3WG7H

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3wg7H00
3ASOH 2Y69H 2EILH 3AG3H 5IY5H 1OCOH 2EINH 3AG1H 1OCRH 2DYRH 2OCCH 1V54H 3X2QH 5B1AH 5B1BH 1OCCH 3ABMH 2EIKH 3ABKH 3ABLH 3WG7H 3ASNH 2EIMH 2EIJH 3AG2H 1V55H 3AG4H 2ZXWH 2DYSH 5B3SH 1OCZH
chains in the Genus database with same CATH superfamily
3FBIB 2OJED 2WAQA 1W0UA 5LD2C 3GTGJ 3CMAI 1ZREA 1Y1WJ 4M3FA 1KYZA 2K4BA 1WI3A 3PO2J 3HBLA 5K7FA 2Q0OA 2VKEA 5J4VA 3QQAA 4M3EA 4RLFA 2XHKA 1K83J 2LNBA 4M6VA 2LP0A 3NQOA 2CMPA 3MEXA 4IZZA 3DTKA 2MLKA 3HUGB 2FQ3A 2I8DA 3CMEI 4JYKA 4RM3A 1NTCA 4OWRB 2Y30A 4RAZA 5J1YA 2IS1A 1Y8QB 1PUFA 4H4KC 2VASA 1SC7A 2FBIA 1YRNA 1ENHA 2JA2A 2JUGA 2YPRA 1SFXA 3EYYA 3QPTA 1VQNI 3ASOH 2BGCA 2L7ZA 2DMNA 3H1CA 4RB0A 3HGYA 4G12A 1G59A 1D0YA 1RIOH 2XGCA 1YW9A 4LOCA 3H5AA 4G7HF 5L3CA 3WHCA 4M72A 1V5EA 2IBDA 4LG0A 3FMRA 2V7FA 3JRDA 2Y31A 3HJEA 2X48A 4XLEA 1MBKA 2W57A 5HLIA 3E1SA 3W6VA 5EZGA 2XAGA 1IXRC 5J8CA 3CF5F 4M3DA 4GYIA 1YG2A 2IT0A 5FFZA 1QA6A 3GTOJ 2VQHA 3QODA 1VQOI 1OCPA 1VQLI 1OPCA 2FNAA 2EH3A 2MGQA 1ZK8A 5F08A 1J9IA 4LLGF 2MC3A 2HDWA 2RQQA 2ZNYA 1XTAA 3DWLE 4S04A 2FU4A 3RKYA 1FY7A 1WGXA 1MMGA 3K2ZA 5C4JJ 5J1RA 3P9IA 4A3IJ 2L2OA 3V8JA 3OYHA 2VKHA 4CYCB 2DTZA 2M0CA 4AYBN 4G7ZF 3JRCA 3RQIA 2CUZA 4B44A 1R49A 1IDZA 1FOYA 5BMZA 5B5EC 2QYOA 2NXNB 2YUSA 1P4XA 2GQQA 2WY7Q 2FSWA 4A5NA 3ZMSA 3C2GA 2PMUA 4HG2A 4F52A 2FNPA 1TNTA 1OLTA 3NRVA 1RRJA 1HW2A 4A3CJ 1POGA 2JRMA 1KU2A 2LBFA 2FA5A 3BR5A 5CVJA 2GAUA 4UV9A 4AIKA 4BHCA 3DU5A 3HSRA 1N25A 4BY7J 3VB2A 2KRFA 1LFBA 3V7CA 2X6WA 4NBQA 1OFCX 2GZWA 2X6YA 1XGOA 1I39A 3V7SA 1JJ6C 1T95A 3DEEA 2VONA 3MKWB 2D2WA 3HOWJ 2VBZA 2XDVA 4XKVA 3E6MA 4BQNA 3GMEA 5AIQA 3OL4A 1W7PA 3CC7I 2R7UA 5K5RA 2EZHA 1TWCJ 4HNVA 4UB6C 2IGMA 2OA4A 4JK1X 1FTZA 2HQRA 2PQ8A 3DPLC 4I09A 4DYRA 1P92A 5FRNA 2HOEA 1WH5A 3GZ5A 4DGWB 3IRQA 2FJ1A 4MQVA 3E5XA 5H6RA 2FX0A 5EDNA 5EF6A 1WHUA 3OYNA 3GFIA 2XPUA 3Q0UA 4XN3A 2QQAA 3FXRA 4QPOA 4Y33A 2FRHA 1LFUP 3BP8A 4YFNF 3PO3J 4HX8A 3PUBA 1I27A 5DCMB 5KK1A 1RUNA 2M8GX 3KFWX 2H94A 3ZR8X 4QIWN 2VBYA 1FEXA 4NUBA 1YIOA 4HX7A 3DTIA 3BR6A 4D9JA 3BG5A 2EK5A 3KP3A 3OY9A 3BC8A 3FX3A 3N4MA 2B63J 3TW7A 1VF9A 1MZBA 2Z2SB 2DQRA 1ZKGA 5CVRA 1R00A 4XRMA 2LF8A 2WY8Q 1BL0A 2M8EA 3ZQ7A 4WK8F 3QYFA 5J6XA 4L5JA 1J09A 4LIUA 4L18B 1JTYA 1BIAA 4CO8A 2GLOA 4A3EJ 4LLNA 2ISZA 2FOWA 2O8XA 4I01A 3SEZA 2MW8A 3L7WA 5E18F 5L3GA 2WB1A 1JKPC 1YJNI 5LEJA 3GYHX 3DV8A 4N4NB 4BJ6C 1DPRA 2MBFA 3BG9A 3HGGA 4FX0A 3G4SI 2KL4A 2QBYA 1J5YA 2Y48A 2E19A 2CWEA 4EEFG 1MNEA 2QVOA 2LFBA 2Z99A 3HSFA 1WVRA 3PJRA 2K9LA 1IUYA 2RV8A 3M7GA 1OCRH 2M45A 4XLHA 1OQYA 3RIRA 1Y8RB 4JX4A 4ESBA 3GTKJ 2A07F 4I0BA 5LEKA 3DLLF 1FBQA 2GIZA 3ECOA 1SFEA 1N77A 1A36A 3GO5A 4AU7A 1SANA 4NC6A 5KAFC 1SD5A 2JA7J 2XC7A 1ZLKA 2LRDA 4PSXA 3ELKA 2LLKA 2OBPA 3DLAA 4FTHA 2E7XA 4GGGA 3BPVA 3L2WA 2AXTC 3UR3C 1QU3A 4DW6A 2DCEA 2HOSA 4NQWB 3X2QH 2OPTA 3WGIA 1GXQA 3P5JA 3DFGA 3F6OA 1RNLA 2CG4A 1A5JA 2VQCA 1DDNA 2XRNA 4DBQA 4ASNA 2E2JJ 2NS8A 1IG7A 3M8JA 3IP4B 1NK3P 3RTRA 3DXJF 2EZLA 2GBYA 9ANTA 2QQ8A 3CDHA 1ORKA 5E17F 2RC4A 2V4JC 3OYLA 2XPVA 3BY6A 3R60A 4WWCA 3HHGA 3KP5A 2IP2A 5EGOA 1O3TA 1XN7A 4IHWA 1Z1DA 1EA3A 3OYMA 2ELJA 5M3MJ 1JHHA 1ON2A 3BPXA 3D5LA 1D8JA 5EYRA 1R7JA 4P9FA 3LSJA 3O8GA 1HC8A 3CJNA 3FKJA 3JSPA 3GX4X 1STZA 2Y9ZA 4KMUX 4UUSA 2Z33A 2AO9A 2NNNA 4BE2A 1JT6A 4O5VA 1ZTRA 4KISA 2HZTA 2HTJA 4UUTA 2M4GA 1WJ5A 1G2HA 1FOKA 1MJAA 3Q0WA 1M1EB 5H2FC 2XB5A 1T2KA 2WTEA 1ZGAA 4PJMA 3EUAA 2F5VA 3GXOA 5DV5A 5EZHA 2ZNZA 3GTJJ 1XGSA 4BS9A 3OYCA 3S3NA 2ZMEA 5IYCJ 2IEKA 2M1BA 2F5EA 3IC7A 3K4KA 1KU9A 1G3YA 4MLOA 4Y3OA 1NH3A 4EJUA 2CQNA 2W25A 2RGVA 3R0JA 1HOMA 3RDIA 1WSUA 5HLHA 1IDYA 3DCFA 4BJ5C 4XKBA 1OYWA 3KIOA 2Z9OA 2M2EA 2JJ7A 3JRAA 2H27A 5F6FA 4BHPA 3DBRB 3GFJA 1P4AA 4HDUA 1J7KA 4XSXF 5LBQA 1FZPB 4Y52J 4GCVA 1OMIA 1KYWA 2CFOA 2FUG2 5TGTA 2CV1A 3KLNA 2ME0A 1G3SA 2HS5A 2XUBA 3K69A 3PFIA 1MSEC 2E1NA 2DMTA 3ZQFA 4P5OA 5FLMJ 2ZJPF 3MZYA 1FP1D 3WTZA 3E5UA 4JX6A 5B3SH 3S3MA 1H8AC 1SAXA 2V6CA 1LUJB 4CHUA 3HIFA 2CH0A 1KONA 1QZZA 3R4KA 3CJRB 2D1HA 4CA0A 3WHBA 3ZQLA 2RNJA 4WXCA 2EV5A 4KICA 2M3AA 3PNYA 5TISC 1W36C 2DT5A 1HQCA 3CLQA 3BCBA 3RJPA 3U1DA 4ENKA 4D7NA 4IEJA 3S3OA 1AHDP 2NRAC 3CO7C 1F9NA 3L2QA 5DD8A 1X1AA 1UJ8A 3KYDB 3W2WA 4I6ZA 1F1ZA 4ESJA 4RA2A 2O3FA 5CLSA 1R5ID 1ON1A 3V8LA 3CDLA 3HC7A 3CJTB 3G1OA 5DCMA 2VLAA 4C2MJ 3IH3A 2LTPA 1K6OA 4DBRA 4MEXF 5K7ZA 1JHFA 2DA7A 2TCTA 3DU6A 3K10A 2PBIA 1SVOA 3I71A 2R7QA 1XS9A 2VJ5A 2MC4A 4ZZLA 3WG9A 3BT9A 1K7AA 3CCYA 4ESFA 5FLVA 2A61A 2EFPA 1DQUA 2DAOA 3LA2A 1E17A 4I2OA 3F0CA 4BL0B 1LJ9A 5JVGF 1X1DA 2ZXWH 4A3BJ 5FFXA 3HPGA 2RKHA 3IWZA 1XMXA 2EZIA 2QLZA 1OCTC 2ECBA 1FP2A 1ITYA 1CQTA 1KGSA 1O57A 3GZ6A 1T38A 2VT3A 5ERIA 2EV0A 2OCCH 1EF4A 3S1MJ 2VUMJ 2H8RA 4KDPA 2K3FA 3HDDA 2NVQJ 1X2NA 1R58A 5ICFA 1YQAA 3QPHA 2EBIA 4ZYGA 3A03A 3BTIA 4AC0A 1E3OC 1BJZA 3S17J 2R7VA 4HF0A 4LK1F 4IVNA 4KIFA 5EJCA 3RSNA 4E7JA 2QSHX 5BQTA 1W1WE 3IRRA 6PAXA 2P5LC 3WE2A 2CQXA 2F5FA 1UHMA 2COMA 4UVAA 3BR1A 1CGPA 2DFFA 3JRHA 3QRFF 2OF7A 1T33A 2NVUB 4A3FJ 1UG0A 1W5TA 4NNJA 5J1UA 5FJ8J 2K9MA 3CD6I 2STWA 5JHUA 2O8KA 4AVZA 2X1EA 5KHDA 2BYVE 3ZCOA 3KEOA 1YI2I 4UNOA 2HNHA 2EV6A 3M9AA 3KE2A 4I99C 4IX7A 4OIOF 2DO7A 3Q5FA 4Q48A 1YW7A 2ZKZA 2CS3A 3FWEA 2XGEA 3IUOA 4UUSB 3BZKA 3L1PA 4B09A 4A93J 1BI2A 2NVTJ 1XD7A 5JI6A 4XKWA 4Y13A 3TGNA 1XCBA 1Z0XA 1JI8A 3H3VK 4BEHA 2ZJRF 3F23A 3HKZA 1KQ9A 2VODA 5GTHC 3ZGKA 1MW7A 3TP0A 1QHGA 2DA5A 2KQRA 2K9NA 5IT9K 4CICA 3PFYA 2M7BA 3IH2A 2BOLA 4E7HA 1RPWA 3O8HA 4MFDA 3LL7A 5GTIC 5D8KB 4IOCF 5EEGA 3BROA 2CW0F 3TO7A 3KETA 1MH4A 3OMYA 1Z3XA 3K70D 1N75A 1U9NA 2E34A 2KMUA 5D4SA 2MLGA 1NG6A 1Z6TA 3MN2A 3ERED 4P9UA 5F1JA 2RAEA 3HZJA 1PJRA 3N97A 1XB4A 2GIVA 4HEA2 3CCSI 3FF5A 1X1BA 4ZZDA 1N78A 2Z3YA 3HRMA 3ONQA 3DPUA 2D45A 2BVLA 2F4IA 4HYEA 3MVPA 2DXIA 3OYGA 4DOZA 1JUSA 5F0CA 1HW1A 1WKMA 2ZO4A 1DPUA 1QQIA 4GRIA 5FROA 2IPQX 4F92B 5E1WA 5FO5A 3OSGA 3HRSA 1BI0A 1K6YA 1I6HJ 4ZYAA 4PFOA 4IPAA 4CYCA 2QENA 1BI3A 1XGNA 4D0PA 2ID3A 2MSYA 3JW4A 4LB6B 3SEQA 5LFAA 3HOVJ 1FC3A 5KCMA 4XM3A 3OYDA 1D1CA 2BVMA 1Y56A 2EIKH 4XOPA 1MJBA 2R3SA 1ODDA 4EATA 4M9ZA 3JTGA 