4FX4A

Crystal structure of m. tuberculosis transcriptional regulator mosr (rv1049) in compex with dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
128
Chain Sequence
ECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSEGSDLTMSELAARIGVERTTLTRNLEVMRRDGLVRVMAGCKRIELTAKGRAALQKAVPLWRGVQAEVTAWPRVRRDIANLGQAAEAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords DNA (5'-D(*TP*AP*CP*AP*GP*AP*TP*TP*CP*GP*TP*GP*TP*AP*GP*CP*T
publication title The Oxidation-sensing Regulator (MosR) Is a New Redox-dependent Transcription Factor in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 40
structure length 128
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4fx4A00
3I59A 4M73A 1KU2A 1U6GA 2BE5F 4L5IA 2XUBA 1A04A 3CO7C 5K5QA 4CDGA 4RAZA 3I59B 3TOBA 5D6EA 1Y0UA 4ON0A 4EM0B 3IL2A 3FXQA 4WXCA 1XDUA 5D5XB 3P7NA 2IA0A 2V1DA 2XKPA 2D2WA 3KP7A 4GO1A 2QENA 1BN5A 3EDPA 4RGRA 3U1DA 1FP2A 1OYIA 2A5YB 1L3LA 3DEUA 5K5OA 1DDNA 3E5XA 1EH7A 5DUKA 3EYYA 1TQMA 2H6BA 5L3DA 4EJVA 3HRSA 3RI4A 5FO5A 2CSOA 3OOPA 5L3EA 3ZMTA 2COMA 5CVRA 4BYYA 3ZMZA 1PP7U 3KCCA 3I5UA 1B1BA 1XCVA 4S04A 3DKWA 4GCVA 5E8GA 4GXOA 4U0WA 3TO7A 2PG4A 1R22A 1QPMA 2AS5F 4TV7A 4LJZF 5FD5A 1X3UA 4HF0A 3KP4A 2QYOA 3TKYA 2K86A 5AIPA 3TDUC 3E6MA 4MGRA 5D8LB 1RI7A 3ZN1A 3ABUA 2FSWA 1S3JA 2V1XA 5ERIA 4YIIA 3HRUA 4YIFA 3BPVA 4CYDA 2OBPA 2HQNA 3MEXA 4RB0A 4JK1X 4RGSA 1JE8A 5DUIA 1R1TA 1T38A 3HRTA 3K9TA 1ZH5A 1MJ9A 3FHZA 2WTEA 5E1ZB 4HDVA 3ERED 3KLOA 3I54A 5JI6A 3KFWX 1KU9A 1LEBA 3WTUC 2KIFA 4D0PA 3V8KA 1KQ8A 4HQMA 1E17A 2Z99A 1IF1A 2Z5UA 3WGIA 2IJLA 1T98A 3SZPA 2MLKA 4YG2F 1FOKA 2J5OA 2XGXA 4EQQA 1SFEA 1W4MA 5H6QA 1CF7B 4AIHA 4OIQF 1OMIA 1FP1D 2FU4A 1KGSA 4OINF 2P5VA 2XAFA 2MC3A 1XSVA 4ENJA 1GXPA 5FLXZ 1BI0A 1QNTA 3BZ6A 4KA4A 4HLYA 2ELHA 3FF5A 2HS5A 4QWQA 3WTXC 3PFIA 4QLCU 2QUFA 1Q1HA 5FD6A 3T1BA 3SFZA 2F2EA 5JR3A 1OKRA 4IPAA 1O3TA 3IKVA 4KN7X 1MJAA 2OAZA 2W24A 4KDPA 3J7AO 1O7LA 4RAYA 1SD4A 1KQ0A 2KIMA 3BDDA 1REPC 3D5LA 3LFKA 1JXSA 3E5UA 2HQRA 2RDPA 2XHKA 3BY6A 1W7PD 4A6DA 3KP5A 5HS9A 2KJBA 4I02A 1UHWA 4WXHA 4Z2YA 3CDHA 1P6RA 3C1DA 3K1PA 3HRMA 1BI3A 4NHJA 1IZ1A 3PQJA 1XD7A 3I58A 3WTSC 1Z05A 3RKYA 4PGGA 1Z9CA 2X0LA 4UNOA 2M1BA 2ADUA 1TW3A 1J5YA 3ELKA 2DPDA 4Y17A 4CGZA 4PDKA 1TLHB 3ROUA 1W7PB 3L9FA 1ON2A 1D8JA 4O3MA 2LNBA 1XB4A 3H3UA 4M6YA 5JHUA 2H27A 1F9NA 3MFKA 4IVNA 4G7HF 3JTGA 2R3SA 1WI9A 2GZWA 2PJPA 1QQIA 2EFNA 2EFQA 1TNSA 2NRAC 4A5MA 2BEOA 4G7OF 4EV0A 1BJAA 1BM9A 1QGPA 4L0YB 4YFNF 2P5LC 1XGMA 4IHSA 1FT9A 3VOEA 2PN6A 5ED4A 5LLQA 4EGZA 1SD5A 3JAMK 4P9FA 5HS8A 4I7HA 3S2WA 3ZMUA 4BXUA 4BAYA 5LGUA 2YX7A 4M71A 1BI2A 3K0LA 3J81K 2E7WA 2V79A 2K7LA 4EGYA 2QLZA 2ZBKA 4GGGA 3REOA 1V4RA 1R7JA 3DV8A 1WSUA 4N9IA 4RGXA 2XASA 3Q9SA 4KN4X 1YTYA 2Y75A 3BJAA 2XVCA 1IRFA 1JHFA 4M6XA 2YR2A 1G3TA 1Z7UA 3E6BA 2STTA 2UXNA 1B9NA 1UFMA 3SZTA 4B09A 2VONA 2RN7A 3FMQA 1J75A 3GF2A 1V3FA 1MDMB 4M72A 4UVCA 2G7UA 2RKHA 3QP6A 2XAJA 4UXNA 3F6OA 2K27A 3BJ6A 2STWA 2ZKZA 5JFRA 2RNJA 1JGSA 2XAQA 1SMTA 1XMKA 4IRIA 5ICEA 3AAFA 2ZNZA 4ETSA 2K02A 3VEPA 2DT5A 3FM3A 2Q8KA 3LA2A 1ZRCA 1T6SA 1L0OC 4AD9A 3QU3A 4NQWA 3RJPA 2GXBA 2A6HF 1LDJA 4LGWA 2PFBA 3V4GA 2ZFWA 1SD7A 2GQQA 5BOXA 1LJ9A 2K4JA 4HBLA 5LGNA 2BGCA 2ZMEA 4XLPF 2LDUA 2Y0MA 2B0LA 2XAGA 3GEZA 5HDGA 2XROA 2M45A 2ZMEB 5L3CA 4RS8A 4ZYHA 3F8MA 3K69A 1YS7A 2EA2A 4Y15A 4IRGA 2OZUA 2NYXA 3MQ0A 3F8NA 3RDIA 2Z9OA 1AOYA 3EYIA 5E20A 1USSA 5BS6A 1UB9A 1EV7A 3QPTA 4DQ2A 3FZVA 3BJOA 3RKWA 2P7VB 4HX8A 2A07F 3GZ6A 1ZG3A 1ZRDA 5LEJA 2VBWA 1XSDA 3E6DA 2DK8A 4HOBA 3RKXA 2ZNYA 3GZ5A 3CUQC 3LQRA 2ZXJA 3HTSB 1K79A 3GFMA 1FLIA 1DPUA 1LNWA 2YPRA 1ZGAA 4KICA 2KIUA 5H20A 5J8CA 4R8HA 5L3BA 4XBFA 2CO5A 2HGCA 3IHUA 1ZARA 3E97A 2W84A 3N4MA 3LAPA 3HSFA 5LRSA 2CWEA 2W85A 2IA2A 1F5TA 3M8FA 1QO0D 4BNCA 4LK0F 5ILVA 1FBQA 3HOTA 4EJWA 1U5TC 4KMUX 1PP8F 2QBYA 1TQIA 1TTYA 2FBKA 4L5JA 2QWWA 3ZPLA 1QBJA 2BYVE 2C6YA 1B6AA 4BHCA 3E6CC 2IRFG 1O3RA 4OOIA 3V8LA 1TNTA 1FSEA 5ICFA 2H6CA 5LGTA 1U3EM 3EUHA 3LQQA 3L09A 4YFKF 5TRDA 1GHCA 2YU3A 2A6EF 3DP7A 2O3FA 2H09A 5A2QK 4EM2A 3P9CA 5CVUA 3HYIA 3ZMDA 2GWRA 2QZ8A 3ML6A 3WTWC 5EEGA 5D8KB 3ZN0A 3Q9VA 3TDZC 5HOOA 3BROA 1FYLA 1LDDA 2A61A 1R1UA 1LB2A 2H94A 3F72A 1S8NA 3N97A 4UV9A 3GX4X 4Y13A 5E1XA 4AVPA 3KEQA 3LWFA 2BBYA 4A0ZA 3IKTA 1FX7A 2L54A 1LVAA 3M7GA 3SXYA 3WTVC 5HVQC 2ISYA 1HQCA 1IAWA 2FE3A 1B9MA 4Q47A 3K1NA 2JTVA 4UVAA 2ISZA 1IN8A 1I6XA 3PQKA 2V1UA 2QVOA 2O8XA 3B02A 4O5VA 1E2XA 1KQ9A 2VC0A 4ESJA 3R0JA 3T5XA 5K5RA 1IW7F 4MEXF 5D5VB 4I98B 2UZKA 4L9NA 2HZTA 3D0SA 1DPRA 3QAHA 2M8EA 3HIFA 4LB5A 4M9SA 3DF8A 2FXAA 1T39A 3ABTA 1F1ZA 3CUOA 4E70A 2Q0OA 2W25A 2VBYA 1YQAA 2FNPA 3V7SA 1OPCA 3P9KA 4U7DA 1IUYA 4CO8A 3VFZA 2CFXA 2EV0A 4HAMA 2VE9A 1C0WA 1TW2A 2MLGA 2O61A 3DPLC 1GVJA 1LQ1A 4MHGA 2HWVA 4LLLA 3IRQA 1XGOA 3V7CA 1J59A 2YX4A 2JPBA 3K2ZA 4OIPF 2EJRA 6PAXA 4ZYDA 2OD5A 3WE3A 1RIOH 1OR7A 3W6JB 2FMYA 4M9XA 1MKMA 4R1HA 2P7CB 2EFOA 1BI1A 1G6NA 2O0YA 5BPDA 1SFXA 2VC1A 2RGVA 1D8KA 1S7OA 2HYFA 2P6SA 1J2XA 1IXRC 1IN7A 3HUGA 2F5EA 5IT9K 3DXJF 4XSXF 3FXUA 1ZAOA 3WE2A 2J5PA 2JSCA 1FYKA 4R79A 2IP2A 3J80K 4U88A 2PI0A 3GXOA 3SQNA 4KFCA 4RB2C 2Z3YA 5ILUA 3KETA 2FMLA 1J0RA 2IW5A 2WWYA 4YFXF 1D5VA 4AWXB 1CGPA 5D5WB 2EFWA 1ZRFA 4ZYGA 1ZG1A 4HA8A 1B59A 4PGHA 3F8BA 3U2RA 1HW1A 4M74A 3QPHA 1YS6A 3MZHA 2OU2A 3IRRA 3GW2A 3KLNA 4P9UA 2QQAA 3FX3A 5J6XA 1HKSA 1QZZA 4UHTA 4I01A 1BBYA 5LRRA 3E5QA 4ZZDA 3BPXA 3H92A 3ZMVA 1G3SA 4HDUA 2Y48A 5E8IA 3VB2A 4ESBA 1JHHA 1FWZA 3EETA 1O3QA 4HF1A 2ZJ2A 4HV6A 1YYVA 4A5NA 4JBAA 3M9AA 4GYIA 3R61A 2F5FA 2RQPA 1R5GA 3BWGA 2E1CA 2L3DA 5DCMA 1PDNC 5LHIA 4G9YA 3F8FA 2LF7A 4MNUA 4ZZLA 3MCZA 1G3YA 3BP8A 3JW4A 1IRGA 4KYWA 3I0TA 2EWNA 3GWZA 5LBQA 5CLSA 5D4RA 4F7ZA 3O2PE 2ETHA 4LD5A 3E3VA 4LG0A 1WKMA 4G94A 3COAC 2UXXA 1H0MA 5DDGA 4MTDA 1U2WA 2R7DA 3HHHA 4KIBA 4HYEA 1P92A 3WTZA 1MGTA 3U9GA 3RYRA 5AIQA 2GAUA 4PCQA 3WU1B 1VTNC 1Z6RA 2CQKA 1OYWA 3JSOA 2L4MA 3RPUA 3JTHA 5HDNA 1HXDA 3HHGA 5CVJA 2VBZA 1UCRA 1IXCA 1FC3A 3R60A 3NQOA 4Q48A 4WK8F 3M8EA 1RZ4A 5JVTA 4FX4A 4UVBA 4Q4ZF 2MD5A 5CVIA 4A0YA 2HTJA 2F5CA 2VT3A 4UUVA 2VBXA 1YW7A 3FMRA 1S7AA 3BOQA 1RNLA 1EH8A 4BHBA 3TO6A 1MD0A 4CICA 4LMYA 2VN2A 2FEZA 1U5TA 5CJ9A 1NHAA 1KU7A 3ECHA 3JAMZ 3GFJA 2BV6A 3EQLF 1ULYA 3KP3A 5F6FA 2AXLA 4WF2A 4RB1A 2VOPA 2OQRA 3LA3A 4RB3C 2WC2A 3KP2A 2IT0A 1SFUA 3J81Z 2Q2EA 1W5TA 5LHGA 5F1RA 1R5HA 2O6GE 1R23A 2PMHA 5DYMA 1DUXC 2PLYA 3ECOA 3TOAA 1H9TA 4I2OA 2DTRA 3T0YA 4A12A 5AONA 2DK5A 3WG9A 4HF2A 4BH9A 3CLOA 3R6SA 3K1MA 2DQRA 2ZO4A 1K78A 1WRJA 3L7WA 4U7BA 2JRTA 1S6LA 3M1EA 1J9IA 4HV5A 5LEKA 1H9GA 4XSZF 5HLIA 2VT2A 3MAJA 4IRHA 4HLXA 3L00A 1T0FA 2D1HA 3IWZA 1O3SA 4KMFA 3RIRA 1RUNA 3V7RA 3R0AA 1TQPA 1P4XA 3F3XA 3QP5A 1I1GA 2QM3A 5BPIA 2OA4A 2GA2A 1XN7A 5EEHA 1P4AA 2E1NA 2FRHA 3WGGA 2TDXA 3H3ZA 5DEQA 2QBYB 3GFIA 4BHPA 2HOEA 4G7ZF 1ON1A 2VXZA 1HBXG 2CW0F 1ONVA 4L18B 1F4KA 1ZLKA 2DAOA 3WU0A 4LB6B 4EM1A 2L02A 3HSRA 2PBIA 4A6EA 3WTYC 4G6DA 1XGNA 1USTA 1K6OA 3R4KA 3QOPA 5K1YA 1Z91A 3RPQA 2UWMA 3T8TA 1AWCA 5FLXK 2DO7A 4KT5C 1IXSB 2JPCA 2ACJA 4EJOA 5LHHA 1S29A 2CYYA 3F21A 3O3KA 5FFZA 4ESFA 2NAZA 2QQ9A 3P9IA 5BQTA 2LKPA 5DD4A 4WWCA 3JSPA 5H6RA 3QU6A 1YIOA 3ISPA 4I0AA 3B73A 4L9VA 2EK5A 1BOAA 3W6KB 3LA7A 4MQVA 3F6VA 3G73A 5DV5A 2R7FA 5TJJA 2OQGA 3ZQ7A 1ZYRF 2A3SA 1P2FA 1HKTA 2IA1A 1YFHA 5J8FA 1HSJA 4H0EA 4K2EA 1BIBA 4L9TA 1W5SA 2CGPA 4RGUA 4ZYEA 1FYMA 1XCBA 3HTUA 1G3WA 1SMYF 3T8RA 3CTAA 4ZH4F 4LLGF 1KYWA 5FFXA 3WODF 2ZCWA 1I27A 3F8CA 4HQEA 1O7FA 2DW4A 3KEOA 4MQ9F 3TGNA 1BIAA 2P6TA 2G7HA 2HR3A 1MJBA 2P4WA 2O03A 2LF8A 4HX7A 2FQ3A 1CF7A 5KVRA 1XGSA 2XRNA 2XAHA 4KIGA 1ZN2A 2OZ6A 3DPTA 3GYHX 4OMZA 2FNAA 4N0BA 3WTTC 5A2QZ 2HTSA 3GO5A 1IN5A 4FHTA 2RVCA 3GLXA 2MA3A 5FGMA 5D6FA 2PMUA 3KP6A 5KK1A 1HW2A 3MWMA 5BMZA 2JT1A 2KKOA 1LEAA 4P55A 3F22A 1FBUA 2GXGA 5IT3A 3TQNA 3FM5A 2KRFA 3I71A 3O6BB 2E7XA 2G9WA 3HOSA 2FA5A 4G6QA 5DCFA 2DBBA 1FY7A 1ZG5A 2RV8A 1O57A 1R1VA 4A2UA 3I64A 1FSHA 5CVVA 2F5DA 5HDKA 1ZREA 4LK1F 2DQLA 2ESHA 3C18A 2IVMA 1BC8C 5L3GA 3WGHA 3IC7A 2X4HA 4P5OA 1R36A 2EV5A 1LDKB 4WXDA 2NNNA 1IN6A 4O6JA 3KZZA 3ZMSA 2HKXA 2K4BA 1BC7C 2M5WA 2EB7A 2HDCA 1W7PA 2EA4A 5E17F 3F23A 1HSTA 1KYZA 4OMYA 3FMSA 5FB2A 1PUEE 2DFIA 4KUMA 5ILSA 2EFPA 3Q5FA 2YSRA 1ZLJA 1U78A 2A68F 2XV4S 4BQAA 3RYPA 2M87A 1B4AA 4LLNA 4EVIA 3LAJA 1UHMA 3GVAA 1YO5C 3HSEA 3L2CA 1FZPB 4JQFA 4U0VA 4Q5SF 5DD8A 1YW8A 4L9JA 2HKOA 1XMAA 1HKQA 3NRVA 5DCMB 2W57A 1XDSA 5CYVA 1D3YA 3KZYA 4I0BA 1ZGJA 2A69F 2LSOA 3C3WA 5IT9Z 2P8TA 1DP7P 1R00A 3CO6C 5F64A 1Z6TA 4CZZA 3J80Z 4MEYF 4LG0B 3KE2A 4HZFA 4HX4A 1ZHFA 2V6CA 2HEOA 4P96A 4EMSA 1MDMA 4U0YA 1U8RA 4WCGA 4IXAA 2VODA 2HFHA 1MZBA 4KNYA 4FX0A 3FWEA 1P4WA 4DNCA 1YG2A 4B8XA 1T2KA 2JZYA 4GYGA 1SD6A 4KIFA 4M9ZA 2GIVA 3OV8A 3G3ZA 4MTEA 2NS0A 3CJNA 3CUQA 2L01A 2IPQX 4A0XA 3I53A 3MZYA 5D4SA 3GFLA 4OU0A 3SHFA 4IJAA 3CUQB 5L3FA 4IHTA 1WWXA 2FOKA 1IN4A 2NNYA 1YLFA 1YW9A 2P5KA 3FXRA 4OIOF 3DQVC 1SAXA 5ICCA 2ESNA 2FF4A 4EJUA 4AIJA 2MBFA 1KU3A 2DLLA 2KJCA 1I1SA 1GXQA 1WQ2A 2M30A 3NEUA 2VOOA 3LSTA 4ENNA 4IF4A 1RUOA 1U5TB 3I4PA 4CXFA 2CG4A 3RTRA 1STZA 2D45A 2QQBA 4ENKA 4CHUA 4N9HA 2DI3A 5E18F 4ENMA 2XKOA 3ZP5A 2FBIA 1G4DA 4AIKA 5HS7A 4HW0A 1QZYA 3IWFA 2FBHA 4G8XA 4S05A 5D5UB 2MH2A 3VODA 4EJTA 1K7AA 5E1WA 1FBSA 4L0ZB 2GA1A 1XSXA 4OIRF 1EH6A 1FPQA 1TBXA 4UV8A 1FNNA 2WV0A 4XLNF 1Z1DA 5HLGA 2DPUA 1I5ZA 2PEXA 2HYGD 2RC4A 2XIGA 3C7JA 1R58A 4PZJA 4LFUA 5HLHA 2EV6A 4FT8A 1KA8A 1K78B 2D1VA 1J7KA 2Z33A 2L4AA 2VE8A 1HW5A 3ULQB 3GUDA 2MH9A 4WX9A 5ICGA 2DU9A 3TO9A 3QRFF 4ASNA 3V8JA 2V9VA 4XRFA 1OYYA 4NB5A 4I09A 3DFGA 1ODDA 2PQ8A
chains in the Genus database with same CATH superfamily
3I59A 4BGDA 1LFUP 3CP2A 3K70D 4M73A 1KU2A 1U6GA 2BE5F 3ABKH 4L5IA 2XUBA 1A04A 1ORKA 3CO7C 5K5QA 1CQTA 3FKJA 4CDGA 4RAZA 3OYFA 2LVSA 3I59B 3AG4H 3IH4A 3TOBA 2X1EA 1G2HA 5D6EA 4BBRJ 1Y0UA 3D5SC 1PUFA 4MFDA 2DXIA 4BY1J 4ON0A 1VQNI 4EM0B 1S7EA 3IL2A 3FXQA 4WXCA 1XDUA 5D5XB 2R7ZJ 3P7NA 2LKSA 2IA0A 3A01A 2V1DA 1T33A 4M3FA 4MIMA 2XKPA 4CCKA 2D2WA 3KP7A 4JP0A 4GO1A 2PMZA 2QENA 2EZIA 1WGXA 1BN5A 4BDZA 3EDPA 3RCOA 3KX2A 3D1NI 4RGRA 3U1DA 1FP2A 3ZGKA 2VUMJ 2G0EA 1OYIA 2DFHA 2A5YB 1K4TA 3OWTA 1ETKA 4LOCA 1L3LA 3DEUA 1WH5A 4F91B 5K5OA 2N8GA 1DDNA 5EG0A 3E5XA 1EH7A 5DUKA 4HSRA 1S9HA 2X1DA 3EYYA 3OIPA 1TQMA 2CV2A 1IG7A 3S93A 2H6BA 5L3DA 2M0MA 4EJVA 2NVUB 3HRSA 3RI4A 5FO5A 2CSOA 2ECBA 3OOPA 4AUXA 5L3EA 3ZMTA 2I8DA 3IAM2 2COMA 2CQQA 5CVRA 3PO2J 2VQCA 4BYYA 2E60A 3ZMZA 4BACA 1FOYA 1PP7U 3KCCA 3I5UA 4II2A 3AFHA 4IHXA 2LC2A 1B1BA 1XCVA 1YIJI 4S04A 2M3AA 1FOWA 1HCRA 2JA6J 3DKWA 2KRHA 4GCVA 2DYRH 1EKEA 5E8GA 3GCMA 4GXOA 4U0WA 1T0FC 1P9QC 2PG4A 3TO7A 1R22A 3C2GA 1QPMA 2WB1A 2AS5F 4TV7A 4LJZF 5FD5A 1X3UA 4HF0A 4Y7NJ 4FQGA 3KP4A 2QYOA 1BR1A 5GADJ 1IJWC 3TKYA 4X6AJ 2K86A 3G1LA 5AIPA 3TDUC 3E6MA 3FXJA 4A93J 4MGRA 4AYBN 2PJRB 5D8LB 5B66C 1FMWA 3JRGA 3QQAA 1GVDA 1RI7A 2K3FA 4B1RA 1MW7A 3ZN1A 4M3GA 3ABUA 2FSWA 1RESA 2OV7A 1RR7A 1S3JA 2V1XA 5ERIA 4YIIA 3EPZA 3HRUA 3K4KA 1TWHJ 2ME0A 4YIFA 3RZOJ 3BPVA 4CYDA 2OBPA 5C4JJ 3W3CA 2HQNA 4CUGA 4XR6A 3MEXA 4RB0A 4ZTJA 4JK1X 1LVKA 4RGSA 1DU6A 1JE8A 1ETQA 5GPAA 5DUIA 1R1TA 1T38A 3HRTA 3K9TA 1ZH5A 1MJ9A 3EUHC 1KZHA 3FHZA 1JKRC 1OCOH 2WTEA 5E1ZB 2GXAA 4HDVA 3QPLA 3ERED 3VYTB 3KLOA 5GAEJ 3I54A 5JI6A 2QCOA 1VQ5I 3KFWX 3JRAA 1KU9A 4N4OB 1LEBA 3WHCA 1YOVB 3OYHA 3K70C 3WTUC 2KIFA 3LSMA 2HQ5A 3V8KA 4D0PA 1KQ8A 3H9QA 3OYAA 5EZGA 2W82A 2W4SA 4A3EJ 4HQMA 4QSHA 3MD2A 1KONA 1E17A 3LL7A 4D7MA 2Z99A 4Y3OA 2Z5UA 3WGIA 1IF1A 2XPWA 4ZDLA 2IJLA 5DTDA 5IOYA 1T98A 3SZPA 5B1AH 2QSGX 1Y1WJ 3VWBA 2MLKA 3MKYB 4YG2F 4IHYA 4BJTA 1FOKA 2DA3A 5J1UA 2J5OA 2XGXA 4EQQA 1SFEA 