47A 1CF7A 3GF2A 2XASA 4S04A 2ZJ2A 3I53A 2M0MA 4RB3C 1LEBA 2XB5A 5GTHC 3MFKA 1O3RA 3CC2I 1SFUA 1UMQA 4AWXB 4YIFA 3JAMZ 1S7AA 4YIRX 3A02A 1TNTA 4BKXA 2CO5A 5FFXA 2AXTC 2HPIA 4LJZF 1DGWY 2K4BA 1RNLA 1FOWA 2QBYA 4OINF 1YJNI 1T8IA 2DA7A 1LE8B 5M3FJ 2PMZA 4MFDA 1YFHA 5FKKA 3D5SC 4D9JA 3ZR8X 4BJ5C 3IUOA 3HOXJ 1GDTA 3G1LA 3GXOA 3CCLI 2L7KA 1LFBA 2VC0A 2OTLI 2G0EA 3N97A 4IX7A 1IN4A 4NNJA 2W57A 3A1YA 4F93B 4E7JA 3HC7A 2DOFA 2ZJPF 4A3DJ 1X1AA 1T0FC 2RKHA 3W2AA 2M7AA 3HOUJ 5EGOB 4A3KJ 1PJRA 2R7DA 4KUMA 2O6GE 2LY2A 3CUQA 3JAMK 1Z7UA 1D8JA 1U9OA 2KIUA 3KP6A 2EZHA 3DCFA 4UB8C 1VTNC 3CF2A 2EPFA 4L9TA 1AKHB 3RKWA 2DPUA 2R7ZJ 1APLC 2HNHA 2OZUA 3P9IA 4RGUA 1N78A 4M72A 3I59A 1FBUA 3PNVA 4HX4A 1FOYA 1Q1HA 4BJTA 2NS8A 3WGHA 5GP9A 4FCYA 2FA5A 3K70C 2M4KA 4G94A 4HSRA 3JRFA 5J8FA 4E7KA 2ZC2A 1DP3A 4BU2A 2L4MA 5DM7F 4B43A 4AIJA 2WV1A 2R7WA 3KZZA 1BN5A 1G3SA 2F4IA 4RGSA 1O3TA 2NOGA 1MBHA 3PQJA 3IH3A 4C3IJ 2ZFWA 5J8CA 4XL9A 4B47A 1RR8C 4RLFA 5B5EC 5GTIC 4HLYA 4EJUA 1R23A 1DGRM 3FX3A 3FMQA 2E1MB 2XAJA 1SD5A 2MH9A 3EUKL 5E1XA 2VPLA 2UXXA 3CMMA 4YFKF 5M5WJ 5L3CA 3OOUA 4EVIA 2E2HJ 2VBZA 4NQWB 5LFAA 1XDUA 1VI0A 3NWSA 1G59A 4IHYA 1FLIA 4UVCA 3HBLA 2V26A 4BE2A 4MNUA 3T8RA 1FX7A 1J5YA 3LA7A 4PJLA 2GXBA 5A2QK 1V54H 1IXCA 1UHMA 1BOAA 4RGRA 2I8DA 4M71A 2F5CA 2LY9A 4CYDA 3I54A 3TP3A 1JJ6C 2W25A 3IH2A 2CMPA 3CCSI 4ZYGA 4PGHA 3IV5A 1VNDA 2L9RA 1OR7C 2VXZA 3H0DA 1USSA 3FKIJ 5F6FA 3OYKA 4R1HA 1HSTA 2RC4A 5L3EA 3AG3H 2WTEA 4FHTA 5D5UB 4PJJA 3FXMA 4E7LA 2IXSA 2O3FA 2XAHA 4GO1A 2M45A 2V9PA 2R7RA 4LK1F 1EJ9A 2CW7A 3QPHA 3K4CA 3BG9A 2KIQA 2BBYA 2L2OA 1RUNA 2YS9A 3DXJF 4WX9A 1W1WE 1UZCA 4M9SA 1HW2A 2Z1DA 1BW6A 4LIVA 2FNAA 1FP1D 5DS9A 5KCMA 2WAQA 1XSXA 2HZDA 1Y56A 2STTA 3NAUA 4CCLA 2L7FP 1FYLA 4M6XA 4YFXF 4HF2A 5FLVA 2ME6A 1XDSA 3R60A 4BL0B 2H6CA 2ZB9A 2Q2EA 2X6YA 4RB0A 4IOAF 1QQIA 2O8KA 2W82A 1X19A 1RPWA 4G12A 2Z2SB 2JPBA 4X1EA 3ZMTA 1ZYRF 3F8BA 4ITVA 5TGTA 1LPQA 1TQIA 2ELKA 4OIRF 1R49A 1ZAOA 4M6YA 2KP6A 3G3ZA 3LQRA 2XAQA 2R5YB 2W7NA 3R0JA 1PYVA 5H6RA 2ZXWH 4H0EA 1BW5A 3J7YJ 4I02A 1QPMA 5TRDA 2Z33A 2EFWA 2IAIA 1TL8A 1XB4A 4BQOA 2TDXA 2M2EA 4QLCU 1Z3XA 3QU3A 1W0TA 2VKHA 4L9NA 2CSOA 3DTEA 2VC1A 3CJTB 3BZCA 1ODDA 3X2QH 5IP7J 3LSPA 3ULQB 1VQPI 3ZQCA 3TBIA 2MABA 2IBDA 2IGOA 3F3XA 1VQ5I 4A93J 2ZBKA 2EZLA 2Y69H 2FMYA 1XSVA 3ELKA 2RDPA 2VJJA 1ZGAA 4HLXA 4MFEA 1UAAA 1IGNA 1H8AC 1MMGA 4ZYHA 1MBKA 4BUPA 1STZA 3REOA 4E7ZA 4A6DA 2OQGA 2MH2A 4F91B 3CMEI 2XPWA 2K86A 1V5EA 3OV8A 1K79A 1YW9A 4B09A 2XF6A 4M74A 2L0KA 3U2RA 5M5YJ 4A0XA 4JYKA 1Y1WJ 2DBBA 5K7FA 1O7FA 2DT5A 2PQ8A 1WJ5A 3C1DA 4I6ZA 1RUOA 3FXLA 2KRHA 2VPRA 4L9VA 3E6DA 3D5LA 2RAEA 3FMRA 5AIQA 2IGKA 3HJEA 4XRSG 2KQRA 1BA5A 3VEPA 2Z3YA 2MBFA 3J7AY 3PJRA 2RQQA 3ZPLA 5TISC 1REPC 1MBGA 3HOWJ 3BT9A 5HDGA 3J81Z 1KGSA 2RQPA 3BDDA 1U6GA 2Y2ZA 2DQRA 3CUQC 1RR7A 2O5RA 3F6VA 2EIMH 2X9DA 3BTIA 3BR3A 2HQRA 3RQ4A 4M73A 4A0YA 3BPXA 5KVRA 3AFHA 4M9ZA 1RKTA 2OV7A 4IXAA 4F3QA 1Z67A 4CICA 2P6SA 3RPQA 3BTLA 2VE8A 1ON1A 3I64A 5EZHA 2DPDA 5HVQC 5ICCA 2QBYB 4BXUA 1BM9A 4XRMA 4WWCA 2D1VA 2VOOA 3MN2A 5JVTA 2HVRA 5IP9J 1W5SA 4BBRJ 3B02A 1E3PA 3V4GA 2WAFA 3CCUI 4N0BA 3H1CA 3J81K 1K4SA 4AYBN 3H36A 3IAS2 2B63J 3ZQGA 5GPAA 3BG7A 1YJWI 1K83J 4CCKA 4DBQA 4IO9F 1JHHA 1UG0A 1SVLA 2OF7A 1SMYF 3BZ6A 4G6TB 5E79C 4KA4A 1SVOA 1FSEA 2IA0A 4KDPA 1SD7A 1IN5A 2ZNYA 1YW8A 4FISA 5IYDJ 1K6OA 5FKNA 1ZQ3P 5FB2A 3OYJA 4C9YA 3BQZA 4XKCA 2GWRA 5CQEA 4ENJA 1F4KA 2DMPA 4XKBA 2E71A 3VYSB 5D5VB 3BR0A 4IQ4A 2CUFA 1OYWA 3R61A 4ESJA 2VE9A 3U1KA 3BLYA 5B66C 2XUBA 3BR5A 2K9QA 2UWMA 2GAUA 5DCMA 5ERIA 3OSFA 3WTYC 3CESA 3F21A 3H35A 2FBHA 2L9NA 2N8GA 1QZYA 2DJIA 2F5DA 2A5WA 2H6BA 3B73A 3H9JA 2ETHA 2PFBA 2V6CA 2JA8J 5LBQA 4M3EA 4BNCA 1I39A 3EUHA 1H0MA 2LRDA 2LBFA 3HKZN 4A0ZA 1TWHJ 3A2KA 5GAGJ 1W7PB 4D1QA 5D4RA 1JT0A 1IDYA 2X51A 3EQLF 4J19A 2HPMA 2JSPA 1HDDC 1S5LC 1EH7A 4UUVA 2CQQA 5F0CA 4RS8A 2WC2A 2YU3A 2M9HA 4AD9A 2E34A 2EH3A 3CMYA 5HNFA 4WXCA 1VQOI 1HKQA 5CVUA 5HOOA 4IKFA 3Q9SA 3EETA 3BR2A 4CA0A 5EZGA 2VI6A 2JMWA 2V79A 4RAZA 5IOZA 1LDJA 1TWCJ 4BDZA 2AXLA 3W2WA 2IS4A 2STWA 2JPCA 2JK3A 2QCOA 4G9YA 2JWTA 2X1CA 4B8XA 4BHCA 2ISYA 4XORA 4LLNA 3DKXA 2K27A 2NOJB 4I98B 3CDLA 4RAYA 3WGGA 4IHSA 4BH9A 3K7AJ 4CSWA 1D0XA 2P81A 2NVTJ 2FJ1A 3Q9VA 4ZH4F 2HGCA 2KLOA 1DU0A 1OCPA 2LR8A 5CVIA 5HS7A 5HODA 4ABZA 1FMVA 3AG1H 3GTMJ 3KEYA 3M8JA 2CV1A 1QHGA 1WI3A 3CTAA 1ON2A 1ZRFA 5L3FA 1R22A 3TDZC 2LREA 2QUFA 1T08B 1XTAA 3GTKJ 1QZZA 3PSFA 1HDPA 2KDZA 2BZTA 4M3BA 3H9QA 2D1HA 2RVCA 2PJRB 4OMYA 1V3FA 1YQAA 3S32A 1OCCH 1IXSB 3V7RA 1B8IB 2ESHA 1DPRA 2EIJH 2CV2A 2K4JA 4A5MA 3ROUA 3GFJA 2XIGA 2D2WA 2ZMEB 5BQTA 1TW2A 2DOEA 3O8GA 3BWGA 4ON0A 1RESA 3DEEA 2VJ5A 4UHTA 1I3QJ 2A68F 1YRNB 4H4KC 4Q48A 4L0ZB 3CCYA 3ERED 5TJJA 3RI4A 2GOXB 3H3UA 1X3ZB 2CS3A 3GO5A 2AS5F 2R4GA 1VF9A 1KU2A 2JUGA 4MQVA 2KKOA 2XGXA 5E3NA 4YFNF 5KAFC 4WXHA 1BL0A 3FWEA 3K4KA 1F9NA 4XICA 3OSGA 3UR3C 1WVRA 1JTXA 3DTKA 3FK6A 1XG1A 2VT2A 4FX0A 2ID3A 3KLNA 1E17A 4QTRA 4JP0A 3K69A 4B48A 5FLXZ 3SQNA 2P8TA 1SD6A 2MFZA 3OYEA 3IRQA 3RQIA 3Q5FA 1YITI 2R7VA 3Q0WA 3HHGA 3P9KA 5LRRA 3SZGA 1OCOH 1POGA 2M7BA 2W1OA 1MMDA 4UV9A 2GLOA 4CZCA 1Y1VJ 3QWLA 5EDNA 2IRFG 4ENNA 1QRYA 2X0LA 3ZQFA 4DYRA 1WJAA 2ZXJA 3ZMUA 2R3SA 3SDBA 3RIRA 1Z0XA 3R4KA 2QQ8A 4HZFA 1Y8RB 3I4NJ 3NARA 2BVLA 1W36C 3GVAA 3GEZA 4M9XA 1Z3YA 1Q1VA 4XONA 2XPUA 4OAZA 3N05A 3S3NA 1OJLA 1USTA 1S7OA 2BGCA 3L2QA 4KITB 1IUYA 3LFUA 5FLMJ 5ILUA 3GLXA 1X1PA 4EQQA 4ZZDA 4JBAA 5FLXK 4AIKA 4KT5C 1B59A 4XOTA 5D8LB 3GCMA 1R7JA 2V4JC 3DLLF 2XRLA 1MKMA 3OOPA 4HA8A 5ILVA 1NK3P 2DW4A 3A0BC 2HKXA 5J3LA 1LUJB 4O3MA 1MW7A 2K9MA 2LTPA 3CCVI 2YU9J 3WE2A 3JW4A 2JSCA 1I50J 1IJWC 1WRJA 2V1NA 1X1DA 3JRGA 1X1CA 4UV8A 2XDVA 1Z21A 2OUMA 5EYRA 3DBRB 1R1UA 2IA2A 2NXNB 5JHFA 1MNDA 1P2FA 3MKYB 1WH5A 4AIDA 4S0HB 3S3MA 1ZH5A 1Y0NA 1GVDA 3NWTA 3Q0VA 2GXGA 