1I39A

Rnase hii from archaeoglobus fulgidus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
b'MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i39A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i39A01
3OVNA 3QERA 1U04A 5SZTA 4DTJA 4F2SA 3NFAA 4FLWA 5HRPA 3NHGA 3V9XA 2Z1HA 1VSFA 1NK8A 4J2DA 4CJ3A 1NJZA 5DK5A 1NJWA 1S9GA 4Y1DA 4W5NA 5K14A 1DLOA 4E3SA 4O44A 2X74A 4DTSA 1EXQA 1LW0A 1RBVA 4CJSA 4CJUA 3OYNA 3OYDA 4KTQA 3G10A 3O4QA 1R0AA 1KFSA 1QS4A 1HPZA 4DSKA 3HM9A 1C1CA 3AVGA 4IDKA 3HP6A 2KFZA 2HHQA 3EZ5A 3NGYA 2Y1IA 3AVJA 4FJNA 1G15A 1RBRA 3AA2A 4B9NA 1FK9A 3LP0A 3ZT3A 2P5OA 3DLKA 3SUPA 3AVNA 1QHTA 4CEDA 3ALYA 1HQEA 1LWFA 2O4GA 4AH9A 3KLHA 4E7IA 4JLHA 4DQPA 4NCAA 5HROA 4KHWA 4E0DA 2VG7A 4IG3A 1ITGA 1VSHA 2YKMA 1JLAA 1S1XA 3TAMA 4AHCA 1ASWA 3DM2A 4CGJA 3NH0A 3V81A 2HHTA 1XHXA 3K2PA 3QLHA 1IKWA 3OYKA 4KHYA 4BWJA 1J54A 4CGFA 3OJSA 1RCHA 4ELUA 2IGIA 5HBMA 2FBXA 2X6SA 1BL3A 4CJEA 3KK3A 2F96A 4I9LA 3AO4A 3BGRA 2LSNA 3U3YA 4K8XA 4CJ4A 4FLZA 2IS3A 5EU7A 2B4JA 4I2PA 3NH2A 4E7KA 5HP1A 3HYFA 1NKEA 3RWUA 2KTQA 1UAXA 4LH5A 3DOKA 3WNGA 4OGCA 2PYJA 4ICLA 2XY5A 1LAWA 1LV5A 1BCMA 3SNNA 3ZT2A 1JLEA 3OYHA 3SCXA 3SQ4A 1LAVA 5J1EA 4N47A 3IS9A 3VQ8A 3SI6A 1U45A 3HPHA 1TL1A 3MXMA 3ZT1A 4FCYA 2EHGA 1WSHA 4F8RA 4Z4IA 2KFNA 3LZJA 3MAQA 4O4GA 3KD1E 1RBUA 1TK8A 4FK0A 1CXUA 2FBTA 2GUIA 1HYZA 1S9EA 4NCGA 4CFDA 4OKEA 4Z4FA 3SZ2A 2F8TA 3KKRA 1RDCA 4L8RB 1Q9XA 1RT1A 4FVMA 2ZD1A 3LPTA 3ZSQA 2BE2A 3I0SA 3RRGA 1JKHA 4XIUA 3OYAA 3VQDA 1RNHA 2B5JA 1VSLA 3SQ1A 4OVLA 1QTMA 1DTTA 1ASVA 3HP9A 4PA1A 1WSJA 4W5TA 1QE1A 1W9HA 3C94A 3MXIA 1U49A 4C8KA 3WNEA 3M8PA 1JL1A 3LWMA 4KB1A 4E1NA 3PY8A 1S1UA 4IG0A 1X9WA 4DTNA 4BE0A 4F2RA 3VQPA 1VRTA 3M8SA 1A5WA 3AA3A 2YNFA 4AHUA 4YFUA 2YV0X 1KLMA 2G8FA 3DOLA 4KHSA 1KVAA 1WAFA 1S6PA 4O5BA 4AHRA 1WSIA 4FW2A 2X6NA 4TSXA 3EY1A 4FJ7A 3ZSVA 2P5GA 4GW6A 3S3MA 1RTJA 1HYVA 1L3UA 1JLBA 3ZSOA 4DFKA 2OZSA 1NOYA 3KLIA 3PX0A 1VSEA 3AO2A 2D5RA 4JRQA 3OYBA 1CLQA 3LDSA 1RDDA 4CFAA 3VA3A 4RW6A 2X78A 1NK4A 1Q9YA 4DU3A 3SUNA 1CZ9A 2XRIA 3QETA 1RT6A 2RPIA 1GOAA 3L8BA 4ZTFA 2D0CA 2OZMA 2DFFA 2XHBA 2Z1IA 4W5QA 4B9LA 3NAEA 4CGDA 4CJLA 3K5MA 4FM1A 3OYFA 4YNQA 3P5JA 4DSIA 4C8MA 3KKSA 3LZIA 1TVRA 2ETJA 3DMJA 4CJKA 1BHLA 1O1WA 1UA1A 3KIOA 3KLGA 4C8OA 4CF9A 3LP3A 4FJ9A 1KRPA 3VQBA 3VQCA 1S1VA 5KI6A 3U6FA 4RW8A 1QSYA 4PQUA 2WONA 3QNOA 3V4IA 3ZCMA 2FBVA 1QSLA 2KZZA 3MXJA 1A5VA 3ISNC 3KTQA 2OPSA 3QIOA 4FLTA 5HLFA 3SJJA 3CFPA 1ZBIA 3B6PA 1QQCA 4FZZA 4KHUA 3V9ZA 4Z4EA 5HRRA 3OS1A 1WLJA 3IAYA 4B8AB 3O3GA 4DSFA 1ZBUA 4IFYA 3HXMA 3WNFA 2VWKA 4DFMA 4CF0A 3QEIA 4CGGA 4KB0A 1YTUA 2QK9A 2YNGA 4F3TA 3V9UA 3OYIA 4B3OA 3AVAA 1IG9A 3VQAA 4DTPA 1IKXA 1C1AA 1NOZA 4CIEA 3ULDA 1D9FA 4FXDA 1XWLA 1X9SA 2DFHA 2XY8A 4LY7A 5J2MA 1KSPA 1HRHA 4DU1A 1HMVA 3F73A 1EX4A 2B6AA 4OLAA 3K5LA 1WSGA 3SV4A 3V9SA 1ASUA 5CZ1A 4DG1A 4LH4A 4AHTA 4CHYA 5CYQA 4CEEA 3HPOA 2Z1GA 3KK2A 1D8YA 2A1RA 1NK7A 3WNHA 3LANA 4PWDA 5CY4A 4GMJB 3TAPA 4E7HA 4CF2A 1JLQA 3OYGA 2IC3A 3LWLA 5FRMA 1IKYA 4DLEA 2F8SA 3ASMA 4KRFA 1I39A 3OYEA 2BDPA 1JLFA 2FC0A 3CM6A 3LAMA 4DU4A 4NCBA 1VSKA 4EZ9A 2AJQA 1L5UA 1GOCA 3AVHA 1J53A 3A2FA 4RG8A 4C8NA 4CEBA 2VG6A 3CQ8A 2PY5A 2HVIA 5FROA 4WE1A 4FLVA 1RTHA 1XI1A 3QNNA 5HRSA 4BE1A 4KHQA 1RT7A 4QAGA 3CFOA 4CGIA 1U47A 4PUOA 2HHUA 3T19A 2EX3A 3T3FA 2Z1JA 4KAZA 4B08A 2HVHA 4N56A 1NKBA 4CK2A 2FBYA 2RN2A 3NGIA 3HK2A 4CFCA 4CHOA 2GBZA 3ZSRA 3CFRA 4BDPA 1C0TA 3RMBA 1KTQA 1L3TA 5D3GA 5J2PA 1RT3A 2P51A 1TKDA 4EP5A 3O3FA 1J5OA 1JLGA 4Q0BA 3K57A 2DFEA 3SQ2A 3TWHA 4B9VA 3HT3A 3FFIA 4AILC 4FJ8A 4HUEA 1I3AA 3H08A 4Z4HA 3DLRA 4ZHRA 3K5OA 3EYZA 1X9MA 1T05A 4QOZB 4FJMA 1K6YA 1BCOA 1RTIA 2QKKA 1BGXT 1C0UA 1RDAA 1WNSA 4HTUA 3V6DA 3TAQA 3L2UA 1TGOA 3PO4A 1CZBA 2KQ2A 4OPKA 4W5OA 3C6UA 3TR8A 3AA5X 2ZE2A 4FJ5A 4J2BA 2ATQA 2OA8A 4CCHA 4FZXC 4I9QA 3OS0A 4GVMA 1L3SA 1FXXA 3KD5E 2QKBA 3G0ZA 4KO0A 1TV6A 1Y97A 4KKOA 3VN5A 2QXFA 4M41A 4DQRA 3C6TA 4G1QA 3L3VA 4HUFA 3TABA 2HHXA 3TANA 3P1GA 1NK5A 1U4BA 4DQIA 2YHBA 4DLGA 2OYQA 1YTAA 3P83D 4M42A 1C1BA 4O0IA 4RW9A 4QCLA 3HPGA 3L3UA 1XHZA 4EZ6A 2DY4A 3AO3A 4OKKA 4FJGA 4FYDA 4LSNA 3SPYA 4OKJA 2IAJA 4RW4A 4N76A 3HJFA 3CM5A 4CIGA 2HHSA 3V1RA 1SL0A 4KTZA 3C95A 4CJVA 3IRXA 4I7FA 4KFBA 3OYJA 4AHVA 4NYFA 4CEQA 3QESA 1NK0A 1B9FA 3AO1A 4CHQA 1ZBHA 4UQGA 3HL8A 3OS2A 2R7YA 3D45A 4DS4A 4H4OA 5KTQA 4CF8A 4Z4CA 3ZT4A 5KGXA 2G8UA 4CHZA 3TAGA 2G8VA 1S6QA 3VQ9A 1D5AA 2NUBA 4DWIA 4FM2A 5DMRA 4FZYA 4H4MA 2YKNA 4IFVA 3MEDA 1VSDA 4KPYA 3AA4A 1KVCA 3NH1A 1X1PA 5E41A 1ZYQA 3AVBA 2XY6A 4CIFA 1SKRA 3ZSXA 3D0PA 1MU2A 3LP1A 4CJRA 2Q3SA 1NK6A 2VG5A 3QIPA 1RTDA 2BANA 2JGUA 1HYSA 4B9TA 3HSTB 4O55A 1BISA 1TKZA 4BDYA 1EP4A 5FRNA 1TKTA 3NF7A 3O3HA 1UOCA 4DQSA 4RW7A 3DRSA 4DF8A 5J2QA 4IBNA 5HRNA 4JS4A 1VSJA 4E7LA 2O4IA 1GOBA 3K59A 5SWMA 3AV9A 5JS2A 3CG7A 1W0HA 3SUOA 4OPJA 4HCCA 2XY7A 3RMCA 1D9DA 3UIQA 4M3YA 4CHNA 4CE9A 1YT3A 3VQQA 4DTMA 5KGWA 1VRUA 4Z4GA 4JS5A 4DQQA 4O0JA 3VQ7A 1SL1A 4M3XA 1HQUA 2IOCA 3AVMA 2RKIA 3NBPA 1WSFA 1SUQA 3NF6A 5J2NA 4FM0A 1HNIA 4CESA 