3CC7I

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cc7I00
1YITI 2JQ7A 3J7YJ 3CCRI 1YJWI 2E36A 2ZJPF 2QEXI 3CC7I 3PIPF 1VQ6I 5JVGF 3CCEI 1FOXA 1VQKI 1VQ5I 4UY8I 5DM6F 3I56I 3CMAI 1VQLI 3CCVI 3G71I 1YJ9I 4IO9F 3CC2I 3G6EI 3CCUI 1FOYA 1YIJI 3CCLI 2OTJI 1VQMI 4IOCF 1VQOI 2E34A 3J7ZI 3CCJI 3CCQI 1VQPI 3CC4I 1QA6A 2H8WA 1VQ4I 2OTLI 4IOAF 5GAHJ 1VQ7I 2K3FA 5GAEJ 1Y39A 3PIOF 3I55I 1VQNI 2ZJQF 3CJTB 3CMEI 2FOWA 1FOWA 3G4SI 3DLLF 3CF5F 3CD6I 2QA4I 1HC8A 5GADJ 3CCSI 1YHQI 5DM7F 1S72I 1YJNI 2NXNB 4V19K 2E35A 3CCMI 1VQ8I 2ZJRF 1ACIA 5GAGJ 1VQ9I 1MMSA 1YI2I
chains in the Genus database with same CATH superfamily
1OMIA 2ZFWA 2HXIA 1BR2A 1YRNA 3DPLC 3PFYA 4BDZA 5DDGA 5IY5H 2M7BA 3BG5A 5E3MA 1X1BA 2PJRA 1PP8F 2FBIA 3KX2A 2Z5UA 5HLIA 4MTEA 3QOPA 1N78A 3KPHA 1ZAOA 2P5VA 3KCCA 5LGUA 3G1LA 3IUOA 1MH4A 4XKWA 5DD8A 3OSFA 3CDHA 2ZNZA 3M8EA 4ITVA 3RKWA 1JHFA 1SC7A 4C2TA 3PM1A 2X1CA 4E7LA 3CMAI 4M9XA 4CZCA 2KJCA 1ZK8A 4UUVA 3K2AA 4LITA 1UELB 4NB5A 4E7ZA 4KMFA 4BJ6C 3K70D 1A31A 3RPUD 4KYWA 5AIPA 2L02A 2LP0A 2XSJC 5E1XA 2GXGA 1MW7A 3BDDA 3WTVC 1ZELA 2CQ7A 2K27A 2WAEA 5E3NA 1VQOI 2M0MA 4B1RA 1MSFC 3L7WA 3OR1C 4D5FA 1D0XA 1JT0A 2DMQA 2GA1A 1S8NA 2CS3A 2CW0F 2JMWA 5L3EA 1X1PA 2QBYA 3H5NA 3WTUC 3IAS2 3AG4H 3CP2A 2K4BA 3ELKA 3SZPA 4KICA 2VBYA 1ZYRF 3ABKH 3BG3A 2O6GE 3TDUC 1PUFA 3PNYA 4FTHA 4TV7A 2B63J 2KQRA 5EG0B 1XB4A 4BL0B 2DFHA 1G3SA 2RREA 4DGWB 3AKZA 3G4SI 1KU2A 2KZVA 2VI6A 4BU2A 5CJ9A 3KP2A 4FETA 1IRXA 4BY1J 2F4MB 3IV5A 2DPUA 3PL8A 1LE8A 1R22A 3JRDA 5IT9K 2M5WA 2AQFA 3CF5F 5M5XJ 3CD6I 2JK3A 2E71A 2K7LA 2ESHA 2PN6A 2O9LA 2PLYA 3RYPA 3FKJA 2AO9A 4S05A 5GP9A 3RI4A 1EH7A 4BQOA 3I4PA 1OCOH 2X1EA 1F43A 3JW4A 4L5EA 1ZGWA 4UUSA 1QBJA 1Y0NA 3FXUA 4RA2A 4B4CA 4LLNA 5IYDJ 1ACIA 3N97A 1A5JA 2VT2A 2ESNA 1E3OC 4B44A 2E7XA 2A6EF 3BR5A 3LNQA 2P7CB 2JA6J 1XMKA 5HNFA 1FBUA 4X1EA 4C9YA 3AAFA 2EWNA 1P2FA 1SD4A 4Y52J 4NUBA 2E60A 1OCPA 4KNYA 4QIWN 2LLKA 1OCCH 3S1NJ 1EKEA 3I9V2 1N75A 1O7FA 4PJ0C 3KP7A 1R23A 1DQUA 1Z05A 3GTOJ 4WK8F 2AS5F 2CQNA 4A5MA 1C0WA 4UUTA 3U1DA 1H8AC 4Y4RA 4BNCA 2F2EA 2R7WA 2QWWA 1X2MA 2E7WA 5J1UA 1NHAA 2VQLA 4PJMA 4V2GA 2IGMA 2LR8A 5ICCA 2DYSH 2CV0A 2L3DA 2L9RA 3AL0C 1P6RA 2YR2A 2CJJA 2EK5A 1V5GA 5F1RA 4JYKA 4C30A 2F5EA 4BQAA 5FKLA 2RQPA 3H5RA 1UJ8A 3IH3A 1HKTA 2F5CA 2JUCA 4IX7A 3HHHA 4XMYA 5K7ZA 1APLC 2A3SA 5FD5A 1QA6A 4B8XA 2GIZA 2CFOA 3MQ0A 3IL2A 3FX3A 3N05A 1WGXA 4ASNA 2VJ5A 4CYDA 4AC0A 2EFWA 1PP7U 2DO7A 3DEWA 3KFWX 2R5YA 3B6AA 4GYIA 3TMOA 5GTHC 1I6HJ 4JQFA 5ED4A 1MBGA 4UHTA 3K4NA 4HNVA 1Q1VA 3NWTA 5TISC 4YG2F 2HDWA 3WTZA 3J7AO 1MNMC 3MKLA 1E3PA 1OCRH 4KN4X 2J5PA 2TCTA 1J09A 1XSDA 2ICWG 1RC9A 2BE5F 1FT9A 3E5XA 3PSIA 4KN7X 1SAXA 5HNHA 2M45A 4HX4A 3F8BA 2WB1N 3ERMA 3IKVA 4LK1F 5B3SH 5H6QA 4N4NB 3F22A 2WV0A 3OWTA 2JA7J 3VWBA 3QOEA 4IRIA 3OL4A 4CCKA 3RQ4A 3F8FA 4A6EA 3BPXA 2WWYA 3IH4A 4XLPF 2C6YA 2ZSHB 1Z7UA 5GADJ 2PJRB 1PVEA 1Z3XA 4MIMA 5FKNA 4HLYA 3S17J 3S32A 3V4GA 1IDZA 5EYRA 5JLWA 3BZCA 3D1NI 2E2IJ 3GCMA 3L9FA 2L2OA 4BS9A 4V19K 5GAGJ 4IRGA 3CUQC 3BQYA 3F23A 1B9MA 4F92B 1GDTA 1TTYA 4YEJA 4KT6A 1SEUA 2BY2A 5GPAA 4CGZA 2KPMA 2H94A 3HTUA 1Z9CA 1REPC 4RB1A 1YFHA 3HGGA 3VOEA 4IHXA 1LVKA 2Y48A 2RQQA 2FBHA 4M3FA 3PIPF 2KMUA 3D5SC 2F48A 2CUJA 2PQ8A 1QHGA 2KLOA 5D5XB 5F0HA 1J9IA 4QWQA 4ZTFA 5HLGA 4UY8I 2XGCA 2NAZA 2QLZA 2XRNA 1WI9A 3R6SA 3ZOBA 2V79A 1TQPA 1H9TA 2V1UA 1IW7F 3PSFA 3L2WA 2EINH 1CGPA 1R1UA 2COMA 3RJPA 5F0FA 3OYBA 4FE7A 1X3WB 5EEGA 1YJ9I 4NDLA 3FKIJ 3WGGA 3CF2A 2HVQA 1ONVA 2QBYB 1WJBA 2Z99A 3WU1B 4FT8A 3PFIA 2Z33A 1K6YA 1JJ8C 3X2QH 2IA0A 3JRCA 3CCLI 1W36D 4P96A 1I1SA 2M87A 1O3RA 1PUFB 3F8MA 2ACJA 3JSOA 4HDVA 1BR1A 2M3AA 2EILH 2BHYA 4HEA2 4RB3C 5A2QK 2VT3A 2LF8A 2X9DA 2AXTC 1LE8B 1VNDA 2HTJA 2P5KA 3G1OA 4IEJA 2XROA 3L2RA 3LFUA 2ZXIA 3CLOA 4A3BJ 4CA0A 1LUJB 2LDUA 4KDPA 1OKRA 1LFBA 3GTGJ 3LOCA 3D5LA 5CVIA 3REOA 3WU0A 2WAFA 2KHMA 2XAHA 4UUSB 3MN2A 1DU0A 5K7FA 1W7PD 2MH9A 2A5YB 1OJLA 2WC2A 4UNOA 1P4AA 2JN6A 1IRZA 1MBKA 5GPCA 1FOWA 3R0JA 1LFPA 3ONQA 2OCEA 2Z16A 1RUNA 5CVJA 2YU9J 3IWFA 4O3MA 4HF2A 4K2EA 3S93A 1IJWC 2QSHX 1B59A 3LA7A 5H6RA 3RZOJ 2P7VB 5L3DA 2MC4A 5E1ZB 1U0JA 3M8FA 3HB9A 4DBRA 2DA7A 1ODDA 4EQQA 3MWMA 3LL7A 4Y33A 4LLLA 1DU6A 3DCFA 4PJJA 3SQNA 3BCBA 2ADUA 2LY1A 3C18A 1SMTA 1WJ5A 4M3DA 4A12A 1YITI 4G6DA 3HUGB 3E7LA 3MKWB 1WCMJ 3FDYA 4I2OA 1IV6A 1PJRA 2VBXA 1Y8QB 2CV2A 2JZYA 1WKMA 2XRLA 2ZJPF 1Y8RB 3QRFF 2HQNA 5HDKA 1GV2A 4ZC3A 1TT0A 4EM2A 2W57A 3K10A 5JLXA 2ZSIB 4HOBA 4F55A 2BGCA 1PDNC 1MNDA 3HZJA 5JFRA 2I10A 4RB2C 2ISZA 1GXQA 3FMRA 2CSOA 1D8JA 3OYLA 3H0GJ 3SDGA 3JREA 3DPTA 4OAYA 3BY6A 4KIFA 4XK4A 4F93B 1UCRA 3G1MA 1K61A 5DUKA 4BXUA 5BMZA 4IO9F 4DZPA 3HL2A 4HV5A 4XOTA 2R5YB 2L01A 1RUOA 3NRVA 4PGHA 4R79A 4G7ZF 3RZDJ 1G8XA 1D0YA 3KE2A 2XKPA 2XVCA 1XCBA 3QAHA 3I54A 3C2HA 2D2WA 4JOMA 4YFXF 2E34A 2V6EA 4UB6C 3SZTA 4AD9A 5JVTA 1JI8A 3CTAA 2IGOA 2B7EA 4BHBA 2WADA 2ECBA 2DCEA 1UHWA 5CYVA 4XLHA 2K40A 4BQNA 4L9NA 4R1HA 3W2WA 1TW3A 1NH3A 5B1BH 3KYDB 4OOIA 4WXDA 4H0EA 3LQRA 4L9VA 1V5EA 2K3FA 4RLFA 3EUHA 5FKOA 3CJNA 4B3XA 4IL6C 4WWCA 4WF2A 2HFHA 4IRHA 1TL8A 3TW7A 4DYRA 3WGIA 2R93J 3WHCA 3RKXA 3CJQB 4UV9A 2I8DA 4E7SA 2AXLA 3DBHB 3CMEI 3RSNA 2G0EA 2IAIA 3FIWA 3HGYA 3PQKA 3HTSB 3CESA 3ERED 4ZYGA 3NQOA 3F6VA 2GAUA 3P9KA 1XGOA 2W25A 2QA4I 2EFOA 3ABLH 2VE8A 3S1MJ 1T98A 2F5DA 2XGDA 2LMDA 2VLAA 4U7BA 2P6SA 4JP0A 5HS8A 3DTIA 4ETSA 3CDLA 1WSUA 3K1NA 2KIUA 1MIJA 2EFNA 4B48A 1HXDA 2BY0A 2K5CA 2NXNB 1YJNI 4GFBA 2R4GA 4QLCU 1X58A 2G7UA 4JX5A 2EZKA 3JRFA 4AIJA 2OZ6A 4D9JA 1P7IA 5FROA 2UZKA 4RAFA 5ILSA 2XB5A 1FYKA 3OYDA 1Z0XA 3VODA 2XAUA 1LEBA 2EBIA 2V7FA 2DXIA 2BBYA 2VPRA 4UVAA 3WG7H 3WG9A 4A0XA 1AU7A 1MMDA 3ZRGA 1SVMA 2CV1A 4Q48A 4HYEA 2IXSA 1UG2A 1ZN2A 4Y15A 5IPAA 4XRSA 4OMZA 3PO3J 4XONA 1YOVB 1B8IA 1ULYA 1LJ9A 4XRSG 4E7KA 4BBSJ 2VOOA 3A2KA 3EYYA 1VFCA 2QGUA 5IP7J 3BTLA 3A02A 3H1CA 5E3LA 3F9KA 2QQBA 1JGSA 2QSFX 4MEYF 1XGMA 1Z7LA 3QPLA 4A3JJ 1JT6A 3A1YA 4LD5A 2VASA 1FC3A 3CQZJ 3DTKA 4KMUX 2A68F 2KFDA 1R6RA 3RYRA 1FX7A 3EETA 1OR7C 1UB9A 2X0LA 3VYUB 1A6IA 1QPMA 2NNNA 3K4JA 2PMZA 2NVTJ 4RS8A 4BBRJ 6PAXA 4G6QA 1FTZA 1MMNA 5D5UB 1Z3YA 2Y69H 3LA3A 3S16J 3OYMA 4BKXA 2KDZA 4O6JA 2L7ZA 2HWVA 2DU9A 5LRRA 4DIQA 4B09A 4FASD 3ROUA 2H8WA 2W24A 2JRTA 4F3QA 1VQ4I 1GXPA 2E19A 4E70A 3OYGA 2LK2A 1OYIA 1Y1VJ 1VF9A 1L3LA 5J1RA 1R49A 2DK5A 