1I39A

Rnase hii from archaeoglobus fulgidus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i39A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i39A01
3IRXA 2HVHA 4DMNA 3OYAA 5KI6A 3F9KA 1VK0A 3LAKA 4KTWA 4PA1A 3L2WA 2JLEA 1IKWA 1TL1A 2BE2A 3HYFA 4XIUA 4OLBA 1C0MA 2IAJA 1U04A 3VQEA 3LWLA 4KFBA 4JRQA 1Q9XA 1EP4A 2DTUA 1CXUA 3DLHA 2RPIA 4CJKA 4FXDA 3VQ4A 3TAPA 1DLOA 4FLTA 3ZT1A 4Z4EA 3LWMA 4LH4A 4DQSA 1D5AA 3DM2A 1ASUA 1FK9A 4HTUA 4IBNA 4E1NA 2XO7A 3ZT3A 3L2VA 4E3SA 4CJSA 4FLVA 3IS9A 3NF8A 3U6FA 4AH9A 3K57A 2HHXA 3KLFA 1B9FA 4HCCA 1NK8A 3MECA 1WAJA 2HNZA 2NUBA 2YNIA 4OKJA 3VQDA 2YV0X 5C24A 3OYEA 2PY5A 3NE6A 1TAQA 1W9HA 4CJLA 1TK8A 4CK1A 4CF2A 3OYKA 3LZIA 1QS4A 1B92A 1D9FA 2HHUA 1NJZA 4CJ5A 1X9WA 3O4NA 3ZSXA 4FM0A 3PX4A 4E0DA 1LV5A 2OPPA 4CE9A 5J2NA 3HXMA 3V9SA 2BGGA 4EP4A 3ULDA 3PX6A 5C25A 1S9EA 1RDCA 1C1AA 3AA2A 3NF6A 4IFYA 1NOZA 4FM2A 3OYMA 1VSFA 4CJRA 4OVLA 3NAEA 3MXMA 1SKSA 4C8MA 3OYBA 4FJJA 1JKHA 2X78A 4DWIA 4KREA 2OPRA 3KKSA 4KTQA 1DTQA 1QTMA 3AVFA 4FJMA 4CEEA 1XWLA 3T1AA 1BISA 1GOBA 3KK2A 5HLFA 4FJLA 4M3ZA 1RT4A 1VRTA 3DLGA 3AVJA 1RTDA 2D0BA 4B9LA 1LWFA 4N47A 2P5GA 4HUFA 1NK0A 2Z1HA 1ZBLA 3CM6A 4H4MA 1IG9A 4I2PA 1SV5A 3C6TA 4B9TA 2Q3SA 2IDOA 3NGIA 4DFJA 2EHGA 2X6NA 3I0SA 1QSYA 4AHUA 1ZYQA 3HT3A 4E89A 4Z4HA 2GBZA 2XY5A 4AHVA 1ZBHA 3LPTA 1IH7A 4DS4A 1LWCA 3RMDA 1BCOA 1WAFA 2X6SA 2YKNA 1RDDA 4FK0A 3DLKA 4E7LA 4CGFA 1NKBA 1SKWA 3QEWA 4DQPA 1I3AA 1VRUA 3G0ZA 2D5RA 3PO5A 4E7HA 4KB0A 4RW6A 3RMBA 4YNQA 1XHZA 4FK4A 4CHNA 4CJFA 4NCAA 4M3YA 1RCHA 2RKIA 2HB5A 3MEGA 4W5RA 1LWEA 4CEQA 4LY7A 4C8NA 4Z4CA 3K58A 3SCXA 1ITGA 5HRRA 4CFDA 3SV3A 1ZBFA 1NK4A 2ZE2A 3SQ1A 4F3TA 3KD1E 3PY8A 4M3WA 3RMCA 3TANA 5E41A 2Y1IA 3ZSOA 1SL1A 1REVA 1SL2A 1S1VA 1SUQA 4ELUA 3M8PA 4DU4A 4DFKA 3NH2A 4CEDA 4OPKA 3EZ5A 4HHTA 1VSJA 4DSLA 4OKKA 4LH5A 1RT3A 2VG5A 2VWKA 3OS0A 3AVKA 2OZMA 4ELVA 3CYMA 1NOYA 3PUFA 2OPQA 3ITHA 3QEVA 3E01A 3QNOA 2FBYA 1T7PA 1NJWA 4B9SA 1WSFA 4CJPA 4ZTJA 4J2DA 2P51A 4DTNA 3C95A 5FDLA 1NKCA 4NYFA 5CY4A 2GV9A 3OYFA 4CHPA 4PQUA 5JS2A 1HYSA 3HL8A 1L3SA 4FK2A 4C8OA 4DF4A 2XY6A 3HVRA 2B6AA 1S1XA 3AVBA 3NGYA 3QLHA 4I7FA 4HCBA 4KHUA 4FJKA 1ASWA 3B6OA 4FVMA 3AO4A 3MAQA 1X9SA 2I5JA 4KI6A 2E4LA 1U45A 1KVCA 1SL0A 1UWBA 4IG3A 4N5SA 3TAMA 3DMJA 4FLWA 4BACA 1C1CA 2RF2A 1IO2A 3QNNA 2A1RA 4L8RB 1VSEA 2ZD1A 2FC0A 4M3XA 2HHVA 1X9MA 3OYLA 3AVGA 4Z4GA 1JL2A 1WSEA 1FKOA 4LD0A 3SI6A 4QAGA 4CF0A 2F8SA 3V9UA 1CZ9A 4DTPA 1RNHA 2HNDA 3ZT4A 5HBMA 3KLGA 5EU7A 1KSPA 4N76A 1JXEA 1KFDA 1VSDA 3AO3A 4HVJA 1J53A 4DSFA 1NK5A 1RBRA 4CCHA 3V1OA 4BDPA 1L3VA 1JL1A 1BQMA 1TGOA 4CF8A 2XHBA 1UA0A 3KKRA 3RWUA 4FZYA 1RILA 1L5UA 4Z4IA 4FZZA 3WNEA 1QHTA 3K5MA 3CFOA 3TAFA 4LSNA 1IKVA 2E6MA 4E19A 4E7IA 2G8KA 1Q9YA 2YHAA 2HHTA 5DMRA 4DLGA 1T03A 3OJSA 1C0UA 3ISNC 3OYGA 3P83D 4Y1DA 2ETJA 3JSMA 3DOKA 4J2BA 1Z26A 1KVBA 4Q0BA 4CGGA 1J9AA 1U48A 4CECA 1Y97A 1YT3A 4CJWA 4J2AA 1VSLA 1N6QA 4DTJA 1JLFA 3I0RA 4CGDA 3HPOA 5KTQA 1JLGA 4E1MA 1WSGA 4JS5A 3OVNA 1UOCA 3CFRA 3NF7A 3SPYA 4QOZB 1BGXT 4B08A 1QSSA 2WONA 4O0IA 4CHZA 1KCFA 1NKEA 2G8WA 3PO4A 3VQ6A 3M8SA 4CK3A 3QETA 1NJXA 2Z1GA 3VQQA 2Z1IA 3OS1A 4KAZA 3I8DA 4KHWA 1O1WA 2IS3A 3KLEA 4DU3A 3V4IA 2BDPA 1WSHA 3ZSZA 3CFPA 2QKBA 4ZTFA 1T8EA 2HNYA 2OYQA 1BCMA 3DLRA 4FYDA 1VSMA 3NBPA 1N5YA 2HHQA 4H8KA 1QSLA 3D45A 3L3UA 1Z25A 1RTIA 3LP2A 4QCLA 2YNHA 3LZJA 4DTSA 3KTQA 4WE1A 3PV8A 3K5OA 3IAYA 1I39A 2G8FA 2O4IA 2AJQA 4BE2A 3C6UA 1YVUA 3HM9A 4HUGA 3MXJA 3O4QA 4BE0A 3WNHA 4ICLA 4F4KA 2ATQA 1S1WA 5K14A 1KLNA 4KKOA 2KQ2A 3S3MA 1ZBIA 4BE1A 4CEAA 3NGZA 4CK2A 4ID1A 4O4GA 3BDPA 3TAGA 3HSTB 3SYZA 4FCYA 3SUPA 5FROA 3NF9A 2DFHA 3S3NA 4W5OA 3OYCA 4DS5A 1XI1A 3QIPA 2YNFA 3LDSA 3THVA 4C8LA 4IG0A 1RT7A 3AVCA 1YTAA 4LSLA 1VSHA 4CERA 4CFBA 3T3FA 1D9DA 4NCBA 4CJEA 3EYZA 3LPUA 2HW3A 4JS4A 1K6YA 4DSIA 3VQCA 1MU2A 3RTVA 1LW0A 3QIOA 4ELTA 2D0CA 1HNVA 3DI6A 4PY5A 4DTUA 5J1EA 5DK5A 4CEBA 5SZTA 4FJ5A 3IG1A 3HPHA 4TSXA 4CHYA 3C94A 3SNNA 4CFCA 3SQ2A 2PZSA 2IGIA 1QE1A 3VN5A 3VA3A 4BDZA 3P5JA 1KVAA 1TK5A 3CM5A 1ZBUA 3F73A 3TAEA 1RBTA 3KIOA 1WN7A 4W5QA 1D8YA 1TK0A 3L3VA 1TKTA 4OLAA 3HO1A 1TL3A 1JLQA 1KRPA 5KRTA 1C1BA 3K5LA 5FRNA 3U3YA 4F3OA 4M3TA 1CLQA 5KRSA 3DRSA 1RTJA 4H4OA 4KRFA 3OJUA 2P1JA 1IKXA 4AHRA 1IKYA 3KK3A 5HRSA 5D3GA 1TAUA 1BQNA 1KLMA 1EXQA 3DOLA 1QQCA 4GW6A 2B4JA 4AHTA 3L8BA 4FLUA 1U4BA 1TKXA 3MEEA 1HJRA 1WSJA 1RT5A 3AV9A 3PX0A 3LANA 5KGXA 3SV4A 4CGHA 2G8HA 4F8RA 2YKMA 4R5PA 3MXIA 1L3UA 2OZSA 5HRNA 4B9MA 3V1RA 3P1GA 3OYDA 1BIZA 1LAWA 1W0HA 4M41A 3V9WA 3S9HA 4MQ3A 5HP1A 3WNGA 3TARA 2PYLA 3LP1A 2HHWA 4W5NA 2F96A 4BDYA 2GUIA 4M45A 5SWMA 3OYHA 1Q8IA 4FJ7A 1RT6A 3NDKA 3VA0A 2G8VA 3AVAA 1NK7A 2PYJA 5CZ2A 4DLEA 1NK6A 1C6VA 3KJVA 4CJ4A 1S1UA 4RW7A 4KHSA 4CIGA 4CIEA 3M8QA 4OGEA 3VQPA 4CESA 4CEOA 4CHQA 1YTUA 3AA5X 4RW8A 1A5XA 3LP3A 3T19A 3KK1A 1LAVA 1RTHA 4DQRA 3O3FA 3RMAA 3AVNA 3L2RA 1FXXA 3G10A 4KHYA 3HJFA 4DSKA 3TAQA 3OY9A 1HQEA 2YHBA 3ZSVA 4E7KA 4DSEA 3CG7A 3BGRA 4OKEA 4CF9A 4I9LA 3ZCMA 2IC3A 1S9GA 4OGCA 3AVHA 2XY7A 5KGWA 4FJHA 4KB1A 