1I39A

Rnase hii from archaeoglobus fulgidus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i39A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i39A01
3NH0A 1JL1A 4CK2A 1MU2A 4G1QA 3ZSWA 1TKDA 4E7KA 4DU1A 4F4KA 4CHPA 4Z4IA 1J9AA 4FLVA 2AJQA 3ZSXA 4OGCA 3SI6A 2Q3SA 4B9LA 4AH9A 3CM5A 3T1AA 1ASVA 3DM2A 1CZBA 1JLGA 1RT1A 5HBMA 1SKWA 4F2SA 4Y1DA 3DLRA 4DLEA 1NJWA 1SUQA 1WSFA 4E7HA 4DFKA 3P5JA 1HQUA 1S1VA 5EU7A 4O5BA 5KGWA 4RW7A 4OVLA 4CFAA 3OYDA 1J54A 1TVRA 4DG1A 4CESA 4BDPA 3V1QA 1G15A 2XRIA 3LAMA 3NF7A 3HXMA 3NCIA 1QSLA 4N56A 1J5OA 2HHWA 4CJWA 1IO2A 3ISNC 1NOYA 4CK1A 1WSJA 2D0BA 3SV4A 4YNQA 1TL1A 3VQDA 4CEEA 1REVA 3AVCA 1Z25A 1D9DA 4QAGA 2G8HA 4FLYA 4ZHRA 3PX4A 5HLFA 4F3TA 1EKEA 1EETA 3AVFA 3I0SA 4DTJA 3RR8A 4KKOA 4M42A 4DQIA 4M3ZA 2VWKA 3ZCMA 1D9FA 2G8UA 2QK9A 3C94A 1X9MA 2HHSA 2QXFA 3KJVA 1HPZA 4DWIA 4L8RB 2ZE2A 4FYDA 1C0UA 3ZSZA 3KLEA 4CEOA 4Z4HA 3B6PA 4BE2A 4IG0A 3MXMA 3K5MA 4KREA 2DFEA 5JS1A 2LSNA 2PZSA 4CF0A 1S5JA 1RTDA 1L3VA 1A5XA 3BGRA 4FJ7A 4N76A 3OYFA 4OPJA 4EZ6A 4NCAA 2OPRA 2KFNA 2HHXA 4KI4A 5KGXA 3NF6A 2G8FA 3DOKA 1BCOA 3OYGA 4KRFA 3HO1A 1TKTA 2KQ2A 2PYJA 4OKKA 2E6MA 1S1WA 4AHVA 4B08A 3E01A 3AVAA 4C8NA 3V9ZA 3QNOA 1BI4B 1S9GA 3TARA 1KFDA 3DLBA 4O55A 4LY7A 5C25A 3SPZA 1NK8A 3QEPA 4B9VA 1GOAA 2X74A 3OYMA 1C0TA 3TAFA 4AILC 2KZZA 3U6FA 2X78A 4CJFA 4E7LA 3SCXA 4FJJA 1C1CA 1VRTA 1R0AA 1J53A 3HPHA 3I8DA 4IFYA 1BGXT 3AVJA 1NJZA 4ID1A 3CFOA 2HMIA 1IKWA 3NGYA 3VQEA 1HYSA 1TAUA 2VG7A 4FLWA 4KV8A 2Z1IA 2VG6A 4RW9A 4AHRA 4K8ZA 3WNHA 4CJLA 4CJSA 3PX0A 1WSIA 2DFHA 4IDKA 4KTZA 3V1OA 3MEEA 3MEDA 3NGZA 1QTMA 2EX3A 2YNGA 4E19A 4ELTA 3KK2A 3VQ5A 3ZT4A 4JS4A 4RW4A 3QEIA 5CYMA 1UAXA 1S1XA 4CJQA 2KFZA 3TABA 2NUBA 4RG8A 3OJUA 2XY8A 3AA2A 4JLHA 2GBZA 3KD1E 4CEDA 3AO5A 3KLIA 2IOCA 3TAMA 4CIEA 3O3HA 2XY7A 4CECA 3K59A 4C8MA 4FLZA 4LSNA 2YNHA 4E89A 1VSEA 3OYEA 3NGIA 4DSEA 4FJGA 4E3SA 5HP1A 1VSIA 3QEWA 3DLKA 1NK5A 4KHSA 1NK4A 1QQCA 3SJJA 4OGEA 4TSXA 1S1UA 3T3FA 1NK7A 4HUEA 4IKFA 2HNDA 2YKMA 3I0RA 1U04A 4CGGA 4BDZA 3VA3A 3TAQA 4PUOA 1CXUA 3AO2A 3SUNA 4FZYA 4JRQA 4I2PA 4I7FA 3IG1A 5JS2A 3VQAA 2WOMA 1UOCA 3ZSYA 3K58A 1XI1A 1FK9A 2RF2A 4KFBA 3OS2A 1T8EA 5HRPA 1D8YA 4B9NA 4CEFA 4DFPA 4FJXA 1F21A 4KHUA 3VQQA 2PYLA 2D0CA 1LWCA 4PWDA 1L3UA 1RT6A 2IAJA 1T05A 3AO1A 4DFMA 1NK6A 3IS9A 3P83D 2P5GA 3HL8A 1YTUA 4LD0A 3LALA 2E4LA 2Y1IA 1NKEA 4IFVA 4N47A 2HHUA 1JKHA 3IRXA 3O4NA 4C8OA 3KD5E 3VQ8A 4B9MA 4FJIA 3AVGA 2F8TA 4HTUA 4O44A 3NBPA 3OYCA 3SQ4A 3AA3A 3THVA 4C8KA 1BCMA 4IG3A 4CGIA 1JXBA 4GW6A 5FRMA 1NKBA 1RBRA 3ALYA 3D45A 2HNZA 4CGFA 3OJSA 1A5WA 4RW6A 3LZJA 3V81A 1WAJA 3ZT3A 1JXEA 1GOCA 3ZSVA 1QSSA 5SZTA 1TAQA 2DFFA 2W42A 3H08A 1EP4A 4KAZA 1TV6A 1Q9XA 4CHYA 3F9KA 3QERA 4FJKA 3NH1A 1JLCA 3TAPA 3DLGA 4PY5A 1KTQA 3S9HA 4CEZA 1LV5A 1SL2A 5SWMA 5J2MA 5HROA 4OKEA 1VSKA 4RW8A 5T7BA 2G8IA 1RBSA 2Z1HA 1C0MA 1A5VA 1HRHA 3VQPA 3HP6A 1ZBLA 4QOZB 1ZBIA 4M3YA 4FZXC 1WLJA 1WSHA 4W5RA 3NAEA 3OYHA 3NF9A 1ASWA 4MFBA 1XHXA 3QETA 5CYQA 1WNSA 4CFCA 4CJVA 3NE6A 1L3SA 3V4IA 3HYFA 3LPTA 1VK0A 1LAWA 3SNNA 1W9HA 4ID5A 1NJYA 4PQUA 2FBYA 1O1WA 1ZBFA 3ULDA 4XIUA 3OS0A 1SL1A 4FVMA 4CJRA 1KLMA 2YHBA 5CY4A 4KTQA 1WAFA 3DOLA 3HPOA 3U3GA 2A1RA 2OYQA 3AVMA 4N41A 4W5NA 4HVJA 3DLHA 3LP0A 2HHVA 4O4GA 3D0PA 2HHQA 1JLBA 1HYZA 1S6PA 2KW4A 4DS4A 1TK5A 1ZYQA 4AHCA 4CFBA 1RNHA 3AVIA 2D0AA 2FBTA 4CJPA 4OJRA 3O4QA 3L2UA 4DF4A 2F8SA 3V9XA 4J2BA 3AO4A 3F73A 1C1AA 4OLBA 5D3GA 1RBUA 4AHUA 3AV9A 5J2PA 3FFIA 2OA8A 3KLFA 3PX6A 4E0DA 1Q9YA 4CJKA 3V9WA 2O4GA 4B8AB 1EX4A 4KHYA 1KVCA 1QE1A 1RDBA 3O3FA 1KRPA 4M3UA 1I3AA 3VQ4A 3NF8A 3C6UA 3M8QA 2P1JA 5KRSA 1B9DA 3QO9A 3KK3A 4FJLA 3NDKA 3PO4A 1RDCA 4F8RA 5CZ1A 1N5YA 3AA4A 2HVIA 3L2VA 1WSEA 1HYVA 3VQ6A 2FBVA 1RT4A 1QSYA 3ASMA 4F2RA 5HRSA 4FM2A 4CIGA 1VRUA 1HJRA 4CF1A 4CJUA 3EYZA 4EZ9A 1DLOA 4BWJA 3CQ8A 1ASUA 1ITGA 4CEBA 5KRTA 4KPYA 4Z4FA 3M8SA 1UA1A 4KHNA 3TWHA 1BISA 4B9UA 4DQPA 1IH7A 4ELUA 1HQEA 1YTAA 2HB5A 2VWJA 1KLNA 3HK2A 3U3YA 3MXIA 3JSMA 4DQQA 2IC3A 3RMBA 1BIUA 3TR8A 4DSJA 4DQSA 3AA5X 4HUFA 3L8BA 2X6SA 3DI6A 3OVNA 3CG7A 4DQRA 1LW0A 4CJ3A 2IDOA 4W5OA 4ICLA 1WSGA 4CFDA 4M3WA 4IBNA 1TK8A 3DYAA 1IKYA 3JYTA 3V6DA 1QS4A 4LH5A 4ZTJA 3ZT0A 4O0IA 2X6NA 1VSDA 3M8RA 3SUOA 4W5QA 1B92A 1C6VA 3M8PA 4B3OA 5J1EA 2B5JA 3CYMA 2OPSA 4M45A 1SKSA 2KZMA 1NKCA 1KCFA 1ZBUA 4HUGA 1U48A 3NFAA 4DF8A 3WNEA 4HCCA 1VSHA 3ZT1A 2HW3A 1RILA 3K5OA 2JLEA 4N5SA 2PY5A 1XHZA 4FJ9A 4DLGA 2ZQBA 1CZ9A 4M3XA 3QNNA 3RMCA 2ITGA 3CFPA 4W5TA 4BE1A 2G8VA 1XWLA 3L2WA 1T7PA 4Q0BA 1RTHA 1EXQA 3C95A 3LZIA 3KIOA 1I39A 4Z4CA 4M3TA 2ETJA 3K5NA 3DRRA 1BIZA 1LAVA 3RWUA 3V9SA 4CJ5A 3A2FA 4KO0A 1KFSA 3KK1A 3CM6A 4E1MA 3AVBA 1C1BA 2Z1GA 1RCHA 3VA0A 1DTQA 5HRNA 1S1TA 3G0ZA 4EP5A 4CCHA 3G10A 3SUPA 5DK5A 3S3NA 4DU4A 3WNFA 4DSIA 4DTNA 2HHTA 1TL3A 4E7JA 3RR7A 2XO7A 3HP9A 2Y1JA 3TANA 2VG5A 4CHQA 2P51A 2GV9A 4CK3A 3TAGA 1FKPA 5DMRA 5E41A 1NK9A 3EY1A 4M41A 2HVHA 4J2EA 1S6QA 3KKRA 4PA1A 1RTJA 5HRRA 3QEVA 3ITHA 3DLEA 4Z4EA 4KHQA 1LWFA 2BANA 3VQ9A 4KHWA 1GOBA 4KI6A 4YFUA 1SL0A 1BQMA 