2CJJA

Crystal structure of the myb domain of the rad transcription factor from antirrhinum majus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RADIALIS
publication title Crystal Structure of the Myb Domain of the Rad Transcription Factor from Antirrhinum Majus.
pubmed doi rcsb
source organism Antirrhinum majus
molecule tags Dna binding protein
total genus 21
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cjjA00
1YRNA 4XK4A 1TWFJ 5EGOB 5C4XJ 2Y31A 3FKIJ 4A3GJ 4A3LJ 3S2DJ 5M5WJ 2NOGA 1GV2A 2N8GA 1GT0C 4M3BA 1JTXA 2NVXJ 3K2AA 2YUSA 1SFOJ 1FIPA 1JKQC 3A03A 3OSGA 4UUSB 3JRGA 2XPVA 3BR0A 4NDLA 2LD5A 5EGOA 3F0CA 5IP9J 2XGCA 4XICA 2P81A 2DA5A 1ZK8A 1ZR2A 2OPTA 2ME6A 3JRDA 4BY1J 1RETA 2QF7A 9ANTA 5IPAA 4A3MJ 4BBRJ 2L7ZA 4JX4A 1U8BA 2Y9YA 3LSJA 2EZLA 4MLOA 3ZQHA 2HOSA 1ETOA 3GTMJ 2TRTA 4A3KJ 2DA6A 3G1OA 3S1QJ 2DJNA 4C3JJ 1OCPA 4D5CA 4A93J 2WAQN 1PUFA 2DN0A 1NK3P 2NVQJ 2QCOA 4DYCA 5C4JJ 2HOTA 1XS9A 3BG9A 2AO9A 1FIAA 4LOCA 1JT6A 1XG1A 1P7IA 3HOUJ 2CUFA 4G12A 1IG7A 4Y52J 3GTOJ 4XIDA 5BNGA 2Y2ZA 4RDUA 3S14J 3ZQLA 2L0KA 3RZOJ 1MBKA 4JX5A 4AUXA 4M3EA 2JN6A 2R92J 4MIMA 2CJJA 2NS7A 2ME0A 5GP9A 2KDZA 1WCMJ 3IH2A 4W1UA 3WHCA 1VNDA 5GPAA 1MBGA 3A01B 2JA5J 1RKWA 2MG4A 3DEWA 5EG0B 2Y9ZA 5IYDJ 2JK3A 4RBOA 5FLVA 4ABZA 2YS9A 4S0HB 2XB0X 1TWGJ 2Y30A 4AYBN 1IJWC 3HB9A 2WV1A 1I3QJ 4D7NA 2MSYA 1WPKA 2AHQA 1QPIA 2DMQA 2EZIA 3O8HA 3O8GA 3W6VA 4FTHA 3A01A 5EG0A 1JKPC 1HOMA 3CQZJ 1IV6A 2M0CA 3DCFA 3H0GJ 5F08A 4X1EA 5IOZA 3D1NI 1F43A 4JX6A 1B72A 2DMUA 2M34A 2XB5A 2HDDA 3TP0A 4IHYA 2LK2A 3B6CA 3TP3A 4A3DJ 1SANA 1POGA 1AKHB 4C3HJ 2VKEA 3BQYA 1QRYA 1APLC 1ZGWA 3HGYA 4D7MA 3IH3A 4A3FJ 2K9SA 3K7AJ 4EEFG 1UG2A 1MBJA 2XPWA 2R93J 3ZQCA 5M5YJ 4B1RA 5FKLA 1GDTA 4B4CA 2K9QA 1AKHA 3FIWA 3BG3A 3S1RJ 4QSHA 1H8AC 1LE8A 2HXIA 5HODA 1D5YA 5EEAA 1RPWA 3CMYA 3GTKJ 2DA7A 3JR9A 5K7FA 2LY9A 1H89C 5F1JA 1O4XA 2HXOA 1MSEC 3FISA 1IC8A 1EF4A 2W48A 3ZQIA 2DA2A 1ITYA 1WH5A 2LKXA 3Q0WA 2HQ5A 1UMQA 5M5XJ 3MVPA 5JLXA 2MGQA 1U9OA 2DA1A 5DS9A 3NAUA 1DU0A 1OJLA 1B8IA 2WB1N 5IOYA 4FE7A 1ETQA 1TWCJ 1FTZA 1Z0XA 2R7ZJ 1TC3C 5IP6A 2LR8A 1PUFB 2VPRA 4W97A 3TW7A 1AHDP 2I10A 3TEDA 1BL0A 3C2BA 1JUSA 5EZGA 4XRMA 3IV5A 4M6VA 4C2MJ 4IHWA 2VUMJ 1I6HJ 1G2HA 3Q0UA 4FCYA 1FEXA 3BQZA 4XRSA 1OCTC 2CUEA 4MO7A 4C3IJ 2VI6A 3Q3SA 4DZJA 2R5ZB 2B63J 1GVDA 1ETXA 1QVUA 2XGEA 2YU9J 3S16J 1ENHA 5IP7J 1W0UA 4M3GA 1LFUP 1JT0A 1HLVA 5E3NA 2HOAA 5C44J 2ZB9A 3BTCA 1MH4A 1T56A 2DMPA 3VPRA 2R5ZA 1U78A 3BR3A 2E2HJ 2NVYJ 1K61A 3JRCA 1ETYA 2O7OA 3RQIA 2FQ4A 3SFIA 3HGGA 1S7EA 3BG5A 3UKGA 3NARA 1HF0A 2EH3A 1K83J 1WGXA 2E2JJ 1T33A 2L7MP 4QTRA 1F36A 3IH4A 4A3JJ 5E3OA 1B72B 1RR7A 2M8GX 1MBEA 1ORKA 2PMZN 1MBFA 3HOYJ 4BY7J 4B3AA 2XRLA 3M3YJ 2FJ1A 2IEKA 2CQXA 1IDZA 3M4OJ 3RZDJ 2HI3A 2GM4A 2E1OA 1VFCA 1JJ6C 2LFBA 1OFCX 1LFBA 1RKTA 2LP0A 1AU7A 2L7FP 1JGGA 2KT0A 1JUMA 3HOWJ 1LE8B 3LSRA 2D5VA 3CDLA 3S15J 1A6IA 2R5YB 2R0QC 3SDGA 5J1YA 3TW6A 3HOXJ 3HEFA 3GBGA 2CQQA 3LSGA 1BW5A 3HBLA 3B6AA 4XRSG 3LSPA 3A02A 1H88C 5EDNA 3PM1A 1GV5A 5F27A 1MH3A 1Z77A 4JYKA 2FD5A 2M2EA 2JWTA 2R5YA 4JP0A 1Y1WJ 1B8IB 4CYCA 3Q0VA 2E2IJ 5J3LA 2CRGA 5EZHA 5K7HA 1MNMC 4BXXJ 3OOUA 2LVSA 1TWAJ 5FJ8J 3QPSA 2GLOA 4BKXA 3S1MJ 3JREA 4HNVA 2K9NA 2TCTA 3HOVJ 1E3OC 1FJLA 4A69C 5FKKA 4A3CJ 2E19A 5J1RA 1TWHJ 4IEJA 2ID3A 2NS8A 3BTJA 3CCYA 3BR2A 4DYQA 5FKNA 2H1KA 3HM5A 3G1MA 2HYJA 2IBDA 3ZQGA 1I50J 2EBIA 3I4MJ 4DW6A 5M3FJ 1MBHA 4J19A 2EQRA 2GBYA 5F0HA 3OSFA 4A3EJ 1HDPA 2JA7J 1ZTRA 2VKVA 2O9LA 5F0FA 2NVTJ 1BJZA 2XPUA 1GUUA 4IHVA 5JLWA 1X2MA 2ECBA 4AC0A 3HOZJ 4A3IJ 4A3BJ 2L9RA 4D5FA 5FKMA 2DTZA 5EYRA 1A5JA 1JKOC 5FKOA 1Q1VA 1P7JA 2EZKA 1NK2P 5IYCJ 2DA3A 3QQAA 1ZKGA 5K7ZA 5FLMJ 4UUSA 3ZQFA 2ELKA 3PO3J 3JRAA 3JRFA 2OF7A 4X6AJ 1JJ8C 4Y7NJ 1X2NA 3I4NJ 4FE4A 1U9NA 3ZOBA 4L5EA 1VI0A 2X9DA 1BA5A 1NTCA 3BTIA 3BR1A 1MSFC 1DU6A 3BR5A 4I6ZA 2XGDA 4M3FA 4FISA 1HCRA 3S17J 1BW6A 3QPLA 5F0CA 5E3LA 1JKRC 1ZR4A 1IDYA 3GTGJ 1ETWA 3MN2A 1JTYA 3GTQJ 3PO2J 4QIWN 3HKZN 4GFBA 2IAIA 2ECCA 1IGNA 5IYBJ 3RKQA 1CQTA 1IUFA 2MW8A 2LTPA 1ZQ3P 2X6OA 4MFEA 3WHBA 3FK6A 5E3MA 4M3DA 3BT9A 3JRHA 3MKLA 2H8RA 3GTJJ 2XSDC 5GPCA 5DTDA 1ETVA 3BR6A 3GTLJ 1Y1VJ 2RAEA 5F04A 5J1UA 3LOCA 4CYCB 1VF9A 1ETKA 1JUPA 3JRBA 2JJ7A 1WH7A 1QVTA 1IRZA 1HDDC 1UHSA 3G1LA 3S2HJ 2M9HA 2Y0SN 3OIOA 3FK7A 3E7LA 3HDDA 1WI3A 2DMTA 4V2FA 3SJMA 3LNQA 1RESA 2COBA 4I76A 2CU7A 2X48A 1X58A 4DYRA 3JRIA 2FX0A 3GTPJ 4DZPA 2DMNA 1XC5A 2JMWA 2K40A 4UUTA 4MFDA 1YRNB 2JA8J 2EZHA 4BBSJ 3H3VK 4IHXA 3BTLA 3S1NJ 2G0EA 5EF6A 2O8KA 1W0TA 5M3MJ 5C3EJ 1FTTA 4V2GA 2ID6A 1R9TJ 2DA4A 2LLKA 3L1PA 2JA6J
chains in the Genus database with same CATH superfamily
4HX7A 5K5QA 2FF4A 3SXYA 3CJTB 4A2UA 4XK4A 1ZLKA 2Y31A 3FKIJ 3K1PA 2Z16A 3OYKA 5D5WB 4A3LJ 3S2DJ 5M5WJ 1GV2A 1Z3XA 1WJCA 3QP5A 4KICA 4M3BA 3HC7A 3WU2C 2FU4A 1XMXA 1FIPA 1RC9A 2VJ5A 4B44A 5LFAA 3OSGA 4XKWA 3JRGA 5LGUA 2XPVA 2LD5A 5JHUA 1FX7A 5EGOA 4YELA 4L0YB 2O0YA 3OYJA 1K7AA 3OYIA 1ZAOA 1Z91A 2OPTA 2DFFA 2EIMH 3JRDA 1RETA 9ANTA 3EUHA 4A3MJ 1G3TA 4WF2A 3OS1A 4RB1A 2EZLA 3ZQHA 1LDJA 3WE3A 1J7KA 3GTMJ 5IT9K 5IY5H 1Z9CA 3G1OA 3IAM2 4B48A 3S1QJ 2XSJC 5J8CA 1FOXA 4ZTJA 2WAQN 2NVQJ 1BIBA 5E18F 5L3CA 3OV8A 1FYKA 1WJDA 4L9TA 2MYSA 4ZDLA 4ZYDA 1I3AA 3HKZA 1MGTA 1SFUA 2V6CA 1IRFA 5J40A 4PSXA 2UWMA 1S7AA 5FRNA 1P7IA 1LVAA 4G12A 4M71A 1IG7A 4Y52J 2Y75A 2VXDA 1I5ZA 5K1YA 3S14J 3FF5A 3ZQLA 2H27A 4II2A 2FBKA 2JN6A 4M3EA 3CF2A 1BN5A 2EA4A 2WC2A 3TDZC 3WHCA 2E36A 2GXBA 4ANJA 2MG4A 5DCFA 3RKWA 2KRFA 4D1QA 2JK3A 2VB6A 3FX3A 2OA4A 3ELKA 4DGWB 1P4AA 1BR2A 2K85A 4G7OF 2LOOA 4YFXF 5J6XA 5JVGF 4D7NA 1QPIA 2DMQA 2VQCA 3O8HA 4S04A 3FDYA 3W6VA 3K4KA 2QSFX 3DFGA 1ACIA 1YFHA 2F5VA 5HDNA 3K4NA 4HF2A 5CVVA 1ZREA 3KYCB 4X1EA 3BROA 3I4PA 4JX6A 1B72A 2X4HA 3TP3A 4J01A 2DXIA 4A3DJ 3CJRB 1SANA 2VKEA 1APLC 2ZJ2A 3ABTA 4D7MA 2K9SA 4KN4X 3GWZA 3T1BA 5KK1A 2LKPA 4M9ZA 3BP8A 3E97A 1OCCH 3I64A 3ZQCA 4BNCA 4OIQF 3OIPA 3WTZA 1EH8A 4BS9A 2MC4A 1B6AA 3HPHA 2CW8A 1GDTA 1DGWY 1TQIA 1IXRC 1Q1HA 3BCBA 3I59A 3BPVA 2IS2A 4P1WA 2VJJA 3FMRA 3S1RJ 2FOWA 3LSTA 1U3EM 2IS6A 2CV2A 1X1PA 3EUHC 3JR9A 4BQAA 2KIMA 4BXFA 2A61A 2Z99A 4XL9A 2PJPA 3OYFA 1X3ZB 5HVQC 1H9GA 5D5XB 5D8KB 4BHCA 1AWCA 1UMQA 5M5XJ 2MABA 1B9MA 2DFHA 3PNYA 1DU0A 4Y15A 1FBSA 2NRAC 2VODA 4BE2A 1Z6TA 2BVLA 4A0XA 2VJ4A 4BE0A 1B8IA 1UG0A 4FE7A 1BR1A 3HOSA 1TWCJ 5H20A 2NNYA 1FOWA 1Z7UA 1FP2A 3MKZA 1IRXA 2LR8A 3QYBA 3W6KB 1P2FA 2V7FA 4U0WA 4XLHA 2LC2A 2NVUB 5HOOA 1AHDP 2LSOA 5CVUA 2KQRA 2L01A 5FD5A 1BL0A 1JUSA 2L5QA 3PSIA 4M6VA 3FXQA 4C2MJ 2XAJA 3JSPA 1A35A 4IHWA 2OZUA 5ILSA 4FCYA 1FEXA 2CG4A 3BWGA 1EKEA 4JK1X 1S72I 3ESWB 3GO5A 1BJAA 2CUJA 3DU6A 2YU9J 1ENHA 1HXDA 5ICGA 3KIOA 3ERED 5IP7J 2VJIA 4U7DA 2F4OB 2BGCA 3GLLA 3R0AA 1YG2A 4M3GA 3VB2A 3COAC 1LFUP 1HLVA 2LYCA 3F6OA 4EJTA 2HOAA 4M72A 1OR7C 2BZTA 2ZB9A 3I56I 3VYUB 1MH4A 2LRDA 2R5ZA 1MMAA 3K6GA 5D8LB 4EQQA 3F21A 2NVYJ 1YS6A 2WADA 3GVAA 4NQWA 2O3FA 4RMNA 2O7OA 2FQ4A 2PLYA 2KMUA 2OQGA 3BC8A 4S05A 5IT9Z 1E3HA 3B02A 2E2JJ 1T33A 3P7NA 1D8JA 2IGKA 3IH4A 2A05A 4L9VA 3ZXSA 1IN5A 1B72B 1RR7A 2E1CA 4GDFA 1MBEA 2A68F 2PMZN 1BI1A 3E5UA 4HQMA 3HOYJ 5B1BH 2XRLA 2HTJA 3BCAA 4EGYA 1QGPA 2FEZA 3S3OA 4ZZDA 1I1SA 3K4JA 2QYOA 3CCEI 1SD5A 3R0JA 3ZGKA 4HF1A 1X1BA 3CP8A 4XLNF 2LFBA 1OFCX 1BC8C 2VONA 4FQGA 1V3FA 1JUMA 2VC0A 3HOWJ 2G9WA 4XSXF 2F5DA 3CC4I 4ZTFA 3CDLA 1R1TA 4HG2A 3HZJA 3S8PA 3IWFA 4D9JA 2R5YB 2R7UA 4BXUA 2CSOA 3JSOA 3TW6A 3ASOH 3P5JA 3PQJA 2O6GE 1BW5A 2DOEA 3H3ZA 3P9CA 2FRHA 3LSPA 4A5NA 3F8MA 3H0DA 3PM1A 3MD2A 1GV5A 2E71A 5CPRB 3ZMUA 1Z77A 3TO7A 4JYKA 2FD5A 5FROA 3ZN0A 1J9IA 4QWQA 5DCMB 1B8IB 2RDPA 2HEOA 1Z21A 1MIJA 3RTRA 5J3LA 3GX4X 3FXJA 5K7HA 4CCJA 3OOUA 3CCLI 1TWAJ 1B4AA 5JI6A 4MQVA 2MLGA 5DV5A 4PCQA 1ZH5A 3CESA 5HLGA 4XLAA 2DLLA 1E3OC 4XQFA 3Q9SA 4A69C 1ZRDA 4WCGA 2STTA 2JSPA 2E19A 1Y8RB 3HRTA 3K4CA 4ITVA 2NS8A 1FNNA 4HV5A 3BTJA 2JRMA 1STZA 3EPZA 2H1KA 3KP5A 2DFEA 1V55H 2CFOA 3M07A 3ZCOA 4Y3OA 1KQ9A 4HDVA 1FSHA 2JPCA 2XF6A 3O6BB 2VN2A 5M3FJ 2W85A 4J19A 4BHPA 2V9KA 2BYVE 1SVOA 1FZPB 5KCMA 1ZTRA 3RDIA 1D1CA 2W7NA 4F92B 4P9FA 2CV0A 2P8TA 3ASNH 4F7ZA 4BJTA 2A6HF 4AC0A 1EH7A 2L9RA 4NQWB 5EYRA 3E6BA 4OINF 5BMZA 1A5JA 5HNHA 4E7LA 1LFPA 5AIQA 2EZKA 1Y56A 1C0WA 5IYCJ 2DA3A 4Q47A 2X6WA 5K7ZA 2VKDA 3ULQB 4UUSA 2K9MA 3ZQFA 3GZNB 3GEZA 2L9NA 3K0LA 3MZ8A 4HLXA 4G6TB 1KQ0A 3SZPA 2PQ8A 1T38A 3N97A 3I71A 2ZKZA 1VI0A 3CJQB 4Z2YA 1FYMA 4BGDA 1BA5A 2FOKA 4XLFA 2EFOA 5CKTA 1F5TA 2QQ9A 2BXYA 5GTHC 1X3UA 2K4BA 1R00A 3WTSC 3QPLA 5E3LA 3NRVA 1FOKA 3GTGJ 3E6CC 1ON2A 4QIWN 3HKZN 4GFBA 1KU9A 1IGNA 5IYBJ 4RGSA 3JAMK 4MEXF 3A2KA 2XGXA 4M9SA 3C7JA 1QZEA 3TGNA 5KAFC 4MFEA 3FMQA 2P7VB 1ZQ3P 3FK6A 