2VOPA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
b'EKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 51
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vopA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vopA02
1D5VA 2EFQA 3FX3A 1MD0A 1TLHB 3K2ZA 4WIIA 2IRFG 3E97A 1R5HA 3ZQ7A 3ZZZA 3FXQA 3Q2TC 3W6KB 1YTYA 5DDGA 4OIQF 3LA7A 2XAHA 4ZKAA 3FF5A 5CLSA 2DHXA 4MEXF 1G3WA 1X4FA 1M5VC 1B59A 5GAGU 5GAHU 2A07F 4A0ZA 2EFOA 4I09A 4M72A 1XGSA 2DNZA 3HSFA 4HAMA 3RKXA 2RQ4A 3MI7X 2MQOA 3CUQC 1WSUA 3K0LA 3BO2A 1ZRDA 4HA8A 3FEXB 1BJAA 2OJ3A 3BEGB 4EGYA 3FM5A 2HVZA 5D5UB 3J7YU 2RT3A 3I55S 1WHWA 3THTA 2GA1A 4HLXA 3HRTA 1YYVA 4HV5A 1F4KA 4O6JA 4OZ1A 5FLXK 3TOAA 4RB0A 2EWNA 2MBFA 4UXNA 2FBKA 5IQQA 3EDPA 4EVIA 1HQCA 3CXCR 3S7RA 4ESBA 2CPEA 3V8LA 4ZYEA 2GZWA 3DEUA 4K2EA 5F1RA 1XSVA 5FLXZ 4CH0S 3U1MA 3CC2S 2W85A 2FC8A 3H3UA 3REOA 1TQPA 3H2VE 4L9JA 2O8XA 2QQ9A 3GLXA 3C1DA 1FYLA 1I1GA 2D1VA 3FMQA 2A6HF 2JVOA 5E18F 2QBYB 4P96A 1L3KA 2Q8KA 1VTNC 4KFCA 4HQMA 1UHWA 4EJOA 1PP8F 3HSEA 2YX7A 4KMFA 3WTUC 2YPRA 2DGVA 1HKSA 2ISYA 5DCMB 4LLLA 2XSFA 5LEJA 2XS7A 2E44A 3LAJA 2MKCA 1M5PC 4MTDA 2DNLA 3L3CA 3CJNA 5ILVA 2FRHA 3LAPA 2A69F 5H1SV 2QBYA 2EK5A 2STTA 3VF0B 3G96A 2K7LA 1O3SA 4GGGA 3JB9k 5JFRA 3P6YC 4M5DB 2VC0A 1RUNA 3N9UC 1GHCA 3ULHA 2EV6A 5DCMA 1O57A 2DO7A 1T6SA 4FXWA 1ZLKA 1BC7C 4RB1A 4EM0B 1FT9A 1SJRA 3GYHX 2KIFA 1PGZA 2OSQA 2MSTA 3FHZA 1ZYRF 2FMYA 1Q86T 4EGZA 5A2QZ 2X1FA 4LMZA 2LQ5A 4KT5C 1ODDA 2KIMA 1P92A 1XSXA 5FO5A 1M1KT 2MLGA 3QP6A 3KP6A 2IT0A 2EVZA 1TW3A 4GO1A 2XRNA 4WX9A 2L3DA 3BJ6A 2M52A 4CGZA 2OBPA 4BH9A 2QWWA 2DGOA 1I27A 3RTRA 2DNKA 2LECA 1HBXG 2W84A 1QM9A 4F7ZA 5FGMA 2MKIA 1WG1A 1R1UA 1ZAOA 3LFKA 3GW2A 2RRBA 4PR6A 2ZMEB 2E5GA 2K86A 2IA1A 2A3JA 1MJAA 5HDKA 3F21A 2KU7A 2U2FA 2KG1A 2FNAA 2VBZA 4A6DA 1Z6TA 2KRRA 4B09A 1TW2A 2Y75A 4DQ2A 2P5KA 3I56S 4YFXF 2NRAC 1WELA 2XAGA 2V1XA 5D8LB 1H6KX 2NS0A 2OD5A 2E7XA 1N52B 2ZJRQ 4FXVA 5HLIA 2JPBA 2RC4A 3O3KA 3GZ6A 3E6BA 5D78A 3QOPA 2FF4A 2MZTA 2KHCA 1VC6A 1EV7A 2SXLA 1YJ9S 4AD9A 4WK8F 1LEAA 1JGSA 1KQSR 2XAJA 2JPCA 4CDGA 5DDPC 1WI8A 3FWEA 2D45A 5K5OA 2FHOB 2M1BA 4KYWA 2MXYA 3R4KA 2L01A 4AVPA 3SZPA 3J7ZT 4TU8A 1EH7A 4CO8A 1SJ4P 3PIPQ 3F6OA 2P4WA 1VQLS 2KM8B 1O7LA 5HS8A 1WEXA 2G7HA 3R60A 1FY7A 2MKKA 4TLQA 3PQKA 4EJWA 3BOQA 2Z99A 4U0VA 2VOPA 5E1ZB 4CH1A 2CQIA 4LMYA 3UWTA 5H20A 4Z2YA 2J5PA 5BMZA 3BDDA 4UVCA 1A7GE 3MUTP 3MD3A 3LQQA 2G0CA 2HFHA 1V4RA 2DNPA 2MJUA 3WE2A 3UCGA 2VE8A 1LVAA 3CMAS 4HX8A 1SD5A 2FOKA 1HKQA 1Z6RA 2H6CA 3TO8A 3G9CA 4WFAQ 2PG4A 2N3OA 2OTJS 4UHTA 4EJUA 2PMUA 2M8HA 3VFZA 1SD6A 4M6XA 1S6LA 3I54A 4QWQA 1Z91A 1YWXA 2VBYA 2MZJA 1YJNS 4ETSA 3T1BA 4M71A 3FXUA 1ZGAA 4A6EA 5LLQA 1YITS 4LFUA 4IO9Q 1X4DA 1XGNA 1GXPA 3WE3A 1P6RA 1PUEE 2MKSA 3B73A 3ZMDA 2CWEA 1DUXC 5L3CA 1NU4A 1R22A 4MHGA 5BOXA 5IT9K 1VQOS 2ESNA 1YG2A 1W7PB 2XASA 2LXIA 2DGUA 3V7RA 3LQVA 1M5KC 2DPUA 2ZJ2A 3BO4A 1ZLJA 5IT9Z 3MXHP 3HI9A 3TYTA 3WTXC 3RKYA 2U1AA 2PQ8A 4XBFA 5DM7Q 1IW7F 5LRSA 4UVAA 3H3ZA 2AYEA 2DNRA 2AS5F 1VQMS 4ON0A 2W24A 4BS2A 4YOEA 2NNNA 3Q9SA 2A5YB 1W7PA 4ASNA 2MB0B 5HVQC 1YI2S 3DFGA 1FXLA 1FJ7A 1YO5C 3JW4A 3WU0A 4ESFA 2P7CB 2KXNB 3IHUA 1CGPA 2H6BA 2F9DA 1P1TA 3DXBA 1I6XA 2Q0OA 1HKTA 2EFNA 3CO7C 2DNOA 2MY7A 1WHYA 5K1YA 2ZNZA 2EV0A 1UHMA 4PRFA 3G73A 1HD1A 3HRSA 5D6FA 4XSZF 2BV6A 2GO9A 1IXSB 1LB2A 4IUFA 3ULQB 3TO7A 3MZHA 2V79A 4LJZF 3TO9A 2NNYA 1S3JA 4JQFA 3LWFA 2G4BA 2MGZB 2YWKA 1ZZNA 3R61A 4HDUA 2DIVA 2KJCA 1UFWA 3L7WA 1BI0A 1SXLA 5H6RA 4M6YA 2PI0A 3VAKA 1BI1A 1WG5A 4A0YA 1TBXA 1F1ZA 3G8SA 2DK8A 5HOOA 4I02A 5D5WB 1TQIA 1IRGA 2Y0MA 3WODF 4BXUA 2CQCA 3M9AA 2QLZA 2OQRA 2KM8C 3I59B 1BY9A 4AIKA 5LHGA 3SFZA 3J80K 3F8NA 1FT8A 1IN6A 3DPLC 3NRVA 4NQWA 2P8TA 1IN7A 5E1WA 5ICGA 2DH9A 1JJ4A 2K27A 1DPRA 5ILSA 3U1LA 4QLCU 5K5RA 5KVRA 5LJ3Y 3K1PA 4G9YA 4Y13A 3J80Z 2E1NA 1U1KA 4AIJA 4L9VA 4G7HF 1U78A 2MZRA 3CCMS 3W6JB 2H94A 4IXAA 5HDGA 2CJKA 4UQTA 2RV8A 3R6SA 3U9GA 1IN8A 2YKAA 2M5WA 1HW5A 2Q2EA 3J81K 3CCES 2PEHA 1KC8T 3CCSS 1KD1T 3C18A 2WBRA 4LLGF 3CCRS 2K3KA 1LJ9A 1XCBA 4KDPA 3CCUS 2FA5A 5FFXA 5CXTA 4OMYA 2YU3A 2B0LA 2VT3A 3J81Z 1XN9A 2EV5A 2GHPA 4HQEA 2YSRA 3S01A 3QP5A 2DIUA 3BS9A 2MQNA 3TKYA 2NZ4A 3CC7S 4ENJA 3M7GA 1WF2A 3CLOA 2V1DA 4F02A 1ON2A 2DTRA 2QYOA 3R0JA 5BQTA 1KOOA 1WHXA 2KT5A 3CF5Q 2EB7A 1W5SA 1QGPA 2IP2A 3WU1B 2XB2D 3Q2SC 3WG9A 2P5VA 2KRBA 2K4JA 5LHHA 4QPTA 3HRUA 4CQ1A 4OMZA 3GFIA 1X5OA 1ZZFA 5CYVA 1LEBA 3B4MA 2HYFA 1DPUA 2UZKA 1GXQA 2DU9A 1G3YA 4L0ZB 2A61A 2WC2A 2I2YA 2JSCA 3WTYC 2CO5A 4LK1F 2DBBA 4S05A 3ELKA 2HWVA 4GCVA 4Q5SF 1Z1DA 5HO4A 3WGGA 5E8GA 5IM0B 1R23A 2O3DA 3V7CA 2O61A 1KU2A 5ICEA 2PEXA 1UCRA 2KG0A 4KIGA 5JVTA 3GUDA 5CYJA 2VOOA 4B8XA 1F9FA 5E17F 2G1DA 3CULA 4PZJA 3FMSA 1KOHA 3E6MA 1YW8A 5ED4A 1BIBA 3JTHA 3IRWP 1X3UA 1ZHFA 5ICCA 2X0LA 3IKVA 4KUMA 2FBHA 3GVAA 1W4MA 5LHIA 3KE2A 5GMKa 5IM0A 4MEYF 1SAXA 4ENMA 2XV4S 4PGHA 4CICA 1J5YA 1FNNA 2MHNA 4UUVA 3TDUC 2FU4A 3CPWR 2DHGA 4F25A 4GYGA 1K73T 1VQ6S 1WWXA 1K7AA 3UCZP 2QZ8A 1KU3A 5F64A 1OPIA 1YIJS 1SMTA 1DRZA 3HHGA 