2CJJA

Crystal structure of the myb domain of the rad transcription factor from antirrhinum majus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
b'GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RADIALIS
publication title Crystal Structure of the Myb Domain of the Rad Transcription Factor from Antirrhinum Majus.
pubmed doi rcsb
source organism Antirrhinum majus
molecule tags Dna binding protein
total genus 21
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cjjA00
4FE7A 4XRSG 2L7MP 2XGDA 4AC0A 2VKVA 1TWFJ 4A3DJ 1MH4A 1WPKA 2OF7A 2HYJA 5K7FA 1T56A 2M8GX 2HOTA 5EDNA 1I6HJ 1S7EA 1RESA 1NK3P 2R5YA 4W1UA 1OCTC 4XICA 3IV5A 1QRYA 2VI6A 4QSHA 2NS7A 3K2AA 2FJ1A 1E3OC 1RKTA 2FQ4A 5FKLA 1H8AC 2Y0SN 1TC3C 3GTGJ 1LE8A 3G1OA 2R5YB 1HDPA 2H8RA 4D7NA 5C44J 2K40A 2IAIA 5F27A 2DA2A 4RDUA 1GV5A 3CDLA 3L1PA 1ETYA 2XRLA 4BBRJ 2LVSA 4FCYA 5GPAA 2AO9A 3RQIA 2EZHA 1PUFA 3BTLA 1AKHB 1ZQ3P 2ZB9A 3JRIA 3I4MJ 4DYRA 3S15J 4D7MA 3GTMJ 4FISA 3H0GJ 2TCTA 2WV1A 1AU7A 2TRTA 5BNGA 3JRGA 5E3OA 3NAUA 2ME0A 3IH2A 1ITYA 2NVXJ 3BR3A 3HOYJ 1YRNB 2NS8A 2Y9ZA 3S1QJ 2LLKA 2M9HA 2Y9YA 3O8HA 4MLOA 2GLOA 1MBGA 2JN6A 2QCOA 2D5VA 2DA5A 3S2HJ 3FK6A 4D5CA 1BJZA 3SJMA 1OCPA 4C3IJ 3BQYA 1A5JA 1QPIA 4IHWA 2DMTA 5F1JA 5DS9A 5EEAA 2X6OA 1Y1WJ 1BL0A 2OPTA 2HQ5A 2DTZA 2M34A 2GBYA 4DZJA 2LFBA 5C3EJ 3Q0WA 1TWCJ 1GV2A 2M0CA 2XPWA 1ZR4A 1JT6A 2JA7J 3S1MJ 2DN0A 5EG0B 4QIWN 3LSPA 1ETWA 4XK4A 4L5EA 1APLC 5J1RA 4A3IJ 1ETQA 5J1YA 1O4XA 2CUFA 2IBDA 3FISA 4G12A 1MSFC 4I6ZA 2DA1A 4BY1J 2DMQA 3DEWA 2K9QA 1Y1VJ 3LSGA 5E3MA 3A03A 3Q3SA 4GFBA 2EZIA 2ID3A 3Q0VA 2G0EA 3LSJA 3TW6A 3FKIJ 1RETA 3OOUA 3HBLA 2DMUA 1MBHA 2WAQN 1AHDP 5M5XJ 1K83J 1I3QJ 3BTCA 4M6VA 3OIOA 1HCRA 4M3BA 1NTCA 2QF7A 4A3MJ 4J19A 2XB5A 3LOCA 1U9OA 2L0KA 5IPAA 3GTOJ 2JA6J 4JP0A 2R93J 1FTZA 3JRHA 3BG5A 1X2MA 5J3LA 3F0CA 3HGGA 1MBJA 2EQRA 2NOGA 5EGOA 3B6AA 1FIPA 3JRAA 3S1RJ 4CYCA 1IJWC 4DYQA 1IV6A 4MO7A 3FIWA 5F0FA 4A3GJ 1DU6A 4MFDA 2FD5A 3ZQHA 1JKOC 4MFEA 3HOVJ 5F04A 2X9DA 1CQTA 2O7OA 1F43A 1X2NA 3QQAA 2JMWA 5EGOB 2MGQA 5J1UA 4A3LJ 4CYCB 4M3EA 2L7ZA 1HDDC 4AYBN 3A02A 1AKHA 5K7HA 1JUSA 5HODA 3HGYA 3HB9A 3GTQJ 2DA3A 2GM4A 2HXOA 1JTYA 5C4XJ 2ECBA 1JKPC 3QPLA 3S2DJ 2ECCA 4FE4A 1IC8A 1U9NA 2HI3A 4W97A 2VPRA 2IEKA 1U8BA 4UUSA 1YRNA 5F0CA 4M3DA 3BR2A 4DW6A 3TEDA 4NDLA 3BR6A 4C3HJ 3OSFA 1P7JA 2LY9A 1TWGJ 2R0QC 1JT0A 4IEJA 1R9TJ 3BR0A 3BG9A 2DMNA 2CUEA 4A3KJ 4JX4A 4DZPA 4BY7J 3ZQFA 5FLMJ 4UUSB 2CQXA 1GUUA 1LFUP 3S16J 2MG4A 4EEFG 1JUPA 4A3BJ 2O8KA 1D5YA 2NVYJ 4IHYA 3BT9A 4JYKA 2K9SA 1IDYA 2JWTA 3ZQLA 1Z0XA 3IH3A 2E2JJ 2XPUA 4HNVA 5JLXA 1ZGWA 4JX6A 3S1NJ 5FKOA 5EG0A 4RBOA 2EBIA 2XGCA 1XC5A 1ZTRA 3RKQA 1JUMA 5FKMA 2JJ7A 1POGA 3HKZN 3BTIA 5M5YJ 2YU9J 1ORKA 3M4OJ 2PMZN 2KT0A 3A01B 3JRCA 5EZGA 1W0TA 1NK2P 3NARA 4A69C 2P81A 1P7IA 2LR8A 1WI3A 5IYBJ 1B8IA 5IOYA 2E2IJ 3PO2J 2Y31A 2HOSA 3ZOBA 4DYCA 4C3JJ 2DJNA 5IOZA 3CQZJ 1ZK8A 2R92J 2MW8A 5FKKA 4A3JJ 1JGGA 4Y52J 5F0HA 3IH4A 2E1OA 3GTPJ 4C2MJ 4XIDA 1B8IB 1Z77A 2JA5J 3HOWJ 3RZOJ 3PM1A 3BR5A 1XS9A 2HOAA 3G1MA 1HLVA 2NVTJ 2NVQJ 2AHQA 1H89C 1H88C 2LP0A 3HEFA 4UUTA 3O8GA 1UHSA 1X58A 1T33A 3OSGA 1HOMA 5F08A 1ETKA 3SFIA 4LOCA 1IUFA 3H3VK 1LFBA 2DA7A 1WCMJ 2H1KA 2E2HJ 5EYRA 4ABZA 1ETVA 2LD5A 2YS9A 4MIMA 3BTJA 1BA5A 3JRFA 2MSYA 3JR9A 1JKQC 2EH3A 3DCFA 2X48A 3MN2A 3LSRA 3ZQCA 1WH5A 5M3MJ 2Y30A 4D5FA 4BBSJ 2CQQA 1ZR2A 2VUMJ 3PO3J 3M3YJ 4BKXA 1SFOJ 4X1EA 3C2BA 2R5ZB 3WHBA 4XRMA 1MSEC 2XGEA 1FIAA 2COBA 1GT0C 2LK2A 3CCYA 3S17J 5IP7J 2EZLA 3WHCA 1JKRC 2DMPA 2N8GA 3HDDA 2VKEA 3ZQGA 4FTHA 3QPSA 1U78A 1BW6A 2XB0X 1IG7A 2FX0A 3D1NI 1QVTA 2RAEA 4M3FA 1RKWA 2HXIA 5EF6A 4A3EJ 2DA6A 5IP6A 1HF0A 4A93J 2ME6A 4B4CA 1FEXA 5E3LA 3Q0UA 5M5WJ 3FK7A 1A6IA 2YUSA 5E3NA 1RPWA 5EZHA 1LE8B 4AUXA 3I4NJ 3E7LA 2EZKA 1JJ8C 2W48A 1B72A 4A3CJ 2XPVA 4I76A 1TWAJ 4X6AJ 5K7ZA 1K61A 5M3FJ 1MBKA 2M2EA 1EF4A 1WH7A 1I50J 2L7FP 3MVPA 3K7AJ 3A01A 3JREA 1PUFB 1WGXA 1QVUA 2E19A 1B72B 2KDZA 1XG1A 3GTKJ 1GVDA 3BG3A 3HOUJ 4IHXA 3VPRA 1ETXA 3TW7A 3W6VA 1ETOA 3MKLA 3HM5A 2HDDA 2CU7A 1MBFA 5DTDA 5IYDJ 5JLWA 3TP3A 3SDGA 3LNQA 5IP9J 1TWHJ 1W0UA 1ZKGA 3BR1A 5C4JJ 3S14J 3GTJJ 5IYCJ 1UG2A 4Y7NJ 5GPCA 2LTPA 2ELKA 3GTLJ 4JX5A 3RZDJ 3HOZJ 1F36A 4IHVA 1SANA 2L9RA 2WB1N 4M3GA 2ID6A 1FJLA 2LKXA 2JK3A 1DU0A 2O9LA 2B63J 1ENHA 1Q1VA 1IDZA 3G1LA 1MH3A 3CMYA 3BQZA 3ZQIA 5GP9A 2JA8J 3UKGA 3HOXJ 2R7ZJ 5FLVA 9ANTA 2CRGA 3JRBA 1OJLA 1OFCX 3TP0A 1BW5A 1VF9A 4XRSA 3JRDA 2DA4A 4V2FA 1G2HA 4V2GA 1FTTA 1MBEA 1GDTA 4QTRA 1JTXA 1VFCA 2K9NA 5FJ8J 1JJ6C 1IRZA 4BXXJ 1UMQA 5FKNA 1RR7A 1VI0A 4B3AA 2XSDC 4A3FJ 1IGNA 3B6CA 2CJJA 2Y2ZA 2I10A 2R5ZA 3GBGA 1VNDA 4B1RA 1MNMC 4S0HB
chains in the Genus database with same CATH superfamily
4FE7A 4HX7A 2CG4A 2K9LA 2VKVA 4LLLA 1TWFJ 1VQ8I 2OF7A 3VYSB 2HYJA 4HNTA 2ZBKA 2F6CA 3F6VA 3W3CA 4CCNA 1YJWI 5J4VA 1RESA 5KHDA 2X6YA 3KPHA 2R5YA 1OCTC 4QSHA 5LLQA 2O0YA 5D5VB 4HRIA 2OZUA 1YHQI 2VQHA 2WV0A 2FQ4A 1DUXC 4A2UA 1VZ0A 1W5SA 4IF4A 1DP7P 2L54A 3C1DA 3TGNA 3CCJI 3WTVC 1D8KA 2LDUA 1D0ZA 2VJ4A 1IXCA 4A12A 1YIJI 3COAC 3P5JA 1KU9A 2K4JA 2Y48A 3CDLA 1UFMA 3DTEA 3LQRA 1E17A 2LVSA 4FCYA 2CV2A 2EB7A 3ZR8X 4WXHA 2ELJA 2MH9A 3BTLA 1AKHB 3K0LA 3PFIA 4IOCF 3PNTA 2AS5F 3JRIA 1SFKA 2BVLA 4OIOF 4YG2F 2EFPA 5H2FC 4IXAA 3GEZA 3W2AA 3S15J 4FISA 2TCTA 3MQ0A 1AU7A 2TRTA 4FQGA 2KIFA 2Q1ZB 5FLXZ 3NAUA 3CJNA 3OYIA 3CCVI 2M1BA 3HOYJ 2VKDA 3S1QJ 2M87A 2YPRA 1W7PA 2LLKA 3N97A 1FPQA 3O8HA 2ISZA 3K4MA 4MLOA 1Y6IA 3ROUA 2R7TA 5EEHA 3IHUA 1IAWA 3D0SA 3EYYA 4D5CA 5DD4A 4RGUA 1KQ8A 1OCPA 2QQBA 3CF2A 5HS9A 2KIUA 2UWMA 2CO5A 1PJRA 3FM5A 2DMTA 1K6OA 1B59A 5F1JA 4RA2A 2X6OA 5HDKA 3BZKA 2P7VB 3E5QA 4UNOA 2W82A 4X0GA 3R0JA 2O03A 1STZA 2M34A 2GBYA 3G6EI 2LFBA 1HXDA 4D0PA 2EILH 1O3QA 1FOYA 1LUJB 2BXZA 2XPWA 1ZR4A 5J6XA 2I5UA 2WBMA 4O5VA 2XKOA 2V1NA 2DN0A 4ENNA 3OS0A 2JA7J 1REPC 3S1MJ 4E7IA 3H5AA 1ETWA 1N77A 1PDNC 5J1RA 2Z9OA 3I59B 4M72A 2NVUB 2QKLB 5J1YA 2VQGA 2X1EA 3WTXC 4QPOA 1LDJA 4G12A 2Y75A 1MSFC 4UVBA 3DLAA 1TLHB 1P92A 2DMQA 3FXUA 4OMZA 3DEWA 1R6RA 2K9QA 4PZJA 1MJ9A 3LSGA 1RUNA 3BJAA 2EZIA 2ID3A 3L2WA 2O3FA 3LSJA 3TW6A 2EV5A 3HXLA 2DMUA 1MBHA 1TP4A 1Y0UA 2XAGA 2QWWA 1BBYA 1OCOH 5LHHA 1XTAA 4I02A 3P9CA 3BTCA 2RDPA 4M3BA 3CC2I 3TO6A 3LQQA 3FF5A 2QF7A 4ZYAA 4BU2A 5IPAA 5D4RA 2R93J 1OQYA 4M9ZA 3KLOA 2Y0SA 3GO5A 3LL7A 1X2MA 1XGOA 3MKZA 1RIOH 1MBJA 3ZMSA 2EQRA 2NOGA 5EGOA 1IV8A 1FIPA 1DP3A 4BUPA 2O6GE 4A3GJ 1DU6A 4MFDA 5F04A 2X9DA 2X6WA 2O7OA 2P5LC 1F43A 1LJ9A 4LJZF 2JMWA 3BP8A 5J1UA 4CYCB 1HDDC 4HPQA 4AYBN 4PK4A 1D0XA 2Y0MA 5K7HA 1Z7LA 2R4GA 1I39A 1VQ7I 2GM4A 1USTA 1X3WB 4HF0A 2P6SA 3GLXA 1ZAOA 4E7ZA 3QPLA 4CH7A 3K1NA 3S2DJ 3P9IA 4FE4A 1ODDA 2HI3A 4W97A 2K02A 4UUSA 1YRNA 2K3PA 4BH9A 4M3DA 2RV8A 3RKXA 1T95A 1HKSA 2JVGA 2ZMEA 3BR6A 3TEDA 2IS4A 1P7JA 4IQ4A 1FMWA 5HLIA 5D8LB 2QSGX 4KT5C 3U21A 2VBWA 2W85A 2MLGA 3BG9A 2DMNA 4HG2A 2W00A 4MEYF 4I0AA 4EMSA 4BY7J 2CQXA 3SZPA 2MG4A 4EEFG 2FUG2 4BAYA 1OPCA 4BE2A 2DYSH 2VOPA 2DFFA 4XOTA 4XN0A 2W24A 4J01A 1G6NA 2K9SA 1X1AA 4AM3A 2XAUA 1IN7A 2DO7A 3OYEA 1K7AA 3A1YA 2E2JJ 2V9KA 2XPUA 1HW5A 5JLXA 5LHIA 4IRGA 3K6GA 5FKOA 1DGRM 4CCJA 4ZYDA 5EG0A 4RBOA 2EBIA 3CO6C 3CP8A 4F93B 1WJAA 1ZTRA 2QLZA 4RM3A 1BM9A 2XDVA 3FHZA 2MYSA 3ELKA 1EJ9A 5HOOA 1XDUA 3ECOA 1T8IA 3GXOA 3JRCA 5CYVA 1JI8A 1HKTA 1MNDA 3U1KA 4IVNA 1HW1A 2K86A 3NARA 1TW3A 3OYLA 5D5XB 2H6BA 2Q2EB 1KQ0A 4YIIA 4WF2A 1M1EB 4I09A 3BOQA 5IOYA 2E2IJ 5H6QA 2CMPA 4IRIA 5TGTA 4C3JJ 1B1BA 4F3QA 2CQ7A 1UZCA 4WXDA 2KRHA 2NS0A 5FKKA 3FBIB 1G59A 2XAFA 1BI3A 3GTPJ 4C2UA 3SFZA 1TQPA 4YIRX 4XIDA 4LB6B 1B8IB 2ZFUA 2JA5J 2UXXA 2LG4A 2XRNA 4CGZA 1U6GA 3RSNA 4MEXF 3RKWA 1MMSA 2F2EA 5ICCA 3O8GA 4PFPA 4I99C 2IJLA 2Z16A 1A31A 3ERED 2QA4I 4P96A 3SFIA 2VBXA 1J5YA 1ULYA 4DBRA 2DA7A 1WQ2A 2G7HA 3ZP5A 4ABZA 2WY8Q 5GTHC 5CVUA 2HQNA 3PSIA 4BHPA 1U2WA 4FX0A 3U2RA 3R6SA 5IT9Z 2ZXJA 2LNBA 4L9TA 5AONA 3MWMA 2MD0A 1G3YA 2V26A 1MDMA 4I2OA 3ZMTA 2EH3A 4WX9A 2DFHA 3K10A 3LSRA 2UZKA 1JE8A 1A35A 3WTUC 2IT0A 3LA7A 4PJ0C 1XMAA 2DT5A 3NRVA 3SEZA 4D5FA 4XBFA 4DNCA 3I54A 2DBBA 3M3YJ 4BKXA 4M74A 4X1EA 1OR7C 3C2BA 2K27A 2OUMA 4HX4A 4EGZA 4XRMA 1AOYA 1R7JA 2A5WA 4BS9A 1E3PA 1SMTA 2COBA 2LK2A 4RB3C 1WVRA 2EZLA 3WHCA 3HPHA 4EJWA 2N8GA 4HQEA 3GYHX 2IA2A 5GTIC 3W2WA 1BW6A 2JVHA 2LBFA 4E7KA 2L01A 1O57A 5IT3A 1I1SA 3D1NI 3CCSI 1VQPI 3H36A 3DBRB 1Z7UA 2RAEA 2EFOA 1WHUA 2XF5A 3KX2A 3VODA 2VJ5A 5JVGF 2ZC2A 5IP6A 2ME6A 3CMMA 2GA1A 5E3LA 3Q0UA 2DT6A 4BACA 2YUSA 3AL0C 4YEJA 4UVCA 2B7EA 5D5UB 4GRIA 4PJJA 1S72I 5D4SA 1RPWA 3I4NJ 3DPLC 4ITVA 1OCZH 4I7HA 2EZKA 1FC3A 3DEUA 3EPZA 4WK8F 1EKEA 2HPMA 1B72A 1WZ2A 4X6AJ 1IN4A 1SFEA 1ZG5A 5FO5A 2GOMA 2X85A 3CF5F 3MEXA 2PMZA 3SZGA 