4MTEA 3AAFA 3P9KA 4MGRA 3MKLA 1T08B 2ICWG 1QHGA 3V8KA 3BG6A 3HHHA 1HW1A 4I02A 4AIJA 5AONA 1FMWA 1ETVA 2LF8A 1TZLA 1UELB 2PBIA 2NXNB 3C18A 4PJLA 3V4GA 2QSHX 5AIPA 4RM3A 1DP3A 2JJ7A 1QVTA 3DTKA 3UR3C 2DAOA 5H6QA 5HDKA 2W84A 1VQNI 4IRIA 1MNDA 3S93A 3DBLB 4RB3C 1J0RA 4M6XA 1DDNA 1NG6A 1TW2A 1WI3A 1UHWA 2WA0A 4IQ4A 4G6DA 4HPQA 4U7BA 2X48A 2CU7A 2VBWA 2PN6A 4GRIA 4I76A 1G6NA 3JRIA 4BH9A 4DBQA 2EFWA 1VZ0A 1K4SA 2DMNA 4UUTA 4RGUA 2X1DA 3L2WA 1R7JA 2RQQA 4L9NA 2JA8J 2OV7A 5ILVA 3GMEA 2CQKA 3RYRA 4A0YA 2LDUA 1RUNA 4CCMA 4MHGA 5FB2A 3EUAA 1R9TJ 4E6KG 2LLKA 2KISA 5CJ9A 3F8BA 4LD5A 2D1VA 1HKTA 2YSRA 1XCBA 3QAHA 1TWFJ 5C4XJ 4MQ9F 1SFEA 2LY1A 3LSIA 3G4SI 2JQ7A 3EETA 2NOGA 1GT0C 2QBYA 3SHFA 1JTXA 3ISPA 1SFKA 4HYEA 1MD0A 2AXLA 2EPFA 1VQLI 1JKQC 4CYDA 1G3SA 3A03A 1U2WA 4I0AA 1HSTA 4UUSB 3BJAA 3PQKA 3BR0A 1USTA 2BY1A 4NDLA 2P0WA 4XONA 4XLPF 3F0CA 3BG7A 3ZMDA 4ZYEA 2KLOA 3WGHA 4C2TA 4E7KA 2DA5A 1ZK8A 2CW7A 2DK5A 3W2AA 4HSRA 1ZR2A 2P6SA 2DI3A 1TTYA 3OL4A 4BY1J 2QF7A 5IPAA 1U8BA 1BI0A 2A69F 2Y9YA 2ZMEA 1MJ9A 1LKXA 1R58A 2K27A 5ERIA 5BOXA 4LLLA 2HOSA 2ZC2A 4J00A 2OJED 3A1YA 4FHTA 5KAIC 1Z6RA 4BU2A 2IXSA 2VBZA 2F5CA 3KPHA 4IJAA 4A93J 1IF1A 2STWA 3HG9A 2R7WA 1XS9A 4BJ5C 3WODF 2VC1A 1ERDA 4F52A 5B66C 4I0BA 2AO9A 1FIAA 2F4IA 3RPQA 2BY2A 2HQAA 4HOBA 3TO9A 3G73A 3HOUJ 3A0HC 2Q8KA 2GZWA 4XIDA 3IWZA 4B8XA 1F1ZA 4RDUA 2ADUA 4JX5A 5LBQA 4AUXA 1YIOA 2IRFG 4MIMA 4EM2A 2ME0A 3IKVA 2RVCA 1WCMJ 5GADJ 1MBGA 3FHZA 1Y0NA 4NC7A 1OMIA 3RI4A 3PIOF 4B43A 1VQMI 1T8IA 2DDBA 5J8FA 1MKMA 2Y69H 3HB9A 1LUJB 3C2HA 1VQ4I 1I3QJ 3S2WA 1XGOA 1FYLA 4G7ZF 2EZIA 3O8GA 4FTHA 3O3KA 3REOA 2QM3A 2GOMA 5DM6F 1HOMA 2FBIA 1L0OC 1WRJA 3G71I 4TV7A 4KISA 1O3SA 1IV6A 2F5EA 1J5YA 1HA8A 2LG4A 3DCFA 3H0GJ 3PNVA 4LJZF 4CHUA 3F8NA 1G8XA 1F43A 2XB5A 4IHYA 2D45A 1P92A 1FC3A 5LEKA 4C3HJ 5TGTA 3OYNA 1OYWA 1QRYA 5D6EA 3DBHB 3HGYA 4A3FJ 4I99C 1OCZH 2VASA 2EIKH 3DP7A 4EEFG 1UG2A 3V7SA 5LRSA 2XPWA 4BEHA 1FOYA 3WTTC 3SZTA 5M5YJ 3RPUD 4B1RA 3AL0C 1OCOH 3JAMZ 2E5NA 4UVBA 1FBUA 1FY7A 5H6RA 1MMNA 4B4CA 1K4TA 1G3YA 2K9QA 2K7LA 1IRGA 1IXCA 2MLKA 3U2RA 3FIWA 1P4WA 3R6SA 2KHMA 4Y33A 4PFPA 3H36A 4Q48A 2HXIA 3LWFA 4JOMA 3CMYA 3TQNA 1VQKI 3AL0B 3MQ0A 2ZMEC 2LY9A 3H9JA 5K7FA 1R4NB 1O4XA 3WTYC 1OLTA 2VOOA 3ZQQA 1EF4A 2W48A 2G7UA 3KP3A 1ITYA 2M7AA 4L9JA 2DPUA 4LLGF 3CUQA 2LKXA 3V8LA 3KLOA 4AIDA 1BC7C 1Z05A 3DKWA 5E17F 5E20A 5JLXA 1U9OA 2EV6A 4XLCA 2ZCWA 3NAUA 5DS9A 2ZMEB 4OIOF 4IVNA 3MAJA 2WAFA 1GVJA 5DUIA 4HZFA 2E1MC 3M8EA 2R7VA 1I39A 3KEYA 4LIUA 3KFWX 3BPXA 4PK4A 4W97A 3TW7A 1T6SA 3SQNA 2KIQA 2UUZA 4I98B 2ETHA 3QWLA 5A2QK 4A6DA 1I6HJ 1G2HA 4ASNA 4PJNA 2M1BA 1ZGAA 3F8CA 3RPUA 2Z1DA 4EM1A 2E1MB 2CUEA 4MO7A 4PGGA 2MH9A 2KL4A 4YRVA 4I7HA 5ICFA 4X0GA 4DZJA 3ZQ7A 3S32A 3I9V2 5BS6A 1TLHB 3NEUA 3H1CA 1YLFA 1QVUA 1OPCA 1MMSA 3S16J 1OKRA 3L2UA 3D0SA 3CMEI 3OYMA 2EIJH 4AYBA 3FMSA 1K6OA 4R1HA 4L5JA 3VYSB 1N77A 3OYHA 2DTRA 5FRMA 2W57A 1T56A 3E6DA 3VPRA 3GW2A 2KDOA 3PFIA 2K02A 2DT5A 1BM9A 4NHJA 3LSMA 2E2HJ 1K61A 2DFIA 1TNSA 4NC6A 1U5TA 4U0VA 4ENMA 1S7EA 3T8RA 2O61A 1HF0A 2EH3A 1S8NA 2B0LA 3WTXC 4QLCU 1WGXA 3HRSA 1KGSA 2VKHA 3DEEA 4XMYA 3TKYA 2WWYA 1VQ7I 4A3JJ 2DJIA 3CCSI 5E3OA 3KYLA 3PUBA 4DOZA 3LFUA 4RAFA 3IC7A 4KN7X 3PSFA 4ESJA 1MBFA 3FM3A 4BY7J 4B3AA 3VFZA 1JGSA 2ELHA 4KT6A 1WJAA 1Y8QB 3V42A 3CCJI 1OR7A 3M4OJ 2H09A 2A6TA 2HFHA 1CF7B 2A5WA 2GM4A 4BEHB 2E1OA 1VFCA 3HL2A 2DCEA 4IXAA 3VYTB 1JJ6C 4Q5SF 2HNHA 4XKVA 5GAGJ 1RKTA 1B9NA 2XRNA 2XAUA 3KP4A 2RKHA 2GIVA 2JRTA 3S3NA 2KT0A 2QQ8A 3QYFA 3CJNA 2P5VA 2E7XA 3CUQC 4ZDOA 3LFKA 3RYPA 3U1DA 2RGVA 1RI7A 3U9GA 3SDGA 2R0QC 1ONVA 5J1YA 3D5LA 3OYEA 2Y48A 3HEFA 3GBGA 2CQQA 5D5UB 2R7TA 4XRSG 3LQRA 2XASA 4RS8A 2WB1A 4O5VA 3CUQB 2VBXA 3CCQI 5HS7A 2R5YA 3OYDA 1X1DA 1QO0D 1BOBA 1BBYA 4HQEA 2O5RA 3D5RC 3OYBA 2A6EF 1ODDA 2HDCA 4BKXA 5GAEJ 5CVJA 3JREA 1XX5A 5ICEA 3DLLF 3H92A 5DCMA 2OZ6A 3G6EI 4MEYF 5FO5A 3HTUA 4A3CJ 1K6YA 3H5RA 4FT8A 2F2EA 2IA1A 3L7WA 3JTGA 3LSHA 1I6XA 1TWHJ 4KIBA 2XAGA 3CCYA 2QKMB 3RCOA 1DPUA 1KU3A 1MJBA 3F23A 2EK5A 3W2VA 4XOPA 2HR3A 1NH3A 2IVMA 5CLSA 2FMLA 4LGWA 2IBDA 1EV7A 3ZQGA 4EATA 4EMSA 2V1DA 2ZJQF 4DW6A 2PJRA 1MBHA 1U5TC 2GBYA 4UB6C 5F0HA 3OSFA 2XC7A 3DEUA 4A3EJ 2M30A 2X6YA 2F6CA 3CDIA 2VKVA 2O9LA 5F0FA 5FFXA 3KZYA 3IAS2 2LKSA 1GUUA 2XPUA 3CTAA 5JLWA 2ECBA 4A3IJ 2FNAA 3G2BA 2DTZA 1SD4A 1U5TB 1WI9A 3K4BA 4KDPA 1NK2P 3E6MA 2K5CA 2XUBA 4GCVA 3QQAA 4LB6B 3ABMH 4G9YA 4UHTA 2E34A 4N4OB 2X85A 2LMDA 3HSEA 1RNLA 3SYTA 1K78A 1MMGA 3CCUI 2ELKA 3HOTA 3CUOA 3JRFA 4RAYA 1XSXA 3OYCA 1JJ8C 1BI3A 4FETA 5A2QZ 1A6QA 4RGXA 3GFIA 5FGMA 1O3TA 3I4NJ 1U9NA 1J09A 2KZVA 3VDXA 1XSVA 1D0ZA 1OQYA 4R79A 4DNCA 4B3XA 1KONA 4E7ZA 1VQ8I 2Z3YA 4E7JA 1WQ2A 1LQ1A 1XTAA 2J5PA 1AA7A 1MSFC 3ZRGA 1R1UA 2A07F 1X4OA 3KCCA 2NS0A 3GUDA 5H2FC 5F0CA 1O7LA 4F3QA 2VBYA 1ZR4A 1KU7A 2L3DA 1ETWA 4YFNF 3A0BC 3OR2C 1XSDA 3GTQJ 5LGTA 1U8RA 2IAIA 4UVAA 3RIRA 3ZMTA 4BDYA 2R7QA 2RN7A 4KA4A 2LTPA 2VE9A 3WHBA 2EILH 2PG4A 2LREA 3BT9A 4YFKF 4EVIA 1WJ5A 2OCCH 4M6YA 4UY8I 5J4YA 1U6GA 2KPMA 3H3UA 3MCZA 3CP2A 4P9UA 5IT3A 2ZJPF 3BJOA 3GTLJ 4E7SA 1TW3A 1Y1VJ 2BOLA 5F04A 3LOCA 4D0PA 4PJMA 1VF9A 4HA8A 4RGRA 4HW0A 1JUPA 2V79A 3JRBA 3R4KA 2BXZA 3BZCA 1ZG3A 2M7BA 2XVCA 3G1LA 1S9HA 2IT0A 1KZHA 1JXSA 3E0JB 2HOEA 4KUMA 2DK8A 1I1GA 2I5UA 4E7IA 3HDDA 2DMTA 3ZMSA 3TL4X 3V8JA 1RESA 2IJLA 5L3DA 1V5GA 1XMKA 1U0JA 1XB4A 4KIFA 4ON0A 3GTPJ 2DYRH 4DZPA 2PFBA 4I01A 2K40A 4LFUA 3HRUA 4LK1F 4M74A 2EB7A 4MFDA 2IA2A 1YRNB 2GOXB 2BBYA 1WFXA 1V54H 1ZHFA 4ZYGA 2E60A 2FNPA 2FQ3A 1ZN2A 4IHXA 3BTLA 4PGHA 1S29A 2PJRB 2G0EA 2JT1A 2O8KA 4OMYA 4N9HA 5M3MJ 3FBNB 4PUSA 1IN7A 4V2GA 1FTTA 4BQQA 2DA4A 1R71A 1XPXA 4AU7A 2L4MA 2JA6J 3KZZA 2DOAA 2AS5F 5KNLA 3U1KA 3CLQA 2HS5A 4ZH4F 3KYDB 4RB0A 4A3GJ 3QU3A 4RA2A 1D3YA 1X1AA 2MC3A 5LLQA 1X3WB 4LG3A 3Q5FA 1G3WA 1YITI 3HUGB 4EJVA 3GZ6A 5LHHA 3EQLF 2CO5A 2XGCA 1K78B 1ZARA 1XDSA 4EGZA 4U87A 2JVHA 2ME6A 4XNFA 4XN0A 3L2VA 1A04A 4BBRJ 2L7ZA 3HJEA 4JX4A 5L3BA 4IL6C 3KP2A 4CXFA 3LSJA 3RJPA 2VIXA 3F8FA 4N0BA 1UHMA 4MLOA 4BJ6C 2Z2SB 4A5MA 1E0EA 2W24A 4OU0A 3IKTA 2DA6A 4E4HA 2DJNA 2DPDA 3HYIA 4Y13A 3IRRA 3GYHX 4D5CA 5KHDA 4ZC3A 2FA5A 2MD0A 2DN0A 5CVIA 4ZZLA 2HDWA 1QU3A 2RNGA 5D6FA 5D4RA 2GXGA 2M5WA 3ZR8X 1PP7U 4HV6A 2HPMA 4XRFA 1JT6A 2WY7Q 2K9LA 3GTOJ 5BNGA 3OYAA 2GAUA 3OR1C 3LA3A 2OUMA 3MKWB 2KJCA 1YE9A 4KIGA 1KQ8A 2CJJA 4U0YA 1MW7A 1ZRFA 5GP9A 2KDZA 4W1UA 2JZYA 2COMA 5GPAA 2ACJA 1FT9A 1NHAA 3A01B 1RKWA 3DEWA 5EG0B 3I55I 5IYDJ 1DP7P 4RBOA 1IUYA 2YS9A 3DXJF 2XB0X 1TWGJ 1ZRCA 1QA6A 4AYBN 4EJUA 3I53A 2Y0SA 5F6FA 2WV1A 1D8KA 1O7FA 4XOTA 5J47A 1WPKA 5ED4A 2JUGA 2VT2A 2QWWA 5HLIA 1R5HA 5E1ZB 2DQRA 3K2ZA 3CC7I 3AFHA 4LK0F 1X4PA 1JKPC 3CQZJ 4YG2F 3BZKA 2BHZA 2M0CA 3TDUC 5F08A 3W6JB 1OYYA 3D1NI 1YJWI 5J4VA 2PI0A 2DMUA 1XMAA 2HDDA 2KIUA 3KZIC 1AKHB 2HVRA 4P96A 3BQYA 2BV6A 3HTSB 3NWTA 2HQNA 4M9XA 2M0MA 4UUVA 3K7AJ 2NOJB 1MBJA 2E5ZA 4JBAA 2R93J 1GHCA 4CSWA 2XAFA 5FKLA 4JQFA 4ZYHA 2PEXA 1FLIA 3BG3A 5TJJA 4XN3A 1H8AC 2HYFA 1HW5A 5E8GA 2WY8Q 2IGOA 3QOPA 1W36D 2OTLI 1YI2I 3ABKH 5EEAA 1RPWA 3GTKJ 2DA7A 2X1EA 1YTYA 1HW2A 5DM7F 1PYVA 2V9PA 4NUBA 2KKOA 4HAMA 1H89C 3DPUA 3S3MA 5F1JA 1N78A 4UVCA 3HSRA 3CO6C 3CMAI 1IC8A 1USSA 4C30A 3KP7A 3ZMVA 2B9SA 1YS7A 4HSTA 4G6QA 1PP8F 5LHIA 5F1RA 4IZZA 1TT5B 1IW7F 2MA3A 3MVPA 1H9TA 1E17A 2MGQA 1R6RA 2DA1A 2Q0OA 1IN4A 4XSZF 3KEQA 2WB1N 2ZSHB 2K3FA 3RKXA 3OYGA 1ETQA 1QBJA 2R7ZJ 1TC3C 5IP6A 3TO6A 3BLYA 1LDDA 3B73A 4F93B 2H8WA 5HDGA 2VPRA 2EFPA 1LEAA 2FSWA 2I10A 2XHKA 3KLNA 3LL7A 3TEDA 3CC2I 2VPLA 2CYYA 4BUPA 2E1NA 4XRMA 4LITA 1QNTA 2H6CA 2O8XA 3DBRB 2VUMJ 2V1UA 3Q0UA 2FXAA 4XRSA 1WVRA 1OCTC 1DQUA 1P6RA 4BYYA 2QLZA 1SAUA 3JCUC 4C3IJ 2HGCA 2BW3A 1L3LA 1OYIA 2B63J 1GXPA 1ETXA 4CCNA 4OIPF 2XGEA 5K5RA 2BY3A 3DF8A 3IHUA 4GO1A 4DBRA 2VQGA 1YQAA 2XKPA 2CWEA 2XIGA 3K70D 4PSWA 1W0UA 1Z67A 5E3NA 5C44J 1M1EB 2DMPA 1LB2A 2HVSA 2XF7A 3OS0A 2Q1ZB 2VQLA 4EV0A 1IV8A 4G8XA 2L9SA 2DT7B 1F9NA 2A5YB 3SFIA 4AIHA 4LIVA 3BG5A 1JHHA 4IPAA 1SC7A 3MFKA 1K83J 3LMMA 4ETSA 3M1EA 3PJRA 3QP6A 4N9IA 4QTRA 3TOAA 3FXLA 2M8GX 2L54A 3H9QA 1ORKA 1SAXA 1R5ID 2LY2A 3M3YJ 2FJ1A 1MNEA 2IEKA 4BAYA 2CQXA 3ABUA 3SEQA 3GFMA 1I27A 5JHFA 3KE2A 1YJ9I 3OMYA 1Z1DA 2IGMA 4CUGA 2LP0A 1VQ5I 4IRGA 2AQFA 1JGGA 2OTJI 1B59A 1LDKB 4CCKA 4ENJA 3DTIA 1E3PA 2D5VA 4HLYA 4KT5C 1CF7A 4WXCA 3S15J 2ESNA 3DV8A 1A6IA 2X6XA 4HEA2 2NYXA 4O6JA 5BPIA 1EJ9A 1REPC 4N4NB 3HOXJ 4BE1A 1MDMB 5BPDA 3QOEA 3TBIA 1SMYF 3HBLA 4AD9A 3LSKA 3TMOA 4AIKA 3K1MA 3GLXA 2P7CB 1H88C 1BIAA 3JTHA 5F27A 1MH3A 1QPMA 1JHFA 1Y0UA 3IUOA 1GXQA 2M2EA 3L00A 2JWTA 3QU6A 5D4SA 3R60A 4JP0A 5EEGA 1XCVA 1Y1WJ 4NB5A 4CYCA 2CFXA 1S6LA 3MEXA 2CUZA 