2VOPA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
EKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 51
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vopA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vopA02
2VT3A 4WKRA 2CPHA 5JFRA 2EV5A 5E17F 3I56S 2HZTA 1XN7A 4BNCA 2FBHA 1S3JA 3FMRA 1OPCA 2KRRA 3WTWC 3H3ZA 1W7PB 1A04A 3R60A 3I53A 1NJIT 1HW5A 5LRRA 4KIGA 5DDQC 4HV5A 4I0BA 4RAYA 2XS2A 1SD5A 2DT5A 1OKRA 5JHUA 1WI8A 1FJ7A 2ZJQQ 1K78A 4EJTA 3LFKA 1WF1A 3TO7A 3LWFA 3BROA 2GQQA 2DHGA 4ESFA 3WE2A 1VQMS 2A6HF 2KG1A 2RUGA 4YIIA 1N52B 2FE3A 4OZ1A 5E8GA 2HGMA 2W57A 1A7GE 2FEZA 2MZTA 3GFIA 1BI3A 4XSZF 1PO6A 3I4PA 4PZJA 3FMQA 1X5PA 3NNAA 2RRBA 2CQ4A 2NYXA 2DQLA 2ZBKA 3G8TA 1UHWA 3JTHA 2ISYA 2CSOA 2DK8A 2X1AA 2O8XA 4G7ZF 2L08A 3EQLF 1S7OA 2P6SA 4Z2XA 1ZHFA 3CC4S 2ERRA 1P2FA 1SJFA 2D9PA 1WI9A 1D8ZA 1N54B 1I1SA 4U0VA 1RKJA 3HTSB 2MZRA 2LA6A 2M1BA 2J5PA 3JAMZ 5DM7Q 2IA0A 2PEXA 3VODA 3LA2A 3WTVC 5AONA 1G4DA 1XDUA 1G6NA 2MSSA 4M9ZA 1YW7A 1WQ2A 4L5IA 4ZKAA 3CLOA 1I5ZA 3S8SA 2FNPA 2A69F 6PAXA 3NS5A 5GAGU 3M7GA 2D2WA 2PFBA 1HBXG 3EDPA 2A07F 1FYKA 1JJHA 2A3JA 2ZMEB 2W25A 2Z9OA 4A2UA 2QFJA 1YJ9S 5ICEA 4N9HA 3V7CA 4O6JA 3I58A 4RB2C 2MLKA 2P8TA 3P3DA 1XCVA 2M70A 3U1DA 2OA4A 4A0ZA 1O3TA 2MD5A 3CCUS 4Y15A 4RU2A 2P5LC 3EYIA 1UCRA 3PQJA 2EVZA 5CJ9A 4HQEA 4F26A 3WTZA 1SFXA 1LDDA 1UFWA 1WI6A 3R4KA 3R0AA 3TKYA 1UAWA 2LKPA 1OMIA 4KA4A 2CPJA 5GAEU 2XAQA 3MAJA 2KXFA 2PMHA 3IRRA 2F3JA 1ZRCA 2MXYA 2DNMA 2KKOA 1J2XA 3V8LA 4S04A 3V8KA 3BJ6A 2QYOA 1F5TA 2ZJPQ 5FD6A 2M88A 3JAMK 2MZJA 1X5OA 1P4XA 2X0LA 4G94A 2QQBA 2NS0A 3GFLA 1IRFA 1EH7A 4MEXF 1HD0A 3Q5FA 4U0WA 2CQIA 4A8XA 4WFAQ 2KXHA 2CFXA 1U1RA 1P4AA 3U1LA 3RKWA 3UD4P 3H2UB 3I55S 1IF1A 4LD5A 1O0PA 2RDPA 4GO1A 4IHSA 1X5SA 2RU3A 2M7SA 2DGUA 3MEXA 2J76E 2VE9A 4TU9A 1DPRA 5HLHA 1QBJA 4XLNF 3GX4X 5LSLA 5K5QA 2DNZA 3VAFA 3CC7S 3IWNC 1U1QA 1G3SA 3IKTA 4P96A 3IWZA 1TQPA 2UZKA 3F22A 3LQQA 1BC7C 2EV6A 5CXTA 2KI2A 4ASNA 2NAZA 3F6VA 2HDCA 3DP7A 2F9JA 3R61A 1DZ5A 1O7FA 2EA4A 4M73A 4KICA 2PMUA 3M9AA 4XRFA 1L3KA 1LEAA 4EM0B 2QLZA 2HVZA 3VFZA 1OWXA 2K4JA 2L41A 1B9MA 3E3VA 4B8XA 1FXLA 3FM3A 3S01A 1DDNA 5IM0A 1CVJA 1W2BR 1AWCA 1VQKS 3SDEA 4RGSA 1KU7A 4EJOA 2VC1A 3FZVA 3HSFA 5DM6Q 2G7UA 2KJCA 4LGWA 1B4AA 4GCVA 2FQ3A 3QPTA 4L9NA 2FHOB 3SMZA 3EETA 3CO7C 2DK2A 3CCJS 3VAMA 3P5TL 3NNHA 3BDDA 2ELHA 4EVIA 1L3LA 5LXRA 2RN7A 2MY8A 2MZSA 2NRAC 1U1MA 4OIRF 2CGPA 5FFZA 1ZGJA 2LNBA 3F8FA 1GXQA 2H94A 1OIAA 2CQBA 2HR3A 1QGPA 5CVJA 1Q86T 4PKDB 5L3BA 5ERIA 3REOA 1FHTA 4WCGA 3DXJF 2EB7A 5D6FA 3THPA 2CQKA 3VAGA 1X0FA 1IW7F 1WEXA 1Q1HA 3LAPA 2BYVE 3IHUA 1MJBA 1XGOA 2IPQX 2HEOA 3KZYA 1XDSA 2PN6A 4CGZA 2RV8A 3KLNA 1TW3A 3LAJA 1P1TA 1O3QA 2CPYA 2OD5A 4XBFA 1RNLA 4R1HA 1P27B 3P6YC 3KP4A 4G7OF 2AD9A 4ZZDA 4G8XA 2L4AA 4WFNQ 4V19X 3M8FA 3ML6A 1Z9CA 4ON0A 3CCVS 2DQRA 4A5NA 3BO3A 2DNNA 2H6CA 2MLGA 1ON1A 4HDVA 3FM5A 1R22A 2WV0A 2U2FA 1AUDA 3FHZA 1KC8T 1J5YA 1SD4A 1X4HA 5DCMB 4WF2A 4MQ9F 3GUDA 5BS6A 4MTEA 4G6QA 1KU9A 2H27A 3HRSA 5FB2A 4UVBA 1H2VZ 2G0CA 4A5MA 4Y13A 1CF7B 5L3CA 1ZLJA 3HRMA 2CPEA 3BZ6A 2PQ8A 3J81Z 4BHBA 2MC3A 3O2PE 5EEHA 3BO2A 1VQPS 3KP2A 3L2CA 3SFZA 2W85A 3QU6A 1WG1A 2D1VA 4ZZLA 3ECOA 2DH9A 3I64A 3CCQS 4LLLA 4CO8A 3EX7B 2EV0A 1FLIA 3CCSS 3T0YA 5HOOA 5E18F 5H6RA 2XS7A 3ZMZA 1KQ8A 1LDKB 2EFPA 2M5WA 5DD4A 3BO4A 2Y48A 1VQLS 1U5TC 2QM3A 3Q2SC 2CQDA 1OO0B 2LEBA 2HYFA 4YUDA 1RUOA 2YX7A 2KN4A 4IOCQ 1BIAA 1HD1A 4S05A 4NHJA 3GO5A 3UCZP 1QQIA 3WU1B 3R0JA 2DTRA 2K02A 2XHKA 2DNRA 4C4WA 2V1DA 1M90T 4CICA 3CXCR 1OYWA 2EFNA 4A6EA 2QA4S 4ENKA 1ZRFA 2V1UA 2Q0OA 5HLGA 2QUFA 2YKAA 1R00A 1OYIA 4I02A 3E6DA 1YG2A 2VBYA 4OIOF 2MYFA 3B02A 1XMAA 2ESHA 3T1BA 3K1NA 1FSHA 1MJAA 3OW2R 2NLWA 3IWFA 3RKYA 4PRFA 2DNHA 1FZPB 1XMKA 3BPXA 2N82B 4P9FA 4KMFA 1H9GA 3JSOA 2AS5F 2E7XA 1I6XA 4FT8A 2GA2A 1KOOA 1Q81T 2YU3A 4JQFA 3V7SA 2OIHA 1VQNS 3QU3A 2UWMA 1BI0A 1UP1A 5LRSA 4IPAA 5IQQA 3CO6C 4HV6A 5E1XA 1U1NA 1XSVA 1STZA 4U88A 4HYEA 4Q4ZF 2SXLA 2XAHA 2CPDA 3E5UA 4CZZA 1IAWA 3J7AO 4OMYA 4EGYA 2DGVA 2FSWA 3IC7A 1SFUA 1YYVA 2OQGA 1M5VC 5ICGA 3CDHA 2YH1A 4IUFA 1DPUA 1ON2A 1YTYA 4LG0A 4U0YA 1BM9A 2VE8A 1RZ4A 2MY7A 4AIKA 1Q7YT 1D9AA 1L0OC 4PGGA 1H0MA 4M5DB 1VQOS 3VAKA 2K86A 2M52A 1KYZA 1EH6A 4ZYGA 2HYIB 2CG4A 3B4MA 1ZZNA 3F8CA 2YWKA 2XIGA 4EM1A 2HOEA 4HA8A 5HVQC 2COMA 1K7AA 2DB1A 1U78A 3DF8A 2LKZA 3F8BA 2F2EA 1HA1A 4I7HA 3ZQ7A 3RDIA 1WTBA 2FBKA 3I59A 4MNUA 4LIRA 1XGNA 2EJRA 1J7KA 3U2RA 2W84A 2Z3YA 2DNKA 1WG4A 1TNSA 4PGHA 2CQ1A 2L9WA 1PDNC 2OQRA 1DBDA 3E6BA 2HGLA 2FF4A 2QBYB 2X1FA 2VOPA 2VBWA 5IT3A 4OINF 5ITHA 5LGUA 1D8JA 4I2OA 4EJUA 3HOSA 2N7CA 3H3UA 1FT8A 3E5QA 3V4GA 3TO9A 1R8PA 3EUHA 5BPIA 1T38A 2BE5F 3CCES 2RT3A 1VC5A 4O3MA 1R58A 4ESJA 2KG0A 3O3KA 1ZG3A 4HX4A 1YO5C 4HF0A 3HUGA 2XKPA 3KEOA 2O3DA 2FA5A 4W92B 1UB9A 2DW4A 1IXSB 1FYLA 2LECA 2KHCA 4K2EA 3G3ZA 3ABTA 3I54A 1KQ0A 5TRDA 3RYRA 2XRNA 2CPZA 2Z99A 3HI9A 4HW0A 2PJPA 3JSPA 1WEYA 2ADBA 4L0YB 1JXSA 2K27A 2L4MA 2XAFA 2MH2A 4C0OC 1W5TA 3RYPA 1NU4A 1K9MT 4EGLA 1QPMA 5FD5A 3EGNA 4I98B 