2VOPA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
EKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 51
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vopA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vopA02
5IT3A 4V19X 1QQIA 3BO3A 1MJBA 3COAC 2M8DB 4HLYA 2EVZA 5FD6A 1ZARA 1R5GA 3CCJS 2RQPA 2QBYB 5LSLA 2MC3A 3PIPQ 5E8GA 3Q9SA 3LA3A 4IRGA 4LK0F 2JTVA 2E7XA 1FLIA 2H09A 5DV5A 3E6CC 4RB2C 1TNTA 4HDVA 1YHQS 1BN5A 3C18A 4Q47A 5AIQA 4WF2A 4M73A 4RGSA 2HGLA 3MWMA 4U67Q 3WTYC 4EM1A 5LGUA 3FM5A 2ZMEB 1IXCA 1ULYA 5JVHQ 1YO5C 2KHCA 3K9TA 3VF0B 1U1QA 1XGSA 1W2BR 2V94A 2M88A 2OU2A 1D8ZA 2N82B 5KVRA 2MHNA 1P6RA 4IUFA 4IVNA 5LHGA 3T5XA 2OZ6A 4CH1A 2MKKA 3BDDA 3ZMVA 2DNKA 1KYWA 4ERDA 2A69F 1FT9A 2W57A 2HR3A 4G7HF 2FEZA 1R00A 3J7ZT 3QPHA 3CUQA 2C6YA 2NNYA 3NEUA 1RIOH 1MDMA 4FXVA 2O61A 1XDUA 3ZN0A 1IAWA 3FXUA 3R0AA 3UCZP 1YS7A 2DIVA 3LA2A 2B0LA 4CYDA 1VTNC 1SJFA 3TO7A 4BS2A 5JHUA 1X4EA 2YX7A 1SFEA 3GEZA 2E5HA 3HRMA 5H20A 3FXRA 3TP2A 2RRBA 3NQOA 5D77A 3OV8A 4L5JA 1UFWA 4ED5A 3MZYA 1EH6A 4UY8T 3RI4A 4MQVA 1S7AA 2WC2A 2M7SA 4QLCU 4M5DB 2K4BA 2MKIA 2X0LA 3I5UA 3HSEA 4L9TA 2QM3A 2D2WA 3WGIA 3J7AO 2LCWA 3BZ6A 5CXTA 3WTSC 1LB2A 5HVQC 1DP7P 2DPDA 2IJLA 4G6DA 3HHNB 2K7LA 5H6QA 1N52B 2I2YA 3IWNC 2FMYA 4G7OF 5ERIA 1WI9A 1UW4A 3GYHX 1U1NA 3HHHA 4U7BA 2ESNA 3ABUA 1FJCA 3PIOQ 3JW4A 3RTRA 1SMYF 4XRFA 1VC5A 1G2EA 3J7YU 4B09A 5KK1A 1KQ8A 5LHIA 3J81K 2DQLA 1SMTA 2XSFA 4OZ1A 2M5WA 5DUKA 3CCRS 1J2XA 5JR3A 4O5VA 2HWVA 4N0BA 4EMSA 1KU9A 1T38A 4Y0FA 3F23A 1Y0UA 2K3KA 1J0RA 1H0MA 1R36A 3U2RA 2VBWA 3MAJA 3DFGA 3FM3A 4WCGA 2E5GA 2MXYA 2QA4S 3NNAA 1OIAA 4CXFA 3NS6A 1K7AA 3F21A 2MKHA 2MZSA 1R1VA 4BQAA 4AWXB 3CDHA 2RVCA 2LKZA 1XD7A 3CPWR 2XV4S 4L9NA 1WEYA 4HX7A 5CVRA 3U1DA 5K1YA 5GAEU 3R60A 3GWZA 1BIBA 3G8TA 1P2FA 1FT8A 1HW1A 3FX3A 2OQGA 1A04A 1HSJA 1NHAA 2G7UA 4EQQA 2OAZA 3LAJA 1TW3A 4BHCA 1VBXA 2YKAA 1PO6A 4O6JA 5D6FA 3GLXA 2P5LC 1IXRC 1CGPA 1D9AA 2IT0A 1F1ZA 2PEHA 4I02A 2HGNA 4HV6A 5ICFA 5ED4A 3ZMDA 3VALA 2JT1A 2G7HA 1YJWS 1BM9A 3G4SS 2VODA 3FF5A 2F3JA 1ODDA 4ENMA 3WE3A 3K0LA 4EJTA 2DHXA 3CMES 5EEHA 2Z5UA 5HLIA 5D4SA 2P7CB 5DETA 3RKXA 2DQRA 3HTSB 3H2UB 2XASA 4CQ1A 1H9GA 5IT9K 4EJWA 4I09A 1IRFA 4AD9A 2DGSA 5EN1A 2KG0A 1XMAA 1HQCA 3W6KB 1ZG3A 2YTCA 3I4PA 3C7JA 3BROA 2D1VA 1FX7A 1IUYA 3EYYA 4RU2A 5H6RA 3REOA 3I58A 2QLZA 4KIGA 2YSRA 4KMUX 2O3DA 1I1SA 3MFKA 5DYMA 5HLHA 1M5KC 1U1OA 2O6GE 4I7HA 4H0EA 1E17A 1YFHA 3WE2A 2XKOA 3IHUA 1GXQA 2W24A 2KJCA 1VQNS 1U1KA 2DBBA 2DNRA 1BI3A 4YIIA 4XSXF 1EV7A 1OR7A 4CO8A 1USSA 3K69A 2MQPA 3CO6C 4UV9A 3TKYA 3IKTA 2QBYA 2A3SA 1ZG1A 4Y13A 5F1RA 2MQQA 3I71A 1WQ2A 1XDSA 1X5TA 2F9DA 2ZJQQ 5DEQA 2L41A 1XCBA 2KFYA 1JE8A 2VBYA 2CQGA 1ZLJA 1J59A 1D8JA 3L9FA 4W92B 2M0GB 2V1DA 2MSTA 4BNCA 3QP5A 4LMYA 2H94A 4RGRA 2LXUA 3AAFA 2CPFA 3RW6A 1CF7B 4G8XA 3RPUA 1QZZA 1UFMA 3EX7B 1BY9A 4OIRF 4WFBQ 3O3KA 1YIJS 3GF2A 2MZ1A 2JPCA 3CCVS 3V8JA 2DNHA 1J9IA 4P5OA 1A7GE 5FLXK 4A12A 4PKDB 3F22A 4EM2A 2GIVA 2GZWA 1F4KA 1S72S 3WTUC 4OMYA 2QUFA 2HQNA 4RGXA 4QQBA 2MGZA 2KH9A 1U1PA 4A0ZA 2DNZA 1N54B 3CD6S 1SD4A 2M87A 3Q9VA 3P3DA 4F02A 2ZXJA 4P96A 1YG2A 1RK8A 2DTRA 2J76E 1XGOA 4EM0B 3FMRA 3WGGA 2A61A 2JX2A 1K73T 1MKMA 2LSOA 3EYIA 3DLLQ 4S04A 2IA1A 1BC7C 4L9VA 1J5YA 3KEQA 2DO4A 3V7CA 4MGRA 2OSQA 2CQ1A 3W6JB 4CGZA 1YYVA 2PEXA 3U1LA 2EFPA 4WFAQ 4DQ2A 3EETA 2MKJA 2RS8A 3H3ZA 1U6FA 1IN6A 1W5TA 1H2TZ 2BGCA 3DPTA 2MPUA 2RV8A 1FYLA 1MJ9A 3T8RA 1I5ZA 3S01A 1CVJA 1U3EM 1PP7U 2CPZA 1LVAA 2OQRA 2VE8A 2IPQX 3I53A 1HKTA 3R61A 3OOPA 4ENKA 2QQBA 2UZKA 2K4JA 4ENNA 2M45A 4CICA 4ZZDA 2IP2A 2L02A 1G6NA 1T6SA 2OZUA 5HO4A 5D5XB 1QVFR 2L3DA 2JWNA 4FT8A 2E7WA 3WG9A 3HTUA 1Z05A 1U1LA 2ISYA 1O57A 2ETHA 2KM8C 3HI9A 2A5YB 1OPIA 2LDUA 3VAFA 2O3FA 3I0TA 4FHTA 4RB3C 4MEYF 1Z9CA 5BJRA 2ZNYA 2VOPA 4M74A 4QWQA 4PRFA 2CPXA 1USTA 4JQFA 1U1MA 4RGUA 2ADUA 1LJ9A 2DO7A 4IPAA 1KOHA 3MCZA 4KIBA 3V8KA 5LSOA 2UWMA 4UXNA 3KP6A 3GXOA 2ZKZA 1Z7UA 4UVCA 3KZZA 4KFCA 2VC1A 3CF5Q 2CQ2A 2BOPA 4U0WA 2X4HA 2ERRA 1KQSR 5D4RA 2XS7A 1TQPA 1U6BA 2MJUA 5GAGU 3S8SA 2M2BA 1OO0B 3P5TL 2DNLA 3SHFA 2QZ8A 3VAIA 3J80Z 4RB1A 1OKRA 3EDPA 4EGYA 4OIOF 4HYEA 4O3MA 1BOAA 4KYWA 1FP2A 2MQMA 2IRFG 1C0WA 1X5OA 3V7SA 2PI0A 3VAJA 2V79A 3U1MA 5BPIA 4HX8A 4KIFA 1V4RA 4HDUA 1BI2A 4GO1A 5DCFA 2R3SA 1FBQA 3G8SA 2W84A 2D9PA 2DPUA 1VQPS 4HZFA 3KZYA 1M90T 2NRAC 2HKXA 2DI3A 5CVUA 3J81Z 4Q4ZF 4P55A 1H9TA 1ZH5A 4A6EA 3F3XA 2PLYA 1NJIT 4R79A 4BAYA 1X4DA 1H6KX 3UWTA 1O7FA 5GMKa 3Q2SC 4TU8A 3LAPA 4YFNF 1L3KA 3I64A 1YIOA 3UCGA 2MA3A 1KC8T 2M8HA 5J6XA 2W25A 3CCUS 2A07F 5E20A 1F9FA 3CCMS 3L2CA 2FA5A 3MUTP 1NU4A 2NLWA 4GGGA 4IF4A 4K2EA 4KMFA 1FC3A 1I27A 1B1BA 1ZRCA 4L9JA 1O3QA 3DXJF 3CO7C 1BI1A 2XKPA 3LSTA 3K1MA 5CYJA 4U0YA 2XRNA 5GVQA 4GYGA 2K8GA 1WG5A 3CC4S 1H2UX 1YWXA 3KP3A 4A2UA 5CVVA 2KN4A 3I59B 1FHTA 1EH8A 2E1CA 2SXLA 3P9IA 2U1AA 2DGOA 2KJBA 2DAOA 2YX4A 2A6EF 4MEXF 4G9YA 3H92A 4M6YA 4TU9A 5A2QK 3GO5A 1XB4A 1FJ7A 1Q7YT 3CULA 1T98A 4EGZA 1G4DA 1V3FA 4B8XA 1ZRDA 3VAGA 3CJNA 1FSEA 5HLGA 1HKSA 4ESBA 1R7JA 