2VOPA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
EKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 51
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vopA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vopA02
2BBYA 4OIOF 3UD3P 2YKAA 3WTUC 2F5DA 4PRFA 4WXDA 3W6KB 5FJ4A 5J6XA 2DNOA 4M73A 3R4KA 4B8XA 3RYPA 1K73T 2PMHA 3VAHA 4RGXA 2U1AA 3O3KA 2H94A 3J7YU 5L3BA 1XD7A 3IHUA 3BJAA 3GFMA 1FYMA 2ZNYA 2P5KA 1Q1HA 4ESBA 5EN1A 4U67Q 4I7HA 2JVOA 5ILUA 2YWKA 3CCSS 3H3UA 1WELA 5LEJA 1N8RT 1QPMA 1SJQA 3FXRA 4P9UA 1REPC 3WTSC 3FXUA 4I0AA 4TLQA 2ZMEA 2MZRA 3FM3A 4M6YA 4ZYHA 4I02A 2MKKA 1BI2A 1OPCA 2UP1A 1LDKB 2MXYA 5GADU 4P55A 5ICGA 1X0FA 2O8XA 1LB2A 5GVQA 2CPHA 2E7WA 4P5OA 4WCGA 1QZZA 1WSUA 2MZJA 4TV7A 3ZN1A 3IKVA 2KG0A 2V6CA 1XGNA 1D9AA 4I09A 1AWCA 2RQ4A 3IWFA 4G6DA 2MD5A 3KLOA 4LG0B 1FPQA 4RU2A 2DT5A 2ZNZA 5H6QA 2KN4A 1LJ9A 1QQIA 2CQBA 3RKYA 3UCZP 1IXRC 5BOXA 2L02A 5DCFA 3R27A 4YFXF 1RIOH 1VQ6S 2MPUA 3H92A 2EA2A 4BH9A 3BJOA 3J7AO 4F26A 1FP1D 4W92B 1WI9A 3EYIA 3ULHA 4HBLA 1GXPA 1VQKS 3IL2A 1E17A 3DV8A 4RB1A 5H6RA 3MD3A 2OQRA 2FOKA 1N52B 1J59A 1X4FA 2OSRA 1T98A 3RYRA 4ETSA 4HF1A 4CYDA 5JHUA 4EJOA 1R36A 5DDGA 3M7GA 4D0PA 1BOAA 1G4DA 2BZ2A 4K2EA 5ED4A 4RGRA 2YH0A 5JVTA 4CDGA 1WTBA 4KMFA 2L54A 2PEHA 3U1LA 1M90T 2L3DA 3I0TA 4CO8A 3RKXA 2J5OA 2ZXJA 4WFAQ 3CDHA 1Z1DA 2M87A 1KQ9A 4Y0FA 4M71A 2MGZB 4CHUA 4V19X 5LHGA 5HLHA 1U3EM 3BOQA 3CUNA 1H0MA 4A0ZA 3WTYC 3GXOA 1S7OA 2C6YA 2CPZA 2UXNA 1UW4A 1SD5A 2HEOA 3N9UC 2WV0A 3WG9A 4HAMA 4N0BA 4CXFA 3BO2A 1WI8A 2OTLS 2EK1A 1M5VC 4I0BA 3L00A 1ZHFA 1IN5A 3J80Z 2F5CA 3WE2A 5LXYA 5E1XA 5DDRC 5D5XB 3F3XA 4KN4X 1GVJA 5JI6A 2KIFA 5ICFA 1DHMA 3S6EA 1MD0A 4UXNA 1ZH5A 3WTXC 1WWHA 3CCLS 1H9TA 2GXBA 1BM9A 4IVNA 4YOEA 1VC0A 1ODDA 4Q5SF 2FNPA 3E5UA 3VF0B 4PDKA 3G8TA 2ZBKA 5JR3A 1SXLA 3N4MA 1FBUA 1VBZA 3HIFA 4U0VA 4WX9A 2JWNA 2AYEA 4U7DA 3HTSB 2P6TA 5BPIA 5A2QZ 3PQJA 4TU8A 5DM6Q 5GAEU 2XNQA 4IF4A 4DNCA 1BBYA 1FOKA 2QUFA 2DGTA 4KICA 3IC7A 4HW0A 4KIGA 3RDIA 4L18B 1J5YA 1TBXA 3K69A 4PZJA 1X4DA 5LGTA 4WFNQ 1YG2A 1LDJA 1HD0A 5E20A 2FSWA 2FXAA 3LA2A 3P9KA 2M70A 1A04A 1YQAA 5ICEA 3FHZA 4HLXA 1ZRFA 1IZ1A 1O3QA 4TU7A 2E1NA 4UVBA 4PGGA 4RAYA 2MZQA 2NNYA 1WHWA 1ZAOA 5D8KB 1YJ9S 2LCWA 1XN7A 4KN7X 2X1AA 4MGRA 1QNTA 2EB7A 3KP5A 3MD1A 4L9VA 4FXVA 3VALA 2F5EA 3CD6S 4NHJA 3NNHA 4P9FA 1URNA 3PIPQ 3DPTA 1U5TA 1SD6A 5JVGQ 2XHKA 3OOPA 2HWVA 1IF1A 4G7HF 1HW5A 1DPRA 2G1DA 2FBKA 1VQOS 3MAJA 2CQDA 3CMES 1FWZA 1MKMA 1HKTA 4MEYF 2Y48A 1PDNC 1P2FA 1UB9A 2KH9A 3SDEA 3THTA 4CIOA 3L09A 4RAZA 4G7OF 4Q48A 2K3KA 3HSRA 3IRRA 3TDUC 4ENMA 2DGQA 2X1FA 1FJEB 4IHTA 1HSJA 1STZA 1QM9A 1MGTA 2OZUA 1FX7A 1SFEA 2K4BA 2MKJA 2RRBA 3MOJB 3E5QA 5K1YA 1M1KT 1YW7A 1L3KA 1PGZA 3M8EA 5L3CA 4O5VA 2OQGA 5J8FA 2PFBA 1W5TA 2E5JA 2O0YA 5DEQA 2DQRA 1OYYA 2FHOB 4KNYA 2M2BA 1OPIA 2N82B 4YUDA 3TO8A 3G9CA 4UHTA 1KC8T 4RS8A 2XKOA 2MZ1A 1UFMA 1MJBA 1HKSA 2GIVA 2K8GA 1ZN2A 1WKMA 1T38A 4EJWA 1Q86T 1JGSA 1J7KA 5LHHA 4QU6A 2XUBA 3DF8A 4A5MA 5FFZA 2MQMA 5HL7Q 1HXDA 5F64A 2LDUA 2BE5F 2P6SA 3S7RA 1F5TA 1W7PB 3G3ZA 4U0WA 3CCJS 2DU9A 1TW2A 1FXLA 4G7ZF 1YJNS 1NHAA 1B6AA 2KJCA 2DPDA 1V3FA 4OIRF 2IP2A 1BC8C 2ZCWA 3VOEA 2EFQA 4Y00A 2HGNA 2K86A 3F6VA 2RQPA 2HKXA 1H2UX 3E5XA 5LRSA 5E1WA 2ZJPQ 4XBFA 2DH7A 3RPQA 4YB1P 3SZTA 2BYVE 2WBRA 1B9MA 1VQLS 1CF7A 5BQTA 2K02A 3MXHP 4CICA 1ON1A 3ECHA 5IT9K 3ZPLA 2KYXA 1O3SA 4R1HA 3ZQ7A 3BP8A 3KP2A 3TOAA 2RV8A 1WQ2A 5EEHA 5TRDA 5EEGA 3VODA 2QFJA 2IVMA 4WCEQ 2EA4A 3EETA 2DNZA 2ISYA 1EH8A 4UVCA 2R3SA 4U88A 1KU7A 1D8JA 1ZREA 1PUEE 3M9AA 2M5WA 3K9TA 5E1ZB 1H9GA 2BGCA 3Q5FA 3QU3A 5DV5A 3HRUA 3LQRA 1JMTA 5F6FA 3U1MA 4OU0A 1WF0A 4MNUA 3RW6A 3CUQA 4IRIA 4LJZF 1QVFR 2P7VB 4A6DA 4M5DB 2XSFA 3QPTA 5FFXA 2KG1A 3VAIA 4A0YA 5FGMA 2LECA 1ZLKA 3F6OA 1G2EA 2PMUA 3V4GA 5LBQA 3F8NA 2P5VA 2ZJ2A 3B4DA 1FSEA 3DXBA 1XMAA 2EFWA 3EUHA 2WC2A 4AD9A 3WGIA 4JK1X 4HLYA 2MQLA 3HTUA 1BI1A 1TNTA 2A61A 3UCGA 3MUMP 2ESNA 1VQPS 2PG4A 1YHQS 3R1HA 1F9NA 2RVJA 1N88A 1K78B 4A5NA 2DHSA 1O3RA 3G4SS 5DUKA 2VE9A 1HSTA 3CCRS 3QU6A 3J80K 4ENJA 1U1MA 2LF8A 4C7QA 3H3ZA 1FBSA 3FX3A 2F9DA 5DD8A 3P3DA 3MZHA 4EVIA 2FNAA 3US5A 2DHGA 2ZFWA 1R5GA 5CVVA 1BC7C 4CH0S 1DRZA 1IQTA 3EQLF 4Q4ZF 2DW4A 2YTCA 3JSPA 1PP8F 4M9ZA 5E17F 2LKZA 2A68F 2ACJA 1OWXA 2DH9A 2PEXA 1R5HA 2IJLA 2M0GB 4GXOA 1USSA 1ZYRF 2QBYA 2V1XA 2MSSA 2NAZA 3VB2A 2AXLA 2LYVA 4FX4A 2L4MA 4MQ9F 2MA3A 1YS6A 2Y0MA 2K4JA 2TDXA 3IKTA 4UUVA 2ISZA 1P92A 1HA1A 4OIQF 1HKQA 3C1DA 2RT3A 3T0YA 1B7FA 1DP7P 1RI7A 4Q47A 4G94A 3GFJA 3WTVC 1R22A 4M9XA 1WF1A 4WF2A 1VBXA 4OMYA 2N3LA 2KM8B 1ZGJA 5FD6A 3F8CA 4LB6B 4RB0A 2KHCA 4ON0A 3LQQA 5F1RA 3KLNA 4L9NA 3EGNA 3G8SA 2D1HA 3V4MA 2P5LC 1YO5C 1YW8A 1O3TA 4UNOA 1TLHB 2XS2A 1UHWA 4PR6A 4KDPA 5HS8A 3NMRA 1HQCA 3KEOA 3ZMUA 1NJIT 3V8JA 5HVQC 1SFXA 1U2WA 1WG4A 2RN7A 2FC9A 1HW2A 1R7JA 2DH8A 3KP3A 1R58A 1JE8A 1P4WA 2BOPA 4CGZA 1ZARA 2RKHA 1XB4A 6PAXA 4LMYA 4KUMA 5L3DA 3SXYA 5LGUA 1YIJS 2CWEA 4F02A 3TGNA 5FLXZ 2CPDA 2EK5A 2MSTA 4Y15A 2OSQA 1NO8A 3VAFA 4I2OA 2DNGA 2CQ2A 2KM8C 1SJ4P 