2BY3A 2ELJA 4L9TA 5C4JJ 2VE9A 4IHTA 2ISYA 1RESA 2HNHA 1Y39A 4PGGA 4CCNA 3R4KA 5M3FJ 1DP3A 1S29A 2M8GX 2X1DA 3DBLB 2QKLB 5J4YA 4P1WA 3I64A 3J80K 4HLXA 3G73A 1JE8A 3GZ6A 2HOTA 3OS0A 4ESJA 5EF6A 2Z9OA 3QPSA 1T39A 3DTEA 1J75A 3I4MJ 1POGA 2FE3A 3Q9SA 1F5TA 4CXFA 2V9PA 2IW5A 1ORKA 4P9FA 3U1KA 2QENA 5L3FA 3O6BB 2F6CA 2NVXJ 4CHUA 4KFCA 2YU3A 1X1DA 4XLFA 2X4HA 1XTAA 4GXOA 5BQTA 3SJMA 3T0YA 1XC5A 3FWEA 1UG0A 1K4TA 4MLOA 4XR6A 3A03A 1V55H 4PK4A 2P6TA 2ELKA 4P9UA 3E5QA 4XKCA 2BYVE 2CQXA 3IRRA 1YI2I 1TW2A 3FXKA 5L3CA 1JGGA 4HV6A 1BI0A 2PFBA 1FNNA 1ITYA 4FQGA 3RPQA 2ME6A 1X19A 2HU9A 2OA4A 1BN5A 4V2FA 3IH2A 3HRMA 5IYBJ 5KAIC 3N4MA 3GTMJ 2CH0A 5LHHA 2M2EA 3CCEI 5EEHA 5LD2C 3BTJA 1SD6A 3NARA 2RNGA 3E6BA 3D5RC 1RI7A 3GZNB 1ZG1A 5DUIA 1YS7A 1XMXA 4EATA 4AWXB 2JUGA 3ASOH 5DM6F 5FLXK 3BR6A 4XLCA 2QZ8A 3G71I 1X4OA 1FIPA 1SFUA 4LLGF 2IGKA 2MABA 1P4WA 3MMYB 1TLHB 2KIFA 3V8LA 3F8CA 5F6FA 2FNPA 4DYCA 1FOYA 2VODA 4FCYA 2ZNYA 4BAYA 1U8BA 4LJZF 1OISA 4KISA 1J2XA 4GRIA 5JHFA 2R7SA 2BZTA 3E0JB 2EIKH 2VKVA 4MNUA 1JUSA 4XLEA 1ZR2A 2CU7A 1T08B 3IWZA 5E17F 2FNAA 3F0CA 1OCZH 4IJAA 1YG2A 2HTSA 3MCZA 5EGOA 3OYJA 1GHCA 3NAUA 1U5TB 2EZHA 4CZZA 4ENKA 2XV4S 3CC4I 3M07A 3J7AY 4AIKA 3QYFA 3P7NA 4N9IA 2YUSA 4UB8C 1Z1DA 2NS8A 3C7JA 3RIRA 5C44J 1E0EA 1F1ZA 4IQJA 1DPRA 3K69A 4O5VA 4J00A 3TOAA 3BOQA 5DV5A 2DOFA 3H3ZA 2MLGA 2VBWA 3ZQLA 2LKXA 1I6XA 2DK8A 2G9WA 2O0YA 1QVTA 4ZZDA 2QF7A 3TDZC 3K70C 3P5JA 1UFMA 3WGHA 5BOXA 1F9NA 2O61A 2XGEA 2PJPA 2XF7A 1P4XA 2RAEA 3BJOA 2XAGA 2VB6A 2EA4A 4HZFA 4D5CA 4ESBA 1ZGJA 5BPDA 1F36A 1RR8C 1QHHD 3SYTA 1YQAA 1ZGAA 2GZWA 2HOSA 5J47A 2EJRA 1OFCX 2DN0A 3JRHA 5E8IA 3U2RA 5AIQA 3RKQA 2LG4A 2LBFB 1G3TA 3D0SA 4A3FJ 1KZHA 1B8IB 3EDPA 1R5GA 3M1CA 1B4AA 3GO5A 2MSYA 1SMYF 5EZHA 1X1CA 1WJFA 1YIOA 2R92J 1ETOA 1FBSA 4F91B 3BJAA 3RKYA 3T5XA 4EVIA 2XKOA 1B1BA 4FX0A 2ETHA 1MBFA 2CUZA 5DTDA 1SANA 3LWFA 2NYXA 4BJTA 4XQFA 4ZYHA 3H92A 1RZ4A 1OQYA 3CC7I 2CUFA 3DV8A 5F1JA 2TDXA 1IV8A 2FA5A 4PZJA 2KJBA 4BE0A 5J1YA 2EFPA 2VL8A 4KJZA 3HOSA 3F72A 4I99C 2EFQA 2IJLA 1V54H 1VI0A 3I58A 3EQLF 1QGPA 2V1NA 1MZBA 1Z21A 3DU5A 2P5LC 4I7HA 2X85A 2Y0SA 4RGXA 5LGNA 1BA5A 1ETYA 1MGTA 1V5FA 2DA3A 1VQLI 4BHPA 2MA3A 3I4NJ 2BEOA 1WFXA 2DTRA 4LG3A 3E1SA 3JTGA 5EZGA 4MHGA 1FLIA 3OYKA 2XF6A 3DPUA 3TGNA 1TNSA 1X4PA 1T33A 3ZCOA 4B43A 1USSA 3V7CA 5M3MJ 1MJ9A 3HPGA 1D1BA 1LB2A 2K9LA 1XSXA 4DW6A 4G6TB 2CGPA 4EGZA 5K7HA 1HCRA 2HEOA 3FM3A 1FSHA 5B1AH 4YFNF 2EB7A 5D8LB 2Y30A 1FP2A 1R4NB 2V26A 3IKTA 1R7JA 2KISA 2MG4A 4IHWA 2DDBA 3H36A 1XGNA 3K1PA 1ZR4A 3HOYJ 3KP5A 1BM9A 1MMGA 2VKHA 4L0ZB 2LC2A 1SFEA 2BXZA 3K1MA 2W85A 2WY8Q 1DP7P 4Q5SF 1BW5A 1P92A 4A3DJ 4HDUA 3GEZA 3TP0A 3OYHA 3GLLA 3S3NA 2XAQA 3MEXA 1OLTA 3L2VA 1R00A 2D5VA 3S1QJ 5LRSA 1AA7A 2PX9A 4L5JA 3BG7A 4EJVA 4WCGA 1TWCJ 1Y56A 3DKYA 5ERIA 1R4MB 5TJJA 2ZXJA 2LYCA 1T0FA 1O3SA 2VOPA 2XIGA 4C3IJ 1BOBA 2AQEA 1KU9A 1RR7A 2R0QC 1TP4A 1K79A 1FOKA 1NG7A 2VIXA 2ZMEC 3S2HJ 4CO8A 1ERDA 4M73A 2XGXA 1R9TJ 5JHUA 3BTIA 1BIAA 2PMZN 4W97A 1EV7A 2H1LA 5IP6A 4LGWA 2K86A 2WAQA 1SVLA 2EQRA 2P8TA 1K78A 3TQNA 2L7MP 2XPVA 1O7LA 1YRNB 1Z91A 4ABZA 2HVSA 2DA5A 3ZGKA 1VQ6I 3E6DA 3K9TA 2MH2A 4XSZF 1GLNA 3HRTA 1JHHA 4PFPA 1QO0D 3CCYA 5F04A 2VC0A 1EJ9A 4MFEA 3C2GA 2Y2ZA 4RM2A 3W6VA 3KIOA 5L3BA 4EJUA 2R5ZA 5EGOB 4A0YA 4YIIA 4M6XA 1QU3A 2ZKZA 4CYCA 3VFZA 2DTZA 3CCUI 2OBPA 2PBIA 2K4JA 2OTJI 1U6GA 4QTRA 3ZQCA 1XDUA 3TOBA 1ETXA 2WBMA 2QSGX 4HRIA 5CQEA 3CO7C 4JX4A 1W5SA 3IP4B 4M72A 3VYSB 1LQ1A 4PDKA 3FMQA 1T8IA 1P9QC 5HLTA 4EJWA 2DFEA 1NK2P 2IVMA 3ULQB 5E79C 3A01A 3C1DA 2JJ7A 5IYCJ 4EGYA 2QKMB 2ZB9A 4OIPF 3ABMH 3CMYA 2X6XA 3UNGC 1HW1A 2QQ9A 5HODA 4BEHA 2KT0A 4JBAA 1IN7A 3BG9A 2X6OA 5B5EC 1K7AA 1XPXA 1B6AA 4B47A 4EMSA 3OYCA 1I1GA 1LEAA 4F52A 1IF1A 2DI3A 4MO7A 1W36C 3I59A 2EZLA 3M1EA 3GTQJ 3R61A 2M7AA 3OY9A 3O3KA 2LNBA 2L9SA 1GT0C 5ICGA 4A3MJ 9ANTA 2XPWA 3E3VA 5ILUA 4XSXF 1O3QA 4RMNA 3BWGA 3PUFA 3QPTA 1T6SA 3ZMTA 5F0CA 2MBFA 5KVRA 1BJAA 3BQZA 2YS9A 2KRFA 4GYGA 5FRNA 2R7DA 2GLOA 4WXHA 3LA2A 1BOAA 1VTNC 3BLYA 2DDAA 1I5ZA 2JPCA 3MD2A 3IHUA 5TRDA 3VSLA 1PYVA 2Y9YA 4RM3A 4CICA 2M1BA 3H9JA 1YJWI 4RGUA 3GFIA 2BXYA 4OIRF 5CQGA 1OPCA 5EDNA 3K4LA 4C3JJ 2FMLA 2LF7A 3ABTA 2V1DA 1WJEA 2QQ8A 3HC7A 5FO5A 4ON0A 3I5UA 2EV0A 5IOZA 3PJRA 4IVNA 2MD0A 4NBQA 4II2A 5HDGA 1OR7A 2GWRA 2IS2A 4Z6YA 1W1WE 4XORA 3V8KA 2W4SA 3OS1A 1ON1A 4HQMA 4KUMA 1RETA 1T56A 3KETA 2CW8A 3W3CA 2XAFA 3FXLA 2KL4A 3JRAA 5DEQA 2E1NA 3AG2H 2CQQA 1U9NA 1VZ0A 4XRFA 2R7VA 1BBYA 3BG6A 4LG0A 1R1TA 3MFKA 2XAJA 3ZMDA 2VJ4A 5IP9J 2GXAA 2CMPA 3M8JA 4AIHA 1YLFA 1AKHA 4LMYA 3GVAA 4GCVA 4IOCF 4DBQA 3LSRA 2PMUA 3LSKA 1OYWA 5DD4A 2XSDC 1OYYA 3HRSA 1H88C 2D1VA 3KP4A 3A0HC 3QU6A 5LBQA 1WHUA 4A3GJ 2Q0OA 4RGSA 1SFXA 2QYOA 2JSCA 3ZQHA 2M34A 4RAZA 1ZHFA 5FFXA 3ZQ7A 3OS2A 2OPTA 3AG1H 5CVUA 1Z77A 3HOTA 4E7HA 3BR2A 2DYRH 2JT1A 4XNFA 1A36A 5GAEJ 3E6MA 2R7QA 1HW5A 2NOGA 2PG4A 2CG4A 1DUXC 3K4CA 4HSTA 5CVRA 1SAUA 1LPQA 1IGNA 1H0MA 5DCMA 3UKGA 3GFLA 5FGMA 3V8JA 4RLQA 3H35A 2VONA 3VPRA 3I3LA 3VB2A 3GFMA 4U7DA 2CYYA 2EIMH 1GUUA 3A0BC 2DA1A 3I71A 3PUBA 1K78B 4CSWA 1DGRM 3RQIA 1WQ2A 2HS5A 3GXOA 4ZH4F 3LMMA 2Y0SN 3LQQA 1QVUA 3HOUJ 1CQTA 5DM7F 4BXXJ 3MKZA 2VKDA 4M3GA 3BZ6A 2PI0A 3H0DA 3J81Z 2W48A 2BVMA 3KEOA 1ETQA 2R5ZB 2R3SA 1FWZA 2BOLA 3U21A 5FLVA 1XS9A 1QZEA 3EUAA 2HZTA 3QP6A 4H4KC 3H3VK 2H6CA 1XGSA 4E7JA 4CYCB 1HSJA 4N4OB 1HOMA 4UVCA 3GW2A 4ENNA 2HGCA 3TO7A 1XG1A 1DDNA 1UHMA 2NVYJ 3OOUA 1ZLJA 1KONA 2FF4A 2QM3A 2FQ3A 4Y7NJ 5LFAA 4RB0A 2R7ZJ 3FZVA 3B6CA 1Y0UA 4B3AA 1TT5B 4PSWA 2DMPA 1MBEA 2M4KA 4HX8A 1QZZA 1KQ8A 2ECCA 3K4BA 3QYBA 3GX4X 3K6GA 3CCVI 4UV8A 5CVVA 3A01B 2R7RA 1ETWA 3SXYA 1UZCA 3W6KB 3MZYA 4NC7A 1WJAA 1YIJI 1WH5A 2DMTA 3H9GA 1ZRDA 4BEHB 1TWHJ 4HW0A 1W5CC 5D8KB 4AVPA 4C3HJ 4KIGA 2YSRA 2DA2A 3KP6A 4RDUA 4HA8A 3I59B 3CCQI 2DT5A 3S3MA 2FMYA 4OU0A 4PJLA 4FHTA 4IQ4A 3F8NA 2JWTA 2X51A 1JJ6C 1FYLA 4GO1A 2OTLI 3M4OJ 1VQ7I 3QU3A 4ESFA 4AYBA 2LREA 4RGRA 4DQ2A 2XPUA 5DYMA 3RPUA 3JAMZ 1W5TA 2JSPA 5H2FC 3B02A 4YIFA 1OCTC 2WAQN 4U0WA 1HDPA 3HOWJ 3ZP5A 4M3EA 4KT5C 5FB2A 2UXNA 4ZDOA 1FTTA 3ZMZA 4ZYDA 1LKXA 4XKVA 5E18F 1ZRCA 3P9CA 2ID6A 2M9HA 2FQ4A 2EV6A 2OAZA 3DWLE 3ZQIA 2OQRA 1N25A 3VYRB 3SHFA 4A3LJ 4C2MJ 4OWRB 2DT6A 3A4CA 2CWEA 3LAPA 1H89C 2EIJH 2WV1A 3ZR8X 3EUKL 3TL4X 1ZH5A 4G8XA 5ICEA 4N0BA 4BGDA 3CZ6A 3E97A 3JRIA 3JTHA 3MZHA 