1GOAA 1BI4B 3KLIA 1JXBA 4KO0A 3L2QA 4K8ZA 4OJRA 4JRPA 2W42A 3K59A 1U49A 1SKRA 1TV6A 4CIFA 1UAXA 4DFPA 1HPZA 5FRMA 3MEDA 3VQAA 4PWDA 5CYQA 2YNGA 2ZQBA 3TR8A 1XHXA 4DF8A 2IOCA 1TVRA 1HQUA 2KW4A 1KTQA 3ALYA 1EX4A 2Z1JA 4CJ3A 1WLJA 1RT1A 1VSIA 2HHSA 5J2MA 1S6QA 2A1SA 3V6DA 1S5JA 4N56A 3M8RA 5J2PA 4B9VA 3AO5A 3AVMA 4W5TA 3DLBA 1FKPA 4FLXA 1X1PA 3AO1A 5C42A 4RW4A 5CZ1A 3ZT2A 3HP9A 1RBVA 4EZ9A 4DFMA 4RW9A 2R7YA 1HYZA 3HP6A 3O3HA 4B3OA 1EKEA 4FW2A 2QK9A 1G15A 4Z0UA 4AHSA 4B8CA 4HUEA 3O3GA 3RR7A 3OYIA 3RRHA 2P5OA 3SQ0A 3SPZA 4DTXA 4DSJA 4CGJA 4KHQA 4AILC 3VQ5A 4AHCA 4K8XA 3ZSQA 1ASVA 4JLHA 3DLEA 3WNFA 3OYNA 3HVTA 4CEFA 2F8TA 4UQGA 2G8IA 4MFBA 3VQ8A 3RR8A 1HNIA 3AA4A 2D0AA 1U47A 2KFNA 1LW2A 3NH0A 4NCGA 3VQ7A 4B9NA 4FLZA 2OA8A 1HMVA 2FBTA 4CF1A 3K2PA 3JYTA 4E7JA 3QEXA 3KD5E 1JLBA 3KLHA 3SUOA 1RBUA 4CFAA 1J54A 3ZSWA 1L3TA 4OPJA 2HVIA 1NK9A 3L2UA 2XY8A 4IKFA 2B5JA 3V9XA 1JLAA 3QERA 4DQIA 4O5BA 3A2FA 3QESA 1F21A 4CEZA 3NCIA 2G8UA 4EZ6A 2WOMA 2VG7A 1EETA 3DRRA 3ASMA 4FJ8A 2DY4A 4J2EA 3B6PA 3AVLA 3DRPA 4RG8A 3AVIA 3SUQA 3TI0A 1J5OA 2ITGA 1BIUA 4FZXC 1XC9A 4GVMA 4DTMA 1WNSA 3LP0A 2FBVA 4KTZA 1A5VA 4FW1A 3V1QA 3S3OA 1JLCA 3ZSRA 2KTQA 3CQ8A 3AA3A 5HRPA 1BHLA 3OYJA 1RBSA 3VQBA 4DU1A 3TABA 2O4GA 1S1TA 3TWHA 4DQQA 1GOCA 1T05A 4NYNA 2QXFA 4M42A 1RDAA 5T7BA 4C8KA 4FJNA 4I9QA 3ZT0A 2KFZA 3NFAA 1A5WA 4ID5A 1BL3A 3QO9A 4CJTA 3RRGA 4PUOA 4B8AB 4KV8A 5J2QA 1WSIA 3UIQA 1KFSA 3SQ4A 5JS1A 1B9DA 3ZSYA 5I3UA 1UA1A 4Q5VA 4DTOA 4N41A 4CJVA 4DG1A 2BANA 4DTRA 4CGIA 4ZHRA 4M3UA 3FFIA 4YFUA 2KZZA 2FBXA 2VG6A 3VQ9A 2JGUA 2VWJA 3U3GA 2RN2A 4M3RA 4CJUA 4I2QA 4CJQA 3V9ZA 3LALA 2E6LA 4F2SA 3SJJA 3K5NA 2X74A 3AO2A 3NH1A 5I42A 1CXQA 2OPSA 4O44A 4FJGA 4FJXA 2QKKA 1DTTA 4O0JA 1JLEA 1C0TA 1RT2A 3EY1A 4FJIA 4GMJB 4BWJA 3SZ2A 3OS2A 3NHGA 4B9UA 1VSKA 1CZBA 5CYMA 1HRHA 5HROA 4KHNA 3D0PA 4KI4A 4G1QA 2Y1JA 1TKDA 4BWMA 1HYVA 1NJYA 4F2RA 4EP5A 1TKZA 3SUNA 4Z4FA 3H08A 3QEPA 1RDBA 1BI4A 1S6PA 2DFFA 2EX3A 3DYAA 4IDKA 4Y1CA 4FM1A 3QEIA 2HMIA 4FJ9A 3LAMA 3HK2A 2LSNA 4IFVA 2DFEA 2KZMA 3QINA 2XRIA 4FLYA 3HPGA 4CHOA 4O55A 4KPYA 3V81A 1R0AA
chains in the Genus database with same CATH superfamily
1XB4A 5GIOA 2GBYA 3VTIA 3L0QA 1P7IA 4AM3A 3JAMZ 4F92B 4HQEA 2IGKA 1VFCA 1CXUA 3DLHA 2RPIA 1M1KO 3LA7A 4KUMA 2QI2A 1LDJA 4P5OA 3S1QJ 2FF3B 3ZT1A 3SQNA 2X78A 5CVRA 3LWMA 4DHYA 4DQSA 1D5AA 1P2FA 2VCPA 3OV8A 3WU2C 5FLVA 2XO7A 4E3SA 3FM3A 4FLVA 3QQAA 3IS9A 5M1NA 2M0CA 4CW7B 1NG9A 1VQNN 1HSJA 5HVQC 3E6MA 4B8XA 2JPBA 4OPAA 1WAJA 2N8GA 3CLOA 2XC7A 3VQDA 2W82A 3G3ZA 1BN5A 3BG7A 1QVUA 4IOAL 4X66K 2RNJA 4WF9L 1NK3P 4NC7A 1N75A 2ACJA 2HVSA 2Q2EB 5IT3A 3TU5A 1FMWA 3O4NA 1RKTA 3TDUC 3HP6A 2OD5A 5F1JA 2V9KA 3O9RA 3PX4A 4IOAF 4NNJA 5J2NA 1W1WE 3QOPA 2P9SB 3HXMA 2QQ9A 2GA2A 4EP4A 2E88A 4WQ4C 3ULDA 3PX6A 2BGGA 5E79C 4CBWA 3VOVA 2F48A 2MFZA 4IVNA 4EAHD 3HSEA 2V7ZA 4C8MA 5JVHL 3GZ5A 1XC3A 1QHAA 3K4MA 2WBNA 2Y2ZA 1DTQA 1K8KA 5E3OA 4UVCA 3H5NA 2ELKA 4A3GJ 3WTZA 2NZTA 5AQPA 3HTVA 3O6WA 2GOXB 1DQUA 1MBEA 4DR5K 3ZMTA 1ZG5A 5IT9O 3T1AA 3WUHA 3LSIA 3FBIB 1SFUA 1BI2A 3CCUI 1GOBA 4OAZA 4BJ6C 4DS4A 3K1PA 3RYPA 2YHWA 2PAVA 1RTDA 4R79A 2D0BA 1NGBA 2GUPA 3R61A 3FXRA 4HOBA 1LWFA 2P5GA 3E6DA 3W6VA 1YLFA 2HOAA 3UKRA 4IHTA 4BGAA 3C6HA 3CM6A 4XOPA 4AC0A 2CUZA 5L3GA 4I2PA 2XDVA 4WX9A 2LNBA 3RZOJ 5IT9K 2Q3SA 3H3NO 4YOVA 3Q0WA 5AQYA 4ANJA 3H0DA 2YJFA 3GFLA 3B8AX 3I0SA 3HT3A 3R8EA 1R71A 2QWPA 1FX7A 1VQ4I 2XY5A 3BTLA 2XPVA 1RUNA 1ATSA 1XMAA 4EEFG 4UY8I 1RDDA 5KK1A 1R5GA 3DLKA 1U2VA 3N4QA 1WBDA 3H3OB 4DQPA 1SKWA 1VRUA 1MKMA 2F5FA 2MC3A 1IC8A 2D5RA 1FYLA 4FWRA 4QS7A 3L8BA 1P90A 2AQFA 3MFKA 4Z94A 4IXCA 4M7XA 4FK4A 1Z77A 2IVMA 3TTCA 3VF2A 2OV7A 3MKLA 2VQLA 1VQMI 4C8NA 1W36D 4C30A 4Z4CA 5FPEA 3K58A 1SFEA 1APLC 2VQEK 3SV3A 3NEUA 4F3TA 1FOWA 1VQNI 1O3SA 2DODA 1V5EA 4HV6A 4MO4A 1R1VA 2A40A 3IKTA 3ZSOA 4XN0A 1REVA 1SL1A 2I8DA 4BRPA 4BQNA 4DFKA 2CMPA 3TL4X 3ZMVA 2WY8Q 5D5UB 5DM7F 3OA9A 3AKZA 1BW5A 2K40A 4NXMK 4HHTA 4C3IJ 4AIKA 5FPDA 4IQJA 4LH5A 5JLFA 3KEYA 2WTUA 2VG5A 2VWKA 2VUMJ 3NAUA 2A05A 3C0BA 3QNOA 2FBYA 3IKVA 3A01B 2G0EA 4ZTJA 1HKSA 4CJPA 1TYQA 2P51A 2VC0A 3S1RJ 2P9KA 4F9OA 3C6AA 3OYFA 1RIOH 2GV9A 4UUVA 5CY4A 1V55H 2BY3A 5J1RA 1XMQK 2K85A 3RPUD 4RAFA 4BC3A 1R0AA 4C8OA 4FK2A 1SMTA 4M72A 4UV8A 3CP8A 3QLHA 4KHUA 3EUHA 4I7FA 4GV6A 4FJKA 3Q0VA 4LK0F 2HOEA 3AO4A 1R00A 4B3XA 3DWLE 1YTYA 4KI6A 2O8DB 3CMMA 2E4LA 1KVCA 1UWBA 1LOTB 3DKXA 3WXLA 4CZGA 4N5SA 4FLWA 4BACA 1C1CA 2RF2A 4A57A 2K9NA 3QNNA 2A1RA 4A3KJ 1VSEA 4H4KC 1ZG1A 3H92A 2O5RA 1X9MA 3OYLA 4XSXF 1E17A 5IWAK 3BJ6A 4I0AA 2QYOA 3DTIA 1JL2A 1WJFA 3ZQFA 4P96A 4KIFA 1BI3A 2KZGA 3WTXC 3CC4N 2E36A 3CESA 1C0FA 2KMUA 2BBYA 4B09A 2HNDA 3HKZN 3ZT4A 5EU7A 3KLGA 4BRAA 1T44A 1KSPA 4CJFA 4N76A 1KONA 4IHSA 3D2FB 1BR1A 1RBRA 4CCHA 4FWKA 3CCVI 4XONA 5KQDA 2B63J 4BDPA 3RDIA 1BU6O 5CE3A 1JL1A 4CF8A 2XHBA 1AA7A 4PSWA 4FZYA 4S0HB 3WQUA 1L5UA 2ESHA 4FZZA 2JUGA 4ABZA 5J8FA 3TAFA 4E19A 3R9PA 1VQMN 3HOYJ 3WG7H 3GEZA 4FWOA 2B0LA 4BR7A 1BC8C 4HEA2 3EPZA 5DMRA 2QA4N 4G12A 2CQKA 1T03A 