1ENHA 2Y30A 1IV6A 2FE3A 1W0UA 4I09A 2R5ZB 1BI0A 3HGYA 2GIVA 2K9LA 3V8LA 4F52A 2QSGX 1ETQA 1MNMC 1FC3A 3CO6C 1BIAA 5EEHA 2FQ4A 1OCTC 3UKGA 1TC3C 3M7GA 2LF8A 1LFUP 3F8FA 3KP5A 1HC8A 1AOYA 2CW8A 3F22A 5EJCA 3TGNA 1I1GA 3OL4A 3I4MJ 2XF5A 2XVCA 4PCQA 3QP6A 3A01A 1KZHA 1N77A 3DWLE 4I2OA 3M3YJ 2RNJA 3TMOA 1D3YA 1SFXA 4U7DA 4MO7A 3WTZA 2F4OB 1TQPA 3ZGKA 1BI2A 4UUSB 2EJRA 3ASNH 2Q8KA 1AU7A 2CU7A 5E3MA 3OYIA 2JJ7A 2HEOA 1HQCA 1YX3A 3PO2J 1Z6TA 2HOAA 3ISPA 1T33A 1VZ0A 2DLLA 2UUZA 2L7ZA 2IEKA 3OYMA 5IT3A 1TNSA 3ASOH 4KNYA 3FDYA 1R9TJ 1FIPA 1YYVA 3DEUA 4LGWA 3RKXA 4ZDPA 1GV2A 4BS9A 1RRJA 2BHYA 4BXXJ 3M9AA 4S05A 3F6OA 2I10A 2KRFA 3K4BA 4A69C 4HF1A 4PDKA 3TEDA 2M1BA 2OCEA 3WU0A 3I55I 2DA2A 3FHNA 1YLFA 3KP3A 2RN7A 4F92B 5E3OA 4W1UA 2IGMA 4KMUX 4PSWA 1WI9A 3QU6A 4XMYA 1ETYA 5HLIA 1ZLJA 2KJBA 4WXDA 3JR9A 2ZSIB 1Z91A 2KZGA 2K9NA 3HRTA 1H9TA 5L3DA 4DJAA 3SJMA 1TT5B 1XCBA 3QYEA 2OU2A 2XKOA 4GDFA 1ETKA 2NVXJ 2HS5A 2V7FA 3N4MA 1ORKA 1ZR4A 3U9GA 1RI7A 4L5EA 3OYBA 1IUFA 3CP2A 1F43A 5LGNA 1YE9A 2JT1A 1HKSA 1SFEA 5DCFA 4PZJA 1AA7A 2VQLA 2AQFA 4ESFA 1YI2I 2E35A 2CGPA 4BGDA 2CFOA 4P96A 3FXQA 2D45A 2KFDA 1YHQI 5J1RA 4OIOF 2LH9A 3FXUA 2OJED 3PFYA 4DZPA 2UXNA 1XMXA 4U87A 1IN7A 3WTUC 2NNNA 2YX7A 4XSXF 3KEQA 1VQ8I 1FPQA 3FZVA 2EZIA 2Z9OA 5IYBJ 3ONQA 4QPOA 5E1WA 4IVNA 4NDLA 4BEHA 3ESWB 3WHBA 4FT8A 2XGEA 2P0WA 5E17F 5J40A 3TO6A 1B4AA 2V1DA 4Y3OA 4PUSA 1ACIA 3E0JB 1IRFA 3RYRA 2VONA 3JSPA 3BTJA 3HZJA 2X1DA 3RYPA 3E97A 3MZYA 4RA2A 4E7HA 3ZCOA 3T1BA 4CCJA 1J59A 4Z2YA 4IHWA 2BW3B 2K40A 1HKTA 3TOAA 1MSEC 2JA5J 4L18B 2WADA 2MLGA 4AUXA 2NRAC 4FASD 3TOBA 1ZRCA 1MBJA 3S2WA 3JRCA 2H27A 3OS2A 3K9TA 4A3MJ 1XSDA 2HWVA 2Z16A 3HOZJ 4G6DA 2AHQA 3OR1C 3P9CA 2BY3A 2R93J 2K85A 2B9SA 1H89C 3ZQHA 3ZQLA 5D6EA 1I27A 1CQTA 2EFOA 2EB7A 5H6QA 5HS9A 2FOWA 2HXIA 1H9GA 1KONA 4CCMA 2F5EA 4BHPA 3E1SA 1JKRC 2IA1A 1GLNA 4Y52J 1P92A 5F1RA 1G6NA 3VB2A 3T5XA 5C44J 1QU3A 1U9NA 2F4MB 2XC7A 1QZEA 2E60A 1FBQA 4RB1A 1YS7A 5DEQA 3EDPA 2EBIA 1QGPA 2VKEA 2BOLA 1S7EA 1U5TA 2HXOA 2RREA 5E18F 1SVMA 3IAM2 2IPQX 4FE4A 3ZMVA 9ANTA 1C0WA 3W2VA 1GXQA 4Y7NJ 3O8HA 2OZ6A 4A3EJ 3DBLB 4PJMA 1SFOJ 2XAGA 2DFEA 5C4XJ 2CQ7A 2FBIA 2DJNA 1P4AA 3HUGA 4LITA 2OCCH 1D1BA 2DFHA 4AYBA 4D5CA 4K2EA 3BG6A 2H94A 4KMFA 3DKWA 4KYWA 2WBMA 3FISA 4A5NA 3ABTA 2R7FA 3S2HJ 2NVYJ 1PUFB 1NK2P 1HBXG 1SFKA 2DT7B 1QPIA 3AL0C 1FOXA 2FMLA 2QEXI 1L0OC 3S8PA 3D1NI 1ZR2A 3H92A 4OAYA 2R7UA 5DUIA 1B72B 2DK8A 1XN7A 3E5QA 1FP2A 4UY8I 3S17J 2FUG2 4IRIA 3QQAA 4O6JA 2B0LA 3M8EA 2K3FA 4NC8A 2E19A 1W5TA 1FOKA 2M3AA 4GGGA 5E20A 3JCUC 2HYGD 2DYSH 3AG4H 3SFIA 3G71I 1BIBA 3SYTA 1VQNI 2KZVA 1A6IA 2ID6A 2QQBA 2KL4A 5ILSA 3HSFA 3TL4X 4C2UA 3HM5A 3W3CA 4HNTA 3IKTA 4MTEA 1WJEA 4NBQA 2DN0A 3K0LA 2HVSA 4NC7A 1EH6A 2VKDA 1SMTA 3WE3A 3HKZA 1S72I 2HZTA 5EF6A 4EJWA 3ZN1A 4KN4X 1H88C 1XGNA 2V1UA 2W48A 3HRSA 1TZLA 5FJ8J 4M3DA 4BE0A 1TP4A 2JA2A 1KYWA 3FXKA 1R5ID 2IGNA 1MBFA 3K4NA 5EEGA 4L5IA 3CMAI 2DAOA 1WWXA 5IPAA 1KU3A 3JSOA 3MKZA 3V8JA 1LDDA 1RETA 2DA4A 3ML6A 2O8XA 1CF7B 3ZMDA 2K9SA 4OOIA 2QKLB 1SAXA 3WTWC 3DU5A 4HAMA 4ASNA 2IJLA 3KP2A 3C2GA 5J6XA 3KP7A 3U1DA 1MNEA 2OTJI 1TW3A 4JX4A 2H8WA 5HNHA 4DNCA 1B6AA 1DU6A 3M1CA 5J1UA 5KK1A 4A3CJ 4AIHA 4BXFA 1NG7A 4LB6B 3F23A 3JTHA 3HOSA 3BTCA 3V8KA 4BY1J 3VODA 2CYYA 1W7PD 1F1ZA 3WU2C 4UXNA 1BR2A 3LSIA 2WWYA 4ETSA 3GLLA 1J7KA 4FQGA 4CYCA 2ZKZA 5FKMA 4AVZA 3LSKA 1IAWA 3I58A 4ENKA 2VT3A 4AC0A 3K4JA 2VBXA 2KT0A 3J80Z 3ZRGA 3SXYA 1ERDA 2EZKA 2IP2A 1PP7U 3HTUA 2BY1A 1JUSA 2I5UA 2X85A 1YG2A 4HQMA 4PJ0C 2CW0F 3PIPF 4XLEA 3S1QJ 3FM3A 1LEAA 3L2WA 2JTVA 4UUTA 2IS1A 4KN7X 3F8MA 2FU4A 5J1YA 3CUQB 1BOBA 3HOTA 4BE1A 1HF0A 3MCZA 4FE7A 1U2WA 2Y0SA 2DOAA 4NC6A 3KLOA 2ZCWA 1HOMA 3VYRB 2DMUA 4UVBA 1ZREA 2WAQN 3LSMA 5FD6A 2HYJA 3I59B 3E6BA 1ETWA 4FETA 3F8CA 1IRGA 2DTZA 2EV5A 3PSIA 2QLZA 3KYLA 3GYHX 3F0CA 2LF7A 3KETA 4PSXA 2QA4I 2O9LA 2PI0A 1G3WA 4YELA 1NHAA 3J80K 4V2GA 2JA7J 2W24A 2DODA 5HS8A 1OCZH 4HBLA 3IKVA 4U7BA 2G9WA 4LK0F 4EGYA 3W6KB 4D7NA 2DCEA 2HYFA 4JQFA 4XBFA 1ZG1A 2R7SA 1X4OA 3MD2A 2HVQA 3ECHA 5E1ZB 2Q0OA 1U5TC 1MJAA 3O2PE 2ESNA 3A4CA 4PFOA 1GV5A 5FO5A 1FYKA 2M8EA 3L09A 3CDHA 3S15J 3DPLC 1T38A 1MBEA 4R79A 4OIQF 2JVHA 3ZQQA 1KQ9A 1XS9A 4Y4RA 2P6TA 3I3LA 3L1PA 2M30A 2ZJRF 1I6XA 5F0FA 2DMTA 1YO5C 3C18A 1X3WB 3HGGA 3DPUA 1M1EB 2HR3A 3FBIB 2J5OA 3NEUA 4QPQA 1BI3A 4LD5A 2Y75A 1J9IA 1F5TA 3PO3J 1R5HA 3DFGA 5H2FC 3LSGA 2RGVA 1LJ9A 1ZARA 2TCTA 3KX2A 1FMWA 5GADJ 5EEAA 1D0ZA 2KIMA 1ZGWA 2VASA 5IY5H 4HG2A 4DQ2A 2FX0A 1WPKA 2L3DA 3TQNA 4X6AJ 3IWZA 3ZQIA 2OA4A 2LG4A 3BP8A 4XLAA 5GPCA 3JREA 1YOVB 1E3HA 2GOMA 4IL6C 2QYOA 3HPGA 3I5UA 4YIIA 2KJCA 1JT6A 1X2MA 2NS7A 2P5KA 2LKSA 1I1SA 1A36A 2BVMA 4IEJA 2MGQA 1GUUA 3HSRA 3RPUD 2ZSHB 5B3SH 2QQ9A 2E1NA 4ANJA 4EMSA 3E6MA 3M8FA 1B9NA 2KRCA 3ERMA 4CH7A 4XOPA 2NNYA 1J75A 4MLOA 4IOCF 1U3EM 2A07F 5BPIA 3KZIC 2Q2EB 1HA8A 4KICA 3JRBA 1LE8A 1L3LA 1IW7F 3K1MA 4G6QA 2WB1A 5LGTA 2MLKA 3FKJA 2L7MP 3CCEI 5DYMA 3LA2A 1R4NB 1Y6IA 2COMA 3E7LA 2BE5F 4XKVA 1KA8A 1XGSA 2VJIA 4L0YB 1FIAA 2F6CA 1BR1A 2FBKA 1VQKI 1S6LA 4IPAA 3ZQ7A 5EGOA 4LOCA 5HDNA 3K10A 2VBWA 4ZTFA 1BC8C 2E5NA 3QRFF 5D5XB 5DD4A 5H20A 4I76A 2GIZA 3VPRA 1D5VA 5DV5A 3BROA 1AKHA 3PNTA 3HL2A 3CZ6A 5M3MJ 2A61A 1ETXA 5K5OA 2ZXHA 1GVJA 2NAZA 1VQ4I 1ZLKA 1Y0UA 3JRAA 1T2KA 2E2IJ 1LDKB 1EKEA 1FBSA 4XLPF 5JI6A 2VQGA 2Z99A 4Z6YA 3QOEA 2HOTA 1YS6A 1TWGJ 3RSNA 2Y48A 4ZJZA 1QHHD 2E2JJ 4QSHA 5LHGA 2X4HA 2LD5A 1OKRA 1O7LA 4C3JJ 1DPUA 2RNGA 1XD7A 4HNVA 1JGGA 2VODA 2P4WA 1UB9A 3LSJA 4E7IA 1I6HJ 3OWTA 1YIOA 3CCJI 3TO9A 3WU1B 3K2AA 1AWCA 4Q5SF 3CUOA 1D5YA 1ULYA 4G7OF 3BJAA 4F55A 1YX5A 4NQWA 1IXRC 1T98A 5KHDA 4A3LJ 2BXYA 3HPHA 4LG0A 2QSHX 5B1AH 4LFUA 1SANA 3VFZA 1O57A 1F36A 4N9HA 2M34A 3RCOA 4DGWB 3MKWB 1OLTA 2JA6J 2XROA 4KIFA 1JKQC 1TWAJ 1QA6A 2EA2A 2VJ4A 4U0WA 1G3YA 3I71A 2VLAA 2NVQJ 4C2MJ 