3QEVA 3LPUA 3AVLA 3VQ4A 3M8RA 4N41A 4M3RA 1Z26A 4W5RA 3THVA 4FJKA 1BI4A 3QINA 5CYMA 2ITGA 2HB5A 3DRPA 4KI4A 3T1AA 1L3VA 2OPQA 1T8EA 2G8IA 3DI6A 4CK1A 4ELTA 1NK9A 1HJRA 3OYLA 1TL3A 3E01A 4CJPA 4FJJA 1F21A 1EETA 3S9HA 4M45A 1C0MA 4J2AA 2YHAA 1FKPA 1CXQA 3JYTA 4E19A 5KRSA 1RT5A 2RF2A 5JS1A 5C25A 1SV5A 4CECA 3HVTA 1WAJA 3KK1A 2KW4A 4I2QA 5C24A 4BWMA 1A5XA 1TAUA 3TAEA 3K5NA 3VA0A 1YVUA 1S1WA 1S5JA 3NF9A 1RILA 3PX4A 3RR7A 3U3GA 4HHTA 4CERA 3PV8A 3MEEA 3PX6A 5I42A 1RDBA 4DSEA 5I3UA 4F3OA 4FW1A 3KLFA 1TAQA 3SUQA 4PY5A 1BQMA 3HVRA 2BGGA 3IG1A 3JSMA 5FDLA 4FJXA 3DLHA 4DTOA 4KTWA 4B9MA 2VWJA 2E6LA 2E6MA 2P1JA 3LAKA 4CHPA 4FLXA 1T7PA 2DTUA 4NYNA 3PUFA 3OJUA 4E89A 4KHNA 3NE6A 1JXEA 4OGEA 3VQ5A 4E7JA 2HNYA 3QEWA 1WSEA 2A1SA 3RRHA 3SPZA 4C8LA 1NJYA 4LSLA 4J2EA 1T03A 1VSMA 1BIUA 2HNZA 2KZMA 4KI6A 1LWCA 3F9KA 4KV8A 1EKEA 1VK0A 4FK2A 3MEGA 2XO7A 3OY9A 1TKXA 3LP2A 4Y1CA 4CEAA 3VQ6A 5KRTA 4BACA 3RTVA 3HO1A 4CEZA 3S3NA 2G8HA 4FJIA 1JL2A 4BDZA 1KFDA 1LW2A 2HHWA 4JRPA 4CJFA 3SQ0A 3ZSWA 3QEXA 3KLEA 4R5PA 4N5SA 3M8QA 3DLGA 2YNHA 3LALA 4BE2A 2D0BA 3MECA 4HUGA 3PO5A 3L2VA 3AVCA 4F4KA 1S1TA 4DS5A 2ZQBA 4CEFA 3NGZA 3SYZA 4DTXA 4FLYA 2G8KA 4MQ3A 1B9DA 4Z0UA 3I8DA 1ZBFA 3B6OA 1RT4A 4B8CA 3QEPA 2E4LA 3RR8A 1JXBA 3OYCA 4FLUA 1SKSA 2HMIA 4CK3A 1BQNA 3AO5A 4HCBA 1B92A 3TARA 3V9WA 3O4NA 3AVIA 3NF8A 3RMDA 1IKVA 1BIZA 4CGHA 4ZTJA 4MFBA 1KLNA 4CEOA 1RBSA 5CZ2A 2G8WA 1RT2A 4FJHA 4M3TA 1Q8IA 4HVJA 1U48A 1NKCA 4ID5A 4DFJA 4DFPA 1N5YA 2OPPA 4B9UA 4OJRA 1REVA 1C6VA 3V1OA 1TK0A 3ZT0A 5T7BA 4EP4A 2Y1JA 4M3ZA 4Q5VA 2OPRA 3L2WA 4FJLA 3KJVA 4CJ5A 3OYMA 4DF4A 4OLBA 3DLBA 3DRRA 4AHSA 1QSSA 4DTRA 3RMAA 1XC9A 2HW3A 3CYMA 2YNIA 1NJXA 2I5JA 4K8ZA 4E1MA 1IO2A 3V1QA 1LWEA 4CJTA 4H8KA 2D0AA 3VQEA 2PYLA 2JLEA 3ZSYA 1KCFA 4CFBA 3L2RA 3ITHA 1SL2A 1JLCA 2HHVA 2PZSA 1ZBLA 1FKOA 1IH7A 4ID1A 4DMNA 3DLEA 3DYAA 5C42A 3L2QA 3NCIA 4DTUA 1SKWA 1N6QA 4CJWA 4FK4A 3ZSZA 1WN7A 1DTQA 3QO9A 1UWBA 4CJQA 3TAFA 4CF1A 2GV9A 2W42A 4ELVA 4M3UA 4M3WA 3SV3A 3AVKA 2HNDA 1RBTA 3K58A 1UA0A 3AVFA 3I0RA 3NDKA 1HNVA 1VSIA 1Z25A 1TK5A 4LD0A 4DSJA 2IDOA 1KVBA 3S3OA 3BDPA 4KREA 4DSLA 4IKFA 4B9SA 3TI0A 1J9AA 1BI4B 2WOMA
chains in the Genus database with same CATH superfamily
3WXJA 5FFZA 1KQ9A 2VL8A 2CGLA 1EWRA 2DA2A 1X58A 1LW0A 3OYDA 2KP6A 4A61A 2Y1IA 3PSIA 4LK1F 1QHHD 1K9MO 1OH6A 2KIUA 2DXIA 1BL3A 3I59B 4BS9A 2I7PA 4WCGA 2HYGD 3ZT2A 3F8NA 1WJ5A 5DTDA 3QPTA 4IEIA 4L8RB 3VB2A 2XF5A 1K4SA 2ZD1A 3ZQIA 2Q0OA 3SBGA 2M5WA 1ASVA 5J3LA 4XBFA 5DCFA 5FKMA 1W7AA 4DYRA 2QA4N 4IG0A 2MA3A 2RNGA 4XSZF 1JGSA 2F7TA 3PQJA 4BRPA 4FPBA 1WSIA 4FW2A 3OMYA 4FJ7A 1JLBA 2XAHA 3PX0A 3AO2A 2V79A 2D5RA 1K79A 4CFAA 1H0MA 4A5NA 2CU7A 3SUNA 3ZX3A 4DZPA 2R7QA 3BZKA 1GLDG 2Z1IA 3UKUA 4DSIA 1B9NA 1K8KB 4UHTA 2KZZA 1O7FA 1Q86O 3CJRB 1IXSB 2CFOA 1A5JA 3H3OB 2NOGA 1XG1A 1N78A 1Z0XA 2BUPA 2XIGA 1T38A 2BVLA 4HEA2 2DFHA 4CSWA 4EMSA 4OLAA 4F55A 4EM1A 2IC3A 5FRMA 4WFBL 4IVNA 4XOTA 3MKWB 2O8XA 3X2QH 2NVXJ 3TU5A 1B72B 1DP3A 3GTQJ 5K5RA 4C8NA 4A6EA 4IRGA 1XI1A 5HRSA 5C2FA 2FMLA 4QAGA 2KKOA 2EX3A 3VERA 3W0LA 4CFCA 5K7FA 3ZP5A 1U6ZA 1EF4A 1N77A 2YHYA 3R6SA 3HT3A 4Z4HA 1ODDA 1M1KO 1BCOA 3B8AX 2DT5A 3VETA 3WE2A 1UJ8A 4M6YA 4CCHA 1L3SA 1FMVA 4X6AJ 2CWEA 4M41A 4HSRA 3ENBA 2L2OA 5ILSA 2Q2EB 2H27A 1MNDA 3DLLF 4IHVA 3V1RA 3WU1B 1SL0A 3OIQA 2ASMA 1STZA 3O08A 3EUKL 2ID6A 2XAFA 3VQ9A 1PJRA 1HKSA 1K6OA 4FZYA 5EZGA 4QLCU 2IVPA 1YJWI 1MJBA 4ASNA 1POGA 4H5RA 2FBHA 4IOAL 3KP4A 1EP4A 3NF7A 2LVSA 2IGOA 4DQSA 2P9UB 1WH7A 3J81Z 5AFUH 4ZDOA 1O57A 4CE9A 4L3QA 4DQQA 4CZJA 4M3XA 3OIOA 2RKIA 1Z05A 4CESA 3M8RA 1HCRA 3D1NI 2WAQA 4WWCA 2DPNA 1MH4A 1IN8A 2JPCA 5C10A 3QU3A 5F6FA 5JS1A 2HXOA 4I2QA 2KKZA 3I0TA 1RILA 4NDLA 3MDQA 5GP9A 2BY0A 3JSMA 4CYDA 1T7PA 4E89A 4PK4A 2XV4S 1T44A 4CEAA 5FD6A 3BTJA 4BDZA 1LW2A 3L09A 4DR1K 1GVDA 4DV6K 4F4KA 3N4PA 4FWOA 1U5TA 2VWBA 2NNNA 4I6MA 4CBWA 3NF8A 3DPLC 4CZFA 3BLYA 1ZRFA 4FJHA 1Q8IA 3PNYA 4OJRA 3V1OA 2O8KA 2L7FP 2UXDK 1YG2A 2HQNA 1A6IA 1T33A 1KD1O 5AQVA 4CJTA 1MZBA 2HHVA 1FJLA 2Q8KA 2LMDA 3ABTA 3HBTA 3GZ5A 4AIKA 2EQRA 2K3PA 2EH3A 1U5TC 4KREA 4B1UB 1U04A 5TKWA 4XLNF 3DLAA 1D5VA 4A5BA 4AM3A 1RBVA 1KAZA 2CQ7A 5IT9Z 1AA7A 2HHQA 3V8LA 1QHTA 3QYBA 1ZTRA 4LLNA 5H6RA 3CJ7A 1F5TA 1TBXA 3V81A 3DM2A 4LB5A 2UUBK 4X1EA 3C7NA 3S32A 1OCZH 3RCOA 3JRCA 1HDPA 2FBXA 3CCVN 3H3ZA 4JI8K 1KYZA 4L0ZB 4IHWA 4YORA 1TC3C 4OGCA 2XY5A 1KONA 3MKYB 1Q1HA 1CF7B 1UG0A 3Q0WA 4JHDA 4CD3A 2OCEA 3ABLH 2FXUA 3SEZA 3IUCA 2XROA 4BQNA 3GZNB 1R22A 2BE2A 2OU2A 3I0SA 1B8IA 1X1AA 2ZXIA 2RE2A 1XSVA 2G8FA 2X1EA 1FPQA 3O2PE 4IOAF 4DFKA 1NOYA 3M7GA 3OYBA 2W25A 5JFRA 3BJOA 1R59O 2QTDA 2X78A 3QETA 4FWQA 1Z7UA 5F0FA 2FBKA 5AQKA 2E35A 5K7HA 2A40A 1O1WA 4ETSA 5D4RA 4LLGF 3V4IA 1SAUA 3BG6A 1HW2A 2HXIA 5DM7F 2YX4A 1U0JA 3JRBA 4IOXA 3H5RA 3P9IA 2JSCA 1XWLA 3ZYYX 3H9GA 5FJ8J 3Q7BA 2Q0UA 2TCTA 2B6AA 3OW2M 3B73A 5CVVA 4ESFA 2CH0A 4ZYHA 4E7HA 3A03A 1JLQA 3LWLA 3IRRA 2V1XA 3NEUA 3CCEI 4KRFA 2J5OA 2W41A 3A2FA 2K3FA 4LOCA 3Q3SA 1RTHA 3T19A 2RN2A 1Y56A 4IJAA 3FMRA 1E4GT 1IBKK 2P51A 1TKDA 