4AU7A 4MEXF 1WRJA 3CO6C 5LLQA 4A3EJ 1Z6RA 2OC6A 2LRDA 1VQ9I 2HYFA 2PMHA 5E20A 2DMUA 1O3TA 3WTYC 2GM4A 3OYFA 3Q0UA 2E36A 1D8KA 3T8TA 1BC7C 4LG0B 2MGQA 1U3EM 4D0PA 3QPHA 1AKHB 1UAAA 2EPFA 2Y9ZA 1A6QA 1VQKI 3S14J 4G7OF 2P4WA 3Q0WA 4FE4A 5LGTA 4EM1A 1J5YA 2ZJ2A 2BY1A 1MMAA 1IO2A 3DU6A 2LFBA 2O5RA 2Y75A 2WTEA 2RKHA 3DEEA 2IT0A 2R7XA 5D6EA 1YO5C 4AVZA 4RBOA 1WI3A 4IF4A 2O7OA 4HF0A 1F4KA 3R0AA 3GMEA 1O4XA 4LB5A 3WE3A 2GA2A 2HKOA 1YS6A 4A2UA 1L0OC 1JKOC 4KITB 3CJRB 3FXOA 4XKBA 1A04A 3FF5A 5D4SA 5DCMB 3JSPA 2LVSA 1J0RA 4DNCA 1FMWA 1I3AA 2E1MB 4L9JA 4M9ZA 3WE2A 4J01A 1ZQ3P 1ZREA 3W2AA 2Y0MA 1T2KA 3L00A 4IPAA 4IOAF 1YX5A 2KIMA 4M74A 3FXJA 4I01A 5C3EJ 1ENHA 1ZG3A 1U5TC 4XN0A 1S3JA 4BH9A 4U87A 3NWSA 1ZLKA 4M6VA 1XMAA 3K4MA 2H1KA 3L2UA 2RGVA 2LOOA 1R1VA 5K5OA 2LTPA 1VQNI 1XD7A 2A61A 3QP5A 2A5WA 4HX7A 5ICFA 1Q1HA 1G3YA 2A07F 2HQAA 3ZMVA 2RV8A 1SVOA 3ZMUA 1IZ1A 4D1QA 1D1AA 1BJZA 1EF4A 4YIRX 3BTCA 1ETVA 2IGNA 3EPZA 5D5WB 3LSIA 4EV0A 2M30A 3L2CA 2ZMEA 3ASNH 1FPQA 1HA8A 1RIOH 3FXRA 4AIDA 2A6HF 1STZA 2I5UA 4KIBA 1ZARA 5HOOA 1I27A 3TEDA 3F6OA 2Q1ZB 3TKYA 3KEYA 1KA8A 2XDVA 2VPLA 3TO9A 2KDOA 4ANJA 5FLXZ 3VEPA 2KRCA 2DPDA 3LSGA 2B0LA 4BDYA 2FUG2 4PUSA 2BVLA 1KGSA 2DOAA 3FM5A 3FMSA 3SZGA 2ELHA 1UMQA 1U9OA 4NC6A 3TP3A 3FBIB 2FJ1A 3J7YJ 3HRUA 4J19A 3LSTA 1TC3C 2QVOA 3HG9A 1ON2A 2IS4A 3ZQQA 3K7AJ 1XDSA 1XN7A 1D3YA 2OQGA 1BI3A 2LH9A 1IRGA 5GTIC 3HPHA 2EV5A 3CUQA 4M3BA 3VDXA 1FOXA 4LK0F 1O57A 5BS6A 4I6ZA 2VQGA 2QCOA 2ZXHA 3NEUA 3OOPA 2W7NA 1HBXG 3VYTB 4MFDA 1D5YA 1S5LC 3V42A 3WODF 3ZQFA 3R60A 4MTDA 4BUPA 3HJEA 4G9YA 4P5OA 1TWGJ 1TZLA 2YPRA 2KP6A 2NVUB 3S3OA 2BV6A 5D4RA 2EH3A 1JTXA 5LEJA 2VQHA 1EH8A 2XASA 4S0HB 4AUXA 5BPIA 1FSEA 1XCVA 4XM3A 1YX3A 3GTPJ 4XL9A 2F5VA 5IT3A 5K1YA 4C2UA 4QPOA 2H09A 1MNEA 2OUMA 1EH6A 1QZYA 2A05A 2FU4A 1T38A 5HS9A 1AWCA 2JVGA 2LKSA 1IC8A 1ZKGA 3J7ZI 2O8KA 1VQPI 4A3CJ 4YELA 3KYCB 1EA3A 2E5ZA 4HAMA 1W0UA 2FSWA 2JA2A 4CCMA 4OIQF 4BXFA 5KNLA 4LIVA 4IKFA 3HOVJ 1ZTRA 3RDIA 4E4HA 2HDDA 4BQQA 2MW8A 2R7OA 3SFIA 5TGTA 2NVQJ 2HYGD 1YW7A 3TO6A 5M5WJ 2VJIA 3PIOF 3PQJA 1E2XA 1P7JA 2EZIA 4IZZA 5DS9A 4YRVA 5F27A 1HKQA 4IHVA 3WTWC 1LNWA 4L18B 5IT9Z 2Q8KA 2OF7A 2HOAA 4G12A 3BC8A 4XIDA 2NRAC 3JRBA 2W82A 2K85A 2ZC2A 3SFZA 1K4SA 2J5OA 1IUFA 3HDDA 3HIFA 2UWMA 1W7PA 2XUBA 1YYVA 2E35A 4FX4A 3QQAA 4G7HF 1YTYA 4UVBA 3BPVA 4CCJA 1VQ8I 1E17A 1JKPC 2HYJA 2IS1A 5FD6A 3TBIA 1MMSA 2L0KA 1BC8C 3HUGA 4Y17A 3CCRI 2AHQA 1BW6A 3I0TA 2LY9A 1IXCA 1JKRC 2R7TA 4YFKF 1G6NA 3DP7A 2O3FA 4LIUA 5EJCA 1FMVA 1HDDC 3DBRB 2VQCA 3DF8A 4JK1X 1VQ5I 1GVJA 4XLAA 4DZJA 4I09A 4AYBN 3E6CC 4IXAA 1LDJA 2Q2EA 1YW8A 3HHGA 5EEAA 3I56I 1A35A 2RVCA 4RAGA 2MYSA 1HLVA 2CRGA 4CH7A 3AL0B 3FK7A 2CFXA 2X48A 2JVHA 2VC1A 3OR2C 4A69C 3IAM2 4NC8A 2L9VA 2STWA 1VQMI 5J3LA 1K83J 2JA8J 4ZJZA 2IPQX 3OMYA 4XN3A 1MDMA 2HQ5A 4II3A 1J59A 5L3GA 1RKWA 2NOJB 3OSGA 5LHIA 3Q9VA 1MH3A 5HS7A 2L9NA 1HSTA 4OIOF 1MBJA 2BW3A 2JRMA 2LSOA 3OL3A 2ZMEB 2YX4A 4W1UA 2L54A 1S7AA 1USTA 2LY2A 3ESWB 3FXQA 4U88A 3ECOA 3GZ5A 3V7SA 3ZQGA 3KZZA 4MGRA 1X1AA 4HBLA 2ZBKA 2IA1A 3OYAA 4X6AJ 3GYHX 1FEXA 1WZ2A 2W84A 5CPRB 2DLLA 3ZPLA 2DOEA 3QYEA 1MD0A 2R7FA 2FXAA 3S8PA 3CJTB 2YX7A 1FP1D 2HXOA 1G2HA 5KCMA 2F4OB 4NQWA 4L0YB 2Y31A 5KK1A 3HKZN 3JR9A 3DLLF 3BR0A 2L5QA 3DKXA 1HC8A 1LDDA 3ZXSA 3CCSI 4KA4A 3FISA 4X0GA 1IAWA 1TNTA 3HSEA 1I39A 1MSEC 5C4XJ 3CUQB 5FRMA 4ZZLA 4LOCA 5HDNA 1N77A 1MBHA 1HQCA 3GBGA 3CUOA 3SEZA 3L09A 3HM5A 3WTXC 3OIQA 2V9KA 4JX6A 4PFOA 1R71A 1ZRFA 2DQRA 2DW4A 2CO5A 3SDBA 4A6DA 3WHBA 1BIBA 3GTLJ 4EEFG 1LDKB 2JQ7A 4ZDLA 1NK3P 1BL0A 2VKEA 1RNLA 4HF1A 1WPKA 4A3KJ 4XBFA 2COBA 2F5FA 4OINF 5JVGF 1FIAA 2HPIA 4BHCA 3LAJA 3WTTC 2MLKA 2VXZA 3LSHA 1XX5A 3ZMSA 3HOZJ 4ZYAA 3GLXA 4I0AA 1HW2A 5E8GA 3MKYB 2RNJA 1T95A 2HR3A 1R5HA 5KHDA 5E1WA 4QPQA 3FBNB 1X2NA 1SD5A 3CC2I 1D0ZA 3CLQA 4I98B 3Q5FA 1IN4A 4BY7J 3T1BA 4QSHA 3V7RA 2E1OA 4LB6B 4RAYA 1QRYA 4DJAA 2A69F 2VUMJ 2ZXWH 4D7NA 2ZCWA 2HKXA 2JPBA 4E7IA 1H9GA 2L4MA 1FJLA 3DXJF 5A2QZ 3FXMA 5J6XA 1D1CA 3HXLA 3OIPA 3KP3A 2IBDA 3DKWA 1CF7A 3K2ZA 1IG7A 2L7KA 2O03A 2V9VA 3DFGA 2M8EA 1IUYA 2KIQA 3M3YJ 2E2JJ 3WTSC 1DGWY 3QODA 2VBZA 1MJAA 3FK6A 3AFHA 3CMMA 2H6BA 4HPQA 4R8HA 2RC4A 1BI1A 3ML6A 2E1CA 1S7EA 2DA6A 2E5NA 3P9IA 5D5VB 2HOEA 3GWZA 1IN6A 4S04A 1G59A 3LSJA 1JKQC 4HQEA 3COAC 1SFOJ 3MZ8A 4M6YA 3K0LA 2LKPA 3E5UA 3KZIC 4BYYA 5F08A 3I55I 1W7PB 2ZO4A 2ZJQF 1T0FC 2DBBA 4M71A 1WJDA 4Y3OA 3KZYA 3LFKA 4IHSA 5FLMJ 3LSMA 2FD5A 2NS0A 1JXSA 1S9HA 1TBXA 1ZG5A 1AHDP 3IRQA 1S7OA 1QNTA 3G2BA 1Y6IA 4IHYA 1FY7A 4EJOA 2IP2A 4DYQA 3TW6A 2E2HJ 2VN2A 4HNUA 5E3OA 1YW9A 3W6JB 2Q2EB 2OV7A 2W00A 2XF5A 1R36A 3J81K 3ISPA 2HQRA 2CUEA 4XOPA 5F64A 1B72A 5K5RA 3B73A 2DA4A 3WU2C 1W4MA 5JR3A 3HOXJ 3QWLA 5J8FA 2V1XA 3FHZA 3AG3H 1G3WA 4GDFA 3BP8A 1PUEE 3G3ZA 2DODA 3Q0VA 3BR3A 5CKTA 2K3PA 2ZFUA 2LD5A 1MDMB 2IRFG 3KYLA 2K9QA 4EJTA 1MKMA 1NG6A 2K02A 3H3UA 2UUZA 2HDCA 3U9GA 3PO2J 1TQMA 2X6YA 4HNTA 1WJCA 2VXDA 1JTYA 4XLNF 3O2PE 4BJ5C 1X3UA 2BW3B 3VSKA 1IDYA 4OAZA 2GBYA 2UV1A 3GTJJ 1TWAJ 2IS6A 3L1PA 4BACA 3S1RJ 2VJJA 2FEZA 2NS7A 4CCLA 4OMYA 4A5NA 5IOYA 2X6WA 2GOXB 1FBQA 2ID3A 3BROA 3KLNA 2DMNA 1U5TA 4D7MA 3W2VA 4BE1A 1DPUA 1NTCA 3OYEA 2V4JC 2RN7A 2GIVA 3F3XA 4XRMA 4NQWB 3M9AA 5GAHJ 1E3HA 2D45A 4ENJA 1Z67A 2O8XA 4WX9A 1IRFA 2W1OA 1FYMA 3OV8A 1FZPB 3L2QA 3UR3C 4PJNA 3GUDA 3C3WA 3FHNA 2L4AA 4M9SA 2UXXA 4Y13A 3EYIA 4WXCA 3JAMK 3CP8A 3GTKJ 2FOKA 4N9HA 5JI6A 4FISA 4L5IA 3GFJA 4Z2YA 2L7FP 2FOWA 4Q47A 4A3IJ 1SFKA 1RKTA 3IC7A 4I76A 1KU7A 2G7HA 1U8RA 3BJ6A 2EA2A 2H8RA 2DJNA 5J40A 4MQ9F 3HSRA 1D5VA 1R5ID 5CLSA 1KYWA 1J7KA 2FRHA 2KKOA 2MC3A 2K9SA 3OIOA 2LBFA 1I3QJ 4U0YA 4A93J 2OU2A 4NNJA 1YHQI 2H27A 5KAFC 1S72I 1IN5A 2D1HA 2F4IA 3BZKA 4U0VA 3RCOA 5EG0A 4BE2A 2JA5J 3CCMI 5LEKA 1JUPA 2CQKA 2RDPA 5FKMA 1KYZA 5FKKA 4A0ZA 1IXSB 4LFUA 4XICA 3K4KA 4GGGA 1HKSA 3H5AA 3MAJA 5K5QA 3JRGA 3SEQA 2DJIA 3MVPA 2QEXI 2P0WA 2JTVA 4I02A 2WB1A 4E6KG 3Q3SA 5HVQC 1Z6TA 2ME0A 2WY7Q 2IEKA 4EM0B 5H20A 1GVDA 2XB0X 2A6TA 1WWXA 2DT7B 5BNGA 5ILVA 1TQIA 2HI3A 4HG2A 1ETKA 2NNYA 5FJ8J 3KEQA 2B9SA 1R58A 2FBKA 3LSPA 2MFZA 1CF7B 1U2WA 2XHKA 5AONA 5LHGA 3F21A 2GXBA 2CW7A 2R7UA 1WH7A 3G6EI 4G94A 2K9MA 3PNVA 3HYIA 1W0TA 2OD5A 3GF2A 4I0BA 3ECHA 3S2DJ 4ZDPA 1KQ9A 5B66C 4ZTJA 2OJED 3BT9A 3HSFA 3HBLA 4PSXA 1TWFJ 5J8CA 2DQLA 2HPMA 2MD5A 3HKZA 2FX0A 5D6FA 1B9NA 1Y1WJ 1KU3A 4MQVA 3ZN0A 2OCCH 2M4GA 3M7GA 2HZDA 3CCJI 1BI2A 2STTA 1S6LA 4NHJA 1XSVA 2V6CA 2Z2SB 3DEUA 1YE9A 2HVRA 2GOMA 3JCUC 2BHZA 1K6OA 4AM3A 3HEFA 1RPWA 1LVAA 5HLHA 2PEXA 2E1MC 1I50J 3DLAA 3CDIA 4UXNA 3T8RA 5M5YJ 3J80Z 1SD7A 2Z1DA 2IA2A 4Q4ZF 4CDGA 1LFUP 2TRTA 3OYIA 5DCFA 3OYNA 1RRJA 3S15J 3EUHC 2XC7A 1AOYA 1MJBA 5J4VA 1V4RA 1U78A 3BCAA 1X3ZB 2KZGA 2WA0A 3DQVC 5FFZA 3S2WA 4F7ZA 4CUGA 2KRHA 1GV5A 1QPIA 3ABUA 1B72B 2P81A 3O8HA 4CCOA 3KLOA 2DAOA 2K9NA 1UHSA 1IXRC 1KQ0A 4P55A 4ENMA 1G4DA 1V3FA 4HSRA 2QQAA 3C2BA 2DFIA 1WVRA 2GQQA 3PNTA 3RTRA 1HF0A 1M1EB 2DFFA 3I53A 2OZUA 3H9QA 3O8GA 2M0CA 3ZN1A 4DOZA 2N8GA 4PCQA 4ZYEA 2Z3YA 3BR1A 1IN8A 1QQIA 1JUMA 2QUFA 2ZJRF 1BR4A
