1I39A

Rnase hii from archaeoglobus fulgidus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i39A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i39A01
4HCCA 1VSFA 3FFIA 3VQAA 1QE1A 1FKOA 3ZCMA 3CQ8A 1KVBA 2Z1IA 4FJMA 2P51A 2ZE2A 3TARA 4O5BA 4BACA 4FM0A 4CEOA 3MXMA 3VQPA 4OLAA 1VSLA 3MEGA 3V9SA 2IC3A 3RR8A 2F8SA 1S5JA 4CF2A 3NGZA 2HHVA 5HROA 1TAQA 4CJWA 3MAQA 2VWJA 2EX3A 3ASMA 3L3VA 1QTMA 3KK1A 1JLQA 3OYDA 1DTTA 3S9HA 1XI1A 1X9MA 1NKBA 4Z4CA 4DF8A 1JLAA 1L5UA 4B9NA 4GW6A 2IGIA 2I5JA 1U45A 3AO2A 3P5JA 3LP1A 3SUQA 3L2RA 4ICLA 3S3NA 1S1TA 4CGJA 4EP4A 3ZSYA 3VQ6A 2AJQA 3SPZA 3ULDA 3V9ZA 3LP3A 4BE0A 3HPHA 3C6UA 4KKOA 1Q9YA 1C1AA 3AVKA 3L2UA 1D8YA 1ITGA 2B5JA 2WOMA 3BDPA 3HK2A 4DMNA 2HNDA 1LV5A 3S3MA 2HHUA 3NF9A 4PQUA 1IH7A 4PUOA 3NF7A 4CHNA 4DTMA 4DFKA 3PX6A 4CJLA 1A5VA 5SWMA 3QETA 1CXQA 3VQCA 1ZBIA 1NJYA 1B9DA 3VQ4A 3TAGA 4N76A 3M8SA 1CLQA 4DLGA 1S9EA 4FW2A 3S3OA 1NJZA 2E6LA 3PV8A 2F8TA 4OVLA 1EXQA 1JXEA 3OYFA 3RR7A 3E01A 1BHLA 3L2WA 4DQQA 4DFMA 1HYVA 1TK8A 5D3GA 4CHPA 1ASWA 3LAKA 1SKSA 4J2BA 3LPTA 1RT7A 5T7BA 4FJGA 1Z26A 1EKEA 2IS3A 2WONA 4PA1A 4CJSA 4CJ4A 3SNNA 5KRSA 1SUQA 1J5OA 1UA0A 4Z0UA 1RCHA 3NBPA 1SKWA 1YT3A 2XRIA 1CXUA 4YFUA 4LD0A 4KRFA 1BI4B 4CJKA 2RF2A 4FLYA 4DQIA 3ZT2A 2BGGA 3AO1A 4I2PA 3VQQA 5CYQA 1VSIA 4Z4HA 4J2DA 4CJFA 1RBRA 3KK3A 3TAQA 2JLEA 4AHCA 2Y1JA 2OPRA 2GV9A 4CJQA 1KVAA 4E1MA 2EHGA 4CGHA 2RN2A 1Q8IA 1RDDA 1IKWA 3VQEA 5CZ1A 3KLEA 3CFOA 3NF8A 1D5AA 2A1SA 4DSFA 1NK5A 4N47A 2PYLA 4CGDA 2DTUA 3RWUA 4C8NA 4M3WA 1W0HA 3TAMA 4H4MA 4RG8A 2D0AA 4RW9A 4B8AB 3NH1A 4C8MA 3QEPA 5J2QA 4E89A 4KHYA 2GUIA 3NFAA 3DLHA 2OYQA 3K58A 3D0PA 5HLFA 4K8ZA 3VQ5A 1WSHA 3H08A 3VQDA 3OYGA 1TAUA 4NCBA 1CZBA 5C25A 1LW2A 3KKSA 1I39A 5CZ2A 2Z1GA 5K14A 4CCHA 1W9HA 3AVFA 4MFBA 4KHNA 1NK8A 2BANA 3LALA 3MXIA 4DS4A 1X9WA 4RW4A 1A5XA 4Y1DA 3OYAA 3O4NA 4CF0A 2KZMA 1NK7A 3HVRA 2G8HA 2YNFA 1N5YA 3ZSQA 2YHAA 4J2AA 3QIOA 3V1RA 4CE9A 1IO2A 1ZBLA 4JLHA 1RDAA 1REVA 2BDPA 4Q5VA 3V1QA 1QS4A 3QINA 2P1JA 4FJJA 3VQ8A 4NCGA 3V9UA 4FJIA 1WSFA 4LSNA 4OJRA 3WNHA 3LPUA 4CERA 3PUFA 1S1WA 1UOCA 3SPYA 1XHZA 3VA0A 4FZXC 4R5PA 2X6SA 4EP5A 3JYTA 2HW3A 2KFNA 3QNOA 3AVGA 4B9LA 3UIQA 2DY4A 1C1BA 1IKYA 4ZTFA 3QO9A 3LANA 4FM1A 4AILC 4FLTA 4KTQA 3TABA 3DLKA 4DQSA 3IRXA 1WAFA 4I2QA 3LDSA 3CFPA 3HXMA 4FCYA 3HPGA 1Y97A 2QK9A 1LWFA 4KV8A 1YVUA 4NCAA 5JS2A 3DM2A 3HVTA 4ID5A 4CGIA 1RT6A 2HNZA 1UWBA 2HVHA 1RTJA 3QERA 3EZ5A 1DLOA 4O0IA 1N6QA 5KGWA 1UA1A 3PO4A 2HHQA 3RTVA 4JS4A 3BGRA 3DLRA 4DU1A 3SV3A 4F4KA 4CF8A 4BDZA 1JXBA 1GOBA 4CJPA 1VSJA 3OYJA 3F73A 5EU7A 4O44A 1A5WA 3LWMA 2G8UA 3KD5E 4WE1A 2HHWA 4FJ5A 4RW8A 1KRPA 4IG0A 2F96A 2FBVA 3QESA 4BWMA 3SUNA 1TVRA 1S1UA 3G10A 3DLGA 4FK2A 4CHOA 3TAFA 2YNIA 4F2SA 3CM5A 3K2PA 3HP9A 4KTWA 3OYBA 3V6DA 2OA8A 2HHTA 2HHSA 1VSEA 2NUBA 3G0ZA 1FKPA 2ETJA 3KD1E 3HM9A 4IDKA 1WSJA 3NH2A 1T7PA 3LP0A 3L8BA 1T05A 4KAZA 3KIOA 2E6MA 3K5MA 5I42A 1BIZA 4FLUA 1SKRA 3P1GA 1VRUA 3VA3A 4E0DA 1FXXA 1TKXA 3OS0A 3HT3A 3QEXA 5HRSA 1KTQA 3SZ2A 1WN7A 4CEDA 5J1EA 3ISNC 3DOKA 2HHXA 2VG7A 2GBZA 1G15A 1HNVA 4DG1A 4CIFA 1U49A 1B9FA 1L3VA 1ZBHA 1BQMA 1TK0A 3TANA 1KLMA 3K5NA 4FK4A 1S9GA 4CEEA 4CK3A 4CJ5A 1ASUA 1RT5A 4DU3A 2YKMA 4EZ6A 4FJ8A 4KI4A 1QSYA 3OS1A 4CEAA 3NF6A 4CIEA 4DQRA 3ZSZA 4Z4IA 1WAJA 2PYJA 1LAWA 2G8WA 1EETA 4F3OA 4KHQA 3C6TA 4CFBA 2O4IA 1HJRA 1QHTA 1ZBFA 2ITGA 3SQ0A 1T03A 1D9FA 4H4OA 4CK1A 2OPSA 3HYFA 1Q9XA 4G1QA 3NH0A 3QEWA 1C0UA 3QLHA 4M3UA 1QQCA 3O3GA 4W5NA 3AO5A 3SUOA 1EX4A 4FYDA 3THVA 1BL3A 4ID1A 4E7JA 1HPZA 3OYEA 3SYZA 2G8KA 4CJVA 4DSLA 1BIUA 4I7FA 4E19A 2XY7A 3HL8A 3NDKA 3DRRA 2BE2A 4O4GA 3KTQA 3WNGA 1QSLA 4E3SA 3M8RA 2YV0X 2HVIA 1SV5A 3TAEA 1BCMA 1S6QA 4KO0A 1RNHA 3AVCA 3LAMA 4M41A 3SQ1A 1QSSA 2IAJA 3SUPA 1NK4A 3ZSXA 1WSEA 1HQEA 1JLCA 4W5RA 3V81A 3RRHA 4HHTA 2XY8A 3VQ9A 1NOZA 4B8CA 2DFFA 1HQUA 2ZD1A 2KTQA 4JRQA 3AVAA 3KLHA 1L3UA 1HNIA 4C8KA 4Z4FA 3K5LA 2KW4A 4CK2A 4DLEA 2B4JA 3U3GA 3CM6A 1BI4A 3D45A 1KFSA 3I8DA 3AVIA 1O1WA 4M3XA 4CJTA 4AHSA 1IG9A 5JS1A 4CFDA 4HUGA 2XHBA 1IKXA 1WSIA 3C95A 4GMJB 3PX4A 3LWLA 4O0JA 1HRHA 3AA4A 3HSTB 4AHTA 1KSPA 3M8QA 4CJUA 3IAYA 3K57A 1UAXA 3DLBA 1RTHA 4GVMA 3MEEA 4BDPA 1L3TA 1WNSA 3VN5A 1RT1A 5HP1A 1HYZA 3TAPA 2D0CA 4BE1A 5FRNA 4HVJA 4DSEA 3TWHA 1XHXA 3LP2A 3V1OA 4C8OA 1C0TA 4E7HA 3AV9A 4E7IA 5FRMA 4OKEA 4BWJA 4DTJA 1RILA 3QIPA 4CGGA 4FLZA 4LY7A 2IOCA 4OKJA 3OYIA 4JRPA 4B9UA 4DSIA 1I3AA 2DFHA 1LAVA 3AVLA 2R7YA 2OZMA 1BGXT 4KB1A 4PWDA 3T1AA 3I0RA 1RBVA 4XIUA 4DTUA 4HUEA 2KZZA 3KLIA 3RMCA 1TKZA 2YNGA 3DYAA 1NJWA 3HO1A 4HCBA 2DFEA 1RBTA 1KFDA 2G8IA 2P5OA 3WNFA 4FVMA 4N5SA 3AA2A 3O4QA 1R0AA 3DMJA 4YNQA 4OLBA 4FZYA 1JLBA 3L2QA 2A1RA 3QEIA 4FJKA 4KHSA 2E4LA 3ITHA 4N56A 4FJNA 4KHUA 1VK0A 4ELTA 4CHQA 4KFBA 4KHWA 2D5RA 3MEDA 3ZT0A 4B3OA 3AVMA 3V9XA 1JLGA 4CESA 1GOAA 3O3FA 4FM2A 3RMDA 1S6PA 3V4IA 4F2RA 1VSMA 4CF1A 1VSHA 5KRTA 3U6FA 3ALYA 3RMAA 4KTZA 1NJXA 3TI0A 2JGUA 4TSXA 3L2VA 4B9SA 4AHRA 1JKHA 4ELUA 1SL0A 4EZ9A 3NGIA 4IFYA 1JL2A 5J2MA 1MU2A 1HMVA 3KLGA 5CY4A 4KI6A 4DFJA 4DWIA 1F21A 