1MGTA 1MDMB 1RR8C 4L9JA 1NHAA 1LDKB 1K78A 3SJMA 4HF1A 1Z91A 4E70A 1G4DA 5FD5A 3LSMA 5CKTA 1SAUA 5D4RA 1ZG3A 1D3YA 5ILUA 2V9KA 4H0EA 2L9SA 1YX5A 2IGKA 2K5CA 5HDGA 5LRRA 3RI4A 2F5CA 3VSKA 2E60A 1R9TJ 3GVAA 3CLOA 4HOBA 3WG7H 5J3LA 1Z7LA 1T8IA 1ULYA 2X4HA 3SXYA 1ETWA 5M5XJ 4W97A 2YX4A 3F72A 3CJQB 3F8BA 3LQQA 3F9KA 2R92J 5BS6A 1HW5A 4C2UA 3R0AA 3A1YA 2ADUA 4Q47A 5IT3A 2JZYA 2EILH 3CMYA 3MFKA 4PJNA 3KEQA 1EH6A 3HG9A 4X1EA 3MWMA 3CP2A 5CYVA 3K1PA 4YIFA 5C3EJ 3BJOA 2KKOA 2JSCA 4UY8I 1R5GA 2MD0A 1GUUA 1UHSA 3VYTB 3ZQGA 4AM3A 4A3LJ 4RS8A 1XDUA 2Y75A 4WXDA 4MNUA 1S5LC 2R7DA 4V2FA 2LVSA 1MMDA 1FWZA 2NVYJ 2DMUA 3V7RA 1VI0A 2TDXA 3DF8A 2VPLA 1VQ8I 3AG3H 3I4NJ 2JA6J 1VQPI 1GVJA 5F64A 4MTEA 3HL2A 2EA4A 2DA2A 2P5KA 1E3PA 2P6TA 4YIRX 2NOGA 3V4GA 1G8XA 2H09A 2UXXA 3V8KA 2HQAA 2O03A 4PFPA 3H36A 1FYKA 4M9SA 5H20A 2BXZA 2P5VA 5B66C 3OSFA 4XK4A 1X3UA 5JHFA 4KN4X 2H1LA 2ZXHA 2OZUA 5IYBJ 3TO9A 4BEHB 2R7WA 4OIQF 3OYBA 2CJJA 1UZCA 2YS9A 1SEUA 4AWXB 1IRZA 3U21A 5HODA 3CCQI 1AKHA 5L3BA 2HR3A 5FB2A 3E3VA 2DA3A 4PCQA 4ENNA 4V19K 3OR2C 3H0DA 2UZKA 3LMMA 4B1RA 1NK2P 1TT0A 4A2UA 4OMYA 1KU7A 4BDYA 4PJ0C 3S2WA 4U87A 2W7NA 2XSDC 4HA8A 2E2HJ 2G9WA 4UB8C 3SYTA 2P6SA 1IO2A 1OYYA 5F0HA 1YFHA 1O4XA 2OV7A 1S3JA 1R36A 3IAM2 4I02A 5F27A 2NOJB 2AXLA 3VEPA 4FASD 5CJ9A 1WH7A 3F22A 1T08B 4A6DA 4N9IA 4CXFA 1A6IA 1Z05A 1ERDA 3KP7A 1Z21A 4L0ZB 3OOPA 2XIGA 4ZTFA 3OYEA 2BY2A 3R61A 1SD7A 4RBOA 2VE8A 1G6NA 1PUEE 4OMZA 5HS7A 1PP8F 4P1WA 1MBFA 5DTDA 3OR1C 1VQ5I 1B4AA 4ABZA 1S29A 1OCOH 1ZHFA 4D5FA 1JGGA 3BOQA 4P55A 4LG0B 1YW8A 5IOYA 2VJIA 4EM0B 1CF7B 3MKYB 4XQFA 2A6EF 3J7YJ 3JRGA 2H1KA 1Q1HA 3B02A 4KT5C 1TL8A 3ZOBA 4A5MA 1SD6A 4CZCA 3RCOA 2YR2A 1K78B 2L4AA 2R93J 5D5WB 3TDZC 3LQRA 4S05A 1TQPA 2EZKA 2JMWA 5D8LB 5JVTA 2IW5A 3KLOA 3OV8A 1HKQA 3REOA 4D1QA 1USTA 1I1GA 1D0XA 1QZYA 3EETA 1Y0UA 3ZMTA 1MNDA 2Z1DA 3I5UA 1YHQI 4B47A 1FBSA 3K0LA 3QPLA 3FIWA 3E6BA 3OOUA 4CCOA 1X19A 2MABA 3S16J 4MO7A 4XKCA 4M3BA 2IS6A 2CFXA 2E7WA 2XRLA 5HNHA 3IL2A 4V2GA 1W36D 1YE9A 2EFNA 2X51A 4BGDA 2DYSH 4M73A 1WRJA 2KP6A 1MBGA 1VFCA 1JKOC 4L0YB 1GV2A 5L3FA 2H8WA 2MD5A 5GPAA 3F8FA 1T98A 3K4NA 4U0VA 4G8XA 1JT0A 3OIPA 4ETSA 4ZYHA 4S0HB 2QKLB 3FK6A 4KIBA 5HVQC 2IS4A 3ABMH 3QU3A 4LK0F 4CSWA 4EM1A 3KYLA 3HHHA 1ONVA 1BR1A 4EV0A 3S1QJ 2QWWA 2WB1N 2QGUA 2W00A 1KQ8A 3EPZA 1I50J 1O3QA 2IS2A 3BDDA 2BHYA 3MZ8A 1MNMC 3GBGA 2HWVA 2EIMH 4XICA 1O7FA 4G9YA 2O7OA 1IN5A 1D0ZA 3L9FA 1YJWI 3GTPJ 4QSHA 3ZN0A 3F8CA 1Z67A 4LD5A 4UV8A 3OS0A 4BXXJ 5ICGA 3DEUA 2HDCA 5IPAA 3WTUC 3NAUA 3M8FA 1MBEA 5J8FA 4CCJA 3PQKA 4FQGA 1BJAA 3HYIA 3NWTA 4ZH4F 3FISA 4HX4A 4BH9A 3G6EI 1ZGJA 2EWNA 2QSFX 3CO6C 3S14J 3AG2H 2E5ZA 3WGGA 5AONA 4HQEA 2LMDA 4KMFA 4NDLA 3ZP5A 2IVMA 3IKTA 1Q1VA 1S72I 1FSHA 2V1NA 2AQFA 3S93A 2WWYA 2HZDA 2L7KA 1TQIA 4ZDOA 5B1AH 3CUQA 2KLOA 3H3ZA 3F8NA 2LKXA 5LGNA 1RI7A 3T8RA 3Q3SA 2F48A 2UUZA 2XGDA 4HLXA 2LKSA 5IP7J 1WFXA 2ME6A 1RESA 4KN7X 3CCEI 2Y0MA 2VT2A 3J80K 2FMYA 2W82A 4PJJA 1TC3C 5EG0A 4ZTJA 2HKXA 5JFRA 3L2CA 2HPMA 3ABUA 4LITA 4A12A 1WJBA 1U9OA 5TJJA 1ZN2A 2L01A 4GFBA 3TL4X 5HNFA 4EJTA 1S7OA 2DN0A 3BWGA 4CCMA 2KZVA 1IJWC 2HKOA 1QHHD 3LSIA 3FKIJ 4EVIA 2PG4A 2DMPA 3QOEA 5FKKA 1IRFA 2XAJA 3FXOA 4E7SA 3I64A 2M7AA 1V55H 3LAPA 4Z6YA 5DUKA 2I10A 3PM1A 2M87A 5JLWA 3C7JA 5E3NA 3H0GJ 4C3JJ 1OR7A 3PIPF 1LEAA 4BQOA 5ED4A 3WTXC 4PZJA 3OYJA 2CUEA 2K7LA 2PN6A 3F6VA 2KT0A 2KDOA 3L09A 2WBMA 2IRFG 3CMMA 4ZDPA 1K4SA 3K1NA 3OS1A 3LSKA 4EQQA 3SZGA 2HEOA 4HRIA 5CVUA 4F3QA 3ZMZA 1W0TA 1FYMA 4KA4A 3LA3A 2B7EA 4AIDA 1B59A 3RYRA 3HEFA 3JRIA 5GAGJ 4D5CA 2P81A 3GTQJ 2P8TA 2STTA 4M6YA 4A0XA 2M34A 5F1RA 4U0YA 1LNWA 1ZRFA 1YITI 4NC8A 4OINF 3AAFA 1SD4A 4XLFA 2OTJI 2V9PA 1K4TA 2ZXIA 1I3AA 3L00A 4PJLA 2BXYA 2LSOA 1U5TA 3H92A 4TV7A 2GA1A 1BOBA 2HDDA 1OR7C 2DQLA 2JK3A 2DOFA 2F2EA 2CGPA 4BXFA 1RETA 3DKWA 3HM5A 2BEOA 3ML6A 2IGOA 4RAYA 2NAZA 3FM5A 1SMTA 3OL3A 3D1NI 1O7LA 1QPMA 2WAEA 3HRUA 4G6DA 2WAQN 2DMQA 3PNTA 4M74A 1QO0D 5EEHA 1FOWA 4LLLA 3JRFA 5LGTA 2IA1A 3W6KB 2CUJA 2BHZA 1QGPA 4E4HA 2F6CA 1D1BA 1WQ2A 2KIUA 3KP2A 3CC2I 1IZ1A 1TP4A 2ICWG 2ESHA 1FIPA 3WTVC 2ESNA 2PMHA 4RDUA 3BTCA 4K2EA 1XDSA 3RPUD 1YIJI 3MZHA 1ZR4A 3N05A 4L9TA 2DFHA 3CUOA 1HSTA 4KYWA 5E1ZB 2JSPA 3K6GA 2VOOA 1X58A 4YIIA 3OYAA 5H6QA 5IYDJ 1OCCH 2UV1A 4EJVA 2Q8KA 3TQNA 2IGNA 3HPHA 1FIAA 3DEWA 2WV1A 2HQNA 2E1CA 1VTNC 2E1MC 4ZJZA 5DUIA 2A3SA 1R1TA 2HYGD 4G7OF 3JAMK 3O3KA 2F4OB 3WODF 1J59A 4A3GJ 4ZYDA 5HS9A 1KU3A 1RZ4A 3UKGA 2JA8J 2NVXJ 4N4OB 3HB9A 3MKZA 3MQ0A 4XSZF 2PJRB 2GXGA 3LWFA 5DCFA 3CC4I 4DYCA 3KZZA 1ETYA 5DM6F 2GXAA 1IN8A 3ERMA 2DOAA 4AYBA 4Z2YA 1BC7C 2OTLI 1A04A 2EFQA 1IW7F 4WF2A 1JTXA 1EJ9A 4HF2A 1EKEA 5CQEA 3OWTA 5J4YA 4HSRA 5LHIA 4IHVA 2HQ5A 4NHJA 1H0MA 2KIFA 1AWCA 5FKOA 2FBKA 1ETQA 1Z6RA 3JTHA 4LIVA 5GAEJ 2OZ6A 4PSWA 1R22A 5FKMA 2X0LA 2JT1A 3M1EA 3TW6A 4J01A 4A3JJ 4BNCA 3AL0B 1UFMA 2KFDA 2VN2A 5LGUA 2E5NA 4LMYA 5CQGA 4RGUA 3MAJA 3BLYA 2RVCA 3IAS2 2V1UA 2Y9YA 4JOMA 3U9GA 2V6EA 2ECCA 3HOSA 3ESWB 2RNGA 4C3HJ 2DT6A 4G6TB 2XSJC 3D5RC 1XSXA 1DGWY 1VQ4I 3W3CA 2L9NA 2DA1A 1S7AA 2DJIA 2V1XA 2XKOA 3KPHA 4A6EA 2CYYA 2LY9A 2QBYB 3A01A 2GOMA 3M07A 4IXAA 2DA4A 3S2DJ 3HOXJ 3A2KA 1FSEA 1BN5A 3ZQQA 2X6XA 3AKZA 1E2XA 1IRGA 1T56A 3RPQA 2ZBKA 1P7JA 2HXIA 4I7HA 1OISA 5K1YA 4EMSA 1IXCA 2X9DA 2ZMEC 4E6KG 1WI9A 2HI3A 2VXZA 3PSIA 1IGNA 2DFIA 2QZ8A 2TRTA 1TQMA 5E79C 4X0GA 1HA8A 5HS8A 1FPQA 4DJAA 1FBUA 4RLQA 3JRBA 4J19A 2QCOA 4MQ9F 3SDBA 3EQLF 2CO5A 2LDUA 3WU0A 3CCJI 2BZTA 2BY0A 4II2A 1X2MA 5FKNA 3ABKH 1GHCA 4PK4A 1AKHB 2H6BA 3VWBA 5BNGA 1B72A 1FJLA 1HKTA 1YLFA 3K4LA 2YU3A 2Z5UA 2KIMA 4ON0A 4IHYA 4I98B 2JA5J 2L4MA 1FMWA 1WPKA 2G0EA 1J2XA 3VYSB 2XROA 4D7MA 1RC9A 1RUOA 2OD5A 1U8BA 3GZNB 3S15J 3G2BA 1K79A 3PSFA 4B48A 2AHQA 3A02A 2A69F 2ZJQF 1B6AA 3L2UA 2VC1A 1ZR2A 3FHZA 5E8GA 3HOTA 2R5ZA 2LD5A 2PI0A 4AD9A 1DU6A 3MKLA 3S1RJ 2YSRA 4DQ2A 1R1UA 2OAZA 2Q2EA 3T0YA 4IHSA 2ID6A 1ZAOA 3PNVA 3QP6A 5LHHA 5IP9J 3GWZA 4IQ4A 3TDUC 5IY5H 4A0ZA 1TW2A 1BC8C 1HDPA 4CH7A 3RKXA 3BG7A 3T1BA 5D5VB 2E1OA 3FHNA 1BW6A 4RGXA 3ABTA 2L0KA 2V26A 3ROUA 1Z9CA 3K1MA 5DD4A 5LRSA 5FGMA 4E7KA 1EV7A 5ICEA 2VJJA 3LSGA 2KISA 1YJ9I 