2HTJA 3NS5A 2MD5A 2L4MA 3DPLC 3IRWP 2KRRA 3QOPA 3DEUA 2CQDA 3EUHA 2QQ9A 2JRSA 3M8EA 2V1XA 4ZYGA 4CZZA 1Z1DA 1S79A 1K9MT 1B4AA 3B4MA 3C1DA 4FXWA 1KD1T 2ZJ2A 2LA4A 1YLFA 4A0YA 2YR2A 1M5VC 5LGNA 3IWZA 3CCLS 2AYGA 1HA1A 3EQLF 3FMQA 3RIRA 4F26A 2M70A 3T8TA 5FB2A 2RS2A 1HW5A 2DNGA 3R27A 3ERED 1G3WA 3BWGA 3DXBA 4GXOA 1U5TA 2KVIA 5D78A 2P6TA 1BBYA 4N9HA 1OWXA 4XLNF 3QU3A 4A5MA 2ZNZA 4R1HA 1KQ9A 1IN7A 2COMA 3PQKA 4MTEA 4OZ0A 3WTTC 1P4XA 5HDGA 1HD1A 4PZJA 2KXFA 2KXHA 3O2PE 3E5UA 4NHJA 1ON2A 1X4AA 2J5PA 4P9FA 3VFZA 3GFIA 2BEOA 5J8FA 4PR6A 4KT5C 2LECA 1U2FA 3NRVA 3F8BA 3HHGA 4HF0A 2EV6A 4XSZF 3CC7S 3E3VA 1X4FA 2F5DA 2CYYA 1N8RT 3UD4P 1YI2S 1SJRA 2P4WA 5BOXA 3S7RA 3RKWA 4U0VA 1YJNS 4ETSA 4LFUA 1S29A 5L3GA 5CVJA 1M1KT 3VAMA 2CPEA 3BO4A 1ZZNA 3QPTA 1ZG5A 3HOTA 2FU4A 2FSWA 3G3ZA 1X4BA 1R1TA 4HAMA 2HYGD 1FY7A 1D8KA 2J8AA 4M9ZA 2A3JA 2P8TA 3ULHA 2ZCWA 1B59A 5HOOA 4FX4A 3CCES 2MLGA 5LEKA 3F6VA 1P92A 3K1NA 3GZ6A 4RAYA 3T0YA 6PAXA 1VQ8S 2ZJPQ 4IHSA 2LNBA 2RN7A 2MZQA 4E70A 1TTYA 1WSUA 1R58A 2MQLA 2EA4A 1IN5A 2HQRA 1KA8A 1WF2A 1L3LA 2E5IA 2MB0B 4UQTA 1YW7A 4WXHA 1PUEE 3JAMZ 5F6FA 3BJ6A 4EVIA 5E18F 4L0ZB 1F9NA 1GVJA 3FZVA 2DW4A 2DGWA 1QBJA 2AXLA 4S05A 3DQVC 3MUMP 2ELHA 2G1DA 2CPDA 3TOAA 3Q2TC 2XAHA 3F8CA 2XIGA 5DUIA 4WIIA 3MD1A 1FXLA 2VBXA 2K27A 2DGTA 2XHKA 2N7CA 2DB1A 3M1EA 1DPRA 3RPQA 3LFKA 5BS6A 1S3JA 3V4GA 2FF4A 4L18B 3ZMUA 4UNOA 3LQQA 5E1ZB 1B6AA 1Q86T 3RYPA 3V4MA 1BI0A 5D5VB 2HS5A 5FO5A 1WRJA 3CUQB 4R8HA 1R23A 4OMZA 4TLQA 1U2WA 3ML6A 2FOKA 5DDOC 4QU7A 5L3CA 2Q0OA 5DD8A 2CO5A 1VBYA 1IF1A 2X1GA 4LB6B 1RUOA 2R7DA 3E6BA 2LF8A 3PFIA 3ZZZA 3CTRA 4YIFA 2DGQA 4HX4A 1YITS 2XS2A 1FOKA 5BQTA 5LHHA 2XNRA 3QAHA 1O3TA 1ZRFA 1VBZA 2LXIA 2CJKA 3E97A 1FNXH 3GUDA 2MGZB 4WXCA 1E2XA 2OBPA 1D3YA 4W90B 2V9VA 2EV0A 3SDEB 2F5CA 4MQ9F 2EA2A 2D45A 4IHTA 2J0SD 2FNAA 1WEZA 1JXSA 2G9WA 3OW2R 2BE5F 2F9JA 1JJ4A 3PQJA 1DRZA 5IM0A 2DT5A 2DU9A 1DBDA 3DV8A 1WHYA 2OTLS 1W7PA 2VONA 5LLQA 4UVBA 4MNUA 2FXAA 4WK8F 3LWFA 2UXNA 2MYFA 1I6XA 4BYYA 3D2WA 2KT5A 1JGSA 4KN4X 3GFJA 1FZPB 1FBUA 1ZGAA 3ECOA 4WCEQ 2P6SA 1KGSA 3JB9k 4C4WA 5LGTA 2VT2A 2LQ5A 3KP7A 2X1FA 3Q5FA 1XMKA 2HTSA 3MUVP 3LQVA 1WG4A 1FWZA 1X3UA 1WEXA 2PN6A 4A6DA 1JHHA 1WF0A 1ZZFA 2GQQA 3GW2A 5FFXA 4WF9Q 2DGVA 5D5UB 3IL2A 4PGHA 2CQPA 2I38A 3THTA 1K6OA 3M8FA 3ZP5A 3JTGA 4EGLA 1MGTA 1EH7A 1NO8A 2GA1A 3CC2S 1Z6RA 1X4HA 3BPVA 3TDUC 4EJUA 1WHXA 5ICGA 2RC4A 3R1LA 3FEYB 2EV5A 2P7VB 1P27B 5L3FA 2PMHA 1JJ2R 2OSRA 3KCCA 2DNOA 1W5SA 2Y75A 2H27A 2MMYA 1P4WA 3KLOA 2DK2A 4GCVA 4M9XA 4KA4A 3SZPA 3NMRA 3F8NA 1HSTA 3KP5A 4ZYEA 2NAZA 1FPQA 4LGWA 5E1WA 2QYOA 2XAGA 2EK1A 2J0QD 1JHFA 2A68F 3HRUA 1QM9A 1G3SA 1SJ3P 5DM6Q 1J75A 1LEBA 2XAJA 3UCUP 2LEAA 2MQOA 5LJ5Y 2JVRA 1RNLA 2FMLA 4ASNA 2HGMA 4IJAA 3K2ZA 2KU7A 4KDPA 1T2KA 2M1BA 4QPTA 1K78A 2CQ4A 3L3CA 4M72A 2AYBA 2QQAA 2R7FA 3IC7A 2CPYA 2EJRA 3HUGA 2DNPA 3ZPLA 4A8XA 2M30A 1R22A 3ZMZA 2XROA 4U88A 2YWKA 5A2QZ 1YW8A 2J5OA 1ZLKA 1UAWA 3D5LA 4YB1P 2F5EA 4LJZF 4OIQF 3LA7A 3TO6A 2EFOA 1FNNA 3VAHA 5DDPC 1IW7F 2BZ2A 3U9GA 1QNTA 2HYIB 4RAZA 1U1RA 4ESFA 5LRRA 1T0FA 3P49B 2K86A 1BC8C 3FMSA 1ZGJA 1SFXA 2QVOA 1O3RA 1WTBA 3BOQA 3I54A 2RVJA 1TBXA 1L0OC 4Y15A 4LK1F 4Q5SF 5DM7Q 1DPUA 3I55S 4OOIA 2ZMEA 1SAXA 2ESHA 1P4AA 2K02A 3L00A 4LG0A 4UHTA 1KOOA 3BJAA 3V7RA 4IO9Q 3QRFF 3ZN1A 3KFWX 4ZH4F 3K1PA 2MJNA 3ROUA 1B7FA 1G3YA 4YFXF 2HYFA 2XUBA 3LQRA 2BYVE 4EJVA 3ABTA 1X4CA 1X5PA 2XS5A 2ZFWA 5CA5A 3HRTA 2OD5A 1VQ5S 1S7OA 5GADU 1VQ9S 2RKHA 5HL7Q 2AS5F 3B73A 2PJPA 1VQMS 4ZYDA 3KLNA 2EFQA 2IW5A 4HLXA 1RUNA 2LEBA 4YUDA 3TDZC 4YG2F 2KKOA 1KU3A 1PGZA 5D6EA 1K8AT 4RS8A 2L9WA 1IN8A 3S6EA 5LXYA 4IXAA 4C0OC 2KYXA 1S8NA 1KYZA 1JMTA 2JSCA 2Z9OA 2VN2A 3DF8A 2RNEA 5LJ3Y 4XBFA 2GWRA 3QP6A 2CQCA 1HD0A 2IA0A 2CQIA 3IWFA 2DNYA 2XAFA 2BV6A 5D8KB 4IOCQ 1A9NB 2OJ3A 1SD7A 2KM8B 1SFUA 1R1UA 3R1HA 3MDFA 4YOEA 2DITA 5J8CA 2OA4A 5LXRA 4F25A 4Z2XA 1RKJA 5H1SV 5GAHU 1WI6A 4GYIA 3MQ0A 3MZHA 1DDNA 5FLXZ 1WG1A 5FFZA 2MSSA 1BJAA 2CWEA 2L01A 2N3LA 3CCQS 2MZRA 2Z99A 3SMZA 2CSOA 4BHPA 5ITHA 4C7QA 1MJAA 5DCMB 5FGMA 3TO8A 2OIHA 3VAKA 5F64A 2MY7A 4F7ZA 3UD3P 1HKQA 2CPHA 2RUGA 1WWHA 2STTA 2EK5A 3CXCR 4L0YB 2U2FA 2DHSA 4LG0B 3EGNA 3DP7A 3M9AA 1SD5A 1URNA 3G71S 2AD9A 4UUVA 1WKMA 1W7PD 1WHWA 1ZN2A 1X5SA 1W4MA 1F5TA 1ZHFA 2DLLA 5ICCA 4AIKA 1HBXG 5K5QA 1AUDA 3RYRA 2HZCA 1Q81T 1ZYRF 4Y00A 3WTZA 2M52A 5DDRC 1PP8F 2PQ8A 3CUNA 1HW2A 2H6BA 2PBIA 2O03A 4OINF 4LIRA 2DIUA 2XB2D 4CDGA 5CLSA 4YFKF 2FHOB 3I56S 2P5VA 3TQNA 5CVIA 4ZKAA 4HOBA 1IRGA 4M9SA 1MD0A 5D5WB 2XNQA 2DNNA 3US5A 3R0JA 1OMIA 2LYVA 3ZMSA 2WBRA 5E8IA 2Q2EA 4HQEA 2UXXA 4Q48A 3RDIA 2DH7A 4NB5A 1TQMA 3TO9A 4RB0A 3BEGB 5ICEA 3BY6A 1TW2A 3KE2A 3FEXB 4HF2A 2MH9A 2F5FA 2MQNA 2FQ3A 2DNQA 4PCQA 3ELKA 1LQ1A 2L08A 3MI7X 1TLHB 2B0GA 2O0YA 4LD5A 2HDCA 2FBKA 4IRIA 2DO0A 2XAQA 3MEXA 4UVAA 3VODA 1UCRA 3P9KA 3J80K 1IXSB 3HYIA 4CH0S 1M5PC 1P1TA 1X4GA 3F8FA 4AVPA 3WODF 2FBIA 1S6LA 2GAUA 3B4DA 3GVAA 2DISA 2P5KA 4D0PA 1DZ5A 3CLOA 2HGCA 3WU1B 3MURP 1DHMA 2RDPA 1SJ4P 3FXQA 4HW0A 2AYMA 3P9CA 1R5HA 