1TBXA 3Q0VA 5DEQA 3ZMZA 2E2IJ 1QQIA 2QQBA 1EH6A 2CRGA 3PIPF 2W25A 4XM3A 3OYLA 1MNMC 5BQTA 5GAHJ 5FFZA 5FJ8J 2GLOA 2M45A 2V9VA 3K4MA 1R1VA 3KX2A 4BL0B 1NG7A 2K9NA 1N75A 3I3LA 4OAZA 5ILUA 3HOVJ 3J7AY 4P5OA 4OOIA 1P4XA 5HS9A 3A4CA 1W36C 4CH7A 2OC6A 2RC4A 2FMYA 2VT3A 5K5OA 1SVMA 2XDVA 1YOVB 5FKNA 4IX7A 1V4RA 4UV8A 2BW3B 6PAXA 1SFXA 3VYRB 4PJ0C 3KP6A 2EV0A 3I4MJ 4R8HA 3PNTA 2YU3A 2HWVA 3C3WA 2R4GA 3O2PE 4KJZA 4KMFA 1HDPA 2JA7J 1D1BA 2BY0A 2NVTJ 3K4LA 2GWRA 4AM3A 4IHVA 4ENNA 3F22A 4FASD 3LA7A 4BACA 1X2MA 2Q2EB 1VQOI 1T98A 5HS8A 3HPGA 5B3SH 1JKOC 5FKOA 1Q1VA 4ESFA 3WTVC 3J81K 5FD6A 2Z33A 2VL8A 2ZBKA 2DOFA 1T2KA 4H0EA 3ML6A 1ZLJA 1RZ4A 4NC8A 2KZGA 1FBQA 4IOCF 2F48A 2UXXA 3VODA 2V1NA 1O57A 3VOEA 3JRAA 2R7SA 2OF7A 4X6AJ 3WGIA 1E2XA 1X19A 2R3SA 3T0YA 1X1CA 3L2RA 2QEXI 4Y7NJ 3DU5A 1X2NA 1LEBA 2HVQA 2ZXWH 1UCRA 3ZOBA 2LBFB 2X9DA 3K70C 4IHSA 1HSJA 1NTCA 4V19K 4A12A 1XN7A 1V5EA 4Q4ZF 2I8DA 3SDBA 2RQPA 1YIJI 2UV1A 2ZNYA 4CA0A 3BR5A 1DU6A 4I6ZA 3J7AO 1YX5A 2QQAA 1HCRA 2BEOA 2GA1A 5DD4A 3LAPA 2AXTC 3RKYA 2ZXHA 3VSKA 4XR6A 1JKRC 5LGNA 1IDYA 2HQRA 3M1CA 3ECOA 2CQ7A 3J7ZI 1PUEE 1JTYA 1WHUA 4IRHA 3PO2J 1P9QC 2ECCA 3CO7C 4K2EA 3RKQA 1CQTA 3C1DA 3NWSA 1IUFA 4OIRF 3WU1B 3K1NA 1GLNA 5E3MA 2HU9A 4M3DA 4IO9F 3JRHA 3DPLC 2R7DA 3OOPA 3GTJJ 2XSDC 2ZSIB 4RB2C 4LLNA 5GPCA 4C2UA 1OISA 1ZGJA 1DUXC 1WZ2A 2W00A 3T8TA 4GXOA 1F4KA 1MZBA 2RAEA 2X1CA 3PFYA 1VQ9I 2HYGD 3HRMA 4CYCB 1BI2A 1ETKA 2M4KA 2XF5A 2HZTA 2HPIA 1R23A 1DGRM 3DPTA 1WH7A 1IRZA 4I2OA 4A0ZA 4OAYA 2B7EA 1HDDC 5CQGA 2ZJRF 4UV9A 1UHSA 3SEZA 3S2HJ 4WWCA 2IS1A 2EINH 2M9HA 2Y0SN 3OIOA 2H6BA 3E7LA 1FWZA 1FPQA 1PVEA 5D5VB 2ZFUA 4V2FA 5E1XA 4WK8F 4IKFA 2P4WA 2COBA 5E79C 1X58A 1Z3YA 1WJBA 1YYVA 1Y6IA 1XC5A 2JMWA 2PMHA 4YIIA 4E70A 2GA2A 1QZYA 3QODA 4RM2A 2X0LA 4BBSJ 1TNTA 2HKXA 4WXDA 2PMUA 1XGMA 2RREA 3GCMA 3PL8A 5E1WA 3PUFA 2IW5A 3S1NJ 4LG0A 4P55A 4GYGA 2JSCA 1W0TA 2DU9A 1LVKA 3EUKL 3P9IA 3E5QA 1W5CC 3EDPA 3ZP5A 3LAJA 3DKYA 2H94A 1SD7A 1XGNA 5LD2C 2BE5F 1PJRA 1YRNA 1Y39A 5EGOB 3N05A 2FBHA 2L4AA 1UZCA 4ZJZA 5L3EA 2N8GA 2P5KA 2NVXJ 2OD5A 3K2AA 3WTWC 3JW4A 2YUSA 1SFOJ 2R7RA 1R22A 4CZZA 4PDKA 3AKZA 2R7XA 5IP9J 4XICA 2P81A 1T95A 1D0YA 4YIFA 2CS3A 4H4KC 1D5VA 3WU0A 3HSFA 1ETOA 5JFRA 3MWMA 1H0MA 2HKOA 2TRTA 3H5NA 4A3KJ 3HUGA 3MZYA 3IL2A 4C3JJ 1ZG1A 3KEOA 1OCPA 3BDDA 2JTVA 4QPOA 1RIOH 3U21A 3FXMA 1PUFA 1NK3P 1YW8A 4HX8A 1XD7A 2QCOA 3FXKA 3FXUA 4DYCA 1J2XA 2RV8A 4HDUA 5C4JJ 1IZ1A 2HOTA 1WKMA 3FWEA 4ZYAA 3BG9A 3DWLE 1UB9A 3X2QH 2QA4I 4LOCA 2K4JA 1XG1A 3E3VA 4NBQA 2CUFA 2ZXIA 3HXLA 1S5LC 2ISYA 2MD5A 2Y2ZA 3IP4B 2L0KA 5CQEA 1MBKA 3RZOJ 2R92J 2NS7A 1WJEA 2VLAA 2IS4A 4L18B 3IH2A 3J81Z 2DQLA 1VNDA 3BZ6A 2C6YA 2CW0F 2JA5J 2V1XA 2W4SA 2Y9ZA 1S7OA 2Z9OA 4NNJA 2DT6A 4RLFA 2E7WA 1IO2A 5FLVA 4ABZA 2EFQA 4S0HB 2Y30A 4KITB 3QPHA 1MMDA 1IJWC 2EJRA 3QRFF 1VQPI 3GFLA 4YEJA 2MSYA 4HX4A 4HRIA 3EYYA 2AHQA 2WBMA 1VQ6I 3K10A 3CD6I 2JVGA 5LHGA 2JA2A 2V26A 2LF7A 3A01A 2YPRA 3HHGA 3AG1H 5EG0A 2ISZA 3J80K 2K3PA 3H9GA 1YX3A 2H1LA 2KP6A 3SFZA 5IOZA 2E35A 3DQVC 1W5SA 2M34A 3FXOA 3TP0A 2LK2A 2KRHA 3B6CA 3HIFA 2JUCA 2R7FA 1POGA 4RAGA 3I59B 4DIQA 2EWNA 1IN8A 2NNNA 1ZGWA 3IH3A 4ENKA 2L2OA 1T0FA 4E7HA 4XLEA 4LG0B 2ELJA 2P5LC 4CZCA 3DLAA 1UFMA 4KFCA 2XAHA 1YJNI 2YR2A 2DDAA 2G7HA 2RNJA 2BHYA 1KYWA 2QVOA 3D5SC 4EM0B 1AKHA 4U88A 1D0XA 2YX7A 4QSHA 1LE8A 1YO5C 3QPTA 4A6EA 2IPQX 4HNUA 1FMVA 5HODA 2D2WA 1D5YA 4BDZA 2IP2A 2BVMA 3CZ6A 3M8FA 2DODA 2GIZA 2P6TA 4CICA 2HXOA 5DD8A 4XBFA 1MSEC 1UAAA 1Z7LA 3FISA 5KVRA 3ZQIA 2DA2A 4UXNA 1TQPA 1WH5A 3R61A 1JE8A 4ESBA 3Q0WA 2HQ5A 2CQNA 2LH9A 4O3MA 1PDNC 1OJLA 2ESHA 4ZDPA 1YW9A 4Z6YA 5IOYA 2WAQA 1HBXG 2L02A 3VWBA 3L9FA 3M9AA 2UZKA 1FTZA 4IHTA 1Z0XA 2WV0A 2HTSA 4HF0A 3FZVA 2W82A 4F91B 2ZXJA 2VQHA 4RAZA 1PUFB 2UXNA 3L2CA 1KYZA 4CO8A 4CCLA 3C2BA 4XKBA 3RSNA 5EZGA 2EA2A 3IV5A 4KMUX 3ZPLA 3GFJA 1AOYA 3ABLH 5HNFA 3BQZA 3OY9A 1VTNC 4B09A 3T5XA 3ONQA 4II3A 2VI6A 3Q3SA 2R5ZB 1GVDA 2R7OA 1HKSA 3FBIB 1WSUA 1J59A 2MH2A 1OCRH 3WG9A 2JPBA 3DKXA 1IN6A 2MBFA 5L3GA 1JT0A 1FP1D 4B47A 1ZELA 3TOBA 4UNOA 3L09A 1RUOA 1KA8A 3BTCA 1U78A 4HBLA 2ZNZA 4BQNA 3BR3A 3K9TA 1TQMA 2L9VA 4GGGA 3JRCA 2M4GA 1QZZA 1ETYA 1J75A 3RQIA 4IQJA 3HGGA 2KFDA 3UKGA 3NARA 4C9YA 1T0FC 2F5FA 5JR3A 5DYMA 2L7MP 2Z5UA 1F36A 1W5TA 2K86A 3J7YJ 2MFZA 5GTIC 2V6EA 1TT0A 1ZG5A 2QKLB 1W1WE 5B1AH 3CMMA 2L7KA 1IDZA 3WE2A 3H5AA 3RZDJ 4BQOA 2HI3A 1D1AA 2KIFA 4WX9A 1HQCA 4G94A 3ECHA 3ROUA 1LFBA 2O03A 3W2WA 1AU7A 2L7FP 2F4MB 1SMTA 1JI8A 2CMPA 3CCMI 1IAWA 1W7PD 2OAZA 4Y17A 1LE8B 5TISC 3LSRA 2W1OA 1TL8A 3MMYB 4PFOA 5FLXK 4PZJA 2VXZA 5JVTA 1N25A 2XROA 1O3RA 2OQRA 3F6VA 4GYIA 3I58A 2TDXA 3FXRA 1SVLA 2OU2A 3GF2A 3LSGA 3V7CA 2VE8A 3LA2A 2EV5A 2HZDA 3WTUC 1ULYA 3B6AA 2XAQA 5LEJA 3A02A 5EDNA 4OWRB 2VOPA 2QSGX 1A31A 2J5OA 3J80Z 5TRDA 4L5IA 4EJWA 2WAEA 5E8IA 3E1SA 4L0ZB 1MJAA 3NQOA 1WWXA 5DDGA 1MDMA 4AVPA 5EZHA 1XDUA 2QZ8A 4BXXJ 2LVSA 2DBBA 1SD6A 3GXOA 3QPSA 2DW4A 3QYEA 3S1MJ 2OCEA 3VEPA 4HNVA 3OS2A 3WGGA 2FE3A 5F64A 2TCTA 1W4MA 4HNTA 4F55A 1FJLA 4FX4A 2V4JC 5FKKA 4CDGA 5J1RA 3KETA 4IEJA 2XV4S 2ID3A 2GQQA 4BHBA 1KU2A 2M87A 3BR2A 4DYQA 1YHQI 1DPRA 2Y0MA 3HM5A 2XKOA 3AG3H 3G1MA 2HYJA 3F72A 1K79A 1W7PA 2OBPA 3F3XA 2IGNA 1I50J 1R4MB 2EBIA 5ICCA 3N4MA 3FKJA 2ZO4A 1EA3A 2EQRA 1ZYRF 4AVZA 3I0TA 2A3SA 5LRRA 4DQ2A 2YX4A 3H35A 3OL3A 3SZGA 5HLTA 1BJZA 3CCVI 2CV1A 1CGPA 2D1HA 2LNBA 3HOZJ 1YW7A 4A3BJ 3M8JA 3WG7H 4D5FA 5FKMA 1QHHD 1T39A 4IOAF 1P7JA 2EFNA 1G4DA 1RRJA 2KRCA 3EYIA 4DJAA 1SEUA 1ZKGA 1TP4A 2IA0A 5FLMJ 2PMZA 1IXSB 3OIQA 4XORA 2Q2EA 1S3JA 5HLHA 3PO3J 1B1BA 5CYVA 2PX9A 4CCOA 1R5GA 3I54A 1LPQA 1G59A 3MZHA 3BJ6A 1O3QA 2GXAA 4FE4A 1R49A 4KNYA 4L5EA 1HC8A 1WJFA 2M8EA 3ZN1A 5DUKA 3BY6A 3E5XA 3BTIA 2QUFA 3BR1A 3F9KA 3Q9VA 4IF4A 5CVRA 3DTEA 3MKYB 2XGDA 4M3FA 4FISA 2NAZA 4YIRX 3M7GA 3S17J 1BW6A 3OWTA 1BOAA 3BOQA 2LBFA 2CGPA 3K69A 2X51A 3MN2A 2QENA 3G3ZA 4QPQA 3IRQA 4KYWA 2MW8A 3AG2H 5EEHA 2X6OA 4LB5A 2H8RA 1LJ9A 1XGSA 3AG4H 4PJJA 1R36A 3L2QA 5DTDA 3BR6A 3I5UA 5L3FA 5B5EC 1HKQA 2FUG2 4RLQA 2QGUA 4XKCA 5J1UA 3W3CA 4UB8C 4AWXB 3ERMA 4FX0A 4I09A 4OMZA 3FK7A 4WXHA 5EJCA 3SJMA 3LNQA 4Y4RA 3FHNA 3UNGC 4DYRA 3VSLA 1V5FA 1RR8C 1BR4A 2KJBA 2FX0A 3GZ5A 3CDHA 3LQQA 4G7HF 4MTDA 2AQEA 3CCRI 2ZFWA 3C2GA 2EZHA 4MNUA 4CGZA 1A36A 3FM5A 5FLXZ 3H3VK 1W7PB 1UJ8A 4M73A 2DO7A 3V7RA 4LMYA 2CH0A 3CLOA 2QBYB 4EJOA 1ON1A 2DYSH 5EF6A 3CF5F 5C3EJ 3RQ4A 1LNWA 2ID6A 2WTEA 2M3AA 3L1PA 1FSEA
chains in the Genus database with same CATH topology
1YRNA 4XK4A 1TWFJ 5EGOB 5C4XJ 2Y31A 3FKIJ 4A3GJ 4A3LJ 3S2DJ 5M5WJ 2NOGA 1GV2A 2N8GA 1GT0C 4M3BA 1JTXA 2NVXJ 3K2AA 2YUSA 1SFOJ 1FIPA 1JKQC 3A03A 3OSGA 4UUSB 3JRGA 2XPVA 3BR0A 4NDLA 2LD5A 5EGOA 3F0CA 5IP9J 2XGCA 4XICA 2P81A 2DA5A 1ZK8A 1ZR2A 2OPTA 2ME6A 3JRDA 4BY1J 1RETA 2QF7A 9ANTA 5IPAA 4A3MJ 4BBRJ 2L7ZA 4JX4A 1U8BA 2Y9YA 3LSJA 2EZLA 4MLOA 3ZQHA 2HOSA 1ETOA 3GTMJ 2TRTA 4A3KJ 2DA6A 3G1OA 3S1QJ 2DJNA 4C3JJ 1OCPA 4D5CA 4A93J 2WAQN 1PUFA 2DN0A 1NK3P 2NVQJ 2QCOA 4DYCA 5C4JJ 2HOTA 1XS9A 3BG9A 2AO9A 1FIAA 4LOCA 1JT6A 1XG1A 1P7IA 3HOUJ 2CUFA 4G12A 1IG7A 4Y52J 3GTOJ 4XIDA 5BNGA 2Y2ZA 4RDUA 3S14J 3ZQLA 2L0KA 3RZOJ 1MBKA 4JX5A 4AUXA 4M3EA 2JN6A 2R92J 4MIMA 2CJJA 2NS7A 2ME0A 5GP9A 2KDZA 1WCMJ 3IH2A 4W1UA 3WHCA 1VNDA 5GPAA 1MBGA 3A01B 2JA5J 1RKWA 2MG4A 3DEWA 5EG0B 2Y9ZA 5IYDJ 2JK3A 4RBOA 5FLVA 4ABZA 2YS9A 4S0HB 2XB0X 1TWGJ 2Y30A 4AYBN 1IJWC 3HB9A 2WV1A 1I3QJ 4D7NA 2MSYA 1WPKA 2AHQA 1QPIA 2DMQA 2EZIA 3O8HA 3O8GA 3W6VA 4FTHA 3A01A 5EG0A 1JKPC 1HOMA 3CQZJ 1IV6A 2M0CA 3DCFA 3H0GJ 5F08A 4X1EA 5IOZA 3D1NI 1F43A 4JX6A 1B72A 2DMUA 2M34A 2XB5A 2HDDA 3TP0A 4IHYA 2LK2A 3B6CA 3TP3A 4A3DJ 1SANA 1POGA 1AKHB 4C3HJ 2VKEA 3BQYA 1QRYA 1APLC 1ZGWA 3HGYA 4D7MA 3IH3A 4A3FJ 2K9SA 3K7AJ 4EEFG 1UG2A 1MBJA 2XPWA 2R93J 3ZQCA 5M5YJ 4B1RA 5FKLA 1GDTA 4B4CA 2K9QA 1AKHA 3FIWA 3BG3A 3S1RJ 4QSHA 1H8AC 1LE8A 2HXIA 5HODA 1D5YA 5EEAA 1RPWA 3CMYA 3GTKJ 2DA7A 3JR9A 5K7FA 2LY9A 1H89C 5F1JA 1O4XA 2HXOA 1MSEC 3FISA 1IC8A 1EF4A 2W48A 3ZQIA 2DA2A 1ITYA 1WH5A 2LKXA 3Q0WA 2HQ5A 1UMQA 5M5XJ 3MVPA 5JLXA 2MGQA 1U9OA 2DA1A 5DS9A 3NAUA 1DU0A 1OJLA 1B8IA 2WB1N 5IOYA 4FE7A 1ETQA 1TWCJ 1FTZA 1Z0XA 2R7ZJ 1TC3C 5IP6A 2LR8A 1PUFB 2VPRA 4W97A 3TW7A 1AHDP 2I10A 3TEDA 1BL0A 3C2BA 1JUSA 5EZGA 4XRMA 3IV5A 4M6VA 4C2MJ 4IHWA 2VUMJ 1I6HJ 1G2HA 3Q0UA 4FCYA 1FEXA 3BQZA 4XRSA 1OCTC 2CUEA 4MO7A 4C3IJ 2VI6A 3Q3SA 4DZJA 2R5ZB 2B63J 1GVDA 1ETXA 1QVUA 2XGEA 2YU9J 3S16J 1ENHA 5IP7J 1W0UA 4M3GA 1LFUP 1JT0A 1HLVA 5E3NA 2HOAA 5C44J 2ZB9A 3BTCA 1MH4A 1T56A 2DMPA 3VPRA 2R5ZA 1U78A 3BR3A 2E2HJ 2NVYJ 1K61A 3JRCA 1ETYA 2O7OA 3RQIA 2FQ4A 3SFIA 3HGGA 1S7EA 3BG5A 3UKGA 3NARA 1HF0A 2EH3A 1K83J 1WGXA 2E2JJ 