3WG7H

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3wg7H00
1V55H 3WG7H 3ASOH 1V54H 5B1BH 3ASNH 1OCCH 3ABKH 1OCOH 2EIMH 2EIKH 3AG2H 2EINH 3AG4H 3AG3H 3ABLH 2DYRH 3ABMH 1OCZH 3AG1H 5IY5H 2ZXWH 1OCRH 2EILH 5B1AH 2EIJH 2DYSH 2OCCH 5B3SH 3X2QH 2Y69H
chains in the Genus database with same CATH superfamily
4KT6A 1G6NA 5C4XJ 2H27A 1Z9CA 4XKBA 4RDUA 2EIMH 2O8KA 4E7HA 2CFXA 2QYOA 2XPVA 4A3CJ 3OV8A 5FFZA 2MD5A 2OUMA 2D1HA 3ZRGA 2F5EA 4LJZF 1SEUA 2WY7Q 4OAZA 2GIZA 2X1EA 3GFMA 4HF0A 2ZKZA 3BJOA 4OIRF 1G59A 2K4BA 1RRJA 3GTKJ 2MA3A 2A3SA 3E5UA 5E1XA 1AKHB 5ICGA 4B48A 2DN0A 2VASA 3WE3A 3K7AJ 3SDBA 5GTHC 1TW2A 1FBUA 3J7ZI 4ESBA 2ELKA 2I8DA 4N0BA 5HS9A 1ETYA 1FYMA 1IDYA 1K61A 2DA3A 4CCKA 2EZIA 2EJRA 1EF4A 3KE2A 3PIOF 5LLQA 1RZ4A 3BY6A 2V1DA 2LNBA 1STZA 2OV7A 2CO5A 4A12A 3K6GA 3I4PA 1H8AC 1WZ2A 4WF2A 4F3QA 1ODDA 4MHGA 2E2JJ 1ZHFA 1FY7A 2Y0SN 1I6XA 1UHSA 5FFXA 5DUKA 5GTIC 1UFMA 3JRFA 4ZZLA 1R4NB 4R79A 3I4MJ 3DKYA 4M3GA 1A04A 4PJLA 3S1RJ 1JKRC 2VBXA 3QQAA 5C44J 3OYMA 4CCOA 3P9IA 3EUHA 5BPDA 2L7MP 4ZYAA 4G94A 5M3MJ 2UZKA 2QSFX 3BZCA 3I64A 1U5TC 2LKSA 2VQHA 1Y1VJ 1DPUA 2BW3B 2IW5A 3AG4H 3AG3H 2XAFA 2F4OB 4I7HA 3K0LA 5J8FA 2OQRA 1IGNA 2VN2A 3L1PA 1PP8F 4MO7A 3BPXA 3I59A 1ZK8A 3PJRA 3L09A 5B3SH 3HOYJ 2NNNA 2KIQA 4HV6A 1Q1HA 2LY9A 1MW7A 4MLOA 4G7OF 2CFOA 1SFKA 2FU4A 2EFQA 4DBRA 4HEA2 2R5YB 2RV8A 4KMUX 4FX0A 3F23A 2D45A 5GPAA 4AU7A 4QWQA 4A0ZA 4WK8F 2EH3A 4HX8A 2HYGD 1D1BA 1SVOA 4XM3A 2G0EA 2JVGA 3BJAA 5J4VA 4IRIA 3ELKA 1ACIA 3M8EA 3HYIA 5EDNA 3PFYA 5C3EJ 5FKOA 1QGPA 2BZTA 3JREA 3CC4I 2W48A 1QPMA 1KONA 1USSA 2K4JA 1I3QJ 3PSIA 2DFEA 2LH9A 2HOTA 3LSTA 2XAHA 1WVRA 1NH3A 1S7OA 2MLKA 4GCVA 1K6YA 1BOAA 3TL4X 2BGCA 1IXCA 1T56A 3ZQLA 4NQWA 1FZPB 1KQ8A 2M45A 4J00A 3Q9VA 3CCEI 3ZQCA 1QA6A 5K1YA 3BPVA 2CH0A 4PFPA 1P92A 2VLAA 2V9KA 1ZRCA 5A2QZ 1X3ZB 1XN7A 2KDOA 1V54H 1A5JA 2DA1A 5L3GA 4FCYA 4LMYA 2E1MC 2OZ6A 2VT3A 4BYYA 1VQMI 2DOEA 3H5AA 1K79A 1KU7A 1TNTA 1FIPA 2P6SA 3RYRA 3ABMH 2DODA 1JUPA 4I76A 2E7WA 3GZ6A 4LLGF 4IO9F 4W97A 4GGGA 1B6AA 3AAFA 1QHGA 5BPIA 2CMPA 1SD5A 1JJ8C 3KZIC 3COAC 5DDGA 5IT9K 4MQVA 5K5QA 5D8KB 3CCVI 2Y69H 1O7LA 5E3MA 1A35A 2HFHA 3JTHA 4B44A 1SFEA 3CJTB 4M3EA 3H0DA 2QBYB 3ABKH 4JQFA 2KMUA 3ERMA 4E7IA 1J5YA 2IT0A 5DCFA 2YPRA 3I9V2 4XKCA 3ZMUA 1QU3A 2ESNA 3WU2C 4BJ6C 2CWEA 2P4WA 1TQMA 4KJZA 3E6BA 1S29A 3HSEA 1FPQA 2DOAA 2OJED 4RLQA 4HV5A 4UY8I 1WGXA 2GLOA 4BHCA 4KYWA 2EFOA 2DA5A 3HKZA 4CDGA 5F6FA 2YS9A 5C4JJ 1RPWA 2LRDA 2ZXIA 4B3XA 3PUFA 3V7CA 1P6RA 3PQJA 1Z7LA 4UVAA 3CUQA 4NB5A 3J7AO 4BL0B 1T95A 1DQUA 1LVKA 1UB9A 2ZMEB 1FC3A 4RGRA 5FKNA 4IOAF 2HQ5A 2PBIA 3HTSB 2UV1A 3FXMA 1ZG5A 3FXLA 3S3NA 4OU0A 5AIPA 3GO5A 2L4MA 3FMSA 3E1SA 3W6VA 5D5WB 1YS7A 5ICEA 2XIGA 5J4YA 4B09A 4ITVA 4UV8A 4XK4A 4XLHA 3ROUA 4BBRJ 1XMXA 3F72A 1ZQ3P 3HRUA 1VI0A 2K02A 1U5TB 2WB1N 2NOGA 1DGWY 4M9XA 4B8XA 3D5LA 4HNUA 5L3CA 2L02A 2RQQA 2PFBA 4KITB 2F5DA 2RDPA 3DP7A 2MYSA 4LFUA 3KETA 4ZJZA 4M6YA 2JA6J 1S72I 2GM4A 5JVTA 3JCUC 5GPCA 3CC2I 1ETOA 4V19K 4DZPA 2E1MB 4J01A 2LVSA 1Y0UA 2H6CA 2J5PA 1BA5A 2CRGA 2K5CA 4N9IA 3OYLA 2YX7A 3I0TA 2M8EA 1ZLJA 1Y8QB 2K85A 3Q0UA 4HX4A 2VIXA 3KP6A 1OLTA 4PSWA 2HDCA 5JLXA 2R5YA 4I2OA 1WWXA 3EETA 4HYEA 1MMSA 1HCRA 5FKMA 3QWLA 3M1CA 1Z3YA 3ZMTA 3SZGA 2R7VA 2UUZA 3RZDJ 2H8WA 4MQ9F 2W00A 4IVNA 2DCEA 3WU1B 5E18F 4H4KC 3I56I 4DNCA 3PNTA 2XGEA 3IAS2 2LF8A 5E1ZB 2ZNZA 3RI4A 3HEFA 4OMZA 1ETWA 5L3EA 2WY8Q 5HLIA 2KHMA 3BR1A 2V1NA 1T6SA 2GZWA 5HDKA 2F2EA 3MN2A 1XS9A 4KIGA 5BNGA 1VQOI 1OCRH 5DD4A 4E7SA 3DKXA 3KFWX 2XHKA 4S0HB 2EZLA 2RVCA 1UZCA 1GDTA 1F1ZA 3KZZA 5ICFA 1U9OA 3HB9A 1T2KA 4HPQA 4A5NA 3CDLA 1MIJA 1MMDA 3DKWA 1U2WA 5KK1A 1CF7B 1KYZA 1LKXA 4AUXA 3KYDB 1HOMA 3TDUC 5IYBJ 2Y9YA 3WHBA 1EH6A 4JBAA 1JGGA 3F8CA 3MZHA 1YX3A 2EILH 3W2VA 2DK5A 4IJAA 1ZREA 2NVXJ 2OPTA 4A3FJ 1ZG1A 1SD7A 2JVHA 4L5JA 1WJCA 1UELB 2EK5A 1ON2A 5DUIA 1YJWI 2ELHA 1UG2A 4FHTA 4EM0B 4W1UA 5KNLA 1Y6IA 2L9SA 4LLLA 5J47A 2E36A 4MNUA 2JA5J 1AA7A 2G7HA 3OL3A 2VQLA 4CCJA 1VQKI 9ANTA 2IAIA 3BR2A 2CUFA 3Q0VA 2HU9A 1I27A 1XGSA 2RREA 2FUG2 2GAUA 2R7RA 3Q0WA 1LB2A 1LUJB 2FNAA 3CCJI 2O3FA 1J09A 3W2WA 4ENMA 3EYYA 1ZTRA 2OTLI 1OCTC 1UHWA 2RGVA 3WTSC 1PYVA 3VEPA 2I10A 2FA5A 2K9QA 4UB6C 3W6KB 2PJPA 3DLAA 3CDIA 2QGUA 1FBQA 2WWYA 2KISA 2CQ7A 3TO9A 4U0WA 4B1RA 2DTZA 4RM3A 2IS4A 3HOVJ 3EPZA 3IRQA 1EA3A 3FXOA 2V6CA 2W1OA 4PJMA 3BROA 2Z5UA 1JKQC 5F1RA 4X6AJ 1XGNA 3TO7A 4LK0F 3OYGA 4I0BA 4FE7A 5D4RA 4RAGA 1V5FA 3CCRI 5ILUA 4G7HF 1VF9A 5DEQA 4A93J 3GF2A 2IP2A 4E7JA 5FLXZ 1MSFC 4XLAA 2EB7A 2XAUA 3QPTA 1KZHA 1WJBA 2EIJH 4FISA 2E34A 3T5XA 2WB1A 2WC2A 1A31A 5GAGJ 5E3LA 2VE8A 2GXBA 5DM6F 5L3FA 2NAZA 2V1XA 1ULYA 2M30A 3G6EI 3BOQA 1Z3XA 3OYAA 1S3JA 4II2A 3RPUA 5DM7F 1MMGA 2JT1A 3DBRB 5D8LB 1W36D 3L2QA 1ZGAA 3JAMK 6PAXA 1NTCA 1X1BA 5F1JA 5M5YJ 3CO6C 2Z33A 1P7IA 2Y2ZA 1JUSA 3U2RA 3ONQA 3GMEA 4HRIA 1NK2P 2VPLA 2OU2A 2IBDA 3LSRA 2QWWA 3B73A 3K4KA 3QAHA 1TP4A 1U8BA 4C2MJ 4EGZA 4IKFA 2CUJA 3D5RC 3GFIA 3JRIA 5CVVA 1Y39A 5FRNA 3FM5A 2KIUA 1YRNA 3OY9A 4MTEA 1E2XA 2O03A 1TNSA 1Z6RA 3CO7C 1OCOH 1S9HA 5HDNA 1T98A 4G8XA 1JT0A 3C2BA 2HWVA 5JR3A 4RGSA 2M4GA 1OQYA 3OR1C 4NHJA 1R00A 3B02A 3LMMA 5GAEJ 1FT9A 3FK6A 1VNDA 2DJIA 5AONA 1DP3A 5CQEA 2XVCA 3JRBA 2NS7A 3QU6A 1WJDA 2CJJA 3X2QH 2DT7B 1FOKA 2ME6A 1IXRC 4DW6A 2B9SA 4ENKA 3S93A 5FLVA 5EEGA 2F6CA 4BACA 1E3HA 2KIMA 3CJRB 2F5VA 2F5CA 2D1VA 4OWRB 4XRFA 2LY2A 1TZLA 3CQZJ 2W24A 1JGSA 3NAUA 2R5ZA 2ZXHA 3QP6A 1IC8A 1WKMA 4LK1F 1EJ9A 3HRTA 1FWZA 5F0CA 5CVIA 3HHHA 4UV9A 4BKXA 1UCRA 2VB6A 4U7DA 1HW2A 3DEEA 2CS3A 3DPLC 5DTDA 1O7FA 4XLFA 4A6EA 1BI2A 1F9NA 3LSKA 5DD8A 2NNYA 2QQAA 5EEHA 3V42A 3MVPA 3FXRA 5GAHJ 3WTXC 3CMEI 1MNDA 4KNYA 3HZJA 1R36A 2XPUA 2ZO4A 1IV6A 1H9TA 2ZSIB 2H8RA 2D2WA 1K78A 2OA4A 4OINF 1W36C 3PIPF 1JI8A 2M3AA 2CUZA 5KVRA 1R71A 3M4OJ 3ULQB 1T0FA 1KU2A 3WTWC 1W0TA 3WG9A 4LG0A 1XCBA 2HGCA 1YITI 2KJCA 1XSDA 4LIVA 4D5CA 4A69C 4ESFA 2JWTA 2IA1A 3KP5A 2LREA 1UHMA 5KHDA 1R1TA 1YOVB 2DMQA 3H5RA 4S05A 1N25A 4ZH4F 3LA7A 1SVLA 2LF7A 4UNOA 1LEBA 2DA2A 3GZNB 1O4XA 4BDZA 4MTDA 3LSHA 5CVUA 2W57A 3MKYB 3CF5F 1V5EA 5LGUA 1J7KA 3FBIB 2NVTJ 1X58A 2MGQA 3V8KA 2E1CA 