3KP7A

Staphylococcus epidermidis tcar (apo form)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
140
Chain Sequence
MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
total genus 54
structure length 140
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp7A00
1B4AA 2FNAA 3LWFA 4L9JA 4A5MA 3W6JB 1F4KA 1F5TA 1XMAA 1LEBA 3GYHX 4WXCA 5DYMA 5TJJA 2HS5A 1S29A 1P6RA 4GXOA 1WSUA 2IT0A 4YIIA 4NHJA 3I59B 1IN6A 4CYDA 1TTYA 2RC4A 4P9UA 1OYWA 2DPUA 4HF2A 2ESNA 2Z9OA 2ZO4A 1JHHA 3DKWA 2QLZA 4MTDA 2R7FA 4BH9A 2CYYA 4O5VA 1P4AA 1ZAOA 4HBLA 1TNTA 3MQ0A 1QPMA 2WTEA 2EV5A 3WTXC 1K79A 3ZN1A 1LDKB 2FA5A 1WQ2A 2GXBA 3F8FA 4HDVA 4WF2A 1R00A 1SMTA 1YS7A 3GLXA 4E70A 1FC3A 4B09A 3KZZA 2A5YB 5HOOA 2XIGA 3GFIA 5J8CA 2XRNA 2ISYA 4G6QA 1FSEA 1AOYA 3SZTA 1XB4A 4OIPF 2BYVE 1EH8A 3BY6A 1WI9A 2MH2A 4PGGA 4UUVA 3R0AA 3SZPA 4Y17A 2FNPA 1YW9A 2PQ8A 1USTA 1BM9A 4XSXF 3J81K 2MLKA 3MZYA 2ZNYA 1HQCA 3BP8A 5BS6A 2A68F 5FGMA 3KFWX 3ML6A 4L0YB 3E5QA 1H0MA 3ZMTA 3WTYC 2M1BA 1TW3A 3WTVC 4IRGA 2P8TA 1U8RA 5L3GA 3KE2A 3K69A 1DPUA 3REOA 2IJLA 2DQRA 3QU6A 1BI2A 4OOIA 2GA1A 2BEOA 1LEAA 1Z1DA 1ZHFA 4PCQA 3DPLC 4UVBA 2CSOA 4HX4A 4CGZA 2TDXA 2H27A 4I02A 3DEUA 1IN8A 5JFRA 2NS0A 4PDKA 4IJAA 2EJRA 3SQNA 1DUXC 4UV8A 3V7CA 4ZYDA 1FBUA 1A04A 2VT3A 3T8RA 4AWXB 3NQOA 4A6DA 3D0SA 1TQMA 1BBYA 3IKTA 2FSWA 2IA2A 5LHIA 3FXQA 4I2OA 3QRFF 3RKWA 4KA4A 3D5LA 5CVRA 4WX9A 4ZZLA 4KMFA 4Q4ZF 3T1BA 1T2KA 5TRDA 2ZNZA 4GYGA 3MZHA 2XAJA 2H6BA 3BJOA 3FMSA 3KP6A 4BHCA 2DPDA 1UHWA 1K7AA 5CLSA 1HW5A 4AD9A 5FB2A 2F5DA 1FYMA 3ZPLA 2P5KA 3CUOA 2KIMA 4UVAA 3NEUA 4Q5SF 5D8KB 5JI6A 2QWWA 5DUKA 1DPRA 3C1DA 2H09A 2EA2A 3K9TA 3EUHA 3TOAA 3GX4X 4GYIA 1IUYA 2Y48A 2MA3A 2W25A 5J8FA 4MHGA 2QVOA 4KN4X 4MQVA 2Q8KA 1R5GA 1KU7A 5ICGA 4AVPA 3DV8A 1G3WA 