2MH2A

Structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
GAPGIILRYLQEQNRPYSAQDVFGNLQKEHGLGKAAVVKALDQLAQEGKIKEKTYGKQKIYFAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and DNA-binding Properties of the Winged Helix Domain of the Meiotic Recombination HOP2 Protein.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords Homologous-pairing protein 2 homolog
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07106 TBPIP TBPIP/Hop2 winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mh2A00
1SMTA 3QP5A 1S6LA 5ICFA 2ZFWA 4GYIA 1B9MA 1EH6A 3F3XA 4I2OA 3VODA 5HLIA 2MD5A 3O2PE 3LAJA 2HOEA 4YIFA 3R4KA 2RQPA 4A0XA 1DDNA 5DV5A 1XMAA 1HSJA 3LA3A 4LK1F 4OMYA 5ICGA 2KRFA 2Q0OA 3FMQA 1QO0D 1CF7B 4LB5A 3F8CA 2H6CA 3WTYC 1LQ1A 3H92A 4CICA 4HF0A 1XSVA 3CUQB 4G8XA 1AOYA 2VXZA 4ENKA 1IN8A 5BPIA 4M9XA 1P92A 4ESBA 3E6CC 2OD5A 3R60A 2P5KA 4I7HA 1SD7A 1FY7A 2QZ8A 1EH8A 4EJVA 2QM3A 2D1VA 3RKYA 4EJUA 5LBQA 3RYRA 2ADUA 3J7AO 2DO7A 2R3SA 1O3SA 4RGRA 1V4RA 3IWZA 3U9GA 2P8TA 2QVOA 2CYYA 3E5UA 1T0FA 2IA2A 4L18B 4AVPA 1QZYA 1R7JA 1ZGJA 5TJJA 5E1XA 2CSOA 3F8NA 5L3GA 3M8FA 2AS5F 1FBQA 3WTUC 4KIFA 1H9GA 4ON0A 4WXDA 3O3KA 4OMZA 1ZARA 1XCVA 2RN7A 4HOBA 5HDNA 3ECOA 2FNAA 3HOSA 1EH7A 1ONVA 3HRSA 4KMUX 5D6EA 2JTVA 5CVIA 3FMRA 4YG2F 1W7PB 2PG4A 1HW5A 3QU6A 2D1HA 4YFXF 4UHTA 4G6QA 3FXUA 3KP2A 5JHUA 3P7NA 5A2QK 3FF5A 2HYGD 4EGZA 1U6GA 1V3FA 1RIOH 4OIOF 4MQVA 1RI7A 2F5DA 3FZVA 2IA1A 5JI6A 2K4JA 2Z33A 3H3UA 3I0TA 3MAJA 2Y48A 4GGGA 3HSEA 4PCQA 4L9VA 3L2CA 5BQTA 4EJTA 3FM3A 3SHFA 2HS5A 3GWZA 4TV7A 3EYYA 3I64A 2F5EA 1JGSA 3J80K 2FSWA 3PQJA 1UFMA 5E20A 2HKXA 4A6EA 1IXSB 3RPUA 4Q4ZF 1JHFA 5ERIA 2J5PA 4BHBA 2XUBA 4KT5C 4ENNA 5ED4A 1KYZA 1UHMA 2LKPA 3BPXA 2EK5A 2LSOA 1KQ8A 1MJ9A 2VE8A 3DV8A 3TGNA 4UUVA 2PQ8A 2K27A 2FEZA 4GCVA 1R1UA 2E1CA 2KKOA 2CQKA 5E17F 2K86A 1OR7A 4D0PA 3E5QA 5LGTA 2PN6A 1JHHA 2GAUA 2A6HF 2DQRA 2HDCA 1QQIA 4CO8A 1FOKA 1Z1DA 2MLKA 3CUQA 1MGTA 2EJRA 4RB1A 4KYWA 4Q48A 4I0BA 3HRUA 4MGRA 1CF7A 1SD4A 1CGPA 1RNLA 1IN4A 3C7JA 4EMSA 1G3SA 3LSTA 1FSEA 2FBIA 2JRTA 2FMLA 4IRIA 5DD4A 4A6DA 4EGYA 3V7CA 4EV0A 5CVJA 3J80Z 2UXXA 1FX7A 4EM1A 1FLIA 2GIVA 4I01A 1S7AA 4U88A 4LLLA 5F6FA 4M6YA 3SQNA 4WF2A 4N0BA 2QUFA 4GXOA 2P7CB 3WU0A 2V79A 3HHHA 3WE2A 4LD5A 1P4AA 4WXCA 2X4HA 3KEOA 4YFNF 4BQAA 3FHZA 5CVUA 3DXJF 3RIRA 2ZBKA 3WTVC 3KFWX 1XB4A 3KETA 4G6DA 2COMA 2LF8A 4Q5SF 4ESFA 5LEKA 3W6KB 3LA2A 3I59A 4L0ZB 5CJ9A 4LJZF 4DQ2A 2VBZA 1DPUA 2IRFG 4U0YA 1E17A 3QP6A 3DPTA 1VTNC 4AWXB 3MZHA 1U5TC 3SFZA 3I59B 2MBFA 5L3FA 2NNYA 3ULQB 3I53A 1XGNA 4M71A 2KIMA 4BAYA 1MDMB 2GWRA 2QQ9A 4LLNA 4IVNA 4OIPF 3ZPLA 3CO7C 1ZG5A 2E1NA 3L00A 4UVCA 2BYVE 4QLCU 3EDPA 2VBWA 2DPUA 2IPQX 3C18A 1U5TB 3V4GA 1H0MA 3BWGA 2H09A 2EA4A 4H0EA 1BI3A 3NRVA 4P9FA 3RPQA 3GFMA 3K69A 4L0YB 3V8KA 4G9YA 1YW7A 2M1BA 4XRFA 3REOA 2O6GE 2JSCA 3J81Z 2EFNA 1F1ZA 3CO6C 3LA7A 4O6JA 4HA8A 1HSTA 3BOQA 4WXHA 5L3BA 1K6OA 2HWVA 5HS8A 2K7LA 1BIAA 4HF1A 3M9AA 3JSOA 2HQRA 2FMYA 4EJWA 3T8TA 1FBSA 4LMYA 3NQOA 2VONA 3FM5A 1DUXC 1F9NA 1YS6A 5BPDA 5FGMA 2EV0A 2FBKA 4L9NA 3W6JB 1HXDA 1MD0A 2P7VB 1FC3A 4ENJA 5E8IA 2Z3YA 2VT2A 1TW2A 1Z05A 3F8FA 1RZ4A 1D5VA 1MKMA 2XKPA 3JAMZ 2G9WA 3E97A 2QBYB 4IRGA 2P5LC 2VBXA 2UWMA 1R1VA 3VEPA 3WU1B 4I02A 1FYLA 3WGIA 2L02A 2W84A 2L54A 2BBYA 2A6EF 5D5VB 3K9TA 3IRRA 5D5UB 1L3LA 4RB3C 3KP3A 1STZA 3FXRA 1T6SA 2LNBA 3C3WA 3GW2A 5IT9Z 3KZYA 5F64A 4RB2C 5FFZA 1ZLJA 2F2EA 2BE5F 3IWFA 5E1ZB 3J81K 2H6BA 3ELKA 4CHUA 1XDSA 4ZZDA 2ZMEB 2EV6A 5D5XB 1XDUA 2W85A 3GEZA 2FF4A 1OYIA 1BIBA 1J0RA 5E1WA 3I71A 2DAOA 2NS0A 3M8EA 3N97A 4Q47A 5EEHA 1ZREA 3MFKA 3RKXA 4MEYF 4NQWA 4ZH4F 1O7FA 3RI4A 2V6CA 3QPTA 2V9VA 3OV8A 3WTWC 2K4BA 4EVIA 2M87A 3T1BA 2STWA 5CVRA 5K5QA 1SFEA 2YSRA 2YU3A 5D5WB 1YS7A 3DQVC 4DNCA 1PP7U 2XROA 3IKTA 1IUYA 4N9HA 3R0JA 1D8KA 2M45A 2OQGA 3Q9VA 4M9SA 2VN2A 1MJAA 2VOPA 3ZMDA 2V1XA 1HW2A 1GXQA 2V1UA 1YFHA 3RDIA 1P2FA 2QQBA 1IXRC 2A5YB 1O3RA 1FP1D 4A12A 4BXUA 3DEUA 5ILSA 2F5CA 4U7DA 2GXBA 2IT0A 2HEOA 1XGSA 1IN5A 5DYMA 3ZMZA 1R5GA 3ERED 4AD9A 4HV5A 4LGWA 4PDKA 4M9ZA 4CGZA 3SXYA 4BNCA 2R7FA 4O3MA 3QPHA 4MTDA 1FP2A 3BP8A 1QNTA 4UV9A 3ZMSA 3F23A 1B6AA 5DEQA 4A5MA 1KGSA 2RVCA 1KA8A 4XSZF 2RC4A 3FWEA 4UVAA 1ZN2A 1D8JA 4KIGA 1IW7F 3JTHA 4ESJA 4MEXF 5ICEA 2YR2A 2OBPA 4KICA 1I5ZA 2XIGA 3K1MA 5L3DA 2HYFA 3KE2A 2FNPA 2KIUA 1ZHFA 2JPCA 2FRHA 2DT5A 2ACJA 3Q9SA 1USSA 4I0AA 1Z6TA 2EFQA 2L4AA 3KP6A 1REPC 2L3DA 1TNTA 2RKHA 3F22A 4OIRF 2A3SA 3ZP5A 5D8LB 4PGHA 4G7OF 2RV8A 1FZPB 3BJOA 3IL2A 1R1TA 4KIBA 1ZG3A 2ZKZA 1K78A 1L0OC 5HOOA 3E6MA 3MWMA 3GFIA 1UHWA 4HQMA 5E18F 2D2WA 3O6BB 3IC7A 1TBXA 4CDGA 5CLSA 4G7HF 1LVAA 3BDDA 1ZG1A 2Z99A 2MH2A 4KMFA 1XSDA 2CGPA 2H27A 3GZ5A 2A07F 4Y17A 3E3VA 1B59A 3LQQA 1ZH5A 1WRJA 2E7WA 3SZTA 1TNSA 1YO5C 2VODA 2NRAC 1WQ2A 4GO1A 3R6SA 4EM0B 1W7PD 4HF2A 3DFGA 3GUDA 4LK0F 1J9IA 1T2KA 2VBYA 3TKYA 5JVTA 4KNYA 1W5TA 4RGSA 1MJBA 5CVVA 3V8LA 2Q8KA 4PGGA 1QBJA 1O3QA 3WGGA 4UXNA 2IJLA 4XBFA 1GXPA 4NHJA 5KVRA 4KDPA 4WWCA 2XGXA 3KZZA 5LGUA 2K02A 3K2ZA 3C1DA 4I09A 1TLHB 1USTA 1YLFA 3VB2A 2YX4A 4K2EA 1F4KA 3WE3A 5ILVA 4HDVA 5FLXZ 1G3WA 2M8EA 4L9JA 5LRRA 3EQLF 1S29A 4GYGA 3BPVA 4BHPA 3ECHA 5J6XA 4ZYGA 4ETSA 3GO5A 4MNUA 1XMKA 2PFBA 4R1HA 5ICCA 5BOXA 3MZYA 2OAZA 2XKOA 3E6DA 1DP7P 3G3ZA 4F7ZA 2ZMEA 4IPAA 2EWNA 2ELHA 4XLPF 2MA3A 3WTZA 2HFHA 4EM2A 3PQKA 5HS9A 3CJNA 5LGNA 4XSXF 2PMHA 2O8XA 1HBXG 4EJOA 2ISYA 3ZN0A 1ULYA 1I1GA 4ZYDA 2YX7A 4MQ9F 1PUEE 1BM9A 1OYYA 3ML6A 4Y15A 1P4WA 1J75A 2OU2A 3VFZA 4P96A 4AIJA 2MH9A 1H9TA 4OIQF 1XSXA 3DF8A 3HOTA 1TTYA 1BBYA 3WGHA 4IJAA 1ZLKA 3L7WA 2EA2A 1G6NA 3JTGA 2IP2A 3KLOA 2HTJA 5FO5A 2ZCWA 4LG0A 1EV7A 2HGCA 5ILUA 2B0LA 3CDHA 4A0ZA 3MEXA 3EYIA 3E6BA 1IF1A 1U2WA 2ZNZA 1X3UA 4LLGF 1BC7C 4WK8F 5KK1A 3I54A 3F21A 2DW4A 3EETA 1YTYA 1ZAOA 4L5JA 1WKMA 3HIFA 2O03A 2DTRA 3LFKA 1FNNA 1K7AA 3ZN1A 2GXGA 2BEOA 3N4MA 1QGPA 1KU9A 4BYYA 3I58A 5CYVA 1U8RA 3CUOA 3CUQC 4MHGA 3P9IA 5TRDA 1OYWA 1LDKB 3HRTA 2ZO4A 4M74A 3TOAA 4RGXA 5D8KB 1IZ1A 2QENA 1OMIA 1HKSA 1G3TA 4OOIA 3DKWA 4OINF 2W57A 5DUIA 3GLXA 4FHTA 1G4DA 2A69F 4CZZA 4Z2YA 3COAC 2Q2EA 1TQMA 1GVJA 3V8JA 1R36A 1J59A 2G7HA 3K1NA 1I1SA 4KFCA 1LB2A 2XAHA 1O7LA 2DPDA 4RGUA 2M30A 3EUHA 1KU7A 3GXOA 3ABTA 3JW4A 5DCMB 1ZRDA 5EEGA 5D4RA 3ZMUA 1FBUA 3FMSA 4ENMA 1I27A 1YIOA 2P6TA 4LFUA 5AONA 3F8BA 2GZWA 3IRQA 1I6XA 4IHSA 3QRFF 2FQ3A 1LDJA 1BC8C 4ASNA 4CXFA 2TDXA 3DPLC 1KU2A 4KN4X 4BH9A 2JPBA 1Y0UA 4Y13A 1PP8F 3V7RA 2F5FA 1XGMA 4ZZLA 3IHUA 1QZZA 4P5OA 2XAGA 1D3YA 1R00A 3G73A 4A2UA 4HX8A 1HW1A 3WODF 1NHAA 2XASA 4EQQA 2ZXJA 3ZMTA 1U3EM 2A61A 3F8MA 4ZYEA 5H6RA 5DDGA 3HHGA 2CO5A 3HUGA 1FPQA 2EB7A 4HQEA 4FT8A 3ISPA 2PMUA 2UZKA 2HKOA 2LF7A 1ZGAA 4XLNF 4HLYA 1BJAA 2EFOA 3M7GA 2XRNA 4AIHA 1R22A 2L4MA 3BROA 4BHCA 3U2RA 1ZRCA 4S05A 2GA1A 2RGVA 3TO6A 4HV6A 1Q1HA 5HDKA 2CG4A 4A0YA 1SFXA 1LJ9A 3K0LA 2PJPA 3D5LA 1E2XA 1O57A 1JE8A 4B09A 1YQAA 2M5WA 2O0YA 3F6VA 5LLQA 5FB2A 2WWYA 3RKWA 4M6XA 3ABUA 4JK1X 3MCZA 3HSRA 3QU3A 2XAFA 2AXLA 4HAMA 4FX4A 2L01A 3KLNA 1IAWA 3BJ6A 3QOPA 5A2QZ 2RDPA 3R61A 3B73A 4AIKA 2XVCA 3H3ZA 2NYXA 2XAJA 1PDNC 5LEJA 2V1DA 2FBHA 3TQNA 1XD7A 4HDUA 1ODDA 4M73A 1S3JA 4G94A 3BZ6A 1XGOA 3SZPA 2VOOA 2CW0F 1IXCA 1IRGA 3B02A 1J5YA 1SMYF 3JSPA 2GA2A 1IN7A 2E7XA 4MTEA 3TDUC 5J8CA 4IRHA 3P9CA 1YG2A 5AIPA 5J8FA 1FSHA 1R58A 4UV8A 1MZBA 3P9KA 2DK5A 4LB6B 1SD6A 2Z9OA 3L9FA 1T38A 2WC2A 3HYIA 1BI2A 1ON1A 1U78A 1YW9A 5IT9K 2UXNA 4R79A 5LRSA 4HLXA 1ZRFA 2IA0A 4JBAA 3IKVA 1RUNA 4RAZA 1KQ0A 1JXSA 3KP5A 3LWFA 3TO7A 1O3TA 3HSFA 2DLLA 2XHKA 3T0YA 3PFIA 4G7ZF 3HTSB 5DD8A 2KIFA 1A04A 1Z91A 1ZYRF 3HRMA 3MQ0A 2YPRA 3T5XA 1KYWA 4L5IA 3TOBA 2ETHA 2WV0A 5DUKA 2XAQA 1KU3A 5HVQC 2HR3A 2PBIA 3K1PA 3WTSC 3GZ6A 2P5VA 3L09A 2G7UA 4L9TA 4P9UA 4R8HA 3RTRA 1W7PA 2QYOA 1WI9A 4WX9A 1TQPA 3CTAA 3WTTC 3GVAA 3LQRA 4FX0A 2NNNA 3RJPA 1XCBA 2O3FA 5L3EA 2ESHA 1KQ9A 2QBYA 2CWEA 5H6QA 5HS7A 1R23A 2OZUA 2R7DA 2QWWA 2DK8A 2DFIA 3GF2A 5LHHA 1XN7A 4U0VA 5IT3A 3GYHX 1UB9A 3FX3A 2CFXA 2BGCA 1SAXA 4B8XA 6PAXA 2RNJA 3GFJA 4HX7A 4RAYA 4YIIA 1TQIA 2IW5A 1LNWA 3WG9A 5FD6A 4PZJA 4UNOA 2VT3A 2EFWA 4M72A 5K5RA 2WTEA 1R5HA 1YW8A 1K79A 1B1BA 5HLGA 1P6RA 3CLOA 4LG0B 2DU9A 1ON2A 1WSUA 3BY6A 3DP7A 4CYDA 3TO9A 3T8RA 2HQNA 2PEXA 1B9NA 2QQAA 2P6SA 5FLXK 5BS6A 2VC0A 1P4XA 4RB0A 3U1DA 3AAFA 5D4SA 5FD5A 4S04A 3KP7A 5DCFA 4HBLA 2DBBA 4O5VA 1S7OA 2OQRA 2Z5UA 3V7SA 2STTA 2FOKA 1FYKA 5K5OA 3F72A 5K1YA 2W24A 3S2WA 4E70A 3D0SA 5FFXA 4HYEA 1DPRA 2X0LA 5E8GA 4KA4A 2ISZA 1T39A 1BN5A 3GFLA 3LAPA 3ZQ7A 3VOEA 3RYPA 4HX4A 4A5NA 3WTXC 2BV6A 2FE3A 4I98B 1SD5A 3TDZC 4IF4A 1BOAA 5HDGA 5JFRA 2C6YA 1MDMA 4JQFA 3KCCA 2QLZA 2Y0MA 2ZNYA 4ZYHA 2PLYA 1C0WA 1Z9CA 1W4MA 2D45A 2W25A 2Y75A 3ZMVA 1B4AA 1W5SA 4KUMA 4P55A 1FWZA 2HZTA 3Q5FA 1U5TA 2P4WA 1WWXA 2EV5A 2XV4S 3I5UA 2GQQA 3HTUA 4RS8A 2PI0A 3M1EA 5AIQA 1BI0A 4IHTA 3E5XA 2FU4A 4UVBA 2KJCA 5DCMA 5LHGA 1UCRA 1AWCA 2NAZA 1J7KA 1LDDA 3QAHA 2JT1A 3KEQA 1RUOA 3KP4A 3FXQA 1HKTA 3BJAA 1T98A 2VE9A 2JZYA 1LEAA 2KJBA 4QWQA 2DI3A 2A68F 1QPMA 3OOPA 2ZJ2A 4HW0A 1Z6RA 4U7BA 2VC1A 4WCGA 1LEBA 4IXAA 1SFUA 3NEUA 1FT9A 2LDUA 2MLGA 1FYMA 4KN7X 5HLHA 5D6FA 2OA4A 2HTSA 1IRFA 1Z7UA 2DQLA 3JAMK 2MC3A 1S8NA 1K78B 4NB5A 1HQCA 2H94A 5BMZA 4OU0A 5F1RA 2J5OA 4N9IA 2FA5A 5LHIA 3GX4X 3ROUA 4YFKF 1IN6A 4U0WA 2EFPA 4HZFA 5H20A 1G3YA 1OPCA 1TW3A 5JR3A 3R0AA 3F6OA 1HKQA 1YYVA 2O61A 1GHCA 2FXAA 5L3CA 1J2XA 2OZ6A 2IVMA 3I4PA 1F5TA 1OKRA 2ESNA 1BI1A
chains in the Genus database with same CATH superfamily
1SMTA 2CH0A 1S6LA 3QP5A 5ICFA 2ZFWA 3FBIB 4GYIA 4B44A 1B9MA 1EH6A 3EUAA 3F3XA 4I2OA 2CU7A 5HLIA 3VODA 2M7AA 2MD5A 2K9QA 3O2PE 2HOEA 2X1DA 4DBQA 3LAJA 4YIFA 3R4KA 4W97A 2L7KA 3OYBA 2HVQA 2ZXWH 2L7FP 2O5RA 2RQPA 4A0XA 1V54H 3BR3A 1DDNA 5DV5A 1XMAA 3IH4A 1HSJA 3LA3A 1Y8QB 4I99C 4II2A 4LK1F 4OMYA 1RPWA 5ICGA 2KRFA 2DA6A 2Q0OA 1YOVB 2HI3A 2R92J 3FMQA 2CV2A 1QO0D 1CF7B 4LB5A 1IV8A 3F8CA 3G71I 2R5YA 3VYRB 1NK3P 2H6CA 3WTYC 1LQ1A 3H92A 3LOCA 4CICA 4HF0A 4XLCA 2L9VA 5IOZA 1XSVA 3CUQB 4G8XA 1AOYA 4DYRA 1FOXA 2VXZA 3GBGA 2MG4A 4ENKA 1IN8A 4BDZA 1PUFA 2KDZA 1HC8A 5BPIA 2VQLA 1P92A 4M9XA 4RLFA 4ESBA 3E6CC 5M5XJ 2OD5A 3R60A 4BE2A 3QYEA 1RR8C 1TL8A 2HOTA 2P5KA 4I7HA 1SAUA 3CMAI 4CH7A 1GV2A 1SD7A 1TC3C 3BZCA 1Y6IA 5GTHC 5B1BH 2KRCA 1FY7A 4FETA 2QZ8A 2E5ZA 2DN0A 3OIQA 4RM3A 1S5LC 1LKXA 1EH8A 4EJVA 4C2TA 2QM3A 1IDYA 4GFBA 4EATA 2D1VA 3RKYA 4EJUA 1JGGA 4XOTA 5LBQA 1SVMA 3RYRA 2ADUA 4A3KJ 4C3JJ 3J7AO 2DO7A 1X1DA 4DYCA 2R3SA 1O3SA 4PSXA 1UZCA 1V4RA 4RGRA 2VKHA 3TMOA 1YRNA 3IWZA 1RKTA 3VSLA 2DJIA 3U9GA 4PJLA 2P8TA 2ECCA 2QVOA 2CYYA 2V1NA 1D1BA 4ZDPA 3E5UA 1T0FA 2IA2A 4L18B 3SYTA 3BZKA 3DLAA 1AKHA 2M0MA 2VIXA 4AVPA 1QZYA 1R7JA 1ZGJA 4YEJA 5J1RA 4PUSA 5TJJA 4L5EA 2JUGA 2CSOA 5E1XA 3F8NA 5L3GA 3M8FA 1AHDP 2AS5F 3VSKA 1FBQA 3WTUC 2CV1A 1YIJI 3A0HC 3HOVJ 2BZTA 4KIFA 1H9GA 2PJRB 3AL0B 2VPRA 2XGDA 4WXDA 4ON0A 2DMQA 3O3KA 2E19A 4OMZA 1ZARA 5EEAA 1XCVA 2RN7A 3VWBA 1SVOA 1DP3A 4HOBA 1G2HA 5EZGA 3H5NA 5HDNA 4PJMA 3FXKA 3ECOA 3HG9A 2XRLA 3CLQA 3UKGA 3HPHA 2FNAA 1F43A 3HOSA 3IV5A 4H4KC 1EH7A 1ONVA 3HRSA 1BA5A 4KMUX 5D6EA 1SVLA 2JTVA 4A3BJ 5CVIA 1Z3YA 4A3EJ 1WGXA 3FMRA 4M3EA 4YG2F 1W7PB 2PG4A 3RQIA 4A3GJ 1X4OA 1JT0A 5DM7F 1HW5A 1ETOA 3H5RA 3QU6A 2D1HA 2X51A 3K70C 4E7JA 4YFXF 4UHTA 4A3JJ 2DA1A 3FXUA 3KP2A 4G6QA 5J1UA 5JHUA 4NC7A 1ZKGA 3W2WA 3P7NA 5BNGA 5A2QK 2OJED 2B9SA 2X1CA 3FF5A 2HYGD 2KZGA 3LFUA 2FUG2 4EGZA 2DXIA 1U6GA 1V3FA 1ITYA 4D5CA 3S16J 1RIOH 4RDUA 1AU7A 4OIOF 3DBHB 4MQVA 2CQ7A 1RI7A 3L2UA 2F5DA 1VQ6I 3FZVA 2LY1A 1P7JA 2IA1A 4BQQA 5JI6A 2BHZA 3U21A 4FCYA 2K4JA 4B3AA 2Z33A 3H3UA 3DEWA 3I0TA 3MAJA 3GTJJ 2Y48A 1WFXA 4GGGA 