3G96A 4WXDA 2KIFA 4BXUA 3WTWC 4QU6A 2PMUA 4P9UA 2Q79A 4OIPF 1TQIA 2CPJA 1LEAA 2ADBA 5IM0B 1UP1A 1D5VA 1YS6A 3NNHA 3SQNA 4LLNA 3R4KA 4AIHA 3JTHA 4A5NA 3N97A 2RNJA 2FRHA 5ILSA 2DNMA 1XN9A 1XGMA 3SFZA 2D3OR 1HL6A 3P7NA 1N88A 1O7LA 4KN7X 2STWA 4LMZA 2IA2A 1UB9A 1KQ0A 1Q1HA 5DD4A 4WX9A 3E5QA 5DDQC 5ILUA 1ZREA 2LF7A 2QEXS 2KIMA 1W7PB 1FJEB 3F6OA 1QVGR 5HS7A 3HOSA 1REPC 3ULQB 2FC8A 1YW9A 1Z91A 5D8LB 3UE2A 1RZ4A 3ISPA 3SDEA 2RT3A 1SXLA 2MH2A 3VEPA 1M5OC 3E6DA 5JVGQ 3BS9A 5K5RA 5E1XA 1FYKA 1LDJA 3WTVC 4JK1X 5TRDA 2Q8KA 1T39A 5FJ4A 1VQOS 5IT9Z 1J7KA 2ACJA 1HXDA 2GHPA 2CQHA 4OU0A 5E17F 2WWYA 4DNCA 3IRRA 3BJOA 2CGPA 3JAMK 3KP4A 4CHUA 1VQ4S 1B9NA 2DHGA 5FD5A 2G0CA 3GX4X 2O8XA 1WELA 3S2WA 2YPRA 1AWCA 4XLPF 1SD6A 3ZMTA 3L7WA 1VQ6S 1XSXA 3TOBA 2CPIA 2Z3YA 2M4MA 4ZZLA 1YQAA 4LB5A 1OYYA 1XSDA 2KRBA 1YJ9S 2MZJA 1OYWA 4WWCA 4N9IA 4I0BA 2YH1A 4G7ZF 2CG4A 3P6YC 2GA2A 3CCSS 3KP2A 5IFMA 2FPHX 2D9OA 1SJQA 3GFLA 2JZYA 1KU2A 3G6ES 3RKYA 1DUXC 4I01A 2LA6A 1K79A 3KETA 1WWXA 2FC9A 2CW0F 5TJJA 2DFIA 2JVOA 2GXGA 3IRQA 2KIUA 3ECHA 3TGNA 2V6CA 3JSOA 5K5OA 3B02A 1FYMA 4L5IA 1WF1A 1QO0D 1I1GA 4IRHA 3G9CA 1VQLS 4HQMA 3K0JA 4HF1A 3DKWA 4ESJA 3F8MA 1FSHA 1VQ7S 1TNSA 2V1UA 1XCVA 3BO2A 5AONA 3WGHA 2CQ3A 2X1AA 1O0PA 2H6CA 2YU3A 3GZ5A 2KXNB 3ZQ7A 1O3SA 2D1HA 2RU3A 1STZA 2FBHA 2RQ4A 5BMZA 2YH0A 3MXHP 3L09A 1ZAOA 5JI6A 3SXLA 2G4BA 2VC0A 3RJPA 2VBZA 2GO9A 1LNWA 2HKOA 5LBQA 1QGPA 5DCMA 1X0FA 3FHZA 1IQTA 3JSPA 2E5JA 1VC0A 2Z33A 4ENJA 2L54A 2CFXA 2DH8A 5JFRA 4PGGA 4MTDA 4I98B 2RGVA 3CMAS 5HDNA 3E5XA 3WTXC 2HZTA 2QFJA 2RRAA 3TYTA 1FP1D 4UV8A 3I59A 2MZTA 3WU0A 2Y48A 1H2VZ 3V8LA 5L3EA 1GXPA 4CIOA 3KEOA 5MLCV 3C3WA 4J5OA 3CTAA 1FBSA 4HA8A 3SZTA 3BP8A 3IKVA 4G94A 3O6BB 2M8EA 1XSVA 3FWEA 1U6GA 2MLKA 4ON0A 4P6QA 5JVTA 1LDKB 1U8RA 1ONVA 1G3TA 1KU7A 4KNYA 4LJMA 2EB7A 4KICA 5EEGA 1UHWA 2QENA 1LDDA 2IVMA 5AIPA 3GFMA 2WTEA 2CQBA 5CJ9A 2QWWA 4LLGF 1Q82T 3CUOA 2DK5A 1QZYA 2DH9A 4JBAA 2HOEA 3H2VE 4WFNQ 1UHMA 3BPXA 2N3OA 2KG1A 2E1NA 2DHAA 5ILVA 2FNPA 2F2EA 4LLLA 1R8PA 4EJOA 5LRSA 2OTJS 3R6SA 2KI2A 3NNCA 3N9UC 4U7DA 1U78A 2ZJRQ 2FE3A 2KRFA 2PG4A 5HS8A 3VOEA 1GHCA 3CUQC 2PE8A 4KUMA 3RW7A 3EGZA 2NNNA 5L3BA 2BBYA 1U5TC 1OPCA 1WI8A 2DGXA 2L4AA 3D0SA 2X1BA 1R8HA 4TU7A 1B9MA 2A6HF 2EK6A 3VB2A 3QU6A 5IQQA 5LEJA 4PDKA 3MOJB 2UP1A 4BH9A 2Y0MA 3HSRA 4G6QA 2M9KA 3MD3A 1QPMA 4NQWA 2EWNA 2ZBKA 1ON1A 3HIFA 4BHBA 1CF7A 1AOYA 1FO1A 1BIAA 3ZZYA 4HBLA 4I0AA 1Z6TA 3F72A 2XGXA 2EFWA 1VQKS 1YTYA 2TDXA 2HFHA 4I2OA 1WHVA 2ZO4A 1U5TB 4AIJA 4M6XA 4WKRA 3M7GA 3G73A 2XVCA 3N4MA 5DDGA 2LKPA 2DK8A 5CYVA 2GXBA 3T1BA 2WV0A 2LMIA 2PFBA 4A0XA 2HEOA 2ISZA 2NS0A 1K78B 2MY8A 2MKSA 2HVZA 2VE9A 2JRTA 2VT3A 4EV0A 2FY1A 2MKCA 2MBFA 3H3UA 2JPBA 2RQCA 3HRSA 3HSFA 2AYEA 4M71A 2ADCA 1IN4A 5HS9A 5L3DA 3THPA 4IOAQ 1VC6A 4Z2YA 2DGUA 2NYXA 4FX0A 3SXYA 3LPYA 4HV5A 4MHGA 2VXZA 1MZBA 2CQKA 1JJHA 1MDMB 5BPDA 1RI7A 1XN7A 2W85A 4ZYHA 2EFNA 5HDKA 4TV7A 2NZ4A 1OYIA 3E6MA 2CQ0A 2E44A 1PDNC 4Y17A 2VOOA 1IZ1A 1XGNA
chains in the Genus database with same CATH superfamily
2MC4A 1OFCX 2M7BA 4V19X 2ZD1B 1FMWA 1V3RA 2WY7Q 3COAC 2HKEA 1JQGA 2EVZA 4M3FA 3B82A 4Y2KA 4HEA9 2HRYA 1UWAA 3RBZA 3SBMA 1R5GA 2A10A 4E7IA 3HDDA 5J2QB 3BTCA 1C1BB 4LK0F 1S1UA 4B43A 3CJ4A 4RB2C 2VG7B 3C2BA 2CWXA 2DR7A 4WF2A 3KLEA 3CMQA 4A3EJ 3EE3A 5GP9A 3W2WA 3IBFB 3WTYC 4DUYF 4BKXA 4B9NA 4C8KA 3TVZA 1P9QC 3CESA 3MZIA 2DA4A 4WTYA 4LBHA 4D9JA 2APOA 5KFGA 3WIUA 2LTPA 3FEZA 2VASA 2EPFA 4YDDB 1TAQA 3HHLA 3MEGB 1YO5C 2KHCA 1JLEB 1W2BR 2C22A 2HHSA 1IWGA 3K5OA 1IQZA 4OYXA 2OPPB 2A18A 4MTPA 1UW9A 2W48A 4RZRA 1AA7A 3ISZA 1MSFC 1EARA 1OCCH 2OZ6A 1Q53A 2OGUA 2N7YA 3BDDA 2ZMEC 2X85A 3MM5A 1KYWA 1SQGA 2W57A 2HR3A 4CH7A 3H5RA 5L1LA 3PRVA 2FEZA 3P96A 4OL8A 3FKIJ 4ITSA 3EXYA 3J7ZT 2GX8A 3CUQA 1WJCA 2E1MC 2JSPA 2Y2ZA 1MDMA 2O61A 1XDUA 2QYGA 4ZIWA 3FXUA 3OR1B 4CDIA 2B0LA 1JWWA 4ALZA 1GTHA 4O4GB 3FGVA 1SJFA 3OXLA 3CC4I 1I51B 5F0HA 1N77A 4PK4A 2XY7A 1JKQC 3PL8A 2DJIA 5J47A 2B4OA 4RBVA 1U6ZA 1WSVA 5IP7J 5H20A 3FXRA 4L5JA 1UFWA 4ED5A 4XONA 2DPIA 2G1HA 3DOKB 2FVQA 2UUAJ 4AYBN 1RTJA 4Y2MA 3KIOA 2GVDA 2E71A 4K0KJ 2QM3A 3K5LA 4R8UB 1E3PA 2IEKA 5DO2A 3WTSC 1DP7P 3MWBA 4S0MA 2I2YA 2K3IA 3WC2A 4GMKA 3IWNC 3GIIA 4W4MA 2XLIA 3SEQA 1WI9A 4OJHA 3GYHX 1IWAA 4U7BA 2UXDF 1NK4A 4IRDA 4KT6A 4ZHRB 4Q8FA 3PIOQ 3H4DA 2V63A 3KDNA 1DU6A 3J7YU 3JCUC 3MPWA 3HDSA 2HRTA 3UW1A 2H1YA 4HYKA 2M5WA 3NMAA 5D6GA 1J2XA 5JR3A 1TKDA 3DPUA 1NJYA 1D1AA 4TYAA 3EPIA 4EMSA 3PW7A 1KU9A 4ZP6A 3V81B 1T38A 2CJYB 4Y0FA 2B5JB 2K3KA 3EXCX 1R36A 2VBWA 3K6GA 3QIPB 1ZELA 2GGPA 3L2QA 5J1EB 2E5GA 3NNAA 1D1BA 4C0HA 1W0UA 2MKHA 2MZSA 4DV4F 2LBFA 3PIOF 4M3DA 4BQAA 1BOBA 1H7XA 2LKZA 1XD7A 3M8JA 2BE7D 2JWTA 3I4MJ 3DOKA 3BH7B 3TWZA 3TJ9A 1IKVB 3GWZA 1BIBA 4U6PA 1P2FA 2VPWB 5M5YJ 4CYUA 4ED0A 3BDEA 2OQGA 1A04A 2GBYA 4E7HA 2COLA 2W4PA 5RUBA 3QATA 1HSJA 1QHHD 4H4MB 4EQQA 2OAZA 1YI2I 3M9NB 1TW3A 4BHCA 4LF8J 2YKAA 1PO6A 3G82B 3W5XA 3H9QA 1ICEB 5D6FA 1VJWA 3GLXA 4DX8H 2D3O1 1CGPA 1D9AA 3MPUB 2Y3YA 2IT0A 2R8KA 4NYOA 4RW6A 4UOGA 4OMFG 