2VOPA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
EKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vopA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vopA02
1Z05A 1S29A 1X4GA 2DU9A 2F5DA 2PMHA 1P27B 2LQ5A 1ODDA 3IL2A 2I38A 2STTA 2MKSA 2RVCA 3QPHA 1HL6A 1SMTA 2CFXA 2FPHX 3G6ES 2XKPA 2MC3A 4AIKA 1FNNA 4RB0A 2F3JA 4HZFA 3JW4A 3HUGA 3M7GA 1ZLKA 2DB1A 3GFJA 1XSXA 4BHCA 2KG1A 4BQAA 1FYLA 1OWXA 1O3TA 1J5YA 1JGSA 3ULQB 5E8GA 1BIAA 3P9KA 3HIFA 4UNOA 2NYXA 5CVUA 2ESHA 4XSXF 1VQ8S 4MQ9F 1Q1HA 5FFXA 3UCZP 2JWNA 4MGRA 1IXRC 1E17A 1U1LA 2ZXJA 2J76E 2MY8A 5ICCA 1MKMA 4HLYA 1IN4A 4KUMA 5DD4A 3DXBA 1F4KA 1WEZA 2GHPA 1B1BA 2KIUA 3DLLQ 2K7LA 5CLSA 1SFUA 3D5LA 3ULHA 3G4SS 1DZ5A 2MA3A 1FBUA 2FOKA 4PZJA 2DGSA 1S3JA 4RU2A 3OW2R 4XRFA 5KK1A 4ESJA 2CYYA 2ACJA 3CMES 1J59A 3NEUA 3TP2A 1S7OA 2QFJA 1BBYA 4IHSA 2EA2A 2IVMA 3GEZA 2LA6A 2Q2EA 2X4HA 2Y75A 3VEPA 2JRSA 3FMQA 4G8XA 4KDPA 4I0BA 1UHWA 4KYWA 2J5PA 1JHFA 3WE2A 2VBWA 2X1AA 5FD5A 2HDCA 1BC7C 1XDSA 5F64A 3MFKA 1WG5A 2P6SA 3KEQA 4RAYA 4A5NA 2NNNA 3EETA 4O3MA 5DDGA 1VTNC 2P7CB 1B6AA 1R58A 3T5XA 1HD0A 4IPAA 1AWCA 4MNUA 3MURP 2X0LA 4HX7A 1FNXH 3RKWA 1KQ8A 2YU3A 3PQKA 1YJWS 1D5VA 1A7GE 1H9GA 3Q9SA 2VBXA 3MEXA 2Z9OA 6PAXA 1B9NA 4NQWA 3CCMS 2MZJA 3VALA 3CO7C 4TV7A 3VAIA 5JHUA 3SFZA 4ETSA 2KU7A 2QWWA 4I2OA 5LRRA 3G3ZA 3VAJA 1GXPA 2E1NA 3K0LA 1UB9A 3VAHA 1AOYA 2KN4A 3GO5A 1CVJA 2RS2A 5DDOC 4IRIA 1DPUA 1K78A 2PEHA 2DGXA 2RV8A 2MJUA 3Q2SC 3L3CA 3US5A 1H2UX 3KETA 2LF7A 3JB9k 2M87A 1WG4A 2ETHA 1O57A 4PCQA 3IKTA 4HQEA 2ADCA 3HSFA 1S79A 3ZN0A 1Q82T 1FX7A 4IUFA 2LEBA 2FU4A 1VQOS 4BYYA 1YIJS 1BN5A 4CO8A 4G6QA 4YB1P 2VE9A 4LLGF 4XLNF 2MZRA 3JAMK 1W7PA 1BI0A 1K6OA 3RDIA 1KQ9A 1BOAA 2L08A 2QQBA 2HYGD 2CWEA 1IXCA 1BJAA 2P5LC 4Q47A 4OIRF 1UFWA 1I1SA 1VQ4S 3P9IA 3ABUA 4UVAA 1WI6A 2KH9A 2O8XA 4EJWA 3TDZC 3RKXA 5HS7A 1P6RA 2A6EF 1YYVA 2LDUA 5BOXA 2ZFWA 5L3BA 1GHCA 4CXFA 2XNQA 4YUDA 2B0LA 3V7RA 2ZJPQ 1D8JA 2XNRA 5D4RA 3MQ0A 1S8NA 3UCGA 3SZTA 5GADU 2M5WA 1VQKS 2HQNA 3TO8A 1Z91A 1BC8C 3BPXA 2FQ3A 3BO4A 2MQNA 2HKOA 3BEGB 1HSTA 2WTEA 2LEAA 2KG0A 2X1FA 3NNAA 1WELA 3NS5A 1JE8A 4UQTA 3D2WA 2CQBA 2D45A 1DUXC 1LDDA 4MTDA 1J0RA 5E1WA 4M74A 4L9NA 1ZGAA 3U1MA 1RUNA 1UHMA 3TKYA 4YG2F 2FNAA 3JTGA 1ZRFA 1YG2A 2EK6A 3EGZA 3VFZA 4IO9Q 2RNEA 1U1QA 2DNZA 5D6EA 1ZYRF 1DP7P 3R1HA 4LFUA 4K2EA 1TQPA 4GGGA 2DGOA 5FGMA 3TDUC 1LVAA 2P5VA 3I56S 1YHQS 2RQCA 2DO0A 3EYIA 1VBYA 4BHBA 2DW4A 5K5OA 3JSOA 4HDVA 3I64A 5BMZA 4KIGA 2M52A 4UV8A 2N3LA 2OTJS 2MQPA 1IRFA 3BY6A 4ENMA 2JX2A 2P7VB 2QA4S 2DNRA 1DDNA 1J7KA 3C18A 5F6FA 2ZNYA 5L3FA 4MHGA 4CHUA 2WWYA 2CGPA 2JTVA 2ELHA 2BGCA 4EJTA 1U1OA 2XHKA 3WTYC 3H3UA 3QPTA 1XMAA 1P4AA 2BV6A 2DH7A 4HAMA 1IUYA 1PGZA 2JPCA 5HL7Q 1KD1T 1QO0D 2Y0MA 2DISA 2FMLA 3CJNA 1I5ZA 2JRTA 2FNPA 2KJBA 1X5OA 5BJRA 1SD6A 3BP8A 2M9KA 4I01A 4RGRA 5LLQA 4WFBQ 4ED5A 5H6RA 4U88A 4EMSA 3LAJA 2RNJA 2CQ2A 2L9WA 1UAWA 2HGLA 3BJOA 2YKAA 2QQAA 3EYYA 3KCCA 3CCSS 4RS8A 3J80K 1X4CA 2ZCWA 4F02A 2RC4A 1X0FA 1SAXA 2CQ3A 3LA2A 5CVRA 2P5KA 4D0PA 1U78A 3ZP5A 2O0YA 5DCMA 1ZLJA 2V1DA 4F26A 5FLXK 4CDGA 1FJEB 2DGUA 1O3QA 4IVNA 2RRAA 4JBAA 1QM9A 2OBPA 4Y17A 2VBZA 2GWRA 4S04A 4O6JA 1Z7UA 1HA1A 4M6XA 1FJCA 3B02A 2VBYA 1P92A 2JSCA 2IW5A 5IT9K 2KM8C 3FM3A 2OTLS 2XASA 3MDFA 1L3KA 1FBQA 1HBXG 4UUVA 3CMAS 1B59A 2VONA 2IA0A 4OU0A 3ZZZA 2XS7A 2MQQA 2LMIA 3M9AA 3FXRA 1VQPS 3H3ZA 5IM0A 3COAC 4XBFA 2ISYA 3RW7A 4MEXF 1XN9A 1RZ4A 1N8RT 4EJVA 2V6CA 2FF4A 4W92B 1USSA 4YFKF 3ISPA 1F9FA 2E5HA 3U1LA 2DT5A 4OMYA 2CPXA 2A69F 1WHWA 3CCLS 1VC6A 2VE8A 1LEBA 2O6GE 5HLIA 2DITA 2L3DA 3GFIA 1IF1A 3K69A 3SDEB 1JJHA 5LJ3Y 2DHAA 1K79A 3RW6A 3D0SA 2PMUA 3BJ6A 1HXDA 1PP7U 2Y48A 3MZHA 2VT3A 3CCES 4C4WA 2XB2D 3IC7A 2ERRA 4PGHA 5HS9A 2A5YB 4IRGA 5LHIA 2LKZA 4UV9A 5TRDA 2GA2A 2FRHA 1STZA 1IQTA 2YR2A 5LEJA 2M2BA 1WQ2A 3THTA 2GXGA 3GF2A 3I55S 3I54A 1T6SA 2HS5A 1B7FA 4CQ1A 1U1KA 3CPWR 3E5UA 5IFMA 5CVIA 1ONVA 1SD5A 4P5OA 4AVPA 4IHTA 2L4AA 2D1VA 2CO5A 1DRZA 5ILUA 2BEOA 5FLXZ 3MD3A 1MGTA 3R0JA 2YPRA 1O3SA 3BO3A 3I58A 2DNMA 5ILSA 4KMUX 1T38A 2MMYA 1U6BA 1BI2A 1X3UA 3HRSA 2DHXA 4KFCA 2B0GA 1YITS 3KP6A 3J7ZT 2DHSA 1DPRA 2KIFA 1HKTA 5LJ5Y 1Z1DA 3GZ6A 4A5MA 4LLNA 2R7FA 4KMFA 1IAWA 4A12A 2DNKA 4HF2A 3EX7B 2MKJA 2DAOA 4WXDA 5JFRA 3VOEA 1IW7F 1W7PD 1G3YA 3F8MA 4HV6A 1H9TA 5E8IA 4P55A 2H27A 3CD6S 3LWFA 5FFZA 3DKWA 2HTJA 3TOBA 1D3YA 4BNCA 2PE8A 3S2WA 1BY9A 4ZH4F 1PUEE 3DF8A 2L01A 3P49B 5ICFA 3C7JA 1G6NA 1IN5A 4YIIA 3OV8A 5A2QZ 1X4HA 5L3GA 4L5IA 4OIPF 3WODF 2Q8KA 1LDJA 3CCUS 1D8ZA 1BM9A 3P7NA 2LCWA 4M73A 2YTCA 1ZG3A 2QLZA 3FXUA 3AAFA 2F9JA 3L9FA 3TYTA 2RN7A 1R5GA 1SD7A 3PQJA 4ZYDA 1OYWA 3VF0B 1KA8A 1U6FA 1TQMA 1ZN2A 2M7SA 5JVGQ 1YW7A 1KU2A 3R0AA 4L0YB 1KQ0A 2MH9A 1VQNS 2FMYA 2H09A 3HOSA 3DQVC 5HOOA 4N0BA 1T39A 2N7CA 3CCJS 2DFIA 2YWKA 2YX7A 5GMKa 2HYFA 3NNCA 3T8RA 2CJKA 3K1NA 1FXLA 3UCUP 1HD1A 1FPQA 5DDRC 3RIRA 3S6EA 2U2FA 1SD4A 5DD8A 3ERED 4AIJA 4M9SA 3F8BA 4Q5SF 2V79A 1ON1A 3I0TA 4N9IA 3THPA 2H6CA 1SMYF 3LQQA 1LEAA 3PFIA 1I6XA 4BS2A 2UZKA 3CF5Q 2M8DB 