3ZQQA 4ESJA 4ZTJA 4Q4ZF 3RYRA 1EF4A 2KRCA 2L7FP 3A01A 2QUFA 1WGXA 2X1DA 3GTKJ 4O3MA 1H0MA 1ETXA 2DPUA 4XKCA 2A5YB 2DOFA 1I3AA 3TW7A 3W6VA 3EDPA 3CDIA 1G4DA 5DTDA 3TP3A 3HOTA 1XSDA 2LRDA 5CLSA 3WG7H 1W0UA 1W7PB 1I1GA 1YI2I 3T5XA 5B3SH 4Y7NJ 2L2OA 2LTPA 3BDDA 2ELKA 2NAZA 1WFXA 4JX5A 3HOZJ 1T98A 4NUBA 2ZCWA 4N4NB 2ID6A 3K70D 1FJLA 1C0WA 1SVMA 5LD2C 2OCCH 4LIVA 4M9SA 2ZXWH 2VOOA 1DU0A 2CFXA 1ENHA 2NYXA 2CW8A 2E36A 2HVSA 1XDSA 3WTSC 2IGOA 3FXRA 2IS1A 3UKGA 2WC2A 3OYBA 3FHNA 1IRFA 3S8PA 3DPUA 3CMAI 3D5LA 2L02A 1LFPA 4XLAA 4ZYEA 3J81K 1XGMA 3TP0A 5DUIA 3KYDB 1UB9A 2VQCA 3MD2A 3JRDA 2B9SA 4V2FA 2R7SA 1G2HA 4V2GA 3V8LA 2OV7A 2K9NA 2LKSA 3DF8A 3RPUD 4BXXJ 1IUYA 1ZN2A 1UMQA 3EETA 3GCMA 2EV0A 2FOWA 2UV1A 5FKNA 1FOWA 1RR7A 2R7OA 2XSDC 4A3FJ 3DQVC 1PUEE 2CJJA 2EIMH 4ZDLA 1WJDA 2HR3A 2BXYA 2K5CA 2XVCA 3GBGA 3L7WA 3RIRA 4IJAA 4L5JA 1D8JA 4S0HB 3M4OJ 5LHGA 2PN6A 3OYHA 2HYFA 3S93A 5JR3A 1WPKA 4OU0A 1WSUA 5K7FA 1T56A 2M8GX 3OYDA 3BG6A 1Z3YA 3F9KA 4XKBA 2RREA 1R4NB 1RZ4A 2O8XA 2F5DA 2ZNZA 2VI6A 3WU2C 2NS7A 3K2AA 3D5SC 3PFYA 4HF1A 3VYRB 2HKXA 2CQKA 3V42A 4YFKF 1A36A 5FKLA 1H8AC 2Y0SN 1IRXA 2DYRH 1YQAA 1QQIA 1T0FC 1LE8A 1FMVA 2K40A 3JAMZ 4UV9A 5DV5A 4RDUA 4LG3A 1IN8A 2B0LA 3L1PA 1ETYA 4CDGA 2MLKA 1FY7A 4BBRJ 4XLCA 3KEOA 2EZHA 2M45A 5CVRA 2VBYA 2VONA 5KVRA 2ZB9A 3TDZC 2A3SA 4UY8I 2H27A 2NRAC 3FXMA 4LD5A 1XN7A 2KLOA 2ME0A 4AD9A 3TOBA 2VKHA 2NVXJ 1ITYA 3ISPA 1YOVB 1YRNB 2NS8A 2QBYA 1IZ1A 2F5FA 5E18F 2ZMEB 2R7QA 4UXNA 3U9GA 3F8BA 2D5VA 4XLFA 1Y39A 2WWYA 2DA5A 3PIPF 2VT2A 2YX4A 5CKTA 3QYFA 4MQVA 4G7HF 1KQ9A 1QPIA 2FSWA 3SHFA 5DS9A 3KP2A 2BE5F 1BL0A 1O7LA 4XR6A 3I9V2 4MTEA 1PP8F 4OIPF 2X51A 1OR7A 2CW0F 4Y3OA 1XCVA 4F55A 2FBHA 1I5ZA 2IPQX 4KITB 2JUGA 5FRNA 1GV2A 4LLNA 1JT6A 4LK0F 5EG0B 2HU9A 4PJMA 3LSPA 2X0LA 5LBQA 4L5EA 1V4RA 2VN2A 5B1AH 3GZNB 2PQ8A 2OD5A 4WCGA 2O61A 3GFLA 3FISA 2L4AA 1IF1A 3ZMDA 1X1PA 4MHGA 4BY1J 2WY7Q 1S6LA 2HTJA 5E3MA 3A03A 2HQAA 1SFUA 4BE0A 3ML6A 3HBLA 4Y33A 5D5WB 5LFAA 1OKRA 3FBNB 1AHDP 3L09A 5M5XJ 1I3QJ 4M6VA 3OIOA 1HCRA 2F4IA 2X1CA 3WU0A 4J19A 2E7XA 1U9OA 1SMYF 2L0KA 2K4BA 2FMYA 5KK1A 4AIHA 4E6KG 5HNFA 3JRHA 3FZVA 2R7DA 1XB4A 2KZGA 3C3WA 5ILSA 4BEHA 4BHCA 3IKTA 5J3LA 2IP2A 3H92A 4A0YA 2XAHA 1JHHA 4YFNF 2BV6A 3OL4A 4OWRB 3U1DA 3OIPA 4G6TB 4L9JA 2UXNA 2JRTA 2D2WA 5F0FA 1VQ6I 2AQFA 3ZQHA 5DUKA 2FBIA 1X2NA 1DPUA 2JQ7A 3QQAA 2P6TA 1YITI 2FE3A 4A3LJ 3AG2H 2ISYA 2Z99A 2L7ZA 4H4KC 4CCLA 3UR3C 3CCRI 5HDGA 1HBXG 3QOPA 1EA3A 2CUJA 2BHZA 3O6BB 3FMSA 5KAFC 1EH6A 5HODA 2V1XA 3HGYA 1SD4A 3HB9A 4CO8A 3GTQJ 1TBXA 1JTYA 3GZ5A 2XUBA 2FMLA 2IGMA 1RRJA 3CUQB 3ZQ7A 4NC7A 1SD5A 2DI3A 3KLNA 1U9NA 2E35A 1YX3A 5F0CA 3OSFA 1K78B 4KDPA 1BIBA 5E1ZB 1FP2A 4L9VA 4Y15A 1JT0A 3CESA 3GZ6A 4TV7A 2K7LA 3HTSB 1CF7A 1HW2A 2QQ8A 4JX4A 4DZPA 1WI9A 2L5QA 1QZEA 2LBFB 2JSPA 4MNUA 1A6QA 1TZLA 3S16J 4B8XA 2KDOA 1SD6A 4GXOA 5E20A 2O8KA 4A3BJ 2H94A 3L2QA 2A61A 4L5IA 2YSRA 2CW7A 4R79A 3BT9A 3EQLF 3TBIA 4RMNA 3WGIA 2VIXA 1U5TB 1P2FA 1Z0XA 2Z3YA 4YFXF 3S3MA 3PNYA 3VYTB 1FOXA 1OYIA 3ZCOA 1K4TA 2K3FA 5JVTA 1XD7A 2XGCA 1BI2A 5FKMA 2JJ7A 1X1DA 5M5YJ 4OAYA 1ORKA 1D1AA 4BQOA 1FYMA 2PMZN 1KU7A 2RN7A 1MGTA 3HUGA 2FXAA 3WTTC 2KT0A 3A01B 3TDUC 2ZNYA 3WGHA 4C30A 4Q5SF 3BROA 2WTEA 2FNPA 3I0TA 5L3DA 1WI3A 4LB5A 3PO2J 2Y31A 3CUQC 1K6YA 1T2KA 4BGDA 3DEEA 2WAQA 3HYIA 5TISC 4DYCA 2DJNA 2IXSA 4HAMA 2MW8A 3T0YA 4HV5A 4A3JJ 3CO7C 4Y52J 5JI6A 2ZJ2A 5HLGA 4NB5A 5DD8A 3K4JA 4HYEA 1MW7A 3LFUA 1B4AA 3HJEA 4E7SA 5LGTA 2DXIA 1N78A 2EFQA 4O6JA 3RZOJ 3JW4A 4E4HA 3FXLA 3HHHA 2LC2A 1F9NA 2NVTJ 3CLQA 1H88C 2VB6A 5FRMA 4UUTA 1IO2A 3NWSA 4BE1A 2G7UA 2ZKZA 1HOMA 2M30A 4RLQA 5F08A 1AA7A 4LOCA 4QWQA 1IUFA 4HDVA 3DKXA 1FWZA 1G3TA 3X2QH 4ENMA 4PFOA 1U8RA 1ETVA 3I56I 2LD5A 2GAUA 2HTSA 4KN4X 2V1UA 3HC7A 1ZG3A 5FFXA 3O2PE 4D1QA 5BPDA 3MMYB 3A0HC 1AWCA 3BTJA 3OV8A 1QZZA 3FMQA 3I55I 4IQJA 4B3XA 3VSKA 1RUOA 3P9KA 2HZDA 1TW2A 3LMMA 1QO0D 2HPIA 2LF8A 4JK1X 4AIKA 1ZGAA 3DCFA 3F21A 1YE9A 2KIQA 5J8FA 4NHJA 1Y0NA 3ZQCA 3N05A 5M3MJ 2Y30A 1ZREA 2BZTA 3BWGA 1Q1HA 3F8CA 1QZYA 1TQIA 1G8XA 5A2QK 2XKPA 2VUMJ 2L9NA 4ESBA 3ASNH 2HVQA 4ZTFA 1EV7A 3HSEA 3UNGC 1V55H 1U0JA 3DTKA 4XLPF 5FB2A 2JUCA 1R5ID 3HG9A 3S17J 2PJRA 2XF6A 3QU3A 2W57A 1XPXA 3JCUC 2DMPA 2EFNA 1UJ8A 3LWFA 3OWTA 1SC7A 3QPSA 2XIGA 1VQMI 1IG7A 1VQ9I 5E8GA 1ZH5A 2BHYA 2P5KA 3JSPA 1YLFA 2HDCA 1RKWA 5EF6A 5ILUA 4A93J 2ACJA 2F48A 2KRFA 5M5WJ 1A6IA 3VWBA 3KIOA 3K4LA 1I6XA 2H09A 1LE8B 4UUVA 4AUXA 5CVJA 3TO9A 1R23A 2RQQA 4L0ZB 4NQWA 3E7LA 1JJ8C 3OYGA 3HKZA 4A3CJ 3CZ6A 2XPVA 4CHUA 1TWAJ 5GAGJ 2AQEA 3H9JA 2E71A 1XGNA 1R4MB 1K61A 1MBKA 3VOEA 1XSVA 2FQ3A 4PJNA 1W36D 4BJTA 2M2EA 4E7LA 3K7AJ 3JREA 1BC7C 3ONQA 4PGHA 3QOEA 4CSWA 2STWA 4KJZA 5L3CA 2V9PA 1XG1A 3PIOF 3G2BA 4OINF 2QVOA 1GVDA 4NC8A 4LIUA 4IHXA 4XNFA 3VPRA 1CGPA 3EUKL 3GX4X 2WA0A 3S3OA 2QZ8A 3E5XA 1OYYA 3MKLA 3HM5A 2HDDA 2K85A 1MBFA 3L2RA 1S8NA 5D6EA 3FMRA 4WXCA 3SDGA 4KIFA 2DJIA 1O3RA 2XAQA 2OJED 5DCMB 1TWHJ 2JA2A 1UAAA 2HYGD 2QBYB 1ZKGA 2YX7A 2QYOA 4EQQA 1UG2A 4AVPA 4QPQA 4P9FA 2P8TA 4Q47A 3GTLJ 1GLNA 2A6HF 3RZDJ 1F5TA 3P7NA 4IHVA 2FBKA 2R3SA 3K1PA 2KZVA 5TJJA 1LNWA 4XSZF 1SEUA 3CUOA 4A5NA 2OQGA 3T8TA 3WE2A 3LSMA 4HBLA 3QRFF 3O3KA 2LKXA 3DU5A 4ZC3A 1TNTA 2O9LA 2WAFA 1SFXA 4EJOA 2OQRA 1MH3A 3CMYA 3ZQIA 1QPMA 1S5LC 1NH3A 3HOXJ 2MBFA 4IX7A 3K69A 5K5QA 1YW9A 4KICA 4LFUA 5H20A 1YW8A 3Q9SA 4XRSA 3ZMZA 4G8XA 5K1YA 4G7ZF 3N4MA 2V6EA 2IS6A 1A04A 5J47A 1MBEA 2ZXHA 1VFCA 1DPRA 2R7UA 3E6CC 3E6MA 4PDKA 1VI0A 2EIKH 1WKMA 2J5PA 4N0BA 5L3GA 3B6CA 2HEOA 2OU2A 2Y2ZA 3K1MA 2ZJRF 2E1MB 3F72A 2I10A 1J59A 5GADJ 4DJAA 2R5ZA 1VNDA 4B1RA 2FEZA 4XRSG 2L7MP 5DM7F 1LQ1A 3D5RC 2OBPA 4HW0A 5BOXA 4RAYA 3WU1B 4A3DJ 3V4GA 3AG3H 4LG0A 3HRSA 2HOTA 2KP6A 5EDNA 1I6HJ 3AG4H 4M71A 1NK3P 3HPGA 4XL9A 4W1UA 1YIOA 4XICA 3IV5A 2F5CA 4ZYHA 3CJQB 5AIPA 1E3OC 3QPTA 1RKTA 2VODA 2F5VA 3CJRB 3I3LA 3E5UA 4RGRA 1TC3C 3KP5A 4HLXA 3FKJA 3K70C 1R1UA 2R5YB 3V8JA 3PL8A 5C44J 5BMZA 4BDYA 3PJRA 2DA2A 1S3JA 4NNJA 1FP1D 2P0WA 2XC7A 5CQGA 1S29A 3GFMA 5LGNA 2XRLA 2AO9A 4AWXB 5IY5H 4PCQA 4BQAA 2ESHA 3DBLB 1PUFA 4A0XA 2LREA 1EH7A 4ZYGA 2CGPA 1BN5A 2GXGA 4K2EA 2Z5UA 3I4MJ 1BR4A 3VSLA 4NBQA 4ANJA 3H0GJ 1R49A 2WV1A 5BNGA 3JRGA 1XSXA 1LPQA 1ZHFA 5E3OA 4IHSA 3F8FA 3SZTA 2OA4A 1TT0A 3FXOA 5FD5A 2CH0A 1HKQA 3V7RA 5E1XA 2M9HA 4KIBA 3MZHA 4CCMA 1T6SA 1ONVA 2VQLA 4DBQA 5BPIA 2GLOA 1P4XA 1BI0A 1XMKA 2JN6A 2O5RA 2QCOA 4D9JA 2WB1A 3AG1H 1BC8C 3S2HJ 3FK6A 5ICEA 3S3NA 2XGXA 3ABLH 3KYCB 3SJMA 3QP5A 4RB0A 2ICWG 3BQYA 3L2UA 2QKMB 2Y69H 4M6YA 2V9VA 4IHWA 2A69F 2EK5A 1R1TA 4I0BA 4CCOA 4KN7X 4U0WA 3VB2A 3ASOH 1Y1WJ 2H1LA 2QGUA 2DTRA 4XMYA 2OPTA 2DTZA 3E6DA 1FX7A 5ERIA 2JSCA 1YYVA 2A05A 3SXYA 3GFIA 2LKPA 5C3EJ 1RC9A 3G4SI 2M0CA 2RNJA 5J4YA 3JSOA 1MMDA 2GIZA 2W4SA 3IUOA 1PP7U 3OYMA 2PX9A 3C18A 1J75A 4L18B 4BXFA 2M0MA 2QM3A 4ENKA 4A3IJ 3OYKA 3KP4A 2TDXA 1O4XA 3MZ8A 2ZXIA 2V1DA 2IBDA 3DU6A 3IWZA 2DODA 1JXSA 2A07F 5F1RA 4I6ZA 4G9YA 3BCBA 1WJBA 1QBJA 2M8EA 4N9IA 4OIRF 1MMNA 2EA4A 3C2HA 3PQJA 1IXRC 4GFBA 2IGKA 4EV0A 2ZJQF 3Q0VA 2G0EA 2CS3A 1OYWA 1R22A 1RETA 1OCCH 4RS8A 3M7GA 4EJTA 2M4KA 2WAQN 5DYMA 2VL8A 3F6OA 1MD0A 1WJCA 3I4PA 5LRRA 2GXBA 2I8DA 3OL3A 5H6RA 2VJJA 1NTCA 1XX5A 3OIQA 4JOMA 4IOAF 1JGSA 1F4KA 1E0EA 2F5EA 4CXFA 3CDHA 1MJBA 1TNSA 1ZYRF 3BG7A 1WJ5A 2JA6J 4EJUA 1FTZA 4KFCA 2VBZA 4CICA 4JQFA 3F0CA 4ZZLA 3HGGA 5FROA 4AYBA 2GZWA 1WRJA 3M07A 3S1RJ 3RTRA 4CYCA 2RNGA 2UUZA 4XKVA 5K5OA 1I27A 3VYUB 3F23A 2ZO4A 1TQMA 1JKOC 4KMFA 1YJ9I 3J81Z 4F92B 3HOVJ 4R1HA 4BQNA 1D3YA 3H35A 5EGOB 5CQEA 2MGQA 4MGRA 4IO9F 4IPAA 3A02A 2KJBA 4KYWA 5DDGA 5LRSA 3BZCA 2DA3A 5D8KB 4BJ6C 2HXOA 1H9TA 5C4XJ 3ABKH 2ECBA 2LYCA 1YJNI 2ECCA 4DOZA 3B73A 1S9HA 1IC8A 3DKWA 4KISA 1YS6A 1U8BA 2VPRA 1UHWA 2DK8A 1MKMA 2IEKA 1Z91A 2A6TA 4XRFA 2QSHX 5D6FA 1J09A 1QHGA 2E34A 4DW6A 4YIFA 2LY9A 5B1BH 2R7WA 2R0QC 3ZMUA 1ON1A 4IEJA 2HNHA 3M9AA 3RDIA 3J80K 4YRVA 2CUEA 4XKWA 4A3KJ 2BY3A 2ZSIB 3ZQFA 4UB8C 5FLMJ 4UUSB 2IW5A 4OMYA 3GFJA 1GUUA 2WAEA 1JUPA 1F1ZA 5HLTA 1HSTA 2NXNB 1D5YA 3CLOA 5GAEJ 3IAS2 2X4HA 1IDYA 2Z33A 3GUDA 5DM6F 3ZQLA 4HQMA 2JTVA 2HFHA 1YS7A 4I01A 1LB2A 4HNVA 1V5GA 4JX6A 1BOBA 1SAUA 4Z6YA 2DU9A 1ZELA 4G94A 1IXSB 4B09A 4LLGF 2V6CA 3G73A 2VC0A 3R60A 2YU3A 1JUMA 1TTYA 2FU4A 3DXJF 3HKZN 3BTIA 2YR2A 2L7KA 3QPHA 2Q2EA 2LOOA 5DCFA 4P9UA 2EPFA 3RQ4A 1Z21A 1R5GA 1QU3A 2ESNA 5EZGA 1NK2P 1W4MA 2Q0OA 2ADUA 2KQRA 2AXLA 1V5FA 4A69C 1P7IA 3KP3A 2DLLA 5J8CA 3OYCA 1N25A 3EYIA 4IKFA 1B8IA 1P4WA 4LK1F 4RGSA 1G3WA 4S04A 4EATA 3OOPA 3F3XA 2RGVA 3CQZJ 2OZ6A 2R92J 1ZGJA 4OIQF 4Y13A 3MKWB 2LY1A 3IP4B 2PG4A 1Z77A 1HQCA 4KT6A 3GVAA 1SAXA 1EH8A 3LSKA 1XS9A 1HLVA 3C7JA 5E17F 4U7DA 4AU7A 