1I39A

Rnase hii from archaeoglobus fulgidus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i39A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i39A01
3RMBA 3NAEA 3O4NA 3L3VA 4G1QA 4I7FA 3TAEA 4FK0A 4CE9A 2FBXA 1WSFA 4GW6A 4Y1DA 1SL2A 4DWIA 3ITHA 2JLEA 3HJFA 1ZYQA 4F4KA 3DRPA 1D9FA 4B9TA 1SUQA 4CGDA 2KZMA 4DSFA 3L2VA 2OPPA 5K14A 1D5AA 4EZ6A 2HVHA 3C95A 4FLYA 2ZE2A 4LH5A 2OA8A 4FJJA 2IDOA 4CJWA 4EP4A 2F8TA 3OS2A 5D3GA 2YNGA 4K8ZA 4DTJA 1VRTA 3KK1A 3L2QA 1JXEA 3B6OA 3VQDA 2D0CA 3CFOA 4KKOA 4H4OA 3PY8A 3A2FA 1TK5A 4UQGA 1VSDA 1KFDA 1DTTA 3C94A 5CY4A 3I0SA 2P5GA 5SWMA 4OPKA 1KFSA 1LWEA 2X78A 2IC3A 1L3VA 3OYMA 4Z0UA 2HVIA 2HHUA 4CHOA 1RTDA 1X9MA 4F3OA 1F21A 3VQCA 4CJTA 3TAGA 1C0MA 3K5OA 1SL1A 3L2WA 3RMDA 4OVLA 4CJLA 1JLEA 3DRSA 3MECA 4ELVA 1SKSA 1HYSA 3IAYA 3HM9A 1B9DA 4N5SA 2KZZA 1RNHA 1C6VA 3H08A 3RRHA 2X6SA 4KPYA 4M3TA 3SQ0A 5C42A 2DFFA 3OYAA 2DFEA 1KCFA 4CGIA 3LDSA 2Z1GA 4RG8A 4CIFA 2FBYA 1WSGA 1HNIA 1QSSA 3UIQA 3DOKA 1IH7A 4DFMA 4C8MA 3HYFA 4KRFA 1JL2A 1UWBA 4LY7A 4B9LA 3RRGA 3S3MA 3SZ2A 4DSKA 3NE6A 4FZYA 4KHYA 3AVGA 4Z4HA 1K6YA 2B6AA 4AHCA 2QKBA 2RF2A 1BL3A 3PO4A 4FJ8A 2RN2A 4CGFA 3KIOA 4CFAA 4HCBA 1WAFA 1FK9A 3LPUA 3LP2A 3SUPA 1J54A 4CEZA 2D0AA 4OKJA 2AJQA 1HQUA 4CIGA 3PX6A 4FJGA 3ZSZA 3K5NA 4CIEA 3OYGA 3VA0A 3TAQA 2ITGA 3M8SA 5HROA 1LW0A 4FJ7A 1HQEA 3G0ZA 3NF7A 3VQ7A 1EP4A 4CEOA 5KTQA 1HYVA 1NK0A 1GOBA 1ASVA 3AVMA 4TSXA 4FLUA 1IG9A 4ID5A 4AHTA 2VG6A 5FDLA 4YNQA 4DSEA 3EY1A 2HW3A 3K5LA 1CXQA 3VQ5A 3OJSA 3SQ2A 4RW7A 2D0BA 4W5NA 1D8YA 4B9VA 4OLBA 1U47A 4C8NA 3LP0A 4RW6A 3T3FA 5E41A 4C8KA 3HL8A 3NDKA 4ELUA 3AVBA 4F2SA 1RTHA 4M41A 3NH0A 2XO7A 1KRPA 3LWLA 1L3TA 2HHQA 1KLMA 1A5WA 4W5OA 1C1BA 3L3UA 3PUFA 3F9KA 4CHNA 4KO0A 1LWFA 1ITGA 1QE1A 1LW2A 2KQ2A 4PA1A 4DLGA 4DTMA 4CEAA 3V81A 4Z4EA 1I39A 2R7YA 5HP1A 1C1CA 1WN7A 3C6UA 4MFBA 4CFBA 4F2RA 5JS1A 3NFAA 4M3XA 1Q9XA 2HNYA 2OPRA 1NOYA 2BGGA 4KTQA 1S6PA 1B9FA 2KFNA 4Y1CA 3VQEA 4KB1A 1CXUA 1X9SA 1T03A 2F8SA 4I9QA 4BE0A 5DMRA 4LSLA 1MU2A 3QETA 4AHSA 3LWMA 5T7BA 2YNHA 5FROA 4IBNA 3KLEA 1D9DA 1KSPA 2G8VA 1IKWA 4KTWA 5J2PA 3SJJA 4B9MA 1UA0A 2YV0X 3DRRA 1ASUA 1TK8A 1W9HA 3VQQA 4H4MA 3G10A 4MQ3A 3V9SA 4CEDA 4Z4FA 3F73A 3DLHA 1EKEA 4Z4GA 3KTQA 3AO3A 5JS2A 2Z1IA 3NGZA 4DTRA 1WLJA 3KK3A 3MXJA 3LAMA 2HHWA 4FM1A 3V9UA 4E1NA 1BISA 4W5RA 4JRQA 3SNNA 3AVAA 1FKPA 3K59A 2F96A 3M8QA 4O0JA 5KGXA 3SPYA 4ZTFA 1FXXA 1N5YA 2KW4A 5FRMA 4I2QA 3VQ4A 1A5XA 1QSYA 1T8EA 2I5JA 3LANA 4ZHRA 4DQPA 1QSLA 1L3SA 4KAZA 2IAJA 4CJ4A 3ZSRA 4B8AB 2BANA 3KK2A 1JXBA 3L8BA 4E89A 2HHSA 2HHXA 1RCHA 4EP5A 3OYCA 4IKFA 3LALA 1RDAA 1VSMA 1DTQA 1VSIA 4QAGA 3VQBA 1YTUA 3BGRA 4CESA 1XHZA 3KKRA 1RBVA 1VSJA 3TR8A 4DQQA 4F8RA 4BWJA 1IKYA 4CJKA 1ZBLA 4CJQA 1CZBA 1TAQA 4PY5A 4M3YA 2ZQBA 4N76A 2YKMA 5HBMA 3DLEA 1EXQA 3OYEA 1HJRA 3OYHA 3MAQA 3LZJA 4CF9A 3AV9A 3NF6A 1S6QA 4FXDA 2EHGA 4DTNA 4O5BA 1EX4A 2G8WA 4DTXA 1RTIA 4AH9A 1RT7A 4CEBA 3T19A 4BACA 3EYZA 1NJZA 2FBVA 3RR7A 4FJHA 1YT3A 2PY5A 1ZBUA 1VSFA 2B4JA 3SYZA 4M42A 2O4GA 3AVJA 1LWCA 2XY5A 3PX4A 1SL0A 3ZSYA 4FW2A 2QKKA 4BDZA 2DFHA 1WSEA 4CGHA 1KVAA 2VG5A 4CJFA 1EETA 4I9LA 4N56A 1T7PA 4DF8A 4B9SA 1RBUA 4NCBA 3DLBA 4N47A 4KREA 1TV6A 4FVMA 3S3OA 3BDPA 1T05A 3RMAA 4FK4A 4FZXC 3V9ZA 3IRXA 3QEIA 3QEPA 1R0AA 3HPGA 2W42A 3DLKA 3T1AA 5J2MA 3ZT3A 2PZSA 1RBSA 2P51A 3SUOA 1N6QA 2RKIA 4FLTA 4M3ZA 3CG7A 4R5PA 3DM2A 3SV3A 2ETJA 4FLVA 2YNFA 1C0TA 4IFVA 3MEGA 3DYAA 1UA1A 3ZSXA 1BQNA 3I8DA 3ZCMA 3AVKA 4Z4CA 2IOCA 2Y1IA 4DF4A 2D5RA 4KHUA 4FJNA 4CJ5A 3SI6A 3M8RA 4M45A 3ISNC 2QK9A 4KHQA 3LZIA 4DQRA 1DLOA 3ULDA 2XY6A 1NJYA 4LH4A 4FJLA 3IG1A 4DQSA 1O1WA 1FKOA 4N41A 1LAWA 4IG0A 1JLAA 3PX0A 4KI6A 4CK1A 3MXMA 3LP3A 3FFIA 3ZT4A 3OYFA 4CGGA 4E7KA 1G15A 1XHXA 2VWKA 3B6PA 4LSNA 4O55A 3NH2A 3OYLA 2PYLA 4J2EA 4FYDA 3AA5X 1BCMA 1QHTA 3NHGA 3LAKA 3SUQA 1NJXA 1A5VA 1RDCA 3AVFA 3ZSQA 3JSMA 4DU3A 4O4GA 1NK6A 4E0DA 4CJUA 4CFDA 3L2UA 4DQIA 3PO5A 4BDPA 3QNNA 1Q9YA 3TWHA 4DU1A 2A1RA 3HVRA 3QEWA 3TI0A 2P5OA 1Q8IA 4DTPA 3OJUA 3HXMA 3JYTA 2FC0A 4K8XA 3QERA 1S5JA 2ATQA 4GVMA 1RT6A 1BGXT 3OYNA 5I3UA 2GBZA 4YFUA 2BDPA 4CGJA 2GUIA 3WNHA 1SKRA 2E6LA 4ZTJA 4E1MA 4CF2A 3U3YA 2YHBA 1GOAA 1XC9A 3VQ9A 1W0HA 3RWUA 5KGWA 3E01A 3ZSWA 4OPJA 4L8RB 3TABA 2HB5A 5J2QA 5J1EA 4NCGA 3CYMA 1U45A 4ELTA 4E7JA 1REVA 1JLCA 1VRUA 4CHZA 4CJRA 1Y97A 3S9HA 2G8FA 3V9XA 4DLEA 4DTOA 1UAXA 4NYFA 4CF0A 3HPHA 4Q5VA 1L5UA 3ALYA 4CERA 4LD0A 4Z4IA 3PV8A 4CJVA 3KJVA 1L3UA 3AO5A 5CYQA 3AVNA 4F3TA 2OPQA 3TANA 1Z26A 2LSNA 3SV4A 4DS4A 1BQMA 3WNGA 4HUEA 4FJ5A 1WAJA 3NCIA 3QESA 4WE1A 4BWMA 2RPIA 3QLHA 3V1QA 4CHPA 5FRNA 1YTAA 1JLFA 3NH1A 4M3WA 4AHVA 4E7IA 2Z1JA 3QIOA 1RILA 4Q0BA 2IS3A 4RW8A 5CYMA 1NK7A 4FJKA 3VN5A 4DFKA 3AVHA 1HRHA 3QIPA 3ZSOA 3OVNA 1JLBA 1VSEA 4HCCA 2O4IA 5HRNA 1NJWA 2XY8A 4W5QA 1JL1A 2X6NA 4KFBA 3AA2A 1BCOA 1BIZA 3QINA 1S9EA 4B8CA 4JS5A 4B3OA 1TL1A 4E3SA 1HPZA 4IFYA 5KRTA 3U6FA 1RT3A 1TL3A 2IGIA 5KRSA 4HTUA 1RTJA 1X9WA 1QS4A 5J2NA 2YKNA 1VSKA 2YNIA 1JKHA 3QO9A 3VQAA 1GOCA 1WSHA 3VQPA 1J9AA 2PYJA 3HK2A 3ZSVA 3OYBA 