3KP7A

Staphylococcus epidermidis tcar (apo form)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
140
Chain Sequence
b'MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
molecule tags Transcription regulator
total genus 54
structure length 140
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp7A00
1R36A 1YS6A 1FBQA 3RKYA 2DQLA 4Y17A 2ZO4A 1YG2A 1XMKA 3IWZA 2EFPA 2GQQA 3B73A 4WXDA 2DK8A 3KE2A 1IN4A 1ZLJA 2HTSA 4A12A 2YR2A 1KGSA 3WTXC 2V79A 5L3DA 5HVQC 3I71A 3FZVA 2DFIA 1JE8A 3JSOA 1QZZA 3GFIA 3KP4A 3SXYA 4WF2A 4CZZA 3BOQA 1IRFA 5JI6A 2DO7A 2O8XA 3M8EA 3F3XA 4U7BA 2XKPA 5HDGA 1QZYA 2RQPA 4ENMA 2VBXA 1S6LA 3L9FA 5FB2A 1BI3A 4WXCA 3BJAA 1L3LA 1K78A 1FNNA 4KYWA 1FSEA 1BIAA 3CO6C 3L2CA 1F9NA 2FMLA 2QQ9A 1U78A 3WE3A 3FXUA 2CW0F 1WSUA 2TDXA 4LG0A 1DDNA 2LSOA 3QP5A 3TKYA 4MEXF 3LA7A 3GLXA 2ZMEB 4GYIA 4EGYA 1F4KA 4XSZF 2A68F 2GA1A 4KNYA 2MA3A 3KLNA 2KIFA 4Q47A 3GXOA 3HOTA 3F22A 4BHPA 4EM1A 3QPTA 1AOYA 4AIHA 1B4AA 1UCRA 3K1PA 2EFWA 3I54A 5HS9A 1D5VA 1YW7A 2XUBA 2FRHA 2CFXA 2FF4A 1W5TA 3COAC 1DPUA 5J8FA 5DUIA 3JTGA 1BJAA 2G9WA 4OOIA 5L3GA 4HLYA 1ZARA 2KKOA 2XVCA 4RS8A 1XDUA 2O0YA 4HYEA 3H3ZA 5DDGA 5JR3A 1V3FA 1G3WA 2HOEA 1ZRCA 3ZP5A 4A5MA 5E20A 2NNNA 2ZNYA 1FT9A 3GFJA 4LB6B 2JT1A 2H6CA 1OYYA 1EH8A 3EYIA 1U2WA 3WE2A 1PP8F 2RVCA 2PMUA 1HSTA 5E1XA 2L3DA 4EJWA 4HDUA 2OA4A 4L0YB 3GFMA 4YIIA 1FBUA 2VT3A 4BQAA 3ZMZA 1HW2A 3MZYA 2GAUA 1F1ZA 1BI0A 2ETHA 3QP6A 2QBYA 4I01A 4HX8A 4LK0F 1LQ1A 3WU0A 3R6SA 4I7HA 4KFCA 3J80K 4Q48A 4ZZLA 1U5TC 4S04A 4GO1A 3I59A 3I64A 1BBYA 5E8GA 5H6RA 1LDDA 4A0XA 2BBYA 3FX3A 3I0TA 2RKHA 2NS0A 4BNCA 1IUYA 3EQLF 5D4RA 4ASNA 2IT0A 1T0FA 2Y75A 2QLZA 1WWXA 1GXPA 4ENNA 1UFMA 3FMQA 2WWYA 1I5ZA 2GWRA 2ISYA 1TQMA 4A5NA 2D1VA 3RPUA 3HIFA 4KIBA 5LGUA 2PBIA 5D5WB 4ESJA 2P5KA 4S05A 2P5LC 1IN5A 4ENJA 2DQRA 1MJBA 1YYVA 1RI7A 2G7UA 4N9HA 5ED4A 2VE9A 3CUQB 2V1UA 4M71A 1HW5A 2CYYA 1S7AA 1TW3A 1REPC 1PUEE 1J9IA 2W57A 4PCQA 2ZJ2A 1D8KA 4UVAA 3SZTA 4IRGA 3ZMTA 4QWQA 3AAFA 3BDDA 3J7AO 4RGSA 3BPVA 1W7PB 5AIQA 2R7FA 1P4WA 4N9IA 2AS5F 4CGZA 2MBFA 3E5XA 2KIUA 3LAJA 5J8CA 3K69A 2STTA 2K4JA 3QAHA 2RN7A 5AIPA 2QM3A 3HRUA 4BH9A 4A6DA 4HQMA 3PFIA 2A5YB 2DPDA 2A07F 1IN8A 1LDKB 1KU9A 3TGNA 3R4KA 2VC0A 3LFKA 1U8RA 3O6BB 3WTVC 3HSFA 1YO5C 3T8TA 1IZ1A 2P8TA 1KYZA 3IHUA 3C3WA 1W5SA 1K6OA 4PDKA 1XN7A 1UB9A 1HKQA 5CVVA 4M6YA 3VFZA 1X3UA 2WV0A 1WQ2A 1EH7A 1STZA 1UHWA 1G4DA 4EGZA 1FP2A 3TDUC 5DV5A 5D5VB 4RB2C 3LA3A 4M9ZA 1ODDA 4G8XA 4P9FA 3I5UA 1ZYRF 3FWEA 4I09A 4Q4ZF 4MNUA 2XKOA 1G3TA 1HKSA 3U9GA 2PFBA 2FMYA 1MGTA 4Y13A 1IF1A 1MD0A 2XHKA 2NAZA 3I53A 3BY6A 4CDGA 1JHFA 3F21A 4LFUA 3DQVC 2Q2EA 5DD4A 2FXAA 4AVPA 4O3MA 1QBJA 1LJ9A 2E7WA 1R00A 3HSEA 1ON1A 4KA4A 3IRRA 5LRRA 4JQFA 1E2XA 1BN5A 5ICFA 2IPQX 4JK1X 4HF2A 1FWZA 1ZHFA 2FEZA 2W85A 3L7WA 2Q0OA 4OMZA 4IRHA 4M9SA 4DNCA 2QWWA 3MAJA 2BE5F 2M8EA 2XAJA 4N0BA 3F23A 4CHUA 2CSOA 4U0YA 4EM0B 4HV6A 4L5JA 4ZYHA 5ILUA 2YU3A 1IXRC 3LQQA 4ZYDA 3GW2A 4GXOA 1XB4A 1ZG3A 4LK1F 1KU7A 2DI3A 4KN7X 4IJAA 5DEQA 1Z9CA 1P4XA 4AIJA 2FBIA 3P9CA 3E6DA 5JVTA 1R23A 2GZWA 1KQ9A 4IF4A 4BHCA 1B1BA 2L01A 3V8LA 2O03A 4P55A 5A2QZ 1FLIA 4F7ZA 1PP7U 1IAWA 3KP7A 4EJOA 3E5QA 1YIOA 2XASA 3GF2A 3HSRA 4HW0A 3CO7C 2E1CA 3T5XA 5HDNA 2HKOA 2XV4S 1TW2A 4RGUA 2H09A 2XAFA 3ERED 3E6CC 3HOSA 2K27A 1HKTA 3M1EA 4KIFA 2FNPA 3R0JA 2IRFG 2DPUA 3WGIA 5K1YA 3KP2A 2OU2A 2M30A 3H3UA 4EJUA 3MQ0A 2CWEA 1XD7A 5D5XB 3GFLA 1KYWA 3K2ZA 3BROA 1ONVA 2O6GE 2YX7A 3ABTA 1SFUA 2PQ8A 1IRGA 5ICCA 1HSJA 2QZ8A 3DPLC 5L3CA 4UNOA 2P4WA 2FNAA 4XLNF 2O61A 3T1BA 5CJ9A 1RUNA 4LLLA 1DP7P 4KN4X 2RDPA 1I1GA 4UUVA 1TQIA 1QO0D 2NRAC 2O3FA 1C0WA 3WTUC 3V7SA 4UXNA 4RAYA 2A3SA 2P7VB 4OINF 3M9AA 3RPQA 1YTYA 2HR3A 3GO5A 3M7GA 1B9MA 1JXSA 1YS7A 5D8LB 3NRVA 2UWMA 2HZTA 2V6CA 1YFHA 4MTEA 2YSRA 3J81K 3SHFA 3J81Z 2QBYB 4MGRA 1XGSA 4P9UA 3WTTC 3CUQC 4AWXB 2L54A 3KZZA 4RGXA 2QVOA 2WC2A 4A0YA 4ENKA 2OAZA 4BXUA 2Z5UA 3I59B 2L4AA 2G7HA 2PN6A 3TO6A 4XBFA 1ZAOA 4YFKF 3E5UA 2H94A 1ZGAA 3W6KB 4WWCA 5ILSA 4B09A 1XCBA 4U0VA 2F5CA 2ZFWA 2ESHA 1CF7B 1S3JA 1LB2A 1IXCA 2FE3A 3VEPA 3HHGA 3WTZA 2L4MA 2E7XA 2UXNA 4BHBA 4HQEA 2W84A 1A04A 4KMFA 1RIOH 3FXRA 3R60A 5FD5A 2J5PA 3KP3A 3EUHA 3HRTA 3ZMUA 1KU2A 3WGGA 3PQKA 3GZ5A 5LRSA 5FGMA 5LLQA 1SD7A 1KA8A 1DPRA 3SFZA 4NHJA 4Q5SF 5D5UB 4KIGA 2ZMEA 3EETA 5HOOA 3DXJF 3GYHX 2HDCA 5CLSA 5IT3A 2K02A 5H6QA 2VODA 4HAMA 4L5IA 5D6EA 3K9TA 4FT8A 2EJRA 2M5WA 4I02A 3DPTA 5FFZA 1MDMB 1HQCA 3KETA 3R0AA 4PZJA 4LB5A 2Z99A 1BIBA 3ZMDA 2FBKA 2VE8A 4NQWA 4O5VA 4G7HF 3ZQ7A 1B6AA 1O3SA 5L3BA 3HTUA 1ZG1A 2XRNA 4TV7A 3VOEA 3GVAA 5K5RA 4LJZF 3Q5FA 3F8FA 2ZNZA 4P5OA 1U6GA 2ZKZA 3NQOA 1BI2A 2VBZA 3C1DA 3RYRA 1TNTA 3DF8A 2OZ6A 3OOPA 3DEUA 2ISZA 1ZN2A 3TDZC 3JW4A 1J59A 2GIVA 5KK1A 2UZKA 2DLLA 5LBQA 4L9TA 4I98B 1SMTA 5HDKA 3HRMA 5BPDA 2IVMA 1R5GA 1H9TA 1O57A 2F5DA 3Q9SA 1HW1A 1I27A 1SFXA 2DW4A 2LNBA 3GUDA 3T8RA 1IW7F 1P92A 4OIQF 1OR7A 3HHHA 4KICA 3ELKA 4QLCU 2YPRA 3FF5A 4UVCA 5ERIA 4OIRF 2ZCWA 3IKVA 3CJNA 2A69F 2VC1A 3RTRA 1FYKA 3EDPA 2XAQA 1T6SA 2BGCA 4M9XA 3KP6A 4RAZA 1T39A 3O2PE 2JSCA 4ZH4F 4ON0A 3RKXA 1Z91A 2D45A 2X4HA 5HS8A 3LAPA 3I4PA 2MC3A 5ICGA 5CVRA 3HUGA 4KUMA 2HS5A 1J5YA 4H0EA 3P7NA 4G6QA 5D8KB 3MCZA 4CICA 2Z33A 1FP1D 2J5OA 1R5HA 3EYYA 1R7JA 2LF8A 1TLHB 1MZBA 2QUFA 2MLGA 2K86A 3CUQA 4LLGF 4CYDA 1OMIA 1PDNC 1EH6A 2F5EA 5HS7A 2IA2A 3F8MA 3WTWC 2F2EA 4HLXA 3P9KA 3FMRA 4E70A 3RYPA 2JPCA 3GX4X 1WI9A 1AWCA 3RKWA 5LEKA 5H20A 2EA4A 2VONA 2STWA 5DCMB 1P6RA 1J2XA 1IXSB 3IRQA 2IA0A 1W7PA 3V8KA 3FMSA 2KIMA 1W7PD 1XGMA 5EEGA 4KT5C 1YW8A 4EM2A 4MQ9F 2CO5A 1O7FA 1D8JA 4K2EA 2CGPA 2FBHA 2ZBKA 3LSTA 5E1ZB 1QNTA 2EA2A 3JSPA 3GEZA 3HTSB 3IKTA 2EB7A 3ISPA 3QOPA 3RIRA 3IC7A 5F64A 3E6MA 1KQ8A 4R8HA 1O7LA 3LQRA 3F8CA 4R79A 3QRFF 2A61A 4GGGA 2FOKA 1XMAA 2JTVA 2DK5A 5BS6A 1OKRA 1G6NA 2DAOA 1SFEA 1FX7A 4ESFA 4PGHA 3BJ6A 2PEXA 3W6JB 1U5TA 4U88A 3ROUA 2C6YA 2DU9A 2RNJA 2JZYA 4FX0A 3LWFA 3TOAA 4LMYA 3K1NA 2JRTA 1ZH5A 3FM3A 5E1WA 5LGTA 2Y48A 2QQAA 5LHIA 2HYFA 1K78B 2P6SA 5FO5A 3ZMSA 1FOKA 3CLOA 1K79A 5A2QK 4MTDA 1ULYA 2COMA 2EFQA 5BMZA 1XDSA 3BWGA 2ZXJA 1LDJA 2Q8KA 1S8NA 4IHTA 4AIKA 4L0ZB 3CDHA 4YFXF 5CVJA 4LG0B 5EEHA 3QPHA 1ZG5A 2RV8A 3S2WA 1K7AA 2FQ3A 1XSDA 5LHGA 1OYWA 3WTSC 3GZ6A 2V9VA 6PAXA 2FA5A 4HZFA 4I0AA 1MKMA 1QQIA 3TOBA 1FYMA 2XROA 2DT5A 5ICEA 3FHZA 5BOXA 1LEBA 5E18F 3HYIA 3RI4A 4IHSA 5DYMA 4HV5A 4IRIA 1ON2A 4RB3C 2M87A 4RGRA 4XRFA 1LNWA 4MHGA 3RJPA 1H9GA 2VOOA 1R1UA 2HWVA 4EJTA 4DQ2A 4UHTA 3GWZA 1O3TA 2ELHA 2PI0A 4ZZDA 3G73A 4Z2YA 3F72A 4RB1A 4B8XA 2KJBA 3WGHA 2D2WA 2KJCA 1ZLKA 3JAMK 4G6DA 3JAMZ 4HF0A 1TBXA 4KMUX 5K5OA 1HBXG 1F5TA 3N97A 1TTYA 1O3QA 2OD5A 3L00A 2BEOA 1KQ0A 4MEYF 1SD4A 4L9NA 4HA8A 2XAGA 4A6EA 2AXLA 2RC4A 3QU6A 1TNSA 5E17F 3F6VA 1WRJA 5HLHA 1OYIA 1S7OA 3R61A 3ULQB 5CVIA 1XSXA 1LEAA 1S29A 5BPIA 5D6FA 4R1HA 1SD6A 1GXQA 1T38A 1RUOA 3K1MA 1XGNA 2M1BA 2H27A 3ZPLA 2VXZA 2RGVA 2X0LA 2HKXA 1DUXC 2EWNA 4G7OF 3MZHA 3IL2A 2W24A 4UV9A 1L0OC 4CO8A 2EFNA 3MFKA 3SQNA 3MEXA 4AD9A 1EV7A 4XSXF 1I1SA 2HQRA 1J7KA 3E6BA 2GA2A 3DFGA 1BC7C 4U0WA 4A0ZA 5F6FA 1W4MA 4I0BA 1J75A 2PLYA 4Y15A 5JFRA 1G3YA 1CGPA 2P5VA 3WODF 2FSWA 4L18B 4G7ZF 4OIOF 2ACJA 1O3RA 1RZ4A 2LDUA 1T2KA 4L9JA 1SAXA 1YW9A 2Z3YA 3M8FA 5ILVA 3RDIA 3TQNA 4UVBA 4UV8A 2GXBA 1FY7A 3FM5A 3U1DA 1Z05A 1GVJA 5KVRA 3WTYC 3G3ZA 4MQVA 3T0YA 3H92A 5J6XA 1FPQA 4EJVA 1Y0UA 2PMHA 1OPCA 5D4SA 2HYGD 3D5LA 2CQKA 2F5FA 4I2OA 2OQGA 2HFHA 1WKMA 1R1VA 1YLFA 4HF1A 2PJPA 3J80Z 3CUOA 1JGSA 2NNYA 5DUKA 3P9IA 4HX7A 1KU3A 2IW5A 3TO9A 4WX9A 1RNLA 4G9YA 1ZRDA 3I58A 4GYGA 4ZYEA 1NHAA 2V1XA 3ZN0A 2DBBA 4ETSA 5K5QA 3Q9VA 4M73A 5TJJA 1CF7A 5IT9K 2EFOA 5IT9Z 1FZPB 4EVIA 1P4AA 2XAHA 2EK5A 1P2FA 5FD6A 2QENA 2Y0MA 2DTRA 2ESNA 1B59A 2NYXA 1XCVA 1QGPA 2XGXA 3KCCA 3LA2A 2R7DA 1ZREA 4U7DA 4NB5A 2OZUA 1FC3A 2ADUA 2OBPA 1B9NA 5AONA 4JBAA 5DD8A 2D1HA 3HRSA 3ZMVA 1VTNC 1E17A 1FBSA 4HBLA 4O6JA 3WG9A 5HLGA 3E97A 3KEOA 2HQNA 3F6OA 5FFXA 2EV5A 4HX4A 1J0RA 3BP8A 2MH2A 1I6XA 1BM9A 3F8NA 5HLIA 1YQAA 4IXAA 1MDMA 3VB2A 3IWFA 3ECOA 4LLNA 4ESBA 2EV0A 1GHCA 3ML6A 2A6EF 1R58A 2HTJA 3O3KA 1SD5A 1BOAA 4OU0A 1T98A 4M72A 2E1NA 4YFNF 2KRFA 2QQBA 3ECHA 2HEOA 3REOA 1Z6RA 2HGCA 2W25A 3DP7A 4RB0A 1BI1A 1MJ9A 4LGWA 1G3SA 4OIPF 1ZGJA 4M74A 4BYYA 2VBYA 4ZYGA 3V7RA 3CTAA 5DCFA 1Q1HA 3WU1B 1USTA 2QYOA 2LKPA 4L9VA 3B02A 2PG4A 3L09A 2MH9A 4PGGA 1USSA 4FHTA 1U5TB 3QU3A 1UHMA 2V1DA 4YG2F 3D0SA 1LVAA 2WTEA 4CXFA 3PQJA 1TQPA 3U2RA 3F8BA 5E8IA 3V4GA 2A6HF 4G94A 4WK8F 3E3VA 3VODA 5F1RA 2OQRA 2K4BA 1MJAA 1IN6A 4EQQA 2EV6A 1FYLA 2IA1A 4BAYA 4EV0A 1R1TA 4XLPF 1JHHA 3KP5A 3SZPA 2FU4A 3BPXA 3C7JA 4YIFA 2CG4A 2VOPA 5L3EA 1IN7A 5FLXK 2IJLA 2K7LA 5FLXZ 4FX4A 2Z9OA 2BV6A 4GCVA 1Z1DA 2LF7A 2MLKA 3C18A 3N4MA 1HXDA 4IPAA 3JTHA 5LGNA 2P7CB 2L02A 3MWMA 1U3EM 4EMSA 4LD5A 2B0LA 3OV8A 3BZ6A 1FSHA 3NEUA 4M6XA 2VN2A 5JHUA 2BYVE 5TRDA 4A2UA 1V4RA 4D0PA 1BC8C 4KDPA 2R3SA 3BJOA 3K0LA 4WCGA 3KEQA 3V7CA 2P6TA 3KFWX 3DKWA 3DV8A 4IVNA 2JPBA 2VBWA 4HOBA 2IP2A 1Z7UA 2H6BA 4OMYA 5CYVA 3KZYA 3ZN1A 4WXHA 5LHHA 4HDVA 5CVUA 5LEJA 1XSVA 1XGOA 2YX4A 3KLOA 1ZRFA 5L3FA 1H0MA 3V8JA 2VT2A 2UXXA 3ABUA 2GXGA 5DCMA 2MD5A 1Z6TA 1D3YA 1QPMA 2XIGA 4P96A 2M45A 5BQTA 3TO7A 3FXQA 1SMYF 1R22A
chains in the Genus database with same CATH superfamily
1R36A 1YS6A 1FBQA 1Q1VA 3RKYA 2DQLA 4Y17A 2ZO4A 1YG2A 2ECCA 1XMKA 3NWSA 1IRXA 1Z77A 1MSEC 3IWZA 1X3WB 2EFPA 2GQQA 3B73A 4JYKA 3ZQIA 2FD5A 4WXDA 2DK8A 2B63J 1SVOA 1B72A 3M1CA 3KE2A 1IN4A 2AO9A 3KX2A 1ZLJA 2HTSA 5FRNA 3DU5A 4A12A 2YR2A 1MH4A 1VNDA 2LKSA 1KGSA 1WPKA 3WTXC 2V79A 5L3DA 4MLOA 2VKEA 5EJCA 5HVQC 2EIKH 4HEA2 2AHQA 3I71A 3FZVA 2TRTA 3CJQB 4MFDA 1XTAA 4Y4RA 3L2VA 2DFIA 1OCZH 1JE8A 2E5ZA 4KT6A 3JSOA 3RZOJ 3W2AA 1QZZA 2JA2A 3GFIA 4JX6A 1WZ2A 4IQ4A 3KP4A 4XIDA 3A01A 2W7NA 3SXYA 3OYMA 5J1YA 2CMPA 2VJ4A 4NC6A 4WF2A 1ACIA 1OFCX 4CZZA 4QIWN 1UHSA 3BOQA 1JGGA 1D1BA 1IRFA 4HPQA 5JI6A 2DO7A 2O8XA 1NK3P 4AYBN 3M8EA 3F3XA 4U7BA 2XKPA 5HDGA 1QZYA 2RQPA 3HL2A 4ENMA 2VBXA 1S6LA 1WJEA 3L9FA 1QZEA 5FB2A 1BI3A 3C2HA 4WXCA 3BJAA 4BJ6C 1L3LA 2X85A 1K78A 4IEJA 2X6YA 1FNNA 4KYWA 1FSEA 2ID6A 3JRCA 2K9NA 1I6HJ 1XMXA 1A6QA 1BIAA 2L0KA 3MKYB 3BLYA 4DBRA 1D0ZA 3CJRB 1QHHD 3CO6C 2R7XA 2RQQA 5IOZA 1BL0A 3EUKL 3L2CA 1F9NA 2FMLA 4CUGA 2QQ9A 1U78A 4E7KA 3WE3A 1W1WE 5IPAA 2KIQA 4FE4A 2KP6A 3FXUA 2CW0F 3DPUA 2R7RA 4RBOA 1OCOH 4XOPA 1WSUA 2TDXA 4LG0A 4IHXA 4A3KJ 4A93J 1W0TA 1DDNA 4BEHB 4NNJA 1HLVA 1BOBA 2LSOA 2HQAA 2DTZA 3AG3H 3QP5A 2LLKA 3ESWB 5JLWA 2Y31A 3TKYA 4MEXF 2DJNA 3LA7A 3GLXA 2ZMEB 4GYIA 4EGYA 5LD2C 1F4KA 2L2OA 4XSZF 2A68F 2GA1A 4KNYA 2MA3A 5EZGA 2WAQA 3KLNA 2KIFA 4Q47A 1HCRA 4A3CJ 3GXOA 3HOTA 3F22A 3PM1A 2HDDA 3VPRA 3G1OA 4BHPA 2IS6A 2WADA 4EM1A 3QPTA 2H8RA 1AOYA 4CYCA 1T8IA 4AIHA 1B4AA 1UCRA 5K7HA 3K1PA 2EFWA 3I54A 1IUFA 1K4SA 1BA5A 2E2IJ 5HS9A 3S1QJ 1D5VA 1YW7A 3ABLH 2WY7Q 2XUBA 2NVYJ 2FRHA 2CFXA 2KISA 4F52A 2FF4A 3OSGA 1W5TA 3I4NJ 4B43A 3COAC 1DPUA 1LFUP 5J8FA 3BT9A 5DUIA 2MGQA 3JTGA 1BJAA 1IC8A 2CQNA 2G9WA 4OOIA 4PSWA 2P0WA 5L3GA 1QVUA 2M4KA 4HLYA 1P7IA 1ZARA 2KKOA 2XVCA 4RS8A 1XDUA 3MKZA 1BR2A 4IHWA 4XR6A 4BUPA 2KFDA 2O0YA 5F27A 4HYEA 3H3ZA 5DDGA 5JR3A 3ZQFA 1OCRH 5E3LA 4ZJZA 3L1PA 3S32A 1V3FA 1G3WA 1DU6A 2K9MA 2HOEA 1ZRCA 4B44A 3OYAA 4ANJA 3H9GA 3HOVJ 1ZTRA 3ZP5A 4A5MA 1DU0A 2A6TA 5E20A 2JVGA 1AHDP 2NNNA 2LYCA 2M2EA 2IS2A 3FXJA 1SVMA 2ZNYA 3W2VA 4B3AA 3H5AA 1FT9A 3OYLA 1J09A 1MBKA 3GFJA 5GAEJ 4LB6B 1UZCA 2JT1A 2H6CA 3OY9A 1OYYA 1EH8A 3BG9A 3EYIA 2IAIA 1U2WA 3WE2A 2Y69H 1PP8F 2RVCA 2Y0SA 4A3JJ 2PMUA 4ZDOA 3HGYA 3BR2A 1HSTA 4OAYA 1KZHA 5E1XA 2CW8A 1E3HA 2V9PA 2L3DA 3M3YJ 4EJWA 4HDUA 