4BQAA 2JRSA 5FLXK 2IW5A 1R1TA 2LEAA 4WXCA 1SMTA 1WELA 1Q82T 5HDKA 1V4RA 4D0PA 2HGCA 3CUQB 2MQPA 3WGHA 4RB3C 2L54A 5EEGA 1RIOH 2DO7A 5F1RA 2M45A 3OOPA 3GLXA 2IT0A 1O3SA 2XVCA 2JT1A 4YFNF 2DNPA 5HDGA 3KLOA 1P92A 4EGZA 4WF9Q 1U1KA 1ZZFA 4UV8A 5DD8A 3N4MA 4IHTA 4M6YA 1ZRDA 1QO0D 2MGZA 1MJ9A 2QQ9A 5BMZA 4IRIA 3P7NA 2CPIA 4HX8A 2PG4A 4EJVA 4ZH4F 1KOHA 1QZYA 3N9UC 1YWXA 3FWEA 4A12A 2IA1A 1B59A 2GXBA 1F4KA 4ENNA 1SJ4P 2E5HA 2GWRA 2MKIA 3ULHA 2DIUA 2IP2A 5IM0B 5IT9K 4RGUA 1BBYA 4FX0A 1GXPA 3D5LA 1R1UA 2K7LA 2V1XA 4EM2A 2BBYA 3SDEB 4AWXB 3US5A 1LQ1A 3GVAA 2P7VB 1J9IA 2RQCA 4PCQA 1FC3A 2DNOA 1MD0A 2FNAA 1A9NB 1R5GA 2J8AA 2EA2A 5ILSA 2FBIA 1FP2A 4U7DA 3G73A 1MKMA 3Q9VA 4WXDA 2M2BA 3BEGB 5HDNA 3NNCA 1K6OA 2ZKZA 3T5XA 4KIFA 1DUXC 1QM9A 2MJNA 4QQBA 1ULYA 3GW2A 3I0TA 1O3RA 4P5OA 1FBUA 1BOAA 4UNOA 5D5XB 1HL6A 3TO6A 1F9FA 2OZ6A 1FYMA 5HLIA 2DISA 1Y0UA 2V6CA 2I38A 2ACJA 2CJKA 5J6XA 3HIFA 1ONVA 2D45A 1WSUA 2MHNA 2ZJRQ 1IN7A 2X1BA 1JMTA 4AIJA 3G9CA 2FOKA 1JJ4A 1M5OC 3SQNA 4HZFA 2XSFA 2DPUA 1W7PA 1HSTA 3W6KB 3H92A 3CF5Q 3MCZA 3LA3A 3TOAA 2E5GA 1B6AA 2XROA 3E6CC 2FC9A 5DDPC 2E44A 2DHSA 1LVAA 4IRHA 2MQNA 3D0SA 3F23A 2OTLS 4YOEA 2ADUA 2UP1A 3ZMSA 5HL7Q 2CQCA 3KCCA 3D2WA 3KP7A 2NNYA 2OU2A 4Y17A 4CH0S 1Z6TA 4N0BA 5CVIA 2RNJA 3WTTC 1URNA 2Q2EA 4RS8A 5K5OA 1JHHA 4UUVA 3CULA 1H9TA 3VAHA 2QVOA 1LDJA 3EYYA 1IN6A 1RI7A 3R1HA 1K73T 2U1AA 4FXVA 2MKHA 5LJ3Y 1SJRA 5D4RA 3DPLC 2JSCA 3T8RA 3MXHP 3ZMDA 3HRUA 3U9GA 3VALA 2D3OR 3PIOQ 2WC2A 5ILVA 2XGXA 3CUQC 4MHGA 4ESBA 1IRGA 4BHPA 2CWEA 3BPVA 2GAUA 5DCFA 2JX2A 4OZ0A 2LCWA 3UCUP 4Q47A 2RQPA 4F02A 2G4BA 1HW1A 2PEHA 4C7QA 2M0GB 1UW4A 2L01A 4AD9A 5D5UB 1VC6A 1N88A 2MMYA 2CQPA 1KA8A 2CQGA 5JR3A 3QAHA 3O6BB 2QWWA 5D5WB 1KU3A 1S29A 4JK1X 1YIOA 3MI7X 3MUVP 1FJCA 2D1HA 1JE8A 2MZ1A 3CCMS 2VXZA 1IZ1A 4WIIA 3HHHA 4A6DA 3CUOA 2EK5A 2OSRA 2DNYA 2Z5UA 4M74A 5E8IA 4CYDA 5BPDA 2ZMEA 2Z33A 2CYYA 4CIOA 5HS8A 1T98A 1K8AT 2K8GA 3TP2A 2IVMA 3ELKA 2EFOA 1ZGAA 5L3EA 2RGVA 4M9SA 3KP6A 5LLQA 3HTUA 1MDMB 2HTSA 2Y75A 4H0EA 3HSEA 3GF2A 5LHIA 2LDUA 1IQTA 2DO4A 2VC0A 5D5VB 1I27A 1T39A 2OTJS 5F6FA 3CCLS 2FRHA 5LBQA 5BOXA 3F8MA 4M72A 3E6MA 1D3YA 1H2UX 3BJAA 1QNTA 2F5FA 4LLGF 2J0SD 2LSOA 2GIVA 2X1GA 1O7LA 3VOEA 2JPBA 5L3DA 4EV0A 2DHAA 2DGQA 1X4FA 2ZFWA 5DYMA 3VAJA 3JTGA 5E1ZB 2F9DA 4PDKA 1BIBA 3DQVC 4LG0B 1XGMA 1FNNA 1U6GA 2A6EF 4HAMA 3ZMUA 4YB1P 3GZ5A 1VQ4S 2Q8KA 4KIBA 3KEQA 4BAYA 3V7RA 4R8HA 4L5JA 2V9VA 4HBLA 2RKHA 1RK8A 4AIHA 1U1OA 3DPTA 3MFKA 4KFCA 4TLQA 2STWA 3QP5A 5D4SA 1LJ9A 5L3GA 2IRFG 3NMRA 3WTXC 3H2VE 4TU7A 4A0YA 3PIPQ 3SHFA 5H6QA 3GZ6A 4OMZA 1E2XA 2DPDA 2M87A 3ISPA 3RKXA 2AYEA 3HHGA 1J0RA 3BWGA 3TOBA 3WGIA 1DRZA 3WTSC 1R23A 3I59B 5D6EA 4UXNA 2KIFA 1DHMA 1TQMA 1XGSA 3G71S 3CD6S 3THTA 5JVGQ 4DQ2A 2CPFA 3CC2S 4RGRA 1OPIA 2JTVA 3K0JA 1KGSA 3AAFA 2DNQA 3J7YU 1SMYF 2A3SA 5DUKA 3HOTA 3DFGA 3CPWR 4YFXF 2DO0A 2MSTA 5JVHQ 2EWNA 4IO9Q 2P4WA 1U5TA 3F8NA 4I0AA 5E20A 1K78B 3K1MA 2HS5A 1VQ8S 2CO5A 3ULQB 1YFHA 3MD1A 2MBFA 4U7BA 5HS9A 2E5IA 1D5VA 2HYGD 4ERDA 1TBXA 1ZG5A 2W24A 2E1CA 4LK0F 2N3OA 4MQVA 1YS6A 2G9WA 2ZNYA 2M4MA 3S6EA 1ZH5A 4F25A 5CVUA 5K1YA 1IXCA 3L09A 3V8JA 1U6FA 3OV8A 3F72A 3RW6A 5DDOC 4OOIA 1YS7A 1M5KC 2MB0B 1HW2A 2MQLA 1S7AA 5GADU 1U2FA 1HKTA 4BHCA 1R36A 2JWNA 2A61A 3RPQA 2Y0MA 1BY9A 4DNCA 5KK1A 4P9UA 3LQRA 2XKOA 1B7FA 1ZLKA 4LMZA 1C0WA 1YHQS 5ICCA 5BQTA 3P49B 1X4CA 3BS9A 4WCEQ 4QWQA 2MPUA 3WTYC 4W90B 3J80K 2YX4A 2JZYA 1VQ7S 3N97A 5JVTA 4HDUA 4LJZF 2LF7A 3LPYA 5A2QK 2DGSA 2WBRA 3IRQA 2XS5A 1J75A 2MGZB 2A68F 4Q48A 3GWZA 4RB0A 1IN4A 4U67Q 3KE2A 1FX7A 3ZMVA 2WWYA 4LLNA 2E7WA 3UCGA 2BEOA 2AYMA 2M8DB 4QU7A 2BOPA 2LQ5A 3KZZA 1U8RA 4B09A 2OZUA 2RS2A 3MZYA 1Z1DA 4FXWA 4ZYDA 2DAOA 3M8EA 2MKCA 3ZMTA 2XAGA 5FLXZ 1U6BA 4NB5A 2ZNZA 3BJOA 5BJRA 1BI1A 3G6ES 1QZZA 3L7WA 4UVCA 4KT5C 2I2YA 1HKSA 4LFUA 4Y0FA 1N8RT 1K79A 3CMES 2YTCA 2H6BA 2F5CA 3MQ0A 3FEYB 1SD6A 1FSEA 3ROUA 1KQ9A 3K2ZA 4L9JA 5LEKA 2ZO4A 2Q79A 1M5PC 1FP1D 2ETHA 2LF8A 4KN7X 3JW4A 2YR2A 1TW2A 4JBAA 3MUTP 2DBBA 3ZZZA 2XNRA 1SXLA 1YW9A 2CQHA 2GHPA 1P4WA 5AIQA 2ZXJA 4HQMA 1JHFA 5IT9Z 2ZCWA 2MJUA 2FC8A 2DGTA 4FHTA 2PBIA 2DFIA 4MEYF 2LMIA 4EQQA 2G7HA 2GA1A 2EK1A 4UQTA 5ED4A 2YSRA 3TDUC 3DV8A 2MQOA 3NQOA 2HKXA 1YJWS 2MKJA 1TNTA 4M6XA 1R5HA 1T6SA 3ABUA 1JGSA 2O0YA 1W4MA 4HOBA 2BZ2A 2BGCA 2FXAA 4EMSA 2MZQA 2UXNA 3IL2A 3CUNA 2VBZA 1ZAOA 1FWZA 1SJQA 4OU0A 2KT5A 1BN5A 1WRJA 3R27A 2CW0F 1MGTA 4IF4A 5CVRA 2GXGA 1KQSR 4RAZA 1B1BA 4YG2F 5L3FA 3MURP 1REPC 2A5YB 4WFBQ 2EFWA 2VBXA 5ICFA 4Y00A 1H2TZ 3KP5A 3B73A 1WEZA 3P9IA 2VONA 4EJWA 5DETA 3MUMP 3E97A 4CDGA 1ZG1A 3FXRA 3VB2A 3GFJA 5CYVA 4LJMA 3RIRA 4IXAA 5F64A 1VTNC 3DKWA 2QEXS 1T0FA 2L3DA 2R3SA 4GXOA 5DUIA 2KFYA 1LNWA 2MA3A 4ENJA 1KU2A 5D77A 1USTA 4YFKF 1SJ3P 2QZ8A 4CXFA 2P7CB 2MKKA 3DEUA 2NZ4A 1S72S 2JVRA 1FBSA 1U1LA 5FGMA 5LGNA 1IUYA 5GVQA 3HHNB 2YH0A 1GVJA 1WKMA 1T2KA 2LXIA 2FY1A 1U3EM 4NQWA 3WTUC 2RVCA 3ZPLA 4G7HF 4L18B 4ZYEA 3CJNA 1TQIA 3L00A 3SXLA 1UFMA 5FFXA 2TDXA 3I71A 4L9TA 1FY7A 3M1EA 1WWHA 3FX3A 5LGTA 5LEJA 2GZWA 