4JBAA 4HX8A 2FBIA 4BXUA 1B59A 2VBWA 2FRHA 5K5OA 2CPFA 1K8AT 1SJFA 2J5PA 2HKOA 2FBHA 3RKWA 4ED5A 2DHAA 1X3UA 2Z9OA 4ENKA 5DCMB 4GGGA 2STTA 2NYXA 3Q2SC 1X4GA 2DGXA 2G7UA 3EDPA 3HOTA 5D6FA 1U5TC 4G6QA 2CQGA 3MCZA 3TYTA 2XASA 5HOOA 2GA2A 1R00A 1K6OA 4A6EA 2HZCA 4UV9A 2L9WA 4IJAA 2M4MA 2QA4S 1IW7F 2ADBA 2OBPA 4XSZF 2OD5A 2D45A 3ERED 2IA2A 4IPAA 2VT3A 2AYGA 1SJRA 3L7WA 4S05A 1NU4A 3ZMDA 2JVRA 3BROA 4EGYA 3S01A 1YI2S 4DQ2A 2GHPA 4FXWA 1Z91A 2ESHA 4KT5C 2HZTA 3B02A 3ZMVA 3FWEA 5HDKA 2CPXA 2HYIB 2QQBA 5MLCV 2MY8A 4R8HA 2DGUA 2VOOA 3FMSA 2ZJRQ 2HQNA 5H1SV 2BEOA 2ADUA 1FZPB 3I64A 1TQMA 3LSTA 2UZKA 5L3FA 4AIHA 2FF4A 4IHSA 1U1LA 3FF5A 1U6BA 4CQ1A 1YLFA 2VBXA 5ERIA 1VC5A 1YS7A 2PN6A 1O7LA 2U2FA 2GO9A 3TP2A 1HW1A 3CJNA 2KRRA 4WF9Q 2XROA 3L3CA 2HS5A 5GMKa 3KE2A 1HBXG 4EGLA 2P4WA 2FY1A 1V4RA 3F21A 2MQPA 3GX4X 2DIVA 3BS9A 2CW0F 1OYIA 2AD9A 2KJBA 1H2VZ 2H6BA 2EFNA 5J8CA 2XRNA 3V8KA 4HX7A 4YFNF 2ADCA 1J2XA 2DNKA 4EM2A 3QP5A 4EV0A 2GQQA 3R0AA 5H20A 4LD5A 3FEXB 2STWA 3J81Z 2DI3A 2LNBA 2M88A 2NLWA 3UWTA 3GWZA 5ILVA 5L3EA 2NZ4A 1B4AA 1ZG5A 4M72A 3Q9SA 3CMAS 3C7JA 1IN7A 2RDPA 2OTJS 2VT2A 3LA3A 2DNPA 2HYFA 1G3YA 3L2CA 3R6SA 2J76E 1QGPA 4M9SA 2RNEA 2IT0A 5LEKA 3HHHA 4B09A 3AAFA 4L5JA 2EFPA 4LLGF 2OA4A 4E70A 5CYVA 3GF2A 2LA6A 4YIIA 4M74A 5JVHQ 4CZZA 4L0ZB 2YSRA 3TKYA 3CUQC 4HX4A 2MH9A 2MMYA 3B4MA 2JPCA 1PO6A 3WU0A 2ZKZA 2FEZA 3JB9k 3TDZC 4RB2C 1A7GE 4UY8T 3GFIA 4LB5A 2LA4A 2CGPA 5HDNA 3G71S 5LHIA 3SXLA 5LJ3Y 2O3FA 1YIOA 2MBFA 3JAMZ 2DNYA 2X1GA 1H6KX 2O03A 3P49B 2LEAA 2OAZA 3WGGA 3L9FA 1ZLJA 2G7HA 2CPJA 2B0GA 3KETA 3NS6A 2QM3A 2MJUA 5IM0B 3QOPA 2MJNA 4FHTA 2MC3A 1N54B 4HF0A 4OOIA 4HYEA 5HLGA 1Z05A 3H2VE 2L4AA 3M8FA 2MH2A 1WF2A 5D8LB 3BO3A 2DB1A 2W57A 2WWYA 4WK8F 4LK0F 3U2RA 2M7SA 4ESFA 2SXLA 1TQPA 4A2UA 3QRFF 2RQCA 1MDMB 2LF7A 1UAWA 2CQ4A 1RNLA 5LGNA 2NS0A 3HSFA 3ML6A 4FT8A 2MQQA 4QWQA 5GAGU 1WHYA 4ASNA 1SD4A 3VAKA 1O7FA 1BN5A 2I38A 2PE8A 1JJHA 1D8KA 3V8LA 3I55S 2D9PA 3G73A 4ZZDA 4EJVA 1VQMS 3ZMZA 2LXIA 2MKSA 5FD5A 4ZYGA 1R1UA 1W7PD 2RGVA 4EGZA 1OKRA 2RVCA 5IT3A 1SD7A 1IN8A 1MJAA 1FP2A 4IXAA 4LG0A 3ZMSA 3MWMA 1VQ7S 3THPA 4N9HA 1M5PC 3O6BB 1ULYA 3GW2A 2P7CB 3E6DA 2XKPA 2XS5A 3FMQA 2IA0A 3I59A 2KIUA 1B9NA 2DNRA 2LQ5A 1YYVA 3NS5A 3F23A 3P7NA 3FMRA 1WI6A 2ZMEB 2M8DB 3BDDA 3WU1B 3ECOA 1JXSA 3K1MA 2KIMA 2OU2A 2Q8KA 3ELKA 4YIFA 1LQ1A 3IWNC 1FC3A 5ITHA 1VQ8S 5CVIA 1X4CA 5KK1A 2LEBA 5AONA 2RS2A 2JSCA 2DITA 3E3VA 1Z6RA 3CTAA 4BYYA 2KFYA 5DM7Q 4J5OA 4HZFA 2FE3A 4LMZA 2A6HF 4UVAA 1Q81T 1S29A 2GWRA 1DDNA 3VFZA 1X5TA 3V7SA 2AYMA 2CQKA 3LQVA 2M45A 2XS7A 2MGZA 2MZSA 1H2TZ 1ON2A 3QPHA 1KA8A 1R1VA 2HFHA 2PLYA 1DPUA 4OZ1A 2HQRA 1X5PA 1USTA 4UV8A 2MB0B 1CGPA 3SHFA 1WRJA 2GAUA 1UCRA 4A0XA 2KU7A 3WTWC 2X1BA 3BY6A 2YX4A 3BJ6A 1JHHA 2K27A 1U6GA 2MZTA 2XB2D 3B73A 1QBJA 3MZYA 3CO7C 3DPLC 2JZYA 2XAQA 3D0SA 1FO1A 1X4HA 4P6QA 3CC7S 1W4MA 2VBYA 1OIAA 1IXCA 2QQ9A 3HOSA 2E5IA 4GO1A 5DD4A 1FT8A 1P4AA 1SAXA 1I5ZA 3CTRA 3MUVP 2EWNA 2DNNA 5TJJA 2VC0A 1BIAA 1TNSA 1WEXA 2ZO4A 5LJ5Y 3UD4P 3RW7A 2MKIA 1QZYA 4OMZA 3Q9VA 5HDGA 4WKRA 2IPQX 2V79A 2V9VA 3R1LA 2QVOA 1TQIA 1RZ4A 3MFKA 3BPXA 3FXQA 1RUOA 4EMSA 4BQAA 3QP6A 2MY7A 1O57A 5DDQC 2DO0A 3QAHA 4HV5A 2H09A 3WE3A 2EV6A 3CCQS 1FYLA 5ICCA 3ROUA 3RJPA 1VQ5S 2HTJA 1S6LA 3DEUA 2CPEA 2F3JA 2VE8A 3T5XA 2M9KA 2F5FA 1BI0A 3Q2TC 2PI0A 3CCUS 1M5OC 1S3JA 5L3GA 1HD1A 1UP1A 2N7CA 5CYJA 4MHGA 3E6MA 3N97A 4A8XA 4BS2A 3P9CA 2H27A 3MEXA 3FEYB 3ZZZA 1YJWS 1SMTA 3J81K 5KVRA 2QWWA 3EYYA 2VXZA 3C18A 1XMKA 1IXSB 2AS5F 2WTEA 3U1DA 2EV5A 3KCCA 2W84A 3U9GA 1U1NA 1U1PA 2MKCA 5A2QK 3TO6A 1X4EA 4O6JA 3P5TL 4A12A 1XSVA 3KP4A 3DKWA 4QQBA 4KYWA 4QPTA 3O2PE 2KRFA 2QZ8A 1P1TA 1FSHA 2YX7A 1HL6A 2W85A 4EQQA 5IFMA 3VAGA 3NNAA 3SQNA 4Z2YA 1Q7YT 4L9JA 4L0YB 1LEAA 4IO9Q 2DK8A 1EH7A 1O0PA 4ZKAA 4IOAQ 3MQ0A 3I5UA 2NRAC 4LJMA 4HOBA 3CUOA 4PGHA 1G3TA 2KXHA 4U7BA 4Z2XA 4P96A 3JW4A 1F9FA 1K7AA 2JRTA 2I2YA 3CCVS 2LMIA 3GZ6A 4QLCU 3V7RA 2RNJA 4OZ0A 3FZVA 1U5TB 1X4BA 1VQ4S 2A5YB 3CC2S 2YU3A 1KU9A 4MQVA 2OJ3A 3EGZA 1FJ7A 1EV7A 1OO0B 1X5OA 3GZ5A 4S04A 3R61A 1KU2A 5CJ9A 1FYKA 1Y0UA 2DGWA 2MKHA 2M8HA 3SDEB 2O6GE 3HI9A 1AOYA 2HGCA 2E5HA 1XGMA 2O61A 1W7PA 4ZZLA 2X0LA 1AUDA 4WIIA 2EVZA 3LAPA 2XGXA 4G9YA 1FJCA 4IRHA 3ZN0A 1JJ2R 4GYGA 4YFKF 5FB2A 5AIPA 2IA1A 5IT9Z 1U1KA 3TQNA 1SJ3P 3S2WA 1J75A 1R8PA 2DQLA 4BHPA 1X5SA 3UE2A 3F22A 4BHBA 4EJUA 1ZG3A 1XGOA 4ZYDA 2E44A 1ZZFA 5D78A 3GFLA 3I71A 5BMZA 5LXRA 2HDCA 3IRWP 4RGUA 4AWXB 1RKJA 3DXJF 2CO5A 1T2KA 5D4SA 1YW9A 3CF5Q 2HGMA 3NQOA 4F7ZA 5IQQA 4HA8A 1RUNA 2KXFA 3I59B 3G6ES 4BAYA 1R1TA 2B0LA 1ZG1A 2A3JA 5CVUA 4GCVA 2MHNA 3CULA 1S79A 2Z33A 2M30A 2DK2A 3DLLQ 4O3MA 5D6EA 5LSOA 3CLOA 4WXCA 1KYWA 1S8NA 1FLIA 2AYBA 5DDPC 3LPYA 1CF7B 1Q82T 2DO4A 1T0FA 1DZ5A 2EJRA 4EJTA 2L41A 1S7AA 2VBZA 1YWXA 2GA1A 2D9OA 3BO4A 1UFWA 1BJAA 3FM5A 3DQVC 3LFKA 4HQMA 3HRSA 3OV8A 2JTVA 1QVGR 4RGSA 2DGOA 2CSOA 2F2EA 2L08A 4LGWA 3BPVA 3P9IA 3ZP5A 2HGLA 5D5UB 3KP6A 3NNCA 2UWMA 3WODF 5JFRA 2YPRA 2RC4A 5GAHU 1KD1T 3MDFA 2QLZA 1FBQA 2IW5A 2MLKA 3KP7A 1E2XA 