1W4MA 5H6QA 1CF7B 2ELKA 4W97A 4AIHA 4OIQF 1OMIA 2A05A 1FP1D 2FU4A 4HSTA 2M7AA 1KGSA 4OINF 4DZPA 3O8GA 2P5VA 2XAFA 3FIWA 2MC3A 1XSVA 4ENJA 1GXPA 3CCSI 5FLXZ 5EF6A 2Z2SB 1BI0A 1QNTA 3BZ6A 4KA4A 4HLYA 2ELHA 1VFCA 2R7VA 4N4NB 4XLFA 3HOZJ 3LSRA 3FF5A 4D1QA 2HS5A 2F4OB 4QWQA 3WTXC 2QKLB 2ID3A 2XB5A 2MSYA 2UUZA 3PFIA 2QUFA 4QLCU 1Q1HA 3S1MJ 1BW5A 5FD6A 3T1BA 5K7FA 3SFZA 2F2EA 2DA1A 5JR3A 2BW3A 1MNMC 1OKRA 5BNGA 4IPAA 1UJ8A 1O3TA 2CUEA 3S3OA 3IKVA 4KN7X 3HJEA 3UKGA 1MJAA 2OAZA 2W24A 4KDPA 3H1CA 3J7AO 1O7LA 1G8XA 4KITB 4IO9F 3ZQLA 4RAYA 1SD4A 1KQ0A 2JA7J 2KIMA 1YRNA 3BDDA 1WJAA 2KL4A 1REPC 3D5LA 2F5VA 3NWTA 3LFKA 2IGOA 1JXSA 1SANA 3E5UA 2HQRA 2QGUA 1LFBA 1OLTA 2Z1DA 2RDPA 2XHKA 3BY6A 1W7PD 2CH0A 2FQ4A 2EIKH 3M4OJ 1HDDC 3DTKA 1ZTRA 4A6DA 2X85A 3CMMA 3KP5A 4G12A 5HS9A 2KJBA 1JKOC 2QSHX 4I02A 1UHWA 3TW7A 1Y56A 4WXHA 4Z2YA 2E1MC 3CDHA 1P6RA 2L7KA 3CMEI 3LOCA 3C1DA 4FE7A 1WPKA 3K1PA 4DZJA 3HRMA 1BI3A 2KDOA 4NHJA 1MNEA 1ZKGA 5J4YA 4YRVA 2W1OA 1IZ1A 3PQJA 1WJCA 3QWLA 4PJNA 1XD7A 3I58A 3WTSC 2E35A 2WA0A 1Z05A 2DDBA 2R7XA 2JA8J 3FBIB 5CQEA 1DGRM 4PGGA 3RKYA 3AG3H 4YEJA 1Z9CA 2LH9A 2X0LA 4UNOA 2M1BA 2ADUA 1TW3A 3QYBA 2JUGA 1BJZA 1J5YA 3ELKA 2DPDA 4Y17A 2Z16A 4CGZA 2E71A 4PDKA 1TLHB 3ROUA 1V5GA 2B7EA 3BR2A 1W7PB 1MBJA 3L9FA 1QVTA 1ON2A 1D8JA 4O3MA 3BLYA 2LNBA 1XB4A 3H3UA 4M6YA 4RMNA 5JHUA 2H27A 3S8PA 3S1QJ 3DLLF 1F9NA 3MFKA 4IVNA 4G7HF 3JTGA 2JJ7A 2WAFA 2R3SA 1WI9A 2GZWA 5LD2C 3ZQGA 2JA2A 2PJPA 1N78A 3KIOA 1QQIA 3KZIC 2R4GA 2EFNA 4E7LA 2EFQA 1TNSA 2NRAC 3K10A 4I76A 4A5MA 1OR7C 2VQGA 2BEOA 3PUFA 3DWLE 3Q0UA 5TISC 2IS4A 5IPAA 4G7OF 1QVUA 4EV0A 1BJAA 1BM9A 3JRCA 2ZJQF 1QGPA 4L0YB 4C3IJ 4YFNF 2P5LC 1XGMA 4IHSA 2X6WA 2QEXI 1FT9A 3VOEA 3TW6A 2PN6A 5ED4A 1VQ4I 2XSJC 5LLQA 4EGZA 1SD5A 3IH3A 3B6CA 4DGWB 3W2AA 2KQRA 3JAMK 1ZR4A 4P9FA 5DS9A 1FIPA 2OC6A 1U8BA 1VQ8I 2HVQA 5HS8A 4I7HA 1D0YA 2TCTA 3BG6A 3S2WA 4Y52J 3ZMUA 4BXUA 4BAYA 5LGUA 2YX7A 2PX9A 4M71A 3GMEA 1BI2A 2ECCA 3K0LA 3P5JA 1XMXA 1I3QJ 3J81K 2E7WA 2V79A 2QA4I 2K7LA 4EGYA 5HNFA 2QLZA 2ZBKA 3MMYB 2NS8A 2DA2A 4GGGA 4PJMA 3KYDB 4BE2A 3REOA 2NXNB 3OS1A 5E3NA 1V4RA 3VSKA 1R7JA 3DV8A 1WSUA 4N9IA 4RGXA 1I50J 2XASA 3Q9SA 3V42A 4KN4X 1YTYA 2Y75A 3W2VA 4V19K 4BEHB 3BJAA 2WV1A 2VIXA 2XVCA 4II3A 1IRFA 3WHBA 1JHFA 4M6XA 2YR2A 1G3TA 1Z7UA 3E6BA 3IP4B 2STTA 2UXNA 1B9NA 1UFMA 3H35A 3ZQIA 2O9LA 3SZTA 1T56A 4B09A 3S16J 2VONA 2RN7A 3DCFA 2WAEA 3FMQA 1J75A 3GF2A 1V3FA 4XLEA 1MDMB 3PUBA 4M72A 2EINH 1UAAA 2BVMA 1A5JA 4UVCA 2G7UA 1LPQA 2D5VA 2RKHA 3QP6A 2BZTA 2XAJA 4UXNA 3F6OA 4BDYA 5M3FJ 3SZGA 2K27A 3BJ6A 2STWA 3CC4I 3LSKA 1E0EA 3DEEA 2ZKZA 5JFRA 3K4LA 4IOCF 2R7WA 2RNJA 1JGSA 2XAQA 1SMTA 1XMKA 1F43A 2R7UA 4IRIA 4JX4A 1ITYA 1WZ2A 2K9NA 4DYQA 5ICEA 3AAFA 2ZNZA 2Y69H 4ETSA 3FKIJ 2K02A 3VEPA 3S17J 2E2JJ 1M1EB 2DT5A 2HPIA 3FM3A 3GTPJ 2Q8KA 3HEFA 3LA2A 1ZRCA 1T6SA 2OUMA 3PO3J 2WADA 2V9KA 1L0OC 3BG5A 4J01A 4AD9A 3QU3A 4NQWA 3RJPA 2ZSHB 2GXBA 3S1NJ 5EJCA 1JTXA 2A6HF 2AO9A 2KRCA 2ZJRF 2ZXWH 1LDJA 4FE4A 4LGWA 4W1UA 2PFBA 3HGGA 2AQEA 3V4GA 5IP6A 2ZFWA 1R49A 3OYGA 1SD7A 2GQQA 5BOXA 1LJ9A 1IO2A 1JI8A 4CH7A 2K4JA 4HBLA 3RQIA 4UUSA 3HC7A 5LGNA 1LUJB 2BGCA 2ZMEA 3OIOA 4XLPF 2LOOA 1ZQ3P 2CV1A 2LDUA 2QQ8A 2RNGA 3CCVI 3DBRB 2Y0MA 3PIPF 3DBHB 2B0LA 2LP0A 2XAGA 3A2KA 3GEZA 3HGYA 1OFCX 5HDGA 2Y0SN 2M45A 2ZMEB 4B3AA 1UELB 5L3CA 4RS8A 2XROA 1QPIA 4ZYHA 4DW6A 1QHHD 1ZR2A 2E34A 3HXLA 3SDGA 3F8MA 3K69A 1YS7A 5HNHA 2EA2A 2KP6A 2Y30A 4Y15A 4IRGA 4LG3A 2OZUA 2NYXA 3BR6A 3CJQB 3MQ0A 2WY7Q 3F8NA 3RDIA 1UMQA 1IRXA 2Z9OA 1AOYA 2DJIA 4E7HA 3EYIA 5E20A 1USSA 5BS6A 4IQJA 1UB9A 1EV7A 3QPTA 3S32A 5C4XJ 5EEAA 3G1MA 4DQ2A 3H36A 3GZNB 1TT5B 3FZVA 4XOTA 2L9VA 3BJOA 2A5WA 3RKWA 2P7VB 4ZDOA 4HX8A 2A07F 3GZ6A 3M1CA 3ZXSA 5FKMA 1ZG3A 1ZRDA 1MMAA 1MMNA 5LEJA 2VBWA 4FISA 3S1RJ 2DJNA 3VYUB 1XSDA 4X0GA 2V7FA 3H3VK 3E6DA 4UB8C 3FXKA 2DK8A 1BA5A 2LD5A 4HOBA 3JR9A 2P0WA 3RKXA 2PMZN 1NH3A 2ZNYA 3CDIA 4NUBA 2XC7A 1PVEA 3HB9A 2JWTA 3GZ5A 1VI0A 3CUQC 2GBYA 1QRYA 1EA3A 4NC8A 3LQRA 2ZXJA 4B47A 3HTSB 1JTYA 3ABMH 1K79A 2H1LA 4E7SA 3GFMA 1FLIA 1IRZA 1DPUA 2DOFA 2X9DA 1LNWA 2CUZA 2YPRA 1ZGAA 4KICA 2KIUA 3UR3C 5TGTA 5F27A 5H20A 5J8CA 5F1JA 4R8HA 5JLWA 4EATA 5L3BA 4XBFA 2M34A 2CO5A 1YJWI 2HGCA 4DYRA 3IHUA 1ZARA 3E97A 2W84A 4D9JA 4ZJZA 4YELA 3N4MA 3LAPA 2EILH 3HSFA 3BG3A 4MFEA 5LRSA 2CWEA 2W85A 1K83J 1S72I 2IA2A 1F5TA 3M8FA 2IBDA 3CJTB 1QO0D 4BNCA 2LYCA 3S3MA 1IDZA 4LK0F 5ILVA 1T08B 3KYCB 1FBQA 3HOTA 3JRIA 1AU7A 4EJWA 5F0CA 2LTPA 2KPMA 1U5TC 3BTIA 2E5ZA 4KMUX 1OCRH 3ESWB 4JOMA 1PP8F 1N77A 2MGQA 2QBYA 1N75A 1TQIA 4IHWA 1TTYA 5EYRA 2HQAA 2FBKA 2WB1N 3ZQFA 3L2QA 2F4MB 1MSEC 4L5JA 2QWWA 3ZPLA 1QBJA 2BYVE 2ZFUA 2CJJA 2C6YA 1E3OC 1YJNI 3K4CA 1B6AA 4BHCA 3OL4A 4D5CA 3E6CC 4RDUA 2IRFG 1O3RA 1PUFB 4OOIA 1R5ID 3V8LA 1TNTA 1X3ZB 1FSEA 2RREA 5ICFA 2H6CA 5LGTA 1U3EM 3CESA 3EUHA 3A01B 2XF7A 3LQQA 2ZB9A 3L09A 4YFKF 5TRDA 1GHCA 2VL8A 2YU3A 2A6EF 2BXZA 3DP7A 3H5AA 3CLQA 2DMNA 1JUMA 3L2WA 2IGKA 3GBGA 2O3FA 1WCMJ 2V9PA 2BY0A 2H09A 2MW8A 5IOZA 5A2QK 1YX5A 4EM2A 3K4MA 4CA0A 1YE9A 3P9CA 1MH3A 3PNVA 5CVUA 3HYIA 2BY3A 3ZMDA 1UG0A 2GWRA 2QZ8A 5GP9A 5EG0B 3ML6A 5F0FA 2L9SA 3JRHA 3OYMA 1VQOI 3WTWC 5EEGA 5D8KB 3ZN0A 2OCCH 2VI6A 4BQQA 5FRNA 1RPWA 5J1YA 1YI2I 4NC6A 2KDZA 3Q9VA 3TDZC 5HOOA 3BROA 3LMMA 1FYLA 1LDDA 2A61A 1R1UA 4XKVA 1LB2A 2H94A 3F72A 1D1BA 1S8NA 3N97A 4AM3A 2XGEA 1OCPA 4UV9A 3GX4X 3NAUA 4Y13A 5DM6F 5E1XA 4A3MJ 3FXMA 5IYBJ 4AVPA 3KEQA 1VQ7I 2K40A 3LWFA 2BBYA 4A0ZA 3IKTA 2JRMA 2XF6A 1FX7A 1R4MB 2L54A 2XAUA 3ZQHA 3PIOF 3JRDA 2LLKA 1LVAA 3M7GA 2JN6A 3SXYA 3WTVC 5HVQC 1BW6A 2E2HJ 2ISYA 1HQCA 1IAWA 5K7HA 1X19A 3DBLB 2FE3A 1B9MA 4Q47A 3DKYA 3K1NA 2L0KA 3WG7H 3OY9A 2JTVA 4UVAA 4F3QA 3OYNA 2ISZA 1IN8A 1I6XA 1JT0A 3OIQA 2Y9YA 3PQKA 1FOXA 3E0JB 1WH7A 2V1UA 2QVOA 1HF0A 2O8XA 3B02A 3OR1C 4O5VA 3U21A 1E2XA 1KQ9A 2VC0A 4ESJA 3R0JA 3G4SI 1FIAA 3T5XA 3VYSB 5K5RA 1IW7F 1PJRA 1SVLA 3G2BA 3LFUA 4MEXF 1GUUA 5D5VB 4I98B 2UZKA 1GV5A 1MMGA 4L9NA 2VQLA 1JKPC 3ZQCA 3PNTA 3HOUJ 4PFOA 2HZTA 3D0SA 1DPRA 3DEWA 3QAHA 4LITA 3RZDJ 1XS9A 1VQ9I 3BR0A 2JQ7A 5FLVA 2M8EA 3HIFA 3ZOBA 4LB5A 4M9SA 4GDFA 2M7BA 3DF8A 4RM2A 2FXAA 1T39A 3ABTA 3DKXA 4A3BJ 4BL0B 3MKZA 1F1ZA 1WJFA 3IAS2 2FJ1A 3CUOA 4E70A 3M07A 2Q0OA 2W25A 2HI3A 4ZC3A 1YJ9I 2VBYA 1YQAA 3JRFA 3QODA 2KIQA 2FNPA 3V7SA 4A3GJ 1OPCA 3P9KA 4NBQA 2AXTC 4OAYA 3IH2A 4U7DA 2QSFX 2LY9A 1IUYA 4CO8A 4KISA 4RLQA 4UY8I 3VFZA 2CFXA 3PSFA 2EV0A 4HAMA 5JVGF 4M3EA 2VE9A 1C0WA 1YX3A 1W36D 2KHMA 2NVQJ 1TW2A 2Y2ZA 2MLGA 1W0UA 4HEA2 2Y31A 3I55I 2WAQA 2O61A 4LIUA 3DPLC 1GVJA 1LQ1A 4MHGA 2AQFA 2HWVA 4LLLA 3IRQA 2K9MA 1XGOA 3V7CA 4CCMA 1FEXA 2FD5A 2DOAA 2HDWA 2KMUA 1J59A 2YX4A 2JPBA 3K2ZA 4OIPF 2EJRA 6PAXA 3E1SA 4ZYDA 2OD5A 3WE3A 4F93B 1RIOH 3E7LA 1OR7A 3W6JB 2R7OA 5KAIC 5E79C 2FMYA 4M9XA 1MKMA 4RAGA 4R1HA 2EBIA 4E7ZA 2P7CB 1BI1A 2EFOA 3A02A 1SC7A 2H8WA 1Q1VA 1G6NA 2O0YA 5BPDA 1SFXA 2VC1A 2RGVA 4RA2A 4DYCA 1D8KA 1S7OA 3OYDA 5M5WJ 2HPMA 2R5YA 2HYFA 3K2AA 1WVRA 3CP8A 3GLLA 4BQNA 1YHQI 2P6SA 5C3EJ 2K9QA 4CYCA 2BW3B 1QU3A 1AHDP 4IL6C 4XOPA 1J2XA 1IXRC 1IN7A 1ZGWA 4IOAF 3HUGA 1GV2A 2F5EA 5IT9K 3DXJF 1R9TJ 4XSXF 1B72A 2W48A 3FXUA 2F48A 3C2HA 4DBQA 1T8IA 1ZAOA 4C3HJ 4PJ0C 1A31A 3CMYA 3WE2A 4CYCB 2J5PA 1YRNB 2JSCA 1LE8A 4XLAA 1OISA 1FYKA 3K4BA 4R79A 1O4XA 2IP2A 3J80K 4U88A 1ZELA 2PI0A 1N25A 3GXOA 1B72B 1X2MA 1XC5A 2CW8A 3H9GA 4XLHA 3SQNA 1TC3C 4KFCA 5K7ZA 4XN0A 4AU7A 1DGWY 2XGDA 4RB2C 1NG6A 2Z3YA 5ILUA 3KETA 4HNVA 4AC0A 2LMDA 2FMLA 4RAFA 3SEQA 4FCYA 1J0RA 4JYKA 2VPRA 2IW5A 2WWYA 4YFXF 3J7YJ 4BXXJ 1D5VA 4JX6A 3TP0A 1W1WE 2X51A 4HNUA 2BXYA 4AWXB 3WU2C 4HNTA 5D5WB 1CGPA 1VNDA 3CZ6A 2X1CA 2EFWA 4E7IA 4XONA 1ZRFA 5J47A 4ZYGA 1JGGA 2MABA 2XRLA 1ZG1A 4HA8A 1G59A 3GTLJ 1B59A 2BOLA 2L9RA 4QIWN 4PGHA 3F8BA 4BY7J 3PNYA 1HW1A 3U2RA 1SFOJ 3S15J 4M74A 2CU7A 4IHVA 4DJAA 3QPHA 3Q0VA 1YS6A 3MZHA 2OU2A 2A6TA 2NVYJ 2M0CA 3J7ZI 3IRRA 3GTJJ 3GW2A 3KLNA 2AHQA 4G6TB 4P9UA 4IKFA 2QQAA 1QA6A 2VKVA 4DIQA 1VQMI 3FX3A 1Y8RB 5J6XA 3QPSA 1HKSA 1QZZA 2W7NA 4UHTA 4QTRA 4I01A 2R7RA 2IXSA 3OYIA 1X4PA 1BBYA 1U9NA 2JK3A 4M3BA 5LRRA 4MO7A 3E5QA 4ZZDA 3HOXJ 4CSWA 2LBFA 3FHNA 4BUPA 3BPXA 3H92A 3ZMVA 1G3SA 4HDUA 2Y48A 5E8IA 1MH4A 2LRDA 3VB2A 4ESBA 1JHHA 1FWZA 3AG1H 3EETA 1O3QA 4HF1A 2ZJ2A 4I6ZA 1FTTA 4HV6A 1YYVA 2JVGA 4A5NA 2LBFB 4JBAA 3JRBA 3M9AA 4GYIA 2BY1A 1V5EA 3ERMA 4J19A 3R61A 2F5FA 3CCMI 3HPGA 1X1AA 2RQPA 1R5GA 3BWGA 2E1CA 2L3DA 5DCMA 1PDNC 1UHSA 5LHIA 2NVTJ 4G9YA 2R5ZA 3F8FA 5C44J 2LF7A 4MNUA 4ZZLA 3MCZA 3BG9A 1U9OA 1R6RA 2M4KA 4EEFG 1IV6A 1G3YA 3BP8A 1Z21A 2ZXHA 3JW4A 4V2FA 1IRGA 4KYWA 1MMSA 3I0TA 3I3LA 3DTIA 2EWNA 3GWZA 2R5ZB 5LBQA 4BE0A 1YITI 2LFBA 1Y0NA 2VJJA 3BR3A 5CLSA 4F7ZA 5E3OA 3O2PE 5D4RA 2ETHA 1X58A 2LREA 2L2OA 2VJIA 3EUAA 1IDYA 2F4IA 2DMPA 3E3VA 4LD5A 5IP9J 4A3CJ 4LG0A 3FK6A 2EIMH 1WKMA 3OSGA 4G94A 4BXFA 4AIDA 3AL0B 2VXDA 4DOZA 2OJED 3COAC 2UXXA 1B8IA 1H0MA 5DDGA 4MTDA 1U2WA 2JVHA 2R7DA 3HHHA 3HZJA 4F55A 3AG2H 4KIBA 1XPXA 1ETWA 3K7AJ 4XKWA 4HYEA 1B8IB 2B63J 1P92A 3WTZA 1TWAJ 4BBSJ 1MGTA 3VPRA 3U9GA 5GAHJ 3RYRA 1AKHA 5AIQA 2GAUA 4PCQA 2DODA 3BCBA 4A3JJ 1VQ6I 3WU1B 5M5YJ 1VTNC 1SVOA 1Z6RA 2CQKA 1OYWA 2MFZA 1Z67A 1RKTA 3JSOA 3GTGJ 2CUFA 1Y39A 2L4MA 3CF2A 3RPUA 3JTHA 4C2TA 5HDNA 1HXDA 3HHGA 3HBLA 3OOUA 5CVJA 2E1OA 4J00A 1ACIA 2VBZA 1UCRA 1IXCA 1FC3A 5KCMA 1TL8A 3BG7A 3R60A 2R7QA 3NQOA 4Q48A 5J1RA 4WK8F 3H0DA 3M8EA 1J09A 1RZ4A 3DPUA 5JVTA 2VASA 4FX4A 4PJLA 4UVBA 4ANJA 4Q4ZF 2ICWG 2MD5A 5CVIA 4A0YA 2HXIA 3FDYA 2HTJA 2F5CA 1JJ8C 2VT3A 1WHUA 1A35A 2CFOA 4UUVA 4NQWB 2VBXA 1YW7A 4XL9A 1U0JA 3FMRA 2V26A 2L7FP 3G6EI 1S7AA 3SJMA 5GTIC 1VQKI 1HOMA 3OYEA 3BOQA 1A6QA 1RNLA 1EH8A 4BHBA 3TO6A 2LKXA 3CD6I 2QKMB 1MD0A 1VQLI 2CW7A 5E3MA 4CICA 2CQNA 3L1PA 2M9HA 3DTEA 4LMYA 2VN2A 4XN3A 2FEZA 1U5TA 5CJ9A 5E3LA 2DMUA 4UUSB 2LG4A 1NHAA 5B1BH 1XTAA 4A3KJ 1KU7A 1IUFA 4A69C 3TEDA 3ECHA 5FKKA 3JAMZ 3GFJA 2BV6A 3JREA 2HOAA 3EQLF 5GAGJ 2MYSA 4LIVA 3VDXA 1ULYA 3KP3A 5F6FA 1X1PA 2AXLA 4WF2A 4RB1A 3FK7A 2VOPA 2COBA 2OQRA 3LA3A 5B3SH 4RB3C 1POGA 3BT9A 1V54H 2WC2A 5EGOA 3OYKA 3KP2A 2IT0A 3CCRI 3OYCA 1SFUA 5GPCA 3J81Z 2Q2EA 4BE1A 1RC9A 2VJ5A 1W5TA 3I9V2 5LHGA 5F1RA 2JUCA 1FTZA 2E19A 1R5HA 2O6GE 2DA6A 1R23A 3MN2A 1FMVA 2PMHA 2O5RA 2GOXB 5DYMA 1DUXC 3OL3A 2PLYA 5FLMJ 1FJLA 2YUSA 1NK2P 3ZRGA 3ECOA 4BU2A 2X6OA 4PK4A 2ZSIB 3TOAA 1VQPI 2EZKA 3H0GJ 4FASD 1H9TA 4I2OA 2O7OA 5B5EC 3C2BA 2DTRA 3T0YA 4A12A 2IEKA 4B44A 5GTHC 4GFBA 2I10A 4ZYAA 5AONA 3I56I 2CV0A 2VKDA 2DK5A 1Y1VJ 2ID6A 3WG9A 4QPOA 1RR8C 4HF2A 3RQ4A 1QHGA 1MNDA 1HLVA 4BH9A 1Z3YA 3CLOA 3KYLA 4C9YA 3R6SA 3K1MA 5JHFA 1R4NB 2M8GX 1IV8A 2DQRA 2ZO4A 1K78A 1WRJA 3L7WA 3Q0WA 2JRTA 4M3DA 4U7BA 2R0QC 1S6LA 1X4OA 2FUG2 3M1EA 1J9IA 4HV5A 4Y4RA 5DM7F 3W2WA 5LEKA 4HRIA 1H9GA 1JUSA 2HNHA 4XSZF 5HLIA 4YIRX 3CCJI 3W6VA 1MBEA 2CUJA 1E3PA 2VT2A 3MAJA 1ZK8A 4IRHA 4HLXA 3L00A 1WI3A 1QZEA 1D1AA 1T0FA 2D1HA 2HVRA 3IWZA 1O3SA 1Y8QB 2BHZA 4KMFA 3RIRA 1RUNA 3V7RA 1HDPA 3R0AA 2OTLI 1TQPA 4PUSA 3HKZA 1T95A 1P4XA 3F3XA 3QP5A 3OR2C 1I1GA 2QM3A 3HOYJ 3K4JA 2ZJPF 5BPIA 2OA4A 1AA7A 3OYLA 2GA2A 1XN7A 4BS9A 5EEHA 1P4AA 2E1NA 2FRHA 3D5RC 4PJJA 2TDXA 3WGGA 5EDNA 2MG4A 2ZMEC 3H3ZA 3TL4X 2MD0A 3VYRB 5DEQA 2QBYB 3GFIA 4BHPA 2HOEA 4G7ZF 3S2HJ 1ON1A 2EZHA 2VXZA 5FKLA 1HBXG 3BZKA 2CW0F 4XKCA 1ONVA 4L18B 4IQ4A 2W00A 3CCLI 1F4KA 1ZLKA 2DAOA 3WU0A 4LB6B 4EM1A 3LSGA 2L02A 3HSRA 3BCAA 3KEYA 1RKWA 2PBIA 4A6EA 3WTYC 3K6GA 4G6DA 1XGNA 2NOGA 2VB6A 1USTA 2CS3A 2HZDA 1K6OA 1JKQC 3GTMJ 3R4KA 1D5YA 4IEJA 2DCEA 5H2FC 2DTZA 2OF7A 1H89C 3QOPA 5J3LA 3QOEA 3UNGC 4XK4A 1Z91A 3CCYA 3RPQA 4CCNA 5K1YA 2UWMA 3BQZA 3CCQI 3T8TA 3BR5A 1AWCA 1I39A 5FLXK 4QPQA 2DO7A 1EJ9A 