1I39A

Rnase hii from archaeoglobus fulgidus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i39A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i39A01
1JLCA 4DFPA 3ULDA 4B9MA 1JL1A 1VSKA 5HROA 2YNFA 3VQ4A 5FDLA 2OZMA 1XHXA 1YTUA 1X1PA 3L3UA 3TABA 1TK0A 3ZCMA 4EP5A 3HPOA 3NF7A 5JS1A 4FJXA 4DTPA 2WONA 3D0PA 3RWUA 1B92A 3TI0A 3ZT1A 3SPZA 3HL8A 3SJJA 2EHGA 4M3RA 4N41A 2HHWA 3OYMA 3NCIA 1Z26A 2KFNA 3HXMA 4FK0A 1EX4A 4E7LA 4DFMA 4E1MA 2O4IA 5CYMA 3RMBA 3K5LA 2D0CA 1XC9A 3AVAA 4AH9A 5J2QA 1NK8A 3F9KA 2RF2A 3OYKA 1JLFA 2BE2A 4IFVA 3H08A 3IG1A 3V1RA 3OS1A 3NE6A 3K5MA 4JS4A 4CHZA 3ZSVA 3TAPA 1SL2A 3V9WA 5C42A 3OYBA 3OJUA 4W5RA 1KTQA 1VSEA 3AVCA 4E1NA 3QEIA 3SUQA 1RTIA 4KO0A 3VQPA 4CF9A 1VSMA 2X74A 3K59A 4C8OA 4B8CA 1IKWA 3KD1E 1WSIA 4CEZA 2ITGA 2Z1IA 3LZIA 4OGCA 3TAMA 1IH7A 4CGFA 1ITGA 1TAQA 4HVJA 3SQ4A 3SUOA 1Q9YA 3V9ZA 3D45A 1X9SA 1UOCA 2ZE2A 4N47A 4E19A 2Q3SA 1NJWA 3SQ1A 3U6FA 4FYDA 1ASUA 1XHZA 4FLVA 2HHUA 2P51A 4CJWA 3L3VA 3A2FA 3HPGA 4OKJA 3V9UA 3S3MA 1C6VA 3KLHA 4FK4A 3QETA 2X6NA 1FXXA 1RTDA 4CGJA 1NK0A 4FJGA 3LWLA 5C24A 2VG6A 4FW2A 1YVUA 1W9HA 3QO9A 4BDYA 3RR8A 1RDBA 4DSFA 1NOZA 1YT3A 3OVNA 3LP2A 4CJTA 3OS0A 1C1AA 3O3HA 3MECA 4FJNA 4CIEA 3NF9A 3L2UA 4DSIA 4F2RA 4CF0A 4OPKA 1LW0A 4KHQA 3CG7A 1HMVA 2DFEA 2B4JA 2BANA 3OYNA 3CM6A 4I9LA 4CGGA 1JL2A 3RMDA 3QIOA 5I42A 1C0MA 1L5UA 2FBTA 4I2QA 3U3GA 1KLMA 2P5GA 3BGRA 2ZQBA 1R0AA 2FBYA 1RT4A 2XRIA 1NK6A 4FJMA 1WSEA 4DQSA 1EETA 3OYAA 4FK2A 4O5BA 3RRHA 4OJRA 2AJQA 4CHPA 3AO4A 4CGHA 4W5QA 4DTMA 4FM2A 3DOLA 3VQ8A 4CK3A 3RMCA 2G8FA 3LP1A 3THVA 3K58A 4CJ4A 1DTQA 1FKOA 3AA5X 4ELVA 2KZMA 3L2VA 1Q9XA 2YKNA 1BCMA 1TK5A 3HP9A 1BHLA 1UWBA 3HSTB 3C94A 3LP0A 3MEEA 4OKEA 3NH2A 3AVGA 3IRXA 1RBVA 1WSHA 3AVFA 1BCOA 3PV8A 4CFDA 1L3SA 1JKHA 4J2AA 3C6TA 3T3FA 3EY1A 3SUPA 3HP6A 2HVIA 5KRSA 1S6PA 1QSSA 1GOBA 4FLWA 4N5SA 4CEBA 2IDOA 3SZ2A 3NGYA 1BIUA 3HYFA 4CGIA 4QAGA 3NHGA 1FKPA 3G10A 4I7FA 4CEFA 3ZSYA 3NF8A 3OYJA 2OYQA 4J2BA 4O44A 2PYLA 2HHSA 4ELTA 2HNZA 4IDKA 4CHNA 4KB0A 4HCCA 2Z1GA 4CEAA 3B6OA 3CYMA 3K57A 4NYNA 1HPZA 4J2EA 4W5OA 4KHYA 1T05A 3LP3A 3OYEA 4DQIA 1UA0A 2B5JA 2RPIA 3ZT3A 4L8RB 4KRFA 2G8WA 1TKXA 1TV6A 1UAXA 2QXFA 3WNFA 3QEVA 1TAUA 1A5XA 1QSLA 3OYLA 3IAYA 5T7BA 4DU1A 4CJ3A 4CIFA 4LSLA 4FLUA 1NK9A 4CJRA 2PZSA 2Z1JA 1SL0A 1VK0A 4Z4IA 3AVJA 4DTXA 4DMNA 3HK2A 1RT5A 4FLTA 4CF2A 2XY6A 3L2QA 3ZSWA 2Y1IA 4CFCA 3P5JA 3VQAA 4CK2A 4CJVA 1VRUA 2VG5A 4F8RA 2NUBA 4Y1CA 4CJPA 1S1TA 4PUOA 1IKXA 1Q8IA 2HB5A 4IBNA 4KHNA 1N6QA 5HRNA 3OYGA 2DY4A 1HYSA 3QNOA 2YV0X 4NYFA 1GOCA 1W0HA 3S3NA 1J9AA 5KRTA 4M3WA 5E41A 4DSEA 1VSHA 4EZ9A 2YNGA 5HRPA 1VRTA 4Q5VA 2G8HA 2KZZA 3JYTA 2D0AA 1CXQA 2IC3A 2XY8A 4DU3A 2IS3A 4KTZA 4CF8A 1CZBA 4XIUA 3DLHA 4DU4A 1KFDA 3T19A 1KRPA 3LDSA 1JLAA 3ZT0A 4Z4HA 2OZSA 1U45A 4E7HA 4C8NA 4E89A 4FLYA 2QKBA 3AA4A 3DLRA 3LWMA 4DTRA 4RW8A 3V9SA 3V6DA 1SKWA 2VWJA 3SCXA 5I3UA 2BGGA 2YKMA 3K2PA 3KK3A 3AV9A 4NCGA 4DFKA 4C8MA 1S1UA 1Z25A 3WNEA 3S3OA 2F96A 1RBTA 1RNHA 1QS4A 5KGWA 4CFBA 2A1RA 2PYJA 2RKIA 3CFOA 3K5OA 1ASWA 3QEWA 3O3GA 4E7KA 3PX4A 1CZ9A 3KLEA 3DM2A 3QINA 4C8KA 1FK9A 4EZ6A 4E3SA 4FJ5A 2HVHA 4CECA 1QTMA 4CERA 1TGOA 4CJQA 5SWMA 3DI6A 2B6AA 3KTQA 1CLQA 1NJXA 3TWHA 1YTAA 2KTQA 3DRPA 5KI6A 4DTOA 1NKEA 1RBUA 4KAZA 4FJ7A 1D9FA 1VSIA 1TVRA 1ASVA 1NK7A 4DSKA 2P1JA 1TKZA 2OPRA 3V81A 1KFSA 4B08A 4Z4CA 4CEQA 1D8YA 4B9LA 4ID5A 1JXBA 1ZBFA 3SQ0A 1L3TA 1VSDA 5D3GA 2EX3A 4FJHA 3MEDA 4M3ZA 1C0TA 4G1QA 2HHQA 2KFZA 1A5WA 2DFHA 4FJIA 3SV3A 3NAEA 3EZ5A 3NGIA 1HNIA 1ZBIA 3M8QA 1L3VA 1B9DA 4I2PA 4J2DA 2XY7A 3MXMA 4FZXC 4FCYA 1HYVA 2O4GA 3L8BA 3HT3A 1WN7A 1XWLA 1RBSA 4CIGA 3QERA 4NCBA 4FJKA 4Q0BA 4DSJA 2JGUA 3LAMA 2E6MA 4DSLA 4DF8A 4OLBA 2IAJA 4B8AB 1RTHA 1MU2A 3VQEA 2OA8A 4YNQA 3OS2A 3PX6A 3EYZA 4DWIA 1B9FA 3DLGA 3V1OA 3SUNA 4CCHA 4FM0A 3MXJA 4RW7A 5CZ1A 4I9QA 2X78A 3SPYA 5J2NA 1S1WA 3G0ZA 2JLEA 4BE1A 4DQRA 2P5OA 3UIQA 4CHOA 4BE2A 1TL1A 2GUIA 1JLEA 3JSMA 1G15A 1RCHA 2YNIA 4BWMA 3V9XA 4CJUA 4CEEA 4ZTFA 3NBPA 1KSPA 3VQCA 4B9VA 1LAVA 2KQ2A 5CYQA 4HUFA 1RILA 1BQNA 3KK2A 4F3TA 1RDCA 3OYFA 4Z4FA 3PUFA 3IS9A 3E01A 5DK5A 4ZTJA 1RT3A 1WAJA 2RN2A 1C1CA 3DLEA 3LANA 4H4OA 2VG7A 3NFAA 1KVBA 1ZBUA 4KKOA 4MFBA 3VQ9A 1KVAA 4IG3A 1HJRA 3VQQA 3ZSXA 4HUGA 3HVRA 4B3OA 4CFAA 4BACA 2ATQA 2VWKA 2DFFA 4FVMA 5CY4A 4CESA 1N5YA 4IKFA 4Z0UA 3VQ6A 4BE0A 1LV5A 4F3OA 1S5JA 3SYZA 3SI6A 1UA1A 3TAEA 1SL1A 3CFPA 4DLEA 3ALYA 4FJLA 4KHUA 4Z4GA 3QEXA 3K5NA 3V1QA 1NK5A 3SNNA 4ELUA 1S9GA 4HTUA 2X6SA 3T1AA 4FM1A 1S6QA 3DLBA 3ZT2A 1RT2A 1NJYA 3HJFA 1SV5A 1EXQA 1HQEA 4GVMA 3ASMA 3NGZA 2IGIA 4KB1A 5HP1A 4KTWA 2WOMA 1HYZA 1SKRA 3FFIA 1QSYA 1S1VA 2ETJA 2D0BA 2HNYA 3NDKA 1U04A 3AVKA 3DLKA 1NKCA 4CE9A 4UQGA 4HHTA 3P1GA 5EU7A 4M41A 1T03A 1TL3A 3HPHA 5HLFA 1BQMA 4PWDA 4AHUA 2OPQA 3I0RA 4DTNA 1TK8A 4B9NA 1C1BA 4KI4A 1WSJA 1S1XA 2G8IA 1ZBHA 3C6UA 4K8XA 4M42A 4OGEA 4LSNA 3CQ8A 1BIZA 3KK1A 4CEDA 4DG1A 4JLHA 4KV8A 4AHCA 2QK9A 4ID1A 1I39A 3WNHA 1T8EA 1O1WA 4ZHRA 5J2PA 4E7IA 1CXUA 1A5VA 3NH0A 1KCFA 1LW2A 3MEGA 1BL3A 3AA2A 3MXIA 