4K2EA 1WI3A 5FLMJ 3CJNA 3BTCA 2XGDA 2JA8J 1G3SA 1ZARA 2JA7J 2WAQN 3A03A 3RDIA 4CYCB 4FE4A 3SFIA 1ETKA 2KRHA 1MJAA 1L3LA 3KP3A 2NRAC 3I59B 5HDGA 2JPBA 1RESA 2DYRH 4XKWA 5E3OA 3LSJA 5DYMA 3OYEA 3L2RA 2KPMA 2UXXA 2XB5A 3A1YA 4PUSA 2BW3A 4BEHB 2QBYA 4XORA 2W84A 3WTVC 2QENA 2Y0MA 1E17A 4CZCA 3QP5A 1YS6A 2HYFA 1Y1WJ 4L18B 2M87A 1X1CA 2LMDA 5JLWA 4IHYA 2CW8A 4M3BA 4ZYDA 1FNNA 1YLFA 1XDUA 1XTAA 3FIWA 4BU2A 2R7FA 1C0WA 2OC6A 1X1DA 3PUBA 3TOAA 1VTNC 2FEZA 4Z6YA 4QSHA 2ID3A 1I5ZA 2XF6A 3JRAA 4I09A 2BOLA 1UMQA 3A2KA 2GXAA 4I6ZA 5ERIA 1FSEA 3E5XA 1O3RA 1W5TA 1XB4A 1K78B 3JRHA 2ID6A 1R4MB 4HZFA 4YIRX 2P5VA 3TKYA 1Z05A 3DXJF 3HOTA 2M8GX 5E79C 4D1QA 3S8PA 3KYCB 5J6XA 3KP2A 1AHDP 5EGOA 5IY5H 2ZXWH 1S6LA 4A0YA 2H6BA 3LOCA 5TISC 1YJ9I 4WXDA 1FP2A 2MG4A 3OYKA 4I98B 1B8IB 2ADUA 1WJ5A 2AS5F 4N9HA 4QPOA 1H9GA 2E2IJ 2VKHA 3CCYA 1I50J 1PDNC 1XCVA 4IHVA 3BTJA 2Y31A 2RKHA 4A3LJ 2LDUA 1BW6A 3QYFA 2K9SA 5KCMA 5HNFA 5K7FA 2EPFA 3T1BA 3J7AY 3DEWA 1Z91A 2IA2A 3K4NA 1WQ2A 2DBBA 2PG4A 3AL0B 2QQ9A 3EYIA 2BY1A 1Y8RB 1JHFA 5BS6A 5F0HA 4BE2A 1IZ1A 4RM2A 2AHQA 3CLOA 4X1EA 1HA8A 2HS5A 2ZJ2A 4NC6A 1OR7A 4JOMA 3W6JB 3A02A 4AM3A 1QQIA 3K70C 2JN6A 4HAMA 2DQLA 3SXYA 2MC4A 2L7KA 1E3OC 2M7BA 3P9CA 2MH9A 2ELJA 2KQRA 5LRRA 4CYCA 1F5TA 2B7EA 3RJPA 5K5RA 4IHSA 2R7TA 2R7XA 4LIUA 3HOSA 2H1LA 4ZTJA 2HOSA 3EQLF 4FX4A 2IRFG 2DJNA 1T0FC 2DI3A 2PLYA 1NK3P 2YR2A 3B6CA 4ENNA 1FMVA 1LDJA 3ASNH 4OAYA 2VC0A 1X3WB 4BS9A 4AIKA 1Q1VA 4Q48A 4R1HA 5HLGA 4P9FA 2HQAA 1O3SA 3E6DA 4UUSA 1YIOA 2STWA 2ZC2A 3N97A 2ZBKA 1FEXA 2CG4A 4G6DA 3FZVA 5BOXA 3ZMSA 2A68F 4XBFA 5EG0B 3OR2C 2PN6A 3GFLA 2B0LA 1N78A 4XSZF 3TOBA 4CSWA 3K10A 4F93B 2H94A 1Z0XA 3QRFF 4PJNA 4XN0A 3VYTB 3MZ8A 3HKZN 2XB0X 4IPAA 4AIDA 3S3MA 1DUXC 1I1SA 3P5JA 4EM1A 2CQQA 2L7FP 4G12A 2CYYA 2HOAA 2E1OA 5FD5A 2Z16A 1V5GA 2HVRA 2HI3A 1TWFJ 5CJ9A 2A07F 5E20A 1BOBA 3OYHA 2NS8A 3L00A 3V8JA 4J19A 4LB5A 2MBFA 4DYCA 3MKZA 3H9QA 1LDKB 3LSMA 3PM1A 3QYEA 3JRDA 3JSOA 3GTJJ 1GHCA 2A6EF 4BY7J 2KJBA 1LE8B 3M8JA 1KQ0A 1OYWA 3RSNA 2K3FA 3FXJA 1W7PA 5J1YA 3WG7H 1OYYA 2FX0A 1BR1A 2ZXJA 4F52A 1R9TJ 1FJLA 2EFPA 2VQCA 1L0OC 1LE8A 1BJAA 1MDMA 2FMYA 3OMYA 5E8IA 4QIWN 4IHXA 4YFKF 4WXHA 2JTVA 1CGPA 1I3AA 2X6OA 3R4KA 3ZQQA 1OR7C 1RUOA 1BBYA 2W25A 1OCPA 4XLNF 3L2UA 1CQTA 2X6WA 4IQ4A 2P7CB 4YIIA 3KYLA 2Q0OA 1MD0A 2WV1A 2L4AA 2HPMA 3C2GA 2R7SA 4XLEA 3TEDA 2IGKA 2KZGA 2HR3A 1WPKA 2MD0A 2V9VA 4NUBA 5AIQA 1HQCA 4CICA 3F6OA 2M0MA 3CF2A 1ZKGA 1V4RA 2X48A 1V3FA 2HXOA 3LA3A 5DS9A 5LEKA 2QCOA 3M07A 2PX9A 5LRSA 3DWLE 2BVMA 3K4LA 2LKPA 4NC7A 3AG2H 3LFKA 1JKPC 2VOPA 2CSOA 4HDUA 2CV0A 1OCZH 3QYBA 3TP0A 4UUSB 4GRIA 3HL2A 4A3MJ 3L2VA 2O6GE 3ZPLA 2EV0A 5IT9Z 3OYDA 1FYLA 5B66C 3DTIA 4GYIA 1QPIA 1X1PA 1FTZA 5FD6A 2FOWA 3NQOA 5D6EA 2XROA 2RN7A 4JX4A 1REPC 2TCTA 1PJRA 5EEAA 1FLIA 1XG1A 3A01B 3ZP5A 2QSGX 2LLKA 4XSXF 1HKSA 1LJ9A 2CU7A 2PQ8A 5D4SA 1OISA 5EYRA 3DBLB 3KX2A 4EGYA 3P9KA 1JUMA 1LVAA 2KFDA 5KAIC 5JHUA 3RPUD 1X2MA 2K9NA 2OAZA 1WFXA 3R0AA 1ZGJA 3ERED 2BHZA 3J7YJ 2OZUA 5DV5A 1TWCJ 2K27A 4CA0A 3CP8A 2O0YA 4KDPA 3MKWB 3Q5FA 3FXKA 4EQQA 4XRMA 2X1CA 2VJ4A 2LP0A 2VXZA 3IH3A 3REOA 1YRNB 3CMAI 3H1CA 2E2HJ 2R93J 1VQ4I 5M5WJ 2FBKA 1MMNA 4M6XA 2GA2A 3UNGC 1BI3A 2EZHA 3ZCOA 1A6IA 3GVAA 3IKVA 2QKLB 2VJIA 3LAJA 5TJJA 4HQEA 1KU3A 2JMWA 4XOPA 4BXUA 1V55H 4G7ZF 2GXGA 2ICWG 2RNGA 3OL4A 1M1EB 4M3DA 4ZYHA 2X0LA 3O3KA 4LD5A 3BCAA 5A2QK 3WU0A 4XR6A 5IT3A 1USTA 3TW6A 1TQPA 2LBFB 3IRRA 1KA8A 5EG0A 1K83J 2MLGA 1Z6TA 3FKJA 2LR8A 1Y56A 2LSOA 4ZTFA 2X1DA 1K4SA 5LGTA 2R4GA 4ABZA 1IO2A 1IN8A 3WTUC 1W0UA 5ICCA 3R0JA 3I71A 1RETA 2ZCWA 3GFJA 2X85A 1IN4A 1W7PB 1HSTA 2MC3A 2XSDC 3K4CA 4RB3C 1ZAOA 2BHYA 2FRHA 2ZFUA 3RYPA 4EEFG 1RUNA 2IS6A 1BJZA 1IN7A 3K2ZA 3MKLA 1YYVA 4ZC3A 2P0WA 5TGTA 1BIAA 1K4TA 2IVMA 2KZVA 5F27A 4B43A 2FNPA 2ME0A 2KT0A 3OIPA 5F64A 2DA6A 3KLOA 2Z2SB 3LQQA 3LSGA 4EMSA 3SDGA 1U78A 4B3AA 3H9GA 4XL9A 1QZYA 4EJUA 3KLNA 4LLNA 1SD6A 1FX7A 4AD9A 2DDBA 3EUKL 2WTEA 2W85A 1YX5A 2C6YA 4BJTA 1MGTA 4AYBN 4KMFA 1IRGA 2BBYA 3KZYA 4RB0A 2A61A 2QKMB 4E6KG 1SVMA 4IF4A 4U7BA 2WADA 3CP2A 3FDYA 1J9IA 3MZYA 2QZ8A 3FF5A 1TL8A 3F8BA 1W4MA 2JA2A 3U1KA 4V2GA 2CQNA 3KEQA 2M4KA 3ZN1A 4L9VA 1BN5A 4XN3A 1IRFA 4CHUA 3H3VK 1AU7A 4PJ0C 3HOWJ 2D5VA 4LITA 1EV7A 1W7PD 4YFNF 2YX4A 1SMYF 2Y48A 2AO9A 4ZYEA 5EGOB 4M9ZA 1MBGA 3U21A 1RIOH 1TWHJ 2JSPA 3GW2A 3GCMA 1FMWA 4X0GA 3F9KA 5F0FA 3H36A 2NVQJ 1YQAA 1ZGWA 4XLCA 4CH7A 3M1EA 4XQFA 3OYJA 5HVQC 2EFNA 3S17J 3OS1A 3F6VA 1GVJA 3P7NA 2PMHA 2ECBA 3VPRA 2DMPA 2EV6A 4HA8A 4UVBA 1D1CA 4RB2C 3TW7A 3GTQJ 1GVDA 2JK3A 4WXCA 3TO6A 3CESA 2BXYA 2LKXA 3N4MA 1B8IA 5EZHA 4CYDA 3K70D 4XONA 4C2UA 4DYRA 2IXSA 2LY1A 2MSYA 2L9NA 5D5VB 1XSVA 3HJEA 3QOPA 3W3CA 2B63J 1B59A 3V4GA 1KGSA 3L2CA 3CJQB 1ON1A 3MQ0A 3BTIA 3WGIA 4BAYA 4KT5C 4A2UA 4NBQA 2WV0A 4PDKA 3HIFA 2DT5A 4HNTA 4BE0A 1YIJI 1NHAA 4A3IJ 3WGHA 4CCNA 4AIJA 1UAAA 4OIOF 1FYKA 3CUQC 1T38A 2IJLA 3HPGA 3S1MJ 1WJAA 2M7AA 3C7JA 2TRTA 3CZ6A 2HDDA 2K3PA 3IC7A 5CKTA 4OMYA 3H3UA 2XAQA 2HQNA 4BQQA 3ML6A 4PJJA 3S1NJ 1FTTA 2NYXA 1MH4A 2DYSH 2WBMA 1XX5A 4RGXA 2ZJPF 4C2TA 2XASA 4C9YA 4A3KJ 2HTSA 2UXNA 1ZRDA 5B1BH 4A3GJ 3T0YA 4H0EA 1LDDA 3A4CA 2H1KA 3F8MA 1JXSA 1A6QA 2K86A 3DF8A 2ZNYA 2VBZA 3F8FA 1P4XA 4DIQA 1E0EA 3BCBA 1D8KA 2L7ZA 1JTYA 4XLPF 2GWRA 2LC2A 3PL8A 3TDZC 4KA4A 5D5XB 2EZKA 4LOCA 2XDVA 2OCEA 2E19A 2E5NA 4HG2A 4WCGA 4OOIA 2PMZA 1TLHB 3MMYB 2WAFA 2V7FA 1TT5B 3K1MA 1Z77A 1JE8A 4N4NB 3CCUI 3CMMA 3QPHA 1CF7A 4M6VA 4IOCF 2HKOA 3K4MA 4I0AA 1LEAA 3I53A 4ASNA 5HS7A 2VOOA 1P4AA 3LSIA 4L5IA 4RGUA 2O5RA 1QO0D 3I3LA 3DPUA 2WAEA 3OYFA 2XF5A 1YW9A 4FTHA 1HF0A 1SAXA 2DT6A 4HBLA 4IHTA 2QQ8A 2Y9ZA 5M3FJ 5LD2C 5TRDA 4U88A 1R22A 2O9LA 2LOOA 5CVJA 3J80Z 3T8RA 1IN5A 1PUFA 3PSFA 5GADJ 1VQPI 3K1PA 1SFUA 3FX3A 1LPQA 1QVUA 3R6SA 1WH7A 2DFIA 1BC7C 3FWEA 2JPCA 4PCQA 3QODA 3IKTA 2HZDA 4HSRA 3TQNA 3E5QA 1QNTA 1YTYA 1AKHA 3TGNA 2BY2A 2HKXA 1EH8A 3E6MA 2O8XA 3BG6A 1X3UA 4KIBA 1D8JA 1TC3C 2DPDA 2BXZA 3BTLA 4FT8A 4MFEA 5ILSA 4EJVA 1KYWA 1RI7A 2R92J 2XPWA 2VKEA 1MJ9A 3OYIA 3AL0C 2LFBA 2H09A 4ZYGA 4L5EA 1POGA 3JW4A 2EINH 1U8RA 2K9LA 3GUDA 4UHTA 4Y13A 3VFZA 1D0XA 2VUMJ 2X6XA 