4NCBA 4Z4GA 4CF8A 3T19A 4CEAA 3HT3A 2KTQA 1VSFA 2E6LA 1X9WA 3OYBA 4J2AA 3RMDA 1JLAA 1TKZA 2B6AA 3NH2A 3SUQA 4M3RA 1RDAA 4FJ5A 1Z26A 1HNVA 1CLQA 4I9LA 1YT3A 1VSJA 4EP4A 4NYFA 4CGHA 3SQ0A 1LWEA 2JGUA 1L5UA 1LW2A 1JLEA 2OPQA 1FXXA 1RTIA 2A1SA 3K2PA 4GMJB 4NYNA 4Y1CA 2OZMA 1RT7A 4OPKA 4FZZA 4GVMA 3AO3A 2YNFA 4QCLA 3RTVA 3LANA 2DY4A 5I42A 4FJMA 2RPIA 4DSFA 3LAKA 1SKRA 3AVNA 3RMAA 2IGIA 1SV5A 2F96A 1Y97A 3DMJA 4ELVA 3MECA 3LPUA 1Q8IA 4B8CA 4FLUA 4DMNA 3HVTA 1IKXA 2XHBA 4CF2A 3BDPA 4H4OA 1BI4A 4BWMA 3VQCA 4BDYA 4ZTFA 1HNIA 3ZSRA 2GUIA 2OZSA 1NOZA 3WNGA 1KVBA 1U4BA 4JRPA 4Q5VA 1TGOA 4DTRA 1NJXA 1FKOA 1VSMA 1BHLA 1KSPA 2D5RA 3K5LA 3SV3A 4R5PA 3QESA 4DTOA 4CERA 4NCGA 3KKSA 2OPPA 4FLTA 1UA0A 3PO5A 4CHZA 3VN5A 4DTPA 3RRHA 3ZSOA 3VQBA 3VQ7A 4CEQA 1X1PA 3QINA 4KB1A 2P5OA 4CGJA 2QKBA 3PUFA 2G8KA 1XC9A 4FJHA 2EHGA 3NHGA 4DU3A 4CJEA 1BQNA 3CFRA 4FJNA 4DTSA 4Z0UA 4CJTA 3EZ5A 4DS5A 3QEXA 4FM1A 3PY8A 4CJ4A 4CHNA 4FJ8A 4OLAA 4O0JA 5KI6A 2ATQA 3OYAA 3O3GA 4OKJA 5FDLA 3OY9A 1ZBHA 5FROA 3OYKA 3OYJA 2ZD1A 1U49A 4WE1A 4HCBA 5FRNA 3MXJA 5J2QA 4FXDA 2WONA 4AHSA 2B4JA 4KTWA 3L2QA 4DFJA 1NK0A 1RBVA 4CGDA 1N6QA 4DTUA 1UWBA 1WN7A 2YV0X 3QLHA 3SPYA 1RT3A 3PV8A 4I9QA 1JLFA 1VSLA 4I2QA 2XY6A 4FK0A 4B9SA 1D5AA 2R7YA 1YVUA 3S3OA 4J2DA 1HMVA 1U47A 1L3TA 2O4IA 3DRSA 2RN2A 3ZSQA 3QIOA 1X9SA 2RKIA 2IS3A 3LWMA 3SZ2A 5CZ2A 4KB0A 4B9TA 3OYLA 2DTUA 1K6YA 1TK0A 4FW1A 3HPGA 3SYZA 2XY5A 3TAEA 4F3OA 1RT2A 3KLHA 3V9UA 3IAYA 3MAQA 4K8XA 3HVRA 1JL2A 2BE2A 4H8KA 4CIFA 1S9EA 4FCYA 3L2RA 4DSKA 1RBTA 3L3VA 3SQ1A 4AHTA 5J2NA 3S3MA 3AVLA 3P1GA 4CHOA 5C42A 3AVHA 1RT5A 1TKXA 1JLQA 1QHTA 3ZT2A 2YHAA 3TI0A 2FC0A 2G8WA 4DSLA 3HM9A 3B6OA 4E7IA 2QKKA 4MQ3A 3LP3A 1T03A 2BGGA 4UQGA 1IG9A 3AVKA 1RDDA 4CF9A 4FK4A 3LWLA 3MEGA 1KVAA 3OS1A 4DTMA 4E1NA 3V1RA 3LP2A 4LSLA 5C24A 2Z1JA 3LDSA 2BDPA 1IKVA 4BACA 3KTQA 4DTXA 1U45A 4FM0A 4JS5A 1W0HA 1DTTA 3QIPA 3LP1A 2YKNA 4FLXA 1CXQA 3RRGA 5KTQA 3HJFA 3SQ2A 3HSTB 3KLGA 3C6TA 4CE9A 3UIQA 1B9FA 3DRPA 3OYNA 4BE0A 4C8LA 4H4MA 3K57A 4HHTA 4FK2A 1BL3A 5K14A 3L3UA 3OYIA 4LH4A 2YNIA 2I5JA 2HNYA 5I3UA 4FW2A 2FBXA
chains in the Genus database with same CATH superfamily
3ZSWA 4A62A 2FU4A 2F5EA 1I27A 3VYSB 2A05A 3ZXSA 2LBFA 4DR2K 3CJ7A 4RAGA 2W40A 1NGIA 4M7XA 2W25A 1A04A 4HWIA 3VYRB 1MJAA 1X9MA 3HRTA 4QSHA 2UV1A 5KPRA 2R7ZJ 1K4TA 1L3VA 4N76A 2P81A 3LDNA 2IP2A 3HOZJ 1XSDA 4HSTA 1ZC6A 4IEIA 3IMXA 2YR2A 1MMAA 4ASNA 3U6FA 3NARA 2X78A 3HHGA 2P0WA 1S5LC 5E18F 2BY1A 3S41A 2P9IA 2MGQA 4MFDA 3KP7A 2VE9A 3VQ5A 1ETXA 2VC1A 2F4IA 2R7RA 2NUBA 4BG9A 1R23A 4MEYF 3TAMA 2F4VK 4K2EA 4NBQA 3DU5A 4E3SA 4OGEA 4CD3A 4Y3OA 2HDDA 3SUNA 2NS7A 1UG0A 4GCVA 2GA2A 4U0YA 2OZ6A 1F21A 2QM3A 3VQQA 5FPEA 1F5TA 2R5YB 1L3UA 2HYGD 3AO1A 1XTAA 3M8EA 3CD6I 4Z94A 3DTKA 4RLQA 2HHUA 3HOYJ 4B1YB 2F8TA 2ZMEC 5DM7L 2P4WA 1A5WA 2JK3A 2QEXI 4HF0A 1TV6A 1REPC 3SHFA 3VYUB 3QFUA 3VF6A 3NH1A 1HKBA 3TQNA 2RN7A 5C44J 1KU9A 1WSHA 4MFBA 1XHXA 2LMDA 3CMYA 5LD2C 1VK0A 2LBFB 1KQ8A 1W9HA 4YFKF 3DJCA 1K4SA 1WHUA 2GM4A 1ZYQA 2W85A 4BRNA 5LEKA 4CJPA 1WBDA 4OLBA 3UB5A 2XHKA 1KVCA 3FBNB 1DUXC 2F4MB 4JI6K 4ENMA 5ICGA 3L4IA 4UUVA 4F8RA 2ID6A 4HOBA 1T33A 1Z3XA 1NGFA 2HNHA 3I4NJ 5KRTA 1ENHA 1KQ0A 3CJ9A 1T56A 2ZXIA 2IC3A 3RMBA 1HKSA 4A5MA 2HFHA 5A2QO 1MZBA 2X48A 2P9IB 3FZMA 1J7KA 3V6DA 3VEXA 5TGTA 1VSDA 3WUHA 3CO6C 2BV6A 2EIKH 1XCVA 4HG2A 2M9HA 4IRIA 3QNNA 1HW1A 1JTXA 1YW8A 1TUUA 3P4IA 4ZYAA 3KVGA 2UXBK 3OOPA 3ZQCA 3DRRA 4KT5C 4H5TA 4XLAA 1Y8QB 3G10A 2QQ9A 2HHTA 1ORKA 4I2OA 2VG5A 4WF2A 4H5RA 2MBFA 2CFOA 4J2EA 4OU0A 3QQAA 1E3OC 5E20A 4BHCA 2MLGA 5AQSA 4LOCA 4M3RA 2LK2A 1VQ4I 3SQ0A 3CCEN 4CBXA 3WU1B 2OZMA 4OPKA 3H35A 4QCLA 2VL8A 5M1KA 5FKKA 3MFKA 1SV5A 3DMJA 1BOAA 1HX1A 1CGPA 3WXKA 4A6EA 1SAXA 1KVBA 2LY9A 4BROA 1ETQA 2RDPA 2D0PA 2DYSH 1P8ZA 4BG8A 3A5NC 3PUFA 1BW5A 4PSWA 2BY3A 3CJQB 3HB9A 4GY2B 3L2QA 1NK0A 4CGDA 1QQOA 2DOFA 3DKXA 1FSHA 2O4IA 4M3DA 4YY3K 2XSDC 3PL8A 4HPQA 4ISEA 2VJJA 4L3QA 4H8KA 3CCUI 3DBLB 4IEJA 3L2RA 1QHTA 1S29A 2DT7B 1UJ8A 3O8GA 3MEGA 2VQFK 1SS6A 1MBEA 2IGNA 5DM7F 2HWVA 4G7ZF 4JYAK 5JHUA 3CCQI 1HNWK 4HHTA 4FK2A 4YOUA 3E97A 4LH4A 2I5JA 5GIOA 3EEQA 4F4KA 4CHPA 1IUYA 2WAFA 2ZM6K 1BI0A 4AH9A 2F2EA 4XBFA 4GKJK 2CH5A 3G73A 3QFPA 4ZYEA 1WBBA 4BQQA 4UY8I 1EF4A 1DGKN 1YFHA 4XRFA 1J5OA 2DLLA 3ISNC 1E17A 1SVMA 4N9HA 2G8HA 1EETA 3RR8A 4M42A 2L7FP 4ZH4F 2WTEA 3A5OC 4FO0A 2QTDA 3SAFA 1XNRK 2HZDA 1N32K 1HCRA 3MXMA 1ZLKA 3K5MA 4M9ZA 1SFXA 4PJNA 1S5JA 1N77A 2WBNA 2HHXA 5EGOA 4UNOA 4DQ2A 5GADP 2OTLI 2OU2A 4X64K 3LFKA 3PQJA 5K7FA 1VQ7I 2WY8Q 4BC2A 1LEBA 3RSNA 3ZX2A 1FX7A 1XNQK 4JHDA 4FLWA 4RW9A 4U87A 3WNHA 2KKOA 2LP0A 3GTOJ 3PUBA 4I01A 4JS4A 3CCJI 4NB4A 3BG5A 2KRFA 3KD1E 2V1NA 3K59A 3MCPA 1OCPA 3IUCA 2DA1A 1S1UA 3E66A 3W3DA 3Q3SA 2KZGA 5BPLA 4PUOA 2KIMA 2VQCA 1QHHD 3G6EI 4DR5K 1N25A 2FMLA 3F0CA 2VQLA 2JVGA 3O9TA 4IQJA 2Y1IA 2VASA 1MSFC 5LL6Z 1JKHA 4I76A 3WEEA 5LHIA 4WCGA 3RPQA 1FIPA 4BNCA 1G3SA 1RBRA 1KAYA 4NHJA 2FBKA 5BRFA 4CHYA 4BAYA 2HPIA 1KTQA 1SAUA 5J2MA 5HROA 4A0XA 2Z1HA 3U2RA 1FTZA 1BI2A 