chains in the Genus database with same CATH topology
1YITI 2JQ7A 3J7YJ 3CCRI 1YJWI 2E36A 2ZJPF 2QEXI 3CC7I 3PIPF 1VQ6I 5JVGF 3CCEI 1FOXA 1VQKI 1VQ5I 4UY8I 5DM6F 3I56I 3CMAI 1VQLI 3CCVI 3G71I 1YJ9I 4IO9F 3CC2I 3G6EI 3CCUI 1FOYA 1YIJI 3CCLI 2OTJI 1VQMI 4IOCF 1VQOI 2E34A 3J7ZI 3CCJI 3CCQI 1VQPI 3CC4I 1QA6A 2H8WA 1VQ4I 2OTLI 4IOAF 5GAHJ 1VQ7I 2K3FA 5GAEJ 1Y39A 3PIOF 3I55I 1VQNI 2ZJQF 3CJTB 3CMEI 2FOWA 1FOWA 3G4SI 3DLLF 3CF5F 3CD6I 2QA4I 1HC8A 5GADJ 3CCSI 1YHQI 5DM7F 1S72I 1YJNI 2NXNB 4V19K 2E35A 3CCMI 1VQ8I 2ZJRF 1ACIA 5GAGJ 1VQ9I 1MMSA 1YI2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT I;  2JQ7 A;  3J7Y J;  3CCR I;  1YJW I;  2E36 A;  2ZJP F;  2QEX I;  3CC7 I;  3PIP F;  1VQ6 I;  5JVG F;  3CCE I;  1FOX A;  1VQK I;  1VQ5 I;  4UY8 I;  5DM6 F;  3I56 I;  3CMA I;  1VQL I;  3CCV I;  3G71 I;  1YJ9 I;  4IO9 F;  3CC2 I;  3G6E I;  3CCU I;  1FOY A;  1YIJ I;  3CCL I;  2OTJ I;  1VQM I;  4IOC F;  1VQO I;  2E34 A;  3J7Z I;  3CCJ I;  3CCQ I;  1VQP I;  3CC4 I;  1QA6 A;  2H8W A;  1VQ4 I;  2OTL I;  4IOA F;  5GAH J;  1VQ7 I;  2K3F A;  5GAE J;  1Y39 A;  3PIO F;  3I55 I;  1VQN I;  2ZJQ F;  3CJT B;  3CME I;  2FOW A;  1FOW A;  3G4S I;  3DLL F;  3CF5 F;  3CD6 I;  2QA4 I;  1HC8 A;  5GAD J;  3CCS I;  1YHQ I;  5DM7 F;  1S72 I;  1YJN I;  2NXN B;  4V19 K;  2E35 A;  3CCM I;  1VQ8 I;  2ZJR F;  1ACI A;  5GAG J;  1VQ9 I;  1MMS A;  1YI2 I; 
#chains in the Genus database with same CATH topology
 1OMI A;  2ZFW A;  2HXI A;  1BR2 A;  1YRN A;  3DPL C;  3PFY A;  4BDZ A;  5DDG A;  5IY5 H;  2M7B A;  3BG5 A;  5E3M A;  1X1B A;  2PJR A;  1PP8 F;  2FBI A;  3KX2 A;  2Z5U A;  5HLI A;  4MTE A;  3QOP A;  1N78 A;  3KPH A;  1ZAO A;  2P5V A;  3KCC A;  5LGU A;  3G1L A;  3IUO A;  1MH4 A;  4XKW A;  5DD8 A;  3OSF A;  3CDH A;  2ZNZ A;  3M8E A;  4ITV A;  3RKW A;  1JHF A;  1SC7 A;  4C2T A;  3PM1 A;  2X1C A;  4E7L A;  3CMA I;  4M9X A;  4CZC A;  2KJC A;  1ZK8 A;  4UUV A;  3K2A A;  4LIT A;  1UEL B;  4NB5 A;  4E7Z A;  4KMF A;  4BJ6 C;  3K70 D;  1A31 A;  3RPU D;  4KYW A;  5AIP A;  2L02 A;  2LP0 A;  2XSJ C;  5E1X A;  2GXG A;  1MW7 A;  3BDD A;  3WTV C;  1ZEL A;  2CQ7 A;  2K27 A;  2WAE A;  5E3N A;  1VQO I;  2M0M A;  4B1R A;  1MSF C;  3L7W A;  3OR1 C;  4D5F A;  1D0X A;  1JT0 A;  2DMQ A;  2GA1 A;  1S8N A;  2CS3 A;  2CW0 F;  2JMW A;  5L3E A;  1X1P A;  2QBY A;  3H5N A;  3WTU C;  3IAS 2;  3AG4 H;  3CP2 A;  2K4B A;  3ELK A;  3SZP A;  4KIC A;  2VBY A;  1ZYR F;  3ABK H;  3BG3 A;  2O6G E;  3TDU C;  1PUF A;  3PNY A;  4FTH A;  4TV7 A;  2B63 J;  2KQR A;  5EG0 B;  1XB4 A;  4BL0 B;  2DFH A;  1G3S A;  2RRE A;  4DGW B;  3AKZ A;  3G4S I;  1KU2 A;  2KZV A;  2VI6 A;  4BU2 A;  5CJ9 A;  3KP2 A;  4FET A;  1IRX A;  4BY1 J;  2F4M B;  3IV5 A;  2DPU A;  3PL8 A;  1LE8 A;  1R22 A;  3JRD A;  5IT9 K;  2M5W A;  2AQF A;  3CF5 F;  5M5X J;  3CD6 I;  2JK3 A;  2E71 A;  2K7L A;  2ESH A;  2PN6 A;  2O9L A;  2PLY A;  3RYP A;  3FKJ A;  2AO9 A;  4S05 A;  5GP9 A;  3RI4 A;  1EH7 A;  4BQO A;  3I4P A;  1OCO H;  2X1E A;  1F43 A;  3JW4 A;  4L5E A;  1ZGW A;  4UUS A;  1QBJ A;  1Y0N A;  3FXU A;  4RA2 A;  4B4C A;  4LLN A;  5IYD J;  1ACI A;  3N97 A;  1A5J A;  2VT2 A;  2ESN A;  1E3O C;  4B44 A;  2E7X A;  2A6E F;  3BR5 A;  3LNQ A;  2P7C B;  2JA6 J;  1XMK A;  5HNF A;  1FBU A;  4X1E A;  4C9Y A;  3AAF A;  2EWN A;  1P2F A;  1SD4 A;  4Y52 J;  4NUB A;  2E60 A;  1OCP A;  4KNY A;  4QIW N;  2LLK A;  1OCC H;  3S1N J;  1EKE A;  3I9V 2;  1N75 A;  1O7F A;  4PJ0 C;  3KP7 A;  1R23 A;  1DQU A;  1Z05 A;  3GTO J;  4WK8 F;  2AS5 F;  2CQN A;  4A5M A;  1C0W A;  4UUT A;  3U1D A;  1H8A C;  4Y4R A;  4BNC A;  2F2E A;  2R7W A;  2QWW A;  1X2M A;  2E7W A;  5J1U A;  1NHA A;  2VQL A;  4PJM A;  4V2G A;  2IGM A;  2LR8 A;  5ICC A;  2DYS H;  2CV0 A;  2L3D A;  2L9R A;  3AL0 C;  1P6R A;  2YR2 A;  2CJJ A;  2EK5 A;  1V5G A;  5F1R A;  4JYK A;  4C30 A;  2F5E A;  4BQA A;  5FKL A;  2RQP A;  3H5R A;  1UJ8 A;  3IH3 A;  1HKT A;  2F5C A;  2JUC A;  4IX7 A;  3HHH A;  4XMY A;  5K7Z A;  1APL C;  2A3S A;  5FD5 A;  1QA6 A;  4B8X A;  2GIZ A;  2CFO A;  3MQ0 A;  3IL2 A;  3FX3 A;  3N05 A;  1WGX A;  4ASN A;  2VJ5 A;  4CYD A;  4AC0 A;  2EFW A;  1PP7 U;  2DO7 A;  3DEW A;  3KFW X;  2R5Y A;  3B6A A;  4GYI A;  3TMO A;  5GTH C;  1I6H J;  4JQF A;  5ED4 A;  1MBG A;  4UHT A;  3K4N A;  4HNV A;  1Q1V A;  3NWT A;  5TIS C;  4YG2 F;  2HDW A;  3WTZ A;  3J7A O;  1MNM C;  3MKL A;  1E3P A;  1OCR H;  4KN4 X;  2J5P A;  2TCT A;  1J09 A;  1XSD A;  2ICW G;  1RC9 A;  2BE5 F;  1FT9 A;  3E5X A;  3PSI A;  4KN7 X;  1SAX A;  5HNH A;  2M45 A;  4HX4 A;  3F8B A;  2WB1 N;  3ERM A;  3IKV A;  4LK1 F;  5B3S H;  5H6Q A;  4N4N B;  3F22 A;  2WV0 A;  3OWT A;  2JA7 J;  3VWB A;  3QOE A;  4IRI A;  3OL4 A;  4CCK A;  3RQ4 A;  3F8F A;  4A6E A;  3BPX A;  2WWY A;  3IH4 A;  4XLP F;  2C6Y A;  2ZSH B;  1Z7U A;  5GAD J;  2PJR B;  1PVE A;  1Z3X A;  4MIM A;  5FKN A;  4HLY A;  3S17 J;  3S32 A;  3V4G A;  1IDZ A;  5EYR A;  5JLW A;  3BZC A;  3D1N I;  2E2I J;  3GCM A;  3L9F A;  2L2O A;  4BS9 A;  4V19 K;  5GAG J;  4IRG A;  3CUQ C;  3BQY A;  3F23 A;  1B9M A;  4F92 B;  1GDT A;  1TTY A;  4YEJ A;  4KT6 A;  1SEU A;  2BY2 A;  5GPA A;  4CGZ A;  2KPM A;  2H94 A;  3HTU A;  1Z9C A;  1REP C;  4RB1 A;  1YFH A;  3HGG A;  3VOE A;  4IHX A;  1LVK A;  2Y48 A;  2RQQ A;  2FBH A;  4M3F A;  3PIP F;  2KMU A;  3D5S C;  2F48 A;  2CUJ A;  2PQ8 A;  1QHG A;  2KLO A;  5D5X B;  5F0H A;  1J9I A;  4QWQ A;  4ZTF A;  5HLG A;  4UY8 I;  2XGC A;  2NAZ A;  2QLZ A;  2XRN A;  1WI9 A;  3R6S A;  3ZOB A;  2V79 A;  1TQP A;  1H9T A;  2V1U A;  1IW7 F;  3PSF A;  3L2W A;  2EIN H;  1CGP A;  1R1U A;  