1K6YA 4BE2A 3TR8A 2FBTA 4CEQA 3OYMA 4E7LA 4OGCA 1HYSA 3AO3A 4M3ZA 1JL1A 5FROA 4M45A 1TKTA 4DSJA 4KB0A 2Z1HA 3T3FA 5E41A 1C0MA 1TL3A 5KI6A 5HRNA 3OJSA 4HUFA 4LSLA 1X1PA 4OKKA 3NAEA 2XY6A 2ZQBA 3LZJA 2G8FA 3SV4A 2VWKA 5C42A 1C1CA 1RT2A 4FJHA 2QKBA 4CFAA 1RT3A 3C94A 3SQ4A 1RBUA 3OYHA 1S1VA 1X9SA 3DRSA 3IG1A 4CEZA 3F9KA 2PY5A 2RPIA 4CEBA 1L3SA 4QOZB 4LH4A 3EYZA 4MQ3A 4E7KA 1J53A 4CGFA 1J54A 4DTXA 1VSDA 5I3UA 3AA5X 4FLXA 1RBSA 4Z4GA 4DFPA 4ZTJA 2X74A 5CYMA 2X6NA 3LZIA 4HTUA 5J2NA 3RRGA 4Y1CA 3VQBA 2RKIA 4F8RA 3ZT4A 1JLEA 1ZYQA 3DRPA 4CFCA 4CEFA 4CJEA 3AVJA 1RTDA 3DI6A 4I9QA 4FK0A 3AA3A 5SZTA 1NKEA 1RTIA 1NK6A 2QKKA 1YTAA 2G8VA 3T19A 4JS5A 4L8RB 2FBYA 2IDOA 5C24A 4CJRA 4CHYA 4PY5A 1DTQA 3CG7A 4OGEA 3PY8A 3VQ7A 1LWEA 1VRTA 1Z25A 4QAGA 3OS2A 3KK2A 4IFVA 4KREA 1RDCA 3PX0A 4FJXA 4OPKA 3RMBA 1J9AA 1SL1A 3OJUA 2W42A 1BCOA 3O3HA 1EP4A 2YNHA 3OYKA 2KQ2A 4FLVA 1XC9A 3SJJA 3ZSVA 4B9VA 3P83D 3OYCA 4W5TA 1RT4A 2XO7A 3K59A 3JSMA 4Z4EA 1CZ9A 4FW1A 4FLWA 3MECA 1ASVA 4B9MA 1C6VA 4AH9A 2VG5A 4M3YA 3B6OA 4CHZA 3AO4A 4NYNA 3SQ2A 4DTRA 1KCFA 1KLNA 1S1XA 3OY9A 3QNNA 1NKCA 4FJLA 3DLEA 4NYFA 5FDLA 4AHUA 2VG6A 3KLFA 3HPOA 1T8EA 3NE6A 2YKNA 2OPQA 1U04A 3NHGA 4OPJA 4BDYA 2P5GA 1U48A 2YHBA 1ZBUA 1NOYA 1IKVA 1TK5A 4RW7A 2OZSA 3WNEA 4UQGA 2O4GA 4I9LA 3A2FA 3AVBA 4M42A 2LSNA 4DTNA 5DK5A 3QEVA 3ZT3A 3HP6A 4W5OA 4IKFA 1TV6A 1YTUA 4F3TA 3OVNA 3OYNA 1XWLA 3L3UA 2ATQA 5KTQA 4DU4A 4DTSA 3SCXA 4DSKA 4FJ7A 3ZSWA 3KJVA 4FXDA 1BISA 1JLFA 3IS9A 3M8PA 2X78A 3ZSOA 3MXJA 3ZSRA 1D9DA 1LW0A 3KKRA 3AVNA 4M3RA 4W5QA 3CFRA 4ELVA 1LWCA 1NK0A 4N41A 1U4BA 4IBNA 4CF9A 1U47A 4IG3A 3NGYA 4H8KA 1VSKA 4DTOA 3AVHA 2KFZA 2QXFA 4DF4A 2Z1JA 1FK9A 4O55A 1TL1A 5KGXA 3ZT1A 3B6PA 1SL2A 5HBMA 5J2PA 4LH5A 4CJ3A 1B92A 2OPPA 2Y1IA 1WLJA 1NK9A 4FJ9A 2FBXA 5HRPA 2FC0A 2Q3SA 4RW6A 2HNYA 3V9WA 3K5OA 4C8LA 3PO5A 1TKDA 2XY5A 4J2EA 4QCLA 1TGOA 2B6AA 3DOLA 4DTPA 4E1NA 4AHVA 1GOCA 5DMRA 3U3YA 4B9TA 4K8XA 4CECA 3SI6A 4Q0BA 2D0BA 2PZSA 5HRRA 4M3TA 2HB5A 1BQNA 3NCIA 1RDBA 1KVCA 1WSGA 3OYLA 4ZHRA 3I0SA 4B08A 4CIGA 3EY1A 3CYMA 4DS5A 4KPYA 4FZZA 3HJFA 2HMIA 4DQPA
chains in the Genus database with same CATH superfamily
5CHIA 3HSRA 2VXZA 2EZHA 2Z99A 3W0LA 2EK5A 3ZYYX 3EUHC 4CF2A 4O8UA 4IQJA 5IP6A 1XG1A 1XPXA 5FPNA 4LF7K 1U2VB 1RKTA 3CIPA 4EP4A 3SPZA 4KKOA 1C1AA 2EH3A 4G94A 2DBBA 3LWFA 3OWTA 2KRHA 5HDKA 4PUOA 2L4MA 3E9LA 3VQCA 4DB3A 1B9DA 3TAGA 4E7SA 3GFMA 4RLQA 2CQXA 4CJSA 2WONA 4LITA 3ESWB 2XRIA 3VQQA 1VTNC 4KISA 3L4IA 1MJ9A 2LY2A 1EWQA 4EAHD 3NFAA 2XAJA 5BQTA 4V19S 1X4OA 5C2DA 1BR4A 4KUMA 3M9AA 4CCHA 4KHPK 3KP5A 3JRIA 4CCOA 1BG3A 3LSJA 4OX9K 3SJHA 4JHDB 4CYCA 3VQ8A 5FLXZ 3JYTA 2STTA 3AVGA 2E8AA 3MEXA 3TABA 4M9SA 2IVPA 1J0RA 4HZFA 2VOPA 2OTLN 3J80K 3VTHA 3RTVA 4HX7A 1GOBA 3OYJA 4CJPA 1LVAA 3S1QJ 3J80O 2RV8A 4RW8A 1KRPA 2F7TA 3DLGA 3K4JA 2JRTA 2ETJA 4YOXA 1KAYA 5EJCA 1FJLA 2XAGA 4AIHA 3C65A 3QEXA 4JKDA 2DLLA 3CP2A 2TRTA 3SZ2A 4DG1A 3W2WA 3AAFA 2R93J 4BJ6C 2O61A 1WAJA 2O4IA 4Y15A 1QHTA 4CK1A 1SVLA 1I1SA 1RRJA 3OYEA 4DSLA 2G7HA 1I94K 4A6EA 3CI5A 4UB6C 4NXNK 2L0KA 3U3GA 4ZYDA 1JT0A 5EGOB 4AHTA 1Z6TA 3RKWA 3M7GA 1HLUA 2BH1A 3MEEA 3QP5A 3CJBA 2IBDA 4XRSG 4H0XB 1XD7A 3DLLL 5FRNA 3LP2A 4E7IA 1DU0A 4DTJA 5EEHA 4DSIA 2L54A 3IUOA 3SDBA 2M2EA 1RBTA 4FWMA 2HQNA 2X6WA 2P5OA 3F8MA 4YNQA 2O0YA 4FJNA 2RNGA 2BVLA 3O3FA 2A40A 5AQRA 3MMYB 1POGA 2UV1A 3TGNA 3ABLH 1N8RO 4E4HA 2CW7A 2JGUA 5CY4A 4B3RK 1MBJA 1GV5A 4DWIA 2E36A 1IAWA 4U0VA 3ZQIA 3WTXC 3AAQA 1TKTA 4KT6A 4I6MA 1X19A 2VWKA 4Y17A 1S7AA 2AQFA 3KHYA 2IS2A 1Z21A 3DPTA 3VEYA 4ESBA 5ED4A 3HRTA 1P90A 1FZPB 4I01A 1R7JA 3GUDA 4Y1CA 1JLEA 3CCLI 2QKMB 3F22A 1T44A 2B7EA 4DV7K 3MWTA 2PG4A 1RUOA 4CI6A 2VKDA 1YQAA 2KFDA 3VERA 4RAGA 2VUMJ 1AHDP 2K9NA 4XLCA 3OY9A 1LDJA 3WXMB 4L0YB 2LDUA 1NOYA 3CF2A 1TK5A 4UQGA 2ZJ2A 3CUQC 1SVMA 4CYCB 1W5CC 3SCXA 3T1BA 1TC3C 5J1UA 2EILH 3O80A 2E1ZA 3K1PA 4J01A 1NGCA 2QCOA 3NGYA 5DTDA 2OZ6A 2Y2ZA 4DF4A 2HQAA 3FWEA 3S93A 1ENHA 5AQFA 4FWKA 1D1AA 1WWXA 2R7VA 3IDHA 2FBXA 5HRPA 2OV7A 1WJAA 5FPEA 4C3HJ 1H8AC 3ZX2A 4Q0BA 1VQLI 3J81Z 3OYLA 3A01A 4UVBA 4YFXF 3VQAA 2DYRH 1N25A 4FJMA 4XNFA 2DA5A 1X3ZB 1VSLA 3O9QA 4FISA 3HRSA 2EFWA 2H6BA 1YYVA 4LF9K 1I50J 1BA1A 1S7EA 3MX2A 5IY5H 3LSMA 5A2QO 4B3SK 1JGSA 2FQ3A 3BG5A 3IH3A 1WPKA 1SEUA 3NF7A 1MH3A 4IVNA 5M3MJ 4PGHA 4DJAA 4DLGA 2QQ8A 1U78A 3OYFA 5BPDA 3VETA 1U5TA 1U9NA 3ZXSA 5MLCQ 4NQWA 4CYDA 3LPTA 1HX1A 3PFYA 5AFUA 1R36A 3HOWJ 5F64A 1UA0A 3S1MJ 1RCHA 3LSIA 4O5VA 4AHCA 4BRPA 4WXCA 1IKWA 1MH4A 3CFOA 2A1SA 1FIPA 2PI0A 4GY2B 3I4MJ 5GAHJ 3DU6A 2H27A 1OLTA 3NH1A 4A2BA 3K9JA 3OOUA 2OYQA 3CLQA 3OYGA 2HYGD 4IOXA 1X3WB 4PSXA 3H5RA 4KHNA 1WQ2A 3O6WA 3SJMA 4RW4A 2DMQA 3CTAA 2WY7Q 4HX4A 1B9NA 3V1RA 2V9PA 2R7DA 1UOCA 3S17J 3GBGA 2MA3A 4C2UA 2Y0SA 1C1BA 2L4AA 4B43A 3BZKA 3LDSA 3QFUA 4LB5A 3CFPA 3QQAA 2CH5A 3KLNA 1N32K 1P2FA 4O0IA 5KGWA 3QBWA 2QEXI 4I6MB 2LBFA 2F96A 3SUNA 2KIUA 4ENKA 2JA6J 2E71A 2BXZA 4AVZA 2DT7B 4FLUA 3LM9A 3HIFA 2GBZA 1Y6IA 3E1YA 5E8GA 4RAYA 4A3KJ 4JBAA 3RSEA 1UCRA 4FJ8A 2NRXA 3D5RC 