3OYHA 1BI1A 3V4IA 4GFBA 2LTPA 1D3YA 3DBHB 1HC8A 4NB5A 1YQAA 3U3GA 3AVMA 1R1UA 4O4GA 3EL2A 5GAHJ 2ME6A 1OFCX 2O8KA 2ZB9A 1LB2A 1QZYA 2HHHK 3V9WA 1B6AA 2D45A 3DTEA 4FSVA 4B1RA 1B9DA 5C4JJ 3GL1A 5EGOB 1JTYA 4B9QA 2WAEA 5IY5H 2WV0A 3GMEA 4X66K 4M9XA 1PP8F 3SBTA 4KPYA 3GYHX 1Z67A 3DKYA 3M8SA 4TV7A 5FPNA 1HQEA 2VBXA 2QM1A 4IX7A 2HPMA 3HDDA 3TR8A 4P55A 4DQSA 2NVQJ 1Q86O 4JHDB 4RB0A 1WJEA 2IVNA 3G25A 1O7LA 1Q1VA 3GFLA 2X6NA 3M8RA 4W5QA 2DMUA 3TOAA 1R59O 1XMAA 2OPSA 1T8IA 1V4TA 1ZKGA 2GTDA 2HW3A 2ESHA 3JAMZ 2G8VA 2R7VA 2O6GE 4YIFA 4FWRA 3E6DA 4HNVA 4E1MA 4G8XA 5HRNA 4JKGA 4KN7X 1W5SA 4GO1A 2PFUA 3BY5A 4ENJA 4FPBA 2P51A 4PSXA 1NK9A 2DDBA 2HVHA 1E4GT 5FFZA 1KC8O 4Z4EA 3WEEB 4IOCL 4KHWA 3BR0A 6PAXA 2WADA 1BQMA 3SXYA 4HQEA 2KRCA 1TBXA 4YELA 4BL0B 3CLQA 2IVPA 2H1LA 3THWA 5A2QK 2M8GX 1TWAJ 1LWEA 3I64A 3I56N 2DK5A 2V1DA 2CQQA 4GVMA 1RESA 3BEXA 3TTFA 2MC4A 3ZQQA 1D8KA 2VKVA 2EH3A 5C3EJ 2Y0MA 4O5VA 1BA1A 1IG8A 1GLCG 1XCBA 4Q5SF 4IO8A 2HTSA 5CQEA 1S7OA 1TLHB 3O3GA 3LSTA 2LKSA 2JPCA 3CCSN 2ZGYA 4O3MA 4KTWA 1N6QA 1P4AA 1UWBA 5KPZA 3PLAA 1ZR2A 4EJOA 3VF2A 1IRXA 2PJPA 3LWMA 5B8HA 5CZ2A 2DTUA 3M1EA 1RT2A 3KLHA 3DEWA 3SFIA 2BE2A 4ON0A 3J80O 3C2HA 2DA7A 3WT0A 2XPWA 4FK4A 1M1EB 4C3IJ 1OKJA 1BJZA 5CYVA 4ISFA 4CE9A 2RGVA 3CZ6A 3BR5A 4A0YA 4DSJA 2CV2A 2QA4I 4DU1A 3VEYA 5AONA 3PFYA 3Q9SA 4ANJA 4Y1DA 4JKGB 1OH6A 3VB2A 1HSJA 3M3ZA 1W2BM 2XRIA 2HHWA 2IVOA 4MLHA 3H1VX 1HDPA 4PJLA 4M3ZA 2PMUA 1I94K 3THWB 5FLMJ 4B44A 5EF6A 4PJJA 3KLEA 3MAJA 3E6CC 5JS1A 4FJ7A 3CLOA 2D1HA 5E3LA 2WC2A 1L3LA 2R7SA 2UUZA 2QWRA 4LY7A 4BRKA 3H3UA 2ZJRL 2F5DA 2XRLA 3A2KA 4ID1A 3R60A 4CJLA 3U21A 2IRFG 5D5WB 1Y39A 2STTA 2XY8A 4MO5A 2DOAA 1HDDC 4PKHA 4WXCA 5JFRA 1LCUA 3SJJA 3CQYA 3BZ6A 3T69A 1V5EA 4JRQA 3ZSYA 1T8EA 1MKMA 3EPZA 5BMZA 2L4AA 5KHDA 1K79A 2D0CA 4HNTA 4PWDA 4UHTA 2XAQA 1T05A 2JUCA 3IS9A 4JI0K 2N8GA 4B1XB 1UAAA 4B9MA 3GO5A 4BJ5C 4IOCF 5LHHA 1NKBA 1NG7A 5KVRA 2VJ4A 4NC8A 1XUPO 2W6KA 3J7YP 4ENNA 1SL2A 1J6ZA 4KFCA 1C0MA 1HRHA 3WGIA 2F5FA 4W5RA 2GEMA 2FD5A 3ULDA 3I55I 4AYBN 1SL1A 2XAJA 2VODA 3HPOA 1FP1D 4N41A 1WWXA 3LSGA 5TISC 2I8DA 2K3FA 2YX6A 1ZARA 5D3GA 1MDUB 1VQ6N 1D1CA 5FFXA 4XH5A 3LSHA 1HNZK 1HKCA 4MLEA 2P1JA 3K1MA 2X6XA 4DJAA 1IJWC 3CJRB 3NDKA 2NXNB 3KLOA 2IVMA 1WSEA 3JRHA 2K4JA 3H9JA 3ASMA 4EZ9A 3OSGA 3J8AA 3U3YA 3IV5A 4DQQA 1QZ5A 3LDPA 4ILGB 1S3XA 3GTJJ 1IKYA 1D5VA 3F9MA 3LQRA 2O61A 3HSCA 1HXDA 2LF8A 5JI6A 4PHTX 2DPUA 2K3PA 4HCCA 3IKTA 3LA2A 4FJ9A 4DLGA 2P9SA 5CJ9A 1J2XA 5B3SH 3KIOA 3IL2A 1B9MA 1R7JA 1LAVA 1GLNA 2JUGA 1TZLA 5L3GA 3CCVI 2DCEA 3SUPA 1TL3A 4C1NI 3OIOA 5HRRA 3QEVA 2LVSA 1LWFA 1K78A 4CEAA 3MMVA 4WYBA 1JLAA 3DWLE 1ZQ3P 2NRVA 2MH9A 1P4XA 1UZCA 2X4HA 1MBKA 4BQLA 4GMJB 5ICCA 3DPLC 1OQYA 1YXQA 4FJMA 1HJOA 3CJCA 5BOXA 3CP2A 4BDYA 3VETA 3ZMSA 3SDGA 2PMZA 1FKOA 4AYBA 3SV3A 1MBFA 4FLTA 2AO9A 2QKBA 3PIPL 3J7ZI 4DS5A 3O08A 1U5TA 3K4BA 1D8JA 3FIWA 3OY9A 1U49A 2XPVA 4DW6A 3QLHA 1RT3A 3K10A 3BOQA 1JLFA 2V9KA 2E19A 3CP8A 1D0ZA 4XSZF 4PCQA 3S3OA 1U47A 3TW7A 1LQ1A 4KMUX 1YIJI 3L3VA 3P1GA 1FP2A 3N4QA 3LP3A 1ETOA 2QLZA 2A5WA 5EY4A 3KWIA 3BT9A 1HKQA 4BQZA 3QYEA 2Q2RA 1LE8A 1SMYF 4A0ZA 3KLGA 3VGMA 2P9SB 1AKHA 1HKGA 5BN9A 5M3MJ 4RS8A 2DA5A 1S22A 4E7KA 3RKWA 3ZSXA 4B3SK 4CCJA 2VGNA 4G6DA 4IF4A 2EFQA 1T6CA 1R22A 2XGXA 1NM1A 4OIQF 3IH2A 3CMAI 4B8XA 5EX5A 4F9OA 3TBIA 3DLAA 2L0KA 1WSJA 1F9NA 4CZLA 1K78B 3I0SA 4F91B 3J80K 2CRGA 4ITVA 1J09A 1C0UA 5FKMA 3R0JA 2HOTA 3O1BA 2DFEA 2ZSHB 2WB1N 2COMA 3BGRA 1J0RA 2OPRA 4N4NB 2XUBA 1S1WA 4AHVA 4C8NA 3V9ZA 4B3MK 3C65A 3HPHA 1RUNA 1XMOK 1G3YA 2E2PA 3Q0VA 5EG0A 1WSIA 1MNMC 2ADUA 1U5TB 1YITI 3MWTA 4RW4A 3QEIA 1DGWY 3CUQC 1VQ5I 4CEDA 5JMVA 1JJ2M 5HDKA 4AD9A 3DLKA 3GTMJ 3FWEA 1NK7A 4D7MA 4IKFA 4C2MJ 4HF2A 4FZYA 1NWKA 3EN9A 5HRPA 2HVRA 4LK0F 3EO3A 4XKVA 4ABZA 3RJPA 1HBXG 1LWCA 3PNVA 4BHBA 1D5YA 1EH7A 3AFHA 4II3A 3AKZA 5JLWA 5D5VB 4PUSA 3NEUA 3KYCB 1LE8B 4RW6A 1JUSA 2X6OA 3IAM2 5BR9A 1AKHB 3F9KA 3CPEA 2P9KA 2CGLA 4RW8A 1TW3A 4BXXJ 4QOZB 4RAYA 4JKDA 1WLJA 1MBHA 4LLGF 3MX5A 3QETA 4ID5A 3KFWX 4IRGA 3EE8A 1IGNA 3E1YA 1DP3A 3KZZA 4L9NA 4DS4A 3VTIA 3JS6A 4CJ7A 3F73A 1SFKA 5AQUA 4G12A 4RA2A 3PIPF 3KLFA 3FZKA 4CJKA 2HBLA 4DBQA 1JKQC 2WB1A 3L2VA 5AZIA 3TTDA 5C12A 4CICA 1ASUA 3SAGA 1BISA 4DQPA 3GEZA 3I54A 1EO1A 3RZDJ 2XGEA 3KPHA 3AA5X 2FLOA 2G7UA 4UVAA 3CCLN 2JMWA 2FJ1A 5EG0B 2CWEA 4O0IA 1SANA 3HGYA 2AXLA 1W7AA 3CYMA 3RIRA 4Q47A 4M6XA 1WJCA 3K5OA 1CZ9A 3RMCA 1LFBA 1T7PA 2E35A 2F5CA 2MD5A 4M3TA 3FXUA 4EAHD 4FASD 3SJHA 2UXDK 5EEAA 3G0ZA 2X0LA 4DU4A 2BBYA 4FX4A 2EBIA 3ASNH 3RR7A 5AQOA 4CK3A 2G0EA 3EY1A 4M41A 3TL4X 3G71N 2R7TA 1KONA 1ATNA 4XKCA 2O8CA 3I0TA 3GCMA 4XLPF 1TKZA 2CS3A 1CF7A 3JAMO 5AIPA 2KMUA 1LW2A 2L9NA 2OPQA 3V8JA 4NXNK 1TQIA 2O5RA 3R3LA 2P9KB 4NYNA 1KD1O 3VODA 1MIJA 1MGTA 2Y9YA 4OMYA 2V51B 2F96A 1Y97A 1S9HA 1QPMA 3CC4N 4CF2A 3LSMA 5KCMA 5H6RA 4OO1J 2P9PA 3ZETA 3LA7A 3BROA 2EZKA 2EZHA 5M5WJ 2JVHA 1X1PA 2L9VA 3NAUA 3K0LA 3B8AX 3FXOA 2ATQA 2HF4A 4WQ5C 2XKPA 2QEXN 4F3QA 1WN7A 1X4OA 2L02A 4BRQA 4LFBK 1BU6O 3EQLF 1ON2A 4KJZA 