1IKVA 4BWJA 4OLAA 4DF4A 2XHBA 2Y1JA 3TANA 3TR8A 1NJZA 3BDPA 4CJFA 4B9SA 2W42A 4FW1A 1KLNA 1DLOA 1JLQA 3DMJA 3DOKA 3DRSA 3L2WA 4ICLA 4RW4A 4JRQA 1LWFA 3ISNC 4F2SA 3AVBA 3KKRA 4DQPA 4FZYA 4KPYA 4M45A 4DTJA 1NOYA 3KD5E 5SZTA 2LSNA 1WSFA 4AHTA 3TAQA 1IG9A 4Y1DA 4RW6A 4E7JA 4LY7A 3F73A 1BISA 1K6YA 4DFJA 1NKBA 4M3TA 1RDAA 4FJJA 1VSLA 1JLBA 3O4NA 1EP4A 3B6PA 1BI4A 2KW4A 3VQDA 3ZSRA 4DTUA 5J1EA 1L3UA 4QCLA 3TAFA 3KKSA 3AVNA 4AHVA 2I5JA 5KTQA 2IOCA 4BDPA 3M8PA 3TARA 1XI1A 2GV9A 4CJEA 3LAKA 2FBXA 3L2RA 1HNVA 3DYAA 4CJLA 2F8SA 1U49A 3ZSOA 5CZ2A 1D5AA 4N56A 3ZT4A 3QIPA 4KFBA 4EP4A 3NH1A 3HM9A 3M8SA 4O4GA 3QEPA 4CHYA 4KHSA 4DTSA 3VQ5A 1I3AA 3ZSZA 1U48A 2G8UA 1T7PA 3AO3A 3RMAA 4K8ZA 4CEOA 4CGDA 4FJ8A 4Z4EA 4HCBA 3O3FA 4O0IA 4N76A 4M3UA 1DTTA 3PO4A 2YHBA 2Z1HA 3P83D 1QHTA 3AVLA 3AVMA 4M3YA 1VSJA 1X9MA 2HHVA 3KLIA 4CJ5A 1Y97A 3CM5A 4IG0A 1WLJA 4LD0A 2XY5A 3LALA 1GOAA 1TKDA 1RT1A 4NCAA 4JRPA 1REVA 1U47A 5FROA 1J53A 4KTQA 4C8LA 3AVIA 1S9EA 3LPUA 4DQQA 3RR7A 3VN5A 1LAWA 3OYIA 1ZBLA 1U4BA 4M3XA 3LPTA 4HUEA 1HRHA 4CK1A 1RT6A 2HNDA 1BI4B 1J5OA 3DRRA 4IFYA 3I8DA 3VA0A 5FRNA 4PQUA 2FBVA 4E0DA 3AO1A 2DTUA 1LWCA 4LH5A 3PY8A 4OKKA 3KLFA 1EKEA 2FC0A 2E4LA 3PX0A 1F21A 5JS2A 5FRMA 2HHTA 3ITHA 3VQBA 2E6LA 4RG8A 3KLGA 1NK4A 1WNSA 5HRSA 4H4MA 2YNHA 2QKKA 2R7YA 3OY9A 3ZSQA 4CHQA 5HBMA 3OJSA 3VA3A 4OPJA 1TKTA 2G8VA 2G8KA 4H8KA 2YHAA 3QLHA 4GW6A 4KHWA 4DS5A 4O0JA 4CF1A 1IKYA 4FZZA 3KJVA 1RT7A 3AO2A 1SKSA 4CJKA 4AHSA 4DS4A 5DMRA 3SV4A 4CJSA 1KVCA 1IO2A 4JS5A 1RTJA 2ZD1A 3MAQA 4FJ9A 3C95A 1WAFA 2OPPA 1VSFA 2PY5A 5HRRA 1HQUA 1X9WA 3PO5A 4WE1A 2F8TA 1J54A 3V4IA 4TSXA 4W5NA 4OVLA 3CFRA 4O55A 3O4QA 4BDZA 3U3YA 3HO1A 1QQCA 3AVHA 3I0SA 4MQ3A 1JLGA 1C0UA 1SUQA 3QESA 2D5RA 3OYHA 1WSGA 4PA1A 3VQ7A 3M8RA 3SQ2A 4R5PA 4AHRA 1RBRA 1LWEA 2XO7A 3OYCA 3QNNA 5C25A 4LH4A 1D9DA 3KIOA 2HMIA 2BDPA 3AA3A 4RW9A 3WNGA 4QOZB 4YFUA 3RTVA 3HVTA 1JXEA 2GBZA 4W5TA 3OYDA 4GMJB 2OPSA 1ZYQA 3TAGA 3RRGA 3AO5A 4PY5A 4KREA 4B9TA 1BGXT 4F4KA 2HHXA 5K14A 4FXDA 4FLXA 1RDDA 5J2MA 4DLGA 4KI6A 3LZJA 2HW3A 3S9HA 3NF6A 4AILC 5KGXA 4B9UA 2A1SA 4FLZA 1QE1A
chains in the Genus database with same CATH superfamily
4RS8A 1TWGJ 1KC8O 2HOSA 1MBEA 3ZCMA 2WONA 2QSFX 1IRXA 3AGRA 1A35A 1R00A 2O4IA 4AIJA 1NGJA 1K9MO 4HRIA 4S04A 3QEIA 1WI9A 4KO0A 2QM1A 1WSIA 4DR3K 3SQ4A 1Q9YA 1NJWA 3O8HA 4ISEA 1WJ5A 5D5VB 2XDVA 2ELKA 5I9EB 1GVJA 2NXNB 3A5OC 3S1NJ 3MZYA 1NK0A 5FKOA 3VESA 2VG6A 2E1MC 1O4XA 3SBTA 4EHTA 3CMEN 3O6WA 4FJNA 3BOQA 4DQ2A 5J3LA 4F2RA 1T6SA 4OIRF 3FE1A 1VQ4I 2FF6A 4I2QA 1RT4A 1G2HA 4A3KJ 4O5BA 4CBXA 4CXFA 2KZMA 4A3JJ 1TK5A 5D5UB 3MEEA 3OTOK 3PIOF 3PSFA 3C6TA 4PSWA 3PIPF 1G6NA 1U3EM 3SUPA 1T3VA 2WTEA 3C1DA 3ZSYA 2VE9A 2HQ5A 4PFPA 3CC2N 3C6HA 4LG0A 5TRDA 4H0XB 4AYBN 4J2EA 4KHYA 1T05A 2E5ZA 1NTCA 1NH3A 2EFWA 4DU1A 4LSLA 1O3QA 2O61A 2PZSA 1SL0A 3HYIA 1RIOH 3VQAA 3HBTA 3DPUA 2MFZA 1VQ8N 2HB5A 4CI6A 3C7JA 3IP4B 5EGOB 4B44A 3J7AY 3HEFA 2E19A 2E5NA 2R93J 3VF2A 2CGKA 3D2FA 3V6DA 2WAQN 2Y0SA 2XAJA 1PVEA 4NCGA 1V4SA 1BW5A 1QS4A 4LLNA 5KQDA 4ENKA 2EPFA 4A0YA 4IRIA 1QTMA 2JK3A 1MNEA 5SWMA 1Y1WJ 5GADJ 3AAPA 4OU0A 4H0YB 3MN9A 1Y0UA 4LLLA 5D3GA 2EX3A 3MEDA 5GP9A 2OUMA 2FD5A 2ZWHA 5K7ZA 1B9DA 3CCJN 3ZP5A 1R23A 1WN7A 4CIGA 4IRGA 4DSJA 2ISZA 5LL6Z 4H5RA 3VQEA 2DQLA 2OA4A 3DLGA 2DMNA 4JP0A 3G0ZA 3PNTA 1SFXA 4ZDLA 2QTDA 3TSQA 3K70D 1VNDA 4HNTA 4BVPA 3NBPA 2DTRA 2DDBA 3OYFA 2PFUA 4LMYA 1Q7YO 2NVXJ 3DBLB 2RN2A 1C1CA 3K69A 1CZAN 2DFFA 2RAEA 4OMYA 4B8XA 2Y9ZA 3ALYA 4KH5A 5LHHA 1S6QA 4GVMA 5IPAA 2QGUA 2BVMA 3S93A 4K41A 4UVCA 3NDKA 3AVKA 5GAEJ 2UUAK 4B9NA 2FQ3A 1VZ0A 2D5VA 1JT0A 3WTSC 4DV5K 4LSNA 1XMXA 4CZGA 2A68F 4ID1A 4MEXF 3MKLA 5BRDA 3G4SI 3K4JA 1VQ6N 3ID8A 4CBUA 3PIOL 4FW1A 3KKRA 1BOAA 2LSNA 4Y1DA 1DU6A 2GXAA 1WCMJ 4H5WA 1IBKK 3VGMA 5E18F 2Q2EB 3M8PA 3ULEA 3CTAA 2KDZA 2LYCA 3M7GA 4IHYA 1WOQA 3ZQFA 3AO3A 3FZHA 1W0TA 4CEOA 5K1YA 2R3SA 1YYVA 3OIQA 1OMIA 4CJ5A 3F8NA 3CM5A 3MX2A 4AUXA 4CZHA 2IBDA 3VN5A 1LAWA 4QWQA 4Y3OA 5FRNA 1LWCA 5H6QA 1U2VB 4BBSJ 2QWRA 3BQYA 2F4MB 4ZYAA 2QKKA 3HSRA 4GW6A 1X3MA 3BCBA 1NG6A 3KZYA 1MBKA 2DMUA 3CF5F 2RGVA 4C2TA 4BDZA 3I0SA 4M3FA 3V8KA 3ASOH 3IC7A 5ELZA 3HTUA 3JW4A 1D9DA 4DR4K 3WHCA 2R7ZJ 3SXYA 1KA8A 1JXEA 2YR2A 1WQ2A 5KNLA 3NRVA 3WU2C 5K5OA 4KI6A 4U0YA 2NAZA 3DKYA 2VT3A 1YITI 3NQOA 3TI0A 3ZT1A 2KFNA 3FXKA 2KLAA 4JS4A 2W48A 5AQHA 3G71I 1Y8RB 2X74A 1A6QA 4IOXA 4CEZA 3LWFA 4XSXF 4LK1F 4CO8A 3LDNA 4B1ZA 3ZETA 1ZGJA 4HX4A 3HOUJ 2V26A 2HBJA 2CQ7A 2OQGA 2VBZA 2E8AA 3CETA 4CJTA 2CV0A 2FBKA 5ICEA 3I56I 1JL2A 5CVUA 1C0MA 3VEPA 2V7ZA 1WGXA 2AJQA 4IO9F 4CGHA 2A5WA 2LLKA 2K02A 2JN6A 3I59A 2NNWA 5JLWA 4JK8A 1X9JA 3MAJA 3Q7BA 2OBPA 1S6LA 2IDOA 1X3WB 5AQZA 1BIUA 2E5LK 1TT5B 1FKPA 2OYQA 3JRAA 1GV5A 2JVGA 2VN2A 3VF4A 1UA0A 1LVKA 1ON1A 5IP6A 3IMXA 1YIJI 2VIXA 2DOAA 3LSRA 3OBYA 3PQJA 4B1YB 2I7PA 3ZGKA 3FHNA 1NK2P 2IVMA 1GOCA 1MMAA 3A4CA 5JLXA 5C2DA 3DXMA 3OL3A 1N33K 2L7FP 2ID3A 2XY8A 4KTZA 1ZRFA 4A5NA 1LEBA 1T8IA 4C8NA 4FLYA 3DLRA 3MN2A 3SCXA 4LF8K 4TV7A 1EH7A 3AFHA 3CP2A 4DHYA 5J1RA 