3DBHB 1GHCA 4BQQA 3OYCA 2E1CA 2HDWA 2XHKA 4MEYF 3GW2A 2X48A 1EF4A 4FX4A 5BS6A 1SAUA 5AONA 2QSFX 3ABLH 4ZC3A 2ZNZA 2YSRA 5LRSA 3OYGA 4Y17A 1IRXA 2XGDA 2DA3A 2ICWG 5LEKA 1K6YA 3UNGC 2GXAA 4V19K 5JFRA 3CCMI 1JJ8C 1X1BA 3L2VA 5DM6F 2OD5A 1LVKA 3W6VA 1A6QA 1J2XA 4EM1A 2JVGA 2QGUA 5M5XJ 2MC3A 3OY9A 1VQ6I 5ED4A 4F7ZA 4P5OA 1WGXA 3G4SI 3S1RJ 2DI3A 1EV7A 1ZRDA 2JN6A 2DFIA 5E8GA 5K7ZA 3ZXSA 2R0QC 2LLKA 2B7EA 2HFHA 1P9QC 1MSFC 4LLGF 5HDKA 1PDNC 3T8TA 3VYTB 3ABKH 4W97A 3SEQA 3F9KA 4M6VA 2Q1ZB 5JR3A 3J7ZI 3WTTC 3G73A 1I3AA 2QENA 3LQQA 2XF7A 3K2ZA 5HLHA 1HLVA 2W85A 3C2HA 1JGSA 2WV0A 4II2A 2CJJA 2XPVA 4QIWN 1BJZA 4EEFG 5LLQA 5CVJA 1K78A 4XK4A 3LA3A 2VKVA 2ISZA 5DCMB 2R5YA 3CDIA 4XQFA 1YIJI 3RTRA 2IS6A 1D0YA 4YG2F 1FT9A 3PM1A 1IZ1A 1MGTA 2JZYA 2LBFB 1BC7C 1OYYA 1WSUA 2DQLA 3H5RA 2FQ3A 4BHBA 4CDGA 3HOYJ 2K02A 2K5CA 2DA6A 1FNNA 1QO0D 3K6GA 1YJ9I 5E3LA 2A3SA 5K7HA 3K4LA 3LMMA 2OBPA 2CUJA 3ZMZA 1O3QA 3L2UA 3NRVA 1T39A 2COBA 3BJ6A 2FXAA 4G7HF 3JRIA 2EV6A 3DLAA 1PUEE 3H3ZA 1DQUA 2V1XA 4CGZA 2KISA 4L9JA 1JTYA 1WH7A 2MSYA 1GXPA 2O7OA 3VDXA 1DP7P 4EJTA 4Q4ZF 4XLCA 2A6HF 2E5ZA 2EINH 4C30A 4A2UA 3JRDA 2WY7Q 4E7SA 2IW5A 2PMHA 5FGMA 3B6AA 5FFZA 2BXZA 1Z05A 2F2EA 1FTTA 4HQEA 1Y8QB 3IRRA 3PNYA 1R00A 5KNLA 3BR6A 2DMQA 1O3SA 4HW0A 2ACJA 1MMSA 2ZFUA 3AAFA 4D5FA 3H5NA 1UJ8A 4G8XA 5F08A 4EM2A 3D5RC 3HB9A 4YRVA 2XV4S 3HYIA 3VOEA 1BR4A 4B4CA 2L01A 5FKLA 2L9SA 4GXOA 4HDVA 3K70D 1KYZA 4RB2C 2DXIA 1BBYA 2ELHA 2EFNA 4XLNF 4UNOA 1P6RA 3KPHA 2HU9A 1YW7A 4IHXA 2HDCA 4YEJA 4KFCA 3BG5A 4U0VA 4CCOA 3MKLA 3G6EI 1B1BA 4OIPF 1E2XA 4CHUA 2A69F 1Z9CA 3KP4A 1QBJA 4RAGA 3QODA 3MAJA 2KIFA 1HW5A 4HSTA 1VFCA 5E8IA 2XRNA 3WTVC 1U0JA 1IDZA 4CUGA 2P5VA 2E1MC 4A3BJ 1JKPC 4G7ZF 3WODF 2IS2A 3KYDB 2R92J 4HV5A 2DMNA 2OC6A 2QVOA 2TRTA 4RGXA 1OFCX 5FRMA 2V9KA 4V2FA 4A3IJ 2LKXA 1G3TA 2EA4A 4JK1X 2QZ8A 3CO7C 1A31A 4EV0A 4XLHA 3RKYA 5GAEJ 1IO2A 4XN0A 3QAHA 2R7XA 1P4WA 2XSJC 4WCGA 2EIKH 1Z7LA 1OISA 1FY7A 5GAHJ 1TLHB 4RM3A 3S1NJ 5DUKA 3QP5A 3FIWA 1T95A 4A12A 4QWQA 1JE8A 5LD2C 3OS1A 5A2QZ 2OPTA 4EJOA 3DPTA 4LG3A 3OYLA 1S3JA 1RZ4A 4XRFA 2M87A 4BAYA 4BDYA 1WFXA 5D4SA 3GX4X 2O0YA 3PQKA 3G2BA 1O4XA 1WZ2A 3S14J 2ZO4A 2PEXA 2JUCA 5D6FA 1SD4A 5CPRB 2DA1A 5IP6A 1JXSA 5K1YA 4ZYAA 2Y9ZA 4I01A 1W7PA 4FTHA 3HIFA 3GMEA 2P7CB 2X1EA 2HQ5A 3CJQB 1IV8A 4KT6A 2VN2A 3R0AA 3FMSA 1TT0A 2LKPA 2XAUA 2E7WA 2Y9YA 4LG0B 5LEJA 5C4JJ 1Y39A 2XGCA 3AG2H 2HQNA 4KIBA 5CYVA 3C7JA 2F5FA 5CLSA 2BV6A 3O3KA 3TW6A 5D8KB 1LNWA 2KMUA 2K3PA 1VQLI 3TW7A 4XN3A 3CF5F 2FRHA 2M0CA 4HNUA 1CGPA 2H09A 3IWFA 1W4MA 1ETVA 1R58A 3WG7H 3FHZA 2IVMA 2CV0A 1XCVA 1MH3A 1AHDP 4NB5A 5BMZA 1NTCA 1UELB 3H5AA 2DU9A 4BQNA 3WGIA 3Q3SA 4ZYDA 1WKMA 3FK7A 2CUZA 2PMZN 1VQ9I 3OIQA 3OYFA 3LFKA 1G2HA 3OYAA 2DDBA 3SZPA 4GRIA 1XGOA 3MZHA 4Y15A 2A5YB 4HOBA 2F48A 2DYRH 1PP8F 4A3GJ 3BPVA 1ZKGA 4RDUA 4UB6C 1S9HA 1R1TA 1S8NA 1KU7A 2NVUB 3VSLA 1RC9A 2PN6A 1K7AA 1JKOC 3DF8A 1MIJA 2PJRA 2RV8A 2D5VA 1V5FA 1Z77A 1B8IA 2PLYA 1X58A 3BOQA 2MC4A 4DW6A 4BJ6C 1SEUA 1ZGJA 4ENMA 2GM4A 1K78B 5LGUA 2ZMEA 4II3A 1A5JA 4RM2A 3G1OA 4A3FJ 3L7WA 3CLQA 5HLGA 2L54A 2VIXA 1YRNA 3A01B 4IRHA 3VYUB 4HV6A 1ZG5A 2M5WA 4RLQA 2CQNA 3DP7A 2XSDC 3LOCA 3BC8A 3ZN0A 4U88A 3B6CA 5DDGA 3AL0B 2IT0A 2LMDA 3QPSA 4LIUA 4B44A 5JLXA 2M4GA 2W4SA 3ZP5A 1GT0C 3LSTA 2LP0A 2A05A 2FSWA 3D0SA 5IOYA 2DTRA 4M3FA 2A6EF 1FZPB 3W6JB 1WJFA 2KPMA 3V7CA 2LYCA 3ZOBA 3DKYA 3H0GJ 3QOPA 1ZN2A 1W5CC 2E36A 2LDUA 3GTPJ 1BI1A 2ELJA 4ZDLA 2VB6A 4WF2A 3T0YA 3MWMA 1IN6A 2LFBA 2CQXA 2W84A 2CH0A 3AKZA 4DZJA 2L9VA 3PL8A 5EG0A 2L5QA 4U0YA 3RPUA 3CJRB 1TBXA 3BQYA 2V6EA 2EV0A 4P1WA 1V4RA 3MVPA 3MQ0A 4RMNA 5LHIA 3SHFA 2DT6A 2LVSA 2EFPA 2DO7A 2NS0A 2P7VB 3S3OA 2YR2A 1TWFJ 2EFQA 5D5WB 1MMNA 3TO7A 2CFXA 4RAFA 1ZTRA 3M1EA 5BOXA 4E6KG 3I56I 2Y31A 3CQZJ 5CQGA 1ZG3A 5CVVA 4AVPA 4HYEA 2QKMB 3HHHA 1X2NA 1X4PA 3SZTA 2LSOA 2EWNA 4AU7A 2ECCA 2FNPA 3BJOA 2YUSA 3FXJA 3MZ8A 4HX8A 5F0HA 3ZMSA 1LQ1A 1IG7A 1K4TA 5ICFA 2O03A 1P7IA 1N75A 3HDDA 3IP4B 2WA0A 5J4VA 3CP8A 4IRGA 3LAJA 4IHTA 1WJBA 4CZZA 3MMYB 2M8GX 1J0RA 4KIGA 4E70A 4XSZF 1DUXC 3A03A 1XGMA 5JVGF 5JLWA 1XX5A 1LKXA 2EK5A 1OQYA 4O5VA 3TKYA 1P4XA 1OMIA 2LC2A 3CC4I 4TV7A 4N4OB 2GZWA 4AM3A 5FRNA 2H1KA 5K5QA 2W00A 4B3XA 2LK2A 1R36A 1JUPA 3HTSB 4J00A 1QVTA 3OYDA 2FF4A 2H8RA 2AO9A 4BEHB 1D1CA 5AIPA 2QQAA 1MDMA 2G7HA 2Y0MA 1XMAA 3U21A 3C3WA 1FSHA 4DBRA 1IRZA 5CVRA 1X3UA 3K4MA 4XRSA 4ZZLA 1RIOH 1V55H 2X6XA 1XC5A 3E5UA 2DK5A 4MGRA 5IYCJ 4I99C 2CWEA 2OAZA 3BCAA 2R5ZA 4DYCA 4BBSJ 1E3OC 4R8HA 4ZTJA 3H3VK 3MEXA 1MD0A 2X6WA 1T56A 2EQRA 1JI8A 1WJDA 3SEZA 4CO8A 5F64A 1MH4A 1BJAA 4MIMA 4RBOA 1R6RA 4HPQA 3L2RA 1G8XA 4XIDA 1EA3A 4P9UA 1R5GA 5C3EJ 2FD5A 3M4OJ 4L5JA 2YX4A 2P5LC 1JUMA 2AQEA 3OR2C 5BNGA 4NHJA 1T6SA 4XLFA 4UUSA 5F1JA 3C2BA 3WTXC 2R7OA 2VQCA 4EATA 1UHWA 3ECOA 3BZKA 1MJBA 2ADUA 2MG4A 3HRUA 3PIOF 3CCRI 1HXDA 5F04A 1ONVA 1P7JA 1VQ7I 4EJVA 3LWFA 3RKQA 1G4DA 3GTJJ 3I0TA 4JX6A 3GZ6A 4HX7A 2MA3A 1SC7A 1U5TB 5DD8A 2HTJA 5L3BA 2E1OA 2PMUA 4GFBA 1QVUA 4I0AA 2GA2A 3DEWA 5CKTA 3DU6A 3GFIA 3F72A 2DFFA 2VXDA 3GTOJ 1WCMJ 3P7NA 1IF1A 2WY8Q 1VQMI 2MYSA 3K1NA 1YTYA 2ZMEC 3VSKA 2VUMJ 3HUGB 1FJLA 1OCRH 2DA5A 2G7UA 2MD5A 3DV8A 3WG9A 2YPRA 5F27A 3WHCA 2WAEA 3IH4A 4OWRB 4KISA 1FEXA 3S1MJ 1KQ8A 3OYNA 1WHUA 3LAPA 3BG3A 3BCBA 1U8BA 4PJNA 3RZDJ 4C3HJ 2MD0A 2PG4A 4A6EA 3FXRA 2CUEA 1XMKA 3PUFA 3PFIA 1I5ZA 5DTDA
chains in the Genus database with same CATH topology
1OCOH 1V54H 1OCRH 3ABKH 3ABLH 5B1AH 1OCZH 3ASNH 5IY5H 2ZXWH 1V55H 3WG7H 2EILH 2DYRH 1OCCH 2OCCH 2EIJH 2EINH 3AG3H 3X2QH 2EIMH 3AG2H 3ASOH 2DYSH 2Y69H 3AG1H 3AG4H 5B3SH 5B1BH 3ABMH 2EIKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO H;  1V54 H;  1OCR H;  3ABK H;  3ABL H;  5B1A H;  1OCZ H;  3ASN H;  5IY5 H;  2ZXW H;  1V55 H;  3WG7 H;  2EIL H;  2DYR H;  1OCC H;  2OCC H;  2EIJ H;  2EIN H;  3AG3 H;  3X2Q H;  2EIM H;  3AG2 H;  3ASO H;  2DYS H;  2Y69 H;  3AG1 H;  3AG4 H;  5B3S H;  5B1B H;  3ABM H;  2EIK H; 
