3CC7I

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cc7I00
1VQLI 1FOXA 3PIOF 1VQ7I 3CCQI 3G4SI 1YHQI 2OTJI 3PIPF 5JVGF 1ACIA 2NXNB 5GADJ 3I56I 3CCVI 4IO9F 1VQ8I 3CC7I 3CCEI 4V19K 3DLLF 5DM7F 2E34A 3G71I 3CF5F 4IOCF 1QA6A 2OTLI 3CC4I 5DM6F 3J7YJ 3CCLI 1YIJI 1S72I 1VQ6I 1HC8A 2ZJQF 2E36A 2QA4I 4IOAF 1FOYA 1VQOI 1YITI 3I55I 1VQKI 1VQNI 3CD6I 2H8WA 2FOWA 3CMEI 1YJ9I 1VQMI 2JQ7A 3CCSI 3CCUI 1VQPI 3J7ZI 4UY8I 5GAGJ 2K3FA 1YI2I 2ZJPF 1FOWA 3CMAI 1YJNI 1Y39A 1VQ5I 2E35A 2QEXI 2ZJRF 3CCJI 3CC2I 3CCMI 1YJWI 5GAHJ 3CJTB 1MMSA 3CCRI 1VQ4I 1VQ9I 3G6EI 5GAEJ
chains in the Genus database with same CATH superfamily
1R49A 3TEDA 3LAJA 1EKEA 1FMVA 3IV5A 3K1PA 4YFKF 1U5TC 1R22A 3QP6A 1B8IA 1AWCA 4CXFA 2DN0A 2R7FA 3Q9VA 2X85A 1FJLA 3ASNH 4A3JJ 2NS7A 2Y0SA 2XPWA 1ZRDA 3S16J 1SD4A 4A3DJ 1QHHD 2DBBA 1YJ9I 4XMYA 2A6TA 3ZP5A 3CP2A 1WHUA 3PL8A 3MN2A 3KP3A 3ZQLA 3J7AO 5IOYA 2DA1A 2LKXA 1ULYA 2XV4S 2HPMA 2LF8A 1JGSA 1ERDA 1UFMA 2DOAA 2F5EA 4UV8A 1MIJA 4E4HA 1BI1A 1OYIA 1AA7A 1X3WB 3BPVA 1MMAA 3WODF 1Y0NA 3H35A 3HDDA 2ZSHB 3HKZA 4NB5A 4IHVA 2W48A 5HNHA 1BA5A 1ON1A 2CQ7A 2EQRA 3VPRA 2FBHA 1YJWI 4M71A 1S8NA 3DF8A 4EQQA 2ME0A 1XPXA 4RLQA 3GFMA 5E8GA 3F8MA 1QRYA 3B6AA 5KAFC 3E5UA 3Q0VA 1WH7A 3QOPA 3TW6A 3S2DJ 4HA8A 1LE8A 4D5FA 1Z21A 1O3QA 4HSRA 1A35A 2GA2A 2M34A 2X1DA 2Y31A 4NC6A 4XRSG 3ZMTA 1O7FA 2L4AA 1JKOC 2DXIA 3H9QA 2QQBA 2K9LA 2K3PA 5EZHA 3FXUA 4P9FA 5K1YA 5HVQC 1XB4A 2E7WA 1RRJA 1FBUA 3KP7A 3D5LA 2GIZA 3H9JA 2GIVA 3DTKA 4JK1X 1HW2A 3RQIA 2NVXJ 2FD5A 4LG0A 2ICWG 2QQAA 2XAFA 1FZPB 4BQQA 3H5NA 3P9CA 4HX8A 1IW7F 4IL6C 4PGGA 4II3A 2V1UA 3S14J 5FLXK 1A36A 4GFBA 2STWA 2KIUA 3WHCA 5ILSA 1FBSA 2Z99A 3ZQCA 4BE0A 3CMEI 2Q2EA 3HG9A 3OYHA 4N4NB 2X6YA 3HEFA 1UG2A 3HUGA 4G6QA 2JN6A 2HVQA 3L2RA 4FE4A 3AG3H 3TQNA 4B1RA 4MEXF 4AUXA 3G2BA 3A4CA 2JJ7A 1ETXA 1G3YA 2Y48A 5H20A 2EBIA 2WC2A 1D8KA 1XN7A 2JT1A 2JZYA 3H5RA 3PFIA 3OOUA 1XCBA 1J5YA 5HLHA 2M1BA 2M7AA 4I09A 1TTYA 4XORA 1IXSB 5AIQA 4AM3A 1O3RA 4HV5A 5C4XJ 3BCBA 2K9QA 3QPTA 2QENA 3I9V2 4ZTFA 1JKRC 4XLFA 3FBIB 1FTZA 3IH3A 1UCRA 2DQLA 1HKSA 1G3SA 1XS9A 4PCQA 5FJ8J 2BXYA 3ZN1A 1IG7A 2W85A 3HL2A 3OIQA 2XB0X 2CV0A 3L2VA 3V7RA 2JUGA 3RIRA 4MNUA 1WJCA 3MKWB 3WTXC 2M45A 4A0YA 3BZCA 3TKYA 3PQKA 2RNGA 1TWCJ 5DD4A 5E1ZB 4X6AJ 2UV1A 3L09A 3KIOA 5FKKA 2L7ZA 2P8TA 3M4OJ 2HWVA 4XLAA 4MHGA 3RPUA 1NK3P 4Z2YA 1K79A 3GTLJ 1OCZH 3L9FA 3K70C 1IDZA 4MEYF 1APLC 3ZR8X 2ELJA 1QU3A 2L0KA 2CO5A 3VSKA 2VQGA 2KHMA 4M73A 3GTGJ 3OS2A 2L5QA 2ETHA 3SYTA 3B6CA 1WGXA 3QQAA 5L3FA 2Y0SN 2PBIA 2D5VA 2FNPA 4XM3A 4BQNA 3HXLA 1F4KA 2R5YA 2EPFA 5E1XA 5HDGA 4EM0B 3RI4A 4NC8A 2JA2A 1HLVA 2CW8A 2KIMA 2NOGA 3DLAA 4JQFA 3BZ6A 1ETVA 3QU6A 4R1HA 4PFPA 3TO7A 2GZWA 1W0UA 2AQFA 1NG7A 2JSPA 3EUHA 2XC7A 2NVTJ 4MFEA 4E7LA 2XF5A 3MMYB 4XL9A 1D0XA 1EJ9A 3CCMI 4I99C 3CJNA 3DBHB 2ZMEB 3IP4B 2H8RA 3AL0C 4B47A 5FLVA 2VQLA 1U9NA 3TDUC 1OCOH 2R7RA 4H0EA 4GCVA 1B72B 3KEYA 5JVGF 1Y6IA 4RGUA 2VBXA 4A3MJ 3RKYA 2OAZA 3L2WA 3K2ZA 1NHAA 1LVKA 2CQNA 3BG5A 3OMYA 2XIGA 3LAPA 3HPGA 3WG7H 2DPUA 1CF7A 2VOPA 4PJNA 3V4GA 1L3LA 1FYKA 1ZYRF 1TT0A 2HDWA 1RNLA 4BQAA 2F48A 3GTKJ 1W4MA 1CGPA 3SZTA 1G59A 2E2HJ 1EF4A 3BOQA 3OYIA 1X2NA 1YX3A 3LSGA 2DYRH 1T2KA 2ELKA 4XKVA 2L7FP 3DP7A 3MZYA 3IAS2 5ILUA 4BAYA 2OA4A 2WAFA 4ETSA 4PSXA 1T0FA 1SC7A 1KU7A 3KLOA 3CMYA 4WXHA 1QVUA 3PM1A 4EJUA 2X9DA 1Z0XA 1YOVB 4BY1J 1RKWA 3DBRB 4HSTA 4XK4A 2H09A 1PP7U 2QUFA 1VQLI 5LD2C 2VASA 3PIOF 1ZN2A 2HKOA 5FKNA 3BG7A 3ZMUA 1D0YA 2V4JC 1DPUA 1P4WA 1JT6A 3JAMK 1S7EA 2V7FA 2DFEA 1WJFA 1JE8A 1LEAA 1U8RA 4XSXF 1X3UA 4E7IA 3IC7A 2GOXB 4Y17A 2K9NA 3OSGA 2D1VA 4CCNA 4TV7A 1BOAA 2KL4A 2RNJA 4BU2A 4A5NA 2BY0A 3OIPA 5CVIA 5LHIA 4C3IJ 3RKQA 4AIDA 2ACJA 4PFOA 3PO2J 3LA7A 1SAXA 3QWLA 1TC3C 2X1CA 4D5CA 2K4JA 3K10A 2R5ZB 2QCOA 4RAYA 9ANTA 1SMTA 1LFPA 4RBOA 2A6EF 3W3CA 4IRIA 1ZG5A 1R7JA 4UB6C 2X6WA 1K61A 4O5VA 1IGNA 5JI6A 3MQ0A 3CF2A 3R6SA 1MKMA 1VQPI 4Y52J 1MNDA 3W6JB 4ESBA 5EDNA 4L9NA 2YU3A 2F4IA 2YU9J 2DT7B 5HNFA 4HYEA 1J09A 3TW7A 5BS6A 2OCCH 3RCOA 1U5TA 2DI3A 1BIAA 1P2FA 1YYVA 2OTJI 1BW5A 2PMUA 4V19K 4PZJA 3H3ZA 1ONVA 2R7UA 2EFQA 3BR1A 3HUGB 3J7YJ 4G7HF 1TWHJ 4IQ4A 3ZQGA 2OQGA 3BR0A 3R0JA 2X48A 4G6TB 3K70D 2JRTA 4CUGA 4WX9A 3OYMA 5F0CA 4A3CJ 2BXZA 4XNFA 5FO5A 3B73A 4HF0A 1MMSA 1B6AA 1E3OC 3OYDA 3ABTA 2ZC2A 1LQ1A 3JTHA 2DTZA 3WTZA 3RYPA 4OINF 1DGWY 4H4KC 3BPXA 2DYSH 2GWRA 1JGGA 4M9SA 1YG2A 4Q47A 1QVTA 4CCJA 1EH8A 5D4SA 4BDZA 3JRDA 3G71I 1W36D 2E1MB 1YO5C 3QYBA 1HW1A 1BW6A 2ZCWA 2NYXA 5B5EC 1LJ9A 1V55H 2X6XA 3LSMA 1ZAOA 1D1AA 3ABMH 1PVEA 2A5WA 3FK7A 2WB1A 1MBHA 3H3UA 4JBAA 4GO1A 1G3WA 4EVIA 4Z6YA 1IUYA 4DW6A 1KQ8A 4GYIA 3OYBA 3H5AA 3F9KA 3BTCA 4W1UA 5K7FA 1JTXA 4CICA 2HQ5A 5TGTA 2RQQA 3BG6A 4ZYDA 3LWFA 4OU0A 2C6YA 2O8XA 2TDXA 1ZKGA 3C2BA 2NVUB 3ZMSA 4EEFG 3D0SA 1MNMC 2QBYB 2NOJB 3M07A 3TO6A 3M7GA 2KIFA 3R4KA 4KT6A 3JTGA 1WQ2A 4ITVA 3K7AJ 2R92J 2ZXIA 2O6GE 3A2KA 2LY2A 3CUQB 4CYDA 2GLOA 3BR2A 2ME6A 2Z33A 2P7VB 2VJ5A 1X4OA 2HNHA 1F1ZA 1ZHFA 5J4VA 1FOXA 4L5JA 1YLFA 3FM3A 1P6RA 3CZ6A 4KIFA 1QZZA 1JHFA 2YSRA 5JHFA 2OPTA 1BOBA 1XGNA 5BQTA 1UG0A 3ESWB 3H92A 4JP0A 2MGQA 1A6QA 4CHUA 3COAC 4PK4A 1R4NB 4RA2A 2XKOA 5F27A 3J80Z 4UY8I 3E6DA 2PN6A 2OQRA 2EWNA 1K78A 3BTLA 2YPRA 2BZTA 3BJOA 1Z67A 1OCPA 1W5TA 1KU2A 1ETQA 2IS1A 2UWMA 5GP9A 1TWFJ 1AKHA 3HJEA 4AYBN 3S2HJ 1R58A 4QPQA 1JKPC 1YX5A 1IXRC 3EYIA 3HTUA 2VLAA 4Y4RA 4KDPA 1VZ0A 2NVYJ 3FXKA 4KMUX 3F6OA 2F5DA 1LB2A 3FKJA 3FBNB 1FEXA 4LFUA 2K4BA 4RB1A 3WHBA 3VYSB 2BOLA 2BVLA 1PUFB 4B3XA 3JR9A 1I3QJ 1BR4A 4NHJA 3FXOA 3JW4A 5E8IA 1Z9CA 4IO9F 5CVUA 1X1AA 5ICCA 3Q0WA 1MJ9A 3VYTB 2XPVA 3QPSA 4GXOA 3HOYJ 1UB9A 4N0BA 1Y56A 4S04A 2R7ZJ 1JKQC 1I6HJ 2MH2A 2W82A 2O0YA 5CQGA 4GGGA 4MQ9F 3LQRA 2RDPA 5D5XB 1TQPA 2V6EA 3LQQA 2ISYA 3FXLA 1Z3YA 4CO8A 3D5RC 5IY5H 2MC3A 3RKWA 3X2QH 4BHBA 2IJLA 5GAEJ 5ICGA 4UXNA 2DO7A 3E0JB 4A69C 4CA0A 4LJZF 3EUAA 1QPMA 4L0YB 4ZYEA 1UHWA 1ZK8A 2IA0A 2CFOA 4AIKA 5J40A 5ED4A 2WBMA 2Y30A 1MNEA 1YITI 1K78B 1W7PB 1FNNA 2K3FA 2CUEA 1B4AA 1FOWA 1JUMA 4IRGA 3IRQA 4AC0A 2PFBA 1T98A 2OBPA 2HDCA 1H89C 1VQ7I 5GTHC 3UKGA 3K4BA 2HOTA 2LP0A 4ZDLA 1T6SA 3QPHA 4OAYA 4R79A 2A6HF 3KCCA 3BG3A 4DYRA 3DKXA 4AWXB 3CQZJ 2HYJA 3DTEA 3TO9A 2VKVA 5IT9K 2EZIA 2ECCA 4HNVA 1SEUA 2XROA 1OCTC 4B44A 4KN7X 1JJ6C 2MD5A 2MFZA 2COMA 4ENKA 1X19A 2VQHA 1RC9A 4XN3A 2KT0A 3AL0B 1P7IA 