3CC7I

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cc7I00
1YJWI 3G6EI 3CCJI 1VQ7I 2ZJPF 1VQKI 3CF5F 3CCLI 5DM7F 1HC8A 1VQPI 2E36A 1VQ8I 3CMEI 3CC4I 2ZJQF 1YHQI 2QA4I 1VQNI 5GAHJ 3PIOF 1YI2I 2K3FA 1ACIA 3G71I 3CCMI 1FOXA 5DM6F 3CCEI 3J7ZI 1S72I 1VQ5I 3CCQI 3DLLF 3CCRI 2FOWA 4IO9F 2OTLI 1VQ6I 3CMAI 5JVGF 1YITI 1VQOI 2QEXI 3CD6I 1VQ9I 2H8WA 3PIPF 3I56I 2OTJI 3CC7I 1VQMI 4UY8I 1YJ9I 3G4SI 2E35A 5GAGJ 2ZJRF 2JQ7A 1VQLI 2NXNB 1FOWA 1YIJI 3CCVI 3CCSI 4V19K 1QA6A 5GAEJ 1VQ4I 3CJTB 3CCUI 2E34A 1Y39A 4IOCF 1YJNI 1MMSA 3CC2I 4IOAF 3I55I 5GADJ 3J7YJ 1FOYA
chains in the Genus database with same CATH superfamily
3JSOA 3B6AA 1SD6A 3U21A 4OIPF 2GIZA 1GXPA 3ZN0A 4NQWB 2M4KA 4F7ZA 5EG0B 4G7OF 2DOFA 3MCZA 3QWLA 5KVRA 4BJ6C 3DWLE 1UHMA 2YR2A 3CF5F 2P0WA 1W7PB 3LFKA 3AG1H 5ERIA 4G94A 2K7LA 2QKMB 1YOVB 3R61A 4E7KA 3OYBA 2DJNA 2XF7A 4XIDA 2VXDA 3AG3H 5KCMA 2QQAA 2E36A 1D5YA 2ELJA 3KZIC 1XSVA 1PJRA 3L2WA 3MKLA 4ZYEA 1IN4A 1I1SA 3E6CC 3SZPA 2X6YA 2H94A 5D5UB 1MBJA 1IN7A 2XPVA 3G71I 3A0BC 3B73A 4MTEA 2A61A 1BI3A 1OQYA 3G2BA 1W36C 1KA8A 2STWA 4Y52J 1MMNA 1K79A 1TQPA 1F4KA 1S7OA 1OLTA 2NS8A 5A2QZ 1EH7A 1T2KA 2KDOA 1N77A 2IS6A 1MNEA 3PSFA 2JVHA 3ABMH 2GZWA 5CQGA 3CMAI 3QYBA 5EF6A 4M9SA 3CQZJ 2MA3A 3K9TA 2Y0SA 1I27A 3BG9A 1S5LC 2R5YB 4ZYGA 4FETA 4MFEA 3QU6A 1T38A 1B9NA 2HOAA 4U7BA 3T8TA 1VQMI 3OYEA 2DQLA 4CDGA 2R7UA 3MD2A 3PSIA 2KP6A 1UHWA 2KHMA 4HRIA 2A5YB 1MJBA 4XKCA 3RKXA 3K4CA 1RESA 4C30A 2PI0A 4GYIA 4A3LJ 5EYRA 2VBZA 2VBXA 3WU0A 5C44J 3PM1A 4BE2A 3PJRA 4Q47A 5L3DA 3K4JA 4WWCA 2DK8A 2LY2A 4GCVA 4ESJA 2HYFA 2BE5F 2QLZA 2OAZA 2GIVA 2KFDA 2HDDA 1STZA 3N05A 4ZZLA 3JAMZ 4DJAA 4FT8A 1XCVA 4ZJZA 2Z9OA 2OZUA 4RAYA 4U88A 4AUXA 1JT0A 5L3FA 2W82A 4KFCA 5E3MA 2XAUA 4OU0A 2Q1ZB 4XORA 2BGCA 3PNTA 3OY9A 3OYIA 2ESHA 3JRHA 3K2ZA 3QYEA 4A0ZA 3HOTA 3K4LA 1IV8A 1O3RA 2FNAA 2OBPA 2YPRA 3DTIA 2DI3A 1SVLA 3FXOA 4ABZA 4AWXB 2HFHA 2J5PA 4HA8A 5D5XB 2PMUA 1DQUA 3ML6A 5D8LB 2NVYJ 1G3YA 1TBXA 2EFNA 4ASNA 3RI4A 5JLXA 3UNGC 1WJ5A 2B0LA 5J8FA 5M5WJ 3PO2J 2HKOA 1S7EA 1FP1D 2A69F 2ISZA 1F43A 2ELHA 2IGNA 3I0TA 3K10A 1R71A 1JE8A 2IA1A 2Y75A 3RTRA 4CXFA 2HI3A 4XICA 4GRIA 5BS6A 2QBYA 3PO3J 3MZYA 3M7GA 3FMSA 1HW5A 1U0JA 5J4YA 3HL2A 5FKMA 1GV5A 1MMAA 1JUSA 3C7JA 1JTYA 3RCOA 1QBJA 2JA6J 1FOKA 1IZ1A 1MBGA 3IUOA 5DM6F 2VBWA 2Y31A 2L9RA 1DUXC 3AFHA 4HSTA 5EDNA 4WX9A 3DLLF 2RN7A 4GYGA 2P5VA 3E1SA 3HOSA 5JVGF 3HOVJ 3OYGA 1RC9A 1FZPB 1VQ9I 2P8TA 3G1LA 2XPUA 4HW0A 4CHUA 3F8NA 3FIWA 3W6JB 3OS0A 2VKVA 4G6TB 1YFHA 2EIJH 3LQQA 4HEA2 3VODA 2PMHA 1DGRM 4CO8A 4L9TA 3MN2A 2X1CA 2ZKZA 5LRRA 1SEUA 2LR8A 5ILUA 3HRSA 3IKTA 4AM3A 3JRBA 3RKYA 3V42A 3OIQA 2OU2A 1TW3A 2RVCA 2DT6A 3FK6A 2WA0A 2XIGA 3QQAA 1JGGA 2HEOA 4JYKA 1B72A 2R5ZA 4RB1A 2ZXHA 1UMQA 5F0HA 1YIJI 1YS6A 5K1YA 3VSLA 1MDMB 2MD0A 2K27A 2QENA 5FFZA 3PFIA 3CCSI 1LDJA 4FQGA 1R6RA 1XGOA 3FM5A 4IZZA 3WU2C 4PGHA 5EGOA 5DS9A 3GTJJ 1LNWA 4L5JA 4P9FA 2CRGA 3WGIA 2DW4A 4HLXA 2D2WA 4BS9A 5HLTA 2EILH 4HSRA 1G2HA 2M1BA 3HHHA 1B6AA 3L2QA 1SMYF 3A2KA 5J6XA 1I3QJ 2UXXA 3J7YJ 1ZLKA 3ELKA 1FOYA 4YFXF 2CV1A 4UUVA 1V3FA 4AIDA 2P6SA 3F21A 3CCJI 1XD7A 4O6JA 3KCCA 2F4MB 1LFPA 1X3ZB 2JMWA 2ZJPF 1HF0A 3DF8A 2W85A 3CDLA 3QP5A 1BOAA 4D9JA 4CYCB 2QSGX 5KNLA 4IKFA 1I6XA 5IY5H 1YRNB 1A04A 4L9VA 1FT9A 3FHNA 2DMNA 4MTDA 2LBFA 2O7OA 4ENNA 5E79C 3F8MA 1F5TA 5LEJA 1FMVA 5HLIA 3OYMA 4RLQA 3BZKA 4BE1A 2LH9A 2CUZA 1D1AA 2EIMH 2GLOA 3EDPA 4RAFA 3CCEI 1O7LA 1A35A 1WGXA 5E8GA 4IHSA 5K7FA 5EG0A 3HUGA 1X19A 2FU4A 4DZJA 5IP7J 3CCRI 3WTYC 2XPWA 3F8CA 3FX3A 1ZELA 3UR3C 2LOOA 3L2VA 2JSCA 2UUZA 3QAHA 3SQNA 4CCLA 2E5NA 5JVTA 4YG2F 4CZZA 1Y6IA 3GZ6A 2DA5A 2X85A 2MC4A 1MSFC 3GMEA 3WTXC 1R58A 3F3XA 2NNNA 4A69C 2FSWA 1N78A 3I3LA 3H92A 3I53A 5CKTA 3ZMUA 4A3EJ 1OCOH 1LB2A 2ZJRF 5EEHA 4HQEA 5HS8A 3J7AY 2HWVA 1LFBA 5FFXA 1PUEE 4AIHA 3GX4X 1RKWA 3AG4H 4IHWA 4N9HA 2DDAA 3B02A 2FNPA 3BZ6A 4BU2A 4B3AA 5EJCA 3U9GA 3MVPA 3WG7H 4QPQA 3H5AA 2FMLA 1W7PD 2OF7A 2HPMA 3RJPA 3H9JA 2EJRA 2HQ5A 2Y48A 1O3QA 4UB8C 5BPDA 1FBUA 4XQFA 1R00A 2DDBA 1T95A 3BLYA 4X0GA 1SFOJ 1MBHA 4FTHA 1ULYA 3SZGA 5D8KB 5B1AH 4I7HA 1OYIA 4IOAF 1RPWA 5E1WA 2YX7A 1Y0UA 2E1OA 1WRJA 2MABA 3TGNA 2HQRA 1JT6A 3P7NA 2K4JA 4ZDOA 1QNTA 2H1KA 4IJAA 5C4JJ 3K0LA 1AOYA 4GDFA 2PMZN 2QM3A 2A6TA 1EV7A 1KZHA 3AAFA 4ENJA 2LKXA 3HOYJ 2CQQA 1KU9A 2FQ4A 2VBYA 2R7WA 1T39A 4C2MJ 4XN3A 1XX5A 2D1HA 3LFUA 1GUUA 3DEUA 1BIBA 3Q0UA 5IPAA 4JP0A 3VOEA 2M4GA 5HS7A 5DM7F 3M9AA 4IQJA 3ZMZA 2O61A 1X1DA 1FLIA 1ENHA 3MQ0A 3P9CA 4XN0A 5LHHA 1LFUP 1LVAA 4IEJA 1VTNC 3ISPA 2DA3A 2X1DA 1TQIA 3L1PA 2R7DA 1IUYA 3C2GA 3KP5A 3FMQA 3LSMA 1TT0A 3JSPA 2HVSA 1P2FA 5CVVA 4UVCA 3TP0A 1CGPA 1MBKA 2RV8A 3ZMSA 4LK0F 2V1XA 2VQHA 3BZCA 1BL0A 2OA4A 4UVAA 2Z5UA 1VQ5I 2IA0A 5EEGA 4CCNA 2XGDA 5ED4A 1XSXA 5C4XJ 3TBIA 4FX0A 2OQGA 1RI7A 1XS9A 3S15J 2WC2A 1HQCA 1N75A 4A12A 2KRFA 2IA2A 1WJEA 3WGHA 2CMPA 4EMSA 1ETWA 2VI6A 3S1RJ 4O3MA 3GFJA 3V7CA 2K9SA 3D5SC 4PJJA 5J40A 1YW7A 2CO5A 3OV8A 2O8KA 3LWFA 4P9UA 2MSYA 3Q9VA 1HKSA 2EFQA 4II2A 4YIFA 2XB0X 1G8XA 3TQNA 4EJTA 1FOWA 2PQ8A 1L3LA 2XGXA 1YW9A 4OIQF 3LAPA 1ODDA 2QCOA 1JJ8C 4P55A 1JKQC 4PJNA 4KICA 3TOBA 2XGEA 3KEYA 2EFOA 5DUKA 1WJDA 1IXRC 4Q4ZF 3BR3A 2L9SA 2VJJA 5KAFC 2F4OB 2ZFWA 4U0VA 3GBGA 2E34A 1JJ6C 1XMXA 1RR8C 3FWEA 3LA7A 3HDDA 1UELB 2WB1A 1SVMA 2O6GE 1D1CA 1ZLJA 1ORKA 4E7IA 3ZPLA 3CP8A 2A5WA 3I4PA 3SZTA 2HDWA 3H3ZA 2D45A 2V1NA 4IHXA 2ZJ2A 2EQRA 1IN6A 2FMYA 3ROUA 1XTAA 1FSEA 1ZHFA 1OPCA 2A3SA 4L9NA 4ZYAA 3BDDA 1BIAA 1SMTA 3SDBA 1IRZA 1KYZA 4NC7A 1HLVA 3HKZN 4ENKA 4M3BA 3ABTA 1UG0A 4AYBA 3SXYA 4A3IJ 2BXYA 3OSFA 1S6LA 4LG0A 3I58A 4QSHA 2QBYB 3HBLA 1X4OA 2KDZA 2CW8A 1XGMA 2PMZA 4PGGA 4CCKA 5J1RA 1R1TA 4RLFA 2VE9A 3GTKJ 4G6QA 4LB5A 2EV6A 3A4CA 1S9HA 2DK5A 2AXLA 4GXOA 5L3BA 4KDPA 2WY7Q 2O5RA 3DKYA 2RAEA 5EEAA 2DA1A 4PJMA 3WTSC 1YI2I 3ERMA 3FM3A 4FE7A 2JWTA 4PDKA 2LDUA 4ENMA 2UV1A 2HVRA 4BHBA 1WJCA 4E7HA 4ZTJA 1PVEA 1IN8A 3C2HA 3I9V2 3H3UA 3LSHA 3VYRB 4LITA 1HOMA 1GXQA 4XLPF 2DAOA 1K6YA 1VQ6I 2HNHA 2FX0A 2LTPA 4KUMA 4F52A 4XONA 1KQ9A 3ZOBA 3P9KA 2DCEA 2K40A 1YRNA 3BP8A 3WE3A 3ZQFA 1K6OA 3I4MJ 1KU3A 2A68F 2M5WA 3CF2A 5K5OA 1RR7A 5DD4A 5AIPA 1U5TA 1WFXA 3O8HA 9ANTA 4GO1A 3ABKH 1B72B 2R5ZB 1IO2A 5FRMA 4M3FA 1MMDA 1U3EM 2W00A 2Y0SN 4BY7J 5LGNA 1U8BA 3V4GA 3PNYA 2DJIA 3A0HC 3BR0A 2TRTA 3OOUA 4MQ9F 3IRRA 2LG4A 2E7WA 5EGOB 