2OA4A 1VI0A 2IXSA 4L0YB 3GFMA 4YIIA 2LMDA 3IH4A 3Q3SA 4XLFA 1FBUA 2VT3A 2ME0A 4BQAA 3TL4X 3ZMZA 1YRNA 3MN2A 4BJ5C 1U8BA 1HW2A 3MZYA 2GAUA 2K40A 1F1ZA 1BI0A 2ETHA 3QP6A 4XQFA 4E7JA 2QBYA 1WI3A 1VQKI 1R6RA 4I01A 5J4VA 4XLEA 3C2BA 4HX8A 4LK0F 1LQ1A 3WU0A 3R6SA 3VYTB 1X4PA 5HLTA 2CQXA 4I7HA 1QA6A 4KFCA 4CCKA 3BR3A 4BBSJ 3J80K 3L2QA 3A0HC 4Q48A 3CMMA 3HOZJ 4ZZLA 3K70D 5EZHA 2R0QC 5J3LA 3WHCA 1WVRA 1U5TC 3KYDB 2XB5A 5FKOA 4S04A 2WB1N 4ITVA 4GO1A 3I59A 3I64A 1T33A 2HVSA 1BBYA 5E8GA 1B8IA 5H6RA 1LDDA 4A0XA 1JTXA 2BBYA 2VKHA 3BR6A 3FX3A 3I0TA 3HDDA 1S9HA 3H0GJ 2NOJB 2QGUA 2NS0A 2RKHA 1BW5A 4BNCA 2DFHA 1NTCA 3ZQCA 1IUYA 3EQLF 5D4RA 4UY8I 2HOTA 4ASNA 2IT0A 2EPFA 3BR5A 1T0FA 2E2HJ 2Y75A 1X1PA 1RPWA 2QLZA 4B4CA 5IP7J 1WWXA 2E19A 2Z16A 2ID3A 2Z2SB 1GXPA 3JRIA 1APLC 2HPMA 4ENNA 3DTIA 1YHQI 1UFMA 4BKXA 3FMQA 3RQ4A 1KONA 1Y39A 1X1DA 2WWYA 3QPSA 1XX5A 2MYSA 1I5ZA 2GWRA 4FE7A 1YX3A 4B3XA 5F0HA 2ISYA 3K4BA 1TQMA 4A5NA 3OYJA 2D1VA 1Y8RB 3RPUA 3HUGB 3X2QH 2VLAA 5C4XJ 1DGRM 4BBRJ 4UB6C 3A2KA 1TT5B 3HIFA 3A1YA 2VASA 4KIBA 5LGUA 2PBIA 4RAFA 4ZDLA 5D5WB 4UUSB 4ESJA 2P5KA 4S05A 2P5LC 1IN5A 1Z67A 2BHZA 1MW7A 4ENJA 2DQRA 1MJBA 1FMWA 1RI7A 1YYVA 2G7UA 4N9HA 5GTHC 2KDZA 5ED4A 1X4OA 4BL0B 2VE9A 3CUQB 2GBYA 3VYUB 1TWHJ 2V1UA 4M71A 4DZPA 2ZXHA 2QQ8A 4CSWA 2OF7A 5EG0B 1HW5A 2CYYA 1S7AA 3PO3J 3H9QA 2VQGA 1TW3A 1REPC 3K4KA 3RKQA 1EA3A 1PUEE 3CCMI 2B9SA 1S72I 2VXDA 1J9IA 1HOMA 1E3PA 3LSMA 2W57A 4PCQA 1WH5A 3KEYA 2ZJ2A 1D8KA 2G0EA 2K3FA 4G6TB 4XORA 5GPCA 5IYCJ 4UVAA 3SZTA 2F48A 4IRGA 3ZMTA 4QWQA 3AAFA 4UB8C 3BDDA 4HRIA 1T95A 3MKLA 3HOYJ 3GZNB 3J7AO 1X2MA 4RGSA 1YOVB 3BR0A 3BPVA 1W7PB 5AIQA 1Y1VJ 3TMOA 2R7FA 1P4WA 4N9IA 2AS5F 4CGZA 2DMQA 4DGWB 5CQEA 2OTJI 4NBQA 1OISA 3JRDA 2MBFA 3E5XA 2KIUA 3FKIJ 3GTGJ 3P5JA 3LAJA 3O8GA 5J8CA 2L7MP 1Z0XA 2A5WA 3K69A 2STTA 3EPZA 3Q0VA 2K4JA 3QAHA 3D1NI 2RN7A 1Y1WJ 1S7EA 5AIPA 2QM3A 1JTYA 1U9OA 3HRUA 4BH9A 3RQIA 3ZQGA 3AG4H 4A6DA 4XRSG 4CCJA 4HQMA 3HKZN 2E5NA 4E6KG 3PFIA 1VF9A 2A5YB 2A07F 2DPDA 1IN8A 3IUOA 1LDKB 1VQOI 1KU9A 3TGNA 3R4KA 2VC0A 3LFKA 3MKWB 1U8RA 3O6BB 4NC7A 2JRMA 3ZCOA 3WTVC 3HSFA 1YO5C 3OS1A 2DMUA 2R7ZJ 3T8TA 1IZ1A 4M3BA 2P8TA 1KYZA 3JRGA 3IHUA 3CCEI 2Y9YA 3C3WA 1W5SA 1K6OA 4ZC3A 2IGMA 3OWTA 4PDKA 1VQNI 1XN7A 1UB9A 5TISC 2LRDA 1VQ8I 4PJMA 2MW8A 1FIAA 1HKQA 5CVVA 4M6YA 2JK3A 3VFZA 5FROA 1X3UA 3AL0B 2WV0A 2COBA 1WQ2A 2NOGA 2D5VA 1ETYA 2L7ZA 1EH7A 1STZA 2W1OA 2HDWA 1UHWA 1G4DA 4EGZA 1FP2A 1BR1A 3TDUC 4B47A 4XMYA 2CFOA 5DV5A 3BQZA 3VYRB 2DDAA 3IAS2 4QSHA 5D5VB 4RB2C 3LA3A 1E0EA 3PFYA 2XF6A 3QYFA 2RNGA 1ODDA 4M9ZA 4G8XA 4P9FA 3I5UA 1ZYRF 1R4MB 2NS8A 1K61A 3CQZJ 5E3OA 4D7NA 2HVRA 1X1AA 3VDXA 1OQYA 4RAGA 5JHFA 3FWEA 4I09A 4Q4ZF 4MNUA 3MMYB 2XKOA 1IDZA 1G3TA 3FIWA 2OJED 1HKSA 4N4NB 4ABZA 4HNVA 3U9GA 2PFBA 4XICA 3BG6A 1R71A 2FMYA 1MGTA 5J47A 2R7UA 4Y13A 2XC7A 1IF1A 3LSJA 3OYDA 1MD0A 2XHKA 1U9NA 4ZYAA 1SVLA 2NAZA 3I53A 5K7ZA 3BY6A 4CDGA 1JHFA 3F21A 4LFUA 3DQVC 2Q2EA 4AU7A 5DD4A 2FXAA 4AVPA 4O3MA 1QBJA 3LSKA 1LJ9A 2E7WA 1R00A 5F1JA 2DA7A 3HSEA 4BY7J 4X0GA 2ZXWH 1ON1A 2LC2A 3FXLA 2M0CA 5F0CA 3UNGC 4KA4A 3GTOJ 1IV8A 3PO2J 3HOUJ 3IRRA 5LRRA 1MBJA 4FCYA 4JQFA 1ZQ3P 1E2XA 2KL4A 1BN5A 5ICFA 3EUHC 1G8XA 4XN0A 4PJJA 4XNFA 2IPQX 4JK1X 4HF2A 4A3BJ 1FWZA 1Z21A 1ZHFA 2FEZA 2M4GA 2W85A 3L7WA 3JRBA 2Q0OA 4OMZA 4IRHA 4M9SA 3SFIA 4DNCA 2QWWA 3B6CA 4P1WA 3MAJA 5HNHA 2BE5F 3CF5F 2M8EA 2XAJA 1VQ9I 4N0BA 4IOCF 3S1NJ 1N75A 4DJAA 2M7AA 4V19K 3F23A 3PUBA 2ZMEC 4CHUA 1A5JA 2M34A 1GDTA 2CSOA 2CV0A 3RSNA 1HA8A 5CKTA 4U0YA 4EM0B 2ZJPF 3Q0WA 4HV6A 4L5JA 2BY3A 4ZYHA 3RCOA 2DA1A 3IH2A 5ILUA 2YU3A 1IXRC 2BXZA 3LQQA 4ZYDA 3GW2A 4GXOA 1XB4A 3EUAA 1ZG3A 4LK1F 1KU7A 2DI3A 1GV5A 1GVDA 2LK2A 3LOCA 4KN7X 4RLFA 4IJAA 5DEQA 1Z9CA 1P4XA 4PJLA 4AIJA 2FBIA 4A3IJ 4CCLA 4XKCA 2NVQJ 3JRFA 2OUMA 2VPRA 2E2JJ 2KMUA 3P9CA 2GM4A 3CLQA 2VKDA 1BW6A 3E6DA 5JVTA 1R23A 3I55I 3GMEA 1ZR4A 1W36C 2GZWA 3GTQJ 4AIDA 5JVGF 1KQ9A 1VQMI 2Z1DA 4IF4A 2E1MB 4M3EA 2JA8J 4M3GA 4BHCA 1B1BA 2PX9A 2L01A 3V8LA 1TWGJ 3NAUA 1WJAA 2O03A 3I4MJ 4P55A 2M0MA 1OCPA 2BOLA 5A2QZ 1FLIA 4Z6YA 4F7ZA 5JLXA 3D5SC 2DMTA 1PP7U 3TEDA 1IAWA 3KP7A 4EJOA 2X6OA 1WH7A 3E5QA 2L9SA 1YIOA 5M5XJ 4Y7NJ 1RRJA 2XASA 3GF2A 3HSRA 1EJ9A 2R5ZB 4S0HB 1GLNA 4HW0A 2VPLA 3BZKA 3CO7C 2E1CA 3T5XA 1NH3A 5HDNA 2HKOA 2XV4S 1TW2A 4RGUA 2H09A 2L9RA 2XAFA 3ERED 3HPHA 3E6CC 2MFZA 3HOSA 5IOYA 4BE2A 2K27A 4RM2A 1HKTA 2IBDA 2EQRA 2HNHA 3M1EA 4BU2A 4KIFA 1JT6A 5KAIC 2FNPA 3R0JA 5KCMA 2IRFG 2DPUA 4XN3A 3WGIA 3KYCB 2JA6J 3G6EI 5K1YA 3KP2A 4EEFG 2OU2A 2M30A 3HZJA 2KT0A 3H3UA 4EJUA 3MQ0A 2JWTA 2CWEA 3GLLA 4JX5A 2DXIA 1XD7A 5D5XB 4KISA 5KHDA 3GFLA 1KYWA 3BQYA 2A05A 2R5YA 3PJRA 3G1LA 3K2ZA 3BROA 4HNUA 1ONVA 2O6GE 2YX7A 2K85A 3ABTA 1SFUA 2PQ8A 1LVKA 1IRGA 5HNFA 5ICCA 1HSJA 4BE0A 3OYGA 2QZ8A 3BCAA 2PJRA 3DPLC 5FKNA 3DBLB 2M3AA 5L3CA 4UNOA 2BVMA 1Y0NA 2P4WA 2X9DA 2FNAA 4XLNF 1X1CA 1OR7C 1JJ8C 4FASD 3BCBA 3PSIA 3CCSI 2O61A 2P81A 1R4NB 3T1BA 2UUZA 3S3MA 5CJ9A 1RUNA 4Y33A 3OIPA 2R4GA 3AG1H 2VQCA 4LLLA 1DP7P 4MO7A 4KN4X 2RDPA 5B5EC 1I1GA 4LG3A 4L5EA 4XOTA 4UUVA 1TQIA 1QO0D 2NRAC 2O3FA 1C0WA 3PNTA 3WTUC 3V7SA 4UXNA 4RAYA 2A3SA 2YS9A 2EIMH 2P7VB 3FISA 3M9AA 4OINF 3RPQA 1YTYA 2HR3A 2O7OA 3GO5A 2W82A 2OPTA 3HBLA 3M7GA 3CMEI 1TC3C 1B9MA 1RC9A 3SYTA 3CP8A 3QQAA 3DLAA 2ECBA 9ANTA 1JXSA 1YS7A 5D8LB 3NRVA 4J01A 4ZTFA 2UWMA 4V2GA 2EH3A 2HZTA 2DMNA 5IYDJ 2V6CA 1YFHA 1SEUA 4MTEA 2YSRA 3H1CA 2TCTA 4ZDPA 3HPGA 3SDGA 3J81K 3SHFA 3J81Z 2QBYB 4MGRA 1LKXA 4D7MA 1XGSA 4P9UA 1LE8B 5GTIC 3WTTC 3CUQC 3LL7A 4AWXB 4D1QA 2L54A 3DU6A 3KZZA 4RGXA 2QVOA 3JRHA 2WC2A 4A0YA 2WA0A 4LITA 4ENKA 2OAZA 3ONQA 5HODA 4BXUA 2Z5UA 3I59B 5K7FA 2L4AA 2DODA 2G7HA 2PN6A 3LNQA 3TO6A 4XBFA 1ZAOA 4YFKF 2Q1ZB 2H94A 2XGEA 1ZGAA 3E5UA 3W6KB 4WWCA 2CUEA 5ILSA 2QF7A 1VQ7I 4B09A 1ZKGA 1XCBA 2LG4A 4U0VA 3PIOF 4HNTA 1FOXA 1MNEA 5CQGA 3J7YJ 2ZXIA 1DQUA 2F5CA 2ZFWA 2ESHA 2X6XA 2LFBA 1CF7B 1S3JA 1LB2A 1IXCA 2FE3A 1RETA 3HHGA 3VEPA 1O4XA 3ZR8X 4HSTA 3WTZA 2ZSHB 3K10A 2L4MA 2E7XA 3M8JA 5EF6A 2UXNA 4BHBA 2CJJA 3I3LA 3OIQA 3OYCA 4HQEA 1MMGA 2W84A 1TZLA 1A04A 4QPOA 2FX0A 4KMFA 1RIOH 3FXRA 2WAQN 3S3OA 1V54H 1SFOJ 1H89C 2E1OA 3R60A 3LSHA 3SEQA 1A35A 5FD5A 2DYSH 2J5PA 1EKEA 2H1KA 3KP3A 2NVUB 1TT0A 3EUHA 3HRTA 3ZMUA 3A4CA 3DCFA 1KU2A 4F91B 3WGGA 4LIUA 3PQKA 4RM3A 1LPQA 3V42A 1JUPA 3GZ5A 4BEHA 2X1EA 5FGMA 5LRSA 5LLQA 3G4SI 1JKOC 1SD7A 2L7FP 1KA8A 2JQ7A 1DPRA 1U0JA 2L9VA 2I8DA 2ZSIB 3SFZA 4DZJA 4NHJA 4Q5SF 3FBNB 2W4SA 5D5UB 4KIGA 2LY2A 2ZMEA 3EETA 5HOOA 1IV6A 3DXJF 4QPQA 3I56I 4PFPA 3GYHX 1X58A 2KRCA 3SEZA 2BW3B 3M4OJ 1AU7A 1FEXA 2IEKA 2HDCA 5CLSA 5IT3A 2K02A 3K4LA 2R7OA 5H6QA 2VODA 4HAMA 4L5IA 5D6EA 3K9TA 5B3SH 3HEFA 2GOXB 4J00A 4FT8A 4HSRA 3AL0C 2EJRA 3HGGA 2M5WA 4I02A 3DPTA 2QSFX 5FFZA 1MDMB 1HQCA 1NK2P 1GV2A 3KETA 2JUGA 3G2BA 3R0AA 4PZJA 4LB5A 4PK4A 2FOWA 4IO9F 2Z99A 1W36D 1BIBA 2KDOA 2O9LA 3ZMDA 4CCMA 1ETQA 1F36A 3PUFA 4B48A 4E7IA 2FBKA 2Y0SN 3OMYA 2VE8A 4NQWA 4IKFA 4O5VA 4JOMA 4G7HF 3ZQ7A 1B6AA 2LBFB 1YITI 4GFBA 1HC8A 5FRMA 1O3SA 3M07A 3FKJA 3HTUA 5L3BA 1ZG1A 2XRNA 4TV7A 2ME6A 3VOEA 3GVAA 5K5RA 1T08B 3J7AY 4LJZF 1D1CA 3Q5FA 3F8FA 2ZNZA 4EATA 4P5OA 1U6GA 2ZKZA 3NQOA 1TWCJ 2K9SA 1BI2A 3DEWA 2VBZA 3C1DA 3FK7A 3RYRA 4A3MJ 1TNTA 3DF8A 3PNVA 2OZ6A 3OOPA 2DCEA 2N8GA 3DEUA 2ISZA 2H1LA 1ZN2A 3TDZC 1WJDA 3JW4A 3L2WA 5EGOB 1J59A 2GIVA 2LR8A 5KK1A 3OL4A 3HC7A 2UZKA 2DLLA 5LBQA 2F4MB 3DKXA 1YI2I 1X3ZB 4L9TA 4M3FA 4I98B 1W0UA 1SMTA 3AFHA 4CCNA 4AUXA 4A3LJ 2QKMB 4UUTA 1MH3A 2I5UA 3NWTA 5HDKA 3HRMA 3GTMJ 4W1UA 5BPDA 2IVMA 2OCCH 2ELJA 1R5GA 4X1EA 2ZJRF 2E71A 3DTKA 1H9TA 1QU3A 1O57A 2F5DA 2WBMA 3Q9SA 4MIMA 3OYNA 1HW1A 5FKKA 1I27A 1BJZA 1SFXA 3S3NA 1JUMA 2DW4A 2LNBA 3CCJI 3GUDA 3T8RA 4PSXA 1K6YA 1IW7F 3IV5A 1P92A 3GBGA 1YJWI 4OIQF 1OR7A 1PUFB 2CV2A 3H36A 2GOMA 2DA6A 3HHHA 2V4JC 3D5RC 2QEXI 2X1CA 2HXOA 4KICA 3ELKA 4QLCU 1YE9A 2YPRA 3FF5A 4UVCA 5ERIA 4OIRF 5FKMA 2ZCWA 1JKRC 3IKVA 3CJNA 4NC8A 2A69F 5GADJ 1YX5A 2RAEA 2VC1A 3RTRA 2NVTJ 2MD0A 2R7WA 1MSFC 1VQ5I 1FYKA 3EDPA 2XAQA 1DP3A 1M1EB 1T6SA 2DFEA 1RR8C 4FTHA 2BGCA 4M9XA 1N25A 4CCOA 3SZGA 3KP6A 4XLHA 2E1MC 5H2FC 4RAZA 1T39A 3G1MA 3O2PE 2JSCA 4ZH4F 2R92J 4ON0A 3RKXA 3E7LA 1Z91A 2XDVA 2D45A 2Y2ZA 2X4HA 3WG7H 2LKXA 5HS8A 1XS9A 4H4KC 2EZKA 3LAPA 3HB9A 3S8PA 5FJ8J 3I4PA 2MC3A 2X1DA 5ICGA 5CVRA 3HUGA 1PVEA 4KUMA 4BQNA 2HS5A 1JJ6C 2HZDA 1J5YA 4H0EA 4V2FA 3P7NA 2F6CA 4G6QA 5D8KB 3MCZA 4CICA 5IP9J 3OYBA 3N05A 4UUSA 1FP1D 4CZCA 2Z33A 1AKHB 2ZJQF 2J5OA 1R5HA 3DBRB 4XKBA 2KZGA 3EYYA 1R7JA 2LF8A 1ORKA 1TLHB 3LSPA 1MZBA 1VQPI 2QUFA 2CS3A 5B1AH 3ZXSA 4IOAF 2MLGA 2K86A 3CUQA 1GT0C 2VI6A 4LLGF 3HJEA 2LVSA 2XPWA 4CYDA 1OMIA 4II3A 5EG0A 1PDNC 4A3DJ 1LFBA 2HI3A 3H0DA 1D0XA 2K9LA 2DFFA 2QSHX 1EH6A 2F5EA 4BDYA 3BG5A 5HS7A 1VZ0A 2CU7A 4XKVA 1OLTA 2IA2A 3F8MA 3WTWC 2KHMA 2F2EA 3CMAI 4HLXA 1BR4A 3P9KA 2VQLA 1G59A 2R7TA 3S2DJ 2IGNA 3FMRA 4X6AJ 4E70A 3RYPA 2L5QA 2DOFA 2JPCA 3GX4X 1WI9A 1NG7A 4W97A 2V26A 3TW6A 1AWCA 4XM3A 3RKWA 3ZOBA 5M5YJ 2V1NA 5LEKA 5H20A 2EA4A 2VONA 2STWA 5DCMB 1P6RA 2W00A 5C44J 3FHNA 3VYSB 2L9NA 3KZIC 1J2XA 1IXSB 3IRQA 4IHVA 2IA0A 5KAFC 1R5ID 1XPXA 3HOWJ 3MZ8A 2V7FA 1W7PA 3V8KA 3ASOH 2OCEA 3FMSA 2KIMA 2QA4I 3OIOA 2EINH 1W7PD 1XGMA 5EEGA 3IH3A 4KT5C 3DWLE 4AC0A 1YW8A 4F92B 1AA7A 3G71I 4EM2A 3JCUC 3DEEA 4MQ9F 2DJIA 2CO5A 2CQQA 1O7FA 5EEAA 1D8JA 4K2EA 1ZR2A 2CGPA 4IHYA 2FBHA 2ZBKA 3LSTA 2MSYA 1QNTA 2HPIA 5E1ZB 2EA2A 3JSPA 1MNMC 1B72B 1Y56A 4PJ0C 3GEZA 3HTSB 3IKTA 2EB7A 2HVQA 3MD2A 2XPVA 3ISPA 3QOPA 3HM5A 2VJ5A 3RIRA 3IC7A 5F64A 3BTLA 1IG7A 2LREA 3E6MA 1KQ8A 4JP0A 4R8HA 2KPMA 1O7LA 3LQRA 3F8CA 4R79A 3QRFF 2A61A 4GGGA 4CH7A 2FOKA 1SANA 3S93A 2HQ5A 2GIZA 1XMAA 2BY2A 2JTVA 2DK5A 5BS6A 1OKRA 1G6NA 2DAOA 2BVLA 1SFEA 4PUSA 1FX7A 4ESFA 1VQLI 2JJ7A 3A01B 4N4OB 1A36A 3VWBA 2DA2A 2VUMJ 3OS0A 4PGHA 1Y6IA 4C30A 1D5YA 3BJ6A 3GTPJ 2PEXA 1MBEA 3W6JB 1FIPA 1YIJI 1U5TA 4U88A 3ROUA 2C6YA 2DU9A 2RNJA 4C3JJ 2JZYA 2WY8Q 1WHUA 4FX0A 1ETVA 3LWFA 4PJNA 3TOAA 4LMYA 4FQGA 3K1NA 3CCRI 2JRTA 3PSFA 1ZH5A 3FM3A 5E1WA 5LGTA 4BE1A 2Y48A 2DA4A 2QQAA 5LHIA 2HYFA 1K78B 1FTTA 2P6SA 5FO5A 2XGCA 2KLOA 3L2RA 2RREA 3ZMSA 1FOKA 3CLOA 1K79A 1P9QC 5DM7F 3OL3A 1H8AC 4AYBA 3I9V2 2VL8A 5A2QK 4MTDA 2KZVA 1ULYA 2COMA 1LFPA 1RKWA 2EFQA 2V9KA 2IGOA 5BMZA 1XDSA 5DM6F 3BWGA 1WGXA 2ZXJA 1LDJA 2Q8KA 2O8KA 1S8NA 2DMPA 3SDBA 4IHTA 4AIKA 4L0ZB 3CDHA 4YFXF 5B1BH 2M7BA 4C2MJ 5CVJA 3OYFA 5EEHA 4LG0B 3QPHA 1ZG5A 3CZ6A 1MIJA 2RV8A 3S2WA 2IS1A 1PJRA 1MNDA 4U87A 5E3NA 2FQ3A 1K7AA 2Y9ZA 3DLLF 1XSDA 3Q0UA 3O8HA 5LHGA 1D1AA 5J4YA 1OYWA 5FLVA 1MBGA 3WTSC 3GZ6A 2V9VA 5EDNA 6PAXA 1T56A 4E7SA 3ZGKA 2FA5A 4HZFA 4I0AA 5GAGJ 4D9JA 3W3CA 1NG6A 4F55A 4I76A 5IYBJ 4D5FA 4NUBA 1QHGA 1MKMA 4RA2A 3PIPF 3OYEA 2PMZN 1QQIA 2XAUA 4CYCB 3K4CA 3QPLA 3TOBA 3FXKA 1TWAJ 4IL6C 1FYMA 1X2NA 2XROA 2DT5A 2NS7A 5ICEA 3FHZA 5BOXA 2R93J 2V6EA 1LEBA 2CH0A 3BTCA 5E18F 3HYIA 3CC7I 3RI4A 2E36A 5DYMA 4IHSA 4OAZA 1EF4A 4HV5A 2AXTC 3U1KA 4IRIA 5FKLA 1ON2A 4RB3C 2M87A 4RGRA 4XRFA 1WJFA 1LNWA 3F0CA 1N78A 4MHGA 3RJPA 1H9GA 2K5CA 2VOOA 2CUZA 2K9QA 1I3QJ 3ZQQA 1R1UA 3H35A 3FDYA 2VJJA 2EILH 5C3EJ 3GTJJ 4AVZA 2HWVA 4M6VA 4EJTA 4DQ2A 4UHTA 2XF5A 3GWZA 1O3TA 2ELHA 2PI0A 4ZZDA 4BY1J 1Z7LA 3G73A 4LOCA 4Z2YA 5M3MJ 3F72A 4RB1A 4MFEA 4B8XA 2KJBA 4DYCA 4F93B 1ETWA 4IQJA 4IX7A 1SFKA 3WGHA 2D2WA 2DA3A 3TP0A 2KJCA 3TP3A 1ZLKA 3GTKJ 4YEJA 5DS9A 1H88C 3JAMK 2E35A 4G6DA 4HF0A 3JAMZ 1TBXA 3RZDJ 4C2TA 4F3QA 4KMUX 5K5OA 3ZQHA 4DOZA 1HBXG 4XK4A 1F5TA 3N97A 3E0JB 2CV1A 1TTYA 1MMSA 1O3QA 1A31A 2OD5A 3L00A 2BEOA 4DYQA 1KQ0A 2DN0A 4RDUA 4AM3A 2R5ZA 4MEYF 1WFXA 1SD4A 