2E5ZA 2KIFA 3OJSA 1V5FA 4L5JA 1GHCA 3CO7C 2ETJA 4YFNF 1OQYA 5E8IA 3LAPA 3KWIA 4I09A 4CGGA 3SXYA 3BJOA 4BRGA 2LREA 1FOYA 3EDPA 4E4HA 4CJWA 4J2AA 4AIJA 4KBOA 3J80Z 3CMEN 2NRWA 4YOWA 3WTSC 2VE8A 4CGDA 4JS5A 2Q2EA 4L9VA 2L7MP 3CJBA 1XGNA 2KKOA 4AM6A 3Q0UA 3DTKA 2WONA 3FISA 1R4MB 3C18A 5D4SA 3MMVA 2WAQN 3PO4A 3K69A 2V1XA 2DPUA 4CK3A 2K3PA 3OOUA 2HF3A 1N36K 4RGXA 2VT3A 4A0XA 5C44J 4MEXF 2GXAA 1G3WA 3SBTA 3OS1A 3I8DA 3QOEA 3V4IA 3IUCA 1FIAA 3ZSZA 3CXCM 3CFPA 3FGUA 4ZTFA 2H8WA 2COBA 4FYDA 1BCMA 3COAC 1VSMA 5IYDJ 2HHQA 3BY5A 4GW6A 2Q8KA 1MJ9A 4ZDLA 3TDZC 4AVZA 3QRFF 1POGA 2MSYA 3E1SA 1Z25A 4FPBA 3LZJA 2EFWA 3AO3A 3LMMA 3TTDA 3J81K 1HW5A 3KLNA 5EJCA 3WTWC 5ELZA 4EHTA 4DV1K 3C6UA 1QZEA 3C2HA 4HUGA 2KISA 4IO9L 3VSLA 3G2BA 4BE0A 3VF4A 4CZMA 5L3EA 2FQ4A 4F4KA 2ATQA 1S1WA 4JKGA 3WGIA 1Y8QB 3H5AA 1DPRA 5J47A 4Q4ZF 4CZIA 1ZBIA 4BE1A 3NGZA 1OH8A 2VB6A 3DJCA 2EV5A 4GYIA 3FZKA 4ID1A 2DMPA 4KITB 3TAGA 3S2HJ 4Q48A 1LKXA 4RTFD 4UV9A 4FCYA 3T1HK 4DR6K 2ZCWA 5FROA 5IPAA 1WQ2A 1G6NA 2DFHA 4G6TB 3RKQA 2P9IB 2IA2A 3OYCA 1VTNC 1O3RA 2F6CA 1R7JA 1TT5B 4ENKA 4PKGA 4C8LA 4IG0A 2G7HA 2LP0A 3DKWA 3K0LA 3NQOA 4XKWA 2RAEA 2NNYA 3VGLA 4CERA 4CJEA 3EYZA 2K9SA 4DV2K 3T3FA 3HBTA 1K6YA 2F4IA 1SL0A 2EWSA 1MU2A 3A8YA 1ILYA 3QIOA 2D0CA 3CDIA 1M90O 2IGMA 2JVHA 3S8PA 4PY5A 1FMVA 2CSOA 3U2RA 1IUYA 5DK5A 5SZTA 4FJ5A 1UMQA 4PGGA 3HPHA 2NRHA 3QBWA 2JSCA 3QMLA 1YVNA 5BPLA 4CHYA 3GLLA 2IGIA 1B59A 2VONA 3VN5A 3KP6A 3K4JA 3CM5A 2ZWHA 1IN4A 1H9GA 2ESNA 3VWBA 4H0OA 5HLFA 4DQ2A 4JN4A 4CZHA 5LD2C 3KIOA 4JNEA 1TNTA 1TK0A 3KYLA 4LG0A 4IX7A 4A3JJ 2E1OA 2WC2A 3CCRI 4BRCA 1B9MA 1TL3A 3VETA 3CF5F 1T38A 5KQ8A 4AHVA 4H0PA 2P5VA 2Z1DA 4H0TB 4HV5A 1V3FA 1ZGJA 2E2OA 1A36A 4M3TA 5BS6A 3HJEA 1RTJA 2HDCA 2V52B 3MX2A 4B3MK 4KRFA 3J7AO 4A69C 1U2WA 1FZPB 2P1JA 2LKPA 4AF1A 1F5TA 1TAUA 4BC2A 1IV8A 3GF2A 3HXLA 1BQNA 1KLMA 3J81O 1PP7U 2HVQA 1S29A 1EH6A 2NOJB 4QSHA 3MKWB 3MEEA 3R0AA 3AV9A 1X4OA 3GL1A 3KZBA 4BROA 2HTJA 1AKHB 3SV4A 2JVGA 4IHXA 4JI2K 4CGHA 4XLNF 2XSDC 1WCMJ 3SFZA 2YKMA 1L3UA 3HOWJ 4B9MA 1JJ2M 2KP6A 3CC2I 4HLYA 3OYDA 1ERDA 1SD6A 3V9WA 3S9HA 1KYZA 1QHGA 1VQKI 4HW0A 1EJ9A 4UHTA 3AG1H 1G99A 3RPUA 1R59O 3IWZA 2A07F 3W2AA 2CW8A 3CO6C 2GUIA 3OYHA 2R7SA 2CGPA 3AL0B 3ENHA 2WV0A 3ZMDA 4EVIA 5EX5A 1NK7A 2EILH 4DLEA 4RAZA 1C6VA 2RHKA 3QU6A 1NK6A 3JSOA 2CH0A 3V8JA 4JQFA 5DTDA 4C9YA 4OIQF 3ZQ7A 2ADUA 1DGWY 3ECHA 2LKSA 5E1ZB 3VYUB 3O5BA 4RW7A 3PUBA 3TO7A 3U8XA 4CIEA 4MFEA 1ACIA 2ZGYA 4CHQA 5K1YA 3EETA 4RW8A 3A0HC 3NVKA 5J4VA 4B3TK 2Z16A 1JKQC 3BWGA 3I54A 3O3FA 2FQ3A 2OJED 4NB5A 3W6JB 3O1WA 3RMAA 3ZETB 3DLAA 1FXXA 3G10A 2I7NA 4K43A 2GA1A 1IZ1A 3FR0A 4E7KA 3SJHA 3HOSA 3TOBA 3ZSVA 5KCMA 4CF9A 5E84A 1S9GA 4GNIA 4V2GA 3AVHA 5KGWA 1OCCH 1WH5A 4KB1A 4BR9A 2DA2A 1JXBA 3SEZA 4KO0A 3W6KB 4K8ZA 4OJRA 4CZKA 4XM3A 1KQ8A 2W42A 1R58A 4AWXB 1U49A 1TNSA 2R7UA 4DFPA 2COMA 3VQAA 2BW3B 1RFQA 4E70A 3M07A 4BC4A 1W7PA 5LHIA 3GFJA 3QYFA 3OIOA 4LFCK 2Z1JA 4FTHA 2L9NA 4G94A 3H35A 1E3MA 2X6OA 4DV7K 5J2MA 2QQBA 4K42A 3H36A 4B1ZA 1YS6A 1S5JA 2R5ZB 3FKJA 3VSKA 5J2PA 5K7HA 3AO5A 3DLBA 1EWQA 5KVRA 2WBMA 2K7LA 1WI3A 5M3MJ 1S3XA 1RI7A 5EY4A 4MDAA 3PQKA 4ZYHA 5B3SH 4RW4A 1FTTA 4LG3A 3HM5A 2XASA 1MGTA 3O8HA 5FKKA 4U0VA 3ZQIA 2ZO4A 4EZ9A 1T0FA 3L6QA 4QTRA 2M4KA 4IJNA 4AHSA 3IC7A 3CC2N 2CUFA 3BQYA 2A42A 2K9QA 3SDGA 3ML6A 3OYIA 2P0WA 5D4RA 2IS2A 3PIOL 3QP5A 2W25A 1I50J 3KP5A 4A3CJ 4DTXA 3WG9A 5JR3A 4JI0K 2P9NB 4KHQA 3FLCO 4AILC 2DBBA 2ITMA 3VQ5A 4AHCA 3LDPA 4FJ7A 3WXKA 1Z67A 4MO5A 4CD3A 5L3CA 1K61A 1NGEA 3WNFA 2OA4A 3CCMN 3CCLI 3RYRA 4BRIA 2CQNA 2JZYA 4W1UA 5EZGA 3SHFA 2DK5A 2AO9A 2KIUA 3CCSN 2V1DA 2CRGA 4NHJA 1HMVA 4CF1A 1JTYA 1E0EA 3JYTA 2EZKA 3QEXA 1VQ9N 2M2EA 1BJZA 4F91B 4H03B 1T08B 2ZGZA 1YJWN 2L9VA 2H94A 1YJ9N 3VOEA 4XLPF 1TWHJ 3Q5FA 4CFAA 3I71A 2BY2A 4BHCA 1DU0A 5DM6L 1L3TA 1P4WA 2QZ8A 2HVIA 3BQZA 1O13A 2H1KA 4LOCA 1FBSA 2HI3A 2O03A 3V9XA 2BYVE 4L9JA 1YW8A 1W0TA 1YXQA 4CEZA 2H6BA 2M4GA 1OKRA 2KRHA 2VG7A 2WOMA 3DRRA 3ASMA 2D2WA 3NCIA 2WADA 4FJ8A 4J2EA 2NXNB 2XGXA 3SDBA 3AVLA 5LJVA 2LRDA 1HOMA 3AGKA 2PBDA 1ETOA 4FZXC 1BIUA 3L7WA 4DTMA 1WNSA 5EDNA 1LEAA 1BR4A 2DN0A 2MH2A 4KTZA 3CZ6A 2LMDA 3G1MA 2M9HA 2KZVA 3H6EA 4Y3OA 1V54H 5D6FA 4LF6K 3ZSRA 3LFKA 5AQFA 3EE8A 2DYRH 2X6XA 2KTQA 1BHLA 4M9XA 1RBSA 3VQBA 5CJ9A 4CH7A 3GG4A 3CCUN 2BVLA 2ZKZA 2M87A 2IVPA 2P8TA 4DNCA 2XV4S 1GLFO 2WC9A 2QXFA 4RDUA 3CJ9A 2MA3A 1GVJA 2XF7A 4RMNA 2EA2A 1SVLA 3DCFA 3KYCB 1A5WA 3QO9A 3T5XA 3CF5L 3H9QA 3NWTA 2VBYA 3MK6A 4KNYA 4B8AB 5TKWA 1RPWA 1WSIA 2UV1A 3DBRB 5EOYA 3UIQA 1IF1A 2UXNA 4UB8C 1VQ4N 4M3ZA 3T1BA 5I3UA 1ZREA 3I3LA 4ZDOA 2YPRA 2OQGA 3A5NC 4OINF 2LC2A 3CCMI 1HKBA 2BANA 3M8EA 4ZHRA 2KZZA 5TJJA 3V42A 1H1VA 4BAYA 3VQ9A 1FBQA 1A6QA 2GXGA 4JEPA 4BEHA 3M8JA 4I2QA 4NC8A 4JP0A 4I98B 1SANA 5DCMA 3ZOBA 2Z9OA 2X74A 1BI1A 1KQ0A 2YHXA 2EQRA 2QTDA 1J0RA 4O44A 3ZX3A 1IDZA 2QKKA 2M30A 2E19A 4AIHA 3EL2A 1JLEA 1C0TA 2IVOA 3EY1A 2VQFK 4ISFA 4EIAA 4BWJA 4B9UA 4EHUA 1EWRA 5HNFA 4A2BA 3NHGA 4EJWA 1VSKA 4KI4A 2HPMA 4JHDA 2DT6A 1MH4A 1HYVA 4HLXA 