3P5TL 4IF4A 2PFBA 4A2UA 2AD9A 3NMRA 3T5XA 2CQ1A 1MZBA 1W7PD 4PGGA 4QQBA 4U7DA 2JRTA 1U8RA 1HXDA 1WI6A 4HX7A 2DNGA 4W92B 4RAYA 2J5OA 1X4BA 4P6QA 3RKWA 2L54A 2M2BA 2QM3A 3B02A 1VQ8S 1O7FA 4C7QA 2O6GE 3HHHA 1XGMA 1FBUA 1LDDA 2YH0A 4WXHA 3EUHA 1B7FA 4OINF 3RI4A 2M4MA 2KXFA 2GAUA 3RPUA 2Y48A 3P9CA 4L9TA 5D5VB 1OYWA 3TGNA 1LQ1A 5LXYA 2MPUA 1U1MA 2GQQA 4KN4X 4L9NA 3HTUA 2CPHA 1EH8A 4CZZA 2DNHA 1X4EA 5DD4A 2XKPA 4ENKA 3KLOA 5H6QA 2DISA 5EEHA 2LXUA 2GXBA 4HBLA 4D0PA 3R1LA 3FMRA 2XGXA 5LSLA 3P9IA 2M9KA 3KCCA 3NS5A 1IXCA 1ZARA 4I7HA 1N54B 2RS8A 1IUYA 1KA8A 2L4MA 5L3EA 3HYIA 3TQNA 3UD4P 3C7JA 1DBDA 2DNNA 2LKPA 4N9HA 1K9MT 2YTCA 2F3JA 1FWZA 2P6SA 3KP7A 2DO4A 4LB6B 3M8FA 4L0YB 2CPXA 2FEZA 3F3XA 3I5UA 4R1HA 2XROA 2MC3A 3LA3A 3VAHA 4ED5A 5L3BA 4H0EA 2JVRA 1IN4A 2EFPA 3ECOA 1CVJA 5JHUA 3QPTA 2M45A 1I1SA 4Y0FA 2X4HA 3M8EA 5AIPA 5GAEU 2PLYA 3BWGA 4OOIA 2VONA 3BPXA 3I64A 3VEPA 5CVUA 2MQLA 2N3LA 2HGMA 1OPCA 2AYBA 2GXGA 3MAJA 4ZH4F 1OIAA 2DNYA 2KIUA 3DKWA 4G6DA 1URNA 4YIIA 2VT2A 1VQPS 3D0SA 3K1NA 2BYVE 3U1DA 1O3TA 4WFBQ 3ERED 2RDPA 2ZMEA 3E6DA 4IPAA 1WG4A 5E1XA 1KU9A 3T8TA 2MSSA 4EJVA 3LPYA 1YFHA 5DETA 1HD0A 3EETA 1FP1D 1T38A 2F5DA 1U2WA 4I98B 4R8HA 1XB4A 2Z33A 1PO6A 1RNLA 2ZJQQ 1K8AT 2DQRA 3VAIA 3H92A 5FD5A 2G7UA 2GA2A 1X4AA 3G4SS 5F6FA 1FYMA 2EA4A 2BGCA 1P4WA 2YR2A 3NQOA 3MUVP 1O3RA 1OR7A 2ADUA 4IHTA 3TP2A 3K0JA 2W25A 4DNCA 1XMAA 2VE9A 4FX4A 2ACJA 5TJJA 2KKOA 1SFXA 2LDUA 2IW5A 5D8KB 1M5OC 1H9GA 2OZUA 2UXNA 2MJNA 4UVBA 2L9WA 1S29A 4A5NA 4YG2F 1BC8C 1X4CA 3VAMA 4HX4A 5BPDA 3KETA 2TDXA 3DPTA 3CTAA 3T8RA 2KRFA 3BO3A 2P6TA 3I58A 3NNHA 2KI2A 2JX2A 2F5CA 3L00A 3SHFA 2DW4A 2ZCWA 4FT8A 4WXCA 2BBYA 2HOEA 1J0RA 2KFYA 3R1HA 2DNQA 3MWMA 3COAC 3WTVC 1JHFA 2V1UA 1RZ4A 2ADBA 2ISZA 2RNEA 3LA2A 2QA4S 4BHBA 4ENNA 3RPQA 1UB9A 1HA1A 1OMIA 1IRFA 2MKJA 1G6NA 1JHHA 1U1NA 2JT1A 2HYGD 3KFWX 1TQMA 2E5IA 3ISPA 5DCFA 2ETHA 3I4PA 2F2EA 2XAFA 1JJHA 6PAXA 2F5EA 2XIGA 5CJ9A 4WF2A 3WTSC 2A3SA 4RGXA 2MYFA 4Y00A 1XDSA 5LEKA 4IHSA 5DYMA 4C0OC 1U1OA 3V7SA 2RVCA 2D2WA 3FM3A 4N0BA 2LEAA 2UXXA 5JR3A 2OSRA 1WI9A 2ZO4A 2XUBA 1K78B 2HGCA 4ZYHA 4WWCA 2F5FA 4M9ZA 4A8XA 3VAFA 2I38A 1OKRA 1XGOA 1X4GA 1S7OA 3D5LA 4JK1X 2KYXA 1U1QA 2E5JA 2LEBA 3EGZA 3VALA 1FYKA 3TDZC 3IRQA 1YS6A 3O2PE 4EQQA 2HKXA 5AIQA 5D6EA 4UY8T 1FJEB 4KIFA 1QNTA 2X1BA 5DDRC 2EK6A 4CYDA 1R1TA 1RKJA 1IN5A 2LF7A 1K78A 2E1CA 3THPA 1X5PA 2LF8A 2OAZA 3BY6A 1WTBA 2DHSA 2KJBA 3CUQB 3VAGA 1P4AA 4CIOA 3JAMK 1U1LA 3MUMP 1IAWA 3CCLS 1Q1HA 5ILUA 3ZPLA 3KEOA 2KN4A 1MJ9A 4WKRA 4OIOF 2PMHA 2PBIA 1QZZA 5L3FA 3K9TA 2ZJPQ 3KP3A 2R7DA 3JAMZ 5CA5A 3IWFA 1BI3A 1ZG3A 2LSOA 1FOKA 4OIPF 5D77A 2CPDA 5EN1A 2E7WA 2XVCA 1UP1A 2ZFWA 1WWHA 4BHPA 3UD3P 1G2EA 3O6BB 5FFZA 1JJ2R 2UP1A 4RS8A 2J0QD 1ZRCA 1WKMA 3WGHA 3R27A 2LA4A 3MFKA 4XLNF 1YW9A 3E5XA 2MMYA 4G8XA 1JMTA 1KGSA 2N82B 2MGZA 4L5IA 5HS9A 1S79A 4FX0A 1RK8A 2M88A 1WF1A 2QUFA 1H9TA 1ZH5A 1U6BA 1SFUA 1QO0D 1H2TZ 5J8CA 2BOPA 2CSOA 2RUGA 2O3FA 2GWRA 3SZTA 4J5OA 3V8JA 3MCZA 4WCGA 3ZN0A 2DI3A 3SXYA 4A12A 2RQPA 1YLFA 4HF2A 2H27A 1JXSA 4MQ9F 3I59A 1YS7A 1XSDA 2CQGA 2L41A 1MDMB 4A0XA 1U3EM 5JI6A 4YB1P 3G3ZA 2QENA 4LIRA 2BEOA 3WGIA 3HTSB 3RYRA 3H2UB 3MQ0A 4WFNQ 1LNWA 5LGTA 1CF7B 1FSHA 3K69A 3TOBA 1VBXA 3IC7A 3KZZA 3RDIA 2FSWA 4Q48A 3ZMZA 1P4XA 5FD6A 1KYZA 3HSRA 2HKOA 4MGRA 2DB1A 3HOSA 4HZFA 1ZG1A 5MLCV 2FMLA 1MDMA 5ICFA 3RW6A 4A5MA 1U1PA 4IRGA 3IRRA 3LQRA 3WTZA 4PDKA 1O3QA 2FC9A 4G7ZF 1W2BR 5DEQA 1F5TA 3ZMTA 2NLWA 1B6AA 4ZZLA 2J8AA 2ERRA 2QVOA 1U1RA 5E8IA 5LRRA 2RU3A 4AWXB 3RW7A 2R7FA 1S7AA 2L4AA 2X1AA 2DK5A 3M1EA 1N8RT 2JTVA 3BZ6A 1P27B 2A68F 2DO0A 5LXRA 3MEXA 4RGSA 2RQCA 3V4GA 2CPYA 2VC1A 5ITHA 1U6GA 3K1MA 1SFEA 3Q9VA 2OA4A 4UNOA 2CQ4A 2VXZA 3ZZYA 4LG0B 3PQJA 1UAWA 2DGSA 3SMZA 1IQTA 4EM1A 3CO6C 1R5GA 3F6VA 3DV8A 3ZP5A 2V9VA 1A9NB 3FEYB 3UCUP 3ROUA 1YW7A 1QPMA 2VBWA 3MURP 4G94A 4PKDB 3IWNC 3VB2A 2ELHA 2CQ0A 1S8NA 3CUOA 1HL6A 2Z9OA 3ML6A 4RGRA 4RAZA 4HYEA 1TNSA 2FY1A 5AONA 5BJRA 3EX7B 1X5TA 1G3SA 4N9IA 3EGNA 3CDHA 1ZGJA 2EFWA 3V8KA 3JSPA 4Y17A 4LG0A 3KP5A 1O0PA 3CC4S 2M0GB 3NNAA 3MDFA 1VQKS 3BROA 1UW4A 5JVHQ 2BE5F 5HL7Q 3KZYA 4EMSA 4M73A 5BPIA 4G7OF 2HZCA 2CPFA 1XN7A 1KU7A 4PCQA 1AOYA 5CVVA 1ULYA 4EM2A 1YHQS 1Z7UA 4ZYGA 4ZZDA 2NYXA 2AYMA 1YQAA 1RUOA 2KVIA 2F9JA 1ZN2A 1XMKA 1K79A 4F26A 3E3VA 2R3SA 4KN7X 4IOCQ 2MQPA 1R00A 3UE2A 2WTEA 3I53A 3B4DA 1NJIT 1WF0A 3AAFA 4LD5A 3C3WA 3ABTA 4S04A 4C4WA 1Q82T 3OOPA 3RIRA 2V94A 4M74A 2M8EA 2FPHX 1E2XA 2ZKZA 2MA3A 3KP4A 3IL2A 4IRIA 1BM9A 3F8CA 1DHMA 5ERIA 4LLNA 4O3MA 4LGWA 1HW1A 2D3OR 2IVMA 1DZ5A 2HEOA 1DDNA 2FQ3A 2JZYA 3PFIA 1G3TA 2LKZA 3GXOA 2HQNA 4O5VA 2J76E 1FC3A 1VBYA 3T0YA 4LB5A 3BJAA 2VN2A 3DXJF 4XLPF 2FBIA 5IFMA 5A2QK 3JTGA 4U67Q 5D4SA 1R58A 3SXLA 1B9MA 3WTTC 1J2XA 1D8ZA 1QVFR 2CQHA 2YH1A 2MKHA 2MZSA 4KICA 2IA0A 5GADU 3RJPA 2RNJA 1S72S 4L18B 5EEGA 3R0AA 1PP7U 1WQ2A 3US5A 5CVJA 2MLKA 4RGUA 2FE3A 2DH8A 2M7SA 5LGNA 4OZ0A 1ZRFA 4W90B 2HZTA 1XDUA 5DDOC 5DV5A 3OV8A 2BZ2A 1SD4A 3L2CA 4RB2C 2CFXA 1WHVA 4BYYA 5FJ4A 3L09A 5HS7A 4P5OA 3CCVS 