2VOPA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
EKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 51
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vopA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vopA02
2HVZA 4CDGA 1QBJA 5E8IA 3TO6A 3TP2A 3ZZYA 3LAJA 4CICA 3MURP 5E1XA 4UY8T 4KMUX 2DO7A 3G4SS 5CYJA 5FLXK 3VAIA 5ICGA 3COAC 4EGZA 3LWFA 4PCQA 1V3FA 2G7HA 3SQNA 2A07F 3HRSA 2PMUA 2EA2A 2GZWA 4QU7A 1JMTA 1SFUA 4CYDA 2FXAA 2QLZA 3CO6C 2MZSA 3S6EA 3J81Z 3W6JB 2RVCA 2DNPA 5LJ3Y 3BZ6A 1O3RA 2MLGA 1LVAA 2HYIB 5H20A 1IW7F 1NO8A 2MGZA 3TDUC 3NS6A 1W4MA 3CCES 2MQNA 5AIQA 1X4HA 3VODA 2Z3YA 2HGMA 1XGSA 1BOAA 4YG2F 3HHNB 2XS7A 1X4GA 3K1PA 4CHUA 3MUMP 4IRHA 5CVUA 2HOEA 1B9MA 3ZMTA 2V6CA 2XB2D 3HOTA 4P6QA 3HHHA 3V8KA 3RIRA 4HLYA 1KYZA 4IOAQ 2DHGA 1KA8A 2E1CA 1WKMA 2DLLA 1T2KA 4AD9A 4LIRA 2LMIA 3MD1A 4WF9Q 1EH8A 4TU7A 2XS2A 4KIGA 2MLKA 3G3ZA 4R8HA 4LLNA 2DNOA 4S04A 3JB9k 5IFMA 2AXLA 1X5SA 2P5LC 2GXBA 1Q86T 1WRJA 2HTJA 3IRWP 5JI6A 4AIHA 2DIUA 5FD6A 3LFKA 3G6ES 2PI0A 3T1BA 2Y48A 4TV7A 4ED5A 4WFAQ 1IRGA 4ASNA 2DNZA 4IRIA 4IHSA 2RV8A 2CWEA 2FQ3A 5CLSA 2AS5F 1YYVA 1H0MA 2RS8A 2QA4S 1REPC 1GVJA 3BWGA 5H6RA 1OR7A 5HOOA 3FHZA 2DNMA 1FOKA 5LGUA 4OINF 1GXQA 4UVBA 5J6XA 1R1TA 3K0JA 4NQWA 4FHTA 5DYMA 1VBZA 2XHKA 5ITHA 5D8KB 3VAMA 1KOOA 2ESNA 5D77A 3H2UB 4W90B 4YFKF 1W5SA 2CQ4A 2M4MA 2V1XA 3N4MA 4RGUA 1WWXA 2OAZA 3F8CA 2DISA 1WTBA 4LK0F 4O3MA 5IQQA 2CQBA 1HD1A 2CQPA 3TOAA 3CXCR 1O7LA 3LA7A 3WTUC 1YS7A 2L01A 2A5YB 3R4KA 2Q0OA 2X1GA 3ELKA 3RDIA 4PDKA 1L3KA 2FE3A 1TQMA 3SZTA 3KE2A 4F7ZA 2KXNB 2CQGA 2WTEA 2VONA 2D9OA 3SDEA 2EFQA 1LEBA 2M2BA 2H94A 2ESHA 4PR6A 3CCRS 2IW5A 2RRAA 2W57A 4LB5A 1U1PA 3O6BB 2ZCWA 2GXGA 4BNCA 4EJOA 3TDZC 4WXCA 4ESFA 3CD6S 1ZARA 2JRTA 2O3FA 4G7ZF 4EJVA 2K86A 3GW2A 1HBXG 2E1NA 2DQLA 4WIIA 2CPDA 2GHPA 3ZMUA 1D8JA 5D5WB 5EEHA 2MY8A 3WU1B 4Y13A 1FYKA 1H9TA 1IXSB 3BJAA 1T98A 1FYMA 1HSJA 2W25A 4A12A 3J80Z 1G3YA 4MTEA 1ZH5A 4RB2C 2F9DA 1VQNS 2LNBA 4RB0A 1IN6A 3EX7B 4YOEA 3KCCA 1OIAA 4HDUA 2J5PA 4AVPA 2MA3A 4XSXF 1CVJA 5LEKA 1ZHFA 2GIVA 5MLCV 1XSXA 3I56S 3P6YC 4OMZA 2CFXA 2RRBA 2QWWA 2CQ0A 1B7FA 5H6QA 3SFZA 4RS8A 1HSTA 2MSTA 4IPAA 5BPDA 1HD0A 3MI7X 3S01A 4Z2XA 3G9CA 1IN4A 3U1LA 2M8HA 2RU3A 4ENMA 3QOPA 1LQ1A 1JHHA 3VALA 1UB9A 4IO9Q 3HSRA 3UD3P 3IRRA 2EK1A 2GA2A 1IQTA 5DM7Q 3WTYC 1YW7A 3JTGA 2MJNA 2MQOA 3CPWR 3GF2A 4OIQF 2IA1A 3IWFA 4CIOA 4XLNF 2MKIA 2J76E 1RIOH 1S6LA 1XGOA 2AYGA 3IKVA 5GMKa 1FY7A 2E44A 2QYOA 2XKPA 3TOBA 5LBQA 1K73T 2YH0A 4F02A 3CC4S 3BY6A 3EYYA 4K2EA 2D3OR 1UFWA 3KFWX 4KN4X 3ML6A 3GXOA 1PGZA 4Y17A 1DUXC 5LHHA 4YB1P 1F9NA 1Q81T 4XSZF 1ZN2A 2XSFA 4N9HA 5FD5A 2FC8A 2DNKA 2KU7A 1R58A 3NRVA 3REOA 4LK1F 4W92B 2G9WA 2RKHA 2YR2A 3GFLA 4HQMA 3T8RA 3HTUA 3DP7A 5GVQA 1VC6A 1I1SA 1VQKS 4JBAA 5A2QZ 1EH6A 4WXDA 1F5TA 1FP1D 6PAXA 4Z2YA 5EN1A 5BQTA 5ICEA 2QQBA 4UXNA 2F3JA 1D9AA 5K5OA 2DO0A 4P55A 3R60A 1Z6TA 1QZZA 3DF8A 5J8CA 3WU0A 5ICCA 4QPTA 3VFZA 2OQRA 1U6FA 3SXYA 1FXLA 1SD6A 1TTYA 5CYVA 4HOBA 1X4CA 4M5DB 1EV7A 3CJNA 1S79A 2DGSA 3KP4A 3GFMA 1DPRA 3G71S 1BI3A 4UHTA 2OZUA 2AYMA 1YITS 2LSOA 2I38A 2D9PA 1IN8A 1TNSA 4L9VA 3EYIA 1R5HA 3CCMS 2DGWA 2P6SA 4EJTA 3BS9A 5IT9Z 1K8AT 2MZ1A 1U1QA 4G6QA 2KM8B 2MHNA 4RAZA 5HLHA 2ISZA 4ESBA 5DEQA 3B4MA 2RC4A 1FWZA 3R0AA 2E5GA 2QQAA 2DTRA 3BPVA 3CTAA 4P96A 4M9SA 5ED4A 2JTVA 4L5IA 2VE8A 1WSUA 5HDGA 3E5QA 3QAHA 2ZFWA 3U1DA 3HSFA 3K1NA 4U67Q 1YS6A 1D8ZA 4C0OC 1DP7P 2F2EA 2QQ9A 3FMQA 1YI2S 1VQ7S 3I0TA 1YWXA 4TU9A 1I27A 4RB3C 3CUOA 2LEAA 2PBIA 4HAMA 3JSPA 2HQNA 1XMKA 4U0YA 1K6OA 4OOIA 3TYTA 4M6XA 2X0LA 1FT8A 2MQLA 2ADCA 2VC0A 1B4AA 1X4DA 2LEBA 2UXXA 3QU3A 3T5XA 2A68F 2LA4A 2ISYA 4CH1A 2KG1A 4M74A 2CPXA 2CQIA 3KZYA 3QP5A 1O3QA 2YH1A 1Q1HA 2ELHA 2KRFA 4AIJA 3CTRA 2CQKA 5F64A 3P9KA 3MOJB 1IZ1A 3I53A 1KGSA 1G3WA 2YX7A 4EJWA 4NHJA 1IUYA 4KA4A 2HEOA 1HL6A 2ZO4A 4IJAA 4PGGA 2ZJRQ 3VOEA 2EK5A 2CJKA 4Y15A 2EWNA 2M8DB 1R36A 2M0GB 2B0GA 2E7WA 1XMAA 5HVQC 3VF0B 1VTNC 3I71A 4Q4ZF 4XLPF 3N97A 2DQRA 5L3EA 3E6BA 2KIFA 3BP8A 3ZMDA 2STTA 4U0VA 4UQTA 2EV0A 1U5TC 1Z91A 5ILSA 5BMZA 3I59A 1VQ5S 2ZBKA 1X4EA 2LF7A 4KICA 5TRDA 3P9CA 3DV8A 4F25A 3NNCA 1MZBA 2BOPA 3VAFA 5D78A 2H09A 4PGHA 4A2UA 2N7CA 4UVAA 5CXTA 3WGHA 2M70A 3E5UA 2BEOA 2NNNA 3B02A 3ZN1A 2P7VB 4HX7A 2YWKA 1ZG1A 3CCVS 4IF4A 4G7HF 1SMTA 3KLOA 5D5VB 1QGPA 5HLGA 1KU2A 2KJCA 4WXHA 2FNPA 2W24A 3NNAA 1KYWA 1SFEA 1SD4A 3BO3A 3TQNA 4M6YA 2CPYA 3JAMK 4LG0A 3I55S 4ZYHA 3F8FA 3CUQA 2J0SD 3F6VA 5HDNA 2NYXA 3DPLC 2HR3A 5AIPA 1T6SA 2KRBA 4IRGA 5K5QA 3M7GA 2PMHA 5E1WA 4A8XA 3IRQA 3L00A 2Q8KA 2HYFA 4JK1X 5FO5A 4P9FA 3RYRA 3RKXA 1U8RA 3CC7S 2HTSA 1ZG3A 2F5EA 2VXZA 3GFIA 3HI9A 4G94A 3FM3A 2DNLA 3WTVC 2KKOA 3DKWA 1JE8A 1U1MA 1U5TA 4O6JA 2X1AA 4WF2A 1FBUA 1T38A 3JAMZ 3US5A 1AWCA 2X4HA 3F23A 1P4WA 1URNA 2EFPA 1TQPA 4C7QA 1BI1A 1FSEA 5FGMA 2LA6A 3S8SA 2IT0A 2JVRA 3O2PE 4A0YA 2DNQA 2KJBA 2QBYA 4LD5A 2LYVA 1RUOA 3CCUS 3M9AA 4LGWA 2EFWA 3P3DA 1FPQA 5LXRA 3MWMA 2QEXS 1D8KA 4OU0A 1HKSA 5GADU 3P5TL 2MXYA 2KIMA 2UXNA 2N3OA 3CULA 4BXUA 3E6CC 