4J2DA 3KLHA 1NK5A 3AVLA 3ZT0A 3MEEA 1RDBA 4DU4A 2E4LA 3AA4A 3U3GA 2KFZA 3TAPA 2G8HA 4OKEA 4KB0A 4DS5A 3OS1A 5HLFA 2Z1HA 3L2RA 3M8PA 1YVUA 4CJEA 4PWDA 1RT1A 3WNFA 1CLQA 1C1AA 1SKWA 3RTVA 2NUBA 4W5TA 2A1SA 3QNOA 1BHLA 1U48A 3EZ5A 3QEXA 3SUNA 4CF1A 2OZMA 4H8KA 4NYNA 4QCLA 1RBTA 4M3UA 4AHUA 2Y1JA 1KTQA 1RT4A 2XRIA 1TK0A 4NCAA 1IKXA 3AA3A 1NOZA 3RMCA 3V4IA 4M3RA 5HRRA 4JLHA 4DTUA 1TGOA 2JGUA 2G8IA 3WNEA 3I0RA 4I2PA 1KVBA 1QQCA 1CZ9A 1RBRA 3NF8A 3O4QA 1UOCA 2VG7A 5HRSA 4FLWA 4DFPA 4DFJA 3VQ8A 4BE2A 4O0IA 1HNVA 2B5JA 2YHAA 1JLGA 1WSIA 2DY4A 5SZTA 3LPTA 3AVIA 1ZBHA 3C6TA 2ZD1A 3AO2A 3DLRA 3ZT1A 3HP9A 3K58A 3ASMA 3MXIA 4KV8A 2G8UA 4B9UA 4O44A 5KI6A 3KLGA 3RR8A 4B08A 3OY9A 4OLAA 4RW9A 4PQUA 1LV5A 3P5JA 4BDYA 4JRPA 1KVCA 1B92A 2WOMA 4CJSA 2GV9A 4E7HA 4CCHA 4PUOA 2BE2A 4CEEA 1X1PA 4JS4A 4CECA 1NK8A 1KLNA 2OYQA 4DSLA 3NF9A 1RT5A 1VSHA 1S1VA 1S1WA 1TKTA 2VWJA 4CEFA 1TVRA 4FK2A 2HHTA 3HP6A 4OGCA 3O3HA 4FW1A 3SCXA 1U4BA 3KD1E 4DG1A 1J53A 4CEQA 4RW4A 3AO4A 1VK0A 3CM5A 3TARA 4J2BA 3S3NA 3SQ1A 2HNDA 3OS0A 3OYKA 4FJ9A 2HMIA 1HYZA 1BI4A 3CM6A 3NGYA 4ICLA 4OGEA 3O3GA 3SPZA 1TKDA 4QOZB 2HHVA 4KHSA 2DTUA 1C0UA 4FM0A 4C8OA 1SV5A 4FZZA 4B9NA 2FBTA 3HSTB 3LP1A 4KTZA 2XHBA 4ID1A 1TKXA 4CF8A 4OKKA 4HUFA 3V1OA 4C8LA 1LAVA 1S1TA 1Z25A 1JLQA 3D45A 4DSJA 3MEDA 3TAFA 2P1JA 2X74A 3HT3A 2XY7A 4FM2A 1NKEA 5HRPA 1S9GA 1XWLA 1ZBFA 4HHTA 1XI1A 1RDDA 4KI4A 4XIUA 2QXFA 3THVA 3AO1A 3P83D 2G8KA 1BIUA 2HNZA 1U04A 3OYJA 4OJRA 2OPSA 4BE1A 5DK5A 1J5OA 4CHYA 4E19A 4HUGA 3CQ8A 1I3AA 3KD5E 4J2AA 3OYIA 3KLFA 4FCYA 4FJXA 3V9WA 1BI4B 5I42A 1VSLA 4AHRA 4E7LA 4CJ3A 5C24A 3QEVA 1NKCA 3AVCA 1NK4A 3VQ6A 4CFCA 1IKVA 1WSJA 2EX3A 4GMJB 4IDKA 4FLZA 1NK9A 3K57A 1RT2A 3NBPA 3TAMA 4KHWA 5CZ2A 3HVTA 4DTSA 3DI6A 3K2PA 2E6MA 5C25A 3O3FA 3K5MA 3CFRA 3V6DA 5CZ1A 3SQ4A 1S1UA 2Q3SA 5EU7A 2OZSA 3HPOA 4CK2A 4FLXA 3HO1A 3IS9A 3DMJA 1IO2A 3KKSA 1NKBA 3OYDA 3VA3A 3DLGA 4IG3A 3CFPA 3ZT2A 3D0PA 4AILC 4DSIA 1S1XA 3V1RA 1ZBIA 3P1GA 3DOLA 3KLIA 4CHQA 4CJPA 2WONA 4HVJA 4DMNA 4KHNA 4EZ9A 1ASWA 4CK3A 1WNSA 1U49A 1QTMA 4FJIA 3NGIA 4FJMA 2KTQA 1TAUA 1TKZA 1HMVA
chains in the Genus database with same CATH superfamily
2D45A 3NAEA 3O4NA 4I01A 4DZPA 4BQZA 2ZJRL 3L3VA 2A69F 4A5BA 2Y0SA 3MKLA 4LGWA 4KA4A 4XOPA 1BU6O 4GW6A 5MLCQ 1SL2A 4XONA 4LJZF 4E70A 1K4SA 1JI8A 4CGDA 1B6AA 1XGOA 2V9PA 2O8EB 1OJLA 4FLYA 4LH5A 2XAQA 4NBQA 2YUSA 5KAFC 1GXQA 3Q9SA 1MDMB 4EP4A 3OS2A 3MN9A 3CESA 3J7ZI 2YNGA 5D3GA 5E17F 4H5VA 1SD5A 3PQKA 1W5CC 3REOA 5IOZA 4OIPF 2R7OA 3VQDA 4JK9A 2OD5A 1TQMA 1WJBA 3R0AA 2O8XA 2VBWA 1IN7A 3V7RA 1K78B 4UB6C 1ZLKA 1KFDA 1VSDA 1VQLN 4KIBA 5HS8A 4Q48A 2FXUA 1V5FA 1T39A 3QPHA 5H6QA 2HFHA 4IOXA 2DK5A 4MDBA 3OBWA 4BAYA 2HBKA 4NNJA 2QWLA 1IBMK 4HTLA 2QWPA 2BHYA 4HNVA 1AWCA 4M9ZA 1RTDA 1X3MA 5TJJA 3J81Z 1F21A 3DF8A 5HVQC 2OV7A 4C2UA 4RB3C 4NB4A 3WGGA 2O8DB 1IGNA 5CVUA 3L2WA 3ZX0A 1X3UA 4CJLA 2ELKA 3RJPA 3HB9A 2L7FP 2OA4A 1YJWI 3HM9A 5K7FA 1RNHA 2BY3A 2LG4A 3CD6N 1Z3XA 2M4KA 3OYAA 4MTEA 4ZJZA 1KCFA 2BY0A 1QHAA 1JUMA 3KFWX 5HDKA 1N34K 3OIQA 3AG2H 1NU0A 5AQSA 2JA5J 4CCNA 4F91B 4PSWA 3DOKA 1GLBG 2XAUA 4KMFA 1MWMA 4C8MA 1ILYA 3J8AA 4OAZA 4L3QA 4LY7A 4B1XB 3H45C 3S3MA 3SZ2A 2F4VK 3PSFA 2PEXA 3DKWA 3GTOJ 1OCOH 4Z4HA 3TQNA 3CMEN 1K6YA 3A2KA 1W7PB 4AHCA 1YAGA 3H46O 1IBKK 1LJ9A 3IV5A 2F5DA 2K9SA 3FXQA 2LSOA 3TDZC 4F93B 4XN0A 3F23A 1EWRA 1W1WE 2VIXA 3CJ9A 2M1BA 3KYCB 4B9LA 1IRFA 3WODF 1P2FA 1J54A 1C0WA 4E6KG 1GLLO 4FZYA 4BR0A 5M1NA 3CMYA 4FJGA 4V19S 3CCEN 3OYGA 3EEQA 3VA0A 4IQJA 5LLQA 4H5RA 3E6BA 2P9IB 5HROA 2GLOA 4KDPA 5KTQA 2CQNA 1EP4A 4QPQA 4FETA 4ENJA 2OZ6A 4KYWA 3G1MA 5TISC 1HYVA 1GOBA 4WQ5C 3VEYA 1NK0A 4O8UA 2HOSA 4FLUA 1IG9A 4AHTA 3F8BA 1E0EA 2L3DA 3JCUC 3W6VA 5ADXH 1KONA 5DM6L 3PO3J 5AZJB 2PAVA 5ERIA 1CXQA 5D6FA 3OJSA 1L3VA 3RYPA 4RW7A 3A0HC 1XTAA 2Y0MA 1YW7A 1W5SA 5M3FJ 2A41A 4CZIA 2V26A 4IFEA 4C8NA 1F36A 2GWKA 4RW6A 3NEUA 3E7LA 5E8GA 2R7UA 1M90O 3WTZA 2RQQA 2W85A 2XPWA 4HW0A 4L18B 4F2SA 4LF9K 1R5HA 2HXOA 1RTHA 4M41A 1TZLA 3NH0A 4JD2B 2XO7A 2Z3YA 3H5AA 1KRPA 2HHQA 1ZELA 5M1PA 3KEQA 5ICFA 4ZZLA 3I64A 3PUFA 1FNNA 2K27A 2GM4A 1BIAA 1BUPA 1LWFA 2LREA 4GKJK 2O8KA 1ITGA 2ASOA 2OZUA 3B8AX 4Z4EA 1WWXA 1WCMJ 4MFBA 1U9NA 2DMNA 5J6XA 2FE3A 2HWVA 4XLHA 3LM9A 2QXLA 4BRGA 3VYTB 4CEQA 3OTOK 5DM7L 2VQCA 2WAQA 1DP3A 1DKGD 1QQMA 2HNYA 2V7ZA 1S6PA 2M45A 3KPHA 1C0FA 3O9QA 1T03A 1EA3A 3ABKH 1U0JA 4LB6B 5JLFA 4X64K 2ETHA 3WTSC 2DTZA 1RRJA 3DXMA 2YNHA 2MH9A 2GQQA 5J2PA 3SJJA 2QWOA 1RKWA 1Y0UA 3DRRA 1TK8A 2VN2A 5DYMA 1W9HA 1BOTO 1JJ6C 3VQQA 4LF6K 1Z6RA 3FFKB 1HW2A 2KQRA 3G10A 4MQ3A 4CEDA 3F73A 1BWFO 5I9EB 1BI0A 1HKCA 3KTQA 2ICWG 4Z4GA 2L5QA 2LOOA 4ZYEA 3NGZA 3MKWB 2XC7A 3OIOA 3H3ZA 2EZKA 4PSXA 5EGOB 3MXJA 2XHKA 4L9NA 3DTIA 1XS9A 4FO0A 5BRHA 1W97L 3KK3A 1BISA 4DYQA 3MCAB 2Z16A 4ILGB 2JRMA 4W5RA 2ZSHB 3SNNA 4G7ZF 4ZTFA 1JXSA 2E20A 3SPYA 4QLCU 3KCCA 2KW4A 3VOVA 4DHYA 5FRMA 1DPRA 1D1CA 4RA2A 2BXYA 2NAZA 1A5XA 2I7NA 1U2VB 1B72B 2KP6A 2ZJRF 3G4SI 2DQRA 3VEPA 2IAJA 3L4IA 3FGUA 2QLZA 4JK7A 1JXBA 3MCPA 4BS9A 