1T33A 2L7MP 4QTRA 1F36A 3IH4A 4A3JJ 5E3OA 1B72B 1RR7A 2M8GX 1MBEA 1ORKA 2PMZN 1MBFA 3HOYJ 4BY7J 4B3AA 2XRLA 3M3YJ 2FJ1A 2IEKA 2CQXA 1IDZA 3M4OJ 3RZDJ 2HI3A 2GM4A 2E1OA 1VFCA 1JJ6C 2LFBA 1OFCX 1LFBA 1RKTA 2LP0A 1AU7A 2L7FP 1JGGA 2KT0A 1JUMA 3HOWJ 1LE8B 3LSRA 2D5VA 3CDLA 3S15J 1A6IA 2R5YB 2R0QC 3SDGA 5J1YA 3TW6A 3HOXJ 3HEFA 3GBGA 2CQQA 3LSGA 1BW5A 3HBLA 3B6AA 4XRSG 3LSPA 3A02A 1H88C 5EDNA 3PM1A 1GV5A 5F27A 1MH3A 1Z77A 4JYKA 2FD5A 2M2EA 2JWTA 2R5YA 4JP0A 1Y1WJ 1B8IB 4CYCA 3Q0VA 2E2IJ 5J3LA 2CRGA 5EZHA 5K7HA 1MNMC 4BXXJ 3OOUA 2LVSA 1TWAJ 5FJ8J 3QPSA 2GLOA 4BKXA 3S1MJ 3JREA 4HNVA 2K9NA 2TCTA 3HOVJ 1E3OC 1FJLA 4A69C 5FKKA 4A3CJ 2E19A 5J1RA 1TWHJ 4IEJA 2ID3A 2NS8A 3BTJA 3CCYA 3BR2A 4DYQA 5FKNA 2H1KA 3HM5A 3G1MA 2HYJA 2IBDA 3ZQGA 1I50J 2EBIA 3I4MJ 4DW6A 5M3FJ 1MBHA 4J19A 2EQRA 2GBYA 5F0HA 3OSFA 4A3EJ 1HDPA 2JA7J 1ZTRA 2VKVA 2O9LA 5F0FA 2NVTJ 1BJZA 2XPUA 1GUUA 4IHVA 5JLWA 1X2MA 2ECBA 4AC0A 3HOZJ 4A3IJ 4A3BJ 2L9RA 4D5FA 5FKMA 2DTZA 5EYRA 1A5JA 1JKOC 5FKOA 1Q1VA 1P7JA 2EZKA 1NK2P 5IYCJ 2DA3A 3QQAA 1ZKGA 5K7ZA 5FLMJ 4UUSA 3ZQFA 2ELKA 3PO3J 3JRAA 3JRFA 2OF7A 4X6AJ 1JJ8C 4Y7NJ 1X2NA 3I4NJ 4FE4A 1U9NA 3ZOBA 4L5EA 1VI0A 2X9DA 1BA5A 1NTCA 3BTIA 3BR1A 1MSFC 1DU6A 3BR5A 4I6ZA 2XGDA 4M3FA 4FISA 1HCRA 3S17J 1BW6A 3QPLA 5F0CA 5E3LA 1JKRC 1ZR4A 1IDYA 3GTGJ 1ETWA 3MN2A 1JTYA 3GTQJ 3PO2J 4QIWN 3HKZN 4GFBA 2IAIA 2ECCA 1IGNA 5IYBJ 3RKQA 1CQTA 1IUFA 2MW8A 2LTPA 1ZQ3P 2X6OA 4MFEA 3WHBA 3FK6A 5E3MA 4M3DA 3BT9A 3JRHA 3MKLA 2H8RA 3GTJJ 2XSDC 5GPCA 5DTDA 1ETVA 3BR6A 3GTLJ 1Y1VJ 2RAEA 5F04A 5J1UA 3LOCA 4CYCB 1VF9A 1ETKA 1JUPA 3JRBA 2JJ7A 1WH7A 1QVTA 1IRZA 1HDDC 1UHSA 3G1LA 3S2HJ 2M9HA 2Y0SN 3OIOA 3FK7A 3E7LA 3HDDA 1WI3A 2DMTA 4V2FA 3SJMA 3LNQA 1RESA 2COBA 4I76A 2CU7A 2X48A 1X58A 4DYRA 3JRIA 2FX0A 3GTPJ 4DZPA 2DMNA 1XC5A 2JMWA 2K40A 4UUTA 4MFDA 1YRNB 2JA8J 2EZHA 4BBSJ 3H3VK 4IHXA 3BTLA 3S1NJ 2G0EA 5EF6A 2O8KA 1W0TA 5M3MJ 5C3EJ 1FTTA 4V2GA 2ID6A 1R9TJ 2DA4A 2LLKA 3L1PA 2JA6J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRN A;  4XK4 A;  1TWF J;  5EGO B;  5C4X J;  2Y31 A;  3FKI J;  4A3G J;  4A3L J;  3S2D J;  5M5W J;  2NOG A;  1GV2 A;  2N8G A;  1GT0 C;  4M3B A;  1JTX A;  2NVX J;  3K2A A;  2YUS A;  1SFO J;  1FIP A;  1JKQ C;  3A03 A;  3OSG A;  4UUS B;  3JRG A;  2XPV A;  3BR0 A;  4NDL A;  2LD5 A;  5EGO A;  3F0C A;  5IP9 J;  2XGC A;  4XIC A;  2P81 A;  2DA5 A;  1ZK8 A;  1ZR2 A;  2OPT A;  2ME6 A;  3JRD A;  4BY1 J;  1RET A;  2QF7 A;  9ANT A;  5IPA A;  4A3M J;  4BBR J;  2L7Z A;  4JX4 A;  1U8B A;  2Y9Y A;  3LSJ A;  2EZL A;  4MLO A;  3ZQH A;  2HOS A;  1ETO A;  3GTM J;  2TRT A;  4A3K J;  2DA6 A;  3G1O A;  3S1Q J;  2DJN A;  4C3J J;  1OCP A;  4D5C A;  4A93 J;  2WAQ N;  1PUF A;  2DN0 A;  1NK3 P;  2NVQ J;  2QCO A;  4DYC A;  5C4J J;  2HOT A;  1XS9 A;  3BG9 A;  2AO9 A;  1FIA A;  4LOC A;  1JT6 A;  1XG1 A;  1P7I A;  3HOU J;  2CUF A;  4G12 A;  1IG7 A;  4Y52 J;  3GTO J;  4XID A;  5BNG A;  2Y2Z A;  4RDU A;  3S14 J;  3ZQL A;  2L0K A;  3RZO J;  1MBK A;  4JX5 A;  4AUX A;  4M3E A;  2JN6 A;  2R92 J;  4MIM A;  2CJJ A;  2NS7 A;  2ME0 A;  5GP9 A;  2KDZ A;  1WCM J;  3IH2 A;  4W1U A;  3WHC A;  1VND A;  5GPA A;  1MBG A;  3A01 B;  2JA5 J;  1RKW A;  2MG4 A;  3DEW A;  5EG0 B;  2Y9Z A;  5IYD J;  2JK3 A;  4RBO A;  5FLV A;  4ABZ A;  2YS9 A;  4S0H B;  2XB0 X;  1TWG J;  2Y30 A;  4AYB N;  1IJW C;  3HB9 A;  2WV1 A;  1I3Q J;  4D7N A;  2MSY A;  1WPK A;  2AHQ A;  1QPI A;  2DMQ A;  2EZI A;  3O8H A;  3O8G A;  3W6V A;  4FTH A;  3A01 A;  5EG0 A;  1JKP C;  1HOM A;  3CQZ J;  1IV6 A;  2M0C A;  3DCF A;  3H0G J;  5F08 A;  4X1E A;  5IOZ A;  3D1N I;  1F43 A;  4JX6 A;  1B72 A;  2DMU A;  2M34 A;  2XB5 A;  2HDD A;  3TP0 A;  4IHY A;  2LK2 A;  3B6C A;  3TP3 A;  4A3D J;  1SAN A;  1POG A;  1AKH B;  4C3H J;  2VKE A;  3BQY A;  1QRY A;  1APL C;  1ZGW A;  3HGY A;  4D7M A;  3IH3 A;  4A3F J;  2K9S A;  3K7A J;  4EEF G;  1UG2 A;  1MBJ A;  2XPW A;  2R93 J;  3ZQC A;  5M5Y J;  4B1R A;  5FKL A;  1GDT A;  4B4C A;  2K9Q A;  1AKH A;  3FIW A;  3BG3 A;  3S1R J;  4QSH A;  1H8A C;  1LE8 A;  2HXI A;  5HOD A;  1D5Y A;  5EEA A;  1RPW A;  3CMY A;  3GTK J;  2DA7 A;  3JR9 A;  5K7F A;  2LY9 A;  1H89 C;  5F1J A;  1O4X A;  2HXO A;  1MSE C;  3FIS A;  1IC8 A;  1EF4 A;  2W48 A;  3ZQI A;  2DA2 A;  1ITY A;  1WH5 A;  2LKX A;  3Q0W A;  2HQ5 A;  1UMQ A;  5M5X J;  3MVP A;  5JLX A;  2MGQ A;  1U9O A;  2DA1 A;  5DS9 A;  3NAU A;  1DU0 A;  1OJL A;  1B8I A;  2WB1 N;  5IOY A;  4FE7 A;  1ETQ A;  1TWC J;  1FTZ A;  1Z0X A;  2R7Z J;  1TC3 C;  5IP6 A;  2LR8 A;  1PUF B;  2VPR A;  4W97 A;  3TW7 A;  1AHD P;  2I10 A;  3TED A;  1BL0 A;  3C2B A;  1JUS A;  5EZG A;  4XRM A;  3IV5 A;  4M6V A;  4C2M J;  4IHW A;  2VUM J;  1I6H J;  1G2H A;  3Q0U A;  4FCY A;  1FEX A;  3BQZ A;  4XRS A;  1OCT C;  2CUE A;  4MO7 A;  4C3I J;  2VI6 A;  3Q3S A;  4DZJ A;  2R5Z B;  2B63 J;  1GVD A;  1ETX A;  1QVU A;  2XGE A;  2YU9 J;  3S16 J;  1ENH A;  5IP7 J;  1W0U A;  4M3G A;  1LFU P;  1JT0 A;  1HLV A;  5E3N A;  2HOA A;  5C44 J;  2ZB9 A;  3BTC A;  1MH4 A;  1T56 A;  2DMP A;  3VPR A;  2R5Z A;  1U78 A;  3BR3 A;  2E2H J;  2NVY J;  1K61 A;  3JRC A;  1ETY A;  2O7O A;  3RQI A;  2FQ4 A;  3SFI A;  3HGG A;  1S7E A;  3BG5 A;  3UKG A;  3NAR A;  1HF0 A;  2EH3 A;  1K83 J;  1WGX A;  2E2J J;  1T33 A;  2L7M P;  4QTR A;  1F36 A;  3IH4 A;  4A3J J;  5E3O A;  1B72 B;  1RR7 A;  2M8G X;  1MBE A;  1ORK A;  2PMZ N;  1MBF A;  3HOY J;  4BY7 J;  4B3A A;  2XRL A;  3M3Y J;  2FJ1 A;  2IEK A;  2CQX A;  1IDZ A;  3M4O J;  3RZD J;  2HI3 A;  2GM4 A;  2E1O A;  1VFC A;  1JJ6 C;  2LFB A;  1OFC X;  1LFB A;  1RKT A;  2LP0 A;  1AU7 A;  2L7F P;  1JGG A;  2KT0 A;  1JUM A;  3HOW J;  1LE8 B;  3LSR A;  2D5V A;  3CDL A;  3S15 J;  1A6I A;  2R5Y B;  2R0Q C;  3SDG A;  5J1Y A;  3TW6 A;  3HOX J;  3HEF A;  3GBG A;  2CQQ A;  3LSG A;  1BW5 A;  3HBL A;  3B6A A;  4XRS G;  3LSP A;  3A02 A;  1H88 C;  5EDN A;  3PM1 A;  1GV5 A;  5F27 A;  1MH3 A;  1Z77 A;  4JYK A;  2FD5 A;  2M2E A;  2JWT A;  2R5Y A;  4JP0 A;  1Y1W J;  1B8I B;  4CYC A;  3Q0V A;  2E2I J;  5J3L A;  2CRG A;  5EZH A;  5K7H A;  1MNM C;  4BXX J;  3OOU A;  2LVS A;  1TWA J;  5FJ8 J;  3QPS A;  2GLO A;  4BKX A;  3S1M J;  3JRE A;  4HNV A;  2K9N A;  2TCT A;  3HOV J;  1E3O C;  1FJL A;  4A69 C;  5FKK A;  4A3C J;  2E19 A;  5J1R A;  1TWH J;  4IEJ A;  2ID3 A;  2NS8 A;  3BTJ A;  3CCY A;  3BR2 A;  4DYQ A;  5FKN A;  2H1K A;  3HM5 A;  3G1M A;  2HYJ A;  2IBD A;  3ZQG A;  1I50 J;  2EBI A;  3I4M J;  4DW6 A;  5M3F J;  1MBH A;  4J19 A;  2EQR A;  2GBY A;  5F0H A;  3OSF A;  4A3E J;  1HDP A;  2JA7 J;  1ZTR A;  2VKV A;  2O9L A;  5F0F A;  2NVT J;  1BJZ A;  2XPU A;  1GUU A;  4IHV A;  5JLW A;  1X2M A;  2ECB A;  4AC0 A;  3HOZ J;  4A3I J;  4A3B J;  2L9R A;  4D5F A;  5FKM A;  2DTZ A;  5EYR A;  1A5J A;  1JKO C;  5FKO A;  1Q1V A;  1P7J A;  2EZK A;  1NK2 P;  5IYC J;  2DA3 A;  3QQA A;  1ZKG A;  5K7Z A;  5FLM J;  4UUS A;  3ZQF A;  2ELK A;  3PO3 J;  3JRA A;  3JRF A;  2OF7 A;  4X6A J;  1JJ8 C;  4Y7N J;  1X2N A;  3I4N J;  4FE4 A;  1U9N A;  3ZOB A;  4L5E A;  1VI0 A;  2X9D A;  1BA5 A;  1NTC A;  3BTI A;  3BR1 A;  1MSF C;  1DU6 A;  3BR5 A;  4I6Z A;  2XGD A;  4M3F A;  4FIS A;  1HCR A;  3S17 J;  1BW6 A;  3QPL A;  5F0C A;  5E3L A;  1JKR C;  1ZR4 A;  1IDY A;  3GTG J;  1ETW A;  3MN2 A;  1JTY A;  3GTQ J;  3PO2 J;  4QIW N;  3HKZ N;  4GFB A;  2IAI A;  2ECC A;  1IGN A;  5IYB J;  3RKQ A;  1CQT A;  1IUF A;  2MW8 A;  2LTP A;  1ZQ3 P;  2X6O A;  4MFE A;  3WHB A;  3FK6 A;  5E3M A;  4M3D A;  3BT9 A;  3JRH A;  3MKL A;  2H8R A;  3GTJ J;  2XSD C;  5GPC A;  5DTD A;  1ETV A;  3BR6 A;  3GTL J;  1Y1V J;  2RAE A;  5F04 A;  5J1U A;  3LOC A;  4CYC B;  1VF9 A;  1ETK A;  1JUP A;  3JRB A;  2JJ7 A;  1WH7 A;  1QVT A;  1IRZ A;  1HDD C;  1UHS A;  3G1L A;  3S2H J;  2M9H A;  2Y0S N;  3OIO A;  3FK7 A;  3E7L A;  3HDD A;  1WI3 A;  2DMT A;  4V2F A;  3SJM A;  3LNQ A;  1RES A;  2COB A;  4I76 A;  2CU7 A;  2X48 A;  1X58 A;  4DYR A;  3JRI A;  2FX0 A;  3GTP J;  4DZP A;  2DMN A;  1XC5 A;  2JMW A;  2K40 A;  4UUT A;  4MFD A;  1YRN B;  2JA8 J;  2EZH A;  4BBS J;  3H3V K;  4IHX A;  3BTL A;  3S1N J;  2G0E A;  5EF6 A;  2O8K A;  1W0T A;  5M3M J;  5C3E J;  1FTT A;  4V2G A;  2ID6 A;  1R9T J;  2DA4 A;  2LLK A;  3L1P A;  2JA6 J; 
#chains in the Genus database with same CATH topology