1HKQA 1K61A 1TZLA 1U78A 3BR5A 2FEZA 5F04A 1GT0C 1TC3C 5H6QA 1VQ4I 3T8RA 3W2WA 1FTZA 2HXOA 2XDVA 4DYCA 4RGSA 3JCUC 2Z16A 3E7LA 2V1DA 3OS2A 1K78B 3GEZA 4KMFA 3K4MA 2ZSIB 1U9NA 3BTCA 3H9GA 4XLEA 2ISYA 3CO7C 1D5VA 2EZLA 1V54H 3CUQA 3DKXA 2M2EA 3KPHA 1ZGAA 3M07A 1YJWI 2VOPA 2KRHA 1F1ZA 3OL4A 5TGTA 3GO5A 4LG3A 2EH3A 2X1EA 2R7QA 3LA2A 4ZYDA 4BQOA 1MH3A 3EYYA 1Y0NA 4JOMA 3CJNA 1SAXA 1TT5B 1OR7A 5B1BH 5IYCJ 3W3CA 1R1VA 1BI0A 1J0RA 3IWFA 3CESA 2LBFB 4R79A 1O3SA 1MSEC 3KETA 1VNDA 3AL0B 3S8PA 1VQPI 5J4VA 1QZYA 2NYXA 1R9TJ 1N25A 4I01A 5J1YA 2E1NA 3BC8A 1YS7A 2XC7A 3C1DA 1YTYA 2GXGA 5DV5A 1W5TA 1USSA 4K2EA 4A3MJ 4L5IA 3IL2A 5HNFA 2M3AA 3ABLH 2DN0A 3CCMI 1QHGA 3HUGB 4G8XA 5FLVA 1DU6A 1TL8A 3KYDB 1ETYA 4KMUX 3TW6A 5CVRA 3FHZA 2ACJA 5FRNA 4F93B 1R5HA 3CUOA 5F64A 3CCQI 3S2WA 4Q5SF 3TKYA 2ID3A 1S8NA 3ZMTA 1KU7A 1IJWC 2DU9A 2E7XA 1Z21A 3JRDA 2V9VA 2F5EA 3DBLB 1W4MA 3CDIA 2BBYA 2VB6A 1IW7F 4JK1X 1EA3A 1LPQA 1WSUA 2V9PA 4C3IJ 2M8EA 1WZ2A 2M30A 4NC6A 4D5FA 5GPAA 2R3SA 4Y15A 4II3A 1Z6TA 2MW8A 1AA7A 2O3FA 3HSFA 3O3KA 3RPUA 2ECCA 1MNMC 2OD5A 3BROA 4QLCU 1NK2P 3HRTA 2XASA 1EJ9A 5CYVA 2X9DA 5ICEA 1SD4A 3DPTA 4EEFG 1MIJA 3FXRA 3CZ6A 4LIVA 2M87A 4KYWA 3GZ5A 2DPUA 4C2TA 3BJOA 3I59A 2XKPA 1FMWA 3PL8A 2KL4A 3AL0C 4BQQA 1OMIA 3CCUI 1TNTA 2KJBA 3FKJA 2A6EF 2NS0A 3QOEA 1X3UA 4MQVA 5CVJA 1JXSA 2GA2A 3OS1A 1TWGJ 1OYYA 3HRMA 1JUPA 4KNYA 1O7FA 2JA2A 2K9MA 4XRSA 5L3GA 3BTIA 1SD5A 3FMRA 2KZVA 2OPTA 3DPLC 2P7VB 2HQAA 1R23A 1DP7P 2R7FA 5FGMA 4QIWN 2E2JJ 1P4AA 3H3VK 3KP4A 2LRDA 1T08B 3EUKL 3GTGJ 3KLOA 1E2XA 5FKNA 2QF7A 5CVIA 5K7ZA 4HX7A 3Q9SA 4BHCA 4EM2A 2Z2SB 2CFXA 5HVQC 5FROA 1T98A 4KJZA 2JJ7A 2XAQA 3ZQIA 4WXDA 4MEXF 1BA5A 2PLYA 1BI2A 2KRCA 1XDSA 5M3MJ 2ZMEA 3L9FA 2DA2A 3JW4A 2JTVA 4G9YA 3RYPA 3MEXA 5FB2A 2QVOA 2VN2A 1U9OA 1FNNA 5BNGA 4FX4A 3W2VA 1QRYA 2LKSA 3HB9A 4BEHB 4BKXA 4D1QA 1OCZH 2QWWA 1OKRA 2RNGA 3HPHA 4U0YA 3CO6C 1BC8C 1HXDA 4ZZDA 2R7OA 1PDNC 3WTWC 1JI8A 2IVMA 3RQIA 4DBQA 4NUBA 4E7JA 1LDDA 4KIFA 4X1EA 1JHFA 1D8KA 2ESNA 3QRFF 1CQTA 2Z33A 3RSNA 4B4CA 2K9LA 1G3SA 3GW2A 2IEKA 3TDUC 1ONVA 2COBA 1FYLA 3HRUA 1ETVA 2XAHA 3LNQA 5LEKA 4B47A 4P1WA 4ITVA 4MNUA 5JR3A 2P6TA 5CPRB 1SANA 3E6BA 3PUFA 1IDYA 1IRXA 3HHGA 2DMQA 2DTRA 4H0EA 4ESFA 3PQKA 4HDUA 3HPGA 3D0SA 1VQLI 3K1MA 3IC7A 3G73A 1H89C 4DYRA 4RGUA 2G9WA 2PJRA 2V79A 3FBIB 2QZ8A 4M74A 1KYWA 1AWCA 3C18A 3R6SA 1BC7C 5B66C 4YIIA 2XVCA 5BQTA 3LSRA 1D0YA 1EKEA 4GGGA 3GLXA 1R5GA 2GBYA 3LOCA 3V8JA 2UZKA 4MLOA 1IC8A 2XF6A 1FJLA 1WPKA 2IAIA 4XOPA 3IHUA 5FD5A 3E5QA 4KN7X 2F48A 3WTTC 1H8AC 4A6EA 3NARA 3WGGA 1XG1A 1K4TA 3QPTA 4BHPA 1O3TA 4CCOA 2DQRA 3DU6A 2JA7J 2RREA 2BEOA 2XRNA 3G6EI 1FIAA 1WWXA 4IHVA 2ZBKA 2A05A 4LG0B 2EB7A 3AG2H 3BG6A 4ON0A 2VPLA 3MWMA 4PZJA 2DMPA 5CQEA 4TV7A 3FBNB 1J9IA 2DT7B 2X4HA 3WTVC 3L2RA 4L0ZB 4XKBA 3DEEA 2W57A 2JA5J 3CLOA 5FO5A 3HGYA 2LD5A 3K70C 1K78A 2EA4A 2P7CB 1J09A 2CU7A 4E7SA 4KA4A 1A6QA 2JUGA 1LQ1A 4LGWA 3H5NA 1WJBA 1YIOA 2VIXA 1Y56A 1XCBA 3Q5FA 3LQRA 2P5LC 1R7JA 1ON1A 2BXZA 4RB2C 4IPAA 3HEFA 5ICFA 2WAQN 3QYFA 3ZQLA 4CGZA 3S2DJ 4UHTA 1IDZA 1NK3P 1VI0A 3FXUA 5HLGA 2DBBA 2DFHA 4E6KG 2KJCA 5E3OA 2PBIA 2MC3A 1U5TB 3H36A 1PUFB 1UFMA 1V55H 3K7AJ 4N0BA 2H8WA 3WU1B 1JHHA 3L09A 2VJ5A 2W1OA 3GUDA 4YELA 1X1PA 1H88C 4B3XA 4DZPA 5LHIA 4D7MA 2L4MA 1XPXA 3W2AA 5F1RA 2HYGD 2CWEA 4WF2A 3VPRA 3WHBA 1MBFA 3LSTA 4JBAA 4EVIA 1W36D 4A5MA 3HGGA 2GM4A 3EUHA 1FEXA 2EWNA 4A2UA 4EJOA 1BR2A 4F3QA 4OOIA 2A07F 3KP7A 4AC0A 2L2OA 1Z1DA 4V19K 4LLNA 2CYYA 5J1UA 3MZHA 3J81K 3MMYB 4PJLA 4NNJA 2VC1A 4P5OA 1Z05A 2XKOA 3IH2A 1QVTA 2BOLA 4EV0A 1W5SA 5B3SH 5HS9A 2XAGA 3MZ8A 4KIGA 5D5VB 1FX7A 1B8IA 2IJLA 2IS1A 3MFKA 2X0LA 2DA7A 4IOCF 3CUQB 2NVTJ 2X6OA 5F0CA 1HCRA 3IV5A 2AXTC 2ME6A 3H0GJ 3SDGA 3I71A 2NVUB 4PK4A 3TDZC 4WCGA 2XUBA 4A6DA 3IH3A 1ZQ3P 1Z91A 4UV8A 5LLQA 4H4KC 2DO7A 3BY6A 2ID6A 2O8XA 5K5QA 1P7JA 1T33A 1A36A 3S3NA 2WB1N 3ECOA 3ZQHA 3F8BA 1GDTA 4I76A 2F6CA 2RQQA 1I6HJ 1X2MA 1U5TC 3R0AA 4S0HB 4BACA 1KQ8A 4Y4RA 4XL9A 3WODF 1GLNA 2X6WA 1ZN2A 1MBEA 1HC8A 2MLGA 3OYJA 4RA2A 3OYLA 4OIOF 3W6VA 2VKHA 1XGSA 1J7KA 3U1DA 3KLNA 1I3AA 2P81A 1AKHA 3FXKA 4AYBN 1FTTA 1NH3A 1J59A 4C9YA 2FQ3A 2F5FA 5GAHJ 1B4AA 2JRMA 3WTUC 1BM9A 2K3FA 2QQBA 3VYTB 4LLLA 1K83J 4RB0A 4EJWA 3I54A 3OIPA 1ZRCA 2ZB9A 4LJZF 1ZG5A 2B9SA 4HF0A 5DDGA 1R22A 2WAEA 2FF4A 4FHTA 3KYLA 1YQAA 3BQZA 3L7WA 5ICCA 2R93J 2VODA 4CCMA 2JZYA 2CV2A 4A3DJ 5ILSA 1VQOI 1ETOA 1J75A 5ICGA 1A6IA 2XB5A 3MKWB 2WAQA 3OWTA 3P5JA 2C6YA 1UG2A 2X48A 1QZEA 3LAJA 2KISA 2NS7A 2B63J 1EH6A 3CUQC 4MHGA 3N97A 2VL8A 1PP7U 3LSJA 3JTGA 1YJ9I 3DBHB 4RMNA 4BEHA 1UJ8A 4KT5C 4OINF 3GWZA 2VJIA 4HNTA 2DXIA 4ZDLA 5KHDA 2FE3A 4EJUA 1OR7C 4IQ4A 3HC7A 3LL7A 1DGWY 5TRDA 2R7TA 1SVOA 2VXZA 3CCVI 3I59B 5FKKA 1E3OC 1RIOH 1FC3A 1FYMA 3F6VA 2K4BA 1B1BA 2HQNA 3OYCA 4PJ0C 1HSJA 1REPC 5GAEJ 2VQGA 5F1JA 4P96A 4ZC3A 3GFIA 1BJZA 2DODA 3GZNB 4XKVA 3SFZA 1SFUA 3V7SA 4PSXA 4L0YB 1YX3A 5GPCA 2DOEA 3A03A 1Y1VJ 3KFWX 1QQIA 2L7MP 3OL3A 2UXNA 3I55I 2OV7A 4B1RA 4M6XA 3JRCA 3S17J 5GADJ 4EM1A 2Z99A 2V6EA 1ZYRF 2GOMA 5E1XA 1R5ID 3DXJF 2ZO4A 4V2FA 1HW1A 1T0FC 4CSWA 1Z67A 1I39A 3M3YJ 1IG7A 4BYYA 4EM0B 2FJ1A 2HGCA 2NRAC 3OMYA 2IGMA 4DQ2A 3RIRA 3L00A 2ZMEB 1Q1HA 2Y30A 3H1CA 1IGNA 1ON2A 1TP4A 2VC0A 3BT9A 3CLQA 2VUMJ 3D5RC 4M73A 2WAFA 5KAIC 3LSKA 4BUPA 1WJAA 1ZH5A 3MKZA 4UV9A 2ELKA 3G1MA 3LSGA 4XLHA 2Y9YA 2ADUA 2DTZA 3RKWA 4BXUA 1H0MA 2DPDA 3IH4A 4BJTA 5HDKA 4EGYA 1H9GA 2NVQJ 2F5CA 4A3GJ 3F22A 4Q48A 3E0JB 4A0YA 3D1NI 1IV6A 4M3EA 3G3ZA 2MH9A 4DIQA 2NNYA 2PJPA 5JHUA 2IRFG 2W48A 1AHDP 1KU2A 1G3WA 3ZGKA 3J7ZI 4JX6A 4XBFA 3TP3A 1XMAA 2O0YA 3UKGA 3GTOJ 2G7UA 2R92J 2HXIA 1R49A 2ETHA 4JX4A 1ZRDA 3NRVA 4I09A 3BG7A 2PN6A 2GWRA 2JRTA 2XSJC 4KT6A 1FWZA 5FLXK 2BY0A 4HOBA 4LK1F 3K1PA 4EQQA 2VKEA 1APLC 3H5RA 1MH4A 4I2OA 2ICWG 5IOYA 1UZCA 2HU9A 4M71A 1U8RA 3T5XA 2O03A 2PJRB 4A3CJ 4Y33A 4HLYA 2M7AA 4GFBA 2GXBA 2NOGA 3ECHA 3HOWJ 1JKPC 1BN5A 2HTJA 4IRGA 2L7KA 2L7ZA 5FD6A 2M34A 3J80K 2OC6A 2WWYA 2ZNZA 4IVNA 2HOTA 2ZMEC 2VE8A 4HV5A 1USTA 2HVQA 3OR2C 1MZBA 1QGPA 2XSDC 1YE9A 2KMUA 2R7XA 5HNHA 4QTRA 4MIMA 3CJTB 5DCFA 2E1CA 1PUFA 3S3OA 1JUMA 2LKPA 2CH0A 2WADA 5HDGA 2QQ8A 3KP6A 4ANJA 1IAWA 3GFLA 1QPIA 1MMSA 3KYCB 5LFAA 3SJMA 5LHGA 4LLGF 4HNUA 3LSIA 2HDCA 3KE2A 1ZTRA 3U1KA 3TO7A 3Q3SA 1OCPA 3ERED 1E0EA 1BW6A 1SFXA 1V5FA 1R4NB 2DMTA 5DD8A 4RM2A 