2CJJA

Crystal structure of the myb domain of the rad transcription factor from antirrhinum majus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords RADIALIS
publication title Crystal Structure of the Myb Domain of the Rad Transcription Factor from Antirrhinum Majus.
pubmed doi rcsb
source organism Antirrhinum majus
total genus 21
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cjjA00
3OOUA 4A3KJ 2AO9A 2ID3A 2MGQA 3F0CA 2X48A 1VFCA 4MFEA 2WV1A 5FJ8J 3JRAA 4J19A 1BW6A 3GTLJ 1GV5A 1W0UA 2LFBA 2ELKA 1MBKA 1UHSA 4AUXA 1W0TA 1ETWA 2COBA 3LSGA 5C3EJ 3RQIA 4W1UA 3HGYA 3BQZA 3JRBA 2IBDA 1LFUP 3Q0UA 4M3EA 1IDYA 4DYRA 1MBGA 1ZQ3P 4FE7A 2DA4A 4XRSG 1MSFC 5M3FJ 2QCOA 4C3IJ 3JRFA 2JA5J 2EZLA 4MLOA 1OCTC 2LTPA 1OCPA 2WB1N 1LE8B 2HDDA 1PUFA 4A3CJ 4D7NA 5F1JA 4BBSJ 2IEKA 2FQ4A 3A03A 5FKOA 2EBIA 2DJNA 1ZR4A 3LOCA 1GUUA 1MBJA 2WAQN 1SANA 1A5JA 1X58A 2DA5A 1QRYA 3BG5A 5M5WJ 4C2MJ 5J1RA 4A3IJ 2XGCA 4QIWN 1IDZA 1ORKA 5J3LA 5M5XJ 2K9NA 2R5ZB 1ZK8A 5C4XJ 2XPWA 2R93J 2YU9J 3MN2A 3BTLA 3D1NI 5DTDA 4C3HJ 5GPCA 4EEFG 3TP3A 2DA7A 1P7JA 1FIAA 2LK2A 2CUEA 2DA1A 9ANTA 5F08A 4A3MJ 1R9TJ 1ITYA 1XC5A 3RZDJ 2CQXA 3ZOBA 3RKQA 1FEXA 3MKLA 3GTGJ 5IPAA 1POGA 1UG2A 2FX0A 1ETOA 1IC8A 3L1PA 1WI3A 5EG0B 1JJ8C 1OJLA 2X9DA 4AYBN 1TWAJ 2CU7A 2M0CA 1D5YA 1RETA 4B4CA 2NS7A 1Q1VA 1JTXA 2NVYJ 4L5EA 2XSDC 3BG3A 2ID6A 2DA6A 4W97A 1U8BA 2B63J 2ECCA 3PO3J 3I4MJ 1FJLA 4DZPA 4A93J 2YUSA 1Y1VJ 1WPKA 1WGXA 1K83J 1I50J 4JX6A 1TWCJ 2MW8A 3CDLA 1PUFB 2M34A 4UUSA 1ETXA 1GVDA 2HXIA 3G1OA 5FKNA 3JRDA 4Y52J 2EQRA 1X2NA 4BY1J 1EF4A 3PM1A 1GT0C 1BA5A 2VPRA 1MH4A 1P7IA 4S0HB 3GTPJ 3FK6A 1JUPA 4JYKA 5F27A 4V2FA 2KDZA 2AHQA 1QVTA 2CQQA 2EZIA 4G12A 5GPAA 1B72A 2XGEA 3S2DJ 3LSJA 5EF6A 2N8GA 2RAEA 4M3FA 4FTHA 1O4XA 1H88C 5IYCJ 3HBLA 2Y30A 5E3LA 2NVQJ 1ETQA 2JA6J 2XPVA 1TWFJ 1TWGJ 1NK2P 5E3NA 3S17J 4QSHA 2G0EA 3K2AA 1RKTA 5FKMA 1RR7A 3MVPA 2JA8J 1H8AC 3QPSA 3S2HJ 4IHXA 3A02A 2FD5A 1U78A 1B8IA 4DYQA 2H8RA 2W48A 2NOGA 1IV6A 4BY7J 1UMQA 3JRCA 1WH7A 2M8GX 5EZHA 4A3FJ 3HDDA 4A69C 1AHDP 1JUSA 2VKEA 3HGGA 2K40A 3HOZJ 1IUFA 5JLWA 5HODA 3Q0WA 2TRTA 2HYJA 4FCYA 3A01A 2L7ZA 5IYBJ 2DMQA 2R5YB 3RZOJ 4IEJA 3NAUA 5F0FA 4D5FA 3S1MJ 3LSRA 1Z0XA 2MSYA 4B1RA 3CQZJ 2O9LA 5BNGA 3HKZN 5F04A 4RBOA 3BR5A 2JMWA 3B6CA 3JREA 2LR8A 2E2JJ 4UUSB 2R7ZJ 1F43A 3SFIA 1HOMA 3JRGA 2O8KA 1RPWA 3S16J 1ETYA 3ZQLA 1H89C 1YRNA 3GTMJ 1IGNA 3ZQCA 1WCMJ 2L0KA 3PO2J 1MH3A 3IH4A 3K7AJ 3S14J 1GDTA 1APLC 2KT0A 3BT9A 3Q0VA 5EDNA 2HOAA 4BKXA 5F0CA 2D5VA 4BBRJ 2NVXJ 1JGGA 2X6OA 4DZJA 1B72B 1HDPA 3SJMA 1IG7A 5IYDJ 1RESA 3DEWA 1CQTA 4XRSA 3BTIA 1VF9A 2ME6A 1NK3P 4CYCA 3CMYA 2IAIA 2GM4A 3HOVJ 1SFOJ 3BR0A 1MBHA 3O8HA 2Y31A 1U9OA 2EH3A 2M2EA 3BTJA 4A3GJ 3FK7A 2E2HJ 5EYRA 4XRMA 4M3DA 3OSFA 5C4JJ 5FLMJ 1JKOC 1Y1WJ 3BR6A 4X1EA 1LFBA 4M3BA 1BJZA 2GLOA 3JR9A 4IHVA 3A01B 3S1RJ 1A6IA 2ECBA 4HNVA 4XIDA 3BR2A 2NS8A 2Y0SN 2K9SA 3I4NJ 2O7OA 4JP0A 2NVTJ 4LOCA 1HF0A 3HOUJ 2Y9YA 1AKHA 2Y9ZA 2Y2ZA 3UKGA 3TP0A 3JRIA 2ME0A 2LVSA 1I6HJ 4B3AA 2JJ7A 3HEFA 2DA2A 4MFDA 2PMZN 4QTRA 2QF7A 3O8GA 4BXXJ 2JK3A 3BTCA 2GBYA 3OIOA 2DMNA 3LSPA 4I76A 1ZTRA 4NDLA 5GP9A 1TWHJ 3TW7A 1ZGWA 3VPRA 3QPLA 2L7FP 3FISA 5FKLA 2E19A 5EEAA 3LNQA 5J1YA 2XB0X 2DA3A 4CYCB 4A3JJ 3HM5A 3Q3SA 3GTJJ 1ENHA 1BL0A 2HOSA 2K9QA 3HOXJ 3TW6A 4A3EJ 2FJ1A 2JA7J 4V2GA 2DN0A 4FISA 1FTZA 2HOTA 5EG0A 5C44J 3C2BA 3GTQJ 2L7MP 5EGOA 2VKVA 2L9RA 2HQ5A 4A3DJ 3HOYJ 1FIPA 3JRHA 4AC0A 1U9NA 2XPUA 3E7LA 4JX4A 3IV5A 4Y7NJ 5IP7J 4DYCA 1MBFA 2R92J 4MIMA 5IOYA 5M5YJ 1FTTA 1JKRC 1JKPC 2H1KA 2LD5A 1HLVA 3GTOJ 4D5CA 2XGDA 1E3OC 4MO7A 2TCTA 5E3MA 5FKKA 3H3VK 4GFBA 3M4OJ 3B6AA 1TC3C 2CJJA 3IH3A 2LKXA 1XG1A 5IP6A 3FIWA 3GTKJ 2E2IJ 2LY9A 3W6VA 3G1LA 1DU6A 3S1QJ 4XK4A 1AKHB 2CUFA 3SDGA 1Z77A 1IRZA 3H0GJ 1VNDA 2MG4A 3M3YJ 2VI6A 4IHWA 5M3MJ 1DU0A 5JLXA 5K7ZA 1X2MA 2I10A 3BG9A 4FE4A 1WH5A 2EZHA 2JWTA 3QQAA 3NARA 3ZQFA 1HDDC 3G1MA 2R0QC 1JKQC 3CCYA 2DTZA 2OF7A 5EZGA 1QVUA 4M3GA 2DMUA 3WHCA 1IJWC 4UUTA 2HXOA 2DMTA 4DW6A 1B8IB 1JT0A 4D7MA 1OFCX 1ETVA 3BR1A 1I3QJ 3ZQHA 3OSGA 1T56A 1VI0A 2LLKA 1ZKGA 3ZQIA 2M9HA 3TEDA 2EZKA 4ABZA 2CRGA 1NTCA 1BW5A 5EGOB 4RDUA 1LE8A 1MNMC 1ZR2A 3HB9A 4A3LJ 2LP0A 3ZQGA 2R5YA 5F0HA 3HOWJ 2XRLA 3GBGA 5IOZA 5DS9A 1F36A 4JX5A 1ETKA 5K7FA 1K61A 1MSEC 3S15J 3WHBA 5IP9J 2JN6A 1JTYA 4X6AJ 3IH2A 2YS9A 3BR3A 4M6VA 2ZB9A 3FKIJ 1T33A 1RKWA 3DCFA 2XB5A 1QPIA 1G2HA 1YRNB 5E3OA 2R5ZA 1AU7A 5FLVA 1S7EA 5J1UA 2HI3A 2DMPA 1MBEA 4C3JJ 3S1NJ 2E1OA 2P81A 4XICA 1JUMA 5K7HA 1HCRA 2VUMJ 1GV2A 1XS9A 4A3BJ 4IHYA 1JJ6C 2OPTA 4I6ZA 3BQYA 1JT6A
chains in the Genus database with same CATH superfamily
5E1WA 4A3KJ 1YOVB 5FROA 1ERDA 2ID3A 2HWVA 3K4LA 4M6XA 4RB0A 4E7KA 2WV1A 3DBHB 2D1VA 3JRAA 2XF5A 4J19A 2E36A 5AIQA 2D45A 4RGRA 5HS7A 4UNOA 3HTUA 2DBBA 1MBKA 3AG1H 1UHSA 4AUXA 1TQIA 1W0TA 2DOFA 5CVRA 1ETWA 3LSGA 1QQIA 3K70D 4W1UA 3BQZA 2HTSA 2WAQA 5DM7F 5L3BA 3Q0UA 1PUEE 1WQ2A 4IF4A 3F8FA 4ENJA 1IDYA 1J0RA 3R4KA 5CVJA 2Z2SB 1D8JA 1JHHA 1ZQ3P 2HFHA 4D0PA 1R36A 1AA7A 1R1TA 3VDXA 1HSJA 2GIZA 3JRFA 1O57A 3ZMDA 2JA5J 2EZLA 1S7AA 1OCTC 1EKEA 3J7YJ 2P7CB 1LE8B 5B1AH 2HDDA 3UNGC 4IPAA 1VZ0A 4A3CJ 5F1JA 5TGTA 4BBSJ 2K9LA 4UHTA 1V54H 2H6BA 4BAYA 4PSWA 5FFZA 2HQNA 4EGZA 3MMYB 2I5UA 1RUOA 1A5JA 4A6DA 4CA0A 4LG0A 1X58A 2DA5A 5M5WJ 5BQTA 3ERED 4ZTJA 4IOAF 4EJVA 5J1RA 4B3XA 4BXFA 2Z33A 4QIWN 3O6BB 3H9JA 1ZAOA 5M5XJ 4XSZF 5C4XJ 1VTNC 2VQGA 2E1MC 2P8TA 4WK8F 5GTHC 4H4KC 2YPRA 4XM3A 3R61A 5ILUA 3O3KA 1V55H 5DTDA 2A5WA 4WCGA 4L9VA 3CC4I 3MZ8A 1CF7B 2H6CA 3I54A 3OOPA 1WVRA 3BDDA 2E1MB 1ITYA 3HOTA 1USTA 2CQNA 2CQXA 3BOQA 3RPUD 3WG7H 5IPAA 4U88A 1POGA 4WF2A 1QZEA 5DUKA 2R4GA 1ETOA 1P4AA 5LRRA 1IC8A 3TOAA 2Q2EA 1WI3A 1FOYA 4UB6C 1O7LA 3WU1B 4HF0A 1PP8F 4XONA 2CU7A 2G9WA 5FLXZ 3HC7A 1MJ9A 4HX4A 2KIMA 1KU2A 1X1PA 2NVYJ 3GFMA 4K2EA 2A3SA 2ID6A 3BPXA 4M6YA 2ECCA 3DBLB 4G7ZF 3DKXA 3PO3J 4TV7A 4DZPA 1DGRM 2JSPA 4NBQA 2Z5UA 1MIJA 3WTZA 2ZJPF 3KIOA 1YYVA 1WGXA 5HLHA 3H9QA 1T8IA 1ZG1A 4JX6A 1PVEA 2MW8A 3FZVA 2PBIA 3DU5A 1D0XA 1GVDA 2EK5A 5FKNA 2STWA 3QPHA 2LG4A 3VODA 4F93B 1K4SA 3L09A 1GT0C 1MH4A 1P7IA 4ESFA 1JUPA 4QWQA 5JR3A 5J4VA 1WJDA 4KIGA 1QVTA 2CQQA 3EUHA 5CVVA 5GPAA 3PQKA 3S2DJ 5E1XA 2N8GA 4XOTA 5TRDA 2RN7A 3DPLC 1ON2A 3KX2A 5E3LA 2JA6J 2ADUA 2XPVA 2JQ7A 2VONA 2LBFB 2HPMA 4HV6A 2K85A 4GDFA 3S17J 2PJRA 3BZKA 4BNCA 3BG7A 1RKTA 2EWNA 2CMPA 3OYNA 3I4PA 3A02A 4IZZA 1B8IA 2H8RA 4DYQA 3BZCA 2NOGA 1JGSA 1XDSA 2NS0A 3C3WA 4BY7J 1MMNA 1UMQA 1WH7A 5EZHA 4A3FJ 4P9FA 1WKMA 3F72A 1FZPB 2K40A 2KRCA 2VQLA 4EM2A 3QP5A 1IUFA 1K78A 3H5NA 1E0EA 4KMFA 1ZREA 1RNLA 2TRTA 2CWEA 1W7PD 3EQLF 5IYBJ 3P7NA 2ICWG 5F0FA 3HYIA 1S9HA 1G8XA 2ZMEC 1Z0XA 4FT8A 2L2OA 3SZTA 2MSYA 1TZLA 5ICCA 1XGNA 2DDAA 1VQ5I 1LNWA 2BGCA 3C7JA 5HOOA 2LR8A 5DEQA 4UUSB 1T95A 5HDNA 2LREA 2R7ZJ 2P0WA 3JRGA 4XNFA 2ZMEB 4XKWA 4MTDA 3ZQLA 1H89C 1YRNA 1IGNA 1BC7C 1XMKA 3R0AA 3PO2J 4LIUA 3GLLA 3DTKA 3G3ZA 4FASD 3H3ZA 1GDTA 1APLC 2KT0A 3JAMZ 3BT9A 3FF5A 4XKBA 4EGYA 4BBRJ 2NVXJ 1R71A 5CQGA 4DZJA 1H0MA 4IVNA 1B72B 3RSNA 3K9TA 1RESA 1P4WA 4XLHA 1UELB 4XRSA 4OAZA 1VF9A 2F4OB 1AOYA 3LFUA 4CCMA 2IT0A 1TP4A 2FEZA 3H3UA 1SD5A 2KMUA 2A6TA 1S3JA 3ZP5A 1LB2A 2B0LA 2DJIA 1G59A 3G73A 1O3TA 2Y31A 5F1RA 1IAWA 1U9OA 4L9TA 3M8EA 3WTUC 2K4JA 2EJRA 3RCOA 3FK7A 1BIAA 3E3VA 4OU0A 1WFXA 3EYYA 5C4JJ 2GOXB 2KIUA 1QHHD 2Z3YA 4NQWA 3CF2A 1A35A 2HTJA 3EETA 5L3FA 1Y56A 1MJAA 3OR2C 3IUOA 2PMZA 4GYIA 3CP8A 2GLOA 4DIQA 2UWMA 2L7KA 2NNYA 1YI2I 1FBUA 4YIRX 3DLAA 3TO9A 3IKVA 1UG0A 4XSXF 2VBWA 3KPHA 4MNUA 3IAM2 2Y0SN 2QZ8A 2QEXI 1XD7A 1EV7A 3HUGB 2Y9YA 3PFIA 1F5TA 1AKHA 3MZHA 4NB5A 1LFPA 1UHMA 4AM3A 4RB3C 1IRXA 1D1BA 1D8KA 2ZXWH 2FNAA 1VQ4I 2DA2A 2VOPA 1T0FC 2ZO4A 3I5UA 4QTRA 2CW0F 2YR2A 3BTCA 4P1WA 3LMMA 1PYVA 3OIOA 2DMNA 1U2WA 1I5ZA 1LPQA 2DFFA 4RAGA 3RYRA 3VOEA 3TW7A 4IKFA 2OC6A 1MZBA 2VE8A 4LMYA 1BI2A 1FMVA 3QPLA 3KP6A 4CZZA 2AS5F 3FISA 5FKLA 2COMA 2RQQA 3TDZC 3DTEA 1XMAA 1HW1A 1S5LC 4CYCB 1Z6RA 4A3JJ 3HM5A 4AD9A 3S3NA 1ENHA 2G7UA 2V26A 2BE5F 1WHUA 2PG4A 3DV8A 3TW6A 4V2GA 2DN0A 2VQCA 1BBYA 5EGOA 2L9RA 2V9VA 3HOYJ 2VQHA 3L2CA 2DT6A 1XGMA 4HW0A 1VQ9I 2XPUA 4F3QA 3PJRA 2AQFA 4Y7NJ 5IP7J 1DP3A 4MIMA 1OCOH 5M5YJ 2R7OA 1JKRC 4HX8A 3RPUA 2H1KA 2LD5A 3FM3A 4A2UA 1E3OC 5GADJ 4A5MA 2TCTA 3AG2H 2F4MB 1TC3C 3BJAA 3TMOA 3IH3A 1RR8C 2W57A 4RGSA 1SMTA 3OMYA 4QPQA 2BOLA 3ZGKA 3REOA 3GW2A 3RDIA 3H0GJ 4HBLA 1IRZA 4ZZDA 4E4HA 2VI6A 5F64A 3BCBA 3PIOF 3L00A 3NWSA 5JLXA 3U1DA 3KE2A 1U8RA 1X2MA 2VC1A 3BG9A 3H35A 4Q48A 1WH5A 2DFIA 2JWTA 3QQAA 2WV0A 1Z91A 2F5CA 4RAFA 3ZQFA 1UCRA 2Z16A 2FF4A 5CVUA 4XL9A 5EZGA 4G6QA 4AVPA 4X0GA 3F8BA 2O03A 2CW8A 1MDMA 2CFOA 1F1ZA 4DW6A 1VQPI 2K3PA 2RC4A 