4FX4A

Crystal structure of m. tuberculosis transcriptional regulator mosr (rv1049) in compex with dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
128
Chain Sequence
ECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSEGSDLTMSELAARIGVERTTLTRNLEVMRRDGLVRVMAGCKRIELTAKGRAALQKAVPLWRGVQAEVTAWPRVRRDIANLGQAAEAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*AP*GP*AP*TP*TP*CP*GP*TP*GP*TP*AP*GP*CP*T
publication title The Oxidation-sensing Regulator (MosR) Is a New Redox-dependent Transcription Factor in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator/dna
total genus 40
structure length 128
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4fx4A00
1R00A 1SFEA 3TDUC 1RUOA 3ERED 1IN7A 1FZPB 2CO5A 1FYKA 2EWNA 2FBHA 1JHHA 3EUHA 4FX0A 2AS5F 3QU6A 5FB2A 4Q4ZF 3WTXC 4IRIA 1MDMB 3DV8A 2D45A 1IUYA 3LA3A 3V8KA 2VT3A 2IJLA 2VC1A 2DU9A 3HIFA 3FXQA 4M71A 2Q8KA 5D5UB 5L3BA 1YLFA 3NRVA 1S3JA 2YX7A 3K1NA 1E2XA 5CVIA 2M5WA 1FX7A 1Z6TA 2UWMA 1K6OA 3HTUA 4K2EA 2DK5A 2HWVA 4BHBA 2PG4A 1IF1A 4IXAA 3I0TA 3HRUA 2ZBKA 3WU0A 1W4MA 4HX4A 2OD5A 2HTJA 4EMSA 1FOKA 3QRFF 1HKQA 1O3QA 3FX3A 3JW4A 1ZRDA 4KNYA 2GAUA 4HBLA 3SQNA 1XMAA 3EETA 4S05A 2XUBA 2QQAA 2CYYA 2ETHA 3CO7C 1YYVA 1CF7A 3R4KA 2JZYA 1XSDA 3KZZA 4KIBA 4Y13A 1P4XA 4AIKA 2XKOA 3K69A 5HS8A 2G7HA 4AVPA 2PQ8A 2DPUA 1R1UA 4P9UA 3RDIA 4G7ZF 2ZO4A 2IVMA 2L3DA 4EM1A 2GWRA 1GHCA 3R6SA 1HKTA 2H27A 2DFIA 4CGZA 2A6EF 2BGCA 1ZLJA 5E1XA 3BPVA 3RPQA 4R1HA 4LG0B 4EM0B 1T39A 4HDUA 1IRGA 2KJCA 2P5LC 2QZ8A 1WQ2A 3C1DA 4OIPF 3VODA 4KT5C 1FY7A 4A12A 2QQBA 5A2QK 2FQ3A 2XVCA 3WE2A 4YFXF 5JR3A 3KE2A 1XCVA 3C7JA 2W85A 2GZWA 1XB4A 5E8GA 4KN4X 1YS6A 1U3EM 2O8XA 5LEKA 1FYLA 3DQVC 4F7ZA 1TQMA 5H6QA 3E6BA 1VTNC 3BROA 1HBXG 1I27A 3F8NA 4MTDA 3ECHA 2DQLA 1DP7P 2GQQA 5LHHA 4GYGA 1J75A 3ZMZA 2Q0OA 2JPCA 1S6LA 2FF4A 5DD8A 2CSOA 4CO8A 1Y0UA 2KIFA 3R61A 3WTWC 5CVVA 1IXRC 4WCGA 4WXHA 3HSEA 2WTEA 3EYYA 3SZTA 2Z9OA 1TBXA 4IHSA 1XGNA 4IRGA 2FBKA 3E6MA 2ZKZA 3KETA 4LK0F 1RZ4A 4ESFA 2XV4S 2K7LA 1GXPA 3HRMA 2PBIA 2WC2A 1DUXC 2XAHA 4RAZA 2VN2A 2DT5A 1I1SA 1FLIA 1BIAA 2CFXA 5DEQA 3ABTA 4R79A 4ENJA 2K27A 3WG9A 1IN5A 1HKSA 2NNNA 3JSPA 4U88A 1HW2A 2DTRA 2J5PA 2WWYA 4RGRA 3JTHA 3V7SA 3MEXA 3BWGA 1ZGJA 3COAC 2A61A 2EFOA 3TO7A 5HOOA 4OIQF 3PQJA 1KYZA 2GIVA 1FBUA 4KMUX 1XGSA 4GO1A 3ZMUA 3ZMSA 4HW0A 1GXQA 3VB2A 3HSRA 1RIOH 4BHCA 3K1PA 3GXOA 2VBYA 1O3RA 1D8JA 2RDPA 1T2KA 2QM3A 2JPBA 4PGHA 4L18B 4P96A 3MCZA 4UV9A 1J5YA 1KU2A 5HS7A 2ZMEB 3ZN1A 1SD7A 2MA3A 3KZYA 5AIQA 4HF2A 1BOAA 4O5VA 5K5OA 3H3UA 1ZARA 3KP7A 1Z7UA 4Y15A 3IRQA 2EV6A 5ICCA 4AD9A 5TRDA 2UXNA 1R1VA 1HW1A 2H6CA 4I01A 2PI0A 4G94A 4HX8A 3RIRA 1YIOA 1NHAA 1ULYA 2EB7A 3P7NA 2VXZA 2PMUA 5LLQA 5FGMA 4O3MA 3WGGA 3QU3A 2E1NA 3IKVA 4CDGA 1ZG1A 1ZN2A 2ZXJA 4BNCA 2R3SA 4RGSA 2RVCA 1SMYF 4H0EA 5J6XA 3L09A 2P6TA 1QO0D 1K78B 1LEAA 2M1BA 1C0WA 1B1BA 2VBWA 1LDDA 2WV0A 3R60A 4WXDA 5CLSA 1WRJA 1FBSA 2EJRA 4CYDA 4HF1A 2Z33A 2ISYA 4KIFA 4B8XA 5DUIA 3KLNA 3CUQB 1CGPA 3SZPA 1D3YA 5LEJA 2AXLA 2A6HF 4LGWA 1PDNC 2DBBA 3BZ6A 4UHTA 5HLHA 1WKMA 2HS5A 3I59A 2YX4A 4CICA 3FHZA 5FLXK 2HYGD 2EFPA 4U0WA 5AIPA 2IA1A 1QZYA 1K79A 1XD7A 1ODDA 2YR2A 3GFMA 3E97A 1KU3A 5ICGA 1E17A 1A04A 1YS7A 1IZ1A 1KU7A 1TNSA 2H09A 2NYXA 3EQLF 4U7DA 2BE5F 1B4AA 1XDUA 2L54A 3MZHA 3QPTA 4LB6B 2HEOA 3ABUA 3G73A 2FXAA 3WTZA 3LSTA 1EH8A 4DQ2A 2MLKA 2NRAC 2JRTA 3QOPA 1BN5A 3GX4X 5LBQA 2EFNA 4EJVA 3M7GA 4ENMA 1YW7A 1ZRCA 4LJZF 2ESHA 4NB5A 1XGMA 4LD5A 3GYHX 2HTSA 2HDCA 1B6AA 3GZ6A 2VBXA 3IHUA 3J81Z 1O7FA 1W7PA 4EGZA 1Z05A 2CW0F 5E8IA 1FPQA 3F23A 1W5SA 3QP6A 2QLZA 3FM3A 1OKRA 1XSXA 1G3YA 3U9GA 3BP8A 1ZYRF 3BDDA 3FXUA 2IA2A 5LHGA 3K0LA 2O03A 2A07F 4MQVA 1TNTA 3SXYA 1Z91A 3V8JA 1U2WA 5KVRA 4I09A 2NS0A 3F21A 4AIHA 3FF5A 4EJUA 3BOQA 2PN6A 1OR7A 2HKXA 2G9WA 2MH2A 1BBYA 3CUOA 1MJ9A 4M6XA 4HZFA 2P5VA 1AWCA 2GXGA 2LF7A 4LFUA 1HSTA 3T8RA 1U5TA 3L2CA 1ON1A 1ZREA 2EA4A 5IT3A 4PZJA 4Q48A 1ZAOA 3RKXA 3V8LA 3WTSC 5D4RA 3WTYC 4KICA 2M45A 1IN6A 3KFWX 2H94A 2JT1A 5HLIA 5L3FA 2O61A 1YO5C 4OMYA 2OAZA 2P7VB 5EEGA 2PMHA 4A0XA 3HRTA 3U2RA 3FM5A 1V4RA 2V1XA 2L02A 1S7OA 2BEOA 2FSWA 1FSEA 3REOA 4RAYA 1HSJA 4G8XA 4UVBA 4XBFA 2E1CA 2QBYA 5ILUA 1D8KA 2P4WA 3F72A 4R8HA 1FP1D 5D8KB 2HQNA 4RS8A 2NAZA 1ZHFA 2M30A 4MEYF 2RC4A 2RV8A 4I02A 2A68F 3DP7A 4MGRA 4UVAA 3DF8A 4N9HA 3BJAA 4M74A 4AWXB 2Y48A 1TTYA 5DD4A 3J7AO 2IT0A 2IA0A 1ZG3A 3T5XA 1SD6A 1BM9A 1V3FA 2OA4A 4L9VA 2OQGA 3ZQ7A 1MJAA 1S8NA 2W84A 2MBFA 5LGNA 2EFWA 5D6EA 2KIMA 5FD5A 2P6SA 3KP4A 4WF2A 2OU2A 3GLXA 4L9NA 1MZBA 2DLLA 4IVNA 5H6RA 1LDJA 3CJNA 2VBZA 2DPDA 3V7RA 2L01A 4LB5A 4EVIA 3MAJA 4I0AA 1QBJA 5ICFA 2W57A 3I5UA 1T0FA 3F8MA 3GUDA 4MNUA 1IN4A 3IWZA 2XASA 4PCQA 4IF4A 1R5GA 4JK1X 2Z3YA 1TW2A 2QQ9A 1DPRA 3GFLA 1J59A 2JSCA 3KP2A 3HRSA 2QENA 5DDGA 1LDKB 2FNPA 1X3UA 1IXSB 3E5XA 2KJBA 4PGGA 2F2EA 1G3WA 1Z6RA 5D8LB 4MEXF 5ILVA 4U7BA 5ED4A 1XSVA 3LAPA 3TOAA 1F5TA 2IRFG 1USTA 2HZTA 1U5TC 2C6YA 5DCMA 1R23A 4ON0A 2JTVA 2P8TA 2KKOA 4IHTA 2MLGA 3F3XA 3BJ6A 3H3ZA 4HDVA 1MJBA 2GXBA 2H6BA 2KIUA 5CVRA 1D5VA 2XKPA 5DCFA 4BAYA 1YW8A 4I2OA 5FFXA 4ETSA 4OIOF 3B73A 3IL2A 1B59A 3ZP5A 4YFNF 4LLNA 2EV0A 2E7WA 4EJOA 3GO5A 3Q9SA 5L3CA 1ZLKA 4Q47A 1FT9A 4E70A 1UB9A 2A69F 2VONA 1FBQA 2W24A 2ESNA 4PDKA 5IT9Z 4WX9A 3E5UA 3LA2A 2R7DA 3IC7A 2HQRA 2XAFA 4HQEA 1O57A 3ZN0A 2B0LA 2M8EA 1KQ8A 1ZG5A 2YSRA 2FEZA 4L5JA 3NQOA 2ZNYA 3RYPA 1CF7B 3ELKA 2L4MA 3F22A 2OZ6A 1MDMA 1BI0A 2VODA 2RGVA 4A2UA 2L4AA 4Q5SF 4ESBA 1U6GA 1RUNA 2VE9A 1JHFA 2GA1A 4KUMA 3MQ0A 5JFRA 1P4WA 3HHHA 3I4PA 1BC8C 3VEPA 4M72A 3WODF 3V7CA 1LJ9A 4BXUA 3M9AA 3C18A 5HDNA 4HOBA 1WSUA 1SD4A 2F5DA 2QWWA 1KQ9A 3LA7A 4HA8A 1QZZA 3P9IA 1UFMA 4M9SA 2D1VA 4G7OF 3T8TA 2UXXA 2RNJA 3FXRA 1SFXA 1ZGAA 1P2FA 5TJJA 3K9TA 3HYIA 2XROA 4IJAA 2Z99A 1ON2A 3JTGA 2F5EA 3TO9A 5F64A 4KIGA 5LRSA 4N9IA 1KGSA 1PP8F 4HV6A 2ACJA 4CZZA 1BI1A 3E6CC 5E1ZB 5HVQC 4G9YA 3IKTA 1MD0A 1FNNA 4HAMA 6PAXA 1TQIA 4OU0A 3VFZA 3RTRA 3Q9VA 4XRFA 1FC3A 2Y75A 5D4SA 5CJ9A 3KCCA 3DKWA 3R0AA 1XDSA 3G3ZA 1MKMA 2HGCA 1Q1HA 4L0ZB 3D0SA 2EA2A 3OV8A 2O6GE 3JAMZ 1FSHA 2O0YA 2FBIA 3HOTA 4XLPF 2MC3A 3LQQA 4LG0A 5K5QA 2XGXA 2RKHA 3I53A 5CYVA 4OIRF 4EM2A 2QUFA 1TW3A 4ZH4F 5E18F 1BI2A 2IPQX 2RN7A 3J80Z 4ZYEA 1F4KA 4EV0A 3GFJA 4JBAA 4A0ZA 4BH9A 5JHUA 1YG2A 2EV5A 1BI3A 2ADUA 4LLLA 1JGSA 3ZPLA 1B9MA 4MHGA 4M9ZA 3AAFA 5K5RA 1W5TA 4KFCA 3J81K 4I7HA 2F5FA 2ZFWA 3BY6A 3ISPA 5D5WB 2OQRA 3L9FA 4A6DA 2HYFA 4KYWA 3S2WA 4P5OA 3HSFA 2BBYA 3F8FA 4JQFA 3E3VA 1H0MA 4A5NA 1KQ0A 1LNWA 4WXCA 1OYYA 3T0YA 2Z5UA 3QAHA 1BJAA 1F9NA 2XHKA 5FO5A 4GCVA 4GXOA 2CGPA 4BQAA 4HYEA 4G6QA 3H92A 2FE3A 5F1RA 4BHPA 1HXDA 1QGPA 2K02A 1GVJA 1O3SA 5FD6A 2Y0MA 2CG4A 3I71A 3ZMTA 5E20A 1MGTA 3JSOA 1I6XA 4ZZDA 3HOSA 3MZYA 1OPCA 2A3SA 3ZMVA 2DQRA 2NNYA 4ESJA 5HDKA 3O2PE 2XRNA 4G7HF 4FT8A 4IPAA 4YIFA 3GZ5A 2P5KA 2PEXA 3TOBA 3K2ZA 3RKWA 4TV7A 1R58A 1O3TA 2MD5A 3LAJA 4GGGA 1G3TA 4EJWA 3Q5FA 5E1WA 1LB2A 2D1HA 1IAWA 4WWCA 3ROUA 3TO6A 3K1MA 4UV8A 4L9JA 3KP3A 3RJPA 2LKPA 5HLGA 3FWEA 4I98B 5DV5A 2K86A 3BJOA 3KEOA 1YFHA 3KP6A 1IN8A 2ZJ2A 3CDHA 4OOIA 1RI7A 2UZKA 4U0VA 3DXJF 2V1UA 1UHMA 2COMA 3C3WA 3TDZC 1F1ZA 2OBPA 2K4BA 1TLHB 2DI3A 3SFZA 3F6VA 5LHIA 4CXFA 2PFBA 4ZYDA 2PLYA 1T6SA 4HV5A 1WWXA 1T38A 3EYIA 3T1BA 4CHUA 1TQPA 5LGUA 4P9FA 5EEHA 2ZMEA 1LVAA 4A6EA 2PJPA 3MWMA 3W6KB 1B9NA 3GVAA 1O7LA 2FMLA 3CTAA 4RB0A 2RQPA 4MQ9F 1R7JA 2Q2EA 1BC7C 3DPLC 3N97A 4LMYA 2V9VA 4KMFA 5F6FA 3I59B 1J0RA 3P9KA 3RPUA 1J2XA 1PP7U 2FOKA 3PQKA 1J9IA 1JE8A 4U0YA 4Z2YA 4LLGF 4ZZLA 1YTYA 2STTA 3CLOA 1KA8A 2HKOA 2ISZA 4MTEA 1W7PD 1FWZA 4EQQA 3LWFA 2EFQA 4YFKF 3ECOA 5AONA 4XLNF 3W6JB 1I5ZA 2ZCWA 2FA5A 4L5IA 4OINF 1P4AA 2FRHA 3WGHA 1USSA 3DPTA 5H20A 4QLCU 5J8CA 5A2QZ 1R36A 4L9TA 1K78A 3WTUC 1R5HA 3GW2A 1IXCA 1DPUA 3RKYA 3GF2A 1BIBA 1XCBA 1IW7F 3FZVA 5ICEA 5BQTA 2BYVE 3F8CA 4YIIA 3CUQA 2KRFA 1R1TA 3M8FA 2QVOA 5BMZA 1DDNA 2QYOA 4BYYA 3FMQA 4S04A 1W7PB 2VOOA 3HUGA 2DW4A 3HHGA 5LRRA 1EH7A 4AIJA 3VOEA 1JXSA 4ZYGA 1IRFA 1G4DA 5ERIA 1KU9A 3E6DA 3GFIA 1U8RA 1P92A 1J7KA 3DEUA 5IT9K 3I54A 3D5LA 2V79A 5BPDA 1G6NA 2FU4A 3I58A 4OMZA 3EDPA 1H9TA 2DK8A 1XMKA 1ONVA 2M87A 1XN7A 1I1GA 1U5TB 3TQNA 5BOXA 2FNAA 3R0JA 4L0YB 2ZNZA 5E17F 5L3GA 3KLOA 1EH6A 3SHFA 3B02A 1RNLA 4DNCA 1HQCA 3WE3A 1PUEE 5DUKA 3RYRA 3O3KA 3GWZA 2YPRA 5HDGA 5ILSA 4UVCA 4NHJA 3KEQA 5BPIA 2VT2A 2P7CB 3WTVC 2VE8A 5BS6A 4ZYHA 4RB3C 1SAXA 5CVJA 4EJTA 2QBYB 2E7XA 3ZMDA 3E5QA 1R22A 2XIGA 2VOPA 5JI6A 4D0PA 2YU3A 4HQMA 5D5VB 1H9GA 3FMSA 1S7AA 5LGTA 5KK1A 1Z1DA 3F8BA 5J8FA 4RGXA 3I64A 4HX7A 3TKYA 1OYIA 1L0OC 1YQAA 2HR3A 5D5XB 1Z9CA 5L3EA 1ZH5A 1XGOA 2W25A 3FMRA 3M8EA 2HFHA 1ZRFA 2LNBA 4IRHA 1WI9A 2IP2A 1STZA 3L7WA 1UCRA 2A5YB 1L3LA 1LQ1A 2STWA 5D6FA 3BPXA 1P6RA 1LEBA 2VC0A 2D2WA 3F6OA 4QWQA 2IW5A 1G3SA 4KN7X 4KA4A 4KDPA 3N4MA 4YG2F 1HW5A 4NQWA 4ENKA 1YW9A 3CO6C 2TDXA 2MH9A 3WTTC 4UUVA 1KYWA 3ML6A 5FFZA 1QQIA 4WK8F 1FP2A 2ELHA 2GA2A 3JAMK 4UNOA 4A0YA 5HS9A 4RGUA 4P55A 3QPHA 5K1YA 3LFKA 3CUQC 2O3FA 1QNTA 2HOEA 3HTSB 4A5MA 2OZUA 2XAQA 4M73A 4UXNA 3RI4A 5JVTA 4N0BA 3WU1B 2X4HA 1SMTA 3P9CA 2DO7A 3LQRA 3DFGA 4ASNA 3J80K 3MFKA 4LK1F 4XSZF 3WGIA 3GEZA 2XAGA 4Y17A 2G7UA 4M6YA 4RB1A 1T98A 3IRRA 2EK5A 2V1DA 4HLYA 3U1DA 2XAJA 3OOPA 1AOYA 2BV6A 2R7FA 1UHWA 1SD5A 1OMIA 1FYMA 1U78A 3ULQB 4GYIA 4HF0A 4XSXF 5DCMB 1REPC 2CWEA 3KP5A 2FMYA 2LSOA 3QP5A 4RB2C 2LDUA 3L00A 1EV7A 1S29A 2J5OA 1K7AA 4I0BA 3V4GA 1SFUA 2F5CA 3NEUA 5CVUA 4HLXA 3PFIA 3M1EA 1QPMA 2LF8A 2CQKA 3IWFA 3O6BB 3TGNA 2K4JA 4M9XA 4B09A 5FLXZ 4ENNA 4FX4A 2V6CA 5L3DA 1OYWA 5DYMA 4EGYA 2DAOA 4G6DA 2X0LA 4FHTA 4O6JA
chains in the Genus database with same CATH superfamily
2V6EA 1R00A 1SFEA 1ZTRA 3TDUC 1RUOA 4BEHA 3ERED 1HC8A 1LE8B 1IN7A 3OSFA 2BVMA 1IDYA 4NUBA 5EG0A 2CO5A 1FZPB 1I6HJ 1FYKA 4ZTJA 2RNGA 3CMAI 2EWNA 1WJAA 4CCLA 2VJ4A 2EPFA 2FBHA 2DT6A 5KHDA 1UAAA 2HDDA 1T08B 1YHQI 1JHHA 3EUHA 3PJRA 4FX0A 2AS5F 4E6KG 2CRGA 1D1AA 3QU6A 5FB2A 4Q4ZF 3WTXC 4IRIA 1MDMB 3CC2I 3K4KA 1SAUA 3DV8A 2D45A 1JUPA 2DFHA 1IUYA 5M5WJ 4QIWN 3TEDA 3GTGJ 1HCRA 3LA3A 3V8KA 2VT3A 2IJLA 2VC1A 2DU9A 1PYVA 3HIFA 5E3NA 3TL4X 3FXQA 4M71A 2HXOA 1BOBA 3K4JA 4UUTA 2Q8KA 5D5UB 5L3BA 1YLFA 3K7AJ 3NRVA 2R7TA 2M8GX 1S3JA 2YX7A 3K1NA 2ICWG 1E2XA 5CVIA 2OPTA 2WAQA 5IY5H 2M5WA 3W2AA 1FX7A 1Z6TA 3AFHA 2DMPA 1K6OA 2B7EA 2LK2A 1OFCX 2UWMA 3HTUA 3MKWB 3KZIC 1Q1VA 1IC8A 4C30A 4YIRX 3MKYB 3LL7A 4K2EA 2DK5A 2HI3A 2HWVA 2K9QA 2QCOA 3HB9A 2E5NA 2PG4A 4BHBA 5B5EC 1VQ5I 2KMUA 4L5EA 3FISA 1IF1A 4IXAA 3L2RA 3I0TA 3HRUA 3DWLE 1JT0A 2ZBKA 4PFOA 4LG3A 3WU0A 1B8IB 1W4MA 4HSRA 3TP0A 4FASD 4HX4A 2OD5A 2HTJA 4EMSA 1FOKA 3QRFF 2JN6A 3UKGA 9ANTA 1HKQA 3VPRA 4RAFA 1O3QA 3FX3A 3DEEA 3ZRGA 4B44A 3S1QJ 2O8KA 2LR8A 3JW4A 2M3AA 1MH4A 1ZRDA 3TP3A 2VQHA 4BACA 4KNYA 1LPQA 3I4MJ 2GAUA 1UELB 4HBLA 1OISA 3SQNA 1WPKA 1G2HA 2RQQA 1XMAA 3EETA 4S05A 3SJMA 2XUBA 2QQAA 2YU9J 1MNMC 3RZOJ 2CYYA 2ETHA 4XK4A 3CO7C 1YYVA 4XN0A 3AKZA 2X85A 1CF7A 5IP7J 3JRFA 2XSJC 3J7ZI 2Y30A 2FQ4A 3R4KA 2JZYA 1XSDA 3KZZA 2HOAA 4KIBA 5B66C 1KONA 4Y13A 1P4XA 2YUSA 1OCCH 3HZJA 2JJ7A 1BL0A 3G6EI 2VJJA 4GRIA 1RPWA 2XKOA 4AIKA 2VB6A 3K69A 4D5CA 1TC3C 3VYSB 5HS8A 5E3MA 3PIPF 3HGYA 2R5YA 1N78A 2G7HA 3BQYA 4AVPA 1DP3A 2PQ8A 2DPUA 1R1UA 4P9UA 3RDIA 4G7ZF 3MKLA 1OLTA 2EIMH 2QA4I 2ZO4A 4CCMA 2IVMA 2L3DA 4EM1A 2GWRA 1GHCA 3R6SA 1HKTA 3OYAA 3C2BA 2H27A 1BW5A 2DFIA 1FMVA 4CGZA 2VPRA 2IEKA 2A6EF 3GTKJ 2BGCA 4ABZA 2EIKH 3LSHA 3I55I 1ZLJA 1MBGA 5E1XA 3FDYA 3BPVA 3RPQA 4FETA 4R1HA 3CC4I 4LG0B 4EM0B 1T39A 4M3DA 4F52A 4HDUA 1IRGA 1VQPI 2KJCA 2P5LC 2QZ8A 2WAEA 3FBNB 4RMNA 1WQ2A 3C1DA 5LFAA 1AKHB 4OIPF 3VODA 2A05A 4KT5C 1FY7A 3ZR8X 4A12A 1V55H 2QQBA 