4AIKA 2IS4A 4B8XA 5HLHA 1ZR4A 5TISC 2ZXIA 5FKLA 3B6CA 4CCJA 2XGCA 3NQOA 4D7NA 1ZRFA 5EZHA 3E3VA 2AS5F 3COAC 3CCLI 1DPUA 1X1BA 2JPCA 4XSZF 4LIUA 4BXFA 2H6BA 2XRLA 2WV0A 1NHAA 1FSHA 3C3WA 5D4SA 2EK5A 1I1GA 3NWSA 3ZR8X 3S14J 5DUIA 3HOZJ 2M8GX 3SHFA 2Z3YA 2N8GA 4L5EA 3K4BA 2CJJA 1D1BA 3R0JA 1YG2A 3F23A 4R8HA 5ILVA 2E2HJ 3A01A 1X58A 2GAUA 2HPIA 2QKLB 2FOWA 3GLLA 1AU7A 2VPRA 3GTQJ 5AONA 2QEXI 2F4IA 3OYAA 3T0YA 2IPQX 3OSGA 4HQMA 4KITB 5FJ8J 3I56I 1SD7A 1ETKA 2KIUA 2KIMA 2PFBA 3VYUB 3FKIJ 3EUAA 3V8KA 4PCQA 4BAYA 1QO0D 2Q2EB 5IT9K 5JHFA 1YYVA 4OIRF 5GAGJ 2EZIA 1J2XA 1FPQA 2RDPA 3CDHA 4XRSG 2KIFA 2ZSHB 1T56A 1P4XA 2HOSA 1T0FA 1Z9CA 1POGA 2RGVA 2R7VA 5IOZA 2P4WA 3F9KA 3KZZA 4E4HA 4HX8A 5BPIA 4DYQA 3O6BB 1O4XA 2EFPA 2VASA 1JKRC 2Y0MA 1B8IB 2CFOA 4UUSB 3HTSB 3BJAA 2DYRH 2FUG2 4FE4A 4U87A 4U7DA 4BY1J 4RGXA 5DEQA 3D5LA 1BBYA 1Z3XA 3CJRB 1F9NA 4V2GA 3E5UA 1QPMA 2GQQA 3SFIA 5H2FC 1LVKA 3LMMA 4BDZA 1JGSA 2EBIA 4DNCA 1W5CC 2EV5A 3WG9A 5DTDA 1FY7A 1JKOC 2VONA 1LUJB 5F6FA 3V7RA 4HX4A 3NAUA 4XLFA 1M1EB 3OYNA 3HTUA 5JLWA 4HAMA 1B59A 1W0TA 1HSTA 2H27A 2HS5A 3I64A 2L9VA 3ABUA 3QODA 4XLCA 3ZQQA 3VSKA 3CP2A 1HA8A 5E1ZB 3BR6A 3T1BA 2LC2A 3IWZA 5LRSA 1AKHB 5EZGA 5CLSA 3PQJA 5H20A 2MG4A 4XK4A 2ZC2A 3REOA 2R7ZJ 3EUHC 5IYBJ 2TCTA 2YSRA 2CGPA 3BR1A 3RPUD 3J81Z 3U2RA 4HYEA 4CYDA 2RQPA 3DEWA 2HR3A 2LF8A 3BWGA 3FISA 4G7HF 2IXSA 1WVRA 4RAZA 1ZARA 2M0CA 3HM5A 4B43A 5GTIC 2OTLI 2OUMA 3OYKA 3ZRGA 4WXHA 2BW3B 4EATA 3LSPA 2QUFA 2BHZA 4C2UA 2LLKA 3OIOA 2ZFUA 1Q1VA 4RB3C 2UWMA 2CG4A 4BJ5C 4C3HJ 2RC4A 4XNFA 4F91B 5BMZA 2K85A 3JRIA 3N4MA 3EQLF 5LD2C 1DPRA 1NG6A 1XC5A 1ZKGA 2X51A 4QPOA 5K5RA 1K7AA 3BG3A 3GTLJ 1LE8A 5HODA 1UAAA 3PUBA 2MD5A 4XSXF 1BR4A 3S16J 1V4RA 1CF7A 2VQLA 2CW7A 3JRFA 2LYCA 4D5CA 1SAUA 4XM3A 3ZQCA 2LSOA 1LKXA 1BW5A 3QOPA 3GTMJ 1UB9A 1X1AA 1QA6A 3QPHA 4LOCA 1R36A 1XN7A 2EFWA 1E3HA 3OR1C 2E1MB 2L02A 3G1OA 3SYTA 4IHTA 3K1NA 1TWHJ 1GVJA 5E20A 3TW7A 2FXAA 3RKQA 4W1UA 4IL6C 2JUCA 2W7NA 4IHYA 1LEAA 4CH7A 1YJNI 2NOJB 4JQFA 4FCYA 2IW5A 2O9LA 3BTLA 4N4NB 1SFKA 4LB6B 1GV2A 4XLNF 4S04A 3IAM2 2DFEA 4WK8F 4I6ZA 2H8RA 3HSEA 2QSFX 3NWTA 3HXLA 5FLMJ 1Z0XA 5J8CA 4ETSA 3PNVA 2ECBA 3F72A 4I0BA 1WI9A 1RNLA 1SC7A 2G7HA 1RETA 1ERDA 2EV0A 4YFKF 2L0KA 3VWBA 4J01A 6PAXA 2ME0A 2E71A 4NBQA 2MLKA 4HPQA 1ZAOA 2LP0A 1TWFJ 3IAS2 1BOBA 4XLAA 4AIJA 3H0DA 2LREA 3GVAA 1SFEA 3DPUA 1KGSA 2R4GA 4FASD 1VQ8I 4IX7A 3L2UA 1W1WE 4DBRA 4M3DA 1KONA 3FDYA 2K3PA 4A3BJ 2IBDA 2XAJA 3S3MA 3GYHX 4MO7A 3VYSB 5E18F 2KQRA 2DYSH 2Y69H 4EJVA 2DA6A 4IF4A 3HOXJ 1OCTC 4OAZA 4JX5A 1ZK8A 2ZCWA 3GTPJ 3CMMA 3KZYA 5KK1A 2FOKA 1OISA 5JFRA 1FBSA 3W6KB 1S72I 2VQCA 1XDUA 1HBXG 3KP2A 3VFZA 3WTZA 1H9TA 4M6YA 3CCYA 1P7IA 2DFFA 1IF1A 4IO9F 4IRIA 5GTHC 4BE0A 2E1MC 4YRVA 3H9QA 4PSWA 4J00A 1RZ4A 2IP2A 2FA5A 2DOAA 5F27A 2L9NA 1ITYA 4HDVA 3HG9A 1ZGWA 3O8GA 3F0CA 3CC7I 1ZREA 3BR2A 1G6NA 4CA0A 2NVXJ 4IXAA 2BYVE 1Z7LA 2E35A 1JTXA 3HSRA 2JT1A 5M5YJ 2BV6A 4A5NA 1ETQA 3OYFA 1MD0A 1P4WA 2JQ7A 4L9JA 3CMYA 4ZDPA 3I4NJ 4HV6A 1RRJA 5D6EA 4G12A 3ESWB 1MMGA 1RKTA 2W24A 3E6DA 1R4MB 2Y9ZA 1WI3A 2CS3A 3JRGA 3KP3A 2I8DA 1QZZA 3RQ4A 1PYVA 2COMA 3TO9A 1IUFA 2XAFA 5E17F 3P9IA 4MGRA 1Y8RB 1B9MA 3DBRB 1E3PA 3TL4X 1EF4A 4OMYA 2D5VA 1G59A 4RS8A 2FD5A 5A2QK 3JR9A 2HTSA 1IN5A 2VKDA 4HBLA 3BOQA 3J7AO 2Q2EA 3CC2I 3JREA 3BQYA 3ZXSA 4DOZA 2K9QA 3JTHA 3DKWA 2RNJA 1DDNA 3E97A 1S29A 1IRFA 3MKYB 5H6RA 4E70A 1LDKB 2V9KA 3M8EA 2VOOA 2JPBA 3Q0VA 2EINH 3C2BA 4M6VA 2WY8Q 5FLXZ 1V5EA 4AVZA 2XF5A 1VQ7I 2MFZA 3TOAA 4A93J 3ZN1A 4J19A 1OJLA 3GFMA 2XHKA 5E3LA 4NQWA 2E19A 2JA8J 4Y7NJ 2V4JC 4UUSA 2QGUA 3RZOJ 3S1MJ 5L3CA 1D0ZA 1P92A 3LA3A 4BDYA 1ZR2A 2K9NA 1ZG3A 4AD9A 1W7PA 2KLOA 1X4PA 4BBRJ 2TDXA 5J3LA 2VJ4A 1X1CA 4PFOA 3J80Z 3CC4I 1S3JA 2JN6A 3JAMK 1YHQI 3R4KA 2GOXB 3QU3A 4MEYF 3PIOF 3A01B 4N9IA 4O5VA 1GVDA 3BPXA 4BBSJ 1TWAJ 3S1NJ 2EIKH 5DYMA 1FBQA 2VLAA 1YO5C 1YW8A 3IRQA 2G0EA 4I0AA 1ETXA 2F2EA 4S05A 3WHCA 4U0WA 2QYOA 2GA1A 5DCMB 4B44A 1XSDA 2CW0F 3FF5A 4LMYA 1Z77A 3KX2A 1QU3A 4I98B 3CD6I 3M8FA 4X6AJ 3FXQA 2D1VA 2LVSA 2OTJI 1TNSA 2CQNA 2IS2A 1WH5A 3S32A 2DMUA 5F0FA 1TW2A 2AHQA 2R5YA 2IGKA 4F92B 2OJED 4B09A 2W4SA 2M45A 4ESBA 4OMZA 2KPMA 4D0PA 1FIPA 2W25A 4ZH4F 4PFPA 1E17A 4G7ZF 3DLAA 1T6SA 2LY9A 2V7FA 2YUSA 4WXCA 4HF2A 3ASOH 2PEXA 1WH7A 2YX4A 4W97A 3HOUJ 1MJAA 2CQ7A 4NC8A 4AU7A 2CQXA 5IP9J 3ZQ7A 1ZG1A 5HOOA 3HYIA 2M9HA 2BW3A 2L4AA 1WCMJ 2AQFA 3F6OA 4RBOA 2WBMA 3E5XA 3K6GA 2V1UA 2LK2A 4L18B 2HKXA 2EZHA 1VF9A 3S93A 4FISA 4RAGA 1I50J 4C3JJ 2M7BA 2DT5A 2KZGA 3ZQGA 4A0XA 5LGTA 4Y17A 4BH9A 4DW6A 3A02A 3ZMVA 2JSPA 2JK3A 3ZMDA 3KEQA 2FBHA 2XV4S 2ZXJA 4EGZA 1HW2A 1G3TA 1NTCA 5K7HA 2QSHX 3H35A 4HZFA 4KN4X 2MBFA 1F36A 2Y2ZA 4Y13A 2L3DA 2BY1A 2R0QC 4G6DA 3GXOA 4A3JJ 1TLHB 2WTEA 5LBQA 5IT9Z 4MFDA 3Q0WA 4RM3A 3ZP5A 3KEOA 1DU0A 1VQKI 1OYWA 1Z7UA 2CUEA 1A5JA 1BR1A 1RUOA 3HZJA 3VDXA 1RUNA 1X3WB 1Z6RA 1WQ2A 2Z1DA 2R7RA 1LEBA 4F55A 2OCCH 2XROA 2STTA 5JI6A 3GCMA 2BVMA 4A3FJ 4XOTA 2K02A 1TWCJ 4KIBA 3M8JA 2ZJQF 3WE2A 4Y3OA 2QA4I 2FRHA 2P5KA 1V5GA 3HIFA 3M1CA 3V8LA 1VQNI 3SEQA 1VFCA 1ACIA 2L7FP 4XRMA 2GXAA 2H6CA 4NB5A 4BQAA 3MAJA 1D0XA 1FOXA 2R7SA 3GF2A 3FK7A 3E6MA 1Y1WJ 2BY2A 4YFNF 1T8IA 5D4RA 2L01A 1YITI 1MJ9A 3K70D 3BTJA 3JRAA 4IRHA 3RZDJ 4XR6A 2PG4A 3DTEA 2M0MA 4YIRX 1LE8B 5BOXA 5B5EC 4BNCA 1BI1A 4UY8I 3BPVA 2K86A 2K5CA 3OYHA 4OAYA 1MNDA 2LF7A 3DCFA 4XMYA 1U6GA 3OOPA 1QVUA 2BHYA 1P6RA 1CF7B 2AQEA 2E60A 2WV1A 3L2CA 2OCEA 4XKWA 5M3FJ 2NXNB 2PX9A 5C3EJ 2VT2A 2KT0A 2KKOA 4RDUA 2DLLA 3SEZA 1TTYA 4I99C 3CTAA 5D5WB 2RKHA 1KQ0A 1MDMA 1FYKA 3O2PE 5CJ9A 5IYDJ 2MGQA 2Q8KA 1MW7A 2LMDA 4XRFA 2HZDA 2DA4A 4CUGA 3F8FA 1VZ0A 3VEPA 3ULQB 1TQMA 4UXNA 2I10A 3A1YA 2Q0OA 1PP8F 3S2HJ 1Z3YA 5FKOA 3TMOA 5M5XJ 2IGOA 4A3KJ 4OWRB 3FXLA 3ZCOA 2YU9J 4HF1A 1L0OC 3FXMA 4M3GA 2J5OA 4E7ZA 4Z6YA 2FBKA 4UNOA 1YLFA 1HKTA 1GHCA 4B48A 3R60A 3BCAA 2YU3A 5F08A 3AKZA 3DV8A 4LD5A 2LNBA 3I5UA 4R1HA 2CUJA 1IXSB 1YX5A 2FBIA 3DU5A 4PUSA 1S7AA 4BL0B 2NAZA 3NEUA 3TO6A 1WJFA 2H1LA 4M72A 4N4OB 1IXCA 3EETA 2DFIA 4I02A 3PFYA 3CJQB 3VB2A 3X2QH 3DTKA 3EYIA 2F5VA 1O57A 4QWQA 3M4OJ 4CYCA 5HDNA 1ZGJA 5L3EA 3QP6A 5E3NA 1UCRA 1G4DA 5GP9A 1P9QC 3QPLA 1FP2A 2EZKA 2LFBA 1Y8QB 1R1UA 3CMEI 1D8JA 1X2NA 2F5DA 4KISA 2HYJA 3M1EA 1I5ZA 2EA2A 2HOEA 3FZVA 2OZ6A 2ZXWH 2KIQA 4CICA 4HG2A 2BZTA 2EPFA 4LFUA 1K4SA 1WKMA 3QPSA 2B7EA 3DQVC 2CQKA 2V26A 4NHJA 2X6XA 5J47A 1D3YA 2CSOA 2BVLA 1IRGA 1NG7A 3S1QJ 1XMKA 2ZNYA 3PIPF 1J5YA 2L54A 2YS9A 4BQNA 3FXJA 3K2AA 2E5ZA 1UHSA 3RPQA 1OFCX 2OQRA 4E7LA 4RGRA 2IT0A 5IT3A 3BG5A 2MH2A 2W84A 1BJAA 3K69A 4ZYHA 3G4SI 3K4NA 1HDPA 1DP3A 2H09A 1A31A 1MGTA 4M9ZA 1OCCH 1LJ9A 2LY1A 4ZTFA 5CVUA 2CUFA 4UVBA 5E8IA 3OYDA 2JVGA 2BY3A 4AVPA 3BJ6A 1HDDC 1W0UA 3ASNH 3BCBA 5TJJA 3HJEA 3EPZA 1EH8A 2CV0A 3IP4B 2HZTA 3KIOA 1U2WA 2E2IJ 4CZCA 3ONQA 5DCMA 4M9XA 1OCRH 2MYSA 3TEDA 4Z2YA 2VT3A 1XGNA 3RYRA 1MKMA 2QQ9A 4BXXJ 4UB6C 2V6CA 1QHHD 4NDLA 3RDIA 2A6HF 2I5UA 3DFGA 4YEJA 1XB4A 1Y39A 5AIQA 2AO9A 5LGUA 1C0WA 4HNVA 3K4KA 5D6FA 4UUTA 3HKZA 3DP7A 4DGWB 5IP6A 1WHUA 4BGDA 3IKVA 2L5QA