4UVAA 2W84A 1DP3A 2W4SA 4B3AA 3F8FA 1YHQI 1N75A 1VTNC 5JLXA 4IXAA 3TBIA 4F3QA 3GVAA 3CC4I 3GTQJ 4FCYA 1JTYA 2RKHA 1OQYA 2ZJQF 1XD7A 5FRMA 4L9JA 4OIRF 2DODA 4MTEA 2O5RA 4KNYA 5IP6A 5HLTA 2KLOA 5DCMA 3I4PA 4UB8C 3OL4A 3GTJJ 1ZELA 2ESHA 2JSCA 1U9OA 2LKSA 2EB7A 2O61A 4S05A 3FDYA 1H0MA 2MLKA 2PX9A 2VT3A 1HCRA 3E5XA 3HKZN 4NQWB 5FKMA 1HA8A 2CV2A 3HOVJ 2VJ4A 1RZ4A 5EEHA 1B72A 1JUSA 3GBGA 2RV8A 1HC8A 4IQJA 2VL8A 3MKYB 3RJPA 3VSLA 2ELHA 1IN4A 2X0LA 1T8IA 2I8DA 3O8GA 1RKTA 1MMGA 2E1NA 3CMAI 2BV6A 3M1EA 3OIOA 5JVTA 2ZJRF 5HS8A 2P6TA 1GV5A 4RGRA 1BIBA 3ULQB 4HQMA 1GVDA 4EJTA 1G4DA 4M6XA 5KK1A 3F21A 1BBYA 3JRGA 3K2AA 3QP5A 3JRCA 2JA7J 2COBA 3F6VA 1PJRA 1FTTA 2BHYA 4BL0B 3RPUD 3WTSC 3PO3J 1R9TJ 2V9VA 3ONQA 3OYKA 1FMWA 4QWQA 3QODA 1WFXA 1YJNI 1DU0A 2IVMA 3DEEA 1P4XA 4UUVA 1QQIA 4MIMA 4Y7NJ 4XKBA 4N9HA 2XVCA 3A01B 5CVRA 1FLIA 2RAEA 2OC6A 2LC2A 3JRIA 4FE7A 3M3YJ 3I59B 2IGKA 4M6YA 4F91B 2R5ZA 1UJ8A 3DV8A 1Z7LA 2LLKA 2V1XA 2A5YB 3M8EA 1WZ2A 1B59A 2Q2EB 4HV6A 1K83J 4HX4A 4M3BA 2J5OA 2EFWA 1FYMA 3MEXA 3PUFA 4NBQA 5J3LA 3OOPA 3HZJA 4M9XA 3GW2A 3I53A 1Z77A 2XSJC 1WVRA 3V8KA 3J80K 5F64A 3S1QJ 3WTWC 3CCJI 2QKLB 2WA0A 3RZOJ 2KRHA 2GQQA 3P7NA 1TNSA 4LB6B 1Z6TA 4U0WA 5F0HA 2DW4A 4XLNF 2GAUA 2FA5A 4ZZDA 2VB6A 3SFZA 1HQCA 3KE2A 4KIBA 4CGZA 2P6SA 2EZKA 1WJ5A 2KISA 4UUTA 1RR8C 2F5CA 2ZMEC 3C2HA 2PLYA 4C9YA 4DBRA 2GM4A 4IKFA 2ZSIB 1J0RA 2P5KA 3SHFA 1RPWA 1TW2A 3CO6C 3E97A 1XC5A 3HC7A 4D0PA 5HDNA 3N97A 3FMRA 3CDLA 2JVGA 1S7OA 3MKLA 4EM1A 4C2TA 2IA2A 3ABUA 4JX6A 4MFDA 5E17F 2LOOA 3S2WA 4IJAA 4Y13A 5E20A 1N25A 1Y1VJ 3KP4A 2B7EA 2M87A 4YG2F 1G3TA 3I5UA 2LBFB 4A3IJ 3ZQHA 3WE2A 2HOEA 2KJCA 1XDUA 5DTDA 4P5OA 2PJRA 1GV2A 4IHXA 1U3EM 1ZTRA 3J7ZI 5E3MA 2L4MA 3NEUA 3V8LA 4E7HA 2P0WA 3LNQA 4C30A 1YIOA 4WXCA 2YUSA 5H6QA 3PJRA 1TWAJ 2ESNA 4F52A 2DMNA 3I3LA 2EINH 4M3FA 3K1MA 2Q8KA 4EJOA 5FD5A 2Z9OA 2IGMA 2VXDA 3MD2A 4M3GA 4EGZA 1U2WA 2EFPA 3ZQFA 4HDUA 5LBQA 5M5YJ 2FF4A 4YEJA 5FRNA 2LR8A 1Z05A 2VKHA 2HGCA 4PJJA 2FBIA 4EV0A 4ZTJA 1QGPA 1T08B 2VBYA 4RLFA 2WB1N 1WRJA 3F0CA 5F6FA 1VF9A 1U6GA 4I6ZA 1ZARA 2FE3A 2HR3A 2WAQA 3S8PA 4BACA 1FX7A 4FT8A 3WG9A 1W0TA 3FK6A 1ZH5A 2XAQA 4RGXA 2HU9A 2RREA 3TDZC 5M3MJ 5HLIA 1ZLKA 2OTLI 1N78A 1O3SA 4XLHA 2VKEA 2O7OA 2OUMA 2XF6A 1IUFA 2IP2A 4MLOA 3JRFA 4A5MA 5EGOA 5F08A 2XRNA 2EA4A 2DT6A 2LG4A 1IV6A 4J01A 1UMQA 4AIJA 1UZCA 2P7CB 3K1NA 3PSIA 4CCLA 3GZ6A 2ID3A 1U5TB 1LDKB 4F92B 3DU6A 1D0ZA 1TLHB 2EV6A 3FM5A 2Z2SB 3S32A 2WV0A 4AVZA 3MKZA 1E3HA 2DQRA 3G73A 3GLXA 4S0HB 2W57A 2XGEA 2K5CA 1E17A 3CD6I 1KONA 3GZNB 4F55A 4KYWA 2ZJPF 2XHKA 4RAFA 4G9YA 2H27A 1T38A 1O57A 5AONA 3RDIA 2Z16A 3A0BC 3AKZA 1VQ4I 2IXSA 4FTHA 3TMOA 3GMEA 3CDIA 4XOTA 1XTAA 4B8XA 4D9JA 2HS5A 1Q1VA 2XB5A 6PAXA 2L9VA 2BVMA 2JUCA 3AG2H 3M8JA 2GOMA 3DLLF 5M3FJ 4ZDOA 1LDDA 3MAJA 3BDDA 4UHTA 2IW5A 5BPDA 1TP4A 2YX4A 3TL4X 4MO7A 5TRDA 1W36C 3W2VA 2FRHA 4V2FA 2LREA 5HS7A 3KP2A 5C44J 2HDDA 1SAUA 2DA3A 4E7ZA 3IWFA 2QKMB 1KYWA 3QYFA 4ASNA 3DFGA 4P96A 3BR3A 3ZMVA 5J1YA 2GXAA 3F8CA 2K7LA 1U8BA 1HOMA 2BGCA 4YELA 1GDTA 4DZJA 2H6BA 1EA3A 1ORKA 3NARA 2KDOA 2IS4A 1VNDA 3DWLE 1ETOA 1JJ8C 2NRAC 4NC7A 1CQTA 1R23A 4K2EA 4W97A 2VN2A 1ETYA 1H9GA 1PYVA 4BUPA 1NTCA 4C2MJ 5B66C 4KUMA 5IP9J 3BZKA 3CCRI 3NRVA 2CS3A 4ANJA 3PUBA 3C7JA 2AXLA 2F6CA 1SVOA 2OF7A 3FWEA 4BEHA 1FPQA 2KFDA 3IRRA 2P5LC 2E7XA 4P9UA 2CQXA 2P81A 5J8FA 5FROA 1W5CC 2IGNA 3CF5F 3VEPA 2ZFUA 2QQ8A 2V1NA 1BJZA 2X4HA 5TISC 1S29A 2MSYA 3IH4A 1XMXA 4XQFA 1LKXA 3G3ZA 1E2XA 2XF7A 3JREA 2L7KA 2PI0A 2RQPA 4LITA 4KA4A 1I6XA 3CLOA 1WJDA 2MD0A 4A3LJ 4I0BA 1ZQ3P 3WTTC 3FX3A 3LFUA 3TOBA 4RS8A 2OD5A 1SD5A 3W2WA 3OYLA 5EF6A 4A3GJ 1LFBA 1LNWA 4P55A 4B43A 1S72I 5EG0B 4LB5A 4KJZA 1ITYA 3WU0A 5K5RA 3K6GA 4IRHA 4OOIA 2XGCA 3WTVC 2LK2A 1GVJA 4QIWN 2HVRA 2QSHX 3K4NA 1ZRCA 5L3EA 2FSWA 5FFXA 1P9QC 1V5GA 3LSKA 3CMMA 2DMQA 1O3TA 1IZ1A 3VYUB 4UVCA 4I76A 2DAOA 1J59A 3CCVI 2BW3A 1MBEA 4HOBA 3AAFA 5DCMB 2R7SA 1AU7A 1G8XA 1ODDA 4L5IA 4AIHA 1VQ6I 4N9IA 5L3CA 2DDBA 4JYKA 3ABKH 1UHMA 2H6CA 2H8WA 3ASOH 5D8LB 2VBZA 4EM2A 3I54A 3LSPA 5KVRA 3F8NA 1R5HA 2Y0MA 3QPLA 4A0XA 1MSFC 1BI3A 2BY1A 5IYCJ 3RSNA 3FZVA 3E6CC 2BYVE 2HYFA 3C3WA 3H0DA 1K4SA 4HNTA 2BY3A 2EA2A 1BR1A 3EYYA 4RB0A 2IT0A 3BG9A 1XSDA 1QBJA 5CLSA 5GADJ 1ZRFA 3CUQA 3U1DA 4JX4A 5DV5A 4ZZLA 4HDVA 1WH5A 2ZNYA 2PJRB 1Y0UA 5CYVA 1QPIA 2FQ4A 2VUMJ 3PNTA 2E1OA 3GTOJ 2WV1A 5E3OA 3O2PE 2AXTC 2XAGA 3OR2C 1R1TA 2Y2ZA 3CJTB 5DCFA 5LFAA 2I5UA 5DUKA 4BKXA 3IWZA 5HS9A 4AU7A 4CH7A 4NNJA 1YS6A 2FU4A 2OV7A 2K9MA 5K7HA 3ZQIA 4UV9A 4KITB 5IT3A 1RR7A 2E34A 4YIFA 1Z91A 3N4MA 2QF7A 1SANA 1NH3A 2HQRA 1Z3XA 2IS2A 3DKWA 2KPMA 2M5WA 4C3HJ 1Z1DA 4XN0A 3MCZA 2FJ1A 4JOMA 2A61A 1MMDA 4BXFA 2F5VA 3KLNA 1WWXA 3QOEA 1OKRA 3JSPA 3FHNA 1XSVA 1K6OA 1IC8A 4U0YA 2E60A 2ZXWH 3L2CA 5L3GA 2YR2A 3CO7C 1K4TA 4BJ5C 4FETA 3CCEI 4FX0A 1SFXA 1T0FC 3GZ5A 3KZZA 1IO2A 3KYLA 3HRMA 2IPQX 2CSOA 3T0YA 4G8XA 3FMSA 5K5OA 3KYDB 4DYQA 3F3XA 2V1DA 1JXSA 4A12A 5FGMA 2E2IJ 1R00A 4PSWA 4C2UA 2CMPA 1SFUA 3K4KA 2UXNA 3UNGC 3WU1B 3FMQA 3HSEA 1MH3A 4LD5A 2JK3A 4QPOA 2CYYA 3G1MA 2VODA 1F36A 2H94A 5GTIC 1ZR4A 2HEOA 2CRGA 2CFXA 5E79C 3VOEA 4HAMA 3HIFA 1TQIA 1DQUA 1LDJA 3OL3A 5IYBJ 2HI3A 5DDGA 2STTA 4E7JA 1R4MB 2JQ7A 5A2QZ 5K7ZA 3RKXA 4RAZA 2AQEA 2K27A 3P9KA 2QZ8A 3S1NJ 3TP0A 2HYGD 4EJWA 2HPIA 5KHDA 1EH6A 4HQEA 1MJBA 1GXPA 4XICA 3GYHX 1K6YA 5KAIC 5BPIA 4IHWA 1OMIA 1F43A 1SVLA 1JHHA 4BHPA 3CC7I 4XLCA 2VIXA 4BXXJ 2L3DA 3WGGA 2A69F 2VI6A 2ZJ2A 3FXJA 5C4JJ 4IVNA 3U1KA 1FSHA 2V9KA 5EGOB 1J75A 5FKLA 3T8TA 5B3SH 2F4MB 2XAUA 2X51A 3CJRB 1H88C 1J9IA 4UUSB 3HRSA 3L7WA 4ESFA 1IRXA 5HLGA 1YTYA 3J81K 2GXBA 1N77A 2OZ6A 5AIPA 2R7TA 4Y15A 2FOKA 4ZH4F 2VKDA 3OSFA 3W6KB 3JRBA 2HTJA 2M4GA 5DM7F 2KRFA 2M4KA 2PEXA 3M9AA 3OWTA 5J6XA 4OIPF 4OMZA 1LVAA 2FOWA 2XDVA 2R3SA 2VBWA 1IDYA 3FXRA 3ZMZA 1TW3A 2DTRA 2PMZN 3GO5A 4Q48A 4ENMA 3FXMA 4A3EJ 3OV8A 2LH9A 1F9NA 2CQKA 1IN5A 3SFIA 3G6EI 3BLYA 3LMMA 5DS9A 4HEA2 4LK0F 4RM2A 1MZBA 2ZB9A 3CTAA 3BR5A 2NNNA 4A3KJ 1ZGWA 3ROUA 1TT5B 1P4AA 2ID6A 1V54H 5FLMJ 4EJVA 4XBFA 2BE5F 2WTEA 1XCVA 2K40A 2Z1DA 1OPCA 2F2EA 3Q0UA 4YIIA 1KYZA 1RUNA 4HPQA 4M3DA 4BHCA 1S5LC 2OU2A 2RVCA 5DD8A 2B63J 5D5UB 4G12A 1YW9A 3LSHA 5DUIA 1HF0A 3HGGA 3G1OA 2H1KA 4IZZA 4II2A 1ACIA 2FNAA 5FD6A 4RB2C 5GPAA 1YIJI 3OR1C 1MH4A 3HOWJ 5ICFA 3K4JA 3K9TA 5LGUA 4XR6A 2G9WA 2MA3A 1USTA 