5KNLA 5A2QK 2FQ3A 2K9SA 3ZXSA 4IHYA 3IP4B 2XVCA 3S3OA 2KRCA 4PSWA 3WE2A 4YFXF 5JR3A 3S1MJ 1HA8A 3KE2A 1XCVA 4XLCA 3C7JA 2W85A 3OMYA 2GZWA 1BJZA 1XB4A 5E8GA 1F43A 3DEWA 1X1PA 4KN4X 4KJZA 3DLAA 4Z6YA 2R0QC 1IV6A 3M1CA 1YS6A 2HXIA 2O8XA 1U3EM 5LEKA 4ITVA 1FYLA 3OYFA 3G1LA 3DQVC 3OIPA 3QWLA 4A3GJ 1UZCA 1A6IA 3LFUA 4RLFA 1ZR2A 4F7ZA 1TQMA 5H6QA 3E6BA 2M9HA 2P81A 1VTNC 3BROA 1HBXG 3EUHC 1SVLA 1I27A 3BCAA 5C44J 1A35A 2QSHX 3A0HC 3IAS2 3F8NA 3WHBA 4MTDA 2BY1A 3CMYA 1MW7A 1X58A 1FOXA 3ECHA 3U21A 2DQLA 1EF4A 3BTJA 1DP7P 2GQQA 5LHHA 3CP8A 2LKXA 3CMMA 4GYGA 4PUSA 3ZMZA 1J75A 3I56I 2Q0OA 2JPCA 2IS4A 1JKPC 1S6LA 2ELJA 2FF4A 5DD8A 2CSOA 4NC8A 4CO8A 1SEUA 1Y0UA 2KIFA 4UY8I 1ETKA 3R61A 1WJDA 4XOTA 5CVVA 3WTWC 1IXRC 4WCGA 1UJ8A 2HQAA 4WXHA 1ZQ3P 3HSEA 2WTEA 1MH3A 1ETOA 3EYYA 3SZTA 4F93B 2Z9OA 1TBXA 3VYUB 2E1OA 1XGNA 4IRGA 3OYIA 3DBLB 4IHSA 2FBKA 2M2EA 3OYCA 5EGOA 3E6MA 2ZKZA 3PM1A 3KETA 2OTLI 1JJ8C 4IOAF 4LK0F 1RZ4A 4ESFA 2XV4S 2L9SA 2K7LA 1PUFA 2CW7A 4ZTFA 1GXPA 3OS2A 3HRMA 4BE2A 2K3PA 3HOWJ 2PBIA 2WC2A 1R6RA 1DUXC 1DGRM 2XAHA 4RAZA 2VN2A 5IP9J 5DM6F 2VASA 3A01A 4AIDA 2DT5A 1I1SA 4BGDA 1FLIA 4DZJA 1BIAA 5DM7F 1MSEC 5B1AH 4MLOA 2CFXA 5DEQA 3P5JA 2E19A 2E1MB 2HZDA 3ABTA 4R79A 1T56A 1ZR4A 1K83J 4IL6C 2QEXI 4ENJA 3CJTB 2K27A 1TWFJ 2JWTA 3WG9A 4C2TA 4ZDOA 4XIDA 3K70C 1IN5A 1HKSA 5FKOA 2NNNA 4M3FA 1U9NA 2JMWA 3JSPA 4U88A 1HW2A 2DTRA 2J5PA 1QU3A 1N25A 2OV7A 1RETA 1YOVB 2WWYA 4RGRA 3B6AA 3JTHA 2DODA 2DMUA 1X1CA 3CCRI 3V7SA 2ZC2A 5F04A 4E7LA 2GLOA 3MEXA 1FTZA 5FKKA 3OL4A 4BQOA 3BWGA 1VZ0A 1ZGJA 2A61A 2EFOA 3TO7A 5HOOA 3COAC 3BR3A 3L2WA 4OIQF 2KZGA 3OL3A 2F4IA 3PQJA 3CMEI 1KYZA 2GIVA 2VXDA 1FBUA 4KMUX 1BR1A 4XRSG 1XGSA 3LSMA 4GO1A 3ZMUA 3RPUD 3ZMSA 4HW0A 4UB8C 1M1EB 1QHHD 4XRMA 2B9SA 1GXQA 3VB2A 3HSRA 3FXLA 1RIOH 2CQQA 4BHCA 3K1PA 1XX5A 3EUAA 3GXOA 1POGA 4D1QA 4BDZA 1IV8A 1I3AA 2VBYA 1O3RA 2I10A 1D8JA 1QHGA 1H88C 2RDPA 1T2KA 2TRTA 3OIQA 1JGGA 1FOYA 2UUZA 2XGCA 2QM3A 2JPBA 4RM3A 3ASOH 4LIUA 1ZK8A 3W6VA 3G2BA 4PGHA 3H9JA 4L18B 1JI8A 2JK3A 4P96A 3MCZA 1VQ8I 4UV9A 1J5YA 1KU2A 1W5CC 5HS7A 3WG7H 3O8HA 3H9GA 2ZFUA 2HPIA 1SFKA 2ZMEB 2KP6A 4BJ6C 3S3NA 1SD7A 3ZN1A 4DGWB 2MA3A 3KZYA 3QPSA 2LC2A 4C2UA 3HPGA 5AIQA 1ORKA 1BA5A 2X1CA 2L9VA 4HF2A 3S15J 5F1JA 1BOAA 4O5VA 3OYEA 1T8IA 3I9V2 3CP2A 5J4YA 5K5OA 3FXMA 3H3UA 2Q2EB 4LOCA 1ZARA 2M0MA 1QZEA 3A03A 4YRVA 1JJ6C 3KP7A 1Z7UA 4Y15A 3IRQA 3ERMA 2JQ7A 2JVHA 2EV6A 5ICCA 2DT7B 4AD9A 3ZGKA 5TRDA 3AL0B 2WBMA 1ITYA 2UXNA 1R1VA 3GMEA 1HW1A 2H6CA 2BY0A 3FXKA 4I01A 2PI0A 4G94A 4HX8A 3RIRA 1YIOA 2F4OB 3HXLA 1NHAA 2W4SA 1ULYA 2EB7A 3P7NA 5IYCJ 1S5LC 3L1PA 1NK2P 2VXZA 3I4NJ 2PMUA 5LLQA 5FGMA 2R7OA 1D1BA 2OTJI 1AHDP 4O3MA 3H9QA 3WGGA 3BR1A 3QU3A 2E1NA 2K9MA 3IKVA 4CDGA 1WJFA 1ZGWA 4A3BJ 4YELA 2EILH 3CLQA 2EQRA 4XL9A 1ZG1A 1ZN2A 4NBQA 4X1EA 1Y1WJ 2ZXJA 2QF7A 1FIPA 4BNCA 2R3SA 2Y9YA 4RGSA 1JTYA 2RVCA 1SMYF 3LSJA 4H0EA 1VF9A 2KLOA 2WB1A 5J6XA 5CKTA 3L09A 1MMGA 2KL4A 4HPQA 1WFXA 5EDNA 1IRZA 1LKXA 2CUFA 1UG2A 3FBIB 2P6TA 1QO0D 3AG4H 1K78B 1LEAA 1ENHA 2M1BA 4A3LJ 1C0WA 1B1BA 1ETQA 4XKWA 2VBWA 3A1YA 1LDDA 3EUKL 2X9DA 3JREA 2DJIA 2WV0A 3R60A 3CJQB 4WXDA 5CLSA 3DLLF 1GDTA 1WRJA 1FBSA 3L2UA 2EJRA 4CYDA 4HF1A 1E3PA 2VLAA 2Z33A 2ISYA 2DMTA 5KCMA 1X4PA 4KIFA 1AU7A 4B8XA 5DUIA 3KLNA 2LVSA 2HVRA 4IX7A 1YRNB 3CUQB 1VQLI 2I8DA 1CGPA 3SZPA 1D3YA 2AQFA 4MFDA 5LEJA 2AXLA 2A6HF 2A5WA 2EIJH 2X6OA 3FK6A 1V5EA 4LGWA 2IGKA 2ZXWH 2DBBA 3BZ6A 1PDNC 3BG3A 4UHTA 4DOZA 5HLHA 1PVEA 2JSPA 3HUGB 3VSLA 1WKMA 4HEA2 2DA5A 2HS5A 1ERDA 3I59A 2LY1A 2YX4A 4CICA 1TZLA 3G71I 3CCLI 3FKJA 2CW8A 4AU7A 4IZZA 3FHZA 2P0WA 3W2WA 5FLXK 2HYGD 5HODA 4QTRA 2EFPA 4U0WA 5AIPA 2IA1A 3M4OJ 1QZYA 2W7NA 1K79A 1XD7A 2R7RA 1ODDA 2YR2A 1YJWI 3GFMA 3HM5A 3E97A 1KU3A 2BW3B 4F91B 5IP6A 5ICGA 2KPMA 1VQKI 1Z21A 2V26A 2JA2A 5EYRA 1E17A 1A04A 1YS7A 1X1BA 2KHMA 2BZTA 3SEQA 1IZ1A 1KU7A 1H89C 1ETVA 3RKQA 1H8AC 1TT0A 4JX6A 5K7ZA 2R7QA 1TNSA 2H09A 2NYXA 4HG2A 3EQLF 3QOEA 2CUJA 4U7DA 1HDDC 2BE5F 3BQZA 1B4AA 1XDUA 2L54A 4XM3A 3MZHA 3QPTA 2L9NA 3C2GA 4LB6B 1BW6A 2HEOA 1DU0A 3AG3H 1X3WB 3ABUA 4XOPA 3G1OA 3PUBA 2FXAA 2L9RA 5DTDA 3WTZA 3G73A 5E3OA 5EZGA 3LSTA 1EH8A 4DQ2A 2MLKA 2AHQA 2NRAC 4AM3A 4ANJA 2JRTA 3QOPA 1BN5A 3JCUC 3GX4X 5LBQA 3KYCB 2EFNA 2W82A 4EJVA 3PSFA 2VQLA 3M7GA 2IS1A 1VQMI 4UUSB 4ENMA 1YW7A 3GTJJ 4A93J 1VQNI 1ZRCA 3CJRB 4LJZF 2ESHA 4NB5A 3PL8A 1XGMA 3QYBA 4LD5A 2R5ZA 1SC7A 3GYHX 2HTSA 2HDCA 1B6AA 3GZ6A 2VBXA 3IHUA 3J81Z 1O7FA 1W7PA 4EGZA 1Z05A 2CW0F 4Y52J 5E8IA 1QVUA 1FPQA 2MYSA 3F23A 1W5SA 3QP6A 2QLZA 3FM3A 3HKZN 1W0TA 1OKRA 2CU7A 4FCYA 2GXAA 3J7YJ 2O5RA 1XSXA 3VWBA 1G3YA 3DKXA 2XF6A 2WADA 3CZ6A 3U9GA 1X1DA 3BP8A 3OSGA 1ZYRF 3BDDA 3BR6A 3PNYA 3FXUA 2IA2A 5LHGA 4OWRB 3I3LA 3K0LA 2O03A 2A07F 2DA3A 4MQVA 1IDZA 1TNTA 3SXYA 1Z91A 3V8JA 1U2WA 1OCPA 5KVRA 4LITA 3CDIA 2R7WA 4I09A 5HNHA 2NS0A 3ZQHA 2ECCA 3F21A 2MGQA 4AIHA 3FF5A 4EJUA 3BOQA 4XICA 2V9KA 1DQUA 2PN6A 1OR7A 2HKXA 3E0JB 3OYKA 2LD5A 3H3VK 2G9WA 4CCOA 5J4VA 2MH2A 1TP4A 4JOMA 1G8XA 1BBYA 4A3KJ 3CUOA 4M3EA 1MJ9A 4M6XA 4HZFA 4BBRJ 2W48A 5B3SH 2P5VA 1AWCA 1ETWA 2GXGA 2LF7A 1RKTA 4LFUA 1HSTA 1MIJA 1XMXA 4BJTA 5GTHC 2KRHA 3T8RA 1U5TA 2Y69H 4JX4A 4N4OB 2COBA 4J00A 1Y39A 2BY2A 3L2CA 2VKHA 2ID6A 2JUCA 1ON1A 1ZREA 2EA4A 2Z1DA 3ONQA 4PZJA 5IT3A 4Q48A 4Y4RA 1ZAOA 3RKXA 3V8LA 2DA4A 3WTSC 4X0GA 2ELKA 4XN3A 4JYKA 2KQRA 5D4RA 3WTYC 4KICA 2M45A 2OF7A 4E7ZA 2FOWA 4DYRA 4NQWB 4C3JJ 1K61A 1DGWY 2PJRA 1IN6A 4BE0A 1JUMA 1FJLA 3KFWX 2H94A 1Z7LA 2IGMA 2JT1A 5HLIA 5L3FA 2O61A 1XC5A 5J47A 1U8BA 3F9KA 4ZDLA 1YO5C 2VPLA 4OMYA 2OAZA 4B43A 4I6ZA 2P7VB 5EEGA 3S17J 2LOOA 2HQ5A 2PMHA 4A0XA 3HRTA 3U2RA 3FM5A 1V4RA 2V1XA 2R7SA 2L02A 1S7OA 2BEOA 3H36A 1UG0A 4UB6C 3BT9A 2FSWA 1FSEA 3REOA 4DIQA 4RAYA 1YITI 5HNFA 1HSJA 4G8XA 4UVBA 4XBFA 5CQEA 2E1CA 2QBYA 5ILUA 1D8KA 1F36A 2P4WA 3F72A 4R8HA 1FP1D 1FOWA 5D8KB 1HOMA 4BXFA 2HQNA 4RS8A 3ZQIA 5FROA 1UMQA 2NAZA 2IBDA 3BC8A 1ZHFA 2M30A 3OYGA 1YJNI 4XLEA 5J40A 4BQNA 4MEYF 2RC4A 2RV8A 4I02A 2A68F 2EINH 3DP7A 3ABMH 4MGRA 4II3A 2DOEA 3KPHA 4UVAA 2OC6A 5JHFA 2HPMA 3DF8A 4AYBN 4N9HA 2G0EA 3S32A 1TWHJ 3BJAA 4M74A 2CS3A 1Z0XA 4AWXB 2Y48A 1TTYA 5DD4A 3H0GJ 2PX9A 5IYBJ 1B72A 3J7AO 2IT0A 3LSIA 2IA0A 5IPAA 1ZG3A 2MSYA 4II2A 3RZDJ 3T5XA 4NC6A 1SD6A 3QODA 4NC7A 1VI0A 1BM9A 1V3FA 2L7KA 2OA4A 2XPWA 1WHUA 2OQGA 3BZKA 4L9VA 1YX3A 3ZQ7A 1MJAA 1S8NA 2W84A 5M5XJ 2MBFA 5J1YA 1OJLA 2Y31A 5LGNA 2K5CA 4XLFA 2EFWA 5FJ8J 5D6EA 2KIMA 1MBJA 3OR1C 5FD5A 2EZLA 2P6SA 3KP4A 4WF2A 2OU2A 3GLLA 2CV1A 3GLXA 4L9NA 1MZBA 2DLLA 3A4CA 4IVNA 3ABKH 5H6RA 1ZKGA 2LBFB 3ZOBA 1LDJA 1R71A 1R9TJ 3CJNA 2VBZA 2DPDA 1FMWA 1MBKA 3BTCA 2JRMA 3V7RA 2L01A 2V9PA 4LB5A 4EVIA 3MAJA 4NDLA 1EKEA 4I0AA 1QBJA 2DDBA 2M34A 5ICFA 2W57A 3G1MA 1T0FA 3I5UA 3E7LA 2W1OA 3LSGA 5KAIC 3F8MA 1IO2A 3QQAA 3GUDA 1Z3YA 4MNUA 1MMSA 1IN4A 2K40A 4B3XA 3IWZA 2HVQA 2XASA 4PCQA 2LLKA 4RLQA 4IF4A 3RQ4A 3OYJA 1R5GA 1W0UA 4JK1X 4BL0B 4XLAA 5EG0B 2Z3YA 1TW2A 2QQ9A 2OUMA 1DPRA 3SDGA 2E5ZA 4KISA 1RKWA 3DBRB 3GFLA 3AG1H 4D5FA 3BCBA 1J59A 2JSCA 3KP2A 3HRSA 1TWGJ 3K4CA 2CMPA 2AQEA 2QENA 5M3FJ 1P9QC 5DDGA 1LDKB 2FNPA 1X3UA 1IXSB 2DOAA 2XF5A 3E5XA 2KJBA 3H5RA 3Q3SA 4PGGA 2F2EA 1I3QJ 1OR7C 1G3WA 2ZB9A 3BG7A 1Z6RA 5D8LB 5C3EJ 1W36D 2VL8A 4MEXF 3LSPA 2Q1ZB 4OAYA 4PJNA 3JRIA 4G12A 5ILVA 3K70D 3MVPA 4U7BA 5ED4A 1YI2I 1XSVA 1GLNA 3LAPA 1OCRH 3TOAA 2BHZA 5IYDJ 1F5TA 3BLYA 3QPLA 2IRFG 1A31A 3BTLA 1USTA 2F5VA 2HZTA 4CSWA 1U5TC 1Z77A 1YX5A 2C6YA 5DCMA 1R23A 2RREA 1QVTA 2TCTA 1FTTA 2XPVA 4ON0A 4IHWA 2JTVA 1MBHA 2P8TA 2MW8A 2KKOA 4IHTA 2MLGA 3F3XA 3BJ6A 3H3ZA 2O7OA 1MJBA 4HDVA 2GXBA 2H6BA 2KIUA 5CVRA 1D5VA 2XKPA 4XKBA 4H4KC 5DCFA 1NG6A 4BAYA 1YW8A 5CQGA 4I2OA 3GTOJ 5FFXA 3M3YJ 4ETSA 4QPQA 1MNEA 5EJCA 4OIOF 1RR8C 5HLTA 3B73A 3D5SC 3IL2A 1B59A 3ZP5A 2BXZA 4YFNF 4LLNA 1VQ6I 2EV0A 2L5QA 1OCOH 2E7WA 4EJOA 3GO5A 3Q9SA 4A69C 5L3CA 1CQTA 1ZLKA 4Q47A 4FISA 4V2FA 4AUXA 2H8RA 3NAUA 1FT9A 1GV5A 2JUGA 3K4NA 2LY2A 4CYCA 4E70A 1UB9A 3HOXJ 4S0HB 2A69F 4M6VA 2VONA 1FBQA 2W24A 2NOJB 2ESNA 3S8PA 4PDKA 5IT9Z 2L2OA 4BKXA 4WX9A 3E5UA 3LA2A 2R7DA 3IC7A 2HQRA 5M3MJ 4MFEA 4KITB 2DA7A 2XAFA 3PUFA 4HQEA 1LE8A 1O57A 3ZN0A 3OS1A 3OYNA 2B0LA 4XKVA 2M8EA 3QYEA 1KQ8A 1ZG5A 2YSRA 2EBIA 1D0XA 1QPIA 2FEZA 1RRJA 4L5JA 3NQOA 2ZNYA 3HOVJ 2BHYA 3RYPA 1CF7B 3TBIA 3HPHA 3ELKA 4Y7NJ 1HF0A 2L4MA 1XPXA 3F22A 2OZ6A 4I76A 4ZJZA 1MDMA 3BG5A 3S93A 4AC0A 1BI0A 2MABA 2VODA 3MD2A 2RGVA 4A2UA 2Z16A 2L4AA 4Q5SF 4ESBA 1U6GA 3HKZA 2ZXIA 1RUNA 2CJJA 2DOFA 2VE9A 1JHFA 3HG9A 2GA1A 4KUMA 3MQ0A 2VQGA 5JFRA 1P4WA 1TWCJ 3HHHA 2JVGA 3I4PA 1BC8C 4E7KA 3VEPA 1VNDA 2ZSIB 4M72A 3WODF 3V7CA 4B47A 1LJ9A 3LSRA 4BXUA 3M9AA 1OCTC 3CC7I 3C18A 5HDNA 4HOBA 3BG9A 4V2GA 4EEFG 2K85A 3PNTA 1WSUA 1SD4A 2F5DA 3OY9A 2QWWA 1KQ9A 3LA7A 4PJLA 3DU6A 4HA8A 1QZZA 2ID3A 1S72I 2GM4A 3P9IA 1UFMA 4M9SA 1QA6A 2D1VA 3IH4A 4G7OF 3T8TA 1Y8QB 3K4MA 3VYRB 1A36A 2DYSH 4DBQA 2UXXA 2RNJA 3FXRA 1B8IA 4BXXJ 3BR5A 2OCEA 3OYBA 1SFXA 1ZGAA 1P2FA 5TJJA 3OOUA 1TWAJ 3K9TA 1MMDA 2QKLB 3HYIA 2XROA 4IJAA 2Z99A 5FKNA 2R92J 1ON2A 3RSNA 3JTGA 5JVGF 2F5EA 2LRDA 1Y1VJ 4HNTA 3TO9A 3CCJI 5F64A 4KIGA 1SVOA 1T0FC 2LP0A 3EPZA 5LRSA 3HOUJ 3K4BA 4N9IA 1KGSA 1KZHA 2WA0A 1PP8F 4HV6A 3HJEA 2DMNA 2ACJA 2HVSA 4CZZA 4I99C 1BI1A 3Q0VA 3CESA 4XR6A 3E6CC 5E1ZB 5HVQC 2X6XA 4G6TB 4G9YA 3IKTA 1MD0A 3JRHA 3Q0WA 3FXOA 2FD5A 1FNNA 2R93J 4HAMA 6PAXA 1A5JA 1TQIA 4IOCF 1ETYA 3K2AA 4OU0A 3VFZA 3RTRA 3A2KA 3GTMJ 2E35A 3Q9VA 4XRFA 1FC3A 2Y75A 5D4SA 2RAEA 3M8JA 2QGUA 5K7FA 5CJ9A 5H2FC 3IH2A 2N8GA 2DTZA 3KCCA 3SYTA 5IOYA 3DKWA 2R7UA 3DU5A 3SEZA 1QRYA 3R0AA 1X2MA 1XDSA 2XB0X 3G3ZA 4E4HA 1MKMA 1P7IA 2HGCA 4D7NA 3KIOA 1Q1HA 4L0ZB 1FEXA 3D0SA 2EA2A 2CV2A 3OV8A 2O6GE 3JAMZ 1FSHA 3DPUA 2O0YA 5BNGA 2FBIA 3HEFA 3JRBA 3HOTA 2M7AA 1ACIA 2X48A 4XLPF 2MC3A 5GAEJ 1WVRA 3LQQA 4QSHA 3VSKA 5B1BH 2Y2ZA 4AYBA 4YEJA 3ZQCA 2K9LA 4ZYAA 5F0CA 4LG0A 3ZCOA 5K5QA 5EGOB 2XGXA 2RKHA 3I53A 5CYVA 4BQQA 3IV5A 1E3HA 4OIRF 3O8GA 1JUSA 5C4XJ 1GVDA 4EM2A 2QUFA 3N05A 1TW3A 4ZH4F 1APLC 5FKMA 5E18F 1AKHA 3GTLJ 4XNFA 2JA6J 1BI2A 1PUFB 2NVTJ 1Z3XA 2IPQX 3CCQI 2RN7A 3J80Z 1XS9A 3S1NJ 4M3BA 5IOZA 4W97A 4ZYEA 1F4KA 4EV0A 1Z67A 2KZVA 3GFJA 4JBAA 4A0ZA 1XTAA 4DBRA 1DU6A 1BR2A 4BH9A 3A01B 3BTIA 2K9NA 2H1LA 2KFDA 5JHUA 1NK3P 3MKZA 4B3AA 3JRCA 3D5RC 1YG2A 3BR2A 2EV5A 2E34A 2NXNB 1BI3A 2ADUA 4LLLA 2CH0A 4IQJA 1JGSA 3ZPLA 3V42A 2X51A 2PMZN 5E3LA 1MBFA 1B9MA 4MHGA 3PFYA 4M9ZA 2V4JC 4IHVA 4RBOA 3NARA 2XSDC 2KDOA 3AAFA 4HRIA 5K5RA 4CH7A 1W5TA 4KFCA 4XKCA 3J81K 4I7HA 2F5FA 2ZFWA 3CCUI 4RDUA 3S14J 2X6WA 2F48A 2LH9A 2CUEA 3BY6A 3ISPA 5D5WB 4MO7A 3OYMA 2VI6A 2OQRA 2Y0SN 3L9FA 4A6DA 2HYFA 4KYWA 3VYTB 3S2WA 1R4NB 4P5OA 3HSFA 3HGGA 2BBYA 1E0EA 3BZCA 4U87A 3JRDA 3F8FA 4JQFA 5J1RA 3E3VA 1H0MA 2CUZA 3S2HJ 1KQ0A 1LNWA 4A5NA 4WXCA 2MD0A 1OYYA 3T0YA 1XG1A 2LFBA 2Z5UA 3QAHA 1BJAA 1F9NA 2XHKA 4C3HJ 5FO5A 4F92B 2K3FA 2CFOA 4BDYA 3JRGA 4GCVA 2DA2A 4GXOA 1MMAA 4KT6A 4FTHA 2CGPA 5CPRB 4BQAA 4HYEA 4G6QA 3H92A 1O4XA 2FE3A 5F1RA 3PO2J 4BHPA 1HXDA 1JT6A 1QGPA 4B1RA 4BE1A 2K02A 1GVJA 2OJED 1O3SA 4Y3OA 2DA1A 2XB5A 4GDFA 3CD6I 5FD6A 3WU2C 2Y0MA 3L2VA 2CG4A 2R7VA 3PO3J 3I71A 1VQ9I 3ZMTA 3IUOA 3QYFA 1X1AA 5E20A 1MGTA 2HOSA 3JSOA 1I6XA 4ZZDA 3PIOF 1LFUP 3HOSA 3MZYA 1OPCA 2A3SA 3ZMVA 2IS2A 2FJ1A 2DQRA 2V7FA 2NNYA 4ESJA 5HDKA 1Y0NA 4J19A 3O2PE 2XRNA 2VJIA 3CF5F 4G7HF 4FT8A 4IPAA 2Y9ZA 2Z2SB 4YIFA 3GZ5A 5GTIC 2BVLA 2P5KA 2PEXA 3TOBA 3K2ZA 1K4TA 1R5ID 2E60A 3RKWA 4TV7A 3OS0A 1R58A 1O3TA 2MD5A 3LAJA 1D0YA 4GGGA 1G3TA 4EJWA 4RM2A 2GOMA 3Q5FA 5E1WA 1LB2A 2D1HA 5J3LA 1IAWA 5F0FA 4WWCA 3ROUA 3TO6A 3K1MA 1RC9A 5GAGJ 5J1UA 1TT5B 2NVYJ 4UV8A 4HSTA 4L9JA 