3RYPA 2NYXA 1MDMA 2JQ7A 1OJLA 1PUFB 2HOTA 4IRHA 2E1MB 4PDKA 4XL9A 5E3OA 1R71A 1Z3YA 2L02A 4IKFA 2PJRA 5J40A 3WTSC 1GDTA 2JUCA 5KVRA 3JREA 2R5YB 2PFBA 3ZMDA 1HDDC 3LFUA 2ELHA 3Q9VA 3WU1B 3CTAA 1C0WA 1TWHJ 3J80Z 3FZVA 3I4MJ 2KZGA 1R5HA 3H5NA 4KUMA 4XRSG 3K4MA 3IH4A 1ACIA 5HLGA 1XSVA 2LREA 2GM4A 2L9VA 3GLLA 3GUDA 1D5VA 1HBXG 5D5XB 1XPXA 1BIBA 1XGMA 3DKYA 4BE0A 4FHTA 1ZQ3P 2IJLA 1FOXA 2KPMA 3OYIA 1X4PA 2XB0X 2L54A 1U8RA 2J5OA 5LLQA 3I55I 4I76A 2B0LA 1QNTA 3PIOF 4UUVA 1Y6IA 2K85A 3DQVC 2W85A 1IV6A 3HTUA 2ZC2A 3G1MA 1LB2A 1LE8A 2QSGX 2XF5A 3WU2C 1PDNC 2HTSA 2I5UA 4A3DJ 2XPWA 2LYCA 2X1DA 4F55A 3I53A 1R4NB 1VNDA 1HXDA 3ZRGA 2XASA 1ZG5A 3MMYB 2XAQA 4LFUA 4KNYA 2BBYA 4IJAA 2QA4I 3M4OJ 3TOAA 4B3AA 3ASNH 1FNNA 5IT9Z 4M71A 5E8IA 2XAHA 2JN6A 3M1CA 2FMLA 3NWSA 3QOPA 4XORA 1PVEA 5CVIA 3LNQA 1JE8A 2O0YA 1R23A 2OCEA 4L5IA 4HNUA 2JVHA 1TT5B 2A5YB 1L3LA 4FT8A 1H9GA 1USSA 1QRYA 2DPDA 1D8KA 3C2HA 4BY1J 4CGZA 4ZC3A 3TOBA 3OIQA 1QVTA 2B9SA 3RPUA 1DU0A 2PLYA 5JLXA 2JRTA 5D5UB 3ZN1A 3CCRI 4XRFA 2M5WA 3E97A 3ZMVA 4L9NA 2D5VA 2CW7A 5IP6A 3A0BC 2GXBA 4ENMA 4B3XA 3BG6A 1YRNB 3SHFA 2DTRA 1BA5A 3FK7A 3FXMA 5E20A 2VJ4A 1YTYA 1G3WA 5K5QA 2LG4A 1W4MA 3M8EA 5L3EA 4XBFA 1SFKA 4ITVA 2QUFA 1B8IA 1UELB 1YOVB 3CCVI 3HOYJ 2ETHA 4QTRA 1IN7A 3K4BA 3HRTA 3UNGC 1RR7A 4HZFA 1U3EM 3KP6A 3LSTA 5GPCA 1GXPA 3E7LA 3K7AJ 2LH9A 1U0JA 3I54A 1MKMA 3KEYA 1IN6A 2M30A 1BW5A 1HKSA 2DLLA 5J47A 4C2TA 3H9JA 1TWFJ 2XF7A 4QWQA 3J7AO 2BY3A 3P7NA 2DBBA 1IRXA 2K9SA 2N8GA 3K2AA 4XIDA 2DA6A 4DNCA 3ZXSA 4GDFA 1U6GA 2ZFUA 1TTYA 3QPSA 1JUPA 1BM9A 4U7BA 3H35A 2YU9J 1LKXA 4HBLA 3BCAA 2O61A 3LA7A 4EJWA 4EGYA 3BQZA 2WC2A 4GYGA 1I6XA 2VKVA 2C6YA 3KZYA 2KIQA 4IF4A 1B1BA 3EUHA 4RB2C 2FBHA 2LF7A 2K4JA 3C3WA 4MGRA 2OU2A 1WJFA 4BU2A 1VQMI 3H5RA 4OU0A 1YYVA 5GAHJ 3AG1H 4BE1A 1ZG1A 1T39A 3VYRB 4B4CA 1WZ2A 4CCKA 1GVDA 1OYIA 3EDPA 2DT7B 3JAMZ 2HYJA 3GTMJ 1F43A 3B6AA 2FQ4A 4P96A 3S1NJ 4BBRJ 1I3QJ 5GP9A 4C3IJ 3ZMUA 3J81K 1U5TB 1XSDA 2F4MB 2WADA 2ELKA 2HPIA 2M0MA 4RGSA 2V1DA 3V42A 3DKXA 1BR4A 3BJ6A 3FXLA 3I56I 4LG3A 3TEDA 1VQ6I 4NC7A 3SZTA 4R1HA 3TKYA 2CU7A 2QKMB 3MD2A 3ZPLA 2QQBA 3QAHA 1X3WB 5ILSA 3ZQHA 3K4JA 4FCYA 2XVCA 3LSRA 2R7SA 3B73A 1XX5A 3GLXA 2WAFA 1E0EA 2FF4A 3WGHA 4XLPF 2BE5F 2R5ZB 2MG4A 2QM3A 4AUXA 3IWFA 3QP5A 1QVUA 5CVVA 2AS5F 4M9XA 4OAZA 5K5OA 4UXNA 2CQQA 2M4KA 2DFEA 4ZYEA 4YELA 4NB5A 3CZ6A 4XLAA 2VBXA 3OS2A 1JJ8C 3FMSA 1B9MA 2QEXI 3O6BB 4UVBA 4JX5A 2OC6A 3L2VA 3GFLA 4OIRF 1UHWA 5DEQA 3CUQC 2W24A 2FD5A 3TMOA 1AA7A 2W4SA 1BI1A 2AQEA 2DDAA 2JVGA 2PMZN 4KT6A 3HKZN 1WWXA 3PUFA 4QLCU 1HLVA 3GW2A 1OKRA 2E36A 2DODA 3Q9SA 2PMZA 3HOUJ 5BOXA 3VOEA 2HXOA 1OCZH 1APLC 2LC2A 5EEAA 4HDVA 1PP7U 1QBJA 2LY2A 1XG1A 2K27A 3A4CA 5FD6A 1MSFC 4BUPA 3FMQA 1RKTA 4FX4A 2O9LA 4R79A 4CZZA 4EM2A 1X1CA 1SFUA 5ICCA 2E2IJ 2MH2A 2ZB9A 3W2AA 3ZQCA 4MEYF 3S8PA 4BACA 3DTEA 3GF2A 2MYSA 5DS9A 4RMNA 4O3MA 2CRGA 1HCRA 1XMKA 4AIHA 5F0FA 4YG2F 3RKWA 5E3MA 4IOAF 4ZDLA 3BR3A 1T6SA 4DZJA 2JPCA 3A01B 2ZSHB 3W2VA 3K9TA 1GLNA 4HV6A 2V9VA 2KRHA 3O2PE 2VQLA 5BPDA 2W84A 2XAUA 2E71A 3IKVA 4KIGA 3E6CC 3U2RA 1MD0A 1Y0NA 4UVCA 5GADJ 4RAGA 4CYDA 5HLTA 2CW8A 2EFWA 1FMVA 4Q5SF 4FE7A 4IO9F 1IUFA 2QQ9A 5L3DA 1A6QA 1MBHA 5C4XJ 3H3UA 1ZYRF 2VOPA 1VZ0A 2R4GA 1BOAA 4XLNF 4WXHA 5AIPA 1TZLA 3C1DA 3HUGA 1TLHB 3VYUB 4YFXF 2CV2A 5E3LA 4BHBA 1QPIA 1QZEA 1FTTA 4U0WA 1XCVA 2VB6A 2K3PA 1TW3A 1P6RA 2BV6A 2VI6A 4XMYA 3OYKA 3M3YJ 1U5TC 2QF7A 1I5ZA 4QPQA 2MFZA 3I0TA 3VDXA 4BDZA 4WX9A 3EUKL 3L2RA 2F5DA 3NEUA 3Q0VA 1YX3A 1FX7A 4L9VA 3VODA 3ISPA 1JGSA 4IRIA 1JKRC 2IA0A 4IHXA 2CSOA 1LQ1A 1F4KA 2KJBA 4M3GA 3LSPA 1ZGWA 1H88C 3SFZA 1V5FA 5DM7F 3DP7A 2DYRH 2O6GE 4MTDA 1MBJA 1V54H 5IOZA 3OIOA 4CCNA 1HSJA 2VBWA 4XONA 1BR2A 3ABLH 2UXNA 2VC0A 1TNSA 1SFOJ 4LGWA 1DP3A 2KDZA 1T0FC 2K02A 2JTVA 3S32A 3J81Z 4LJZF 1A35A 2HVSA 2LKPA 1U2WA 2ZMEB 2FEZA 1MMAA 1ZELA 3AG4H 1JKQC 4C9YA 1DGRM 4G94A 3VFZA 1J75A 2PEXA 2P4WA 3QU6A 4ANJA 3G3ZA 4FISA 3PL8A 2DOEA 3KX2A 1FT9A 2ZXJA 5EGOB 5KNLA 4BQAA 3HOZJ 2HVQA 4IHTA 3CUQB 2JPBA 4BXUA 2YX7A 3FXQA 4MFEA 3GCMA 3FM3A 4M6XA 1LE8B 1ZARA 2DW4A 2Z16A 1O3RA 3HSEA 1B72B 1YS7A 5A2QK 2RQPA 1H9TA 1S9HA 2GA2A 3HXLA 4HAMA 1NG7A 2GOXB 4Y7NJ 2HVRA 2NS7A 2VQGA 2E35A 2R5YA 3PQJA 3SQNA 5E1XA 2M9HA 3K4CA 3JR9A 1MIJA 3U1KA 4BQQA 3QYBA 3KYCB 3AFHA 4ENJA 1I1SA 3IV5A 1PYVA 3RKQA 4HSTA 4XNFA 1R6RA 2RDPA 4BJTA 3LSHA 1X1PA 3C2BA 4FETA 3BZ6A 3JCUC 2X6OA 2IAIA 4R8HA 2FOKA 4PGGA 4MHGA 5EG0B 3QYEA 1W7PB 3NARA 3GEZA 4KITB 1G3TA 2GWRA 1S6LA 2ZCWA 3LOCA 3BTJA 5M5YJ 2Y69H 2Y2ZA 3HTSB 4A3KJ 2EB7A 4A69C 3AL0C 3J7ZI 2L5QA 2MH9A 3F8MA 1W5CC 2W1OA 1J0RA 2JWTA 2MA3A 3ZQIA 2R7TA 4KJZA 5FLXZ 1WJCA 1IV8A 4Q4ZF 4X6AJ 3B6CA 4N0BA 3A0HC 2LBFB 2KHMA 4RM2A 5A2QZ 1REPC 2VPRA 4HQMA 3DBHB 2LK2A 5DYMA 3WTTC 3E5QA 1S8NA 2L3DA 3TO6A 2A5WA 1L0OC 3FXUA 3BG3A 2Y0SA 4YFKF 1JXSA 2W48A 4E7IA 1BBYA 2K40A 4GO1A 2HOAA 2CQ7A 3G1LA 2Y0SN 3CCUI 1A31A 1LDJA 2VL8A 4RB3C 2L7FP 3RZDJ 2BY1A 3W6JB 3BQYA 3CCMI 2Q1ZB 4JP0A 5C44J 3JSOA 2LY1A 1VQ7I 1D5YA 2P0WA 2NNYA 1XC5A 1V5GA 2RN7A 4YRVA 5M5WJ 4HV5A 1X3ZB 4RAFA 2ZSIB 5CPRB 4OAYA 2HGCA 1GT0C 1V3FA 1W5SA 2OQGA 4I0AA 4E7ZA 4U88A 2R7ZJ 2X85A 1IAWA 2O5RA 4HW0A 2EA2A 1IF1A 4U7DA 5LHGA 2VXDA 2R7XA 2DI3A 3I59B 4C30A 1FYLA 1F5TA 2RREA 3SZPA 2XKPA 1Z7UA 4WCGA 3F21A 2CQKA 4EGZA 1ZRCA 3OYFA 2A68F 1UB9A 1MMSA 2KJCA 2HYFA 4MIMA 1B8IB 2DK8A 2V79A 2LOOA 5FRMA 2WA0A 1AU7A 1P4WA 4F7ZA 4Y17A 1LVKA 3FXKA 2DU9A 2EJRA 3RQ4A 2LR8A 3FXJA 4BAYA 3BTLA 4DZPA 1H89C 2IXSA 1LVAA 2L7MP 1U78A 5FKLA 3P9KA 2KRCA 4E7LA 2VIXA 3H9GA 3J7AY 1T0FA 4BBSJ 2IA2A 1AOYA 3LFKA 1UAAA 3I3LA 1MJ9A 4IL6C 3IHUA 4UHTA 1JUMA 5HOOA 1IC8A 3QWLA 4PUSA 2FE3A 4AVPA 4PGHA 4RGRA 1KQ0A 1P9QC 1YO5C 1YS6A 3E6DA 1DP7P 1UCRA 4F93B 2D1VA 4DYQA 2DDBA 4CDGA 2HU9A 3GTLJ 3I59A 3S2HJ 2X1CA 2R7FA 2PJPA 3BR2A 1CF7A 2ZJ2A 3MCZA 1TWGJ 1UG2A 5D6FA 1ETKA 4EJOA 4Y15A 3VSLA 4HNTA 1ZRDA 1Y1VJ 3COAC 2CUFA 1VQKI 3BZCA 1P2FA 4OOIA 2A6HF 2R7RA 1MMNA 3TP3A 2P7VB 1GV5A 1LPQA 1E3HA 3RZOJ 2HFHA 3I4PA 1W7PD 3DBLB 2L9RA 1B9NA 4N9HA 3TBIA 1EH7A 2Q2EB 1WJDA 3VPRA 1SVLA 2PX9A 3E0JB 5TRDA 4NQWA 4LB5A 1D1AA 3CF2A 4OIPF 4A0YA 1XMAA 2WV0A 4II3A 3R6SA 