3WTTC 4ENKA 2AS5F 5AIPA 1U6GA 3JSPA 5LEKA 2J0QD 3KP7A 2W24A 1D9AA 2ZJ2A 4QU6A 1FSHA 3O3KA 2N82B 1VQMS 2G1DA 3IWFA 3GZ5A 2ADUA 3MZYA 2PBIA 2LNBA 1R22A 1WWHA 3DXJF 4QLCU 2D1HA 2IPQX 5BPIA 1VQLS 1K9MT 1Y0UA 3EGNA 2XGXA 3UWTA 1X4EA 2CSOA 3NQOA 3GUDA 3F8FA 4KT5C 1U1MA 4YIFA 2RRBA 4LIRA 4ESBA 2F2EA 2DNPA 1OYIA 2DIVA 2GZWA 4HX4A 3CC2S 1U5TB 4HA8A 1P2FA 5HDNA 4Q4ZF 3G8TA 1XMKA 2XAFA 2LA4A 4KNYA 1G4DA 3FM5A 1M1KT 3HHNB 3R60A 1QPMA 3O6BB 3SXLA 2FEZA 3HRMA 2MQLA 3P3DA 2OQGA 4LLLA 1QZZA 1WI9A 3GLXA 3I59A 4EM2A 4LJMA 1SJRA 1OMIA 2M8EA 2MBFA 5CA5A 2M45A 1B9MA 1KYWA 5LHGA 5ICEA 1LJ9A 1OPIA 4BAYA 3R4KA 5FJ4A 3KP4A 1XSVA 1XDUA 3CUOA 2MSTA 5ITHA 1YS7A 3E6BA 2N3OA 1WEYA 3I4PA 3LA3A 2LXIA 1J9IA 2MH2A 2VXZA 2K86A 4A0YA 2CQPA 2O3DA 3S01A 2OD5A 1ZRDA 2Q79A 2E44A 4LB5A 2DGVA 4WF9Q 2IP2A 2V94A 3MD1A 1UP1A 3WTWC 1D8KA 5EEHA 5K5QA 1QQIA 5D5XB 3R61A 5FO5A 4HV5A 5D78A 1SJQA 3H2UB 1MZBA 4U0VA 2XUBA 5DM7Q 5LGUA 5BPDA 2LXUA 2LSOA 4B8XA 2ESNA 3P6YC 3J81K 4TU9A 1JHHA 4AD9A 4WCEQ 4KN4X 2MGZB 3FHZA 4F7ZA 4ERDA 3CUQB 5D4SA 2E7WA 1V4RA 5LGNA 4EGZA 5K5RA 2DNQA 3K1MA 2OQRA 2PG4A 2CPIA 4GYGA 2KHCA 3HTUA 1YO5C 1L0OC 3L7WA 2DO4A 5TJJA 5LSOA 2MXYA 1IZ1A 3FMSA 1FYKA 4OMZA 2DQRA 2QVOA 2NNYA 2GQQA 1HW1A 4C7QA 2EK1A 2MHNA 5D6FA 2L54A 2OAZA 4Y0FA 3G9CA 1X4FA 2CW0F 4M72A 2HYIB 2GA1A 2EWNA 2M1BA 1XN7A 2HEOA 4EM1A 3HTSB 2HTSA 4LJZF 2DK2A 2FHOB 3BPVA 3F6OA 3KLNA 4IF4A 3WGGA 5MLCV 3MXHP 1U8RA 3QAHA 1NU4A 2FXAA 4UVBA 5HLHA 5GAEU 1G3WA 1JXSA 3DEUA 2OA4A 3B4MA 1Q81T 1XGSA 2H94A 4A0XA 3TO6A 2J8AA 3V4MA 2ISZA 4XSZF 4CIOA 2A61A 1UW4A 1ZGJA 1IN7A 3PIPQ 2P4WA 2QEXS 3G73A 3F21A 4A6DA 2CPHA 2J0SD 2G0CA 4U7BA 1VC0A 1OYYA 1VQ7S 4EJOA 2VC1A 5CYJA 4M9XA 1Z9CA 2VC0A 2KYXA 4UVCA 3I5UA 3VAGA 1KGSA 1SJ3P 2WV0A 5DYMA 3HHGA 2G7HA 1T0FA 3JAMZ 3F23A 2PLYA 3LFKA 1M5VC 1YFHA 1U5TA 1RNLA 4S05A 1LB2A 1A9NB 3ZMUA 3EQLF 2HGNA 2HGCA 3G96A 3ZPLA 1MJAA 1YJNS 5DV5A 4G7HF 2GIVA 1QVFR 3J81Z 2IA2A 4IXAA 4LG0B 5D8KB 5D5VB 5D77A 1YWXA 4HOBA 2HQRA 2MJNA 3IRWP 1QBJA 5AONA 4EVIA 2KI2A 4WK8F 2FBHA 2XAJA 4MTEA 1HQCA 1FT9A 2PN6A 1PP8F 3QU6A 3FEXB 2CQGA 2ADBA 2DNOA 3HI9A 3BDDA 5IQQA 1K73T 3EUHA 4WXCA 2P8TA 1X4BA 3R27A 3TGNA 1SXLA 1XB4A 3ECOA 3V7CA 3MCZA 4LK1F 3E3VA 2EFWA 3N4MA 3F8NA 1JJ4A 2CQIA 1MDMB 1YW9A 3BWGA 3DPTA 5HLGA 1XCBA 1VBXA 3HYIA 4PKDB 3VB2A 3BS9A 3KP2A 1R7JA 2KFYA 3GYHX 2MZ1A 1S6LA 4L18B 4HF1A 1QGPA 2MB0B 3F22A 2L41A 3KP3A 3BROA 2XS5A 1W2BR 1HW5A 2K3KA 1WWXA 5GAHU 5DUKA 2W57A 3K0JA 1XCVA 4RB1A 4GCVA 3QU3A 2NAZA 3Q9VA 4M71A 2WBRA 3DPLC 3RJPA 1KU9A 4KA4A 2KXHA 4RB2C 1MJ9A 1KOHA 1ZG1A 4I02A 2MQOA 3TQNA 1ZZNA 4P96A 1VQ5S 4ESFA 3CUQA 4J5OA 1EH6A 2OIHA 3EDPA 5ILVA 4MQVA 2DNYA 2KRFA 2AYMA 3E6MA 1I1GA 4ZYGA 3WTXC 2E5JA 4WFAQ 1U1RA 1NJIT 2BZ2A 4WKRA 4Y13A 2DK8A 2ZJQQ 5D5UB 1WHYA 4QU7A 2KIMA 1HKQA 4GO1A 4ZKAA 3WTVC 2AYBA 2A07F 5ICGA 2XROA 3ZMDA 4G7ZF 3DFGA 1R23A 2MSSA 4Q48A 4L9JA 1L3LA 4EGYA 2MYFA 3J7AO 1ZG5A 1O7LA 1YLFA 4WXHA 3ZMTA 1IRGA 1OKRA 3N97A 2DO7A 2VT2A 5LGTA 2DQLA 1I27A 3FMRA 2YH0A 5L3CA 4WFNQ 1W5TA 4H0EA 4EQQA 2HGMA 3QRFF 1SFEA 3MUMP 2HZCA 1SFXA 2RVJA 1JMTA 1QVGR 4HYEA 2IRFG 5LHHA 1RI7A 3FF5A 4OIOF 3BZ6A 4KN7X 2CPDA 1ZHFA 1BI1A 3J80Z 3BO2A 3U2RA 4RAZA 3UD4P 5CVJA 3M8FA 4LK0F 1FC3A 3VODA 1T98A 2CPJA 3R1LA 1GXQA 4RGUA 1R00A 2ZBKA 3WTSC 2FBIA 1Q86T 2V1XA 3IRRA 2KRBA 1RKJA 3ECHA 2K27A 2FC9A 4PRFA 2YX4A 4LD5A 3RYPA 3BJAA 2QYOA 3CC7S 2DPDA 2O61A 5J6XA 1HSJA 2DGTA 2A3SA 1OR7A 2QBYB 3VAKA 2DTRA 2IA1A 5IT9Z 1PO6A 2M4MA 2G9WA 2F9DA 2CQKA 4KIBA 1K7AA 3WGHA 4W90B 5D8LB 3RI4A 4YOEA 1ZAOA 5LXYA 1NO8A 3ABTA 1WEXA 4L9TA 5D5WB 3LAPA 2VOPA 4ZZDA 1ZH5A 1IN8A 2RUGA 2OSQA 1XGMA 2KKOA 2SXLA 2DIUA 1XD7A 5DETA 5AIQA 2EJRA 2PFBA 2CG4A 5GAGU 2JVRA 3IWNC 4U7DA 1N88A 4A8XA 2G4BA 1F1ZA 4M9ZA 5DCFA 3CCVS 1TNSA 2HKXA 1U2WA 3WE3A 3CDHA 1R1TA 1P4WA 1T2KA 4TLQA 4IOCQ 3GX4X 3BOQA 3HSRA 3SZPA 4O5VA 4HF0A 1XGNA 5H6QA 4LGWA 4M6YA 4FXWA 3NRVA 1WHXA 2QM3A 2CQ4A 3Q2TC 3CUNA 1M5PC 3UD3P 3VAFA 1S72S 4ZYHA 2MKHA 3F6VA 1MJBA 3IWZA 4B09A 1JJ2R 5L3DA 1UCRA 3NNHA 3FWEA 3KEOA 1YIOA 3F72A 4V19X 1WF2A 1FP1D 4L0ZB 4PR6A 3GWZA 4I7HA 3C1DA 2MZSA 2JZYA 5LXRA 1O7FA 2M0GB 2RGVA 1KC8T 5DDPC 2DI3A 4Y15A 4EM0B 2FSWA 3NS6A 2D9PA 2NZ4A 4RB3C 1R8PA 5L3EA 5BQTA 2CQCA 2MKIA 2DK5A 3HRTA 2BYVE 3O2PE 2CQ0A 3H92A 2MPUA 2KRRA 2KM8B 1R1UA 2HOEA 4AIHA 4UHTA 1W4MA 3KZZA 3HHHA 2DPUA 4NB5A 3W6KB 3ZMZA 1F5TA 1Q7YT 1GVJA 3E6DA 1FT8A 3SDEA 2MKCA 1J75A 5CXTA 1FJ7A 2HR3A 1EH8A 2XRNA 1YJ9S 2R3SA 3B73A 4HBLA 4KICA 2TDXA 1FOKA 2LKPA 2P6TA 2W85A 3DP7A 4IJAA 4A6EA 4U0WA 5KVRA 4CH1A 2FA5A 4UXNA 4HLXA 3ZN1A 3RPQA 1HW2A 5J8FA 1K8AT 4OZ0A 3J7YU 2YH1A 3I53A 2MZQA 1KYZA 4I0AA 3IKVA 3PIOQ 5E20A 2U1AA 2FBKA 1TBXA 1G2EA 4ZYEA 4R79A 2COMA 5J8CA 2BBYA 3CCQS 1YQAA 3ROUA 2K4JA 2ZO4A 2JT1A 3G8SA 1OIAA 4GYIA 3HRUA 4HX8A 3LQVA 2X1GA 2DH8A 3M1EA 1E2XA 1ZRCA 2JVOA 2DNHA 1U3EM 3SMZA 3REOA 3MAJA 2A6HF 2J5OA 1O3RA 2XS2A 3B4DA 1ZARA 2KXNB 2A68F 2QBYA 1H2TZ 1H2VZ 4ENJA 4EV0A 4CZZA 2QQ9A 2FY1A 3HSEA 3QP5A 1VBZA 5DCMB 5E1XA 2QUFA 2ZMEB 2EV6A 4ZZLA 1LDKB 2DHGA 4QWQA 2XV4S 