2LMDA 3SDBA 3CCSI 3KP3A 2E2IJ 2WY8Q 4XLHA 3KYLA 3RJPA 2LKPA 3FKIJ 1JTXA 3ZQLA 5HLGA 3FWEA 4I98B 4ZC3A 3D1NI 5DV5A 2K86A 3BJOA 3X2QH 3KEOA 1D1CA 1YFHA 2DN0A 2DDAA 2QQ8A 3KP6A 4D7MA 4E7IA 1IN8A 2ZJ2A 3CDHA 4OOIA 1RI7A 2UZKA 4U0VA 3MZ8A 3DXJF 2AXTC 2LREA 3DCFA 2V1UA 1UHMA 4DW6A 4A3JJ 3F0CA 3DTKA 3UR3C 2WB1N 4A3CJ 2COMA 3C3WA 3TDZC 4DJAA 3H1CA 1F1ZA 2OBPA 2K4BA 1TLHB 2DI3A 3SFZA 3F6VA 4IO9F 5LHIA 2I5UA 4CXFA 2PFBA 1U0JA 3TW7A 4ZYDA 2PLYA 1T6SA 1G59A 4HV5A 3S16J 1WWXA 5F08A 3G4SI 1T38A 3EYIA 3T1BA 4CHUA 1TQPA 3LSKA 3OWTA 5LGUA 4P9FA 5EEHA 2DXIA 2ZMEA 1LVAA 4A6EA 4CZCA 4EATA 2PJPA 3MWMA 3Q0UA 3W6KB 5LD2C 1B9NA 5JLXA 1Y8RB 3GVAA 1O7LA 2FMLA 1WJBA 2CQXA 4AVZA 3CTAA 4RB0A 4E7SA 2RQPA 4MQ9F 3A0BC 1R7JA 2E36A 2Q2EA 2GIZA 3DTIA 1BC7C 3DPLC 3N97A 2LG4A 3GBGA 4LMYA 2V9VA 3CDLA 4KMFA 5F6FA 3CCYA 3I59B 1J0RA 3E1SA 3P9KA 3RPUA 4F55A 2HNHA 4PJJA 2L7MP 1PJRA 3ASNH 1J2XA 1PP7U 1GT0C 1T95A 2FOKA 2L0KA 3PQKA 3OYHA 1LFPA 1J9IA 1JE8A 2M4KA 4U0YA 4Z2YA 3DTEA 1OQYA 4C9YA 4LLGF 4ZZLA 1NG7A 4X6AJ 1YTYA 2STTA 3J7AY 3CLOA 1KA8A 5F0HA 2HKOA 3WHCA 2ISZA 4MTEA 1W7PD 1FWZA 2W00A 1A6QA 3LWFA 4EQQA 2OCCH 2EFQA 2GBYA 4OAZA 2VKDA 4YFKF 4BY7J 4RA2A 3ECOA 3A02A 5AONA 2A6TA 4XLNF 3W6JB 1I5ZA 1MSFC 2ZCWA 2FA5A 3FK7A 4L5IA 2M7BA 5FKLA 2UV1A 4OINF 1P4AA 2FRHA 3WGHA 1WZ2A 1USSA 1UHSA 3DPTA 5K7HA 1TL8A 2VQCA 5H20A 2NOGA 4QLCU 5J8CA 5A2QZ 1WGXA 2LYCA 3RQIA 1I39A 1R36A 4L9TA 3RCOA 1K78A 3B6CA 3WTUC 5GAHJ 3LMMA 1R5HA 3GW2A 2ZJRF 1P7JA 4IKFA 1IXCA 1DPUA 3RKYA 2VKVA 3MMYB 3GF2A 1Z9CA 1BIBA 1XCBA 3IAM2 4BEHB 1IW7F 1HDPA 2ECBA 3FZVA 5EEAA 2BY3A 5ICEA 1V5GA 5BQTA 5DS9A 2DYRH 2BYVE 2HU9A 3PNVA 4CCNA 1YRNA 3F8CA 4YIIA 3CUQA 4XMYA 3S3MA 2KRFA 1S9HA 1R1TA 1LVKA 3M8FA 2R5ZB 2QVOA 5BMZA 1DDNA 4A3EJ 1JKRC 2X1EA 2QYOA 4BYYA 1X4OA 3FMQA 2LY9A 4S04A 3ZQQA 4PFPA 1W7PB 1IGNA 4P1WA 3CCEI 4M3GA 2MFZA 2O9LA 1E3OC 3HUGA 1J09A 2VOOA 2DW4A 3HHGA 1MMNA 4C2MJ 3CCVI 5LRRA 1V54H 3TW6A 1EH7A 2E1MC 4AIJA 3GCMA 4PSXA 3VOEA 2XPUA 1Y56A 2IS6A 1JXSA 4ZYGA 1IRFA 1S7EA 1G4DA 1HLVA 5ERIA 1KU9A 3E6DA 4D9JA 1JKQC 2F4MB 3GFIA 1U8RA 3ABLH 1P92A 1J7KA 2WAQN 3DEUA 3HOZJ 1IUFA 1WCMJ 2BW3A 4MIMA 5IT9K 3I54A 4IQ4A 3D5LA 3U1KA 4HNUA 2ZXHA 2V79A 4XORA 5BPDA 2XGEA 1G6NA 2FU4A 3I58A 4OMZA 3EDPA 1H9TA 2QSFX 4FQGA 2DK8A 3H5NA 3GTQJ 4NNJA 1XMKA 1ONVA 2PMZA 3BG6A 3AG2H 4A3IJ 5FLVA 2EZIA 2M87A 1JKOC 2EZKA 3DKYA 1XN7A 1W36C 1D0ZA 1I1GA 1U5TB 3PSIA 3TQNA 2LTPA 5BOXA 2R7ZJ 4BY1J 2FNAA 1VQ7I 1EJ9A 3R0JA 3LOCA 3ESWB 2BOLA 4HNVA 4L0YB 2ZNZA 5E17F 1IG7A 2Y0SA 4FE7A 3KLOA 1EH6A 5L3GA 3SHFA 4C3IJ 2PJRB 3B02A 5E79C 1RNLA 4DNCA 2IXSA 4UUSA 1HQCA 3WE3A 1PUEE 5DUKA 3GZNB 3RYRA 1LUJB 4CUGA 1T33A 3O3KA 3GWZA 2M4GA 2EZHA 2WY7Q 2IAIA 2YPRA 2ZMEC 3HC7A 5HDGA 5ILSA 4J01A 2ZJPF 4UVCA 4NHJA 4A3DJ 1WJEA 3OIOA 1RESA 3OR2C 1YIJI 5TISC 3FHNA 1YE9A 3L2QA 1K4SA 1VFCA 3KEQA 2MC4A 5BPIA 2GOXB 2VT2A 2P7CB 3NWTA 2WV1A 3WTVC 2VE8A 2CQ7A 2X1DA 4DZPA 1SVMA 3S1RJ 3HOYJ 5BS6A 3K10A 4ZYHA 2XAUA 3CCMI 2R5YB 4RB3C 1SAXA 2JA5J 4B48A 4PJMA 2B63J 5CVJA 4EJTA 3H5AA 2QBYB 2E7XA 2VJ5A 3K4LA 3ZMDA 3E5QA 3UNGC 5FLMJ 3W2VA 1R22A 4F3QA 2XIGA 3AL0C 3BR0A 2VOPA 2NVQJ 5JI6A 1SANA 4D0PA 2YU3A 3CF2A 4HQMA 5D5VB 1H9GA 3TMOA 3FMSA 4QPOA 3H0DA 2DJNA 1S7AA 5C4JJ 5LGTA 2XF7A 3JRAA 2QSGX 5KK1A 1NH3A 2JA8J 1X2NA 1Z1DA 3F8BA 3VDXA 3M07A 5J8FA 4RGXA 3I64A 1EA3A 2DMQA 2IGNA 2DA6A 4HX7A 3C2HA 4PJ0C 3TKYA 1OYIA 1L0OC 1MNDA 1YQAA 2HR3A 3W3CA 4ZDPA 4Y33A 5D5XB 2YS9A 5L3EA 1ZH5A 1XGOA 2W25A 1ZELA 3FMRA 3M8EA 2HFHA 1U9OA 1ZRFA 2LNBA 1VQ4I 2E2HJ 4IRHA 1B72B 1WI9A 4PK4A 2DFEA 2IP2A 4B4CA 2IGOA 3JR9A 1STZA 3L7WA 1UCRA 1X3ZB 2A5YB 2LKSA 3DBHB 3IH3A 1LQ1A 5D6FA 1Y6IA 3BPXA 5EZHA 4CA0A 1L3LA 1IJWC 2STWA 2HDWA 1P6RA 2R7XA 1LEBA 2BXYA 1K6YA 2VC0A 2D2WA 2E2JJ 3F6OA 4QWQA 4CCKA 3ZQFA 2IW5A 1G3SA 4KN7X 4KA4A 2ZSHB 4KDPA 3N4MA 1OCZH 1HW5A 1R4MB 4YG2F 3SZGA 4NQWA 4ENKA 4DYQA 1YW9A 4JP0A 2L7ZA 3CO6C 5KAFC 3FXJA 2TDXA 2MH9A 3WTTC 4UUVA 5TGTA 1KYWA 3ML6A 5FFZA 3S2DJ 2KDZA 1QQIA 2MG4A 4WK8F 1ETXA 3OYLA 1FP2A 2DCEA 2ELHA 2GA2A 3CQZJ 3FIWA 3JAMK 4A0YA 4UNOA 5GPAA 4RGUA 1WJ5A 4LIVA 4W1UA 4P55A 5HS9A 2NVUB 1WH7A 2KISA 3QPHA 5K1YA 3LFKA 1BR4A 3CUQC 2EH3A 2O3FA 3KX2A 1QNTA 1X19A 2HOEA 2XRLA 1SFOJ 2ME0A 3HTSB 2DFFA 4A5MA 1WH5A 2OZUA 5EF6A 1WJCA 2XAQA 4A3MJ 4M73A 4UXNA 3RI4A 2AO9A 5JVTA 4N0BA 2NS7A 3WU1B 2X4HA 1SMTA 2XDVA 3P9CA 4V19K 1MBEA 4FE4A 1AA7A 2DO7A 2ME6A 3LQRA 3DFGA 4CCJA 4ASNA 1N77A 3J80K 2CQNA 3MFKA 4LK1F 3HL2A 1R49A 4XSZF 2X6YA 3KEYA 5M5YJ 3WGIA 2CV0A 3GEZA 1N75A 1RR7A 1W1WE 1LFBA 1GV2A 2XAGA 4GFBA 4E7JA 4Y17A 1V5FA 2G7UA 3H35A 3OYDA 4M6YA 3LNQA 4RB1A 2WAFA 2XC7A 1T98A 3IRRA 2EK5A 1NTCA 2V1DA 4BU2A 2NVXJ 3NWSA 2VUMJ 3KYDB 4XONA 4HLYA 2H8WA 3U1DA 2XAJA 3OOPA 4IEJA 2D5VA 1AOYA 2BV6A 2JA7J 2R7FA 1UHWA 2VKEA 4BUPA 1SD5A 2V1NA 4XQFA 4BJ5C 3MN2A 1OMIA 1IRXA 2VIXA 1FYMA 1U78A 3ULQB 5FRNA 2XGDA 4GYIA 4HF0A 4XSXF 2M0CA 1WI3A 1I50J 4JX5A 2R4GA 5DCMB 1REPC 2CWEA 3KP5A 2FMYA 2LSOA 3QP5A 4N4NB 4RB2C 2LDUA 3L00A 4A3FJ 1EV7A 1S29A 2J5OA 2KIQA 4BBSJ 1FIAA 2F6CA 2ZJQF 1YJ9I 2HOTA 3SFIA 1K7AA 4I0BA 3V4GA 2H1KA 1SFUA 5GADJ 5FRMA 2F5CA 3NEUA 4E7HA 5CVUA 3GTPJ 4HLXA 2NS8A 3PFIA 3M1EA 5JLWA 1D5YA 1QPMA 4DYCA 2LF8A 2QKMB 2LBFA 1GUUA 3ZQGA 2CQKA 4BS9A 2HYJA 4IHXA 2L7FP 2FX0A 3IWFA 1VQOI 3O6BB 3TGNA 2E71A 5GPCA 2K4JA 2KT0A 4M9XA 4B09A 3HDDA 5FLXZ 4ENNA 4FX4A 2V6CA 5L3DA 3K6GA 1OYWA 4RAGA 5DYMA 4CYCB 4EGYA 2DAOA 2FUG2 3HBLA 4G6DA 2X0LA 4FHTA 4XRSA 5GP9A 5F27A 4O6JA
chains in the Genus database with same CATH topology
1R00A 1SFEA 3TDUC 1RUOA 3ERED 1IN7A 1FZPB 2CO5A 1FYKA 2EWNA 2FBHA 1JHHA 3EUHA 4FX0A 2AS5F 3QU6A 5FB2A 4Q4ZF 3WTXC 4IRIA 1MDMB 3DV8A 2D45A 1IUYA 3LA3A 3V8KA 2VT3A 2IJLA 2VC1A 2DU9A 3HIFA 3FXQA 4M71A 2Q8KA 5D5UB 5L3BA 1YLFA 3NRVA 1S3JA 2YX7A 3K1NA 1E2XA 5CVIA 2M5WA 1FX7A 1Z6TA 2UWMA 1K6OA 3HTUA 4K2EA 2DK5A 2HWVA 4BHBA 2PG4A 1IF1A 4IXAA 3I0TA 3HRUA 2ZBKA 3WU0A 1W4MA 4HX4A 2OD5A 2HTJA 4EMSA 1FOKA 3QRFF 1HKQA 1O3QA 3FX3A 3JW4A 1ZRDA 4KNYA 2GAUA 4HBLA 3SQNA 1XMAA 3EETA 4S05A 2XUBA 2QQAA 2CYYA 2ETHA 3CO7C 1YYVA 1CF7A 3R4KA 2JZYA 1XSDA 3KZZA 4KIBA 4Y13A 1P4XA 4AIKA 2XKOA 3K69A 5HS8A 2G7HA 4AVPA 2PQ8A 2DPUA 1R1UA 4P9UA 3RDIA 4G7ZF 2ZO4A 2IVMA 2L3DA 4EM1A 2GWRA 1GHCA 3R6SA 1HKTA 2H27A 2DFIA 4CGZA 2A6EF 2BGCA 1ZLJA 5E1XA 3BPVA 3RPQA 4R1HA 4LG0B 4EM0B 1T39A 4HDUA 1IRGA 2KJCA 2P5LC 2QZ8A 1WQ2A 3C1DA 4OIPF 3VODA 4KT5C 1FY7A 4A12A 2QQBA 5A2QK 2FQ3A 2XVCA 3WE2A 4YFXF 5JR3A 3KE2A 1XCVA 3C7JA 2W85A 2GZWA 1XB4A 5E8GA 4KN4X 1YS6A 1U3EM 2O8XA 5LEKA 1FYLA 3DQVC 4F7ZA 1TQMA 5H6QA 3E6BA 1VTNC 3BROA 1HBXG 1I27A 3F8NA 4MTDA 3ECHA 2DQLA 1DP7P 2GQQA 5LHHA 4GYGA 1J75A 3ZMZA 2Q0OA 2JPCA 1S6LA 2FF4A 5DD8A 2CSOA 4CO8A 1Y0UA 2KIFA 3R61A 3WTWC 5CVVA 1IXRC 4WCGA 4WXHA 3HSEA 2WTEA 3EYYA 3SZTA 2Z9OA 1TBXA 4IHSA 1XGNA 4IRGA 2FBKA 3E6MA 2ZKZA 3KETA 4LK0F 1RZ4A 4ESFA 2XV4S 2K7LA 1GXPA 3HRMA 2PBIA 2WC2A 1DUXC 2XAHA 4RAZA 2VN2A 2DT5A 1I1SA 1FLIA 1BIAA 2CFXA 5DEQA 3ABTA 4R79A 4ENJA 2K27A 3WG9A 1IN5A 1HKSA 2NNNA 3JSPA 4U88A 1HW2A 2DTRA 2J5PA 2WWYA 4RGRA 3JTHA 3V7SA 3MEXA 3BWGA 1ZGJA 3COAC 2A61A 2EFOA 3TO7A 5HOOA 4OIQF 3PQJA 1KYZA 2GIVA 1FBUA 4KMUX 1XGSA 4GO1A 3ZMUA 3ZMSA 4HW0A 1GXQA 3VB2A 3HSRA 1RIOH 4BHCA 3K1PA 3GXOA 2VBYA 1O3RA 1D8JA 2RDPA 1T2KA 2QM3A 2JPBA 4PGHA 4L18B 4P96A 3MCZA 4UV9A 1J5YA 1KU2A 5HS7A 2ZMEB 3ZN1A 1SD7A 2MA3A 3KZYA 5AIQA 4HF2A 1BOAA 4O5VA 5K5OA 3H3UA 1ZARA 3KP7A 1Z7UA 4Y15A 3IRQA 2EV6A 5ICCA 4AD9A 5TRDA 2UXNA 1R1VA 1HW1A 2H6CA 4I01A 2PI0A 4G94A 4HX8A 3RIRA 1YIOA 1NHAA 1ULYA 2EB7A 3P7NA 2VXZA 2PMUA 5LLQA 5FGMA 4O3MA 3WGGA 3QU3A 2E1NA 3IKVA 4CDGA 1ZG1A 1ZN2A 2ZXJA 4BNCA 2R3SA 4RGSA 2RVCA 1SMYF 4H0EA 5J6XA 3L09A 2P6TA 1QO0D 1K78B 1LEAA 2M1BA 1C0WA 1B1BA 2VBWA 1LDDA 2WV0A 3R60A 4WXDA 5CLSA 1WRJA 1FBSA 2EJRA 4CYDA 4HF1A 2Z33A 2ISYA 4KIFA 4B8XA 5DUIA 3KLNA 3CUQB 1CGPA 3SZPA 1D3YA 5LEJA 2AXLA 2A6HF 4LGWA 1PDNC 2DBBA 3BZ6A 4UHTA 5HLHA 1WKMA 2HS5A 3I59A 2YX4A 4CICA 3FHZA 5FLXK 2HYGD 2EFPA 4U0WA 5AIPA 2IA1A 1QZYA 1K79A 1XD7A 1ODDA 2YR2A 3GFMA 3E97A 1KU3A 5ICGA 1E17A 1A04A 1YS7A 1IZ1A 1KU7A 1TNSA 2H09A 2NYXA 3EQLF 4U7DA 2BE5F 1B4AA 1XDUA 2L54A 3MZHA 3QPTA 4LB6B 2HEOA 3ABUA 3G73A 2FXAA 3WTZA 3LSTA 1EH8A 4DQ2A 2MLKA 2NRAC 2JRTA 3QOPA 1BN5A 3GX4X 5LBQA 2EFNA 4EJVA 3M7GA 4ENMA 1YW7A 1ZRCA 4LJZF 2ESHA 4NB5A 1XGMA 4LD5A 3GYHX 2HTSA 2HDCA 1B6AA 3GZ6A 2VBXA 3IHUA 3J81Z 1O7FA 1W7PA 4EGZA 1Z05A 2CW0F 5E8IA 1FPQA 3F23A 1W5SA 3QP6A 2QLZA 3FM3A 1OKRA 1XSXA 1G3YA 3U9GA 3BP8A 1ZYRF 3BDDA 3FXUA 2IA2A 5LHGA 3K0LA 2O03A 2A07F 4MQVA 1TNTA 3SXYA 1Z91A 3V8JA 1U2WA 5KVRA 4I09A 2NS0A 3F21A 4AIHA 3FF5A 4EJUA 3BOQA 2PN6A 1OR7A 2HKXA 2G9WA 2MH2A 1BBYA 3CUOA 1MJ9A 4M6XA 4HZFA 2P5VA 1AWCA 2GXGA 2LF7A 4LFUA 1HSTA 3T8RA 1U5TA 3L2CA 1ON1A 1ZREA 2EA4A 5IT3A 4PZJA 4Q48A 1ZAOA 3RKXA 3V8LA 3WTSC 5D4RA 3WTYC 4KICA 2M45A 1IN6A 3KFWX 2H94A 2JT1A 5HLIA 5L3FA 2O61A 1YO5C 4OMYA 2OAZA 2P7VB 5EEGA 2PMHA 4A0XA 3HRTA 3U2RA 3FM5A 1V4RA 2V1XA 2L02A 1S7OA 2BEOA 2FSWA 1FSEA 3REOA 4RAYA 1HSJA 4G8XA 4UVBA 4XBFA 2E1CA 2QBYA 5ILUA 1D8KA 2P4WA 3F72A 4R8HA 1FP1D 5D8KB 2HQNA 4RS8A 2NAZA 1ZHFA 2M30A 4MEYF 2RC4A 2RV8A 4I02A 2A68F 3DP7A 4MGRA 4UVAA 3DF8A 4N9HA 3BJAA 4M74A 4AWXB 2Y48A 1TTYA 5DD4A 3J7AO 2IT0A 2IA0A 1ZG3A 3T5XA 1SD6A 1BM9A 1V3FA 2OA4A 4L9VA 2OQGA 3ZQ7A 1MJAA 1S8NA 2W84A 2MBFA 5LGNA 2EFWA 5D6EA 2KIMA 5FD5A 2P6SA 3KP4A 4WF2A 2OU2A 3GLXA 4L9NA 1MZBA 2DLLA 4IVNA 5H6RA 1LDJA 3CJNA 2VBZA 2DPDA 3V7RA 2L01A 4LB5A 4EVIA 3MAJA 4I0AA 1QBJA 5ICFA 2W57A 3I5UA 1T0FA 3F8MA 3GUDA 4MNUA 1IN4A 3IWZA 2XASA 4PCQA 4IF4A 1R5GA 4JK1X 2Z3YA 1TW2A 2QQ9A 1DPRA 3GFLA 1J59A 2JSCA 3KP2A 3HRSA 2QENA 5DDGA 1LDKB 2FNPA 1X3UA 1IXSB 3E5XA 2KJBA 4PGGA 2F2EA 1G3WA 1Z6RA 5D8LB 4MEXF 5ILVA 4U7BA 5ED4A 1XSVA 3LAPA 3TOAA 1F5TA 2IRFG 1USTA 2HZTA 1U5TC 2C6YA 5DCMA 1R23A 4ON0A 2JTVA 2P8TA 2KKOA 4IHTA 2MLGA 3F3XA 3BJ6A 3H3ZA 4HDVA 1MJBA 2GXBA 2H6BA 2KIUA 5CVRA 1D5VA 2XKPA 5DCFA 4BAYA 1YW8A 4I2OA 5FFXA 4ETSA 4OIOF 3B73A 3IL2A 1B59A 3ZP5A 4YFNF 4LLNA 2EV0A 2E7WA 4EJOA 3GO5A 3Q9SA 5L3CA 1ZLKA 4Q47A 1FT9A 4E70A 1UB9A 2A69F 2VONA 1FBQA 2W24A 2ESNA 4PDKA 5IT9Z 4WX9A 3E5UA 3LA2A 2R7DA 3IC7A 2HQRA 2XAFA 4HQEA 1O57A 3ZN0A 2B0LA 2M8EA 1KQ8A 1ZG5A 2YSRA 2FEZA 4L5JA 3NQOA 2ZNYA 3RYPA 1CF7B 3ELKA 2L4MA 3F22A 2OZ6A 1MDMA 1BI0A 2VODA 2RGVA 4A2UA 2L4AA 4Q5SF 4ESBA 1U6GA 1RUNA 2VE9A 1JHFA 2GA1A 4KUMA 3MQ0A 5JFRA 1P4WA 3HHHA 3I4PA 1BC8C 3VEPA 4M72A 3WODF 3V7CA 1LJ9A 4BXUA 3M9AA 3C18A 5HDNA 4HOBA 1WSUA 1SD4A 2F5DA 2QWWA 1KQ9A 3LA7A 4HA8A 1QZZA 3P9IA 1UFMA 4M9SA 2D1VA 4G7OF 3T8TA 2UXXA 2RNJA 3FXRA 1SFXA 1ZGAA 1P2FA 5TJJA 3K9TA 3HYIA 2XROA 4IJAA 2Z99A 1ON2A 3JTGA 2F5EA 3TO9A 5F64A 4KIGA 5LRSA 4N9IA 1KGSA 1PP8F 4HV6A 2ACJA 4CZZA 1BI1A 3E6CC 5E1ZB 5HVQC 4G9YA 3IKTA 1MD0A 1FNNA 4HAMA 6PAXA 1TQIA 4OU0A 3VFZA 3RTRA 3Q9VA 4XRFA 1FC3A 2Y75A 5D4SA 5CJ9A 3KCCA 3DKWA 3R0AA 1XDSA 3G3ZA 1MKMA 2HGCA 1Q1HA 4L0ZB 3D0SA 2EA2A 3OV8A 2O6GE 3JAMZ 1FSHA 2O0YA 2FBIA 3HOTA 4XLPF 2MC3A 3LQQA 4LG0A 5K5QA 2XGXA 2RKHA 3I53A 5CYVA 4OIRF 4EM2A 2QUFA 1TW3A 4ZH4F 5E18F 1BI2A 2IPQX 2RN7A 3J80Z 4ZYEA 1F4KA 4EV0A 3GFJA 4JBAA 4A0ZA 4BH9A 5JHUA 1YG2A 2EV5A 1BI3A 2ADUA 4LLLA 1JGSA 3ZPLA 1B9MA 4MHGA 4M9ZA 3AAFA 5K5RA 1W5TA 4KFCA 3J81K 4I7HA 2F5FA 2ZFWA 3BY6A 3ISPA 5D5WB 2OQRA 3L9FA 4A6DA 2HYFA 4KYWA 3S2WA 4P5OA 3HSFA 2BBYA 3F8FA 4JQFA 3E3VA 1H0MA 4A5NA 1KQ0A 1LNWA 4WXCA 1OYYA 3T0YA 2Z5UA 3QAHA 1BJAA 1F9NA 2XHKA 5FO5A 4GCVA 4GXOA 2CGPA 4BQAA 4HYEA 4G6QA 3H92A 2FE3A 5F1RA 4BHPA 1HXDA 1QGPA 2K02A 1GVJA 1O3SA 5FD6A 2Y0MA 2CG4A 3I71A 3ZMTA 5E20A 1MGTA 3JSOA 1I6XA 4ZZDA 3HOSA 3MZYA 1OPCA 2A3SA 3ZMVA 2DQRA 2NNYA 4ESJA 5HDKA 3O2PE 2XRNA 4G7HF 4FT8A 4IPAA 4YIFA 3GZ5A 2P5KA 2PEXA 3TOBA 