1YVUA 5JLHA 3HM8A 5AZIB 4ZYDA 3U4LA 4AUXA 1W0TA 4DR7K 3SZ2A 4RCHA 3CCEI 1JLQA 1OYWA 3T0YA 1T03A 2CG4A 1HR0K 3IHUA 2A68F 1FBQA 2RNGA 2ZJPL 3WTYC 2COBA 1XGMA 5C24A 4DHYA 1W0HA 2L54A 4JI3K 1TWCJ 3C6TA 3K57A 2FBXA 4Q4ZF 4HA8A 4CK2A 4G1QA 1BJAA 3SI6A 1WQ2A 3WE3A 4OWRB 2JTVA 1B72A 3C2GA 3DM2A 1JLGA 5J8CA 2DYRH 1JUPA 5EU7A 5AQXA 1X3ZB 2WY7Q 4DG1A 4JQFA 2VKEA 4HLXA 3NF7A 4J19A 4CK1A 2O8CB 2PBIA 3HOSA 4XRSA 2YJEA 2VB6A 3F8NA 1CF7B 3SZTA 2CGPA 3JRDA 1BA0A 5HS8A 4L5JA 1GV5A 4EGZA 4KRFA 2E6MA 1OVQA 2Y75A 2P9PB 3ZETB 5AQYA 2KDOA 2W84A 3OYMA 3O1WA 2PEXA 1OCZH 1HYSA 2HMIA 1JGSA 5ILSA 2OQRA 1W97L 3D2EA 2BVMA 2EPFA 3F8CA 5TKWA 2A6HF 1LFPA 3V42A 3WTVC 5CYMA 4XNFA 2L7KA 3EETA 1WCMJ 1VF9A 3O3HA 4K25A 4CZMA 3CCYA 3QEWA 2ME0A 3K9JA 1T6DA 1H88C 1SKWA 4I7FA 3FXMA 4HX7A 2VOPA 4KHUA 4BRIA 3CDIA 2P5GA 2HBKA 2ZCWA 1DKGD 1RZ4A 5EJCA 4CCOA 1BCMA 3ALYA 4CGFA 2HNZA 1RR8C 3MN7A 5DD8A 4XM3A 1H8AC 1QSSA 5SZTA 4DR3K 4YHHK 3E6BA 1ZG5A 4CEZA 1A5VA 1GLAG 3E6MA 3NAEA 1B72B 5CYQA 3NE6A 2VXDA 4RDUA 1IN4A 3WHBA 4KA4A 3CCUN 3EUHA 3FK6A 3IH3A 4CA0A 3L7WA 2QVOA 1E3PA 1A36A 4YOTA 5KQDA 3AARA 4RGXA 1S72I 2RE2A 4OJRA 5GIPA 2A5YB 3PX6A 3QMLA 5HLIA 1KQ9A 4KHYA 3CDLA 4CCMA 1G3WA 2R5ZA 2LRDA 3CCQN 1XGNA 2NRHA 3OTOK 2QWOA 5IP7J 4C30A 1JJ6C 2VIXA 1ZTRA 3H1CA 1D0XA 4CEBA 3FLCO 1G99A 3O5BA 3JSOA 1BR2A 2O8XA 1G8XA 2R4GA 2X6SA 3OVNA 5J4VA 3D2EB 4BR5A 4CJ3A 3A4CA 4LFCK 2A42A 3JYTA 5K5OA 3BPVA 5LMNK 5LHGA 2ZJPF 1LJ9A 5GAEJ 1D1AA 3H5AA 2XPUA 3BDDA 1XQSC 3ZMUA 3NFAA 4Y15A 4FWLA 1LPQA 5H2FC 4LLNA 4IHYA 2J4RA 4Z4CA 3DTIA 2NRWA 3VFZA 1LFUP 4MNUA 1C1BA 3HBTA 4GYGA 1S1TA 1T0FC 4MIMA 4DSIA 4UUSA 4E7JA 2ELKA 2K4BA 1JXSA 3TAGA 4FISA 2ESNA 2X6YA 3A5LC 2CH6A 1R4NB 3IRQA 4Z4GA 2CGKA 3K9TA 1VSFA 1X9WA 3CCJN 2VE8A 2M4KA 2VJ5A 4U7BA 3L9FA 2R7UA 5FJ8J 4JAXA 1OYIA 4A2UA 4CYDA 3BZCA 3HVTA 1IKXA 5ELZA 1LDJA 2WFBA 3MWMA 2V79A 3ZSRA 4FT8A 1FSEA 1RFQA 4BC4A 1X3WB 1KA8A 1NGAA 4DTPA 1GLDG 5TKYA 4CEQA 3QINA 4KB1A 4S05A 2VWBA 3FXRA 2IA0A 1QVUA 1QQMA 4Z0UA 3BG9A 3OIPA 3FX3A 4FE7A 2FMYA 3OYJA 1ZR4A 2R5ZB 2B4JA 1G2HA 2D2WA 1ZREA 2VYPA 4A3DJ 2MSYA 2QWQA 3DRSA 4E1JA 2W00A 3ZSQA 3JAMK 4B9TA 1I1SA 1F4KA 2EV6A 4DR1K 5CVJA 4DSKA 2ZKZA 1Z3YA 1YW9A 1Q1HA 3M5RA 4YOYA 1UFMA 1TC3C 4DTMA 1IBMK 1XC5A 4HQMA 4R79A 4KYWA 1PYVA 4X1EA 3CJ1A 3IRRA 2DJNA 2UZKA 1VTNC 5F04A 3CJAA 3ZR8X 2A3ZA 4FW2A 3QNOA 1JL1A 3GFJA 1J5EK 3H92A 2KKZA 2OF7A 2LSOA 5EZHA 4QS9A 3TO6A 2HKOA 4J8FA 3TO7A 4UUSB 1SVLA 3I71A 2KQRA 2FXUA 3LM2A 4KNYA 2IW5A 3DV8A 1ZBSA 4OIRF 2FNPA 4ZHRA 2F48A 1D9FA 3HSEA 2QXFA 3KJVA 2M7BA 5IYDJ 4DR4K 3E9LA 4CF0A 3FMRA 4FVUA 3K4NA 4EZ6A 2ELJA 3SFZA 2E5LK 4XLFA 5A2QZ 3UNGC 2E88A 5K1YA 4CDGA 3T8TA 2R7DA 1KFDA 4EJWA 2KRHA 4B1VA 3SCXA 1C1CA 1GVDA 1HSTA 3CUOA 3RKYA 3VQEA 4DV3K 2GXAA 3PX0A 3ASOH 4WWCA 2RHKA 4IHXA 3CMEN 1UAXA 2NRAC 3GTGJ 5KAIC 2GBZA 2GAUA 1OCOH 2IOCA 2WTUA 1HLUA 3WGGA 4L0ZB 3OYEA 3M7GA 1MBJA 2CUFA 4OIOF 3TAQA 2MC3A 3S8PA 5AQMA 3GTLJ 4WQ4A 4XH4A 5JS2A 4JKAA 5K5RA 4V2FA 4KFBA 3WQUA 2JSCA 4M3EA 5IOYA 1EA3A 1BO5O 1YTUA 1K61A 4O8UA 1IRGA 4GW6A 5IPAA 4G7OF 2QWWA 1GLEG 4II2A 4KIGA 1MWKA 2DO7A 4BRFA 3KYLA 1P4WA 2E1ZA 2K85A 2L2OA 1G3TA 5DM6L 2QSHX 3BR2A 1QZZA 3V7CA 2CQXA 2IS4A 5E26A 1WAFA 4FL9A 2R0QC 1ZG3A 4W5NA 2P6SA 1HYZA 3WXJA 4JK7A 3C6HA 2YSRA 4CCKA 3AO4A 4BJ6C 5AZJA 4E0DA 4CZHA 5D6EA 2R7OA 3LAPA 2R93J 3C2BA 3S15J 4DV5K 3OOUA 3NF8A 4RGUA 2ASOA 1YAGA 1S3JA 4FWQA 2YUSA 3RYPA 4BQOA 3C3WA 1HYVA 3EYZA 2M34A 4EMSA 2DJIA 3RPUA 1BUPA 2DPNA 3PIOL 4B9UA 1DGRM 3CMMA 3FFKB 2TCTA 2PI0A 4I7HA 4IEEA 2P9NA 2IDOA 4W5OA 2JA2A 2PN6A 5DEQA 2QGUA 1C6VA 1Y1WJ 2KZMA 2XDVA 1ZK8A 4JV5K 2J5OA 2ZSIB 1XHZA 3TTCA 4S0HB 1BN5A 1BL0A 4BY7J 3LDOA 5FPDA 3N4PA 3K5NA 4DB3A 1VQ6I 3ID8A 2HOEA 3HRUA 2Y31A 1RDUA 1H9GA 1OLTA 3HP9A 1WI9A 2DK8A 4H0XB 1VQOI 4KBOA 3AL0C 1RPWA 3DAWA 4JI5K 2KDZA 2V1XA 1GOBA 4H5WA 4K43A 3EYIA 5M1OA 3V8LA 2KTQA 3RMDA 2B6AA 4FJ5A 3OBWA 1VSJA 2LY2A 3Q9VA 3S16J 4CD1A 5M5XJ 3ELKA 3ZPLA 3J81O 4B3AA 2IGOA 4ZJZA 4BVPA 3CI5A 4KN4X 1FBSA 1S7AA 3K70D 3LAJA 2JN6A 2HI3A 3HRGA 1MD0A 2LR8A 2FRHA 2NYXA 3QP6A 4L5IA 2WA0A 1ZYRF 1DDNA 1BQNA 3CFRA 5AZJB 2Y0SN 4OLAA 3OYAA 2E1YA 4WE1A 1QQNA 2VKHA 1EV7A 5J4YA 4RM3A 3SPYA 5L3EA 2W48A 4I2QA 3J7ZO 1OPCA 1I50J 1T44A 3HXLA 3OYLA 3NVMA 4FW1A 3I8BA 1B4AA 1X9JA 1BIAA 4MFEA 1LDKB 5JR3A 3TI0A 2O8EA 2FC0A 4MQ3A 2P9NB 4R8HA 2MLKA 2ZF5O 2NS0A 1X2MA 4LG0A 4YDUA 2Z1JA 5ADXH 3KTQA 4FLXA 1CXQA 1IRFA 2XAUA 1OISA 1MU2A 1U8BA 2L4MA 3FZVA 2GX9A 2Q3SA 1NJIO 2Y69H 1LUJB 2UWMA 4AIJA 4BY1J 1WSFA 4LGWA 1HQUA 3CO7C 5DM6F 1J54A 3C7NA 2Z1DA 4LIVA 1QSLA 4N56A 1QZ6A 3A01A 1EJ9A 4BRDA 1Z7LA 3V8KA 1R6RA 3VQDA 2E60A 2EIMH 2STWA 2K9MA 2G8UA 2QK9A 4C23A 5GTHC 5D4SA 4EATA 4IXAA 2IT0A 1RTDA 3HUGA 1FYMA 4JYKA 4OPJA 4NCAA 1X4PA 2KQ2A 3FHZA 3R4KA 4O55A 3CCVN 4QIWN 4XR6A 3OIQA 3TAFA 4AILC 3PIOF 4FJJA 4JNEA 4NNJA 4JI4K 4O8KA 3R6MA 2VG7A 4V2GA 1TQPA 2NOGA 1VHXA 2FQ4A 4MQ9F 3LSKA 3WXLA 2AA4A 3MCAB 2KFZA 2Z2SB 2V6CA 2Y0SA 2PFBA 3GWZA 2HS5A 1W5TA 1MW7A 1E2XA 3ONQA 4CECA 2EZIA 4H4KC 4X6AJ 3KP5A 1YS6A 5BNGA 2WWYA 1OH5A 