5CVVA 5JVTA 2CQHA 2F5EA 4ON0A 4OIQF 4WX9A 1FY7A 3VAMA 3RTRA 3E5XA 1TW2A 1P1TA 1X4DA 3E5QA 1FWZA 1WSUA 1TNTA 2PQ8A 3JTHA 5HO4A 3FXQA 4I98B 4M5DB 4G94A 4OZ1A 1WI8A 1X5SA 3U1DA 5HDGA 2EFNA 4RGSA 1RIOH 3ML6A 1FHTA 4HDUA 3S7RA 1ZREA 2CQDA 3CTRA 4E70A 2V1UA 4I09A 3GVAA 5DM6Q 4OOIA 2PI0A 1B4AA 5IM0B 2OZ6A 2RS8A 2UXXA 4DQ2A 1MD0A 2I2YA 1WRJA 2DGWA 3GW2A 2H6BA 3KP5A 1WKMA 1WHVA 4KIFA 2XSFA 3FZVA 1SJ4P 4QQBA 2ZKZA 3H2VE 5HS8A 1YS6A 4ASNA 2OJ3A 3G71S 2XAHA 4LB6B 1PDNC 2UXNA 2MKKA 2KVIA 3E6CC 4WIIA 4Z2XA 2HWVA 2G7UA 2D3OR 3MI7X 1IXSB 4CH0S 3WTZA 4G7OF 4JQFA 2Z33A 1XSDA 1X5PA 5JVHQ 2NLWA 1M90T 4FHTA 3P9CA 5JR3A 2A3JA 4AWXB 2DNLA 4L9VA 1TTYA 1FP2A 2O03A 1FO1A 2STWA 5FB2A 2CPZA 4U67Q 3LQRA 5FD6A 2EFOA 3V8LA 1WF0A 1G3TA 4A0ZA 3SXYA 3IRQA 3K2ZA 3KZYA 3MWMA 1U1NA 5ERIA 2CQ1A 2FE3A 1R8HA 3V8KA 1W5SA 1SJFA 5CYVA 1AUDA 1R5HA 2V9VA 3SQNA 1OO0B 3L09A 4XLPF 2ZJRQ 1EH7A 4FX4A 4RGXA 3MUTP 2QZ8A 2M30A 2E1CA 3ELKA 1NHAA 2NS0A 1A04A 4G9YA 3V4GA 1ULYA 5H1SV 2KJCA 2MQMA 1Z6TA 2DBBA 2RQPA 3CLOA 1KU7A 3WTUC 1N54B 4P9FA 3KE2A 4BHPA 4CYDA 2D9OA 3KLOA 3P5TL 3WGIA 3F8CA 3IHUA 2LF8A 5E1ZB 4WWCA 1CF7B 5DDQC 3FEYB 1DBDA 2D2WA 1USTA 3TOAA 3WU1B 2F5CA 2Z99A 2XAGA 1TW3A 2RQ4A 4MEYF 2CPYA 1O0PA 2GO9A 1EV7A 3MUVP 4CGZA 5DEQA 2LECA 4JK1X 3W6JB 3MOJB 1R1VA 3CXCR 2CPEA 5H20A 4F25A 3M8EA 2C6YA 1KOOA 1YW8A 2IT0A 1RUOA 3CTAA 2K02A 2DLLA 1FSEA 4CICA 4FT8A 4L5JA 2M8HA 2EK5A 1BI3A 2EV0A 3NMRA 5E17F 1ZZFA 2ZMEA 5K1YA 1HKSA 4G6DA 1TLHB 3Q5FA 1URNA 2BE5F 3WG9A 2L02A 3RKYA 2UWMA 2DNGA 2OU2A 1FBSA 4YFNF 1P4XA 4Y00A 4TU7A 1VQ9S 4HW0A 2EB7A 2CPFA 2FC8A 5LRSA 3K1PA 2X1BA 1M5KC 3C3WA 2MGZA 3ZMSA 2YSRA 3DV8A 3KFWX 1H6KX 2JPBA 4NHJA 5EN1A 4DNCA 4EJUA 3QP6A 1CGPA 1YI2S 2MY7A 3N9UC 4QPTA 4OINF 2R7DA 1RK8A 1QZYA 3FX3A 2XIGA 3LPYA 5IT3A 1IN6A 1R36A 1U1PA 3ZQ7A 1H0MA 2M70A 2VN2A 3CO6C 2OZUA 1LNWA 1G3SA 4P6QA 5BS6A 1F9NA 3QOPA 1U5TC 2GAUA 5A2QK 2PEXA 1C0WA 2HFHA 2RKHA 4IOAQ 2K8GA 1REPC 3GXOA 5ED4A 3RYRA 1YTYA 2MD5A 1KQSR 3RPUA 2MZTA 4EGLA 2GXBA 5EEGA 5GVQA 3SHFA 4BH9A 5E18F 2EVZA 1VC5A 3E97A 1FZPB 1OPCA 2Z5UA 1ON2A 1KU3A 4R1HA 2BOPA 1X4AA 2RDPA 3OOPA 4LMZA 3TO9A 2EFQA 2NRAC 3LSTA 4U0YA 2E5GA 5LBQA 1TQIA 2MLGA 4WCGA 1U2FA 2WC2A 3U9GA 1V3FA 2AD9A 3V7SA 2XVCA 5HVQC 4TU8A 4YFXF 2UP1A 1LQ1A 1Z6RA 2L4MA 3GFMA 1WTBA 2KXFA 2W84A 2AXLA 3CC4S 3GFLA 5JI6A 3L2CA 5DUIA 4Z2YA 2DGQA 2DH9A 4P9UA 2PJPA 2ZNZA 3ZMVA 1FYMA 1DHMA 3R6SA 2Q0OA 2EFPA 3I59B 4HQMA 3UE2A 4C0OC 4WF2A 1WF1A 4LMYA 2E7XA 2DNNA 5HDKA 1J2XA 2K4BA 4IRHA 3V8JA 3ZZYA 1QNTA 1K78B 3F3XA 1UFMA 4FXVA 1VQ6S 1S7AA 3L00A 3WU0A 5LSLA 4PGGA 2VODA 2O3FA 2IJLA 2OSRA 3K9TA 4LG0A 2RT3A 4N9HA 3CULA 1M5OC 3LA7A 2AYGA 4PDKA 3CUQC 2XKOA 3HOTA 1BIBA 1CF7A 2RU3A 5CJ9A 2KT5A 2HZTA 2QENA 2W25A 4R8HA 3CCRS 1X5TA 3TO7A 2HVZA 1W7PB 2LYVA 4UY8T 1WG1A 2MLKA 4ENNA 2F5FA 4A2UA 4BXUA 2M88A 3T1BA 1N52B 3T8TA 2AYEA 4FX0A 3T0YA 2EV5A 2E5IA 1MDMA 2Z3YA 2XAQA 3S8SA 2EA4A 3I71A 4GXOA 2VOOA 1XGOA 5F1RA 1FLIA
chains in the Genus database with same CATH superfamily
3K7AJ 1UMQA 1P27B 4RPFA 3IL2A 3WDOA 3M32B 1K4TA 1HL6A 1JKHB 3JR9A 2ECBA 1RP5A 4NOHA 3G6YA 1UKUA 4WTOB 4HZFA 4X4PA 4DL2A 1AYEA 2IVYA 4KHRA 2CNLB 3GFJA 1CULA 4OX9F 4BHCA 4EMDA 2L48A 2PGCA 3OLAA 1O3TA 2HHHJ 4KT0C 1N6QA 3E51A 2HNZA 1HNIB 2X6WA 2WSEC 2V8VA 3WBZA 4GKJF 2XBPA 3UCZP 3R2CJ 4NLQA 2D74B 5EGYA 2XEXA 3DRRB 1C1CA 2ZXJA 4KH0B 5GAEJ 1VQPI 3WC0A 4KUMA 1WEZA 2VF3A 4CCOA 3IV5A 1G2HA 1SC6A 3DLLQ 4NEZA 2YNHB 5CLSA 4FYVB 1IUJA 3D5LA 2A2DA 4XR6A 4M3BA 2FOKA 2WAQA 4Q43A 1S3JA 1AROP 1NJYA 3OW2R 1EJ7L 4HRIA 2K9NA 2UVWA 4ESJA 1ZK8A 2DR8A 3VQSA 3NEUA 2K9LA 2V69A 1VZ0A 5ETMA 4ZDOA 1S7OA 2Y8WA 4V2FA 1K44A 3BDEA 1BBYA 4IHSA 2EA2A 2NR0A 2QL9B 2E71A 2Q2EA 3BR5A 3H40A 1TKXB 2V2QA 3FMQA 4G8XA 4KDPA 2V5HG 1T8EA 4I0BA 3G8QA 1YSJA 2PEBA 4B3AA 3WE2A 3MWBA 3DU5A 2VBWA 2W4DA 2X1AA 5FD5A 4ECZA 2GBYA 4ENOA 4ZPBA 5M5WJ 3RKQA 3KEYA 4U7UD 4D3HA 2IA6A 2H54B 4KGVB 3T5XA 1HD0A 2LFVA 2RF2A 2HHHF 3MURP 5FDLA 3FCVA 1LW2B 1RCOB 2R7ZJ 3MEXA 3AB2B 3M6VA 2J6UA 3VAIA 4I7FB 5EG0B 3BJYA 4OZ2A 4UY85 2QWWA 5LRRA 3G3ZA 2Z2YB 4F4AA 2KTQA 3RQ4A 3HSGA 3GO5A 4Y3CA 1D0EA 2RS2A 1QY7A 1U49A 5DDOC 1DPUA 2OO4A 2DGXA 5THWA 3Q2SC 3ENQA 2ROGA 2D7SA 4F50A 5DQHA 3KETA 3BPDA 3PYDA 2QV6A 3JSRA 3IKTA 2ADCA 2HVSA 1VRTA 3GTLJ 2XRLA 4DV3J 3HKWA 4HNUA 1JLAA 1X9MA 1UJ6A 4RW6B 5F8NA 2DT6A 1GNKA 4BYYA 4RWWA 1B0VA 4YB1P 4UZCA 4USWA 2VD3A 2KIQA 1RLDA 1CQNA 5E33A 4I2QB 4X64F 3BGRA 2QSFX 5HROA 1IDYA 3C2PA 2QQBA 1TL1A 2VG5B 4B1RA 2R4FA 1D09B 2FHMA 3HXLA 1YGYA 2WB1D 3JRBA 3M32A 1ICEB 5L3BA 2CZ4A 3BCAA 1DTTB 3HT0A 1RR8C 3MQ0A 2C2MB 1S8NA 1WPKA 3M8YA 1PJRA 2YPYA 3ICLA 3TO8A 4F2RA 1CJKA 3JTPA 3BO4A 3LUYA 1NB2A 5H9FK 2XZTB 5E79C 2HKOA 2OEMA 1IC8A 1WELA 1VQ8I 1JE8A 2R2SA 5F08A 4M95A 4C2MJ 1DUXC 1LDDA 1J0RA 4M74A 4OI6A 3U1MA 2LH9A 2ZEJA 1U26A 2H4YB 4CCJA 3DRRA 1JI8A 4KV8A 1JTYA 2RNEA 3TWZA 5D6EA 1ZYRF 3GTGJ 4X84A 1S0VA 4K2EA 2YNHA 4DV3F 2BX6A 4ECRA 1T11A 2GFFA 4GGGA 1KNZA 3PNYA 3TDUC 5I3UB 2ZH3A 3HHDA 4IR1A 5BMZA 2E1OA 4DL5A 5SUHA 1QTNB 3K8WA 4Y33A 2AGPA 1IRFA 