3K2ZA 3RKWA 4TV7A 1R58A 1O3TA 2MD5A 3LAJA 4GGGA 1G3TA 4EJWA 3Q5FA 5E1WA 1LB2A 2D1HA 1IAWA 4WWCA 3ROUA 3TO6A 3K1MA 4UV8A 4L9JA 3KP3A 3RJPA 2LKPA 5HLGA 3FWEA 4I98B 5DV5A 2K86A 3BJOA 3KEOA 1YFHA 3KP6A 1IN8A 2ZJ2A 3CDHA 4OOIA 1RI7A 2UZKA 4U0VA 3DXJF 2V1UA 1UHMA 2COMA 3C3WA 3TDZC 1F1ZA 2OBPA 2K4BA 1TLHB 2DI3A 3SFZA 3F6VA 5LHIA 4CXFA 2PFBA 4ZYDA 2PLYA 1T6SA 4HV5A 1WWXA 1T38A 3EYIA 3T1BA 4CHUA 1TQPA 5LGUA 4P9FA 5EEHA 2ZMEA 1LVAA 4A6EA 2PJPA 3MWMA 3W6KB 1B9NA 3GVAA 1O7LA 2FMLA 3CTAA 4RB0A 2RQPA 4MQ9F 1R7JA 2Q2EA 1BC7C 3DPLC 3N97A 4LMYA 2V9VA 4KMFA 5F6FA 3I59B 1J0RA 3P9KA 3RPUA 1J2XA 1PP7U 2FOKA 3PQKA 1J9IA 1JE8A 4U0YA 4Z2YA 4LLGF 4ZZLA 1YTYA 2STTA 3CLOA 1KA8A 2HKOA 2ISZA 4MTEA 1W7PD 1FWZA 4EQQA 3LWFA 2EFQA 4YFKF 3ECOA 5AONA 4XLNF 3W6JB 1I5ZA 2ZCWA 2FA5A 4L5IA 4OINF 1P4AA 2FRHA 3WGHA 1USSA 3DPTA 5H20A 4QLCU 5J8CA 5A2QZ 1R36A 4L9TA 1K78A 3WTUC 1R5HA 3GW2A 1IXCA 1DPUA 3RKYA 3GF2A 1BIBA 1XCBA 1IW7F 3FZVA 5ICEA 5BQTA 2BYVE 3F8CA 4YIIA 3CUQA 2KRFA 1R1TA 3M8FA 2QVOA 5BMZA 1DDNA 2QYOA 4BYYA 3FMQA 4S04A 1W7PB 2VOOA 3HUGA 2DW4A 3HHGA 5LRRA 1EH7A 4AIJA 3VOEA 1JXSA 4ZYGA 1IRFA 1G4DA 5ERIA 1KU9A 3E6DA 3GFIA 1U8RA 1P92A 1J7KA 3DEUA 5IT9K 3I54A 3D5LA 2V79A 5BPDA 1G6NA 2FU4A 3I58A 4OMZA 3EDPA 1H9TA 2DK8A 1XMKA 1ONVA 2M87A 1XN7A 1I1GA 1U5TB 3TQNA 5BOXA 2FNAA 3R0JA 4L0YB 2ZNZA 5E17F 5L3GA 3KLOA 1EH6A 3SHFA 3B02A 1RNLA 4DNCA 1HQCA 3WE3A 1PUEE 5DUKA 3RYRA 3O3KA 3GWZA 2YPRA 5HDGA 5ILSA 4UVCA 4NHJA 3KEQA 5BPIA 2VT2A 2P7CB 3WTVC 2VE8A 5BS6A 4ZYHA 4RB3C 1SAXA 5CVJA 4EJTA 2QBYB 2E7XA 3ZMDA 3E5QA 1R22A 2XIGA 2VOPA 5JI6A 4D0PA 2YU3A 4HQMA 5D5VB 1H9GA 3FMSA 1S7AA 5LGTA 5KK1A 1Z1DA 3F8BA 5J8FA 4RGXA 3I64A 4HX7A 3TKYA 1OYIA 1L0OC 1YQAA 2HR3A 5D5XB 1Z9CA 5L3EA 1ZH5A 1XGOA 2W25A 3FMRA 3M8EA 2HFHA 1ZRFA 2LNBA 4IRHA 1WI9A 2IP2A 1STZA 3L7WA 1UCRA 2A5YB 1L3LA 1LQ1A 2STWA 5D6FA 3BPXA 1P6RA 1LEBA 2VC0A 2D2WA 3F6OA 4QWQA 2IW5A 1G3SA 4KN7X 4KA4A 4KDPA 3N4MA 4YG2F 1HW5A 4NQWA 4ENKA 1YW9A 3CO6C 2TDXA 2MH9A 3WTTC 4UUVA 1KYWA 3ML6A 5FFZA 1QQIA 4WK8F 1FP2A 2ELHA 2GA2A 3JAMK 4UNOA 4A0YA 5HS9A 4RGUA 4P55A 3QPHA 5K1YA 3LFKA 3CUQC 2O3FA 1QNTA 2HOEA 3HTSB 4A5MA 2OZUA 2XAQA 4M73A 4UXNA 3RI4A 5JVTA 4N0BA 3WU1B 2X4HA 1SMTA 3P9CA 2DO7A 3LQRA 3DFGA 4ASNA 3J80K 3MFKA 4LK1F 4XSZF 3WGIA 3GEZA 2XAGA 4Y17A 2G7UA 4M6YA 4RB1A 1T98A 3IRRA 2EK5A 2V1DA 4HLYA 3U1DA 2XAJA 3OOPA 1AOYA 2BV6A 2R7FA 1UHWA 1SD5A 1OMIA 1FYMA 1U78A 3ULQB 4GYIA 4HF0A 4XSXF 5DCMB 1REPC 2CWEA 3KP5A 2FMYA 2LSOA 3QP5A 4RB2C 2LDUA 3L00A 1EV7A 1S29A 2J5OA 1K7AA 4I0BA 3V4GA 1SFUA 2F5CA 3NEUA 5CVUA 4HLXA 3PFIA 3M1EA 1QPMA 2LF8A 2CQKA 3IWFA 3O6BB 3TGNA 2K4JA 4M9XA 4B09A 5FLXZ 4ENNA 4FX4A 2V6CA 5L3DA 1OYWA 5DYMA 4EGYA 2DAOA 4G6DA 2X0LA 4FHTA 4O6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R00 A;  1SFE A;  3TDU C;  1RUO A;  3ERE D;  1IN7 A;  1FZP B;  2CO5 A;  1FYK A;  2EWN A;  2FBH A;  1JHH A;  3EUH A;  4FX0 A;  2AS5 F;  3QU6 A;  5FB2 A;  4Q4Z F;  3WTX C;  4IRI A;  1MDM B;  3DV8 A;  2D45 A;  1IUY A;  3LA3 A;  3V8K A;  2VT3 A;  2IJL A;  2VC1 A;  2DU9 A;  3HIF A;  3FXQ A;  4M71 A;  2Q8K A;  5D5U B;  5L3B A;  1YLF A;  3NRV A;  1S3J A;  2YX7 A;  3K1N A;  1E2X A;  5CVI A;  2M5W A;  1FX7 A;  1Z6T A;  2UWM A;  1K6O A;  3HTU A;  4K2E A;  2DK5 A;  2HWV A;  4BHB A;  2PG4 A;  1IF1 A;  4IXA A;  3I0T A;  3HRU A;  2ZBK A;  3WU0 A;  1W4M A;  4HX4 A;  2OD5 A;  2HTJ A;  4EMS A;  1FOK A;  3QRF F;  1HKQ A;  1O3Q A;  3FX3 A;  3JW4 A;  1ZRD A;  4KNY A;  2GAU A;  4HBL A;  3SQN A;  1XMA A;  3EET A;  4S05 A;  2XUB A;  2QQA A;  2CYY A;  2ETH A;  3CO7 C;  1YYV A;  1CF7 A;  3R4K A;  2JZY A;  1XSD A;  3KZZ A;  4KIB A;  4Y13 A;  1P4X A;  4AIK A;  2XKO A;  3K69 A;  5HS8 A;  2G7H A;  4AVP A;  2PQ8 A;  2DPU A;  1R1U A;  4P9U A;  3RDI A;  4G7Z F;  2ZO4 A;  2IVM A;  2L3D A;  4EM1 A;  2GWR A;  1GHC A;  3R6S A;  1HKT A;  2H27 A;  2DFI A;  4CGZ A;  2A6E F;  2BGC A;  1ZLJ A;  5E1X A;  3BPV A;  3RPQ A;  4R1H A;  4LG0 B;  4EM0 B;  1T39 A;  4HDU A;  1IRG A;  2KJC A;  2P5L C;  2QZ8 A;  1WQ2 A;  3C1D A;  4OIP F;  3VOD A;  4KT5 C;  1FY7 A;  4A12 A;  2QQB A;  5A2Q K;  2FQ3 A;  2XVC A;  3WE2 A;  4YFX F;  5JR3 A;  3KE2 A;  1XCV A;  3C7J A;  2W85 A;  2GZW A;  1XB4 A;  5E8G A;  4KN4 X;  1YS6 A;  1U3E M;  2O8X A;  5LEK A;  1FYL A;  3DQV C;  4F7Z A;  1TQM A;  5H6Q A;  3E6B A;  1VTN C;  3BRO A;  1HBX G;  1I27 A;  3F8N A;  4MTD A;  3ECH A;  2DQL A;  1DP7 P;  2GQQ A;  5LHH A;  4GYG A;  1J75 A;  3ZMZ A;  2Q0O A;  2JPC A;  1S6L A;  2FF4 A;  5DD8 A;  2CSO A;  4CO8 A;  1Y0U A;  2KIF A;  3R61 A;  3WTW C;  5CVV A;  1IXR C;  4WCG A;  4WXH A;  3HSE A;  2WTE A;  3EYY A;  3SZT A;  2Z9O A;  1TBX A;  4IHS A;  1XGN A;  4IRG A;  2FBK A;  3E6M A;  2ZKZ A;  3KET A;  4LK0 F;  1RZ4 A;  4ESF A;  2XV4 S;  2K7L A;  1GXP A;  3HRM A;  2PBI A;  2WC2 A;  1DUX C;  2XAH A;  4RAZ A;  2VN2 A;  2DT5 A;  1I1S A;  1FLI A;  1BIA A;  2CFX A;  5DEQ A;  3ABT A;  4R79 A;  4ENJ A;  2K27 A;  3WG9 A;  1IN5 A;  1HKS A;  2NNN A;  3JSP A;  4U88 A;  1HW2 A;  2DTR A;  2J5P A;  2WWY A;  4RGR A;  3JTH A;  3V7S A;  3MEX A;  3BWG A;  1ZGJ A;  3COA C;  2A61 A;  2EFO A;  3TO7 A;  5HOO A;  4OIQ F;  3PQJ A;  1KYZ A;  2GIV A;  1FBU A;  4KMU X;  1XGS A;  4GO1 A;  3ZMU A;  3ZMS A;  4HW0 A;  1GXQ A;  3VB2 A;  3HSR A;  1RIO H;  4BHC A;  3K1P A;  3GXO A;  2VBY A;  1O3R A;  1D8J A;  2RDP A;  1T2K A;  2QM3 A;  2JPB A;  4PGH A;  4L18 B;  4P96 A;  3MCZ A;  4UV9 A;  1J5Y A;  1KU2 A;  5HS7 A;  2ZME B;  3ZN1 A;  1SD7 A;  2MA3 A;  3KZY A;  5AIQ A;  4HF2 A;  1BOA A;  4O5V A;  5K5O A;  3H3U A;  1ZAR A;  3KP7 A;  1Z7U A;  4Y15 A;  3IRQ A;  2EV6 A;  5ICC A;  4AD9 A;  5TRD A;  2UXN A;  1R1V A;  1HW1 A;  2H6C A;  4I01 A;  2PI0 A;  4G94 A;  4HX8 A;  3RIR A;  1YIO A;  1NHA A;  1ULY A;  2EB7 A;  3P7N A;  2VXZ A;  2PMU A;  5LLQ A;  5FGM A;  4O3M A;  3WGG A;  3QU3 A;  2E1N A;  3IKV A;  4CDG A;  1ZG1 A;  1ZN2 A;  2ZXJ A;  4BNC A;  2R3S A;  4RGS A;  2RVC A;  1SMY F;  4H0E A;  5J6X A;  3L09 A;  2P6T A;  1QO0 D;  1K78 B;  1LEA A;  2M1B A;  1C0W A;  1B1B A;  2VBW A;  1LDD A;  2WV0 A;  3R60 A;  4WXD A;  5CLS A;  1WRJ A;  1FBS A;  2EJR A;  4CYD A;  4HF1 A;  2Z33 A;  2ISY A;  4KIF A;  4B8X A;  5DUI A;  3KLN A;  3CUQ B;  1CGP A;  3SZP A;  1D3Y A;  5LEJ A;  2AXL A;  2A6H F;  4LGW A;  1PDN C;  2DBB A;  3BZ6 A;  4UHT A;  5HLH A;  1WKM A;  2HS5 A;  3I59 A;  2YX4 A;  4CIC A;  3FHZ A;  5FLX K;  2HYG D;  2EFP A;  4U0W A;  5AIP A;  2IA1 A;  1QZY A;  1K79 A;  1XD7 A;  1ODD A;  2YR2 A;  3GFM A;  3E97 A;  1KU3 A;  5ICG A;  1E17 A;  1A04 A;  1YS7 A;  1IZ1 A;  1KU7 A;  1TNS A;  2H09 A;  2NYX A;  3EQL F;  4U7D A;  2BE5 F;  1B4A A;  1XDU A;  2L54 A;  3MZH A;  3QPT A;  4LB6 B;  2HEO A;  3ABU A;  3G73 A;  2FXA A;  3WTZ A;  3LST A;  1EH8 A;  4DQ2 A;  2MLK A;  2NRA C;  2JRT A;  3QOP A;  1BN5 A;  3GX4 X;  5LBQ A;  2EFN A;  4EJV A;  3M7G A;  4ENM A;  1YW7 A;  1ZRC A;  4LJZ F;  2ESH A;  4NB5 A;  1XGM A;  4LD5 A;  3GYH X;  2HTS A;  2HDC A;  1B6A A;  3GZ6 A;  2VBX A;  3IHU A;  3J81 Z;  1O7F A;  1W7P A;  4EGZ A;  1Z05 A;  2CW0 F;  5E8I A;  1FPQ A;  3F23 A;  1W5S A;  3QP6 A;  2QLZ A;  3FM3 A;  1OKR A;  1XSX A;  1G3Y A;  3U9G A;  3BP8 A;  1ZYR F;  3BDD A;  3FXU A;  2IA2 A;  5LHG A;  3K0L A;  2O03 A;  2A07 F;  4MQV A;  1TNT A;  3SXY A;  1Z91 A;  3V8J A;  1U2W A;  5KVR A;  4I09 A;  2NS0 A;  3F21 A;  4AIH A;  3FF5 A;  4EJU A;  3BOQ A;  2PN6 A;  1OR7 A;  2HKX A;  2G9W A;  2MH2 A;  1BBY A;  3CUO A;  1MJ9 A;  4M6X A;  4HZF A;  2P5V A;  1AWC A;  2GXG A;  2LF7 A;  4LFU A;  1HST A;  3T8R A;  1U5T A;  3L2C A;  1ON1 A;  1ZRE A;  2EA4 A;  5IT3 A;  4PZJ A;  4Q48 A;  1ZAO A;  3RKX A;  3V8L A;  3WTS C;  5D4R A;  3WTY C;  4KIC A;  2M45 A;  1IN6 A;  3KFW X;  2H94 A;  2JT1 A;  5HLI A;  5L3F A;  2O61 A;  1YO5 C;  4OMY A;  2OAZ A;  2P7V B;  5EEG A;  2PMH A;  4A0X A;  3HRT A;  3U2R A;  3FM5 A;  1V4R A;  2V1X A;  2L02 A;  1S7O A;  2BEO A;  2FSW A;  1FSE A;  3REO A;  4RAY A;  1HSJ A;  4G8X A;  4UVB A;  4XBF A;  2E1C A;  2QBY A;  5ILU A;  1D8K A;  2P4W A;  3F72 A;  4R8H A;  1FP1 D;  5D8K B;  2HQN A;  4RS8 A;  2NAZ A;  1ZHF A;  2M30 A;  4MEY F;  2RC4 A;  2RV8 A;  4I02 A;  2A68 F;  3DP7 A;  4MGR A;  4UVA A;  3DF8 A;  4N9H A;  3BJA A;  4M74 A;  4AWX B;  2Y48 A;  1TTY A;  5DD4 A;  3J7A O;  2IT0 A;  2IA0 A;  1ZG3 A;  3T5X A;  1SD6 A;  1BM9 A;  1V3F A;  2OA4 A;  4L9V A;  2OQG A;  3ZQ7 A;  1MJA A;  1S8N A;  2W84 A;  2MBF A;  5LGN A;  2EFW A;  5D6E A;  2KIM A;  5FD5 A;  2P6S A;  3KP4 A;  4WF2 A;  2OU2 A;  3GLX A;  4L9N A;  1MZB A;  2DLL A;  4IVN A;  5H6R A;  1LDJ A;  3CJN A;  2VBZ A;  2DPD A;  3V7R A;  2L01 A;  4LB5 A;  4EVI A;  3MAJ A;  4I0A A;  1QBJ A;  5ICF A;  2W57 A;  3I5U A;  1T0F A;  3F8M A;  3GUD A;  4MNU A;  1IN4 A;  3IWZ A;  2XAS A;  4PCQ A;  4IF4 A;  1R5G A;  4JK1 X;  2Z3Y A;  1TW2 A;  2QQ9 A;  1DPR A;  3GFL A;  1J59 A;  2JSC A;  3KP2 A;  3HRS A;  2QEN A;  5DDG A;  1LDK B;  2FNP A;  1X3U A;  1IXS B;  3E5X A;  2KJB A;  4PGG A;  2F2E A;  1G3W A;  1Z6R A;  5D8L B;  4MEX F;  5ILV A;  4U7B A;  5ED4 A;  1XSV A;  3LAP A;  3TOA A;  1F5T A;  2IRF G;  1UST A;  2HZT A;  1U5T C;  2C6Y A;  5DCM A;  1R23 A;  4ON0 A;  2JTV A;  2P8T A;  2KKO A;  4IHT A;  2MLG A;  3F3X A;  3BJ6 A;  3H3Z A;  4HDV A;  1MJB A;  2GXB A;  2H6B A;  2KIU A;  5CVR A;  1D5V A;  2XKP A;  5DCF A;  4BAY A;  1YW8 A;  4I2O A;  5FFX A;  4ETS A;  4OIO F;  3B73 A;  3IL2 A;  1B59 A;  3ZP5 A;  4YFN F;  4LLN A;  2EV0 A;  2E7W A;  4EJO A;  3GO5 A;  3Q9S A;  5L3C A;  1ZLK A;  4Q47 A;  1FT9 A;  4E70 A;  1UB9 A;  2A69 F;  2VON A;  1FBQ A;  2W24 A;  2ESN A;  4PDK A;  5IT9 Z;  4WX9 A;  3E5U A;  3LA2 A;  2R7D A;  3IC7 A;  2HQR A;  2XAF A;  4HQE A;  1O57 A;  3ZN0 A;  2B0L A;  2M8E A;  1KQ8 A;  1ZG5 A;  2YSR A;  2FEZ A;  4L5J A;  3NQO A;  2ZNY A;  3RYP A;  1CF7 B;  3ELK A;  2L4M A;  3F22 A;  2OZ6 A;  1MDM A;  1BI0 A;  2VOD A;  2RGV A;  4A2U A;  2L4A A;  4Q5S F;  4ESB A;  1U6G A;  1RUN A;  2VE9 A;  1JHF A;  2GA1 A;  4KUM A;  3MQ0 A;  5JFR A;  1P4W A;  3HHH A;  3I4P A;  1BC8 C;  3VEP A;  4M72 A;  3WOD F;  3V7C A;  1LJ9 A;  4BXU A;  3M9A A;  3C18 A;  5HDN A;  4HOB A;  1WSU A;  1SD4 A;  2F5D A;  2QWW A;  1KQ9 A;  3LA7 A;  4HA8 A;  1QZZ A;  3P9I A;  1UFM A;  4M9S A;  2D1V A;  4G7O F;  3T8T A;  2UXX A;  2RNJ A;  3FXR A;  1SFX A;  1ZGA A;  1P2F A;  5TJJ A;  3K9T A;  3HYI A;  2XRO A;  4IJA A;  2Z99 A;  1ON2 A;  3JTG A;  2F5E A;  3TO9 A;  5F64 A;  4KIG A;  5LRS A;  4N9I A;  1KGS A;  1PP8 F;  4HV6 A;  2ACJ A;  4CZZ A;  1BI1 A;  3E6C C;  5E1Z B;  5HVQ C;  4G9Y A;  3IKT A;  1MD0 A;  1FNN A;  4HAM A;  6PAX A;  1TQI A;  4OU0 A;  3VFZ A;  3RTR A;  3Q9V A;  4XRF A;  1FC3 A;  2Y75 A;  5D4S A;  5CJ9 A;  3KCC A;  3DKW A;  3R0A A;  1XDS A;  3G3Z A;  1MKM A;  2HGC A;  1Q1H A;  4L0Z B;  3D0S A;  2EA2 A;  3OV8 A;  2O6G E;  3JAM Z;  1FSH A;  2O0Y A;  2FBI A;  3HOT A;  4XLP F;  2MC3 A;  3LQQ A;  4LG0 A;  5K5Q A;  2XGX A;  2RKH A;  3I53 A;  5CYV A;  4OIR F;  4EM2 A;  2QUF A;  1TW3 A;  4ZH4 F;  5E18 F;  1BI2 A;  2IPQ X;  2RN7 A;  3J80 Z;  4ZYE A;  1F4K A;  4EV0 A;  3GFJ A;  4JBA A;  4A0Z A;  4BH9 A;  5JHU A;  1YG2 A;  2EV5 A;  1BI3 A;  2ADU A;  4LLL A;  1JGS A;  3ZPL A;  1B9M A;  4MHG A;  4M9Z A;  3AAF A;  5K5R A;  1W5T A;  4KFC A;  3J81 K;  4I7H A;  2F5F A;  2ZFW A;  3BY6 A;  3ISP A;  5D5W B;  2OQR A;  3L9F A;  4A6D A;  2HYF A;  4KYW A;  3S2W A;  4P5O A;  3HSF A;  2BBY A;  3F8F A;  4JQF A;  3E3V A;  1H0M A;  4A5N A;  1KQ0 A;  1LNW A;  4WXC A;  1OYY A;  3T0Y A;  2Z5U A;  3QAH A;  1BJA A;  1F9N A;  2XHK A;  5FO5 A;  4GCV A;  4GXO A;  2CGP A;  4BQA A;  4HYE A;  4G6Q A;  3H92 