2KXFA 2CPZA 3J80K 4OZ1A 5LEJA 1STZA 1UHWA 2P6TA 5JHUA 4UV9A 4OZ0A 4U0WA 1P6RA 2UZKA 1WEZA 4LJZF 4AWXB 1L3LA 3THTA 3CUQC 3M8EA 5LRSA 2DGTA 1WF0A 2VBZA 5E8GA 4G8XA 5D8LB 1SXLA 1YG2A 4MGRA 1BN5A 3FXUA 3TKYA 3OOPA 1FX7A 2MB0B 1G2EA 2NLWA 5E17F 3FEXB 2PLYA 3IWNC 1XDSA 4KMFA 5J8FA 2MH9A 2BV6A 4TU8A 1U2WA 1HKQA 2AYBA 4BH9A 1XCBA 1B6AA 1ON2A 3KZZA 2YTCA 2DK8A 4YFXF 2KIUA 4HLXA 1T0FA 2L02A 2COMA 5ICFA 1JXSA 2GWRA 4HQEA 4RGXA 3ZMSA 2EA4A 3G73A 1CF7A 1RZ4A 4FXWA 1YHQS 4Q5SF 2OU2A 1YJ9S 2N82B 4KN7X 2A3JA 3MQ0A 5BOXA 1WWHA 1L0OC 5BJRA 2JT1A 4A0ZA 1J59A 5HS9A 1WHYA 4I01A 5DUIA 4I02A 3ZN0A 1S29A 2MMYA 1R5GA 1PO6A 1U5TB 4RGRA 5DCFA 1OMIA 4KIFA 5CJ9A 2VODA 1U2FA 4EM0B 3M1EA 2DBBA 1OPCA 1Z9CA 1U6GA 1PP7U 4WFNQ 1ODDA 2OSQA 2XRNA 2OD5A 1XDUA 2KVIA 2XKOA 2M9KA 2CQ3A 4ZH4F 2DB1A 1O7FA 1B1BA 5LHIA 1LDJA 3ECOA 3NNHA 2JPCA 5JVTA 1D3YA 1H2UX 3U1MA 2YU3A 3KP7A 2Y0MA 2OQGA 1RK8A 2FC9A 3NQOA 2QBYB 3PIPQ 2M8EA 1I6XA 2WV0A 3U2RA 5KK1A 2HZCA 5DCMA 2HKOA 3RJPA 3R61A 2V1UA 2A61A 3CCLS 5K1YA 3ROUA 1OYWA 3J7YU 3JTHA 5IM0B 1AOYA 2FSWA 1FBQA 4UNOA 5FFXA 2KFYA 2NRAC 1X5TA 4MHGA 2XROA 2OIHA 3V4GA 1VBXA 3I58A 3VEPA 3NEUA 1P4XA 3LSTA 3FXRA 5D5UB 1W7PA 2G0CA 2V79A 4CO8A 2W85A 4V19X 2LXIA 4R1HA 5DETA 1SJFA 5L3DA 4QU6A 1WEXA 1YFHA 2IJLA 4P5OA 1OKRA 1OYIA 4HZFA 2ACJA 3H3UA 2HQRA 4MTDA 2AYEA 2D45A 3UCGA 3BO2A 3C18A 1QZYA 2VN2A 4ZYDA 3B73A 4GGGA 3RI4A 1U78A 3UCZP 2F5FA 1Q82T 1IXCA 4L5JA 5GAGU 2E7XA 1MKMA 2MBFA 1U1NA 2CSOA 3ULQB 2EFOA 1USTA 4B09A 2H6CA 4BHCA 4WK8F 3N9UC 3DLLQ 3MZYA 4A6EA 1M1KT 2A6HF 1PP8F 1R23A 4KIBA 5F1RA 2DNHA 2KI2A 5DDRC 2MKJA 3S7RA 4BS2A 1RI7A 1SJ3P 5CVRA 2DHSA 3HSEA 4OIPF 2GA1A 1LDKB 4RU2A 3V7RA 4BAYA 2CQ1A 1ZLJA 2DGOA 2ZMEA 5HLIA 3EDPA 1FT9A 3KP3A 2KH9A 2PEHA 5ERIA 2FMYA 5H1SV 3GLXA 3V4MA 1SD5A 2HS5A 2R7DA 3CLOA 2WBRA 1B59A 3H92A 2FNAA 2RN7A 2RNJA 4HYEA 1FC3A 2Z9OA 1OYYA 2RT3A 1TNTA 4HV6A 3I54A 3LA2A 2VC1A 1PUEE 2J0QD 3TO7A 5AONA 2VT3A 4H0EA 2BZ2A 3PQKA 1MJBA 4QLCU 3FZVA 3MUVP 1F4KA 3QP6A 2MKSA 1XGNA 2BGCA 2XAHA 1R8HA 3L7WA 4CXFA 1ULYA 1FJEB 4I09A 4OMYA 2VE9A 1WQ2A 2Q2EA 3F8MA 3K69A 3KP6A 2FBHA 4HV5A 2JPBA 3C3WA 4DNCA 5EEGA 2MSSA 3E97A 1Z1DA 1RKJA 3WE2A 3TGNA 1U1KA 5L3BA 4MQVA 3D0SA 1KC8T 2XAGA 2DNNA 1IRFA 3KEQA 5L3FA 2L54A 1BC8C 2R7FA 5HL7Q 3T8TA 2P4WA 4N0BA 3RKYA 4L0YB 1KU7A 3LPYA 5D4RA 4WKRA 4E70A 3SXLA 2M88A 1WHVA 5LGTA 2DO4A 2XS5A 4G7OF 3CUNA 1YIOA 4FXVA 2N3LA 2L4MA 2CQDA 2ADUA 3HRUA 3QRFF 2LF8A 3ULHA 3FXQA 2FRHA 2V9VA 5HO4A 2CPHA 1X4BA 1VC5A 1HW1A 2B0LA 3GO5A 1U1LA 4LJMA 1B9NA 2MD5A 3CCQS 5JFRA 1R00A 1A9NB 3DEUA 2E5JA 4U7DA 1GXPA 3ERED 1YTYA 2HGCA 2G1DA 1SJ4P 2L3DA 2VBXA 4YIFA 1K78A 1TW3A 4HBLA 3DQVC 2F9JA 5HDKA 4A5MA 4EGLA 3CDHA 5GAEU 4Y00A 1VQ8S 1LDDA 3K9TA 1H9GA 2O61A 1X4FA 4ERDA 4XBFA 2CPIA 1VQMS 4LG0B 3C7JA 1HW2A 1YW8A 2DPUA 2K4JA 1G6NA 3F8BA 2L9WA 2GO9A 2HFHA 3R1LA 3HUGA 3GVAA 4Q48A 1E17A 3D5LA 1WI9A 3VAHA 2RVJA 1J9IA 3WG9A 4MEXF 3B4DA 5D5XB 1G3TA 4ZZLA 5FLXZ 2JX2A 5DV5A 1J5YA 3UD4P 2MH2A 1M90T 2CW0F 2QVOA 2VBYA 1F1ZA 2WC2A 2MZTA 2X1BA 2LCWA 3DFGA 1BM9A 2W84A 4HX4A 3HRTA 1XN9A 1VC0A 2R3SA 3QPTA 4FT8A 5TJJA 4WFBQ 2CPJA 1YIJS 2XNQA 3E3VA 1WG1A 4YFNF 1CGPA 4IXAA 5D4SA 1G4DA 1U3EM 2DW4A 5LHGA 1U1OA 3CMES 2M52A 4ETSA 1J0RA 4I98B 1SAXA 3O3KA 1ONVA 2ERRA 1FLIA 2ZNYA 1FZPB 3CO7C 2QFJA 1FNNA 3P9IA 2DITA 1WI8A 5DDGA 3KP5A 1Y0UA 4JQFA 5DUKA 3BJ6A 4EJUA 2DGQA 1XD7A 1TLHB 1QQIA 2JVOA 1TBXA 3GWZA 1VQ6S 1DRZA 1WHXA 3CCJS 5HS8A 1EH7A 2CG4A 4ENNA 3BROA 2FOKA 1HXDA 1I5ZA 4IUFA 5JVGQ 1VQ4S 3UCUP 5DM6Q 1V4RA 2OTJS 2D2WA 1R8PA 4M9XA 1P2FA 4I0AA 3ABTA 3I64A 4YUDA 1YJNS 4KT5C 3LA3A 3PFIA 3RPUA 3FM5A 5ILVA 2M45A 1R1VA 1QVFR 2VT2A 3NS5A 2EVZA 3IKTA 1WF1A 5IM0A 3MXHP 4KDPA 2DH8A 5CA5A 5F6FA 2M7SA 4EVIA 4ENJA 4HF2A 2EK6A 2SXLA 4ON0A 1R1UA 3ZPLA 2L41A 1S7AA 3V7CA 3VAGA 4WCGA 3R6SA 4KFCA 1UW4A 2ZNZA 1KOHA 3SDEB 3I59B 1Z6RA 1I1GA 1R22A 3MDFA 1X3UA 3JW4A 3BEGB 2QZ8A 3PIOQ 4WX9A 2DH7A 1XB4A 1QNTA 3S2WA 4NB5A 1XN7A 1K7AA 2FPHX 4M9ZA 2PEXA 3J81K 2G4BA 3OW2R 3MFKA 4HF1A 3R1HA 1HA1A 3GZ5A 1KQSR 2YKAA 1O3TA 1Z7UA 2RQPA 4L0ZB 3MEXA 3RW7A 1J2XA 2QENA 1TW2A 4ESJA 1HQCA 2HGLA 1QVGR 3BOQA 2K02A 1IAWA 1LNWA 3RYPA 2P5KA 1D5VA 2XGXA 1FHTA 3MAJA 3U9GA 1PDNC 3MZHA 5D6EA 1ZZNA 2FBKA 2EJRA 5CVJA 2MKKA 2UP1A 3WTWC 3H2VE 4M72A 2RQ4A 2CGPA 3K1MA 1U6BA 1HKTA 1ZREA 3G96A 3SZPA 3FX3A 3V8JA 3L2CA 2ZKZA 4L9TA 2KM8C 2CQCA 4LFUA 1ZLKA 2IP2A 4PZJA 3ECHA 1AUDA 1QO0D 1MJ9A 2FA5A 2OA4A 1XCVA 2DK5A 2CPFA 1MJAA 1BIAA 2XAQA 1S72S 1KQ0A 3ABUA 1GHCA 5L3CA 2LQ5A 5IT9K 2IVMA 3KETA 5DDQC 2PJPA 1YLFA 3WTZA 2ZJQQ 4YIIA 4UVCA 3FMRA 2DAOA 4LB6B 4OIRF 3LQQA 4I2OA 2GQQA 4GYGA 3BO4A 2DGVA 4O5VA 1YQAA 3BPXA 4A5NA 1UCRA 4EQQA 4ZKAA 5DD4A 5ILUA 2LKPA 4MNUA 1NJIT 3W6KB 1WEYA 4U88A 2MY7A 1A04A 1BI0A 1WELA 5A2QK 4FX4A 2MQQA 2HGNA 4ZZDA 2DNGA 4LLGF 2CYYA 1WF2A 3QPHA 3M8FA 3F72A 5LSLA 3CMAS 3KLNA 2MKHA 4B8XA 2F5DA 4OIOF 2MPUA 2PFBA 1DPUA 1P27B 2XIGA 1CF7B 2IA0A 3LQVA 3K2ZA 2STWA 2FHOB 1O57A 3IWZA 3IL2A 2K8GA 3LAPA 4EGYA 4GO1A 2HWVA 2P8TA 1H2VZ 3HOSA 2RNEA 3EGZA 3AAFA 4A6DA 1XSDA 4QQBA 