1R7JA 1BOAA 4HDVA 3QU6A 4P9FA 2H09A 1FPQA 1U5TB 4JBAA 2UWMA 3E6CC 3NEUA 4KA4A 5LGUA 4GYIA 1D8KA 2C6YA 2EJRA 2RKHA 3NS6A 5E20A 3QRFF 3ECHA 2IA2A 3DQVC 2L08A 1J7KA 1QQIA 2DLLA 2NAZA 3QAHA 5D5XB 1YJWS 1LDKB 4MQVA 2ADCA 2M87A 4TV7A 1BBYA 2STWA 4MNUA 1R1VA 5CVIA 2D9OA 3CTRA 2CGPA 5LSOA 4HW0A 3L9FA 1WEZA 1FJCA 2K4BA 1U5TA 4KMUX 1U6FA 3F23A 2VODA 4RU2A 2L02A 4I0AA 1G4DA 3IKTA 5J8FA 2M70A 4OU0A 2QFJA 2CPJA 1XD7A 3HIFA 3CCJS 3D2WA 1REPC 3S2WA 2MH2A 2OZ6A 2RN7A 2V6CA 3P7NA 4QU6A 3KEQA 4I2OA 4BQAA 4BAYA 1YIOA 2DPDA 5TRDA 5K5QA 1FHTA 1VQNS 1Y0UA 3MD1A 2DGXA 3LSTA 2DITA 3VOEA 2A6EF 1R8HA 4M9XA 3BJOA 2ZXJA 3P9KA 2JRSA 4YFKF 1FLIA 1IZ1A 1IF1A 3FXRA 1FNXH 4I01A 4U7BA 3U2RA 3GF2A 4Z2XA 4AIHA 1TTYA 1SJ3P 4TU7A 2HR3A 4P55A 1X0FA 1T2KA 2J0SD 2FNPA 4G6QA 4YFNF 1SMYF 2E5HA 1KYWA 1UFMA 3V4MA 4GXOA 1D8JA 1F9NA 2G9WA 2P7VB 3GO5A 1VC0A 5DUIA 4V19X 1VQ7S 2CQPA 3P49B 1U2FA 2CQ3A 2HGNA 4FHTA 2CQ2A 1NHAA 4IOAQ 2XS2A 5HDNA 3IWZA 3BPVA 4LJMA 3GWZA 1Q81T 3CCQS 2D9PA 2RS2A 3CUNA 4U88A 2LYVA 2PE8A 3GFMA 3E5UA 3SDEB 1BN5A 3N4MA 3F8BA 1SD7A 2DK2A 2RGVA 1DP7P 2DGTA 5HLGA 2MD5A 1K6OA 2CW0F 3J7AO 2LCWA 2KH9A 2DFIA 1VQ4S 2AXLA 1D3YA 2WV0A 4WF9Q 2JWNA 2MZQA 1VC5A 4I0BA 3MOJB 3KLNA 2XHKA 1VQ5S 3GX4X 4Y15A 2HQRA 3F22A 1JE8A 3ZMSA 3VAJA 1R36A 3SQNA 1VBZA 1KQ0A 2DHAA 3P3DA 3G71S 1QVGR 2ESHA 5HLHA 3S8SA 2FXAA 3SDEA 3F72A 2OTLS 4U0YA 1HW2A 1EH6A 1W5TA 1ON1A 2CQKA 2HS5A 2COMA 3FZVA 1AWCA 5DUKA 5FB2A 2MY8A 2CQBA 4YIFA 1C0WA 2DQLA 3WTWC 1KQ9A 2IPQX 2CPIA 2DH7A 2AYGA 4HV6A 4ESJA 2RVJA 3RYPA 2N7CA 1Z05A 1J75A 2CPZA 2HGLA 1X5SA 1BI2A 2XNRA 5DM6Q 2CG4A 4HLYA 1U5TC 1X4HA 3VODA 1T0FA 3PIOQ 3HOTA 5LJ5Y 1FSEA 1FBQA 5LBQA 2OIHA 1I5ZA 4KIBA 3HHNB 4ZYDA 3GEZA 1GVJA 4CHUA 2M30A 4E70A 3QPHA 1L0OC 3DF8A 4P9UA 4WCEQ 2KXHA 1FP2A 1N88A 3G8TA 5IT3A 2LNBA 1RI7A 2O03A 2WWYA 1HSTA 2LMIA 1WEYA 4YUDA 4WXDA 1ONVA 2DGQA 4Q4ZF 4KNYA 1E17A 1XCVA 1H2VZ 2ZBKA 4XRFA 1OYIA 4R79A 2Q79A 2YX4A 1LDJA 3I71A 5DDQC 1B4AA 2RRAA 3MZYA 3EYYA 2HTJA 1TNTA 4IRHA 1MJBA 2MQQA 1FX7A 4UV9A 2M8DB 3ZMVA 3NNCA 3EYIA 3ABUA 2PJPA 2QQAA 1KQ8A 4HF0A 1H0MA 1L3LA 4EGLA 3CUQA 3KP2A 1B9NA 1OO0B 3F8FA 5JVGQ 1P2FA 3F8MA 4IJAA 1HSJA 2EK1A 1A04A 4EJTA 1M90T 5CVRA 2GIVA 3DLLQ 2XNQA 1PDNC 3E5QA 2DT5A 2X1GA 4RB3C 2Z5UA 1ZG5A 3GFJA 2QEXS 2HYIB 1ZREA 1OYYA 3ZN1A 1Z9CA 3S6EA 3EQLF 1AUDA 2Z3YA 2EA2A 1IXRC 3CD6S 1OWXA 4NHJA 5L3DA 4MTEA 3OW2R 4NB5A 4XSXF 1V3FA 2K02A 1SJFA 4UV8A 2HTSA 4BNCA 1MKMA 2D1HA 5J6XA 2CQDA 2ZNYA 2XKOA 3GFLA 1FO1A 3DP7A 2OU2A 4ERDA 5L3GA 4TU9A 2P5LC 1R8PA 2VBXA 1QBJA 4L5JA 2LA6A 2B0GA 3I0TA 1QZYA 4LK0F 1J9IA 4IVNA 1H2UX 2XAQA 2K8GA 1D9AA 2DNMA 2QQBA 2DAOA 3CMES 4BHCA 1T39A 2CYYA 4EV0A 5DD8A 2PN6A 1VQ9S 1USTA 3GZ5A 1BIAA 2IJLA 1USSA 3BP8A 3G6ES 2O0YA 1T98A 4M9SA 1RIOH 4QU7A 1B1BA 2MQMA 2MZ1A 5KK1A 3Q5FA 3QU3A 3TO6A 1Q7YT 1MGTA 5BS6A 1CF7A 4HOBA 3HUGA 3ZMUA 1NO8A 4CXFA 1WRJA 1SJQA 4U0WA 4OIRF 2DGWA 3N97A 2W57A 1FZPB 4HF1A 1STZA 5GVQA 2HDCA 4Q47A 1FBSA 3JSOA 1J59A 2XS5A 5D4RA 3HRMA 2OQGA 2MH9A
chains in the Genus database with same CATH superfamily
3QODA 4ED4A 1QE1A 1S77D 1ZM3A 5ETQA 1D0YA 3DLJA 3KNGA 1EKEA 5DDGA 3LA7A 2EBGA 1V5EA 1ZPVA 3QWLA 5CLSA 5FKLA 3GTYX 2PIIA 2OTJI 1M5VC 1UZHA 1TWCJ 5GAGU 1VQ5I 5GAHU 4M72A 4H54A 3R7BB 3HSFA 1CJKB 2H8RA 1S9GA 1YJ7A 2IS2A 2RQ4A 4JX5A 3BO2A 1CS4A 4X65J 4ZK7M 3GTQJ 3G71I 1BJAA 5GMEA 1BMQB 5D5UB 4Q43A 1WJDA 2YQ0A 2OD4A 4R5PB 3I55S 3THTA 4HLXA 1S0NA 3HRTA 1YYVA 1F4KA 2BQUA 1U9NA 3S3MA 2FHJA 2XSJC 2HWHA 2GX8A 1ITPA 5GPAA 1FEEA 1VQOI 4P10A 3OTOF 2FBKA 2W2PP 1CJKA 5IQQA 5ETPA 3EDPA 2ZFUA 3CXCR 3LSHA 4JI5F 3V8LA 3DEUA 4IYQA 2V4JC 1BW6A 5ETTA 5I3QA 3CC2S 2BV3A 2F4VJ 3H3UA 1BHNA 1N5YB 5J2MB 1EQMA 1S9HA 1VQMI 3OD2A 2ZH7A 1A35A 4ZP7A 1FYLA 3OXLA 1I1GA 1E3OC 2A6HF 3V2UC 1RWVB 5E18F 2X1EA 5JVGF 3D4JA 2F48A 4JI6F 4MYTA 1GT8A 5KFXA 3NP5A 4NWBA 4A3DJ 2OD6A 2QLBB 1I3AA 3PSIA 3WTUC 5J1YA 2XSFA 3EUAA 4OV1A 2H65B 2LP0A 1N5YA 5J2MA 1NSQA 2AO9A 3AL0C 2DNLA 3L3CA 1RTJA 2QSFX 5ILVA 1HYSB 1R4MB 5H1SV 3D5SC 4A4JA 4JI1F 3M07A 4C8LA 3G96A 3BZQA 1ZGWA 2M5YA 3AA9A 4RW7A 5JFRA 2VC0A 1RUNA 4LFAF 2HMIB 3ULHA 2EV6A 4F55A 2APOA 1O57A 4HLBA 2DO7A 4WPAA 3BTIA 1XNRF 4RB1A 2QEXI 2FJEB 1ITYA 3FHZA 3BGFA 4Z7YA 1ZYRF 2E35A 2FJBB 4C48A 1H7XA 4ZP9A 2FMYA 4EGZA 3E2EA 1Y8RB 3PHTA 3BG6A 5D4NA 1P7JA 4AXJA 5HODA 3K6GA 1T03B 4L3KA 4OJ1A 4KT5C 3WX8A 4LRCA 1PAUB 2HMIA 3IG1B 3KP6A 2JJ4D 3LP1A 4ED3A 4ZLJA 1IV8A 3NGKA 2FOWA 3IV5A 8ATCB 4DR6J 4JB8B 3I6PA 1OJLA 4BH9A 4M1KA 2DNKA 2LECA 3TZWA 3O8GA 1YSJA 3ZQIA 3N28A 5FGMA 2XLKA 3O6QA 4RLEA 5LMNJ 1R7IA 5J4VA 1T03A 2GNKA 5BYQA 2ZMEB 3CCEI 2K86A 2V50A 3CMYA 2GS8A 2U2FA 2Z1DA 3HKZN 1B70B 3A8EA 4XK8C 1D0EA 2HNYB 1TWGJ 1WELA 3PY8A 2X3DA 4OYIA 5HLTA 2V1XA 5D8LB 5KOXA 2FVSA 2KDZA 5DLGA 4Q8EA 4XOTA 1T8IA 2WVEA 1R49A 4J90A 3OBIA 2VPXB 1LNQA 1EV7A 4MFEA 1MSEC 3ZTPA 1LEAA 2B51A 4BHQA 3GIJA 2HNYA 3JTOA 1UKUA 1AFIA 2OF7A 3HZEA 3JR9A 1NH8A 3CD5A 2XC7A 4CDGA 4NLWA 2NXNA 5K5OA 1TL7B 1Y4ZB 1EKRA 3SZPA 4OX9F 1EH7A 4CO8A 5TGTA 5KFFA 3PIPQ 1T08B 2P4WA 1VQLS 2G0EA 1O7LA 4URSA 2G7HA 