1P4XA 3WTZA 2F9JA 3CUQB 5BJRA 1K78A 2Y75A 4XRFA 5CVRA 2OIHA 3K0LA 2CQCA 1KU3A 1FT9A 1TTYA 4EM0B 1U78A 2D3OR 2CQPA 1CVJA 4C4WA 4LK1F 1A9NB 1XCBA 1D5VA 1QO0D 2NNNA 1BY9A 2HTSA 3ABUA 2QQAA 1DUXC 3P6YC 3GYHX 5E8GA 2Z3YA 3T8TA 1MZBA 2XV4S 1KQ8A 2EFOA 2J0SD 4EM1A 2MQOA 1U1RA 2DO7A 3RIRA 1FNXH 1WHXA 4W90B 3WTTC 1KQSR 5BS6A 2K7LA 2A07F 5D77A 3CO6C 4AIJA 2HVZA 2HR3A 2CQIA 2JX2A 2CQHA 2CPIA 2FMYA 2QYOA 3CCES 1VC6A 2J0QD 5E8IA 3KFWX 2Q0OA 4R79A 1L3LA 1IUYA 4ESJA 4ERDA 2CQ0A 1F4KA 3I4PA 4WXHA 4MTDA 2A69F 2MQNA 4LIRA 4GYIA 3HHNB 1JJ4A 4MTEA 2A6EF 2XIGA 1BIBA 1ZRCA 3BWGA 2FC8A 2Q2EA 4AIKA 2DTRA 1EH6A 2DNHA 2KVIA 2Q79A 4HQEA 4L9TA 3E6CC 3GVAA 2KKOA 2CFXA 4WWCA 2J8AA 4KIBA 5CA5A 4WFBQ 3TO9A 2HYGD 4Y17A 2G0CA 3J7ZT 1GXQA 3C3WA 2QBYB 3KZZA 5HLIA 1VTNC 1I27A 2FPHX 2DIUA 4BNCA 4I98B 4N9IA 3HHGA 2CQ1A 1U1QA 3W6JB 1WEYA 3CC4S 5AIQA 2PJPA 1YTYA 5FO5A 3JSOA 1T6SA 5DYMA 2V1DA 2EV0A 1LVAA 3GUDA 3KEQA 3T1BA 2KXNB 1P6RA 3HSEA 3TO7A 3UCUP 5DDOC 1OR7A 3K0JA 2H6CA 3MI7X 2X4HA 5HS9A 5D5WB 1U1OA 1M5KC 4U0YA 2DLLA 2L01A 2MLGA 3COAC 3CXCR 1R8HA 1VBYA 2V94A 2VONA 5K5RA 2LXUA 5DCMA 2DNQA 1PP7U 1W2BR 2DK5A 3E6BA 2DNMA 2E7XA 4H0EA 1L0OC 1FY7A 3K1NA 3HUGA 4PKDB 1I1SA 1VQ9S 3HYIA 1FNNA 1OYWA 4G8XA 2G4BA 2FU4A 3K1PA 4RB3C 2PBIA 1XDUA 1Z6TA 4HV6A 3LA7A 2O3DA 1U8RA 2RUGA 3V7CA 5HO4A 3PQKA 2M1BA 1SFUA 1JHFA 2YR2A 1WG5A 1KOHA 2GZWA 4QU7A 5FLXK 2KT5A 4CH1A 4C0OC 3HRTA 3D5LA 2QENA 2CQ3A 2MYFA 1I6XA 1MJ9A 2EK6A 2D1VA 2A3SA 1D3YA 3ZMTA 2ETHA 2JPBA 3I56S 5D5VB 4F25A 2V1UA 2R7DA 1KGSA 4JQFA 4HDVA 1T39A 2JRSA 3NRVA 3IRQA 2DBBA 1XGSA 2G9WA 3SMZA 1ONVA 3GEZA 2RRAA 2Z99A 2FMLA 4KFCA 4LLNA 2BV6A 1X4AA 3RPUA 3RTRA 2VODA 1KOOA 1G3SA 1LEBA 1J9IA 4HF2A 2CPYA 5ILSA 1OMIA 1ZZNA 1R23A 2CYYA 2W25A 3GLXA 1P27B 3ISPA 4IOCQ 2XNRA 1Z9CA 3DP7A 3M1EA 1U2FA 2DGSA 1LDDA 2Z5UA 3LWFA 3H2UB 1I1GA 1LNWA 2LSOA 4YG2F 2KI2A 2YH1A 4OINF 2XAHA 3JTHA 3F72A 2W24A 3REOA 3F8FA 3BZ6A 5LSLA 1IRFA 2ERRA 4UQTA 3F8MA 1DBDA 4LFUA 1U6FA 1UHMA 5LRRA 2DHXA 1XDSA 1KYZA 3DFGA 1WEZA 2XAJA 3MUTP 2FQ3A 1YFHA 1FHTA 3VEPA 3BEGB 1ZGAA 4ENNA 2DFIA 4HDUA 2DISA 4TU9A 3CCMS 2D2WA 2DGVA 5DUIA 2E1CA 4KIFA 4OIPF 2KRBA 4Y13A 5BPDA 1F1ZA 1XSDA 3EX7B 1GHCA 4FX0A 5CVJA 1ZRDA 3VAJA 2VC1A 2VN2A 3G96A 3WGHA 3JTGA 5LLQA 2DNLA 2M8EA 1VQNS 1XSXA 3I54A 3E97A 2XVCA 3VAMA 5CLSA 1Z7UA 1XN9A 2RS8A 3D2WA 2IRFG 4NQWA 3NEUA 2UXXA 3I58A 2HOEA 1B1BA 2E5GA 1XCVA 2FA5A 2OZ6A 3MURP 1K9MT 5K5QA 1IN4A 4IRGA 4M6XA 1J0RA 2GXGA 5CXTA 1IAWA 2PQ8A 2N3OA 1G3WA 3GO5A 1SMYF 3PIOQ 1W5SA 3TOBA 2RU3A 1K79A 2JT1A 2QEXS 2DAOA 4IUFA 3ULQB 1G6NA 3KZYA 4PCQA 2VOPA 4I01A 5IM0A 3R60A 1BI3A 2ELHA 4KMUX 1RK8A 1WHVA 2LKPA 3LAJA 2CG4A 3PFIA 2XAFA 4AVPA 1IRGA 3F8BA 4XLNF 3ABTA 3R0JA 1D8ZA 3SFZA 3K2ZA 4BHCA 1IN6A 4ZH4F 2CJKA 3OW2R 1C0WA 3IWZA 4MEXF 2P8TA 4KA4A 4XLPF 2ZJQQ 3CPWR 2XAGA 2R7FA 4NB5A 2COMA 1MDMA 3SZPA 3I53A 2M52A 1S72S 1TW3A 4LLLA 4ZYEA 5DETA 3ZZYA 4L5IA 1KQ0A 1WWXA 5E18F 4XSXF 5D4RA 1WG1A 3S8SA 3HRMA 3RI4A 1YITS 2DPUA 3JAMK 3T8RA 5HS7A
chains in the Genus database with same CATH superfamily
3UD3P 2RHQB 3WTUC 4PRFA 4WXDA 4RKUC 3W6KB 5DG7A 5FJ4A 1D5YA 4FN5A 4M73A 3RYPA 3ABKH 3UNYA 4NLDA 2AMCB 4RGXA 4DUZF 1IG7A 2EIJH 3AG2H 1X2MA 4M8LA 2DYSH 3MAQA 5B09A 1S4FA 5KAIC 4NXNJ 3GFMA 1FYMA 4ESBA 2AZ1A 4I7HA 1BJZA 4DR5J 5ILUA 3CCLI 3PNIA 5CYMA 1N8RT 3BR9A 1SJQA 3MM7B 3FXRA 3FXUA 1U0HA 4ZVOB 2MZRA 1NK0A 4NA3A 2CJQA 2MKKA 2RMLA 4CCJA 3BZQA 3OSFA 2DA5A 1LDKB 2DR5A 1S59A 5GADU 2DA4A 2W00A 3MMJA 5ICGA 2Y0BB 4FE4A 1YX5A 2E7WA 3IS9B 1SFOJ 1WSUA 2MZJA 4GC7A 3IKVA 4NA2A 4O0NA 4B9MA 1XGNA 5CYQA 2LG4A 2DMPA 3IWFA 3HUGB 3AHPA 4ZVRB 2E29A 3CWJA 1TVRB 1Z0XA 2AEFA 2HWIA 2FD5A 5H6QA 2KN4A 1SQFA 2CQBA 3RKYA 2BW2A 5D15A 1MMSA 4YFXF 1RIOH 2XYHB 4V2FA 1VQ6S 4BH9A 1UVNA 1WNEA 4EBEA 3UN3A 5KHDA 3RBDA 1WI9A 4HBLA 3HKZN 3DV8A 4UZBA 2OQRA 3HPOA 1IKWA 1OCPA 3RYRA 4ETSA 1TL3B 4HF1A 3BTIA 2G13A 1S49A 5K9FA 1R36A 3M7GA 2HPUA 4K2EA 1Q78A 3P4UB 1N75A 1X9WA 1KQGB 1ZTWA 1WDDA 3HVTB 4CDGA 3NEKA 2PEHA 4ETXA 4CO8A 2J5OA 2HBZB 1HW8A 3AG3H 4DUZJ 3PW0A 1EKEA 3FCHA 4Y0FA 1D1AA 3F0NA 3T1HF 5HLHA 1U3EM 2DEIA 1NK4A 5KOXA 4G65A 3CDAA 4DR2F 1SD5A 1S0MA 2HAIA 2VPLA 4N0BA 1CJUA 3LA0A 5F0UA 1H3DA 1WJ9A 1OCZH 3S3MA 4USWA 5E1XA 1GXTA 4WZMA 1GVJA 1K1QA 1X1DA 2KIFA 3HZGA 4M3FA 4UXNA 3CD7A 3QRPA 3CCLS 1MWZA 4CO3A 1ACMB 2FZCB 1R0AA 3VQTA 4PDKA 3OYLA 4OI3A 4EYHB 2HNDB 1SXLA 3N4MA 2VKHA 5KFHA 2R0QC 4LG3A 3NOGA 2H48B 3OL4A 2WAEA 2M5YA 1OMSA 4CO5A 4Y2CA 2P6TA 4J9RA 5ETOA 2XNQA 3BQYA 3M2VA 4DXLA 1GXLA 1JIHA 2DGTA 2VASA 3OFGA 1P8GA 3JSMA 1FMVA 3K69A 4PZJA 3ZTRA 1F2HA 4WFNQ 1YG2A 3HHLA 1HD0A 4P10A 2L3MA 1TL8A 1A6LA 2XO7A 2M70A 3AQOA 4XK8C 1HBMB 3ZQFA 1VZ0A 2F1FA 3K7RA 4HLXA 2WY7Q 4NMLA 1IRXA 4CO2A 2NNYA 1WHWA 3PO4A 3B6AA 1SVMA 4ECRA 1YJ9S 1VQLI 3OFEA 2LCWA 4EBCA 1ERDA 3NRBA 1QNTA 4Y34A 4LVOP 1ICEB 1MWQA 2PEBA 4B9TA 4FXVA 3GSDA 1NBEB 3HPHA 4QIEA 4DR2J 3O8WA 3NNHA 2NUUG 4LF1A 3MEDA 4EI2A 2XHKA 2A18A 2KT2A 4G7HF 3KLVA 2VICA 5KAFC 2G1DA 4AQYF 5E0OA 3MAJA 1FWZA 2FD2A 3GR0A 2KJVA 2KH9A 2EBIA 3CD5A 1V3ZA 2KTQA 