4OU0A 1FOKA 5FFZA 3OV8A 3J80Z 2EB7A 4ZYGA 2D45A 4AIJA 2K86A 2NRAC 1KYZA 2VE8A 2RN7A 2BE5F 1MZBA 5D5XB 2O0YA 2Q2EA 1NHAA 2G9WA 2VONA 1IZ1A 3I71A 4JK1X 1HW1A 3LAJA 2IRFG 4BAYA 3KP4A 3N4MA 4Q48A 1LDDA 2Z99A 2OAZA 1IAWA 2FBHA 2EA4A 4NB5A 5H6QA 3FXUA 2IPQX 3F23A 4JBAA 1YG2A 3DPTA 2XROA 1PDNC 4ETSA 5FD5A 1G6NA 2V6CA 3CJNA 4L5IA 3BOQA 1MJBA 2XKPA 2QQ9A 3VB2A 2QENA 1R22A 1QQIA 1HKQA 3RI4A 3QPTA 2MD5A 1WWXA 4EGYA 3LA7A 4QLCU 3ERED 4LD5A 1E2XA 2K27A 2GZWA 3TO7A 3B73A 4D0PA 4CO8A 3BJAA 1KU2A 2XAHA 3P9IA 4HX7A 3C7JA 4EVIA 2VBXA 2FXAA 1TW2A 2XAQA 3R60A 4KIBA 1XD7A 3HSFA 3OOPA 3U1DA 5BQTA 1RUNA 4N9IA 5KVRA 4LLLA 1PP7U 3F8BA 4YIFA 1SD7A 3VODA 2KIFA 5IT3A 4KFCA 4KIGA 3VOEA 1BJAA 1SD4A 1W7PB 2P6TA 4S04A 1I1GA 3IWFA 4HF0A 4R8HA 3GFLA 2CGPA 2VODA 3I59A 1W5SA 3J80K 1U2WA 5LGTA 2NNYA 4WCGA 1ZRFA 3JAMZ 1ZLKA 1G3TA 1ZRCA 3ZQ7A 1FSHA 1KYWA 5L3DA 5CVUA 4P9FA 2FMYA 3KZYA 1TQIA 2LF8A 4M9ZA 4L18B 1IW7F 1KU9A 1J0RA 1ONVA 3DFGA 2MBFA 1IN5A 1LB2A 4MTEA 1Y0UA 3WG9A 3BJ6A 2M30A 2OZUA 3H3ZA 2VBZA 3IRQA 1REPC 2EWNA 5AIQA 2OQRA 1FX7A 2QBYB 5E20A 1XGSA 3ZMSA 5D5WB 5FLXZ 4I0AA 5HS9A 4A0ZA 2Z5UA 3WODF 4RB2C 3TO9A 4WXHA 3FXRA 3R6SA 2Z3YA 3V4GA 1LJ9A 5H20A 2CQKA 1BOAA 1TLHB 3ELKA 3BPXA 4G7ZF 4CDGA 2FQ3A 3WGHA 2E1CA 2OBPA 3K1MA 3JSPA 1HXDA 4GO1A 1K6OA 3P9KA 3LAPA 1FYLA 1BIBA 5CJ9A 4S05A 2Y75A 2K7LA 2XVCA 1X3UA 2A3SA 5K5QA 2VT2A 1D8JA 1QO0D 3RPUA 3FMQA 4ZZDA 3LA2A 5ILSA 5D5UB 1KGSA 4OMZA 1EH6A 3FM5A 4EJWA 1U78A 3JTHA 4IHTA 2X4HA 2COMA 4HLXA 3HHGA 5LRSA 2FEZA 4U7DA 4HX8A 1ON1A 1Z7UA 3E97A 3PQJA 1O57A 1I5ZA 2FOKA 3SFZA 4HLYA 1YS6A 3I58A 3PFIA 2OA4A 3ROUA 2X0LA 5CVVA 4LLGF 2JPBA 1CF7B 1R1VA 2LKPA 3E6MA 4HV6A 3GXOA 3QPHA 2JZYA 2V1XA 3LFKA 2A07F 5JVTA 3DQVC 3JAMK 2OQGA 2R3SA 3CUQB 3IHUA 4ESFA 1P92A 3VEPA 1FY7A 3L7WA 