3O1WA 2X48A 3CF5L 3P9IA 4C8KA 4FJ5A 3U21A 4ETSA 3KTQA 3RVCA 1MBFA 1WVRA 2X4HA 3D5LA 4H03B 3KCCA 4CEQA 2DMTA 3BTLA 5KCMA 1Y56A 2LOOA 1T33A 2V52B 1D0XA 1MWKA 1DGWY 3FGUA 1PUFB 1LB2A 3M4OJ 4NUBA 3GZ6A 2HVQA 3FISA 3UR3C 1ZC6A 2UXCK 3QERA 2JGUA 4F91B 3O9UA 3U9DA 1S7EA 1GLDG 5J8FA 3QRFF 4G7HF 3PX6A 4RTFD 3JXUA 2P5OA 4BE2A 2K5CA 1JLEA 2IS1A 1DQUA 4E4HA 3F3XA 1WJBA 1VQPI 3V42A 2O03A 2CYYA 3E01A 5BPDA 3R1XA 4K25A 4MLHA 2P9IB 5CYVA 3U9ZA 1MJAA 4FWMA 1SL1A 3HRTA 4G6TB 2W6KA 4A2BA 1FLIA 3K5NA 1KAXA 2X6SA 2ZSHB 2LBFA 3MDQA 3DLLF 1R71A 4B47A 1NKCA 4HHTA 5AQYA 3X2QH 2E7WA 1XB4A 2OPQA 1QZ6A 3FK7A 4IO9L 4Q5SF 1BIZA 4YFKF 4IOCF 1HNWK 3H0DA 1T8EA 3TR8A 4Z94A 5LRSA 2W7NA 1A31A 3DOKA 4FZYA 1YX5A 2EV5A 4UUTA 4AHTA 5SZTA 1K73O 1IG9A 5JVGF 5J6XA 1EP4A 5AONA 4JNEA 5KPZA 3ZSRA 1QHAA 3CMAN 2COMA 2HVRA 1USTA 1ILYA 1KQ0A 2NNNA 4YIFA 4XLNF 4O4GA 4EM2A 3ZEUA 1HUXA 3TL4X 4M72A 2QF7A 2EFQA 1NLVA 2G8UA 1T44A 4HWIA 3VQ5A 3ZX0A 4BRQA 1NWKA 4KITB 5EF6A 4M3YA 3LSHA 4MIMA 3L0QA 2HHVA 1X3NA 1S72I 5EZHA 1QBJA 2AQFA 4JYAK 4NQWB 2FSKA 2WY8Q 4DJAA 2RQQA 4XH5A 2CG4A 3VA0A 2DTUA 3T8TA 4U87A 4BEHA 5J4YA 3KLGA 3IWZA 1UAAA 4IHTA 2UWMA 4MLEA 2DLLA 4C30A 2BOLA 4OPJA 3GG4A 4NC8A 4H8KA 5AQIA 2D5RA 1D4XA 5IP9J 3FIWA 2R7SA 3WXJA 1TWHJ 2JZYA 2IVNA 2LKSA 3KEOA 5AQKA 3ECHA 4P5OA 1ZYQA 2KIUA 4FXDA 4A93J 3NF6A 3JRCA 2W40A 1TNTA 4EAHD 2E2PA 2XASA 1IN5A 5DUIA 2H27A 2IAIA 2HHWA 3QP6A 3NCIA 4BRHA 4CCLA 3AVAA 3OYKA 4N4OB 1SFUA 1H89C 1J9IA 3CO7C 3DAWA 1OVQA 2BW3B 1KTQA 2W6LA 3AVCA 1VSMA 4FVUA 1GLBG 1JE8A 3NAUA 3V9ZA 4UUSB 1JCGA 4BRLA 2Q3SA 3WXMB 3A2FA 2V7FA 4ITVA 4CGJA 1HXDA 4BDYA 2MH9A 3DLLL 5HDGA 3CP8A 1BBYA 1MA9B 2RKHA 3CG7A 3R0JA 3GO5A 4NB4A 4D1QA 2G9WA 2X1DA 1TWCJ 3AO4A 2NOGA 4IOCL 2XHKA 5D4RA 1BHLA 4ZJZA 4OKEA 1FSEA 2EA2A 3LDOA 3PLAA 1A6IA 3HP6A 4BXFA 2VBWA 4DV7K 3KZZA 3NGYA 2AQEA 4BQZA 1B8IB 1S3JA 3OOUA 1SFOJ 3NF8A 4FQGA 3AL0C 4IEJA 3TQNA 2E1OA 3OYEA 4LLGF 1Y6IA 3K1PA 4KRFA 3QEVA 2Y48A 1LE8A 5T7BA 1TYQB 4MFEA 1YO5C 2DO7A 3FDYA 2DJNA 4R1HA 4KH4A 2ZJQL 4IBNA 3ZYYX 1SEUA 4ILGB 1RPWA 1YJ9N 1BUPA 4BRNA 2ZO4A 4M3WA 3HC7A 5HRPA 3CC4N 2EH3A 2G8HA 3JCUC 2UV1A 4ISGA 2H1KA 3DLHA 4KIBA 4CZIA 2QUFA 2M0CA 2HOAA 1B1BA 4A57A 3J7ZI 2L0KA 1NGCA 5I3UA 1ZHFA 4FE7A 1CQTA 2DT7B 1LVAA 2IEKA 2R7RA 1T08B 4M7XA 4UB8C 1NKEA 3WTTC 2LREA 1ZTRA 4GGGA 2L9VA 4PDKA 1QQIA 1PJRA 4GCVA 4ESBA 3REOA 4DBQA 4KYWA 3WTUC 4FCYA 1HYVA 5EEAA 4B8AB 1WPKA 5E3LA 3W6JB 2JLEA 2HF4A 4BRKA 3JSMA 4A0ZA 1X1CA 5HLGA 3E5UA 4LOCA 3VQCA 1O7FA 1V5EA 3S2HJ 3JREA 4KAZA 1HDDC 4H4OA 3OYCA 1YX3A 2ZSIB 5FPMA 3HXLA 5H2FC 1JJ6C 4BACA 4C23A 3KYDB 4BE0A 1NGBA 4PJMA 3TAEA 2F4IA 5B66C 4PUSA 3LDPA 3ZT2A 4UUVA 1DPUA 2GEMA 4QS7A 2KRHA 4KTWA 4V2GA 1S1VA 2P9PA 2QCOA 3DLKA 1OR7C 1NU0A 1NMNA 2OU2A 1GLFO 1XMOK 3VOEA 1YHQI 1S9HA 2J5OA 4JLHA 1CXUA 4JQFA 1LW2A 1GLEG 3MXIA 1OCCH 2L9NA 1KQ8A 1HW5A 5F08A 4JRQA 3MMVA 4RW4A 3OOPA 3IKVA 3ABUA 3ID6A 1LDJA 1KD1O 4RW6A 3CLOA 3VOVA 4U7DA 4I6MB 1Q18A 2AO9A 3J7AO 4IDHA 3E9OA 2EJRA 1TT0A 4G6QA 3ENOA 2O8CB 2CJJA 3M8SA 2VT2A 1BL0A 4CICA 3P83D 3GTOJ 1B59A 1E4FT 3KLIA 2ELHA 4D5FA 4IOAF 3B02A 1V55H 2KIQA 3CZ6A 4BC4A 4DQQA 2JRTA 4BHBA 3THWB 2JWLA 3I8DA 1GLCG 3AO1A 4HPQA 1EH6A 3KLFA 3PX0A 5FRMA 3ITHA 2GX9A 1GT0C 4NLBA 4BC2A 4F3QA 3HUGA 5EEGA 4M3GA 3QWLA 3ZSQA 4CHQA 2G8VA 2M8GX 3HZ6A 2X9DA 2CV2A 3TP0A 1RT7A 1SKSA 3WTVC 3IRQA 1X3UA 4DIQA 3KP2A 1U78A 2IW5A 2PY5A 3CCQN 1X9WA 1X2NA 4AIKA 4OVLA 3T5XA 3O4QA 3MCZA 3OYHA 4DR1K 1SD6A 3KIOA 1JXSA 2XGCA 4HG2A 2QLZA 1ZG3A 2KKZA 4XRFA 2GM4A 3TAGA 1B9MA 3CO6C 2CO5A 2YSRA 4ESJA 1JLCA 3JTGA 4DNCA 2VKVA 1VQON 2EV0A 3VMFB 4N41A 3IAM2 3FR0A 4AC0A 3C2BA 4G8XA 3U2RA 2HU9A 1VSEA 4WCGA 4C8OA 1IKWA 3CUQB 3G1LA 3MN6A 1UHMA 3AG1H 2NLXA 2QA4I 4CJWA 3L3VA 1RTDA 3OR2C 5IOZA 3LWLA 1M1KO 2EWSA 3IRRA 4FW2A 1Y64A 5F0XA 4HBLA 4CGZA 2NS7A 1LW0A 4FE4A 1NM1A 1NK6A 2EILH 1WZ2A 4FK2A 4BRDA 2HQAA 2DPUA 2YCHA 3MWMA 3LAPA 3WEEB 2BXYA 3O9RA 3J7YJ 3CJNA 1WSHA 1JKHA 3EY1A 5JHFA 2LD5A 4XN0A 3G10A 4M7YA 5M5WJ 3DXKA 1TUUA 2M0MA 2UU9K 3B6OA 3M8FA 3OYLA 2I7NA 3SDBA 1ZRCA 5BPLA 3QPSA 4JX5A 1JHFA 1MH4A 1VQ4N 2F5EA 4IOAL 1IRFA 2DY4A 1TTYA 3ZMUA 3O80A 2BH1A 2JUCA 3CMMA 2E1YA 5E3MA 2PX9A 4Q5VA 2FE3A 3S41A 2QWPA 4CF8A 3E9PA 1X19A 4E89A 4PJJA 3ENBA 2TCTA 1Z25A 2PYJA 1GUUA 3SZTA 2HR3A 3QINA 1FK9A 2OTJI 2GIZA 1YW8A 1S29A 4RDUA 2K9SA 3M3ZA 1ASVA 2P1JA 1MGTA 3O9SA 1YI2I 2P9NB 1R36A 2KL4A 4XLPF 2BY0A 2DFHA 1IV6A 3M8QA 4BGBA 1U9NA 2L2OA 4Q0BA 2E2NA 1OKJA 2P9SB 3O5BA 2O8BB 4RB0A 3MXJA 1QZYA 2X78A 5J2NA 1Z0XA 2O7OA 3RPQA 2IVOA 1SS6A 1R22A 1I94K 2RQPA 1RCHA 4A62A 4CZFA 1S22A 1VQNN 2XROA 4Y15A 3ZPLA 1HOMA 4I98B 2FEZA 5TKWA 2OANA 3FXOA 5JLHA 1NGAA 2ATQA 3CJTB 4OWRB 3TW6A 3VQ6A 3SYZA 2NRRA 2JMWA 4ZYGA 4KHUA 3GTMJ 3OSFA 4XRSG 4K0KK 1O13A 3U1KA 4J01A 2VBYA 2WOMA 4ZYDA 1QSYA 4X66K 2VPRA 3AAFA 3I55I 3TSUA 3DKXA 1R5GA 1SZ2A 3P1GA 5M1QA 5HLFA 3VEVA 1FMVA 2R5ZB 1EO1A 5A2QO 1AKHB 4XBFA 3JSPA 3AY9A 3KK1A 4E6KG 2O8EB 2FLOA 1HA8A 4F9OA 4LG3A 3S1MJ 2HBLA 3FXQA 3BWGA 4ZDPA 3KD5E 3S2WA 3S15J 4YOUA 3NEUA 4PHTX 1RDAA 2XKOA 1BI4A 