3OVSA 2OCCH 2NXUA 3CEDA 1WD6A 3TDUC 4ENMA 1O4XA 1STZA 1ZAXA 5D4OA 1FX7A 2MKJA 1SL1A 4CNZA 4UUTA 1W1WE 2RU9A 3M8EA 5L3CA 4O5VA 2PFBA 4LF6F 4GKJJ 2IYIA 1UJ6A 3CF2A 1OYYA 2FHOB 1RBAA 2BE9B 1FMWA 1JI8A 3G9CA 4UHTA 1KC8T 2MZ1A 1FOWA 1UFMA 2CUJA 1N34J 2GIVA 2M8GX 1A36A 2JLEA 1T38A 3PW5A 1JGSA 1S6PB 4X4SA 2GS8A 4H54A 3DLBA 3QODA 4D3HA 5HL7Q 4KKOA 2IC3A 3W8GA 1NTCA 2NQPA 2BE5F 1YHQI 2VI6A 4CO4A 2EPIA 3GIJA 4F52A 3EPGA 4HT7A 3GYXB 2VFTA 3M4OJ 4A4JA 1W7PB 4U0WA 4ZVEA 2HYJA 3ZO7A 5B0BA 3PY8A 1M5HA 3CCRI 1CJVA 1GTEA 3VGVA 2J7UA 2XSJC 3X3UA 2KJCA 2HZAA 4OV6A 1V3FA 1B72B 2YKQA 2C2ZB 4C2MA 5DZ7A 4Y00A 5IWAF 2HGNA 5KG3A 5D3GA 2RQPA 1FX2A 1WUUA 3ILJA 2QEXI 1NB2A 5CCLA 5E1WA 2ZJPQ 4EEFG 3FDSA 3M8ZA 1WJAA 3RPQA 1ORKA 4KGZB 2OKQA 3SZTA 1VQLS 2K02A 4CICA 4TVAB 4N4NB 3PVXA 3CJTA 4X1EA 2KYXA 6AT1B 4AQYJ 1TZ0A 4TN2A 2AQEA 3ZQ7A 3BP8A 1FTZA 1RTIA 2LVWA 3AD9C 5EEHA 5TRDA 3VODA 3TQEA 3ESWB 1Z3YA 3MMCB 4DV1J 4UVCA 3JQJA 2M34A 2EBEA 1PUEE 3M9AA 4DBRA 3Q5FA 1JMTA 3U1MA 2CZ4A 2NXEA 3R6LB 4HTJA 4I67A 2IM2A 4LSNB 2VDIA 3RW6A 4URGA 3CUQA 4F0KA 1FKPA 4LJZF 4ZDPA 3M2RB 1RAJA 4DYCA 4GKKJ 3M6UA 1S0VA 3QPTA 3ZXWA 4D7NA 1R4MB 1KKHA 4RBTA 3M9NB 4WK3A 5HODA 3DYAA 3S3OA 2LECA 2PMUA 1JUSA 2OEJA 3QT8A 4RMNA 3B4DA 3IMQJ 3Q8UA 1XMAA 2GIQA 3EUHA 3KOAA 5KFOA 2MHEA 4R0JA 2VL1A 2NS8A 4PJMA 3CCSI 4EEYA 1ZK8A 4JK1X 4HLYA 2MQLA 3HSDA 4NZ6A 1RU1A 1VQPS 5HNFA 4F3QA 1YHQS 3EMTA 2H3EB 4ZPWR 4USJC 3Q3SA 4MYUA 4RU9A 1UMJA 1HSTA 4I1TA 5D4PA 5T7LA 3CCRS 4C0HA 3QU6A 1JLCA 4WU3A 1S7HA 4TY9A 3H3ZA 3FSIA 2HRUA 1Z67A 1QRYA 1R5GA 3MM5A 5CVVA 4IOBA 3TW6A 2F48A 1S1TB 4XO0A 3FISA 2QLWA 4QW8A 3OJSA 2XMWA 4Q4ZF 2PA3A 1PP8F 4M9ZA 2DH9A 3J81j 5D8HB 1WCMJ 2AJ4A 2YKPA 2M0GB 1TK8A 1WC0A 3WDOA 2L4MA 2QE5A 4MQ9F 5KG0A 3VVUA 4CLYA 2ISZA 2VLAA 2YWGA 3IAS9 1YI2I 3SCLE 3WZ0A 1B7FA 1RI7A 5A8RA 4PYDA 3T5KA 1RDRA 3GFJA 2PT0A 1F5AA 3H1CA 1ZOTA 3G6YA 4OMYA 1QAXA 1ZGJA 4U9RA 2F5GA 2FTRA 4RB0A 2K7JA 2ZH7A 5KCMA 1HLWA 5F1RA 5J1PA 1XG1A 4B3SJ 4WTYA 2P5LC 1TWGJ 4UNOA 1NSQA 2XS2A 4A3BJ 1QAIA 2EI5A 4IYQA 5HS8A 3M1CA 4FISA 1R8BA 3A8KA 3OD2A 2FC9A 3ZXSA 1T9UA 3RAQA 1U48A 1R7JA 3KP3A 1R58A 3E01B 2BOPA 1GTHA 2H1KA 4FS1A 2CFOA 1XS9A 3HHLC 1F43A 5IP9J 5LGUA 2AKWB 5FLXZ 2CPDA 1J27A 4Y15A 1PUFB 1V5IB 2FBIA 3EPIA 3FSYA 5HLTA 2ABYA 3EDRB 2FLNA 4F4YA 2YNHB 1BW5A 4RW7A 5C42B 3QATA 2J5PA 3K5PA 4ZVHA 2FBHA 3UO0A 5B08A 3VTIA 1S5ZA 1TL7A 1X3UA 3DOKA 2DCUB 1RTJA 1ZM9A 3HCXA 4E2FB 3T19A 4IHYA 4DX8H 3MR3A 2XZDB 4J9QA 4EBDA 4CCOA 2C2MB 4MFBA 3CNQP 3JSYA 2NVUB 3RKQA 2FJVA 2E1OA 8ATCB 4ZIWA 2DCEA 3MR7A 5DG9A 2NXNA 1R31A 3HP6A 1PYSB 1X8DA 1Z21A 4UV9A 2L9WA 5F8IA 1S9GA 3HL2A 1IW7F 2OBPA 3IG1A 2Y9HA 2OD5A 2D45A 2CKWA 3ERED 2DT9A 4IPAA 1Y0NA 3MM9B 3K7AJ 1SJRA 2GO8A 3GFYA 2CW7A 2PMZA 2ZH6A 1TMMA 4S05A 2F4MB 3ZMDA 5H9FJ 1Y00A 3S01A 1YI2S 4B9UA 3A4TA 4ZN3A 1EJ9A 1GDTA 3DEWA 5LMNF 3RPUD 2HZTA 5HDKA 3FK4A 5JLXA 2HYIB 3V6DA 4G1PA 3OR1A 2ZJRQ 1X60A 2R3VA 2ADUA 3I64A 2W7NA 1VQOI 1JJCB 5L3FA 5K7HA 2JOQA 4IHSA 4KE5A 1U1LA 5HVFA 3FF5A 1U6BA 4CQ1A 4ELVA 3J80U 3IA0A 2ZOGA 3LSJA 3ENVA 3BT9A 3ZRGA 1HW1A 2KRRA 2BE2A 3PDNA 3BG7A 1KFDA 3KG1A 2WB4A 2P4WA 2JEIA 1EIYB 2CUZA 1YJTA 1E6YA 2AD9A 2UUCF 1RA6A 4Y7NJ 2UXBF 1B99A 3QGIA 2EFNA 3QJLA 4X4QA 1ETYA 4HX7A 2YVSA 3S1NJ 4QWBA 3I55I 4BJ6C 4C9DA 2GQQA 3R0AA 4DL7A 3VZIA 2JA8J 3GZ7A 4MJKA 1RT7B 4DMZA 5ILVA 3PFOA 3WBZA 2A6MA 1AROP 5K5MA 4OL8A 2KRCA 4X4NA 3C7JA 4R5PB 4F4KA 2CJAA 1IN7A 1FNMA 3SQGA 4M3BA 4XLAA 2DNPA 2HYFA 1W2IA 2FLOA 3HJVA 2YKMB 3J7YJ 2J76E 4FKYA 1N6QB 3AB4B 4M9SA 3FC9A 2RNEA 4QWEA 2MDAA 4QPOA 1S1XB 4JI8F 2XHWA 1XMBA 4OYAA 3A13A 2R8KA 1FA0A 1BR2A 5CYVA 3MEEA 1LUJB 4NLXA 4L0ZB 3TZZA 5LMNJ 2YSRA 4XIUA 3CUQC 2WONB 2KZZA 1QA6A 1BQXA 1CJKA 4HSTA 4NQWB 1PO6A 2ZKZA 2FEZA 3JB9k 5KFZA 4ZJQA 1R89A 4RB2C 4BBSJ 3GFIA 4LB5A 2LA4A 1RUSA 5HDNA 1Z2LA 4LQ3A 5KFCA 4ZPVR 5IT4A 4FCYA 2MBFA 3JAMZ 1H6KX 2O03A 1D0EA 4XICA 3GTKJ 2LEAA 3L9ZA 3RUBL 4ENOA 1TL1A 1WJBA 4CLUA 1V6HA 1KFSA 3EUHC 1HR0J 3NS6A 1RPWA 2CUEA 1HNVA 3A3NB 3V6HA 3IR6B 2MC3A 3M05A 4PYAA 3G1MA 3GBGA 5F08A 2MGQA 1X19A 2N4CA 2CV2A 3H2VE 1Q8KA 2ZITA 2HXIA 3N01A 1WF2A 2VG6A 5FRMA 3NBPB 4DJBA 2UXBJ 1YRXA 1W7WA 3K89A 4DLEA 4LK0F 1QHHD 1LWEB 4OYWA 4NLTA 2PX9A 4DSFA 2OUGA 3IGNA 3CC7I 2G2YA 4NE9C 3OIPA 2Z0GA 5EX0A 4HL9A 5GAGU 5HMYA 1WHYA 3KUHA 1O7FA 2GIZA 2PE8A 1RKWA 3HMJG 4FE7A 4PXDA 3E1SA 3I55S 4EUVA 1OCOH 3BYPA 1MH4A 2LXIA 1LWFA 5C2GA 1B3TA 2C1EB 2HS4A 5FD5A 3MCOA 1Y39A 4EGZA 3IH4A 3ADAC 1X9MA 2HQIA 4JI8J 1RSCA 2GJ2A 3LP0B 4BCAA 1YBUA 3ZMSA 3BKUA 4RPFA 1M5PC 3ISNC 2E2HJ 3I32A 3O6BB 3PIOF 4ECXA 4J9UE 4X4TA 4H4OA 3SV3A 2XKPA 2IA0A 2PFFB 1ZM3A 2DNRA 2ZOFA 1RGVA 3QIPB 1LPQA 4WBFA 2Z2ZA 5JJBA 1XC9A 1T11A 3WU1B 5BYRA 4II2A 1JXSA 2OU2A 2WB1N 5B3SH 4YIFA 2CA9A 2D5VA 1RT3A 3K4JA 1LQ1A 1T02A 5ITHA 7AT1B 1P9QC 1KWMA 3PCOB 2H54B 4URSA 2IJFA 3AY0A 2XPUA 4FYDA 2JSCA 2J9DA 2DITA 3H5RA 1YJWI 6FD1A 3CTAA 4BYYA 3DLJA 1YLXA 4J5OA 4FXDA 4UVAA 2R7WA 1NK5A 1DDNA 3VFZA 1FWKA 3UFCX 3CJSA 4PJJA 2MGZA 2BKPA 4E7ZA 4B3OA 2C2KB 3CMMA 3QPHA 1KA8A 2HFHA 2PLYA 1DPUA 