3BG5A 1TQIA 1RKTA 2VBYA 1HKQA 4I99C 4Q5SF 4RAZA 1SANA 4C3JJ 2W4SA 3H35A 3LQRA 3ESWB 1G3WA 2E35A 3ISPA 4JK1X 2VE9A 4LG3A 2K9MA 4MEXF 3BJ6A 2YU3A 3VODA 2ZB9A 3WHCA 1D1AA 2OTJI 3SHFA 3DEUA 3FHNA 3RIRA 1YG2A 4DJAA 3EUHC 2DTRA 2FQ3A 5BMZA 2VC1A 2LK2A 2P81A 3PNVA 4YELA 1VZ0A 1Y0NA 2IGNA 4YIFA 2V6EA 3GTLJ 3RKXA 4E70A 3RKYA 3CDHA 4XMYA 2RC4A 3ZQHA 1IAWA 2JZYA 3S14J 2Y75A 2DMTA 2R7QA 1DPRA 1ZH5A 2PMUA 2YSRA 3IAM2 3HG9A 4BQNA 2WA0A 2BY0A 1B4AA 1TBXA 1MJBA 2CGPA 1FOXA 3ZXSA 3OYCA 3HGGA 3ZQIA 5JHFA 1IRXA 3HRMA 1IN6A 2Q2EA 3KP7A 5FB2A 2I5UA 1H89C 3IHUA 3H5NA 3JTGA 1Z7UA 4PSXA 3CMYA 2AQEA 4BH9A 1IV8A 2GIVA 3HHGA 2QA4I 4HOBA 3VYSB 2ZMEC 1OJLA 2LYCA 1MBFA 3CCLI 1T33A 3DTEA 2E71A 5HNHA 1ENHA 4Y3OA 4EJOA 1H88C 5F04A 5FKKA 3O6BB 2X6YA 4JYKA 2LG4A 4GDFA 3BZKA 3BQYA 3WODF 5H6RA 2R7OA 3GX4X 1WH5A 3ABTA 2CV1A 3HTUA 5K7HA 2BYVE 1A36A 1IRZA 4HW0A 4E7LA 2JUGA 2F4IA 2XAGA 1X4OA 3IWFA 4ON0A 3GYHX 3GTMJ 3ZN0A 4F91B 2O61A 1U9NA 1R58A 2AXLA 4ANJA 3BG9A 3IV5A 3BC8A 3NWTA 2BY3A 3LFUA 4E7ZA 3FKIJ 3BDDA 3C2HA 1IJWC 4RB1A 1GT0C 1G3TA 4IX7A 2E1NA 2KRFA 1S7EA 3MAJA 1D5YA 1D5VA 1B9NA 5LEJA 5LFAA 2ZJRF 4MFDA 2VPRA 1GLNA 1P9QC 4U0YA 2DW4A 3I58A 4G6TB 3SZPA 3WGGA 5HOOA 2IEKA 4QPQA 4DBQA 1VQ6I 2M34A 2NXNB 5DCMB 3HDDA 1ITYA 2EA4A 3C1DA 1T08B 3IWZA 4NDLA 3DCFA 2XKPA 4Y17A 4DOZA 3SJMA 3KPHA 3CC7I 1ZLKA 4II3A 3VYRB 4NC8A 1FOYA 2E60A 2PEXA 2J5OA 4U0VA 5IP6A 4KFCA 4KIFA 1OYIA 2QUFA 1QHHD 2BVLA 3ZOBA 4XIDA 2IS1A 2AQFA 1YFHA 3H3ZA 2VODA 2A5WA 2RNJA 3F21A 5K5OA 2NS0A 2DA7A 2EA2A 2FJ1A 4OIPF 5FRMA 2DMUA 5H2FC 3D5SC 3OWTA 4BNCA 4RMNA 3JSPA 4A3EJ 2HQRA 2X4HA 1R1UA 5IP9J 2M5WA 2Z99A 4BUPA 2L2OA 4WX9A 2A05A 1ZR2A 1NG6A 2QLZA 3E7LA 3G1OA 3KEOA 4HF1A 1HKTA 2XKOA 4C3IJ 2FE3A 1TTYA 1R1VA 3DV8A 2K40A 4AYBA 3BR0A 1HBXG 3QU3A 2XRLA 1LNWA 1O57A 3TMOA 1MMAA 1ZYRF 2LTPA 3S32A 4Y52J 3LNQA 2L54A 3CD6I 4HDVA 2ACJA 3K2AA 3G71I 3ECHA 1XGOA 3S2DJ 2HOEA 1WCMJ 2RQPA 3CTAA 3FHZA 1LFBA 3FMRA 1GUUA 2ZSHB 2Q8KA 2VJ5A 4FASD 2QF7A 1MSEC 2Z1DA 1XMAA 2P5LC 3SZTA 1YO5C 1R7JA 1YW7A 3DFGA 2ISZA 4EJWA 3S16J 3Q9SA 3M3YJ 1XSXA 1BR4A 4RBOA 1GV5A 3ZQGA 3G3ZA 1SD4A 2MABA 3GZ5A 5JI6A 1IF1A 4Y33A 3G1MA 1T39A 3PNYA 4XNFA 4AVPA 3ECOA 4I01A 3S15J 2ZJQF 3KIOA 3HC7A 2VKDA 4GXOA 1R5HA 1MKMA 3CCQI 4KICA 1VQ7I 3S1QJ 3OOUA 3GXOA 2Q2EB 3W2AA 4AC0A 5F08A 1FOWA 4KUMA 4QTRA 1W1WE 1XC5A 2ESHA 3JAMZ 4KN4X 2R3SA 1SFOJ 5JFRA 2DXIA 1DGRM 4DZJA 3SYTA 4BHPA 4ESJA 3DTKA 3F8NA 1FIAA 3TBIA 2FXAA 4EM2A 1ZELA 1RR7A 3VB2A 3G1LA 5BQTA 2R7ZJ 1P2FA 3NARA 5H6QA 1ZRFA 3ASOH 3R61A 4BXFA 3BG7A 2K7LA 2ZFWA 3MWMA 4R8HA 4XICA 2L0KA 1OKRA 4CUGA 3GLLA 3LA2A 1B9MA 5L3DA 3K4BA 2HZTA 2DDAA 3N05A 2KRCA 3MD2A 5HS8A 2JRTA 2M2EA 2YUSA 4Z2YA 3IL2A 2HVSA 2GQQA 3MEXA 3H92A 3HUGB 5IYDJ 1K7AA 3FXQA 2COBA 1O3QA 3LSPA 5B1AH 1VQ5I 2XGCA 5EJCA 1G4DA 1W5CC 1ZG3A 3OS0A 4B47A 2COMA 4A3JJ 1OPCA 2STTA 2FSWA 2TDXA 1YW8A 5LHGA 5ED4A 3G2BA 1I1GA 2G9WA 1N75A 1SMTA 3IH2A 2FD5A 4D9JA 3T8TA 4P5OA 3DPTA 2QQBA 4ZDLA 4ZDOA 3HM5A 1W5SA 1TWGJ 1X1AA 5D6FA 5M5XJ 2X51A 3ZGKA 2Q1ZB 3VOEA 3BG3A 3CCMI 3GBGA 2Y0SA 2HXIA 1BM9A 1S8NA 3MFKA 5FROA 2KP6A 3C3WA 4HLYA 1PUFB 3DU6A 1SAUA 2DO7A 3K69A 1WJFA 1BI1A 4E4HA 1YE9A 1Z21A 1OCCH 1G8XA 2VJJA 3R60A 4DQ2A 4YRVA 5EF6A 4B4CA 1AWCA 4GFBA 3J81Z 1HDDC 2W82A 2IA0A 4JX5A 4L0YB 2OBPA 4O3MA 3RQIA 2E5ZA 3OYNA 2V1UA 3ZMVA 2VL8A 2E7XA 4LB6B 2M9HA 3TP3A 4BEHA 3H0GJ 4TV7A 1LFPA 1R23A 2XUBA 4LG0B 3V8LA 2DOFA 5LBQA 2HYJA 1Z1DA 1IXSB 2OF7A 4CO8A 2BEOA 2N8GA 1HXDA 1BC8C 3K4JA 3LAPA 1B72A 2R0QC 4BBSJ 1ERDA 4ETSA 3BR5A 3A01A 1U0JA 4KISA 3F0CA 2EIKH 3FK7A 1HSJA 4G9YA 4A3BJ 3D1NI 1XPXA 5CLSA 3ABUA 1FP1D 4L9NA 5J1RA 5GP9A 1VQLI 1GV2A 1MBKA 2VQGA 3BLYA 3I55I 1QRYA 4HSTA 2CV2A 3CUQB 1Z67A 4BJ5C 3JRGA 4MEYF 1X4PA 4G6QA 2YU9J 4P96A 5IOZA 2DPUA 2G7UA 3GLXA 2IGMA 5IPAA 3BWGA 3HUGA 3IH4A 2FMLA 1VQ8I 1ETQA 1AOYA 2JRMA 2O7OA 4FETA 4EJTA 3BZ6A 5KAFC 4L0ZB 2VT2A 3DLLF 3RTRA 2NOJB 1MZBA 2MW8A 3GEZA 5LHHA 4EV0A 5IYCJ 1U5TA 1IUFA 3M8FA 1PUEE 4DGWB 2KDZA 2A69F 2DK8A 3BP8A 2L3DA 1SC7A 3K9TA 3DBHB 1LQ1A 2V9PA 4KN7X 2W7NA 3KCCA 1D0YA 3BR3A 2V4JC 3FMQA 2A5YB 4GO1A 3B6AA 2CUEA 2JQ7A 4RA2A 4CXFA 4P9UA 3HGYA 1MDMB 1R6RA 5CPRB 4A3DJ 4M71A 2V26A 2X9DA 2JUCA 1UG0A 1G3YA 1MBHA 2Y30A 4CGZA 3I4NJ 1APLC 2QM3A 4Y15A 4IRGA 4IEJA 2OQGA 2EQRA 1WI9A 1B1BA 4RLFA 4RAYA 1JHHA 2KKOA 3U1DA 5J3LA 2L9VA 3OOPA 4JP0A 3UKGA 2FBHA 4L9TA 3I5UA 4LGWA 1J2XA 4Q47A 5DCMA 4F92B 1VFCA 1KU9A 3AFHA 2A6HF 4C3HJ 2PI0A 2DFFA 2FQ4A 2CQXA 3OSFA 3UR3C 2QEXI 3EUAA 1P4WA 1FBSA 2P5KA 3SFZA 4M3FA 1WJEA 1D0ZA 3U9GA 3L2WA 1ORKA 1HLVA 1DU6A 4BGDA 5D5UB 2VKVA 1DDNA 3NWSA 3RQ4A 1EH7A 2XV4S 1PP7U 3JRCA 2OCCH 3FISA 4BQAA 2FOKA 3HRSA 3ZMDA 1H0MA 2RAEA 3H9JA 3JR9A 1J59A 1R5ID 3K1NA 4P55A 3HPHA 4CCMA 4HNVA 2XGXA 4U87A 3VDXA 4D7MA 2OD5A 2MFZA 3S2WA 3ZMZA 3EDPA 3A0HC 1QVTA 1F36A 4C30A 1BI0A 5LGNA 3SQNA 2R5ZB 2JJ7A 3PQKA 3HXLA 4NNJA 4EVIA 3L7WA 3NEUA 4JX6A 4N4OB 2DA4A 2M1BA 2VI6A 1U3EM 3OYBA 1XD7A 3AG1H 1YJNI 1J75A 1R5GA 3ZQ7A 5E1WA 1T8IA 3RKQA 2M0CA 2HPIA 1E3PA 2PJRA 4ZDPA 3O8HA 3KEYA 3LWFA 4HF2A 3J80K 3PO2J 2F4MB 2WAQA 4EATA 5E3NA 4PGHA 1X2NA 3OS2A 3HOUJ 3VSKA 1MBEA 1S7AA 2P6TA 5J8CA 1P7JA 1I39A 3BR6A 1QBJA 4YG2F 3ABLH 1QZZA 3FBNB 1ZR4A 3HBLA 3O8GA 4F7ZA 2F48A 4ZZDA 1BL0A 5B5EC 4ENJA 3M7GA 5ILVA 4A0XA 3J81K 4IZZA 3E3VA 4A6DA 3AKZA 4MGRA 1G2HA 3FXUA 2P8TA 4WWCA 4BDYA 1I6HJ 5J40A 4UXNA 1DU0A 1QZEA 3DQVC 3M9AA 3RPQA 3HOXJ 4Y4RA 3OSGA 4IRHA 5K7ZA 2FF4A 3CLQA 5FJ8J 1B72B 2BE5F 3CUOA 5CVRA 5E8GA 1NG7A 3FM3A 4M73A 4PK4A 1YHQI 5LHIA 2VONA 4D5FA 2Z9OA 2V79A 4UUTA 3I54A 2KL4A 4BXXJ 3QPSA 2XC7A 1JTXA 1JT6A 3A0BC 2LBFA 2KIFA 4I02A 1XMKA 1BW5A 2EFWA 4DYQA 5CYVA 4YFXF 4E7KA 2HVQA 1PVEA 2PMZN 1MNMC 1TW3A 3DU5A 4FQGA 5IP7J 3Q3SA 3NRVA 2NVYJ 1HW5A 3SEZA 1ETVA 1MNEA 1OFCX 4HQMA 3S2HJ 3D0SA 4P1WA 2XF7A 2EBIA 3PFIA 3IUOA 3GWZA 2CW0F 5FLXK 2DQRA 4BY1J 4IL6C 4PZJA 5H20A 2HDWA 4CCLA 3S3OA 2XAJA 4BE1A 1OMIA 2EWNA 2EV5A 2A6TA 4YEJA 4A5MA 3V7RA 1BR2A 4M9SA 3F3XA 1RC9A 4UVCA 2XRNA 1WSUA 5J1UA 3V7SA 2BV6A 1DP7P 4S04A 1RKWA 4RS8A 1IW7F 3OIOA 1WRJA 1GXQA 4IQJA 2IGOA 1MBJA 2KLOA 3QOEA 3WTYC 3OIQA 1BIBA 3VYUB 1VQ9I 2LD5A 1D3YA 4BQOA 4Q4ZF 4UUVA 3ZQFA 