2BQRA 1QAYA 1Q5VA 2VODA 3C15A 3G86A 1P9YA 1ODDA 3WE3A 2KYZA 5HBMB 3R2CJ 2B4VA 5HLIA 4IH6A 2GV1A 5E3MA 3T1AA 4MIAA 2XASA 3BGUA 1H9GA 1A36A 5IT9K 4EJWA 1S0NA 1HI0P 2DXDA 2YU9J 4AD9A 1NSKL 4C11A 3QRRA 1HQCA 4RWXA 2W4CA 2R8HA 3TAQA 1YGYA 2OLWA 2GMJA 3CMAI 1U8BA 2DOEA 2NXJA 2AJ4A 1R6RA 4RUBA 2CUJA 2ZJRF 4RU2A 1OQ3A 5K7ZA 4E8UA 4KMUX 2ABYA 5I3PA 4O3NA 1P6TA 5HLHA 1YBAA 4DR5F 1M5KC 2B9EA 3CJRA 3A02A 1RLCL 3GZNB 4DCPB 2CJJA 3RQIA 3WE2A 2XKOA 3IHUA 1GXQA 2ID3A 2F7VA 3OSFA 2YNHB 1YBUA 3CCYA 3J7AY 1YZ6A 1RYSA 4OV6A 1RBAA 1USSA 3PJXA 4YP3A 1BLUA 2HVHA 5KT2A 2V26A 2ZVSA 1ZG1A 4ILRA 4XLAA 3I71A 2ZJQQ 4KV8B 2C3PA 1JE8A 4OZ2A 2CQGA 3F0NA 1J59A 1F6TA 3HGYA 3GE9A 2NZCA 4RMNA 4W92B 2V1DA 3SDGA 3OQ2A 3MM7B 4J37A 3HMJG 4N76A 2DA6A 1F9EB 3ZC4A 1XWLA 1BY9A 2E35A 5EZHA 3O3KA 4C9YA 5THWA 1WACA 4XQFA 1TQLA 3HULA 4P5OA 2VA2A 4YHHJ 4A12A 4X66J 3W2VB 2WVDA 3OVSA 2IS6A 4EM2A 1S72S 3BDPA 2DCLA 4CM0A 4JX5A 3WTUC 2QUFA 3MM6B 3N01A 2A6MA 2KH9A 4YDXA 1U1PA 2I9SA 1MMSA 1PUFA 3OUYB 3BREA 1U8WA 2OPRB 3D6TB 1JTYA 2M87A 4F02A 1TL1B 4RNOA 5HLTA 2H8RA 1RK8A 1YZ7A 3MM9B 4DX7A 2J76E 1XGOA 4EM0B 3WGGA 1FIPA 2VQGA 1C1CB 1HBOA 5ETNA 1MKMA 5A8WB 3MMBB 3DLLQ 4S04A 1BC7C 1GEHA 3S2HJ 3M8SA 3KK2B 3GBGA 1WC6A 3J81U 3O44A 2DO4A 4HACB 4QPXA 3ET6B 4FF4A 2Y1LB 4LF4J 2QLWA 1QSSA 1YYVA 2PEXA 1U02A 2BANB 3EETA 2RS8A 1LW2B 1H2TZ 3ABLH 4A4JA 4WKYA 2YVSA 1CJTA 3MMBA 1GMWA 1FIAA 5FLVA 4MKBA 1T03A 2HW3A 5DJBA 1CVJA 3S01A 3BSNA 2OAUA 1KTVA 3DU5A 1PP7U 1WC3A 2CPZA 2OQRA 3I53A 1HKTA 2J8SA 4USIA 4OYMA 2M45A 3GFHA 3V42A 2W2PP 4Y65A 2IP2A 2IM1A 3CDEA 1QVFR 2HZDA 4FT8A 2ZXHA 2ZC2A 1FERA 2GMHA 3HTUA 4CO2A 2ISYA 2OO4A 5D0RA 5ETVA 1ZA2B 2LY9A 3HI9A 2A5YB 1RLDA 3A01A 1IG7A 3I0TA 4RB3C 5BJRA 2VOPA 4NC8A 1SC1B 4BGDA 4RGUA 5DGAA 1U25A 2DHHA 2AMCB 4CCHA 5KFHA 1B7YB 2UWMA 3KP6A 3GXOA 1ZTRA 3KZZA 4KFCA 3HG9A 4PXEA 1K0TA 1Y9OA 2X4HA 4NX9A 2ERRA 2ID6A 1P8GA 1TAUA 3TANA 5D4RA 4NCGB 2XGPA 2Y8WA 1R71A 4JV1A 5ETSA 4GVBA 4LUBA 1A6IA 1KLNA 4ZLJA 2M2EA 2DNLA 4DV4J 3SHFA 5KFCA 4I56A 3W64A 2IBOA 3EDPA 3CE8A 4OIOF 1OISA 3DU6A 2HHUA 3PEJA 5B7WA 2IRFG 3H9GA 4M5HA 3KMSA 3RQ4A 3H5SA 3HZEA 3E7LA 3HSZA 5TGTA 1VRUB 3JQJA 1C2PA 4FF1A 4HDUA 2AJQA 3OSGA 1VQPS 4HZFA 3KK1A 5GTIC 2V2QA 5IT9Y 4I99C 3OFGA 2FY8A 4P55A 4WJBA 3K70D 1NJIT 2CVIA 1FE4A 3V5RA 5B0DA 1H6KX 3UWTA 1O7FA 4JYKA 3Q2SC 4HHHA 3QQAA 1Q8IA 1L3KA 3I64A 1NH8A 1UVNA 3MMAB 1KC8T 2W25A 3CCUS 1HW9A 2A07F 4B3MF 4H4KC 2FHKA 1N78A 5E3AA 4K2EA 3NL0A 4IQMA 4NLSA 2EILH 1P1LA 4TN2A 4L9JA 1TL5A 3HVTB 1D9DA 2L7ZA 2DMTA 5A2QU 4F0MA 4U0YA 1ZQ3P 3QO9A 4M5GA 4UT4A 3TZXA 2W01A 2XZDB 1H2UX 5LM7E 4A2UA 3PKMA 3IAS2 1FHTA 5H9FJ 2SXLA 2U1AA 2ZC4A 3W5ZA 2DAOA 1S1VA 4TU9A 2BHZA 3OTCA 1Y10A 1XB4A 1FJ7A 2IHR1 2OMLA 4NPOA 4KY3A 1R0AA 1MN9A 1V3FA 1ZRDA 4EEYA 4OAYA 2KIQA 4LG3A 1MU2A 4ESBA 3GJRB 2HTJA 1RHQB 3PG9A 3JSRA 2MD5A 4FKXA 4ZPVR 1ZR4A 2QQ9A 1WC5A 1IXKA 2JL9A 1FOXA 2EZKA 3CD5A 2V1XA 4ZYGA 1Z1DA 3S1TA 1MWYA 3B4MA 4FXWA 1R3NA 5CAAA 2R5ZB 1Q0NA 3Q0WA 1CQTA 5DLFA 4FVMA 2AYGA 1RTJB 2GMLA 3RIRA 2IS1A 5DQHA 4DLGA 2PC6A 2QCOA 3E1SA 4KGKA 2LOOA 1VBKA 2RS2A 4KJZA 4N56A 3HBLA 2XGCA 1OQ6A 1SV5B 1U5TA 5J2PB 2PJRB 4O3RA 3FXJA 1OWXA 3I82A 3UD5A 4R1HA 3BQZA 4TLRA 2COMA 4JI8F 4PUOA 3FK7A 4MTEA 1W1WE 2D69A 1P4XA 3BR8A 3IC1A 3DLKA 1S4EA 2HBRB 5HDGA 2HHHJ 2ZH7A 2YNIB 2HQIA 4F4YA 3DFEA 2KXFA 3O2PE 4IOCF 1X4AA 2J5PA 4LF5F 4P9FA 3VFZA 2RREA 4NLUA 2BEOA 2CH0A 2V5HG 3F56A 1XIQA 3AL0B 2LECA 2JLEA 4FYWB 3NRVA 2K9SA 3SFUA 1K83J 2NYHA 3OHAA 1HHQA 2QGUA 2F5DA 4ED7A 1NSQA 2JJ4D 1N8RT 1D0XA 3UD4P 4OJ3A 1V5EA 2F40A 2FQQB 3KKFA 2WB4A 2XMWA 4CA0A 2H4YB 4IFVB 1YJNS 2YKPA 1SFKA 1X2MA 4ITVA 1ETWA 3C15B 1HNWJ 1A6LA 3QPTA 3G6EI 1ZG5A 2VJUA 1NHVA 3CJ5A 2FU4A 4O3QA 5J2MB 2A05A 1QLNA 3GTGJ 3W65A 1IKXB 3K4MA 4M9ZA 4PJLA 2ZCWA 3TL4X 3SQOP 9ATCB 3LNQA 1BMQB 2BJ8A 4F0KA 4AL7A 3GZ6A 4RAYA 3T0YA 4GO5X 4O4RA 1Y3KA 2WW8A 4CCLA 4URGA 1RR7A 2RN7A 3PSFA 4MFBB 2PFDA 1RETA 1WSUA 2QJ3A 3GV7B 2MQLA 4XO0A 1N75A 3UVJB 4NEYA 2E5IA 1UZCA 7AT1B 3P5BP 3JAMZ 1YJNI 5E18F 1F9NA 2HXIA 3ENQA 3DTEA 3M6UA 4OX9J 4FYYB 2BVZA 2G1DA 3OR2C 1ZPWX 3TOAA 5GAEJ 1HYSB 1QSYA 3KJQB 5DG7A 5DUIA 4WIIA 3MD1A 3QNWB 2OELA 4OV1A 1FA0A 1Z1ZA 1M1HA 2XHKA 2N7CA 3M1EA 5D0GA 2L9VA 1EKRA 4L18B 4A3KJ 3FZ2A 1RWNB 1TL3A 1KDNA 1PYSB 4C8YA 1U7LA 2DY9A 3MCMA 1LWCB 1WRJA 1BGXT 4HL9A 2CNNB 4HG2A 5IOZA 4OMZA 1U2WA 4C11B 2AXTC 2XYGB 2Q0OA 4I6AA 2JDJA 1HNXJ 2CO5A 1VBYA 3KLGB 3B54A 2QFIA 3LP2A 3S8PA 3BLYA 1XMBA 2DGQA 4F3QA 2W2NP 5C2CA 2P9CA 1MMLA 3RRKA 4NXNF 1PG5B 4F91B 5AJ3J 3PUBA 1O3TA 4U95A 1VBZA 1U9OA 2LXIA 3E97A 5HJYA 3GUDA 2B56A 5DM6F 4WXCA 1E2XA 1OCTC 5A8WA 4PQAA 4MQ9F 3A8KA 2EA2A 2X6WA 2J0SD 2FNAA 2J9CA 2QYCA 1JXSA 2LKSA 1DRZA 1OCOH 1FRLA 2DT5A 3U1NA 1QY7A 3NGDA 2X6YA 3MMYB 2VONA 2JLGA 1F60B 1OLTA 3D1NI 2NVUB 2VLAA 3LWFA 5J1UA 4HI1A 2JOQA 4ZVGA 2DT7B 1JGSA 3QT7A 4KC5A 2DEJA 5C24B 3GFJA 2GIRA 1FBUA 1ZGAA 2BJEA 3HF5A 3JQKA 1S9GA 1S6PA 4WCEQ 4E4HA 2ZD1A 2J5AA 5LGTA 1RT4A 2X1FA 4IRCA 3DOLA 1AZSB 2GAGC 5IV3A 2EIMH 2RJZA 3IO1A 3MUVP 4XORA 2W9CB 2LREA 1Q8BA 