1QM9A 4Y0FA 3HIFA 1BBYA 4M71A 2NAZA 1VQLS 1A7GE 1BJAA 3L3CA 2L4AA 1WHWA 2CPEA 5JR3A 1X4AA 1W7PD 4EM1A 3K0LA 3F6OA 2IA2A 1O0PA 2KHCA 3DXBA 3E6DA 3D2WA 4EMSA 1ZGAA 1UHMA 1MD0A 3MUTP 3ZMZA 3ISPA 1IXRC 3VB2A 1K79A 1X5PA 2EB7A 1VQ9S 4RB1A 5E20A 2HKXA 2JZYA 1IF1A 4MEYF 1WI6A 1SMYF 4UUVA 1X0FA 2P5VA 3L9FA 1ZZFA 2DNRA 2KYXA 1ON1A 1FP2A 2OBPA 3L09A 2DNYA 1DDNA 3NMRA 4CZZA 2LDUA 2DU9A 2VOPA 4RGSA 5GAHU 2BBYA 4BYYA 5FFZA 2H6BA 1WG4A 1HW5A 5JVHQ 2L08A 3CUQB 1M5VC 2K27A 3DPTA 2BE5F 1DHMA 4J5OA 1RUNA 3MD3A 3V8LA 1FYLA 3QU6A 2FMLA 4TLQA 5DDPC 3KEOA 1TQIA 2MZQA 2ZJ2A 2DPDA 1P1TA 1S3JA 1LJ9A 2NS0A 2EV5A 2O03A 1M5PC 4HF0A 2VOOA 3P49B 3Q5FA 1JJ2R 3VAKA 5LGNA 3ZMVA 2M30A 3RPQA 1KU3A 2ZJPQ 4IOCQ 1QPMA 2MZJA 3V7SA 1T39A 5CVIA 3UE2A 1N52B 1K9MT 3OV8A 4XRFA 3F21A 2K3KA 1JJ4A 2RS2A 3EETA 3GYHX 4M73A 2M1BA 2HZTA 2D1HA 1Z05A 2EV6A 4P9UA 4LMYA 1F9FA 3E5XA 2F5CA 1SJRA 2MQMA 2RDPA 3HHGA 1MGTA 2M5WA 4HDVA 2HYGD 5LXYA 2YPRA 1OWXA 2RGVA 4N9IA 1MDMB 2DIVA 2RQCA 3R27A 1VQOS 3WGGA 2ZMEB 2OSRA 1ZAOA 2IPQX 2HDCA 4L18B 2O0YA 3C1DA 1KQ9A 4LMZA 1FSHA 1JGSA 2BYVE 1J75A 3CC2S 2DI3A 1IN5A 3EQLF 2DHAA 1FBSA 1JHFA 2YX4A 1ZG5A 2QM3A 2MZRA 2FU4A 1ZRDA 1KD1T 2Y75A 2FY1A 2O3DA 2V94A 4G6DA 4FX0A 2VBWA 4PRFA 2KN4A 1XSVA 2XAFA 3RTRA 3P7NA 4KUMA 3GFJA 3H3ZA 2Z5UA 4GXOA 3TO8A 5LJ5Y 2XUBA 4ZYGA 5IT3A 1S7OA 2JSCA 1UP1A 2E5HA 5LLQA 4CH0S 1YJWS 3WTSC 1N54B 3PQJA 4ZYEA 4L9NA 2Z33A 1W7PB 1H2TZ 3HYIA 2KT5A 3R0JA 3KP2A 2U2FA 1P4AA 5D6FA 2NNYA 1OO0B 2A3SA 2FBIA 3EGNA 4C4WA 3GUDA 2DT5A 4WWCA 4PKDB 1N8RT 4BQAA 2FF4A 2V1DA 3IC7A 2EFNA 3WTXC 3WGIA 3RW6A 4AIKA 1VBYA 5BPIA 2RUGA 4DQ2A 2WWYA 3FMSA 5LSOA 2J8AA 2DH9A 4BHPA 5KVRA 1SD7A 3TO9A 2TDXA 1BC7C 1O3SA 1G3SA 3SMZA 2K7LA 4UV8A 5DCMB 1BY9A 2GAUA 4L9JA 5E18F 1DZ5A 4HW0A 2K4BA 1XGMA 1ZGJA 3VAJA 1YO5C 2OJ3A 2DFIA 5FB2A 4D0PA 4R79A 2CO5A 1H6KX 3ZP5A 1NHAA 2XVCA 3WTTC 5BS6A 2P7CB 4EM2A 1NU4A 2I2YA 3UWTA 5L3GA 1LEAA 1SJQA 5DD8A 4HA8A 3GEZA 1OPIA 1RNLA 2X1FA 2O8XA 4U7BA 3BDDA 4KNYA 4GCVA 2UWMA 3WODF 1S8NA 3T0YA 1USSA 2JRSA 2LECA 3Q2SC 2JWNA 4BHBA 2MYFA 2ETHA 2CQ2A 2ZXJA 2Q79A 3FF5A 1BIBA 1P92A 3HRMA 2MJUA 2PN6A 4A0XA 1M5OC 1FJ7A 1MDMA 3E6MA 1ZYRF 2YSRA 2PQ8A 4IVNA 3CCSS 2XV4S 3IHUA 3THPA 3FEYB 4HX8A 2MGZB 1SFXA 2J5OA 2DGXA 1FNXH 1FJCA 2PE8A 5K5RA 2E5IA 3Q9VA 3DXJF 2FEZA 3F22A 1W2BR 3G8TA 4F26A 1UFMA 2IRFG 1WG5A 3J7AO 4I0BA 1K78B 1KQ8A 4WCEQ 2A6EF 4I7HA 2MQPA 2A69F 2OZ6A 2DGUA 2LKZA 2MKCA 1IN7A 4KYWA 3SHFA 4S05A 5CVVA 2LXUA 5DDOC 4CQ1A 2KRRA 2MC3A 2Z99A 1R7JA 3GZ6A 2D1VA 3ZZZA 3RKWA 3I4PA 1U1RA 5E1ZB 4ENKA 2OTLS 1JJHA 1ZRFA 1DBDA 1BI2A 3I5UA 4QWQA 2CQHA 2XAJA 4GYIA 2U1AA 3HTSB 3MCZA 4CGZA 3BJOA 1LB2A 1N88A 5LRRA 1YW9A 3J7ZT 3G8SA 3WE3A 3ZQ7A 1X5OA 2DK2A 2XNRA 4EV0A 1Q7YT 5HS7A 2KXHA 1W5TA 3Q9SA 2M87A 2O6GE 1M5KC 4LLLA 2DHXA 1KU9A 1VQPS 2PG4A 4MQ9F 1ZRCA 3GX4X 1E2XA 2G7UA 2C6YA 3F8NA 1FO1A 4G9YA 4Q47A 1C0WA 3FWEA 3LQRA 2KG0A 2AD9A 1J7KA 3EUHA 1UAWA 3F3XA 4RAYA 3CF5Q 2H27A 2NZ4A 3Q2TC 3JSOA 4IHTA 2QUFA 2ADBA 5FJ4A 2XASA
chains in the Genus database with same CATH superfamily
2GAHC 3CCLI 1RTHB 2KRCA 2HVZA 1HNXF 2CRLA 3EPZA 3TP2A 2R7RA 2XCPA 4CICA 1SQEA 1RAGB 4I2QA 5I4MA 5E1XA 4CO0A 5FLXK 3X2QH 4M5IA 3COAC 3VAIA 2EKYA 3I9ZA 3QQAA 4LITA 4C98A 1AKHA 2G7HA 3SQNA 1UJ6A 4BHQA 1KHVA 1WKLA 2EC2A 1N33F 3BPDA 4QU7A 1SFUA 2C2EA 5D0HA 4P71A 3W60A 5KT2A 4E7SA 2NR0A 2QLZA 3QLHB 2B9YA 4XN0A 2LREA 1ZA1B 4ECVA 2PIIA 1PILA 3VSLA 4X4PA 3B8HA 4XPCA 2MGZA 3PW4A 4Z7YA 3CCES 1X4HA 2Z2MA 3VODA 4DSIA 2B51A 2W01A 2VPWB 3HVAA 1BOAA 1NKBA 2OV7A 1K83J 2CS3A 4RDUA 4JV5J 2HOEA 4C8KA 5JVGF 4P6QA 4XIUA 3V8KA 2PMZN 3RIRA 1KYZA 4IOAQ 1KA8A 4NEZA 3TA2A 2OD4A 1SAUA 1WJDA 2XB5A 5HQLA 1CC7A 4WF9Q 4B02A 4KIGA 2QLXA 2DNOA 3JB9k 1R8AA 3HDDA 4C30A 3DGVA 4K4YA 2GXBA 1WRJA 4A46A 3OL9A 2APOA 2HLTA 5FD6A 2PI0A 1SUQA 1E6VB 1F2HA 3BCBA 4MFDA 2CNKB 1IRGA 2DNZA 3SCJE 2ZHAA 4AIDA 4IHSA 2XY6A 2CWEA 1SC3B 2JJ4D 2QA4S 4WTYA 1REPC 5HOOA 2NREA 2DNMA 1FOKA 2HWHA 3BG5A 4FETA 4ZCLA 2NS8A 3MKLA 4ZPCA 4ECYA 5DYMA 3PYGA 5ITHA 3M8PB 1TWAJ 2KKHA 1HNZF 4J9QA 1KOOA 1TT5B 4P72A 5D77A 1VQ5I 4QR0A 4YFKF 3PW2A 3OYAA 2CQ4A 3LL7A 2HHHF 2DISA 2P9EA 3D3BJ 2I6WA 4C11B 4J00A 3HJFA 1O7LA 1S1VA 3OTCA 2L01A 3MR7A 2Q0OA 1X0PA 4ED7A 2X1GA 3ELKA 2KT0A 4URGA 4HHJA 5A6WA 4Y28C 1QU3A 2EBIA 2KXNB 2UXCF 2VONA 3MMCB 2J0XA 1RSCA 1W5CC 2AZ1A 2EFQA 5FRNA 4ELTA 2NXCA 3D6TB 2HNYB 3HG9A 2J7KA 3BKFA 2HHWA 4LB5A 1SH3A 3MMJA 2DA2A 3ZQLA 2YQ0A 3EVOA 5A6PA 3AD7C 5AE1A 4BNCA 3S3OA 2GVZA 1Y4ZB 4WXCA 3KLGB 2V5HG 4UOFA 5HJXA 2ZZTA 2IRYA 2HPUA 3LO3A 1K47A 3M8ZA 2ZC4A 3ENQA 2LP0A 3V6KA 2BE9B 2HIQA 4E8UA 2L9VA 4Z37A 3WHIA 3ZMUA 3GG0A 2OFGX 5D5WB 4DG1B 2XF5A 1TUWA 4XRMA 2QC3A 2NXNA 2LBFB 2BW2A 5AT1B 3BJAA 4A12A 3VTIA 3J80Z 3T19A 4MTEA 1W0UA 2F9DA 4X84A 4BY1J 2GQCA 4RB0A 3KLIB 4YOEA 4MFBB 3DLKA 2Z1DA 1OIAA 2V68A 2ZC3A 2J5PA 2OCCH 5LEKA 1MROB 3G1MA 5MLCV 3OSPA 1XSXA 2CFXA 3W2VA 1HNZJ 3FSXA 1Z2LA 4RS8A 4DV2F 1HSTA 3MI7X 1AZSA 3NMAA 4L75A 4QIGA 1IN4A 4X4QA 1R71A 1V5FA 3M32B 2RU3A 3FJ2A 4J9KA 4B3TF 4ENMA 4DR3F 1UB9A 3K4CA 2DDBA 