2HHUA 4IRKA 2HQRA 4X64F 3SSRA 2QMWA 3DKYA 3CQZJ 2HNYA 3SHFA 2GAUA 3M4XA 3G1LA 3WTWC 2X1BA 4HHHA 4JI4F 5I42A 5F0WA 2YX4A 3BJ6A 4GMKA 1JHHA 4OZLA 4FKXA 3OYGA 1MMAA 5T14A 1QBJA 3MZYA 3CO7C 1RAOA 3D0SA 1FO1A 1X4HA 3CC7S 2VBYA 4OJGA 2MQ8A 3HOSA 4XKWA 4OI1A 3H4BA 4WK1A 3CC2I 2DNNA 4I0WA 2VIHA 4JOMA 4OZNA 1IBKF 1MN9A 1F60B 2HHTA 3ETMA 5LJ5Y 4ZJLA 3PEJA 4I64A 5K8NA 1QZYA 3KUEA 3OFFA 3D5SC 3TUZC 1YIJI 4CNYA 4ECUA 2NVTJ 1K44A 3R1LA 2QVOA 4B3RF 2BM0A 1RZ4A 4GRSA 2C2DA 3BPXA 3FXQA 1RUOA 4RLFA 3EGVA 4EMSA 3QP6A 5EEAA 2MY7A 2BX6A 2UUBJ 4D3GA 1Q0NA 1IR2A 4LFCF 5ICCA 4CI0B 4M94A 1SANA 4UUWA 4BE0A 3DEUA 3OR1C 3T5XA 3VYRB 4UT4A 2M9KA 2F5FA 4USUA 3LP1B 1TP4A 3Q2TC 4ELTA 1OY6A 5GAGJ 4TYBA 3MFHA 1QUPA 3M6XA 3HGGA 1YRNB 2N7CA 2HIQA 2LR8A 3E6MA 3VDXA 2QO3A 2AQ4A 1YJWS 1SMTA 3J81K 3F9KA 4ANEA 5KVRA 1NDKA 3HHLD 1XMKA 3IBCB 2EV5A 4PABA 3KCCA 3U9GA 2ZFUA 1U1PA 3TO6A 2NXJA 1FFSB 1X4PA 4A12A 4CP5A 4UTGA 1LFBA 1XSVA 3KP4A 2ECCA 3DKWA 3G6EI 3FBFA 4AU7A 1TL5A 4QPTA 2KRFA 4WFZA 3MPDA 5L39A 5CZXA 2V2QA 2DR8A 1UL3A 4DV6J 1Q7YT 4KYZA 2DK8A 3EZOA 5KFIA 1V5VA 3W62A 4LSZB 4MKBA 3MAHA 5J1UA 2KXHA 3R2DJ 4RW6B 4U7BA 5KFJA 2VPRA 3I9V2 4E6KG 1DFDA 3ZQGA 4XL9A 4P96A 1ZS6A 2YKNA 1RKTA 3HDSA 3MCMA 5U47A 1UEVA 2JRTA 1GMVA 4OLOA 5D4NA 3W2VA 2GAHC 1IKVA 1FI4A 4TYAA 2ZD1B 3CC2S 4I4BA 2YU3A 3V4IB 1FJ7A 4O4GB 3LP2B 3T1YF 3GZ5A 2ZE2A 4P1WA 5I3UA 3R61A 2XWYA 1KU2A 3KIOA 2GOXB 4K0KF 3KJQB 4U8YA 4C48A 1GV2A 3MTKA 1C1BB 3SDEB 1URRA 2J6UA 1XR7A 2O61A 3S1RJ 2X0LA 4XTTA 1AUDA 1XERA 1HNIA 3DMJA 4WIIA 2EVZA 3LAPA 2VDHA 4N4OB 2QMXA 1HWJA 1MLAA 5IC6B 3HFVA 2ZUGA 1R27B 3J7AY 4BJTA 2XRLA 4C3IJ 3O44A 3GWCA 5IT9Z 1U1KA 3MEKA 1N25A 1J75A 1R8PA 4J9LA 3UE2A 2JWTA 2GJFA 3JTPA 4F2RA 1XGOA 1ZZFA 3GTMJ 4NUBA 4OMFG 1F9EB 3TJAA 3OUYA 3FUYA 3GFLA 3QYYA 4RW8A 3RTVA 3KEYA 3U27A 3IRWP 4AYBN 1TV6B 1RKJA 4U7UD 4IKAA 2E9TA 4DSJA 1U45A 2JJ4D 3I5BA 1YW9A 3DRRA 3KK1A 3NQOA 2NR0A 3M07A 5JVGF 3BG6A 5EZGA 2KXFA 4O4RA 3G6ES 2LY1A 4ECTA 2R93J 2G2ZA 2B0LA 3K2YA 1ZG1A 2NYIA 2NVXJ 4GCVA 5E3AA 2GOMA 2MHNA 3CDUA 5THWA 2DK2A 2Q3PA 2D7SA 4KY3A 3W60A 5DQHA 4OAYA 3GYNA 1KYWA 3TEDA 1MU2B 3CVKA 2CWXA 2JVGA 1IJWC 2BOLA 2B9EA 1G3OA 2V4QA 4RUCA 4DU7A 1T0FA 5KFUA 1DZ5A 3T1YJ 2EJRA 2L41A 1S7AA 1SVLA 2L9NA 5HN0A 3H98A 1V5GA 4ZHRA 2D9OA 1RHMB 4K0KJ 4OWRB 2R7RA 4RAGA 1UFWA 3GTPJ 5F9LA 3FM5A 4RX6A 3TW7A 3DQVC 4X66J 2CVEA 4HQMA 3UDVA 3OV8A 2H8WA 1FFWB 2JTVA 4DPOA 1QVGR 3VSKA 4CYCA 1JLGB 2L08A 4F3OA 4LGWA 2HLTA 2W1BA 3ZP5A 2QKMB 5D5UB 3KP6A 3J81Y 1NHKL 2Y1JA 3WODF 2YPRA 2HOSA 1NRKA 2QG9B 3PEHA 5KFSA 1KD1T 1T7PA 1DTTB 1VCTA 1WZ2A 3MEGA 1UVMA 4J9VA 5B1BH 1T0TV 4Y2KA 2GVDB 2X6XA 2OIHA 2CQCA 3L95X 1KTVA 2Q6CA 4PPDA 4EM0B 2D3OR 4DV0F 3DRSA 2CQPA 1CVJA 1TT5B 4LK1F 1NK6A 4DV7F 3TAMB 2V8VA 4LBIA 1SI9A 2NNNA 2FVPA 4Q44A 2ZWPA 1YBAA 3ABUA 2QQAA 1P6TA 3C14A 3R5BA 1HYSB 1ACIA 4XKCA 1T9YA 4DYRA 2XHCA 4U7CA 2O01C 4ILRA 1RWUA 5BS6A 5D77A 2A07F 2HVZA 3DLGB 2HR3A 1YK9A 2BANA 4FF3A 2JX2A 4ES3A 2CQHA 5H9EJ 1L3VA 1VC6A 1NEEA 2P9GA 5E8IA 1NH8A 2HXOA 2Q0OA 4ERDA 4HI1A 1F4KA 4YP3A 2W9CA 1QTNB 4LRFA 2MYSA 5C25B 3N0VA 1BMQB 4GYIA 1FJGF 1BIBA 4BY1J 1S1VA 4DR3F 4DR1F 1EH6A 4LFBF 1J09A 4A3CJ 2Q79A 4HQEA 3W6VA 5LL6d 2KT0A 4MH8A 5D0GA 2KKOA 2CFXA 4I6AA 4CT8A 4HRIA 1UTAA 5CA5A 4WFBQ 3TO9A 3ISND 3UDEA 4IHVA 1GXQA 5HLIA 3DDNA 1VTNC 3L2RA 1C1CA 5DGAA 3KLEA 2EINH 4XK4A 2KHMA 1FEXA 4ZCKA 2XSDC 3GFHA 4I98B 3EZ5A 2XF5A 4LIUA 1MROB 5AIQA 1OJLA 1YTYA 2YNFB 1CULB 1T03A 1YQHA 1T6SA 1BA5A 1SKUB 1HQUA 3DRPB 3T1BA 2HHSA 4WXOA 3IV5A 4DV0J 4ZCIA 2H6CA 4DV7J 2V9PA 4L75A 3CJ4A 1U1OA 1M5KC 3GJTB 1P1LA 1MW7A 3CXCR 4BQOA 4B3MF 2UVWA 1VYAA 2VONA 2K5CA 2DNQA 1HPZA 2DNMA 3KNGA 5E5NA 2XMMA 4OYOA 1FY7A 1R6VA 3HUGA 2ZBRA 2BUNA 2J9DE 1CG2A 1I5OB 4WP9A 1C0TA 4HI2A 3OYKA 1LFWA 4DZDA 4RB3C 1UG0A 1YJRA 3ET6A 4HV6A 3LA7A 4CLWA 4PQUA 1A35A 5E2QA 5HVGA 1WC6A 1VQNI 3NCQA 4PJ0C 1VJWA 2J0WA 5K14B 3CCUI 4QU7A 4DBQA 2IM1A 2KT5A 4C0OC 1HLVA 4H4KA 1N77A 1F36A 4DR3J 2MYFA 1O5JA 1DAXA 4LFBJ 1I6XA 4OYIA 4N41A 2XB0X 1TUWA 3ZMTA 4NI2B 1TKZA 3E7LA 1KGSA 3QSIA 5MAOA 1XTZA 1VMBA 4XNFA 1VRUB 3SMZA 2G9WA 2B4UA 2OPPA 2YWFA 4DZ6A 2H4WB 4LLNA 2BV6A 1X4AA 2PMZD 1LWCA 3VSLA 1D09B 1KOOA 4O3RA 2YY3A 1J9IA 1C4AA 3IN5A 1MG7A 3QQCD 2CPYA 3CDIA 2FVRA 2P0WA 3H9QA 4QYZK 3DLAA 2CYYA 3GLXA 1IWGA 1KLMB 2GCFA 4DQSA 1GK8A 3S17J 3MFIA 4UB8C 2GVZA 3PJRA 3KKFA 1LDDA 2Z5UA 5EG0B 2XYPB 4ILMA 2CJ9A 4RLEA 4JI7J 5L1JA 1NKEA 1BW6A 1J5OB 5HMXA 3JTHA 2VFVA 3F72A 3Q0WA 2W24A 2RDDA 1WKKA 3TP3A 1YITI 3OYJA 2ERRA 1IRFA 1RT2B 1DBDA 1VDHA 1UHMA 3Q22A 3DFGA 1AKHA 1I50J 3EVMA 1NK9A 3MUTP 1FK9B 2COLA 3VWSA 1FHTA 3CIMA 1KQFB 4I68A 4MK8A 2DFIA 4KQZA 4HDUA 2DISA 3CCMS 1EKRA 4E4HA 4KIFA 1S6QB 5BPDA 2J0XA 1F1ZA 4YN3B 1Q53A 1XSDA 2WB1D 1NAQA 2R4FA 1LFUP 4DUYJ 2DNLA 4C98A 4XDCA 1VQNS 3SDGA 3I54A 1FTTA 3CZ6A 3VAMA 4A69C 2HFVA 2TCTA 1XN9A 1IQZA 3D2WA 1YOVB 3JRCA 2UXXA 4DI6A 3I31A 1B1BA 2E5GA 3AKZA 4ZTFA 1XCVA 4QR0A 3QWPA 2X1CA 5HP1B 2GXGA 4OAZA 1TU0B 2RRNA 2V4RA 5CXTA 1G3WA 3ZTSA 5B66C 1SMYF 3PIOQ 4ZS6A 1PAUB 4L76A 2RU3A 2K9NA 