1ULYA 1P2FA 4ENJA 3ECHA 3GW2A 4CICA 2DK8A 2HQNA 4KMUX 2H6CA 1WRJA 4KN7X 4Y13A 3L9FA 2P7CB 1T38A 1USSA 2BV6A 5DD8A 1SD5A 3MEXA 3WTTC 3F3XA 2PI0A 1O3QA 1T39A 5LHHA 4L9TA 2VOPA 1XMKA 4G6DA 3FM3A 2XASA 3KLNA 4PZJA 5FLXK 1ODDA 2J5PA 5JHUA 4LLNA 2DU9A 2JTVA 4YFKF 4MEYF 2ACJA 2RNJA 1T6SA 5KK1A 2K4JA 5E1XA 2KIUA 4A2UA 1KQ8A 2IW5A 2LF7A 3E3VA 2E1NA 3COAC 3LQQA 3DP7A 5E18F 3GEZA 1O3SA 5L3BA 5HLIA 3J7AO 3GF2A 4DNCA 2M45A 2FMLA 1HBXG 4G7OF 2ZMEA 1Z05A 2VOOA 1QBJA 1YW7A 5IT9Z 4A0XA 4XBFA 4BHPA 2EFOA 4MQ9F 2A61A 1S6LA 1S7AA 3RDIA 4OIOF 3GUDA 2KJCA 3T5XA 2NYXA 3TOBA 1MJAA 2DBBA 2A69F 5ICCA 2V79A 1R5HA 1KQ0A 4H0EA 4F7ZA 5BPDA 3TDUC 5LHGA 1W5TA 2EFQA 3EETA 3RPQA 5D4RA 2M87A 1OPCA 1BI1A 1HW2A 1XSVA 2XKOA 1H9GA 1L0OC 4HA8A 3WU0A 3WTZA 1J59A 3QU3A 5ILUA 4OIQF 2Y0MA 2P5LC 1HSJA 1UHMA 3BDDA 4ENKA 5BPIA 5D6EA 2W57A 4PGHA 3V7SA 5DV5A 1RNLA 4UNOA 3P7NA 1GXQA 2YSRA 2CW0F 4QWQA 4O6JA 4RGRA 2O61A 4K2EA 4ENMA 4RGSA 1ZN2A 2O6GE 2D1VA 4G94A 2OZ6A 4HOBA 2KKOA 2BBYA 5BOXA 4U0YA 4UVCA 4ZYHA 2R7DA 2UXXA 2HEOA 2ZMEB 3WGIA 2AXLA 2WC2A 3U2RA 5DUIA 1OMIA 2XAFA 5D8LB 3MWMA 4GCVA 3HUGA 3RKYA 2XAGA 1D8KA 1ZG3A 3GZ5A 1QGPA 4B8XA 2VC1A 1R1TA 1SFXA 1W7PA 1FZPB 4XLNF 4UV9A 5LGNA 2ELHA 2WV0A 3IL2A 1JHFA 2KRFA 5IT9K 1GVJA 2KJBA 4UXNA 4EQQA 4IF4A 2OD5A 3B02A 4L0ZB 4LJZF 3G3ZA 3KP7A 1SFUA 3K1NA 1I27A 3F8NA 3M8FA 3HYIA 4GGGA 2GXGA 2V1DA 1LNWA 1QZYA 4M9XA 1I1SA 3I5UA 1U6GA 2DT5A 1O7LA 4A0YA 2UXNA 4RGXA 1ZYRF 4FX4A 4HQMA 4KYWA 3JSOA 4A6EA 4IPAA 1STZA 1YYVA 2YX4A 3RJPA 4BXUA 1Z6RA 5E1WA 1H9TA 1HKTA 1YTYA 3KP3A 2A6HF 1IN7A 2JPCA 4ESJA 2QBYA 3CUQC 3O6BB 3LSTA 2EFWA 5F64A 2DO7A 3R61A 4HAMA 1FBQA 1J9IA 5HS8A 2QUFA 4ENNA 5L3CA 2UWMA 3HSRA 4LK0F 2EFNA 4KIFA 1BIAA 1IXSB 3N97A 4RAZA 3C3WA 3KETA 2RGVA 5DCFA 3CO7C 5ILVA 4KDPA 1C0WA 