3G73A 4J00A 3ECHA 2UWMA 1ETXA 3KZIC 3F3XA 1UMQA 1X4OA 3WE3A 1EH8A 2BW3B 3CESA 1KZHA 1S7EA 2DPUA 2NS0A 2P7CB 4BKXA 2J5PA 5JR3A 3LAJA 3FDYA 1VQ9I 2EINH 4XOTA 3C18A 1RKWA 1SVMA 5B1BH 2DK5A 3D0SA 2EFOA 1LEBA 4BYYA 3DPTA 5DDGA 5KAIC 5HDNA 5FLXK 1ETVA 4RB1A 1P7IA 3I9V2 4W1UA 3SDGA 1LDDA 2XGXA 2ZFWA 4XN0A 2H6CA 2K9QA 3WTWC 1ZH5A 4IQJA 3CDIA 1ETOA 3EYIA 2CV0A 5HDKA 2EQRA 4HLYA 1MH3A 1ZLJA 5K7HA 1IN4A 3WTYC 1F36A 4YEJA 1KA8A 2VE9A 4A3MJ 4XR6A 2ISYA 3K70C 4AIJA 2G7UA 4DIQA 5D6EA 3CCLI 4KFCA 2DJNA 3ULQB 4FE4A 1TWAJ 3SFIA 3CQZJ 4F91B 3GFMA 3I58A 4CCLA 1LFPA 2XAFA 1WJAA 1FLIA 1Z77A 4JBAA 3H9QA 2XF6A 1TBXA 3P9CA 1HF0A 1V4RA 4HPQA 2FXAA 1R1VA 4IRGA 2VKDA 1R4MB 2XV4S 3KCCA 1SMYF 4O6JA 3D5SC 2ACJA 2G7HA 4G6QA 3G71I 1DUXC 2K86A 5ILVA 4XLCA 1Y39A 1IXSB 4CUGA 5BPIA 3T8TA 2R7OA 3KP4A 4GXOA 1K61A 2OUMA 1WJEA 5F04A 2R0QC 4XRSA 4Y4RA 3FBNB 3CP8A 4B8XA 3T5XA 1O3SA 2A6TA 4L5EA 2EIJH 3BJAA 4B43A 3BR0A 1WCMJ 2COBA 3EUHC 2EPFA 4JQFA 2A05A 2BW3A 5M3FJ 2OQRA
chains in the Genus database with same CATH topology
3ASOH 2Y69H 2EILH 3AG3H 5IY5H 1OCOH 2EINH 3AG1H 1OCRH 2DYRH 2OCCH 1V54H 3X2QH 5B1AH 5B1BH 1OCCH 3ABMH 2EIKH 3ABKH 3ABLH 3WG7H 3ASNH 2EIMH 2EIJH 3AG2H 1V55H 3AG4H 2ZXWH 2DYSH 5B3SH 1OCZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO H;  2Y69 H;  2EIL H;  3AG3 H;  5IY5 H;  1OCO H;  2EIN H;  3AG1 H;  1OCR H;  2DYR H;  2OCC H;  1V54 H;  3X2Q H;  5B1A H;  5B1B H;  1OCC H;  3ABM H;  2EIK H;  3ABK H;  3ABL H;  3WG7 H;  3ASN H;  2EIM H;  2EIJ H;  3AG2 H;  1V55 H;  3AG4 H;  2ZXW H;  2DYS H;  5B3S H;  1OCZ H; 
#chains in the Genus database with same CATH topology
 3FBI B;  2OJE D;  2WAQ A;  1W0U A;  5LD2 C;  3GTG J;  3CMA I;  1ZRE A;  1Y1W J;  4M3F A;  1KYZ A;  2K4B A;  1WI3 A;  3PO2 J;  3HBL A;  5K7F A;  2Q0O A;  2VKE A;  5J4V A;  3QQA A;  4M3E A;  4RLF A;  2XHK A;  1K83 J;  2LNB A;  4M6V A;  2LP0 A;  3NQO A;  2CMP A;  3MEX A;  4IZZ A;  3DTK A;  2MLK A;  3HUG B;  2FQ3 A;  2I8D A;  3CME I;  4JYK A;  4RM3 A;  1NTC A;  4OWR B;  2Y30 A;  4RAZ A;  5J1Y A;  2IS1 A;  1Y8Q B;  1PUF A;  4H4K C;  2VAS A;  1SC7 A;  2FBI A;  1YRN A;  1ENH A;  2JA2 A;  2JUG A;  2YPR A;  1SFX A;  3EYY A;  3QPT A;  1VQN I;  3ASO H;  2BGC A;  2L7Z A;  2DMN A;  3H1C A;  4RB0 A;  3HGY A;  4G12 A;  1G59 A;  1D0Y A;  1RIO H;  2XGC A;  1YW9 A;  4LOC A;  3H5A A;  4G7H F;  5L3C A;  3WHC A;  4M72 A;  1V5E A;  2IBD A;  4LG0 A;  3FMR A;  2V7F A;  3JRD A;  2Y31 A;  3HJE A;  2X48 A;  4XLE A;  1MBK A;  2W57 A;  5HLI A;  3E1S A;  3W6V A;  5EZG A;  2XAG A;  1IXR C;  5J8C A;  3CF5 F;  4M3D A;  4GYI A;  1YG2 A;  2IT0 A;  5FFZ A;  1QA6 A;  3GTO J;  2VQH A;  3QOD A;  1VQO I;  1OCP A;  1VQL I;  1OPC A;  2FNA A;  2EH3 A;  2MGQ A;  1ZK8 A;  5F08 A;  1J9I A;  4LLG F;  2MC3 A;  2HDW A;  2RQQ A;  2ZNY A;  1XTA A;  3DWL E;  4S04 A;  2FU4 A;  3RKY A;  1FY7 A;  1WGX A;  1MMG A;  3K2Z A;  5C4J J;  5J1R A;  3P9I A;  4A3I J;  2L2O A;  3V8J A;  3OYH A;  2VKH A;  4CYC B;  2DTZ A;  2M0C A;  4AYB N;  4G7Z F;  3JRC A;  3RQI A;  2CUZ A;  4B44 A;  1R49 A;  1IDZ A;  1FOY A;  5BMZ A;  5B5E C;  2QYO A;  2NXN B;  2YUS A;  1P4X A;  2GQQ A;  2WY7 Q;  2FSW A;  4A5N A;  3ZMS A;  3C2G A;  2PMU A;  4HG2 A;  4F52 A;  2FNP A;  1TNT A;  1OLT A;  3NRV A;  1RRJ A;  1HW2 A;  4A3C J;  1POG A;  2JRM A;  1KU2 A;  2LBF A;  2FA5 A;  3BR5 A;  5CVJ A;  2GAU A;  4UV9 A;  4AIK A;  4BHC A;  3DU5 A;  3HSR A;  1N25 A;  4BY7 J;  3VB2 A;  2KRF A;  1LFB A;  3V7C A;  2X6W A;  4NBQ A;  1OFC X;  2GZW A;  2X6Y A;  1XGO A;  1I39 A;  3V7S A;  1JJ6 C;  1T95 A;  3DEE A;  2VON A;  3MKW B;  2D2W A;  3HOW J;  2VBZ A;  2XDV A;  4XKV A;  3E6M A;  4BQN A;  3GME A;  5AIQ A;  3OL4 A;  1W7P A;  3CC7 I;  2R7U A;  5K5R A;  2EZH A;  1TWC J;  4HNV A;  4UB6 C;  2IGM A;  2OA4 A;  4JK1 X;  1FTZ A;  2HQR A;  2PQ8 A;  3DPL C;  4I09 A;  4DYR A;  1P92 A;  5FRN A;  2HOE A;  1WH5 A;  3GZ5 A;  4DGW B;  3IRQ A;  2FJ1 A;  4MQV A;  3E5X A;  5H6R A;  2FX0 A;  5EDN A;  5EF6 A;  1WHU A;  3OYN A;  3GFI A;  2XPU A;  3Q0U A;  4XN3 A;  2QQA A;  3FXR A;  4QPO A;  4Y33 A;  2FRH A;  1LFU P;  3BP8 A;  4YFN F;  3PO3 J;  4HX8 A;  3PUB A;  1I27 A;  5DCM B;  5KK1 A;  1RUN A;  2M8G X;  3KFW X;  2H94 A;  3ZR8 X;  4QIW N;  2VBY A;  1FEX A;  4NUB A;  1YIO A;  4HX7 A;  3DTI A;  3BR6 A;  4D9J A;  3BG5 A;  2EK5 A;  3KP3 A;  3OY9 A;  3BC8 A;  3FX3 A;  3N4M A;  2B63 J;  3TW7 A;  1VF9 A;  1MZB A;  2Z2S B;  2DQR A;  1ZKG A;  5CVR A;  1R00 A;  4XRM A;  2LF8 A;  2WY8 Q;  1BL0 A;  2M8E A;  3ZQ7 A;  4WK8 F;  3QYF A;  5J6X A;  4L5J A;  1J09 A;  4LIU A;  4L18 B;  1JTY A;  1BIA A;  4CO8 A;  2GLO A;  4A3E J;  4LLN A;  2ISZ A;  2FOW A;  2O8X A;  4I01 A;  3SEZ A;  2MW8 A;  3L7W A;  5E18 F;  5L3G A;  2WB1 A;  1JKP C;  1YJN I;  5LEJ A;  3GYH X;  3DV8 A;  4N4N B;  4BJ6 C;  1DPR A;  2MBF A;  3BG9 A;  3HGG A;  4FX0 A;  3G4S I;  2KL4 A;  2QBY A;  1J5Y A;  2Y48 A;  2E19 A;  2CWE A;  4EEF G;  1MNE A;  2QVO A;  2LFB A;  2Z99 A;  3HSF A;  1WVR A;  3PJR A;  2K9L A;  1IUY A;  2RV8 A;  3M7G A;  1OCR H;  2M45 A;  4XLH A;  1OQY A;  3RIR A;  1Y8R B;  4JX4 A;  4ESB A;  3GTK J;  2A07 F;  4I0B A;  5LEK A;  3DLL F;  1FBQ A;  2GIZ A;  3ECO A;  1SFE A;  1N77 A;  1A36 A;  3GO5 A;  4AU7 A;  1SAN A;  4NC6 A;  5KAF C;  1SD5 A;  2JA7 J;  2XC7 A;  1ZLK A;  2LRD A;  4PSX A;  3ELK A;  2LLK A;  2OBP A;  3DLA A;  4FTH A;  2E7X A;  4GGG A;  3BPV A;  3L2W A;  2AXT C;  3UR3 C;  1QU3 A;  4DW6 A;  2DCE A;  2HOS A;  4NQW B;  3X2Q H;  2OPT A;  3WGI A;  1GXQ A;  3P5J A;  3DFG A;  3F6O A;  1RNL A;  2CG4 A;  1A5J A;  2VQC A;  1DDN A;  2XRN A;  4DBQ A;  4ASN A;  2E2J J;  2NS8 A;  1IG7 A;  3M8J A;  3IP4 B;  1NK3 P;  3RTR A;  3DXJ F;  2EZL A;  2GBY A;  9ANT A;  2QQ8 A;  3CDH A;  1ORK A;  5E17 F;  2RC4 A;  2V4J C;  3OYL A;  2XPV A;  3BY6 A;  3R60 A;  4WWC A;  3HHG A;  3KP5 A;  2IP2 A;  5EGO A;  1O3T A;  1XN7 A;  4IHW A;  1Z1D A;  1EA3 A;  3OYM A;  2ELJ A;  5M3M J;  1JHH A;  1ON2 A;  3BPX A;  3D5L A;  1D8J A;  5EYR A;  1R7J A;  4P9F A;  3LSJ A;  3O8G A;  1HC8 A;  3CJN A;  3FKJ A;  3JSP A;  3GX4 X;  1STZ A;  2Y9Z A;  4KMU X;  4UUS A;  