2COM A;  3RJP A;  5F0F A;  3OYB A;  4FE7 A;  1X3W B;  5EEG A;  1YJ9 I;  4NDL A;  3FKI J;  3WGG A;  3CF2 A;  2HVQ A;  1ONV A;  2QBY B;  1WJB A;  2Z99 A;  3WU1 B;  4FT8 A;  3PFI A;  2Z33 A;  1K6Y A;  1JJ8 C;  3X2Q H;  2IA0 A;  3JRC A;  3CCL I;  1W36 D;  4P96 A;  1I1S A;  2M87 A;  1O3R A;  1PUF B;  3F8M A;  2ACJ A;  3JSO A;  4HDV A;  1BR1 A;  2M3A A;  2EIL H;  2BHY A;  4HEA 2;  4RB3 C;  5A2Q K;  2VT3 A;  2LF8 A;  2X9D A;  2AXT C;  1LE8 B;  1VND A;  2HTJ A;  2P5K A;  3G1O A;  4IEJ A;  2XRO A;  3L2R A;  3LFU A;  2ZXI A;  3CLO A;  4A3B J;  4CA0 A;  1LUJ B;  2LDU A;  4KDP A;  1OKR A;  1LFB A;  3GTG J;  3LOC A;  3D5L A;  5CVI A;  3REO A;  3WU0 A;  2WAF A;  2KHM A;  2XAH A;  4UUS B;  3MN2 A;  1DU0 A;  5K7F A;  1W7P D;  2MH9 A;  2A5Y B;  1OJL A;  2WC2 A;  4UNO A;  1P4A A;  2JN6 A;  1IRZ A;  1MBK A;  5GPC A;  1FOW A;  3R0J A;  1LFP A;  3ONQ A;  2OCE A;  2Z16 A;  1RUN A;  5CVJ A;  2YU9 J;  3IWF A;  4O3M A;  4HF2 A;  4K2E A;  3S93 A;  1IJW C;  2QSH X;  1B59 A;  3LA7 A;  5H6R A;  3RZO J;  2P7V B;  5L3D A;  2MC4 A;  5E1Z B;  1U0J A;  3M8F A;  3HB9 A;  4DBR A;  2DA7 A;  1ODD A;  4EQQ A;  3MWM A;  3LL7 A;  4Y33 A;  4LLL A;  1DU6 A;  3DCF A;  4PJJ A;  3SQN A;  3BCB A;  2ADU A;  2LY1 A;  3C18 A;  1SMT A;  1WJ5 A;  4M3D A;  4A12 A;  1YIT I;  4G6D A;  3HUG B;  3E7L A;  3MKW B;  1WCM J;  3FDY A;  4I2O A;  1IV6 A;  1PJR A;  2VBX A;  1Y8Q B;  2CV2 A;  2JZY A;  1WKM A;  2XRL A;  2ZJP F;  1Y8R B;  3QRF F;  2HQN A;  5HDK A;  1GV2 A;  4ZC3 A;  1TT0 A;  4EM2 A;  2W57 A;  3K10 A;  5JLX A;  2ZSI B;  4HOB A;  4F55 A;  2BGC A;  1PDN C;  1MND A;  3HZJ A;  5JFR A;  2I10 A;  4RB2 C;  2ISZ A;  1GXQ A;  3FMR A;  2CSO A;  1D8J A;  3OYL A;  3H0G J;  3SDG A;  3JRE A;  3DPT A;  4OAY A;  3BY6 A;  4KIF A;  4XK4 A;  4F93 B;  1UCR A;  3G1M A;  1K61 A;  5DUK A;  4BXU A;  5BMZ A;  4IO9 F;  4DZP A;  3HL2 A;  4HV5 A;  4XOT A;  2R5Y B;  2L01 A;  1RUO A;  3NRV A;  4PGH A;  4R79 A;  4G7Z F;  3RZD J;  1G8X A;  1D0Y A;  3KE2 A;  2XKP A;  2XVC A;  1XCB A;  3QAH A;  3I54 A;  3C2H A;  2D2W A;  4JOM A;  4YFX F;  2E34 A;  2V6E A;  4UB6 C;  3SZT A;  4AD9 A;  5JVT A;  1JI8 A;  3CTA A;  2IGO A;  2B7E A;  4BHB A;  2WAD A;  2ECB A;  2DCE A;  1UHW A;  5CYV A;  4XLH A;  2K40 A;  4BQN A;  4L9N A;  4R1H A;  3W2W A;  1TW3 A;  1NH3 A;  5B1B H;  3KYD B;  4OOI A;  4WXD A;  4H0E A;  3LQR A;  4L9V A;  1V5E A;  2K3F A;  4RLF A;  3EUH A;  5FKO A;  3CJN A;  4B3X A;  4IL6 C;  4WWC A;  4WF2 A;  2HFH A;  4IRH A;  1TL8 A;  3TW7 A;  4DYR A;  3WGI A;  2R93 J;  3WHC A;  3RKX A;  3CJQ B;  4UV9 A;  2I8D A;  4E7S A;  2AXL A;  3DBH B;  3CME I;  3RSN A;  2G0E A;  2IAI A;  3FIW A;  3HGY A;  3PQK A;  3HTS B;  3CES A;  3ERE D;  4ZYG A;  3NQO A;  3F6V A;  2GAU A;  3P9K A;  1XGO A;  2W25 A;  2QA4 I;  2EFO A;  3ABL H;  2VE8 A;  3S1M J;  1T98 A;  2F5D A;  2XGD A;  2LMD A;  2VLA A;  4U7B A;  2P6S A;  4JP0 A;  5HS8 A;  3DTI A;  4ETS A;  3CDL A;  1WSU A;  3K1N A;  2KIU A;  1MIJ A;  2EFN A;  4B48 A;  1HXD A;  2BY0 A;  2K5C A;  2NXN B;  1YJN I;  4GFB A;  2R4G A;  4QLC U;  1X58 A;  2G7U A;  4JX5 A;  2EZK A;  3JRF A;  4AIJ A;  2OZ6 A;  4D9J A;  1P7I A;  5FRO A;  2UZK A;  4RAF A;  5ILS A;  2XB5 A;  1FYK A;  3OYD A;  1Z0X A;  3VOD A;  2XAU A;  1LEB A;  2EBI A;  2V7F A;  2DXI A;  2BBY A;  2VPR A;  4UVA A;  3WG7 H;  3WG9 A;  4A0X A;  1AU7 A;  1MMD A;  3ZRG A;  1SVM A;  2CV1 A;  4Q48 A;  4HYE A;  2IXS A;  1UG2 A;  1ZN2 A;  4Y15 A;  5IPA A;  4XRS A;  4OMZ A;  3PO3 J;  4XON A;  1YOV B;  1B8I A;  1ULY A;  1LJ9 A;  4XRS G;  4E7K A;  4BBS J;  2VOO A;  3A2K A;  3EYY A;  1VFC A;  2QGU A;  5IP7 J;  3BTL A;  3A02 A;  3H1C A;  5E3L A;  3F9K A;  2QQB A;  1JGS A;  2QSF X;  4MEY F;  1XGM A;  1Z7L A;  3QPL A;  4A3J J;  1JT6 A;  3A1Y A;  4LD5 A;  2VAS A;  1FC3 A;  3CQZ J;  3DTK A;  4KMU X;  2A68 F;  2KFD A;  1R6R A;  3RYR A;  1FX7 A;  3EET A;  1OR7 C;  1UB9 A;  2X0L A;  3VYU B;  1A6I A;  1QPM A;  2NNN A;  3K4J A;  2PMZ A;  2NVT J;  4RS8 A;  4BBR J;  6PAX A;  4G6Q A;  1FTZ A;  1MMN A;  5D5U B;  1Z3Y A;  2Y69 H;  3LA3 A;  3S16 J;  3OYM A;  4BKX A;  2KDZ A;  4O6J A;  2L7Z A;  2HWV A;  2DU9 A;  5LRR A;  4DIQ A;  4B09 A;  4FAS D;  3ROU A;  2H8W A;  2W24 A;  2JRT A;  4F3Q A;  1VQ4 I;  1GXP A;  2E19 A;  4E70 A;  3OYG A;  2LK2 A;  1OYI A;  1Y1V J;  1VF9 A;  1L3L A;  5J1R A;  1R49 A;  2DK5 A;  2BY3 A;  2ELJ A;  4L9T A;  5C4J J;  2VE9 A;  4IHT A;  2ISY A;  1RES A;  2HNH A;  1Y39 A;  4PGG A;  4CCN A;  3R4K A;  5M3F J;  1DP3 A;  1S29 A;  2M8G X;  2X1D A;  3DBL B;  2QKL B;  5J4Y A;  4P1W A;  3I64 A;  3J80 K;  4HLX A;  3G73 A;  1JE8 A;  3GZ6 A;  2HOT A;  3OS0 A;  4ESJ A;  5EF6 A;  2Z9O A;  3QPS A;  1T39 A;  3DTE A;  1J75 A;  3I4M J;  1POG A;  2FE3 A;  3Q9S A;  1F5T A;  4CXF A;  2V9P A;  2IW5 A;  1ORK A;  4P9F A;  3U1K A;  2QEN A;  5L3F A;  3O6B B;  2F6C A;  2NVX J;  4CHU A;  4KFC A;  2YU3 A;  1X1D A;  4XLF A;  2X4H A;  1XTA A;  4GXO A;  5BQT A;  3SJM A;  3T0Y A;  1XC5 A;  3FWE A;  1UG0 A;  1K4T A;  4MLO A;  4XR6 A;  3A03 A;  1V55 H;  4PK4 A;  2P6T A;  2ELK A;  4P9U A;  3E5Q A;  4XKC A;  2BYV E;  2CQX A;  3IRR A;  1YI2 I;  1TW2 A;  3FXK A;  5L3C A;  1JGG A;  4HV6 A;  1BI0 A;  2PFB A;  1FNN A;  1ITY A;  4FQG A;  3RPQ A;  2ME6 A;  1X19 A;  2HU9 A;  2OA4 A;  1BN5 A;  4V2F A;  3IH2 A;  3HRM A;  5IYB J;  5KAI C;  3N4M A;  3GTM J;  2CH0 A;  5LHH A;  2M2E A;  3CCE I;  5EEH A;  5LD2 C;  3BTJ A;  1SD6 A;  3NAR A;  2RNG A;  3E6B A;  3D5R C;  1RI7 A;  3GZN B;  1ZG1 A;  5DUI A;  1YS7 A;  1XMX A;  4EAT A;  4AWX B;  2JUG A;  3ASO H;  5DM6 F;  5FLX K;  3BR6 A;  4XLC A;  2QZ8 A;  3G71 I;  1X4O A;  1FIP A;  1SFU A;  4LLG F;  2IGK A;  2MAB A;  1P4W A;  3MMY B;  1TLH B;  2KIF A;  3V8L A;  3F8C A;  5F6F A;  2FNP A;  4DYC A;  1FOY A;  2VOD A;  4FCY A;  2ZNY A;  4BAY A;  1U8B A;  4LJZ F;  1OIS A;  4KIS A;  1J2X A;  4GRI A;  5JHF A;  2R7S A;  2BZT A;  3E0J B;  2EIK H;  2VKV A;  4MNU A;  1JUS A;  4XLE A;  1ZR2 A;  2CU7 A;  1T08 B;  3IWZ A;  5E17 F;  2FNA A;  3F0C A;  1OCZ H;  4IJA A;  1YG2 A;  2HTS A;  3MCZ A;  5EGO A;  3OYJ A;  1GHC A;  3NAU A;  1U5T B;  2EZH A;  4CZZ A;  4ENK A;  2XV4 S;  3CC4 I;  3M07 A;  3J7A Y;  4AIK A;  3QYF A;  3P7N A;  4N9I A;  2YUS A;  4UB8 C;  1Z1D A;  2NS8 A;  3C7J A;  3RIR A;  5C44 J;  1E0E A;  1F1Z A;  4IQJ A;  1DPR