3NF6A 2MSYA 3T8RA 3EKSA 1OR7C 3S14J 1BA5A 3QEWA 2VLAA 2FOWA 1I6XA 3SYZA 4DR1K 3BT9A 4D0PA 1RFQA 2CQQA 3QWLA 1S6QA 5BN8A 3LAMA 1QSSA 3A5LC 1NK4A 4DOZA 1LEBA 1HNZK 2PBIA 3H3OB 3DXKA 2XROA 2HVRA 1IKXA 4HPQA 4O0JA 2JVHA 3KP3A 3K57A 1SQKA 2Y9YA 3ELKA 3O9RA 1NJIO 1V4SA 3OBWA 1WSUA 3QPHA 3H1QA 3BG6A 3GLLA 3C6HA 5FRMA 2HS5A 3HYIA 4II3A 4BWJA 2HKXA 2VJ5A 3KETA 1KZHA 3A01B 3SAHA 2FA5A 2VE8A 2TCTA 2WA0A 3EUAA 4FJKA 2HOAA 2JA8J 4KFBA 3DPUA 1JCFA 4WQ4C 5KRTA 3K4NA 1C0GA 4KTZA 2H09A 4AIDA 3WTZA 3H36A 4GDFA 3K4BA 3DEUA 4CEQA 5IWAK 4R1HA 4EGYA 1QZZA 2FMYA 3KLOA 2XAFA 2XB0X 1RBUA 1IC8A 3U1KA 2RPIA 4CEBA 3EYZA 4NQWB 2R0QC 3B02A 3O9TA 4LFAK 4JI5K 4I9QA 3RPUA 5F0XA 5C24A 5BPIA 1HDPA 4AC0A 5ELZA 5BREA 4JK1X 3O9UA 4IO8A 3RMBA 3EE9A 4HG2A 2KQ2A 2F5FA 2XC7A 1BI3A 4MLOA 3FX3A 1ASVA 1ATNA 2CUEA 2IGKA 3CDLA 1B6AA 2VG6A 2E2JJ 5HS7A 1WUAA 2KMUA 3ZQHA 3MKZA 2OZSA 5LHIA 4JK7A 2O4GA 1YITI 2DPUA 3BG7A 1XWLA 3IC7A 2GXBA 4YIFA 1RPWA 4GV3A 3ZSRA 4M9ZA 3BR2A 3UR3C 1WJEA 1U47A 1SAXA 2PQ8A 2XB5A 2HGCA 5HBMA 3BPVA 2CFOA 1B92A 4CHUA 1WLJA 4FJ9A 4QCLA 1YOVB 2H8RA 4IL6C 3PO2J 2LBFB 2W85A 2OC6A 4DR4K 2ZXHA 2A07F 2VJ4A 5D5VB 4XH5A 1RNLA 1QU3A 2IGMA 3VEXA 2F8SA 2OCCH 2VJJA 3GTGJ 2GUPA 3S9HA 3A5MC 4KH5A 2H8WA 1FIAA 1VAZA 3RSEB 3P9IA 3E0JB 4RDUA 2ID6A 3SEQA 1RKWA 4XOTA 2NZTA 5CVUA 4CUGA 2OANA 2B5JA 2W84A 2ZJPL 4K43A 5E84A 1YI2I 1VQ5I 1CXQA 5HLTA 1YIJN 3WGIA 2F8TA 1HYVA 5LJWA 3LMMA 1XSDA 4Z0UA 3NBPA 2FMLA 4WWCA 2BGGA 2GOMA 2XDVA 2JLEA 3CCLN 1X2MA 4CJQA 4V2FA 4FWSA 1W36D 2IS1A 4XM3A 2M0MA 2ZMEC 1MBGA 4C8NA 1IBLK 5EVZA 2YUSA 4C8MA 3DPLC 5M1PA 3M1CA 2HR3A 3ZPLA 2QGUA 5FPMA 3K0SA 3ENOA 4NCBA 1NGFA 3H1VX 2R5YA 2VWBA 1RGIA 3U8XA 2BANA 4BR2A 1T6CA 3E5UA 5JLXA 3ZSQA 1ZBLA 4JLHA 3V9UA 3PFIA 3RKXA 4R5PA 4KTQA 4DUYK 3GO5A 1KGSA 1YVUA 3I53A 4EVIA 2HVHA 2DA3A 2NYXA 2IVNA 3AG4H 2EB7A 2LD5A 2XKPA 4JN4A 2V1XA 5EU7A 3LWMA 2EZKA 5CYVA 4BU2A 1Q86O 2BYVE 1S1UA 3ENBA 2CQNA 2I10A 2F5CA 1VQLN 3BJ6A 3ZETA 1BIZA 3DFGA 2V26A 4FPBA 2CGKA 4G9ZA 2V6CA 3DOKA 1U49A 2H1LA 1B9FA 1P7JA 4F55A 5FLVA 2E35A 1PP8F 1RT5A 1Y1VJ 2YKMA 2JA2A 2PEXA 2VN2A 5J1RA 5M3FJ 4NBQA 4FVUA 4W5NA 2UUCK 2XHKA 1DPRA 4LGWA 4NC8A 2K9MA 1R00A 2G8KA 4FWRA 1BIUA 1TW2A 3HL8A 2Z1DA 1YS6A 4BR5A 2CH6A 5LRRA 4BRQA 2WWYA 5LJVA 1HNWK 5C0YA 4BYYA 2PJRA 2ZD1A 1L3UA 5AQYA 4MIMA 4KT5C 4RM3A 3D45A 1KFSA 3L9FA 1D0XA 4CJTA 2CO5A 4L5IA 4CICA 3SQNA 1PP7U 4U7BA 3PIOF 2DODA 1W1WE 2Q1ZB 5HP1A 4Y3OA 4CJ7A 2R7FA 1RETA 2P0WA 4BJ5C 3H1CA 3QIPA 4CZMA 2OZMA 4PWDA 4FWOA 2UXXA 3L4QA 2EWSA 3RMCA 2YNGA 4YDUA 3BLYA 2K85A 2M1BA 3O1WA 3H0DA 3L1PA 1WJFA 3AA2A 2ESHA 1ILYA 2LK2A 3TSUA 2O8DA 3OOPA 1JJ6C 3K1MA 2LKSA 5K7FA 1Y1WJ 2X1DA 5J2MA 3K10A 2WBMA 4PFOA 2FE3A 2EFPA 3AO3A 2O6GE 4HBLA 2Q2RA 3A1YA 4DSJA 2XRNA 1T6DA 1YJNN 3ID8A 3C2HA 4LSLA 1S8NA 2JWLA 3LZJA 4FJHA 2OJED 1L3SA 1WCMJ 4E7KA 3Q7BA 1XGMA 3MN2A 3AA5X 1HKBA 1MWMA 1S7OA 4D1QA 4U67L 3DRPA 3HOYJ 1SFKA 2ZNYA 1E3OC 3NVKA 2F9WA 1D8KA 3E3VA 2L7ZA 2O8BA 4KJZA 4CHYA 4RTFD 4QAGA 3OL4A 4AM3A 4IFVA 5C4XJ 2KZVA 1BCOA 1EP4A 1WKMA 1PDNC 3K70D 3PJRA 3ZQLA 5JVTA 1FBQA 3VWBA 4AH9A 3BG9A 2R5YB 4C1NK 3SZPA 4NYFA 3NHGA 1HKTA 2NRZA 3EETA 2NRRA 3AVBA 2CYYA 3QEVA 4W5OA 1TV6A 1YTUA 3OYNA 4XRSA 1SANA 3CCRN 3KX2A 3LSGA 1U4BA 3ZMZA 1C0WA 2HYFA 4B1YB 2WTUA 2XUBA 2QXFA 2Z1JA 3TEDA 3J7ZO 1Z7UA 1LJ9A 3N4QA 3PNVA 1GLBG 4F52A 3FZLA 4OAYA 3CMAN 2D0BA 2ZFUA 4EIAA 3RPQA 2FSWA 2Z1IA 1FYMA 3ZETB 2E5NA 3VQPA 2HF4A 3OHRA 2JMWA 1K9MO 4CJWA 3E9PA 1WRJA 2QWOA 3GZ6A 1DTTA 1QQOA 2OBPA 2DMPA 4CCLA 1E2XA 4DV4K 4IOAL 2P9NA 2EFQA 2D5VA 4A2UA 4KYWA 3I8BA 2V1NA 4BVPA 4WF9L 1WJ5A 5IPAA 3LDNA 2HMPA 1HQCA 1JCGA 3RTRA 4P96A 1G3YA 1NJYA 4GRIA 4OOIA 1MIJA 4DQQA 2P9LA 1NGEA 1NHAA 3HSFA 2PJRB 1J2XA 1P9QC 2VODA 1W7PA 4V19K 3MQ0A 2EHGA 3WUHA 2P5LC 3VQEA 5EXWA 4N47A 3MWMA 1GLNA 2ELHA 1BO5O 4H4MA 4NNJA 2IEKA 3VGKA 3DLHA 2NRVA 1T6SA 2R4GA 3SFIA 2F5EA 1WB9A 4MFBA 1VQKI 1NK8A 3LALA 1A5XA 3O4NA 1S72I 4CE9A 2IP2A 3LSPA 3PUFA 1GLFO 2F4OB 2DY4A 3I55I 2KISA 4PL7A 2A5WA 1QZEA 4DYRA 4FWLA 3CCUN 4HW0A 1Y97A 5CR4A 3ZN1A 3F6VA 4LD5A 1LDDA 4CGIA 3THYB 3RPUD 4BXUA 4JS4A 1VQ6I 2KKOA 3QOPA 4RAZA 2Q31A 1IN6A 4M6YA 4CXFA 4DV1K 4L9VA 1TVRA 2VT2A 4CGZA 5E79C 5AQNA 1V5EA 5JLWA 4A59A 4ZDPA 3ISNC 1HNVA 4XH4A 3QYFA 4X65K 2O8BB 5KPTA 3V7CA 3ZMVA 4C2MJ 1U8BA 2L9RA 4BR0A 3SUOA 4JI0K 4Q48A 4I7FA 3K0LA 4O4GA 4XQFA 3WE3A 1MSFC 4E3SA 2EA4A 3O2PE 3G4SI 1YI2N 1VQ5N 1WSEA 4GKKK 3F23A 3PLAA 5HLGA 4KN7X 1NG6A 1A04A 3H45C 5EEGA 1OCCH 3AVIA 1QA6A 5JS1A 2H1KA 2E2QA 2MLGA 5CLSA 3SZGA 4B3XA 1RTHA 3VYRB 4IHSA 2D0CA 3G6EI 4Z6YA 4E7HA 2EPFA 4JRPA 3TL4X 1KFDA 3FHNA 4OLBA 2GTDA 5LEKA 3L2QA 5M5YJ 2DOEA 1KU7A 3DAWA 1WBBA 4BL0B 2D1KA 3RMDA 2XPWA 5H20A 1VSHA 3S8PA 4XN0A 4AHRA 2K5CA 2MW8A 2P9NB 3CJCA 3GTQJ 3O8GA 2UXDK 2WAEA 1Q7YO 2DT6A 4XOPA 3DBLB 2IA2A 4ISEA 2WC2A 4PJMA 1V4TA 3R61A 1ZRFA 4F93B 5C42A 2KQRA 1RT3A 3SQ4A 1JCEA 3DRSA 1N77A 2P9LB 1TBXA 1RBSA 2K9QA 3TSPA 2QI2A 2XF6A 3OSFA 4EV0A 2M5WA 1W7PB 1YTAA 1JXSA 2JSPA 5AQHA 3KYCB 3AL0C 1HOMA 2GA1A 3HRMA 3O3HA 3LSRA 3JREA 4BR7A 3JSMA 2GWJA 