1GLDG 3I8BA 1B72A 2HHXA 4AIHA 1X1CA 4DGWB 3F9MA 4HX7A 5LRRA 3G3ZA 4UUSB 3LALA 1RDAA 3VQBA 5HL7L 3BPVA 3O1WA 1QZ5A 4CESA 3KKRA 3K70C 4DV2K 5CKTA 2ZJPL 3TL4X 3G6EN 3BR3A 1FIPA 1MMNA 3D2FA 2DA6A 1BA0A 3RPQA 4HNUA 1IRGA 2P9KA 2EZHA 2ZQBA 2YKMA 3SDBA 1EXQA 2KRCA 3OYEA 4OMZA 4YOUA 5H20A 4M74A 1S6QA 2R7DA 5FLXK 3H3UA 4BQLA 3LSGA 3M8FA 2QZ8A 1IJWC 3EO3A 2G8WA 2JVGA 3GL1A 4BRCA 2XB5A 3G73A 3EYZA 2FBVA 3RR7A 4IDHA 2WBNA 4K42A 1RUOA 1YT3A 1ESVA 1VSFA 3LSJA 3SXYA 2O4GA 3AVJA 3C18A 2XY5A 3HM5A 3ABLH 3ZSYA 2QKKA 2DFHA 1TAUA 1KVAA 1J75A 2XRNA 1EETA 4I9LA 1T7PA 1X4PA 1YTYA 4JD2A 5BN9A 1MMGA 3I59A 1T08B 3AY9A 4XOTA 5D8KB 3TOBA 3NQOA 5C4JJ 1WAFA 2HQAA 5AQTA 2FSWA 4MTDA 4FZXC 4WQ4A 4BR4A 2XF5A 3DPTA 2F5FA 3F6OA 5J2MA 3KZYA 2PZSA 2M8GX 2NRZA 3LL3A 1RBSA 3FHZA 2XGCA 1N6QA 2OCEA 5J1RA 4KH6A 3CG7A 1Z1DA 1HKSA 3DM2A 4U87A 1NMDA 2YNFA 4FWNA 3KWIA 1BQNA 3I8DA 4Z4CA 2O8BB 4H0VB 2R5YA 2D5RA 1IXRC 2A6AA 3C0BA 2MD0A 4H0YB 3UNGC 5EVZA 2GXAA 4C3IJ 3K0LA 3ISNC 3A8YA 2PLYA 4KHQA 2NLXA 1T33A 3CCLN 4L0ZB 4BRFA 3RSEB 2EZLA 3IG1A 1O1WA 2V9KA 1FKOA 5BRFA 2MBFA 4R1HA 1JLAA 3D2EB 2WAFA 5DCMB 4OWRB 2EV6A 4YIFA 3LP3A 4O5FA 2HOEA 3D1NI 3FFIA 4CFBA 5CPRB 5A2QO 2KDOA 5HDNA 1NGDA 5AFUH 4E7KA 1OH5A 1CF7B 1XHXA 3B6PA 3R6SA 3WXIA 2LYCA 3OYLA 3NH2A 4J2EA 4B4CA 2OPTA 1O3SA 3C3WA 1QHTA 3LAKA 3LA2A 3ZGKA 1BR1A 1PYVA 1UHWA 3CUQB 3TTFA 1YW9A 2ZBKA 1RDCA 2P9NB 3JSMA 3I56N 1NK6A 2Y75A 1OCRH 2D4WA 5IWAK 3WG9A 2GA2A 3L2UA 1R49A 4CFDA 2HHTA 3QNNA 3OBYA 1Q9YA 2NVXJ 1YE9A 4DU1A 2E35A 2HS5A 3AAQA 3OR2C 2E2OA 4J8FA 3QEWA 3KX2A 5FD6A 2NS7A 1SFUA 1LOTB 3EUAA 4D0PA 3EL2A 5C2FA 1B8IB 3QB0A 1W36D 1S5JA 2ATQA 5F2RA 3BZ6A 3TKYA 1X2MA 1YS7A 3ZQ7A 3JRGA 4EJTA 2BDPA 2QWWA 2ACJA 1LDKB 3DPUA 1IDYA 2VASA 1U6ZA 2WB1A 1O4XA 2RDPA 4PCQA 1YF5L 2FRHA 5ELZA 4E1MA 1F1ZA 2NNWA 3U3YA 1QA6A 3AFHA 3OWTA 3ECHA 3E01A 1VQMN 5EY4A 4S04A 3ISPA 1OLTA 1WKMA 1RIOH 1GT0C 4CZFA 1XGMA 4NCGA 5J1EA 1RNLA 2IGMA 2XUBA 3PUBA 5BR9A 2NNYA 2RN7A 4HX4A 2JT1A 5HS9A 3TP0A 2G8FA 3IRRA 4DTOA 1UAXA 2WC2A 3VFZA 1YJ9I 4JBAA 1NGBA 3HPHA 1PUEE 4Q5VA 3HOXJ 4CERA 4LD0A 5AQIA 1L5UA 3V42A 3FX3A 1XX5A 2JSCA 3CJNA 3WTWC 1BI3A 4Y52J 1L3UA 1R5ID 2LF7A 1OPCA 2OPQA 3TANA 3IAS2 4HAMA 1Z26A 3H0DA 3SV4A 5DUKA 2JSPA 4HUEA 1SEUA 3I59B 4QWQA 3RQIA 3L4QA 2IS4A 5AQLA 2AQFA 4GFBA 2RPIA 3VF2A 3F8NA 2P7CB 3HDDA 1W7PD 5AONA 3WTYC 3S16J 4HG2A 3IUOA 3O8MA 4GVEA 3PIOF 4B3XA 1XNQK 2ME0A 2JA8J 2X6YA 4OPAA 1C0GA 1Y1WJ 3VESA 4A3DJ 5CYMA 1WI9A 1WGXA 3WTVC 3VN5A 4DQQA 1NK7A 2UUAK 2DCEA 5GADP 4DW6A 1LQ1A 1TUUA 3SBTA 3ZSOA 3OVNA 4HCCA 2E1MC 2PI0A 2QSFX 3W2AA 4W5QA 3CUQA 3UR3C 1YITI 2X6NA 1BIZA 5AFUA 4JS5A 3Q7CA 1OFCX 2IPQX 3R4KA 1Y8QB 3ELKA 4E3SA 2CRGA 1HPZA 3EN9A 5CVVA 4IVNA 2GXBA 2IGIA 1X3ZB 3KK1A 4YEJA 2X6OA 3CCEI 2R7VA 1QS4A 3E9OA 3ATVA 3BUZB 3SUOA 3K69A 3QO9A 1R6RA 3K4KA 2OC6A 1GOCA 3VQPA 3HK2A 3OYBA 4J2DA 1ZRDA 3AVLA 4JX4A 3AA4A 4F7ZA 4Y3OA 1U5TB 4YY3K 4UUSA 3HZJA 1J0RA 2E1NA 3OS1A 4F55A 3L00A 1OKJA 5AZIB 5M1OA 2EFWA 4PKHA 3O6BB 3T7ZA 3ZQIA 3WNFA 3KVGA 2JK3A 5BPMA 4DZJA 3RTVA 2NUBA 2A1SA 4EGYA 1BHLA 4BHCA 2CO5A 3ABMH 3WXJA 3EZ5A 2M2EA 3QEXA 3SUNA 4H8KA 4NYNA 3DAWA 2LLKA 4M3UA 1MBHA 4JN4A 3PL8A 2FMYA 1Q81O 1XG1A 1IC8A 1MIJA 5AIPA 1TK0A 5EZHA 2ELJA 2XRIA 3NRVA 3FZFA 1IKXA 3RMCA 4NCAA 4G7OF 1VQNN 3HEFA 1Y8RB 5B8HA 3PNYA 4C3HJ 4GGGA 3J80Z 3JSPA 4JNEA 3ZETB 3DU5A 3QYFA 4C3JJ 4I2PA 3C2GA 3E6DA 4M3FA 2E1OA 1OQYA 1WJAA 3BZCA 2P9UB 1EH6A 3U2RA 1UOCA 4P55A 4A0XA 5HRSA 4Y33A 3CDHA 4A3KJ 2XSJC 1P90A 4H03B 2DN0A 3I55N 2RV8A 1I50J 3GXOA 4BEHB 2IAIA 3LPTA 3H3VK 4YOYA 2W25A 2O8EA 4MO5A 2Q36A 1EH8A 2ZD1A 3MXIA 5BRDA 3RR8A 4PK4A 1ZG1A 4OLAA 1HSTA 3VGLA 2PMZA 4RW9A 4XIDA 2M5WA 4JRPA 3P7NA 2WOMA 2IVOA 2HYFA 2GV9A 2WA0A 5FLXO 3W3CA 4WXHA 4BXFA 1BN5A 3V8KA 4IHVA 1B1BA 4RB0A 3GX4X 4XH4A 4CECA 2DMUA 1AHDP 2FQ4A 2LDUA 1N78A 5AQRA 4NDLA 4CUGA 4DV1K 1S1VA 1S1WA 1YOVB 4CEFA 2DODA 5J1UA 1YX3A 2NVQJ 1O57A 1YS6A 2KKZA 4FW1A 1RGIA 4BGAA 4YOWA 4IRGA 3MWTA 2CG4A 4DG1A 3CC2I 2CGKA 2NYXA 2ZNYA 2V7FA 4GRIA 1TC3C 4BJ6C 2BHZA 2MD5A 2QWMA 3OYKA 2HNDA 3LQRA 3L0QA 3VGKA 1ZGWA 4XRSA 2W4SA 1VQOI 1HYZA 3MN6A 5AQJA 5TKWA 2K3PA 5DD8A 4QSHA 4UY8I 1MA9B 2HHVA 3TSPA 1BG3A 1KQ9A 3FLCO 1R59O 3CF2A 2VKDA 5EYRA 4EEFG 4C8OA 4FT8A 4JOMA 4B9NA 4ESJA 1YYVA 1BOBA 5AZJA 4IXAA 2FBTA 5BPLA 3LP1A 5EGOA 1DDNA 4H5TA 4ID1A 3TU5A 4LIVA 2FOWA 2XRLA 3L1PA 4FTHA 1TWGJ 3HSFA 4F9OA 2W7NA 3TAFA 3CI5A 2IGKA 1SFKA 2MC3A 1XWLA 5HRPA 4HHTA 1BA1A 3KP6A 3K2ZA 3M1CA 1KAZA 5ICCA 1QRYA 1S7EA 3H35A 1VQ8I 2QXFA 4XNFA 3ZPLA 3AO1A 1VQPI 3EE8A 3P83D 2EK5A 1R1VA 2H94A 4XH5A 3SHFA 2VBXA 2VQGA 2JUCA 1QVUA 4M72A 1J5OA 3ID6A 4EJOA 2KZVA 5DUIA 2P9SB 2VT2A 4H0PA 4JKDA 3CQ8A 5LEKA 1POGA 3OYIA 3K6GA 3T5XA 5JVGF 2A3ZA 2H1LA 2IIRA 4AHRA 2K4BA 3ZCOA 2R7TA 1NK4A 2WY7Q 4CFCA 3I55I 1WSJA 4YELA 4IDKA 2QI2A 3T69A 3R0JA 4BBRJ 1RT2A 4AM6A 2OUMA 2ZXWH 2X0LA 3MQ0A 3CCJI 2EIJH 3S93A 2GXGA 5D5UB 2TDXA 2G7HA 3GF2A 3CCRI 4YDUA 3O3FA 1S1UA 1N32K 5EU7A 1D8KA 4FLXA 5FFZA 4XRMA 3L6QA 3DWLE 1XCBA 1Z7LA 1G3WA 3EUHA 4PJ0C 1QNTA 4IG3A 4AILC 4CZMA 