1NNEA 4BUPA 3VTHA 3U21A 3V6DA 3QFPA 2ZE2A 3HGYA 2DMNA 1QHAA 5TRDA 3IAS2 4QPOA 1NK5A 3T1BA 5HDKA 3P83D 1OVQA 2R7WA 3F21A 4LSNA 1GLJO 5ICGA 1WBBA 1Y0UA 3MN5A 4K2EA 2A41A 1B9FA 3D45A 4BQZA 4B44A 3TAGA 2CJJA 1IXRC 2VPRA 4KPYA 3EEQA 3CQZJ 5AQTA 5KQ8A 3EDPA 4CZKA 1YVNA 2XB0X 2ZXHA 1TKZA 3R60A 2P9SA 4RW7A 1UHWA 5ERIA 3QPSA 1SD4A 1W5TA 4DQ8A 2M45A 3F6OA 2QLZA 4QIWN 1VRUA 3NAUA 4FETA 3AL0B 4C30A 4OAZA 3LPUA 1BI4A 4C2UA 3PO3J 3KCCA 1T8EA 5FKNA 1HBXG 4PL8A 3IFRA 5D5XB 1JCEA 2EV6A 4CA0A 4DV5K 3D6RA 3C6AA 3P4IA 3HOZJ 4HHTA 1QHGA 3KFWX 2NRTA 3R0AA 5FDLA 2CMPA 1KU2A 4B43A 4KICA 2IVOA 3RJPA 1D1CA 3K4CA 4OPHA 2A5XA 3F9KA 2UWMA 3LP2A 3GUDA 1Y0NA 1H8AC 2G8HA 4B4CA 2NNYA 1A04A 4N5SA 1MBEA 4YHHK 4BE2A 2CQKA 1RFQA 1MDMA 3UNGC 1S1TA 1DT9A 5JR3A 3I8DA 4C3IJ 1BWFO 4B8CA 1E3MA 2W7NA 1LEAA 3TDUC 3O4NA 2ZO4A 2NRXA 4DV0K 5FLXZ 4JI3K 2OBPA 2CG4A 4FX4A 1FIAA 1TQPA 1M90O 3GXOA 4DF4A 2ITMA 4JKDA 3RMAA 4IF4A 3CYMA 3S41A 1OFCX 3KP6A 3J7AY 3CXCM 1NGFA 1ZBLA 3L2QA 3DLEA 2I8DA 4Y7NJ 4FASD 4H03B 2OV7A 1HNZK 1UWBA 2W42A 3IMXA 3I55I 2EFWA 3R6MA 2E60A 4B3RK 1BIBA 2VJJA 4LF8K 3C95A 3NGYA 4DTJA 2R7FA 4FT8A 5K14A 5C4XJ 1EXQA 3ZQ7A 2KQRA 4RB0A 4DSKA 1I6XA 2QSHX 1N25A 1FJGK 4I01A 4OWRB 4B9NA 3LP0A 2BHYA 3ZT3A 2QWRA 3ULQB 1Y1WJ 4E7IA 3WXMB 4IG3A 2RAEA 1NG9A 1MA9B 3SXYA 4KHYA 2M8GX 2AQEA 3QP5A 1K4TA 5GTHC 2R0QC 3F22A 3IKMA 4UVAA 4I2PA 3G3ZA 3CO7C 4RLQA 3DP7A 2O8DA 3DOKA 1XTAA 3HRUA 2O5RA 2DTZA 3SCXA 4BAYA 4XH1A 1TL1A 3E9OA 2UUCK 2IPQX 4NCGA 3EE8A 4Z4FA 1RT1A 3RDIA 5IY5H 3GFJA 1Q1VA 3TKYA 3FWEA 5LGUA 4RAFA 1DTTA 3FHNA 1T3VA 1WSJA 1ZXOA 1QQMA 2GBYA 1D0YA 2W82A 3ZQHA 4LG3A 3UKRB 3WUHA 2D0OA 2NNWA 3C18A 2OZSA 3D5RC 3IUOA 3S14J 3D7EO 4PZJA 2RPIA 4ISFA 1USTA 2JUGA 4IEJA 2PMHA 4YNQA 3P5JA 3C2HA 2LKXA 1L3LA 3KLGA 1Z91A 1S1VA 4KUMA 3SJJA 3PL8A 1R00A 4CF0A 2LY2A 3S15J 4A3DJ 1NOZA 1N75A 1X9SA 5J2MA 2YX6A 2VCPA 1EX4A 2IXSA 2P0WA 3CCEN 3R0JA 5HNHA 3CCMI 4LH4A 5AQOA 1D8YA 4DKWA 3LANA 3AY9A 3ZMUA 2ZMEB 3HUGB 3F2KA 2IS1A 2DA1A 1J53A 5F27A 2ETHA 4XIDA 2PY5A 4IZ9A 4KHQA 3F3XA 4X66K 4KAZA 1WJCA 4CK2A 2XSDC 3RMBA 1KTQA 2L9RA 2JWTA 2PJRB 1BU6O 3OV8A 2M0MA 4BR2A 2VJIA 3FLCO 3TWHA 4DIQA 3TAQA 1TGOA 3GTOJ 4J2BA 3PNTA 2ATQA 3HOVJ 3VEXA 3FZMA 2COBA 2CUJA 4DQRA 4NBQA 4OKKA 5DYMA 2XPUA 1VQ5I 1G4DA 1MWKA 4I7FA 3K4JA 5M1KA 3HSCA 4C2TA 2K85A 4PJMA 4CF8A 1IRFA 4WQ5C 4A2BA 4CHZA 1UG2A 2G8VA 4O6JA 5GIOA 1BDGA 2JK3A 5KNLA 2RQQA 4JKGA 1IV8A 1D8JA 4GXOA 1MU2A 1ZBSA 3TTDA 3J80K 4RGRA 4EGYA 4H0TB 1VSJA 1TWCJ 3IP4B 1G3WA 5JS2A 1K8AO 3W6VA 2HPMA 1TQIA 1TW2A 3VYUB 2ZNZA 1UMQA 3G71I 1HNIA 4A3LJ 3VQ4A 1IBMK 5CVUA 4KJZA 4YIFA 4DV7K 4OOIA 3T1AA 5B5EC 2XF6A 3DI6A 1V3FA 1WCMJ 3FGUA 4J2AA 1ILYA 1JJ8C 2LLKA 2ZKZA 1W7PD 5C25A 1JI8A 2VBZA 4BQQA 2W1OA 2RN7A 1LEBA 2A5YB 1NGCA 4BRFA 2ZGZA 3AG1H 4K25A 3DLHA 2CO5A 4B8XA 5H2FC 1T03A 2LBFA 1LWCA 3GTGJ 5IWAK 4ABZA 5J47A 4BACA 3IC7A 5H6QA 3QEXA 1YI2I 1JT0A 1IXCA 2VXZA 2QI2A 1SZ2A 4I6ZA 2JRTA 5JLXA 2R93J 2PLYA 1VQPN 1XCBA 3CC4I 1BQNA 1YHQI 1R9TJ 3JR9A 1KLNA 2KL4A 4M3TA 4NUBA 4JK9A 1C6VA 1P4XA 2Y1JA 4Q5VA 1Q7YO 3OYMA 3DRRA 4K8ZA 4CBUA 3CCJI 3I55N 1SS6A 1JXSA 4MIMA 2EJRA 3VODA 2L54A 5C42A 2JSPA 4V19K 2P9IA 3RSNA 3FXOA 4XLHA 4BQLA 1NTCA 2M0CA 5L3EA 3AVKA 2H6BA 1TK5A 3M8FA 4CW7B 2FOKA 2K9QA 4Z6YA 1FP2A 2L02A 3HTUA 3R3LA 4D1QA 4W5NA 4U88A 2IA0A 3G10A 2CS3A 3O8GA 3HGGA 3DF8A 3T0YA 1C1CA 2PFUA 3EZ5A 3DTIA 2F9WA 1G15A 2UUZA 5J1YA 4RTFD 4B47A 3QODA 1ASWA 1XHXA 3QLHA 2ZXJA 4KITB 2IGIA 3S2WA 4I76A 2NRZA 2Y69H 1DU0A 3U3YA 4CJ4A 5AQLA 1U78A 1J75A 1ZGJA 4IXCA 2DOEA 4C3HJ 4BREA 1LAVA 2VQEK 3G1MA 3D0SA 1ZYRF 1Z3XA 4KT5C 2OQRA 3LFUA 3O4WA 5C0YA 3VQDA 4OVLA 2BY1A 2LYCA 2HVSA 1QQNA 3K1NA 5E20A 2CUFA 1X9WA 2WFBA 4YDUC 4YFUA 4OX9K 2YV0X 3FR0A 3ZMTA 4TSXA 3MCPA 4FL9A 1MJ9A 5HS9A 4DU3A 5K7ZA 1CZ9A 1GOAA 4CGDA 3K5MA 3KKSA 3DMJA 1KRPA 2Y48A 5FPEA 1G3YA 3U1KA 4IHSA 4FLTA 4FZZA 2DA3A 1ZBUA 3MN9A 4IFYA 4M9XA 3AG4H 1OCTC 1VI0A 3K4NA 1HQCA 2M30A 4JD2B 3DKWA 3AG2H 1ETYA 1HMVA 3RQ4A 3E5QA 1MBKA 4PJJA 5CYQA 4LGWA 1Z6TA 4CF2A 4B1XB 1IKYA 3LAMA 2XF7A 2AJQA 2P9LA 4RG8A 1XCVA 3I58A 3CQ8A 4XRFA 5CPRB 4BE1A 1OLTA 2Q0RA 3NGIA 2GBZA 3WG7H 2LTPA 4BRQA 3H08A 2P9KA 3QQAA 3VPRA 1F43A 2NZTA 3SAFA 5LHHA 1RUNA 1VQ5N 3TABA 4C9YA 1K83J 4RW9A 4O3MA 3R8EA 1I50J 3GFLA 3HJFA 2O3FA 2HHSA 4KTZA 4YOTA 4OO1J 1NK0A 2MD5A 5E3LA 5BQTA 1S6LA 3M4OJ 5AIQA 5DMRA 5CLSA 3N05A 1IG8A 5EGOA 3NH1A 3AVBA 2JA6J 1T2KA 3GCMA 4O5VA 2JGUA 4IL6C 1ETOA 4LG0B 1SFKA 4CD1A 4PCQA 3E9PA 3O9TA 2E1NA 4DJAA 3VGMA 2Y0SN 3O6WA 3LSJA 4NQWB 2KHMA 3TOAA 3JRIA 3QINA 5CYMA 5DCMB 5GADJ 2ZJPL 4BRGA 1L3VA 4DW6A 3OYLA 4G94A 3HKZA 4PSXA 1T0FA 4QWQA 4CECA 5IYBJ 4RM3A 1KYWA 1SC7A 1BL0A 4Q48A 4CCJA 2YUSA 3R1XA 4IXAA 1ESVA 2R7UA 5ELZA 4RCHA 4DTOA 2VWJA 3OJUA 4LFCK 3KEQA 2DA7A 3EKSA 2VE9A 3SPZA 4GVEA 2RV8A 5EZHA 4IRIA 4LK0F 4DHYA 4FJIA 3GF2A 2QW9A 3ZSWA 2CV2A 3CC4N 1JTYA 1T0FC 3L2VA 3HSEA 1YHQN 5AQMA 2CQNA 1ZG1A 5CVRA 1LFBA 3RVCA 4FLUA 5E1WA 1MMNA 3VYSB 3FXUA 3QBXA 2MC3A 3AO5A 3J81O 3V4GA 4G12A 2A6TA 4XEIA 5F1XA 5LL6Z 1VQNN 5KAIC 3GTLJ 3CCJN 4B3XA 3WTYC 