A;  2FE3 A;  5F1R A;  4BHP A;  1HXD A;  1QGP A;  2K02 A;  1GVJ A;  1O3S A;  5FD6 A;  2Y0M A;  2CG4 A;  3I71 A;  3ZMT A;  5E20 A;  1MGT A;  3JSO A;  1I6X A;  4ZZD A;  3HOS A;  3MZY A;  1OPC A;  2A3S A;  3ZMV A;  2DQR A;  2NNY A;  4ESJ A;  5HDK A;  3O2P E;  2XRN A;  4G7H F;  4FT8 A;  4IPA A;  4YIF A;  3GZ5 A;  2P5K A;  2PEX A;  3TOB A;  3K2Z A;  3RKW A;  4TV7 A;  1R58 A;  1O3T A;  2MD5 A;  3LAJ A;  4GGG A;  1G3T A;  4EJW A;  3Q5F A;  5E1W A;  1LB2 A;  2D1H A;  1IAW A;  4WWC A;  3ROU A;  3TO6 A;  3K1M A;  4UV8 A;  4L9J A;  3KP3 A;  3RJP A;  2LKP A;  5HLG A;  3FWE A;  4I98 B;  5DV5 A;  2K86 A;  3BJO A;  3KEO A;  1YFH A;  3KP6 A;  1IN8 A;  2ZJ2 A;  3CDH A;  4OOI A;  1RI7 A;  2UZK A;  4U0V A;  3DXJ F;  2V1U A;  1UHM A;  2COM A;  3C3W A;  3TDZ C;  1F1Z A;  2OBP A;  2K4B A;  1TLH B;  2DI3 A;  3SFZ A;  3F6V A;  5LHI A;  4CXF A;  2PFB A;  4ZYD A;  2PLY A;  1T6S A;  4HV5 A;  1WWX A;  1T38 A;  3EYI A;  3T1B A;  4CHU A;  1TQP A;  5LGU A;  4P9F A;  5EEH A;  2ZME A;  1LVA A;  4A6E A;  2PJP A;  3MWM A;  3W6K B;  1B9N A;  3GVA A;  1O7L A;  2FML A;  3CTA A;  4RB0 A;  2RQP A;  4MQ9 F;  1R7J A;  2Q2E A;  1BC7 C;  3DPL C;  3N97 A;  4LMY A;  2V9V A;  4KMF A;  5F6F A;  3I59 B;  1J0R A;  3P9K A;  3RPU A;  1J2X A;  1PP7 U;  2FOK A;  3PQK A;  1J9I A;  1JE8 A;  4U0Y A;  4Z2Y A;  4LLG F;  4ZZL A;  1YTY A;  2STT A;  3CLO A;  1KA8 A;  2HKO A;  2ISZ A;  4MTE A;  1W7P D;  1FWZ A;  4EQQ A;  3LWF A;  2EFQ A;  4YFK F;  3ECO A;  5AON A;  4XLN F;  3W6J B;  1I5Z A;  2ZCW A;  2FA5 A;  4L5I A;  4OIN F;  1P4A A;  2FRH A;  3WGH A;  1USS A;  3DPT A;  5H20 A;  4QLC U;  5J8C A;  5A2Q Z;  1R36 A;  4L9T A;  1K78 A;  3WTU C;  1R5H A;  3GW2 A;  1IXC A;  1DPU A;  3RKY A;  3GF2 A;  1BIB A;  1XCB A;  1IW7 F;  3FZV A;  5ICE A;  5BQT A;  2BYV E;  3F8C A;  4YII A;  3CUQ A;  2KRF A;  1R1T A;  3M8F A;  2QVO A;  5BMZ A;  1DDN A;  2QYO A;  4BYY A;  3FMQ A;  4S04 A;  1W7P B;  2VOO A;  3HUG A;  2DW4 A;  3HHG A;  5LRR A;  1EH7 A;  4AIJ A;  3VOE A;  1JXS A;  4ZYG A;  1IRF A;  1G4D A;  5ERI A;  1KU9 A;  3E6D A;  3GFI A;  1U8R A;  1P92 A;  1J7K A;  3DEU A;  5IT9 K;  3I54 A;  3D5L A;  2V79 A;  5BPD A;  1G6N A;  2FU4 A;  3I58 A;  4OMZ A;  3EDP A;  1H9T A;  2DK8 A;  1XMK A;  1ONV A;  2M87 A;  1XN7 A;  1I1G A;  1U5T B;  3TQN A;  5BOX A;  2FNA A;  3R0J A;  4L0Y B;  2ZNZ A;  5E17 F;  5L3G A;  3KLO A;  1EH6 A;  3SHF A;  3B02 A;  1RNL A;  4DNC A;  1HQC A;  3WE3 A;  1PUE E;  5DUK A;  3RYR A;  3O3K A;  3GWZ A;  2YPR A;  5HDG A;  5ILS A;  4UVC A;  4NHJ A;  3KEQ A;  5BPI A;  2VT2 A;  2P7C B;  3WTV C;  2VE8 A;  5BS6 A;  4ZYH A;  4RB3 C;  1SAX A;  5CVJ A;  4EJT A;  2QBY B;  2E7X A;  3ZMD A;  3E5Q A;  1R22 A;  2XIG A;  2VOP A;  5JI6 A;  4D0P A;  2YU3 A;  4HQM A;  5D5V B;  1H9G A;  3FMS A;  1S7A A;  5LGT A;  5KK1 A;  1Z1D A;  3F8B A;  5J8F A;  4RGX A;  3I64 A;  4HX7 A;  3TKY A;  1OYI A;  1L0O C;  1YQA A;  2HR3 A;  5D5X B;  1Z9C A;  5L3E A;  1ZH5 A;  1XGO A;  2W25 A;  3FMR A;  3M8E A;  2HFH A;  1ZRF A;  2LNB A;  4IRH A;  1WI9 A;  2IP2 A;  1STZ A;  3L7W A;  1UCR A;  2A5Y B;  1L3L A;  1LQ1 A;  2STW A;  5D6F A;  3BPX A;  1P6R A;  1LEB A;  2VC0 A;  2D2W A;  3F6O A;  4QWQ A;  2IW5 A;  1G3S A;  4KN7 X;  4KA4 A;  4KDP A;  3N4M A;  4YG2 F;  1HW5 A;  4NQW A;  4ENK A;  1YW9 A;  3CO6 C;  2TDX A;  2MH9 A;  3WTT C;  4UUV A;  1KYW A;  3ML6 A;  5FFZ A;  1QQI A;  4WK8 F;  1FP2 A;  2ELH A;  2GA2 A;  3JAM K;  4UNO A;  4A0Y A;  5HS9 A;  4RGU A;  4P55 A;  3QPH A;  5K1Y A;  3LFK A;  3CUQ C;  2O3F A;  1QNT A;  2HOE A;  3HTS B;  4A5M A;  2OZU A;  2XAQ A;  4M73 A;  4UXN A;  3RI4 A;  5JVT A;  4N0B A;  3WU1 B;  2X4H A;  1SMT A;  3P9C A;  2DO7 A;  3LQR A;  3DFG A;  4ASN A;  3J80 K;  3MFK A;  4LK1 F;  4XSZ F;  3WGI A;  3GEZ A;  2XAG A;  4Y17 A;  2G7U A;  4M6Y A;  4RB1 A;  1T98 A;  3IRR A;  2EK5 A;  2V1D A;  4HLY A;  3U1D A;  2XAJ A;  3OOP A;  1AOY A;  2BV6 A;  2R7F A;  1UHW A;  1SD5 A;  1OMI A;  1FYM A;  1U78 A;  3ULQ B;  4GYI A;  4HF0 A;  4XSX F;  5DCM B;  1REP C;  2CWE A;  3KP5 A;  2FMY A;  2LSO A;  3QP5 A;  4RB2 C;  2LDU A;  3L00 A;  1EV7 A;  1S29 A;  2J5O A;  1K7A A;  4I0B A;  3V4G A;  1SFU A;  2F5C A;  3NEU A;  5CVU A;  4HLX A;  3PFI A;  3M1E A;  1QPM A;  2LF8 A;  2CQK A;  3IWF A;  3O6B B;  3TGN A;  2K4J A;  4M9X A;  4B09 A;  5FLX Z;  4ENN A;  4FX4 A;  2V6C A;  5L3D A;  1OYW A;  5DYM A;  4EGY A;  2DAO A;  4G6D A;  2X0L A;  4FHT A;  4O6J A; 
#chains in the Genus database with same CATH topology
 2V6E A;  1R00 A;  1SFE A;  1ZTR A;  3TDU C;  1RUO A;  4BEH A;  3ERE D;  1HC8 A;  1LE8 B;  1IN7 A;  3OSF A;  2BVM A;  1IDY A;  4NUB A;  5EG0 A;  2CO5 A;  1FZP B;  1I6H J;  1FYK A;  4ZTJ A;  2RNG A;  3CMA I;  2EWN A;  1WJA A;  4CCL A;  2VJ4 A;  2EPF A;  2FBH A;  2DT6 A;  5KHD A;  1UAA A;  2HDD A;  1T08 B;  1YHQ I;  1JHH A;  3EUH A;  3PJR A;  4FX0 A;  2AS5 F;  4E6K G;  2CRG A;  1D1A A;  3QU6 A;  5FB2 A;  4Q4Z F;  3WTX C;  4IRI A;  1MDM B;  3CC2 I;  3K4K A;  1SAU A;  3DV8 A;  2D45 A;  1JUP A;  2DFH A;  1IUY A;  5M5W J;  4QIW N;  3TED A;  3GTG J;  1HCR A;  3LA3 A;  3V8K A;  2VT3 A;  2IJL A;  2VC1 A;  2DU9 A;  1PYV A;  3HIF A;  5E3N A;  3TL4 X;  3FXQ A;  4M71 A;  2HXO A;  1BOB A;  3K4J A;  4UUT A;  2Q8K A;  5D5U B;  5L3B A;  1YLF A;  3K7A J;  3NRV A;  2R7T A;  2M8G X;  1S3J A;  2YX7 A;  3K1N A;  2ICW G;  1E2X A;  5CVI A;  2OPT A;  2WAQ A;  5IY5 H;  2M5W A;  3W2A A;  1FX7 A;  1Z6T A;  3AFH A;  2DMP A;  1K6O A;  2B7E A;  2LK2 A;  1OFC X;  2UWM A;  3HTU A;  3MKW B;  3KZI C;  1Q1V A;  1IC8 A;  4C30 A;  4YIR X;  3MKY B;  3LL7 A;  4K2E A;  2DK5 A;  2HI3 A;  2HWV A;  2K9Q A;  2QCO A;  3HB9 A;  2E5N A;  2PG4 A;  4BHB A;  5B5E C;  1VQ5 I;  2KMU A;  4L5E A;  3FIS A;  1IF1 A;  4IXA A;  3L2R A;  3I0T A;  3HRU A;  3DWL E;  1JT0 A;  2ZBK A;  4PFO A;  4LG3 A;  3WU0 A;  1B8I B;  1W4M A;  4HSR A;  3TP0 A;  4FAS D;  4HX4 A;  2OD5 A;  2HTJ A;  4EMS A;  1FOK A;  3QRF F;  2JN6 A;  3UKG A;  9ANT A;  1HKQ A;  3VPR A;  4RAF A;  1O3Q A;  3FX3 A;  3DEE A;  3ZRG A;  4B44 A;  3S1Q J;  2O8K A;  2LR8 A;  3JW4 A;  2M3A A;  1MH4 A;  1ZRD A;  3TP3 A;  2VQH A;  4BAC A;  4KNY A;  1LPQ A;  3I4M J;  2GAU A;  1UEL B;  4HBL A;  1OIS A;  3SQN A;  1WPK A;  1G2H A;  2RQQ A;  1XMA A;  3EET A;  4S05 A;  3SJM A;  2XUB A;  2QQA A;  2YU9 J;  1MNM C;  3RZO J;  2CYY A;  2ETH A;  4XK4 A;  3CO7 C;  1YYV A;  4XN0 A;  3AKZ A;  2X85 A;  1CF7 A;  5IP7 J;  3JRF A;  2XSJ C;  3J7Z I;  2Y30 A;  2FQ4 A;  3R4K A;  2JZY A;  1XSD A;  3KZZ A;  2HOA A;  4KIB A;  5B66 C;  1KON A;  4Y13 A;  1P4X A;  2YUS A;  1OCC H;  3HZJ A;  2JJ7 A;  1BL0 A;  3G6E I;  2VJJ A;  4GRI A;  1RPW A;  2XKO A;  4AIK A;  2VB6 A;  3K69 A;  4D5C A;  1TC3 C;  3VYS B;  5HS8 A;  5E3M A;  3PIP F;  3HGY A;  2R5Y A;  1N78 A;  2G7H A;  3BQY A;  4AVP A;  1DP3 A;  2PQ8 A;  2DPU A;  1R1U A;  4P9U A;  3RDI A;  4G7Z F;  3MKL A;  1OLT A;  2EIM H;  2QA4 I;  2ZO4 A;  4CCM A;  2IVM A;  2L3D A;  4EM1 A;  2GWR A;  1GHC A;  3R6S A;  1HKT A;  3OYA A;  3C2B A;  2H27 A;  1BW5 A;  2DFI A;  1FMV A;  4CGZ A;  2VPR A;  2IEK A;  2A6E F;  3GTK J;  2BGC A;  4ABZ A;  2EIK H;  3LSH A;  3I55 I;  1ZLJ A;  1MBG A;  5E1X A;  3FDY A;  3BPV A;  3RPQ A;  4FET A;  4R1H A;  3CC4 I;  4LG0 B;  4EM0 B;  1T39 A;  4M3D A;  4F52 A;  4HDU A;  1IRG A;  1VQP I;  2KJC A;  2P5L C;  2QZ8 A;  2WAE A;  3FBN B;  4RMN A;  1WQ2 A;  3C1D A;  5LFA A;  1AKH B;  4OIP F;  3VOD A;  2A05 A;  4KT5 C;  1FY7 A;  3ZR8 X;  4A12 A;  1V55 H;  2QQB A;  5KNL A;  5A2Q K;  2FQ3 A;  2K9S A;  3ZXS A;  4IHY A;  3IP4 B;  2XVC A;  3S3O A;  2KRC A;  4PSW A;  3WE2 A;  4YFX F;  5JR3 A;  3S1M J;  1HA8 A;  3KE2 A;  1XCV A;  4XLC A;  3C7J A;  2W85 A;  3OMY A;  2GZW A;  1BJZ A;  1XB4 A;  5E8G A;  1F43 A;  3DEW A;  1X1P A;  4KN4 X;  4KJZ A;  3DLA A;  4Z6Y A;  2R0Q C;  1IV6 A;  3M1C A;  1YS6 A;  2HXI A;  2O8X A;  1U3E M;  5LEK A;  4ITV A;  1FYL A;  3OYF A;  3G1L A;  3DQV C;  3OIP A;  3QWL A;  4A3G J;  1UZC A;  1A6I A;  3LFU A;  4RLF A;  1ZR2 A;  4F7Z A;  1TQM A;  5H6Q A;  3E6B A;  2M9H A;  2P81 A;  1VTN C;  3BRO A;  1HBX G;  3EUH C;  1SVL A;  1I27 A;  3BCA A;  5C44 J;  1A35 A;  2QSH X;  3A0H C;  3IAS 2;  3F8N A;  3WHB A;  4MTD A;  2BY1 A;  3CMY A;  1MW7 A;  1X58 A;  1FOX A;  3ECH A;  3U21 A;  2DQL A;  1EF4 A;  3BTJ A;  1DP7 P;  2GQQ A;  5LHH A;  3CP8 A;  2LKX A;  3CMM A;  4GYG A;  4PUS A;  3ZMZ A;  1J75 A;  3I56 I;  2Q0O A;  2JPC A;  2IS4 A;  1JKP C;  1S6L A;  2ELJ A;  2FF4 A;  5DD8 A;  2CSO A;  4NC8 A;  4CO8 A;  1SEU A;  1Y0U A;  2KIF A;  4UY8 I;  1ETK A;  3R61 A;  1WJD A;  4XOT A;  5CVV A;  3WTW C;  1IXR C;  4WCG A;  1UJ8 A;  2HQA A;  4WXH A;  1ZQ3 P;  3HSE A;  2WTE A;  1MH3 A;  1ETO A;  3EYY A;  3SZT A;  4F93 B;  2Z9O A;  1TBX A;  3VYU B;  2E1O A;  1XGN A;  4IRG A;  3OYI A;  3DBL B;  4IHS A;  2FBK A;  2M2E A;  3OYC A;  5EGO A;  3E6M A;  2ZKZ A;  3PM1 A;  3KET A;  2OTL I;  1JJ8 C;  4IOA F;  4LK0 F;  1RZ4 A;  4ESF A;  2XV4 S;  2L9S A;  2K7L A;  1PUF A;  2CW7 A;  4ZTF A;  1GXP A;  3OS2 A;  3HRM A;  4BE2 A;  2K3P A;  3HOW J;  2PBI A;  2WC2 A;  1R6R A;  1DUX C;  1DGR M;  2XAH A;  4RAZ A;  2VN2 A;  5IP9 J;  5DM6 F;  2VAS A;  3A01 A;  4AID A;  2DT5 A;  1I1S A;  4BGD A;  1FLI A;  4DZJ A;  1BIA A;  5DM7 F;  1MSE C;  5B1A H;  4MLO A;  2CFX A;  5DEQ A;  3P5J A;  2E19 A;  2E1M B;  2HZD A;  3ABT A;  4R79 A;  1T56 A;  1ZR4 A;  1K83 J;  4IL6 C;  2QEX I;  4ENJ A;  3CJT B;  2K27 A;  1TWF J;  2JWT A;  3WG9 A;  4C2T A;  4ZDO A;  4XID A;  3K70 C;  1IN5 A;  1HKS A;  5FKO A;  2NNN A;  4M3F A;  1U9N A;  2JMW A;  3JSP A;  4U88 A;  1HW2 A;  2DTR A;  2J5P A;  1QU3 A;  1N25 A;  2OV7 A;  1RET A;  1YOV B;  2WWY A;  4RGR A;  3B6A A;  3JTH A;  2DOD A;  2DMU A;  1X1C A;  3CCR I;  3V7S A;  2ZC2 A;  5F04 A;  4E7L A;  2GLO A;  3MEX A;  1FTZ A;  5FKK A;  3OL4 A;  4BQO A;  3BWG A;  1VZ0 A;  1ZGJ A;  2A61 A;  2EFO A;  3TO7 A;  5HOO A;  3COA C;  3BR3 A;  3L2W A;  4OIQ F;  2KZG A;  3OL3 A;  2F4I A;  3PQJ A;  3CME I;  1KYZ A;  2GIV A;  2VXD A;  1FBU A;  4KMU X;  1BR1 A;  4XRS G;  1XGS A;  3LSM A;  4GO1 A;  3ZMU A;  3RPU D;  3ZMS A;  4HW0 A;  4UB8 C;  1M1E B;  1QHH D;  4XRM A;  2B9S A;  1GXQ A;  3VB2 A;  3HSR A;  3FXL A;  1RIO H;  2CQQ A;  4BHC A;  3K1P A;  1XX5 A;  3EUA A;  3GXO A;  1POG A;  4D1Q A;  4BDZ A;  1IV8 A;  1I3A A;  2VBY A;  1O3R A;  2I10 A;  1D8J A;  1QHG A;  1H88 C;  2RDP A;  1T2K A;  2TRT A;  3OIQ A;  1JGG A;  1FOY A;  2UUZ A;  2XGC A;  2QM3 A;  2JPB A;  4RM3 A;  3ASO H;  4LIU A;  1ZK8 A;  3W6V A;  3G2B A;  4PGH A;  3H9J A;  4L18 B;  1JI8 A;  2JK3 A;  4P96 A;  3MCZ A;  1VQ8 I;  4UV9 A;  1J5Y A;  1KU2 A;  1W5C C;  5HS7 A;  3WG7 H;  3O8H A;  3H9G A;  2ZFU A;  2HPI A;  1SFK A;  2ZME B;  2KP6 A;  4BJ6 C;  3S3N A;  1SD7 A;  3ZN1 A;  4DGW B;  2MA3 A;  3KZY A;  3QPS A;  2LC2 A;  4C2U A;  3HPG A;  5AIQ A;  1ORK A;  1BA5 A;  2X1C A;  2L9V A;  4HF2 A;  3S15 J;  5F1J A;  1BOA A;  4O5V A;  3OYE A;  1T8I A;  3I9V 2;  3CP2 A;  5J4Y A;  5K5O A;  3FXM A;  3H3U A;  2Q2E B;  4LOC A;  1ZAR A;  2M0M A;  1QZE A;  3A03 A;  4YRV A;  1JJ6 C;  3KP7 A;  1Z7U A;  4Y15 A;  3IRQ A;  3ERM A;  2JQ7 A;  2JVH A;  2EV6 A;  5ICC A;  2DT7 B;  4AD9 A;  3ZGK A;  5TRD A;  3AL0 B;  2WBM A;  1ITY A;  2UXN A;  1R1V A;  3GME A;  1HW1 A;  2H6C A;  2BY0 A;  3FXK A;  4I01 A;  2PI0 A;  4G94 A;  4HX8 A;  3RIR A;  1YIO A;  2F4O B;  3HXL A;  1NHA A;  2W4S A;  1ULY A;  2EB7 A;  3P7N A;  5IYC J;  1S5L C;  3L1P A;  1NK2 P;  2VXZ A;  3I4N J;  2PMU A;  5LLQ A;  5FGM A;  2R7O A;  1D1B A;  2OTJ I;  1AHD P;  4O3M A;  3H9Q A;  3WGG A;  3BR1 A;  3QU3 A;  2E1N A;  2K9M A;  3IKV A;  