4L9NA 1YRNB 1LUJB 4HA8A 2XAGA 3HOXJ 4A6EA 1RESA 1ZGWA 2AXLA 2XF7A 4JX4A 2RC4A 4LIVA 3QU6A 1TNSA 4M3DA 3TBIA 1RKTA 5E17F 4I99C 1HF0A 2QKLB 3F6VA 4DBQA 1WRJA 4IZZA 5HLHA 1E3OC 1OYIA 1S7OA 3B6AA 3CF2A 3R61A 1JKQC 3ULQB 5CVIA 1UELB 1XSXA 2HYJA 1LEAA 1S29A 5BPIA 4R1HA 5D6FA 1JI8A 1ZK8A 1SD6A 3ABMH 1GXQA 3MVPA 5F08A 1R9TJ 3S14J 1T38A 5KNLA 2LOOA 1RUOA 3K1MA 1XGNA 2NXNB 2WAEA 2M1BA 1YJNI 2H27A 3ZPLA 4ZTJA 2VXZA 2RGVA 2X0LA 5GAHJ 2HKXA 1B8IB 2FJ1A 3ERMA 1IJWC 1DUXC 2AQFA 2EWNA 4XLAA 3CCLI 1N77A 3A03A 4YRVA 4G7OF 3MZHA 3CCQI 1ETOA 3IL2A 2BY0A 2W24A 4I6ZA 3OSFA 2GLOA 1ERDA 4UV9A 1L0OC 1G2HA 4CO8A 2VJIA 3CC4I 1DGWY 2EFNA 3MFKA 3SQNA 3CC2I 4GRIA 3MEXA 4AD9A 1VFCA 3E1SA 1HDPA 1EV7A 4XSXF 4NQWB 1I1SA 4BQOA 1YJ9I 2HQRA 1J7KA 2WB1A 3E6BA 2GA2A 2YUSA 3DFGA 1BC7C 3H3VK 2DT7B 4U0WA 4A0ZA 5F6FA 4BQQA 1W4MA 4I0BA 3FXMA 3OYHA 1J75A 2PLYA 3F9KA 1V5EA 4Y15A 5JFRA 1OJLA 1UJ8A 4NDLA 1G3YA 1CGPA 1K83J 2P5VA 3WODF 2FSWA 2ZFUA 4L18B 2IS4A 4G7ZF 4OIOF 2ACJA 3IP4B 4Y3OA 1O3RA 1RZ4A 2LDUA 1T2KA 3ABKH 4L9JA 4A3EJ 1SAXA 1YW9A 4BGDA 2JA7J 2Z3YA 3S17J 3M8FA 2XSJC 4A69C 5ILVA 3RDIA 3TQNA 2LP0A 4UVBA 4UV8A 2WV1A 3DTEA 2ICWG 3K2AA 2GXBA 1FY7A 3TW7A 3FM5A 3U1DA 2XRLA 1TP4A 1Z05A 1GVJA 5KVRA 3WTYC 2BZTA 3QYBA 3G3ZA 4FISA 3QWLA 4MQVA 5E79C 4XL9A 3T0YA 3H92A 1IRZA 5J6XA 1FPQA 3CP2A 2ZB9A 1IGNA 2B7EA 3CDIA 4EJVA 1Y0UA 2PMHA 2LY9A 2BY1A 3H5RA 1OPCA 5D4SA 2HYGD 3D5LA 4XONA 2LD5A 2CQKA 1ZELA 1RR7A 2F5FA 1LE8A 4I2OA 2OQGA 2HFHA 1WKMA 3BC8A 1R1VA 1YLFA 4HF1A 1JT0A 1FJLA 3K6GA 2PJPA 3J80Z 1X1BA 3CUOA 1MMDA 1JGSA 1V5GA 2NNYA 2K3PA 3FXOA 3OR1C 3S2HJ 3CJTB 5DUKA 3P9IA 4HX7A 1UAAA 4A3GJ 1KU3A 2IW5A 3TO9A 4WX9A 1RNLA 2VB6A 4G9YA 4DW6A 1ZRDA 3I58A 4GYGA 5B66C 1QPIA 4XRMA 3ZQLA 2JMWA 2LTPA 5E3MA 4ZYEA 1NHAA 2V1XA 4PFOA 4HG2A 3CCYA 3KPHA 1OCTC 1CQTA 3ZN0A 2DBBA 4ETSA 3JREA 5K5QA 3LSIA 3Q9VA 2JN6A 4M73A 5TJJA 1CF7A 3S15J 5IT9K 2EFOA 5IT9Z 2F4IA 1FZPB 4E7ZA 4EVIA 3WU2C 1P4AA 1W5CC 2XAHA 4E7LA 2EK5A 2FQ4A 1P2FA 3K4NA 5FD6A 2QENA 4Y52J 2Y0MA 4C2UA 4CA0A 1WJCA 2DTRA 2ESNA 1B59A 2XPUA 2F4OB 2NYXA 1XCVA 3BG3A 2EBIA 4G12A 4XLCA 1QGPA 3RPUD 2XGXA 3KCCA 3DKYA 3LA2A 4BJTA 2R7DA 4C3IJ 3HKZA 2DOEA 2OC6A 5F0FA 1POGA 3PNYA 2E60A 1ZREA 4U7DA 1V55H 2KQRA 1I3AA 3FBIB 4NB5A 3BZCA 2I10A 2OZUA 1WJBA 1PYVA 1FC3A 2ADUA 2OBPA 1B9NA 5AONA 1P7JA 4JBAA 5DD8A 4BACA 2D1HA 3HRSA 3ZMVA 1VTNC 3KYLA 5TGTA 4J19A 1E17A 1FBSA 1SAUA 3NARA 2QSGX 5LFAA 2BW3A 4HBLA 3W6VA 4O6JA 3WG9A 3AG2H 2DA5A 2JUCA 1V5FA 3LFUA 1FOWA 5HLGA 3E97A 3K4MA 3KEOA 1HDDC 2HQNA 3H5NA 4XKWA 2M9HA 1IDYA 3F6OA 5FFXA 5IP6A 2EV5A 3CDLA 3S1MJ 4HX4A 1J0RA 3BP8A 1FMVA 3WHBA 2MH2A 3JRAA 3J7ZI 1I6XA 1ETXA 2O5RA 1BM9A 3F8NA 3QODA 5HLIA 5BNGA 2HXIA 3W2WA 1UG0A 3HG9A 3S16J 1YQAA 4IXAA 3SJMA 3VB2A 3IWFA 1SC7A 1MDMA 5GP9A 3CD6I 3ECOA 3OR2C 4LLNA 3CESA 2EZHA 4ESBA 2EV0A 3LSRA 2Y30A 2IGKA 4BDZA 1XC5A 1GHCA 5EYRA 4C3HJ 2Q2EB 2BXYA 3ML6A 2A6EF 1R58A 2HTJA 1FOYA 3O3KA 1SD5A 1BOAA 4C9YA 4OU0A 1T98A 4M72A 2E1NA 4YFNF 1I50J 2JSPA 2LBFA 2KRFA 2QQBA 3ECHA 4KJZA 2HEOA 3C2GA 4BS9A 1MMNA 3REOA 1Z6RA 2HGCA 2HOSA 2W48A 2W25A 3QOEA 4QTRA 1UMQA 4YELA 2R7QA 2LH9A 1WJ5A 1Z3XA 3DP7A 2M8GX 1IO2A 1BI1A 1MJ9A 4RB0A 4D5CA 5M5WJ 3CCUI 5FLMJ 4LGWA 2LY1A 1QRYA 3GTLJ 1G3SA 3JR9A 1TWFJ 2MC4A 2MABA 4OIPF 1ZGJA 5C4JJ 4M74A 4BYYA 2VBYA 4ZYGA 2CW7A 3V7RA 4BXFA 3CTAA 2H8WA 1Q1HA 2MG4A 3A02A 2HOAA 5DCFA 3CMYA 3WU1B 1USTA 2QYOA 2LKPA 5EGOA 4L9VA 3U21A 3B02A 2PG4A 3L09A 2MH9A 4PGGA 1USSA 4FHTA 1U5TB 3QU3A 1UHMA 4E7HA 1Y8QB 2BHYA 2V1DA 4YG2F 3VSKA 3D0SA 3A0BC 1LVAA 2CRGA 2WTEA 4RLQA 4KITB 4CXFA 1UG2A 3PQJA 1TQPA 3U2RA 2YU9J 4GDFA 3F8BA 1MBFA 5E8IA 3V4GA 2A6HF 4G94A 4WK8F 2X6WA 2X48A 3E3VA 3VODA 5F1RA 2OQRA 2NVXJ 4II2A 2K4BA 2DDBA 5M3FJ 1MJAA 1IN6A 4EQQA 2EV6A 5GPAA 3LSGA 1XG1A 1PUFA 1FYLA 2EIJH 2IA1A 1F43A 2EZLA 5F04A 4BAYA 4EV0A 1R1TA 2CQ7A 2KRHA 1JHHA 2E34A 4XLPF 1K4TA 3KP5A 3SZPA 1MMAA 3HXLA 2F5VA 4B1RA 5DTDA 2FU4A 3BPXA 3C7JA 4OWRB 4RMNA 4YIFA 2CG4A 5CPRB 2VOPA 2VQHA 1D0YA 5L3EA 4YIRX 2DYRH 1IN7A 1ETKA 3PL8A 3QYEA 5FLXK 2IJLA 2K7LA 3DBHB 3UKGA 5FLXZ 4FX4A 1ITYA 2Z9OA 1Z3YA 2BV6A 1QVTA 4GCVA 1Z1DA 2LF7A 2MLKA 2DOAA 3C18A 2ZC2A 3N4MA 3VSLA 1HXDA 4IPAA 3JTHA 5LGNA 2P7CB 2L02A 3MWMA 1U3EM 2CUJA 3K7AJ 4EMSA 4LD5A 2B0LA 3OV8A 3BZ6A 1FSHA 4E4HA 2OV7A 1GUUA 3NEUA 4M6XA 2VN2A 5JHUA 2BYVE 5TRDA 4A2UA 1V4RA 4D0PA 1R49A 1BC8C 1AKHA 4KDPA 3S1RJ 2R3SA 2R7VA 3BJOA 2XGDA 3K0LA 4WCGA 3KEQA 3UR3C 1ENHA 3V7CA 2P6TA 3KFWX 2AQEA 3IAM2 2R5YB 3LMMA 1WCMJ 3DKWA 3K4JA 3DV8A 2OTLI 4IVNA 3H9JA 2JVHA 2JPBA 2CUFA 1S5LC 3BG7A 2VBWA 4HOBA 3L2UA 2JA5J 2IP2A 1OCCH 2XSDC 2FUG2 3OYIA 3CCVI 3OOUA 2HU9A 1Z7UA 2H6BA 2PJRB 4OMYA 5CYVA 2L7KA 3KIOA 4FETA 3KZYA 3ZN1A 4WXHA 5LHHA 3K70C 2PMZA 3OYKA 5CVUA 4HDVA 5LEJA 1A6IA 5J1RA 1XSVA 5J40A 4BXXJ 2R7SA 5J1UA 2X51A 3GCMA 1XGOA 2YX4A 3KLOA 2ELKA 3BTJA 3BTIA 1ZRFA 2VIXA 4XRSA 5L3FA 2UV1A 2VKVA 2DT6A 1H0MA 3V8JA 5IY5H 1MBHA 2VT2A 2UXXA 3ASNH 3ZRGA 2EZIA 1VQ6I 3ABUA 3BR1A 2QCOA 2XB0X 1VQ4I 2GXGA 5DCMA 2MD5A 1X19A 1I39A 1Z6TA 3OS2A 1JKPC 1D3YA 4DIQA 4A3FJ 1QPMA 2XIGA 1FTZA 1TL8A 4DYRA 2GXAA 4P96A 1T0FC 2M45A 5BQTA 3AKZA 2WAFA 3TO7A 3FXQA 3FK6A 1SMYF 1R22A 1JUSA
chains in the Genus database with same CATH topology
1R36A 1YS6A 1FBQA 3RKYA 2DQLA 4Y17A 2ZO4A 1YG2A 1XMKA 3IWZA 2EFPA 2GQQA 3B73A 4WXDA 2DK8A 3KE2A 1IN4A 1ZLJA 2HTSA 4A12A 2YR2A 1KGSA 3WTXC 2V79A 5L3DA 5HVQC 3I71A 3FZVA 2DFIA 1JE8A 3JSOA 1QZZA 3GFIA 3KP4A 3SXYA 4WF2A 4CZZA 3BOQA 1IRFA 5JI6A 2DO7A 2O8XA 3M8EA 3F3XA 4U7BA 2XKPA 5HDGA 1QZYA 2RQPA 4ENMA 2VBXA 1S6LA 3L9FA 5FB2A 1BI3A 4WXCA 3BJAA 1L3LA 1K78A 1FNNA 4KYWA 1FSEA 1BIAA 3CO6C 3L2CA 1F9NA 2FMLA 2QQ9A 1U78A 3WE3A 3FXUA 2CW0F 1WSUA 2TDXA 4LG0A 1DDNA 2LSOA 3QP5A 3TKYA 4MEXF 3LA7A 3GLXA 2ZMEB 4GYIA 4EGYA 1F4KA 4XSZF 2A68F 2GA1A 4KNYA 2MA3A 3KLNA 2KIFA 4Q47A 3GXOA 3HOTA 3F22A 4BHPA 4EM1A 3QPTA 1AOYA 4AIHA 1B4AA 1UCRA 3K1PA 2EFWA 3I54A 5HS9A 1D5VA 1YW7A 2XUBA 2FRHA 2CFXA 2FF4A 1W5TA 3COAC 1DPUA 5J8FA 5DUIA 3JTGA 1BJAA 2G9WA 4OOIA 5L3GA 4HLYA 1ZARA 2KKOA 2XVCA 4RS8A 1XDUA 2O0YA 4HYEA 3H3ZA 5DDGA 5JR3A 1V3FA 1G3WA 2HOEA 1ZRCA 3ZP5A 4A5MA 5E20A 2NNNA 2ZNYA 1FT9A 3GFJA 4LB6B 2JT1A 2H6CA 1OYYA 1EH8A 3EYIA 1U2WA 3WE2A 1PP8F 2RVCA 2PMUA 1HSTA 5E1XA 2L3DA 4EJWA 4HDUA 2OA4A 4L0YB 3GFMA 4YIIA 1FBUA 2VT3A 4BQAA 3ZMZA 1HW2A 3MZYA 2GAUA 1F1ZA 1BI0A 2ETHA 3QP6A 2QBYA 4I01A 4HX8A 4LK0F 1LQ1A 3WU0A 3R6SA 4I7HA 4KFCA 3J80K 4Q48A 4ZZLA 1U5TC 4S04A 4GO1A 3I59A 3I64A 1BBYA 5E8GA 5H6RA 1LDDA 4A0XA 2BBYA 3FX3A 3I0TA 2RKHA 2NS0A 4BNCA 1IUYA 3EQLF 5D4RA 4ASNA 2IT0A 1T0FA 2Y75A 2QLZA 1WWXA 1GXPA 4ENNA 1UFMA 3FMQA 2WWYA 1I5ZA 2GWRA 2ISYA 1TQMA 4A5NA 2D1VA 3RPUA 3HIFA 4KIBA 5LGUA 2PBIA 5D5WB 4ESJA 2P5KA 4S05A 2P5LC 1IN5A 4ENJA 2DQRA 1MJBA 1YYVA 1RI7A 2G7UA 4N9HA 5ED4A 2VE9A 3CUQB 2V1UA 4M71A 1HW5A 2CYYA 1S7AA 1TW3A 1REPC 1PUEE 1J9IA 2W57A 4PCQA 2ZJ2A 1D8KA 4UVAA 3SZTA 4IRGA 3ZMTA 4QWQA 3AAFA 3BDDA 3J7AO 4RGSA 3BPVA 1W7PB 5AIQA 2R7FA 1P4WA 4N9IA 2AS5F 4CGZA 2MBFA 3E5XA 2KIUA 3LAJA 5J8CA 3K69A 2STTA 2K4JA 3QAHA 2RN7A 5AIPA 2QM3A 3HRUA 4BH9A 4A6DA 4HQMA 3PFIA 2A5YB 2DPDA 2A07F 1IN8A 1LDKB 1KU9A 3TGNA 3R4KA 2VC0A 3LFKA 1U8RA 3O6BB 3WTVC 3HSFA 1YO5C 3T8TA 1IZ1A 2P8TA 1KYZA 3IHUA 3C3WA 1W5SA 1K6OA 4PDKA 1XN7A 1UB9A 1HKQA 5CVVA 4M6YA 3VFZA 1X3UA 2WV0A 1WQ2A 1EH7A 1STZA 1UHWA 1G4DA 4EGZA 1FP2A 3TDUC 5DV5A 5D5VB 4RB2C 3LA3A 4M9ZA 1ODDA 4G8XA 4P9FA 3I5UA 1ZYRF 3FWEA 4I09A 4Q4ZF 4MNUA 2XKOA 1G3TA 1HKSA 3U9GA 2PFBA 2FMYA 1MGTA 4Y13A 1IF1A 1MD0A 2XHKA 2NAZA 3I53A 3BY6A 4CDGA 1JHFA 3F21A 4LFUA 3DQVC 2Q2EA 5DD4A 2FXAA 4AVPA 4O3MA 1QBJA 1LJ9A 2E7WA 1R00A 3HSEA 1ON1A 4KA4A 3IRRA 5LRRA 4JQFA 1E2XA 1BN5A 5ICFA 2IPQX 4JK1X 4HF2A 1FWZA 1ZHFA 2FEZA 2W85A 3L7WA 2Q0OA 4OMZA 4IRHA 4M9SA 4DNCA 2QWWA 3MAJA 2BE5F 2M8EA 2XAJA 4N0BA 3F23A 4CHUA 2CSOA 4U0YA 4EM0B 4HV6A 4L5JA 4ZYHA 5ILUA 2YU3A 1IXRC 3LQQA 4ZYDA 3GW2A 4GXOA 1XB4A 1ZG3A 4LK1F 1KU7A 2DI3A 4KN7X 4IJAA 5DEQA 1Z9CA 1P4XA 4AIJA 2FBIA 3P9CA 3E6DA 5JVTA 1R23A 2GZWA 1KQ9A 4IF4A 4BHCA 1B1BA 2L01A 3V8LA 2O03A 4P55A 5A2QZ 1FLIA 4F7ZA 1PP7U 1IAWA 3KP7A 4EJOA 3E5QA 1YIOA 2XASA 3GF2A 3HSRA 4HW0A 3CO7C 2E1CA 3T5XA 5HDNA 2HKOA 2XV4S 1TW2A 4RGUA 2H09A 2XAFA 3ERED 3E6CC 3HOSA 2K27A 1HKTA 3M1EA 4KIFA 2FNPA 3R0JA 2IRFG 2DPUA 3WGIA 5K1YA 3KP2A 2OU2A 2M30A 3H3UA 4EJUA 3MQ0A 2CWEA 1XD7A 5D5XB 3GFLA 1KYWA 3K2ZA 3BROA 1ONVA 2O6GE 2YX7A 3ABTA 1SFUA 2PQ8A 1IRGA 5ICCA 1HSJA 2QZ8A 3DPLC 5L3CA 4UNOA 2P4WA 2FNAA 4XLNF 2O61A 3T1BA 5CJ9A 1RUNA 4LLLA 1DP7P 4KN4X 2RDPA 1I1GA 4UUVA 1TQIA 1QO0D 2NRAC 2O3FA 1C0WA 3WTUC 3V7SA 4UXNA 4RAYA 2A3SA 2P7VB 4OINF 3M9AA 3RPQA 1YTYA 2HR3A 3GO5A 3M7GA 1B9MA 1JXSA 1YS7A 5D8LB 3NRVA 2UWMA 2HZTA 2V6CA 1YFHA 4MTEA 2YSRA 3J81K 3SHFA 3J81Z 2QBYB 4MGRA 1XGSA 4P9UA 3WTTC 3CUQC 4AWXB 2L54A 3KZZA 4RGXA 2QVOA 2WC2A 4A0YA 4ENKA 2OAZA 4BXUA 2Z5UA 3I59B 2L4AA 2G7HA 2PN6A 3TO6A 4XBFA 1ZAOA 4YFKF 3E5UA 2H94A 1ZGAA 3W6KB 4WWCA 5ILSA 4B09A 1XCBA 4U0VA 2F5CA 2ZFWA 2ESHA 1CF7B 1S3JA 1LB2A 1IXCA 2FE3A 3VEPA 3HHGA 3WTZA 2L4MA 2E7XA 2UXNA 4BHBA 4HQEA 2W84A 1A04A 4KMFA 1RIOH 3FXRA 3R60A 5FD5A 2J5PA 3KP3A 3EUHA 3HRTA 3ZMUA 1KU2A 3WGGA 3PQKA 3GZ5A 5LRSA 5FGMA 5LLQA 1SD7A 1KA8A 1DPRA 3SFZA 4NHJA 4Q5SF 5D5UB 4KIGA 2ZMEA 3EETA 5HOOA 3DXJF 3GYHX 2HDCA 5CLSA 5IT3A 2K02A 5H6QA 2VODA 4HAMA 4L5IA 5D6EA 3K9TA 4FT8A 2EJRA 2M5WA 4I02A 3DPTA 5FFZA 1MDMB 1HQCA 3KETA 3R0AA 4PZJA 4LB5A 2Z99A 1BIBA 3ZMDA 2FBKA 2VE8A 4NQWA 4O5VA 4G7HF 3ZQ7A 1B6AA 1O3SA 5L3BA 3HTUA 1ZG1A 2XRNA 4TV7A 3VOEA 3GVAA 5K5RA 4LJZF 3Q5FA 3F8FA 2ZNZA 4P5OA 1U6GA 2ZKZA 3NQOA 1BI2A 2VBZA 3C1DA 3RYRA 1TNTA 3DF8A 2OZ6A 3OOPA 3DEUA 2ISZA 1ZN2A 3TDZC 3JW4A 1J59A 2GIVA 5KK1A 2UZKA 2DLLA 5LBQA 4L9TA 4I98B 1SMTA 5HDKA 3HRMA 5BPDA 2IVMA 1R5GA 1H9TA 1O57A 2F5DA 3Q9SA 1HW1A 1I27A 1SFXA 2DW4A 2LNBA 3GUDA 3T8RA 1IW7F 1P92A 4OIQF 1OR7A 3HHHA 4KICA 3ELKA 4QLCU 2YPRA 3FF5A 4UVCA 5ERIA 4OIRF 2ZCWA 3IKVA 3CJNA 2A69F 2VC1A 3RTRA 1FYKA 3EDPA 2XAQA 1T6SA 2BGCA 4M9XA 3KP6A 4RAZA 1T39A 3O2PE 2JSCA 4ZH4F 4ON0A 3RKXA 1Z91A 2D45A 2X4HA 5HS8A 3LAPA 3I4PA 2MC3A 5ICGA 5CVRA 3HUGA 4KUMA 2HS5A 1J5YA 4H0EA 3P7NA 4G6QA 5D8KB 3MCZA 4CICA 2Z33A 1FP1D 2J5OA 1R5HA 3EYYA 1R7JA 2LF8A 1TLHB 1MZBA 2QUFA 2MLGA 2K86A 3CUQA 4LLGF 4CYDA 1OMIA 1PDNC 1EH6A 2F5EA 5HS7A 2IA2A 3F8MA 3WTWC 2F2EA 4HLXA 3P9KA 3FMRA 4E70A 3RYPA 2JPCA 3GX4X 1WI9A 1AWCA 3RKWA 5LEKA 5H20A 2EA4A 2VONA 2STWA 5DCMB 1P6RA 1J2XA 1IXSB 3IRQA 2IA0A 1W7PA 3V8KA 3FMSA 2KIMA 1W7PD 1XGMA 5EEGA 4KT5C 1YW8A 4EM2A 4MQ9F 2CO5A 1O7FA 1D8JA 4K2EA 2CGPA 2FBHA 2ZBKA 3LSTA 5E1ZB 1QNTA 2EA2A 3JSPA 3GEZA 3HTSB 3IKTA 2EB7A 3ISPA 3QOPA 3RIRA 3IC7A 5F64A 3E6MA 1KQ8A 4R8HA 1O7LA 3LQRA 3F8CA 4R79A 3QRFF 2A61A 4GGGA 2FOKA 1XMAA 2JTVA 2DK5A 5BS6A 1OKRA 1G6NA 2DAOA 1SFEA 1FX7A 4ESFA 4PGHA 3BJ6A 2PEXA 3W6JB 1U5TA 4U88A 3ROUA 2C6YA 2DU9A 2RNJA 2JZYA 4FX0A 3LWFA 3TOAA 4LMYA 3K1NA 2JRTA 1ZH5A 3FM3A 5E1WA 5LGTA 2Y48A 2QQAA 5LHIA 2HYFA 1K78B 2P6SA 5FO5A 3ZMSA 1FOKA 3CLOA 1K79A 5A2QK 4MTDA 1ULYA 2COMA 2EFQA 5BMZA 1XDSA 3BWGA 2ZXJA 1LDJA 2Q8KA 1S8NA 4IHTA 4AIKA 4L0ZB 3CDHA 4YFXF 5CVJA 4LG0B 5EEHA 3QPHA 1ZG5A 2RV8A 3S2WA 1K7AA 2FQ3A 1XSDA 5LHGA 1OYWA 3WTSC 3GZ6A 2V9VA 6PAXA 2FA5A 4HZFA 4I0AA 1MKMA 1QQIA 3TOBA 1FYMA 2XROA 2DT5A 5ICEA 3FHZA 5BOXA 1LEBA 5E18F 3HYIA 3RI4A 4IHSA 5DYMA 4HV5A 4IRIA 1ON2A 4RB3C 2M87A 4RGRA 4XRFA 1LNWA 4MHGA 3RJPA 1H9GA 2VOOA 1R1UA 2HWVA 4EJTA 4DQ2A 4UHTA 3GWZA 1O3TA 2ELHA 2PI0A 4ZZDA 3G73A 4Z2YA 3F72A 4RB1A 4B8XA 2KJBA 3WGHA 2D2WA 2KJCA 1ZLKA 3JAMK 4G6DA 3JAMZ 4HF0A 1TBXA 4KMUX 5K5OA 1HBXG 1F5TA 3N97A 1TTYA 1O3QA 2OD5A 3L00A 2BEOA 1KQ0A 4MEYF 1SD4A 4L9NA 4HA8A 2XAGA 