2NVQJ 1H89C 1IRGA 1X58A 2BW3A 4ASNA 2HKOA 2ZMEC 3OSGA 5TRDA 1T39A 1ETKA 4CCKA 2GWRA 3H3VK 1LFBA 3OYAA 3G3ZA 1WCMJ 2FRHA 5EYRA 3J7ZI 4L0YB 1DQUA 1BI1A 2PJPA 3BPXA 4XLEA 3LAPA 2YS9A 2CSOA 2QQ9A 3IC7A 3I58A 2MD5A 1FZPB 2RVCA 3J7AO 4II2A 3FXQA 1BA5A 3ZGKA 3QAHA 1R71A 2MSYA 4HNUA 4FX4A 3CC4I 1IN6A 2X6XA 3SDBA 3KCCA 3TOAA 2GXAA 2DAOA 3RI4A 5F64A 2CV1A 5FLXK 2CQQA 3A4CA 2HWVA 1VQOI 2DFEA 1ZR2A 3PO3J 3NQOA 1SFOJ 1USSA 2R5ZB 2BYVE 4GYIA 2RC4A 1MDMB 1MSEC 2XGEA 3RJPA 1DDNA 4BYYA 3DWLE 1VQKI 5IP7J 1UG0A 2KISA 4UB6C 2IVMA 3RYPA 3HDDA 3GLLA 1FBQA 3ZQGA 1X1BA 4EJVA 4FTHA 4LG0B 1U78A 2XB0X 2NNYA 2FX0A 1KYZA 4HEA2 1FYKA 4JBAA 1ZRFA 3QWLA 3A0BC 1SVLA 1QVTA 4M3FA 4AVZA 2R7RA 4XONA 2DA6A 4B4CA 4R8HA 1D1BA 1FEXA 4HLYA 1R00A 5JFRA 3L2CA 4RM2A 3FX3A 2W25A 5HLHA 1IN5A 3IRRA 2CYYA 2STTA 2W48A 5HVQC 4I76A 4ZH4F 1YX5A 3MAJA 4U0VA 4BNCA 5K7ZA 4XLHA 1D5VA 3H5NA 3TL4X 4HV6A 2KIMA 3BZ6A 3H9QA 1WH7A 1PUFB 1J0RA 3HHGA 5ED4A 2A6EF 4ENJA 2E19A 1B72B 3HTUA 3H3UA 3KZYA 2M7BA 3BG3A 4J00A 1NG7A 4I98B 2GIVA 1ETOA 1X19A 4BJ5C 2CU7A 5IYDJ 1YTYA 3PUBA 2M3AA 1L3LA 4ZZDA 3OY9A 3BR1A 3LAJA 3A2KA 1D0YA 1Y56A 2V7FA 3VEPA 1MIJA 1UCRA 2VXZA 3Q5FA 3AAFA 1RR8C 1T0FA 3TKYA 1KYWA 2Q8KA 2OTJI 2CWEA 1G3SA 1SANA 4KIGA 2PMHA 2WB1N 3E1SA 2OC6A 4BQQA 3T1BA 2PMUA 3LA3A 2F4OB 2OCEA 3ZPLA 1VQNI 1J9IA 1FYLA 1JHFA 2H8WA 4RB2C 1ERDA 1Q1VA 2VC1A 3G1LA 1QHHD 3BQZA 5GP9A 2HQRA 4FT8A 3PSFA 1XMXA 3HSRA 9ANTA 3E97A 2CRGA 1LEBA 4U88A 3R4KA 2IS2A 3I64A 3WODF 1OJLA 1OFCX 2MA3A 3LSTA 1VF9A 3V8KA 2IGNA 3HRTA 1V5EA 1GDTA 1JTXA 3KP6A 5FJ8J 1JJ6C 1U5TC 2OAZA 3DBHB 1IRZA 1P4AA 2VE8A 2AXTC 2H6CA 1LVAA 1L0OC 3VFZA 3QU6A 2JT1A 4N9HA 5JHUA 4P55A 3OYFA 4UV8A 2ZFWA 1SD7A 2KKOA 1W36C 4Z2YA 2EFWA 3F8MA 3BJOA 3TMOA 4HSRA 2RQPA 1MNMC 1ZRDA 2W7NA 2XGDA 4CYDA 2VPLA 4AC0A 2MABA 2W1OA 4A6EA 1Z3XA 2P7CB 1MH4A 2MFZA 2KPMA 3FWEA 1YO5C 4OAZA 2LY2A 1VQLI 2ZSHB 4B48A 1W5TA 1S7EA 1MZBA 4L9NA 4U0YA 4HF2A 1QRYA 3DLLF 3HRUA 3HZJA 3M8FA 4S05A 2FJ1A 4LMYA 2R7XA 1GVJA 3L00A 1BR1A 1MMAA 3GTGJ 3DFGA 3EUHC 2R7VA 3IKVA 3G1OA 3PQKA 1HDPA 2H8RA 4D7NA 2IAIA 3KETA 2MC4A 5F27A 3MCZA 1MJAA 4H0EA 3Q9VA 3H3ZA 4FHTA 1T38A 2DPDA 3CMEI 4AIJA 1GV5A 3JTHA 2LMDA 5GPAA 1S7AA 1Z1DA 3PUFA 3RQIA 3BC8A 3LSIA 3K4CA 1PVEA 1QGPA 1W1WE 3F8NA 1ZQ3P 4RGXA 5F6FA 4DYRA 1KU2A 2L3DA 3K4BA 3IRQA 3H0DA 1VTNC 4GDFA 4EVIA 2DOAA 3FXJA 4D7MA 3GTMJ 1BOAA 3OYJA 3QYBA 5LGUA 1Z67A 2ZJPF 4M6XA 4IRHA 4XORA 1RNLA 3IH2A 5A2QZ 3CJTB 3REOA 3BR3A 4Y4RA 3E0JB 2Y9ZA 2DQRA 4E7JA 3B02A 2Y9YA 2D45A 3CTAA 3KP7A 4A5MA 2VE9A 2KHMA 1MBGA 2E7WA 1FSHA 1H9GA 3KEYA 2OTLI 3HSFA 1BJZA 2M5WA 3CCUI 4C3IJ 3OS1A 1A5JA 4LITA 3H9GA 2V4JC 4XM3A 4A6DA 1ON2A 5E8IA 2CV0A 5EEAA 2E5ZA 2BY1A 5J40A 3LA2A 3QP6A 2HQ5A 4DIQA 4DZJA 3HRMA 2KL4A 3Q0WA 3CCLI 1TWCJ 3MZYA 2DQLA 5EJCA 1KONA 2COMA 3JTGA 4HX8A 2DCEA 2PI0A 4QIWN 4NC6A 5B5EC 5IT9K 2J5OA 4XK4A 2ELHA 1APLC 3ZN0A 2HDWA 1ETQA 2BY2A 3T8RA 4U87A 1WJEA 3NWTA 2CUFA 2EV6A 4G6DA 2E1NA 1B9MA 4IL6C 4EM2A 2DA1A 3FXKA 1HA8A 3HL2A 2L4MA 3F22A 4U7BA 1UELB 1Y1VJ 3DTIA 3KZIC 3Q3SA 2IA0A 5CJ9A 5L3FA 5KAIC 4RB1A 3FKIJ 3OOUA 4ESFA 4HSTA 3R0AA 1LVKA 2HS5A 3WGGA 4A0ZA 3AL0B 4QLCU 1X4PA 3H1CA 1K83J 4CZCA 1Z9CA 5LEJA 4ON0A 4KMUX 4B44A 4A3MJ 2XB5A 3LOCA 3GTOJ 2XAJA 4JP0A 1B9NA 2FF4A 3BG5A 3ZMVA 3ABUA 3V7CA 1NG6A 5ICGA 3CCEI 2BW3B 2HGCA 2E5NA 2XHKA 4BXUA 3CCMI 3B6AA 1LDKB 3JRAA 1LDDA 3GF2A 5CVVA 3WE3A 1IJWC 4E7HA 2KJCA 3DP7A 4DYQA 2BEOA 2DFIA 1IV6A 1GHCA 4MO7A 3FIWA 2BY0A 3CCQI 5FFZA 2FD5A 4BEHB 4MFEA 3ULQB 4IZZA 3J7AY 3KFWX 1CQTA 3CUQA 5ILVA 3FDYA 3GW2A 2P4WA 4M3EA 3TO7A 1U3EM 1AKHA 1FBSA 4ZJZA 4GCVA 1LEAA 2C6YA 2L9VA 1JUSA 4E70A 2GQQA 2HZTA 2M7AA 2XV4S 2WADA 1K78A 4FETA 2EIJH 2LF7A 1JKPC 2CFOA 3ECHA 4PSXA 1Z6RA 2VT3A 2PEXA 3E6BA 3IAM2 5K5RA 3DPTA 5L3EA 2LH9A 5HDNA 4V19K 2BGCA 3BR2A 3J7YJ 4NDLA 3KZZA 4C3HJ 1ZG1A 1TWGJ 4GO1A 4KUMA 5FGMA 3L2VA 1R9TJ 1R1VA 3BR0A 2DK5A 4IHTA 2JRMA 3OR2C 2VXDA 1V3FA 3ZRGA 1ZRCA 2E1MC 2QEXI 1Z6TA 1U5TA 5BQTA 3BLYA 1LFUP 4BHBA 4KA4A 4Q48A 4XLNF 2VASA 2P5VA 5E79C 2KFDA 2NVYJ 3KEQA 3QYEA 4M9XA 4IHYA 4JYKA 3M8JA 1CF7B 3K4KA 1R5HA 2A68F 4XQFA 2JWTA 3CC7I 1UHMA 5HS7A 3W6JB 3FM3A 4HZFA 3IH3A 1X4OA 3K4NA 1GXQA 1ZGWA 2VLAA 3S1NJ 4GGGA 3TQNA 2V79A 3OYNA 1TT5B 1XC5A 3E3VA 1P9QC 3K2ZA 1POGA 2YU9J 3H5RA 3SQNA 3I59A 1Y8QB 3R61A 3M8EA 4PSWA 5E1WA 3RCOA 1W5CC 3WTZA 5ICFA 2E1CA 3KYLA 3V7SA 3OR1C 1W0TA 2DW4A 4ZDPA 3RKQA 4F7ZA 1O3SA 2P81A 5CPRB 3EUHA 2LR8A 5IYBJ 4XSXF 3RPQA 3HUGB 5B66C 4RAZA 2HOSA 1K4SA 3ZOBA 3ZN1A 1S7OA 2G9WA 3L9FA 5IOZA 1ZK8A 3AKZA 1FLIA 2DOEA 1JGGA 2MC3A 5F0HA 3IH4A 3ESWB 4N4OB 4F52A 2E1OA 4DQ2A 4C2MJ 3HOWJ 2F4MB 1FBUA 4UHTA 3PM1A 3BR5A 3ABMH 3RKYA 1OLTA 2HOAA 1FSEA 1O7FA 3G1MA 4F91B 2AHQA 2LP0A 2FOKA 3HEFA 4RLFA 1E2XA 3MFKA 1UHSA 4G7OF 1T33A 4P5OA 1RI7A 2JPBA 3DV8A 1ZLKA 1OISA 1KU3A 1YG2A 2E2HJ 2H1KA 3K9TA 4B43A 3JAMK 1BR2A 3VDXA 5KNLA 3LFKA 3M1EA 4BL0B 3LSHA 2ETHA 1IW7F 2MH2A 4MIMA 4PUSA 1QA6A 2L9SA 2XASA 1TL8A 1R36A 2RKHA 3JRFA 1ACIA 1MNEA 2DDAA 3JR9A 3I53A 3PNVA 4GYGA 1JKQC 1FOKA 3GMEA 2X48A 3MN2A 2LSOA 5BS6A 1WH5A 5L3BA 4BBSJ 2Z1DA 1D1CA 4HOBA 4WWCA 1OMIA 2M4GA 1MMGA 4YELA 3WHBA 1WWXA 3WTWC 3S2WA 3AFHA 1FIAA 3HIFA 1GT0C 2QENA 2IA1A 3CCYA 1JKRC 2XSJC 4C2TA 4KNYA 2EJRA 1N75A 1P6RA 2VKEA 1Z05A 2CUZA 3IWFA 1VQ5I 3OS2A 3CD6I 4M73A 4EGYA 2D1HA 1X3UA 5JHFA 2CQNA 2QSFX 1HC8A 1B6AA 2NNNA 1YW7A 1K79A 5GAHJ 1ZARA 2R7FA 4PJLA 5EEGA 5CVIA 2FNAA 1VQ4I 2PJRB 2HXIA 3EUAA 4G6QA 4A3EJ 1HF0A 1NHAA 5FD6A 2XF7A 4ZDOA 1SVOA 3FK7A 2JPCA 5E3NA 4CUGA 5EZHA 4B47A 2HOEA 3KE2A 3QODA 3SYTA 4DGWB 4P1WA 3WG9A 1FNNA 1XGSA 4PGGA 5LEKA 4UVAA 4HDUA 1E3HA 4LGWA 4FASD 5M3FJ 1J2XA 2KMUA 5AIQA 4EM0B 2BVMA 2FA5A 2NOJB 1I50J 1KZHA 3MVPA 1HSJA 4NQWB 3ZXSA 1QVUA 2D1VA 5DCMA 4ETSA 2BOLA 2KDZA 3OMYA 4BDZA 2VJIA 3HOSA 3HOUJ 3BCAA 4C9YA 1J7KA 3I71A 2BBYA 1DGWY 3ERMA 1W7PD 5JLWA 3M1CA 2IRFG 3LNQA 5IP9J 5C4JJ 4MQ9F 3GTJJ 1GXPA 1QNTA 5IYCJ 1R58A 4RAGA 2Z2SB 5GPCA 1O3TA 1BIAA 3S32A 3BJ6A 4XOPA 3J80Z 5DEQA 1F36A 1KA8A 4HA8A 3SEQA 2L9RA 2QQAA 3CP2A 2K9MA 3IL2A 4M3GA 2EINH 3I5UA 4Y17A 4EM1A 5HS8A 4RAFA 2JK3A 5HNHA 2GA2A 3W2VA 2B63J 4MTDA 2DDBA 2HVRA 1X3ZB 1IDZA 2XROA 1ZLJA 3MKYB 3G71I 2JA8J 5KCMA 2JZYA 2R7ZJ 2EA2A 5FLVA 3JRBA 1FT9A 4AIDA 1T08B 1YFHA 3BY6A 1LKXA 3WTYC 1WJFA 1BW5A 3RPUA 2GOXB 2DA4A 4II3A 2PFBA 3DKYA 1PYVA 3GWZA 2DT7B 1FTTA 4QTRA 2EWNA 1V54H 4CZZA 6PAXA 3ABTA 3W6KB 2PBIA 1X1CA 4CA0A 3BPVA 2E60A 2PLYA 1Y8RB 4B3AA 4XN3A 1IGNA 1XCBA 1KGSA 4OOIA 1OCRH 1BJAA 3NEUA 2W84A 3S14J 3C2GA
chains in the Genus database with same CATH topology
4FE7A 4XRSG 2L7MP 2XGDA 4AC0A 2VKVA 1TWFJ 4A3DJ 1MH4A 1WPKA 2OF7A 2HYJA 5K7FA 1T56A 2M8GX 2HOTA 5EDNA 1I6HJ 1S7EA 1RESA 1NK3P 2R5YA 4W1UA 1OCTC 4XICA 3IV5A 1QRYA 2VI6A 4QSHA 2NS7A 3K2AA 2FJ1A 1E3OC 1RKTA 2FQ4A 5FKLA 1H8AC 2Y0SN 1TC3C 3GTGJ 1LE8A 3G1OA 2R5YB 1HDPA 2H8RA 4D7NA 5C44J 2K40A 2IAIA 5F27A 2DA2A 4RDUA 1GV5A 3CDLA 3L1PA 1ETYA 2XRLA 4BBRJ 2LVSA 4FCYA 5GPAA 2AO9A 3RQIA 2EZHA 1PUFA 3BTLA 1AKHB 1ZQ3P 2ZB9A 3JRIA 3I4MJ 4DYRA 3S15J 4D7MA 3GTMJ 4FISA 3H0GJ 2TCTA 2WV1A 1AU7A 2TRTA 5BNGA 3JRGA 5E3OA 3NAUA 2ME0A 3IH2A 1ITYA 2NVXJ 3BR3A 3HOYJ 1YRNB 2NS8A 2Y9ZA 3S1QJ 2LLKA 2M9HA 2Y9YA 3O8HA 4MLOA 2GLOA 1MBGA 2JN6A 2QCOA 2D5VA 2DA5A 3S2HJ 3FK6A 4D5CA 1BJZA 3SJMA 1OCPA 4C3IJ 3BQYA 1A5JA 1QPIA 4IHWA 2DMTA 5F1JA 5DS9A 5EEAA 2X6OA 1Y1WJ 1BL0A 2OPTA 2HQ5A 2DTZA 2M34A 2GBYA 4DZJA 2LFBA 5C3EJ 3Q0WA 1TWCJ 1GV2A 2M0CA 2XPWA 1ZR4A 1JT6A 2JA7J 3S1MJ 2DN0A 5EG0B 4QIWN 3LSPA 1ETWA 4XK4A 4L5EA 1APLC 5J1RA 4A3IJ 1ETQA 5J1YA 1O4XA 2CUFA 2IBDA 3FISA 4G12A 1MSFC 4I6ZA 2DA1A 4BY1J 2DMQA 3DEWA 2K9QA 1Y1VJ 3LSGA 5E3MA 3A03A 3Q3SA 4GFBA 2EZIA 2ID3A 3Q0VA 2G0EA 3LSJA 3TW6A 3FKIJ 1RETA 3OOUA 3HBLA 2DMUA 1MBHA 2WAQN 1AHDP 5M5XJ 1K83J 1I3QJ 3BTCA 4M6VA 3OIOA 1HCRA 4M3BA 1NTCA 2QF7A 4A3MJ 4J19A 2XB5A 3LOCA 1U9OA 2L0KA 5IPAA 3GTOJ 2JA6J 4JP0A 2R93J 1FTZA 3JRHA 3BG5A 1X2MA 5J3LA 3F0CA 3HGGA 1MBJA 2EQRA 2NOGA 5EGOA 3B6AA 1FIPA 3JRAA 3S1RJ 4CYCA 1IJWC 4DYQA 1IV6A 4MO7A 3FIWA 5F0FA 4A3GJ 1DU6A 4MFDA 2FD5A 3ZQHA 1JKOC 4MFEA 3HOVJ 5F04A 2X9DA 1CQTA 2O7OA 1F43A 1X2NA 3QQAA 2JMWA 5EGOB 2MGQA 5J1UA 4A3LJ 4CYCB 4M3EA 2L7ZA 1HDDC 4AYBN 3A02A 1AKHA 5K7HA 1JUSA 5HODA 3HGYA 3HB9A 3GTQJ 2DA3A 2GM4A 2HXOA 1JTYA 5C4XJ 2ECBA 1JKPC 3QPLA 3S2DJ 2ECCA 4FE4A 1IC8A 1U9NA 2HI3A 4W97A 2VPRA 2IEKA 1U8BA 4UUSA 1YRNA 5F0CA 4M3DA 3BR2A 4DW6A 3TEDA 4NDLA 3BR6A 4C3HJ 3OSFA 1P7JA 2LY9A 1TWGJ 2R0QC 1JT0A 4IEJA 1R9TJ 3BR0A 3BG9A 2DMNA 2CUEA 4A3KJ 4JX4A 4DZPA 4BY7J 3ZQFA 5FLMJ 4UUSB 2CQXA 1GUUA 1LFUP 3S16J 2MG4A 4EEFG 1JUPA 4A3BJ 2O8KA 1D5YA 2NVYJ 4IHYA 3BT9A 4JYKA 2K9SA 1IDYA 2JWTA 3ZQLA 1Z0XA 3IH3A 2E2JJ 2XPUA 4HNVA 5JLXA 1ZGWA 4JX6A 3S1NJ 