3HSEA 4PCQA 4L9VA 2Y30A 3L2CA 1APLC 4KITB 3A01B 3ZR8X 2E1OA 5BQTA 1VQ9I 4EJTA 3FM3A 3SHFA 2HS5A 3GWZA 4TV7A 1W5CC 3B6CA 3EYYA 1MNEA 3I64A 2OUMA 3OMYA 1D1AA 2F5EA 2JUCA 2MSYA 1JGSA 3J80K 2FSWA 3J7AY 3FXJA 3PQJA 3CESA 1UFMA 2VL8A 3GCMA 5E20A 3SDBA 3MD2A 2HKXA 1WH7A 4A6EA 1IXSB 1Z0XA 3RPUA 4Q4ZF 1JHFA 5ERIA 2J5PA 4BHBA 2XUBA 4KT5C 4ENNA 5ED4A 3CCJI 3CMMA 3HOYJ 2VASA 1KYZA 1UHMA 2LKPA 1B72A 2NVTJ 2DDBA 4OAYA 3BPXA 1U0JA 2EK5A 2LSOA 3NARA 1MJ9A 2VE8A 1KQ8A 1YX5A 3DV8A 3TGNA 1YRNB 2W82A 4UUVA 2PQ8A 2K27A 3KZIC 2FEZA 2JN6A 1T56A 2V7FA 4A93J 3JCUC 2OC6A 4GCVA 3Q3SA 1IV6A 2F4MB 3DCFA 2GIZA 1R1UA 4ZTFA 2E1CA 2KKOA 2CMPA 2CQKA 5E17F 2K86A 2E2JJ 4BL0B 1OR7A 4D0PA 1MIJA 4A3CJ 3E5QA 3JRGA 4ZDOA 1ORKA 2AQEA 1IJWC 2LBFA 5LGTA 2PN6A 3HM5A 1JHHA 1QU3A 3AFHA 4IZZA 2BVLA 2A6HF 2DQRA 2GAUA 2HDCA 1QQIA 4CO8A 3GTPJ 1QRYA 3FXOA 1FOKA 3JRHA 1Z1DA 2MLKA 2QF7A 3CUQA 3IAM2 1MGTA 4QPQA 1T08B 2EJRA 1IC8A 2ELJA 4RB1A 4KYWA 4Q48A 4I0BA 4BUPA 2R5YB 1FOWA 2Y69H 3HRUA 2WAFA 4MGRA 1R49A 1CF7A 5E3NA 2ZB9A 1SD4A 2V9PA 1CGPA 3GTLJ 1RNLA 1IN4A 3BG3A 3K6GA 3C7JA 3FXLA 4EMSA 1G3SA 2EQRA 3LSTA 4HPQA 1FSEA 1TWFJ 1OLTA 2FBIA 2JRTA 2FMLA 3WU2C 4IRIA 5DD4A 1R4NB 2ZXIA 4UUTA 2NVUB 2M7BA 1BJZA 4A6DA 4EGYA 3V7CA 4EV0A 5CVJA 3AG2H 5GPCA 1JJ6C 4XN3A 4BJ5C 2JVHA 4LIUA 3J80Z 4BBSJ 2UXXA 1FX7A 4EM1A 3SDGA 4NBQA 2GIVA 4I01A 1FLIA 4Y7NJ 1S7AA 1TP4A 4XQFA 3MKZA 4D1QA 4U88A 1BW5A 4LLLA 3FBNB 1QPIA 5F6FA 3OYKA 4XKBA 2NVXJ 3PNTA 4M6YA 2HXOA 2JA2A 3SQNA 4AUXA 3VYUB 4C2MJ 4WF2A 4N0BA 2QUFA 4HNVA 4GXOA 3PNYA 2P7CB 3WU0A 2V79A 4N4NB 2LKXA 3HHHA 3NWTA 3WE2A 4QIWN 4LD5A 3ZOBA 1VQPI 1P4AA 4WXCA 2X4HA 3KEOA 4YFNF 4BQAA 2FD5A 2KP6A 3FHZA 4LOCA 2WA0A 2F4OB 9ANTA 4V2FA 2KISA 3Q0VA 4JYKA 3I4MJ 1K4SA 5CVUA 3DXJF 1ZTRA 2ZBKA 3RIRA 3WTVC 3LNQA 3KFWX 2E1MC 1XB4A 3IH2A 4ZJZA 3KETA 4G6DA 2COMA 2LF8A 2L9RA 4AVZA 2NS8A 4Q5SF 4ESFA 3AKZA 5LEKA 2JSPA 5C4XJ 2R7QA 3W6KB 4D9JA 4B43A 3LA2A 3I59A 4L0ZB 1OCRH 4BU2A 1GUUA 5CJ9A 4LJZF 4NDLA 1QVUA 2RREA 1JKPC 1JTYA 4DQ2A 3HXLA 4XLFA 3MN2A 4XN0A 2VBZA 1X1AA 4UUSA 1DPUA 4UUSB 2DA2A 2X6OA 5EF6A 2IRFG 3A03A 1T95A 4U0YA 1E17A 3QP6A 2Y9YA 3BR0A 4KT6A 1R9TJ 3CP8A 3DPTA 1VTNC 4E6KG 2HOAA 4AWXB 1HF0A 3MZHA 1U5TC 3SFZA 3I59B 1NK2P 4XR6A 2MBFA 3ULQB 5L3FA 1DQUA 5J47A 2NNYA 3I53A 5CQEA 2WY7Q 1MBKA 1XGNA 2AO9A 4M71A 3CC7I 2WB1A 2KIMA 3TW7A 1FMVA 3W3CA 4BAYA 5FROA 4PSWA 4Y4RA 4C9YA 2VLAA 1MDMB 2LLKA 1EA3A 2GWRA 2QQ9A 1RRJA 4LLNA 4IVNA 4OIPF 2Q2EB 2BW3B 2VQHA 5JLWA 3ZPLA 4BS9A 2BY3A 1R5ID 1K61A 5IYCJ 1XMXA 4XL9A 3G6EI 2CW7A 1UMQA 1JKRC 3CO7C 1WVRA 2L5QA 4KISA 2O9LA 1D5YA 1ZG5A 3MMYB 2E1NA 3L00A 1MMAA 5H2FC 1VQ5I 3HOXJ 4UVCA 2HDDA 2LTPA 1WH5A 4F91B 4BQOA 1YJWI 2BYVE 4QLCU 5M3FJ 1XPXA 2IGKA 3EDPA 4XNFA 4G6TB 2FOWA 1BL0A 2VBWA 2DPUA 2QCOA 2DMUA 2EPFA 3M4OJ 3S2HJ 4J01A 2IPQX 3CJTB 3K70D 1K83J 2COBA 2H8WA 1JJ8C 3C18A 1U5TB 2R4GA 3OWTA 4C30A 3V4GA 3KIOA 1H0MA 3BWGA 4Y33A 1FIAA 2H09A 1R4MB 2ZJRF 2XGEA 1HLVA 2EA4A 4CSWA 4H0EA 2K85A 3MVPA 1EJ9A 5EGOA 4F92B 2JA8J 3D1NI 1BI3A 3NRVA 1I3AA 3PJRA 2ID3A 4P9FA 3OYMA 1MH3A 3RPQA 1I6HJ 3GFMA 3K69A 4L0YB 3V8KA 5E79C 4G9YA 2IAIA 1HDDC 1YW7A 4JP0A 2M1BA 4XRFA 1Z67A 3LSIA 3REOA 2I5UA 1DGRM 3BR6A 3HJEA 3BLYA 2O6GE 1A5JA 2JSCA 3J81Z 1XC5A 2EFNA 2OCCH 1F1ZA 2EINH 1VQNI 1AA7A 3CO6C 2R7SA 3LA7A 4O6JA 4HA8A 1HSTA 3BOQA 4WXHA 5EG0B 5L3BA 1K6OA 4Y52J 1WJCA 2HWVA 5HS8A 2K7LA 1RC9A 1BIAA 1LFUP 4HF1A 2ME0A 3M9AA 3JSOA 4X6AJ 5CKTA 3ZCOA 2V6EA 2HQRA 2FMYA 3DKXA 4EJWA 1IRXA 3HGYA 3T8TA 1FBSA 4LMYA 3NQOA 1GDTA 3FM5A 2VONA 1DUXC 4S0HB 1F9NA 4DW6A 1YS6A 5BPDA 2XAUA 4J19A 2VQCA 1IDZA 5FGMA 2EV0A 2FBKA 4L9NA 3W6JB 3WHCA 1HXDA 2KLOA 2CQQA 1MD0A 4ZC3A 2P7VB 2LP0A 1FC3A 4ENJA 5E8IA 2Z3YA 2F4IA 2KT0A 1ETQA 5E3OA 3OYNA 3TW6A 2VT2A 1TW2A 1Z05A 3F8FA 2DOAA 1RZ4A 3ZQIA 1D5VA 3TL4X 3LL7A 1MKMA 1JT6A 1X19A 3HBLA 2XKPA 1XX5A 1BOBA 3JAMZ 1VQ7I 1IRZA 3A01A 2G9WA 4BEHA 3E97A 4MO7A 2QBYB 4BE1A 4IRGA 3PUBA 2P5LC 1HDPA 2LG4A 3PUFA 3W2AA 2VBXA 2UWMA 2LK2A 4F55A 1R1VA 3VEPA 3WU1B 4I02A 3KYLA 1FYLA 3WGIA 1Y1WJ 5EGOB 4IX7A 2L02A 2W84A 2L54A 5B1AH 2BBYA 1D0YA 2A6EF 5D5VB 3K9TA 2YU9J 3IRRA 5D5UB 1L3LA 5B66C 4RB3C 3KP3A 2QGUA 1STZA 3FXRA 4I6ZA 1T6SA 1WJFA 3GW2A 2K3FA 2LNBA 3C3WA 5IT9Z 3KZYA 3JRIA 4C2UA 3CCYA 5F64A 4XKCA 4RB2C 3CCSI 5FFZA 1ZLJA 1ZQ3P 5HNFA 3S17J 2F2EA 1WJDA 4B3XA 2BE5F 3IWFA 5E1ZB 2KFDA 3DTIA 2WB1N 3J81K 4KMFA 2H6BA 3ELKA 5J4YA 2ZJPF 4CHUA 1XDSA 4ZZDA 2ZMEB 2EV6A 3DWLE 1W36C 5D5XB 3HOWJ 3GTMJ 1XDUA 3BCAA 4Z6YA 2W85A 3CD6I 3GEZA 2FF4A 1LE8B 1OYIA 1BIBA 3S15J 2E71A 1J0RA 3LSPA 3OYIA 4HNUA 1YHQI 1ETXA 5E1WA 3I71A 2DAOA 2NS0A 3M1CA 4M3FA 3M8EA 3OYAA 3N97A 2HQ5A 3BTCA 4Q47A 3K4LA 2VXDA 5EEHA 2HPMA 1ZREA 3MFKA 2CQNA 3RKXA 4RBOA 2LFBA 4YRVA 4MEYF 4NQWA 4ZH4F 1O7FA 3RI4A 2V6CA 3OL3A 2V9VA 3QPTA 2EILH 3OV8A 3F0CA 5TISC 2K4BA 3WTWC 2ZSHB 4EVIA 2M87A 3T1BA 1E0EA 2H1KA 2STWA 3SEZA 3I55I 5CVRA 4CCMA 2FQ4A 2JA6J 3PFYA 5K5QA 1SFEA 2YSRA 2YU3A 5D5WB 3G1MA 1YS7A 3DQVC 4DNCA 1PP7U 2XROA 3S1NJ 3IKTA 3I4NJ 1MH4A 1U9OA 4N9HA 1AKHB 3R0JA 1D8KA 2CQXA 3FHNA 1IUYA 2M45A 2EZHA 2OQGA 3FK6A 1WZ2A 1W0UA 1G8XA 2BY0A 3Q9VA 2R93J 4M9SA 2VN2A 1QVTA 2Y31A 2K5CA 2B63J 1MJAA 1JUMA 4XOPA 3CCMI 2VOPA 3ZMDA 2F6CA 2V1XA 1HW2A 2LH9A 1FMWA 4AYBA 2MYSA 1LFBA 1GXQA 3BR5A 2V1UA 1YFHA 3RDIA 1GV5A 1P2FA 2VJJA 1SEUA 2QQBA 1IXRC 2A5YB 1O3RA 3PSFA 1FP1D 2VB6A 1B8IB 2UUZA 5FKNA 4BXUA 3DEUA 4A12A 1W36D 1VQ8I 5ILSA 2F5CA 4U7DA 4LITA 3PL8A 2HVSA 2KQRA 2IT0A 1P7IA 2GXBA 2HEOA 1XGSA 1IN5A 3A4CA 5DYMA 2WAQA 3ZMZA 1R5GA 2X9DA 5F1JA 3ERED 1OCCH 4AD9A 2NS7A 4HV5A 2LMDA 1MBGA 4LGWA 4PDKA 4M9ZA 1UHSA 2M34A 3LSGA 4CGZA 2W00A 4XMYA 2LREA 3SXYA 4MFEA 4G12A 1DU6A 4BNCA 3WG7H 2DA7A 1E3HA 2R7FA 4O3MA 3KX2A 3QPHA 2AHQA 4MTDA 1FP2A 2XF5A 2XPWA 4BQNA 3BP8A 1QNTA 1POGA 1IGNA 4UV9A 2A6TA 3OR1C 2TRTA 2VQGA 1M1EB 5EZHA 5LD2C 1VI0A 4XIDA 3ZMSA 3F23A 4BDYA 2Z1DA 1B6AA 5DEQA 4A5MA 1KGSA 2RVCA 1KA8A 4HSTA 4XKWA 2E60A 1G59A 1ENHA 4AU7A 3BG5A 4XSZF 2RC4A 3FWEA 3H9JA 4UVAA 2M4GA 5F04A 1ZN2A 1D8JA 5J4VA 3CQZJ 4KIGA 1IW7F 4DZPA 3P5JA 2GOXB 3BTJA 3JTHA 4ESJA 3KYCB 1FIPA 2ELKA 2MABA 4MEXF 1LPQA 3QODA 5ICEA 2YR2A 3RQ4A 2OBPA 4KJZA 2VI6A 4KICA 4HSRA 1U8BA 1I5ZA 2XIGA 2CJJA 3K1MA 5L3DA 2HYFA 3ERMA 5C3EJ 3KE2A 1J09A 3CCQI 2OTLI 2DT7B 2FNPA 2KIUA 3LSKA 1ZHFA 3HPGA 2EIMH 2JPCA 2FRHA 2DT5A 2JA5J 2ACJA 3Q9SA 2HDWA 1USSA 4I0AA 1UJ8A 1Z6TA 2EFQA 1Z7LA 2L4AA 3KP6A 4D7NA 1REPC 2HXIA 3OYHA 2L3DA 1BW6A 1TNTA 1Y39A 2RKHA 3OSFA 3F22A 4OIRF 2A3SA 3CF5F 2R7VA 1X3WB 3ZP5A 5D8LB 2JVGA 4PGHA 4G7OF 3JRCA 2RV8A 1FZPB 5B5EC 3BQYA 3SJMA 3BJOA 2DCEA 3IL2A 1R1TA 4KIBA 1ZG3A 2ZKZA 1L0OC 1K78A 5HOOA 3E6MA 3MWMA 3GFIA 1UHWA 4HQMA 5E18F 2D2WA 3O6BB 3IC7A 1GLNA 1TBXA 1PJRA 4CDGA 4B47A 5CLSA 4G7HF 1LVAA 1T33A 4IL6C 1MBFA 1LVKA 2JK3A 3BDDA 3H9QA 1ZG1A 2RNGA 2Z99A 2MH2A 4BXFA 2CS3A 2KZVA 3JR9A 2WADA 1XSDA 2CGPA 3GZ5A 4B4CA 4Y17A 2A07F 2H27A 3E3VA 1B59A 4BXXJ 5GAHJ 3LQQA 2NVQJ 2L7ZA 1ZH5A 1WRJA 2E7WA 3SZTA 3CDLA 1TNSA 1WJ5A 5FKMA 5KAFC 4IHYA 4LIVA 1YO5C 3FK7A 2NRAC 2VODA 3K4CA 1WQ2A 4I76A 4GO1A 3R6SA 4EM0B 1W7PD 4X1EA 3DFGA 4HF2A 3GUDA 4LK0F 1RR7A 4P1WA 1J9IA 1T2KA 2VBYA 2LR8A 3TKYA 5IYDJ 5JVTA 2OPTA 1VQOI 3A2KA 4KNYA 1RKWA 3HDDA 1S7EA 3L2RA 5GPAA 1W5TA 4XM3A 4RGSA 1MJBA 2VKDA 1VZ0A 5CVVA 3V8LA 2DA3A 4QTRA 2Q8KA 4PGGA 1QBJA 2XGCA 2W4SA 4PK4A 1O3QA 4NUBA 3AG4H 2CUFA 3WGGA 1YI2I 4UXNA 3OS1A 3PM1A 3HL2A 4PJJA 1B8IA 2IJLA 4XBFA 3S93A 5HNHA 1GXPA 4NHJA 2CUZA 1D0XA 5KHDA 3DLLF 3U1KA 5JHFA 5K7FA 1JUSA 2L0KA 2KDOA 3I56I 5KVRA 4ABZA 4KDPA 4WWCA 2R7ZJ 2XGXA 3GZNB 5FRNA 2V26A 1MNDA 3AG3H 3KZZA 4PFOA 4XKVA 2IS4A 1Y8RB 5LGUA 2K02A 3K2ZA 1UG2A 2LY2A 3C1DA 4I09A 1TLHB 1USTA 3QPLA 1YLFA 2A5WA 3VB2A 4BY1J 2E35A 3BC8A 3DBRB 2YX4A 4K2EA 1OQYA 1F4KA 2DOEA 5IP7J 3WE3A 5FKLA 5ILVA 4HDVA 4D7MA 5FLXZ 5DM6F 3QYBA 1G3WA 1S9HA 2M8EA 4II3A 4L9JA 3CMYA 5LRRA 3EQLF 3EUHC 1K4TA 3ABKH 2IGOA 1SC7A 3G1OA 1S29A 4GYGA 3BPVA 2QSFX 2K9SA 4BHPA 3ECHA 2IGMA 5J6XA 4ZYGA 4ETSA 3QWLA 3GO5A 3JRAA 4MNUA 1OISA 1MBJA 1XMKA 2PFBA 1EF4A 1O4XA 3LSHA 4R1HA 5ICCA 5BOXA 2XC7A 2E36A 2JJ7A 2Z2SB 1FOYA 4RMNA 4DIQA 2FX0A 3MZYA 2OAZA 5F0HA 2XKOA 2GOMA 3G4SI 3SFIA 3M07A 1ERDA 3E6DA 3CCLI 2VJIA 1DP7P 1LUJB 3G3ZA 4F7ZA 3IAS2 2ZMEA 2L7MP 1OFCX 4IPAA 3ABMH 2EWNA 2ELHA 3Q0UA 2DA4A 3O8GA 2VKEA 4NQWB 4XLPF 2MA3A 3WTZA 2HFHA 3TBIA 4EM2A 3PQKA 5HS9A 3CJNA 5TGTA 5LGNA 4XSXF 2PMHA 2O8XA 1HBXG 3E1SA 1JUPA 3K10A 3HB9A 3TEDA 4EJOA 4BJTA 1TZLA 2OF7A 5IPAA 2NXNB 4Y3OA 2ISYA 3ZN0A 1ULYA 1I1GA 4ZYDA 1X1CA 2YX7A 4MQ9F 1PUEE 2F48A 4BACA 3S3NA 1BM9A 1OYYA 3ML6A 4Y15A 2EH3A 4BKXA 1P4WA 4FE7A 3SEQA 2F5VA 2M0CA 2BHYA 1J75A 2OU2A 4M6VA 1T0FC 3VFZA 4P96A 3FKJA 4AIJA 3GTOJ 2MH9A 1V5GA 1QHGA 1H9TA 4OIQF 1XSXA 4AYBN 4DOZA 2EZKA 2X6XA 3HZJA 3PIOF 3DF8A 2QKLB 1KONA 3H9GA 2M8GX 3HOTA 1TTYA 5IY5H 1BBYA 3WGHA 4IJAA 1ZLKA 3OS2A 2R5ZA 4A3MJ 3L7WA 2NVYJ 2EA2A 1G6NA 4AC0A 3JTGA 2LBFB 2DFEA 1PVEA 2IP2A 3KLOA 2HTJA 2LYCA 4E7LA 3G1LA 2ECBA 4FISA 4M3BA 3K4BA 4DYQA 2L9SA 1JKOC 4BEHB 2P0WA 5FO5A 2ZCWA 4LG0A 3PO2J 1EV7A 2HGCA 5ILUA 2B0LA 3CDHA 4A0ZA 3MEXA 3EYIA 2XSDC 4MFDA 4V2GA 4E7ZA 3J7YJ 3E6BA 4C3HJ 5GADJ 1U2WA 1IF1A 2ZNZA 1GVDA 1X3UA 3MKLA 4LLGF 4HEA2 1YITI 1BC7C 4RAGA 4WK8F 5EDNA 2JQ7A 5KK1A 3I54A 3LMMA 5M3MJ 2RQQA 3F21A 3VDXA 3CCUI 2DW4A 3EETA 1YTYA 1ZAOA 4L5JA 1WKMA 2W48A 3UNGC 3HIFA 2O03A 4M3GA 1IO2A 1X2NA 2PX9A 4CCNA 4JX5A 4E7KA 2DTRA 2Y0SN 2GM4A 1N75A 3LFKA 1FNNA 1ZELA 4IOAF 2R5ZB 1K7AA 1RETA 2I10A 1TWHJ 2GXGA 3ZN1A 2MD0A 1DU0A 2BEOA 3N4MA 1MSEC 1QGPA 1KU9A 2KIQA 4BYYA 3CP2A 3I58A 2K40A 5CYVA 3D5SC 1VF9A 1U8RA 3CUOA 1MSFC 3CUQC 4MHGA 3CZ6A 2WV1A 3X2QH 2V4JC 2QQ8A 3P9IA 5TRDA 2IBDA 1OYWA 1TT5B 2W7NA 5IYBJ 1LDKB 3HRTA 2ZO4A 4M74A 5HODA 3TOAA 1EKEA 4RGXA 5D8KB 2M3AA 1IZ1A 1X3ZB 3ZQQA 2QENA 3IH3A 3G2BA 1OMIA 2XPVA 1HKSA 2K9MA 1G3TA 4OOIA 1TT0A 5FLMJ 3DKWA 4OINF 3OSGA 2W57A 2DODA 5DUIA 3GLXA 4FHTA 3ESWB 4BY7J 2NOGA 1G4DA 1A35A 2A69F 2JWTA 4CZZA 4Z2YA 3COAC 2Q2EA 1TQMA 1GVJA 3V8JA 2X6WA 1R36A 1J59A 2G7HA 1K6YA 1Z21A 3S3OA 2DOFA 3Q0WA 2R0QC 3K1NA 2Q1ZB 1I1SA 4KFCA 2ID6A 1LB2A 2XAHA 1O7LA 1YX3A 2M9HA 2GLOA 2DPDA 4RGUA 2M30A 3EUHA 3OY9A 4ZYAA 4ZTJA 1KU7A 3ZGKA 3CF2A 5F0FA 3GXOA 4DBRA 3ABTA 3JW4A 5KNLA 3DU6A 5DCMB 3CMEI 1ZRDA 5EEGA 1WJEA 3ZQGA 5D4RA 2BOLA 3OIPA 3ZMUA 1FBUA 3FMSA 2FJ1A 3BG7A 4ENMA 1I27A 1YIOA 5CQGA 5E3MA 1TWCJ 2P6TA 2QSHX 4LFUA 5J40A 4E7IA 2R7XA 5AONA 4ANJA 3K4KA 3F8BA 1FJLA 3CCVI 2GZWA 3A02A 3IRQA 1I6XA 1R6RA 4IHSA 4HNTA 3QRFF 2FQ3A 1LDJA 1BC8C 2WY8Q 3H0GJ 4ASNA 4CXFA 2TDXA 1UAAA 3DPLC 3W2VA 1KU2A 5IOYA 4KN4X 1MBHA 1HA8A 4A3IJ 2K3PA 4BH9A 2JPBA 1Y0UA 4RLQA 4Y13A 1PP8F 1V55H 3V7RA 2F5FA 4IHWA 4CYCA 2V9KA 1XGMA 3BG6A 1U9NA 4ZZLA 1W1WE 3IHUA 1LFPA 1QZZA 4P5OA 2XAGA 3FKIJ 1D3YA 1R00A 3G73A 4A2UA 4HX8A 2XDVA 1HW1A 2GXAA 3WODF 1NHAA 3EUKL 2XASA 4EQQA 2ZXJA 3ZMTA 1OCOH 1U3EM 2A61A 4CA0A 3A0BC 3HOZJ 2L9NA 3F8MA 2QKMB 2XSJC 1JI8A 4ZYEA 5H6RA 4B1RA 5DDGA 1XS9A 3HHGA 3OIOA 2CO5A 3F9KA 2K9NA 3H1CA 1RESA 3HUGA 1FPQA 2EB7A 4HQEA 1VQMI 1VNDA 3ISPA 4FT8A 2PMUA 4JOMA 2EZLA 2UZKA 2HKOA 1HCRA 2LY9A 3DPUA 2LF7A 1ZGAA 4XLNF 1MMNA 3L2VA 1QZEA 2TCTA 4F93B 2LOOA 5C4JJ 4HLYA 3IP4B 1BJAA 1TWAJ 3RPUD 3RZDJ 2EFOA 3M7GA 4OAZA 3OYCA 2XRNA 4AIHA 5E3LA 4NC8A 1R22A 2L4MA 3BROA 4BHCA 3U2RA 3S2DJ 2DFHA 1ZRCA 4HRIA 3I9V2 2ME6A 4S05A 2GA1A 3MZ8A 3DKYA 2RGVA 1V5EA 3TO6A 2LRDA 4HV6A 1Q1HA 5HDKA 2CG4A 4A0YA 1D1CA 1KZHA 1SFXA 3HKZA 1LJ9A 1NH3A 2AQFA 1BR1A 3K0LA 4CCKA 5JVGF 2PJPA 1X2MA 3JRFA 1H89C 4XRSG 1SANA 2IXSA 3D5LA 3FDYA 4N4OB 2VUMJ 3FXMA 4X0GA 1YJNI 1E2XA 5IP9J 1O57A 1JE8A 3OYGA 3LSRA 4B09A 1YQAA 1OCZH 3M8JA 2M5WA 2O0YA 3F6VA 4E4HA 5F0CA 5LLQA 1X4PA 2BY1A 5FB2A 2WWYA 4CCOA 