4A6EA 2AXLA 2RC4A 3QU6A 1TNSA 5E17F 3F6VA 1WRJA 5HLHA 1OYIA 1S7OA 3R61A 3ULQB 5CVIA 1XSXA 1LEAA 1S29A 5BPIA 5D6FA 4R1HA 1SD6A 1GXQA 1T38A 1RUOA 3K1MA 1XGNA 2M1BA 2H27A 3ZPLA 2VXZA 2RGVA 2X0LA 2HKXA 1DUXC 2EWNA 4G7OF 3MZHA 3IL2A 2W24A 4UV9A 1L0OC 4CO8A 2EFNA 3MFKA 3SQNA 3MEXA 4AD9A 1EV7A 4XSXF 1I1SA 2HQRA 1J7KA 3E6BA 2GA2A 3DFGA 1BC7C 4U0WA 4A0ZA 5F6FA 1W4MA 4I0BA 1J75A 2PLYA 4Y15A 5JFRA 1G3YA 1CGPA 2P5VA 3WODF 2FSWA 4L18B 4G7ZF 4OIOF 2ACJA 1O3RA 1RZ4A 2LDUA 1T2KA 4L9JA 1SAXA 1YW9A 2Z3YA 3M8FA 5ILVA 3RDIA 3TQNA 4UVBA 4UV8A 2GXBA 1FY7A 3FM5A 3U1DA 1Z05A 1GVJA 5KVRA 3WTYC 3G3ZA 4MQVA 3T0YA 3H92A 5J6XA 1FPQA 4EJVA 1Y0UA 2PMHA 1OPCA 5D4SA 2HYGD 3D5LA 2CQKA 2F5FA 4I2OA 2OQGA 2HFHA 1WKMA 1R1VA 1YLFA 4HF1A 2PJPA 3J80Z 3CUOA 1JGSA 2NNYA 5DUKA 3P9IA 4HX7A 1KU3A 2IW5A 3TO9A 4WX9A 1RNLA 4G9YA 1ZRDA 3I58A 4GYGA 4ZYEA 1NHAA 2V1XA 3ZN0A 2DBBA 4ETSA 5K5QA 3Q9VA 4M73A 5TJJA 1CF7A 5IT9K 2EFOA 5IT9Z 1FZPB 4EVIA 1P4AA 2XAHA 2EK5A 1P2FA 5FD6A 2QENA 2Y0MA 2DTRA 2ESNA 1B59A 2NYXA 1XCVA 1QGPA 2XGXA 3KCCA 3LA2A 2R7DA 1ZREA 4U7DA 4NB5A 2OZUA 1FC3A 2ADUA 2OBPA 1B9NA 5AONA 4JBAA 5DD8A 2D1HA 3HRSA 3ZMVA 1VTNC 1E17A 1FBSA 4HBLA 4O6JA 3WG9A 5HLGA 3E97A 3KEOA 2HQNA 3F6OA 5FFXA 2EV5A 4HX4A 1J0RA 3BP8A 2MH2A 1I6XA 1BM9A 3F8NA 5HLIA 1YQAA 4IXAA 1MDMA 3VB2A 3IWFA 3ECOA 4LLNA 4ESBA 2EV0A 1GHCA 3ML6A 2A6EF 1R58A 2HTJA 3O3KA 1SD5A 1BOAA 4OU0A 1T98A 4M72A 2E1NA 4YFNF 2KRFA 2QQBA 3ECHA 2HEOA 3REOA 1Z6RA 2HGCA 2W25A 3DP7A 4RB0A 1BI1A 1MJ9A 4LGWA 1G3SA 4OIPF 1ZGJA 4M74A 4BYYA 2VBYA 4ZYGA 3V7RA 3CTAA 5DCFA 1Q1HA 3WU1B 1USTA 2QYOA 2LKPA 4L9VA 3B02A 2PG4A 3L09A 2MH9A 4PGGA 1USSA 4FHTA 1U5TB 3QU3A 1UHMA 2V1DA 4YG2F 3D0SA 1LVAA 2WTEA 4CXFA 3PQJA 1TQPA 3U2RA 3F8BA 5E8IA 3V4GA 2A6HF 4G94A 4WK8F 3E3VA 3VODA 5F1RA 2OQRA 2K4BA 1MJAA 1IN6A 4EQQA 2EV6A 1FYLA 2IA1A 4BAYA 4EV0A 1R1TA 4XLPF 1JHHA 3KP5A 3SZPA 2FU4A 3BPXA 3C7JA 4YIFA 2CG4A 2VOPA 5L3EA 1IN7A 5FLXK 2IJLA 2K7LA 5FLXZ 4FX4A 2Z9OA 2BV6A 4GCVA 1Z1DA 2LF7A 2MLKA 3C18A 3N4MA 1HXDA 4IPAA 3JTHA 5LGNA 2P7CB 2L02A 3MWMA 1U3EM 4EMSA 4LD5A 2B0LA 3OV8A 3BZ6A 1FSHA 3NEUA 4M6XA 2VN2A 5JHUA 2BYVE 5TRDA 4A2UA 1V4RA 4D0PA 1BC8C 4KDPA 2R3SA 3BJOA 3K0LA 4WCGA 3KEQA 3V7CA 2P6TA 3KFWX 3DKWA 3DV8A 4IVNA 2JPBA 2VBWA 4HOBA 2IP2A 1Z7UA 2H6BA 4OMYA 5CYVA 3KZYA 3ZN1A 4WXHA 5LHHA 4HDVA 5CVUA 5LEJA 1XSVA 1XGOA 2YX4A 3KLOA 1ZRFA 5L3FA 1H0MA 3V8JA 2VT2A 2UXXA 3ABUA 2GXGA 5DCMA 2MD5A 1Z6TA 1D3YA 1QPMA 2XIGA 4P96A 2M45A 5BQTA 3TO7A 3FXQA 1SMYF 1R22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R36 A;  1YS6 A;  1FBQ A;  3RKY A;  2DQL A;  4Y17 A;  2ZO4 A;  1YG2 A;  1XMK A;  3IWZ A;  2EFP A;  2GQQ A;  3B73 A;  4WXD A;  2DK8 A;  3KE2 A;  1IN4 A;  1ZLJ A;  2HTS A;  4A12 A;  2YR2 A;  1KGS A;  3WTX C;  2V79 A;  5L3D A;  5HVQ C;  3I71 A;  3FZV A;  2DFI A;  1JE8 A;  3JSO A;  1QZZ A;  3GFI A;  3KP4 A;  3SXY A;  4WF2 A;  4CZZ A;  3BOQ A;  1IRF A;  5JI6 A;  2DO7 A;  2O8X A;  3M8E A;  3F3X A;  4U7B A;  2XKP A;  5HDG A;  1QZY A;  2RQP A;  4ENM A;  2VBX A;  1S6L A;  3L9F A;  5FB2 A;  1BI3 A;  4WXC A;  3BJA A;  1L3L A;  1K78 A;  1FNN A;  4KYW A;  1FSE A;  1BIA A;  3CO6 C;  3L2C A;  1F9N A;  2FML A;  2QQ9 A;  1U78 A;  3WE3 A;  3FXU A;  2CW0 F;  1WSU A;  2TDX A;  4LG0 A;  1DDN A;  2LSO A;  3QP5 A;  3TKY A;  4MEX F;  3LA7 A;  3GLX A;  2ZME B;  4GYI A;  4EGY A;  1F4K A;  4XSZ F;  2A68 F;  2GA1 A;  4KNY A;  2MA3 A;  3KLN A;  2KIF A;  4Q47 A;  3GXO A;  3HOT A;  3F22 A;  4BHP A;  4EM1 A;  3QPT A;  1AOY A;  4AIH A;  1B4A A;  1UCR A;  3K1P A;  2EFW A;  3I54 A;  5HS9 A;  1D5V A;  1YW7 A;  2XUB A;  2FRH A;  2CFX A;  2FF4 A;  1W5T A;  3COA C;  1DPU A;  5J8F A;  5DUI A;  3JTG A;  1BJA A;  2G9W A;  4OOI A;  5L3G A;  4HLY A;  1ZAR A;  2KKO A;  2XVC A;  4RS8 A;  1XDU A;  2O0Y A;  4HYE A;  3H3Z A;  5DDG A;  5JR3 A;  1V3F A;  1G3W A;  2HOE A;  1ZRC A;  3ZP5 A;  4A5M A;  5E20 A;  2NNN A;  2ZNY A;  1FT9 A;  3GFJ A;  4LB6 B;  2JT1 A;  2H6C A;  1OYY A;  1EH8 A;  3EYI A;  1U2W A;  3WE2 A;  1PP8 F;  2RVC A;  2PMU A;  1HST A;  5E1X A;  2L3D A;  4EJW A;  4HDU A;  2OA4 A;  4L0Y B;  3GFM A;  4YII A;  1FBU A;  2VT3 A;  4BQA A;  3ZMZ A;  1HW2 A;  3MZY A;  2GAU A;  1F1Z A;  1BI0 A;  2ETH A;  3QP6 A;  2QBY A;  4I01 A;  4HX8 A;  4LK0 F;  1LQ1 A;  3WU0 A;  3R6S A;  4I7H A;  4KFC A;  3J80 K;  4Q48 A;  4ZZL A;  1U5T C;  4S04 A;  4GO1 A;  3I59 A;  3I64 A;  1BBY A;  5E8G A;  5H6R A;  1LDD A;  4A0X A;  2BBY A;  3FX3 A;  3I0T A;  2RKH A;  2NS0 A;  4BNC A;  1IUY A;  3EQL F;  5D4R A;  4ASN A;  2IT0 A;  1T0F A;  2Y75 A;  2QLZ A;  1WWX A;  1GXP A;  4ENN A;  1UFM A;  3FMQ A;  2WWY A;  1I5Z A;  2GWR A;  2ISY A;  1TQM A;  4A5N A;  2D1V A;  3RPU A;  3HIF A;  4KIB A;  5LGU A;  2PBI A;  5D5W B;  4ESJ A;  2P5K A;  4S05 A;  2P5L C;  1IN5 A;  4ENJ A;  2DQR A;  1MJB A;  1YYV A;  1RI7 A;  2G7U A;  4N9H A;  5ED4 A;  2VE9 A;  3CUQ B;  2V1U A;  4M71 A;  1HW5 A;  2CYY A;  1S7A A;  1TW3 A;  1REP C;  1PUE E;  1J9I A;  2W57 A;  4PCQ A;  2ZJ2 A;  1D8K A;  4UVA A;  3SZT A;  4IRG A;  3ZMT A;  4QWQ A;  3AAF A;  3BDD A;  3J7A O;  4RGS A;  3BPV A;  1W7P B;  5AIQ A;  2R7F A;  1P4W A;  4N9I A;  2AS5 F;  4CGZ A;  2MBF A;  3E5X A;  2KIU A;  3LAJ A;  5J8C A;  3K69 A;  2STT A;  2K4J A;  3QAH A;  2RN7 A;  5AIP A;  2QM3 A;  3HRU A;  4BH9 A;  4A6D A;  4HQM A;  3PFI A;  2A5Y B;  2DPD A;  2A07 F;  1IN8 A;  1LDK B;  1KU9 A;  3TGN A;  3R4K A;  2VC0 A;  3LFK A;  1U8R A;  3O6B B;  3WTV C;  3HSF A;  1YO5 C;  3T8T A;  1IZ1 A;  2P8T A;  1KYZ A;  3IHU A;  3C3W A;  1W5S A;  1K6O A;  4PDK A;  1XN7 A;  1UB9 A;  1HKQ A;  5CVV A;  4M6Y A;  3VFZ A;  1X3U A;  2WV0 A;  1WQ2 A;  1EH7 A;  1STZ A;  1UHW A;  1G4D A;  4EGZ A;  1FP2 A;  3TDU C;  5DV5 A;  5D5V B;  4RB2 C;  3LA3 A;  4M9Z A;  1ODD A;  4G8X A;  4P9F A;  3I5U A;  1ZYR F;  3FWE A;  4I09 A;  4Q4Z F;  4MNU A;  2XKO A;  1G3T A;  1HKS A;  3U9G A;  2PFB A;  2FMY A;  1MGT A;  4Y13 A;  1IF1 A;  1MD0 A;  2XHK A;  2NAZ A;  3I53 A;  3BY6 A;  4CDG A;  1JHF A;  3F21 A;  4LFU A;  3DQV C;  2Q2E A;  5DD4 A;  2FXA A;  4AVP A;  4O3M A;  1QBJ A;  1LJ9 A;  2E7W A;  1R00 A;  3HSE A;  1ON1 A;  4KA4 A;  3IRR A;  5LRR A;  4JQF A;  1E2X A;  1BN5 A;  5ICF A;  2IPQ X;  4JK1 X;  4HF2 A;  1FWZ A;  1ZHF A;  2FEZ A;  2W85 A;  3L7W A;  2Q0O A;  4OMZ A;  4IRH A;  4M9S A;  4DNC A;  2QWW A;  3MAJ A;  2BE5 F;  2M8E A;  2XAJ A;  4N0B A;  3F23 A;  4CHU A;  2CSO A;  4U0Y A;  4EM0 B;  4HV6 A;  4L5J A;  4ZYH A;  5ILU A;  2YU3 A;  1IXR C;  3LQQ A;  4ZYD A;  3GW2 A;  4GXO A;  1XB4 A;  1ZG3 A;  4LK1 F;  1KU7 A;  2DI3 A;  4KN7 X;  4IJA A;  5DEQ A;  1Z9C A;  1P4X A;  4AIJ A;  2FBI A;  3P9C A;  3E6D A;  5JVT A;  1R23 A;  2GZW A;  1KQ9 A;  4IF4 A;  4BHC A;  1B1B A;  2L01 A;  3V8L A;  2O03 A;  4P55 A;  5A2Q Z;  1FLI A;  4F7Z A;  1PP7 U;  1IAW A;  3KP7 A;  4EJO A;  3E5Q A;  1YIO A;  2XAS A;  3GF2 A;  3HSR A;  4HW0 A;  3CO7 C;  2E1C A;  3T5X A;  5HDN A;  2HKO A;  2XV4 S;  1TW2 A;  4RGU A;  2H09 A;  2XAF A;  3ERE D;  3E6C C;  3HOS A;  2K27 A;  1HKT A;  3M1E A;  4KIF A;  2FNP A;  3R0J A;  2IRF G;  2DPU A;  3WGI A;  5K1Y A;  3KP2 A;  2OU2 A;  2M30 A;  3H3U A;  4EJU A;  3MQ0 A;  2CWE A;  1XD7 A;  5D5X B;  3GFL A;  1KYW A;  3K2Z A;  3BRO A;  1ONV A;  2O6G E;  2YX7 A;  3ABT A;  1SFU A;  2PQ8 A;  1IRG A;  5ICC A;  1HSJ A;  2QZ8 A;  3DPL C;  5L3C A;  4UNO A;  2P4W A;  2FNA A;  4XLN F;  2O61 A;  3T1B A;  5CJ9 A;  1RUN A;  4LLL A;  1DP7 P;  4KN4 X;  2RDP A;  1I1G A;  4UUV A;  1TQI A;  1QO0 D;  2NRA C;  2O3F A;  1C0W A;  3WTU C;  3V7S A;  4UXN A;  4RAY A;  2A3S A;  2P7V B;  4OIN F;  3M9A A;  3RPQ A;  1YTY A;  2HR3 A;  3GO5 A;  3M7G A;  1B9M A;  1JXS A;  1YS7 A;  5D8L B;  3NRV A;  2UWM A;  2HZT A;  2V6C A;  1YFH A;  4MTE A;  2YSR A;  3J81 K;  3SHF A;  3J81 Z;  2QBY B;  4MGR A;  1XGS A;  4P9U A;  3WTT C;  3CUQ C;  4AWX B;  2L54 A;  3KZZ A;  4RGX A;  2QVO A;  2WC2 A;  4A0Y A;  4ENK A;  2OAZ A;  4BXU A;  2Z5U A;  3I59 B;  2L4A A;  2G7H A;  2PN6 A;  3TO6 A;  4XBF A;  1ZAO A;  4YFK F;  3E5U A;  2H94 A;  1ZGA A;  3W6K B;  4WWC A;  5ILS A;  4B09 A;  1XCB A;  4U0V A;  2F5C A;  2ZFW A;  2ESH A;  1CF7 B;  1S3J A;  1LB2 A;  1IXC A;  2FE3 A;  3VEP A;  3HHG A;  3WTZ A;  2L4M A;  2E7X A;  2UXN A;  4BHB A;  4HQE A;  2W84 A;  1A04 A;  4KMF A;  1RIO H;  3FXR A;  3R60 A;  5FD5 A;  2J5P A;  3KP3 A;  3EUH A;  3HRT A;  3ZMU A;  1KU2 A;  3WGG A;  3PQK A;  3GZ5 A;  5LRS A;  5FGM A;  5LLQ A;  1SD7 A;  1KA8 A;  1DPR A;  3SFZ A;  4NHJ A;  4Q5S F;  5D5U B;  4KIG A;  2ZME A;  3EET A;  5HOO A;  3DXJ F;  3GYH X;  2HDC A;  5CLS A;  5IT3 A;  2K02 A;  5H6Q A;  2VOD A;  4HAM A;  4L5I A;  5D6E A;  3K9T A;  4FT8 A;  2EJR A;  2M5W A;  4I02 A;  3DPT A;  5FFZ A;  1MDM B;  1HQC A;  3KET A;  3R0A A;  4PZJ A;  4LB5 A;  2Z99 A;  1BIB A;  3ZMD A;  2FBK A;  2VE8 A;  4NQW A;  4O5V A;  4G7H F;  3ZQ7 A;  1B6A A;  1O3S A;  5L3B A;  3HTU A;  1ZG1 A;  2XRN A;  4TV7 A;  3VOE A;  3GVA A;  5K5R A;  4LJZ F;  3Q5F A;  3F8F A;  2ZNZ A;  4P5O A;  1U6G A;  2ZKZ A;  3NQO A;  1BI2 A;  2VBZ A;  3C1D A;  3RYR A;  1TNT A;  3DF8 A;  2OZ6 A;  3OOP A;  3DEU A;  2ISZ A;  1ZN2 A;  3TDZ C;  3JW4 A;  1J59 A;  2GIV A;  5KK1 A;  2UZK A;  2DLL A;  5LBQ A;  4L9T A;  4I98 B;  1SMT A;  5HDK A;  3HRM A;  5BPD A;  2IVM A;  1R5G A;  1H9T A;  1O57 A;  2F5D A;  3Q9S A;  1HW1 A;  1I27 A;  1SFX A;  2DW4 A;  2LNB A;  3GUD A;  3T8R A;  1IW7 F;  1P92 A;  4OIQ F;  1OR7 A;  3HHH A;  4KIC A;  3ELK A;  4QLC U;  2YPR A;  3FF5 A;  4UVC A;  5ERI A;  4OIR F;  2ZCW A;  3IKV A;  3CJN A;  2A69 F;  2VC1 A;  3RTR A;  1FYK A;  3EDP A;  2XAQ A;  1T6S A;  2BGC A;  4M9X A;  3KP6 A;  4RAZ A;  1T39 A;  3O2P E;  2JSC A;  4ZH4 F;  4ON0 A;  3RKX A;  1Z91 A;  2D45 A;  2X4H A;  5HS8 A;  3LAP A;  3I4P A;  2MC3 A;  5ICG A;  5CVR A;  3HUG A;  4KUM A;  2HS5 A;  1J5Y A;  4H0E A;  3P7N A;  4G6Q A;  5D8K B;  3MCZ A;  4CIC A;  2Z33 A;  1FP1 D;  2J5O A;  1R5H A;  3EYY A;  1R7J A;  2LF8 A;  1TLH B;  1MZB A;  2QUF A;  2MLG A;  2K86 A;  3CUQ A;  4LLG F;  4CYD A;  1OMI A;  1PDN C;  1EH6 A;  2F5E A;  5HS7 A;  2IA2 A;  3F8M A;  3WTW C;  2F2E A;  4HLX A;  3P9K A;  3FMR A;  4E70 A;  3RYP A;  2JPC A;  3GX4 X;  1WI9 A;  1AWC A;  3RKW A;  5LEK A;  5H20 A;  2EA4 A;  2VON A;  2STW A;  5DCM B;  1P6R A;  1J2X A;  1IXS B;  3IRQ A;  2IA0 A;  1W7P A;  3V8K A;  3FMS A;  2KIM A;  1W7P D;  1XGM A;  5EEG A;  4KT5 C;  1YW8 A;  4EM2 A;  4MQ9 F;  2CO5 A;  1O7F A;  1D8J A;  4K2E A;  2CGP A;  2FBH A;  2ZBK A;  3LST A;  5E1Z B;  1QNT A;  2EA2 A;  3JSP A;  3GEZ A;  3HTS B;  3IKT A;  2EB7 A;  3ISP A;  3QOP A;  3RIR A;  3IC7 A;  5F64 A;  3E6M A;  1KQ8 A;  4R8H A;  1O7L A;  3LQR A;  3F8C A;  4R79 A;  3QRF F;  2A61 A;  4GGG A;  2FOK A;  1XMA A;  2JTV A;  2DK5 A;  5BS6 A;  1OKR A;  1G6N A;  2DAO A;  1SFE A;  1FX7 A;  4ESF A;  4PGH A;  3BJ6 A;  2PEX A;  3W6J B;  1U5T A;  4U88 A;  3ROU A;  2C6Y A;  2DU9 A;  2RNJ A;  2JZY A;  4FX0 A;  3LWF A;  3TOA A;  4LMY A;  3K1N A;  2JRT A;  1ZH5 A;  3FM3 A;  5E1W A;  5LGT A;  2Y48 A;  2QQA A;  5LHI A;  2HYF A;  1K78 B;  2P6S A;  5FO5 A;  3ZMS A;  1FOK A;  3CLO A;  1K79 A;  5A2Q K;  4MTD A;  1ULY A;  2COM A;  2EFQ A;  5BMZ A;  1XDS A;  3BWG A;  2ZXJ A;  1LDJ A;  2Q8K A;  1S8N A;  4IHT A;  4AIK A;  4L0Z B;  3CDH A;  4YFX F;  5CVJ A;  4LG0 B;  5EEH A;  3QPH A;  1ZG5 A;  2RV8 A;  3S2W A;  1K7A A;  2FQ3 A;  1XSD A;  5LHG A;  1OYW A;  3WTS C;  3GZ6 A;  2V9V A;  6PAX A;  2FA5 A;  4HZF A;  4I0A A;  1MKM A;  1QQI A;  3TOB A;  1FYM A;  2XRO A;  2DT5 A;  5ICE A;  3FHZ A;  5BOX A;  1LEB A;  5E18 F;  3HYI A;  3RI4 A;  4IHS