4KFBB 2KDOA 1WF0A 4JI4F 5DRKA 1ZZFA 3MM6A 2GQQA 4WF9Q 2CVEA 4EO8A 4X62F 3PM9A 4RW7A 2GVDB 3THTA 1E6YB 3PYDA 2R2RA 3M8FA 3ZP5A 1EH7A 3M8ZA 2KFNA 1X4HA 3ZTOA 1BUXA 4KFBA 4DL2A 2CQXA 5ICGA 3AJ1A 5F3TA 5EGOA 3FEYB 2GZOA 1P27B 2R9LA 2PMHA 4Y2CA 1W5SA 1M1EB 3RUBL 3D68A 2C3MA 4UOHA 3NMRA 4DR7F 2ZH6A 1FXRA 3KP5A 4ZYEA 2FHMA 2PI5A 3HLUA 3I32A 3JRDA 2GIFA 2EK1A 3R5CA 3QWUA 2RE1A 4RW4B 3BPSP 1XMOF 1SJ3P 1RAHB 3UCUP 3D1HA 4A3MJ 3AG4H 2ROPA 1RNLA 2ZC3A 4ASNA 5KHDA 2KU7A 4KDPA 2M1BA 4LRAA 2ICWG 2CQ4A 2PMWA 2AYBA 2R7FA 3DN9A 3IC7A 3HUGA 2OPPA 5LL6d 3PKYA 2K3PA 4Y4RA 4A8XA 3LP0A 1LK7A 4E98A 3NLCA 2MLZA 1PYTA 2VU5A 3Q86A 4IEJA 1YW8A 1NUEA 1PAEX 2BANA 2J5OA 1ZLKA 1UAWA 1G6BA 3VVTA 4X62J 4LJZF 3LOUA 3VAHA 2HIYA 3U9GA 2XM3A 1QNTA 4J9UE 4ECTA 3ZQCA 2XMMA 5LRRA 2YUSA 1U2RA 2W1BA 1SC3B 4JX6A 3OYLA 3VSLA 4DX5A 1XTAA 5H2FC 1JJ6C 4GKKF 3IG1A 3M8PA 4PJNA 1N25A 1O3RA 4M5DA 2MG4A 3MTKA 1XNQF 1TBXA 3VWBA 4Z37A 2CJXB 4Y15A 5DM7Q 3AOAA 4CUGA 1SKRA 5AXLA 4V2FA 2XZTB 2K02A 3HOYJ 3MPDA 3K5NA 1YOVB 4X4VA 1JLAB 2ASDA 1WCMJ 2CJ9A 1PJ5A 3V7RA 4LFCJ 2X48A 3GYNA 3KFWX 4ZH4F 3H36A 2MJNA 1ZK8A 2LQJA 2IYIA 1V54H 1X4CA 4A3DJ 4CLFA 2ACMA 1NZ8A 3GR1A 2WB1N 4ZVTB 4NXMF 1VQ5S 4DWIA 5GADU 1VQ9S 3OOUA 2MD0A 3B73A 4A3FJ 5HODA 2LEBA 4YUDA 4DSJA 2FJEB 2DR9A 1KU3A 3W3CA 3W7BA 1FXDA 2L9WA 1IN8A 1G3OA 3S6EA 4R0JA 3VHQA 1S8NA 1KYZA 1MBEA 1PYOB 3PW0A 3HSDA 2HFUA 3D28A 4U7CA 1WC4A 3M1VA 3M2VB 4BHQA 3ONQA 3DF8A 2EBEA 4FP9A 1BR1A 1OY8A 1MBHA 2YKMA 3WU2C 4K0KF 4DSIA 2WVFA 2JC1A 2XAFA 4F3MA 4C8NA 1A9NB 2E2JJ 4HEA2 1DP3A 1SL0A 1JGGA 5C2GA 2KM8B 5B0EA 1S1WB 5GADJ 2JEIA 2K9QA 3LSMA 1U8SA 1QD1A 5L1JA 3MDFA 2B7EA 5J8CA 2OA4A 1FNOA 2HZAA 3DOMB 4U7UK 1TK5A 1RKJA 4ICLA 5H1SV 2E9ZA 1DDNA 5FLXZ 2MSSA 1BJAA 2KZGA 2DYRH 4YN3B 3DLGB 2W4DA 4TKTA 1N32J 1HW8A 2E7VA 5DCMB 2P2CB 1YRNB 5F64A 3DLBA 1WWHA 1TKZB 3CXCR 3PFEA 2XGDA 1FRIA 4OI1A 5F41A 3NBPA 1URNA 1XMQJ 4UUVA 1W7PD 1ZN2A 1W4MA 2DLLA 1HR0J 2VPRA 3RYRA 4IDKB 1Y11A 1UPPA 2RAEA 4RW6B 1HBNA 4X2BA 3WTZA 4P2SA 5L1IA 3E3XA 4BLGA 3NP5A 3NAHA 2H6BA 5BR8F 2NVTJ 2CA9A 4UUSA 2UUCJ 1G1XA 3PM1A 1HWLA 1RP5A 3BN7A 1VS3A 2FHOB 4OI4A 1GXTA 2RQKA 5CVIA 4D5FA 3ZCOA 4M9SA 5SUHA 2DNNA 3R0JA 2Z2MA 1GAOA 4LFCF 2TRTA 4J9SA 2B7CB 1LE8B 4HQEA 3KLIA 1TTHB 4OYOA 4G3IA 4K5SA 2YNFA 4HT5A 2VG6A 3CF2A 1WHUA 3A4TA 2GC8A 3BEGB 3BGOP 4B3MJ 3BY6A 1TP4A 3KE2A 4N47A 3M30B 5HMWA 2XHCA 2GHVC 2GFFA 2YPYA 2DYSH 4XOTA 2B0GA 2VFTA 2FBKA 3EWGA 3BZCA 3MEXA 4DR4F 1UCRA 1IXSB 3HYIA 4XKCA 4GVBB 4AVPA 3WODF 1IJWC 3CJRB 1LUJB 2XO7A 1J5EF 3Q8YA 1I94F 1T05B 5IOLA 2HGCA 3MURP 2BE2B 3FHNA 3TMOA 5IC6B 1WSRA 8AT1B 1WTFA 4BXUA 2DA2A 4Y6IA 2PMUA 2RKIB 2Q79A 2YBVA 1HI8A 4M94A 2QA2A 4LREA 1TQIA 2CPJA 2OI2A 2ADBA 1UFKA 1ENHA 3NNHA 3SQNA 3R4KA 3M9MB 4A5NA 3N97A 2L9NA 2F5GA 2DOFA 4QYZJ 2D3OR 4A8OA 4X4QA 1NJXA 3P7NA 2JA7J 1N88A 3VGSA 5HMXA 1J5EJ 2STWA 4Y52J 1KQ0A 1Q1HA 3W8PA 5DD4A 5FLXY 1TWHJ 5ILUA 4BS9A 1MWZA 4ZJOA 3M8PB 2HSEB 2ZKTA 2KZMA 3KK2A 3I4HX 3HOSA 2LQ8A 4KISA 4IG0B 1F5AA 2OFGX 3ULQB 3JYTA 4KAIA 1HR0F 1LW2A 1Z91A 5J3LA 4USHA 1OJ4A 1A35A 3JAMU 2XF7A 2XBPA 3BPDA 5JVGQ 3IGVA 1MROB 2Y0SN 3S3MA 4ZJQA 1Z7LA 3FSIA 3BQ0A 4Y2IA 2KQRA 5FJ4A 1MMAA 4F52A 5J1YA 3RG6A 2ACJA 4WP3A 1NK6A 4WFZA 4NA1A 5B0CA 4OU0A 3IRRA 3BJOA 2OEKA 4Q0BB 1B9NA 3P45B 3V81A 2O8XA 4KHPJ 3R5GA 3AD8C 1N36F 1AWCA 4JI2J 3D0HE 5AE1A 1KTQA 4F7VA 2O8KA 1SD6A 2MQ8A 2UVUA 1VQ6S 3BCBA 3KYLA 4KR0B 1VOMA 1YQAA 1NKEA 4CTAA 2DT6A 4KRWA 1BW6A 1OYWA 1S7EA 2JEGA 3OD2A 3KK3B 2YH1A 3EVWA 2O5DA 1N56A 4G7ZF 4QJVA 2GA2A 4BUPA 1NK2P 1RBLA 4XDCA 2JZYA 1Y5NB 2ZBCA 2PEBA 2H1KA 5F8IA 2K5CA 1DUXC 4I01A 2NXNA 4XLFA 1JXLA 1YITI 2CJBA 4MH8A 2JVOA 2NYIA 2GXGA 2X9DA 3AQPA 2DDBA 4F04B 3GFXA 4IRHA 5JHFA 4LIUA 1RABB 2HQ5A 2IVFB 1VR6A 4S0HB 4HF1A 2RKIA 3UNYA 1KBRA 5AONA 1NH3A 4TVAB 3K2YA 2CZ4A 1O3SA 1WDTA 3VR1A 4QR1A 4DPTA 1T08B 2RQ4A 4X0GA 3VGVA 1RTIA 3MXHP 3POTB 5KT4A 3CCVI 1MBKA 2HKOA 3T41A 5HN0A 2JA8J 3Q23A 4P2FA 1WJ9A 2Z33A 5EG0B 1ZBTA 2VICA 4ENJA 4WE1A 4M63A 2DH8A 1B99A 1ZM2A 4PZVA 4PQUB 1H8AC 4MTDA 3E5XA 1OSDA 2RRAA 3TYTA 4UV8A 3C16A 3L2VA 2MZTA 1UG0A 2YKNA 2Y48A 1RT1A 3PFOA 1REGX 5L3EA 4A8MP 4O4GA 4JI0J 2YNFB 3KEOA 3RGIA 1IKXA 2JJ7A 4NCAA 3G8QA 3BP8A 2RDJA 3IKVA 2M8EA 5DLGA 3FCHA 1U6GA 3K4JA 4C3LA 2W7PA 2MLKA 2HAFA 3OYAA 2E19A 4ON0A 3QT5A 4P6QA 5GPAA 2F6CA 1U0SA 4DPWA 4ECWA 4BJTA 1ONVA 2GW8A 4JBCA 6FD1A 3PFYA 3I9V9 1UJ5A 5B0GA 5EEGA 3HXMA 2VIXA 3FBNB 5AIPA 3QLHA 1TT0A 4Y33A 5EYRA 3DDNA 5KFQA 2DEIA 1KRPA 2QWWA 2UV8G 5KFKA 1CEZA 1JLCB 3L7PA 3TARA 2VKDA 1QZYA 2PI4A 4JBAA 1EJ9A 3S2DJ 3BPXA 1YJVA 3G87A 1U09A 3CB4A 3W2VA 4PYDA 5A6PA 1VF9A 4LLLA 1R8PA 2KI2A 3N9UC 1KS2A 3H1CA 5LMNF 1CULA 5IT4A 3FVYA 1S9HA 2KRFA 2D3UA 5HS8A 2WADA 3HL2A 2C42A 4RR5A 2VUMJ 4FNIA 4Q44A 1VQMI 5EWFA 2PE8A 2Q1LA 2HYJA 1LWFB 4TY8A 4ENOA 1DTTA 2QE5A 4PFOA 2YY3A 4CT9A 3FSXA 2RD5C 2QO3A 1WI8A 2X1BA 2EBGA 1L3SA 3QU6A 3ZZ0A 2BE2A 3MOJB 4RAGA 4BQNA 1CJKB 1FWLA 3LP1B 4EUVA 5IYCJ 1DTQA 1N0UA 3HSRA 4G6QA 3H25A 1QPMA 4NQWA 3MCNA 1TZLA 3HOUJ 1ON1A 4BHBA 1R49A 4DQQA 1Z6TA 3F72A 