1MNDA 3JAMY 2W9BA 1RAIB 4NWBA 4ZIWA 2B9SA 5E5NA 3WTYC 4FZVA 1UVMA 1JLEA 4KJZA 1P1LA 3NAUA 1SBRA 2IC3A 3GF2A 1U2CA 5DLFA 1YHQI 1MBFA 4K4SA 2ID6A 4CIOA 3E8OA 2MKIA 3GTMJ 1S6LA 4C8YA 4ZDOA 3J7AY 3FK6A 3IP0A 1FY7A 2QYOA 1PBAA 3TEDA 2UUBJ 5E3OA 2EIJH 2YH0A 4MIMA 4JI2F 1VQMI 4KHPF 2EINH 4F02A 2LMDA 2D3OR 4CCMA 1UFWA 1Y11A 5E33A 5JMNA 2FZKB 1CJVB 3GXOA 3UI3A 4YB1P 5LHHA 4XDDA 1F9NA 2HQFA 1YJ7A 2NUHA 5KFPA 1DLOB 1ZN2A 5C4XJ 4PXCA 3L7PA 1JLEB 2B56A 2KU7A 3KUEA 3NRVA 3DYAA 4B3OB 2RKHA 2FGOA 3DP7A 1VC6A 4N77A 3PSIA 4JBAA 3LSMA 1RTHA 2MABA 3GTOJ 5CCLA 1DQ8A 5EN1A 5ICEA 1WZ2A 2GHVC 4DUZJ 3C8YA 1KN6A 3BLYA 2DO0A 4GMKA 4C8LA 2Z30B 1QZZA 1M0SA 1VQLI 4QPOA 1U6FA 3SXYA 1NK6A 3D6MB 1FXLA 3RB0A 1TTYA 3D6FB 1X4CA 3I4NJ 3PZPA 5JLXA 1VOMA 4XLFA 1ZR4A 2W4PA 2AGOA 3KP4A 2VQEF 1JLFA 1DPRA 2OZUA 1WJ9A 2AYMA 2RQKA 4WZQA 2ZFHA 4CI0B 3VVUA 4LIVA 3HSZA 3A02A 3S93A 4URSA 1IN0A 2LVSA 3FRZA 4P10A 2YNIA 2DVIA 3CDUA 4RAZA 5HLHA 1H72C 5E3QA 2K9MA 2CNLB 1PYVA 3BSNA 2RC4A 3A3NB 2V4RA 2DTRA 3BPVA 3CTAA 4L5IA 1TL1B 3HSFA 1NK3P 1YS6A 2N7YA 2UUTA 2HDDA 1NJZA 2F2EA 3M8QA 1RT3A 3FZBA 3HHLC 1YWXA 3FVYA 1XEZA 2HHUA 2EFVA 3SQGA 4RB3C 3CUOA 4XNFA 2QSGX 2PBIA 3GZNB 2V1NA 1P7IA 2Z2SB 3CW2C 4OOIA 3DOLB 3TYTA 3FK7A 3ZXSA 4DHVA 2FYXA 2LVWA 2OEKA 3DCFA 4BGDA 2ISYA 5ETQA 4AYBN 2B43A 2EC0A 2CPXA 1J2VA 4FYXB 3KZYA 1O3QA 3K6GA 1Q1HA 4AIJA 3CTRA 2CQKA 2D69A 2OI2A 1AW0A 3KK1A 1R5ID 2E5LF 4ZVQB 1KGSA 1G3WA 1G59A 3DBHB 1N34J 1HL6A 4IOBA 4R5PA 4QWCA 1B0PA 3DLLF 1X19A 1UZDA 4LSNB 2M8DB 2QSFA 5HVQC 4QIWN 1VTNC 3OFHA 4Q4ZF 1CULA 3N97A 4BL0B 2XB0X 4XR6A 1BMQB 1NBEB 1V3SA 4ZC3A 3W61A 5C24A 3ZMDA 3CJKB 4U0VA 2GIQA 2EV0A 3QIPB 1VQ5S 1NRKA 4RW7B 4QR1A 1X4EA 3LWMA 4CNZA 2DA1A 4M3GA 1DARA 1E0EA 3NNCA 5LSRA 2BOPA 3H0DA 3HHLD 4PGHA 4A2UA 2N7CA 4UVAA 4H4OB 1S77D 4C3LA 2WAQA 3A1YG 3ZN1A 4IFVA 4FNIA 2M4GA 4CYCB 3ISNC 4IF4A 5D5VB 3CB4A 1QGPA 1PUFA 1KU2A 4JI0J 5B0DA 2MSYA 3D1QA 2FNPA 4NXMF 1SD4A 3TQNA 3K7RA 4RWXA 3CO9A 3JAMK 3I55S 1BOBA 1QSLA 2J0SD 2QSFX 1NK9A 4UY85 1V54H 5AIPA 1T6SA 3AJ1A 2ASLA 5K5QA 3JSBA 4C8OA 5E1WA 4ALZA 3VSKA 4A8XA 4DFKA 4ZVPB 2XLIA 3L00A 4JK1X 5FO5A 4P9FA 3S16J 1HOMA 2V9PA 3RKXA 1JLBA 2HTSA 2F5EA 3BN4A 1IJFB 2ACYA 4G94A 3QGIA 2HVSA 2HG4A 1LQ9A 3FM3A 4RMNA 3LANA 2CW8A 4NC6A 2Z2ZA 2KKOA 1R0AA 3DKWA 1JE8A 1PJ7A 1QVTA 1P4WA 4R25A 4IRKA 4C7QA 4KT0C 1JLBB 4PJNA 5FGMA 3D9BA 3S8SA 2CJXB 3O2PE 4H4KA 1Z77A 3QSIA 3KLHA 4LGWA 4Y2CA 1PYSB 3JRDA 3P3DA 2RAEA 1H73A 3MEDB 5CQGA 3MWMA 3G6EI 1HQEA 4LR9A 3A01A 3HXMA 3CULA 2KXFA 1I39A 1UZCA 4OZ1A 5LEJA 2GOMA 3FMBA 3HM5A 1DP3A 1LFBA 3ISND 4OZ0A 4RJVA 3W9HA 1P6RA 1WEZA 1OMSA 1OYEA 4BC7A 3M8EA 1Q8BA 3A8IA 3QOEA 4FASD 2NPFA 4BLGA 4BDPA 3Q8YA 2NLWA 3FEXB 2CJYB 2WADA 4DLGA 4KFBA 2PLYA 3V6JA 2VFRA 3MZIA 2BV6A 4TU8A 4LF4F 3K5MA 5F8MA 1HKQA 4OYXA 3BQ2A 5L1LA 3JTPA 1ON2A 3KZZA 1U48A 2DK8A 5JJBA 2GXAA 1T0FA 1SL0A 2GJIA 3OXLA 4M6VA 3U7JA 4HSRA 4E7IA 2EA4A 1CF7A 1SKRA 1VDHA 1YHQS 2I5UA 1YJ9S 3KUGA 3KLHB 3HOWJ 3MQ0A 3DRRA 5BOXA 1WWHA 1L0OC 1A0OB 3RQIA 1Q16B 5BJRA 2JT1A 1EJ9A 4EO8A 3RSNA 3IBCB 2DT7B 1OISA 3MHYA 4TVAB 1QD1A 3ZZUA 5DCFA 5CJ9A 3C2GA 3UR0A 2OHDA 3U27A 2V4JB 1PP7U 2EG2A 3SEQA 1XDUA 5AJ3F 3D5RC 4D5CA 2DB1A 4JI5J 2DOAA 4JV1A 2IY5B 4HACA 5IY5H 4Z6YA 3IUOA 3NOCA 3K4KA 3MTJA 2L9SA 1H2UX 1VQNI 2ID3A 4BQNA 2GHWA 1FRKA 3M07A 1KTQA 4UT4A 1PAUB 3UVJB 3JRCA 2R2TA 1F1BB 1TKZB 5CQEA 3HD1A 2NVYJ 3TMOA 5GP9A 1SH2A 2BA9A 3MECB 2HW3A 2PT0A 1M1HA 3CCLS 1WD6A 4A3MJ 1T9YA 4X4VA 5B09A 3G6YA 3UR3C 4UQGA 2JA5J 2HNDA 2ZZNA 2QX0A 4DN9A 5IM0B 2HDWA 1YRTA 2FSWA 4UNOA 3QO9B 1NB7A 4LSLA 2LQ9A 3FSIA 2OIHA 2ZBQA 2DYRH 1VBXA 1RYSA 3NEUA 1JWWA 2N4CA 3LSTA 3FBCA 3BQ0A 4U95A 5LMNF 2W85A 3PJRA 2ZH3A 5DETA 4QU6A 3HKZD 2Q3PA 3BM7A 3A1YA 1HC8A 1UPPA 4ELUA 2GZOA 2XCAA 4KHMA 3CSKA 3HOVJ 3OYDA 2OLWA 3ZTOA 3IP4B 2ELKA 1YJVA 1GXLA 2VN2A 3GCMA 3RI4A 4NX9A 1U78A 1U09A 3UCZP 1FRIA 3M1CA 1Q82T 1IXCA 2GIZA 4EEYA 2KFDA 5GAGU 2E7XA 2AJFE 1MKMA 2MBFA 4O4GA 1U1NA 3OMYA 2EFOA 4OV6A 4B09A 4J9PA 2H6CA 4NQWB 2UXBJ 4BHCA 4WK8F 4USIA 4TXSA 3MZYA 1ORKA 1GXUA 1M1KT 1UELB 1PP8F 2QLBB 4KIBA 3GTQJ 4LF9F 2DNHA 3R7BB 1YK9A 1KP6A 3DOLA 5CVRA 3U1NA 4OL8A 5EDNA 1DLOA 5H9FJ 2XMTA 4LF2A 2CQ1A 2DGOA 3W9IA 2ZMEA 1U2RA 2KH9A 1CJVA 1RTDB 2FMYA 3F41A 3W5YA 4L73A 1XJWB 1K0TA 2AHQA 3BQ1A 1GDTA 3MVPA 3W64A 1FC3A 5GAGJ 3I54A 1VYAA 3R8YA 3AFHA 1N5TA 2VG6A 5K14B 1HWKA 3WX4A 2OF7A 3TO7A 1PBUA 2VT3A 2BZ2A 4DV7F 1RT1B 3W5ZA 1SJ1A 3OIOA 1MJBA 4QLCU 2OUMA 2M0CA 5KFSA 3JRFA 3BGRA 2MKSA 2BGCA 3BN7A 1KHWA 4I09A 1ZPWX 2EH3A 4WP3A 5C25A 2HOTA 1QSYA 1N6QA 3C3WA 4V19J 1RLDA 1T05B 4BBSJ 4DIQA 1WKKA 2GAGC 4LFBF 3NGRA 1Z1DA 4JI8J 1RKJA 3V42A 2V26A 2G9OA 4XAKA 4DFJA 1JLFB 5FKLA 5KFGA 1UZHA 5DJBA 2J9EA 3MZ8A 4UOCA 3QFHA 1V3RA 2L54A 4M94A 4C3HJ 5KAKA 2P4WA 3RKYA 3QYEA 1KU7A 2LEPA 2A2DA 4M5HA 1WPKA 2G1HA 3MR3A 4WKRA 1QPIA 3I31A 1WHVA 1U26A 2OPTA 5LGTA 2XS5A 1EP4A 2L4MA 3JRHA 4HLBA 3HRUA 4HG2A 3QRFF 1NG7A 1BR4A 3ULHA 2YNIB 4KGKA 3MAAA 1X4BA 4WTOB 1HW1A 1D1AA 3I56I 2YWHA 4D3HA 3VVTA 4FF1A 1FDBA 2O1PA 2Z0GA 4OJ3A 4CLFA 