4D7MA 1YJNI 3M9AA 4GGGA 4XLEA 4MEXF 2V6CA 3MEXA 1SVLA 4RA2A 3KZIC 1S8NA 2V6EA 3ZQIA 3TEDA 4WX9A 2YX7A 3FMSA 2PI0A 2A61A 2F5EA 3ML6A 4ABZA 4BHPA 2DI3A 3DF8A 4XLNF 1BJAA 3OL3A 3MKYB 1ZR2A 3OS0A 2CQKA 1T6SA 5HVQC 2BY0A 5A2QK 2V1XA 2LF8A 2WBMA 5IOZA 5DS9A 1F36A 4MHGA 3KYLA 2EILH 1K61A 1QHGA 1FOKA 4XKVA 2KZGA 1YG2A 2JN6A 2R7RA 1RKWA 2OV7A 3AG4H 1U5TC 1Z7UA 3W6KB 1Y0UA 3V8JA 2R5ZA 2Y0MA 4N9IA 5ICFA 4OMZA 1ZG5A 2IGKA 3S1NJ 2PQ8A 2HZTA 1U5TB 1DDNA 1R5ID 4IHYA 3PQJA 4I6ZA 2BV6A 1JT6A 4G6DA 2WADA 3OOUA 2AO9A 2CO5A 3CUQA 3FBNB 2MGQA 2WTEA 3F0CA 1VFCA 4KFCA 3CC7I 1R4NB 2ZC2A 4OIQF 2H1LA 3CUOA 1IW7F 5FJ8J 2W85A 4UVCA 1LQ1A 1E2XA 3GTLJ 1GV5A 2LFBA 2ELKA 5KAIC 2EPFA 3RYPA 2COBA 3D5RC 1V3FA 2R7QA 3HGYA 3K1NA 1AWCA 2GXBA 3QODA 1LFUP 1B9NA 4XOPA 3T8TA 2BY2A 3NRVA 4XORA 2ESNA 4FE7A 2BHZA 2DA4A 5JHUA 1XSVA 2QCOA 1N75A 4OIPF 4C3IJ 3OYKA 2BVLA 3WG9A 2VE9A 2V1UA 3O2PE 1MW7A 2O61A 3L2WA 3K6GA 2IEKA 1R5GA 2EBIA 2HR3A 5D4SA 4DJAA 4E7JA 2X6WA 3LOCA 2LY1A 2KRFA 3LL7A 1GUUA 1MBJA 1T2KA 1CGPA 3J81K 1O3SA 5JVGF 4C2MJ 3VEPA 1LKXA 4A3IJ 2PEXA 2XGCA 3BZ6A 1ORKA 5IT9Z 3Q9VA 2EFNA 3F9KA 3A0HC 3M07A 2K9NA 4P9UA 4A12A 3JW4A 2XPWA 1OR7A 1SD6A 3ECOA 2YU9J 4RM2A 3MN2A 4XN0A 3R6SA 4DNCA 2X6YA 2RV8A 3I53A 2JRMA 3CCRI 4GO1A 4BQQA 5FFXA 2LSOA 2DA7A 2KPMA 3WTWC 2G7HA 4PJNA 3CLQA 5E18F 4FQGA 1EH8A 5F08A 1XC5A 3RZDJ 3AL0C 1D5VA 4KN4X 4A0ZA 3F8NA 3OYFA 3GTGJ 2BYVE 4M74A 1YIJI 2FX0A 3QYEA 2QA4I 4EJWA 2CV2A 2JRTA 2NRAC 3OS2A 2Y69H 4BS9A 1LEBA 3PUBA 4E6KG 1JJ8C 3OS1A 2X9DA 4IXAA 3GFLA 3EPZA 1WRJA 3LA7A 4UVBA 1Y8QB 1QNTA 3AL0B 2H94A 1MD0A 5CVIA 5BPIA 1D5YA 1RETA 3DEEA 3E6MA 3FXKA 4YRVA 1Q1VA 2IA1A 3IL2A 4L5EA 4G8XA 2XSDC 4Q5SF 3BG3A 1D1CA 2DA6A 2DU9A 3CO7C 1U8BA 4KIBA 2M7AA 1FYMA 3MFKA 1GLNA 1FJLA 1YFHA 4IQ4A 2YUSA 4QLCU 2FOWA 1TNTA 2VT3A 4UUVA 3ZCOA 2OD5A 1I50J 1K79A 1TWCJ 4BDYA 3CDLA 5LD2C 3E97A 2M34A 2OTJI 1ETXA 1FPQA 3JRDA 3KP7A 2GA1A 4ZDPA 1O3RA 4AU7A 1X19A 2J5OA 1YTYA 4BY1J 1EF4A 4M9SA 2FXAA 3FM5A 3M7GA 1R58A 1BA5A 1RC9A 4RMNA 3KEOA 3CCJI 2IRFG 4B43A 1R1VA 3IRRA 1MNDA 3MZYA 1FC3A 3UR3C 2WAFA 3GCMA 2V9KA 4G12A 4PJMA 2MA3A 5EF6A 4NC7A 1H88C 4M3FA 1K4TA 2WY8Q 5IYCJ 4Z2YA 5B66C 2WAEA 2DTRA 2QSGX 1YX3A 3A2KA 2XASA 1TWFJ 1TWGJ 2L54A 3GFIA 2ISYA 1NK2P 4DOZA 1LVKA 2MABA 1R00A 1R1UA 2OJED 2M4KA 3ABTA 5ICEA 2R7FA 3F23A 2IS6A 2V7FA 2ETHA 1RR7A 3MVPA 3OWTA 1KZHA 4NC8A 1SFUA 2VPLA 4IHXA 1U78A 1TQMA 4ZYHA 2W48A 3H1CA 4LD5A 3HHGA 4QPOA 3OYMA 3HDDA 3P9IA 1JUSA 4YEJA 2VKEA 3ECHA 1IRFA 4BHCA 2XKPA 4PFOA 4BACA 3FHNA 3GO5A 1X3UA 4M71A 1J5YA 3Q0WA 2OZUA 3A01A 2L7ZA 4F52A 5HLIA 2R5YB 1KYZA 3BWGA 2VASA 3S1MJ 2CV1A 2Q1ZB 1NHAA 3LSRA 1N77A 1T39A 1DP7P 2E5ZA 1XPXA 2OUMA 2V1NA 2F4IA 5B1BH 2HS5A 5F04A 4L18B 1ZHFA 3IRQA 3WODF 3WTTC 3E6BA 1F43A 4KYWA 3PNYA 1IXCA 1YLFA 1EA3A 4CO8A 3OYHA 4ENMA 3DLLF 1NG6A 3KCCA 3S14J 5E1ZB 1X4PA 3Q0VA 1EJ9A 2OU2A 3CZ6A 2HOAA 3VFZA 1JGGA 4ETSA 3IHUA 2HKXA 1KU9A 2P7VB 5IYDJ 2X85A 1IN7A 2DFEA 2ZFUA 2LOOA 3BTIA 4R8HA 2HVRA 2ME6A 3L7WA 3I59B 1NK3P 2IAIA 3J80K 2LMDA 3S2WA 2UXNA 5DM6F 1XCBA 1BOBA 1SFOJ 3E1SA 3W2VA 4CZCA 2VBYA 3QYFA 1Y8RB 4PJLA 4OIRF 1T98A 2PX9A 2FRHA 4RB2C 2IJLA 1JXSA 4EMSA 2M2EA 5LLQA 3BTJA 1UZCA 4ZDOA 1W4MA 2XAHA 3IWZA 4A3GJ 3ZMTA 2OAZA 4KNYA 2E2HJ 4IOCF 4BUPA 1MNEA 1SC7A 2QVOA 4M3DA 3OSFA 2QKMB 3BJOA 2ZJRF 3M1CA 1Y0NA 1SFXA 5FLMJ 2BBYA 3BR6A 4HQMA 4M72A 2CFXA 1LJ9A 3ELKA 5B3SH 4FX4A 3I9V2 3J7AO 1VQMI 4OWRB 1K78B 1BJZA 4N4OB 4EV0A 2PN6A 2HKOA 1G3TA 4EM0B 3JR9A 4Z6YA 2O8XA 3S1RJ 1A6IA 2IA0A 2QUFA 4M9XA 2ECBA 5J47A 2HDWA 5BS6A 1SMYF 2A5YB 3PL8A 1P2FA 3ULQB 2HYFA 2O0YA 3H5RA 4I0AA 4BJ6C 5FRMA 4ZYGA 2O7OA 3I4NJ 2V9PA 2ZCWA 4LOCA 2XDVA 2OCCH 2LYCA 3EYIA 4XMYA 2Y2ZA 2JPBA 1IF1A 3JRIA 2KIQA 2ME0A 4O5VA 4GRIA 3KFWX 3N97A 1I6HJ 3ZR8X 4B3AA 4EVIA 3RKWA 4MFDA 5K5QA 2L9NA 3GWZA 4BQAA 2JK3A 3FHZA 1YJWI 4B09A 1ZTRA 2VT2A 1GXPA 2GOMA 2M3AA 1ULYA 3A0BC 3ZMVA 1CF7A 1ZGWA 3D5LA 3VPRA 2ZNZA 2LRDA 5FGMA 1YS7A 2L7FP 2NAZA 3E5UA 1UFMA 5LFAA 5EEAA 2Z1DA 5J1YA 3U21A 2DXIA 1DPRA 2CGPA 4YFNF 2A07F 4IHSA 2ESHA 4KJZA 1SVOA 2KISA 3GTJJ 3BLYA 1BI0A 2X51A 4S05A 2Z9OA 2K9QA 2ZFWA 3MD2A 2FJ1A 2IXSA 2HOTA 5L3GA 5C44J 3C2BA 2L7MP 1UAAA 1HXDA 2OTLI 1R7JA 3D5SC 4E7IA 3V7RA 3CCEI 2HZDA 5L3DA 3U1KA 4A3DJ 4L5JA 2HPIA 2W84A 4CICA 3BROA 4I0BA 4ZC3A 4YFXF 1U9NA 5CPRB 4JX4A 5J6XA 2KJCA 3IV5A 4E7HA 4NQWB 1J75A 2R92J 5IOYA 1FTTA 4HG2A 1ZH5A 1JKPC 1SFKA 1XGSA 2R7XA 5AONA 3ROUA 2EFPA 3GTOJ 1D0YA 2XGDA 1YX5A 2GXAA 4MO7A 5E3MA 2DQLA 5FKKA 4BHBA 4GFBA 3M4OJ 3B6AA 1U0JA 1J59A 2CS3A 2CJJA 2LKXA 5IP6A 4N9HA 2YX4A 2E2IJ 2JVGA 3FXQA 2GAUA 1Y39A 1GHCA 3W6VA 1Z3YA 4AIHA 4EJTA 4XK4A 1AKHB 4HA8A 4L0YB 2ZNYA 2CUFA 1FP1D 1R5HA 4HNUA 1WJBA 3KLNA 4HF1A 1MMGA 1FBQA 3MKZA 2XAQA 1DU0A 1XGOA 1DQUA 4HPQA 1RUNA 1TW3A 2MLKA 4F91B 1SAXA 2M0MA 4ITVA 4FE4A 3G6EI 1VQ8I 2EZHA 3AFHA 3HPGA 3X2QH 2JA2A 2LDUA 3SXYA 1G3SA 2K7LA 2LBFA 3OYDA 4CCJA 1HDDC 3ESWB 2OF7A 2CH0A 3RQ4A 4M3GA 4ZZLA 1NG7A 4BEHA 3WHCA 5LHHA 3WTXC 2FMYA 5TJJA 1JT0A 2XHKA 3QOEA 3V8LA 1ETVA 1OFCX 3BR1A 4NC6A 4IRIA 2HVSA 4U7DA 2GWRA 4KITB 2EIJH 1T56A 1VI0A 2K5CA 3SZGA 2RDPA 2UZKA 2M9HA 5HDGA 5H6QA 1G4DA 1QZZA 4AIKA 4B8XA 2HQRA 1HW5A 3CJTB 1NTCA 2HGCA 3F21A 1BW5A 2EV0A 5EGOB 4RDUA 3KP3A 2MLGA 2LP0A 1YW7A 1KU7A 3GZ5A 4PSXA 4CH7A 1ON1A 2MH9A 1MMSA 3F8CA 2FQ3A 3HOWJ 3TQNA 4EJOA 2A05A 3ZXSA 1BI3A 5DCMB 1O3QA 1MSEC 3OYJA 3GEZA 5K1YA 3BR3A 3LSHA 1X3ZB 2JSCA 1QGPA 3SDBA 4B44A 4AIJA 2QBYB 3E5QA 5JHFA 3DKYA 1G6NA 3U9GA 2XB5A 5F6FA 1QPIA 1G2HA 3ISPA 4L9NA 3I55I 1AU7A 2R7WA 1MBEA 4C3JJ 2GA2A 2WWYA 2P81A 1QPMA 4XICA 4U0VA 2VL8A 1TL8A 1R23A 3V42A 1YS6A 2IPQX 2LF7A 3BQYA 1YIOA 3MKWB 2K4BA 2KQRA 2R7VA 2E1CA 2ZXHA 2X48A 3ZMSA 1IZ1A 2EA2A 2DW4A 3L2RA 5TISC 3CCVI 1TBXA 3RQIA 2KP6A 3WTYC 1ZYRF 1MDMB 2XKOA 3P9KA 3DTIA 4WWCA 4M3EA 1FSHA 1W5SA 2MYSA 5J4YA 4BJTA 3KLOA 1MBGA 1XSDA 1FLIA 2UV1A 4BU2A 3K2ZA 3W2WA 3ASNH 3OR1C 4XRSG 5D5UB 1BN5A 4KA4A 5M3FJ 4C2UA 1TT0A 3PSFA 5DCFA 2DOEA 1E17A 4NUBA 2LTPA 1BR1A 2KLOA 2WB1N 1PUFA 4I09A 4MQ9F 3SFZA 2O5RA 1VQ6I 4KT5C 2VLAA 1L3LA 1ACIA 3FXMA 1ZLKA 1TQPA 2K86A 5DD8A 4KN7X 3T1BA 3A03A 3WU2C 2M1BA 2DJNA 2GIVA 4XLAA 3VSLA 1YITI 4HQEA 3ZQ7A 4G6TB 3CCSI 4G7OF 2R7TA 1J9IA 2WAQN 1SANA 2FBIA 1QRYA 1XSXA 2JTVA 2BY3A 4XBFA 1STZA 1FBSA 1IDZA 2M45A 1MKMA 2VB6A 4HAMA 1BR4A 1X1BA 4AWXB 1I1GA 1KONA 5D6FA 2R5ZB 3V7SA 3PNVA 3CUQC 1RRJA 1HC8A 4NHJA 1SD4A 4IQJA 3T0YA 1ZARA 2DAOA 2DFHA 4C3HJ 4YIIA 3RTRA 3TP3A 4HDUA 2F5FA 1OISA 3ZN1A 1P7JA 1FIAA 2LK2A 3PNTA 4M9ZA 2H27A 2DA1A 3CUQB 4F55A 1TTYA 5FD5A 9ANTA 2C6YA 4A3MJ 2AXTC 1R9TJ 3ABMH 3F3XA 3CJQB 2IS4A 3ZQQA 1HSTA 3IKTA 3L1PA 4BGDA 3KP4A 4A5NA 2KIFA 5EG0B 2RKHA 1OJLA 1WI9A 1Z05A 3FXRA 4GYGA 4UV9A 1TWAJ 4DBRA 3IWFA 5H6RA 2DT7B 4B4CA 2H8WA 2NS7A 5CYVA 1JTXA 5FO5A 3BJ6A 3KYDB 4W97A 2B63J 2RQPA 2QM3A 4HDVA 4CUGA 5JI6A 2R7UA 3I4MJ 2HVQA 3JCUC 5LGTA 4A93J 4ZYEA 2XF7A 2ELJA 2QQ9A 4D9JA 4XN3A 3ASOH 4L9JA 4KT6A 3G1OA 4HSTA 4CXFA 2EQRA 3CO6C 2FUG2 1X2NA 1J09A 2A6EF 3S3MA 4LFUA 2VXZA 3LWFA 1W7PA 1OR7C 5EJCA 4JK1X 1WJ5A 1FT9A 3FK6A 4JYKA 4BE0A 3KEYA 2I8DA 4PFPA 4V2FA 4RM3A 2KDZA 4O6JA 1OMIA 4PGHA 3LSIA 1IN6A 3VYSB 4F92B 4AVZA 2E7XA 4HX7A 3I64A 2EZIA 4XQFA 2XGEA 2EINH 1R6RA 3LSJA 4DBQA 2RAEA 1O4XA 3M8FA 4RLQA 2P5VA 2VJJA 4ZH4F 2ZSHB 3HBLA 5E20A 2Y30A 2NVQJ 2VJIA 1Q1HA 5E3NA 2M4GA 1HKSA 3K4JA 2E35A 1HKQA 4LJZF 4JQFA 4Y3OA 4E7LA 2DO7A 2NNNA 2WC2A 5FKMA 4R79A 1DUXC 1A36A 4IO9F 2BXYA 1H8AC 3QPSA 2OBPA 2P6TA 2VKDA 2FD5A 2CV0A 1ZGAA 2MD5A 4BJ5C 3U2RA 5JVTA 5AIPA 2LY2A 2M8GX 2EFWA 4A69C 4YIFA 1Z7LA 3DP7A 3ZN0A 5ILVA 2Q0OA 2QQ8A 3LSMA 5JLWA 4BDZA 4L0ZB 2VBZA 3BPVA 2F5VA 2W25A 5HODA 2KHMA 1VQOI 4RLFA 1ZGJA 2QWWA 3QOPA 4LG3A 4IEJA 2B9SA 2HEOA 1J2XA 2CUJA 3GZNB 2KJBA 1QA6A 3BG6A 1I39A 3W2AA 4PJ0C 4YELA 3CQZJ 3SHFA 1ZLJA 2O9LA 2VXDA 2ZJ2A 3TO7A 3HKZN 5D5XB 5FLXK 3RIRA 4RBOA 2JMWA 2L3DA 3B6CA 3IC7A 4Y13A 5HLGA 4IJAA 2MC4A 3PUFA 5KHDA 1WJAA 2M8EA 3GTMJ 1DPUA 3VB2A 3GF2A 2L0KA 2BY1A 4Q47A 5LGNA 2TDXA 1MH3A 3C2HA 3IH4A 3CJRB 1RZ4A 1FNNA 2W00A 2E60A 2QSFX 4BKXA 1U5TA 5F0CA 4LLGF 2CQ7A 1WJFA 3HZJA 5BOXA 5ILSA 2IGOA 3K4KA 2W82A 1IG7A 3DEWA 4LLNA 1E3PA 4UY8I 2E71A 2FBKA 3A1YA 4XLPF 4LB6B 3QU6A 2VBXA 2GM4A 1G3YA 3HOVJ 3L9FA 4ENNA 5K5RA 3CF5F 2RGVA 3HTSB 1MBHA 1VQ7I 1KQ8A 5EEGA 3P5JA 2Y0SA 1XB4A 5HNHA 2EH3A 3OYIA 2X4HA 1UB9A 1F4KA 1BOAA 4CSWA 5EYRA 3SZPA 4XRMA 1WJEA 2NOJB 4YG2F 1FWZA 1JKOC 1Y1WJ 5LEKA 4ESBA 4HLYA 3DXJF 4X1EA 4HNTA 1LFBA 1IUYA 1XN7A 3M1EA 3AAFA 3JSPA 4M3BA 2E5NA 5BPDA 3F6OA 1QO0D 2KDOA 3HSFA 2XSJC 5J40A 3A01B 4UV8A 4DGWB 4HNVA 4XIDA 2DYRH 3RKXA 3I3LA 3BR2A 3ABUA 2VOOA 3I0TA 2NS8A 2JZYA 2K9SA 2Y75A 3HHHA 1WZ2A 4LG0B 4OMYA 3DEUA 1OCRH 2GZWA 3TL4X 