1IF1A 1TWGJ 1WSUA 4DIQA 1OCRH 2V9PA 1P92A 4PJLA 1OYWA 4ZYGA 1R5GA 3LA2A 4LIVA 3MFKA 4C3JJ 3DEUA 4G7OF 4IHYA 3S1RJ 2QVOA 2NS0A 2UZKA 2W24A 2LBFA 1RESA 1XDSA 2W00A 2L7MP 3VODA 1USSA 3JSOA 1TL8A 1GT0C 4HW0A 2R0QC 1YE9A 2IBDA 3TGNA 2V6CA 2QLZA 2AO9A 1KQ9A 2O03A 3Q5FA 4J19A 2DA4A 3L1PA 3ZOBA 3OY9A 2G7HA 5FLXZ 1B9NA 4HRIA 2ZXJA 2VONA 3V42A 2OZUA 1ZLJA 3GTMJ 1GLNA 1H9TA 2D45A 1E3PA 2KQRA 1WJEA 1FC3A 1VFCA 4I98B 4FASD 2CH0A 2E1CA 1UAAA 3IKVA 2DLLA 1DDNA 2NXNB 3GLLA 5IPAA 1WCMJ 3W2AA 2J5PA 3FIWA 1BN5A 3S93A 4D7NA 4YFXF 1KU9A 1O7LA 1RIOH 1UELB 3K4MA 3D1NI 3DEWA 1TQMA 3DTIA 3JAMZ 3ABLH 1D8JA 3CCSI 3ZXSA 1Y1WJ 2MABA 2FXAA 2Y9YA 5LRRA 1X1BA 3K0LA 2R4GA 4DOZA 2MBFA 2KP6A 5D5WB 1SD6A 4L9TA 1KZHA 4QSHA 2JPBA 1MDMB 4JX5A 1OJLA 1X3ZB 1F5TA 1P7JA 3KPHA 2L9RA 2O3FA 2VQCA 3CCQI 4DZPA 2NNYA 4A3BJ 4CCKA 3I59A 2Y9ZA 3GFJA 2GXGA 1R1VA 5BNGA 3A01A 1AHDP 2JPCA 2WY8Q 3E5QA 3ECHA 5CKTA 2QQ9A 1VQOI 1LUJB 5FB2A 3JRHA 5HDKA 2EILH 2JWTA 2JTVA 3KETA 3V8JA 4ENJA 1OYYA 2XUBA 3U2RA 1IN6A 3CDHA 1NK2P 5FKOA 1XGMA 3KFWX 5L3BA 2FX0A 3CUOA 1XMAA 2KZVA 4WF2A 1ZG1A 2ZKZA 3Q3SA 3O8HA 3K4LA 3G4SI 1JT0A 3CUQC 4J00A 1X1PA 3KZYA 1I1GA 1LPQA 3VYRB 5IOZA 1DPRA 3BC8A 3C1DA 1ZGJA 5IT9Z 2XPUA 4CZZA 1XGOA 1IRFA 5CQEA 1B1BA 4WCGA 5B1BH 4Q5SF 1V5EA 2AHQA 2YS9A 4BE1A 1SD7A 2DCEA 2E2JJ 2FQ3A 4DQ2A 2RC4A 5A2QK 2R7WA 2LY1A 1V5FA 2WAQN 4XLEA 4D1QA 1FP2A 3OYFA 3SDGA 1G6NA 5LGTA 1BC7C 2L9NA 2QGUA 3R61A 2M0MA 4E7SA 2KDZA 3QU3A 3HM5A 5EJCA 3FISA 2VE9A 4CYCA 2DA6A 3S3MA 3S17J 2PJPA 3V7CA 2DDAA 3WE3A 3H3VK 4LMYA 1R5ID 2VC1A 4ZC3A 1R6RA 1FBQA 1XGSA 1D5VA 3A1YA 3SXYA 2L01A 2H1LA 1A5JA 5H2FC 2GBYA 2F5FA 3OYJA 2QBYA 3NWSA 2K85A 3KYCB 3I4MJ 2BEOA 5L3DA 3H36A 4A6DA 4BXUA 4Q4ZF 3I58A 4CCOA 4U88A 2YX7A 1J2XA 2VE8A 4BJTA 4Y3OA 4FQGA 1R1UA 2FEZA 1TBXA 2EV0A 3IAM2 2MG4A 5D5VB 4KISA 1HKQA 1GXQA 2WWYA 3S3NA 1IN8A 1W7PA 3K4CA 1VI0A 4FX4A 1D1BA 3EPZA 1FWZA 2M0CA 1I3AA 1XSXA 3DKYA 3BT9A 1MW7A 5JR3A 3WGHA 3QRFF 5D8KB 2EH3A 1T33A 2HZDA 3HTSB 1S6LA 3R60A 2Y69H 5JFRA 3MWMA 1QA6A 3GTPJ 1J7KA 5F04A 2HKXA 2PQ8A 1C0WA 2UXXA 2WAEA 3ZMDA 1S3JA 3S3OA 2HFHA 2LFBA 1BJAA 1XX5A 3CESA 3GEZA 5EG0A 3HRUA 1B9MA 4FISA 2V26A 2JA8J 1ON2A 2DJIA 3OYEA 1MD0A 2QSFX 3VB2A 4UNOA 3U21A 5ICEA 4XRMA 1HW5A 2E5NA 2NVQJ 1A31A 4BBRJ 3HRTA 1HDPA 4I0AA 4ZDPA 4HLYA 1HSTA 3HGYA 4BGDA 1I5ZA 2EJRA 2LF7A 4BNCA 1L0OC 2XKPA 2HTSA 3AFHA 4LGWA 2DK8A 3RZDJ 4AD9A 1Y39A 1W7PD 3TP3A 5J1UA 2AS5F 3EETA 4DGWB 3MZ8A 3FF5A 2W25A 3D5SC 4XRFA 4N4OB 4F7ZA 3KX2A 5F1JA 1R36A 2XRLA 4BE2A 1U78A 1M1EB 5J8CA 3BCAA 5D6FA 4V2GA 2CW7A 3T1BA 2MH9A 3J81Z 1SVMA 5ERIA 2L9SA 2HQAA 5EZGA 3ML6A 1HBXG 4BH9A 4DBQA 3S15J 5DM6F 2DA7A 2MYSA 3GF2A 3LA3A 1UHSA 1SFEA 3I71A 4XSZF 4HX7A 4MGRA 3HHHA 5D4RA 3BTIA 4RM3A 5BOXA 3BWGA 1JI8A 1LFUP 4ZYAA 2M9HA 4CSWA 4IF4A 3GX4X 5JHUA 3IUOA 1YW8A 4XKCA 4G7ZF 5JLWA 3LOCA 4NQWA 4M9ZA 2DA5A 5E18F 3TOAA 1CF7B 3HBLA 3DCFA 1WI3A 1T56A 2G0EA 3R0AA 5TJJA 3OS0A 3DPLC 1HKTA 5J4YA 4XRSA 3BROA 4A2UA 2KJBA 2HVSA 1ZR2A 5LHGA 4BQOA 3GWZA 2ZBKA 3K69A 4UVBA 5E1WA 2R7OA 3BTJA 2VJIA 2Z5UA 3M1CA 1VQ9I 4EMSA 1ZGAA 4IHSA 1YFHA 3QYEA 3JCUC 3VWBA 2FMYA 4I7HA 2Q0OA 2G7UA 2ZXHA 5M5WJ 3ERED 1W5SA 1BL0A 2A05A 4G94A 2BY2A 1QZYA 4FHTA 4GRIA 3LSRA 2M30A 1FOKA 4OIOF 2VXZA 4KN4X 3MZHA 4ZJZA 3A02A 1AOYA 2R7XA 2BW3B 1H8AC 2O9LA 4L0ZB 3E3VA 1D3YA 2CV1A 2PMZA 4RB3C 3BJAA 2DMTA 5E3LA 3WU2C 4UUSA 2JVHA 3JRAA 3W6VA 3SEQA 3OS1A 2HQNA 2WADA 2MLGA 1WI9A 3FXQA 3ZGKA 4CYCB 3REOA 1QZEA 3IHUA 2QM3A 2WY7Q 1STZA 1SFKA 3E7LA 3MVPA 1HXDA 2CUFA 2JA6J 2D2WA 3CCLI 4HNUA 5EYRA 1MMNA 2ZMEA 2CJJA 4A0ZA 4DYCA 1VQNI 3AG4H 3B02A 3PNVA 3HSFA 2DU9A 5EEAA 3QAHA 2N8GA 2IEKA 4U0VA 3UR3C 3E1SA 2CGPA 3IL2A 1Z7UA 2TCTA 3S1MJ 2R93J 1KGSA 3U9GA 2L02A 2VT2A 1WKMA 3Q9SA 3SEZA 2DPDA 2L2OA 1X1DA 2EFNA 2M3AA 2Z3YA 5D6EA 3ZRGA 1MGTA 3ELKA 4RDUA 1EH7A 1EV7A 3KP5A 1MSEC 3M8FA 4LLLA 1SFOJ 3F8BA 2FMLA 4Y33A 2IA1A 1YS7A 3BJ6A 1MDMA 1O4XA 2HXOA 5GPCA 4LOCA 1KU3A 3H0GJ 4I2OA 3CCUI 1X4PA 4YRVA 2MC4A 4BS9A 2QEXI 1SMYF 1W1WE 4PGHA 2IS6A 2W1OA 2EIMH 4M74A 2VOOA 4BEHB 1KA8A 1PP8F 4IEJA 4IOAF 1MBKA 3H9GA 3I0TA 3F23A 4KMFA 2VPRA 1E0EA 4DNCA 5J1RA 2VPLA 3SQNA 3ZQQA 2GA1A 5IP7J 3HB9A 4WWCA 3DU5A 4D7MA 2ECBA 4U87A 3ZN0A 3WGIA 3CJQB 2XASA 4P1WA 3I55I 1D5YA 3SZPA 4LIUA 4WXDA 4HF2A 1VQMI 4BBSJ 1U0JA 5GAGJ 5F1RA 1VQ5I 3LL7A 1IXCA 3NQOA 3L2UA 3DQVC 1DUXC 3KEOA 3ERMA 4CCMA 1FT9A 1RETA 4BJ6C 5B1AH 2ZO4A 4KIGA 4L5EA 5LEJA 3KZIC 3PSFA 4X1EA 2B0LA 2EIKH 5H6RA 2LRDA 5LRSA 4LK1F 1QO0D 2OCEA 2LDUA 1AKHB 4KICA 3F72A 1HSJA 4IOCF 1OLTA 4B48A 1ETKA 5E3NA 1PDNC 2NS8A 1ZG3A 4BY7J 4MTDA 2QWWA 2O8KA 2FUG2 1YI2I 1LEBA 3L00A 1T39A 1POGA 1I27A 3LSIA 3IKTA 3N05A 4QTRA 1LE8B 1DU6A 3H1CA 5F0FA 4RAGA 2E1MC 2EZLA 2LY9A 2R7DA 4M3EA 2X6OA 2KZGA 2XGDA 3FHZA 4ENNA 3SDBA 3BQZA 3A0HC 5C3EJ 4A93J 4I02A 2IGOA 4XOPA 5KNLA 3WTYC 5HODA 2HOSA 2DFHA 5CJ9A 1ETWA 2XAHA 1S9HA 3O6BB 3DXJF 4LG0B 3LSTA 4HG2A 2IAIA 1GUUA 3SZGA 3L2QA 2F4OB 2LYCA 4X0GA 2B9SA 1WPKA 2LNBA 4KT5C 5HOOA 1D1CA 4L18B 4OMYA 4OAZA 3LFKA 4HZFA 1YRNA 2XGXA 2EZHA 3EDPA 3OYAA 3C18A 1ZREA 2LSOA 1IRGA 2M8EA 2DK5A 1NG6A 2EV5A 2M7BA 4RMNA 2RN7A 2W7NA 4KFCA 3WTUC 1FIPA 3OYCA 3I4NJ 2P4WA 1OR7A 4BYYA 1WJBA 2DT5A 3EQLF 3J7AY 2ADUA 4B09A 4EATA 2CG4A 1FSEA 3BR6A 1B8IB 3A03A 2BBYA 5CVJA 1I50J 1FIAA 4XLPF 1HDDC 2NAZA 5LHHA 1WJAA 2ISZA 4ESJA 4IPAA 1OISA 4LLGF 3PFYA 3GCMA 1KQ0A 2EFOA 2PG4A 3T5XA 2HZTA 2ZFWA 4XKWA 2DFFA 1V4RA 2R5YB 4NUBA 1G2HA 1Q1HA 4PDKA 2V79A 2KKOA 2K9SA 1FOYA 4E6KG 3RYRA 1RI7A 3PQJA 1TZLA 4LLNA 3CCYA 3SJMA 3HOZJ 1I1SA 3BY6A 4QLCU 1V3FA 5GAHJ 1Y8RB 4R8HA 3P9IA 2FBKA 4XIDA 4GYGA 4EGYA 2R7QA 1RUOA 2A3SA 1YRNB 2OJED 3IH2A 1DP7P 3NAUA 2MW8A 4YFNF 1OR7C 5J47A 2IRFG 4WK8F 4IHTA 4DJAA 3RPQA 2TRTA 3HOTA 2KMUA 3BQYA 2K86A 1IN7A 4HF1A 3DBLB 3EUKL 3EUHC 1TNTA 3GUDA 1K7AA 3ZCOA 4OIQF 1Y8QB 3F22A 1R71A 3CLQA 2LTPA 3PNYA 2ZNZA 3OYGA 2E5ZA 1X58A 3GXOA 2X1EA 4HLXA 4MQVA 2CQQA 4E70A 2VJJA 1QNTA 2CUJA 1VQ8I 3O3KA 2XAJA 5LLQA 1IJWC 2UUZA 4A3FJ 1BR2A 2L54A 2JMWA 1FP1D 1QHGA 4U7BA 1MBGA 2DFIA 4ZYHA 1BM9A 2VC0A 2I10A 4O6JA 2A68F 1BI0A 5EEGA 3HPHA 2E35A 2M2EA 1IRZA 2XSDC 2DA2A 3HOUJ 3HHGA 4HBLA 4XONA 2K02A 3AG1H 1FY7A 3GFLA 4M72A 3HYIA 3I56I 1JUPA 1YQAA 2P5VA 1X1CA 3P5JA 2DOEA 3GFIA 2KRCA 4PJ0C 4L9VA 4PUSA 3CP8A 2CUZA 4U7DA 1VQKI 2QSGX 4CZCA 2CU7A 3ISPA 1BC8C 2LD5A 2JA5J 2DMUA 1GHCA 1BI2A 1MBJA 4NDLA 3CC2I 2EIJH 4G6DA 3G1LA 2LKPA 2CW0F 2DOFA 3ZQ7A 3HOSA 2A07F 2DMPA 4F93B 2BHZA 5CPRB 2PMHA 5FFZA 4CDGA 2DJNA 1X2MA 3PIPF 1DGRM 3VDXA 1S7AA 3LSJA 3V7SA 4PJMA 4I01A 4M6VA 5IYDJ 1I39A 5CVVA 4IX7A 1ENHA 2M8GX 3E6MA 1XMKA 2CWEA 3KP6A 4LG3A 3KEQA 3NWTA 3RQ4A 2LMDA 5LGNA 5DYMA 3FKIJ 5KCMA 1A6IA 4AVPA 1OFCX 4A6EA 3HSRA 1OCCH 3ZPLA 2D1HA 1MJAA 3ECOA 5BMZA 1YW7A 2E71A 4E7KA 1MBFA 1T95A 1PUFA 1IAWA 2HOAA 5M5XJ 2JRMA 2QYOA 4OWRB 2HXIA 4RGSA 3T8RA 3I64A 3C2GA 5K5QA 4O3MA 5ILVA 3RTRA 4ABZA 2KIQA 3HOXJ 2E19A 4ON0A 1A04A 2LVSA 4GDFA 3VFZA 5LEKA 3DPTA 2Y75A 4YIRX 2E36A 5DEQA 2QA4I 3E6BA 1IV8A 3BP8A 1FYLA 3DPUA 2EK5A 2Q1ZB 4B4CA 2R7VA 1REPC 1XG1A 4BDYA 3OYNA 2RGVA 1Z6RA 1PUEE 4AYBA