1FSEA 2JPBA 2VG5A 4KMUX 3SQ2A 1KCFA 3QNNA 5HS8A 5FDLA 4AHUA 4YRVA 4RW7A 1ZR4A 3BPXA 2ZWHA 2JTVA 4FJ7A 1AWCA 4DU4A 1BISA 4XL9A 4ZDOA 5AQIA 3M8PA 2X78A 3U9ZA 1LW0A 4MDAA 3BR5A 1TUUA 4G9YA 1XSXA 2GIVA 3AVHA 2KFZA 2LFBA 2EV0A 3G1OA 5KGXA 5L3FA 5J2PA 2OPPA 5J3LA 1NK9A 3ZQFA 1TP4A 1IN4A 2Y30A 1MDMA 3DOLA 1IG8A 2M45A 5L3GA 4EFHA 3I56N 3UKUA 3NCIA 4B08A 3CYMA 3VF2A 3OIPA 2GEMA 4GV9A 3BP8A 5JVHL 1FY7A 3CCMI 1AA7A 4CEOA 3R9PA 3MAQA 4EHUA 1YW8A 3HOUJ 3MN5A 2R7UA 4LF4K 1L5UA 4B9NA 3W2VA 1XMQK 3SUQA 3KP6A 3C0BA 5LHGA 2UUBK 3D7EO 2XGDA 3CUQA 1LFBA 1C0FA 1JXEA 1W36C 4DFMA 1QVFM 4UUVA 4GGGA 3JTGA 5D3GA 2ZJQL 4WQ5C 5FD5A 4P1WA 1ACIA 1CXUA 4RGXA 2VBYA 2CV0A 3TAQA 2M7AA 4Z94A 4XLNF 1Q8IA 3HI0A 1Q81O 2E1OA 2HPMA 3S1NJ 3MCPA 4DSFA 2FJ1A 4JYAK 1HKQA 2PYLA 1ITYA 1O4XA 1WSHA 1TAUA 1P6RA 5CVIA 3AVFA 5JFRA 4BQZA 2YNFA 4D7NA 5AQJA 4HF1A 1DUXC 1A6IA 4U0WA 4B1XB 3QAHA 4A3LJ 4LSNA 3SPYA 4MLHA 5TKYA 2BY3A 1ZLJA 4AVPA 2VC1A 5LMNK 4NCAA 5TGTA 1UWBA 3DLRA 2DMUA 1ETWA 4PJNA 3BOQA 3KVGA 3TAFA 2ISZA 3JS6A 3CM5A 3V6DA 1OFCX 3AY9A 3FFKB 1TT0A 1VHXA 4B44A 1T33A 1Z3YA 1WN7A 5AJ3K 3COAC 3WXIA 4CIFA 1BQMA 3GFJA 1EF4A 2A6AA 2BEOA 5GAGP 2PYJA 4KHQA 3A4CA 3KK7A 3KWGA 1TYQB 2UXNA 2HSTA 1HJOA 4DR2K 2QQ9A 4S0HB 4X66K 3QYBA 1RDWX 2V79A 1ZG1A 1TQMA 2RQPA 1X3UA 1CF7A 3K5LA 1N78A 2D2WA 2WTEA 3HSEA 1K7AA 3I0TA 1WSIA 2YX7A 1WNSA 2W25A 1RT1A 2MFZA 1EA3A 5FKMA 1MDMB 4FLZA 1Y0UA 4KB1A 1U5TC 1PVEA 3UKUB 1T08B 1IRZA 4RMNA 1NJWA 3D0SA 2XAUA 4FVMA 1VQKN 3JAMZ 5ICFA 1VQ4N 4QS9A 1MWKA 1S72N 2KDOA 4BGBA 3V4IA 3O3KA 2STWA 4TSXA 1JKHA 1ZBSA 1JL2A 3R4KA 2UXBK 1HMVA 3TDZC 2ZFWA 4DFJA 2K4JA 1W7PD 2I8DA 4BGAA 3CUQB 5DD4A 3DWLE 3FE1A 2K40A 1X1PA 2ZQBA 1ZKGA 2K4BA 4FX4A 1RT2A 3D5SC 3H3UA 4MQ3A 4KIFA 1J53A 4HQEA 1T95A 4DTXA 4LK1F 2C6YA 1Z91A 4OAZA 1OYWA 3VQBA 3PSIA 3TO7A 3OIOA 5SZTA 2P81A 2K86A 3VGMA 1TNSA 4EQQA 4KREA 4BRKA 1E3HA 3TTFA 2LF8A 4FLVA 4NUBA 4YG2F 3MZYA 4ENJA 3BQYA 1W97L 2EIKH 5JICA 4NYNA 5LHHA 4HWIA 3BG3A 3DLEA 2IPQX 1LB2A 3ZEUA 4M73A 2J4RA 1ZBUA 4A62A 4HF2A 4I9LA 3PQKA 1ZH5A 4U0YA 1ON2A 1Y0NA 4RGSA 3ZSOA 1KXPA 4ELVA 3IMXA 3BTJA 3MVPA 1R5ID 4H8KA 1KAXA 1FK9A 1XQSC 4O55A 3GZNB 1I6HJ 2OUMA 5EY4A 2QWWA 3BC8A 3FDYA 2FC0A 3V9WA 2B6AA 4BBRJ 1O7LA 3G6EN 4BG9A 5HRRA 2XASA 1BQNA 1J5EK 3ZQQA 1SD5A 3FFIA 2IC3A 1LFUP 3TTCA 3NGZA 4JV5K 1SAUA 2EX3A 1F36A 3RDIA 4HAMA 3FF5A 5JVGL 2CG4A 1XMAA 4JI3K 2IGIA 3KEOA 3QRFF 3S3NA 2QM1A 1SAZA 4BE0A 4PL8A 4E7ZA 3G71N 2WOMA 4PKHA 3TP3A 1USTA 4H0VB 1IH7A 1NNEA 1ZBIA 1SD7A 2QKLB 3EZWA 3M8SA 1CLQA 5CQGA 3S3OA 3FLCO 3WTVC 2JQ7A 1XN7A 2WY8Q 1EQYA 3EE8A 4RB1A 1JUSA 3GG4A 3NWTA 1MA9B 3ULEA 1OH8A 2OPRA 4WX9A 1BJAA 3V8JA 1RDDA 1G59A 5E8IA 2LTPA 3F0CA 3HOZJ 3RWUA 3QYEA 2D0AA 4K0KK 2KIMA 3KYDB 5JLFA 3MFKA 1XDUA 2OCEA 3OW2M 1W9HA 4CA0A 2PLYA 5IOZA 1NK7A 1O7FA 4BKXA 5AQXA 2YCHA 3F9MA 3LPUA 1QBJA 4CERA 4K41A 2X6SA 1ZRDA 1IKYA 4AILC 3OL3A 3Q0UA 3HVTA 4DUZK 3AG2H 1A31A 3DQVC 2DQLA 1VSJA 2V9KA 4HEA2 2NVUB 4O44A 2GWKA 4X6AJ 3M8EA 5FLXO 3W6KB 4H0EA 3PSFA 4RB3C 3SBTA 5AZJA 3QPSA 1YHQI 3G0ZA 4IDKA 3I5UA 3K5MA 4OIPF 5EZGA 2W57A 4QPQA 2BY0A 3HTUA 3CCMN 3PIPL 2HHXA 2VG7A 1MBKA 1ZELA 1LEAA 4KH4A 1NGDA 1XB4A 4FK4A 4CEEA 2HBLA 4XICA 3VF6A 5FPDA 3UB5A 2GBYA 4OWRB 4DQRA 2YJFA 4Z4IA 4A5MA 2OPSA 4G1QA 3WU0A 2CFXA 2E7XA 1USSA 3RQIA 1EX4A 4FYDA 4ITVA 1VF9A 3IAS2 3FXMA 2XRLA 4E19A 5LY3A 3SQ1A 5KHDA 4CVNE 5JLHA 2CQKA 3V81A 1JLCA 2X1EA 4GYIA 4B4CA 5E3OA 3RIRA 3UE5A 1T8IA 2GOXB 2V52B 3LDLA 2OU2A 3ATUA 1IG9A 3RKQA 3PX4A 2VQHA 3MKWB 1P4WA 3M8QA 4XMYA 2V9VA 1L3TA 3K9TA 4HX8A 1FOYA 5KK1A 2OZUA 3AV9A 2AP1A 1FX7A 4PKGA 2CMPA 2KL4A 2DFHA 3O9SA 2OTLI 2VQEK 4HUEA 2KZZA 1QRYA 1KU9A 3D1NI 3ZR8X 4N9HA 4N5SA 3TKYA 2YI1A 3K7AJ 4H5RA 2O9LA 2FBIA 2D5RA 3MEDA 4IFEA 4F2RA 4RCHA 3CJQB 3GXOA 1T3VA 3K4CA 4PCQA 2FBTA 2V6EA 5F1XA 4E6KG 3RZOJ 3KEYA 2DMNA 3OBYA 5GINA 3J7AP 4P5OA 2Y48A 3T69A 3OYHA 1X9SA 1K4SA 2IRFG 5IT9K 4B3TK 1J54A 1U2WA 1I1GA 3RKYA 4Z4GA 1D8JA 4XKVA 4BR9A 3LZIA 3RRGA 4BAYA 1E3PA 3ULEB 3P31A 2IDOA 4GXOA 4HDVA 4WFNL 3F5TA 4XRFA 4HF0A 2D4WA 2LRDA 2YNHA 1UELB 3WG9A 3OYCA 1Y39A 2ZBKA 3CHWA 3FXQA 4FW1A 5E17F 4XEIA 1B72B 3DKXA 5C10A 1MD0A 2LNBA 4FJLA 5GIOA 3H3ZA 4YELA 1OVQA 4BDYA 2NXNB 2WADA 1KA8A 1DGWY 4BRGA 3A2FA 4G6TB 2LSNA 4IKFA 4AU7A 1FTZA 4C23A 5AQUA 1G4DA 4RBOA 5KVRA 2FXUA 4IBNA 3WE2A 4XKWA 4BQOA 4A3IJ 3WHBA 3C2BA 4RA2A 3PO5A 2Z33A 1MSEC 4IJNA 1ZC6A 4IHTA 3VYUB 3U9DA 1SMTA 1T2KA 3VEOA 4JNEA 2NRHA 2ZGYA 2WUSA 3FGUA 3V9SA 3GEZA 4YOUA 1REPC 2YX4A 3HKZN 3OYDA 1X9MA 1NKBA 4DQ8A 5AQZA 4PUSA 3J81K 1F5TA 3VQ6A 1ETKA 3HPHA 3J81O 3AVKA 1U3EM 1ITGA 1XSVA 4KIBA 4DMNA 1LV5A 2HHUA 4YDUC 3FXKA 5SWMA 1BI2A 4FW2A 1LOTB 3PV8A 4A3BJ 3V4GA 4AM7A 3IAM2 4M3GA 4B3AA 1HW5A 4J2BA 5F27A 5HL7L 3SNNA 2LKPA 2R7WA 3OTOK 3J7YP 4FWPA 1SFOJ 4CZHA 1A35A 4CJFA 5J1YA 2GV9A 5IOYA 4NDLA 3IUCA 4I7HA 2V51B 2E20A 5F1JA 5JHFA 1TL8A 4K8ZA 3H08A 5CVVA 2UWMA 1GT0C 1ERDA 1QO0D 5EDNA 1X3NA 1MNMC 2XPUA 2I7PA 1BW5A 2L7KA 2YHAA 4IHYA 1IO2A 1RDAA 1A6QA 2A61A 1JHHA 1R59O 3D2EA 1S1WA 3FZFA 3QO9A 3V8KA 1YRNA 5GADJ 