#chains in the Genus database with same CATH topology
 3EYY A;  2R7T A;  3SDG A;  2XB0 X;  2PJP A;  1OYI A;  3DQV C;  2LOO A;  3V7S A;  2HQA A;  2PX9 A;  1MJ9 A;  2BEO A;  1ZEL A;  4HEA 2;  2O61 A;  3M07 A;  4B3A A;  1A35 A;  2NYX A;  4ZDO A;  1HSJ A;  2L02 A;  1IN8 A;  3GBG A;  3TP0 A;  1E0E A;  1HW1 A;  3I4P A;  3O6B B;  4NUB A;  2Y0S N;  2HOE A;  4ESB A;  4GYG A;  4BQA A;  2GQQ A;  2CQK A;  4WK8 F;  3GTL J;  4B1R A;  3CCQ I;  1OPC A;  5FD5 A;  4J01 A;  1MMA A;  3S93 A;  3FF5 A;  3FM5 A;  3F8N A;  4MEX F;  4PK4 A;  3NQO A;  2VQH A;  3COA C;  3OL3 A;  2GBY A;  1W36 D;  3QYF A;  3HOV J;  1B9M A;  3E6C C;  3GUD A;  3Q0U A;  4XM3 A;  4MHG A;  4BYY A;  2ZJQ F;  2R7Q A;  1IC8 A;  4I7H A;  1DDN A;  2VOP A;  5HLT A;  4EGZ A;  5K5R A;  3IL2 A;  3J7A O;  3P5J A;  2L4A A;  3K1P A;  4X0G A;  3LL7 A;  1T0F A;  4JX5 A;  1EH8 A;  1LVA A;  1NH3 A;  3SFZ A;  2BW3 A;  4GCV A;  2DDA A;  4MQ9 F;  4DIQ A;  3KCC A;  1MZB A;  2F5V A;  3KIO A;  2HI3 A;  2CG4 A;  3KEO A;  2JQ7 A;  1Z1D A;  1LFP A;  4IZZ A;  3L2C A;  1TQM A;  3LSR A;  2LY1 A;  4HF0 A;  4CXF A;  3R6S A;  3OS0 A;  4IHV A;  5EG0 B;  2BHZ A;  3PUB A;  4IF4 A;  2JRM A;  5FRO A;  1UCR A;  1D8K A;  4OU0 A;  3L9F A;  1PVE A;  2HDD A;  4P55 A;  4I0B A;  1S29 A;  1ITY A;  4D7M A;  4LB5 A;  3BR1 A;  3EPZ A;  3HG9 A;  3QPT A;  3CC7 I;  3KE2 A;  1KU9 A;  1WQ2 A;  3GTG J;  4JOM A;  4BY7 J;  4P9F A;  1U78 A;  4CYC B;  4OMZ A;  5CJ9 A;  3LNQ A;  4EM0 B;  3EYI A;  1UFM A;  4CCN A;  3JRH A;  2UZK A;  4HRI A;  2BYV E;  2A6T A;  4HDU A;  2HOS A;  4DYQ A;  2X6O A;  3GZN B;  2QM3 A;  3I9V 2;  2HTS A;  3RDI A;  3KFW X;  3G1M A;  1V5G A;  3V42 A;  2VBY A;  4C2T A;  5IT9 Z;  3S2D J;  1XPX A;  2V9V A;  4XNF A;  2C6Y A;  4D0P A;  4Q47 A;  3HEF A;  5L3G A;  4IJA A;  5ICE A;  1FWZ A;  3GZ5 A;  5BPD A;  3OIP A;  4ZYE A;  1FTZ A;  3ABM H;  1K61 A;  1FYM A;  3KYC B;  1ZK8 A;  3KZY A;  3OIO A;  3IC7 A;  2OQR A;  2BY2 A;  1R71 A;  3EUH C;  3GFM A;  6PAX A;  2HKO A;  3BY6 A;  2QF7 A;  4PGG A;  1PUF A;  3E5X A;  3FXO A;  4A3J J;  4N9I A;  5JHU A;  2EIL H;  1MDM B;  3A0H C;  2PBI A;  2FOK A;  3RJP A;  5FKO A;  2UV1 A;  1OR7 A;  2H1L A;  4XKW A;  1N25 A;  3GFL A;  2WB1 N;  1UHS A;  3QPL A;  1U8R A;  3FBN B;  4KJZ A;  1B72 A;  4Y33 A;  1WJC A;  2E7X A;  4XR6 A;  3HRM A;  2FEZ A;  4UVA A;  1R4M B;  2XKP A;  1TTY A;  3QYB A;  3EUA A;  5IT9 K;  5KAI C;  3TDU C;  4LMY A;  4Y13 A;  2K7L A;  2ZXI A;  3HSE A;  2Z5U A;  3E3V A;  3IHU A;  2GA1 A;  4DOZ A;  2XAF A;  3HXL A;  2QWW A;  2CRG A;  4BAC A;  1R1V A;  2VL8 A;  3VWB A;  4N4N B;  4E4H A;  4IQJ A;  1ZHF A;  3WTS C;  3JTG A;  4GYI A;  1J09 A;  1HCR A;  3CJN A;  2ME0 A;  1RKW A;  1QNT A;  3DTI A;  2BY0 A;  3S16 J;  2J5P A;  3LSH A;  2ECB A;  1D1A A;  1Z6R A;  3OMY A;  5B1B H;  5ICG A;  4MTD A;  1KQ0 A;  2MW8 A;  1LB2 A;  3RZO J;  2KHM A;  2JRT A;  4LLL A;  3H9G A;  3CLO A;  2LNB A;  1NG6 A;  3GWZ A;  5LHH A;  3CD6 I;  3L00 A;  1JHF A;  1UG2 A;  2KDO A;  4M3G A;  1A04 A;  3ABU A;  3OYH A;  1ETO A;  4PFP A;  3GTQ J;  5J4Y A;  5J47 A;  1CF7 A;  3GF2 A;  2XAS A;  4S04 A;  2ZJ2 A;  3I53 A;  2M0M A;  4RB3 C;  1LEB A;  2XB5 A;  5GTH C;  3MFK A;  1O3R A;  3CC2 I;  1SFU A;  1UMQ A;  4AWX B;  4YIF A;  3JAM Z;  1S7A A;  4YIR X;  3A02 A;  1TNT A;  4BKX A;  2CO5 A;  5FFX A;  2AXT C;  2HPI A;  4LJZ F;  1DGW Y;  2K4B A;  1RNL A;  1FOW A;  2QBY A;  4OIN F;  1YJN I;  1T8I A;  2DA7 A;  1LE8 B;  5M3F J;  2PMZ A;  4MFD A;  1YFH A;  5FKK A;  3D5S C;  4D9J A;  3ZR8 X;  4BJ5 C;  3IUO A;  3HOX J;  1GDT A;  3G1L A;  3GXO A;  3CCL I;  2L7K A;  1LFB A;  2VC0 A;  2OTL I;  2G0E A;  3N97 A;  4IX7 A;  1IN4 A;  4NNJ A;  2W57 A;  3A1Y A;  4F93 B;  4E7J A;  3HC7 A;  2DOF A;  2ZJP F;  4A3D J;  1X1A A;  1T0F C;  2RKH A;  3W2A A;  2M7A A;  3HOU J;  5EGO B;  4A3K J;  1PJR A;  2R7D A;  4KUM A;  2O6G E;  2LY2 A;  3CUQ A;  3JAM K;  1Z7U A;  1D8J A;  1U9O A;  2KIU A;  3KP6 A;  2EZH A;  3DCF A;  4UB8 C;  1VTN C;  3CF2 A;  2EPF A;  4L9T A;  1AKH B;  3RKW A;  2DPU A;  2R7Z J;  1APL C;  2HNH A;  2OZU A;  3P9I A;  4RGU A;  1N78 A;  4M72 A;  3I59 A;  1FBU A;  3PNV A;  4HX4 A;  1FOY A;  1Q1H A;  4BJT A;  2NS8 A;  3WGH A;  5GP9 A;  4FCY A;  2FA5 A;  3K70 C;  2M4K A;  4G94 A;  4HSR A;  3JRF A;  5J8F A;  4E7K A;  2ZC2 A;  1DP3 A;  4BU2 A;  2L4M A;  5DM7 F;  4B43 A;  4AIJ A;  2WV1 A;  2R7W A;  3KZZ A;  1BN5 A;  1G3S A;  2F4I A;  4RGS A;  1O3T A;  2NOG A;  1MBH A;  3PQJ A;  3IH3 A;  4C3I J;  2ZFW A;  5J8C A;  4XL9 A;  4B47 A;  1RR8 C;  4RLF A;  5B5E C;  5GTI C;  4HLY A;  4EJU A;  1R23 A;  1DGR M;  3FX3 A;  3FMQ A;  2E1M B;  2XAJ A;  1SD5 A;  2MH9 A;  3EUK L;  5E1X A;  2VPL A;  2UXX A;  3CMM A;  4YFK F;  5M5W J;  5L3C A;  3OOU A;  4EVI A;  2E2H J;  2VBZ A;  4NQW B;  5LFA A;  1XDU A;  1VI0 A;  3NWS A;  1G59 A;  4IHY A;  1FLI A;  4UVC A;  3HBL A;  2V26 A;  4BE2 A;  4MNU A;  3T8R A;  1FX7 A;  1J5Y A;  3LA7 A;  4PJL A;  2GXB A;  5A2Q K;  1V54 H;  1IXC A;  1UHM A;  1BOA A;  4RGR A;  2I8D A;  4M71 A;  2F5C A;  2LY9 A;  4CYD A;  3I54 A;  3TP3 A;  1JJ6 C;  2W25 A;  3IH2 A;  2CMP A;  3CCS I;  4ZYG A;  4PGH A;  3IV5 A;  1VND A;  2L9R A;  1OR7 C;  2VXZ A;  3H0D A;  1USS A;  3FKI J;  5F6F A;  3OYK A;  4R1H A;  1HST A;  2RC4 A;  5L3E A;  3AG3 H;  2WTE A;  4FHT A;  5D5U B;  4PJJ A;  3FXM A;  4E7L A;  2IXS A;  2O3F A;  2XAH A;  4GO1 A;  2M45 A;  2V9P A;  2R7R A;  4LK1 F;  1EJ9 A;  2CW7 A;  3QPH A;  3K4C A;  3BG9 A;  2KIQ A;  2BBY A;  2L2O A;  1RUN A;  2YS9 A;  3DXJ F;  4WX9 A;  1W1W E;  1UZC A;  4M9S A;  1HW2 A;  2Z1D A;  1BW6 A;  4LIV A;  2FNA A;  1FP1 D;  5DS9 A;  5KCM A;  2WAQ A;  1XSX A;  2HZD A;  1Y56 A;  2STT A;  3NAU A;  