chains in the Genus database with same CATH topology
1VQLI 1FOXA 3PIOF 1VQ7I 3CCQI 3G4SI 1YHQI 2OTJI 3PIPF 5JVGF 1ACIA 2NXNB 5GADJ 3I56I 3CCVI 4IO9F 1VQ8I 3CC7I 3CCEI 4V19K 3DLLF 5DM7F 2E34A 3G71I 3CF5F 4IOCF 1QA6A 2OTLI 3CC4I 5DM6F 3J7YJ 3CCLI 1YIJI 1S72I 1VQ6I 1HC8A 2ZJQF 2E36A 2QA4I 4IOAF 1FOYA 1VQOI 1YITI 3I55I 1VQKI 1VQNI 3CD6I 2H8WA 2FOWA 3CMEI 1YJ9I 1VQMI 2JQ7A 3CCSI 3CCUI 1VQPI 3J7ZI 4UY8I 5GAGJ 2K3FA 1YI2I 2ZJPF 1FOWA 3CMAI 1YJNI 1Y39A 1VQ5I 2E35A 2QEXI 2ZJRF 3CCJI 3CC2I 3CCMI 1YJWI 5GAHJ 3CJTB 1MMSA 3CCRI 1VQ4I 1VQ9I 3G6EI 5GAEJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL I;  1FOX A;  3PIO F;  1VQ7 I;  3CCQ I;  3G4S I;  1YHQ I;  2OTJ I;  3PIP F;  5JVG F;  1ACI A;  2NXN B;  5GAD J;  3I56 I;  3CCV I;  4IO9 F;  1VQ8 I;  3CC7 I;  3CCE I;  4V19 K;  3DLL F;  5DM7 F;  2E34 A;  3G71 I;  3CF5 F;  4IOC F;  1QA6 A;  2OTL I;  3CC4 I;  5DM6 F;  3J7Y J;  3CCL I;  1YIJ I;  1S72 I;  1VQ6 I;  1HC8 A;  2ZJQ F;  2E36 A;  2QA4 I;  4IOA F;  1FOY A;  1VQO I;  1YIT I;  3I55 I;  1VQK I;  1VQN I;  3CD6 I;  2H8W A;  2FOW A;  3CME I;  1YJ9 I;  1VQM I;  2JQ7 A;  3CCS I;  3CCU I;  1VQP I;  3J7Z I;  4UY8 I;  5GAG J;  2K3F A;  1YI2 I;  2ZJP F;  1FOW A;  3CMA I;  1YJN I;  1Y39 A;  1VQ5 I;  2E35 A;  2QEX I;  2ZJR F;  3CCJ I;  3CC2 I;  3CCM I;  1YJW I;  5GAH J;  3CJT B;  1MMS A;  3CCR I;  1VQ4 I;  1VQ9 I;  3G6E I;  5GAE J; 
#chains in the Genus database with same CATH topology
 1R49 A;  3TED A;  3LAJ A;  1EKE A;  1FMV A;  3IV5 A;  3K1P A;  4YFK F;  1U5T C;  1R22 A;  3QP6 A;  1B8I A;  1AWC A;  4CXF A;  2DN0 A;  2R7F A;  3Q9V A;  2X85 A;  1FJL A;  3ASN H;  4A3J J;  2NS7 A;  2Y0S A;  2XPW A;  1ZRD A;  3S16 J;  1SD4 A;  4A3D J;  1QHH D;  2DBB A;  1YJ9 I;  4XMY A;  2A6T A;  3ZP5 A;  3CP2 A;  1WHU A;  3PL8 A;  3MN2 A;  3KP3 A;  3ZQL A;  3J7A O;  5IOY A;  2DA1 A;  2LKX A;  1ULY A;  2XV4 S;  2HPM A;  2LF8 A;  1JGS A;  1ERD A;  1UFM A;  2DOA A;  2F5E A;  4UV8 A;  1MIJ A;  4E4H A;  1BI1 A;  1OYI A;  1AA7 A;  1X3W B;  3BPV A;  1MMA A;  3WOD F;  1Y0N A;  3H35 A;  3HDD A;  2ZSH B;  3HKZ A;  4NB5 A;  4IHV A;  2W48 A;  5HNH A;  1BA5 A;  1ON1 A;  2CQ7 A;  2EQR A;  3VPR A;  2FBH A;  1YJW I;  4M71 A;  1S8N A;  3DF8 A;  4EQQ A;  2ME0 A;  1XPX A;  4RLQ A;  3GFM A;  5E8G A;  3F8M A;  1QRY A;  3B6A A;  5KAF C;  3E5U A;  3Q0V A;  1WH7 A;  3QOP A;  3TW6 A;  3S2D J;  4HA8 A;  1LE8 A;  4D5F A;  1Z21 A;  1O3Q A;  4HSR A;  1A35 A;  2GA2 A;  2M34 A;  2X1D A;  2Y31 A;  4NC6 A;  4XRS G;  3ZMT A;  1O7F A;  2L4A A;  1JKO C;  2DXI A;  3H9Q A;  2QQB A;  2K9L A;  2K3P A;  5EZH A;  3FXU A;  4P9F A;  5K1Y A;  5HVQ C;  1XB4 A;  2E7W A;  1RRJ A;  1FBU A;  3KP7 A;  3D5L A;  2GIZ A;  3H9J A;  2GIV A;  3DTK A;  4JK1 X;  1HW2 A;  3RQI A;  2NVX J;  2FD5 A;  4LG0 A;  2ICW G;  2QQA A;  2XAF A;  1FZP B;  4BQQ A;  3H5N A;  3P9C A;  4HX8 A;  1IW7 F;  4IL6 C;  4PGG A;  4II3 A;  2V1U A;  3S14 J;  5FLX K;  1A36 A;  4GFB A;  2STW A;  2KIU A;  3WHC A;  5ILS A;  1FBS A;  2Z99 A;  3ZQC A;  4BE0 A;  3CME I;  2Q2E A;  3HG9 A;  3OYH A;  4N4N B;  2X6Y A;  3HEF A;  1UG2 A;  3HUG A;  4G6Q A;  2JN6 A;  2HVQ A;  3L2R A;  4FE4 A;  3AG3 H;  3TQN A;  4B1R A;  4MEX F;  4AUX A;  3G2B A;  3A4C A;  2JJ7 A;  1ETX A;  1G3Y A;  2Y48 A;  5H20 A;  2EBI A;  2WC2 A;  1D8K A;  1XN7 A;  2JT1 A;  2JZY A;  3H5R A;  3PFI A;  3OOU A;  1XCB A;  1J5Y A;  5HLH A;  2M1B A;  2M7A A;  4I09 A;  1TTY A;  4XOR A;  1IXS B;  5AIQ A;  4AM3 A;  1O3R A;  4HV5 A;  5C4X J;  3BCB A;  2K9Q A;  3QPT A;  2QEN A;  3I9V 2;  4ZTF A;  1JKR C;  4XLF A;  3FBI B;  1FTZ A;  3IH3 A;  1UCR A;  2DQL A;  1HKS A;  1G3S A;  1XS9 A;  4PCQ A;  5FJ8 J;  2BXY A;  3ZN1 A;  1IG7 A;  2W85 A;  3HL2 A;  3OIQ A;  2XB0 X;  2CV0 A;  3L2V A;  3V7R A;  2JUG A;  3RIR A;  4MNU A;  1WJC A;  3MKW B;  3WTX C;  2M45 A;  4A0Y A;  3BZC A;  3TKY A;  3PQK A;  2RNG A;  1TWC J;  5DD4 A;  5E1Z B;  4X6A J;  2UV1 A;  3L09 A;  3KIO A;  5FKK A;  2L7Z A;  2P8T A;  3M4O J;  2HWV A;  4XLA A;  4MHG A;  3RPU A;  1NK3 P;  4Z2Y A;  1K79 A;  3GTL J;  1OCZ H;  3L9F A;  3K70 C;  1IDZ A;  4MEY F;  1APL C;  3ZR8 X;  2ELJ A;  1QU3 A;  2L0K A;  2CO5 A;  3VSK A;  2VQG A;  2KHM A;  4M73 A;  3GTG J;  3OS2 A;  2L5Q A;  2ETH A;  3SYT A;  3B6C A;  1WGX A;  3QQA A;  5L3F A;  2Y0S N;  2PBI A;  2D5V A;  2FNP A;  4XM3 A;  4BQN A;  3HXL A;  1F4K A;  2R5Y A;  2EPF A;  5E1X A;  5HDG A;  4EM0 B;  3RI4 A;  4NC8 A;  2JA2 A;  1HLV A;  2CW8 A;  2KIM A;  2NOG A;  3DLA A;  4JQF A;  3BZ6 A;  1ETV A;  3QU6 A;  4R1H A;  4PFP A;  3TO7 A;  2GZW A;  1W0U A;  2AQF A;  1NG7 A;  2JSP A;  3EUH A;  2XC7 A;  2NVT J;  4MFE A;  4E7L A;  2XF5 A;  3MMY B;  4XL9 A;  1D0X A;  1EJ9 A;  3CCM I;  4I99 C;  3CJN A;  3DBH B;  2ZME B;  3IP4 B;  2H8R A;  3AL0 C;  4B47 A;  5FLV A;  2VQL A;  1U9N A;  3TDU C;  1OCO H;  2R7R A;  4H0E A;  4GCV A;  1B72 B;  3KEY A;  5JVG F;  1Y6I A;  4RGU A;  2VBX A;  4A3M J;  3RKY A;  2OAZ A;  3L2W A;  3K2Z A;  1NHA A;  1LVK A;  2CQN A;  3BG5 A;  3OMY A;  2XIG A;  3LAP A;  3HPG A;  3WG7 H;  2DPU A;  1CF7 A;  2VOP A;  4PJN A;  3V4G A;  1L3L A;  1FYK A;  1ZYR F;  1TT0 A;  2HDW A;  1RNL A;  4BQA A;  2F48 A;  3GTK J;  1W4M A;  1CGP A;  3SZT A;  1G59 A;  2E2H J;  1EF4 A;  3BOQ A;  3OYI A;  1X2N A;  1YX3 A;  3LSG A;  2DYR H;  1T2K A;  2ELK A;  4XKV A;  2L7F P;  3DP7 A;  3MZY A;  3IAS 2;  5ILU A;  4BAY A;  2OA4 A;  2WAF A;  4ETS A;  4PSX A;  1T0F A;  1SC7 A;  1KU7 A;  3KLO A;  3CMY A;  4WXH A;  1QVU A;  3PM1 A;  4EJU A;  2X9D A;  1Z0X A;  1YOV B;  4BY1 J;  1RKW A;  3DBR B;  4HST A;  4XK4 A;  2H09 A;  1PP7 U;  2QUF A;  