chains in the Genus database with same CATH topology
1YJWI 3G6EI 3CCJI 1VQ7I 2ZJPF 1VQKI 3CF5F 3CCLI 5DM7F 1HC8A 1VQPI 2E36A 1VQ8I 3CMEI 3CC4I 2ZJQF 1YHQI 2QA4I 1VQNI 5GAHJ 3PIOF 1YI2I 2K3FA 1ACIA 3G71I 3CCMI 1FOXA 5DM6F 3CCEI 3J7ZI 1S72I 1VQ5I 3CCQI 3DLLF 3CCRI 2FOWA 4IO9F 2OTLI 1VQ6I 3CMAI 5JVGF 1YITI 1VQOI 2QEXI 3CD6I 1VQ9I 2H8WA 3PIPF 3I56I 2OTJI 3CC7I 1VQMI 4UY8I 1YJ9I 3G4SI 2E35A 5GAGJ 2ZJRF 2JQ7A 1VQLI 2NXNB 1FOWA 1YIJI 3CCVI 3CCSI 4V19K 1QA6A 5GAEJ 1VQ4I 3CJTB 3CCUI 2E34A 1Y39A 4IOCF 1YJNI 1MMSA 3CC2I 4IOAF 3I55I 5GADJ 3J7YJ 1FOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW I;  3G6E I;  3CCJ I;  1VQ7 I;  2ZJP F;  1VQK I;  3CF5 F;  3CCL I;  5DM7 F;  1HC8 A;  1VQP I;  2E36 A;  1VQ8 I;  3CME I;  3CC4 I;  2ZJQ F;  1YHQ I;  2QA4 I;  1VQN I;  5GAH J;  3PIO F;  1YI2 I;  2K3F A;  1ACI A;  3G71 I;  3CCM I;  1FOX A;  5DM6 F;  3CCE I;  3J7Z I;  1S72 I;  1VQ5 I;  3CCQ I;  3DLL F;  3CCR I;  2FOW A;  4IO9 F;  2OTL I;  1VQ6 I;  3CMA I;  5JVG F;  1YIT I;  1VQO I;  2QEX I;  3CD6 I;  1VQ9 I;  2H8W A;  3PIP F;  3I56 I;  2OTJ I;  3CC7 I;  1VQM I;  4UY8 I;  1YJ9 I;  3G4S I;  2E35 A;  5GAG J;  2ZJR F;  2JQ7 A;  1VQL I;  2NXN B;  1FOW A;  1YIJ I;  3CCV I;  3CCS I;  4V19 K;  1QA6 A;  5GAE J;  1VQ4 I;  3CJT B;  3CCU I;  2E34 A;  1Y39 A;  4IOC F;  1YJN I;  1MMS A;  3CC2 I;  4IOA F;  3I55 I;  5GAD J;  3J7Y J;  1FOY A; 
#chains in the Genus database with same CATH topology
 3JSO A;  3B6A A;  1SD6 A;  3U21 A;  4OIP F;  2GIZ A;  1GXP A;  3ZN0 A;  4NQW B;  2M4K A;  4F7Z A;  5EG0 B;  4G7O F;  2DOF A;  3MCZ A;  3QWL A;  5KVR A;  4BJ6 C;  3DWL E;  1UHM A;  2YR2 A;  3CF5 F;  2P0W A;  1W7P B;  3LFK A;  3AG1 H;  5ERI A;  4G94 A;  2K7L A;  2QKM B;  1YOV B;  3R61 A;  4E7K A;  3OYB A;  2DJN A;  2XF7 A;  4XID A;  2VXD A;  3AG3 H;  5KCM A;  2QQA A;  2E36 A;  1D5Y A;  2ELJ A;  3KZI C;  1XSV A;  1PJR A;  3L2W A;  3MKL A;  4ZYE A;  1IN4 A;  1I1S A;  3E6C C;  3SZP A;  2X6Y A;  2H94 A;  5D5U B;  1MBJ A;  1IN7 A;  2XPV A;  3G71 I;  3A0B C;  3B73 A;  4MTE A;  2A61 A;  1BI3 A;  1OQY A;  3G2B A;  1W36 C;  1KA8 A;  2STW A;  4Y52 J;  1MMN A;  1K79 A;  1TQP A;  1F4K A;  1S7O A;  1OLT A;  2NS8 A;  5A2Q Z;  1EH7 A;  1T2K A;  2KDO A;  1N77 A;  2IS6 A;  1MNE A;  3PSF A;  2JVH A;  3ABM H;  2GZW A;  5CQG A;  3CMA I;  3QYB A;  5EF6 A;  4M9S A;  3CQZ J;  2MA3 A;  3K9T A;  2Y0S A;  1I27 A;  3BG9 A;  1S5L C;  2R5Y B;  4ZYG A;  4FET A;  4MFE A;  3QU6 A;  1T38 A;  1B9N A;  2HOA A;  4U7B A;  3T8T A;  1VQM I;  3OYE A;  2DQL A;  4CDG A;  2R7U A;  3MD2 A;  3PSI A;  2KP6 A;  1UHW A;  2KHM A;  4HRI A;  2A5Y B;  1MJB A;  4XKC A;  3RKX A;  3K4C A;  1RES A;  4C30 A;  2PI0 A;  4GYI A;  4A3L J;  5EYR A;  2VBZ A;  2VBX A;  3WU0 A;  5C44 J;  3PM1 A;  4BE2 A;  3PJR A;  4Q47 A;  5L3D A;  3K4J A;  4WWC A;  2DK8 A;  2LY2 A;  4GCV A;  4ESJ A;  2HYF A;  2BE5 F;  2QLZ A;  2OAZ A;  2GIV A;  2KFD A;  2HDD A;  1STZ A;  3N05 A;  4ZZL A;  3JAM Z;  4DJA A;  4FT8 A;  1XCV A;  4ZJZ A;  2Z9O A;  2OZU A;  4RAY A;  4U88 A;  4AUX A;  1JT0 A;  5L3F A;  2W82 A;  4KFC A;  5E3M A;  2XAU A;  4OU0 A;  2Q1Z B;  4XOR A;  2BGC A;  3PNT A;  3OY9 A;  3OYI A;  2ESH A;  3JRH A;  3K2Z A;  3QYE A;  4A0Z A;  3HOT A;  3K4L A;  1IV8 A;  1O3R A;  2FNA A;  2OBP A;  2YPR A;  3DTI A;  2DI3 A;  1SVL A;  3FXO A;  4ABZ A;  4AWX B;  2HFH A;  2J5P A;  4HA8 A;  5D5X B;  2PMU A;  1DQU A;  3ML6 A;  5D8L B;  2NVY J;  1G3Y A;  1TBX A;  2EFN A;  4ASN A;  3RI4 A;  5JLX A;  3UNG C;  1WJ5 A;  2B0L A;  5J8F A;  5M5W J;  3PO2 J;  2HKO A;  1S7E A;  1FP1 D;  2A69 F;  2ISZ A;  1F43 A;  2ELH A;  2IGN A;  3I0T A;  3K10 A;  1R71 A;  1JE8 A;  2IA1 A;  2Y75 A;  3RTR A;  4CXF A;  2HI3 A;  4XIC A;  4GRI A;  5BS6 A;  2QBY A;  3PO3 J;  3MZY A;  3M7G A;  3FMS A;  1HW5 A;  1U0J A;  5J4Y A;  3HL2 A;  5FKM A;  1GV5 A;  1MMA A;  1JUS A;  3C7J A;  1JTY A;  3RCO A;  1QBJ A;  2JA6 J;  1FOK A;  1IZ1 A;  1MBG A;  3IUO A;  5DM6 F;  2VBW A;  2Y31 A;  2L9R A;  1DUX C;  3AFH A;  4HST A;  5EDN A;  4WX9 A;  3DLL F;  2RN7 A;  4GYG A;  2P5V A;  3E1S A;  3HOS A;  5JVG F;  3HOV J;  3OYG A;  1RC9 A;  1FZP B;  1VQ9 I;  2P8T A;  3G1L A;  2XPU A;  4HW0 A;  4CHU A;  3F8N A;  3FIW A;  3W6J B;  3OS0 A;  2VKV A;  4G6T B;  1YFH A;  2EIJ H;  3LQQ A;  4HEA 2;  3VOD A;  2PMH A;  1DGR M;  4CO8 A;  4L9T A;  3MN2 A;  2X1C A;  2ZKZ A;  5LRR A;  1SEU A;  2LR8 A;  5ILU A;  3HRS A;  3IKT A;  4AM3 A;  3JRB A;  3RKY A;  3V42 A;  3OIQ A;  2OU2 A;  1TW3 A;  2RVC A;  2DT6 A;  3FK6 A;  2WA0 A;  2XIG A;  3QQA A;  1JGG A;  2HEO A;  4JYK A;  1B72 A;  2R5Z A;  4RB1 A;  2ZXH A;  1UMQ A;  5F0H A;  1YIJ I;  1YS6 A;  5K1Y A;  3VSL A;  1MDM B;  2MD0 A;  2K27 A;  2QEN A;  5FFZ A;  3PFI A;  3CCS I;  1LDJ A;  4FQG A;  1R6R A;  1XGO A;  3FM5 A;  4IZZ A;  3WU2 C;  4PGH A;  5EGO A;  5DS9 A;  3GTJ J;  1LNW A;  4L5J A;  4P9F A;  2CRG A;  3WGI A;  2DW4 A;  4HLX A;  2D2W A;  4BS9 A;  5HLT A;  2EIL H;  4HSR A;  1G2H A;  2M1B A;  3HHH A;  1B6A A;  3L2Q A;  1SMY F;  3A2K A;  5J6X A;  1I3Q J;  2UXX A;  3J7Y J;  1ZLK A;  3ELK A;  1FOY A;  4YFX F;  2CV1 A;  4UUV A;  1V3F A;  4AID A;  2P6S A;  3F21 A;  3CCJ I;  1XD7 A;  4O6J A;  3KCC A;  2F4M B;  1LFP A;  1X3Z B;  2JMW A;  2ZJP F;  1HF0 A;  3DF8 A;  2W85 A;  3CDL A;  3QP5 A;  1BOA A;  4D9J A;  4CYC B;  2QSG X;  5KNL A;  4IKF A;  1I6X A;  5IY5 H;  1YRN B;  1A04 A;  4L9V A;  1FT9 A;  3FHN A;  2DMN A;  4MTD A;  2LBF A;  2O7O A;  4ENN A;  5E79 C;  3F8M A;  1F5T A;  5LEJ A;  1FMV A;  5HLI A;  3OYM A;  4RLQ A;  3BZK A;  4BE1 A;  2LH9 A;  2CUZ A;  1D1A A;  2EIM H;  2GLO A;  