A;  3K69 A;  4O5V A;  4J00 A;  3TOA A;  3BOQ A;  5DV5 A;  2DOF A;  3H3Z A;  2MLG A;  2VBW A;  3ZQL A;  2LKX A;  1I6X A;  2DK8 A;  2G9W A;  2O0Y A;  1QVT A;  4ZZD A;  2QF7 A;  3TDZ C;  3K70 C;  3P5J A;  1UFM A;  3WGH A;  5BOX A;  1F9N A;  2O61 A;  2XGE A;  2PJP A;  2XF7 A;  1P4X A;  2RAE A;  3BJO A;  2XAG A;  2VB6 A;  2EA4 A;  4HZF A;  4D5C A;  4ESB A;  1ZGJ A;  5BPD A;  1F36 A;  1RR8 C;  1QHH D;  3SYT A;  1YQA A;  1ZGA A;  2GZW A;  2HOS A;  5J47 A;  2EJR A;  1OFC X;  2DN0 A;  3JRH A;  5E8I A;  3U2R A;  5AIQ A;  3RKQ A;  2LG4 A;  2LBF B;  1G3T A;  3D0S A;  4A3F J;  1KZH A;  1B8I B;  3EDP A;  1R5G A;  3M1C A;  1B4A A;  3GO5 A;  2MSY A;  1SMY F;  5EZH A;  1X1C A;  1WJF A;  1YIO A;  2R92 J;  1ETO A;  1FBS A;  4F91 B;  3BJA A;  3RKY A;  3T5X A;  4EVI A;  2XKO A;  1B1B A;  4FX0 A;  2ETH A;  1MBF A;  2CUZ A;  5DTD A;  1SAN A;  3LWF A;  2NYX A;  4BJT A;  4XQF A;  4ZYH A;  3H92 A;  1RZ4 A;  1OQY A;  3CC7 I;  2CUF A;  3DV8 A;  5F1J A;  2TDX A;  1IV8 A;  2FA5 A;  4PZJ A;  2KJB A;  4BE0 A;  5J1Y A;  2EFP A;  2VL8 A;  4KJZ A;  3HOS A;  3F72 A;  4I99 C;  2EFQ A;  2IJL A;  1V54 H;  1VI0 A;  3I58 A;  3EQL F;  1QGP A;  2V1N A;  1MZB A;  1Z21 A;  3DU5 A;  2P5L C;  4I7H A;  2X85 A;  2Y0S A;  4RGX A;  5LGN A;  1BA5 A;  1ETY A;  1MGT A;  1V5F A;  2DA3 A;  1VQL I;  4BHP A;  2MA3 A;  3I4N J;  2BEO A;  1WFX A;  2DTR A;  4LG3 A;  3E1S A;  3JTG A;  5EZG A;  4MHG A;  1FLI A;  3OYK A;  2XF6 A;  3DPU A;  3TGN A;  1TNS A;  1X4P A;  1T33 A;  3ZCO A;  4B43 A;  1USS A;  3V7C A;  5M3M J;  1MJ9 A;  3HPG A;  1D1B A;  1LB2 A;  2K9L A;  1XSX A;  4DW6 A;  4G6T B;  2CGP A;  4EGZ A;  5K7H A;  1HCR A;  2HEO A;  3FM3 A;  1FSH A;  5B1A H;  4YFN F;  2EB7 A;  5D8L B;  2Y30 A;  1FP2 A;  1R4N B;  2V26 A;  3IKT A;  1R7J A;  2KIS A;  2MG4 A;  4IHW A;  2DDB A;  3H36 A;  1XGN A;  3K1P A;  1ZR4 A;  3HOY J;  3KP5 A;  1BM9 A;  1MMG A;  2VKH A;  4L0Z B;  2LC2 A;  1SFE A;  2BXZ A;  3K1M A;  2W85 A;  2WY8 Q;  1DP7 P;  4Q5S F;  1BW5 A;  1P92 A;  4A3D J;  4HDU A;  3GEZ A;  3TP0 A;  3OYH A;  3GLL A;  3S3N A;  2XAQ A;  3MEX A;  1OLT A;  3L2V A;  1R00 A;  2D5V A;  3S1Q J;  5LRS A;  1AA7 A;  2PX9 A;  4L5J A;  3BG7 A;  4EJV A;  4WCG A;  1TWC J;  1Y56 A;  3DKY A;  5ERI A;  1R4M B;  5TJJ A;  2ZXJ A;  2LYC A;  1T0F A;  1O3S A;  2VOP A;  2XIG A;  4C3I J;  1BOB A;  2AQE A;  1KU9 A;  1RR7 A;  2R0Q C;  1TP4 A;  1K79 A;  1FOK A;  1NG7 A;  2VIX A;  2ZME C;  3S2H J;  4CO8 A;  1ERD A;  4M73 A;  2XGX A;  1R9T J;  5JHU A;  3BTI A;  1BIA A;  2PMZ N;  4W97 A;  1EV7 A;  2H1L A;  5IP6 A;  4LGW A;  2K86 A;  2WAQ A;  1SVL A;  2EQR A;  2P8T A;  1K78 A;  3TQN A;  2L7M P;  2XPV A;  1O7L A;  1YRN B;  1Z91 A;  4ABZ A;  2HVS A;  2DA5 A;  3ZGK A;  1VQ6 I;  3E6D A;  3K9T A;  2MH2 A;  4XSZ F;  1GLN A;  3HRT A;  1JHH A;  4PFP A;  1QO0 D;  3CCY A;  5F04 A;  2VC0 A;  1EJ9 A;  4MFE A;  3C2G A;  2Y2Z A;  4RM2 A;  3W6V A;  3KIO A;  5L3B A;  4EJU A;  2R5Z A;  5EGO B;  4A0Y A;  4YII A;  4M6X A;  1QU3 A;  2ZKZ A;  4CYC A;  3VFZ A;  2DTZ A;  3CCU I;  2OBP A;  2PBI A;  2K4J A;  2OTJ I;  1U6G A;  4QTR A;  3ZQC A;  1XDU A;  3TOB A;  1ETX A;  2WBM A;  2QSG X;  4HRI A;  5CQE A;  3CO7 C;  4JX4 A;  1W5S A;  3IP4 B;  4M72 A;  3VYS B;  1LQ1 A;  4PDK A;  3FMQ A;  1T8I A;  1P9Q C;  5HLT A;  4EJW A;  2DFE A;  1NK2 P;  2IVM A;  3ULQ B;  5E79 C;  3A01 A;  3C1D A;  2JJ7 A;  5IYC J;  4EGY A;  2QKM B;  2ZB9 A;  4OIP F;  3ABM H;  3CMY A;  2X6X A;  3UNG C;  1HW1 A;  2QQ9 A;  5HOD A;  4BEH A;  2KT0 A;  4JBA A;  1IN7 A;  3BG9 A;  2X6O A;  5B5E C;  1K7A A;  1XPX A;  1B6A A;  4B47 A;  4EMS A;  3OYC A;  1I1G A;  1LEA A;  4F52 A;  1IF1 A;  2DI3 A;  4MO7 A;  1W36 C;  3I59 A;  2EZL A;  3M1E A;  3GTQ J;  3R61 A;  2M7A A;  3OY9 A;  3O3K A;  2LNB A;  2L9S A;  1GT0 C;  5ICG A;  4A3M J;  9ANT A;  2XPW A;  3E3V A;  5ILU A;  4XSX F;  1O3Q A;  4RMN A;  3BWG A;  3PUF A;  3QPT A;  1T6S A;  3ZMT A;  5F0C A;  2MBF A;  5KVR A;  1BJA A;  3BQZ A;  2YS9 A;  2KRF A;  4GYG A;  5FRN A;  2R7D A;  2GLO A;  4WXH A;  3LA2 A;  1BOA A;  1VTN C;  3BLY A;  2DDA A;  1I5Z A;  2JPC A;  3MD2 A;  3IHU A;  5TRD A;  3VSL A;  1PYV A;  2Y9Y A;  4RM3 A;  4CIC A;  2M1B A;  3H9J A;  1YJW I;  4RGU A;  3GFI A;  2BXY A;  4OIR F;  5CQG A;  1OPC A;  5EDN A;  3K4L A;  4C3J J;  2FML A;  2LF7 A;  3ABT A;  2V1D A;  1WJE A;  2QQ8 A;  3HC7 A;  5FO5 A;  4ON0 A;  3I5U A;  2EV0 A;  5IOZ A;  3PJR A;  4IVN A;  2MD0 A;  4NBQ A;  4II2 A;  5HDG A;  1OR7 A;  2GWR A;  2IS2 A;  4Z6Y A;  1W1W E;  4XOR A;  3V8K A;  2W4S A;  3OS1 A;  1ON1 A;  4HQM A;  4KUM A;  1RET A;  1T56 A;  3KET A;  2CW8 A;  3W3C A;  2XAF A;  3FXL A;  2KL4 A;  3JRA A;  5DEQ A;  2E1N A;  3AG2 H;  2CQQ A;  1U9N A;  1VZ0 A;  4XRF A;  2R7V A;  1BBY A;  3BG6 A;  4LG0 A;  1R1T A;  3MFK A;  2XAJ A;  3ZMD A;  2VJ4 A;  5IP9 J;  2GXA A;  2CMP A;  3M8J A;  4AIH A;  1YLF A;  1AKH A;  4LMY A;  3GVA A;  4GCV A;  4IOC F;  4DBQ A;  3LSR A;  2PMU A;  3LSK A;  1OYW A;  5DD4 A;  2XSD C;  1OYY A;  3HRS A;  1H88 C;  2D1V A;  3KP4 A;  3A0H C;  3QU6 A;  5LBQ A;  1WHU A;  4A3G J;  2Q0O A;  4RGS A;  1SFX A;  2QYO A;  2JSC A;  3ZQH A;  2M34 A;  4RAZ A;  1ZHF A;  5FFX A;  3ZQ7 A;  3OS2 A;  2OPT A;  3AG1 H;  5CVU A;  1Z77 A;  3HOT A;  4E7H A;  3BR2 A;  2DYR H;  2JT1 A;  4XNF A;  1A36 A;  5GAE J;  3E6M A;  2R7Q A;  1HW5 A;  2NOG A;  2PG4 A;  2CG4 A;  1DUX C;  3K4C A;  4HST A;  5CVR A;  1SAU A;  1LPQ A;  1IGN A;  1H0M A;  5DCM A;  3UKG A;  3GFL A;  5FGM A;  3V8J A;  4RLQ A;  3H35 A;  2VON A;  3VPR A;  3I3L A;  3VB2 A;  3GFM A;  4U7D A;  2CYY A;  2EIM H;  1GUU A;  3A0B C;  2DA1 A;  3I71 A;  3PUB A;  1K78 B;  4CSW A;  1DGR M;  3RQI A;  1WQ2 A;  2HS5 A;  3GXO A;  4ZH4 F;  3LMM A;  2Y0S N;  3LQQ A;  1QVU A;  3HOU J;  1CQT A;  5DM7 F;  4BXX J;  3MKZ A;  2VKD A;  4M3G A;  3BZ6 A;  2PI0 A;  3H0D A;  3J81 Z;  2W48 A;  2BVM A;  3KEO A;  1ETQ A;  2R5Z B;  2R3S A;  1FWZ A;  2BOL A;  3U21 A;  5FLV A;  1XS9 A;  1QZE A;  3EUA A;  2HZT A;  3QP6 A;  4H4K C;  3H3V K;  2H6C A;  1XGS A;  4E7J A;  4CYC B;  1HSJ A;  4N4O B;  1HOM A;  4UVC A;  3GW2 A;  4ENN A;  2HGC A;  3TO7 A;  1XG1 A;  1DDN A;  1UHM A;  2NVY J;  3OOU A;  1ZLJ A;  1KON A;  2FF4 A;  2QM3 A;  2FQ3 A;  4Y7N J;  5LFA A;  4RB0 A;  2R7Z J;  3FZV A;  3B6C A;  1Y0U A;  4B3A A;  1TT5 B;  4PSW A;  