1VQL I;  5LD2 C;  2VAS A;  3PIO F;  1ZN2 A;  2HKO A;  5FKN A;  3BG7 A;  3ZMU A;  1D0Y A;  2V4J C;  1DPU A;  1P4W A;  1JT6 A;  3JAM K;  1S7E A;  2V7F A;  2DFE A;  1WJF A;  1JE8 A;  1LEA A;  1U8R A;  4XSX F;  1X3U A;  4E7I A;  3IC7 A;  2GOX B;  4Y17 A;  2K9N A;  3OSG A;  2D1V A;  4CCN A;  4TV7 A;  1BOA A;  2KL4 A;  2RNJ A;  4BU2 A;  4A5N A;  2BY0 A;  3OIP A;  5CVI A;  5LHI A;  4C3I J;  3RKQ A;  4AID A;  2ACJ A;  4PFO A;  3PO2 J;  3LA7 A;  1SAX A;  3QWL A;  1TC3 C;  2X1C A;  4D5C A;  2K4J A;  3K10 A;  2R5Z B;  2QCO A;  4RAY A;  9ANT A;  1SMT A;  1LFP A;  4RBO A;  2A6E F;  3W3C A;  4IRI A;  1ZG5 A;  1R7J A;  4UB6 C;  2X6W A;  1K61 A;  4O5V A;  1IGN A;  5JI6 A;  3MQ0 A;  3CF2 A;  3R6S A;  1MKM A;  1VQP I;  4Y52 J;  1MND A;  3W6J B;  4ESB A;  5EDN A;  4L9N A;  2YU3 A;  2F4I A;  2YU9 J;  2DT7 B;  5HNF A;  4HYE A;  1J09 A;  3TW7 A;  5BS6 A;  2OCC H;  3RCO A;  1U5T A;  2DI3 A;  1BIA A;  1P2F A;  1YYV A;  2OTJ I;  1BW5 A;  2PMU A;  4V19 K;  4PZJ A;  3H3Z A;  1ONV A;  2R7U A;  2EFQ A;  3BR1 A;  3HUG B;  3J7Y J;  4G7H F;  1TWH J;  4IQ4 A;  3ZQG A;  2OQG A;  3BR0 A;  3R0J A;  2X48 A;  4G6T B;  3K70 D;  2JRT A;  4CUG A;  4WX9 A;  3OYM A;  5F0C A;  4A3C J;  2BXZ A;  4XNF A;  5FO5 A;  3B73 A;  4HF0 A;  1MMS A;  1B6A A;  1E3O C;  3OYD A;  3ABT A;  2ZC2 A;  1LQ1 A;  3JTH A;  2DTZ A;  3WTZ A;  3RYP A;  4OIN F;  1DGW Y;  4H4K C;  3BPX A;  2DYS H;  2GWR A;  1JGG A;  4M9S A;  1YG2 A;  4Q47 A;  1QVT A;  4CCJ A;  1EH8 A;  5D4S A;  4BDZ A;  3JRD A;  3G71 I;  1W36 D;  2E1M B;  1YO5 C;  3QYB A;  1HW1 A;  1BW6 A;  2ZCW A;  2NYX A;  5B5E C;  1LJ9 A;  1V55 H;  2X6X A;  3LSM A;  1ZAO A;  1D1A A;  3ABM H;  1PVE A;  2A5W A;  3FK7 A;  2WB1 A;  1MBH A;  3H3U A;  4JBA A;  4GO1 A;  1G3W A;  4EVI A;  4Z6Y A;  1IUY A;  4DW6 A;  1KQ8 A;  4GYI A;  3OYB A;  3H5A A;  3F9K A;  3BTC A;  4W1U A;  5K7F A;  1JTX A;  4CIC A;  2HQ5 A;  5TGT A;  2RQQ A;  3BG6 A;  4ZYD A;  3LWF A;  4OU0 A;  2C6Y A;  2O8X A;  2TDX A;  1ZKG A;  3C2B A;  2NVU B;  3ZMS A;  4EEF G;  3D0S A;  1MNM C;  2QBY B;  2NOJ B;  3M07 A;  3TO6 A;  3M7G A;  2KIF A;  3R4K A;  4KT6 A;  3JTG A;  1WQ2 A;  4ITV A;  3K7A J;  2R92 J;  2ZXI A;  2O6G E;  3A2K A;  2LY2 A;  3CUQ B;  4CYD A;  2GLO A;  3BR2 A;  2ME6 A;  2Z33 A;  2P7V B;  2VJ5 A;  1X4O A;  2HNH A;  1F1Z A;  1ZHF A;  5J4V A;  1FOX A;  4L5J A;  1YLF A;  3FM3 A;  1P6R A;  3CZ6 A;  4KIF A;  1QZZ A;  1JHF A;  2YSR A;  5JHF A;  2OPT A;  1BOB A;  1XGN A;  5BQT A;  1UG0 A;  3ESW B;  3H92 A;  4JP0 A;  2MGQ A;  1A6Q A;  4CHU A;  3COA C;  4PK4 A;  1R4N B;  4RA2 A;  2XKO A;  5F27 A;  3J80 Z;  4UY8 I;  3E6D A;  2PN6 A;  2OQR A;  2EWN A;  1K78 A;  3BTL A;  2YPR A;  2BZT A;  3BJO A;  1Z67 A;  1OCP A;  1W5T A;  1KU2 A;  1ETQ A;  2IS1 A;  2UWM A;  5GP9 A;  1TWF J;  1AKH A;  3HJE A;  4AYB N;  3S2H J;  1R58 A;  4QPQ A;  1JKP C;  1YX5 A;  1IXR C;  3EYI A;  3HTU A;  2VLA A;  4Y4R A;  4KDP A;  1VZ0 A;  2NVY J;  3FXK A;  4KMU X;  3F6O A;  2F5D A;  1LB2 A;  3FKJ A;  3FBN B;  1FEX A;  4LFU A;  2K4B A;  4RB1 A;  3WHB A;  3VYS B;  2BOL A;  2BVL A;  1PUF B;  4B3X A;  3JR9 A;  1I3Q J;  1BR4 A;  4NHJ A;  3FXO A;  3JW4 A;  5E8I A;  1Z9C A;  4IO9 F;  5CVU A;  1X1A A;  5ICC A;  3Q0W A;  1MJ9 A;  3VYT B;  2XPV A;  3QPS A;  4GXO A;  3HOY J;  1UB9 A;  4N0B A;  1Y56 A;  4S04 A;  2R7Z J;  1JKQ C;  1I6H J;  2MH2 A;  2W82 A;  2O0Y A;  5CQG A;  4GGG A;  4MQ9 F;  3LQR A;  2RDP A;  5D5X B;  1TQP A;  2V6E A;  3LQQ A;  2ISY A;  3FXL A;  1Z3Y A;  4CO8 A;  3D5R C;  5IY5 H;  2MC3 A;  3RKW A;  3X2Q H;  4BHB A;  2IJL A;  5GAE J;  5ICG A;  4UXN A;  2DO7 A;  3E0J B;  4A69 C;  4CA0 A;  4LJZ F;  3EUA A;  1QPM A;  4L0Y B;  4ZYE A;  1UHW A;  1ZK8 A;  2IA0 A;  2CFO A;  4AIK A;  5J40 A;  5ED4 A;  2WBM A;  2Y30 A;  1MNE A;  1YIT I;  1K78 B;  1W7P B;  1FNN A;  2K3F A;  2CUE A;  1B4A A;  1FOW A;  1JUM A;  4IRG A;  3IRQ A;  4AC0 A;  2PFB A;  1T98 A;  2OBP A;  2HDC A;  1H89 C;  1VQ7 I;  5GTH C;  3UKG A;  3K4B A;  2HOT A;  2LP0 A;  4ZDL A;  1T6S A;  3QPH A;  4OAY A;  4R79 A;  2A6H F;  3KCC A;  3BG3 A;  4DYR A;  3DKX A;  4AWX B;  3CQZ J;  2HYJ A;  3DTE A;  3TO9 A;  2VKV A;  5IT9 K;  2EZI A;  2ECC A;  4HNV A;  1SEU A;  2XRO A;  1OCT C;  4B44 A;  4KN7 X;  1JJ6 C;  2MD5 A;  2MFZ A;  2COM A;  4ENK A;  1X19 A;  2VQH A;  1RC9 A;  4XN3 A;  2KT0 A;  3AL0 B;  1P7I A;  4UVA A;  2W84 A;  1DP3 A;  2W4S A;  4B3A A;  3F8F A;  1YHQ I;  1N75 A;  1VTN C;  5JLX A;  4IXA A;  3TBI A;  4F3Q A;  3GVA A;  3CC4 I;  3GTQ J;  4FCY A;  1JTY A;  2RKH A;  1OQY A;  2ZJQ F;  1XD7 A;  5FRM A;  4L9J A;  4OIR F;  2DOD A;  4MTE A;  2O5R A;  4KNY A;  5IP6 A;  5HLT A;  2KLO A;  5DCM A;  3I4P A;  4UB8 C;  3OL4 A;  3GTJ J;  1ZEL A;  2ESH A;  2JSC A;  1U9O A;  2LKS A;  2EB7 A;  2O61 A;  4S05 A;  3FDY A;  1H0M A;  2MLK A;  2PX9 A;  2VT3 A;  1HCR A;  3E5X A;  3HKZ N;  4NQW B;  5FKM A;  1HA8 A;  2CV2 A;  3HOV J;  2VJ4 A;  1RZ4 A;  5EEH A;  1B72 A;  1JUS A;  3GBG A;  2RV8 A;  1HC8 A;  4IQJ A;  2VL8 A;  3MKY B;  3RJP A;  3VSL A;  2ELH A;  1IN4 A;  2X0L A;  1T8I A;  2I8D A;  3O8G A;  1RKT A;  1MMG A;  2E1N A;  3CMA I;  2BV6 A;  3M1E A;  3OIO A;  5JVT A;  2ZJR F;  5HS8 A;  2P6T A;  1GV5 A;  4RGR A;  1BIB A;  3ULQ B;  4HQM A;  1GVD A;  4EJT A;  1G4D A;  4M6X A;  5KK1 A;  3F21 A;  1BBY A;  3JRG A;  3K2A A;  3QP5 A;  3JRC A;  2JA7 J;  2COB A;  3F6V A;  1PJR A;  1FTT A;  2BHY A;  4BL0 B;  3RPU D;  3WTS C;  3PO3 J;  1R9T J;  2V9V A;  3ONQ A;  3OYK A;  1FMW A;  4QWQ A;  3QOD A;  1WFX A;  1YJN I;  1DU0 A;  2IVM A;  3DEE A;  1P4X A;  4UUV A;  1QQI A;  4MIM A;  4Y7N J;  4XKB A;  4N9H A;  2XVC A;  3A01 B;  5CVR A;  1FLI A;  2RAE A;  2OC6 A;  2LC2 A;  3JRI A;  4FE7 A;  3M3Y J;  3I59 B;  2IGK A;  4M6Y A;  4F91 B;  2R5Z A;  1UJ8 A;  3DV8 A;  1Z7L A;  2LLK A;  2V1X A;  2A5Y B;  3M8E A;  1WZ2 A;  1B59 A;  2Q2E B;  4HV6 A;  1K83 J;  4HX4 A;  4M3B A;  2J5O A;  2EFW A;  1FYM A;  3MEX A;  3PUF A;  4NBQ A;  5J3L A;  3OOP A;  3HZJ A;  4M9X A;  3GW2 A;  3I53 A;  1Z77 A;  2XSJ C;  1WVR A;  3V8K A;  3J80 K;  5F64 A;  3S1Q J;  3WTW C;  3CCJ I;  2QKL B;  2WA0 A;  3RZO J;  2KRH A;  2GQQ A;  3P7N A;  1TNS A;  4LB6 B;  1Z6T A;  4U0W A;  5F0H A;  2DW4 A;  4XLN F;  2GAU A;  2FA5 A;  4ZZD A;  2VB6 A;  3SFZ A;  1HQC A;  3KE2 A;  4KIB A;  4CGZ A;  2P6S A;  2EZK