5JFRA 5K5MA 3ZZRA 2WBMA 2PA3A 3DDNA 4ES2A 3VWBA 3SYTA 1MMDA 1K78A 2VLAA 3OFEA 3BR6A 1TW3A 1KZHA 3NL0A 2WOMA 4DZDA 3EVWA 4A5MA 3AT1B 3HUGB 5E3RA 5CYQB 1VQ8S 4GRSA 4XBFA 3E1SA 1S6OA 3GB0A 4LG0B 3T1YJ 1V5IB 1YW8A 2K4JA 5TGTA 4DLEA 3EXCX 2HFHA 2D5VA 1WI9A 5A8RA 4FF3A 1J9IA 4JI7F 3CC2I 3B4DA 1G3TA 2IRXA 1XC9A 2HHXA 2UXDJ 1RHKB 3BTLA 5CD4A 1S7HA 3KYDB 4LR8A 2VBYA 4ID5A 5LL6d 1Y1WJ 1F1ZA 1XC5A 3T1HF 4NI2A 2G0JA 1JUMA 1RBAA 5CZXA 3TANA 3CMMA 1YX3A 2W84A 1NSQA 5HMYA 5GMDA 4HX4A 3HRTA 5AE3A 5HROA 1VC0A 5FLXY 4FT8A 5TJJA 3LGMA 2HK3A 4F3QA 5ETKA 3P8BB 1A36A 2E60A 3J7YI 3IGVA 1R8BA 3OBIA 3HD2A 2I5JB 5LHGA 4F3OA 3CMES 1UJ8A 2HVIA 3FDYA 3QYBA 1SAXA 1VCTA 1ONVA 3L1PA 2ERRA 4DZPA 3CO7C 1T8EA 4FN5A 4WKYA 1FNNA 3P9IA 3CDAA 3ILOA 5DUKA 4EJUA 2GX8A 2V63A 2VI6A 3O2IA 2Q6BA 3GWZA 1OCZH 2R8IA 2CWKA 2HQAA 4X64J 2XF7A 2JJ7A 5HS8A 4UUSB 4QWEA 1HNVB 5GPAA 2XY5A 4XDCA 4I6AA 4FQGA 4PQUB 4IUFA 5JVGQ 3UCUP 4DXLA 2D2WA 5E79C 1R8PA 1VK3A 2CVIA 4M9XA 4I0AA 1VFJA 3ABTA 1DGRM 2OEJA 3H42A 3PFIA 3RPUA 3MEGA 1ZM9A 2TCTA 3ESWB 2GVZB 2VT2A 1V5VA 1S9GA 2EVZA 2JFDA 3FBFA 3IKTA 1FKAF 3MXHP 3MM7A 3WU2C 2QKLB 1U9OA 3PEHA 5CA5A 2UUWA 2HRYA 1PVEA 4NYZA 3ZC4A 2LKXA 1YX2A 4DV3J 2FVRA 4DPOA 3V7CA 5M5WJ 5KG1A 3R6SA 2NXJA 2KVQE 4ZVHA 1VIXA 1H74A 2ICWG 4E7KA 3I59B 4OFZA 4CCKA 1IBLF 1NK8A 5TISC 3GFYA 3JW4A 3TBIA 1Y3JA 1JQGA 4NA3A 5M2UA 3PIOQ 4WX9A 4LFAJ 3J7AN 1QNTA 5CAAA 2VQLA 3M6WA 4DU7A 3AD9C 5EHHA 1PKUA 2DXDA 3V5RA 4P2MA 3TQEA 4U87A 1HBOB 1HA1A 2PO4A 2YKAA 1HCRA 2HFOA 1Z7UA 4OHYA 4DPXA 1J2XA 1TW2A 4UUWA 4N41A 1QVGR 1RA7A 1I3OB 5J2PB 1VQ8I 2QSWA 2YKNA 2RREA 1WFXA 1IAWA 1LNWA 3MM7B 2P5KA 1FHTA 2BM1A 2W7AA 5LMUF 3RPUD 3JYTA 1BR2A 5F0CA 3QGGA 4QSHA 3DDKA 1HMVB 1FNMA 2EJRA 5GTHC 3CT9A 5CVJA 4C2UA 4WJBA 1I94J 3WTWC 2O7OA 2VQFJ 5GADI 1U6BA 2DR7A 2OMLA 3OJSA 1B0TA 2GMLA 4B9UA 4LFUA 3MPVA 1ZLKA 2XMVA 1RHRB 3ECHA 1MJ9A 2OA4A 2DK5A 4CLKA 1MJAA 3MOZA 2XAQA 3HPOA 4AL5A 1GHCA 5IT9K 2HNHA 3X1LB 5EWFA 4NZ7A 4HPQA 4C9YA 3KETA 1SKSA 4KJIA 4DN0A 2PJPA 2BABA 2ZJQQ 1Z67A 1UL3A 4FBTA 1HNIA 4KO0A 4OIRF 3KEYA 1C4AA 1SVMA 4O5VA 2R92J 3BPXA 4A5NA 4EQQA 4ZKAA 2CQQA 5DD4A 4O23A 5ILUA 4XRSA 4MNUA 3W6KB 4HI1A 1D09B 4C8MA 1REVA 3QPLA 3MEGB 2OGUA 1WHUA 3NGTA 4LF8F 3QPHA 3DHXA 1J5EF 3M8FA 3BSOA 2RQMA 1OYDA 2MPUA 4B8XA 4B9SA 3CMYA 4KGVB 3RAQA 4A3BJ 1VQPI 4PG5A 2IA0A 1OY6A 2STWA 1P9YA 1O57A 3IWZA 3KK3A 4F04B 3HPHA 3VGTA 2P8TA 4ZVSB 3EGZA 3HZGA 4A6DA 1AKHB 3QODA 1IRXA 2DMNA 5A0YB 4XLEA 4M71A 3UN3A 3CDEA 1BJAA 2IIHA 2J5AA 2L4AA 3VDXA 1VRQC 4ZPTR 3IAS2 1X4AA 2NVTJ 4EM1A 3F6OA 2XHCA 2ACMA 4A8YA 2UV1A 3D2WA 5KAIC 1ZGAA 3OIQA 4ZP6A 3MUTP 3ABMH 3ZMZA 2COLA 3VHQA 1K79A 2B8QA 2EB7A 4HHUA 4B3RJ 2C3UA 3OQ2A 2E1OA 2VG6B 3ZFVA 5EGYA 3M4OJ 1S59A 1VQ9I 3BR9A 1X3ZB 1ON1A 2DNYA 4PXEA 2VG7A 3HVRA 4CZZA 1S1WB 3PX6A 3EUAA 3DLAA 1WJCA 2VOPA 4RGSA 4IYQA 5HNHA 5GAHU 2H6BA 2OP5A 3DPTA 2BE5F 1DHMA 1RT4B 3LFUA 3V8LA 1FYLA 3KUHA 1UHSA 5B7WA 3CCUI 3AG3H 1NJWA 1RT6A 4B9LA 1P1TA 1TKTA 2NS0A 3T1YF 3A0BC 1M5PC 1TT0A 3Q0AA 3P49B 4OZJA 3NGSA 4PG4A 4HNUA 2RQQA 1UEVA 2C2DA 2M30A 3RPQA 3A8JA 1KU3A 4IOCQ 1QPMA 2IYIA 1T39A 3S32A 4F4YA 2VU5A 2V4QA 1N52B 4AU7A 5HLFA 1TUGB 4XRFA 1S1XB 1Z21A 5D4LA 3GYHX 2M1BA 1B0VA 1WJFA 2VF3A 2DY1A 4S0MA 3DFEA 1Z05A 4ZCIA 2EV6A 4A69C 4K8RA 1PC4A 3A13A 1GNKA 3CMQA 4PG7A 5B0BA 1MGTA 3GFXA 3KJVA 3QT5A 1HBUB 3CCSI 1VK8A 3G4SI 3A3PB 2EI5A 1VNDA 1N6QB 5LXYA 2YPRA 1HR0F 2RGVA 3M9MB 1XMQF 2ZWOA 1F9HA 3SSQA 1RT2B 2J7UA 2ZMEB 4U8VA 2V69A 1NH7A 5LMUJ 1SVDA 2HRTA 3GSIA 4HH0A 1NHVA 2DXEA 1JGSA 4GFBA 1J75A 3CC2S 3HT3A 5C7PA 1IN5A 3DU5A 1LUJB 2HPIA 1VRTA 2ZEJA 2V2KA 2C42A 2YUSA 1YIJI 4FCYA 4HR2A 3W7BA 1ZRDA 4II3A 3IBWA 3V4IB 1HARA 4DQQA 3RZAA 2XAFA 3RTRA 2JMWA 3HFZB 3PO4A 4OI4A 2Z8QA 3TW0A 3EGVA 1HBNB 5IZHA 5IT3A 1BQMB 4JX5A 1HPZA 1S9EA 5LLQA 4KV8A 3WQPA 3WTSC 2BY0A 1Z3XA 2IA6A 4FP9A 4XLCA 3PQJA 4OHVA 4EBEA 4X4NA 5A8WB 1RTDA 2Z33A 1MG7A 1HYSB 4FTHA 5IS2A 2KT5A 1IXKA 1RE1B 2IPOB 3RQ4A 5IYCJ 3GUDA 4WFXA 4RKUC 1ICEB 2ABYA 2AJ2A 3MGJA 4P9SA 4NLSA 3EMTA 4DV1J 3RCOA 4AIKA 2IS2A 4LRAA 1VBYA 1W7WA 4W4MA 4ILRA 4DQ2A 3AH6A 1GV2A 4FXDA 2J8AA 2BY3A 2ME0A 4NBQA 1G3SA 1S6QB 3SMZA 3PVXA 4DF8A 5EDWA 5EWEA 4KGZB 5CH7B 3SV4A 4V2FA 3PIOF 1J5OB 2HVQA 5RUBA 2KZVA 2PSZA 3TEGA 3ILIA 2JEGA 3VYTB 4C48A 3J81Y 5BS6A 3H9GA 1IV6A 2TRTA 2RNGA 3L2QA 2RE1A 4HA8A 1FVSA 3GEZA 1RNLA 3AD8C 1MU2A 4GCVA 2UWMA 3WODF 1S8NA 2F4VF 1D1CA 3DEEA 1S4FA 5LMNJ 1SKUB 1HFEL 2JWNA 2MYFA 1NSKL 1BW5A 2R5ZA 4CLYA 1RWOB 2Z58B 4Y7NJ 3OR2B 3ICLA 2MJUA 3QT7A 1NK5A 3I9V2 1UW9A 2C22A 2L3MA 1GMWA 3CCSS 2XV4S 2UXDF 2UVWA 1VR6A 4PFPA 1NHUA 3THPA 4DGWB 1FRHA 4E2FB 1KS2A 1D0ZA 4KH1B 4EYHB 5DGAA 1W2BR 3G8TA 5HQMA 1VI7A 1BL0A 3IG1A 3F44A 3R5DA 1LVKA 5B66C 1ZTRA 1X1AA 1UG2A 2A69F 2BW3B 3JSMA 4GO5X 4S05A 5DQGA 1RT7A 5DDOC 1ZETA 4CQ1A 2H1KA 3AB4B 3PO5A 1U0SA 1CS4B 3ZZZA 3RKWA 1EJ7L 2VG5A 4Q5VA 3QRQA 1BI2A 2O8KA 5KFLA 3MFIA 3QJJA 1T3OA 2CQHA 3PEJA 2U1AA 4BWJA 4G12A 3LOUA 2ECCA 5IOYA 3MCZA 2CA9A 3CCMI 3JSMB 1S0VA 4ZHRA 4FVMA 2HMIA 5LRRA 2DT9A 2E71A 4ED8A 2E19A 3G8SA 