2OAZA 1YI2S 3MZHA 3LSTA 5D8KB 1YQAA 1VQ6S 4Q5SF 2DITA 4HLXA 2XASA 1M1KT 3RJPA 2KM8B 1Z7UA 2KRFA 1R8HA 1SD7A 2RC4A 2HWVA 1Z05A 1PUEE 1J59A 4LB6B 1G3TA 3Q9SA 1QVGR 2QBYA 1WHYA 3DXBA 4CH1A 4M9XA 1WHXA 4GYGA 3KETA 3R6SA 3UD3P 1TTYA 2H09A 1WF0A 4OIQF 2L02A 5HO4A 2VT2A 2HTJA 1VQ5S 5AIPA 2JVOA 2FMLA 1ZREA 3UWTA 3ECHA 3T8TA 2XNQA 4RGXA 3SZPA 4I01A 2AYBA 3FXUA 3SXYA 3BP8A 2DH8A 1WG5A 1F1ZA 2KU7A 2KRBA 1H6KX 2FMYA 2QENA 1WHVA 1Z6RA 1HSJA 2HKOA 4ENMA 2EFQA 4KMUX 3C3WA 1S6LA 3U1MA 1IN8A 2DLLA 2MQMA 2J5OA 2OBPA 5H1SV 4MGRA 4Z2YA 2DGOA 4P6QA 1UHMA 5TJJA 3VEPA 1NO8A 1X4EA 1YITS 4F7ZA 2MKSA 1USSA 3HSRA 4WWCA 1BI2A 1RUNA 1GHCA 1VBYA 2DIVA 3WE3A 2EK6A 2IJLA 3WGGA 2FPHX 3CUQA 5DV5A 3W6JB 1FO1A 1V3FA 3EGZA 1HXDA 4KNYA 2R7FA 1VBZA 1FT9A 2KVIA 1QVFR 1R1VA 2NNNA 2CQ2A 1LB2A 1XN9A 1CGPA 1JJ2R 1G3WA 3F6OA 1X4GA 1NHAA 3PFIA 3FMSA 1LEBA 1VBXA 1U5TB 3PQKA 5CLSA 4BYYA 1AOYA 5LXYA 4TV7A 2V94A 4G6DA 1Z91A 1X4DA 2MH9A 4OIPF 2K3KA 2KYXA 2F5EA 3B4DA 2ZJ2A 3J7ZT 3HRTA 4CQ1A 2YPRA 2LYVA 2JPCA 3NRVA 3WODF 3WU0A 2O61A 5IFMA 2R7DA 3LQVA 4LB5A 4KN4X 4WXHA 4HF2A 2RVJA 2OJ3A 2WTEA 4KDPA 1I1GA 3E5XA 4J5OA 2M8HA 3QOPA 3MOJB 2M30A 3MWMA 3K69A 1G2EA 4PR6A 3MDFA 2ISZA 1YW8A 5DEQA 3ZN0A 2LA4A 1EV7A 2DHXA 2MQQA 4IVNA 2KM8C 4I09A 3RI4A 1XSDA 3Q2TC 1S8NA 2N3LA 4BS2A 2VODA 2O3FA 2ADCA 4WK8F 2PE8A 4IJAA 4KUMA 4BH9A 5K5RA 2VN2A 4GYIA 5LHGA 4ZYHA 4UHTA 1B9NA 2FU4A 4HF1A 4WX9A 3RPUA 3QP6A 4QPTA 2PI0A 3COAC 2DNLA 3C18A 2VOOA 3TDZC 2CQ3A 3CTAA 2XV4S 4G9YA 2ESNA 2XUBA 3K0LA 2CQ0A 3KFWX 4RB1A 1ZN2A 1EH8A 3G96A 2HFHA 2P5VA 3F21A 1SAXA 4XSXF 2KIUA 1MZBA 1XD7A 1WWXA 2PLYA 4LMYA 2HQNA 2KH9A 3ZP5A 3G8SA 4CHUA 2LXUA 2DI3A 3C7JA 2C6YA 1YJNS 3G4SS 3CMAS 1IXRC 3KP3A 1WF2A 1HKQA 5DDRC 5FO5A 3S7RA 1O57A 1VC0A 4LK1F 3TYTA 2J0QD 2DU9A 4UY8T 2CPXA 3NEUA 1ZARA 4IOAQ 4HLYA 2HGNA 3WG9A 1WHWA 3R1LA 2QQAA 1SFEA 2HZCA 5GMKa 1X5TA 2RRAA 2UXXA 5LHHA 3ZN1A 2DH7A 1ZYRF 2DGWA 2B0LA 2IA2A 2M9KA 5JI6A 1U2WA 1X3UA 1XSXA 3J80Z 1BJAA 2E1NA 5CA5A 1HQCA 2XAJA 1G3YA 5CVVA 2F5DA 5A2QZ 2E5JA 1BC8C 3S2WA 4A0XA 3FEXB 3F3XA 5E1WA 1P6RA 5J8FA 5H20A 2V79A 1R7JA 2HQRA 1PP8F 3ERED 4E70A 2GO9A 2O6GE 3TO8A 1E17A 3BOQA 4AVPA 2G1DA 4GGGA 3DLLQ 4FX4A 3V4MA 2DK5A 1DP7P 2OSQA 3VF0B 4P55A 3ZZYA 1OR7A 1FBQA 4XLPF 3P9CA 1X4AA 4YIFA 2JRTA 3FF5A 2DGXA 2KXNB 3TGNA 3RW7A 5DDGA 2P5KA 5J8CA 3K9TA 5FJ4A 4M71A 2M8EA 3CTRA 3QRFF 5ILUA 3QPHA 2P6TA 1MDMA 1PP7U 5CYJA 2DNGA 2KIMA 4N9IA 1FJEB 1FNXH 2O03A 2RS8A 4QLCU 1KD1T 2AYGA 2XB2D 1XB4A 3HYIA 3J81K 2K4BA 3L9FA 1PGZA 1VQ9S 4UVAA 1D8KA 1IN5A 2RQ4A 2AXLA 1FPQA 1ODDA 2X4HA 3GYHX 3NS6A 4O5VA 5GAHU 3SZTA 5EN1A 1W5SA 3FXQA 1OYYA 4BXUA 5LSOA 3GEZA 3IKVA 3IRWP 3L3CA 3CCRS 4IRGA 4R79A 5KVRA 1S79A 2B0GA 3UE2A 1KYWA 4TU8A 3C1DA 4ED5A 3GFMA 4UV9A 3VAIA 1YIJS 3LA7A 3TQNA 3JB9k 1X4BA 2BV6A 1FOKA 1TLHB 2RNEA 1F9NA 4QU6A 4L0ZB 5D8LB 4L9VA 5HS7A 3GXOA 2STTA 3K1PA 4HX7A 4ETSA 4MTDA 3RTRA 1W7PD 1XCBA 5DCMA 4KYWA 5D78A 3P9KA 3BY6A 3I5UA 5LJ5Y 1CF7A 5MLCV 1YLFA 3MD3A 1U1PA 2D9OA 2KJBA
chains in the Genus database with same CATH superfamily
5FLVA 4WKRA 2N4DA 3GP9A 1PYVA 1A6IA 2EV5A 1XN7A 2FBHA 1S3JA 1OPCA 1VLOA 3ZTSA 3H3ZA 1RT7B 1T05B 1ROFA 3PJWA 5D0EA 4KSEB 3CMMA 2VG5B 2DA2A 2WBMA 2G0JA 1NJIT 4JI5F 4DWIA 5LRRA 4QYRA 2VQFF 1R4MB 1SD5A 3VWSA 1WI8A 2Z2MA 1EA3A 3L1PA 5KG1A 4EJTA 1D0ZA 4C2UA 1ULRA 1AA7A 2CDQA 3LWFA 2GQQA 2DHGA 3WE2A 4E7KA 2CQXA 2HIQA 1D1BA 3UNYA 4ECVA 1C4AA 2RUGA 1JKHA 4YIIA 3TOQA 4R0JA 4ECQA 1RWVB 2LP4A 5E8GA 3QYBA 2E29A 3BR2A 1T3OA 2GX8A 4IH7A 3CCUI 3GFIA 4I99C 4XSZF 4BY7J 3GBGA 2R8KA 1PO6A 3I4PA 4I0WA 3K8VA 3FMQA 3GTYX 1X5PA 3KK2A 2RRBA 2XWXA 2F63A 3FK4A 1LWFA 3WX4A 2DQLA 4YR0A 3MVPA 1JTYA 1XNRF 4KHPJ 5C4XJ 4G7ZF 4I68A 1BWVA 3QJLA 5ETPA 1F2HA 3JRDA 1X4PA 1ZHFA 1GX5A 1MMGA 2ERRA 5KAIC 2XI2A 1P2FA 2D9PA 2VDHA 1WI9A 1D8ZA 4U0VA 4ZVUB 3HTSB 1N36F 4N77A 4RJVA 2FHJD 3BZCA 3JAMZ 3MR2A 3HOXJ 2BA9A 3LSIA 1Q5VA 3GMEA 4U87A 1P7JA 4ZTFA 4DQRA 1XDUA 3RZOJ 1QVUA 1TC3C 4UUTA 3IGVA 3I55I 5GAGU 3GIRA 2PFBA 4KV8A 2QGFB 1FYKA 5M2UA 3GZ7A 1J5OB 3J7A1 1W2IA 1S6QA 2ZOMA 2Z9OA 4A2UA 3HHDA 4OZ3A 4O6JA 1Q5YA 4UOCA 4FPIA 2MYSA 2F4OB 2Z56B 5J1UA 4YELA 1HYSA 4G12A 2W9BB 2NVXJ 2HBRB 2L9SA 2P5LC 3EYIA 4DFJA 1RWNB 4U96A 5CJ9A 3LWMA 1TKZA 3FFIA 1Q8LA 1TR0A 4O0NA 1TUVA 1WI6A 2W2PP 3ZZUA 3TW6A 2LKPA 1TK5A 2RHQB 4KA4A 2HVEA 2CPJA 2VIHA 4B3OA 5F0HA 3EXYA 4RW7A 3MAJA 1ZA2B 4ED2A 2KXFA 1WD6A 1CLFA 3IRRA 4X62F 2M3DA 3HPOA 2MXYA 2XCAA 3PO5A 2R92J 2DNMA 4ZLNA 4ES2A 4S04A 1FMVA 2QYOA 4QIWN 2MZJA 4Q45A 5KG4A 1P4XA 4G94A 2HVQA 2NS0A 1B4SA 3E1SA 4DS5A 4R25A 5M2RA 1VRUB 1LK7A 3S1RJ 3KXDA 4MFBB 2OJED 4XIDA 5HVGA 2G0EA 2KXHA 3THVA 4DX8H 5FRMA 1JT0A 1QAYA 3F44A 3TJ9A 2FY8A 1T56A 2HOTA 3I0SB 4LD5A 3RAMA 2RDPA 4IHSA 1BL0A 5F04A 2ASDA 2ZB9A 2HFZA 2WAQN 2ZWPA 2H5EA 2J76E 2CJAA 5H9EK 3UN3A 4DCPB 1QBJA 3OYMA 3QBCA 1H74A 3VAFA 3OWTA 1U1QA 3GJSB 2PMZN 3PY8A 4I2QB 1N5YB 3LQQA 3DOMA 2EBGA 1YOVB 5A2QU 2KI2A 2NAZA 4ZJOA 2LKXA 2HDCA 3GTJJ 4LF8F 2F9JA 2F8EX 4ZVQB 3E2EA 3MEDB 3TWZA 4M73A 5HROA 2MDAA 5FKMA 3M9AA 3IM9A 3UQSA 4EM0B 