1GXPA 1UJ8A 1XGMA 4HX7A 1IDZA 3F22A 5CQGA 3G73A 2Z3YA 3BQZA 1HC8A 3GTGJ 3RZOJ 2PJRB 3E6CC 2CW7A 4M72A 1HW1A 1JJ6C 5FGMA 2L01A 5HLHA 4XRSG 1JKOC 4M74A 3VSLA 3WTZA 4IXAA 3C18A 1KQ9A 4O5VA 4AWXB 3RKWA 4XOTA 3VWBA 2XSJC 4BHBA 2FBIA 3E97A 1RR8C 2GOMA 5HLTA 1HDPA 1TT0A 4PGGA 1RNLA 1SFXA 2GOXB 2DMNA 2F5FA 1F43A 4HLXA 2JSCA 2ECCA 2HEOA 2DFHA 1TWAJ 3PO3J 2UWMA 1ETXA 2IPQX 2HNHA 4AIHA 4GYGA 4QLCU 4XRSA 3BT9A 4D0PA 1X19A 4F55A 2ISYA 5E17F 4D7NA 1S5LC 2DAOA 2L9RA 2GBYA 2L5QA 2MH2A 3MCZA 1IUYA 1FSHA 4CZZA 3RCOA 2HTJA 3L9FA 1U6GA 5L3BA 3QPLA 2VBWA 2GA1A 1LFUP 4UB8C 2ETHA 2NVUB 3HSRA 2R7DA 3KP4A 2CQKA 3GTPJ 1EKEA 4AVZA 2R7WA 2AXTC 2DU9A 4IHWA 2QVOA 5FKLA 3GTOJ 1R49A 4NQWB 1IG7A 3G4SI 2ZMEA 1K6OA 2P7VB 5IOYA 1ZN2A 1F4KA 4PFOA 3HSFA 5HODA 3HOZJ 2VXDA 1XDSA 1N77A 3IP4B 2IS2A 4XKVA 3WE2A 4OIQF 1WHUA 4L9JA 2QSHX 1O3TA 4O6JA 3O2PE 3WTTC 3E0JB 5EZGA 3SEQA 4Y7NJ 4MIMA 1J0RA 1MH3A 3CCSI 3LL7A 1YI2I 5FO5A 2R7UA 5JVGF 1VQNI 4V2FA 2DLLA 3ZR8X 1ONVA 4RAFA
chains in the Genus database with same CATH topology
1V55H 3WG7H 3ASOH 1V54H 5B1BH 3ASNH 1OCCH 3ABKH 1OCOH 2EIMH 2EIKH 3AG2H 2EINH 3AG4H 3AG3H 3ABLH 2DYRH 3ABMH 1OCZH 3AG1H 5IY5H 2ZXWH 1OCRH 2EILH 5B1AH 2EIJH 2DYSH 2OCCH 5B3SH 3X2QH 2Y69H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V55 H;  3WG7 H;  3ASO H;  1V54 H;  5B1B H;  3ASN H;  1OCC H;  3ABK H;  1OCO H;  2EIM H;  2EIK H;  3AG2 H;  2EIN H;  3AG4 H;  3AG3 H;  3ABL H;  2DYR H;  3ABM H;  1OCZ H;  3AG1 H;  5IY5 H;  2ZXW H;  1OCR H;  2EIL H;  5B1A H;  2EIJ H;  2DYS H;  2OCC H;  5B3S H;  3X2Q H;  2Y69 H; 
#chains in the Genus database with same CATH topology
 4KT6 A;  1G6N A;  5C4X J;  2H27 A;  1Z9C A;  4XKB A;  4RDU A;  2EIM H;  2O8K A;  4E7H A;  2CFX A;  2QYO A;  2XPV A;  4A3C J;  3OV8 A;  5FFZ A;  2MD5 A;  2OUM A;  2D1H A;  3ZRG A;  2F5E A;  4LJZ F;  1SEU A;  2WY7 Q;  4OAZ A;  2GIZ A;  2X1E A;  3GFM A;  4HF0 A;  2ZKZ A;  3BJO A;  4OIR F;  1G59 A;  2K4B A;  1RRJ A;  3GTK J;  2MA3 A;  2A3S A;  3E5U A;  5E1X A;  1AKH B;  5ICG A;  4B48 A;  2DN0 A;  2VAS A;  3WE3 A;  3K7A J;  3SDB A;  5GTH C;  1TW2 A;  1FBU A;  3J7Z I;  4ESB A;  2ELK A;  2I8D A;  4N0B A;  5HS9 A;  1ETY A;  1FYM A;  1IDY A;  1K61 A;  2DA3 A;  4CCK A;  2EZI A;  2EJR A;  1EF4 A;  3KE2 A;  3PIO F;  5LLQ A;  1RZ4 A;  3BY6 A;  2V1D A;  2LNB A;  1STZ A;  2OV7 A;  2CO5 A;  4A12 A;  3K6G A;  3I4P A;  1H8A C;  1WZ2 A;  4WF2 A;  4F3Q A;  1ODD A;  4MHG A;  2E2J J;  1ZHF A;  1FY7 A;  2Y0S N;  1I6X A;  1UHS A;  5FFX A;  5DUK A;  5GTI C;  1UFM A;  3JRF A;  4ZZL A;  1R4N B;  4R79 A;  3I4M J;  3DKY A;  4M3G A;  1A04 A;  4PJL A;  3S1R J;  1JKR C;  2VBX A;  3QQA A;  5C44 J;  3OYM A;  4CCO A;  3P9I A;  3EUH A;  5BPD A;  2L7M P;  4ZYA A;  4G94 A;  5M3M J;  2UZK A;  2QSF X;  3BZC A;  3I64 A;  1U5T C;  2LKS A;  2VQH A;  1Y1V J;  1DPU A;  2BW3 B;  2IW5 A;  3AG4 H;  3AG3 H;  2XAF A;  2F4O B;  4I7H A;  3K0L A;  5J8F A;  2OQR A;  1IGN A;  2VN2 A;  3L1P A;  1PP8 F;  4MO7 A;  3BPX A;  3I59 A;  1ZK8 A;  3PJR A;  3L09 A;  5B3S H;  3HOY J;  2NNN A;  2KIQ A;  4HV6 A;  1Q1H A;  2LY9 A;  1MW7 A;  4MLO A;  4G7O F;  2CFO A;  1SFK A;  2FU4 A;  2EFQ A;  4DBR A;  4HEA 2;  2R5Y B;  2RV8 A;  4KMU X;  4FX0 A;  3F23 A;  2D45 A;  5GPA A;  4AU7 A;  4QWQ A;  4A0Z A;  4WK8 F;  2EH3 A;  4HX8 A;  2HYG D;  1D1B A;  1SVO A;  4XM3 A;  2G0E A;  2JVG A;  3BJA A;  5J4V A;  4IRI A;  3ELK A;  1ACI A;  3M8E A;  3HYI A;  5EDN A;  3PFY A;  5C3E J;  5FKO A;  1QGP A;  2BZT A;  3JRE A;  3CC4 I;  2W48 A;  1QPM A;  1KON A;  1USS A;  2K4J A;  1I3Q J;  3PSI A;  2DFE A;  2LH9 A;  2HOT A;  3LST A;  2XAH A;  1WVR A;  1NH3 A;  1S7O A;  2MLK A;  4GCV A;  1K6Y A;  1BOA A;  3TL4 X;  2BGC A;  1IXC A;  1T56 A;  3ZQL A;  4NQW A;  1FZP B;  1KQ8 A;  2M45 A;  4J00 A;  3Q9V A;  3CCE I;  3ZQC A;  1QA6 A;  5K1Y A;  3BPV A;  2CH0 A;  4PFP A;  1P92 A;  2VLA A;  2V9K A;  1ZRC A;  5A2Q Z;  1X3Z B;  1XN7 A;  2KDO A;  1V54 H;  1A5J A;  2DA1 A;  5L3G A;  4FCY A;  4LMY A;  2E1M C;  2OZ6 A;  2VT3 A;  4BYY A;  1VQM I;  2DOE A;  3H5A A;  1K79 A;  1KU7 A;  1TNT A;  1FIP A;  2P6S A;  3RYR A;  3ABM H;  2DOD A;  1JUP A;  4I76 A;  2E7W A;  3GZ6 A;  4LLG F;  4IO9 F;  4W97 A;  4GGG A;  1B6A A;  3AAF A;  1QHG A;  5BPI A;  2CMP A;  1SD5 A;  1JJ8 C;  3KZI C;  3COA C;  5DDG A;  5IT9 K;  4MQV A;  5K5Q A;  5D8K B;  3CCV I;  2Y69 H;  1O7L A;  5E3M A;  1A35 A;  2HFH A;  3JTH A;  4B44 A;  1SFE A;  3CJT B;  4M3E A;  3H0D A;  2QBY B;  3ABK H;  4JQF A;  2KMU A;  3ERM A;  4E7I A;  1J5Y A;  2IT0 A;  5DCF A;  2YPR A;  3I9V 2;  4XKC A;  3ZMU A;  1QU3 A;  2ESN A;  3WU2 C;  4BJ6 C;  2CWE A;  2P4W A;  1TQM A;  4KJZ A;  3E6B A;  1S29 A;  3HSE A;  1FPQ A;  2DOA A;  2OJE D;  4RLQ A;  4HV5 A;  4UY8 I;  1WGX A;  2GLO A;  4BHC A;  4KYW A;  2EFO A;  2DA5 A;  3HKZ A;  4CDG A;  5F6F A;  2YS9 A;  5C4J J;  1RPW A;  2LRD A;  2ZXI A;  4B3X A;  3PUF A;  3V7C A;  1P6R A;  3PQJ A;  1Z7L A;  4UVA A;  3CUQ A;  4NB5 A;  3J7A O;  4BL0 B;  1T95 A;  1DQU A;  1LVK A;  1UB9 A;  2ZME B;  1FC3 A;  4RGR A;  5FKN A;  4IOA F;  2HQ5 A;  2PBI A;  3HTS B;  2UV1 A;  3FXM A;  1ZG5 A;  3FXL A;  3S3N A;  4OU0 A;  5AIP A;  3GO5 A;  2L4M A;  3FMS A;  3E1S A;  3W6V A;  5D5W B;  1YS7 A;  5ICE A;  2XIG A;  5J4Y A;  4B09 A;  4ITV A;  4UV8 A;  4XK4 A;  4XLH A;  3ROU A;  4BBR J;  1XMX A;  3F72 A;  1ZQ3 P;  3HRU A;  1VI0 A;  2K02 A;  1U5T B;  2WB1 N;  2NOG A;  1DGW Y;  4M9X A;  4B8X A;  3D5L A;  4HNU A;  5L3C A;  2L02 A;  2RQQ A;  2PFB A;  4KIT B;  2F5D A;  2RDP A;  3DP7 A;  2MYS A;  4LFU A;  3KET A;  4ZJZ A;  4M6Y A;  2JA6 J;  1S72 I;  2GM4 A;  5JVT A;  3JCU C;  5GPC A;  3CC2 I;  1ETO A;  4V19 K;  4DZP A;  2E1M B;  4J01 A;  2LVS A;  1Y0U A;  2H6C A;  2J5P A;  1BA5 A;  2CRG A;  2K5C A;  4N9I A;  3OYL A;  2YX7 A;  3I0T A;  2M8E A;  1ZLJ A;  1Y8Q B;  2K85 A;  3Q0U A;  4HX4 A;  2VIX A;  3KP6 A;  1OLT A;  4PSW A;  2HDC A;  5JLX A;  2R5Y A;  4I2O A;  1WWX A;  3EET A;  4HYE A;  1MMS A;  1HCR A;  5FKM A;  3QWL A;  3M1C A;  1Z3Y A;  3ZMT A;  3SZG A;  2R7V A;  2UUZ A;  3RZD J;  2H8W A;  4MQ9 F;  2W00 A;  4IVN A;  2DCE A;  