3EDP A;  4RAF A;  3CCE I;  1O7L A;  1A35 A;  1WGX A;  5E8G A;  4IHS A;  5K7F A;  5EG0 A;  3HUG A;  1X19 A;  2FU4 A;  4DZJ A;  5IP7 J;  3CCR I;  3WTY C;  2XPW A;  3F8C A;  3FX3 A;  1ZEL A;  3UR3 C;  2LOO A;  3L2V A;  2JSC A;  2UUZ A;  3QAH A;  3SQN A;  4CCL A;  2E5N A;  5JVT A;  4YG2 F;  4CZZ A;  1Y6I A;  3GZ6 A;  2DA5 A;  2X85 A;  2MC4 A;  1MSF C;  3GME A;  3WTX C;  1R58 A;  3F3X A;  2NNN A;  4A69 C;  2FSW A;  1N78 A;  3I3L A;  3H92 A;  3I53 A;  5CKT A;  3ZMU A;  4A3E J;  1OCO H;  1LB2 A;  2ZJR F;  5EEH A;  4HQE A;  5HS8 A;  3J7A Y;  2HWV A;  1LFB A;  5FFX A;  1PUE E;  4AIH A;  3GX4 X;  1RKW A;  3AG4 H;  4IHW A;  4N9H A;  2DDA A;  3B02 A;  2FNP A;  3BZ6 A;  4BU2 A;  4B3A A;  5EJC A;  3U9G A;  3MVP A;  3WG7 H;  4QPQ A;  3H5A A;  2FML A;  1W7P D;  2OF7 A;  2HPM A;  3RJP A;  3H9J A;  2EJR A;  2HQ5 A;  2Y48 A;  1O3Q A;  4UB8 C;  5BPD A;  1FBU A;  4XQF A;  1R00 A;  2DDB A;  1T95 A;  3BLY A;  4X0G A;  1SFO J;  1MBH A;  4FTH A;  1ULY A;  3SZG A;  5D8K B;  5B1A H;  4I7H A;  1OYI A;  4IOA F;  1RPW A;  5E1W A;  2YX7 A;  1Y0U A;  2E1O A;  1WRJ A;  2MAB A;  3TGN A;  2HQR A;  1JT6 A;  3P7N A;  2K4J A;  4ZDO A;  1QNT A;  2H1K A;  4IJA A;  5C4J J;  3K0L A;  1AOY A;  4GDF A;  2PMZ N;  2QM3 A;  2A6T A;  1EV7 A;  1KZH A;  3AAF A;  4ENJ A;  2LKX A;  3HOY J;  2CQQ A;  1KU9 A;  2FQ4 A;  2VBY A;  2R7W A;  1T39 A;  4C2M J;  4XN3 A;  1XX5 A;  2D1H A;  3LFU A;  1GUU A;  3DEU A;  1BIB A;  3Q0U A;  5IPA A;  4JP0 A;  3VOE A;  2M4G A;  5HS7 A;  5DM7 F;  3M9A A;  4IQJ A;  3ZMZ A;  2O61 A;  1X1D A;  1FLI A;  1ENH A;  3MQ0 A;  3P9C A;  4XN0 A;  5LHH A;  1LFU P;  1LVA A;  4IEJ A;  1VTN C;  3ISP A;  2DA3 A;  2X1D A;  1TQI A;  3L1P A;  2R7D A;  1IUY A;  3C2G A;  3KP5 A;  3FMQ A;  3LSM A;  1TT0 A;  3JSP A;  2HVS A;  1P2F A;  5CVV A;  4UVC A;  3TP0 A;  1CGP A;  1MBK A;  2RV8 A;  3ZMS A;  4LK0 F;  2V1X A;  2VQH A;  3BZC A;  1BL0 A;  2OA4 A;  4UVA A;  2Z5U A;  1VQ5 I;  2IA0 A;  5EEG A;  4CCN A;  2XGD A;  5ED4 A;  1XSX A;  5C4X J;  3TBI A;  4FX0 A;  2OQG A;  1RI7 A;  1XS9 A;  3S15 J;  2WC2 A;  1HQC A;  1N75 A;  4A12 A;  2KRF A;  2IA2 A;  1WJE A;  3WGH A;  2CMP A;  4EMS A;  1ETW A;  2VI6 A;  3S1R J;  4O3M A;  3GFJ A;  3V7C A;  2K9S A;  3D5S C;  4PJJ A;  5J40 A;  1YW7 A;  2CO5 A;  3OV8 A;  2O8K A;  3LWF A;  4P9U A;  2MSY A;  3Q9V A;  1HKS A;  2EFQ A;  4II2 A;  4YIF A;  2XB0 X;  1G8X A;  3TQN A;  4EJT A;  1FOW A;  2PQ8 A;  1L3L A;  2XGX A;  1YW9 A;  4OIQ F;  3LAP A;  1ODD A;  2QCO A;  1JJ8 C;  4P55 A;  1JKQ C;  4PJN A;  4KIC A;  3TOB A;  2XGE A;  3KEY A;  2EFO A;  5DUK A;  1WJD A;  1IXR C;  4Q4Z F;  3BR3 A;  2L9S A;  2VJJ A;  5KAF C;  2F4O B;  2ZFW A;  4U0V A;  3GBG A;  2E34 A;  1JJ6 C;  1XMX A;  1RR8 C;  3FWE A;  3LA7 A;  3HDD A;  1UEL B;  2WB1 A;  1SVM A;  2O6G E;  1D1C A;  1ZLJ A;  1ORK A;  4E7I A;  3ZPL A;  3CP8 A;  2A5W A;  3I4P A;  3SZT A;  2HDW A;  3H3Z A;  2D45 A;  2V1N A;  4IHX A;  2ZJ2 A;  2EQR A;  1IN6 A;  2FMY A;  3ROU A;  1XTA A;  1FSE A;  1ZHF A;  1OPC A;  2A3S A;  4L9N A;  4ZYA A;  3BDD A;  1BIA A;  1SMT A;  3SDB A;  1IRZ A;  1KYZ A;  4NC7 A;  1HLV A;  3HKZ N;  4ENK A;  4M3B A;  3ABT A;  1UG0 A;  4AYB A;  3SXY A;  4A3I J;  2BXY A;  3OSF A;  1S6L A;  4LG0 A;  3I58 A;  4QSH A;  2QBY B;  3HBL A;  1X4O A;  2KDZ A;  2CW8 A;  1XGM A;  2PMZ A;  4PGG A;  4CCK A;  5J1R A;  1R1T A;  4RLF A;  2VE9 A;  3GTK J;  4G6Q A;  4LB5 A;  2EV6 A;  3A4C A;  1S9H A;  2DK5 A;  2AXL A;  4GXO A;  5L3B A;  4KDP A;  2WY7 Q;  2O5R A;  3DKY A;  2RAE A;  5EEA A;  2DA1 A;  4PJM A;  3WTS C;  1YI2 I;  3ERM A;  3FM3 A;  4FE7 A;  2JWT A;  4PDK A;  2LDU A;  4ENM A;  2UV1 A;  2HVR A;  4BHB A;  1WJC A;  4E7H A;  4ZTJ A;  1PVE A;  1IN8 A;  3C2H A;  3I9V 2;  3H3U A;  3LSH A;  3VYR B;  4LIT A;  1HOM A;  1GXQ A;  4XLP F;  2DAO A;  1K6Y A;  1VQ6 I;  2HNH A;  2FX0 A;  2LTP A;  4KUM A;  4F52 A;  4XON A;  1KQ9 A;  3ZOB A;  3P9K A;  2DCE A;  2K40 A;  1YRN A;  3BP8 A;  3WE3 A;  3ZQF A;  1K6O A;  3I4M J;  1KU3 A;  2A68 F;  2M5W A;  3CF2 A;  5K5O A;  1RR7 A;  5DD4 A;  5AIP A;  1U5T A;  1WFX A;  3O8H A;  9ANT A;  4GO1 A;  3ABK H;  1B72 B;  2R5Z B;  1IO2 A;  5FRM A;  4M3F A;  1MMD A;  1U3E M;  2W00 A;  2Y0S N;  4BY7 J;  5LGN A;  1U8B A;  3V4G A;  3PNY A;  2DJI A;  3A0H C;  3BR0 A;  2TRT A;  3OOU A;  4MQ9 F;  3IRR A;  2LG4 A;  2E7W A;  5EGO B;  1HKQ A;  1K61 A;  1TZL A;  1U78 A;  3BR5 A;  2FEZ A;  5F04 A;  1GT0 C;  1TC3 C;  5H6Q A;  1VQ4 I;  3T8R A;  3W2W A;  1FTZ A;  2HXO A;  2XDV A;  4DYC A;  4RGS A;  3JCU C;  2Z16 A;  3E7L A;  2V1D A;  3OS2 A;  1K78 B;  3GEZ A;  4KMF A;  3K4M A;  2ZSI B;  1U9N A;  3BTC A;  3H9G A;  4XLE A;  2ISY A;  3CO7 C;  1D5V A;  2EZL A;  1V54 H;  3CUQ A;  3DKX A;  2M2E A;  3KPH A;  1ZGA A;  3M07 A;  1YJW I;  2VOP A;  2KRH A;  1F1Z A;  3OL4 A;  5TGT A;  3GO5 A;  4LG3 A;  2EH3 A;  2X1E A;  2R7Q A;  3LA2 A;  4ZYD A;  4BQO A;  1MH3 A;  3EYY A;  1Y0N A;  4JOM A;  3CJN A;  1SAX A;  1TT5 B;  1OR7 A;  5B1B H;  5IYC J;  3W3C A;  1R1V A;  1BI0 A;  1J0R A;  3IWF A;  3CES A;  2LBF B;  4R79 A;  1O3S A;  1MSE C;  3KET A;  1VND A;  3AL0 B;  3S8P A;  1VQP I;  5J4V A;  1QZY A;  2NYX A;  1R9T J;  1N25 A;  4I01 A;  5J1Y A;  2E1N A;  3BC8 A;  1YS7 A;  2XC7 A;  3C1D A;  1YTY A;  2GXG A;  5DV5 A;  1W5T A;  1USS A;  4K2E A;  4A3M J;  4L5I A;  3IL2 A;  5HNF A;  2M3A A;  3ABL H;  2DN0 A;  3CCM I;  1QHG A;  3HUG B;  4G8X A;  5FLV A;  1DU6 A;  1TL8 A;  3KYD B;  1ETY A;  4KMU X;  3TW6 A;  5CVR A;  3FHZ A;  2ACJ A;  5FRN A;  4F93 B;  1R5H A;  3CUO A;  5F64 A;  3CCQ I;  3S2W A;  4Q5S F;  3TKY A;  2ID3 A;  1S8N A;  3ZMT A;  1KU7 A;  1IJW C;  2DU9 A;  2E7X A;  1Z21 A;  3JRD A;  2V9V A;  2F5E A;  3DBL B;  1W4M A;  3CDI A;  2BBY A;  2VB6 A;  1IW7 F;  4JK1 X;  1EA3 A;  1LPQ A;  1WSU A;  2V9P A;  4C3I J;  2M8E A;  1WZ2 A;  2M30 A;  4NC6 A;  4D5F A;  5GPA A;  2R3S A;  4Y15 A;  4II3 A;  1Z6T A;  2MW8 A;  1AA7 A;  2O3F A;  3HSF A;  3O3K A;  3RPU A;  2ECC A;  1MNM C;  2OD5 A;  3BRO A;  4QLC U;  1NK2 P;  3HRT A;  2XAS A;  1EJ9 A;  5CYV A;  2X9D A;  5ICE A;  1SD4 A;  3DPT A;  4EEF G;  1MIJ A;  3FXR A;  3CZ6 A;  4LIV A;  2M87 A;  4KYW A;  3GZ5 A;  2DPU A;  4C2T A;  3BJO A;  3I59 A;  2XKP A;  1FMW A;  3PL8 A;  2KL4 A;  3AL0 C;  4BQQ A;  1OMI A;  3CCU I;  1TNT A;  2KJB A;  3FKJ A;  2A6E