4I0AA 3KJVA 1YTYA 3LALA 4XOPA 3I9ZA 2ZO4A 1HI1A 1U5TB 5J2PA 2CFOA 2LFBA 5J2NA 3G73A 4LR9A 2H3EB 4A93J 4ZVPB 4F0HA 1P7JA 4CLTA 1R0AB 5I3UA 3DLHA 5HQLA 2W1OA 3I3LA 2LMIA 1FRMA 4MKVA 2VE9A 2FY1A 2ZBIA 2YKQA 2MKCA 1RWKB 1KQFB 3Q22A 1UTAA 2UUBF 3EICA 2W7NA 4YR0A 3HRSA 2E5ZA 2C2EA 1X3WB 3SYZA 3EZUA 3LWMA 2ADCA 3DCAA 4ILMA 5HS9A 5L3DA 5IP9J 2DGUA 3NGSA 1LQ9A 4LIVA 4FX0A 2XI2A 4HV5A 4DU7A 4MHGA 2VXZA 5H9EK 4ZVEA 2WOMB 2GJIA 3PX4A 1TR0A 3KLFA 4JI3J 1VQKI 5IP6A 4IQJA 4XN3A 3KG1A 3OYEA 2HPIA 4DUZJ 1QE1B 2AWZA 1UHSA 4L6V3 1SANA 2E44A 4NA3A 1PDNC 3PJ9A 4Y17A 2HLTA 1IZ1A 4DMZA 1GDTA 1QQIA 1WGXA 1N36J 4LSLA 3I96A 2M8DB 2UUBJ 1ETKA 5FD6A 1ZARA 3LSGA 5M2RA 1GMUA 2C2ZB 1HCRA 2LVWA 4O44B 3W2WB 3FBCA 3CCJS 2RQPA 5LSLA 2MC3A 3PIPQ 3G6XA 3LA3A 1RHRB 3M2RA 3QQCD 3C46A 1FLIA 4KKOA 3KK1B 3E6CC 1YHQS 4II2A 3S17J 2VFUA 1BN5A 3C18A 4Q47A 2FJWA 2FD5A 5AIQA 3H35A 2QL5B 3GTMJ 1RHJB 2HGLA 1OR7C 1YRXA 4YR3A 4U67Q 1NJWA 1EB0A 4FBTA 2DMUA 3HZGA 3MECA 5L39A 4QPQA 4EM1A 3W6VA 3QZ8A 2QSFA 1K61A 4DR3F 2LEPA 3R7BB 1ZM3A 3H9JA 2JN6A 1XGSA 4WIQA 3CCEI 2RB7A 3D67A 4KQZA 5KVRA 3TA0A 4V19K 2MHNA 1ZGWA 1P6RA 5K7FA 3H5UA 4CH1A 3DRYA 2KO1A 2DNKA 4KYZA 1SC4B 4OZLA 4AYBA 3DHWC 3WDOA 4G7HF 2XAUA 1QVUA 4D5CA 3NEUA 1D0ZA 3IBWA 3W8GA 1YJUA 2NXEA 2Q3PA 2XB5A 3MAAB 2OPQB 3R0AA 4L5EA 1PBUA 3JRAA 2JRMA 3UCZP 4QIVA 2HFZA 2KB2A 1VTNC 4ZN1A 1HF0A 1S10A 5JHUA 1X4EA 3RU0A 2YX7A 4ILLA 2E5HA 4X66F 1JLQA 1WKJA 2RRBA 3PVXA 3NQOA 4EBEA 4DR2F 5DQIA 2CXEA 3MZYA 3J80U 4QZVB 4MQVA 4CCMA 2WC2A 2M7SA 4M5DB 5TISC 3DBLB 1F3FA 3PEHA 1JUMA 3AB4B 4ECVA 5ETTA 3WGIA 2GJ2A 2BQ3A 4EZ6A 4KO0B 2RF2B 2LCWA 3OS1A 5HVQC 4LT6A 2IJLA 2HQGA 3OYHA 3HHNB 1QPIA 5H6QA 2XHWA 2IM2A 4LQ9A 2FVSA 1CG2A 3NY0A 3DGPA 4DV7J 1NHKL 3HM9A 3HHHA 4DQRA 1FFWB 2C2RA 4LF4F 3JW4A 1SMYF 4XRFA 3NOCA 2J9DE 2JA6J 2KL4A 2DQLA 2HPMA 4RW8B 4OZ1A 4EO6A 3CMYA 3FQKA 3CCRS 3MKWB 4HDGA 3JRGA 2VG7A 4C8OA 3FK6A 4FPIA 4HH0A 1S7HA 4N0BA 3FRZA 3UN3A 4B9SA 2DXIA 4LFBJ 2WVEA 1Y0UA 3VQSA 2ZDPA 1J0RA 1ETYA 2CWKA 4DQPA 1UMQA 3MAJA 4HH1A 4A8FA 2DOAA 2QA4S 1R1VA 4XIDA 1D09B 5ETOA 2RVCA 1B72A 3N05A 3MAAA 4X4UA 5KT6A 5M3FJ 2Y69H 3J7YJ 5CVRA 2OV7A 5CHCB 1ZOTA 5E3OA 5GAEU 4HVZA 3MEEB 4URSA 2XLJA 1HW1A 3FX3A 3ZR8X 4GKJF 3CC7I 1BD6A 4JI7F 2C2OB 3ITHB 2JZ5A 2W9BA 1IXRC 2YXLA 3QRQA 3HKZD 2ZH9A 2HGNA 3HEFA 3I0RA 3BG3A 2JEFA 5ICFA 5ED4A 1VQOI 2TCTA 3ZMDA 2C2NA 4OJGA 1YJWS 5JVGF 3G4SS 2HZVA 1Z0XA 3FF5A 1SH2A 4ER8A 3LSPA 3K0LA 5KG3A 2XQCA 4NYZA 2LYCA 2DHXA 3DI6B 2KT2A 3CMES 4IFYA 5EEHA 3CVKA 2P7CB 4BL0B 4RW7B 3H2UB 2F4MB 5F8GA 2KTQA 1IRFA 4EATA 2HIQA 5KG6A 5EN1A 4DOZA 1XMAA 3PR5B 3W6KB 2EW9A 2Y9ZA 2B43A 1NTCA 2B4UA 3K7AJ 1R9TJ 2EG2A 4TYBA 3I4PA 1AUSL 3TOQA 3C7JA 4PYAA 5H6RA 3REOA 1DLOA 4NXMJ 3N6LA 3KLFB 2WW4A 4WXWA 2O3DA 2ZJQF 1FX4A 1GX5A 1WC1A 2BJDA 2CU7A 1BQNA 4C3KA 1U1OA 2O6GE 2X6OA 4H0EA 3K89A 1YFHA 3MM9A 1LE8A 4FDFA 3BG9A 2N8GA 1MBGA 2KJCA 3H5NA 3HVTA 3T1HJ 1U1KA 4LF6J 4LRDA 4KJIA 1RT5A 3A2KA 5IPAA 1BI3A 4YIIA 1RAFB 2H4WB 5G0RB 1EV7A 2ZB9A 4C97A 2Y0SD 2RDIA 5AE3A 1M1GA 3TKYA 2QRRA 5FLMJ 3IKTA 5F8LA 3DBRB 1X9MA 4LSNB 2HWTA 2A3SA 3DWLE 4Y13A 5F1RA 2G0JA 3A1YG 1ZS6A 1FDNA 4KT0C 4USJC 2MLYA 1XDSA 2F9DA 3EPGA 2KL8A 2WY8Q 1XCBA 4XRSA 2VBYA 1DGRM 1T3OA 1D8JA 2J9EA 1I3QJ 4ED8A 2EPIA 3ISND 3BF4A 2B5JA 2IMWP 2H94A 2LXUA 3RW6A 1CF7B 3IS9A 4G8XA 1QZZA 2AHOB 3GJSB 3EX7B 3EPZA 3EDQB 1PSDA 4CM2A 3BV8A 3CCVS 2DNHA 1B3TA 4QBUA 1BE4A 2WSEC 3C16B 2GZWA 2OPQA 3WX8A 1J5OA 2QLFB 1IKVA 3PRDA 4ELVA 2HHXA 4A3JJ 4A0ZA 3CNQP 3SZGA 1HARA 3G1LA 1SD4A 3HOWJ 4DL0C 4P96A 1FD8A 2Y0SA 3ZZOA 3Q83A 1UWBA 3ZXWA 3HKZN 1TV6B 4U8YA 4DR6F 2LSOA 4DJAA 1Q4RA 2EFVA 2IY5B 2IA1A 4L9VA 1J5YA 2B63J 3OL3A 3SDBA 2BUNA 1G2HA 3KEQA 1N5YB 3PTWA 3BR0A 2D41A 4MGRA 1I39A 2E9TA 2CQ1A 3ICLA 2WAEA 2EFPA 1VLYA 1W5TA 2QL9B 2BGCA 4DR2J 1AKHA 5F0WA 1MJ9A 3T8RA 4DEZA 3FBIB 4AXIA 4TY9A 1LVAA 3PSIA 5IXUA 2IPQX 4DDFA 3R61A 3PY8A 2QQBA 4UUTA 2L02A 4X6AJ 1T6SA 1RESA 2JWNA 4DV7F 2E7WA 5J1PA 1Z05A 1FK9A 6FDRA 2ETHA 5JLXA 2VJ5A 1UVJA 1FCAA 2LDUA 4N7TA 3VAFA 4FHTA 2NVQJ 2ZNYA 4M74A 5FDLA 4QWQA 4HRIA 1QUVA 3DGPB 2DXFA 4JQFA 3FXLA 3WHBA 3IAM9 4EFAC 3HKZA 4I67A 3X3UA 1RT5B 4FS2A 3T9ZA 4MK9A 5KFSA 3AL0C 3CLQA 1KOHA 2VKHA 1VZ0A 1C0TA 1Z7UA 3KPHA 1O6XA 1UJ4A 1LKZA 3CF5Q 2CQ2A 2BOPA 2AGPA 3KMQA 1KQSR 4AIDA 3BTJA 4MJKA 5E3QA 2QTWA 3OYBA 1N5TA 2G9OA 4U8VA 4ECYA 3P5TL 1LFWA 4RLFA 2VXDA 2NSCA 4NBQA 3J80Z 1SB6A 2IGMA 2BHYA 1LWXA 4RB1A 2NPIA 5LT5A 3K5MA 3PCOB 1FWKA 1BOAA 3MFIA 2E29A 4RUCA 4KYWA 1FFGB 1FP2A 2MQMA 4ZVHA 2BV3A 1X5OA 3V7SA 1GNKA 4R0EA 4UB8C 4ZHRA 3U1MA 3IUOA 5BPIA 4KIFA 5H9EJ 5IT0A 2YKNB 1BI2A 2V4JC 4DLEA 3RPUD 4N77A 5GAGI 2D9PA 2DPUA 1DFDA 1CQNA 2WAQN 2NRAC 5CVUA 3J81Z 4A8KA 4PJMA 1H9TA 4UF4A 5E41A 3GV5B 3QAEA 3H59A 4R79A 2FVPA 4BAYA 3TJAA 2QF7A 3BQYA 4DX6A 2VV5A 4TU8A 2V4JA 2MA3A 3PACA 5ETQA 2M8HA 5J6XA 5K14A 4DR6J 2NQPA 3HJEA 3O1LA 1ZR2A 1F9FA 5D0HA 5KFNA 2CJQA 3CCMS 4YY3J 3MUTP 1ERDA 2DKOB 4GGGA 2G0IA 3D3CJ 3MM8B 4IF4A 3FBFA 4QYZK 2BJ1A 1B1BA 1ZRCA 1NDLA 1S1UB 3DXJF 1BI1A 3LSTA 3K1MA 3BBCA 1R4NB 