5FKOA 5EG0A 4RBOA 2EBIA 2XGCA 1XC5A 1ZTRA 3RKQA 1JUMA 5FKMA 2JJ7A 1POGA 3HKZN 3BTIA 5M5YJ 2YU9J 1ORKA 3M4OJ 2PMZN 2KT0A 3A01B 3JRCA 5EZGA 1W0TA 1NK2P 3NARA 4A69C 2P81A 1P7IA 2LR8A 1WI3A 5IYBJ 1B8IA 5IOYA 2E2IJ 3PO2J 2Y31A 2HOSA 3ZOBA 4DYCA 4C3JJ 2DJNA 5IOZA 3CQZJ 1ZK8A 2R92J 2MW8A 5FKKA 4A3JJ 1JGGA 4Y52J 5F0HA 3IH4A 2E1OA 3GTPJ 4C2MJ 4XIDA 1B8IB 1Z77A 2JA5J 3HOWJ 3RZOJ 3PM1A 3BR5A 1XS9A 2HOAA 3G1MA 1HLVA 2NVTJ 2NVQJ 2AHQA 1H89C 1H88C 2LP0A 3HEFA 4UUTA 3O8GA 1UHSA 1X58A 1T33A 3OSGA 1HOMA 5F08A 1ETKA 3SFIA 4LOCA 1IUFA 3H3VK 1LFBA 2DA7A 1WCMJ 2H1KA 2E2HJ 5EYRA 4ABZA 1ETVA 2LD5A 2YS9A 4MIMA 3BTJA 1BA5A 3JRFA 2MSYA 3JR9A 1JKQC 2EH3A 3DCFA 2X48A 3MN2A 3LSRA 3ZQCA 1WH5A 5M3MJ 2Y30A 4D5FA 4BBSJ 2CQQA 1ZR2A 2VUMJ 3PO3J 3M3YJ 4BKXA 1SFOJ 4X1EA 3C2BA 2R5ZB 3WHBA 4XRMA 1MSEC 2XGEA 1FIAA 2COBA 1GT0C 2LK2A 3CCYA 3S17J 5IP7J 2EZLA 3WHCA 1JKRC 2DMPA 2N8GA 3HDDA 2VKEA 3ZQGA 4FTHA 3QPSA 1U78A 1BW6A 2XB0X 1IG7A 2FX0A 3D1NI 1QVTA 2RAEA 4M3FA 1RKWA 2HXIA 5EF6A 4A3EJ 2DA6A 5IP6A 1HF0A 4A93J 2ME6A 4B4CA 1FEXA 5E3LA 3Q0UA 5M5WJ 3FK7A 1A6IA 2YUSA 5E3NA 1RPWA 5EZHA 1LE8B 4AUXA 3I4NJ 3E7LA 2EZKA 1JJ8C 2W48A 1B72A 4A3CJ 2XPVA 4I76A 1TWAJ 4X6AJ 5K7ZA 1K61A 5M3FJ 1MBKA 2M2EA 1EF4A 1WH7A 1I50J 2L7FP 3MVPA 3K7AJ 3A01A 3JREA 1PUFB 1WGXA 1QVUA 2E19A 1B72B 2KDZA 1XG1A 3GTKJ 1GVDA 3BG3A 3HOUJ 4IHXA 3VPRA 1ETXA 3TW7A 3W6VA 1ETOA 3MKLA 3HM5A 2HDDA 2CU7A 1MBFA 5DTDA 5IYDJ 5JLWA 3TP3A 3SDGA 3LNQA 5IP9J 1TWHJ 1W0UA 1ZKGA 3BR1A 5C4JJ 3S14J 3GTJJ 5IYCJ 1UG2A 4Y7NJ 5GPCA 2LTPA 2ELKA 3GTLJ 4JX5A 3RZDJ 3HOZJ 1F36A 4IHVA 1SANA 2L9RA 2WB1N 4M3GA 2ID6A 1FJLA 2LKXA 2JK3A 1DU0A 2O9LA 2B63J 1ENHA 1Q1VA 1IDZA 3G1LA 1MH3A 3CMYA 3BQZA 3ZQIA 5GP9A 2JA8J 3UKGA 3HOXJ 2R7ZJ 5FLVA 9ANTA 2CRGA 3JRBA 1OJLA 1OFCX 3TP0A 1BW5A 1VF9A 4XRSA 3JRDA 2DA4A 4V2FA 1G2HA 4V2GA 1FTTA 1MBEA 1GDTA 4QTRA 1JTXA 1VFCA 2K9NA 5FJ8J 1JJ6C 1IRZA 4BXXJ 1UMQA 5FKNA 1RR7A 1VI0A 4B3AA 2XSDC 4A3FJ 1IGNA 3B6CA 2CJJA 2Y2ZA 2I10A 2R5ZA 3GBGA 1VNDA 4B1RA 1MNMC 4S0HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FE7 A;  4XRS G;  2L7M P;  2XGD A;  4AC0 A;  2VKV A;  1TWF J;  4A3D J;  1MH4 A;  1WPK A;  2OF7 A;  2HYJ A;  5K7F A;  1T56 A;  2M8G X;  2HOT A;  5EDN A;  1I6H J;  1S7E A;  1RES A;  1NK3 P;  2R5Y A;  4W1U A;  1OCT C;  4XIC A;  3IV5 A;  1QRY A;  2VI6 A;  4QSH A;  2NS7 A;  3K2A A;  2FJ1 A;  1E3O C;  1RKT A;  2FQ4 A;  5FKL A;  1H8A C;  2Y0S N;  1TC3 C;  3GTG J;  1LE8 A;  3G1O A;  2R5Y B;  1HDP A;  2H8R A;  4D7N A;  5C44 J;  2K40 A;  2IAI A;  5F27 A;  2DA2 A;  4RDU A;  1GV5 A;  3CDL A;  3L1P A;  1ETY A;  2XRL A;  4BBR J;  2LVS A;  4FCY A;  5GPA A;  2AO9 A;  3RQI A;  2EZH A;  1PUF A;  3BTL A;  1AKH B;  1ZQ3 P;  2ZB9 A;  3JRI A;  3I4M J;  4DYR A;  3S15 J;  4D7M A;  3GTM J;  4FIS A;  3H0G J;  2TCT A;  2WV1 A;  1AU7 A;  2TRT A;  5BNG A;  3JRG A;  5E3O A;  3NAU A;  2ME0 A;  3IH2 A;  1ITY A;  2NVX J;  3BR3 A;  3HOY J;  1YRN B;  2NS8 A;  2Y9Z A;  3S1Q J;  2LLK A;  2M9H A;  2Y9Y A;  3O8H A;  4MLO A;  2GLO A;  1MBG A;  2JN6 A;  2QCO A;  2D5V A;  2DA5 A;  3S2H J;  3FK6 A;  4D5C A;  1BJZ A;  3SJM A;  1OCP A;  4C3I J;  3BQY A;  1A5J A;  1QPI A;  4IHW A;  2DMT A;  5F1J A;  5DS9 A;  5EEA A;  2X6O A;  1Y1W J;  1BL0 A;  2OPT A;  2HQ5 A;  2DTZ A;  2M34 A;  2GBY A;  4DZJ A;  2LFB A;  5C3E J;  3Q0W A;  1TWC J;  1GV2 A;  2M0C A;  2XPW A;  1ZR4 A;  1JT6 A;  2JA7 J;  3S1M J;  2DN0 A;  5EG0 B;  4QIW N;  3LSP A;  1ETW A;  4XK4 A;  4L5E A;  1APL C;  5J1R A;  4A3I J;  1ETQ A;  5J1Y A;  1O4X A;  2CUF A;  2IBD A;  3FIS A;  4G12 A;  1MSF C;  4I6Z A;  2DA1 A;  4BY1 J;  2DMQ A;  3DEW A;  2K9Q A;  1Y1V J;  3LSG A;  5E3M A;  3A03 A;  3Q3S A;  4GFB A;  2EZI A;  2ID3 A;  3Q0V A;  2G0E A;  3LSJ A;  3TW6 A;  3FKI J;  1RET A;  3OOU A;  3HBL A;  2DMU A;  1MBH A;  2WAQ N;  1AHD P;  5M5X J;  1K83 J;  1I3Q J;  3BTC A;  4M6V A;  3OIO A;  1HCR A;  4M3B A;  1NTC A;  2QF7 A;  4A3M J;  4J19 A;  2XB5 A;  3LOC A;  1U9O A;  2L0K A;  5IPA A;  3GTO J;  2JA6 J;  4JP0 A;  2R93 J;  1FTZ A;  3JRH A;  3BG5 A;  1X2M A;  5J3L A;  3F0C A;  3HGG A;  1MBJ A;  2EQR A;  2NOG A;  5EGO A;  3B6A A;  1FIP A;  3JRA A;  3S1R J;  4CYC A;  1IJW C;  4DYQ A;  1IV6 A;  4MO7 A;  3FIW A;  5F0F A;  4A3G J;  1DU6 A;  4MFD A;  2FD5 A;  3ZQH A;  1JKO C;  4MFE A;  3HOV J;  5F04 A;  2X9D A;  1CQT A;  2O7O A;  1F43 A;  1X2N A;  3QQA A;  2JMW A;  5EGO B;  2MGQ A;  5J1U A;  4A3L J;  4CYC B;  4M3E A;  2L7Z A;  1HDD C;  4AYB N;  3A02 A;  1AKH A;  5K7H A;  1JUS A;  5HOD A;  3HGY A;  3HB9 A;  3GTQ J;  2DA3 A;  2GM4 A;  2HXO A;  1JTY A;  5C4X J;  2ECB A;  1JKP C;  3QPL A;  3S2D J;  2ECC A;  4FE4 A;  1IC8 A;  1U9N A;  2HI3 A;  4W97 A;  2VPR A;  2IEK A;  1U8B A;  4UUS A;  1YRN A;  5F0C A;  4M3D A;  3BR2 A;  4DW6 A;  3TED A;  4NDL A;  3BR6 A;  4C3H J;  3OSF A;  1P7J A;  2LY9 A;  1TWG J;  2R0Q C;  1JT0 A;  4IEJ A;  1R9T J;  3BR0 A;  3BG9 A;  2DMN A;  2CUE A;  4A3K J;  4JX4 A;  4DZP A;  4BY7 J;  3ZQF A;  5FLM J;  4UUS B;  2CQX A;  1GUU A;  1LFU P;  3S16 J;  2MG4 A;  4EEF G;  1JUP A;  4A3B J;  2O8K A;  1D5Y A;  2NVY J;  4IHY A;  3BT9 A;  4JYK A;  2K9S A;  1IDY A;  2JWT A;  3ZQL A;  1Z0X A;  3IH3 A;  2E2J J;  2XPU A;  4HNV A;  5JLX A;  1ZGW A;  4JX6 A;  3S1N J;  5FKO A;  5EG0 A;  4RBO A;  2EBI A;  2XGC A;  1XC5 A;  1ZTR A;  3RKQ A;  1JUM A;  5FKM A;  2JJ7 A;  1POG A;  3HKZ N;  3BTI A;  5M5Y J;  2YU9 J;  1ORK A;  3M4O J;  2PMZ N;  2KT0 A;  3A01 B;  3JRC A;  5EZG A;  1W0T A;  1NK2 P;  3NAR A;  4A69 C;  2P81 A;  1P7I A;  2LR8 A;  1WI3 A;  5IYB J;  1B8I A;  5IOY A;  2E2I J;  3PO2 J;  2Y31 A;  2HOS A;  3ZOB A;  4DYC A;  4C3J J;  2DJN A;  5IOZ A;  3CQZ J;  1ZK8 A;  2R92 J;  2MW8 A;  5FKK A;  4A3J J;  1JGG A;  4Y52 J;  5F0H A;  3IH4 A;  2E1O A;  3GTP J;  4C2M J;  4XID A;  1B8I B;  1Z77 A;  2JA5 J;  3HOW J;  3RZO J;  3PM1 A;  3BR5 A;  1XS9 A;  2HOA A;  3G1M A;  1HLV A;  2NVT J;  2NVQ J;  2AHQ A;  1H89 C;  1H88 C;  2LP0 A;  3HEF A;  4UUT A;  3O8G A;  1UHS A;  1X58 A;  1T33 A;  3OSG A;  1HOM A;  5F08 A;  1ETK A;  3SFI A;  4LOC A;  1IUF A;  3H3V K;  1LFB A;  2DA7 A;  1WCM J;  2H1K A;  2E2H J;  5EYR A;  4ABZ A;  1ETV A;  2LD5 A;  2YS9 A;  4MIM A;  3BTJ A;  1BA5 A;  3JRF A;  2MSY A;  3JR9 A;  1JKQ C;  2EH3 A;  3DCF A;  2X48 A;  3MN2 A;  3LSR A;  3ZQC A;  1WH5 A;  5M3M J;  2Y30 A;  4D5F A;  4BBS J;  2CQQ A;  1ZR2 A;  2VUM J;  3PO3 J;  3M3Y J;  4BKX A;  1SFO J;  4X1E A;  3C2B A;  2R5Z B;  3WHB A;  4XRM A;  1MSE C;  2XGE A;  1FIA A;  2COB A;  1GT0 C;  2LK2 A;  3CCY A;  3S17 J;  5IP7 J;  2EZL A;  3WHC A;  1JKR C;  2DMP A;  2N8G A;  3HDD A;  2VKE A;  3ZQG A;  4FTH A;  3QPS A;  1U78 A;  1BW6 A;  2XB0 X;  1IG7 A;  2FX0 A;  3D1N I;  1QVT A;  2RAE A;  4M3F A;  1RKW A;  2HXI A;  5EF6 A;  4A3E J;  2DA6 A;  5IP6 A;  1HF0 A;  4A93 J;  2ME6 A;  4B4C A;  1FEX A;  5E3L A;  3Q0U A;  5M5W J;  3FK7 A;  1A6I A;  2YUS A;  5E3N A;  1RPW A;  5EZH A;  1LE8 B;  4AUX A;  3I4N J;  3E7L A;  2EZK A;  1JJ8 C;  2W48 A;  1B72 A;  4A3C J;  2XPV A;  4I76 A;  1TWA J;  4X6A J;  5K7Z A;  1K61 A;  5M3F J;  1MBK A;  2M2E A;  1EF4 A;  1WH7 A;  1I50 J;  2L7F P;  3MVP A;  3K7A J;  3A01 A;  3JRE A;  1PUF B;  1WGX A;  1QVU A;  2E19 A;  1B72 B;  2KDZ A;  1XG1 A;  3GTK J;  1GVD A;  3BG3 A;  3HOU J;  4IHX A;  3VPR A;  1ETX A;  3TW7 A;  3W6V A;  1ETO A;  3MKL A;  3HM5 A;  2HDD A;  2CU7 A;  1MBF A;  5DTD A;  5IYD J;  5JLW A;  3TP3 A;  3SDG A;  3LNQ A;  5IP9 J;  1TWH J;  1W0U A;  1ZKG A;  3BR1 A;  5C4J J;  3S14 J;  3GTJ J;  5IYC J;  1UG2 A;  4Y7N J;  5GPC A;  2LTP A;  2ELK A;  3GTL J;  4JX5 A;  3RZD J;  3HOZ J;  1F36 A;  4IHV A;  1SAN A;  2L9R A;  2WB1 N;  4M3G A;  2ID6 A;  1FJL A;  2LKX A;  2JK3 A;  1DU0 A;  2O9L A;  2B63 J;  1ENH A;  1Q1V A;  1IDZ A;  3G1L A;  1MH3 A;  3CMY A;  3BQZ A;  3ZQI A;  5GP9 A;  2JA8 J;  3UKG A;  3HOX J;  2R7Z J;  5FLV A;  9ANT A;  2CRG A;  3JRB A;  1OJL A;  1OFC X;  3TP0 A;  1BW5 A;  1VF9 A;  4XRS A;  3JRD A;  2DA4 A;  4V2F A;  1G2H A;  4V2G A;  1FTT A;  1MBE A;  1GDT A;  4QTR A;  1JTX A;  1VFC A;  2K9N A;  5FJ8 J;  1JJ6 C;  1IRZ A;  4BXX J;  1UMQ A;  5FKN A;  1RR7 A;  1VI0 A;  4B3A A;  2XSD C;  4A3F J;  1IGN A;  3B6C A;  2CJJ A;  2Y2Z A;  2I10 A;  2R5Z A;  3GBG A;  1VND A;  4B1R A;  1MNM C;  4S0H B; 
#chains in the Genus database with same CATH topology