4I2QA 1WAFA 1FT9A 1LWFA 3IRQA 4LIUA 1SFUA 4B47A 3SV3A 4L18B 3DTIA 1JJ2M 4MFDA 1SD6A 1E3MA 4WE1A 2FBVA 4H5NA 2YNIA 4F2SA 3P9CA 5DM6L 4KAZA 4MEYF 2DTRA 4CBUA 3P1GA 5ADXA 1XX5A 1NGHA 2VI6A 1ZAOA 1K6OA 4DU3A 2X6OA 1LVKA 1I27A 1GUUA 2O8XA 4DR5K 4BH9A 1ZBFA 1NG9A 2IGNA 3FISA 4CBXA 1DPUA 1YF5L 1ONVA 4JK8A 2HDCA 2G7UA 1UHWA 4E7JA 1HPZA 3H9GA 2XY7A 4EJWA 3DRRA 5KQ8A 3WNGA 1QSLA 3U2RA 3M8RA 4DV5K 3LAJA 1SV5A 3CMEI 3EKUA 2X6YA 3KZBA 2VASA 1GXQA 4HLYA 2XY8A 3LSTA 4JRQA 2ME6A 1IDYA 4OMYA 4MTEA 1QHHD 3GTLJ 5K1YA 1IN7A 1MBEA 4BRHA 5DUIA 2LSOA 2DMTA 4R8HA 4B09A 1HYZA 4O6JA 2KP6A 1XMXA 3ECOA 4JYKA 3SYTA 1LAVA 2X48A 3C2GA 1TKZA 3DYAA 5AIPA 2G8IA 5KPZA 4XLPF 3O4QA 4UUTA 4ANJA 1PUEE 4ELTA 1HKGA 3WU2C 3ZT0A 4RB0A 4OIRF 3IHUA 1KYWA 4NLBA 3VOEA 4EZ9A 3NGIA 3FMSA 1JI8A 1XMOK 3CC2N 3TR8A 4IRGA 4E7LA 3BTIA 5AQWA 4EM2A 2YR2A 2IA0A 3CJ7A 2PY5A 4BY1J 1HA8A 4JD2A 2DXIA 1YHQN 3R60A 4DFPA 2VGMA 4LMYA 3BJAA 2VE9A 1MBHA 5ICGA 3T19A 2W6KA 2V7FA 4LG0A 4JKBA 1BW6A 2NRAC 3RQ4A 5AQTA 4OPKA 2HTSA 4JAXA 2Y0SN 3P83D 3K59A 4B1UB 4FLWA 1C6VA 5LL6Z 2QSHX 2JZYA 2PFUA 1NKCA 1WJCA 2YHBA 1IBMK 1G99A 1TTYA 4M42A 2X1CA 3D2EB 3BZCA 1E4GT 1YRNB 3CFRA 1VQ8I 4N41A 4G7HF 2IVMA 1K8KA 3BR0A 2GWRA 2Y1IA 2FQ4A 4M6VA 1FC3A 3AKZA 3HSCA 2LH9A 4DTPA 3U3YA 3SI6A 2PZSA 2LC2A 1TT5B 3CCJI 2V1UA 3H9QA 2ZE2A 4BACA 2HXOA 4U7DA 4A6DA 3N97A 3ASMA 1X1CA 4M3BA 2LF7A 4QS8A 2I5JA 3AO2A 3GTJJ 4GV6A 2AJQA 3KPHA 1Z1DA 3LP3A 2NNNA 2L2OA 2PMHA 3I58A 5ILUA 2UZKA 2P4WA 3NF9A 2CGLA 3PX6A 4N76A 4DR6K 3G25A 4O5FA 4YOWA 1GV2A 2ISYA 1ASWA 5CE3A 2IS3A 1VZ0A 3CDIA 3HOVJ 4XK4A 4KRFA 2CV1A 2R7OA 2RF2A 3VSKA 3KK3A 3WU1B 5D4SA 4E1MA 3FBIB 4A5BA 4QIWN 1R58A 4BY7J 2R92J 1NK5A 3NF8A 3ATVA 3MKLA 1W0HA 2ELJA 3MN7A 4YHHK 1QZ6A 1JHFA 5GAEP 2ICWG 2DT5A 1HSJA 1X1BA 3JW4A 5LGTA 2VCPA 5J4YA 4MLEA 4Y1DA 3S1RJ 3V1QA 1UHSA 4FJJA 2CH0A 2P8TA 1JJ8C 4RM2A 1L3LA 1ORKA 1YUWA 1VQOI 3LANA 2X51A 4FLTA 3BCBA 1W2BM 4L3QA 4H5TA 1H9TA 5C12A 2A6EF 2CSOA 2EZIA 4UVAA 1DU6A 1HSTA 3D2FA 3QERA 3VEWA 2K3PA 2RQQA 4RGUA 4DNCA 3KEQA 3DWLA 4WQ5A 3C18A 2HHWA 4IG0A 4BWMA 3CJ1A 1OH6A 2DA7A 3HP9A 4HSRA 2EFNA 3KE2A 3JTHA 4DYCA 3KIOA 4JD2B 2E7WA 1GLAG 2PN6A 1FXXA 3OS0A 1A36A 4CD1A 2VPRA 4XR6A 1SVOA 1S3XA 1YIJI 5AQPA 4IDHA 4A3JJ 4LG0B 3GCMA 3PIPF 2P7VB 1LAWA 4NB4A 4BJTA 1HJRA 2R5ZA 4RWTA 3VESA 4MHGA 4M6XA 1ULYA 2M3AA 5M5WJ 3KTQA 3TU5A 4XIDA 1R4NB 3TAEA 1BCMA 4DV2K 4ISGA 2HDWA 3K2ZA 4W5RA 4FE4A 3HRGA 4HHTA 4IEEA 4HOBA 2KZGA 4F9OA 2Z2SB 3BR6A 4Q47A 4LFBK 3DF8A 3WXJA 1VI0A 3HHGA 4BRLA 4A5NA 2VBZA 2UYTA 3GLXA 4HUGA 5FKOA 3WODF 1HRHA 3ZLJA 1XUPO 1K8KB 5CVJA 3ZMTA 3A0BC 4S05A 4BE1A 3TWHA 2BW3A 4BEHA 1MGTA 1HXDA 1RILA 5F0HA 4B9UA 2QWNA 3I0RA 4XONA 1RBVA 2HFHA 3ZP5A 2DFEA 4EEFG 4B1ZA 3AL0B 1JLBA 2DI3A 3MZ8A 5C15A 4KHSA 1V54H 2BY2A 1JE8A 4ELUA 2NLXA 2XGEA 3TW6A 4WCGA 2X6XA 4BGDA 2M4GA 5E41A 1TL3A 3MAJA 4OKKA 2XY6A 3FXUA 3IG1A 3B8AX 5A2QK 4LG3A 3OSGA 1VSDA 4XLFA 2RKHA 2FF3B 1J5YA 2DN0A 1EH6A 5J2NA 1R1UA 2RKIA 2JWTA 4OIQF 5AQVA 3OS2A 3KK2A 1GLJO 2IAIA 3GDQA 3J7AY 2OQRA 4A69C 3A02A 3WEEA 1BU6O 5C2FA 3WTYC 4DTRA 5K5RA 1KLNA 1HC8A 4XN3A 2MC4A 1U04A 2Z5UA 4ETSA 3BZ6A 1U48A 4BRMA 1IN8A 1Z9CA 3CMEN 4DTNA 3HP6A 3JSOA 2QF7A 2ATQA 3B6CA 3B6AA 2QWRA 2CRGA 2E60A 1FSHA 1SC7A 2O8EA 1LWCA 4P9UA 4DZPA 4Q5SF 1VSKA 3D2FB 2O8CA 3VTIA 2A42A 1XC5A 3MD2A 3RI4A 4YY3K 1WSGA 4K42A 2GXGA 3CQ8A 2P51A 3R0AA 1YJNI 5LFAA 4O5BA 3EPZA 5H6QA 3TOAA 2VIXA 5D6FA 2ECCA 1P4AA 1GDTA 1XMKA 4JI7K 4A0ZA 4CZJA 1R9TJ 2R5ZB 1FW6A 4ISFA 3FM3A 1NGAA 5EG0A 2VOOA 2WAQN 2IVOA 4DTMA 4CJLA 1OYYA 2FSJA 4OPHA 3RR7A 3L2WA 1H9GA 4CCKA 4B48A 5BPMA 1EKEA 5KRSA 2YHYA 3F6OA 4ILGB 2Q97A 2J5OA 4AUXA 3AO1A 3I59A 5FFZA 3TBIA 1RBRA 2YHWA 2Y1JA 2F2EA 3Q3SA 3QU3A 3CJTB 5GTHC 5FKLA 3M3YJ 2HEOA 5LGUA 4M3WA 3CCRI 1ZG5A 5B1BH 3K58A 4BEHB 5C3EJ 1S5LC 2MBFA 3KKSA 1OPCA 1I39A 2L7MP 2DYSH 5AQQA 4ENMA 2PJPA 2Y69H 4F3QA 2KZMA 1N5YA 1REVA 4Q5VA 2XV4S 4ZC3A 4DBQA 4DR3K 3WNHA 4AYBN 3CMAI 4LJZF 3FMQA 2CW8A 1EWRA 1FP1D 3CQZJ 1BN5A 3HPGA 3A5NC 1VQ8N 1K73O 2HNZA 4YFNF 4JKCA 1DLOA 1UA1A 1OH5A 4FWQA 3JR9A 1ZREA 3BJOA 1WVRA 4CZLA 1X4PA 3Q0WA 4Y4RA 5BNGA 1NGGA 1EV7A 2HHTA 2HHSA 2NUBA 5DM7F 1S22A 5I42A 3CCJN 3BROA 2P5VA 4LLLA 4KA4A 1BM9A 5J4VA 4HV6A 3K5NA 3TQNA 4EZ6A 1V5FA 1QSYA 1U5TB 3QOEA 1EETA 4CZIA 2NS8A 2DPNA 3KWIA 1T03A 4I76A 3WEEB 1Q9XA 4A57A 1QQCA 3O3GA 1CZAN 2DK8A 4EM0B 4XLEA 2JK3A 3SUPA 3ZSXA 1FJGK 4CSWA 3E5XA 3W3DA 4P55A 1IGNA 2VXDA 2GXAA 3SMSA 4AHSA 2O8EB 3QB0A 4U87A 1K8AO 3C95A 4PJLA 4BXXJ 3AA4A 1KSPA 1ETVA 4FQGA 5K7HA 3MMVA 2O8CB 3K4LA 4CZGA 4KFCA 1VQMI 4HVJA 4DR7K 4DSEA 3CCUI 1IJWC 3HGGA 3OYIA 4H0TB 4OKJA 3ERMA 2AXLA 4HDUA 1BGXT 2CU7A 3LA3A 1BA0A 5F04A 3W6VA 3BDDA 2YJEA 2VQCA 1QVTA 2ZJRF 3H5NA 2IS6A 4JQFA 4ZYGA 4NO7A 3QFPA 1Q1HA 1GOAA 2VGNA 1XNRK 3U6FA 3CQYA 5LRSA 4B9SA 1VQON 1M1EB 2HPIA 4WCEL 2E1MB 3FXLA 4BRCA 1JL1A 2UU9K 2NVTJ 2Z1HA 3T3FA 5EG0B 4HUFA 5GAHP 1NLVA 2H3GX 2ADUA 4JP0A 5E26A 2HXIA 1TWAJ 1BL0A 1SD4A 4H5WA 2W00A 3DI6A 1GHCA 3I59B 3Q7CA 1H0MA 2V1DA 3GWZA 2HQ5A 1BI1A 2ECBA 4MTDA 1LUJB 4O8KA 4W5TA 