3KP7A

Staphylococcus epidermidis tcar (apo form)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
140
Chain Sequence
MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
molecule tags Transcription regulator
total genus 54
structure length 140
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp7A00
3ZN0A 3LWFA 1O3RA 1TLHB 4G7OF 3I0TA 3KZZA 1TTYA 4AWXB 1IN4A 2OZUA 3R0AA 2YX7A 1S7OA 4A0XA 1FBSA 1TNSA 5L3GA 5FFZA 4WX9A 2AXLA 1ON2A 4HV5A 3TQNA 1QZZA 2OBPA 4HQEA 3GYHX 2D45A 1L3LA 3OV8A 1RNLA 3KEOA 4H0EA 4EM2A 2JPCA 3BROA 4LJZF 4HV6A 2JRTA 2Y48A 4PCQA 1TQMA 3DPTA 3MFKA 3CTAA 2O0YA 2EA4A 2CG4A 2W24A 4LFUA 1T0FA 1T6SA 2W57A 1WQ2A 3E6BA 1XSXA 1KYWA 3FXRA 4N9HA 2W25A 2EFQA 2HZTA 3QRFF 1FPQA 5FD6A 3F3XA 2Y0MA 4A5MA 2PFBA 2W85A 4RAYA 2VONA 3QP5A 2B0LA 1HBXG 2DLLA 1JGSA 5D5VB 3Q9SA 4M9SA 4MTEA 2XAFA 4PZJA 5HS9A 1SAXA 1BIAA 3PQJA 2K4BA 1BBYA 1RUNA 1TW2A 3MQ0A 3BY6A 3CO6C 3G3ZA 5H6RA 1J59A 4HF1A 1K7AA 3TDZC 4AVPA 4EJWA 3TO6A 1OYIA 5LLQA 1G3WA 4UVCA 5DUKA 3GFJA 1BM9A 1UB9A 4LMYA 4IRIA 4HLYA 4OIOF 1XDSA 2GAUA 2P4WA 3DEUA 4ENNA 4A0ZA 4HDUA 2BE5F 4AIJA 4P55A 3ERED 1R22A 4Q48A 1XGMA 1UHMA 4M6XA 2YX4A 3ZPLA 2QM3A 2HS5A 4EVIA 1YO5C 2Y75A 4Q5SF 4I02A 3RIRA 2ESNA 2C6YA 4EQQA 2L01A 2RDPA 3GUDA 1OYYA 3F8CA 2Q8KA 4XLNF 4KFCA 4YIFA 2HQRA 3HHHA 2NRAC 1XN7A 1IXRC 3ZMZA 4L0YB 2K27A 1J2XA 1SMTA 2ZJ2A 5JFRA 3HHGA 1HKTA 4NQWA 1FC3A 5LRSA 1HW1A 4RGRA 4WXCA 3IC7A 1H0MA 4UV8A 4KYWA 2YSRA 3ABUA 2XHKA 1X3UA 4G7ZF 1ZLKA 1QZYA 4G94A 1FLIA 2UZKA 4A2UA 3L9FA 3WODF 5JVTA 1WRJA 4NHJA 2RNJA 1LEAA 1LDDA 2VBZA 2L54A 1RUOA 4LGWA 3DXJF 4PGGA 2BGCA 5F1RA 2FXAA 2RVCA 2MD5A 1Z91A 3FHZA 2CO5A 3HRTA 1R58A 2BEOA 2G7HA 4CHUA 5BPIA 2IJLA 3KFWX 3WTVC 1G3TA 1WKMA 2GA2A 4WWCA 2AS5F 3DV8A 3F23A 3F8BA 2OQGA 4KMFA 2CQKA 3BWGA 1BN5A 5F6FA 4GO1A 1P4XA 3FXQA 2V6CA 4KNYA 1R5GA 2RC4A 3ISPA 2ISYA 3L2CA 2UXXA 3V7CA 1F9NA 4EV0A 4I98B 2EV6A 2EJRA 2STWA 1YYVA 3BJAA 4GCVA 2DK5A 2E7XA 3EDPA 3FM3A 1KU7A 4MQ9F 2F5FA 5A2QK 3GFLA 5ICFA 2H94A 2XROA 4GGGA 1IRFA 2XASA 1S3JA 4KUMA 5L3CA 3DKWA 3SZPA 1DPUA 5CJ9A 1KU3A 1ZRFA 1MJBA 3WGIA 1OPCA 2P7CB 1LJ9A 3VB2A 5D5XB 4BYYA 1LQ1A 1I1GA 3KP4A 1K78A 4UXNA 1KGSA 1XSVA 1OMIA 2BYVE 2XAJA 4L9JA 3KCCA 3EETA 5LGTA 5FLXK 2QQAA 1ZARA 3U9GA 2F5EA 3TKYA 5CVRA 3O6BB 1GVJA 1UHWA 1U5TA 4KN7X 3GFMA 2IT0A 4XRFA 5BMZA 4A5NA 4M73A 3GX4X 4UVAA 3D5LA 2RV8A 5BPDA 4OOIA 3C1DA 3DFGA 3MAJA 1FOKA 4TV7A 1GXQA 4ON0A 2HOEA 1QBJA 1STZA 4EJUA 1G3SA 2KIFA 2IA0A 3QPTA 3CDHA 4LG0B 1EH8A 2Q2EA 2EV0A 2VBWA 3FXUA 1ZLJA 3TGNA 4CGZA 3WTYC 1E2XA 2WWYA 2QENA 1FYLA 1REPC 4M71A 3N4MA 3HRUA 2VN2A 2GXBA 4BH9A 3I5UA 5LGUA 2IP2A 3E6DA 1LDJA 5EEGA 5ED4A 3T5XA 4U0VA 3BPVA 4A6DA 4HX7A 2LNBA 2KIMA 1R36A 1SD7A 3ZMSA 1YLFA 3GEZA 1KU9A 1YTYA 1J7KA 2DQRA 4WXHA 1LNWA 1E17A 1QO0D 4HX4A 3WTWC 4PDKA 5HOOA 1SFEA 2M45A 4BNCA 4L9TA 2VE9A 4M74A 2ZNZA 5AIPA 4LLLA 3HTSB 3WE2A 1BC7C 4KA4A 1P92A 2VBXA 2GIVA 2FBHA 3HRMA 1BOAA 3AAFA 2DPDA 4RGSA 1HKSA 3F8NA 3C7JA 3FZVA 3IHUA 1HKQA 6PAXA 5IT3A 1HSJA 5LEJA 1W7PD 5L3EA 2EWNA 3HUGA 5HDGA 5LBQA 5BS6A 2ACJA 1GHCA 1XCVA 1JHFA 1S6LA 1U6GA 2STTA 4IF4A 3RPUA 4EM0B 3KLOA 3V8KA 3K2ZA 1GXPA 4F7ZA 4RB0A 4G8XA 4JK1X 2A61A 3T0YA 4BHPA 3K69A 4KIBA 2MLKA 3LSTA 3JTHA 4YFXF 5D6FA 2P6TA 1FX7A 2EFOA 3C18A 1PDNC 1FY7A 3I4PA 5L3BA 2VOPA 3LAJA 3RJPA 2PMHA 2ZMEA 1ZG3A 1IXSB 3NEUA 5DCMA 4K2EA 4L9VA 2HTSA 1Z7UA 2ETHA 2V1UA 3R61A 4JBAA 2FMLA 2XRNA 1YW9A 1IRGA 3ML6A 3U2RA 5D8LB 3LFKA 1F5TA 4HW0A 3RPQA 2LDUA 5CVUA 1IXCA 1IW7F 3EQLF 2O61A 2W84A 2XUBA 1DPRA 3M1EA 2XVCA 5E18F 3LA7A 3L09A 4KICA 4A6EA 3QAHA 2CGPA 1FBQA 4P9FA 1YS6A 4FX4A 3L7WA 1ZAOA 3BJOA 1B6AA 3JW4A 4HF0A 3HIFA 3J81Z 1FP2A 5DUIA 3K1NA 1WWXA 3S2WA 2OU2A 4ETSA 2IA1A 3MEXA 4CO8A 3COAC 3RYPA 2L3DA 4L0ZB 4CZZA 3V7RA 4S04A 5E8IA 4HDVA 3BZ6A 3GF2A 2ZCWA 5BOXA 2J5PA 2YR2A 4EJTA 3HSFA 5F64A 3E6CC 1ZREA 2DFIA 3BOQA 2Z99A 3K1MA 1XSDA 2VOOA 1FBUA 1T98A 1K78B 4HF2A 4E70A 3P9KA 4IRGA 3ZP5A 3R4KA 1D5VA 1RI7A 4G6QA 2XV4S 2ELHA 3R0JA 4EM1A 3SFZA 1U5TC 2H27A 3KP3A 4OINF 2VC1A 1J0RA 2LF8A 1ULYA 3I53A 3KP2A 1YFHA 2V79A 2KJBA 2NYXA 1RIOH 2FBKA 2QVOA 3LAPA 1HSTA 2PQ8A 1YW8A 1A04A 3QU3A 4CYDA 3O2PE 1G6NA 1WSUA 2FEZA 1S29A 5E1ZB 1R1VA 5ILSA 1XGSA 5AIQA 5HS7A 2HDCA 1C0WA 2E7WA 1IF1A 2P6SA 3GWZA 2KJCA 3E5XA 2D2WA 3HSRA 1FT9A 5CVVA 2V1DA 3I71A 3KE2A 4M9ZA 3ZMDA 2A68F 2M30A 2H6BA 3LQRA 3WTTC 4ZZLA 3Q9VA 3GVAA 1U78A 4I7HA 4EMSA 1R5HA 2Z9OA 3O3KA 2P5VA 1J5YA 3R60A 5D5WB 4FX0A 1DP7P 4U7BA 1P4WA 3B02A 2P5LC 2JZYA 3ULQB 4WCGA 1O57A 3L00A 2H6CA 2HEOA 2HTJA 4I01A 4R79A 3SZTA 4ESJA 2QBYA 1XGOA 3KEQA 5E1WA 3RYRA 2HFHA 2FF4A 4GYIA 3TO9A 4M72A 5JHUA 1R23A 3ZQ7A 3K0LA 5IT9K 4RGUA 1D8JA 3JSOA 5DCFA 4LLNA 3E5UA 1ZN2A 3KZYA 1F4KA 4IRHA 3HOTA 2NS0A 1CF7A 5LHHA 1TNTA 2DK8A 4FT8A 3LQQA 2OZ6A 2RQPA 4O6JA 4WK8F 1IAWA 2K86A 1B4AA 1U8RA 1SFUA 3E5QA 2G7UA 3TDUC 1G4DA 4AIKA 4YG2F 2XKPA 4FHTA 2VXZA 3SQNA 4Y15A 2FA5A 4EGYA 5TJJA 2F5DA 2BV6A 3EYIA 4I2OA 5FGMA 3V8LA 2GXGA 3VFZA 1FYMA 3P9CA 1QGPA 3ELKA 1Z6TA 2R7FA 4ZYDA 3J7AO 2OD5A 1L0OC 4IPAA 2PJPA 2EV5A 1ZGAA 2GWRA 2ZXJA 2A07F 2EK5A 3IL2A 2FQ3A 1I5ZA 2ZMEB 1Z1DA 4KMUX 3OOPA 5DCMB 4IJAA 2IPQX 3HYIA 3R6SA 4ENKA 3ZN1A 4MHGA 4UVBA 1I1SA 1T38A 3F72A 5CVJA 1MD0A 2PLYA 4IHTA 2O6GE 4IHSA 1S7AA 3W6KB 3F8FA 1O3SA 2IA2A 2A6EF 1OYWA 2QYOA 2Z33A 3BP8A 4QLCU 1EV7A 2A5YB 5CLSA 2HGCA 5FB2A 3ECHA 4ESFA 2XAHA 2JT1A 4YFKF 2RKHA 5LRRA 4MEXF 1RZ4A 4I09A 3DP7A 4QWQA 4LK1F 1SD6A 3EYYA 3J80K 4OIPF 4LK0F 3V8JA 5KVRA 4XLPF 3IRQA 2ISZA 4DNCA 3KP6A 4BXUA 4MTDA 1B9MA 2P5KA 3MCZA 3RDIA 3WTUC 2HR3A 2MH2A 3FMSA 1I6XA 2ZBKA 5K5RA 2EFNA 1Z05A 3C3WA 4PGHA 5A2QZ 4P96A 4A0YA 4HYEA 3VOEA 5ILVA 3WGGA 5E20A 3H3ZA 3QPHA 2FU4A 2M8EA 3NRVA 1DDNA 4G6DA 2G9WA 1I27A 1W5TA 5D4SA 3IWFA 1KU2A 1IN6A 2DI3A 2PG4A 1LB2A 4CXFA 2WV0A 3M8FA 2CW0F 1USSA 1D8KA 4AD9A 2DU9A 1ZRCA 1XGNA 3K9TA 2YPRA 2DAOA 1BC8C 2QQBA 1AWCA 3FMQA 1LEBA 3D0SA 1WI9A 1O7FA 4HX8A 3T8RA 4N9IA 1G3YA 5FLXZ 1USTA 3ECOA 5DD4A 3GLXA 2PI0A 3JTGA 1Z9CA 1ONVA 3NQOA 3H3UA 1TW3A 1SFXA 4OMYA 5JI6A 4G9YA 5H20A 3LA3A 3E3VA 5BQTA 3I59A 4LD5A 1P6RA 3SHFA 3H92A 1OKRA 4R8HA 5FD5A 5HLHA 3J80Z 4OIQF 3ABTA 5JR3A 3G73A 2O03A 5K1YA 4CDGA 4P5OA 1YS7A 2MH9A 3RKYA 2R7DA 4S05A 4M6YA 2PMUA 4HLXA 1YIOA 4Q4ZF 3Q5FA 2K4JA 1R00A 5LHIA 2LSOA 4KN4X 4BHBA 2CYYA 2WTEA 2FNAA 2DW4A 4HAMA 2VE8A 3QP6A 4RS8A 3FF5A 1KQ0A 1UCRA 3TO7A 3WTSC 4L9NA 1FWZA 2ESHA 3CUQA 3M9AA 1UFMA 1R1UA 1MJ9A 3IWZA 2QBYB 3WTZA 3QU6A 3FM5A 3I64A 1EH7A 3V4GA 2BBYA 4YIIA 1FYKA 2M1BA 1B9NA 2HYFA 1LVAA 1XB4A 1NHAA 2H09A 1KA8A 2COMA 5ERIA 2NNYA 1HW2A 2EA2A 1HQCA 3REOA 5FO5A 1ODDA 1J9IA 1CF7B 2FBIA 4AIHA 3WGHA 3TOBA 4A12A 3FWEA 2LF7A 2E1NA 4DQ2A 5LGNA 1TBXA 2OAZA 2DTRA 1BJAA 5KK1A 1ZGJA 2VODA 4ZH4F 1BI0A 2XIGA 4GYGA 2KKOA 1CGPA 3M8EA 3MWMA 3PQKA 3JAMK 1PP7U 1YG2A 2EFWA 5HDKA 3WU1B 4M9XA 4CICA 4MEYF 1BI2A 2V9VA 4LLGF 2MA3A 3ROUA 1F1ZA 1ZG5A 4OMZA 4MGRA 1MZBA 1J75A 3F6VA 4G7HF 2VBYA 1IZ1A 1ZYRF 2UWMA 5D4RA 2L4MA 3F22A 1H9GA 4LG0A 4RB3C 1MDMA 1ON1A 2FSWA 4XBFA 1W7PA 5DYMA 2HWVA 3GXOA 3WE3A 3GFIA 4O3MA 4U7DA 1ZHFA 2JSCA 4I0AA 5ICCA 2EFPA 2PBIA 4Y17A 2R3SA 1U5TB 3CO7C 2XAGA 3M7GA 2DBBA 2FOKA 5HS8A 1V4RA 2HQNA 1LDKB 2MBFA 1FNNA 3JAMZ 3P9IA 2NAZA 1K79A 1KQ8A 1MGTA 2JPBA 2V1XA 2FE3A 3E97A 1T39A 4ZYGA 2A69F 2MLGA 3HRSA 3I58A 1ZRDA 3B73A 2JTVA 1FZPB 3F6OA 1XCBA 2D1HA 3VEPA 3F21A 4EJOA 5L3DA 2O3FA 2VT2A 1PUEE 1U3EM 3ZMVA 4KIGA 3FMRA 2M87A 3WTXC 2KIUA 5CVIA 1BI1A 5E1XA 5HDNA 1AOYA 1YW7A 3P7NA 2L02A 3TOAA 4GXOA 1B59A 1TQPA 4WF2A 3VODA 4MQVA 3SXYA 1O3TA 1ZH5A 4ZYHA 2QZ8A 3T8TA 4L5IA 2ADUA 5TRDA 2MC3A 3U1DA 5H6QA 4I0BA 4RB2C 3RKWA 1KQ9A 3RI4A 3E6MA 3DF8A 2L4AA 2OA4A 2YU3A 3I59B 1O3QA 5D8KB 1Q1HA 5E17F 1SD5A 2UXNA 2KRFA 1JXSA 2FNPA 4LB6B 5FFXA 1QNTA 4Z2YA 2ZFWA 4IVNA 4RGXA 4HQMA 4ENMA 4D0PA 2EB7A 2Z5UA 3HTUA 5LHGA 2QQ9A 2TDXA 2OQRA 1DUXC 1OR7A 3N97A 3BJ6A 1H9TA 4HOBA 1ZG1A 1FP1D 2J5OA 3JSPA 4HZFA 2Q0OA 2K02A 3I54A 1BI3A 5D6EA 3KP7A 2QUFA 3RTRA 3MZHA 1IN5A 1P4AA 4WXDA 3CUQC 3HOSA 3CUQB 4U88A 5ICEA 5AONA 4RB1A 2DPUA 2ZNYA 4O5VA 4IXAA 1B1BA 1FSHA 4UNOA 2D1VA 5J6XA 3ZMUA 2RGVA 4BHCA 4BQAA 2LKPA 1D3YA 2HYGD 3MZYA 2VT3A 3WU0A 5CYVA 3GW2A 2QWWA 1EH6A 4ESBA 1SD4A 1Y0UA 5IT9Z 4Q47A 5K5OA 1MKMA 4ZYEA 1PP8F 3F8MA 4OU0A 2Z3YA 3LA2A 1W4MA 4Y13A 5L3FA 1SMYF 2IVMA 2PEXA 4ENJA 1VTNC 2X0LA 4KT5C 4KIFA 1QQIA 5HLIA 5J8FA 1P2FA 2A3SA 4JQFA 2XKOA 3EUHA 1YQAA 4XSXF 2O8XA 4RAZA 4OIRF 5HLGA 4XSZF 3CLOA 4EJVA 2WC2A 4U0WA 3BDDA 2E1CA 2HKOA 3PFIA 4R1HA 1Z6RA 3KLNA 1JHHA 2IRFG 2PN6A 4UUVA 3FX3A 3HSEA 3GO5A 3V7SA 2HKXA 1TQIA 1XMKA 2CWEA 2FRHA 3CJNA 5ILUA 1S8NA 1V3FA 4ZZDA 1R1TA 5DDGA 3T1BA 1QPMA 1MDMB 2K7LA 4HA8A 3KETA 1W7PB 1FSEA 2NNNA 5HVQC 2DT5A 1U2WA 1R7JA 4L18B 1O7LA 1HW5A 3DPLC 4EGZA 2VC0A 2XAQA 5J8CA 1XD7A 2IW5A 2RN7A 4L5JA 5D5UB 3IKTA 5K5QA 4HBLA 4LB5A 2F5CA 1IN8A 3IRRA 2M5WA 2GA1A 3CUOA 4YFNF 4UHTA 2QLZA 4MNUA 1KYZA 3GZ6A 2GZWA 3KP5A 1JE8A 2FMYA 2DO7A 4KDPA 5LEKA 5E8GA 4B09A 4U0YA 3ZMTA 4BAYA 1MJAA 1XDUA 1XMAA 2ZKZA 1IUYA 1IN7A 1W5SA 3BPXA 2A6HF 2CSOA 3GZ5A 1BIBA 2DQLA 2P7VB 2F2EA 4N0BA 4UV9A 2GQQA 5EEHA 3WG9A 4NB5A 3W6JB 2CFXA 1K6OA 1HXDA 3QOPA 5DD8A 4B8XA 2P8TA 4ASNA 5ICGA 2ZO4A 5DV5A 2X4HA 3IKVA 1T2KA 2XGXA 5DEQA 3J81K 3K1PA 3RKXA 3DQVC 4P9UA
chains in the Genus database with same CATH superfamily
2KRHA 1G8XA 3ZN0A 4BUPA 1N78A 3GTQJ 5C4XJ 2EINH 3RQIA 1ETYA 2EH3A 3LWFA 3X2QH 2X6WA 2JRMA 4XM3A 1O3RA 1YJ9I 1V55H 1TLHB 4G7OF 3I0TA 3S2DJ 3KZZA 1JKOC 1TTYA 4AWXB 3OYDA 2CUZA 1IN4A 2OZUA 3R0AA 1A35A 2YX7A 3K4LA 1S7OA 4A0XA 3OYKA 3QODA 1FBSA 1TNSA 5L3GA 2EZIA 4XORA 3JRIA 5FFZA 3B6AA 3OIPA 1MSFC 4WX9A 3CC7I 2PJRA 4AYBN 2AXLA 1ON2A 3J7ZI 3B6CA 1TZLA 1RRJA 4HV5A 2CQQA 3TQNA 3IH4A 4B3AA 1QZZA 2OBPA 5KAIC 4QTRA 2NXNB 1TWHJ 4HQEA 4RLFA 1TC3C 5HLTA 3GYHX 2D45A 2KPMA 3A2KA 3DKXA 1FTTA 1S5LC 1L3LA 3OV8A 2IGMA 1ERDA 1RNLA 1XTAA 4D9JA 5FRMA 2BZTA 3CP8A 1A6QA 2EZHA 1OR7C 4BE1A 2NOJB 3KEOA 3GTOJ 4H0EA 4EM2A 2JPCA 4CYCB 3BROA 2JK3A 2K9QA 4LJZF 4HV6A 2JRTA 3LSRA 1UMQA 3BG5A 3HPGA 2QSFX 3K2AA 3N05A 2Y48A 4X1EA 4PCQA 4UUTA 2X48A 5EZGA 1TQMA 3FXMA 1T56A 3DPTA 5F0HA 3MFKA 4D7MA 1VQ8I 3CTAA 4F3QA 3ZQLA 2O0YA 2EA4A 3DU5A 2CG4A 3BQZA 5GAGJ 2K9NA 2W24A 4LFUA 1T0FA 1JKPC 1T6SA 2W57A 1WQ2A 3E6BA 2WAQA 1XSXA 4A3BJ 1KYWA 4PJ0C 3FXRA 4N9HA 2W25A 2DFHA 1YRNA 2EFQA 2HZTA 5F04A 3QRFF 4ZYAA 1FPQA 1HF0A 4JX5A 5FD6A 3F3XA 4JX4A 2Y0MA 2H1KA 4A5MA 1WJAA 2PFBA 2W85A 4RAYA 2VONA 2FD5A 3QP5A 2B0LA 1HBXG 2DLLA 1JGSA 2N8GA 5D5VB 3QYEA 3OYJA 3Q9SA 4M9SA 1OFCX 2DOFA 4MTEA 2XAFA 2M34A 4PZJA 5HS9A 2M4GA 1BIAA 1SAXA 1WJBA 3PQJA 2K4BA 2Z16A 1BBYA 4II3A 2DA6A 1OCPA 1RUNA 3D1NI 2ECCA 1TW2A 1UHSA 3MQ0A 3BY6A 1GVDA 3CO6C 4ZTFA 3G3ZA 4BKXA 3FDYA 2LRDA 5H6RA 1J59A 4HF1A 4B4CA 1K7AA 4U87A 3TDZC 2V26A 3NARA 4AVPA 4EJWA 1I3QJ 1QHGA 3TO6A 1AA7A 1OYIA 2OUMA 2PMZA 5LLQA 1G3WA 4UVCA 5DUKA 3BLYA 3GFJA 1BM9A 4MFEA 1UB9A 4CCLA 3CZ6A 4LMYA 3H35A 4IRIA 4HLYA 2BW3A 3HGYA 4OIOF 5IY5H 1XDSA 2GAUA 2P4WA 3DEUA 3OYMA 4ENNA 4A0ZA 4HDUA 3LSJA 2VQCA 2BE5F 4AIJA 4ZDOA 3K70D 1A5JA 4P55A 3ERED 1R22A 2GM4A 5FKNA 4Q48A 3L2WA 2XGDA 1XGMA 2ECBA 1APLC 1UHMA 4M6XA 2HNHA 4F55A 2YX4A 1T08B 1DGWY 4JP0A 4FASD 2QM3A 2YS9A 2QEXI 1YIJI 3ZPLA 4E4HA 2HS5A 2VL8A 3HG9A 4EVIA 1YO5C 2Y75A 4Q5SF 1WJFA 3I3LA 4I02A 3F9KA 3RIRA 2ESNA 2LBFA 2C6YA 1V5FA 4EQQA 2L01A 3A0BC 1WZ2A 2RDPA 1LFPA 3CCVI 3GUDA 4XRSG 1OYYA 5IOYA 3F8CA 3LSKA 2Q8KA 5JLXA 2O7OA 4XLNF 4KFCA 3OL4A 4YIFA 3KPHA 2HQRA 3HHHA 2NRAC 1XN7A 1HA8A 1IXRC 2WB1N 3ZMZA 4L0YB 5CPRB 2K27A 1J2XA 1SMTA 2ZJ2A 5JFRA 3HHGA 2JA8J 1WHUA 1HKTA 4NQWA 1LFBA 1FC3A 2VJ5A 4C9YA 5LRSA 1HW1A 2M4KA 4BEHA 1JUMA 4RGRA 4WXCA 3IC7A 1H0MA 