2PFBA 4HZFA 1PP8F 4M72A 1LVAA 2F5CA 1K78B 4LMYA 2HGCA 1UB9A 1MDMA 3EYYA 3WE2A 2CO5A 4YFXF 2HFHA 1GXPA 4ESBA 2E7XA 1D3YA 2EV6A 5L3EA 1CF7A 3HOSA 3C18A 2W84A 1R23A 1KU3A 4CHUA 4M6YA 3HRTA 1BC7C 3IKVA 3CUQA 2IA0A 4KICA 4N0BA 2L3DA 3I54A 4MEXF 5JR3A 3H3UA 2VBWA 2F2EA 3WTUC 2O8XA 1TBXA 2K4BA 4R79A 1B1BA 3G73A 2F5EA 3IRRA 5D6FA 1XGNA 4I09A 1ZH5A 3FWEA 2FBKA 3F6VA 1QZZA 1GHCA 4EJVA 4A5NA 1HKSA 5HDKA 4EM1A 4MNUA 3BROA 2XUBA 1V4RA 4IHSA 3LQRA 4LK1F 2ISZA 3F72A 2HR3A 4ON0A 2NAZA 3TQNA 2DK5A 4HYEA 4MGRA 1O7FA 2PJPA 1XSDA 2RKHA 3F22A 1XDSA 2HYFA 4I01A 2PMUA 5A2QZ 3U9GA 1J5YA 3Q9SA 2IA1A 1OYYA 2HKOA 4I7HA 5ED4A 3RYRA 4M71A 1MDMB 4FT8A 2QQAA 3KEOA 4P5OA 2DTRA 1B9NA 1Z9CA 4G8XA 3VFZA 3TKYA 4U0VA 2YU3A 2VE9A 6PAXA 3ZMUA 1E17A 1YO5C 1D5VA 1KA8A 3CDHA 2HQRA 1SMYF 1IXRC 5CVJA 5K1YA 4RS8A 4RB1A 2JRTA 5LEKA 4Q47A 4KT5C 2HZTA 1PUEE 3PQKA 1B6AA 1J75A 2CFXA 3ABTA 3WGGA 1QNTA 2HWVA 5FD6A 5ERIA 2VC0A 1G3YA 4EJOA 4P55A 2ZJ2A 1ZG1A 5AONA 4EJUA 2ESHA 5HDNA 4EJTA 3HTSB 4BHBA 5EEGA 1FWZA 4WWCA 1XN7A 2P6SA 4EGZA 5LRRA 2YR2A 4ZYEA 4HV5A 4M9SA 2P5VA 3HRMA 3I64A 5HS7A 1HSTA 3V7RA 2PBIA 4KNYA 1R7JA 5DD4A 3LA3A 1MJ9A 4XLPF 5ICEA 3GFJA 3WU1B 1TQPA 3ZP5A 3ZMVA 3GZ6A 1T98A 2M8EA 4I0BA 3V8LA 4AIKA 1FP2A 1FLIA 4OIRF 4ZH4F 4LG0A 1UFMA 5AIPA 2QM3A 3DXJF 1FP1D 3K1PA 1S8NA 4WXDA 1BC8C 1MKMA 3R4KA 1O3TA 3KEQA 1KQ9A 5HDGA 5EEHA 3FX3A 2GWRA 2B0LA 3QAHA 3CO6C 5A2QK 2HTSA 3W6KB 2G7UA 1JGSA 2EK5A 2ADUA 2RDPA 1XCBA 3P9CA 2L54A 1DP7P 2EV0A 2DW4A 3IC7A 3FZVA 3T8TA 3HIFA 1FYKA 2YX7A 3CLOA 2STWA 1YIOA 1BI3A 3ZMZA 2C6YA 1RI7A 1IN4A 3K2ZA 4IRIA 1FNNA 3L00A 2HDCA 2YPRA 1L3LA 5H6RA 4M6XA 5J6XA 5F1RA 2XGXA 4L9NA 1I6XA 2P7VB 1SD6A 3KCCA 4RGUA 2M5WA 1J7KA 4G7HF 3FHZA 2FRHA 3NRVA 2HOEA 5DCMA 2HYGD 3RTRA 1V3FA 4HDUA 3BPVA 2BGCA 3EQLF 