2XO7A 3MECA 2W48A 4M3YA 4BG8A 3DXKB 3KLFA 2YKNA 1JTXA 2OPQA 3JXUA 3OIQA 2R7TA 2YHXA 4AQYK 1RI7A 3VMFB 3GVAA 5HLHA 4A61A 2JN6A 5F0FA 4B1VA 3P4IA 4A3FJ 5LGNA 4H5VA 1FBSA 2AS5F 2VQLA 1IJJA 3DLAA 1QQIA 3FMRA 2MYSA 3B6PA 3TPQA 5BMZA 4RW6A 5BR8K 2DK5A 5B8HA 3ZRGA 5L3DA 4K8XA 4CECA 1QPMA 3U21A 2JVGA 3N05A 3HJFA 4BQAA 4GO1A 3FR0A 2DJIA 1BIBA 1GVJA 5KAFC 2XSJC 3N4PA 5FD6A 1S5JA 2BVMA 4ASNA 3I71A 3KK1A 1IG7A 1XI1A 4Z4CA 2H94A 2JT1A 4BQQA 2KJBA 1R4MB 1NMNA 2Q1NA 4ICLA 3BY5A 3V9ZA 2DPDA 4NHJA 1VFCA 4JX4A 3L2UA 3FXRA 2VL8A 4DV6K 4DFKA 2HI3A 2X85A 1HPMA 4GFBA 2E6LA 2G9WA 1EXQA 4H0YB 3A2KA 1KQSM 5B1AH 4FO0A 1B1BA 4NLCA 2WB1N 3CQXA 1NK2P 2BBYA 2EINH 2NRTA 2QWMA 1W4MA 5FKKA 1NGBA 3VOVA 1D5YA 1IUFA 3KZYA 3R6MA 3QBXA 2EJRA 1ATRA 4E89A 3D0PA 2QQBA 2ZC2A 3VQ5A 2OTJN 5EGOA 2IW5A 3ZQGA 5ILVA 3HVRA 1H1VA 2JUCA 4L0ZB 3QIOA 2IT0A 1IXRC 1R22A 2AQEA 3S2HJ 1YTYA 3T1YK 3I56I 1XHZA 2KFNA 4DQ2A 4B9LA 3HOSA 3DLLF 3M6GA 4W97A 4KV8A 4CBWA 4DHYA 3CERA 4ID5A 2L9VA 3QMLA 1I5ZA 2HHQA 3E7LA 1UHMA 1TLHB 2L01A 3J8AA 1JUMA 3G10A 4II2A 1VSEA 1FKPA 2QZ8A 2VKHA 1ZK8A 1H89C 1GVDA 1MZBA 4E0DA 1EH8A 3HT3A 1R6RA 5B3SH 1KTQA 4KITB 2NVXJ 1DT9A 2XPVA 1GLCG 1FEXA 3VGLA 3THXA 1KLMA 3VEVA 4KIGA 3OS1A 4CIEA 1LNWA 4G7ZF 2P5KA 4F3OA 3C6TA 3OR1C 3FKIJ 4HA8A 3DU5A 1JTYA 1C0UA 2F4VK 2V7ZA 2HOSA 2MLKA 1T0FA 5E3MA 2L7FP 4BHCA 1ODDA 5ICCA 4Q4ZF 3QPLA 4KO0A 4RAFA 4Y0WA 1YLFA 3RRHA 5LLQA 5EF6A 3SDGA 4OIOF 2XF7A 2YSRA 5DS9A 4G8XA 2DFFA 5E20A 4DLEA 1BI4A 3VDXA 4JI6K 4Y33A 3S16J 4RB2C 5EYRA 4N0BA 3U1DA 4BDPA 4H03B 3SZTA 1KYZA 2DCEA 3CJ9A 3WXLA 3KP4A 4ILJA 2IOCA 1O57A 2K7LA 1ETYA 4WFBL 3I4NJ 2BV6A 1MMGA 5HNHA 2EFOA 2HOTA 3W3CA 3DMJA 4IOCL 2QSGX 1MNDA 1XC3A 1F4KA 1T38A 1TWGJ 1VSMA 3RMAA 4DIQA 1NJXA 2QLZA 4MO7A 1GXPA 3MCZA 4IFYA 2Q0RA 2E2HJ 1NH3A 1ZHFA 3LL3A 4ESJA 4TV7A 1HYSA 3JAMK 4OU0A 1BR2A 1QGPA 4BRIA 5HRNA 3JAMO 3QODA 1WBDA 1S1VA 4MFEA 1MW7A 3H0GJ 2B9SA 1Q18A 2CGPA 3IP4B 4ZTJA 3LFUA 3DKYA 4CFCA 3F72A 4CEFA 1RTDA 3AVJA 4UVCA 3RSNA 1DTQA 4OGEA 5DCMA 2XGCA 3S41A 3HKZA 2A3SA 4FJXA 1J9AA 5IP7J 2M7BA 5FFXA 2ACJA 3HJEA 1Z05A 4B9MA 2LP0A 3PIOL 2VPLA 3B6OA 2KDZA 4IPAA 1T8EA 1IKVA 4C2TA 3WQTA 1M1KO 2VT3A 1UB9A 1XNQK 4AD9A 2ZXJA 2UUAK 5IYBJ 5DUKA 1YFHA 4EJOA 1D9DA 4BR4A 3AVNA 4M3RA 2K02A 1NK0A 1VQ4I 4IG3A 5CKTA 3GFIA 4DTOA 4LF5K 3LFKA 5AZIA 3JRAA 1Q82O 2O8DB 1M90O 4GKJK 4WK8F 3MX5A 4C8LA 2XGXA 1VQMN 3F8BA 3IH4A 2ZO4A 3FZVA 3GW2A 5JI6A 5IT9Z 4DS5A 1OKRA 1V55H 4DQPA 2ELKA 1VSFA 1FKOA 3ZCMA 2JRMA 1IV6A 3TARA 2NVQJ 3MEGA 3O8HA 1TAQA 4A3DJ 3ASOH 3L3VA 3THXB 1HBXG 3FBNB 4IX7A 3E1SA 5K5QA 2K9LA 3BR3A 1STZA 2XKOA 3P5JA 1YVNA 3E66A 4BRAA 1YE9A 3OR2C 2YPRA 3GTMJ 3C6UA 1Q9YA 2P6SA 4A12A 1EH7A 3BDPA 1PYVA 1A5VA 4XKCA 4H0OA 3HTSB 1OCOH 3BTLA 4K2EA 2XSDC 3EYYA 5FJ8J 4CHPA 1BUPA 3VPRA 3C7JA 3CC4N 5FLMJ 1BI4B 4CJKA 4I2PA 4EJTA 5CZ1A 1D5AA 2E19A 4RG8A 3QEPA 5J2QA 4LF8K 4I09A 5HLFA 2E2OA 1CZBA 5M1OA 1LW2A 2P9KA 5K14A 2ZM6K 1IXSB 1X9WA 3Q9SA 3GMEA 3G2BA 3FK6A 4XKBA 4G6DA 5IP9J 1HUXA 4OJRA 2HW3A 2NOGA 3QNOA 3IWZA 1B59A 4JKHA 1TW3A 4W1UA 2GELA 1B8IA 2GIZA 1R5GA 2JA5J 1RT6A 3QDKA 3IKVA 3A03A 4LK0F 3EZ5A 1GLEG 1YJWI 4LFUA 2E2PA 3DP7A 1A5JA 1Y56A 4DCHA 4CHOA 2W7NA 1VQ9I 2ZF5O 3C7NA 3M07A 4C9YA 1WSJA 3G71I 2X0LA 5LBQA 1SKRA 4UXNA 3R3LA 1N36K 4F92B 1YS7A 1TK0A 3ASNH 2L9SA 1ASUA 1IRXA 1IRFA 4DYQA 4L5EA 5DCMB 1JKOC 1OISA 2DO7A 2AO9A 4CFBA 3CUOA 4B9QA 2NRWA 4RLFA 5B5EC 5DDGA 2BE2A 1ZGJA 5TRDA 2YV0X 3JRDA 3AVCA 4N9IA 3VQ9A 4B8CA 3P39A 4Y13A 1G3TA 1MMDA 4IXAA 4FSVA 1OCTC 3GX4X 2A6TA 5E1XA 3FK7A 4ZJZA 3RYRA 2ZSHB 3HSTB 3THWA 1R71A 1MMNA 3E97A 3DLBA 2XAHA 4M7YA 4GCVA 5AZIB 2X9DA 5BS6A 4EJUA 2F6CA 3CCQI 4CGGA 2HOEA 1R1VA 3AVLA 4BC5A 3ZQCA 2KIFA 2KHOA 2LY9A 3K1NA 3CJNA 1WH5A 4CZCA 1KU2A 2HNHA 2E4LA 4KHUA 4NC6A 4A2AA 2P9IA 1JKPC 1YW7A 4C30A 4JI1K 4JI2K 4GVEA 3L2VA 5FKNA 2RGVA 4NB5A 1MU2A 2DFIA 2AA4A 2YX6A 4HNTA 3CJRB 4JX5A 4XSZF 5FROA 3AARA 2ZKZA 3E6DA 3M4OJ 3MDQA 4BRNA 3SV4A 3CF5L 1G3WA 1C1CA 2BE5F 4DGWB 4OLAA 4LIVA 5H2FC 1IF1A 5LD2C 5HODA 1FPQA 2G0EA 4ZDLA 1J6ZA 2ESNA 4KN4X 4I0AA 2HQRA 1NK6A 4LB6B 3AGRA 2G8VA 5HNFA 4JKAA 3H46O 3CDHA 3F8NA 1D5VA 2W6LA 1LDKB 1Z67A 1QQMA 2ZJPF 3MCAB 4RGRA 2DOFA 5D6EA 4YIRX 2AHQA 1RT4A 1G8XA 2PMZN 2B0LA 1LQ1A 2P9KB 1CQTA 4OPJA 3TP0A 3WNEA 3ZT3A 4F3TA 3L3UA 3DV8A 1T56A 2M30A 1NGIA 5CJ9A 1B8IB 3MN9A 3ABTA 3TSQA 4CZKA 5HLIA 1JKQC 1R23A 2LKXA 3NVMA 1MMSA 5CVRA 1ZGWA 3DTEA 2FSKA 3C1DA 4HTLA 3ZX3A 5HOOA 1F9NA 1E17A 1RDBA 3EY1A 4GNIA 3L09A 3C7NB 1Y8QB 3HZJA 2IJLA 3H6EA 1FYKA 5IT3A 2GA2A 4A0XA 3GTOJ 2HHVA 2H6CA 4OMZA 2EA2A 4IEJA 3IH2A 2VJIA 2DTZA 4A3MJ 1D0YA 3H92A 3RCOA 3KFWX 4GW6A 2E1NA 4P9FA 1HW1A 2LY1A 4K25A 2FF6A 1YX5A 2CJJA 1OCPA 1WJDA 3HK2A 4I02A 2W1OA 3VQ4A 1NJZA 3E01A 2FOKA 2KRFA 1SKSA 4JKFA 3H35A 5T7BA 1J5OA 2L02A 3FHZA 4M3FA 4LD0A 3H3NO 4J8FA 3ZT2A 3HOXJ 1ATSA 1LFPA 5KNLA 3HM5A 3THWB 4KBOA 2DTUA 1RUNA 4BRFA 3GYHX 1JT6A 4RW9A 4B8AB 2A05A 2MD0A 3K69A 3CCVI 2Z1GA 2PAVA 3BWGA 2ME0A 4ABZA 4CF0A 4MQVA 2G8HA 3CMMA 3J80Z 4IJAA 1QS4A 3QINA 2P1JA 2I7NA 4FJIA 2P9IB 2M87A 