1RB0A 3TVZA 2GX8A 1JT0A 4PCQA 3FXOA 1N5YA 5IM0A 2LH9A 4E7IA 1BI3A 2ELHA 5CD4H 3M8QA 2OPQB 3BR6A 1WHVA 2ATCB 3AJDA 3PFIA 3ZCOA 4X65J 2XAFA 3M8WA 4DDFA 3F8BA 2GGPB 3ABTA 3Q83A 2W2MP 4DL3A 2XGQA 3SFZA 5E3QA 3K2ZA 2HSEB 5GADI 3OL9A 2CJKA 1QZEA 2FGOA 2P8TA 4Q45A 4UB6C 1HNZF 4ZDLA 1RWOB 3BDPA 2D41A 3D5RC 2M52A 1TW3A 3W5ZA 3KK3A 4L73A 4LSLB 3OBIA 4YELA 3CMYA 1WG1A 3OR2A 4DPUA 2Y30A 1H88C 3RI4A 1YITS 1HI0P 5C3EJ 4OIOF 2BRKA 2YKAA 2JVHA 1BQNB 2EFGA 3B8HA 2D74B 3CJQB 4M3DA 1TELA 1CC8A 1B8IA 2PMHA 3VAHA 3OXGA 3OXFA 3RB0A 1F9HA 1OCTC 3I0SA 3Q89A 1BQMA 4YB6A 1XD7A 3IHUA 4IZZA 5DM6F 2P5KA 3BKFA 3QYEA 4PG8A 3HM5A 1WELA 2AV5A 4P9UA 4DR7J 2B7CB 4I0AA 2ZMEA 4XIDA 2ROPA 4ZYHA 3RZOJ 3HEFA 3OS1A 3TX8A 1MNEA 4A3LJ 1HBNB 3SDBA 2L9DA 2E1MB 2K40A 2AQFA 1FE4A 2C42A 5DZ6A 2MXYA 4P55A 4TQSA 1X0FA 2O8XA 2XF7A 4P5OA 4WCGA 1QZZA 1MMGA 3IP0A 3ZN1A 1JXVA 2XI3A 1OPZA 2V6CA 5ETLA 3AFGA 1D9AA 2CRLA 3KJVA 2DFFA 4ED1A 4I09A 2RAQA 4G6DA 4HPQA 2LDYA 3BQ1A 3DGPA 4XLHA 1Y0HA 4GVBB 1JK9B 3ZQIA 4ED4A 5E3RA 1N36J 3H92A 2EA2A 2DXFA 4F26A 1CS4B 1FP1D 3EYIA 3ULHA 2CW8A 4ILLA 3IL2A 5H6RA 3MD3A 2FOKA 1N52B 4JOUA 1J59A 1T98A 1RQ0A 2AW0A 3L2UA 1C0UA 1U8SA 3H5NA 2QC3A 5DDGA 2R7QA 2ZVSA 4D0PA 1BOAA 1VNDA 2W9BA 5ED4A 4NLUA 4DGWB 4G6TB 5A8KB 1QVUA 2JJ7A 2B5JB 2HFNA 4L72B 3PKYA 4A47A 3U1LA 4NXMF 2L3DA 4NASA 2ZM6J 2ZXJA 2AIRB 4M3EA 2IAJA 4M71A 4FPRA 5J2PA 4V19X 4RNOA 5A6WA 1BLUA 3CUNA 2UV1A 4C3MA 1MBKA 1H0MA 1XBWA 3TI0A 3GXOA 1S7OA 4CZCA 2CPZA 1UW4A 3M2UB 2O1PA 3BG3A 2BQRA 1JLBB 3N9UC 2WV0A 3WG9A 2LBFB 3BO2A 1WI8A 1HI8A 2OTLS 2EK1A 2HIYA 4LR8A 4I0BA 2L7MP 1IN5A 2F5CA 3WE2A 2JUGA 3E8OA 4KN4X 4HG2A 4HACB 5HJYA 1S57A 2DYRH 5JI6A 1IBCB 2IEKA 5GP9A 3C6UA 1AU7A 3SFUA 1EZZB 3WTXC 3HF5A 1H9TA 5J47A 1BM9A 4M5NA 1V55H 2PDAA 2FNPA 2DY1A 3VF0B 2XMVA 2ZBKA 1RT4B 5JR3A 4P71A 3K5LA 2NZCA 1VQ9I 1S1TA 4C11A 5C24B 1FBUA 3NCPA 4AYBD 1VBZA 4I2QA 1LK5A 2BV3A 2FOWA 3ILOA 4WX9A 1XNRJ 1VFJA 4DS4A 2X6YA 1ULRA 5BPIA 3C6TB 5KNLA 5GAEU 3I0RB 3M8JA 1T95A 3HOZJ 1YJVA 2QUFA 5FKMA 4KICA 2I5JB 2F4VF 5DM7F 4KIGA 3DXSX 3RDIA 4KHPF 2CAJA 2KISA 5HROA 5KFWA 3VCDA 5E20A 4QCLA 3THVA 3P9KA 1SBRA 1RABB 2VH7A 4DPYA 5ICEA 4W97A 2CJJA 1PJ5A 2LFBA 2RD5C 2IS6A 1EETB 4A8WA 3M8RA 2B6AB 1HF0A 2V8PA 1ZAOA 1KHWA 1FDDA 2VPWB 3QAEA 4FYYB 4WE1A 1I51B 1D3WA 4X4PA 3MD1A 2LLZA 3VALA 2ZKTA 2LRDA 3QLHA 3CD6S 5H9FK 1SH0A 4NHJA 2XC9A 1TT0A 2EZKA 2R92J 1URNA 1ZKGA 3DPTA 2QRRA 4RO0A 5JVGQ 1IF1A 1DPRA 4QIWD 3NGKA 4N5SA 2LOOA 1NCLA 2XC7A 2IA6A 3HD1A 4BXXJ 2ZC2A 4I56A 1X1CA 2WVFA 1P2FA 1BUXA 4RAZA 4QPQA 4Q48A 1OYDA 2CQ7A 2EG2A 3HSRA 2DGQA 4IHTA 2Y8YA 4BXFA 1RWNB 2L7KA 1SFEA 2K4BA 2RRBA 1GH8A 3MOJB 3LSIA 2V67A 5K1YA 2LY2A 4A3EJ 5HJXA 1H0HB 5J2MB 2XF6A 3UR0A 1YW7A 2JEJA 5EUHA 4UW2A 2JMWA 3FBEA 1FERA 2LEPA 1W5TA 2HKEA 1R0CB 3ZC4A 4OYZA 3FRYA 2XY5A 4KFBA 3NGSA 1AFIA 4YUDA 4QZVB 1OISA 2XKOA 4DQRA 4H4MA 1JQGA 3QWUA 2HNHA 2F4VJ 4EJWA 1OY8A 1Q86T 1RTHB 2ASLA 3DF8A 2KLOA 4CCKA 1V3SA 4WFXA 5FFZA 4F93B 2MQMA 4IFYA 5F64A 2ATLA 2LDUA 3G3ZA 5HATA 3BH7B 4NYOA 4C3LA 2V2KA 2DPDA 4GO5X 3OR2C 5L38A 4FVMA 2EFQA 3F6VA 4DX6A 4AL5A 3MMYB 4JI5F 5K8OA 1T3NA 4IO9F 4I7FA 3A12A 4C2MJ 1B9MA 3CJRA 1CF7A 5BQTA 4ZTJA 4BDZA 3MPUB 4ID5B 3HXMA 2ZHBA 3MXHP 2IS4A 3ECHA 3D0GE 3IBWA 1IUJA 1KVJA 2Z2SB 3L7OA 1O3SA 3G6VA 1OLTA 2YKOA 4R1HA 3C66A 4YS2A 2QCOA 1VF9A 2DFEA 2HVEA 4Y65A 2RV8A 3DRXA 4ZPBA 4XRSG 2FJAB 4F0MA 4BBYA 3MGJA 1S72I 2X6OA 3ITHA 1D8JA 4OHYA 2ZMEC 3VQSA 1WVRA 2XMAA 4C30A 5DV5A 5F6FA 1D0ZA 4CLFA 4OU0A 3RRGA 3FDYA 3OVAA 3NWRA 3NCRA 3CDWA 3TARA 2HQAA 4MNUA 1D8YA 3M30A 3DLHA 3S32A 2VKEA 2RSQA 1QVFR 4IG0B 2W2NP 2MC4A 2P7VB 4A6DA 4KO0B 1RT7A 3GB0A 4WPAA 3DOLB 4BS9A 1ZLKA 2A2DA 2C3MA 1G2EA 1UKUA 3FCVA 4Y28C 5LBQA 3F8NA 4PUOB 1SV5B 1F3FA 1ZELA 4U96A 1YVFA 3DEEA 4A8KA 2V50A 4AD9A 1EHWA 1TKTA 2Z57B 2C3YA 4C8ZA 3BBFA 4K4TA 3UCGA 2ESNA 2FHMA 2PG4A 3CE8A 1F9NA 1Y5NB 4CM2A 5CAAA 2DHSA 2OUMA 1O3RA 2J9EA 3G4SS 4JI5J 1UVLA 2DPJA 4ZP8A 2Z1DA 1WH5A 3J80K 4ENJA 1SIWB 1LKXA 3CF5F 1FBSA 4JV5J 1QD1A 1KQKA 2F9DA 3C15A 2IGNA 4EVIA 1BC7C 4DHVA 3N05A 1IQTA 3EQLF 1SAUA 2BOAA 3OTOF 4O23A 3PYDA 3DPUA 5KFQA 2C28A 2DW4A 2KVQE 3DLLF 3G86A 3JSPA 3KLIB 3IM8A 4N8OA 3ZQCA 4DJAA 2IJLA 1S77D 1USSA 4MO7A 2QBYA 2NAZA 2QLFB 1VQKI 3MKYB 4FX4A 2RQQA 2MA3A 1VI7A 1YS6A 4ABZA 2Y0MA 1KS2A 5HI7A 4WU2A 2WADA 3BGRA 1HKQA 3C1DA 1RTZA 1N5QA 3T0YA 1DP7P 3O8HA 1F6TA 2MEWA 3WTVC 4M9XA 1WF1A 3HX9A 1FOXA 1HQ2A 2UZAA 4F50A 1HQEB 4KISA 4ZP9A 2N3LA 2KM8B 2L5QA 2Q2EB 2VKZG 2L2OA 3F8CA 3CJKA 4LB6B 8RUCA 1LQ9A 2KHCA 3MMAB 1TK5A 3LQQA 1NJYA 4WP8A 1N48A 5AXLA 3F44A 2HWTA 1Y11A 2D1HA 3V4MA 1O3TA 4Z7CA 2KKHA 4IFVA 1HQCA 1FE0A 2NYHA 4UY85 1TKXB 4OZ2A 3LOCA 2EKNA 5HVQC 1SFXA 1WG4A 1C4CA 2E7VA 2RJZA 2G1HA 2A10A 2DH8A 2HFOA 2HQFA 4TY8A 1P4WA 3AXMA 2BVZA 1E0EA 9RUBA 4ECZA 1N0VC 4XPEA 3LGMA 5L3DA 2J8SA 2XCAA 3JTNA 3H40A 1NPPA 1MSWD 3K4BA 3RRKA 4U8VA 2OSQA 1LV5A 4JI1F 4I2OA 2VG5A 2V34A 2CQ2A 4JBAA 4E7KA 2VBWA 1TL4A 2CPFA 5KFBA 4F04B 1IUFA 2HNZB 3LSRA 4PJLA 2XDVA 4DV3F 2E5NA 3PYFA 2E1PA 5A8WA 4P7VA 3OTOJ 2Z9OA 