3WU1 B;  5E18 F;  4H4K C;  3I56 I;  4DNC A;  3PNT A;  2XGE A;  3IAS 2;  2LF8 A;  5E1Z B;  2ZNZ A;  3RI4 A;  3HEF A;  4OMZ A;  1ETW A;  5L3E A;  2WY8 Q;  5HLI A;  2KHM A;  3BR1 A;  2V1N A;  1T6S A;  2GZW A;  5HDK A;  2F2E A;  3MN2 A;  1XS9 A;  4KIG A;  5BNG A;  1VQO I;  1OCR H;  5DD4 A;  4E7S A;  3DKX A;  3KFW X;  2XHK A;  4S0H B;  2EZL A;  2RVC A;  1UZC A;  1GDT A;  1F1Z A;  3KZZ A;  5ICF A;  1U9O A;  3HB9 A;  1T2K A;  4HPQ A;  4A5N A;  3CDL A;  1MIJ A;  1MMD A;  3DKW A;  1U2W A;  5KK1 A;  1CF7 B;  1KYZ A;  1LKX A;  4AUX A;  3KYD B;  1HOM A;  3TDU C;  5IYB J;  2Y9Y A;  3WHB A;  1EH6 A;  4JBA A;  1JGG A;  3F8C A;  3MZH A;  1YX3 A;  2EIL H;  3W2V A;  2DK5 A;  4IJA A;  1ZRE A;  2NVX J;  2OPT A;  4A3F J;  1ZG1 A;  1SD7 A;  2JVH A;  4L5J A;  1WJC A;  1UEL B;  2EK5 A;  1ON2 A;  5DUI A;  1YJW I;  2ELH A;  1UG2 A;  4FHT A;  4EM0 B;  4W1U A;  5KNL A;  1Y6I A;  2L9S A;  4LLL A;  5J47 A;  2E36 A;  4MNU A;  2JA5 J;  1AA7 A;  2G7H A;  3OL3 A;  2VQL A;  4CCJ A;  1VQK I;  9ANT A;  2IAI A;  3BR2 A;  2CUF A;  3Q0V A;  2HU9 A;  1I27 A;  1XGS A;  2RRE A;  2FUG 2;  2GAU A;  2R7R A;  3Q0W A;  1LB2 A;  1LUJ B;  2FNA A;  3CCJ I;  2O3F A;  1J09 A;  3W2W A;  4ENM A;  3EYY A;  1ZTR A;  2OTL I;  1OCT C;  1UHW A;  2RGV A;  3WTS C;  1PYV A;  3VEP A;  2I10 A;  2FA5 A;  2K9Q A;  4UB6 C;  3W6K B;  2PJP A;  3DLA A;  3CDI A;  2QGU A;  1FBQ A;  2WWY A;  2KIS A;  2CQ7 A;  3TO9 A;  4U0W A;  4B1R A;  2DTZ A;  4RM3 A;  2IS4 A;  3HOV J;  3EPZ A;  3IRQ A;  1EA3 A;  3FXO A;  2V6C A;  2W1O A;  4PJM A;  3BRO A;  2Z5U A;  1JKQ C;  5F1R A;  4X6A J;  1XGN A;  3TO7 A;  4LK0 F;  3OYG A;  4I0B A;  4FE7 A;  5D4R A;  4RAG A;  1V5F A;  3CCR I;  5ILU A;  4G7H F;  1VF9 A;  5DEQ A;  4A93 J;  3GF2 A;  2IP2 A;  4E7J A;  5FLX Z;  1MSF C;  4XLA A;  2EB7 A;  2XAU A;  3QPT A;  1KZH A;  1WJB A;  2EIJ H;  4FIS A;  2E34 A;  3T5X A;  2WB1 A;  2WC2 A;  1A31 A;  5GAG J;  5E3L A;  2VE8 A;  2GXB A;  5DM6 F;  5L3F A;  2NAZ A;  2V1X A;  1ULY A;  2M30 A;  3G6E I;  3BOQ A;  1Z3X A;  3OYA A;  1S3J A;  4II2 A;  3RPU A;  5DM7 F;  1MMG A;  2JT1 A;  3DBR B;  5D8L B;  1W36 D;  3L2Q A;  1ZGA A;  3JAM K;  6PAX A;  1NTC A;  1X1B A;  5F1J A;  5M5Y J;  3CO6 C;  2Z33 A;  1P7I A;  2Y2Z A;  1JUS A;  3U2R A;  3ONQ A;  3GME A;  4HRI A;  1NK2 P;  2VPL A;  2OU2 A;  2IBD A;  3LSR A;  2QWW A;  3B73 A;  3K4K A;  3QAH A;  1TP4 A;  1U8B A;  4C2M J;  4EGZ A;  4IKF A;  2CUJ A;  3D5R C;  3GFI A;  3JRI A;  5CVV A;  1Y39 A;  5FRN A;  3FM5 A;  2KIU A;  1YRN A;  3OY9 A;  4MTE A;  1E2X A;  2O03 A;  1TNS A;  1Z6R A;  3CO7 C;  1OCO H;  1S9H A;  5HDN A;  1T98 A;  4G8X A;  1JT0 A;  3C2B A;  2HWV A;  5JR3 A;  4RGS A;  2M4G A;  1OQY A;  3OR1 C;  4NHJ A;  1R00 A;  3B02 A;  3LMM A;  5GAE J;  1FT9 A;  3FK6 A;  1VND A;  2DJI A;  5AON A;  1DP3 A;  5CQE A;  2XVC A;  3JRB A;  2NS7 A;  3QU6 A;  1WJD A;  2CJJ A;  3X2Q H;  2DT7 B;  1FOK A;  2ME6 A;  1IXR C;  4DW6 A;  2B9S A;  4ENK A;  3S93 A;  5FLV A;  5EEG A;  2F6C A;  4BAC A;  1E3H A;  2KIM A;  3CJR B;  2F5V A;  2F5C A;  2D1V A;  4OWR B;  4XRF A;  2LY2 A;  1TZL A;  3CQZ J;  2W24 A;  1JGS A;  3NAU A;  2R5Z A;  2ZXH A;  3QP6 A;  1IC8 A;  1WKM A;  4LK1 F;  1EJ9 A;  3HRT A;  1FWZ A;  5F0C A;  5CVI A;  3HHH A;  4UV9 A;  4BKX A;  1UCR A;  2VB6 A;  4U7D A;  1HW2 A;  3DEE A;  2CS3 A;  3DPL C;  5DTD A;  1O7F A;  4XLF A;  4A6E A;  1BI2 A;  1F9N A;  3LSK A;  5DD8 A;  2NNY A;  2QQA A;  5EEH A;  3V42 A;  3MVP A;  3FXR A;  5GAH J;  3WTX C;  3CME I;  1MND A;  4KNY A;  3HZJ A;  1R36 A;  2XPU A;  2ZO4 A;  1IV6 A;  1H9T A;  2ZSI B;  2H8R A;  2D2W A;  1K78 A;  2OA4 A;  4OIN F;  1W36 C;  3PIP F;  1JI8 A;  2M3A A;  2CUZ A;  5KVR A;  1R71 A;  3M4O J;  3ULQ B;  1T0F A;  1KU2 A;  3WTW C;  1W0T A;  3WG9 A;  4LG0 A;  1XCB A;  2HGC A;  1YIT I;  2KJC A;  1XSD A;  4LIV A;  4D5C A;  4A69 C;  4ESF A;  2JWT A;  2IA1 A;  3KP5 A;  2LRE A;  1UHM A;  5KHD A;  1R1T A;  1YOV B;  2DMQ A;  3H5R A;  4S05 A;  1N25 A;  4ZH4 F;  3LA7 A;  1SVL A;  2LF7 A;  4UNO A;  1LEB A;  2DA2 A;  3GZN B;  1O4X A;  4BDZ A;  4MTD A;  3LSH A;  5CVU A;  2W57 A;  3MKY B;  3CF5 F;  1V5E A;  5LGU A;  1J7K A;  3FBI B;  2NVT J;  1X58 A;  2MGQ A;  3V8K A;  2E1C A;  4K2E A;  1WI3 A;  5FLM J;  3CJN A;  3BTC A;  2XGD A;  2JA8 J;  1G3S A;  1ZAR A;  2JA7 J;  2WAQ N;  3A03 A;  3RDI A;  4CYC B;  4FE4 A;  3SFI A;  1ETK A;  2KRH A;  1MJA A;  1L3L A;  3KP3 A;  2NRA C;  3I59 B;  5HDG A;  2JPB A;  1RES A;  2DYR H;  4XKW A;  5E3O A;  3LSJ A;  5DYM A;  3OYE A;  3L2R A;  2KPM A;  2UXX A;  2XB5 A;  3A1Y A;  4PUS A;  2BW3 A;  4BEH B;  2QBY A;  4XOR A;  2W84 A;  3WTV C;  2QEN A;  2Y0M A;  1E17 A;  4CZC A;  3QP5 A;  1YS6 A;  2HYF A;  1Y1W J;  4L18 B;  2M87 A;  1X1C A;  2LMD A;  5JLW A;  4IHY A;  2CW8 A;  4M3B A;  4ZYD A;  1FNN A;  1YLF A;  1XDU A;  1XTA A;  3FIW A;  4BU2 A;  2R7F A;  1C0W A;  2OC6 A;  1X1D A;  3PUB A;  3TOA A;  1VTN C;  2FEZ A;  4Z6Y A;  4QSH A;  2ID3 A;  1I5Z A;  2XF6 A;  3JRA A;  4I09 A;  2BOL A;  1UMQ A;  3A2K A;  2GXA A;  4I6Z A;  5ERI A;  1FSE A;  3E5X A;  1O3R A;  1W5T A;  1XB4 A;  1K78 B;  3JRH A;  2ID6 A;  1R4M B;  4HZF A;  4YIR X;  2P5V A;  3TKY A;  1Z05 A;  3DXJ F;  3HOT A;  2M8G X;  5E79 C;  4D1Q A;  3S8P A;  3KYC B;  5J6X A;  3KP2 A;  1AHD P;  5EGO A;  5IY5 H;  2ZXW H;  1S6L A;  4A0Y A;  2H6B A;  3LOC A;  5TIS C;  1YJ9 I;  4WXD A;  1FP2 A;  2MG4 A;  3OYK A;  4I98 B;  1B8I B;  2ADU A;  1WJ5 A;  2AS5 F;  4N9H A;  4QPO A;  1H9G A;  2E2I J;  2VKH A;  3CCY A;  1I50 J;  1PDN C;  1XCV A;  4IHV A;  3BTJ A;  2Y31 A;  2RKH A;  4A3L J;  2LDU A;  1BW6 A;  3QYF A;  2K9S A;  5KCM A;  5HNF A;  5K7F A;  2EPF A;  3T1B A;  3J7A Y;  3DEW A;  1Z91 A;  2IA2 A;  3K4N A;  1WQ2 A;  2DBB A;  2PG4 A;  3AL0 B;  2QQ9 A;  3EYI A;  2BY1 A;  1Y8R B;  1JHF A;  5BS6 A;  5F0H A;  4BE2 A;  1IZ1 A;  4RM2 A;  2AHQ A;  3CLO A;  4X1E A;  1HA8 A;  2HS5 A;  2ZJ2 A;  4NC6 A;  1OR7 A;  4JOM A;  3W6J B;  3A02 A;  4AM3 A;  1QQI A;  3K70 C;  2JN6 A;  4HAM A;  2DQL A;  3SXY A;  2MC4 A;  2L7K A;  1E3O C;  2M7B A;  3P9C A;  2MH9 A;  2ELJ A;  2KQR A;  5LRR A;  4CYC A;  