4CCL A;  2L7F P;  1FYL A;  4M6X A;  4YFX F;  4HF2 A;  5FLV A;  2ME6 A;  1XDS A;  3R60 A;  4BL0 B;  2H6C A;  2ZB9 A;  2Q2E A;  2X6Y A;  4RB0 A;  4IOA F;  1QQI A;  2O8K A;  2W82 A;  1X19 A;  1RPW A;  4G12 A;  2Z2S B;  2JPB A;  4X1E A;  3ZMT A;  1ZYR F;  3F8B A;  4ITV A;  5TGT A;  1LPQ A;  1TQI A;  2ELK A;  4OIR F;  1R49 A;  1ZAO A;  4M6Y A;  2KP6 A;  3G3Z A;  3LQR A;  2XAQ A;  2R5Y B;  2W7N A;  3R0J A;  1PYV A;  5H6R A;  2ZXW H;  4H0E A;  1BW5 A;  3J7Y J;  4I02 A;  1QPM A;  5TRD A;  2Z33 A;  2EFW A;  2IAI A;  1TL8 A;  1XB4 A;  4BQO A;  2TDX A;  2M2E A;  4QLC U;  1Z3X A;  3QU3 A;  1W0T A;  2VKH A;  4L9N A;  2CSO A;  3DTE A;  2VC1 A;  3CJT B;  3BZC A;  1ODD A;  3X2Q H;  5IP7 J;  3LSP A;  3ULQ B;  1VQP I;  3ZQC A;  3TBI A;  2MAB A;  2IBD A;  2IGO A;  3F3X A;  1VQ5 I;  4A93 J;  2ZBK A;  2EZL A;  2Y69 H;  2FMY A;  1XSV A;  3ELK A;  2RDP A;  2VJJ A;  1ZGA A;  4HLX A;  4MFE A;  1UAA A;  1IGN A;  1H8A C;  1MMG A;  4ZYH A;  1MBK A;  4BUP A;  1STZ A;  3REO A;  4E7Z A;  4A6D A;  2OQG A;  2MH2 A;  4F91 B;  3CME I;  2XPW A;  2K86 A;  1V5E A;  3OV8 A;  1K79 A;  1YW9 A;  4B09 A;  2XF6 A;  4M74 A;  2L0K A;  3U2R A;  5M5Y J;  4A0X A;  4JYK A;  1Y1W J;  2DBB A;  5K7F A;  1O7F A;  2DT5 A;  2PQ8 A;  1WJ5 A;  3C1D A;  4I6Z A;  1RUO A;  3FXL A;  2KRH A;  2VPR A;  4L9V A;  3E6D A;  3D5L A;  2RAE A;  3FMR A;  5AIQ A;  2IGK A;  3HJE A;  4XRS G;  2KQR A;  1BA5 A;  3VEP A;  2Z3Y A;  2MBF A;  3J7A Y;  3PJR A;  2RQQ A;  3ZPL A;  5TIS C;  1REP C;  1MBG A;  3HOW J;  3BT9 A;  5HDG A;  3J81 Z;  1KGS A;  2RQP A;  3BDD A;  1U6G A;  2Y2Z A;  2DQR A;  3CUQ C;  1RR7 A;  2O5R A;  3F6V A;  2EIM H;  2X9D A;  3BTI A;  3BR3 A;  2HQR A;  3RQ4 A;  4M73 A;  4A0Y A;  3BPX A;  5KVR A;  3AFH A;  4M9Z A;  1RKT A;  2OV7 A;  4IXA A;  4F3Q A;  1Z67 A;  4CIC A;  2P6S A;  3RPQ A;  3BTL A;  2VE8 A;  1ON1 A;  3I64 A;  5EZH A;  2DPD A;  5HVQ C;  5ICC A;  2QBY B;  4BXU A;  1BM9 A;  4XRM A;  4WWC A;  2D1V A;  2VOO A;  3MN2 A;  5JVT A;  2HVR A;  5IP9 J;  1W5S A;  4BBR J;  3B02 A;  1E3P A;  3V4G A;  2WAF A;  3CCU I;  4N0B A;  3H1C A;  3J81 K;  1K4S A;  4AYB N;  3H36 A;  3IAS 2;  2B63 J;  3ZQG A;  5GPA A;  3BG7 A;  1YJW I;  1K83 J;  4CCK A;  4DBQ A;  4IO9 F;  1JHH A;  1UG0 A;  1SVL A;  2OF7 A;  1SMY F;  3BZ6 A;  4G6T B;  5E79 C;  4KA4 A;  1SVO A;  1FSE A;  2IA0 A;  4KDP A;  1SD7 A;  1IN5 A;  2ZNY A;  1YW8 A;  4FIS A;  5IYD J;  1K6O A;  5FKN A;  1ZQ3 P;  5FB2 A;  3OYJ A;  4C9Y A;  3BQZ A;  4XKC A;  2GWR A;  5CQE A;  4ENJ A;  1F4K A;  2DMP A;  4XKB A;  2E71 A;  3VYS B;  5D5V B;  3BR0 A;  4IQ4 A;  2CUF A;  1OYW A;  3R61 A;  4ESJ A;  2VE9 A;  3U1K A;  3BLY A;  5B66 C;  2XUB A;  3BR5 A;  2K9Q A;  2UWM A;  2GAU A;  5DCM A;  5ERI A;  3OSF A;  3WTY C;  3CES A;  3F21 A;  3H35 A;  2FBH A;  2L9N A;  2N8G A;  1QZY A;  2DJI A;  2F5D A;  2A5W A;  2H6B A;  3B73 A;  3H9J A;  2ETH A;  2PFB A;  2V6C A;  2JA8 J;  5LBQ A;  4M3E A;  4BNC A;  1I39 A;  3EUH A;  1H0M A;  2LRD A;  2LBF A;  3HKZ N;  4A0Z A;  1TWH J;  3A2K A;  5GAG J;  1W7P B;  4D1Q A;  5D4R A;  1JT0 A;  1IDY A;  2X51 A;  3EQL F;  4J19 A;  2HPM A;  2JSP A;  1HDD C;  1S5L C;  1EH7 A;  4UUV A;  2CQQ A;  5F0C A;  4RS8 A;  2WC2 A;  2YU3 A;  2M9H A;  4AD9 A;  2E34 A;  2EH3 A;  3CMY A;  5HNF A;  4WXC A;  1VQO I;  1HKQ A;  5CVU A;  5HOO A;  4IKF A;  3Q9S A;  3EET A;  3BR2 A;  4CA0 A;  5EZG A;  2VI6 A;  2JMW A;  2V79 A;  4RAZ A;  5IOZ A;  1LDJ A;  1TWC J;  4BDZ A;  2AXL A;  3W2W A;  2IS4 A;  2STW A;  2JPC A;  2JK3 A;  2QCO A;  4G9Y A;  2JWT A;  2X1C A;  4B8X A;  4BHC A;  2ISY A;  4XOR A;  4LLN A;  3DKX A;  2K27 A;  2NOJ B;  4I98 B;  3CDL A;  4RAY A;  3WGG A;  4IHS A;  4BH9 A;  3K7A J;  4CSW A;  1D0X A;  2P81 A;  2NVT J;  2FJ1 A;  3Q9V A;  4ZH4 F;  2HGC A;  2KLO A;  1DU0 A;  1OCP A;  2LR8 A;  5CVI A;  5HS7 A;  5HOD A;  4ABZ A;  1FMV A;  3AG1 H;  3GTM J;  3KEY A;  3M8J A;  2CV1 A;  1QHG A;  1WI3 A;  3CTA A;  1ON2 A;  1ZRF A;  5L3F A;  1R22 A;  3TDZ C;  2LRE A;  2QUF A;  1T08 B;  1XTA A;  3GTK J;  1QZZ A;  3PSF A;  1HDP A;  2KDZ A;  2BZT A;  4M3B A;  3H9Q A;  2D1H A;  2RVC A;  2PJR B;  4OMY A;  1V3F A;  1YQA A;  3S32 A;  1OCC H;  1IXS B;  3V7R A;  1B8I B;  2ESH A;  1DPR A;  2EIJ H;  2CV2 A;  2K4J A;  4A5M A;  3ROU A;  3GFJ A;  2XIG A;  2D2W A;  2ZME B;  5BQT A;  1TW2 A;  2DOE A;  3O8G A;  3BWG A;  4ON0 A;  1RES A;  3DEE A;  2VJ5 A;  4UHT A;  1I3Q J;  2A68 F;  1YRN B;  4H4K C;  4Q48 A;  4L0Z B;  3CCY A;  3ERE D;  5TJJ A;  3RI4 A;  2GOX B;  3H3U A;  1X3Z B;  2CS3 A;  3GO5 A;  2AS5 F;  2R4G A;  1VF9 A;  1KU2 A;  2JUG A;  4MQV A;  2KKO A;  2XGX A;  5E3N A;  4YFN F;  5KAF C;  4WXH A;  1BL0 A;  3FWE A;  3K4K A;  1F9N A;  4XIC A;  3OSG A;  3UR3 C;  1WVR A;  1JTX A;  3DTK A;  3FK6 A;  1XG1 A;  2VT2 A;  4FX0 A;  2ID3 A;  3KLN A;  1E17 A;  4QTR A;  4JP0 A;  3K69 A;  4B48 A;  5FLX Z;  3SQN A;  2P8T A;  1SD6 A;  2MFZ A;  3OYE A;  3IRQ A;  3RQI A;  3Q5F A;  1YIT I;  2R7V A;  3Q0W A;  3HHG A;  3P9K A;  5LRR A;  3SZG A;  1OCO H;  1POG A;  2M7B A;  2W1O A;  1MMD A;  4UV9 A;  2GLO A;  4CZC A;  1Y1V J;  3QWL A;  5EDN A;  2IRF G;  4ENN A;  1QRY A;  2X0L A;  3ZQF A;  4DYR A;  1WJA A;  2ZXJ A;  3ZMU A;  2R3S A;  3SDB A;  3RIR A;  1Z0X A;  3R4K A;  2QQ8 A;  4HZF A;  1Y8R B;  3I4N J;  3NAR A;  2BVL A;  1W36 C;  3GVA A;  3GEZ A;  4M9X A;  1Z3Y A;  1Q1V A;  4XON A;  2XPU A;  4OAZ A;  3N05 A;  3S3N A;  1OJL A;  1UST A;  1S7O A;  2BGC A;  3L2Q A;  4KIT B;  1IUY A;  3LFU A;  5FLM J;  5ILU A;  3GLX A;  1X1P A;  4EQQ A;  4ZZD A;  4JBA A;  5FLX K;  4AIK A;  4KT5 C;  1B59 A;  4XOT A;  5D8L B;  3GCM A;  1R7J A;  2V4J C;  3DLL F;  2XRL A;  1MKM A;  3OOP A;  4HA8 A;  5ILV A;  1NK3 P;  2DW4 A;  3A0B C;  2HKX A;  5J3L A;  1LUJ B;  4O3M A;  1MW7 A;  2K9M A;  2LTP A;  3CCV I;  2YU9 J;  3WE2 A;  