2DMP A;  1MBE A;  2M4K A;  4HX8 A;  1QZZ A;  1KQ8 A;  2ECC A;  3K4B A;  3QYB A;  3GX4 X;  3K6G A;  3CCV I;  4UV8 A;  5CVV A;  3A01 B;  2R7R A;  1ETW A;  3SXY A;  1UZC A;  3W6K B;  3MZY A;  4NC7 A;  1WJA A;  1YIJ I;  1WH5 A;  2DMT A;  3H9G A;  1ZRD A;  4BEH B;  1TWH J;  4HW0 A;  1W5C C;  5D8K B;  4AVP A;  4C3H J;  4KIG A;  2YSR A;  2DA2 A;  3KP6 A;  4RDU A;  4HA8 A;  3I59 B;  3CCQ I;  2DT5 A;  3S3M A;  2FMY A;  4OU0 A;  4PJL A;  4FHT A;  4IQ4 A;  3F8N A;  2JWT A;  2X51 A;  1JJ6 C;  1FYL A;  4GO1 A;  2OTL I;  3M4O J;  1VQ7 I;  3QU3 A;  4ESF A;  4AYB A;  2LRE A;  4RGR A;  4DQ2 A;  2XPU A;  5DYM A;  3RPU A;  3JAM Z;  1W5T A;  2JSP A;  5H2F C;  3B02 A;  4YIF A;  1OCT C;  2WAQ N;  4U0W A;  1HDP A;  3HOW J;  3ZP5 A;  4M3E A;  4KT5 C;  5FB2 A;  2UXN A;  4ZDO A;  1FTT A;  3ZMZ A;  4ZYD A;  1LKX A;  4XKV A;  5E18 F;  1ZRC A;  3P9C A;  2ID6 A;  2M9H A;  2FQ4 A;  2EV6 A;  2OAZ A;  3DWL E;  3ZQI A;  2OQR A;  1N25 A;  3VYR B;  3SHF A;  4A3L J;  4C2M J;  4OWR B;  2DT6 A;  3A4C A;  2CWE A;  3LAP A;  1H89 C;  2EIJ H;  2WV1 A;  3ZR8 X;  3EUK L;  3TL4 X;  1ZH5 A;  4G8X A;  5ICE A;  4N0B A;  4BGD A;  3CZ6 A;  3E97 A;  3JRI A;  3JTH A;  3MZH A;  4AU7 A;  4MEX F;  1WRJ A;  3CO6 C;  5LLQ A;  4A3E J;  1Z6R A;  2OC6 A;  2LRD A;  1VQ9 I;  2HYF A;  2PMH A;  5E20 A;  2DMU A;  1O3T A;  3WTY C;  2GM4 A;  3OYF A;  3Q0U A;  2E36 A;  1D8K A;  3T8T A;  1BC7 C;  4LG0 B;  2MGQ A;  1U3E M;  4D0P A;  3QPH A;  1AKH B;  1UAA A;  2EPF A;  2Y9Z A;  1A6Q A;  1VQK I;  3S14 J;  4G7O F;  2P4W A;  3Q0W A;  4FE4 A;  5LGT A;  4EM1 A;  1J5Y A;  2ZJ2 A;  2BY1 A;  1MMA A;  1IO2 A;  3DU6 A;  2LFB A;  2O5R A;  2Y75 A;  2WTE A;  2RKH A;  3DEE A;  2IT0 A;  2R7X A;  5D6E A;  1YO5 C;  4AVZ A;  4RBO A;  1WI3 A;  4IF4 A;  2O7O A;  4HF0 A;  1F4K A;  3R0A A;  3GME A;  1O4X A;  4LB5 A;  3WE3 A;  2GA2 A;  2HKO A;  1YS6 A;  4A2U A;  1L0O C;  1JKO C;  4KIT B;  3CJR B;  3FXO A;  4XKB A;  1A04 A;  3FF5 A;  5D4S A;  5DCM B;  3JSP A;  2LVS A;  1J0R A;  4DNC A;  1FMW A;  1I3A A;  2E1M B;  4L9J A;  4M9Z A;  3WE2 A;  4J01 A;  1ZQ3 P;  1ZRE A;  3W2A A;  2Y0M A;  1T2K A;  3L00 A;  4IPA A;  4IOA F;  1YX5 A;  2KIM A;  4M74 A;  3FXJ A;  4I01 A;  5C3E J;  1ENH A;  1ZG3 A;  1U5T C;  4XN0 A;  1S3J A;  4BH9 A;  4U87 A;  3NWS A;  1ZLK A;  4M6V A;  1XMA A;  3K4M A;  2H1K A;  3L2U A;  2RGV A;  2LOO A;  1R1V A;  5K5O A;  2LTP A;  1VQN I;  1XD7 A;  2A61 A;  3QP5 A;  2A5W A;  4HX7 A;  5ICF A;  1Q1H A;  1G3Y A;  2A07 F;  2HQA A;  3ZMV A;  2RV8 A;  1SVO A;  3ZMU A;  1IZ1 A;  4D1Q A;  1D1A A;  1BJZ A;  1EF4 A;  4YIR X;  3BTC A;  1ETV A;  2IGN A;  3EPZ A;  5D5W B;  3LSI A;  4EV0 A;  2M30 A;  3L2C A;  2ZME A;  3ASN H;  1FPQ A;  1HA8 A;  1RIO H;  3FXR A;  4AID A;  2A6H F;  1STZ A;  2I5U A;  4KIB A;  1ZAR A;  5HOO A;  1I27 A;  3TED A;  3F6O A;  2Q1Z B;  3TKY A;  3KEY A;  1KA8 A;  2XDV A;  2VPL A;  3TO9 A;  2KDO A;  4ANJ A;  5FLX Z;  3VEP A;  2KRC A;  2DPD A;  3LSG A;  2B0L A;  4BDY A;  2FUG 2;  4PUS A;  2BVL A;  1KGS A;  2DOA A;  3FM5 A;  3FMS A;  3SZG A;  2ELH A;  1UMQ A;  1U9O A;  4NC6 A;  3TP3 A;  3FBI B;  2FJ1 A;  3J7Y J;  3HRU A;  4J19 A;  3LST A;  1TC3 C;  2QVO A;  3HG9 A;  1ON2 A;  2IS4 A;  3ZQQ A;  3K7A J;  1XDS A;  1XN7 A;  1D3Y A;  2OQG A;  1BI3 A;  2LH9 A;  1IRG A;  5GTI C;  3HPH A;  2EV5 A;  3CUQ A;  4M3B A;  3VDX A;  1FOX A;  4LK0 F;  1O57 A;  5BS6 A;  4I6Z A;  2VQG A;  2QCO A;  2ZXH A;  3NEU A;  3OOP A;  2W7N A;  1HBX G;  3VYT B;  4MFD A;  1D5Y A;  1S5L C;  3V42 A;  3WOD F;  3ZQF A;  3R60 A;  4MTD A;  4BUP A;  3HJE A;  4G9Y A;  4P5O A;  1TWG J;  1TZL A;  2YPR A;  2KP6 A;  2NVU B;  3S3O A;  2BV6 A;  5D4R A;  2EH3 A;  1JTX A;  5LEJ A;  2VQH A;  1EH8 A;  2XAS A;  4S0H B;  4AUX A;  5BPI A;  1FSE A;  1XCV A;  4XM3 A;  1YX3 A;  3GTP J;  4XL9 A;  2F5V A;  5IT3 A;  5K1Y A;  4C2U A;  4QPO A;  2H09 A;  1MNE A;  2OUM A;  1EH6 A;  1QZY A;  2A05 A;  2FU4 A;  1T38 A;  5HS9 A;  1AWC A;  2JVG A;  2LKS A;  1IC8 A;  1ZKG A;  3J7Z I;  2O8K A;  1VQP I;  4A3C J;  4YEL A;  3KYC B;  1EA3 A;  2E5Z A;  4HAM A;  1W0U A;  2FSW A;  2JA2 A;  4CCM A;  4OIQ F;  4BXF A;  5KNL A;  4LIV A;  4IKF A;  3HOV J;  1ZTR A;  3RDI A;  4E4H A;  2HDD A;  4BQQ A;  2MW8 A;  2R7O A;  3SFI A;  5TGT A;  2NVQ J;  2HYG D;  1YW7 A;  3TO6 A;  5M5W J;  2VJI A;  3PIO F;  3PQJ A;  1E2X A;  1P7J A;  2EZI A;  4IZZ A;  5DS9 A;  4YRV A;  5F27 A;  1HKQ A;  4IHV A;  3WTW C;  1LNW A;  4L18 B;  5IT9 Z;  2Q8K A;  2OF7 A;  2HOA A;  4G12 A;  3BC8 A;  4XID A;  2NRA C;  3JRB A;  2W82 A;  2K85 A;  2ZC2 A;  3SFZ A;  1K4S A;  2J5O A;  1IUF A;  3HDD A;  3HIF A;  2UWM A;  1W7P A;  2XUB A;  1YYV A;  2E35 A;  4FX4 A;  3QQA A;  4G7H F;  1YTY A;  4UVB A;  3BPV A;  4CCJ A;  1VQ8 I;  1E17 A;  1JKP C;  2HYJ A;  2IS1 A;  5FD6 A;  3TBI A;  1MMS A;  2L0K A;  1BC8 C;  3HUG A;  4Y17 A;  3CCR I;  2AHQ A;  1BW6 A;  3I0T A;  2LY9 A;  1IXC A;  1JKR C;  2R7T A;  4YFK F;  1G6N A;  3DP7 A;  2O3F A;  4LIU A;  5EJC A;  1FMV A;  1HDD C;  3DBR B;  2VQC A;  3DF8 A;  4JK1 X;  1VQ5 I;  1GVJ A;  4XLA A;  4DZJ A;  4I09 A;  4AYB N;  3E6C C;  4IXA A;  1LDJ A;  2Q2E A;  1YW8 A;  3HHG A;  5EEA A;  3I56 I;  1A35 A;  2RVC A;  4RAG A;  2MYS A;  1HLV A;  2CRG A;  4CH7 A;  3AL0 B;  3FK7 A;  2CFX A;  2X48 A;  2JVH A;  2VC1 A;  3OR2 C;  4A69 C;  3IAM 2;  4NC8 A;  2L9V A;  2STW A;  1VQM I;  5J3L A;  1K83 J;  2JA8 J;  4ZJZ A;  2IPQ X;  3OMY A;  4XN3 A;  1MDM A;  2HQ5 A;  4II3 A;  1J59 A;  5L3G A;  1RKW A;  2NOJ B;  3OSG A;  5LHI A;  3Q9V A;  1MH3 A;  5HS7 A;  2L9N A;  1HST A;  4OIO F;  1MBJ A;  2BW3 A;  2JRM A;  2LSO A;  3OL3 A;  2ZME B;  2YX4 A;  4W1U A;  2L54 A;  1S7A A;  1UST A;  2LY2 A;  3ESW B;  3FXQ A;  4U88 A;  3ECO A;  3GZ5 A;  3V7S A;  3ZQG A;  3KZZ A;  4MGR A;  1X1A A;  4HBL A;  2ZBK A;  2IA1 A;  3OYA A;  4X6A J;  3GYH X;  1FEX A;  1WZ2 A;  2W84 A;  5CPR B;  2DLL A;  3ZPL A;  2DOE A;  3QYE A;  1MD0 A;  2R7F A;  2FXA A;  3S8P A;  3CJT B;  2YX7 A;  1FP1 D;  2HXO A;  1G2H A;  5KCM A;  2F4O B;  4NQW A;  4L0Y B;  2Y31 A;  5KK1 A;  3HKZ N;  3JR9 A;  3DLL F;  3BR0 A;  2L5Q A;  3DKX A;  1HC8 A;  1LDD A;  3ZXS A;  3CCS I;  4KA4 A;  3FIS A;  4X0G A;  1IAW A;  1TNT A;  3HSE A;  1I39 A;  1MSE C;  5C4X J;  3CUQ B;  5FRM A;  4ZZL A;  4LOC A;  5HDN A;  1N77 A;  1MBH A;  1HQC A;  3GBG