2JUCA 5GTIC 1S22A 4OLBA 1Q81O 2HW3A 2HZDA 2I5JA 3QICA 3W6KB 5ADXH 3ZSYA 4QS7A 2JMWA 2HS5A 3ZSZA 1R1UA 4H0VB 4AC0A 5B8HA 3E6BA 4CJ7A 5EEAA 2KMUA 3NDKA 5IP7J 3GMEA 5A2QK 4M71A 3UKGA 5FKKA 3TO6A 2NYXA 4BGBA 1Y1VJ 1E17A 5EVZA 3LDQA 2Z16A 5F08A 2WB1N 1ZK8A 1HPZA 2KPMA 2LFBA 1W7PB 2MG4A 2V26A 3HOYJ 2P5OA 1MSEC 2ZFWA 4BR9A 4NXMK 4KHWA 2VG7A 2RDPA 1N8RO 2EWSA 4HV5A 2CQXA 1WSUA 3F8MA 3BGRA 2PMZA 3BUZB 3BR0A 4XKWA 1NKEA 5IP6A 3I5UA 3T69A 3VEOA 3EO3A 1YITN 1E3PA 1DGWY 4B3OA 4OMZA 2MH9A 5K1YA 2R5YB 4FWLA 4JKHA 4A5MA 1S9EA 3OBYA 3O1WA 3MXIA 2HOEA 2KRHA 2XKPA 3JRHA 5FKOA 4GCVA 4BGDA 2A5WA 4AHRA 2D1VA 2Q1ZB 1TYQB 1RUOA 5F04A 1NK4A 4FVUA 2L5QA 2XHBA 5IT9O 4B9LA 3NAEA 3BR2A 2OAZA 5FPNA 1GLEG 3LL7A 3LA7A 1P2FA 1IN4A 3U6FA 2FBVA 2ZWHA 3QIOA 2XGCA 3B6PA 4RM2A 3IAYA 2XAGA 4DQ2A 2ZJPF 2FX0A 1YW7A 3OYIA 4XN3A 4F7ZA 4O5FA 3RZDJ 4BR4A 4FXDA 1H88C 4LY7A 3KWIA 5E3OA 3BF3A 2Y30A 5AZIA 2IW5A 3TAPA 4JYAK 2F8SA 3SDGA 4DU4A 4FLVA 4CXFA 2Y9YA 1FC3A 4ENJA 3J7ZO 4N56A 1IJJA 2DDAA 3BC8A 3A01B 3MWMA 4WF9L 3ASNH 1LVAA 3K57A 3SQ2A 3EYZA 1K6YA 3L2UA 1CZBA 1ZG5A 3AA5X 3PO2J 3G6EI 2OTLI 4UB6C 1Y97A 1Y64A 1IRGA 4G1QA 4D7NA 3CETA 3PNVA 2GEMA 5HOOA 1BN5A 3RKXA 4OKJA 2ECBA 2IAJA 4G6DA 2DOAA 3AO1A 2B9SA 1FOYA 3CLQA 1T8IA 3OHRA 1ZBHA 4Z4CA 5AQHA 2MSYA 3P39A 2NUBA 3PFYA 4CYCB 2WUSA 4BRDA 4XH4A 4JKGB 1X1PA 2XY6A 3DFGA 5JVGL 3ESWB 1S29A 1JKQC 4B9TA 4ILGB 5L3GA 5J1RA 5J2QA 1LE8A 4E7LA 5F0XA 2UXCK 4JKCA 1X1DA 4JX4A 5KGWA 1FBQA 3M1CA 1ORKA 1SL1A 1EH6A 2O8FA 1R5HA 4M3RA 2MH2A 3J8AA 3L1PA 4DV1K 3SFZA 2DO7A 1O13A 2HEOA 3OSFA 4RGXA 3ABMH 4IWVA 4TV7A 4H0YB 2A61A 4HLXA 3PSFA 3CC2I 1SV5A 1F1ZA 4JKAA 4GV3A 4NC7A 4RAZA 1S1WA 1ZQ3P 1LOTB 1ZGAA 4UUTA 3IG1A 4X62K 2FSKA 5L3CA 2E6MA 1NGGA 4CHPA 2A3SA 2M3AA 3ERMA 2DLLA 2HNYA 1WSEA 2F5EA 5LMNK 3I59A 2LBFB 4I0BA 2BOLA 5KRTA 4UUSB 5EYRA 4CZZA 4K0KK 3ABUA 4JRPA 3SQ0A 5CR4A 4B3MK 3M8QA 2LP0A 3JS6A 3J7AP 3CF5L 4DS5A 2IA1A 2RQPA 2E4LA 2EFQA 3S8PA 3ZMSA 2DK8A 5ICEA 3CDLA 1A36A 4XH5A 3RMDA 1IKVA 4CGHA 4MFBA 3MX5A 3DAWA 1U48A 4WYBA 3RKQA 5AQGA 2DDBA 1R58A 3M3ZA 2DYSH 3V1QA 2KDZA 2HQ5A 2JLEA 3L2RA 3BZ6A 4HDUA 1IH7A 3MCZA 2GV9A 1KXPA 1K8KA 3K58A 3I0RA 3RKWA 1EA3A 2M4KA 5EG0A 3L9FA 2XASA 1OMIA 1FOWA 4FPAA 2KHOA 5C3EJ 2DPUA 2EPFA 2WTEA 3GO5A 4HF0A 4G9YA 1MKMA 4BC2A 4WFNL 1VQON 4FWRA 4JKBA 3ZMDA 4H5WA 4Y4RA 4MDBA 2KLAA 2D4WA 4AH9A 3GWZA 3VF4A 4II3A 4JEPA 1P9QC 4BWJA 1J54A 2GLOA 1B72A 2X6SA 3OL3A 3KK3A 3GEZA 5BRDA 5EU7A 1T95A 5FLXO 2GWKA 2Z3YA 3SNNA 2FSJA 4Z4IA 4Y33A 2K4JA 1JHFA 1Y6IA 3MFKA 3VEYA 3G1LA 2MYSA 3ULEA 3GYHX 3BCAA 1HUXA 2BTFA 3CUOA 3MZHA 3F72A 3SQ1A 1KU9A 2IGNA 1UCRA 4EJWA 3VESA 1XDUA 4PFPA 1I1SA 5LGTA 2YPRA 1OISA 1XMQK 2Q2EA 2NRVA 4O5BA 2L4AA 1WB9A 3LNQA 3QP6A 2X6NA 2P5GA 4GW6A 2M2EA 4RB3C 1GLLO 1W5SA 4U0WA 2PEXA 3RPUA 3V42A 4FM1A 1H9TA 4LMYA 5F1RA 1K73O 2V1NA 1D1BA 4PQUA 1T56A 2WONA 3IH4A 1A5VA 3FMQA 3CFPA 3DTEA 3OS1A 4A3JJ 4B8AB 2P9UA 3AVAA 4HZFA 2VGNA 4IQJA 2VXDA 4BY7J 2EWNA 4M74A 3N97A 1WSGA 2X9DA 4CEEA 3V8JA 4GMJB 3C6HA 1RESA 4L5IA 2O0YA 4F93B 5BREA 4BR7A 2EV0A 3VOEA 4IO9L 3JRDA 2W4SA 3QPHA 4WE1A 3QNNA 2CUZA 2PN6A 1HKQA 4BVOA 2ZSHB 3H3VK 2C6YA 3CLOA 1D0ZA 5D3GA 2PBDA 5J2PA 4Q0BA 3K4BA 3JAMK 3ZEUB 4NHJA 3H1QA 3GG4A 4AWXB 4HNVA 4W5OA 2D1HA 2R5ZA 3F6VA 5CVJA 2MW8A 4PKGA 4BQOA 1ONVA 2OYQA 1I5ZA 1C1BA 4GFBA 4V19S 4FYDA 4R8HA 4N76A 4M73A 2CQQA 3D2FB 4JI0K 3OYJA 5BR8K 1APLC 4DS4A 2CYYA 1J7KA 2BV6A 5EGOB 2AXLA 2YKNA 4H4MA 4JN4A 2XUBA 1H89C 4D9JA 2W85A 5LGNA 1YFHA 5GAHJ 3HSTB 2F2EA 4BDYA 4LJZF 4DF8A 2DQLA 3MWTA 1Z1DA 1YIJN 4FWSA 3Q9VA 4UY8O 3VDXA 2P5LC 3NF6A 4N41A 2K40A 2JA8J 3FXMA 3CMYA 3CC2N 4KI4A 2OPQA 4CK1A 1XQSC 5FPMA 3S9HA 3OBWA 3HOXJ 4E19A 1MJAA 3E6DA 4LD5A 3DTKA 3KK1A 2VQLA 4BWMA 4XL9A 3VA0A 4JBAA 2LR8A 1S5JA 3WTSC 1QVFM 1QZ5A 2IIRA 4ZJZA 2BGGA 4ZH4F 3ZN0A 2OZUA 1GLBG 3CCYA 3VQ5A 2AS5F 2A1SA 3O80A 2DN0A 4ZDPA 2KZMA 1EKEA 4U0VA 1TKXA 4CEZA 3U9GA 1XPXA 3DLGA 3MECA 1CF7A 1QO0D 4DTXA 2WBNA 3WTTC 2ELKA 3B6OA 1JCFA 4RWTA 3OR1C 3E1SA 5IYDJ 4S0HB 3EQLF 2K7LA 3D5LA 2DAOA 4L5JA 4B9UA 3E1YA 3BF1A 5AIPA 2DMTA 2IGKA 2F4VK 1FEXA 2QA4I 4YOUA 3CCRN 4Q5SF 2M4GA 2DK5A 2MABA 1KCFA 1S7EA 1IAWA 2VBWA 3LAJA 4OINF 4A0XA 1X3NA 4GYGA 5GAGP 2MC4A 3OIPA 2A6AA 2HNDA 3CUQB 1ZC6A 3AVFA 4QPQA 2F4MB 4DSJA 1IJWC 1VQ9I 2COMA 3OVNA 1TT0A 4KNYA 3FZVA 3WG9A 4HBLA 1VQ7N 2R7RA 1K78B 1S9GA 1V4RA 4CO8A 4CHUA 3VOVA 3JCUC 3ZQGA 1R49A 2ZB9A 1KFSA 1GLFO 5HL7L 3HM9A 3AFHA 4IO9F 2GWRA 4MDAA 3K4KA 1C0GA 2ISYA 3W6JB 3SUPA 4GV9A 4CEDA 2O4GA 4NCAA 2I7NA 5M5YJ 5BS6A 3NH0A 1XN7A 1V5GA 4CJEA 1EWQA 2F96A 2PBIA 3CJTB 4XQFA 1X2MA 3U4LA 2R4GA 1BR2A 3NH2A 2EFPA 3QAHA 1ATNA 1G99A 5IP9J 1QZEA 3KP3A 4R79A 5ICFA 4J19A 1KQ8A 3I8BA 1TK8A 1RR7A 3ZETA 2FBTA 5C44J 1A31A 1SMYF 1VSLA 3K0LA 4KIGA 1FY7A 1QTMA 4L9NA 2O61A 3OSGA 1W9HA 2G7UA 2GXBA 4DTNA 4KHPK 1MW7A 1XMAA 3HB9A 5J1UA 4BBRJ 2D1KA 4UUVA 4HQEA 4LC9B 3UE5A 4XSXF 1WQ2A 1BA5A 1Z7LA 3HTSB 2OZMA 4JK1X 4W97A 4A12A 1BIAA 4IOCL 1MDUB 3MN6A 4C8MA 1WUAA 3KE2A 4CJKA 5E79C 4GKKK 1V5EA 3K9KA 4RW8A 3MXJA 3KTQA 2E71A 1ZBIA 1DQUA 