5BQTA 4PKGA 4DTUA 1ACIA 4HX7A 5BR8K 4CCMA 1IXSB 3GBTA 2BY1A 3FXUA 3ZX2A 2GQQA 5IYBJ 4N56A 3V4GA 5HS7A 3RMAA 3V8LA 2PMHA 2KIMA 2MW8A 3G73A 3AVMA 4HLXA 4XNFA 3ERMA 2X6YA 5EY4A 3FFKB 4BRMA 4F92B 4KTQA 1F43A 1U4BA 3SBGA 2JWTA 4IFYA 3DRRA 4Q47A 3WU1B 3VSKA 2DOEA 5D5XB 3DWLE 2EWNA 2GLOA 2KHMA 1JKQC 1ESVA 1VQKN 5KPTA 1MH3A 3AO2A 3SK3A 4Y17A 3L4QA 1OR7A 3TTFA 2P0WA 4MQ3A 4XLEA 1SUQA 1I5ZA 4PA1A 1G8XA 3QYBA 3SQ2A 4RW9A 1V4RA 3HI0A 4IZ9A 3S14J 5A2QK 2IJLA 2STTA 4KREA 3ZLJA 4JKGA 4IO8A 4LD5A 3KFWX 2P9LB 2BTFA 5KGXA 3CERA 4FLZA 2IP2A 2JPCA 3H3NO 3CCJI 3RI4A 4BC3A 1YTUA 2QBYA 1U6GA 2FMLA 1X2MA 3NF7A 4DTPA 3SJJA 4HV5A 2V9VA 3HRSA 1HKSA 2FBIA 1D8KA 2DPNA 4GDFA 3RKXA 1YOVB 3BROA 4J00A 2E1ZA 3OS1A 4E1JA 2AHQA 2WTUA 3KHYA 3LSTA 1IH7A 1OCTC 1X9SA 1GV2A 2AA4A 2WADA 4AM6A 4JEPA 3CF2A 3HPGA 4A3IJ 3CJQB 2X6NA 1WBBA 1FW6A 2HTSA 3QYEA 5AQRA 5EX5A 3JSOA 1IDYA 4IJAA 4E7SA 3UKGA 2UUCK 4II2A 2RE2A 3QIOA 2XRLA 2FBTA 1VQ9I 4Z6YA 2ZQBA 2W4SA 3LSIA 3RRHA 1YITN 2GXBA 1Z9CA 2FU4A 4B9QA 5ILVA 2O8DA 3JRDA 3SZ2A 3G71N 1QRYA 3W2VA 5FJ8J 4B09A 2JJ7A 3LSKA 4IDKA 4KB0A 3CCMI 4WQ4C 4NYNA 4W5OA 2BVLA 2QENA 1QZEA 1NK9A 4CJ3A 2ETHA 3VEXA 4Z4IA 3ZSWA 1F5TA 3I56N 1Q8IA 2MBFA 2ASOA 1D1CA 2QXLA 1W0HA 2YS9A 4B3TK 3F9MA 5KRTA 2CQXA 5BPIA 1YQAA 2IS6A 3J8AA 1KFDA 2OZSA 5DCMA 5J4VA 5C4JJ 4QIWN 2HF3A 2UXNA 3FBIB 2WAEA 2HKOA 2BUPA 2MC4A 2DFIA 4CJ7A 5L3EA 3HTVA 1DP3A 2ICWG 3WQUA 1YTAA 5TKYA 1UHSA 1YIJN 3SQ0A 1ZLKA 1VSDA 1DP7P 2NNYA 4IWVA 3ZR8X 3ZQ7A 3VENA 2X1CA 3MXMA 3CCSI 4FJKA 1E3PA 2E6MA 1KZHA 4WFBL 1ZR4A 1RTHA 4DWIA 5DYMA 2JA6J 3WT0A 4JI1K 1S1WA 2LRDA 3ZQHA 3V8JA 4A3EJ 1T38A 3GOIA 2KQ2A 4KMUX 3M1FA 1SAZA 4RLFA 2BYVE 5FLVA 3IS9A 4B3MK 2O5RA 4KKOA 3LANA 1ZBUA 4H5VA 3GFIA 4B3OA 4HUGA 1N5YA 2M30A 3QP5A 2LF7A 5TJJA 1HSJA 4M3DA 1MZBA 3HJFA 1HQEA 5CQGA 2IGIA 1HYZA 2FSWA 3R8EA 2HNYA 1TW2A 4YFNF 1SAXA 1N77A 3HDDA 1XS9A 5ILSA 4PWDA 4P9FA 3CQZJ 4A3CJ 1WSJA 2FX0A 2XGXA 3FK6A 2CW7A 4LG0B 4DG1A 1RESA 5DD4A 1HW1A 2HEOA 4OPAA 4BWJA 1G59A 1IRZA 4FX0A 1VQPN 2PAVA 2R7UA 3E6MA 4KPYA 2DPDA 1WBDA 2ZMEA 4OIQF 1Y0NA 1GVDA 2DI3A 3M8EA 5E17F 3QBWA 1LKXA 3MWTA 3BY6A 4WF9L 1BA0A 2GV9A 3P38A 2LR8A 3R61A 1YRNA 2E2QA 3ZT4A 1ZG1A 2ESNA 1NG7A 1H1VA 2QM3A 4K8ZA 3D2FB 1TQPA 2P9UA 2LP0A 1W5CC 1X9MA 1LFUP 3AGKA 1WLJA 4LD0A 4HSTA 1J53A 3ZCOA 3F21A 1RT6A 4MDBA 1B4AA 2E4LA 3D5SC 3PO2J 5EG0A 1YW9A 3FKJA 2R7YA 2ECBA 2NRHA 1JGGA 3LA7A 1VTNC 3CCEI 2BV6A 3BZKA 1JT6A 4FZZA 3GTJJ 3VPRA 4M6YA 1N25A 1SFEA 1FPQA 4B1RA 3SV4A 3MX5A 5GAHP 4YY3K 4C3JJ 2VGNA 3CD6I 2HGCA 3A2KA 3RCOA 4B3AA 1OKRA 3HOTA 3I4PA 5C25A 2IRFG 3S32A 2GELA 4QOZB 2GOMA 4IHWA 3K2AA 4CZLA 2E1NA 2VQGA 4LB6B 4DOZA 4M9ZA 1I6HJ 1S72N 1YW7A 5GTHC 1Q86O 1QE1A 5CHIA 1TBXA 3J7AP 2RDPA 3ELKA 4EP5A 3HPOA 3RPUD 3TO9A 4FWQA 4CZCA 4DFMA 3DP7A 2WBMA 5FLXO 4H0TB 4LIVA 3A0IX 1R5HA 3MKZA 3HGGA 2IGOA 4CH7A 4KA4A 2EZKA 1XGMA 2LF8A 4F52A 3SQ1A 4KN4X 4ASNA 1UELB 1O3RA 3H1CA 1FZPB 4NB5A 3K1NA 2L7KA 3ENHA 1SMYF 3T69A 5HDKA 4LC9B 2PLYA 2DA1A 3K7AJ 4KHQA 2HBKA 4BH9A 1FC3A 1G4DA 2Z9OA 1HSTA 3KETA 4DQSA 2EA4A 1FYLA 3ULEB 4FM2A 5AQSA 2G8FA 3LP1A 4CJ4A 4QLCU 3H1QA 3L2VA 3ZRGA 4FASD 3C94A 1M90O 1V5FA 3PV8A 4CFDA 2HVIA 1S6PA 2DA2A 2WB1A 4QS9A 3CCLI 2H6CA 4NHJA 1X4OA 1ZXOA 1KU9A 1TAUA 3HOZJ 4FLUA 1KYWA 1NGHA 5IT9K 4CF2A 2PJPA 1EH8A 3A5LC 4LF4K 4BR9A 4BQAA 3RIRA 4CZZA 3GWZA 2LTPA 3LNQA 2JA7J 3QAHA 1VRTA 5LGTA 3DU5A 3W0LA 5FLXK 4DV3K 2VE8A 4DTRA 1ZRDA 1GHCA 4IHSA 2R7XA 3I8BA 2Z5UA 4BQLA 1JJ8C 2LH9A 2CFOA 2NVYJ 1VQ7I 1C0TA 3E0JB 3AG2H 4H5NA 1Q1HA 3FZKA 1IV8A 3ZETB 4YNQA 3OS2A 2EFNA 3FMRA 4RW7A 2R7OA 2FF3B 3VEOA 1TL1A 1G15A 4QPOA 4BQQA 4PSXA 4CEEA 2FUG2 2ECCA 5AQTA 2E2JJ 1BQNA 3GBGA 2R7QA 4CD1A 3UIQA 2NVQJ 3NFAA 4MFBA 2O0YA 5LFAA 1LEAA 2FOKA 2YI1A 3E6CC 3SI6A 1ATSA 3KWGA 4NO7A 4KIGA 4XLHA 2CRGA 4AVZA 2L02A 3I59B 3VPZA 1T0FA 4YEJA 4A2UA 2Q2EA 1KONA 4M41A 5ICGA 3HPHA 2L54A 3BG3A 4DTNA 4HA8A 4FWRA 5E8IA 1KAYA 3GF2A 1I39A 4ZHRA 5J2PA 4BXXJ 5BN8A 3V7CA 1A5VA 1AOYA 2IGMA 2XHBA 2WV1A 1FBSA 3MK6A 4CJFA 4LFAK 4FOEA 2KZGA 4PJLA 4BNCA 4B43A 2HZTA 2MH2A 3VERA 4LY7A 3F73A 4LF7K 3KP6A 3SJHA 4CA0A 2XPUA 5IP7J 2Q97A 3UKUA 1U2VA 1BA5A 3M5RA 3ZSOA 1R1TA 3M6GA 4EP4A 3TSPA 3QEPA 2OAZA 3E97A 5F1XA 3C18A 5JI6A 2YHBA 3AVLA 4XM3A 2ZJPF 3HOSA 4JKEA 3K10A 3RSNA 4YOVA 3CJAA 3SAHA 1YHQN 1B72A 3AVIA 1BI1A 1F36A 2HFHA 5KAFC 3CC4I 1BOBA 3HRGA 5KVRA 3OJSA 4Y13A 5GAGJ 3LAJA 3OA9A 4AHSA 1FJGK 4DS4A 2ESHA 1KVCA 4WE1A 2EZHA 1LPQA 3M8JA 3QESA 3IUCA 3BEXA 4HNUA 4R79A 2KDOA 2YX7A 1OH8A 2J4RA 3KYCB 2HW3A 2HYJA 3S9HA 4AILC 2X6XA 3KEQA 3KZIC 3L3UA 3QU3A 2P5KA 3HL8A 4GYIA 1Z26A 3FHZA 2LBFB 5KQ8A 3PUBA 3ZSVA 1XDUA 2P81A 4E1NA 1WJCA 3K4KA 1QPMA 4B8CA 3I54A 4CGFA 4CSWA 1FEXA 3HHGA 4FYDA 4L3QA 1HKBA 4FK4A 1JJ2M 1EF4A 4WCEL 2NRXA 2CGPA 3TEDA 3JAMZ 4M6VA 1QVGM 2KHOA 5E79C 5JHUA 4OPKA 3VDXA 5CR4A 1TNSA 5I42A 3U3GA 2KT0A 4N9IA 2M1BA 3VF6A 2VLAA 1ATNA 4M9SA 1WJDA 3RMCA 4CK3A 4RGRA 3GE1A 1BCMA 3VYUB 2YU9J 3ZEUB 1RBVA 3AVFA 1HX1A 3GLLA 1J5EK 1QSSA 1XGSA 2CS3A 4OAZA 4U7BA 3THXA 2Q2RA 2NRTA 4CEFA 2K9LA 3QYFA 