3WTWC 1U5TC 4U88A 1IXCA 1S7OA 4DQ2A 1XGMA 2ZKZA 3F6OA 2VN2A 3Q5FA 4EM0B 1W4MA 3HRSA 2A6EF 2H94A 1Z91A 4YG2F 1AWCA 1SFEA 3I4PA 4XRFA 4LG0B 3R0JA 5E1ZB 3HTUA 3FF5A 2QYOA 3ZMDA 3HHHA 1XSXA 2GAUA 3FMRA 2O3FA 2DAOA 1YQAA 2CWEA 2GIVA 3RYPA 2STTA 1LQ1A 5L3FA 1YW8A 1EH7A 2HTJA 3L09A 3F21A 1FPQA 5LGUA 3SHFA 2V1UA 3HSEA 4IRHA 3E6BA 1G4DA 3ULQB 2G7HA 3IWZA 3E5XA 1R36A 4HW0A 3QP5A 1R1UA 1F1ZA 2DI3A 2P4WA 3M9AA 2VBYA 4U0WA 1UCRA 4YFNF 5FFXA 4RB0A 3BWGA 3WE3A 1T0FA 2W85A 4U7BA 4HF1A 1K78A 2FE3A 5K5RA 4RB3C 5K5OA 3M7GA 2CG4A 1P4WA 2ETHA 2GQQA 4A12A 4O3MA 2L01A 4LFUA 4N9HA 4EV0A 4UHTA 3SXYA 4BNCA 2PG4A 1LDJA 1MGTA 2XV4S 4HQEA 1XGOA 3GFMA 3EDPA 1ZARA 2Q0OA 3MFKA 2RV8A 1F9NA 1U5TA 2VXZA 3ABUA 2GA2A 2FU4A 3KLOA 4Z2YA 2PLYA 5DCMB 3QP6A 4L5JA 2PN6A 1SAXA 3RIRA 3CTAA 1W7PD 2L02A 1RZ4A 2MH9A 1WKMA 1BN5A 1IRGA 3Q9VA 5D4SA 4M74A 2JT1A 1OYIA 2O03A 1IRFA 1VTNC 2JSCA 3S2WA 1ZREA 1ON2A 3K0LA 5E17F 3BZ6A 3ISPA 5DEQA 4IXAA 4FHTA 4ASNA 1ZGJA 2AS5F 2PEXA 3GWZA 2F5FA 3TGNA 4EMSA 2D1HA 4JQFA 1G3SA 1ZG5A 5LBQA 4CZZA 2DLLA 5CVIA 1ZLJA 2IVMA 4R1HA 4BYYA 2ZCWA 5FO5A 1O3RA 4LB5A 2PMHA 1Z6TA 4NQWA 1Q1HA 3F8MA 2EFPA 3ZN0A 3M1EA 4EM2A 2V9VA 3TO6A 4KUMA 5LLQA 3V8KA 2W24A 1TNSA 3MCZA 4FX0A 5BMZA 3F8CA 1RIOH 3GVAA 3WTSC 2J5OA 3GO5A 1R58A 3T0YA 3ECOA 2E7WA 5E8IA 3HOTA 2LNBA 3O3KA 3L2CA 3I53A 2ZXJA 2ZFWA 3KP5A 1DDNA 2RQPA 2RVCA 4AIHA 4BQAA 4I98B 4RAYA 2L4MA 2UZKA 2DQLA 1BI0A 1U5TB 2L4AA 2HKXA 1YFHA 1RUOA 3M8EA 1OKRA 2LSOA 2QZ8A 1FBSA 1U3EM 1B59A 1P4XA 2ZBKA 4CXFA 4OINF 1ZGAA 3E5UA 2FF4A 4TV7A 2NNNA 1J2XA 3JTGA 2FBIA 1IF1A 4XSZF 3MAJA 3I0TA 3JW4A 2LDUA 4M73A 5HLGA 4WK8F 3E6CC 3H92A 4LB6B 5F6FA 4G9YA 3HRUA 1CGPA 5HVQC 3QOPA 4IVNA 3E6DA 3EYIA 3V8JA 5LEJA 2Z33A 5CYVA 1EV7A 4P96A 5DDGA 3KP2A 1XCVA 1JXSA 1OR7A 1B9MA 2MLGA 3J81Z 2DFIA 2XHKA 2IP2A 2MC3A 2OU2A 1FT9A 1MD0A 2D2WA 4OMYA 3TDZC 4L9VA 3AAFA 1XDUA 1ZRDA 3DF8A 1YLFA 3RKXA 3O2PE 2QQBA 5E8GA 1S3JA 2WWYA 4Y15A 1JE8A 5ICFA 5D5VB 2K02A 4LGWA 5HLHA