2R7XA 4FZXC 4EP5A 2A68F 3HL2A 3UIQA 4D5FA 3PO3J 3LAPA 4D7MA 2QK9A 1HCRA 3LA7A 2HWVA 2HBKA 4BROA 3ULQB 3T8TA 1N6QA 4QPOA 3ZX0A 3CLOA 1ESVA 4F4KA 2IXSA 4X1EA 1WH7A 1XGOA 3MKYB 3K2PA 3F21A 1DP3A 2A69F 2LVSA 4CEDA 1G15A 4V2GA 3DXJF 4O3MA 1EO1A 3ZMSA 2QA4I 1QQNA 1L0OC 4HNVA 3AGKA 3ZSZA 3LDOA 1BC7C 4BUPA 4NXMK 4M3UA 1BWFO 5TJJA 3K4MA 3R0JA 3TO6A 4CJVA 3HTVA 2OD5A 1UG2A 3GZ5A 9ANTA 2F5DA 2HVQA 2O8FA 4FE7A 1HNIA 4HQMA 5F2RA 1Z7LA 2XVCA 1O1WA 4CFDA 1FBUA 2E1MC 3NWSA 2LMDA 2F5VA 2E1CA 2K3FA 2DU9A 4UY8O 3V1OA 4IEIA 5BPNA 5E1WA 4FOEA 5J40A 2DA6A 4YFKF 2R7YA 3FKJA 4I2OA 1DKGD 4HCBA 4UUSA 1R0AA 4FZYA 2LR8A 2DDAA 3SXYA 1FNNA 4FTHA 3L00A 4KHWA 1FYLA 2VQGA 1S6PA 3CESA 4IOCF 3PNTA 5J8CA 3BQZA 1U6GA 4M63C 2E1YA 4KI6A 3AG3H 1RR7A 1MJAA 4EATA 1NU0A 1NM1A 4M45A 4L9NA 1WZ2A 1YJWN 3SHFA 1NGJA 4YEJA 2QENA 3WHCA 1HDDC 4CEZA 5GP9A 2OQGA 3PQJA 3MWPA 3IL2A 1VQ9N 5CYMA 3BR1A 3V7RA 3IFRA 4IOAF 3S2WA 4N4OB 3AA3A 4JS5A 2CS3A 4JI4K 2HU9A 2QWLA 3CG7A 3CPWM 3VQ7A 4GYGA 3WT0A 4HLXA 2R7SA 3FXJA 2KPMA 2COBA 2KLAA 2W42A 1CF7B 3CC7I 3ZSVA 4CCMA 4EM1A 2PX9A 1VQPI 4CHZA 5GPAA 2HHHK 1PUFA 2ITMA 2GLOA 3HPOA 2WAQA 1MBFA 5DK5A 3TDUC 1UFMA 1O3RA 3PM1A 3MXJA 1W5SA 5F0CA 4YOVA 3JRFA 2K9SA 1FOKA 2A5XA 2QYOA 4H4KC 2DA1A 3ZT1A 3VEZA 2W41A 2VBXA 4M72A 2RREA 3C3WA 4J2EA 1IRGA 4J00A 2XY5A 3SLCA 1TGOA 3CO7C 2DJNA 3ABMH 3CCQN 5A2QZ 1Y8RB 3CC2I 5DYMA 3A0HC 4ZHRA 2GAUA 2HMIA 4HCCA 1QE1A 3QICA 3THYA 4CZZA 3RR8A 4IRIA 5FLXK 4JKGA 2VWJA 2DOAA 3O8MA 1XDSA 2QEXN 4AYBA 3OV8A 1FWZA 4CH7A 2FNPA 3L2RA 4S04A 3ZSYA 2ASOA 1WGXA 3ML6A 1BDGA 5BRDA 5AIQA 3ECHA 2BUPA 1RIOH 1IV0A 5D5UB 3CCSI 4CHNA 2MG4A 4OVLA 1BHLA 1BOBA 1AOYA 3NQOA 2RNJA 1QNTA 4FJGA 2O8FB 1Z26A 4CJ4A 1ZG3A 4BREA 1SKWA 2OA4A 2CV2A 4DQIA 4J2DA 5CYQA 1VSIA 3S32A 3BEXA 2PBDA 3CD6I 1VQ7I 5BRFA 3ZEUB 3KLEA 2Q0UA 1KD1O 1OMIA 4XH1A 5E1ZB 1YJ9I 2FSNA 3M3ZA 3VQDA 3O6BB 2Y0MA 3F3XA 1UJ8A 3JSPA 1HKSA 3K6GA 3SAGA 1YG2A 5ADXH 3MXIA 4DS4A 1ZQ3P 3OYAA 4UUSB 3NARA 1TQIA 1NMDA 4IO9L 3DBRB 3VA0A 2WV0A 3KZIC 3O1BA 4CZEA 3DLKA 4FETA 3P9KA 2QBYA 3P38A 2Q2EA 1J9IA 4BVOA 2WBNA 1FLIA 3CCYA 3WGGA 5BOXA 3F73A 1ZARA 2L5QA 2G8UA 4FJ5A 3R8EA 3QESA 3SMPA 4ZZLA 1K78A 2FF4A 3CCEI 1O3TA 1T7PA 3DJCA 3ZOBA 2E88A 3E9OA 5HRSA 2GZWA 5J1EA 3ROUA 3I3LA 2XF5A 2EWNA 1X9JA 4G12A 3I9V2 1BOAA 1O13A 2YS9A 2M4KA 5IYCJ 3QLHA 5D4RA 5F6FA 3AO5A 4PK4A 3E6MA 2BGCA 3DEWA 4Y52J 5AQSA 4RS8A 1RESA 1PUFB 2EIMH 2CUJA 2IAJA 2E5ZA 2KTQA 1NOZA 4IHVA 3VFZA 2B4JA 2M34A 3ONQA 3CM6A 2DA2A 3HUGA 3I8DA 4ZYAA 3U9GA 2IS4A 4E70A 3EUHA 1XGNA 4PJJA 4M3XA 1TWFJ 3BF3A 2P7CB 5HDGA 1K61A 1O3QA 4CJUA 1UAXA 3I33A 2EV5A 4AIKA 3TAPA 3Q5FA 1UZCA 1YITN 3CO6C 3TTDA 5HDNA 1I3AA 4IHWA 5J6XA 3H9JA 3A0IX 1K83J 1UAAA 4XIUA 1NWKA 1RDUA 3CCVN 3HO1A 3HC7A 4U88A 4B8XA 4UY8I 2A1RA 1FOXA 4KICA 1E4FT 4JKGB 5F1RA 4CESA 2QW9A 4FM2A 1U0JA 3ALYA 3SEZA 3M1FA 3TI0A 1K4TA 5AZJB 2RDPA 3ERED 1F21A 3GTPJ 2CGJA 5KCMA 2F48A 5ILSA 3NAEA 3C94A 4AIJA 3BCAA 2EIJH 4IZZA 4CGFA 3Q9VA 2Y9ZA 2HYJA 5I3UA 3VEPA 3CF5F 2X6NA 4HTUA 2KIQA 4WXHA 4JI8K 1NKEA 1RTIA 2QKKA 5EX5A 3HGYA 4PY5A 3HOTA 5DV5A 2QA4N 2VBWA 4A5AA 3OYKA 3UNGC 1BI0A 4B1WB 2HF3A 2ZJQF 3DCFA 2O7OA 1F1ZA 1MMAA 2FXAA 3LSKA 3CMYA 3WQUA 3CETA 5D8LB 3VYTB 4DTSA 5KTQA 3KJVA 2BHYA 3DTKA 3L2CA 5GAGJ 3KKRA 5D5WB 2WB1A 3OA9A 1BIAA 2IGOA 1DGKN 4CF9A 5FO5A 2RAEA 5HVQC 2NS0A 2QBYB 2Q2EB 1X58A 4LLGF 1SL2A 1T0FC 4CJ3A 1HNXK 3LDPA 2EQRA 4AHVA 1GOCA 5DMRA 1D0ZA 1J75A 4CD3A 4FZZA 4CIGA 1K78B 1ETXA 5KAIC 4BXFA 1SMYF 1HF0A 1KVBA 1ZRCA 1MNEA 1VQNI 1CGPA 1J09A 1D1BA 3QU6A 2CUZA 1WOQA 2XAQA 3V8LA 4DF8A 5JHUA 1OVYA 1NG7A 3VB2A 3ZCOA 3WTSC 3WTWC 1DEJA 4CGJA 5M1KA 1X1DA 2HNDA 1Y64A 3LA2A 1QVGM 4PQUA 3QETA 3I4PA 1SFEA 1S9EA 3MK6A 4G7OF 1IDZA 5GIPA 4HYEA 3NRVA 4PA1A 1SUQA 4YFUA 1TYQA 3HUGB 3KYLA 3CZ6A 3VPZA 4NC7A 2QWPA 4HV5A 2KJCA 3X2QH 4DKWA 2BTFA 2M8GX 2DAOA 4X64K 2E2NA 3VYSB 4ZH4F 3SFZA 3CC7N 1MDUB 5M1QA 1DDNA 2ASMA 5C25A 3A5OC 1X2NA 2KLOA 1B4AA 1XCVA 1VQPN 1G2HA 1NK3P 4C1NI 1NTCA 1FMWA 4JKEA 1HLVA 4LLNA 3S15J 1ZR2A 3T0YA 1WSFA 4OPAA 3M8JA 2NOJB 2WFBA 3TOBA 4UNOA 5E18F 3HXMA 4D5CA 2Q0OA 3NEUA 3FIWA 3J7ZI 1RTJA 2P9SA 3BGRA 5M1FA 4DU1A 3JRGA 1QZYA 3KD5E 5DD8A 5E3NA 3SAFA 2EBIA 1WJBA 3L0QA 3LQQA 4FPAA 3IKMA 4KTWA 1GLLO 2OA8A 1P8ZA 2A41A 4UHTA 3TW7A 1OCRH 5CPRB 2ID3A 3L8BA 2Z16A 3LP0A 4YORA 1VRUA 3BTCA 4PFPA 4PJ0C 2V4JC 2QM3A 3TANA 3P7NA 1S9GA 4MGRA 4KI4A 3KCCA 2ZGZA 3OMYA 1N34K 2G8WA 2ITGA 3WG7H 3FXOA 3SQ0A 1D9FA 4H4OA 2IIRA 2IA1A 1BL3A 3ISPA 1OQYA 3EQLF 3D5LA 1G6NA 4MNUA 3CCSN 3VENA 1RR8C 3L6QA 1HKCA 2JUGA 1B9MA 1HQUA 3E6BA 4CDGA 4C8KA 2DA4A 1Z3XA 3NMUA 2RC4A 3ZGKA 5FB2A 2XHBA 5L3EA 3CD6N 1VQ7N 2LLKA 4H0PA 4ENNA 4EJVA 2RN7A 3FM5A 1ZGAA 2NNYA 1F43A 1YJ9N 1X1AA 4JK9A 4LY7A 4M3EA 4IRHA 4WXDA 1EJ9A 3S2DJ 3GF2A 1GLDG 3QEIA 1S29A 3I64A 1VK0A 4F91B 3AVMA 3V9XA 1R1TA 3F8CA 1JLGA 1H88C 4A3EJ 5AFUH 1JUPA 1HW2A 3T1HK 4XLHA 3WGHA 3SBGA 4BHPA 3I54A 1DQUA 4M3ZA 4KB0A 3UKRA 5D8KB 5CQEA 3OJSA 2D1HA 2QKBA 4CFAA 3WTUC 1N33K 4FLXA 5JVGF 2QSFX 3CCEN 3IRRA 2X74A 4E1JA 2L3DA 1ZYQA 3HXLA 1U8RA 5AQOA 