3G2BA 3EETA 1DT9A 3FZVA 2QA4N 2HDCA 3WNFA 4FPAA 1QU3A 4BEHB 2HQRA 2BBYA 2WFBA 2P7CB 3RPUA 3DQVC 3L7WA 4M74A 1YUWA 1XGOA 4BGDA 4PUOA 2ZJPL 5AIPA 3N4MA 5AQGA 3L00A 4UVBA 2W25A 2QKMB 2K40A 5E41A 2QWMA 4DR7K 1WFXA 1CXQA 3EQLF 1HR0K 3JTHA 4XIUA 2JT1A 2CGJA 3LDLA 2OTLI 3GEZA 4YDUC 3NWSA 3DKWA 2OD5A 2V51B 3L6QA 3HJEA 2XAQA 1G3WA 3HHHA 1CGPA 2EV6A 3C2HA 5IT3A 3EE8A 3HOVJ 2MA3A 2K3PA 3WHBA 3DRPA 4DTOA 5FKMA 4CW7B 4B3SK 2G7HA 4B08A 4JI0K 2VJ5A 5F0CA 1D8YA 4HLYA 4WX9A 3C7NA 1RDUA 4FJHA 5B3SH 3O9QA 4A5MA 5ED4A 2YHWA 4J2DA 4KT6A 1K8KB 2PBDA 4FX4A 4DF8A 1PP8F 2AXLA 2OA8A 3EYZA 4BJ6C 2PMUA 4BROA 3PQKA 3HOWJ 5C12A 1KSPA 4B9VA 1P7IA 5B1BH 4F7ZA 2KJCA 1RILA 2IGNA 1R4MB 1Z3YA 4H0OA 2L7ZA 3VQQA 2OC6A 1XQSC 4L0YB 2OTJN 3DXJF 2L5QA 4IRHA 5C3EJ 4HV6A 2A3ZA 1TZLA 3IH2A 5AIQA 3KP3A 1HBXG 1YI2N 5GINA 2F4VK 1USSA 2Q8KA 1XG1A 3Q9SA 4MGRA 3ZMZA 2DT6A 3KLOA 1P9QC 1Z3XA 4XQFA 1X1AA 1TK8A 2G8IA 2VODA 4EJTA 2WY7Q 2XF6A 3WNHA 4OLAA 2DK5A 4IZZA 1KLNA 3GZNB 3DMJA 3ISNC 4YIIA 4AM7A 1K4SA 4DTJA 1JUPA 3CUQC 2IVPA 1T6DA 3CJ7A 1XC5A 5J1EA 4HF2A 1L3UA 4A5BA 4AHVA 5KTQA 2F8SA 1KQSM 4FETA 1MDMB 4XMYA 1Q81O 1MJ9A 4KHSA 4XOTA 3WE2A 3HKZA 2A3SA 3I55N 1IGNA 1DTTA 3LOCA 2Z1HA 3CDHA 1P7JA 1X1DA 2DK8A 2IGKA 1TW3A 3LM2A 3K9TA 5L3GA 4JV5K 5AZJA 3A02A 4JRPA 1REVA 2PG4A 4C8LA 3LPUA 1N32K 4I09A 5IYDJ 2NS0A 2A6TA 2TRTA 2QEXN 1EKEA 2DJIA 2QWOA 2E6LA 2H8RA 1WNSA 2ADUA 5ADXA 1HLVA 4H4MA 3TO6A 2FXAA 3OIPA 4DZJA 3TDUC 4L18B 2Z99A 1K7AA 1F1ZA 4QTRA 2ZD1A 5E1WA 1JLGA 2V4JC 4G9YA 1WSGA 4R5PA 2E2OA 4Q4ZF 3BY5A 4IX7A 2M45A 4BR0A 4O5VA 3I0TA 3LZJA 3PFIA 4OIPF 1TC3C 5FKKA 2UYTA 3UB5A 3OWTA 4XICA 1FY7A 2UUZA 3DBHB 2CQNA 1ON2A 2GAUA 2X1EA 2QKLB 1D5YA 5K7FA 1ORKA 4IPAA 1JLFA 2BE2A 3TAPA 2P9PB 5C42A 2J5PA 1ZH5A 3IV5A 1IJJA 2A61A 2D0OA 1VQNI 2BEOA 3CQXA 4EV0A 5HLIA 2CFXA 3ERED 2HHUA 5BR9A 3JRGA 3CPWM 2P51A 5HVQC 3QETA 4FJGA 4H0VB 4HYEA 4XLAA 1NOZA 2XGEA 1C1AA 4XL9A 3MECA 1TP4A 4ZYHA 2P5GA 4H0PA 1FP2A 3THVA 3WTZA 2FRHA 4D9JA 4ELVA 4EJWA 1VF9A 3TP3A 1ZGAA 1J0RA 3KP7A 1D3YA 3U9GA 5KRSA 3T1YK 4FO0A 2XKPA 4N5SA 1XSXA 4XONA 2W00A 4IL6C 1ZG5A 1FT9A 3PSIA 4KUMA 2GIVA 4GVEA 1V3FA 1BOTO 2G8WA 1TKXA 2QWNA 1A5XA 1STZA 1LFBA 3VYRB 3RTRA 3HUGB 3R3LA 2VGMA 2ZJ2A 5DCFA 3FKIJ 4CJPA 3HOYJ 1IKXA 1VQ9N 1CF7A 2R4GA 3S3NA 4CCJA 3DPLC 2KZZA 3CI5A 2K3FA 5LMUK 4DR2K 2X6WA 4JKAA 2KMUA 4FPBA 4PCQA 3K2PA 3WODF 3PIPL 1OFCX 3GCMA 4E7KA 3PX4A 3CC7N 3THYA 3CCMN 5E26A 1VQKI 4BGAA 2EINH 2F4OB 3PFYA 5KI6A 3RSEB 3VTHA 1HDPA 2Z1DA 3B73A 4M71A 4XK4A 3NAEA 1OH5A 1YE9A 3BT9A 2QQBA 4A6EA 3HT3A 3U8XA 2M4KA 5EOYA 2A07F 4MO4A 2KLOA 4Y7NJ 1V4TA 3SUNA 4YORA 2KPMA 1ZAOA 3H35A 2PJRB 1HJOA 3LM9A 1ZARA 2CUEA 4PJNA 1LAVA 1RR7A 1OYIA 1L0OC 4F3TA 4ZTJA 1WAJA 2P9KA 2EK5A 2ZXHA 1ZELA 2K85A 5F1JA 2HZDA 3LL3A 1V54H 1YG2A 3ATVA 1MIJA 4M6XA 3T1AA 3SAGA 1KQ9A 3ASMA 5FFXA 4ZZLA 4YDUA 1MMNA 3CCSN 1JHHA 3GFMA 5EU7A 3G6EI 3T7ZA 1BQMA 3DXKB 4AHUA 3I0RA 1S1XA 3C6UA 4K8XA 4B1UB 4OGEA 1K6OA 5F1RA 4X64K 3CCUI 4KV8A 4OX9K 3NH0A 2E1CA 3MEGA 5HNFA 2MLGA 2QYOA 4ENMA 3L2WA 3DRSA 4ICLA 4DQPA 3AAQA 1WSFA 1FYKA 4J8FA 4FJJA 1VSLA 3SZGA 2L4AA 5BRFA 4DUZK 3E1SA 3AVNA 5AQUA 3D6RA 3BP8A 3MZ8A 2K9QA 4IHVA 1VQ5I 3QIPA 3NH1A 4DTSA 2PFBA 4BR4A 2LFBA 1VSJA 5J8CA 1QHHD 1D0ZA 1G99A 3A0HC 5FROA 2F5FA 3NWTA 2EZLA 2RVCA 3HIFA 2NOJB 4WK8F 2LG4A 2WV0A 1EJ9A 4A3FJ 1POGA 3ZQIA 3HM5A 3ECOA 4JI5K 3ZN0A 4WQ5A 5BRHA 1WAFA 4BRPA 2R92J 1J54A 2E36A 3A5MC 3HO1A 2ZBKA 4V19K 3W2AA 3O9TA 3AVHA 4JK9A 3IH4A 3BTCA 3GTQJ 2K27A 4BY7J 4G7ZF 4CYCA 2K9MA 5EJCA 3W3CA 2ZGYA 1BI3A 4F4KA 5KK1A 5K14A 4FLXA 4RM2A 1TLHB 2VKDA 3ZQQA 1HKQA 4B9MA 3K0LA 3EYIA 4BYYA 2EHGA 4NC7A 1QVTA 3K5LA 5EXWA 4A6DA 3I3LA 3CCEN 2MC3A 3F5TA 5FFZA 3HG9A 4W5RA 4H5TA 1HKTA 3FXLA 1VHXA 1FOYA 3CD6N 4WFAL 1J6ZA 1I1GA 2W24A 1UOCA 1BU6O 2JPBA 3V9UA 3Q3SA 4OKJA 2COBA 1S8NA 5ERIA 4HDVA 1FX7A 2D1VA 2YPRA 3H5NA 3MMYB 5C0YA 2AP1A 1BDGA 1RDBA 3OS0A 1T98A 1I27A 2VOOA 2FJ1A 3OYNA 4YOTA 3H1VX 1L5UA 1VFCA 3BGRA 4BRFA 1J75A 3MD2A 2Y30A 3H3ZA 2FA5A 4AIDA 4XN3A 3CCVI 2M3AA 2YX6A 5D8LB 2XSJC 4P9UA 3AG4H 2CQQA 3R6SA 2GWRA 2LMDA 3BPXA 1BCOA 5AQMA 1Z6RA 5EZGA 3VEWA 3G1MA 1GOBA 2LNBA 4OO1J 2IA1A 3SEQA 2GA1A 2A6EF 3CYMA 2B5JA 1HF0A 3CQYA 3E6BA 4XH1A 1O57A 4L8RB 2CV1A 1TV6A 2P5LC 5TGTA 4DBRA 3ISPA 3F23A 1PUEE 1U9OA 2K4BA 4L5EA 3HK2A 5L3BA 2XC7A 3L2CA 4I2OA 1SAUA 4X0GA 3CXCM 4UY8O 1LDDA 3OYGA 3T1HK 4NYFA 4KDPA 5F0HA 2PN6A 4DSEA 1QPIA 2XPWA 2D0AA 3A1YA 2IS3A 3OMYA 2JWKA 3LDSA 4ZZDA 1SKWA 3V9SA 5D6FA 3N97A 3KK3A 4YELA 1XSVA 4BQOA 3CCLN 2TDXA 2E7XA 4J19A 3I71A 2P9SA 2RKIA 3K5OA 3MCPA 1PDNC 2W85A 4CZKA 2L9RA 2O8BA 4CECA 1FP1D 1JTXA 4KBOA 3J80K 2QBYB 1RBUA 1VSIA 2EIJH 3N4PA 1ODDA 3WTXC 3O08A 1WSUA 3OBWA 3OR1C 4YHHK 3CJCA 2XUBA 1ETYA 1OPCA 1L3VA 1ZBIA 3BG7A 1UG2A 3J81O 1OQYA 1BG3A 1O3TA 3K0SA 4OLBA 1XMKA 3FMQA 4PJ0C 3ZQLA 1B9FA 3C2GA 4RAGA 2GUIA 4HSRA 2BHZA 5AFUA 2YNIA 3VEZA 4GYGA 4MFDA 4HUFA 1K78A 2Z2SB 2Y9YA 1BJAA 3PUFA 1AKHA 3DLEA 4AWXB 4B3XA 2UXXA 3MQ0A 1LDKB 1HJRA 4FVMA 3V7RA 3IHUA 3H0GJ 1HNZK 4GKKK 5LGNA 4LFCK 4ENNA 4FJLA 5D4SA 