4KT5C 3LNQA 1IXSB 2JPCA 2ACJA 4XMYA 4EJOA 2OPTA 5LHHA 1S29A 1P7IA 2CYYA 4S0HB 5HODA 3F21A 3CC2I 3O3KA 2CMPA 2XF5A 5FFZA 4ESFA 2NAZA 1EF4A 2QQ9A 2HOSA 4ITVA 3P9IA 2IS1A 5BQTA 3PFYA 4A3IJ 2LKPA 5DD4A 4A3LJ 3OMYA 4WWCA 3HG9A 3JSPA 5H6RA 3QU6A 4BJ5C 4XRMA 1YIOA 3ISPA 4I0AA 3B73A 4L9VA 3O8HA 2EK5A 1BOAA 3W6KB 2WAQN 3LA7A 4MQVA 3F6VA 2B9SA 2HOTA 2KZVA 3G73A 1SVMA 3TP3A 1OCCH 5DV5A 2XPUA 2R7FA 5TJJA 2LR8A 2OQGA 1ETXA 3ZQ7A 1ZYRF 2HXOA 2A3SA 1P2FA 2PJRA 1HKTA 2BY2A 2IA1A 1YFHA 2EIJH 1VZ0A 4U87A 5J8FA 1ETVA 1HSJA 4H0EA 2LY2A 4K2EA 1BIBA 1DU0A 4L9TA 1W5SA 1TWFJ 2DDAA 4OAZA 2CGPA 4RGUA 3RSNA 1D0ZA 2KZGA 4ZYEA 2VJ4A 1X1CA 2XGCA 4XNFA 1FYMA 1R71A 1XCBA 3HTUA 1UZCA 1G3WA 3VSLA 1MBFA 1SMYF 3T8RA 2DT7B 2JMWA 2IS6A 2DOEA 2VLAA 3CTAA 3G1OA 4DBRA 4ZH4F 4LLGF 1KYWA 2WY8Q 5FFXA 3WODF 2DA5A 2ZCWA 2Y9ZA 3GTQJ 1I27A 2X6XA 3SFIA 3F8CA 4HQEA 1JUPA 1O7FA 2OCEA 2P81A 2DW4A 2LK2A 3KEOA 3I4MJ 2V4JC 4HPQA 2E1MB 3ZCOA 4MQ9F 1Y6IA 3TGNA 1BIAA 3MKLA 4PSWA 2P6TA 2G7HA 2XPVA 1APLC 1WFXA 3G71I 1K61A 4NDLA 2L5QA 2HR3A 4F92B 3NWSA 1MJBA 5J40A 5CPRB 4E7JA 1XX5A 2P4WA 3DU5A 4CCLA 1K6YA 2O03A 3OS2A 4C2MJ 2LF8A 3X2QH 4HX7A 2FQ3A 1CF7A 5KVRA 4A3DJ 5CKTA 1XGSA 2DA7A 2XRNA 4MLOA 4XRSG 1BR4A 2XAHA 4KIGA 2EPFA 1ZN2A 2OZ6A 3DPTA 3GYHX 4OMZA 4BKXA 2IAIA 3ASOH 3HPHA 2FNAA 3CCEI 1A36A 4N0BA 3WTTC 1PYVA 5A2QZ 1TWCJ 2HTSA 2RAEA 4M6VA 4E4HA 3GO5A 4F52A 3M8JA 3MKWB 2DFFA 2DFEA 1IN5A 2WBMA 4FHTA 2RVCA 3TMOA 3GLXA 4AYBA 1NK3P 2MA3A 5FGMA 5D6FA 3QYEA 2PMUA 4XORA 3BQYA 4E6KG 3KP6A 5KK1A 1HW2A 3MWMA 2VKHA 4KT6A 1V5FA 5BMZA 1ETOA 3U1KA 2JT1A 1Z0XA 1BOBA 2KKOA 3HL2A 3JCUC 4B4CA 2CQXA 1LEAA 4P55A 5LFAA 3GTOJ 3F22A 2E36A 3CQZJ 1FBUA 2GXGA 5IT3A 3FISA 3TQNA 3FM5A 2KRFA 4XICA 2NS7A 2R5YB 3I71A 4RM3A 3SYTA 3O6BB 3S14J 2E7XA 3L2RA 2G9WA 4CCJA 1Z3XA 3HOSA 2H8RA 2FA5A 3HUGB 4G6QA 5DCFA 2DBBA 2L7ZA 3DU6A 1FY7A 3SEZA 1ZG5A 3HOWJ 2RV8A 2XSDC 1DQUA 3FXOA 3ZR8X 2EQRA 1O57A 1R1VA 3HM5A 5IY5H 3CDLA 2IGMA 4A2UA 3I64A 1LE8B 1W0TA 5F04A 1FSHA 2UV1A 5CVVA 2F5DA 2IGNA 4XQFA 5HDKA 1ZREA 4LK1F 4XM3A 3NARA 2DQLA 2ESHA 3C18A 2YU9J 2IVMA 1BC8C 5L3GA 2GOMA 4D7NA 3WGHA 4XRSA 3IC7A 3A0BC 3F0CA 2DMTA 1X1BA 2X4HA 4P5OA 1R36A 3RKQA 2EV5A 3Q3SA 1LDKB 4B43A 3TBIA 4WXDA 2NNNA 1IN6A 3OYJA 4O6JA 3KZZA 5JLXA 1I3AA 2E5NA 2K9SA 3F9KA 3CCUI 3ZMSA 2DT6A 4C2UA 2L7MP 2HKXA 2K4BA 1BC7C 2M5WA 4E7KA 2EB7A 2HDCA 1W7PA 2EA4A 2GM4A 1WJBA 2KLOA 2IS2A 5E17F 5M3MJ 3F23A 2F6CA 2K3PA 1WJDA 3LSIA 3PL8A 1HSTA 1KYZA 2FX0A 4OMYA 5CQGA 3FMSA 3PJRA 3OSFA 3I4NJ 1GLNA 5FB2A 1PUEE 2DFIA 3QYFA 1MSFC 4KUMA 4PSXA 2GIZA 5ILSA 4FTHA 1D0XA 2EFPA 1DP3A 4JX5A 3Q5FA 3BC8A 1E3HA 2YSRA 1BR2A 3A1YA 2ELJA 1H88C 5KNLA 1ZLJA 2H1KA 5IYCJ 5F0HA 1U78A 1V55H 2A68F 1W36C 2XV4S 4BQAA 1RETA 3RYPA 3EUKL 2M87A 1B4AA 1TWGJ 4LLNA 4RLFA 1LFPA 5IYDJ 2M2EA 4EVIA 3OS0A 1GDTA 2R93J 3J7AY 5EZHA 1NG7A 3LAJA 1UHMA 3GVAA 1YO5C 3HSEA 3L2CA 1TP4A 1FZPB 4JQFA 4U0VA 3A03A 4Q5SF 4IZZA 3BR1A 1OCTC 3BTJA 4C30A 2FOWA 5DD8A 4OWRB 3OYBA 5HLTA 1YW8A 3A4CA 2HKOA 1TZLA 4L9JA 3ZQQA 3L2UA 3S2DJ 1IGNA 1XMAA 2YS9A 1HKQA 2ZXIA 3NRVA 2HYJA 5DCMB 3H5RA 3CMAI 3BTCA 3S3NA 2W57A 1F36A 1JT6A 1SFKA 1XDSA 2R7TA 5CYVA 1D3YA 2KISA 3KZYA 4I0BA 1ZGJA 2A69F 2LSOA 3C3WA 4Y33A 5IT9Z 1MBHA 4BJ6C 2VPLA 1OQYA 1SAUA 1Z7LA 4BEHA 3ABLH 4CZCA 2P8TA 1DP7P 3GTKJ 1R00A 2JA5J 4P1WA 2E2IJ 4B48A 5FKNA 3CO6C 5F64A 1Z6TA 3RPUD 4CZZA 2JSPA 3J80Z 1HC8A 2K9LA 3CC7I 4MEYF 4NC7A 4LG0B 3KE2A 4HZFA 4HX4A 3IV5A 1ZHFA 2V6CA 2HEOA 2RQQA 4P96A 1A6IA 4HG2A 4EMSA 1MDMA 3ONQA 5KAFC 4U0YA 5J4VA 1U8RA 4WCGA 4IXAA 2VODA 2HFHA 2K85A 1MZBA 1X2NA 4KNYA 4FX0A 3FWEA 1P4WA 4DNCA 1YG2A 2ME6A 4B8XA 1I6HJ 1T2KA 2JZYA 4GYGA 1LKXA 3N05A 1SD6A 2LY1A 4KIFA 1HA8A 4M9ZA 2GIVA 3OV8A 3G3ZA 4MTEA 4IX7A 2O8KA 2NS0A 3H9JA 4NNJA 2DN0A 4ZTFA 3CJNA 3CUQA 4X1EA 2BVLA 2L01A 2IPQX 4AVZA 1AKHB 4A0XA 2L9NA 3I53A 3BTLA 3MZYA 5D4SA 3GFLA 2MC4A 4OU0A 4H4KC 4IJAA 3SHFA 3CUQB 3HOVJ 1X1DA 3ASNH 1IC8A 5L3FA 4IHTA 1WWXA 2FOKA 4V2GA 1IN4A 2KT0A 2HU9A 1YLFA 2NNYA 4ABZA 3AKZA 2HDDA 1YW9A 2V6EA 4I99C 2P5KA 2XB0X 3FXRA 4OIOF 5KHDA 3BZCA 3DQVC 2V1NA 3CF5F 1SAXA 4ZDPA 2EH3A 3H5NA 3IUOA 5ICCA 2ESNA 5M5XJ 1XG1A 2FF4A 4EJUA 4Z6YA 4AIJA 2MBFA 1KU3A 2DLLA 2I5UA 2KJCA 1I1SA 1GXQA 2X48A 3KPHA 1WQ2A 4A3FJ 2M30A 1X3WB 3NEUA 2VOOA 3LSTA 1MIJA 1H8AC 4ENNA 4XIDA 2Q1ZB 1OCZH 4IF4A 9ANTA 1RUOA 1U5TB 3I4PA 4CXFA 2CG4A 3RTRA 1STZA 2D45A 3PSIA 2QQBA 5IP7J 4ENKA 3CJRB 2BHYA 4CHUA 1D1CA 3HKZN 1MBKA 1OJLA 3DLAA 4CCOA 3MVPA 4KJZA 4N9HA 2DI3A 5E18F 1ERDA 4ENMA 2XKOA 3FXLA 3ZP5A 3AL0C 2FBIA 1BL0A 2NVXJ 4FETA 1G4DA 4RBOA 4AIKA 5HS7A 4HW0A 2QF7A 1QZYA 3IWFA 1RRJA 5EGOB 1ENHA 2FBHA 4C3JJ 4G8XA 3PM1A 4BQOA 5D5UB 2MH2A 4S05A 2Q2EB 3VODA 1GT0C 2GLOA 2DA4A 1UG2A 3LSJA 4EJTA 2R92J 1K7AA 5E1WA 4GRIA 1FBSA 2XDVA 3LSHA 3MZ8A 4L0ZB 2GA1A 1XSXA 4OIRF 2EZLA 1EH6A 1FPQA 1TBXA 4UV8A 1K4SA 1FNNA 3M3YJ 4D5FA 1Z77A 2WV0A 3B6AA 1MMDA 4XLNF 2M4GA 2NOJB 1Z1DA 5HLGA 1JJ6C 2DPUA 1I5ZA 2TRTA 3LSPA 2PEXA 1WJEA 1VF9A 2HYGD 3K4NA 1TT0A 2RC4A 2XIGA 2R7SA 2OTJI 4UB6C 3C7JA 1R58A 4PZJA 4LFUA 5HLHA 2EV6A 4UUTA 4B3XA 1ETYA 1P7JA 4FT8A 1KA8A 2KFDA 2ZC2A 1K78B 3L2VA 2D1VA 1J7KA 5FRMA 2Z33A 2K5CA 2L4AA 3FBNB 5FKOA 2VE8A 1HW5A 3ULQB 1NTCA 5FROA 2DMQA 3GUDA 3SDBA 1W5CC 2MH9A 3A0HC 2DYSH 5ICGA 2DU9A 4WX9A 1MBGA 4XKBA 3TO9A 1S5LC 4ASNA 3QRFF 3V8JA 2V9VA 2HVSA 4XRFA 1OYYA 2CQ7A 4NB5A 5FJ8J 1WJ5A 1SEUA 2Y0SA 2VQHA 4I09A 4PFPA 3DFGA 1ODDA 4XLCA 5F08A 2PQ8A 2X6YA 2CRGA 4L5EA 2VKEA 3HDDA
chains in the Genus database with same CATH topology
3I59A 4M73A 1KU2A 1U6GA 2BE5F 4L5IA 2XUBA 1A04A 3CO7C 5K5QA 4CDGA 4RAZA 3I59B 3TOBA 5D6EA 1Y0UA 4ON0A 4EM0B 3IL2A 3FXQA 4WXCA 1XDUA 5D5XB 3P7NA 2IA0A 2V1DA 2XKPA 2D2WA 3KP7A 4GO1A 2QENA 1BN5A 3EDPA 4RGRA 3U1DA 1FP2A 1OYIA 2A5YB 1L3LA 3DEUA 5K5OA 1DDNA 3E5XA 1EH7A 5DUKA 3EYYA 1TQMA 2H6BA 5L3DA 4EJVA 3HRSA 3RI4A 5FO5A 2CSOA 3OOPA 5L3EA 3ZMTA 2COMA 5CVRA 4BYYA 3ZMZA 1PP7U 3KCCA 3I5UA 1B1BA 1XCVA 4S04A 3DKWA 4GCVA 5E8GA 4GXOA 4U0WA 3TO7A 2PG4A 1R22A 1QPMA 2AS5F 4TV7A 4LJZF 5FD5A 1X3UA 4HF0A 3KP4A 2QYOA 3TKYA 2K86A 5AIPA 3TDUC 3E6MA 4MGRA 5D8LB 1RI7A 3ZN1A 3ABUA 2FSWA 1S3JA 2V1XA 5ERIA 4YIIA 3HRUA 4YIFA 3BPVA 4CYDA 2OBPA 2HQNA 3MEXA 4RB0A 4JK1X 4RGSA 1JE8A 5DUIA 1R1TA 1T38A 3HRTA 3K9TA 1ZH5A 1MJ9A 3FHZA 2WTEA 5E1ZB 4HDVA 3ERED 3KLOA 3I54A 5JI6A 3KFWX 1KU9A 1LEBA 3WTUC 2KIFA 4D0PA 3V8KA 1KQ8A 4HQMA 1E17A 2Z99A 1IF1A 2Z5UA 3WGIA 2IJLA 1T98A 3SZPA 2MLKA 4YG2F 1FOKA 2J5OA 2XGXA 4EQQA 1SFEA 1W4MA 5H6QA 1CF7B 4AIHA 4OIQF 1OMIA 1FP1D 2FU4A 1KGSA 4OINF 2P5VA 2XAFA 2MC3A 1XSVA 4ENJA 1GXPA 5FLXZ 1BI0A 1QNTA 3BZ6A 4KA4A 4HLYA 2ELHA 3FF5A 2HS5A 4QWQA 3WTXC 3PFIA 4QLCU 2QUFA 1Q1HA 5FD6A 3T1BA 3SFZA 2F2EA 5JR3A 1OKRA 4IPAA 1O3TA 3IKVA 4KN7X 1MJAA 2OAZA 2W24A 4KDPA 3J7AO 1O7LA 4RAYA 1SD4A 1KQ0A 2KIMA 3BDDA 1REPC 3D5LA 3LFKA 1JXSA 3E5UA 2HQRA 2RDPA 2XHKA 3BY6A 1W7PD 4A6DA 3KP5A 5HS9A 2KJBA 4I02A 1UHWA 4WXHA 4Z2YA 3CDHA 1P6RA 3C1DA 3K1PA 3HRMA 1BI3A 4NHJA 1IZ1A 3PQJA 1XD7A 3I58A 3WTSC 1Z05A 3RKYA 4PGGA 1Z9CA 2X0LA 4UNOA 2M1BA 2ADUA 1TW3A 1J5YA 3ELKA 2DPDA 4Y17A 4CGZA 4PDKA 1TLHB 3ROUA 1W7PB 3L9FA 1ON2A 1D8JA 4O3MA 2LNBA 1XB4A 3H3UA 4M6YA 5JHUA 2H27A 1F9NA 3MFKA 4IVNA 4G7HF 3JTGA 2R3SA 1WI9A 2GZWA 2PJPA 1QQIA 2EFNA 2EFQA 1TNSA 2NRAC 4A5MA 2BEOA 4G7OF 4EV0A 1BJAA 1BM9A 1QGPA 4L0YB 4YFNF 2P5LC 1XGMA 4IHSA 1FT9A 3VOEA 2PN6A 5ED4A 5LLQA 4EGZA 1SD5A 3JAMK 4P9FA 5HS8A 4I7HA 3S2WA 3ZMUA 4BXUA 4BAYA 5LGUA 2YX7A 4M71A 1BI2A 3K0LA 3J81K 2E7WA 2V79A 2K7LA 4EGYA 2QLZA 2ZBKA 4GGGA 3REOA 1V4RA 1R7JA 3DV8A 1WSUA 4N9IA 4RGXA 2XASA 3Q9SA 4KN4X 1YTYA 2Y75A 3BJAA 2XVCA 1IRFA 1JHFA 4M6XA 2YR2A 1G3TA 1Z7UA 3E6BA 2STTA 2UXNA 1B9NA 1UFMA 3SZTA 4B09A 2VONA 2RN7A 3FMQA 1J75A 3GF2A 1V3FA 1MDMB 4M72A 4UVCA 2G7UA 2RKHA 3QP6A 2XAJA 4UXNA 3F6OA 2K27A 3BJ6A 2STWA 2ZKZA 5JFRA 2RNJA 1JGSA 2XAQA 1SMTA 1XMKA 4IRIA 5ICEA 3AAFA 2ZNZA 4ETSA 2K02A 3VEPA 2DT5A 3FM3A 2Q8KA 3LA2A 1ZRCA 1T6SA 1L0OC 4AD9A 3QU3A 4NQWA 3RJPA 2GXBA 2A6HF 1LDJA 4LGWA 2PFBA 3V4GA 2ZFWA 1SD7A 2GQQA 5BOXA 1LJ9A 2K4JA 4HBLA 5LGNA 2BGCA 2ZMEA 4XLPF 2LDUA 2Y0MA 2B0LA 2XAGA 3GEZA 5HDGA 2XROA 2M45A 2ZMEB 5L3CA 4RS8A 4ZYHA 3F8MA 3K69A 1YS7A 2EA2A 4Y15A 4IRGA 2OZUA 2NYXA 3MQ0A 3F8NA 3RDIA 2Z9OA 1AOYA 3EYIA 5E20A 1USSA 5BS6A 1UB9A 1EV7A 3QPTA 4DQ2A 3FZVA 3BJOA 3RKWA 2P7VB 4HX8A 2A07F 3GZ6A 1ZG3A 1ZRDA 5LEJA 2VBWA 1XSDA 3E6DA 2DK8A 4HOBA 3RKXA 2ZNYA 3GZ5A 3CUQC 3LQRA 2ZXJA 3HTSB 1K79A 3GFMA 1FLIA 1DPUA 1LNWA 2YPRA 1ZGAA 4KICA 2KIUA 5H20A 5J8CA 4R8HA 5L3BA 4XBFA 2CO5A 2HGCA 3IHUA 1ZARA 3E97A 2W84A 3N4MA 3LAPA 3HSFA 5LRSA 2CWEA 2W85A 2IA2A 1F5TA 3M8FA 1QO0D 4BNCA 4LK0F 5ILVA 1FBQA 3HOTA 4EJWA 1U5TC 4KMUX 1PP8F 2QBYA 1TQIA 1TTYA 2FBKA 4L5JA 2QWWA 3ZPLA 1QBJA 2BYVE 2C6YA 1B6AA 4BHCA 3E6CC 2IRFG 1O3RA 4OOIA 3V8LA 1TNTA 1FSEA 5ICFA 2H6CA 5LGTA 1U3EM 3EUHA 3LQQA 3L09A 4YFKF 5TRDA 1GHCA 2YU3A 2A6EF 3DP7A 2O3FA 2H09A 5A2QK 4EM2A 3P9CA 5CVUA 3HYIA 3ZMDA 2GWRA 2QZ8A 3ML6A 3WTWC 5EEGA 5D8KB 3ZN0A 3Q9VA 3TDZC 5HOOA 3BROA 1FYLA 1LDDA 2A61A 1R1UA 1LB2A 2H94A 3F72A 1S8NA 3N97A 4UV9A 3GX4X 4Y13A 5E1XA 4AVPA 3KEQA 3LWFA 2BBYA 4A0ZA 3IKTA 1FX7A 2L54A 1LVAA 3M7GA 3SXYA 3WTVC 5HVQC 2ISYA 1HQCA 1IAWA 2FE3A 1B9MA 4Q47A 3K1NA 2JTVA 4UVAA 2ISZA 1IN8A 1I6XA 3PQKA 2V1UA 2QVOA 2O8XA 3B02A 4O5VA 1E2XA 1KQ9A 2VC0A 4ESJA 3R0JA 3T5XA 5K5RA 1IW7F 4MEXF 5D5VB 4I98B 2UZKA 4L9NA 2HZTA 3D0SA 1DPRA 3QAHA 2M8EA 3HIFA 4LB5A 4M9SA 3DF8A 2FXAA 1T39A 3ABTA 1F1ZA 3CUOA 4E70A 2Q0OA 2W25A 2VBYA 1YQAA 2FNPA 3V7SA 1OPCA 3P9KA 4U7DA 1IUYA 4CO8A 3VFZA 2CFXA 2EV0A 4HAMA 2VE9A 1C0WA 1TW2A 2MLGA 2O61A 3DPLC 1GVJA 1LQ1A 4MHGA 2HWVA 4LLLA 3IRQA 1XGOA 3V7CA 1J59A 2YX4A 2JPBA 3K2ZA 4OIPF 2EJRA 6PAXA 4ZYDA 2OD5A 3WE3A 1RIOH 1OR7A 3W6JB 2FMYA 4M9XA 1MKMA 4R1HA 2P7CB 2EFOA 1BI1A 1G6NA 2O0YA 5BPDA 1SFXA 2VC1A 2RGVA 1D8KA 1S7OA 2HYFA 2P6SA 1J2XA 1IXRC 1IN7A 3HUGA 2F5EA 5IT9K 3DXJF 4XSXF 3FXUA 1ZAOA 3WE2A 2J5PA 2JSCA 1FYKA 4R79A 2IP2A 3J80K 4U88A 2PI0A 3GXOA 3SQNA 4KFCA 4RB2C 2Z3YA 5ILUA 3KETA 2FMLA 1J0RA 2IW5A 2WWYA 4YFXF 1D5VA 4AWXB 1CGPA 5D5WB 2EFWA 1ZRFA 4ZYGA 1ZG1A 4HA8A 1B59A 4PGHA 3F8BA 3U2RA 1HW1A 4M74A 3QPHA 1YS6A 3MZHA 2OU2A 3IRRA 3GW2A 3KLNA 4P9UA 2QQAA 3FX3A 5J6XA 1HKSA 1QZZA 4UHTA 4I01A 1BBYA 5LRRA 3E5QA 4ZZDA 3BPXA 3H92A 3ZMVA 1G3SA 4HDUA 2Y48A 5E8IA 3VB2A 4ESBA 1JHHA 1FWZA 3EETA 1O3QA 4HF1A 2ZJ2A 4HV6A 1YYVA 4A5NA 4JBAA 3M9AA 4GYIA 3R61A 2F5FA 2RQPA 1R5GA 3BWGA 2E1CA 2L3DA 5DCMA 1PDNC 5LHIA 4G9YA 3F8FA 2LF7A 4MNUA 4ZZLA 3MCZA 1G3YA 3BP8A 3JW4A 1IRGA 4KYWA 3I0TA 2EWNA 3GWZA 5LBQA 5CLSA 5D4RA 4F7ZA 3O2PE 2ETHA 4LD5A 3E3VA 4LG0A 1WKMA 4G94A 3COAC 2UXXA 1H0MA 5DDGA 4MTDA 1U2WA 2R7DA 3HHHA 4KIBA 4HYEA 1P92A 3WTZA 1MGTA 3U9GA 3RYRA 5AIQA 2GAUA 4PCQA 3WU1B 1VTNC 1Z6RA 2CQKA 1OYWA 3JSOA 2L4MA 3RPUA 3JTHA 5HDNA 1HXDA 3HHGA 5CVJA 2VBZA 1UCRA 1IXCA 1FC3A 3R60A 3NQOA 4Q48A 4WK8F 3M8EA 1RZ4A 5JVTA 4FX4A 4UVBA 4Q4ZF 2MD5A 5CVIA 4A0YA 2HTJA 2F5CA 2VT3A 4UUVA 2VBXA 1YW7A 3FMRA 1S7AA 3BOQA 1RNLA 1EH8A 4BHBA 3TO6A 1MD0A 4CICA 4LMYA 2VN2A 2FEZA 1U5TA 5CJ9A 1NHAA 1KU7A 3ECHA 3JAMZ 3GFJA 2BV6A 3EQLF 1ULYA 3KP3A 5F6FA 2AXLA 4WF2A 4RB1A 2VOPA 2OQRA 3LA3A 4RB3C 2WC2A 3KP2A 2IT0A 1SFUA 3J81Z 2Q2EA 1W5TA 5LHGA 5F1RA 1R5HA 2O6GE 1R23A 2PMHA 5DYMA 1DUXC 2PLYA 3ECOA 3TOAA 1H9TA 4I2OA 2DTRA 3T0YA 4A12A 5AONA 2DK5A 3WG9A 4HF2A 4BH9A 3CLOA 3R6SA 3K1MA 2DQRA 2ZO4A 1K78A 1WRJA 3L7WA 4U7BA 2JRTA 1S6LA 3M1EA 1J9IA 4HV5A 5LEKA 1H9GA 4XSZF 5HLIA 2VT2A 3MAJA 4IRHA 4HLXA 3L00A 1T0FA 2D1HA 3IWZA 1O3SA 4KMFA 3RIRA 1RUNA 3V7RA 3R0AA 1TQPA 1P4XA 3F3XA 3QP5A 1I1GA 2QM3A 5BPIA 2OA4A 2GA2A 1XN7A 5EEHA 1P4AA 2E1NA 2FRHA 3WGGA 2TDXA 3H3ZA 5DEQA 2QBYB 3GFIA 4BHPA 2HOEA 4G7ZF 1ON1A 2VXZA 