1S72N 1NJYA 4F2RA 3F3XA 3SUNA 4Z4FA 2CQQA 4BR5A 5EEHA 1HLVA 2V51B 1BI4A 4V19K 2EX3A 1QHHD 1Z1DA 1U78A 3IL2A 4IDKA 4Y1CA 3ZYYX 5BRHA 2F9TA 3SCXA 3VDXA 5BNGA 5C15A 1MDMB 2CYYA 5AZJB 3DXKB 3BR0A 3CPWM 5FKNA 1E4GT 2V26A 3F21A 2XAJA 1HF0A 4O55A 4L5IA 4QPOA 3V81A 2HVHA 4DMNA 5KI6A 2DMQA 2KL4A 3LAKA 3L2WA 2JLEA 1IKWA 3JW4A 3HYFA 2HKOA 3IFRA 1SD5A 1T8IA 3MCAB 3VQEA 3LWLA 4OLBA 2R7RA 2H3GX 4JRQA 2DTUA 3V8LA 4FXDA 5LMNK 4WFNL 3VQ4A 1SAZA 4PCQA 4A5AA 3TW7A 2PLYA 4YIFA 2R92J 2QUFA 3DBHB 5LGTA 4GDFA 2JA6J 1DLOA 1N34K 1ZYRF 3I5UA 4LH4A 2ZMEB 2A6EF 5FO5A 1LQ1A 2QQ8A 4C23A 4LD5A 4IWVA 5D5VB 1FK9A 4HTUA 4E1NA 3RQ4A 3CP2A 3L2VA 3ZT3A 4XOTA 4FX0A 2P9IA 1X2MA 3KLFA 1B9FA 3MN5A 1BA0A 4ZYGA 2HNZA 1U2VB 1O3TA 1WOQA 4E6KG 2HYGD 3O9SA 1FWZA 1W7PD 2YNIA 4OKJA 2YV0X 2FXAA 2W7NA 4CJLA 2X1DA 2JWKA 3LZIA 2HOSA 1PUEE 2BHZA 1B72B 1MH3A 4PKIA 1NJZA 1X9WA 1RR7A 1ETWA 4AD9A 4Y13A 4FM0A 1XN7A 4BBRJ 1QNTA 2XGEA 4YRVA 1MMNA 3G1OA 4FHTA 4BU2A 2PMHA 1IXRC 3LNQA 2NRAC 4WFAL 3MMYB 3IH3A 3EE9A 3FDYA 3BP8A 3BROA 3BOQA 1RDUA 3BG3A 2VQCA 3A03A 2NS0A 1NOZA 3MXMA 1RGIA 3OYBA 2B9SA 3OIQA 2DA5A 3GTJJ 4EMSA 2WTEA 5JHUA 2OPRA 5FD5A 3W2WA 2W6KA 5EXWA 4DWIA 1QTMA 3EUHC 3AVFA 4FJMA 1NMDA 4BHBA 4KHPK 1JHFA 1AWCA 2LK2A 3MD2A 5ADXA 2QXLA 5FLXK 1BISA 1NGJA 4JKDA 2IAIA 1P9QC 2VC1A 4G9YA 2VPRA 2ME0A 2RN7A 2VKVA 3FHNA 4ESJA 1IAWA 4O3MA 4QAGA 4KT5C 3AVJA 3LFUA 3QBXA 1UELB 1JJ8C 1G3SA 5AQUA 3QODA 2Z1HA 2O6GE 3THWA 4FLZA 3ENOA 5B8HA 5GAGJ 2LD5A 4B9TA 2IDOA 1LNWA 2JWLA 4DFJA 5FFXA 5L3FA 5BRFA 3D1NI 2VJ5A 4AHUA 1K4SA 5E20A 4H5NA 4Z4HA 3ZCOA 1XC5A 3D5RC 3LWFA 1D4XA 2GBZA 4IHWA 1IH7A 1YI2I 1LWCA 1W97L 3EKUA 3DXJF 2E71A 2Q36A 2YKNA 3CJCA 2A5WA 3UB5A 2Y9ZA 4FK0A 1Y0NA 3BT9A 2XAGA 4W97A 1LFUP 2L0KA 1F36A 1I3AA 3GO5A 2AXLA 3TEDA 3G0ZA 4E7HA 4V19S 3PNVA 4L0ZB 2NVQJ 3G71I 1XTAA 3QYEA 2GAUA 1W5TA 1F4KA 3HTSB 3TSQA 1BA5A 1RCHA 4CZZA 2QWWA 4RBOA 3LA2A 4FWQA 5AQZA 4W5RA 2LTPA 2QSFX 4DUYK 3QFPA 4DOZA 4CFDA 2ZJPL 1NK4A 1D9DA 2ZE2A 4B3SK 3SQ1A 3F8MA 4Y33A 2EH3A 5IP6A 3KD1E 3PY8A 2CO5A 3HKZA 1NGIA 3MDQA 4M3WA 2IBDA 4C1NI 3TANA 2Y1IA 1SL2A 1S1VA 1RESA 3V4GA 5AQNA 5AFUA 5HS7A 1NLVA 4ELUA 2X51A 2BZTA 3RIRA 3A5OC 1FP2A 1IJJA 5BN8A 3EZ5A 1UHSA 2GOMA 3FBNB 3OL3A 1D1BA 1S9HA 1ZTRA 1J59A 1VSJA 2H27A 4E1JA 4DSLA 1ODDA 3HC7A 2UXXA 2V9PA 3AVKA 4FE7A 1SQKA 2FMYA 1ZRFA 1NOYA 4PUSA 1JHHA 1T7PA 4Z4IA 3E01A 2JRMA 3NVMA 3K9JA 3ZETA 2HHUA 1K73O 3QFUA 2RGVA 1OCRH 5EZHA 3LL7A 3KP2A 1KAYA 3C95A 4NYFA 5FDLA 4BEHB 1NKCA 1IRZA 4NLBA 4CHPA 1YOVB 2W40A 3HL8A 4JI8K 1WRJA 1BA1A 1ATRA 2FSJA 2XY6A 3HVRA 4HCBA 2IGNA 5KNLA 3NGYA 4B1XB 2EWNA 1K83J 3MAQA 2A6TA 3DAWA 2WB1N 1Z3YA 2P7CB 3BR5A 4M71A 5ERIA 3V7CA 1NGHA 4J8FA 5F2RA 3TTFA 4BG8A 1IO2A 1W7PB 4L8RB 3RSEA 3THXB 2FC0A 2J5OA 1SZ2A 4LIVA 3AVGA 1U6GA 3JTHA 4LB6B 1WSEA 3BZCA 3JR9A 1FKOA 2F8SA 2R7FA 1DDNA 3FFKB 3GFMA 3V9UA 4DTPA 5C0YA 3CDHA 2LFBA 5HBMA 2UUCK 4G8XA 2EFOA 1KFDA 1NG6A 2YX7A 4QS9A 5KPRA 1MMAA 4UNOA 5LY3A 3CCRN 2F5VA 3ABTA 2MG4A 5FPMA 5GIPA 1L3VA 1BQMA 3K1NA 4ENNA 1LCUA 3TSUA 3WTYC 1TBXA 4KN7X 3WE2A 3G71N 1QHTA 5LHHA 2EV6A 4ITVA 2VPLA 3ESWB 1NHAA 3CFOA 4LSNA 3SYTA 2HNHA 3BJAA 4E7IA 4DYQA 1DP7P 2DK8A 4D7MA 1IKVA 3SK3A 4DV6K 1Q9YA 2RKHA 2YHAA 4B1WB 3MWTA 5IP9J 4RWTA 1TLHB 2P6SA 4IZ9A 1C0UA 4Y1DA 3C2GA 3BG6A 2R93J 3DOKA 2LH9A 1Z26A 3WEEB 5C10A 5M3FJ 1GV5A 2KJCA 2DYSH 3U9ZA 4Q0BA 5EG0B 1U48A 3H9GA 2Q97A 2CQXA 4L9NA 4N0BA 1BG3A 1A04A 2HTSA 1X9JA 3V1QA 3F2KA 3PLAA 1G4DA 2ASMA 1IG8A 4A3EJ 1JLFA 1B72A 4M74A 1J2XA 1MDMA 5AZJA 3KEQA 5KTQA 4DBRA 5B5EC 3OVNA 2E2HJ 4H5RA 5BPMA 3SPYA 4QOZB 4JBAA 2STTA 4B08A 2NS8A 1Y0UA 3P7NA 2LY9A 5J40A 2R7ZJ 3E1YA 3VQ6A 4X1EA 1W2BM 3BR2A 5C2FA 1NJXA 2Z1GA 1MMDA 3F9MA 3THYB 3HUGB 3JREA 1H0MA 3SAGA 3KP4A 2Z1IA 4YOXA 2EZIA 4PWDA 4LLGF 1T56A 1O1WA 2OF7A 1X1BA 3KLEA 3CC7I 3Q9VA 4DU3A 3BCBA 1Y6IA 5GADP 1T8EA 1PYVA 2CFXA 4XSZF 4DQ8A 2GZWA 1SFKA 2LY2A 4H8KA 1QSLA 1OISA 2KJBA 1XGOA 1ONVA 2L5QA 3IHUA 4HA8A 1RTIA 5M1QA 2YNHA 1YJNN 1UHMA 4DTSA 1RDWX 3K5OA 1I39A 1KAXA 2O4IA 2AJQA 4RB2C 4LG0B 5TISC 1FSHA 3FXLA 3PFIA 2VIXA 2VE9A 2G8UA 3THWB 1SAXA 4RAYA 3A0IX 2A69F 3I56N 3CD6N 2CV0A 3K1MA 3TMOA 4MNUA 4XQFA 1YQAA 2M8EA 4MDBA 4FOEA 1QZYA 4OMZA 4PK4A 2IS6A 3HSTB 3O9UA 3SYZA 2X6YA 4IEJA 5AQLA 2F9WA 3G6EI 1SEUA 1N8RO 3BR6A 3S3NA 1G2HA 2V9VA 1HNWK 1XI1A 2DMNA 3LDSA 1OH5A 1USSA 4I76A 4XH5A 1YG2A 1ETQA 5AQRA 2IGOA 3ZGKA 4LSLA 2HSTA 3R0JA 2A5YB 4QWQA 1XSXA 4FWNA 5E26A 1VQPN 1XNQK 2E2NA 3LPUA 2HW3A 3RCOA 5C3EJ 2LY1A 5AFUH 3VQCA 3HTUA 1LW0A 1FC3A 3WXMB 4ELTA 3OBWA 2VGMA 2E2JJ 1IBLK 2XUBA 4R8HA 1QO0D 1X3UA 5E3MA 5J1EA 3IG1A 2JA8J 4TSXA 4J01A 2R7OA 3I59A 3SQ2A 2E1ZA 1QE1A 3VA3A 4FWLA 1KVAA 4JAXA 3AGRA 3CHWA 2O8DA 3GBGA 1DT9A 2AA4A 5DDGA 3F73A 4QIWN 3TAEA 2XAQA 1RBTA 3ATVA 1WN7A 1D8YA 3PQJA 3I0TA 3DPUA 5BQTA 3HSRA 1KQ9A 3ZN1A 3HO1A 4Q5VA 1OJLA 5F0CA 4HVJA 2DA1A 5KRTA 5M5WJ 4Y15A 4HNVA 4F3OA 4P9UA 1HKCA 3M8FA 1GUUA 3E0JB 2Y48A 2RREA 3G73A 2JK3A 5KRSA 3OJUA 4HYEA 1CLQA 4UVBA 2F5CA 5A2QO 2QCOA 2FSNA 3H5RA 5HRSA 5KAIC 3JRIA 2QWQA 2QGUA 2Y75A 1IRXA 1IN7A 