F;  2NS0 A;  3QOE A;  1X3U A;  4MQV A;  5CVJ A;  1JXS A;  2GA2 A;  3OS1 A;  1TWG J;  1OYY A;  3HRM A;  1JUP A;  4KNY A;  1O7F A;  2JA2 A;  2K9M A;  4XRS A;  5L3G A;  3BTI A;  1SD5 A;  3FMR A;  2KZV A;  2OPT A;  3DPL C;  2P7V B;  2HQA A;  1R23 A;  1DP7 P;  2R7F A;  5FGM A;  4QIW N;  2E2J J;  1P4A A;  3H3V K;  3KP4 A;  2LRD A;  1T08 B;  3EUK L;  3GTG J;  3KLO A;  1E2X A;  5FKN A;  2QF7 A;  5CVI A;  5K7Z A;  4HX7 A;  3Q9S A;  4BHC A;  4EM2 A;  2Z2S B;  2CFX A;  5HVQ C;  5FRO A;  1T98 A;  4KJZ A;  2JJ7 A;  2XAQ A;  3ZQI A;  4WXD A;  4MEX F;  1BA5 A;  2PLY A;  1BI2 A;  2KRC A;  1XDS A;  5M3M J;  2ZME A;  3L9F A;  2DA2 A;  3JW4 A;  2JTV A;  4G9Y A;  3RYP A;  3MEX A;  5FB2 A;  2QVO A;  2VN2 A;  1U9O A;  1FNN A;  5BNG A;  4FX4 A;  3W2V A;  1QRY A;  2LKS A;  3HB9 A;  4BEH B;  4BKX A;  4D1Q A;  1OCZ H;  2QWW A;  1OKR A;  2RNG A;  3HPH A;  4U0Y A;  3CO6 C;  1BC8 C;  1HXD A;  4ZZD A;  2R7O A;  1PDN C;  3WTW C;  1JI8 A;  2IVM A;  3RQI A;  4DBQ A;  4NUB A;  4E7J A;  1LDD A;  4KIF A;  4X1E A;  1JHF A;  1D8K A;  2ESN A;  3QRF F;  1CQT A;  2Z33 A;  3RSN A;  4B4C A;  2K9L A;  1G3S A;  3GW2 A;  2IEK A;  3TDU C;  1ONV A;  2COB A;  1FYL A;  3HRU A;  1ETV A;  2XAH A;  3LNQ A;  5LEK A;  4B47 A;  4P1W A;  4ITV A;  4MNU A;  5JR3 A;  2P6T A;  5CPR B;  1SAN A;  3E6B A;  3PUF A;  1IDY A;  1IRX A;  3HHG A;  2DMQ A;  2DTR A;  4H0E A;  4ESF A;  3PQK A;  4HDU A;  3HPG A;  3D0S A;  1VQL I;  3K1M A;  3IC7 A;  3G73 A;  1H89 C;  4DYR A;  4RGU A;  2G9W A;  2PJR A;  2V79 A;  3FBI B;  2QZ8 A;  4M74 A;  1KYW A;  1AWC A;  3C18 A;  3R6S A;  1BC7 C;  5B66 C;  4YII A;  2XVC A;  5BQT A;  3LSR A;  1D0Y A;  1EKE A;  4GGG A;  3GLX A;  1R5G A;  2GBY A;  3LOC A;  3V8J A;  2UZK A;  4MLO A;  1IC8 A;  2XF6 A;  1FJL A;  1WPK A;  2IAI A;  4XOP A;  3IHU A;  5FD5 A;  3E5Q A;  4KN7 X;  2F48 A;  3WTT C;  1H8A C;  4A6E A;  3NAR A;  3WGG A;  1XG1 A;  1K4T A;  3QPT A;  4BHP A;  1O3T A;  4CCO A;  2DQR A;  3DU6 A;  2JA7 J;  2RRE A;  2BEO A;  2XRN A;  3G6E I;  1FIA A;  1WWX A;  4IHV A;  2ZBK A;  2A05 A;  4LG0 B;  2EB7 A;  3AG2 H;  3BG6 A;  4ON0 A;  2VPL A;  3MWM A;  4PZJ A;  2DMP A;  5CQE A;  4TV7 A;  3FBN B;  1J9I A;  2DT7 B;  2X4H A;  3WTV C;  3L2R A;  4L0Z B;  4XKB A;  3DEE A;  2W57 A;  2JA5 J;  3CLO A;  5FO5 A;  3HGY A;  2LD5 A;  3K70 C;  1K78 A;  2EA4 A;  2P7C B;  1J09 A;  2CU7 A;  4E7S A;  4KA4 A;  1A6Q A;  2JUG A;  1LQ1 A;  4LGW A;  3H5N A;  1WJB A;  1YIO A;  2VIX A;  1Y56 A;  1XCB A;  3Q5F A;  3LQR A;  2P5L C;  1R7J A;  1ON1 A;  2BXZ A;  4RB2 C;  4IPA A;  3HEF A;  5ICF A;  2WAQ N;  3QYF A;  3ZQL A;  4CGZ A;  3S2D J;  4UHT A;  1IDZ A;  1NK3 P;  1VI0 A;  3FXU A;  5HLG A;  2DBB A;  2DFH A;  4E6K G;  2KJC A;  5E3O A;  2PBI A;  2MC3 A;  1U5T B;  3H36 A;  1PUF B;  1UFM A;  1V55 H;  3K7A J;  4N0B A;  2H8W A;  3WU1 B;  1JHH A;  3L09 A;  2VJ5 A;  2W1O A;  3GUD A;  4YEL A;  1X1P A;  1H88 C;  4B3X A;  4DZP A;  5LHI A;  4D7M A;  2L4M A;  1XPX A;  3W2A A;  5F1R A;  2HYG D;  2CWE A;  4WF2 A;  3VPR A;  3WHB A;  1MBF A;  3LST A;  4JBA A;  4EVI A;  1W36 D;  4A5M A;  3HGG A;  2GM4 A;  3EUH A;  1FEX A;  2EWN A;  4A2U A;  4EJO A;  1BR2 A;  4F3Q A;  4OOI A;  2A07 F;  3KP7 A;  4AC0 A;  2L2O A;  1Z1D A;  4V19 K;  4LLN A;  2CYY A;  5J1U A;  3MZH A;  3J81 K;  3MMY B;  4PJL A;  4NNJ A;  2VC1 A;  4P5O A;  1Z05 A;  2XKO A;  3IH2 A;  1QVT A;  2BOL A;  4EV0 A;  1W5S A;  5B3S H;  5HS9 A;  2XAG A;  3MZ8 A;  4KIG A;  5D5V B;  1FX7 A;  1B8I A;  2IJL A;  2IS1 A;  3MFK A;  2X0L A;  2DA7 A;  4IOC F;  3CUQ B;  2NVT J;  2X6O A;  5F0C A;  1HCR A;  3IV5 A;  2AXT C;  2ME6 A;  3H0G J;  3SDG A;  3I71 A;  2NVU B;  4PK4 A;  3TDZ C;  4WCG A;  2XUB A;  4A6D A;  3IH3 A;  1ZQ3 P;  1Z91 A;  4UV8 A;  5LLQ A;  4H4K C;  2DO7 A;  3BY6 A;  2ID6 A;  2O8X A;  5K5Q A;  1P7J A;  1T33 A;  1A36 A;  3S3N A;  2WB1 N;  3ECO A;  3ZQH A;  3F8B A;  1GDT A;  4I76 A;  2F6C A;  2RQQ A;  1I6H J;  1X2M A;  1U5T C;  3R0A A;  4S0H B;  4BAC A;  1KQ8 A;  4Y4R A;  4XL9 A;  3WOD F;  1GLN A;  2X6W A;  1ZN2 A;  1MBE A;  1HC8 A;  2MLG A;  3OYJ A;  4RA2 A;  3OYL A;  4OIO F;  3W6V A;  2VKH A;  1XGS A;  1J7K A;  3U1D A;  3KLN A;  1I3A A;  2P81 A;  1AKH A;  3FXK A;  4AYB N;  1FTT A;  1NH3 A;  1J59 A;  4C9Y A;  2FQ3 A;  2F5F A;  5GAH J;  1B4A A;  2JRM A;  3WTU C;  1BM9 A;  2K3F A;  2QQB A;  3VYT B;  4LLL A;  1K83 J;  4RB0 A;  4EJW A;  3I54 A;  3OIP A;  1ZRC A;  2ZB9 A;  4LJZ F;  1ZG5 A;  2B9S A;  4HF0 A;  5DDG A;  1R22 A;  2WAE A;  2FF4 A;  4FHT A;  3KYL A;  1YQA A;  3BQZ A;  3L7W A;  5ICC A;  2R93 J;  2VOD A;  4CCM A;  2JZY A;  2CV2 A;  4A3D J;  5ILS A;  1VQO I;  1ETO A;  1J75 A;  5ICG A;  1A6I A;  2XB5 A;  3MKW B;  2WAQ A;  3OWT A;  3P5J A;  2C6Y A;  1UG2 A;  2X48 A;  1QZE A;  3LAJ A;  2KIS A;  2NS7 A;  2B63 J;  1EH6 A;  3CUQ C;  4MHG A;  3N97 A;  2VL8 A;  1PP7 U;  3LSJ A;  3JTG A;  1YJ9 I;  3DBH B;  4RMN A;  4BEH A;  1UJ8 A;  4KT5 C;  4OIN F;  3GWZ A;  2VJI A;  4HNT A;  2DXI A;  4ZDL A;  5KHD A;  2FE3 A;  4EJU A;  1OR7 C;  4IQ4 A;  3HC7 A;  3LL7 A;  1DGW Y;  5TRD A;  2R7T A;  1SVO A;  2VXZ A;  3CCV I;  3I59 B;  5FKK A;  1E3O C;  1RIO H;  1FC3 A;  1FYM A;  3F6V A;  2K4B A;  1B1B A;  2HQN A;  3OYC A;  4PJ0 C;  1HSJ A;  1REP C;  5GAE J;  2VQG A;  5F1J A;  4P96 A;  4ZC3 A;  3GFI A;  1BJZ A;  2DOD A;  3GZN B;  4XKV A;  3SFZ A;  1SFU A;  3V7S A;  4PSX A;  4L0Y B;  1YX3 A;  5GPC A;  2DOE A;  3A03 A;  1Y1V J;  3KFW X;  1QQI A;  2L7M P;  3OL3 A;  2UXN A;  3I55 I;  2OV7 A;  4B1R A;  4M6X A;  3JRC A;  3S17 J;  5GAD J;  4EM1 A;  2Z99 A;  2V6E A;  1ZYR F;  2GOM A;  5E1X A;  1R5I D;  3DXJ F;  2ZO4 A;  4V2F A;  1HW1 A;  1T0F C;  4CSW A;  1Z67 A;  1I39 A;  3M3Y J;  1IG7 A;  4BYY A;  4EM0 B;  2FJ1 A;  2HGC A;  2NRA C;  3OMY A;  2IGM A;  4DQ2 A;  3RIR A;  3L00 A;  2ZME B;  1Q1H A;  2Y30 A;  3H1C A;  1IGN A;  1ON2 A;  1TP4 A;  2VC0 A;  3BT9 A;  3CLQ A;  2VUM J;  3D5R C;  4M73 A;  2WAF A;  5KAI C;  3LSK A;  4BUP A;  1WJA A;  1ZH5 A;  3MKZ A;  4UV9 A;  2ELK A;  3G1M A;  3LSG A;  4XLH A;  2Y9Y A;  2ADU A;  2DTZ A;  3RKW A;  4BXU A;  1H0M A;  2DPD A;  3IH4 A;  4BJT A;  5HDK A;  4EGY A;  1H9G A;  2NVQ J;  2F5C A;  4A3G J;  3F22 A;  4Q48 A;  3E0J B;  4A0Y A;  3D1N I;  1IV6 A;  4M3E A;  3G3Z A;  2MH9 A;  4DIQ A;  2NNY A;  2PJP A;  5JHU A;  2IRF G;  