3S2HJ 4UV8A 4DGWB 2JA2A 2Q1ZB 2X6XA 4KYWA 2G0EA 2YSRA 2OF7A 3ABUA 1SFKA 2XHKA 1R5ID 1X3UA 1D0ZA 4G7ZF 3QYBA 1ZLKA 1QZYA 4C2MJ 4G94A 1ZR2A 1FLIA 1UG2A 2UZKA 4A2UA 3TMOA 3GZNB 3L9FA 2R5YB 2DODA 3WODF 5JVTA 1WRJA 4NHJA 2RNJA 2DJIA 1LEAA 1LDDA 3MKYB 1X1CA 2VBZA 4UY8I 5GAHJ 1RETA 1HCRA 2L54A 1RUOA 5GPAA 1Z67A 2HDWA 4LGWA 1ETOA 3DXJF 4PGGA 2BGCA 1ZQ3P 5F1RA 4C3JJ 3I55I 1RC9A 2FXAA 2M8GX 3W3CA 3L2QA 4II2A 2RVCA 2W4SA 2MD5A 1Z91A 4NC8A 3FHZA 3QPSA 1Y8RB 2CO5A 2P81A 3HRTA 2MSYA 2EZKA 3H9JA 1VQ6I 1Z77A 4QIWN 1R58A 4Y7NJ 4AU7A 3BG9A 2HOSA 2BEOA 1VQPI 2BVMA 2G7HA 4A3GJ 2XF7A 1PYVA 1K61A 1G2HA 2R0QC 2HPMA 4CHUA 2LC2A 5BPIA 2VASA 2IJLA 3KFWX 1RR8C 3WTVC 1XC5A 1G3TA 1WKMA 2GA2A 2KISA 3Q0WA 5IYDJ 4IHXA 4WWCA 4XKWA 2AS5F 3DV8A 3F23A 3F8BA 2OQGA 3AG3H 4KMFA 2CQKA 3BWGA 3HKZN 1BN5A 5F6FA 4GO1A 3CQZJ 3G2BA 2WAFA 2WY8Q 3D5SC 1P4XA 4OWRB 1X4PA 2NS7A 3FXQA 2W82A 3BR0A 2V6CA 3DPUA 5IP6A 4KNYA 1N75A 1R5GA 1T8IA 1FOWA 2RC4A 3ISPA 1MNMC 4M6VA 2ISYA 2L7KA 2E2HJ 3L2CA 1DGRM 3CMYA 3HOVJ 4A69C 2MD0A 2UXXA 3V7CA 1F9NA 4EV0A 1U9OA 3CMMA 4I98B 2EV6A 1HOMA 2EJRA 4ZC3A 2STWA 4BBRJ 4E7LA 1YYVA 3BJAA 4GCVA 5TISC 4GRIA 2DK5A 2E7XA 3ZGKA 5CQEA 2XDVA 2HXOA 4UB8C 3EDPA 3FM3A 4BL0B 1KU7A 4D5CA 1TWAJ 3G1LA 2V1NA 4MQ9F 5B5EC 1ETKA 2F5FA 3GFLA 5A2QK 3CJQB 1Y0NA 2H94A 5ICFA 5J1RA 2XROA 2XGCA 2HOTA 4GGGA 1LVKA 1IRFA 2XASA 1S3JA 4KUMA 1JJ6C 5L3CA 3W2WA 1AKHA 3DKWA 2RQQA 2E35A 5FRNA 3HOUJ 1W36C 3SEZA 3SZPA 1DPUA 1WFXA 5CJ9A 5K7ZA 1KU3A 1ZRFA 1MJBA 2PJRB 3WGIA 1OPCA 2P7CB 1LJ9A 2CQXA 2PX9A 3VB2A 5D5XB 4BYYA 1LQ1A 1I1GA 1H88C 3KP4A 1GV5A 3HOYJ 1K78A 4A3LJ 4UXNA 2X1DA 1KGSA 1XSVA 1OMIA 2BYVE 2MW8A 2XAJA 3TP3A 4MIMA 1GV2A 2DMUA 3BR6A 3KCCA 4L9JA 1RKTA 2LFBA 2JA5J 3EETA 3FISA 5LGTA 3H36A 4MFDA 5FLXK 2QQAA 1ZARA 2HQ5A 3BG7A 5J40A 3U9GA 2F5EA 2CU7A 4IZZA 3BR1A 3TKYA 5CVRA 3O6BB 1GVJA 3S8PA 1UHWA 2KIQA 1U5TA 4KN7X 3VPRA 3GFMA 3G6EI 2EQRA 2IT0A 2H1LA 4E7IA 4XRFA 5BMZA 1X4OA 4A5NA 4M73A 4RAGA 3GX4X 4BGDA 4UVAA 3D5LA 4XKBA 2RV8A 3KYDB 5BPDA 4OOIA 3C1DA 4CH7A 1T0FC 1E3PA 2GLOA 3DFGA 4XL9A 3MAJA 2JVGA 1FOKA 2ZXHA 1GXQA 4TV7A 4ON0A 1JUSA 2Y30A 3JRGA 2HOEA 1YRNB 4AUXA 1QBJA 2DFFA 1STZA 4EJUA 3LSMA 1G3SA 2O5RA 4XKVA 4J01A 2R92J 2KIFA 3HJEA 2IA0A 3QPTA 1J09A 2M7BA 1PUFA 3CDHA 4CCMA 4LG0B 4RMNA 1EH8A 3CESA 2E60A 2Q2EA 2EV0A 4DBQA 2JQ7A 2BVLA 2VBWA 3FXUA 2R7ZJ 1YHQI 1ZLJA 3TGNA 4CGZA 1I6HJ 5IPAA 3WTYC 1E2XA 2WWYA 5TGTA 2KMUA 3LFUA 2QENA 4ZTJA 1FYLA 1REPC 1NTCA 1IC8A 4M71A 3N4MA 1WI3A 1LFUP 3HRUA 2VN2A 4BJ6C 1QA6A 2DMQA 4D1QA 2GXBA 1TWGJ 2XC7A 4BH9A 3I5UA 3OYEA 4PSXA 5LGUA 2IP2A 1Y6IA 3E6DA 4CCNA 1LDJA 5B66C 4A3MJ 5EEGA 5ED4A 1CQTA 2I10A 4LIUA 4FETA 2QSHX 3T5XA 4U0VA 2XB0X 3BPVA 1IV8A 2A5WA 4A6DA 4HX7A 3FBNB 3CCSI 4PJMA 3F0CA 1X1AA 2LNBA 2KIMA 1R36A 1SD7A 3ZMSA 1YLFA 1JTYA 2VQHA 3GEZA 4IOAF 5E3MA 1KU9A 1YTYA 2DFEA 1A6IA 4UB6C 1J7KA 2ZJPF 2DQRA 2BW3B 4WXHA 1LNWA 1E17A 3GBGA 1QO0D 2M2EA 4HX4A 2ID6A 3QOEA 3WTWC 1OCRH 1WJEA 2TRTA 4PDKA 5HOOA 1SFEA 2M45A 4BNCA 4L9TA 2VE9A 4M74A 2ZNZA 5AIPA 4LLLA 1QHHD 2X6YA 3HTSB 3WE2A 1BC7C 4KA4A 1P92A 4A93J 2VBXA 3HEFA 2GIVA 4BQOA 1BR4A 3S1MJ 2FBHA 3HRMA 3HC7A 1BOAA 3AAFA 2QGUA 1ZGWA 2DPDA 4RGSA 1HKSA 3F8NA 3C7JA 3FZVA 3IHUA 3SEQA 3AG4H 3JRCA 3H0GJ 3GTPJ 3W6VA 1VI0A 1HKQA 6PAXA 3BG6A 5IT3A 1HSJA 5LEJA 2LBFB 1W7PD 5L3EA 4AYBA 2Z1DA 2KQRA 2EWNA 3HUGA 1ITYA 5KNLA 5HDGA 5CQGA 2TCTA 4ZDLA 2M9HA 5LBQA 1SANA 5BS6A 2ACJA 3RCOA 1WJCA 2H8WA 1GHCA 1JHFA 1JTXA 1XCVA 3JR9A 3A4CA 1S6LA 4S0HB 1U6GA 4DOZA 2EIKH 3PL8A 5IYCJ 2STTA 4IF4A 1QRYA 5GPCA 3RPUA 2VPRA 4EM0B 2LKXA 1X3WB 4NQWB 1RPWA 3KLOA 4BEHB 3V8KA 1VZ0A 3K2ZA 1GXPA 3OSGA 1BR2A 2GOMA 4F7ZA 2IGNA 3SJMA 4RB0A 2XSDC 4G8XA 4JK1X 2A61A 3T0YA 5JHFA 4BHPA 4ZDPA 2VIXA 1X58A 3EUAA 5GADJ 3OSFA 3K69A 4KIBA 4IO9F 2MLKA 2F4IA 3LSTA 3JTHA 4YFXF 5D6FA 2P6TA 2CS3A 2DDAA 1FX7A 2EFOA 3C18A 1PDNC 1FY7A 3H5NA 3MKLA 3GTGJ 4BXXJ 1D5YA 2ZJQF 3I4PA 1KZHA 5L3BA 2F5VA 2VOPA 2GBYA 2LY1A 1FTZA 2COBA 3LAJA 4J00A 3RJPA 3PJRA 2JWTA 2PMHA 2ZMEA 1ZG3A 1IXSB 1VQNI 3NEUA 4W97A 5DCMA 4K2EA 4L9VA 2HTSA 2R7WA 1Z7UA 3CDIA 2ETHA 2F4OB 4F93B 2V1UA 2ELKA 3R61A 2FMLA 2AXTC 4JBAA 5GP9A 2XRNA 3TW7A 2B9SA 1YW9A 1IRGA 3ML6A 3U2RA 1W0TA 3OOUA 5D8LB 3LFKA 1G59A 3GTKJ 1F5TA 3FKIJ 1SC7A 3A1YA 2OV7A 4HW0A 2LDUA 5CVUA 1IXCA 1RR7A 3RPQA 1H8AC 3S16J 1IW7F 1Z7LA 2NVTJ 3EQLF 3Q3SA 2O61A 2NVQJ 4CUGA 2W84A 3IP4B 2XUBA 2BY3A 1DPRA 2XAUA 3M1EA 2XVCA 5E18F 3LA7A 3L2UA 1ZKGA 2DT7B 4Y3OA 1E0EA 3L09A 4HNVA 4KICA 3HGGA 2JN6A 4A6EA 3OR1C 3QAHA 4NNJA 2CGPA 4E7JA 1FBQA 2RAEA 3G1MA 4P9FA 1YS6A 4FX4A 3L7WA 3CJRB 1DU0A 5EG0B 1T33A 2HDDA 2LLKA 1ZAOA 3OL3A 3BJOA 2ZC2A 1AHDP 1B6AA 3JW4A 4HF0A 3ZQCA 3HIFA 4IQ4A 2JA6J 4XRMA 3I4MJ 2KRCA 3ZQQA 3BR3A 1AU7A 4E7SA 3J81Z 1FP2A 5M3MJ 4PJNA 5DUIA 3K1NA 1WWXA 4RM3A 2QCOA 3S2WA 1OCCH 2OU2A 3ZXSA 2QA4I 4I76A 2IA1A 4ETSA 2LP0A 2AO9A 3OS0A 3MEXA 4CO8A 3COAC 1EJ9A 3DKYA 3CCLI 4J19A 3RYPA 4DZJA 2K5CA 2L3DA 5K7FA 4C3HJ 4DYCA 1OCZH 3CCMI 2VLAA 4L0ZB 2XRLA 2FOWA 4KISA 3PIPF 4CZZA 3V7RA 4S04A 4BDZA 1X2MA 5E8IA 1X1BA 2X1CA 5IYBJ 4HDVA 2EZLA 4DYRA 3BZ6A 2R5ZA 3GF2A 3MKZA 2ZCWA 5BOXA 2YUSA 1AKHB 3UKGA 2KDZA 4A3IJ 4BQQA 2M0CA 2J5PA 2LG4A 1W5CC 5FLMJ 2YR2A 4EJTA 3HSFA 3MN2A 1F36A 5F64A 2L9NA 3E6CC 1ZREA 1D1CA 2Z2SB 2R7VA 2DFIA 3BOQA 4D5FA 1WCMJ 2Z99A 2L9VA 3K1MA 1WPKA 1XSDA 2VOOA 2IGOA 1FBUA 1T98A 3W2VA 1B72A 2HPIA 5EZHA 5IOZA 1K78B 4HF2A 2DDBA 4E70A 3P9KA 4IRGA 2VQGA 3ZP5A 2ZSHB 3R4KA 3GTJJ 3MD2A 1D5VA 3PUBA 3H3VK 1RI7A 5HODA 1VQOI 1V54H 2DA7A 4G6QA 2XF6A 2XV4S 2ELHA 3R0JA 4EM1A 1MH3A 2E34A 2XPVA 3SFZA 3D5RC 1U5TC 2H27A 3SYTA 5JVGF 1PVEA 3KP3A 1YI2I 4OINF 3BTIA 2VC1A 3OYHA 4FE7A 1J0RA 2LF8A 4UUSA 1ULYA 3OMYA 3JRHA 3I53A 3KP2A 1YFHA 2R7SA 2WY7Q 4DYQA 2V79A 2KJBA 2NYXA 1RIOH 2FBKA 2QVOA 3LSHA 1X3ZB 3LAPA 2VI6A 1HSTA 1X1DA 5J1YA 2PQ8A 1YW8A 1IUFA 1A04A 3QU3A 3ZOBA 4CYDA 1D1BA 1JJ8C 2LK2A 1Y8QB 3G4SI 3O2PE 3M3YJ 1G6NA 1WSUA 2FEZA 3VWBA 1SAUA 3LMMA 1S29A 5E1ZB 1R1VA 4M3EA 1NG6A 2X6OA 1XGSA 2Y2ZA 5AIQA 5ILSA 5HS7A 3UR3C 2HDCA 1C0WA 2E7WA 5DM7F 1IF1A 4XQFA 1PUFB 4XICA 3VYSB 2P6SA 3GWZA 3CC4I 2KJCA 3OS1A 3E5XA 2D2WA 2Q2EB 2DXIA 1MNDA 4HEA2 2NS8A 4F91B 9ANTA 3HSRA 3GLLA 1FT9A 5CVVA 2V1DA 3I71A 3KE2A 3I4NJ 4M9ZA 2LKSA 3ZMDA 2A68F 2M30A 2H6BA 1I3AA 1TT5B 3LQRA 2KZVA 4NUBA 3WTTC 1R71A 3HDDA 1LE8A 4ZZLA 3Q9VA 4B47A 3GVAA 5J4VA 3TBIA 5M3FJ 1U78A 2M0MA 4I7HA 4EMSA 1R5HA 2HVQA 2Z9OA 3O3KA 4PK4A 4IHVA 2P5VA 1J5YA 3R60A 2JUGA 5D5WB 2FX0A 4FX0A 1DP7P 2IS1A 4U7BA 1P4WA 3B02A 1M1EB 4M3FA 2X85A 2P5LC 2JZYA 3ULQB 4WCGA 1O57A 4BQNA 5M5WJ 3L00A 4KITB 3S1NJ 2H6CA 2CV1A 4ABZA 1Y56A 2HEOA 2HTJA 2R7XA 4I01A 4AVZA 3BR2A 2K3FA 4R79A 3SZTA 4ESJA 2QBYA 4A3DJ 2L9SA 1I50J 4IHWA 1XGOA 1O4XA 3KEQA 3BCBA 5E1WA 3RYRA 2HFHA 3OS2A 2FF4A 4GYIA 3TO9A 4M72A 5BNGA 5JHUA 4IHYA 1R23A 5FKMA 1SVMA 3ZQ7A 3K0LA 5IT9K 1UZCA 4RGUA 4XOPA 1D8JA 3JSOA 3ZCOA 5DCFA 4LLNA 3E5UA 2GIZA 3H5RA 1ZN2A 3V42A 2NVXJ 2DJNA 2O9LA 3KZYA 1F4KA 4IRHA 4BE2A 2KFDA 4Y33A 3HOTA 3PO2J 2DMTA 2NS0A 1CF7A 1MSEC 3KX2A 2A6TA 2CH0A 2EIMH 5LHHA 1TNTA 2UV1A 2DK8A 4FT8A 4PJJA 4RA2A 1TWCJ 2M3AA 3HUGB 3LQQA 3IH3A 4DIQA 5EF6A 2OZ6A 3CD6I 2R4GA 3SDBA 2WADA 1TT0A 4QPOA 1FOXA 2HU9A 4X6AJ 2RQPA 1ACIA 4O6JA 4WK8F 2ZXWH 3IH2A 4DJAA 2VXDA 1IAWA 1WGXA 2K3PA 2K86A 3DU6A 1B4AA 1U8RA 1SFUA 4BS9A 1ZR4A 5FKOA 2KDOA 3E5QA 1HDPA 5KCMA 2R7QA 2G7UA 3TP0A 2HI3A 3TDUC 1G4DA 4AIKA 4YG2F 2XKPA 3E7LA 3O8HA 4CYCA 4BACA 4E7KA 4FHTA 2VXZA 3DBHB 1JT6A 1S72I 3SQNA 4Y15A 3K4NA 2FA5A 2Y69H 3AG1H 1R9TJ 5F27A 4EGYA 2DA1A 3ABLH 3BC8A 1UAAA 1IDYA 5TJJA 2F5DA 2BV6A 1U8BA 4E7HA 2QKMB 4HNUA 3EYIA 4I2OA 5FGMA 3V8LA 2GXGA 4XLAA 2DA5A 3VFZA 3BCAA 2ICWG 2CRGA 2ZJRF 1FYMA 3P9CA 4B44A 1N25A 1QGPA 4IOCF 3ELKA 5DTDA 3FXOA 1Z6TA 2R7FA 4ZYDA 3J7AO 2OD5A 1L0OC 4IPAA 2PJPA 2HVSA 4GDFA 2EV5A 2DYRH 3DTKA 4ITVA 3RQ4A 1ZGAA 1X2NA 5B1BH 2L7MP 2GWRA 3BTJA 2ZXJA 2A07F 2EK5A 3IL2A 3JREA 3JCUC 2ZMEC 2FQ3A 1I5ZA 2ZMEB 1Z1DA 4KMUX 3H1CA 3OOPA 5DCMB 2OTLI 2RREA 4IJAA 5IP9J 4HSTA 2IPQX 3HYIA 2VJ4A 3R6SA 4ENKA 3ZN1A 4MHGA 4UVBA 1I1SA 1BW5A 1T38A 3F72A 2R7OA 5CVJA 1MD0A 4FQGA 2PLYA 4DW6A 3FKJA 4IHTA 2O6GE 4IHSA 4I6ZA 1S7AA 3W6KB 3F8FA 3U1KA 1O3SA 2IA2A 1YX5A 3ESWB 2A6EF 1OYWA 2QYOA 3E1SA 5KAFC 2Z33A 3S3OA 1NH3A 3FHNA 3DWLE 2VUMJ 3BP8A 3IAS2 4QLCU 1EV7A 2QF7A 2A5YB 3PNVA 4D7NA 5CLSA 2HGCA 1GLNA 5FB2A 3ECHA 1FMVA 4ESFA 2XAHA 2JT1A 2BXYA 4XK4A 2RKHA 4YFKF 5LRRA 1IV6A 1NG7A 4MEXF 1RZ4A 1IG7A 4I09A 2ZFUA 2WA0A 1I39A 5FROA 2XB5A 3NWTA 3DP7A 4QWQA 4IKFA 4LK1F 4IQJA 2LY2A 4BU2A 1SD6A 3EYYA 3G1OA 1LUJB 5B1AH 3J80K 4BDYA 1YITI 3OIQA 3K7AJ 1JKQC 4OIPF 3MKWB 2FUG2 4LK0F 3V8JA 3O8GA 5KVRA 3HZJA 4XLPF 2IS2A 3IRQA 2ISZA 1RKWA 4DNCA 3KP6A 4BXUA 4MTDA 1B9MA 1VQMI 2MGQA 2P5KA 3MCZA 2CQNA 3RDIA 1SEUA 3QQAA 3WTUC 2HR3A 1MMDA 2F48A 2UUZA 2MH2A 4CCOA 3FMSA 1W36D 1I6XA 2ZBKA 1WH5A 5K5RA 2EFNA 2OCEA 1Z05A 3SDGA 3C3WA 2R7UA 4EEFG 4PGHA 1MBEA 2L5QA 2MG4A 5A2QZ 4P96A 4FTHA 4A0YA 2MYSA 4HYEA 1BR1A 4CCKA 4XNFA 3VOEA 5ILVA 3WGGA 5E20A 3PNYA 3DLAA 3H3ZA 2XSJC 4XLFA 3QPHA 2FU4A 2M8EA 3NRVA 1B8IA 1DDNA 4XR6A 2JMWA 2G9WA 4G6DA 2EBIA 1PJRA 3PO3J 1I27A 1W5TA 1XMXA 3IWFA 5D4SA 3GTMJ 1QU3A 1KU2A 1IN6A 2DI3A 2PG4A 2VB6A 2VKDA 5FKKA 1LB2A 4CXFA 3LSGA 2WV0A 2FQ4A 2CW0F 3M8FA 1USSA 1FOYA 3KZIC 1D8KA 2E71A 4HSRA 4AD9A 2CUJA 2DU9A 3TEDA 1ZRCA 1XGNA 1B72B 1GDTA 2V7FA 3K9TA 2YPRA 2DAOA 3FBIB 1BC8C 2QQBA 1AWCA 3FMQA 3L1PA 4XLEA 1LKXA 3HOZJ 1LEBA 3D0SA 3CDLA 1WI9A 1O7FA 3A01A 4HX8A 3T8RA 4N9IA 1FMWA 1G3YA 5FLXZ 2HVRA 2IS6A 1USTA 3ECOA 5DD4A 3K4KA 3GLXA 2XGEA 3MZ8A 3OIOA 2PI0A 1Z0XA 2NOGA 3JTGA 1HC8A 1Z9CA 1ONVA 3NQOA 4OAYA 3H3UA 1TW3A 3HL2A 1D1AA 5F0FA 1NK2P 1SFXA 4OMYA 1W1WE 2GOXB 5JI6A 4G9YA 2VJIA 1P7IA 5H20A 4CA0A 4UUSB 1D0XA 3LA3A 3E3VA 5BQTA 5B3SH 3I59A 4LD5A 1Z3YA 1IO2A 1P6RA 3SHFA 3H92A 1OKRA 4R8HA 5FD5A 1OLTA 5HLHA 1JT0A 3J80Z 4OIQF 3ABTA 3DTEA 5JR3A 1VQLI 2L0KA 4PFOA 1JUPA 2K9LA 3CF5F 2DA2A 2CW8A 2XPUA 5FLVA 3DCFA 1E3HA 3G73A 3BTLA 3ERMA 2O03A 2YU9J 2Y0SN 5K1YA 1Y1VJ 4CDGA 1FJLA 4NC7A 4P5OA 1VF9A 1ORKA 1YS7A 2MH9A 3RKYA 2HQAA 2R7DA 4M6YA 4S05A 2D5VA 1FEXA 2PMUA 4HLXA 1YIOA 2LREA 2MFZA 2NVYJ 1U9NA 3ONQA 4Q4ZF 3Q5FA 2ELJA 2K4JA 1R00A 5LHIA 1YX3A 3HBLA 2LSOA 4KN4X 4BHBA 1LE8B 3KYLA 1JI8A 3PSFA 4NBQA 2CYYA 2WTEA 2FNAA 3BZCA 4RLQA 4RDUA 2DW4A 4HAMA 4BJ5C 4BY1J 2VE8A 3Q0VA 4BXFA 3QP6A 4RS8A 3M07A 3RKQA 3FF5A 1KQ0A 3ZR8X 1UCRA 3I9V2 3TO7A 3WTSC 4HG2A 2ME0A 3KEYA 4L9NA 1FWZA 2ESHA 3CUQA 4BY7J 3M9AA 1UFMA 2XPWA 2ZSIB 1R1UA 3BT9A 1T95A 1MJ9A 3IWZA 3VYTB 4M3DA 4V19K 2QBYB 5EGOA 3WTZA 3QU6A 4XIDA 2VJJA 1XX5A 3FM5A 3I64A 2CW7A 1EH7A 1X19A 3V4GA 2BBYA 3VYUB 2V9KA 1MBGA 3BG3A 4YIIA 1FYKA 5J3LA 2M1BA 1B9NA 2HYFA 4X0GA 1LVAA 1XB4A 1NHAA 3MVPA 3VSKA 2BOLA 2H09A 1KA8A 1ZK8A 2COMA 5ERIA 2L7FP 3DBRB 2NNYA 1BW6A 3EPZA 1HW2A 2CV0A 2EA2A 2LR8A 1HQCA 3REOA 2XF5A 5FO5A 3U21A 1ODDA 2B7EA 3A0HC 3L2VA 1FIAA 1J9IA 1CF7B 3PFYA 3RZOJ 2FBIA 3H9GA 4AIHA 3WGHA 3TOBA 4IX7A 3E0JB 4A12A 3FWEA 2LF7A 3CJTB 2E1NA 4DQ2A 5LGNA 1TBXA 2OAZA 1IJWC 2K9MA 3LOCA 3K4CA 5C3EJ 2X51A 2DTRA 1BJAA 5KK1A 5E3OA 3DBLB 1ZGJA 1TWFJ 4E7ZA 2VODA 3UNGC 3CCEI 4ZH4F 1R4NB 1ETQA 5HNHA 1QVTA 1BI0A 3C2GA 2XIGA 2Y31A 4GYGA 5F08A 1K4TA 3OYFA 4HPQA 2KKOA 1CGPA 3M8EA 3MWMA 3PQKA 2DA3A 1YE9A 2NVUB 2GXAA 3JAMK 3J7AY 5IP7J 1PP7U 1MW7A 1YG2A 4B1RA 3OR2C 3PM1A 4QSHA 4C2TA 2EFWA 5HDKA 2LH9A 3WU1B 4XONA 3HM5A 3TW6A 4M9XA 4V2GA 1S9HA 2FJ1A 1VQ4I 4CICA 4MEYF 1BI2A 1Y39A 2V9VA 4LLGF 2MA3A 3K10A 3ROUA 1F1ZA 1ZG5A 3ZQGA 4OMZA 1UJ8A 4MGRA 3ASNH 4DZPA 3FXLA 1MZBA 3OYNA 1VQKI 1J75A 3F6VA 5FJ8J 4MO7A 4G7HF 2VBYA 1P9QC 3K70C 1IZ1A 2MC4A 1HLVA 1ZYRF 2OC6A 3DEWA 2UWMA 5D4RA 2L4MA 