3RKWA 2OV7A 3ABUA 4M6XA 4JK1X 2CFOA 2M4KA 3MCZA 3HSRA 3QU3A 3MKWB 1IUFA 2XAFA 1Z77A 3DBLB 2AXLA 5J3LA 4HAMA 2R7TA 4FX4A 2L01A 2O8KA 3KLNA 2O7OA 1I3QJ 1IAWA 2Z16A 3BJ6A 3QOPA 2IEKA 3HUGB 5A2QZ 1MBEA 5M5YJ 3OYJA 2AXTC 3S32A 2RDPA 1Q1VA 3R61A 4XLEA 2QSGX 3B73A 1XTAA 2HU9A 2XVCA 4AIKA 3H3ZA 2E2HJ 5IP6A 2NYXA 2XAJA 3UR3C 4RAFA 5CPRB 1PDNC 1ZR4A 3B6AA 4UB8C 5LEJA 2V1DA 2FBHA 3TQNA 2KHMA 1B72B 1MNMC 1XD7A 1WCMJ 4HDUA 1ODDA 4BE0A 2XB0X 3MKYB 4B48A 4M73A 2X1EA 1S3JA 2D5VA 3NAUA 1SFKA 4G94A 3BZ6A 1XGOA 3SZPA 2VOOA 3DEEA 2DA5A 5K7HA 3GTGJ 2CW0F 1IXCA 3E0JB 1IRGA 3B02A 2E2IJ 3H5AA 1J5YA 2Y9ZA 1SMYF 2DYSH 3JSPA 2GA2A 1IN7A 3FIWA 4PFPA 3C2BA 2W1OA 2E7XA 2Y2ZA 4MTEA 3TDUC 3OYLA 2CW8A 4IRHA 5J8CA 3P9CA 1DGWY 1YG2A 3BG9A 5AIPA 5J8FA 1FSHA 1R58A 3ZQCA 5FLVA 3M3YJ 4UV8A 1MZBA 3H3VK 5DTDA 2JRMA 3P9KA 2DK5A 4LB6B 1SD6A 2Z9OA 3L9FA 1X1BA 1T38A 2WC2A 3HYIA 1VQKI 1W0TA 1BI2A 3S14J 1ON1A 1U78A 1YW9A 4V19K 5IT9K 2UXNA 1IG7A 5GTIC 4R79A 4A3DJ 1WI3A 5LRSA 4W1UA 4HLXA 4OWRB 3H36A 4NNJA 5FJ8J 2EIJH 1ZRFA 3L2WA 4XK4A 2MW8A 1X58A 3GLLA 3HOUJ 2IA0A 4JBAA 2YUSA 3IKVA 1RUNA 4RAZA 3C2GA 2E5NA 1MW7A 1KQ0A 1JXSA 1CQTA 3KP5A 3LWFA 3TO7A 1O3TA 2RAEA 4E7SA 3KYDB 3HSFA 4XORA 2DLLA 2XHKA 1Y0NA 2BXZA 2X85A 5B3SH 3T0YA 1E3OC 3PFIA 4G7ZF 2BY2A 4XRMA 3HTSB 4JX6A 3W6VA 3SZGA 5DD8A 2KIFA 1A04A 1Z91A 1I39A 4EEFG 3KPHA 1ZYRF 3HRMA 3MQ0A 2DMNA 2YPRA 2ZXHA 3T5XA 1R71A 3RZOJ 1KYWA 4L5IA 1ETVA 3TOBA 2K9LA 2ETHA 2PMZA 2WV0A 5DUKA 2XAQA 1KU3A 5HVQC 3JRDA 4QPOA 2GBYA 4AIDA 2HR3A 2DFFA 2PBIA 3K1PA 3K4NA 1FEXA 3WTSC 4PJ0C 3GZ6A 2P5VA 2DT6A 3L09A 2PJRA 1MMGA 2G7UA 4L9TA 4P9UA 4R8HA 1T8IA 1E3PA 2IS2A 2UV1A 4BBRJ 3RTRA 1W7PA 2QYOA 1WI9A 3IUOA 3C2HA 4GDFA 1VQLI 4WX9A 1TQPA 4ITVA 3CTAA 2HPIA 3WTTC 3E7LA 3GVAA 2MGQA 5HLTA 4XRSA 2LC2A 3LQRA 4U87A 1FTTA 4FX0A 4CZCA 2NNNA 2KMUA 4E7HA 2ZFUA 3QYFA 3RJPA 1XCBA 2O3FA 5L3EA 1QHHD 1KQ9A 2ESHA 3OS0A 2QBYA 1FTZA 2CWEA 5H6QA 5HS7A 1R23A 4FASD 3K4JA 3BCBA 4XLHA 1NG6A 2OZUA 2R7DA 4J00A 2QWWA 2DK8A 2ZJQF 2DFIA 1OCPA 3GF2A 3WHBA 5LHHA 1XN7A 4U0VA 5IT3A 2XB5A 3GYHX 1UB9A 3HKZN 3ONQA 2XF6A 3FX3A 2CFXA 2BGCA 1SAXA 3H0DA 2X6YA 4B8XA 3CDIA 4XONA 5KCMA 6PAXA 2RNJA 2LVSA 3GFJA 4HX7A 3CJQB 3N05A 1V5FA 1LE8A 4RAYA 4ZDLA 4YIIA 1TQIA 3S1RJ 2IW5A 1LNWA 1H88C 3WG9A 5FD6A 4PZJA 4UNOA 2VT3A 3V42A 5EG0A 2EFWA 1PUFB 1OR7C 4M72A 5K5RA 1BR4A 3D5RC 2QA4I 2WTEA 1R5HA 1YW8A 4DGWB 2XPUA 1H8AC 2JA7J 5K7ZA 2CRGA 1K79A 1B1BA 3BT9A 3AG1H 3TP0A 5HLGA 2YS9A 1P6RA 3CLOA 4LG0B 4BJ6C 3CCEI 4IKFA 2QEXI 2DU9A 2NOJB 3H35A 3DTKA 1ON2A 1WSUA 2CUJA 3BY6A 3DP7A 4CYDA 3TO9A 3T8RA 3BTLA 1A36A 5F27A 2HQNA 2PEXA 3BR1A 1GT0C 1B9NA 4XICA 2QQAA 2P6SA 4PJNA 3S3MA 2VJ5A 5BS6A 1ZR2A 5FLXK 2VC0A 3CC4I 2LKSA 1PYVA 4FTHA 1P4XA 4RB0A 4XLAA 3U1DA 3AAFA 3VYSB 2R7WA 5D4SA 2HNHA 5FD5A 4S04A 3KP7A 5DCFA 4HBLA 3CJRB 3K2AA 1S72I 3S1QJ 2DBBA 4O5VA 1S7OA 2VPLA 3OOUA 2ZC2A 1QA6A 2OQRA 2Z5UA 3V7SA 2STTA 2FOKA 2IGNA 3RKQA 4MLOA 5FKKA 1TWGJ 5K5OA 1FYKA 3O8HA 3F72A 4BGDA 3ABLH 5GP9A 5K1YA 4IQ4A 1Y56A 4JX4A 3BR2A 1ETYA 2W24A 3S2WA 4E70A 4FQGA 3D0SA 5FFXA 3NWSA 3OYDA 4HYEA 1DPRA 2X0LA 5E8GA 4KA4A 2ISZA 2DTZA 1T39A 3OYFA 3QPSA 1BN5A 1UELB 2WAEA 2DMTA 3GFLA 3LAPA 1MMDA 3ZQ7A 3QOEA 3ZQHA 3VOEA 5FRMA 3HEFA 3DTEA 4F52A 3S1MJ 3RYPA 1I50J 3JRBA 4HX4A 1ZGWA 4A5NA 2OCEA 2BV6A 3WTXC 2FE3A 4I98B 4YIRX 3PO3J 1SD5A 2BW3A 3TDZC 4IF4A 1OCTC 3ASOH 1BOAA 1NG7A 3VYTB 2X48A 1ACIA 5HDGA 2B7EA 3J7ZI 5JFRA 2C6YA 1MDMA 4JQFA 3KCCA 2QLZA 2MC4A 2KPMA 2Y0MA 4F3QA 1P9QC 2ZNYA 3ZQLA 4ZYHA 1WJBA 2PLYA 3L1PA 3OL4A 5LFAA 3ZXSA 1C0WA 4D5FA 3PNVA 1X1PA 1SFOJ 1Z9CA 3K7AJ 2IS1A 2I8DA 3L2QA 2H8RA 4CUGA 4CYCB 1N25A 4UB6C 3S8PA 1W4MA 4CCLA 4A3FJ 2D45A 2IS6A 2W25A 2OTJI 5EJCA 5GAEJ 2Y75A 4RM2A 3ZMVA 1B4AA 1YE9A 4UY8I 5FKOA 1W5SA 1ETWA 4KUMA 1A31A 4P55A 1FWZA 3HC7A 2CV0A 3QQAA 3GMEA 4DZJA 1JTXA 2HZTA 1A6QA 3Q5FA 1U5TA 2EZIA 1N77A 3BTIA 1F36A 2P4WA 2E34A 2DYRH 2EIKH 5C44J 1WWXA 2EV5A 2XV4S 3I5UA 2GQQA 3HTUA 4RS8A 2PMZN 2PI0A 3M1EA 3PSIA 5AIQA 1BI0A 3TP3A 1WHUA 1Y1VJ 2KRHA 2ZMEC 5F08A 2HZDA 2P81A 2CUEA 3OR2C 4HG2A 1WPKA 4IQJA 1A6IA 4IHTA 1VQ4I 3ZQFA 3E5XA 2FU4A 2L2OA 4UVBA 5KAIC 2LD5A 2KJCA 2R7UA 5DCMA 5LHGA 2N8GA 1UCRA 1AWCA 4IHVA 2NAZA 3VPRA 4YELA 1XG1A 1J7KA 1LDDA 3QAHA 2H1LA 2JT1A 3PIPF 3KEQA 1RUOA 1YJ9I 3I3LA 3KP4A 3FXQA 1HKTA 3ASNH 3BJAA 4IO9F 2WBMA 1T98A 2DJNA 2VE9A 2JZYA 2A05A 1LEAA 2KJBA 4QWQA 3GTQJ 2DI3A 2A68F 5GAGJ 3CCRI 3AL0C 1VFCA 1QPMA 1WJAA 2E1MB 4FE4A 3CC2I 3OOPA 2ZJ2A 4GRIA 4HW0A 1Z6RA 4C3IJ 4U7BA 2ZSIB 2VC1A 4A69C 2Y0SA 2JMWA 4WCGA 5M5WJ 1LEBA 2M2EA 4IXAA 2DMPA 1JKQC 5EYRA 1SFUA 1ZK8A 3NEUA 1FT9A 4IHXA 2LDUA 2BVMA 2HOSA 3FISA 2MLGA 1FYMA 1Z3XA 4KN7X 2EBIA 5HLHA 1NTCA 5D6FA 2VKVA 2OA4A 2HTSA 1IRFA 1Z7UA 2BXYA 3LSMA 5DS9A 2DQLA 3JAMK 2MC3A 4MIMA 1S8NA 1UG0A 1K78B 4NB5A 1MMSA 1HQCA 2H94A 3LSJA 3RCOA 4OU0A 5BMZA 4CCJA 2J5OA 5F1RA 4IOCF 3OYEA 4N9IA 2WAQN 2FA5A 2HYJA 2XF7A 1OJLA 5LHIA 3ROUA 3GX4X 2HVRA 3ZRGA 2R7RA 4DJAA 3JREA 3A1YA 4YFKF 1IN6A 2DDAA 2G0EA 4U0WA 2EFPA 4HZFA 3BQZA 3DU5A 1D0ZA 5H20A 4IEJA 3EPZA 5JLXA 5J1YA 4NC6A 1BR2A 1HOMA 4LG3A 4RA2A 1G3YA 1OPCA 3RSNA 1N78A 1TW3A 2ICWG 3GTKJ 3HGGA 5JR3A 3R0AA 4A3LJ 3F6OA 1HKQA 2KL4A 1YYVA 2O61A 1GHCA 2FXAA 2MFZA 5L3CA 4AM3A 1J2XA 3KEYA 2OZ6A 2HQAA 4QSHA 2IVMA 2VJ4A 3K4MA 1ETKA 3I4PA 1F5TA 4M3DA 2R7OA 1OKRA 2ESNA 1BI1A
chains in the Genus database with same CATH topology
1SMTA 3QP5A 1S6LA 5ICFA 2ZFWA 4GYIA 1B9MA 1EH6A 3F3XA 4I2OA 3VODA 5HLIA 2MD5A 3O2PE 3LAJA 2HOEA 4YIFA 3R4KA 2RQPA 4A0XA 1DDNA 5DV5A 1XMAA 1HSJA 3LA3A 4LK1F 4OMYA 5ICGA 2KRFA 2Q0OA 3FMQA 1QO0D 1CF7B 4LB5A 3F8CA 2H6CA 3WTYC 1LQ1A 3H92A 4CICA 4HF0A 1XSVA 3CUQB 4G8XA 1AOYA 2VXZA 4ENKA 1IN8A 5BPIA 4M9XA 1P92A 4ESBA 3E6CC 2OD5A 3R60A 2P5KA 4I7HA 1SD7A 1FY7A 2QZ8A 1EH8A 4EJVA 2QM3A 2D1VA 3RKYA 4EJUA 5LBQA 3RYRA 2ADUA 3J7AO 2DO7A 2R3SA 1O3SA 4RGRA 1V4RA 3IWZA 3U9GA 2P8TA 2QVOA 2CYYA 3E5UA 1T0FA 2IA2A 4L18B 4AVPA 1QZYA 1R7JA 1ZGJA 5TJJA 5E1XA 2CSOA 3F8NA 5L3GA 3M8FA 2AS5F 1FBQA 3WTUC 4KIFA 1H9GA 4ON0A 4WXDA 3O3KA 4OMZA 1ZARA 1XCVA 2RN7A 4HOBA 5HDNA 3ECOA 2FNAA 3HOSA 1EH7A 1ONVA 3HRSA 4KMUX 5D6EA 2JTVA 5CVIA 3FMRA 4YG2F 1W7PB 2PG4A 1HW5A 3QU6A 2D1HA 4YFXF 4UHTA 4G6QA 3FXUA 3KP2A 5JHUA 3P7NA 5A2QK 3FF5A 2HYGD 4EGZA 1U6GA 1V3FA 1RIOH 4OIOF 4MQVA 1RI7A 2F5DA 3FZVA 2IA1A 5JI6A 2K4JA 2Z33A 3H3UA 3I0TA 3MAJA 2Y48A 4GGGA 3HSEA 4PCQA 4L9VA 3L2CA 5BQTA 4EJTA 3FM3A 3SHFA 2HS5A 3GWZA 4TV7A 3EYYA 3I64A 2F5EA 1JGSA 3J80K 2FSWA 3PQJA 1UFMA 5E20A 2HKXA 4A6EA 1IXSB 3RPUA 4Q4ZF 1JHFA 5ERIA 2J5PA 4BHBA 2XUBA 4KT5C 4ENNA 5ED4A 1KYZA 1UHMA 2LKPA 3BPXA 2EK5A 2LSOA 1KQ8A 1MJ9A 2VE8A 3DV8A 3TGNA 4UUVA 2PQ8A 2K27A 2FEZA 4GCVA 1R1UA 2E1CA 2KKOA 2CQKA 5E17F 2K86A 1OR7A 4D0PA 3E5QA 5LGTA 2PN6A 1JHHA 2GAUA 2A6HF 2DQRA 2HDCA 1QQIA 4CO8A 1FOKA 1Z1DA 2MLKA 3CUQA 1MGTA 2EJRA 4RB1A 4KYWA 4Q48A 4I0BA 3HRUA 4MGRA 1CF7A 1SD4A 1CGPA 1RNLA 1IN4A 3C7JA 4EMSA 1G3SA 3LSTA 1FSEA 2FBIA 2JRTA 2FMLA 4IRIA 5DD4A 4A6DA 4EGYA 3V7CA 4EV0A 5CVJA 3J80Z 2UXXA 1FX7A 4EM1A 1FLIA 2GIVA 4I01A 1S7AA 4U88A 4LLLA 5F6FA 4M6YA 3SQNA 4WF2A 4N0BA 2QUFA 4GXOA 2P7CB 3WU0A 2V79A 3HHHA 3WE2A 4LD5A 1P4AA 4WXCA 2X4HA 3KEOA 4YFNF 4BQAA 3FHZA 5CVUA 3DXJF 3RIRA 2ZBKA 3WTVC 3KFWX 1XB4A 3KETA 4G6DA 2COMA 2LF8A 4Q5SF 4ESFA 5LEKA 3W6KB 3LA2A 3I59A 4L0ZB 5CJ9A 4LJZF 4DQ2A 2VBZA 1DPUA 2IRFG 4U0YA 1E17A 3QP6A 3DPTA 1VTNC 4AWXB 3MZHA 1U5TC 3SFZA 3I59B 2MBFA 5L3FA 2NNYA 3ULQB 3I53A 1XGNA 4M71A 2KIMA 4BAYA 1MDMB 2GWRA 2QQ9A 4LLNA 4IVNA 4OIPF 3ZPLA 3CO7C 1ZG5A 2E1NA 3L00A 4UVCA 2BYVE 4QLCU 3EDPA 2VBWA 2DPUA 2IPQX 3C18A 1U5TB 3V4GA 1H0MA 3BWGA 2H09A 2EA4A 4H0EA 1BI3A 3NRVA 4P9FA 3RPQA 3GFMA 3K69A 4L0YB 3V8KA 4G9YA 1YW7A 2M1BA 4XRFA 3REOA 2O6GE 2JSCA 3J81Z 2EFNA 1F1ZA 3CO6C 3LA7A 4O6JA 4HA8A 1HSTA 3BOQA 4WXHA 5L3BA 1K6OA 2HWVA 5HS8A 2K7LA 1BIAA 4HF1A 3M9AA 3JSOA 2HQRA 2FMYA 4EJWA 3T8TA 1FBSA 4LMYA 3NQOA 2VONA 3FM5A 1DUXC 1F9NA 1YS6A 5BPDA 5FGMA 2EV0A 2FBKA 4L9NA 3W6JB 1HXDA 1MD0A 2P7VB 1FC3A 4ENJA 5E8IA 2Z3YA 2VT2A 1TW2A 1Z05A 3F8FA 1RZ4A 1D5VA 1MKMA 2XKPA 3JAMZ 2G9WA 3E97A 2QBYB 4IRGA 2P5LC 2VBXA 2UWMA 1R1VA 3VEPA 3WU1B 4I02A 1FYLA 3WGIA 2L02A 2W84A 2L54A 2BBYA 2A6EF 5D5VB 3K9TA 3IRRA 5D5UB 1L3LA 4RB3C 3KP3A 1STZA 3FXRA 1T6SA 2LNBA 3C3WA 3GW2A 5IT9Z 3KZYA 5F64A 4RB2C 5FFZA 1ZLJA 2F2EA 2BE5F 3IWFA 5E1ZB 3J81K 2H6BA 3ELKA 4CHUA 1XDSA 4ZZDA 2ZMEB 2EV6A 5D5XB 1XDUA 2W85A 3GEZA 2FF4A 1OYIA 1BIBA 1J0RA 5E1WA 3I71A 2DAOA 2NS0A 3M8EA 3N97A 4Q47A 5EEHA 1ZREA 3MFKA 3RKXA 4MEYF 4NQWA 4ZH4F 1O7FA 3RI4A 2V6CA 3QPTA 2V9VA 3OV8A 3WTWC 2K4BA 4EVIA 2M87A 3T1BA 2STWA 5CVRA 5K5QA 1SFEA 2YSRA 2YU3A 5D5WB 1YS7A 3DQVC 4DNCA 1PP7U 2XROA 3IKTA 1IUYA 4N9HA 3R0JA 1D8KA 2M45A 2OQGA 3Q9VA 4M9SA 2VN2A 1MJAA 2VOPA 3ZMDA 2V1XA 1HW2A 1GXQA 2V1UA 1YFHA 3RDIA 1P2FA 2QQBA 1IXRC 2A5YB 1O3RA 1FP1D 4A12A 4BXUA 3DEUA 5ILSA 2F5CA 4U7DA 2GXBA 2IT0A 2HEOA 1XGSA 1IN5A 5DYMA 3ZMZA 1R5GA 3ERED 4AD9A 4HV5A 4LGWA 4PDKA 4M9ZA 4CGZA 3SXYA 4BNCA 2R7FA 4O3MA 3QPHA 4MTDA 1FP2A 3BP8A 1QNTA 4UV9A 3ZMSA 3F23A 1B6AA 5DEQA 4A5MA 1KGSA 2RVCA 1KA8A 4XSZF 2RC4A 3FWEA 4UVAA 1ZN2A 1D8JA 4KIGA 1IW7F 3JTHA 4ESJA 4MEXF 5ICEA 2YR2A 2OBPA 4KICA 1I5ZA 2XIGA 3K1MA 5L3DA 2HYFA 3KE2A 2FNPA 2KIUA 1ZHFA 2JPCA 2FRHA 2DT5A 2ACJA 3Q9SA 1USSA 4I0AA 1Z6TA 2EFQA 2L4AA 3KP6A 1REPC 2L3DA 1TNTA 2RKHA 3F22A 4OIRF 2A3SA 3ZP5A 5D8LB 4PGHA 4G7OF 2RV8A 1FZPB 3BJOA 3IL2A 1R1TA 4KIBA 1ZG3A 2ZKZA 1K78A 1L0OC 5HOOA 3E6MA 3MWMA 3GFIA 1UHWA 4HQMA 5E18F 2D2WA 3O6BB 3IC7A 1TBXA 4CDGA 5CLSA 4G7HF 1LVAA 3BDDA 1ZG1A 2Z99A 2MH2A 4KMFA 1XSDA 2CGPA 2H27A 3GZ5A 2A07F 4Y17A 3E3VA 1B59A 3LQQA 1ZH5A 1WRJA 2E7WA 3SZTA 1TNSA 1YO5C 2VODA 2NRAC 1WQ2A 4GO1A 3R6SA 4EM0B 1W7PD 4HF2A 3DFGA 3GUDA 4LK0F 1J9IA 1T2KA 2VBYA 3TKYA 5JVTA 4KNYA 1W5TA 4RGSA 1MJBA 5CVVA 3V8LA 2Q8KA 4PGGA 1QBJA 1O3QA 3WGGA 4UXNA 2IJLA 4XBFA 1GXPA 4NHJA 5KVRA 4KDPA 4WWCA 2XGXA 3KZZA 5LGUA 2K02A 3K2ZA 3C1DA 4I09A 1TLHB 1USTA 1YLFA 3VB2A 2YX4A 4K2EA 1F4KA 3WE3A 5ILVA 4HDVA 5FLXZ 1G3WA 2M8EA 4L9JA 5LRRA 3EQLF 1S29A 4GYGA 3BPVA 4BHPA 3ECHA 5J6XA 4ZYGA 4ETSA 3GO5A 4MNUA 1XMKA 2PFBA 4R1HA 5ICCA 5BOXA 3MZYA 2OAZA 2XKOA 3E6DA 1DP7P 3G3ZA 4F7ZA 2ZMEA 4IPAA 2EWNA 2ELHA 4XLPF 2MA3A 3WTZA 2HFHA 4EM2A 3PQKA 5HS9A 3CJNA 5LGNA 4XSXF 2PMHA 2O8XA 1HBXG 4EJOA 2ISYA 3ZN0A 1ULYA 1I1GA 4ZYDA 2YX7A 4MQ9F 1PUEE 1BM9A 1OYYA 3ML6A 4Y15A 1P4WA 1J75A 2OU2A 3VFZA 4P96A 4AIJA 2MH9A 1H9TA 4OIQF 1XSXA 3DF8A 3HOTA 1TTYA 1BBYA 3WGHA 4IJAA 1ZLKA 3L7WA 2EA2A 1G6NA 3JTGA 2IP2A 3KLOA 2HTJA 5FO5A 2ZCWA 4LG0A 1EV7A 2HGCA 5ILUA 2B0LA 3CDHA 4A0ZA 3MEXA 3EYIA 3E6BA 1IF1A 1U2WA 2ZNZA 1X3UA 4LLGF 1BC7C 4WK8F 5KK1A 3I54A 3F21A 2DW4A 3EETA 1YTYA 1ZAOA 4L5JA 1WKMA 3HIFA 2O03A 2DTRA 3LFKA 1FNNA 1K7AA 3ZN1A 2GXGA 2BEOA 3N4MA 1QGPA 1KU9A 4BYYA 3I58A 5CYVA 1U8RA 3CUOA 3CUQC 4MHGA 3P9IA 5TRDA 1OYWA 1LDKB 3HRTA 2ZO4A 4M74A 3TOAA 4RGXA 5D8KB 1IZ1A 2QENA 1OMIA 1HKSA 1G3TA 4OOIA 3DKWA 4OINF 2W57A 5DUIA 3GLXA 4FHTA 1G4DA 2A69F 4CZZA 4Z2YA 3COAC 2Q2EA 1TQMA 1GVJA 3V8JA 1R36A 1J59A 2G7HA 3K1NA 1I1SA 4KFCA 1LB2A 2XAHA 1O7LA 2DPDA 4RGUA 2M30A 3EUHA 1KU7A 3GXOA 3ABTA 3JW4A 5DCMB 1ZRDA 5EEGA 5D4RA 3ZMUA 1FBUA 3FMSA 4ENMA 1I27A 1YIOA 2P6TA 4LFUA 5AONA 3F8BA 2GZWA 3IRQA 1I6XA 4IHSA 3QRFF 2FQ3A 1LDJA 1BC8C 4ASNA 4CXFA 2TDXA 3DPLC 1KU2A 4KN4X 4BH9A 2JPBA 1Y0UA 4Y13A 1PP8F 3V7RA 2F5FA 1XGMA 4ZZLA 3IHUA 1QZZA 4P5OA 2XAGA 1D3YA 1R00A 3G73A 4A2UA 4HX8A 1HW1A 3WODF 1NHAA 2XASA 4EQQA 2ZXJA 3ZMTA 1U3EM 2A61A 3F8MA 4ZYEA 5H6RA 5DDGA 3HHGA 2CO5A 3HUGA 1FPQA 2EB7A 4HQEA 4FT8A 3ISPA 2PMUA 2UZKA 2HKOA 2LF7A 1ZGAA 4XLNF 4HLYA 1BJAA 2EFOA 3M7GA 2XRNA 4AIHA 1R22A 2L4MA 3BROA 4BHCA 3U2RA 1ZRCA 4S05A 2GA1A 