3DU5A 3KYDB 3F23A 1EXQA 1B4AA 2ZMEC 1QQCA 2B4JA 2KLAA 3IDHA 4AHTA 3WXIA 4KH4A 2E1YA 1XSVA 3DF8A 2MBFA 1HJRA 1D0ZA 5GAHJ 1DGKN 1NK2P 1MSFC 3F6VA 2CW7A 3V1RA 4A12A 2PBIA 3P1GA 1LAWA 2D1HA 3N05A 1X3ZB 3DP7A 1EQYA 1QPIA 3LP1A 4W5NA 3GZNB 2VN2A 5TGTA 4RM3A 5FFZA 3VEOA 4XRSG 4XH4A 3FMSA 1HR0K 2Y0MA 3NDKA 2FBHA 2WAEA 2OCCH 4N9HA 3S1NJ 3E3VA 3I59B 4CA0A 2G8VA 3AVAA 4OPHA 2WAFA 2P9UA 5D6EA 3RSNA 4KMUX 3KJVA 2QWRA 1VQPI 1EO1A 3CLQA 1K9MO 1O4XA 1UAXA 1VQ7N 4OGEA 4CESA 4CEOA 5AQXA 1XCVA 3LP3A 2MLGA 4CUGA 3RVCA 3T19A 3KK1A 4A6EA 1BR2A 3O80A 2DQLA 4DQRA 3PO3J 3BTCA 4DYCA 3AVNA 2O8CA 2DT7B 3MWPA 2PJRA 4BQAA 5BPNA 3B6CA 1O57A 3A2KA 2RDPA 5BR9A 4I9LA 2EK5A 4WXHA 4AVPA 1IW7F 1T6SA 2QM1A 2XY7A 3VMFB 3P9IA 4B1RA 4XRMA 1BI4B 1GOAA 3KLIA 3UNGC 3TBIA 3KZYA 1HKQA 4N4NB 5E1WA 3J7AP 3UE5A 3K0SA 3DXMB 3J8AA 3K59A 3PO5A 2G7UA 4DJAA 2A6HF 1HCRA 5FRMA 1WH7A 5CYQA 2ZXHA 1TL8A 1XHXA 2M0MA 3LSMA 1ZGAA 1XCBA 3FF5A 1KTQA 2X1EA 2XGDA 1EX4A 1LEBA 4ESBA 4OIRF 4HNUA 1E3PA 4YEJA 1RT1A 4HBLA 1VSIA 5BR8K 1QQIA 4XLCA 1S6QA 2PG4A 3GE1A 4N56A 1T39A 1BI0A 3AVMA 2YX4A 2MGQA 1FKPA 3GBTA 1X1PA 5IYCJ 3A5LC 1S72I 2YR2A 3ZT2A 5CZ1A 2UWMA 3HP9A 1JTXA 2KIQA 5LBQA 3S2DJ 4Y0WA 3HM8A 5AR0A 2R7YA 1J6ZA 4RGRA 4BJTA 4YHHK 4B3OA 2QK9A 4II2A 3LAJA 4FW2A 2K02A 1W4MA 2DTRA 2NYXA 2XF6A 4OX9K 2IRFG 3DQVC 3BG9A 3RRHA 3SQ0A 2TCTA 4A93J 2WAQA 3J7AY 1WFXA 4CGJA 2BTFA 3V8KA 2O8CB 3J81Z 1YW9A 1S8NA 3HGGA 2OANA 3LDLA 4WXDA 4K8XA 3UKGA 3HJFA 2DA4A 3FXQA 4YELA 3RKYA 3DLEA 4CEFA 3MKYB 4NDLA 2F8TA 1FT9A 2KFDA 4UQGA 2NOGA 1VQ7I 4MFBA 2NS7A 3ONQA 5HODA 3AA4A 4NCGA 2O3FA 3DEEA 4M3EA 5J3LA 4BQQA 4P9FA 1NGGA 1TTYA 1HX1A 3DWLA 2X48A 5BN9A 5DM7L 4DV0K 2HPIA 5GPAA 1A6IA 5IY5H 2Z33A 4XLEA 5K7FA 2MD5A 1NG7A 2VJJA 2E8AA 4KIGA 3E5UA 4AYBN 2VQHA 1B1BA 4OPJA 1NK9A 5HDKA 2GTDA 5CVJA 3GFIA 5CKTA 3O1BA 3D0SA 3DPTA 4IKFA 4NXNK 1TWFJ 4MHGA 1U0JA 4WQ5A 1YHQN 1ESVA 1JLAA 1R1UA 5LL6Z 4XN3A 3TW6A 3QERA 4DQIA 3A2FA 2RNGA 2P4WA 5K5RA 5HDNA 4I01A 4CSWA 1ON2A 3F8FA 3M9AA 2R7TA 1EETA 5KPTA 4HZFA 2BHYA 4BRMA 2ZJRL 1VI0A 2VT2A 1Z6TA 3SUQA 3TI0A 1V4TA 1OH6A 2XF5A 1GXQA 1XC9A 4QPQA 1ETKA 2IVNA 4BS9A 4JKFA 4E7ZA 1UG2A 1A5VA 2ZNYA 3PFYA 1TQIA 2QKMB 3PSFA 3KP3A 1O7LA 2BY1A 3S93A 3ZMSA 5E8GA 3S3OA 1JLCA 3FMQA 4FW1A 2M1BA 2CWEA 2CW0F 3O2PE 3AA3A 3NRVA 3CUQC 5EF6A 5GAHP 3CQ8A 3FXOA 1R6RA 1TT0A 2CS3A 1T98A 1QQOA 2JN6A 4DU1A 3U9GA 1S1TA 3TWHA 1JCGA 4DQQA 2FUG2 3DFGA 2XRLA 1D1CA 4ASNA 1ETVA 4LGWA 3S14J 4C8KA 2A3ZA 2QBYA 2P9LB 2ID3A 2F4MB 3JRAA 3SMSA 4CZEA 4B4CA 3NFAA 4YOYA 2W00A 4EJTA 3CCYA 3RRGA 4KV8A 1I1SA 3O4WA 5AQOA 4H0EA 2NAZA 5CQEA 1YIJI 1ZGWA 3ZSYA 1YI2N 2M5WA 2EPFA 1ZXOA 3K70D 4DTOA 4FLUA 4DR4K 1GLEG 4CJVA 4WYBA 4DG1A 1U4BA 4DTRA 3WEEA 1X19A 4CGIA 1TW2A 1ZARA 2FBXA 4CXFA 1LPQA 1N78A 4XR6A 1VQ5N 4G7ZF 3U3GA 1E4FT 4R1HA 1BIBA 3V9ZA 2E6LA 4F2SA 3U4LA 3PJRA 3K5NA 3TP0A 4DUZK 3RJPA 1VQ8I 5DUKA 3CC4I 1M1EB 2NNWA 3J7ZO 2EFPA 4Z2YA 4BRQA 1ZR2A 3BUZB 4LFBK 4IO9F 3RZDJ 4RA2A 4WCEL 5M1FA 4KHNA 2IW5A 2XAUA 4M9SA 2V7FA 1YW7A 1YHQI 2UYTA 1TKZA 5E17F 2CH5A 4EP5A 1FOKA 1FEXA 1U8RA 4FM1A 2L7ZA 4L18B 4CICA 1WGXA 3QEIA 2O0YA 3UR3C 3DXMA 3E9OA 3OMYA 3LAMA 2V4JC 4HTLA 4HDVA 2QWMA 2NVXJ 2YUSA 4FE4A 4UB6C 2VBXA 3VPRA 4FLYA 3HPGA 3VFZA 1HC8A 5M1PA 3HHHA 2LR8A 4PDKA 1UA0A 1UHWA 1K4TA 2QA4I 4PA1A 2HQRA 4KTWA 4H5WA 2DFIA 1KU2A 5JI6A 4UUSA 2V1UA 2IAJA 4XIUA 2GM4A 4HX8A 1U04A 4KFBA 1EP4A 4LITA 3QPSA 1EH7A 4CJKA 1K8AO 1ON1A 2GEMA 4M3BA 2I5UA 3E5QA 5DM6F 3TAPA 2OBPA 4GV9A 1HPMA 3P38A 3AARA 4ILHA 1OYYA 2VOPA 3FXJA 2KRCA 3CMEI 1B9NA 1WI9A 3DM2A 4FVUA 3Q7BA 3CMYA 4IBNA 4DSIA 2K27A 2MLKA 4GXOA 5J1UA 1HDPA 1XGMA 2HGCA 4RS8A 2PI0A 5DUIA 2P9KB 3NF8A 4QS8A 4AH9A 4CJSA 3JRFA 2DXIA 3K57A 2HHXA 1NK8A 2W1OA 3MECA 4IJAA 4ZYDA 3GUDA 1ORKA 3JAMK 3N97A 2NUBA 2IP2A 1PUFB 3OYEA 4H0YB 3CCLN 4A0YA 3AY9A 3T7ZA 4M3FA 4ETSA 3JRBA 3OYKA 5EGOA 4CF2A 4CCNA 2IA0A 1TK8A 1IG7A 1ITYA 1Z21A 3EUAA 3WGGA 4BRFA 4JYAK 4XKCA 1JUSA 3FXUA 2GWKA 1LV5A 1VQ5I 4E0DA 2OPPA 4CE9A 2MW8A 2EIMH 2K4BA 2K9MA 2XB0X 3V9SA 4OO1J 3J7ZI 5AIPA 3NF6A 1RDCA 4FM2A 3QETA 2KQRA 4KH5A 1L0OC 1VSFA 4CJRA 2FJ1A 3FZFA 4OVLA 1VQ8N 2Q1NA 4FJJA 2QKBA 4KREA 2LVSA 3HIFA 4LF8K 1ZLJA 3TKYA 2FSWA 4CEEA 5F0XA 1P4XA 1PDNC 4A2AA 2V1NA 4DKWA 4QCLA 1E2XA 1RKWA 1XDSA 2RV8A 2UUZA 3K9TA 3M7GA 3ZMZA 3KK2A 4XORA 5CVIA 1RT4A 2H8RA 1HBXG 2HOTA 4A0ZA 1VRTA 2YX6A 3D5LA 3DLGA 2XGCA 4B9LA 4RLQA 5F6FA 4JD2B 4MTDA 3N4PA 4N47A 4U67L 4AYBA 4H5TA 3HZ6A 4BVOA 4HUFA 4JKBA 1NK0A 2F5DA 2IPQX 3DEWA 3VYRB 2M7AA 3HGYA 1IG9A 3S1MJ 3C6TA 4RB1A 1MZBA 5JLHA 1XMXA 2EHGA 2X6NA 2NRRA 2ETHA 2ICWG 2DOAA 4E89A 1JUPA 2ZF5O 3HSFA 3B73A 5CLSA 1NGFA 3LPTA 3Q7CA 3PIPL 4XEIA 2LLKA 3MAJA 3K70C 4HDUA 2V79A 3RSEB 2OU2A 4HQMA 3CC7N 1NKBA 3QEWA 2RE2A 2PFUA 2L9SA 2QSGX 4RW6A 1LVKA 1EV7A 4BXFA 2XROA 3HEFA 2JT1A 2XSJC 2HB5A 2JA2A 2ECCA 1OPCA 2L9RA 2PMZN 1MIJA 1Z7LA 2W84A 2Y31A 3RPQA 3ERED 1ITGA 5HRRA 1G59A 3GTQJ 1WSUA 5DV5A 3AAQA 2I10A 4MLEA 4GV3A 1B6AA 2BGCA 4DZPA 4ZDPA 3GTPJ 3HUGA 3F6OA 5FD6A 3F72A 1W36C 2P9SA 3RMCA 1U5TC 3CD6I 2HYJA 3QU3A 3EYIA 