1FIPA 3GMEA 2CMPA 3F22A 2IAIA 1H9GA 2CFOA 1ENHA 4LG0A 3EUKL 3HB9A 1ZTRA 4PSWA 2WB1A 2IGKA 4RB3C 2BY0A 2CUFA 2OCCH 4IEJA 1MDMA 1ON1A 2FSWA 4XBFA 2HYJA 5C44J 4OAZA 1BA5A 2OPTA 2QSGX 1W7PA 5DYMA 1SFOJ 1Z21A 4Y4RA 2HWVA 3GXOA 1IRZA 3WE3A 3RSNA 1YJNI 2DTZA 3GFIA 3CCQI 2X9DA 4O3MA 4U7DA 4LIVA 3WG7H 1VFCA 1ZHFA 2JSCA 2BHZA 4Y52J 4I0AA 4C2UA 3HOWJ 3FIWA 5ICCA 2WV1A 2EFPA 2PBIA 4Y17A 2R3SA 4CCJA 3CCJI 1U5TB 1K6YA 3EUHC 3CO7C 2JVHA 2R7RA 2XAGA 2AHQA 3M7GA 2DBBA 2FOKA 5HS8A 1V4RA 2HQNA 3ZRGA 1LDKB 2MBFA 1FNNA 2DT6A 4C3IJ 3JAMZ 3CLQA 3JRFA 2E1OA 1XG1A 3P9IA 1K83J 4RM2A 4W1UA 2H8RA 4XN0A 5CKTA 2VPLA 3L2RA 1ETXA 2NAZA 2KL4A 1K79A 2WAQN 5JLWA 1DQUA 1MIJA 3JRDA 1KQ8A 1MGTA 2JPBA 2V1XA 3S1RJ 1YOVB 2FE3A 3E97A 5GTHC 2DMNA 1T39A 1BL0A 1XS9A 4ZYGA 2A69F 5J1UA 2MLGA 3FXKA 2HXIA 2LD5A 3AFHA 4GFBA 3HRSA 1Y1WJ 2LY9A 1X1PA 3I58A 3AL0C 2CQ7A 3JRBA 2LOOA 3K6GA 4JOMA 5H2FC 1ZRDA 3B73A 3AL0B 2Y9YA 2JSPA 2JTVA 2LMDA 1FZPB 2MABA 5DS9A 3F6OA 1XCBA 2D1HA 3VEPA 3A02A 3ZQIA 4EJOA 3F21A 5L3DA 3VSLA 2O3FA 4LG3A 4XMYA 2VT2A 1PUEE 1U3EM 1HDDC 3OYBA 3ZMVA 5KHDA 4KIGA 3FMRA 1WVRA 2L2OA 2F4MB 2A05A 2M7AA 2M87A 1B8IB 3WTXC 2ZB9A 3DTIA 2JA7J 4BBSJ 3HKZA 2KIUA 5HNFA 5CVIA 1BI1A 5E1XA 2W1OA 5HDNA 1AOYA 3M1CA 1YW7A 3P7NA 2L02A 3TOAA 4GXOA 3A03A 3WHBA 4XRSA 3IV5A 5DM6F 1B59A 1VNDA 1TQPA 4C30A 5EEAA 4WF2A 3VODA 1U0JA 4MQVA 2PMZN 2L7ZA 3S14J 3SXYA 4CZCA 1O3TA 3ZQHA 3A01B 4NDLA 2BY1A 1ZH5A 2JUCA 2CJJA 4F52A 2KZGA 4ZYHA 2BHYA 2QZ8A 5EJCA 3T8TA 4L5IA 4KT6A 1WJDA 1Q1VA 4IL6C 2ADUA 5TRDA 2MC3A 2LYCA 3U1DA 4A3EJ 5H6QA 4I0BA 3H9QA 4RBOA 4RB2C 4V2FA 1IDZA 3RKWA 1KQ9A 3P5JA 3RI4A 3E6MA 3DF8A 2L4AA 2OA4A 2YU3A 3I59B 3PNTA 3CCRI 5D8KB 1O3QA 1OJLA 3PUFA 1Q1HA 2JJ7A 5E17F 4LOCA 2K85A 1SD5A 2UXNA 2KRFA 4BJTA 3CMEI 2FNPA 1JXSA 4LB6B 5FFXA 1XPXA 1QNTA 4Z2YA 2ZFWA 3HXLA 1MBFA 3SFIA 4IVNA 4RGXA 2K40A 4HQMA 2E1MC 4ENMA 2E1MB 3CC2I 4D0PA 1VQ7I 4PJLA 2EB7A 2Z5UA 1R49A 3HTUA 2RNGA 5LHGA 2L9RA 2QQ9A 1UELB 2TDXA 3FK7A 3SZGA 2B63J 2OQRA 4EATA 2EILH 1JKRC 1DUXC 1OR7A 3N97A 5E3LA 1WJ5A 1V5EA 3BJ6A 1H9TA 4HOBA 4PFPA 4AIDA 1ZG1A 1FP1D 2J5OA 3JSPA 4HZFA 2Q0OA 2K02A 3I54A 2E19A 3OYGA 1BI3A 1R6RA 4KJZA 5D6EA 3KP7A 4B3XA 5EG0A 2QUFA 3RTRA 3MZHA 4DBRA 1IN5A 1P4AA 4WXDA 3CUQC 3QWLA 3HOSA 3CUQB 4U88A 5ICEA 3CCYA 2KP6A 5AONA 4RB1A 2DPUA 1OCOH 2ZNYA 4O5VA 4IXAA 5F1JA 1B1BA 1FSHA 3NWSA 3G71I 5EGOB 4JYKA 4UNOA 2ID3A 2D1VA 5GAEJ 4HNTA 1QVUA 5J6XA 5M5XJ 3H0DA 3GTLJ 3ZMUA 4ZJZA 2RGVA 4BHCA 1Z3XA 1WH7A 4BQAA 2HZDA 2BXZA 1D3YA 2LKPA 2VKHA 1P7JA 3FK6A 4CSWA 5J47A 3AKZA 3S15J 2V9PA 2AQEA 5F0CA 4F92B 2HYGD 4L5EA 3MZYA 2VT3A 3WU0A 5CYVA 3GW2A 2QWWA 1N77A 1EH6A 2LTPA 2QQ8A 4ESBA 4N4NB 1SD4A 4XN3A 4ANJA 3QYFA 2Y9ZA 1Y0UA 1MBHA 1MNEA 5IT9Z 4Q47A 3K4BA 4XLCA 3ABMH 5K5OA 1MKMA 4ZYEA 1PP8F 3CF2A 2EPFA 3F8MA 3J7YJ 3OYLA 4OU0A 2Z3YA 3LA2A 3KYCB 3RPUD 1W4MA 3TL4X 1IGNA 4Y13A 5L3FA 1SMYF 2I8DA 2IVMA 2PEXA 3LNQA 4ENJA 2X0LA 4KT5C 1MH4A 1VTNC 4KIFA 2DCEA 2E2JJ 4A3KJ 5LFAA 5GTIC 1QQIA 3AG2H 5HLIA 3C2HA 3BR5A 2O8KA 3VYRB 5J8FA 1P2FA 2A3SA 4JQFA 1ZELA 2XKOA 1DP3A 2X1EA 2KLOA 3EUHA 1YQAA 4XSXF 2O8XA 4RAZA 4OIRF 1QZEA 5HLGA 4XSZF 3HOXJ 1LPQA 4LITA 1H89C 1D0YA 3IUOA 5J4YA 3CLOA 5FKLA 4EJVA 2W48A 3K4JA 2WC2A 1GUUA 4U0WA 3BDDA 3VDXA 2E1CA 3W2AA 2ZXIA 4B48A 5LD2C 3H5AA 2HKOA 3PFIA 3S17J 1MMSA 4HRIA 2DN0A 1MBKA 4R1HA 2DOEA 3WHCA 3IAM2 4Z6YA 4YRVA 4H4KC 3BTCA 4A3FJ 2WAEA 1Z6RA 4FCYA 3KLNA 1JHHA 1UG0A 2IRFG 2I5UA 3PIOF 1IRXA 2PN6A 2HOAA 3FX3A 4QPQA 3CMAI 3HSEA 4UUVA 2E36A 4AC0A 2KT0A 3WU2C 2W7NA 3GO5A 2DOAA 3S1QJ 4G6TB 3ZQFA 3MMYB 3V7SA 2Y0SA 2HKXA 5EDNA 2R5ZB 1MMNA 1TQIA 1XMKA 2CWEA 2IEKA 3OYIA 3CJNA 2FRHA 5EYRA 5ILUA 1S8NA 2VQLA 1V3FA 4ZZDA 1R1TA 5DDGA 3ASOH 2R7TA 3T1BA 1QPMA 4FISA 4XLHA 1ETVA 1A36A 1R4MB 2P0WA 1MDMB 4E6KG 2K7LA 2QKLB 1A31A 4FE4A 3OYCA 4HA8A 3KIOA 3KETA 1W7PB 1FSEA 2NNNA 1TP4A 2ME6A 4G12A 5HVQC 5E3NA 1YJWI 1EF4A 2DT5A 4P1WA 2IBDA 4XKCA 3M4OJ 5M5YJ 3K4MA 1U2WA 1R7JA 4L18B 1O7LA 1SVOA 4B43A 1HW5A 3DPLC 4EGZA 2VC0A 4BE0A 3ABKH 2VKVA 2WBMA 3QPLA 1SVLA 1EKEA 2XAQA 2V4JC 5J8CA 2CV2A 1XD7A 1MBJA 1F43A 2R93J 2IW5A 4M3GA 2RN7A 4L5JA 5D5UB 2OJED 3IKTA 3RZDJ 2CUEA 3DEEA 2W00A 5K5QA 1OISA 1KONA 2V6EA 1VQ5I 3OYAA 4HBLA 2R5YA 4LB5A 4JX6A 1S7EA 2F5CA 1IN8A 3IRRA 2M5WA 2GA1A 3CUOA 4YFNF 4UHTA 2KHMA 2QLZA 4MNUA 1KYZA 1TL8A 3GZ6A 2GZWA 3KP5A 1QPIA 1JE8A 1BJZA 3LSIA 2DA4A 3M8JA 3OY9A 1GT0C 3S3MA 1DU6A 2DYSH 2FMYA 2IXSA 4N4OB 5C4JJ 3Q0UA 4PUSA 2DO7A 3CCUI 1VQ9I 2E2IJ 4KDPA 2BY2A 5E8GA 5LEKA 1POGA 5K7HA 3FXJA 3DLLF 4B09A 4U0YA 3NAUA 3S3NA 3PSIA 3ZMTA 4BAYA 1MJAA 4A3CJ 4I99C 1XDUA 1XMAA 2ZKZA 3BZKA 1RESA 2E5NA 1IUYA 2E5ZA 4YELA 1IN7A 1W5SA 4RAFA 4YEJA 3BPXA 2A6HF 2CSOA 3GZ5A 1BIBA 1W0UA 2DQLA 2K9SA 2P7VB 2F2EA 4N0BA 1E3OC 2IS4A 1NK3P 2LVSA 2AQFA 2OTJI 4AM3A 4UV9A 2GQQA 5EEHA 1MMAA 3WG9A 1JGGA 4M3BA 4NB5A 4XOTA 2CFXA 3W6JB 3I56I 1K6OA 1HXDA 3C2BA 3QOPA 5DD8A 2F6CA 4B8XA 3S93A 2VKEA 3LL7A 3OWTA 3GCMA 4NC6A 2P8TA 3CP2A 4ASNA 5ICGA 5E79C 2DMPA 2ZO4A 4MLOA 1K4SA 5DV5A 3S32A 2X4HA 4YIRX 1OCTC 3IKVA 1T2KA 1OQYA 2XGXA 5DEQA 4A3JJ 1EA3A 3J81K 3HPHA 1ETWA 3K1PA 3BQYA 3RKXA 2EIJH 1V5GA 3LSPA 1BOBA 3DQVC 3JRAA 1MMGA 4P9UA
chains in the Genus database with same CATH topology
3ZN0A 3LWFA 1O3RA 1TLHB 4G7OF 3I0TA 3KZZA 1TTYA 4AWXB 1IN4A 2OZUA 3R0AA 2YX7A 1S7OA 4A0XA 1FBSA 1TNSA 5L3GA 5FFZA 4WX9A 2AXLA 1ON2A 4HV5A 3TQNA 1QZZA 2OBPA 4HQEA 3GYHX 2D45A 1L3LA 3OV8A 1RNLA 3KEOA 4H0EA 4EM2A 2JPCA 3BROA 4LJZF 4HV6A 2JRTA 2Y48A 4PCQA 1TQMA 3DPTA 3MFKA 3CTAA 2O0YA 2EA4A 2CG4A 2W24A 4LFUA 1T0FA 1T6SA 2W57A 1WQ2A 3E6BA 1XSXA 1KYWA 3FXRA 4N9HA 2W25A 2EFQA 2HZTA 3QRFF 1FPQA 5FD6A 3F3XA 2Y0MA 4A5MA 2PFBA 2W85A 4RAYA 2VONA 3QP5A 2B0LA 1HBXG 2DLLA 1JGSA 5D5VB 3Q9SA 4M9SA 4MTEA 2XAFA 4PZJA 5HS9A 1SAXA 1BIAA 3PQJA 2K4BA 1BBYA 1RUNA 1TW2A 3MQ0A 3BY6A 3CO6C 3G3ZA 5H6RA 1J59A 4HF1A 1K7AA 3TDZC 4AVPA 4EJWA 3TO6A 1OYIA 5LLQA 1G3WA 4UVCA 5DUKA 3GFJA 1BM9A 1UB9A 4LMYA 4IRIA 4HLYA 4OIOF 1XDSA 2GAUA 2P4WA 3DEUA 4ENNA 4A0ZA 4HDUA 2BE5F 4AIJA 4P55A 3ERED 1R22A 4Q48A 1XGMA 1UHMA 4M6XA 2YX4A 3ZPLA 2QM3A 2HS5A 4EVIA 1YO5C 2Y75A 4Q5SF 4I02A 3RIRA 2ESNA 2C6YA 4EQQA 2L01A 2RDPA 3GUDA 1OYYA 3F8CA 2Q8KA 4XLNF 4KFCA 4YIFA 2HQRA 3HHHA 2NRAC 1XN7A 1IXRC 3ZMZA 4L0YB 2K27A 1J2XA 1SMTA 2ZJ2A 5JFRA 3HHGA 1HKTA 4NQWA 1FC3A 5LRSA 1HW1A 4RGRA 4WXCA 3IC7A 1H0MA 4UV8A 4KYWA 2YSRA 3ABUA 2XHKA 1X3UA 4G7ZF 1ZLKA 1QZYA 4G94A 1FLIA 2UZKA 4A2UA 3L9FA 3WODF 5JVTA 1WRJA 4NHJA 2RNJA 1LEAA 1LDDA 2VBZA 2L54A 1RUOA 4LGWA 3DXJF 4PGGA 2BGCA 5F1RA 2FXAA 2RVCA 2MD5A 1Z91A 3FHZA 2CO5A 3HRTA 1R58A 2BEOA 2G7HA 4CHUA 5BPIA 2IJLA 3KFWX 3WTVC 1G3TA 1WKMA 2GA2A 4WWCA 2AS5F 3DV8A 3F23A 3F8BA 2OQGA 4KMFA 2CQKA 3BWGA 1BN5A 5F6FA 4GO1A 1P4XA 3FXQA 2V6CA 4KNYA 1R5GA 2RC4A 3ISPA 2ISYA 3L2CA 2UXXA 3V7CA 1F9NA 4EV0A 4I98B 2EV6A 2EJRA 2STWA 1YYVA 3BJAA 4GCVA 2DK5A 2E7XA 3EDPA 3FM3A 1KU7A 4MQ9F 2F5FA 5A2QK 3GFLA 5ICFA 2H94A 2XROA 4GGGA 1IRFA 2XASA 1S3JA 4KUMA 5L3CA 3DKWA 3SZPA 1DPUA 5CJ9A 1KU3A 1ZRFA 1MJBA 3WGIA 1OPCA 2P7CB 1LJ9A 3VB2A 5D5XB 4BYYA 1LQ1A 1I1GA 3KP4A 1K78A 4UXNA 1KGSA 1XSVA 1OMIA 2BYVE 2XAJA 4L9JA 3KCCA 3EETA 5LGTA 5FLXK 2QQAA 1ZARA 3U9GA 2F5EA 3TKYA 5CVRA 3O6BB 1GVJA 1UHWA 1U5TA 4KN7X 3GFMA 2IT0A 4XRFA 5BMZA 4A5NA 4M73A 3GX4X 4UVAA 3D5LA 2RV8A 5BPDA 4OOIA 3C1DA 3DFGA 3MAJA 1FOKA 4TV7A 1GXQA 4ON0A 2HOEA 1QBJA 1STZA 4EJUA 1G3SA 2KIFA 2IA0A 3QPTA 3CDHA 4LG0B 1EH8A 2Q2EA 2EV0A 2VBWA 3FXUA 1ZLJA 3TGNA 4CGZA 3WTYC 1E2XA 2WWYA 2QENA 1FYLA 1REPC 4M71A 3N4MA 3HRUA 2VN2A 2GXBA 4BH9A 3I5UA 5LGUA 2IP2A 3E6DA 1LDJA 5EEGA 5ED4A 3T5XA 4U0VA 3BPVA 4A6DA 4HX7A 2LNBA 2KIMA 1R36A 1SD7A 3ZMSA 1YLFA 3GEZA 1KU9A 1YTYA 1J7KA 2DQRA 4WXHA 1LNWA 1E17A 1QO0D 4HX4A 3WTWC 4PDKA 5HOOA 1SFEA 2M45A 4BNCA 4L9TA 2VE9A 4M74A 2ZNZA 5AIPA 4LLLA 3HTSB 3WE2A 1BC7C 4KA4A 1P92A 2VBXA 2GIVA 2FBHA 3HRMA 1BOAA 3AAFA 2DPDA 4RGSA 1HKSA 3F8NA 3C7JA 3FZVA 3IHUA 1HKQA 6PAXA 5IT3A 1HSJA 5LEJA 1W7PD 5L3EA 2EWNA 3HUGA 5HDGA 5LBQA 5BS6A 2ACJA 1GHCA 1XCVA 1JHFA 1S6LA 1U6GA 2STTA 4IF4A 3RPUA 4EM0B 3KLOA 3V8KA 3K2ZA 1GXPA 4F7ZA 4RB0A 4G8XA 4JK1X 2A61A 3T0YA 4BHPA 3K69A 4KIBA 2MLKA 3LSTA 3JTHA 4YFXF 5D6FA 2P6TA 1FX7A 2EFOA 3C18A 1PDNC 1FY7A 3I4PA 5L3BA 2VOPA 3LAJA 3RJPA 2PMHA 2ZMEA 1ZG3A 1IXSB 3NEUA 5DCMA 4K2EA 4L9VA 2HTSA 1Z7UA 2ETHA 2V1UA 3R61A 4JBAA 2FMLA 2XRNA 1YW9A 1IRGA 3ML6A 3U2RA 5D8LB 3LFKA 1F5TA 4HW0A 3RPQA 2LDUA 5CVUA 1IXCA 1IW7F 3EQLF 2O61A 2W84A 2XUBA 1DPRA 3M1EA 2XVCA 5E18F 3LA7A 3L09A 4KICA 4A6EA 3QAHA 2CGPA 1FBQA 4P9FA 1YS6A 4FX4A 3L7WA 1ZAOA 3BJOA 1B6AA 3JW4A 4HF0A 3HIFA 3J81Z 1FP2A 5DUIA 3K1NA 1WWXA 3S2WA 2OU2A 4ETSA 2IA1A 3MEXA 4CO8A 3COAC 3RYPA 2L3DA 4L0ZB 4CZZA 3V7RA 4S04A 5E8IA 4HDVA 3BZ6A 3GF2A 2ZCWA 5BOXA 2J5PA 2YR2A 4EJTA 3HSFA 5F64A 3E6CC 1ZREA 2DFIA 3BOQA 2Z99A 3K1MA 1XSDA 2VOOA 1FBUA 1T98A 1K78B 4HF2A 4E70A 3P9KA 4IRGA 3ZP5A 3R4KA 1D5VA 1RI7A 4G6QA 2XV4S 2ELHA 3R0JA 4EM1A 3SFZA 1U5TC 2H27A 3KP3A 4OINF 2VC1A 1J0RA 2LF8A 1ULYA 3I53A 3KP2A 1YFHA 2V79A 2KJBA 2NYXA 1RIOH 2FBKA 2QVOA 3LAPA 1HSTA 2PQ8A 1YW8A 1A04A 3QU3A 4CYDA 3O2PE 1G6NA 1WSUA 2FEZA 1S29A 5E1ZB 1R1VA 5ILSA 1XGSA 5AIQA 5HS7A 2HDCA 1C0WA 2E7WA 1IF1A 2P6SA 3GWZA 2KJCA 3E5XA 2D2WA 3HSRA 1FT9A 5CVVA 2V1DA 3I71A 3KE2A 4M9ZA 3ZMDA 2A68F 2M30A 2H6BA 3LQRA 3WTTC 4ZZLA 3Q9VA 3GVAA 1U78A 4I7HA 4EMSA 1R5HA 2Z9OA 3O3KA 2P5VA 1J5YA 3R60A 5D5WB 4FX0A 1DP7P 4U7BA 1P4WA 3B02A 2P5LC 2JZYA 3ULQB 4WCGA 1O57A 3L00A 2H6CA 2HEOA 2HTJA 4I01A 4R79A 3SZTA 4ESJA 2QBYA 1XGOA 3KEQA 5E1WA 3RYRA 2HFHA 2FF4A 4GYIA 3TO9A 4M72A 5JHUA 1R23A 3ZQ7A 3K0LA 5IT9K 4RGUA 1D8JA 3JSOA 5DCFA 4LLNA 3E5UA 1ZN2A 3KZYA 1F4KA 4IRHA 3HOTA 2NS0A 1CF7A 5LHHA 1TNTA 2DK8A 4FT8A 3LQQA 2OZ6A 2RQPA 4O6JA 4WK8F 1IAWA 2K86A 1B4AA 1U8RA 1SFUA 3E5QA 2G7UA 3TDUC 1G4DA 4AIKA 4YG2F 2XKPA 4FHTA 2VXZA 3SQNA 4Y15A 2FA5A 4EGYA 5TJJA 2F5DA 2BV6A 3EYIA 4I2OA 5FGMA 3V8LA 2GXGA 3VFZA 1FYMA 3P9CA 1QGPA 3ELKA 1Z6TA 2R7FA 4ZYDA 3J7AO 2OD5A 1L0OC 4IPAA 2PJPA 2EV5A 1ZGAA 2GWRA 2ZXJA 2A07F 2EK5A 3IL2A 2FQ3A 1I5ZA 2ZMEB 1Z1DA 4KMUX 3OOPA 5DCMB 4IJAA 2IPQX 3HYIA 3R6SA 4ENKA 3ZN1A 4MHGA 4UVBA 1I1SA 1T38A 3F72A 5CVJA 1MD0A 2PLYA 4IHTA 2O6GE 4IHSA 1S7AA 3W6KB 3F8FA 1O3SA 2IA2A 2A6EF 1OYWA 2QYOA 2Z33A 3BP8A 4QLCU 1EV7A 2A5YB 5CLSA 2HGCA 5FB2A 3ECHA 4ESFA 2XAHA 2JT1A 4YFKF 2RKHA 5LRRA 4MEXF 1RZ4A 4I09A 3DP7A 4QWQA 4LK1F 1SD6A 3EYYA 3J80K 4OIPF 4LK0F 3V8JA 5KVRA 4XLPF 3IRQA 2ISZA 4DNCA 3KP6A 4BXUA 4MTDA 1B9MA 2P5KA 3MCZA 3RDIA 3WTUC 2HR3A 2MH2A 3FMSA 1I6XA 2ZBKA 5K5RA 2EFNA 1Z05A 3C3WA 4PGHA 5A2QZ 4P96A 4A0YA 4HYEA 3VOEA 5ILVA 3WGGA 5E20A 3H3ZA 3QPHA 2FU4A 2M8EA 3NRVA 1DDNA 4G6DA 2G9WA 1I27A 1W5TA 5D4SA 3IWFA 1KU2A 1IN6A 2DI3A 2PG4A 1LB2A 4CXFA 2WV0A 3M8FA 2CW0F 1USSA 1D8KA 4AD9A 2DU9A 1ZRCA 1XGNA 3K9TA 2YPRA 2DAOA 1BC8C 2QQBA 1AWCA 3FMQA 1LEBA 3D0SA 1WI9A 1O7FA 4HX8A 3T8RA 4N9IA 1G3YA 5FLXZ 1USTA 3ECOA 5DD4A 3GLXA 2PI0A 3JTGA 1Z9CA 1ONVA 3NQOA 3H3UA 1TW3A 1SFXA 4OMYA 5JI6A 4G9YA 5H20A 3LA3A 3E3VA 5BQTA 3I59A 4LD5A 1P6RA 3SHFA 3H92A 1OKRA 4R8HA 5FD5A 5HLHA 3J80Z 4OIQF 3ABTA 5JR3A 3G73A 2O03A 5K1YA 4CDGA 4P5OA 1YS7A 2MH9A 3RKYA 2R7DA 4S05A 4M6YA 2PMUA 4HLXA 1YIOA 4Q4ZF 3Q5FA 2K4JA 1R00A 5LHIA 2LSOA 4KN4X 4BHBA 2CYYA 2WTEA 2FNAA 2DW4A 4HAMA 2VE8A 3QP6A 4RS8A 3FF5A 1KQ0A 1UCRA 3TO7A 3WTSC 4L9NA 1FWZA 2ESHA 3CUQA 3M9AA 1UFMA 1R1UA 1MJ9A 3IWZA 2QBYB 3WTZA 3QU6A 3FM5A 3I64A 1EH7A 3V4GA 2BBYA 4YIIA 1FYKA 2M1BA 1B9NA 2HYFA 1LVAA 1XB4A 1NHAA 2H09A 1KA8A 2COMA 5ERIA 2NNYA 1HW2A 2EA2A 1HQCA 3REOA 5FO5A 1ODDA 1J9IA 1CF7B 2FBIA 4AIHA 3WGHA 3TOBA 4A12A 3FWEA 2LF7A 2E1NA 4DQ2A 5LGNA 1TBXA 2OAZA 2DTRA 1BJAA 5KK1A 1ZGJA 2VODA 