2FJVA 2DJNA 4YY3J 1M1GA 3W66A 4EV0A 5ETLA 1Q7YT 1LXNA 2FZCB 2XWYA 1W5TA 2QLFB 3KHLA 4LLLA 1ETQA 5HP1B 1KU9A 4ZLNA 4MQ9F 1ZRCA 3R2CJ 2C6YA 1VGYA 5L1JA 1FO1A 2HHVA 5EF6A 4G9YA 2HMIB 3FWEA 3D1OA 3H5UA 2OCEA 3JQJA 1LWEA 4ZK7M 2CV1A 4B3RF 4AYBD 3LP1A 4D7MA 2CJAA 5EJCA 4LBHA 5E8IA 1TV6A 3TO6A 3C15B 3ZZYA 1FOWA 3LAJA 1LWXA 1JLCA 4AD6A 2RF2B 4OJHA 3MURP 3DXSX 1KWMA 4M63A 3G4SS 4KY3A 2AKWB 5ICGA 2BW3A 2F8MA 2Y8YA 1JT6A 4KTQA 4EGZA 4N47A 2A07F 3A01B 2PMUA 2EA2A 2PC6A 2GZWA 5C24B 4AL6A 1JMTA 1RESA 4IHWA 4JX4A 4M3FA 4F67A 3BT9A 3S6EA 3J81Z 9ANTA 3BZ6A 2VFVA 1LVAA 4O44A 5H20A 1IW7F 2W9AA 2YU9J 4HNTA 3NS6A 1W4MA 2JLFA 1EETB 2CADA 1XGSA 2BXJA 4YG2F 2NCKL 3LP2B 3HHNB 4YS2A 4OX9F 4LF9J 3F9KA 5LOQA 1RKWA 2HHSA 2FVCA 2XB2D 1R43A 4HLYA 4BQOA 4USVA 3MN2A 3OT9A 2OPPA 1R0AB 2DHGA 2E1CA 1VBKA 4XLHA 4QOTA 1T2KA 2LMIA 2DY9A 2ZOFA 1F5CA 3MD1A 5J1EB 1EH8A 3RYLA 4TU7A 4R8HA 4S04A 3WHCA 1SC4B 4RW6A 1RWUA 4W1UA 4DX6A 3N05A 2J6TA 2WSEC 2C2KB 3IRWP 2WAFA 5KFEA 3LFKA 3G6ES 3NCRA 3JSYA 3GCWP 3IWLA 3TARA 2OPQA 2VQFF 2DRAA 1NJYA 1F6TA 2RV8A 1RAOA 2V8PA 2WAEA 1YYVA 1H0MA 2RHQB 3M05A 5HVGA 4EWTA 1GV5A 2FLPA 4AXIA 2XLKA 1IKVB 4HH1A 5H9FK 1LWCB 4OJGA 1A6QA 4OINF 1JKPC 3K5LA 5EEAA 3K0JA 1N5QA 4DR4J 2XHKA 3D66A 1GT0C 3DCAA 2VJJA 3GJSB 1WUUA 2UVUA 3H2UB 4W90B 3A4TA 3GTGJ 1X60A 4DYCA 2L7FP 4RGUA 1WWXA 1PJ5A 1QUPA 4J9RA 3F8CA 3RZDJ 3PG9A 2CZVC 2JSPA 4LK0F 4O3MA 1NB2A 1SI9A 2DCLA 5HJYA 3LA7A 1RR7A 1KVIA 1BE4A 2PJRA 3RAMA 4M5LA 3RDIA 4PDKA 2E2JJ 1TQMA 4J9UE 1ZAXA 3PL8A 3KE2A 2D9OA 1S1TB 1SC1B 2DCUB 4WU3A 3FXOA 3J81j 3FDSA 2VH7A 3QMQA 2ESHA 2H4WB 1FDNA 1FD2A 2IW5A 4DV3F 5KCMA 3H2LA 4HNVA 2Y1JA 3O6BB 2GXGA 4OV1A 2VKZG 2VZ9A 4B3OA 4ESFA 5IV3A 2OKQA 1VRTB 3Q8QB 2O3FA 1RT2A 1ZK8A 1X9MA 4LRFA 1TKTB 4CLTA 4FF4A 3G8QA 1H7WA 4YMEA 3THVA 2R93J 1H9TA 1IXSB 5JHFA 2VL8A 2B5JB 1RT4A 1HSJA 4ZLPA 4RNNA 3N6NA 4P75A 3E0JB 3HFVA 1VQNS 4OJ1A 1IN6A 3EX7B 1RT6B 1SQFA 3A03A 1CVJA 4NLYA 1FCAA 2M4KA 1ZHFA 3LSGA 3ZZPA 3BF4A 3I56S 3AOCA 1URRA 3TI0A 5HI7A 2QWWA 3BR1A 1B7FA 1Z1ZA 3JQKA 2QMXA 4IPAA 2V9KA 3MM9A 4X66F 3KZIC 4ZDPA 3S01A 3G9CA 3LAKA 3CD6I 2B9XA 3BQZA 1JHHA 1O4XA 3HSRA 2R2UA 3UD3P 3IRRA 2GA2A 3OYKA 4CSWA 2WY7Q 1MBJA 2HQGA 2N8GA 2VPRA 1YW7A 4BS9A 4IHXA 2XMMA 3T1HJ 5I42A 2MJNA 2H48B 3CPWR 5EGOB 2RMLA 3DRSB 3ET6A 3LW5C 4QIVA 2FJXA 3EZOA 1CQNA 2IA1A 2IRUA 4CH7A 4NZ0A 1WACA 2J76E 1RIOH 5KT7A 4F2RA 1WNEA 3IKVA 2YKPA 5GMKa 2VUMJ 4N8NA 1JXLA 5LBQA 2UVRA 3ZQHA 1NPKA 4HT7A 3CC4S 3BY6A 3EYYA 3G1LA 3KJVB 2VG7B 1J5EJ 3RTVA 4MYUA 3CJQA 2DA5A 3KFWX 1KLMB 4DSKA 1WC5A 1PGZA 2CQNA 1DUXC 1N36F 2NXEA 2BANB 4II2A 4NRTA 3V6DB 1ERDA 3KDNA 2I8EA 2AGPA 2FC8A 3K70D 1S0OA 2EZKA 5C42A 2D41A 3FCHA 4LK1F 2JA8J 4L6V3 3KLGA 3GFLA 4XN3A 1M5SA 1NSPA 1VQKS 5E41A 3QJPA 3CO0P 1JLAA 5A2QZ 3T5KA 1W36C 4H4MB 2XHWA 3N4WA 1C0UA 2AZ3A 1FESA 1H3DA 4PSWA 3DYAB 4U7UD 4KO0B 1FP1D 4Z2YA 5BQTA 5AXKA 1RDRA 3BKUA 1XPXA 1D9AA 2GVDB 4P55A 5FKOA 2HAFA 1Z6TA 2M3DA 5J4YA 3OTOJ 1A5JA 3K5PA 3WU0A 4QPTA 3VFZA 2OQRA 2HK2A 1R6RA 2EQRA 2FVQA 1VJQA 4O3NA 2ELJA 3GFMA 4OHWA 1YJRA 2IAJB 4FNHA 2HQ5A 1FEXA 4DMZA 1BI3A 4UHTA 1NMEB 1YITS 2P81A 2ATLA 2LSOA 1LWFA 4LF6F 3I82A 4I7FA 1LPQA 4JI2J 5KG0A 1U8SA 3EYIA 4BACA 2XC7A 1MSFC 3OVAA 4P1WA 2Q1ZB 2M7AA 2P6SA 4EJTA 1AA1B 4OX8A 4MIBA 1D1UA 1J09A 3TJ9A 2MZ1A 1ZTTA 2QCOA 4G6QA 2KM8B 2ISZA 5DEQA 1IBCB 1FWZA 3R0AA 2E5GA 4DV7J 3HOYJ 1REGX 3TWZA 4N5SA 4M9SA 2UZAA 2BX6A 5ED4A 1WC6A 2IGNA 1FWLA 5KT6A 1WSUA 3E5QA 4A8OA 1IBLJ 3L2WA 5B0CA 4U67Q 3CIMA 4OYOA 3RBZA 2D74B 1LW2B 2QQ9A 3FMQA 1YI2S 3KLIA 2K85A 3TUJC 3MPUB 5HBMA 1I27A 2HFVA 4HAMA 3JSPA 3Q22A 1Q78A 1SV5A 2HQNA 1HI0P 5MAOA 1K6OA 1TC3C 4I2PA 3S2HJ 4LF7F 5IOZA 1VIOA 2X0LA 1FT8A 2EG1A 2ADCA 5BR8F 1XIQA 5HLTA 1B4AA 4X1EA 3F0CA 2UXXA 3I0RA 3X3UA 5H9EK 3QU3A 4FKXA 5C4JJ 3T5XA 4CH1A 5FIIA 3HZJA 4J01A 1P7JA 4DBQA 5EUHA 2LKSA 4PJJA 1H0HB 2KRFA 4CO1A 1YSJA 4IOAF 5F64A 3P9KA 3M2UB 1GEHA 5M5XJ 3CC4I 1HNVA 2YX7A 4B9NA 1VISA 3AOAA 1IUYA 2AP6A 3MCMA 3P96A 4PGGA 2ZJRQ 3VOEA 4FPRA 2M0GB 1NM2A 3ITHB 4I2PB 1D8YA 3VF0B 3I71A 4XLPF 4EYIB 4KYZA 5KAFC 1E6VA 3BP8A 2KT2A 5C44J 3Q24A 2YWGA 4BE0A 4FVCA 1EA3A 1Z91A 5ILSA 5BMZA 3I59A 3ENVA 5EG0A 3UDVA 1S1VB 1XMOF 2BKOA 3DV8A 4F25A 2JHEA 3RRGA 2V2VA 4IO9F 3C66A 3FUYA 2MG4A 2V7FA 2FD2A 3KG0A 5ETRA 2NNNA 3B02A 2P7VB 2YWKA 4OZLA 1ZG1A 3D7SB 2XI3A 3HVTB 4LIUA 4G7HF 4LOCA 4EEFG 5HLGA 2HOAA 4NEYA 3S1TA 3WDOA 2WW4A 2NSBA 5EZHA 2MLXA 5A76A 1E3OC 3I5CA 3NNAA 1KYWA 1SFEA 2FQ4A 3VYRB 1S6UA 3BO3A 4A4JA 4M6YA 2V0NA 1WJBA 4DR6F 1JB0C 2CPYA 3I5AA 1LK7A 3GIKA 4LG0A 2F8EX 4CCOA 3C14B 1JKQC 4MYTA 3DKXA 2GVDA 2HHTA 4DL7A 3CJQB 3ADAC 2WOMB 5B1BH 2HR3A 1MSWD 4OYBA 1LW2A 2PMHA 2CZ4A 4DR2J 1F43A 3IRQA 2HYFA 2BW7A 3RYRA 4OYWA 4PUSA 1CJUA 3HI9A 1RWPB 4L3KA 3LSKA 2ZUGA 1IG7A 3WTVC 4O6JA 4WF2A 5F27A 1T38A 3BH7B 2XSJC 1AWCA 3KG1A 1BI1A 1NCLA 4ES1A 1TFYA 1QAXA 2LA6A 2JVRA 2DNQA 2KJBA 2QBYA 2LYVA 1RUOA 3CCUS 2DCEA 1YRNA 3PACA 1L3SA 5LXRA 3ZZTA 4JI8F 3WZ0A 3E2EA 2J9DA 1F5BA 2BKNA 4KB7A 2MXYA 2KIMA 1TQLA 2JFKA 3E6CC 3TAQA 4RUAA 1NSAA 3IR7B 