2I7PA 2FF3B 1T2KA 1YITN 1LFPA 4OO1J 5LRSA 1REPC 3F22A 4WK8F 3DOLA 3G1OA 1CGPA 3ASOH 2IA2A 3EKSA 4KICA 2WONA 4A3IJ 4V19K 3MX2A 1ETKA 1JGSA 3R6MA 5C12A 4KHNA 4EZ9A 3IP4B 4BEHA 4FJIA 1I1GA 3ZMSA 4FJMA 2BVLA 4HOBA 5HLHA 3O9UA 3NGIA 2LBFA 2F8SA 1TW2A 2JTVA 3I9V2 1YRNB 1TNTA 1FTTA 4G1QA 1RDWX 3L9FA 4WWCA 4CI6A 2OQGA 4DOZA 4CXFA 1JUSA 2NVYJ 1XMOK 4FOEA 2GZWA 2JLEA 4DWIA 2EB7A 1X2NA 1OCTC 3DRPA 1ZYQA 1D9FA 2L4MA 4X1EA 3ONQA 4RLFA 1SUQA 4B9TA 2R7XA 4BY9C 5FLVA 2DT6A 4DSFA 4CO8A 4JQFA 2OPPA 1D5AA 3S2HJ 2HVHA 3C95A 2VC1A 1IV0A 2ZE2A 3CJ1A 2J5OA 1DU0A 3I4MJ 2OA8A 4B1VA 2E2NA 4FJJA 2IDOA 4CJWA 3LWFA 2VBZA 1Z9CA 1TL8A 1VRTA 1EWQA 2XGEA 4M3YA 3BLYA 3CQZJ 2D0CA 4KKOA 3KP3A 3R8EA 5JVHL 4LF5K 3NVKA 1FTZA 1KYZA 3GUDA 4GXOA 3ZN0A 1WJDA 4IO9L 5A2QK 5GAEJ 3GTPJ 3C94A 5CY4A 2Y48A 5IP9J 4OPKA 1TWFJ 3ASNH 1V4SA 1VQ6N 2V4JC 2LP0A 2EQRA 4R8HA 2JVHA 1GLFO 3IRQA 5FPNA 3RSEA 3D6RA 5KAIC 1TW3A 3LZIA 1XMQK 2IS1A 1OH6A 1OYWA 4RB1A 2KL4A 4CJTA 3TAGA 4A0YA 1GLEG 2ISYA 4UB8C 3MECA 2IVPA 3G71N 3B02A 4B3MK 4MO4A 1B9DA 4N5SA 3SJHA 2Q1ZB 5GAHJ 4KPYA 3H08A 4M3TA 2O8DA 2X1CA 3J7AO 3CC7I 3SQ0A 5C42A 2DFFA 2DFEA 3WGIA 4CGIA 1TLHB 1P7JA 5JR3A 4JI3K 2Q0OA 3HGGA 2YHWA 2Z1GA 4RG8A 2FBYA 4I0AA 1QSSA 1WJ5A 1IH7A 4PGHA 3M3YJ 4KRFA 4M7XA 4HDUA 1BJZA 2DA7A 2E19A 5FO5A 2PJRA 4AIJA 5E79C 2E2QA 3DEWA 5LHHA 2KHOA 4QS8A 4CD1A 3NE6A 3RRGA 1JT6A 3GTMJ 3O2PE 3ZEUA 2TRTA 4PZJA 5FGMA 4KN4X 4BR2A 3CCRN 3FZHA 3PO4A 3S41A 1MH3A 2HHHK 2RN2A 4M3BA 4ZDLA 4S05A 3P9IA 4XRFA 3VYRB 3KIOA 3BF3A 4HCBA 3ABTA 2ASPA 2Y9ZA 1LVAA 2D0AA 4OKJA 2QGUA 2LBFB 2BUPA 4BXXJ 3I54A 1K8KB 3K5NA 4CIEA 4RMNA 3TO9A 2DTRA 2KIUA 1U8RA 3JS6A 3DPLC 3IFRA 4V2GA 3M8SA 1VQPN 1B9MA 1T98A 3QPTA 4OAYA 5F08A 4CICA 1G8XA 1LW0A 2BTFA 2J5PA 3G0ZA 3ZQGA 1U2WA 3H1CA 1LE8B 4CEOA 3FXLA 4BHBA 5LD2C 3O1BA 3DWLA 2H6CA 4KIFA 1YLFA 3O6WA 4TSXA 3BT9A 2W24A 1S6LA 2P0WA 3ROUA 1XNRK 1MNDA 4IOCF 1NGAA 3AGRA 2Q31A 2A68F 3EY1A 2HW3A 4MLOA 2K9MA 1HCRA 1DGWY 2H8WA 1KAYA 3C7JA 3S8PA 5L3FA 3CMEI 2D0BA 3FXOA 1MGTA 4A5AA 2D0OA 2X4HA 4W5NA 3KYDB 1D8YA 2KHMA 4OLBA 1QVFM 2LH9A 3HXMA 2A5XA 3DJCA 1KA8A 3LP0A 3AG4H 5E41A 2HKXA 1J6ZA 4B43A 3AVBA 4K0KK 2P81A 2P5VA 4OPHA 3VMFB 1QQOA 2NVTJ 2FBKA 2FU4A 1Z3YA 2E1YA 4FVUA 1G3YA 4U0WA 4YIIA 1U2VA 3LWLA 3P31A 1KLMA 2QTDA 4W5OA 5JHFA 2E5LK 4DNCA 3BTLA 1C1BA 2Q0UA 4HQMA 1ZN2A 1ITYA 4DR2K 2IA0A 2MH2A 5F0FA 3DBLB 4JYAK 4DTMA 1A36A 1TNSA 1Q82O 3HSRA 1ETWA 2R7YA 2VQHA 3QYEA 4G9YA 3JRBA 3FMQA 2QWRA 1S7OA 5HP1A 3C6UA 3CCUI 1OCPA 1MDUB 3NFAA 5TGTA 4NQWB 4OIOF 4FX4A 2R0QC 1XPXA 5M3MJ 2PG4A 3GTLJ 2BGGA 2UV1A 3OV8A 1LKXA 2DA5A 2EA4A 1B9FA 3VEOA 3VQEA 2WAQN 3ERMA 2QWQA 2WV1A 4I9QA 1VQLI 4BE0A 2HF3A 4I2OA 3TO7A 2QW9A 4LSLA 1MU2A 4UUTA 2JN6A 4AU7A 3GLLA 3KLEA 3E1SA 5FROA 4BRQA 2G8VA 3FK6A 1IKWA 4NB5A 1WVRA 4W1UA 4FOIA 3PIPL 5ICGA 2EZIA 2ZXHA 2YV0X 1UA0A 1JKRC 4KH4A 4JHDA 1WRJA 1BA5A 1ETYA 4KT5C 4LK1F 5EEHA 5F27A 2EV5A 4HF1A 3F2KA 2NOJB 4B1WB 3CF5L 3DLHA 3CJCA 3AO3A 4DTRA 1AU7A 2HHWA 3VPRA 3V9UA 4BROA 2FSKA 2H1KA 3CJAA 4JRQA 5LMUK 1NMNA 1FKPA 3AVAA 3CZ6A 3F21A 1N5YA 1FXXA 4CBWA 4R79A 4ILHA 3D5LA 2IA1A 5BR8K 4YG2F 3VQ4A 1Z05A 4MGRA 3K9KA 2H09A 4M73A 3P38A 1W2BM 2I5JA 4DQPA 4KAZA 2CUEA 1UCRA 1L3SA 3GLXA 4CJ4A 4IHXA 5L3DA 2YPRA 3AAFA 2BANA 4B8AB 1GVDA 2GWRA 2A5YB 3DCFA 4LITA 3A5NC 3TTDA 2UXCK 3DEEA 3CCSI 1R5GA 4LOCA 3K1MA 3QU3A 4A61A 4QAGA 3W6JB 1DTQA 1XHZA 1WBBA 5E1WA 3CC7N 4EFHA 3WT0A 4FWKA 3S17J 1TAQA 4CJ7A 1O13A 3VEWA 2A61A 3D7EO 1WHUA 1ETOA 1FEXA 4CYCB 3LZJA 2GELA 3H3NO 4IRIA 1T44A 5FJ8J 4KISA 3AV9A 3NF6A 4BC4A 4B9QA 3A01A 1HC8A 4DJAA 3ZMUA 1STZA 3VGMA 5AQHA 4PUOA 1RTIA 4AH9A 1WH7A 3PIOL 3SBGA 4RB2C 3RCOA 4CEBA 2V1UA 1FIAA 2PY5A 2HTJA 3BY6A 3SYZA 2ZJQL 1Q7YO 2FQ3A 2XASA 3QODA 1VQ7I 1RETA 1FX7A 4Y15A 4FW2A 4CJPA 1M1KO 4N56A 4CGHA 3BQZA 1NGEA 4BGDA 4NCBA 1FW6A 3DLBA 3ZMZA 4N47A 2VONA 3ZR8X 5KPTA 3CJQB 3SYTA 1FOYA 4MFDA 4FK4A 1IN4A 2QM1A 3TOAA 1W7AA 3Q5FA 3QEPA 1KGSA 1T56A 3U4LA 4CW7B 2QQ8A 3CJTB 2P51A 4I6MA 4ZYDA 5CHIA 4A69C 3V7CA 2RKIA 4M3ZA 4KIGA 2BVMA 4DB3A 2E34A 9ANTA 5AQVA 4R5PA 4DBRA 4HQEA 3SV3A 2JJ7A 1HA8A 1UA1A 3H5NA 1T3VA 4A0ZA 4FWRA 4II3A 3ZCMA 2IOCA 4BVPA 4IRHA 3WU2C 3E3VA 3RSNA 4CJ5A 5LMNK 4FJNA 2DU9A 3SI6A 3M8RA 2RVCA 4M45A 3VODA 3VYUB 2HEOA 2IS6A 2FSNA 1ONVA 2VJIA 1MD0A 3PNVA 5JI6A 2ZSIB 1LE8A 3RKYA 3BPXA 4L9TA 4HDVA 1EF4A 2H3GX 4FJLA 4CA0A 3VWBA 4DQSA 3CLOA 1OCZH 1LAWA 3U9DA 1FJLA 5JVGL 2NS0A 4IEEA 2DMPA 4KI6A 2YI1A 4CK1A 1ZGAA 4B3SK 2DYRH 3DXMB 1OR7C 3L7WA 2E60A 1H1VA 1HUXA 3FZLA 3ZQFA 3ZT4A 1D0XA 2VBYA 2JPCA 3LSPA 3K70D 2P9UA 3EQLF 5K5OA 2K85A 3BTIA 3CP8A 3GG4A 4C2TA 3W0LA 2PYLA 2NRTA 3AA5X 3CD6I 3SUQA 5KK1A 3K1PA 3CETA 3U9GA 1V4TA 4O4GA 4E0DA 1H88C 5C10A 1J5YA 4IO8A 4CJUA 2PJRB 4DQIA 4D7MA 2AS5F 5EG0B 3CCYA 4A5MA 1JJ8C 4OX9K 1K7AA 1FYKA 2GIVA 3TI0A 2P5OA 1Q8IA 4XLEA 4BRKA 2Q2EB 4H0XB 3OJUA 4DTPA 3LA7A 2FC0A 4K8XA 1S3JA 3QP5A 2E7WA 2PMUA 3BR1A 4BY1J 4RGUA 3JAMO 2R7ZJ 1BGXT 3OYNA 4XLNF 2GBZA 3P4IA 2BOLA 3OW2M 1H9GA 3LSRA 4L5IA 3CC2N 2HPIA 1T0FA 2YSRA 4IJAA 2GUIA 4B1ZA 4ZTJA 2R7SA 