3PQKA 4BKXA 1IWGA 2ZHAA 4EJWA 3BR8A 3KTQA 2FLOA 2MW8A 4U0VA 1VK8A 2VOPA 2WV1A 2YXLA 5E1ZB 4USUA 2L9VA 2A6TA 1A5JA 3UWTA 2IGOA 5A8RB 4Y2CA 5BMZA 1T7PA 2IA6A 3FXMA 2G0CA 3JTNA 5ETNA 2K06A 5AJ3F 4DV3J 2HFHA 1FRLA 2ZE2A 3WE2A 1LVAA 4YB5A 3TEHB 5F8MA 3M8QB 3CMAS 4C0HA 4PG5A 1RKIA 4OZ2A 3JSMB 3NAHA 4PUOA 2PG4A 2N3OA 2OTJS 2WY8Q 2E2HJ 1HDDC 1G7CB 3LP2B 1KLMB 1S6LA 5A8RA 2O66A 2MZJA 1YJNS 1IJEB 4LF7F 4ETSA 2OEJA 1RT5A 3T1BA 4XLFA 4OQJA 2C3UA 1SVLA 3FXUA 2WSCC 5LLQA 5H9EK 2WAQN 1N5QA 4IH5A 2CWEA 2ZZMA 3M8QA 5CYQB 1IKVB 1PUFB 2W4CA 3JSMA 2DD8S 4LBHA 3LNQA 5BOXA 4F36A 1RQ0A 2UXBF 5F8IA 1VQOS 4NLGA 2LXIA 2QO3A 3M8JA 1KLMA 4LF9J 4YHHF 2Q66A 1C1BA 2H8WA 4WU3A 2ZJ2A 3TQEA 2YQ1A 4PEOA 3HI9A 3H9GA 1LWXA 3EGVA 5DM7Q 3U7JA 3H3ZA 5CYQA 2DNRA 1IKVA 2MTLA 2AS5F 1VQMS 4C9YA 4IEJA 4YOEA 2A5YB 3PW2A 4JUZA 2CQNA 4ASNA 4LF5J 1BQMB 5E3AA 5HVQC 4KH1B 4OFZA 1IBMJ 1MBGA 3G1OA 1N77A 2CU7A 2H6BA 2PI5A 1ICEB 1B8IA 4UTGA 2IY5B 1B99A 2Z57B 1LFWA 2EV0A 2UVUA 1RT3B 4A46A 4AD6A 1HD1A 2YPZA 4JI0J 4K4UA 2HDDA 3D67A 1N34F 5AE2A 3I4MJ 1BQMA 5KG1A 3TO9A 1HQUA 3LWFA 1GTEA 4PQUB 3D0IE 5C44J 2ZJRF 2KJCA 1UFWA 3EUKL 4I4BA 2CVEA 1WG5A 4A0YA 1TBXA 3G8SA 2FDNA 2VA2A 1Z2ZA 3HHDA 3PM9A 5HOOA 4PPDA 4RPFA 3A0BC 5BYSA 4U7UK 3WODF 4CO5A 5HQMA 4BDZA 2QLZA 2M8GX 2EH3A 2HOTA 2FZKB 4NA3A 2KM8C 4IX7A 2P0WA 1VRTB 4AIKA 2BXJA 3SFZA 3J80K 3DPLC 1L3UA 3NRVA 4ECVA 1IN7A 1JLFB 3GV7B 4JI7J 5ILSA 4ZS6A 1LWFB 4QLCU 2Y8YA 1ETWA 3CF2A 4DF4A 5LJ3Y 3W2VA 3K1PA 3BTCA 3MMYB 1SVDA 4K0KJ 4TY9A 2H94A 2KZVA 1XEZA 4J9SA 2D3UA 1VRTA 3TZZA 3R6SA 5HLFB 3IRXB 3WIUA 3DGVA 3CCES 1JLFA 1YRTA 3UNYA 2XPVA 3KWMA 2K3KA 2HS3A 1LJ9A 1XCBA 1LWFA 2FA5A 5J3LA 5CXTA 4JP8A 2AJ4A 2VT3A 4AM3A 3E51A 2ME0A 3A1YG 3N05A 1FTZA 1UZCA 3QP5A 3CEDA 2OPQA 3PUFA 4HDHA 4ED8A 3IRXA 4ENJA 3NARA 3KLFA 3CLOA 2V1DA 1HHQA 5GAGI 5GAHI 4Q5VA 3CF5Q 4A69C 3TA0A 4P2MA 2HFOA 4IG3B 1U7LA 1MN9A 3L2WA 3WU1B 3WG9A 2P5VA 3C2GA 1RRJA 4I99C 4QPTA 4CQ1A 4QPOA 4OMZA 1VIOA 4P52A 1PJ5A 2RF2A 4DUZJ 4X64J 7AT1B 1ZZFA 5CYVA 2I0XA 2HYFA 2A61A 3ITHA 2WAQA 3DFEA 4O3SA 4LK1F 2DBBA 4B48A 2RQQA 2CNKB 4GCVA 5G0RB 2Y31A 2Q43A 2R5YA 5E8GA 3V7CA 2PEXA 4NLPA 4PAAA 4KIGA 4B8XA 1F9FA 1VI7A 3B6CA 2G1DA 3CULA 5EX0A 3FMSA 2BW7A 5ED4A 3HC7A 2C3OA 1U2CA 3QPIA 4ZLLA 1RLCL 4RW4B 1I50J 3GMEA 3EDQB 3IKVA 3GVAA 3BR2A 5J1RA 5IT0A 4HSRA 1LKZA 4FBUA 4XK4A 4X4QA 2HQAA 3AFHA 1KP6A 3H25A 4CICA 3LSJA 2MHNA 4CLLA 1HPZB 3TDUC 4NL5A 1SQFA 2XYPB 2DA6A 3PV8A 3S1RJ 3NXZA 3BG7A 4NLDA 4RW4A 4C3MA 2KVQE 2KT2A 5IT4A 2R7RA 1KU3A 3OWTA 3T1HF 3OQ2A 1DRZA 3HHGA 4U87A 1F43A 2B63J 2PO4A 3HFZB 2ZJPF 2AZ3A 3HOYJ 2VZ9A 4CM2A 3A8IA 4A2UA 1MZBA 4PGGA 4QQBA 2K2PA 1U8RA 1HXDA 2FQ4A 1DQ9A 5D6GA 5EZHA 3RKWA 3Q8SB 2M2BA 3AKZA 1MSFC 1TL1B 3GBGA 4NMLA 1QAJA 1RKTA 5GAEJ 3OMYA 3EICA 2YS9A 5SZTA 1BXNA 1XGMA 1FBUA 2J6SA 2YH0A 4WXHA 4L9TA 5D5VB 1OYWA 5HATA 5LXYA 2MPUA 1U1MA 2GQQA 2HQFA 3EZOA 4KN4X 1HHTP 2MD0A 5F1JA 2YNGA 1IDYA 3AJDA 2YY3A 1EH8A 4E4HA 1L3SA 4D5CA 5DD4A 4ENKA 1TL1A 2HRYA 2DCLA 3KLOA 5H6QA 4OV6A 5U47A 2LXUA 1ULRA 1RT6B 4PK4A 4EMDA 2CJ9A 4B44A 2GXAA 3CB4A 4XPCA 3P9IA 2M9KA 3R8YA 3T1YJ 4BU2A 3NS5A 3BN4A 4I7HA 2RS8A 3LSIA 3M4XA 1KA8A 3WHCA 1GV5A 5L3EA 5M5XJ 1OY6A 2VICA 3IBWA 3C7JA 1BUXA 2HWIA 3ZQLA 2HHXA 2LKPA 1K9MT 2YTCA 1UTAA 2AX1A 4AFFA 3OR1C 4LB6B 4OZ3A 2CPXA 3I5UA 4R1HA 1RT6A 2XROA 5B0EA 4AYBA 4DU8A 3LA3A 4UQGA 3IM8A 2F4MB 4ED5A 5L3BA 4H0EA 1IKWB 5CCMA 3ECOA 2VKVA 1Y9OA 1APLC 4ES2A 3GE9A 2M45A 1I1SA 3T9NA 3M8EA 2BXZA 1EIYB 3LTOA 1RESA 3KX2A 3I64A 4OYOA 2N3LA 2F5GA 1FD8A 4DR2F 1P7IA 2R2TA 2E5LJ 5C42B 2C42A 4DMZA 4DPWA 2XCAA 4ZH4F 3DNCA 1RHKB 3IH3A 1UFLA 3FK4A 3DKWA 4YN3B 2HPUA 2QLWA 3PX4A 3MKZA 2VT2A 3BTLA 3ABMH 2W4PA 5IWAF 3QBCA 4HNTA 1MBJA 1WG4A 2R42A 2B4UA 1IR0A 4K5SA 1KU9A 3T8TA 4YEAA 2DFFA 4EJVA 1WJCA 1HD0A 5KFCA 1D0ZA 3ICLA 4I98B 3TBIA 4R8HA 2EZHA 2HSEB 4ILLA 2Z33A 2ZJQQ 3MMJA 1HBMA 3FRYA 2DT6A 1Z0XA 2NR0A 5FIIA 2G7UA 2VJVA 3EPIA 3HPGA 2EA4A 3ENQA 2XQCA 4ZIWA 3NQOA 2COLA 4LQ9A 3TP0A 4MT1A 2QN6B 1TK5A 3K0JA 2CW7A 2MDAA 3NWGA 4FPRA 1DU0A 4NEZA 4RJVA 1RU2A 2R8GA 2UXNA 3KK3A 4NZ7A 2DHHA 3BCAA 1XMXA 4YP3A 2DN0A 3QT7A 4ZIVA 1OCTC 3BO3A 4BQQA 1W7WA 3TUZC 2P6TA 2JX2A 2X9DA 4HACB 2F5CA 3QRRA 3KK1B 3MMCA 2BBYA 3DTIA 4KISA 5M5WJ 4NXMF 2BR0A 1BA5A 1JHFA 5EZGA 4B1RA 1CLFA 1VQKI 1RZ4A 2JH3A 3FJ2A 1OYDA 1S6PB 3GCXP 4ED1A 1OMIA 1CJTA 2WTFA 3LF0A 4BJ6C 1KKHA 3C2PA 1U8BA 2I5JB 4UW2A 4IHVA 5B66C 1ZTRA 4HACA 4TN2A 4DSKA 2D41A 3QAUA 1IM4A 2XIGA 2QYCA 4X65F 4PXDA 5L38A 2CRGA 3WTSC 2MYFA 1XQIA 4Q7AA 3GWCA 4Y00A 5DYMA 3PRVA 1NSPA 1S6PA 1U48A 3FIWA 4IG0A 3PHEA 1P6TA 3QNWB 4PG7A 2XUBA 3UN5A 2HGCA 4ZYHA 3QLHA 4WWCA 1CJUB 2R7TA 3DLEB 4NC8A 3OYHA 1GNKA 2FVCA 4DV6J 1S7OA 3D5LA 2RH3A 1SKSA 1DGWY 3Q0AA 1KDNA 2D7SA 2ZMEC 1FYKA 3FFIB 3IRQA 2P9EA 1VNDA 2HKXA 4MTPA 1Q8BA 4B02A 2F4VF 4FYVB 1ETKA 3PSFA 3LSMA 4RNNA 3ONQA 2BQRA 4A3IJ 3Q8VA 4DV1F 1CJUA 3DLEA 1JLEB 3THPA 2GMLA 2KP6A 3GZ7A 2M4GA 2ASJA 3M7VA 1IR1A 2DHSA 3VAGA 1P4AA 3X1LB 3JAMK 3T6BA 1D1UA 1AUSL 4IH6A 1Q1HA 3H5AA 3IP0A 5ILUA 3SYTA 4WKRA 1LXNA 