2KHMA 2E34A 5D5XB 3IKTA 2O8KA 3K9KA 3PL8A 3HZ6A 5AQGA 3T5XA 1QPIA 3LOCA 1SL1A 5FGMA 1JGGA 3OJUA 2F4IA 5GADP 1XC9A 4CCJA 3SJJA 3AFHA 4Z4EA 2RE2A 1N75A 2NVYJ 1QZ5A 1S1XA 4FX0A 3NE6A 3HDDA 2ZB9A 5BR9A 2P5GA 2WC9A 2VYPA 5KQDA 1DGRM 2CQ7A 4C3JJ 4IZ9A 3OVNA 6PAXA 1TNTA 1WHUA 1JLFA 1S9HA 4M71A 1VNDA 3BY6A 2HZDA 2Z3YA 1G3SA 3EUKL 2VKVA 2ZXWH 1TL1A 5EEAA 4R79A 2P9SB 3HBLA 1OR7A 4QLCU 3J7AO 2Q3SA 2HNYA 4FASD 3DXMA 1FMVA 5H1SQ 4B1RA 4XLAA 2QQAA 2NNWA 3B73A 2MD5A 2HB5A 3CPEA 3I55N 2QUFA 3G73A 3I0SA 4B3MK 2GM4A 1E0EA 1WI3A 3ABKH 2ZXIA 1FOWA 3MXMA 4ZYEA 2ASPA 4XORA 1VQ6N 5IYDJ 2P6TA 1JLAA 2WAFA 1BR1A 1WI9A 4PSWA 2FD5A 2M9HA 3LL7A 1D8YA 3K70C 4M9XA 3S3MA 1SS6A 4DBRA 1S3JA 1HR0K 2COMA 5AQKA 3K4KA 3LAKA 3VSLA 1AKHA 1ZLKA 3ENHA 1YT3A 4FLYA 4KH6A 1D4XA 4HNUA 4Z4HA 2KT0A 4IXCA 2W40A 4DW6A 1QVUA 3TO9A 4CGHA 2RN2A 4OO1J 5H6RA 1Q1VA 4WQ4A 2TDXA 5C44J 1RZ4A 4CGDA 2D1VA 3TAMA 4A3CJ 3G4SN 3GOIA 2A3ZA 4PHTX 4KHYA 3H3VK 5J8FA 4LFCK 4KMFA 5C4JJ 2MH2A 2LYCA 2EZLA 5CZ2A 3M1EA 1V5GA 2UUZA 2PFBA 4J2AA 2BDPA 5AR0A 3EYIA 4BC3A 4BHBA 2P9UA 1W7AA 1BOTO 4ZTFA 2FEZA 4FM1A 2FU4A 4IO9F 4X0GA 3IRXA 1IUYA 2OF7A 4M74A 5JS2A 3DM2A 3UKGA 1MKMA 3PO4A 4QTRA 2R7QA 3UKRB 3TMOA 1YO5C 2O3FA 2E5LK 2VB6A 4FK2A 4PGGA 2YU9J 3OYBA 4WYBA 5M5XJ 3KD1E 2GX9A 1ZYRF 3Q0VA 3EEQA 2E6MA 2FRHA 2HDDA 2B63J 4FOIA 3VA3A 4CW7B 1TKXA 1S6LA 5LMUK 1VQNN 1L3VA 1KQ8A 4CJ5A 2K27A 2FBHA 4CEAA 2F9TA 3CP8A 4MO4A 1ON1A 3F8FA 3HYFA 4XRMA 4UB8C 3NH0A 5DEQA 2CW0F 4KNYA 3THVA 1ETQA 1TUYA 3E6CC 2V7YA 2P9PA 1OCZH 4A3GJ 4CCNA 1FTTA 5JMVA 3GE1A 1O3SA 1RNHA 1SFXA 2LOOA 3C6AA 4KDPA 2OTJI 3G1MA 2LREA 3KLHA 4Z4FA 3D6RA 3RZDJ 1V3FA 1B72A 2JA7J 4L5JA 3W2AA 4GMJB 3LWLA 2JPCA 5LEJA 3R6SA 4AF1A 2O5RA 4IHXA 2MGQA 4BNCA 1D1CA 2JWKA 3DXMB 1KQ9A 3GBTA 5J47A 2PMZA 2BXYA 4DTUA 3KLIA 3LDQA 3J7YJ 3WNFA 1KAZA 2W4SA 3WTTC 2A5YB 2A6HF 4N56A 5L3BA 4XBFA 1UMQA 1TZLA 2GQQA 3FZMA 3JRBA 4D9JA 3K2AA 1SL0A 5K5OA 2CUFA 5KPRA 1K6YA 4OGCA 3GL1A 2R7ZJ 4AM6A 4MQ9F 2ZMEA 4BQLA 5E3LA 1V4RA 1JKRC 3ZQ7A 5B66C 1UG0A 4I0BA 5ERIA 4QOZB 3F9KA 2HBMA 4LH4A 1KQ0A 2UXCK 4OINF 4PDKA 5K7ZA 1AKHB 4BC2A 3GFLA 2BHZA 1YIOA 3ZT4A 4CJEA 5AQLA 2E2IJ 5TKWA 4HRIA 4CJRA 4MDBA 3U4LA 2VC0A 3PY8A 4FL9A 1LWEA 1Z25A 1IXCA 1RDCA 3PX0A 2LG4A 3AAPA 4C3IJ 4B9VA 3EN9A 4MO5A 3R1XA 3ZMUA 3M8FA 3FZKA 1P4XA 3AO4A 4EHTA 3CXCM 2OPTA 1BC8C 4PZJA 2AXTC 3BUZB 4QS7A 3T7ZA 1T39A 2R3SA 4L9TA 2F4MB 2EV6A 4I98B 3HB9A 3O4WA 2L9NA 4DSKA 2BW3B 2P9UB 4BY9C 2JJ7A 5HS9A 4J19A 1LCUA 1YW9A 2NS7A 3HRUA 2M0CA 4DV3K 2HZTA 1LE8A 1Z77A 3ZN0A 2D0OA 3QP6A 1X3MA 3PUBA 2QXLA 5AONA 2R7RA 4MEXF 3EL2A 4A0YA 2WV1A 4UV8A 4I6ZA 5EZHA 1J59A 1TKDA 1ZXOA 5GPCA 1T98A 3LSHA 1APLC 1KVCA 1BBYA 4I99C 4LF6K 4LOCA 2BOLA 3V42A 4FM0A 5HROA 1IN5A 1Z6RA 1QTMA 1OH7A 1JLQA 1AU7A 4JOMA 3DBHB 4EGZA 1U45A 3LP1A 1S1TA 1ZTRA 3ULDA 2OAZA 4PKIA 5IT9O 3VODA 4YOTA 2D0PA 3REOA 2HBJA 4N4NB 2P9PB 5DM6F 4YOYA 3IWFA 3JRHA 5M1NA 1TK8A 2NAZA 1R5HA 1RT7A 3HG9A 4QWQA 1P7IA 2HVSA 3PNYA 4IQ4A 1KVAA 5BPLA 1KU3A 3DKWA 3O5BA 4IF4A 4BQNA 4L9JA 5L3CA 4FWNA 1TQPA 2JSCA 1TWCJ 3LM2A 1YX3A 2GUIA 1FP2A 2ETHA 1OYIA 1XGSA 3LNQA 3RYPA 3IV5A 1IW7F 3KP7A 2KRCA 1P92A 1QHAA 2ZCWA 4ON0A 1XS9A 5I9EB 4DV0K 3KP2A 1OJLA 4NCGA 2ZSIB 2BY1A 4DQSA 4WF2A 4FCYA 1NBWA 2VKEA 3EDPA 4FHTA 3HHHA 2M8EA 2BZTA 5EOYA 2ZMEB 3RJPA 4QSHA 4CF8A 4BDZA 1JXBA 1U9OA 1A5WA 1YXQA 4CO8A 3E5QA 2RHKA 5BRHA 1WFXA 3HM9A 1SZ2A 2QWQA 3NH2A 3O08A 1T05A 1Z0XA 3SK3A 3G3ZA 3VF4A 2J5PA 2FX0A 2RVCA 1ZBHA 2Y75A 4CK3A 4ZZDA 5GTIC 3QPTA 4G6QA 1LKXA 3CC4I 1U2VA 2MABA 2FLOA 3V7SA 3BF1A 5AQMA 1IBKK 4ID1A 2Q36A 3NDKA 4WFAL 4ESFA 2HVIA 4M41A 3EO3A 3MZHA 1HQEA 1RC9A 3GTKJ 3AVAA 3HBTA 1TWHJ 2KW4A 4CK2A 4UV9A 3LQRA 1OKJA 1LE8B 1XTAA 3N4MA 2Q8KA 1W0TA 1MJBA 3AG1H 5F08A 1J7KA 3IAYA 4GVMA 3W6JB 4ILHA 4JEPA 3G1LA 3KZZA 3F2KA 3VN5A 3ZMDA 1R49A 3FZHA 1XHXA 4C8OA 1C0TA 1BJZA 4JX6A 3H5AA 4OKEA 3JRCA 1IZ1A 1I3QJ 4HSTA 4BC4A 2X4HA 3T1AA 3WXKA 2N8GA 5JR3A 3ID6A 1W5TA 4BRDA 3M5RA 4Y7NJ 4LC9B 2QVOA 4JHDA 3ITHA 4CHQA 4B3OA 2FBKA 4A93J 4BS9A 2DW4A 5DM7L 1K79A 4CF1A 2Z9OA 1W0UA 2QTDA 4M3DA 1D3YA 3KLGA 5GAEJ 1QHGA 4BE2A 3OYMA 1IV8A 3MN6A 2MC3A 2VQFK 3L7WA 2FUG2 1C0MA 5KI6A 2G8FA 2YU3A 3DEEA 2PMUA 2MH9A 2VONA 1KONA 4AWXB 1LPQA 1ZN2A 2W82A 4F8RA 1PJRA 2ZNZA 4L8RB 2FBYA 5ICEA 1ETOA 2HTJA 1VRTA 1KC8O 4BBSJ 1DP7P 4CZFA 4YIIA 2FNAA 1U6ZA 2DDBA 1CZ9A 4X62K 3NAUA 4M7XA 3HM8A 2CWEA 3CJAA 4FK0A 2W24A 3ABUA 3A8YA 2KKZA 4FT8A 4XSXF 2O03A 5DCFA 4EMSA 3ZSWA 4FXDA 4DZJA 3IS9A 2D45A 2Y31A 2ZJRL 4IWVA 2DQRA 4W5QA 2XIGA 2HKOA 5BN9A 4Z2YA 3RVCA 3JCUC 4LH5A 4ZYHA 1YAGA 3HEFA 1XCBA 3K5OA 2I5UA 5TISC 4B9TA 4E1NA 4M3TA 4KPYA 4F7ZA
chains in the Genus database with same CATH topology
4HCCA 1VSFA 3FFIA 3VQAA 1QE1A 1FKOA 3ZCMA 3CQ8A 1KVBA 2Z1IA 4FJMA 2P51A 2ZE2A 3TARA 4O5BA 4BACA 4FM0A 4CEOA 3MXMA 3VQPA 4OLAA 1VSLA 3MEGA 3V9SA 2IC3A 3RR8A 2F8SA 1S5JA 4CF2A 3NGZA 2HHVA 5HROA 1TAQA 4CJWA 3MAQA 2VWJA 2EX3A 3ASMA 3L3VA 1QTMA 3KK1A 1JLQA 3OYDA 1DTTA 3S9HA 1XI1A 1X9MA 1NKBA 4Z4CA 4DF8A 1JLAA 1L5UA 4B9NA 4GW6A 2IGIA 2I5JA 1U45A