2Z33 A;  2AO9 A;  2NNN A;  4BE2 A;  1JT6 A;  4O5V A;  1ZTR A;  4KIS A;  2HZT A;  2HTJ A;  4UUT A;  2M4G A;  1WJ5 A;  1G2H A;  1FOK A;  1MJA A;  3Q0W A;  1M1E B;  5H2F C;  2XB5 A;  1T2K A;  2WTE A;  1ZGA A;  4PJM A;  3EUA A;  2F5V A;  3GXO A;  5DV5 A;  5EZH A;  2ZNZ A;  3GTJ J;  1XGS A;  4BS9 A;  3OYC A;  3S3N A;  2ZME A;  5IYC J;  2IEK A;  2M1B A;  2F5E A;  3IC7 A;  3K4K A;  1KU9 A;  1G3Y A;  4MLO A;  4Y3O A;  1NH3 A;  4EJU A;  2CQN A;  2W25 A;  2RGV A;  3R0J A;  1HOM A;  3RDI A;  1WSU A;  5HLH A;  1IDY A;  3DCF A;  4BJ5 C;  4XKB A;  1OYW A;  3KIO A;  2Z9O A;  2M2E A;  2JJ7 A;  3JRA A;  2H27 A;  5F6F A;  4BHP A;  3DBR B;  3GFJ A;  1P4A A;  4HDU A;  1J7K A;  4XSX F;  5LBQ A;  1FZP B;  4Y52 J;  4GCV A;  1OMI A;  1KYW A;  2CFO A;  2FUG 2;  5TGT A;  2CV1 A;  3KLN A;  2ME0 A;  1G3S A;  2HS5 A;  2XUB A;  3K69 A;  3PFI A;  1MSE C;  2E1N A;  2DMT A;  3ZQF A;  4P5O A;  5FLM J;  2ZJP F;  3MZY A;  1FP1 D;  3WTZ A;  3E5U A;  4JX6 A;  5B3S H;  3S3M A;  1H8A C;  1SAX A;  2V6C A;  1LUJ B;  4CHU A;  3HIF A;  2CH0 A;  1KON A;  1QZZ A;  3R4K A;  3CJR B;  2D1H A;  4CA0 A;  3WHB A;  3ZQL A;  2RNJ A;  4WXC A;  2EV5 A;  4KIC A;  2M3A A;  3PNY A;  5TIS C;  1W36 C;  2DT5 A;  1HQC A;  3CLQ A;  3BCB A;  3RJP A;  3U1D A;  4ENK A;  4D7N A;  4IEJ A;  3S3O A;  1AHD P;  2NRA C;  3CO7 C;  1F9N A;  3L2Q A;  5DD8 A;  1X1A A;  1UJ8 A;  3KYD B;  3W2W A;  4I6Z A;  1F1Z A;  4ESJ A;  4RA2 A;  2O3F A;  5CLS A;  1R5I D;  1ON1 A;  3V8L A;  3CDL A;  3HC7 A;  3CJT B;  3G1O A;  5DCM A;  2VLA A;  4C2M J;  3IH3 A;  2LTP A;  1K6O A;  4DBR A;  4MEX F;  5K7Z A;  1JHF A;  2DA7 A;  2TCT A;  3DU6 A;  3K10 A;  2PBI A;  1SVO A;  3I71 A;  2R7Q A;  1XS9 A;  2VJ5 A;  2MC4 A;  4ZZL A;  3WG9 A;  3BT9 A;  1K7A A;  3CCY A;  4ESF A;  5FLV A;  2A61 A;  2EFP A;  1DQU A;  2DAO A;  3LA2 A;  1E17 A;  4I2O A;  3F0C A;  4BL0 B;  1LJ9 A;  5JVG F;  1X1D A;  2ZXW H;  4A3B J;  5FFX A;  3HPG A;  2RKH A;  3IWZ A;  1XMX A;  2EZI A;  2QLZ A;  1OCT C;  2ECB A;  1FP2 A;  1ITY A;  1CQT A;  1KGS A;  1O57 A;  3GZ6 A;  1T38 A;  2VT3 A;  5ERI A;  2EV0 A;  2OCC H;  1EF4 A;  3S1M J;  2VUM J;  2H8R A;  4KDP A;  2K3F A;  3HDD A;  2NVQ J;  1X2N A;  1R58 A;  5ICF A;  1YQA A;  3QPH A;  2EBI A;  4ZYG A;  3A03 A;  3BTI A;  4AC0 A;  1E3O C;  1BJZ A;  3S17 J;  2R7V A;  4HF0 A;  4LK1 F;  4IVN A;  4KIF A;  5EJC A;  3RSN A;  4E7J A;  2QSH X;  5BQT A;  1W1W E;  3IRR A;  6PAX A;  2P5L C;  3WE2 A;  2CQX A;  2F5F A;  1UHM A;  2COM A;  4UVA A;  3BR1 A;  1CGP A;  2DFF A;  3JRH A;  3QRF F;  2OF7 A;  1T33 A;  2NVU B;  4A3F J;  1UG0 A;  1W5T A;  4NNJ A;  5J1U A;  5FJ8 J;  2K9M A;  3CD6 I;  2STW A;  5JHU A;  2O8K A;  4AVZ A;  2X1E A;  5KHD A;  2BYV E;  3ZCO A;  3KEO A;  1YI2 I;  4UNO A;  2HNH A;  2EV6 A;  3M9A A;  3KE2 A;  4I99 C;  4IX7 A;  4OIO F;  2DO7 A;  3Q5F A;  4Q48 A;  1YW7 A;  2ZKZ A;  2CS3 A;  3FWE A;  2XGE A;  3IUO A;  4UUS B;  3BZK A;  3L1P A;  4B09 A;  4A93 J;  1BI2 A;  2NVT J;  1XD7 A;  5JI6 A;  4XKW A;  4Y13 A;  3TGN A;  1XCB A;  1Z0X A;  1JI8 A;  3H3V K;  4BEH A;  2ZJR F;  3F23 A;  3HKZ A;  1KQ9 A;  2VOD A;  5GTH C;  3ZGK A;  1MW7 A;  3TP0 A;  1QHG A;  2DA5 A;  2KQR A;  2K9N A;  5IT9 K;  4CIC A;  3PFY A;  2M7B A;  3IH2 A;  2BOL A;  4E7H A;  1RPW A;  3O8H A;  4MFD A;  3LL7 A;  5GTI C;  5D8K B;  4IOC F;  5EEG A;  3BRO A;  2CW0 F;  3TO7 A;  3KET A;  1MH4 A;  3OMY A;  1Z3X A;  3K70 D;  1N75 A;  1U9N A;  2E34 A;  2KMU A;  5D4S A;  2MLG A;  1NG6 A;  1Z6T A;  3MN2 A;  3ERE D;  4P9U A;  5F1J A;  2RAE A;  3HZJ A;  1PJR A;  3N97 A;  1XB4 A;  2GIV A;  4HEA 2;  3CCS I;  3FF5 A;  1X1B A;  4ZZD A;  1N78 A;  2Z3Y A;  3HRM A;  3ONQ A;  3DPU A;  2D45 A;  2BVL A;  2F4I A;  4HYE A;  3MVP A;  2DXI A;  3OYG A;  4DOZ A;  1JUS A;  5F0C A;  1HW1 A;  1WKM A;  2ZO4 A;  1DPU A;  1QQI A;  4GRI A;  5FRO A;  2IPQ X;  4F92 B;  5E1W A;  5FO5 A;  3OSG A;  3HRS A;  1BI0 A;  1K6Y A;  1I6H J;  4ZYA A;  4PFO A;  4IPA A;  4CYC A;  2QEN A;  1BI3 A;  1XGN A;  4D0P A;  2ID3 A;  2MSY A;  3JW4 A;  4LB6 B;  3SEQ A;  5LFA A;  3HOV J;  1FC3 A;  5KCM A;  4XM3 A;  3OYD A;  1D1C A;  2BVM A;  1Y56 A;  2EIK H;  4XOP A;  1MJB A;  2R3S A;  1ODD A;  4EAT A;  4M9Z A;  3JTG A;  1MGT A;  1MDM B;  1RR8 C;  4L9J A;  1NHA A;  1LDK B;  1K78 A;  3SJM A;  4HF1 A;  1Z91 A;  4E70 A;  1G4D A;  5FD5 A;  3LSM A;  5CKT A;  1SAU A;  5D4R A;  1ZG3 A;  1D3Y A;  5ILU A;  2V9K A;  4H0E A;  2L9S A;  1YX5 A;  2IGK A;  2K5C A;  5HDG A;  5LRR A;  3RI4 A;  2F5C A;  3VSK A;  2E60 A;  1R9T J;  3GVA A;  3CLO A;  4HOB A;  3WG7 H;  5J3L A;  1Z7L A;  1T8I A;  1ULY A;  2X4H A;  3SXY A;  1ETW A;  5M5X J;  4W97 A;  2YX4 A;  3F72 A;  3CJQ B;  3F8B A;  3LQQ A;  3F9K A;  2R92 J;  5BS6 A;  1HW5 A;  4C2U A;  3R0A A;  3A1Y A;  2ADU A;  4Q47 A;  5IT3 A;  2JZY A;  2EIL H;  3CMY A;  3MFK A;  4PJN A;  3KEQ A;  1EH6 A;  3HG9 A;  4X1E A;  3MWM A;  3CP2 A;  5CYV A;  3K1P A;  4YIF A;  5C3E J;  3BJO A;  2KKO A;  2JSC A;  4UY8 I;  1R5G A;  2MD0 A;  1GUU A;  1UHS A;  3VYT B;  3ZQG A;  4AM3 A;  4A3L J;  4RS8 A;  1XDU A;  2Y75 A;  4WXD A;  4MNU A;  1S5L C;  2R7D A;  4V2F A;  2LVS A;  1MMD A;  1FWZ A;  2NVY J;  2DMU A;  3V7R A;  1VI0 A;  2TDX A;  3DF8 A;  2VPL A;  1VQ8 I;  3AG3 H;  3I4N J;  2JA6 J;  1VQP I;  1GVJ A;  5F64 A;  4MTE A;  3HL2 A;  2EA4 A;  2DA2 A;  2P5K A;  1E3P A;  2P6T A;  4YIR X;  2NOG A;  3V4G A;  1G8X A;  2H09 A;  2UXX A;  3V8K A;  2HQA A;  2O03 A;  4PFP A;  3H36 A;  1FYK A;  4M9S A;  5H20 A;  2BXZ A;  2P5V A;  5B66 C;  3OSF A;  4XK4 A;  1X3U A;  5JHF A;  4KN4 X;  2H1L A;  2ZXH A;  2OZU A;  5IYB J;  3TO9 A;  4BEH B;  2R7W A;  4OIQ F;  3OYB A;  2CJJ A;  1UZC A;  2YS9 A;  1SEU A;  4AWX B;  1IRZ A;  3U21 A;  5HOD A;  3CCQ I;  1AKH A;  5L3B A;  2HR3 A;  5FB2 A;  3E3V A;  2DA3 A;  4PCQ A;  4ENN A;  4V19 K;  3OR2 C;  3H0D A;  2UZK A;  3LMM A;  4B1R A;  1NK2 P;  1TT0 A;  4A2U A;  4OMY A;  1KU7 A;  4BDY A;  4PJ0 C;  3S2W A;  4U87 A;  2W7N A;  2XSD C;  4HA8 A;  2E2H J;  2G9W A;  4UB8 C;  3SYT A;  2P6S A;  1IO2 A;  1OYY A;  5F0H A;  1YFH A;  1O4X A;  2OV7 A;  1S3J A;  1R36 A;  3IAM 2;  4I02 