4CDG A;  1WJF A;  1ZGW A;  4A3B J;  4YEL A;  2EIL H;  3CLQ A;  2EQR A;  4XL9 A;  1ZG1 A;  1ZN2 A;  4NBQ A;  4X1E A;  1Y1W J;  2ZXJ A;  2QF7 A;  1FIP A;  4BNC A;  2R3S A;  2Y9Y A;  4RGS A;  1JTY A;  2RVC A;  1SMY F;  3LSJ A;  4H0E A;  1VF9 A;  2KLO A;  2WB1 A;  5J6X A;  5CKT A;  3L09 A;  1MMG A;  2KL4 A;  4HPQ A;  1WFX A;  5EDN A;  1IRZ A;  1LKX A;  2CUF A;  1UG2 A;  3FBI B;  2P6T A;  1QO0 D;  3AG4 H;  1K78 B;  1LEA A;  1ENH A;  2M1B A;  4A3L J;  1C0W A;  1B1B A;  1ETQ A;  4XKW A;  2VBW A;  3A1Y A;  1LDD A;  3EUK L;  2X9D A;  3JRE A;  2DJI A;  2WV0 A;  3R60 A;  3CJQ B;  4WXD A;  5CLS A;  3DLL F;  1GDT A;  1WRJ A;  1FBS A;  3L2U A;  2EJR A;  4CYD A;  4HF1 A;  1E3P A;  2VLA A;  2Z33 A;  2ISY A;  2DMT A;  5KCM A;  1X4P A;  4KIF A;  1AU7 A;  4B8X A;  5DUI A;  3KLN A;  2LVS A;  2HVR A;  4IX7 A;  1YRN B;  3CUQ B;  1VQL I;  2I8D A;  1CGP A;  3SZP A;  1D3Y A;  2AQF A;  4MFD A;  5LEJ A;  2AXL A;  2A6H F;  2A5W A;  2EIJ H;  2X6O A;  3FK6 A;  1V5E A;  4LGW A;  2IGK A;  2ZXW H;  2DBB A;  3BZ6 A;  1PDN C;  3BG3 A;  4UHT A;  4DOZ A;  5HLH A;  1PVE A;  2JSP A;  3HUG B;  3VSL A;  1WKM A;  4HEA 2;  2DA5 A;  2HS5 A;  1ERD A;  3I59 A;  2LY1 A;  2YX4 A;  4CIC A;  1TZL A;  3G71 I;  3CCL I;  3FKJ A;  2CW8 A;  4AU7 A;  4IZZ A;  3FHZ A;  2P0W A;  3W2W A;  5FLX K;  2HYG D;  5HOD A;  4QTR A;  2EFP A;  4U0W A;  5AIP A;  2IA1 A;  3M4O J;  1QZY A;  2W7N A;  1K79 A;  1XD7 A;  2R7R A;  1ODD A;  2YR2 A;  1YJW I;  3GFM A;  3HM5 A;  3E97 A;  1KU3 A;  2BW3 B;  4F91 B;  5IP6 A;  5ICG A;  2KPM A;  1VQK I;  1Z21 A;  2V26 A;  2JA2 A;  5EYR A;  1E17 A;  1A04 A;  1YS7 A;  1X1B A;  2KHM A;  2BZT A;  3SEQ A;  1IZ1 A;  1KU7 A;  1H89 C;  1ETV A;  3RKQ A;  1H8A C;  1TT0 A;  4JX6 A;  5K7Z A;  2R7Q A;  1TNS A;  2H09 A;  2NYX A;  4HG2 A;  3EQL F;  3QOE A;  2CUJ A;  4U7D A;  1HDD C;  2BE5 F;  3BQZ A;  1B4A A;  1XDU A;  2L54 A;  4XM3 A;  3MZH A;  3QPT A;  2L9N A;  3C2G A;  4LB6 B;  1BW6 A;  2HEO A;  1DU0 A;  3AG3 H;  1X3W B;  3ABU A;  4XOP A;  3G1O A;  3PUB A;  2FXA A;  2L9R A;  5DTD A;  3WTZ A;  3G73 A;  5E3O A;  5EZG A;  3LST A;  1EH8 A;  4DQ2 A;  2MLK A;  2AHQ A;  2NRA C;  4AM3 A;  4ANJ A;  2JRT A;  3QOP A;  1BN5 A;  3JCU C;  3GX4 X;  5LBQ A;  3KYC B;  2EFN A;  2W82 A;  4EJV A;  3PSF A;  2VQL A;  3M7G A;  2IS1 A;  1VQM I;  4UUS B;  4ENM A;  1YW7 A;  3GTJ J;  4A93 J;  1VQN I;  1ZRC A;  3CJR B;  4LJZ F;  2ESH A;  4NB5 A;  3PL8 A;  1XGM A;  3QYB A;  4LD5 A;  2R5Z A;  1SC7 A;  3GYH X;  2HTS A;  2HDC A;  1B6A A;  3GZ6 A;  2VBX A;  3IHU A;  3J81 Z;  1O7F A;  1W7P A;  4EGZ A;  1Z05 A;  2CW0 F;  4Y52 J;  5E8I A;  1QVU A;  1FPQ A;  2MYS A;  3F23 A;  1W5S A;  3QP6 A;  2QLZ A;  3FM3 A;  3HKZ N;  1W0T A;  1OKR A;  2CU7 A;  4FCY A;  2GXA A;  3J7Y J;  2O5R A;  1XSX A;  3VWB A;  1G3Y A;  3DKX A;  2XF6 A;  2WAD A;  3CZ6 A;  3U9G A;  1X1D A;  3BP8 A;  3OSG A;  1ZYR F;  3BDD A;  3BR6 A;  3PNY A;  3FXU A;  2IA2 A;  5LHG A;  4OWR B;  3I3L A;  3K0L A;  2O03 A;  2A07 F;  2DA3 A;  4MQV A;  1IDZ A;  1TNT A;  3SXY A;  1Z91 A;  3V8J A;  1U2W A;  1OCP A;  5KVR A;  4LIT A;  3CDI A;  2R7W A;  4I09 A;  5HNH A;  2NS0 A;  3ZQH A;  2ECC A;  3F21 A;  2MGQ A;  4AIH A;  3FF5 A;  4EJU A;  3BOQ A;  4XIC A;  2V9K A;  1DQU A;  2PN6 A;  1OR7 A;  2HKX A;  3E0J B;  3OYK A;  2LD5 A;  3H3V K;  2G9W A;  4CCO A;  5J4V A;  2MH2 A;  1TP4 A;  4JOM A;  1G8X A;  1BBY A;  4A3K J;  3CUO A;  4M3E A;  1MJ9 A;  4M6X A;  4HZF A;  4BBR J;  2W48 A;  5B3S H;  2P5V A;  1AWC A;  1ETW A;  2GXG A;  2LF7 A;  1RKT A;  4LFU A;  1HST A;  1MIJ A;  1XMX A;  4BJT A;  5GTH C;  2KRH A;  3T8R A;  1U5T A;  2Y69 H;  4JX4 A;  4N4O B;  2COB A;  4J00 A;  1Y39 A;  2BY2 A;  3L2C A;  2VKH A;  2ID6 A;  2JUC A;  1ON1 A;  1ZRE A;  2EA4 A;  2Z1D A;  3ONQ A;  4PZJ A;  5IT3 A;  4Q48 A;  4Y4R A;  1ZAO A;  3RKX A;  3V8L A;  2DA4 A;  3WTS C;  4X0G A;  2ELK A;  4XN3 A;  4JYK A;  2KQR A;  5D4R A;  3WTY C;  4KIC A;  2M45 A;  2OF7 A;  4E7Z A;  2FOW A;  4DYR A;  4NQW B;  4C3J J;  1K61 A;  1DGW Y;  2PJR A;  1IN6 A;  4BE0 A;  1JUM A;  1FJL A;  3KFW X;  2H94 A;  1Z7L A;  2IGM A;  2JT1 A;  5HLI A;  5L3F A;  2O61 A;  1XC5 A;  5J47 A;  1U8B A;  3F9K A;  4ZDL A;  1YO5 C;  2VPL A;  4OMY A;  2OAZ A;  4B43 A;  4I6Z A;  2P7V B;  5EEG A;  3S17 J;  2LOO A;  2HQ5 A;  2PMH A;  4A0X A;  3HRT A;  3U2R A;  3FM5 A;  1V4R A;  2V1X A;  2R7S A;  2L02 A;  1S7O A;  2BEO A;  3H36 A;  1UG0 A;  4UB6 C;  3BT9 A;  2FSW A;  1FSE A;  3REO A;  4DIQ A;  4RAY A;  1YIT I;  5HNF A;  1HSJ A;  4G8X A;  4UVB A;  4XBF A;  5CQE A;  2E1C A;  2QBY A;  5ILU A;  1D8K A;  1F36 A;  2P4W A;  3F72 A;  4R8H A;  1FP1 D;  1FOW A;  5D8K B;  1HOM A;  4BXF A;  2HQN A;  4RS8 A;  3ZQI A;  5FRO A;  1UMQ A;  2NAZ A;  2IBD A;  3BC8 A;  1ZHF A;  2M30 A;  3OYG A;  1YJN I;  4XLE A;  5J40 A;  4BQN A;  4MEY F;  2RC4 A;  2RV8 A;  4I02 A;  2A68 F;  2EIN H;  3DP7 A;  3ABM H;  4MGR A;  4II3 A;  2DOE A;  3KPH A;  4UVA A;  2OC6 A;  5JHF A;  2HPM A;  3DF8 A;  4AYB N;  4N9H A;  2G0E A;  3S32 A;  1TWH J;  3BJA A;  4M74 A;  2CS3 A;  1Z0X A;  4AWX B;  2Y48 A;  1TTY A;  5DD4 A;  3H0G J;  2PX9 A;  5IYB J;  1B72 A;  3J7A O;  2IT0 A;  3LSI A;  2IA0 A;  5IPA A;  1ZG3 A;  2MSY A;  4II2 A;  3RZD J;  3T5X A;  4NC6 A;  1SD6 A;  3QOD A;  4NC7 A;  1VI0 A;  1BM9 A;  1V3F A;  2L7K A;  2OA4 A;  2XPW A;  1WHU A;  2OQG A;  3BZK A;  4L9V A;  1YX3 A;  3ZQ7 A;  1MJA A;  1S8N A;  2W84 A;  5M5X J;  2MBF A;  5J1Y A;  1OJL A;  2Y31 A;  5LGN A;  2K5C A;  4XLF A;  2EFW A;  5FJ8 J;  5D6E A;  2KIM A;  1MBJ A;  3OR1 C;  5FD5 A;  2EZL A;  2P6S A;  3KP4 A;  4WF2 A;  2OU2 A;  3GLL A;  2CV1 A;  3GLX A;  4L9N A;  1MZB A;  2DLL A;  3A4C A;  4IVN A;  3ABK H;  5H6R A;  1ZKG A;  2LBF B;  3ZOB A;  1LDJ A;  1R71 A;  1R9T J;  3CJN A;  2VBZ A;  2DPD A;  1FMW A;  1MBK A;  3BTC A;  2JRM A;  3V7R A;  2L01 A;  2V9P A;  4LB5 A;  4EVI A;  3MAJ A;  4NDL A;  1EKE A;  4I0A A;  1QBJ A;  2DDB A;  2M34 A;  5ICF A;  2W57 A;  3G1M A;  1T0F A;  3I5U A;  3E7L A;  2W1O A;  3LSG A;  5KAI C;  3F8M A;  1IO2 A;  3QQA A;  3GUD A;  1Z3Y A;  4MNU A;  1MMS A;  1IN4 A;  2K40 A;  4B3X A;  3IWZ A;  2HVQ A;  2XAS A;  4PCQ A;  2LLK A;  4RLQ A;  4IF4 A;  3RQ4 A;  3OYJ A;  1R5G A;  1W0U A;  4JK1 X;  4BL0 B;  4XLA A;  5EG0 B;  2Z3Y A;  1TW2 A;  2QQ9 A;  2OUM A;  1DPR A;  3SDG A;  2E5Z A;  4KIS A;  1RKW A;  3DBR B;  3GFL A;  3AG1 H;  4D5F A;  3BCB A;  1J59 A;  2JSC A;  3KP2 A;  3HRS A;  1TWG J;  3K4C A;  2CMP A;  2AQE A;  2QEN A;  5M3F J;  1P9Q C;  5DDG A;  1LDK B;  2FNP A;  1X3U A;  1IXS B;  2DOA A;  2XF5 A;  3E5X A;  2KJB A;  3H5R A;  3Q3S A;  4PGG A;  2F2E A;  1I3Q J;  1OR7 C;  1G3W A;  2ZB9 A;  3BG7 A;  1Z6R A;  5D8L B;  5C3E J;  1W36 D;  2VL8 A;  4MEX F;  3LSP A;  2Q1Z B;  4OAY A;  4PJN A;  3JRI A;  4G12 A;  5ILV A;  3K70 D;  3MVP A;  4U7B A;  5ED4 A;  1YI2 I;  1XSV A;  1GLN A;  3LAP A;  1OCR H;  3TOA A;  2BHZ A;  5IYD J;  1F5T A;  3BLY A;  3QPL A;  2IRF G;  1A31 A;  3BTL A;  1UST A;  2F5V A;  2HZT A;  4CSW A;  1U5T C;  1Z77 A;  1YX5 A;  2C6Y A;  5DCM A;  1R23 A;  2RRE A;  1QVT A;  2TCT A;  1FTT A;  2XPV A;  4ON0 A;  4IHW A;  2JTV A;  1MBH A;  2P8T A;  2MW8 A;  2KKO A;  4IHT A;  2MLG A;  3F3X A;  3BJ6 A;  3H3Z A;  2O7O A;  1MJB A;  4HDV A;  2GXB A;  2H6B A;  2KIU A;  5CVR A;  1D5V A;  2XKP A;  4XKB A;  4H4K C;  5DCF A;  1NG6 A;  4BAY A;  1YW8 A;  5CQG A;  4I2O A;  3GTO J;  5FFX A;  3M3Y J;  4ETS A;  4QPQ A;  1MNE A;  5EJC A;  4OIO F;  1RR8 C;  5HLT A;  3B73 A;  3D5S C;  3IL2 A;  1B59 A;  3ZP5 A;  2BXZ A;  4YFN F;  4LLN A;  1VQ6 I;  2EV0 A;  2L5Q A;  1OCO H;  2E7W A;  4EJO A;  3GO5 A;  3Q9S A;  4A69 C;  5L3C A;  1CQT A;  1ZLK A;  4Q47 A;  4FIS A;  4V2F A;  4AUX A;  2H8R A;  3NAU A;  1FT9 A;  1GV5 A;  2JUG A;  3K4N A;  2LY2 A;  4CYC A;  4E70 A;  1UB9 A;  3HOX J;  4S0H B;  2A69 F;  4M6V A;  2VON A;  1FBQ A;  2W24 A;  2NOJ B;  2ESN A;  3S8P A;  4PDK A;  5IT9 Z;  2L2O A;  4BKX A;  4WX9 A;  3E5U A;  3LA2 A;  2R7D A;  3IC7 A;  2HQR A;  5M3M J;  4MFE A;  4KIT B;  2DA7 A;  2XAF A;  3PUF A;  4HQE A;  1LE8 A;  1O57 A;  3ZN0 A;  3OS1 A;  3OYN A;  2B0L A;  4XKV A;  2M8E A;  3QYE A;  1KQ8 A;  1ZG5 A;  2YSR A;  2EBI A;  1D0X A;  1QPI A;  2FEZ A;  1RRJ A;  4L5J A;  3NQO A;  2ZNY A;  3HOV J;  2BHY A;  3RYP A;  1CF7 B;  3TBI A;  3HPH A;  3ELK A;  4Y7N J;  1HF0 A;  2L4M A;  1XPX A;  3F22 A;  2OZ6 A;  4I76 A;  4ZJZ A;  1MDM A;  3BG5 A;  3S93 A;  4AC0 A;  1BI0 A;  2MAB A;  2VOD A;  3MD2 A;  2RGV A;  4A2U A;  2Z16 A;  2L4A A;  4Q5S F;  4ESB A;  1U6G A;  3HKZ A;  2ZXI A;  1RUN A;  2CJJ A;  2DOF A;  2VE9 A;  1JHF A;  3HG9 A;  2GA1 A;  4KUM A;  3MQ0 A;  2VQG A;  5JFR A;  1P4W A;  1TWC J;  3HHH A;  2JVG A;  3I4P A;  1BC8 C;  4E7K A;  3VEP A;  1VND A;  2ZSI B;  4M72 A;  3WOD F;  3V7C A;  4B47 A;  1LJ9 A;  3LSR A;  4BXU A;  3M9A A;  1OCT C;  3CC7 I;  3C18 A;  5HDN A;  4HOB A;  3BG9 A;  4V2G A;  4EEF G;  2K85 A;  3PNT A;  1WSU A;  1SD4 A;  2F5D A;  3OY9 A;  2QWW A;  1KQ9 A;  3LA7 A;  4PJL A;  3DU6 A;  4HA8 A;  1QZZ A;  2ID3 A;  1S72 I;  2GM4 A;  3P9I A;  1UFM A;  4M9S A;  1QA6 A;  2D1V A;  3IH4 A;  4G7O F;  3T8T A;  1Y8Q B;  3K4M A;  3VYR B;  1A36 A;  2DYS H;  4DBQ A;  2UXX A;  2RNJ A;  3FXR A;  1B8I A;  4BXX J;  3BR5 A;  2OCE A;  3OYB A;  1SFX A;  1ZGA A;  1P2F A;  5TJJ A;  3OOU A;  1TWA J;  3K9T A;  1MMD A;  2QKL B;  3HYI A;  2XRO A;  4IJA A;  2Z99 A;  5FKN A;  2R92 J;  1ON2 A;  3RSN A;  3JTG A;  5JVG F;  2F5E A;  2LRD A;  1Y1V J;  4HNT A;  3TO9 A;  3CCJ I;  5F64 A;  4KIG A;  1SVO A;  1T0F C;  2LP0 A;  3EPZ A;  5LRS A;  3HOU J;  3K4B A;  4N9I A;  1KGS A;  1KZH A;  2WA0 A;  1PP8 F;  4HV6 A;  3HJE A;  2DMN A;  2ACJ A;  2HVS A;  4CZZ A;  4I99 C;  1BI1 A;  3Q0V A;  3CES A;  4XR6 A;  3E6C C;  5E1Z B;  5HVQ C;  2X6X A;  4G6T B;  4G9Y A;  3IKT A;  1MD0 A;  3JRH A;  3Q0W A;  3FXO A;  2FD5 A;  1FNN A;  2R93 J;  4HAM A;  6PAX A;  1A5J A;  1TQI A;  4IOC F;  1ETY A;  3K2A A;  4OU0 A;  3VFZ A;  3RTR A;  3A2K A;  3GTM J;  2E35 A;  3Q9V A;  4XRF A;  1FC3 A;  2Y75 A;  5D4S A;  2RAE A;  3M8J A;  2QGU A;  5K7F A;  5CJ9 A;  5H2F C;  3IH2 A;  2N8G A;  2DTZ A;  3KCC A;  3SYT A;  5IOY A;  3DKW A;  2R7U A;  3DU5 A;  3SEZ A;  1QRY A;  3R0A A;  1X2M A;  1XDS A;  2XB0 X;  3G3Z A;  4E4H A;  1MKM A;  1P7I A;  2HGC A;  4D7N A;  3KIO A;  1Q1H A;  4L0Z B;  1FEX A;  3D0S A;  2EA2 A;  2CV2 A;  3OV8 A;  2O6G E;  3JAM Z;  1FSH A;  3DPU A;  2O0Y A;  5BNG A;  2FBI A;  3HEF A;  3JRB A;  3HOT A;  2M7A A;  1ACI A;  2X48 A;  4XLP F;  2MC3 A;  5GAE J;  1WVR A;  3LQQ A;  4QSH A;  3VSK A;  5B1B H;  2Y2Z A;  4AYB A;  4YEJ A;  3ZQC A;  2K9L A;  4ZYA A;  5F0C A;  4LG0 A;  3ZCO A;  5K5Q A;  5EGO B;  2XGX A;  2RKH A;  3I53 A;  5CYV A;  4BQQ A;  3IV5 A;  1E3H A;  4OIR F;  3O8G A;  1JUS A;  5C4X J;  1GVD A;  4EM2 A;  2QUF A;  3N05 A;  1TW3 A;  4ZH4 F;  1APL C;  5FKM A;  5E18 F;  1AKH A;  3GTL J;  4XNF A;  2JA6 J;  1BI2 A;  1PUF B;  2NVT J;  1Z3X A;  2IPQ X;  3CCQ I;  2RN7 A;  3J80 Z;  1XS9 A;  3S1N J;  4M3B A;  5IOZ A;  4W97 A;  4ZYE A;  1F4K A;  4EV0 A;  1Z67 A;  2KZV A;  3GFJ A;  4JBA A;  4A0Z A;  1XTA A;  4DBR A;  1DU6 A;  1BR2 A;  4BH9 A;  3A01 B;  3BTI A;  2K9N A;  2H1L A;  2KFD A;  5JHU A;  1NK3 P;  3MKZ A;  4B3A A;  3JRC A;  3D5R C;  1YG2 A;  3BR2 A;  2EV5 A;  2E34 A;  2NXN B;  1BI3 A;  2ADU A;  4LLL A;  2CH0 A;  4IQJ A;  1JGS A;  3ZPL A;  3V42 A;  2X51 A;  2PMZ N;  5E3L A;  1MBF A;  1B9M A;  4MHG A;  3PFY A;  4M9Z A;  2V4J C;  4IHV A;  4RBO A;  3NAR A;  2XSD C;  2KDO A;  3AAF A;  4HRI A;  5K5R A;  4CH7 A;  1W5T A;  4KFC A;  4XKC A;  3J81 K;  4I7H A;  2F5F A;  2ZFW A;  3CCU I;  4RDU A;  3S14 J;  2X6W A;  2F48 A;  2LH9 A;  2CUE A;  3BY6 A;  3ISP A;  5D5W B;  4MO7 A;  3OYM A;  2VI6 A;  2OQR A;  2Y0S N;  3L9F A;  4A6D A;  2HYF A;  4KYW A;  3VYT B;  3S2W A;  1R4N B;  4P5O A;  3HSF A;  3HGG A;  2BBY A;  1E0E A;  3BZC A;  4U87 A;  3JRD A;  3F8F A;  4JQF A;  5J1R A;  3E3V A;  1H0M A;  2CUZ A;  3S2H J;  1KQ0 A;  1LNW A;  4A5N A;  4WXC A;  2MD0 A;  1OYY A;  3T0Y A;  1XG1 A;  2LFB A;  2Z5U A;  3QAH A;  1BJA A;  1F9N A;  2XHK A;  4C3H J;  5FO5 A;  4F92 B;  2K3F A;  2CFO A;  4BDY A;  3JRG A;  4GCV A;  2DA2 A;  4GXO A;  1MMA A;  4KT6 A;  4FTH A;  2CGP A;  5CPR B;  4BQA A;  4HYE A;  4G6Q A;  3H92 A;  1O4X A;  2FE3 A;  5F1R A;  3PO2 J;  4BHP A;  1HXD A;  1JT6 A;  1QGP A;  4B1R A;  4BE1 A;  2K02 A;  1GVJ A;  2OJE D;  1O3S A;  4Y3O A;  2DA1 A;  2XB5 A;  4GDF A;  3CD6 I;  5FD6 A;  3WU2 C;  2Y0M A;  3L2V A;  2CG4 A;  2R7V A;  3PO3 J;  3I71 A;  1VQ9 I;  3ZMT A;  3IUO A;  3QYF A;  1X1A A;  5E20 A;  1MGT A;  2HOS A;  3JSO A;  1I6X A;  4ZZD A;  3PIO F;  1LFU P;  3HOS A;  3MZY A;  1OPC A;  2A3S A;  3ZMV A;  2IS2 A;  2FJ1 A;  2DQR A;  2V7F A;  2NNY A;  4ESJ A;  5HDK A;  1Y0N A;  4J19 A;  3O2P E;  2XRN A;  2VJI A;  3CF5 F;  4G7H F;  4FT8 A;  4IPA A;  2Y9Z A;  2Z2S B;  4YIF A;  3GZ5 A;  5GTI C;  2BVL A;  2P5K A;  2PEX A;  3TOB A;  3K2Z A;  1K4T A;  1R5I D;  2E60 A;  3RKW A;  4TV7 A;  3OS0 A;  1R58 A;  1O3T A;  2MD5 A;  3LAJ A;  1D0Y A;  4GGG A;  1G3T A;  4EJW A;  4RM2 A;  2GOM A;  3Q5F A;  5E1W A;  1LB2 A;  2D1H A;  5J3L A;  1IAW A;  5F0F A;  4WWC A;  3ROU A;  3TO6 A;  3K1M A;  1RC9 A;  5GAG J;  5J1U A;  1TT5 B;  2NVY J;  4UV8 A;  4HST A;  4L9J A;  2LMD A;  3SDB A;  3CCS I;  3KP3 A;  2E2I J;  2WY8 Q;  4XLH A;  3KYL A;  3RJP A;  2LKP A;  3FKI J;  1JTX A;  3ZQL A;  5HLG A;  3FWE A;  4I98 B;  4ZC3 A;  3D1N I;  5DV5 A;  2K86 A;  3BJO A;  3X2Q H;  3KEO A;  1D1C A;  1YFH A;  2DN0 A;  2DDA A;  2QQ8 A;  3KP6 A;  4D7M A;  4E7I A;  1IN8 A;  2ZJ2 A;  3CDH A;  4OOI A;  1RI7 A;  2UZK A;  4U0V A;  3MZ8 A;  3DXJ F;  2AXT C;  2LRE A;  3DCF A;  2V1U A;  1UHM A;  4DW6 A;  4A3J J;  3F0C A;  3DTK A;  3UR3 C;  2WB1 N;  4A3C J;  2COM A;  3C3W A;  3TDZ C;  4DJA A;  3H1C A;  1F1Z A;  2OBP A;  2K4B A;  1TLH B;  2DI3 A;  3SFZ A;  3F6V A;  4IO9 F;  5LHI A;  2I5U A;  4CXF A;  2PFB A;  1U0J A;  3TW7 A;  4ZYD A;  2PLY A;  1T6S A;  1G59 A;  4HV5 A;  3S16 J;  1WWX A;  5F08 A;  3G4S I;  1T38 A;  3EYI A;  3T1B A;  4CHU A;  1TQP A;  3LSK A;  3OWT A;  5LGU A;  4P9F A;  5EEH A;  2DXI A;  2ZME A;  1LVA A;  4A6E A;  4CZC A;  4EAT A;  2PJP A;  3MWM A;  3Q0U A;  3W6K B;  5LD2 C;  1B9N A;  5JLX A;  1Y8R B;  3GVA A;  1O7L A;  2FML A;  1WJB A;  2CQX A;  4AVZ A;  3CTA A;  4RB0 A;  4E7S A;  2RQP A;  4MQ9 F;  3A0B C;  1R7J A;  2E36 A;  2Q2E A;  2GIZ A;  3DTI A;  1BC7 C;  3DPL C;  3N97 A;  2LG4 A;  3GBG A;  4LMY A;  2V9V A;  3CDL A;  4KMF A;  5F6F A;  3CCY A;  3I59 B;  1J0R A;  3E1S A;  3P9K A;  3RPU A;  4F55 A;  2HNH A;  4PJJ A;  2L7M P;  1PJR A;  3ASN H;  1J2X A;  1PP7 U;  1GT0 C;  1T95 A;  2FOK A;  2L0K A;  3PQK A;  3OYH A;  1LFP A;  1J9I A;  1JE8 A;  2M4K A;  4U0Y A;  4Z2Y A;  3DTE A;  1OQY A;  4C9Y A;  4LLG F;  4ZZL A;  1NG7 A;  4X6A J;  1YTY A;  2STT A;  3J7A Y;  3CLO A;  1KA8 A;  5F0H A;  2HKO A;  3WHC A;  2ISZ A;  4MTE A;  1W7P D;  1FWZ A;  2W00 A;  1A6Q A;  3LWF A;  4EQQ A;  2OCC H;  2EFQ A;  2GBY A;  4OAZ A;  2VKD A;  4YFK F;  4BY7 J;  4RA2 A;  3ECO A;  3A02 A;  5AON A;  2A6T A;  4XLN F;  3W6J B;  1I5Z A;  1MSF C;  2ZCW A;  2FA5 A;  3FK7 A;  4L5I A;  2M7B A;  5FKL A;  2UV1 A;  4OIN F;  1P4A A;  2FRH A;  3WGH A;  1WZ2 A;  1USS A;  1UHS A;  3DPT A;  5K7H A;  1TL8 A;  2VQC A;  5H20 A;  2NOG A;  4QLC U;  5J8C A;  5A2Q Z;  1WGX A;  2LYC A;  3RQI A;  1I39 A;  1R36 A;  4L9T A;  3RCO A;  1K78 A;  3B6C A;  3WTU C;  5GAH J;  3LMM A;  1R5H A;  3GW2 A;  2ZJR F;  1P7J A;  4IKF A;  1IXC A;  1DPU A;  3RKY A;  2VKV A;  3MMY B;  3GF2 A;  1Z9C A;  1BIB A;  1XCB A;  3IAM 2;  4BEH B;  1IW7 F;  1HDP A;  2ECB A;  3FZV A;  5EEA A;  2BY3 A;  5ICE A;  1V5G A;  5BQT A;  5DS9 A;  2DYR H;  2BYV E;  2HU9 A;  3PNV A;  4CCN A;  1YRN A;  3F8C A;  4YII A;  3CUQ A;  4XMY A;  3S3M A;  2KRF A;  1S9H A;  1R1T A;  1LVK A;  3M8F A;  2R5Z B;  2QVO A;  5BMZ A;  1DDN A;  4A3E J;  1JKR C;  2X1E A;  2QYO A;  4BYY A;  1X4O A;  3FMQ A;  2LY9 A;  4S04 A;  3ZQQ A;  4PFP A;  1W7P B;  1IGN A;  4P1W A;  3CCE I;  4M3G A;  2MFZ A;  2O9L A;  1E3O C;  3HUG A;  1J09 A;  2VOO A;  2DW4 A;  3HHG A;  1MMN A;  4C2M J;  3CCV I;  5LRR A;  1V54 H;  3TW6 A;  1EH7 A;  2E1M C;  4AIJ A;  3GCM A;  4PSX A;  3VOE A;  2XPU A;  1Y56 A;  2IS6 A;  1JXS A;  4ZYG A;  1IRF A;  1S7E A;  1G4D A;  1HLV A;  5ERI A;  1KU9 A;  3E6D A;  4D9J A;  1JKQ C;  2F4M B;  3GFI A;  1U8R A;  3ABL H;  1P92 A;  1J7K A;  2WAQ N;  3DEU A;  3HOZ J;  1IUF A;  1WCM J;  2BW3 A;  4MIM A;  5IT9 K;  3I54 A;  4IQ4 A;  3D5L A;  3U1K A;  4HNU A;  2ZXH A;  2V79 A;  4XOR A;  5BPD A;  2XGE A;  1G6N A;  2FU4 A;  3I58 A;  4OMZ A;  3EDP A;  1H9T A;  2QSF X;  4FQG A;  2DK8 A;  3H5N A;  3GTQ J;  4NNJ A;  1XMK A;  1ONV A;  2PMZ A;  3BG6 A;  3AG2 H;  4A3I J;  5FLV A;  2EZI A;  2M87 A;  1JKO C;  2EZK A;  3DKY A;  1XN7 A;  1W36 C;  1D0Z A;  1I1G A;  1U5T B;  3PSI A;  3TQN A;  2LTP A;  5BOX A;  2R7Z J;  4BY1 J;  2FNA A;  1VQ7 I;  1EJ9 A;  3R0J A;  3LOC A;  3ESW B;  2BOL A;  4HNV A;  4L0Y B;  2ZNZ A;  5E17 F;  1IG7 A;  2Y0S A;  4FE7 A;  3KLO A;  1EH6 A;  5L3G A;  3SHF A;  4C3I J;  2PJR B;  3B02 A;  5E79 C;  1RNL A;  4DNC A;  2IXS A;  4UUS A;  1HQC A;  3WE3 A;  1PUE E;  5DUK A;  3GZN B;  3RYR A;  1LUJ B;  4CUG A;  1T33 A;  3O3K A;  3GWZ A;  2M4G A;  2EZH A;  2WY7 Q;  2IAI A;  2YPR A;  2ZME C;  3HC7 A;  5HDG A;  5ILS A;  4J01 A;  2ZJP F;  4UVC A;  4NHJ A;  4A3D J;  1WJE A;  3OIO A;  1RES A;  3OR2 C;  1YIJ I;  5TIS C;  3FHN A;  1YE9 A;  3L2Q A;  1K4S A;  1VFC A;  3KEQ A;  2MC4 A;  5BPI A;  2GOX B;  2VT2 A;  2P7C B;  3NWT A;  2WV1 A;  3WTV C;  2VE8 A;  2CQ7 A;  2X1D A;  4DZP A;  1SVM A;  3S1R J;  3HOY J;  5BS6 A;  3K10 A;  4ZYH A;  2XAU A;  3CCM I;  2R5Y B;  4RB3 C;  1SAX A;  2JA5 J;  4B48 A;  4PJM A;  2B63 J;  5CVJ A;  4EJT A;  3H5A A;  2QBY B;  2E7X A;  2VJ5 A;  3K4L A;  3ZMD A;  3E5Q A;  3UNG C;  5FLM J;  3W2V A;  1R22 A;  4F3Q A;  2XIG A;  3AL0 C;  3BR0 A;  2VOP A;  2NVQ J;  5JI6 A;  1SAN A;  4D0P A;  2YU3 A;  3CF2 A;  4HQM A;  5D5V B;  1H9G A;  3TMO A;  3FMS A;  4QPO A;  3H0D A;  2DJN A;  1S7A A;  5C4J J;  5LGT A;  2XF7 A;  3JRA A;  2QSG X;  5KK1 A;  1NH3 A;  2JA8 J;  1X2N A;  1Z1D A;  3F8B A;  3VDX A;  3M07 A;  5J8F A;  4RGX A;  3I64 A;  1EA3 A;  2DMQ A;  2IGN A;  2DA6 A;  4HX7 A;  3C2H A;  4PJ0 C;  3TKY A;  1OYI A;  1L0O C;  1MND A;  1YQA A;  2HR3 A;  3W3C A;  4ZDP A;  4Y33 A;  5D5X B;  2YS9 A;  5L3E A;  1ZH5 A;  1XGO A;  2W25 A;  1ZEL A;  3FMR A;  3M8E A;  2HFH A;  1U9O A;  1ZRF A;  2LNB A;  1VQ4 I;  2E2H J;  4IRH A;  1B72 B;  1WI9 A;  4PK4 A;  2DFE A;  2IP2 A;  4B4C A;  2IGO A;  3JR9 A;  1STZ A;  3L7W A;  1UCR A;  1X3Z B;  2A5Y B;  2LKS A;  3DBH B;  3IH3 A;  1LQ1 A;  5D6F A;  1Y6I A;  3BPX A;  5EZH A;  4CA0 A;  1L3L A;  1IJW C;  2STW A;  2HDW A;  1P6R A;  2R7X A;  1LEB A;  2BXY A;  1K6Y A;  2VC0 A;  2D2W A;  2E2J J;  3F6O A;  4QWQ A;  4CCK A;  3ZQF A;  2IW5 A;  1G3S A;  4KN7 X;  4KA4 A;  2ZSH B;  4KDP A;  3N4M A;  1OCZ H;  1HW5 A;  1R4M B;  4YG2 F;  3SZG A;  4NQW A;  4ENK A;  4DYQ A;  1YW9 A;  4JP0 A;  2L7Z A;  3CO6 C;  5KAF C;  3FXJ A;  2TDX A;  2MH9 A;  3WTT C;  4UUV A;  5TGT A;  1KYW A;  3ML6 A;  5FFZ A;  3S2D J;  2KDZ A;  1QQI A;  2MG4 A;  4WK8 F;  1ETX A;  3OYL A;  1FP2 A;  2DCE A;  2ELH A;  2GA2 A;  3CQZ J;  3FIW A;  3JAM K;  4A0Y A;  4UNO A;  5GPA A;  4RGU A;  1WJ5 A;  4LIV A;  4W1U A;  4P55 A;  5HS9 A;  2NVU B;  1WH7 A;  2KIS A;  3QPH A;  5K1Y A;  3LFK A;  1BR4 A;  3CUQ C;  2EH3 A;  2O3F A;  3KX2 A;  1QNT A;  1X19 A;  2HOE A;  2XRL A;  1SFO J;  2ME0 A;  3HTS B;  2DFF A;  4A5M A;  1WH5 A;  2OZU A;  5EF6 A;  1WJC A;  2XAQ A;  4A3M J;  4M73 A;  4UXN A;  3RI4 A;  2AO9 A;  5JVT A;  4N0B A;  2NS7 A;  3WU1 B;  2X4H A;  1SMT A;  2XDV A;  3P9C A;  4V19 K;  1MBE A;  4FE4 A;  1AA7 A;  2DO7 A;  2ME6 A;  3LQR A;  3DFG A;  4CCJ A;  4ASN A;  1N77 A;  3J80 K;  2CQN A;  3MFK A;  4LK1 F;  3HL2 A;  1R49 A;  4XSZ F;  2X6Y A;  3KEY A;  5M5Y J;  3WGI A;  2CV0 A;  3GEZ A;  1N75 A;  1RR7 A;  1W1W E;  1LFB A;  1GV2 A;  2XAG A;  4GFB A;  4E7J A;  4Y17 A;  1V5F A;  2G7U A;  3H35 A;  3OYD A;  4M6Y A;  3LNQ A;  4RB1 A;  2WAF A;  2XC7 A;  1T98 A;  3IRR A;  2EK5 A;  1NTC A;  2V1D A;  4BU2 A;  2NVX J;  3NWS A;  2VUM J;  3KYD B;  4XON A;  4HLY A;  2H8W A;  3U1D A;  2XAJ A;  3OOP A;  4IEJ A;  2D5V A;  1AOY A;  2BV6 A;  2JA7 J;  2R7F A;  1UHW A;  2VKE A;  4BUP A;  1SD5 A;  2V1N A;  4XQF A;  4BJ5 C;  3MN2 A;  1OMI A;  1IRX A;  2VIX A;  1FYM A;  1U78 A;  3ULQ B;  5FRN A;  2XGD A;  4GYI A;  4HF0 A;  4XSX F;  2M0C A;  1WI3 A;  1I50 J;  4JX5 A;  2R4G A;  5DCM B;  1REP C;  2CWE A;  3KP5 A;  2FMY A;  2LSO A;  3QP5 A;  4N4N B;  4RB2 C;  2LDU A;  3L00 A;  4A3F J;  1EV7 A;  1S29 A;  2J5O A;  2KIQ A;  4BBS J;  1FIA A;  2F6C A;  2ZJQ F;  1YJ9 I;  2HOT A;  3SFI A;  1K7A A;  4I0B A;  3V4G A;  2H1K A;  1SFU A;  5GAD J;  5FRM A;  2F5C A;  3NEU A;  4E7H A;  5CVU A;  3GTP J;  4HLX A;  2NS8 A;  3PFI A;  3M1E A;  5JLW A;  1D5Y A;  1QPM A;  4DYC A;  2LF8 A;  2QKM B;  2LBF A;  1GUU A;  3ZQG A;  2CQK A;  4BS9 A;  2HYJ A;  4IHX A;  2L7F P;  2FX0 A;  3IWF A;  1VQO I;  3O6B B;  3TGN A;  2E71 A;  5GPC A;  2K4J A;  2KT0 A;  4M9X A;  4B09 A;  3HDD A;  5FLX Z;  4ENN A;  4FX4 A;  2V6C A;  5L3D A;  3K6G A;  1OYW A;  4RAG A;  5DYM A;  4CYC B;  4EGY A;  2DAO A;  2FUG 2;  3HBL A;  4G6D A;  2X0L A;  4FHT A;  4XRS A;  5GP9 A;  5F27 A;  4O6J A; 
#chains in the Genus database with same CATH homology