4G7OF 4BR0A 5E41A 1SUQA 2JMWA 4DU4A 5B66C 2YI1A 2E1MC 3NH2A 3CCJN 3EUKL 3SEQA 4KMFA 3LDQA 1LDKB 1S7OA 4OKKA 2OPTA 1O3QA 2Q2RA 4WK8F 1RT3A 3OS0A 4ELVA 3OIPA 3G6EN 1U9OA 4DR1K 2BXYA 3PUFA 2CUEA 4J00A 2RVCA 4MLHA 4B9SA 5L3DA 4J2DA 2O8EB 1WSFA 1AHDP 2BH1A 3TPQA 2DO7A 3ULQB 1KU3A 2BUPA 5D8KB 3FXMA 2HHHK 2PX9A 4F93B 1XNRK 5CVUA 4HSTA 5D5XB 4FWSA 5JS2A 1Y64A 2M7BA 1Q82O 1L3SA 2JA7J 3O08A 1HNXK 5C4JJ 4EJUA 3J7YJ 1S1XA 2B6AA 1NGDA 3AVBA 2O8EA 3VTHA 4B9NA 1ASWA 3B6OA 1X9SA 3ABLH 4TV7A 4CIFA 3QPLA 4C3JJ 2I5JA 3CJ1A 4BQLA 1KU7A 4D5FA 2EA4A 2YU3A 4BY7J 1IGNA 2R7WA 5F1XA 2VKEA 2HHVA 4M3XA 4K2EA 4P1WA 3K6GA 3LSRA 3KX2A 4BH9A 3IAM2 3E6CC 2VKDA 4IF4A 4Z4GA 1T33A 3WU0A 5FJ8J 3ULEA 5DS9A 3ZQCA 4BR2A 2DOFA 2FOWA 1WKMA 2L02A 2L7FP 4L5EA 4NQWA 4O5VA 2AQEA 3MN6A 1SAUA 1GT0C 4DV3K 5EYRA 5HLHA 1VSDA 1Z0XA 1KYWA 4HF0A 4CCOA 1HA8A 1MBFA 4XL9A 4V2FA 1J53A 4DSFA 3D5SC 1NK5A 4G9ZA 2HKXA 1I6HJ 5AIQA 3VESA 1JCEA 4OU0A 4FO0A 3O8GA 3H46O 3KKRA 1HUXA 2XIGA 1JE8A 2UU9K 3S17J 3RWUA 3WODF 4ZYEA 1QVTA 1T6DA 3WXJA 4CYCB 3WNEA 1LUJB 1GLAG 5HLTA 3DLLF 3K5MA 4WF2A 3FM5A 1WJBA 2ELHA 3OBYA 3QYBA 3H1CA 2LKXA 1UCRA 2HHTA 1D0XA 3ZX0A 3IRRA 1F1ZA 1WHUA 1JGSA 1W5SA 3ABUA 3ZXSA 4ZYAA 4PHTX 2YSRA 1YJ9I 3ISNC 2GX9A 4J2BA 1MJBA 1FLIA 5AQSA 1HKTA 2F5EA 3J7YP 4RAGA 3FHZA 4CECA 2K3FA 3CCJI 3VODA 1GLJO 1YT3A 5D5WB 1XMOK 2Q1ZB 2X85A 4DV5K 3KE2A 5A2QZ 3AAPA 3HPOA 2QLZA 2F2EA 4EATA 1JLGA 4E1MA 5C12A 1KXPA 4BVPA 1QSSA 4IRHA 2MABA 1HQCA 3VEVA 3CIPA 4WQ5C 2FXUA 3LL3A 3L4QA 5AQMA 4CCJA 3VQQA 4IOXA 4QLCU 1I94K 2IS3A 2YCHA 2QVOA 5HS9A 4MLOA 2R0QC 1X58A 1H8AC 1KU9A 1CF7B 1OMIA 5LEJA 1JXSA 2KLOA 1YYVA 3DLRA 3VEYA 3F22A 3N4MA 2ME6A 3U1DA 2NRVA 4CD1A 3CF2A 1N5YA 3ZX2A 1J09A 3D45A 4CVNE 3LP2A 3I58A 3JRHA 2FE3A 2KDZA 4M7YA 4X62K 3KTQA 3CTAA 4WE1A 5DD8A 3PV8A 3IAYA 2G8FA 3SFIA 1T3VA 4AM7A 1MWKA 2FBKA 2GELA 1H89C 4PL8A 2CJJA 2DMUA 1NM1A 2G9WA 1JKOC 1BBYA 4ICLA 3WNHA 3HB9A 2OZUA 4MEYF 1OLTA 3ERMA 5AQTA 1L3LA 1IXSB 4BREA 2F4OB 5DD4A 5EGOB 3BEXA 4DW6A 1Z3XA 2ZJPF 2OUMA 4CEAA 4B3RK 1GV2A 3CCSI 1QU3A 5GAGP 3BDPA 4C3HJ 3BTJA 4CBUA 1RR8C 2PJRB 1YJWI 4PKHA 3I8BA 1V5GA 1YRNB 4I6ZA 4HF2A 3H1QA 2LF8A 1YJNI 1STZA 2YNFA 3E9PA 4BGDA 3FMRA 1UZCA 1K78A 1XQSC 4F7ZA 2O9LA 1YTAA 4NCBA 4CFBA 3G4SI 5H6RA 4ENMA 3KK7A 1NGCA 4JOMA 4OWRB 5KHDA 5K5OA 2CV1A 1G3TA 4LLNA 1S3JA 2BW3A 4CZLA 3OTOK 4B43A 3A0BC 1V4SA 3SAFA 2EV0A 1VQLN 2HU9A 4IQ4A 1HNVA 5FLMJ 4B1YB 1D5YA 2P5KA 2CUJA 4DTUA 2TRTA 4CEBA 4FISA 4XRSA 1T2KA 2O8XA 3MN7A 1CF7A 3VEWA 2PZSA 1BJAA 4BDZA 1TK5A 1DPUA 2NLXA 5HDGA 3BDDA 4M3DA 2K5CA 3JRGA 4ZC3A 3AG4H 1ZBUA 2NVYJ 2RQPA 4DYRA 2PJPA 2XHKA 4D5CA 5ILSA 4YORA 1IXCA 3E9LA 3LM9A 4W5QA 5LMUK 3L3VA 4CCMA 3I4NJ 1SMYF 1SFXA 1ZK8A 2P81A 3VPZA 1YITN 1KRPA 2OTJN 3K5LA 5FRNA 2JA5J 1MD0A 3CJQB 2PMZA 5B1AH 3HYIA 4CZFA 5LEKA 4WCGA 1IKXA 3CCEN 5D3GA 1IKYA 2P6TA 5KPZA 3KK3A 1ZH5A 3BPXA 4D7NA 1R1TA 2DQRA 2EJRA 2EINH 4KDPA 3T69A 2AHQA 2R7DA 3CDLA 4RLFA 4OMYA 2Q0UA 3HL2A 3K4CA 3PIOF 1AU7A 1XGSA 3C3WA 4KISA 1XUPO 3PX0A 4WXCA 1WSHA 2AP1A 5LJWA 1TW3A 1IV0A 4F8RA 2H1LA 4YY3K 4R5PA 3MXIA 5LFAA 4BKXA 3A5MC 5FB2A 5HRNA 4LFUA 5E3LA 4YFKF 2ASOA 5HP1A 4M41A 1K7AA 3WNGA 2NNNA 5JLWA 2M8GX 2M34A 3BPVA 2ZFUA 2F96A 2D45A 2DPNA 4M45A 5SWMA 3VA0A 1OCTC 1QRYA 2DTZA 1G3YA 1D8KA 3ZP5A 1W0UA 1OVQA 4KTQA 4CJ4A 1LE8B 1S1UA 3G4SN 3HI0A 4CIGA 3CCVN 1Y8RB 1MWMA 2ZMEA 2WA0A 4IL6C 3M8QA 1YTUA 1A5XA 1NWKA 5AJ3K 1H9TA 4JK7A 1FW6A 1LAVA 1RTHA 4EFHA 1R22A 1QQMA 2FU4A 3V7SA 3VYTB 5M1KA 3ECOA 2Y0SA 3IWFA 4H5VA 4KHYA 3OY9A 2VKHA 1HQEA 2YHBA 3M3ZA 1S7EA 3BGRA 3CG7A 4GKJK 2YJEA 4C2UA 3R1XA 2IC3A 3IMXA 3ZCMA 2BY0A 4MTEA 3CJNA 2AS5F 2E7WA 3HOTA 3L2QA 4A62A 1IN5A 4JYKA 4JRPA 3FZMA 4XH1A 2A6AA 1HNZK 4FL9A 4Y7NJ 1TV6A 4M6XA 2NVUB 1XPXA 2ZXJA 1ZLKA 1ATNA 1C0GA 1J9IA 1HPZA 2GQQA 2WFBA 1ZG3A 2YNGA 3MEDA 2DMTA 2O8FA 2D1KA 1FIPA 2V6CA 3AG2H 3EQLF 1HQUA 1TVRA 3ALYA 1FYMA 1JCFA 4CJ3A 2VXDA 2VASA 1WLJA 1MDUB 4NLCA 2ZXWH 4JX4A 2QEXN 4BY9C 3IV5A 2E1CA 4BRDA 1QZ6A 3THXA 2HHSA 3HOXJ 4HX4A 1UB9A 4PJJA 4X0GA 4IOCF 1B8IA 1GDTA 5AZIB 5ADXH 2W41A 4IRGA 1TZLA 3TQNA 3AFHA 1K8KB 3CJRB 4YIIA 4N9IA 1W5CC 3GW2A 3HBLA 2OTJI 3I64A 3SAHA 4A3LJ 4UUTA 3HOZJ 3K7AJ 1P4AA 4IPAA 1ZKGA 3AO1A 3GOIA 3GYHX 5C42A 2O8BA 3L00A 5GAEJ 3HZJA 3A02A 1WVRA 1YS7A 3L2CA 2E35A 2MYSA 2OZ6A 2E1NA 5CQGA 4C2MJ 4OIOF 4CYCA 2STWA 1HYZA 3JXUA 3F8BA 4RW9A 3VERA 3CUQA 3RMDA 1EKEA 2FNAA 1HLUA 1DUXC 4B8CA 1NGAA 4PL7A 4HUEA 2E7XA 1SVOA 4XKBA 4XLAA 2Y30A 3DEUA 1ZELA 1AOYA 1BO5O 4CZJA 3RR7A 1PUFA 4A61A 4C1NK 2KFNA 2J5PA 5M5XJ 3J80K 2ISZA 1U5TA 5DEQA 2Q0OA 1LDDA 3LSGA 2JPCA 2LYCA 3LDOA 5CYVA 1ASVA 4JLHA 4UXNA 3OYNA 2R7XA 3HVTA 4MQ9F 1XS9A 2FF4A 4HAMA 3FZHA 1X1AA 2E60A 1AKHA 3VQ8A 3ASOH 3GWZA 2V6EA 1U47A 3MZYA 1LW2A 3RR8A 3VQ7A 2OA8A 5M5YJ 2FBTA 3MVPA 2VL8A 3U21A 4CDGA 4A59A 4RB0A 2CG4A 2HMIA 3BR1A 3H3UA 4GGGA 4PZJA 4JK8A 4XLHA 4XIDA 3KD5E 3FXKA 4HRIA 1KZHA 3PNTA 3R6SA 4ESFA 2NVTJ 2LBFA 3TGNA 1WUAA 3SUOA 1VQ6I 1RBUA 3FE1A 4UUSB 2FA5A 1J54A 1TP4A 4MFDA 3QWLA 3IH4A 4EM2A 5A2QK 3RKWA 2B5JA 3S41A 4XICA 