4EZ9A 3LW5C 3MEKA 4EUVA 1TTHB 2PMHA 3S1QJ 3FXKA 3KP3A 5HAOA 3PYFA 3BYPA 3UR3C 4BJ5C 2AMCB 4BE0A 4OIPF 3LGMA 1JLEA 1FOWA 2EBEA 3QIDA 2LQJA 2JZ5A 1YE9A 2GAGC 4AYBD 3LUYA 1N75A 3W66A 3UPFA 2AF6A 3H98A 4WTYA 3TVYA 3WDOA 1LQ9A 1G2EA 5FFZA 2CV2A 4KGZB 1NCLA 1JJ2R 1DU6A 2J0QD 1WKMA 5IS2A 4J9MA 5F08A 3R27A 4U7CA 1NTCA 3W7BA 1YW9A 3E5XA 4ZCKA 2CJJA 3P5BP 5KG2A 2EZKA 4F0HA 4K4ZA 2MGZA 1RK8A 2M88A 1WF1A 2OLWA 1UJ5A 2NXUA 1ZH5A 1YJWI 1NK5A 1FDBA 2CRLA 4YB7A 4D3HA 2RUGA 1GTHA 8RUCA 3SZTA 2AIRB 2WOMB 3V8JA 3WHIA 3KJVB 1TFWA 3U1NA 3QZ8A 2JNJA 5M2PA 2AT1B 3TA2A 1QHHD 3OL7A 3I3LA 4A12A 1YLFA 2E1RA 3L2QA 4HF2A 3H36A 3I59A 4DR6F 2O1PA 2L3MA 3BN7A 2IRYA 4Y52J 3FXLA 4RUBA 1Y10A 4A0XA 1U3EM 4YB1P 2R0QC 4LIRA 4A93J 3UN3A 5LMNF 2IIHA 4RAGA 3H2UB 1UZDA 2WOMA 3KJVA 1FSHA 2LBFB 4OYWA 2FSWA 2IC3B 1RWWB 3J80U 4NMXA 3SCJE 3HSRA 4E0DA 2HKOA 3CZ6A 2DB1A 3KLIA 3HOSA 2DA1A 1ZG1A 2QTWA 1J27A 1YRNB 2E2IJ 4A5MA 3FK6A 3I32A 1U1PA 4UY85 2NXCA 1NLKL 3L1PA 1QAYA 3J81j 2VDIA 1Z67A 1GXLA 3G1LA 4DDFA 3HHKA 1U1RA 5LRRA 2HNZB 1CPZA 2F4OB 1N6QB 1IO2A 3B78A 2RQKA 4DPUA 2QA4I 1S7AA 2HVSA 4CLPA 2X1AA 2DK5A 2HHUA 3FCHA 3H5SA 5LXRA 3MEXA 2RQCA 2VHGA 2HRTA 5ITHA 1S1XB 2K7KA 3U02A 1VQ4I 5KNLA 4UNOA 2CQ4A 1D0XA 4PSWA 2YNFB 3G2BA 5HBMB 3ZP5A 2V9VA 2R7SA 3FEYB 4ANDA 1YW7A 3G1MA 2L9SA 3DDIA 3H5UA 3WC0A 3CJ3A 2HG4A 3HLUA 4QWBA 4NYOA 3VB2A 2ELHA 2CQ0A 2VFVA 4BWJA 1MBHA 4RAZA 1NDCA 1TNSA 4UUXA 1S1XA 1ZELA 1IXKA 2FVQA 4B3OB 1TT5B 3RUBL 3CDHA 1ZGJA 2G13A 5FDLA 4U8YA 3KP5A 4RW8B 3MMAA 1K6YA 5KAFC 2WONB 4AXIA 4DV3F 1T3NA 3BROA 1VQKS 5EUHA 4FPIA 2X1DA 5IOYA 5C24B 2HQ3A 3DRRB 2VPLA 4NLRA 1NJXA 4KHRA 4EMSA 2V26A 3G2XA 2K85A 2CPFA 4USVA 5CVVA 1QTNB 1OCPA 4CM0A 1RAHB 4ZYGA 3NG8A 2AYMA 3CJ4A 3GFXA 4B9MA 1K79A 4DEZA 3ASOH 4M3BA 3UFCX 4KN7X 4DW6A 4LIVA 4WZQA 1IN0A 3L2RA 1LVKA 1FOYA 2WTEA 3CCLI 3MR6A 2WONA 3FBFA 2W7AA 4LVOP 3JYTB 3TA1A 3QATA 5C24A 1EAYC 2AU0A 1KNZA 4NCGA 2HVRA 5ETSA 3ABTA 2COBA 1Y1WJ 2XM3A 3RIRA 3VVTA 4M74A 5ADZA 1E2XA 3QO9A 1G2HA 1WC4A 1IJFB 5FLVA 3F8CA 2OPTA 4LF9F 3D6MB 2D3OR 1DZ5A 1MMGA 2GC8A 3G82B 1FTCA 3QGIA 3HJFA 4DU7A 2BW2A 3ZTRA 4ICLB 4MIMA 3JYTA 2GOXB 4ZVOB 2JZYA 1FK9B 5D0RA 5KFEA 3IWXA 1YX5A 3HOUJ 1NK4A 1VF9A 1G3TA 1XX5A 1TC3C 2NVUB 2LKZA 2NPFA 2XO6A 4O5VA 2J76E 4N8OA 1FC3A 1V55H 4TXSA 2ZH1A 1GX6A 2BW3B 4P73A 4U67Q 5D4SA 5KFZA 2DEIA 3GYGA 4LF5F 5EYRA 1QPIA 3K2YA 3O5TB 4N8NA 4C8KA 4EWTA 2RNJA 2K1RB 2Y1LB 4PWDB 5EEGA 3R0AA 3R6LB 1FMVA 4M3DA 3QPSA 1FK9A 4UOFA 4OZ0A 3MVPA 4YQWA 3DLKB 4PYDA 3DOMB 3BGLA 3PZPA 1XDUA 3HF5A 4JI0F 5DDOC 2NXEA 5DV5A 2BW3A 4UZCA 4DV4F 2RHSB 3VYRB 3PO5A 5KTQA 1Z3XA 5FJ4A 3K4CA 3L09A 5HS7A 3KMQA 4DSFA 4KBIA 2WY7Q 1Q5YA 1E3HA 1RADB 3I0RB 4P9FA 2K1RA 2H09A 4DR1F 2UWMA 2W9BB 3OXGA 3E6CC 5LGUA 1BW5A 3C6UB 2A6OA 7FD1A 4GYIA 5F0UA 4OHZA 5B3SH 2C6YA 3ILLA 2V0NA 2VF3A 4K50A 3DLKA 2IA2A 3DOMA 2NAZA 1HBNA 2V8GA 3UDCA 3HHEA 1YJWS 1LDKB 2STWA 1HHSA 2D9OA 2DA5A 5LSOA 4YDDB 1R0AB 3NRBA 4HW0A 4B3XA 4J19A 1WEZA 1N5SA 2K4BA 3FBIB 3OS1A 2JA7J 2L02A 1G4DA 4ITVA 4JI4F 4OU0A 4ZVFA 9ATCB 5IYCJ 3ZZPA 3G6XA 4F04B 3H42A 1L3TA 3F0CA 1REPC 2C3MA 2V8VA 2OZ6A 2V6CA 4K0KF 2J0XA 3GYNA 4BQAA 4BAYA 3NOCA 2DPDA 4N56A 4JV5J 3H0DA 1M1HA 2RILA 3FBEA 3LWMA 1IV6A 5F8JA 3S32A 3DXSX 2A6EF 3AD7C 5C25B 4M9XA 1RT2A 3BJOA 3P9KA 2F5VA 1Y5NB 1IZ1A 2OEKA 3FXRA 3M9MB 4UF4A 5KFSA 3BQ2A 4CWBA 1FKOB 2J7KA 3DU5A 4B3RJ 4TU7A 3K17A 1NK9A 1UEUA 1R0BG 1AA7A 2E5HA 2UV1A 1JX4A 3D66A 3IC1A 3ZXSA 1VC0A 5A76A 2Y9HA 4V19X 4Y3CA 5HANA 3P49B 1TWHJ 4RZRA 4NNJA 5C25A 2MGQA 3Q22A 5KT7A 1UVJA 3NL0A 4N47A 4LRFA 3BPVA 1Q81T 4FBTA 2FX0A 1FKOA 5D0GA 2D9PA 2RS2A 3CUNA 4DUZF 2LYVA 1D5YA 3GFMA 3DLGB 2KYZA 2E1PA 2XB5A 4CCJA 2X6YA 1PILA 2RGVA 1DP7P 2VU5A 1MSWD 1G8XA 3RSNA 1AFJA 2DGTA 3JREA 5K5MA 1TV6B 4A3BJ 3J7AO 1MROB 4UZBA 1VQ4S 1WI3A 5J1NA 2JWNA 2MZQA 3MOJB 2M2EA 2XHKA 3KLNA 2R7QA 4Y15A 1WJFA 1JE8A 3ZNJ1 3VAJA 2B4VA 4MK9A 5KFLA 3KG0A 2KZZA 5KG4A 3PVXA 5HLHA 4RBUA 2J6TA 4KJIA 2MABA 1HW2A 1EH6A 1W5TA 4CO1A 1ON1A 1N36F 2WSFC 3KYLA 2C22A 2AGPA 1AWCA 5DUKA 5JJBA 4I76A 1MROA 3U1KA 1KONA 2AV5A 3WTWC 1KQ9A 2IPQX 2HQ5A 4FYYB 2AEMA 2BEFA 2E34A 2CPZA 2HGLA 3LGNA 4RNHA 2XNRA 2EIJH 3CJRA 3PXGa 3M8ZA 3G6YA 1URRA 2NOGA 3VODA 4ER8A 1T0FA 4DQRA 1SFOJ 2DR9A 1FBQA 1KBRA 1W25A 5EGYA 2XGCA 2OIHA 2X6XA 4C3IJ 3HHNB 3DU6A 3G87A 2M30A 5KFGA 3KYCB 4F93B 2RUSA 3EUNA 3K59A 2WAEA 2O03A 1HSTA 2LMIA 1SV5A 3JRIA 2HOSA 4QOTA 4WXDA 3JXOA 2DGQA 4UY8I 4LF2A 4A8MP 4KKOA 1XCVA 3VDXA 2QSGX 4R79A 2YX4A 2DT9A 2C2RA 3CJ8A 2JFKA 4IRHA 1EHWA 3FSYA 2M8DB 3ZMVA 4AQYJ 2QQAA 2Y8WA 1KQ8A 3J7Z5 4RLQA 5T7LB 1QUVA 4EGLA 3CCVI 1PSDA 1B9NA 1OO0B 5JVGQ 4GC7A 3F8MA 4IJAA 4ITSA 4ETZA 3KLVA 4OI4A 3K8VA 4EJTA 3H7HB 1SVOA 4OMFG 1E6YA 1T02A 2V8PA 4YB6A 4ECWA 3UDVA 2QGUA 2DPIA 3OTEA 2DT5A 4OI3A 4RB3C 1ZG5A 3GFJA 4KB7A 1U0HB 3JAMU 2VPRA 4FF3A 5T7LA 2Z3YA 4J01A 2PMZA 9ANTA 2ZXWH 4C2TA 4V19J 2E7VA 3TAQA 1BD6A 5KFBA 1OWXA 2GM4A 4NHJA 1JXLA 4MTEA 3PO4A 4CP5A 2V8DA 1ROFA 3ZZUA 3NCPA 2CQQA 2Q2EB 1S49A 2HTSA 3QGGA 1F9EB 2IJFA 4FVCA 2D3O1 3DBRB 2ZEJA 4ERDA 