chains in the Genus database with same CATH superfamily
1B4AA 2FNAA 2LREA 3LWFA 3QQAA 4L9JA 2VJ5A 4BY1J 3ZQGA 4A5MA 2LTPA 3W6JB 1F4KA 1F5TA 1IGNA 1XMAA 1LEBA 5EF6A 3GYHX 1UG2A 4WXCA 1W5CC 5DYMA 5TJJA 2CS3A 2HS5A 2TRTA 1OCTC 3SEQA 1BJZA 2K40A 1S29A 2OTJI 1P6RA 4GXOA 1WSUA 5FKOA 2ELJA 4YIIA 1NTCA 3BCAA 2IT0A 4IKFA 3OYGA 4NHJA 5F0HA 3I59B 1IN6A 4KJZA 3AG2H 4CYDA 3OYCA 1OLTA 1LE8B 3K70D 5M5WJ 1TTYA 2RC4A 5EG0B 4P9UA 1OYWA 2VQLA 2DPUA 2HOSA 4LIVA 2DYSH 4LOCA 2BXYA 4I76A 5IP9J 4HF2A 2ESNA 2R7TA 1QA6A 2BW3A 2ZO4A 2Z9OA 2M8GX 1JHHA 2L0KA 4RM2A 1A6IA 3DKWA 3CCQI 2QLZA 5M3FJ 4MTDA 2R7FA 4BH9A 2CYYA 4O5VA 1P4AA 1ZAOA 4HBLA 5JLWA 1TNTA 4NC7A 1B72B 3MQ0A 4CCLA 3IAS2 4JX6A 2LH9A 2ME6A 1QPMA 2WTEA 3H5NA 3DLLF 2EPFA 3KIOA 2EV5A 3WTXC 1ZQ3P 1WJDA 1K79A 2LY2A 3ZN1A 1LDKB 2FA5A 2BXZA 2PMZA 1WQ2A 3LOCA 2GXBA 3F8FA 4HDVA 2EILH 2ZC2A 3BZCA 4WF2A 1R00A 1SMTA 1GV2A 1YS7A 3FK6A 3GLXA 1FC3A 4E70A 2B9SA 4B09A 3OYIA 1PYVA 4HEA2 1WFXA 3KZZA 2OPTA 5K7ZA 2DT6A 2JK3A 2XGDA 2A5YB 3BQZA 5HOOA 2XIGA 4G12A 2E5NA 3GFIA 5J8CA 3MD2A 3BG9A 4ZDLA 3OYFA 2XRNA 2NVYJ 2ISYA 4G6QA 1FSEA 1AOYA 4B47A 3SZTA 1X1AA 2CU7A 1XB4A 4OIPF 2K3PA 1ZTRA 2BYVE 2HOAA 2DA6A 1EH8A 4A3MJ 3BY6A 2JA6J 3UR3C 1WI9A 2MH2A 1M1EB 4PGGA 3JRGA 4UUVA 1OCCH 1X3ZB 3R0AA 3H9JA 3SZPA 4DZPA 4Y17A 2FNPA 3H9GA 1YW9A 2IGKA 2Y30A 1NK3P 5E3MA 2PQ8A 1USTA 1BM9A 4XSXF 3J81K 2MLKA 3MZYA 5KAIC 2LD5A 2V9KA 3FKIJ 4RLFA 2ZNYA 3PUBA 3OYLA 1HQCA 5EGOB 3BP8A 3A1YA 2UUZA 3W3CA 5BS6A 2A68F 1BR1A 5FGMA 1ZR4A 2IXSA 3KFWX 4JP0A 1U9OA 3ML6A 4L0YB 2DCEA 3E5QA 1H0MA 3ZMTA 5HNHA 3WTYC 2M1BA 