3COAC 1Q82O 4KB0A 5J4VA 2ZGYA 1C1AA 1D9FA 2KZVA 4WXCA 4NLBA 4IEEA 3IDHA 1X3WB 3V9SA 3HZJA 1UFMA 4H0PA 4CHYA 3HL2A 2A1RA 4UV8A 4MGRA 3S2HJ 5JLWA 3NWSA 4BROA 3G2BA 2LOOA 1I39A 5AQNA 2HFHA 3M6GA 1OCPA 2X6WA 5EDNA 1W0UA 2HVHA 1NKBA 2R92J 2JRMA 1PP7U 4HG2A 3I4MJ 4ON0A 3CP2A 3HRMA 4Y3OA 2WTUA 2ZXWH 4QOZB 4FWKA 3AL0C 1Z3YA 2CGJA 3ZQFA 3S16J 3C6UA 4EJOA 4I9QA 3CJ9A 2STTA 3DWLE 1SVLA 2OUMA 2QGUA 2QUFA 3QB0A 1OR7A 4OPAA 1XHZA 3AO3A 4LF7K 1OYIA 3ABKH 4Q4ZF 4NYFA 1HC8A 4A59A 1SFEA 4PJ0C 3MEDA 1KVCA 4IHXA 3JRGA 4CIFA 1SKRA 3ZSXA 3K0SA 1D0XA 3QIPA 2G7HA 3DCFA 3W3DA 3DRSA 2FQ3A 2V7FA 4MFEA 1W97L 2O03A 2O8BB 1OR7C 5JMVA 2BH1A 2VUMJ 2MGQA 3UR3C 1S3JA 3VQ7A 2O8FB 1BJAA 2QWWA 3F9MA 3THVA 1JUMA 4B1WB 3RKYA 3K7AJ 3H92A 2FLOA 5KHDA 1ZELA 3F8FA 3H6EA 3MN7A 5KRSA 1ACIA 1U2WA 2PQ8A 1W5CC 1WAJA 1TAUA 2AP1A 3TAEA 3PX4A 4PGHA 1RDWX 4GV6A 3ECOA 4RA2A 1YS7A 3MZ8A 5HODA 1TUYA 3AGRA 2IEKA 1R5ID 2LKPA 3HOUJ 2E6LA 2P1JA 4FWNA 4FLXA 2FF4A 4XRMA 1XMXA 3NE6A 3RRHA 2IA2A 1NJYA 2JA5J 3S17J 4FK2A 2XO7A 2JN6A 2K27A 2XGEA 3CCVI 1SFUA 3V7RA 2HKOA 4XLCA 5DM6L 1HX1A 2OA4A 1BI2A 4DV2K 2ZQBA 1HKTA 2L0KA 2HVRA 3QEPA 2ELJA 3VEZA 1YLFA 2HWVA 3HI0A 2LD5A 4G8XA 1KAXA 1NKCA 4IOCF 4M3ZA 5GAEP 3UKRA 4ZYAA 3PIOF 2AA4A 2P9NB 3BROA 2P4WA 3THWA 2M87A 3CCSI 1VQ9N 4DR7K 2HDDA 1KA8A 5JVHL 2GA1A 4M6XA 2YX7A 1HNVA 2L9SA 5EG0B 1SMTA 4DSLA 3N4MA 1J9AA 3THYB 3BPXA 2XC7A 1LQ1A 3CDIA 3S1RJ 5F0HA 4CJ3A 2IVNA 5E1ZB 4CDGA 1IW7F 3I56I 1FLIA 3RSEB 3QPLA 2QENA 2K4BA 5AONA 1KAYA 3C2BA 1I3QJ 3M8JA 3QYEA 4IDHA 1XMKA 4E0DA 3EL2A 1TTYA 1P7IA 2ZMEA 2YKMA 4LFAK 4DUZK 3B02A 1I6HJ 3HUGA 2MD0A 2X6OA 2M1BA 4YG2F 5E3NA 3CJCA 4NO7A 2P81A 2D0PA 4OMYA 3Q5FA 1HOMA 3IWFA 1V4SA 2KRCA 2QBYB 4A69C 2PJRA 3MXMA 5FLVA 2TDXA 3ULEB 4M63C 2QCOA 1RDCA 2NOJB 2OCCH 2VKVA 4FVMA 2RKHA 5LJVA 5LRRA 4D0PA 3CO6C 3L4IA 2UXBK 3TDZC 4PA1A 1KU7A 2ZMEC 4XN0A 1BC7C 3MAJA 3GBTA 4AHUA 4N9HA 3DEWA 4GGGA 4DGWB 5F2RA 4KN4X 2E2OA 2YR2A 3K4LA 3J7YP 3VA3A 4RW6A 2VBYA 3AAQA 3BTLA 2D0CA 1WJAA 5E18F 1BI3A 4CF9A 1G3TA 2HF4A 3VQBA 3VQCA 5BN9A 2Y75A 5HLFA 2ZSIB 2OQGA 4HV6A 3SZTA 3T1YK 5BPLA 5B3SH 4XICA 2K86A 1LDJA 1GV2A 4PSWA 1HRHA 1MBGA 2QYOA 3PJRA 4DB3A 5JHUA 4RMNA 1NK7A 1LKXA 2WC9A 4F9OA 3JTHA 4PWDA 3OYGA 4JQFA 4WF2A 5HLHA 3SZGA 5E17F 2FC0A 4NCBA 2A69F 3QOEA 2E1CA 5M3FJ 4BNCA 2ZCWA 3NQOA 2H3GX 2YU3A 2EK5A 3ZSRA 3CFRA 1V4TA 1L3TA 2E1MC 1ATSA 1ETKA 3G1OA 5DM6F 1MBFA 1C0UA 4HTUA 2UXXA 4XRSG 4LFUA 1Y8RB 3ZGKA 2R5ZB 2HBJA 4KKOA 1ETVA 2FUG2 2EFOA 1NGBA 2WWYA 4DQIA 1FW6A 3L3UA 2W00A 4EZ6A 3ELKA 3SPYA 4RW4A 5ED4A 3O1BA 3LDLA 3KETA 3NWTA 4CEQA 3CP8A 2R7YA 3Q7CA 4K43A 2G8UA 4DWIA 4FM2A 5AZJB 1B9MA 3T8TA 4E7SA 1A35A 2ICWG 2ACJA 2Q3SA 1DPRA 4P9FA 2CW8A 1YQAA 3O3HA 2CW7A 1NMNA 1IUFA 4EJVA 4XONA 3CPEA 3D2EB 1ZR2A 4M3YA 5CVIA 2FSNA 1RC9A 2KFDA 3B6CA 1J6ZA 4BQAA 2EIJH 3CJAA 1KQ0A 5J6XA 2E36A 4Y17A 3V7CA 3E0JB 3SK3A 4ZZDA 3ZMZA 4CVNE 2QVOA 3DBRB 2EZLA 1TL3A 4CJPA 1VF9A 4A6DA 4FWMA 1C0MA 5CQGA 4HDVA 1LVKA 3QBWA 3LOCA 1P4WA 1PP8F 3HVTA 5C24A 3NF9A 1WH5A 1VQ4I 5KK1A 4CERA 4UXNA 4FW1A 3SUQA 2FRHA 2WV0A 1QA6A 1WHUA 2XVCA 2VC1A 2R7DA 4M6VA 1JXEA 4J00A 1BG3A 1UELB 2HNZA 4AIHA 2XAUA 1KFDA 3AARA 3KLEA 3ZRGA 2P9PB 2XB5A 1VFCA 2ESNA 4H5TA 4JI4K 4RDUA 4MQ9F 2WADA 1RT4A 4RAGA 2W24A 4CZCA 1BI1A 1N33K 1LDKB 1IN5A 4CK3A 1ZKGA 1B92A 1YTYA 1RT2A 3CIPA 1XC5A 4ID5A 1Z67A 3CCSN 4AHSA 4OIPF 2B7EA 1IO2A 3O5BA 3L7WA 4GY2B 2FF6A 4CFBA 4A62A 4BVPA 3DYAA 2P6SA 4HQMA 3SV3A 4S05A 3DJCA 1WGXA 4EGZA 3I56N 2AO9A 3TI0A 1MMGA 5SZTA 4ESJA 1DPUA 4DR4K 2VQCA 5BRFA 1E2XA 4JD2A 4J8FA 5AQQA 3AVNA 3ALYA 3E97A 3KP5A 4CGJA 3TAMA 2HHTA 5L3BA 1IKWA 2F48A 2LSOA 1LCUA 1T6DA 3AO4A 2J5PA 4B1VA 2BW3A 2BXYA 3PFIA 2A05A 2KTQA 3OYHA 1XGOA 4PL7A 3VQ8A 3ZETB 2KDOA 1R4NB 4CFDA 2BHZA 3SZ2A 2V9PA 4I09A 3S2DJ 1RPWA 4HNUA 3DEUA 1MD0A 4WXDA 3OYAA 1OPCA 3I4NJ 3BZCA 1QGPA 3U8XA 1NWKA 1J59A 1LUJB 3C94A 2NVQJ 1U49A 2P8TA 2CW0F 3HZ6A 4JI5K 1B59A 4AVPA 3GW2A 4JOMA 3ZPLA 1RTJA 2VGMA 3GFIA 1YO5C 2ZFUA 5TISC 4B48A 2DFFA 4EHUA 1KQSM 4LF4K 2WAQN 4I2OA 3NVMA 4FJ9A 1I94K 1HJOA 2NRRA 4U7BA 4KH4A 1QSLA 2QSFX 1VQ8I 3F0CA 1AKHB 3HXMA 4N4NB 4CGGA 2YNGA 4ANJA 3VQAA 3CI5A 4LG0A 1TT5B 1W4MA 3ULDA 1BA1A 1S3XA 3IH3A 5HS7A 3BG5A 5JI6A 2W6LA 1O3QA 1HDDC 4R1HA 3F73A 3IKVA 1IF1A 2VB6A 4NQWA 3TTFA 4AHTA 3HPOA 4DR5K 3TMOA 3WNHA 5DCMA 3ZQQA 3CM6A 2K9NA 4H0EA 3DXMB 4HW0A 1VSKA 4CZHA 4ENNA 2JWLA 2TRTA 1ETXA 3KYDB 1NLVA 4FWPA 4M7YA 1I3AA 1X9MA 1RDAA 3CF2A 3TR8A 4HSTA 3EYIA 4HNTA 4GVMA 3G0ZA 1TV6A 3VN5A 3LA2A 2VQGA 3LSPA 3FXJA 3FF5A 4FJGA 1J5YA 2VKHA 3KYLA 2E2HJ 3IRXA 4AHVA 3M3YJ 1T6SA 2QWPA 1TWGJ 4N9IA 1VQPI 3IH2A 3H3NO 1Z6RA 1RRJA 3CQXA 5HLTA 1O4XA 3LP1A 3FXLA 2BANA 2DYRH 4YEJA 5FRNA 3GZ6A 3WT0A 1U9NA 1CZAN 1NU0A 4JNEA 1MMDA 3KZIC 3BR5A 5LBQA 3AVMA 4AVZA 5LEJA 2YU9J 2ASPA 3FBIB 2FXAA 2CRGA 1K61A 1ON1A 1B6AA 5L3DA 4KBOA 3BJAA 4ELTA 3QFUA 3HM5A 1VQ4N 2V6EA 1QQOA 5D6EA 5DEQA 1WPKA 1U8BA 1W7PA 1OVYA 4Y0WA 1YVUA 3RR7A 1BJZA 3KLFA 5BPMA 4A3EJ 2LF7A 3LSGA 4A0ZA 4QSHA 4RBOA 2V1DA 3MEGA 1WJDA 2DI3A 2P7CB 3O9UA 2HHWA 3W3CA 4QS9A 3LALA 