4ZH4F 1BI0A 2XIGA 4GYGA 2KKOA 1CGPA 3M8EA 3MWMA 3PQKA 3JAMK 1PP7U 1YG2A 2EFWA 5HDKA 3WU1B 4M9XA 4CICA 4MEYF 1BI2A 2V9VA 4LLGF 2MA3A 3ROUA 1F1ZA 1ZG5A 4OMZA 4MGRA 1MZBA 1J75A 3F6VA 4G7HF 2VBYA 1IZ1A 1ZYRF 2UWMA 5D4RA 2L4MA 3F22A 1H9GA 4LG0A 4RB3C 1MDMA 1ON1A 2FSWA 4XBFA 1W7PA 5DYMA 2HWVA 3GXOA 3WE3A 3GFIA 4O3MA 4U7DA 1ZHFA 2JSCA 4I0AA 5ICCA 2EFPA 2PBIA 4Y17A 2R3SA 1U5TB 3CO7C 2XAGA 3M7GA 2DBBA 2FOKA 5HS8A 1V4RA 2HQNA 1LDKB 2MBFA 1FNNA 3JAMZ 3P9IA 2NAZA 1K79A 1KQ8A 1MGTA 2JPBA 2V1XA 2FE3A 3E97A 1T39A 4ZYGA 2A69F 2MLGA 3HRSA 3I58A 1ZRDA 3B73A 2JTVA 1FZPB 3F6OA 1XCBA 2D1HA 3VEPA 3F21A 4EJOA 5L3DA 2O3FA 2VT2A 1PUEE 1U3EM 3ZMVA 4KIGA 3FMRA 2M87A 3WTXC 2KIUA 5CVIA 1BI1A 5E1XA 5HDNA 1AOYA 1YW7A 3P7NA 2L02A 3TOAA 4GXOA 1B59A 1TQPA 4WF2A 3VODA 4MQVA 3SXYA 1O3TA 1ZH5A 4ZYHA 2QZ8A 3T8TA 4L5IA 2ADUA 5TRDA 2MC3A 3U1DA 5H6QA 4I0BA 4RB2C 3RKWA 1KQ9A 3RI4A 3E6MA 3DF8A 2L4AA 2OA4A 2YU3A 3I59B 1O3QA 5D8KB 1Q1HA 5E17F 1SD5A 2UXNA 2KRFA 1JXSA 2FNPA 4LB6B 5FFXA 1QNTA 4Z2YA 2ZFWA 4IVNA 4RGXA 4HQMA 4ENMA 4D0PA 2EB7A 2Z5UA 3HTUA 5LHGA 2QQ9A 2TDXA 2OQRA 1DUXC 1OR7A 3N97A 3BJ6A 1H9TA 4HOBA 1ZG1A 1FP1D 2J5OA 3JSPA 4HZFA 2Q0OA 2K02A 3I54A 1BI3A 5D6EA 3KP7A 2QUFA 3RTRA 3MZHA 1IN5A 1P4AA 4WXDA 3CUQC 3HOSA 3CUQB 4U88A 5ICEA 5AONA 4RB1A 2DPUA 2ZNYA 4O5VA 4IXAA 1B1BA 1FSHA 4UNOA 2D1VA 5J6XA 3ZMUA 2RGVA 4BHCA 4BQAA 2LKPA 1D3YA 2HYGD 3MZYA 2VT3A 3WU0A 5CYVA 3GW2A 2QWWA 1EH6A 4ESBA 1SD4A 1Y0UA 5IT9Z 4Q47A 5K5OA 1MKMA 4ZYEA 1PP8F 3F8MA 4OU0A 2Z3YA 3LA2A 1W4MA 4Y13A 5L3FA 1SMYF 2IVMA 2PEXA 4ENJA 1VTNC 2X0LA 4KT5C 4KIFA 1QQIA 5HLIA 5J8FA 1P2FA 2A3SA 4JQFA 2XKOA 3EUHA 1YQAA 4XSXF 2O8XA 4RAZA 4OIRF 5HLGA 4XSZF 3CLOA 4EJVA 2WC2A 4U0WA 3BDDA 2E1CA 2HKOA 3PFIA 4R1HA 1Z6RA 3KLNA 1JHHA 2IRFG 2PN6A 4UUVA 3FX3A 3HSEA 3GO5A 3V7SA 2HKXA 1TQIA 1XMKA 2CWEA 2FRHA 3CJNA 5ILUA 1S8NA 1V3FA 4ZZDA 1R1TA 5DDGA 3T1BA 1QPMA 1MDMB 2K7LA 4HA8A 3KETA 1W7PB 1FSEA 2NNNA 5HVQC 2DT5A 1U2WA 1R7JA 4L18B 1O7LA 1HW5A 3DPLC 4EGZA 2VC0A 2XAQA 5J8CA 1XD7A 2IW5A 2RN7A 4L5JA 5D5UB 3IKTA 5K5QA 4HBLA 4LB5A 2F5CA 1IN8A 3IRRA 2M5WA 2GA1A 3CUOA 4YFNF 4UHTA 2QLZA 4MNUA 1KYZA 3GZ6A 2GZWA 3KP5A 1JE8A 2FMYA 2DO7A 4KDPA 5LEKA 5E8GA 4B09A 4U0YA 3ZMTA 4BAYA 1MJAA 1XDUA 1XMAA 2ZKZA 1IUYA 1IN7A 1W5SA 3BPXA 2A6HF 2CSOA 3GZ5A 1BIBA 2DQLA 2P7VB 2F2EA 4N0BA 4UV9A 2GQQA 5EEHA 3WG9A 4NB5A 3W6JB 2CFXA 1K6OA 1HXDA 3QOPA 5DD8A 4B8XA 2P8TA 4ASNA 5ICGA 2ZO4A 5DV5A 2X4HA 3IKVA 1T2KA 2XGXA 5DEQA 3J81K 3K1PA 3RKXA 3DQVC 4P9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZN0 A;  3LWF A;  1O3R A;  1TLH B;  4G7O F;  3I0T A;  3KZZ A;  1TTY A;  4AWX B;  1IN4 A;  2OZU A;  3R0A A;  2YX7 A;  1S7O A;  4A0X A;  1FBS A;  1TNS A;  5L3G A;  5FFZ A;  4WX9 A;  2AXL A;  1ON2 A;  4HV5 A;  3TQN A;  1QZZ A;  2OBP A;  4HQE A;  3GYH X;  2D45 A;  1L3L A;  3OV8 A;  1RNL A;  3KEO A;  4H0E A;  4EM2 A;  2JPC A;  3BRO A;  4LJZ F;  4HV6 A;  2JRT A;  2Y48 A;  4PCQ A;  1TQM A;  3DPT A;  3MFK A;  3CTA A;  2O0Y A;  2EA4 A;  2CG4 A;  2W24 A;  4LFU A;  1T0F A;  1T6S A;  2W57 A;  1WQ2 A;  3E6B A;  1XSX A;  1KYW A;  3FXR A;  4N9H A;  2W25 A;  2EFQ A;  2HZT A;  3QRF F;  1FPQ A;  5FD6 A;  3F3X A;  2Y0M A;  4A5M A;  2PFB A;  2W85 A;  4RAY A;  2VON A;  3QP5 A;  2B0L A;  1HBX G;  2DLL A;  1JGS A;  5D5V B;  3Q9S A;  4M9S A;  4MTE A;  2XAF A;  4PZJ A;  5HS9 A;  1SAX A;  1BIA A;  3PQJ A;  2K4B A;  1BBY A;  1RUN A;  1TW2 A;  3MQ0 A;  3BY6 A;  3CO6 C;  3G3Z A;  5H6R A;  1J59 A;  4HF1 A;  1K7A A;  3TDZ C;  4AVP A;  4EJW A;  3TO6 A;  1OYI A;  5LLQ A;  1G3W A;  4UVC A;  5DUK A;  3GFJ A;  1BM9 A;  1UB9 A;  4LMY A;  4IRI A;  4HLY A;  4OIO F;  1XDS A;  2GAU A;  2P4W A;  3DEU A;  4ENN A;  4A0Z A;  4HDU A;  2BE5 F;  4AIJ A;  4P55 A;  3ERE D;  1R22 A;  4Q48 A;  1XGM A;  1UHM A;  4M6X A;  2YX4 A;  3ZPL A;  2QM3 A;  2HS5 A;  4EVI A;  1YO5 C;  2Y75 A;  4Q5S F;  4I02 A;  3RIR A;  2ESN A;  2C6Y A;  4EQQ A;  2L01 A;  2RDP A;  3GUD A;  1OYY A;  3F8C A;  2Q8K A;  4XLN F;  4KFC A;  4YIF A;  2HQR A;  3HHH A;  2NRA C;  1XN7 A;  1IXR C;  3ZMZ A;  4L0Y B;  2K27 A;  1J2X A;  1SMT A;  2ZJ2 A;  5JFR A;  3HHG A;  1HKT A;  4NQW A;  1FC3 A;  5LRS A;  1HW1 A;  4RGR A;  4WXC A;  3IC7 A;  1H0M A;  4UV8 A;  4KYW A;  2YSR A;  3ABU A;  2XHK A;  1X3U A;  4G7Z F;  1ZLK A;  1QZY A;  4G94 A;  1FLI A;  2UZK A;  4A2U A;  3L9F A;  3WOD F;  5JVT A;  1WRJ A;  4NHJ A;  2RNJ A;  1LEA A;  1LDD A;  2VBZ A;  2L54 A;  1RUO A;  4LGW A;  3DXJ F;  4PGG A;  2BGC A;  5F1R A;  2FXA A;  2RVC A;  2MD5 A;  1Z91 A;  3FHZ A;  2CO5 A;  3HRT A;  1R58 A;  2BEO A;  2G7H A;  4CHU A;  5BPI A;  2IJL A;  3KFW X;  3WTV C;  1G3T A;  1WKM A;  2GA2 A;  4WWC A;  2AS5 F;  3DV8 A;  3F23 A;  3F8B A;  2OQG A;  4KMF A;  2CQK A;  3BWG A;  1BN5 A;  5F6F A;  4GO1 A;  1P4X A;  3FXQ A;  2V6C A;  4KNY A;  1R5G A;  2RC4 A;  3ISP A;  2ISY A;  3L2C A;  2UXX A;  3V7C A;  1F9N A;  4EV0 A;  4I98 B;  2EV6 A;  2EJR A;  2STW A;  1YYV A;  3BJA A;  4GCV A;  2DK5 A;  2E7X A;  3EDP A;  3FM3 A;  1KU7 A;  4MQ9 F;  2F5F A;  5A2Q K;  3GFL A;  5ICF A;  2H94 A;  2XRO A;  4GGG A;  1IRF A;  2XAS A;  1S3J A;  4KUM A;  5L3C A;  3DKW A;  3SZP A;  1DPU A;  5CJ9 A;  1KU3 A;  1ZRF A;  1MJB A;  3WGI A;  1OPC A;  2P7C B;  1LJ9 A;  3VB2 A;  5D5X B;  4BYY A;  1LQ1 A;  1I1G A;  3KP4 A;  1K78 A;  4UXN A;  1KGS A;  1XSV A;  1OMI A;  2BYV E;  2XAJ A;  4L9J A;  3KCC A;  3EET A;  5LGT A;  5FLX K;  2QQA A;  1ZAR A;  3U9G A;  2F5E A;  3TKY A;  5CVR A;  3O6B B;  1GVJ A;  1UHW A;  1U5T A;  4KN7 X;  3GFM A;  2IT0 A;  4XRF A;  5BMZ A;  4A5N A;  4M73 A;  3GX4 X;  4UVA A;  3D5L A;  2RV8 A;  5BPD A;  4OOI A;  3C1D A;  3DFG A;  3MAJ A;  1FOK A;  4TV7 A;  1GXQ A;  4ON0 A;  2HOE A;  1QBJ A;  1STZ A;  4EJU A;  1G3S A;  2KIF A;  2IA0 A;  3QPT A;  3CDH A;  4LG0 B;  1EH8 A;  2Q2E A;  2EV0 A;  2VBW A;  3FXU A;  1ZLJ A;  3TGN A;  4CGZ A;  3WTY C;  1E2X A;  2WWY A;  2QEN A;  1FYL A;  1REP C;  4M71 A;  3N4M A;  3HRU A;  2VN2 A;  2GXB A;  4BH9 A;  3I5U A;  5LGU A;  2IP2 A;  3E6D A;  1LDJ A;  5EEG A;  5ED4 A;  3T5X A;  4U0V A;  3BPV A;  4A6D A;  4HX7 A;  2LNB A;  2KIM A;  1R36 A;  1SD7 A;  3ZMS A;  1YLF A;  3GEZ A;  1KU9 A;  1YTY A;  1J7K A;  2DQR A;  4WXH A;  1LNW A;  1E17 A;  1QO0 D;  4HX4 A;  3WTW C;  4PDK A;  5HOO A;  1SFE A;  2M45 A;  4BNC A;  4L9T A;  2VE9 A;  4M74 A;  2ZNZ A;  5AIP A;  4LLL A;  3HTS B;  3WE2 A;  1BC7 C;  4KA4 A;  1P92 A;  2VBX A;  2GIV A;  2FBH A;  3HRM A;  1BOA A;  3AAF A;  2DPD A;  4RGS A;  1HKS A;  3F8N A;  3C7J A;  3FZV A;  3IHU A;  1HKQ A;  6PAX A;  5IT3 A;  1HSJ A;  5LEJ A;  1W7P D;  5L3E A;  2EWN A;  3HUG A;  5HDG A;  5LBQ A;  5BS6 A;  2ACJ A;  1GHC A;  1XCV A;  1JHF A;  1S6L A;  1U6G A;  2STT A;  4IF4 A;  3RPU A;  4EM0 B;  3KLO A;  3V8K A;  3K2Z A;  1GXP A;  4F7Z A;  4RB0 A;  4G8X A;  4JK1 X;  2A61 A;  3T0Y A;  4BHP A;  3K69 A;  4KIB A;  2MLK A;  3LST A;  3JTH A;  4YFX F;  5D6F A;  2P6T A;  1FX7 A;  2EFO A;  3C18 A;  1PDN C;  1FY7 A;  3I4P A;  5L3B A;  2VOP A;  3LAJ A;  3RJP A;  2PMH A;  2ZME A;  1ZG3 A;  1IXS B;  3NEU A;  5DCM A;  4K2E A;  4L9V A;  2HTS A;  1Z7U A;  2ETH A;  2V1U A;  3R61 A;  4JBA A;  2FML A;  2XRN A;  1YW9 A;  1IRG A;  3ML6 A;  3U2R A;  5D8L B;  3LFK A;  1F5T A;  4HW0 A;  3RPQ A;  2LDU A;  5CVU A;  1IXC A;  1IW7 F;  3EQL F;  2O61 A;  2W84 A;  2XUB A;  1DPR A;  3M1E A;  2XVC A;  5E18 F;  3LA7 A;  3L09 A;  4KIC A;  4A6E A;  3QAH A;  2CGP A;  1FBQ A;  4P9F A;  1YS6 A;  4FX4 A;  3L7W A;  1ZAO A;  3BJO A;  1B6A A;  3JW4 A;  4HF0 A;  3HIF A;  3J81 Z;  1FP2 A;  5DUI A;  3K1N A;  1WWX A;  3S2W A;  2OU2 A;  4ETS A;  2IA1 A;  3MEX A;  4CO8 A;  3COA C;  3RYP A;  2L3D A;  4L0Z B;  4CZZ A;  3V7R A;  4S04 A;  5E8I A;  4HDV A;  3BZ6 A;  3GF2 A;  2ZCW A;  5BOX A;  2J5P A;  2YR2 A;  4EJT A;  3HSF A;  5F64 A;  3E6C C;  1ZRE A;  2DFI A;  3BOQ A;  2Z99 A;  3K1M A;  1XSD A;  2VOO A;  1FBU A;  1T98 A;  1K78 B;  4HF2 A;  4E70 A;  3P9K A;  4IRG A;  3ZP5 A;  3R4K A;  1D5V A;  1RI7 A;  4G6Q A;  2XV4 S;  2ELH A;  3R0J A;  4EM1 A;  3SFZ A;  1U5T C;  2H27 A;  3KP3 A;  4OIN F;  2VC1 A;  1J0R A;  2LF8 A;  1ULY A;  3I53 A;  3KP2 A;  1YFH A;  2V79 A;  2KJB A;  2NYX A;  1RIO H;  2FBK A;  2QVO A;  3LAP A;  1HST A;  2PQ8 A;  1YW8 A;  1A04 A;  3QU3 A;  4CYD A;  3O2P E;  1G6N A;  1WSU A;  2FEZ A;  1S29 A;  5E1Z B;  1R1V A;  5ILS A;  1XGS A;  5AIQ A;  5HS7 A;  2HDC A;  1C0W A;  2E7W A;  1IF1 A;  2P6S A;  3GWZ A;  2KJC A;  3E5X A;  2D2W A;  3HSR A;  1FT9 A;  5CVV A;  2V1D A;  3I71 A;  3KE2 A;  4M9Z A;  3ZMD A;  2A68 F;  2M30 A;  2H6B A;  3LQR A;  3WTT C;  4ZZL A;  3Q9V A;  3GVA A;  1U78 A;  4I7H A;  4EMS A;  1R5H A;  2Z9O A;  3O3K A;  2P5V A;  1J5Y A;  3R60 A;  5D5W B;  4FX0 A;  1DP7 P;  4U7B A;  1P4W A;  3B02 A;  2P5L C;  2JZY A;  3ULQ B;  4WCG A;  1O57 A;  3L00 A;  2H6C A;  2HEO A;  2HTJ A;  4I01 A;  4R79 A;  3SZT A;  4ESJ A;  2QBY A;  1XGO A;  3KEQ A;  5E1W A;  3RYR A;  2HFH A;  2FF4 A;  4GYI A;  3TO9 A;  4M72 A;  5JHU A;  1R23 A;  3ZQ7 A;  3K0L A;  5IT9 K;  4RGU A;  1D8J A;  3JSO A;  5DCF A;  4LLN A;  3E5U A;  1ZN2 A;  3KZY A;  1F4K A;  4IRH A;  3HOT A;  2NS0 A;  1CF7 A;  5LHH A;  1TNT A;  2DK8 A;  4FT8 A;  3LQQ A;  2OZ6 A;  2RQP A;  4O6J A;  4WK8 F;  1IAW A;  2K86 A;  1B4A A;  1U8R A;  1SFU A;  3E5Q A;  2G7U A;  3TDU C;  1G4D A;  4AIK A;  4YG2 F;  2XKP A;  4FHT A;  2VXZ A;  3SQN A;  4Y15 A;  2FA5 A;  4EGY A;  5TJJ A;  2F5D A;  2BV6 A;  3EYI A;  4I2O A;  5FGM A;  3V8L A;  2GXG A;  3VFZ A;  1FYM A;  3P9C A;  1QGP A;  3ELK A;  1Z6T A;  2R7F A;  4ZYD A;  3J7A O;  2OD5 A;  1L0O C;  4IPA A;  2PJP A;  2EV5 A;  1ZGA A;  2GWR A;  2ZXJ A;  2A07 F;  2EK5 A;  3IL2 A;  2FQ3 A;  1I5Z A;  2ZME B;  1Z1D A;  4KMU X;  3OOP A;  5DCM B;  4IJA A;  2IPQ X;  3HYI A;  3R6S A;  4ENK A;  3ZN1 A;  4MHG A;  4UVB A;  1I1S A;  1T38 A;  3F72 A;  5CVJ A;  1MD0 A;  2PLY A;  4IHT A;  2O6G E;  4IHS A;  1S7A A;  3W6K B;  3F8F A;  1O3S A;  2IA2 A;  2A6E F;  1OYW A;  2QYO A;  2Z33 A;  3BP8 A;  4QLC U;  1EV7 A;  2A5Y B;  5CLS A;  2HGC A;  5FB2 A;  3ECH A;  4ESF A;  2XAH A;  2JT1 A;  4YFK F;  2RKH A;  5LRR A;  4MEX F;  1RZ4 A;  4I09 A;  3DP7 A;  4QWQ A;  4LK1 F;  1SD6 A;  3EYY A;  3J80 K;  4OIP F;  4LK0 F;  3V8J A;  5KVR A;  4XLP F;  3IRQ A;  2ISZ A;  4DNC A;  3KP6 A;  4BXU A;  4MTD A;  1B9M A;  2P5K A;  3MCZ A;  3RDI A;  3WTU C;  2HR3 A;  2MH2 A;  3FMS A;  1I6X A;  2ZBK A;  5K5R A;  2EFN A;  1Z05 A;  3C3W A;  4PGH A;  5A2Q Z;  4P96 A;  4A0Y A;  4HYE A;  3VOE A;  5ILV A;  3WGG A;  5E20 A;  3H3Z A;  3QPH A;  2FU4 A;  2M8E A;  3NRV A;  1DDN A;  4G6D A;  2G9W A;  1I27 A;  1W5T A;  5D4S A;  3IWF A;  1KU2 A;  1IN6 A;  2DI3 A;  2PG4 A;  1LB2 A;  4CXF A;  2WV0 A;  3M8F A;  2CW0 F;  1USS A;  1D8K A;  4AD9 A;  2DU9 A;  1ZRC A;  1XGN A;  3K9T A;  2YPR A;  2DAO A;  1BC8 C;  2QQB A;  1AWC A;  3FMQ A;  1LEB A;  3D0S A;  1WI9 A;  1O7F A;  4HX8 A;  3T8R A;  4N9I A;  1G3Y A;  5FLX Z;  1UST A;  3ECO A;  5DD4 A;  3GLX A;  2PI0 A;  3JTG A;  1Z9C A;  1ONV A;  3NQO A;  3H3U A;  1TW3 A;  1SFX A;  4OMY A;  5JI6 A;  4G9Y A;  5H20 A;  3LA3 A;  3E3V A;  5BQT A;  3I59 A;  4LD5 A;  1P6R A;  3SHF A;  3H92 A;  1OKR A;  4R8H A;  5FD5 A;  5HLH A;  3J80 Z;  4OIQ F;  3ABT A;  5JR3 A;  3G73 A;  2O03 A;  5K1Y A;  4CDG A;  4P5O A;  1YS7 A;  2MH9 A;  3RKY A;  2R7D A;  4S05 A;  4M6Y A;  2PMU A;  4HLX A;  1YIO A;  4Q4Z F;  3Q5F A;  2K4J A;  1R00 A;  5LHI A;  2LSO A;  4KN4 X;  4BHB A;  2CYY A;  2WTE A;  2FNA A;  2DW4 A;  4HAM A;  2VE8 A;  3QP6 A;  4RS8 A;  3FF5 A;  1KQ0 A;  1UCR A;  3TO7 A;  3WTS C;  4L9N