5GVQA 1V5VA 2K8GA 1WG5A 2XDVA 5FROA 1IUJA 1YWXA 1UZDA 2OCCH 3CCLI 2CG8A 2KN4A 3D5SC 2QC3A 2E1CA 3P9IA 2DGOA 4ELTA 1TU0B 2YX4A 2A6EF 2IRXA 2QKMB 1IGNA 1FKPB 3PYGA 1C0UB 3ILIA 6AT1B 4M6YA 3D1QA 2VDIA 4C30A 1MLAA 4YB7A 2VKEA 1Q7YT 2Y31A 4FBUA 3H5AA 3DYAA 4DXLA 2V9WA 3R5JB 3CJNA 4F4WA 4FF3A 2J0WA 5EHHA 1R7JA 2VQHA 4RJVA 1OMSA 4DV5J 1U24A 2KRRA 4AYBD 2UV8A 1GXUA 1FE0A 2QEXI 4A3GJ 2JRSA 3FXKA 3M8EA 1JNRB 3PX6A 4CZZA 3T5KA 4DN9A 3CZ6A 5A8KB 1WZ2A 1UJ6A 1K9MT 1RWOB 3C1DA 5CPRB 1S48A 2K1RB 3C6TA 5LGNA 1OSCA 3CCLS 3Q8RB 3EQLF 2L9DA 2JFKA 4JI6J 4DPXA 4J91A 4F26A 2LDIA 3J80Y 4OZ3A 4Q2LA 1RTDA 2V9KA 1JKHB 3ERED 3DXBA 4JV5F 5EGOB 1SV5A 2P6TA 3MN2A 4P1WA 1BBYA 1R8CA 4N9HA 4KIAA 4XLNF 3QU3A 4A5MA 3DOMA 2AU0A 3MR6A 3K70C 2DDAA 1GLNA 4JI5J 1EF4A 2EZHA 7FD1A 3IXQA 5KAFC 1HD1A 4PZJA 4K2XA 4OYIA 2RHQB 2KXHA 2YNIA 5HP1A 3E5UA 3QGGA 3B8HA 5IWAF 4ZK7M 3KLHA 3D6HB 1IDYA 4E7JA 1VYAA 4JYAJ 4K7QA 3GFIA 3KTQA 3MF5A 3HHKA 1XNQJ 1NB7A 4PR6A 4KT5C 1FKAF 1TWCJ 4D7MA 1U2FA 2YQ0A 3DKYA 5CABA 4BQOA 2EV6A 1NK5A 1RT2B 1P7IA 2UXCF 1X4FA 2B3TB 2CNLB 2CYYA 2LP0A 2P4WA 2DMNA 2BW3A 5BOXA 1CJKA 2L3MA 3LP1A 4NLQA 3A3PB 2KISA 4ETSA 2ATCB 1MN7A 4AT1B 1S29A 2I5JA 5CVJA 3A12A 5A0YA 5GMDA 2JNJA 2WSFC 4FYDA 1RT2A 3CJKB 3KLIB 2R2SA 1IKWA 2OD4A 5LSRA 3IM8A 1C4AA 1X4BA 1R1TA 4NLYA 4HAMA 3H40A 4NC6A 1FY7A 4AQYF 1AU7A 2P8TA 1WKLA 1N5QA 3HPGA 3CCES 1IKYA 1E6VB 3CJ2A 1QHGA 2HOTA 4IKAA 3PZPA 2B9YA 4XIUA 1RB0A 4NC7A 3IRXA 1VQ8S 4OAZA 1A31A 2LNBA 2FB0A 3M8WA 2MZQA 2DJWA 3R8YA 4E70A 3A3OB 2FYXA 3DXSX 4WZMA 2HQRA 1KA8A 1UVMA 4M3EA 4F92B 3ET6A 4ZVRB 1SPBP 2ASJA 4UQTA 1YW7A 4WXHA 2BY3A 3BJ6A 2DMPA 3FBEA 1FRHA 3FZVA 2JK3A 2YPZA 4CYCA 1QBJA 2AXLA 2VG5A 2ATLA 3BKUA 2R7WA 2GM4A 1XR5A 3V6KA 2XIGA 2IMOA 2F4OB 1FXLA 2H1LA 2K27A 3CO0P 3K10A 1J2VA 2FIUA 1OCZH 2Q1ZB 1YJRA 3PIPF 1DPRA 3ELHA 5BS6A 2VHGA 4J9RA 4XICA 2FF4A 4A69C 2XF6A 5IZHA 3LQQA 4G1IA 3G2XA 2LK2A 1BI0A 4BU2A 1RWXB 1YJWI 3ZNUA 4A47A 4B9TA 4TLQA 4KHRA 4XTTA 3ML6A 2FOKA 5DDOC 4JX4A 4DSFA 4RNNA 2IBDA 5DD8A 4RW9A 4I2PB 2X1GA 3TRGA 4LB6B 1MWQA 5E3RA 3OR2B 3PFIA 3ZZZA 4AC0A 3LP2B 3CTRA 4YIFA 3KLVA 4II3A 3DC2A 3GMGA 5E5NA 2XF5A 2YKMB 3QAHA 3IMQJ 1ZRFA 3C8YA 1TELA 3EUAA 1RT3A 2MGZB 1ETXA 1VQ7I 2BQUA 4K4ZA 2EIJH 2VH7A 2YNHA 4W90B 4QIFA 3L95X 2VFRA 2QKLB 4ZN3A 1WEZA 2Z57B 4DBRA 4BEHB 2Y30A 3D4JA 3QPIA 1JJ4A 2HWHA 4DV2F 5IM0A 1DBDA 2NUHA 3NCQA 3I31A 1WHYA 4QIEA 5J2MA 1X1CA 3DRPB 3S1MJ 4UVBA 2WZ1A 3R3TA 2FXAA 5FKNA 4EEFG 2UXNA 1I6XA 2DPJA 2KT5A 2J7WA 3OL8A 3NG8A 2YS9A 4I1TA 2WAFA 3EDRB 4JP8A 3A01B 1CLFA 2HHPA 2HNYA 1CC7A 3QYBA 1HC8A 1UA1A 1U2CA 1UL3A 2XC9A 3AHPA 1KGSA 1RJJA 4C4WA 2VT2A 3KP7A 2JFDA 3ILLA 1HOMA 2HQ3A 3LQVA 2J0XA 2AT1B 3CCZA 3SCKE 1QZEA 2HHHF 4ETXA 1JHHA 2VZ9A 3M2RB 5KFJA 3ENWA 3HFKA 2CQPA 2I38A 4XLCA 2CNKB 1R89A 1MH3A 1CS4B 3JTGA 3A1YA 4RNMA 1NO8A 4CO4A 3CC2S 3QJLA 3BPVA 2XC7A 4IHYA 1W25A 1JKRC 2J6TA 2FUG2 1PJ6A 1N6QA 4E7LA 1JJ2R 2DNOA 2MMYA 1P4WA 1E3OC 3KLOA 1IVZA 2AF6A 4DFJA 3F8NA 4DPUA 2VPXB 1HSTA 4CI0B 1T0FC 2NAZA 1B0TA 2QYOA 3TP3A 2XAGA 3M32B 3QIPA 1G3SA 5DM6Q 1J75A 1LEBA 3H90A 4A3CJ 2R4GA 3K2ZA 1VHFA 1RZMA 4OFZA 2WB1D 1IBCB 4FISA 3VVUA 1RA7A 2DNPA 1S77D 2M30A 1R22A 2BRLA 3ZMZA 4NASA 3GCXP 2YWKA 2V8DA 3F73A 1BXNA 5GAHI 3D5LA 4E2FB 4J9LA 1FRJA 3TO6A 2VFVA 3M2VA 1T56A 1IW7F 4UUWA 3UPFA 2E2HJ 2HYIB 4USTA 2I5JB 4ESFA 3CDLA 1A5JA 1HIYA 2GQCA 3P49B 4DJBA 2K86A 1NDKA 2L7FP 3JR9A 1FKOB 1RAOA 3FMSA 3UN5A 1ZGJA 1PC4A 2DTZA 2R2UA 2QVOA 1WTBA 5EUHA 3I54A 4JYAF 2RVJA 1L0OC 4LK1F 4Q5SF 1IBMJ 4OOIA 2ESHA 2VIHA 1IR1A 3L00A 1G59A 2QLXA 3GYGA 4ZVFA 5J2QA 1X9SA 3K8WA 1YRUA 3QRFF 5T7LB 4ZC3A 3CD6I 1AT1B 1HQEA 5KCMA 1RCOB 1HNWF 1G3YA 2OJED 5KOXA 1H38A 4PWDA 2BYVE 1Q7LB 1UEUA 4ES3A 2XS5A 1HWKA 4QR2A 2VKVA 4KHMA 1VQMS 4D3GA 4HLXA 4YG2F 2W9AA 1MMDA 3N5BA 3KZIC 5K8MA 1V3SA 4IXAA 3RZDJ 2RDDA 4C0OC 2EKNA 4L75A 1JMTA 4DG1B 1JLCA 1D1UA 2O9LA 4NE9C 3W66A 2QV6A 2VN2A 2RNEA 3I0SA 3I6PA 2E5LF 4XBFA 3JAMY 4UQGA 2XLKA 3M8QB 2P9GA 3J7ZI 3W1YC 1L3TA 1HD0A 2IA0A 3IWFA 1T95A 2BV6A 5D8KB 5AXMA 3TUIC 1FMVA 3HCXA 2OJ3A 3FIWA 2HNZB 1FTCA 1AKHB 1JXEA 4DL5A 2M4GA 3GLJA 2OPRA 2ZWPA 5LXRA 4F25A 3TBIA 5GAHU 2ROEA 3N79A 5KFOA 2OCEA 3BM7A 1S97A 4J9VA 2CWEA 4BC9A 2L01A 3CCQS 2Z99A 3MPVA 3SMZA 3S32A 3DDIA 3TQ1A 4RAFA 3PO3J 2AEMA 4ZCLA 5ITHA 4PG8A 1MJAA 3EJMA 3M2UA 2BXZA 1DTQB 2KZVA 2MY7A 3ZZPA 5HSPA 5D4OA 3NGRA 2JQ7A 4XN0A 1HKQA 1GX6A 3GB0A 2ZM6J 3KX2A 4DR3J 2DHSA 3C66A 1IM4A 1X9WA 3DP7A 4U96A 2E1MB 3AG3H 4IFYB 3BG6A 1RT3B 1RWMB 2XSJA 2OUGA 1ZHFA 1U47A 3QYYA 4G1QA 1CPZA 1HBXG 5K5QA 2HZCA 3RRGA 1FEXA 3IP4B 3AB2B 3GP9A 1S5ZA 4NNJA 4F4ZA 4PWDB 4XPCA 1FWPA 2PBIA 3SEZA 4OINF 1XTZA 3CO9A 3MECB 2XB2D 2IGNA 3IR5B 1BHNA 1PILA 4ZKAA 4HOBA 2FDNA 1MD0A 1N0VC 5J4YA 2FGOA 1OMIA 1CC8A 5C25A 3ZMSA 5E8IA 3BTIA 2LY1A 1NPRA 2EFGA 2DR8A 2CMPA 1KLMA 4WFYA 2XI3A 4NB5A 4NMLA 3TO9A 4RB0A 1S1XA 4KGVB 5ICEA 5HLFB 1I3OB 1BQMB 1YJ7A 4HF2A 4CT8A 2F5FA 2MQNA 1LQ1A 2LQ9A 2VFSA 1WFXA 2HG4A 1TLHB 2LXFA 4LD5A 3AG2H 4AUKA 4FE7A 3VCDA 2M3AA 2QMUB 4CNYA 1S1VB 3J80K 1AYEA 1RKIA 3F8FA 