2OTJI 1FOXA 5AR0A 3I9V2 2XGDA 3A5OC 2R5YA 3K69A 2ZBKA 4GDFA 5F64A 1NG6A 1PVEA 2IVMA 4C1NK 1YX3A 5B66C 4BC4A 3TARA 3WEEA 4CEOA 4EJTA 1RBSA 3T7ZA 1O3RA 4O8UA 3DEEA 2OPRA 2O9LA 4HTLA 2Y0MA 3KK7A 2F5VA 1U9OA 4WFAL 3THWB 2XAQA 1SAZA 5BPIA 1LWEA 1TYQA 5C12A 1LPQA 5M1PA 1SL2A 5IPAA 1KZHA 2X0LA 1FKOA 4S04A 2O7OA 1QQIA 3NCIA 4CJWA 1P4AA 4CF1A 4Z94A 3ID6A 5F1JA 4JI1K 4PHTX 1R36A 4IKFA 1ZHFA 3QERA 3RPQA 3NFAA 3GVAA 3NHGA 3V9XA 2VQHA 4U0YA 5D5VB 3MMYB 4FJNA 3WXLA 3KLHA 4JX5A 4QS8A 1YUWA 1RETA 4DUYK 4O8KA 1WI9A 2JJ7A 4AU7A 5ICCA 3F5TA 3RIRA 4Y15A 5HBMA 2CH6A 1DDNA 3K10A 4BC5A 3CJQB 3DKYA 2B4JA 1HLVA 4WQ5A 2IS2A 3SQ4A 3K9JA 3A01A 3ZT1A 1Z21A 2EHGA 2G0EA 1BOTO 3WODF 3TSPA 4K42A 1S7OA 1IV0A 2XRLA 5D8KB 1QBJA 3RTRA 3KKRA 1BOAA 1R1TA 3LPTA 1F36A 1FBSA 4M9SA 1IV6A 4A3CJ 1X4OA 3HP9A 2M9HA 2O8CB 5TGTA 1OH7A 4L18B 1WWXA 1WAFA 1S6PA 2NS7A 1V5FA 2GQQA 4AIJA 3QDKA 2VKEA 4FO0A 5M1FA 3WTWC 1VQ8N 1IC8A 5IOZA 4CYCA 3OYFA 5LLQA 3LP3A 2OPSA 2ZM6K 3V9ZA 2DTRA 2QQBA 5E84A 2EV5A 2E1MB 1ATRA 4F3TA 3HXLA 4BEHA 4YELA 2ZF5O 2XY8A 1YW8A 1BO5O 2YS9A 5DV5A 5CZ1A 3EYYA 3BG3A 4NXNK 3AG3H 5C4JJ 2P7VB 2YCHA 2HOTA 2IS6A 3TPQA 2JWKA 2QWOA 4RGSA 1X3MA 2HTSA 3T3FA 2Z1JA 5EOYA 2IRFG 1BC8C 5M5XJ 3MMVA 2GOXB 3TGNA 5HLGA 4B9VA 3O8HA 5M5WJ 2E2IJ 4DV4K 3V7SA 2QKKA 2MLGA 1WFXA 3PO4A 2KQ2A 1MBHA 2OA8A 3LL3A 4UUSA 2DJNA 2QKBA 3H45C 2FQ4A 3B6AA 2HHXA 3J81K 3HBLA 2FJ1A 3BWGA 3DU5A 4FHTA 2YHBA 3FDYA 4QCLA 5JICA 3QMLA 1RZ4A 2DY4A 1P90A 4YOVA 5K5QA 4MTDA 3AKZA 1Z77A 2RNJA 1E4FT 3MCAB 2Y2ZA 3LFKA 5GPAA 1NM1A 3QESA 4CHQA 4RAYA 4GKJK 4YOWA 3F23A 1XC3A 4FQGA 1X4PA 5CE3A 2DJIA 3CD6I 5E8GA 4BG9A 1ZYQA 4QTRA 1TWHJ 4CJRA 2F4OB 1VQNI 2Q31A 1RTDA 5MLCQ 2HNHA 1J5EK 3R4KA 1O3SA 2GIZA 4L9JA 3K59A 3SUOA 2PG4A 3RMCA 5ILVA 4O0JA 3LSHA 2K5CA 4E6KG 1FIPA 2A6EF 3R9PA 1NK9A 2WAFA 1WJBA 4IJNA 4FJJA 4HPQA 3LA3A 4M45A 4JV5K 1RT5A 1YJNI 1BUPA 4L9VA 2KW4A 2CUEA 1X2NA 3KZBA 1S9HA 1YJ9N 2CV0A 3S1MJ 3KLNA 3REOA 1MNEA 5I42A 1MH3A 3J80Z 1AHDP 3ML6A 1TAQA 1S72N 1C0FA 2R3SA 3VF2A 3MVPA 4KTWA 3KEOA 3LAKA 4YDUA 2E2PA 2QSGX 1OYWA 4OGEA 1KU3A 4C2MJ 4YOYA 2WA0A 4H5NA 2ME6A 3E9LA 4KV8A 4KHUA 2OTJN 3H35A 1VK0A 3RTVA 1Y39A 2X1CA 1TW3A 2L7ZA 2E2NA 3HRTA 3PO5A 1OCCH 4CEFA 4BU2A 3DKXA 1YITI 1ZBFA 4KH5A 4F52A 2HQAA 3FZFA 2E34A 3A5LC 3FFKB 1WZ2A 3K2ZA 3CCLI 3H0GJ 5BMZA 2OPPA 2VKDA 5IT9K 3ZT0A 3HJEA 2HTJA 3L2WA 4BHBA 1FSEA 2GWJA 1ON2A 1PDNC 3SLCA 1UHSA 4G7HF 4ZZLA 3I54A 4ILHA 4ID1A 5AQIA 1EH7A 1SKWA 4G6QA 4BHCA 3QO9A 4A0YA 2QWNA 2YHWA 5HS8A 2KIFA 4ELVA 3ZQCA 1RBTA 1UA0A 4L9TA 1VSIA 4LD0A 2UYTA 1FMWA 5DM7L 2WOMA 3TQNA 2BVMA 4FSVA 1YX5A 1NJWA 4Y1DA 1DLOA 2E19A 3O9RA 1R0AA 2EA2A 4B9QA 4OIQF 4D5FA 1NMDA 3BT9A 2STWA 3DLKA 1VZ0A 4DR3K 5HROA 4JI2K 1DP7P 1ITGA 1VSHA 2AXTC 2QKMB 1TLHB 4W1UA 3QWLA 4EQQA 4HLYA 1P7JA 2KJBA 1IZ1A 3SBTA 1GDTA 2BW3B 2HBLA 1IRZA 1U6GA 4XMYA 1S7AA 2CFXA 3FXKA 1BCMA 2X48A 5L3FA 3KD1E 3I64A 2YHXA 2ISZA 5AFUA 4J01A 3ZEUA 1PYVA 4OKEA 4BL0B 2DMQA 2P5VA 3ZSQA 3RRGA 4CUGA 1JKHA 1WKMA 2QQ9A 5AQWA 1VQMN 3LWMA 4KB1A 3AA3A 2YNFA 1XNQK 2QWLA 3D2FA 3ZSVA 3S3MA 4ESBA 2QZ8A 4DYQA 5HDNA 3OA9A 1Q9YA 2JQ7A 3SMSA 3DU6A 2Z2SB 4C8OA 4FTHA 4MEXF 1BM9A 3ATVA 4XLAA 3CC7I 2XAJA 1YTUA 5HLIA 1AWCA 3H5AA 3O6BB 2LF8A 3AGKA 3KWGA 4DCHA 1JJ2M 2VJ4A 2NS0A 4U87A 1SEUA 1B4AA 3FHZA 4BYYA 3FZKA 4DLEA 1NGDA 3ASMA 3RQIA 3GTPJ 1L5UA 4Y13A 4WK8F 3CFOA 1U47A 3THXB 2FBYA 4CHOA 4M7XA 2F5DA 3M1EA 1JLGA 4AILC 4ZHRA 3K5OA 2VPLA 3N4QA 1RTIA 1BGXT 4FJ5A 4KIFA 1N32K 1DEJA 2E5ZA 3BY5A 1UZCA 3L3VA 4HUFA 3VGLA 3TANA 5J40A 1YTAA 1T6CA 1GXQA 3KVGA 1HNWK 1GLCG 1HLUA 4B3SK 1MGTA 3C0BA 5AQPA 5D4SA 3CD6N 1ULYA 3OL4A 3OS2A 5JHFA 1D5AA 4EATA 1HA8A 1FX7A 2FSWA 2EIMH 2ADUA 5DD4A 2VG5A 2VOPA 3GL1A 4O55A 4A3GJ 4JS4A 1MNMC 2QWQA 2XY7A 3UIQA 2QEXI 4LITA 2Z9OA 1HQUA 3CUQA 5FKLA 2IOCA 1SQKA 4I99C 2HGCA 1XUPO 1GVJA 4MLOA 1SFOJ 2QQAA 3HC7A 3QOPA 1YJNN 3I3LA 2NVUB 5DDGA 1MMSA 2H8RA 3LMMA 1K78A 1F21A 2O8EA 1CXQA 1T08B 1WRJA 2RF2A 3SFIA 2KJCA 3CZ6A 2DW4A 2NS8A 5M3MJ 3PV8A 2GXAA 4DSEA 1VQOI 1BQMA 5FLXK 3TSQA 1G3SA 2XPVA 4ZYDA 5EEGA 2OJED 4NYNA 4YFKF 5CJ9A 3CUQC 1QVUA 2A68F 1FNNA 1O3TA 4PJLA 3S93A 3ZN1A 1JL2A 4CJFA 4M3FA 3H9JA 1SAXA 4R5PA 2HR3A 4U67L 2RVCA 4PGGA 2DU9A 3RYPA 4RLFA 4DNCA 3MK6A 3SYZA 4G6TB 4FLYA 4MQ3A 2VT3A 4A3BJ 4Z0UA 1HKGA 4IO8A 3CCLN 1Q18A 4P5OA 2RHKA 2P6TA 2HMIA 1S8NA 3WEEB 3EUAA 1YJWN 3V9WA 3TO9A 2HDCA 1I1GA 2J4RA 4DFJA 3MEXA 2EBIA 4NC6A 1LJ9A 5T7BA 4LB6B 5C15A 4CCKA 3DLBA 1XC9A 1NJXA 1TUUA 1B1BA 4E1MA 2MLKA 2HYJA 5CKTA 4KMUX 1P92A 1W0TA 4HRIA 2PZSA 5B1AH 5KAFC 4DTUA 1A6QA 5BOXA 3WXKA 1LDDA 3TAFA 1TNSA 3U1DA 4M3UA 4M3WA 3EN9A 4ENMA 5FFXA 3FE1A 1JTXA 2V4JC 1FOKA 4XM3A 3LM9A 5KQDA 2FNAA 5GADP 1U2VA 3BG9A 1RDUA 2NRAC 1QZZA 2M34A 5C2DA 5M1QA 3OYNA 1Y8QB 4BRMA 3DBHB 3JREA 1VQ6I 3DXJF 4HX4A 2W6KA 3T8RA 4FOIA 4AYBN 1RCHA 2AHQA 2IBDA 4ELUA 4I9LA 3WU2C 2LY1A 4E7KA 2NAZA 5A2QZ 2E1YA 5HP1A 1FYKA 4LH5A 1D5YA 4CCOA 3KX2A 1RI7A 2PYJA 2GOMA 1LV5A 5J1EA 3OOUA 3SI6A 1U45A 2KRFA 4O4GA 1CXUA 1HYZA 4HA8A 3WGIA 1YRNB 4CICA 3P38A 3Q0VA 1T98A 2GTDA 2NRHA 2Q36A 