3PSIA 1I27A 5KNLA 3L2VA 2O6GE 3TP0A 2PMHA 4UXNA 3K4BA 4EATA 1D1AA 3FMRA 2WA0A 3ZMZA 2PMZN 3FX3A 2BEOA 4BH9A 2BW3A 2DLLA 4S04A 1E3HA 2L5QA 4NDLA 4PDKA 1D3YA 1OKRA 3S93A 5GP9A 1VQNI 2ACJA 3H92A 2CW7A 4RGUA 2MC3A 1KU3A 2DK5A 2NXNB 4M73A 2AQEA 4MEYF 1WJCA 2GXGA 2WB1A 4CCLA 2MBFA 5HLTA 5GAEJ 3JAMK 4XRFA 1OPCA 5A2QZ 3M8JA 2HDCA 2Q2EB 1BL0A 4V19K 2DK8A 2HOSA 4BYYA 1FTZA 2JA7J 4FISA 1RIOH 3DPUA 2STTA 4GXOA 2HNHA 2VKVA 1JHFA 2HQ5A 4LIVA 4II2A 1B9MA 1ZG3A 3BY6A 4MGRA 4P55A 5CLSA 3D0SA 1A6QA 3K0LA 1FMWA 5L3EA 3E7LA 1TNSA 2X1CA 5FB2A 5D5WB 4DQ2A 3OL4A 1MBFA 2FOKA 5GAGJ 2CSOA 3TGNA 5KAFC 4JOMA 4D5CA 2X0LA 3H3VK 5E8IA 3HG9A 3HSEA 3EUHC 4R1HA 2IS2A 1ZELA 5HS9A 3E6CC 1W36C 4Y15A 3CESA 2EA4A 2L4AA 3FIWA 3GTKJ 4U87A 4KUMA 2DCEA 3FMQA 3VYRB 3C1DA 3G1LA 4ZYAA 1DU6A 3S1QJ 1Y6IA 2L01A 3SDGA 1Z77A 4BE2A 1HA8A 2XGXA 1ODDA 3R0JA 4RGXA 1BR2A 4IHWA 5M3MJ 4HYEA 2F6CA 4RS8A 3CDIA 5K7ZA 3T5XA 1REPC 3JTGA 5ERIA 2DOAA 5LHIA 1S29A 2VJ4A 3QRFF 3SYTA 3BC8A 5E79C 2OZ6A 3G1MA 2PJRB 3CCYA 2WY7Q 4HV5A 4C2TA 4E7SA 5DYMA 2DMUA 2YU3A 1J7KA 1BM9A 2EB7A 4PJJA 3I56I 2H09A 1B8IB 1ZRFA 2FE3A 1IV8A 1T08B 4IRHA 2OQRA 1R4MB 1K7AA 1OCCH 2XAJA 3ERMA 4EJUA 3VWBA 2LLKA 4Y4RA 1I6XA 3TBIA 4CCKA 2K9MA 4U0YA 4OIOF 1MJBA 1OQYA 1BIBA 2CRGA 1ZRDA 2F5DA 3EDPA 4FETA 3WE3A 1EH7A 2EV5A 4HOBA 3J81Z 1LE8A 4N0BA 1X1CA 3HB9A 4A3LJ 2ELHA 3DWLE 3ZQGA 4BL0B 2R5YA 4I7HA 1B6AA 1HKTA 1HBXG 3TDUC 3GBGA 1IO2A 3HRTA 4OAYA 1LVAA 1ETKA 1OCZH 3KETA 5LEJA 3S15J 2R7SA 4X6AJ 3QP6A 3IH2A 4M6VA 2XRNA 3KEQA 1Z21A 2JUCA 3DCFA 5GAHJ 3A4CA 5E3OA 1YRNB 5FLVA 4ZDLA 1S7EA 3IAS2 5J1UA 5HDKA 2M5WA 2DMPA 2LH9A 2RNJA 4Q4ZF 4B47A 1OYIA 4CGZA 2CG4A 5K5OA 2DPDA 1U6GA 1JUMA 1FP2A 2ZXIA 1F9NA 2X6XA 1HCRA 1GV2A 3VYUB 2OPTA 4LITA 2FNPA 3JSOA 2BVMA 2KZVA 2VN2A 3G71I 4LLLA 3S8PA 3FXOA 3GFJA 4MFEA 3ABKH 2NYXA 1W5CC 3DU6A 2KFDA 4C9YA 1BW6A 5L3CA 2E34A 3LAPA 1W0UA 3I59A 2KKOA 2UXXA 2LKSA 1JI8A 3GLXA 3NQOA 4IRGA 5C3EJ 4BEHB 1S7OA 3JRBA 2ZBKA 5CJ9A 2IBDA 1IN4A 2JUGA 1Z3XA 1OLTA 3HKZA 2JVHA 4DYRA 4D1QA 3KZYA 4OINF 2EV6A 2OA4A 3I71A 3FXUA 5D8KB 1P4XA 5KCMA 3OYEA 3K70C 2QSHX 1QZYA 3OYBA 2XC7A 2IVMA 1MSFC 1UJ8A 3HIFA 3CMMA 1K6YA 2BHYA 2ISZA 2Z99A 4MLOA 2QLZA 1OCPA 4EQQA 3MQ0A 5B5EC 2E1NA 1KA8A 1I3AA 4GCVA 4D7NA 5LBQA 3ZPLA 2ZJQF 3GMEA 2XIGA 2FQ4A 1U3EM 5FKOA 3KP2A 3B02A 1ZR4A 1NH3A 2R3SA 3V8KA 2EFQA 3L2UA 3BG5A 4H0EA 1K6OA 4RAZA 2FMLA 4Y33A 2MH2A 1Z1DA 1XMXA 4B48A 1TT5B 4KIFA 5J3LA 3WU0A 1ZK8A 1VQLI 2R93J 4PUSA 4Y17A 3TOBA 3BTLA 4PGGA 3D1NI 5FRNA 2RNGA 2XF6A 3CP2A 2XROA 2DT5A 3OIQA 5GPCA 4EEFG 1V5GA 1TLHB 1QBJA 2CUEA 3QU3A 3QYBA 3ABLH 4WXDA 2QKLB 3K10A 3ZOBA 3RKQA 2JT1A 4KDPA 3HPHA 1FEXA 3MKLA 4II3A 4KMUX 1UG2A 1T38A 2M7BA 1WSUA 1R22A 4AYBN 3HRMA 5DD4A 2OCEA 3CCUI 2M0CA 2RVCA 5LRSA 1PDNC 3FWEA 3FBIB 3ONQA 5LHGA 3NEUA 2B7EA 3DFGA 2VODA 3LSTA 1LDKB 3LFKA 3QPTA 4LK0F 1YW8A 5BMZA 1Y1VJ 1WPKA 2W4SA 2FA5A 4I01A 1K83J 4J00A 1Z67A 1PUFB 4UUSA 2HXIA 4Y52J 5D5VB 2D2WA 2XVCA 1KQ9A 2ZMEA 3JTHA 5D4RA 2QGUA 3S3OA 3E6DA 2DPUA 1YHQI 3ZRGA 2X1EA 1S72I 4E70A 4CHUA 3PM1A 2VPRA 1MGTA 4S0HB 3F22A 4XR6A 3GTPJ 2BXZA 5F27A 3AKZA 2NVUB 3J80Z 2OQGA 2AHQA 4HEA2 5CQEA 2PMUA 4G94A 1B72A 3G2BA 2W7NA 5ICGA 3CTAA 2HQAA 2FU4A 4FTHA 3DKWA 2CYYA 1HQCA 4XLFA 1ETQA 1ZN2A 1B1BA 3DPTA 4G7HF 5E17F 4QSHA 1JE8A 2G0EA 4BXUA 3K2AA 2PJPA 5IT9K 1LDJA 2JA8J 1PJRA 3CCMI 1FYKA 1Z9CA 3S2HJ 3MAJA 3CC2I 2DYSH 3LSKA 1N25A 3EUAA 1IV6A 1SAUA 3JRCA 2LNBA 3RPQA 1BI1A 1AHDP 1PP7U 5IY5H 3HGGA 3HXLA 1YJ9I 4HF2A 3HOZJ 1P9QC 3WTSC 3HL2A 2R7DA 4HSRA 3GX4X 1G3WA 3OIPA 2P6SA 4ZYDA 2QYOA 1H9GA 1MMDA 2HYJA 4FCYA 3CD6I 3H9GA 2DMQA 1FOWA 5LGUA 3RZOJ 3NAUA 4D5FA 3QAHA 5H2FC 5D6EA 3HRUA 2VC0A 4PZJA 4B1RA 1TW2A 5DCMA 1XTAA 3MWMA 5BNGA 3HUGA 3BR5A 3K1PA 3JREA 1WWXA 3Q5FA 3HRSA 4LK1F 4IL6C 3I58A 2E2JJ 2QBYA 3SFIA 1HOMA 2F2EA 2O8KA 1RPWA 3S16J 1ETYA 3GZ6A 2IW5A 3ZQCA 2ZKZA 1WCMJ 3H0DA 1W7PB 1H9TA 3P9CA 3K7AJ 1Z6TA 4CCNA 3VSKA 2XUBA 5EDNA 3FKJA 1LDDA 2D5VA 1YO5C 2X6OA 1KQ0A 2FBHA 4KICA 1HDPA 3SJMA 1T0FA 1X3WB 1CQTA 1OYWA 4I02A 2MD0A 2W24A 3OYGA 3C2GA 3GYHX 1B59A 4CYCA 3CMYA 4EM1A 3LA3A 2IGNA 1S6LA 3CLOA 6PAXA 5J8CA 2JPCA 5KVRA 3BR0A 2K27A 3K4NA 3O8HA 4L5IA 4J01A 1X1DA 1A04A 1YQAA 3TKYA 2UUZA 2FSWA 3KP5A 3RKYA 4RB1A 2K3FA 3E0JB 3E5XA 3QWLA 1KYWA 1YW9A 1OYYA 3KYCB 5IT3A 3OYLA 1V4RA 1YE9A 4MQVA 4HRIA 2HOEA 5H20A 5E8GA 2ZXJA 3GUDA 3F8MA 4XKCA 2V79A 1HW2A 2KRHA 4IHVA 2VIXA 2HU9A 4UB8C 1FOXA 4I98B 1SVMA 1W5TA 1XX5A 2VJ5A 2XAGA 3W3CA 1A31A 4O3MA 1SFEA 3WGIA 1X4OA 4AIDA 1I1SA 2QQBA 2O3FA 2J5PA 2BZTA 4OOIA 4JP0A 2NVTJ 4PCQA 2DDBA 3HOUJ 1HF0A 4FX0A 2A6HF 2Y9ZA 1V5EA 3UKGA 1XCVA 1C0WA 1UHWA 2M87A 2IGMA 2LVSA 2JJ7A 3HEFA 1IN8A 3BCAA 4ON0A 2PLYA 4WXCA 2QF7A 3O8GA 4BXXJ 4ZJZA 2GBYA 1P92A 3LSPA 1W1WE 4I76A 3OYAA 3OY9A 1X1AA 5CKTA 2Y48A 4MTEA 1TWHJ 2V4JC 3GVAA 4BQOA 3DBRB 3AG3H 1GXQA 2MFZA 3K69A 4UVAA 3COAC 2E19A 2M30A 3LQRA 3LNQA 2VKHA 3LQQA 2XB0X 2DA3A 3EUKL 2LC2A 3Q3SA 1P6RA 4IX7A 4ESJA 3HSRA 2Q8KA 5FD6A 3HOXJ 3PFYA 4A3EJ 2IS1A 2P5KA 4JBAA 3HOSA 3RI4A 5EG0A 3GTQJ 3Q9SA 1R49A 4WXHA 3L2QA 3H36A 3WGGA 3K4CA 2PFBA 4A0XA 1SEUA 5D8LB 1FIPA 3ZMUA 4CCOA 3JRHA 4AC0A 3V7CA 2K02A 4DYCA 4C30A 1V5FA 4U0WA 2IA2A 3WTVC 1L0OC 1W36D 2IP2A 5GTIC 1HLVA 4PK4A 3G4SI 4P5OA 5DV5A 1FSEA 1ZRCA 1XG1A 2L9SA 4LGWA 2EIMH 4U7BA 2F48A 5DDGA 1N78A 3FXLA 5J8FA 3HJEA 1KGSA 3WGHA 2LY9A 3DQVC 2KL4A 1LEAA 3SQNA 3BP8A 5EEHA 3CMAI 3CCQI 2E7WA 3KZZA 1VNDA 1RI7A 2MG4A 1ONVA 4A0YA 3M3YJ 2CUZA 4FHTA 3FXJA 2P4WA 3NWTA 5KK1A 3V4GA 3OYCA 4XLCA 3CCLI 2I10A 5JFRA 1MMAA 4AYBA 1BC8C 2YSRA 3NARA 3SEQA 1IRGA 3VYTB 2D1HA 2BW3B 2L9VA 2R0QC 3S32A 1JKQC 2L02A 2DTZA 3H5AA 1QVUA 1EH6A 3F6VA 3K1MA 1QU3A 2XAFA 3RJPA 2AXLA 4CDGA 1IJWC 2DQRA 3W6JB 4UUTA 4LB5A 2HXOA 5ED4A 4I2OA 1D0ZA 2DMTA 3J7AY 2XAUA 4IHTA 1M1EB 1I3QJ 3ZQHA 3WE2A 4KISA 3OSGA 2HYGD 2V1DA 1XDUA 5DUIA 1ZKGA 2LKPA 1FY7A 3K4MA 1GVJA 2DODA 2EZKA 3LAJA 4ASNA 4RAYA 2L4MA 3TO6A 2A69F 1MNMC 2P5LC 1O7FA 2W1OA 2A68F 5F0HA 3GXOA 2ZSIB 3MCZA 2RREA 1SD7A 2XRLA 3CMEI 1USSA 3J7ZI 4JX5A 5K7FA 1IXSB 3B73A 2EIKH 5HNFA 4YFKF 2XV4S 3WHBA 5IP9J 1JTYA 3N4MA 3C18A 2YS9A 4N4NB 2ZB9A 3FKIJ 1T33A 4NNJA 4ZTFA 1IN5A 2QENA 3LA2A 2GQQA 4G9YA 3R60A 3FDYA 1FX7A 3SEZA 2X1DA 4HLXA 4F7ZA 4P96A 4ENKA 1FYLA 1LUJB 1DGWY 2QQAA 4HZFA 4A6EA 2HI3A 2EFOA 5HS8A 3N05A 1VQKI 2E1OA 4BE1A 1B4AA 3CJNA 4ANJA 5K7HA 2VUMJ 4I99C 1IXRC 3T8RA 3PIPF 1XS9A 3OV8A 4E7ZA 4A3BJ 1JJ6C 4BQNA 4CYDA 3IP4B 3CDHA
chains in the Genus database with same CATH topology
3OOUA 4A3KJ 2AO9A 2ID3A 2MGQA 3F0CA 2X48A 1VFCA 4MFEA 2WV1A 5FJ8J 3JRAA 4J19A 1BW6A 3GTLJ 1GV5A 1W0UA 2LFBA 2ELKA 1MBKA 1UHSA 4AUXA 1W0TA 1ETWA 2COBA 3LSGA 5C3EJ 3RQIA 4W1UA 3HGYA 3BQZA 3JRBA 2IBDA 1LFUP 3Q0UA 4M3EA 1IDYA 4DYRA 1MBGA 1ZQ3P 4FE7A 2DA4A 4XRSG 1MSFC 5M3FJ 2QCOA 4C3IJ 3JRFA 2JA5J 2EZLA 4MLOA 1OCTC 2LTPA 1OCPA 2WB1N 1LE8B 2HDDA 1PUFA 4A3CJ 4D7NA 5F1JA 4BBSJ 2IEKA 2FQ4A 3A03A 5FKOA 2EBIA 2DJNA 1ZR4A 3LOCA 1GUUA 1MBJA 2WAQN 1SANA 1A5JA 1X58A 2DA5A 1QRYA 3BG5A 5M5WJ 4C2MJ 5J1RA 4A3IJ 2XGCA 4QIWN 1IDZA 1ORKA 5J3LA 5M5XJ 2K9NA 2R5ZB 1ZK8A 5C4XJ 2XPWA 2R93J 2YU9J 3MN2A 3BTLA 3D1NI 5DTDA 4C3HJ 5GPCA 4EEFG 3TP3A 2DA7A 1P7JA 1FIAA 2LK2A 2CUEA 2DA1A 9ANTA 5F08A 4A3MJ 1R9TJ 1ITYA 1XC5A 3RZDJ 2CQXA 3ZOBA 3RKQA 1FEXA 3MKLA 3GTGJ 5IPAA 1POGA 1UG2A 2FX0A 1ETOA 1IC8A 3L1PA 1WI3A 5EG0B 1JJ8C 1OJLA 2X9DA 4AYBN 1TWAJ 2CU7A 2M0CA 1D5YA 1RETA 4B4CA 2NS7A 1Q1VA 1JTXA 2NVYJ 4L5EA 2XSDC 3BG3A 2ID6A 2DA6A 4W97A 1U8BA 2B63J 2ECCA 3PO3J 3I4MJ 1FJLA 4DZPA 4A93J 2YUSA 1Y1VJ 1WPKA 1WGXA 1K83J 1I50J 4JX6A 1TWCJ 2MW8A 3CDLA 1PUFB 2M34A 4UUSA 1ETXA 1GVDA 2HXIA 3G1OA 5FKNA 3JRDA 4Y52J 2EQRA 1X2NA 4BY1J 1EF4A 3PM1A 1GT0C 1BA5A 2VPRA 1MH4A 1P7IA 4S0HB 3GTPJ 3FK6A 1JUPA 4JYKA 5F27A 4V2FA 2KDZA 2AHQA 1QVTA 2CQQA 2EZIA 4G12A 5GPAA 1B72A 2XGEA 3S2DJ 3LSJA 5EF6A 2N8GA 2RAEA 4M3FA 4FTHA 1O4XA 1H88C 5IYCJ 3HBLA 2Y30A 5E3LA 2NVQJ 1ETQA 2JA6J 2XPVA 1TWFJ 1TWGJ 1NK2P 5E3NA 3S17J 4QSHA 2G0EA 3K2AA 1RKTA 5FKMA 1RR7A 3MVPA 2JA8J 1H8AC 3QPSA 3S2HJ 4IHXA 3A02A 2FD5A 1U78A 1B8IA 4DYQA 2H8RA 2W48A 2NOGA 1IV6A 4BY7J 1UMQA 3JRCA 1WH7A 2M8GX 5EZHA 4A3FJ 3HDDA 4A69C 1AHDP 1JUSA 2VKEA 3HGGA 2K40A 3HOZJ 1IUFA 5JLWA 5HODA 3Q0WA 2TRTA 2HYJA 4FCYA 3A01A 2L7ZA 5IYBJ 2DMQA 2R5YB 3RZOJ 4IEJA 3NAUA 5F0FA 4D5FA 3S1MJ 3LSRA 1Z0XA 2MSYA 4B1RA 3CQZJ 2O9LA 5BNGA 3HKZN 5F04A 4RBOA 3BR5A 2JMWA 3B6CA 3JREA 2LR8A 2E2JJ 4UUSB 2R7ZJ 1F43A 3SFIA 1HOMA 3JRGA 2O8KA 1RPWA 3S16J 1ETYA 3ZQLA 1H89C 1YRNA 3GTMJ 1IGNA 3ZQCA 1WCMJ 2L0KA 3PO2J 1MH3A 3IH4A 3K7AJ 3S14J 1GDTA 1APLC 2KT0A 3BT9A 3Q0VA 5EDNA 2HOAA 4BKXA 5F0CA 2D5VA 4BBRJ 2NVXJ 1JGGA 2X6OA 4DZJA 1B72B 1HDPA 3SJMA 1IG7A 5IYDJ 1RESA 3DEWA 