A;  5DYM A;  4HV5 A;  4IRI A;  1ON2 A;  4RB3 C;  2M87 A;  4RGR A;  4XRF A;  1LNW A;  4MHG A;  3RJP A;  1H9G A;  2VOO A;  1R1U A;  2HWV A;  4EJT A;  4DQ2 A;  4UHT A;  3GWZ A;  1O3T A;  2ELH A;  2PI0 A;  4ZZD A;  3G73 A;  4Z2Y A;  3F72 A;  4RB1 A;  4B8X A;  2KJB A;  3WGH A;  2D2W A;  2KJC A;  1ZLK A;  3JAM K;  4G6D A;  3JAM Z;  4HF0 A;  1TBX A;  4KMU X;  5K5O A;  1HBX G;  1F5T A;  3N97 A;  1TTY A;  1O3Q A;  2OD5 A;  3L00 A;  2BEO A;  1KQ0 A;  4MEY F;  1SD4 A;  4L9N A;  4HA8 A;  2XAG A;  4A6E A;  2AXL A;  2RC4 A;  3QU6 A;  1TNS A;  5E17 F;  3F6V A;  1WRJ A;  5HLH A;  1OYI A;  1S7O A;  3R61 A;  3ULQ B;  5CVI A;  1XSX A;  1LEA A;  1S29 A;  5BPI A;  5D6F A;  4R1H A;  1SD6 A;  1GXQ A;  1T38 A;  1RUO A;  3K1M A;  1XGN A;  2M1B A;  2H27 A;  3ZPL A;  2VXZ A;  2RGV A;  2X0L A;  2HKX A;  1DUX C;  2EWN A;  4G7O F;  3MZH A;  3IL2 A;  2W24 A;  4UV9 A;  1L0O C;  4CO8 A;  2EFN A;  3MFK A;  3SQN A;  3MEX A;  4AD9 A;  1EV7 A;  4XSX F;  1I1S A;  2HQR A;  1J7K A;  3E6B A;  2GA2 A;  3DFG A;  1BC7 C;  4U0W A;  4A0Z A;  5F6F A;  1W4M A;  4I0B A;  1J75 A;  2PLY A;  4Y15 A;  5JFR A;  1G3Y A;  1CGP A;  2P5V A;  3WOD F;  2FSW A;  4L18 B;  4G7Z F;  4OIO F;  2ACJ A;  1O3R A;  1RZ4 A;  2LDU A;  1T2K A;  4L9J A;  1SAX A;  1YW9 A;  2Z3Y A;  3M8F A;  5ILV A;  3RDI A;  3TQN A;  4UVB A;  4UV8 A;  2GXB A;  1FY7 A;  3FM5 A;  3U1D A;  1Z05 A;  1GVJ A;  5KVR A;  3WTY C;  3G3Z A;  4MQV A;  3T0Y A;  3H92 A;  5J6X A;  1FPQ A;  4EJV A;  1Y0U A;  2PMH A;  1OPC A;  5D4S A;  2HYG D;  3D5L A;  2CQK A;  2F5F A;  4I2O A;  2OQG A;  2HFH A;  1WKM A;  1R1V A;  1YLF A;  4HF1 A;  2PJP A;  3J80 Z;  3CUO A;  1JGS A;  2NNY A;  5DUK A;  3P9I A;  4HX7 A;  1KU3 A;  2IW5 A;  3TO9 A;  4WX9 A;  1RNL A;  4G9Y A;  1ZRD A;  3I58 A;  4GYG A;  4ZYE A;  1NHA A;  2V1X A;  3ZN0 A;  2DBB A;  4ETS A;  5K5Q A;  3Q9V A;  4M73 A;  5TJJ A;  1CF7 A;  5IT9 K;  2EFO A;  5IT9 Z;  1FZP B;  4EVI A;  1P4A A;  2XAH A;  2EK5 A;  1P2F A;  5FD6 A;  2QEN A;  2Y0M A;  2DTR A;  2ESN A;  1B59 A;  2NYX A;  1XCV A;  1QGP A;  2XGX A;  3KCC A;  3LA2 A;  2R7D A;  1ZRE A;  4U7D A;  4NB5 A;  2OZU A;  1FC3 A;  2ADU A;  2OBP A;  1B9N A;  5AON A;  4JBA A;  5DD8 A;  2D1H A;  3HRS A;  3ZMV A;  1VTN C;  1E17 A;  1FBS A;  4HBL A;  4O6J A;  3WG9 A;  5HLG A;  3E97 A;  3KEO A;  2HQN A;  3F6O A;  5FFX A;  2EV5 A;  4HX4 A;  1J0R A;  3BP8 A;  2MH2 A;  1I6X A;  1BM9 A;  3F8N A;  5HLI A;  1YQA A;  4IXA A;  1MDM A;  3VB2 A;  3IWF A;  3ECO A;  4LLN A;  4ESB A;  2EV0 A;  1GHC A;  3ML6 A;  2A6E F;  1R58 A;  2HTJ A;  3O3K A;  1SD5 A;  1BOA A;  4OU0 A;  1T98 A;  4M72 A;  2E1N A;  4YFN F;  2KRF A;  2QQB A;  3ECH A;  2HEO A;  3REO A;  1Z6R A;  2HGC A;  2W25 A;  3DP7 A;  4RB0 A;  1BI1 A;  1MJ9 A;  4LGW A;  1G3S A;  4OIP F;  1ZGJ A;  4M74 A;  4BYY A;  2VBY A;  4ZYG A;  3V7R A;  3CTA A;  5DCF A;  1Q1H A;  3WU1 B;  1UST A;  2QYO A;  2LKP A;  4L9V A;  3B02 A;  2PG4 A;  3L09 A;  2MH9 A;  4PGG A;  1USS A;  4FHT A;  1U5T B;  3QU3 A;  1UHM A;  2V1D A;  4YG2 F;  3D0S A;  1LVA A;  2WTE A;  4CXF A;  3PQJ A;  1TQP A;  3U2R A;  3F8B A;  5E8I A;  3V4G A;  2A6H F;  4G94 A;  4WK8 F;  3E3V A;  3VOD A;  5F1R A;  2OQR A;  2K4B A;  1MJA A;  1IN6 A;  4EQQ A;  2EV6 A;  1FYL A;  2IA1 A;  4BAY A;  4EV0 A;  1R1T A;  4XLP F;  1JHH A;  3KP5 A;  3SZP A;  2FU4 A;  3BPX A;  3C7J A;  4YIF A;  2CG4 A;  2VOP A;  5L3E A;  1IN7 A;  5FLX K;  2IJL A;  2K7L A;  5FLX Z;  4FX4 A;  2Z9O A;  2BV6 A;  4GCV A;  1Z1D A;  2LF7 A;  2MLK A;  3C18 A;  3N4M A;  1HXD A;  4IPA A;  3JTH A;  5LGN A;  2P7C B;  2L02 A;  3MWM A;  1U3E M;  4EMS A;  4LD5 A;  2B0L A;  3OV8 A;  3BZ6 A;  1FSH A;  3NEU A;  4M6X A;  2VN2 A;  5JHU A;  2BYV E;  5TRD A;  4A2U A;  1V4R A;  4D0P A;  1BC8 C;  4KDP A;  2R3S A;  3BJO A;  3K0L A;  4WCG A;  3KEQ A;  3V7C A;  2P6T A;  3KFW X;  3DKW A;  3DV8 A;  4IVN A;  2JPB A;  2VBW A;  4HOB A;  2IP2 A;  1Z7U A;  2H6B A;  4OMY A;  5CYV A;  3KZY A;  3ZN1 A;  4WXH A;  5LHH A;  4HDV A;  5CVU A;  5LEJ A;  1XSV A;  1XGO A;  2YX4 A;  3KLO A;  1ZRF A;  5L3F A;  1H0M A;  3V8J A;  2VT2 A;  2UXX A;  3ABU A;  2GXG A;  5DCM A;  2MD5 A;  1Z6T A;  1D3Y A;  1QPM A;  2XIG A;  4P96 A;  2M45 A;  5BQT A;  3TO7 A;  3FXQ A;  1SMY F;  1R22 A; 
#chains in the Genus database with same CATH topology
 1R36 A;  1YS6 A;  1FBQ A;  1Q1V A;  3RKY A;  2DQL A;  4Y17 A;  2ZO4 A;  1YG2 A;  2ECC A;  1XMK A;  3NWS A;  1IRX A;  1Z77 A;  1MSE C;  3IWZ A;  1X3W B;  2EFP A;  2GQQ A;  3B73 A;  4JYK A;  3ZQI A;  2FD5 A;  4WXD A;  2DK8 A;  2B63 J;  1SVO A;  1B72 A;  3M1C A;  3KE2 A;  1IN4 A;  2AO9 A;  3KX2 A;  1ZLJ A;  2HTS A;  5FRN A;  3DU5 A;  4A12 A;  2YR2 A;  1MH4 A;  1VND A;  2LKS A;  1KGS A;  1WPK A;  3WTX C;  2V79 A;  5L3D A;  4MLO A;  2VKE A;  5EJC A;  5HVQ C;  2EIK H;  4HEA 2;  2AHQ A;  3I71 A;  3FZV A;  2TRT A;  3CJQ B;  4MFD A;  1XTA A;  4Y4R A;  3L2V A;  2DFI A;  1OCZ H;  1JE8 A;  2E5Z A;  4KT6 A;  3JSO A;  3RZO J;  3W2A A;  1QZZ A;  2JA2 A;  3GFI A;  4JX6 A;  1WZ2 A;  4IQ4 A;  3KP4 A;  4XID A;  3A01 A;  2W7N A;  3SXY A;  3OYM A;  5J1Y A;  2CMP A;  2VJ4 A;  4NC6 A;  4WF2 A;  1ACI A;  1OFC X;  4CZZ A;  4QIW N;  1UHS A;  3BOQ A;  1JGG A;  1D1B A;  1IRF A;  4HPQ A;  5JI6 A;  2DO7 A;  2O8X A;  1NK3 P;  4AYB N;  3M8E A;  3F3X A;  4U7B A;  2XKP A;  5HDG A;  1QZY A;  2RQP A;  3HL2 A;  4ENM A;  2VBX A;  1S6L A;  1WJE A;  3L9F A;  1QZE A;  5FB2 A;  1BI3 A;  3C2H A;  4WXC A;  3BJA A;  4BJ6 C;  1L3L A;  2X85 A;  1K78 A;  4IEJ A;  2X6Y A;  1FNN A;  4KYW A;  1FSE A;  2ID6 A;  3JRC A;  2K9N A;  1I6H J;  1XMX A;  1A6Q A;  1BIA A;  2L0K A;  3MKY B;  3BLY A;  4DBR A;  1D0Z A;  3CJR B;  1QHH D;  3CO6 C;  2R7X A;  2RQQ A;  5IOZ A;  1BL0 A;  3EUK L;  3L2C A;  1F9N A;  2FML A;  4CUG A;  2QQ9 A;  1U78 A;  4E7K A;  3WE3 A;  1W1W E;  5IPA A;  2KIQ A;  4FE4 A;  2KP6 A;  3FXU A;  2CW0 F;  3DPU A;  2R7R A;  4RBO A;  1OCO H;  4XOP A;  1WSU A;  2TDX A;  4LG0 A;  4IHX A;  4A3K J;  4A93 J;  1W0T A;  1DDN A;  4BEH B;  4NNJ A;  1HLV A;  1BOB A;  2LSO A;  2HQA A;  2DTZ A;  3AG3 H;  3QP5 A;  2LLK A;  3ESW B;  5JLW A;  2Y31 A;  3TKY A;  4MEX F;  2DJN A;  3LA7 A;  3GLX A;  2ZME B;  4GYI A;  4EGY A;  5LD2 C;  1F4K A;  2L2O A;  4XSZ F;  2A68 F;  2GA1 A;  4KNY A;  2MA3 A;  5EZG A;  2WAQ A;  3KLN A;  2KIF A;  4Q47 A;  1HCR A;  4A3C J;  3GXO A;  3HOT A;  3F22 A;  3PM1 A;  2HDD A;  3VPR A;  3G1O A;  4BHP A;  2IS6 A;  2WAD A;  4EM1 A;  3QPT A;  2H8R A;  1AOY A;  4CYC A;  1T8I A;  4AIH A;  1B4A A;  1UCR A;  5K7H A;  3K1P A;  2EFW A;  3I54 A;  1IUF A;  1K4S A;  1BA5 A;  2E2I J;  5HS9 A;  3S1Q J;  1D5V A;  1YW7 A;  3ABL H;  2WY7 Q;  2XUB A;  2NVY J;  2FRH A;  2CFX A;  2KIS A;  4F52 A;  2FF4 A;  3OSG A;  1W5T A;  3I4N J;  4B43 A;  3COA C;  1DPU A;  1LFU P;  5J8F A;  3BT9 A;  5DUI A;  2MGQ A;  3JTG A;  1BJA A;  1IC8 A;  2CQN A;  2G9W A;  4OOI A;  4PSW A;  2P0W A;  5L3G A;  1QVU A;  2M4K A;  4HLY A;  1P7I A;  1ZAR A;  2KKO A;  2XVC A;  4RS8 A;  1XDU A;  3MKZ A;  1BR2 A;  4IHW A;  4XR6 A;  4BUP A;  2KFD A;  2O0Y A;  5F27 A;  4HYE A;  3H3Z A;  5DDG A;  5JR3 A;  3ZQF A;  1OCR H;  5E3L A;  4ZJZ A;  3L1P A;  3S32 A;  1V3F A;  1G3W A;  1DU6 A;  2K9M A;  2HOE A;  1ZRC A;  4B44 A;  3OYA A;  4ANJ A;  3H9G A;  3HOV J;  1ZTR A;  3ZP5 A;  4A5M A;  1DU0 A;  2A6T A;  5E20 A;  2JVG A;  1AHD P;  2NNN A;  2LYC A;  2M2E A;  2IS2 A;  3FXJ A;  1SVM A;  2ZNY A;  3W2V A;  4B3A A;  3H5A A;  1FT9 A;  3OYL A;  1J09 A;  1MBK A;  3GFJ A;  5GAE J;  4LB6 B;  1UZC A;  2JT1 A;  2H6C A;  3OY9 A;  1OYY A;  1EH8 A;  3BG9 A;  3EYI A;  2IAI A;  1U2W A;  3WE2 A;  2Y69 H;  1PP8 F;  2RVC A;  2Y0S A;  4A3J J;  2PMU A;  4ZDO A;  3HGY A;  3BR2 A;  1HST A;  4OAY A;  1KZH A;  5E1X A;  2CW8 A;  1E3H A;  2V9P A;  2L3D A;  3M3Y J;  4EJW A;  4HDU A;  2OA4 A;  1VI0 A;  2IXS A;  4L0Y B;  3GFM A;  4YII A;  2LMD A;  3IH4 A;  3Q3S A;  4XLF A;  1FBU A;  2VT3 A;  2ME0 A;  4BQA A;  3TL4 X;  3ZMZ A;  1YRN A;  3MN2 A;  4BJ5 C;  1U8B A;  1HW2 A;  3MZY A;  2GAU A;  2K40 A;  1F1Z A;  1BI0 A;  2ETH A;  3QP6 A;  4XQF A;  4E7J A;  2QBY A;  1WI3 A;  1VQK I;  1R6R A;  4I01 A;  5J4V A;  4XLE A;  3C2B A;  4HX8 A;  4LK0 F;  1LQ1 A;  3WU0 A;  3R6S A;  3VYT B;  1X4P A;  5HLT A;  2CQX A;  4I7H A;  1QA6 A;  4KFC A;  4CCK A;  3BR3 A;  4BBS J;  3J80 K;  3L2Q A;  3A0H C;  4Q48 A;  3CMM A;  3HOZ J;  4ZZL A;  3K70 D;  5EZH A;  2R0Q C;  5J3L A;  3WHC A;  1WVR A;  1U5T C;  3KYD B;  2XB5 A;  5FKO A;  4S04 A;  2WB1 N;  4ITV A;  4GO1 A;  3I59 A;  3I64 A;  1T33 A;  2HVS A;  1BBY A;  5E8G A;  1B8I A;  5H6R A;  1LDD A;  4A0X A;  1JTX A;  2BBY A;  2VKH A;  3BR6 A;  3FX3 A;  3I0T A;  3HDD A;  1S9H A;  3H0G J;  2NOJ B;  2QGU A;  2NS0 A;  2RKH A;  1BW5 A;  4BNC A;  2DFH A;  1NTC A;  3ZQC A;  1IUY A;  3EQL F;  5D4R A;  4UY8 I;  2HOT A;  4ASN A;  2IT0 A;  2EPF A;  3BR5 A;  1T0F A;  2E2H J;  2Y75 A;  1X1P A;  1RPW A;  2QLZ A;  4B4C A;  5IP7 J;  1WWX A;  2E19 A;  2Z16 A;  2ID3 A;  2Z2S B;  1GXP A;  3JRI A;  1APL C;  2HPM A;  4ENN A;  3DTI A;  1YHQ I;  1UFM A;  4BKX A;  3FMQ A;  3RQ4 A;  1KON A;  1Y39 A;  1X1D A;  2WWY A;  3QPS A;  1XX5 A;  2MYS A;  1I5Z A;  2GWR A;  4FE7 A;  1YX3 A;  4B3X A;  5F0H A;  2ISY A;  3K4B A;  1TQM A;  4A5N A;  3OYJ A;  2D1V A;  1Y8R B;  3RPU A;  3HUG B;  3X2Q H;  2VLA A;  5C4X J;  1DGR M;  4BBR J;  4UB6 C;  3A2K A;  1TT5 B;  3HIF A;  3A1Y A;  2VAS A;  4KIB A;  5LGU A;  2PBI A;  4RAF A;  4ZDL A;  5D5W B;  4UUS B;  4ESJ A;  2P5K A;  4S05 A;  2P5L C;  1IN5 A;  1Z67 A;  2BHZ A;  1MW7 A;  4ENJ A;  2DQR A;  1MJB A;  1FMW A;  1RI7 A;  1YYV A;  2G7U A;  4N9H A;  5GTH C;  2KDZ A;  5ED4 A;  1X4O A;  4BL0 B;  2VE9 A;  3CUQ B;  2GBY A;  3VYU B;  1TWH J;  2V1U A;  4M71 A;  4DZP A;  2ZXH A;  2QQ8 A;  4CSW A;  2OF7 A;  5EG0 B;  1HW5 A;  2CYY A;  1S7A A;  3PO3 J;  3H9Q A;  2VQG A;  1TW3 A;  1REP C;  3K4K A;  3RKQ A;  1EA3 A;  1PUE E;  3CCM I;  2B9S A;  1S72 I;  2VXD A;  1J9I A;  1HOM A;  1E3P A;  3LSM A;  2W57 A;  4PCQ A;  1WH5 A;  3KEY A;  2ZJ2 A;  1D8K A;  2G0E A;  2K3F A;  4G6T B;  4XOR A;  5GPC A;  5IYC J;  4UVA A;  3SZT A;  2F48 A;  4IRG A;  3ZMT A;  4QWQ A;  3AAF A;  4UB8 C;  3BDD A;  4HRI A;  1T95 A;  3MKL A;  3HOY J;  3GZN B;  3J7A O;  1X2M A;  4RGS A;  1YOV B;  3BR0 A;  3BPV A;  1W7P B;  5AIQ A;  1Y1V J;  3TMO A;  2R7F A;  1P4W A;  4N9I A;  2AS5 F;  4CGZ A;  2DMQ A;  4DGW B;  5CQE A;  2OTJ I;  4NBQ A;  1OIS A;  3JRD A;  2MBF A;  3E5X A;  2KIU A;  3FKI J;  3GTG J;  3P5J A;  3LAJ A;  3O8G A;  5J8C A;  2L7M P;  1Z0X A;  2A5W A;  3K69 A;  2STT A;  3EPZ A;  3Q0V A;  2K4J A;  3QAH A;  3D1N I;  2RN7 A;  1Y1W J;  1S7E A;  5AIP A;  2QM3 A;  1JTY A;  1U9O A;  3HRU A;  4BH9 A;  3RQI A;  3ZQG A;  3AG4 H;  4A6D A;  4XRS G;  4CCJ A;  4HQM A;  3HKZ N;  2E5N A;  4E6K G;  3PFI A;  1VF9 A;  2A5Y B;  2A07 F;  2DPD A;  1IN8 A;  3IUO A;  1LDK B;  1VQO I;  1KU9 A;  3TGN A;  3R4K A;  2VC0 A;  3LFK A;  3MKW B;  1U8R A;  3O6B B;  4NC7 A;  2JRM A;  3ZCO A;  3WTV C;  3HSF A;  1YO5 C;  3OS1 A;  2DMU A;  2R7Z J;  3T8T A;  1IZ1 A;  4M3B A;  2P8T A;  1KYZ A;  3JRG A;  3IHU A;  3CCE I;  2Y9Y A;  3C3W A;  1W5S A;  1K6O A;  4ZC3 A;  2IGM A;  3OWT A;  4PDK A;  1VQN I;  1XN7 A;  1UB9 A;  5TIS C;  2LRD A;  1VQ8 I;  4PJM A;  2MW8 A;  1FIA A;  1HKQ A;  5CVV A;  4M6Y A;  2JK3 A;  3VFZ A;  5FRO A;  1X3U A;  3AL0 B;  2WV0 A;  2COB A;  1WQ2 A;  2NOG A;  2D5V A;  1ETY A;  2L7Z A;  1EH7 A;  1STZ A;  2W1O A;  2HDW A;  1UHW A;  1G4D A;  4EGZ A;  1FP2 A;  1BR1 A;  3TDU C;  4B47 A;  4XMY A;  2CFO A;  5DV5 A;  3BQZ A;  