1LOUA 3JCUC 3GIIA 2K4JA 4KB7A 2WOMB 1GTHA 3FM3A 3DBRB 3BTIA 2NR0A 1BHNA 2UVRA 5GMEA 4RGSA 3ZZRA 4BCAA 3TZXA 2HNZB 3OR2C 4B3XA 3HSFA 2KFNA 2G7UA 3SCIE 1B4AA 3OJUA 2FQ3A 1Y0NA 2HDDA 4NLUA 2FHOB 2M7AA 4GRIA 5B09A 3V6DB 2B7EA 3P5TL 2XMKA 3A1YG 2ELHA 3EYZA 3G1OA 5LXRA 3W9JA 4NZ6A 1VI0A 4RWXA 2R7UA 1VQPI 3QIPB 1SC3B 1ZGJA 3F8FA 1GXQA 3H0PA 2H94A 4NEYA 3K4JA 1OIAA 3M6XA 2UVUA 3HDDA 3O8GA 5CVJA 3KYLA 2F8HA 1Q86T 4B1RA 5LM7E 2VFSA 3GFXA 4HYKA 1B72B 2LY2A 3A01A 5D6FA 1T33A 3VAGA 3DRRA 1VRTB 4HT5A 2AU0A 3LMMA 2XCPA 2I10A 2XI3A 3JSRA 4NZ0A 4NMXA 3AXMA 3IHUA 1OCRH 1MJBA 4HPQA 2HEOA 2LD5A 2QSWA 4NCBA 6FDRA 3KG1A 3PV8A 1QSSA 1XDSA 2RV8A 2QA4I 3LAJA 1P1TA 3QODA 3BH7B 3HLUA 4YB6A 1RNLA 4R1HA 1RWUA 4G7OF 2KRCA 4QCLA 4ABZA 3HXLA 2DQRA 2D7SA 3PSIA 1W26A 4DV1F 4P75A 1NH7A 2QE5A 3X1LB 5A0YA 2XZTB 2I8EA 2NXEA 2BM0A 2YX1A 2LVWA 2CV2A 3AD7C 4FBUA 3I0RA 2WV0A 4LSNB 5DCMB 4WF2A 1VQNI 2VLAA 1KU9A 4DL0C 1GK8A 5JXSA 4IHVA 1RHJB 2HNDB 4URQU 2W8LA 3W5XA 3HRMA 4XLEA 1IV8A 4BHBA 3K5PA 3F56A 3CJ3A 3BO2A 4XORA 5I3UB 1FKPB 1NZ8A 1YZ6A 2IVYA 3PX6A 1X8DA 3CCQS 4CO8A 2YPYA 2GC8A 2LKSA 5H6RA 2Y1LB 2XS7A 1S49A 2ZBCA 1IRXA 3LP1A 2MD0A 2ZHOA 4DR3J 3RG6A 3Q2SC 5HMXA 2Q1LA 2KN4A 4IOCQ 1GT8A 1QAXA 1HD1A 4PEOA 4DV5J 4IFVB 2AZ3A 1S9EA 1QQIA 2NSCA 2DTRA 4ZPDA 1R9TJ 1M90T 2XMWA 3J80Y 3CXCR 2EFNA 2QCOA 2GM4A 3J81Y 4M5NA 3M2RB 4LF9F 1BUXA 1D0EA 2J0XA 1I6HJ 4ZP8A 3T1BA 2JK3A 1FSHA 1MJAA 4NA1A 3OW2R 5KFOA 3RKYA 2JEGA 2L7KA 1X1PA 1HIYA 4KHRA 1P6TA 3KOAA 2N82B 1DTTB 5KFSA 4KMFA 3OIQA 4FT8A 3ZQCA 3IO1A 4F0MA 2OC6A 5DTDA 2E19A 2NUHA 3KK3B 5HLFB 4DIQA 3VDXA 3KLGB 1UFKA 1UP1A 5LRSA 9ATCB 4PG8A 2R2SA 5IQQA 4G65A 1U1NA 2H3EB 4U88A 5DG7A 4O3RA 3MMAB 3CJ8A 4DYQA 1GEHA 3J7AO 1Q4RA 4EGYA 5CHCB 3S8PA 1RABB 3QT6A 3CJKB 4QIGA 3SCJE 1S9FA 2BJEA 2IJRA 5ETQA 3BJYA 2JUGA 4HSRA 1BGXT 2Q43A 2LBFB 1R49A 4UUXA 2YH1A 1DPUA 3JRIA 4CSWA 4B3AA 4U0YA 3M8PB 1LWCA 1IBMF 5A6WA 4PGGA 1N33J 1X2NA 1NK3P 2WVDA 1KYZA 2VASA 1TL4A 3MPDA 3MM8A 1EH6A 2HYIB 4RAGA 4FVCA 3VVUA 3HVRA 2NQPA 2YWKA 1RAIB 2WZ1A 4M63A 4J9QA 3SQGB 2COMA 2HU9A 1S1UA 2F5VA 3OY9A 5E3PA 1UJ8A 1RU1A 5CYMB 2VHGA 3ZQ7A 2RQQA 3PEJA 2HHQA 1WTBA 4J9SA 4M3FA 3AHPA 5CYQB 3OSGA 3QWUA 2Z3YA 1WG4A 1TNSA 2L9WA 1N34J 2BVMA 5DQGA 1ITYA 4GC6A 2DJIA 3BGOP 4ZN3A 2VJ5A 2X1FA 2NOGA 2WVFA 1S0MA 1D8JA 3PEHA 4I2OA 1FT8A 4UOHA 3V4GA 2OELA 4FXDA 4QJVA 2BE5F 3CCES 2BE2A 4O3MA 3ZZPA 4DR5F 4ESJA 3AD8C 5B0BA 2KG0A 5IT4A 1RLDA 5E79C 1WZ2A 1NRKA 1T02A 3BZKA 4X0GA 1NDLA 2DW4A 3B78A 2UVWA 4HKQA 3ABTA 1KQ0A 5TRDA 3PJRA 3ZNUA 2XRNA 3HI9A 2PJPA 4XQFA 2ZH3A 4L0YB 1YKWA 2XAFA 1NU4A 4DV4J 2JRSA 2IW5A 3BBFA 4YQWA 2ZJPF 2KJWA 1T95A 3OIPA 2VU5A 1V4RA 4BE1A 1HDDC 3EUKL 2HGCA 4RMNA 2MQPA 3HPHA 1LXJA 1FMWA 4I4BA 2Y8WA 2M45A 3GLXA 3BBBA 2OD6A 1FDBA 3DRXA 3LGNA 1O3SA 4ZIVA 2XVCA 1WJEA 4EGZA 2YKOA 3MMBA 3MFIA 3OFFA 5CPRB 4PWWA 2KDZA 5A8KB 4XRMA 3S1QJ 3BPSP 3GTLJ 2WAEA 3N4MA 1ZRDA 3A4TA 5DQHA 5T41A 3BKTA 2OTLI 3PNIA 2MGZA 2VUMJ 2ZHBA 1BR2A 4HX8A 4NOHA 4EJVA 4ZH4F 3ZCOA 5D3GA 1F4KA 2VKEA 1SJ4P 2E5HA 4O3PA 3UDEA 2IP2A 4EBEA 1BBYA 4FX0A 3MF5A 1BXNA 2I0XA 1R1UA 2C3MA 1B3TA 4HR2A 3GVAA 2P7VB 4ZLJA 1UVNA 3AAWB 5KG5A 1REGX 1Y4ZB 1MD0A 1CJVB 2GVDB 3EPZA 2FNAA 1A9NB 2J8AA 2EA2A 5IZHA 1BE4A 3D4JA 4OHZA 4FKYA 5A8WB 1SBRA 5HDNA 3NNCA 4IZZA 3RPUD 1GAOA 4NPOA 3M9NB 3T5XA 4KIFA 2MJNA 5KFPA 3GW2A 1H88C 3KLIB 1RZMA 4HLBA 3C2GA 1BOAA 4G3IA 2K85A 2PC6A 1SH3A 1G59A 2L7MP 2B3TB 2VPYB 1B70B 2QQ8A 1FYMA 4O4GB 3A8EA 3HULA 1VQSA 2I38A 2CJKA 3HIFA 3KTQA 2ZJRQ 1QHHD 4AIJA 4IKAA 3G9CA 1RGVA 2W82A 4HZFA 4UB8C 3NOCA 1I3AA 1R4NB 4LR8A 4G6TB 3LA3A 1YVFA 2DY1A 2FZGB 1B6AA 2XROA 2FC9A 3OS2A 4HI2A 1JGGA 4NYZA 2DHSA 3DRSB 2YKQA 3LPEA 1RKWA 2CQNA 3F23A 1FDAA 4YOEA 2UP1A 1UWBA 1HW9A 4IYQA 1N77A 1ZM3A 3H5RA 4DJBA 3CW2C 3GCMA 3P5BP 3R3TA 3JSBA 4P2MA 1HLWA 1MU2B 3FRZA 5CVIA 2EKYA 3WTTC 3DKDA 1URNA 1HA8A 4RS8A 3FXOA 3KKFA 1XEZA 4OYAA 4UUVA 3GTGJ 2CXEA 2QVOA 1LDJA 4A3CJ 3ZXWA 3D0GE 3R1HA 2HZAA 4XOTA 2UUBJ 1ACIA 4BKXA 1ZYQA 5LJ3Y 1NCLA 2AKWB 4FCYA 3H8YA 4LRFA 3U9GA 3VALA 2FYXA 4AE5A 2ZDOA 1RCOB 2XGXA 3T5HA 5GAHJ 1C1BA 3PR5B 4ZK7M 4I7FB 4CUGA 3ESWB 1A5JA 4BHPA 4JI3J 3BPVA 2GAUA 2DJNA 4F4WA 4II2A 3M32A 2BMBA 4Q47A 1HW1A 2PEHA 3FKIJ 2M0GB 1UW4A 2L01A 4OMFG 5D5UB 5BYSA 5K8NA 4V19J 2CQPA 3GYGA 2DFHA 3NMAA 1C0TB 1JE8A 1UVLA 2VXZA 3OR2A 3PW4A 3HHHA 2HQGA 3PL8A 2A10A 1RAJA 3KJVB 3CUOA 4G6VB 1VK8A 3S3NA 2Z5UA 4P9SA 3BCBA 5E8IA 3D5RC 2CYYA 2FHJA 5HS8A 2ZH2A 4Y33A 2A6TA 1T98A 1S5LC 4PYDA 1D3WA 3RB4A 4WBFA 1OJ4A 2AEFA 2ZSHB 1P1LA 5K8PA 2RGVA 1JXVA 3KP6A 5JLXA 2HFNA 4Z6YA 2FVPA 4IO9F 1SPBP 4CTAA 3GF2A 1IQTA 3GG1A 3MM7A 1NDKA 3KHRA 1S1TB 4O0IA 2O5RA 2DO4A 1VQLI 3RQIA 1T39A 4KIAA 3HT3A 1NB2A 1VFJA 3EM1A 2R5ZB 2GGPB 1VQ8I 3LWLA 4LLGF 2CMPA 2FJEB 3P45B 2JPBA 5L3DA 4EV0A 4ZCLA 4DR2J 2BM1A 2NS8A 2ZFWA 5DYMA 2X6WA 1N78A 4YY3J 3VAJA 5LL6d 5ETTA 3Q3SA 4FF4A 3DQVC 1F6TA 2A6EF 4HAMA 4O44A 3EUNA 3BQ1A 1E3OC 8ATCB 1SKSA 4ZVPB 5FKKA 5F8IA 4L5JA 4DYCA 4HBLA 1IUJA 1RK8A 4PFOA 2ZVSA 4DV2J 4KFCA 2STWA 3TARA 3NMRA 2JLFA 3WTXC 4GKKJ 