2RGVA 3TO6A 4HV6A 1Q1HA 5HDKA 2CG4A 4A0YA 1SFXA 1LJ9A 3K0LA 2PJPA 3D5LA 1E2XA 1O57A 1JE8A 4B09A 1YQAA 2M5WA 2O0YA 3F6VA 5LLQA 5FB2A 2WWYA 3RKWA 4M6XA 3ABUA 4JK1X 3MCZA 3HSRA 3QU3A 2XAFA 2AXLA 4HAMA 4FX4A 2L01A 3KLNA 1IAWA 3BJ6A 3QOPA 5A2QZ 2RDPA 3R61A 3B73A 4AIKA 2XVCA 3H3ZA 2NYXA 2XAJA 1PDNC 5LEJA 2V1DA 2FBHA 3TQNA 1XD7A 4HDUA 1ODDA 4M73A 1S3JA 4G94A 3BZ6A 1XGOA 3SZPA 2VOOA 2CW0F 1IXCA 1IRGA 3B02A 1J5YA 1SMYF 3JSPA 2GA2A 1IN7A 2E7XA 4MTEA 3TDUC 5J8CA 4IRHA 3P9CA 1YG2A 5AIPA 5J8FA 1FSHA 1R58A 4UV8A 1MZBA 3P9KA 2DK5A 4LB6B 1SD6A 2Z9OA 3L9FA 1T38A 2WC2A 3HYIA 1BI2A 1ON1A 1U78A 1YW9A 5IT9K 2UXNA 4R79A 5LRSA 4HLXA 1ZRFA 2IA0A 4JBAA 3IKVA 1RUNA 4RAZA 1KQ0A 1JXSA 3KP5A 3LWFA 3TO7A 1O3TA 3HSFA 2DLLA 2XHKA 3T0YA 3PFIA 4G7ZF 3HTSB 5DD8A 2KIFA 1A04A 1Z91A 1ZYRF 3HRMA 3MQ0A 2YPRA 3T5XA 1KYWA 4L5IA 3TOBA 2ETHA 2WV0A 5DUKA 2XAQA 1KU3A 5HVQC 2HR3A 2PBIA 3K1PA 3WTSC 3GZ6A 2P5VA 3L09A 2G7UA 4L9TA 4P9UA 4R8HA 3RTRA 1W7PA 2QYOA 1WI9A 4WX9A 1TQPA 3CTAA 3WTTC 3GVAA 3LQRA 4FX0A 2NNNA 3RJPA 1XCBA 2O3FA 5L3EA 2ESHA 1KQ9A 2QBYA 2CWEA 5H6QA 5HS7A 1R23A 2OZUA 2R7DA 2QWWA 2DK8A 2DFIA 3GF2A 5LHHA 1XN7A 4U0VA 5IT3A 3GYHX 1UB9A 3FX3A 2CFXA 2BGCA 1SAXA 4B8XA 6PAXA 2RNJA 3GFJA 4HX7A 4RAYA 4YIIA 1TQIA 2IW5A 1LNWA 3WG9A 5FD6A 4PZJA 4UNOA 2VT3A 2EFWA 4M72A 5K5RA 2WTEA 1R5HA 1YW8A 1K79A 1B1BA 5HLGA 1P6RA 3CLOA 4LG0B 2DU9A 1ON2A 1WSUA 3BY6A 3DP7A 4CYDA 3TO9A 3T8RA 2HQNA 2PEXA 1B9NA 2QQAA 2P6SA 5FLXK 5BS6A 2VC0A 1P4XA 4RB0A 3U1DA 3AAFA 5D4SA 5FD5A 4S04A 3KP7A 5DCFA 4HBLA 2DBBA 4O5VA 1S7OA 2OQRA 2Z5UA 3V7SA 2STTA 2FOKA 1FYKA 5K5OA 3F72A 5K1YA 2W24A 3S2WA 4E70A 3D0SA 5FFXA 4HYEA 1DPRA 2X0LA 5E8GA 4KA4A 2ISZA 1T39A 1BN5A 3GFLA 3LAPA 3ZQ7A 3VOEA 3RYPA 4HX4A 4A5NA 3WTXC 2BV6A 2FE3A 4I98B 1SD5A 3TDZC 4IF4A 1BOAA 5HDGA 5JFRA 2C6YA 1MDMA 4JQFA 3KCCA 2QLZA 2Y0MA 2ZNYA 4ZYHA 2PLYA 1C0WA 1Z9CA 1W4MA 2D45A 2W25A 2Y75A 3ZMVA 1B4AA 1W5SA 4KUMA 4P55A 1FWZA 2HZTA 3Q5FA 1U5TA 2P4WA 1WWXA 2EV5A 2XV4S 3I5UA 2GQQA 3HTUA 4RS8A 2PI0A 3M1EA 5AIQA 1BI0A 4IHTA 3E5XA 2FU4A 4UVBA 2KJCA 5DCMA 5LHGA 1UCRA 1AWCA 2NAZA 1J7KA 1LDDA 3QAHA 2JT1A 3KEQA 1RUOA 3KP4A 3FXQA 1HKTA 3BJAA 1T98A 2VE9A 2JZYA 1LEAA 2KJBA 4QWQA 2DI3A 2A68F 1QPMA 3OOPA 2ZJ2A 4HW0A 1Z6RA 4U7BA 2VC1A 4WCGA 1LEBA 4IXAA 1SFUA 3NEUA 1FT9A 2LDUA 2MLGA 1FYMA 4KN7X 5HLHA 5D6FA 2OA4A 2HTSA 1IRFA 1Z7UA 2DQLA 3JAMK 2MC3A 1S8NA 1K78B 4NB5A 1HQCA 2H94A 5BMZA 4OU0A 5F1RA 2J5OA 4N9IA 2FA5A 5LHIA 3GX4X 3ROUA 4YFKF 1IN6A 4U0WA 2EFPA 4HZFA 5H20A 1G3YA 1OPCA 1TW3A 5JR3A 3R0AA 3F6OA 1HKQA 1YYVA 2O61A 1GHCA 2FXAA 5L3CA 1J2XA 2OZ6A 2IVMA 3I4PA 1F5TA 1OKRA 2ESNA 1BI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMT A;  3QP5 A;  1S6L A;  5ICF A;  2ZFW A;  4GYI A;  1B9M A;  1EH6 A;  3F3X A;  4I2O A;  3VOD A;  5HLI A;  2MD5 A;  3O2P E;  3LAJ A;  2HOE A;  4YIF A;  3R4K A;  2RQP A;  4A0X A;  1DDN A;  5DV5 A;  1XMA A;  1HSJ A;  3LA3 A;  4LK1 F;  4OMY A;  5ICG A;  2KRF A;  2Q0O A;  3FMQ A;  1QO0 D;  1CF7 B;  4LB5 A;  3F8C A;  2H6C A;  3WTY C;  1LQ1 A;  3H92 A;  4CIC A;  4HF0 A;  1XSV A;  3CUQ B;  4G8X A;  1AOY A;  2VXZ A;  4ENK A;  1IN8 A;  5BPI A;  4M9X A;  1P92 A;  4ESB A;  3E6C C;  2OD5 A;  3R60 A;  2P5K A;  4I7H A;  1SD7 A;  1FY7 A;  2QZ8 A;  1EH8 A;  4EJV A;  2QM3 A;  2D1V A;  3RKY A;  4EJU A;  5LBQ A;  3RYR A;  2ADU A;  3J7A O;  2DO7 A;  2R3S A;  1O3S A;  4RGR A;  1V4R A;  3IWZ A;  3U9G A;  2P8T A;  2QVO A;  2CYY A;  3E5U A;  1T0F A;  2IA2 A;  4L18 B;  4AVP A;  1QZY A;  1R7J A;  1ZGJ A;  5TJJ A;  5E1X A;  2CSO A;  3F8N A;  5L3G A;  3M8F A;  2AS5 F;  1FBQ A;  3WTU C;  4KIF A;  1H9G A;  4ON0 A;  4WXD A;  3O3K A;  4OMZ A;  1ZAR A;  1XCV A;  2RN7 A;  4HOB A;  5HDN A;  3ECO A;  2FNA A;  3HOS A;  1EH7 A;  1ONV A;  3HRS A;  4KMU X;  5D6E A;  2JTV A;  5CVI A;  3FMR A;  4YG2 F;  1W7P B;  2PG4 A;  1HW5 A;  3QU6 A;  2D1H A;  4YFX F;  4UHT A;  4G6Q A;  3FXU A;  3KP2 A;  5JHU A;  3P7N A;  5A2Q K;  3FF5 A;  2HYG D;  4EGZ A;  1U6G A;  1V3F A;  1RIO H;  4OIO F;  4MQV A;  1RI7 A;  2F5D A;  3FZV A;  2IA1 A;  5JI6 A;  2K4J A;  2Z33 A;  3H3U A;  3I0T A;  3MAJ A;  2Y48 A;  4GGG A;  3HSE A;  4PCQ A;  4L9V A;  3L2C A;  5BQT A;  4EJT A;  3FM3 A;  3SHF A;  2HS5 A;  3GWZ A;  4TV7 A;  3EYY A;  3I64 A;  2F5E A;  1JGS A;  3J80 K;  2FSW A;  3PQJ A;  1UFM A;  5E20 A;  2HKX A;  4A6E A;  1IXS B;  3RPU A;  4Q4Z F;  1JHF A;  5ERI A;  2J5P A;  4BHB A;  2XUB A;  4KT5 C;  4ENN A;  5ED4 A;  1KYZ A;  1UHM A;  2LKP A;  3BPX A;  2EK5 A;  2LSO A;  1KQ8 A;  1MJ9 A;  2VE8 A;  3DV8 A;  3TGN A;  4UUV A;  2PQ8 A;  2K27 A;  2FEZ A;  4GCV A;  1R1U A;  2E1C A;  2KKO A;  2CQK A;  5E17 F;  2K86 A;  1OR7 A;  4D0P A;  3E5Q A;  5LGT A;  2PN6 A;  1JHH A;  2GAU A;  2A6H F;  2DQR A;  2HDC A;  1QQI A;  4CO8 A;  1FOK A;  1Z1D A;  2MLK A;  3CUQ A;  1MGT A;  2EJR A;  4RB1 A;  4KYW A;  4Q48 A;  4I0B A;  3HRU A;  4MGR A;  1CF7 A;  1SD4 A;  1CGP A;  1RNL A;  1IN4 A;  3C7J A;  4EMS A;  1G3S A;  3LST A;  1FSE A;  2FBI A;  2JRT A;  2FML A;  4IRI A;  5DD4 A;  4A6D A;  4EGY A;  3V7C A;  4EV0 A;  5CVJ A;  3J80 Z;  2UXX A;  1FX7 A;  4EM1 A;  1FLI A;  2GIV A;  4I01 A;  1S7A A;  4U88 A;  4LLL A;  5F6F A;  4M6Y A;  3SQN A;  4WF2 A;  4N0B A;  2QUF A;  4GXO A;  2P7C B;  3WU0 A;  2V79 A;  3HHH A;  3WE2 A;  4LD5 A;  1P4A A;  4WXC A;  2X4H A;  3KEO A;  4YFN F;  4BQA A;  3FHZ A;  5CVU A;  3DXJ F;  3RIR A;  2ZBK A;  3WTV C;  3KFW X;  1XB4 A;  3KET A;  4G6D A;  2COM A;  2LF8 A;  4Q5S F;  4ESF A;  5LEK A;  3W6K B;  3LA2 A;  3I59 A;  4L0Z B;  5CJ9 A;  4LJZ F;  4DQ2 A;  2VBZ A;  1DPU A;  2IRF G;  4U0Y A;  1E17 A;  3QP6 A;  3DPT A;  1VTN C;  4AWX B;  3MZH A;  1U5T C;  3SFZ A;  3I59 B;  2MBF A;  5L3F A;  2NNY A;  3ULQ B;  3I53 A;  1XGN A;  4M71 A;  2KIM A;  4BAY A;  1MDM B;  2GWR A;  2QQ9 A;  4LLN A;  4IVN A;  4OIP F;  3ZPL A;  3CO7 C;  1ZG5 A;  2E1N A;  3L00 A;  4UVC A;  2BYV E;  4QLC U;  3EDP A;  2VBW A;  2DPU A;  2IPQ X;  3C18 A;  1U5T B;  3V4G A;  1H0M A;  3BWG A;  2H09 A;  2EA4 A;  4H0E A;  1BI3 A;  3NRV A;  4P9F A;  3RPQ A;  3GFM A;  3K69 A;  4L0Y B;  3V8K A;  4G9Y A;  1YW7 A;  2M1B A;  4XRF A;  3REO A;  2O6G E;  2JSC A;  3J81 Z;  2EFN A;  1F1Z A;  3CO6 C;  3LA7 A;  4O6J A;  4HA8 A;  1HST A;  3BOQ A;  4WXH A;  5L3B A;  1K6O A;  2HWV A;  5HS8 A;  2K7L A;  1BIA A;  4HF1 A;  3M9A A;  3JSO A;  2HQR A;  2FMY A;  4EJW A;  3T8T A;  1FBS A;  4LMY A;  3NQO A;  2VON A;  3FM5 A;  1DUX C;  1F9N A;  1YS6 A;  5BPD A;  5FGM A;  2EV0 A;  2FBK A;  4L9N A;  3W6J B;  1HXD A;  1MD0 A;  2P7V B;  1FC3 A;  4ENJ A;  5E8I A;  2Z3Y A;  2VT2 A;  1TW2 A;  1Z05 A;  3F8F A;  1RZ4 A;  1D5V A;  1MKM A;  2XKP A;  3JAM Z;  2G9W A;  3E97 A;  2QBY B;  4IRG A;  2P5L C;  2VBX A;  2UWM A;  1R1V A;  3VEP A;  3WU1 B;  4I02 A;  1FYL A;  3WGI A;  2L02 A;  2W84 A;  2L54 A;  2BBY A;  2A6E F;  5D5V B;  3K9T A;  3IRR A;  5D5U B;  1L3L A;  4RB3 C;  3KP3 A;  1STZ A;  3FXR A;  1T6S A;  2LNB A;  3C3W A;  3GW2 A;  5IT9 Z;  3KZY A;  5F64 A;  4RB2 C;  5FFZ A;  1ZLJ A;  2F2E A;  2BE5 F;  3IWF A;  5E1Z B;  3J81 K;  2H6B A;  3ELK A;  4CHU A;  1XDS A;  4ZZD A;  2ZME B;  2EV6 A;  5D5X B;  1XDU A;  2W85 A;  3GEZ A;  2FF4 A;  1OYI A;  1BIB A;  1J0R A;  5E1W A;  3I71 A;  2DAO A;  2NS0 A;  3M8E A;  3N97 A;  4Q47 A;  5EEH A;  1ZRE A;  3MFK A;  3RKX A;  4MEY F;  4NQW A;  4ZH4 F;  1O7F A;  3RI4 A;  2V6C A;  3QPT A;  2V9V A;  3OV8 A;  3WTW C;  2K4B A;  4EVI A;  2M87 A;  3T1B A;  2STW A;  5CVR A;  5K5Q A;  1SFE A;  2YSR A;  2YU3 A;  5D5W B;  1YS7 A;  3DQV C;  4DNC A;  1PP7 U;  2XRO A;  3IKT A;  1IUY A;  4N9H A;  3R0J A;  1D8K A;  2M45 A;  2OQG A;  3Q9V A;  4M9S A;  2VN2 A;  1MJA A;  2VOP A;  3ZMD A;  2V1X A;  1HW2 A;  1GXQ A;  2V1U A;  1YFH A;  3RDI A;  1P2F A;  2QQB A;  1IXR C;  2A5Y B;  1O3R A;  1FP1 D;  4A12 A;  4BXU A;  3DEU A;  5ILS A;  2F5C A;  4U7D A;  2GXB A;  2IT0 A;  2HEO A;  1XGS A;  1IN5 A;  5DYM A;  3ZMZ A;  1R5G A;  3ERE D;  4AD9 A;  4HV5 A;  4LGW A;  4PDK A;  4M9Z A;  4CGZ A;  3SXY A;  4BNC A;  2R7F A;  4O3M A;  3QPH A;  4MTD A;  1FP2 A;  3BP8 A;  1QNT A;  4UV9 A;  3ZMS A;  3F23 A;  1B6A A;  5DEQ A;  4A5M A;  1KGS A;  2RVC A;  1KA8 A;  4XSZ F;  2RC4 A;  3FWE A;  4UVA A;  1ZN2 A;  1D8J A;  4KIG A;  1IW7 F;  3JTH A;  4ESJ A;  4MEX F;  5ICE A;  2YR2 A;  2OBP A;  4KIC A;  1I5Z A;  2XIG A;  3K1M A;  5L3D A;  2HYF A;  3KE2 A;  2FNP A;  2KIU A;  1ZHF A;  2JPC A;  2FRH A;  2DT5 A;  2ACJ A;  3Q9S A;  1USS A;  4I0A A;  1Z6T A;  2EFQ A;  2L4A A;  3KP6 A;  1REP C;  2L3D A;  1TNT A;  2RKH A;  3F22 A;  4OIR F;  2A3S A;  3ZP5 A;  5D8L B;  4PGH A;  4G7O F;  2RV8 A;  1FZP B;  3BJO A;  3IL2 A;  1R1T A;  4KIB A;  1ZG3 A;  2ZKZ A;  1K78 A;  1L0O C;  5HOO A;  3E6M A;  3MWM A;  3GFI A;  1UHW A;  4HQM A;  5E18 F;  2D2W A;  3O6B B;  3IC7 A;  1TBX A;  4CDG A;  5CLS A;  4G7H F;  1LVA A;  3BDD A;  1ZG1 A;  2Z99 A;  2MH2 A;  4KMF A;  1XSD A;  2CGP A;  2H27 A;  3GZ5 A;  2A07 F;  4Y17 A;  3E3V A;  1B59 A;  3LQQ A;  1ZH5 A;  1WRJ A;  2E7W A;  3SZT A;  1TNS A;  1YO5 C;  2VOD A;  2NRA C;  1WQ2 A;  4GO1 A;  3R6S A;  4EM0 B;  1W7P D;  4HF2 A;  3DFG A;  3GUD A;  4LK0 F;  1J9I A;  1T2K A;  2VBY A;  3TKY A;  5JVT A;  4KNY A;  1W5T A;  4RGS A;  1MJB A;  5CVV A;  3V8L A;  2Q8K A;  4PGG A;  1QBJ A;  1O3Q A;  3WGG A;  4UXN A;  2IJL A;  4XBF A;  1GXP A;  4NHJ A;  5KVR A;  4KDP A;  4WWC A;  2XGX A;  3KZZ A;  5LGU A;  2K02 A;  3K2Z A;  3C1D A;  4I09 A;  1TLH B;  1UST A;  1YLF A;  3VB2 A;  2YX4 A;  4K2E A;  1F4K A;  3WE3 A;  5ILV A;  4HDV A;  5FLX Z;  1G3W A;  2M8E A;  4L9J A;  5LRR A;  3EQL F;  1S29 A;  4GYG A;  3BPV A;  4BHP A;  3ECH A;  5J6X A;  4ZYG A;  4ETS A;  3GO5 A;  4MNU A;  1XMK A;  2PFB A;  4R1H A;  5ICC A;  5BOX A;  3MZY A;  2OAZ A;  2XKO A;  3E6D A;  1DP7 P;  3G3Z A;  4F7Z A;  2ZME A;  4IPA A;  2EWN A;  2ELH A;  4XLP F;  2MA3 A;  3WTZ A;  2HFH A;  4EM2 A;  3PQK A;  5HS9 A;  3CJN A;  5LGN A;  4XSX F;  2PMH A;  2O8X A;  1HBX G;  4EJO A;  2ISY A;  3ZN0 A;  1ULY A;  1I1G A;  4ZYD A;  2YX7 A;  4MQ9 F;  1PUE E;  1BM9 A;  1OYY A;  3ML6 A;  4Y15 A;  1P4W A;  1J75 A;  2OU2 A;  3VFZ A;  4P96 A;  4AIJ A;  2MH9 A;  1H9T A;  4OIQ F;  1XSX A;  3DF8 A;  3HOT A;  1TTY A;  1BBY A;  3WGH A;  4IJA A;  1ZLK A;  3L7W A;  2EA2 A;  1G6N A;  3JTG A;  2IP2 A;  3KLO A;  2HTJ A;  5FO5 A;  2ZCW A;  4LG0 A;  1EV7 A;  2HGC A;  5ILU A;  2B0L A;  3CDH A;  4A0Z A;  3MEX A;  3EYI A;  3E6B A;  1IF1 A;  1U2W A;  2ZNZ A;  1X3U A;  4LLG F;  1BC7 C;  4WK8 F;  5KK1 A;  3I54 A;  3F21 A;  2DW4 A;  3EET A;  1YTY A;  1ZAO A;  4L5J A;  1WKM A;  3HIF A;  2O03 A;  2DTR A;  3LFK A;  1FNN A;  1K7A A;  3ZN1 A;  2GXG A;  2BEO A;  3N4M A;  1QGP A;  1KU9 A;  4BYY A;  3I58 A;  5CYV A;  1U8R A;  3CUO A;  3CUQ C;  4MHG A;  3P9I A;  5TRD A;  1OYW A;  1LDK B;  3HRT A;  2ZO4 A;  4M74 A;  3TOA A;  4RGX A;  5D8K B;  1IZ1 A;  2QEN A;  1OMI A;  1HKS A;  1G3T A;  4OOI A;  3DKW A;  4OIN F;  2W57 A;  5DUI A;  3GLX A;  4FHT A;  1G4D A;  2A69 F;  4CZZ A;  4Z2Y A;  3COA C;  2Q2E A;  1TQM A;  1GVJ A;  3V8J A;  1R36 A;  1J59 A;  2G7H A;  3K1N A;  1I1S A;  4KFC A;  1LB2 A;  2XAH A;  1O7L A;  2DPD A;  4RGU A;  2M30 A;  3EUH A;  1KU7 A;  3GXO A;  3ABT A;  3JW4 A;  5DCM B;  1ZRD A;  5EEG A;  5D4R A;  3ZMU A;  1FBU A;  3FMS A;  4ENM A;  1I27 A;  1YIO A;  2P6T A;  4LFU A;  5AON A;  3F8B A;  2GZW A;  3IRQ A;  1I6X A;  4IHS A;  3QRF F;  2FQ3 A;  1LDJ A;  1BC8 C;  4ASN A;  4CXF A;  2TDX A;  3DPL C;  1KU2 A;  4KN4 X;  4BH9 A;  2JPB A;  1Y0U A;  4Y13 A;  1PP8 F;  3V7R A;  2F5F A;  1XGM A;  4ZZL A;  3IHU A;  1QZZ A;  4P5O A;  2XAG A;  1D3Y A;  1R00 