A;  1FWZ A;  2ESH A;  3CUQ A;  3M9A A;  1UFM A;  1R1U A;  1MJ9 A;  3IWZ A;  2QBY B;  3WTZ A;  3QU6 A;  3FM5 A;  3I64 A;  1EH7 A;  3V4G A;  2BBY A;  4YII A;  1FYK A;  2M1B A;  1B9N A;  2HYF A;  1LVA A;  1XB4 A;  1NHA A;  2H09 A;  1KA8 A;  2COM A;  5ERI A;  2NNY A;  1HW2 A;  2EA2 A;  1HQC A;  3REO A;  5FO5 A;  1ODD A;  1J9I A;  1CF7 B;  2FBI A;  4AIH A;  3WGH A;  3TOB A;  4A12 A;  3FWE A;  2LF7 A;  2E1N A;  4DQ2 A;  5LGN A;  1TBX A;  2OAZ A;  2DTR A;  1BJA A;  5KK1 A;  1ZGJ A;  2VOD A;  4ZH4 F;  1BI0 A;  2XIG A;  4GYG A;  2KKO A;  1CGP A;  3M8E A;  3MWM A;  3PQK A;  3JAM K;  1PP7 U;  1YG2 A;  2EFW A;  5HDK A;  3WU1 B;  4M9X A;  4CIC A;  4MEY F;  1BI2 A;  2V9V A;  4LLG F;  2MA3 A;  3ROU A;  1F1Z A;  1ZG5 A;  4OMZ A;  4MGR A;  1MZB A;  1J75 A;  3F6V A;  4G7H F;  2VBY A;  1IZ1 A;  1ZYR F;  2UWM A;  5D4R A;  2L4M A;  3F22 A;  1H9G A;  4LG0 A;  4RB3 C;  1MDM A;  1ON1 A;  2FSW A;  4XBF A;  1W7P A;  5DYM A;  2HWV A;  3GXO A;  3WE3 A;  3GFI A;  4O3M A;  4U7D A;  1ZHF A;  2JSC A;  4I0A A;  5ICC A;  2EFP A;  2PBI A;  4Y17 A;  2R3S A;  1U5T B;  3CO7 C;  2XAG A;  3M7G A;  2DBB A;  2FOK A;  5HS8 A;  1V4R A;  2HQN A;  1LDK B;  2MBF A;  1FNN A;  3JAM Z;  3P9I A;  2NAZ A;  1K79 A;  1KQ8 A;  1MGT A;  2JPB A;  2V1X A;  2FE3 A;  3E97 A;  1T39 A;  4ZYG A;  2A69 F;  2MLG A;  3HRS A;  3I58 A;  1ZRD A;  3B73 A;  2JTV A;  1FZP B;  3F6O A;  1XCB A;  2D1H A;  3VEP A;  3F21 A;  4EJO A;  5L3D A;  2O3F A;  2VT2 A;  1PUE E;  1U3E M;  3ZMV A;  4KIG A;  3FMR A;  2M87 A;  3WTX C;  2KIU A;  5CVI A;  1BI1 A;  5E1X A;  5HDN A;  1AOY A;  1YW7 A;  3P7N A;  2L02 A;  3TOA A;  4GXO A;  1B59 A;  1TQP A;  4WF2 A;  3VOD A;  4MQV A;  3SXY A;  1O3T A;  1ZH5 A;  4ZYH A;  2QZ8 A;  3T8T A;  4L5I A;  2ADU A;  5TRD A;  2MC3 A;  3U1D A;  5H6Q A;  4I0B A;  4RB2 C;  3RKW A;  1KQ9 A;  3RI4 A;  3E6M A;  3DF8 A;  2L4A A;  2OA4 A;  2YU3 A;  3I59 B;  1O3Q A;  5D8K B;  1Q1H A;  5E17 F;  1SD5 A;  2UXN A;  2KRF A;  1JXS A;  2FNP A;  4LB6 B;  5FFX A;  1QNT A;  4Z2Y A;  2ZFW A;  4IVN A;  4RGX A;  4HQM A;  4ENM A;  4D0P A;  2EB7 A;  2Z5U A;  3HTU A;  5LHG A;  2QQ9 A;  2TDX A;  2OQR A;  1DUX C;  1OR7 A;  3N97 A;  3BJ6 A;  1H9T A;  4HOB A;  1ZG1 A;  1FP1 D;  2J5O A;  3JSP A;  4HZF A;  2Q0O A;  2K02 A;  3I54 A;  1BI3 A;  5D6E A;  3KP7 A;  2QUF A;  3RTR A;  3MZH A;  1IN5 A;  1P4A A;  4WXD A;  3CUQ C;  3HOS A;  3CUQ B;  4U88 A;  5ICE A;  5AON A;  4RB1 A;  2DPU A;  2ZNY A;  4O5V A;  4IXA A;  1B1B A;  1FSH A;  4UNO A;  2D1V A;  5J6X A;  3ZMU A;  2RGV A;  4BHC A;  4BQA A;  2LKP A;  1D3Y A;  2HYG D;  3MZY A;  2VT3 A;  3WU0 A;  5CYV A;  3GW2 A;  2QWW A;  1EH6 A;  4ESB A;  1SD4 A;  1Y0U A;  5IT9 Z;  4Q47 A;  5K5O A;  1MKM A;  4ZYE A;  1PP8 F;  3F8M A;  4OU0 A;  2Z3Y A;  3LA2 A;  1W4M A;  4Y13 A;  5L3F A;  1SMY F;  2IVM A;  2PEX A;  4ENJ A;  1VTN C;  2X0L A;  4KT5 C;  4KIF A;  1QQI A;  5HLI A;  5J8F A;  1P2F A;  2A3S A;  4JQF A;  2XKO A;  3EUH A;  1YQA A;  4XSX F;  2O8X A;  4RAZ A;  4OIR F;  5HLG A;  4XSZ F;  3CLO A;  4EJV A;  2WC2 A;  4U0W A;  3BDD A;  2E1C A;  2HKO A;  3PFI A;  4R1H A;  1Z6R A;  3KLN A;  1JHH A;  2IRF G;  2PN6 A;  4UUV A;  3FX3 A;  3HSE A;  3GO5 A;  3V7S A;  2HKX A;  1TQI A;  1XMK A;  2CWE A;  2FRH A;  3CJN A;  5ILU A;  1S8N A;  1V3F A;  4ZZD A;  1R1T A;  5DDG A;  3T1B A;  1QPM A;  1MDM B;  2K7L A;  4HA8 A;  3KET A;  1W7P B;  1FSE A;  2NNN A;  5HVQ C;  2DT5 A;  1U2W A;  1R7J A;  4L18 B;  1O7L A;  1HW5 A;  3DPL C;  4EGZ A;  2VC0 A;  2XAQ A;  5J8C A;  1XD7 A;  2IW5 A;  2RN7 A;  4L5J A;  5D5U B;  3IKT A;  5K5Q A;  4HBL A;  4LB5 A;  2F5C A;  1IN8 A;  3IRR A;  2M5W A;  2GA1 A;  3CUO A;  4YFN F;  4UHT A;  2QLZ A;  4MNU A;  1KYZ A;  3GZ6 A;  2GZW A;  3KP5 A;  1JE8 A;  2FMY A;  2DO7 A;  4KDP A;  5LEK A;  5E8G A;  4B09 A;  4U0Y A;  3ZMT A;  4BAY A;  1MJA A;  1XDU A;  1XMA A;  2ZKZ A;  1IUY A;  1IN7 A;  1W5S A;  3BPX A;  2A6H F;  2CSO A;  3GZ5 A;  1BIB A;  2DQL A;  2P7V B;  2F2E A;  4N0B A;  4UV9 A;  2GQQ A;  5EEH A;  3WG9 A;  4NB5 A;  3W6J B;  2CFX A;  1K6O A;  1HXD A;  3QOP A;  5DD8 A;  4B8X A;  2P8T A;  4ASN A;  5ICG A;  2ZO4 A;  5DV5 A;  2X4H A;  3IKV A;  1T2K A;  2XGX A;  5DEQ A;  3J81 K;  3K1P A;  3RKX A;  3DQV C;  4P9U A; 
#chains in the Genus database with same CATH topology
 2KRH A;  1G8X A;  3ZN0 A;  4BUP A;  1N78 A;  3GTQ J;  5C4X J;  2EIN H;  3RQI A;  1ETY A;  2EH3 A;  3LWF A;  3X2Q H;  2X6W A;  2JRM A;  4XM3 A;  1O3R A;  1YJ9 I;  1V55 H;  1TLH B;  4G7O F;  3I0T A;  3S2D J;  3KZZ A;  1JKO C;  1TTY A;  4AWX B;  3OYD A;  2CUZ A;  1IN4 A;  2OZU A;  3R0A A;  1A35 A;  2YX7 A;  3K4L A;  1S7O A;  4A0X A;  3OYK A;  3QOD A;  1FBS A;  1TNS A;  5L3G A;  2EZI A;  4XOR A;  3JRI A;  5FFZ A;  3B6A A;  3OIP A;  1MSF C;  4WX9 A;  3CC7 I;  2PJR A;  4AYB N;  2AXL A;  1ON2 A;  3J7Z I;  3B6C A;  1TZL A;  1RRJ A;  4HV5 A;  2CQQ A;  3TQN A;  3IH4 A;  4B3A A;  1QZZ A;  2OBP A;  5KAI C;  4QTR A;  2NXN B;  1TWH J;  4HQE A;  4RLF A;  1TC3 C;  5HLT A;  3GYH X;  2D45 A;  2KPM A;  3A2K A;  3DKX A;  1FTT A;  1S5L C;  1L3L A;  3OV8 A;  2IGM A;  1ERD A;  1RNL A;  1XTA A;  4D9J A;  5FRM A;  2BZT A;  3CP8 A;  1A6Q A;  2EZH A;  1OR7 C;  4BE1 A;  2NOJ B;  3KEO A;  3GTO J;  4H0E A;  4EM2 A;  2JPC A;  4CYC B;  3BRO A;  2JK3 A;  2K9Q A;  4LJZ F;  4HV6 A;  2JRT A;  3LSR A;  1UMQ A;  3BG5 A;  3HPG A;  2QSF X;  3K2A A;  3N05 A;  2Y48 A;  4X1E A;  4PCQ A;  4UUT A;  2X48 A;  5EZG A;  1TQM A;  3FXM A;  1T56 A;  3DPT A;  5F0H A;  3MFK A;  4D7M A;  1VQ8 I;  3CTA A;  4F3Q A;  3ZQL A;  2O0Y A;  2EA4 A;  3DU5 A;  2CG4 A;  3BQZ A;  5GAG J;  2K9N A;  2W24 A;  4LFU A;  1T0F A;  1JKP C;  1T6S A;  2W57 A;  1WQ2 A;  3E6B A;  2WAQ A;  1XSX A;  4A3B J;  1KYW A;  4PJ0 C;  3FXR A;  4N9H A;  2W25 A;  2DFH A;  1YRN A;  2EFQ A;  2HZT A;  5F04 A;  3QRF F;  4ZYA A;  1FPQ A;  1HF0 A;  4JX5 A;  5FD6 A;  3F3X A;  4JX4 A;  2Y0M A;  2H1K A;  4A5M A;  1WJA A;  2PFB A;  2W85 A;  4RAY A;  2VON A;  2FD5 A;  3QP5 A;  2B0L A;  1HBX G;  2DLL A;  1JGS A;  2N8G A;  5D5V B;  3QYE A;  3OYJ A;  3Q9S A;  4M9S A;  1OFC X;  2DOF A;  4MTE A;  2XAF A;  2M34 A;  4PZJ A;  5HS9 A;  2M4G A;  1BIA A;  1SAX A;  1WJB A;  3PQJ A;  2K4B A;  2Z16 A;  1BBY A;  4II3 A;  2DA6 A;  1OCP A;  1RUN A;  3D1N I;  2ECC A;  1TW2 A;  1UHS A;  3MQ0 A;  3BY6 A;  1GVD A;  3CO6 C;  4ZTF A;  3G3Z A;  4BKX A;  3FDY A;  2LRD A;  5H6R A;  1J59 A;  4HF1 A;  4B4C A;  1K7A A;  4U87 A;  3TDZ C;  2V26 A;  3NAR A;  4AVP A;  4EJW A;  1I3Q J;  1QHG A;  3TO6 A;  1AA7 A;  1OYI A;  2OUM A;  2PMZ A;  5LLQ A;  1G3W A;  4UVC A;  5DUK A;  3BLY A;  3GFJ A;  1BM9 A;  4MFE A;  1UB9 A;  4CCL A;  3CZ6 A;  4LMY A;  3H35 A;  4IRI A;  4HLY A;  2BW3 A;  3HGY A;  4OIO F;  5IY5 H;  1XDS A;  2GAU A;  2P4W A;  3DEU A;  3OYM A;  4ENN A;  4A0Z A;  4HDU A;  3LSJ A;  2VQC A;  2BE5 F;  4AIJ A;  4ZDO A;  3K70 D;  1A5J A;  4P55 A;  3ERE D;  1R22 A;  2GM4 A;  5FKN A;  4Q48 A;  3L2W A;  2XGD A;  1XGM A;  2ECB A;  1APL C;  1UHM A;  4M6X A;  2HNH A;  4F55 A;  2YX4 A;  1T08 B;  1DGW Y;  4JP0 A;  4FAS D;  2QM3 A;  2YS9 A;  2QEX I;  1YIJ I;  3ZPL A;  4E4H A;  2HS5 A;  2VL8 A;  3HG9 A;  4EVI A;  1YO5 C;  2Y75 A;  4Q5S F;  1WJF A;  3I3L A;  4I02 A;  3F9K A;  3RIR A;  2ESN A;  2LBF A;  2C6Y A;  1V5F A;  4EQQ A;  2L01 A;  3A0B C;  1WZ2 A;  2RDP A;  1LFP A;  3CCV I;  3GUD A;  4XRS G;  1OYY A;  5IOY A;  3F8C A;  3LSK A;  2Q8K A;  5JLX A;  2O7O A;  4XLN F;  4KFC A;  3OL4 A;  4YIF A;  3KPH A;  2HQR A;  3HHH A;  2NRA C;  1XN7 A;  1HA8 A;  1IXR C;  2WB1 N;  3ZMZ A;  4L0Y B;  5CPR B;  2K27 A;  1J2X A;  1SMT A;  2ZJ2 A;  5JFR A;  3HHG A;  2JA8 J;  1WHU A;  1HKT A;  4NQW A;  1LFB A;  1FC3 A;  2VJ5 A;  4C9Y A;  5LRS A;  1HW1 A;  2M4K A;  4BEH A;  1JUM A;  4RGR A;  4WXC A;  3IC7 A;  1H0M A;  3S2H J;  4UV8 A;  4DGW B;  2JA2 A;  2Q1Z B;  2X6X A;  4KYW A;  2G0E A;  2YSR A;  2OF7 A;  3ABU A;  1SFK A;  2XHK A;  1R5I D;  1X3U A;  1D0Z A;  4G7Z F;  3QYB A;  1ZLK A;  1QZY A;  4C2M J;  4G94 A;  1ZR2 A;  1FLI A;  1UG2 A;  2UZK A;  4A2U A;  3TMO A;  3GZN B;  3L9F A;  2R5Y B;  2DOD A;  3WOD F;  5JVT A;  1WRJ A;  4NHJ A;  2RNJ A;  2DJI A;  1LEA A;  1LDD A;  3MKY B;  1X1C A;  2VBZ A;  4UY8 I;  5GAH J;  1RET A;  1HCR A;  2L54 A;  1RUO A;  5GPA A;  1Z67 A;  2HDW A;  4LGW A;  1ETO A;  3DXJ F;  4PGG A;  2BGC A;  1ZQ3 P;  5F1R A;  4C3J J;  3I55 I;  1RC9 A;  2FXA A;  2M8G X;  3W3C A;  3L2Q A;  4II2 A;  2RVC A;  2W4S A;  2MD5 A;  1Z91 A;  4NC8 A;  3FHZ A;  3QPS A;  1Y8R B;  2CO5 A;  2P81 A;  3HRT A;  2MSY A;  2EZK A;  3H9J A;  1VQ6 I;  1Z77 A;  4QIW N;  1R58 A;  4Y7N J;  4AU7 A;  3BG9 A;  2HOS A;  2BEO A;  1VQP I;  2BVM A;  2G7H A;  4A3G J;  2XF7 A;  1PYV A;  1K61 A;  1G2H A;  2R0Q C;  2HPM A;  4CHU A;  2LC2 A;  5BPI A;  2VAS A;  2IJL A;  3KFW X;  1RR8 C;  3WTV C;  1XC5 A;  1G3T A;  1WKM A;  2GA2 A;  2KIS A;  3Q0W A;  5IYD J;  4IHX A;  4WWC A;  4XKW A;  2AS5 F;  3DV8 A;  3F23 A;  3F8B A;  2OQG A;  3AG3 H;  4KMF A;  2CQK A;  3BWG A;  3HKZ N;  1BN5 A;  5F6F A;  4GO1 A;  3CQZ J;  3G2B A;  2WAF A;  2WY8 Q;  3D5S C;  1P4X A;  4OWR B;  1X4P A;  2NS7 A;  3FXQ A;  2W82 A;  3BR0 A;  2V6C A;  3DPU A;  5IP6 A;  4KNY A;  1N75 A;  1R5G A;  1T8I A;  1FOW A;  2RC4 A;  3ISP A;  1MNM C;  4M6V A;  2ISY A;  2L7K A;  2E2H J;  3L2C A;  1DGR M;  3CMY A;  3HOV J;  4A69 C;  2MD0 A;  2UXX A;  3V7C A;  1F9N A;  4EV0 A;  1U9O A;  3CMM A;  4I98 B;  2EV6 A;  1HOM A;  2EJR A;  4ZC3 A;  2STW A;  4BBR J;  4E7L A;  1YYV A;  3BJA A;  4GCV A;  5TIS C;  4GRI A;  2DK5 A;  2E7X A;  3ZGK A;  5CQE A;  2XDV A;  2HXO A;  4UB8 C;  3EDP A;  3FM3 A;  4BL0 B;  1KU7 A;  4D5C A;  1TWA J;  3G1L A;  2V1N A;  4MQ9 F;  5B5E C;  1ETK A;  2F5F A;  3GFL A;  5A2Q K;  3CJQ B;  1Y0N A;  2H94 A;  5ICF A;  5J1R A;  2XRO A;  2XGC A;  2HOT A;  4GGG A;  1LVK A;  1IRF A;  2XAS A;  1S3J A;  4KUM A;  1JJ6 C;  5L3C A;  3W2W A;  1AKH A;  3DKW A;  2RQQ A;  2E35 A;  5FRN A;  3HOU J;  1W36 C;  3SEZ A;  3SZP A;  1DPU A;  1WFX A;  5CJ9 A;  5K7Z A;  1KU3 A;  1ZRF A;  1MJB A;  2PJR B;  3WGI A;  1OPC A;  2P7C B;  1LJ9 A;  2CQX A;  2PX9 A;  3VB2 A;  5D5X B;  4BYY A;  1LQ1 A;  1I1G A;  1H88 C;  3KP4 A;  1GV5 A;  3HOY J;  1K78 A;  4A3L J;  4UXN A;  2X1D A;  1KGS A;  1XSV A;  1OMI A;  2BYV E;  2MW8 A;  2XAJ A;  3TP3 A;  4MIM A;  1GV2 A;  2DMU A;  3BR6 A;  3KCC A;  4L9J A;  1RKT A;  2LFB A;  2JA5 J;  3EET A;  3FIS A;  5LGT A;  3H36 A;  4MFD A;  5FLX K;  2QQA A;  1ZAR A;  2HQ5 A;  3BG7 A;  5J40 A;  3U9G A;  2F5E A;  2CU7 A;  4IZZ A;  3BR1 A;  3TKY A;  5CVR A;  3O6B B;  1GVJ A;  3S8P A;  1UHW A;  2KIQ A;  1U5T A;  4KN7 X;  3VPR A;  3GFM A;  3G6E I;  2EQR A;  2IT0 A;  2H1L A;  4E7I A;  4XRF A;  5BMZ A;  1X4O A;  4A5N A;  4M73 A;  4RAG A;  3GX4 X;  4BGD A;  4UVA A;  3D5L A;  4XKB A;  2RV8 A;  3KYD B;  5BPD A;  4OOI A;  3C1D A;  4CH7 A;  1T0F C;  1E3P A;  2GLO A;  3DFG A;  4XL9 A;  3MAJ A;  2JVG A;  1FOK A;  2ZXH A;  1GXQ A;  4TV7 A;  4ON0 A;  1JUS A;  2Y30 A;  3JRG A;  2HOE A;  1YRN B;  4AUX A;  1QBJ A;  2DFF A;  1STZ A;  4EJU A;  3LSM A;  1G3S A;  2O5R A;  4XKV A;  4J01 A;  2R92 J;  2KIF A;  3HJE A;  2IA0 A;  3QPT A;  1J09 A;  2M7B A;  1PUF A;  3CDH A;  4CCM A;  4LG0 B;  4RMN A;  1EH8 A;  3CES A;  2E60 A;  2Q2E A;  2EV0 A;  4DBQ A;  2JQ7 A;  2BVL A;  2VBW A;  3FXU A;  2R7Z J;  1YHQ I;  1ZLJ A;  3TGN A;  4CGZ A;  1I6H J;  5IPA A;  3WTY C;  1E2X A;  2WWY A;  5TGT A;  2KMU A;  3LFU A;  2QEN A;  4ZTJ A;  1FYL A;  1REP C;  1NTC A;  1IC8 A;  4M71 A;  3N4M A;  1WI3 A;  1LFU P;  3HRU A;  2VN2 A;  