3QT7A 3F9KA 1UFLA 2DPJA 2XMVA 1LWCA 1DDNA 1VQLI 3C18A 2OPQB 1W25A 4E7KA 1VS3A 1MBJA 5RUBA 2NS8A 3LO3A 1MSWD 4I64A 2CGPA 2YKMA 1GX5A 1Z3XA 4E7JA 4USKA 4EJTA 3CCTA 1U1OA 2DDBA 4F3MA 4GRIA 1TU0B 2DH7A 1AB8A 1IUYA 1PGZA 1Z77A 5HL7Q 1TUGB 2FLPA 1U0HA 4DR3J 2F5GA 4YN3B 3MFIA 4USMA 4XRMA 4OV6A 1LW2A 1K0TA 2JRTA 3DCFA 5C44J 4V2GA 2FVQA 4B9LA 3D66A 1LQ9A 4A3LJ 3QAEA 5EG0A 3BJOA 3A8EA 3K10A 5KFVA 4LRAA 3CW2C 2DJNA 1E6YB 2W2NP 1IKWA 2HVIA 2EPIA 1EP4B 2P5KA 1FESA 3K70D 5EHHA 3PFYA 2KFNA 4F26A 5M3MJ 3MR6A 2DGUA 4PQUA 1RBOB 2JEGA 1VQOI 3MEDB 4JBAA 4Y17A 3M30A 4OZLA 2FHJD 2KQRA 5E41A 2VBZA 4QWAA 1EQMA 4S04A 3B6BA 4OLPA 4BQQA 3NOGA 2DJWA 5G4DA 2J5AA 3CD7A 2XPVA 4GVBB 3OFGA 5B08A 2KM8C 3FM3A 2LQBA 2OTLS 2XASA 1RHMB 5KFRA 3H1CA 4LF5J 2JN6A 1FBQA 1L3KA 3RRHA 1KTVA 2VG5A 3R5GA 2PA8D 2AJQA 4NYOA 4TY8B 1B59A 3DFEA 2IA0A 4NC6A 1U6ZA 4ALZA 2BXYA 3HZGA 4OU0A 1ZM3A 5EDNA 5CQGA 2LMIA 3SCIE 1Y00A 5IM0A 3PKYA 3RAXA 4MEXF 3K5MA 1N8RT 1FXRA 4F4WA 2W2MP 2V6CA 5HQ8A 4W92B 4YFKF 2Y0SA 1ENHA 2VFVA 4OMYA 4DV4J 3L7PA 3CCLS 1ZM2A 4MFDA 3TAPA 3GFIA 2C3MA 3SDEB 4KTQA 3OYEA 1MWQA 3KG4A 1C1BB 2J7WA 2VL1A 1K79A 3AOBA 3ISZA 4C97A 3QQAA 4AM3A 3MMAB 3CCES 3HKZN 3QMQA 2FJXA 3K5OA 2EPFA 2IEKA 4UV9A 4IOAF 5J47A 3UI3A 1IQTA 4B3MJ 5A0YA 3THTA 2UV8G 3U7JA 2GXGA 1E3PA 3GF2A 1CS4B 4B3TJ 2DCLA 5C24B 3CPWR 2IFXA 1IBMF 1WJDA 3DRSB 3HOUJ 3PSFA 2M4GA 5CVIA 4URSA 3CJTB 4IHTA 2QEXI 5A8RA 4B3SF 1DQAA 2CO5A 2F8MA 4NPOA 2QLJB 1IDZA 3MD3A 3A0BC 3DLEA 3R0JA 1O3SA 1RISA 1I5OB 1UJ5A 3TJAA 1JUMA 1U6BA 1BI2A 3EVOA 1WOPA 4K0KJ 3BKTA 3M2VA 1YITS 4N8OA 2BXJA 2BY2A 3A3NB 3QWUA 1OPZA 5HN0A 2K9QA 3Q8YA 1DPRA 1HKTA 4LLNA 2Y69H 3TQEA 2NPFA 2VDIA 3M2UB 3LL7A 4LBIA 2K85A 4HF2A 5DRKA 4I2PB 4IR9A 2E1AA 1S1UB 3VYTB 1S0NA 5KOWA 1H89C 4NA3A 4R0EA 4IH5A 3DKWA 1L3VA 4AU7A 1FOWA 3S2WA 4ZH4F 4RWXA 2XM3A 3QFHA 2ZSHB 2HQIA 2NCKL 4BWJA 3C7JA 5LMNF 2HBZB 4HVZA 1DJ0A 5DLGA 2E2HJ 1X4HA 4OIPF 2C42A 5ETTA 1LDJA 1MSFC 2YTCA 3OJUA 1Y8RB 3F0CA 4BDPA 1OCOH 4RUCA 4AXIA 3TX0A 2H9ZA 3Q8QB 2P0WA 3MEDA 1OISA 2OPSA 3ERMA 3TZZA 1FE4A 1S9GA 3PYEA 1T9XA 2GGPB 2G2OA 2FQQB 2PA3A 1OYWA 2Z57B 4OMFG 2KZMA 1U6FA 4MO7A 4FP9A 4OZNA 1MMNA 2RUSA 3GIMA 2M7SA 3HJEA 2Y9ZA 3DHWC 5AXMA 2OV7A 2XI3A 1MROB 4A48A 5KG2A 2QO3A 1R4MB 3G86A 3HM5A 5GMKa 3OL6A 2QF7A 3CJ0A 1FXLA 4X0GA 3S6EA 2D1CA 3FKIJ 3F8BA 4Q5SF 1QJHA 2V79A 2OD4A 1ON1A 1HWIA 1NSQA 2H6CA 2EFGA 3IUOA 3LQQA 3PFIA 5F8MA 2JFDA 3B78A 2KT3A 1U6GA 4CNZA 5LEKA 3DOKA 4PPZA 4UF4A 1FI4A 1T33A 1QSSA 1WJAA 2G1DA 2HNDA 2WW8A 5KFPA 1NBEB 2IPQX 3ET6B 1REVB 4Y2IA 1K9MT 2XGXA 4BJ5C 2M7AA 5F04A 1Y7PA 5EWFA 1U1MA 1CQTA 5I42A 4ESBA 2DIVA 1BQMB 2EI5A 1UCNA 1CS4A 2IRUA 3MR2A 1P2FA 4URGA 4Q4ZF 3G8TA 1XMKA 1HBUB 1RACB 1G4DA 4ZPCA 2ZHBA 4XLFA 3DRSA 4DR6J 3DOMB 4DJAA 1QPMA 1TT0A 2Z56B 2DDAA 4LG3A 2DMUA 3QGPA 5HMZA 2HNYA 4NXMJ 1C0TB 3B6CA 3OD2A 4EO8A 3KKFA 4EM2A 4LJMA 1NEEA 2ZKUA 1WJCA 4ES3A 1FRXA 3GSIA 1AW0A 3F56A 2M8EA 2MBFA 4G6TB 2M45A 1B9MA 1KYWA 5LHGA 2E1RA 1LJ9A 3R4KA 4CLYA 2JEIA 2W7AA 5FJ4A 5E3LA 3D5SC 1KLMB 2DYSH 4X65F 4XNFA 3WC2A 3CUOA 2EWHA 1SKSA 3PYFA 4Q7AA 2N3OA 4PYAA 3V81B 3DTKA 1Y10A 3TZXA 1J9IA 3WQPA 4JI8F 2LEPA 1ZRDA 2NYIA 2E44A 2GA7A 3I4NJ 4LB5A 2DGVA 4WF9Q 1G3OA 1S57A 2BHYA 1A31A 2R7RA 1A6IA 3FSYA 4I2PA 1XG1A 1NH8A 4HV5A 1HMVB 2FJEB 4H54A 2R5ZB 1SJQA 2K5CA 1FX2A 3L2UA 5LSRA 3MOZA 2XY7A 4RW9A 1B70B 2EBEA 3TP3A 4GC7A 3SSRA 2E7WA 1DU6A 5LGNA 2DA1A 2HIYA 1CEZA 3IBCB 3OOUA 4ZTFA 1ZS6A 3MHYA 2PG4A 4OHWA 5HQLA 4GYGA 3ETMA 3KJFB 1L0OC 2DO4A 5L1KA 2CJ9A 2QVOA 3Q86A 5CABA 2EKYA 4YR0A 2GQQA 4C7QA 4HKQA 3DRPB 2EK1A 2QMWA 3CCJI 3KLIA 2OLWA 2OAZA 2I1RA 1ZR2A 2GXAA 1IQZA 4XIDA 4H4OA 3DM2A 3K57A 5G0RA 2JH3A 1SVOA 2GA1A 5HP1B 5AJ3J 3HTSB 1ZAVA 4DN9A 2POKA 1RTJB 4I99C 3BPVA 4IF4A 4OJHA 1OCTC 4F91B 2A10A 3I4MJ 4GO5X 2MTLA 4ID5B 3GTPJ 4OHZA 3W60A 4EWTA 4DYQA 2IXSA 5K8MA 2OA4A 4BGDA 2HQ3A 3FMBA 4PUOB 3V4MA 1VQMI 4IO9F 3OBIA 2CV0A 4D7MA 3HVTA 1UW4A 4QPXA 3GIKA 2FLLA 2ZD1B 1UG0A 2LLZA 1NK7A 2J0SD 4U7BA 1F6TA 4JI3J 1S1XB 3DNCA 1VQ7S 4U96A 3LH2S 3OPKA 5FLMJ 1Z9CA 3QGGA 2VC0A 2DJIA 2E19A 3I5UA 2X6OA 2V4JB 2VJIA 4Z37A 2G7HA 5J1PA 2FB0A 3LFKA 2ZJRF 3RZOJ 4RNHA 4O3PA 3EYZA 2UUAF 3ZMUA 3EQLF 1XERA 2HGNA 1SC3B 4XN0A 1MJAA 2RNGA 3NGKA 5DV5A 4G7HF 5BYRA 3J81Z 3FBEA 5D8KB 5D5VB 1YWXA 2ME0A 3FBIB 2AJ4A 3H42A 5AONA 4I68A 2HOAA 4A8YA 1LWEB 3KLFA 3FEXB 3M7VA 3HI9A 5IQQA 4WXCA 4F55A 3AOCA 3TGNA 3CDIA 1OJLA 3DTIA 4OI4A 4ATNA 3JSMB 2V2VA 2EFWA 3KXDA 3N4MA 3PNIA 3FMWA 1RT4B 1KTQA 1WDDA 1MDMB 4A3DJ 1WVRA 1QU3A 3HYIA 1W2IA 4PKDB 2Q3PA 3VB2A 3SQGB 4RO0A 2HK2A 3BC8A 1S6LA 3AAWB 4L18B 2HS4A 3FDYA 3CZ6A 5KT6A 5GP9A 3F22A 3H8YA 2L41A 5M5YJ 3BROA 2QYGA 3TX8A 1HW5A 2K3KA 1B8IB 4GCVA 5J3LA 3Q9VA 2IGMA 4DX6A 3RJPA 4C0HA 4FBTA 4RB2C 1BMQB 3KLEB 1MJ9A 3FKBA 1KOHA 1ZG1A 5FKMA 4OIXA 4RNOA 3KHRA 2YU9J 2VJ4A 5ILVA 4MQVA 2DNYA 2FX0A 4BC9A 4WFAQ 3W9JA 1JT6A 4GO1A 2VJJA 4JV2A 2AYBA 2PIIA 3RBZA 2R7TA 1X3ZB 2LP4A 2UUTA 2XMWA 4J9QA 3KDNA 2MSSA 4Q48A 3MMBB 3V5RA 4EGYA 1ZG5A 1O7LA 4NWBA 2H3EB 2VT2A 1S9FA 3SI8A 4F8RA 2YH0A 