A;  3G73 A;  4A2U A;  4HX8 A;  1HW1 A;  3WOD F;  1NHA A;  2XAS A;  4EQQ A;  2ZXJ A;  3ZMT A;  1U3E M;  2A61 A;  3F8M A;  4ZYE A;  5H6R A;  5DDG A;  3HHG A;  2CO5 A;  3HUG A;  1FPQ A;  2EB7 A;  4HQE A;  4FT8 A;  3ISP A;  2PMU A;  2UZK A;  2HKO A;  2LF7 A;  1ZGA A;  4XLN F;  4HLY A;  1BJA A;  2EFO A;  3M7G A;  2XRN A;  4AIH A;  1R22 A;  2L4M A;  3BRO A;  4BHC A;  3U2R A;  1ZRC A;  4S05 A;  2GA1 A;  2RGV A;  3TO6 A;  4HV6 A;  1Q1H A;  5HDK A;  2CG4 A;  4A0Y A;  1SFX A;  1LJ9 A;  3K0L A;  2PJP A;  3D5L A;  1E2X A;  1O57 A;  1JE8 A;  4B09 A;  1YQA A;  2M5W A;  2O0Y A;  3F6V A;  5LLQ A;  5FB2 A;  2WWY A;  3RKW A;  4M6X A;  3ABU A;  4JK1 X;  3MCZ A;  3HSR A;  3QU3 A;  2XAF A;  2AXL A;  4HAM A;  4FX4 A;  2L01 A;  3KLN A;  1IAW A;  3BJ6 A;  3QOP A;  5A2Q Z;  2RDP A;  3R61 A;  3B73 A;  4AIK A;  2XVC A;  3H3Z A;  2NYX A;  2XAJ A;  1PDN C;  5LEJ A;  2V1D A;  2FBH A;  3TQN A;  1XD7 A;  4HDU A;  1ODD A;  4M73 A;  1S3J A;  4G94 A;  3BZ6 A;  1XGO A;  3SZP A;  2VOO A;  2CW0 F;  1IXC A;  1IRG A;  3B02 A;  1J5Y A;  1SMY F;  3JSP A;  2GA2 A;  1IN7 A;  2E7X A;  4MTE A;  3TDU C;  5J8C A;  4IRH A;  3P9C A;  1YG2 A;  5AIP A;  5J8F A;  1FSH A;  1R58 A;  4UV8 A;  1MZB A;  3P9K A;  2DK5 A;  4LB6 B;  1SD6 A;  2Z9O A;  3L9F A;  1T38 A;  2WC2 A;  3HYI A;  1BI2 A;  1ON1 A;  1U78 A;  1YW9 A;  5IT9 K;  2UXN A;  4R79 A;  5LRS A;  4HLX A;  1ZRF A;  2IA0 A;  4JBA A;  3IKV A;  1RUN A;  4RAZ A;  1KQ0 A;  1JXS A;  3KP5 A;  3LWF A;  3TO7 A;  1O3T A;  3HSF A;  2DLL A;  2XHK A;  3T0Y A;  3PFI A;  4G7Z F;  3HTS B;  5DD8 A;  2KIF A;  1A04 A;  1Z91 A;  1ZYR F;  3HRM A;  3MQ0 A;  2YPR A;  3T5X A;  1KYW A;  4L5I A;  3TOB A;  2ETH A;  2WV0 A;  5DUK A;  2XAQ A;  1KU3 A;  5HVQ C;  2HR3 A;  2PBI A;  3K1P A;  3WTS C;  3GZ6 A;  2P5V A;  3L09 A;  2G7U A;  4L9T A;  4P9U A;  4R8H A;  3RTR A;  1W7P A;  2QYO A;  1WI9 A;  4WX9 A;  1TQP A;  3CTA A;  3WTT C;  3GVA A;  3LQR A;  4FX0 A;  2NNN A;  3RJP A;  1XCB A;  2O3F A;  5L3E A;  2ESH A;  1KQ9 A;  2QBY A;  2CWE A;  5H6Q A;  5HS7 A;  1R23 A;  2OZU A;  2R7D A;  2QWW A;  2DK8 A;  2DFI A;  3GF2 A;  5LHH A;  1XN7 A;  4U0V A;  5IT3 A;  3GYH X;  1UB9 A;  3FX3 A;  2CFX A;  2BGC A;  1SAX A;  4B8X A;  6PAX A;  2RNJ A;  3GFJ A;  4HX7 A;  4RAY A;  4YII A;  1TQI A;  2IW5 A;  1LNW A;  3WG9 A;  5FD6 A;  4PZJ A;  4UNO A;  2VT3 A;  2EFW A;  4M72 A;  5K5R A;  2WTE A;  1R5H A;  1YW8 A;  1K79 A;  1B1B A;  5HLG A;  1P6R A;  3CLO A;  4LG0 B;  2DU9 A;  1ON2 A;  1WSU A;  3BY6 A;  3DP7 A;  4CYD A;  3TO9 A;  3T8R A;  2HQN A;  2PEX A;  1B9N A;  2QQA A;  2P6S A;  5FLX K;  5BS6 A;  2VC0 A;  1P4X A;  4RB0 A;  3U1D A;  3AAF A;  5D4S A;  5FD5 A;  4S04 A;  3KP7 A;  5DCF A;  4HBL A;  2DBB A;  4O5V A;  1S7O A;  2OQR A;  2Z5U A;  3V7S A;  2STT A;  2FOK A;  1FYK A;  5K5O A;  3F72 A;  5K1Y A;  2W24 A;  3S2W A;  4E70 A;  3D0S A;  5FFX A;  4HYE A;  1DPR A;  2X0L A;  5E8G A;  4KA4 A;  2ISZ A;  1T39 A;  1BN5 A;  3GFL A;  3LAP A;  3ZQ7 A;  3VOE A;  3RYP A;  4HX4 A;  4A5N A;  3WTX C;  2BV6 A;  2FE3 A;  4I98 B;  1SD5 A;  3TDZ C;  4IF4 A;  1BOA A;  5HDG A;  5JFR A;  2C6Y A;  1MDM A;  4JQF A;  3KCC A;  2QLZ A;  2Y0M A;  2ZNY A;  4ZYH A;  2PLY A;  1C0W A;  1Z9C A;  1W4M A;  2D45 A;  2W25 A;  2Y75 A;  3ZMV A;  1B4A A;  1W5S A;  4KUM A;  4P55 A;  1FWZ A;  2HZT A;  3Q5F A;  1U5T A;  2P4W A;  1WWX A;  2EV5 A;  2XV4 S;  3I5U A;  2GQQ A;  3HTU A;  4RS8 A;  2PI0 A;  3M1E A;  5AIQ A;  1BI0 A;  4IHT A;  3E5X A;  2FU4 A;  4UVB A;  2KJC A;  5DCM A;  5LHG A;  1UCR A;  1AWC A;  2NAZ A;  1J7K A;  1LDD A;  3QAH A;  2JT1 A;  3KEQ A;  1RUO A;  3KP4 A;  3FXQ A;  1HKT A;  3BJA A;  1T98 A;  2VE9 A;  2JZY A;  1LEA A;  2KJB A;  4QWQ A;  2DI3 A;  2A68 F;  1QPM A;  3OOP A;  2ZJ2 A;  4HW0 A;  1Z6R A;  4U7B A;  2VC1 A;  4WCG A;  1LEB A;  4IXA A;  1SFU A;  3NEU A;  1FT9 A;  2LDU A;  2MLG A;  1FYM A;  4KN7 X;  5HLH A;  5D6F A;  2OA4 A;  2HTS A;  1IRF A;  1Z7U A;  2DQL A;  3JAM K;  2MC3 A;  1S8N A;  1K78 B;  4NB5 A;  1HQC A;  2H94 A;  5BMZ A;  4OU0 A;  5F1R A;  2J5O A;  4N9I A;  2FA5 A;  5LHI A;  3GX4 X;  3ROU A;  4YFK F;  1IN6 A;  4U0W A;  2EFP A;  4HZF A;  5H20 A;  1G3Y A;  1OPC A;  1TW3 A;  5JR3 A;  3R0A A;  3F6O A;  1HKQ A;  1YYV A;  2O61 A;  1GHC A;  2FXA A;  5L3C A;  1J2X A;  2OZ6 A;  2IVM A;  3I4P A;  1F5T A;  1OKR A;  2ESN A;  1BI1 A; 
#chains in the Genus database with same CATH topology
 1SMT A;  2CH0 A;  1S6L A;  3QP5 A;  5ICF A;  2ZFW A;  3FBI B;  4GYI A;  4B44 A;  1B9M A;  1EH6 A;  3EUA A;  3F3X A;  4I2O A;  2CU7 A;  5HLI A;  3VOD A;  2M7A A;  2MD5 A;  2K9Q A;  3O2P E;  2HOE A;  2X1D A;  4DBQ A;  3LAJ A;  4YIF A;  3R4K A;  4W97 A;  2L7K A;  3OYB A;  2HVQ A;  2ZXW H;  2L7F P;  2O5R A;  2RQP A;  4A0X A;  1V54 H;  3BR3 A;  1DDN A;  5DV5 A;  1XMA A;  3IH4 A;  1HSJ A;  3LA3 A;  1Y8Q B;  4I99 C;  4II2 A;  4LK1 F;  4OMY A;  1RPW A;  5ICG A;  2KRF A;  2DA6 A;  2Q0O A;  1YOV B;  2HI3 A;  2R92 J;  3FMQ A;  2CV2 A;  1QO0 D;  1CF7 B;  4LB5 A;  1IV8 A;  3F8C A;  3G71 I;  2R5Y A;  3VYR B;  1NK3 P;  2H6C A;  3WTY C;  1LQ1 A;  3H92 A;  3LOC A;  4CIC A;  4HF0 A;  4XLC A;  2L9V A;  5IOZ A;  1XSV A;  3CUQ B;  4G8X A;  1AOY A;  4DYR A;  1FOX A;  2VXZ A;  3GBG A;  2MG4 A;  4ENK A;  1IN8 A;  4BDZ A;  1PUF A;  2KDZ A;  1HC8 A;  5BPI A;  2VQL A;  1P92 A;  4M9X A;  4RLF A;  4ESB A;  3E6C C;  5M5X J;  2OD5 A;  3R60 A;  4BE2 A;  3QYE A;  1RR8 C;  1TL8 A;  2HOT A;  2P5K A;  4I7H A;  1SAU A;  3CMA I;  4CH7 A;  1GV2 A;  1SD7 A;  1TC3 C;  3BZC A;  1Y6I A;  5GTH C;  5B1B H;  2KRC A;  1FY7 A;  4FET A;  2QZ8 A;  2E5Z A;  2DN0 A;  3OIQ A;  4RM3 A;  1S5L C;  1LKX A;  1EH8 A;  4EJV A;  4C2T A;  2QM3 A;  1IDY A;  4GFB A;  4EAT A;  2D1V A;  3RKY A;  4EJU A;  1JGG A;  4XOT A;  5LBQ A;  1SVM A;  3RYR A;  2ADU A;  4A3K J;  4C3J J;  3J7A O;  2DO7 A;  1X1D A;  4DYC A;  2R3S A;  1O3S A;  4PSX A;  1UZC A;  1V4R A;  4RGR A;  2VKH A;  3TMO A;  1YRN A;  3IWZ A;  1RKT A;  3VSL A;  2DJI A;  3U9G A;  4PJL A;  2P8T A;  2ECC A;  2QVO A;  2CYY A;  2V1N A;  1D1B A;  4ZDP A;  3E5U A;  1T0F A;  2IA2 A;  4L18 B;  3SYT A;  3BZK A;  3DLA A;  1AKH A;  2M0M A;  2VIX A;  4AVP A;  1QZY A;  1R7J A;  1ZGJ A;  4YEJ A;  5J1R A;  4PUS A;  5TJJ A;  4L5E A;  2JUG A;  2CSO A;  5E1X A;  3F8N A;  5L3G A;  3M8F A;  1AHD P;  2AS5 F;  3VSK A;  1FBQ A;  3WTU C;  2CV1 A;  1YIJ I;  3A0H C;  3HOV J;  2BZT A;  4KIF A;  1H9G A;  2PJR B;  3AL0 B;  2VPR A;  2XGD A;  4WXD A;  4ON0 A;  2DMQ A;  3O3K A;  2E19 A;  4OMZ A;  1ZAR A;  5EEA A;  1XCV A;  2RN7 A;  3VWB A;  1SVO A;  1DP3 A;  4HOB A;  1G2H A;  5EZG A;  3H5N A;  5HDN A;  4PJM A;  3FXK A;  3ECO A;  3HG9 A;  2XRL A;  3CLQ A;  3UKG A;  3HPH A;  2FNA A;  1F43 A;  3HOS A;  3IV5 A;  4H4K C;  1EH7 A;  1ONV A;  3HRS A;  1BA5 A;  4KMU X;  5D6E A;  1SVL A;  2JTV A;  4A3B J;  5CVI A;  1Z3Y A;  4A3E J;  1WGX A;  3FMR A;  4M3E A;  4YG2 F;  1W7P B;  2PG4 A;  3RQI A;  4A3G J;  1X4O A;  1JT0 A;  5DM7 F;  1HW5 A;  1ETO A;  3H5R A;  3QU6 A;  2D1H A;  2X51 A;  3K70 C;  4E7J A;  4YFX F;  4UHT A;  4A3J J;  2DA1 A;  3FXU A;  3KP2 A;  4G6Q A;  5J1U A;  5JHU A;  4NC7 A;  1ZKG A;  3W2W A;  3P7N A;  5BNG A;  5A2Q K;  2OJE D;  2B9S A;  2X1C A;  3FF5 A;  2HYG D;  2KZG A;  3LFU A;  2FUG 2;  4EGZ A;  2DXI A;  1U6G A;  1V3F A;  1ITY A;  4D5C A;  3S16 J;  1RIO H;  4RDU A;  1AU7 A;  4OIO F;  3DBH B;  4MQV A;  2CQ7 A;  1RI7 A;  3L2U A;  2F5D A;  1VQ6 I;  3FZV A;  2LY1 A;  1P7J A;  2IA1 A;  4BQQ A;  5JI6 A;  2BHZ A;  3U21 A;  4FCY A;  2K4J A;  4B3A A;  2Z33 A;  3H3U A;  3DEW A;  3I0T A;  3MAJ A;  3GTJ J;  2Y48 A;  1WFX A;  4GGG A;  3HSE A;  4PCQ A;  4L9V A;  2Y30 A;  3L2C A;  1APL C;  4KIT B;  3A01 B;  3ZR8 X;  2E1O A;  5BQT A;  1VQ9 I;  4EJT A;  3FM3 A;  3SHF A;  2HS5 A;  3GWZ A;  4TV7 A;  1W5C C;  3B6C A;  3EYY A;  1MNE A;  3I64 A;  2OUM A;  3OMY A;  1D1A A;  2F5E A;  2JUC A;  2MSY A;  1JGS A;  3J80 K;  2FSW A;  3J7A Y;  3FXJ A;  3PQJ A;  3CES A;  1UFM A;  2VL8 A;  3GCM A;  5E20 A;  3SDB A;  3MD2 A;  2HKX A;  1WH7 A;  4A6E A;  1IXS B;  1Z0X A;  3RPU A;  4Q4Z F;  1JHF A;  5ERI A;  2J5P A;  4BHB A;  2XUB A;  4KT5 C;  4ENN A;  5ED4 A;  3CCJ I;  3CMM A;  3HOY J;  2VAS A;  1KYZ A;  1UHM A;  2LKP A;  1B72 A;  2NVT J;  2DDB A;  4OAY A;  3BPX A;  1U0J A;  2EK5 A;  2LSO A;  3NAR A;  1MJ9 A;  2VE8 A;  1KQ8 A;  1YX5 A;  3DV8 A;  3TGN A;  1YRN B;  2W82 A;  4UUV A;  2PQ8 A;  2K27 A;  3KZI C;  2FEZ A;  2JN6 A;  1T56 A;  2V7F A;  4A93 J;  3JCU C;  2OC6 A;  4GCV A;  3Q3S A;  1IV6 A;  2F4M B;  3DCF A;  2GIZ A;  1R1U A;  4ZTF A;  2E1C A;  2KKO A;  2CMP A;  2CQK A;  5E17 F;  2K86 A;  2E2J J;  4BL0 B;  1OR7 A;  4D0P A;  1MIJ A;  4A3C J;  3E5Q A;  3JRG A;  4ZDO A;  1ORK A;  2AQE A;  1IJW C;  2LBF A;  5LGT A;  2PN6 A;  3HM5 A;  1JHH A;  1QU3 A;  3AFH A;  4IZZ A;  2BVL A;  2A6H F;  2DQR A;  2GAU A;  2HDC A;  1QQI A;  4CO8 A;  3GTP J;  1QRY A;  3FXO A;  1FOK A;  3JRH A;  1Z1D A;  2MLK A;  2QF7 A;  3CUQ A;  3IAM 2;  1MGT A;  4QPQ A;  1T08 B;  2EJR A;  1IC8 A;  2ELJ A;  4RB1 A;  4KYW A;  4Q48 A;  4I0B A;  4BUP A;  2R5Y B;  1FOW A;  2Y69 H;  3HRU A;  2WAF A;  4MGR A;  1R49 A;  1CF7 A;  5E3N A;  2ZB9 A;  1SD4 A;  2V9P A;  1CGP A;  3GTL J;  1RNL A;  1IN4 A;  3BG3 A;  3K6G A;  3C7J A;  3FXL A;  4EMS A;  1G3S A;  2EQR A;  3LST A;  4HPQ A;  1FSE A;  1TWF J;  1OLT A;  2FBI A;  2JRT A;  2FML A;  3WU2 C;  4IRI A;  5DD4 A;  1R4N B;  2ZXI A;  4UUT A;  2NVU B;  2M7B A;  1BJZ A;  4A6D A;  4EGY A;  3V7C A;  4EV0 A;  5CVJ A;  3AG2 H;  5GPC A;  1JJ6 C;  4XN3 A;  4BJ5 C;  2JVH A;  4LIU A;  3J80 Z;  4BBS J;  2UXX A;  1FX7 A;  4EM1 A;  3SDG A;  4NBQ A;  2GIV A;  4I01 A;  1FLI A;  4Y7N J;  1S7A A;  1TP4 A;  4XQF A;  3MKZ A;  4D1Q A;  4U88 A;  1BW5 A;  4LLL A;  3FBN B;  1QPI A;  5F6F A;  3OYK A;  4XKB A;  2NVX J;  3PNT A;  4M6Y A;  2HXO A;  2JA2 A;  3SQN A;  4AUX A;  3VYU B;  4C2M J;  4WF2 A;  4N0B A;  2QUF A;  4HNV A;  4GXO A;  3PNY A;  2P7C B;  3WU0 A;  2V79 A;  4N4N B;  2LKX A;  3HHH A;  3NWT A;  3WE2 A;  4QIW N;  4LD5 A;  3ZOB A;  1VQP I;  1P4A A;  4WXC A;  2X4H A;  3KEO A;  4YFN F;  4BQA A;  2FD5 A;  2KP6 A;  3FHZ A;  4LOC A;  2WA0 A;  2F4O B;  9ANT A;  4V2F A;  2KIS A;  3Q0V A;  4JYK A;  3I4M J;  1K4S A;  5CVU A;  3DXJ F;  1ZTR A;  2ZBK A;  3RIR A;  3WTV C;  3LNQ A;  3KFW X;  2E1M C;  1XB4 A;  3IH2 A;  4ZJZ A;  3KET A;  4G6D A;  2COM A;  2LF8 A;  2L9R A;  4AVZ A;  2NS8 A;  4Q5S F;  4ESF A;  3AKZ A;  5LEK A;  2JSP A;  5C4X J;  2R7Q A;  3W6K B;  4D9J A;  4B43 A;  3LA2 A;  3I59 A;  4L0Z B;  1OCR H;  4BU2 A;  1GUU A;  5CJ9 A;  4LJZ F;  4NDL A;  1QVU A;  2RRE A;  1JKP C;  1JTY A;  4DQ2 A;  3HXL A;  4XLF A;  3MN2 A;  4XN0 A;  2VBZ A;  1X1A A;  4UUS A;  1DPU A;  4UUS B;  2DA2 A;  2X6O A;  5EF6 A;  2IRF G;  3A03 A;  1T95 A;  4U0Y A;  1E17 A;  3QP6 A;  2Y9Y A;  3BR0 A;  4KT6 A;  1R9T J;  3CP8 A;  3DPT A;  1VTN C;  4E6K G;  2HOA A;  4AWX B;  1HF0 A;  3MZH A;  1U5T C;  3SFZ A;  3I59 B;  1NK2 P;  4XR6 A;  2MBF A;  3ULQ B;  5L3F A;  1DQU A;  5J47 A;  2NNY A;  3I53 A;  5CQE A;  2WY7 Q;  1MBK A;  1XGN A;  2AO9 A;  4M71 A;  3CC7 I;  2WB1 A;  2KIM A;  3TW7 A;  1FMV A;  3W3C A;  4BAY A;  5FRO A;  4PSW A;  4Y4R A;  4C9Y A;  2VLA A;  1MDM B;  2LLK A;  1EA3 A;  2GWR A;  2QQ9 A;  1RRJ A;  4LLN A;  4IVN A;  4OIP F;  2Q2E B;  2BW3 B;  2VQH A;  5JLW A;  3ZPL A;  4BS9 A;  2BY3 A;  1R5I D;  1K61 A;  5IYC J;  1XMX A;  4XL9 A;  3G6E I;  2CW7 A;  1UMQ A;  1JKR C;  3CO7 C;  1WVR A;  2L5Q A;  4KIS A;  2O9L A;  1D5Y A;  1ZG5 A;  3MMY B;  2E1N A;  3L00 A;  1MMA A;  5H2F C;  1VQ5 I;  3HOX