A;  5F27 A;  2NOJ B;  2AXL A;  3VEP A;  4FAS D;  5CJ9 A;  1WH7 A;  3F22 A;  1T08 B;  4A6D A;  4N9I A;  4CXF A;  1A6I A;  1Z05 A;  1ERD A;  3KP7 A;  1Z21 A;  4L0Z B;  3OOP A;  2XIG A;  4ZTF A;  3OYE A;  2BY2 A;  3R61 A;  1SD7 A;  4RBO A;  2VE8 A;  1G6N A;  1PUE E;  4OMZ A;  5HS7 A;  1PP8 F;  4P1W A;  1MBF A;  5DTD A;  3OR1 C;  1VQ5 I;  1B4A A;  4ABZ A;  1S29 A;  1OCO H;  1ZHF A;  4D5F A;  1JGG A;  3BOQ A;  4P55 A;  4LG0 B;  1YW8 A;  5IOY A;  2VJI A;  4EM0 B;  1CF7 B;  3MKY B;  4XQF A;  2A6E F;  3J7Y J;  3JRG A;  2H1K A;  1Q1H A;  3B02 A;  4KT5 C;  1TL8 A;  3ZOB A;  4A5M A;  1SD6 A;  4CZC A;  3RCO A;  2YR2 A;  1K78 B;  2L4A A;  2R93 J;  5D5W B;  3TDZ C;  3LQR A;  4S05 A;  1TQP A;  2EZK A;  2JMW A;  5D8L B;  5JVT A;  2IW5 A;  3KLO A;  3OV8 A;  1HKQ A;  3REO A;  4D1Q A;  1UST A;  1I1G A;  1D0X A;  1QZY A;  3EET A;  1Y0U A;  3ZMT A;  1MND A;  2Z1D A;  3I5U A;  1YHQ I;  4B47 A;  1FBS A;  3K0L A;  3QPL A;  3FIW A;  3E6B A;  3OOU A;  4CCO A;  1X19 A;  2MAB A;  3S16 J;  4MO7 A;  4XKC A;  4M3B A;  2IS6 A;  2CFX A;  2E7W A;  2XRL A;  5HNH A;  3IL2 A;  4V2G A;  1W36 D;  1YE9 A;  2EFN A;  2X51 A;  4BGD A;  2DYS H;  4M73 A;  1WRJ A;  2KP6 A;  1MBG A;  1VFC A;  1JKO C;  4L0Y B;  1GV2 A;  5L3F A;  2H8W A;  2MD5 A;  5GPA A;  3F8F A;  1T98 A;  3K4N A;  4U0V A;  4G8X A;  1JT0 A;  3OIP A;  4ETS A;  4ZYH A;  4S0H B;  2QKL B;  3FK6 A;  4KIB A;  5HVQ C;  2IS4 A;  3ABM H;  3QU3 A;  4LK0 F;  4CSW A;  4EM1 A;  3KYL A;  3HHH A;  1ONV A;  1BR1 A;  4EV0 A;  3S1Q J;  2QWW A;  2WB1 N;  2QGU A;  2W00 A;  1KQ8 A;  3EPZ A;  1I50 J;  1O3Q A;  2IS2 A;  3BDD A;  2BHY A;  3MZ8 A;  1MNM C;  3GBG A;  2HWV A;  2EIM H;  4XIC A;  1O7F A;  4G9Y A;  2O7O A;  1IN5 A;  1D0Z A;  3L9F A;  1YJW I;  3GTP J;  4QSH A;  3ZN0 A;  3F8C A;  1Z67 A;  4LD5 A;  4UV8 A;  3OS0 A;  4BXX J;  5ICG A;  3DEU A;  2HDC A;  5IPA A;  3WTU C;  3NAU A;  3M8F A;  1MBE A;  5J8F A;  4CCJ A;  3PQK A;  4FQG A;  1BJA A;  3HYI A;  3NWT A;  4ZH4 F;  3FIS A;  4HX4 A;  4BH9 A;  3G6E I;  1ZGJ A;  2EWN A;  2QSF X;  3CO6 C;  3S14 J;  3AG2 H;  2E5Z A;  3WGG A;  5AON A;  4HQE A;  2LMD A;  4KMF A;  4NDL A;  3ZP5 A;  2IVM A;  3IKT A;  1Q1V A;  1S72 I;  1FSH A;  2V1N A;  2AQF A;  3S93 A;  2WWY A;  2HZD A;  2L7K A;  1TQI A;  4ZDO A;  5B1A H;  3CUQ A;  2KLO A;  3H3Z A;  3F8N A;  2LKX A;  5LGN A;  1RI7 A;  3T8R A;  3Q3S A;  2F48 A;  2UUZ A;  2XGD A;  4HLX A;  2LKS A;  5IP7 J;  1WFX A;  2ME6 A;  1RES A;  4KN7 X;  3CCE I;  2Y0M A;  2VT2 A;  3J80 K;  2FMY A;  2W82 A;  4PJJ A;  1TC3 C;  5EG0 A;  4ZTJ A;  2HKX A;  5JFR A;  3L2C A;  2HPM A;  3ABU A;  4LIT A;  4A12 A;  1WJB A;  1U9O A;  5TJJ A;  1ZN2 A;  2L01 A;  4GFB A;  3TL4 X;  5HNF A;  4EJT A;  1S7O A;  2DN0 A;  3BWG A;  4CCM A;  2KZV A;  1IJW C;  2HKO A;  1QHH D;  3LSI A;  3FKI J;  4EVI A;  2PG4 A;  2DMP A;  3QOE A;  5FKK A;  1IRF A;  2XAJ A;  3FXO A;  4E7S A;  3I64 A;  2M7A A;  1V55 H;  3LAP A;  4Z6Y A;  5DUK A;  2I10 A;  3PM1 A;  2M87 A;  5JLW A;  3C7J A;  5E3N A;  3H0G J;  4C3J J;  1OR7 A;  3PIP F;  1LEA A;  4BQO A;  5ED4 A;  3WTX C;  4PZJ A;  3OYJ A;  2CUE A;  2K7L A;  2PN6 A;  3F6V A;  2KT0 A;  2KDO A;  3L09 A;  2WBM A;  2IRF G;  3CMM A;  4ZDP A;  1K4S A;  3K1N A;  3OS1 A;  3LSK A;  4EQQ A;  3SZG A;  2HEO A;  4HRI A;  5CVU A;  4F3Q A;  3ZMZ A;  1W0T A;  1FYM A;  4KA4 A;  3LA3 A;  2B7E A;  4AID A;  1B59 A;  3RYR A;  3HEF A;  3JRI A;  5GAG J;  4D5C A;  2P81 A;  3GTQ J;  2P8T A;  2STT A;  4M6Y A;  4A0X A;  2M34 A;  5F1R A;  4U0Y A;  1LNW A;  1ZRF A;  1YIT I;  4NC8 A;  4OIN F;  3AAF A;  1SD4 A;  4XLF A;  2OTJ I;  2V9P A;  1K4T A;  2ZXI A;  1I3A A;  3L00 A;  4PJL A;  2BXY A;  2LSO A;  1U5T A;  3H92 A;  4TV7 A;  2GA1 A;  1BOB A;  2HDD A;  1OR7 C;  2DQL A;  2JK3 A;  2DOF A;  2F2E A;  2CGP A;  4BXF A;  1RET A;  3DKW A;  3HM5 A;  2BEO A;  3ML6 A;  2IGO A;  4RAY A;  2NAZ A;  3FM5 A;  1SMT A;  3OL3 A;  3D1N I;  1O7L A;  1QPM A;  2WAE A;  3HRU A;  4G6D A;  2WAQ N;  2DMQ A;  3PNT A;  4M74 A;  1QO0 D;  5EEH A;  1FOW A;  4LLL A;  3JRF A;  5LGT A;  2IA1 A;  3W6K B;  2CUJ A;  2BHZ A;  1QGP A;  4E4H A;  2F6C A;  1D1B A;  1WQ2 A;  2KIU A;  3KP2 A;  3CC2 I;  1IZ1 A;  1TP4 A;  2ICW G;  2ESH A;  1FIP A;  3WTV C;  2ESN A;  2PMH A;  4RDU A;  3BTC A;  4K2E A;  1XDS A;  3RPU D;  1YIJ I;  3MZH A;  1ZR4 A;  3N05 A;  4L9T A;  2DFH A;  3CUO A;  1HST A;  4KYW A;  5E1Z B;  2JSP A;  3K6G A;  2VOO A;  1X58 A;  4YII A;  3OYA A;  5H6Q A;  5IYD J;  1OCC H;  2UV1 A;  4EJV A;  2Q8K A;  3TQN A;  2IGN A;  3HPH A;  1FIA A;  3DEW A;  2WV1 A;  2HQN A;  2E1C A;  1VTN C;  2E1M C;  4ZJZ A;  5DUI A;  2A3S A;  1R1T A;  2HYG D;  4G7O F;  3JAM K;  3O3K A;  2F4O B;  3WOD F;  1J59 A;  4A3G J;  4ZYD A;  5HS9 A;  1KU3 A;  1RZ4 A;  3UKG A;  2JA8 J;  2NVX J;  4N4O B;  3HB9 A;  3MKZ A;  3MQ0 A;  4XSZ F;  2PJR B;  2GXG A;  3LWF A;  5DCF A;  3CC4 I;  4DYC A;  3KZZ A;  1ETY A;  5DM6 F;  2GXA A;  1IN8 A;  3ERM A;  2DOA A;  4AYB A;  4Z2Y A;  1BC7 C;  2OTL I;  1A04 A;  2EFQ A;  1IW7 F;  4WF2 A;  1JTX A;  1EJ9 A;  4HF2 A;  1EKE A;  5CQE A;  3OWT A;  5J4Y A;  4HSR A;  5LHI A;  4IHV A;  2HQ5 A;  4NHJ A;  1H0M A;  2KIF A;  1AWC A;  5FKO A;  2FBK A;  1ETQ A;  1Z6R A;  3JTH A;  4LIV A;  5GAE J;  2OZ6 A;  4PSW A;  1R22 A;  5FKM A;  2X0L A;  2JT1 A;  3M1E A;  3TW6 A;  4J01 A;  4A3J J;  4BNC A;  3AL0 B;  1UFM A;  2KFD A;  2VN2 A;  5LGU A;  2E5N A;  4LMY A;  5CQG A;  4RGU A;  3MAJ A;  3BLY A;  2RVC A;  3IAS 2;  2V1U A;  2Y9Y A;  4JOM A;  3U9G A;  2V6E A;  2ECC A;  3HOS A;  3ESW B;  2RNG A;  4C3H J;  2DT6 A;  4G6T B;  2XSJ C;  3D5R C;  1XSX A;  1DGW Y;  1VQ4 I;  3W3C A;  2L9N A;  2DA1 A;  1S7A A;  2DJI A;  2V1X A;  2XKO A;  3KPH A;  4A6E A;  2CYY A;  2LY9 A;  2QBY B;  3A01 A;  2GOM A;  3M07 A;  4IXA A;  2DA4 A;  3S2D J;  3HOX J;  3A2K A;  1FSE A;  1BN5 A;  3ZQQ A;  2X6X A;  3AKZ A;  1E2X A;  1IRG A;  1T56 A;  3RPQ A;  2ZBK A;  1P7J A;  2HXI A;  4I7H A;  1OIS A;  5K1Y A;  4EMS A;  1IXC A;  2X9D A;  2ZME C;  4E6K G;  1WI9 A;  2HI3 A;  2VXZ A;  3PSI A;  1IGN A;  2DFI A;  2QZ8 A;  2TRT A;  1TQM A;  5E79 C;  4X0G