3H2VE 2YNHA 5E41A 1KONA 4F4XA 2Y1JA 4OQJA 3VYRB 1BQMA 3RB6A 2DPDA 5C42A 2XAUA 4P2FA 4DSIA 3ISPA 3NWSA 3HHGA 3BWGA 3BG5A 1JLBA 3ZNJ1 5D6EA 3I59B 3GTQJ 2K9QA 2KIFA 3AQPA 3VGVA 3CD6S 4OV1A 2CJXB 1EKSA 3HM5A 1WC5A 2MEWA 4DZ6A 5LMUF 3DOLA 5TISC 2FJVA 3J7YU 4LFAF 4HHHA 2IM3A 1T3NA 2BUNA 2EWNA 1OSCA 1U09A 2C3UA 4I0AA 3HZEA 2HXOA 1UW9A 5KFVA 1HNIA 3R9LA 1YFHA 4UTGA 4DUZJ 4LF4F 3MD1A 2R93J 1RTHB 4MIBA 1YX3A 1Z3YA 4R0EA 2IGNA 2XMAA 1TFYA 2E1CA 3V2UC 5IYBJ 2XF7A 1UELB 3H9QA 2M4MA 1VMBA 2JMWA 5CVUA 3LSGA 2WW8A 1ZELA 4K4SA 2O01C 1W25A 4YHHF 2X3GA 3OV8A 4RKUC 2V34A 4JI5J 3NGRA 3CMEI 1SANA 2ELJA 2VQFJ 4PJLA 1LWFB 5GADU 1U2FA 1HKTA 1TMJA 1ZM9A 1T9XA 3CVKA 4QPQA 3NBPA 5KK1A 4H54A 1I6JA 3LQRA 4AYBA 4Y2IA 3F0NA 3QO9B 1H8AC 2DOFA 1DQ9A 5FLMJ 4NX9A 1NHVA 2VJIA 3BS9A 4WCEQ 2HVIA 2HS0A 1RBOB 2DCUB 4USKA 2YX4A 5JVTA 4HDUA 4LBHA 1JKRC 2QF7A 5A2QK 2DGSA 3UD5A 2XS5A 4DL7A 2A68F 4Q48A 2DR8A 1TV6B 4LRAA 2E2HJ 3H2LA 4U67Q 1FX7A 2Z30B 2FUG2 2LQ5A 1YJVA 1NMEB 4OYZA 4DR7F 1XNRJ 1U8RA 4KV8B 3RJMB 1PAUB 1WTFA 3NWTA 4C8YA 2BVLA 2DODA 1HCRA 1S6QB 5ETNA 4K4TA 2J7UA 2A5WA 4QPOA 3ZMTA 1HARA 1N36J 2XAGA 3BJOA 1OSDA 1JLFB 2R7QA 1UKUA 4OI2A 3LNQA 3CCZA 3S17J 2XLIA 1N8RT 2X51A 3FMBA 1TKZB 3TA1A 2LQ8A 2YTCA 4N5SA 2H6BA 4K4ZA 2F5CA 1UG0A 1TWHJ 5LEKA 3K2YA 2FZCB 3Q8UA 4D1QA 3GFYA 1I94F 2A2CA 1TTHB 2V50A 3M2VB 4OHWA 1FIAA 4RW7B 1TW2A 3MUTP 2MHEA 2DBBA 2OKQA 3KLEA 1RSCA 2XNRA 1S99A 3Q0UA 2CQHA 4N8NA 2H8WA 2GHPA 3OVBA 5FLXY 3CO0P 2QGUA 3QATA 4TXSA 4ZVSB 1UAAA 4FYWB 2MJUA 1YE9A 1X3ZB 2FC8A 2DGTA 4FHTA 3OHBA 2EZKA 2X6XA 4MEYF 2LMIA 3MKWB 1KEKA 2F5GA 2KT2A 3TDUC 2E1AA 4C0BA 3NQOA 2VG6B 1YJWS 1KFDA 4F2SA 4CO1A 4QWDA 1D0XA 3IXQA 1YI2I 2RU9A 3L7UA 2AF6A 3MMYB 5C4JJ 4X62J 2CWXA 2RHSB 1JGSA 4C3LA 4LOCA 3CJ0A 1VHFA 4K50A 2MZQA 1DURA 3GIJA 3RBEA 5IT9Y 5HK4A 2AQ4A 2J0WA 3CUNA 2MQ8A 2VBZA 1QUPA 1V5VA 2QLXA 1FWZA 4MK9A 3PO2J 3QIDA 2RF2A 1BN5A 4JX4A 1TL7A 2Q66A 3R27A 1RETA 3VSLA 1KQSR 1Q7LB 2ZFHA 3VCDA 4YG2F 5L3FA 3FBCA 3D3BJ 3A12A 5HROB 4LVNP 1H2TZ 2B6AB 2B7BB 2KL4A 2VONA 1JNZB 5BNGA 1YX2A 3DRPA 2HFSA 3VB2A 2R7OA 5F64A 1TU0B 2V8VA 1XNQF 2KDOA 2QEXS 2R3SA 4FS1A 4GXOA 5DUIA 3AQOA 2DKOB 2KFYA 3F41A 4ANDA 1KU2A 2DXEA 3KLFB 3JQKA 5C5JA 2P7CB 2HDWA 4DPXA 5EHHA 3HOWJ 4PUSA 2XHCA 1WVRA 3HJVA 3CE8A 1T2KA 4LVOP 2FY1A 1GDTA 4LF8J 1HI1A 2BBEA 5CD4A 3IBFB 1ELOA 2PA3A 1HPZA 2HFOA 4Y52J 3CDLA 1V5GA 2TDXA 3I71A 1FY7A 2L7ZA 3FX3A 4B9SA 2GZWA 3F0CA 2K1RA 4YDDB 1YQAA 2I9SA 2HPUA 1VQ6S 1V55H 3F9KA 1QE1B 1SL0A 4NNJA 1R8HA 1QJHA 1VRQC 4RZRA 5KFHA 3A01B 3IBCB 4GVBA 4Q5VA 3J7YJ 4LB6B 2LQ9A 3M6WA 1YDLA 2XB0X 4H4KC 3LP2A 2FJBB 2QBYA 3CCWA 3HOZJ 1WHYA 3DXBA 3I3LA 3SFGA 4OIQF 1OLTA 3QRPA 3QOEA 3DI6A 4FNHA 4WXWA 1VQ5S 3PSFA 4XKBA 1QY7A 3GV5B 3T8TA 2XNQA 2MKYA 1DY3A 4I01A 1UEUA 3ZOBA 4CI0B 3CIZA 5A0YB 2UXDF 1R0BG 4V19K 2YWFA 2KU7A 3D6HB 1WHVA 3LP0A 3I0RB 1MMSA 1RKIA 3EMTA 1S6LA 2KZVA 4F4AA 2YXLA 3U1MA 3K5NA 5GADJ 5IV4A 1MNMC 2K5CA 4X4UA 4Z2YA 4P6QA 3VEPA 5J2PA 4W97A 4DW6A 4NC8A 2B5JA 4F7ZA 2EINH 2R8GA 5GAGI 4WWCA 4ZVTB 3OFGA 5FDLA 1WDTA 2D3O1 5HNFA 2FPHX 2BX6A 3ZTRA 5DV5A 5AXNA 3W6JB 1NUEA 2OUMA 4K4XA 4KJZA 4KNYA 1PKUA 1FT9A 3GTKJ 4M3GA 1QVFR 2CQ2A 2NNNA 2FHKA 3BLYA 5A76A 2JHEA 5K5MA 1IN0A 4LF5J 3F6OA 4ZPAA 5SZTA 3TL4X 3ZRGA 3FMSA 4PABA 1LEBA 3GYXB 5CLSA 1S9EB 2IVFB 4G6DA 1X4DA 2ICWG 4HDGA 1MSWD 3ZTQA 2KYXA 3FXLA 4OIPF 3QAUA 3R5DA 4DFKA 4A3DJ 1G6BA 3R6GB 4IOAF 4ANCA 4E7JA 3NRVA 3CMAI 4HF2A 1LQ9A 2RVJA 4TY8A 5J1PA 3DTEA 1W0TA 4OZ5A 1TP7A 2X3DA 2BQUA 1FKOA 3MOJB 3CC2I 3W2VA 1G2EA 4B43A 1R3NA 3SSRA 2ZH4A 5DEQA 1BOBA 3AJ2A 2WVBA 2MQQA 1EV7A 1IKYB 4IOBA 5I4MA 2KM8C 4BWMA 4NASA 1HQEA 2N3LA 2VODA 4J9MA 4BBSJ 3KJNB 3FBIB 4LF9J 4IJAA 4KUMA 1N32F 1N75A 2F8MA 5K5RA 2VN2A 4GYIA 1AFJA 4ZYHA 4HF1A 3RPUA 4C30A 4F3MA 5KG7A 5K7HA 1CC8A 4QPTA 2PI0A 1JUMA 5LSRA 1G3OA 2O67A 2DTZA 2DNLA 3PM9A 4NBQA 3CTAA 2GAHC 4EZ9A 2FVCA 3HP6A 2E9TA 2M4KA 3SIPB 3K0LA 1IM4A 2CQ0A 3DYAA 3T5JA 4Q8FA 4RB1A 3RAXA 5KT2A 1ZN2A 1EH8A 2M2EA 3AT1B 1T9WA 3Q8YA 1MZBA 1WC0A 3HVTA 4DOZA 2RDIA 3QT5A 4IO1A 1WWXA 5DLFA 3ZP5A 1WORA 1A31A 3SZ2A 3FK6A 4CHUA 1KBRA 2LXUA 2VD3A 4M5LA 5F8MA 5EX0A 2F65A 3KP3A 4B9TA 1OCPA 4O23A 5FO5A 1KVKA 4OYIA 3BQYA 3NEUA 2DCLA 2VL8A 1UMJA 4WE1B 1HWUA 4G1PA 2DCEA 3PFEA 4OJ3A 3ITHA 3ZTOA 2DH7A 1IBMJ 4C98A 2M9KA 3TW7A 1X3UA 4OYPA 2X1EA 1RT4B 3FBBA 4I1TA 4F3QA 1G3YA 3KYDB 3PDNA 5G0RA 2XBPA 4B9NA 1X0PA 1TFWA 5E3LA 3R5JB 1PYOB 2IC3A 2QLFB 5IYCJ 4A0XA 3CDUA 4DJAA 3CCRI 3HFZB 4Y2MA 5JMNA 1YIJI 2KIQA 4C3IJ 3K7AJ 1SV5A 3BOQA 3DLEA 2CUYA 2VKDA 2HBQB 1HWKA 2ME6A 3DLLQ 3TP0A 4KT6A 1RADB 1BMQB 4C97A 2R2TA 3AY0A 2FD2A 1E0EA 2RIJA 3WQPA 4XLPF 1OMSA 2DGXA 4J9RA 2W4SA 4DQSA 1RC9A 1HBMA 3RW7A 3PG9A 5DDGA 5EF6A 4I69A 5ETRA 4CYUB 1CJTA 3A8JA 4C8MA 2KZGA 2VIXA 2BHZA 2L9NA 4DR5J 1E3PA 2JA7J 3G86A 4IH6A 2W01A 2JC0A 1RTZA 1CEZA 2PIIA 2KIMA 4N9IA 4D3GA 1Y5LB 1KD1T 2H48B 3M1CA 4QTRA 3HYIA 3CJQA 5EZHA 1PGZA 1VQ9S 2IEKA 1IN5A 2NPIA 3ZO7A 2AXLA 2CADA 5GTHC 3VR1A 2X4HA 2ROEA 3K58A 3MEGA 1TVRA 2GOXB 3OSNA 1R6RA 1D09B 2CUZA 3IRXA 2YQ1A 