1HBXG 2CW0F 1ONVA 4L18B 1F4KA 1ZLKA 2DAOA 3WU0A 4LB6B 4EM1A 2L02A 3HSRA 2PBIA 4A6EA 3WTYC 4G6DA 1XGNA 1USTA 1K6OA 3R4KA 3QOPA 5K1YA 1Z91A 3RPQA 2UWMA 3T8TA 1AWCA 5FLXK 2DO7A 4KT5C 1IXSB 2JPCA 2ACJA 4EJOA 5LHHA 1S29A 2CYYA 3F21A 3O3KA 5FFZA 4ESFA 2NAZA 2QQ9A 3P9IA 5BQTA 2LKPA 5DD4A 4WWCA 3JSPA 5H6RA 3QU6A 1YIOA 3ISPA 4I0AA 3B73A 4L9VA 2EK5A 1BOAA 3W6KB 3LA7A 4MQVA 3F6VA 3G73A 5DV5A 2R7FA 5TJJA 2OQGA 3ZQ7A 1ZYRF 2A3SA 1P2FA 1HKTA 2IA1A 1YFHA 5J8FA 1HSJA 4H0EA 4K2EA 1BIBA 4L9TA 1W5SA 2CGPA 4RGUA 4ZYEA 1FYMA 1XCBA 3HTUA 1G3WA 1SMYF 3T8RA 3CTAA 4ZH4F 4LLGF 1KYWA 5FFXA 3WODF 2ZCWA 1I27A 3F8CA 4HQEA 1O7FA 2DW4A 3KEOA 4MQ9F 3TGNA 1BIAA 2P6TA 2G7HA 2HR3A 1MJBA 2P4WA 2O03A 2LF8A 4HX7A 2FQ3A 1CF7A 5KVRA 1XGSA 2XRNA 2XAHA 4KIGA 1ZN2A 2OZ6A 3DPTA 3GYHX 4OMZA 2FNAA 4N0BA 3WTTC 5A2QZ 2HTSA 3GO5A 1IN5A 4FHTA 2RVCA 3GLXA 2MA3A 5FGMA 5D6FA 2PMUA 3KP6A 5KK1A 1HW2A 3MWMA 5BMZA 2JT1A 2KKOA 1LEAA 4P55A 3F22A 1FBUA 2GXGA 5IT3A 3TQNA 3FM5A 2KRFA 3I71A 3O6BB 2E7XA 2G9WA 3HOSA 2FA5A 4G6QA 5DCFA 2DBBA 1FY7A 1ZG5A 2RV8A 1O57A 1R1VA 4A2UA 3I64A 1FSHA 5CVVA 2F5DA 5HDKA 1ZREA 4LK1F 2DQLA 2ESHA 3C18A 2IVMA 1BC8C 5L3GA 3WGHA 3IC7A 2X4HA 4P5OA 1R36A 2EV5A 1LDKB 4WXDA 2NNNA 1IN6A 4O6JA 3KZZA 3ZMSA 2HKXA 2K4BA 1BC7C 2M5WA 2EB7A 2HDCA 1W7PA 2EA4A 5E17F 3F23A 1HSTA 1KYZA 4OMYA 3FMSA 5FB2A 1PUEE 2DFIA 4KUMA 5ILSA 2EFPA 3Q5FA 2YSRA 1ZLJA 1U78A 2A68F 2XV4S 4BQAA 3RYPA 2M87A 1B4AA 4LLNA 4EVIA 3LAJA 1UHMA 3GVAA 1YO5C 3HSEA 3L2CA 1FZPB 4JQFA 4U0VA 4Q5SF 5DD8A 1YW8A 4L9JA 2HKOA 1XMAA 1HKQA 3NRVA 5DCMB 2W57A 1XDSA 5CYVA 1D3YA 3KZYA 4I0BA 1ZGJA 2A69F 2LSOA 3C3WA 5IT9Z 2P8TA 1DP7P 1R00A 3CO6C 5F64A 1Z6TA 4CZZA 3J80Z 4MEYF 4LG0B 3KE2A 4HZFA 4HX4A 1ZHFA 2V6CA 2HEOA 4P96A 4EMSA 1MDMA 4U0YA 1U8RA 4WCGA 4IXAA 2VODA 2HFHA 1MZBA 4KNYA 4FX0A 3FWEA 1P4WA 4DNCA 1YG2A 4B8XA 1T2KA 2JZYA 4GYGA 1SD6A 4KIFA 4M9ZA 2GIVA 3OV8A 3G3ZA 4MTEA 2NS0A 3CJNA 3CUQA 2L01A 2IPQX 4A0XA 3I53A 3MZYA 5D4SA 3GFLA 4OU0A 3SHFA 4IJAA 3CUQB 5L3FA 4IHTA 1WWXA 2FOKA 1IN4A 2NNYA 1YLFA 1YW9A 2P5KA 3FXRA 4OIOF 3DQVC 1SAXA 5ICCA 2ESNA 2FF4A 4EJUA 4AIJA 2MBFA 1KU3A 2DLLA 2KJCA 1I1SA 1GXQA 1WQ2A 2M30A 3NEUA 2VOOA 3LSTA 4ENNA 4IF4A 1RUOA 1U5TB 3I4PA 4CXFA 2CG4A 3RTRA 1STZA 2D45A 2QQBA 4ENKA 4CHUA 4N9HA 2DI3A 5E18F 4ENMA 2XKOA 3ZP5A 2FBIA 1G4DA 4AIKA 5HS7A 4HW0A 1QZYA 3IWFA 2FBHA 4G8XA 4S05A 5D5UB 2MH2A 3VODA 4EJTA 1K7AA 5E1WA 1FBSA 4L0ZB 2GA1A 1XSXA 4OIRF 1EH6A 1FPQA 1TBXA 4UV8A 1FNNA 2WV0A 4XLNF 1Z1DA 5HLGA 2DPUA 1I5ZA 2PEXA 2HYGD 2RC4A 2XIGA 3C7JA 1R58A 4PZJA 4LFUA 5HLHA 2EV6A 4FT8A 1KA8A 1K78B 2D1VA 1J7KA 2Z33A 2L4AA 2VE8A 1HW5A 3ULQB 3GUDA 2MH9A 4WX9A 5ICGA 2DU9A 3TO9A 3QRFF 4ASNA 3V8JA 2V9VA 4XRFA 1OYYA 4NB5A 4I09A 3DFGA 1ODDA 2PQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I59 A;  4M73 A;  1KU2 A;  1U6G A;  2BE5 F;  4L5I A;  2XUB A;  1A04 A;  3CO7 C;  5K5Q A;  4CDG A;  4RAZ A;  3I59 B;  3TOB A;  5D6E A;  1Y0U A;  4ON0 A;  4EM0 B;  3IL2 A;  3FXQ A;  4WXC A;  1XDU A;  5D5X B;  3P7N A;  2IA0 A;  2V1D A;  2XKP A;  2D2W A;  3KP7 A;  4GO1 A;  2QEN A;  1BN5 A;  3EDP A;  4RGR A;  3U1D A;  1FP2 A;  1OYI A;  2A5Y B;  1L3L A;  3DEU A;  5K5O A;  1DDN A;  3E5X A;  1EH7 A;  5DUK A;  3EYY A;  1TQM A;  2H6B A;  5L3D A;  4EJV A;  3HRS A;  3RI4 A;  5FO5 A;  2CSO A;  3OOP A;  5L3E A;  3ZMT A;  2COM A;  5CVR A;  4BYY A;  3ZMZ A;  1PP7 U;  3KCC A;  3I5U A;  1B1B A;  1XCV A;  4S04 A;  3DKW A;  4GCV A;  5E8G A;  4GXO A;  4U0W A;  3TO7 A;  2PG4 A;  1R22 A;  1QPM A;  2AS5 F;  4TV7 A;  4LJZ F;  5FD5 A;  1X3U A;  4HF0 A;  3KP4 A;  2QYO A;  3TKY A;  2K86 A;  5AIP A;  3TDU C;  3E6M A;  4MGR A;  5D8L B;  1RI7 A;  3ZN1 A;  3ABU A;  2FSW A;  1S3J A;  2V1X A;  5ERI A;  4YII A;  3HRU A;  4YIF A;  3BPV A;  4CYD A;  2OBP A;  2HQN A;  3MEX A;  4RB0 A;  4JK1 X;  4RGS A;  1JE8 A;  5DUI A;  1R1T A;  1T38 A;  3HRT A;  3K9T A;  1ZH5 A;  1MJ9 A;  3FHZ A;  2WTE A;  5E1Z B;  4HDV A;  3ERE D;  3KLO A;  3I54 A;  5JI6 A;  3KFW X;  1KU9 A;  1LEB A;  3WTU C;  2KIF A;  4D0P A;  3V8K A;  1KQ8 A;  4HQM A;  1E17 A;  2Z99 A;  1IF1 A;  2Z5U A;  3WGI A;  2IJL A;  1T98 A;  3SZP A;  2MLK A;  4YG2 F;  1FOK A;  2J5O A;  2XGX A;  4EQQ A;  1SFE A;  1W4M A;  5H6Q A;  1CF7 B;  4AIH A;  4OIQ F;  1OMI A;  1FP1 D;  2FU4 A;  1KGS A;  4OIN F;  2P5V A;  2XAF A;  2MC3 A;  1XSV A;  4ENJ A;  1GXP A;  5FLX Z;  1BI0 A;  1QNT A;  3BZ6 A;  4KA4 A;  4HLY A;  2ELH A;  3FF5 A;  2HS5 A;  4QWQ A;  3WTX C;  3PFI A;  4QLC U;  2QUF A;  1Q1H A;  5FD6 A;  3T1B A;  3SFZ A;  2F2E A;  5JR3 A;  1OKR A;  4IPA A;  1O3T A;  3IKV A;  4KN7 X;  1MJA A;  2OAZ A;  2W24 A;  4KDP A;  3J7A O;  1O7L A;  4RAY A;  1SD4 A;  1KQ0 A;  2KIM A;  3BDD A;  1REP C;  3D5L A;  3LFK A;  1JXS A;  3E5U A;  2HQR A;  2RDP A;  2XHK A;  3BY6 A;  1W7P D;  4A6D A;  3KP5 A;  5HS9 A;  2KJB A;  4I02 A;  1UHW A;  4WXH A;  4Z2Y A;  3CDH A;  1P6R A;  3C1D A;  3K1P A;  3HRM A;  1BI3 A;  4NHJ A;  1IZ1 A;  3PQJ A;  1XD7 A;  3I58 A;  3WTS C;  1Z05 A;  3RKY A;  4PGG A;  1Z9C A;  2X0L A;  4UNO A;  2M1B A;  2ADU A;  1TW3 A;  1J5Y A;  3ELK A;  2DPD A;  4Y17 A;  4CGZ A;  4PDK A;  1TLH B;  3ROU A;  1W7P B;  3L9F A;  1ON2 A;  1D8J A;  4O3M A;  2LNB A;  1XB4 A;  3H3U A;  4M6Y A;  5JHU A;  2H27 A;  1F9N A;  3MFK A;  4IVN A;  4G7H F;  3JTG A;  2R3S A;  1WI9 A;  2GZW A;  2PJP A;  1QQI A;  2EFN A;  2EFQ A;  1TNS A;  2NRA C;  4A5M A;  2BEO A;  4G7O F;  4EV0 A;  1BJA A;  1BM9 A;  1QGP A;  4L0Y B;  4YFN F;  2P5L C;  1XGM A;  4IHS A;  1FT9 A;  3VOE A;  2PN6 A;  5ED4 A;  5LLQ A;  4EGZ A;  1SD5 A;  3JAM K;  4P9F A;  5HS8 A;  4I7H A;  3S2W A;  3ZMU A;  4BXU A;  4BAY A;  5LGU A;  2YX7 A;  4M71 A;  1BI2 A;  3K0L A;  3J81 K;  2E7W A;  2V79 A;  2K7L A;  4EGY A;  2QLZ A;  2ZBK A;  4GGG A;  3REO A;  1V4R A;  1R7J A;  3DV8 A;  1WSU A;  4N9I A;  4RGX A;  2XAS A;  3Q9S A;  4KN4 X;  1YTY A;  2Y75 A;  3BJA A;  2XVC A;  1IRF A;  1JHF A;  4M6X A;  2YR2 A;  1G3T A;  1Z7U A;  3E6B A;  2STT A;  2UXN A;  1B9N A;  1UFM A;  3SZT A;  4B09 A;  2VON A;  2RN7 A;  3FMQ A;  1J75 A;  3GF2 A;  1V3F A;  1MDM B;  4M72 A;  4UVC A;  2G7U A;  2RKH A;  3QP6 A;  2XAJ A;  4UXN A;  3F6O A;  2K27 A;  3BJ6 A;  2STW A;  2ZKZ A;  5JFR A;  2RNJ A;  1JGS A;  2XAQ A;  1SMT A;  1XMK A;  4IRI A;  5ICE A;  3AAF A;  2ZNZ A;  4ETS A;  2K02 A;  3VEP A;  2DT5 A;  3FM3 A;  2Q8K A;  3LA2 A;  1ZRC A;  1T6S A;  1L0O C;  4AD9 A;  3QU3 A;  4NQW A;  3RJP A;  2GXB A;  2A6H F;  1LDJ A;  4LGW A;  2PFB A;  3V4G A;  2ZFW A;  1SD7 A;  2GQQ A;  5BOX A;  1LJ9 A;  2K4J A;  4HBL A;  5LGN A;  2BGC A;  2ZME A;  4XLP F;  2LDU A;  2Y0M A;  2B0L A;  2XAG A;  3GEZ A;  5HDG A;  2XRO A;  2M45 A;  2ZME B;  5L3C A;  4RS8 A;  4ZYH A;  3F8M A;  3K69 A;  1YS7 A;  2EA2 A;  4Y15 A;  4IRG A;  2OZU A;  2NYX A;  3MQ0 A;  3F8N A;  3RDI A;  2Z9O A;  1AOY A;  3EYI A;  5E20 A;  1USS A;  5BS6 A;  1UB9 A;  1EV7 A;  3QPT A;  4DQ2 A;  3FZV A;  3BJO A;  3RKW A;  2P7V B;  4HX8 A;  2A07 F;  3GZ6 A;  1ZG3 A;  1ZRD A;  5LEJ A;  2VBW A;  1XSD A;  3E6D A;  2DK8 A;  4HOB A;  3RKX A;  2ZNY A;  3GZ5 A;  3CUQ C;  3LQR A;  2ZXJ A;  3HTS B;  1K79 A;  3GFM A;  1FLI A;  1DPU A;  1LNW A;  2YPR A;  1ZGA A;  4KIC A;  2KIU A;  5H20 A;  5J8C A;  4R8H A;  5L3B A;  4XBF A;  2CO5 A;  2HGC A;  3IHU A;  1ZAR A;  3E97 A;  2W84 A;  3N4M A;  3LAP A;  3HSF A;  5LRS A;  2CWE A;  2W85 A;  2IA2 A;  1F5T A;  3M8F A;  1QO0 D;  4BNC A;  4LK0 F;  5ILV A;  1FBQ A;  3HOT A;  4EJW A;  1U5T C;  4KMU X;  1PP8 F;  2QBY A;  1TQI A;  1TTY A;  2FBK A;  4L5J A;  2QWW A;  3ZPL A;  1QBJ A;  2BYV E;  2C6Y A;  1B6A A;  4BHC A;  3E6C C;  2IRF G;  1O3R A;  4OOI A;  3V8L A;  1TNT A;  1FSE A;  5ICF A;  2H6C A;  5LGT A;  1U3E M;  3EUH A;  3LQQ A;  3L09 A;  4YFK F;  5TRD A;  1GHC A;  2YU3 A;  2A6E F;  3DP7 A;  2O3F A;  2H09 A;  5A2Q K;  4EM2 A;  3P9C A;  5CVU A;  3HYI A;  3ZMD A;  2GWR A;  2QZ8 A;  3ML6 A;  3WTW C;  5EEG A;  5D8K B;  3ZN0 A;  3Q9V A;  3TDZ C;  5HOO A;  3BRO A;  1FYL A;  1LDD A;  2A61 A;  1R1U A;  1LB2 A;  2H94 A;  3F72 A;  1S8N A;  3N97 A;  4UV9 A;  3GX4 X;  4Y13 A;  5E1X A;  4AVP A;  3KEQ A;  3LWF A;  2BBY A;  4A0Z A;  3IKT A;  1FX7 A;  2L54 A;  1LVA A;  3M7G A;  3SXY A;  3WTV C;  5HVQ C;  2ISY A;  1HQC A;  1IAW A;  2FE3 A;  1B9M A;  4Q47 A;  3K1N A;  2JTV A;  4UVA A;  2ISZ A;  1IN8 A;  1I6X A;  3PQK A;  2V1U A;  2QVO A;  2O8X A;  3B02 A;  4O5V A;  1E2X A;  1KQ9 A;  2VC0 A;  4ESJ A;  3R0J A;  3T5X A;  5K5R A;  1IW7 F;  4MEX F;  5D5V B;  4I98 B;  2UZK A;  4L9N A;  2HZT A;  3D0S A;  1DPR A;  3QAH A;  2M8E A;  3HIF A;  4LB5 A;  4M9S A;  3DF8 A;  2FXA A;  1T39 A;  3ABT A;  1F1Z A;  3CUO A;  4E70 A;  2Q0O A;  2W25 A;  2VBY A;  1YQA A;  2FNP A;  3V7S A;  1OPC A;  3P9K A;  4U7D A;  1IUY A;  4CO8 A;  3VFZ A;  2CFX A;  2EV0 A;  4HAM A;  2VE9 A;  1C0W A;  1TW2 A;  2MLG A;  2O61 A;  3DPL C;  1GVJ A;  1LQ1 A;  4MHG A;  2HWV A;  4LLL A;  3IRQ A;  1XGO A;  3V7C A;  1J59 A;  2YX4 A;  2JPB A;  3K2Z A;  4OIP F;  2EJR A;  6PAX A;  4ZYD A;  2OD5 A;  3WE3 A;  1RIO H;  1OR7 A;  3W6J B;  2FMY A;  4M9X A;  1MKM A;  4R1H A;  2P7C B;  2EFO A;  1BI1 A;  1G6N A;  2O0Y A;  5BPD A;  1SFX A;  2VC1 A;  2RGV A;  1D8K A;  1S7O A;  2HYF A;  2P6S A;  1J2X A;  1IXR C;  1IN7 A;  3HUG A;  2F5E A;  5IT9 K;  3DXJ F;  4XSX F;  3FXU A;  1ZAO A;  3WE2 A;  2J5P A;  2JSC A;  1FYK A;  4R79 A;  2IP2 A;  3J80 K;  4U88 A;  2PI0 A;  3GXO A;  3SQN A;  4KFC A;  4RB2 C;  2Z3Y A;  5ILU A;  3KET A;  2FML A;  1J0R A;  2IW5 A;  2WWY A;  4YFX F;  1D5V A;  4AWX B;  1CGP A;  5D5W B;  2EFW A;  1ZRF A;  4ZYG A;  1ZG1 A;  4HA8 A;  1B59 A;  4PGH A;  3F8B A;  3U2R A;  1HW1 A;  4M74 A;  3QPH A;  1YS6 A;  3MZH A;  2OU2 A;  3IRR A;  3GW2 A;  3KLN A;  4P9U A;  2QQA A;  3FX3 A;  5J6X A;  1HKS A;  1QZZ A;  4UHT A;  4I01 A;  1BBY A;  5LRR A;  3E5Q A;  4ZZD A;  3BPX A;  3H92 A;  3ZMV A;  1G3S A;  4HDU A;  2Y48 A;  5E8I A;  3VB2 A;  4ESB A;  1JHH A;  1FWZ A;  3EET A;  1O3Q A;  4HF1 A;  2ZJ2 A;  4HV6 A;  1YYV A;  4A5N A;  4JBA A;  3M9A A;  4GYI A;  3R61 A;  2F5F A;  2RQP A;  1R5G A;  3BWG A;  2E1C A;  2L3D A;  5DCM A;  1PDN C;  5LHI A;  4G9Y A;  3F8F A;  2LF7 A;  4MNU A;  4ZZL A;  3MCZ A;  1G3Y A;  3BP8 A;  3JW4 A;  1IRG A;  4KYW A;  3I0T A;  2EWN A;  3GWZ A;  5LBQ A;  5CLS A;  5D4R A;  4F7Z A;  3O2P E;  2ETH A;  4LD5 A;  3E3V A;  4LG0 A;  1WKM A;  4G94 A;  3COA C;  2UXX A;  1H0M A;  5DDG A;  4MTD A;  1U2W A;  2R7D A;  3HHH A;  4KIB A;  4HYE A;  1P92 A;  3WTZ A;  1MGT A;  3U9G A;  3RYR A;  5AIQ A;  2GAU A;  4PCQ A;  3WU1 B;  1VTN C;  1Z6R A;  2CQK A;  1OYW A;  3JSO A;  2L4M A;  3RPU A;  3JTH A;  5HDN A;  1HXD A;  3HHG A;  5CVJ A;  2VBZ A;  1UCR A;  1IXC A;  1FC3 A;  3R60 A;  3NQO A;  4Q48 A;  4WK8 F;  3M8E A;  1RZ4 A;  5JVT A;  4FX4 A;  4UVB A;  4Q4Z F;  2MD5 A;  5CVI A;  4A0Y A;  2HTJ A;  2F5C A;  2VT3 A;  4UUV A;  2VBX A;  1YW7 A;  3FMR A;  1S7A A;  3BOQ A;  1RNL A;  1EH8 A;  4BHB A;  3TO6 A;  1MD0 A;  4CIC A;  4LMY A;  2VN2 A;  2FEZ A;  1U5T A;  5CJ9 A;  1NHA A;  1KU7 A;  3ECH A;  3JAM Z;  3GFJ A;  2BV6 A;  3EQL F;  1ULY A;  3KP3 A;  5F6F A;  2AXL A;  4WF2 A;  4RB1 A;  2VOP A;  2OQR A;  3LA3 A;  4RB3 C;  2WC2 A;  3KP2 A;  2IT0 A;  1SFU A;  3J81 Z;  2Q2E A;  1W5T A;  5LHG A;  5F1R A;  1R5H A;  2O6G E;  1R23 A;  2PMH A;  5DYM A;  1DUX C;  2PLY A;  3ECO A;  3TOA A;  1H9T A;  4I2O A;  2DTR A;  3T0Y A;  4A12 A;  5AON A;  2DK5 A;  3WG9 A;  4HF2 A;  4BH9 A;  3CLO A;  3R6S A;  3K1M A;  2DQR A;  2ZO4 A;  1K78 A;  1WRJ A;  3L7W A;  4U7B A;  2JRT A;  1S6L A;  3M1E A;  1J9I A;  4HV5 A;  5LEK A;  1H9G A;  4XSZ F;  5HLI A;  2VT2 A;  3MAJ A;  