 4HX7 A;  5K5Q A;  2FF4 A;  3SXY A;  3CJT B;  4A2U A;  4XK4 A;  1ZLK A;  2Y31 A;  3FKI J;  3K1P A;  2Z16 A;  3OYK A;  5D5W B;  4A3L J;  3S2D J;  5M5W J;  1GV2 A;  1Z3X A;  1WJC A;  3QP5 A;  4KIC A;  4M3B A;  3HC7 A;  3WU2 C;  2FU4 A;  1XMX A;  1FIP A;  1RC9 A;  2VJ5 A;  4B44 A;  5LFA A;  3OSG A;  4XKW A;  3JRG A;  5LGU A;  2XPV A;  2LD5 A;  5JHU A;  1FX7 A;  5EGO A;  4YEL A;  4L0Y B;  2O0Y A;  3OYJ A;  1K7A A;  3OYI A;  1ZAO A;  1Z91 A;  2OPT A;  2DFF A;  2EIM H;  3JRD A;  1RET A;  9ANT A;  3EUH A;  4A3M J;  1G3T A;  4WF2 A;  3OS1 A;  4RB1 A;  2EZL A;  3ZQH A;  1LDJ A;  3WE3 A;  1J7K A;  3GTM J;  5IT9 K;  5IY5 H;  1Z9C A;  3G1O A;  3IAM 2;  4B48 A;  3S1Q J;  2XSJ C;  5J8C A;  1FOX A;  4ZTJ A;  2WAQ N;  2NVQ J;  1BIB A;  5E18 F;  5L3C A;  3OV8 A;  1FYK A;  1WJD A;  4L9T A;  2MYS A;  4ZDL A;  4ZYD A;  1I3A A;  3HKZ A;  1MGT A;  1SFU A;  2V6C A;  1IRF A;  5J40 A;  4PSX A;  2UWM A;  1S7A A;  5FRN A;  1P7I A;  1LVA A;  4G12 A;  4M71 A;  1IG7 A;  4Y52 J;  2Y75 A;  2VXD A;  1I5Z A;  5K1Y A;  3S14 J;  3FF5 A;  3ZQL A;  2H27 A;  4II2 A;  2FBK A;  2JN6 A;  4M3E A;  3CF2 A;  1BN5 A;  2EA4 A;  2WC2 A;  3TDZ C;  3WHC A;  2E36 A;  2GXB A;  4ANJ A;  2MG4 A;  5DCF A;  3RKW A;  2KRF A;  4D1Q A;  2JK3 A;  2VB6 A;  3FX3 A;  2OA4 A;  3ELK A;  4DGW B;  1P4A A;  1BR2 A;  2K85 A;  4G7O F;  2LOO A;  4YFX F;  5J6X A;  5JVG F;  4D7N A;  1QPI A;  2DMQ A;  2VQC A;  3O8H A;  4S04 A;  3FDY A;  3W6V A;  3K4K A;  2QSF X;  3DFG A;  1ACI A;  1YFH A;  2F5V A;  5HDN A;  3K4N A;  4HF2 A;  5CVV A;  1ZRE A;  3KYC B;  4X1E A;  3BRO A;  3I4P A;  4JX6 A;  1B72 A;  2X4H A;  3TP3 A;  4J01 A;  2DXI A;  4A3D J;  3CJR B;  1SAN A;  2VKE A;  1APL C;  2ZJ2 A;  3ABT A;  4D7M A;  2K9S A;  4KN4 X;  3GWZ A;  3T1B A;  5KK1 A;  2LKP A;  4M9Z A;  3BP8 A;  3E97 A;  1OCC H;  3I64 A;  3ZQC A;  4BNC A;  4OIQ F;  3OIP A;  3WTZ A;  1EH8 A;  4BS9 A;  2MC4 A;  1B6A A;  3HPH A;  2CW8 A;  1GDT A;  1DGW Y;  1TQI A;  1IXR C;  1Q1H A;  3BCB A;  3I59 A;  3BPV A;  2IS2 A;  4P1W A;  2VJJ A;  3FMR A;  3S1R J;  2FOW A;  3LST A;  1U3E M;  2IS6 A;  2CV2 A;  1X1P A;  3EUH C;  3JR9 A;  4BQA A;  2KIM A;  4BXF A;  2A61 A;  2Z99 A;  4XL9 A;  2PJP A;  3OYF A;  1X3Z B;  5HVQ C;  1H9G A;  5D5X B;  5D8K B;  4BHC A;  1AWC A;  1UMQ A;  5M5X J;  2MAB A;  1B9M A;  2DFH A;  3PNY A;  1DU0 A;  4Y15 A;  1FBS A;  2NRA C;  2VOD A;  4BE2 A;  1Z6T A;  2BVL A;  4A0X A;  2VJ4 A;  4BE0 A;  1B8I A;  1UG0 A;  4FE7 A;  1BR1 A;  3HOS A;  1TWC J;  5H20 A;  2NNY A;  1FOW A;  1Z7U A;  1FP2 A;  3MKZ A;  1IRX A;  2LR8 A;  3QYB A;  3W6K B;  1P2F A;  2V7F A;  4U0W A;  4XLH A;  2LC2 A;  2NVU B;  5HOO A;  1AHD P;  2LSO A;  5CVU A;  2KQR A;  2L01 A;  5FD5 A;  1BL0 A;  1JUS A;  2L5Q A;  3PSI A;  4M6V A;  3FXQ A;  4C2M J;  2XAJ A;  3JSP A;  1A35 A;  4IHW A;  2OZU A;  5ILS A;  4FCY A;  1FEX A;  2CG4 A;  3BWG A;  1EKE A;  4JK1 X;  1S72 I;  3ESW B;  3GO5 A;  1BJA A;  2CUJ A;  3DU6 A;  2YU9 J;  1ENH A;  1HXD A;  5ICG A;  3KIO A;  3ERE D;  5IP7 J;  2VJI A;  4U7D A;  2F4O B;  2BGC A;  3GLL A;  3R0A A;  1YG2 A;  4M3G A;  3VB2 A;  3COA C;  1LFU P;  1HLV A;  2LYC A;  3F6O A;  4EJT A;  2HOA A;  4M72 A;  1OR7 C;  2BZT A;  2ZB9 A;  3I56 I;  3VYU B;  1MH4 A;  2LRD A;  2R5Z A;  1MMA A;  3K6G A;  5D8L B;  4EQQ A;  3F21 A;  2NVY J;  1YS6 A;  2WAD A;  3GVA A;  4NQW A;  2O3F A;  4RMN A;  2O7O A;  2FQ4 A;  2PLY A;  2KMU A;  2OQG A;  3BC8 A;  4S05 A;  5IT9 Z;  1E3H A;  3B02 A;  2E2J J;  1T33 A;  3P7N A;  1D8J A;  2IGK A;  3IH4 A;  2A05 A;  4L9V A;  3ZXS A;  1IN5 A;  1B72 B;  1RR7 A;  2E1C A;  4GDF A;  1MBE A;  2A68 F;  2PMZ N;  1BI1 A;  3E5U A;  4HQM A;  3HOY J;  5B1B H;  2XRL A;  2HTJ A;  3BCA A;  4EGY A;  1QGP A;  2FEZ A;  3S3O A;  4ZZD A;  1I1S A;  3K4J A;  2QYO A;  3CCE I;  1SD5 A;  3R0J A;  3ZGK A;  4HF1 A;  1X1B A;  3CP8 A;  4XLN F;  2LFB A;  1OFC X;  1BC8 C;  2VON A;  4FQG A;  1V3F A;  1JUM A;  2VC0 A;  3HOW J;  2G9W A;  4XSX F;  2F5D A;  3CC4 I;  4ZTF A;  3CDL A;  1R1T A;  4HG2 A;  3HZJ A;  3S8P A;  3IWF A;  4D9J A;  2R5Y B;  2R7U A;  4BXU A;  2CSO A;  3JSO A;  3TW6 A;  3ASO H;  3P5J A;  3PQJ A;  2O6G E;  1BW5 A;  2DOE A;  3H3Z A;  3P9C A;  2FRH A;  3LSP A;  4A5N A;  3F8M A;  3H0D A;  3PM1 A;  3MD2 A;  1GV5 A;  2E71 A;  5CPR B;  3ZMU A;  1Z77 A;  3TO7 A;  4JYK A;  2FD5 A;  5FRO A;  3ZN0 A;  1J9I A;  4QWQ A;  5DCM B;  1B8I B;  2RDP A;  2HEO A;  1Z21 A;  1MIJ A;  3RTR A;  5J3L A;  3GX4 X;  3FXJ A;  5K7H A;  4CCJ A;  3OOU A;  3CCL I;  1TWA J;  1B4A A;  5JI6 A;  4MQV A;  2MLG A;  5DV5 A;  4PCQ A;  1ZH5 A;  3CES A;  5HLG A;  4XLA A;  2DLL A;  1E3O C;  4XQF A;  3Q9S A;  4A69 C;  1ZRD A;  4WCG A;  2STT A;  2JSP A;  2E19 A;  1Y8R B;  3HRT A;  3K4C A;  4ITV A;  2NS8 A;  1FNN A;  4HV5 A;  3BTJ A;  2JRM A;  1STZ A;  3EPZ A;  2H1K A;  3KP5 A;  2DFE A;  1V55 H;  2CFO A;  3M07 A;  3ZCO A;  4Y3O A;  1KQ9 A;  4HDV A;  1FSH A;  2JPC A;  2XF6 A;  3O6B B;  2VN2 A;  5M3F J;  2W85 A;  4J19 A;  4BHP A;  2V9K A;  2BYV E;  1SVO A;  1FZP B;  5KCM A;  1ZTR A;  3RDI A;  1D1C A;  2W7N A;  4F92 B;  4P9F A;  2CV0 A;  2P8T A;  3ASN H;  4F7Z A;  4BJT A;  2A6H F;  4AC0 A;  1EH7 A;  2L9R A;  4NQW B;  5EYR A;  3E6B A;  4OIN F;  5BMZ A;  1A5J A;  5HNH A;  4E7L A;  1LFP A;  5AIQ A;  2EZK A;  1Y56 A;  1C0W A;  5IYC J;  2DA3 A;  4Q47 A;  2X6W A;  5K7Z A;  2VKD A;  3ULQ B;  4UUS A;  2K9M A;  3ZQF A;  3GZN B;  3GEZ A;  2L9N A;  3K0L A;  3MZ8 A;  4HLX A;  4G6T B;  1KQ0 A;  3SZP A;  2PQ8 A;  1T38 A;  3N97 A;  3I71 A;  2ZKZ A;  1VI0 A;  3CJQ B;  4Z2Y A;  1FYM A;  4BGD A;  1BA5 A;  2FOK A;  4XLF A;  2EFO A;  5CKT A;  1F5T A;  2QQ9 A;  2BXY A;  5GTH C;  1X3U A;  2K4B A;  1R00 A;  3WTS C;  3QPL A;  5E3L A;  3NRV A;  1FOK A;  3GTG J;  3E6C C;  1ON2 A;  4QIW N;  3HKZ N;  4GFB A;  1KU9 A;  1IGN A;  5IYB J;  4RGS A;  3JAM K;  4MEX F;  3A2K A;  2XGX A;  4M9S A;  3C7J A;  1QZE A;  3TGN A;  5KAF C;  4MFE A;  3FMQ A;  2P7V B;  1ZQ3 P;  3FK6 A;  4MTE A;  3AAF A;  3P9K A;  4MGR A;  3MKL A;  1T08 B;  2ICW G;  1QHG A;  3V8K A;  3BG6 A;  3HHH A;  1HW1 A;  4I02 A;  4AIJ A;  5AON A;  1FMW A;  1ETV A;  2LF8 A;  1TZL A;  1UEL B;  2PBI A;  2NXN B;  3C18 A;  4PJL A;  3V4G A;  2QSH X;  5AIP A;  4RM3 A;  1DP3 A;  2JJ7 A;  1QVT A;  3DTK A;  3UR3 C;  2DAO A;  5H6Q A;  5HDK A;  2W84 A;  1VQN I;  4IRI A;  1MND A;  3S93 A;  3DBL B;  4RB3 C;  1J0R A;  4M6X A;  1DDN A;  1NG6 A;  1TW2 A;  1WI3 A;  1UHW A;  2WA0 A;  4IQ4 A;  4G6D A;  4HPQ A;  4U7B A;  2X48 A;  2CU7 A;  2VBW A;  2PN6 A;  4GRI A;  4I76 A;  1G6N A;  3JRI A;  4BH9 A;  4DBQ A;  2EFW A;  1VZ0 A;  1K4S A;  2DMN A;  4UUT A;  4RGU A;  2X1D A;  3L2W A;  1R7J A;  2RQQ A;  4L9N A;  2JA8 J;  2OV7 A;  5ILV A;  3GME A;  2CQK A;  3RYR A;  4A0Y A;  2LDU A;  1RUN A;  4CCM A;  4MHG A;  5FB2 A;  3EUA A;  1R9T J;  4E6K G;  2LLK A;  2KIS A;  5CJ9 A;  3F8B A;  4LD5 A;  2D1V A;  1HKT A;  2YSR A;  1XCB A;  3QAH A;  1TWF J;  5C4X J;  4MQ9 F;  1SFE A;  2LY1 A;  3LSI A;  3G4S I;  2JQ7 A;  3EET A;  2NOG A;  1GT0 C;  2QBY A;  3SHF A;  1JTX A;  3ISP A;  1SFK A;  4HYE A;  1MD0 A;  2AXL A;  2EPF A;  1VQL I;  1JKQ C;  4CYD A;  1G3S A;  3A03 A;  1U2W A;  4I0A A;  1HST A;  4UUS B;  3BJA A;  3PQK A;  3BR0 A;  1UST A;  2BY1 A;  4NDL A;  2P0W A;  4XON A;  4XLP F;  3F0C A;  3BG7 A;  3ZMD A;  4ZYE A;  2KLO A;  3WGH A;  4C2T A;  4E7K A;  2DA5 A;  1ZK8 A;  2CW7 A;  2DK5 A;  3W2A A;  4HSR A;  1ZR2 A;  2P6S A;  2DI3 A;  1TTY A;  3OL4 A;  4BY1 J;  2QF7 A;  5IPA A;  1U8B A;  1BI0 A;  2A69 F;  2Y9Y A;  2ZME A;  1MJ9 A;  1LKX A;  1R58 A;  2K27 A;  5ERI A;  5BOX A;  4LLL A;  2HOS A;  2ZC2 A;  4J00 A;  2OJE D;  3A1Y A;  4FHT A;  5KAI C;  1Z6R A;  4BU2 A;  2IXS A;  2VBZ A;  2F5C A;  3KPH A;  4IJA A;  4A93 J;  1IF1 A;  2STW A;  3HG9 A;  2R7W A;  1XS9 A;  4BJ5 C;  3WOD F;  2VC1 A;  1ERD A;  4F52 A;  5B66 C;  4I0B A;  2AO9 A;  1FIA A;  2F4I A;  3RPQ A;  2BY2 A;  2HQA A;  4HOB A;  3TO9 A;  3G73 A;  3HOU J;  3A0H C;  2Q8K A;  2GZW A;  4XID A;  3IWZ A;  4B8X A;  1F1Z A;  4RDU A;  2ADU A;  4JX5 A;  5LBQ A;  4AUX A;  1YIO A;  2IRF G;  4MIM A;  4EM2 A;  2ME0 A;  3IKV A;  2RVC A;  1WCM J;  5GAD J;  1MBG A;  3FHZ A;  1Y0N A;  4NC7 A;  1OMI A;  3RI4 A;  3PIO F;  4B43 A;  1VQM I;  1T8I A;  2DDB A;  5J8F A;  1MKM A;  2Y69 H;  3HB9 A;  1LUJ B;  3C2H A;  1VQ4 I;  1I3Q J;  3S2W A;  1XGO A;  1FYL A;  4G7Z F;  2EZI A;  3O8G A;  4FTH A;  3O3K A;  3REO A;  2QM3 A;  2GOM A;  5DM6 F;  1HOM A;  2FBI A;  1L0O C;  1WRJ A;  3G71 I;  4TV7 A;  4KIS A;  1O3S A;  1IV6 A;  2F5E A;  1J5Y A;  1HA8 A;  2LG4 A;  3DCF A;  3H0G J;  3PNV A;  4LJZ F;  4CHU A;  3F8N A;  1G8X A;  1F43 A;  2XB5 A;  4IHY A;  2D45 A;  1P92 A;  1FC3 A;  5LEK A;  4C3H J;  5TGT A;  3OYN A;  1OYW A;  1QRY A;  5D6E A;  3DBH B;  3HGY A;  4A3F J;  4I99 C;  1OCZ H;  2VAS A;  2EIK H;  3DP7 A;  4EEF G;  1UG2 A;  3V7S A;  5LRS A;  2XPW A;  4BEH A;  1FOY A;  3WTT C;  3SZT A;  5M5Y J;  3RPU D;  4B1R A;  3AL0 C;  