2G9OA 4J19A 3W3CA 1VQMI 4I6ZA 4LBIA 1LNQA 4K4VA 4YN3B 5KVRA 4BL0B 1CBKA 2W4CA 3M8SA 2CIMA 4TU8A 3C1DA 4UV9A 1FOWA 2WADA 1S48A 5CAAA 1Z2LA 2WTFA 4DMZA 4JI7J 4XLFA 2JA5J 4Q43A 3OQ2A 1FOKA 3ZZOA 1TLHB 4V1Ak 4LF7F 4NQWB 4L9VA 1D0YA 1B99A 3K1PA 3SEZA 3M8QA 3GYNA 5FRNA 2HNYA 3DGPB 1S4FA 3IV5A 4KYWA 4HSTA 2CUEA 2JEIA 3QQCD 1CF7A 5E0OA 3MD3A 1RTIA 2D9OA 2VT3A 1KQGB 1HDPA 1OQ6A 4DUYF 5JFRA 1R0AB 4DX7A 4OI1A 5JHFA 5E17F 1JB0C 3FMRA 3WTWC 2E1OA 5HMYA 3EUHC 4KIGA 3MTKA 1Y6IA 1H73A 2BANB 3S15J 4U8YA 1OKRA 5JHUA 2AMCB 1FJ7A 4QR1A 3BROA 4AUXA 5IT0A 2Z1DA 3SFIA 3RRGA 2A6HF 1XR6A 4LRCA 2LH9A 4FYXB 1IDYA 3CCTA 4HNVA 4OJGA 1OYEA 2EBIA 1F43A 2D5VA 3HK2A 2HGMA 1A7GE 3MR7A 3OL7A 3MPUB 3OXGA 4MIAA 5KFDA 1JUSA 1JJCB 3PYFA 1HW8A 2F4MB 2OPQB 4ZP6A 3NNAA 1FIPA 1G1XA 2JFKA 5DO2A 5IPAA 4NYOA 3OYHA 3GU0A 2NYXA 4RWWA 4B9VA 2F1FA 1H7XA 3C6UA 1UHWA 3CZ6A 3JTHA 2AHOB 3O1LA 2DK8A 2X1AA 1C1BB 2L08A 4OX9F 9ANTA 1Q53A 2P6SA 1IJFB 3A8KA 4Z2XA 2UV1A 3OYCA 2IJFA 1SJFA 3H40A 1N54B 1WI3A 3MEEA 2DR9A 2MZRA 2LA6A 3SJMA 1V3SA 3IAM2 1AHDP 2B9WA 8AT1B 2NVTJ 3PFYA 1DTQB 3CD5A 5DM7Q 2L9VA 2IA0A 4B3MF 2R7VA 3LA2A 4B4CA 2GVZB 3O44A 5D15A 2M0MA 3O6QA 2V4JC 1G6NA 2MSSA 5B0AA 2CV0A 4L5IA 1I5ZA 3G1LA 2A69F 3OR2B 6PAXA 4ED6A 4USVA 3JR9A 4J00A 2LU1A 1HBXG 1JJHA 3LOUA 4JI2F 1L3TA 3IP0A 1V3ZA 4YR3A 2P8IA 2B9YA 4P7VA 3EUAA 1YRXA 5H2FC 5ICEA 3V7CA 5D0GA 1E6VA 4F04B 4RB2C 3C19A 2P8TA 3CC7I 2Q3PA 4QYZK 3U1DA 4B9LA 4YP3A 2OA4A 3IM8A 2CRLA 2UUWA 1U0HA 3CCUS 3E7LA 4Y15A 4RU2A 3SSQA 5L8RC 4CTAB 2JEFA 4HQEA 1OYDA 2H5IB 4CLWA 3JRGA 3N5BA 4F26A 3WTZA 3L95X 1RQ0A 1YBTA 4ECSA 4PFPA 1UFWA 2H4YB 1U8SA 1X9SA 3TKYA 2V9KA 1OMIA 4H4KA 5HSPA 2BRKA 3RBXA 5GAEU 2XAQA 4XR6A 1ZRCA 2NUUG 3V8KA 2F4IA 4DX5A 1VQKI 1O51A 4O44B 1ERDA 2IS1A 1SCJB 1LFUP 1HD0A 1U2RA 3Q5FA 3HSDA 2QL7B 4NC6A 4A8XA 4WFAQ 2JJ4D 2CFXA 3H98A 3RKWA 3ASNH 2EKNA 3SCLE 3H2UB 3CCJI 1Y56A 2AGOA 3I55S 1IF1A 4IRKA 1X5SA 3JTPA 2DGUA 1F1BB 1BQMB 4UB6C 3MM5A 3MEXA 4EWTA 5C42B 1T03A 2GMLA 2AZ1A 3G1MA 5HLHA 2MC4A 3GX4X 1REVA 2J9CA 3GTOJ 4KITB 5LSLA 5TGTA 3IKTA 1RHQB 4P96A 4JP8A 3M4OJ 4I2PB 1TUWA 3IWZA 4CT9A 2EV6A 4CYCB 2XO6A 2AQEA 4ASNA 4DF4A 1S6PB 2HYJA 2JH3A 4ILRA 3KG4A 1T08B 2EA4A 3OPKA 5THWA 1L3KA 4XRFA 5KFMA 1MMLA 3C8YA 4DZDA 4FDFA 4F36A 4DX6A 2D3UA 2HVZA 3VFZA 4J9OA 3E3VA 4FQGA 3UR3C 6FD1A 1IDZA 3R6LB 4E98A 1NKCA 4YEAA 1AWCA 2WAFA 4AXIA 1KU7A 4BEHA 4ETXA 2VC1A 2KJCA 2HQDA 5LMUJ 4GCVA 4LG3A 3CT9A 4K8RA 3QPTA 4ZVHA 2ZMEC 4LFAJ 4KO0A 4ZN1A 1YQHA 2Z2YB 3AB2B 1UVMA 3QYFA 4PPZA 5J1RA 4EVIA 4MJKA 3PO4A 5ETMA 2MY8A 2MZSA 2NRAC 2FQQB 1U1MA 4LF4J 2W9CB 2ME0A 4DHVA 1VF9A 2M5YA 2DYSH 1JWWA 1QGPA 4NLDA 3FDYA 4I76A 4PKDB 2R0QC 2Q6CA 4OYMA 5KFYA 3BF4A 2R8HA 1FHTA 3BC8A 2J9DE 2JRMA 4WP8A 2LOOA 3EJMA 2CQKA 1WEXA 1MNDA 4YHHJ 3PX4A 3UDCA 2G13A 1Q1HA 5B1BH 1FA0A 3EDRB 3IR6B 2BYVE 5KFKA 3BKUA 1K6YA 4KQZA 4F67A 3KZYA 5J1EB 3W64A 2PN6A 2AO9A 1Y8RB 4UUSA 4CGZA 3KLNA 4IG3A 5L1LA 2LEPA 5J2QA 3ETMA 2CPYA 4WK3A 5I3PA 2OD5A 1Z21A 1P27B 2KJVA 4GFBA 4ZZDA 4WFNQ 3SBMA 3ML6A 2M8GX 4A5NA 3Q8VA 2W7PA 1ZPWX 4UZCA 2FJAB 5F8HA 4BDPA 2H6CA 3GIKA 4WU3A 1ON1A 1VZ0A 3FM5A 1MN9A 2E9RX 1R22A 1I51B 2U2FA 2V69A 3Q83A 4J9KA 1AKHB 1J5YA 1SD4A 3D0IE 4RU9A 2UUZA 3LALA 4G6QA 3RCOA 3SDGA 2H27A 3HRSA 2WSCC 4UVBA 1TL1A 3PJ9A 5KG6A 2VL1A 1WJAA 3HDSA 5L3CA 3PJXA 2CPEA 2PQ8A 3J81Z 2GJFA 4DR7J 5EEHA 2VQGA 1VQPS 3GTMJ 2E9ZA 1S97A 3SFZA 4C9YA 2RQKA 5I3QA 3I87A 4PG5A 2D1VA 4ZZLA 4USIA 3BDPA 2RREA 2DH9A 4RPFA 2R7XA 1LW0A 2LREA 3KLEB 3EX7B 1UWAA 4BE2A 3HVAA 3W8GA 2YS9A 3IN5A 3KNAA 2Y48A 3QMQA 1U5TC 3Q0VA 3DKYA 3OYEA 1WKJA 2HNHA 4AYBN 2YX7A 2HS4A 3WU1B 3R0JA 2OPRA 3SEQA 1NM2A 1U7LA 2DR5A 2QA4S 1X1BA 4ENKA 1I94J 4NXMF 1NSKL 1R00A 1SUQA 1YG2A 2MYFA 3OYBA 1F0XA 1XMAA 4MIWA 1DP3A 4TY9A 1HLVA 3K1NA 2HQCA 2RH3A 1NH3A 3IWFA 2CNKB 4PRFA 4DPOA 1UZCA 2RB7A 1X1DA 1XMKA 1EKEA 1DQUA 4P9FA 1FEXA 2FX0A 2E2JJ 3JSOA 4DN9A 2LYCA 3MR5A 3HF5A 2VZ9A 2GA2A 4ECUA 2YU3A 2RF2B 1TL7B 2Y31A 2DVIA 4CLYA 1VQNS 2UWMA 2HWIA 2NXNA 3HXMA 4IX7A 3CO6C 4HV6A 3DDIA 4HYEA 4Q4ZF 2SXLA 5GAEJ 4CZZA 1RTDA 1RYSA 3DRPB 2DGVA 1ZAWA 1OPZA 1K0TA 1YRTA 2HFUA 1YYVA 1NZAA 3OLAA 4X1EA 1JLCA 1KLNA 2J7WA 5KFCA 2KB2A 3CDHA 2BW3A 2ASYA 3QZ7A 2HHHF 2EG1A 2BJDA 4CCHA 1H98A 3H0DA 5GP9A 3B8HA 3CP2A 2MY7A 4AIKA 3KNGA 2XY6A 1D9AA 2L9RA 1IGNA 1C1CA 1I3OB 1PUFA 2K86A 1S7HA 3J7YI 3A2KA 2V4RA 5M3MJ 2B9SA 5J3LA 3FXMA 4ZYGA 2CG4A 4R8UA 3GQCA 4CCJA 4A4JA 1WDDA 3BREA 3F8CA 1MH3A 2K1RB 2JJ7A 4NWBA 2XIGA 1G4CA 3GMGA 4L5EA 3KUEA 2JN6A 3GSIA 1K7AA 5HVQC 1U78A 2IMOA 3DF8A 3F8BA 2F2EA 1XNQJ 2WHOA 1S1XB 3LGMA 5C3EJ 1U6ZA 4QIFA 4CLFA 2A0FB 3U2RA 2HHWA 3BR9A 3SDBA 2DNKA 2WSFC 3KUHA 2QA2A 3E6BA 5GTIC 3OHAA 2QBYB 3HD1A 4PWDA 4Y34A 4RNFA 3UDLA 2V26A 5IT3A 3A8IA 1NBEB 5ITHA 3Q89A 3HOSA 5GADI 3ADAC 3EUHA 3DI6B 2IY5B 3BQZA 3GWCA 2QO3A 1PJ6A 4CA0A 3DXSX 1RT1A 4YEJA 1ZG3A 2QSGX 2O3DA 2HLUA 2ZH1A 3E51A 5JJBA 4QR0A 3TAQA 1YBUA 2B8PA 2LMDA 4DCOB 1QVTA 4EATA 2XQCA 3LP0B 2FD5A 4NA2A 3RYRA 2Z99A 3W62A 5F3TA 3VV2B 4DV0F 1WEYA 2ADBA 2K27A 4C0OC 5HAOA 2MH2A 3RYPA 