1CQTA 4XRSA 3BTIA 1VF9A 2ME6A 1NK3P 4CYCA 3CMYA 2IAIA 2GM4A 3HOVJ 1SFOJ 3BR0A 1MBHA 3O8HA 2Y31A 1U9OA 2EH3A 2M2EA 3BTJA 4A3GJ 3FK7A 2E2HJ 5EYRA 4XRMA 4M3DA 3OSFA 5C4JJ 5FLMJ 1JKOC 1Y1WJ 3BR6A 4X1EA 1LFBA 4M3BA 1BJZA 2GLOA 3JR9A 4IHVA 3A01B 3S1RJ 1A6IA 2ECBA 4HNVA 4XIDA 3BR2A 2NS8A 2Y0SN 2K9SA 3I4NJ 2O7OA 4JP0A 2NVTJ 4LOCA 1HF0A 3HOUJ 2Y9YA 1AKHA 2Y9ZA 2Y2ZA 3UKGA 3TP0A 3JRIA 2ME0A 2LVSA 1I6HJ 4B3AA 2JJ7A 3HEFA 2DA2A 4MFDA 2PMZN 4QTRA 2QF7A 3O8GA 4BXXJ 2JK3A 3BTCA 2GBYA 3OIOA 2DMNA 3LSPA 4I76A 1ZTRA 4NDLA 5GP9A 1TWHJ 3TW7A 1ZGWA 3VPRA 3QPLA 2L7FP 3FISA 5FKLA 2E19A 5EEAA 3LNQA 5J1YA 2XB0X 2DA3A 4CYCB 4A3JJ 3HM5A 3Q3SA 3GTJJ 1ENHA 1BL0A 2HOSA 2K9QA 3HOXJ 3TW6A 4A3EJ 2FJ1A 2JA7J 4V2GA 2DN0A 4FISA 1FTZA 2HOTA 5EG0A 5C44J 3C2BA 3GTQJ 2L7MP 5EGOA 2VKVA 2L9RA 2HQ5A 4A3DJ 3HOYJ 1FIPA 3JRHA 4AC0A 1U9NA 2XPUA 3E7LA 4JX4A 3IV5A 4Y7NJ 5IP7J 4DYCA 1MBFA 2R92J 4MIMA 5IOYA 5M5YJ 1FTTA 1JKRC 1JKPC 2H1KA 2LD5A 1HLVA 3GTOJ 4D5CA 2XGDA 1E3OC 4MO7A 2TCTA 5E3MA 5FKKA 3H3VK 4GFBA 3M4OJ 3B6AA 1TC3C 2CJJA 3IH3A 2LKXA 1XG1A 5IP6A 3FIWA 3GTKJ 2E2IJ 2LY9A 3W6VA 3G1LA 1DU6A 3S1QJ 4XK4A 1AKHB 2CUFA 3SDGA 1Z77A 1IRZA 3H0GJ 1VNDA 2MG4A 3M3YJ 2VI6A 4IHWA 5M3MJ 1DU0A 5JLXA 5K7ZA 1X2MA 2I10A 3BG9A 4FE4A 1WH5A 2EZHA 2JWTA 3QQAA 3NARA 3ZQFA 1HDDC 3G1MA 2R0QC 1JKQC 3CCYA 2DTZA 2OF7A 5EZGA 1QVUA 4M3GA 2DMUA 3WHCA 1IJWC 4UUTA 2HXOA 2DMTA 4DW6A 1B8IB 1JT0A 4D7MA 1OFCX 1ETVA 3BR1A 1I3QJ 3ZQHA 3OSGA 1T56A 1VI0A 2LLKA 1ZKGA 3ZQIA 2M9HA 3TEDA 2EZKA 4ABZA 2CRGA 1NTCA 1BW5A 5EGOB 4RDUA 1LE8A 1MNMC 1ZR2A 3HB9A 4A3LJ 2LP0A 3ZQGA 2R5YA 5F0HA 3HOWJ 2XRLA 3GBGA 5IOZA 5DS9A 1F36A 4JX5A 1ETKA 5K7FA 1K61A 1MSEC 3S15J 3WHBA 5IP9J 2JN6A 1JTYA 4X6AJ 3IH2A 2YS9A 3BR3A 4M6VA 2ZB9A 3FKIJ 1T33A 1RKWA 3DCFA 2XB5A 1QPIA 1G2HA 1YRNB 5E3OA 2R5ZA 1AU7A 5FLVA 1S7EA 5J1UA 2HI3A 2DMPA 1MBEA 4C3JJ 3S1NJ 2E1OA 2P81A 4XICA 1JUMA 5K7HA 1HCRA 2VUMJ 1GV2A 1XS9A 4A3BJ 4IHYA 1JJ6C 2OPTA 4I6ZA 3BQYA 1JT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOU A;  4A3K J;  2AO9 A;  2ID3 A;  2MGQ A;  3F0C A;  2X48 A;  1VFC A;  4MFE A;  2WV1 A;  5FJ8 J;  3JRA A;  4J19 A;  1BW6 A;  3GTL J;  1GV5 A;  1W0U A;  2LFB A;  2ELK A;  1MBK A;  1UHS A;  4AUX A;  1W0T A;  1ETW A;  2COB A;  3LSG A;  5C3E J;  3RQI A;  4W1U A;  3HGY A;  3BQZ A;  3JRB A;  2IBD A;  1LFU P;  3Q0U A;  4M3E A;  1IDY A;  4DYR A;  1MBG A;  1ZQ3 P;  4FE7 A;  2DA4 A;  4XRS G;  1MSF C;  5M3F J;  2QCO A;  4C3I J;  3JRF A;  2JA5 J;  2EZL A;  4MLO A;  1OCT C;  2LTP A;  1OCP A;  2WB1 N;  1LE8 B;  2HDD A;  1PUF A;  4A3C J;  4D7N A;  5F1J A;  4BBS J;  2IEK A;  2FQ4 A;  3A03 A;  5FKO A;  2EBI A;  2DJN A;  1ZR4 A;  3LOC A;  1GUU A;  1MBJ A;  2WAQ N;  1SAN A;  1A5J A;  1X58 A;  2DA5 A;  1QRY A;  3BG5 A;  5M5W J;  4C2M J;  5J1R A;  4A3I J;  2XGC A;  4QIW N;  1IDZ A;  1ORK A;  5J3L A;  5M5X J;  2K9N A;  2R5Z B;  1ZK8 A;  5C4X J;  2XPW A;  2R93 J;  2YU9 J;  3MN2 A;  3BTL A;  3D1N I;  5DTD A;  4C3H J;  5GPC A;  4EEF G;  3TP3 A;  2DA7 A;  1P7J A;  1FIA A;  2LK2 A;  2CUE A;  2DA1 A;  9ANT A;  5F08 A;  4A3M J;  1R9T J;  1ITY A;  1XC5 A;  3RZD J;  2CQX A;  3ZOB A;  3RKQ A;  1FEX A;  3MKL A;  3GTG J;  5IPA A;  1POG A;  1UG2 A;  2FX0 A;  1ETO A;  1IC8 A;  3L1P A;  1WI3 A;  5EG0 B;  1JJ8 C;  1OJL A;  2X9D A;  4AYB N;  1TWA J;  2CU7 A;  2M0C A;  1D5Y A;  1RET A;  4B4C A;  2NS7 A;  1Q1V A;  1JTX A;  2NVY J;  4L5E A;  2XSD C;  3BG3 A;  2ID6 A;  2DA6 A;  4W97 A;  1U8B A;  2B63 J;  2ECC A;  3PO3 J;  3I4M J;  1FJL A;  4DZP A;  4A93 J;  2YUS A;  1Y1V J;  1WPK A;  1WGX A;  1K83 J;  1I50 J;  4JX6 A;  1TWC J;  2MW8 A;  3CDL A;  1PUF B;  2M34 A;  4UUS A;  1ETX A;  1GVD A;  2HXI A;  3G1O A;  5FKN A;  3JRD A;  4Y52 J;  2EQR A;  1X2N A;  4BY1 J;  1EF4 A;  3PM1 A;  1GT0 C;  1BA5 A;  2VPR A;  1MH4 A;  1P7I A;  4S0H B;  3GTP J;  3FK6 A;  1JUP A;  4JYK A;  5F27 A;  4V2F A;  2KDZ A;  2AHQ A;  1QVT A;  2CQQ A;  2EZI A;  4G12 A;  5GPA A;  1B72 A;  2XGE A;  3S2D J;  3LSJ A;  5EF6 A;  2N8G A;  2RAE A;  4M3F A;  4FTH A;  1O4X A;  1H88 C;  5IYC J;  3HBL A;  2Y30 A;  5E3L A;  2NVQ J;  1ETQ A;  2JA6 J;  2XPV A;  1TWF J;  1TWG J;  1NK2 P;  5E3N A;  3S17 J;  4QSH A;  2G0E A;  3K2A A;  1RKT A;  5FKM A;  1RR7 A;  3MVP A;  2JA8 J;  1H8A C;  3QPS A;  3S2H J;  4IHX A;  3A02 A;  2FD5 A;  1U78 A;  1B8I A;  4DYQ A;  2H8R A;  2W48 A;  2NOG A;  1IV6 A;  4BY7 J;  1UMQ A;  3JRC A;  1WH7 A;  2M8G X;  5EZH A;  4A3F J;  3HDD A;  4A69 C;  1AHD P;  1JUS A;  2VKE A;  3HGG A;  2K40 A;  3HOZ J;  1IUF A;  5JLW A;  5HOD A;  3Q0W A;  2TRT A;  2HYJ A;  4FCY A;  3A01 A;  2L7Z A;  5IYB J;  2DMQ A;  2R5Y B;  3RZO J;  4IEJ A;  3NAU A;  5F0F A;  4D5F A;  3S1M J;  3LSR A;  1Z0X A;  2MSY A;  4B1R A;  3CQZ J;  2O9L A;  5BNG A;  3HKZ N;  5F04 A;  4RBO A;  3BR5 A;  2JMW A;  3B6C A;  3JRE A;  2LR8 A;  2E2J J;  4UUS B;  2R7Z J;  1F43 A;  3SFI A;  1HOM A;  3JRG A;  2O8K A;  1RPW A;  3S16 J;  1ETY A;  3ZQL A;  1H89 C;  1YRN A;  3GTM J;  1IGN A;  3ZQC A;  1WCM J;  2L0K A;  3PO2 J;  1MH3 A;  3IH4 A;  3K7A J;  3S14 J;  1GDT A;  1APL C;  2KT0 A;  3BT9 A;  3Q0V A;  5EDN A;  2HOA A;  4BKX A;  5F0C A;  2D5V A;  4BBR J;  2NVX J;  1JGG A;  2X6O A;  4DZJ A;  1B72 B;  1HDP A;  3SJM A;  1IG7 A;  5IYD J;  1RES A;  3DEW A;  1CQT A;  4XRS A;  3BTI A;  1VF9 A;  2ME6 A;  1NK3 P;  4CYC A;  3CMY A;  2IAI A;  2GM4 A;  3HOV J;  1SFO J;  3BR0 A;  1MBH A;  3O8H A;  2Y31 A;  1U9O A;  2EH3 A;  2M2E A;  3BTJ A;  4A3G J;  3FK7 A;  2E2H J;  5EYR A;  4XRM A;  4M3D A;  3OSF A;  5C4J J;  5FLM J;  1JKO C;  1Y1W J;  3BR6 A;  4X1E A;  1LFB A;  4M3B A;  1BJZ A;  2GLO A;  3JR9 A;  4IHV A;  3A01 B;  3S1R J;  1A6I A;  2ECB A;  4HNV A;  4XID A;  3BR2 A;  2NS8 A;  2Y0S N;  2K9S A;  3I4N J;  2O7O A;  4JP0 A;  2NVT J;  4LOC A;  1HF0 A;  3HOU J;  2Y9Y A;  1AKH A;  2Y9Z A;  2Y2Z A;  3UKG A;  3TP0 A;  3JRI A;  2ME0 A;  2LVS A;  1I6H J;  4B3A A;  2JJ7 A;  3HEF A;  2DA2 A;  4MFD A;  2PMZ N;  4QTR A;  2QF7 A;  3O8G A;  4BXX J;  2JK3 A;  3BTC A;  2GBY A;  3OIO A;  2DMN A;  3LSP A;  4I76 A;  1ZTR A;  4NDL A;  5GP9 A;  1TWH J;  3TW7 A;  1ZGW A;  3VPR A;  3QPL A;  2L7F P;  3FIS A;  5FKL A;  2E19 A;  5EEA A;  3LNQ A;  5J1Y A;  2XB0 X;  2DA3 A;  4CYC B;  4A3J J;  3HM5 A;  3Q3S A;  3GTJ J;  1ENH A;  1BL0 A;  2HOS A;  2K9Q A;  3HOX J;  3TW6 A;  4A3E J;  2FJ1 A;  2JA7 J;  4V2G A;  2DN0 A;  4FIS A;  1FTZ A;  2HOT A;  5EG0 A;  5C44 J;  3C2B A;  3GTQ J;  2L7M P;  5EGO A;  2VKV A;  2L9R A;  2HQ5 A;  4A3D J;  3HOY J;  1FIP A;  3JRH A;  4AC0 A;  1U9N A;  2XPU A;  3E7L A;  4JX4 A;  3IV5 A;  4Y7N J;  5IP7 J;  4DYC A;  1MBF A;  2R92 J;  4MIM A;  5IOY A;  5M5Y J;  1FTT A;  1JKR C;  1JKP C;  2H1K A;  2LD5 A;  1HLV A;  3GTO J;  4D5C A;  2XGD A;  1E3O C;  4MO7 A;  2TCT A;  5E3M A;  5FKK A;  3H3V K;  4GFB A;  3M4O J;  3B6A A;  1TC3 C;  2CJJ A;  3IH3 A;  2LKX A;  1XG1 A;  5IP6 A;  3FIW A;  3GTK J;  2E2I J;  2LY9 A;  3W6V A;  3G1L A;  1DU6 A;  3S1Q J;  4XK4 A;  1AKH B;  2CUF A;  3SDG A;  1Z77 A;  1IRZ A;  3H0G J;  1VND A;  2MG4 A;  3M3Y J;  2VI6 A;  4IHW A;  5M3M J;  1DU0 A;  5JLX A;  5K7Z A;  1X2M A;  2I10 A;  3BG9 A;  4FE4 A;  1WH5 A;  2EZH A;  2JWT A;  3QQA A;  3NAR A;  3ZQF A;  1HDD C;  3G1M A;  2R0Q C;  1JKQ C;  3CCY A;  2DTZ A;  2OF7 A;  5EZG A;  1QVU A;  4M3G A;  2DMU A;  3WHC A;  1IJW C;  4UUT A;  2HXO A;  2DMT A;  4DW6 A;  1B8I B;  1JT0 A;  4D7M A;  1OFC X;  1ETV A;  3BR1 A;  1I3Q J;  3ZQH A;  3OSG A;  1T56 A;  1VI0 A;  2LLK A;  1ZKG A;  3ZQI A;  2M9H A;  3TED A;  2EZK A;  4ABZ A;  2CRG A;  1NTC A;  1BW5 A;  5EGO B;  4RDU A;  1LE8 A;  1MNM C;  1ZR2 A;  3HB9 A;  4A3L J;  2LP0 A;  3ZQG A;  2R5Y A;  5F0H A;  3HOW J;  2XRL A;  3GBG A;  5IOZ A;  5DS9 A;  1F36 A;  4JX5 A;  1ETK A;  5K7F A;  1K61 A;  1MSE C;  3S15 J;  3WHB A;  5IP9 J;  2JN6 A;  1JTY A;  4X6A J;  3IH2 A;  2YS9 A;  3BR3 A;  4M6V A;  2ZB9 A;  3FKI J;  1T33 A;  1RKW A;  3DCF A;  2XB5 A;  1QPI A;  1G2H A;  1YRN B;  5E3O A;  2R5Z A;  1AU7 A;  5FLV A;  1S7E A;  5J1U A;  2HI3 A;  2DMP A;  1MBE A;  4C3J J;  3S1N J;  2E1O A;  2P81 A;  4XIC A;  1JUM A;  5K7H A;  1HCR A;  2VUM J;  1GV2 A;  1XS9 A;  4A3B J;  4IHY A;  1JJ6 C;  2OPT A;  4I6Z A;  3BQY A;  1JT6 A; 
#chains in the Genus database with same CATH topology