1OCO H;  3JAM Z;  2E5N A;  4UVB A;  1FBU A;  1FY7 A;  5H6R A;  1MMN A;  4B4C A;  1K4T A;  1G3Y A;  2K9Q A;  2K7L A;  1IRG A;  1IXC A;  2MLK A;  3U2R A;  3FIW A;  1P4W A;  3R6S A;  2KHM A;  4Y33 A;  4PFP A;  3H36 A;  4Q48 A;  2HXI A;  3LWF A;  4JOM A;  3CMY A;  3TQN A;  1VQK I;  3AL0 B;  3MQ0 A;  2ZME C;  2LY9 A;  3H9J A;  5K7F A;  1R4N B;  1O4X A;  3WTY C;  1OLT A;  2VOO A;  3ZQQ A;  1EF4 A;  2W48 A;  2G7U A;  3KP3 A;  1ITY A;  2M7A A;  4L9J A;  2DPU A;  4LLG F;  3CUQ A;  2LKX A;  3V8L A;  3KLO A;  4AID A;  1BC7 C;  1Z05 A;  3DKW A;  5E17 F;  5E20 A;  5JLX A;  1U9O A;  2EV6 A;  4XLC A;  2ZCW A;  3NAU A;  5DS9 A;  2ZME B;  4OIO F;  4IVN A;  3MAJ A;  2WAF A;  1GVJ A;  5DUI A;  4HZF A;  2E1M C;  3M8E A;  2R7V A;  1I39 A;  3KEY A;  4LIU A;  3KFW X;  3BPX A;  4PK4 A;  4W97 A;  3TW7 A;  1T6S A;  3SQN A;  2KIQ A;  2UUZ A;  4I98 B;  2ETH A;  3QWL A;  5A2Q K;  4A6D A;  1I6H J;  1G2H A;  4ASN A;  4PJN A;  2M1B A;  1ZGA A;  3F8C A;  3RPU A;  2Z1D A;  4EM1 A;  2E1M B;  2CUE A;  4MO7 A;  4PGG A;  2MH9 A;  2KL4 A;  4YRV A;  4I7H A;  5ICF A;  4X0G A;  4DZJ A;  3ZQ7 A;  3S32 A;  3I9V 2;  5BS6 A;  1TLH B;  3NEU A;  3H1C A;  1YLF A;  1QVU A;  1OPC A;  1MMS A;  3S16 J;  1OKR A;  3L2U A;  3D0S A;  3CME I;  3OYM A;  2EIJ H;  4AYB A;  3FMS A;  1K6O A;  4R1H A;  4L5J A;  3VYS B;  1N77 A;  3OYH A;  2DTR A;  5FRM A;  2W57 A;  1T56 A;  3E6D A;  3VPR A;  3GW2 A;  2KDO A;  3PFI A;  2K02 A;  2DT5 A;  1BM9 A;  4NHJ A;  3LSM A;  2E2H J;  1K61 A;  2DFI A;  1TNS A;  4NC6 A;  1U5T A;  4U0V A;  4ENM A;  1S7E A;  3T8R A;  2O61 A;  1HF0 A;  2EH3 A;  1S8N A;  2B0L A;  3WTX C;  4QLC U;  1WGX A;  3HRS A;  1KGS A;  2VKH A;  3DEE A;  4XMY A;  3TKY A;  2WWY A;  1VQ7 I;  4A3J J;  2DJI A;  3CCS I;  5E3O A;  3KYL A;  3PUB A;  4DOZ A;  3LFU A;  4RAF A;  3IC7 A;  4KN7 X;  3PSF A;  4ESJ A;  1MBF A;  3FM3 A;  4BY7 J;  4B3A A;  3VFZ A;  1JGS A;  2ELH A;  4KT6 A;  1WJA A;  1Y8Q B;  3V42 A;  3CCJ I;  1OR7 A;  3M4O J;  2H09 A;  2A6T A;  2HFH A;  1CF7 B;  2A5W A;  2GM4 A;  4BEH B;  2E1O A;  1VFC A;  3HL2 A;  2DCE A;  4IXA A;  3VYT B;  1JJ6 C;  4Q5S F;  2HNH A;  4XKV A;  5GAG J;  1RKT A;  1B9N A;  2XRN A;  2XAU A;  3KP4 A;  2RKH A;  2GIV A;  2JRT A;  3S3N A;  2KT0 A;  2QQ8 A;  3QYF A;  3CJN A;  2P5V A;  2E7X A;  3CUQ C;  4ZDO A;  3LFK A;  3RYP A;  3U1D A;  2RGV A;  1RI7 A;  3U9G A;  3SDG A;  2R0Q C;  1ONV A;  5J1Y A;  3D5L A;  3OYE A;  2Y48 A;  3HEF A;  3GBG A;  2CQQ A;  5D5U B;  2R7T A;  4XRS G;  3LQR A;  2XAS A;  4RS8 A;  2WB1 A;  4O5V A;  3CUQ B;  2VBX A;  3CCQ I;  5HS7 A;  2R5Y A;  3OYD A;  1X1D A;  1QO0 D;  1BOB A;  1BBY A;  4HQE A;  2O5R A;  3D5R C;  3OYB A;  2A6E F;  1ODD A;  2HDC A;  4BKX A;  5GAE J;  5CVJ A;  3JRE A;  1XX5 A;  5ICE A;  3DLL F;  3H92 A;  5DCM A;  2OZ6 A;  3G6E I;  4MEY F;  5FO5 A;  3HTU A;  4A3C J;  1K6Y A;  3H5R A;  4FT8 A;  2F2E A;  2IA1 A;  3L7W A;  3JTG A;  3LSH A;  1I6X A;  1TWH J;  4KIB A;  2XAG A;  3CCY A;  2QKM B;  3RCO A;  1DPU A;  1KU3 A;  1MJB A;  3F23 A;  2EK5 A;  3W2V A;  4XOP A;  2HR3 A;  1NH3 A;  2IVM A;  5CLS A;  2FML A;  4LGW A;  2IBD A;  1EV7 A;  3ZQG A;  4EAT A;  4EMS A;  2V1D A;  2ZJQ F;  4DW6 A;  2PJR A;  1MBH A;  1U5T C;  2GBY A;  4UB6 C;  5F0H A;  3OSF A;  2XC7 A;  3DEU A;  4A3E J;  2M30 A;  2X6Y A;  2F6C A;  3CDI A;  2VKV A;  2O9L A;  5F0F A;  5FFX A;  3KZY A;  3IAS 2;  2LKS A;  1GUU A;  2XPU A;  3CTA A;  5JLW A;  2ECB A;  4A3I J;  2FNA A;  3G2B A;  2DTZ A;  1SD4 A;  1U5T B;  1WI9 A;  3K4B A;  4KDP A;  1NK2 P;  3E6M A;  2K5C A;  2XUB A;  4GCV A;  3QQA A;  4LB6 B;  3ABM H;  4G9Y A;  4UHT A;  2E34 A;  4N4O B;  2X85 A;  2LMD A;  3HSE A;  1RNL A;  3SYT A;  1K78 A;  1MMG A;  3CCU I;  2ELK A;  3HOT A;  3CUO A;  3JRF A;  4RAY A;  1XSX A;  3OYC A;  1JJ8 C;  1BI3 A;  4FET A;  5A2Q Z;  1A6Q A;  4RGX A;  3GFI A;  5FGM A;  1O3T A;  3I4N J;  1U9N A;  1J09 A;  2KZV A;  3VDX A;  1XSV A;  1D0Z A;  1OQY A;  4R79 A;  4DNC A;  4B3X A;  1KON A;  4E7Z A;  1VQ8 I;  2Z3Y A;  4E7J A;  1WQ2 A;  1LQ1 A;  1XTA A;  2J5P A;  1AA7 A;  1MSF C;  3ZRG A;  1R1U A;  2A07 F;  1X4O A;  3KCC A;  2NS0 A;  3GUD A;  5H2F C;  5F0C A;  1O7L A;  4F3Q A;  2VBY A;  1ZR4 A;  1KU7 A;  2L3D A;  1ETW A;  4YFN F;  3A0B C;  3OR2 C;  1XSD A;  3GTQ J;  5LGT A;  1U8R A;  2IAI A;  4UVA A;  3RIR A;  3ZMT A;  4BDY A;  2R7Q A;  2RN7 A;  4KA4 A;  2LTP A;  2VE9 A;  3WHB A;  2EIL H;  2PG4 A;  2LRE A;  3BT9 A;  4YFK F;  4EVI A;  1WJ5 A;  2OCC H;  4M6Y A;  4UY8 I;  5J4Y A;  1U6G A;  2KPM A;  3H3U A;  3MCZ A;  3CP2 A;  4P9U A;  5IT3 A;  2ZJP F;  3BJO A;  3GTL J;  4E7S A;  1TW3 A;  1Y1V J;  2BOL A;  5F04 A;  3LOC A;  4D0P A;  4PJM A;  1VF9 A;  4HA8 A;  4RGR A;  4HW0 A;  1JUP A;  2V79 A;  3JRB A;  3R4K A;  2BXZ A;  3BZC A;  1ZG3 A;  2M7B A;  2XVC A;  3G1L A;  1S9H A;  2IT0 A;  1KZH A;  1JXS A;  3E0J B;  2HOE A;  4KUM A;  2DK8 A;  1I1G A;  2I5U A;  4E7I A;  3HDD A;  2DMT A;  3ZMS A;  3TL4 X;  3V8J A;  1RES A;  2IJL A;  5L3D A;  1V5G A;  1XMK A;  1U0J A;  1XB4 A;  4KIF A;  4ON0 A;  3GTP J;  2DYR H;  4DZP A;  2PFB A;  4I01 A;  2K40 A;  4LFU A;  3HRU A;  4LK1 F;  4M74 A;  2EB7 A;  4MFD A;  2IA2 A;  1YRN B;  2GOX B;  2BBY A;  1WFX A;  1V54 H;  1ZHF A;  4ZYG A;  2E60 A;  2FNP A;  2FQ3 A;  1ZN2 A;  4IHX A;  3BTL A;  4PGH A;  1S29 A;  2PJR B;  2G0E A;  2JT1 A;  2O8K A;  4OMY A;  4N9H A;  5M3M J;  3FBN B;  4PUS A;  1IN7 A;  4V2G A;  1FTT A;  4BQQ A;  2DA4 A;  1R71 A;  1XPX A;  4AU7 A;  2L4M A;  2JA6 J;  3KZZ A;  2DOA A;  2AS5 F;  5KNL A;  3U1K A;  3CLQ A;  2HS5 A;  4ZH4 F;  3KYD B;  4RB0 A;  4A3G J;  3QU3 A;  4RA2 A;  1D3Y A;  1X1A A;  2MC3 A;  5LLQ A;  1X3W B;  4LG3 A;  3Q5F A;  1G3W A;  1YIT I;  3HUG B;  4EJV A;  3GZ6 A;  5LHH A;  3EQL F;  2CO5 A;  2XGC A;  1K78 B;  1ZAR A;  1XDS A;  4EGZ A;  4U87 A;  2JVH A;  2ME6 A;  4XNF A;  4XN0 A;  3L2V A;  1A04 A;  4BBR J;  2L7Z A;  3HJE A;  4JX4 A;  5L3B A;  4IL6 C;  3KP2 A;  4CXF A;  3LSJ A;  3RJP A;  2VIX A;  3F8F A;  4N0B A;  1UHM A;  4MLO A;  4BJ6 C;  2Z2S B;  4A5M A;  1E0E A;  2W24 A;  4OU0 A;  3IKT A;  2DA6 A;  4E4H A;  2DJN A;  2DPD A;  3HYI A;  4Y13 A;  3IRR A;  3GYH X;  4D5C A;  5KHD A;  4ZC3 A;  2FA5 A;  2MD0 A;  2DN0 A;  5CVI A;  4ZZL A;  2HDW A;  1QU3 A;  2RNG A;  5D6F A;  5D4R A;  2GXG A;  2M5W A;  3ZR8 X;  1PP7 U;  4HV6 A;  2HPM A;  4XRF A;  1JT6 A;  2WY7 Q;  2K9L A;  3GTO J;  5BNG A;  3OYA A;  2GAU A;  3OR1 C;  3LA3 A;  2OUM A;  3MKW B;  2KJC A;  1YE9 A;  4KIG A;  1KQ8 A;  2CJJ A;  4U0Y A;  1MW7 A;  1ZRF A;  5GP9 A;  2KDZ A;  4W1U A;  2JZY A;  2COM A;  5GPA A;  2ACJ A;  1FT9 A;  1NHA A;  3A01 B;  1RKW A;  3DEW A;  5EG0 B;  3I55 I;  5IYD J;  1DP7 P;  4RBO A;  1IUY A;  2YS9 A;  3DXJ F;  2XB0 X;  1TWG J;  1ZRC A;  1QA6 A;  4AYB N;  4EJU A;  3I53 A;  2Y0S A;  5F6F A;  2WV1 A;  1D8K A;  1O7F A;  4XOT A;  5J47 A;  1WPK A;  5ED4 A;  2JUG A;  2VT2 A;  2QWW A;  5HLI A;  1R5H A;  5E1Z B;  2DQR A;  3K2Z A;  3CC7 I;  3AFH A;  4LK0 F;  1X4P A;  1JKP C;  3CQZ J;  4YG2 F;  3BZK A;  2BHZ A;  2M0C A;  3TDU C;  5F08 A;  3W6J B;  1OYY A;  3D1N I;  1YJW I;  5J4V A;  2PI0 A;  2DMU A;  1XMA A;  2HDD A;  2KIU A;  3KZI C;  1AKH B;  2HVR A;  4P96 A;  3BQY A;  2BV6 A;  3HTS B;  3NWT A;  2HQN A;  4M9X A;  2M0M A;  4UUV A;  3K7A J;  2NOJ B;  1MBJ A;  2E5Z A;  4JBA A;  2R93 J;  1GHC A;  4CSW A;  2XAF A;  5FKL A;  4JQF A;  4ZYH A;  2PEX A;  1FLI A;  3BG3 A;  5TJJ A;  4XN3 A;  1H8A C;  2HYF A;  1HW5 A;  5E8G A;  2WY8 Q;  2IGO A;  3QOP A;  1W36 D;  2OTL I;  1YI2 I;  3ABK H;  5EEA A;  1RPW A;  3GTK J;  2DA7 A;  2X1E A;  1YTY A;  1HW2 A;  5DM7 F;  1PYV A;  2V9P A;  4NUB A;  2KKO A;  4HAM A;  1H89 C;  3DPU A;  3S3M A;  5F1J A;  1N78 A;  4UVC A;  3HSR A;  3CO6 C;  3CMA I;  1IC8 A;  1USS A;  4C30 A;  3KP7 A;  3ZMV A;  2B9S A;  1YS7 A;  4HST A;  4G6Q A;  1PP8 F;  5LHI A;  5F1R A;  4IZZ A;  1TT5 B;  1IW7 F;  2MA3 A;  3MVP A;  1H9T A;  1E17 A;  2MGQ A;  1R6R A;  2DA1 A;  2Q0O A;  1IN4 A;  4XSZ F;  3KEQ A;  2WB1 N;  2ZSH B;  2K3F A;  3RKX A;  3OYG A;  1ETQ A;  1QBJ A;  2R7Z J;  1TC3 C;  5IP6 A;  3TO6 A;  3BLY A;  1LDD A;  3B73 A;  4F93 B;  2H8W A;  5HDG A;  2VPR A;  2EFP A;  1LEA A;  2FSW A;  2I10 A;  2XHK A;  3KLN A;  3LL7 A;  3TED A;  3CC2 I;  2VPL A;  2CYY A;  4BUP A;  2E1N A;  4XRM A;  4LIT A;  1QNT A;  2H6C A;  2O8X A;  3DBR B;  2VUM J;  2V1U A;  3Q0U A;  2FXA A;  4XRS A;  1WVR A;  1OCT C;  1DQU A;  1P6R A;  4BYY A;  2QLZ A;  1SAU A;  3JCU C;  4C3I J;  2HGC A;  2BW3 A;  1L3L A;  1OYI A;  2B63 J;  1GXP A;  1ETX A;  4CCN A;  4OIP F;  2XGE A;  5K5R A;  2BY3 A;  3DF8 A;  3IHU A;  4GO1 A;  