4IRH A;  4HLX A;  3L00 A;  1T0F A;  2D1H A;  3IWZ A;  1O3S A;  4KMF A;  3RIR A;  1RUN A;  3V7R A;  3R0A A;  1TQP A;  1P4X A;  3F3X A;  3QP5 A;  1I1G A;  2QM3 A;  5BPI A;  2OA4 A;  2GA2 A;  1XN7 A;  5EEH A;  1P4A A;  2E1N A;  2FRH A;  3WGG A;  2TDX A;  3H3Z A;  5DEQ A;  2QBY B;  3GFI A;  4BHP A;  2HOE A;  4G7Z F;  1ON1 A;  2VXZ A;  1HBX G;  2CW0 F;  1ONV A;  4L18 B;  1F4K A;  1ZLK A;  2DAO A;  3WU0 A;  4LB6 B;  4EM1 A;  2L02 A;  3HSR A;  2PBI A;  4A6E A;  3WTY C;  4G6D A;  1XGN A;  1UST A;  1K6O A;  3R4K A;  3QOP A;  5K1Y A;  1Z91 A;  3RPQ A;  2UWM A;  3T8T A;  1AWC A;  5FLX K;  2DO7 A;  4KT5 C;  1IXS B;  2JPC A;  2ACJ A;  4EJO A;  5LHH A;  1S29 A;  2CYY A;  3F21 A;  3O3K A;  5FFZ A;  4ESF A;  2NAZ A;  2QQ9 A;  3P9I A;  5BQT A;  2LKP A;  5DD4 A;  4WWC A;  3JSP A;  5H6R A;  3QU6 A;  1YIO A;  3ISP A;  4I0A A;  3B73 A;  4L9V A;  2EK5 A;  1BOA A;  3W6K B;  3LA7 A;  4MQV A;  3F6V A;  3G73 A;  5DV5 A;  2R7F A;  5TJJ A;  2OQG A;  3ZQ7 A;  1ZYR F;  2A3S A;  1P2F A;  1HKT A;  2IA1 A;  1YFH A;  5J8F A;  1HSJ A;  4H0E A;  4K2E A;  1BIB A;  4L9T A;  1W5S A;  2CGP A;  4RGU A;  4ZYE A;  1FYM A;  1XCB A;  3HTU A;  1G3W A;  1SMY F;  3T8R A;  3CTA A;  4ZH4 F;  4LLG F;  1KYW A;  5FFX A;  3WOD F;  2ZCW A;  1I27 A;  3F8C A;  4HQE A;  1O7F A;  2DW4 A;  3KEO A;  4MQ9 F;  3TGN A;  1BIA A;  2P6T A;  2G7H A;  2HR3 A;  1MJB A;  2P4W A;  2O03 A;  2LF8 A;  4HX7 A;  2FQ3 A;  1CF7 A;  5KVR A;  1XGS A;  2XRN A;  2XAH A;  4KIG A;  1ZN2 A;  2OZ6 A;  3DPT A;  3GYH X;  4OMZ A;  2FNA A;  4N0B A;  3WTT C;  5A2Q Z;  2HTS A;  3GO5 A;  1IN5 A;  4FHT A;  2RVC A;  3GLX A;  2MA3 A;  5FGM A;  5D6F A;  2PMU A;  3KP6 A;  5KK1 A;  1HW2 A;  3MWM A;  5BMZ A;  2JT1 A;  2KKO A;  1LEA A;  4P55 A;  3F22 A;  1FBU A;  2GXG A;  5IT3 A;  3TQN A;  3FM5 A;  2KRF A;  3I71 A;  3O6B B;  2E7X A;  2G9W A;  3HOS A;  2FA5 A;  4G6Q A;  5DCF A;  2DBB A;  1FY7 A;  1ZG5 A;  2RV8 A;  1O57 A;  1R1V A;  4A2U A;  3I64 A;  1FSH A;  5CVV A;  2F5D A;  5HDK A;  1ZRE A;  4LK1 F;  2DQL A;  2ESH A;  3C18 A;  2IVM A;  1BC8 C;  5L3G A;  3WGH A;  3IC7 A;  2X4H A;  4P5O A;  1R36 A;  2EV5 A;  1LDK B;  4WXD A;  2NNN A;  1IN6 A;  4O6J A;  3KZZ A;  3ZMS A;  2HKX A;  2K4B A;  1BC7 C;  2M5W A;  2EB7 A;  2HDC A;  1W7P A;  2EA4 A;  5E17 F;  3F23 A;  1HST A;  1KYZ A;  4OMY A;  3FMS A;  5FB2 A;  1PUE E;  2DFI A;  4KUM A;  5ILS A;  2EFP A;  3Q5F A;  2YSR A;  1ZLJ A;  1U78 A;  2A68 F;  2XV4 S;  4BQA A;  3RYP A;  2M87 A;  1B4A A;  4LLN A;  4EVI A;  3LAJ A;  1UHM A;  3GVA A;  1YO5 C;  3HSE A;  3L2C A;  1FZP B;  4JQF A;  4U0V A;  4Q5S F;  5DD8 A;  1YW8 A;  4L9J A;  2HKO A;  1XMA A;  1HKQ A;  3NRV A;  5DCM B;  2W57 A;  1XDS A;  5CYV A;  1D3Y A;  3KZY A;  4I0B A;  1ZGJ A;  2A69 F;  2LSO A;  3C3W A;  5IT9 Z;  2P8T A;  1DP7 P;  1R00 A;  3CO6 C;  5F64 A;  1Z6T A;  4CZZ A;  3J80 Z;  4MEY F;  4LG0 B;  3KE2 A;  4HZF A;  4HX4 A;  1ZHF A;  2V6C A;  2HEO A;  4P96 A;  4EMS A;  1MDM A;  4U0Y A;  1U8R A;  4WCG A;  4IXA A;  2VOD A;  2HFH A;  1MZB A;  4KNY A;  4FX0 A;  3FWE A;  1P4W A;  4DNC A;  1YG2 A;  4B8X A;  1T2K A;  2JZY A;  4GYG A;  1SD6 A;  4KIF A;  4M9Z A;  2GIV A;  3OV8 A;  3G3Z A;  4MTE A;  2NS0 A;  3CJN A;  3CUQ A;  2L01 A;  2IPQ X;  4A0X A;  3I53 A;  3MZY A;  5D4S A;  3GFL A;  4OU0 A;  3SHF A;  4IJA A;  3CUQ B;  5L3F A;  4IHT A;  1WWX A;  2FOK A;  1IN4 A;  2NNY A;  1YLF A;  1YW9 A;  2P5K A;  3FXR A;  4OIO F;  3DQV C;  1SAX A;  5ICC A;  2ESN A;  2FF4 A;  4EJU A;  4AIJ A;  2MBF A;  1KU3 A;  2DLL A;  2KJC A;  1I1S A;  1GXQ A;  1WQ2 A;  2M30 A;  3NEU A;  2VOO A;  3LST A;  4ENN A;  4IF4 A;  1RUO A;  1U5T B;  3I4P A;  4CXF A;  2CG4 A;  3RTR A;  1STZ A;  2D45 A;  2QQB A;  4ENK A;  4CHU A;  4N9H A;  2DI3 A;  5E18 F;  4ENM A;  2XKO A;  3ZP5 A;  2FBI A;  1G4D A;  4AIK A;  5HS7 A;  4HW0 A;  1QZY A;  3IWF A;  2FBH A;  4G8X A;  4S05 A;  5D5U B;  2MH2 A;  3VOD A;  4EJT A;  1K7A A;  5E1W A;  1FBS A;  4L0Z B;  2GA1 A;  1XSX A;  4OIR F;  1EH6 A;  1FPQ A;  1TBX A;  4UV8 A;  1FNN A;  2WV0 A;  4XLN F;  1Z1D A;  5HLG A;  2DPU A;  1I5Z A;  2PEX A;  2HYG D;  2RC4 A;  2XIG A;  3C7J A;  1R58 A;  4PZJ A;  4LFU A;  5HLH A;  2EV6 A;  4FT8 A;  1KA8 A;  1K78 B;  2D1V A;  1J7K A;  2Z33 A;  2L4A A;  2VE8 A;  1HW5 A;  3ULQ B;  3GUD A;  2MH9 A;  4WX9 A;  5ICG A;  2DU9 A;  3TO9 A;  3QRF F;  4ASN A;  3V8J A;  2V9V A;  4XRF A;  1OYY A;  4NB5 A;  4I09 A;  3DFG A;  1ODD A;  2PQ8 A; 
#chains in the Genus database with same CATH topology
 3I59 A;  4BGD A;  1LFU P;  3CP2 A;  3K70 D;  4M73 A;  1KU2 A;  1U6G A;  2BE5 F;  3ABK H;  4L5I A;  2XUB A;  1A04 A;  1ORK A;  3CO7 C;  5K5Q A;  1CQT A;  3FKJ A;  4CDG A;  4RAZ A;  3OYF A;  2LVS A;  3I59 B;  3AG4 H;  3IH4 A;  3TOB A;  2X1E A;  1G2H A;  5D6E A;  4BBR J;  1Y0U A;  3D5S C;  1PUF A;  4MFD A;  2DXI A;  4BY1 J;  4ON0 A;  1VQN I;  4EM0 B;  1S7E A;  3IL2 A;  3FXQ A;  4WXC A;  1XDU A;  5D5X B;  2R7Z J;  3P7N A;  2LKS A;  2IA0 A;  3A01 A;  2V1D A;  1T33 A;  4M3F A;  4MIM A;  2XKP A;  4CCK A;  2D2W A;  3KP7 A;  4JP0 A;  4GO1 A;  2PMZ A;  2QEN A;  2EZI A;  1WGX A;  1BN5 A;  4BDZ A;  3EDP A;  3RCO A;  3KX2 A;  3D1N I;  4RGR A;  3U1D A;  1FP2 A;  3ZGK A;  2VUM J;  2G0E A;  1OYI A;  2DFH A;  2A5Y B;  1K4T A;  3OWT A;  1ETK A;  4LOC A;  1L3L A;  3DEU A;  1WH5 A;  4F91 B;  5K5O A;  2N8G A;  1DDN A;  5EG0 A;  3E5X A;  1EH7 A;  5DUK A;  4HSR A;  1S9H A;  2X1D A;  3EYY A;  3OIP A;  1TQM A;  2CV2 A;  1IG7 A;  3S93 A;  2H6B A;  5L3D A;  2M0M A;  4EJV A;  2NVU B;  3HRS A;  3RI4 A;  5FO5 A;  2CSO A;  2ECB A;  3OOP A;  4AUX A;  5L3E A;  3ZMT A;  2I8D A;  3IAM 2;  2COM A;  2CQQ A;  5CVR A;  3PO2 J;  2VQC A;  4BYY A;  2E60 A;  3ZMZ A;  4BAC A;  1FOY A;  1PP7 U;  3KCC A;  3I5U A;  4II2 A;  3AFH A;  4IHX A;  2LC2 A;  1B1B A;  1XCV A;  1YIJ I;  4S04 A;  2M3A A;  1FOW A;  1HCR A;  2JA6 J;  3DKW A;  2KRH A;  4GCV A;  2DYR H;  1EKE A;  5E8G A;  3GCM A;  4GXO A;  4U0W A;  1T0F C;  1P9Q C;  2PG4 A;  3TO7 A;  1R22 A;  3C2G A;  1QPM A;  2WB1 A;  2AS5 F;  4TV7 A;  4LJZ F;  5FD5 A;  1X3U A;  4HF0 A;  4Y7N J;  4FQG A;  3KP4 A;  2QYO A;  1BR1 A;  5GAD J;  1IJW C;  3TKY A;  4X6A J;  2K86 A;  3G1L A;  5AIP A;  3TDU C;  3E6M A;  3FXJ A;  4A93 J;  4MGR A;  4AYB N;  2PJR B;  5D8L B;  5B66 C;  1FMW A;  3JRG A;  3QQA A;  1GVD A;  1RI7 A;  2K3F A;  4B1R A;  1MW7 A;  3ZN1 A;  4M3G A;  3ABU A;  2FSW A;  1RES A;  2OV7 A;  1RR7 A;  1S3J A;  2V1X A;  5ERI A;  4YII A;  3EPZ A;  3HRU A;  3K4K A;  1TWH J;  2ME0 A;  4YIF A;  3RZO J;  3BPV A;  4CYD A;  2OBP A;  5C4J J;  3W3C A;  2HQN A;  4CUG A;  4XR6 A;  3MEX A;  4RB0 A;  4ZTJ A;  4JK1 X;  1LVK A;  4RGS A;  1DU6 A;  1JE8 A;  1ETQ A;  5GPA A;  5DUI A;  1R1T A;  1T38 A;  3HRT A;  3K9T A;  1ZH5 A;  1MJ9 A;  3EUH C;  1KZH A;  3FHZ A;  1JKR C;  1OCO H;  2WTE A;  5E1Z B;  2GXA A;  4HDV A;  3QPL A;  3ERE D;  3VYT B;  3KLO A;  5GAE J;  3I54 A;  5JI6 A;  2QCO A;  1VQ5 I;  3KFW X;  3JRA A;  1KU9 A;  4N4O B;  1LEB A;  3WHC A;  1YOV B;  3OYH A;  3K70 C;  3WTU C;  2KIF A;  3LSM A;  2HQ5 A;  3V8K A;  4D0P A;  1KQ8 A;  3H9Q A;  3OYA A;  5EZG A;  2W82 A;  2W4S A;  4A3E J;  4HQM A;  4QSH A;  3MD2 A;  1KON A;  1E17 A;  3LL7 A;  4D7M A;  2Z99 A;  4Y3O A;  2Z5U A;  3WGI A;  1IF1 A;  2XPW A;  4ZDL A;  2IJL A;  5DTD A;  5IOY A;  1T98 A;  3SZP A;  5B1A H;  2QSG X;  1Y1W J;  3VWB A;  2MLK A;  3MKY B;  4YG2 F;  4IHY A;  4BJT A;  1FOK A;  2DA3 A;  5J1U A;  2J5O A;  2XGX A;  4EQQ A;  1SFE A;  1W4M A;  5H6Q A;  1CF7 B;  2ELK A;  4W97 A;  4AIH A;  4OIQ F;  1OMI A;  2A05 A;  1FP1 D;  2FU4 A;  4HST A;  2M7A A;  1KGS A;  4OIN F;  4DZP A;  3O8G A;  2P5V A;  2XAF A;  3FIW A;  2MC3 A;  1XSV A;  4ENJ A;  1GXP A;  3CCS I;  5FLX Z;  5EF6 A;  2Z2S B;  1BI0 A;  1QNT A;  3BZ6 A;  4KA4 A;  4HLY A;  2ELH A;  1VFC A;  2R7V A;  4N4N B;  4XLF A;  3HOZ J;  3LSR A;  3FF5 A;  4D1Q A;  2HS5 A;  2F4O B;  4QWQ A;  3WTX C;  2QKL B;  2ID3 A;  2XB5 A;  2MSY A;  2UUZ A;  3PFI A;  2QUF A;  4QLC U;  1Q1H A;  3S1M J;  1BW5 A;  5FD6 A;  3T1B A;  5K7F A;  3SFZ A;  2F2E A;  2DA1 A;  5JR3 A;  2BW3 A;  1MNM C;  1OKR A;  5BNG A;  4IPA A;  1UJ8 A;  1O3T A;  2CUE A;  3S3O A;  3IKV A;  4KN7 X;  3HJE A;  3UKG A;  1MJA A;  2OAZ A;  2W24 A;  4KDP A;  3H1C A;  3J7A O;  1O7L A;  1G8X A;  4KIT B;  4IO9 F;  3ZQL A;  4RAY A;  1SD4 A;  1KQ0 A;  2JA7 J;  2KIM A;  1YRN A;  3BDD A;  1WJA A;  2KL4 A;  1REP C;  3D5L A;  2F5V A;  3NWT A;  3LFK A;  2IGO A;  1JXS A;  1SAN A;  3E5U A;  2HQR A;  2QGU A;  1LFB A;  1OLT A;  2Z1D A;  2RDP A;  2XHK A;  3BY6 A;  1W7P D;  2CH0 A;  2FQ4 A;  2EIK H;  3M4O J;  1HDD C;  3DTK A;  1ZTR A;  4A6D A;  2X85 A;  3CMM A;  3KP5 A;  4G12 A;  5HS9 A;  2KJB A;  1JKO C;  2QSH X;  4I02 A;  1UHW A;  3TW7 A;  1Y56 A;  4WXH A;  4Z2Y A;  2E1M C;  3CDH A;  1P6R A;  2L7K A;  3CME I;  3LOC A;  3C1D A;  4FE7 A;  1WPK A;  3K1P A;  4DZJ A;  3HRM A;  1BI3 A;  2KDO A;  4NHJ A;  1MNE A;  1ZKG A;  5J4Y A;  4YRV A;  2W1O A;  1IZ1 A;  3PQJ A;  1WJC A;  3QWL A;  4PJN A;  1XD7 A;  3I58 A;  3WTS C;  2E35 A;  2WA0 A;  1Z05 A;  2DDB A;  2R7X A;  2JA8 J;  3FBI B;  5CQE A;  1DGR M;  4PGG A;  3RKY A;  3AG3 H;  4YEJ A;  1Z9C A;  2LH9 A;  2X0L A;  4UNO A;  2M1B A;  2ADU A;  1TW3 A;  3QYB A;  2JUG A;  1BJZ A;  1J5Y A;  3ELK A;  2DPD A;  4Y17 A;  2Z16 A;  4CGZ A;  2E71 A;  4PDK A;  1TLH B;  3ROU A;  1V5G A;  2B7E A;  3BR2 A;  1W7P B;  1MBJ A;  3L9F A;  1QVT A;  1ON2 A;  1D8J A;  4O3M A;  3BLY A;  2LNB A;  1XB4 A;  3H3U A;  4M6Y A;  4RMN A;  5JHU A;  2H27 A;  3S8P A;  3S1Q J;  3DLL F;  1F9N A;  3MFK A;  4IVN A;  4G7H F;  3JTG A;  2JJ7 A;  2WAF A;  2R3S A;  1WI9 A;  2GZW A;  5LD2 C;  3ZQG A;  2JA2 A;  2PJP A;  1N78 A;  3KIO A;  1QQI A;  3KZI C;  2R4G A;  2EFN A;  4E7L A;  2EFQ A;  1TNS A;  2NRA C;  3K10 A;  4I76 A;  4A5M A;  1OR7 C;  2VQG A;  2BEO A;  3PUF A;  3DWL E;  3Q0U A;  5TIS C;  2IS4 A;  5IPA A;  4G7O F;  1QVU A;  4EV0 A;  1BJA A;  1BM9 A;  3JRC A;  2ZJQ F;  1QGP A;  4L0Y B;  4C3I J;  4YFN F;  2P5L C;  1XGM A;  4IHS A;  2X6W A;  2QEX I;  1FT9 A;  3VOE A;  3TW6 A;  2PN6 A;  5ED4 A;  1VQ4 I;  2XSJ C;  5LLQ A;  4EGZ A;  1SD5 A;  3IH3 A;  3B6C A;  4DGW B;  3W2A A;  2KQR A;  3JAM K;  1ZR4 A;  4P9F A;  5DS9 A;  1FIP A;  2OC6 A;  1U8B A;  1VQ8 I;  2HVQ A;  5HS8 A;  4I7H A;  1D0Y A;  2TCT A;  3BG6 A;  3S2W A;  4Y52 J;  3ZMU A;  4BXU A;  4BAY A;  5LGU A;  2YX7 A;  2PX9 A;  4M71 A;  3GME A;  1BI2 A;  2ECC A;  3K0L A;  3P5J A;  1XMX A;  1I3Q J;  3J81 K;  2E7W A;  2V79 A;  2QA4 I;  2K7L A;  4EGY A;  5HNF A;  2QLZ A;  2ZBK A;  3MMY B;  2NS8 A;  2DA2 A;  4GGG A;  4PJM A;  3KYD B;  4BE2 A;  3REO A;  2NXN B;  3OS1 A;  5E3N A;  1V4R A;  3VSK A;  1R7J A;  3DV8 A;  1WSU A;  4N9I A;  4RGX A;  1I50 J;  2XAS A;  3Q9S A;  3V42 A;  4KN4 X;  1YTY A;  2Y75 A;  3W2V A;  4V19 K;  4BEH B;  3BJA A;  2WV1 A;  2VIX A;  2XVC A;  4II3 A;  1IRF A;  3WHB A;  1JHF A;  4M6X A;  2YR2 A;  1G3T A;  1Z7U A;  3E6B A;  3IP4 B;  2STT A;  2UXN A;  1B9N A;  1UFM A;  3H35 A;  3ZQI A;  2O9L A;  3SZT A;  1T56 A;  4B09 A;  3S16 J;  2VON A;  2RN7 A;  3DCF A;  2WAE A;  3FMQ A;  1J75 A;  3GF2 A;  1V3F A;  4XLE A;  1MDM B;  3PUB A;  4M72 A;  2EIN H;  1UAA A;  2BVM A;  1A5J A;  4UVC A;  2G7U A;  1LPQ A;  2D5V A;  2RKH A;  3QP6 A;  2BZT A;  2XAJ A;  4UXN A;  3F6O A;  4BDY A;  5M3F J;  3SZG A;  2K27 A;  3BJ6 A;  2STW A;  3CC4 I;  3LSK A;  1E0E A;  3DEE A;  2ZKZ A;  5JFR A;  3K4L A;  4IOC F;  2R7W A;  2RNJ A;  1JGS A;  2XAQ A;  1SMT A;  1XMK A;  1F43 A;  2R7U A;  4IRI A;  4JX4 A;  1ITY A;  1WZ2 A;  2K9N A;  4DYQ A;  5ICE A;  3AAF A;  2ZNZ A;  