A;  1WJ5 A;  2KIS A;  4UUT A;  1RR8 C;  2F5C A;  2ZME C;  3C2H A;  2PLY A;  4C9Y A;  4DBR A;  2GM4 A;  4IKF A;  2ZSI B;  1J0R A;  2P5K A;  3SHF A;  1RPW A;  1TW2 A;  3CO6 C;  3E97 A;  1XC5 A;  3HC7 A;  4D0P A;  5HDN A;  3N97 A;  3FMR A;  3CDL A;  2JVG A;  1S7O A;  3MKL A;  4EM1 A;  4C2T A;  2IA2 A;  3ABU A;  4JX6 A;  4MFD A;  5E17 F;  2LOO A;  3S2W A;  4IJA A;  4Y13 A;  5E20 A;  1N25 A;  1Y1V J;  3KP4 A;  2B7E A;  2M87 A;  4YG2 F;  1G3T A;  3I5U A;  2LBF B;  4A3I J;  3ZQH A;  3WE2 A;  2HOE A;  2KJC A;  1XDU A;  5DTD A;  4P5O A;  2PJR A;  1GV2 A;  4IHX A;  1U3E M;  1ZTR A;  3J7Z I;  5E3M A;  2L4M A;  3NEU A;  3V8L A;  4E7H A;  2P0W A;  3LNQ A;  4C30 A;  1YIO A;  4WXC A;  2YUS A;  5H6Q A;  3PJR A;  1TWA J;  2ESN A;  4F52 A;  2DMN A;  3I3L A;  2EIN H;  4M3F A;  3K1M A;  2Q8K A;  4EJO A;  5FD5 A;  2Z9O A;  2IGM A;  2VXD A;  3MD2 A;  4M3G A;  4EGZ A;  1U2W A;  2EFP A;  3ZQF A;  4HDU A;  5LBQ A;  5M5Y J;  2FF4 A;  4YEJ A;  5FRN A;  2LR8 A;  1Z05 A;  2VKH A;  2HGC A;  4PJJ A;  2FBI A;  4EV0 A;  4ZTJ A;  1QGP A;  1T08 B;  2VBY A;  4RLF A;  2WB1 N;  1WRJ A;  3F0C A;  5F6F A;  1VF9 A;  1U6G A;  4I6Z A;  1ZAR A;  2FE3 A;  2HR3 A;  2WAQ A;  3S8P A;  4BAC A;  1FX7 A;  4FT8 A;  3WG9 A;  1W0T A;  3FK6 A;  1ZH5 A;  2XAQ A;  4RGX A;  2HU9 A;  2RRE A;  3TDZ C;  5M3M J;  5HLI A;  1ZLK A;  2OTL I;  1N78 A;  1O3S A;  4XLH A;  2VKE A;  2O7O A;  2OUM A;  2XF6 A;  1IUF A;  2IP2 A;  4MLO A;  3JRF A;  4A5M A;  5EGO A;  5F08 A;  2XRN A;  2EA4 A;  2DT6 A;  2LG4 A;  1IV6 A;  4J01 A;  1UMQ A;  4AIJ A;  1UZC A;  2P7C B;  3K1N A;  3PSI A;  4CCL A;  3GZ6 A;  2ID3 A;  1U5T B;  1LDK B;  4F92 B;  3DU6 A;  1D0Z A;  1TLH B;  2EV6 A;  3FM5 A;  2Z2S B;  3S32 A;  2WV0 A;  4AVZ A;  3MKZ A;  1E3H A;  2DQR A;  3G73 A;  3GLX A;  4S0H B;  2W57 A;  2XGE A;  2K5C A;  1E17 A;  3CD6 I;  1KON A;  3GZN B;  4F55 A;  4KYW A;  2ZJP F;  2XHK A;  4RAF A;  4G9Y A;  2H27 A;  1T38 A;  1O57 A;  5AON A;  3RDI A;  2Z16 A;  3A0B C;  3AKZ A;  1VQ4 I;  2IXS A;  4FTH A;  3TMO A;  3GME A;  3CDI A;  4XOT A;  1XTA A;  4B8X A;  4D9J A;  2HS5 A;  1Q1V A;  2XB5 A;  6PAX A;  2L9V A;  2BVM A;  2JUC A;  3AG2 H;  3M8J A;  2GOM A;  3DLL F;  5M3F J;  4ZDO A;  1LDD A;  3MAJ A;  3BDD A;  4UHT A;  2IW5 A;  5BPD A;  1TP4 A;  2YX4 A;  3TL4 X;  4MO7 A;  5TRD A;  1W36 C;  3W2V A;  2FRH A;  4V2F A;  2LRE A;  5HS7 A;  3KP2 A;  5C44 J;  2HDD A;  1SAU A;  2DA3 A;  4E7Z A;  3IWF A;  2QKM B;  1KYW A;  3QYF A;  4ASN A;  3DFG A;  4P96 A;  3BR3 A;  3ZMV A;  5J1Y A;  2GXA A;  3F8C A;  2K7L A;  1U8B A;  1HOM A;  2BGC A;  4YEL A;  1GDT A;  4DZJ A;  2H6B A;  1EA3 A;  1ORK A;  3NAR A;  2KDO A;  2IS4 A;  1VND A;  3DWL E;  1ETO A;  1JJ8 C;  2NRA C;  4NC7 A;  1CQT A;  1R23 A;  4K2E A;  4W97 A;  2VN2 A;  1ETY A;  1H9G A;  1PYV A;  4BUP A;  1NTC A;  4C2M J;  5B66 C;  4KUM A;  5IP9 J;  3BZK A;  3CCR I;  3NRV A;  2CS3 A;  4ANJ A;  3PUB A;  3C7J A;  2AXL A;  2F6C A;  1SVO A;  2OF7 A;  3FWE A;  4BEH A;  1FPQ A;  2KFD A;  3IRR A;  2P5L C;  2E7X A;  4P9U A;  2CQX A;  2P81 A;  5J8F A;  5FRO A;  1W5C C;  2IGN A;  3CF5 F;  3VEP A;  2ZFU A;  2QQ8 A;  2V1N A;  1BJZ A;  2X4H A;  5TIS C;  1S29 A;  2MSY A;  3IH4 A;  1XMX A;  4XQF A;  1LKX A;  3G3Z A;  1E2X A;  2XF7 A;  3JRE A;  2L7K A;  2PI0 A;  2RQP A;  4LIT A;  4KA4 A;  1I6X A;  3CLO A;  1WJD A;  2MD0 A;  4A3L J;  4I0B A;  1ZQ3 P;  3WTT C;  3FX3 A;  3LFU A;  3TOB A;  4RS8 A;  2OD5 A;  1SD5 A;  3W2W A;  3OYL A;  5EF6 A;  4A3G J;  1LFB A;  1LNW A;  4P55 A;  4B43 A;  1S72 I;  5EG0 B;  4LB5 A;  4KJZ A;  1ITY A;  3WU0 A;  5K5R A;  3K6G A;  4IRH A;  4OOI A;  2XGC A;  3WTV C;  2LK2 A;  1GVJ A;  4QIW N;  2HVR A;  2QSH X;  3K4N A;  1ZRC A;  5L3E A;  2FSW A;  5FFX A;  1P9Q C;  1V5G A;  3LSK A;  3CMM A;  2DMQ A;  1O3T A;  1IZ1 A;  3VYU B;  4UVC A;  4I76 A;  2DAO A;  1J59 A;  3CCV I;  2BW3 A;  1MBE A;  4HOB A;  3AAF A;  5DCM B;  2R7S A;  1AU7 A;  1G8X A;  1ODD A;  4L5I A;  4AIH A;  1VQ6 I;  4N9I A;  5L3C A;  2DDB A;  4JYK A;  3ABK H;  1UHM A;  2H6C A;  2H8W A;  3ASO H;  5D8L B;  2VBZ A;  4EM2 A;  3I54 A;  3LSP A;  5KVR A;  3F8N A;  1R5H A;  2Y0M A;  3QPL A;  4A0X A;  1MSF C;  1BI3 A;  2BY1 A;  5IYC J;  3RSN A;  3FZV A;  3E6C C;  2BYV E;  2HYF A;  3C3W A;  3H0D A;  1K4S A;  4HNT A;  2BY3 A;  2EA2 A;  1BR1 A;  3EYY A;  4RB0 A;  2IT0 A;  3BG9 A;  1XSD A;  1QBJ A;  5CLS A;  5GAD J;  1ZRF A;  3CUQ A;  3U1D A;  4JX4 A;  5DV5 A;  4ZZL A;  4HDV A;  1WH5 A;  2ZNY A;  2PJR B;  1Y0U A;  5CYV A;  1QPI A;  2FQ4 A;  2VUM J;  3PNT A;  2E1O A;  3GTO J;  2WV1 A;  5E3O A;  3O2P E;  2AXT C;  2XAG A;  3OR2 C;  1R1T A;  2Y2Z A;  3CJT B;  5DCF A;  5LFA A;  2I5U A;  5DUK A;  4BKX A;  3IWZ A;  5HS9 A;  4AU7 A;  4CH7 A;  4NNJ A;  1YS6 A;  2FU4 A;  2OV7 A;  2K9M A;  5K7H A;  3ZQI A;  4UV9 A;  4KIT B;  5IT3 A;  1RR7 A;  2E34 A;  4YIF A;  1Z91 A;  3N4M A;  2QF7 A;  1SAN A;  1NH3 A;  2HQR A;  1Z3X A;  2IS2 A;  3DKW A;  2KPM A;  2M5W A;  4C3H J;  1Z1D A;  4XN0 A;  3MCZ A;  2FJ1 A;  4JOM A;  2A61 A;  1MMD A;  4BXF A;  2F5V A;  3KLN A;  1WWX A;  3QOE A;  1OKR A;  3JSP A;  3FHN A;  1XSV A;  1K6O A;  1IC8 A;  4U0Y A;  2E60 A;  2ZXW H;  3L2C A;  5L3G A;  2YR2 A;  3CO7 C;  1K4T A;  4BJ5 C;  4FET A;  3CCE I;  4FX0 A;  1SFX A;  1T0F C;  3GZ5 A;  3KZZ A;  1IO2 A;  3KYL A;  3HRM A;  2IPQ X;  2CSO A;  3T0Y A;  4G8X A;  3FMS A;  5K5O A;  3KYD B;  4DYQ A;  3F3X A;  2V1D A;  1JXS A;  4A12 A;  5FGM A;  2E2I J;  1R00 A;  4PSW A;  4C2U A;  2CMP A;  1SFU A;  3K4K A;  2UXN A;  3UNG C;  3WU1 B;  3FMQ A;  3HSE A;  1MH3 A;  4LD5 A;  2JK3 A;  4QPO A;  2CYY A;  3G1M A;  2VOD A;  1F36 A;  2H94 A;  5GTI C;  1ZR4 A;  2HEO A;  2CRG A;  2CFX A;  5E79 C;  3VOE A;  4HAM A;  3HIF A;  1TQI A;  1DQU A;  1LDJ A;  3OL3 A;  5IYB J;  2HI3 A;  5DDG A;  2STT A;  4E7J A;  1R4M B;  2JQ7 A;  5A2Q Z;  5K7Z A;  3RKX A;  4RAZ A;  2AQE A;  2K27 A;  3P9K A;  2QZ8 A;  3S1N J;  3TP0 A;  2HYG D;  4EJW A;  2HPI A;  5KHD A;  1EH6 A;  4HQE A;  1MJB A;  1GXP A;  4XIC A;  3GYH X;  1K6Y A;  5KAI C;  5BPI A;  4IHW A;  1OMI A;  1F43 A;  1SVL A;  1JHH A;  4BHP A;  3CC7 I;  4XLC A;  2VIX A;  4BXX J;  2L3D A;  3WGG A;  2A69 F;  2VI6 A;  2ZJ2 A;  3FXJ A;  5C4J J;  4IVN A;  3U1K A;  1FSH A;  2V9K A;  5EGO B;  1J75 A;  5FKL A;  3T8T A;  5B3S H;  2F4M B;  