3FKIJ 2FZGB 1STZA 3CJTB 4U0WA 2KDOA 1VQ4I 5KFIA 2B5JA 3OL4A 5BXIA 1L3LA 5IXUA 2XMAA 2R7ZJ 1N33J 4IEJA 4PWDA 2R7SA 4X6AJ 3BBCA 4X65J 1BN5A 3WC2A 3TKYA 4GDFA 1RWMB 3OOPA 1FX7A 1G2EA 3OUYB 2XZTB 4M8LA 3IWNC 1XDSA 4ANCA 4I64A 4AC0A 4KMFA 2AIRB 2XG8A 2BJ3A 1U2WA 2AEFA 1D1BA 4JBCA 1S1UA 1TKXB 2LY1A 1B6AA 1IO2A 2PD1A 2XI2A 1UWBA 2COMA 4OI3A 4G1PA 4RGXA 2DOEA 4CO5A 1YITI 4FXWA 3D3CJ 4KN7X 8RUCA 2A3JA 2RSQA 1FJLA 5E3MA 5DQHA 1X1DA 2QV6A 2D7SA 5C25B 1S9HA 1RETA 1WHYA 5DUIA 5J1RA 4PEOA 1R5GA 1PO6A 1U5TB 4LQ3A 2X1CA 4RGRA 3SCKE 4I56A 1OMIA 2R7UA 1T9XA 3M1EA 3IXQA 1FK9B 3BR2A 2JLEA 2DBBA 1OPCA 3J7Z5 3P4UB 1RT5A 2I10A 2OSQA 2XRNA 1ZGWA 3EVMA 1HWLA 2ECBA 1LDJA 2LU2A 3ECOA 3EDRB 3MM9B 4C3IJ 1D3YA 4PAAA 3EGWB 3AHPA 3K8WA 4F3MA 3PFEA 2HFSA 1T08B 3KP7A 2VKHA 2B4PA 3LTOA 1RRJA 3ZCOA 3HX9A 4AT1B 5HNFA 2YKMA 3S1NJ 3EXYA 1T03B 5KK1A 5KNLA 2HZCA 4ED3A 3K4MA 4J9MA 1HLVA 5IPAA 3ROUA 5K1YA 1IRZA 3PKYA 1SL2A 5CZVA 2LC2A 3GSDA 3LPEA 3TJAA 5F8LA 1EAYC 3CQZJ 4WIQA 1CLFA 3AL0B 3JTHA 2YY3A 4WPAA 4E0DA 1FBQA 2OPPB 4MHGA 4TQSA 4IG0A 2H54B 3VEPA 4KHRA 4DZ6A 2G0CA 2V79A 4XTTA 1TL3B 4NCAA 1C0TB 3T3FA 5C2GA 3DRPA 2MEWA 5L3DA 2ZE2B 2HS3A 2K9LA 4H54A 1OKRA 3H3UA 3BGFA 2HQRA 3OL3A 2AYEA 2D45A 1IBKF 3UCGA 4JI5F 4V19K 3IM8A 4ZYDA 3B73A 2OFHX 4DUYF 2WZ1A 2L7ZA 2H5IB 2CH0A 5KFWA 4L5JA 2E5LJ 4ENOA 4UUXA 1TFWA 3GU0A 4ECSA 3NOGA 3ABKH 2RHSB 1RWKB 1USTA 1G3OA 2Y1RI 4YFUA 4ITSA 3N9UC 3DLLQ 3H9JA 3QO9A 5EWGA 2FQQB 4IHYA 4JV5F 1SEUA 2M7BA 5F1RA 2GIFA 2NS1B 2J9DE 2V8HA 1RI7A 2BRLA 1AXQA 3PYFA 1NDLA 1SJ3P 2EFGA 2CQ7A 4I1TA 4DSEA 1FTTA 4YDXA 1ZLJA 5HLIA 4QIWD 1FT9A 3KP3A 5DS7A 1S12A 4WFZA 2PEHA 5ERIA 4X4OA 5CCMA 1T0TV 3GLXA 2F7VA 4QWAA 2R7DA 3BSCA 3CLOA 5IC4B 2WBRA 3H92A 2RN7A 2RNJA 3S1MJ 4ZP7A 2RT3A 2VFSA 3UVJA 4HV6A 4RLQA 3LA2A 2VC1A 3KLFB 1PUEE 5AONA 3CJ8A 2XSJB 4NUBA 3ZQGA 3T1AA 2KT3A 4UF4A 3MUVP 3AY0A 3QP6A 1R8HA 4K0KF 3L7WA 2HSEB 1FJEB 3V6HA 4NA2A 2BE2B 4OMYA 4UOHA 1YOVB 2B8PA 5B5EC 5F08A 2Q2EA 1HNXJ 2FBHA 2JPBA 4DNCA 5DM7F 2KLOA 1OY8A 3E97A 2ILYA 1TWGJ 1RUSA 3ZQQA 1E6YB 2QQ8A 3OYIA 1R9TJ 1ZBTA 4HI2A 1H7XA 3IN5A 2NOJB 2XAGA 1S57A 2RDJA 3F0NA 4GO7X 5HL7Q 2DFHA 2A18A 1BWEA 4WK3A 3VPRA 4L0YB 4Y2MA 2WA0A 2ZVIA 3MEDA 1F0XA 5D4RA 3LPYA 1DGWY 4E70A 2E2HJ 5J1EA 4QTRA 2DO4A 4G7OF 4E7LA 4XKCA 1YRUA 4FXVA 4F0KA 5HODA 2ADUA 4DFPA 2R8KA 4J9NA 5HO4A 1WVRA 2CPHA 5J2MA 3BGLA 2BDPA 4M3BA 1RT7B 4WK1A 1R00A 3HVWA 3L7UA 3FKJA 1TV6B 3C15A 2E5JA 4U7DA 1NH3A 1XNRJ 3ERED 2BOLA 2HGCA 1SJ4P 2L3DA 2CWXA 1TK5A 1EETA 2XQCA 4RLFA 2W7NA 1NK7A 1SPBP 2J7WA 1LW0B 4A8SA 4HBLA 2KRHA 1FJGF 1TAQA 3K4NA 4ZITA 4ERDA 5E0OA 4TKTA 2M8GX 1HW2A 5HK4A 4QJVA 2DPUA 2DA4A 1OPZA 1NEEA 3K89A 2JSXA 2X6OA 3DRXA 3R1LA 4NDLA 3D5LA 4LRBA 5DTDA 3JREA 3N79A 1Q53A 2DEIA 3M6VA 2QF7A 2AEMA 4MEXF 5D5XB 1LW0A 4N7TA 3M8JA 5DV5A 3L2VA 1J5YA 2MH2A 5B3SH 4HL9A 4LQ9A 4A93J 3VWSA 3FXJA 2WB1A 2XPUA 3G6VA 1EIYB 4O3RA 1VLYA 3HMJG 3DFGA 2V2ZA 1PUFB 4DR1J 1XN9A 4YN3B 1UMJA 4U6PA 1GQEA 4QYRA 2CJBA 4PXDA 1CJTA 2CPJA 1YIJS 2A05A 4B3TJ 2XNQA 2WVFA 1CS4A 4YFNF 3MCOA 3B6CA 3I96A 1U3EM 3DKDA 1U0HA 1O8BA 1ZELA 1RLCL 1B99A 4ETSA 1RU2A 1ZS6A 4CTAB 2AJ4A 4OI0A 1FLIA 1FZPB 2ZBPA 5K8MA 3HHLA 5E3PA 1WI8A 2KTQA 5DDGA 1HQEB 1Y0UA 4JQFA 2HAIA 2VUGA 1TBXA 3OJUA 4R5PB 3CCJS 2RD5C 1KQFB 1F3VA 1XTZA 1S6QA 3OS0A 5HATA 1GH8A 4L72B 1I5ZA 5C5JA 1ZA2B 3PRVA 5KT3A 4DX7A 1P2FA 2QMWA 3HVTA 2JDJA 3LA3A 3SFUA 3FM5A 3KKFA 1VQKI 2HQCA 3ZQCA 3QJLA 2WAQN 1RR8C 4KDPA 5F6FA 3OXGA 3IV5A 4ITVA 4HF2A 2LU1A 4ECTA 1R1UA 2KZZA 4YB5A 2L41A 4PUOB 2LQ8A 3OYBA 3VAGA 3ZNUA 4PWWA 5IQ6A 3JTNA 3EE3A 2VXDA 4QPQA 4Y65A 4DCOB 1KOHA 3SDEB 3A2KA 1KR4A 1R27B 1Z6RA 2GMJA 4IHVA 1FX4A 3MDFA 1X3UA 3BEGB 1WORA 3TJ8A 4OIXA 1U49A 1XB4A 1NPRA 4NB5A 1YRXA 2CUYA 2K1RA 1UAAA 4O0NA 2PEXA 3QIDA 3QYFA 4LG3A 1IJWC 4RL1A 3AXKA 3OW2R 3MFKA 5KFZA 4HF1A 5FLXU 3BG9A 4XO0A 4J9OA 3R1HA 3WIUA 2BOAA 3GZ5A 1KQSR 1O3TA 4L5EA 4L0ZB 3KHHA 3MEXA 1HHTP 4LVNP 1IDYA 4X62J 3KK1B 4ESJA 3PRBA 2HGLA 3HHEA 3W3SA 2DJWA 2LRDA 4AUKA 2L9RA 4RW9A 1D5VA 2XGXA 1AFJA 1PDNC 1DTTA 1BGXT 2ILZA 5D6EA 1ZZNA 2DRBA 3KNAA 1FIPA 5B0FA 1JTXA 2Q1LA 1VF9A 1VQ6I 3H9QA 2MKKA 1ETYA 2UP1A 1ZYQA 4M72A 1NAQA 2CGPA 4LFCF 5A8WA 3K1MA 3GONA 1HKTA 3CJKA 4P2XA 1WH7A 1SKWA 3SZPA 5K8PA 2MFZA 2PI5A 3L2CA 3J7YJ 2ZKZA 2YWWA 1N0UA 2CQCA 1G6BA 3PCOB 3JRIA 2IJNA 3NWRA 5L8RC 1RYRA 1BIAA 2VB6A 1S72S 2MDAA 2XGDA 4CYUA 3ABUA 1RHMB 3CJRA 1S7EA 2IVMA 5DDQC 2K06A 1YLFA 3KMSA 1D9FA 3WTZA 3AKZA 2QT7A 4YIIA 3NWSA 2KQRA 2DAOA 4LB6B 4ECXA 3I87A 1D5YA 4GYGA 3CF2A 3DLBA 1N77A 4DQSA 2GJ2A 3U02A 1WTFA 4GRIA 3UW1A 1WEYA 4U88A 4DPUA 1A04A 7FDRA 2WY8Q 3HHKA 4FX4A 4ZZDA 3W8GA 4NPOA 1WF2A 2XO6A 2EPFA 3FRYA 3VQTA 3KLVA 5KFTA 1PAEX 3W1YC 3TUZC 1A6LA 1APSA 2MKHA 2F5DA 3MMBB 1M1EB 3MMYB 3CP8A 3OTBA 1HPZB 1S9EB 3UDLA 2FHOB 2K8GA 3LAPA 4EGYA 5IOLA 3GYGA 2AXTC 2WK4A 3HOSA 3M8QB 2RNEA 1LFWA 4IRDA 4Y0FA 4CA0A 3V4IA 1A7GE 4NE9C 2VD3A 2RAQA 5EX0A 3NS7B 1FOYA 4MKYA 2ZBRA 3DXBA 4EMSA 4DV2J 4ILMA 1IXRC 3VB2A 1X5PA 5L1KA 2HKXA 1IF1A 2DJIA 2JUGA 4MEYF 1EKSA 1WI6A 2FHJD 1RWVB 4G1QA 