3VYR B;  2DDA A;  3IAS 2;  4QSH A;  5D5V B;  4RB2 C;  3LA3 A;  1E0E A;  3PFY A;  2XF6 A;  3QYF A;  2RNG A;  1ODD A;  4M9Z A;  4G8X A;  4P9F A;  3I5U A;  1ZYR F;  1R4M B;  2NS8 A;  1K61 A;  3CQZ J;  5E3O A;  4D7N A;  2HVR A;  1X1A A;  3VDX A;  1OQY A;  4RAG A;  5JHF A;  3FWE A;  4I09 A;  4Q4Z F;  4MNU A;  3MMY B;  2XKO A;  1IDZ A;  1G3T A;  3FIW A;  2OJE D;  1HKS A;  4N4N B;  4ABZ A;  4HNV A;  3U9G A;  2PFB A;  4XIC A;  3BG6 A;  1R71 A;  2FMY A;  1MGT A;  5J47 A;  2R7U A;  4Y13 A;  2XC7 A;  1IF1 A;  3LSJ A;  3OYD A;  1MD0 A;  2XHK A;  1U9N A;  4ZYA A;  1SVL A;  2NAZ A;  3I53 A;  5K7Z A;  3BY6 A;  4CDG A;  1JHF A;  3F21 A;  4LFU A;  3DQV C;  2Q2E A;  4AU7 A;  5DD4 A;  2FXA A;  4AVP A;  4O3M A;  1QBJ A;  3LSK A;  1LJ9 A;  2E7W A;  1R00 A;  5F1J A;  2DA7 A;  3HSE A;  4BY7 J;  4X0G A;  2ZXW H;  1ON1 A;  2LC2 A;  3FXL A;  2M0C A;  5F0C A;  3UNG C;  4KA4 A;  3GTO J;  1IV8 A;  3PO2 J;  3HOU J;  3IRR A;  5LRR A;  1MBJ A;  4FCY A;  4JQF A;  1ZQ3 P;  1E2X A;  2KL4 A;  1BN5 A;  5ICF A;  3EUH C;  1G8X A;  4XN0 A;  4PJJ A;  4XNF A;  2IPQ X;  4JK1 X;  4HF2 A;  4A3B J;  1FWZ A;  1Z21 A;  1ZHF A;  2FEZ A;  2M4G A;  2W85 A;  3L7W A;  3JRB A;  2Q0O A;  4OMZ A;  4IRH A;  4M9S A;  3SFI A;  4DNC A;  2QWW A;  3B6C A;  4P1W A;  3MAJ A;  5HNH A;  2BE5 F;  3CF5 F;  2M8E A;  2XAJ A;  1VQ9 I;  4N0B A;  4IOC F;  3S1N J;  1N75 A;  4DJA A;  2M7A A;  4V19 K;  3F23 A;  3PUB A;  2ZME C;  4CHU A;  1A5J A;  2M34 A;  1GDT A;  2CSO A;  2CV0 A;  3RSN A;  1HA8 A;  5CKT A;  4U0Y A;  4EM0 B;  2ZJP F;  3Q0W A;  4HV6 A;  4L5J A;  2BY3 A;  4ZYH A;  3RCO A;  2DA1 A;  3IH2 A;  5ILU A;  2YU3 A;  1IXR C;  2BXZ A;  3LQQ A;  4ZYD A;  3GW2 A;  4GXO A;  1XB4 A;  3EUA A;  1ZG3 A;  4LK1 F;  1KU7 A;  2DI3 A;  1GV5 A;  1GVD A;  2LK2 A;  3LOC A;  4KN7 X;  4RLF A;  4IJA A;  5DEQ A;  1Z9C A;  1P4X A;  4PJL A;  4AIJ A;  2FBI A;  4A3I J;  4CCL A;  4XKC A;  2NVQ J;  3JRF A;  2OUM A;  2VPR A;  2E2J J;  2KMU A;  3P9C A;  2GM4 A;  3CLQ A;  2VKD A;  1BW6 A;  3E6D A;  5JVT A;  1R23 A;  3I55 I;  3GME A;  1ZR4 A;  1W36 C;  2GZW A;  3GTQ J;  4AID A;  5JVG F;  1KQ9 A;  1VQM I;  2Z1D A;  4IF4 A;  2E1M B;  4M3E A;  2JA8 J;  4M3G A;  4BHC A;  1B1B A;  2PX9 A;  2L01 A;  3V8L A;  1TWG J;  3NAU A;  1WJA A;  2O03 A;  3I4M J;  4P55 A;  2M0M A;  1OCP A;  2BOL A;  5A2Q Z;  1FLI A;  4Z6Y A;  4F7Z A;  5JLX A;  3D5S C;  2DMT A;  1PP7 U;  3TED A;  1IAW A;  3KP7 A;  4EJO A;  2X6O A;  1WH7 A;  3E5Q A;  2L9S A;  1YIO A;  5M5X J;  4Y7N J;  1RRJ A;  2XAS A;  3GF2 A;  3HSR A;  1EJ9 A;  2R5Z B;  4S0H B;  1GLN A;  4HW0 A;  2VPL A;  3BZK A;  3CO7 C;  2E1C A;  3T5X A;  1NH3 A;  5HDN A;  2HKO A;  2XV4 S;  1TW2 A;  4RGU A;  2H09 A;  2L9R A;  2XAF A;  3ERE D;  3HPH A;  3E6C C;  2MFZ A;  3HOS A;  5IOY A;  4BE2 A;  2K27 A;  4RM2 A;  1HKT A;  2IBD A;  2EQR A;  2HNH A;  3M1E A;  4BU2 A;  4KIF A;  1JT6 A;  5KAI C;  2FNP A;  3R0J A;  5KCM A;  2IRF G;  2DPU A;  4XN3 A;  3WGI A;  3KYC B;  2JA6 J;  3G6E I;  5K1Y A;  3KP2 A;  4EEF G;  2OU2 A;  2M30 A;  3HZJ A;  2KT0 A;  3H3U A;  4EJU A;  3MQ0 A;  2JWT A;  2CWE A;  3GLL A;  4JX5 A;  2DXI A;  1XD7 A;  5D5X B;  4KIS A;  5KHD A;  3GFL A;  1KYW A;  3BQY A;  2A05 A;  2R5Y A;  3PJR A;  3G1L A;  3K2Z A;  3BRO A;  4HNU A;  1ONV A;  2O6G E;  2YX7 A;  2K85 A;  3ABT A;  1SFU A;  2PQ8 A;  1LVK A;  1IRG A;  5HNF A;  5ICC A;  1HSJ A;  4BE0 A;  3OYG A;  2QZ8 A;  3BCA A;  2PJR A;  3DPL C;  5FKN A;  3DBL B;  2M3A A;  5L3C A;  4UNO A;  2BVM A;  1Y0N A;  2P4W A;  2X9D A;  2FNA A;  4XLN F;  1X1C A;  1OR7 C;  1JJ8 C;  4FAS D;  3BCB A;  3PSI A;  3CCS I;  2O61 A;  2P81 A;  1R4N B;  3T1B A;  2UUZ A;  3S3M A;  5CJ9 A;  1RUN A;  4Y33 A;  3OIP A;  2R4G A;  3AG1 H;  2VQC A;  4LLL A;  1DP7 P;  4MO7 A;  4KN4 X;  2RDP A;  5B5E C;  1I1G A;  4LG3 A;  4L5E A;  4XOT A;  4UUV A;  1TQI A;  1QO0 D;  2NRA C;  2O3F A;  1C0W A;  3PNT A;  3WTU C;  3V7S A;  4UXN A;  4RAY A;  2A3S A;  2YS9 A;  2EIM H;  2P7V B;  3FIS A;  3M9A A;  4OIN F;  3RPQ A;  1YTY A;  2HR3 A;  2O7O A;  3GO5 A;  2W82 A;  2OPT A;  3HBL A;  3M7G A;  3CME I;  1TC3 C;  1B9M A;  1RC9 A;  3SYT A;  3CP8 A;  3QQA A;  3DLA A;  2ECB A;  9ANT A;  1JXS A;  1YS7 A;  5D8L B;  3NRV A;  4J01 A;  4ZTF A;  2UWM A;  4V2G A;  2EH3 A;  2HZT A;  2DMN A;  5IYD J;  2V6C A;  1YFH A;  1SEU A;  4MTE A;  2YSR A;  3H1C A;  2TCT A;  4ZDP A;  3HPG A;  3SDG A;  3J81 K;  3SHF A;  3J81 Z;  2QBY B;  4MGR A;  1LKX A;  4D7M A;  1XGS A;  4P9U A;  1LE8 B;  5GTI C;  3WTT C;  3CUQ C;  3LL7 A;  4AWX B;  4D1Q A;  2L54 A;  3DU6 A;  3KZZ A;  4RGX A;  2QVO A;  3JRH A;  2WC2 A;  4A0Y A;  2WA0 A;  4LIT A;  4ENK A;  2OAZ A;  3ONQ A;  5HOD A;  4BXU A;  2Z5U A;  3I59 B;  5K7F A;  2L4A A;  2DOD A;  2G7H A;  2PN6 A;  3LNQ A;  3TO6 A;  4XBF A;  1ZAO A;  4YFK F;  2Q1Z B;  2H94 A;  2XGE A;  1ZGA A;  3E5U A;  3W6K B;  4WWC A;  2CUE A;  5ILS A;  2QF7 A;  1VQ7 I;  4B09 A;  1ZKG A;  1XCB A;  2LG4 A;  4U0V A;  3PIO F;  4HNT A;  1FOX A;  1MNE A;  5CQG A;  3J7Y J;  2ZXI A;  1DQU A;  2F5C A;  2ZFW A;  2ESH A;  2X6X A;  2LFB A;  1CF7 B;  1S3J A;  1LB2 A;  1IXC A;  2FE3 A;  1RET A;  3HHG A;  3VEP A;  1O4X A;  3ZR8 X;  4HST A;  3WTZ A;  2ZSH B;  3K10 A;  2L4M A;  2E7X A;  3M8J A;  5EF6 A;  2UXN A;  4BHB A;  2CJJ A;  3I3L A;  3OIQ A;  3OYC A;  4HQE A;  1MMG A;  2W84 A;  1TZL A;  1A04 A;  4QPO A;  2FX0 A;  4KMF A;  1RIO H;  3FXR A;  2WAQ N;  3S3O A;  1V54 H;  1SFO J;  1H89 C;  2E1O A;  3R60 A;  3LSH A;  3SEQ A;  1A35 A;  5FD5 A;  2DYS H;  2J5P A;  1EKE A;  2H1K A;  3KP3 A;  2NVU B;  1TT0 A;  3EUH A;  3HRT A;  3ZMU A;  3A4C A;  3DCF A;  1KU2 A;  4F91 B;  3WGG A;  4LIU A;  3PQK A;  4RM3 A;  1LPQ A;  3V42 A;  1JUP A;  3GZ5 A;  4BEH A;  2X1E A;  5FGM A;  5LRS A;  5LLQ A;  3G4S I;  1JKO C;  1SD7 A;  2L7F P;  1KA8 A;  2JQ7 A;  1DPR A;  1U0J A;  2L9V A;  2I8D A;  2ZSI B;  3SFZ A;  4DZJ A;  4NHJ A;  4Q5S F;  3FBN B;  2W4S A;  5D5U B;  4KIG A;  2LY2 A;  2ZME A;  3EET A;  5HOO A;  1IV6 A;  3DXJ F;  4QPQ A;  3I56 I;  4PFP A;  3GYH X;  1X58 A;  2KRC A;  3SEZ A;  2BW3 B;  3M4O J;  1AU7 A;  1FEX A;  2IEK A;  2HDC A;  5CLS A;  5IT3 A;  2K02 A;  3K4L A;  2R7O A;  5H6Q A;  2VOD A;  4HAM A;  4L5I A;  5D6E A;  3K9T A;  5B3S H;  3HEF A;  2GOX B;  4J00 A;  4FT8 A;  4HSR A;  3AL0 C;  2EJR A;  3HGG A;  2M5W A;  4I02 A;  3DPT A;  2QSF X;  5FFZ A;  1MDM B;  1HQC A;  1NK2 P;  1GV2 A;  3KET A;  2JUG A;  3G2B A;  3R0A A;  4PZJ A;  4LB5 A;  4PK4 A;  2FOW A;  4IO9 F;  2Z99 A;  1W36 D;  1BIB A;  2KDO A;  2O9L A;  3ZMD A;  4CCM A;  1ETQ A;  1F36 A;  3PUF A;  4B48 A;  4E7I A;  2FBK A;  2Y0S N;  3OMY A;  2VE8 A;  4NQW A;  4IKF A;  4O5V A;  4JOM A;  4G7H F;  3ZQ7 A;  1B6A A;  2LBF B;  1YIT I;  4GFB A;  1HC8 A;  5FRM A;  1O3S A;  3M07 A;  3FKJ A;  3HTU A;  5L3B A;  1ZG1 A;  2XRN A;  4TV7 A;  2ME6 A;  3VOE A;  3GVA A;  5K5R A;  1T08 B;  3J7A Y;  4LJZ F;  1D1C A;  3Q5F A;  3F8F A;  2ZNZ A;  4EAT A;  4P5O A;  1U6G A;  2ZKZ A;  3NQO A;  1TWC J;  2K9S A;  1BI2 A;  3DEW A;  2VBZ A;  3C1D A;  3FK7 A;  3RYR A;  4A3M J;  1TNT A;  3DF8 A;  3PNV A;  2OZ6 A;  3OOP A;  2DCE A;  2N8G A;  3DEU A;  2ISZ A;  2H1L A;  1ZN2 A;  3TDZ C;  1WJD A;  3JW4 A;  3L2W A;  5EGO B;  1J59 A;  2GIV A;  2LR8 A;  5KK1 A;  3OL4 A;  3HC7 A;  2UZK A;  2DLL A;  5LBQ A;  2F4M B;  3DKX A;  1YI2 I;  1X3Z B;  4L9T A;  4M3F A;  4I98 B;  1W0U A;  1SMT A;  3AFH A;  4CCN A;  4AUX A;  4A3L J;  2QKM B;  4UUT A;  1MH3 A;  2I5U A;  3NWT A;  5HDK A;  3HRM A;  3GTM J;  4W1U A;  5BPD A;  2IVM A;  2OCC H;  2ELJ A;  1R5G A;  4X1E A;  2ZJR F;  2E71 A;  3DTK A;  1H9T A;  1QU3 A;  1O57 A;  2F5D A;  2WBM A;  3Q9S A;  4MIM A;  3OYN A;  1HW1 A;  5FKK A;  1I27 A;  1BJZ A;  1SFX A;  3S3N A;  1JUM A;  2DW4 A;  2LNB A;  3CCJ I;  3GUD A;  3T8R A;  4PSX A;  1K6Y A;  1IW7 F;  3IV5 A;  1P92 A;  3GBG A;  1YJW I;  4OIQ F;  1OR7 A;  1PUF B;  2CV2 A;  3H36 A;  2GOM A;  2DA6 A;  3HHH A;  2V4J C;  3D5R C;  2QEX I;  2X1C A;  2HXO A;  4KIC A;  3ELK A;  4QLC U;  1YE9 A;  2YPR A;  3FF5 A;  4UVC A;  5ERI A;  4OIR F;  5FKM A;  2ZCW A;  1JKR C;  3IKV A;  3CJN A;  4NC8 A;  2A69 F;  5GAD J;  1YX5 A;  2RAE A;  2VC1 A;  3RTR A;  2NVT J;  2MD0 A;  2R7W A;  1MSF C;  1VQ5 I;  1FYK A;  3EDP A;  2XAQ A;  1DP3 A;  1M1E B;  1T6S A;  2DFE A;  1RR8 C;  4FTH A;  2BGC A;  4M9X A;  1N25 A;  4CCO A;  3SZG A;  3KP6 A;  4XLH A;  2E1M C;  5H2F C;  4RAZ A;  1T39 A;  3G1M A;  3O2P E;  2JSC A;  4ZH4 F;  2R92 J;  4ON0 A;  3RKX A;  3E7L A;  1Z91 A;  2XDV A;  2D45 A;  2Y2Z A;  2X4H A;  3WG7 H;  2LKX A;  5HS8 A;  1XS9 A;  4H4K C;  2EZK A;  3LAP A;  3HB9 A;  3S8P A;  5FJ8 J;  3I4P A;  2MC3 A;  2X1D A;  5ICG A;  5CVR A;  3HUG A;  1PVE A;  4KUM A;  4BQN A;  2HS5 A;  1JJ6 C;  2HZD A;  1J5Y A;  4H0E A;  4V2F A;  3P7N A;  2F6C A;  4G6Q A;  5D8K B;  3MCZ A;  4CIC A;  5IP9 J;  3OYB A;  3N05 A;  4UUS A;  1FP1 D;  4CZC A;  2Z33 A;  1AKH B;  2ZJQ F;  2J5O A;  1R5H A;  3DBR B;  4XKB A;  2KZG A;  3EYY A;  1R7J A;  2LF8 A;  1ORK A;  1TLH B;  3LSP A;  1MZB A;  1VQP I;  2QUF A;  2CS3 A;  5B1A H;  3ZXS A;  4IOA F;  2MLG A;  2K86 A;  3CUQ A;  1GT0 C;  2VI6 A;  4LLG F;  3HJE A;  2LVS A;  2XPW A;  4CYD A;  1OMI A;  4II3 A;  5EG0 A;  1PDN C;  4A3D J;  1LFB A;  2HI3 A;  3H0D A;  1D0X A;  2K9L A;  2DFF A;  2QSH X;  1EH6 A;  2F5E A;  4BDY A;  3BG5 A;  5HS7 A;  1VZ0 A;  2CU7 A;  4XKV A;  1OLT A;  2IA2 A;  3F8M A;  3WTW C;  2KHM A;  2F2E A;  3CMA I;  4HLX A;  1BR4 A;  3P9K A;  2VQL A;  1G59 A;  2R7T A;  3S2D J;  2IGN A;  3FMR A;  4X6A J;  4E70 A;  3RYP A;  2L5Q A;  2DOF A;  2JPC A;  3GX4 X;  1WI9 A;  1NG7 A;  4W97 A;  2V26 A;  3TW6 A;  1AWC A;  4XM3 A;  3RKW A;  3ZOB A;  5M5Y J;  2V1N A;  5LEK A;  5H20 A;  2EA4 A;  2VON A;  2STW A;  5DCM B;  1P6R A;  2W00 A;  5C44 J;  3FHN A;  3VYS B;  2L9N A;  3KZI C;  1J2X A;  1IXS B;  3IRQ A;  4IHV A;  2IA0 A;  5KAF C;  1R5I D;  1XPX A;  3HOW J;  3MZ8 A;  2V7F A;  1W7P A;  3V8K A;  3ASO H;  2OCE A;  3FMS A;  2KIM A;  2QA4 I;  3OIO A;  2EIN H;  1W7P D;  1XGM A;  5EEG A;  3IH3 A;  4KT5 C;  3DWL E;  4AC0 A;  1YW8 A;  4F92 B;  1AA7 A;  3G71 I;  4EM2 A;  3JCU C;  3DEE A;  4MQ9 F;  2DJI A;  2CO5 A;  2CQQ A;  1O7F A;  5EEA A;  1D8J A;  4K2E A;  1ZR2 A;  2CGP A;  4IHY A;  2FBH A;  2ZBK A;  3LST A;  2MSY A;  1QNT A;  2HPI A;  5E1Z B;  2EA2 A;  3JSP A;  1MNM C;  1B72 B;  1Y56 A;  4PJ0 C;  3GEZ A;  3HTS B;  3IKT A;  2EB7 A;  2HVQ A;  3MD2 A;  2XPV A;  3ISP A;  3QOP A;  3HM5 A;  2VJ5 A;  3RIR A;  3IC7 A;  5F64 A;  3BTL A;  1IG7 A;  2LRE A;  3E6M A;  1KQ8 A;  4JP0 A;  4R8H A;  2KPM A;  1O7L A;  3LQR A;  3F8C A;  4R79 A;  3QRF F;  2A61 A;  4GGG A;  4CH7 A;  2FOK A;  1SAN A;  3S93 A;  2HQ5 A;  2GIZ A;  1XMA A;  2BY2 A;  2JTV A;  2DK5 A;  5BS6 A;  1OKR A;  1G6N A;  2DAO A;  2BVL A;  1SFE A;  4PUS A;  1FX7 A;  4ESF A;  1VQL I;  2JJ7 A;  3A01 B;  4N4O B;  1A36 A;  3VWB A;  2DA2 A;  2VUM J;  3OS0 A;  4PGH A;  1Y6I A;  4C30 A;  1D5Y A;  3BJ6 A;  3GTP J;  2PEX A;  1MBE A;  3W6J B;  1FIP A;  1YIJ I;  1U5T A;  4U88 A;  3ROU A;  2C6Y A;  2DU9 A;  2RNJ A;  4C3J J;  2JZY A;  2WY8 Q;  1WHU A;  4FX0 A;  1ETV A;  3LWF A;  4PJN A;  3TOA A;  4LMY A;  4FQG A;  3K1N A;  3CCR I;  2JRT A;  3PSF A;  1ZH5 A;  3FM3 A;  5E1W A;  5LGT A;  4BE1 A;  2Y48 A;  2DA4 A;  2QQA A;  5LHI A;  2HYF A;  1K78 B;  1FTT A;  2P6S A;  5FO5 A;  2XGC A;  2KLO A;  3L2R A;  2RRE A;  3ZMS A;  1FOK A;  3CLO A;  1K79 A;  1P9Q C;  5DM7 F;  3OL3 A;  1H8A C;  4AYB A;  3I9V 2;  2VL8 A;  5A2Q K;  4MTD A;  2KZV A;  1ULY A;  2COM A;  1LFP A;  1RKW A;  2EFQ A;  2V9K A;  2IGO A;  5BMZ A;  1XDS A;  5DM6 F;  3BWG A;  1WGX A;  2ZXJ A;  1LDJ A;  2Q8K A;  2O8K A;  1S8N A;  2DMP A;  3SDB A;  4IHT A;  4AIK A;  4L0Z B;  3CDH A;  4YFX F;  5B1B H;  2M7B A;  4C2M J;  5CVJ A;  3OYF A;  5EEH A;  4LG0 B;  3QPH A;  1ZG5 A;  3CZ6 A;  1MIJ A;  2RV8 A;  3S2W A;  2IS1 A;  1PJR A;  1MND A;  4U87 A;  5E3N A;  2FQ3 A;  1K7A A;  2Y9Z A;  3DLL F;  1XSD A;  3Q0U A;  3O8H A;  5LHG A;  1D1A A;  5J4Y A;  1OYW A;  5FLV A;  1MBG A;  3WTS C;  3GZ6 A;  2V9V A;  5EDN A;  6PAX A;  1T56 A;  4E7S A;  3ZGK A;  2FA5 A;  4HZF A;  4I0A A;  5GAG J;  4D9J A;  3W3C A;  1NG6 A;  4F55 A;  4I76 A;  5IYB J;  4D5F A;  4NUB A;  1QHG A;  1MKM A;  4RA2 A;  3PIP F;  3OYE A;  2PMZ N;  1QQI A;  2XAU A;  4CYC B;  3K4C A;  3QPL A;  3TOB A;  3FXK A;  1TWA J;  4IL6 C;  1FYM A;  1X2N A;  2XRO A;  2DT5 A;  2NS7 A;  5ICE A;  3FHZ A;  5BOX A;  2R93 J;  2V6E A;  1LEB A;  2CH0 A;  3BTC A;  5E18 F;  3HYI A;  3CC7 I;  3RI4 A;  2E36 A;  5DYM A;  4IHS A;  4OAZ A;  1EF4 A;  4HV5 A;  2AXT C;  3U1K A;  4IRI A;  5FKL A;  1ON2 A;  4RB3 C;  2M87 A;  4RGR A;  4XRF A;  1WJF A;  1LNW A;  3F0C A;  1N78 A;  4MHG A;  3RJP A;  1H9G A;  2K5C A;  2VOO A;  2CUZ A;  2K9Q A;  1I3Q J;  3ZQQ A;  1R1U A;  3H35 A;  3FDY A;  2VJJ A;  2EIL H;  5C3E J;  3GTJ J;  4AVZ A;  2HWV A;  4M6V A;  4EJT A;  4DQ2 A;  4UHT A;  2XF5 A;  3GWZ A;  1O3T A;  2ELH A;  2PI0 A;  4ZZD A;  4BY1 J;  1Z7L A;  3G73 A;  4LOC A;  4Z2Y A;  5M3M J;  3F72 A;  4RB1 A;  4MFE A;  4B8X A;  2KJB A;  4DYC A;  4F93 B;  1ETW A;  4IQJ A;  4IX7 A;  1SFK A;  3WGH A;  2D2W A;  2DA3 A;  3TP0 A;  2KJC A;  3TP3 A;  1ZLK A;  3GTK J;  4YEJ A;  5DS9 A;  1H88 C;  3JAM K;  2E35 A;  4G6D A;  4HF0 A;  3JAM Z;  1TBX A;  3RZD J;  4C2T A;  4F3Q A;  4KMU X;  5K5O A;  3ZQH A;  4DOZ A;  1HBX G;  4XK4 A;  1F5T A;  3N97 A;  3E0J B;  2CV1 A;  1TTY A;  1MMS A;  1O3Q A;  1A31 A;  2OD5 A;  3L00 A;  2BEO A;  4DYQ A;  1KQ0 A;  2DN0 A;  4RDU A;  4AM3 A;  2R5Z A;  4MEY F;  1WFX A;  1SD4 A;  4L9N A;  1YRN B;  1LUJ B;  4HA8 A;  2XAG A;  3HOX J;  4A6E A;  1RES A;  1ZGW A;  2AXL A;  2XF7 A;  4JX4 A;  2RC4 A;  4LIV A;  3QU6 A;  1TNS A;  4M3D A;  3TBI A;  1RKT A;  5E17 F;  4I99 C;  1HF0 A;  2QKL B;  3F6V A;  4DBQ A;  1WRJ A;  4IZZ A;  5HLH A;  1E3O C;  1OYI A;  1S7O A;  3B6A A;  3CF2 A;  3R61 A;  1JKQ C;  3ULQ B;  5CVI A;  1UEL B;  1XSX A;  2HYJ A;  1LEA A;  1S29 A;  5BPI A;  4R1H A;  5D6F A;  1JI8 A;  1ZK8 A;  1SD6 A;  3ABM H;  1GXQ A;  3MVP A;  5F08 A;  1R9T J;  3S14 J;  1T38 A;  5KNL A;  2LOO A;  1RUO A;  3K1M A;  1XGN A;  2NXN B;  2WAE A;  2M1B A;  1YJN I;  2H27 A;  3ZPL A;  4ZTJ A;  2VXZ A;  2RGV A;  2X0L A;  5GAH J;  2HKX A;  1B8I B;  2FJ1 A;  3ERM A;  1IJW C;  1DUX C;  2AQF A;  2EWN A;  4XLA A;  3CCL I;  1N77 A;  3A03 A;  4YRV A;  4G7O F;  3MZH A;  3CCQ I;  1ETO A;  3IL2 A;  2BY0 A;  2W24 A;  4I6Z A;  3OSF A;  2GLO A;  1ERD A;  4UV9 A;  1L0O C;  1G2H A;  4CO8 A;  2VJI A;  3CC4 I;  1DGW Y;  2EFN A;  3MFK A;  3SQN A;  3CC2 I;  4GRI A;  3MEX A;  4AD9 A;  1VFC A;  3E1S A;  1HDP A;  1EV7 A;  4XSX F;  4NQW B;  1I1S A;  4BQO A;  1YJ9 I;  2HQR A;  1J7K A;  2WB1 A;  3E6B A;  2GA2 A;  2YUS A;  3DFG A;  1BC7 C;  3H3V K;  2DT7 B;  4U0W A;  4A0Z A;  5F6F A;  4BQQ A;  1W4M A;  4I0B A;  3FXM A;  3OYH A;  1J75 A;  2PLY A;  3F9K A;  1V5E A;  4Y15 A;  5JFR A;  1OJL A;  1UJ8 A;  4NDL A;  1G3Y A;  1CGP A;  1K83 J;  2P5V A;  3WOD F;  2FSW A;  2ZFU A;  4L18 B;  2IS4 A;  4G7Z F;  4OIO F;  2ACJ A;  3IP4 B;  4Y3O A;  1O3R A;  1RZ4 A;  2LDU A;  1T2K A;  3ABK H;  4L9J A;  4A3E J;  1SAX A;  1YW9 A;  4BGD A;  2JA7 J;  2Z3Y A;  3S17 J;  3M8F A;  2XSJ C;  4A69 C;  5ILV A;  3RDI A;  3TQN A;  2LP0 A;  4UVB A;  4UV8 A;  2WV1 A;  3DTE A;  2ICW G;  3K2A A;  2GXB A;  1FY7 A;  3TW7 A;  3FM5 A;  3U1D A;  2XRL A;  1TP4 A;  1Z05 A;  1GVJ A;  5KVR A;  3WTY C;  2BZT A;  3QYB A;  3G3Z A;  4FIS A;  3QWL A;  4MQV A;  5E79 C;  4XL9 A;  3T0Y A;  3H92 A;  1IRZ A;  5J6X A;  1FPQ A;  3CP2 A;  2ZB9 A;  1IGN A;  2B7E A;  3CDI A;  4EJV A;  1Y0U A;  2PMH A;  2LY9 A;  2BY1 A;  3H5R A;  1OPC A;  5D4S A;  2HYG D;  3D5L A;  4XON A;  2LD5 A;  2CQK A;  1ZEL A;  1RR7 A;  2F5F A;  1LE8 A;  4I2O A;  2OQG A;  2HFH A;  1WKM A;  3BC8 A;  1R1V A;  1YLF A;  4HF1 A;  1JT0 A;  1FJL A;  3K6G A;  2PJP A;  3J80 Z;  1X1B A;  3CUO A;  1MMD A;  1JGS A;  1V5G A;  2NNY A;  2K3P A;  3FXO A;  3OR1 C;  3S2H J;  3CJT B;  5DUK A;  3P9I A;  4HX7 A;  1UAA A;  4A3G J;  1KU3 A;  2IW5 A;  3TO9 A;  4WX9 A;  1RNL A;  2VB6 A;  4G9Y A;  4DW6 A;  1ZRD A;  3I58 A;  4GYG A;  5B66 C;  1QPI A;  4XRM A;  3ZQL A;  2JMW A;  2LTP A;  5E3M A;  4ZYE A;  1NHA A;  2V1X A;  4PFO A;  4HG2 A;  3CCY A;  3KPH A;  1OCT C;  1CQT A;  3ZN0 A;  2DBB A;  4ETS A;  3JRE A;  5K5Q A;  3LSI A;  3Q9V A;  2JN6 A;  4M73 A;  5TJJ A;  1CF7 A;  3S15 J;  5IT9 K;  2EFO A;  5IT9 Z;  2F4I A;  1FZP B;  4E7Z A;  4EVI A;  3WU2 C;  1P4A A;  1W5C C;  2XAH A;  4E7L A;  2EK5 A;  2FQ4 A;  1P2F A;  3K4N A;  5FD6 A;  2QEN A;  4Y52 J;  2Y0M A;  4C2U A;  4CA0 A;  1WJC A;  2DTR A;  2ESN A;  1B59 A;  2XPU A;  2F4O B;  2NYX A;  1XCV A;  3BG3 A;  2EBI A;  4G12 A;  4XLC A;  1QGP A;  3RPU D;  2XGX A;  3KCC A;  3DKY A;  3LA2 A;  4BJT A;  2R7D A;  4C3I J;  3HKZ A;  2DOE A;  2OC6 A;  5F0F A;  1POG A;  3PNY A;  2E60 A;  1ZRE A;  4U7D A;  1V55 H;  2KQR A;  1I3A A;  3FBI B;  4NB5 A;  3BZC A;  2I10 A;  2OZU A;  1WJB A;  1PYV A;  1FC3 A;  2ADU A;  2OBP A;  1B9N A;  5AON A;  1P7J A;  4JBA A;  5DD8 A;  4BAC A;  2D1H A;  3HRS A;  3ZMV A;  1VTN C;  3KYL A;  5TGT A;  4J19 A;  1E17 A;  1FBS A;  1SAU A;  3NAR A;  2QSG X;  5LFA A;  2BW3 A;  4HBL A;  3W6V A;  4O6J A;  3WG9 A;  3AG2 H;  2DA5 A;  2JUC A;  1V5F A;  3LFU A;  1FOW A;  5HLG A;  3E97 A;  3K4M A;  3KEO A;  1HDD C;  2HQN A;  3H5N A;  4XKW A;  2M9H A;  1IDY A;  3F6O A;  5FFX A;  5IP6 A;  2EV5 A;  3CDL A;  3S1M J;  4HX4 A;  1J0R A;  3BP8 A;  1FMV A;  3WHB A;  2MH2 A;  3JRA A;  3J7Z I;  1I6X A;  1ETX A;  2O5R A;  1BM9 A;  3F8N A;  3QOD A;  5HLI A;  5BNG A;  2HXI A;  3W2W A;  1UG0 A;  3HG9 A;  3S16 J;  1YQA A;  4IXA A;  3SJM A;  3VB2 A;  3IWF A;  1SC7 A;  1MDM A;  5GP9 A;  3CD6 I;  3ECO A;  3OR2 C;  4LLN A;  3CES A;  2EZH A;  4ESB A;  2EV0 A;  3LSR A;  2Y30 A;  2IGK A;  4BDZ A;  1XC5 A;  1GHC A;  5EYR A;  4C3H J;  2Q2E B;  2BXY A;  3ML6 A;  2A6E F;  1R58 A;  2HTJ A;  1FOY A;  3O3K A;  1SD5 A;  1BOA A;  4C9Y A;  4OU0 A;  1T98 A;  4M72 A;  2E1N A;  4YFN F;  1I50 J;  2JSP A;  2LBF A;  2KRF A;  2QQB A;  3ECH A;  4KJZ A;  2HEO A;  3C2G A;  4BS9 A;  1MMN A;  3REO A;  1Z6R A;  2HGC A;  2HOS A;  2W48 A;  2W25 A;  3QOE A;  4QTR A;  1UMQ A;  4YEL A;  2R7Q A;  2LH9 A;  1WJ5 A;  1Z3X A;  3DP7 A;  2M8G X;  1IO2 A;  1BI1 A;  1MJ9 A;  4RB0 A;  4D5C A;  5M5W J;  3CCU I;  5FLM J;  4LGW A;  2LY1 A;  1QRY A;  3GTL J;  1G3S A;  3JR9 A;  1TWF J;  2MC4 A;  2MAB A;  4OIP F;  1ZGJ A;  5C4J J;  4M74 A;  4BYY A;  2VBY A;  4ZYG A;  2CW7 A;  3V7R A;  4BXF A;  3CTA A;  2H8W A;  1Q1H A;  2MG4 A;  3A02 A;  2HOA A;  5DCF A;  3CMY A;  3WU1 B;  1UST A;  2QYO A;  2LKP A;  5EGO A;  4L9V A;  3U21 A;  3B02 A;  2PG4 A;  3L09 A;  2MH9 A;  4PGG A;  1USS A;  4FHT A;  1U5T B;  3QU3 A;  1UHM A;  4E7H A;  1Y8Q B;  2BHY A;  2V1D A;  4YG2 F;  3VSK A;  3D0S A;  3A0B C;  1LVA A;  2CRG A;  2WTE A;  4RLQ A;  4KIT B;  4CXF A;  1UG2 A;  3PQJ A;  1TQP A;  3U2R A;  2YU9 J;  4GDF A;  3F8B A;  1MBF A;  5E8I A;  3V4G A;  2A6H F;  4G94 A;  4WK8 F;  2X6W A;  2X48 A;  3E3V A;  3VOD A;  5F1R A;  2OQR A;  2NVX J;  4II2 A;  2K4B A;  2DDB A;  5M3F J;  1MJA A;  1IN6 A;  4EQQ A;  2EV6 A;  5GPA A;  3LSG A;  1XG1 A;  1PUF A;  1FYL A;  2EIJ H;  2IA1 A;  1F43 A;  2EZL A;  5F04 A;  4BAY A;  4EV0 A;  1R1T A;  2CQ7 A;  2KRH A;  1JHH A;  2E34 A;  4XLP F;  1K4T A;  3KP5 A;  3SZP A;  1MMA A;  3HXL A;  2F5V A;  4B1R A;  5DTD A;  2FU4 A;  3BPX A;  3C7J A;  4OWR B;  4RMN A;  4YIF A;  2CG4 A;  5CPR B;  2VOP A;  2VQH A;  1D0Y A;  5L3E A;  4YIR X;  2DYR H;  1IN7 A;  1ETK A;  3PL8 A;  3QYE A;  5FLX K;  2IJL A;  2K7L A;  3DBH B;  3UKG A;  5FLX Z;  4FX4 A;  1ITY A;  2Z9O A;  1Z3Y A;  2BV6 A;  1QVT A;  4GCV A;  1Z1D A;  2LF7 A;  2MLK A;  2DOA A;  3C18 A;  2ZC2 A;  3N4M A;  3VSL A;  1HXD A;  4IPA A;  3JTH A;  5LGN A;  2P7C B;  2L02 A;  3MWM A;  1U3E M;  2CUJ A;  3K7A J;  4EMS A;  4LD5 A;  2B0L A;  3OV8 A;  3BZ6 A;  1FSH A;  4E4H A;  2OV7 A;  1GUU A;  3NEU A;  4M6X A;  2VN2 A;  5JHU A;  2BYV E;  5TRD A;  4A2U A;  1V4R A;  4D0P A;  1R49 A;  1BC8 C;  1AKH A;  4KDP A;  3S1R J;  2R3S A;  2R7V A;  3BJO A;  2XGD A;  3K0L A;  4WCG A;  3KEQ A;  3UR3 C;  1ENH A;  3V7C A;  2P6T A;  3KFW X;  2AQE A;  3IAM 2;  2R5Y B;  3LMM A;  1WCM J;  3DKW A;  3K4J A;  3DV8 A;  2OTL I;  4IVN A;  3H9J A;  2JVH A;  2JPB A;  2CUF A;  1S5L C;  3BG7 A;  2VBW A;  4HOB A;  3L2U A;  2JA5 J;  2IP2 A;  1OCC H;  2XSD C;  2FUG 2;  3OYI A;  3CCV I;  3OOU A;  2HU9 A;  1Z7U A;  2H6B A;  2PJR B;  4OMY A;  5CYV A;  2L7K A;  3KIO A;  4FET A;  3KZY A;  3ZN1 A;  4WXH A;  5LHH A;  3K70 C;  2PMZ A;  3OYK A;  5CVU A;  4HDV A;  5LEJ A;  1A6I A;  5J1R A;  1XSV A;  5J40 A;  4BXX J;  2R7S A;  5J1U A;  2X51 A;  3GCM A;  1XGO A;  2YX4 A;  3KLO A;  2ELK A;  3BTJ A;  3BTI A;  1ZRF A;  2VIX A;  4XRS A;  5L3F A;  2UV1 A;  2VKV A;  2DT6 A;  1H0M A;  3V8J A;  5IY5 H;  1MBH A;  2VT2 A;  2UXX A;  3ASN H;  3ZRG A;  2EZI A;  1VQ6 I;  3ABU A;  3BR1 A;  2QCO A;  2XB0 X;  1VQ4 I;  2GXG A;  5DCM A;  2MD5 A;  1X19 A;  1I39 A;  1Z6T A;  3OS2 A;  1JKP C;  1D3Y A;  4DIQ A;  4A3F J;  1QPM A;  2XIG A;  1FTZ A;  1TL8 A;  4DYR A;  2GXA A;  4P96 A;  1T0F C;  2M45 A;  5BQT A;  3AKZ A;  2WAF A;  3TO7 A;  3FXQ A;  3FK6 A;  1SMY F;  1R22 A;  1JUS A; 
#chains in the Genus database with same CATH homology
 1R36 A;  1YS6 A;  1FBQ A;  3RKY A;  2DQL A;  4Y17 A;  2ZO4 A;  1YG2 A;  1XMK A;  3IWZ A;  2EFP A;  2GQQ A;  3B73 A;  4WXD A;  2DK8 A;  3KE2 A;  1IN4 A;  1ZLJ A;  2HTS A;  4A12 A;  2YR2 A;  1KGS A;  3WTX C;  2V79 A;  5L3D A;  5HVQ C;  3I71 A;  3FZV A;  2DFI A;  1JE8 A;  3JSO A;  1QZZ A;  3GFI A;  3KP4 A;  3SXY A;  4WF2 A;  4CZZ A;  3BOQ A;  1IRF A;  5JI6 A;  2DO7 A;  2O8X A;  3M8E A;  3F3X A;  4U7B A;  2XKP A;  5HDG A;  1QZY A;  2RQP A;  4ENM A;  2VBX A;  1S6L A;  3L9F A;  5FB2 A;  1BI3 A;  4WXC A;  3BJA A;  1L3L A;  1K78 A;  1FNN A;  4KYW A;  1FSE A;  1BIA A;  3CO6 C;  3L2C A;  1F9N A;  2FML A;  2QQ9 A;  1U78 A;  3WE3 A;  3FXU A;  2CW0 F;  1WSU A;  2TDX A;  4LG0 A;  1DDN A;  2LSO A;  3QP5 A;  3TKY A;  4MEX F;  3LA7 A;  3GLX A;  2ZME B;  4GYI A;  4EGY A;  1F4K A;  4XSZ F;  2A68 F;  2GA1 A;  4KNY A;  2MA3 A;  3KLN A;  2KIF A;  4Q47 A;  3GXO A;  3HOT A;  3F22 A;  4BHP A;  4EM1 A;  3QPT A;  1AOY A;  4AIH A;  1B4A A;  1UCR A;  3K1P A;  2EFW A;  3I54 A;  5HS9 A;  1D5V A;  1YW7 A;  2XUB A;  2FRH A;  2CFX A;  2FF4 A;  1W5T A;  3COA C;  1DPU A;  5J8F A;  5DUI A;  3JTG A;  1BJA A;  2G9W A;  4OOI A;  5L3G A;  4HLY A;  1ZAR A;  2KKO A;  2XVC A;  4RS8 A;  1XDU A;  2O0Y A;  4HYE A;  3H3Z A;  5DDG A;  5JR3 A;  1V3F A;  1G3W A;  2HOE A;  1ZRC A;  3ZP5 A;  4A5M A;  5E20 A;  2NNN A;  2ZNY A;  1FT9 A;  3GFJ A;  4LB6 B;  2JT1 A;  2H6C A;  1OYY A;  1EH8 A;  3EYI A;  1U2W A;  3WE2 A;  1PP8 F;  2RVC A;  2PMU A;  1HST A;  5E1X A;  2L3D A;  4EJW A;  4HDU A;  2OA4 A;  4L0Y B;  3GFM A;  4YII A;  1FBU A;  2VT3 A;  4BQA A;  3ZMZ A;  1HW2 A;  3MZY A;  2GAU A;  1F1Z A;  1BI0 A;  2ETH A;  3QP6 A;  2QBY A;  4I01 A;  4HX8 A;  4LK0 F;  1LQ1 A;  3WU0 A;  3R6S A;  4I7H A;  4KFC A;  