3S15J 4WFNQ 4C8YA 3QJLA 3FKJA 2GIQA 3M6WA 4ECXA 1E3OC 2IRFG 3PJXA 2H1YA 2E35A 1GAOA 2APOA 1ZHFA 1IR1A 3J80Z 1RABB 4RAZA 3C6UB 2LY9A 5FD1A 3UD4P 4A8FA 2W8KA 4PUOA 5HJYA 1S7HA 2XF5A 2ZH1A 2EIKH 3QNWB 1GXQA 4TNOA 3GV8B 3NWGA 2OH2A 4HH1A 1YE9A 1GUUA 3NCQA 4AYBD 3D0IE 3I5AA 5D4LA 3HVWA 4A46A 2R2UA 2GHWA 2J6SA 3TAQA 5KHDA 1X9SA 2I10A 3BJAA 3CC7S 3D1HA 1YZ7A 4OYZA 1HSJA 2V4JA 2HLTA 2LDYA 1SAUA 5IT9Z 4QJVA 4BQNA 3D0GE 2W82A 2YKQA 4KIBA 3WGHA 1JLQA 2AWZA 2V2ZA 3LAPA 2ZE2A 4WJBA 5HNHA 1IN8A 2RUGA 1U02A 4RUHA 1RXOB 2DIUA 2R4GA 5IC6B 1FDBA 4F4XA 3MZ8A 4FKXA 3ZTPA 2X3DA 1RWUA 3I9V2 5CKTA 5DETA 1LWEA 3H5SA 2EJRA 2PFBA 4NZ0A 3IWNC 1RHJB 1N88A 3CCVS 5KFBA 2HKXA 2WV1A 3CDHA 4JYKA 1T2KA 4TLQA 3GX4X 1PYSB 3HSRA 5ETRA 3LGMA 3SYZA 5HATA 2CVEA 3QOEA 4UY8I 3M2RB 2JZ5A 5DJBA 3MPWA 3K4LA 1UWBA 2E5LJ 5GADJ 3SQGA 1VF9A 4M6YA 1E6VB 3NRVA 2CFOA 3Q0WA 3RRKA 2NUUG 3CUNA 2ZXIA 1M5PC 1VQYA 2BE7D 1WOSA 2VPXB 3UD3P 4CLTA 4A4JA 4M5KA 3KTQA 1PIEA 2UXDJ 2F65A 3NGUA 4B09A 5L3DA 1UCRA 3NNHA 4WKYA 3BR9A 4ZK7M 1YIOA 2BJ9A 4PG4A 4K4XA 4V19X 1FP1D 4CYUB 1VQ5I 1L3TA 2DCEA 3TEHB 3IRXB 3GWZA 4NXNJ 3R5BA 4B47A 1GMVA 1O7FA 2F48A 2M0GB 4X4SA 1YI2I 3GBGA 5EX0A 4IH7A 2DRAA 3UNGC 3NS6A 5B66C 3DDIA 2D9PA 3OFEA 3D6TB 3EZOA 1F2HA 5CYQA 5L3EA 2CQCA 1RT3B 1RT2A 3HRTA 4FISA 2FDNA 3W64A 1RWVB 3O2PE 1T8IA 1JJ6C 2KT2A 1C4AA 1R1UA 3KLHB 1I6HJ 3HHHA 1FIAA 3ZMZA 3MMBA 4BC7A 1GVJA 3E6DA 1FT8A 2GW8A 2MKCA 2DA2A 1S9EA 1YJ9S 4KICA 4JV0A 1UZCA 3VVTA 3DP7A 3KMSA 4OFZA 3TA2A 4U0WA 4CH1A 3HVRA 2E5LF 4C8LA 3QWLA 1AHDP 3HBLA 2N4DA 1D0XA 1FRIA 3PW0A 2XO7A 3P4UB 4RL1A 1VBKA 3X3UA 1RT5B 1KYZA 3KG0A 4BQOA 3BQ1A 3IKVA 3PIOQ 4X66J 3M8SA 4CWBA 2WONB 3KWMA 5FKKA 1G2EA 4YDDB 4QIWN 4R79A 1JXLA 4DQQA 3CCQS 3H35A 4DUZJ 2K4JA 4NLSA 2CA9A 3G8SA 3QFWA 4HX8A 5F9NA 3MR7A 4XO0A 3GJTB 5A6WA 2FZGB 1R8CA 4LSNA 2DTZA 2E9RX 1FFWB 4CCKA 1ZYQA 1E2XA 4QPQA 3NKYA 3V6DB 3GYGA 1TELA 2O01C 3OYJA 2J5OA 2QKMB 5FJ8J 1NKCA 3B4DA 2R0QC 4F93B 2AHQA 1F5BA 4J00A 1HNXF 4TQSA 3BGFA 5IP6A 4CZZA 4M1KA 2QQ9A 4LBHA 1Z2LA 3MECA 1VBZA 1RWMB 2V63A 1NZAA 2ZMEB 1RYSA 4DR2J 2EV6A 1F36A 3AJ1A 1RT7B 1TUWA 3QYYA 3MM8B 5EZHA 1FJGJ 4FE7A 1TC3C 3M8PA 2XGQA 4DG1B 4WX9A 4U87A 3VAMA 4PG8A 3ABKH 5C42A 3CP2A 1TW2A 1X4DA 2DEJA 5KG7A 2YNFA 1VCTA 4JYAJ 2ICWG 3GV7B 5T7LA 4XK4A 2HVQA 4CH7A 1X5SA 3QRRA 1NJZA 1XNQF 3L9ZA 4P2MA 2COLA 4CLSA 1GXTA 1RIOH 3ML6A 3S7RA 4M5MA 2AJFE 2FUG2 2ZHOA 1E6VA 3DLJA 3D0HE 3ZQLA 3GVAA 5DM6Q 4OOIA 2PI0A 2VI6A 1PG5B 1B4AA 3ILOA 1KONA 3MAHA 3GFZA 2OZ6A 2I2YA 1F43A 1LUJB 3GW2A 2H6BA 1WKMA 1I50J 1AT1B 4KIFA 4IRCA 4ZHRB 4Y2MA 3MCOA 1RHRB 1SI9A 4QQBA 4HSTA 2DR6A 1A35A 2OJ3A 3G71S 4RJVA 1JIHA 4WBFA 1PDNC 3CT9A 1HQUA 2W2OP 4IHWA 1I39A 1HC8A 5IPAA 2KVIA 1G59A 2G7UA 4JP8A 2WSCC 3T19A 3FGVA 4G7OF 3AJ2A 1X5PA 3A2KA 4LIUA 2VQFF 5FROA 2NLWA 3NY0A 1M90T 4HTIA 3AG2H 5SZTA 4NLXA 3AG3H 2WA0A 2A3JA 2DNLA 1JT0A 2J0XA 1P7JA 2STWA 3A13A 4WTYA 2UXCJ 5FB2A 4AE5A 3JSBA 2DT9A 5D3GB 3TUZC 3RBEA 2FOWA 1WF0A 5CH7B 2IVFB 5KFMA 3SXYA 3K2ZA 3KZYA 1YK9A 3MWMA 4JYAF 4C48A 1U1NA 4ZLLA 5F0CA 3SFUA 5ERIA 4WFYA 1OY8A 4KHPF 1WDTA 3SQNA 3PNTA 1Z67A 2ZJRQ 2EEYA 3J7YI 2LREA 1WH5A 3EUKL 2XULA 2QZ8A 2FJDB 4QTRA 2L5QA 1X2NA 3NAHA 4C3IJ 5AE3A 2ZZMA 1Z6TA 2WONA 3GMGA 4DL6A 2E9ZA 2XDVA 4YHHJ 4DI6A 3KE2A 4XORA 1APLC 4ECTA 3M9NB 3WGIA 1LK7A 3HOYJ 3MM6B 3T1YF 4WK1A 2D2WA 1A6QA 4NYZA 1G4CA 2Z99A 2CDRB 2XAGA 2F4VF 4MEYF 1O0PA 1TL8A 2GO9A 4QR2A 4II2A 2BKNA 1GQEA 2LECA 3D54A 3S3OA 3MEKA 1SKUB 1HNWJ 2RHSB 3MOJB 2JVGA 1R1VA 4Y7NJ 5H20A 4HACB 2IDLA 4OHVA 3RB0A 1LOUA 2UXCF 4OX8A 1NH7A 1TWGJ 1YW8A 3MPYA 4ZVEA 4FS2A 2RAQA 2IT0A 4UUTA 2CKWA 3DHXA 3CTAA 2H8RA 4H4KA 2K02A 1IO2A 3HHLB 4DSKA 2EK5A 1BI3A 1I3QJ 2XB0X 1T9WA 1ZZFA 1NNDA 2ZMEA 2B9EA 1EETA 3DPUA 1URNA 4JX4A 1SL0A 3BKFA 1UMJA 3PFOA 2L02A 4LRBA 2DNGA 4DG1A 4YFNF 1FBSA 4Y65A 3C14B 3HPHA 4Q8FA 1YJ7A 2OI2A 3D3CJ 3GFXA 3HLUA 1HBMA 5DQGA 5D6GA 3O8GA 3TJ8A 1GMUA 3KFWX 5EN1A 4DNCA 3PCOB 4CI0B 2Z16A 4NZ7A 3QP6A 1VI7A 3SSQA 3UW1A 1N5YB 2H8WA 3MM7B 3OSNA 4OINF 1NZ8A 3BF4A 3CIMA 3FX3A 5KFAA 2XIGA 1S6QA 3NMAA 2DODA 2ZSIB 3O8WA 4JI2J 3SZ2A 1RA6A 1LNWA 1G3SA 1S99A 3PHTA 3GTKJ 3QOPA 1BJZA 2CRGA 3O8HA 2GAUA 2PC6A 4OI0A 4ZHRA 5A2QK 4F7VA 4RAFA 3IH4A 1C0WA 2K8GA 1KQKA 3M1VA 1TT5B 3IA0A 1H8AC 3SHFA 4BH9A 2DXIA 2K06A 5B7WA 1VC5A 3LGHA 3JAMU 5JLXA 4CSWA 2CWKA 1SVMA 1NK6A 1ON2A 1KU3A 2VH7A 4LF7J 4PXCA 1K6YA 3BTCA 3BREA 2AXTC 2VG6A 4FVCA 3TO9A 4C8ZA 2E5GA 3EMTA 1TQIA 3M4XA 5C25B 4Q45A 4QPOA 2WC2A 3U9GA 1TK0A 4DV2J 2XYGB 2X85A 2IMWP 2W01A 3IS9B 2LTPA 2I8EA 3OYDA 4DCJB 1ZM4A 4DR7F 4HEA2 5KT4A 2Z0GA 3NS7B 2KXFA 2W84A 1YX2A 4ES2A 3CC4S 1T05B 3SV3A 1JKOC 4WPAA 2DGQA 4ECVA 2PJPA 4JI7F 1BXNA 3A1YA 5HI7A 1HPZA 3I59B 5IYBJ 3UE2A 3G82B 4QYRA 2R93J 5B0BA 3PY8A 1OMSA 2ZB9A 3ISNC 1YRNA 3KDOA 1WKKA 2HYJA 4ZVPB 3WU0A 5LSLA 2O3FA 3EUNA 3OHAA 1HBNB 4NUBA 4N9HA 3M9OB 4MTPA 2MQ8A 4AUKA 5HAOA 3HOTA 4URQU 2I5UA 4F0KA 1BIBA 4F67A 2RU3A 5H2FC 3PJ9A 4QWDA 3DLGB 4Y2CA 2RU9A 1Q53A 1HI8A 5TGTA 1TMMA 2RMLA 2ZH5A 1X5TA 2C28A 3TO7A 1KVKA 1WG1A 5HMXA 