J;  4UVC A;  2HDD A;  2LTP A;  1WH5 A;  4F91 B;  4BQO A;  1YJW I;  2BYV E;  4QLC U;  5M3F J;  1XPX A;  2IGK A;  3EDP A;  4XNF A;  4G6T B;  2FOW A;  1BL0 A;  2VBW A;  2DPU A;  2QCO A;  2DMU A;  2EPF A;  3M4O J;  3S2H J;  4J01 A;  2IPQ X;  3CJT B;  3K70 D;  1K83 J;  2COB A;  2H8W A;  1JJ8 C;  3C18 A;  1U5T B;  2R4G A;  3OWT A;  4C30 A;  3V4G A;  3KIO A;  1H0M A;  3BWG A;  4Y33 A;  1FIA A;  2H09 A;  1R4M B;  2ZJR F;  2XGE A;  1HLV A;  2EA4 A;  4CSW A;  4H0E A;  2K85 A;  3MVP A;  1EJ9 A;  5EGO A;  4F92 B;  2JA8 J;  3D1N I;  1BI3 A;  3NRV A;  1I3A A;  3PJR A;  2ID3 A;  4P9F A;  3OYM A;  1MH3 A;  3RPQ A;  1I6H J;  3GFM A;  3K69 A;  4L0Y B;  3V8K A;  5E79 C;  4G9Y A;  2IAI A;  1HDD C;  1YW7 A;  4JP0 A;  2M1B A;  4XRF A;  1Z67 A;  3LSI A;  3REO A;  2I5U A;  1DGR M;  3BR6 A;  3HJE A;  3BLY A;  2O6G E;  1A5J A;  2JSC A;  3J81 Z;  1XC5 A;  2EFN A;  2OCC H;  1F1Z A;  2EIN H;  1VQN I;  1AA7 A;  3CO6 C;  2R7S A;  3LA7 A;  4O6J A;  4HA8 A;  1HST A;  3BOQ A;  4WXH A;  5EG0 B;  5L3B A;  1K6O A;  4Y52 J;  1WJC A;  2HWV A;  5HS8 A;  2K7L A;  1RC9 A;  1BIA A;  1LFU P;  4HF1 A;  2ME0 A;  3M9A A;  3JSO A;  4X6A J;  5CKT A;  3ZCO A;  2V6E A;  2HQR A;  2FMY A;  3DKX A;  4EJW A;  1IRX A;  3HGY A;  3T8T A;  1FBS A;  4LMY A;  3NQO A;  1GDT A;  3FM5 A;  2VON A;  1DUX C;  4S0H B;  1F9N A;  4DW6 A;  1YS6 A;  5BPD A;  2XAU A;  4J19 A;  2VQC A;  1IDZ A;  5FGM A;  2EV0 A;  2FBK A;  4L9N A;  3W6J B;  3WHC A;  1HXD A;  2KLO A;  2CQQ A;  1MD0 A;  4ZC3 A;  2P7V B;  2LP0 A;  1FC3 A;  4ENJ A;  5E8I A;  2Z3Y A;  2F4I A;  2KT0 A;  1ETQ A;  5E3O A;  3OYN A;  3TW6 A;  2VT2 A;  1TW2 A;  1Z05 A;  3F8F A;  2DOA A;  1RZ4 A;  3ZQI A;  1D5V A;  3TL4 X;  3LL7 A;  1MKM A;  1JT6 A;  1X19 A;  3HBL A;  2XKP A;  1XX5 A;  1BOB A;  3JAM Z;  1VQ7 I;  1IRZ A;  3A01 A;  2G9W A;  4BEH A;  3E97 A;  4MO7 A;  2QBY B;  4BE1 A;  4IRG A;  3PUB A;  2P5L C;  1HDP A;  2LG4 A;  3PUF A;  3W2A A;  2VBX A;  2UWM A;  2LK2 A;  4F55 A;  1R1V A;  3VEP A;  3WU1 B;  4I02 A;  3KYL A;  1FYL A;  3WGI A;  1Y1W J;  5EGO B;  4IX7 A;  2L02 A;  2W84 A;  2L54 A;  5B1A H;  2BBY A;  1D0Y A;  2A6E F;  5D5V B;  3K9T A;  2YU9 J;  3IRR A;  5D5U B;  1L3L A;  5B66 C;  4RB3 C;  3KP3 A;  2QGU A;  1STZ A;  3FXR A;  4I6Z A;  1T6S A;  1WJF A;  3GW2 A;  2K3F A;  2LNB A;  3C3W A;  5IT9 Z;  3KZY A;  3JRI A;  4C2U A;  3CCY A;  5F64 A;  4XKC A;  4RB2 C;  3CCS I;  5FFZ A;  1ZLJ A;  1ZQ3 P;  5HNF A;  3S17 J;  2F2E A;  1WJD A;  4B3X A;  2BE5 F;  3IWF A;  5E1Z B;  2KFD A;  3DTI A;  2WB1 N;  3J81 K;  4KMF A;  2H6B A;  3ELK A;  5J4Y A;  2ZJP F;  4CHU A;  1XDS A;  4ZZD A;  2ZME B;  2EV6 A;  3DWL E;  1W36 C;  5D5X B;  3HOW J;  3GTM J;  1XDU A;  3BCA A;  4Z6Y A;  2W85 A;  3CD6 I;  3GEZ A;  2FF4 A;  1LE8 B;  1OYI A;  1BIB A;  3S15 J;  2E71 A;  1J0R A;  3LSP A;  3OYI A;  4HNU A;  1YHQ I;  1ETX A;  5E1W A;  3I71 A;  2DAO A;  2NS0 A;  3M1C A;  4M3F A;  3M8E A;  3OYA A;  3N97 A;  2HQ5 A;  3BTC A;  4Q47 A;  3K4L A;  2VXD A;  5EEH A;  2HPM A;  1ZRE A;  3MFK A;  2CQN A;  3RKX A;  4RBO A;  2LFB A;  4YRV A;  4MEY F;  4NQW A;  4ZH4 F;  1O7F A;  3RI4 A;  2V6C A;  3OL3 A;  2V9V A;  3QPT A;  2EIL H;  3OV8 A;  3F0C A;  5TIS C;  2K4B A;  3WTW C;  2ZSH B;  4EVI A;  2M87 A;  3T1B A;  1E0E A;  2H1K A;  2STW A;  3SEZ A;  3I55 I;  5CVR A;  4CCM A;  2FQ4 A;  2JA6 J;  3PFY A;  5K5Q A;  1SFE A;  2YSR A;  2YU3 A;  5D5W B;  3G1M A;  1YS7 A;  3DQV C;  4DNC A;  1PP7 U;  2XRO A;  3S1N J;  3IKT A;  3I4N J;  1MH4 A;  1U9O A;  4N9H A;  1AKH B;  3R0J A;  1D8K A;  2CQX A;  3FHN A;  1IUY A;  2M45 A;  2EZH A;  2OQG A;  3FK6 A;  1WZ2 A;  1W0U A;  1G8X A;  2BY0 A;  3Q9V A;  2R93 J;  4M9S A;  2VN2 A;  1QVT A;  2Y31 A;  2K5C A;  2B63 J;  1MJA A;  1JUM A;  4XOP A;  3CCM I;  2VOP A;  3ZMD A;  2F6C A;  2V1X A;  1HW2 A;  2LH9 A;  1FMW A;  4AYB A;  2MYS A;  1LFB A;  1GXQ A;  3BR5 A;  2V1U A;  1YFH A;  3RDI A;  1GV5 A;  1P2F A;  2VJJ A;  1SEU A;  2QQB A;  1IXR C;  2A5Y B;  1O3R A;  3PSF A;  1FP1 D;  2VB6 A;  1B8I B;  2UUZ A;  5FKN A;  4BXU A;  3DEU A;  4A12 A;  1W36 D;  1VQ8 I;  5ILS A;  2F5C A;  4U7D A;  4LIT A;  3PL8 A;  2HVS A;  2KQR A;  2IT0 A;  1P7I A;  2GXB A;  2HEO A;  1XGS A;  1IN5 A;  3A4C A;  5DYM A;  2WAQ A;  3ZMZ A;  1R5G A;  2X9D A;  5F1J A;  3ERE D;  1OCC H;  4AD9 A;  2NS7 A;  4HV5 A;  2LMD A;  1MBG A;  4LGW A;  4PDK A;  4M9Z A;  1UHS A;  2M34 A;  3LSG A;  4CGZ A;  2W00 A;  4XMY A;  2LRE A;  3SXY A;  4MFE A;  4G12 A;  1DU6 A;  4BNC A;  3WG7 H;  2DA7 A;  1E3H A;  2R7F A;  4O3M A;  3KX2 A;  3QPH A;  2AHQ A;  4MTD A;  1FP2 A;  2XF5 A;  2XPW A;  4BQN A;  3BP8 A;  1QNT A;  1POG A;  1IGN A;  4UV9 A;  2A6T A;  3OR1 C;  2TRT A;  2VQG A;  1M1E B;  5EZH A;  5LD2 C;  1VI0 A;  4XID A;  3ZMS A;  3F23 A;  4BDY A;  2Z1D A;  1B6A A;  5DEQ A;  4A5M A;  1KGS A;  2RVC A;  1KA8 A;  4HST A;  4XKW A;  2E60 A;  1G59 A;  1ENH A;  4AU7 A;  3BG5 A;  4XSZ F;  2RC4 A;  3FWE A;  3H9J A;  4UVA A;  2M4G A;  5F04 A;  1ZN2 A;  1D8J A;  5J4V A;  3CQZ J;  4KIG A;  1IW7 F;  4DZP A;  3P5J A;  2GOX B;  3BTJ A;  3JTH A;  4ESJ A;  3KYC B;  1FIP A;  2ELK A;  2MAB A;  4MEX F;  1LPQ A;  3QOD A;  5ICE A;  2YR2 A;  3RQ4 A;  2OBP A;  4KJZ A;  2VI6 A;  4KIC A;  4HSR A;  1U8B A;  1I5Z A;  2XIG A;  2CJJ A;  3K1M A;  5L3D A;  2HYF A;  3ERM A;  5C3E J;  3KE2 A;  1J09 A;  3CCQ I;  2OTL I;  2DT7 B;  2FNP A;  2KIU A;  3LSK A;  1ZHF A;  3HPG A;  2EIM H;  2JPC A;  2FRH A;  2DT5 A;  2JA5 J;  2ACJ A;  3Q9S A;  2HDW A;  1USS A;  4I0A A;  1UJ8 A;  1Z6T A;  2EFQ A;  1Z7L A;  2L4A A;  3KP6 A;  4D7N A;  1REP C;  2HXI A;  3OYH A;  2L3D A;  1BW6 A;  1TNT A;  1Y39 A;  2RKH A;  3OSF A;  3F22 A;  4OIR F;  2A3S A;  3CF5 F;  2R7V A;  1X3W B;  3ZP5 A;  5D8L B;  2JVG A;  4PGH A;  4G7O F;  3JRC A;  2RV8 A;  1FZP B;  5B5E C;  3BQY A;  3SJM A;  3BJO A;  2DCE A;  3IL2 A;  1R1T A;  4KIB A;  1ZG3 A;  2ZKZ A;  1L0O C;  1K78 A;  5HOO A;  3E6M A;  3MWM A;  3GFI A;  1UHW A;  4HQM A;  5E18 F;  2D2W A;  3O6B B;  3IC7 A;  1GLN A;  1TBX A;  1PJR A;  4CDG A;  4B47 A;  5CLS A;  4G7H F;  1LVA A;  1T33 A;  4IL6 C;  1MBF A;  1LVK A;  2JK3 A;  3BDD A;  3H9Q A;  1ZG1 A;  2RNG A;  2Z99 A;  2MH2 A;  4BXF A;  2CS3 A;  2KZV A;  3JR9 A;  2WAD A;  1XSD A;  2CGP A;  3GZ5 A;  4B4C A;  4Y17 A;  2A07 F;  2H27 A;  3E3V A;  1B59 A;  4BXX J;  5GAH J;  3LQQ A;  2NVQ J;  2L7Z A;  1ZH5 A;  1WRJ A;  2E7W A;  3SZT A;  3CDL A;  1TNS A;  1WJ5 A;  5FKM A;  5KAF C;  4IHY A;  4LIV A;  1YO5 C;  3FK7 A;  2NRA C;  2VOD A;  3K4C A;  1WQ2 A;  4I76 A;  4GO1 A;  3R6S A;  4EM0 B;  1W7P D;  4X1E A;  3DFG A;  4HF2 A;  3GUD A;  4LK0 F;  1RR7 A;  4P1W A;  1J9I A;  1T2K A;  2VBY A;  2LR8 A;  3TKY A;  5IYD J;  5JVT A;  2OPT A;  1VQO I;  3A2K A;  4KNY A;  1RKW A;  3HDD A;  1S7E A;  3L2R A;  5GPA A;  1W5T A;  4XM3 A;  4RGS A;  1MJB A;  2VKD A;  1VZ0 A;  5CVV A;  3V8L A;  2DA3 A;  4QTR A;  2Q8K A;  4PGG A;  1QBJ A;  2XGC A;  2W4S A;  4PK4 A;  1O3Q A;  4NUB A;  3AG4 H;  2CUF A;  3WGG A;  1YI2 I;  4UXN A;  3OS1 A;  3PM1 A;  3HL2 A;  4PJJ A;  1B8I A;  2IJL A;  4XBF A;  3S93 A;  5HNH A;  1GXP A;  4NHJ A;  2CUZ A;  1D0X A;  5KHD A;  3DLL F;  3U1K A;  5JHF A;  5K7F A;  1JUS A;  2L0K A;  2KDO A;  3I56 I;  5KVR A;  4ABZ A;  4KDP A;  4WWC A;  2R7Z J;  2XGX A;  3GZN B;  5FRN A;  2V26 A;  1MND A;  3AG3 H;  3KZZ A;  4PFO A;  4XKV A;  2IS4 A;  1Y8R B;  5LGU A;  2K02 A;  3K2Z A;  1UG2 A;  2LY2 A;  3C1D A;  4I09 A;  1TLH B;  1UST A;  3QPL A;  1YLF A;  2A5W A;  3VB2 A;  4BY1 J;  2E35 A;  3BC8 A;  3DBR B;  2YX4 A;  4K2E A;  1OQY A;  1F4K A;  2DOE A;  5IP7 J;  3WE3 A;  5FKL A;  5ILV A;  4HDV A;  4D7M A;  5FLX Z;  5DM6 F;  3QYB A;  1G3W A;  1S9H A;  2M8E A;  4II3 A;  4L9J A;  3CMY A;  5LRR A;  3EQL F;  3EUH C;  1K4T A;  3ABK H;  2IGO A;  1SC7 A;  3G1O A;  1S29 A;  4GYG A;  3BPV A;  2QSF X;  2K9S A;  4BHP A;  3ECH A;  2IGM A;  5J6X A;  4ZYG A;  4ETS A;  3QWL A;  3GO5 A;  3JRA A;  4MNU A;  1OIS A;  1MBJ A;  1XMK A;  2PFB A;  1EF4 A;  1O4X A;  3LSH A;  4R1H A;  5ICC A;  5BOX A;  2XC7 A;  2E36 A;  2JJ7 A;  2Z2S B;  1FOY A;  4RMN A;  4DIQ A;  2FX0 A;  3MZY A;  2OAZ A;  5F0H A;  2XKO A;  2GOM A;  3G4S I;  3SFI A;  3M07 A;  1ERD A;  3E6D A;  3CCL I;  2VJI A;  1DP7 P;  1LUJ B;  3G3Z A;  4F7Z A;  3IAS 2;  2ZME A;  2L7M P;  1OFC X;  4IPA A;  3ABM H;  2EWN A;  2ELH A;  3Q0U A;  2DA4 A;  3O8G A;  2VKE A;  4NQW B;  4XLP F;  2MA3 A;  3WTZ A;  2HFH A;  3TBI A;  4EM2 A;  3PQK A;  5HS9 A;  3CJN A;  5TGT A;  5LGN A;  4XSX F;  2PMH A;  2O8X A;  1HBX G;  3E1S A;  1JUP A;  3K10 A;  3HB9 A;  3TED A;  4EJO A;  4BJT A;  1TZL A;  2OF7 A;  5IPA A;  2NXN B;  4Y3O A;  2ISY A;  3ZN0 A;  1ULY A;  1I1G A;  4ZYD A;  1X1C A;  2YX7 A;  4MQ9 F;  1PUE E;  2F48 A;  4BAC A;  3S3N A;  1BM9 A;  1OYY A;  3ML6 A;  4Y15 A;  2EH3 A;  4BKX A;  1P4W A;  4FE7 A;  3SEQ A;  2F5V A;  2M0C A;  2BHY A;  1J75 A;  2OU2 A;  4M6V A;  1T0F C;  3VFZ A;  4P96 A;  3FKJ A;  4AIJ A;  3GTO J;  2MH9 A;  1V5G A;  1QHG A;  1H9T A;  4OIQ F;  1XSX A;  4AYB N;  4DOZ A;  2EZK A;  2X6X A;  3HZJ A;  3PIO F;  3DF8 A;  2QKL B;  1KON A;  3H9G A;  2M8G X;  3HOT A;  1TTY A;  5IY5 H;  1BBY A;  3WGH A;  4IJA A;  1ZLK A;  3OS2 A;  2R5Z A;  4A3M J;  3L7W A;  2NVY J;  2EA2 A;  1G6N A;  4AC0 A;  3JTG A;  2LBF B;  2DFE A;  1PVE A;  2IP2 A;  3KLO A;  2HTJ A;  2LYC A;  4E7L A;  3G1L A;  2ECB A;  4FIS A;  4M3B A;  3K4B A;  4DYQ A;  2L9S A;  1JKO C;  4BEH B;  2P0W A;  5FO5 A;  2ZCW A;  4LG0 A;  3PO2 J;  1EV7 A;  2HGC A;  5ILU A;  2B0L A;  3CDH A;  4A0Z A;  3MEX A;  3EYI A;  2XSD C;  4MFD A;  4V2G A;  4E7Z A;  3J7Y J;  3E6B A;  4C3H J;  5GAD J;  1U2W A;  1IF1 A;  2ZNZ A;  1GVD A;  1X3U A;  3MKL A;  4LLG F;  4HEA 2;  1YIT I;  1BC7 C;  4RAG A;  4WK8 F;  5EDN A;  2JQ7 A;  5KK1 A;  3I54 A;  3LMM A;  5M3M J;  2RQQ A;  3F21 A;  3VDX A;  3CCU I;  2DW4 A;  3EET A;  1YTY A;  1ZAO A;  4L5J A;  1WKM A;  2W48 A;  3UNG C;  3HIF A;  2O03 A;  4M3G A;  1IO2 A;  1X2N A;  2PX9 A;  4CCN A;  4JX5 A;  4E7K A;  2DTR A;  2Y0S N;  2GM4 A;  1N75 A;  3LFK A;  1FNN A;  1ZEL A;  4IOA F;  2R5Z B;  1K7A A;  1RET A;  2I10 A;  1TWH J;  2GXG A;  3ZN1 A;  2MD0 A;  1DU0 A;  2BEO A;  3N4M A;  1MSE C;  1QGP A;  1KU9 A;  2KIQ A;  4BYY A;  3CP2 A;  3I58 A;  2K40 A;  5CYV A;  3D5S C;  1VF9 A;  1U8R A;  3CUO A;  1MSF C;  3CUQ C;  4MHG A;  3CZ6 A;  2WV1 A;  3X2Q H;  2V4J C;  2QQ8 A;  3P9I A;  5TRD A;  2IBD A;  1OYW A;  1TT5 B;  2W7N A;  5IYB J;  1LDK B;  3HRT A;  2ZO4 A;  4M74 A;  5HOD A;  3TOA A;  1EKE A;  4RGX A;  5D8K B;  2M3A A;  1IZ1 A;  1X3Z B;  3ZQQ A;  2QEN A;  3IH3 A;  3G2B A;  1OMI A;  2XPV A;  1HKS A;  2K9M A;  1G3T A;  4OOI A;  1TT0 A;  5FLM J;  3DKW A;  4OIN F;  3OSG A;  2W57 A;  2DOD A;  5DUI A;  3GLX A;  4FHT A;  3ESW B;  4BY7 J;  2NOG A;  1G4D A;  1A35 A;  2A69 F;  2JWT A;  4CZZ A;  4Z2Y A;  3COA C;  2Q2E A;  1TQM A;  1GVJ A;  3V8J A;  2X6W A;  1R36 A;  1J59 A;  2G7H A;  1K6Y A;  1Z21 A;  3S3O A;  2DOF A;  3Q0W A;  2R0Q C;  3K1N A;  2Q1Z B;  1I1S A;  4KFC A;  2ID6 A;  1LB2 A;  2XAH A;  1O7L A;  1YX3 A;  2M9H A;  2GLO A;  2DPD A;  4RGU A;  2M30 A;  3EUH A;  3OY9 A;  4ZYA A;  4ZTJ A;  1KU7 A;  3ZGK A;  3CF2 A;  5F0F A;  3GXO A;  4DBR A;  3ABT A;  3JW4 A;  5KNL A;  3DU6 A;  5DCM B;  3CME I;  1ZRD A;  5EEG A;  1WJE A;  3ZQG A;  5D4R A;  2BOL A;  3OIP A;  3ZMU A;  1FBU A;  3FMS A;  2FJ1 A;  3BG7 A;  4ENM A;  1I27 A;  1YIO A;  5CQG A;  5E3M A;  1TWC J;  2P6T A;  2QSH X;  4LFU A;  5J40 A;  4E7I A;  2R7X A;  5AON A;  4ANJ A;  3K4K A;  3F8B A;  1FJL A;  3CCV I;  2GZW A;  3A02 A;  3IRQ A;  1I6X A;  