2W48 A;  1AHD P;  1KU2 A;  1G3W A;  3ZGK A;  3J7Z I;  4JX6 A;  4XBF A;  3TP3 A;  1XMA A;  2O0Y A;  3UKG A;  3GTO J;  2G7U A;  2R92 J;  2HXI A;  1R49 A;  2ETH A;  4JX4 A;  1ZRD A;  3NRV A;  4I09 A;  3BG7 A;  2PN6 A;  2GWR A;  2JRT A;  2XSJ C;  4KT6 A;  1FWZ A;  5FLX K;  2BY0 A;  4HOB A;  4LK1 F;  3K1P A;  4EQQ A;  2VKE A;  1APL C;  3H5R A;  1MH4 A;  4I2O A;  2ICW G;  5IOY A;  1UZC A;  2HU9 A;  4M71 A;  1U8R A;  3T5X A;  2O03 A;  2PJR B;  4A3C J;  4Y33 A;  4HLY A;  2M7A A;  4GFB A;  2GXB A;  2NOG A;  3ECH A;  3HOW J;  1JKP C;  1BN5 A;  2HTJ A;  4IRG A;  2L7K A;  2L7Z A;  5FD6 A;  2M34 A;  3J80 K;  2OC6 A;  2WWY A;  2ZNZ A;  4IVN A;  2HOT A;  2ZME C;  2VE8 A;  4HV5 A;  1UST A;  2HVQ A;  3OR2 C;  1MZB A;  1QGP A;  2XSD C;  1YE9 A;  2KMU A;  2R7X A;  5HNH A;  4QTR A;  4MIM A;  3CJT B;  5DCF A;  2E1C A;  1PUF A;  3S3O A;  1JUM A;  2LKP A;  2CH0 A;  2WAD A;  5HDG A;  2QQ8 A;  3KP6 A;  4ANJ A;  1IAW A;  3GFL A;  1QPI A;  1MMS A;  3KYC B;  5LFA A;  3SJM A;  5LHG A;  4LLG F;  4HNU A;  3LSI A;  2HDC A;  3KE2 A;  1ZTR A;  3U1K A;  3TO7 A;  3Q3S A;  1OCP A;  3ERE D;  1E0E A;  1BW6 A;  1SFX A;  1V5F A;  1R4N B;  2DMT A;  5DD8 A;  4RM2 A;  4AIK A;  2IS4 A;  4B8X A;  5HLH A;  1ZR4 A;  5TIS C;  2ZXI A;  5FKL A;  3B6C A;  4CCJ A;  2XGC A;  3NQO A;  4D7N A;  1ZRF A;  5EZH A;  3E3V A;  2AS5 F;  3COA C;  3CCL I;  1DPU A;  1X1B A;  2JPC A;  4XSZ F;  4LIU A;  4BXF A;  2H6B A;  2XRL A;  2WV0 A;  1NHA A;  1FSH A;  3C3W A;  5D4S A;  2EK5 A;  1I1G A;  3NWS A;  3ZR8 X;  3S14 J;  5DUI A;  3HOZ J;  2M8G X;  3SHF A;  2Z3Y A;  2N8G A;  4L5E A;  3K4B A;  2CJJ A;  1D1B A;  3R0J A;  1YG2 A;  3F23 A;  4R8H A;  5ILV A;  2E2H J;  3A01 A;  1X58 A;  2GAU A;  2HPI A;  2QKL B;  2FOW A;  3GLL A;  1AU7 A;  2VPR A;  3GTQ J;  5AON A;  2QEX I;  2F4I A;  3OYA A;  3T0Y A;  2IPQ X;  3OSG A;  4HQM A;  4KIT B;  5FJ8 J;  3I56 I;  1SD7 A;  1ETK A;  2KIU A;  2KIM A;  2PFB A;  3VYU B;  3FKI J;  3EUA A;  3V8K A;  4PCQ A;  4BAY A;  1QO0 D;  2Q2E B;  5IT9 K;  5JHF A;  1YYV A;  4OIR F;  5GAG J;  2EZI A;  1J2X A;  1FPQ A;  2RDP A;  3CDH A;  4XRS G;  2KIF A;  2ZSH B;  1T56 A;  1P4X A;  2HOS A;  1T0F A;  1Z9C A;  1POG A;  2RGV A;  2R7V A;  5IOZ A;  2P4W A;  3F9K A;  3KZZ A;  4E4H A;  4HX8 A;  5BPI A;  4DYQ A;  3O6B B;  1O4X A;  2EFP A;  2VAS A;  1JKR C;  2Y0M A;  1B8I B;  2CFO A;  4UUS B;  3HTS B;  3BJA A;  2DYR H;  2FUG 2;  4FE4 A;  4U87 A;  4U7D A;  4BY1 J;  4RGX A;  5DEQ A;  3D5L A;  1BBY A;  1Z3X A;  3CJR B;  1F9N A;  4V2G A;  3E5U A;  1QPM A;  2GQQ A;  3SFI A;  5H2F C;  1LVK A;  3LMM A;  4BDZ A;  1JGS A;  2EBI A;  4DNC A;  1W5C C;  2EV5 A;  3WG9 A;  5DTD A;  1FY7 A;  1JKO C;  2VON A;  1LUJ B;  5F6F A;  3V7R A;  4HX4 A;  3NAU A;  4XLF A;  1M1E B;  3OYN A;  3HTU A;  5JLW A;  4HAM A;  1B59 A;  1W0T A;  1HST A;  2H27 A;  2HS5 A;  3I64 A;  2L9V A;  3ABU A;  3QOD A;  4XLC A;  3ZQQ A;  3VSK A;  3CP2 A;  1HA8 A;  5E1Z B;  3BR6 A;  3T1B A;  2LC2 A;  3IWZ A;  5LRS A;  1AKH B;  5EZG A;  5CLS A;  3PQJ A;  5H20 A;  2MG4 A;  4XK4 A;  2ZC2 A;  3REO A;  2R7Z J;  3EUH C;  5IYB J;  2TCT A;  2YSR A;  2CGP A;  3BR1 A;  3RPU D;  3J81 Z;  3U2R A;  4HYE A;  4CYD A;  2RQP A;  3DEW A;  2HR3 A;  2LF8 A;  3BWG A;  3FIS A;  4G7H F;  2IXS A;  1WVR A;  4RAZ A;  1ZAR A;  2M0C A;  3HM5 A;  4B43 A;  5GTI C;  2OTL I;  2OUM A;  3OYK A;  3ZRG A;  4WXH A;  2BW3 B;  4EAT A;  3LSP A;  2QUF A;  2BHZ A;  4C2U A;  2LLK A;  3OIO A;  2ZFU A;  1Q1V A;  4RB3 C;  2UWM A;  2CG4 A;  4BJ5 C;  4C3H J;  2RC4 A;  4XNF A;  4F91 B;  5BMZ A;  2K85 A;  3JRI A;  3N4M A;  3EQL F;  5LD2 C;  1DPR A;  1NG6 A;  1XC5 A;  1ZKG A;  2X51 A;  4QPO A;  5K5R A;  1K7A A;  3BG3 A;  3GTL J;  1LE8 A;  5HOD A;  1UAA A;  3PUB A;  2MD5 A;  4XSX F;  1BR4 A;  3S16 J;  1V4R A;  1CF7 A;  2VQL A;  2CW7 A;  3JRF A;  2LYC A;  4D5C A;  1SAU A;  4XM3 A;  3ZQC A;  2LSO A;  1LKX A;  1BW5 A;  3QOP A;  3GTM J;  1UB9 A;  1X1A A;  1QA6 A;  3QPH A;  4LOC A;  1R36 A;  1XN7 A;  2EFW A;  1E3H A;  3OR1 C;  2E1M B;  2L02 A;  3G1O A;  3SYT A;  4IHT A;  3K1N A;  1TWH J;  1GVJ A;  5E20 A;  3TW7 A;  2FXA A;  3RKQ A;  4W1U A;  4IL6 C;  2JUC A;  2W7N A;  4IHY A;  1LEA A;  4CH7 A;  1YJN I;  2NOJ B;  4JQF A;  4FCY A;  2IW5 A;  2O9L A;  3BTL A;  4N4N B;  1SFK A;  4LB6 B;  1GV2 A;  4XLN F;  4S04 A;  3IAM 2;  2DFE A;  4WK8 F;  4I6Z A;  2H8R A;  3HSE A;  2QSF X;  3NWT A;  3HXL A;  5FLM J;  1Z0X A;  5J8C A;  4ETS A;  3PNV A;  2ECB A;  3F72 A;  4I0B A;  1WI9 A;  1RNL A;  1SC7 A;  2G7H A;  1RET A;  1ERD A;  2EV0 A;  4YFK F;  2L0K A;  3VWB A;  4J01 A;  6PAX A;  2ME0 A;  2E71 A;  4NBQ A;  2MLK A;  4HPQ A;  1ZAO A;  2LP0 A;  1TWF J;  3IAS 2;  1BOB A;  4XLA A;  4AIJ A;  3H0D A;  2LRE A;  3GVA A;  1SFE A;  3DPU A;  1KGS A;  2R4G A;  4FAS D;  1VQ8 I;  4IX7 A;  3L2U A;  1W1W E;  4DBR A;  4M3D A;  1KON A;  3FDY A;  2K3P A;  4A3B J;  2IBD A;  2XAJ A;  3S3M A;  3GYH X;  4MO7 A;  3VYS B;  5E18 F;  2KQR A;  2DYS H;  2Y69 H;  4EJV A;  2DA6 A;  4IF4 A;  3HOX J;  1OCT C;  4OAZ A;  4JX5 A;  1ZK8 A;  2ZCW A;  3GTP J;  3CMM A;  3KZY A;  5KK1 A;  2FOK A;  1OIS A;  5JFR A;  1FBS A;  3W6K B;  1S72 I;  2VQC A;  1XDU A;  1HBX G;  3KP2 A;  3VFZ A;  3WTZ A;  1H9T A;  4M6Y A;  3CCY A;  1P7I A;  2DFF A;  1IF1 A;  4IO9 F;  4IRI A;  5GTH C;  4BE0 A;  2E1M C;  4YRV A;  3H9Q A;  4PSW A;  4J00 A;  1RZ4 A;  2IP2 A;  2FA5 A;  2DOA A;  5F27 A;  2L9N A;  1ITY A;  4HDV A;  3HG9 A;  1ZGW A;  3O8G A;  3F0C A;  3CC7 I;  1ZRE A;  3BR2 A;  1G6N A;  4CA0 A;  2NVX J;  4IXA A;  2BYV E;  1Z7L A;  2E35 A;  1JTX A;  3HSR A;  2JT1 A;  5M5Y J;  2BV6 A;  4A5N A;  1ETQ A;  3OYF A;  1MD0 A;  1P4W A;  2JQ7 A;  4L9J A;  3CMY A;  4ZDP A;  3I4N J;  4HV6 A;  1RRJ A;  5D6E A;  4G12 A;  3ESW B;  1MMG A;  1RKT A;  2W24 A;  3E6D A;  1R4M B;  2Y9Z A;  1WI3 A;  2CS3 A;  3JRG A;  3KP3 A;  2I8D A;  1QZZ A;  3RQ4 A;  1PYV A;  2COM A;  3TO9 A;  1IUF A;  2XAF A;  5E17 F;  3P9I A;  4MGR A;  1Y8R B;  1B9M A;  3DBR B;  1E3P A;  3TL4 X;  1EF4 A;  4OMY A;  2D5V A;  1G59 A;  4RS8 A;  2FD5 A;  5A2Q K;  3JR9 A;  2HTS A;  1IN5 A;  2VKD A;  4HBL A;  3BOQ A;  3J7A O;  2Q2E A;  3CC2 I;  3JRE A;  3BQY A;  3ZXS A;  4DOZ A;  2K9Q A;  3JTH A;  3DKW A;  2RNJ A;  1DDN A;  3E97 A;  1S29 A;  1IRF A;  3MKY B;  5H6R A;  4E70 A;  1LDK B;  2V9K