1F5T A;  2B7E A;  3RJP A;  5K5R A;  4IHS A;  2R7T A;  2R7X A;  4LIU A;  3HOS A;  2H1L A;  4ZTJ A;  2HOS A;  3EQL F;  4FX4 A;  2IRF G;  2DJN A;  1T0F C;  2DI3 A;  2PLY A;  1NK3 P;  2YR2 A;  3B6C A;  4ENN A;  1FMV A;  1LDJ A;  3ASN H;  4OAY A;  2VC0 A;  1X3W B;  4BS9 A;  4AIK A;  1Q1V A;  4Q48 A;  4R1H A;  5HLG A;  4P9F A;  2HQA A;  1O3S A;  3E6D A;  4UUS A;  1YIO A;  2STW A;  2ZC2 A;  3N97 A;  2ZBK A;  1FEX A;  2CG4 A;  4G6D A;  3FZV A;  5BOX A;  3ZMS A;  2A68 F;  4XBF A;  5EG0 B;  3OR2 C;  2PN6 A;  3GFL A;  2B0L A;  1N78 A;  4XSZ F;  3TOB A;  4CSW A;  3K10 A;  4F93 B;  2H94 A;  1Z0X A;  3QRF F;  4PJN A;  4XN0 A;  3VYT B;  3MZ8 A;  3HKZ N;  2XB0 X;  4IPA A;  4AID A;  3S3M A;  1DUX C;  1I1S A;  3P5J A;  4EM1 A;  2CQQ A;  2L7F P;  4G12 A;  2CYY A;  2HOA A;  2E1O A;  5FD5 A;  2Z16 A;  1V5G A;  2HVR A;  2HI3 A;  1TWF J;  5CJ9 A;  2A07 F;  5E20 A;  1BOB A;  3OYH A;  2NS8 A;  3L00 A;  3V8J A;  4J19 A;  4LB5 A;  2MBF A;  4DYC A;  3MKZ A;  3H9Q A;  1LDK B;  3LSM A;  3PM1 A;  3QYE A;  3JRD A;  3JSO A;  3GTJ J;  1GHC A;  2A6E F;  4BY7 J;  2KJB A;  1LE8 B;  3M8J A;  1KQ0 A;  1OYW A;  3RSN A;  2K3F A;  3FXJ A;  1W7P A;  5J1Y A;  3WG7 H;  1OYY A;  2FX0 A;  1BR1 A;  2ZXJ A;  4F52 A;  1R9T J;  1FJL A;  2EFP A;  2VQC A;  1L0O C;  1LE8 A;  1BJA A;  1MDM A;  2FMY A;  3OMY A;  5E8I A;  4QIW N;  4IHX A;  4YFK F;  4WXH A;  2JTV A;  1CGP A;  1I3A A;  2X6O A;  3R4K A;  3ZQQ A;  1OR7 C;  1RUO A;  1BBY A;  2W25 A;  1OCP A;  4XLN F;  3L2U A;  1CQT A;  2X6W A;  4IQ4 A;  2P7C B;  4YII A;  3KYL A;  2Q0O A;  1MD0 A;  2WV1 A;  2L4A A;  2HPM A;  3C2G A;  2R7S A;  4XLE A;  3TED A;  2IGK A;  2KZG A;  2HR3 A;  1WPK A;  2MD0 A;  2V9V A;  4NUB A;  5AIQ A;  1HQC A;  4CIC A;  3F6O A;  2M0M A;  3CF2 A;  1ZKG A;  1V4R A;  2X48 A;  1V3F A;  2HXO A;  3LA3 A;  5DS9 A;  5LEK A;  2QCO A;  3M07 A;  2PX9 A;  5LRS A;  3DWL E;  2BVM A;  3K4L A;  2LKP A;  4NC7 A;  3AG2 H;  3LFK A;  1JKP C;  2VOP A;  2CSO A;  4HDU A;  2CV0 A;  1OCZ H;  3QYB A;  3TP0 A;  4UUS B;  4GRI A;  3HL2 A;  4A3M J;  3L2V A;  2O6G E;  3ZPL A;  2EV0 A;  5IT9 Z;  3OYD A;  1FYL A;  5B66 C;  3DTI A;  4GYI A;  1QPI A;  1X1P A;  1FTZ A;  5FD6 A;  2FOW A;  3NQO A;  5D6E A;  2XRO A;  2RN7 A;  4JX4 A;  1REP C;  2TCT A;  1PJR A;  5EEA A;  1FLI A;  1XG1 A;  3A01 B;  3ZP5 A;  2QSG X;  2LLK A;  4XSX F;  1HKS A;  1LJ9 A;  2CU7 A;  2PQ8 A;  5D4S A;  1OIS A;  5EYR A;  3DBL B;  3KX2 A;  4EGY A;  3P9K A;  1JUM A;  1LVA A;  2KFD A;  5KAI C;  5JHU A;  3RPU D;  1X2M A;  2K9N A;  2OAZ A;  1WFX A;  3R0A A;  1ZGJ A;  3ERE D;  2BHZ A;  3J7Y J;  2OZU A;  5DV5 A;  1TWC J;  2K27 A;  4CA0 A;  3CP8 A;  2O0Y A;  4KDP A;  3MKW B;  3Q5F A;  3FXK A;  4EQQ A;  4XRM A;  2X1C A;  2VJ4 A;  2LP0 A;  2VXZ A;  3IH3 A;  3REO A;  1YRN B;  3CMA I;  3H1C A;  2E2H J;  2R93 J;  1VQ4 I;  5M5W J;  2FBK A;  1MMN A;  4M6X A;  2GA2 A;  3UNG C;  1BI3 A;  2EZH A;  3ZCO A;  1A6I A;  3GVA A;  3IKV A;  2QKL B;  2VJI A;  3LAJ A;  5TJJ A;  4HQE A;  1KU3 A;  2JMW A;  4XOP A;  4BXU A;  1V55 H;  4G7Z F;  2GXG A;  2ICW G;  2RNG A;  3OL4 A;  1M1E B;  4M3D A;  4ZYH A;  2X0L A;  3O3K A;  4LD5 A;  3BCA A;  5A2Q K;  3WU0 A;  4XR6 A;  5IT3 A;  1UST A;  3TW6 A;  1TQP A;  2LBF B;  3IRR A;  1KA8 A;  5EG0 A;  1K83 J;  2MLG A;  1Z6T A;  3FKJ A;  2LR8 A;  1Y56 A;  2LSO A;  4ZTF A;  2X1D A;  1K4S A;  5LGT A;  2R4G A;  4ABZ A;  1IO2 A;  1IN8 A;  3WTU C;  1W0U A;  5ICC A;  3R0J A;  3I71 A;  1RET A;  2ZCW A;  3GFJ A;  2X85 A;  1IN4 A;  1W7P B;  1HST A;  2MC3 A;  2XSD C;  3K4C A;  4RB3 C;  1ZAO A;  2BHY A;  2FRH A;  2ZFU A;  3RYP A;  4EEF G;  1RUN A;  2IS6 A;  1BJZ A;  1IN7 A;  3K2Z A;  3MKL A;  1YYV A;  4ZC3 A;  2P0W A;  5TGT A;  1BIA A;  1K4T A;  2IVM A;  2KZV A;  5F27 A;  4B43 A;  2FNP A;  2ME0 A;  2KT0 A;  3OIP A;  5F64 A;  2DA6 A;  3KLO A;  2Z2S B;  3LQQ A;  3LSG A;  4EMS A;  3SDG A;  1U78 A;  4B3A A;  3H9G A;  4XL9 A;  1QZY A;  4EJU A;  3KLN A;  4LLN A;  1SD6 A;  1FX7 A;  4AD9 A;  2DDB A;  3EUK L;  2WTE A;  2W85 A;  1YX5 A;  2C6Y A;  4BJT A;  1MGT A;  4AYB N;  4KMF A;  1IRG A;  2BBY A;  3KZY A;  4RB0 A;  2A61 A;  2QKM B;  4E6K G;  1SVM A;  4IF4 A;  4U7B A;  2WAD A;  3CP2 A;  3FDY A;  1J9I A;  3MZY A;  2QZ8 A;  3FF5 A;  1TL8 A;  3F8B A;  1W4M A;  2JA2 A;  3U1K A;  4V2G A;  2CQN A;  3KEQ A;  2M4K A;  3ZN1 A;  4L9V A;  1BN5 A;  4XN3 A;  1IRF A;  4CHU A;  3H3V K;  1AU7 A;  4PJ0 C;  3HOW J;  2D5V A;  4LIT A;  1EV7 A;  1W7P D;  4YFN F;  2YX4 A;  1SMY F;  2Y48 A;  2AO9 A;  4ZYE A;  5EGO B;  4M9Z A;  1MBG A;  3U21 A;  1RIO H;  1TWH J;  2JSP A;  3GW2 A;  3GCM A;  1FMW A;  4X0G A;  3F9K A;  5F0F A;  3H36 A;  2NVQ J;  1YQA A;  1ZGW A;  4XLC A;  4CH7 A;  3M1E A;  4XQF A;  3OYJ A;  5HVQ C;  2EFN A;  3S17 J;  3OS1 A;  3F6V A;  1GVJ A;  3P7N A;  2PMH A;  2ECB A;  3VPR A;  2DMP A;  2EV6 A;  4HA8 A;  4UVB A;  1D1C A;  4RB2 C;  3TW7 A;  3GTQ J;  1GVD A;  2JK3 A;  4WXC A;  3TO6 A;  3CES A;  2BXY A;  2LKX A;  3N4M A;  1B8I A;  5EZH A;  4CYD A;  3K70 D;  4XON A;  4C2U A;  4DYR A;  2IXS A;  2LY1 A;  2MSY A;  2L9N A;  5D5V B;  1XSV A;  3HJE A;  3QOP A;  3W3C A;  2B63 J;  1B59 A;  3V4G A;  1KGS A;  3L2C A;  3CJQ B;  1ON1 A;  3MQ0 A;  3BTI A;  3WGI A;  4BAY A;  4KT5 C;  4A2U A;  4NBQ A;  2WV0 A;  4PDK A;  3HIF A;  2DT5 A;  4HNT A;  4BE0 A;  1YIJ I;  1NHA A;  4A3I J;  3WGH A;  4CCN A;  4AIJ A;  1UAA A;  4OIO F;  1FYK A;  3CUQ C;  1T38 A;  2IJL A;  3HPG A;  3S1M J;  1WJA A;  2M7A A;  3C7J A;  2TRT A;  3CZ6 A;  2HDD A;  2K3P A;  3IC7 A;  5CKT A;  4OMY A;  3H3U A;  2XAQ A;  2HQN A;  4BQQ A;  3ML6 A;  4PJJ A;  3S1N J;  1FTT A;  2NYX A;  1MH4 A;  2DYS H;  2WBM A;  1XX5 A;  4RGX A;  2ZJP F;  4C2T A;  2XAS A;  4C9Y A;  4A3K J;  2HTS A;  2UXN A;  1ZRD A;  5B1B H;  4A3G J;  3T0Y A;  4H0E A;  1LDD A;  3A4C A;  2H1K A;  3F8M A;  1JXS A;  1A6Q A;  2K86 A;  3DF8 A;  2ZNY A;  2VBZ A;  3F8F A;  1P4X A;  4DIQ A;  1E0E A;  3BCB A;  1D8K A;  2L7Z A;  1JTY A;  4XLP F;  2GWR A;  2LC2 A;  3PL8 A;  3TDZ C;  4KA4 A;  5D5X B;  2EZK A;  4LOC A;  2XDV A;  2OCE A;  2E19 A;  2E5N A;  4HG2 A;  4WCG A;  4OOI