 1R00 A;  1SFE A;  3TDU C;  1RUO A;  3ERE D;  1IN7 A;  1FZP B;  2CO5 A;  1FYK A;  2EWN A;  2FBH A;  1JHH A;  3EUH A;  4FX0 A;  2AS5 F;  3QU6 A;  5FB2 A;  4Q4Z F;  3WTX C;  4IRI A;  1MDM B;  3DV8 A;  2D45 A;  1IUY A;  3LA3 A;  3V8K A;  2VT3 A;  2IJL A;  2VC1 A;  2DU9 A;  3HIF A;  3FXQ A;  4M71 A;  2Q8K A;  5D5U B;  5L3B A;  1YLF A;  3NRV A;  1S3J A;  2YX7 A;  3K1N A;  1E2X A;  5CVI A;  2M5W A;  1FX7 A;  1Z6T A;  2UWM A;  1K6O A;  3HTU A;  4K2E A;  2DK5 A;  2HWV A;  4BHB A;  2PG4 A;  1IF1 A;  4IXA A;  3I0T A;  3HRU A;  2ZBK A;  3WU0 A;  1W4M A;  4HX4 A;  2OD5 A;  2HTJ A;  4EMS A;  1FOK A;  3QRF F;  1HKQ A;  1O3Q A;  3FX3 A;  3JW4 A;  1ZRD A;  4KNY A;  2GAU A;  4HBL A;  3SQN A;  1XMA A;  3EET A;  4S05 A;  2XUB A;  2QQA A;  2CYY A;  2ETH A;  3CO7 C;  1YYV A;  1CF7 A;  3R4K A;  2JZY A;  1XSD A;  3KZZ A;  4KIB A;  4Y13 A;  1P4X A;  4AIK A;  2XKO A;  3K69 A;  5HS8 A;  2G7H A;  4AVP A;  2PQ8 A;  2DPU A;  1R1U A;  4P9U A;  3RDI A;  4G7Z F;  2ZO4 A;  2IVM A;  2L3D A;  4EM1 A;  2GWR A;  1GHC A;  3R6S A;  1HKT A;  2H27 A;  2DFI A;  4CGZ A;  2A6E F;  2BGC A;  1ZLJ A;  5E1X A;  3BPV A;  3RPQ A;  4R1H A;  4LG0 B;  4EM0 B;  1T39 A;  4HDU A;  1IRG A;  2KJC A;  2P5L C;  2QZ8 A;  1WQ2 A;  3C1D A;  4OIP F;  3VOD A;  4KT5 C;  1FY7 A;  4A12 A;  2QQB A;  5A2Q K;  2FQ3 A;  2XVC A;  3WE2 A;  4YFX F;  5JR3 A;  3KE2 A;  1XCV A;  3C7J A;  2W85 A;  2GZW A;  1XB4 A;  5E8G A;  4KN4 X;  1YS6 A;  1U3E M;  2O8X A;  5LEK A;  1FYL A;  3DQV C;  4F7Z A;  1TQM A;  5H6Q A;  3E6B A;  1VTN C;  3BRO A;  1HBX G;  1I27 A;  3F8N A;  4MTD A;  3ECH A;  2DQL A;  1DP7 P;  2GQQ A;  5LHH A;  4GYG A;  1J75 A;  3ZMZ A;  2Q0O A;  2JPC A;  1S6L A;  2FF4 A;  5DD8 A;  2CSO A;  4CO8 A;  1Y0U A;  2KIF A;  3R61 A;  3WTW C;  5CVV A;  1IXR C;  4WCG A;  4WXH A;  3HSE A;  2WTE A;  3EYY A;  3SZT A;  2Z9O A;  1TBX A;  4IHS A;  1XGN A;  4IRG A;  2FBK A;  3E6M A;  2ZKZ A;  3KET A;  4LK0 F;  1RZ4 A;  4ESF A;  2XV4 S;  2K7L A;  1GXP A;  3HRM A;  2PBI A;  2WC2 A;  1DUX C;  2XAH A;  4RAZ A;  2VN2 A;  2DT5 A;  1I1S A;  1FLI A;  1BIA A;  2CFX A;  5DEQ A;  3ABT A;  4R79 A;  4ENJ A;  2K27 A;  3WG9 A;  1IN5 A;  1HKS A;  2NNN A;  3JSP A;  4U88 A;  1HW2 A;  2DTR A;  2J5P A;  2WWY A;  4RGR A;  3JTH A;  3V7S A;  3MEX A;  3BWG A;  1ZGJ A;  3COA C;  2A61 A;  2EFO A;  3TO7 A;  5HOO A;  4OIQ F;  3PQJ A;  1KYZ A;  2GIV A;  1FBU A;  4KMU X;  1XGS A;  4GO1 A;  3ZMU A;  3ZMS A;  4HW0 A;  1GXQ A;  3VB2 A;  3HSR A;  1RIO H;  4BHC A;  3K1P A;  3GXO A;  2VBY A;  1O3R A;  1D8J A;  2RDP A;  1T2K A;  2QM3 A;  2JPB A;  4PGH A;  4L18 B;  4P96 A;  3MCZ A;  4UV9 A;  1J5Y A;  1KU2 A;  5HS7 A;  2ZME B;  3ZN1 A;  1SD7 A;  2MA3 A;  3KZY A;  5AIQ A;  4HF2 A;  1BOA A;  4O5V A;  5K5O A;  3H3U A;  1ZAR A;  3KP7 A;  1Z7U A;  4Y15 A;  3IRQ A;  2EV6 A;  5ICC A;  4AD9 A;  5TRD A;  2UXN A;  1R1V A;  1HW1 A;  2H6C A;  4I01 A;  2PI0 A;  4G94 A;  4HX8 A;  3RIR A;  1YIO A;  1NHA A;  1ULY A;  2EB7 A;  3P7N A;  2VXZ A;  2PMU A;  5LLQ A;  5FGM A;  4O3M A;  3WGG A;  3QU3 A;  2E1N A;  3IKV A;  4CDG A;  1ZG1 A;  1ZN2 A;  2ZXJ A;  4BNC A;  2R3S A;  4RGS A;  2RVC A;  1SMY F;  4H0E A;  5J6X A;  3L09 A;  2P6T A;  1QO0 D;  1K78 B;  1LEA A;  2M1B A;  1C0W A;  1B1B A;  2VBW A;  1LDD A;  2WV0 A;  3R60 A;  4WXD A;  5CLS A;  1WRJ A;  1FBS A;  2EJR A;  4CYD A;  4HF1 A;  2Z33 A;  2ISY A;  4KIF A;  4B8X A;  5DUI A;  3KLN A;  3CUQ B;  1CGP A;  3SZP A;  1D3Y A;  5LEJ A;  2AXL A;  2A6H F;  4LGW A;  1PDN C;  2DBB A;  3BZ6 A;  4UHT A;  5HLH A;  1WKM A;  2HS5 A;  3I59 A;  2YX4 A;  4CIC A;  3FHZ A;  5FLX K;  2HYG D;  2EFP A;  4U0W A;  5AIP A;  2IA1 A;  1QZY A;  1K79 A;  1XD7 A;  1ODD A;  2YR2 A;  3GFM A;  3E97 A;  1KU3 A;  5ICG A;  1E17 A;  1A04 A;  1YS7 A;  1IZ1 A;  1KU7 A;  1TNS A;  2H09 A;  2NYX A;  3EQL F;  4U7D A;  2BE5 F;  1B4A A;  1XDU A;  2L54 A;  3MZH A;  3QPT A;  4LB6 B;  2HEO A;  3ABU A;  3G73 A;  2FXA A;  3WTZ A;  3LST A;  1EH8 A;  4DQ2 A;  2MLK A;  2NRA C;  2JRT A;  3QOP A;  1BN5 A;  3GX4 X;  5LBQ A;  2EFN A;  4EJV A;  3M7G A;  4ENM A;  1YW7 A;  1ZRC A;  4LJZ F;  2ESH A;  4NB5 A;  1XGM A;  4LD5 A;  3GYH X;  2HTS A;  2HDC A;  1B6A A;  3GZ6 A;  2VBX A;  3IHU A;  3J81 Z;  1O7F A;  1W7P A;  4EGZ A;  1Z05 A;  2CW0 F;  5E8I A;  1FPQ A;  3F23 A;  1W5S A;  3QP6 A;  2QLZ A;  3FM3 A;  1OKR A;  1XSX A;  1G3Y A;  3U9G A;  3BP8 A;  1ZYR F;  3BDD A;  3FXU A;  2IA2 A;  5LHG A;  3K0L A;  2O03 A;  2A07 F;  4MQV A;  1TNT A;  3SXY A;  1Z91 A;  3V8J A;  1U2W A;  5KVR A;  4I09 A;  2NS0 A;  3F21 A;  4AIH A;  3FF5 A;  4EJU A;  3BOQ A;  2PN6 A;  1OR7 A;  2HKX A;  2G9W A;  2MH2 A;  1BBY A;  3CUO A;  1MJ9 A;  4M6X A;  4HZF A;  2P5V A;  1AWC A;  2GXG A;  2LF7 A;  4LFU A;  1HST A;  3T8R A;  1U5T A;  3L2C A;  1ON1 A;  1ZRE A;  2EA4 A;  5IT3 A;  4PZJ A;  4Q48 A;  1ZAO A;  3RKX A;  3V8L A;  3WTS C;  5D4R A;  3WTY C;  4KIC A;  2M45 A;  1IN6 A;  3KFW X;  2H94 A;  2JT1 A;  5HLI A;  5L3F A;  2O61 A;  1YO5 C;  4OMY A;  2OAZ A;  2P7V B;  5EEG A;  2PMH A;  4A0X A;  3HRT A;  3U2R A;  3FM5 A;  1V4R A;  2V1X A;  2L02 A;  1S7O A;  2BEO A;  2FSW A;  1FSE A;  3REO A;  4RAY A;  1HSJ A;  4G8X A;  4UVB A;  4XBF A;  2E1C A;  2QBY A;  5ILU A;  1D8K A;  2P4W A;  3F72 A;  4R8H A;  1FP1 D;  5D8K B;  2HQN A;  4RS8 A;  2NAZ A;  1ZHF A;  2M30 A;  4MEY F;  2RC4 A;  2RV8 A;  4I02 A;  2A68 F;  3DP7 A;  4MGR A;  4UVA A;  3DF8 A;  4N9H A;  3BJA A;  4M74 A;  4AWX B;  2Y48 A;  1TTY A;  5DD4 A;  3J7A O;  2IT0 A;  2IA0 A;  1ZG3 A;  3T5X A;  1SD6 A;  1BM9 A;  1V3F A;  2OA4 A;  4L9V A;  2OQG A;  3ZQ7 A;  1MJA A;  1S8N A;  2W84 A;  2MBF A;  5LGN A;  2EFW A;  5D6E A;  2KIM A;  5FD5 A;  2P6S A;  3KP4 A;  4WF2 A;  2OU2 A;  3GLX A;  4L9N A;  1MZB A;  2DLL A;  4IVN A;  5H6R A;  1LDJ A;  3CJN A;  2VBZ A;  2DPD A;  3V7R A;  2L01 A;  4LB5 A;  4EVI A;  3MAJ A;  4I0A A;  1QBJ A;  5ICF A;  2W57 A;  3I5U A;  1T0F A;  3F8M A;  3GUD A;  4MNU A;  1IN4 A;  3IWZ A;  2XAS A;  4PCQ A;  4IF4 A;  1R5G A;  4JK1 X;  2Z3Y A;  1TW2 A;  2QQ9 A;  1DPR A;  3GFL A;  1J59 A;  2JSC A;  3KP2 A;  3HRS A;  2QEN A;  5DDG A;  1LDK B;  2FNP A;  1X3U A;  1IXS B;  3E5X A;  2KJB A;  4PGG A;  2F2E A;  1G3W A;  1Z6R A;  5D8L B;  4MEX F;  5ILV A;  4U7B A;  5ED4 A;  1XSV A;  3LAP A;  3TOA A;  1F5T A;  2IRF G;  1UST A;  2HZT A;  1U5T C;  2C6Y A;  5DCM A;  1R23 A;  4ON0 A;  2JTV A;  2P8T A;  2KKO A;  4IHT A;  2MLG A;  3F3X A;  3BJ6 A;  3H3Z A;  4HDV A;  1MJB A;  2GXB A;  2H6B A;  2KIU A;  5CVR A;  1D5V A;  2XKP A;  5DCF A;  4BAY A;  1YW8 A;  4I2O A;  5FFX A;  4ETS A;  4OIO F;  3B73 A;  3IL2 A;  1B59 A;  3ZP5 A;  4YFN F;  4LLN A;  2EV0 A;  2E7W A;  4EJO A;  3GO5 A;  3Q9S A;  5L3C A;  1ZLK A;  4Q47 A;  1FT9 A;  4E70 A;  1UB9 A;  2A69 F;  2VON A;  1FBQ A;  2W24 A;  2ESN A;  4PDK A;  5IT9 Z;  4WX9 A;  3E5U A;  3LA2 A;  2R7D A;  3IC7 A;  2HQR A;  2XAF A;  4HQE A;  1O57 A;  3ZN0 A;  2B0L A;  2M8E A;  1KQ8 A;  1ZG5 A;  2YSR A;  2FEZ A;  4L5J A;  3NQO A;  2ZNY A;  3RYP A;  1CF7 B;  3ELK A;  2L4M A;  3F22 A;  2OZ6 A;  1MDM A;  1BI0 A;  2VOD A;  2RGV A;  4A2U A;  2L4A A;  4Q5S F;  4ESB A;  1U6G A;  1RUN A;  2VE9 A;  1JHF A;  2GA1 A;  4KUM A;  3MQ0 A;  5JFR A;  1P4W A;  3HHH A;  3I4P A;  1BC8 C;  3VEP A;  4M72 A;  3WOD F;  3V7C A;  1LJ9 A;  4BXU A;  3M9A A;  3C18 A;  5HDN A;  4HOB A;  1WSU A;  1SD4 A;  2F5D A;  2QWW A;  1KQ9 A;  3LA7 A;  4HA8 A;  1QZZ A;  3P9I A;  1UFM A;  4M9S A;  2D1V A;  4G7O F;  3T8T A;  2UXX A;  2RNJ A;  3FXR A;  1SFX A;  1ZGA A;  1P2F A;  5TJJ A;  3K9T A;  3HYI A;  2XRO A;  4IJA A;  2Z99 A;  1ON2 A;  3JTG A;  2F5E A;  3TO9 A;  5F64 A;  4KIG A;  5LRS A;  4N9I A;  1KGS A;  1PP8 F;  4HV6 A;  2ACJ A;  4CZZ A;  1BI1 A;  3E6C C;  5E1Z B;  5HVQ C;  4G9Y A;  3IKT A;  1MD0 A;  1FNN A;  4HAM A;  6PAX A;  1TQI A;  4OU0 A;  3VFZ A;  3RTR A;  3Q9V A;  4XRF A;  1FC3 A;  2Y75 A;  5D4S A;  5CJ9 A;  3KCC A;  3DKW A;  3R0A A;  1XDS A;  3G3Z A;  1MKM A;  2HGC A;  1Q1H A;  4L0Z B;  3D0S A;  2EA2 A;  3OV8 A;  2O6G E;  3JAM Z;  1FSH A;  2O0Y A;  2FBI A;  3HOT A;  4XLP F;  2MC3 A;  3LQQ A;  4LG0 A;  5K5Q A;  2XGX A;  2RKH A;  3I53 A;  5CYV A;  4OIR F;  4EM2 A;  2QUF A;  1TW3 A;  4ZH4 F;  5E18 F;  1BI2 A;  2IPQ X;  2RN7 A;  3J80 Z;  4ZYE A;  1F4K A;  4EV0 A;  3GFJ A;  4JBA A;  4A0Z A;  4BH9 A;  5JHU A;  1YG2 A;  2EV5 A;  1BI3 A;  2ADU A;  4LLL A;  1JGS A;  3ZPL A;  1B9M A;  4MHG A;  4M9Z A;  3AAF A;  5K5R A;  1W5T A;  4KFC A;  3J81 K;  4I7H A;  2F5F A;  2ZFW A;  3BY6 A;  3ISP A;  5D5W B;  2OQR A;  3L9F A;  4A6D A;  2HYF A;  4KYW A;  3S2W A;  4P5O A;  3HSF A;  2BBY A;  3F8F A;  4JQF A;  3E3V A;  1H0M A;  4A5N A;  1KQ0 A;  1LNW A;  4WXC A;  1OYY A;  3T0Y A;  2Z5U A;  3QAH A;  1BJA A;  1F9N A;  2XHK A;  5FO5 A;  4GCV A;  4GXO A;  2CGP A;  4BQA A;  4HYE A;  4G6Q A;  3H92 A;  2FE3 A;  5F1R A;  4BHP A;  1HXD A;  1QGP A;  2K02 A;  1GVJ A;  1O3S A;  5FD6 A;  2Y0M A;  2CG4 A;  3I71 A;  3ZMT A;  5E20 A;  1MGT A;  3JSO A;  1I6X A;  4ZZD A;  3HOS A;  3MZY A;  1OPC A;  2A3S A;  3ZMV A;  2DQR A;  2NNY A;  4ESJ A;  5HDK A;  3O2P E;  2XRN A;  4G7H F;  4FT8 A;  4IPA A;  4YIF A;  3GZ5 A;  2P5K A;  2PEX A;  3TOB A;  3K2Z A;  3RKW A;  4TV7 A;  1R58 A;  1O3T A;  2MD5 A;  3LAJ A;  4GGG A;  1G3T A;  4EJW A;  3Q5F A;  5E1W A;  1LB2 A;  2D1H A;  1IAW A;  4WWC A;  3ROU A;  3TO6 A;  3K1M A;  4UV8 A;  4L9J A;  3KP3 A;  3RJP A;  2LKP A;  5HLG A;  3FWE A;  4I98 B;  5DV5 A;  2K86 A;  3BJO A;  3KEO A;  1YFH A;  3KP6 A;  1IN8 A;  2ZJ2 A;  3CDH A;  4OOI A;  1RI7 A;  2UZK A;  4U0V A;  3DXJ F;  2V1U A;  1UHM A;  2COM A;  3C3W A;  3TDZ C;  1F1Z A;  2OBP A;  2K4B A;  1TLH B;  2DI3 A;  3SFZ A;  3F6V A;  5LHI A;  4CXF A;  2PFB A;  4ZYD A;  2PLY A;  1T6S A;  4HV5 A;  1WWX A;  1T38 A;  3EYI A;  3T1B A;  4CHU A;  1TQP A;  5LGU A;  4P9F A;  5EEH A;  2ZME A;  1LVA A;  4A6E A;  2PJP A;  3MWM A;  3W6K B;  1B9N A;  3GVA A;  1O7L A;  2FML A;  3CTA A;  4RB0 A;  2RQP A;  4MQ9 F;  1R7J A;  2Q2E A;  1BC7 C;  3DPL C;  3N97 A;  4LMY A;  2V9V A;  4KMF A;  5F6F A;  3I59 B;  1J0R A;  3P9K A;  3RPU A;  1J2X A;  1PP7 U;  2FOK A;  3PQK A;  1J9I A;  1JE8 A;  4U0Y A;  4Z2Y A;  4LLG F;  4ZZL A;  1YTY A;  2STT A;  3CLO A;  1KA8 A;  2HKO A;  2ISZ A;  4MTE A;  1W7P D;  1FWZ A;  4EQQ A;  3LWF A;  2EFQ A;  4YFK F;  3ECO A;  5AON A;  4XLN F;  3W6J B;  1I5Z A;  2ZCW A;  2FA5 A;  4L5I A;  4OIN F;  1P4A A;  2FRH A;  3WGH A;  1USS A;  3DPT A;  5H20 A;  4QLC U;  5J8C A;  5A2Q Z;  1R36 A;  4L9T A;  1K78 A;  3WTU C;  1R5H A;  3GW2 A;  1IXC A;  1DPU A;  3RKY A;  3GF2 A;  1BIB A;  1XCB A;  1IW7 F;  3FZV A;  5ICE A;  5BQT A;  2BYV E;  3F8C A;  4YII A;  3CUQ A;  2KRF A;  1R1T A;  3M8F A;  2QVO A;  5BMZ A;  1DDN A;  2QYO A;  4BYY A;  3FMQ A;  4S04 A;  1W7P B;  2VOO A;  3HUG A;  2DW4 A;  3HHG A;  5LRR A;  1EH7 A;  4AIJ A;  3VOE A;  1JXS A;  4ZYG A;  1IRF A;  1G4D A;  5ERI A;  1KU9 A;  3E6D A;  3GFI A;  1U8R A;  1P92 A;  1J7K A;  3DEU A;  5IT9 K;  3I54 A;  3D5L A;  2V79 A;  5BPD A;  1G6N A;  2FU4 A;  3I58 A;  4OMZ A;  3EDP A;  1H9T A;  2DK8 A;  1XMK A;  1ONV A;  2M87 A;  1XN7 A;  1I1G A;  1U5T B;  3TQN A;  5BOX A;  2FNA A;  3R0J A;  4L0Y B;  2ZNZ A;  5E17 F;  5L3G A;  3KLO A;  1EH6 A;  3SHF A;  3B02 A;  1RNL A;  4DNC A;  1HQC A;  3WE3 A;  1PUE E;  5DUK A;  3RYR A;  3O3K A;  3GWZ A;  2YPR A;  5HDG A;  5ILS A;  4UVC A;  4NHJ A;  3KEQ A;  5BPI A;  2VT2 A;  2P7C B;  3WTV C;  2VE8 A;  5BS6 A;  4ZYH A;  4RB3 C;  1SAX A;  5CVJ A;  4EJT A;  2QBY B;  2E7X A;  3ZMD A;  3E5Q A;  1R22 A;  2XIG A;  2VOP A;  5JI6 A;  4D0P A;  2YU3 A;  4HQM A;  5D5V B;  1H9G A;  3FMS A;  1S7A A;  5LGT A;  5KK1 A;  1Z1D A;  3F8B A;  5J8F A;  4RGX A;  3I64 A;  4HX7 A;  3TKY A;  1OYI A;  1L0O C;  1YQA A;  2HR3 A;  5D5X B;  1Z9C A;  5L3E A;  1ZH5 A;  1XGO A;  2W25 A;  3FMR A;  3M8E A;  2HFH A;  1ZRF A;  2LNB A;  4IRH A;  1WI9 A;  2IP2 A;  1STZ A;  3L7W A;  1UCR A;  2A5Y B;  1L3L A;  1LQ1 A;  2STW A;  5D6F A;  3BPX A;  1P6R A;  1LEB A;  2VC0 A;  2D2W A;  3F6O A;  4QWQ A;  2IW5 A;  1G3S A;  4KN7 X;  4KA4 A;  4KDP A;  3N4M A;  4YG2 F;  1HW5 A;  4NQW A;  4ENK A;  1YW9 A;  3CO6 C;  2TDX A;  2MH9 A;  3WTT C;  4UUV A;  1KYW A;  3ML6 A;  5FFZ A;  1QQI A;  4WK8 F;  1FP2 A;  2ELH A;  2GA2 A;  3JAM K;  4UNO A;  4A0Y A;  5HS9 A;  4RGU A;  4P55 A;  3QPH A;  5K1Y A;  3LFK A;  3CUQ C;  2O3F A;  1QNT A;  2HOE A;  3HTS B;  4A5M A;  2OZU A;  2XAQ A;  4M73 A;  4UXN A;  3RI4 A;  5JVT A;  4N0B A;  3WU1 B;  2X4H A;  1SMT A;  3P9C A;  2DO7 A;  3LQR A;  3DFG A;  4ASN A;  3J80 K;  3MFK A;  4LK1 F;  4XSZ F;  3WGI A;  3GEZ A;  2XAG A;  4Y17 A;  2G7U A;  4M6Y A;  4RB1 A;  1T98 A;  3IRR A;  2EK5 A;  2V1D A;  4HLY A;  3U1D A;  2XAJ A;  3OOP A;  1AOY A;  2BV6 A;  2R7F A;  1UHW A;  1SD5 A;  1OMI A;  1FYM A;  1U78 A;  3ULQ B;  4GYI A;  4HF0 A;  4XSX F;  5DCM B;  1REP C;  2CWE A;  3KP5 A;  2FMY A;  2LSO A;  3QP5 A;  4RB2 C;  2LDU A;  3L00 A;  1EV7 A;  1S29 A;  2J5O A;  1K7A A;  4I0B A;  3V4G A;  1SFU A;  2F5C A;  3NEU A;  5CVU A;  4HLX A;  3PFI A;  3M1E A;  1QPM A;  2LF8 A;  2CQK A;  3IWF A;  3O6B B;  3TGN A;  2K4J A;  4M9X A;  4B09 A;  5FLX Z;  4ENN A;  4FX4 A;  2V6C A;  5L3D A;  1OYW A;  5DYM A;  4EGY A;  2DAO A;  4G6D A;  2X0L A;  4FHT A;  4O6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...