2XAU A;  2X51 A;  3CJR B;  1H88 C;  1J9I A;  4UUS B;  3HRS A;  3L7W A;  4ESF A;  1IRX A;  5HLG A;  1YTY A;  3J81 K;  2GXB A;  1N77 A;  2OZ6 A;  5AIP A;  2R7T A;  4Y15 A;  2FOK A;  4ZH4 F;  2VKD A;  3OSF A;  3W6K B;  3JRB A;  2HTJ A;  2M4G A;  5DM7 F;  2KRF A;  2M4K A;  2PEX A;  3M9A A;  3OWT A;  5J6X A;  4OIP F;  4OMZ A;  1LVA A;  2FOW A;  2XDV A;  2R3S A;  2VBW A;  1IDY A;  3FXR A;  3ZMZ A;  1TW3 A;  2DTR A;  2PMZ N;  3GO5 A;  4Q48 A;  4ENM A;  3FXM A;  4A3E J;  3OV8 A;  2LH9 A;  1F9N A;  2CQK A;  1IN5 A;  3SFI A;  3G6E I;  3BLY A;  3LMM A;  5DS9 A;  4HEA 2;  4LK0 F;  4RM2 A;  1MZB A;  2ZB9 A;  3CTA A;  3BR5 A;  2NNN A;  4A3K J;  1ZGW A;  3ROU A;  1TT5 B;  1P4A A;  2ID6 A;  1V54 H;  5FLM J;  4EJV A;  4XBF A;  2BE5 F;  2WTE A;  1XCV A;  2K40 A;  2Z1D A;  1OPC A;  2F2E A;  3Q0U A;  4YII A;  1KYZ A;  1RUN A;  4HPQ A;  4M3D A;  4BHC A;  1S5L C;  2OU2 A;  2RVC A;  5DD8 A;  2B63 J;  5D5U B;  4G12 A;  1YW9 A;  3LSH A;  5DUI A;  1HF0 A;  3HGG A;  3G1O A;  2H1K A;  4IZZ A;  4II2 A;  1ACI A;  2FNA A;  5FD6 A;  4RB2 C;  5GPA A;  1YIJ I;  3OR1 C;  1MH4 A;  3HOW J;  5ICF A;  3K4J A;  3K9T A;  5LGU A;  4XR6 A;  2G9W A;  2MA3 A;  1UST A;  1IF1 A;  1TWG J;  1WSU A;  4DIQ A;  1OCR H;  2V9P A;  1P92 A;  4PJL A;  1OYW A;  4ZYG A;  1R5G A;  3LA2 A;  4LIV A;  3MFK A;  4C3J J;  3DEU A;  4G7O F;  4IHY A;  3S1R J;  2QVO A;  2NS0 A;  2UZK A;  2W24 A;  2LBF A;  1RES A;  1XDS A;  2W00 A;  2L7M P;  3VOD A;  1USS A;  3JSO A;  1TL8 A;  1GT0 C;  4HW0 A;  2R0Q C;  1YE9 A;  2IBD A;  3TGN A;  2V6C A;  2QLZ A;  2AO9 A;  1KQ9 A;  2O03 A;  3Q5F A;  4J19 A;  2DA4 A;  3L1P A;  3ZOB A;  3OY9 A;  2G7H A;  5FLX Z;  1B9N A;  4HRI A;  2ZXJ A;  2VON A;  3V42 A;  2OZU A;  1ZLJ A;  3GTM J;  1GLN A;  1H9T A;  2D45 A;  1E3P A;  2KQR A;  1WJE A;  1FC3 A;  1VFC A;  4I98 B;  4FAS D;  2CH0 A;  2E1C A;  1UAA A;  3IKV A;  2DLL A;  1DDN A;  2NXN B;  3GLL A;  5IPA A;  1WCM J;  3W2A A;  2J5P A;  3FIW A;  1BN5 A;  3S93 A;  4D7N A;  4YFX F;  1KU9 A;  1O7L A;  1RIO H;  1UEL B;  3K4M A;  3D1N I;  3DEW A;  1TQM A;  3DTI A;  3JAM Z;  3ABL H;  1D8J A;  3CCS I;  3ZXS A;  1Y1W J;  2MAB A;  2FXA A;  2Y9Y A;  5LRR A;  1X1B A;  3K0L A;  2R4G A;  4DOZ A;  2MBF A;  2KP6 A;  5D5W B;  1SD6 A;  4L9T A;  1KZH A;  4QSH A;  2JPB A;  1MDM B;  4JX5 A;  1OJL A;  1X3Z B;  1F5T A;  1P7J A;  3KPH A;  2L9R A;  2O3F A;  2VQC A;  3CCQ I;  4DZP A;  2NNY A;  4A3B J;  4CCK A;  3I59 A;  2Y9Z A;  3GFJ A;  2GXG A;  1R1V A;  5BNG A;  3A01 A;  1AHD P;  2JPC A;  2WY8 Q;  3E5Q A;  3ECH A;  5CKT A;  2QQ9 A;  1VQO I;  1LUJ B;  5FB2 A;  3JRH A;  5HDK A;  2EIL H;  2JWT A;  2JTV A;  3KET A;  3V8J A;  4ENJ A;  1OYY A;  2XUB A;  3U2R A;  1IN6 A;  3CDH A;  1NK2 P;  5FKO A;  1XGM A;  3KFW X;  5L3B A;  2FX0 A;  3CUO A;  1XMA A;  2KZV A;  4WF2 A;  1ZG1 A;  2ZKZ A;  3Q3S A;  3O8H A;  3K4L A;  3G4S I;  1JT0 A;  3CUQ C;  4J00 A;  1X1P A;  3KZY A;  1I1G A;  1LPQ A;  3VYR B;  5IOZ A;  1DPR A;  3BC8 A;  3C1D A;  1ZGJ A;  5IT9 Z;  2XPU A;  4CZZ A;  1XGO A;  1IRF A;  5CQE A;  1B1B A;  4WCG A;  5B1B H;  4Q5S F;  1V5E A;  2AHQ A;  2YS9 A;  4BE1 A;  1SD7 A;  2DCE A;  2E2J J;  2FQ3 A;  4DQ2 A;  2RC4 A;  5A2Q K;  2R7W A;  2LY1 A;  1V5F A;  2WAQ N;  4XLE A;  4D1Q A;  1FP2 A;  3OYF A;  3SDG A;  1G6N A;  5LGT A;  1BC7 C;  2L9N A;  2QGU A;  3R61 A;  2M0M A;  4E7S A;  2KDZ A;  3QU3 A;  3HM5 A;  5EJC A;  3FIS A;  2VE9 A;  4CYC A;  2DA6 A;  3S3M A;  3S17 J;  2PJP A;  3V7C A;  2DDA A;  3WE3 A;  3H3V K;  4LMY A;  1R5I D;  2VC1 A;  4ZC3 A;  1R6R A;  1FBQ A;  1XGS A;  1D5V A;  3A1Y A;  3SXY A;  2L01 A;  2H1L A;  1A5J A;  5H2F C;  2GBY A;  2F5F A;  3OYJ A;  2QBY A;  3NWS A;  2K85 A;  3KYC B;  3I4M J;  2BEO A;  5L3D A;  3H36 A;  4A6D A;  4BXU A;  4Q4Z F;  3I58 A;  4CCO A;  4U88 A;  2YX7 A;  1J2X A;  2VE8 A;  4BJT A;  4Y3O A;  4FQG A;  1R1U A;  2FEZ A;  1TBX A;  2EV0 A;  3IAM 2;  2MG4 A;  5D5V B;  4KIS A;  1HKQ A;  1GXQ A;  2WWY A;  3S3N A;  1IN8 A;  1W7P A;  3K4C A;  1VI0 A;  4FX4 A;  1D1B A;  3EPZ A;  1FWZ A;  2M0C A;  1I3A A;  1XSX A;  3DKY A;  3BT9 A;  1MW7 A;  5JR3 A;  3WGH A;  3QRF F;  5D8K B;  2EH3 A;  1T33 A;  2HZD A;  3HTS B;  1S6L A;  3R60 A;  2Y69 H;  5JFR A;  3MWM A;  1QA6 A;  3GTP J;  1J7K A;  5F04 A;  2HKX A;  2PQ8 A;  1C0W A;  2UXX A;  2WAE A;  3ZMD A;  1S3J A;  3S3O A;  2HFH A;  2LFB A;  1BJA A;  1XX5 A;  3CES A;  3GEZ A;  5EG0 A;  3HRU A;  1B9M A;  4FIS A;  2V26 A;  2JA8 J;  1ON2 A;  2DJI A;  3OYE A;  1MD0 A;  2QSF X;  3VB2 A;  4UNO A;  3U21 A;  5ICE A;  4XRM A;  1HW5 A;  2E5N A;  2NVQ J;  1A31 A;  4BBR J;  3HRT A;  1HDP A;  4I0A A;  4ZDP A;  4HLY A;  1HST A;  3HGY A;  4BGD A;  1I5Z A;  2EJR A;  2LF7 A;  4BNC A;  1L0O C;  2XKP A;  2HTS A;  3AFH A;  4LGW A;  2DK8 A;  3RZD J;  4AD9 A;  1Y39 A;  1W7P D;  3TP3 A;  5J1U A;  2AS5 F;  3EET A;  4DGW B;  3MZ8 A;  3FF5 A;  2W25 A;  3D5S C;  4XRF A;  4N4O B;  4F7Z A;  3KX2 A;  5F1J A;  1R36 A;  2XRL A;  4BE2 A;  1U78 A;  1M1E B;  5J8C A;  3BCA A;  5D6F A;  4V2G A;  2CW7 A;  3T1B A;  2MH9 A;  3J81 Z;  1SVM A;  5ERI A;  2L9S A;  2HQA A;  5EZG A;  3ML6 A;  1HBX G;  4BH9 A;  4DBQ A;  3S15 J;  5DM6 F;  2DA7 A;  2MYS A;  3GF2 A;  3LA3 A;  1UHS A;  1SFE A;  3I71 A;  4XSZ F;  4HX7 A;  4MGR A;  3HHH A;  5D4R A;  3BTI A;  4RM3 A;  5BOX A;  3BWG A;  1JI8 A;  1LFU P;  4ZYA A;  2M9H A;  4CSW A;  4IF4 A;  3GX4 X;  5JHU A;  3IUO A;  1YW8 A;  4XKC A;  4G7Z F;  5JLW A;  3LOC A;  4NQW A;  4M9Z A;  2DA5 A;  5E18 F;  3TOA A;  1CF7 B;  3HBL A;  3DCF A;  1WI3 A;  1T56 A;  2G0E A;  3R0A A;  5TJJ A;  3OS0 A;  3DPL C;  1HKT A;  5J4Y A;  4XRS A;  3BRO A;  4A2U A;  2KJB A;  2HVS A;  1ZR2 A;  5LHG A;  4BQO A;  3GWZ A;  2ZBK A;  3K69 A;  4UVB A;  5E1W A;  2R7O A;  3BTJ A;  2VJI A;  2Z5U A;  3M1C A;  1VQ9 I;  4EMS A;  1ZGA A;  4IHS A;  1YFH A;  3QYE A;  3JCU C;  3VWB A;  2FMY A;  4I7H A;  2Q0O A;  2G7U A;  2ZXH A;  5M5W J;  3ERE D;  1W5S A;  1BL0 A;  2A05 A;  4G94 A;  2BY2 A;  1QZY A;  4FHT A;  4GRI A;  3LSR A;  2M30 A;  1FOK A;  4OIO F;  2VXZ A;  4KN4 X;  3MZH A;  4ZJZ A;  3A02 A;  1AOY A;  2R7X A;  2BW3 B;  1H8A C;  2O9L A;  4L0Z B;  3E3V A;  1D3Y A;  2CV1 A;  2PMZ A;  4RB3 C;  3BJA A;  2DMT A;  5E3L A;  3WU2 C;  4UUS A;  2JVH A;  3JRA A;  3W6V A;  3SEQ A;  3OS1 A;  2HQN A;  2WAD A;  2MLG