 5E1W A;  4A3K J;  1YOV B;  5FRO A;  1ERD A;  2ID3 A;  2HWV A;  3K4L A;  4M6X A;  4RB0 A;  4E7K A;  2WV1 A;  3DBH B;  2D1V A;  3JRA A;  2XF5 A;  4J19 A;  2E36 A;  5AIQ A;  2D45 A;  4RGR A;  5HS7 A;  4UNO A;  3HTU A;  2DBB A;  1MBK A;  3AG1 H;  1UHS A;  4AUX A;  1TQI A;  1W0T A;  2DOF A;  5CVR A;  1ETW A;  3LSG A;  1QQI A;  3K70 D;  4W1U A;  3BQZ A;  2HTS A;  2WAQ A;  5DM7 F;  5L3B A;  3Q0U A;  1PUE E;  1WQ2 A;  4IF4 A;  3F8F A;  4ENJ A;  1IDY A;  1J0R A;  3R4K A;  5CVJ A;  2Z2S B;  1D8J A;  1JHH A;  1ZQ3 P;  2HFH A;  4D0P A;  1R36 A;  1AA7 A;  1R1T A;  3VDX A;  1HSJ A;  2GIZ A;  3JRF A;  1O57 A;  3ZMD A;  2JA5 J;  2EZL A;  1S7A A;  1OCT C;  1EKE A;  3J7Y J;  2P7C B;  1LE8 B;  5B1A H;  2HDD A;  3UNG C;  4IPA A;  1VZ0 A;  4A3C J;  5F1J A;  5TGT A;  4BBS J;  2K9L A;  4UHT A;  1V54 H;  2H6B A;  4BAY A;  4PSW A;  5FFZ A;  2HQN A;  4EGZ A;  3MMY B;  2I5U A;  1RUO A;  1A5J A;  4A6D A;  4CA0 A;  4LG0 A;  1X58 A;  2DA5 A;  5M5W J;  5BQT A;  3ERE D;  4ZTJ A;  4IOA F;  4EJV A;  5J1R A;  4B3X A;  4BXF A;  2Z33 A;  4QIW N;  3O6B B;  3H9J A;  1ZAO A;  5M5X J;  4XSZ F;  5C4X J;  1VTN C;  2VQG A;  2E1M C;  2P8T A;  4WK8 F;  5GTH C;  4H4K C;  2YPR A;  4XM3 A;  3R61 A;  5ILU A;  3O3K A;  1V55 H;  5DTD A;  2A5W A;  4WCG A;  4L9V A;  3CC4 I;  3MZ8 A;  1CF7 B;  2H6C A;  3I54 A;  3OOP A;  1WVR A;  3BDD A;  2E1M B;  1ITY A;  3HOT A;  1UST A;  2CQN A;  2CQX A;  3BOQ A;  3RPU D;  3WG7 H;  5IPA A;  4U88 A;  1POG A;  4WF2 A;  1QZE A;  5DUK A;  2R4G A;  1ETO A;  1P4A A;  5LRR A;  1IC8 A;  3TOA A;  2Q2E A;  1WI3 A;  1FOY A;  4UB6 C;  1O7L A;  3WU1 B;  4HF0 A;  1PP8 F;  4XON A;  2CU7 A;  2G9W A;  5FLX Z;  3HC7 A;  1MJ9 A;  4HX4 A;  2KIM A;  1KU2 A;  1X1P A;  2NVY J;  3GFM A;  4K2E A;  2A3S A;  2ID6 A;  3BPX A;  4M6Y A;  2ECC A;  3DBL B;  4G7Z F;  3DKX A;  3PO3 J;  4TV7 A;  4DZP A;  1DGR M;  2JSP A;  4NBQ A;  2Z5U A;  1MIJ A;  3WTZ A;  2ZJP F;  3KIO A;  1YYV A;  1WGX A;  5HLH A;  3H9Q A;  1T8I A;  1ZG1 A;  4JX6 A;  1PVE A;  2MW8 A;  3FZV A;  2PBI A;  3DU5 A;  1D0X A;  1GVD A;  2EK5 A;  5FKN A;  2STW A;  3QPH A;  2LG4 A;  3VOD A;  4F93 B;  1K4S A;  3L09 A;  1GT0 C;  1MH4 A;  1P7I A;  4ESF A;  1JUP A;  4QWQ A;  5JR3 A;  5J4V A;  1WJD A;  4KIG A;  1QVT A;  2CQQ A;  3EUH A;  5CVV A;  5GPA A;  3PQK A;  3S2D J;  5E1X A;  2N8G A;  4XOT A;  5TRD A;  2RN7 A;  3DPL C;  1ON2 A;  3KX2 A;  5E3L A;  2JA6 J;  2ADU A;  2XPV A;  2JQ7 A;  2VON A;  2LBF B;  2HPM A;  4HV6 A;  2K85 A;  4GDF A;  3S17 J;  2PJR A;  3BZK A;  4BNC A;  3BG7 A;  1RKT A;  2EWN A;  2CMP A;  3OYN A;  3I4P A;  3A02 A;  4IZZ A;  1B8I A;  2H8R A;  4DYQ A;  3BZC A;  2NOG A;  1JGS A;  1XDS A;  2NS0 A;  3C3W A;  4BY7 J;  1MMN A;  1UMQ A;  1WH7 A;  5EZH A;  4A3F J;  4P9F A;  1WKM A;  3F72 A;  1FZP B;  2K40 A;  2KRC A;  2VQL A;  4EM2 A;  3QP5 A;  1IUF A;  1K78 A;  3H5N A;  1E0E A;  4KMF A;  1ZRE A;  1RNL A;  2TRT A;  2CWE A;  1W7P D;  3EQL F;  5IYB J;  3P7N A;  2ICW G;  5F0F A;  3HYI A;  1S9H A;  1G8X A;  2ZME C;  1Z0X A;  4FT8 A;  2L2O A;  3SZT A;  2MSY A;  1TZL A;  5ICC A;  1XGN A;  2DDA A;  1VQ5 I;  1LNW A;  2BGC A;  3C7J A;  5HOO A;  2LR8 A;  5DEQ A;  4UUS B;  1T95 A;  5HDN A;  2LRE A;  2R7Z J;  2P0W A;  3JRG A;  4XNF A;  2ZME B;  4XKW A;  4MTD A;  3ZQL A;  1H89 C;  1YRN A;  1IGN A;  1BC7 C;  1XMK A;  3R0A A;  3PO2 J;  4LIU A;  3GLL A;  3DTK A;  3G3Z A;  4FAS D;  3H3Z A;  1GDT A;  1APL C;  2KT0 A;  3JAM Z;  3BT9 A;  3FF5 A;  4XKB A;  4EGY A;  4BBR J;  2NVX J;  1R71 A;  5CQG A;  4DZJ A;  1H0M A;  4IVN A;  1B72 B;  3RSN A;  3K9T A;  1RES A;  1P4W A;  4XLH A;  1UEL B;  4XRS A;  4OAZ A;  1VF9 A;  2F4O B;  1AOY A;  3LFU A;  4CCM A;  2IT0 A;  1TP4 A;  2FEZ A;  3H3U A;  1SD5 A;  2KMU A;  2A6T A;  1S3J A;  3ZP5 A;  1LB2 A;  2B0L A;  2DJI A;  1G59 A;  3G73 A;  1O3T A;  2Y31 A;  5F1R A;  1IAW A;  1U9O A;  4L9T A;  3M8E A;  3WTU C;  2K4J A;  2EJR A;  3RCO A;  3FK7 A;  1BIA A;  3E3V A;  4OU0 A;  1WFX A;  3EYY A;  5C4J J;  2GOX B;  2KIU A;  1QHH D;  2Z3Y A;  4NQW A;  3CF2 A;  1A35 A;  2HTJ A;  3EET A;  5L3F A;  1Y56 A;  1MJA A;  3OR2 C;  3IUO A;  2PMZ A;  4GYI A;  3CP8 A;  2GLO A;  4DIQ A;  2UWM A;  2L7K A;  2NNY A;  1YI2 I;  1FBU A;  4YIR X;  3DLA A;  3TO9 A;  3IKV A;  1UG0 A;  4XSX F;  2VBW A;  3KPH A;  4MNU A;  3IAM 2;  2Y0S N;  2QZ8 A;  2QEX I;  1XD7 A;  1EV7 A;  3HUG B;  2Y9Y A;  3PFI A;  1F5T A;  1AKH A;  3MZH A;  4NB5 A;  1LFP A;  1UHM A;  4AM3 A;  4RB3 C;  1IRX A;  1D1B A;  1D8K A;  2ZXW H;  2FNA A;  1VQ4 I;  2DA2 A;  2VOP A;  1T0F C;  2ZO4 A;  3I5U A;  4QTR A;  2CW0 F;  2YR2 A;  3BTC A;  4P1W A;  3LMM A;  1PYV A;  3OIO A;  2DMN A;  1U2W A;  1I5Z A;  1LPQ A;  2DFF A;  4RAG A;  3RYR A;  3VOE A;  3TW7 A;  4IKF A;  2OC6 A;  1MZB A;  2VE8 A;  4LMY A;  1BI2 A;  1FMV A;  3QPL A;  3KP6 A;  4CZZ A;  2AS5 F;  3FIS A;  5FKL A;  2COM A;  2RQQ A;  3TDZ C;  3DTE A;  1XMA A;  1HW1 A;  1S5L C;  4CYC B;  1Z6R A;  4A3J J;  3HM5 A;  4AD9 A;  3S3N A;  1ENH A;  2G7U A;  2V26 A;  2BE5 F;  1WHU A;  2PG4 A;  3DV8 A;  3TW6 A;  4V2G A;  2DN0 A;  2VQC A;  1BBY A;  5EGO A;  2L9R A;  2V9V A;  3HOY J;  2VQH A;  3L2C A;  2DT6 A;  1XGM A;  4HW0 A;  1VQ9 I;  2XPU A;  4F3Q A;  3PJR A;  2AQF A;  4Y7N J;  5IP7 J;  1DP3 A;  4MIM A;  1OCO H;  5M5Y J;  2R7O A;  1JKR C;  4HX8 A;  3RPU A;  2H1K A;  2LD5 A;  3FM3 A;  4A2U A;  1E3O C;  5GAD J;  4A5M A;  2TCT A;  3AG2 H;  2F4M B;  1TC3 C;  3BJA A;  3TMO A;  3IH3 A;  1RR8 C;  2W57 A;  4RGS A;  1SMT A;  3OMY A;  4QPQ A;  2BOL A;  3ZGK A;  3REO A;  3GW2 A;  3RDI A;  3H0G J;  4HBL A;  1IRZ A;  4ZZD A;  4E4H A;  2VI6 A;  5F64 A;  3BCB A;  3PIO F;  3L00 A;  3NWS A;  5JLX A;  3U1D A;  3KE2 A;  1U8R A;  1X2M A;  2VC1 A;  3BG9 A;  3H35 A;  4Q48 A;  1WH5 A;  2DFI A;  2JWT A;  3QQA A;  2WV0 A;  1Z91 A;  2F5C A;  4RAF A;  3ZQF A;  1UCR A;  2Z16 A;  2FF4 A;  5CVU A;  4XL9 A;  5EZG A;  4G6Q A;  4AVP A;  4X0G A;  3F8B A;  2O03 A;  2CW8 A;  1MDM A;  2CFO A;  1F1Z A;  4DW6 A;  1VQP I;  2K3P A;  2RC4 A;  4D7M A;  1YJN I;  3M9A A;  4GGG A;  4XLE A;  4MEX F;  2V6C A;  3MEX A;  1SVL A;  4RA2 A;  3KZI C;  1S8N A;  2V6E A;  3ZQI A;  3TED A;  4WX9 A;  2YX7 A;  3FMS A;  2PI0 A;  2A61 A;  2F5E A;  3ML6 A;  4ABZ A;  4BHP A;  2DI3 A;  3DF8 A;  4XLN F;  1BJA A;  3OL3 A;  3MKY B;  1ZR2 A;  3OS0 A;  2CQK A;  1T6S A;  5HVQ C;  2BY0 A;  5A2Q K;  2V1X A;  2LF8 A;  2WBM A;  5IOZ A;  5DS9 A;  1F36 A;  4MHG A;  3KYL A;  2EIL H;  1K61 A;  1QHG A;  1FOK A;  4XKV A;  2KZG A;  1YG2 A;  2JN6 A;  2R7R A;  1RKW A;  2OV7 A;  3AG4 H;  1U5T C;  1Z7U A;  3W6K B;  1Y0U A;  3V8J A;  2R5Z A;  2Y0M A;  4N9I A;  5ICF A;  4OMZ A;  1ZG5 A;  2IGK A;  3S1N J;  2PQ8 A;  2HZT A;  1U5T B;  1DDN A;  1R5I D;  4IHY A;  3PQJ A;  4I6Z A;  2BV6 A;  1JT6 A;  4G6D A;  2WAD A;  3OOU A;  2AO9 A;  2CO5 A;  3CUQ A;  3FBN B;  2MGQ A;  2WTE A;  3F0C A;  1VFC A;  4KFC A;  3CC7 I;  1R4N B;  2ZC2 A;  4OIQ F;  2H1L A;  3CUO A;  1IW7 F;  5FJ8 J;  2W85 A;  4UVC A;  1LQ1 A;  1E2X A;  3GTL J;  1GV5 A;  2LFB A;  2ELK A;  5KAI C;  2EPF A;  3RYP A;  2COB A;  3D5R C;  1V3F A;  2R7Q A;  3HGY A;  3K1N A;  1AWC A;  2GXB A;  3QOD A;  1LFU P;  1B9N A;  4XOP A;  3T8T A;  2BY2 A;  3NRV A;  4XOR A;  2ESN A;  4FE7 A;  2BHZ A;  2DA4 A;  5JHU A;  1XSV A;  2QCO A;  1N75 A;  4OIP F;  4C3I J;  3OYK A;  2BVL A;  3WG9 A;  2VE9 A;  2V1U A;  3O2P E;  1MW7 A;  2O61 A;  3L2W A;  3K6G A;  2IEK A;  1R5G A;  2EBI A;  2HR3 A;  5D4S A;  4DJA A;  4E7J A;  2X6W A;  3LOC A;  2LY1 A;  2KRF A;  3LL7 A;  1GUU A;  1MBJ A;  1T2K A;  1CGP A;  3J81 K;  1O3S A;  5JVG F;  4C2M J;  3VEP A;  1LKX A;  4A3I J;  2PEX A;  2XGC A;  3BZ6 A;  1ORK A;  5IT9 Z;  3Q9V A;  2EFN A;  3F9K A;  3A0H C;  3M07 A;  2K9N A;  4P9U A;  4A12 A;  3JW4 A;  2XPW A;  1OR7 A;  1SD6 A;  3ECO A;  2YU9 J;  4RM2 A;  3MN2 A;  4XN0 A;  3R6S A;  4DNC A;  2X6Y A;  2RV8 A;  3I53 A;  2JRM A;  3CCR I;  4GO1 A;  4BQQ A;  5FFX A;  2LSO A;  2DA7 A;  2KPM A;  3WTW C;  2G7H A;  4PJN A;  3CLQ A;  5E18 F;  4FQG A;  1EH8 A;  5F08 A;  1XC5 A;  3RZD J;  3AL0 C;  1D5V A;  4KN4 X;  4A0Z A;  3F8N A;  3OYF A;  3GTG J;  2BYV E;  4M74 A;  1YIJ I;  2FX0 A;  3QYE A;  2QA4 I;  4EJW A;  2CV2 A;  2JRT A;  2NRA C;  3OS2 A;  2Y69 H;  4BS9 A;  1LEB A;  3PUB A;  4E6K G;  1JJ8 C;  3OS1 A;  2X9D A;  4IXA A;  3GFL A;  3EPZ A;  1WRJ A;  3LA7 A;  4UVB A;  1Y8Q B;  1QNT A;  3AL0 B;  2H94 A;  1MD0 A;  5CVI A;  5BPI A;  1D5Y A;  1RET A;  3DEE A;  3E6M A;  3FXK A;  4YRV A;  1Q1V A;  2IA1 A;  3IL2 A;  4L5E A;  4G8X A;  2XSD C;  4Q5S F;  3BG3 A;  1D1C A;  2DA6 A;  2DU9 A;  3CO7 C;  1U8B A;  4KIB A;  2M7A A;  1FYM A;  3MFK A;  1GLN A;  1FJL A;  1YFH A;  4IQ4 A;  2YUS A;  4QLC U;  2FOW A;  1TNT A;  2VT3 A;  4UUV A;  3ZCO A;  2OD5 A;  1I50 J;  1K79 A;  1TWC J;  4BDY A;  3CDL A;  5LD2 C;  3E97 A;  2M34 A;  2OTJ I;  1ETX A;  1FPQ A;  3JRD A;  3KP7 A;  2GA1 A;  4ZDP A;  1O3R A;  4AU7 A;  1X19 A;  2J5O A;  1YTY A;  4BY1 J;  1EF4 A;  4M9S A;  