A;  3CUO A;  3SEZ A;  3L09 A;  3HM5 A;  3WTX C;  3OIQ A;  2V9K A;  4JX6 A;  4PFO A;  1R71 A;  1ZRF A;  2DQR A;  2DW4 A;  2CO5 A;  3SDB A;  4A6D A;  3WHB A;  1BIB A;  3GTL J;  4EEF G;  1LDK B;  2JQ7 A;  4ZDL A;  1NK3 P;  1BL0 A;  2VKE A;  1RNL A;  4HF1 A;  1WPK A;  4A3K J;  4XBF A;  2COB A;  2F5F A;  4OIN F;  5JVG F;  1FIA A;  2HPI A;  4BHC A;  3LAJ A;  3WTT C;  2MLK A;  2VXZ A;  3LSH A;  1XX5 A;  3ZMS A;  3HOZ J;  4ZYA A;  3GLX A;  4I0A A;  1HW2 A;  5E8G A;  3MKY B;  2RNJ A;  1T95 A;  2HR3 A;  1R5H A;  5KHD A;  5E1W A;  4QPQ A;  3FBN B;  1X2N A;  1SD5 A;  3CC2 I;  1D0Z A;  3CLQ A;  4I98 B;  3Q5F A;  1IN4 A;  4BY7 J;  3T1B A;  4QSH A;  3V7R A;  2E1O A;  4LB6 B;  4RAY A;  1QRY A;  4DJA A;  2A69 F;  2VUM J;  2ZXW H;  4D7N A;  2ZCW A;  2HKX A;  2JPB A;  4E7I A;  1H9G A;  2L4M A;  1FJL A;  3DXJ F;  5A2Q Z;  3FXM A;  5J6X A;  1D1C A;  3HXL A;  3OIP A;  3KP3 A;  2IBD A;  3DKW A;  1CF7 A;  3K2Z A;  1IG7 A;  2L7K A;  2O03 A;  2V9V A;  3DFG A;  2M8E A;  1IUY A;  2KIQ A;  3M3Y J;  2E2J J;  3WTS C;  1DGW Y;  3QOD A;  2VBZ A;  1MJA A;  3FK6 A;  3AFH A;  3CMM A;  2H6B A;  4HPQ A;  4R8H A;  2RC4 A;  1BI1 A;  3ML6 A;  2E1C A;  1S7E A;  2DA6 A;  2E5N A;  3P9I A;  5D5V B;  2HOE A;  3GWZ A;  1IN6 A;  4S04 A;  1G59 A;  3LSJ A;  1JKQ C;  4HQE A;  3COA C;  1SFO J;  3MZ8 A;  4M6Y A;  3K0L A;  2LKP A;  3E5U A;  3KZI C;  4BYY A;  5F08 A;  3I55 I;  1W7P B;  2ZO4 A;  2ZJQ F;  1T0F C;  2DBB A;  4M71 A;  1WJD A;  4Y3O A;  3KZY A;  3LFK A;  4IHS A;  5FLM J;  3LSM A;  2FD5 A;  2NS0 A;  1JXS A;  1S9H A;  1TBX A;  1ZG5 A;  1AHD P;  3IRQ A;  1S7O A;  1QNT A;  3G2B A;  1Y6I A;  4IHY A;  1FY7 A;  4EJO A;  2IP2 A;  4DYQ A;  3TW6 A;  2E2H J;  2VN2 A;  4HNU A;  5E3O A;  1YW9 A;  3W6J B;  2Q2E B;  2OV7 A;  2W00 A;  2XF5 A;  1R36 A;  3J81 K;  3ISP A;  2HQR A;  2CUE A;  4XOP A;  5F64 A;  1B72 A;  5K5R A;  3B73 A;  2DA4 A;  3WU2 C;  1W4M A;  5JR3 A;  3HOX J;  3QWL A;  5J8F A;  2V1X A;  3FHZ A;  3AG3 H;  1G3W A;  4GDF A;  3BP8 A;  1PUE E;  3G3Z A;  2DOD A;  3Q0V A;  3BR3 A;  5CKT A;  2K3P A;  2ZFU A;  2LD5 A;  1MDM B;  2IRF G;  3KYL A;  2K9Q A;  4EJT A;  1MKM A;  1NG6 A;  2K02 A;  3H3U A;  2UUZ A;  2HDC A;  3U9G A;  3PO2 J;  1TQM A;  2X6Y A;  4HNT A;  1WJC A;  2VXD A;  1JTY A;  4XLN F;  3O2P E;  4BJ5 C;  1X3U A;  2BW3 B;  3VSK A;  1IDY A;  4OAZ A;  2GBY A;  2UV1 A;  3GTJ J;  1TWA J;  2IS6 A;  3L1P A;  4BAC A;  3S1R J;  2VJJ A;  2FEZ A;  2NS7 A;  4CCL A;  4OMY A;  4A5N A;  5IOY A;  2X6W A;  2GOX B;  1FBQ A;  2ID3 A;  3BRO A;  3KLN A;  2DMN A;  1U5T A;  4D7M A;  3W2V A;  4BE1 A;  1DPU A;  1NTC A;  3OYE A;  2V4J C;  2RN7 A;  2GIV A;  3F3X A;  4XRM A;  4NQW B;  3M9A A;  5GAH J;  1E3H A;  2D45 A;  4ENJ A;  1Z67 A;  2O8X A;  4WX9 A;  1IRF A;  2W1O A;  1FYM A;  3OV8 A;  1FZP B;  3L2Q A;  3UR3 C;  4PJN A;  3GUD A;  3C3W A;  3FHN A;  2L4A A;  4M9S A;  2UXX A;  4Y13 A;  3EYI A;  4WXC A;  3JAM K;  3CP8 A;  3GTK J;  2FOK A;  4N9H A;  5JI6 A;  4FIS A;  4L5I A;  3GFJ A;  4Z2Y A;  2L7F P;  2FOW A;  4Q47 A;  4A3I J;  1SFK A;  1RKT A;  3IC7 A;  4I76 A;  1KU7 A;  2G7H A;  1U8R A;  3BJ6 A;  2EA2 A;  2H8R A;  2DJN A;  5J40 A;  4MQ9 F;  3HSR A;  1D5V A;  1R5I D;  5CLS A;  1KYW A;  1J7K A;  2FRH A;  2KKO A;  2MC3 A;  2K9S A;  3OIO A;  2LBF A;  1I3Q J;  4U0Y A;  4A93 J;  2OU2 A;  4NNJ A;  1YHQ I;  2H27 A;  5KAF C;  1S72 I;  1IN5 A;  2D1H A;  2F4I A;  3BZK A;  4U0V A;  3RCO A;  5EG0 A;  4BE2 A;  2JA5 J;  3CCM I;  5LEK A;  1JUP A;  2CQK A;  2RDP A;  5FKM A;  1KYZ A;  5FKK A;  4A0Z A;  1IXS B;  4LFU A;  4XIC A;  3K4K A;  4GGG A;  1HKS A;  3H5A A;  3MAJ A;  5K5Q A;  3JRG A;  3SEQ A;  2DJI A;  3MVP A;  2QEX I;  2P0W A;  2JTV A;  4I02 A;  2WB1 A;  4E6K G;  3Q3S A;  5HVQ C;  1Z6T A;  2ME0 A;  2WY7 Q;  2IEK A;  4EM0 B;  5H20 A;  1GVD A;  2XB0 X;  2A6T A;  1WWX A;  2DT7 B;  5BNG A;  5ILV A;  1TQI A;  2HI3 A;  4HG2 A;  1ETK A;  2NNY A;  5FJ8 J;  3KEQ A;  2B9S A;  1R58 A;  2FBK A;  3LSP A;  2MFZ A;  1CF7 B;  1U2W A;  2XHK A;  5AON A;  5LHG A;  3F21 A;  2GXB A;  2CW7 A;  2R7U A;  1WH7 A;  3G6E I;  4G94 A;  2K9M A;  3PNV A;  3HYI A;  1W0T A;  2OD5 A;  3GF2 A;  4I0B A;  3ECH A;  3S2D J;  4ZDP A;  1KQ9 A;  5B66 C;  4ZTJ A;  2OJE D;  3BT9 A;  3HSF A;  3HBL A;  4PSX A;  1TWF J;  5J8C A;  2DQL A;  2HPM A;  2MD5 A;  3HKZ A;  2FX0 A;  5D6F A;  1B9N A;  1Y1W J;  1KU3 A;  4MQV A;  3ZN0 A;  2OCC H;  2M4G A;  3M7G A;  2HZD A;  3CCJ I;  1BI2 A;  2STT A;  1S6L A;  4NHJ A;  1XSV A;  2V6C A;  2Z2S B;  3DEU A;  1YE9 A;  2HVR A;  2GOM A;  3JCU C;  2BHZ A;  1K6O A;  4AM3 A;  3HEF A;  1RPW A;  1LVA A;  5HLH A;  2PEX A;  2E1M C;  1I50 J;  3DLA A;  3CDI A;  4UXN A;  3T8R A;  5M5Y J;  3J80 Z;  1SD7 A;  2Z1D A;  2IA2 A;  4Q4Z F;  4CDG A;  1LFU P;  2TRT A;  3OYI A;  5DCF A;  3OYN A;  1RRJ A;  3S15 J;  3EUH C;  2XC7 A;  1AOY A;  1MJB A;  5J4V A;  1V4R A;  1U78 A;  3BCA A;  1X3Z B;  2KZG A;  2WA0 A;  3DQV C;  5FFZ A;  3S2W A;  4F7Z A;  4CUG A;  2KRH A;  1GV5 A;  1QPI A;  3ABU A;  1B72 B;  2P81 A;  3O8H A;  4CCO A;  3KLO A;  2DAO A;  2K9N A;  1UHS A;  1IXR C;  1KQ0 A;  4P55 A;  4ENM A;  1G4D A;  1V3F A;  4HSR A;  2QQA A;  3C2B A;  2DFI A;  1WVR A;  2GQQ A;  3PNT A;  3RTR A;  1HF0 A;  1M1E B;  2DFF A;  3I53 A;  2OZU A;  3H9Q A;  3O8G A;  2M0C A;  3ZN1 A;  4DOZ A;  2N8G A;  4PCQ A;  4ZYE A;  2Z3Y A;  3BR1 A;  1IN8 A;  1QQI A;  1JUM A;  2QUF A;  2ZJR F;  1BR4 A; 
#chains in the Genus database with same CATH homology
 1YIT I;  2JQ7 A;  3J7Y J;  3CCR I;  1YJW I;  2E36 A;  2ZJP F;  2QEX I;  3CC7 I;  3PIP F;  1VQ6 I;  5JVG F;  3CCE I;  1FOX A;  1VQK I;  1VQ5 I;  4UY8 I;  5DM6 F;  3I56 I;  3CMA I;  1VQL I;  3CCV I;  3G71 I;  1YJ9 I;  4IO9 F;  3CC2 I;  3G6E I;  3CCU I;  1FOY A;  1YIJ I;  3CCL I;  2OTJ I;  1VQM I;  4IOC F;  1VQO I;  2E34 A;  3J7Z I;  3CCJ I;  3CCQ I;  1VQP I;  3CC4 I;  1QA6 A;  2H8W A;  1VQ4 I;  2OTL I;  4IOA F;  5GAH J;  1VQ7 I;  2K3F A;  5GAE J;  1Y39 A;  3PIO F;  3I55 I;  1VQN I;  2ZJQ F;  3CJT B;  3CME I;  2FOW A;  1FOW A;  3G4S I;  3DLL F;  3CF5 F;  3CD6 I;  2QA4 I;  1HC8 A;  5GAD J;  3CCS I;  1YHQ I;  5DM7 F;  1S72 I;  1YJN I;  2NXN B;  4V19 K;  2E35 A;  3CCM I;  1VQ8 I;  2ZJR F;  1ACI A;  5GAG J;  1VQ9 I;  1MMS A;  1YI2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...