A;  1WI9 A;  3FXQ A;  3ZGK A;  4CYC B;  3REO A;  1QZE A;  3IHU A;  2QM3 A;  2WY7 Q;  1STZ A;  1SFK A;  3E7L A;  3MVP A;  1HXD A;  2CUF A;  2JA6 J;  2D2W A;  3CCL I;  4HNU A;  5EYR A;  1MMN A;  2ZME A;  2CJJ A;  4A0Z A;  4DYC A;  1VQN I;  3AG4 H;  3B02 A;  3PNV A;  3HSF A;  2DU9 A;  5EEA A;  3QAH A;  2N8G A;  2IEK A;  4U0V A;  3UR3 C;  3E1S A;  2CGP A;  3IL2 A;  1Z7U A;  2TCT A;  3S1M J;  2R93 J;  1KGS A;  3U9G A;  2L02 A;  2VT2 A;  1WKM A;  3Q9S A;  3SEZ A;  2DPD A;  2L2O A;  1X1D A;  2EFN A;  2M3A A;  2Z3Y A;  5D6E A;  3ZRG A;  1MGT A;  3ELK A;  4RDU A;  1EH7 A;  1EV7 A;  3KP5 A;  1MSE C;  3M8F A;  4LLL A;  1SFO J;  3F8B A;  2FML A;  4Y33 A;  2IA1 A;  1YS7 A;  3BJ6 A;  1MDM A;  1O4X A;  2HXO A;  5GPC A;  4LOC A;  1KU3 A;  3H0G J;  4I2O A;  3CCU I;  1X4P A;  4YRV A;  2MC4 A;  4BS9 A;  2QEX I;  1SMY F;  1W1W E;  4PGH A;  2IS6 A;  2W1O A;  2EIM H;  4M74 A;  2VOO A;  4BEH B;  1KA8 A;  1PP8 F;  4IEJ A;  4IOA F;  1MBK A;  3H9G A;  3I0T A;  3F23 A;  4KMF A;  2VPR A;  1E0E A;  4DNC A;  5J1R A;  2VPL A;  3SQN A;  3ZQQ A;  2GA1 A;  5IP7 J;  3HB9 A;  4WWC A;  3DU5 A;  4D7M A;  2ECB A;  4U87 A;  3ZN0 A;  3WGI A;  3CJQ B;  2XAS A;  4P1W A;  3I55 I;  1D5Y A;  3SZP A;  4LIU A;  4WXD A;  4HF2 A;  1VQM I;  4BBS J;  1U0J A;  5GAG J;  5F1R A;  1VQ5 I;  3LL7 A;  1IXC A;  3NQO A;  3L2U A;  3DQV C;  1DUX C;  3KEO A;  3ERM A;  4CCM A;  1FT9 A;  1RET A;  4BJ6 C;  5B1A H;  2ZO4 A;  4KIG A;  4L5E A;  5LEJ A;  3KZI C;  3PSF A;  4X1E A;  2B0L A;  2EIK H;  5H6R A;  2LRD A;  5LRS A;  4LK1 F;  1QO0 D;  2OCE A;  2LDU A;  1AKH B;  4KIC A;  3F72 A;  1HSJ A;  4IOC F;  1OLT A;  4B48 A;  1ETK A;  5E3N A;  1PDN C;  2NS8 A;  1ZG3 A;  4BY7 J;  4MTD A;  2QWW A;  2O8K A;  2FUG 2;  1YI2 I;  1LEB A;  3L00 A;  1T39 A;  1POG A;  1I27 A;  3LSI A;  3IKT A;  3N05 A;  4QTR A;  1LE8 B;  1DU6 A;  3H1C A;  5F0F A;  4RAG A;  2E1M C;  2EZL A;  2LY9 A;  2R7D A;  4M3E A;  2X6O A;  2KZG A;  2XGD A;  3FHZ A;  4ENN A;  3SDB A;  3BQZ A;  3A0H C;  5C3E J;  4A93 J;  4I02 A;  2IGO A;  4XOP A;  5KNL A;  3WTY C;  5HOD A;  2HOS A;  2DFH A;  5CJ9 A;  1ETW A;  2XAH A;  1S9H A;  3O6B B;  3DXJ F;  4LG0 B;  3LST A;  4HG2 A;  2IAI A;  1GUU A;  3SZG A;  3L2Q A;  2F4O B;  2LYC A;  4X0G A;  2B9S A;  1WPK A;  2LNB A;  4KT5 C;  5HOO A;  1D1C A;  4L18 B;  4OMY A;  4OAZ A;  3LFK A;  4HZF A;  1YRN A;  2XGX A;  2EZH A;  3EDP A;  3OYA A;  3C18 A;  1ZRE A;  2LSO A;  1IRG A;  2M8E A;  2DK5 A;  1NG6 A;  2EV5 A;  2M7B A;  4RMN A;  2RN7 A;  2W7N A;  4KFC A;  3WTU C;  1FIP A;  3OYC A;  3I4N J;  2P4W A;  1OR7 A;  4BYY A;  1WJB A;  2DT5 A;  3EQL F;  3J7A Y;  2ADU A;  4B09 A;  4EAT A;  2CG4 A;  1FSE A;  3BR6 A;  1B8I B;  3A03 A;  2BBY A;  5CVJ A;  1I50 J;  1FIA A;  4XLP F;  1HDD C;  2NAZ A;  5LHH A;  1WJA A;  2ISZ A;  4ESJ A;  4IPA A;  1OIS A;  4LLG F;  3PFY A;  3GCM A;  1KQ0 A;  2EFO A;  2PG4 A;  3T5X A;  2HZT A;  2ZFW A;  4XKW A;  2DFF A;  1V4R A;  2R5Y B;  4NUB A;  1G2H A;  1Q1H A;  4PDK A;  2V79 A;  2KKO A;  2K9S A;  1FOY A;  4E6K G;  3RYR A;  1RI7 A;  3PQJ A;  1TZL A;  4LLN A;  3CCY A;  3SJM A;  3HOZ J;  1I1S A;  3BY6 A;  4QLC U;  1V3F A;  5GAH J;  1Y8R B;  4R8H A;  3P9I A;  2FBK A;  4XID A;  4GYG A;  4EGY A;  2R7Q A;  1RUO A;  2A3S A;  1YRN B;  2OJE D;  3IH2 A;  1DP7 P;  3NAU A;  2MW8 A;  4YFN F;  1OR7 C;  5J47 A;  2IRF G;  4WK8 F;  4IHT A;  4DJA A;  3RPQ A;  2TRT A;  3HOT A;  2KMU A;  3BQY A;  2K86 A;  1IN7 A;  4HF1 A;  3DBL B;  3EUK L;  3EUH C;  1TNT A;  3GUD A;  1K7A A;  3ZCO A;  4OIQ F;  1Y8Q B;  3F22 A;  1R71 A;  3CLQ A;  2LTP A;  3PNY A;  2ZNZ A;  3OYG A;  2E5Z A;  1X58 A;  3GXO A;  2X1E A;  4HLX A;  4MQV A;  2CQQ A;  4E70 A;  2VJJ A;  1QNT A;  2CUJ A;  1VQ8 I;  3O3K A;  2XAJ A;  5LLQ A;  1IJW C;  2UUZ A;  4A3F J;  1BR2 A;  2L54 A;  2JMW A;  1FP1 D;  1QHG A;  4U7B A;  1MBG A;  2DFI A;  4ZYH A;  1BM9 A;  2VC0 A;  2I10 A;  4O6J A;  2A68 F;  1BI0 A;  5EEG A;  3HPH A;  2E35 A;  2M2E A;  1IRZ A;  2XSD C;  2DA2 A;  3HOU J;  3HHG A;  4HBL A;  4XON A;  2K02 A;  3AG1 H;  1FY7 A;  3GFL A;  4M72 A;  3HYI A;  3I56 I;  1JUP A;  1YQA A;  2P5V A;  1X1C A;  3P5J A;  2DOE A;  3GFI A;  2KRC A;  4PJ0 C;  4L9V A;  4PUS A;  3CP8 A;  2CUZ A;  4U7D A;  1VQK I;  2QSG X;  4CZC A;  2CU7 A;  3ISP A;  1BC8 C;  2LD5 A;  2JA5 J;  2DMU A;  1GHC A;  1BI2 A;  1MBJ A;  4NDL A;  3CC2 I;  2EIJ H;  4G6D A;  3G1L A;  2LKP A;  2CW0 F;  2DOF A;  3ZQ7 A;  3HOS A;  2A07 F;  2DMP A;  4F93 B;  2BHZ A;  5CPR B;  2PMH A;  5FFZ A;  4CDG A;  2DJN A;  1X2M A;  3PIP F;  1DGR M;  3VDX A;  1S7A A;  3LSJ A;  3V7S A;  4PJM A;  4I01 A;  4M6V A;  5IYD J;  1I39 A;  5CVV A;  4IX7 A;  1ENH A;  2M8G X;  3E6M A;  1XMK A;  2CWE A;  3KP6 A;  4LG3 A;  3KEQ A;  3NWT A;  3RQ4 A;  2LMD A;  5LGN A;  5DYM A;  3FKI J;  5KCM A;  1A6I A;  4AVP A;  1OFC X;  4A6E A;  3HSR A;  1OCC H;  3ZPL A;  2D1H A;  1MJA A;  3ECO A;  5BMZ A;  1YW7 A;  2E71 A;  4E7K A;  1MBF A;  1T95 A;  1PUF A;  1IAW A;  2HOA A;  5M5X J;  2JRM A;  2QYO A;  4OWR B;  2HXI A;  4RGS A;  3T8R A;  3I64 A;  3C2G A;  5K5Q A;  4O3M A;  5ILV A;  3RTR A;  4ABZ A;  2KIQ A;  3HOX J;  2E19 A;  4ON0 A;  1A04 A;  2LVS A;  4GDF A;  3VFZ A;  5LEK A;  3DPT A;  2Y75 A;  4YIR X;  2E36 A;  5DEQ A;  2QA4 I;  3E6B A;  1IV8 A;  3BP8 A;  1FYL A;  3DPU A;  2EK5 A;  2Q1Z B;  4B4C A;  2R7V A;  1REP C;  1XG1 A;  4BDY A;  3OYN A;  2RGV A;  1Z6R A;  1PUE E;  4AYB A; 
#chains in the Genus database with same CATH homology
 1VQL I;  1FOX A;  3PIO F;  1VQ7 I;  3CCQ I;  3G4S I;  1YHQ I;  2OTJ I;  3PIP F;  5JVG F;  1ACI A;  2NXN B;  5GAD J;  3I56 I;  3CCV I;  4IO9 F;  1VQ8 I;  3CC7 I;  3CCE I;  4V19 K;  3DLL F;  5DM7 F;  2E34 A;  3G71 I;  3CF5 F;  4IOC F;  1QA6 A;  2OTL I;  3CC4 I;  5DM6 F;  3J7Y J;  3CCL I;  1YIJ I;  1S72 I;  1VQ6 I;  1HC8 A;  2ZJQ F;  2E36 A;  2QA4 I;  4IOA F;  1FOY A;  1VQO I;  1YIT I;  3I55 I;  1VQK I;  1VQN I;  3CD6 I;  2H8W A;  2FOW A;  3CME I;  1YJ9 I;  1VQM I;  2JQ7 A;  3CCS I;  3CCU I;  1VQP I;  3J7Z I;  4UY8 I;  5GAG J;  2K3F A;  1YI2 I;  2ZJP F;  1FOW A;  3CMA I;  1YJN I;  1Y39 A;  1VQ5 I;  2E35 A;  2QEX I;  2ZJR F;  3CCJ I;  3CC2 I;  3CCM I;  1YJW I;  5GAH J;  3CJT B;  1MMS A;  3CCR I;  1VQ4 I;  1VQ9 I;  3G6E I;  5GAE J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...