4FWOA 4BR7A 4OMZA 4QS8A 3KZBA 3K58A 1MJBA 5ERIA 4CZZA 1KYWA 1MJ9A 1E0EA 2O8EB 2Z5UA 4MHGA 2LFBA 3WODF 4FETA 4BJTA 4LG0B 1HF0A 4O44A 1FT9A 2W41A 4C8KA 4KDPA 4NLCA 3MKZA 3ZT3A 2W42A 2HYJA 5FKOA 1JLCA 2LY1A 3OL3A 1YX3A 5AFUA 3TO9A 1USTA 3CXCM 3LQQA 1RKWA 3VQPA 3M8FA 1JGGA 1WNSA 5IT9O 4GV6A 3KLNA 2FBYA 1B59A 1FY7A 3OS0A 1YIJN 4DYRA 3C7NB 2Q1ZB 2DW4A 3A01B 2CW7A 4ESJA 1JLBA 1FOXA 4CFBA 1QO0D 3AVIA 2FBTA 2F8SA 4O6JA 1ESVA 1C1AA 5J2PA 3EYYA 5F1XA 1PDNC 3H9GA 3BCAA 3HUGB 3J80Z 4HRIA 5CZ1A 1TNTA 5HNHA 4H5NA 5GAGP 3HM5A 5HRSA 4CF1A 3B73A 3ZRGA 5BPDA 4HX4A 5FD6A 2DMPA 5EDNA 2LH9A 1ZHFA 5DTDA 3CG7A 2EFPA 1FTTA 3DYAA 2VUMJ 3R0AA 3ZQLA 4WFAL 3SUOA 1OH8A 2AP1A 3GBGA 1SKSA 1YJWN 4HUGA 4DF8A 3F72A 2JLEA 4WXDA 3M8JA 2ITGA 4BE1A 5E1ZB 4PGHA 4XOTA 3GLXA 4PKGA 2K5CA 1K73O 4KUMA 3VA0A 4B47A 4JN4A 3A03A 4DV7K 1JHFA 5FLVA 3GF2A 2HU9A 3ZOBA 5ILUA 4CO8A 5J1RA 2K9QA 2JRTA 4PA1A 3VEOA 1LOTB 3MN5A 1W7PA 1BDGA 2HF3A 3T19A 1G4DA 2E6LA 1YITN 4MO4A 5DCMA 1RDAA 5F2RA 4HV5A 1VQ5N 3LFUA 1HLVA 4NC6A 5J1YA 5ICFA 2G7HA 5LGTA 1V5GA 2HQ5A 3CCLI 2BZTA 5AQTA 3DLLL 3BG7A 3CF5L 1Q8IA 2PX9A 1LDDA 3KP6A 1NGHA 4NLBA 1VSMA 3QESA 3QPHA 2EJRA 1I5ZA 2JJ7A 3D0SA 3Q0UA 4IQ4A 1SQKA 5HL7L 2FF3B 4FJNA 4DTSA 4UVBA 3EZ5A 3EUKL 5KI6A 4GNIA 2JZYA 2A3SA 1GT0C 4YG2F 4LB5A 3GVAA 2XVCA 3P9CA 4G9YA 2YV0X 4I6MA 1VSLA 3QBXA 3G71I 1J59A 5DV5A 3G1OA 2IJLA 4C1NK 2NAZA 2OD5A 1SD4A 3J81K 3VEWA 3QPTA 4GV3A 1R58A 1LNWA 2RKHA 3ZQGA 2M0CA 4DSLA 2QKKA 1GUUA 3JRFA 4CZEA 3SDBA 1RDDA 2OC6A 3CC4I 3ERMA 2HBMA 4FM0A 3R61A 3RTRA 3OYNA 5AQVA 2K9LA 4XMYA 2IPQX 5I3UA 3NH0A 4FLVA 2E36A 4OGCA 3SAHA 1ASVA 5JVTA 3MN9A 5F0CA 4O5BA 3FKIJ 3A0IX 2KT0A 3TP0A 2HKXA 3QOPA 5EEHA 2ZFWA 3JRAA 3SV4A 4MQVA 2DDAA 1W7PB 4B48A 4FLYA 1YIOA 1JUMA 3O9QA 1FYLA 4GXOA 2Z33A 4KISA 2VWKA 5DCMB 2V4JC 1NK3P 2LSNA 1WJDA 3MN2A 2FOWA 4WXHA 3K4MA 3D1NI 3GTPJ 2EV0A 2G8FA 3WXMB 1HA8A 3NVKA 2FF4A 1S9GA 4RMNA 3HI0A 3IDHA 5C25A 3ZP5A 2DMTA 4Z6YA 1J53A 1QRYA 3NGYA 2XAHA 1IV0A 4KV8A 4XN0A 1LVKA 3V1OA 3I9V2 4ELTA 1TT0A 2JWTA 4RG8A 3DXJF 4LLLA 1BWFO 3K4JA 2XY7A 1YI2I 4BGAA 3UE5A 4LSNA 4QTRA 4I6MB 3NGIA 4MO7A 2K27A 1N8RO 1RI7A 4A59A 1UG2A 2EIJH 1D4XA 4JK8A 3AO2A 4MLOA 2BXZA 1IBKK 1EWQA 1FK9A 2RF2A 3OS2A 3HIFA 3TP3A 4B3RK 2PYLA 1YF5L 1NKEA 2O7OA 4HTUA 1G6NA 5BRHA 4ESFA 3O6WA 4CGIA 1BR1A 3Q7CA 2BY0A 1AA7A 2UYTA 1JXEA 3QERA 1FJLA 4FJKA 2F9WA 3VSLA 3B02A 2C6YA 1ETKA 1X2NA 4UXNA 4BH9A 1ZBLA 1EH8A 4M7YA 3DLLF 3CF5F 1UELB 3HOVJ 4XIDA 1ZBFA 2VGMA 1XN7A 3IKMA 4YEJA 4FWSA 3K1PA 3LDLA 4XKBA 4X65K 4E4HA 3O4QA 3KEYA 4KH4A 4H0VB 3CC2N 3E5UA 4H0YB 3K2ZA 1Z77A 3KK3A 4BEHA 1WZ2A 9ANTA 3ZCOA 1V5FA 4CIGA 1FWZA 1Y1VJ 3CQ8A 3O2PE 1R00A 4BS9A 3EDPA 2HB5A 3QWLA 1KLNA 2XGCA 4M74A 5AQRA 5GPAA 2GXBA 3JSMA 4HUFA 4I6ZA 4BY9C 5IT9K 2XF6A 3HKZN 1WSGA 3K4KA 3OW2M 2W1OA 4A93J 1B92A 1A6QA 2H1KA 2A6EF 1NKCA 3TW6A 4QPOA 3AAQA 1ZRDA 1OKRA 2PY5A 5J8FA 3CFPA 4AM7A 1OMIA 1I39A 2ETJA 2ZGZA 4A3MJ 4HF1A 1J5YA 3BTLA 3QP5A 4JKBA 3AVBA 1RCHA 3ZMVA 3S3NA 3WNFA 2DT5A 2E2NA 1NBWA 5I9EB 3LL7A 3S93A 2B63J 1RTJA 5HLTA 4W97A 4DZJA 4KHQA 5KQ8A 3HT3A 1OR7A 2CW8A 3OR1C 3TMOA 1KGSA 2V7FA 1WH5A 3WTXC 2DY4A 5I42A 5FLXK 3LAKA 4LIUA 2CU7A 4YOVA 3D7EO 3SZGA 2XHBA 1HNIA 1APLC 3FR0A 1X58A 2JWLA 4UV8A 3CHWA 4DTOA 4ZDPA 4CERA 4IHVA 4XH1A 1UA0A 3FDYA 3THXA 3VQ7A 5AQJA 1R4MB 3V7RA 5IYBJ 1TNSA 2KP6A 3D2FA 3VEZA 3QEXA 3K1NA 1GLJO 1GHCA 2E1MB 3OYKA 4BR0A 5FRNA 4AF1A 5J2QA 4BEHB 3ZX0A 3PV8A 5JVGL 1D5AA 4QPQA 2XV4S 5L3FA 2RN2A 1X9SA 4DYCA 3OMYA 4XONA 3HPGA 1XMXA 4X62K 4JK1X 1JL2A 2H6CA 5GP9A 4C2TA 5GAHP 3FBIB 3W6VA 3SMSA 3L4QA 3DU6A 1OVYA 3QPSA 1S72N 5ILVA 4E1NA 3LP2A 3L2CA 3HKZA 3QPLA 1IKVA 5DCFA 3MK6A 1R5ID 3ZN1A 3ZLJA 2Z9OA 2YKNA 4I0BA 3RKXA 3HSTB 2O8DA 4BE0A 2BEOA 4OINF 3IAS2 1Q82O 3LA3A 1NHAA 4IZ9A 1IV6A 4PK4A 2ELHA 1AU7A 3ZN0A 2MA3A 4L9JA 5H6QA 1SUQA 2M7AA 4I09A 1S1VA 4D9JA 4BBRJ 3V1QA 3NCIA 1KQSM 1Z21A 5D4RA 1ZAOA 4DQIA 1WUAA 2DA3A 1HPZA 4DWIA 4L8RB 1IF1A 2DMNA 4BE2A 3MVPA 3B6PA 4KREA 5LEJA 1A5XA 1O3SA 3C0BA 1BCOA 2EFOA 4KMFA 3HO1A 1IXCA 1IXSB 4BKXA 2Y9ZA 3Q0WA 2EILH 3TARA 3KX2A 3S1NJ 1O3QA 4GGGA 2PJRA 4H0PA 1K8AO 3T7ZA 1TWHJ 1TAUA 3THXB 1DT9A 1D0YA 3NGZA 3D2FB 3WXIA 2EX3A 4IOAL 3QDKA 4V19K 3M1FA 1F36A 3QU3A 2EA2A 2DXIA 5DD4A 2FSWA 1AOYA 5EYRA 3AG3H 5F64A 5HLHA 2JA6J 1VSIA 3FISA 2E1NA 4H03B 3I5UA 2OA4A 1T3VA 2DTZA 2VPLA 2XGDA 4B4CA 2IAJA 3P83D 4AIHA 2O8BA 4GDFA 3OYCA 3SQ4A 4BRGA 1JXBA 1SFEA 4M6VA 3ZMTA 4LK1F 3O8HA 1GOCA 5EEGA 2O8DB 4KAZA 3H08A 4FZXC 2HOAA 1FLIA 1L3SA 3GW2A 3CMEI 5JLFA 1YRNB 1VQLI 1U3EM 4IXCA 3CETA 4P9UA 4DUYK 4HVJA 3LP0A 3MMYB 4LD5A 1QE1A 4M3UA 2L9SA 2W82A 5KRSA 4H0TB 3JRBA 3QB0A 4P5OA 4CZJA 1N5YA 2KLOA 5JVGF 2OJED 5AQZA 4BBSJ 4M3FA 3ZMDA 1W36D 3TWHA 4ELUA 1IH7A 1IRZA 1U6GA 2PJRB 1SD6A 2AXTC 5H1SQ 3VGLA 3DI6A 4BQAA 3OHRA 2HQNA 4IBNA 2EK5A 3BQYA 1AHDP 2A5XA 2E2OA 1KU2A 2FNAA 2LC2A 4BRLA 3I3LA 3ZT1A 4M3XA 4HTLA 3E7LA 4BXUA 3MX2A 2O03A 2FXAA 4KO0A 3CM6A 3NWSA 5FO5A 2XO7A 2Y1JA 2GV9A 1C0FA 1WSUA 2O8BB 3ITHA 1K9MO 2FX0A 3CERA 2DFIA 2H6BA 3D6RA 5E3MA 3GFIA 1Y0NA 3MZHA 