 4FE7 A;  4HX7 A;  2CG4 A;  2K9L A;  2VKV A;  4LLL A;  1TWF J;  1VQ8 I;  2OF7 A;  3VYS B;  2HYJ A;  4HNT A;  2ZBK A;  2F6C A;  3F6V A;  3W3C A;  4CCN A;  1YJW I;  5J4V A;  1RES A;  5KHD A;  2X6Y A;  3KPH A;  2R5Y A;  1OCT C;  4QSH A;  5LLQ A;  2O0Y A;  5D5V B;  4HRI A;  2OZU A;  1YHQ I;  2VQH A;  2WV0 A;  2FQ4 A;  1DUX C;  4A2U A;  1VZ0 A;  1W5S A;  4IF4 A;  1DP7 P;  2L54 A;  3C1D A;  3TGN A;  3CCJ I;  3WTV C;  1D8K A;  2LDU A;  1D0Z A;  2VJ4 A;  1IXC A;  4A12 A;  1YIJ I;  3COA C;  3P5J A;  1KU9 A;  2K4J A;  2Y48 A;  3CDL A;  1UFM A;  3DTE A;  3LQR A;  1E17 A;  2LVS A;  4FCY A;  2CV2 A;  2EB7 A;  3ZR8 X;  4WXH A;  2ELJ A;  2MH9 A;  3BTL A;  1AKH B;  3K0L A;  3PFI A;  4IOC F;  3PNT A;  2AS5 F;  3JRI A;  1SFK A;  2BVL A;  4OIO F;  4YG2 F;  2EFP A;  5H2F C;  4IXA A;  3GEZ A;  3W2A A;  3S15 J;  4FIS A;  2TCT A;  3MQ0 A;  1AU7 A;  2TRT A;  4FQG A;  2KIF A;  2Q1Z B;  5FLX Z;  3NAU A;  3CJN A;  3OYI A;  3CCV I;  2M1B A;  3HOY J;  2VKD A;  3S1Q J;  2M87 A;  2YPR A;  1W7P A;  2LLK A;  3N97 A;  1FPQ A;  3O8H A;  2ISZ A;  3K4M A;  4MLO A;  1Y6I A;  3ROU A;  2R7T A;  5EEH A;  3IHU A;  1IAW A;  3D0S A;  3EYY A;  4D5C A;  5DD4 A;  4RGU A;  1KQ8 A;  1OCP A;  2QQB A;  3CF2 A;  5HS9 A;  2KIU A;  2UWM A;  2CO5 A;  1PJR A;  3FM5 A;  2DMT A;  1K6O A;  1B59 A;  5F1J A;  4RA2 A;  2X6O A;  5HDK A;  3BZK A;  2P7V B;  3E5Q A;  4UNO A;  2W82 A;  4X0G A;  3R0J A;  2O03 A;  1STZ A;  2M34 A;  2GBY A;  3G6E I;  2LFB A;  1HXD A;  4D0P A;  2EIL H;  1O3Q A;  1FOY A;  1LUJ B;  2BXZ A;  2XPW A;  1ZR4 A;  5J6X A;  2I5U A;  2WBM A;  4O5V A;  2XKO A;  2V1N A;  2DN0 A;  4ENN A;  3OS0 A;  2JA7 J;  1REP C;  3S1M J;  4E7I A;  3H5A A;  1ETW A;  1N77 A;  1PDN C;  5J1R A;  2Z9O A;  3I59 B;  4M72 A;  2NVU B;  2QKL B;  5J1Y A;  2VQG A;  2X1E A;  3WTX C;  4QPO A;  1LDJ A;  4G12 A;  2Y75 A;  1MSF C;  4UVB A;  3DLA A;  1TLH B;  1P92 A;  2DMQ A;  3FXU A;  4OMZ A;  3DEW A;  1R6R A;  2K9Q A;  4PZJ A;  1MJ9 A;  3LSG A;  1RUN A;  3BJA A;  2EZI A;  2ID3 A;  3L2W A;  2O3F A;  3LSJ A;  3TW6 A;  2EV5 A;  3HXL A;  2DMU A;  1MBH A;  1TP4 A;  1Y0U A;  2XAG A;  2QWW A;  1BBY A;  1OCO H;  5LHH A;  1XTA A;  4I02 A;  3P9C A;  3BTC A;  2RDP A;  4M3B A;  3CC2 I;  3TO6 A;  3LQQ A;  3FF5 A;  2QF7 A;  4ZYA A;  4BU2 A;  5IPA A;  5D4R A;  2R93 J;  1OQY A;  4M9Z A;  3KLO A;  2Y0S A;  3GO5 A;  3LL7 A;  1X2M A;  1XGO A;  3MKZ A;  1RIO H;  1MBJ A;  3ZMS A;  2EQR A;  2NOG A;  5EGO A;  1IV8 A;  1FIP A;  1DP3 A;  4BUP A;  2O6G E;  4A3G J;  1DU6 A;  4MFD A;  5F04 A;  2X9D A;  2X6W A;  2O7O A;  2P5L C;  1F43 A;  1LJ9 A;  4LJZ F;  2JMW A;  3BP8 A;  5J1U A;  4CYC B;  1HDD C;  4HPQ A;  4AYB N;  4PK4 A;  1D0X A;  2Y0M A;  5K7H A;  1Z7L A;  2R4G A;  1I39 A;  1VQ7 I;  2GM4 A;  1UST A;  1X3W B;  4HF0 A;  2P6S A;  3GLX A;  1ZAO A;  4E7Z A;  3QPL A;  4CH7 A;  3K1N A;  3S2D J;  3P9I A;  4FE4 A;  1ODD A;  2HI3 A;  4W97 A;  2K02 A;  4UUS A;  1YRN A;  2K3P A;  4BH9 A;  4M3D A;  2RV8 A;  3RKX A;  1T95 A;  1HKS A;  2JVG A;  2ZME A;  3BR6 A;  3TED A;  2IS4 A;  1P7J A;  4IQ4 A;  1FMW A;  5HLI A;  5D8L B;  2QSG X;  4KT5 C;  3U21 A;  2VBW A;  2W85 A;  2MLG A;  3BG9 A;  2DMN A;  4HG2 A;  2W00 A;  4MEY F;  4I0A A;  4EMS A;  4BY7 J;  2CQX A;  3SZP A;  2MG4 A;  4EEF G;  2FUG 2;  4BAY A;  1OPC A;  4BE2 A;  2DYS H;  2VOP A;  2DFF A;  4XOT A;  4XN0 A;  2W24 A;  4J01 A;  1G6N A;  2K9S A;  1X1A A;  4AM3 A;  2XAU A;  1IN7 A;  2DO7 A;  3OYE A;  1K7A A;  3A1Y A;  2E2J J;  2V9K A;  2XPU A;  1HW5 A;  5JLX A;  5LHI A;  4IRG A;  3K6G A;  5FKO A;  1DGR M;  4CCJ A;  4ZYD A;  5EG0 A;  4RBO A;  2EBI A;  3CO6 C;  3CP8 A;  4F93 B;  1WJA A;  1ZTR A;  2QLZ A;  4RM3 A;  1BM9 A;  2XDV A;  3FHZ A;  2MYS A;  3ELK A;  1EJ9 A;  5HOO A;  1XDU A;  3ECO A;  1T8I A;  3GXO A;  3JRC A;  5CYV A;  1JI8 A;  1HKT A;  1MND A;  3U1K A;  4IVN A;  1HW1 A;  2K86 A;  3NAR A;  1TW3 A;  3OYL A;  5D5X B;  2H6B A;  2Q2E B;  1KQ0 A;  4YII A;  4WF2 A;  1M1E B;  4I09 A;  3BOQ A;  5IOY A;  2E2I J;  5H6Q A;  2CMP A;  4IRI A;  5TGT A;  4C3J J;  1B1B A;  4F3Q A;  2CQ7 A;  1UZC A;  4WXD A;  2KRH A;  2NS0 A;  5FKK A;  3FBI B;  1G59 A;  2XAF A;  1BI3 A;  3GTP J;  4C2U A;  3SFZ A;  1TQP A;  4YIR X;  4XID A;  4LB6 B;  1B8I B;  2ZFU A;  2JA5 J;  2UXX A;  2LG4 A;  2XRN A;  4CGZ A;  1U6G A;  3RSN A;  4MEX F;  3RKW A;  1MMS A;  2F2E A;  5ICC A;  3O8G A;  4PFP A;  4I99 C;  2IJL A;  2Z16 A;  1A31 A;  3ERE D;  2QA4 I;  4P96 A;  3SFI A;  2VBX A;  1J5Y A;  1ULY A;  4DBR A;  2DA7 A;  1WQ2 A;  2G7H A;  3ZP5 A;  4ABZ A;  2WY8 Q;  5GTH C;  5CVU A;  2HQN A;  3PSI A;  4BHP A;  1U2W A;  4FX0 A;  3U2R A;  3R6S A;  5IT9 Z;  2ZXJ A;  2LNB A;  4L9T A;  5AON A;  3MWM A;  2MD0 A;  1G3Y A;  2V26 A;  1MDM A;  4I2O A;  3ZMT A;  2EH3 A;  4WX9 A;  2DFH A;  3K10 A;  3LSR A;  2UZK A;  1JE8 A;  1A35 A;  3WTU C;  2IT0 A;  3LA7 A;  4PJ0 C;  1XMA A;  2DT5 A;  3NRV A;  3SEZ A;  4D5F A;  4XBF A;  4DNC A;  3I54 A;  2DBB A;  3M3Y J;  4BKX A;  4M74 A;  4X1E A;  1OR7 C;  3C2B A;  2K27 A;  2OUM A;  4HX4 A;  4EGZ A;  4XRM A;  1AOY A;  1R7J A;  2A5W A;  4BS9 A;  1E3P A;  1SMT A;  2COB A;  2LK2 A;  4RB3 C;  1WVR A;  2EZL A;  3WHC A;  3HPH A;  4EJW A;  2N8G A;  4HQE A;  3GYH X;  2IA2 A;  5GTI C;  3W2W A;  1BW6 A;  2JVH A;  2LBF A;  4E7K A;  2L01 A;  1O57 A;  5IT3 A;  1I1S A;  3D1N I;  3CCS I;  1VQP I;  3H36 A;  3DBR B;  1Z7U A;  2RAE A;  2EFO A;  1WHU A;  2XF5 A;  3KX2 A;  3VOD A;  2VJ5 A;  5JVG F;  2ZC2 A;  5IP6 A;  2ME6 A;  3CMM A;  2GA1 A;  5E3L A;  3Q0U A;  2DT6 A;  4BAC A;  2YUS A;  3AL0 C;  4YEJ A;  4UVC A;  2B7E A;  5D5U B;  4GRI A;  4PJJ A;  1S72 I;  5D4S A;  1RPW A;  3I4N J;  3DPL C;  4ITV A;  1OCZ H;  4I7H A;  2EZK A;  1FC3 A;  3DEU A;  3EPZ A;  4WK8 F;  1EKE A;  2HPM A;  1B72 A;  1WZ2 A;  4X6A J;  1IN4 A;  1SFE A;  1ZG5 A;  5FO5 A;  2GOM A;  2X85 A;  3CF5 F;  3MEX A;  2PMZ A;  3SZG A;  3ZQQ A;  4ESJ A;  4ZTJ A;  4Q4Z F;  3RYR A;  1EF4 A;  2KRC A;  2L7F P;  3A01 A;  2QUF A;  1WGX A;  2X1D A;  3GTK J;  4O3M A;  1H0M A;  1ETX A;  2DPU A;  4XKC A;  2A5Y B;  2DOF A;  1I3A A;  3TW7 A;  3W6V A;  3EDP A;  3CDI A;  1G4D A;  5DTD A;  3TP3 A;  3HOT A;  1XSD A;  2LRD A;  5CLS A;  3WG7 H;  1W0U A;  1W7P B;  1I1G A;  1YI2 I;  3T5X A;  5B3S H;  4Y7N J;  2L2O A;  2LTP A;  3BDD A;  2ELK A;  2NAZ A;  1WFX A;  4JX5 A;  3HOZ J;  1T98 A;  4NUB A;  2ZCW A;  4N4N B;  2ID6 A;  3K70 D;  1FJL A;  1C0W A;  1SVM A;  5LD2 C;  2OCC H;  4LIV A;  4M9S A;  2ZXW H;  2VOO A;  1DU0 A;  2CFX A;  1ENH A;  2NYX A;  2CW8 A;  2E36 A;  2HVS A;  1XDS A;  3WTS C;  2IGO A;  3FXR A;  2IS1 A;  3UKG A;  2WC2 A;  3OYB A;  3FHN A;  1IRF A;  3S8P A;  3DPU A;  3CMA I;  3D5L A;  2L02 A;  1LFP A;  4XLA A;  4ZYE A;  3J81 K;  1XGM A;  3TP0 A;  5DUI A;  3KYD B;  1UB9 A;  2VQC A;  3MD2 A;  3JRD A;  2B9S A;  4V2F A;  2R7S A;  1G2H A;  4V2G A;  3V8L A;  2OV7 A;  2K9N A;  2LKS A;  3DF8 A;  3RPU D;  4BXX J;  1IUY A;  1ZN2 A;  1UMQ A;  3EET A;  3GCM A;  2EV0 A;  2FOW A;  2UV1 A;  5FKN A;  1FOW A;  1RR7 A;  2R7O A;  2XSD C;  4A3F J;  3DQV C;  1PUE E;  2CJJ A;  2EIM H;  4ZDL A;  1WJD A;  2HR3 A;  2BXY A;  2K5C A;  2XVC A;  3GBG A;  3L7W A;  3RIR A;  4IJA A;  4L5J A;  1D8J A;  4S0H B;  3M4O J;  5LHG A;  2PN6 A;  3OYH A;  2HYF A;  3S93 A;  5JR3 A;  1WPK A;  4OU0 A;  1WSU A;  5K7F A;  1T56 A;  2M8G X;  3OYD A;  3BG6 A;  1Z3Y A;  3F9K A;  4XKB A;  2RRE A;  1R4N B;  1RZ4 A;  2O8X A;  2F5D A;  2ZNZ A;  2VI6 A;  3WU2 C;  2NS7 A;  3K2A A;  3D5S C;  3PFY A;  4HF1 A;  3VYR B;  2HKX A;  2CQK A;  3V42 A;  4YFK F;  1A36 A;  5FKL A;  1H8A C;  2Y0S N;  1IRX A;  2DYR H;  1YQA A;  1QQI A;  1T0F C;  1LE8 A;  1FMV A;  2K40 A;  3JAM Z;  4UV9 A;  5DV5 A;  4RDU A;  4LG3 A;  1IN8 A;  2B0L A;  3L1P A;  1ETY A;  4CDG A;  2MLK A;  1FY7 A;  4BBR J;  4XLC A;  3KEO A;  2EZH A;  2M45 A;  5CVR A;  2VBY A;  2VON A;  5KVR A;  2ZB9 A;  3TDZ C;  2A3S A;  4UY8 I;  2H27 A;  2NRA C;  3FXM A;  4LD5 A;  1XN7 A;  2KLO A;  2ME0 A;  4AD9 A;  3TOB A;  2VKH A;  2NVX J;  1ITY A;  3ISP A;  1YOV B;  1YRN B;  2NS8 A;  2QBY A;  1IZ1 A;  2F5F A;  5E18 F;  2ZME B;  2R7Q A;  4UXN A;  3U9G A;  3F8B A;  2D5V A;  4XLF A;  1Y39 A;  2WWY A;  2DA5 A;  3PIP F;  2VT2 A;  2YX4 A;  5CKT A;  3QYF A;  4MQV A;  4G7H F;  1KQ9 A;  1QPI A;  2FSW A;  3SHF A;  5DS9 A;  3KP2 A;  2BE5 F;  1BL0 A;  1O7L A;  4XR6 A;  3I9V 2;  4MTE A;  1PP8 F;  4OIP F;  2X51 A;  1OR7 A;  2CW0 F;  4Y3O A;  1XCV A;  4F55 A;  2FBH A;  1I5Z A;  2IPQ X;  4KIT B;  2JUG A;  5FRN A;  1GV2 A;  4LLN A;  1JT6 A;  4LK0 F;  5EG0 B;  2HU9 A;  4PJM A;  3LSP A;  2X0L A;  5LBQ A;  4L5E A;  1V4R A;  2VN2 A;  5B1A H;  3GZN B;  2PQ8 A;  2OD5 A;  4WCG A;  2O61 A;  3GFL A;  3FIS A;  2L4A A;  1IF1 A;  3ZMD A;  1X1P A;  4MHG A;  4BY1 J;  2WY7 Q;  1S6L A;  2HTJ A;  5E3M A;  3A03 A;  2HQA A;  1SFU A;  4BE0 A;  3ML6 A;  3HBL A;  4Y33 A;  5D5W B;  5LFA A;  1OKR A;  3FBN B;  1AHD P;  3L09 A;  5M5X J;  1I3Q