A;  2PMZ A;  1TLH B;  3MMY B;  2WAF A;  2V7F A;  1TT5 B;  3K1M A;  1Z77 A;  1JE8 A;  4N4N B;  3CCU I;  3CMM A;  3QPH A;  1CF7 A;  4M6V A;  4IOC F;  2HKO A;  3K4M A;  4I0A A;  1LEA A;  3I53 A;  4ASN A;  5HS7 A;  2VOO A;  1P4A A;  3LSI A;  4L5I A;  4RGU A;  2O5R A;  1QO0 D;  3I3L A;  3DPU A;  2WAE A;  3OYF A;  2XF5 A;  1YW9 A;  4FTH A;  1HF0 A;  1SAX A;  2DT6 A;  4HBL A;  4IHT A;  2QQ8 A;  2Y9Z A;  5M3F J;  5LD2 C;  5TRD A;  4U88 A;  1R22 A;  2O9L A;  2LOO A;  5CVJ A;  3J80 Z;  3T8R A;  1IN5 A;  1PUF A;  3PSF A;  5GAD J;  1VQP I;  3K1P A;  1SFU A;  3FX3 A;  1LPQ A;  1QVU A;  3R6S A;  1WH7 A;  2DFI A;  1BC7 C;  3FWE A;  2JPC A;  4PCQ A;  3QOD A;  3IKT A;  2HZD A;  4HSR A;  3TQN A;  3E5Q A;  1QNT A;  1YTY A;  1AKH A;  3TGN A;  2BY2 A;  2HKX A;  1EH8 A;  3E6M A;  2O8X A;  3BG6 A;  1X3U A;  4KIB A;  1D8J A;  1TC3 C;  2DPD A;  2BXZ A;  3BTL A;  4FT8 A;  4MFE A;  5ILS A;  4EJV A;  1KYW A;  1RI7 A;  2R92 J;  2XPW A;  2VKE A;  1MJ9 A;  3OYI A;  3AL0 C;  2LFB A;  2H09 A;  4ZYG A;  4L5E A;  1POG A;  3JW4 A;  2EIN H;  1U8R A;  2K9L A;  3GUD A;  4UHT A;  4Y13 A;  3VFZ A;  1D0X A;  2VUM J;  2X6X A;  3BG5 A;  1TQI A;  1RKT A;  2VBY A;  1HKQ A;  4I99 C;  4Q5S F;  4RAZ A;  1SAN A;  4C3J J;  2W4S A;  3H35 A;  3LQR A;  3ESW B;  1G3W A;  2E35 A;  3ISP A;  4JK1 X;  2VE9 A;  4LG3 A;  2K9M A;  4MEX F;  3BJ6 A;  2YU3 A;  3VOD A;  2ZB9 A;  3WHC A;  1D1A A;  2OTJ I;  3SHF A;  3DEU A;  3FHN A;  3RIR A;  1YG2 A;  4DJA A;  3EUH C;  2DTR A;  2FQ3 A;  5BMZ A;  2VC1 A;  2LK2 A;  2P81 A;  3PNV A;  4YEL A;  1VZ0 A;  1Y0N A;  2IGN A;  4YIF A;  2V6E A;  3GTL J;  3RKX A;  4E70 A;  3RKY A;  3CDH A;  4XMY A;  2RC4 A;  3ZQH A;  1IAW A;  2JZY A;  3S14 J;  2Y75 A;  2DMT A;  2R7Q A;  1DPR A;  1ZH5 A;  2PMU A;  2YSR A;  3IAM 2;  3HG9 A;  4BQN A;  2WA0 A;  2BY0 A;  1B4A A;  1TBX A;  1MJB A;  2CGP A;  1FOX A;  3ZXS A;  3OYC A;  3HGG A;  3ZQI A;  5JHF A;  1IRX A;  3HRM A;  1IN6 A;  2Q2E A;  3KP7 A;  5FB2 A;  2I5U A;  1H89 C;  3IHU A;  3H5N A;  3JTG A;  1Z7U A;  4PSX A;  3CMY A;  2AQE A;  4BH9 A;  1IV8 A;  2GIV A;  3HHG A;  2QA4 I;  4HOB A;  3VYS B;  2ZME C;  1OJL A;  2LYC A;  1MBF A;  3CCL I;  1T33 A;  3DTE A;  2E71 A;  5HNH A;  1ENH A;  4Y3O A;  4EJO A;  1H88 C;  5F04 A;  5FKK A;  3O6B B;  2X6Y A;  4JYK A;  2LG4 A;  4GDF A;  3BZK A;  3BQY A;  3WOD F;  5H6R A;  2R7O A;  3GX4 X;  1WH5 A;  3ABT A;  2CV1 A;  3HTU A;  5K7H A;  2BYV E;  1A36 A;  1IRZ A;  4HW0 A;  4E7L A;  2JUG A;  2F4I A;  2XAG A;  1X4O A;  3IWF A;  4ON0 A;  3GYH X;  3GTM J;  3ZN0 A;  4F91 B;  2O61 A;  1U9N A;  1R58 A;  2AXL A;  4ANJ A;  3BG9 A;  3IV5 A;  3BC8 A;  3NWT A;  2BY3 A;  3LFU A;  4E7Z A;  3FKI J;  3BDD A;  3C2H A;  1IJW C;  4RB1 A;  1GT0 C;  1G3T A;  4IX7 A;  2E1N A;  2KRF A;  1S7E A;  3MAJ A;  1D5Y A;  1D5V A;  1B9N A;  5LEJ A;  5LFA A;  2ZJR F;  4MFD A;  2VPR A;  1GLN A;  1P9Q C;  4U0Y A;  2DW4 A;  3I58 A;  4G6T B;  3SZP A;  3WGG A;  5HOO A;  2IEK A;  4QPQ A;  4DBQ A;  1VQ6 I;  2M34 A;  2NXN B;  5DCM B;  3HDD A;  1ITY A;  2EA4 A;  3C1D A;  1T08 B;  3IWZ A;  4NDL A;  3DCF A;  2XKP A;  4Y17 A;  4DOZ A;  3SJM A;  3KPH A;  3CC7 I;  1ZLK A;  4II3 A;  3VYR B;  4NC8 A;  1FOY A;  2E60 A;  2PEX A;  2J5O A;  4U0V A;  5IP6 A;  4KFC A;  4KIF A;  1OYI A;  2QUF A;  1QHH D;  2BVL A;  3ZOB A;  4XID A;  2IS1 A;  2AQF A;  1YFH A;  3H3Z A;  2VOD A;  2A5W A;  2RNJ A;  3F21 A;  5K5O A;  2NS0 A;  2DA7 A;  2EA2 A;  2FJ1 A;  4OIP F;  5FRM A;  2DMU A;  5H2F C;  3D5S C;  3OWT A;  4BNC A;  4RMN A;  3JSP A;  4A3E J;  2HQR A;  2X4H A;  1R1U A;  5IP9 J;  2M5W A;  2Z99 A;  4BUP A;  2L2O A;  4WX9 A;  2A05 A;  1ZR2 A;  1NG6 A;  2QLZ A;  3E7L A;  3G1O A;  3KEO A;  4HF1 A;  1HKT A;  2XKO A;  4C3I J;  2FE3 A;  1TTY A;  1R1V A;  3DV8 A;  2K40 A;  4AYB A;  3BR0 A;  1HBX G;  3QU3 A;  2XRL A;  1LNW A;  1O57 A;  3TMO A;  1MMA A;  1ZYR F;  2LTP A;  3S32 A;  4Y52 J;  3LNQ A;  2L54 A;  3CD6 I;  4HDV A;  2ACJ A;  3K2A A;  3G71 I;  3ECH A;  1XGO A;  3S2D J;  2HOE A;  1WCM J;  2RQP A;  3CTA A;  3FHZ A;  1LFB A;  3FMR A;  1GUU A;  2ZSH B;  2Q8K A;  2VJ5 A;  4FAS D;  2QF7 A;  1MSE C;  2Z1D A;  1XMA A;  2P5L C;  3SZT A;  1YO5 C;  1R7J A;  1YW7 A;  3DFG A;  2ISZ A;  4EJW A;  3S16 J;  3Q9S A;  3M3Y J;  1XSX A;  1BR4 A;  4RBO A;  1GV5 A;  3ZQG A;  3G3Z A;  1SD4 A;  2MAB A;  3GZ5 A;  5JI6 A;  1IF1 A;  4Y33 A;  3G1M A;  1T39 A;  3PNY A;  4XNF A;  4AVP A;  3ECO A;  4I01 A;  3S15 J;  2ZJQ F;  3KIO A;  3HC7 A;  2VKD A;  4GXO A;  1R5H A;  1MKM A;  3CCQ I;  4KIC A;  1VQ7 I;  3S1Q J;  3OOU A;  3GXO A;  2Q2E B;  3W2A A;  4AC0 A;  5F08 A;  1FOW A;  4KUM A;  4QTR A;  1W1W E;  1XC5 A;  2ESH A;  3JAM Z;  4KN4 X;  2R3S A;  1SFO J;  5JFR A;  2DXI A;  1DGR M;  4DZJ A;  3SYT A;  4BHP A;  4ESJ A;  3DTK A;  3F8N A;  1FIA A;  3TBI A;  2FXA A;  4EM2 A;  1ZEL A;  1RR7 A;  3VB2 A;  3G1L A;  5BQT A;  2R7Z J;  1P2F A;  3NAR A;  5H6Q A;  1ZRF A;  3ASO H;  3R61 A;  4BXF A;  3BG7 A;  2K7L A;  2ZFW A;  3MWM A;  4R8H A;  4XIC A;  2L0K A;  1OKR A;  4CUG A;  3GLL A;  3LA2 A;  1B9M A;  5L3D A;  3K4B A;  2HZT A;  2DDA A;  3N05 A;  2KRC A;  3MD2 A;  5HS8 A;  2JRT A;  2M2E A;  2YUS A;  4Z2Y A;  3IL2 A;  2HVS A;  2GQQ A;  3MEX A;  3H92 A;  3HUG B;  5IYD J;  1K7A A;  3FXQ A;  2COB A;  1O3Q A;  3LSP A;  5B1A H;  1VQ5 I;  2XGC A;  5EJC A;  1G4D A;  1W5C C;  1ZG3 A;  3OS0 A;  4B47 A;  2COM A;  4A3J J;  1OPC A;  2STT A;  2FSW A;  2TDX A;  1YW8 A;  5LHG A;  5ED4 A;  3G2B A;  1I1G A;  2G9W A;  1N75 A;  1SMT A;  3IH2 A;  2FD5 A;  4D9J A;  3T8T A;  4P5O A;  3DPT A;  2QQB A;  4ZDL A;  4ZDO A;  3HM5 A;  1W5S A;  1TWG J;  1X1A A;  5D6F A;  5M5X J;  2X51 A;  3ZGK A;  2Q1Z B;  3VOE A;  3BG3 A;  3CCM I;  3GBG A;  2Y0S A;  2HXI A;  1BM9 A;  1S8N A;  3MFK A;  5FRO A;  2KP6 A;  3C3W A;  4HLY A;  1PUF B;  3DU6 A;  1SAU A;  2DO7 A;  3K69 A;  1WJF A;  1BI1 A;  4E4H A;  1YE9 A;  1Z21 A;  1OCC H;  1G8X A;  2VJJ A;  3R60 A;  4DQ2 A;  4YRV A;  5EF6 A;  4B4C A;  1AWC A;  4GFB A;  3J81 Z;  1HDD C;  2W82 A;  2IA0 A;  4JX5 A;  4L0Y B;  2OBP A;  4O3M A;  3RQI A;  2E5Z A;  3OYN A;  2V1U