3DP7A 1TWFJ 2FJDB 5KG6A 1U0HA 1CBKA 5GAHJ 3NKYA 4CDIA 3DHWC 2X1CA 2HZVA 3V42A 2ME6A 4KJZA 4IDKB 1QZYA 2GGPB 3ZR8X 1WC3A 4E7KA 4BHCA 4ECZA 4KFBB 1OY8A 2ROEA 1TVRA 2YWFA 2IAJB 2E5LF 3C3LA 3J7A1 1TK8A 3IGNA 5L9NA 2JN6A 2PN6A 5F3ZA 3GZ5A 2VKHA 1HKAA 2ACMA 1T98A 4M9SA 1UJ4A 1BR4A 1YKWA 3QSIA 1MWYA 3OOUA 2OKQA 3ZZ0A 3TO6A 4CH7A 1Q7YT 4QIWN 4IDKA 1VQ7I 2BKNA 4XDDA 1CF7A 1W26A 4HOBA 3ZMUA 3QMQA 5HJXA 3PW0A 4CXFA 1EF4A 1SJQA 3OL3A 1OCCH 4OIRF 1NUEA 1STZA 5GVQA 4KFBA 1FBSA 2IAJA 3HRMA 2OQGA 2VQFJ 2MH9A 1V6HA 2EFQA 3MM7B 4LVNP 3P5JA 3BQZA 4UB8C 1TLHB 3BREA 1R5HA 3ZQ7A 2W2NP 3FXQA 1JLBB 2XAHA 2AW0A 1NPRA 4ZKAA 3FF5A 1R6VA 4MEXF 1G3WA 1QUPA 4A8KA 4DYQA 1B59A 2PC6A 5KG7A 4U96A 4H4MA 1ETVA 2ZOGA 3LH2S 3ISZA 4TYAA 2G2OA 4HAMA 3RKXA 2HNDB 3MI7X 2VIHA 4RL1A 3K0LA 5DGAA 4CLWA 3FEXB 1YITI 3JRDA 3MM7A 3J7YU 4EO6A 4BDPA 3CW2C 1HI0P 5DM7F 1JLBA 4IFVB 1FEXA 2AEJA 3O3LA 5FLXK 4R25A 3KIOA 2XMAA 3MAQA 1UFKA 1AROP 4EVIA 2HNDA 3LAKA 3S7RA 3H3VK 1ETYA 3SQGB 1ZM9A 2FC8A 4KQZA 3REOA 3K5LA 4L9JA 2HVDA 2QQ9A 4IFVA 3BDPA 1T9VA 3MM5B 2OUMA 3C1DA 3AA8A 4C98A 1NAQA 2AHOB 1IC8A 2D1VA 1GVDA 1YI2I 1HOMA 1TKXB 4GO7X 4DWIA 3IH2A 1L3KA 5FRNA 4I6YA 3BJYA 2O5RA 1UHWA 1PP8F 3HSEA 2YX7A 2DGVA 1HKSA 5AE3A 4LLLA 2BE9B 2ZBRA 3FNNA 4B3MJ 3UR0A 4GC6A 2HHVA 2DXDA 1N5TA 2GJ2A 3V81A 3GTLJ 2H5JB 6FDRA 4LR8A 1GT0C 3MKLA 1RAGB 3VF0B 4DV6F 3OXFA 1H73A 4I2QA 3W5XA 1NHVA 3FQKA 3CMMA 3HEFA 3KPHA 4RW6A 1UVMA 2KFDA 2QKMB 1T6SA 3W2WB 3VGUA 3GYHX 1PGZA 2LDIA 3UDLA 3PX6A 1UWBB 2PI4A 1T94A 3MCNA 4XR6A 4ES3A 4DYCA 1Q86T 4K4SA 1JUMA 2FB0A 2D69A 5HMXA 2XZTB 4RUCA 2X1FA 4LMZA 4HH0A 2PMZD 1BC6A 2KIMA 2CUYA 1MG7A 2XY7A 1M1KT 3NLCA 2MLGA 4J9LA 3V6HA 3W2WA 4QIVA 4GO1A 3BJ6A 3NCQA 1KTVA 4KYZA 2OBPA 1C0TA 4A47A 3CCMI 4M5MA 4NZ6A 4XICA 1LUJB 2C1EB 2B5JB 3S3OA 1R1UA 3TEDA 3A8KA 3GW2A 4UOCA 1RB0A 3OL6A 4XMYA 5DS7A 4PR6A 2LVWA 4CNYA 3CCSI 2ALYB 3W9IA 3CF5F 1VJQA 3CCRI 3F21A 1VCTA 4DCPB 2KG1A 3RZAA 2HBQB 2FNAA 3FDYA 3ASNH 4B09A 5B0BA 1TW2A 4Y7NJ 1LW2A 2LG4A 4YFXF 3DM2B 2B5JA 4ZC3A 3AQOA 4ZP8A 4P75A 4I2PA 2E7XA 1N52B 2ZJRQ 2QA4G 4FXVA 5HLIA 1O51A 3PEJA 3FSIA 1D9FA 2X6OA 3GZ6A 2YWHA 5BXIA 1YBTA 4NA1A 3QOPA 3HJVA 2FF4A 2KHCA 1VC6A 1T8EA 3KKFA 5J2PA 3GIMA 3N79A 4DIQA 3Q0WA 2OMOA 1JGSA 1P9QC 3IS9B 1KQSR 3OIPA 4NXNJ 1CQMA 4IHXA 4I6AA 4ETXA 4ZVEA 3D1QA 3I4HX 1VBKA 1UELB 2HBRB 2PJRB 2FHKA 2ILYA 3EWGA 2ZH6A 2QSFA 5DDPC 1P8GA 1WI8A 3TJ8A 4DX6A 2ZBIA 2AX0A 2DXEA 2M1BA 4LREA 4OX8A 2L01A 4KTQA 2DFEA 3WC2A 3FDSA 4EEFG 3J7ZT 3JRBA 3KEYA 3K4MA 2E5NA 1IM6A 4ANJA 1WSRA 4WE1B 3IS9A 2J0WA 1AB8A 1FY7A 5J47A 2ZXHA 3AAWB 4DS5A 2R7OA 4XIUA 3BOQA 3JSBA 4Y2AA 2WADA 4WP9A 1Q4RA 4HI1A 1X58A 4MIWA 4ZVHA 4Q45A 4N41A 2K5CA 2VJUA 4CUGA 4CH1A 4HI2A 3L2VA 3H4BA 2ZH5A 4LMYA 4NC6A 2XMUA 5H20A 3GFYA 3J7ZI 1JKPC 2J5PA 4UVCA 5CH7B 1N25A 5F41A 2XHCA 1DY3A 3MD3A 2H51B 3MKWB 1R8AA 2XMTA 4DHVA 1LFPA 2DXIA 4NE9C 3TJAA 2PX9A 2DNPA 4WP3A 1RYRA 4QR2A 3EJMA 5KG3A 5IYDJ 1VYAA 3J80Y 1HKQA 1Z6RA 2BZTA 4UHTA 3H2LA 2M8HA 4ZLNA 2R9LA 4M6XA 2WSEC 3IUOA 1U4BA 4QWQA 4DF8A 3K5PA 3CO0P 1YWXA 1R5ID 2OPRB 2RREA 1ZGAA 2JLEA 2DRBA 1YITS 2WVFA 1R89A 4USTA 1DQAA 1PUEE 2HRUA 2MKSA 2HYJA 4A8WA 4HEA2 5L3CA 5C7PA 1ZQ3P 4A8SA 1YK9A 4MHGA 5IT9K 2M0MA 3SI8A 4ECTA 2O9LA 3A3PB 4LOCA 3JTPA 3LP0A 5CCLA 2XASA 1RKWA 3CNQP 2M34A 1JIHA 5IC4B 4OJGA 5JXSA 2OPRA 2B7EA 1PYSB 2DPUA 3MXHP 2V4QA 3TYTA 2U1AA 2PQ8A 4XBFA 1S9EB 1MW7A 3NEKA 4RBOA 1FRKA 4UVAA 1XPXA 2ICWG 4OJ3A 4P7VA 3NGUA 4BWMA 2B8QA 2CNOB 5KFRA 3KLEB 3SEOA 1TMMA 3HSDA 2JVHA 3Q9SA 1FRHA 4F4ZA 1LV5A 1YI2S 3DFGA 4KHMA 1FJ7A 2HS4A 2P9CA 1MMSA 2F9DA 2Q0OA 3OYKA 4CT9A 2DNOA 4PG8A 2LMDA 4PRFA 3C15A 3G73A 4ED2A 3HRSA 3MF5A 3KLEA 1NNDA 2BV6A 2WW8A 1LB2A 2A2CA 4KH0B 5J4YA 3ULQB 3MZHA 2V79A 2O67A 4QWDA 8AT1B 1S3JA 4IR9A 4JQFA 5M5YJ 3OYFA 2DR5A 2YNHB 4NQWB 3N6LA 5SUHA 4PJ0C 1ZR4A 4M6YA 1RAAB 2FD5A 2ZSHB 4IRDA 5D5WB 1J5EJ 2Y0MA 4BXUA 2B4PA 4O3OA 4LF8F 2DYSH 1BY9A 1JKQC 1RTIB 1VQPI 4IR1A 1FT8A 3OSPA 3PFOA 4NQWA 2DH9A 2K27A 2HKEA 1SKRA 3CMQA 1HQEB 4OYBA 3MEGB 3GLJA 2E1NA 1FEHA 4AIJA 4L9VA 2MZRA 3CCMS 3W6JB 2ZITA 2VKDA 1K0TA 2KL4A 4TNOA 4UQTA 1SC3B 1RHJB 3J81K 3RB4A 4DFKA 5CAAA 3CCSS 1KD1T 1X19A 3C18A 3KDNA 2WBRA 2JC0A 3U21A 4HRIA 3MR2A 4L5EA 3CCRS 4A3GJ 4KE5A 3A3NB 5FFXA 1HQEA 2XMKA 3OYDA 2YU3A 3D1NI 2B7CB 2EV5A 2XI2A 2JUGA 2MQNA 1U02A 4WFYA 1BOBA 1NZAA 2NCKL 4QIEA 4ALZA 3RRKA 3LO3A 3HL2A 2Q3PA 3M7GA 1WF2A 3LOCA 2QYOA 5BQTA 1SC4B 2LFVA 2KT5A 3ZZOA 1QGPA 4LSZB 3Q2SC 2KRBA 3K4NA 3HRUA 2XF6A 4WXWA 2UVRA 4IO9F 2OPPA 4OX6A 1GX5A 4Q44A 5K7FA 3J7YI 1JLCB 3AB4B 3B4MA 1DPUA 2UZKA 1O6XA 3GIKA 3HT0A 4L0ZB 4USWA 2IBDA 3SDGA 2I2YA 4JV5F 2CO5A 4E7LA 4Q5SF 2M3AA 4FDFA 4NEYA 3OR2B 2O3DA 4X66F 1WJBA 5DTDA 5GPCA 1UCRA 3BGRB 2OAUA 2Z16A 3BSOA 1LWEB 4F0MA 1T9XA 3HOVJ 1U6ZA 2F4FA 2B4OA 3JTHA 2RRNA 1V5FA 1ZHFA 1WPKA 1NK0A 4QYRA 4E8UA 1GXUA 1NDLA 5EDNA 3KE2A 3Q0VA 2VD3A 3OYJA 2C2ZB 5GMKa 1IBKF 4X4NA 1S1VB 1VISA 4MEYF 1SAXA 2F8EX 2HLUA 3T5JA 3BGRA 2Z0GA 1TKDA 2XY6A 2GIZA 4PGHA 2VFRA 1J5YA 3SCIE 2XB0X 1HQ2A 1XWLA 2CUJA 1I3OB 4C9DA 