1HNVA 4IHWA 2R92J 4J01A 3S32A 1FXXA 3DXKA 1IG7A 2KIUA 4Y7NJ 2FSKA 4V19S 3CQZJ 5LJWA 1R1VA 2W4SA 3LSPA 5B5EC 3WTZA 2RQQA 2CUZA 4RB1A 1IN8A 1XC9A 4H5VA 4LG3A 4O0JA 2X1EA 4OKJA 4IOAF 1X1CA 3BR3A 3ISPA 3SK3A 4H0EA 2WONA 2Q36A 4I9QA 3H3VK 5M1PA 1L3TA 4KB0A 1X1AA 1K6YA 4F3OA 3K70C 3JCUC 3MAQA 4CH7A 2NVUB 3S3MA 5C42A 3P31A 2M5WA 3HM9A 2BGGA 4ISGA 1RIOH 2M8EA 2FE3A 3VENA 3P7NA 2I7PA 3LDSA 1IC8A 5B1AH 4BACA 1FW6A 2W57A 3HZJA 5CVUA 5CPRB 4NUBA 1YO5C 3F22A 1FIAA 3LP1A 4LF5K 3HJFA 4RAFA 2JPBA 2L5QA 3I0RA 1HUXA 2RQPA 1R1TA 1WGXA 1FNNA 4F92B 1MNDA 3FXJA 3W6KB 2DBBA 3WTSC 2QSGX 1CZBA 5HBMA 2XKOA 3J7AO 4OPHA 3KWGA 4BDPA 1VI0A 3LAMA 1P9QC 2BGCA 1IO2A 1NOYA 2QZ8A 5B1BH 4BVOA 4ZC3A 4MEXF 1SVOA 4F3TA 3R6SA 2ITMA 4K42A 3SBGA 1ITYA 5CKTA 2HHSA 1WOQA 2JA8J 1I6HJ 1A5JA 2BE5F 3ZSZA 1XGOA 4PFOA 3DXKB 2PZSA 3I33A 3E3VA 2QI2A 3MCZA 3RPUD 3L09A 1NGGA 3H9QA 3GZ6A 2HXIA 5HLGA 5DYMA 3DEUA 1HQCA 4ENKA 3SPZA 1C0TA 1Z05A 4EM0B 3W0LA 3I8DA 1NJZA 1BIBA 1O7FA 1VQON 1JT0A 3UKRA 1UHWA 2DFHA 4CYCA 3IC7A 4L9TA 1C0GA 1RUOA 4FLZA 2R7QA 2KIFA 1Q81O 2HNDA 4CGGA 2YX7A 3VA3A 3ENOA 3FXQA 2QW9A 4Y13A 4HLYA 1FJGK 5JLXA 2GBYA 3CJBA 2NNNA 5CQGA 1Y0UA 4BQNA 1Z91A 4DV0K 4IRHA 2Y48A 1BR4A 1RT6A 5IOZA 1Z9CA 1SAZA 3IRXA 4AQYK 5GAGJ 5E3NA 3ZSVA 3BQZA 1TAQA 3H0GJ 3TAPA 5E79C 5L3BA 5SWMA 1VSKA 2CMPA 2EINH 3HP6A 4XLEA 3BPXA 2VKDA 1WB9A 4F7ZA 4QWQA 1WPKA 2OQGA 1NJYA 4HSRA 4XIUA 3MWPA 1YTYA 1T95A 2GIZA 2QQ8A 2Q0RA 4A5BA 4YRVA 2Q97A 2YHBA 5CY4A 5LMUK 4GRIA 2EV5A 2A1RA 3ESWB 5C15A 3D0PA 2V7ZA 2KW4A 4J00A 5D8KB 2L01A 1RNHA 3LWFA 4I02A 4AHUA 5BS6A 3N97A 3KP4A 2M3AA 4B8AB 3G1LA 5J1UA 3FE1A 3ENBA 5E84A 1V55H 4DNCA 4AC0A 1NGJA 2ZJRF 3QO9A 3LM9A 2EZLA 5LRSA 1UHSA 2QENA 2B7EA 2WUSA 4EHTA 1W4MA 3KZIC 4I0AA 4F2RA 1GV2A 2V9PA 1BA5A 4BYYA 4BWJA 3OSFA 1ZRCA 5EOYA 3MN6A 3I4MJ 2X1CA 4IHTA 4U7DA 4LFUA 3FM5A 1U5TC 3UKRB 4PL7A 2YX4A 3J7AP 3SJMA 1QS4A 1H89C 1HOMA 3MZYA 4EFHA 1BI3A 4CYCB 2B5JA 2IS2A 4M45A 3M6GA 1U48A 2ZMEA 2Q0OA 4S04A 4JD2A 1FOKA 3WTTC 4RB2C 3ECOA 2LKXA 2AQEA 5EXWA 2MW8A 3B6AA 1WFXA 2Z1GA 3T1YK 1YJNN 4CCHA 1VQNN 4EQQA 2OAZA 2M0MA 3ERED 2YHYA 3T5XA 4CHUA 3IP4B 1FC3A 3FGUA 1SL0A 3R9PA 2D1VA 3H3OB 4EP4A 4XORA 3PJRA 3HRMA 3LSIA 3H3ZA 3PSFA 2HVSA 3AO3A 3RTVA 4MGRA 5M1QA 3HEFA 4JOMA 2IGIA 3W2AA 4IL6C 2J5PA 4FLUA 1BI4A 1YJWI 4HDUA 1IDZA 1ZELA 1RKTA 2D5RA 2UXXA 4LF4K 3S1RJ 3VGKA 2E1OA 5DUIA 3VN5A 3RRHA 3VQBA 3TDUC 1JT6A 1SEUA 3A5MC 2P5OA 4FJHA 3NHGA 1I1GA 4CJEA 3F8MA 4CJ4A 3M9AA 2ZD1A 2LG4A 4DR6K 4AHSA 1RBVA 2LNBA 1BBYA 1A6IA 4BUPA 1VQ9I 2QWMA 1ZGAA 4FK0A 2R7YA 2CQKA 2DPDA 3GDQA 4EM1A 2ISZA 1ETVA 4XLHA 2HOSA 2IS3A 4MTDA 1G59A 3IAYA 1S9EA 2HBJA 4CHOA 3CTAA 4BGDA 2YHAA 5LGUA 1O3RA 1N78A 2ZWHA 1IN6A 2FSNA 3LWLA 1KVAA 3WHCA 3V1RA 1QNTA 4NQWA 4IHSA 3N05A 2ZXJA 4JS5A 2ZO4A 5KTQA 1RC9A 4IJAA 2ZMEB 2V26A 4BC5A 4C8LA 4H4MA 3W2WA 4CEFA 4JD2B 3H36A 1V4RA 2ACJA 1PUFA 1VNDA 4Z4IA 3ROUA 2QWLA 1J9AA 2AJQA 4B9LA 1BM9A 4FWMA 2CUEA 2R3SA 2EFWA 1TVRA 1P6RA 4MDAA 3K6GA 1TWFJ 5BPNA 2Q2EA 1KYZA 2F4OB 4CEEA 4QAGA 2QUFA 3CIPA 2IAIA 4A3LJ 1JHHA 4IO9L 3BG3A 2R7FA 3C94A 1FMWA 4FE4A 3GXOA 1W5CC 4CEOA 4Z4HA 4IG0A 3HOWJ 5C2FA 1MDMA 3OYFA 2ZC2A 3S17J 4KI4A 5KGXA 4A12A 2K40A 3E1SA 3TU5A 2PYJA 4U88A 2GWRA 4B08A 4G9ZA 1BI4B 3R8EA 4FWNA 1S6LA 2RV8A 2ECBA 3VEPA 1GDTA 5IYCJ 4DZPA 2A6AA 3TGNA 2FQ3A 1SFOJ 2EQRA 3A02A 3KCCA 1YX5A 1S1XA 1Y6IA 2E34A 2OZUA 2O0YA 2QQBA 1ODDA 1XDUA 3G4SN 4E89A 3BF3A 4M63C 2W24A 1U04A 2BH1A 3G1MA 4MTEA 5BQTA 4O5FA 3IG1A 1FBUA 2WOMA 3JSPA 1UOCA 1XI1A 4PL8A 4AWXB 4M3GA 4DFPA 4JI2K 2ZFUA 1N75A 1K7AA 2HMPA 1W7PD 2MD0A 3HL8A 4F55A 3CJTB 3J81Z 3ATVA 3O4NA 1AWCA 3AVGA 3NBPA 4NQWB 2M45A 4IG3A 3JRGA 4QS7A 3G3ZA 2K02A 3V81A 1NMDA 1GXQA 2JQ7A 2HQRA 1EP4A 2O3FA 4PY5A 5EVZA 1PUFB 2OANA 2WAQN 2Z99A 2G8IA 1RETA 4LF8K 3HHHA 3PNTA 3NF9A 4IFEA 1TP4A 2JA7J 3LPTA 2R7XA 1O1WA 2FSJA 2YS9A 5D5UB 3FF5A 1KLMA 2QCOA 5J40A 2HHVA 2Q2EB 1H1VA 1NK2P 2F7TA 3A1YA 4G7HF 2O4GA 3QBWA 1N34K 1KRPA 1VQ8I 4ETSA 2CW0F 3M8QA 5LBQA 1XB4A 1MDMB 4JKHA 3IWZA 4N0BA 1XX5A 1O4XA 3VMFB 3VQ6A 5C4XJ 1QSYA 4CZIA 5LFAA 1POGA 1MMDA 4FQGA 3QRFF 1TTYA 4CZCA 2ID3A 1ITGA 5IWAK 1K83J 1UA1A 4R1HA 2DA4A 3NRVA 1KAZA 2V9VA 3AGKA 2ZXHA 3HC7A 1LW0A 4ICLA 4M3WA 1QU3A 4B3OA 3E5XA 5J1EA 2VT3A 2MG4A 4HBLA 2QF7A 4XK4A 1HW2A 4N5SA 3I58A 3L2WA 4Q0BA 1TQMA 1NGCA 3DP7A 4RLFA 5L3DA 2D1KA 4CJ5A 2IGMA 4BGBA 2M30A 2XRNA 3CC2I 3SQNA 5GADJ 4EVIA 4G6TB 1CQTA 2V52B 4WX9A 5E41A 1SD5A 2X51A 3HSRA 1IZ1A 1OCRH 2BANA 4M71A 3HG9A 1U2VA 2FF6A 3MKYB 4IO9F 3NH2A 4AM6A 1P7JA 4I9LA 3CCMI 2UUAK 1YT3A 1XMQK 3BZKA 1HPMA 2GIVA 1L5UA 1JLEA 2KPMA 1PJRA 1YI2N 4Y4RA 5F1JA 2HDCA 1SZ2A 3QODA 2DN0A 3FZFA 2YNFA 1B8IA 1ATRA 3P38A 4DSFA 1SKRA 3O4WA 2WAQA 2EA4A 4DMNA 4UY8O 4BRHA 2OZSA 4Q5VA 1KSPA 3KKSA 2B0LA 2BVLA 2F6CA 3UKUA 2D5VA 5AQLA 4DU3A 1F43A 2VXZA 4FJ8A 4JKCA 1ZBHA 3WTWC 4FXDA 4DTUA 4GV9A 4B9SA 4BC3A 4J2DA 1VQKN 4E7ZA 3AGRA 2RKIA 4EEFG 1TK0A 4C3HJ 4XOPA 2GWKA 2PQ8A 4DIQA 4AHTA 3ZT2A 4E7IA 3M4OJ 3H5RA 3GUDA 2OTJI 3AVKA 1N33K 2P7CB 3W2VA 2ZJQL 1XG1A 3LL3A 2BDPA 5HVQC 