A;  3ZMV A;  2VL8 A;  2E7X A;  4LB6 B;  2M9H A;  3TP3 A;  4BEH A;  3H0G J;  4TV7 A;  1LFP A;  1R23 A;  2XUB A;  4LG0 B;  3V8L A;  2DOF A;  5LBQ A;  2HYJ A;  1Z1D A;  1IXS B;  2OF7 A;  4CO8 A;  2BEO A;  2N8G A;  1HXD A;  1BC8 C;  3K4J A;  3LAP A;  1B72 A;  2R0Q C;  4BBS J;  1ERD A;  4ETS A;  3BR5 A;  3A01 A;  1U0J A;  4KIS A;  3F0C A;  2EIK H;  3FK7 A;  1HSJ A;  4G9Y A;  4A3B J;  3D1N I;  1XPX A;  5CLS A;  3ABU A;  1FP1 D;  4L9N A;  5J1R A;  5GP9 A;  1VQL I;  1GV2 A;  1MBK A;  2VQG A;  3BLY A;  3I55 I;  1QRY A;  4HST A;  2CV2 A;  3CUQ B;  1Z67 A;  4BJ5 C;  3JRG A;  4MEY F;  1X4P A;  4G6Q A;  2YU9 J;  4P96 A;  5IOZ A;  2DPU A;  2G7U A;  3GLX A;  2IGM A;  5IPA A;  3BWG A;  3HUG A;  3IH4 A;  2FML A;  1VQ8 I;  1ETQ A;  1AOY A;  2JRM A;  2O7O A;  4FET A;  4EJT A;  3BZ6 A;  5KAF C;  4L0Z B;  2VT2 A;  3DLL F;  3RTR A;  2NOJ B;  1MZB A;  2MW8 A;  3GEZ A;  5LHH A;  4EV0 A;  5IYC J;  1U5T A;  1IUF A;  3M8F A;  1PUE E;  4DGW B;  2KDZ A;  2A69 F;  2DK8 A;  3BP8 A;  2L3D A;  1SC7 A;  3K9T A;  3DBH B;  1LQ1 A;  2V9P A;  4KN7 X;  2W7N A;  3KCC A;  1D0Y A;  3BR3 A;  2V4J C;  3FMQ A;  2A5Y B;  4GO1 A;  3B6A A;  2CUE A;  2JQ7 A;  4RA2 A;  4CXF A;  4P9U A;  3HGY A;  1MDM B;  1R6R A;  5CPR B;  4A3D J;  4M71 A;  2V26 A;  2X9D A;  2JUC A;  1UG0 A;  1G3Y A;  1MBH A;  2Y30 A;  4CGZ A;  3I4N J;  1APL C;  2QM3 A;  4Y15 A;  4IRG A;  4IEJ A;  2OQG A;  2EQR A;  1WI9 A;  1B1B A;  4RLF A;  4RAY A;  1JHH A;  2KKO A;  3U1D A;  5J3L A;  2L9V A;  3OOP A;  4JP0 A;  3UKG A;  2FBH A;  4L9T A;  3I5U A;  4LGW A;  1J2X A;  4Q47 A;  5DCM A;  4F92 B;  1VFC A;  1KU9 A;  3AFH A;  2A6H F;  4C3H J;  2PI0 A;  2DFF A;  2FQ4 A;  2CQX A;  3OSF A;  3UR3 C;  2QEX I;  3EUA A;  1P4W A;  1FBS A;  2P5K A;  3SFZ A;  4M3F A;  1WJE A;  1D0Z A;  3U9G A;  3L2W A;  1ORK A;  1HLV A;  1DU6 A;  4BGD A;  5D5U B;  2VKV A;  1DDN A;  3NWS A;  3RQ4 A;  1EH7 A;  2XV4 S;  1PP7 U;  3JRC A;  2OCC H;  3FIS A;  4BQA A;  2FOK A;  3HRS A;  3ZMD A;  1H0M A;  2RAE A;  3H9J A;  3JR9 A;  1J59 A;  1R5I D;  3K1N A;  4P55 A;  3HPH A;  4CCM A;  4HNV A;  2XGX A;  4U87 A;  3VDX A;  4D7M A;  2OD5 A;  2MFZ A;  3S2W A;  3ZMZ A;  3EDP A;  3A0H C;  1QVT A;  1F36 A;  4C30 A;  1BI0 A;  5LGN A;  3SQN A;  2R5Z B;  2JJ7 A;  3PQK A;  3HXL A;  4NNJ A;  4EVI A;  3L7W A;  3NEU A;  4JX6 A;  4N4O B;  2DA4 A;  2M1B A;  2VI6 A;  1U3E M;  3OYB A;  1XD7 A;  3AG1 H;  1YJN I;  1J75 A;  1R5G A;  3ZQ7 A;  5E1W A;  1T8I A;  3RKQ A;  2M0C A;  2HPI A;  1E3P A;  2PJR A;  4ZDP A;  3O8H A;  3KEY A;  3LWF A;  4HF2 A;  3J80 K;  3PO2 J;  2F4M B;  2WAQ A;  4EAT A;  5E3N A;  4PGH A;  1X2N A;  3OS2 A;  3HOU J;  3VSK A;  1MBE A;  1S7A A;  2P6T A;  5J8C A;  1P7J A;  1I39 A;  3BR6 A;  1QBJ A;  4YG2 F;  3ABL H;  1QZZ A;  3FBN B;  1ZR4 A;  3HBL A;  3O8G A;  4F7Z A;  2F48 A;  4ZZD A;  1BL0 A;  5B5E C;  4ENJ A;  3M7G A;  5ILV A;  4A0X A;  3J81 K;  4IZZ A;  3E3V A;  4A6D A;  3AKZ A;  4MGR A;  1G2H A;  3FXU A;  2P8T A;  4WWC A;  4BDY A;  1I6H J;  5J40 A;  4UXN A;  1DU0 A;  1QZE A;  3DQV C;  3M9A A;  3RPQ A;  3HOX J;  4Y4R A;  3OSG A;  4IRH A;  5K7Z A;  2FF4 A;  3CLQ A;  5FJ8 J;  1B72 B;  2BE5 F;  3CUO A;  5CVR A;  5E8G A;  1NG7 A;  3FM3 A;  4M73 A;  4PK4 A;  1YHQ I;  5LHI A;  2VON A;  4D5F A;  2Z9O A;  2V79 A;  4UUT A;  3I54 A;  2KL4 A;  4BXX J;  3QPS A;  2XC7 A;  1JTX A;  1JT6 A;  3A0B C;  2LBF A;  2KIF A;  4I02 A;  1XMK A;  1BW5 A;  2EFW A;  4DYQ A;  5CYV A;  4YFX F;  4E7K A;  2HVQ A;  1PVE A;  2PMZ N;  1MNM C;  1TW3 A;  3DU5 A;  4FQG A;  5IP7 J;  3Q3S A;  3NRV A;  2NVY J;  1HW5 A;  3SEZ A;  1ETV A;  1MNE A;  1OFC X;  4HQM A;  3S2H J;  3D0S A;  4P1W A;  2XF7 A;  2EBI A;  3PFI A;  3IUO A;  3GWZ A;  2CW0 F;  5FLX K;  2DQR A;  4BY1 J;  4IL6 C;  4PZJ A;  5H20 A;  2HDW A;  4CCL A;  3S3O A;  2XAJ A;  4BE1 A;  1OMI A;  2EWN A;  2EV5 A;  2A6T A;  4YEJ A;  4A5M A;  3V7R A;  1BR2 A;  4M9S A;  3F3X A;  1RC9 A;  4UVC A;  2XRN A;  1WSU A;  5J1U A;  3V7S A;  2BV6 A;  1DP7 P;  4S04 A;  1RKW A;  4RS8 A;  1IW7 F;  3OIO A;  1WRJ A;  1GXQ A;  4IQJ A;  2IGO A;  1MBJ A;  2KLO A;  3QOE A;  3WTY C;  3OIQ A;  1BIB A;  3VYU B;  1VQ9 I;  2LD5 A;  1D3Y A;  4BQO A;  4Q4Z F;  4UUV A;  3ZQF A;  1GXP A;  1UJ8 A;  1XGM A;  4HX7 A;  1IDZ A;  3F22 A;  5CQG A;  3G73 A;  2Z3Y A;  3BQZ A;  1HC8 A;  3GTG J;  3RZO J;  2PJR B;  3E6C C;  2CW7 A;  4M72 A;  1HW1 A;  1JJ6 C;  5FGM A;  2L01 A;  5HLH A;  4XRS G;  1JKO C;  4M74 A;  3VSL A;  3WTZ A;  4IXA A;  3C18 A;  1KQ9 A;  4O5V A;  4AWX B;  3RKW A;  4XOT A;  3VWB A;  2XSJ C;  4BHB A;  2FBI A;  3E97 A;  1RR8 C;  2GOM A;  5HLT A;  1HDP A;  1TT0 A;  4PGG A;  1RNL A;  1SFX A;  2GOX B;  2DMN A;  2F5F A;  1F43 A;  4HLX A;  2JSC A;  2ECC A;  2HEO A;  2DFH A;  1TWA J;  3PO3 J;  2UWM A;  1ETX A;  2IPQ X;  2HNH A;  4AIH A;  4GYG A;  4QLC U;  4XRS A;  3BT9 A;  4D0P A;  1X19 A;  4F55 A;  2ISY A;  5E17 F;  4D7N A;  1S5L C;  2DAO A;  2L9R A;  2GBY A;  2L5Q A;  2MH2 A;  3MCZ A;  1IUY A;  1FSH A;  4CZZ A;  3RCO A;  2HTJ A;  3L9F A;  1U6G A;  5L3B A;  3QPL A;  2VBW A;  2GA1 A;  1LFU P;  4UB8 C;  2ETH A;  2NVU B;  3HSR A;  2R7D A;  3KP4 A;  2CQK A;  3GTP J;  1EKE A;  4AVZ A;  2R7W A;  2AXT C;  2DU9 A;  4IHW A;  2QVO A;  5FKL A;  3GTO J;  1R49 A;  4NQW B;  1IG7 A;  3G4S I;  2ZME A;  1K6O A;  2P7V B;  5IOY A;  1ZN2 A;  1F4K A;  4PFO A;  3HSF A;  5HOD A;  3HOZ J;  2VXD A;  1XDS A;  1N77 A;  3IP4 B;  2IS2 A;  4XKV A;  3WE2 A;  4OIQ F;  1WHU A;  4L9J A;  2QSH X;  1O3T A;  4O6J A;  3O2P E;  3WTT C;  3E0J B;  5EZG A;  3SEQ A;  4Y7N J;  4MIM A;  1J0R A;  1MH3 A;  3CCS I;  3LL7 A;  1YI2 I;  5FO5 A;  2R7U A;  5JVG F;  1VQN I;  4V2F A;  2DLL A;  3ZR8 X;  1ONV A;  4RAF A; 
#chains in the Genus database with same CATH homology
 1V55 H;  3WG7 H;  3ASO H;  1V54 H;  5B1B H;  3ASN H;  1OCC H;  3ABK H;  1OCO H;  2EIM H;  2EIK H;  3AG2 H;  2EIN H;  3AG4 H;  3AG3 H;  3ABL H;  2DYR H;  3ABM H;  1OCZ H;  3AG1 H;  5IY5 H;  2ZXW H;  1OCR H;  2EIL H;  5B1A H;  2EIJ H;  2DYS H;  2OCC H;  5B3S H;  3X2Q H;  2Y69 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...