4I02A 1VQ7N 1SV5A 2XSDC 2FQ4A 1SKRA 2O8DB 2ETJA 4D7MA 4JI3K 2XIGA 3FZMA 3H6EA 1N8RO 3KE2A 3LSGA 2A6AA 1YJNI 3QFPA 5MLCQ 2ZXJA 2M8EA 5BMZA 3AA2A 1UCRA 2NZTA 3D7EO 4L9JA 3AVBA 1KYZA 2DMQA 1JUMA 1BA1A 1E3OC 4RGSA 1BISA 3TPQA 5LBQA 1ENHA 1WH7A 3ABLH 3VQDA 4V19S 2LK2A 4M73A 3S16J 2I8DA 1XI1A 3T1BA 4DQ8A 3GTPJ 3VSLA 4KFBA 3P31A 2F2EA 3J81K 4NLCA 5DCMB 2JRMA 4Z4EA 1QO0D 4JKHA 3SQNA 4AD9A 1VAZA 1S9EA 4FOIA 3FXRA 1KU3A 1J5OA 3MFKA 2VWBA 4OKKA 2Z3YA 5JS2A 4EEFG 2O8FA 3O8MA 3VA3A 4HDUA 4EQQA 1HC8A 4WXDA 2A5XA 4CF1A 1HW2A 4N9HA 3BUZB 2GXGA 1IO2A 2XAUA 2GBYA 3A0BC 1G3YA 5JVGL 4W5NA 4FWNA 1YXQA 1LWEA 4LH4A 2FBHA 4U0WA 3RTVA 3HVTA 2QQ9A 5EVZA 1YLFA 4BR7A 3JRHA 4X62K 1R6RA 3S1RJ 3MZHA 3CHWA 1UG0A 2HHXA 2RREA 4G6DA 4YG2F 4DKWA 4JX4A 3KYLA 4DFPA 2XV4S 4XKVA 4A3BJ 1VSKA 5HROA 4HX8A 4A3MJ 1WRJA 4FK0A 4JD2B 5ADXH 3KP4A 5FD5A 3SEZA 5GADP 5F0FA 1PP7U 3IG1A 2XRNA 5BREA 3VQPA 4CF9A 3KD1E 1BIAA 5BS6A 1TWFJ 3Q0VA 3U6FA 4FLVA 1IG8A 2PI0A 1IZ1A 4GKJK 2ME0A 4C2MJ 2Y0SN 4BHPA 3RYRA 1BI2A 4ON0A 4CIEA 4DSIA 2ZMEB 1KAZA 1YFHA 4JOMA 3CM6A 3O1BA 2GA2A 2M34A 4PGGA 3WXKA 3FBNB 2XRIA 4FJMA 2HPIA 3OYAA 1YVNA 4W5QA 3L1PA 2R7WA 1YRNB 1UWBA 3O4WA 4J2AA 2R5YA 2P9UB 3T3FA 5IY5H 3LSMA 4H4KC 3OYJA 4J2BA 4O44A 5HS9A 1MBGA 3K57A 3LP3A 2RPIA 5GAEP 1SFKA 4E70A 4KHPK 4CJRA 2V1XA 1K8AO 1ZR2A 3SAFA 5EG0B 3Q0WA 4CK2A 5BOXA 4BHCA 2VG5A 3FF5A 1W7PD 1SVMA 4KHNA 1LUJB 3SMPA 3WGGA 2ZXIA 3RQ4A 2D45A 2YNGA 2QSHX 1UHWA 5DUKA 3JYTA 5IOYA 1CZBA 2EB7A 3H5AA 3T19A 4E7HA 3LWMA 4RW8A 2VWJA 2YKMA 1K4TA 1U5TB 1RBTA 5KGWA 3KLEA 2XB0X 1XNRK 4GV9A 3M3YJ 9ANTA 1ETOA 5B8HA 1NJXA 1OJLA 4B3RK 1TVRA 2OPRA 3ZMTA 1IW7F 2VXDA 1L3TA 1UB9A 2L7MP 3NVMA 3CCRI 4A69C 4GFBA 1HNIA 3CDLA 3F6VA 1LOTB 4UB6C 4NCBA 2B9SA 4PKIA 4DR5K 5L3FA 5AQLA 2P7VB 5HS8A 1MU2A 3ZQCA 5CZ1A 2IXSA 1NG9A 4A61A 2G7UA 2OTLN 2B0LA 4CHOA 1JKRC 4XR6A 1VQLI 3DF8A 1NGGA 3V9XA 4CJUA 5JR3A 2L3DA 4GV6A 4WYBA 3S2DJ 1HCRA 4WXCA 2DU9A 3K6GA 2YU3A 4IEIA 3U4LA 3P9CA 4CZEA 2VJ4A 3ZMVA 1RT3A 5EEHA 3ZSXA 1Z6TA 4HOBA 3HRUA 1RC9A 1UA1A 5M1FA 3CFPA 3WG9A 3V1QA 3E5XA 1LCUA 3HSCA 3ATUA 1EXQA 4KB1A 4I7HA 2RN7A 1IXCA 2HTJA 4C1NI 1OLTA 3A5NC 2NVUB 4BKXA 4A2AA 4IF4A 4MDAA 3BR3A 5M3FJ 1JKPC 4DZPA 4AHCA 2ZNYA 2O8KA 4E7IA 2DYSH 3K1MA 4JHDA 1W1WE 3PO3J 2W82A 3K4CA 1BC8C 3PNVA 1SVOA 4M45A 2A41A 4YOXA 4S0HB 4M3TA 3O4NA 2HS5A 1ULYA 2VPLA 4BDPA 2DA3A 2YHYA 5J47A 2XPVA 5GPAA 3BJAA 3ZN1A 1AA7A 4NXMK 2CUJA 2VBXA 4M3UA 5AJ3K 2Q0OA 2XY5A 3KEYA 4JKFA 3K4LA 2KRCA 1D5VA 4A5AA 3OYIA 1QZZA 4HZFA 3F8MA 4E0DA 4LH5A 1F21A 1H0MA 1LJ9A 5DTDA 4OINF 2X85A 3K70C 2HYGD 1REPC 2MYSA 4DS5A 1EV7A 3CUOA 4ABZA 3C95A 4TSXA 2LSOA 2W41A 1C0UA 3VQ7A 3VGLA 3UKRB 2D4WA 3C65A 1FOKA 4MO7A 2MD0A 1U2WA 3JR9A 2JSCA 4XRMA 3F0CA 3MCAB 3EYYA 5JICA 2A1SA 3FWEA 3GDQA 2YX4A 1X1PA 3TABA 3IKTA 5JS1A 4E7LA 3P39A 1NK8A 1K83J 1IF1A 3V1RA 2V1NA 2GZWA 1RUOA 3SUQA 5ICCA 1GXPA 3LZIA 2Z1IA 4JI2K 2XF7A 1TAQA 1NHAA 2ZE2A 4UXNA 3DWLA 2R0QC 1ASUA 3EE9A 4FHTA 1E0EA 1IUFA 3QU6A 1FXXA 3BJOA 3A01A 1Q1VA 5C24A 1W9HA 3W6KB 1YT3A 3LP2A 5HLTA 1OH7A 3KPHA 4PKHA 3L2UA 1U8RA 4CBWA 2HQNA 4CGGA 5LLQA 4LITA 5F27A 1EA3A 3LQRA 3FMSA 5M1OA 3UKUB 1FIAA 4BS9A 1WJAA 2KISA 3ROUA 3RZDJ 2DBBA 1FKOA 1Q9XA 5K5RA 3NH2A 4C9YA 5CVIA 3ABTA 4Y33A 3MWPA 2ZKZA 1AHDP 2XB5A 4QAGA 4UV9A 1ZKGA 5A2QZ 3R6MA 4O8UA 3OV8A 1B72B 2Q31A 4MQVA 4CHNA 2K9NA 2IT0A 4BL0B 1HPZA 3I4NJ 3ZT3A 4L9VA 4EM1A 2M2EA 1JCFA 5AZIB 3TGNA 3OSGA 2Z1JA 3O2PE 4DMNA 4FLTA 1WUAA 1GDTA 2LDUA 1XTAA 3FXJA 1VRUA 2NUBA 2QQAA 4Y1CA 2N8GA 5HRNA 2FNAA 2YV0X 3LL7A 4RMNA 4ESFA 1VSHA 4DU3A 5BPMA 1ETXA 2VQFK 1U45A 1IRGA 3D5RC 3UE5A 2GUPA 1RUNA 2QEXI 3F8CA 2YJFA 3H46O 4LB5A 3S3OA 3GUDA 4I99C 1QQMA 3MN5A 3EPZA 3RYPA 2DW4A 2XF5A 4A59A 4CZJA 3TWHA 4XORA 5F2RA 4MHGA 1D9FA 1NK7A 1ETVA 1KFSA 3FZFA 1NGEA 1A04A 4JKDA 4GO1A 4ZH4F 2X6OA 4M3ZA 3P4IA 2HHQA 1A5WA 4FJIA 3SV3A 3EZ5A 5AQFA 4FT8A 4I2PA 1JUSA 3QPTA 2XY7A 1IN4A 2FXUA 3LAMA 5EYRA 1Q82O 4XLCA 2EQRA 3SHFA 4DQRA 2Z16A 1TL8A 2JQ7A 4BWMA 3WXIA 1ZBSA 3KK2A 3D2EA 1GLNA 2D1HA 2IIRA 5LHIA 4IXCA 5CQEA 2EZIA 1Y8QB 3WU0A 2VWKA 3ZQGA 2B7EA 1W7PA 2Q1NA 4DLEA 2VC1A 4Z4GA 3M07A 1HNXK 1WHUA 4QPQA 1OCRH 3GVAA 1BI0A 4JX6A 1H8AC 4K43A 1P4XA 3PJRA 3A8YA 4UQGA 3THXB 2M7BA 3CJRB 2Q0RA 5CLSA 4O3MA 1ZBHA 3D1NI 4HQMA 5H20A 4KH6A 3GFLA 3I58A 4ILJA 1E3HA 1XC3A 1G3SA 2OV7A 4DF4A 5AFUH 3BDPA 5B1AH 4MQ9F 5DV5A 2H1LA 4B9SA 3QOEA 1JLQA 1LFPA 4F2SA 3TW7A 1X1BA 2DA6A 2F5CA 4EJVA 3FM5A 5E3OA 1NKBA 4RGUA 1JLBA 2KW4A 1R58A 3TAFA 3KKSA 1HNVA 4BC5A 1IDZA 4L5JA 5CZ2A 1D1BA 1D5AA 3HM9A 2ASMA 2QSGX 2F9WA 4FWSA 3KP5A 3GYHX 5CJ9A 4HCBA 1MJBA 5BN9A 5J1YA 3G6EN 2AS5F 1FMWA 1P4WA 1GOAA 3J7ZO 3CCUN 3VFZA 2WWYA 3F2KA 4Y52J 1Z91A 1C0GA 3HB9A 4DV1K 3VODA 3C7NB 1S3XA 3B6CA 4BJTA 1MMGA 3OY9A 2B63J 1ITYA 1EWRA 3E9LA 4Y4RA 3M9AA 4JKBA 3EEQA 3K4MA 2VCPA 2PEXA 3LMMA 4JS5A 4CDGA 3PO5A 4PGHA 1J2XA 3CC7I 1VQ5N 3M8RA 3OIOA 2VJIA 2F48A 1G3TA 2VQEK 4YFUA 3S17J 3F72A 4W5TA 2H3GX 2HKXA 1YIOA 3N05A 1IBMK 4B9UA 2MABA 2NRWA 4NDLA 1JL1A 4IXAA 4IQJA 3DCFA 1MNDA 1HLUA 2P6TA 3RWUA 1B92A 