2FXA A;  3FM5 A;  3M7G A;  1R58 A;  1BA5 A;  1RC9 A;  4RMN A;  3KEO A;  3CCJ I;  2IRF G;  4B43 A;  1R1V A;  3IRR A;  1MND A;  3MZY A;  1FC3 A;  3UR3 C;  2WAF A;  3GCM A;  2V9K A;  4G12 A;  4PJM A;  2MA3 A;  5EF6 A;  4NC7 A;  1H88 C;  4M3F A;  1K4T A;  2WY8 Q;  5IYC J;  4Z2Y A;  5B66 C;  2WAE A;  2DTR A;  2QSG X;  1YX3 A;  3A2K A;  2XAS A;  1TWF J;  1TWG J;  2L54 A;  3GFI A;  2ISY A;  1NK2 P;  4DOZ A;  1LVK A;  2MAB A;  1R00 A;  1R1U A;  2OJE D;  2M4K A;  3ABT A;  5ICE A;  2R7F A;  3F23 A;  2IS6 A;  2V7F A;  2ETH A;  1RR7 A;  3MVP A;  3OWT A;  1KZH A;  4NC8 A;  1SFU A;  2VPL A;  4IHX A;  1U78 A;  1TQM A;  4ZYH A;  2W48 A;  3H1C A;  4LD5 A;  3HHG A;  4QPO A;  3OYM A;  3HDD A;  3P9I A;  1JUS A;  4YEJ A;  2VKE A;  3ECH A;  1IRF A;  4BHC A;  2XKP A;  4PFO A;  4BAC A;  3FHN A;  3GO5 A;  1X3U A;  4M71 A;  1J5Y A;  3Q0W A;  2OZU A;  3A01 A;  2L7Z A;  4F52 A;  5HLI A;  2R5Y B;  1KYZ A;  3BWG A;  2VAS A;  3S1M J;  2CV1 A;  2Q1Z B;  1NHA A;  3LSR A;  1N77 A;  1T39 A;  1DP7 P;  2E5Z A;  1XPX A;  2OUM A;  2V1N A;  2F4I A;  5B1B H;  2HS5 A;  5F04 A;  4L18 B;  1ZHF A;  3IRQ A;  3WOD F;  3WTT C;  3E6B A;  1F43 A;  4KYW A;  3PNY A;  1IXC A;  1YLF A;  1EA3 A;  4CO8 A;  3OYH A;  4ENM A;  3DLL F;  1NG6 A;  3KCC A;  3S14 J;  5E1Z B;  1X4P A;  3Q0V A;  1EJ9 A;  2OU2 A;  3CZ6 A;  2HOA A;  3VFZ A;  1JGG A;  4ETS A;  3IHU A;  2HKX A;  1KU9 A;  2P7V B;  5IYD J;  2X85 A;  1IN7 A;  2DFE A;  2ZFU A;  2LOO A;  3BTI A;  4R8H A;  2HVR A;  2ME6 A;  3L7W A;  3I59 B;  1NK3 P;  2IAI A;  3J80 K;  2LMD A;  3S2W A;  2UXN A;  5DM6 F;  1XCB A;  1BOB A;  1SFO J;  3E1S A;  3W2V A;  4CZC A;  2VBY A;  3QYF A;  1Y8R B;  4PJL A;  4OIR F;  1T98 A;  2PX9 A;  2FRH A;  4RB2 C;  2IJL A;  1JXS A;  4EMS A;  2M2E A;  5LLQ A;  3BTJ A;  1UZC A;  4ZDO A;  1W4M A;  2XAH A;  3IWZ A;  4A3G J;  3ZMT A;  2OAZ A;  4KNY A;  2E2H J;  4IOC F;  4BUP A;  1MNE A;  1SC7 A;  2QVO A;  4M3D A;  3OSF A;  2QKM B;  3BJO A;  2ZJR F;  3M1C A;  1Y0N A;  1SFX A;  5FLM J;  2BBY A;  3BR6 A;  4HQM A;  4M72 A;  2CFX A;  1LJ9 A;  3ELK A;  5B3S H;  4FX4 A;  3I9V 2;  3J7A O;  1VQM I;  4OWR B;  1K78 B;  1BJZ A;  4N4O B;  4EV0 A;  2PN6 A;  2HKO A;  1G3T A;  4EM0 B;  3JR9 A;  4Z6Y A;  2O8X A;  3S1R J;  1A6I A;  2IA0 A;  2QUF A;  4M9X A;  2ECB A;  5J47 A;  2HDW A;  5BS6 A;  1SMY F;  2A5Y B;  3PL8 A;  1P2F A;  3ULQ B;  2HYF A;  2O0Y A;  3H5R A;  4I0A A;  4BJ6 C;  5FRM A;  4ZYG A;  2O7O A;  3I4N J;  2V9P A;  2ZCW A;  4LOC A;  2XDV A;  2OCC H;  2LYC A;  3EYI A;  4XMY A;  2Y2Z A;  2JPB A;  1IF1 A;  3JRI A;  2KIQ A;  2ME0 A;  4O5V A;  4GRI A;  3KFW X;  3N97 A;  1I6H J;  3ZR8 X;  4B3A A;  4EVI A;  3RKW A;  4MFD A;  5K5Q A;  2L9N A;  3GWZ A;  4BQA A;  2JK3 A;  3FHZ A;  1YJW I;  4B09 A;  1ZTR A;  2VT2 A;  1GXP A;  2GOM A;  2M3A A;  1ULY A;  3A0B C;  3ZMV A;  1CF7 A;  1ZGW A;  3D5L A;  3VPR A;  2ZNZ A;  2LRD A;  5FGM A;  1YS7 A;  2L7F P;  2NAZ A;  3E5U A;  1UFM A;  5LFA A;  5EEA A;  2Z1D A;  5J1Y A;  3U21 A;  2DXI A;  1DPR A;  2CGP A;  4YFN F;  2A07 F;  4IHS A;  2ESH A;  4KJZ A;  1SVO A;  2KIS A;  3GTJ J;  3BLY A;  1BI0 A;  2X51 A;  4S05 A;  2Z9O A;  2K9Q A;  2ZFW A;  3MD2 A;  2FJ1 A;  2IXS A;  2HOT A;  5L3G A;  5C44 J;  3C2B A;  2L7M P;  1UAA A;  1HXD A;  2OTL I;  1R7J A;  3D5S C;  4E7I A;  3V7R A;  3CCE I;  2HZD A;  5L3D A;  3U1K A;  4A3D J;  4L5J A;  2HPI A;  2W84 A;  4CIC A;  3BRO A;  4I0B A;  4ZC3 A;  4YFX F;  1U9N A;  5CPR B;  4JX4 A;  5J6X A;  2KJC A;  3IV5 A;  4E7H A;  4NQW B;  1J75 A;  2R92 J;  5IOY A;  1FTT A;  4HG2 A;  1ZH5 A;  1JKP C;  1SFK A;  1XGS A;  2R7X A;  5AON A;  3ROU A;  2EFP A;  3GTO J;  1D0Y A;  2XGD A;  1YX5 A;  2GXA A;  4MO7 A;  5E3M A;  2DQL A;  5FKK A;  4BHB A;  4GFB A;  3M4O J;  3B6A A;  1U0J A;  1J59 A;  2CS3 A;  2CJJ A;  2LKX A;  5IP6 A;  4N9H A;  2YX4 A;  2E2I J;  2JVG A;  3FXQ A;  2GAU A;  1Y39 A;  1GHC A;  3W6V A;  1Z3Y A;  4AIH A;  4EJT A;  4XK4 A;  1AKH B;  4HA8 A;  4L0Y B;  2ZNY A;  2CUF A;  1FP1 D;  1R5H A;  4HNU A;  1WJB A;  3KLN A;  4HF1 A;  1MMG A;  1FBQ A;  3MKZ A;  2XAQ A;  1DU0 A;  1XGO A;  1DQU A;  4HPQ A;  1RUN A;  1TW3 A;  2MLK A;  4F91 B;  1SAX A;  2M0M A;  4ITV A;  4FE4 A;  3G6E I;  1VQ8 I;  2EZH A;  3AFH A;  3HPG A;  3X2Q H;  2JA2 A;  2LDU A;  3SXY A;  1G3S A;  2K7L A;  2LBF A;  3OYD A;  4CCJ A;  1HDD C;  3ESW B;  2OF7 A;  2CH0 A;  3RQ4 A;  4M3G A;  4ZZL A;  1NG7 A;  4BEH A;  3WHC A;  5LHH A;  3WTX C;  2FMY A;  5TJJ A;  1JT0 A;  2XHK A;  3QOE A;  3V8L A;  1ETV A;  1OFC X;  3BR1 A;  4NC6 A;  4IRI A;  2HVS A;  4U7D A;  2GWR A;  4KIT B;  2EIJ H;  1T56 A;  1VI0 A;  2K5C A;  3SZG A;  2RDP A;  2UZK A;  2M9H A;  5HDG A;  5H6Q A;  1G4D A;  1QZZ A;  4AIK A;  4B8X A;  2HQR A;  1HW5 A;  3CJT B;  1NTC A;  2HGC A;  3F21 A;  1BW5 A;  2EV0 A;  5EGO B;  4RDU A;  3KP3 A;  2MLG A;  2LP0 A;  1YW7 A;  1KU7 A;  3GZ5 A;  4PSX A;  4CH7 A;  1ON1 A;  2MH9 A;  1MMS A;  3F8C A;  2FQ3 A;  3HOW J;  3TQN A;  4EJO A;  2A05 A;  3ZXS A;  1BI3 A;  5DCM B;  1O3Q A;  1MSE C;  3OYJ A;  3GEZ A;  5K1Y A;  3BR3 A;  3LSH A;  1X3Z B;  2JSC A;  1QGP A;  3SDB A;  4B44 A;  4AIJ A;  2QBY B;  3E5Q A;  5JHF A;  3DKY A;  1G6N A;  3U9G A;  2XB5 A;  5F6F A;  1QPI A;  1G2H A;  3ISP A;  4L9N A;  3I55 I;  1AU7 A;  2R7W A;  1MBE A;  4C3J J;  2GA2 A;  2WWY A;  2P81 A;  1QPM A;  4XIC A;  4U0V A;  2VL8 A;  1TL8 A;  1R23 A;  3V42 A;  1YS6 A;  2IPQ X;  2LF7 A;  3BQY A;  1YIO A;  3MKW B;  2K4B A;  2KQR A;  2R7V A;  2E1C A;  2ZXH A;  2X48 A;  3ZMS A;  1IZ1 A;  2EA2 A;  2DW4 A;  3L2R A;  5TIS C;  3CCV I;  1TBX A;  3RQI A;  2KP6 A;  3WTY C;  1ZYR F;  1MDM B;  2XKO A;  3P9K A;  3DTI A;  4WWC A;  4M3E A;  1FSH A;  1W5S A;  2MYS A;  5J4Y A;  4BJT A;  3KLO A;  1MBG A;  1XSD A;  1FLI A;  2UV1 A;  4BU2 A;  3K2Z A;  3W2W A;  3ASN H;  3OR1 C;  4XRS G;  5D5U B;  1BN5 A;  4KA4 A;  5M3F J;  4C2U A;  1TT0 A;  3PSF A;  5DCF A;  2DOE A;  1E17 A;  4NUB A;  2LTP A;  1BR1 A;  2KLO A;  2WB1 N;  1PUF A;  4I09 A;  4MQ9 F;  3SFZ A;  2O5R A;  1VQ6 I;  4KT5 C;  2VLA A;  1L3L A;  1ACI A;  3FXM A;  1ZLK A;  1TQP A;  2K86 A;  5DD8 A;  4KN7 X;  3T1B A;  3A03 A;  3WU2 C;  2M1B A;  2DJN A;  2GIV A;  4XLA A;  3VSL A;  1YIT I;  4HQE A;  3ZQ7 A;  4G6T B;  3CCS I;  4G7O F;  2R7T A;  1J9I A;  2WAQ N;  1SAN A;  2FBI A;  1QRY A;  1XSX A;  2JTV A;  2BY3 A;  4XBF A;  1STZ A;  1FBS A;  1IDZ A;  2M45 A;  1MKM A;  2VB6 A;  4HAM A;  1BR4 A;  1X1B A;  4AWX B;  1I1G A;  1KON A;  5D6F A;  2R5Z B;  3V7S A;  3PNV A;  3CUQ C;  1RRJ A;  1HC8 A;  4NHJ A;  1SD4 A;  4IQJ A;  3T0Y A;  1ZAR A;  2DAO A;  2DFH A;  4C3H J;  4YII A;  3RTR A;  3TP3 A;  4HDU A;  2F5F A;  1OIS A;  3ZN1 A;  1P7J A;  1FIA A;  2LK2 A;  3PNT A;  4M9Z A;  2H27 A;  2DA1 A;  3CUQ B;  4F55 A;  1TTY A;  5FD5 A;  9ANT A;  2C6Y A;  4A3M J;  2AXT C;  1R9T J;  3ABM H;  3F3X A;  3CJQ B;  2IS4 A;  3ZQQ A;  1HST A;  3IKT A;  3L1P A;  4BGD A;  3KP4 A;  4A5N A;  2KIF A;  5EG0 B;  2RKH A;  1OJL A;  1WI9 A;  1Z05 A;  3FXR A;  4GYG A;  4UV9 A;  1TWA J;  4DBR A;  3IWF A;  5H6R A;  2DT7 B;  4B4C A;  2H8W A;  2NS7 A;  5CYV A;  1JTX A;  5FO5 A;  3BJ6 A;  3KYD B;  4W97 A;  2B63 J;  2RQP A;  2QM3 A;  4HDV A;  4CUG A;  5JI6 A;  2R7U A;  3I4M J;  2HVQ A;  3JCU C;  5LGT A;  4A93 J;  4ZYE A;  2XF7 A;  2ELJ A;  2QQ9 A;  4D9J A;  4XN3 A;  3ASO H;  4L9J A;  4KT6 A;  3G1O A;  4HST A;  4CXF A;  2EQR A;  3CO6 C;  2FUG 2;  1X2N A;  1J09 A;  2A6E F;  3S3M A;  4LFU A;  2VXZ A;  3LWF A;  1W7P A;  1OR7 C;  5EJC A;  4JK1 X;  1WJ5 A;  1FT9 A;  3FK6 A;  4JYK A;  4BE0 A;  3KEY A;  2I8D A;  4PFP A;  4V2F A;  4RM3 A;  2KDZ A;  4O6J A;  1OMI A;  4PGH A;  3LSI A;  1IN6 A;  3VYS B;  4F92 B;  4AVZ A;  2E7X A;  4HX7 A;  3I64 A;  2EZI A;  4XQF A;  2XGE A;  2EIN H;  1R6R A;  3LSJ A;  4DBQ A;  2RAE A;  1O4X A;  3M8F A;  4RLQ A;  2P5V A;  2VJJ A;  4ZH4 F;  2ZSH B;  3HBL A;  5E20 A;  2Y30 A;  2NVQ J;  2VJI A;  1Q1H A;  5E3N A;  2M4G A;  1HKS A;  3K4J A;  2E35 A;  1HKQ A;  4LJZ F;  4JQF A;  4Y3O A;  4E7L A;  2DO7 A;  2NNN A;  2WC2 A;  5FKM A;  4R79 A;  1DUX C;  1A36 A;  4IO9 F;  2BXY A;  1H8A C;  3QPS A;  2OBP A;  2P6T A;  2VKD A;  2FD5 A;  2CV0 A;  1ZGA A;  2MD5 A;  4BJ5 C;  3U2R A;  5JVT A;  5AIP A;  2LY2 A;  2M8G X;  2EFW A;  4A69 C;  4YIF A;  1Z7L A;  3DP7 A;  3ZN0 A;  5ILV A;  2Q0O A;  2QQ8 A;  3LSM A;  5JLW A;  4BDZ A;  4L0Z B;  2VBZ A;  3BPV A;  2F5V A;  2W25 A;  5HOD A;  2KHM A;  1VQO I;  4RLF A;  1ZGJ A;  2QWW A;  3QOP A;  4LG3 A;  4IEJ A;  2B9S A;  2HEO A;  1J2X A;  2CUJ A;  3GZN B;  2KJB A;  1QA6 A;  3BG6 A;  1I39 A;  3W2A A;  4PJ0 C;  4YEL A;  3CQZ J;  3SHF A;  