4DBR A;  2VQG A;  1YQA A;  2XKP A;  2CWE A;  2XIG A;  3K70 D;  4PSW A;  1W0U A;  1Z67 A;  5E3N A;  5C44 J;  1M1E B;  2DMP A;  1LB2 A;  2HVS A;  2XF7 A;  3OS0 A;  2Q1Z B;  2VQL A;  4EV0 A;  1IV8 A;  4G8X A;  2L9S A;  2DT7 B;  1F9N A;  2A5Y B;  3SFI A;  4AIH A;  4LIV A;  3BG5 A;  1JHH A;  4IPA A;  1SC7 A;  3MFK A;  1K83 J;  3LMM A;  4ETS A;  3M1E A;  3PJR A;  3QP6 A;  4N9I A;  4QTR A;  3TOA A;  3FXL A;  2M8G X;  2L54 A;  3H9Q A;  1ORK A;  1SAX A;  1R5I D;  2LY2 A;  3M3Y J;  2FJ1 A;  1MNE A;  2IEK A;  4BAY A;  2CQX A;  3ABU A;  3SEQ A;  3GFM A;  1I27 A;  5JHF A;  3KE2 A;  1YJ9 I;  3OMY A;  1Z1D A;  2IGM A;  4CUG A;  2LP0 A;  1VQ5 I;  4IRG A;  2AQF A;  1JGG A;  2OTJ I;  1B59 A;  1LDK B;  4CCK A;  4ENJ A;  3DTI A;  1E3P A;  2D5V A;  4HLY A;  4KT5 C;  1CF7 A;  4WXC A;  3S15 J;  2ESN A;  3DV8 A;  1A6I A;  2X6X A;  4HEA 2;  2NYX A;  4O6J A;  5BPI A;  1EJ9 A;  1REP C;  4N4N B;  3HOX J;  4BE1 A;  1MDM B;  5BPD A;  3QOE A;  3TBI A;  1SMY F;  3HBL A;  4AD9 A;  3LSK A;  3TMO A;  4AIK A;  3K1M A;  3GLX A;  2P7C B;  1H88 C;  1BIA A;  3JTH A;  5F27 A;  1MH3 A;  1QPM A;  1JHF A;  1Y0U A;  3IUO A;  1GXQ A;  2M2E A;  3L00 A;  2JWT A;  3QU6 A;  5D4S A;  3R60 A;  4JP0 A;  5EEG A;  1XCV A;  1Y1W J;  4NB5 A;  4CYC A;  2CFX A;  1S6L A;  3MEX A;  2CUZ A;  1TBX A;  3Q0V A;  5DEQ A;  3ZMZ A;  2E2I J;  1QQI A;  2QQB A;  1EH6 A;  2CRG A;  3PIP F;  2W25 A;  4XM3 A;  3OYL A;  1MNM C;  5BQT A;  5GAH J;  5FFZ A;  5FJ8 J;  2GLO A;  2M45 A;  2V9V A;  3K4M A;  1R1V A;  3KX2 A;  4BL0 B;  1NG7 A;  2K9N A;  1N75 A;  3I3L A;  4OAZ A;  5ILU A;  3HOV J;  3J7A Y;  4P5O A;  4OOI A;  1P4X A;  5HS9 A;  3A4C A;  1W36 C;  4CH7 A;  2OC6 A;  2RC4 A;  2FMY A;  2VT3 A;  5K5O A;  1SVM A;  2XDV A;  1YOV B;  5FKN A;  4IX7 A;  1V4R A;  4UV8 A;  2BW3 B;  6PAX A;  1SFX A;  3VYR B;  4PJ0 C;  3KP6 A;  2EV0 A;  3I4M J;  4R8H A;  3PNT A;  2YU3 A;  2HWV A;  3C3W A;  2R4G A;  3O2P E;  4KJZ A;  4KMF A;  1HDP A;  2JA7 J;  1D1B A;  2BY0 A;  2NVT J;  3K4L A;  2GWR A;  4AM3 A;  4IHV A;  4ENN A;  3F22 A;  4FAS D;  3LA7 A;  4BAC A;  1X2M A;  2Q2E B;  1VQO I;  1T98 A;  5HS8 A;  3HPG A;  5B3S H;  1JKO C;  5FKO A;  1Q1V A;  4ESF A;  3WTV C;  3J81 K;  5FD6 A;  2Z33 A;  2VL8 A;  2ZBK A;  2DOF A;  1T2K A;  4H0E A;  3ML6 A;  1ZLJ A;  1RZ4 A;  4NC8 A;  2KZG A;  1FBQ A;  4IOC F;  2F48 A;  2UXX A;  3VOD A;  2V1N A;  1O57 A;  3VOE A;  3JRA A;  2R7S A;  2OF7 A;  4X6A J;  3WGI A;  1E2X A;  1X19 A;  2R3S A;  3T0Y A;  1X1C A;  3L2R A;  2QEX I;  4Y7N J;  3DU5 A;  1X2N A;  1LEB A;  2HVQ A;  2ZXW H;  1UCR A;  3ZOB A;  2LBF B;  2X9D A;  3K70 C;  4IHS A;  1HSJ A;  1NTC A;  4V19 K;  4A12 A;  1XN7 A;  1V5E A;  4Q4Z F;  2I8D A;  3SDB A;  2RQP A;  1YIJ I;  2UV1 A;  2ZNY A;  4CA0 A;  3BR5 A;  1DU6 A;  4I6Z A;  3J7A O;  1YX5 A;  2QQA A;  1HCR A;  2BEO A;  2GA1 A;  5DD4 A;  3LAP A;  2AXT C;  3RKY A;  2ZXH A;  3VSK A;  4XR6 A;  1JKR C;  5LGN A;  1IDY A;  2HQR A;  3M1C A;  3ECO A;  2CQ7 A;  3J7Z I;  1PUE E;  1JTY A;  1WHU A;  4IRH A;  3PO2 J;  1P9Q C;  2ECC A;  3CO7 C;  4K2E A;  3RKQ A;  1CQT A;  3C1D A;  3NWS A;  1IUF A;  4OIR F;  3WU1 B;  3K1N A;  1GLN A;  5E3M A;  2HU9 A;  4M3D A;  4IO9 F;  3JRH A;  3DPL C;  2R7D A;  3OOP A;  3GTJ J;  2XSD C;  2ZSI B;  4RB2 C;  4LLN A;  5GPC A;  4C2U A;  1OIS A;  1ZGJ A;  1DUX C;  1WZ2 A;  2W00 A;  3T8T A;  4GXO A;  1F4K A;  1MZB A;  2RAE A;  2X1C A;  3PFY A;  1VQ9 I;  2HYG D;  3HRM A;  4CYC B;  1BI2 A;  1ETK A;  2M4K A;  2XF5 A;  2HZT A;  2HPI A;  1R23 A;  1DGR M;  3DPT A;  1WH7 A;  1IRZ A;  4I2O A;  4A0Z A;  4OAY A;  2B7E A;  1HDD C;  5CQG A;  2ZJR F;  4UV9 A;  1UHS A;  3SEZ A;  3S2H J;  4WWC A;  2IS1 A;  2EIN H;  2M9H A;  2Y0S N;  3OIO A;  2H6B A;  3E7L A;  1FWZ A;  1FPQ A;  1PVE A;  5D5V B;  2ZFU A;  4V2F A;  5E1X A;  4WK8 F;  4IKF A;  2P4W A;  2COB A;  5E79 C;  1X58 A;  1Z3Y A;  1WJB A;  1YYV A;  1Y6I A;  1XC5 A;  2JMW A;  2PMH A;  4YII A;  4E70 A;  2GA2 A;  1QZY A;  3QOD A;  4RM2 A;  2X0L A;  4BBS J;  1TNT A;  2HKX A;  4WXD A;  2PMU A;  1XGM A;  2RRE A;  3GCM A;  3PL8 A;  5E1W A;  3PUF A;  2IW5 A;  3S1N J;  4LG0 A;  4P55 A;  4GYG A;  2JSC A;  1W0T A;  2DU9 A;  1LVK A;  3EUK L;  3P9I A;  3E5Q A;  1W5C C;  3EDP A;  3ZP5 A;  3LAJ A;  3DKY A;  2H94 A;  1SD7 A;  1XGN A;  5LD2 C;  2BE5 F;  1PJR A;  1YRN A;  1Y39 A;  5EGO B;  3N05 A;  2FBH A;  2L4A A;  1UZC A;  4ZJZ A;  5L3E A;  2N8G A;  2P5K A;  2NVX J;  2OD5 A;  3K2A A;  3WTW C;  3JW4 A;  2YUS A;  1SFO J;  2R7R A;  1R22 A;  4CZZ A;  4PDK A;  3AKZ A;  2R7X A;  5IP9 J;  4XIC A;  2P81 A;  1T95 A;  1D0Y A;  4YIF A;  2CS3 A;  4H4K C;  1D5V A;  3WU0 A;  3HSF A;  1ETO A;  5JFR A;  3MWM A;  1H0M A;  2HKO A;  2TRT A;  3H5N A;  4A3K J;  3HUG A;  3MZY A;  3IL2 A;  4C3J J;  1ZG1 A;  3KEO A;  1OCP A;  3BDD A;  2JTV A;  4QPO A;  1RIO H;  3U21 A;  3FXM A;  1PUF A;  1NK3 P;  1YW8 A;  4HX8 A;  1XD7 A;  2QCO A;  3FXK A;  3FXU A;  4DYC A;  1J2X A;  2RV8 A;  4HDU A;  5C4J J;  1IZ1 A;  2HOT A;  1WKM A;  3FWE A;  4ZYA A;  3BG9 A;  3DWL E;  1UB9 A;  3X2Q H;  2QA4 I;  4LOC A;  2K4J A;  1XG1 A;  3E3V A;  4NBQ A;  2CUF A;  2ZXI A;  3HXL A;  1S5L C;  2ISY A;  2MD5 A;  2Y2Z A;  3IP4 B;  2L0K A;  5CQE A;  1MBK A;  3RZO J;  2R92 J;  2NS7 A;  1WJE A;  2VLA A;  2IS4 A;  4L18 B;  3IH2 A;  3J81 Z;  2DQL A;  1VND A;  3BZ6 A;  2C6Y A;  2CW0 F;  2JA5 J;  2V1X A;  2W4S A;  2Y9Z A;  1S7O A;  2Z9O A;  4NNJ A;  2DT6 A;  4RLF A;  2E7W A;  1IO2 A;  5FLV A;  4ABZ A;  2EFQ A;  4S0H B;  2Y30 A;  4KIT B;  3QPH A;  1MMD A;  1IJW C;  2EJR A;  3QRF F;  1VQP I;  3GFL A;  4YEJ A;  2MSY A;  4HX4 A;  4HRI A;  3EYY A;  2AHQ A;  2WBM A;  1VQ6 I;  3K10 A;  3CD6 I;  2JVG A;  5LHG A;  2JA2 A;  2V26 A;  2LF7 A;  3A01 A;  2YPR A;  3HHG A;  3AG1 H;  5EG0 A;  2ISZ A;  3J80 K;  2K3P A;  3H9G A;  1YX3 A;  2H1L A;  2KP6 A;  3SFZ A;  5IOZ A;  2E35 A;  3DQV C;  1W5S A;  2M34 A;  3FXO A;  3TP0 A;  2LK2 A;  2KRH A;  3B6C A;  3HIF A;  2JUC A;  2R7F A;  1POG A;  4RAG A;  3I59 B;  4DIQ A;  2EWN A;  1IN8 A;  2NNN A;  1ZGW A;  3IH3 A;  4ENK A;  2L2O A;  1T0F A;  4E7H A;  4XLE A;  4LG0 B;  2ELJ A;  2P5L C;  4CZC A;  3DLA A;  1UFM A;  4KFC A;  2XAH A;  1YJN I;  2YR2 A;  2DDA A;  2G7H A;  2RNJ A;  2BHY A;  1KYW A;  2QVO A;  3D5S C;  4EM0 B;  1AKH A;  4U88 A;  1D0X A;  2YX7 A;  4QSH A;  1LE8 A;  1YO5 C;  3QPT A;  4A6E A;  2IPQ X;  4HNU A;  1FMV A;  5HOD A;  2D2W A;  1D5Y A;  4BDZ A;  2IP2 A;  2BVM A;  3CZ6 A;  3M8F A;  2DOD A;  2GIZ A;  2P6T A;  4CIC A;  2HXO A;  5DD8 A;  4XBF A;  1MSE C;  1UAA A;  1Z7L A;  3FIS A;  5KVR A;  3ZQI A;  2DA2 A;  4UXN A;  1TQP A;  1WH5 A;  3R61 A;  1JE8 A;  4ESB A;  3Q0W A;  2HQ5 A;  2CQN A;  2LH9 A;  4O3M A;  1PDN C;  1OJL A;  2ESH A;  4ZDP A;  1YW9 A;  4Z6Y A;  5IOY A;  2WAQ A;  1HBX G;  2L02 A;  3VWB A;  3L9F A;  3M9A A;  2UZK A;  1FTZ A;  4IHT A;  1Z0X A;  2WV0 A;  2HTS A;  4HF0 A;  3FZV A;  2W82 A;  4F91 B;  2ZXJ A;  2VQH A;  4RAZ A;  1PUF B;  2UXN A;  3L2C A;  1KYZ A;  4CO8 A;  4CCL A;  3C2B A;  4XKB A;  3RSN A;  5EZG A;  2EA2 A;  3IV5 A;  4KMU X;  3ZPL A;  3GFJ A;  1AOY A;  3ABL H;  5HNF A;  3BQZ A;  3OY9 A;  1VTN C;  4B09 A;  3T5X A;  3ONQ A;  4II3 A;  2VI6 A;  3Q3S A;  2R5Z B;  1GVD A;  2R7O A;  1HKS A;  3FBI B;  1WSU A;  1J59 A;  2MH2 A;  1OCR H;  3WG9 A;  2JPB A;  3DKX A;  1IN6 A;  2MBF A;  5L3G A;  1JT0 A;  1FP1 D;  4B47 A;  1ZEL A;  3TOB A;  4UNO A;  3L09 A;  1RUO A;  1KA8 A;  3BTC A;  1U78 A;  4HBL A;  2ZNZ A;  4BQN A;  3BR3 A;  3K9T A;  1TQM A;  2L9V A;  4GGG A;  3JRC A;  2M4G A;  1QZZ A;  1ETY A;  1J75 A;  3RQI A;  4IQJ A;  3HGG A;  2KFD A;  3UKG A;  3NAR A;  4C9Y A;  1T0F C;  2F5F A;  5JR3 A;  5DYM A;  2L7M P;  2Z5U A;  1F36 A;  1W5T A;  2K86 A;  3J7Y J;  2MFZ A;  5GTI C;  2V6E A;  1TT0 A;  1ZG5 A;  2QKL B;  1W1W E;  5B1A H;  3CMM A;  2L7K A;  1IDZ A;  3WE2 A;  3H5A A;  3RZD J;  4BQO A;  2HI3 A;  1D1A A;  2KIF A;  4WX9 A;  1HQC A;  4G94 A;  3ECH A;  3ROU A;  1LFB A;  2O03 A;  3W2W A;  1AU7 A;  2L7F P;  2F4M B;  1SMT A;  1JI8 A;  2CMP A;  3CCM I;  1IAW A;  1W7P D;  2OAZ A;  4Y17 A;  1LE8 B;  5TIS C;  3LSR A;  2W1O A;  1TL8 A;  3MMY B;  4PFO A;  5FLX K;  4PZJ A;  2VXZ A;  5JVT A;  1N25 A;  2XRO A;  1O3R A;  2OQR A;  3F6V A;  4GYI A;  3I58 A;  2TDX A;  3FXR A;  1SVL A;  2OU2 A;  3GF2 A;  3LSG A;  3V7C A;  2VE8 A;  3LA2 A;  2EV5 A;  2HZD A;  3WTU C;  1ULY A;  3B6A A;  2XAQ A;  5LEJ A;  3A02 A;  5EDN A;  4OWR B;  2VOP A;  2QSG X;  1A31 A;  2J5O A;  3J80 Z;  5TRD A;  4L5I A;  4EJW A;  2WAE A;  5E8I A;  3E1S A;  4L0Z B;  1MJA A;  3NQO A;  1WWX A;  5DDG A;  1MDM A;  4AVP A;  5EZH