4E1MA 6PAXA 1SQKA 1BIBA 2RF2A 3H08A 3K5MA 4RAYA 1SL2A 1RTIA 4OMZA 4K42A 1UZCA 2ITGA 4HVJA 3BZCA 1XN7A 3KK7A 2EIMH 3DU6A 3KLHA 3BG6A 5LJWA 1XNQK 5DD8A 4B1VA 1YVUA 2OCCH 4DV2K 2Q0UA 3OVNA 2ZJQF 2BANA 2CWEA 3RMDA 1W2BM 4V2FA 2A42A 2BZTA 3ONQA 5CE3A 1NNEA 3K58A 2E20A 4IFEA 1RETA 2HDDA 3IRXA 1IN7A 4HAMA 3W3DA 3K2ZA 3N4QA 4L9NA 3IKMA 4CEBA 3NHGA 5AZJB 4OAYA 2VONA 1IXRC 1E3MA 3EZWA 4HCCA 4CEAA 2C6YA 3H36A 4ANJA 5BNGA 1ETQA 4RA2A 3DTEA 2F7TA 4I0BA 2Y1IA 5CPRB 3L09A 2HXIA 1YS7A 5AR0A 5EDNA 5F04A 4RM3A 1J9AA 3JS6A 4EHUA 3CCVN 2P4WA 1YF5L 1QVFM 3TOBA 2ZB9A 1YJWN 1K8KA 1BJZA 4DFKA 3TTDA 4CFBA 1QQNA 3KX2A 1XPXA 1TWAJ 2OZUA 4CERA 4CJQA 3DI6A 2B6AA 5FO5A 1QA6A 4D0PA 1F4KA 3PNYA 4Z4CA 3G25A 2VL8A 4BAYA 3L9FA 4IEEA 2UXBK 2O4GA 1LQ1A 1F9NA 4GRIA 2QI2A 1XWLA 5H1SQ 1DEJA 1KXPA 4BG9A 2IAJA 2DXIA 4AQYK 1R49A 1Z77A 4L9TA 3IAS2 2NS8A 1IC8A 4ZTFA 3WXLA 4LK0F 3QBXA 3ESWB 4LFBK 5DK5A 2QWWA 4C3HJ 1NOYA 4IG3A 5IT9Z 2DT5A 2UZKA 2XAFA 2P8TA 4RB1A 1S5JA 3FZLA 3K9JA 5C2FA 3QEXA 4ELUA 4MTEA 1ZK8A 4Q48A 2ELJA 4A3GJ 1OYYA 1X4PA 4A3LJ 3FFIA 5FLXZ 3TU5A 1ZLJA 2BGCA 2P6SA 4BBRJ 3LFKA 1NGDA 1R59O 1H9TA 1MDMA 5AQPA 2DTZA 5IT9O 3CQ8A 4FL9A 4MLOA 3P9KA 1ERDA 5D6EA 5LRRA 1KGSA 5LMNK 4C1NK 4XKBA 2CH5A 1QVUA 3F8FA 3R4KA 3GTLJ 3K4BA 4ENJA 4E7JA 1AU7A 1CF7B 2WA0A 4QCLA 2I5JA 4D7NA 2IOCA 4HF0A 2QQ8A 4JYKA 2CMPA 1B9NA 2FBXA 1U49A 1U8BA 3H9QA 2YUSA 4CCNA 1T7PA 4KFCA 1U48A 4O0IA 2MSYA 4LIUA 4H0EA 4JN4A 3LALA 4AM3A 1RT1A 3J7YP 2E35A 4EFHA 1U47A 1RR8C 3ZMSA 3THYB 5BPNA 4RCHA 1YJNN 3EKSA 1EWQA 4DGWB 2WAFA 2V79A 3EL2A 4CUGA 4BQNA 4A12A 2JA8J 3FM3A 1TKTA 2YHAA 3QLHA 3E66A 3IDHA 2F5DA 1W36D 2MLKA 2NVTJ 5M1PA 5LHGA 3DTKA 3MAQA 5LEKA 4FJ9A 1WWXA 1VSFA 1HQUA 5DDGA 5HODA 1W36C 3CFRA 1XSDA 5EGOA 5JVHL 4JI6K 2RHKA 1E17A 1KU2A 1XUPO 2GBZA 3SZPA 1P90A 4K2EA 3RZOJ 1SC7A 3DEWA 4DLGA 2P9KB 1FWZA 4XRSA 1TK0A 3COAC 2CUZA 3B8AX 4RWTA 5C44J 4O6JA 5CYMA 1XC9A 1R7JA 2D0CA 3QPHA 2WUSA 3F9KA 1QGPA 1S5LC 4IFVA 3GMEA 3NE6A 4CHZA 1BN5A 4DYRA 3FLCO 2VASA 3BJ6A 4DYQA 2VYPA 4MNUA 5DM7F 4OGCA 1SMTA 4IJNA 5TISC 1BR1A 3WE3A 1J59A 1XHZA 3BC8A 3DLAA 4NC6A 1RNLA 2JUGA 3EUAA 3H45C 4S05A 3NF9A 3KLNA 5FPEA 4G7OF 3CPEA 2DFEA 4I9LA 5HNHA 1R0AA 3BLYA 2HOTA 1EETA 1YS6A 5L3DA 4CHPA 2ZFUA 2NRVA 3DOLA 3LA3A 4WQ4A 5M5XJ 3ML6A 4AF1A 2DA4A 2XAGA 4FLWA 3T0YA 4CZMA 2M4GA 5E84A 4I7FA 2FF4A 1T39A 4ELTA 2Z1GA 1BO5O 2P5VA 1K61A 3W6VA 3IAYA 2D2WA 3O3KA 4CIFA 3KVGA 1ZN2A 4FSVA 5GAHJ 3AVJA 4DTXA 2XY6A 3L2QA 3S1QJ 3P5JA 3R60A 5JLFA 1T2KA 1I6XA 2LVSA 2D1KA 2JVHA 4JI4K 1HYSA 3RSEA 1APLC 3WTYC 2KRFA 3BR5A 3OHRA 4NBQA 3EN9A 4AU7A 3QPLA 3V7SA 1WJFA 2IC3A 1DDNA 5CVVA 4CYCB 1W4MA 3NMUA 2H09A 1I1SA 1KRPA 1JLAA 4IHXA 4W97A 5C4XJ 3BR0A 2V6EA 1FJLA 3AV9A 2VXZA 1S1UA 2F96A 3E1YA 1ASWA 3KWIA 1JGSA 3DM2A 2HXOA 1OCZH 4EZ6A 3GX4X 4I76A 1QQOA 2PJRA 4FJ7A 1BR2A 1VQMI 4ID5A 3ZXSA 4FWOA 3DXMB 3EUHC 3HGYA 4G1QA 1XX5A 4XOPA 4CCKA 4HTLA 5GIPA 3G3ZA 2LY1A 3NGIA 2E1MB 5IWAK 3L8BA 1L3LA 1XGNA 3BTIA 1IAWA 5C10A 3DTIA 2GOXB 2H94A 3ULQB 1W5TA 4HW0A 3RJPA 3HRMA 1MSFC 1J5YA 3GZ5A 2LY9A 4CCOA 2VG7A 1KVBA 3VQ9A 4DQIA 5DM7L 1NJIO 5LEJA 1P92A 1MMDA 2AXTC 3HBLA 1IUYA 4FM1A 3I33A 3CCRN 1FSHA 2VQCA 2ID6A 2V9PA 4U0VA 2D0BA 1XDSA 3I9V2 2A05A 2RV8A 3SJMA 4XLFA 4WF2A 1ATRA 4F93B 3QQAA 3WGHA 1VQLN 1IKVA 2E88A 5LJVA 1NJZA 1OISA 2W42A 3F22A 2ISYA 1N75A 4XKCA 1ZGWA 2F9TA 3QICA 4FWKA 2HSTA 3DPTA 3WTWC 2Q36A 3HM8A 4C2UA 2DDAA 3OL4A 3TARA 5CVRA 5D5WB 3L2RA 4ZC3A 1MKMA 5FLMJ 1NBWA 1HKGA 1I3AA 2ZXWH 3DEEA 3E6DA 2ZMEC 3PO4A 3E7LA 4O8KA 3IH3A 1FNNA 1ETWA 4NCAA 2LC2A 3OW2M 1JKOC 4M3XA 2Y31A 4QSHA 1GLAG 1RRJA 3BCAA 3TMOA 4GXOA 5K5QA 4I01A 2HHTA 4RG8A 1NK4A 5HRSA 1O7LA 3CCYA 2YNHA 1OYWA 2ME6A 4KHWA 2CGLA 1N34K 4CJKA 3CJ1A 4RLQA 2WC9A 2UUBK 2JA2A 5HRRA 1T56A 3R0AA 3V4IA 1FYMA 4O55A 2DMPA 1WI3A 1QQCA 4YOWA 1NK3P 3TTCA 3WNGA 2YHXA 2KJBA 2IA2A 1RDWX 2K86A 1HKCA 1BR4A 1KU7A 1OH6A 2W57A 4GMJB 4CD3A 1K78B 3CMEI 1BGXT 2M9HA 4YRVA 2KIFA 4XIDA 4WXHA 4LGWA 2L4MA 5FD6A 4FJXA 2R7FA 1E4GT 1DKGD 2V1DA 4M3RA 3OYMA 1ZQ3P 3HXMA 5FKLA 1U5TC 2PQ8A 2KZVA 1PUFA 1ZREA 3OJUA 3SLCA 2IS2A 2QWLA 5FPDA 3SUOA 3E5QA 4II3A 3CC2I 1ETKA 4E19A 3F8BA 4DV0K 1C6VA 3BG9A 2V9KA 3FX3A 4DV4K 3I4MJ 3O3HA 2RC4A 4BRAA 2JSPA 1VQ8I 2B4JA 1RFQA 2FBYA 3G4SN 2P9IA 3BQZA 3LFUA 4FTHA 5FKNA 4OJRA 1MBHA 2DODA 5KAIC 4DTMA 3AA5X 1O3SA 2KP6A 1VI0A 2PMZA 4JKCA 4OOIA 4JI7K 5GPCA 3HYFA 4CGIA 4KMFA 4DR6K 4MEYF 2VQHA 2PYLA 3L4IA 2HNZA 3BF1A 4RAFA 5AQQA 3GTKJ 2BY3A 5HDNA 2HMPA 5B5EC 3AKZA 4MO5A 2OF7A 1WJEA 1VK0A 4EJOA 4LJZF 1Z7LA 2O8FB 2X51A 4F8RA 4O5FA 3C0BA 1N6QA 3VEYA 3QNOA 3SYTA 4EZ9A 2DN0A 5AQNA 4EGZA 2O6GE 4DU4A 1XCBA 1XCVA 4Z4HA 1QZ5A 3BDDA 1LE8B 5HOOA 2BGGA 4ISFA 1ZYRF 4BU2A 2EIKH 1CZ9A 4NQWA 2GTDA 4DV6K 3IUOA 1OCPA 1BW6A 2KTQA 2HI3A 4F55A 2W1OA 4DSKA 1V5GA 1TKZA 3V81A 1JXBA 2YJEA 2KFZA 4EM0B 3DV8A 4Z2YA 5E1XA 4PZJA 4FZXC 2BHYA 3ABKH 2ZCWA 1NMDA 4JK7A 2LKPA 1IN8A 4KICA 3GXOA 4FISA 3SPYA 3QB0A 4EIAA 1W97L 4U67L 1VQ6I 2IPQX 4ILHA 2A6HF 3MKYB 2Y69H 1U6ZA 5CYQA 3BR1A 2BY2A 5M5YJ 4RB2C 3D0SA 1H88C 4RBOA 3Q7CA 