4ZLPA 2UUAJ 4F25A 4GYGA 4F8RA 3TMOA 2AJFE 2QZ8A 1G1XA 4ZA1A 1YG0A 3SFIA 1RHMB 4K2JA 3Q8PB 1S1VA 4FE7A 1UMJA 1S57A 2Z2SB 4DR5J 2CQ1A 4ZJQA 2HURA 4U7DA 4LITA 1RTDB 5FLXU 1X1CA 4YR0A 2DNGA 3OFEA 3GTPJ 1FDDA 2A10A 2L54A 4QPXA 3B02A 4X4OA 1TELA 4DI6A 1LDDA 3MM9B 3EUHA 3N6MA 4OINF 2BJ7A 3R2CJ 3RI4A 2M4MA 3RPUA 2Y48A 4AL6A 1JQGA 3ZC4A 2B9SA 1LQ1A 1SVMA 1WZ2A 3HVTB 3ZRGA 2MG4A 1Z7LA 4L9NA 3HTUA 4V2GA 1ZK8A 4RU9A 3PCOB 2XKPA 3F73A 2YU9J 4DV7F 2ASYA 4D7MA 1SH2A 2EPFA 4HBLA 3MEDA 5JHFA 2DYAA 1E0EA 3OTDA 1N54B 2V69A 3O44A 2O01C 4BE1A 1ETQA 3HVTA 3BSAA 4DSJA 1DBDA 4HT7A 2FHMA 5ETLA 4ZVGA 5KFPA 2P6SA 3KP7A 3MMBA 4LFBJ 5HMZA 1K1SA 1DTQB 2N4CA 2YPYA 3TW6A 1JKHB 4O4GB 3D54A 2MC3A 1RGVA 4B9UA 4ZJOA 4AQYF 2JVRA 1IN4A 2EC0A 4X4UA 2EFPA 1CVJA 3QPTA 5A2QU 3C14A 2ACYA 4ANEA 1CG2A 4Y0FA 4LQ3A 4G6TB 2XI3A 3N5BA 3KLGB 2PLYA 2XGDA 2VONA 4OOIA 1JUPA 5CKTA 3TANA 1XERA 1OPCA 2GJFA 3FXOA 4IL6C 3MAJA 1PC4A 1OIAA 2DNYA 3DDNA 1VQSA 4X2BA 1URNA 2ZBCA 3HVRA 3Q8RB 3T19A 4AUKA 1VQPS 3K1NA 1O4XA 1I6JA 4MKAA 4F7VA 3MZ8A 3A1YA 3ERED 1S7IA 4J9UE 2L0KA 4IPAA 3HPHA 3MTJA 3CIZA 3LPYA 3SV3A 4YS2A 4W97A 5F0CA 5DETA 3EETA 1FP1D 4N7TA 3OSNA 4N4NB 1U2WA 4DUTA 2XF5A 2CNLB 3T5HA 3OS2A 3RBZA 3QT5A 4USHA 3S15J 3POTB 1RNLA 1FJLA 4B9TA 2BANB 1FTRA 2DQRA 1RA6A 3H92A 5FD5A 4ZCLA 1KVIA 1DARA 3TRGA 2GCFA 2GA2A 1X4AA 3PRBA 3JAMY 4ZMMA 1S99A 2CUFA 2P81A 3MUVP 1HLVA 2ELKA 2L7FP 3RJMB 2W25A 3CQZJ 4C30A 2ACJA 5TJJA 4DBQA 2IW5A 1OCRH 4QWAA 1SKWA 1RWKB 2JSPA 4A48A 2BKOA 2L9WA 1TZ0A 2KQRA 1A31A 4DL3A 4HX4A 3ETMA 2FGOA 5BPDA 3KETA 5LSRA 3HULA 4DSEA 4DG1B 1BE4A 2IS4A 2QLXA 3K8WA 3VWBA 5H9EJ 2F65A 1S97A 5TISC 2DW4A 4FT8A 2YKQA 4QSHA 4CO0A 3R1HA 2VQFF 3CC4I 2ADBA 2ISZA 4ILRA 1HNXF 3HB9A 1OLTA 3L7UA 2RAQA 3WZ0A 3BZKA 3RPQA 4MMOA 1IRFA 3MM8B 1G6NA 1U1NA 3QQAA 4FQGA 1TUGB 4DG1A 5KFKA 2HYGD 3BF4A 1OCOH 2V2ZA 1YHQI 4CCMA 2Z2MA 1JGGA 2ETHA 1JK9B 2C3PA 3I4PA 3M32B 1JJHA 2F5EA 1R9TJ 1ZAWA 4WK1A 4WF2A 1WORA 2KLOA 4PJJA 2A3SA 2F8HA 3PDNA 1Y6IA 3CE8A 1V3RA 1XDSA 1JI8A 3FM3A 5F0FA 1VQ8I 2F4IA 2DDBA 3MM8A 3KUEA 4L6V3 2Z8QA 1NK3P 1Q7LB 3SFGA 2VKRA 1OKRA 5JUMA 1AHDP 3AH6A 2WB1N 3M32A 4JK1X 5E2QA 2LEBA 5DGBA 3EGZA 3VALA 3QGPA 1CSJA 4V1Ak 1HMVB 2XWXA 2ZH9A 2XBPA 4D5FA 4RR5A 1U45A 5DRKA 3FK7A 1KS2A 2EK6A 1EJ9A 1IN5A 1RT7A 2LFBA 4CLYA 2YX1A 3SSSA 4F4KA 3NAIA 4RM3A 4OAZA 1MBEA 5IT9U 2OAZA 3HHLA 3BY6A 1WTBA 3KHLA 2Z2ZA 3CUQB 2IGNA 1FFSB 1IAWA 2XGPA 4WYLA 1S72I 1MMDA 2D3ZA 1HMVA 1I94J 3ZPLA 3KEOA 4NLXA 4M94A 1OR7C 1XBWA 2EILH 3HT3A 4OIOF 2JEGA 1QZZA 2CQXA 4KC5A 3K9TA 3CP8A 5LOQA 2R7DA 3OYGA 1BI3A 3DYAB 2LSOA 3MZIA 1F3FA 5EN1A 2JLFA 5M3MJ 2XVCA 4M5LA 3H59A 1UP1A 3M8PA 4DPYA 1TL5A 5DJBA 4ID5B 2ZUGA 2W4DA 2BQ3A 4PWWA 4UT4A 3DI6B 3OFHA 2UP1A 5EWEA 1ZRCA 3WGHA 2DJNA 1D8YA 3RAQA 2L7MP 5FD1A 2W9CA 3LSPA 2GW8A 2LA4A 3AG3H 4XLNF 5HK4A 4G8XA 1JMTA 3DYAA 2PFFB 4L5IA 1S79A 4CLTA 1F60B 2PGCA 2QUFA 1H9TA 1VRUB 1KQFB 1SFUA 1S5LC 3AFGA 5J8CA 4TKTA 4PUSA 1DLOB 2YQ3A 2O3FA 3AQPA 2M4KA 4CCOA 3TZYA 1EJ7L 3QFWA 4FZVA 2CXEA 2IM3A 3DI6A 5KOWA 2DI3A 1LKXA 3SXYA 5KFUA 2MYSA 1SCJB 4ZVPB 5T41A 4C3HJ 1S1UB 2BM1A 3DTKA 4BQOA 2JUCA 4RNOA 2BVZA 2V1NA 1MDMB 5JI6A 1YZ6A 1RBOB 3G3ZA 1DLOA 3HCXA 1FNMA 2BJ1A 3DKXA 5IY5H 1F36A 1FWKA 5KHDA 3MQ0A 2XF7A 3BKTA 1FA0A 1HW8A 1K0VA 4I64A 1SAUA 3HUGB 3KZZA 1R0CB 3DBLB 4Q48A 4FYXB 4TQRA 3WU2C 1S6UA 2BE2B 1SQGA 1IVZA 4J7CA 5MLCV 1X4PA 2FMLA 2AZ1A 1MDMA 4QBUA 3A02A 3RW6A 2DA7A 2GA7A 4IRGA 3IRRA 2N7YA 1O3QA 5LFAA 3FBBA 1OQ6A 4EK2A 3D0GE 3B6BA 3ZMTA 3FSXA 1YZ7A 3PUBA 3BG5A 4ZZLA 4E6KG 3J81U 2ERRA 3A03A 4XKCA 3DEEA 2LXFA 1S9GB 4DBRA 1S10A 1YJRA 2R7FA 3VVUA 2BE2A 1RBLA 4HDGA 4NXNF 2G0IA 3D9BA 4JBCA 3K5MA 4DJBA 2HFZA 4J9NA 3TNVA 3BZ6A 3V4GA 2VC1A 1U6GA 3Q9VA 3IN5A 2OA4A 2G0JA 1EX8A 4PXEA 4HG2A 5E3RA 2VA3A 2VXZA 3K4KA 3D1OA 1IQTA 4LBPA 3AT1B 1KFDA 3F6VA 4AL7A 3QJJA 2MFZA 3I96A 1PC5A 4CCLA 1T95A 2WB1A 4N77A 3J7AN 3IAS9 3CUOA 2QCOA 4ZCMA 1WC5A 2JOQA 3B54A 5KFJA 2XMWA 1FVSA 4LFCJ 4PJNA 1JJCB 1WTFA 5A6WA 3EX7B 5KG5A 3A4TA 1PYVA 4NUBA 3FVYA 3OSGA 3RAXA 1CC7A 3CC4S 3NNAA 3VGTA 3MDFA 9RUBA 1A6LA 3VYTB 1MWZA 5HL7Q 4X4TA 3D0HE 2OFGX 4O3RA 5B0DA 1SPBP 5BPIA 3GPAA 2HZCA 1HA8A 1XN7A 2A5WA 1QY7A 3O2IA 4JYKA 5L1IA 1ULYA 1YHQS 2UUBF 1YQAA 3FKBA 1N32F 2DPJA 3TVZA 1ZN2A 5E33A 4F26A 3KMSA 5KT4A 4JI8J 1RTJB 2R3SA 2F7VA 2DTZA 2NVYJ 3SSQA 2AQFA 2B8PA 2YKMA 5CZXA 3UE2A 5KFOA 4ZPVR 1RT4B 2IFXA 3AAFA 4GKJJ 3DOKA 1F6TA 4RW7B 3EGWB 3C3WA 2OPSB 3IR7B 1X2MA 4S04A 3HGGA 4USMA 2QMXA 3UW1A 1BGXT 2GVZB 1M5SA 3IL2A 3RB0A 4M5GA 1X4OA 2LC2A 2NVQJ 4ZVQB 2V4RA 1HW1A 2IVMA 4WJBA 4DQQA 3ENAA 1DDNA 1RT4A 4QYZK 4HTIA 1RDRA 1KWMA 2OPSA 1VBYA 3T0YA 5GP9A 2XGQA 3LP1B 2AJ1A 2GVZA 4B47A 1R58A 3H5NA 3M2RB 3VYSB 2KJWA 1APSA 4ZDNA 4ECQA 2YH1A 2MZSA 1D09B 2QF7A 2R8HA 4KICA 2OV7A 4XAKA 1S72S 4FETA 2CADA 3R2DJ 2VJ4A 3KLHA 1RYSA 3ESWB 1HBUB 1NJYA 1PP7U 1WQ2A 3DBHB 5CVJA 2V63A 2MLKA 2YKNA 3T3FA 3NAUA 1S48A 2DH8A 3QPLA 2DJWA 5IP7J 1WOOA 2VI6A 2HZTA 5J1EA 5FKMA 1H89C 4RNMA 3CJ5A 1ACIA 2KZMA 1SD4A 2VFTA 4RB2C 2B3TB 3SCLE 2E1OA 4YR3A 2CFXA 4CLKA 