1QE1A 5K5OA 2DT6A 1BBYA 4F2RA 4BE0A 1A5WA 2Z33A 3DOLA 4BXUA 1ITYA 5CYVA 4ZDLA 1L3UA 2ZJ2A 1CLQA 4BR5A 1RDDA 2XRIA 3L8BA 4JI6K 4RB2C 3BTCA 1OH5A 3CC7N 1BHLA 3KIOA 1QVGM 4MNUA 2ZC2A 3HKZN 3QNOA 4BC3A 3F8CA 1QZYA 1W2BM 2FEZA 1AOYA 5LJWA 4B3TK 3O3GA 2O6GE 2JPBA 2QK9A 2YSRA 3V9UA 4BEHB 2O8BA 4DTPA 1ZARA 2GM4A 1HSTA 4CIEA 3WHBA 3ATUA 3L6QA 1V54H 5AQRA 3SV4A 2CV1A 3ZX0A 1YIJI 1XD7A 3P31A 5E26A 4LF6K 3FKJA 5H20A 3OYEA 2BDPA 1JLFA 3BG7A 3TSUA 1W1WE 2FA5A 2HVIA 2EB7A 3BEXA 3ENOA 4B08A 3M9AA 1C0TA 1YOVB 3O3FA 1QPIA 3MWPA 4HUEA 3FXRA 1T05A 1OKJA 4YRVA 4JK7A 4AM7A 1FXXA 4BHPA 4B1ZA 2WY8Q 4BRNA 5J8FA 2YJFA 2K9MA 1JKPC 3JRFA 1TQMA 2LRDA 4LIUA 2F8TA 4UQGA 1XGSA 2BE5F 5KTQA 3UKUB 3J7AO 4IFVA 3AA4A 2GAUA 2LKSA 1JJ6C 3D0PA 5E1XA 1O7LA 1ZG3A 1FTTA 1NK6A 2P9NA 2VBXA 1TKTA 1YS6A 2QEXN 4WX9A 2NVYJ 1GUUA 1YIOA 4IBNA 5FGMA 3CCRI 1BOBA 4OPJA 4DTMA 2DMUA 4BRCA 5LMUK 3MN2A 4YFXF 3NBPA 4FM0A 3VEWA 3QEVA 3THYA 2ITGA 2HB5A 2PMZN 1HW5A 4M3GA 1QZ6A 3RSEA 3C7JA 1VQ7I 3K5NA 3I4PA 2HF3A 4BKXA 5I3UA 4KDPA 5LY3A 2LREA 4G9ZA 2ZNYA 4A5AA 2F9TA 4WQ4A 2A3ZA 4HWIA 4WCEL 2BGCA 4LSLA 1GLAG 4J2EA 3HSRA 1VSMA 2DPDA 4Y1CA 3ISPA 3DV8A 5M1NA 3M5RA 2A6HF 2QBYA 4BY1J 3CMAI 4A3IJ 3SHFA 2G8KA 3L2CA 3U2RA 3D5SC 4KN7X 3HTVA 4RS8A 1NH3A 5AQJA 4HF2A 4CCNA 5DUKA 4L0YB 2ZJRL 4WQ4C 1NGIA 4CGZA 1LFUP 5JVGF 2YNIA 3ZXSA 2HU9A 1Z9CA 2PYLA 4MHGA 1JLCA 4BJ6C 1WN7A 2FNPA 5EY4A 4EM0B 5EEHA 1IUYA 4E7ZA 3VTIA 1ZH5A 4FE4A 3BDPA 4XOPA 4JI7K 5IOYA 3AAPA 3PIPL 2X6YA 5DK5A 2FBIA 2LH9A 1S5LC 2X74A 1VQ6N 3ASOH 2F4IA 4KTQA 3TBIA 3AVGA 4IDKA 2KFZA 1RGIA 4JYKA 3FZLA 3AA2A 2VASA 3K70C 5JLHA 2GXGA 4OIOF 4HAMA 3ZQLA 1TWAJ 5EXWA 3GTKJ 4DQPA 4E4HA 2Y0SA 4ITVA 1S1XA 4CCLA 3OYKA 4IQ4A 1ETWA 3C2GA 5LHGA 2IS3A 2L7KA 3TW6A 2K9LA 4FE7A 1CQTA 1IN6A 2LK2A 1NGEA 4F8RA 5D5WB 1VQLI 4MO5A 1R71A 2GUIA 3E3VA 3F8BA 3CF5F 1PUFA 3VF6A 1RKWA 3L00A 1U5TB 1TWFJ 1FWZA 4PDKA 1RR8C 4I6MB 3T1HK 4XK4A 3ZR8X 3G4SI 3DXKA 2BZTA 1YW9A 2X1DA 3VFZA 3M8PA 1IDYA 3PY8A 1VRTA 3CJ1A 1SD5A 4DZJA 1NGHA 1HYVA 2DA5A 1PUEE 3A0BC 1CGPA 3KZYA 3JSOA 4ZTFA 2KISA 5AQFA 4BXFA 5BNGA 5AZJA 3DWLA 3LZIA 4KFCA 3BTIA 3ZCMA 1SD6A 1XNRK 4B1RA 4NNJA 5HRRA 2VT2A 1VHXA 4DSFA 4DFMA 3BR6A 2MBFA 2E8AA 1IKXA 3HM8A 3D2EA 5EX5A 3CJBA 3JW4A 2JT1A 5CHIA 1SFXA 2PFBA 1FZPB 2QKLB 4GO1A 1JT6A 4RGUA 5LEKA 2B63J 2RREA 3RYRA 3HG9A 5E8IA 5CY4A 3GLLA 2HYFA 1OH8A 3CMEI 3C7NB 2QF7A 4IZZA 1TL8A 3RI4A 2Q1NA 3E5XA 1X19A 1BW6A 4IHYA 1X3UA 2GUPA 4CEBA 5FROA 3FBNB 4PUOA 2BXZA 2UU9K 4IFEA 2WB1A 4BR0A 2QQ8A 4Q47A 2HBMA 3S1NJ 3NMUA 4JHDB 2ID3A 2ZJQL 3DLRA 3LSRA 3DBLB 1WNSA 3W2VA 3FX3A 5LRSA 4FZXC 1G8XA 1B8IB 4CZEA 2P9PA 4P9UA 4DR2K 3A5NC 3HPGA 4OAYA 5FPDA 2ZJRF 1G2HA 1P8ZA 1YE9A 3CM5A 2GA2A 1VNDA 1BI0A 4KH6A 2R7SA 1D1AA 3W2WA 2LG4A 4A3KJ 1FSHA 3HL8A 3SYTA 1BR4A 3ROUA 2NRWA 1DU6A 1VSDA 3P9KA 3MKLA 2H1KA 3JAMZ 2M8EA 3LM2A 3K70D 3ZCOA 1JCGA 2VLAA 1EJ9A 3BR1A 2R7VA 2VODA 3CJNA 4IHTA 4I7HA 2BYVE 4JAXA 2HOAA 3A02A 3PIPF 5BR9A 4HCCA 2VC0A 3CCMN 1USSA 1QRYA 3Q0UA 3TP3A 5BPDA 3HOTA 4FJKA 3PLAA 3SAHA 2D5VA 3C3WA 3BP8A 4BG8A 2O8EB 1EETA 3A2KA 2V7YA 2RGVA 2F5CA 3VEPA 4DYCA 3CHWA 1MBJA 1A5XA 4FOEA 3U3GA 3DPTA 1HPMA 4HYEA 1F9NA 3PX6A 4IX7A 2L01A 1EQYA 3FIWA 4B9MA 1MWMA 2DTUA 1VQKI 1R23A 3CDHA 1BIUA 4KI6A 4A3MJ 3OY9A 2HDWA 5KPRA 3CMAN 4FISA 4KMFA 3S3NA 1L0OC 2OC6A 3GE1A 1D3YA 5FO5A 4AYBA 1JGGA 4H4KC 4HUGA 4XKCA 4C3JJ 3HSFA 1LFPA 3LSIA 1RIOH 4LFBK 1IG7A 3HHHA 1GV5A 5LFAA 1DGKN 3AVIA 4ZTJA 1U3EM 4PUSA 4MQVA 3OWTA 3BJ6A 2FMYA 4X0GA 5KVRA 2FU4A 2R7OA 4DBRA 4B09A 4UNOA 5GAHP 3ERED 2P9SB 2D0AA 4H0OA 4MLEA 4DMNA 1N6QA 3G71N 4H0XB 3HHGA 4EM2A 3QYFA 4AM6A 3J80O 2V52B 2L7MP 1KVBA 2Q97A 3S3OA 3WTZA 4LF5K 3LDOA 1BI4B 2FOWA 1GHCA 4NB5A 1AKHA 3Q9SA 1U2VB 1NK8A 4J2DA 3M07A 1OYYA 3VWBA 1YXQA 4O44A 4DTSA 3K9TA 3O4QA 1QS4A 3HP6A 2QM3A 3BOQA 1RBRA 1ZLKA 1JKRC 1FK9A 1J0RA 3ZOBA 4KIBA 3VSLA 1JLAA 4AHCA 5AQUA 3SZPA 3DXMA 4CGFA 3WTVC 2ZJQF 4C1NI 3E6MA 1YI2N 2HI3A 4K8XA 4M3DA 1OQYA 3BR3A 1VQLN 5EF6A 1IN7A 1T39A 3TOBA 4WXHA 2XGXA 3JTGA 1JLEA 5AQXA 4N47A 2HMPA 2V9KA 4FCYA 1XSXA 5TJJA 1MDMB 1RBUA 4FK0A 3G4SN 1Q9XA 2PI0A 5BPNA 1HNXK 3NRVA 1NBWA 1YF5L 4W5TA 4V2FA 3WNEA 4E1NA 4BRKA 1VAZA 1S1UA 3VQPA 3IL2A 2LY9A 4KHSA 1KVAA 2L3DA 4II2A 3HRSA 3I33A 4EJUA 1HXDA 3JSPA 3TTCA 2WBMA 2Z5UA 1WOQA 1RT6A 2IAIA 4W5QA 4CJLA 3WQTA 2KLOA 1TVRA 1XX5A 3SAGA 1QSYA 2I10A 3AAFA 3LWFA 1WLJA 3WNFA 1XGNA 3WQUA 2E5LK 4IRHA 2L9VA 3DPUA 1ASUA 3CMEN 4DOZA 3KK2A 3VMFB 2JVGA 4NLCA 2PAVA 3HEFA 1E3HA 1ETQA 1GOCA 3AVHA 3H1VX 2FE3A 2W48A 2Y31A 2E2QA 3TO7A 2O8DB 5ADXA 4EVIA 2M7BA 1BW5A 4A2UA 3MX2A 3VENA 4EP5A 3LSKA 4N0BA 4FJ8A 2GIVA 4PJNA 4YY3K 3BQYA 1REPC 1ERDA 2E7XA 2DCEA 2E20A 3LAPA 3C6TA 4M3BA 5DUIA 3P1GA 1U4BA 4DLGA 4M42A 3WGHA 4H5VA 1DUXC 3MD2A 1N34K 4CIGA 1HSJA 1XS9A 5GIPA 5IYCJ 4KFBA 2XKOA 3FZHA 3TL4X 1NK3P 6PAXA 2E88A 4H4OA 2DOFA 2K9SA 1R6RA 1S6QA 1R1VA 4UVBA 3GTJJ 1HR0K 2DBBA 3H0DA 1ZRCA 5E41A 2CSOA 2FF3B 1HYSA 1BISA 4I0AA 1UOCA 2ME0A 3BQZA 2IS4A 1SANA 2O4IA 1GOBA 1AU7A 3AV9A 3KZZA 5LD2C 1N36K 3VQQA 3JRAA 2V6CA 3K2AA 4JS5A 4BRIA 