5CY4A 1W5SA 5E20A 4RB3C 1NK5A 1FTTA 1S9GA 4HTUA 2VOPA 4LF9K 3DLBA 2V1UA 1RT2A 1IBLK 3UNGC 2R5YB 2BW3A 1T03A 4UNOA 1N78A 1RKTA 4UUSA 4X65K 1BM9A 4WFNL 2QK9A 1O1WA 4CHUA 4HNVA 3LSPA 1KCFA 1T0FC 3TANA 2Y1JA 3EUHA 2IS4A 1DLOA 1LWFA 2BE5F 2FSJA 1K6YA 1QNTA 5M3MJ 3O6BB 4JI8K 5F64A 2E71A 1H9GA 5E3NA 1Z67A 2CW0F 4UVAA 2RNJA 3QMLA 2HPMA 2QVOA 2CH6A 3ZSZA 5ICFA 3SDGA 4CGDA 1B6AA 2EFOA 1B8IA 1RGIA 3RR7A 1R9TJ 1M1EB 1ZBLA 1HRHA 4CK1A 1BWFO 5KPRA 2VQLA 2FMYA 2FBVA 4I0AA 2STWA 1TYQA 3VQBA 2CU7A 1MBJA 4JK1X 5HBMA 2XGDA 1WKMA 2G8KA 5DEQA 3RQIA 3JRIA 1RTJA 1JTYA 3H92A 2Y2ZA 3U3YA 3H3UA 5D8KB 1FBUA 2CSOA 2M87A 4JD2A 4AHRA 3QNNA 3WG7H 3T8RA 3WGIA 2WB1N 4PY5A 3HSFA 2GWKA 2OCEA 3B6AA 2O9LA 5JFRA 1RDDA 4M3BA 5K7HA 5ILUA 2CUFA 5E8GA 1GLJO 1U0JA 2HYFA 4CVNE 3ULDA 2H8WA 2YNFA 3VQ4A 4W1UA 2UXDK 3D0PA 3SPZA 4LF5K 2RNGA 2H6BA 1EX4A 3RMBA 5M1KA 2R7DA 4YIRX 3HSEA 4EJUA 3OYBA 5GIOA 3V9WA 4IQ4A 2DCEA 3SFIA 2LY2A 2EBIA 2PBIA 4B1XB 2E34A 4N47A 1UMQA 3VYSB 1AWCA 4BJ5C 4XH4A 4L0ZB 5J1UA 1BC7C 4JHDB 4WWCA 3QO9A 3RR8A 4JBAA 4A3DJ 1P8ZA 4BUPA 1IG7A 5E1ZB 5AQOA 4BXUA 3K9KA 1KLMA 4GNIA 4Y0WA 3HL2A 3VQ8A 2VJJA 4P55A 2M5WA 2Y0MA 3HP9A 2CW8A 4AYBA 3CESA 3Q5FA 1MSEC 4M63C 3WUHA 4XEIA 4R8HA 1R5ID 1S7OA 5AQVA 4A0XA 2VKHA 2QXFA 3BR2A 4AVPA 1QSLA 4AIHA 5JMVA 1U5TA 4FWLA 3H9JA 3E3VA 3ZMDA 1P4AA 1Z21A 4EVIA 5CVJA 4I6MA 1RI7A 2L01A 2WAQA 2ZF5O 2A69F 3VYTB 4GY2B 1Z05A 2IA0A 2FOWA 3RKYA 2E2HJ 3LA2A 2O8CA 4U88A 2QWQA 3ZT0A 2QKBA 3QODA 4OIOF 2ASPA 3WNEA 3QEWA 2VI6A 3Q9VA 3BPVA 3U1DA 3MN7A 1TGOA 3THWA 1CLQA 1ZBFA 1SD7A 1UJ8A 4KJZA 1TQMA 3I53A 5LY3A 4DSLA 1IJWC 4BR2A 2V6CA 4CCHA 4I9QA 5GAGP 4FM0A 4I6ZA 1X58A 1R1UA 4BE1A 4EATA 1A36A 3A01B 3SFZA 4BRCA 1DPRA 1DUXC 1XMQK 1TQIA 3VGKA 4Z4FA 4BRGA 2I5UA 4CFAA 1E2XA 2ZM6K 4PFOA 4Z0UA 3CMAI 3GFJA 3AL0B 3M1CA 3BG5A 1XD7A 2QW9A 1NJYA 1UFMA 2VUMJ 1MDUB 5HP1A 2QZ8A 2R7TA 3RKWA 2DQRA 1N36K 3P7NA 1D8JA 1Y1VJ 1TL3A 1LNWA 2F6CA 4B48A 1C1BA 3CUQA 4M42A 1I50J 4YFXF 3QFUA 2MGQA 1RKWA 4CEDA 4PK4A 2WBNA 1NGIA 1PYVA 3H5RA 4RAZA 3J80Z 2A5YB 2CH0A 4DCHA 4DB3A 3M1EA 1DGKN 2V7YA 3DBRB 3LQQA 4BREA 2WC2A 1C0WA 3BTJA 3WEEA 4DW6A 4CHYA 4FJ8A 3O3FA 4N76A 3W2WA 1QHTA 3J80O 3EKUA 4YOYA 4IG0A 5L3CA 4G9ZA 2NYXA 2OZ6A 5AQXA 3I5UA 3UKRA 4OPHA 5HL7L 3PL8A 3LDQA 2HNDA 1BI4B 1Z1DA 2Q1ZB 4PQUA 2JTVA 4JAXA 4BR5A 1T6CA 2MG4A 4ZYEA 3QOPA 4O0JA 1IKYA 2DA5A 3FXMA 5DMRA 1Y39A 2Z33A 1OVYA 3TOAA 2LKXA 1YJWI 2OPPA 3CLQA 5DS9A 4B1WB 2HWVA 2VC0A 1RBRA 3G1OA 2A40A 1IN6A 1JCEA 2OQRA 3AA3A 3OYDA 2MD5A 4BY1J 3RRGA 3AO5A 1R4NB 2HBMA 3D2EB 2JA5J 4CYDA 1D1AA 4ZDOA 3DJCA 5J2MA 3MEXA 2L9SA 4XKWA 1W7PB 1SVLA 5FDLA 2OZMA 1XHXA 2K7LA 2HHHK 3HOXJ 1DGRM 3MVPA 1C0FA 3VTIA 2EFPA 2P9NA 4N4NB 2OJED 2O8XA 4AH9A 5J2QA 5DM6F 5H6RA 2K4JA 3GLXA 3R9PA 5HLHA 3J81Z 4X1EA 3SMSA 4JKGB 4BVOA 3K59A 4KN7X 1RZ4A 5FPNA 4G94A 4P96A 3TAMA 1ITGA 2FSNA 2Y75A 3D45A 3S8PA 3S3MA 1SD4A 4M9XA 3HZJA 3H9GA 3C3WA 4C3IJ 2OPTA 1A5JA 4DSFA 4CF0A 1HMVA 3GW2A 3VWBA 3C6AA 1YJ9I 1WSEA 2BXZA 3H3VK 3AG3H 5AZIA 5AQWA 1DTQA 4LFUA 4UV8A 2HVSA 2YKNA 3HSTB 3LP0A 3AVGA 1L3SA 1WH5A 4N0BA 4BY9C 2R5ZA 3HTSB 2HHSA 1R1VA 1FTZA 1JI8A 2KFDA 2PMZN 1W7AA 4KT5C 1UAXA 2O8EA 2FNPA 5JVTA 1K79A 2HNHA 1RT5A 4CFCA 2XVCA 1IV0A 4CJVA 1S1TA 1MW7A 3DEUA 4IVNA 4HQEA 1MNMC 2ZJRF 1J09A 4MTDA 4EMSA 2DAOA 1TUYA 2E60A 2O3FA 1D0YA 5FB2A 3AA4A 4RGXA 3KZBA 3PM1A 2R7VA 4C8MA 4HEA2 4XSZF 1MD0A 2A1RA 1RNHA 2M7AA 3CFOA 3O3GA 3RDIA 3CIPA 1I3QJ 1FIPA 4E3SA 3VETA 2HVHA 1MMSA 1S7AA 4BRIA 5F6FA 4KISA 1GLLO 1T95A 1MWMA 3F6OA 4QS8A 4X6AJ 4B9LA 3AARA 2NRZA 2ZFWA 2DOFA 1DU0A 1HPMA 3EUKL 2HDWA 4BG8A 3GL1A 2X0LA 4LF6K 1RBSA 2W84A 3VB2A 5IYCJ 2G0EA 5FGMA 1ONVA 3V1OA 3ABMH 4DYCA 4FWPA 3HKZN 3LSJA 3EDPA 3JAMO 5DM6L 1Z7UA 3K4NA 1RDCA 2P9LA 2VB6A 3RKQA 1KVAA 4KNYA 3HVRA 2ZNZA 4IKFA 4CESA 4F3OA 1LV5A 1VQMN 3A03A 3EO3A 4B4CA 4G12A 3BZ6A 3SNNA 3NARA 5AQJA 2ACJA 1FBQA 3I64A 3TKYA 2I10A 2VKEA 3NGZA 4L5IA 3ZX3A 5C15A 4D5CA 4EGYA 3CDIA 3DFGA 1U04A 4CE9A 3GTGJ 4HF1A 3MKWB 4KI4A 2CQKA 3CMYA 3JRBA 5CKTA 1XMAA 5GTIC 1YAGA 3NVKA 2E2IJ 4M3EA 3WQTA 1BL3A 5M1NA 1HQCA 3H3OB 1GXQA 5KHDA 2KQRA 3TAQA 3ZOBA 4DFJA 3B6PA 1WB9A 1NGFA 3CCQI 4CJEA 3LAKA 3DYAA 4CJLA 2KKOA 1YTYA 2DYRH 2XAHA 4DUYK 2ZGZA 3IWFA 5J40A 3BR6A 1P6RA 3TO7A 3TBIA 4PL7A 1Y97A 3IL2A 1X3ZB 3ASNH 2ZJRL 1TKDA 1QHGA 3Q0UA 3CJBA 4E7ZA 3O8GA 3LPTA 4HUEA 3JAMK 1VQOI 3CJ9A 3PY8A 2FC0A 1SD5A 4UY8I 3JRFA 3BF3A 2D0PA 1FOXA 3KJVA 4P1WA 4GV3A 2NRAC 4CJSA 2HOEA 2F8TA 1SANA 4NXNK 1FOWA 1W0UA 2ITMA 1EQYA 4NNJA 2HMIA 4PL8A 2XO7A 2BDPA 5LGUA 1OCOH 3TDZC 2GWJA 2ZC2A 2F5VA 5LD2C 2OPSA 3IFRA 4WQ5C 4B9TA 1P2FA 2DA7A 1J7KA 4KIFA 3QDKA 4UHTA
chains in the Genus database with same CATH topology
1JLCA 4DFPA 3ULDA 4B9MA 1JL1A 1VSKA 5HROA 2YNFA 3VQ4A 5FDLA 2OZMA 1XHXA 1YTUA 1X1PA 3L3UA 3TABA 1TK0A 3ZCMA 4EP5A 3HPOA 3NF7A 5JS1A 4FJXA 4DTPA 2WONA 3D0PA 3RWUA 1B92A 3TI0A 3ZT1A 3SPZA 3HL8A 3SJJA 2EHGA 4M3RA 4N41A 2HHWA 3OYMA 3NCIA 1Z26A 2KFNA 3HXMA 4FK0A 1EX4A 4E7LA 4DFMA 4E1MA 2O4IA 5CYMA 3RMBA 3K5LA 2D0CA 1XC9A 3AVAA 4AH9A 5J2QA 1NK8A