3VESA 3RRGA 5IT9Z 1MH3A 3GBTA 3GTQJ 1NGEA 4EGYA 1MA9B 4EHUA 3NMUA 3L3UA 4IOXA 2YI1A 2YHWA 1MWMA 3DLRA 3P5JA 4CFAA 3BUZB 2FA5A 2KHOA 2MABA 1G15A 5MLCQ 4JI8K 2PAVA 3ABLH 2PBDA 2D0BA 1TL1A 1XGSA 5GAEP 5E8IA 1YVNA 4KKOA 1U2VB 3HYIA 1IBLK 3OV8A 3G2BA 1DPUA 2FBHA 1ZXOA 4BRAA 1B8IB 1CZAN 3EUHC 1HW5A 1R49A 3DLBA 5FLXZ 3KE2A 4CJFA 1VRTA 3C7JA 4A3GJ 4JX4A 4JKFA 3UKUB 4K8ZA 5E1XA 2RREA 1T98A 2BY2A 4CJSA 3MEDA 2ZNYA 3KK2A 2X85A 3ZT4A 4CZFA 5F6FA 3TABA 3AA2A 2X9DA 5F0FA 4LITA 2BUPA 4FTHA 2YNHA 4M72A 3A0HC 4HUEA 3DBRB 4FPAA 2ASMA 5ICEA 4PDKA 3BTIA 2BHZA 4XLCA 1TUYA 1J9IA 2XROA 4DFMA 3SEQA 1QVGM 2E4LA 3I53A 3KETA 4RGSA 1ETYA 4C8OA 3KD5E 3VQ8A 3O9SA 2KJCA 2VPRA 4P9FA 3FXKA 3BC8A 1GXPA 1R36A 1A31A 4JEPA 5HODA 1RDWX 4FWPA 1WJAA 1Q9XA 3RSEA 3SEZA 5KAFC 3HRSA 1ZBIA 2OCEA 4A3CJ 4M73A 3HZ6A 3WTUC 2MH2A 1WI3A 2Y30A 4FX0A 4FVMA 3X2QH 3F6OA 3ABKH 5K7ZA 2HHQA 5JHFA 1S6PA 2CUJA 4A3KJ 4J2BA 1PUEE 1RBUA 3AV9A 2OA8A 3FFIA 1RDBA 3O80A 3C6UA 1JCFA 3PO4A 2Z16A 3AA4A 2HVIA 2HSTA 3U9ZA 1DU0A 4A2AA 4OOIA 1HJRA 4DBRA 2ZNZA 3PFIA 4Z4FA 5AIQA 5AQKA 1YTAA 2VWJA 4P96A 2DQLA 5D8LB 2ISYA 5M1NA 4ESBA 2ZJQF 2R7WA 3M8PA 3PO3J 1GVJA 4OIPF 1VQPI 1R71A 2A61A 1JKOC 4OAYA 2VQGA 2GXGA 1Z0XA 2JWKA 2E8AA 3S1MJ 1EXQA 4HNUA 1EQYA 2CQNA 3RWUA 3V9SA 4Y52J 2QWPA 1W36C 4L0YB 2NVXJ 3IUOA 3P9IA 4BR9A 4DCHA 5M3FJ 2XSJC 3L6QA 1FKPA 1V4SA 2X6WA 3JRCA 2GA1A 3DFGA 4PKIA 4KI6A 4NCBA 2VQEK 2A69F 1U9OA 4J2AA 3ML6A 5BRDA 3SLCA 5E8GA 2PMZN 2P9UA 4HEA2 3RSEB 1RTIA 4Q48A 2MFZA 2K9SA 4B1WB 4ELVA 4PFPA 4B8CA 3GTKJ 3BDPA 1XPXA 3VQCA 3BF1A 5BREA 3C1DA 3K4CA 4D5CA 2VBYA 4R5PA 2IBDA 4IWVA 3T1BA 1U9NA 3HJEA 4CGJA 1O57A 3JTHA 3ZQHA 2EHGA 4CJTA 4CHNA 2V1UA 5BR8K 1U6ZA 2P7VB 4YFXF 2LKPA 1T08B 3AG4H 3VOVA 3WGHA 1HKTA 3L00A 2GWJA 3PM1A 3J7YJ 1VQLN 3AAPA 1S7EA 1YOVB 1RT5A 5E17F 1PP7U 2VI6A 4UQGA 2I10A 1F1ZA 3GX4X 3ZEUA 3QIPA 1YW7A 2VONA 3M07A 1RR7A 4YOXA 4WQ4C 1E3MA 1X3UA 3JRIA 4DOZA 5EZGA 2UUBK 1IW7F 3GFMA 3CC7I 4FOIA 4F2SA 5GTIC 4E7HA 1D1BA 3E5QA 5KGWA 2OBPA 4OVLA 3SZPA 1B1BA 1XSVA 2XF7A 4CI6A 3THYA 1YHQI 1REVA 1Z25A 2UUCK 3CESA 3D5LA 4UV9A 4DTJA 3TEDA 2V6EA 5HNFA 2H8WA 2ETHA 2VBZA 4XEIA 2P9UB 4DUZK 2WV1A 4L9VA 3BJAA 3DF8A 4DV6K 1XC3A 1QVTA 3K4LA 4LF9K 2CGJA 1GOAA 4E7LA 3LNQA 1R0AA 4IFYA 1T6SA 4EV0A 3REOA 4PZJA 3U8XA 4NC7A 4JK9A 2PMHA 5LGNA 4KTZA 4RBOA 1QTMA 3DQVC 1WRJA 3LDQA 1NTCA 3COAC 3DXMA 4JLHA 3KLIA 2EFNA 4ZDLA 1WH7A 4DSEA 1NK5A 1NK4A 3GE1A 1QHAA 2YJFA 5FKLA 3ZMZA 3C6AA 2FBIA 2NOJB 5F27A 4EJUA 1TYQA 4A5NA 2XB5A 3LALA 3AG1H 4DYQA 2E2HJ 3ZEUB 1LKXA 2NS8A 1IXRC 5FPMA 3JTGA 3LZJA 3BLYA 3HOXJ 1WAJA 2LREA 3ATUA 3CCRN 3HBLA 2DFFA 3K9KA 3VOEA 3DLGA 5AQFA 1U2WA 2XC7A 2E2JJ 1LV5A 2E2QA 2L9RA 3HGGA 3WG7H 2IS1A 2OPTA 3GOIA 1ASWA 2IIRA 4CJVA 4XICA 3BJOA 4PQUA 2E7XA 2F9TA 2CO5A 5J6XA 3THYB 1VQMI 2XIGA 1YJ9I 4AHCA 2DOEA 2D0AA 4DF4A 3TDZC 1NG9A 5DS9A 4JI7K 1R5GA 4F52A 3CUQA 2A40A 4YIIA 2FBVA 1RT4A 3IKVA 5C0YA 1UCRA 4WF9L 1VRUA 1BW6A 3BTCA 1DLOA 5JVHL 2PLYA 2CJJA 3TSPA 4LJZF 1NH3A 4I98B 1NNEA 4WFNL 3F2KA 3MKLA 3ZT0A 5D5XB 2GQQA 3S2DJ 1FOWA 4LF6K 1P92A 3DXMB 1KCFA 3KP2A 1ILYA 2IXSA 1NU0A 3R1XA 3WQTA 1RILA 4CW7B 1KZHA 4RAZA 3TPQA 1Z1DA 3GZNB 1QGPA 1KU3A 1K8KA 3C95A 2QWNA 4B1UB 4H0OA 3A2FA 4HDVA 1DTQA 3IH4A 2E71A 5DK5A 1UHMA 2ECCA 5KK1A 4YDUC 1TYQB 3QYFA 5CE3A 5DMRA 4WFBL 1S6QA 2GELA 4YFUA 4CF8A 2H27A 2RAEA 3IWFA 1K6OA 3OYBA 5KPTA 1VAZA 1CLQA 2DI3A 4LC9B 4I99C 2OUMA 3HTUA 4A3FJ 1V54H 2NLXA 4OX9K 3PQKA 5F0XA 3LANA 3KHYA 3RMAA 2YU3A 4PJMA 3BTJA 4H4OA 4BWMA 4ILJA 4ZTFA 5FD5A 3WNGA 4X0GA 1RNLA 1ZGWA 4YFNF 5AQWA 4A57A 3PO5A 2DTRA 4CZKA 3UR3C 3P39A 2BW3A 3MDQA 2VN2A 3PY8A 1YJNI 5FDLA 1VQNI 4HCBA 2FOKA 3MXJA 2DMQA 3I4PA 3CUQB 4RTFD 1P7IA 1N36K 3A8YA 4CVNE 3TAEA 4K8XA 4FCYA 4KIFA 1RBTA 3AVHA 2NRRA 1JI8A 3BG6A 4HAMA 3VEVA 4CZGA 3OS1A 4FWKA 3CDHA 4DTXA 3U1DA 1TT5B 3BP8A 3HOUJ 1DTTA 1MNEA 3SQ2A 2GZWA 3DKWA 2XB0X 1FOYA 2WC9A 2HNYA 1K8KB 4K41A 2IA1A 2A6TA 1TWGJ 2L3DA 3T1AA 1OJLA 3BJ6A 4RW7A 3OYDA 2ICWG 3EE9A 4RM2A 5K5QA 3HXMA 3W3CA 2M4GA 4KH6A 1STZA 3DPTA 3AVCA 1WJFA 4AIDA 1D9DA 3Q7BA 1EKEA 3ZCMA 3F6VA 2NRXA 2G9WA 3QOEA 4OPAA 3F8FA 5J3LA 1QA6A 1WKMA 3W6JB 4WQ5A 3CD6N 3DOKA 5AQPA 2YCHA 3WE2A 3E01A 3AVAA 1ETWA 1V3FA 3KZYA 4DV1K 3OR2C 3K7AJ 5CR4A 4B43A 4LMYA 4CBWA 3ULQB 4C2UA 3O6BB 4IDKA 2BW3B 3MEEA 3ECHA 3VERA 4DGWB 1X3MA 3K69A 3AO5A 4CIEA 1IN5A 1VSEA 4A6DA 4B09A 4TSXA 3T3FA 4FOEA 3L1PA 1P90A 2NZTA 3VPZA 4AU7A 3LSJA 5FLXO 1U78A 1O3TA 3OWTA 1XMKA 4EIAA 4XRSG 4BRCA 3PO2J 1NK6A 5ADXA 4LD0A 1WJBA 5F0HA 2IGKA 1U8RA 4FJIA 2LDUA 4CGZA 3AA3A 3THVA 5FB2A 3FM3A 2QXLA 3D45A 2M87A 1DEJA 3OL4A 4UUTA 1VQ9N 4BRPA 2HXOA 3EUAA 2F5VA 3L0QA 3E0JB 5T7BA 1RBSA 4F93B 2VT2A 1XD7A 2YHXA 2IEKA 2K86A 4AM3A 4A3JJ 1LEAA 3G4SI 3DOLA 5LLQA 3RKQA 2BOLA 3FKJA 3DLHA 2FUG2 3RVCA 3WU0A 1TK5A 2JRMA 5HS9A 3L2UA 3MEXA 1Q9YA 3O8MA 2QYOA 1I3AA 2EB7A 4KIBA 2AHQA 1RDCA 2AQFA 1Q18A 3SYTA 1OYYA 2JT1A 3ENHA 5AQGA 4FM2A 2V7YA 3DCFA 2P9LA 3VDXA 4A2BA 4KHNA 3AG2H 1C0WA 1VQ4N 3ZQIA 4GVEA 1BIUA 1BG3A 3ZYYX 4DQRA 1VZ0A 1MMNA 1XS9A 1ZBUA 4M6YA 2P5KA 