2JUCA 2H51B 4IDKB 4P7TA 5J2PB 2YKNA 4KC5A 2BABA 4J01A 3DDKA 5AJ3F 1RWMB 4WXCA 5K14B 1FVSA 2AX0A 3WX8A 1WELA 1Q82T 3CJ5A 5HDKA 3CF5F 2Z0GA 2NYHA 2R2UA 4RB3C 3SI8A 2KHMA 2UXDJ 2JT1A 3BR3A 2DNPA 5HDGA 3KLOA 1P92A 4NA3A 2QL9B 4CNZA 3BYPA 4WF9Q 1U1KA 3D67A 3ETOA 2F7VA 4M6YA 1RWOB 2IHR1 1KVJA 1MJ9A 5BMZA 4IRIA 1IKXA 2PG4A 4R5PB 4RW6B 3SYZA 1PJ7A 3Q0AA 3HL2A 1YWXA 3EVWA 4WK1A 2IA1A 1B59A 2GXBA 2V4JA 4LF2A 4J9NA 2BKNA 2VKZG 2MKIA 2DIUA 5IM0B 4RGUA 4OZNA 3D5LA 4EM2A 4OI3A 3SDEB 4H4OB 1J9IA 2RQCA 3RAQA 2Y9YA 3MD2A 4UZBA 2DNOA 2CWKA 4TY8B 3MEKA 3DMJB 4XLHA 5D4PA 3IS9A 3PIOF 1FP2A 4U7DA 3G73A 3JAMY 1J2VA 4DSFA 4IRCA 4XLCA 4M1KA 5BXIA 1K6OA 3W2VB 4UOGA 2ZKZA 1Y0HA 3OR1C 4XK8C 1GV5A 1O3RA 2BEFA 2OMOA 3C14B 1FBUA 2QA4G 1KDNA 1RAAB 4KJIA 1I50J 3TO6A 2V2VA 1RBLA 3IC1A 2OZ6A 2E36A 2DISA 2V6CA 2ACJA 1ONVA 2MHNA 2B7CB 4IH5A 4Z37A 1JMTA 1TL8A 2FOKA 1R8AA 1FOYA 1JJ4A 3SQNA 2XSFA 2DPUA 1RT2A 3FBFA 3CD7A 3MCZA 2PI5A 1Y1VJ 2E71A 2E5LJ 1V9OA 1FDDA 2NS1B 3QLHB 2KP6A 3D28A 5HANA 1RWKB 4IRHA 4RW9B 3D0SA 2OTLS 3MM6B 3HVTB 4ZLLA 5CH7B 3TUZC 5HL7Q 2BJ9A 4C9DA 2FLNA 5M5XJ 2PMWA 2E5NA 4CCLA 2UVVA 4CH0S 2R7ZJ 3UVJA 1N32J 2D1CA 2H54B 4DV7F 1ZAVA 2RNJA 2Q2EA 4LREA 3LSJA 2H8RA 4Y6IA 4A46A 4FXVA 1HHQA 5I42A 3EZOA 3J80U 1W7WA 1SJRA 3ITHB 1MH4A 5D4RA 1ETOA 4K7QA 3HRUA 3CCLI 4U8VA 2AX1A 2D3OR 5L1KA 1MBGA 1NKBA 3H36A 5ILVA 3CUQC 2KT0A 1PC5A 2YKMA 3PR4A 3U21A 3CJRA 2GFFA 2IC3B 2I5JA 2XULA 2ZSIB 2BOAA 2RDJA 3UCUP 4D7MA 1SKWA 3DHXA 5KT3A 2G4BA 1OCCH 2MLZA 4C7QA 3L2QA 4AD9A 4MT1A 1VC6A 1N88A 1FEHA 3CJSA 1Y7PA 3TX8A 3G82B 2CQGA 1SV5B 4ZPWR 2KHDA 1TWGJ 3ZQLA 3DLEB 3O3LA 3TAMB 3LSHA 2AWZA 1ZETA 3QAHA 3TEDA 1FJCA 1U47A 1GQEA 1C4CA 1JT6A 3DU6A 1IZ1A 4DU7A 4A6DA 3ABKH 4ZPBA 3VVTA 3QT7A 2DNYA 2YWEA 1TL3B 2ZMEA 4CIOA 3OUYA 1RHRB 2OI2A 1CJTB 5AT1B 2W7OA 2VPZB 2ZOGA 3D6TB 2EFOA 2COBA 2V5HG 1BW5A 2NOJB 3IP4B 4KGMA 2LFBA 1X58A 4UY85 1DJ0A 1GXLA 2Y75A 3C2BA 4IOCF 4C2MJ 3HSEA 4XAKA 2COLA 5LMNJ 3K4LA 3CJQB 4X2BA 2FRHA 5LBQA 5BOXA 1ZQ3P 1H38A 3F8MA 1T7PA 1JK9B 3AB4B 1UTAA 1H2UX 3MEGB 5KFWA 1QNTA 2X1GA 3OLBA 3IRXB 4N7TA 1OFCX 2O66A 3R2CJ 2I1RA 3NG8A 2VUGA 4LR7A 3BGLA 2XG8A 3JTGA 1BC6A 5E1ZB 2F9DA 4LT6A 4PDKA 1Q79A 4U7UK 5CD4H 5B7WA 4LG0B 1XGMA 2M9HA 3K59A 3CLQA 4CWBA 2YNIA 5IY5H 4BAYA 4URGA 2V9VA 5HI7A 3DLJA 3KDOA 1U1OA 3M8QB 5M5YJ 4TLQA 2K7KA 4U95A 1NG7A 5D4SA 3FCVA 4ZPTR 3MR6A 3LSRA 4JI0F 4TU7A 4B3SF 2TRTA 3W9HA 3DM2B 3PIPQ 3GE9A 2HPIA 1HR0F 3GZ6A 1QTMA 5B0CA 4OMZA 2KFZA 4B08A 3ET6A 2EIJH 3V81A 3TOBA 3OYNA 1DRZA 2P81A 4UXNA 3GJTB 2XYPB 5JVGQ 4BHQA 3CEDA 1VQ7I 4RGRA 3K0JA 3JSMB 1KGSA 3AAFA 2Y9ZA 4LF7J 2A3SA 2QKMB 5DUKA 2DA1A 3DFGA 2PI4A 3NGDA 4YFXF 3GB0A 2DO0A 4IO9Q 1U5TA 4KRWA 2IRYA 2HS5A 2D3ZA 1W1WE 1VQ8S 4QIVA 2QRRA 4ID5A 5K7ZA 4C3HJ 2HAFA 4DUYJ 2QSFA 3PYGA 3FSXA 2OAUA 1XK8A 1AW0A 4OYXA 2DEJA 2V8PA 1YS6A 2G9WA 2ZNYA 3S6EA 5KFQA 1ZH5A 2K3IA 5K1YA 3G6EI 3AOAA 3C3LA 5C25A 5AE1A 4M5JA 3F72A 2C1EB 4RW4A 3RW6A 4XRSA 2IS6A 5DDOC 3HHLD 4XONA 4MK7A 2MB0B 1HW2A 3PM1A 2ZXIA 3C6UB 4DNCA 1VLYA 4P9UA 3LUYA 3HX9A 4EEYA 2NS7A 2BJ1A 5BQTA 2XY5A 3MEEB 2G2YA 1ETYA 2WY8Q 4W90B 3OTEA 3M8ZA 3T1YF 2ZC4A 4UUWA 3N6NA 5DGBA 1X4OA 5E7OB 3HG9A 2DTJA 2Y0BB 3H1CA 4BQOA 3GWZA 2WWYA 4LLNA 3UCGA 2BEOA 5D6GA 4CNYA 2BOPA 2O5DA 4B09A 4K4WA 4OX9J 2V2QA 2ZITA 1PVEA 2RS2A 2A1BA 3MZYA 4IR1A 2H65B 4ZYDA 3PW7A 1HHTP 1KRPA 3R97A 2MKCA 4ED3A 3GZNB 5FLXZ 1CQMA 3K2AA 4BJTA 1B64A 3N5FA 1CJKA 4B3MJ 1U0HB 4JI4F 2JA6J 5FKOA 2I2YA 1HKSA 2FLPA 3PTWA 3OYDA 2W00A 3CGIA 1FEEA 3CMES 4N8OA 3NOGA 4OX8A 3W8PA 3MQ0A 3T1HF 1FSEA 3ROUA 2ZO4A 2Q79A 1M5PC 1WUUA 2MABA 3D1NI 5BYRA 2XGDA 1FP1D 4JI2J 2ZZMA 4KN7X 3ILIA 3HB9A 2J9EA 2IFXA 4JBAA 2JZ5A 1M5SA 3ZZZA 4F93B 3ZC4A 3IBWA 3DBHB 4F91B 4FF3A 4MAKA 1P4WA 2PX9A 3MM9A 3G2BA 4IKFA 3CJTA 5IT9Z 1JIHA 4NRUA 3OYFA 1DAXA 3QSYB 1S72I 1T9VA 1SFOJ 3VZIA 2Z58B 3ASOH 1RISA 4DQPA 2GA1A 1XIQA 2EK1A 4KHMA 2YSRA 1YRNA 1AROP 2XF5A 2ZE2B 2AJ4A 2G2ZA 3OTCA 4WTOB 1N5QA 1RU2A 1TNTA 2QYGA 4M6XA 4FYYB 2IXSA 2Y69H 3MM5B 1AFIA 1R5HA 1T03B 3CWJA 2UUCJ 1NSAA 5IP9J 4HOBA 3MMCB 1REVB 2UZAA 3AODA 2BZ2A 2PO4A 2UXNA 3SV4A 2UXBF 4WYLA 4C3KA 4DSLA 3NXZA 2FVSA 4E7LA 4EUVA 4K4UA 4BACA 3FQKA 1VGYA 2KT5A 3RUBL 2Y30A 2CW0F 3GCWP 1B1BA 3MURP 4DPYA 2EFWA 2VBXA 5ICFA 3HHEA 4IFYA 5KAKA 1JLEA 1TKXA 3KP5A 4LIUA 3DEEA 3HHLC 4DLGA 3ILLA 3QGPA 4JI1F 1H89C 2WVCA 4CDGA 1ZG1A 3FXRA 3GFJA 2DMUA 5CYVA 4LJMA 3RIRA 3UN2A 1RTJB 3V42A 3DKWA 1H7WA 4IR9A 2V67A 2L3DA 2WW4A 4BEHB 2KLOA 5D77A 1SEUA 1SJ3P 3RR7A 2NZ4A 2JVRA 1FBSA 2BY1A 1U1LA 1GVJA 2IDEA 3QPLA 2LXIA 4KGZB 4DR1F 2ALZA 1E6YB 3OYJA 1GMWD 4ZYEA 1TQIA 3C15B 5C7PA 3SXLA 4DSEA 2OUGA 1ZGWA 1F36A 2V8DA 5LEJA 1G7CB 1WSVA 1YI2S 3OR1A 3D0HE 3H3VK 4HHUA 5HVHA 3VSKA 4EU0A 4U7CA 3HKZD 1BR1A 1VK3A 1SL2A 3QO9A 3RJPA 2KM8B 1Z7UA 1PC4A 1HKAA 2RC4A 3FNNA 2GO8A 1VQYA 2LDIA 3QT8A 1PUEE 4YR2A 4F7VA 4C8ZA 1WHUA 1J59A 1G3TA 4D7NA 2BY2A 1RT7A 1B8IB 2AV5A 1MLAA 1FJLA 2VG5A 1N6QB 3WU2C 3ILJA 4GYGA 3KETA 3KUGA 4UUSB 2X1CA 2W7AA 2HRTA 2L02A 4L74A 2VT2A 3M2UA 4KAIA 3C2PA 2MLXA 3BM7A 1ZREA 2V9WA 