5DCMB 2BR0A 4XLCA 2STTA 2NYXA 3Q2SC 3HOTA 3KK2A 2QFIA 3BZCA 3SSQA 2CQGA 4RM2A 3AH6A 3NS7B 3TYTA 2YPZA 4RBOA 5HOOA 2GA2A 1K6OA 3QT5A 4PWDA 5AE1A 3TZWA 1T05A 5IS2A 1NK2P 4YDDB 2YWWA 2XCPA 3FK6A 4IJAA 2QA4S 2ADBA 2R5ZB 3FKBA 5BYSA 1SUQB 1HBOB 1OR7C 1AHDP 1N32F 3H36A 3PTWA 1S48A 1U02A 3SQOP 1ZGWA 4M95A 2JVRA 1UZCA 3BROA 3G71I 1ZTTA 4FXWA 5CHCB 3IC1A 4II3A 2XGEA 2FYXA 4F91B 2J6TA 2V9WA 4PXCA 1VBKA 3B02A 1HHSA 4YHHJ 3FWEA 1JLAA 2CPXA 4HEA9 1EX8A 2DGUA 3FBBA 5J2QB 2VJ4A 2HQNA 4OZJA 5H1SV 2W7PA 4UUSB 2GLOA 1U4BA 1TQMA 3LSTA 2UZKA 3J80Y 4AIHA 5FDLB 5HNHA 4LF8F 2FF4A 1X7VA 3DFEA 2CXEA 1Y5LB 5ERIA 2EZIA 2VIXA 2V2ZA 5D0RA 3TUIC 2QTWA 1WHUA 4ZJZA 1YS7A 2PN6A 4L3NA 1RE1B 3SYZA 3WC0A 2GO9A 1S9HA 2HBRB 4C3KA 3DOMA 3FFIB 3RYLA 3LSMA 4I69A 2Y0SN 5GMKa 3KE2A 1DURA 2IHR1 3F21A 1KSPA 2MQPA 1ZQ3P 4F4WA 5IYBJ 3BS9A 4DV3J 1H2VZ 3BV8A 2H1YA 1LE8A 3K17A 4RW9B 3QP5A 3K58A 3ZZ0A 3V2UC 1VQMI 1OS5A 3J81Z 1PJ7A 3JTOA 4CLZA 3N6LA 4Q7AA 2OFHX 3GWZA 4UOCA 2CV0A 1JNZB 2BXZA 1FXDA 1FIAA 2JDJA 2K2PA 1WJ5A 4F4AA 1RYSA 3VGTA 5KG1A 3UVJA 3OLAA 3BGLA 3PG9A 3AB2B 3D3CJ 1N32J 3R6SA 2ZKUA 3H9JA 2BEFA 2WVCA 1QGPA 5E33A 3GQCA 3C3LA 1XR5A 2IT0A 2EC2A 3HHHA 2AGPA 1QVTA 2MLXA 2IDLA 3LL7A 3FMBA 2VQHA 3S93A 1RLCL 3GF2A 5JVHQ 4M74A 4OHXA 4PEOA 3H20A 2MMYA 3B4MA 4WTOB 3JRFA 3TDZC 2ELKA 4UY8T 4M5JA 2VPZB 2BJEA 1RLDA 3G71S 4IOCF 2JNJA 5LJ3Y 3EWGA 3HSGA 1CQNA 2DNYA 2X1GA 2RDJA 3JYTB 2XLJA 1D0XA 4LF8J 2WBMA 3WGGA 3SCIE 2OI2A 2NREA 3V4IA 2JLGA 4CLSA 4EO8A 2DN0A 4O44B 1U47A 4NLVA 3RQ4A 5HLGA 5HLFA 1EQMA 1VI0A 1RWWB 2L4AA 3M8FA 1RESA 3C2HA 2VUGA 3R9LA 3KLHA 4IH7A 2IJNA 2BE7D 4QWAA 2MH2A 3PHEA 2HU9A 2DB1A 3PX6A 1N33F 4P2XA 2W57A 2WWYA 1UFLA 4OV1A 2RDIA 4ESFA 4OI2A 1TQPA 2M2EA 3H5XA 1NKCA 5LGNA 1KN6A 4YB5A 3M1VA 5T41A 1BN5A 5I3QA 2VA3A 1JJHA 1D8KA 3QO9A 4ZZDA 2BQUA 1VQMS 3ZMZA 5HVHA 2K9MA 4TLRA 4AXJA 3SI8A 4NC8A 2DRDA 3FK7A 2ILYA 4AVZA 1W7PD 3OPKA 3VV2B 4OX7A 1TFYA 2RVCA 1ZPWX 2KHDA 3Q0AA 1SD7A 1MJAA 1BD6A 1JKPC 4LG0A 3ILIA 3AOAA 4Y4RA 4N9HA 4F0HA 3CCQI 4L3KA 2LU2A 1HW9A 4NA1A 4WZQA 2M4GA 5JLWA 2XS5A 1VQ5I 3ERMA 4P9SA 1Y8QB 5CYMB 4X4RA 1UHSA 3F23A 3NWSA 3FMRA 1U0HB 4A3JJ 2HVDA 2Q8KA 2NOGA 1PSDA 3DLEB 3DHWC 3QGPA 5CVIA 3KHHA 2LEBA 5H9EK 2Q66A 2RS2A 4C2UA 5FD1A 2I8DA 2KFYA 5DM7Q 4O3SA 5CYQB 4HZFA 1K83J 2WAQA 2KL8A 2DFHA 1GX5A 3U02A 4QIGA 1X5TA 2H4YB 3V7SA 2CQKA 2XS7A 3ASOH 1VK8A 2MZSA 4OQJA 2HZDA 3I82A 1ON2A 6FDRA 3NMAA 2HHXA 1T8EA 3K6GA 1USTA 2K7KA 2VFUA 2A0FB 3PRBA 2QA2A 4RDUA 1VQSA 1HNXJ 2MB0B 4DLGA 3HO1A 4J9MA 4A93J 4DF4A 3UQSA 4KGMA 2XB2D 2DRAA 2R7XA 3B73A 1F5BA 3ELHA 4K5SA 3R6GB 1DQ9A 4LR7A 3CCVI 1OIAA 1VGYA 2QQ9A 2BXYA 4GO1A 5DD4A 1P4AA 3EUKL 2IRUA 3CTRA 1NMEB 1FX4A 1VQ4I 2BM1A 3Q8QB 1R5ID 4DV2J 1BIAA 1AXQA 3W5YA 5KT6A 2I9SA 9ANTA 1V3RA 1P9YA 2Z2MA 3UD4P 1ZBTA 3RW7A 3HLUA 4MFDA 4LF9F 1TR0A 5HDGA 3AJ1A 2HG4A 1WJCA 3CLQA 1CJTA 4N76A 3PYGA 1CJUB 3GONA 3OIQA 4AUKA 4BQAA 1O57A 3QAHA 4MLOA 3CCQS 3HOUJ 4X4UA 2Y9ZA 1R6YA 4KB7A 3K2AA 3ROUA 3F0CA 3RJPA 3GJQB 1VQ5S 1S6LA 5ETVA 2G0EA 2CPEA 3HFZB 1R0AB 1BWEA 4RA2A 2F3JA 3HKZA 1FD8A 4MIBA 1NZAA 3S1TA 1M5OC 4RW4A 4DR5F 5L3GA 2CJBA 3CO0P 3ZGKA 3D6TB 1S1UA 3C8YA 2H27A 1RT6A 2UV8G 2QWWA 5F3TA 4I6WA 3C18A 3MZ8A 2F6CA 1IXSB 2WTEA 3U1DA 4X0GA 2B4OA 2FQQB 2W84A 2C3PA 1IR0A 1QSYA 2MKCA 2B63J 1Q8IA 4KSEB 4O6JA 2QSHX 2K3IA 2W7AA 3H42A 3JSMB 3V81A 2YNFA 4KYWA 1RACB 1P1TA 4ZLJA 4DYQA 3R5AA 1HL6A 2W85A 3GTYX 1MBFA 5EWEA 4L0YB 4IO9Q 2OAUA 1S7EA 1EH7A 3FBNB 3MQ0A 1BXNA 2NRAC 1UETA 2PIIA 3TVYA 4PGHA 1NK3P 4DR6F 1G3TA 3MOZA 1FD2A 1RP5A 1NUEA 4I76A 3IRXA 5J40A 4NLOA 4LF9J 2XSJA 4C2TA 2I2YA 3CCVS 3ZZOA 4NZ0A 3GZNB 3OS2A 3GZ6A 3Q8RB 2GHWA 3M8PA 3OYIA 3MEDB 1X4BA 1VQ4S 3FBIB 5KG2A 2OJ3A 4MQVA 2XZTB 2COBA 5IP6A 3T6JA 4FETA 1OO0B 3D68A 3QIDA 3PO2J 3LGNA 5LD2C 5CJ9A 3RSNA 2WVBA 3I5CA 3I9V9 4GC6A 3HI9A 1AOYA 5B0FA 2E5HA 1WPKA 3MMBA 4UOHA 3CB4A 3HOYJ 3H0PA 2VQCA 3J7Z5 4RWWA 3K4MA 4IQ4A 5D0HA 2ZH4A 3PZPA 3R7SB 4G9YA 5IY5H 1H7WA 2O66A 4KC5A 3LO3A 1FJCA 1FFGB 2DY9A 2H5JB 4DV4F 1NH7A 3D4JA 4JUZA 3D67A 3HZEA 3RU0A 4IRDA 1HKAA 1WOSA 3IP4B 2R9LA 4DL6A 3TQNA 4NCGA 5FLVA 1FEHA 3QRRA 2DQLA 4BE2A 3BR3A 3ZTPA 3F22A 1ZG3A 5DRKA 4B1RA 4ZPTR 2EKYA 5D0EA 3JREA 4AC0A 1KVKA 5D78A 5IZHA 5BMZA 5LXRA 4XRMA 5FKLA 4KKOB 2IC3B 1NK8A 4RGUA 2IGMA 4AWXB 3KYLA 2NPFA 3W8PA 1HC8A 1JXEA 3CCEI 2Q1LA 3CF5Q 2HGMA 4RNNA 4F7ZA 3FGVA 4O3OA 1CJVB 2JQ7A 1U49A 4HA8A 3I59B 4QW9A 4BAYA 2HVHA 4DR6J 2CNOB 3L7UA 3K4CA 1YDLA 2EQRA 3OVBA 5D3GB 1S79A 3O3LA 3GU0A 3D0HE 3DLLQ 2OPRA 2C2OB 2F8MA 2Y1RI 4GFBA 1S8NA 1FLIA 4M5DA 5DDPC 1Q82T 2VQFF 3CJTB 4EJTA 4J01A 1YWXA 2VQGA 2V8GA 3D1QA 2OMLA 2M0MA 3Q8VA 1RTIB 2ME0A 4OHZA 4AE5A 3HRSA 2ZH2A 2F4OB 1S6QA 4G1IA 3EM1A 4LF7F 2NXCA 3H4DA 3D1NI 3P9IA 5CQGA 2FJXA 2DJNA 3NNCA 1NK7A 1OY9A 1RTDA 2XMTA 4B9SA 3GLJA 2PI5A 2QLZA 2E19A 4C3JJ 1HBUA 1FBQA 1KR4A 4AT1B 4BHQA 4DV4J 1WORA 1E2XA 5E79C 3CUQB 5BJRA 1RRJA 1K78A 5E3NA 4XRFA 1FKPB 2ZFHA 1KU3A 1FT9A 4XMYA 1TTYA 1FVSA 5B1AH 1U7LA 5RUBA 2GFFA 4MKVA 2FVQA 5KFRA 4C4WA 4JI0J 3DYAB 1XCBA 1BY9A 3S14J 4JX6A 1VQ7I 