4BJ6 C;  1QA6 A;  2DMQ A;  4D1Q A;  2GXB A;  1TWG J;  2XC7 A;  4BH9 A;  3I5U A;  3OYE A;  4PSX A;  5LGU A;  2IP2 A;  1Y6I A;  3E6D A;  4CCN A;  1LDJ A;  5B66 C;  4A3M J;  5EEG A;  5ED4 A;  1CQT A;  2I10 A;  4LIU A;  4FET A;  2QSH X;  3T5X A;  4U0V A;  2XB0 X;  3BPV A;  1IV8 A;  2A5W A;  4A6D A;  4HX7 A;  3FBN B;  3CCS I;  4PJM A;  3F0C A;  1X1A A;  2LNB A;  2KIM A;  1R36 A;  1SD7 A;  3ZMS A;  1YLF A;  1JTY A;  2VQH A;  3GEZ A;  4IOA F;  5E3M A;  1KU9 A;  1YTY A;  2DFE A;  1A6I A;  4UB6 C;  1J7K A;  2ZJP F;  2DQR A;  2BW3 B;  4WXH A;  1LNW A;  1E17 A;  3GBG A;  1QO0 D;  2M2E A;  4HX4 A;  2ID6 A;  3QOE A;  3WTW C;  1OCR H;  1WJE A;  2TRT A;  4PDK A;  5HOO A;  1SFE A;  2M45 A;  4BNC A;  4L9T A;  2VE9 A;  4M74 A;  2ZNZ A;  5AIP A;  4LLL A;  1QHH D;  2X6Y A;  3HTS B;  3WE2 A;  1BC7 C;  4KA4 A;  1P92 A;  4A93 J;  2VBX A;  3HEF A;  2GIV A;  4BQO A;  1BR4 A;  3S1M J;  2FBH A;  3HRM A;  3HC7 A;  1BOA A;  3AAF A;  2QGU A;  1ZGW A;  2DPD A;  4RGS A;  1HKS A;  3F8N A;  3C7J A;  3FZV A;  3IHU A;  3SEQ A;  3AG4 H;  3JRC A;  3H0G J;  3GTP J;  3W6V A;  1VI0 A;  1HKQ A;  6PAX A;  3BG6 A;  5IT3 A;  1HSJ A;  5LEJ A;  2LBF B;  1W7P D;  5L3E A;  4AYB A;  2Z1D A;  2KQR A;  2EWN A;  3HUG A;  1ITY A;  5KNL A;  5HDG A;  5CQG A;  2TCT A;  4ZDL A;  2M9H A;  5LBQ A;  1SAN A;  5BS6 A;  2ACJ A;  3RCO A;  1WJC A;  2H8W A;  1GHC A;  1JHF A;  1JTX A;  1XCV A;  3JR9 A;  3A4C A;  1S6L A;  4S0H B;  1U6G A;  4DOZ A;  2EIK H;  3PL8 A;  5IYC J;  2STT A;  4IF4 A;  1QRY A;  5GPC A;  3RPU A;  2VPR A;  4EM0 B;  2LKX A;  1X3W B;  4NQW B;  1RPW A;  3KLO A;  4BEH B;  3V8K A;  1VZ0 A;  3K2Z A;  1GXP A;  3OSG A;  1BR2 A;  2GOM A;  4F7Z A;  2IGN A;  3SJM A;  4RB0 A;  2XSD C;  4G8X A;  4JK1 X;  2A61 A;  3T0Y A;  5JHF A;  4BHP A;  4ZDP A;  2VIX A;  1X58 A;  3EUA A;  5GAD J;  3OSF A;  3K69 A;  4KIB A;  4IO9 F;  2MLK A;  2F4I A;  3LST A;  3JTH A;  4YFX F;  5D6F A;  2P6T A;  2CS3 A;  2DDA A;  1FX7 A;  2EFO A;  3C18 A;  1PDN C;  1FY7 A;  3H5N A;  3MKL A;  3GTG J;  4BXX J;  1D5Y A;  2ZJQ F;  3I4P A;  1KZH A;  5L3B A;  2F5V A;  2VOP A;  2GBY A;  2LY1 A;  1FTZ A;  2COB A;  3LAJ A;  4J00 A;  3RJP A;  3PJR A;  2JWT A;  2PMH A;  2ZME A;  1ZG3 A;  1IXS B;  1VQN I;  3NEU A;  4W97 A;  5DCM A;  4K2E A;  4L9V A;  2HTS A;  2R7W A;  1Z7U A;  3CDI A;  2ETH A;  2F4O B;  4F93 B;  2V1U A;  2ELK A;  3R61 A;  2FML A;  2AXT C;  4JBA A;  5GP9 A;  2XRN A;  3TW7 A;  2B9S A;  1YW9 A;  1IRG A;  3ML6 A;  3U2R A;  1W0T A;  3OOU A;  5D8L B;  3LFK A;  1G59 A;  3GTK J;  1F5T A;  3FKI J;  1SC7 A;  3A1Y A;  2OV7 A;  4HW0 A;  2LDU A;  5CVU A;  1IXC A;  1RR7 A;  3RPQ A;  1H8A C;  3S16 J;  1IW7 F;  1Z7L A;  2NVT J;  3EQL F;  3Q3S A;  2O61 A;  2NVQ J;  4CUG A;  2W84 A;  3IP4 B;  2XUB A;  2BY3 A;  1DPR A;  2XAU A;  3M1E A;  2XVC A;  5E18 F;  3LA7 A;  3L2U A;  1ZKG A;  2DT7 B;  4Y3O A;  1E0E A;  3L09 A;  4HNV A;  4KIC A;  3HGG A;  2JN6 A;  4A6E A;  3OR1 C;  3QAH A;  4NNJ A;  2CGP A;  4E7J A;  1FBQ A;  2RAE A;  3G1M A;  4P9F A;  1YS6 A;  4FX4 A;  3L7W A;  3CJR B;  1DU0 A;  5EG0 B;  1T33 A;  2HDD A;  2LLK A;  1ZAO A;  3OL3 A;  3BJO A;  2ZC2 A;  1AHD P;  1B6A A;  3JW4 A;  4HF0 A;  3ZQC A;  3HIF A;  4IQ4 A;  2JA6 J;  4XRM A;  3I4M J;  2KRC A;  3ZQQ A;  3BR3 A;  1AU7 A;  4E7S A;  3J81 Z;  1FP2 A;  5M3M J;  4PJN A;  5DUI A;  3K1N A;  1WWX A;  4RM3 A;  2QCO A;  3S2W A;  1OCC H;  2OU2 A;  3ZXS A;  2QA4 I;  4I76 A;  2IA1 A;  4ETS A;  2LP0 A;  2AO9 A;  3OS0 A;  3MEX A;  4CO8 A;  3COA C;  1EJ9 A;  3DKY A;  3CCL I;  4J19 A;  3RYP A;  4DZJ A;  2K5C A;  2L3D A;  5K7F A;  4C3H J;  4DYC A;  1OCZ H;  3CCM I;  2VLA A;  4L0Z B;  2XRL A;  2FOW A;  4KIS A;  3PIP F;  4CZZ A;  3V7R A;  4S04 A;  4BDZ A;  1X2M A;  5E8I A;  1X1B A;  2X1C A;  5IYB J;  4HDV A;  2EZL A;  4DYR A;  3BZ6 A;  2R5Z A;  3GF2 A;  3MKZ A;  2ZCW A;  5BOX A;  2YUS A;  1AKH B;  3UKG A;  2KDZ A;  4A3I J;  4BQQ A;  2M0C A;  2J5P A;  2LG4 A;  1W5C C;  5FLM J;  2YR2 A;  4EJT A;  3HSF A;  3MN2 A;  1F36 A;  5F64 A;  2L9N A;  3E6C C;  1ZRE A;  1D1C A;  2Z2S B;  2R7V A;  2DFI A;  3BOQ A;  4D5F A;  1WCM J;  2Z99 A;  2L9V A;  3K1M A;  1WPK A;  1XSD A;  2VOO A;  2IGO A;  1FBU A;  1T98 A;  3W2V A;  1B72 A;  2HPI A;  5EZH A;  5IOZ A;  1K78 B;  4HF2 A;  2DDB A;  4E70 A;  3P9K A;  4IRG A;  2VQG A;  3ZP5 A;  2ZSH B;  3R4K A;  3GTJ J;  3MD2 A;  1D5V A;  3PUB A;  3H3V K;  1RI7 A;  5HOD A;  1VQO I;  1V54 H;  2DA7 A;  4G6Q A;  2XF6 A;  2XV4 S;  2ELH A;  3R0J A;  4EM1 A;  1MH3 A;  2E34 A;  2XPV A;  3SFZ A;  3D5R C;  1U5T C;  2H27 A;  3SYT A;  5JVG F;  1PVE A;  3KP3 A;  1YI2 I;  4OIN F;  3BTI A;  2VC1 A;  3OYH A;  4FE7 A;  1J0R A;  2LF8 A;  4UUS A;  1ULY A;  3OMY A;  3JRH A;  3I53 A;  3KP2 A;  1YFH A;  2R7S A;  2WY7 Q;  4DYQ A;  2V79 A;  2KJB A;  2NYX A;  1RIO H;  2FBK A;  2QVO A;  3LSH A;  1X3Z B;  3LAP A;  2VI6 A;  1HST A;  1X1D A;  5J1Y A;  2PQ8 A;  1YW8 A;  1IUF A;  1A04 A;  3QU3 A;  3ZOB A;  4CYD A;  1D1B A;  1JJ8 C;  2LK2 A;  1Y8Q B;  3G4S I;  3O2P E;  3M3Y J;  1G6N A;  1WSU A;  2FEZ A;  3VWB A;  1SAU A;  3LMM A;  1S29 A;  5E1Z B;  1R1V A;  4M3E A;  1NG6 A;  2X6O A;  1XGS A;  2Y2Z A;  5AIQ A;  5ILS A;  5HS7 A;  3UR3 C;  2HDC A;  1C0W A;  2E7W A;  5DM7 F;  1IF1 A;  4XQF A;  1PUF B;  4XIC A;  3VYS B;  2P6S A;  3GWZ A;  3CC4 I;  2KJC A;  3OS1 A;  3E5X A;  2D2W A;  2Q2E B;  2DXI A;  1MND A;  4HEA 2;  2NS8 A;  4F91 B;  9ANT A;  3HSR A;  3GLL A;  1FT9 A;  5CVV A;  2V1D A;  3I71 A;  3KE2 A;  3I4N J;  4M9Z A;  2LKS A;  3ZMD A;  2A68 F;  2M30 A;  2H6B A;  1I3A A;  1TT5 B;  3LQR A;  2KZV A;  4NUB A;  3WTT C;  1R71 A;  3HDD A;  1LE8 A;  4ZZL A;  3Q9V A;  4B47 A;  3GVA A;  5J4V A;  3TBI A;  5M3F J;  1U78 A;  2M0M A;  4I7H A;  4EMS A;  1R5H A;  2HVQ A;  2Z9O A;  3O3K A;  4PK4 A;  4IHV A;  2P5V A;  1J5Y A;  3R60 A;  2JUG A;  5D5W B;  2FX0 A;  4FX0 A;  1DP7 P;  2IS1 A;  4U7B A;  1P4W A;  3B02 A;  1M1E B;  4M3F A;  2X85 A;  2P5L C;  2JZY A;  3ULQ B;  4WCG A;  1O57 A;  4BQN A;  5M5W J;  3L00 A;  4KIT B;  3S1N J;  2H6C A;  2CV1 A;  4ABZ A;  1Y56 A;  2HEO A;  2HTJ A;  2R7X A;  4I01 A;  4AVZ A;  3BR2 A;  2K3F A;  4R79 A;  3SZT A;  4ESJ A;  2QBY A;  4A3D J;  2L9S A;  1I50 J;  4IHW A;  1XGO A;  1O4X A;  3KEQ A;  3BCB A;  5E1W A;  3RYR A;  2HFH A;  3OS2 A;  2FF4 A;  4GYI A;  3TO9 A;  4M72 A;  5BNG A;  5JHU A;  4IHY A;  1R23 A;  5FKM A;  1SVM A;  3ZQ7 A;  3K0L A;  5IT9 K;  1UZC A;  4RGU A;  4XOP A;  1D8J A;  3JSO A;  3ZCO A;  5DCF A;  4LLN A;  3E5U A;  2GIZ A;  3H5R A;  1ZN2 A;  3V42 A;  2NVX J;  2DJN A;  2O9L A;  3KZY A;  1F4K A;  4IRH A;  4BE2 A;  2KFD A;  4Y33 A;  3HOT A;  3PO2 J;  2DMT A;  2NS0 A;  1CF7 A;  1MSE C;  3KX2 A;  2A6T A;  2CH0 A;  2EIM H;  5LHH A;  1TNT A;  2UV1 A;  2DK8 A;  4FT8 A;  4PJJ A;  4RA2 A;  1TWC J;  2M3A A;  3HUG B;  3LQQ A;  3IH3 A;  4DIQ A;  5EF6 A;  2OZ6 A;  3CD6 I;  2R4G A;  3SDB A;  2WAD A;  1TT0 A;  4QPO A;  1FOX A;  2HU9 A;  4X6A J;  2RQP A;  1ACI A;  4O6J A;  4WK8 F;  2ZXW H;  3IH2 A;  4DJA A;  2VXD A;  1IAW A;  1WGX A;  2K3P A;  2K86 A;  3DU6 A;  1B4A A;  1U8R A;  1SFU A;  4BS9 A;  1ZR4 A;  5FKO A;  2KDO A;  3E5Q A;  1HDP A;  5KCM A;  2R7Q A;  2G7U A;  3TP0 A;  2HI3 A;  3TDU C;  1G4D A;  4AIK A;  4YG2 F;  2XKP A;  3E7L A;  3O8H A;  4CYC A;  4BAC A;  4E7K A;  4FHT A;  2VXZ A;  3DBH B;  1JT6 A;  1S72 I;  3SQN A;  4Y15 A;  3K4N A;  2FA5 A;  2Y69 H;  3AG1 H;  1R9T J;  5F27 A;  4EGY A;  2DA1 A;  3ABL H;  3BC8 A;  1UAA A;  1IDY A;  5TJJ A;  2F5D A;  2BV6 A;  1U8B A;  4E7H A;  2QKM B;  4HNU A;  3EYI A;  4I2O A;  5FGM A;  3V8L A;  2GXG A;  4XLA A;  2DA5 A;  3VFZ A;  3BCA A;  2ICW G;  2CRG A;  2ZJR F;  1FYM A;  3P9C A;  4B44 A;  1N25 A;  1QGP A;  4IOC F;  3ELK A;  5DTD A;  3FXO A;  1Z6T A;  2R7F A;  4ZYD A;  3J7A O;  2OD5 A;  1L0O C;  4IPA A;  2PJP A;  2HVS A;  4GDF A;  2EV5 A;  2DYR H;  3DTK A;  4ITV A;  3RQ4 A;  1ZGA A;  1X2N A;  5B1B H;  2L7M P;  2GWR A;  3BTJ A;  2ZXJ A;  2A07 F;  2EK5 A;  3IL2 A;  3JRE A;  3JCU C;  2ZME C;  2FQ3 A;  1I5Z A;  2ZME B;  1Z1D A;  4KMU X;  3H1C A;  3OOP A;  5DCM B;  2OTL I;  2RRE A;  4IJA A;  5IP9 J;  4HST A;  2IPQ X;  3HYI A;  2VJ4 A;  3R6S A;  4ENK A;  3ZN1 A;  4MHG A;  4UVB A;  1I1S A;  1BW5 A;  1T38 A;  3F72 A;  2R7O A;  5CVJ A;  1MD0 A;  4FQG A;  2PLY A;  4DW6 A;  3FKJ A;  4IHT A;  2O6G E;  4IHS A;  4I6Z A;  1S7A A;  3W6K B;  3F8F A;  3U1K A;  1O3S A;  2IA2 A;  1YX5 A;  3ESW B;  2A6E F;  1OYW A;  2QYO A;  3E1S A;  5KAF C;  2Z33 A;  3S3O A;  1NH3 A;  3FHN A;  3DWL E;  2VUM J;  3BP8 A;  3IAS 2;  4QLC U;  1EV7 A;  2QF7 A;  2A5Y B;  3PNV A;  4D7N A;  5CLS A;  2HGC A;  1GLN A;  5FB2 A;  3ECH A;  1FMV A;  4ESF A;  2XAH A;  2JT1 A;  2BXY A;  4XK4 A;  2RKH A;  4YFK F;  5LRR A;  1IV6 A;  1NG7 A;  4MEX F;  1RZ4 A;  1IG7 A;  4I09 A;  2ZFU A;  2WA0 A;  1I39 A;  5FRO A;  2XB5 A;  3NWT A;  3DP7 A;  4QWQ A;  4IKF A;  4LK1 F;  4IQJ A;  2LY2 A;  4BU2 A;  1SD6 A;  3EYY A;  3G1O A;  1LUJ B;  5B1A H;  3J80 K;  4BDY A;  1YIT I;  3OIQ A;  3K7A J;  1JKQ C;  4OIP F;  3MKW B;  2FUG 2;  4LK0 F;  3V8J A;  3O8G A;  5KVR A;  3HZJ A;  4XLP F;  2IS2 A;  3IRQ A;  2ISZ A;  1RKW A;  4DNC A;  3KP6 A;  4BXU A;  4MTD A;  1B9M A;  1VQM I;  2MGQ A;  2P5K A;  3MCZ A;  2CQN A;  3RDI A;  1SEU A;  3QQA A;  3WTU C;  2HR3 A;  1MMD A;  2F48 A;  2UUZ A;  2MH2 A;  4CCO A;  3FMS A;  1W36 D;  1I6X A;  2ZBK A;  1WH5 A;  5K5R A;  2EFN A;  2OCE A;  1Z05 A;  3SDG A;  3C3W A;  2R7U A;  4EEF G;  4PGH A;  1MBE A;  2L5Q A;  2MG4 A;  5A2Q Z;  4P96 A;  4FTH A;  4A0Y A;  2MYS A;  4HYE A;  1BR1 A;  4CCK A;  4XNF A;  3VOE A;  5ILV A;  3WGG A;  5E20 A;  3PNY A;  3DLA A;  3H3Z A;  2XSJ C;  4XLF A;  3QPH A;  2FU4 A;  2M8E A;  3NRV A;  1B8I A;  1DDN A;  4XR6 A;  2JMW A;  2G9W A;  4G6D A;  2EBI A;  1PJR A;  3PO3 J;  1I27 A;  1W5T A;  1XMX A;  3IWF A;  5D4S A;  3GTM J;  1QU3 A;  1KU2 A;  1IN6 A;  2DI3 A;  2PG4 A;  2VB6 A;  2VKD A;  5FKK A;  1LB2 A;  4CXF A;  3LSG A;  2WV0 A;  2FQ4 A;  2CW0 F;  3M8F A;  1USS A;  1FOY A;  3KZI C;  1D8K A;  2E71 A;  4HSR A;  4AD9 A;  2CUJ A;  2DU9 A;  3TED A;  1ZRC A;  1XGN A;  1B72 B;  1GDT A;  2V7F A;  3K9T A;  2YPR A;  2DAO A;  3FBI B;  1BC8 C;  2QQB A;  1AWC A;  3FMQ A;  3L1P A;  4XLE A;  1LKX A;  3HOZ J;  1LEB A;  3D0S A;  3CDL A;  1WI9 A;  1O7F A;  3A01 A;  4HX8 A;  3T8R A;  4N9I A;  1FMW A;  1G3Y A;  5FLX Z;  2HVR A;  2IS6 A;  1UST A;  3ECO A;  5DD4 A;  3K4K A;  3GLX A;  2XGE A;  3MZ8 A;  3OIO A;  2PI0 A;  1Z0X A;  2NOG A;  3JTG A;  1HC8 A;  1Z9C A;  1ONV A;  3NQO A;  4OAY A;  3H3U A;  1TW3 A;  3HL2 A;  1D1A A;  5F0F A;  1NK2 P;  1SFX A;  4OMY A;  1W1W E;  2GOX B;  5JI6 A;  4G9Y A;  2VJI A;  1P7I A;  5H20 A;  4CA0 A;  4UUS B;  1D0X A;  3LA3 A;  3E3V A;  5BQT A;  5B3S H;  3I59 A;  4LD5 A;  1Z3Y A;  1IO2 A;  1P6R A;  3SHF A;  3H92 A;  1OKR A;  4R8H A;  5FD5 A;  1OLT A;  5HLH A;  1JT0 A;  3J80 Z;  4OIQ F;  3ABT A;  3DTE A;  5JR3 A;  1VQL I;  2L0K A;  4PFO A;  1JUP A;  2K9L A;  3CF5 F;  2DA2 A;  2CW8 A;  2XPU A;  5FLV A;  3DCF A;  1E3H A;  3G73 A;  3BTL A;  3ERM A;  2O03 A;  2YU9 J;  2Y0S N;  5K1Y A;  1Y1V J;  4CDG A;  1FJL A;  4NC7 A;  4P5O A;  1VF9 A;  1ORK A;  1YS7 A;  2MH9 A;  3RKY A;  2HQA A;  2R7D A;  4M6Y A;  4S05 A;  2D5V A;  1FEX A;  2PMU A;  4HLX A;  1YIO A;  2LRE A;  2MFZ A;  2NVY J;  1U9N A;  3ONQ A;  4Q4Z F;  3Q5F A;  2ELJ A;  2K4J A;  1R00 A;  5LHI A;  1YX3 A;  3HBL A;  2LSO A;  4KN4 X;  4BHB A;  1LE8 B;  3KYL A;  1JI8 A;  3PSF A;  4NBQ A;  2CYY A;  2WTE A;  2FNA A;  3BZC A;  4RLQ A;  4RDU A;  2DW4 