4FDFA 4A2UA 2RE1A 3IP4B 1S12A 2Y9YA 4FX0A 1HDPA 4HACA 2XB5A 1SIZA 1YQHA 2QE5A 1ERDA 1XTZA 4BE1A 1Z05A 1S29A 2DYRH 1ODDA 4OX6A 2MKSA 4IRDA 2RVCA 3QPHA 1SMTA 2CFXA 2FPHX 3HHLA 3QPSA 4ED7A 3AD9C 4X4NA 5H9EK 2IYGA 4AIKA 1B0PA 3FBFA 3HUGA 3M7GA 1ZLKA 4DV5F 2DB1A 1ACMB 1XK8A 3UR0A 1FD8A 3CMMA 2XLJA 1PKUA 4EZ6A 1DP3A 2OTLI 1J5YA 3ULQB 1F0XA 5DQIA 5KFHA 3P9KA 2OCCH 4IQJA 3POTB 3H5YA 1VQ8S 2ESHA 4XSXF 2UVUA 4MQ9F 4V1Ak 1IXRC 3GCWP 3AXMA 1OQ3A 1U1LA 3T3FA 5EWEA 2J76E 3KLGB 3VZHA 2MY8A 4HLYA 3QLHB 1EQ0A 1F4KA 4ZVGA 2FGOA 2CW7A 3CJ2A 2K1RA 7FDRA 1HWUA 3K5NA 1SFUA 1QVUA 2YWWA 1AZSA 2Z1DA 2NSCA 4MYUA 4EEFG 2VIXA 2V4JC 3C2HA 2GO8A 4RU2A 1PBUA 2R2TA 3CCLI 1IBLF 4XRFA 2CYYA 3J7A1 1U0JA 2MSYA 2PX9A 3FNNA 4OZ3A 2QFJA 2VKZG 3GEZA 4C9YA 4ED8A 2X4HA 3VEPA 1JTXA 2A18A 3CF5F 3TI0A 1TL5A 2Y1JA 3CCEI 2R5YA 4TY9A 4KYWA 4RMNA 1JHFA 2BRKA 2JSPA 1S1VB 1VR6A 2ILZA 3MR3A 4BXXJ 1IJFB 5DO2A 1BR4A 4XLEA 3BQ2A 2MLXA 1IWAA 2VICA 4JX5A 1XDSA 2DA4A 1KS2A 3OR2B 3QO9A 4PWDB 3MEGA 2O5DA 4O3MA 2P7CB 1B6AA 4FNHA 4CLLA 3TAMA 3RBXA 2ATCB 4MNUA 3JRHA 1YJWS 2DA3A 3Q9SA 4Q2MA 4BWMA 6PAXA 2DOAA 2B6AB 3TUIC 3VALA 3CP8A 3CO7C 5E0OA 4CM0A 1NXIA 1Z2ZA 4LITA 3SFZA 2OUGA 4YS2A 2MYSA 2MABA 1RKWA 1WKJA 1PYVA 4GKKF 2W9CB 1CJUB 4MFEA 1AOYA 2UXBF 3KOAA 1CVJA 3C16B 5E2QA 4IRIA 4IH6A 2RV8A 2MJUA 1BLUA 1F60B 3US5A 4IZZA 3JB9k 4RBVA 4B9VA 2M87A 1WG4A 4PABA 2MG4A 4BEHA 4PCQA 1RTHB 1SH3A 4R8UA 3IR7B 1RAEB 3KYLA 1QPIA 2VPRA 5GAHJ 3ISND 2M0CA 1FX7A 2LEBA 1NJXA 3DLGA 1VQOS 2F1FA 1BN5A 3PJRA 5KFKA 4XLNF 3M3YJ 2GMHA 5K9FA 2E36A 1BOAA 2HYGD 1BJAA 4Q47A 1UFWA 1I1SA 6FD1A 1VQ4S 1H73A 2JQ7A 3GFHA 4YRVA 4KJZA 4EJWA 1W7WA 3TDZC 3RKXA 2UZAA 2A6EF 4Y52J 2LDUA 5DLFA 3HGYA 5J2PB 4YUDA 2XNQA 1RBLA 4B44A 5KFZA 5D4RA 3UCGA 3SZTA 4LRCA 5F8LA 1VQKS 1KWMA 4G1QB 3VHQA 3Q22A 5KT3A 3GTJJ 5DS9A 1MG7A 3DOLB 3M8JA 3PEJA 3BEGB 3NNAA 2WTEA 2X1FA 1P7IA 2O5RA 1SV5B 2HHUA 2HFSA 1M5HA 3K4CA 3D2WA 3K59A 1UEUA 1FEEA 2X1EA 2CQBA 1TFWA 4WWSA 4O3RA 2YS9A 2TRTA 4HPQA 3OYIA 4YG2F 2FNAA 2QSGX 4Y2AA 4YB7A 3JTGA 4MKYA 1YG2A 4TYAA 1JK9B 4WU3A 3BZQA 1DP7P 2J9EA 2X51A 4I1TA 5FLXY 2ZDOA 5ETNA 1YOVB 1BHNA 2HVEA 1WC0A 2C3PA 2P5VA 3I56S 1YHQS 2QLXA 2QSFA 4EO6A 5B0AA 3EYIA 1VBYA 3EGVA 2DW4A 3JSOA 4HDVA 2ATLA 1Z3YA 3PTWA 2WOMA 3HOWJ 4OV1A 2Q6BA 3BY6A 4ENMA 4LFCJ 2P7VB 2QA4S 2C2KB 5EWGA 1FDNA 1J7KA 3AFHA 3OTOJ 2QYCA 5BR8F 5L3FA 4GFBA 2WWYA 2HWIA 2RH3A 4IEJA 2BGCA 4R5PA 4A3KJ 4DQIA 2XHKA 3QPTA 3HKZD 3T9NA 1UFKA 1SB6A 3RSNA 2RJZA 2JPCA 1N56A 5A8KA 3ABMH 2DISA 4GMKA 5A2QY 3CJNA 2C3OA 1LXNA 5GAGJ 4BACA 4ED5A 2M9KA 2G0IA 3UVJB 5H6RA 3W63A 4FETA 3OYAA 3TL4X 1PC4A 2C2DA 3X2QH 1UAWA 5ETVA 3QJJA 4RS8A 3W8PA 3BN7A 1X1BA 4UW2A 3G1LA 5IWAF 1X0FA 1SAXA 1RWXB 4B3XA 4WE1B 3DKYA 1RTDA 2BKOA 2V34A 3LP0B 3OUYB 3UDVA 5EYRA 4DL3A 5DCMA 1ZLJA 2D41A 2HQAA 2KRCA 4CDGA 3L7OA 3CCYA 2HZDA 4H4MB 4BE0A 4NYPA 4BKXA 2EC0A 4O6JA 3E0JB 4F4YA 5KAFC 3MKLA 2QT7A 4B43A 2VBYA 2V9WA 3RAMA 2JSCA 1RCXB 2W2PP 4DFJA 4K2JA 1HBXG 2C2OB 1UTAA 3NAIA 3CMAS 2Z2ZA 2YKNB 2VONA 3BQYA 9RUBA 4QWCA 2H4WB 1X31C 2JC1A 3EE3A 3ZZZA 1B3TA 4WZQA 4GDFA 2KRHA 3BQZA 2MQQA 2NVYJ 1IXKA 1XMXA 2B9WA 5J2PA 4LF9F 1WGXA 1FOXA 2J9DA 1ULRA 2GZOA 1FEXA 3R8YA 5KFQA 4K5RA 2ISYA 2ZOFA 3FFIB 1XN9A 1N36F 4EZ9A 3HO1A 3ZXSA 3MMCB 3H5AA 5E3MA 3DOLA 1EKSA 1FK9B 2JJ4D 2A69F 1SV5A 1OLTA 1QRYA 2YY3A 4CNYA 3NP5A 3W9HA 2DITA 2H1KA 3K69A 4CLFA 4XN3A 3SYTA 5I3QA 2VKEA 3OYHA 1RT6A 2CZ9A 3HSDA 3D0SA 2CQXA 3BJ6A 1PP7U 2VASA 4C4WA 5KFJA 2QA4G 3IC7A 4PGHA 2A5YB 2LKZA 4JOMA 4W4MA 2GA2A 2CQQA 3SFGA 3ZR8X 3SEOA 1N32F 3K89A 1WQ2A 2VZ9A 2QGFB 4PEOA 1TQLA 4X62J 3I55S 4OI2A 4LFAJ 2HS5A 1JJCB 4HSRA 1U1KA 1R0BG 4KO0A 1UHSA 4PJ0C 6FDRA 3P96A 4JB8B 4OJGA 2KHDA 2B56A 5J1YA 2L4AA 1GEHA 4J37A 3PX6A 3ENAA 3IGNA 2LQJA 1DRZA 2ZMEC 2Y0BB 1JLCA 2BEOA 1VQ7I 4MJKA 3U21A 2X9DA 4RUBA 3BO3A 3I58A 2W48A 2MMYA 1X3UA 2FGCA 3BQ0A 2DHXA 2CH0A 2B0GA 2AX0A 4M5NA 1S5ZA 2XQCA 1Y6IA 3OVBA 3ABLH 2DHSA 2BDPA 3CB4A 2GIZA 4FS1A 3A8IA 3W9IA 5LJ5Y 3BBCA 4A5MA 5J1EB 4DU8A 1IAWA 1R27B 2LD5A 4ZDNA 2B51A 1O6XA 3EX7B 2BVLA 2MKJA 4WXDA 4IHXA 3QRQA 3CJRA 1W7PD 5D0GA 1H9TA 3EM1A 4MK8A 4D5CA 4DR1J 2FLOA 3KK1B 2PE8A 2I0XA 2LR8A 3DF8A 4J9OA 1S0OA 3TQ1A 1CJVB 2IBDA 4WE1A 1FIPA 3OV8A 1REGX 5L3GA 3G87A 2EINH 4L5IA 4X62F 3WODF 2WAQN 2GM4A 2LCWA 1BM9A 4DSLA 4F52A 2QCOA 2F9JA 2ALZA 4ZTJA 4DFKA 4O4RA 2RN7A 4ZYAA 4DQSA 1Y3JA 2C22A 3PQJA 1ZAXA 4C3HJ 3VF0B 1KA8A 2W1BA 4Q5VA 4DWIA 3SV4A 1CJTA 5CAAA 2AGQA 3S2HJ 5IV4A 4FF3A 2ZBQA 3DU6A 1RA7A 3R0AA 2H51B 4L0YB 1Y9OA 2ACYA 1T03A 1N25A 1VQNS 1JLFB 2FMYA 3MF5A 2GVZB 3DQVC 5HOOA 4QCLA 3CCJS 2HMIA 2YWKA 2X1DA 2UUCJ 1HWLA 2LBFB 5F0UA 4RBUA 1RAAB 4S0MA 2CJKA 1JLBB 1X1AA 2JK3A 1JKRC 4PG6A 1FOYA 5DD8A 3JQMA 1QE1B 4DS4A 4N9IA 5B0FA 1SMYF 2UZKA 3CF5Q 1VDHA 2IM3A 5AIPA 4V19K 4OYMA 1T56A 1XR7A 1MNDA 4EATA 1N77A 3UFCX 5K7FA 3O3KA 2N82B 4NCAA 1VQMS 1EZZB 3MZYA 1FE0A 1WWHA 4QW8A 4QLCU 1Q1VA 2E29A 2ZWOA 1IKVB 5BPIA 4X4OA 1SEUA 2WAEA 1AFIA 2HHSA 3NQOA 1Y0NA 4U95A 3F8FA 1UJ4A 4YIFA 2D5VA 1EX8A 3LGNA 5E5NA 4HX4A 3CC2S 1LNQA 