5AQWA 3QESA 5C2DA 1F21A 3B6AA 4JKGB 4EZ6A 5GP9A 2YS9A 1X1CA 2DU9A 3KPHA 4JI7K 4DR7K 3VGMA 4CCKA 1BM9A 4YIRX 3DRPA 4K25A 3AVIA 1I3QJ 1JKRC 5AQKA 4II3A 1SFOJ 2ITGA 3I55N 4GVMA 2HBKA 1WWXA 1LWEA 2KPMA 2OTLI 3ULEB 2A68F 5AQJA 3VYSB 1T0FC 2JJ7A 5DCMB 4DIQA 1XDUA 3JSPA 3UKUA 4JX6A 3WHBA 2WWYA 3W3DA 5HRPA 2UXDK 1E3OC 1ZN2A 1I27A 2H6CA 3H9JA 4KYWA 1DP3A 1DGRM 3BTIA 1IBKK 3LSPA 1CQTA 2MD0A 1YUWA 4JKCA 1BC7C 5JVGF 1NBWA 2X4HA 3SJMA 3L4IA 4NYNA 4JI6K 4CO8A 2KKZA 2C6YA 3SLCA 5T7BA 4FJNA 4M73A 1Z7UA 1VZ0A 2IIRA 3BF1A 5GTHC 3ZT0A 2HQNA 2KFZA 2M45A 5EEAA 1XD7A 4GFBA 3GTLJ 2EIKH 3S15J 2FRHA 2TDXA 1SVMA 4XMYA 4HNTA 5J2QA 3MZ8A 2DA6A 3VEPA 1KFSA 3SQ4A 4YOTA 4BR4A 1P8ZA 1B9DA 4KA4A 3ELKA 3DXKA 3GXOA 1IN8A 1MNDA 1VF9A 4BJ5C 1Y39A 2LBFB 3FK7A 1UJ8A 1BOAA 4FQGA 3RI4A 1I6XA 4LF9K 4N41A 4CCLA 4PFOA 4FOIA 4B1VA 3DTEA 4M3UA 4YFUA 5GPCA 1EH8A 3SBGA 4GCVA 1UAAA 3L1PA 2VG6A 2ZFWA 4I6MA 2VWJA 4X65K 3F0CA 2RN2A 4M3RA 2FEZA 4CJQA 3C7JA 1FYKA 5GADJ 1LJ9A 3VB2A 3SJJA 2RQQA 3AO2A 3NH1A 1JKPC 4FJXA 2IS1A 3O3KA 3M5RA 1DTTA 2X9DA 3BLYA 3LSHA 2L7KA 3JTGA 1RT2A 4O0JA 4Q47A 4GMJB 3SZ2A 4FJIA 1VQ6N 3SZPA 3M3YJ 2WUSA 4I99C 1CZBA 1HRHA 3BZ6A 1K79A 2W57A 3D0PA 5HROA 1JGGA 3EEQA 5CR4A 1O7FA 1RDBA 5BREA 2R3SA 4LJZF 3C7NB 3DYAA 3ZQLA 4WWCA 3VF6A 4I7HA 2EB7A 4DCHA 3ABKH 3HK2A 1LFPA 2ZXIA 4PSXA 2DFEA 4IFVA 5CPRB 2QKLB 3QINA 4HX7A 4FT8A 2XRIA 1USTA 3I55I 3OWTA 5EVZA 4CHOA 2L2OA 1JT6A 3IRXA 3OYAA 3F9KA 1VK0A 3FX3A 4LC9B 1WBBA 2FSKA 2BE2A 1TL1A 5GAEP 2FF6A 2KIMA 1C0MA 3SMPA 3V7RA 4JKAA 1Q9XA 2NRTA 4BG9A 5IOYA 1BOTO 4FLTA 5J4YA 3ASNH 4Z4EA 5E1XA 2Y69H 4M6VA 3M1EA 1ASUA 4PGHA 3U6FA 5F08A 3LQQA 4UY8O 4LIUA 4CGZA 4HCCA 3I33A 1MBGA 4ON0A 3JS6A 5HS8A 5AQGA 4G7HF 4GKKK 2R7QA 5ICEA 1MMGA 4DSJA 2PY5A 2OC6A 5C24A 3NE6A 1TAQA 1W9HA 5F0FA 5B1BH 4BHPA 1WZ2A 3CI5A 4CK1A 3GX4X 1QS4A 1B92A 3OR2C 1NU0A 1D9FA 1MMSA 4MO7A 3KVGA 1MNMC 1X1DA 3P39A 4JK9A 3ZSXA 5IT9Z 4CJ5A 3CCQN 5HLIA 1XSDA 4IO8A 4JI3K 5AONA 3Q3SA 3WU1B 5TRDA 1OR7C 5C25A 1S9EA 3AA2A 1C1AA 4FPAA 4IFYA 3U3YA 3OYMA 1D5VA 3JRCA 3P4IA 5HL7L 3NAEA 1SKSA 4HG2A 5IP7J 4LFAK 1JKHA 4IEEA 4LLLA 4S04A 3KKSA 3K4NA 3LM2A 3WTTC 2ZJRF 1GLNA 3GTKJ 2R5YB 5IYBJ 3NWSA 1JT0A 3ID6A 3HRMA 3BZKA 1BIAA 1XWLA 2O8FB 4BXUA 1E3HA 1ULYA 1N33K 2ASPA 3IH2A 4LF5K 3X2QH 4IOCL 4EGZA 2KHOA 2O61A 5C4XJ 2FX0A 4F52A 1IRGA 1MA9B 5LRSA 4PJMA 4B48A 1K6OA 2DLLA 3I53A 1ZBLA 3JCUC 4H4MA 4GY2B 2XAHA 3GDQA 3PNYA 2HXOA 1SV5A 2CGLA 2NRZA 1IRFA 3HOUJ 3NGIA 1QSYA 1ZYQA 3GTGJ 4FJLA 1YX3A 3OHRA 2ISYA 3SZTA 1ZBHA 4XBFA 1QA6A 2HWVA 2FBIA 4JX5A 1F43A 3C65A 4B1UB 1BCOA 1WAFA 2X6SA 5EG0A 3C1DA 5BPIA 1OKJA 1D1AA 4E7LA 1MBJA 2OQRA 3D2EB 3U9DA 4CGFA 1OCPA 3ZEUA 4CYDA 2K4JA 2HDDA 2D5VA 4HF1A 1IUFA 3AL0C 4KB0A 1P7JA 3HDDA 3RMBA 2DJIA 1QZ5A 4YNQA 1XHZA 2VJ4A 4CHNA 3CJAA 2FLOA 3I4PA 4NCAA 4M3YA 4OOIA 2RKIA 3LA3A 3TO6A 3MEGA 2JRTA 1EA3A 4CEQA 4LY7A 1R49A 4CBXA 5MLCQ 1OYIA 2DAOA 3UKRB 1ZBFA 2Y0SN 3HHGA 3F8NA 2XB5A 1J5EK 2CFOA 2P7VB 4BRHA 4WFBL 3FKIJ 3R60A 1U8BA 1KQSM 1DKGD 3R3LA 4RB3C 2L01A 1YFHA 3GTMJ 1OYWA 3GTOJ 3M8PA 2GWJA 2XVCA 3WE3A 1U3EM 1VHXA 3WQTA 4BRKA 4CEDA 3ZN0A 2HF4A 4OPKA 4NBQA 4JI5K 3LSTA 4M9ZA 1UG0A 1LB2A 1OCOH 3MEXA 3K2AA 3CCQI 2VWBA 2OZMA 2HBJA 3BC8A 3CYMA 4JKEA 4O8KA 2OPQA 2A3SA 3ZQHA 3IP4B 4AUXA 3ITHA 1HW2A 3QEVA 2IJLA 1NJWA 2UUBK 3K10A 4KJZA 1Z91A 2VBZA 2HFHA 4EM0B 4CZCA 4DTNA 1HYSA 4PQUA 2XPWA 4JD2A 1HDDC 2HXIA 2W6LA 3H3ZA 3B02A 3BG5A 4DF4A 4HWIA 5AQQA 1SS6A 2EFNA 2ELJA 2ZBKA 2HMPA 4FVMA 3FWEA 2KRFA 4DZJA 3DLLL 1U45A 4F3QA 4IG3A 1BOBA 1CZAN 1Q1HA 3DMJA 3TAMA 5FLXO 3WTVC 1R4NB 2YU9J 2ZD1A 4LMYA 1IN6A 2BOLA 4RGSA 4UVAA 1YO5C 1GVDA 3HRUA 3DBLB 1NMNA 1S22A 3LQRA 3TO9A 4U88A 4K0KK 1Z6RA 4LD0A 3SI6A 2KDOA 2IT0A 4EV0A 1WB9A 1Q86O 4G6DA 1EF4A 2UXCK 1CZ9A 1MW7A 1RNHA 1BL0A 1RNLA 4DV4K 1R5ID 1JXEA 5LHGA 3REOA 4IDHA 4EGYA 1WJAA 4HPQA 3ISPA 2XPUA 3AG3H 5F27A 3BF3A 3CJ7A 3ENBA 3MX5A 3V1OA 3F5TA 2KZMA 5DYMA 3T8TA 5D8LB 1TGOA 1PJRA 1ETYA 2A41A 3F8CA 3MCZA 4ZZLA 4DR2K 3MWMA 3MQ0A 1RILA 2NRXA 3KP7A 4F55A 1YE9A 1VNDA 3CUQB 2L4AA 4MIMA 2LOOA 4A5NA 2YHYA 3E6BA 2W4SA 3CCEI 2VGNA 2E6MA 4BL0B 2G8KA 2DA3A 2X1CA 3P9KA 5GINA 3EZWA 1NH3A 4FASD 1J75A 2ZJQL 1KC8O 4DLGA 1Z9CA 5FPNA 1Y56A 4X64K 3OYGA 3O9QA 3JSMA 4EQQA 2VOOA 1HXDA 1R36A 3KLOA 3OOPA 3P83D 4CI6A 4JV5K 1KVBA 1Y1WJ 2ZNZA 3ZR8X 1QGPA 1J9AA 1R23A 1YRNA 1Y97A 5AQHA 3CQXA 2IEKA 2LF7A 1VSLA 1N6QA 2MC4A 3QB0A 3VEZA 1X3WB 4DTJA 3I0RA 5AQIA 1WSGA 2BE5F 1VQOI 1UOCA 3CFRA 1YX5A 4BXXJ 3E97A 1BGXT 1NTCA 2VYPA 3NF7A 3ZRGA 5FLXZ 3L9FA 4BYYA 1Y1VJ 4HSRA 1TUUA 1KCFA 5ILUA 4CHZA 5K7ZA 5CHIA 1SD7A 2GWRA 4O0IA 3M8SA 1NKEA 2G8WA 3R6MA 3QICA 5CVVA 2HR3A 4L9TA 4U7BA 1DEJA 1FJGK 4KHWA 4NB4A 2BDPA 2CGJA 5JHFA 3KHYA 4EJVA 4Q5SF 2FOKA 3U1KA 1U6ZA 2HNYA 2OYQA 1B8IB 3BY6A 9ANTA 3NBPA 2ZM6K 1YIOA 3MZHA 1IJWC 3L3UA 3WT0A 1UFMA 3PM1A 2DPDA 3ABMH 2O8BB 1ENHA 1OR7A 1WJDA 2DCEA 2QQAA 3IAS2 1ZQ3P 4BE2A 3OSFA 1TC3C 1GLLO 3HM9A 5IOZA 1YVUA 5F04A 1TYQB 3H45C 3MXJA 1ZC6A 4O6JA 3O4QA 4FWMA 1LE8A 1XX5A 4GO1A 1TQPA 3RQIA 1ZR4A 1DU6A 5F64A 5K14A 3UKUB 