5M1FA 1QZEA 4OAZA 2IA2A 1PVEA 3I59A 1FEXA 1XWLA 5E3OA 4CUGA 2HYFA 1YUWA 3RYRA 4NXMK 4EP5A 1R5HA 5J47A 4KHPK 3RZOJ 1EWRA 3KKRA 4IZZA 5LJVA 2HEOA 4D7NA 2H8RA 1SFUA 2ZXWH 2GLOA 4Y1CA 1UMQA 1RT7A 4FZZA 1T39A 1DP7P 3LPUA 4RGRA 2KISA 2P5VA 4JRPA 4DTRA 3JW4A 3MQ0A 3K5LA 1IJJA 4HV6A 2NNWA 4IJNA 5F1RA 4BU2A 3T1HK 2KFDA 3U9GA 4AVZA 1XSXA 5CHIA 4CSWA 1J75A 2DU9A 1S8NA 1NLVA 1HMVA 5AQNA 3TOBA 2P9LB 4UVCA 2XY5A 5BPMA 3MD2A 3V9UA 4QLCU 3ABMH 3EKSA 4CIFA 4WK8F 4E6KG 1ACIA 3AVLA 2JA5J 3B6OA 2Q8KA 3ULEA 1T0FA 4CF9A 5M5YJ 4XSXF 1T38A 3H3NO 2OTLN 3QU6A 4DQ8A 1VQ8N 1VQ7N 3K2AA 3UIQA 3DRPA 2E5NA 3I59B 4ZDOA 2YNIA 5JICA 1ONVA 1A35A 1JKRC 2I5UA 4L5EA 1RT1A 4DLEA 1BC7C 2ZBKA 4YOWA 5GINA 4M3BA 4Y33A 2P6TA 2CQ7A 4ZZLA 2TRTA 1VQKI 1Q7YO 4YNQA 3QYBA 2XASA 3FZLA 2E1CA 3LOCA 4FYDA 4C3JJ 3G6EN 4XQFA 4KT6A 3SMPA 4AVPA 2E2IJ 2DA2A 5HDNA 3S2HJ 3S1QJ 3OYGA 1ZLJA 2Y2ZA 5IP9J 4OKKA 4B3TK 2NVTJ 2OCCH 1NK8A 3QEPA 4DV2K 1X1DA 5HS7A 2X74A 2D4WA 2KZVA 3BY6A 2KZZA 1IUFA 3CFOA 1IKWA 3RCOA 3PNYA 2E1MC 2CH0A 2VG6A 2KJBA 2AS5F 4AHRA 1OCCH 2NVYJ 1KXPA 3V7SA 4E19A 1YG2A 1Z6TA 1JJ8C 3CCMN 1RRJA 3OJUA 4AIKA 3RDIA 2K7LA 2KIQA 4D0PA 4BHPA 3I56I 5HDGA 2OV7A 4LFAK 5IP6A 1L0OC 4PGGA 1ON1A 1TW2A 2KL4A 4FHTA 3VPRA 1I6XA 3C18A 4BDZA 1ZGJA 1CXUA 1KU7A 4I2PA 3VQAA 4FJXA 2E5ZA 5F08A 5C10A 3ULEB 4GKKK 4IFVA 4N47A 3TSUA 1GLLO 4YORA 5FRMA 5CVIA 3GG4A 2BTFA 3OJSA 3TSQA 3CCSI 1YE9A 1USSA 3FMSA 1YYVA 1MBGA 2VOOA 3DPUA 2O8FA 3BCBA 1I3QJ 3M3YJ 4OKEA 4N4OB 4ZYGA 2XAFA 1BOBA 2GUPA 4W1UA 4CJRA 2OYQA 1OR7C 1DQUA 2OTJN 2BYVE 3FHNA 4XLNF 4UB8C 3H5NA 3T8RA 2VJIA 1EX4A 2Q31A 3VQ4A 5AQQA 2YPRA 5FGMA 5E1WA 2P5LC 1ERDA 1WJ5A 3LMMA 5FKNA 5AQIA 4NO7A 1ZG1A 3QICA 3NWTA 1B9NA 5CVRA 2DA6A 1ZN2A 1U0JA 4BREA 1RGIA 3MXIA 4JBAA 3OA9A 3L8BA 3RQIA 4Y17A 4BXFA 4CFDA 3O3KA 1TK8A 4EJVA 4YIRX 5BPIA 2XF5A 4EM2A 2VLAA 4A61A 5HOOA 3GZ5A 1VSHA 1UB9A 5AR0A 1RTHA 1JCGA 4PJ0C 1BIZA 2YU9J 3KK1A 2H94A 2EWSA 4WCEL 2LF7A 2LYCA 4EJTA 1QHGA 2CV0A 2VC0A 2VBWA 3VQ9A 1GLBG 4XL9A 1DU6A 3SUQA 5TJJA 1YRNA 1XDSA 2K9NA 2QQAA 1OCTC 4DV4K 2JGUA 2TDXA 2O8FB 3CF2A 5ED4A 3EKUA 2GOMA 3HL2A 4A3BJ 3DWLA 4ILHA 2E20A 1MH4A 3RI4A 5L3CA 1KAXA 4NCGA 2HZTA 2OPPA 4GYIA 4CHZA 5TRDA 2QA4N 3OBYA 2HDWA 1X19A 5CVVA 3FK7A 4FM1A 2DODA 1ZH5A 5FROA 3ZQFA 4U67L 2FEZA 1Y56A 4Y0WA 5K7HA 2NRTA 4IDHA 3K0SA 2L7ZA 3SYZA 3FXLA 2A41A 4JP0A 1SD7A 2JSPA 4B1ZA 2QKMB 5GPCA 5J2NA 1IV8A 1MMSA 5C2DA 2G8WA 2MYSA 1M90O 3FMQA 4E70A 3U9DA 1Z6RA 1W1WE 3O9RA 3PSIA 1Y8RB 4K0KK 1QBJA 1ATSA 5K14A 2VQHA 1TKDA 4D1QA 2PG4A 1IDYA 4XKWA 3J7AY 1W0UA 2HTJA 3CM5A 5AFUH 2LD5A 1NJWA 1R9TJ 4DFKA 1GLFO 4E7SA 3BR6A 4CESA 1TL8A 3AY9A 1VFCA 1JCEA 1SMTA 1IAWA 1H0MA 4CJWA 2KHMA 2ASPA 3VSKA 4M9SA 4HX8A 3PX4A 5HLFA 1QPIA 3AVFA 4BRMA 2VCPA 3IFRA 2ZE2A 1VQPN 4P1WA 2Q0UA 3DEEA 3ZGKA 3F21A 2KFNA 2GOXB 1QQIA 3H1QA 3NF6A 2O9LA 1BC8C 1TKTA 3CQXA 3VYTB 2M2EA 4B9VA 3VWBA 5B66C 3CJNA 3F3XA 1Y64A 4LF7K 1BGXT 3AVJA 4KICA 3E9OA 5DDGA 2Q1NA 2Z1IA 2M1BA 2CV1A 4B3XA 3VTHA 2YNGA 3FZHA 3LSRA 2UXNA 4CJQA 1H9TA 3I55N 2H09A 2DT6A 4C8MA 4DKWA 2H3GX 1NGBA 4FJGA 5HP1A 4KHSA 1QQCA 2YKMA 1ZRFA 4KITB 1LVAA 2HQAA 4U0VA 3H6EA 1D8YA 4B9NA 3H46O 4A69C 3A0BC 3F23A 1X1BA 3RQ4A 2CSOA 3TKYA 1NGDA 4ZYHA 3EZWA 1E3HA 2KLAA 4XRMA 2RC4A 3F5TA 5CLSA 4BR2A 3AL0B 2HVQA 3WU2C 1NMNA 3S9HA 2QKLB 1FPQA 2LLKA 4IVNA 4CBUA 4JX5A 3HTVA 4RWTA 3S14J 4M3YA 4G94A 1JE8A 4CFCA 4KH5A 2DQRA 4L18B 3HYFA 1LAWA 3SNNA 3U1KA 5BN8A 4KTQA 1P2FA 2P8TA 4G6QA 3M1CA 2ZJ2A 3V9XA 4HW0A 5H20A 4C9YA 3AAFA 3CPWM 2QBYA 1SC7A 3O3FA 2QSFX 1Z7UA 1YLFA 1T2KA 4FJLA 4BR4A 4HYEA 1DPRA 3MZ8A 3KEOA 2RVCA 4CJUA 3CC7N 3B6CA 3CCRI 4Z2YA 2E7WA 2NRZA 3VF4A 3HK2A 1ULYA 3UKGA 2CYYA 2D0OA 1E4FT 3D5RC 1YHQN 1X3NA 1FYKA 4ZTJA 4LH5A 3QAHA 3JREA 4IPAA 2L7MP 1NG6A 2W6LA 3WNEA 2A07F 2ZQBA 4W5TA 2IS6A 3LZIA 1QVFM 2HR3A 3ABUA 2W7NA 3ZX3A 4XN3A 1KFSA 3P9KA 4RB3C 4DTNA 4ZZDA 1FZPB 4N9IA 3TANA 4A3EJ 4CHQA 3HSFA 3N4MA 3KEQA 3JR9A 2BXYA 4A3IJ 3JXUA 3DLEA 1BOTO 4U0WA 2LOOA 2CFXA 4LB6B 4UB6C 3BWGA 1Z26A 5LY3A 4NYFA 4CGHA 2X1DA 1FMVA 2B9SA 3KP3A 3ID6A 2A1SA 3K2PA 5AQHA 3KK7A 2RPIA 4NDLA 3AVNA 2XAGA 3MECA 3ABTA 4CCLA 2BHYA 2NNYA 4CCNA 1JKPC 2GUIA 1OH7A 4CXFA 1NOZA 1MSEC 1U4BA 5DUKA 3HOTA 3BR1A 1TGOA 3NQOA 4MDBA 1NJXA 1BHLA 2EWNA 5LRRA 3H45C 1O13A 2DAOA 3HTSB 3ZSOA 1YS7A 2G8KA 3ZQ7A 4JX6A 3MKWB 3GLLA 1HNXK 3Q5FA 2QBYB 3WG9A 1MMGA 2WBMA 3CMAN 4DFJA 4A5AA 2Z3YA 4JKEA 3O9UA 2XY6A 3KYDB 4HZFA 3V4GA 3E9PA 3QIOA 2UXCK 5IT3A 3HVRA 5KNLA 3SQ1A 1TKXA 3S2WA 1IN7A 1WVRA 2R5YA 4JI1K 5D6FA 1EH6A 1VQMN 1YJ9N 1IG9A 5AJ3K 2RNJA 4LSLA 3H0DA 1U45A 2UU9K 2I7NA 3F8BA 4D5FA 2HGCA 3D5SC 1B9FA 1BL3A 3OYIA 1M1KO
chains in the Genus database with same CATH topology
3NH0A 1JL1A 4CK2A 1MU2A 4G1QA 3ZSWA 1TKDA 4E7KA 4DU1A 4F4KA 4CHPA 4Z4IA 1J9AA 4FLVA 2AJQA 3ZSXA 4OGCA 3SI6A 2Q3SA 4B9LA 4AH9A 3CM5A 3T1AA 1ASVA 3DM2A 1CZBA 1JLGA 1RT1A 5HBMA 1SKWA 4F2SA 4Y1DA 3DLRA 4DLEA 1NJWA 1SUQA 1WSFA 4E7HA 4DFKA 3P5JA 1HQUA 1S1VA 5EU7A 4O5BA 5KGWA 4RW7A 4OVLA 4CFAA 3OYDA 1J54A 1TVRA 4DG1A 4CESA 4BDPA 3V1QA 1G15A 2XRIA