3J80 K;  4Q48 A;  4ZZL A;  1U5T C;  4S04 A;  4GO1 A;  3I59 A;  3I64 A;  1BBY A;  5E8G A;  5H6R A;  1LDD A;  4A0X A;  2BBY A;  3FX3 A;  3I0T A;  2RKH A;  2NS0 A;  4BNC A;  1IUY A;  3EQL F;  5D4R A;  4ASN A;  2IT0 A;  1T0F A;  2Y75 A;  2QLZ A;  1WWX A;  1GXP A;  4ENN A;  1UFM A;  3FMQ A;  2WWY A;  1I5Z A;  2GWR A;  2ISY A;  1TQM A;  4A5N A;  2D1V A;  3RPU A;  3HIF A;  4KIB A;  5LGU A;  2PBI A;  5D5W B;  4ESJ A;  2P5K A;  4S05 A;  2P5L C;  1IN5 A;  4ENJ A;  2DQR A;  1MJB A;  1YYV A;  1RI7 A;  2G7U A;  4N9H A;  5ED4 A;  2VE9 A;  3CUQ B;  2V1U A;  4M71 A;  1HW5 A;  2CYY A;  1S7A A;  1TW3 A;  1REP C;  1PUE E;  1J9I A;  2W57 A;  4PCQ A;  2ZJ2 A;  1D8K A;  4UVA A;  3SZT A;  4IRG A;  3ZMT A;  4QWQ A;  3AAF A;  3BDD A;  3J7A O;  4RGS A;  3BPV A;  1W7P B;  5AIQ A;  2R7F A;  1P4W A;  4N9I A;  2AS5 F;  4CGZ A;  2MBF A;  3E5X A;  2KIU A;  3LAJ A;  5J8C A;  3K69 A;  2STT A;  2K4J A;  3QAH A;  2RN7 A;  5AIP A;  2QM3 A;  3HRU A;  4BH9 A;  4A6D A;  4HQM A;  3PFI A;  2A5Y B;  2DPD A;  2A07 F;  1IN8 A;  1LDK B;  1KU9 A;  3TGN A;  3R4K A;  2VC0 A;  3LFK A;  1U8R A;  3O6B B;  3WTV C;  3HSF A;  1YO5 C;  3T8T A;  1IZ1 A;  2P8T A;  1KYZ A;  3IHU A;  3C3W A;  1W5S A;  1K6O A;  4PDK A;  1XN7 A;  1UB9 A;  1HKQ A;  5CVV A;  4M6Y A;  3VFZ A;  1X3U A;  2WV0 A;  1WQ2 A;  1EH7 A;  1STZ A;  1UHW A;  1G4D A;  4EGZ A;  1FP2 A;  3TDU C;  5DV5 A;  5D5V B;  4RB2 C;  3LA3 A;  4M9Z A;  1ODD A;  4G8X A;  4P9F A;  3I5U A;  1ZYR F;  3FWE A;  4I09 A;  4Q4Z F;  4MNU A;  2XKO A;  1G3T A;  1HKS A;  3U9G A;  2PFB A;  2FMY A;  1MGT A;  4Y13 A;  1IF1 A;  1MD0 A;  2XHK A;  2NAZ A;  3I53 A;  3BY6 A;  4CDG A;  1JHF A;  3F21 A;  4LFU A;  3DQV C;  2Q2E A;  5DD4 A;  2FXA A;  4AVP A;  4O3M A;  1QBJ A;  1LJ9 A;  2E7W A;  1R00 A;  3HSE A;  1ON1 A;  4KA4 A;  3IRR A;  5LRR A;  4JQF A;  1E2X A;  1BN5 A;  5ICF A;  2IPQ X;  4JK1 X;  4HF2 A;  1FWZ A;  1ZHF A;  2FEZ A;  2W85 A;  3L7W A;  2Q0O A;  4OMZ A;  4IRH A;  4M9S A;  4DNC A;  2QWW A;  3MAJ A;  2BE5 F;  2M8E A;  2XAJ A;  4N0B A;  3F23 A;  4CHU A;  2CSO A;  4U0Y A;  4EM0 B;  4HV6 A;  4L5J A;  4ZYH A;  5ILU A;  2YU3 A;  1IXR C;  3LQQ A;  4ZYD A;  3GW2 A;  4GXO A;  1XB4 A;  1ZG3 A;  4LK1 F;  1KU7 A;  2DI3 A;  4KN7 X;  4IJA A;  5DEQ A;  1Z9C A;  1P4X A;  4AIJ A;  2FBI A;  3P9C A;  3E6D A;  5JVT A;  1R23 A;  2GZW A;  1KQ9 A;  4IF4 A;  4BHC A;  1B1B A;  2L01 A;  3V8L A;  2O03 A;  4P55 A;  5A2Q Z;  1FLI A;  4F7Z A;  1PP7 U;  1IAW A;  3KP7 A;  4EJO A;  3E5Q A;  1YIO A;  2XAS A;  3GF2 A;  3HSR A;  4HW0 A;  3CO7 C;  2E1C A;  3T5X A;  5HDN A;  2HKO A;  2XV4 S;  1TW2 A;  4RGU A;  2H09 A;  2XAF A;  3ERE D;  3E6C C;  3HOS A;  2K27 A;  1HKT A;  3M1E A;  4KIF A;  2FNP A;  3R0J A;  2IRF G;  2DPU A;  3WGI A;  5K1Y A;  3KP2 A;  2OU2 A;  2M30 A;  3H3U A;  4EJU A;  3MQ0 A;  2CWE A;  1XD7 A;  5D5X B;  3GFL A;  1KYW A;  3K2Z A;  3BRO A;  1ONV A;  2O6G E;  2YX7 A;  3ABT A;  1SFU A;  2PQ8 A;  1IRG A;  5ICC A;  1HSJ A;  2QZ8 A;  3DPL C;  5L3C A;  4UNO A;  2P4W A;  2FNA A;  4XLN F;  2O61 A;  3T1B A;  5CJ9 A;  1RUN A;  4LLL A;  1DP7 P;  4KN4 X;  2RDP A;  1I1G A;  4UUV A;  1TQI A;  1QO0 D;  2NRA C;  2O3F A;  1C0W A;  3WTU C;  3V7S A;  4UXN A;  4RAY A;  2A3S A;  2P7V B;  4OIN F;  3M9A A;  3RPQ A;  1YTY A;  2HR3 A;  3GO5 A;  3M7G A;  1B9M A;  1JXS A;  1YS7 A;  5D8L B;  3NRV A;  2UWM A;  2HZT A;  2V6C A;  1YFH A;  4MTE A;  2YSR A;  3J81 K;  3SHF A;  3J81 Z;  2QBY B;  4MGR A;  1XGS A;  4P9U A;  3WTT C;  3CUQ C;  4AWX B;  2L54 A;  3KZZ A;  4RGX A;  2QVO A;  2WC2 A;  4A0Y A;  4ENK A;  2OAZ A;  4BXU A;  2Z5U A;  3I59 B;  2L4A A;  2G7H A;  2PN6 A;  3TO6 A;  4XBF A;  1ZAO A;  4YFK F;  3E5U A;  2H94 A;  1ZGA A;  3W6K B;  4WWC A;  5ILS A;  4B09 A;  1XCB A;  4U0V A;  2F5C A;  2ZFW A;  2ESH A;  1CF7 B;  1S3J A;  1LB2 A;  1IXC A;  2FE3 A;  3VEP A;  3HHG A;  3WTZ A;  2L4M A;  2E7X A;  2UXN A;  4BHB A;  4HQE A;  2W84 A;  1A04 A;  4KMF A;  1RIO H;  3FXR A;  3R60 A;  5FD5 A;  2J5P A;  3KP3 A;  3EUH A;  3HRT A;  3ZMU A;  1KU2 A;  3WGG A;  3PQK A;  3GZ5 A;  5LRS A;  5FGM A;  5LLQ A;  1SD7 A;  1KA8 A;  1DPR A;  3SFZ A;  4NHJ A;  4Q5S F;  5D5U B;  4KIG A;  2ZME A;  3EET A;  5HOO A;  3DXJ F;  3GYH X;  2HDC A;  5CLS A;  5IT3 A;  2K02 A;  5H6Q A;  2VOD A;  4HAM A;  4L5I A;  5D6E A;  3K9T A;  4FT8 A;  2EJR A;  2M5W A;  4I02 A;  3DPT A;  5FFZ A;  1MDM B;  1HQC A;  3KET A;  3R0A A;  4PZJ A;  4LB5 A;  2Z99 A;  1BIB A;  3ZMD A;  2FBK A;  2VE8 A;  4NQW A;  4O5V A;  4G7H F;  3ZQ7 A;  1B6A A;  1O3S A;  5L3B A;  3HTU A;  1ZG1 A;  2XRN A;  4TV7 A;  3VOE A;  3GVA A;  5K5R A;  4LJZ F;  3Q5F A;  3F8F A;  2ZNZ A;  4P5O A;  1U6G A;  2ZKZ A;  3NQO A;  1BI2 A;  2VBZ A;  3C1D A;  3RYR A;  1TNT A;  3DF8 A;  2OZ6 A;  3OOP A;  3DEU A;  2ISZ A;  1ZN2 A;  3TDZ C;  3JW4 A;  1J59 A;  2GIV A;  5KK1 A;  2UZK A;  2DLL A;  5LBQ A;  4L9T A;  4I98 B;  1SMT A;  5HDK A;  3HRM A;  5BPD A;  2IVM A;  1R5G A;  1H9T A;  1O57 A;  2F5D A;  3Q9S A;  1HW1 A;  1I27 A;  1SFX A;  2DW4 A;  2LNB A;  3GUD A;  3T8R A;  1IW7 F;  1P92 A;  4OIQ F;  1OR7 A;  3HHH A;  4KIC A;  3ELK A;  4QLC U;  2YPR A;  3FF5 A;  4UVC A;  5ERI A;  4OIR F;  2ZCW A;  3IKV A;  3CJN A;  2A69 F;  2VC1 A;  3RTR A;  1FYK A;  3EDP A;  2XAQ A;  1T6S A;  2BGC A;  4M9X A;  3KP6 A;  4RAZ A;  1T39 A;  3O2P E;  2JSC A;  4ZH4 F;  4ON0 A;  3RKX A;  1Z91 A;  2D45 A;  2X4H A;  5HS8 A;  3LAP A;  3I4P A;  2MC3 A;  5ICG A;  5CVR A;  3HUG A;  4KUM A;  2HS5 A;  1J5Y A;  4H0E A;  3P7N A;  4G6Q A;  5D8K B;  3MCZ A;  4CIC A;  2Z33 A;  1FP1 D;  2J5O A;  1R5H A;  3EYY A;  1R7J A;  2LF8 A;  1TLH B;  1MZB A;  2QUF A;  2MLG A;  2K86 A;  3CUQ A;  4LLG F;  4CYD A;  1OMI A;  1PDN C;  1EH6 A;  2F5E A;  5HS7 A;  2IA2 A;  3F8M A;  3WTW C;  2F2E A;  4HLX A;  3P9K A;  3FMR A;  4E70 A;  3RYP A;  2JPC A;  3GX4 X;  1WI9 A;  1AWC A;  3RKW A;  5LEK A;  5H20 A;  2EA4 A;  2VON A;  2STW A;  5DCM B;  1P6R A;  1J2X A;  1IXS B;  3IRQ A;  2IA0 A;  1W7P A;  3V8K A;  3FMS A;  2KIM A;  1W7P D;  1XGM A;  5EEG A;  4KT5 C;  1YW8 A;  4EM2 A;  4MQ9 F;  2CO5 A;  1O7F A;  1D8J A;  4K2E A;  2CGP A;  2FBH A;  2ZBK A;  3LST A;  5E1Z B;  1QNT A;  2EA2 A;  3JSP A;  3GEZ A;  3HTS B;  3IKT A;  2EB7 A;  3ISP A;  3QOP A;  3RIR A;  3IC7 A;  5F64 A;  3E6M A;  1KQ8 A;  4R8H A;  1O7L A;  3LQR A;  3F8C A;  4R79 A;  3QRF F;  2A61 A;  4GGG A;  2FOK A;  1XMA A;  2JTV A;  2DK5 A;  5BS6 A;  1OKR A;  1G6N A;  2DAO A;  1SFE A;  1FX7 A;  4ESF A;  4PGH A;  3BJ6 A;  2PEX A;  3W6J B;  1U5T A;  4U88 A;  3ROU A;  2C6Y A;  2DU9 A;  2RNJ A;  2JZY A;  4FX0 A;  3LWF A;  3TOA A;  4LMY A;  3K1N A;  2JRT A;  1ZH5 A;  3FM3 A;  5E1W A;  5LGT A;  2Y48 A;  2QQA A;  5LHI A;  2HYF A;  1K78 B;  2P6S A;  5FO5 A;  3ZMS A;  1FOK A;  3CLO A;  1K79 A;  5A2Q K;  4MTD A;  1ULY A;  2COM A;  2EFQ A;  5BMZ A;  1XDS A;  3BWG A;  2ZXJ A;  1LDJ A;  2Q8K A;  1S8N A;  4IHT A;  4AIK A;  4L0Z B;  3CDH A;  4YFX F;  5CVJ A;  4LG0 B;  5EEH A;  3QPH A;  1ZG5 A;  2RV8 A;  3S2W A;  1K7A A;  2FQ3 A;  1XSD A;  5LHG A;  1OYW A;  3WTS C;  3GZ6 A;  2V9V A;  6PAX A;  2FA5 A;  4HZF A;  4I0A A;  1MKM A;  1QQI A;  3TOB A;  1FYM A;  2XRO A;  2DT5 A;  5ICE A;  3FHZ A;  5BOX A;  1LEB A;  5E18 F;  3HYI A;  3RI4 A;  4IHS A;  5DYM A;  4HV5 A;  4IRI A;  1ON2 A;  4RB3 C;  2M87 A;  4RGR A;  4XRF A;  1LNW A;  4MHG A;  3RJP A;  1H9G A;  2VOO A;  1R1U A;  2HWV A;  4EJT A;  4DQ2 A;  4UHT A;  3GWZ A;  1O3T A;  2ELH A;  2PI0 A;  4ZZD A;  3G73 A;  4Z2Y A;  3F72 A;  4RB1 A;  4B8X A;  2KJB A;  3WGH A;  2D2W A;  2KJC A;  1ZLK A;  3JAM K;  4G6D A;  3JAM Z;  4HF0 A;  1TBX A;  4KMU X;  5K5O A;  1HBX G;  1F5T A;  3N97 A;  1TTY A;  1O3Q A;  2OD5 A;  3L00 A;  2BEO A;  1KQ0 A;  4MEY F;  1SD4 A;  4L9N A;  4HA8 A;  2XAG A;  4A6E A;  2AXL A;  2RC4 A;  3QU6 A;  1TNS A;  5E17 F;  3F6V A;  1WRJ A;  5HLH A;  1OYI A;  1S7O A;  3R61 A;  3ULQ B;  5CVI A;  1XSX A;  1LEA A;  1S29 A;  5BPI A;  5D6F A;  4R1H A;  1SD6 A;  1GXQ A;  1T38 A;  1RUO A;  3K1M A;  1XGN A;  2M1B A;  2H27 A;  3ZPL A;  2VXZ A;  2RGV A;  2X0L A;  2HKX A;  1DUX C;  2EWN A;  4G7O F;  3MZH A;  3IL2 A;  2W24 A;  4UV9 A;  1L0O C;  4CO8 A;  2EFN A;  3MFK A;  3SQN A;  3MEX A;  4AD9 A;  1EV7 A;  4XSX F;  1I1S A;  2HQR A;  1J7K A;  3E6B A;  2GA2 A;  3DFG A;  1BC7 C;  4U0W A;  4A0Z A;  5F6F A;  1W4M A;  4I0B A;  1J75 A;  2PLY A;  4Y15 A;  5JFR A;  1G3Y A;  1CGP A;  2P5V A;  3WOD F;  2FSW A;  4L18 B;  4G7Z F;  4OIO F;  2ACJ A;  1O3R A;  1RZ4 A;  2LDU A;  1T2K A;  4L9J A;  1SAX A;  1YW9 A;  2Z3Y A;  3M8F A;  5ILV A;  3RDI A;  3TQN A;  4UVB A;  4UV8 A;  2GXB A;  1FY7 A;  3FM5 A;  3U1D A;  1Z05 A;  1GVJ A;  5KVR A;  3WTY C;  3G3Z A;  4MQV A;  3T0Y A;  3H92 A;  5J6X A;  1FPQ A;  4EJV A;  1Y0U A;  2PMH A;  1OPC A;  5D4S A;  2HYG D;  3D5L A;  2CQK A;  2F5F A;  4I2O A;  2OQG A;  2HFH A;  1WKM A;  1R1V A;  1YLF A;  4HF1 A;  2PJP A;  3J80 Z;  3CUO A;  1JGS A;  2NNY A;  5DUK A;  3P9I A;  4HX7 A;  1KU3 A;  2IW5 A;  3TO9 A;  4WX9 A;  1RNL A;  4G9Y A;  1ZRD A;  3I58 A;  4GYG A;  4ZYE A;  1NHA A;  2V1X A;  3ZN0 A;  2DBB A;  4ETS A;  5K5Q A;  3Q9V A;  4M73 A;  5TJJ A;  1CF7 A;  5IT9 K;  2EFO A;  5IT9 Z;  1FZP B;  4EVI A;  1P4A A;  2XAH A;  2EK5 A;  1P2F A;  5FD6 A;  2QEN A;  2Y0M A;  2DTR A;  2ESN A;  1B59 A;  2NYX A;  1XCV A;  1QGP A;  2XGX A;  3KCC A;  3LA2 A;  2R7D A;  1ZRE A;  4U7D A;  4NB5 A;  2OZU A;  1FC3 A;  2ADU A;  2OBP A;  1B9N A;  5AON A;  4JBA A;  5DD8 A;  2D1H A;  3HRS A;  3ZMV A;  1VTN C;  1E17 A;  1FBS A;  4HBL A;  4O6J A;  3WG9 A;  5HLG A;  3E97 A;  3KEO A;  2HQN A;  3F6O A;  5FFX A;  2EV5 A;  4HX4 A;  1J0R A;  3BP8 A;  2MH2 A;  1I6X A;  1BM9 A;  3F8N A;  5HLI A;  1YQA A;  4IXA A;  1MDM A;  3VB2 A;  3IWF A;  3ECO A;  4LLN A;  4ESB A;  2EV0 A;  1GHC A;  3ML6 A;  2A6E F;  1R58 A;  2HTJ A;  3O3K A;  1SD5 A;  1BOA A;  4OU0 A;  1T98 A;  4M72 A;  2E1N A;  4YFN F;  2KRF A;  2QQB A;  3ECH A;  2HEO A;  3REO A;  1Z6R A;  2HGC A;  2W25 A;  3DP7 A;  4RB0 A;  1BI1 A;  1MJ9 A;  4LGW A;  1G3S A;  4OIP F;  1ZGJ A;  4M74 A;  4BYY A;  2VBY A;  4ZYG A;  3V7R A;  3CTA A;  5DCF A;  1Q1H A;  3WU1 B;  1UST A;  2QYO A;  2LKP A;  4L9V A;  3B02 A;  2PG4 A;  3L09 A;  2MH9 A;  4PGG A;  1USS A;  4FHT A;  1U5T B;  3QU3 A;  1UHM A;  2V1D A;  4YG2 F;  3D0S A;  1LVA A;  2WTE A;  4CXF A;  3PQJ A;  1TQP A;  3U2R A;  3F8B A;  5E8I A;  3V4G A;  2A6H F;  4G94 A;  4WK8 F;  3E3V A;  3VOD A;  5F1R A;  2OQR A;  2K4B A;  1MJA A;  1IN6 A;  4EQQ A;  2EV6 A;  1FYL A;  2IA1 A;  4BAY A;  4EV0 A;  1R1T A;  4XLP F;  1JHH A;  3KP5 A;  3SZP A;  2FU4 A;  3BPX A;  3C7J A;  4YIF A;  2CG4 A;  2VOP A;  5L3E A;  1IN7 A;  5FLX K;  2IJL A;  2K7L A;  5FLX Z;  4FX4 A;  2Z9O A;  2BV6 A;  4GCV A;  1Z1D A;  2LF7 A;  2MLK A;  3C18 A;  3N4M A;  1HXD A;  4IPA A;  3JTH A;  5LGN A;  2P7C B;  2L02 A;  3MWM A;  1U3E M;  4EMS A;  4LD5 A;  2B0L A;  3OV8 A;  3BZ6 A;  1FSH A;  3NEU A;  4M6X A;  2VN2 A;  5JHU A;  2BYV E;  5TRD A;  4A2U A;  1V4R A;  4D0P A;  1BC8 C;  4KDP A;  2R3S A;  3BJO A;  3K0L A;  4WCG A;  3KEQ A;  3V7C A;  2P6T A;  3KFW X;  3DKW A;  3DV8 A;  4IVN A;  2JPB A;  2VBW A;  4HOB A;  2IP2 A;  1Z7U A;  2H6B A;  4OMY A;  5CYV A;  3KZY A;  3ZN1 A;  4WXH A;  5LHH A;  4HDV A;  5CVU A;  5LEJ A;  1XSV A;  1XGO A;  2YX4 A;  3KLO A;  1ZRF A;  5L3F A;  1H0M A;  3V8J A;  2VT2 A;  2UXX A;  3ABU A;  2GXG A;  5DCM A;  2MD5 A;  1Z6T A;  1D3Y A;  1QPM A;  2XIG A;  4P96 A;  2M45 A;  5BQT A;  3TO7 A;  3FXQ A;  1SMY F;  1R22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...