3M3ZA 3SMPA 4HLYA 5FLMJ 4CF2A 1IG7A 2YHBA 1EH7A 2X6XA 1W0HA 1Z21A 3VQ9A 4WFNL 2HKOA 4WXCA 3U8XA 3J81O 4DUYK 2YR2A 3WXKA 5FPEA 3MKYB 5GAHP 3UKUB 2EA2A 5FLXZ 2HB5A 1U45A 3CYMA 1K9MO 2PX9A 4RAFA 2KRFA 2PBDA 1FZPB 2EFOA 4CHZA 2QA4I 4LLGF 1Y97A 3S9HA 4X66K 2EFQA 4HNTA 2L02A 4BGBA 4CF0A 4JI6K 4BU2A 3MKZA 1YXQA 4B3RK 3I4PA 4EGZA 3OA9A 3BP8A 2HDDA 4QS7A 4FWSA 5LGUA 4Y0WA 3PV8A 4LC9B 3GMEA 2L54A 3ZQCA 4DBQA 4IHSA 4F3TA 2WTUA 2A6HF 2DA4A 3K2AA 4PJLA 2DYSH 5F0HA 5J4YA 4JV5K 4BJTA 2A3SA 2KZGA 4JI4K 3MAJA 3SAGA 3CPWM 1YIJN 1FLIA 3MMYB 4WQ5A 3C6AA 4WE1A 3NCIA 3QESA 2BY2A 4BWMA 4GV3A 4HZFA 3V1QA 5FRNA 1LFBA 4EJUA 2BW3A 4CHPA 4BQOA 5K1YA 1YTAA 3D5SC 3O3KA 5GPAA 4E7IA 1RILA 2AA4A 3QIOA 4EJWA 3BDDA 2BGCA 2COBA 1HRHA 4O8KA 2VOPA 1RUNA 5DCMA 1VSEA 1WUAA 4LFAK 2FD5A 4EV0A 5HRNA 4I6ZA 2M0MA 5ILSA 2OBPA 2V1NA 3MWPA 2P5LC 1MBEA 5DEQA 4IF4A 5D6EA 2GTDA 4XSXF 2Q97A 2K7LA 1T6SA 3G4SN 1J09A 2DOEA 2A5WA 4IO9F 5DM7F 2CS3A 1YX5A 2EWNA 1JKHA 2F4OB 5H6RA 3M1FA 3ZSVA 2YX7A 1T8IA 4MEXF 1XGNA 5A2QZ 5AQKA 3ZT0A 1NK5A 2D5VA 3MEEA 4CZHA 5HLIA 2E4LA 4NO7A 3U3GA 3LDQA 4DU4A 4OKEA 3TAPA 1NNEA 4KB0A 1LUJB 4CZKA 1WSUA 4DF4A 3CJRB 3QP6A 1X9JA 2DOFA 3D0SA 3HHHA 3L2RA 1R36A 3BTCA 2O6GE 4H5NA 3V9SA 2EILH 2JA7J 1ZH5A 5IPAA 1R9TJ 1QHGA 1C1AA 1SKWA 5CYVA 5F0CA 3QNOA 3F8MA 4I6MB 4CF1A 4X65K 3E66A 3IKTA 2KRHA 4U0YA 2R5ZA 3HSEA 3ID8A 1MDMA 4U7DA 4FWPA 4JKGA 1WI3A 2DA3A 1MBFA 1R4NB 2Y2ZA 4B1RA 2V6EA 2A6EF 3V4IA 1R22A 3IH4A 5DCFA 4YDUC 2AXTC 3MZ8A 2E7XA 2P9NA 1TGOA 5HRRA 2IGNA 4OOIA 2JGUA 2FJ1A 2FNAA 2ZKZA 3I0TA 4EM2A 3WHBA 1QQCA 1X58A 2AP1A 1W4MA 3DXJF 2P9SA 4JHDB 3KP2A 1CZ9A 1RBRA 3S1QJ 3NF8A 3LDOA 4F92B 1ZARA 3WHCA 5E3MA 1NGJA 2VG7A 4FLWA 1Q1VA 4XKVA 2VGNA 3E5QA 3VQ8A 3O8HA 2EIMH 4O0IA 1E17A 4DFJA 2YHAA 3D2FB 4H0EA 1WSIA 2DY4A 1QU3A 2STTA 3GOIA 3VETA 3HKZA 5BQTA 1E4GT 3C6TA 3AO2A 2OF7A 3H5RA 1P4WA 3HP9A 1VQ9N 4U67L 4KV8A 1OISA 1ZR2A 4DV0K 2F6CA 1HX1A 5KI6A 4B9UA 2I10A 3GEZA 3OY9A 5AQYA 1LV5A 2CFXA 2O61A 2QEXI 3QBXA 1DT9A 3FXMA 2OTJN 2C6YA 2BE2A 2UWMA 1KFSA 1S9HA 1X1BA 2P9LA 2M7AA 3NF9A 4JKCA 5GINA 3QDKA 4ZDOA 2MSYA 3CLQA 1RT5A 1VSHA 2YS9A 5F64A 3CF5F 3UKRA 3N97A 2HXIA 1TVRA 4OU0A 3SEQA 1G2HA 1OYYA 1JCEA 3PLAA 5DDGA 1P4AA 2Z2SB 4RW4A 1BIBA 1HBXG 2VC0A 4LB5A 1VK0A 2XSDC 4YORA 3SAHA 2O8CA 3PSIA 1UG2A 4B8XA 3CHWA 3KE2A 3FHNA 2P4WA 3ENHA 1GHCA 4FJ9A 2HZTA 3CM6A 1GVJA 3HG9A 4OGEA 4BBSJ 1MMSA 3THWA 1NK8A 3LSTA 3GO5A 4JI0K 3OSGA 4KJZA 3FR0A 2HU9A 1C0UA 3W3DA 4BRLA 4HF2A 4DR1K 1SV5A 3E6MA 3SAFA 2ZM6K 3HIFA 1IF1A 3LFKA 3LSMA 2XHBA 4BG9A 4LG0B 3AG3H 1FPQA 3BR0A 1SC7A 1HLUA 2E8AA 1MW7A 2DT7B 3J7ZO 5J3LA 5AQZA 4LFCK 4M6YA 3GZ6A 1LAVA 1JLQA 5BPDA 1LVKA 1Z25A 3C7NA 3QMLA 4I0BA 3RKWA 3CCQI 3FISA 2XY7A 4FM2A 2CW7A 1A6IA 2Y31A 5GP9A 1ATRA 4RLQA 3LSIA 3MMVA 5F0XA 3C7NB 1Q18A 5GAEP 1XI1A 4LG3A 1GLJO 3ZETA 1RDDA 1SFXA 4KI4A 4XIUA 3ZP5A 4J2BA 5FKNA 4RGRA 3J7YJ 3OYJA 5FKLA 5GAGJ 2OPSA 2W40A 3GBTA 1YFHA 3EE9A 4BQNA 3T1HK 4Z94A 3CXCM 4A59A 3QPLA 3R61A 2HDWA 1HNXK 2HBLA 4J2AA 4KUMA 4ITVA 3V9WA 4NQWA 4A62A 4LK0F 1LEAA 4HEA2 4CJ3A 3QEVA 4JYKA 3GDQA 1HDDC 1DPUA 2NRWA 2X78A 4IOCL 5E3NA 2EX3A 4FLZA 2CH0A 3K57A 2JPBA 3F6VA 3DBRB 4DIQA 1SVOA 3HVTA 2B0LA 3ECOA 5F1RA 2YJFA 3E1YA 4H0TB 4DTSA 1R1UA 2OJED 5DV5A 3K2PA 4S0HB 4AC0A 3CFRA 5CZ1A 2WB1N 2Q3SA 4OIRF 5BS6A 1LB2A 2HMPA 3HPOA 2OZSA 4CK2A 3HO1A 5JLHA 1NKBA 3VA3A 3O8GA 3EUKL 3ZT2A 2XPUA 4A3CJ 1S1XA 2WUSA 3S2DJ 4DSIA 1BBYA 4EATA 3KLIA 3CUOA 4F4KA 4NLBA 1WH5A 4PJMA 1BC8C 4HSTA 3CCLI 2P9IA 1XC5A 2QUFA 4IOAF 4CK3A 2GOXB 3FMRA 4FHTA 4BNCA 3E5UA 1ZRFA 3U9ZA 5ADXA 1QVTA 2UUBK 3HOTA 1J5EK 3RPUD 2F5CA 3OIPA 4XLCA 2EV0A 2IW5A 4G12A 1I1SA 1ATSA 4I7FA 3CC4N 4FK0A 4CE9A 2DA2A 1WSFA 3HJFA 1XUPO 4WQ4C 2BZTA 1IJJA 1U78A 3HOUJ 1NK3P 1ZKGA 3BC8A 1HXDA 3Q9VA 5HLTA 4YIRX 2OAZA 3O08A 2CJJA 2JRTA 3OHRA 1W7PA 5E26A 3L2VA 1N77A 2RE2A 3DV8A 5K7ZA 4MIMA 1YHQI 4BRPA 5JMVA 1E2XA 4NC6A 4D5FA 2F8TA 3KLOA 2ZNZA 1VAZA 1IRXA 1JXEA 3B6OA 4GDFA 3HJEA 1B59A 1TK5A 4UQGA 2Y30A 4BL0B 3FM3A 5ILUA 1O3TA 6PAXA 1K79A 1DTTA 3MN7A 3Q7BA 2IVMA 2R93J 2DDAA 5IT3A 4NXMK 3RVCA 1JCFA 2IJLA 4A3GJ 2J4RA 3QICA 3KLHA 1YHQN 3H9GA 3BWGA 2NRAC 2BV6A 4HF0A 2P9PA 1DGKN 2IC3A 3QAHA 4Z0UA 5DTDA 1QZZA 4CHOA 3V4GA 5LBQA 2DA1A 2K02A 5E8IA 4UY8O 2MGQA 4HWIA 4F52A 3BY5A 2VOOA 2CU7A 3FM5A 1UFMA 3NMUA 3H3OB 2XV4S 5HS7A 4E1JA 1ETQA 4OVLA 3ZRGA 4IHWA 3HM8A 1SKSA 2L9VA 3IAYA 1HYSA 2HQRA 3E0JB 4L9JA 5E84A 3RRHA 5F04A 5CQEA 2VE9A 1X1DA 4CCMA 4EMSA 1MSEC 1VQ4I 2X6SA 4Y17A 4RDUA 1JUPA 1SVMA 4Q5SF 3RTRA 2IRFG 2XAHA 4Z6YA 2KJBA 4UUVA 1HKTA 4DFMA 2HZDA 1UWBA 2CGLA 5KPRA 4FISA 4C8LA 2G9WA 4ANJA 2NXNB 4KHYA 1R00A 1QHHD 2VJJA 3G6EI 4XL9A 2QBYA 3VTHA 2RF2A 4HRIA 3J81K 1XMAA 1BL3A 2FOKA 3HI0A 2KPMA 5CE3A 3AGKA 1F4KA 4FJ8A 3MZYA 3JRCA 1CF7A 2AHQA 2O7OA 2L0KA 1D3YA 3IAM2 1FOKA 2QBYB 1ZTRA 3GCMA 4OIQF 1FK9A 4N4OB 4FQGA 3LP2A 3SUPA 2LY1A 2MA3A 3IMXA 1WJFA 5D5VB 3L2CA 2H8RA 1W0UA 4O3MA 3S1NJ 1HQUA 2Q1NA 2FBIA 5J47A 4A3JJ 3ZSZA 3TAQA 2ITGA 4L8RB 3GFMA 4N0BA 4BH9A 1HQEA 3BR5A 3NF7A 3VQ7A 1X3WB 1IBLK 4Z2YA 1QPIA 