3V42A 3T9NA 2VPYB 4Q2MA 2KRHA 2W9AA 1DUXC 2A6TA 1M1HA 1E3HA 3GYHX 1RHUB 3RBZA 1VRTB 3MCSA 2XV4S 4F55A 3BCBA 2MQOA 4GKJF 4ICLA 3AFHA 1JB0C 2QMUB 3K70C 4IHXA 1WHXA 4BC9A 4W90B 4XN0A 3WTTC 1WSRA 2K7LA 2XY7A 4RM3A 4C8YA 1U26A 1N34F 2CPIA 4P74A 2FMYA 2QYOA 2IYGA 3CCES 2M4KA 2J0QD 2J9CA 3KFWX 1L3LA 3R7BB 2CQ0A 5T7LB 1JLCB 1REVA 2DA6A 5IOZA 2RKIA 4JX5A 3GFZA 3I56I 4LIRA 3JR9A 1LXNA 3HHNB 4P7TA 2VQFJ 3OTBA 1ZRCA 3MM5B 5C44J 2ZC3A 4X4VA 2KVIA 1D9FA 3GVAA 1FRMA 2J8AA 5F0FA 2Y0SD 3TAQA 1R3NA 1WC3A 4LF7J 2HYGD 1RAIB 3J7ZT 2MD0A 1UW9A 3N6MA 3HT3A 3CJ2A 1I27A 4A3MJ 4EWTA 3FJ2A 2DIUA 4F8RA 2OO4A 5IOYA 2CQ1A 1U1QA 3SFGA 3HXLA 2JA5J 3CCTA 3KHRA 1OSDA 4LIVA 1S1WA 4ECWA 4I99C 1PYTA 3PR4A 2EWHA 5A8RB 4MT1A 2V1DA 2EV0A 1NDLA 3DBRB 1Y3JA 5HBMA 3UI3A 1P6RA 2GMHA 2KB2A 1XNQJ 1RAHB 1OSCA 2VD3A 4DV1F 2WOMA 3K0JA 4IH6A 3FCWA 2C3UA 5HS9A 4JI3F 4RL1A 4U0YA 2DLLA 2MLGA 3COAC 1VBYA 1R8HA 4JV0A 2CU7A 1FEEA 2DK5A 3BBBA 4EK2A 4B3AA 1L0OC 2PD1A 2XWXA 2QGFB 5FKOA 4PKDB 1I1SA 1I94J 2W8KA 1FNNA 4GKKF 4G8XA 4E8UA 2G4BA 3A3OB 4GVBA 1F0XA 3N79A 2LXFA 1Z6TA 2CZVC 1G1XA 4HSRA 3K4KA 1NDCA 4NLWA 1U8RA 2RUGA 1YZ7A 3PQKA 2BY1A 2HI3A 2B9WA 3MKWB 1XIQA 2LTPA 5IPAA 3HGYA 1QPIA 2YR2A 2CRGA 2DD8S 2CUFA 3AXKA 2W4DA 4BWJA 2GZWA 5FLXK 5AT1B 3NP5A 3TWZA 4XRSA 4RW7B 2HQDA 2DA1A 3HRTA 2QENA 1TL7B 2D1VA 4J7CA 1RTJB 2A3SA 1H72C 3HJFA 2CJXB 5A8KA 2ETHA 4PFOA 2R42A 3I56S 2AX0A 3FRZA 2JSPA 2R7DA 3OYEA 1ZETA 4HDVA 3H0DA 3BSNA 2JRSA 5LT5A 2HS0A 4MFBB 3LALA 4MAKA 4U6PA 3QZ8A 3A03A 2ZB9A 1IVZA 1ONVA 3GEZA 2Z99A 1S6OA 4KFCA 1VLOA 2VKDA 3KLGA 5EHHA 5E3CA 1JKOC 2WSCC 2NXNB 3LSGA 2JA6J 1IKYA 3LOUA 1S9GB 3JRAA 3IG1B 3A1YG 5SUHA 5AE3A 2KZVA 1GQEA 3TW0A 4ZLLA 1P27B 4IX7A 4IOCQ 3PACA 2IBOA 1PVEA 1VFCA 3SEOA 4JI3J 2DGSA 2FLPA 3QBCA 2LSOA 3OYMA 3C2BA 3GPAA 4OINF 2YQ0A 1IR1A 3AODA 3REOA 3V6DB 1RT4A 3BZ6A 3OR1B 5JMNA 5LSLA 2BA9A 4UQTA 3M3YJ 4LFUA 2DHXA 1KYZA 4Z6YA 1MMDA 3VR1A 4P72A 1Z7LA 2FQ3A 1YFHA 1CLFA 2VG7A 4WKYA 2R7OA 4DFKA 5A0YA 5ADZA 4B47A 3PM9A 1LVKA 4A3IJ 3FQKA 2D2WA 4B3SF 4JYKA 2BE2B 4OIPF 3QPSA 2DR6A 4Y13A 3BKTA 1X9SA 2VJVA 3JS9A 1TUGB 1BC6A 3EX7B 1GHCA 1JKQC 1FKAF 4ZIVA 1GT0C 3BQ0A 3VAJA 2LD5A 2OPSA 3LAKA 5LLQA 1E6YB 3DLKA 2KPMA 1XSXA 4MKYA 5CLSA 4NWBA 1UVJA 3I5AA 2CUYA 2NVQJ 2RS8A 4AL7A 2DXDA 3NEUA 1SC1B 3I58A 1S5LC 2HOEA 3IR5B 1YRUA 3K4LA 1WC5A 1S9EA 3MURP 2E66A 1JKHA 5M3MJ 4M6XA 3VGUA 1RKIA 1IAWA 2PQ8A 2GHVC 4R8UA 1XPXA 2XGPA 2AHOB 3MAAA 4HHJA 1W5SA 3SQGB 3EPZA 1K79A 3WIVA 2QEXS 4LRBA 2DAOA 3W9JA 3KZYA 1UWBA 1IBLJ 2V1NA 2LK2A 1T9XA 4LOCA 3R60A 4KMUX 2R7UA 2DOEA 2LKPA 2VV5A 5KFDA 4AVPA 4XLNF 3MEEB 4RBUA 1IKXA 1D8ZA 4BHCA 4ZH4F 3OW2R 1RHKB 2E5LF 3IWZA 3SYTA 4V2GA 2COMA 3OYDA 1MDMA 1MIJA 3SZPA 1D1BA 3A8JA 1YJUA 2JA7J 4ZYEA 3T9ZA 4G1QA 1KQ0A 5E18F 4XSXF 4NLSA 2PGCA 3W64A 2W7OA 3BGOP 1TL1B 1WGXA 1U9NA 2JRMA 1TQLA 1R6RA 2QYCA 5FLXY 4LREA 2DPUA 2GQCA 3JAMK 5HS7A 4D5FA 1HNVB 2F5DA 5GTHC 3SCJE 3LSKA 1SJ1A 2DNOA 2JEFA 2POKA 2R4GA 1K73T 1H8AC 2LQ9A 2QSFA 2U1AA 4WP3A 3J7YU 2H94A 1FKOA 2ZWOA 1HNWF 3GIIA 4NC7A 3BJAA 5IYDJ 5B7WA 4CYUA 4V1Ak 3LPEA 4J00A 5ETKA 4U67Q 3FSXA 4DV5J 1NPKA 2JVOA 1EF4A 2YWKA 3NGTA 3CCSS 3DRYA 3H3UA 3MD2A 2QL9B 1M1EB 2ZXHA 5DG8A 5LEJA 4BEHA 1REPC 1X31C 3EXYA 4R0EA 4TLQA 3FM3A 4M6YA 4Z7YA 4I02A 4I2PA 3N4WA 5HQLA 2X6WA 2VUMJ 1ITYA 1DGRM 5KFTA 2B43A 2ASYA 5GVQA 1LB2A 1LWFB 4IDKA 3GILA 2CPHA 4FS2A 3P96A 4N56A 4A8QA 4HLBA 2K9LA 3DI6A 1FDNA 1FVQA 1KTQA 2YX1A 4P2SA 1QAJA 1LW2A 3J7A1 2QSFX 5J2NA 1FPQA 4RU2A 3BSAA 1LEOA 1LJ9A 3HHEA 2ZEJA 1QQIA 3H3VK 1I6HJ 3UCZP 2L02A 3R27A 4H4OB 4Y2MA 1UJ8A 1Z3XA 3RQIA 2E5LJ 3MZIA 4HEA2 4V19J 2YS9A 3J7AO 1WKJA 3G82A 2KFNA 2YNGA 4DQIA 2FHJD 2RH3A 1AW0A 1E17A 4RB1A 5ETTA 4LITA 1FCAA 3MM6A 1X4FA 2B9XA 1RWPB 1TP7A 2WAQD 1RT3B 4CYDA 2W1OA 4NDLA 4EJOA 2OLWA 1TK0A 2BZ2A 4PWWA 5GAEI 4JP0A 4ZK7M 1ITPA 2M3DA 2KZGA 1R71A 3BGFA 5JVTA 2ZZMA 2FJ1A 2L54A 3QT6A 1TTHB 3RKXA 5C7PA 3TA0A 4WFAQ 3KHGA 3CDHA 3K70D 3IFEA 1HNWJ 2JN6A 2MGZB 4B3OB 3CD0A 4Q43A 3CMEI 5F9NA 4QWDA 4A0ZA 3M32A 1OQYA 2HEOA 1HR0F 2WZ1A 4HAMA 3T5HA 2HNYB 1LW0A 3ZOBA 4CXFA 2P9CA 3GP9A 4O3PA 2W8LA 3CSKA 3D6MB 2UXCF 2GXAA 4A48A 3J80Z 3SCKE 2VQEF 1YKWA 2RQKA 5I42B 5LXYA 2GBYA 5DDRC 5D5XB 4GVLA 1SL2A 1WH7A 3S6EA 1ZH5A 3SZ2A 1WWHA 2VJJA 4YOEA 3PJWA 4XM3A 5ETMA 1ODDA 5KFPA 4Y2IA 4NL5A 1DLOA 1JLFA 1VOMA 3BG9A 2NVYJ 1ZTRA 2WB1A 3DM2B 2PJRB 3JRGA 2H1LA 2HFUA 4HH0A 1U24A 2QL5B 1NNDA 3K4NA 4A8SA 3KX2A 2JWNA 2V4JA 1DGWY 5KT5A 5A2QZ 3CJ5A 4O3NA 3AQPA 5G0RA 3VPRA 4IF4A 3BR2A 5DO2A 5L1KA 1BBYA 3JAMY 3HKZD 3I87A 4DCPB 3JXOA 3CCJI 1SQGA 4L18B 2B3TB 1J5YA 1TBXA 1KP6A 4QJVA 1X4DA 5LGTA 5CABA 2C2RA 2CDRB 1FJLA 4OIXA 3K10A 2V8HA 2FSWA 3ABMH 2FXAA 4HNUA 5JXSA 3TA1A 2M7AA 2R2UA 3NAHA 1ZRFA 1BGXT 4TU7A 2R5YA 2MZQA 3POTA 1XN7A 4F4ZA 4CWBA 2WSEC 2F5EA 4LRAA 2L9RA 5FKKA 3H8YA 2BYCA 9ATCB 1G2HA 1U5TA 1SD6A 3W66A 3OOPA 3OY9A 2J7WA 5IC4B 1RCXB 4DL4A 1HW5A 1HARA 2QLJB 2UXCJ 1RCOB 4LRDA 1ZYQA 2QN6B 2VQEJ 1VQOS 1GMWA 2V2VA 2CQDA 3ZTQA 3CMES 5KFXA 3OL8A 1MKMA 1HKTA 4J37A 1UB9A 2YXLA 2HZVA 2BJ1A 1SB6A