J;  4M6V A;  3OIO A;  1HCR A;  2F4I A;  2X1C A;  3WU0 A;  4J19 A;  2E7X A;  1U9O A;  1SMY F;  2L0K A;  2K4B A;  2FMY A;  5KK1 A;  4AIH A;  4E6K G;  5HNF A;  3JRH A;  3FZV A;  2R7D A;  1XB4 A;  2KZG A;  3C3W A;  5ILS A;  4BEH A;  4BHC A;  3IKT A;  5J3L A;  2IP2 A;  3H92 A;  4A0Y A;  2XAH A;  1JHH A;  4YFN F;  2BV6 A;  3OL4 A;  4OWR B;  3U1D A;  3OIP A;  4G6T B;  4L9J A;  2UXN A;  2JRT A;  2D2W A;  5F0F A;  1VQ6 I;  2AQF A;  3ZQH A;  5DUK A;  2FBI A;  1X2N A;  1DPU A;  2JQ7 A;  3QQA A;  2P6T A;  1YIT I;  2FE3 A;  4A3L J;  3AG2 H;  2ISY A;  2Z99 A;  2L7Z A;  4H4K C;  4CCL A;  3UR3 C;  3CCR I;  5HDG A;  1HBX G;  3QOP A;  1EA3 A;  2CUJ A;  2BHZ A;  3O6B B;  3FMS A;  5KAF C;  1EH6 A;  5HOD A;  2V1X A;  3HGY A;  1SD4 A;  3HB9 A;  4CO8 A;  3GTQ J;  1TBX A;  1JTY A;  3GZ5 A;  2XUB A;  2FML A;  2IGM A;  1RRJ A;  3CUQ B;  3ZQ7 A;  4NC7 A;  1SD5 A;  2DI3 A;  3KLN A;  1U9N A;  2E35 A;  1YX3 A;  5F0C A;  3OSF A;  1K78 B;  4KDP A;  1BIB A;  5E1Z B;  1FP2 A;  4L9V A;  4Y15 A;  1JT0 A;  3CES A;  3GZ6 A;  4TV7 A;  2K7L A;  3HTS B;  1CF7 A;  1HW2 A;  2QQ8 A;  4JX4 A;  4DZP A;  1WI9 A;  2L5Q A;  1QZE A;  2LBF B;  2JSP A;  4MNU A;  1A6Q A;  1TZL A;  3S16 J;  4B8X A;  2KDO A;  1SD6 A;  4GXO A;  5E20 A;  2O8K A;  4A3B J;  2H94 A;  3L2Q A;  2A61 A;  4L5I A;  2YSR A;  2CW7 A;  4R79 A;  3BT9 A;  3EQL F;  3TBI A;  4RMN A;  3WGI A;  2VIX A;  1U5T B;  1P2F A;  1Z0X A;  2Z3Y A;  4YFX F;  3S3M A;  3PNY A;  3VYT B;  1FOX A;  1OYI A;  3ZCO A;  1K4T A;  2K3F A;  5JVT A;  1XD7 A;  2XGC A;  1BI2 A;  5FKM A;  2JJ7 A;  1X1D A;  5M5Y J;  4OAY A;  1ORK A;  1D1A A;  4BQO A;  1FYM A;  2PMZ N;  1KU7 A;  2RN7 A;  1MGT A;  3HUG A;  2FXA A;  3WTT C;  2KT0 A;  3A01 B;  3TDU C;  2ZNY A;  3WGH A;  4C30 A;  4Q5S F;  3BRO A;  2WTE A;  2FNP A;  3I0T A;  5L3D A;  1WI3 A;  4LB5 A;  3PO2 J;  2Y31 A;  3CUQ C;  1K6Y A;  1T2K A;  4BGD A;  3DEE A;  2WAQ A;  3HYI A;  5TIS C;  4DYC A;  2DJN A;  2IXS A;  4HAM A;  2MW8 A;  3T0Y A;  4HV5 A;  4A3J J;  3CO7 C;  4Y52 J;  5JI6 A;  2ZJ2 A;  5HLG A;  4NB5 A;  5DD8 A;  3K4J A;  4HYE A;  1MW7 A;  3LFU A;  1B4A A;  3HJE A;  4E7S A;  5LGT A;  2DXI A;  1N78 A;  2EFQ A;  4O6J A;  3RZO J;  3JW4 A;  4E4H A;  3FXL A;  3HHH A;  2LC2 A;  1F9N A;  2NVT J;  3CLQ A;  1H88 C;  2VB6 A;  5FRM A;  4UUT A;  1IO2 A;  3NWS A;  4BE1 A;  2G7U A;  2ZKZ A;  1HOM A;  2M30 A;  4RLQ A;  5F08 A;  1AA7 A;  4LOC A;  4QWQ A;  1IUF A;  4HDV A;  3DKX A;  1FWZ A;  1G3T A;  3X2Q H;  4ENM A;  4PFO A;  1U8R A;  1ETV A;  3I56 I;  2LD5 A;  2GAU A;  2HTS A;  4KN4 X;  2V1U A;  3HC7 A;  1ZG3 A;  5FFX A;  3O2P E;  4D1Q A;  5BPD A;  3MMY B;  3A0H C;  1AWC A;  3BTJ A;  3OV8 A;  1QZZ A;  3FMQ A;  3I55 I;  4IQJ A;  4B3X A;  3VSK A;  1RUO A;  3P9K A;  2HZD A;  1TW2 A;  3LMM A;  1QO0 D;  2HPI A;  2LF8 A;  4JK1 X;  4AIK A;  1ZGA A;  3DCF A;  3F21 A;  1YE9 A;  2KIQ A;  5J8F A;  4NHJ A;  1Y0N A;  3ZQC A;  3N05 A;  5M3M J;  2Y30 A;  1ZRE A;  2BZT A;  3BWG A;  1Q1H A;  3F8C A;  1QZY A;  1TQI A;  1G8X A;  5A2Q K;  2XKP A;  2VUM J;  2L9N A;  4ESB A;  3ASN H;  2HVQ A;  4ZTF A;  1EV7 A;  3HSE A;  3UNG C;  1V55 H;  1U0J A;  3DTK A;  4XLP F;  5FB2 A;  2JUC A;  1R5I D;  3HG9 A;  3S17 J;  2PJR A;  2XF6 A;  3QU3 A;  2W57 A;  1XPX A;  3JCU C;  2DMP A;  2EFN A;  1UJ8 A;  3LWF A;  3OWT A;  1SC7 A;  3QPS A;  2XIG A;  1VQM I;  1IG7 A;  1VQ9 I;  5E8G A;  1ZH5 A;  2BHY A;  2P5K A;  3JSP A;  1YLF A;  2HDC A;  1RKW A;  5EF6 A;  5ILU A;  4A93 J;  2ACJ A;  2F48 A;  2KRF A;  5M5W J;  1A6I A;  3VWB A;  3KIO A;  3K4L A;  1I6X A;  2H09 A;  1LE8 B;  4UUV A;  4AUX A;  5CVJ A;  3TO9 A;  1R23 A;  2RQQ A;  4L0Z B;  4NQW A;  3E7L A;  1JJ8 C;  3OYG A;  3HKZ A;  4A3C J;  3CZ6 A;  2XPV A;  4CHU A;  1TWA J;  5GAG J;  2AQE A;  3H9J A;  2E71 A;  1XGN A;  1R4M B;  1K61 A;  1MBK A;  3VOE A;  1XSV A;  2FQ3 A;  4PJN A;  1W36 D;  4BJT A;  2M2E A;  4E7L A;  3K7A J;  3JRE A;  1BC7 C;  3ONQ A;  4PGH A;  3QOE A;  4CSW A;  2STW A;  4KJZ A;  5L3C A;  2V9P A;  1XG1 A;  3PIO F;  3G2B A;  4OIN F;  2QVO A;  1GVD A;  4NC8 A;  4LIU A;  4IHX A;  4XNF A;  3VPR A;  1CGP A;  3EUK L;  3GX4 X;  2WA0 A;  3S3O A;  2QZ8 A;  3E5X A;  1OYY A;  3MKL A;  3HM5 A;  2HDD A;  2K85 A;  1MBF A;  3L2R A;  1S8N A;  5D6E A;  3FMR A;  4WXC A;  3SDG A;  4KIF A;  2DJI A;  1O3R A;  2XAQ A;  2OJE D;  5DCM B;  1TWH J;  2JA2 A;  1UAA A;  2HYG D;  2QBY B;  1ZKG A;  2YX7 A;  2QYO A;  4EQQ A;  1UG2 A;  4AVP A;  4QPQ A;  4P9F A;  2P8T A;  4Q47 A;  3GTL J;  1GLN A;  2A6H F;  3RZD J;  1F5T A;  3P7N A;  4IHV A;  2FBK A;  2R3S A;  3K1P A;  2KZV A;  5TJJ A;  1LNW A;  4XSZ F;  1SEU A;  3CUO A;  4A5N A;  2OQG A;  3T8T A;  3WE2 A;  3LSM A;  4HBL A;  3QRF F;  3O3K A;  2LKX A;  3DU5 A;  4ZC3 A;  1TNT A;  2O9L A;  2WAF A;  1SFX A;  4EJO A;  2OQR A;  1MH3 A;  3CMY A;  3ZQI A;  1QPM A;  1S5L C;  1NH3 A;  3HOX J;  2MBF A;  4IX7 A;  3K69 A;  5K5Q A;  1YW9 A;  4KIC A;  4LFU A;  5H20 A;  1YW8 A;  3Q9S A;  4XRS A;  3ZMZ A;  4G8X A;  5K1Y A;  4G7Z F;  3N4M A;  2V6E A;  2IS6 A;  1A04 A;  5J47 A;  1MBE A;  2ZXH A;  1VFC A;  1DPR A;  2R7U A;  3E6C C;  3E6M A;  4PDK A;  1VI0 A;  2EIK H;  1WKM A;  2J5P A;  4N0B A;  5L3G A;  3B6C A;  2HEO A;  2OU2 A;  2Y2Z A;  3K1M A;  2ZJR F;  2E1M B;  3F72 A;  2I10 A;  1J59 A;  5GAD J;  4DJA A;  2R5Z A;  1VND A;  4B1R A;  2FEZ A;  4XRS G;  2L7M P;  5DM7 F;  1LQ1 A;  3D5R C;  2OBP A;  4HW0 A;  5BOX A;  4RAY A;  3WU1 B;  4A3D J;  3V4G A;  3AG3 H;  4LG0 A;  3HRS A;  2HOT A;  2KP6 A;  5EDN A;  1I6H J;  3AG4 H;  4M71 A;  1NK3 P;  3HPG A;  4XL9 A;  4W1U A;  1YIO A;  4XIC A;  3IV5 A;  2F5C A;  4ZYH A;  3CJQ B;  5AIP A;  1E3O C;  3QPT A;  1RKT A;  2VOD A;  2F5V A;  3CJR B;  3I3L A;  3E5U A;  4RGR A;  1TC3 C;  3KP5 A;  4HLX A;  3FKJ A;  3K70 C;  1R1U A;  2R5Y B;  3V8J A;  3PL8 A;  5C44 J;  5BMZ A;  4BDY A;  3PJR A;  2DA2 A;  1S3J A;  4NNJ A;  1FP1 D;  2P0W A;  2XC7 A;  5CQG A;  1S29 A;  3GFM A;  5LGN A;  2XRL A;  2AO9 A;  4AWX B;  5IY5 H;  4PCQ A;  4BQA A;  2ESH A;  3DBL B;  1PUF A;  4A0X A;  2LRE A;  1EH7 A;  4ZYG A;  2CGP A;  1BN5 A;  2GXG A;  4K2E A;  2Z5U A;  3I4M J;  1BR4 A;  3VSL A;  4NBQ A;  4ANJ A;  3H0G J;  1R49 A;  2WV1 A;  5BNG A;  3JRG A;  1XSX A;  1LPQ A;  1ZHF A;  5E3O A;  4IHS A;  3F8F A;  3SZT A;  2OA4 A;  1TT0 A;  3FXO A;  5FD5 A;  2CH0 A;  1HKQ A;  3V7R A;  5E1X A;  2M9H A;  4KIB A;  3MZH A;  4CCM A;  1T6S A;  1ONV A;  2VQL A;  4DBQ A;  5BPI A;  2GLO A;  1P4X A;  1BI0 A;  1XMK A;  2JN6 A;  2O5R A;  2QCO A;  4D9J A;  2WB1 A;  3AG1 H;  1BC8 C;  3S2H J;  3FK6 A;  5ICE A;  3S3N A;  2XGX A;  3ABL H;  3KYC B;  3SJM A;  3QP5 A;  4RB0 A;  2ICW G;  3BQY A;  3L2U A;  2QKM B;  2Y69 H;  4M6Y A;  2V9V A;  4IHW A;  2A69 F;  2EK5 A;  1R1T A;  4I0B A;  4CCO A;  4KN7 X;  4U0W A;  3VB2 A;  3ASO H;  1Y1W J;  2H1L A;  2QGU A;  2DTR A;  4XMY A;  2OPT A;  2DTZ A;  3E6D A;  1FX7 A;  5ERI A;  2JSC A;  1YYV A;  2A05 A;  3SXY A;  3GFI A;  2LKP A;  5C3E J;  1RC9 A;  3G4S I;  2M0C A;  2RNJ A;  5J4Y A;  3JSO A;  1MMD A;  2GIZ A;  2W4S A;  3IUO A;  1PP7 U;  3OYM A;  2PX9 A;  3C18 A;  1J75 A;  4L18 B;  4BXF A;  2M0M A;  2QM3 A;  4ENK A;  4A3I J;  3OYK A;  3KP4 A;  2TDX A;  1O4X A;  3MZ8 A;  2ZXI A;  2V1D A;  2IBD A;  3DU6 A;  3IWZ A;  2DOD A;  1JXS A;  2A07 F;  5F1R A;  4I6Z A;  4G9Y A;  3BCB A;  1WJB A;  1QBJ A;  2M8E A;  4N9I A;  4OIR F;  1MMN A;  2EA4 A;  3C2H A;  3PQJ A;  1IXR C;  4GFB A;  2IGK A;  4EV0 A;  2ZJQ F;  3Q0V A;  2G0E A;  2CS3 A;  1OYW A;  1R22 A;  1RET A;  1OCC H;  4RS8 A;  3M7G A;  4EJT A;  2M4K A;  2WAQ N;  5DYM A;  2VL8 A;  3F6O A;  1MD0 A;  1WJC A;  3I4P A;  5LRR A;  2GXB A;  2I8D A;  3OL3 A;  5H6R A;  2VJJ A;  1NTC A;  1XX5 A;  3OIQ A;  4JOM A;  4IOA F;  1JGS A;  1F4K A;  1E0E A;  2F5E A;  4CXF A;  3CDH A;  1MJB A;  1TNS A;  1ZYR F;  3BG7 A;  1WJ5 A;  2JA6 J;  4EJU A;  1FTZ A;  4KFC A;  2VBZ A;  4CIC A;  4JQF A;  3F0C A;  4ZZL A;  3HGG A;  5FRO A;  4AYB A;  2GZW A;  1WRJ A;  3M07 A;  3S1R J;  3RTR A;  4CYC A;  2RNG A;  2UUZ A;  4XKV A;  5K5O A;  1I27 A;  3VYU B;  3F23 A;  2ZO4 A;  1TQM A;  1JKO C;  4KMF A;  1YJ9 I;  3J81 Z;  4F92 B;  3HOV J;  4R1H A;  4BQN A;  1D3Y A;  3H35 A;  5EGO B;  5CQE A;  2MGQ A;  4MGR A;  4IO9 F;  4IPA A;  3A02 A;  2KJB A;  4KYW A;  5DDG A;  5LRS A;  3BZC A;  2DA3 A;  5D8K B;  4BJ6 C;  2HXO A;  1H9T A;  5C4X J;  3ABK H;  2ECB A;  2LYC A;  1YJN I;  2ECC A;  4DOZ A;  3B73 A;  1S9H A;  1IC8 A;  3DKW A;  4KIS A;  1YS6 A;  1U8B A;  2VPR A;  1UHW A;  2DK8 A;  1MKM A;  2IEK A;  1Z91 A;  2A6T A;  4XRF A;  2QSH X;  5D6F A;  1J09 A;  1QHG A;  2E34 A;  4DW6 A;  4YIF