3TW6A 1VYAA 2HZVA 1D1UA 2VHGA 2NXNB 2JA2A 3HHNB 1FDDA 2YWGA 3GILA 3O6BB 3SXLA 5E3AA 2DMPA 2FEZA 3HHLC 4FF4A 2ME6A 1POGA 5M2UA 3QSYB 3DEWA 3HJVA 3OYFA 4XOTA 4K2XA 4EUVA 2OMOA 2DR5A 1WI9A 4LF6F 1SJRA 4AL6A 3PRDA 5CA5A 4FCYA 3THVA 1FXDA 2DOEA 2AQFA 2JUGA 4BAYA 1FKOB 1XSVA 1XDUA 4TVAB 4L3NA 5ITHA 1YS7A 4ELTA 1V3ZA 2CJXB 1N4LA 1AUSL 2G0JA 5DG8A 2XMAA 1JJ8C 2X1CA 3LA3A 2CQPA 5J1EA 2HG4A 1RLCL 2Q79A 3AH6A 2DY9A 3I6PA 2IP2A 3F44A 3W61A 3FRYA 1MSEC 3ZQFA 5K5QA 5CHCB 2XLIA 2LOOA 5D5XB 1CPZA 1SKRA 3R61A 3MVPA 3ILJA 2ASDA 3G2XA 3H2UB 3CCVI 3BM7A 1MZBA 2E5ZA 1R0AB 3AG1H 1XMQF 1NK2P 5D0HA 3CSKA 5DM7Q 3PO4A 1CJVA 2ESNA 3P6YC 3J81K 4BJTA 4WCEQ 1XEZA 4IDKB 5JLWA 1FERA 4KN4X 2JOQA 3LP2B 2YBVA 3BH7B 4EGZA 5K5RA 4WYLA 3C6TB 1X1CA 3UKGA 1WJFA 4XRSA 1YO5C 5TJJA 5LSOA 1VFJA 4NI2B 4OMZA 1S6UA 2NNYA 3BG5A 1GXUA 1HW1A 4HLBA 1IV8A 2MHNA 1UVIA 2L54A 4U8YA 4Y0FA 2ZM6F 3G9CA 1GLNA 1VNDA 4M6VA 2CW0F 2ACMA 4M72A 1TV6B 1BR1A 5B0EA 2BXZA 2M1BA 2HEOA 1LEOA 2IGKA 4FE4A 2FJBB 2DK2A 3AD7C 4DV1J 2ABYA 2H5EA 3KLNA 3DLBA 3D1OA 1HF0A 2CV2A 1UW9A 1U8RA 3NARA 3O3LA 5KFUA 1NU4A 3MZIA 2R42A 5GAEU 1ZM9A 1MBHA 5HLHA 1FX4A 1QD1A 1QE1A 1RAOA 5AXKA 3MGJA 1DURA 1L3SA 2HW3A 1S6PB 1XGSA 3QAUA 1U47A 4LF1A 4JV5J 3IMQJ 4ICLB 5H9FJ 3C2BA 4ZVRB 2A61A 2GIRA 1IN7A 3TW7A 4LF8F 4LBPA 3MEEB 1RTIA 4U7UK 4KITB 3G73A 4OQJA 1U8SA 4X2BA 2K7JA 1R0CB 4MFBA 4M5LA 1HNVA 2G0CA 1HLVA 2AMCB 2NOGA 4EJOA 2VC1A 3AT1B 4DSEA 1I3AA 1Y3KA 4UVCA 4WIQA 3VAGA 1KGSA 2WV0A 3L95X 2HPMA 1F3VA 4USVA 1T0FA 2PLYA 1M5VC 1YFHA 2K7KA 3RB4A 4IKFA 2CJQA 1RGVA 3ONQA 3CCQI 1U48A 2HGCA 3G96A 3H20A 3ZPLA 3SZGA 2OFHX 1RAHB 1QLNA 4JI4J 1JLEB 5F0WA 4IXAA 4XDCA 4QWEA 1MBKA 4HOBA 3A1YG 1FFSB 2IJRA 2KI2A 2XAJA 4MTEA 1HQCA 3QT5A 1FT9A 4LRFA 1PP8F 4IOBA 2CQGA 3X1LB 4NCGA 4F92B 3BDDA 3F73A 4ED6A 4CTAA 1X4BA 5KT2A 3VYRB 1QAJA 3CJQA 2WY7Q 4I6AA 2BR0A 1XB4A 3ECOA 2KDZA 3V7CA 4BE2A 1APSA 3E3VA 4DR5F 1TKDA 3ESWB 2DA5A 4ELVA 2YPZA 3KJVB 4UT4A 5HSPA 4AIDA 5CZVA 3VZIA 1DLOB 1UVLA 3DPTA 2WVEA 2Y0SN 3LFUA 1Q7LB 3W3SA 3GYHX 3K4KA 1Z4UA 3M9MB 4KFBB 3GTYX 4QOTA 1V5VA 2P81A 1LKZA 2ZC4A 3E1SA 2NOJB 2GJ2A 3HG9A 1HDDC 3FCWA 8AT1B 1XCVA 2JLGA 2DXEA 3QU3A 2NAZA 2G2ZA 1R31A 3VSKA 2IRXA 3IR6B 1KU9A 2KXHA 1N6QB 3H36A 3W5YA 2HNZB 4U7CA 4IDKA 3FBCA 2E7VA 1GX6A 2MQOA 1VQ5S 3EZ5A 4ESFA 3ZCOA 4ZP7A 3GFYA 4A8OA 1J5OA 5KG4A 3LP2A 5IOYA 1W0TA 2AYMA 5K7ZA 4UB8C 1I1GA 1WJBA 4ZYGA 3WTXC 3I82A 1U1RA 2PMZD 4JI1J 1C1CB 1A6LA 1WJ5A 3H4BA 4B3RJ 4ABZA 4WKRA 2DK8A 2ZJQQ 2M8GX 3D68A 1PYTA 2KIMA 4RW8A 1D0YA 3RUBL 1P1LA 3K2AA 2V4RA 3WTVC 4NI2A 2CG8A 4XPEA 3OLBA 4G7ZF 3OR2C 3JRAA 4LFBF 2KO1A 2LU1A 2YUSA 2VA3A 4L9JA 4XKCA 3E3XA 5I4MA 4WXHA 5KFLA 1GT8A 2DQLA 1W5CC 1I27A 1J09A 5A8WA 1TP4A 1W5TA 5KFTA 2HVDA 1IJWC 1YLXA 2Q2EB 4EQQA 3RGIA 4XK8C 1Y5NB 4NA1A 4QIFA 2RVJA 4HYEA 5LHHA 4XKWA 4JI5F 4OJ1A 3KG1A 3GTOJ 4ED3A 3MKWB 2VDHA 2WBMA 2HWTA 3BO2A 3EUHC 4ZMMA 5LOQA 2UV1A 1S6PA 5L9XA 1FRLA 3RR8A 3TNVA 2WVDA 2CPJA 3OL7A 5I3PA 3Q0VA 3PL8A 3M05A 2RF2B 4RGUA 4FASD 1R00A 2ZBKA 3TMOA 2VJVA 2Q66A 3IRRA 1F9EB 3GU0A 1M1GA 3JYTA 2FC9A 2V6EA 2BY3A 4PRFA 2CUFA 4LD5A 3JS9A 1XWLA 2VUGA 3K4BA 4JI1F 3L2QA 3LSHA 2DGTA 1OR7A 1S4EA 3WHBA 3PJWA 2IA1A 1RADB 2DR9A 4F4ZA 2G9WA 2F9DA 1KVIA 4I67A 1ZELA 2XWYA 4W90B 4M5HA 5D8LB 1QUPA 3UN5A 4YOEA 4OZ5A 1WEXA 2GOMA 1BWEA 5D15A 5D5WB 1IKYA 3TEDA 2IC3A 1JXEA 4DL4A 3IAM2 3OYLA 4M3EA 1LE8A 3DCAA 4F0HA 4QIWD 3D9BA 2AJ2A 1XD7A 1VRTB 3W5XA 4ZPVR 3I9ZA 3BN4A 5JJBA 2JVRA 4X4TA 4CCNA 2JDJA 4A8XA 2G4BA 2CQ7A 4F3OA 1HIYA 1B64A 1TNSA 3WE3A 3W66A 2L7MP 4IOCQ 2YKOA 3BG9A 3NXZA 3BOQA 3DDKA 3D4JA 2F4IA 3L1PA 2VQHA 5HROB 1PCAA 1Y39A 4O5VA 1WI3A 1LPQA 2VU5A 1DLOA 4CCHA 1TL1B 2L9DA 2XMUA 2WVBA 5H6QA 3HGGA 1NAQA 4FXWA 1WHXA 3KK3B 2CQ4A 4KFBA 3AD8C 3QPIA 1RESA 1FA0A 5CD4H 2WCXA 1G7CB 5KFDA 3PYGA 1TL7B 3O1LA 5F8IA 1S72S 2MKHA 4LVOP 3F6VA 5AXNA 1CJKB 1JJ2R 4RW4B 2R7XA 1AA7A 5F8JA 1V3SA 5U47A 1PJ7A 3UPFA 5HJXA 4L0ZB 2HK3A 4PR6A 1NLKL 4KH1B 2XZDB 4FYYB 3LSPA 3C1DA 1YJUA 2MZSA 4UTGA 5LXRA 2ZH2A 2DI3A 2FSWA 3LALA 3MAAB 2OHDA 4ECWA 4KV8B 1R8PA 2DK5A 3ELHA 2CQ0A 2KRRA 2LK2A 1W4MA 3HPGA 2DPUA 2YQ1A 4ILRA 2YNIB 3LANA 5CXTA 1FJ7A 3VCDA 2RDJA 1MMLA 4K4VA 4AC0A 1JX4A 3W2WB 4AT1B 4DL0C 5EEAA 5C7PA 4NLPA 2BYCA 1H72C 3H9GA 2AQEA 4IJAA 3U1KA 2UVVA 5KVRA 2EC2A 1U2CA 2EZLA 1LWCB 3OTEA 3TJ9A 4UOFA 3QSIA 3BR2A 5FIIA 1K8AT 3I53A 5CQEA 4LR9A 2MZQA 3CJ3A 2ZC2A 5F8HA 2YKMB 2R8IA 1D1AA 1XMOJ 2MW8A 4P73A 2FBKA 2M5YA 2COMA 3OYNA 4N47A 1U0HB 4PJNA 3CC4I 1NSPA 3UN2A 1H38A 1OIAA 3LQVA 1SVLA 2WADA 1PVEA 4OAZA 3C3LA 3M1EA 1CQMA 1QHGA 4IG0A 3EICA 2VQCA 3T1AA 1TL3A 2ZWPA 3SMZA 2ASJA 3REOA 1PJ5A 2HHPA 5BYSA 3MAJA 1O3RA 3TW0A 4ZLJA 3DKXA 4DFMA 2OFGX 3NAUA 2A68F 3S3NA 3LSGA 3O2IA 1Y5LB 3EJMA 1H2VZ 1IKWB 4I56A 1T08B 2Y1RI 3K5PA 4CP5A 3QT8A 4A8QA 1OY6A 1S9HA 4DX8H 2QUFA 4ZZLA 1LDKB 4PQUB 5JVTA 3M30B 2CQHA 4Q44A 2F5EA 2ALYB 4DYRA 3VV2B 1YX5A 1G6BA 2A0FB 2MLZA 3E5XA 3E5QA 2IJNA 3A12A 4CO1A 2PQ8A 3JTHA 5HO4A 4Z7CA 1DQUA 2V26A 4LVNP 3WU2C 4G12A 1LKXA 2HLUA 3A01A 5GTIC 2AF6A 3AXKA 4NCBA 