2Y69 H;  4ETS A;  3FKI J;  2K02 A;  3VEP A;  3S17 J;  2E2J J;  1M1E B;  2DT5 A;  2HPI A;  3FM3 A;  3GTP J;  2Q8K A;  3HEF A;  3LA2 A;  1ZRC A;  1T6S A;  2OUM A;  3PO3 J;  2WAD A;  2V9K A;  1L0O C;  3BG5 A;  4J01 A;  4AD9 A;  3QU3 A;  4NQW A;  3RJP A;  2ZSH B;  2GXB A;  3S1N J;  5EJC A;  1JTX A;  2A6H F;  2AO9 A;  2KRC A;  2ZJR F;  2ZXW H;  1LDJ A;  4FE4 A;  4LGW A;  4W1U A;  2PFB A;  3HGG A;  2AQE A;  3V4G A;  5IP6 A;  2ZFW A;  1R49 A;  3OYG A;  1SD7 A;  2GQQ A;  5BOX A;  1LJ9 A;  1IO2 A;  1JI8 A;  4CH7 A;  2K4J A;  4HBL A;  3RQI A;  4UUS A;  3HC7 A;  5LGN A;  1LUJ B;  2BGC A;  2ZME A;  3OIO A;  4XLP F;  2LOO A;  1ZQ3 P;  2CV1 A;  2LDU A;  2QQ8 A;  2RNG A;  3CCV I;  3DBR B;  2Y0M A;  3PIP F;  3DBH B;  2B0L A;  2LP0 A;  2XAG A;  3A2K A;  3GEZ A;  3HGY A;  1OFC X;  5HDG A;  2Y0S N;  2M45 A;  2ZME B;  4B3A A;  1UEL B;  5L3C A;  4RS8 A;  2XRO A;  1QPI A;  4ZYH A;  4DW6 A;  1QHH D;  1ZR2 A;  2E34 A;  3HXL A;  3SDG A;  3F8M A;  3K69 A;  1YS7 A;  5HNH A;  2EA2 A;  2KP6 A;  2Y30 A;  4Y15 A;  4IRG A;  4LG3 A;  2OZU A;  2NYX A;  3BR6 A;  3CJQ B;  3MQ0 A;  2WY7 Q;  3F8N A;  3RDI A;  1UMQ A;  1IRX A;  2Z9O A;  1AOY A;  2DJI A;  4E7H A;  3EYI A;  5E20 A;  1USS A;  5BS6 A;  4IQJ A;  1UB9 A;  1EV7 A;  3QPT A;  3S32 A;  5C4X J;  5EEA A;  3G1M A;  4DQ2 A;  3H36 A;  3GZN B;  1TT5 B;  3FZV A;  4XOT A;  2L9V A;  3BJO A;  2A5W A;  3RKW A;  2P7V B;  4ZDO A;  4HX8 A;  2A07 F;  3GZ6 A;  3M1C A;  3ZXS A;  5FKM A;  1ZG3 A;  1ZRD A;  1MMA A;  1MMN A;  5LEJ A;  2VBW A;  4FIS A;  3S1R J;  2DJN A;  3VYU B;  1XSD A;  4X0G A;  2V7F A;  3H3V K;  3E6D A;  4UB8 C;  3FXK A;  2DK8 A;  1BA5 A;  2LD5 A;  4HOB A;  3JR9 A;  2P0W A;  3RKX A;  2PMZ N;  1NH3 A;  2ZNY A;  3CDI A;  4NUB A;  2XC7 A;  1PVE A;  3HB9 A;  2JWT A;  3GZ5 A;  1VI0 A;  3CUQ C;  2GBY A;  1QRY A;  1EA3 A;  4NC8 A;  3LQR A;  2ZXJ A;  4B47 A;  3HTS B;  1JTY A;  3ABM H;  1K79 A;  2H1L A;  4E7S A;  3GFM A;  1FLI A;  1IRZ A;  1DPU A;  2DOF A;  2X9D A;  1LNW A;  2CUZ A;  2YPR A;  1ZGA A;  4KIC A;  2KIU A;  3UR3 C;  5TGT A;  5F27 A;  5H20 A;  5J8C A;  5F1J A;  4R8H A;  5JLW A;  4EAT A;  5L3B A;  4XBF A;  2M34 A;  2CO5 A;  1YJW I;  2HGC A;  4DYR A;  3IHU A;  1ZAR A;  3E97 A;  2W84 A;  4D9J A;  4ZJZ A;  4YEL A;  3N4M A;  3LAP A;  2EIL H;  3HSF A;  3BG3 A;  4MFE A;  5LRS A;  2CWE A;  2W85 A;  1K83 J;  1S72 I;  2IA2 A;  1F5T A;  3M8F A;  2IBD A;  3CJT B;  1QO0 D;  4BNC A;  2LYC A;  3S3M A;  1IDZ A;  4LK0 F;  5ILV A;  1T08 B;  3KYC B;  1FBQ A;  3HOT A;  3JRI A;  1AU7 A;  4EJW A;  5F0C A;  2LTP A;  2KPM A;  1U5T C;  3BTI A;  2E5Z A;  4KMU X;  1OCR H;  3ESW B;  4JOM A;  1PP8 F;  1N77 A;  2MGQ A;  2QBY A;  1N75 A;  1TQI A;  4IHW A;  1TTY A;  5EYR A;  2HQA A;  2FBK A;  2WB1 N;  3ZQF A;  3L2Q A;  2F4M B;  1MSE C;  4L5J A;  2QWW A;  3ZPL A;  1QBJ A;  2BYV E;  2ZFU A;  2CJJ A;  2C6Y A;  1E3O C;  1YJN I;  3K4C A;  1B6A A;  4BHC A;  3OL4 A;  4D5C A;  3E6C C;  4RDU A;  2IRF G;  1O3R A;  1PUF B;  4OOI A;  1R5I D;  3V8L A;  1TNT A;  1X3Z B;  1FSE A;  2RRE A;  5ICF A;  2H6C A;  5LGT A;  1U3E M;  3CES A;  3EUH A;  3A01 B;  2XF7 A;  3LQQ A;  2ZB9 A;  3L09 A;  4YFK F;  5TRD A;  1GHC A;  2VL8 A;  2YU3 A;  2A6E F;  2BXZ A;  3DP7 A;  3H5A A;  3CLQ A;  2DMN A;  1JUM A;  3L2W A;  2IGK A;  3GBG A;  2O3F A;  1WCM J;  2V9P A;  2BY0 A;  2H09 A;  2MW8 A;  5IOZ A;  5A2Q K;  1YX5 A;  4EM2 A;  3K4M A;  4CA0 A;  1YE9 A;  3P9C A;  1MH3 A;  3PNV A;  5CVU A;  3HYI A;  2BY3 A;  3ZMD A;  1UG0 A;  2GWR A;  2QZ8 A;  5GP9 A;  5EG0 B;  3ML6 A;  5F0F A;  2L9S A;  3JRH A;  3OYM A;  1VQO I;  3WTW C;  5EEG A;  5D8K B;  3ZN0 A;  2OCC H;  2VI6 A;  4BQQ A;  5FRN A;  1RPW A;  5J1Y A;  1YI2 I;  4NC6 A;  2KDZ A;  3Q9V A;  3TDZ C;  5HOO A;  3BRO A;  3LMM A;  1FYL A;  1LDD A;  2A61 A;  1R1U A;  4XKV A;  1LB2 A;  2H94 A;  3F72 A;  1D1B A;  1S8N A;  3N97 A;  4AM3 A;  2XGE A;  1OCP A;  4UV9 A;  3GX4 X;  3NAU A;  4Y13 A;  5DM6 F;  5E1X A;  4A3M J;  3FXM A;  5IYB J;  4AVP A;  3KEQ A;  1VQ7 I;  2K40 A;  3LWF A;  2BBY A;  4A0Z A;  3IKT A;  2JRM A;  2XF6 A;  1FX7 A;  1R4M B;  2L54 A;  2XAU A;  3ZQH A;  3PIO F;  3JRD A;  2LLK A;  1LVA A;  3M7G A;  2JN6 A;  3SXY A;  3WTV C;  5HVQ C;  1BW6 A;  2E2H J;  2ISY A;  1HQC A;  1IAW A;  5K7H A;  1X19 A;  3DBL B;  2FE3 A;  1B9M A;  4Q47 A;  3DKY A;  3K1N A;  2L0K A;  3WG7 H;  3OY9 A;  2JTV A;  4UVA A;  4F3Q A;  3OYN A;  2ISZ A;  1IN8 A;  1I6X A;  1JT0 A;  3OIQ A;  2Y9Y A;  3PQK A;  1FOX A;  3E0J B;  1WH7 A;  2V1U A;  2QVO A;  1HF0 A;  2O8X A;  3B02 A;  3OR1 C;  4O5V A;  3U21 A;  1E2X A;  1KQ9 A;  2VC0 A;  4ESJ A;  3R0J A;  3G4S I;  1FIA A;  3T5X A;  3VYS B;  5K5R A;  1IW7 F;  1PJR A;  1SVL A;  3G2B A;  3LFU A;  4MEX F;  1GUU A;  5D5V B;  4I98 B;  2UZK A;  1GV5 A;  1MMG A;  4L9N A;  2VQL A;  1JKP C;  3ZQC A;  3PNT A;  3HOU J;  4PFO A;  2HZT A;  3D0S A;  1DPR A;  3DEW A;  3QAH A;  4LIT A;  3RZD J;  1XS9 A;  1VQ9 I;  3BR0 A;  2JQ7 A;  5FLV A;  2M8E A;  3HIF A;  3ZOB A;  4LB5 A;  4M9S A;  4GDF A;  2M7B A;  3DF8 A;  4RM2 A;  2FXA A;  1T39 A;  3ABT A;  3DKX A;  4A3B J;  4BL0 B;  3MKZ A;  1F1Z A;  1WJF A;  3IAS 2;  2FJ1 A;  3CUO A;  4E70 A;  3M07 A;  2Q0O A;  2W25 A;  2HI3 A;  4ZC3 A;  1YJ9 I;  2VBY A;  1YQA A;  3JRF A;  3QOD A;  2KIQ A;  2FNP A;  3V7S A;  4A3G J;  1OPC A;  3P9K A;  4NBQ A;  2AXT C;  4OAY A;  3IH2 A;  4U7D A;  2QSF X;  2LY9 A;  1IUY A;  4CO8 A;  4KIS A;  4RLQ A;  4UY8 I;  3VFZ A;  2CFX A;  3PSF A;  2EV0 A;  4HAM A;  5JVG F;  4M3E A;  2VE9 A;  1C0W A;  1YX3 A;  1W36 D;  2KHM A;  2NVQ J;  1TW2 A;  2Y2Z A;  2MLG A;  1W0U A;  4HEA 2;  2Y31 A;  3I55 I;  2WAQ A;  2O61 A;  4LIU A;  3DPL C;  1GVJ A;  1LQ1 A;  4MHG A;  2AQF A;  2HWV A;  4LLL A;  3IRQ A;  2K9M A;  1XGO A;  3V7C A;  4CCM A;  1FEX A;  2FD5 A;  2DOA A;  2HDW A;  2KMU A;  1J59 A;  2YX4 A;  2JPB A;  3K2Z A;  4OIP F;  2EJR A;  6PAX A;  3E1S A;  4ZYD A;  2OD5 A;  3WE3 A;  4F93 B;  1RIO H;  3E7L A;  1OR7 A;  3W6J B;  2R7O A;  5KAI C;  5E79 C;  2FMY A;  4M9X A;  1MKM A;  4RAG A;  4R1H A;  2EBI A;  4E7Z A;  2P7C B;  1BI1 A;  2EFO A;  3A02 A;  1SC7 A;  2H8W A;  1Q1V A;  1G6N A;  2O0Y A;  5BPD A;  1SFX A;  2VC1 A;  2RGV A;  4RA2 A;  4DYC A;  1D8K A;  1S7O A;  3OYD A;  5M5W J;  2HPM A;  2R5Y A;  2HYF A;  3K2A A;  1WVR A;  3CP8 A;  3GLL A;  4BQN A;  1YHQ I;  2P6S A;  5C3E J;  2K9Q A;  4CYC A;  2BW3 B;  1QU3 A;  1AHD P;  4IL6 C;  4XOP A;  1J2X A;  1IXR C;  1IN7 A;  1ZGW A;  4IOA F;  3HUG A;  1GV2 A;  2F5E A;  5IT9 K;  3DXJ F;  1R9T J;  4XSX F;  1B72 A;  2W48 A;  3FXU A;  2F48 A;  3C2H A;  4DBQ A;  1T8I A;  1ZAO A;  4C3H J;  4PJ0 C;  1A31 A;  3CMY A;  3WE2 A;  4CYC B;  2J5P A;  1YRN B;  2JSC A;  1LE8 A;  4XLA A;  1OIS A;  1FYK A;  3K4B A;  4R79 A;  1O4X A;  2IP2 A;  3J80 K;  4U88 A;  1ZEL A;  2PI0 A;  1N25 A;  3GXO A;  1B72 B;  1X2M A;  1XC5 A;  2CW8 A;  3H9G A;  4XLH A;  3SQN A;  1TC3 C;  4KFC A;  5K7Z A;  4XN0 A;  4AU7 A;  1DGW Y;  2XGD A;  4RB2 C;  1NG6 A;  2Z3Y A;  5ILU A;  3KET A;  4HNV A;  4AC0 A;  2LMD A;  2FML A;  4RAF A;  3SEQ A;  4FCY A;  1J0R A;  4JYK A;  2VPR A;  2IW5 A;  2WWY A;  4YFX F;  3J7Y J;  4BXX J;  1D5V A;  4JX6 A;  3TP0 A;  1W1W E;  2X51 A;  4HNU A;  2BXY A;  4AWX B;  3WU2 C;  4HNT A;  5D5W B;  1CGP A;  1VND A;  3CZ6 A;  2X1C A;  2EFW A;  4E7I A;  4XON A;  1ZRF A;  5J47 A;  4ZYG A;  1JGG A;  2MAB A;  2XRL A;  1ZG1 A;  4HA8 A;  1G59 A;  3GTL J;  1B59 A;  2BOL A;  2L9R A;  4QIW N;  4PGH A;  3F8B A;  4BY7 J;  3PNY A;  1HW1 A;  3U2R A;  1SFO J;  3S15 J;  4M74 A;  2CU7 A;  4IHV A;  4DJA A;  3QPH A;  3Q0V A;  1YS6 A;  3MZH A;  2OU2 A;  2A6T A;  2NVY J;  2M0C A;  3J7Z I;  3IRR A;  3GTJ J;  3GW2 A;  3KLN A;  2AHQ A;  4G6T B;  4P9U A;  4IKF A;  2QQA A;  1QA6 A;  2VKV A;  4DIQ A;  1VQM I;  3FX3 A;  1Y8R B;  5J6X A;  3QPS A;  1HKS A;  1QZZ A;  2W7N A;  4UHT A;  4QTR A;  4I01 A;  2R7R A;  2IXS A;  3OYI A;  1X4P A;  1BBY A;  1U9N A;  2JK3 A;  4M3B A;  5LRR A;  4MO7 A;  3E5Q A;  4ZZD A;  3HOX J;  4CSW A;  2LBF A;  3FHN A;  4BUP A;  3BPX A;  3H92 A;  3ZMV A;  1G3S A;  4HDU A;  2Y48 A;  5E8I A;  1MH4 A;  2LRD A;  3VB2 A;  4ESB A;  1JHH A;  1FWZ A;  3AG1 H;  3EET A;  1O3Q A;  4HF1 A;  2ZJ2 A;  4I6Z A;  1FTT A;  4HV6 A;  1YYV A;  2JVG A;  4A5N A;  2LBF B;  4JBA A;  3JRB A;  3M9A A;  4GYI A;  2BY1 A;  1V5E A;  3ERM A;  4J19 A;  3R61 A;  2F5F A;  3CCM I;  3HPG A;  1X1A A;  2RQP A;  1R5G A;  3BWG A;  2E1C A;  2L3D A;  5DCM A;  1PDN C;  1UHS A;  5LHI A;  2NVT J;  4G9Y A;  2R5Z A;  3F8F A;  5C44 J;  2LF7 A;  4MNU A;  4ZZL A;  3MCZ A;  3BG9 A;  1U9O A;  1R6R A;  2M4K A;  4EEF G;  1IV6 A;  1G3Y A;  3BP8 A;  1Z21 A;  2ZXH A;  3JW4 A;  4V2F A;  1IRG A;  4KYW A;  1MMS A;  3I0T A;  3I3L A;  3DTI A;  2EWN A;  3GWZ A;  2R5Z B;  5LBQ A;  4BE0 A;  1YIT I;  2LFB A;  1Y0N A;  2VJJ A;  3BR3 A;  5CLS A;  4F7Z A;  5E3O A;  3O2P E;  5D4R A;  2ETH A;  1X58 A;  2LRE A;  2L2O A;  2VJI A;  3EUA A;  1IDY A;  2F4I A;  2DMP A;  3E3V A;  4LD5 A;  5IP9 J;  4A3C J;  4LG0 A;  3FK6 A;  2EIM H;  1WKM A;  3OSG A;  4G94 A;  4BXF A;  4AID A;  3AL0 B;  2VXD A;  4DOZ A;  2OJE D;  3COA C;  2UXX A;  1B8I A;  1H0M A;  5DDG A;  4MTD A;  1U2W A;  2JVH A;  2R7D A;  3HHH A;  3HZJ A;  4F55 A;  3AG2 H;  4KIB A;  1XPX A;  1ETW A;  3K7A J;  4XKW A;  4HYE A;  1B8I B;  2B63 J;  1P92 A;  3WTZ A;  1TWA J;  4BBS J;  1MGT A;  3VPR A;  3U9G A;  5GAH J;  3RYR A;  1AKH A;  5AIQ A;  2GAU A;  4PCQ A;  2DOD A;  3BCB A;  4A3J J;  1VQ6 I;  3WU1 B;  5M5Y J;  1VTN C;  1SVO A;  1Z6R A;  2CQK A;  1OYW A;  2MFZ A;  1Z67 A;  1RKT A;  3JSO A;  3GTG J;  2CUF A;  1Y39 A;  2L4M A;  3CF2 A;  3RPU A;  3JTH A;  4C2T A;  5HDN A;  1HXD A;  3HHG A;  3HBL A;  3OOU A;  5CVJ A;  2E1O A;  4J00 A;  1ACI A;  2VBZ A;  1UCR A;  1IXC A;  1FC3 A;  5KCM A;  1TL8 A;  3BG7 A;  3R60 A;  2R7Q A;  3NQO A;  4Q48 A;  5J1R A;  4WK8 F;  3H0D A;  3M8E A;  1J09 A;  1RZ4 A;  3DPU A;  5JVT A;  2VAS A;  4FX4 A;  4PJL A;  4UVB A;  4ANJ A;  4Q4Z F;  2ICW G;  2MD5 A;  5CVI A;  4A0Y A;  2HXI A;  3FDY A;  2HTJ A;  2F5C A;  1JJ8 C;  2VT3 A;  1WHU A;  1A35 A;  2CFO A;  4UUV A;  4NQW B;  2VBX A;  1YW7 A;  4XL9 A;  1U0J A;  3FMR A;  2V26 A;  2L7F P;  3G6E I;  1S7A A;  3SJM A;  5GTI C;  1VQK I;  1HOM A;  3OYE A;  3BOQ A;  1A6Q A;  1RNL A;  1EH8 A;  4BHB A;  3TO6 A;  2LKX A;  3CD6 I;  2QKM B;  1MD0 A;  1VQL I;  2CW7 A;  5E3M A;  4CIC A;  2CQN A;  3L1P A;  2M9H A;  3DTE A;  4LMY A;  2VN2 A;  4XN3 A;  2FEZ A;  1U5T A;  5CJ9 A;  5E3L A;  2DMU A;  4UUS B;  2LG4 A;  1NHA A;  5B1B H;  1XTA A;  4A3K J;  1KU7 A;  1IUF A;  4A69 C;  3TED A;  3ECH A;  5FKK A;  3JAM Z;  3GFJ A;  2BV6 A;  3JRE A;  2HOA A;  3EQL F;  5GAG J;  2MYS A;  4LIV A;  3VDX A;  1ULY A;  3KP3 A;  5F6F A;  1X1P A;  2AXL A;  4WF2 A;  4RB1 A;  3FK7 A;  2VOP A;  2COB A;  2OQR A;  3LA3 A;  5B3S H;  4RB3 C;  1POG A;  3BT9 A;  1V54 H;  2WC2 A;  5EGO A;  3OYK A;  3KP2 A;  2IT0 A;  3CCR I;  3OYC A;  1SFU A;  5GPC A;  3J81 Z;  2Q2E A;  4BE1 A;  1RC9 A;  2VJ5 A;  1W5T A;  3I9V 2;  5LHG A;  5F1R A;  2JUC A;  1FTZ A;  2E19 A;  1R5H A;  2O6G E;  2DA6 A;  1R23 A;  3MN2 A;  1FMV A;  2PMH A;  2O5R A;  2GOX B;  5DYM A;  1DUX C;  3OL3 A;  2PLY A;  5FLM J;  1FJL A;  2YUS A;  1NK2 P;  3ZRG A;  3ECO A;  4BU2 A;  2X6O A;  4PK4 A;  2ZSI B;  3TOA A;  1VQP I;  2EZK A;  3H0G J;  4FAS D;  1H9T A;  4I2O A;  2O7O A;  5B5E C;  3C2B A;  2DTR A;  3T0Y A;  4A12 A;  2IEK A;  4B44 A;  5GTH C;  4GFB A;  2I10 A;  4ZYA A;  5AON A;  3I56 I;  2CV0 A;  2VKD A;  2DK5 A;  1Y1V J;  2ID6 A;  3WG9 A;  4QPO A;  1RR8 C;  4HF2 A;  3RQ4 A;  1QHG A;  1MND