3M2RA 2DY9A 4P5OA 2BACA 3TAMB 4B3SF 5A8KA 5B0AA 4HDVA 1YBUA 4M3FA 2OCEA 3NEUA 3OR2C 1HBUA 2EJRA 3NS6A 5E20A 1IGNA 3BKUA 2L08A 3S17J 2B9XA 2AEFA 3CMEI 1J7KA 1QQIA 2K7JA 5EWGA 4XORA 4USKA 5D5XB 1OYEA 2M87A 4TV7A 5HSPA 1BBYA 3TR5A 1GDTA 3CTRA 4ZDLA 3LFUA 2CGPA 1IQZA 3CD7A 3TAMA 4M5NA 1LWCB 1FJCA 1U6FA 2WVDA 4I0AA 2NXNB 2M70A 5HQLA 1VIXA 4C3KA 1HNIB 3CCJS 1PYTA 2EG2A 3HG9A 4LG3A 4OI0A 4DPOA 2RN7A 2NVXJ 3P7NA 2VL1A 3KEQA 4QU6A 2YWWA 2DT7B 1YIOA 2H4YB 4ZHRB 4X4RA 4RBTA 2LQBA 4FASD 2C2KB 3LSTA 3ZTQA 1LWCA 1JLQB 4IKFA 3S1MJ 4YFKF 4LIUA 2CZVC 1IF1A 1HNIA 4FNIA 1N56A 1FNXH 3PR4A 2HAFA 1WNEA 3U2RA 3GF2A 4Z2XA 4A8OA 1QSSA 1FRMA 2XMVA 3Q8YA 4P55A 3ENWA 2FNPA 3GCWP 1R4NB 2W1OA 2HQCA 4NPOA 1SMYF 2XEXA 4ZHRA 1KRPA 2X6WA 3FEZA 2ZE2B 3V4MA 3MTKA 2ZZNA 3HOXJ 3NY0A 4CA0A 2P7VB 4BS9A 2KPMA 1JLQA 1RHRB 4NLSA 5LMUJ 4PUOB 2CQPA 4FHTA 2K9QA 1NHAA 3M30B 5T14A 4WU2A 4GMKA 3IWZA 4FKYA 1S0OA 1TL3B 4LJMA 4LF6J 3KJNB 4A8QA 3GWZA 2FHJD 2FLNA 1RT5B 2YKOA 1TMJA 4U88A 2QMUB 3QAEA 3E5UA 3SDEB 1BN5A 3N4MA 4WK3A 1SL1A 2EI5A 5HLGA 3RR8A 1K6OA 2LCWA 3GJSB 4K4XA 2ASLA 2DFIA 3C8YA 1D3YA 2WV0A 3M30A 4IQXA 4JYAF 1VQ5S 3GX4X 4C3JJ 1R8CA 3NCRA 1HLWA 4XTTA 1TL3A 2EG1A 1C1BB 2QX0A 1V3SA 3G71S 3E1SA 4M5HA 2E19A 2B7BB 2KHDA 2ZM6F 2FXAA 3SDEA 4IO1A 3ET6B 2HS5A 4NCBA 3FZVA 2MY8A 2HFVA 5H2FC 2FLLA 3ADAC 3TUIC 1ZTWA 3D5RC 2GHWA 1HWJA 2F1FA 4LFAJ 3RYPA 1HIYA 1SIWB 4CTAB 1UA1A 1X5SA 2FZCB 4CO3A 1MWQA 2CG4A 2QSWA 2TRTA 4NC7A 1B8IB 1U5TC 2EZLA 1X4HA 3ET6A 4RWXA 2UUAF 4HT5A 1FSEA 1MNDA 5LJ5Y 5LBQA 2XC9A 4KIBA 1AYEA 3GEZA 3S14J 1GVJA 1KN6A 4F91B 1L0OC 4F52A 3DF8A 4P9UA 1FP2A 5IT3A 2LNBA 1RI7A 2WWYA 2CDQA 4EYHB 5D4OA 1NB7A 4CTAA 4YUDA 1HQUB 1ONVA 1AZSB 5AXNA 3QWPA 1E17A 2V2QA 3RRHA 2ZBKA 4DZPA 3SEQA 2YBVA 4XRFA 1JLGB 1VHIA 2IEKA 1W36D 2Q79A 4OAYA 1LDJA 3R7NB 2BVLA 3RCOA 4F2RA 3EYYA 4CYUB 1TNTA 1MJBA 1H0HB 2MQQA 1FX7A 4UV9A 3A12A 3F56A 4RNFA 4HF0A 2R7UA 1DFDA 5KFHA 1NZ8A 3R6GB 2Y3YA 3S2DJ 2W7OA 2HI3A 2EK1A 1AZSA 3HKZA 1TT0A 5E79C 1HI8A 2JQ7A 1JLGA 3CO9A 1X9SA 1VLOA 2XSJA 3E5QA 1KHWA 4DX8H 5FLXY 4OZLA 2Z5UA 4CYUA 4C2MA 2H1KA 2HHSA 2QEXS 1OYYA 2DODA 3W2VB 5HP1B 3IR5B 3EQLF 4R8UB 3LGHA 1AUDA 3WQPA 2XRLA 1RAOA 2V4JA 3NGDA 4NB5A 2CDRB 3OW2R 1K4TA 4XQFA 1V3FA 2K02A 2RQMA 1SJFA 2QL9B 2Z30B 3MPVA 1HCRA 3QQCD 2KB2A 1X7VA 4YIRX 4LFBF 2XKOA 2FYXA 3GFLA 3AL0B 1CEZA 2OU2A 5L3GA 2XDVA 2LYCA 3OIOA 2GIFA 5HP1A 1A6QA 4JI2J 1QDUB 4R8UA 3QYBA 1GFWB 5EX3A 3F0NA 2RB7A 4P2XA 4K8RA 4AL5A 2OPQB 3VWSA 3P8BB 2ZUAA 4LUBA 4IVNA 2MKYA 2K8GA 2R5ZB 3KLFB 3DRSA 1D9AA 2DAOA 3P96A 1VI0A 3CMES 3KJQB 1BR1A 2CYYA 2AHQA 2BX6A 2AQ4A 4YELA 4URGA 2BABA 2QLFB 3HKWA 1BIAA 3BG9A 1MH4A 1USSA 4A3JJ 2O0YA 3LMMA 3HD2A 1G4CA 4LSNB 1B1BA 2RF2B 2MQMA 1W0UA 4PG4A 5BS6A 3ITHB 2VPYB 3CWJA 1NG7A 1NO8A 2Y0SN 5AJ3J 1WH5A 4U0WA 2R5ZA 2JA6J 2W57A 5A0YB 2R5YB 2VDHA 3CJSA 3GQCA 4C8OA 3CCQI 3HPOA 2XS5A 1HNVB 5IOZA 3FX3A 2F6CA 4LSNA 1MD0A 3L95X 3K2ZA 1E6VB 4G65A 3ZZZA 3Q2TC 1YTYA 4OIQF 3IWLA 4DL6A 3CDLA 1X4FA 1Z4UA 3R7SB 1QTMA 3SCKE 2A07F 4A0ZA 4DQSA 3K70D 4F3MA 5A0YA 2XLJA 1DJ0A 1NKBA 4JP0A 3CUQC 3PFEA 1ZRDA 1HNVA 4HA8A 1GV2A 5DM6F 1EQ0A 5ETRA 4U6PA 4EGYA 3FM5A 2W01A 4MFBA 4ED0A 2ECCA 5B09A 2RT3A 2Z58B 3OY9A 1E6VA 3PIOF 1WHWA 2JSXA 4HV5A 3Q24A 4O4RA 4XDCA 1YVFA 2E9RX 3GV5B 2VL8A 4E7JA 2EWNA 2CJQA 2MBFA 3H9JA 4UXNA 3GV8B 3C6TB 3S3NA 4ZPDA 3OYBA 2W4SA 4DYRA 2CPEA 3BG3A 1U2RA 3N4WA 2GZWA 4XN3A 4K2EA 1XSVA 2K40A 3BT9A 3WX4A 5F8NA 2IBKA 2W85A 2YVSA 4DCOB 1TQPA 1IWAA 3TUJC 2O8XA 5B7WA 2HHHF 4RO0A 1VDHA 1I39A 4BXXJ 3MR7A 1EETA 3C6TA 2QBYB 1TFYA 4I7FB 4P96A 2Q8KA 4KFCA 1RBAA 4F0KA 3OYMA 1JTYA 4EJOA 2ZVIA 3W2AA 2QKLB 4BL0B 4KMFA 1EKSA 1QZEA 2YPRA 1IR2A 4HL9A 2YNGB 5LEJA 1S6OA 2ZKUA 2E44A 1N33J 1OSDA 2P2CB 2MKCA 3PYGA 2CJYB 2ZXIA 3K5NA 1X0PA 2FRHA 3LAPA 2A69F 3K57A 1BL0A 4JV2A 2QBYA 2EK5A 4XONA 2STTA 4I7FA 2K7LA 1HBOB 4G12A 4GGGA 4BBRJ 2J8SA 4M5DB 4PJMA 3H8YA 3N9UC 1GHCA 2LY9A 1HNWJ 5J1UA 2FJWA 4FXWA 1ZLKA 4WBFA 3CJTB 4EM0B 5B0CA 1UVNA 1NG6A 3FCWA 1OS5A 2DDAA 4DQPA 4OWRB 2OSQA 4F92B 3N01A 4A3EJ 3MKYB 1RTHA 2DMPA 2DRDA 5J2QA 3JRHA 1FNOA 5IXUA 1D1CA 2VKZG 3IO1A 3TEGA 2RNGA 4CNZA 3CVKA 2MSYA 2ZB9A 1HBOA 4M5DA 1ODDA 4DL7A 1XSXA 3ILIA 2KKHA 3QP6A 1I94F 1XC5A 3CJTA 2HFNA 1TW3A 1IBCB 3AJ1A 2FVRA 2FLPA 2M52A 2I10A 4CGZA 4ED6A 4LSLA 4ZN1A 3B8HA 2QWWA 1I27A 3RTRA 1Z77A 1UG0A 3THVA 1QM9A 2XO7A 4F7ZA 5G4DA 4X0GA 2X7IA 1WG1A 3S93A 1Q8IA 3J7AY 2GBYA 1ZAOA 2RRBA 3CT9A 1QU3A 2E5GA 2L5QA 1BLUA 2A3JA 3BV8A 1MJAA 5HDKA 5IT9Y 4NASA 3BYRA 4W4MA 3OHBA 1NPPA 2RU9A 4A6DA 1PIEA 3Q89A 2O8KA 2HNHA 3FKIJ 2Y75A 3GCMA 2Y0SA 2P5KA 2BBEA 3A3OB 5KFIA 2UUCJ 2XAGA 1HBMB 1H6KX 3LSGA 2E60A 4UUWA 3UQSA 1GUUA 2UU9F 2HZDA 4C6AA 2OD5A 5B5EC 3R5CA 2YNIA 3EYZA 4NLQA 2ZFHA 2JPBA 2RC4A 4ELVA 3O3KA 1WKLA 1VK3A 4IOBA 4OI6A 2WBMA 1K44A 4XNFA 1FMWA 2HPIA 2SXLA 4G1QB 4AD9A 3QT8A 4WK8F 3SV4A 4NLVA 1X1PA 1GMWA 4FF1A 2EC2A 2V2VA 1RWNB 3KK3B 2JPCA 1N4LA 3V4IB 4DLGA 4G1PA 4PFOA 4LR9A 2D45A 4J9OA 1XMOJ 2FHOB 4I6WA 1HR0J 2MXYA 2K9NA 5CZVA 3R4KA 1A6IA 4AVPA 5HNHA 1EZZB 2WAQD