A;  1XDU A;  2QZ8 A;  4BXX J;  2LVS A;  2DBB A;  1SD6 A;  3GXO A;  3QPS A;  2DW4 A;  3QYE A;  3S1M J;  2OCE A;  3VEP A;  4HNV A;  3OS2 A;  3WGG A;  2FE3 A;  5F64 A;  2TCT A;  1W4M A;  4HNT A;  4F55 A;  1FJL A;  4FX4 A;  2V4J C;  5FKK A;  4CDG A;  5J1R A;  3KET A;  4IEJ A;  2XV4 S;  2ID3 A;  2GQQ A;  4BHB A;  1KU2 A;  2M87 A;  3BR2 A;  4DYQ A;  1YHQ I;  1DPR A;  2Y0M A;  3HM5 A;  2XKO A;  3AG3 H;  3G1M A;  2HYJ A;  3F72 A;  1K79 A;  1W7P A;  2OBP A;  3F3X A;  2IGN A;  1I50 J;  1R4M B;  2EBI A;  5ICC A;  3N4M A;  3FKJ A;  2ZO4 A;  1EA3 A;  2EQR A;  1ZYR F;  4AVZ A;  3I0T A;  2A3S A;  5LRR A;  4DQ2 A;  2YX4 A;  3H35 A;  3OL3 A;  3SZG A;  5HLT A;  1BJZ A;  3CCV I;  2CV1 A;  1CGP A;  2D1H A;  2LNB A;  3HOZ J;  1YW7 A;  4A3B J;  3M8J A;  3WG7 H;  4D5F A;  5FKM A;  1QHH D;  1T39 A;  4IOA F;  1P7J A;  2EFN A;  1G4D A;  1RRJ A;  2KRC A;  3EYI A;  4DJA A;  1SEU A;  1ZKG A;  1TP4 A;  2IA0 A;  5FLM J;  2PMZ A;  1IXS B;  3OIQ A;  4XOR A;  2Q2E A;  1S3J A;  5HLH A;  3PO3 J;  1B1B A;  5CYV A;  2PX9 A;  4CCO A;  1R5G A;  3I54 A;  1LPQ A;  1G59 A;  3MZH A;  3BJ6 A;  1O3Q A;  2GXA A;  4FE4 A;  1R49 A;  4KNY A;  4L5E A;  1HC8 A;  1WJF A;  2M8E A;  3ZN1 A;  5DUK A;  3BY6 A;  3E5X A;  3BTI A;  2QUF A;  3BR1 A;  3F9K A;  3Q9V A;  4IF4 A;  5CVR A;  3DTE A;  3MKY B;  2XGD A;  4M3F A;  4FIS A;  2NAZ A;  4YIR X;  3M7G A;  3S17 J;  1BW6 A;  3OWT A;  1BOA A;  3BOQ A;  2LBF A;  2CGP A;  3K69 A;  2X51 A;  3MN2 A;  2QEN A;  3G3Z A;  4QPQ A;  3IRQ A;  4KYW A;  2MW8 A;  3AG2 H;  5EEH A;  2X6O A;  4LB5 A;  2H8R A;  1LJ9 A;  1XGS A;  3AG4 H;  4PJJ A;  1R36 A;  3L2Q A;  5DTD A;  3BR6 A;  3I5U A;  5L3F A;  5B5E C;  1HKQ A;  2FUG 2;  4RLQ A;  2QGU A;  4XKC A;  5J1U A;  3W3C A;  4UB8 C;  4AWX B;  3ERM A;  4FX0 A;  4I09 A;  4OMZ A;  3FK7 A;  4WXH A;  5EJC A;  3SJM A;  3LNQ A;  4Y4R A;  3FHN A;  3UNG C;  4DYR A;  3VSL A;  1V5F A;  1RR8 C;  1BR4 A;  2KJB A;  2FX0 A;  3GZ5 A;  3CDH A;  3LQQ A;  4G7H F;  4MTD A;  2AQE A;  3CCR I;  2ZFW A;  3C2G A;  2EZH A;  4MNU A;  4CGZ A;  1A36 A;  3FM5 A;  5FLX Z;  3H3V K;  1W7P B;  1UJ8 A;  4M73 A;  2DO7 A;  3V7R A;  4LMY A;  2CH0 A;  3CLO A;  2QBY B;  4EJO A;  1ON1 A;  2DYS H;  5EF6 A;  3CF5 F;  5C3E J;  3RQ4 A;  1LNW A;  2ID6 A;  2WTE A;  2M3A A;  3L1P A;  1FSE A; 
#chains in the Genus database with same CATH homology
 1YRN A;  4XK4 A;  1TWF J;  5EGO B;  5C4X J;  2Y31 A;  3FKI J;  4A3G J;  4A3L J;  3S2D J;  5M5W J;  2NOG A;  1GV2 A;  2N8G A;  1GT0 C;  4M3B A;  1JTX A;  2NVX J;  3K2A A;  2YUS A;  1SFO J;  1FIP A;  1JKQ C;  3A03 A;  3OSG A;  4UUS B;  3JRG A;  2XPV A;  3BR0 A;  4NDL A;  2LD5 A;  5EGO A;  3F0C A;  5IP9 J;  2XGC A;  4XIC A;  2P81 A;  2DA5 A;  1ZK8 A;  1ZR2 A;  2OPT A;  2ME6 A;  3JRD A;  4BY1 J;  1RET A;  2QF7 A;  9ANT A;  5IPA A;  4A3M J;  4BBR J;  2L7Z A;  4JX4 A;  1U8B A;  2Y9Y A;  3LSJ A;  2EZL A;  4MLO A;  3ZQH A;  2HOS A;  1ETO A;  3GTM J;  2TRT A;  4A3K J;  2DA6 A;  3G1O A;  3S1Q J;  2DJN A;  4C3J J;  1OCP A;  4D5C A;  4A93 J;  2WAQ N;  1PUF A;  2DN0 A;  1NK3 P;  2NVQ J;  2QCO A;  4DYC A;  5C4J J;  2HOT A;  1XS9 A;  3BG9 A;  2AO9 A;  1FIA A;  4LOC A;  1JT6 A;  1XG1 A;  1P7I A;  3HOU J;  2CUF A;  4G12 A;  1IG7 A;  4Y52 J;  3GTO J;  4XID A;  5BNG A;  2Y2Z A;  4RDU A;  3S14 J;  3ZQL A;  2L0K A;  3RZO J;  1MBK A;  4JX5 A;  4AUX A;  4M3E A;  2JN6 A;  2R92 J;  4MIM A;  2CJJ A;  2NS7 A;  2ME0 A;  5GP9 A;  2KDZ A;  1WCM J;  3IH2 A;  4W1U A;  3WHC A;  1VND A;  5GPA A;  1MBG A;  3A01 B;  2JA5 J;  1RKW A;  2MG4 A;  3DEW A;  5EG0 B;  2Y9Z A;  5IYD J;  2JK3 A;  4RBO A;  5FLV A;  4ABZ A;  2YS9 A;  4S0H B;  2XB0 X;  1TWG J;  2Y30 A;  4AYB N;  1IJW C;  3HB9 A;  2WV1 A;  1I3Q J;  4D7N A;  2MSY A;  1WPK A;  2AHQ A;  1QPI A;  2DMQ A;  2EZI A;  3O8H A;  3O8G A;  3W6V A;  4FTH A;  3A01 A;  5EG0 A;  1JKP C;  1HOM A;  3CQZ J;  1IV6 A;  2M0C A;  3DCF A;  3H0G J;  5F08 A;  4X1E A;  5IOZ A;  3D1N I;  1F43 A;  4JX6 A;  1B72 A;  2DMU A;  2M34 A;  2XB5 A;  2HDD A;  3TP0 A;  4IHY A;  2LK2 A;  3B6C A;  3TP3 A;  4A3D J;  1SAN A;  1POG A;  1AKH B;  4C3H J;  2VKE A;  3BQY A;  1QRY A;  1APL C;  1ZGW A;  3HGY A;  4D7M A;  3IH3 A;  4A3F J;  2K9S A;  3K7A J;  4EEF G;  1UG2 A;  1MBJ A;  2XPW A;  2R93 J;  3ZQC A;  5M5Y J;  4B1R A;  5FKL A;  1GDT A;  4B4C A;  2K9Q A;  1AKH A;  3FIW A;  3BG3 A;  3S1R J;  4QSH A;  1H8A C;  1LE8 A;  2HXI A;  5HOD A;  1D5Y A;  5EEA A;  1RPW A;  3CMY A;  3GTK J;  2DA7 A;  3JR9 A;  5K7F A;  2LY9 A;  1H89 C;  5F1J A;  1O4X A;  2HXO A;  1MSE C;  3FIS A;  1IC8 A;  1EF4 A;  2W48 A;  3ZQI A;  2DA2 A;  1ITY A;  1WH5 A;  2LKX A;  3Q0W A;  2HQ5 A;  1UMQ A;  5M5X J;  3MVP A;  5JLX A;  2MGQ A;  1U9O A;  2DA1 A;  5DS9 A;  3NAU A;  1DU0 A;  1OJL A;  1B8I A;  2WB1 N;  5IOY A;  4FE7 A;  1ETQ A;  1TWC J;  1FTZ A;  1Z0X A;  2R7Z J;  1TC3 C;  5IP6 A;  2LR8 A;  1PUF B;  2VPR A;  4W97 A;  3TW7 A;  1AHD P;  2I10 A;  3TED A;  1BL0 A;  3C2B A;  1JUS A;  5EZG A;  4XRM A;  3IV5 A;  4M6V A;  4C2M J;  4IHW A;  2VUM J;  1I6H J;  1G2H A;  3Q0U A;  4FCY A;  1FEX A;  3BQZ A;  4XRS A;  1OCT C;  2CUE A;  4MO7 A;  4C3I J;  2VI6 A;  3Q3S A;  4DZJ A;  2R5Z B;  2B63 J;  1GVD A;  1ETX A;  1QVU A;  2XGE A;  2YU9 J;  3S16 J;  1ENH A;  5IP7 J;  1W0U A;  4M3G A;  1LFU P;  1JT0 A;  1HLV A;  5E3N A;  2HOA A;  5C44 J;  2ZB9 A;  3BTC A;  1MH4 A;  1T56 A;  2DMP A;  3VPR A;  2R5Z A;  1U78 A;  3BR3 A;  2E2H J;  2NVY J;  1K61 A;  3JRC A;  1ETY A;  2O7O A;  3RQI A;  2FQ4 A;  3SFI A;  3HGG A;  1S7E A;  3BG5 A;  3UKG A;  3NAR A;  1HF0 A;  2EH3 A;  1K83 J;  1WGX A;  2E2J J;  1T33 A;  2L7M P;  4QTR A;  1F36 A;  3IH4 A;  4A3J J;  5E3O A;  1B72 B;  1RR7 A;  2M8G X;  1MBE A;  1ORK A;  2PMZ N;  1MBF A;  3HOY J;  4BY7 J;  4B3A A;  2XRL A;  3M3Y J;  2FJ1 A;  2IEK A;  2CQX A;  1IDZ A;  3M4O J;  3RZD J;  2HI3 A;  2GM4 A;  2E1O A;  1VFC A;  1JJ6 C;  2LFB A;  1OFC X;  1LFB A;  1RKT A;  2LP0 A;  1AU7 A;  2L7F P;  1JGG A;  2KT0 A;  1JUM A;  3HOW J;  1LE8 B;  3LSR A;  2D5V A;  3CDL A;  3S15 J;  1A6I A;  2R5Y B;  2R0Q C;  3SDG A;  5J1Y A;  3TW6 A;  3HOX J;  3HEF A;  3GBG A;  2CQQ A;  3LSG A;  1BW5 A;  3HBL A;  3B6A A;  4XRS G;  3LSP A;  3A02 A;  1H88 C;  5EDN A;  3PM1 A;  1GV5 A;  5F27 A;  1MH3 A;  1Z77 A;  4JYK A;  2FD5 A;  2M2E A;  2JWT A;  2R5Y A;  4JP0 A;  1Y1W J;  1B8I B;  4CYC A;  3Q0V A;  2E2I J;  5J3L A;  2CRG A;  5EZH A;  5K7H A;  1MNM C;  4BXX J;  3OOU A;  2LVS A;  1TWA J;  5FJ8 J;  3QPS A;  2GLO A;  4BKX A;  3S1M J;  3JRE A;  4HNV A;  2K9N A;  2TCT A;  3HOV J;  1E3O C;  1FJL A;  4A69 C;  5FKK A;  4A3C J;  2E19 A;  5J1R A;  1TWH J;  4IEJ A;  2ID3 A;  2NS8 A;  3BTJ A;  3CCY A;  3BR2 A;  4DYQ A;  5FKN A;  2H1K A;  3HM5 A;  3G1M A;  2HYJ A;  2IBD A;  3ZQG A;  1I50 J;  2EBI A;  3I4M J;  4DW6 A;  5M3F J;  1MBH A;  4J19 A;  2EQR A;  2GBY A;  5F0H A;  3OSF A;  4A3E J;  1HDP A;  2JA7 J;  1ZTR A;  2VKV A;  2O9L A;  5F0F A;  2NVT J;  1BJZ A;  2XPU A;  1GUU A;  4IHV A;  5JLW A;  1X2M A;  2ECB A;  4AC0 A;  3HOZ J;  4A3I J;  4A3B J;  2L9R A;  4D5F A;  5FKM A;  2DTZ A;  5EYR A;  1A5J A;  1JKO C;  5FKO A;  1Q1V A;  1P7J A;  2EZK A;  1NK2 P;  5IYC J;  2DA3 A;  3QQA A;  1ZKG A;  5K7Z A;  5FLM J;  4UUS A;  3ZQF A;  2ELK A;  3PO3 J;  3JRA A;  3JRF A;  2OF7 A;  4X6A J;  1JJ8 C;  4Y7N J;  1X2N A;  3I4N J;  4FE4 A;  1U9N A;  3ZOB A;  4L5E A;  1VI0 A;  2X9D A;  1BA5 A;  1NTC A;  3BTI A;  3BR1 A;  1MSF C;  1DU6 A;  3BR5 A;  4I6Z A;  2XGD A;  4M3F A;  4FIS A;  1HCR A;  3S17 J;  1BW6 A;  3QPL A;  5F0C A;  5E3L A;  1JKR C;  1ZR4 A;  1IDY A;  3GTG J;  1ETW A;  3MN2 A;  1JTY A;  3GTQ J;  3PO2 J;  4QIW N;  3HKZ N;  4GFB A;  2IAI A;  2ECC A;  1IGN A;  5IYB J;  3RKQ A;  1CQT A;  1IUF A;  2MW8 A;  2LTP A;  1ZQ3 P;  2X6O A;  4MFE A;  3WHB A;  3FK6 A;  5E3M A;  4M3D A;  3BT9 A;  3JRH A;  3MKL A;  2H8R A;  3GTJ J;  2XSD C;  5GPC A;  5DTD A;  1ETV A;  3BR6 A;  3GTL J;  1Y1V J;  2RAE A;  5F04 A;  5J1U A;  3LOC A;  4CYC B;  1VF9 A;  1ETK A;  1JUP A;  3JRB A;  2JJ7 A;  1WH7 A;  1QVT A;  1IRZ A;  1HDD C;  1UHS A;  3G1L A;  3S2H J;  2M9H A;  2Y0S N;  3OIO A;  3FK7 A;  3E7L A;  3HDD A;  1WI3 A;  2DMT A;  4V2F A;  3SJM A;  3LNQ A;  1RES A;  2COB A;  4I76 A;  2CU7 A;  2X48 A;  1X58 A;  4DYR A;  3JRI A;  2FX0 A;  3GTP J;  4DZP A;  2DMN A;  1XC5 A;  2JMW A;  2K40 A;  4UUT A;  4MFD A;  1YRN B;  2JA8 J;  2EZH A;  4BBS J;  3H3V K;  4IHX A;  3BTL A;  3S1N J;  2G0E A;  5EF6 A;  2O8K A;  1W0T A;  5M3M J;  5C3E J;  1FTT A;  4V2G A;  2ID6 A;  1R9T J;  2DA4 A;  2LLK A;  3L1P A;  2JA6 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...