1W1WE 1X0FA 1ZZFA 3CJTA 2WVBA 3PHTA 1DDNA 1UKUA 2Z2LA 3NMRA 1RKTA 3KLEB 1XR6A 1ETKA 2X7IA 2R8GA 1EKRA 3B82A 4BYYA 1WG4A 2B4VA 3OHAA 1H8AC 4B4CA 2L08A 4RBVA 3AG4H 5BNGA 4IDKA 1F3FA 2M3AA 2DR5A 3QU6A 1LFPA 3KEOA 4C8NA 3DLKB 4Y3CA 4MFBA 2HHQA 1FKPB 2ASDA 4RO0A 5GAEI 2DPDA 5DLGA 3T9NA 2Y8WA 1LJ9A 2QEXI 2O03A 1ZTWA 5KFFA 3TW7A 3AODA 2Y9YA 3BG6A 1HNIB 1ITPA 4HF0A 4RNMA 2W9BB 4GKJF 3RB6A 3QPSA 3Q5FA 1U02A 4A8WA 2UUZA 2DEJA 2KJVA 1KEKA 3R2DJ 1MBKA 3BR8A 3TX0A 3VAKA 1ROFA 4IO1A 4RBTA 2ZJPQ 2DHHA 2ZH6A 3R7SB 4J9SA 3PNVA 3K4BA 3W63A 2L9NA 1FDAA 5F3ZA 2W1BA 3PY8A 2UXCJ 1IDZA 1JJ4A 3EETA 2C2NA 4M73A 3CJSA 3LSHA 2ROPA 2HNYA 1RKIA 5H9EJ 1F9FA 3E5XA 1SJRA 5BR8J 2MQMA 4RBUA 3J7A1 4XMYA 3RUBL 4LF7J 4HDVA 5B0EA 3PSFA 2JEJA 1QHGA 3PYDA 2HFNA 4N9IA 2MLYA 1VMBA 2RQCA 1Y5IB 2NVXJ 3KX2A 2X3GA 5IP9J 1QSSA 1XNQF 1VQOS 4ZVFA 3WGGA 4C3JJ 1W0TA 4L18B 4BCAA 2O0YA 1KQ9A 4LMZA 3M2UA 1IKXA 1FRJA 3H25A 3BREA 3GFZA 3H4DA 3EQLF 1I5OB 2H51B 4Q8FA 2DHAA 4QW9A 1FBSA 1WDDA 2V8VA 4IH5A 3I0SA 2MZRA 1WOOA 4K5RA 1MMSA 3H0GJ 2O3DA 2V94A 1FFWB 3HGYA 4O3PA 4G6DA 2KN4A 4RA2A 3TQ1A 3P7NA 2BKPA 3BV8A 2H5EA 4DYQA 3TO8A 2V9WA 1HQUA 5KFKA 2EILH 2XUBA 3M30B 2BQRA 1S7OA 3PHEA 2G2YA 4F4AA 2JSCA 1SCJB 1UP1A 2YNGA 3V2UC 4CH0S 4DL6A 3MKWB 2DTZA 3M9NB 5LT5A 1N54B 4DL3A 2RUSA 3W6VA 4ZYEA 1NDPA 5FKMA 4DYRA 4L9NA 1W7PB 3EZ5A 2ZDPA 3HO1A 4KC5A 1EB0A 3R0JA 4C11A 1RBOB 4XPEA 2U2FA 1MWZA 1REVB 5D6FA 4A3IJ 2VV5A 3QATA 2A3SA 4KGMA 3EGNA 2DT5A 4PKDB 1N8RT 1DTQB 2FF4A 2VICA 1MH3A 3H36A 5I3PA 8AT1B 2HBZB 1V9OA 3M7VA 4CCJA 2GBYA 2WWYA 2X6YA 5LSOA 5J3LA 2QL5B 1YI2I 2V6EA 1HIYA 1U47A 2IDLA 1S7IA 3TO9A 1OCRH 1QAJA 2TDXA 4UUSA 1O3SA 2K7LA 2FGCA 4BC9A 1APLC 2HRUA 2GAUA 1G1XA 3MMCA 5KFJA 3OTDA 2AQEA 3VAJA 3L95X 2ZZMA 1N25A 4OI1A 3QNWB 3CP2A 7FD1A 4RW6B 4R79A 4R8UB 3WTTC 1MMGA 4EM2A 5KOWA 4EBDA 1YBUA 3ZQIA 1LEAA 5DD8A 3JYTB 4DWIA 3M2VB 3EDQB 2EKNA 2JC1A 3LF0A 3HF5A 4NCGA 2ME6A 2LECA 4QIEA 4BHBA 2PMZA 2CQ2A 3JTOA 3ENWA 3DM2B 2Q79A 3FF5A 2EPIA 4K7QA 2PN6A 2PMWA 3GQCA 2AU0A 4JI3J 1FEEA 1MDMA 3E6MA 1ZYRF 4J9LA 3H8YA 2PQ8A 1U4BA 4KR0B 3FISA 2I0XA 2XMKA 2W4DA 2O66A 1XERA 2C3PA 4O44B 3NWTA 1FNXH 1FJCA 1FWKA 3Q9VA 1SUQB 2BJ7A 2IS4A 3J7ZI 4YIRX 3J7AO 1WG5A 1K78B 1KQ8A 3GTYX 5GPCA 2NUUG 2MQPA 1TTHB 2DT6A 2OZ6A 2DGUA 2LKZA 4MK7A 1TK0A 1RC9A 2C3MA 2LXUA 2VFUA 2O01C 3IMQJ 2C2RA 3VZHA 3ONQA 2KRRA 2MC3A 1ZQ3P 5M2RA 3GZ6A 2ZJQF 2D1VA 2W7OA 2HFZA 5E1ZB 4ENKA 1JJHA 1DBDA 4CP5A 3I5UA 4QWQA 3MEKA 2AEJA 2DA6A 4ZJZA 4CGZA 3BJOA 4KBIA 1T95A 4A48A 4MIAA 2A5WA 3KYCB 3WE3A 3ZQ7A 4HHHA 4F2SA 1IV8A 5E3NA 2HVRA 1B8IB 1M5KC 3IH2A 8ATCB 2PG4A 4USUA 4IX7A 4DL0C 2NQPA 3BZQA 2G7UA 1XMXA 2EXUA 4C3KA 4AL7A 2MHEA 3LQRA 4A3EJ 4XIDA 1UAWA 3EUHA 4JV2A 4RLEA 5GAGI 2H27A 2NZ4A 1S99A 5KFOA 3H1CA 2QUFA 2K2PA 3NEKA 5FJ4A 2XASA 4ECWA 3KDOA 2H4YB 4FE4A 4CDGA 4H4MA 2Q2EB 1QBJA 3DRSA 3VZIA 5L38A 1UEKA 4ZPBA 1Q1VA 3MFHA 3HM9A 3LSJA 4XM3A 2A2CA 3ZTQA 3U1KA 2KZGA 1WOPA 1X4OA 1MWYA 3J80Y 1XNQJ 1ACIA 5F0WA 4HTJA 1YJUA 2BY1A 3CDBA 2L2OA 2R0QC 2CUJA 4RAGA 4CYDA 3LGHA 4HEA2 5ETVA 4BDZA 5HANA 3JR9A 4P7TA 1LKXA 4CLUA 3W6JB 2RVCA 5F8GA 3CCEI 5KFHA 5IP6A 2HYIB 1NO8A 4YELA 4JI4J 2CNOB 3TDUC 4IH7A 1U8BA 5M5YJ 5AIQA 5D0RA 1FOXA 1HW8A 3RB4A 4K2XA 2XS7A 3K1PA 4CHUA 3O1LA 2A6OA 3ZMTA 4DS5A 1C1BA 3D68A 4NYPA 2HXIA 2QYGA 1K1QA 4J7CA 1MU2B 1WKMA 4EZ9A 3QAUA 4AD9A 1FWPA 4LIRA 3EZUA 1PCAA 4DPWA 3DLJA 2Y0SA 2MLKA 3G3ZA 4F92B 4LLNA 2IM0A 5IFMA 2AXLA 1IKWA 1X5SA 2QSHX 2Z4PA 1RAEB 1Q86T 3I4HX 2HTJA 2ZBIA 2DIUA 4FISA 4Y4RA 3T1BA 2Y48A 4TV7A 1NNDA 2WVEA 2HZDA 4WFAQ 1H98A 1NH8A 2IM1A 4IRIA 3QT8A 3BBBA 4TY9A 2DMPA 2FQ3A 2AS5F 3QZ8A 1GVJA 5KG5A 5H6RA 1OR7A 3N5FA 3FHZA 3GYXB 1F9EB 2X9DA 2I1RA 3HK2A 2BM0A 1GXQA 2R42A 4B9TA 1R1TA 2M9HA 4FHTA 3R7NB 3AB2B 5KG2A 4ED6A 3VAMA 2RU9A 2ESNA 1RT1A 2M4MA 2LFBA 4FPIA 2OAZA 3CJ5A 2PEBA 3LGNA 1WTBA 1K0VA 4A3CJ 2CQBA 3TOAA 1R3NA 1YS7A 3B6AA 2A5YB 3CCTA 2DR9A 2K1RB 3MPYA 3WHBA 3W2AA 2OPQB 2J6UA 1AA7A 3OIPA 3SZTA 3DLEA 4JI6F 1HA8A 4F7ZA 1J27A 2CQGA 2WTEA 4PYAA 5F41A 3SDEA 2M2BA 2W7PA 3CCRS 4ZCMA 3DMJB 3DTEA 1TL3A 1QHHD 3DOKA 1RTJA 4F8RA 2W2QP 2RRAA 2W57A 1W26A 1ZPVA 4OAZA 4C3MA 3NGDA 1U1PA 1KDNA 4UZBA 2LTPA 2BHZA 4RNHA 4EJOA 2VA2A 3TDZC 3CD6S 1C1BB 1T56A 2GO8A 5D3GA 4U9RA 4JX6A 1TZ0A 4G7ZF 3Q0WA 4EJVA 3GW2A 1IKVA 1HBXG 2HU9A 2E1NA 2ZD1A 2CPDA 1QY7A 1RQ0A 2BHYA 2GHPA 1YJ9I 5EEHA 3DLGA 3H90A 1TAUA 4Y13A 2XDVA 2H8RA 1T98A 2W25A 4RB2C 2G2ZA 1UA0A 3KCCA 2XYGB 4J37A 4MKAA 4HDUA 4K4WA 3I55I 4AVPA 2MA3A 2L9DA 3MD2A 2ZH2A 1YQHA 1TKZA 2GIVA 3OL7A 1QLNA 1L5UA 4LFCJ 3P6YC 4OMZA 2RRBA 2YWFA 3M2RB 4IG3B 2XULA 2CQ0A 5H6QA 4CT9A 2MSTA 1HD0A 3SFGA 2W9CB 4ETXA 4Z2XA 5F0HA 3R9LA 5KT4A 3U1LA 3FQLA 2M8HA 1N5SA 5HAOA 4ZS6A 2VKDA 4CNYA 2QLJB 3K7AJ 3VALA 4IO9Q 4DJBA 3BPSP 1RHQB 4ANJA 4MT1A 4JI1F 4XKWA 3GJTB 5DG7A 1IQTA 3EJMA 2BQUA 3L2RA 4IQ4A 1CPZA 3EPIA 1FIAA 2NZCA 4Q45A 2W2MP 3EUHC 4X62F 2QL7B 3JTGA 1N32F 2QA2A 4XK8C 3Q23A 4JP8A 3TZZA 1WKJA 2JOQA 4D5FA 3HLUA 2F4VJ 1AHDP 4MO7A 4RW8B 3VYUB 2JK3A 2E44A 2OPRB 2XKPA 3RKQA 2AJ0A 2R7OA 4EFAC