3JW4 A;  2JSC A;  1I50 J;  1IJW C;  1WRJ A;  2V1N A;  1X1D A;  3JRG A;  1X1C A;  4UV8 A;  2XDV A;  1Z21 A;  2OUM A;  5EYR A;  3DBR B;  1R1U A;  2IA2 A;  2NXN B;  5JHF A;  1MND A;  1P2F A;  3MKY B;  1WH5 A;  4AID A;  4S0H B;  3S3M A;  1ZH5 A;  1Y0N A;  1GVD A;  3NWT A;  3Q0V A;  2GXG A;  1ENH A;  2Y30 A;  1IV6 A;  2FE3 A;  1W0U A;  4I09 A;  2R5Z B;  1BI0 A;  3HGY A;  2GIV A;  2K9L A;  3V8L A;  4F52 A;  2QSG X;  1ETQ A;  1MNM C;  1FC3 A;  3CO6 C;  1BIA A;  5EEH A;  2FQ4 A;  1OCT C;  3UKG A;  1TC3 C;  3M7G A;  2LF8 A;  1LFU P;  3F8F A;  3KP5 A;  1HC8 A;  1AOY A;  2CW8 A;  3F22 A;  5EJC A;  3TGN A;  1I1G A;  3OL4 A;  3I4M J;  2XF5 A;  2XVC A;  4PCQ A;  3QP6 A;  3A01 A;  1KZH A;  1N77 A;  3DWL E;  4I2O A;  3M3Y J;  2RNJ A;  3TMO A;  1D3Y A;  1SFX A;  4U7D A;  4MO7 A;  3WTZ A;  2F4O B;  1TQP A;  3ZGK A;  1BI2 A;  4UUS B;  2EJR A;  3ASN H;  2Q8K A;  1AU7 A;  2CU7 A;  5E3M A;  3OYI A;  2JJ7 A;  2HEO A;  1HQC A;  1YX3 A;  3PO2 J;  1Z6T A;  2HOA A;  3ISP A;  1T33 A;  1VZ0 A;  2DLL A;  2UUZ A;  2L7Z A;  2IEK A;  3OYM A;  5IT3 A;  1TNS A;  3ASO H;  4KNY A;  3FDY A;  1R9T J;  1FIP A;  1YYV A;  3DEU A;  4LGW A;  3RKX A;  4ZDP A;  1GV2 A;  4BS9 A;  1RRJ A;  2BHY A;  4BXX J;  3M9A A;  4S05 A;  3F6O A;  2I10 A;  2KRF A;  3K4B A;  4A69 C;  4HF1 A;  4PDK A;  3TED A;  2M1B A;  2OCE A;  3WU0 A;  3I55 I;  2DA2 A;  3FHN A;  1YLF A;  3KP3 A;  2RN7 A;  4F92 B;  5E3O A;  4W1U A;  2IGM A;  4KMU X;  4PSW A;  1WI9 A;  3QU6 A;  4XMY A;  1ETY A;  5HLI A;  1ZLJ A;  2KJB A;  4WXD A;  3JR9 A;  2ZSI B;  1Z91 A;  2KZG A;  2K9N A;  3HRT A;  1H9T A;  5L3D A;  4DJA A;  3SJM A;  1TT5 B;  1XCB A;  3QYE A;  2OU2 A;  2XKO A;  4GDF A;  1ETK A;  2NVX J;  2HS5 A;  2V7F A;  3N4M A;  1ORK A;  1ZR4 A;  3U9G A;  1RI7 A;  4L5E A;  3OYB A;  1IUF A;  3CP2 A;  1F43 A;  5LGN A;  1YE9 A;  2JT1 A;  1HKS A;  1SFE A;  5DCF A;  4PZJ A;  1AA7 A;  2VQL A;  2AQF A;  4ESF A;  1YI2 I;  2E35 A;  2CGP A;  4BGD A;  2CFO A;  4P96 A;  3FXQ A;  2D45 A;  2KFD A;  1YHQ I;  5J1R A;  4OIO F;  2LH9 A;  3FXU A;  2OJE D;  3PFY A;  4DZP A;  2UXN A;  1XMX A;  4U87 A;  1IN7 A;  3WTU C;  2NNN A;  2YX7 A;  4XSX F;  3KEQ A;  1VQ8 I;  1FPQ A;  3FZV A;  2EZI A;  2Z9O A;  5IYB J;  3ONQ A;  4QPO A;  5E1W A;  4IVN A;  4NDL A;  4BEH A;  3ESW B;  3WHB A;  4FT8 A;  2XGE A;  2P0W A;  5E17 F;  5J40 A;  3TO6 A;  1B4A A;  2V1D A;  4Y3O A;  4PUS A;  1ACI A;  3E0J B;  1IRF A;  3RYR A;  2VON A;  3JSP A;  3BTJ A;  3HZJ A;  2X1D A;  3RYP A;  3E97 A;  3MZY A;  4RA2 A;  4E7H A;  3ZCO A;  3T1B A;  4CCJ A;  1J59 A;  4Z2Y A;  4IHW A;  2BW3 B;  2K40 A;  1HKT A;  3TOA A;  1MSE C;  2JA5 J;  4L18 B;  2WAD A;  2MLG A;  4AUX A;  2NRA C;  4FAS D;  3TOB A;  1ZRC A;  1MBJ A;  3S2W A;  3JRC A;  2H27 A;  3OS2 A;  3K9T A;  4A3M J;  1XSD A;  2HWV A;  2Z16 A;  3HOZ J;  4G6D A;  2AHQ A;  3OR1 C;  3P9C A;  2BY3 A;  2R93 J;  2K85 A;  2B9S A;  1H89 C;  3ZQH A;  3ZQL A;  5D6E A;  1I27 A;  1CQT A;  2EFO A;  2EB7 A;  5H6Q A;  5HS9 A;  2FOW A;  2HXI A;  1H9G A;  1KON A;  4CCM A;  2F5E A;  4BHP A;  3E1S A;  1JKR C;  2IA1 A;  1GLN A;  4Y52 J;  1P92 A;  5F1R A;  1G6N A;  3VB2 A;  3T5X A;  5C44 J;  1QU3 A;  1U9N A;  2F4M B;  2XC7 A;  1QZE A;  2E60 A;  1FBQ A;  4RB1 A;  1YS7 A;  5DEQ A;  3EDP A;  2EBI A;  1QGP A;  2VKE A;  2BOL A;  1S7E A;  1U5T A;  2HXO A;  2RRE A;  5E18 F;  1SVM A;  3IAM 2;  2IPQ X;  4FE4 A;  3ZMV A;  9ANT A;  1C0W A;  3W2V A;  1GXQ A;  4Y7N J;  3O8H A;  2OZ6 A;  4A3E J;  3DBL B;  4PJM A;  1SFO J;  2XAG A;  2DFE A;  5C4X J;  2CQ7 A;  2FBI A;  2DJN A;  1P4A A;  3HUG A;  4LIT A;  2OCC H;  1D1B A;  2DFH A;  4AYB A;  4D5C A;  4K2E A;  3BG6 A;  2H94 A;  4KMF A;  3DKW A;  4KYW A;  2WBM A;  3FIS A;  4A5N A;  3ABT A;  2R7F A;  3S2H J;  2NVY J;  1PUF B;  1NK2 P;  1HBX G;  1SFK A;  2DT7 B;  1QPI A;  3AL0 C;  1FOX A;  2FML A;  2QEX I;  1L0O C;  3S8P A;  3D1N I;  1ZR2 A;  3H92 A;  4OAY A;  2R7U A;  5DUI A;  1B72 B;  2DK8 A;  1XN7 A;  3E5Q A;  1FP2 A;  4UY8 I;  3S17 J;  2FUG 2;  4IRI A;  3QQA A;  4O6J A;  2B0L A;  3M8E A;  2K3F A;  4NC8 A;  2E19 A;  1W5T A;  1FOK A;  2M3A A;  4GGG A;  5E20 A;  3JCU C;  2HYG D;  2DYS H;  3AG4 H;  3SFI A;  3G71 I;  1BIB A;  3SYT A;  1VQN I;  2KZV A;  1A6I A;  2ID6 A;  2QQB A;  2KL4 A;  5ILS A;  3HSF A;  3TL4 X;  4C2U A;  3HM5 A;  3W3C A;  4HNT A;  3IKT A;  4MTE A;  1WJE A;  4NBQ A;  2DN0 A;  3K0L A;  2HVS A;  4NC7 A;  1EH6 A;  2VKD A;  1SMT A;  3WE3 A;  3HKZ A;  1S72 I;  2HZT A;  5EF6 A;  4EJW A;  3ZN1 A;  4KN4 X;  1H88 C;  1XGN A;  2V1U A;  2W48 A;  3HRS A;  1TZL A;  5FJ8 J;  4M3D A;  4BE0 A;  1TP4 A;  2JA2 A;  1KYW A;  3FXK A;  1R5I D;  2IGN A;  1MBF A;  3K4N A;  5EEG A;  4L5I A;  3CMA I;  2DAO A;  1WWX A;  5IPA A;  1KU3 A;  3JSO A;  3MKZ A;  3V8J A;  1LDD A;  1RET A;  2DA4 A;  3ML6 A;  2O8X A;  1CF7 B;  3ZMD A;  2K9S A;  4OOI A;  2QKL B;  1SAX A;  3WTW C;  3DU5 A;  4HAM A;  4ASN A;  2IJL A;  3KP2 A;  3C2G A;  5J6X A;  3KP7 A;  3U1D A;  1MNE A;  2OTJ I;  1TW3 A;  4JX4 A;  2H8W A;  5HNH A;  4DNC A;  1B6A A;  1DU6 A;  3M1C A;  5J1U A;  5KK1 A;  4A3C J;  4AIH A;  4BXF A;  1NG7 A;  4LB6 B;  3F23 A;  3JTH A;  3HOS A;  3BTC A;  3V8K A;  4BY1 J;  3VOD A;  2CYY A;  1W7P D;  1F1Z A;  3WU2 C;  4UXN A;  1BR2 A;  3LSI A;  2WWY A;  4ETS A;  3GLL A;  1J7K A;  4FQG A;  4CYC A;  2ZKZ A;  5FKM A;  4AVZ A;  3LSK A;  1IAW A;  3I58 A;  4ENK A;  2VT3 A;  4AC0 A;  3K4J A;  2VBX A;  2KT0 A;  3J80 Z;  3ZRG A;  3SXY A;  1ERD A;  2EZK A;  2IP2 A;  1PP7 U;  3HTU A;  2BY1 A;  1JUS A;  2I5U A;  2X85 A;  1YG2 A;  4HQM A;  4PJ0 C;  2CW0 F;  3PIP F;  4XLE A;  3S1Q J;  3FM3 A;  1LEA A;  3L2W A;  2JTV A;  4UUT A;  2IS1 A;  4KN7 X;  3F8M A;  2FU4 A;  5J1Y A;  3CUQ B;  1BOB A;  3HOT A;  4BE1 A;  1HF0 A;  3MCZ A;  4FE7 A;  1U2W A;  2Y0S A;  2DOA A;  4NC6 