A;  2LY9 A;  5B1B H;  2R7W A;  2R0Q C;  3ZMU A;  1ON1 A;  4IEJ A;  2HNH A;  3M9A A;  3RDI A;  3J80 K;  4YRV A;  2CUE A;  4XKW A;  4A3K J;  2BY3 A;  2ZSI B;  3ZQF A;  4UB8 C;  5FLM J;  4UUS B;  2IW5 A;  4OMY A;  3GFJ A;  1GUU A;  2WAE A;  1JUP A;  1F1Z A;  5HLT A;  1HST A;  2NXN B;  1D5Y A;  3CLO A;  5GAE J;  3IAS 2;  2X4H A;  1IDY A;  2Z33 A;  3GUD A;  5DM6 F;  3ZQL A;  4HQM A;  2JTV A;  2HFH A;  1YS7 A;  4I01 A;  1LB2 A;  4HNV A;  1V5G A;  4JX6 A;  1BOB A;  1SAU A;  4Z6Y A;  2DU9 A;  1ZEL A;  4G94 A;  1IXS B;  4B09 A;  4LLG F;  2V6C A;  3G73 A;  2VC0 A;  3R60 A;  2YU3 A;  1JUM A;  1TTY A;  2FU4 A;  3DXJ F;  3HKZ N;  3BTI A;  2YR2 A;  2L7K A;  3QPH A;  2Q2E A;  2LOO A;  5DCF A;  4P9U A;  2EPF A;  3RQ4 A;  1Z21 A;  1R5G A;  1QU3 A;  2ESN A;  5EZG A;  1NK2 P;  1W4M A;  2Q0O A;  2ADU A;  2KQR A;  2AXL A;  1V5F A;  4A69 C;  1P7I A;  3KP3 A;  2DLL A;  5J8C A;  3OYC A;  1N25 A;  3EYI A;  4IKF A;  1B8I A;  1P4W A;  4LK1 F;  4RGS A;  1G3W A;  4S04 A;  4EAT A;  3OOP A;  3F3X A;  2RGV A;  3CQZ J;  2OZ6 A;  2R92 J;  1ZGJ A;  4OIQ F;  4Y13 A;  3MKW B;  2LY1 A;  3IP4 B;  2PG4 A;  1Z77 A;  1HQC A;  4KT6 A;  3GVA A;  1SAX A;  1EH8 A;  3LSK A;  1XS9 A;  1HLV A;  3C7J A;  5E17 F;  4U7D A;  4AU7 A;  2NVQ J;  1H89 C;  1IRG A;  1X58 A;  2BW3 A;  4ASN A;  2HKO A;  2ZME C;  3OSG A;  5TRD A;  1T39 A;  1ETK A;  4CCK A;  2GWR A;  3H3V K;  1LFB A;  3OYA A;  3G3Z A;  1WCM J;  2FRH A;  5EYR A;  3J7Z I;  4L0Y B;  1DQU A;  1BI1 A;  2PJP A;  3BPX A;  4XLE A;  3LAP A;  2YS9 A;  2CSO A;  2QQ9 A;  3IC7 A;  3I58 A;  2MD5 A;  1FZP B;  2RVC A;  3J7A O;  4II2 A;  3FXQ A;  1BA5 A;  3ZGK A;  3QAH A;  1R71 A;  2MSY A;  4HNU A;  4FX4 A;  3CC4 I;  1IN6 A;  2X6X A;  3SDB A;  3KCC A;  3TOA A;  2GXA A;  2DAO A;  3RI4 A;  5F64 A;  2CV1 A;  5FLX K;  2CQQ A;  3A4C A;  2HWV A;  1VQO I;  2DFE A;  1ZR2 A;  3PO3 J;  3NQO A;  1SFO J;  1USS A;  2R5Z B;  2BYV E;  4GYI A;  2RC4 A;  1MDM B;  1MSE C;  2XGE A;  3RJP A;  1DDN A;  4BYY A;  3DWL E;  1VQK I;  5IP7 J;  1UG0 A;  2KIS A;  4UB6 C;  2IVM A;  3RYP A;  3HDD A;  3GLL A;  1FBQ A;  3ZQG A;  1X1B A;  4EJV A;  4FTH A;  4LG0 B;  1U78 A;  2XB0 X;  2NNY A;  2FX0 A;  1KYZ A;  4HEA 2;  1FYK A;  4JBA A;  1ZRF A;  3QWL A;  3A0B C;  1SVL A;  1QVT A;  4M3F A;  4AVZ A;  2R7R A;  4XON A;  2DA6 A;  4B4C A;  4R8H A;  1D1B A;  1FEX A;  4HLY A;  1R00 A;  5JFR A;  3L2C A;  4RM2 A;  3FX3 A;  2W25 A;  5HLH A;  1IN5 A;  3IRR A;  2CYY A;  2STT A;  2W48 A;  5HVQ C;  4I76 A;  4ZH4 F;  1YX5 A;  3MAJ A;  4U0V A;  4BNC A;  5K7Z A;  4XLH A;  1D5V A;  3H5N A;  3TL4 X;  4HV6 A;  2KIM A;  3BZ6 A;  3H9Q A;  1WH7 A;  1PUF B;  1J0R A;  3HHG A;  5ED4 A;  2A6E F;  4ENJ A;  2E19 A;  1B72 B;  3HTU A;  3H3U A;  3KZY A;  2M7B A;  3BG3 A;  4J00 A;  1NG7 A;  4I98 B;  2GIV A;  1ETO A;  1X19 A;  4BJ5 C;  2CU7 A;  5IYD J;  1YTY A;  3PUB A;  2M3A A;  1L3L A;  4ZZD A;  3OY9 A;  3BR1 A;  3LAJ A;  3A2K A;  1D0Y A;  1Y56 A;  2V7F A;  3VEP A;  1MIJ A;  1UCR A;  2VXZ A;  3Q5F A;  3AAF A;  1RR8 C;  1T0F A;  3TKY A;  1KYW A;  2Q8K A;  2OTJ I;  2CWE A;  1G3S A;  1SAN A;  4KIG A;  2PMH A;  2WB1 N;  3E1S A;  2OC6 A;  4BQQ A;  3T1B A;  2PMU A;  3LA3 A;  2F4O B;  2OCE A;  3ZPL A;  1VQN I;  1J9I A;  1FYL A;  1JHF A;  2H8W A;  4RB2 C;  1ERD A;  1Q1V A;  2VC1 A;  3G1L A;  1QHH D;  3BQZ A;  5GP9 A;  2HQR A;  4FT8 A;  3PSF A;  1XMX A;  3HSR A;  9ANT A;  3E97 A;  2CRG A;  1LEB A;  4U88 A;  3R4K A;  2IS2 A;  3I64 A;  3WOD F;  1OJL A;  1OFC X;  2MA3 A;  3LST A;  1VF9 A;  3V8K A;  2IGN A;  3HRT A;  1V5E A;  1GDT A;  1JTX A;  3KP6 A;  5FJ8 J;  1JJ6 C;  1U5T C;  2OAZ A;  3DBH B;  1IRZ A;  1P4A A;  2VE8 A;  2AXT C;  2H6C A;  1LVA A;  1L0O C;  3VFZ A;  3QU6 A;  2JT1 A;  4N9H A;  5JHU A;  4P55 A;  3OYF A;  4UV8 A;  2ZFW A;  1SD7 A;  2KKO A;  1W36 C;  4Z2Y A;  2EFW A;  3F8M A;  3BJO A;  3TMO A;  4HSR A;  2RQP A;  1MNM C;  1ZRD A;  2W7N A;  2XGD A;  4CYD A;  2VPL A;  4AC0 A;  2MAB A;  2W1O A;  4A6E A;  1Z3X A;  2P7C B;  1MH4 A;  2MFZ A;  2KPM A;  3FWE A;  1YO5 C;  4OAZ A;  2LY2 A;  1VQL I;  2ZSH B;  4B48 A;  1W5T A;  1S7E A;  1MZB A;  4L9N A;  4U0Y A;  4HF2 A;  1QRY A;  3DLL F;  3HRU A;  3HZJ A;  3M8F A;  4S05 A;  2FJ1 A;  4LMY A;  2R7X A;  1GVJ A;  3L00 A;  1BR1 A;  1MMA A;  3GTG J;  3DFG A;  3EUH C;  2R7V A;  3IKV A;  3G1O A;  3PQK A;  1HDP A;  2H8R A;  4D7N A;  2IAI A;  3KET A;  2MC4 A;  5F27 A;  3MCZ A;  1MJA A;  4H0E A;  3Q9V A;  3H3Z A;  4FHT A;  1T38 A;  2DPD A;  3CME I;  4AIJ A;  1GV5 A;  3JTH A;  2LMD A;  5GPA A;  1S7A A;  1Z1D A;  3PUF A;  3RQI A;  3BC8 A;  3LSI A;  3K4C A;  1PVE A;  1QGP A;  1W1W E;  3F8N A;  1ZQ3 P;  4RGX A;  5F6F A;  4DYR A;  1KU2 A;  2L3D A;  3K4B A;  3IRQ A;  3H0D A;  1VTN C;  4GDF A;  4EVI A;  2DOA A;  3FXJ A;  4D7M A;  3GTM J;  1BOA A;  3OYJ A;  3QYB A;  5LGU A;  1Z67 A;  2ZJP F;  4M6X A;  4IRH A;  4XOR A;  1RNL A;  3IH2 A;  5A2Q Z;  3CJT B;  3REO A;  3BR3 A;  4Y4R A;  3E0J B;  2Y9Z A;  2DQR A;  4E7J A;  3B02 A;  2Y9Y A;  2D45 A;  3CTA A;  3KP7 A;  4A5M A;  2VE9 A;  2KHM A;  1MBG A;  2E7W A;  1FSH A;  1H9G A;  3KEY A;  2OTL I;  3HSF A;  1BJZ A;  2M5W A;  3CCU I;  4C3I J;  3OS1 A;  1A5J A;  4LIT A;  3H9G A;  2V4J C;  4XM3 A;  4A6D A;  1ON2 A;  5E8I A;  2CV0 A;  5EEA A;  2E5Z A;  2BY1 A;  5J40 A;  3LA2 A;  3QP6 A;  2HQ5 A;  4DIQ A;  4DZJ A;  3HRM A;  2KL4 A;  3Q0W A;  3CCL I;  1TWC J;  3MZY A;  2DQL A;  5EJC A;  1KON A;  2COM A;  3JTG A;  4HX8 A;  2DCE A;  2PI0 A;  4QIW N;  4NC6 A;  5B5E C;  5IT9 K;  2J5O A;  4XK4 A;  2ELH A;  1APL C;  3ZN0 A;  2HDW A;  1ETQ A;  2BY2 A;  3T8R A;  4U87 A;  1WJE A;  3NWT A;  2CUF A;  2EV6 A;  4G6D A;  2E1N A;  1B9M A;  4IL6 C;  4EM2 A;  2DA1 A;  3FXK A;  1HA8 A;  3HL2 A;  2L4M A;  3F22 A;  4U7B A;  1UEL B;  1Y1V J;  3DTI A;  3KZI C;  3Q3S A;  2IA0 A;  5CJ9 A;  5L3F A;  5KAI C;  4RB1 A;  3FKI J;  3OOU A;  4ESF A;  4HST A;  3R0A A;  1LVK A;  2HS5 A;  3WGG A;  4A0Z A;  3AL0 B;  4QLC U;  1X4P A;  3H1C A;  1K83 J;  4CZC A;  1Z9C A;  5LEJ A;  4ON0 A;  4KMU X;  4B44 A;  4A3M J;  2XB5 A;  3LOC A;  3GTO J;  2XAJ A;  4JP0 A;  1B9N A;  2FF4 A;  3BG5 A;  3ZMV A;  3ABU A;  3V7C A;  1NG6 A;  5ICG A;  3CCE I;  2BW3 B;  2HGC A;  2E5N A;  2XHK A;  4BXU A;  3CCM I;  3B6A A;  1LDK B;  3JRA A;  1LDD A;  3GF2 A;  5CVV A;  3WE3 A;  1IJW C;  4E7H A;  2KJC A;  3DP7 A;  4DYQ A;  2BEO A;  2DFI A;  1IV6 A;  1GHC A;  4MO7 A;  3FIW A;  2BY0 A;  3CCQ I;  5FFZ A;  2FD5 A;  4BEH B;  4MFE A;  3ULQ B;  4IZZ A;  3J7A Y;  3KFW X;  1CQT A;  3CUQ A;  5ILV A;  3FDY A;  3GW2 A;  2P4W A;  4M3E A;  3TO7 A;  1U3E M;  1AKH A;  1FBS A;  4ZJZ A;  4GCV A;  1LEA A;  2C6Y A;  2L9V A;  1JUS A;  4E70 A;  2GQQ A;  2HZT A;  2M7A A;  2XV4 S;  2WAD A;  1K78 A;  4FET A;  2EIJ H;  2LF7 A;  1JKP C;  2CFO A;  3ECH A;  4PSX A;  1Z6R A;  2VT3 A;  2PEX A;  3E6B A;  3IAM 2;  5K5R A;  3DPT A;  5L3E A;  2LH9 A;  5HDN A;  4V19 K;  2BGC A;  3BR2 A;  3J7Y J;  4NDL A;  3KZZ A;  4C3H J;  1ZG1 A;  1TWG J;  4GO1 A;  4KUM A;  5FGM A;  3L2V A;  1R9T J;  1R1V A;  3BR0 A;  2DK5 A;  4IHT A;  2JRM A;  3OR2 C;  2VXD A;  1V3F A;  3ZRG A;  1ZRC A;  2E1M C;  2QEX I;  1Z6T A;  1U5T A;  5BQT A;  3BLY A;  1LFU P;  4BHB A;  4KA4 A;  4Q48 A;  4XLN F;  2VAS A;  2P5V A;  5E79 C;  2KFD A;  2NVY J;  3KEQ A;  3QYE A;  4M9X A;  4IHY A;  4JYK A;  3M8J A;  1CF7 B;  3K4K A;  1R5H A;  2A68 F;  4XQF A;  2JWT A;  3CC7 I;  1UHM A;  5HS7 A;  3W6J B;  3FM3 A;  4HZF A;  3IH3 A;  1X4O A;  3K4N A;  1GXQ A;  1ZGW A;  2VLA A;  3S1N J;  4GGG A;  3TQN A;  2V79 A;  3OYN A;  1TT5 B;  1XC5 A;  3E3V A;  1P9Q C;  3K2Z A;  1POG A;  2YU9 J;  3H5R A;  3SQN A;  3I59 A;  1Y8Q B;  3R61 A;  3M8E A;  4PSW A;  5E1W A;  3RCO A;  1W5C C;  3WTZ A;  5ICF A;  2E1C A;  3KYL A;  3V7S A;  3OR1 C;  1W0T A;  2DW4 A;  4ZDP A;  3RKQ A;  4F7Z A;  1O3S A;  2P81 A;  5CPR B;  3EUH A;  2LR8 A;  5IYB J;  4XSX F;  3RPQ A;  3HUG B;  5B66 C;  4RAZ A;  2HOS A;  1K4S A;  3ZOB A;  3ZN1 A;  1S7O A;  2G9W A;  3L9F A;  5IOZ A;  1ZK8 A;  3AKZ A;  1FLI A;  2DOE A;  1JGG A;  2MC3 A;  5F0H A;  3IH4 A;  3ESW B;  4N4O B;  4F52 A;  2E1O A;  4DQ2 A;  4C2M J;  3HOW J;  2F4M B;  1FBU A;  4UHT A;  3PM1 A;  3BR5 A;  3ABM H;  3RKY A;  1OLT A;  2HOA A;  1FSE A;  1O7F A;  3G1M A;  4F91 B;  2AHQ A;  2LP0 A;  2FOK A;  3HEF A;  4RLF A;  1E2X A;  3MFK A;  1UHS A;  4G7O F;  1T33 A;  4P5O A;  1RI7 A;  2JPB A;  3DV8 A;  1ZLK A;  1OIS A;  1KU3 A;  1YG2 A;  2E2H J;  2H1K A;  3K9T A;  4B43 A;  3JAM K;  1BR2 A;  3VDX A;  5KNL A;  3LFK A;  3M1E A;  4BL0 B;  3LSH A;  2ETH A;  1IW7 F;  2MH2 A;  4MIM A;  4PUS A;  1QA6 A;  2L9S