A;  1HLV A;  4BH9 A;  1Z3Y A;  3CLO A;  3KYL A;  4C9Y A;  3R6S A;  3K1M A;  5JHF A;  1R4N B;  2M8G X;  1IV8 A;  2DQR A;  2ZO4 A;  1K78 A;  1WRJ A;  3L7W A;  3Q0W A;  2JRT A;  4M3D A;  4U7B A;  2R0Q C;  1S6L A;  1X4O A;  2FUG 2;  3M1E A;  1J9I A;  4HV5 A;  4Y4R A;  5DM7 F;  3W2W A;  5LEK A;  4HRI A;  1H9G A;  1JUS A;  2HNH A;  4XSZ F;  5HLI A;  4YIR X;  3CCJ I;  3W6V A;  1MBE A;  2CUJ A;  1E3P A;  2VT2 A;  3MAJ A;  1ZK8 A;  4IRH A;  4HLX A;  3L00 A;  1WI3 A;  1QZE A;  1D1A A;  1T0F A;  2D1H A;  2HVR A;  3IWZ A;  1O3S A;  1Y8Q B;  2BHZ A;  4KMF A;  3RIR A;  1RUN A;  3V7R A;  1HDP A;  3R0A A;  2OTL I;  1TQP A;  4PUS A;  3HKZ A;  1T95 A;  1P4X A;  3F3X A;  3QP5 A;  3OR2 C;  1I1G A;  2QM3 A;  3HOY J;  3K4J A;  2ZJP F;  5BPI A;  2OA4 A;  1AA7 A;  3OYL A;  2GA2 A;  1XN7 A;  4BS9 A;  5EEH A;  1P4A A;  2E1N A;  2FRH A;  3D5R C;  4PJJ A;  2TDX A;  3WGG A;  5EDN A;  2MG4 A;  2ZME C;  3H3Z A;  3TL4 X;  2MD0 A;  3VYR B;  5DEQ A;  2QBY B;  3GFI A;  4BHP A;  2HOE A;  4G7Z F;  3S2H J;  1ON1 A;  2EZH A;  2VXZ A;  5FKL A;  1HBX G;  3BZK A;  2CW0 F;  4XKC A;  1ONV A;  4L18 B;  4IQ4 A;  2W00 A;  3CCL I;  1F4K A;  1ZLK A;  2DAO A;  3WU0 A;  4LB6 B;  4EM1 A;  3LSG A;  2L02 A;  3HSR A;  3BCA A;  3KEY A;  1RKW A;  2PBI A;  4A6E A;  3WTY C;  3K6G A;  4G6D A;  1XGN A;  2NOG A;  2VB6 A;  1UST A;  2CS3 A;  2HZD A;  1K6O A;  1JKQ C;  3GTM J;  3R4K A;  1D5Y A;  4IEJ A;  2DCE A;  5H2F C;  2DTZ A;  2OF7 A;  1H89 C;  3QOP A;  5J3L A;  3QOE A;  3UNG C;  4XK4 A;  1Z91 A;  3CCY A;  3RPQ A;  4CCN A;  5K1Y A;  2UWM A;  3BQZ A;  3CCQ I;  3T8T A;  3BR5 A;  1AWC A;  1I39 A;  5FLX K;  4QPQ A;  2DO7 A;  1EJ9 A;  4KT5 C;  3LNQ A;  1IXS B;  2JPC A;  2ACJ A;  4XMY A;  4EJO A;  2OPT A;  5LHH A;  1S29 A;  1P7I A;  2CYY A;  4S0H B;  5HOD A;  3F21 A;  3CC2 I;  3O3K A;  2CMP A;  2XF5 A;  5FFZ A;  4ESF A;  2NAZ A;  1EF4 A;  2QQ9 A;  2HOS A;  4ITV A;  3P9I A;  2IS1 A;  5BQT A;  3PFY A;  4A3I J;  2LKP A;  5DD4 A;  4A3L J;  3OMY A;  4WWC A;  3HG9 A;  3JSP A;  5H6R A;  3QU6 A;  4BJ5 C;  4XRM A;  1YIO A;  3ISP A;  4I0A A;  3B73 A;  4L9V A;  3O8H A;  2EK5 A;  1BOA A;  3W6K B;  2WAQ N;  3LA7 A;  4MQV A;  3F6V A;  2B9S A;  2HOT A;  2KZV A;  3G73 A;  1SVM A;  3TP3 A;  1OCC H;  5DV5 A;  2XPU A;  2R7F A;  5TJJ A;  2LR8 A;  2OQG A;  1ETX A;  3ZQ7 A;  1ZYR F;  2HXO A;  2A3S A;  1P2F A;  2PJR A;  1HKT A;  2BY2 A;  2IA1 A;  1YFH A;  2EIJ H;  1VZ0 A;  4U87 A;  5J8F A;  1ETV A;  1HSJ A;  4H0E A;  2LY2 A;  4K2E A;  1BIB A;  1DU0 A;  4L9T A;  1W5S A;  1TWF J;  2DDA A;  4OAZ A;  2CGP A;  4RGU A;  3RSN A;  1D0Z A;  2KZG A;  4ZYE A;  2VJ4 A;  1X1C A;  2XGC A;  4XNF A;  1FYM A;  1R71 A;  1XCB A;  3HTU A;  1UZC A;  1G3W A;  3VSL A;  1MBF A;  1SMY F;  3T8R A;  2DT7 B;  2JMW A;  2IS6 A;  2DOE A;  2VLA A;  3CTA A;  3G1O A;  4DBR A;  4ZH4 F;  4LLG F;  1KYW A;  2WY8 Q;  5FFX A;  3WOD F;  2DA5 A;  2ZCW A;  2Y9Z A;  3GTQ J;  1I27 A;  2X6X A;  3SFI A;  3F8C A;  4HQE A;  1JUP A;  1O7F A;  2OCE A;  2P81 A;  2DW4 A;  2LK2 A;  3KEO A;  3I4M J;  2V4J C;  4HPQ A;  2E1M B;  3ZCO A;  4MQ9 F;  1Y6I A;  3TGN A;  1BIA A;  3MKL A;  4PSW A;  2P6T A;  2G7H A;  2XPV A;  1APL C;  1WFX A;  3G71 I;  1K61 A;  4NDL A;  2L5Q A;  2HR3 A;  4F92 B;  3NWS A;  1MJB A;  5J40 A;  5CPR B;  4E7J A;  1XX5 A;  2P4W A;  3DU5 A;  4CCL A;  1K6Y A;  2O03 A;  3OS2 A;  4C2M J;  2LF8 A;  3X2Q H;  4HX7 A;  2FQ3 A;  1CF7 A;  5KVR A;  4A3D J;  5CKT A;  1XGS A;  2DA7 A;  2XRN A;  4MLO A;  4XRS G;  1BR4 A;  2XAH A;  4KIG A;  2EPF A;  1ZN2 A;  2OZ6 A;  3DPT A;  3GYH X;  4OMZ A;  4BKX A;  2IAI A;  3ASO H;  3HPH A;  2FNA A;  3CCE I;  1A36 A;  4N0B A;  3WTT C;  1PYV A;  5A2Q Z;  1TWC J;  2HTS A;  2RAE A;  4M6V A;  4E4H A;  3GO5 A;  4F52 A;  3M8J A;  3MKW B;  2DFF A;  2DFE A;  1IN5 A;  2WBM A;  4FHT A;  2RVC A;  3TMO A;  3GLX A;  4AYB A;  1NK3 P;  2MA3 A;  5FGM A;  5D6F A;  3QYE A;  2PMU A;  4XOR A;  3BQY A;  4E6K G;  3KP6 A;  5KK1 A;  1HW2 A;  3MWM A;  2VKH A;  4KT6 A;  1V5F A;  5BMZ A;  1ETO A;  3U1K A;  2JT1 A;  1Z0X A;  1BOB A;  2KKO A;  3HL2 A;  3JCU C;  4B4C A;  2CQX A;  1LEA A;  4P55 A;  5LFA A;  3GTO J;  3F22 A;  2E36 A;  3CQZ J;  1FBU A;  2GXG A;  5IT3 A;  3FIS A;  3TQN A;  3FM5 A;  2KRF A;  4XIC A;  2NS7 A;  2R5Y B;  3I71 A;  4RM3 A;  3SYT A;  3O6B B;  3S14 J;  2E7X A;  3L2R A;  2G9W A;  4CCJ A;  1Z3X A;  3HOS A;  2H8R A;  2FA5 A;  3HUG B;  4G6Q A;  5DCF A;  2DBB A;  2L7Z A;  3DU6 A;  1FY7 A;  3SEZ A;  1ZG5 A;  3HOW J;  2RV8 A;  2XSD C;  1DQU A;  3FXO A;  3ZR8 X;  2EQR A;  1O57 A;  1R1V A;  3HM5 A;  5IY5 H;  3CDL A;  2IGM A;  4A2U A;  3I64 A;  1LE8 B;  1W0T A;  5F04 A;  1FSH A;  2UV1 A;  5CVV A;  2F5D A;  2IGN A;  4XQF A;  5HDK A;  1ZRE A;  4LK1 F;  4XM3 A;  3NAR A;  2DQL A;  2ESH A;  3C18 A;  2YU9 J;  2IVM A;  1BC8 C;  5L3G A;  2GOM A;  4D7N A;  3WGH A;  4XRS A;  3IC7 A;  3A0B C;  3F0C A;  2DMT A;  1X1B A;  2X4H A;  4P5O A;  1R36 A;  3RKQ A;  2EV5 A;  3Q3S A;  1LDK B;  4B43 A;  3TBI A;  4WXD A;  2NNN A;  1IN6 A;  3OYJ A;  4O6J A;  3KZZ A;  5JLX A;  1I3A A;  2E5N A;  2K9S A;  3F9K A;  3CCU I;  3ZMS A;  2DT6 A;  4C2U A;  2L7M P;  2HKX A;  2K4B A;  1BC7 C;  2M5W A;  4E7K A;  2EB7 A;  2HDC A;  1W7P A;  2EA4 A;  2GM4 A;  1WJB A;  2KLO A;  2IS2 A;  5E17 F;  5M3M J;  3F23 A;  2F6C A;  2K3P A;  1WJD A;  3LSI A;  3PL8 A;  1HST A;  1KYZ A;  2FX0 A;  4OMY A;  5CQG A;  3FMS A;  3PJR A;  3OSF A;  3I4N J;  1GLN A;  5FB2 A;  1PUE E;  2DFI A;  3QYF A;  1MSF C;  4KUM A;  4PSX A;  2GIZ A;  5ILS A;  4FTH A;  1D0X A;  2EFP A;  1DP3 A;  4JX5 A;  3Q5F A;  3BC8 A;  1E3H A;  2YSR A;  1BR2 A;  3A1Y A;  2ELJ A;  1H88 C;  5KNL A;  1ZLJ A;  2H1K A;  5IYC J;  5F0H A;  1U78 A;  1V55 H;  2A68 F;  1W36 C;  2XV4 S;  4BQA A;  1RET A;  3RYP A;  3EUK L;  2M87 A;  1B4A A;  1TWG J;  4LLN A;  4RLF A;  1LFP A;  5IYD J;  2M2E A;  4EVI A;  3OS0 A;  1GDT A;  2R93 J;  3J7A Y;  5EZH A;  1NG7 A;  3LAJ A;  1UHM A;  3GVA A;  1YO5 C;  3HSE A;  3L2C A;  1TP4 A;  1FZP B;  4JQF A;  4U0V A;  3A03 A;  4Q5S F;  4IZZ A;  3BR1 A;  1OCT C;  3BTJ A;  4C30 A;  2FOW A;  5DD8 A;  4OWR B;  3OYB A;  5HLT A;  1YW8 A;  3A4C A;  2HKO A;  1TZL A;  4L9J A;  3ZQQ A;  3L2U A;  3S2D J;  1IGN A;  1XMA A;  2YS9 A;  1HKQ A;  2ZXI A;  3NRV A;  2HYJ A;  5DCM B;  3H5R A;  3CMA I;  3BTC A;  3S3N A;  2W57 A;  1F36 A;  1JT6 A;  1SFK A;  1XDS A;  2R7T A;  5CYV A;  1D3Y A;  2KIS A;  3KZY A;  4I0B A;  1ZGJ A;  2A69 F;  2LSO A;  3C3W A;  4Y33 A;  5IT9 Z;  1MBH A;  4BJ6 C;  2VPL A;  1OQY A;  1SAU A;  1Z7L A;  4BEH A;  3ABL H;  4CZC A;  2P8T A;  1DP7 P;  3GTK J;  1R00 A;  2JA5 J;  4P1W A;  2E2I J;  4B48 A;  5FKN A;  3CO6 C;  5F64 A;  1Z6T A;  3RPU D;  4CZZ A;  2JSP A;  3J80 Z;  1HC8 A;  2K9L A;  3CC7 I;  4MEY F;  4NC7 A;  4LG0 B;  3KE2 A;  4HZF A;  4HX4 A;  3IV5 A;  1ZHF A;  2V6C A;  2HEO A;  2RQQ A;  4P96 A;  1A6I A;  4HG2 A;  4EMS A;  1MDM A;  3ONQ A;  5KAF C;  4U0Y A;  5J4V A;  1U8R A;  4WCG A;  4IXA A;  2VOD A;  2HFH A;  2K85 A;  1MZB A;  1X2N A;  4KNY A;  4FX0 A;  3FWE A;  1P4W A;  4DNC A;  1YG2 A;  2ME6 A;  4B8X A;  1I6H J;  1T2K A;  2JZY A;  4GYG A;  1LKX A;  3N05 A;  1SD6 A;  2LY1 A;  4KIF A;  1HA8 A;  4M9Z A;  2GIV A;  3OV8 A;  3G3Z A;  4MTE A;  4IX7 A;  2O8K A;  2NS0 A;  3H9J A;  4NNJ A;  2DN0 A;  4ZTF A;  3CJN A;  3CUQ A;  4X1E A;  2BVL A;  2L01 A;  2IPQ X;  4AVZ A;  1AKH B;  4A0X A;  2L9N A;  3I53 A;  3BTL A;  3MZY A;  5D4S A;  3GFL A;  2MC4 A;  4OU0 A;  4H4K C;  4IJA A;  3SHF A;  3CUQ B;  3HOV J;  1X1D A;  3ASN H;  1IC8 A;  5L3F A;  4IHT A;  1WWX A;  2FOK A;  4V2G A;  1IN4 A;  2KT0 A;  2HU9 A;  1YLF A;  2NNY A;  4ABZ A;  3AKZ A;  2HDD A;  1YW9 A;  2V6E A;  4I99 C;  2P5K A;  2XB0 X;  3FXR A;  4OIO F;  5KHD A;  3BZC A;  3DQV C;  2V1N A;  3CF5 F;  1SAX A;  4ZDP A;  2EH3 A;  3H5N A;  3IUO A;  5ICC A;  2ESN A;  5M5X J;  1XG1 A;  2FF4 A;  4EJU A;  4Z6Y A;  4AIJ A;  2MBF A;  1KU3 A;  2DLL A;  2I5U A;  2KJC A;  1I1S A;  1GXQ A;  2X48 A;  3KPH A;  1WQ2 A;  4A3F J;  2M30 A;  1X3W B;  3NEU A;  2VOO A;  3LST A;  1MIJ A;  1H8A C;  4ENN A;  4XID A;  2Q1Z B;  1OCZ H;  4IF4 A;  9ANT A;  1RUO A;  1U5T B;  3I4P A;  4CXF A;  2CG4 A;  3RTR A;  1STZ A;  2D45 A;  3PSI A;  2QQB A;  5IP7 J;  4ENK A;  3CJR B;  2BHY A;  4CHU A;  1D1C A;  3HKZ N;  1MBK A;  1OJL A;  3DLA A;  4CCO A;  3MVP A;  4KJZ A;  4N9H A;  2DI3 A;  5E18 F;  1ERD A;  4ENM A;  2XKO A;  3FXL A;  3ZP5 A;  3AL0 C;  2FBI A;  1BL0 A;  2NVX J;  4FET A;  1G4D A;  4RBO A;  4AIK A;  5HS7 A;  4HW0 A;  2QF7 A;  1QZY A;  3IWF A;  1RRJ A;  5EGO B;  1ENH A;  2FBH A;  4C3J J;  4G8X A;  3PM1 A;  4BQO A;  5D5U B;  2MH2 A;  4S05 A;  2Q2E B;  3VOD A;  1GT0 C;  2GLO A;  2DA4 A;  1UG2 A;  3LSJ A;  4EJT A;  2R92 J;  1K7A A;  5E1W A;  4GRI A;  1FBS A;  2XDV A;  3LSH A;  3MZ8 A;  4L0Z B;  2GA1 A;  1XSX A;  4OIR F;  2EZL A;  1EH6 A;  1FPQ A;  1TBX A;  4UV8 A;  1K4S A;  1FNN A;  3M3Y J;  4D5F A;  1Z77 A;  2WV0 A;  3B6A A;  1MMD A;  4XLN F;  2M4G A;  2NOJ B;  1Z1D A;  5HLG A;  1JJ6 C;  2DPU A;  1I5Z A;  2TRT A;  3LSP A;  2PEX A;  1WJE A;  1VF9 A;  2HYG D;  3K4N A;  1TT0 A;  2RC4 A;  2XIG A;  2R7S A;  2OTJ I;  4UB6 C;  3C7J A;  1R58 A;  4PZJ A;  4LFU A;  5HLH A;  2EV6 A;  4UUT A;  4B3X A;  1ETY A;  1P7J A;  4FT8 A;  1KA8 A;  2KFD A;  2ZC2 A;  1K78 B;  3L2V A;  2D1V A;  1J7K A;  5FRM A;  2Z33 A;  2K5C A;  2L4A A;  3FBN B;  5FKO A;  2VE8 A;  1HW5 A;  3ULQ B;  1NTC A;  5FRO A;  2DMQ A;  3GUD A;  3SDB A;  1W5C C;  2MH9 A;  3A0H C;  2DYS H;  5ICG A;  2DU9 A;  4WX9 A;  1MBG A;  4XKB A;  3TO9 A;  1S5L C;  4ASN A;  3QRF F;  3V8J A;  2V9V A;  2HVS A;  4XRF A;  1OYY A;  2CQ7 A;  4NB5 A;  5FJ8 J;  1WJ5 A;  1SEU A;  2Y0S A;  2VQH A;  4I09 A;  4PFP A;  3DFG A;  1ODD A;  4XLC A;  5F08 A;  2PQ8 A;  2X6Y A;  2CRG A;  4L5E A;  2VKE A;  3HDD A; 
#chains in the Genus database with same CATH homology