1X19A 2A6TA 2NYHA 3ZFVA 1XX5A 2QA2A 3PNVA 2CXEA 2JEFA 2UU9J 1B72B 2V1UA 3KK3A 4FVMA 1VQSA 3FSIA 4ZPAA 4LOCA 4DQRA 1TL7A 1NG6A 5IM0B 1MD0A 1WRJA 2O9LA 2DGWA 1HLWA 4RW4A 3KP5A 1RKIA 3BLYA 2KMUA 4A3IJ 2XSFA 4BDYA 3OL3A 1BW6A 2ZKZA 4K7QA 3CMYA 2VB6A 3H2VE 5HS8A 4ASNA 4ED4A 1KKHA 2UXNA 7FD1A 3E6CC 1SFOJ 4WIIA 2HWVA 2HXOA 5L39A 4AL7A 1BUXA 3HD2A 2ZZTA 2Q43A 2GNKA 3MAAA 1KRPA 3MAQA 3BR1A 1FO1A 1TUVA 4Q0BA 3ITHB 3LQRA 3K6GA 2EFOA 1FWLA 5K20B 5A0YB 4ZN3A 3F0NA 5JXSA 1G3TA 3OXLA 4PWWA 1XNRJ 1WC1A 2OP5A 1MBFA 3IRQA 2YNIA 3EZUA 5D0RA 5LT5A 3DBLB 3W2WA 2FE3A 3BYRA 4DF8A 1SJFA 3RBDA 5A8RB 1AUDA 1R5HA 1OO0B 3NWTA 5K5MA 4FX4A 1H88C 4A93J 3E7LA 2V0NA 3MUTP 5F1JA 3DLEB 2ZFUA 3DYAA 1K0VA 2M30A 2IRYA 3V4GA 4J9PA 5H1SV 4X4VA 4W1UA 4NLVA 2DBBA 1SUQB 3M2VB 3EVWA 2NQPA 4P9FA 1YJWI 4CYDA 2D9OA 3P5TL 2HHQA 1CF7B 4WWCA 4DUYJ 1NM2A 4P72A 3JTNA 3TP0A 2JWTA 4HT7A 3PACA 4KC5A 4CGZA 3OTBA 4L73A 2HZAA 3N79A 4PAAA 3W6JB 2IDEA 4A8KA 1S76D 2CPEA 3SEZA 2BABA 1ZQ3P 4R25A 2NVQJ 2CNNB 1NDPA 3I9V9 4OYOA 3LSIA 2W9BA 1R8AA 1IKXB 3KIOA 1FSEA 3QIPA 3JRFA 4P7VA 4HI2A 4TXSA 1MMDA 3Q5FA 1MBEA 2DKOB 1MN7A 2OPSB 4EI2A 1S9GB 1WH7A 2OU2A 2BY1A 4E7LA 1HQEA 2P8IA 4ZJOA 2IJFA 2EB7A 2CPFA 2W4PA 3OIQA 2FVRA 3MKYB 4L6V3 2MGZA 2FYXA 2YSRA 1WACA 1VQ4I 3QJPA 2JPBA 4NHJA 4DPOA 4EJUA 1SH2A 1V54H 1CGPA 3N9UC 1HI1A 4QPTA 3HZEA 2R7DA 1QZYA 1B72A 1BD6A 1VQKI 1T9UA 4CA0A 5IT3A 4DR3F 2WB1A 1RWOB 2AIRB 2YVSA 4OJ3A 3B6AA 3RU0A 1ROFA 4ZCMA 1U1PA 1H0MA 2OZUA 3ZTQA 4OI3A 3TA1A 1T0FC 3PO2J 4RNMA 4JV1A 1SQFA 3ZXWA 2KB2A 2PEXA 2VFSA 2HFHA 2KL4A 2HU9A 4XQFA 3M6XA 4II3A 3DOKB 5ED4A 4EGLA 4BBSJ 2GXBA 5EEGA 5GVQA 3SDGA 2UUWA 2HNDB 1FZPB 1OYDA 1GMWD 1QAXA 2XY5A 3RTVA 3WX4A 3PRBA 5CZXA 2HFOA 3J81U 1HWKA 5TISC 2MLGA 4WCGA 2XF7A 3ITHA 1ETOA 1U2FA 4RW7B 3P5BP 3I56I 1YHQI 2AD9A 4CO5A 5I42B 4OYXA 2C2RA 4TU8A 1K61A 1LWFA 1LQ1A 3K17A 5D4PA 3HP6A 3GFMA 2AXLA 1Z1ZA 1OJ4A 1YVFA 3FXKA 2VL8A 2QA4I 4ECYA 4USIA 5DZ6A 4Z2YA 5CPRB 2DH9A 4LF5F 2ZNZA 3ZMVA 1FYMA 4X4RA 2YX1A 3PVXA 5E3NA 2HNYB 2FIUA 4HQMA 1BA5A 1P9YA 4C0OC 2ZBCA 4KPCA 4LMYA 2R8KA 2E7XA 2DNNA 5ETPA 2K4BA 3V8JA 2N4CA 2CMPA 3F3XA 3M4OJ 1VQ6S 5DGAA 1S7AA 3HX9A 4E6KG 4PGGA 1SUQA 2OSRA 1ETKA 1RSCA 4LG0A 3PG9A 1C0UA 3CULA 1M5OC 3LA7A 5IC4B 4EFAC 2ZBPA 1J27A 4DV4F 1CF7A 2KT5A 2HZTA 4DZ6A 2QENA 4RLFA 3EPZA 3HOXJ 3O6QA 1R6RA 3N5FA 4DR4J 5IP7J 1PUFA 2MLKA 3W8GA 5J2MA 3IO1A 1HNZJ 5KG5A 3CF2A 2GQCA 2M88A 3T8TA 1QA6A 2AYEA 2VQEJ 2DCUB 2Z3YA 4DF4A 2EA4A 3I71A 1SL1A 4RW9B 1KEKA 1SQEA 5L1JA 2DU9A 4B3MF 2PMHA 2LQ5A 4D9JA 2I38A 4RM2A 1IKXA 4GC6A 2XKPA 4B3TF 1S59A 2MC3A 2VPWB 4JI6J 3MTJA 1W1WE 4S0HB 1FNNA 4RB0A 2F3JA 4LIVA 4Q8EA 2ZBIA 4XKVA 1CG2A 2KJWA 3IAS9 4ANCA 3S2DJ 4BQAA 2FHJA 4XM3A 3A02A 1OWXA 4YY3J 2FUG9 1JGSA 4IG3B 5E8GA 1BIAA 1MU2B 4USUA 1SC1B 4ER8A 2NYXA 5CVUA 3CMAI 1T02A 3KLIB 3OYBA 2CW8A 3HL2A 2JWNA 4H4OB 3DM2B 4K0KF 5JVGF 1O5JA 3J80U 4XRSG 5G0RB 2EQRA 1IN4A 5D4NA 4DQPA 2GLOA 4ED0A 3ULHA 5FLXU 2B5JA 1FBUA 1OR7C 4USJC 4DFPA 2DGSA 4UOCA 1X1DA 1CC7A 5KK1A 4TKTA 2ACJA 1RDRA 3L2VA 1J59A 2I5JA 1OS5A 3TP2A 2W8LA 5L8RC 2Y1LB 3NG8A 4DEZA 1ZGWA 2LA6A 1WNEA 5KFXA 3Q0AA 3S3MA 2JHEA 3HVTB 5L9NA 4IX7A 2ZC3A 3H2LA 5IT9U 4PUSA 2BANB 5D4OA 1UHWA 2J5PA 2RQMA 1J5EJ 1MMSA 2LFBA 2RQQA 2HDWA 3MM5A 2HDCA 1BC7C 4J9RA 3UNYA 5F64A 1FWPA 1N75A 4QR0A 3I55I 4RAYA 4A5NA 5KNLA 2BJ1A 2NNNA 4RW7A 3EETA 2IM1A 1VTNC 3H9QA 4ZVTB 4DPXA 4IPAA 2GS8A 3P45B 3PSIA 4HX7A 4QZVB 1KQ8A 1KFSA 4PJJA 4ZJLA 1RRJA 1H9GA 2E2IJ 2UUBJ 2Z9OA 1B9NA 4NQWA 4DZPA 3PM1A 2BEFA 4J9VA 3CCMS 2OCEA 2XAUA 3PIOF 5B0GA 2ZXWH 2DXFA 5JHUA 4ETSA 5ETKA 3KLFB 1RAJA 1HKAA 1GXPA 5CCMA 2YWFA 2IM2A 1UB9A 3VAHA 2AEJA 5JMNA 1S1WA 3UN3A 2PEHA 3L3CA 1IM4A 1VLOA 3D6FB 2LF7A 3DMJA 3IM8A 4OI1A 2ETHA 1FJLA 2HQCA 4HQEA 2EKNA 3CCRI 1BR2A 1S79A 3CCZA 1FKPA 5MAOA 1P8GA 3LWLA 4KPYA 4CO8A 5FRMA 3Q83A 1FCAA 2XPWA 4G6QA 2VE9A 3CMQA 4WFZA 4HHHA 2MZRA 3JAMK 1BI0A 4O44A 4BY7J 1J5EF 3QQCD 2HURA 4A3BJ 1SPBP 2L08A 3PO3J 4KYZA 1IR0A 2CWEA 2XSDC 2P5LC 3P9IA 3ABUA 1WI6A 2E1PA 4KBIA 3MKZA 2KH9A 1OCRH 1NK4A 5HS7A 3BGLA 1YYVA 4BXFA 5BOXA 2ZFWA 4OYAA 1TVRA 2B4OA 1GHCA 2B0LA 3V7RA 2ZJPQ 3R5CA 1D8JA 2XNRA 2MEWA 1XBWA 4A3GJ 1JLGA 5GADU 2M5WA 4ZIVA 1KN6A 3MPUB 4ED2A 3BPXA 3CD5A 4DR6F 3I0RA 3LSKA 3AQOA 3G6VA 2MQNA 1D1BA 3DBRB 1SL2A 1HSTA 2LEAA 5C5JA 3GCXP 4NXMF 1KHVA 3P5JA 3QWPA 2LYCA 2HPUA 4IG3A 1MU2A 2QG9B 1VQNI 5EX3A 3RZDJ 2D45A 4K4TA 1VMBA 3G6XA 4DSIA 2VG7B 3T6BA 5DM6F 4MTDA 3T6JA 2DVIA 4L9NA 3ZQGA 1IGNA 4I69A 1ZGAA 1XC9A 1UHMA 1BQXA 4N7TA 1ZRFA 1RHUB 2BVZA 2EK6A 1U1QA 4RM3A 3G4SI 2DNZA 3GWCA 4LFUA 1AKHA 5GPAA 1ETQA 1ZA1B 4DYCA 1R4NB 1WC4A 3TZYA 4C8MA 5FGMA 1PJ6A 2AQ4A 1Q95G 1LVAA 2DO0A 2XY6A 4YIRX 5BNGA 3I64A 1WZ2A 4LT6A 2M52A 4UV8A 5M2PA 2N3LA 2OTJS 3J81j 3R6GB 3D6MB 2JX2A 2COBA 2DNRA 3F41A 4K5SA 5F6FA 2BANA 2ZNYA 4RLEA 4DSJA 3ASOH 1UEVA 4CHUA 3HPOA 4C0BA 4HEA9 1IJEB 1TL4A 3M8QA 2GAHC 3CO0P 3WTYC 3JCUC 3CC2I 2UVRA 1X58A 3EXYA 3KK2A 2VIHA 3S16J 3EDRB 1MIJA 4E2FB 4HAMA 1KQGB 5EF6A 1QO0D 1X4OA 2Y0MA 3LSMA 2HOSA 1JLQB 2HSEB 2FMLA