A;  2XAS A;  1TL8 A;  1R36 A;  2RKH A;  3JRF A;  1ACI A;  1MNE A;  2DDA A;  3JR9 A;  3I53 A;  3PNV A;  4GYG A;  1JKQ C;  1FOK A;  3GME A;  2X48 A;  3MN2 A;  2LSO A;  5BS6 A;  1WH5 A;  5L3B A;  4BBS J;  2Z1D A;  1D1C A;  4HOB A;  4WWC A;  1OMI A;  2M4G A;  1MMG A;  4YEL A;  3WHB A;  1WWX A;  3WTW C;  3S2W A;  3AFH A;  1FIA A;  3HIF A;  1GT0 C;  2QEN A;  2IA1 A;  3CCY A;  1JKR C;  2XSJ C;  4C2T A;  4KNY A;  2EJR A;  1N75 A;  1P6R A;  2VKE A;  1Z05 A;  2CUZ A;  3IWF A;  1VQ5 I;  3OS2 A;  3CD6 I;  4M73 A;  4EGY A;  2D1H A;  1X3U A;  5JHF A;  2CQN A;  2QSF X;  1HC8 A;  1B6A A;  2NNN A;  1YW7 A;  1K79 A;  5GAH J;  1ZAR A;  2R7F A;  4PJL A;  5EEG A;  5CVI A;  2FNA A;  1VQ4 I;  2PJR B;  2HXI A;  3EUA A;  4G6Q A;  4A3E J;  1HF0 A;  1NHA A;  5FD6 A;  2XF7 A;  4ZDO A;  1SVO A;  3FK7 A;  2JPC A;  5E3N A;  4CUG A;  5EZH A;  4B47 A;  2HOE A;  3KE2 A;  3QOD A;  3SYT A;  4DGW B;  4P1W A;  3WG9 A;  1FNN A;  1XGS A;  4PGG A;  5LEK A;  4UVA A;  4HDU A;  1E3H A;  4LGW A;  4FAS D;  5M3F J;  1J2X A;  2KMU A;  5AIQ A;  4EM0 B;  2BVM A;  2FA5 A;  2NOJ B;  1I50 J;  1KZH A;  3MVP A;  1HSJ A;  4NQW B;  3ZXS A;  1QVU A;  2D1V A;  5DCM A;  4ETS A;  2BOL A;  2KDZ A;  3OMY A;  4BDZ A;  2VJI A;  3HOS A;  3HOU J;  3BCA A;  4C9Y A;  1J7K A;  3I71 A;  2BBY A;  1DGW Y;  3ERM A;  1W7P D;  5JLW A;  3M1C A;  2IRF G;  3LNQ A;  5IP9 J;  5C4J J;  4MQ9 F;  3GTJ J;  1GXP A;  1QNT A;  5IYC J;  1R58 A;  4RAG A;  2Z2S B;  5GPC A;  1O3T A;  1BIA A;  3S32 A;  3BJ6 A;  4XOP A;  3J80 Z;  5DEQ A;  1F36 A;  1KA8 A;  4HA8 A;  3SEQ A;  2L9R A;  2QQA A;  3CP2 A;  2K9M A;  3IL2 A;  4M3G A;  2EIN H;  3I5U A;  4Y17 A;  4EM1 A;  5HS8 A;  4RAF A;  2JK3 A;  5HNH A;  2GA2 A;  3W2V A;  2B63 J;  4MTD A;  2DDB A;  2HVR A;  1X3Z B;  1IDZ A;  2XRO A;  1ZLJ A;  3MKY B;  3G71 I;  2JA8 J;  5KCM A;  2JZY A;  2R7Z J;  2EA2 A;  5FLV A;  3JRB A;  1FT9 A;  4AID A;  1T08 B;  1YFH A;  3BY6 A;  1LKX A;  3WTY C;  1WJF A;  1BW5 A;  3RPU A;  2GOX B;  2DA4 A;  4II3 A;  2PFB A;  3DKY A;  1PYV A;  3GWZ A;  2DT7 B;  1FTT A;  4QTR A;  2EWN A;  1V54 H;  4CZZ A;  6PAX A;  3ABT A;  3W6K B;  2PBI A;  1X1C A;  4CA0 A;  3BPV A;  2E60 A;  2PLY A;  1Y8R B;  4B3A A;  4XN3 A;  1IGN A;  1XCB A;  1KGS A;  4OOI A;  1OCR H;  1BJA A;  3NEU A;  2W84 A;  3S14 J;  3C2G A; 
#chains in the Genus database with same CATH homology
 4FE7 A;  4XRS G;  2L7M P;  2XGD A;  4AC0 A;  2VKV A;  1TWF J;  4A3D J;  1MH4 A;  1WPK A;  2OF7 A;  2HYJ A;  5K7F A;  1T56 A;  2M8G X;  2HOT A;  5EDN A;  1I6H J;  1S7E A;  1RES A;  1NK3 P;  2R5Y A;  4W1U A;  1OCT C;  4XIC A;  3IV5 A;  1QRY A;  2VI6 A;  4QSH A;  2NS7 A;  3K2A A;  2FJ1 A;  1E3O C;  1RKT A;  2FQ4 A;  5FKL A;  1H8A C;  2Y0S N;  1TC3 C;  3GTG J;  1LE8 A;  3G1O A;  2R5Y B;  1HDP A;  2H8R A;  4D7N A;  5C44 J;  2K40 A;  2IAI A;  5F27 A;  2DA2 A;  4RDU A;  1GV5 A;  3CDL A;  3L1P A;  1ETY A;  2XRL A;  4BBR J;  2LVS A;  4FCY A;  5GPA A;  2AO9 A;  3RQI A;  2EZH A;  1PUF A;  3BTL A;  1AKH B;  1ZQ3 P;  2ZB9 A;  3JRI A;  3I4M J;  4DYR A;  3S15 J;  4D7M A;  3GTM J;  4FIS A;  3H0G J;  2TCT A;  2WV1 A;  1AU7 A;  2TRT A;  5BNG A;  3JRG A;  5E3O A;  3NAU A;  2ME0 A;  3IH2 A;  1ITY A;  2NVX J;  3BR3 A;  3HOY J;  1YRN B;  2NS8 A;  2Y9Z A;  3S1Q J;  2LLK A;  2M9H A;  2Y9Y A;  3O8H A;  4MLO A;  2GLO A;  1MBG A;  2JN6 A;  2QCO A;  2D5V A;  2DA5 A;  3S2H J;  3FK6 A;  4D5C A;  1BJZ A;  3SJM A;  1OCP A;  4C3I J;  3BQY A;  1A5J A;  1QPI A;  4IHW A;  2DMT A;  5F1J A;  5DS9 A;  5EEA A;  2X6O A;  1Y1W J;  1BL0 A;  2OPT A;  2HQ5 A;  2DTZ A;  2M34 A;  2GBY A;  4DZJ A;  2LFB A;  5C3E J;  3Q0W A;  1TWC J;  1GV2 A;  2M0C A;  2XPW A;  1ZR4 A;  1JT6 A;  2JA7 J;  3S1M J;  2DN0 A;  5EG0 B;  4QIW N;  3LSP A;  1ETW A;  4XK4 A;  4L5E A;  1APL C;  5J1R A;  4A3I J;  1ETQ A;  5J1Y A;  1O4X A;  2CUF A;  2IBD A;  3FIS A;  4G12 A;  1MSF C;  4I6Z A;  2DA1 A;  4BY1 J;  2DMQ A;  3DEW A;  2K9Q A;  1Y1V J;  3LSG A;  5E3M A;  3A03 A;  3Q3S A;  4GFB A;  2EZI A;  2ID3 A;  3Q0V A;  2G0E A;  3LSJ A;  3TW6 A;  3FKI J;  1RET A;  3OOU A;  3HBL A;  2DMU A;  1MBH A;  2WAQ N;  1AHD P;  5M5X J;  1K83 J;  1I3Q J;  3BTC A;  4M6V A;  3OIO A;  1HCR A;  4M3B A;  1NTC A;  2QF7 A;  4A3M J;  4J19 A;  2XB5 A;  3LOC A;  1U9O A;  2L0K A;  5IPA A;  3GTO J;  2JA6 J;  4JP0 A;  2R93 J;  1FTZ A;  3JRH A;  3BG5 A;  1X2M A;  5J3L A;  3F0C A;  3HGG A;  1MBJ A;  2EQR A;  2NOG A;  5EGO A;  3B6A A;  1FIP A;  3JRA A;  3S1R J;  4CYC A;  1IJW C;  4DYQ A;  1IV6 A;  4MO7 A;  3FIW A;  5F0F A;  4A3G J;  1DU6 A;  4MFD A;  2FD5 A;  3ZQH A;  1JKO C;  4MFE A;  3HOV J;  5F04 A;  2X9D A;  1CQT A;  2O7O A;  1F43 A;  1X2N A;  3QQA A;  2JMW A;  5EGO B;  2MGQ A;  5J1U A;  4A3L J;  4CYC B;  4M3E A;  2L7Z A;  1HDD C;  4AYB N;  3A02 A;  1AKH A;  5K7H A;  1JUS A;  5HOD A;  3HGY A;  3HB9 A;  3GTQ J;  2DA3 A;  2GM4 A;  2HXO A;  1JTY A;  5C4X J;  2ECB A;  1JKP C;  3QPL A;  3S2D J;  2ECC A;  4FE4 A;  1IC8 A;  1U9N A;  2HI3 A;  4W97 A;  2VPR A;  2IEK A;  1U8B A;  4UUS A;  1YRN A;  5F0C A;  4M3D A;  3BR2 A;  4DW6 A;  3TED A;  4NDL A;  3BR6 A;  4C3H J;  3OSF A;  1P7J A;  2LY9 A;  1TWG J;  2R0Q C;  1JT0 A;  4IEJ A;  1R9T J;  3BR0 A;  3BG9 A;  2DMN A;  2CUE A;  4A3K J;  4JX4 A;  4DZP A;  4BY7 J;  3ZQF A;  5FLM J;  4UUS B;  2CQX A;  1GUU A;  1LFU P;  3S16 J;  2MG4 A;  4EEF G;  1JUP A;  4A3B J;  2O8K A;  1D5Y A;  2NVY J;  4IHY A;  3BT9 A;  4JYK A;  2K9S A;  1IDY A;  2JWT A;  3ZQL A;  1Z0X A;  3IH3 A;  2E2J J;  2XPU A;  4HNV A;  5JLX A;  1ZGW A;  4JX6 A;  3S1N J;  5FKO A;  5EG0 A;  4RBO A;  2EBI A;  2XGC A;  1XC5 A;  1ZTR A;  3RKQ A;  1JUM A;  5FKM A;  2JJ7 A;  1POG A;  3HKZ N;  3BTI A;  5M5Y J;  2YU9 J;  1ORK A;  3M4O J;  2PMZ N;  2KT0 A;  3A01 B;  3JRC A;  5EZG A;  1W0T A;  1NK2 P;  3NAR A;  4A69 C;  2P81 A;  1P7I A;  2LR8 A;  1WI3 A;  5IYB J;  1B8I A;  5IOY A;  2E2I J;  3PO2 J;  2Y31 A;  2HOS A;  3ZOB A;  4DYC A;  4C3J J;  2DJN A;  5IOZ A;  3CQZ J;  1ZK8 A;  2R92 J;  2MW8 A;  5FKK A;  4A3J J;  1JGG A;  4Y52 J;  5F0H A;  3IH4 A;  2E1O A;  3GTP J;  4C2M J;  4XID A;  1B8I B;  1Z77 A;  2JA5 J;  3HOW J;  3RZO J;  3PM1 A;  3BR5 A;  1XS9 A;  2HOA A;  3G1M A;  1HLV A;  2NVT J;  2NVQ J;  2AHQ A;  1H89 C;  1H88 C;  2LP0 A;  3HEF A;  4UUT A;  3O8G A;  1UHS A;  1X58 A;  1T33 A;  3OSG A;  1HOM A;  5F08 A;  1ETK A;  3SFI A;  4LOC A;  1IUF A;  3H3V K;  1LFB A;  2DA7 A;  1WCM J;  2H1K A;  2E2H J;  5EYR A;  4ABZ A;  1ETV A;  2LD5 A;  2YS9 A;  4MIM A;  3BTJ A;  1BA5 A;  3JRF A;  2MSY A;  3JR9 A;  1JKQ C;  2EH3 A;  3DCF A;  2X48 A;  3MN2 A;  3LSR A;  3ZQC A;  1WH5 A;  5M3M J;  2Y30 A;  4D5F A;  4BBS J;  2CQQ A;  1ZR2 A;  2VUM J;  3PO3 J;  3M3Y J;  4BKX A;  1SFO J;  4X1E A;  3C2B A;  2R5Z B;  3WHB A;  4XRM A;  1MSE C;  2XGE A;  1FIA A;  2COB A;  1GT0 C;  2LK2 A;  3CCY A;  3S17 J;  5IP7 J;  2EZL A;  3WHC A;  1JKR C;  2DMP A;  2N8G A;  3HDD A;  2VKE A;  3ZQG A;  4FTH A;  3QPS A;  1U78 A;  1BW6 A;  2XB0 X;  1IG7 A;  2FX0 A;  3D1N I;  1QVT A;  2RAE A;  4M3F A;  1RKW A;  2HXI A;  5EF6 A;  4A3E J;  2DA6 A;  5IP6 A;  1HF0 A;  4A93 J;  2ME6 A;  4B4C A;  1FEX A;  5E3L A;  3Q0U A;  5M5W J;  3FK7 A;  1A6I A;  2YUS A;  5E3N A;  1RPW A;  5EZH A;  1LE8 B;  4AUX A;  3I4N J;  3E7L A;  2EZK A;  1JJ8 C;  2W48 A;  1B72 A;  4A3C J;  2XPV A;  4I76 A;  1TWA J;  4X6A J;  5K7Z A;  1K61 A;  5M3F J;  1MBK A;  2M2E A;  1EF4 A;  1WH7 A;  1I50 J;  2L7F P;  3MVP A;  3K7A J;  3A01 A;  3JRE A;  1PUF B;  1WGX A;  1QVU A;  2E19 A;  1B72 B;  2KDZ A;  1XG1 A;  3GTK J;  1GVD A;  3BG3 A;  3HOU J;  4IHX A;  3VPR A;  1ETX A;  3TW7 A;  3W6V A;  1ETO A;  3MKL A;  3HM5 A;  2HDD A;  2CU7 A;  1MBF A;  5DTD A;  5IYD J;  5JLW A;  3TP3 A;  3SDG A;  3LNQ A;  5IP9 J;  1TWH J;  1W0U A;  1ZKG A;  3BR1 A;  5C4J J;  3S14 J;  3GTJ J;  5IYC J;  1UG2 A;  4Y7N J;  5GPC A;  2LTP A;  2ELK A;  3GTL J;  4JX5 A;  3RZD J;  3HOZ J;  1F36 A;  4IHV A;  1SAN A;  2L9R A;  2WB1 N;  4M3G A;  2ID6 A;  1FJL A;  2LKX A;  2JK3 A;  1DU0 A;  2O9L A;  2B63 J;  1ENH A;  1Q1V A;  1IDZ A;  3G1L A;  1MH3 A;  3CMY A;  3BQZ A;  3ZQI A;  5GP9 A;  2JA8 J;  3UKG A;  3HOX J;  2R7Z J;  5FLV A;  9ANT A;  2CRG A;  3JRB A;  1OJL A;  1OFC X;  3TP0 A;  1BW5 A;  1VF9 A;  4XRS A;  3JRD A;  2DA4 A;  4V2F A;  1G2H A;  4V2G A;  1FTT A;  1MBE A;  1GDT A;  4QTR A;  1JTX A;  1VFC A;  2K9N A;  5FJ8 J;  1JJ6 C;  1IRZ A;  4BXX J;  1UMQ A;  5FKN A;  1RR7 A;  1VI0 A;  4B3A A;  2XSD C;  4A3F J;  1IGN A;  3B6C A;  2CJJ A;  2Y2Z A;  2I10 A;  2R5Z A;  3GBG A;  1VND A;  4B1R A;  1MNM C;  4S0H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...