A;  3KLO A;  2ZCW A;  1HOM A;  3VYR B;  2DMU A;  4UVB A;  1ZRE A;  2WAQ N;  3LSM A;  5FD6 A;  2HYJ A;  3I59 B;  3E6B A;  1ETW A;  4FET A;  3F8C A;  1IRG A;  2DTZ A;  2EV5 A;  3PSI A;  2QLZ A;  3KYL A;  3GYH X;  3F0C A;  2LF7 A;  3KET A;  4PSX A;  2QA4 I;  2O9L A;  2PI0 A;  1G3W A;  4YEL A;  1NHA A;  3J80 K;  4V2G A;  2JA7 J;  2W24 A;  2DOD A;  5HS8 A;  1OCZ H;  4HBL A;  3IKV A;  4U7B A;  2G9W A;  4LK0 F;  4EGY A;  3W6K B;  4D7N A;  2DCE A;  2HYF A;  4JQF A;  4XBF A;  1ZG1 A;  2R7S A;  1X4O A;  3MD2 A;  2HVQ A;  3ECH A;  5E1Z B;  2Q0O A;  1U5T C;  1MJA A;  3O2P E;  2ESN A;  3A4C A;  4PFO A;  1GV5 A;  5FO5 A;  1FYK A;  2M8E A;  3L09 A;  3CDH A;  3S15 J;  3DPL C;  1T38 A;  1MBE A;  4R79 A;  4OIQ F;  2JVH A;  3ZQQ A;  1KQ9 A;  1XS9 A;  4Y4R A;  2P6T A;  3I3L A;  3L1P A;  2M30 A;  2ZJR F;  1I6X A;  5F0F A;  2DMT A;  1YO5 C;  3C18 A;  1X3W B;  3HGG A;  3DPU A;  1M1E B;  2HR3 A;  3FBI B;  2J5O A;  3NEU A;  4QPQ A;  1BI3 A;  4LD5 A;  2Y75 A;  1J9I A;  1F5T A;  3PO3 J;  1R5H A;  3DFG A;  5H2F C;  3LSG A;  2RGV A;  1LJ9 A;  1ZAR A;  2TCT A;  3KX2 A;  1FMW A;  5GAD J;  5EEA A;  1D0Z A;  2KIM A;  1ZGW A;  2VAS A;  5IY5 H;  4HG2 A;  4DQ2 A;  2FX0 A;  1WPK A;  2L3D A;  3TQN A;  4X6A J;  3IWZ A;  3ZQI A;  2OA4 A;  2LG4 A;  3BP8 A;  4XLA A;  5GPC A;  3JRE A;  1YOV B;  1E3H A;  2GOM A;  4IL6 C;  2QYO A;  3HPG A;  3I5U A;  4YII A;  2KJC A;  1JT6 A;  1X2M A;  2NS7 A;  2P5K A;  2LKS A;  1I1S A;  1A36 A;  2BVM A;  4IEJ A;  2MGQ A;  1GUU A;  3HSR A;  3RPU D;  2ZSH B;  5B3S H;  2QQ9 A;  2E1N A;  4ANJ A;  4EMS A;  3E6M A;  3M8F A;  1B9N A;  2KRC A;  3ERM A;  4CH7 A;  4XOP A;  2NNY A;  1J75 A;  4MLO A;  4IOC F;  1U3E M;  2A07 F;  5BPI A;  3KZI C;  2Q2E B;  1HA8 A;  4KIC A;  3JRB A;  1LE8 A;  1L3L A;  1IW7 F;  3K1M A;  4G6Q A;  2WB1 A;  5LGT A;  2MLK A;  3FKJ A;  2L7M P;  3CCE I;  5DYM A;  3LA2 A;  1R4N B;  1Y6I A;  2COM A;  3E7L A;  2BE5 F;  4XKV A;  1KA8 A;  1XGS A;  2VJI A;  4L0Y B;  1FIA A;  2F6C A;  1BR1 A;  2FBK A;  1VQK I;  1S6L A;  4IPA A;  3ZQ7 A;  5EGO A;  4LOC A;  5HDN A;  3K10 A;  2VBW A;  4ZTF A;  1BC8 C;  2E5N A;  3QRF F;  5D5X B;  5DD4 A;  5H20 A;  4I76 A;  2GIZ A;  3VPR A;  1D5V A;  5DV5 A;  3BRO A;  1AKH A;  3PNT A;  3HL2 A;  3CZ6 A;  5M3M J;  2A61 A;  1ETX A;  5K5O A;  2ZXH A;  1GVJ A;  2NAZ A;  1VQ4 I;  1ZLK A;  1Y0U A;  3JRA A;  1T2K A;  2E2I J;  1LDK B;  1EKE A;  1FBS A;  4XLP F;  5JI6 A;  2VQG A;  2Z99 A;  4Z6Y A;  3QOE A;  2HOT A;  1YS6 A;  1TWG J;  3RSN A;  2Y48 A;  4ZJZ A;  1QHH D;  2E2J J;  4QSH A;  5LHG A;  2X4H A;  2LD5 A;  1OKR A;  1O7L A;  4C3J J;  1DPU A;  2RNG A;  1XD7 A;  4HNV A;  1JGG A;  2VOD A;  2P4W A;  1UB9 A;  3LSJ A;  4E7I A;  1I6H J;  3OWT A;  1YIO A;  3CCJ I;  3TO9 A;  3WU1 B;  3K2A A;  1AWC A;  4Q5S F;  3CUO A;  1D5Y A;  1ULY A;  4G7O F;  3BJA A;  4F55 A;  1YX5 A;  4NQW A;  1IXR C;  1T98 A;  5KHD A;  4A3L J;  2BXY A;  3HPH A;  4LG0 A;  2QSH X;  5B1A H;  4LFU A;  1SAN A;  3VFZ A;  1O57 A;  1F36 A;  4N9H A;  2M34 A;  3RCO A;  4DGW B;  3MKW B;  1OLT A;  2JA6 J;  2XRO A;  4KIF A;  1JKQ C;  1TWA J;  1QA6 A;  2EA2 A;  2VJ4 A;  4U0W A;  1G3Y A;  3I71 A;  2VLA A;  2NVQ J;  4C2M J;  3DBH B;  1GHC A;  4BQQ A;  3OYC A;  2E1C A;  2HDW A;  2XHK A;  4MEY F;  3GW2 A;  2X48 A;  1EF4 A;  4FX4 A;  5BS6 A;  1SAU A;  5AON A;  2QSF X;  3ABL H;  4ZC3 A;  2ZNZ A;  2YSR A;  5LRS A;  3OYG A;  4Y17 A;  1IRX A;  2XGD A;  2DA3 A;  2ICW G;  5LEK A;  1K6Y A;  3UNG C;  2GXA A;  4V19 K;  5JFR A;  3CCM I;  1JJ8 C;  1X1B A;  3L2V A;  5DM6 F;  2OD5 A;  1LVK A;  3W6V A;  1A6Q A;  1J2X A;  4EM1 A;  2JVG A;  2QGU A;  5M5X J;  2MC3 A;  3OY9 A;  1VQ6 I;  5ED4 A;  4F7Z A;  4P5O A;  1WGX A;  3G4S I;  3S1R J;  2DI3 A;  1EV7 A;  1ZRD A;  2JN6 A;  2DFI A;  5E8G A;  5K7Z A;  3ZXS A;  2R0Q C;  2LLK A;  2B7E A;  2HFH A;  1P9Q C;  1MSF C;  4LLG F;  5HDK A;  1PDN C;  3T8T A;  3VYT B;  3ABK H;  4W97 A;  3SEQ A;  3F9K A;  4M6V A;  2Q1Z B;  5JR3 A;  3J7Z I;  3WTT C;  3G73 A;  1I3A A;  2QEN A;  3LQQ A;  2XF7 A;  3K2Z A;  5HLH A;  1HLV A;  2W85 A;  3C2H A;  1JGS A;  2WV0 A;  4II2 A;  2CJJ A;  2XPV A;  4QIW N;  1BJZ A;  4EEF G;  5LLQ A;  5CVJ A;  1K78 A;  4XK4 A;  3LA3 A;  2VKV A;  2ISZ A;  5DCM B;  2R5Y A;  3CDI A;  4XQF A;  1YIJ I;  3RTR A;  2IS6 A;  1D0Y A;  4YG2 F;  1FT9 A;  3PM1 A;  1IZ1 A;  1MGT A;  2JZY A;  2LBF B;  1BC7 C;  1OYY A;  1WSU A;  2DQL A;  3H5R A;  2FQ3 A;  4BHB A;  4CDG A;  3HOY J;  2K02 A;  2K5C A;  2DA6 A;  1FNN A;  1QO0 D;  3K6G A;  1YJ9 I;  5E3L A;  2A3S A;  5K7H A;  3K4L A;  3LMM A;  2OBP A;  2CUJ A;  3ZMZ A;  1O3Q A;  3L2U A;  3NRV A;  1T39 A;  2COB A;  3BJ6 A;  2FXA A;  4G7H F;  3JRI A;  2EV6 A;  3DLA A;  1PUE E;  3H3Z A;  1DQU A;  2V1X A;  4CGZ A;  2KIS A;  4L9J A;  1JTY A;  1WH7 A;  2MSY A;  1GXP A;  2O7O A;  3VDX A;  1DP7 P;  4EJT A;  4Q4Z F;  4XLC A;  2A6H F;  2E5Z A;  2EIN H;  4C30 A;  4A2U A;  3JRD A;  2WY7 Q;  4E7S A;  2IW5 A;  2PMH A;  5FGM A;  3B6A A;  5FFZ A;  2BXZ A;  1Z05 A;  2F2E A;  1FTT A;  4HQE A;  1Y8Q B;  3IRR A;  3PNY A;  1R00 A;  5KNL A;  3BR6 A;  2DMQ A;  1O3S A;  4HW0 A;  2ACJ A;  1MMS A;  2ZFU A;  3AAF A;  4D5F A;  3H5N A;  1UJ8 A;  4G8X A;  5F08 A;  4EM2 A;  3D5R C;  3HB9 A;  4YRV A;  2XV4 S;  3HYI A;  3VOE A;  1BR4 A;  4B4C A;  2L01 A;  5FKL A;  2L9S A;  4GXO A;  4HDV A;  3K70 D;  1KYZ A;  4RB2 C;  2DXI A;  1BBY A;  2ELH A;  2EFN A;  4XLN F;  4UNO A;  1P6R A;  3KPH A;  2HU9 A;  1YW7 A;  4IHX A;  2HDC A;  4YEJ A;  4KFC A;  3BG5 A;  4U0V A;  4CCO A;  3MKL A;  3G6E I;  1B1B A;  4OIP F;  1E2X A;  4CHU A;  2A69 F;  1Z9C A;  3KP4 A;  1QBJ A;  4RAG A;  3QOD A;  3MAJ A;  2KIF A;  1HW5 A;  4HST A;  1VFC A;  5E8I A;  2XRN A;  3WTV C;  1U0J A;  1IDZ A;  4CUG A;  2P5V A;  2E1M C;  4A3B J;  1JKP C;  4G7Z F;  3WOD F;  2IS2 