5CVIA 4ZH4F 3EKUA 2L2OA 1KC8O 2CWEA 1ASVA 4J00A 2W57A 4ZYHA 2X1DA 1K61A 2KLAA 3AVMA 1V4RA 4XKWA 5FDLA 5AQPA 4GKKK 1E3PA 4BXUA 1W0TA 4XH1A 3WE2A 3K5LA 3DXKB 2QQBA 1O7FA 3WU1B 3VQ5A 4JKEA 2HYJA 5E20A 3VSKA 3SDGA 3ERED 2ZWHA 3THYA 3IL2A 4IEIA 1NG7A 3FBIB 1U47A 3H1VX 2DJNA 3MD2A 1U8BA 3VERA 3NDKA 3JW4A 4ELUA 2PN6A 3EZWA 3HL2A 1YIOA 4JK8A 3CQYA 4JI2K 4WXDA 2VLAA 5B1BH 1A04A 1LCUA 3VF4A 4BR9A 2K9LA 1J9IA 2FMLA 2Q2EA 4CHNA 2EINH 4KO0A 3MCZA 4OINF 4WCEL 4ENNA 1HLVA 2KQ2A 5C3EJ 2KJCA 3K4JA 3N4QA 3THXB 1YG2A 2ZMEC 1GLCG 4DV3K 2LR8A 1IN5A 4EJVA 1TWCJ 1KQSM 4BQQA 3HBTA 3ULEA 4M3XA 2OPRA 2D1HA 1NOYA 1TYQA 4KTQA 2PMZN 4A12A 1WOQA 2LNBA 2QKLB 1CXUA 2D0PA 4EIAA 1X9SA 1OYIA 2I5UA 3JSOA 4DV4K 1LDJA 2OCCH 4AM3A 1VQ5I 4JI5K 2BE5F 4AHSA 2GUPA 2CQQA 3LWMA 1W36C 5T7BA 3T1YK 4IBNA 1D9DA 4KTWA 2K86A 3LFUA 3S15J 3CCJN 1VQ4N 2RREA 5F1XA 4H4MA 4H0OA 4CBXA 3CCMN 4NUBA 4PUSA 1G6NA 4G6QA 2UXDK 2ECBA 3G25A 4BRAA 4NXNK 4XRSG 3VDXA 5JS2A 3QYBA 4HBLA 1ZAOA 3TW7A 4EM0B 5IP7J 2ZXJA 2A40A 2JA2A 3WTTC 1WLJA 4YOTA 3SLCA 4WYBA 3PY8A 4UV9A 1OKRA 4E1NA 2A07F 2E2JJ 3VEZA 5CQGA 2G7UA 1VFCA 4FM1A 1S29A 2YHXA 4I2QA 1E4FT 3RYRA 1UHMA 1QSYA 3LANA 4ZHRA 3CMMA 3LQQA 3QOPA 3FZVA 3NWTA 3OL4A 1JE8A 4BRDA 3L8BA 1OCCH 4HA8A 2H27A 1KU9A 5AZIA 4E89A 4MHGA 1MJBA 3A4CA 1RCHA 4PFOA 2HHSA 4A6EA 3IC7A 3OYCA 5HDGA 4HSRA 1ZREA 1YTUA 3TMOA 2DW4A 1D0ZA 5L3BA 2ESNA 1RBVA 1VSJA 3OSFA 3JRHA 5J8FA 3LAJA 1FT9A 4H5WA 1IKYA 3TR8A 4CVNE 1RI7A 1ZBLA 2UU9K 3LSKA 4M63C 4CJQA 1CZBA 1JHHA 1V3FA 3WGHA 2HTSA 1BOAA 2GA1A 4LD5A 4UNOA 4LFBK 4A3MJ 4N76A 2E88A 3OYHA 3J80O 3IWFA 1HJRA 3A01B 4CF9A 5M1KA 2CSOA 3VF6A 2EHGA 4DTNA 5GTHC 3LL7A 3E6CC 1TYQB 3K4LA 1EX4A 4O5BA 4CYCA 1XB4A 3WXMB 4DTXA 2VQFK 3JRAA 1WJCA 2JMWA 4II2A 1RT7A 4B1UB 4LG0A 1HW5A 4BHPA 4CZCA 2X1EA 4BACA 1T6DA 1NJZA 2G8UA 1J7KA 2B4JA 2E2PA 2IT0A 3BZKA 2LMDA 4WCGA 3PX4A 4K2EA 4CYDA 3PJRA 1SL0A 3KETA 2PYJA 1LNWA 4BDZA 5DS9A 1WSEA 2GWJA 2VG5A 1XGSA 3A5LC 4K8ZA 5JFRA 2CGPA 3FBNB 1RBUA 3R1XA 2QA4N 3A03A 2VJ4A 4ZZDA 4FVMA 3S3OA 1D8JA 2EH3A 5LJWA 1T05A 3BDPA 2L7ZA 5JHUA 3FZKA 3M07A 5EXWA 3HPGA 4DR7K 4ON0A 2O8CB 3DLKA 3T1AA 4F3QA 3ZT3A 3RKXA 3KHYA 3OMYA 2AXLA 3GBGA 2HOTA 1QO0D 4XKBA 2M3AA 1M1EB 1MBKA 2UZKA 1TUYA 1ZXOA 2R7WA 3HRSA 1C0TA 2ETJA 2ITMA 1FMWA 4FLVA 2WBMA 2Y1IA 3L09A 4KHUA 2G0EA 1SAZA 2NZTA 4BYYA 3PFYA 2Z1DA 2VCPA 5D5WB 2QK9A 5IYDJ 4PL7A 2AQEA 2QF7A 3DEUA 1NJYA 3H92A 1MJAA 2M87A 5KCMA 3HTVA 1QVGM 3PX0A 3HUGA 3JR9A 4C2MJ 1IXSB 2ZB9A 3OYFA 2DJIA 3MX5A 3SK3A 1K8AO 1V5EA 2DT5A 3ATUA 2OANA 2DAOA 1NHAA 1G15A 3BROA 4FYDA 4C23A 2HBJA 1Z77A 2JWTA 3ZX3A 3NARA 5IP6A 1SFEA 1T6CA 1NJXA 4XQFA 3AVFA 3WTUC 1R71A 3ZSQA 4DU3A 1RPWA 2CGJA 4AVZA 4ASNA 4B48A 4KMUX 3TWHA 2A1RA 4DR4K 3HVRA 1HKQA 3RWUA 2LK2A 4O5VA 1TT5B 3FK7A 3THVA 1JJ2M 1JTYA 1GUUA 1KXPA 5DD4A 1SANA 2XVCA 3U1DA 4MQ9F 4DUZK 3CUQC 1HKBA 4GVMA 1SVLA 3ZOBA 5TKYA 2VL8A 5I3UA 4CGJA 1TTYA 2VB6A 4ILJA 4P5OA 3SJMA 3HOZJ 2E6LA 1T0FC 2JUGA 1UG0A 1WBDA 1FOWA 3RI4A 1IW7F 4I09A 2VQEK 1HQCA 1ON2A 5EDNA 2Q8KA 3S1MJ 1IUYA 3UKUA 5D8LB 3ZSWA 3LM2A 4DV5K 1D0YA 2NRHA 3AL0B 3R60A 3KZBA 5J2QA 2X48A 2LY9A 2OTJI 2QKMB 2XPVA 1Y64A 1P9QC 2GOMA 5CVRA 3QBWA 3FWEA 1REVA 1VRUA 5FKKA 2M30A 2YX4A 1DP7P 4JKBA 5IT9K 4CJRA 1G4DA 3NVMA 3V9XA 2O8FB 2O9LA 2MW8A 2W84A 4IWVA 2CUZA 2NVUB 4DLEA 2O8FA 1XSXA 5LGNA 1ZHFA 1ZRCA 3PFIA 3T8TA 4JK1X 3ALYA 4KBOA 1OH8A 2F2EA 4JI8K 3KJVA 1IDZA 3SMSA 3AO5A 4BRNA 3FKJA 4NHJA 1LEBA 3AVNA 2KKOA 3TSUA 2LSNA 2STWA 1K8KA 1I27A 2NOGA 3FXRA 1BQMA 4KNYA 4M3GA 3WNGA 4H4KC 3G71I 2M4GA 4FJ5A 2E1MB 1O3QA 1MNMC 1A5JA 1SMTA 3EPZA 1K78A 3QLHA 1L0OC 4DR6K 2F9TA 4EHUA 4RGXA 2ELHA 5AR0A 1K4TA 3LDLA 4M3WA 2Z1JA 4Q0BA 4BG8A 4NC8A 4A3BJ 1NBWA 3CCMI 4RW8A 1EQYA 1SS6A 4K25A 4A2AA 4DFKA 2VGMA 2KMUA 3QIPA 3GTGJ 1JHFA 3HTUA 1IUFA 1R23A 4RS8A 2O4IA 1XN7A 1G59A 2DMQA 1NJWA 1I94K 5AJ3K 1ERDA 4KFBA 3AA2A 4D1QA 3QFUA 4B8CA 4B3OA 3MVPA 1NJIO 1H0MA 3MWMA 1A31A 4U0VA 5HNFA 2Y69H 1U5TC 1V5GA 2K4JA 2Q0RA 4CHUA 3U6FA 1RT3A 2VPRA 4PJJA 1UB9A 5KRSA 1RTJA 1X9WA 4PDKA 3COAC 3TSQA 1ZGJA 4P96A 5M1FA 4UV8A 1VSKA 2IS2A 1NM1A 2YNIA 1WSHA 3CMAN 1J9AA 2WFBA 2MFZA 1BI2A 2VPLA 1YO5C 3M1EA 1UELB 3KZIC 3Q3SA 2HPMA 2TCTA 2V7YA 4HV5A 1RDBA 2LTPA 3SZGA 4BUPA 3O80A 2ZJPF 3I5UA 3ENOA 2WTEA 1ODDA 4DS5A 4FE7A 4XORA 3GTQJ 2V1DA 5HLFA 4FSVA 2Z1HA 4HV6A 2ISZA 5J40A 2R5YB 4MO7A 4L9VA 4MNUA 2VJ5A 4CJEA 2QM3A 2N8GA 2VT3A 3CTAA 4DYCA 3KZZA 1RT1A 1CLQA 5EOYA 3PX6A 3WTXC 4CIGA 3CJBA 1U48A 4IHYA 3SQNA 1XDSA 4IL6C 3LOCA 2NRRA 4JX5A 1LFUP 5FKMA 1XC3A 2YX6A 3FKIJ 3RQ4A 1RBTA 3V8LA 4Q4ZF 2PBIA 2CFOA 2F4MB 2M0CA 1PVEA 3I58A 3F8CA 5EG0A 1AOYA 1JGGA 1KTQA 1RT4A 4K43A 1MH4A 1WQ2A 1NOZA 1OVYA 3AA3A 4MEYF 4M3RA 4CZJA 4D7NA 5M5WJ 4A93J 1OR7A 1VI0A 1FBQA 3B73A 3WNEA 4QPOA 3ENBA 3UE5A 4O6JA 2BXZA 3WE3A 1KYWA 4N9HA 1MMDA 4WF9L 2OTLI 3HZ6A 1V54H 3M7GA 3O9RA 4JEPA 1YRNA 1HDPA 4BE2A 1OH7A 2ZGZA 3JTGA 1CZAN 1HNVA 2B5JA 3FXJA 4XEIA 5SZTA 3AVIA 2E5ZA 1LPQA 3S32A 2XAFA 2P8TA 4XK4A 2HDCA 1G99A 3ASMA 3ZT1A 3T0YA 4DSLA 3GFLA 4GV6A 4ABZA 2LD5A 4CGZA 4B08A 