A;  4HAM A;  4BJ5 C;  4BY1 J;  2VE8 A;  3Q0V A;  4BXF A;  3QP6 A;  4RS8 A;  3M07 A;  3RKQ A;  3FF5 A;  1KQ0 A;  3ZR8 X;  1UCR A;  3I9V 2;  3TO7 A;  3WTS C;  4HG2 A;  2ME0 A;  3KEY A;  4L9N A;  1FWZ A;  2ESH A;  3CUQ A;  4BY7 J;  3M9A A;  1UFM A;  2XPW A;  2ZSI B;  1R1U A;  3BT9 A;  1T95 A;  1MJ9 A;  3IWZ A;  3VYT B;  4M3D A;  4V19 K;  2QBY B;  5EGO A;  3WTZ A;  3QU6 A;  4XID A;  2VJJ A;  1XX5 A;  3FM5 A;  3I64 A;  2CW7 A;  1EH7 A;  1X19 A;  3V4G A;  2BBY A;  3VYU B;  2V9K A;  1MBG A;  3BG3 A;  4YII A;  1FYK A;  5J3L A;  2M1B A;  1B9N A;  2HYF A;  4X0G A;  1LVA A;  1XB4 A;  1NHA A;  3MVP A;  3VSK A;  2BOL A;  2H09 A;  1KA8 A;  1ZK8 A;  2COM A;  5ERI A;  2L7F P;  3DBR B;  2NNY A;  1BW6 A;  3EPZ A;  1HW2 A;  2CV0 A;  2EA2 A;  2LR8 A;  1HQC A;  3REO A;  2XF5 A;  5FO5 A;  3U21 A;  1ODD A;  2B7E A;  3A0H C;  3L2V A;  1FIA A;  1J9I A;  1CF7 B;  3PFY A;  3RZO J;  2FBI A;  3H9G A;  4AIH A;  3WGH A;  3TOB A;  4IX7 A;  3E0J B;  4A12 A;  3FWE A;  2LF7 A;  3CJT B;  2E1N A;  4DQ2 A;  5LGN A;  1TBX A;  2OAZ A;  1IJW C;  2K9M A;  3LOC A;  3K4C A;  5C3E J;  2X51 A;  2DTR A;  1BJA A;  5KK1 A;  5E3O A;  3DBL B;  1ZGJ A;  1TWF J;  4E7Z A;  2VOD A;  3UNG C;  3CCE I;  4ZH4 F;  1R4N B;  1ETQ A;  5HNH A;  1QVT A;  1BI0 A;  3C2G A;  2XIG A;  2Y31 A;  4GYG A;  5F08 A;  1K4T A;  3OYF A;  4HPQ A;  2KKO A;  1CGP A;  3M8E A;  3MWM A;  3PQK A;  2DA3 A;  1YE9 A;  2NVU B;  2GXA A;  3JAM K;  3J7A Y;  5IP7 J;  1PP7 U;  1MW7 A;  1YG2 A;  4B1R A;  3OR2 C;  3PM1 A;  4QSH A;  4C2T A;  2EFW A;  5HDK A;  2LH9 A;  3WU1 B;  4XON A;  3HM5 A;  3TW6 A;  4M9X A;  4V2G A;  1S9H A;  2FJ1 A;  1VQ4 I;  4CIC A;  4MEY F;  1BI2 A;  1Y39 A;  2V9V A;  4LLG F;  2MA3 A;  3K10 A;  3ROU A;  1F1Z A;  1ZG5 A;  3ZQG A;  4OMZ A;  1UJ8 A;  4MGR A;  3ASN H;  4DZP A;  3FXL A;  1MZB A;  3OYN A;  1VQK I;  1J75 A;  3F6V A;  5FJ8 J;  4MO7 A;  4G7H F;  2VBY A;  1P9Q C;  3K70 C;  1IZ1 A;  2MC4 A;  1HLV A;  1ZYR F;  2OC6 A;  3DEW A;  2UWM A;  5D4R A;  2L4M A;  1FIP A;  3GME A;  2CMP A;  3F22 A;  2IAI A;  1H9G A;  2CFO A;  1ENH A;  4LG0 A;  3EUK L;  3HB9 A;  1ZTR A;  4PSW A;  2WB1 A;  2IGK A;  4RB3 C;  2BY0 A;  2CUF A;  2OCC H;  4IEJ A;  1MDM A;  1ON1 A;  2FSW A;  4XBF A;  2HYJ A;  5C44 J;  4OAZ A;  1BA5 A;  2OPT A;  2QSG X;  1W7P A;  5DYM A;  1SFO J;  1Z21 A;  4Y4R A;  2HWV A;  3GXO A;  1IRZ A;  3WE3 A;  3RSN A;  1YJN I;  2DTZ A;  3GFI A;  3CCQ I;  2X9D A;  4O3M A;  4U7D A;  4LIV A;  3WG7 H;  1VFC A;  1ZHF A;  2JSC A;  2BHZ A;  4Y52 J;  4I0A A;  4C2U A;  3HOW J;  3FIW A;  5ICC A;  2WV1 A;  2EFP A;  2PBI A;  4Y17 A;  2R3S A;  4CCJ A;  3CCJ I;  1U5T B;  1K6Y A;  3EUH C;  3CO7 C;  2JVH A;  2R7R A;  2XAG A;  2AHQ A;  3M7G A;  2DBB A;  2FOK A;  5HS8 A;  1V4R A;  2HQN A;  3ZRG A;  1LDK B;  2MBF A;  1FNN A;  2DT6 A;  4C3I J;  3JAM Z;  3CLQ A;  3JRF A;  2E1O A;  1XG1 A;  3P9I A;  1K83 J;  4RM2 A;  4W1U A;  2H8R A;  4XN0 A;  5CKT A;  2VPL A;  3L2R A;  1ETX A;  2NAZ A;  2KL4 A;  1K79 A;  2WAQ N;  5JLW A;  1DQU A;  1MIJ A;  3JRD A;  1KQ8 A;  1MGT A;  2JPB A;  2V1X A;  3S1R J;  1YOV B;  2FE3 A;  3E97 A;  5GTH C;  2DMN A;  1T39 A;  1BL0 A;  1XS9 A;  4ZYG A;  2A69 F;  5J1U A;  2MLG A;  3FXK A;  2HXI A;  2LD5 A;  3AFH A;  4GFB A;  3HRS A;  1Y1W J;  2LY9 A;  1X1P A;  3I58 A;  3AL0 C;  2CQ7 A;  3JRB A;  2LOO A;  3K6G A;  4JOM A;  5H2F C;  1ZRD A;  3B73 A;  3AL0 B;  2Y9Y A;  2JSP A;  2JTV A;  2LMD A;  1FZP B;  2MAB A;  5DS9 A;  3F6O A;  1XCB A;  2D1H A;  3VEP A;  3A02 A;  3ZQI A;  4EJO A;  3F21 A;  5L3D A;  3VSL A;  2O3F A;  4LG3 A;  4XMY A;  2VT2 A;  1PUE E;  1U3E M;  1HDD C;  3OYB A;  3ZMV A;  5KHD A;  4KIG A;  3FMR A;  1WVR A;  2L2O A;  2F4M B;  2A05 A;  2M7A A;  2M87 A;  1B8I B;  3WTX C;  2ZB9 A;  3DTI A;  2JA7 J;  4BBS J;  3HKZ A;  2KIU A;  5HNF A;  5CVI A;  1BI1 A;  5E1X A;  2W1O A;  5HDN A;  1AOY A;  3M1C A;  1YW7 A;  3P7N A;  2L02 A;  3TOA A;  4GXO A;  3A03 A;  3WHB A;  4XRS A;  3IV5 A;  5DM6 F;  1B59 A;  1VND A;  1TQP A;  4C30 A;  5EEA A;  4WF2 A;  3VOD A;  1U0J A;  4MQV A;  2PMZ N;  2L7Z A;  3S14 J;  3SXY A;  4CZC A;  1O3T A;  3ZQH A;  3A01 B;  4NDL A;  2BY1 A;  1ZH5 A;  2JUC A;  2CJJ A;  4F52 A;  2KZG A;  4ZYH A;  2BHY A;  2QZ8 A;  5EJC A;  3T8T A;  4L5I A;  4KT6 A;  1WJD A;  1Q1V A;  4IL6 C;  2ADU A;  5TRD A;  2MC3 A;  2LYC A;  3U1D A;  4A3E J;  5H6Q A;  4I0B A;  3H9Q A;  4RBO A;  4RB2 C;  4V2F A;  1IDZ A;  3RKW A;  1KQ9 A;  3P5J A;  3RI4 A;  3E6M A;  3DF8 A;  2L4A A;  2OA4 A;  2YU3 A;  3I59 B;  3PNT A;  3CCR I;  5D8K B;  1O3Q A;  1OJL A;  3PUF A;  1Q1H A;  2JJ7 A;  5E17 F;  4LOC A;  2K85 A;  1SD5 A;  2UXN A;  2KRF A;  4BJT A;  3CME I;  2FNP A;  1JXS A;  4LB6 B;  5FFX A;  1XPX A;  1QNT A;  4Z2Y A;  2ZFW A;  3HXL A;  1MBF A;  3SFI A;  4IVN A;  4RGX A;  2K40 A;  4HQM A;  2E1M C;  4ENM A;  2E1M B;  3CC2 I;  4D0P A;  1VQ7 I;  4PJL A;  2EB7 A;  2Z5U A;  1R49 A;  3HTU A;  2RNG A;  5LHG A;  2L9R A;  2QQ9 A;  1UEL B;  2TDX A;  3FK7 A;  3SZG A;  2B63 J;  2OQR A;  4EAT A;  2EIL H;  1JKR C;  1DUX C;  1OR7 A;  3N97 A;  5E3L A;  1WJ5 A;  1V5E A;  3BJ6 A;  1H9T A;  4HOB A;  4PFP A;  4AID A;  1ZG1 A;  1FP1 D;  2J5O A;  3JSP A;  4HZF A;  2Q0O A;  2K02 A;  3I54 A;  2E19 A;  3OYG A;  1BI3 A;  1R6R A;  4KJZ A;  5D6E A;  3KP7 A;  4B3X A;  5EG0 A;  2QUF A;  3RTR A;  3MZH A;  4DBR A;  1IN5 A;  1P4A A;  4WXD A;  3CUQ C;  3QWL A;  3HOS A;  3CUQ B;  4U88 A;  5ICE A;  3CCY A;  2KP6 A;  5AON A;  4RB1 A;  2DPU A;  1OCO H;  2ZNY A;  4O5V A;  4IXA A;  5F1J A;  1B1B A;  1FSH A;  3NWS A;  3G71 I;  5EGO B;  4JYK A;  4UNO A;  2ID3 A;  2D1V A;  5GAE J;  4HNT A;  1QVU A;  5J6X A;  5M5X J;  3H0D A;  3GTL J;  3ZMU A;  4ZJZ A;  2RGV A;  4BHC A;  1Z3X A;  1WH7 A;  4BQA A;  2HZD A;  2BXZ A;  1D3Y A;  2LKP A;  2VKH A;  1P7J A;  3FK6 A;  4CSW A;  5J47 A;  3AKZ A;  3S15 J;  2V9P A;  2AQE A;  5F0C A;  4F92 B;  2HYG D;  4L5E A;  3MZY A;  2VT3 A;  3WU0 A;  5CYV A;  3GW2 A;  2QWW A;  1N77 A;  1EH6 A;  2LTP A;  2QQ8 A;  4ESB A;  4N4N B;  1SD4 A;  4XN3 A;  4ANJ A;  3QYF A;  2Y9Z A;  1Y0U A;  1MBH A;  1MNE A;  5IT9 Z;  4Q47 A;  3K4B A;  4XLC A;  3ABM H;  5K5O A;  1MKM A;  4ZYE A;  1PP8 F;  3CF2 A;  2EPF A;  3F8M A;  3J7Y J;  3OYL A;  4OU0 A;  2Z3Y A;  3LA2 A;  3KYC B;  3RPU D;  1W4M A;  3TL4 X;  1IGN A;  4Y13 A;  5L3F A;  1SMY F;  2I8D A;  2IVM A;  2PEX A;  3LNQ A;  4ENJ A;  2X0L A;  4KT5 C;  1MH4 A;  1VTN C;  4KIF A;  2DCE A;  2E2J J;  4A3K J;  5LFA A;  5GTI C;  1QQI A;  3AG2 H;  5HLI A;  3C2H A;  3BR5 A;  2O8K A;  3VYR B;  5J8F A;  1P2F A;  2A3S A;  4JQF A;  1ZEL A;  2XKO A;  1DP3 A;  2X1E A;  2KLO A;  3EUH A;  1YQA A;  4XSX F;  2O8X A;  4RAZ A;  4OIR F;  1QZE A;  5HLG A;  4XSZ F;  3HOX J;  1LPQ A;  4LIT A;  1H89 C;  1D0Y A;  3IUO A;  5J4Y A;  3CLO A;  5FKL A;  4EJV A;  2W48 A;  3K4J A;  2WC2 A;  1GUU A;  4U0W A;  3BDD A;  3VDX A;  2E1C A;  3W2A A;  2ZXI A;  4B48 A;  5LD2 C;  3H5A A;  2HKO A;  3PFI A;  3S17 J;  1MMS A;  4HRI A;  2DN0 A;  1MBK A;  4R1H A;  2DOE A;  3WHC A;  3IAM 2;  4Z6Y A;  4YRV A;  4H4K C;  3BTC A;  4A3F J;  2WAE A;  1Z6R A;  4FCY A;  3KLN A;  1JHH A;  1UG0 A;  2IRF G;  2I5U A;  3PIO F;  1IRX A;  2PN6 A;  2HOA A;  3FX3 A;  4QPQ A;  3CMA I;  3HSE A;  4UUV A;  2E36 A;  4AC0 A;  2KT0 A;  3WU2 C;  2W7N A;  3GO5 A;  2DOA A;  3S1Q J;  4G6T B;  3ZQF A;  3MMY B;  3V7S A;  2Y0S A;  2HKX A;  5EDN A;  2R5Z B;  1MMN A;  1TQI A;  1XMK A;  2CWE A;  2IEK A;  3OYI A;  3CJN A;  2FRH A;  5EYR A;  5ILU A;  1S8N A;  2VQL A;  1V3F A;  4ZZD A;  1R1T A;  5DDG A;  3ASO H;  2R7T A;  3T1B A;  1QPM A;  4FIS A;  4XLH A;  1ETV A;  1A36 A;  1R4M B;  2P0W A;  1MDM B;  4E6K G;  2K7L A;  2QKL B;  1A31 A;  4FE4 A;  3OYC A;  4HA8 A;  3KIO A;  3KET A;  1W7P B;  1FSE A;  2NNN A;  1TP4 A;  2ME6 A;  4G12 A;  5HVQ C;  5E3N A;  1YJW I;  1EF4 A;  2DT5 A;  4P1W A;  2IBD A;  4XKC A;  3M4O J;  5M5Y J;  3K4M A;  1U2W A;  1R7J A;  4L18 B;  1O7L A;  1SVO A;  4B43 A;  1HW5 A;  3DPL C;  4EGZ A;  2VC0 A;  4BE0 A;  3ABK H;  2VKV A;  2WBM A;  3QPL A;  1SVL A;  1EKE A;  2XAQ A;  2V4J C;  5J8C A;  2CV2 A;  1XD7 A;  1MBJ A;  1F43 A;  2R93 J;  2IW5 A;  4M3G A;  2RN7 A;  4L5J A;  5D5U B;  2OJE D;  3IKT A;  3RZD J;  2CUE A;  3DEE A;  2W00 A;  5K5Q A;  1OIS A;  1KON A;  2V6E A;  1VQ5 I;  3OYA A;  4HBL A;  2R5Y A;  4LB5 A;  4JX6 A;  1S7E A;  2F5C A;  1IN8 A;  3IRR A;  2M5W A;  2GA1 A;  3CUO A;  4YFN F;  4UHT A;  2KHM A;  2QLZ A;  4MNU A;  1KYZ A;  1TL8 A;  3GZ6 A;  2GZW A;  3KP5 A;  1QPI A;  1JE8 A;  1BJZ A;  3LSI A;  2DA4 A;  3M8J A;  3OY9 A;  1GT0 C;  3S3M A;  1DU6 A;  2DYS H;  2FMY A;  2IXS A;  4N4O B;  5C4J J;  3Q0U A;  4PUS A;  2DO7 A;  3CCU I;  1VQ9 I;  2E2I J;  4KDP A;  2BY2 A;  5E8G A;  5LEK A;  1POG A;  5K7H A;  3FXJ A;  3DLL F;  4B09 A;  4U0Y A;  3NAU A;  3S3N A;  3PSI A;  3ZMT A;  4BAY A;  1MJA A;  4A3C J;  4I99 C;  1XDU A;  1XMA A;  2ZKZ A;  3BZK A;  1RES A;  2E5N A;  1IUY A;  2E5Z A;  4YEL A;  1IN7 A;  1W5S A;  4RAF A;  4YEJ A;  3BPX A;  2A6H F;  2CSO A;  3GZ5 A;  1BIB A;  1W0U A;  2DQL A;  2K9S A;  2P7V B;  2F2E A;  4N0B A;  1E3O C;  2IS4 A;  1NK3 P;  2LVS A;  2AQF A;  2OTJ I;  4AM3 A;  4UV9 A;  2GQQ A;  5EEH A;  1MMA A;  3WG9 A;  1JGG A;  4M3B A;  4NB5 A;  4XOT A;  2CFX A;  3W6J B;  3I56 I;  1K6O A;  1HXD A;  3C2B A;  3QOP A;  5DD8 A;  2F6C A;  4B8X A;  3S93 A;  2VKE A;  3LL7 A;  3OWT A;  3GCM A;  4NC6 A;  2P8T A;  3CP2 A;  4ASN A;  5ICG A;  5E79 C;  2DMP A;  2ZO4 A;  4MLO A;  1K4S A;  5DV5 A;  3S32 A;  2X4H A;  4YIR X;  1OCT C;  3IKV A;  1T2K A;  1OQY A;  2XGX A;  5DEQ A;  4A3J J;  1EA3 A;  3J81 K;  3HPH A;  1ETW A;  3K1P A;  3BQY A;  3RKX A;  2EIJ H;  1V5G A;  3LSP A;  1BOB A;  3DQV C;  3JRA A;  1MMG A;  4P9U A; 
#chains in the Genus database with same CATH homology
 3ZN0 A;  3LWF A;  1O3R A;  1TLH B;  4G7O F;  3I0T A;  3KZZ A;  1TTY A;  4AWX B;  1IN4 A;  2OZU A;  3R0A A;  2YX7 A;  1S7O A;  4A0X A;  1FBS A;  1TNS A;  5L3G A;  5FFZ A;  4WX9 A;  2AXL A;  1ON2 A;  4HV5 A;  3TQN A;  1QZZ A;  2OBP A;  4HQE A;  3GYH X;  2D45 A;  1L3L A;  3OV8 A;  1RNL A;  3KEO A;  4H0E A;  4EM2 A;  2JPC A;  3BRO A;  4LJZ F;  4HV6 A;  2JRT A;  2Y48 A;  4PCQ A;  1TQM A;  3DPT A;  3MFK A;  3CTA A;  2O0Y A;  2EA4 A;  2CG4 A;  2W24 A;  4LFU A;  1T0F A;  1T6S A;  2W57 A;  1WQ2 A;  3E6B A;  1XSX A;  1KYW A;  3FXR A;  4N9H A;  2W25 A;  2EFQ A;  2HZT A;  3QRF F;  1FPQ A;  5FD6 A;  3F3X A;  2Y0M A;  4A5M A;  2PFB A;  2W85 A;  4RAY A;  2VON A;  3QP5 A;  2B0L A;  1HBX G;  2DLL A;  1JGS A;  5D5V B;  3Q9S A;  4M9S A;  4MTE A;  2XAF A;  4PZJ A;  5HS9 A;  1SAX A;  1BIA A;  3PQJ A;  2K4B A;  1BBY A;  1RUN A;  1TW2 A;  3MQ0 A;  3BY6 A;  3CO6 C;  3G3Z A;  5H6R A;  1J59 A;  4HF1 A;  1K7A A;  3TDZ C;  4AVP A;  4EJW A;  3TO6 A;  1OYI A;  5LLQ A;  1G3W A;  4UVC A;  5DUK A;  3GFJ A;  1BM9 A;  1UB9 A;  4LMY A;  4IRI A;  4HLY A;  4OIO F;  1XDS A;  2GAU A;  2P4W A;  3DEU A;  4ENN A;  4A0Z A;  4HDU A;  2BE5 F;  4AIJ A;  4P55 A;  3ERE D;  1R22 A;  4Q48 A;  1XGM A;  1UHM A;  4M6X A;  2YX4 A;  3ZPL A;  2QM3 A;  2HS5 A;  4EVI A;  1YO5 C;  2Y75 A;  4Q5S F;  4I02 A;  3RIR A;  2ESN A;  2C6Y A;  4EQQ A;  2L01 A;  2RDP A;  3GUD A;  1OYY A;  3F8C A;  2Q8K A;  4XLN F;  4KFC A;  4YIF A;  2HQR A;  3HHH A;  2NRA C;  1XN7 A;  1IXR C;  3ZMZ A;  4L0Y B;  2K27 A;  1J2X A;  1SMT A;  2ZJ2 A;  5JFR A;  3HHG A;  1HKT A;  4NQW A;  1FC3 A;  5LRS A;  1HW1 A;  4RGR A;  4WXC A;  3IC7 A;  1H0M A;  4UV8 A;  4KYW A;  2YSR A;  3ABU A;  2XHK A;  1X3U A;  4G7Z F;  1ZLK A;  1QZY A;  4G94 A;  