A;  1HA8 A;  5HS8 A;  1FPQ A;  4DJA A;  1FBU A;  4RLQ A;  3JRB A;  4J19 A;  2QCO A;  4MQ9 F;  3SDB A;  3EQL F;  2CO5 A;  2LDU A;  3WU0 A;  3CCJ I;  2BZT A;  2BY0 A;  4II2 A;  1X2M A;  5FKN A;  3ABK H;  1GHC A;  4PK4 A;  1AKH B;  2H6B A;  3VWB A;  5BNG A;  1B72 A;  1FJL A;  1HKT A;  1YLF A;  3K4L A;  2YU3 A;  2Z5U A;  2KIM A;  4ON0 A;  4IHY A;  4I98 B;  2JA5 J;  2L4M A;  1FMW A;  1WPK A;  2G0E A;  1J2X A;  3VYS B;  2XRO A;  4D7M A;  1RC9 A;  1RUO A;  2OD5 A;  1U8B A;  3GZN B;  3S15 J;  3G2B A;  1K79 A;  3PSF A;  4B48 A;  2AHQ A;  3A02 A;  2A69 F;  2ZJQ F;  1B6A A;  3L2U A;  2VC1 A;  1ZR2 A;  3FHZ A;  5E8G A;  3HOT A;  2R5Z A;  2LD5 A;  2PI0 A;  4AD9 A;  1DU6 A;  3MKL A;  3S1R J;  2YSR A;  4DQ2 A;  1R1U A;  2OAZ A;  2Q2E A;  3T0Y A;  4IHS A;  2ID6 A;  1ZAO A;  3PNV A;  3QP6 A;  5LHH A;  5IP9 J;  3GWZ A;  4IQ4 A;  3TDU C;  5IY5 H;  4A0Z A;  1TW2 A;  1BC8 C;  1HDP A;  4CH7 A;  3RKX A;  3BG7 A;  3T1B A;  5D5V B;  2E1O A;  3FHN A;  1BW6 A;  4RGX A;  3ABT A;  2L0K A;  2V26 A;  3ROU A;  1Z9C A;  3K1M A;  5DD4 A;  5LRS A;  5FGM A;  4E7K A;  1EV7 A;  5ICE A;  2VJJ A;  3LSG A;  2KIS A;  1YJ9 I;  3RYP A;  2NYX A;  1MDM A;  2JQ7 A;  1OJL A;  1PUF B;  2HOT A;  4IRH A;  2E1M B;  4PDK A;  4XL9 A;  5E3O A;  1R71 A;  1Z3Y A;  2L02 A;  4IKF A;  2PJR A;  5J40 A;  3WTS C;  1GDT A;  2JUC A;  5KVR A;  3JRE A;  2R5Y B;  2PFB A;  3ZMD A;  1HDD C;  3LFU A;  2ELH A;  3Q9V A;  3WU1 B;  3CTA A;  1C0W A;  1TWH J;  3J80 Z;  3FZV A;  3I4M J;  2KZG A;  1R5H A;  3H5N A;  4KUM A;  4XRS G;  3K4M A;  3IH4 A;  1ACI A;  5HLG A;  1XSV A;  2LRE A;  2GM4 A;  2L9V A;  3GLL A;  3GUD A;  1D5V A;  1HBX G;  5D5X B;  1XPX A;  1BIB A;  1XGM A;  3DKY A;  4BE0 A;  4FHT A;  1ZQ3 P;  2IJL A;  1FOX A;  2KPM A;  3OYI A;  1X4P A;  2XB0 X;  2L54 A;  1U8R A;  2J5O A;  5LLQ A;  3I55 I;  4I76 A;  2B0L A;  1QNT A;  3PIO F;  4UUV A;  1Y6I A;  2K85 A;  3DQV C;  2W85 A;  1IV6 A;  3HTU A;  2ZC2 A;  3G1M A;  1LB2 A;  1LE8 A;  2QSG X;  2XF5 A;  3WU2 C;  1PDN C;  2HTS A;  2I5U A;  4A3D J;  2XPW A;  2LYC A;  2X1D A;  4F55 A;  3I53 A;  1R4N B;  1VND A;  1HXD A;  3ZRG A;  2XAS A;  1ZG5 A;  3MMY B;  2XAQ A;  4LFU A;  4KNY A;  2BBY A;  4IJA A;  2QA4 I;  3M4O J;  3TOA A;  4B3A A;  3ASN H;  1FNN A;  5IT9 Z;  4M71 A;  5E8I A;  2XAH A;  2JN6 A;  3M1C A;  2FML A;  3NWS A;  3QOP A;  4XOR A;  1PVE A;  5CVI A;  3LNQ A;  1JE8 A;  2O0Y A;  1R23 A;  2OCE A;  4L5I A;  4HNU A;  2JVH A;  1TT5 B;  2A5Y B;  1L3L A;  4FT8 A;  1H9G A;  1USS A;  1QRY A;  2DPD A;  1D8K A;  3C2H A;  4BY1 J;  4CGZ A;  4ZC3 A;  3TOB A;  3OIQ A;  1QVT A;  2B9S A;  3RPU A;  1DU0 A;  2PLY A;  5JLX A;  2JRT A;  5D5U B;  3ZN1 A;  3CCR I;  4XRF A;  2M5W A;  3E97 A;  3ZMV A;  4L9N A;  2D5V A;  2CW7 A;  5IP6 A;  3A0B C;  2GXB A;  4ENM A;  4B3X A;  3BG6 A;  1YRN B;  3SHF A;  2DTR A;  1BA5 A;  3FK7 A;  3FXM A;  5E20 A;  2VJ4 A;  1YTY A;  1G3W A;  5K5Q A;  2LG4 A;  1W4M A;  3M8E A;  5L3E A;  4XBF A;  1SFK A;  4ITV A;  2QUF A;  1B8I A;  1UEL B;  1YOV B;  3CCV I;  3HOY J;  2ETH A;  4QTR A;  1IN7 A;  3K4B A;  3HRT A;  3UNG C;  1RR7 A;  4HZF A;  1U3E M;  3KP6 A;  3LST A;  5GPC A;  1GXP A;  3E7L A;  3K7A J;  2LH9 A;  1U0J A;  3I54 A;  1MKM A;  3KEY A;  1IN6 A;  2M30 A;  1BW5 A;  1HKS A;  2DLL A;  5J47 A;  4C2T A;  3H9J A;  1TWF J;  2XF7 A;  4QWQ A;  3J7A O;  2BY3 A;  3P7N A;  2DBB A;  1IRX A;  2K9S A;  2N8G A;  3K2A A;  4XID A;  2DA6 A;  4DNC A;  3ZXS A;  4GDF A;  1U6G A;  2ZFU A;  1TTY A;  3QPS A;  1JUP A;  1BM9 A;  4U7B A;  3H35 A;  2YU9 J;  1LKX A;  4HBL A;  3BCA A;  2O61 A;  3LA7 A;  4EJW A;  4EGY A;  3BQZ A;  2WC2 A;  4GYG A;  1I6X A;  2VKV A;  2C6Y A;  3KZY A;  2KIQ A;  4IF4 A;  1B1B A;  3EUH A;  4RB2 C;  2FBH A;  2LF7 A;  2K4J A;  3C3W A;  4MGR A;  2OU2 A;  1WJF A;  4BU2 A;  1VQM I;  3H5R A;  4OU0 A;  1YYV A;  5GAH J;  3AG1 H;  4BE1 A;  1ZG1 A;  1T39 A;  3VYR B;  4B4C A;  1WZ2 A;  4CCK A;  1GVD A;  1OYI A;  3EDP A;  2DT7 B;  3JAM Z;  2HYJ A;  3GTM J;  1F43 A;  3B6A A;  2FQ4 A;  4P96 A;  3S1N J;  4BBR J;  1I3Q J;  5GP9 A;  4C3I J;  3ZMU A;  3J81 K;  1U5T B;  1XSD A;  2F4M B;  2WAD A;  2ELK A;  2HPI A;  2M0M A;  4RGS A;  2V1D A;  3V42 A;  3DKX A;  1BR4 A;  3BJ6 A;  3FXL A;  3I56 I;  4LG3 A;  3TED A;  1VQ6 I;  4NC7 A;  3SZT A;  4R1H A;  3TKY A;  2CU7 A;  2QKM B;  3MD2 A;  3ZPL A;  2QQB A;  3QAH A;  1X3W B;  5ILS A;  3ZQH A;  3K4J A;  4FCY A;  2XVC A;  3LSR A;  2R7S A;  3B73 A;  1XX5 A;  3GLX A;  2WAF A;  1E0E A;  2FF4 A;  3WGH A;  4XLP F;  2BE5 F;  2R5Z B;  2MG4 A;  2QM3 A;  4AUX A;  3IWF A;  3QP5 A;  1QVU A;  5CVV A;  2AS5 F;  4M9X A;  4OAZ A;  5K5O A;  4UXN A;  2CQQ A;  2M4K A;  2DFE A;  4ZYE A;  4YEL A;  4NB5 A;  3CZ6 A;  4XLA A;  2VBX A;  3OS2 A;  1JJ8 C;  3FMS A;  1B9M A;  2QEX I;  3O6B B;  4UVB A;  4JX5 A;  2OC6 A;  3L2V A;  3GFL A;  4OIR F;  1UHW A;  5DEQ A;  3CUQ C;  2W24 A;  2FD5 A;  3TMO A;  1AA7 A;  2W4S A;  1BI1 A;  2AQE A;  2DDA A;  2JVG A;  2PMZ N;  4KT6 A;  3HKZ N;  1WWX A;  3PUF A;  4QLC U;  1HLV A;  3GW2 A;  1OKR A;  2E36 A;  2DOD A;  3Q9S A;  2PMZ A;  3HOU J;  5BOX A;  3VOE A;  2HXO A;  1OCZ H;  1APL C;  2LC2 A;  5EEA A;  4HDV A;  1PP7 U;  1QBJ A;  2LY2 A;  1XG1 A;  2K27 A;  3A4C A;  5FD6 A;  1MSF C;  4BUP A;  3FMQ A;  1RKT A;  4FX4 A;  2O9L A;  4R79 A;  4CZZ A;  4EM2 A;  1X1C A;  1SFU A;  5ICC A;  2E2I J;  2MH2 A;  2ZB9 A;  3W2A A;  3ZQC A;  4MEY F;  3S8P A;  4BAC A;  3DTE A;  3GF2 A;  2MYS A;  5DS9 A;  4RMN A;  4O3M A;  2CRG A;  1HCR A;  1XMK A;  4AIH A;  5F0F A;  4YG2 F;  3RKW A;  5E3M A;  4IOA F;  4ZDL A;  3BR3 A;  1T6S A;  4DZJ A;  2JPC A;  3A01 B;  2ZSH B;  3W2V A;  3K9T A;  1GLN A;  4HV6 A;  2V9V A;  2KRH A;  3O2P E;  2VQL A;  5BPD A;  2W84 A;  2XAU A;  2E71 A;  3IKV A;  4KIG A;  3E6C C;  3U2R A;  1MD0 A;  1Y0N A;  4UVC A;  5GAD J;  4RAG A;  4CYD A;  5HLT A;  2CW8 A;  2EFW A;  1FMV A;  4Q5S F;  4FE7 A;  4IO9 F;  1IUF A;  2QQ9 A;  5L3D A;  1A6Q A;  1MBH A;  5C4X J;  3H3U A;  1ZYR F;  2VOP A;  1VZ0 A;  2R4G A;  1BOA A;  4XLN F;  4WXH A;  5AIP A;  1TZL A;  3C1D A;  3HUG A;  1TLH B;  3VYU B;  4YFX