1ZLJ A;  2O9L A;  2VXD A;  2ZJ2 A;  3TO7 A;  3HKZ N;  5D5X B;  5FLX K;  3RIR A;  4RBO A;  2JMW A;  2L3D A;  3B6C A;  3IC7 A;  4Y13 A;  5HLG A;  4IJA A;  2MC4 A;  3PUF A;  5KHD A;  1WJA A;  2M8E A;  3GTM J;  1DPU A;  3VB2 A;  3GF2 A;  2L0K A;  2BY1 A;  4Q47 A;  5LGN A;  2TDX A;  1MH3 A;  3C2H A;  3IH4 A;  3CJR B;  1RZ4 A;  1FNN A;  2W00 A;  2E60 A;  2QSF X;  4BKX A;  1U5T A;  5F0C A;  4LLG F;  2CQ7 A;  1WJF A;  3HZJ A;  5BOX A;  5ILS A;  2IGO A;  3K4K A;  2W82 A;  1IG7 A;  3DEW A;  4LLN A;  1E3P A;  4UY8 I;  2E71 A;  2FBK A;  3A1Y A;  4XLP F;  4LB6 B;  3QU6 A;  2VBX A;  2GM4 A;  1G3Y A;  3HOV J;  3L9F A;  4ENN A;  5K5R A;  3CF5 F;  2RGV A;  3HTS B;  1MBH A;  1VQ7 I;  1KQ8 A;  5EEG A;  3P5J A;  2Y0S A;  1XB4 A;  5HNH A;  2EH3 A;  3OYI A;  2X4H A;  1UB9 A;  1F4K A;  1BOA A;  4CSW A;  5EYR A;  3SZP A;  4XRM A;  1WJE A;  2NOJ B;  4YG2 F;  1FWZ A;  1JKO C;  1Y1W J;  5LEK A;  4ESB A;  4HLY A;  3DXJ F;  4X1E A;  4HNT A;  1LFB A;  1IUY A;  1XN7 A;  3M1E A;  3AAF A;  3JSP A;  4M3B A;  2E5N A;  5BPD A;  3F6O A;  1QO0 D;  2KDO A;  3HSF A;  2XSJ C;  5J40 A;  3A01 B;  4UV8 A;  4DGW B;  4HNV A;  4XID A;  2DYR H;  3RKX A;  3I3L A;  3BR2 A;  3ABU A;  2VOO A;  3I0T A;  2NS8 A;  2JZY A;  2K9S A;  2Y75 A;  3HHH A;  1WZ2 A;  4LG0 B;  4OMY A;  3DEU A;  1OCR H;  2GZW A;  3TL4 X;  3PSI A;  1I27 A;  5KNL A;  3L2V A;  2O6G E;  3TP0 A;  2PMH A;  4UXN A;  3K4B A;  4EAT A;  1D1A A;  3FMR A;  2WA0 A;  3ZMZ A;  2PMZ N;  3FX3 A;  2BEO A;  4BH9 A;  2BW3 A;  2DLL A;  4S04 A;  1E3H A;  2L5Q A;  4NDL A;  4PDK A;  1D3Y A;  1OKR A;  3S93 A;  5GP9 A;  1VQN I;  2ACJ A;  3H92 A;  2CW7 A;  4RGU A;  2MC3 A;  1KU3 A;  2DK5 A;  2NXN B;  4M73 A;  2AQE A;  4MEY F;  1WJC A;  2GXG A;  2WB1 A;  4CCL A;  2MBF A;  5HLT A;  5GAE J;  3JAM K;  4XRF A;  1OPC A;  5A2Q Z;  3M8J A;  2HDC A;  2Q2E B;  1BL0 A;  4V19 K;  2DK8 A;  2HOS A;  4BYY A;  1FTZ A;  2JA7 J;  4FIS A;  1RIO H;  3DPU A;  2STT A;  4GXO A;  2HNH A;  2VKV A;  1JHF A;  2HQ5 A;  4LIV A;  4II2 A;  1B9M A;  1ZG3 A;  3BY6 A;  4MGR A;  4P55 A;  5CLS A;  3D0S A;  1A6Q A;  3K0L A;  1FMW A;  5L3E A;  3E7L A;  1TNS A;  2X1C A;  5FB2 A;  5D5W B;  4DQ2 A;  3OL4 A;  1MBF A;  2FOK A;  5GAG J;  2CSO A;  3TGN A;  5KAF C;  4JOM A;  4D5C A;  2X0L A;  3H3V K;  5E8I A;  3HG9 A;  3HSE A;  3EUH C;  4R1H A;  2IS2 A;  1ZEL A;  5HS9 A;  3E6C C;  1W36 C;  4Y15 A;  3CES A;  2EA4 A;  2L4A A;  3FIW A;  3GTK J;  4U87 A;  4KUM A;  2DCE A;  3FMQ A;  3VYR B;  3C1D A;  3G1L A;  4ZYA A;  1DU6 A;  3S1Q J;  1Y6I A;  2L01 A;  3SDG A;  1Z77 A;  4BE2 A;  1HA8 A;  2XGX A;  1ODD A;  3R0J A;  4RGX A;  1BR2 A;  4IHW A;  5M3M J;  4HYE A;  2F6C A;  4RS8 A;  3CDI A;  5K7Z A;  3T5X A;  1REP C;  3JTG A;  5ERI A;  2DOA A;  5LHI A;  1S29 A;  2VJ4 A;  3QRF F;  3SYT A;  3BC8 A;  5E79 C;  2OZ6 A;  3G1M A;  2PJR B;  3CCY A;  2WY7 Q;  4HV5 A;  4C2T A;  4E7S A;  5DYM A;  2DMU A;  2YU3 A;  1J7K A;  1BM9 A;  2EB7 A;  4PJJ A;  3I56 I;  2H09 A;  1B8I B;  1ZRF A;  2FE3 A;  1IV8 A;  1T08 B;  4IRH A;  2OQR A;  1R4M B;  1K7A A;  1OCC H;  2XAJ A;  3ERM A;  4EJU A;  3VWB A;  2LLK A;  4Y4R A;  1I6X A;  3TBI A;  4CCK A;  2K9M A;  4U0Y A;  4OIO F;  1MJB A;  1OQY A;  1BIB A;  2CRG A;  1ZRD A;  2F5D A;  3EDP A;  4FET A;  3WE3 A;  1EH7 A;  2EV5 A;  4HOB A;  3J81 Z;  1LE8 A;  4N0B A;  1X1C A;  3HB9 A;  4A3L J;  2ELH A;  3DWL E;  3ZQG A;  4BL0 B;  2R5Y A;  4I7H A;  1B6A A;  1HKT A;  1HBX G;  3TDU C;  3GBG A;  1IO2 A;  3HRT A;  4OAY A;  1LVA A;  1ETK A;  1OCZ H;  3KET A;  5LEJ A;  3S15 J;  2R7S A;  4X6A J;  3QP6 A;  3IH2 A;  4M6V A;  2XRN A;  3KEQ A;  1Z21 A;  2JUC A;  3DCF A;  5GAH J;  3A4C A;  5E3O A;  1YRN B;  5FLV A;  4ZDL A;  1S7E A;  3IAS 2;  5J1U A;  5HDK A;  2M5W A;  2DMP A;  2LH9 A;  2RNJ A;  4Q4Z F;  4B47 A;  1OYI A;  4CGZ A;  2CG4 A;  5K5O A;  2DPD A;  1U6G A;  1JUM A;  1FP2 A;  2ZXI A;  1F9N A;  2X6X A;  1HCR A;  1GV2 A;  3VYU B;  2OPT A;  4LIT A;  2FNP A;  3JSO A;  2BVM A;  2KZV A;  2VN2 A;  3G71 I;  4LLL A;  3S8P A;  3FXO A;  3GFJ A;  4MFE A;  3ABK H;  2NYX A;  1W5C C;  3DU6 A;  2KFD A;  4C9Y A;  1BW6 A;  5L3C A;  2E34 A;  3LAP A;  1W0U A;  3I59 A;  2KKO A;  2UXX A;  2LKS A;  1JI8 A;  3GLX A;  3NQO A;  4IRG A;  5C3E J;  4BEH B;  1S7O A;  3JRB A;  2ZBK A;  5CJ9 A;  2IBD A;  1IN4 A;  2JUG A;  1Z3X A;  1OLT A;  3HKZ A;  2JVH A;  4DYR A;  4D1Q A;  3KZY A;  4OIN F;  2EV6 A;  2OA4 A;  3I71 A;  3FXU A;  5D8K B;  1P4X A;  5KCM A;  3OYE A;  3K70 C;  2QSH X;  1QZY A;  3OYB A;  2XC7 A;  2IVM A;  1MSF C;  1UJ8 A;  3HIF A;  3CMM A;  1K6Y A;  2BHY A;  2ISZ A;  2Z99 A;  4MLO A;  2QLZ A;  1OCP A;  4EQQ A;  3MQ0 A;  5B5E C;  2E1N A;  1KA8 A;  1I3A A;  4GCV A;  4D7N A;  5LBQ A;  3ZPL A;  2ZJQ F;  3GME A;  2XIG A;  2FQ4 A;  1U3E M;  5FKO A;  3KP2 A;  3B02 A;  1ZR4 A;  1NH3 A;  2R3S A;  3V8K A;  2EFQ A;  3L2U A;  3BG5 A;  4H0E A;  1K6O A;  4RAZ A;  2FML A;  4Y33 A;  2MH2 A;  1Z1D A;  1XMX A;  4B48 A;  1TT5 B;  4KIF A;  5J3L A;  3WU0 A;  1ZK8 A;  1VQL I;  2R93 J;  4PUS A;  4Y17 A;  3TOB A;  3BTL A;  4PGG A;  3D1N I;  5FRN A;  2RNG A;  2XF6 A;  3CP2 A;  2XRO A;  2DT5 A;  3OIQ A;  5GPC A;  4EEF G;  1V5G A;  1TLH B;  1QBJ A;  2CUE A;  3QU3 A;  3QYB A;  3ABL H;  4WXD A;  2QKL B;  3K10 A;  3ZOB A;  3RKQ A;  2JT1 A;  4KDP A;  3HPH A;  1FEX A;  3MKL A;  4II3 A;  4KMU X;  1UG2 A;  1T38 A;  2M7B A;  1WSU A;  1R22 A;  4AYB N;  3HRM A;  5DD4 A;  2OCE A;  3CCU I;  2M0C A;  2RVC A;  5LRS A;  1PDN C;  3FWE A;  3FBI B;  3ONQ A;  5LHG A;  3NEU A;  2B7E A;  3DFG A;  2VOD A;  3LST A;  1LDK B;  3LFK A;  3QPT A;  4LK0 F;  1YW8 A;  5BMZ A;  1Y1V J;  1WPK A;  2W4S A;  2FA5 A;  4I01 A;  1K83 J;  4J00 A;  1Z67 A;  1PUF B;  4UUS A;  2HXI A;  4Y52 J;  5D5V B;  2D2W A;  2XVC A;  1KQ9 A;  2ZME A;  3JTH A;  5D4R A;  2QGU A;  3S3O A;  3E6D A;  2DPU A;  1YHQ I;  3ZRG A;  2X1E A;  1S72 I;  4E70 A;  4CHU A;  3PM1 A;  2VPR A;  1MGT A;  4S0H B;  3F22 A;  4XR6 A;  3GTP J;  2BXZ A;  5F27 A;  3AKZ A;  2NVU B;  3J80 Z;  2OQG A;  2AHQ A;  4HEA 2;  5CQE A;  2PMU A;  4G94 A;  1B72 A;  3G2B A;  2W7N A;  5ICG A;  3CTA A;  2HQA A;  2FU4 A;  4FTH A;  3DKW A;  2CYY A;  1HQC A;  4XLF A;  1ETQ A;  1ZN2 A;  1B1B A;  3DPT A;  4G7H F;  5E17 F;  4QSH A;  1JE8 A;  2G0E A;  4BXU A;  3K2A A;  2PJP A;  5IT9 K;  1LDJ A;  2JA8 J;  1PJR A;  3CCM I;  1FYK A;  1Z9C A;  3S2H J;  3MAJ A;  3CC2 I;  2DYS H;  3LSK A;  1N25 A;  3EUA A;  1IV6 A;  1SAU A;  3JRC A;  2LNB A;  3RPQ A;  1BI1 A;  1AHD P;  1PP7 U;  5IY5 H;  3HGG A;  3HXL A;  1YJ9 I;  4HF2 A;  3HOZ J;  1P9Q C;  3WTS C;  3HL2 A;  2R7D A;  4HSR A;  3GX4 X;  1G3W A;  3OIP A;  2P6S A;  4ZYD A;  2QYO A;  1H9G A;  1MMD A;  2HYJ A;  4FCY A;  3CD6 I;  3H9G A;  2DMQ A;  1FOW A;  5LGU A;  3RZO J;  3NAU A;  4D5F A;  3QAH A;  5H2F C;  5D6E A;  3HRU A;  2VC0 A;  4PZJ A;  4B1R A;  1TW2 A;  5DCM A;  1XTA A;  3MWM A;  5BNG A;  3HUG A;  3BR5 A;  3K1P A;  3JRE A;  1WWX A;  3Q5F A;  3HRS A;  4LK1 F;  4IL6 C;  3I58 A;  2E2J J;  2QBY A;  3SFI A;  1HOM A;  2F2E A;  2O8K A;  1RPW A;  3S16 J;  1ETY A;  3GZ6 A;  2IW5 A;  3ZQC A;  2ZKZ A;  1WCM J;  3H0D A;  1W7P B;  1H9T A;  3P9C A;  3K7A J;  1Z6T A;  4CCN A;  3VSK A;  2XUB A;  5EDN A;  3FKJ A;  1LDD A;  2D5V A;  1YO5 C;  2X6O A;  1KQ0 A;  2FBH A;  4KIC A;  1HDP A;  3SJM A;  1T0F A;  1X3W B;  1CQT A;  1OYW A;  4I02 A;  2MD0 A;  2W24 A;  3OYG A;  3C2G A;  3GYH X;  1B59 A;  4CYC A;  3CMY A;  4EM1 A;  3LA3 A;  2IGN A;  1S6L A;  3CLO A;  6PAX A;  5J8C A;  2JPC A;  5KVR A;  3BR0 A;  2K27 A;  3K4N A;  3O8H A;  4L5I A;  4J01 A;  1X1D A;  1A04 A;  1YQA A;  3TKY A;  2UUZ A;  2FSW A;  3KP5 A;  3RKY A;  4RB1 A;  2K3F A;  3E0J B;  3E5X A;  3QWL A;  1KYW A;  1YW9 A;  1OYY A;  3KYC B;  5IT3 A;  3OYL A;  1V4R A;  1YE9 A;  4MQV A;  4HRI A;  2HOE A;  5H20 A;  5E8G A;  2ZXJ A;  3GUD A;  3F8M A;  4XKC A;  2V79 A;  1HW2 A;  2KRH A;  4IHV A;  2VIX A;  2HU9 A;  4UB8 C;  1FOX A;  4I98 B;  1SVM A;  1W5T A;  1XX5 A;  2VJ5 A;  2XAG A;  3W3C A;  1A31 A;  4O3M A;  1SFE A;  3WGI A;  1X4O A;  4AID A;  1I1S A;  2QQB A;  2O3F A;  2J5P A;  2BZT A;  4OOI A;  4JP0 A;  2NVT J;  4PCQ A;  2DDB A;  3HOU J;  1HF0 A;  4FX0 A;  2A6H F;  2Y9Z A;  1V5E A;  3UKG A;  1XCV A;  1C0W A;  1UHW A;  2M87 A;  2IGM A;  2LVS A;  2JJ7 A;  3HEF A;  1IN8 A;  3BCA A;  4ON0 A;  2PLY A;  4WXC A;  2QF7 A;  3O8G A;  4BXX J;  4ZJZ A;  2GBY A;  1P92 A;  3LSP A;  1W1W E;  4I76 A;  3OYA A;  3OY9 A;  1X1A A;  5CKT A;  2Y48 A;  4MTE A;  1TWH J;  2V4J C;  3GVA A;  4BQO A;  3DBR B;  3AG3 H;  1GXQ A;  2MFZ A;  3K69 A;  4UVA A;  3COA C;  2E19 A;  2M30 