1FLI A;  2UZK A;  4A2U A;  3L9F A;  3WOD F;  5JVT A;  1WRJ A;  4NHJ A;  2RNJ A;  1LEA A;  1LDD A;  2VBZ A;  2L54 A;  1RUO A;  4LGW A;  3DXJ F;  4PGG A;  2BGC A;  5F1R A;  2FXA A;  2RVC A;  2MD5 A;  1Z91 A;  3FHZ A;  2CO5 A;  3HRT A;  1R58 A;  2BEO A;  2G7H A;  4CHU A;  5BPI A;  2IJL A;  3KFW X;  3WTV C;  1G3T A;  1WKM A;  2GA2 A;  4WWC A;  2AS5 F;  3DV8 A;  3F23 A;  3F8B A;  2OQG A;  4KMF A;  2CQK A;  3BWG A;  1BN5 A;  5F6F A;  4GO1 A;  1P4X A;  3FXQ A;  2V6C A;  4KNY A;  1R5G A;  2RC4 A;  3ISP A;  2ISY A;  3L2C A;  2UXX A;  3V7C A;  1F9N A;  4EV0 A;  4I98 B;  2EV6 A;  2EJR A;  2STW A;  1YYV A;  3BJA A;  4GCV A;  2DK5 A;  2E7X A;  3EDP A;  3FM3 A;  1KU7 A;  4MQ9 F;  2F5F A;  5A2Q K;  3GFL A;  5ICF A;  2H94 A;  2XRO A;  4GGG A;  1IRF A;  2XAS A;  1S3J A;  4KUM A;  5L3C A;  3DKW A;  3SZP A;  1DPU A;  5CJ9 A;  1KU3 A;  1ZRF A;  1MJB A;  3WGI A;  1OPC A;  2P7C B;  1LJ9 A;  3VB2 A;  5D5X B;  4BYY A;  1LQ1 A;  1I1G A;  3KP4 A;  1K78 A;  4UXN A;  1KGS A;  1XSV A;  1OMI A;  2BYV E;  2XAJ A;  4L9J A;  3KCC A;  3EET A;  5LGT A;  5FLX K;  2QQA A;  1ZAR A;  3U9G A;  2F5E A;  3TKY A;  5CVR A;  3O6B B;  1GVJ A;  1UHW A;  1U5T A;  4KN7 X;  3GFM A;  2IT0 A;  4XRF A;  5BMZ A;  4A5N A;  4M73 A;  3GX4 X;  4UVA A;  3D5L A;  2RV8 A;  5BPD A;  4OOI A;  3C1D A;  3DFG A;  3MAJ A;  1FOK A;  4TV7 A;  1GXQ A;  4ON0 A;  2HOE A;  1QBJ A;  1STZ A;  4EJU A;  1G3S A;  2KIF A;  2IA0 A;  3QPT A;  3CDH A;  4LG0 B;  1EH8 A;  2Q2E A;  2EV0 A;  2VBW A;  3FXU A;  1ZLJ A;  3TGN A;  4CGZ A;  3WTY C;  1E2X A;  2WWY A;  2QEN A;  1FYL A;  1REP C;  4M71 A;  3N4M A;  3HRU A;  2VN2 A;  2GXB A;  4BH9 A;  3I5U A;  5LGU A;  2IP2 A;  3E6D A;  1LDJ A;  5EEG A;  5ED4 A;  3T5X A;  4U0V A;  3BPV A;  4A6D A;  4HX7 A;  2LNB A;  2KIM A;  1R36 A;  1SD7 A;  3ZMS A;  1YLF A;  3GEZ A;  1KU9 A;  1YTY A;  1J7K A;  2DQR A;  4WXH A;  1LNW A;  1E17 A;  1QO0 D;  4HX4 A;  3WTW C;  4PDK A;  5HOO A;  1SFE A;  2M45 A;  4BNC A;  4L9T A;  2VE9 A;  4M74 A;  2ZNZ A;  5AIP A;  4LLL A;  3HTS B;  3WE2 A;  1BC7 C;  4KA4 A;  1P92 A;  2VBX A;  2GIV A;  2FBH A;  3HRM A;  1BOA A;  3AAF A;  2DPD A;  4RGS A;  1HKS A;  3F8N A;  3C7J A;  3FZV A;  3IHU A;  1HKQ A;  6PAX A;  5IT3 A;  1HSJ A;  5LEJ A;  1W7P D;  5L3E A;  2EWN A;  3HUG A;  5HDG A;  5LBQ A;  5BS6 A;  2ACJ A;  1GHC A;  1XCV A;  1JHF A;  1S6L A;  1U6G A;  2STT A;  4IF4 A;  3RPU A;  4EM0 B;  3KLO A;  3V8K A;  3K2Z A;  1GXP A;  4F7Z A;  4RB0 A;  4G8X A;  4JK1 X;  2A61 A;  3T0Y A;  4BHP A;  3K69 A;  4KIB A;  2MLK A;  3LST A;  3JTH A;  4YFX F;  5D6F A;  2P6T A;  1FX7 A;  2EFO A;  3C18 A;  1PDN C;  1FY7 A;  3I4P A;  5L3B A;  2VOP A;  3LAJ A;  3RJP A;  2PMH A;  2ZME A;  1ZG3 A;  1IXS B;  3NEU A;  5DCM A;  4K2E A;  4L9V A;  2HTS A;  1Z7U A;  2ETH A;  2V1U A;  3R61 A;  4JBA A;  2FML A;  2XRN A;  1YW9 A;  1IRG A;  3ML6 A;  3U2R A;  5D8L B;  3LFK A;  1F5T A;  4HW0 A;  3RPQ A;  2LDU A;  5CVU A;  1IXC A;  1IW7 F;  3EQL F;  2O61 A;  2W84 A;  2XUB A;  1DPR A;  3M1E A;  2XVC A;  5E18 F;  3LA7 A;  3L09 A;  4KIC A;  4A6E A;  3QAH A;  2CGP A;  1FBQ A;  4P9F A;  1YS6 A;  4FX4 A;  3L7W A;  1ZAO A;  3BJO A;  1B6A A;  3JW4 A;  4HF0 A;  3HIF A;  3J81 Z;  1FP2 A;  5DUI A;  3K1N A;  1WWX A;  3S2W A;  2OU2 A;  4ETS A;  2IA1 A;  3MEX A;  4CO8 A;  3COA C;  3RYP A;  2L3D A;  4L0Z B;  4CZZ A;  3V7R A;  4S04 A;  5E8I A;  4HDV A;  3BZ6 A;  3GF2 A;  2ZCW A;  5BOX A;  2J5P A;  2YR2 A;  4EJT A;  3HSF A;  5F64 A;  3E6C C;  1ZRE A;  2DFI A;  3BOQ A;  2Z99 A;  3K1M A;  1XSD A;  2VOO A;  1FBU A;  1T98 A;  1K78 B;  4HF2 A;  4E70 A;  3P9K A;  4IRG A;  3ZP5 A;  3R4K A;  1D5V A;  1RI7 A;  4G6Q A;  2XV4 S;  2ELH A;  3R0J A;  4EM1 A;  3SFZ A;  1U5T C;  2H27 A;  3KP3 A;  4OIN F;  2VC1 A;  1J0R A;  2LF8 A;  1ULY A;  3I53 A;  3KP2 A;  1YFH A;  2V79 A;  2KJB A;  2NYX A;  1RIO H;  2FBK A;  2QVO A;  3LAP A;  1HST A;  2PQ8 A;  1YW8 A;  1A04 A;  3QU3 A;  4CYD A;  3O2P E;  1G6N A;  1WSU A;  2FEZ A;  1S29 A;  5E1Z B;  1R1V A;  5ILS A;  1XGS A;  5AIQ A;  5HS7 A;  2HDC A;  1C0W A;  2E7W A;  1IF1 A;  2P6S A;  3GWZ A;  2KJC A;  3E5X A;  2D2W A;  3HSR A;  1FT9 A;  5CVV A;  2V1D A;  3I71 A;  3KE2 A;  4M9Z A;  3ZMD A;  2A68 F;  2M30 A;  2H6B A;  3LQR A;  3WTT C;  4ZZL A;  3Q9V A;  3GVA A;  1U78 A;  4I7H A;  4EMS A;  1R5H A;  2Z9O A;  3O3K A;  2P5V A;  1J5Y A;  3R60 A;  5D5W B;  4FX0 A;  1DP7 P;  4U7B A;  1P4W A;  3B02 A;  2P5L C;  2JZY A;  3ULQ B;  4WCG A;  1O57 A;  3L00 A;  2H6C A;  2HEO A;  2HTJ A;  4I01 A;  4R79 A;  3SZT A;  4ESJ A;  2QBY A;  1XGO A;  3KEQ A;  5E1W A;  3RYR A;  2HFH A;  2FF4 A;  4GYI A;  3TO9 A;  4M72 A;  5JHU A;  1R23 A;  3ZQ7 A;  3K0L A;  5IT9 K;  4RGU A;  1D8J A;  3JSO A;  5DCF A;  4LLN A;  3E5U A;  1ZN2 A;  3KZY A;  1F4K A;  4IRH A;  3HOT A;  2NS0 A;  1CF7 A;  5LHH A;  1TNT A;  2DK8 A;  4FT8 A;  3LQQ A;  2OZ6 A;  2RQP A;  4O6J A;  4WK8 F;  1IAW A;  2K86 A;  1B4A A;  1U8R A;  1SFU A;  3E5Q A;  2G7U A;  3TDU C;  1G4D A;  4AIK A;  4YG2 F;  2XKP A;  4FHT A;  2VXZ A;  3SQN A;  4Y15 A;  2FA5 A;  4EGY A;  5TJJ A;  2F5D A;  2BV6 A;  3EYI A;  4I2O A;  5FGM A;  3V8L A;  2GXG A;  3VFZ A;  1FYM A;  3P9C A;  1QGP A;  3ELK A;  1Z6T A;  2R7F A;  4ZYD A;  3J7A O;  2OD5 A;  1L0O C;  4IPA A;  2PJP A;  2EV5 A;  1ZGA A;  2GWR A;  2ZXJ A;  2A07 F;  2EK5 A;  3IL2 A;  2FQ3 A;  1I5Z A;  2ZME B;  1Z1D A;  4KMU X;  3OOP A;  5DCM B;  4IJA A;  2IPQ X;  3HYI A;  3R6S A;  4ENK A;  3ZN1 A;  4MHG A;  4UVB A;  1I1S A;  1T38 A;  3F72 A;  5CVJ A;  1MD0 A;  2PLY A;  4IHT A;  2O6G E;  4IHS A;  1S7A A;  3W6K B;  3F8F A;  1O3S A;  2IA2 A;  2A6E F;  1OYW A;  2QYO A;  2Z33 A;  3BP8 A;  4QLC U;  1EV7 A;  2A5Y B;  5CLS A;  2HGC A;  5FB2 A;  3ECH A;  4ESF A;  2XAH A;  2JT1 A;  4YFK F;  2RKH A;  5LRR A;  4MEX F;  1RZ4 A;  4I09 A;  3DP7 A;  4QWQ A;  4LK1 F;  1SD6 A;  3EYY A;  3J80 K;  4OIP F;  4LK0 F;  3V8J A;  5KVR A;  4XLP F;  3IRQ A;  2ISZ A;  4DNC A;  3KP6 A;  4BXU A;  4MTD A;  1B9M A;  2P5K A;  3MCZ A;  3RDI A;  3WTU C;  2HR3 A;  2MH2 A;  3FMS A;  1I6X A;  2ZBK A;  5K5R A;  2EFN A;  1Z05 A;  3C3W A;  4PGH A;  5A2Q Z;  4P96 A;  4A0Y A;  4HYE A;  3VOE A;  5ILV A;  3WGG A;  5E20 A;  3H3Z A;  3QPH A;  2FU4 A;  2M8E A;  3NRV A;  1DDN A;  4G6D A;  2G9W A;  1I27 A;  1W5T A;  5D4S A;  3IWF A;  1KU2 A;  1IN6 A;  2DI3 A;  2PG4 A;  1LB2 A;  4CXF A;  2WV0 A;  3M8F A;  2CW0 F;  1USS A;  1D8K A;  4AD9 A;  2DU9 A;  1ZRC A;  1XGN A;  3K9T A;  2YPR A;  2DAO A;  1BC8 C;  2QQB A;  1AWC A;  3FMQ A;  1LEB A;  3D0S A;  1WI9 A;  1O7F A;  4HX8 A;  3T8R A;  4N9I A;  1G3Y A;  5FLX Z;  1UST A;  3ECO A;  5DD4 A;  3GLX A;  2PI0 A;  3JTG A;  1Z9C A;  1ONV A;  3NQO A;  3H3U A;  1TW3 A;  1SFX A;  4OMY A;  5JI6 A;  4G9Y A;  5H20 A;  3LA3 A;  3E3V A;  5BQT A;  3I59 A;  4LD5 A;  1P6R A;  3SHF A;  3H92 A;  1OKR A;  4R8H A;  5FD5 A;  5HLH A;  3J80 Z;  4OIQ F;  3ABT A;  5JR3 A;  3G73 A;  2O03 A;  5K1Y A;  4CDG A;  4P5O A;  1YS7 A;  2MH9 A;  3RKY A;  2R7D A;  4S05 A;  4M6Y A;  2PMU A;  4HLX A;  1YIO A;  4Q4Z F;  3Q5F A;  2K4J A;  1R00 A;  5LHI A;  2LSO A;  4KN4 X;  4BHB A;  2CYY A;  2WTE A;  2FNA A;  2DW4 A;  4HAM A;  2VE8 A;  3QP6 A;  4RS8 A;  3FF5 A;  1KQ0 A;  1UCR A;  3TO7 A;  3WTS C;  4L9N A;  1FWZ A;  2ESH A;  3CUQ A;  3M9A A;  1UFM A;  1R1U A;  1MJ9 A;  3IWZ A;  2QBY B;  3WTZ A;  3QU6 A;  3FM5 A;  3I64 A;  1EH7 A;  3V4G A;  2BBY A;  4YII A;  1FYK A;  2M1B A;  1B9N A;  2HYF A;  1LVA A;  1XB4 A;  1NHA A;  2H09 A;  1KA8 A;  2COM A;  5ERI A;  2NNY A;  1HW2 A;  2EA2 A;  1HQC A;  3REO A;  5FO5 A;  1ODD A;  1J9I A;  1CF7 B;  2FBI A;  4AIH A;  3WGH A;  3TOB A;  4A12 A;  3FWE A;  2LF7 A;  2E1N A;  4DQ2 A;  5LGN A;  1TBX A;  2OAZ A;  2DTR A;  1BJA A;  5KK1 A;  1ZGJ A;  2VOD A;  4ZH4 F;  1BI0 A;  2XIG A;  4GYG A;  2KKO A;  1CGP A;  3M8E A;  3MWM A;  3PQK A;  3JAM K;  1PP7 U;  1YG2 A;  2EFW A;  5HDK A;  3WU1 B;  4M9X A;  4CIC A;  4MEY F;  1BI2 A;  2V9V A;  4LLG F;  2MA3 A;  3ROU A;  1F1Z A;  1ZG5 A;  4OMZ A;  4MGR A;  1MZB A;  1J75 A;  3F6V A;  4G7H F;  2VBY A;  1IZ1 A;  1ZYR F;  2UWM A;  5D4R A;  2L4M A;  3F22 A;  1H9G A;  4LG0 A;  4RB3 C;  1MDM A;  1ON1 A;  2FSW A;  4XBF A;  1W7P A;  5DYM A;  2HWV A;  3GXO A;  3WE3 A;  3GFI A;  4O3M A;  4U7D A;  1ZHF A;  2JSC A;  4I0A A;  5ICC A;  2EFP A;  2PBI A;  4Y17 A;  2R3S A;  1U5T B;  3CO7 C;  2XAG A;  3M7G A;  2DBB A;  2FOK A;  5HS8 A;  1V4R A;  2HQN A;  1LDK B;  2MBF A;  1FNN A;  3JAM Z;  3P9I A;  2NAZ A;  1K79 A;  1KQ8 A;  1MGT A;  2JPB A;  2V1X A;  2FE3 A;  3E97 A;  1T39 A;  4ZYG A;  2A69 F;  2MLG A;  3HRS A;  3I58 A;  1ZRD A;  3B73 A;  2JTV A;  1FZP B;  3F6O A;  1XCB A;  2D1H A;  3VEP A;  3F21 A;  4EJO A;  5L3D A;  2O3F A;  2VT2 A;  1PUE E;  1U3E M;  3ZMV A;  4KIG A;  3FMR A;  2M87 A;  3WTX C;  2KIU A;  5CVI A;  1BI1 A;  5E1X A;  5HDN A;  1AOY A;  1YW7 A;  3P7N A;  2L02 A;  3TOA A;  4GXO A;  1B59 A;  1TQP A;  4WF2 A;  3VOD A;  4MQV A;  3SXY A;  1O3T A;  1ZH5 A;  4ZYH A;  2QZ8 A;  3T8T A;  4L5I A;  2ADU A;  5TRD A;  2MC3 A;  3U1D A;  5H6Q A;  4I0B A;  4RB2 C;  3RKW A;  1KQ9 A;  3RI4 A;  3E6M A;  3DF8 A;  2L4A A;  2OA4 A;  2YU3 A;  3I59 B;  1O3Q A;  5D8K B;  1Q1H A;  5E17 F;  1SD5 A;  2UXN A;  2KRF A;  1JXS A;  2FNP A;  4LB6 B;  5FFX A;  1QNT A;  4Z2Y A;  2ZFW A;  4IVN A;  4RGX A;  4HQM A;  4ENM A;  4D0P A;  2EB7 A;  2Z5U A;  3HTU A;  5LHG A;  2QQ9 A;  2TDX A;  2OQR A;  1DUX C;  1OR7 A;  3N97 A;  3BJ6 A;  1H9T A;  4HOB A;  1ZG1 A;  1FP1 D;  2J5O A;  3JSP A;  4HZF A;  2Q0O A;  2K02 A;  3I54 A;  1BI3 A;  5D6E A;  3KP7 A;  2QUF A;  3RTR A;  3MZH A;  1IN5 A;  1P4A A;  4WXD A;  3CUQ C;  3HOS A;  3CUQ B;  4U88 A;  5ICE A;  5AON A;  4RB1 A;  2DPU A;  2ZNY A;  4O5V A;  4IXA A;  1B1B A;  1FSH A;  4UNO A;  2D1V A;  5J6X A;  3ZMU A;  2RGV A;  4BHC A;  4BQA A;  2LKP A;  1D3Y A;  2HYG D;  3MZY A;  2VT3 A;  3WU0 A;  5CYV A;  3GW2 A;  2QWW A;  1EH6 A;  4ESB A;  1SD4 A;  1Y0U A;  5IT9 Z;  4Q47 A;  5K5O A;  1MKM A;  4ZYE A;  1PP8 F;  3F8M A;  4OU0 A;  2Z3Y A;  3LA2 A;  1W4M A;  4Y13 A;  5L3F A;  1SMY F;  2IVM A;  2PEX A;  4ENJ A;  1VTN C;  2X0L A;  4KT5 C;  4KIF A;  1QQI A;  5HLI A;  5J8F A;  1P2F A;  2A3S A;  4JQF A;  2XKO A;  3EUH A;  1YQA A;  4XSX F;  2O8X A;  4RAZ A;  4OIR F;  5HLG A;  4XSZ F;  3CLO A;  4EJV A;  2WC2 A;  4U0W A;  3BDD A;  2E1C A;  2HKO A;  3PFI A;  4R1H A;  1Z6R A;  3KLN A;  1JHH A;  2IRF G;  2PN6 A;  4UUV A;  3FX3 A;  3HSE A;  3GO5 A;  3V7S A;  2HKX A;  1TQI A;  1XMK A;  2CWE A;  2FRH A;  3CJN A;  5ILU A;  1S8N A;  1V3F A;  4ZZD A;  1R1T A;  5DDG A;  3T1B A;  1QPM A;  1MDM B;  2K7L A;  4HA8 A;  3KET A;  1W7P B;  1FSE A;  2NNN A;  5HVQ C;  2DT5 A;  1U2W A;  1R7J A;  4L18 B;  1O7L A;  1HW5 A;  3DPL C;  4EGZ A;  2VC0 A;  2XAQ A;  5J8C A;  1XD7 A;  2IW5 A;  2RN7 A;  4L5J A;  5D5U B;  3IKT A;  5K5Q A;  4HBL A;  4LB5 A;  2F5C A;  1IN8 A;  3IRR A;  2M5W A;  2GA1 A;  3CUO A;  4YFN F;  4UHT A;  2QLZ A;  4MNU A;  1KYZ A;  3GZ6 A;  2GZW A;  3KP5 A;  1JE8 A;  2FMY A;  2DO7 A;  4KDP A;  5LEK A;  5E8G A;  4B09 A;  4U0Y A;  3ZMT A;  4BAY A;  1MJA A;  1XDU A;  1XMA A;  2ZKZ A;  1IUY A;  1IN7 A;  1W5S A;  3BPX A;  2A6H F;  2CSO A;  3GZ5 A;  1BIB A;  2DQL A;  2P7V B;  2F2E A;  4N0B A;  4UV9 A;  2GQQ A;  5EEH A;  3WG9 A;  4NB5 A;  3W6J B;  2CFX A;  1K6O A;  1HXD A;  3QOP A;  5DD8 A;  4B8X A;  2P8T A;  4ASN A;  5ICG A;  2ZO4 A;  5DV5 A;  2X4H A;  3IKV A;  1T2K A;  2XGX A;  5DEQ A;  3J81 K;  3K1P A;  3RKX A;  3DQV C;  4P9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...