1FJLA 4FSVA 2GXBA 1QVGM 4KKOA 3S3MA 2KQ2A 1KLNA 2UUAK 4IEIA 5J8CA 4C2TA 2R7VA 2ZC2A 4CK2A 4M6YA 3VEXA 1NNEA 2ZJ2A 1Q1VA 1C0WA 4O4GA 1TWAJ 1PVEA 4I2OA 4BBSJ 2KHMA 4D0PA 1KA8A 4GVEA 2QEXI 3T1YK 3SUPA 1FY7A 5FKOA 1BUPA 3QDKA 3NF9A 3C2BA 4W5OA 4DS5A 1CGPA 2RC4A 3QIPA 3QAHA 3THVA 2WB1A 3ZQGA 4G6QA 4NUBA 4I0BA 4BRNA 1T95A 5FGMA 1FP1D 1RT7A 3AVCA 5JLXA 4IZZA 1VSHA 2L4MA 1D3YA 3WGHA 5GTIC 2FNPA 2VI6A 2WY7Q 5H20A 1OVYA 4JS4A 4LB5A 2BXZA 3RTVA 4H0XB 3GVAA 3H0GJ 4Y17A 4CF0A 3KWGA 1S5LC 2EFQA 3DI6A 4ISGA 3QPHA 4JI4K 3THYA 3MKZA 2P9UB 4I6MB 5DCFA 3S2WA 3QPTA 3C94A 4CFCA 3SNNA 4L3QA 1WJCA 4WQ4A 4LF4K 3W3CA 3T0YA 3PL8A 4P55A 2D0PA 3P5JA 5ICCA 5ILVA 3MN9A 1VQON 1IBMK 3A4CA 1QVFM 4BNCA 4KT6A 1FOXA 5E3NA 4B3AA 1ETXA 4XRFA 4A2UA 4Z6YA 1TKTA 2HS5A 5H6QA 3TSPA 4OLAA 3TOAA 4N4OB 3EN9A 1RZ4A 2HZDA 4KFCA 1JLQA 2QSHX 1MJAA 1VQLI 1C1BA 3CPEA 4BGBA 4PJLA 1VQKN 2DJNA 4LK1F 1QPMA 2H09A 2Z3YA 2D0OA 3DRSA 4H4OA 3KEOA 4A6DA 5JVGL 2ID6A 3LSKA 4ZH4F 5LGNA 2FD5A 4MGRA 5FKMA 1RRJA 4AIDA 4AHRA 2HDWA 2IS4A 4AQYK 1XG1A 2HZTA 3Q9SA 5BPDA 1A5JA 3DOLA 4FLXA 1KD1O 2OAZA 4JHDB 1YIJN 3JAMO 1S7AA 1TKXA 4A3FJ 1I5ZA 2CQ7A 5JFRA 5KAFC 1RT5A 1WSJA 4NO7A 3LANA 1GXPA 2JWTA 4AU7A 1QBJA 5KGXA 4S05A 1QQNA 4IXAA 4ILGB 2XRNA 5E18F 3LDNA 2G8HA 1K78B 2HBMA 4BC5A 2OZSA 1ZBSA 4NC6A 4EJOA 1YITI 1R9TJ 1LVAA 1BIZA 1W0HA 3D2FA 3OW2M 3TARA 2PYLA 2DA7A 2XAFA 4MQ3A 5AQVA 2HHWA 3K2ZA 3CMAN 5JVTA 1OFCX 3DV8A 2QENA 2DOEA 4BUPA 2ZJQF 4BDYA 1Q8IA 4JK1X 1RT6A 4MQVA 4D1QA 1FBUA 1OCZH 4D9JA 1Q81O 4GRIA 4E7SA 2PYJA 3GLXA 4PFPA 5CZ2A 3CETA 4JKHA 5BRDA 1XMKA 2HYFA 4KHSA 3O6BB 3VQPA 2VXZA 5L3BA 1Z05A 3AA5X 3MCPA 4ISEA 5LRRA 3O9TA 1ZRCA 3K4KA 3W0LA 2QM3A 1Q7YO 1X2NA 2X0LA 3FZLA 3BCAA 3E7LA 5M1OA 1U5TB 3WTUC 3A01A 3L2RA 2WV1A 4O5FA 4FX4A 4KN4X 1W7AA 4DSKA 2XKPA 4IHVA 3H3VK 3TAQA 2VQGA 5HLGA 1X3MA 3M1FA 4A5BA 2E1MB 4DSEA 4Y4RA 4OKEA 2J4RA 3TP3A 4BQOA 2E2IJ 4GYGA 4OGCA 4FJHA 1ZAOA 1J5YA 4RGUA 3OSGA 3C7NA 4KICA 4A3MJ 2HQ5A 1SC7A 3HRSA 2EIJH 4ZZDA 1FSEA 2BVMA 1NJIO 1Q18A 1SKRA 3FK6A 2R5YA 4M3GA 4BQZA 2ZQBA 2QF7A 3TR8A 1VAZA 4M63C 4DF8A 1PP8F 2IOCA 3KZIC 2KW4A 2P9LA 2VLAA 1I1GA 2E2PA 1MNEA 2EZHA 4XNFA 1F9NA 4EM1A 1RUOA 1BWFO 3BR3A 2A1SA 3V6DA 2DI3A 2CH6A 3EO3A 4DB3A 5I9EB 2Q0RA 4YFXF 3M8RA 4B9VA 4OIPF 4U0YA 5HOOA 3EKSA 4W5TA 4B44A 1ZHFA 3OR1C 2D1VA 2ZB9A 2Z2SB 3K4LA 1WJEA 3H1VX 3T8RA 3I4MJ 3D6RA 1KAZA 4XK4A 1LFBA 3ROUA 4CHUA 2DW4A 4XLFA 1G8XA 1RBVA 4K41A 2CU7A 4DFMA 1MBHA 1OH7A 3FZVA 2IA1A 2DDBA 3EYYA 3O3HA 1HSTA 4A3IJ 1VQ9I 2W85A 4J19A 1G15A 4Z0UA 5JICA 1MSEC 3M1CA 1X3NA 1HW1A 3O3GA 4YOUA 1D0YA 3S32A 5K5QA 1MBKA 4PJ0C 5EEGA 3CMAI 4Y52J 3SPZA 1TUYA 2P5OA 1J7KA 1V4RA 2Y9YA 1GLCG 2AXTC 2D4WA 4PJNA 5F1RA 2F4VK 1A31A 2FMLA 2UZKA 3CUOA 6PAXA 2JUCA 1HKGA 3I56I 4YG2F 2QBYB 3ZSQA 4B9QA 1HJOA 3P31A 3HOVJ 3K4BA 3R4KA 4O8UA 2V7YA 4A5MA 2QWOA 1N32K 2G8IA 2HQAA 1T6CA 4KH6A 1HNIA 2D0AA 3NMUA 3NH0A 1IDYA 3J80O 2OCEA 3WHCA 2HBLA 3CQYA 3K9KA 3PIPF 2P5LC 3HRGA 2E20A 3DPLC 3QP6A 2EBIA 3FIWA 4U87A 5ICGA 4E7JA 1GLBG 3K2PA 2VJIA 3O8MA 4RCHA 3KFWX 2GIVA 5J1YA 3JRDA 3HG9A 1JLBA 3KLHA 4FETA 2F7TA 4BY1J 2BV6A 4A3DJ 3RKXA 3CERA 3RTRA 3ZSWA 3D7EO 5HNHA 3M6GA 2L3DA 4FWPA 4A3BJ 3PO2J 3HSCA 2E5NA 3L2UA 2XY8A 1TWCJ 5ICFA 4LF7K 5H2FC 5BMZA 2GLOA 1BDGA 2L54A 2R5ZA 2W24A 4O5BA 4OAYA 5AZIA 5J6XA 4KAZA 3KZZA 1YAGA 2A5XA 3OL4A 1TWGJ 3A1YA 1X4PA 5F0HA 3KETA 2DY4A 3B6PA 2P9NA 2QWNA 4RG8A 1RETA 1REPC 2ZSHB 3LSJA 4H0VB 3GZ6A 1U9NA 1J5OA 3L09A 3LP0A 3W2VA 2FBVA 3ZMUA 2K9LA 1QZZA 2K86A 3G1LA 5LGUA 5JMVA 3D2EA 2PN6A 5LLQA 4DR3K 1P92A 3ZLJA 5ED4A 2DT5A 4U0WA 2QW9A 3OYJA 3M4OJ 4ILJA 4KIBA 2PEXA 1GLDG 2EZLA 4YDUA 2LDUA 1YF5L 4X6AJ 3LOCA 2MH9A 2PQ8A 2O4GA 3TABA 2KT0A 3MN2A 1H88C 3HRTA 4B47A 1GOCA 1T05A 3ZQQA 1RC9A 2Q31A 4M42A 2P9PA 2E5LK 1RDAA 2LG4A 3DKYA 4I9QA 2BEOA 3G25A 4NQWB 3ID8A 2LSOA 2E34A 5BOXA 1FTZA 4ID5A 1BL3A 5H1SQ 1N25A 2PFBA 4CJTA 4PUOA 3CJTB 2W48A 4U7DA 2Z5UA 3I9V2 1IV6A 3NARA 2OTLN 3ATUA 5JS1A 1ZRDA 1UA1A 2HEOA 3DU6A 2GIZA 3GMEA 2JSPA 2CGKA 1A35A 2X6WA 2ZSIB 4BRLA 1S6LA 2E2QA 3IKMA 3VENA 3KCCA 2O8KA 3FFIA 4JI1K 3PSIA 1JI8A 2XKOA 4XKVA 3AAFA 2B7EA 3S16J 2JGUA 1JJ6C 2R4GA 4ZJZA 2ECBA 4CJUA 4YDUC 4DGWB 4IFEA 3LALA 1WJ5A 3CQZJ 3E66A 2HVRA 2Z99A 3SZGA 5I42A 1BW6A 2A61A 1CXQA 2OPSA 4FJGA 2O7OA 3IRQA 1FPQA 1TQMA 3P9CA 2QWLA 2IXSA 1SD4A 4DBQA 3OS2A 3ZPLA 2M3AA 5CYMA 4CJ7A 2CV2A 4I02A 4RM2A 4G1QA 4BWMA 5FKLA 2Y1JA 4L0YB 1JUMA 3ZEUB 1TKDA 1FNNA 3H08A 3QEPA 1WPKA 2UXBK 4ENJA 1S6PA 2DFFA 2VBWA 1R5HA 4FJ9A 3VGKA 3IUOA 2JQ7A 4IRIA 2PMUA 5TKYA 2VODA 2I7PA 2LSNA 1KGSA 3E5XA 4IHYA 2JTVA 2DDAA 1N77A 3GCMA 1D8JA 4KPYA 2P9PB 1P6RA
chains in the Genus database with same CATH topology
3IRXA 2HVHA 4DMNA 3OYAA 5KI6A 3F9KA 1VK0A 3LAKA 4KTWA 4PA1A 3L2WA 2JLEA 1IKWA 1TL1A 2BE2A 3HYFA 4XIUA 4OLBA 1C0MA 2IAJA 1U04A 3VQEA 3LWLA 4KFBA 4JRQA 1Q9XA 1EP4A 2DTUA 1CXUA 3DLHA 2RPIA 4CJKA 4FXDA 3VQ4A 3TAPA 1DLOA 4FLTA 3ZT1A 4Z4EA 3LWMA 4LH4A 4DQSA 1D5AA 3DM2A 1ASUA 1FK9A 4HTUA 4IBNA 4E1NA 2XO7A 3ZT3A 3L2VA 4E3SA 4CJSA 4FLVA 3IS9A 3NF8A 3U6FA</