1R6R A;  4IHS A;  4HNT A;  3QRF F;  2FQ3 A;  1LDJ A;  1BC8 C;  2WY8 Q;  3H0G J;  4ASN A;  4CXF A;  2TDX A;  1UAA A;  3DPL C;  3W2V A;  1KU2 A;  5IOY A;  4KN4 X;  1MBH A;  1HA8 A;  4A3I J;  2K3P A;  4BH9 A;  2JPB A;  1Y0U A;  4RLQ A;  4Y13 A;  1PP8 F;  1V55 H;  3V7R A;  2F5F A;  4IHW A;  4CYC A;  2V9K A;  1XGM A;  3BG6 A;  1U9N A;  4ZZL A;  1W1W E;  3IHU A;  1LFP A;  1QZZ A;  4P5O A;  2XAG A;  3FKI J;  1D3Y A;  1R00 A;  3G73 A;  4A2U A;  4HX8 A;  2XDV A;  1HW1 A;  2GXA A;  3WOD F;  1NHA A;  3EUK L;  2XAS A;  4EQQ A;  2ZXJ A;  3ZMT A;  1OCO H;  1U3E M;  2A61 A;  4CA0 A;  3A0B C;  3HOZ J;  2L9N A;  3F8M A;  2QKM B;  2XSJ C;  1JI8 A;  4ZYE A;  5H6R A;  4B1R A;  5DDG A;  1XS9 A;  3HHG A;  3OIO A;  2CO5 A;  3F9K A;  2K9N A;  3H1C A;  1RES A;  3HUG A;  1FPQ A;  2EB7 A;  4HQE A;  1VQM I;  1VND A;  3ISP A;  4FT8 A;  2PMU A;  4JOM A;  2EZL A;  2UZK A;  2HKO A;  1HCR A;  2LY9 A;  3DPU A;  2LF7 A;  1ZGA A;  4XLN F;  1MMN A;  3L2V A;  1QZE A;  2TCT A;  4F93 B;  2LOO A;  5C4J J;  4HLY A;  3IP4 B;  1BJA A;  1TWA J;  3RPU D;  3RZD J;  2EFO A;  3M7G A;  4OAZ A;  3OYC A;  2XRN A;  4AIH A;  5E3L A;  4NC8 A;  1R22 A;  2L4M A;  3BRO A;  4BHC A;  3U2R A;  3S2D J;  2DFH A;  1ZRC A;  4HRI A;  3I9V 2;  2ME6 A;  4S05 A;  2GA1 A;  3MZ8 A;  3DKY A;  2RGV A;  1V5E A;  3TO6 A;  2LRD A;  4HV6 A;  1Q1H A;  5HDK A;  2CG4 A;  4A0Y A;  1D1C A;  1KZH A;  1SFX A;  3HKZ A;  1LJ9 A;  1NH3 A;  2AQF A;  1BR1 A;  3K0L A;  4CCK A;  5JVG F;  2PJP A;  1X2M A;  3JRF A;  1H89 C;  4XRS G;  1SAN A;  2IXS A;  3D5L A;  3FDY A;  4N4O B;  2VUM J;  3FXM A;  4X0G A;  1YJN I;  1E2X A;  5IP9 J;  1O57 A;  1JE8 A;  3OYG A;  3LSR A;  4B09 A;  1YQA A;  1OCZ H;  3M8J A;  2M5W A;  2O0Y A;  3F6V A;  4E4H A;  5F0C A;  5LLQ A;  1X4P A;  2BY1 A;  5FB2 A;  2WWY A;  4CCO A;  3RKW A;  2OV7 A;  3ABU A;  4M6X A;  4JK1 X;  2CFO A;  2M4K A;  3MCZ A;  3HSR A;  3QU3 A;  3MKW B;  1IUF A;  2XAF A;  1Z77 A;  3DBL B;  2AXL A;  5J3L A;  4HAM A;  2R7T A;  4FX4 A;  2L01 A;  2O8K A;  3KLN A;  2O7O A;  1I3Q J;  1IAW A;  2Z16 A;  3BJ6 A;  3QOP A;  2IEK A;  3HUG B;  5A2Q Z;  1MBE A;  5M5Y J;  3OYJ A;  2AXT C;  3S32 A;  2RDP A;  1Q1V A;  3R61 A;  4XLE A;  2QSG X;  3B73 A;  1XTA A;  2HU9 A;  2XVC A;  4AIK A;  3H3Z A;  2E2H J;  5IP6 A;  2NYX A;  2XAJ A;  3UR3 C;  4RAF A;  5CPR B;  1PDN C;  1ZR4 A;  3B6A A;  4UB8 C;  5LEJ A;  2V1D A;  2FBH A;  3TQN A;  2KHM A;  1B72 B;  1MNM C;  1XD7 A;  1WCM J;  4HDU A;  1ODD A;  4BE0 A;  2XB0 X;  3MKY B;  4B48 A;  4M73 A;  2X1E A;  1S3J A;  2D5V A;  3NAU A;  1SFK A;  4G94 A;  3BZ6 A;  1XGO A;  3SZP A;  2VOO A;  3DEE A;  2DA5 A;  5K7H A;  3GTG J;  2CW0 F;  1IXC A;  3E0J B;  1IRG A;  3B02 A;  2E2I J;  3H5A A;  1J5Y A;  2Y9Z A;  1SMY F;  2DYS H;  3JSP A;  2GA2 A;  1IN7 A;  3FIW A;  4PFP A;  3C2B A;  2W1O A;  2E7X A;  2Y2Z A;  4MTE A;  3TDU C;  3OYL A;  2CW8 A;  4IRH A;  5J8C A;  3P9C A;  1DGW Y;  1YG2 A;  3BG9 A;  5AIP A;  5J8F A;  1FSH A;  1R58 A;  3ZQC A;  5FLV A;  3M3Y J;  4UV8 A;  1MZB A;  3H3V K;  5DTD A;  2JRM A;  3P9K A;  2DK5 A;  4LB6 B;  1SD6 A;  2Z9O A;  3L9F A;  1X1B A;  1T38 A;  2WC2 A;  3HYI A;  1VQK I;  1W0T A;  1BI2 A;  3S14 J;  1ON1 A;  1U78 A;  1YW9 A;  4V19 K;  5IT9 K;  2UXN A;  1IG7 A;  5GTI C;  4R79 A;  4A3D J;  1WI3 A;  5LRS A;  4W1U A;  4HLX A;  4OWR B;  3H36 A;  4NNJ A;  5FJ8 J;  2EIJ H;  1ZRF A;  3L2W A;  4XK4 A;  2MW8 A;  1X58 A;  3GLL A;  3HOU J;  2IA0 A;  4JBA A;  2YUS A;  3IKV A;  1RUN A;  4RAZ A;  3C2G A;  2E5N A;  1MW7 A;  1KQ0 A;  1JXS A;  1CQT A;  3KP5 A;  3LWF A;  3TO7 A;  1O3T A;  2RAE A;  4E7S A;  3KYD B;  3HSF A;  4XOR A;  2DLL A;  2XHK A;  1Y0N A;  2BXZ A;  2X85 A;  5B3S H;  3T0Y A;  1E3O C;  3PFI A;  4G7Z F;  2BY2 A;  4XRM A;  3HTS B;  4JX6 A;  3W6V A;  3SZG A;  5DD8 A;  2KIF A;  1A04 A;  1Z91 A;  1I39 A;  4EEF G;  3KPH A;  1ZYR F;  3HRM A;  3MQ0 A;  2DMN A;  2YPR A;  2ZXH A;  3T5X A;  1R71 A;  3RZO J;  1KYW A;  4L5I A;  1ETV A;  3TOB A;  2K9L A;  2ETH A;  2PMZ A;  2WV0 A;  5DUK A;  2XAQ A;  1KU3 A;  5HVQ C;  3JRD A;  4QPO A;  2GBY A;  4AID A;  2HR3 A;  2DFF A;  2PBI A;  3K1P A;  3K4N A;  1FEX A;  3WTS C;  4PJ0 C;  3GZ6 A;  2P5V A;  2DT6 A;  3L09 A;  2PJR A;  1MMG A;  2G7U A;  4L9T A;  4P9U A;  4R8H A;  1T8I A;  1E3P A;  2IS2 A;  2UV1 A;  4BBR J;  3RTR A;  1W7P A;  2QYO A;  1WI9 A;  3IUO A;  3C2H A;  4GDF A;  1VQL I;  4WX9 A;  1TQP A;  4ITV A;  3CTA A;  2HPI A;  3WTT C;  3E7L A;  3GVA A;  2MGQ A;  5HLT A;  4XRS A;  2LC2 A;  3LQR A;  4U87 A;  1FTT A;  4FX0 A;  4CZC A;  2NNN A;  2KMU A;  4E7H A;  2ZFU A;  3QYF A;  3RJP A;  1XCB A;  2O3F A;  5L3E A;  1QHH D;  1KQ9 A;  2ESH A;  3OS0 A;  2QBY A;  1FTZ A;  2CWE A;  5H6Q A;  5HS7 A;  1R23 A;  4FAS D;  3K4J A;  3BCB A;  4XLH A;  1NG6 A;  2OZU A;  2R7D A;  4J00 A;  2QWW A;  2DK8 A;  2ZJQ F;  2DFI A;  1OCP A;  3GF2 A;  3WHB A;  5LHH A;  1XN7 A;  4U0V A;  5IT3 A;  2XB5 A;  3GYH X;  1UB9 A;  3HKZ N;  3ONQ A;  2XF6 A;  3FX3 A;  2CFX A;  2BGC A;  1SAX A;  3H0D A;  2X6Y A;  4B8X A;  3CDI A;  4XON A;  5KCM A;  6PAX A;  2RNJ A;  2LVS A;  3GFJ A;  4HX7 A;  3CJQ B;  3N05 A;  1V5F A;  1LE8 A;  4RAY A;  4ZDL A;  4YII A;  1TQI A;  3S1R J;  2IW5 A;  1LNW A;  1H88 C;  3WG9 A;  5FD6 A;  4PZJ A;  4UNO A;  2VT3 A;  3V42 A;  5EG0 A;  2EFW A;  1PUF B;  1OR7 C;  4M72 A;  5K5R A;  1BR4 A;  3D5R C;  2QA4 I;  2WTE A;  1R5H A;  1YW8 A;  4DGW B;  2XPU A;  1H8A C;  2JA7 J;  5K7Z A;  2CRG A;  1K79 A;  1B1B A;  3BT9 A;  3AG1 H;  3TP0 A;  5HLG A;  2YS9 A;  1P6R A;  3CLO A;  4LG0 B;  4BJ6 C;  3CCE I;  4IKF A;  2QEX I;  2DU9 A;  2NOJ B;  3H35 A;  3DTK A;  1ON2 A;  1WSU A;  2CUJ A;  3BY6 A;  3DP7 A;  4CYD A;  3TO9 A;  3T8R A;  3BTL A;  1A36 A;  5F27 A;  2HQN A;  2PEX A;  3BR1 A;  1GT0 C;  1B9N A;  4XIC A;  2QQA A;  2P6S A;  4PJN A;  3S3M A;  2VJ5 A;  5BS6 A;  1ZR2 A;  5FLX K;  2VC0 A;  3CC4 I;  2LKS A;  1PYV A;  4FTH A;  1P4X A;  4RB0 A;  4XLA A;  3U1D A;  3AAF A;  3VYS B;  2R7W A;  5D4S A;  2HNH A;  5FD5 A;  4S04 A;  3KP7 A;  5DCF A;  4HBL A;  3CJR B;  3K2A A;  1S72 I;  3S1Q J;  2DBB A;  4O5V A;  1S7O A;  2VPL A;  3OOU A;  2ZC2 A;  1QA6 A;  2OQR A;  2Z5U A;  3V7S A;  2STT A;  2FOK A;  2IGN A;  3RKQ A;  4MLO A;  5FKK A;  1TWG J;  5K5O A;  1FYK A;  3O8H A;  3F72 A;  4BGD A;  3ABL H;  5GP9 A;  5K1Y A;  4IQ4 A;  1Y56 A;  4JX4 A;  3BR2 A;  1ETY A;  2W24 A;  3S2W A;  4E70 A;  4FQG A;  3D0S A;  5FFX A;  3NWS A;  3OYD A;  4HYE A;  1DPR A;  2X0L A;  5E8G A;  4KA4 A;  2ISZ A;  2DTZ A;  1T39 A;  3OYF A;  3QPS A;  1BN5 A;  1UEL B;  2WAE A;  2DMT A;  3GFL A;  3LAP A;  1MMD A;  3ZQ7 A;  3QOE A;  3ZQH A;  3VOE A;  5FRM A;  3HEF A;  3DTE A;  4F52 A;  3S1M J;  3RYP A;  1I50 J;  3JRB A;  4HX4 A;  1ZGW A;  4A5N A;  2OCE A;  2BV6 A;  3WTX C;  2FE3 A;  4I98 B;  4YIR X;  3PO3 J;  1SD5 A;  2BW3 A;  3TDZ C;  4IF4 A;  1OCT C;  3ASO H;  1BOA A;  1NG7 A;  3VYT B;  2X48 A;  1ACI A;  5HDG A;  2B7E A;  3J7Z I;  5JFR A;  2C6Y A;  1MDM A;  4JQF A;  3KCC A;  2QLZ A;  2MC4 A;  2KPM A;  2Y0M A;  4F3Q A;  1P9Q C;  2ZNY A;  3ZQL A;  4ZYH A;  1WJB A;  2PLY A;  3L1P A;  3OL4 A;  5LFA A;  3ZXS A;  1C0W A;  4D5F A;  3PNV A;  1X1P A;  1SFO J;  1Z9C A;  3K7A J;  2IS1 A;  2I8D A;  3L2Q A;  2H8R A;  4CUG A;  4CYC B;  1N25 A;  4UB6 C;  3S8P A;  1W4M A;  4CCL A;  4A3F J;  2D45 A;  2IS6 A;  2W25 A;  2OTJ I;  5EJC A;  5GAE J;  2Y75 A;  4RM2 A;  3ZMV A;  1B4A A;  1YE9 A;  4UY8 I;  5FKO A;  1W5S A;  1ETW A;  4KUM A;  1A31 A;  4P55 A;  1FWZ A;  3HC7 A;  2CV0 A;  3QQA A;  3GME A;  4DZJ A;  1JTX A;  2HZT A;  1A6Q A;  3Q5F A;  1U5T A;  2EZI A;  1N77 A;  3BTI A;  1F36 A;  2P4W A;  2E34 A;  2DYR H;  2EIK H;  5C44 J;  1WWX A;  2EV5 A;  2XV4 S;  3I5U A;  2GQQ A;  3HTU A;  4RS8 A;  2PMZ N;  2PI0 A;  3M1E A;  3PSI A;  5AIQ A;  1BI0 A;  3TP3 A;  1WHU A;  1Y1V J;  2KRH A;  2ZME C;  5F08 A;  2HZD A;  2P81 A;  2CUE A;  3OR2 C;  4HG2 A;  1WPK A;  4IQJ A;  1A6I A;  4IHT A;  1VQ4 I;  3ZQF A;  3E5X A;  2FU4 A;  2L2O A;  4UVB A;  5KAI C;  2LD5 A;  2KJC A;  2R7U A;  5DCM A;  5LHG A;  2N8G A;  1UCR A;  1AWC A;  4IHV A;  2NAZ A;  3VPR A;  4YEL A;  1XG1 A;  1J7K A;  1LDD A;  3QAH A;  2H1L A;  2JT1 A;  3PIP F;  3KEQ A;  1RUO A;  1YJ9 I;  3I3L A;  3KP4 A;  3FXQ A;  1HKT A;  3ASN H;  3BJA A;  4IO9 F;  2WBM A;  1T98 A;  2DJN A;  2VE9 A;  2JZY A;  2A05 A;  1LEA A;  2KJB A;  4QWQ A;  3GTQ J;  2DI3 A;  2A68 F;  5GAG J;  3CCR I;  3AL0 C;  1VFC A;  1QPM A;  1WJA A;  2E1M B;  4FE4 A;  3CC2 I;  3OOP A;  2ZJ2 A;  4GRI A;  4HW0 A;  1Z6R A;  4C3I J;  4U7B A;  2ZSI B;  2VC1 A;  4A69 C;  2Y0S A;  2JMW A;  4WCG A;  5M5W J;  1LEB A;  2M2E A;  4IXA A;  2DMP A;  1JKQ C;  5EYR A;  1SFU A;  1ZK8 A;  3NEU A;  1FT9 A;  4IHX A;  2LDU A;  2BVM A;  2HOS A;  3FIS A;  2MLG A;  1FYM A;  1Z3X A;  4KN7 X;  2EBI A;  5HLH A;  1NTC A;  5D6F A;  2VKV A;  2OA4 A;  2HTS A;  1IRF A;  1Z7U A;  2BXY A;  3LSM A;  5DS9 A;  2DQL A;  3JAM K;  2MC3 A;  4MIM A;  1S8N A;  1UG0 A;  1K78 B;  4NB5 A;  1MMS A;  1HQC A;  2H94 A;  3LSJ A;  3RCO A;  4OU0 A;  5BMZ A;  4CCJ A;  2J5O A;  5F1R A;  4IOC F;  3OYE A;  4N9I A;  2WAQ N;  2FA5 A;  2HYJ A;  2XF7 A;  1OJL A;  5LHI A;  3ROU A;  3GX4 X;  2HVR A;  3ZRG A;  2R7R A;  4DJA A;  3JRE A;  3A1Y A;  4YFK F;  1IN6 A;  2DDA A;  2G0E A;  4U0W A;  2EFP A;  4HZF A;  3BQZ A;  3DU5 A;  1D0Z A;  5H20 A;  4IEJ A;  3EPZ A;  5JLX A;  5J1Y A;  4NC6 A;  1BR2 A;  1HOM A;  4LG3 A;  4RA2 A;  1G3Y A;  1OPC A;  3RSN A;  1N78 A;  1TW3 A;  2ICW G;  3GTK J;  3HGG A;  5JR3 A;  3R0A A;  4A3L J;  3F6O A;  1HKQ A;  2KL4 A;  1YYV A;  2O61 A;  1GHC A;  2FXA A;  2MFZ A;  5L3C A;  4AM3 A;  1J2X A;  3KEY A;  2OZ6 A;  2HQA A;  4QSH A;  2IVM A;  2VJ4 A;  3K4M A;  1ETK A;  3I4P A;  1F5T A;  4M3D A;  2R7O A;  1OKR A;  2ESN A;  1BI1 A; 
#chains in the Genus database with same CATH homology
 1SMT A;  3QP5 A;  1S6L A;  5ICF A;  2ZFW A;  4GYI A;  1B9M A;  1EH6 A;  3F3X A;  4I2O A;  3VOD A;  5HLI A;  2MD5 A;  3O2P E;  3LAJ A;  2HOE A;  4YIF A;  3R4K A;  2RQP A;  4A0X A;  1DDN A;  5DV5 A;  1XMA A;  1HSJ A;  3LA3 A;  4LK1 F;  4OMY A;  5ICG A;  2KRF A;  2Q0O A;  3FMQ A;  1QO0 D;  1CF7 B;  4LB5 A;  3F8C A;  2H6C A;  3WTY C;  1LQ1 A;  3H92 A;  4CIC A;  4HF0 A;  1XSV A;  3CUQ B;  4G8X A;  1AOY A;  2VXZ A;  4ENK A;  1IN8 A;  5BPI A;  4M9X A;  1P92 A;  4ESB A;  3E6C C;  2OD5 A;  3R60 A;  2P5K A;  4I7H A;  1SD7 A;  1FY7 A;  2QZ8 A;  1EH8 A;  4EJV A;  2QM3 A;  2D1V A;  3RKY A;  4EJU A;  5LBQ A;  3RYR A;  2ADU A;  3J7A O;  2DO7 A;  2R3S A;  1O3S A;  4RGR A;  1V4R A;  3IWZ A;  3U9G A;  2P8T A;  2QVO A;  2CYY A;  3E5U A;  1T0F A;  2IA2 A;  4L18 B;  4AVP A;  1QZY A;  1R7J A;  1ZGJ A;  5TJJ A;  5E1X A;  2CSO A;  3F8N A;  5L3G A;  3M8F A;  2AS5 F;  1FBQ A;  3WTU C;  4KIF A;  1H9G A;  4ON0 A;  4WXD A;  3O3K A;  4OMZ A;  1ZAR A;  1XCV A;  2RN7 A;  4HOB A;  5HDN A;  3ECO A;  2FNA A;  3HOS A;  1EH7 A;  1ONV A;  3HRS A;  4KMU X;  5D6E A;  2JTV A;  5CVI A;  3FMR A;  4YG2 F;  1W7P B;  2PG4 A;  1HW5 A;  3QU6 A;  2D1H A;  4YFX F;  4UHT A;  4G6Q A;  3FXU A;  3KP2 A;  5JHU A;  3P7N A;  5A2Q K;  3FF5 A;  2HYG D;  4EGZ A;  1U6G A;  1V3F A;  1RIO H;  4OIO F;  4MQV A;  1RI7 A;  2F5D A;  3FZV A;  2IA1 A;  5JI6 A;  2K4J A;  2Z33 A;  3H3U A;  3I0T A;  3MAJ A;  2Y48 A;  4GGG A;  3HSE A;  4PCQ A;  4L9V A;  3L2C A;  5BQT A;  4EJT A;  3FM3 A;  3SHF A;  2HS5 A;  3GWZ A;  4TV7 A;  3EYY A;  3I64 A;  2F5E A;  1JGS A;  3J80 K;  2FSW A;  3PQJ A;  1UFM A;  5E20 A;  2HKX A;  4A6E A;  1IXS B;  3RPU A;  4Q4Z F;  1JHF A;  5ERI A;  2J5P A;  4BHB A;  2XUB A;  