1WBDA 1NJIO 5J2NA 5D5UB 4CZLA 4W5RA 1LNWA 2A07F 4NB4A 2X6XA 4MO4A 3H46O 3JYTA 3KP2A 4N4OB 5AQZA 3A1YA 3CESA 2VI6A 1F4KA 4LLLA 4UVCA 4MEYF 3H3UA 4YOXA 1VQKN 1RDBA 5CQEA 4F3OA 3HVRA 4I98B 4FJXA 1XGMA 5HDGA 4KHNA 4E7JA 3QEWA 2DA6A 5F0CA 1G59A 3C65A 2ASOA 3A0IX 2Y9ZA 4EIAA 5BN8A 2PX9A 1H1VA 2W57A 4HF1A 2H1LA 2UZKA 2LNBA 2D0BA 1XB4A 3AVCA 1UHMA 4B1YB 3NGZA 1QNTA 2B0LA 3O9SA 2HQRA 1NGJA 1BIZA 4B3AA 3FISA 1W36C 2O8CA 5IT3A 4HVJA 2H09A 1NGAA 4DFPA 1MSFC 4UV9A 3HIFA 1REVA 5EJCA 2R7XA 1IDZA 3T5XA 3I53A 3KJVA 4IPAA 3E7LA 4F91B 2A42A 4H8KA 4HX7A 2JA7J 4XLEA 2BY3A 1QPMA 4L5EA 1MMAA 1IRXA 2V7ZA 4FK4A 4DBQA 4CJQA 3K1MA 1Z25A 3GDQA 2XHKA 1WJEA 5AJ3K 3L0QA 2GZWA 3IHUA 2Q2RA 4JK8A 2XRNA 3H9QA 4FLWA 4OIRF 4XLPF 2Z1HA 1VSFA 2K02A 1ZGWA 2HSTA 4CJUA 4UB8C 1GXPA 3IWZA 3SJHA 3AVJA 4DR6K 4CZIA 3CCQI 1HQEA 4JLHA 2V51B 2HZTA 1VTNC 3K2PA 3OJSA 2BBYA 5D8LB 2LSNA 5FLMJ 1FYMA 1K7AA 3A4CA 3RWUA 1BR1A 5AQYA 3LDPA 1LAWA 5TKYA 4Z2YA 3IS9A 3HPHA 2KFNA 1WSHA 3LZJA 1DGRM 1PUFB 2DMPA 2VQFK 1ZRDA 4M72A 3ZMVA 5FB2A 3GFMA 3VYTB 3DXKB 4C8KA 1JL1A 1TP4A 4GRIA 1XSDA 2EA4A 4CCMA 4MFDA 4E70A 3TW7A 3OTOK 3EY1A 1J2XA 3HOSA 1IBLK 3ZSOA 3KLIA 2PMUA 3TEDA 2GELA 2NXNB 2LC2A 3K4MA 4A57A 4MLHA 4JP0A 4BGAA 1MIJA 2IJLA 4ZYEA 2P9IB 1WVRA 1LB2A 3UB5A 4DV3K 3CTAA 2ETJA 2VONA 3FK6A 1HKCA 5KI6A 4X64K 3GTMJ 4KT6A 3J7ZI 1QQCA 2QM1A 2D45A 3W2AA 2AQFA 2WY7Q 3QEIA 2UV1A 1ZAOA 4I02A 1IGNA 5A2QO 2OF7A 2E7WA 4DU1A 4KA4A 3K5LA 1U8RA 2NVTJ 2VJ5A 3ECHA 2XSJC 3GBGA 3IV5A 2G9WA 3CCUI 1NK2P 1ZR4A 2XPWA 3H1CA 3VYRB 3BDDA 1SD7A 3ID8A 2E5NA 3WE3A 2N8GA 3SDBA 4ISEA 1RT7A 2HHUA 2JA2A 4ZYGA 3SEQA 2Z99A 3HK2A 1W36D 4V2GA 4XRSA 1RT3A 3SQNA 2VN2A 4ZC3A 2KT0A 2R7ZJ 3RZOJ 4A3FJ 3U9ZA 3BY6A 4JKFA 3IAM2 3PQKA 2LDUA 3LQQA 1NG7A 2QXFA 1ENHA 3A8YA 2X51A 2V1UA 3EPZA 2ECCA 2F5FA 2YJEA 1V55H 2P5KA 5KGXA 2NLXA 4BY9C 4XKVA 2E1OA 2QWMA 1HKBA 3KP7A 4BRLA 4XORA 3LSTA 1E0EA 3WGGA 5HRNA 4FX0A 1X9JA 4U7DA 1W0HA 3E6CC 4CHNA 5GAGJ 2WC2A 2EFNA 1JUSA 5JLFA 4CI6A 2UUAK 3WTUC 3AVLA 2X85A 3O8MA 3DRPA 2G8IA 2H8WA 1JE8A 2VYPA 2YHAA 1HW1A 2P9LB 2JTVA 1EH8A 3M1FA 2KIQA 4BRAA 4EEFG 3PUFA 2P9KB 3G6EN 2OTLN 2HHHK 4C8LA 3CPWM 2FD5A 3LQRA 4Y52J 1KGSA 2KIMA 3K6GA 3G25A 1R7JA 3A5MC 2L4MA 3H36A 2WV1A 2EIKH 1WJFA 4AQYK 2VE8A 4XKBA 2OD5A 1I27A 2EINH 2EZKA 1JXBA 4ILJA 3R61A 2OZ6A 2UXNA 1SKSA 4OU0A 4GYIA 4HCBA 1GT0C 4EV0A 3TP0A 3VPZA 2JZYA 3CMMA 3NARA 2G8WA 2V9VA 4HOBA 5CZ2A 3S1QJ 3EZWA 5BRHA 1N5YA 4LF9K 1EO1A 1TK0A 3FM5A 1YAGA 4CJ5A 1QSSA 2IP2A 4LIVA 3DQVC 4K41A 3VQEA 3MQ0A 3ITHA 5HNFA 3CQYA 2ELHA 1E3OC 1FYLA 4P96A 1TNTA 2KZGA 2W84A 3ENHA 1X1CA 3LSMA 4B9SA 5HVQC 3EUHA 3KLOA 4F2SA 4KISA 5HRPA 1NJZA 4BJ5C 4E3SA 2W40A 4CJSA 3CCQN 3GOIA 4CH7A 3ZX2A 2L9NA 5GINA 1R4MB 4XLFA 1EV7A 2F6CA 1LWFA 4CZMA 2QXLA 2IGMA 1J9IA 4C23A 3QU6A 4PKHA 4FLZA 1OKRA 2WAEA 3HYFA 1R5GA 1FT9A 4BJTA 3EUHC 1UAXA 3THXA 3V8KA 3WNGA 2HKXA 4ICLA 1P6RA 1ZN2A 1UAAA 5GPCA 2MFZA 3MAQA 1FBUA 5B1BH 1XDSA 3K1PA 3KEYA 4YFNF 3P9CA 4AF1A 4XIUA 1RNHA 2B5JA 4MO7A 3WXIA 3QRFF 4PFOA 3L4QA 2R7TA 2EZHA 3M8SA 3JXUA 1KLMA 1JKOC 2VIXA 4D5CA 3PUBA 1QVTA 1VSEA 2JVHA 4JRQA 3LDSA 4KYWA 3RPUD 2DQRA 4M9ZA 2CGPA 2XDVA 1UA1A 3MZYA 4ISGA 2Z1DA 3SMPA 3ISNC 3SJMA 3CERA 4Z4EA 2H94A 4G7OF 3WHCA 3HDDA 2VWKA 5E3MA 5H1SQ 1IG9A 4YIRX 4M3EA 1KSPA 4EAHD 3VSKA 3CCUN 1OCRH 4DG1A 3GX4X 3P7NA 2E1ZA 2Z1GA 4P55A 2I5UA 5J4YA 4XNFA 1DKGD 3PM1A 1M1EB 4F3QA 4EZ9A 2PJPA 3KHYA 2VG6A 4AD9A 4AUXA 4CGIA 4RB1A 1RKTA 1OJLA 4BDPA 2HVQA 3FM3A 4P1WA 2HOSA 2VOOA 4X65K 1YJ9I 1J5OA 1G6NA 2DFEA 3FFIA 3EE9A 3A0HC 5KPZA 4FJMA 4CBXA 1S72I 2DFIA 3G73A 4OPKA 2H6CA 4YIIA 2EILH 4BXXJ 3OS0A 3KD5E 3EETA 1NHAA 2DT7B 4KO0A 5D6FA 5DD8A 3KYCB 4PKIA 3M8EA 4BH9A 3I71A 5LHIA 4O0IA 3MKZA 4G7ZF 1J09A 4EFHA 4CZGA 3FK7A 2YI1A 4UY8I 4BBSJ 2M7AA 2RC4A 3FXQA 4CJVA 1H9GA 2BEOA 3O3KA 3HRGA 3ZT4A 2E2JJ 3ONQA 1YYVA 5GAEJ 2OPTA 4JX6A 4MTEA 2EZIA 3PIOL 5I9EB 5M1OA 5SWMA 3CG7A 1D9DA 2DODA 1YT3A 1SVOA 1ZREA 4BRHA 4GNIA 4Z4GA 3EKUA 1X1BA 1WSFA 1SUQA 2ESHA 1WI3A 2CGKA 1Z26A 5AZIB 3KPHA 1UB9A 1HF0A 5DS9A 4EHTA 1JHHA 2OANA 1HJRA 1X3ZB 4A93J 3E01A 5ILUA 5KPTA 3VGKA 1FKPA 1D8KA 2D2WA 1BA0A 5KCMA 4ENKA 3BPVA 3MEEA 3FKIJ 5JVTA 1JUPA 9ANTA 4PY5A 3O9QA 1RNLA 1XMOK 2IT0A 5J8CA 3H5NA 4NC8A 3BCBA 1FTZA 3OOPA 3FMSA 3HO1A 3VQ6A 2BY2A 3U9DA 4HX8A 1TZLA 2CH5A 3JAMO 3HOWJ 2DA4A 2HPIA 1SVMA 2X4HA 2YNHA 3WU0A 2GX9A 1C0WA 4XR6A 1B9DA 5AQSA 4AIDA 1YRNA 1OCOH 4D7MA 3RR8A 3OYCA 5FD5A 1ZLJA 3HYIA 3E5UA 3WTXC 3ZLJA 4F92B 4A2AA 3DLLL 1VQMI 4EP4A 4FJLA 4JKEA 4DTRA 4E1JA 1QU3A 1D4XA 1KC8O 3J7YJ 2HBKA 1LE8B 3NVKA 3C1DA 1FP1D 1GLNA 3E66A 1DTQA 3GLXA 3IRQA 2IDOA 3IKTA 3OR2C 3VEVA 3LDNA
chains in the Genus database with same CATH topology
3OVNA 3QERA 1U04A 5SZTA 4DTJA 4F2SA 3NFAA 4FLWA 5HRPA 3NHGA 3V9XA 2Z1HA 1VSFA 1NK8A 4J2DA 4CJ3A 1NJZA 5DK5A 1NJWA 1S9GA 4Y1DA 4W5NA 5K14A 1DLOA 4E3SA 4O44A 2X74A 4DTSA 1EXQA 1LW0A 1RBVA 4CJSA 4CJUA 3OYNA 3OYDA 4KTQA 3G10A 3O4QA 1R0AA 1KFSA 1QS4A 1HPZA 4DSKA 3HM9A 1C1CA 3AVGA 4IDKA 3HP6A 2KFZA 2HHQA 3EZ5A 3NGYA 2Y1IA 3AVJA 4FJNA 1G15A 1RBRA