4BVOA 4PQUA 2V52B 2Y0SN 4E7HA 1B92A 1GLAG 1KVCA 4CJSA 4CCHA 3MN2A 4AIKA 4CEEA 1TT0A 2EJRA 3U21A 3JAMK 5H1SQ 4JS4A 3T1BA 1JCGA 3R3LA 5LL6Z 1HNZK 1KLNA 2K40A 3D5RC 2OYQA 1RC9A 4LF4K 4E4HA 4EHTA 2F7TA 2VWJA 2EBIA 2W41A 4FK2A 4DR5K 3HP6A 3O3HA 3SCXA 3KD1E 2XF7A 4OMYA 4FPAA 2ID6A 5HODA 3K4BA 5LFAA 4G7HF 3Q0UA 4RM2A 3AO4A 1R7JA 2NNNA 3CP2A 3W2WA 4A3FJ 3CM5A 1TP4A 3H6EA 5E1ZB 5B66C 1XCVA 2W82A 3TARA 5FFXA 5FPMA 4ETSA 1ZYRF 3GTJJ 3CCVI 3DTKA 3IH2A 2HMIA 1TKDA 3GFIA 3O3GA 5M5XJ 1KQ8A 1ZQ3P 4QOZB 1SMYF 3JRIA 3KP7A 1U5TA 3KP5A 1A35A 2DTUA 3BJ6A 3J7YP 4FM0A 3QOEA 3THYB 3BG6A 2ZGYA 2BEOA 1IN6A 2COMA 3DKXA 3FIWA 4A5NA 4YFNF 2DPDA 1ATNA 3C65A 1VQNI 1YI2I 1FOXA 3HSTB 2B7EA 1FP1D 1Y56A 1OMIA 3DU6A 2D1VA 4CCKA 4B1YB 4CF8A 2FLOA 3V1OA 2BYVE 2F5VA 3H36A 3HHGA 1MKMA 3EUHC 4Q47A 1DUXC 1S1TA 2UUZA 4AIDA 2ZF5O 2P1JA 4B3TK 2QYOA 3HT3A 4U7BA 2RNGA 4G94A 1ZBFA 2D1KA 4BRIA 3BG5A 5LJVA 3QPSA 4CH7A 3BTJA 1FBSA 4IQ4A 3ZMTA 1H9TA 1KAXA 1S22A 2RHKA 2ADUA 2G8KA 3ULQB 3QRFF 4JKGB 1U04A 2PQ8A 3WU0A 1FYMA 1VTNC 4XMYA 4E19A 4UVBA 4IFVA 4YOXA 1NG6A 2HF4A 3C1DA 5BNGA 4BC5A 5LY3A 3RPUA 4FCYA 2E36A 4FJXA 3LMMA 2LY2A 4M9SA 3VPZA 4E7LA 3TTCA 1F43A 2PMHA 4XLFA 4FL9A 3AVCA 1F9NA 5C24A 4DR3K 1NKCA 2VI6A 1IKVA 5KQDA 2ID3A 1NK9A 2WAEA 2R5ZB 1E3HA 3NBPA 1FSHA 4ISEA 2HHUA 1VHXA 5CZ2A 4M7YA 1GV5A 4PKIA 3DI6A 5C25A 2PJPA 1X1AA 2HVRA 1MMAA 5EEGA 3O9TA 3K5MA 3V6DA 4BJ5C 3FXUA 3IKVA 3IS9A 3VB2A 3KKSA 3V8JA 2GBYA 1U9OA 1P7IA 3KEYA 3DLGA 3CFPA 3D0PA 1N75A 3HRTA 3BCBA 5EEAA 2NRVA 1ZBIA 2FXAA 4XSZF 3S1RJ 1YUWA 2LFBA 5LHGA 4LLNA 3P1GA 1X19A 3ZYYX 3J80K 4CHQA 4DMNA 4XM3A 3OOUA 1TQPA 1S72I 3M5RA 1NG9A 1U49A 2VYPA 2QQAA 2ZC2A 3DXKA 1QTMA 2XROA 1PUFA 3LDNA 3HRUA 1HMVA 1DU6A 3RMBA 4RWTA 3FDYA 3TAEA 5KHDA 3PIPF 1O7LA 3SFIA 2FBXA 1FMVA 1UJ8A 3DP7A 4Y1DA 5BN8A 3CO7C 3ITHA 5C4XJ 1SD4A 3I53A 2ZCWA 5H2FC 1MSFC 4RAYA 2KZMA 2Q2RA 2HBMA 5K14A 4EZ6A 4DKWA 3LA3A 2ECCA 5L3CA 2I8DA 2IXSA 3BOQA 4CDGA 4J19A 2R7QA 1K73O 2HGCA 3KWGA 3MDQA 3U1KA 5J1YA 4DTJA 2HQNA 4ZYAA 3L2QA 4TV7A 3S2WA 4B47A 3LNQA 3IKMA 2DFIA 3CFOA 3KK7A 3BR6A 5ED4A 3A2FA 5BOXA 5TRDA 4H4OA 1VQ5N 1Z91A 4BR7A 4CCOA 3I0SA 3HUGB 4MFEA 5SWMA 2P5GA 3D2EA 5AQGA 1PJRA 1VQMI 5EJCA 2JA6J 4WFBL 2RAEA 1I6XA 4D5CA 4KITB 5ICEA 2KIQA 1GLNA 3OYMA 1LWEA 1NGCA 4MDAA 4AD9A 1P8ZA 2HVIA 1LDDA 4GO1A 1X9MA 4F3OA 3VQCA 4DYRA 2MLKA 1HSJA 5GTIC 4ISGA 3TPQA 2KLOA 1C0MA 3K5OA 1SL1A 1HPMA 3RMDA 3JRFA 1XMKA 3HOYJ 2L9SA 3I56I 4ELVA 1JLEA 2IEKA 3DRSA 1MBGA 1E3MA 3RDIA 1NTCA 2KZZA 4GY2B 1SFOJ 4BQAA 1C6VA 2CQ7A 4BKXA 2OQRA 3P9KA 3HGYA 3LDSA 4CZGA 3SZTA 4AQYK 3M4OJ 4CIFA 2VODA 1WSGA 1HNIA 1R4MB 3UIQA 3A0IX 1KU2A 2FA5A 3HKZN 3HYFA 5M1QA 4RAGA 3KYLA 1JL2A 2NS8A 2R92J 4MLEA 1XSDA 4DSKA 1WB9A 3AVGA 1N8RO 1AKHA 2B6AA 2Z99A 2QKBA 1D4XA 4IZ9A 2ZJQF 3QWLA 4XR6A 4N9IA 1QBJA 3I71A 5E3LA 2Y9YA 4E7ZA 2QEXN 3ZXSA 5AQNA 1ETXA 5AQWA 5IT9O 4CGFA 3JREA 2YHYA 4CFAA 3LPUA 4A3EJ 4CEZA 2MG4A 3QFPA 2AJQA 4M6XA 5AQOA 3MZHA 2VQLA 1WPKA 4LF8K 1Z6TA 4V2FA 1S3XA 3LDPA 1WJEA 4FJ7A 4DQ8A 4I02A 2Z5UA 4G6DA 2XIGA 1VQON 5E18F 1Q86O 3SZPA 1Z0XA 4BRHA 2H6BA 2DI3A 3K4CA 3TO6A 1O3RA 3WQTA 4ID5A 2O3FA 3S14J 5CJ9A 2VG6A 1ZK8A 4YNQA 4DSEA 2NRXA 3K7AJ 5C2DA 4JKAA 3PO2J 1I3QJ 1KZHA 1PP7U 3CERA 1BL0A 3JXUA 4G9ZA 3SQ2A 2CQXA 4L0YB 2EFPA 4I98B 3HTSB 3B6AA 3MK6A 3H9QA 4B9VA 1FY7A 1HF0A 1YVNA 5AQXA 1XD7A 3T3FA 3THWB 2P6SA 4AVPA 2CQKA 3E97A 4KT6A 3HL8A 4EVIA 3P39A 4C8KA 1RZ4A 2CYYA 2XGXA 5K7HA 4ZDPA 2EPFA 5BPNA 1VQKN 1K83J 3BQYA 4A2BA 3CCVN 1L3TA 4Y7NJ 1FYLA 4XICA 1A5WA 3M9AA 3L3UA 3F9KA 2CUFA 2FF4A 4CCLA 3UKRB 1VZ0A 4UVAA 1LW2A 1QE1A 4PA1A 4DLGA 2FEZA 2L7MP 1G3TA 1I39A 4RGSA 4CEAA 3V81A 3PM1A 1OVQA 2OU2A 1C1CA 2FBHA 2FX0A 1WN7A 4F2RA 5JS1A 2F4IA 3TW6A 2DLLA 1Q9XA 1QPMA 4GV9A 2O5RA 3MN5A 4BR5A 2LKSA 3ABUA 2KFNA 2RNJA 1UHSA 3PNTA 2E1ZA 4Y1CA 2HVSA 1N36K 4KB1A 1APLC 2DBBA 2Z9OA 1R1TA 3GZNB 3WQUA 2QENA 4RAZA 5DMRA 3DLAA 2FSJA 3X2QH 3ZMVA 3F5TA 3QETA 4AM7A 2YJEA 2DPUA 1KSPA 3A02A 1L3LA 3WUHA 5GIPA 3K9TA 2QSHX 1G3SA 2QCOA 3TGNA 2VE8A 3J7AP 1ASUA 2WWYA 2XKOA 1NWKA 1GXPA 2JWLA 4CD3A 2FNPA 2QWNA 3UB5A 4BC3A 1JKOC 4QS9A 4PHTX 5C15A 1EKEA 4HYEA 4X62K 4Z4FA 4KH5A 2KIMA 4E7SA 2Z1IA 1ZLJA 4WF2A 4A57A 2O8BA 2VKVA 4QIWN 3LAMA 2JZYA 2F48A 3THXA 2AO9A 2K5CA 3GWZA 3ZN1A 2F96A 3M8QA 4O0JA 5EX5A 5KGXA 4U88A 3K59A 4X0GA 3ZQHA 1EV7A 4G8XA 2GEMA 4KFCA 2HNHA 4A3LJ 1T8EA 1FP2A 4RBOA 1QSLA 2HOAA 1RFQA 5HOOA 3ZSRA 2VKEA 2W6LA 1BM9A 3TBIA 4JAXA 3KK2A 3N4PA 4MQVA 4J01A 5JVTA 2L4AA 1JTXA 4M9XA 4IKFA 3J7AY 3HRGA 4C1NI 4EP5A 1VSMA 3CCQN 1P92A 1VSIA 3BGRA 4XKCA 3WXLA 1QQNA 3FMSA 1W5TA 3Q0VA 1H8AC 3A1YA 4FE4A 3CO6C 2CV0A 2P9LB 4BWJA 4CJKA 4F8RA 2HR3A 2FF6A 1YQAA 5FPDA 3BG9A 1VNDA 3ZX2A 2YU9J 4PY5A 1TBXA 1EO1A 4KN7X 3AL0C 3Q0WA 5HBMA 3RIRA 3DLEA 3MAQA 2W00A 4IHTA 1MZBA 2V6CA 2V1XA 2DMTA 4GNIA 4X6AJ 4FXDA 5JICA 3RZDJ 3JAMZ 3SFZA 3ZQLA 1BDGA 3T19A 2BH1A 1ACIA 4FJHA 2P5KA 2B9SA 3CPEA 3C2BA 1ZBUA 2DK8A 4C30A 1B4AA 4FWMA 4M42A 5L3GA 2X51A 1LWCA 3IUCA 3VENA 1IG8A 2LC2A 2GX9A 3V7SA 1IRZA 1V55H 3M8JA 2W6KA 2CMPA 1TWAJ 4CJFA 