4KT5 C;  4ENN A;  5ED4 A;  1KYZ A;  1UHM A;  2LKP A;  3BPX A;  2EK5 A;  2LSO A;  1KQ8 A;  1MJ9 A;  2VE8 A;  3DV8 A;  3TGN A;  4UUV A;  2PQ8 A;  2K27 A;  2FEZ A;  4GCV A;  1R1U A;  2E1C A;  2KKO A;  2CQK A;  5E17 F;  2K86 A;  1OR7 A;  4D0P A;  3E5Q A;  5LGT A;  2PN6 A;  1JHH A;  2GAU A;  2A6H F;  2DQR A;  2HDC A;  1QQI A;  4CO8 A;  1FOK A;  1Z1D A;  2MLK A;  3CUQ A;  1MGT A;  2EJR A;  4RB1 A;  4KYW A;  4Q48 A;  4I0B A;  3HRU A;  4MGR A;  1CF7 A;  1SD4 A;  1CGP A;  1RNL A;  1IN4 A;  3C7J A;  4EMS A;  1G3S A;  3LST A;  1FSE A;  2FBI A;  2JRT A;  2FML A;  4IRI A;  5DD4 A;  4A6D A;  4EGY A;  3V7C A;  4EV0 A;  5CVJ A;  3J80 Z;  2UXX A;  1FX7 A;  4EM1 A;  1FLI A;  2GIV A;  4I01 A;  1S7A A;  4U88 A;  4LLL A;  5F6F A;  4M6Y A;  3SQN A;  4WF2 A;  4N0B A;  2QUF A;  4GXO A;  2P7C B;  3WU0 A;  2V79 A;  3HHH A;  3WE2 A;  4LD5 A;  1P4A A;  4WXC A;  2X4H A;  3KEO A;  4YFN F;  4BQA A;  3FHZ A;  5CVU A;  3DXJ F;  3RIR A;  2ZBK A;  3WTV C;  3KFW X;  1XB4 A;  3KET A;  4G6D A;  2COM A;  2LF8 A;  4Q5S F;  4ESF A;  5LEK A;  3W6K B;  3LA2 A;  3I59 A;  4L0Z B;  5CJ9 A;  4LJZ F;  4DQ2 A;  2VBZ A;  1DPU A;  2IRF G;  4U0Y A;  1E17 A;  3QP6 A;  3DPT A;  1VTN C;  4AWX B;  3MZH A;  1U5T C;  3SFZ A;  3I59 B;  2MBF A;  5L3F A;  2NNY A;  3ULQ B;  3I53 A;  1XGN A;  4M71 A;  2KIM A;  4BAY A;  1MDM B;  2GWR A;  2QQ9 A;  4LLN A;  4IVN A;  4OIP F;  3ZPL A;  3CO7 C;  1ZG5 A;  2E1N A;  3L00 A;  4UVC A;  2BYV E;  4QLC U;  3EDP A;  2VBW A;  2DPU A;  2IPQ X;  3C18 A;  1U5T B;  3V4G A;  1H0M A;  3BWG A;  2H09 A;  2EA4 A;  4H0E A;  1BI3 A;  3NRV A;  4P9F A;  3RPQ A;  3GFM A;  3K69 A;  4L0Y B;  3V8K A;  4G9Y A;  1YW7 A;  2M1B A;  4XRF A;  3REO A;  2O6G E;  2JSC A;  3J81 Z;  2EFN A;  1F1Z A;  3CO6 C;  3LA7 A;  4O6J A;  4HA8 A;  1HST A;  3BOQ A;  4WXH A;  5L3B A;  1K6O A;  2HWV A;  5HS8 A;  2K7L A;  1BIA A;  4HF1 A;  3M9A A;  3JSO A;  2HQR A;  2FMY A;  4EJW A;  3T8T A;  1FBS A;  4LMY A;  3NQO A;  2VON A;  3FM5 A;  1DUX C;  1F9N A;  1YS6 A;  5BPD A;  5FGM A;  2EV0 A;  2FBK A;  4L9N A;  3W6J B;  1HXD A;  1MD0 A;  2P7V B;  1FC3 A;  4ENJ A;  5E8I A;  2Z3Y A;  2VT2 A;  1TW2 A;  1Z05 A;  3F8F A;  1RZ4 A;  1D5V A;  1MKM A;  2XKP A;  3JAM Z;  2G9W A;  3E97 A;  2QBY B;  4IRG A;  2P5L C;  2VBX A;  2UWM A;  1R1V A;  3VEP A;  3WU1 B;  4I02 A;  1FYL A;  3WGI A;  2L02 A;  2W84 A;  2L54 A;  2BBY A;  2A6E F;  5D5V B;  3K9T A;  3IRR A;  5D5U B;  1L3L A;  4RB3 C;  3KP3 A;  1STZ A;  3FXR A;  1T6S A;  2LNB A;  3C3W A;  3GW2 A;  5IT9 Z;  3KZY A;  5F64 A;  4RB2 C;  5FFZ A;  1ZLJ A;  2F2E A;  2BE5 F;  3IWF A;  5E1Z B;  3J81 K;  2H6B A;  3ELK A;  4CHU A;  1XDS A;  4ZZD A;  2ZME B;  2EV6 A;  5D5X B;  1XDU A;  2W85 A;  3GEZ A;  2FF4 A;  1OYI A;  1BIB A;  1J0R A;  5E1W A;  3I71 A;  2DAO A;  2NS0 A;  3M8E A;  3N97 A;  4Q47 A;  5EEH A;  1ZRE A;  3MFK A;  3RKX A;  4MEY F;  4NQW A;  4ZH4 F;  1O7F A;  3RI4 A;  2V6C A;  3QPT A;  2V9V A;  3OV8 A;  3WTW C;  2K4B A;  4EVI A;  2M87 A;  3T1B A;  2STW A;  5CVR A;  5K5Q A;  1SFE A;  2YSR A;  2YU3 A;  5D5W B;  1YS7 A;  3DQV C;  4DNC A;  1PP7 U;  2XRO A;  3IKT A;  1IUY A;  4N9H A;  3R0J A;  1D8K A;  2M45 A;  2OQG A;  3Q9V A;  4M9S A;  2VN2 A;  1MJA A;  2VOP A;  3ZMD A;  2V1X A;  1HW2 A;  1GXQ A;  2V1U A;  1YFH A;  3RDI A;  1P2F A;  2QQB A;  1IXR C;  2A5Y B;  1O3R A;  1FP1 D;  4A12 A;  4BXU A;  3DEU A;  5ILS A;  2F5C A;  4U7D A;  2GXB A;  2IT0 A;  2HEO A;  1XGS A;  1IN5 A;  5DYM A;  3ZMZ A;  1R5G A;  3ERE D;  4AD9 A;  4HV5 A;  4LGW A;  4PDK A;  4M9Z A;  4CGZ A;  3SXY A;  4BNC A;  2R7F A;  4O3M A;  3QPH A;  4MTD A;  1FP2 A;  3BP8 A;  1QNT A;  4UV9 A;  3ZMS A;  3F23 A;  1B6A A;  5DEQ A;  4A5M A;  1KGS A;  2RVC A;  1KA8 A;  4XSZ F;  2RC4 A;  3FWE A;  4UVA A;  1ZN2 A;  1D8J A;  4KIG A;  1IW7 F;  3JTH A;  4ESJ A;  4MEX F;  5ICE A;  2YR2 A;  2OBP A;  4KIC A;  1I5Z A;  2XIG A;  3K1M A;  5L3D A;  2HYF A;  3KE2 A;  2FNP A;  2KIU A;  1ZHF A;  2JPC A;  2FRH A;  2DT5 A;  2ACJ A;  3Q9S A;  1USS A;  4I0A A;  1Z6T A;  2EFQ A;  2L4A A;  3KP6 A;  1REP C;  2L3D A;  1TNT A;  2RKH A;  3F22 A;  4OIR F;  2A3S A;  3ZP5 A;  5D8L B;  4PGH A;  4G7O F;  2RV8 A;  1FZP B;  3BJO A;  3IL2 A;  1R1T A;  4KIB A;  1ZG3 A;  2ZKZ A;  1K78 A;  1L0O C;  5HOO A;  3E6M A;  3MWM A;  3GFI A;  1UHW A;  4HQM A;  5E18 F;  2D2W A;  3O6B B;  3IC7 A;  1TBX A;  4CDG A;  5CLS A;  4G7H F;  1LVA A;  3BDD A;  1ZG1 A;  2Z99 A;  2MH2 A;  4KMF A;  1XSD A;  2CGP A;  2H27 A;  3GZ5 A;  2A07 F;  4Y17 A;  3E3V A;  1B59 A;  3LQQ A;  1ZH5 A;  1WRJ A;  2E7W A;  3SZT A;  1TNS A;  1YO5 C;  2VOD A;  2NRA C;  1WQ2 A;  4GO1 A;  3R6S A;  4EM0 B;  1W7P D;  4HF2 A;  3DFG A;  3GUD A;  4LK0 F;  1J9I A;  1T2K A;  2VBY A;  3TKY A;  5JVT A;  4KNY A;  1W5T A;  4RGS A;  1MJB A;  5CVV A;  3V8L A;  2Q8K A;  4PGG A;  1QBJ A;  1O3Q A;  3WGG A;  4UXN A;  2IJL A;  4XBF A;  1GXP A;  4NHJ A;  5KVR A;  4KDP A;  4WWC A;  2XGX A;  3KZZ A;  5LGU A;  2K02 A;  3K2Z A;  3C1D A;  4I09 A;  1TLH B;  1UST A;  1YLF A;  3VB2 A;  2YX4 A;  4K2E A;  1F4K A;  3WE3 A;  5ILV A;  4HDV A;  5FLX Z;  1G3W A;  2M8E A;  4L9J A;  5LRR A;  3EQL F;  1S29 A;  4GYG A;  3BPV A;  4BHP A;  3ECH A;  5J6X A;  4ZYG A;  4ETS A;  3GO5 A;  4MNU A;  1XMK A;  2PFB A;  4R1H A;  5ICC A;  5BOX A;  3MZY A;  2OAZ A;  2XKO A;  3E6D A;  1DP7 P;  3G3Z A;  4F7Z A;  2ZME A;  4IPA A;  2EWN A;  2ELH A;  4XLP F;  2MA3 A;  3WTZ A;  2HFH A;  4EM2 A;  3PQK A;  5HS9 A;  3CJN A;  5LGN A;  4XSX F;  2PMH A;  2O8X A;  1HBX G;  4EJO A;  2ISY A;  3ZN0 A;  1ULY A;  1I1G A;  4ZYD A;  2YX7 A;  4MQ9 F;  1PUE E;  1BM9 A;  1OYY A;  3ML6 A;  4Y15 A;  1P4W A;  1J75 A;  2OU2 A;  3VFZ A;  4P96 A;  4AIJ A;  2MH9 A;  1H9T A;  4OIQ F;  1XSX A;  3DF8 A;  3HOT A;  1TTY A;  1BBY A;  3WGH A;  4IJA A;  1ZLK A;  3L7W A;  2EA2 A;  1G6N A;  3JTG A;  2IP2 A;  3KLO A;  2HTJ A;  5FO5 A;  2ZCW A;  4LG0 A;  1EV7 A;  2HGC A;  5ILU A;  2B0L A;  3CDH A;  4A0Z A;  3MEX A;  3EYI A;  3E6B A;  1IF1 A;  1U2W A;  2ZNZ A;  1X3U A;  4LLG F;  1BC7 C;  4WK8 F;  5KK1 A;  3I54 A;  3F21 A;  2DW4 A;  3EET A;  1YTY A;  1ZAO A;  4L5J A;  1WKM A;  3HIF A;  2O03 A;  2DTR A;  3LFK A;  1FNN A;  1K7A A;  3ZN1 A;  2GXG A;  2BEO A;  3N4M A;  1QGP A;  1KU9 A;  4BYY A;  3I58 A;  5CYV A;  1U8R A;  3CUO A;  3CUQ C;  4MHG A;  3P9I A;  5TRD A;  1OYW A;  1LDK B;  3HRT A;  2ZO4 A;  4M74 A;  3TOA A;  4RGX A;  5D8K B;  1IZ1 A;  2QEN A;  1OMI A;  1HKS A;  1G3T A;  4OOI A;  3DKW A;  4OIN F;  2W57 A;  5DUI A;  3GLX A;  4FHT A;  1G4D A;  2A69 F;  4CZZ A;  4Z2Y A;  3COA C;  2Q2E A;  1TQM A;  1GVJ A;  3V8J A;  1R36 A;  1J59 A;  2G7H A;  3K1N A;  1I1S A;  4KFC A;  1LB2 A;  2XAH A;  1O7L A;  2DPD A;  4RGU A;  2M30 A;  3EUH A;  1KU7 A;  3GXO A;  3ABT A;  3JW4 A;  5DCM B;  1ZRD A;  5EEG A;  5D4R A;  3ZMU A;  1FBU A;  3FMS A;  4ENM A;  1I27 A;  1YIO A;  2P6T A;  4LFU A;  5AON A;  3F8B A;  2GZW A;  3IRQ A;  1I6X A;  4IHS A;  3QRF F;  2FQ3 A;  1LDJ A;  1BC8 C;  4ASN A;  4CXF A;  2TDX A;  3DPL C;  1KU2 A;  4KN4 X;  4BH9 A;  2JPB A;  1Y0U A;  4Y13 A;  1PP8 F;  3V7R A;  2F5F A;  1XGM A;  4ZZL A;  3IHU A;  1QZZ A;  4P5O A;  2XAG A;  1D3Y A;  1R00 A;  3G73 A;  4A2U A;  4HX8 A;  1HW1 A;  3WOD F;  1NHA A;  2XAS A;  4EQQ A;  2ZXJ A;  3ZMT A;  1U3E M;  2A61 A;  3F8M A;  4ZYE A;  5H6R A;  5DDG A;  3HHG A;  2CO5 A;  3HUG A;  1FPQ A;  2EB7 A;  4HQE A;  4FT8 A;  3ISP A;  2PMU A;  2UZK A;  2HKO A;  2LF7 A;  1ZGA A;  4XLN F;  4HLY A;  1BJA A;  2EFO A;  3M7G A;  2XRN A;  4AIH A;  1R22 A;  2L4M A;  3BRO A;  4BHC A;  3U2R A;  1ZRC A;  4S05 A;  2GA1 A;  2RGV A;  3TO6 A;  4HV6 A;  1Q1H A;  5HDK A;  2CG4 A;  4A0Y A;  1SFX A;  1LJ9 A;  3K0L A;  2PJP A;  3D5L A;  1E2X A;  1O57 A;  1JE8 A;  4B09 A;  1YQA A;  2M5W A;  2O0Y A;  3F6V A;  5LLQ A;  5FB2 A;  2WWY A;  3RKW A;  4M6X A;  3ABU A;  4JK1 X;  3MCZ A;  3HSR A;  3QU3 A;  2XAF A;  2AXL A;  4HAM A;  4FX4 A;  2L01 A;  3KLN A;  1IAW A;  3BJ6 A;  3QOP A;  5A2Q Z;  2RDP A;  3R61 A;  3B73 A;  4AIK A;  2XVC A;  3H3Z A;  2NYX A;  2XAJ A;  1PDN C;  5LEJ A;  2V1D A;  2FBH A;  3TQN A;  1XD7 A;  4HDU A;  1ODD A;  4M73 A;  1S3J A;  4G94 A;  3BZ6 A;  1XGO A;  3SZP A;  2VOO A;  2CW0 F;  1IXC A;  1IRG A;  3B02 A;  1J5Y A;  1SMY F;  3JSP A;  2GA2 A;  1IN7 A;  2E7X A;  4MTE A;  3TDU C;  5J8C A;  4IRH A;  3P9C A;  1YG2 A;  5AIP A;  5J8F A;  1FSH A;  1R58 A;  4UV8 A;  1MZB A;  3P9K A;  2DK5 A;  4LB6 B;  1SD6 A;  2Z9O A;  3L9F A;  1T38 A;  2WC2 A;  3HYI A;  1BI2 A;  1ON1 A;  1U78 A;  1YW9 A;  5IT9 K;  2UXN A;  4R79 A;  5LRS A;  4HLX A;  1ZRF A;  2IA0 A;  4JBA A;  3IKV A;  1RUN A;  4RAZ A;  1KQ0 A;  1JXS A;  3KP5 A;  3LWF A;  3TO7 A;  1O3T A;  3HSF A;  2DLL A;  2XHK A;  3T0Y A;  3PFI A;  4G7Z F;  3HTS B;  5DD8 A;  2KIF A;  1A04 A;  1Z91 A;  1ZYR F;  3HRM A;  3MQ0 A;  2YPR A;  3T5X A;  1KYW A;  4L5I A;  3TOB A;  2ETH A;  2WV0 A;  5DUK A;  2XAQ A;  1KU3 A;  5HVQ C;  2HR3 A;  2PBI A;  3K1P A;  3WTS C;  3GZ6 A;  2P5V A;  3L09 A;  2G7U A;  4L9T A;  4P9U A;  4R8H A;  3RTR A;  1W7P A;  2QYO A;  1WI9 A;  4WX9 A;  1TQP A;  3CTA A;  3WTT C;  3GVA A;  3LQR A;  4FX0 A;  2NNN A;  3RJP A;  1XCB A;  2O3F A;  5L3E A;  2ESH A;  1KQ9 A;  2QBY A;  2CWE A;  5H6Q A;  5HS7 A;  1R23 A;  2OZU A;  2R7D A;  2QWW A;  2DK8 A;  2DFI A;  3GF2 A;  5LHH A;  1XN7 A;  4U0V A;  5IT3 A;  3GYH X;  1UB9 A;  3FX3 A;  2CFX A;  2BGC A;  1SAX A;  4B8X A;  6PAX A;  2RNJ A;  3GFJ A;  4HX7 A;  4RAY A;  4YII A;  1TQI A;  2IW5 A;  1LNW A;  3WG9 A;  5FD6 A;  4PZJ A;  4UNO A;  2VT3 A;  2EFW A;  4M72 A;  5K5R A;  2WTE A;  1R5H A;  1YW8 A;  1K79 A;  1B1B A;  5HLG A;  1P6R A;  3CLO A;  4LG0 B;  2DU9 A;  1ON2 A;  1WSU A;  3BY6 A;  3DP7 A;  4CYD A;  3TO9 A;  3T8R A;  2HQN A;  2PEX A;  1B9N A;  2QQA A;  2P6S A;  5FLX K;  5BS6 A;  2VC0 A;  1P4X A;  4RB0 A;  3U1D A;  3AAF A;  5D4S A;  5FD5 A;  4S04 A;  3KP7 A;  5DCF A;  4HBL A;  2DBB A;  4O5V A;  1S7O A;  2OQR A;  2Z5U A;  3V7S A;  2STT A;  2FOK A;  1FYK A;  5K5O A;  3F72 A;  5K1Y A;  2W24 A;  3S2W A;  4E70 A;  3D0S A;  5FFX A;  4HYE A;  1DPR A;  2X0L A;  5E8G A;  4KA4 A;  2ISZ A;  1T39 A;  1BN5 A;  3GFL A;  3LAP A;  3ZQ7 A;  3VOE A;  3RYP A;  4HX4 A;  4A5N A;  3WTX C;  2BV6 A;  2FE3 A;  4I98 B;  1SD5 A;  3TDZ C;  4IF4 A;  1BOA A;  5HDG A;  5JFR A;  2C6Y A;  1MDM A;  4JQF A;  3KCC A;  2QLZ A;  2Y0M A;  2ZNY A;  4ZYH A;  2PLY A;  1C0W A;  1Z9C A;  1W4M A;  2D45 A;  2W25 A;  2Y75 A;  3ZMV A;  1B4A A;  1W5S A;  4KUM A;  4P55 A;  1FWZ A;  2HZT A;  3Q5F A;  1U5T A;  2P4W A;  1WWX A;  2EV5 A;  2XV4 S;  3I5U A;  2GQQ A;  3HTU A;  4RS8 A;  2PI0 A;  3M1E A;  5AIQ A;  1BI0 A;  4IHT A;  3E5X A;  2FU4 A;  4UVB A;  2KJC A;  5DCM A;  5LHG A;  1UCR A;  1AWC A;  2NAZ A;  1J7K A;  1LDD A;  3QAH A;  2JT1 A;  3KEQ A;  1RUO A;  3KP4 A;  3FXQ A;  1HKT A;  3BJA A;  1T98 A;  2VE9 A;  2JZY A;  1LEA A;  2KJB A;  4QWQ A;  2DI3 A;  2A68 F;  1QPM A;  3OOP A;  2ZJ2 A;  4HW0 A;  1Z6R A;  4U7B A;  2VC1 A;  4WCG A;  1LEB A;  4IXA A;  1SFU A;  3NEU A;  1FT9 A;  2LDU A;  2MLG A;  1FYM A;  4KN7 X;  5HLH A;  5D6F A;  2OA4 A;  2HTS A;  1IRF A;  1Z7U A;  2DQL A;  3JAM K;  2MC3 A;  1S8N A;  1K78 B;  4NB5 A;  1HQC A;  2H94 A;  5BMZ A;  4OU0 A;  5F1R A;  2J5O A;  4N9I A;  2FA5 A;  5LHI A;  3GX4 X;  3ROU A;  4YFK F;  1IN6 A;  4U0W A;  2EFP A;  4HZF A;  5H20 A;  1G3Y A;  1OPC A;  1TW3 A;  5JR3 A;  3R0A A;  3F6O A;  1HKQ A;  1YYV A;  2O61 A;  1GHC A;  2FXA A;  5L3C A;  1J2X A;  2OZ6 A;  2IVM A;  3I4P A;  1F5T A;  1OKR A;  2ESN A;  1BI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...