A;  3LQR A;  3LNQ A;  2VKH A;  3LQQ A;  2XB0 X;  2DA3 A;  3EUK L;  2LC2 A;  3Q3S A;  1P6R A;  4IX7 A;  4ESJ A;  3HSR A;  2Q8K A;  5FD6 A;  3HOX J;  3PFY A;  4A3E J;  2IS1 A;  2P5K A;  4JBA A;  3HOS A;  3RI4 A;  5EG0 A;  3GTQ J;  3Q9S A;  1R49 A;  4WXH A;  3L2Q A;  3H36 A;  3WGG A;  3K4C A;  2PFB A;  4A0X A;  1SEU A;  5D8L B;  1FIP A;  3ZMU A;  4CCO A;  3JRH A;  4AC0 A;  3V7C A;  2K02 A;  4DYC A;  4C30 A;  1V5F A;  4U0W A;  2IA2 A;  3WTV C;  1L0O C;  1W36 D;  2IP2 A;  5GTI C;  1HLV A;  4PK4 A;  3G4S I;  4P5O A;  5DV5 A;  1FSE A;  1ZRC A;  1XG1 A;  2L9S A;  4LGW A;  2EIM H;  4U7B A;  2F48 A;  5DDG A;  1N78 A;  3FXL A;  5J8F A;  3HJE A;  1KGS A;  3WGH A;  2LY9 A;  3DQV C;  2KL4 A;  1LEA A;  3SQN A;  3BP8 A;  5EEH A;  3CMA I;  3CCQ I;  2E7W A;  3KZZ A;  1VND A;  1RI7 A;  2MG4 A;  1ONV A;  4A0Y A;  3M3Y J;  2CUZ A;  4FHT A;  3FXJ A;  2P4W A;  3NWT A;  5KK1 A;  3V4G A;  3OYC A;  4XLC A;  3CCL I;  2I10 A;  5JFR A;  1MMA A;  4AYB A;  1BC8 C;  2YSR A;  3NAR A;  3SEQ A;  1IRG A;  3VYT B;  2D1H A;  2BW3 B;  2L9V A;  2R0Q C;  3S32 A;  1JKQ C;  2L02 A;  2DTZ A;  3H5A A;  1QVU A;  1EH6 A;  3F6V A;  3K1M A;  1QU3 A;  2XAF A;  3RJP A;  2AXL A;  4CDG A;  1IJW C;  2DQR A;  3W6J B;  4UUT A;  4LB5 A;  2HXO A;  5ED4 A;  4I2O A;  1D0Z A;  2DMT A;  3J7A Y;  2XAU A;  4IHT A;  1M1E B;  1I3Q J;  3ZQH A;  3WE2 A;  4KIS A;  3OSG A;  2HYG D;  2V1D A;  1XDU A;  5DUI A;  1ZKG A;  2LKP A;  1FY7 A;  3K4M A;  1GVJ A;  2DOD A;  2EZK A;  3LAJ A;  4ASN A;  4RAY A;  2L4M A;  3TO6 A;  2A69 F;  1MNM C;  2P5L C;  1O7F A;  2W1O A;  2A68 F;  5F0H A;  3GXO A;  2ZSI B;  3MCZ A;  2RRE A;  1SD7 A;  2XRL A;  3CME I;  1USS A;  3J7Z I;  4JX5 A;  5K7F A;  1IXS B;  3B73 A;  2EIK H;  5HNF A;  4YFK F;  2XV4 S;  3WHB A;  5IP9 J;  1JTY A;  3N4M A;  3C18 A;  2YS9 A;  4N4N B;  2ZB9 A;  3FKI J;  1T33 A;  4NNJ A;  4ZTF A;  1IN5 A;  2QEN A;  3LA2 A;  2GQQ A;  4G9Y A;  3R60 A;  3FDY A;  1FX7 A;  3SEZ A;  2X1D A;  4HLX A;  4F7Z A;  4P96 A;  4ENK A;  1FYL A;  1LUJ B;  1DGW Y;  2QQA A;  4HZF A;  4A6E A;  2HI3 A;  2EFO A;  5HS8 A;  3N05 A;  1VQK I;  2E1O A;  4BE1 A;  1B4A A;  3CJN A;  4ANJ A;  5K7H A;  2VUM J;  4I99 C;  1IXR C;  3T8R A;  3PIP F;  1XS9 A;  3OV8 A;  4E7Z A;  4A3B J;  1JJ6 C;  4BQN A;  4CYD A;  3IP4 B;  3CDH A; 
#chains in the Genus database with same CATH homology
 3OOU A;  4A3K J;  2AO9 A;  2ID3 A;  2MGQ A;  3F0C A;  2X48 A;  1VFC A;  4MFE A;  2WV1 A;  5FJ8 J;  3JRA A;  4J19 A;  1BW6 A;  3GTL J;  1GV5 A;  1W0U A;  2LFB A;  2ELK A;  1MBK A;  1UHS A;  4AUX A;  1W0T A;  1ETW A;  2COB A;  3LSG A;  5C3E J;  3RQI A;  4W1U A;  3HGY A;  3BQZ A;  3JRB A;  2IBD A;  1LFU P;  3Q0U A;  4M3E A;  1IDY A;  4DYR A;  1MBG A;  1ZQ3 P;  4FE7 A;  2DA4 A;  4XRS G;  1MSF C;  5M3F J;  2QCO A;  4C3I J;  3JRF A;  2JA5 J;  2EZL A;  4MLO A;  1OCT C;  2LTP A;  1OCP A;  2WB1 N;  1LE8 B;  2HDD A;  1PUF A;  4A3C J;  4D7N A;  5F1J A;  4BBS J;  2IEK A;  2FQ4 A;  3A03 A;  5FKO A;  2EBI A;  2DJN A;  1ZR4 A;  3LOC A;  1GUU A;  1MBJ A;  2WAQ N;  1SAN A;  1A5J A;  1X58 A;  2DA5 A;  1QRY A;  3BG5 A;  5M5W J;  4C2M J;  5J1R A;  4A3I J;  2XGC A;  4QIW N;  1IDZ A;  1ORK A;  5J3L A;  5M5X J;  2K9N A;  2R5Z B;  1ZK8 A;  5C4X J;  2XPW A;  2R93 J;  2YU9 J;  3MN2 A;  3BTL A;  3D1N I;  5DTD A;  4C3H J;  5GPC A;  4EEF G;  3TP3 A;  2DA7 A;  1P7J A;  1FIA A;  2LK2 A;  2CUE A;  2DA1 A;  9ANT A;  5F08 A;  4A3M J;  1R9T J;  1ITY A;  1XC5 A;  3RZD J;  2CQX A;  3ZOB A;  3RKQ A;  1FEX A;  3MKL A;  3GTG J;  5IPA A;  1POG A;  1UG2 A;  2FX0 A;  1ETO A;  1IC8 A;  3L1P A;  1WI3 A;  5EG0 B;  1JJ8 C;  1OJL A;  2X9D A;  4AYB N;  1TWA J;  2CU7 A;  2M0C A;  1D5Y A;  1RET A;  4B4C A;  2NS7 A;  1Q1V A;  1JTX A;  2NVY J;  4L5E A;  2XSD C;  3BG3 A;  2ID6 A;  2DA6 A;  4W97 A;  1U8B A;  2B63 J;  2ECC A;  3PO3 J;  3I4M J;  1FJL A;  4DZP A;  4A93 J;  2YUS A;  1Y1V J;  1WPK A;  1WGX A;  1K83 J;  1I50 J;  4JX6 A;  1TWC J;  2MW8 A;  3CDL A;  1PUF B;  2M34 A;  4UUS A;  1ETX A;  1GVD A;  2HXI A;  3G1O A;  5FKN A;  3JRD A;  4Y52 J;  2EQR A;  1X2N A;  4BY1 J;  1EF4 A;  3PM1 A;  1GT0 C;  1BA5 A;  2VPR A;  1MH4 A;  1P7I A;  4S0H B;  3GTP J;  3FK6 A;  1JUP A;  4JYK A;  5F27 A;  4V2F A;  2KDZ A;  2AHQ A;  1QVT A;  2CQQ A;  2EZI A;  4G12 A;  5GPA A;  1B72 A;  2XGE A;  3S2D J;  3LSJ A;  5EF6 A;  2N8G A;  2RAE A;  4M3F A;  4FTH A;  1O4X A;  1H88 C;  5IYC J;  3HBL A;  2Y30 A;  5E3L A;  2NVQ J;  1ETQ A;  2JA6 J;  2XPV A;  1TWF J;  1TWG J;  1NK2 P;  5E3N A;  3S17 J;  4QSH A;  2G0E A;  3K2A A;  1RKT A;  5FKM A;  1RR7 A;  3MVP A;  2JA8 J;  1H8A C;  3QPS A;  3S2H J;  4IHX A;  3A02 A;  2FD5 A;  1U78 A;  1B8I A;  4DYQ A;  2H8R A;  2W48 A;  2NOG A;  1IV6 A;  4BY7 J;  1UMQ A;  3JRC A;  1WH7 A;  2M8G X;  5EZH A;  4A3F J;  3HDD A;  4A69 C;  1AHD P;  1JUS A;  2VKE A;  3HGG A;  2K40 A;  3HOZ J;  1IUF A;  5JLW A;  5HOD A;  3Q0W A;  2TRT A;  2HYJ A;  4FCY A;  3A01 A;  2L7Z A;  5IYB J;  2DMQ A;  2R5Y B;  3RZO J;  4IEJ A;  3NAU A;  5F0F A;  4D5F A;  3S1M J;  3LSR A;  1Z0X A;  2MSY A;  4B1R A;  3CQZ J;  2O9L A;  5BNG A;  3HKZ N;  5F04 A;  4RBO A;  3BR5 A;  2JMW A;  3B6C A;  3JRE A;  2LR8 A;  2E2J J;  4UUS B;  2R7Z J;  1F43 A;  3SFI A;  1HOM A;  3JRG A;  2O8K A;  1RPW A;  3S16 J;  1ETY A;  3ZQL A;  1H89 C;  1YRN A;  3GTM J;  1IGN A;  3ZQC A;  1WCM J;  2L0K A;  3PO2 J;  1MH3 A;  3IH4 A;  3K7A J;  3S14 J;  1GDT A;  1APL C;  2KT0 A;  3BT9 A;  3Q0V A;  5EDN A;  2HOA A;  4BKX A;  5F0C A;  2D5V A;  4BBR J;  2NVX J;  1JGG A;  2X6O A;  4DZJ A;  1B72 B;  1HDP A;  3SJM A;  1IG7 A;  5IYD J;  1RES A;  3DEW A;  1CQT A;  4XRS A;  3BTI A;  1VF9 A;  2ME6 A;  1NK3 P;  4CYC A;  3CMY A;  2IAI A;  2GM4 A;  3HOV J;  1SFO J;  3BR0 A;  1MBH A;  3O8H A;  2Y31 A;  1U9O A;  2EH3 A;  2M2E A;  3BTJ A;  4A3G J;  3FK7 A;  2E2H J;  5EYR A;  4XRM A;  4M3D A;  3OSF A;  5C4J J;  5FLM J;  1JKO C;  1Y1W J;  3BR6 A;  4X1E A;  1LFB A;  4M3B A;  1BJZ A;  2GLO A;  3JR9 A;  4IHV A;  3A01 B;  3S1R J;  1A6I A;  2ECB A;  4HNV A;  4XID A;  3BR2 A;  2NS8 A;  2Y0S N;  2K9S A;  3I4N J;  2O7O A;  4JP0 A;  2NVT J;  4LOC A;  1HF0 A;  3HOU J;  2Y9Y A;  1AKH A;  2Y9Z A;  2Y2Z A;  3UKG A;  3TP0 A;  3JRI A;  2ME0 A;  2LVS A;  1I6H J;  4B3A A;  2JJ7 A;  3HEF A;  2DA2 A;  4MFD A;  2PMZ N;  4QTR A;  2QF7 A;  3O8G A;  4BXX J;  2JK3 A;  3BTC A;  2GBY A;  3OIO A;  2DMN A;  3LSP A;  4I76 A;  1ZTR A;  4NDL A;  5GP9 A;  1TWH J;  3TW7 A;  1ZGW A;  3VPR A;  3QPL A;  2L7F P;  3FIS A;  5FKL A;  2E19 A;  5EEA A;  3LNQ A;  5J1Y A;  2XB0 X;  2DA3 A;  4CYC B;  4A3J J;  3HM5 A;  3Q3S A;  3GTJ J;  1ENH A;  1BL0 A;  2HOS A;  2K9Q A;  3HOX J;  3TW6 A;  4A3E J;  2FJ1 A;  2JA7 J;  4V2G A;  2DN0 A;  4FIS A;  1FTZ A;  2HOT A;  5EG0 A;  5C44 J;  3C2B A;  3GTQ J;  2L7M P;  5EGO A;  2VKV A;  2L9R A;  2HQ5 A;  4A3D J;  3HOY J;  1FIP A;  3JRH A;  4AC0 A;  1U9N A;  2XPU A;  3E7L A;  4JX4 A;  3IV5 A;  4Y7N J;  5IP7 J;  4DYC A;  1MBF A;  2R92 J;  4MIM A;  5IOY A;  5M5Y J;  1FTT A;  1JKR C;  1JKP C;  2H1K A;  2LD5 A;  1HLV A;  3GTO J;  4D5C A;  2XGD A;  1E3O C;  4MO7 A;  2TCT A;  5E3M A;  5FKK A;  3H3V K;  4GFB A;  3M4O J;  3B6A A;  1TC3 C;  2CJJ A;  3IH3 A;  2LKX A;  1XG1 A;  5IP6 A;  3FIW A;  3GTK J;  2E2I J;  2LY9 A;  3W6V A;  3G1L A;  1DU6 A;  3S1Q J;  4XK4 A;  1AKH B;  2CUF A;  3SDG A;  1Z77 A;  1IRZ A;  3H0G J;  1VND A;  2MG4 A;  3M3Y J;  2VI6 A;  4IHW A;  5M3M J;  1DU0 A;  5JLX A;  5K7Z A;  1X2M A;  2I10 A;  3BG9 A;  4FE4 A;  1WH5 A;  2EZH A;  2JWT A;  3QQA A;  3NAR A;  3ZQF A;  1HDD C;  3G1M A;  2R0Q C;  1JKQ C;  3CCY A;  2DTZ A;  2OF7 A;  5EZG A;  1QVU A;  4M3G A;  2DMU A;  3WHC A;  1IJW C;  4UUT A;  2HXO A;  2DMT A;  4DW6 A;  1B8I B;  1JT0 A;  4D7M A;  1OFC X;  1ETV A;  3BR1 A;  1I3Q J;  3ZQH A;  3OSG A;  1T56 A;  1VI0 A;  2LLK A;  1ZKG A;  3ZQI A;  2M9H A;  3TED A;  2EZK A;  4ABZ A;  2CRG A;  1NTC A;  1BW5 A;  5EGO B;  4RDU A;  1LE8 A;  1MNM C;  1ZR2 A;  3HB9 A;  4A3L J;  2LP0 A;  3ZQG A;  2R5Y A;  5F0H A;  3HOW J;  2XRL A;  3GBG A;  5IOZ A;  5DS9 A;  1F36 A;  4JX5 A;  1ETK A;  5K7F A;  1K61 A;  1MSE C;  3S15 J;  3WHB A;  5IP9 J;  2JN6 A;  1JTY A;  4X6A J;  3IH2 A;  2YS9 A;  3BR3 A;  4M6V A;  2ZB9 A;  3FKI J;  1T33 A;  1RKW A;  3DCF A;  2XB5 A;  1QPI A;  1G2H A;  1YRN B;  5E3O A;  2R5Z A;  1AU7 A;  5FLV A;  1S7E A;  5J1U A;  2HI3 A;  2DMP A;  1MBE A;  4C3J J;  3S1N J;  2E1O A;  2P81 A;  4XIC A;  1JUM A;  5K7H A;  1HCR A;  2VUM J;  1GV2 A;  1XS9 A;  4A3B J;  4IHY A;  1JJ6 C;  2OPT A;  4I6Z A;  3BQY A;  1JT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...