1SZ2A 3A0BC 4N4NB 4B9SA 4NC7A 4DF8A 2K3FA 4CZEA 2WV0A 5FD5A 5J4VA 1TV6A 4A6DA 5BREA 1RESA 4KREA 3RMAA 2PFBA 3V9ZA 2HYGD 3IRXA 1BW6A 2M8EA 3QEIA 1Y6IA 2DXIA 1R0AA 2W42A 5JLXA 1RR7A 2DDBA 4JP0A 4UHTA 1SD6A 3HOSA 1D5VA 3E9LA 4JI7K 3W6KB 1MJ9A 2WY8Q 3RZOJ 3N05A 2VUMJ 4FLTA 5K5RA 3VTIA 4DV6K 1ENHA 5FKOA 3MEGA 5LHIA 4QTRA 4YRVA 4BY7J 3DYAA 3A5OC 2V51B 3AVKA 3ZSXA 3ZQQA 1S7AA 2CUJA 2DOAA 2VXZA 2VWBA 4A2UA 4AYBA 3TEDA 2UXNA 4I76A 4HPQA 1USTA 1SAXA 2E2HJ 1YJ9N 2E71A 1XSVA 2KT0A 4FX0A 1E3OC 1DLOA 2WC9A 1WFXA 3ULDA 2XY6A 4LH4A 4FPBA 1IZ1A 2EFNA 1D5YA 1VQ8N 4N41A 4JX6A 4IG0A 2Z33A 1I6HJ 1FWZA 4PJNA 4RCHA 3MXMA 3HBLA 4FWQA 3ML6A 2GIZA 3C6HA 1BJAA 3M6GA 4CGGA 2A05A 3B6CA 4M3EA 2VWKA 2L01A 3NWSA 3VYSB 2E2IJ 3A5MC 4LSNA 4O55A 3VEXA 3NHGA 1BCMA 3DBHB 2A6TA 5HNHA 1H89C 1RR8C 5E1XA 1ZC6A 2YCHA 2ZXIA 4DQ2A 5GIOA 3C2HA 1YI2N 2MLGA 1A5VA 2FUG2 4RTFD 1XC9A 5F6FA 1QZYA 3PO5A 4BDPA 2ZO4A 4GYIA 5KPZA 4YOVA 3AAPA 1ETVA 3JTHA 4G6TB 2O03A 5BMZA 1NLVA 1Z67A 4AUXA 3EYYA 1IV8A 2R7FA 1P6RA 2RC4A 3JYTA 1J59A 1S5LC 1RT6A 2X9DA 5BPIA 2CW8A 4M3DA 2R4GA 3VSLA 4YFUA 3TP3A 1GV2A 3CIPA 5IYBJ 3FE1A 3LSHA 3WNHA 2XKPA 1SKRA 3W2VA 2F9WA 2M34A 1TWHJ 1KU3A 1QQIA 1S8NA 2ZJ2A 4D9JA 1GOAA 4JKFA 2ME6A 1EJ9A 5KGWA 3F3XA 4Y4RA 1CQTA 2JWKA 4BREA 4DQRA 4OPJA 2MYSA 2E1CA 4PKGA 3TABA 4ELTA 3VEVA 3HSCA 4E7JA 1JLCA 4Y13A 2ZFUA 5IYCJ 3WEEB 4K41A 3BEXA 1XQSC 3CCSN 3CCUN 1BO5O 3WEEA 4NYFA 1KU7A 4Z4IA 1KQ0A 5IT9Z 4CJVA 3DLLL 5CYQA 1X4OA 1I5ZA 3IH3A 1BI1A 4L5JA 1GDTA 1Q1HA 5EZGA 1JT0A 1NK2P 3GW2A 2YU3A 4CZLA 1T38A 4DS4A 1IN8A 2ESHA 1HW1A 5C0YA 1ZR4A 1WAJA 3OR1C 3OOPA 1K6OA 3CC4I 3O5BA 3VOEA 2VKHA 1JLFA 3P9CA 4P9UA 4IXCA 3NH1A 4GCVA 3F0CA 1YJNI 1NGGA 4AHVA 3DTEA 3FZMA 2IS3A 1VQKI 4FJKA 4M71A 1FJGK 1BR4A 5B5EC 3AVHA 4P1WA 4IOAL 5E3OA 1JLBA 3H1QA 1DGRM 2XY8A 1JL1A 4RM3A 5JLWA 1BCOA 3QINA 1S9EA 2UXXA 2LRDA 1R58A 4FWLA 2L9NA 4LLLA 2HI3A 1TL1A 3HRMA 2V79A 1HR0K 2IVNA 4IFYA 5KRTA 3K9JA 4B3AA 3H0GJ 1TL3A 3GFJA 2F5EA 4HTUA 4I99C 3JRDA 1U3EM 1P4XA 5EF6A 1DEJA 4ZYGA 1SD7A 1X3NA 4LMYA 1PUFB 2YKNA 3VQAA 5AQUA 5J2NA 3E9PA 3QERA 1WZ2A 4C9YA 1YIJI 3I33A 2OTLN 3F8FA 2KFZA 2UXBK 4W97A 2IP2A 2G8HA 1SAUA 2XGDA 4LIUA 3K1NA 2O0YA 2P9PB 4XLAA 1Y1VJ 1IXCA 3M8PA 1JKPC 1D1BA 1YVUA 2HSTA 4B9MA 4PWDA 2A42A 3FXKA 3O9SA 4ENMA 4W5TA 3K0SA 3GYHX 5B1AH 1B8IA 3KP4A 3M8EA 2XAGA 2OZMA 4DV7K 2HVQA 3HC7A 1QZ6A 4IJNA 2BBYA 2P7VB 3EDPA 4AHUA 3DFGA 4QCLA 4C1NK 2Y1JA 2DO7A 3SEZA 1AA7A 4P9FA 1KD1O 1UMQA 1ULYA 2IBDA 1VF9A 4CBUA 4JLHA 1BR2A 4DTUA 1NGHA 1ZG3A 5IY5H 1SQKA 2G8IA 1TQIA 2X85A 3I0RA 3DQVC 1KVBA 3WG7H 1XDUA 4ESFA 4ISFA 3OL3A 3I3LA 3K10A 3CQXA 3F72A 3IHUA 4I7HA 3O4QA 4NLCA 2RQPA 5AQFA 4DFPA 3CMAI 4XLPF 5KNLA 1NGIA 3IWZA 5GPCA 1JLGA 5AIQA 1UAAA 2DPNA 2MABA 5C44J 2ASMA 2M9HA 1FSEA 1XMXA 1YW8A 1ZBHA 3AKZA 4WFAL 2X6WA 3DLRA 3GTKJ 3K58A 2L7KA 2K9NA 5GADJ 4O44A 3KLGA 4ZC3A 1ZBSA 3BJOA 2IGOA 1IAWA 4FWOA 3ZLJA 3P5JA 5D5XB 4BDYA 3HOVJ 3O4WA 3HXLA 4XBFA 2V9VA 1ORKA 3BG7A 5FB2A 3H9JA 3RKQA 3UKGA 3CJ7A 4PL8A 2EIKH 1X1PA 4IX7A 1HKGA 3NAUA 3DKYA 4IPAA 4ESBA 2CV2A 1NGFA 1RDUA 3AARA 3ZMDA 1D1AA 2PFUA 1VQ9I 1TKTA 5AQQA 3GZ5A 2W48A 2DQLA 1FC3A 1T95A 4CZZA 4OGCA 1U4BA 1ON1A 2ZFWA 1VQ7N 4AWXB 5LEJA 2E5NA 2B63J 1J53A 1N33K 2BY1A 5D4SA 2JQ7A 2K9QA 3BJAA 3K4NA 5HLGA 1HJOA 5KVRA 5AQMA 2UUCK 3S3NA 1HOMA 3SQ1A 2QQ9A 3OS0A 1HNWK 3NGYA 3CDLA 3G1LA 4IEJA 4EM1A 1BI4A 4ICLA 3SPZA 1MBJA 1MNEA 4EQQA 1J2XA 3EYIA 3TDUC 4CSWA 4YFXF 4KHSA 3KLNA 2LKPA 2RGVA 3MEXA 1NH3A 3QU6A 4JI1K 2KISA 3QQAA 5L3EA 3KEOA 2CH6A 4FZZA 1PDNC 1QGPA 3BR2A 2XB0X 1BW5A 4KTZA 4AF1A 2KIFA 3CDIA 2ZMEA 5CLSA 1BC7C 1TKXA 1VQ6I 1FBUA 4OKKA 5GAGP 4YHHK 4HUFA 1PP8F 2LVSA 4DSJA 3D45A 1B9NA 3MEDA 5ILVA 3ESWB 2X74A 1NKEA 4UVCA 1S9GA 3FF5A 4HLXA 4PGGA 5K5QA 4HX8A 3IDHA 2XAJA 2P6TA 3HOWJ 2UYTA 4YFKF 3EETA 3ULEB 4LFUA 3T8RA 2ZMEB 3N4MA 5LGTA 4B44A 2P9KB 1A6QA 2LKXA 1DQUA 3BG3A 1BIUA 2M7BA 3BCAA 2W1OA 3G2BA 5DM6F 1MWKA 1Y0NA 2HNZA 5IOYA 2D2WA 4BE1A 4B09A 4OJRA 2CH5A 2L9RA 5DK5A 4WX9A 1IV6A 4CHYA 1YJWN 4HUGA 2VXDA 2KFDA 4PFPA 1I3AA 2BW3B 2LF8A 4ENKA 1ZG5A 3GE1A 3KD5E 3KLFA 2HQ5A 5KQ8A 3E5XA 3ZEUB 1BI4B 1RKTA 5I42A 2QVOA 1AKHB 1VSLA 2EWSA 4M6VA 5F1JA 1Y39A 3BF1A 5M5YJ 1F5TA 3VQ6A 2XDVA 5D4RA 4XN3A 3DLLF 4GMJB 2QSGX 4LF7K 1USSA 4EAHD 5B3SH 3TAMA 4KHWA 1U6GA 4MLHA 2MC4A 2WADA 4KHPK 2GAUA 4BRMA 4AYBN 1UZCA 3I4NJ 2E6MA 1S72N 4FASD 3AG1H 3SQ4A 5CVJA 4L5EA 2R7RA 4UXNA 3R9PA 2XF6A 3GVAA 1IO2A 2CV1A 3DMJA 3OYDA 1Z7UA 3LAPA 4JKHA 4DCHA 3V1RA 1JKQC 3K4MA 1YJNN 3MFKA 3HYIA 2KDZA 5CR4A 4BC2A 4HVJA 1N25A 2R3SA 4CCJA 4IZZA 2CW0F 1ASWA 1QZEA 1WNSA 2KTQA 2RKHA 4GYGA 3PQJA 1TKZA 5J8CA
chains in the Genus database with same CATH topology
3RMBA 3NAEA 3O4NA 3L3VA 4G1QA 4I7FA 3TAEA 4FK0A 4CE9A 2FBXA 1WSFA 4GW6A 4Y1DA 1SL2A 4DWIA 3ITHA 2JLEA 3HJFA 1ZYQA 4F4KA 3DRPA 1D9FA 4B9TA 1SUQA 4CGDA 2KZMA 4DSFA 3L2VA 2OPPA 5K14A 1D5AA 4EZ6A 2HVHA 3C95A 4FLYA 2ZE2A 4LH5A 2OA8A 4FJJA 2IDOA 4CJWA 4EP4A 2F8TA 3OS2A 5D3GA 2YNGA 4K8ZA 4DTJA 1VRTA 3KK1A 3L2QA 1JXEA 3B6OA 3VQDA 2D0CA 3CFOA 4KKOA 4H4OA</