F;  2CV2 A;  5E3L A;  4BHB A;  1QPI A;  1QZE A;  1FTT A;  4U0W A;  1XCV A;  2VB6 A;  2K3P A;  1TW3 A;  1P6R A;  2BV6 A;  2VI6 A;  4XMY A;  3OYK A;  3M3Y J;  1U5T C;  2QF7 A;  1I5Z A;  4QPQ A;  2MFZ A;  3I0T A;  3VDX A;  4BDZ A;  4WX9 A;  3EUK L;  3L2R A;  2F5D A;  3NEU A;  3Q0V A;  1YX3 A;  1FX7 A;  4L9V A;  3VOD A;  3ISP A;  1JGS A;  4IRI A;  1JKR C;  2IA0 A;  4IHX A;  2CSO A;  1LQ1 A;  1F4K A;  2KJB A;  4M3G A;  3LSP A;  1ZGW A;  1H88 C;  3SFZ A;  1V5F A;  5DM7 F;  3DP7 A;  2DYR H;  2O6G E;  4MTD A;  1MBJ A;  1V54 H;  5IOZ A;  3OIO A;  4CCN A;  1HSJ A;  2VBW A;  4XON A;  1BR2 A;  3ABL H;  2UXN A;  2VC0 A;  1TNS A;  1SFO J;  4LGW A;  1DP3 A;  2KDZ A;  1T0F C;  2K02 A;  2JTV A;  3S32 A;  3J81 Z;  4LJZ F;  1A35 A;  2HVS A;  2LKP A;  1U2W A;  2ZME B;  2FEZ A;  1MMA A;  1ZEL A;  3AG4 H;  1JKQ C;  4C9Y A;  1DGR M;  4G94 A;  3VFZ A;  1J75 A;  2PEX A;  2P4W A;  3QU6 A;  4ANJ A;  3G3Z A;  4FIS A;  3PL8 A;  2DOE A;  3KX2 A;  1FT9 A;  2ZXJ A;  5EGO B;  5KNL A;  4BQA A;  3HOZ J;  2HVQ A;  4IHT A;  3CUQ B;  2JPB A;  4BXU A;  2YX7 A;  3FXQ A;  4MFE A;  3GCM A;  3FM3 A;  4M6X A;  1LE8 B;  1ZAR A;  2DW4 A;  2Z16 A;  1O3R A;  3HSE A;  1B72 B;  1YS7 A;  5A2Q K;  2RQP A;  1H9T A;  1S9H A;  2GA2 A;  3HXL A;  4HAM A;  1NG7 A;  2GOX B;  4Y7N J;  2HVR A;  2NS7 A;  2VQG A;  2E35 A;  2R5Y A;  3PQJ A;  3SQN A;  5E1X A;  2M9H A;  3K4C A;  3JR9 A;  1MIJ A;  3U1K A;  4BQQ A;  3QYB A;  3KYC B;  3AFH A;  4ENJ A;  1I1S A;  3IV5 A;  1PYV A;  3RKQ A;  4HST A;  4XNF A;  1R6R A;  2RDP A;  4BJT A;  3LSH A;  1X1P A;  3C2B A;  4FET A;  3BZ6 A;  3JCU C;  2X6O A;  2IAI A;  4R8H A;  2FOK A;  4PGG A;  4MHG A;  5EG0 B;  3QYE A;  1W7P B;  3NAR A;  3GEZ A;  4KIT B;  1G3T A;  2GWR A;  1S6L A;  2ZCW A;  3LOC A;  3BTJ A;  5M5Y J;  2Y69 H;  2Y2Z A;  3HTS B;  4A3K J;  2EB7 A;  4A69 C;  3AL0 C;  3J7Z I;  2L5Q A;  2MH9 A;  3F8M A;  1W5C C;  2W1O A;  1J0R A;  2JWT A;  2MA3 A;  3ZQI A;  2R7T A;  4KJZ A;  5FLX Z;  1WJC A;  1IV8 A;  4Q4Z F;  4X6A J;  3B6C A;  4N0B A;  3A0H C;  2LBF B;  2KHM A;  4RM2 A;  5A2Q Z;  1REP C;  2VPR A;  4HQM A;  3DBH B;  2LK2 A;  5DYM A;  3WTT C;  3E5Q A;  1S8N A;  2L3D A;  3TO6 A;  2A5W A;  1L0O C;  3FXU A;  3BG3 A;  2Y0S A;  4YFK F;  1JXS A;  2W48 A;  4E7I A;  1BBY A;  2K40 A;  4GO1 A;  2HOA A;  2CQ7 A;  3G1L A;  2Y0S N;  3CCU I;  1A31 A;  1LDJ A;  2VL8 A;  4RB3 C;  2L7F P;  3RZD J;  2BY1 A;  3W6J B;  3BQY A;  3CCM I;  2Q1Z B;  4JP0 A;  5C44 J;  3JSO A;  2LY1 A;  1VQ7 I;  1D5Y A;  2P0W A;  2NNY A;  1XC5 A;  1V5G A;  2RN7 A;  4YRV A;  5M5W J;  4HV5 A;  1X3Z B;  4RAF A;  2ZSI B;  5CPR B;  4OAY A;  2HGC A;  1GT0 C;  1V3F A;  1W5S A;  2OQG A;  4I0A A;  4E7Z A;  4U88 A;  2R7Z J;  2X85 A;  1IAW A;  2O5R A;  4HW0 A;  2EA2 A;  1IF1 A;  4U7D A;  5LHG A;  2VXD A;  2R7X A;  2DI3 A;  3I59 B;  4C30 A;  1FYL A;  1F5T A;  2RRE A;  3SZP A;  2XKP A;  1Z7U A;  4WCG A;  3F21 A;  2CQK A;  4EGZ A;  1ZRC A;  3OYF A;  2A68 F;  1UB9 A;  1MMS A;  2KJC A;  2HYF A;  4MIM A;  1B8I B;  2DK8 A;  2V79 A;  2LOO A;  5FRM A;  2WA0 A;  1AU7 A;  1P4W A;  4F7Z A;  4Y17 A;  1LVK A;  3FXK A;  2DU9 A;  2EJR A;  3RQ4 A;  2LR8 A;  3FXJ A;  4BAY A;  3BTL A;  4DZP A;  1H89 C;  2IXS A;  1LVA A;  2L7M P;  1U78 A;  5FKL A;  3P9K A;  2KRC A;  4E7L A;  2VIX A;  3H9G A;  3J7A Y;  1T0F A;  4BBS J;  2IA2 A;  1AOY A;  3LFK A;  1UAA A;  3I3L A;  1MJ9 A;  4IL6 C;  3IHU A;  4UHT A;  1JUM A;  5HOO A;  1IC8 A;  3QWL A;  4PUS A;  2FE3 A;  4AVP A;  4PGH A;  4RGR A;  1KQ0 A;  1P9Q C;  1YO5 C;  1YS6 A;  3E6D A;  1DP7 P;  1UCR A;  4F93 B;  2D1V A;  4DYQ A;  2DDB A;  4CDG A;  2HU9 A;  3GTL J;  3I59 A;  3S2H J;  2X1C A;  2R7F A;  2PJP A;  3BR2 A;  1CF7 A;  2ZJ2 A;  3MCZ A;  1TWG J;  1UG2 A;  5D6F A;  1ETK A;  4EJO A;  4Y15 A;  3VSL A;  4HNT A;  1ZRD A;  1Y1V J;  3COA C;  2CUF A;  1VQK I;  3BZC A;  1P2F A;  4OOI A;  2A6H F;  2R7R A;  1MMN A;  3TP3 A;  2P7V B;  1GV5 A;  1LPQ A;  1E3H A;  3RZO J;  2HFH A;  3I4P A;  1W7P D;  3DBL B;  2L9R A;  1B9N A;  4N9H A;  3TBI A;  1EH7 A;  2Q2E B;  1WJD A;  3VPR A;  1SVL A;  2PX9 A;  3E0J B;  5TRD A;  4NQW A;  4LB5 A;  1D1A A;  3CF2 A;  4OIP F;  4A0Y A;  1XMA A;  2WV0 A;  4II3 A;  3R6S A;  3G73 A;  4J00 A;  3ECH A;  2UWM A;  1ETX A;  3KZI C;  3F3X A;  1UMQ A;  1X4O A;  3WE3 A;  1EH8 A;  2BW3 B;  3CES A;  1KZH A;  1S7E A;  2DPU A;  2NS0 A;  2P7C B;  4BKX A;  2J5P A;  5JR3 A;  3LAJ A;  3FDY A;  1VQ9 I;  2EIN H;  4XOT A;  3C18 A;  1RKW A;  1SVM A;  5B1B H;  2DK5 A;  3D0S A;  2EFO A;  1LEB A;  4BYY A;  3DPT A;  5DDG A;  5KAI C;  5HDN A;  5FLX K;  1ETV A;  4RB1 A;  1P7I A;  3I9V 2;  4W1U A;  3SDG A;  1LDD A;  2XGX A;  2ZFW A;  4XN0 A;  2H6C A;  2K9Q A;  3WTW C;  1ZH5 A;  4IQJ A;  3CDI A;  1ETO A;  3EYI A;  2CV0 A;  5HDK A;  2EQR A;  4HLY A;  1MH3 A;  1ZLJ A;  5K7H A;  1IN4 A;  3WTY C;  1F36 A;  4YEJ A;  1KA8 A;  2VE9 A;  4A3M J;  4XR6 A;  2ISY A;  3K70 C;  4AIJ A;  2G7U A;  4DIQ A;  5D6E A;  3CCL I;  4KFC A;  2DJN A;  3ULQ B;  4FE4 A;  1TWA J;  3SFI A;  3CQZ J;  4F91 B;  3GFM A;  3I58 A;  4CCL A;  1LFP A;  2XAF A;  1WJA A;  1FLI A;  1Z77 A;  4JBA A;  3H9Q A;  2XF6 A;  1TBX A;  3P9C A;  1HF0 A;  1V4R A;  4HPQ A;  2FXA A;  1R1V A;  4IRG A;  2VKD A;  1R4M B;  2XV4 S;  3KCC A;  1SMY F;  4O6J A;  3D5S C;  2ACJ A;  2G7H A;  4G6Q A;  3G71 I;  1DUX C;  2K86 A;  5ILV A;  4XLC A;  1Y39 A;  1IXS B;  4CUG A;  5BPI A;  3T8T A;  2R7O A;  3KP4 A;  4GXO A;  1K61 A;  2OUM A;  1WJE A;  5F04 A;  2R0Q C;  4XRS A;  4Y4R A;  3FBN B;  3CP8 A;  4B8X A;  3T5X A;  1O3S A;  2A6T A;  4L5E A;  2EIJ H;  3BJA A;  4B43 A;  3BR0 A;  1WCM J;  2COB A;  3EUH C;  2EPF A;  4JQF A;  2A05 A;  2BW3 A;  5M3F J;  2OQR A; 
#chains in the Genus database with same CATH homology
 3ASO H;  2Y69 H;  2EIL H;  3AG3 H;  5IY5 H;  1OCO H;  2EIN H;  3AG1 H;  1OCR H;  2DYR H;  2OCC H;  1V54 H;  3X2Q H;  5B1A H;  5B1B H;  1OCC H;  3ABM H;  2EIK H;  3ABK H;  3ABL H;  3WG7 H;  3ASN H;  2EIM H;  2EIJ H;  3AG2 H;  1V55 H;  3AG4 H;  2ZXW H;  2DYS H;  5B3S H;  1OCZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...