A;  3KYD B;  2R92 J;  4HV5 A;  2DMN A;  2OC6 A;  2QVO A;  2TRT A;  4RGX A;  1OFC X;  5FRM A;  2V9K A;  4V2F A;  4A3I J;  2LKX A;  1G3T A;  2EA4 A;  4JK1 X;  2QZ8 A;  3CO7 C;  1A31 A;  4EV0 A;  4XLH A;  3RKY A;  5GAE J;  1IO2 A;  4XN0 A;  3QAH A;  2R7X A;  1P4W A;  2XSJ C;  4WCG A;  2EIK H;  1Z7L A;  1OIS A;  1FY7 A;  5GAH J;  1TLH B;  4RM3 A;  3S1N J;  5DUK A;  3QP5 A;  3FIW A;  1T95 A;  4A12 A;  4QWQ A;  1JE8 A;  5LD2 C;  3OS1 A;  5A2Q Z;  2OPT A;  4EJO A;  3DPT A;  4LG3 A;  3OYL A;  1S3J A;  1RZ4 A;  4XRF A;  2M87 A;  4BAY A;  4BDY A;  1WFX A;  5D4S A;  3GX4 X;  2O0Y A;  3PQK A;  3G2B A;  1O4X A;  1WZ2 A;  3S14 J;  2ZO4 A;  2PEX A;  2JUC A;  5D6F A;  1SD4 A;  5CPR B;  2DA1 A;  5IP6 A;  1JXS A;  5K1Y A;  4ZYA A;  2Y9Z A;  4I01 A;  1W7P A;  4FTH A;  3HIF A;  3GME A;  2P7C B;  2X1E A;  2HQ5 A;  3CJQ B;  1IV8 A;  4KT6 A;  2VN2 A;  3R0A A;  3FMS A;  1TT0 A;  2LKP A;  2XAU A;  2E7W A;  2Y9Y A;  4LG0 B;  5LEJ A;  5C4J J;  1Y39 A;  2XGC A;  3AG2 H;  2HQN A;  4KIB A;  5CYV A;  3C7J A;  2F5F A;  5CLS A;  2BV6 A;  3O3K A;  3TW6 A;  5D8K B;  1LNW A;  2KMU A;  2K3P A;  1VQL I;  3TW7 A;  4XN3 A;  3CF5 F;  2FRH A;  2M0C A;  4HNU A;  1CGP A;  2H09 A;  3IWF A;  1W4M A;  1ETV A;  1R58 A;  3WG7 H;  3FHZ A;  2IVM A;  2CV0 A;  1XCV A;  1MH3 A;  1AHD P;  4NB5 A;  5BMZ A;  1NTC A;  1UEL B;  3H5A A;  2DU9 A;  4BQN A;  3WGI A;  3Q3S A;  4ZYD A;  1WKM A;  3FK7 A;  2CUZ A;  2PMZ N;  1VQ9 I;  3OIQ A;  3OYF A;  3LFK A;  1G2H A;  3OYA A;  2DDB A;  3SZP A;  4GRI A;  1XGO A;  3MZH A;  4Y15 A;  2A5Y B;  4HOB A;  2F48 A;  2DYR H;  1PP8 F;  4A3G J;  3BPV A;  1ZKG A;  4RDU A;  4UB6 C;  1S9H A;  1R1T A;  1S8N A;  1KU7 A;  2NVU B;  3VSL A;  1RC9 A;  2PN6 A;  1K7A A;  1JKO C;  3DF8 A;  1MIJ A;  2PJR A;  2RV8 A;  2D5V A;  1V5F A;  1Z77 A;  1B8I A;  2PLY A;  1X58 A;  3BOQ A;  2MC4 A;  4DW6 A;  4BJ6 C;  1SEU A;  1ZGJ A;  4ENM A;  2GM4 A;  1K78 B;  5LGU A;  2ZME A;  4II3 A;  1A5J A;  4RM2 A;  3G1O A;  4A3F J;  3L7W A;  3CLQ A;  5HLG A;  2L54 A;  2VIX A;  1YRN A;  3A01 B;  4IRH A;  3VYU B;  4HV6 A;  1ZG5 A;  2M5W A;  4RLQ A;  2CQN A;  3DP7 A;  2XSD C;  3LOC A;  3BC8 A;  3ZN0 A;  4U88 A;  3B6C A;  5DDG A;  3AL0 B;  2IT0 A;  2LMD A;  3QPS A;  4LIU A;  4B44 A;  5JLX A;  2M4G A;  2W4S A;  3ZP5 A;  1GT0 C;  3LST A;  2LP0 A;  2A05 A;  2FSW A;  3D0S A;  5IOY A;  2DTR A;  4M3F A;  2A6E F;  1FZP B;  3W6J B;  1WJF A;  2KPM A;  3V7C A;  2LYC A;  3ZOB A;  3DKY A;  3H0G J;  3QOP A;  1ZN2 A;  1W5C C;  2E36 A;  2LDU A;  3GTP J;  1BI1 A;  2ELJ A;  4ZDL A;  2VB6 A;  4WF2 A;  3T0Y A;  3MWM A;  1IN6 A;  2LFB A;  2CQX A;  2W84 A;  2CH0 A;  3AKZ A;  4DZJ A;  2L9V A;  3PL8 A;  5EG0 A;  2L5Q A;  4U0Y A;  3RPU A;  3CJR B;  1TBX A;  3BQY A;  2V6E A;  2EV0 A;  4P1W A;  1V4R A;  3MVP A;  3MQ0 A;  4RMN A;  5LHI A;  3SHF A;  2DT6 A;  2LVS A;  2EFP A;  2DO7 A;  2NS0 A;  2P7V B;  3S3O A;  2YR2 A;  1TWF J;  2EFQ A;  5D5W B;  1MMN A;  3TO7 A;  2CFX A;  4RAF A;  1ZTR A;  3M1E A;  5BOX A;  4E6K G;  3I56 I;  2Y31 A;  3CQZ J;  5CQG A;  1ZG3 A;  5CVV A;  4AVP A;  4HYE A;  2QKM B;  3HHH A;  1X2N A;  1X4P A;  3SZT A;  2LSO A;  2EWN A;  4AU7 A;  2ECC A;  2FNP A;  3BJO A;  2YUS A;  3FXJ A;  3MZ8 A;  4HX8 A;  5F0H A;  3ZMS A;  1LQ1 A;  1IG7 A;  1K4T A;  5ICF A;  2O03 A;  1P7I A;  1N75 A;  3HDD A;  3IP4 B;  2WA0 A;  5J4V A;  3CP8 A;  4IRG A;  3LAJ A;  4IHT A;  1WJB A;  4CZZ A;  3MMY B;  2M8G X;  1J0R A;  4KIG A;  4E70 A;  4XSZ F;  1DUX C;  3A03 A;  1XGM A;  5JVG F;  5JLW A;  1XX5 A;  1LKX A;  2EK5 A;  1OQY A;  4O5V A;  3TKY A;  1P4X A;  1OMI A;  2LC2 A;  3CC4 I;  4TV7 A;  4N4O B;  2GZW A;  4AM3 A;  5FRN A;  2H1K A;  5K5Q A;  2W00 A;  4B3X A;  2LK2 A;  1R36 A;  1JUP A;  3HTS B;  4J00 A;  1QVT A;  3OYD A;  2FF4 A;  2H8R A;  2AO9 A;  4BEH B;  1D1C A;  5AIP A;  2QQA A;  1MDM A;  2G7H A;  2Y0M A;  1XMA A;  3U21 A;  3C3W A;  1FSH A;  4DBR A;  1IRZ A;  5CVR A;  1X3U A;  3K4M A;  4XRS A;  4ZZL A;  1RIO H;  1V55 H;  2X6X A;  1XC5 A;  3E5U A;  2DK5 A;  4MGR A;  5IYC J;  4I99 C;  2CWE A;  2OAZ A;  3BCA A;  2R5Z A;  4DYC A;  4BBS J;  1E3O C;  4R8H A;  4ZTJ A;  3H3V K;  3MEX A;  1MD0 A;  2X6W A;  1T56 A;  2EQR A;  1JI8 A;  1WJD A;  3SEZ A;  4CO8 A;  5F64 A;  1MH4 A;  1BJA A;  4MIM A;  4RBO A;  1R6R A;  4HPQ A;  3L2R A;  1G8X A;  4XID A;  1EA3 A;  4P9U A;  1R5G A;  5C3E J;  2FD5 A;  3M4O J;  4L5J A;  2YX4 A;  2P5L C;  1JUM A;  2AQE A;  3OR2 C;  5BNG A;  4NHJ A;  1T6S A;  4XLF A;  4UUS A;  5F1J A;  3C2B A;  3WTX C;  2R7O A;  2VQC A;  4EAT A;  1UHW A;  3ECO A;  3BZK A;  1MJB A;  2ADU A;  2MG4 A;  3HRU A;  3PIO F;  3CCR I;  1HXD A;  5F04 A;  1ONV A;  1P7J A;  1VQ7 I;  4EJV A;  3LWF A;  3RKQ A;  1G4D A;  3GTJ J;  3I0T A;  4JX6 A;  3GZ6 A;  4HX7 A;  2MA3 A;  1SC7 A;  1U5T B;  5DD8 A;  2HTJ A;  5L3B A;  2E1O A;  2PMU A;  4GFB A;  1QVU A;  4I0A A;  2GA2 A;  3DEW A;  5CKT A;  3DU6 A;  3GFI A;  3F72 A;  2DFF A;  2VXD A;  3GTO J;  1WCM J;  3P7N A;  1IF1 A;  2WY8 Q;  1VQM I;  2MYS A;  3K1N A;  1YTY A;  2ZME C;  3VSK A;  2VUM J;  3HUG B;  1FJL A;  1OCR H;  2DA5 A;  2G7U A;  2MD5 A;  3DV8 A;  3WG9 A;  2YPR A;  5F27 A;  3WHC A;  2WAE A;  3IH4 A;  4OWR B;  4KIS A;  1FEX A;  3S1M J;  1KQ8 A;  3OYN A;  1WHU A;  3LAP A;  3BG3 A;  3BCB A;  1U8B A;  4PJN A;  3RZD J;  4C3H J;  2MD0 A;  2PG4 A;  4A6E A;  3FXR A;  2CUE A;  1XMK A;  3PUF A;  3PFI A;  1I5Z A;  5DTD A; 
#chains in the Genus database with same CATH homology
 1OCO H;  1V54 H;  1OCR H;  3ABK H;  3ABL H;  5B1A H;  1OCZ H;  3ASN H;  5IY5 H;  2ZXW H;  1V55 H;  3WG7 H;  2EIL H;  2DYR H;  1OCC H;  2OCC H;  2EIJ H;  2EIN H;  3AG3 H;  3X2Q H;  2EIM H;  3AG2 H;  3ASO H;  2DYS H;  2Y69 H;  3AG1 H;  3AG4 H;  5B3S H;  5B1B H;  3ABM H;  2EIK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...