A;  3M8E A;  2VOO A;  2JPB A;  3Q0V A;  2EIN H;  3C2B A;  4M6V A;  2WY8 Q;  5FLX Z;  1V5E A;  4AVZ A;  2XF5 A;  1VQ7 I;  2MFZ A;  3TOA A;  4A93 J;  3ZN1 A;  4J19 A;  1OJL A;  3GFM A;  2XHK A;  5E3L A;  4NQW A;  2E19 A;  2JA8 J;  4Y7N J;  2V4J C;  4UUS A;  2QGU A;  3RZO J;  3S1M J;  5L3C A;  1D0Z A;  1P92 A;  3LA3 A;  4BDY A;  1ZR2 A;  2K9N A;  1ZG3 A;  4AD9 A;  1W7P A;  2KLO A;  1X4P A;  4BBR J;  2TDX A;  5J3L A;  2VJ4 A;  1X1C A;  4PFO A;  3J80 Z;  3CC4 I;  1S3J A;  2JN6 A;  3JAM K;  1YHQ I;  3R4K A;  2GOX B;  3QU3 A;  4MEY F;  3PIO F;  3A01 B;  4N9I A;  4O5V A;  1GVD A;  3BPX A;  4BBS J;  1TWA J;  3S1N J;  2EIK H;  5DYM A;  1FBQ A;  2VLA A;  1YO5 C;  1YW8 A;  3IRQ A;  2G0E A;  4I0A A;  1ETX A;  2F2E A;  4S05 A;  3WHC A;  4U0W A;  2QYO A;  2GA1 A;  5DCM B;  4B44 A;  1XSD A;  2CW0 F;  3FF5 A;  4LMY A;  1Z77 A;  3KX2 A;  1QU3 A;  4I98 B;  3CD6 I;  3M8F A;  4X6A J;  3FXQ A;  2D1V A;  2LVS A;  2OTJ I;  1TNS A;  2CQN A;  2IS2 A;  1WH5 A;  3S32 A;  2DMU A;  5F0F A;  1TW2 A;  2AHQ A;  2R5Y A;  2IGK A;  4F92 B;  2OJE D;  4B09 A;  2W4S A;  2M45 A;  4ESB A;  4OMZ A;  2KPM A;  4D0P A;  1FIP A;  2W25 A;  4ZH4 F;  4PFP A;  1E17 A;  4G7Z F;  3DLA A;  1T6S A;  2LY9 A;  2V7F A;  2YUS A;  4WXC A;  4HF2 A;  3ASO H;  2PEX A;  1WH7 A;  2YX4 A;  4W97 A;  3HOU J;  1MJA A;  2CQ7 A;  4NC8 A;  4AU7 A;  2CQX A;  5IP9 J;  3ZQ7 A;  1ZG1 A;  5HOO A;  3HYI A;  2M9H A;  2BW3 A;  2L4A A;  1WCM J;  2AQF A;  3F6O A;  4RBO A;  2WBM A;  3E5X A;  3K6G A;  2V1U A;  2LK2 A;  4L18 B;  2HKX A;  2EZH A;  1VF9 A;  3S93 A;  4FIS A;  4RAG A;  1I50 J;  4C3J J;  2M7B A;  2DT5 A;  2KZG A;  3ZQG A;  4A0X A;  5LGT A;  4Y17 A;  4BH9 A;  4DW6 A;  3A02 A;  3ZMV A;  2JSP A;  2JK3 A;  3ZMD A;  3KEQ A;  2FBH A;  2XV4 S;  2ZXJ A;  4EGZ A;  1HW2 A;  1G3T A;  1NTC A;  5K7H A;  2QSH X;  3H35 A;  4HZF A;  4KN4 X;  2MBF A;  1F36 A;  2Y2Z A;  4Y13 A;  2L3D A;  2BY1 A;  2R0Q C;  4G6D A;  3GXO A;  4A3J J;  1TLH B;  2WTE A;  5LBQ A;  5IT9 Z;  4MFD A;  3Q0W A;  4RM3 A;  3ZP5 A;  3KEO A;  1DU0 A;  1VQK I;  1OYW A;  1Z7U A;  2CUE A;  1A5J A;  1BR1 A;  1RUO A;  3HZJ A;  3VDX A;  1RUN A;  1X3W B;  1Z6R A;  1WQ2 A;  2Z1D A;  2R7R A;  1LEB A;  4F55 A;  2OCC H;  2XRO A;  2STT A;  5JI6 A;  3GCM A;  2BVM A;  4A3F J;  4XOT A;  2K02 A;  1TWC J;  4KIB A;  3M8J A;  2ZJQ F;  3WE2 A;  4Y3O A;  2QA4 I;  2FRH A;  2P5K A;  1V5G A;  3HIF A;  3M1C A;  3V8L A;  1VQN I;  3SEQ A;  1VFC A;  1ACI A;  2L7F P;  4XRM A;  2GXA A;  2H6C A;  4NB5 A;  4BQA A;  3MAJ A;  1D0X A;  1FOX A;  2R7S A;  3GF2 A;  3FK7 A;  3E6M A;  1Y1W J;  2BY2 A;  4YFN F;  1T8I A;  5D4R A;  2L01 A;  1YIT I;  1MJ9 A;  3K70 D;  3BTJ A;  3JRA A;  4IRH A;  3RZD J;  4XR6 A;  2PG4 A;  3DTE A;  2M0M A;  4YIR X;  1LE8 B;  5BOX A;  5B5E C;  4BNC A;  1BI1 A;  4UY8 I;  3BPV A;  2K86 A;  2K5C A;  3OYH A;  4OAY A;  1MND A;  2LF7 A;  3DCF A;  4XMY A;  1U6G A;  3OOP A;  1QVU A;  2BHY A;  1P6R A;  1CF7 B;  2AQE A;  2E60 A;  2WV1 A;  3L2C A;  2OCE A;  4XKW A;  5M3F J;  2NXN B;  2PX9 A;  5C3E J;  2VT2 A;  2KT0 A;  2KKO A;  4RDU A;  2DLL A;  3SEZ A;  1TTY A;  4I99 C;  3CTA A;  5D5W B;  2RKH A;  1KQ0 A;  1MDM A;  1FYK A;  3O2P E;  5CJ9 A;  5IYD J;  2MGQ A;  2Q8K A;  1MW7 A;  2LMD A;  4XRF A;  2HZD A;  2DA4 A;  4CUG A;  3F8F A;  1VZ0 A;  3VEP A;  3ULQ B;  1TQM A;  4UXN A;  2I10 A;  3A1Y A;  2Q0O A;  1PP8 F;  3S2H J;  1Z3Y A;  5FKO A;  3TMO A;  5M5X J;  2IGO A;  4A3K J;  4OWR B;  3FXL A;  3ZCO A;  2YU9 J;  4HF1 A;  1L0O C;  3FXM A;  4M3G A;  2J5O A;  4E7Z A;  4Z6Y A;  2FBK A;  4UNO A;  1YLF A;  1HKT A;  1GHC A;  4B48 A;  3R60 A;  3BCA A;  2YU3 A;  5F08 A;  3AKZ A;  3DV8 A;  4LD5 A;  2LNB A;  3I5U A;  4R1H A;  2CUJ A;  1IXS B;  1YX5 A;  2FBI A;  3DU5 A;  4PUS A;  1S7A A;  4BL0 B;  2NAZ A;  3NEU A;  3TO6 A;  1WJF A;  2H1L A;  4M72 A;  4N4O B;  1IXC A;  3EET A;  2DFI A;  4I02 A;  3PFY A;  3CJQ B;  3VB2 A;  3X2Q H;  3DTK A;  3EYI A;  2F5V A;  1O57 A;  4QWQ A;  3M4O J;  4CYC A;  5HDN A;  1ZGJ A;  5L3E A;  3QP6 A;  5E3N A;  1UCR A;  1G4D A;  5GP9 A;  1P9Q C;  3QPL A;  1FP2 A;  2EZK A;  2LFB A;  1Y8Q B;  1R1U A;  3CME I;  1D8J A;  1X2N A;  2F5D A;  4KIS A;  2HYJ A;  3M1E A;  1I5Z A;  2EA2 A;  2HOE A;  3FZV A;  2OZ6 A;  2ZXW H;  2KIQ A;  4CIC A;  4HG2 A;  2BZT A;  2EPF A;  4LFU A;  1K4S A;  1WKM A;  3QPS A;  2B7E A;  3DQV C;  2CQK A;  2V26 A;  4NHJ A;  2X6X A;  5J47 A;  1D3Y A;  2CSO A;  2BVL A;  1IRG A;  1NG7 A;  3S1Q J;  1XMK A;  2ZNY A;  3PIP F;  1J5Y A;  2L54 A;  2YS9 A;  4BQN A;  3FXJ A;  3K2A A;  2E5Z A;  1UHS A;  3RPQ A;  1OFC X;  2OQR A;  4E7L A;  4RGR A;  2IT0 A;  5IT3 A;  3BG5 A;  2MH2 A;  2W84 A;  1BJA A;  3K69 A;  4ZYH A;  3G4S I;  3K4N A;  1HDP A;  1DP3 A;  2H09 A;  1A31 A;  1MGT A;  4M9Z A;  1OCC H;  1LJ9 A;  2LY1 A;  4ZTF A;  5CVU A;  2CUF A;  4UVB A;  5E8I A;  3OYD A;  2JVG A;  2BY3 A;  4AVP A;  3BJ6 A;  1HDD C;  1W0U A;  3ASN H;  3BCB A;  5TJJ A;  3HJE A;  3EPZ A;  1EH8 A;  2CV0 A;  3IP4 B;  2HZT A;  3KIO A;  1U2W A;  2E2I J;  4CZC A;  3ONQ A;  5DCM A;  4M9X A;  1OCR H;  2MYS A;  3TED A;  4Z2Y A;  2VT3 A;  1XGN A;  3RYR A;  1MKM A;  2QQ9 A;  4BXX J;  4UB6 C;  2V6C A;  1QHH D;  4NDL A;  3RDI A;  2A6H F;  2I5U A;  3DFG A;  4YEJ A;  1XB4 A;  1Y39 A;  5AIQ A;  2AO9 A;  5LGU A;  1C0W A;  4HNV A;  3K4K A;  5D6F A;  4UUT A;  3HKZ A;  3DP7 A;  4DGW B;  5IP6 A;  1WHU A;  4BGD A;  3IKV A;  2L5Q A; 
#chains in the Genus database with same CATH homology
 1YJW I;  3G6E I;  3CCJ I;  1VQ7 I;  2ZJP F;  1VQK I;  3CF5 F;  3CCL I;  5DM7 F;  1HC8 A;  1VQP I;  2E36 A;  1VQ8 I;  3CME I;  3CC4 I;  2ZJQ F;  1YHQ I;  2QA4 I;  1VQN I;  5GAH J;  3PIO F;  1YI2 I;  2K3F A;  1ACI A;  3G71 I;  3CCM I;  1FOX A;  5DM6 F;  3CCE I;  3J7Z I;  1S72 I;  1VQ5 I;  3CCQ I;  3DLL F;  3CCR I;  2FOW A;  4IO9 F;  2OTL I;  1VQ6 I;  3CMA I;  5JVG F;  1YIT I;  1VQO I;  2QEX I;  3CD6 I;  1VQ9 I;  2H8W A;  3PIP F;  3I56 I;  2OTJ I;  3CC7 I;  1VQM I;  4UY8 I;  1YJ9 I;  3G4S I;  2E35 A;  5GAG J;  2ZJR F;  2JQ7 A;  1VQL I;  2NXN B;  1FOW A;  1YIJ I;  3CCV I;  3CCS I;  4V19 K;  1QA6 A;  5GAE J;  1VQ4 I;  3CJT B;  3CCU I;  2E34 A;  1Y39 A;  4IOC F;  1YJN I;  1MMS A;  3CC2 I;  4IOA F;  3I55 I;  5GAD J;  3J7Y J;  1FOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...