2FBIA 4NRUA 3W9HA 3ZZRA 5C24A 4WP9A 2GAUA 2DISA 2P5KA 2BZTA 4J9NA 1ZYQA 3DTIA 4D0PA 2X1EA 3H2LA 1DHMA 1UFLA 4U9RA 3UDEA 2RDPA 1EQMA 3TR5A 2K85A 2I8DA 2ZBQA 1EJ7L 2CKWA 2P9EA 4QU6A 3QRPA 3NEKA 1UP1A 2C1EB 5HROA 1D5VA 3F44A 2CQQA 2DXEA 1T9YA 2RNJA 2ZEJA 1RAEB 3E01B 1VQNI 1JIHA 4IG0A 2HMIA 4OX7A 2YWFA 2L7MP 1O7LA 4KN7X 1JLBA 2IA2A 1UB9A 2L2OA 1W36D 1FVSA 1UAAA 3E5QA 4RBOA 2BYCA 5DDQC 4DL3A 2QEXS 2KIMA 1W7PB 2Z0GA 4OI3A 1FJEB 2XULA 4DSKA 3UR0A 2W2OP 3QIDA 4WZQA 5B0AA 2VA3A 2XPVA 2FC8A 2BW2A 3CJSA 2F4FA 5C5JA 4XRMA 2RQQA 1DURA 2CIMA 3V6HA 4JV5J 1RZ4A 3ZQQA 3VEPA 3E6DA 4L3NA 3BS9A 3PW4A 5E1XA 2BXJA 2ELJA 4J19A 3WTVC 1X2NA 4D3HA 2KFDA 2Q8KA 2IYGA 5HMZA 4NQWB 3M30A 1HYSA 1T39A 1IBLJ 4O3SA 5IT9Z 1HA8A 4QWBA 5DS9A 3RTVA 3V4IA 5E17F 1NJZA 2CGPA 3RCOA 1HBUA 4CHUA 4HTJA 2QSHX 1VQ4S 4I76A 3MAHA 2WVCA 5FD5A 2G0CA 2HBYB 3GX4X 1JLAA 2KT3A 2YPRA 2AX0A 3DRSA 1JLFA 2CPIA 4FYXB 5AE2A 1EETB 2HMIB 4DPYA 4LB5A 1OYYA 1XSDA 2KRBA 5BYQA 1YJ9S 3KNGA 4CTAB 2MZJA 4WWCA 4N9IA 3MPYA 5KFFA 2ZFUA 1LXJA 3CCSS 3KP2A 2FPHX 4LFAF 3IH3A 3FFIB 1KU2A 2FZGB 5GAHJ 3RRHA 5LD2C 3DM2B 4E7ZA 4I7FA 3KETA 1WWXA 2FC9A 5TJJA 2AW0A 1NCLA 1WPKA 2NVYJ 4B3RF 2KIUA 3BC8A 3ECHA 3TGNA 2V67A 3T5HA 1XR6A 4YQWA 1LOUA 1FYMA 4L5IA 4ZTFA 5EX0A 5EGYA 1I1GA 3G9CA 3GFYA 4J9KA 4MIWA 4EZ9A 3P5JA 4LRCA 3K0JA 2VB6A 4I6ZA 4ESJA 3F8MA 1VQ7S 1PJRA 1IBLF 1VQ8I 1XCVA 2BKPA 4ED1A 1O0PA 4FTHA 1QAJA 3GSIA 3ZQ7A 4W98A 2CJAA 2RU3A 1YJ9I 2FBHA 2WONA 3HUGB 1IM6A 2RILA 3IWXA 4N4NB 1I6HJ 1ZAOA 1FVQA 1UJ8A 3KLEB 3RJPA 1TC3C 2VBZA 3OFHA 4IRKA 4DUTA 2GO9A 1LNWA 3J7Z5 4XKVA 2R3VA 5DCMA 3FHZA 3JSPA 2F8MA 3M1VB 4JI8J 1VC0A 4Q43A 2CFXA 1BWEA 3OFEA 2WSCC 1S59A 4I98B 4BACA 1F5CA 3I59A 4IZZA 2W9BB 3WU0A 3JYTB 1H2VZ 8ATCB 5MLCV 3EZOA 4WXOA 1RXOB 4DR1J 3A0BC 4HA8A 2BJ3A 3QGPA 3O6BB 2L9RA 4P10A 3A13A 4LITA 3FWEA 4HT7A 4ANEA 5I4MA 5ETKA 4PWUA 4HTIA 4ZVQB 2ZOFA 1T9TA 1VK8A 2WRMA 2L48A 2BJ9A 1LDKB 1UEVA 1B8IA 1U8RA 4D1QA 4OI2A 4I64A 4KNYA 3BSOA 3R6GB 3DMJA 4DR4J 4BXXJ 4BC7A 1T11A 1UHWA 1LDDA 2IVMA 3O8GA 2CQBA 5CJ9A 4KH1B 4QW9A 1Q82T 4IHWA 2DH9A 1XMXA 1T9XA 4MYTA 2BE9B 2VQEJ 4IHXA 2KG1A 3AKZA 4M5LA 5ILVA 4M95A 4M5IA 4EJOA 3ZXSA 3SJMA 3R6SA 2OTJS 1Z77A 3W62A 3NOGA 4U7DA 3E0JB 2FE3A 2AZ3A 1UETA 4C2MA 4CCJA 4X4RA 1GHCA 2Y1RI 4KUMA 3RW7A 3QT8A 1EZZB 4Y28C 5CQEA 5L3BA 2G2YA 1VI7A 1RTDB 4BXFA 1V6HA 3DRXA 3D0SA 2A6HF 5IQQA 4PDKA 1WUUA 1Z4UA 2A2DA 2VKRA 4V19J 2UP1A 1H73A 4USWA 3CF5F 3FISA 2Y0MA 2R8IA 2M9KA 1H98A 5I3QA 1ACIA 2EWNA 4IKFA 2DT9A 1CF7A 1U49A 1AOYA 2DA5A 1GUUA 2UXBF 3TA1A 4HBLA 5KG4A 1GFWB 2EFWA 1SH3A 5JUMA 4RPFA 3SCJE 1NH7A 1FF2A 4ZP7A 2WK4A 2HURA 2FLOA 2CAJA 2I8EA 1FRXA 2JH3A 2O67A 3MEKA 4LF2A 1TKXB 5ADZA 2GXBA 3ZOBA 2PFBA 3DGVA 1IRZA 1X19A 1K78B 3U27A 1EA3A 3HT3A 2HVDA 1RE1B 3X2QH 2VT3A 5ETRA 2UVVA 2ZZMA 4WE1B 2IC3A 3OT9A 3GONA 3H3UA 4P9SA 4RLEA 1I3AA 4B3SF 3OPKA 2NOJB 2NYXA 2IS2A 3GLLA 3GTLJ 3SXYA 1ZKGA 1N48A 1ROFA 3M3YJ 2AQEA 1MZBA 3LGHA 4MMOA 3D66A 2VQFJ 2HI3A 2POKA 5BPDA 2R2TA 1R0BG 2EFNA 2LU1A 4TV7A 2NZ4A 3E6MA 1O5JA 3CCUI 1JT0A 1OY6A 5IT3A 1XEZA 1V55H 2CADA 3BO3A 1MJBA 2ACYA 3AD7C 2LRDA 2E1PA 1FDBA 2AJ0A 5EDWA 4BE2A 1H0HB 1U26A 5C4JJ 4U7UD 1L3UA 5F8NA 2VDHA 2XO6A 2QBYB 1H72C 5A2QY 5E8GA 3Q9SA 4IRGA 3KWMA 4Y34A 2JTVA 1K0VA 4J9PA 1TNTA 4DL7A 5E79C 4GC6A 5A8RB 4RGSA 3N28A 1VCTA 3T6BA 5LFAA 1K6YA 3FKBA 4LSNA 5HVHA 5F8MA 1S6PB 1RWWB 2RHSB 3M2UB 4OHYA 4IO9F 3K59A 5M2UA 4YR2A 3C2GA 2VJIA 2ZMEB 1IXCA 4P52A 3O8WA 1R43A 2LP4A 3F9KA 2R0QC 3VF0B 4BJ6C 1U1QA 3IH4A 2NXUA 3JSMA 5T14A 3EM1A 2O7OA 2DRBA 4RLQA 3MZ8A 2N82B 1IUFA 1FTTA 3OTDA 4IVNA 1Z2ZA 3T5XA 2LDYA 2MKKA 2OD6A 4IH5A 3K8VA 4ERDA 1FT9A 5KFUA 1DU0A 1S99A 3MM8A 5E3NA 3QPHA 3I5AA 4Q0BA 3ZN0A 4KO0A 1S6OA 4B3TF 2DIVA 2JVGA 3UN2A 3LA2A 4M6VA 2RMLA 1IBKF 3TP0A 5D3GA 2KRCA 4Y7NJ 2OPSB 3TQEA 2LKXA 3TO7A 2IJRA 2ELKA 1SFEA 1VDHA 4CZCA 1TMJA 3HJFA 1SC7A 2H51B 4USVA 5DM7F 5D77A 3OV8A 1SAUA 4CLUA 2JA2A 1SC6A 2EQRA 3RI4A 1IJEB 1TT5B 4DGWB 2HK2A 1S7AA 3DTKA 2CDRB 4QLCU 2MKIA 2X0LA 3I5UA 4R8UA 4L9TA 1NEEA 4XPEA 2D2WA 2V2KA 1LW0A 2MSYA 5FRMA 4OYZA 5CXTA 2DPDA 4G6DA 1GT8A 3MM7A 4G12A 2K7LA 1VRTA 5K8OA 3QWPA 3MAQA 3BKFA 1RWPB 3CD7A 2UVRA 3OV7A 3I0RB 2ESNA 3ABUA 4ECQA 4DFPA 1FJCA 1LW0B 5KFMA 3KDOA 1VC5A 1G2EA 4B09A 1KQ8A 5LHIA 5FJ8J 1AW0A 2WAQA 4WK1A 5AXKA 1SMTA 4HDHA 5DUKA 1LNQA 3TX8A 3U02A 3ENAA 3VGTA 1B0PA 2B9XA 3F23A 3WBZA 3JS9A 1NM2A 2E36A 3RAMA 1MH4A 2HBQB 1H0MA 3U2RA 1T05A 3PYEA 3HO1A 3FM3A 2H5JB 1OIAA 3NS6A 4AL6A 1K7AA 4KPCA 1TVRA 3F21A 4F36A 4AWXB 3CDHA 2M0CA 4A8YA 1Y3JA 2XV4S 4L9NA 3U1DA 3FXOA 2NVXJ 4X65F 5FKKA 2R8JA 4OLPA 4KPYA 2JUCA 3OLBA 3R60A 3G8TA 4CO3A 1FT8A 3BSAA 2BM0A 2OFHX 3AOCA 2IJNA 2N4DA 1APLC 5KFZA 4OJ1A 4TNOA 1NHAA 2G7UA 3OY9A 4I6YA 1VBXA 3HT0A 1EAYC 5FD1A 3OYNA 2A5WA 1GV2A 3Q8PB 1F1ZA 1S9EA 5IT9U 2PEHA 1Q5YA 4HV6A 4AL5A 2E34A 2JT1A 1V5FA 5JMNA 2G7HA 5D4NA 2VJJA 1IBKJ 3C6UB 3PRBA 3GQCA 2VF3A 4EJTA 3H20A 1TK0A 2ZBPA 1TV6A 5D4SA 1W5CC 2EC2A 2IAJA 4QCLA 5DETA 4BDPA 3RKXA 3IBCB 3J7YI 4DV3F 4BWMA 4CQ1A 4ZP9A 1HBNB 4I09A 3S3NA 3N6MA