 3I59 A;  4M73 A;  1KU2 A;  1U6G A;  2BE5 F;  4L5I A;  2XUB A;  1A04 A;  3CO7 C;  5K5Q A;  4CDG A;  4RAZ A;  3I59 B;  3TOB A;  5D6E A;  1Y0U A;  4ON0 A;  4EM0 B;  3IL2 A;  3FXQ A;  4WXC A;  1XDU A;  5D5X B;  3P7N A;  2IA0 A;  2V1D A;  2XKP A;  2D2W A;  3KP7 A;  4GO1 A;  2QEN A;  1BN5 A;  3EDP A;  4RGR A;  3U1D A;  1FP2 A;  1OYI A;  2A5Y B;  1L3L A;  3DEU A;  5K5O A;  1DDN A;  3E5X A;  1EH7 A;  5DUK A;  3EYY A;  1TQM A;  2H6B A;  5L3D A;  4EJV A;  3HRS A;  3RI4 A;  5FO5 A;  2CSO A;  3OOP A;  5L3E A;  3ZMT A;  2COM A;  5CVR A;  4BYY A;  3ZMZ A;  1PP7 U;  3KCC A;  3I5U A;  1B1B A;  1XCV A;  4S04 A;  3DKW A;  4GCV A;  5E8G A;  4GXO A;  4U0W A;  3TO7 A;  2PG4 A;  1R22 A;  1QPM A;  2AS5 F;  4TV7 A;  4LJZ F;  5FD5 A;  1X3U A;  4HF0 A;  3KP4 A;  2QYO A;  3TKY A;  2K86 A;  5AIP A;  3TDU C;  3E6M A;  4MGR A;  5D8L B;  1RI7 A;  3ZN1 A;  3ABU A;  2FSW A;  1S3J A;  2V1X A;  5ERI A;  4YII A;  3HRU A;  4YIF A;  3BPV A;  4CYD A;  2OBP A;  2HQN A;  3MEX A;  4RB0 A;  4JK1 X;  4RGS A;  1JE8 A;  5DUI A;  1R1T A;  1T38 A;  3HRT A;  3K9T A;  1ZH5 A;  1MJ9 A;  3FHZ A;  2WTE A;  5E1Z B;  4HDV A;  3ERE D;  3KLO A;  3I54 A;  5JI6 A;  3KFW X;  1KU9 A;  1LEB A;  3WTU C;  2KIF A;  4D0P A;  3V8K A;  1KQ8 A;  4HQM A;  1E17 A;  2Z99 A;  1IF1 A;  2Z5U A;  3WGI A;  2IJL A;  1T98 A;  3SZP A;  2MLK A;  4YG2 F;  1FOK A;  2J5O A;  2XGX A;  4EQQ A;  1SFE A;  1W4M A;  5H6Q A;  1CF7 B;  4AIH A;  4OIQ F;  1OMI A;  1FP1 D;  2FU4 A;  1KGS A;  4OIN F;  2P5V A;  2XAF A;  2MC3 A;  1XSV A;  4ENJ A;  1GXP A;  5FLX Z;  1BI0 A;  1QNT A;  3BZ6 A;  4KA4 A;  4HLY A;  2ELH A;  3FF5 A;  2HS5 A;  4QWQ A;  3WTX C;  3PFI A;  4QLC U;  2QUF A;  1Q1H A;  5FD6 A;  3T1B A;  3SFZ A;  2F2E A;  5JR3 A;  1OKR A;  4IPA A;  1O3T A;  3IKV A;  4KN7 X;  1MJA A;  2OAZ A;  2W24 A;  4KDP A;  3J7A O;  1O7L A;  4RAY A;  1SD4 A;  1KQ0 A;  2KIM A;  3BDD A;  1REP C;  3D5L A;  3LFK A;  1JXS A;  3E5U A;  2HQR A;  2RDP A;  2XHK A;  3BY6 A;  1W7P D;  4A6D A;  3KP5 A;  5HS9 A;  2KJB A;  4I02 A;  1UHW A;  4WXH A;  4Z2Y A;  3CDH A;  1P6R A;  3C1D A;  3K1P A;  3HRM A;  1BI3 A;  4NHJ A;  1IZ1 A;  3PQJ A;  1XD7 A;  3I58 A;  3WTS C;  1Z05 A;  3RKY A;  4PGG A;  1Z9C A;  2X0L A;  4UNO A;  2M1B A;  2ADU A;  1TW3 A;  1J5Y A;  3ELK A;  2DPD A;  4Y17 A;  4CGZ A;  4PDK A;  1TLH B;  3ROU A;  1W7P B;  3L9F A;  1ON2 A;  1D8J A;  4O3M A;  2LNB A;  1XB4 A;  3H3U A;  4M6Y A;  5JHU A;  2H27 A;  1F9N A;  3MFK A;  4IVN A;  4G7H F;  3JTG A;  2R3S A;  1WI9 A;  2GZW A;  2PJP A;  1QQI A;  2EFN A;  2EFQ A;  1TNS A;  2NRA C;  4A5M A;  2BEO A;  4G7O F;  4EV0 A;  1BJA A;  1BM9 A;  1QGP A;  4L0Y B;  4YFN F;  2P5L C;  1XGM A;  4IHS A;  1FT9 A;  3VOE A;  2PN6 A;  5ED4 A;  5LLQ A;  4EGZ A;  1SD5 A;  3JAM K;  4P9F A;  5HS8 A;  4I7H A;  3S2W A;  3ZMU A;  4BXU A;  4BAY A;  5LGU A;  2YX7 A;  4M71 A;  1BI2 A;  3K0L A;  3J81 K;  2E7W A;  2V79 A;  2K7L A;  4EGY A;  2QLZ A;  2ZBK A;  4GGG A;  3REO A;  1V4R A;  1R7J A;  3DV8 A;  1WSU A;  4N9I A;  4RGX A;  2XAS A;  3Q9S A;  4KN4 X;  1YTY A;  2Y75 A;  3BJA A;  2XVC A;  1IRF A;  1JHF A;  4M6X A;  2YR2 A;  1G3T A;  1Z7U A;  3E6B A;  2STT A;  2UXN A;  1B9N A;  1UFM A;  3SZT A;  4B09 A;  2VON A;  2RN7 A;  3FMQ A;  1J75 A;  3GF2 A;  1V3F A;  1MDM B;  4M72 A;  4UVC A;  2G7U A;  2RKH A;  3QP6 A;  2XAJ A;  4UXN A;  3F6O A;  2K27 A;  3BJ6 A;  2STW A;  2ZKZ A;  5JFR A;  2RNJ A;  1JGS A;  2XAQ A;  1SMT A;  1XMK A;  4IRI A;  5ICE A;  3AAF A;  2ZNZ A;  4ETS A;  2K02 A;  3VEP A;  2DT5 A;  3FM3 A;  2Q8K A;  3LA2 A;  1ZRC A;  1T6S A;  1L0O C;  4AD9 A;  3QU3 A;  4NQW A;  3RJP A;  2GXB A;  2A6H F;  1LDJ A;  4LGW A;  2PFB A;  3V4G A;  2ZFW A;  1SD7 A;  2GQQ A;  5BOX A;  1LJ9 A;  2K4J A;  4HBL A;  5LGN A;  2BGC A;  2ZME A;  4XLP F;  2LDU A;  2Y0M A;  2B0L A;  2XAG A;  3GEZ A;  5HDG A;  2XRO A;  2M45 A;  2ZME B;  5L3C A;  4RS8 A;  4ZYH A;  3F8M A;  3K69 A;  1YS7 A;  2EA2 A;  4Y15 A;  4IRG A;  2OZU A;  2NYX A;  3MQ0 A;  3F8N A;  3RDI A;  2Z9O A;  1AOY A;  3EYI A;  5E20 A;  1USS A;  5BS6 A;  1UB9 A;  1EV7 A;  3QPT A;  4DQ2 A;  3FZV A;  3BJO A;  3RKW A;  2P7V B;  4HX8 A;  2A07 F;  3GZ6 A;  1ZG3 A;  1ZRD A;  5LEJ A;  2VBW A;  1XSD A;  3E6D A;  2DK8 A;  4HOB A;  3RKX A;  2ZNY A;  3GZ5 A;  3CUQ C;  3LQR A;  2ZXJ A;  3HTS B;  1K79 A;  3GFM A;  1FLI A;  1DPU A;  1LNW A;  2YPR A;  1ZGA A;  4KIC A;  2KIU A;  5H20 A;  5J8C A;  4R8H A;  5L3B A;  4XBF A;  2CO5 A;  2HGC A;  3IHU A;  1ZAR A;  3E97 A;  2W84 A;  3N4M A;  3LAP A;  3HSF A;  5LRS A;  2CWE A;  2W85 A;  2IA2 A;  1F5T A;  3M8F A;  1QO0 D;  4BNC A;  4LK0 F;  5ILV A;  1FBQ A;  3HOT A;  4EJW A;  1U5T C;  4KMU X;  1PP8 F;  2QBY A;  1TQI A;  1TTY A;  2FBK A;  4L5J A;  2QWW A;  3ZPL A;  1QBJ A;  2BYV E;  2C6Y A;  1B6A A;  4BHC A;  3E6C C;  2IRF G;  1O3R A;  4OOI A;  3V8L A;  1TNT A;  1FSE A;  5ICF A;  2H6C A;  5LGT A;  1U3E M;  3EUH A;  3LQQ A;  3L09 A;  4YFK F;  5TRD A;  1GHC A;  2YU3 A;  2A6E F;  3DP7 A;  2O3F A;  2H09 A;  5A2Q K;  4EM2 A;  3P9C A;  5CVU A;  3HYI A;  3ZMD A;  2GWR A;  2QZ8 A;  3ML6 A;  3WTW C;  5EEG A;  5D8K B;  3ZN0 A;  3Q9V A;  3TDZ C;  5HOO A;  3BRO A;  1FYL A;  1LDD A;  2A61 A;  1R1U A;  1LB2 A;  2H94 A;  3F72 A;  1S8N A;  3N97 A;  4UV9 A;  3GX4 X;  4Y13 A;  5E1X A;  4AVP A;  3KEQ A;  3LWF A;  2BBY A;  4A0Z A;  3IKT A;  1FX7 A;  2L54 A;  1LVA A;  3M7G A;  3SXY A;  3WTV C;  5HVQ C;  2ISY A;  1HQC A;  1IAW A;  2FE3 A;  1B9M A;  4Q47 A;  3K1N A;  2JTV A;  4UVA A;  2ISZ A;  1IN8 A;  1I6X A;  3PQK A;  2V1U A;  2QVO A;  2O8X A;  3B02 A;  4O5V A;  1E2X A;  1KQ9 A;  2VC0 A;  4ESJ A;  3R0J A;  3T5X A;  5K5R A;  1IW7 F;  4MEX F;  5D5V B;  4I98 B;  2UZK A;  4L9N A;  2HZT A;  3D0S A;  1DPR A;  3QAH A;  2M8E A;  3HIF A;  4LB5 A;  4M9S A;  3DF8 A;  2FXA A;  1T39 A;  3ABT A;  1F1Z A;  3CUO A;  4E70 A;  2Q0O A;  2W25 A;  2VBY A;  1YQA A;  2FNP A;  3V7S A;  1OPC A;  3P9K A;  4U7D A;  1IUY A;  4CO8 A;  3VFZ A;  2CFX A;  2EV0 A;  4HAM A;  2VE9 A;  1C0W A;  1TW2 A;  2MLG A;  2O61 A;  3DPL C;  1GVJ A;  1LQ1 A;  4MHG A;  2HWV A;  4LLL A;  3IRQ A;  1XGO A;  3V7C A;  1J59 A;  2YX4 A;  2JPB A;  3K2Z A;  4OIP F;  2EJR A;  6PAX A;  4ZYD A;  2OD5 A;  3WE3 A;  1RIO H;  1OR7 A;  3W6J B;  2FMY A;  4M9X A;  1MKM A;  4R1H A;  2P7C B;  2EFO A;  1BI1 A;  1G6N A;  2O0Y A;  5BPD A;  1SFX A;  2VC1 A;  2RGV A;  1D8K A;  1S7O A;  2HYF A;  2P6S A;  1J2X A;  1IXR C;  1IN7 A;  3HUG A;  2F5E A;  5IT9 K;  3DXJ F;  4XSX F;  3FXU A;  1ZAO A;  3WE2 A;  2J5P A;  2JSC A;  1FYK A;  4R79 A;  2IP2 A;  3J80 K;  4U88 A;  2PI0 A;  3GXO A;  3SQN A;  4KFC A;  4RB2 C;  2Z3Y A;  5ILU A;  3KET A;  2FML A;  1J0R A;  2IW5 A;  2WWY A;  4YFX F;  1D5V A;  4AWX B;  1CGP A;  5D5W B;  2EFW A;  1ZRF A;  4ZYG A;  1ZG1 A;  4HA8 A;  1B59 A;  4PGH A;  3F8B A;  3U2R A;  1HW1 A;  4M74 A;  3QPH A;  1YS6 A;  3MZH A;  2OU2 A;  3IRR A;  3GW2 A;  3KLN A;  4P9U A;  2QQA A;  3FX3 A;  5J6X A;  1HKS A;  1QZZ A;  4UHT A;  4I01 A;  1BBY A;  5LRR A;  3E5Q A;  4ZZD A;  3BPX A;  3H92 A;  3ZMV A;  1G3S A;  4HDU A;  2Y48 A;  5E8I A;  3VB2 A;  4ESB A;  1JHH A;  1FWZ A;  3EET A;  1O3Q A;  4HF1 A;  2ZJ2 A;  4HV6 A;  1YYV A;  4A5N A;  4JBA A;  3M9A A;  4GYI A;  3R61 A;  2F5F A;  2RQP A;  1R5G A;  3BWG A;  2E1C A;  2L3D A;  5DCM A;  1PDN C;  5LHI A;  4G9Y A;  3F8F A;  2LF7 A;  4MNU A;  4ZZL A;  3MCZ A;  1G3Y A;  3BP8 A;  3JW4 A;  1IRG A;  4KYW A;  3I0T A;  2EWN A;  3GWZ A;  5LBQ A;  5CLS A;  5D4R A;  4F7Z A;  3O2P E;  2ETH A;  4LD5 A;  3E3V A;  4LG0 A;  1WKM A;  4G94 A;  3COA C;  2UXX A;  1H0M A;  5DDG A;  4MTD A;  1U2W A;  2R7D A;  3HHH A;  4KIB A;  4HYE A;  1P92 A;  3WTZ A;  1MGT A;  3U9G A;  3RYR A;  5AIQ A;  2GAU A;  4PCQ A;  3WU1 B;  1VTN C;  1Z6R A;  2CQK A;  1OYW A;  3JSO A;  2L4M A;  3RPU A;  3JTH A;  5HDN A;  1HXD A;  3HHG A;  5CVJ A;  2VBZ A;  1UCR A;  1IXC A;  1FC3 A;  3R60 A;  3NQO A;  4Q48 A;  4WK8 F;  3M8E A;  1RZ4 A;  5JVT A;  4FX4 A;  4UVB A;  4Q4Z F;  2MD5 A;  5CVI A;  4A0Y A;  2HTJ A;  2F5C A;  2VT3 A;  4UUV A;  2VBX A;  1YW7 A;  3FMR A;  1S7A A;  3BOQ A;  1RNL A;  1EH8 A;  4BHB A;  3TO6 A;  1MD0 A;  4CIC A;  4LMY A;  2VN2 A;  2FEZ A;  1U5T A;  5CJ9 A;  1NHA A;  1KU7 A;  3ECH A;  3JAM Z;  3GFJ A;  2BV6 A;  3EQL F;  1ULY A;  3KP3 A;  5F6F A;  2AXL A;  4WF2 A;  4RB1 A;  2VOP A;  2OQR A;  3LA3 A;  4RB3 C;  2WC2 A;  3KP2 A;  2IT0 A;  1SFU A;  3J81 Z;  2Q2E A;  1W5T A;  5LHG A;  5F1R A;  1R5H A;  2O6G E;  1R23 A;  2PMH A;  5DYM A;  1DUX C;  2PLY A;  3ECO A;  3TOA A;  1H9T A;  4I2O A;  2DTR A;  3T0Y A;  4A12 A;  5AON A;  2DK5 A;  3WG9 A;  4HF2 A;  4BH9 A;  3CLO A;  3R6S A;  3K1M A;  2DQR A;  2ZO4 A;  1K78 A;  1WRJ A;  3L7W A;  4U7B A;  2JRT A;  1S6L A;  3M1E A;  1J9I A;  4HV5 A;  5LEK A;  1H9G A;  4XSZ F;  5HLI A;  2VT2 A;  3MAJ A;  4IRH A;  4HLX A;  3L00 A;  1T0F A;  2D1H A;  3IWZ A;  1O3S A;  4KMF A;  3RIR A;  1RUN A;  3V7R A;  3R0A A;  1TQP A;  1P4X A;  3F3X A;  3QP5 A;  1I1G A;  2QM3 A;  5BPI A;  2OA4 A;  2GA2 A;  1XN7 A;  5EEH A;  1P4A A;  2E1N A;  2FRH A;  3WGG A;  2TDX A;  3H3Z A;  5DEQ A;  2QBY B;  3GFI A;  4BHP A;  2HOE A;  4G7Z F;  1ON1 A;  2VXZ A;  1HBX G;  2CW0 F;  1ONV A;  4L18 B;  1F4K A;  1ZLK A;  2DAO A;  3WU0 A;  4LB6 B;  4EM1 A;  2L02 A;  3HSR A;  2PBI A;  4A6E A;  3WTY C;  4G6D A;  1XGN A;  1UST A;  1K6O A;  3R4K A;  3QOP A;  5K1Y A;  1Z91 A;  3RPQ A;  2UWM A;  3T8T A;  1AWC A;  5FLX K;  2DO7 A;  4KT5 C;  1IXS B;  2JPC A;  2ACJ A;  4EJO A;  5LHH A;  1S29 A;  2CYY A;  3F21 A;  3O3K A;  5FFZ A;  4ESF A;  2NAZ A;  2QQ9 A;  3P9I A;  5BQT A;  2LKP A;  5DD4 A;  4WWC A;  3JSP A;  5H6R A;  3QU6 A;  1YIO A;  3ISP A;  4I0A A;  3B73 A;  4L9V A;  2EK5 A;  1BOA A;  3W6K B;  3LA7 A;  4MQV A;  3F6V A;  3G73 A;  5DV5 A;  2R7F A;  5TJJ A;  2OQG A;  3ZQ7 A;  1ZYR F;  2A3S A;  1P2F A;  1HKT A;  2IA1 A;  1YFH A;  5J8F A;  1HSJ A;  4H0E A;  4K2E A;  1BIB A;  4L9T A;  1W5S A;  2CGP A;  4RGU A;  4ZYE A;  1FYM A;  1XCB A;  3HTU A;  1G3W A;  1SMY F;  3T8R A;  3CTA A;  4ZH4 F;  4LLG F;  1KYW A;  5FFX A;  3WOD F;  2ZCW A;  1I27 A;  3F8C A;  4HQE A;  1O7F A;  2DW4 A;  3KEO A;  4MQ9 F;  3TGN A;  1BIA A;  2P6T A;  2G7H A;  2HR3 A;  1MJB A;  2P4W A;  2O03 A;  2LF8 A;  4HX7 A;  2FQ3 A;  1CF7 A;  5KVR A;  1XGS A;  2XRN A;  2XAH A;  4KIG A;  1ZN2 A;  2OZ6 A;  3DPT A;  3GYH X;  4OMZ A;  2FNA A;  4N0B A;  3WTT C;  5A2Q Z;  2HTS A;  3GO5 A;  1IN5 A;  4FHT A;  2RVC A;  3GLX A;  2MA3 A;  5FGM A;  5D6F A;  2PMU A;  3KP6 A;  5KK1 A;  1HW2 A;  3MWM A;  5BMZ A;  2JT1 A;  2KKO A;  1LEA A;  4P55 A;  3F22 A;  1FBU A;  2GXG A;  5IT3 A;  3TQN A;  3FM5 A;  2KRF A;  3I71 A;  3O6B B;  2E7X A;  2G9W A;  3HOS A;  2FA5 A;  4G6Q A;  5DCF A;  2DBB A;  1FY7 A;  1ZG5 A;  2RV8 A;  1O57 A;  1R1V A;  4A2U A;  3I64 A;  1FSH A;  5CVV A;  2F5D A;  5HDK A;  1ZRE A;  4LK1 F;  2DQL A;  2ESH A;  3C18 A;  2IVM A;  1BC8 C;  5L3G A;  3WGH A;  3IC7 A;  2X4H A;  4P5O A;  1R36 A;  2EV5 A;  1LDK B;  4WXD A;  2NNN A;  1IN6 A;  4O6J A;  3KZZ A;  3ZMS A;  2HKX A;  2K4B A;  1BC7 C;  2M5W A;  2EB7 A;  2HDC A;  1W7P A;  2EA4 A;  5E17 F;  3F23 A;  1HST A;  1KYZ A;  4OMY A;  3FMS A;  5FB2 A;  1PUE E;  2DFI A;  4KUM A;  5ILS A;  2EFP A;  3Q5F A;  2YSR A;  1ZLJ A;  1U78 A;  2A68 F;  2XV4 S;  4BQA A;  3RYP A;  2M87 A;  1B4A A;  4LLN A;  4EVI A;  3LAJ A;  1UHM A;  3GVA A;  1YO5 C;  3HSE A;  3L2C A;  1FZP B;  4JQF A;  4U0V A;  4Q5S F;  5DD8 A;  1YW8 A;  4L9J A;  2HKO A;  1XMA A;  1HKQ A;  3NRV A;  5DCM B;  2W57 A;  1XDS A;  5CYV A;  1D3Y A;  3KZY A;  4I0B A;  1ZGJ A;  2A69 F;  2LSO A;  3C3W A;  5IT9 Z;  2P8T A;  1DP7 P;  1R00 A;  3CO6 C;  5F64 A;  1Z6T A;  4CZZ A;  3J80 Z;  4MEY F;  4LG0 B;  3KE2 A;  4HZF A;  4HX4 A;  1ZHF A;  2V6C A;  2HEO A;  4P96 A;  4EMS A;  1MDM A;  4U0Y A;  1U8R A;  4WCG A;  4IXA A;  2VOD A;  2HFH A;  1MZB A;  4KNY A;  4FX0 A;  3FWE A;  1P4W A;  4DNC A;  1YG2 A;  4B8X A;  1T2K A;  2JZY A;  4GYG A;  1SD6 A;  4KIF A;  4M9Z A;  2GIV A;  3OV8 A;  3G3Z A;  4MTE A;  2NS0 A;  3CJN A;  3CUQ A;  2L01 A;  2IPQ X;  4A0X A;  3I53 A;  3MZY A;  5D4S A;  3GFL A;  4OU0 A;  3SHF A;  4IJA A;  3CUQ B;  5L3F A;  4IHT A;  1WWX A;  2FOK A;  1IN4 A;  2NNY A;  1YLF A;  1YW9 A;  2P5K A;  3FXR A;  4OIO F;  3DQV C;  1SAX A;  5ICC A;  2ESN A;  2FF4 A;  4EJU A;  4AIJ A;  2MBF A;  1KU3 A;  2DLL A;  2KJC A;  1I1S A;  1GXQ A;  1WQ2 A;  2M30 A;  3NEU A;  2VOO A;  3LST A;  4ENN A;  4IF4 A;  1RUO A;  1U5T B;  3I4P A;  4CXF A;  2CG4 A;  3RTR A;  1STZ A;  2D45 A;  2QQB A;  4ENK A;  4CHU A;  4N9H A;  2DI3 A;  5E18 F;  4ENM A;  2XKO A;  3ZP5 A;  2FBI A;  1G4D A;  4AIK A;  5HS7 A;  4HW0 A;  1QZY A;  3IWF A;  2FBH A;  4G8X A;  4S05 A;  5D5U B;  2MH2 A;  3VOD A;  4EJT A;  1K7A A;  5E1W A;  1FBS A;  4L0Z B;  2GA1 A;  1XSX A;  4OIR F;  1EH6 A;  1FPQ A;  1TBX A;  4UV8 A;  1FNN A;  2WV0 A;  4XLN F;  1Z1D A;  5HLG A;  2DPU A;  1I5Z A;  2PEX A;  2HYG D;  2RC4 A;  2XIG A;  3C7J A;  1R58 A;  4PZJ A;  4LFU A;  5HLH A;  2EV6 A;  4FT8 A;  1KA8 A;  1K78 B;  2D1V A;  1J7K A;  2Z33 A;  2L4A A;  2VE8 A;  1HW5 A;  3ULQ B;  3GUD A;  2MH9 A;  4WX9 A;  5ICG A;  2DU9 A;  3TO9 A;  3QRF F;  4ASN A;  3V8J A;  2V9V A;  4XRF A;  1OYY A;  4NB5 A;  4I09 A;  3DFG A;  1ODD A;  2PQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...