3FXUA 2ZH8A 1AZSB 5F3ZA 1HNXF 4U7UD 1V3RA 1WG5A 2CA9A 4DL6A 2ATLA 2FMYA 2QENA 2ROGA 4F4YA 2EFQA 3RR8A 1U0SA 4KMUX 1DGRM 4LIVA 1WFXA 2OBPA 4RX6A 4USTA 4MGRA 1TWCJ 4NEZA 2CNNB 2JQ7A 2FJXA 5HN0A 1OQYA 1USSA 3HSRA 1GHCA 1AA1B 1VBYA 3WE3A 2YQ3A 3WGGA 3OL9A 3H9JA 3NCRA 4LF1A 3CUQA 2OCEA 2IAJA 3EGZA 1OCOH 4C3JJ 1VBZA 2KVIA 1R1VA 5CCLA 4PWUA 5EDNA 1XN9A 4ZYAA 4RM2A 5CKTA 4K2XA 1ZA1B 3UN5A 1ZOTA 1VBXA 1APSA 2VFRA 1AOYA 2BACA 1Z91A 1WC1A 2ID6A 2XEXA 4CLSA 2K3KA 3H0GJ 4ES3A 2ZJ2A 2BDPA 2GHVC 1SL1A 3NGSA 3W66A 4NRTA 1SUQB 1YJNI 1TT5B 1UHSA 3HRTA 4CQ1A 1Y10A 1CPZA 3G4SI 5GAEI 5KFRA 1XS9A 5E33A 3DCFA 3OFHA 2R7DA 4FE4A 3A3PB 3LQVA 1CQTA 3D7SB 2BJ8A 4WXHA 4DZPA 2OJ3A 4WP3A 1EQMA 1RE1B 4PG6A 1N0UA 2XYHB 3QOPA 3EWGA 3TVZA 2J6TA 2W9BA 3DLAA 4YS2A 4PR6A 2ISZA 1SC7A 4ZCMA 2NXNB 3KX2A 2OV7A 2LA4A 2AJFE 1RB0A 4IVNA 1J27A 2E35A 1S8NA 4RUHA 1LXNA 4NXMJ 4Y2AA 1FCAA 2O3FA 3T5KA 4WK8F 4ITSA 3EXCX 4AL6A 1TK8A 4HNUA 4ZCIA 2P9EA 1B9NA 2DR6A 2GZOA 3PYEA 4WX9A 2X48A 1JLCB 2VKRA 3COAC 4DFMA 1T94A 3C18A 2VOOA 2CQ3A 4C2TA 4JOUA 2HKEA 4G9YA 2B63J 4GKJF 4Y2CA 4C48A 4PG7A 1C1CB 1PUFB 3RU0A 3G96A 2ILZA 3F21A 1Y3JA 1IJEB 1KVIA 2W8KA 2KIUA 2XGEA 3B6AA 4NI2A 4DR6F 4DL2A 1XD7A 3HCXA 3AD9C 3ZZ0A 3G8SA 3NRBA 1Z7LA 5FLXU 1NJYA 1EZZB 2HQAA 2C6YA 1UA0A 1TMMA 3ENWA 4NL5A 4RNNA 3CMAS 3RBZA 3W9IA 5DDRC 1VC0A 4TLRA 5E3CA 1ZARA 4L76A 4IOAQ 2HHHJ 2QFIA 3R1LA 1X5TA 4EMDA 4PSXA 2B9XA 5LHHA 3ZN1A 3OXLA 2NXCA 5HQ8A 2IA2A 3L2WA 1HI8A 2PT0A 5EDWA 4I2QA 4PWDB 2E1NA 2QV6A 3MAAA 1NHKL 5EZGA 2ZM6F 4OZJA 2C3OA 3IG1A 2E66A 3MEDA 4BXXJ 3FEXB 1BD6A 3F3XA 1S12A 4O3OA 5IT9U 5J8FA 1RT1B 5H20A 2V79A 1R31A 3VZHA 4X4VA 4WKYA 2X6OA 2GO9A 2PJRB 2HS3A 3TO8A 4AVPA 4D9JA 4X4OA 3RRHA 2HNZA 1ZAXA 1ZTRA 3Q8SB 2V1NA 3W61A 4FX4A 3V4MA 3M7VA 1KLMA 2DK5A 1DP7P 4OIXA 2OHDA 3HZGA 4C6AA 5HJYA 2GNKA 5KFNA 3FQLA 3EVMA 3CIMA 3TBIA 2KXNB 1NJXA 1V5IB 1S9HA 2EH3A 2IYIA 2J5AA 5FJ4A 4M71A 5EWFA 1FTRA 4DEZA 1Z4UA 5H9FJ 3QIPA 2WONA 1VR6A 4JV0A 1X31C 2FGCA 3AJDA 5ILUA 3S1TA 2EXUA 3I56I 4DG1B 4W4MA 2AEMA 5J4YA 2DFEA 2NYIA 5CYJA 1R5ID 1FNXH 2VPXB 2JL9A 1B72A 4DI6A 3DBLB 2KKHA 3AL0C 2XB2D 3J81K 2AJ0A 2XB5A 2ZKTA 4BBYA 1VRTA 1MROA 3L9FA 4DV0J 3DU5A 1Y8QB 2VPLA 1JLQA 3DLKA 4J9VA 1ODDA 4Q44A 5GAHU 2ZBPA 1IKWB 4EEFG 1W5SA 3HEFA 1RDRA 1OYYA 4BXUA 5LSOA 5AJ3J 1EP4B 3IKVA 2BRLA 1YJWI 3A02A 2L0KA 4CM2A 3LANA 3TANA 1XMQF 3L3CA 3CCRS 4IRGA 1QDUB 2CFOA 1QRYA 2BY0A 3MKYB 1YIJS 3TZZA 1Z2ZA 4IRDA 1EHWA 2ZUGA 2J7KA 5D8LB 4DR3F 3WG7H 1WJFA 2STTA 4ETSA 1ZTWA 2ZEJA 4ELVA 1W7PD 3WIUA 5DCMA 4KPCA 2HHSA 1KQKA 2HSEB 2Y9HA 3BY6A 1BW6A 4HDHA 3I5UA 3L7OA 3JREA 1Q78A 5MLCV 2CPHA 3CC4I 4USJC 4RUCA 2HZTA 5B5EC 2L3MA 4BNCA 2WB1D 2N8GA 1OS5A 3OTOF 1RT2B 4RUAA 1ENHA 2LY9A 4NCGA 4DL3A 3I53A 4OJHA 1HW5A 4P10A 2OP5A 1C0UB 2K9MA 1RT6A 3TX0A 2BHYA 4I0BA 4RAYA 1Z77A 2XS2A 2GS8A 2BE9B 2ZJQQ 1K78A 1PG5B 1FX2A 3R5CA 3NWGA 2JEJA 4ESFA 1VQMS 1RA7A 3KYCB 2QN6B 4NLXA 2AEJA 3M2RA 1R6YA 4KR0B 1YJ9I 4PK4A 2NZCA 3VYSB 2VH7A 4OZ1A 4JV1A 2Q2EB 2W57A 1SVMA 3FCWA 4DV3F 2NVQJ 2H9ZA 1WOOA 4A8KA 2FEZA 2MZTA 3LTOA 4M5GA 3OMYA 1UMQA 3AA8A 2QSHX 1XC9A 5SUHA 2O8KA 3I5CA 4CCOA 1FOXA 3U02A 4M5HA 5C2CA 3KK3A 4ZITA 5HLFA 3LSMA 1N33F 4Y3OA 3BGRB 3K6GA 1Y39A 2XTJP 1IKVB 1BQNB 2ZH9A 3SQOP 2O8XA 2KMUA 2YKMB 1SJ1A 3M8YA 3NLCA 3H4DA 2XWYA 2ALYB 1S7OA 2ZWOA 3CJRB 1UZDA 3POTB 2RJZA 3E8OA 3DKXA 2PFDA 1B0PA 4DV7J 3HZJA 1I1SA 4LQ3A 3MAHA 4BQNA 2CG8A 1RKJA 2HBZB 3HHLA 4OI6A 2E1MC 1HBOA 1S1VB 4NCAA 4JI8F 1SKRA 3PKYA 5KNLA 4RLQA 2PEXA 2VG7A 1MIJA 3PFOA 5JLWA 5DS9A 1GVDA 2JLGA 1G4DA 2I5UA 5M3FJ 4M9ZA 3FEZA 3M8PA 4ZKAA 3CLOA 3S8SA 1MNEA 3JRCA 2IM0A 4FN5A 2NVYJ 3R8YA 2RNGA 3E01B 4C11A 5ADZA 4BC9A 1SB6A 2D2WA 3BTLA 2A07F 2ZMEB 4URSA 1BR4A 2W25A 4N9HA 2XMJA 1MSFC 4KTQA 4ZMMA 3P3DA 1XCVA 5E3QA 2M70A 4NLVA 4A0ZA 1O3TA 2QMXA 4NLGA 1I3QJ 1UCRA 2YU9J 3PQJA 2EVZA 3P4UB 3R2DJ 2CQQA 1RRJA 4LSLA 3R0AA 3IFEA 1NXIA 4LBPA 1LEOA 5C24A 4DBQA 2IGKA 1RAGB 3BSNA 2JVHA 4MFEA 2PMHA 5D4OA 2F3JA 3FDSA 1TKTB 2CJYB 2KKOA 1AB8A 2QJ3A 3BJ6A 1F5TA 1X5OA 2GQ2A 4Y7NJ 2X0LA 3CDWA 2QQBA 3GFLA 3ISZA 2FVQA 5J47A 1OCTC 3C16B 1IRFA 2RRNA 3HPGA 2YNIB 2WV1A 3QRQA 4U0WA 2YUSA 1PILA 3DLBA 1DU0A 3G6XA 1U1RA 3K10A 4OFZA 3U1LA 2BW7A 1FE0A 3UD4P 4MFDA 2QLWA 2V8HA 1TAUA 4RW8A 1CJUB 2ZC3A 4GO1A 3RB3A 2RU3A 2M7SA 5J4VA 1SVLA 1FESA 3PX0A 4TU9A 1Q8BA 1DPRA 4F52A 4WXOA 3U1KA 4XLNF 4QR2A 4ZVOB 3EICA 1K0VA 4WFZA 1F5CA 1KHWA 3ZTPA 5K5QA 3CC7S 4WFXA 3I32A 3IWNC 3N0VA 1VCTA 2Y0SD 5GPAA 3WBZA 3MECB 2UZKA 4JV5F 4AU7A 3F22A 1HMVA 1BC7C 4B3RF 5CXTA 2IBOA 1MMNA 5E3MA 1HC8A 3ZFVA 3DP7A 5F0CA 4ZTJA 5LOQA 2BKOA 4G1QA 4DDFA 1WH7A 2HI3A 1TP4A 1D1AA 4JI0J 1LEAA 4B3SJ 1U26A 3OOUA 3PW0A 1HNWF 1HR0J 1S77D 4ID5B 1V5EA 1AU7A 5KG3A 2P9CA 1FRLA 4O3QA 1FXLA 3GLLA 3CCVI 2ZVIA 1CVJA 1W2BR 3BGFA 1VQKS 2MW8A 2XYGB 4EJOA 2VICA 5H9EJ 3BSAA 3GONA 5DM6Q 5C25B 1NK0A 1CJVA 1FK9B 5F0UA 2V9PA 2BVZA 4L9NA 2QMUB 3SMZA 3EETA 1FERA 5A8WA 5F9NA 2FIUA 3CCJS 3BYRA 1HQ2A 3NNHA 4Q2LA 2FLLA 3QYEA 4XMYA 2VF3A 4HH0A 9RUBA 2C22A 4OIRF 2CGPA 3BGUA 5DRKA 5FFZA 2R8IA