2LMDA 1TW3A 3WTVC 4UB8C 1MSFC 5FROA 2EINH 4IRGA 2DDAA 2R7RA 2P8TA 1VI0A 5L3GA 3KE2A 1U8RA 1TWAJ 3K69A 2VUMJ 1DPUA 3K4MA 3REOA 2IJLA 2DQRA 2E1OA 1TZLA 3QU6A 1BI2A 2XAUA 5IY5H 3SEZA 4OOIA 2GA1A 3HM5A 2BEOA 1LEAA 1Z1DA 1SVLA 1ZHFA 2TCTA 3DPLC 4PCQA 4UVBA 2E1MB 3JRCA 5JVGF 5F0FA 2CSOA 2XB0X 2F6CA 2W48A 4HX4A 2AO9A 4CGZA 2P81A 2M3AA 2TDXA 1F43A 3F9KA 2H27A 4XRSA 4IZZA 1GLNA 2CUZA 1VFCA 4I02A 1ZKGA 4Y3OA 2Y9ZA 2ZXWH 2WAFA 2HZDA 3ABMH 4YRVA 4D7MA 2LY9A 2L9NA 3DEUA 4E7ZA 3A03A 1IN8A 5JFRA 2NS0A 4PDKA 2ZFUA 4IJAA 5EJCA 2EJRA 3SQNA 1DUXC 2VXDA 2M4GA 4UV8A 1I3AA 2XC7A 3I56I 3V7CA 4A3FJ 2XPUA 1IJWC 4ZYDA 1FBUA 1A04A 1TWHJ 2VT3A 3T8RA 4AWXB 3HC7A 3NQOA 3A01A 4A6DA 1U0JA 3D0SA 4PFPA 1TQMA 2L7MP 3OMYA 1BBYA 3IKTA 4BE1A 4A3BJ 2FSWA 2IA2A 5LHIA 2GOXB 4LITA 3FXQA 1GT0C 2O5RA 4NNJA 2YU9J 4I2OA 3QRFF 3RKWA 4KA4A 1E3OC 3D5LA 2LG4A 2ZB9A 5CVRA 3RKQA 4WX9A 1QZEA 5KAFC 4ZZLA 1I39A 4KMFA 4BQQA 1ETKA 3J7YJ 3CF2A 3T1BA 4Q4ZF 2KQRA 2OF7A 3K6GA 1T2KA 1J09A 2DA3A 3A2KA 5TRDA 3K4LA 2ZNZA 1SVMA 4GYGA 2HVRA 3MZHA 3WU2C 4CA0A 2XAJA 2H6BA 1ITYA 1HLVA 3BJOA 3FMSA 3KP6A 4BHCA 4BE2A 1GUUA 4CZCA 1UHWA 2DPDA 1K7AA 5CLSA 4BE0A 2IS2A 1HW5A 1MH3A 4M3FA 4AD9A 1JKRC 2E36A 3G71I 2ZXHA 5FB2A 2F5DA 1D0ZA 2F4MB 1ETWA 2OCEA 3LSJA 1FYMA 3ZPLA 2P5KA 2H8RA 3CUOA 2KIMA 1VQ4I 1R9TJ 4UVAA 1NH3A 3NEUA 4XKBA 3PO3J 4Q5SF 5D8KB 4DYRA 5JI6A 2R0QC 2DJNA 4M6VA 2QWWA 5IOYA 5DUKA 2IGOA 4CCOA 1DPRA 2ID3A 5CQEA 1V55H 4F93B 3C1DA 1TWCJ 2H09A 5GPAA 1VQ9I 2EA2A 3K9TA 3EUHA 3CCSI 4A3EJ 2IS1A 2JUCA 4XNFA 3G6EI 3TOAA 1IRZA 2BZTA 4AYBA 3GX4X 4GYIA 1IUYA 2Y48A 4Y7NJ 2MA3A 5IOZA 2ZJQF 2EZLA 2W25A 5J8FA 4XOPA 2QVOA 4MHGA 4KN4X 1N25A 4MQVA 4PJMA 2Q8KA 1AHDP 1R5GA 2HQAA 1KU7A 5DM7F 5ICGA 2NVQJ 4AVPA 3DV8A 1G3WA 2ECBA 4OU0A 4PK4A 3A4CA 3HJEA 2DXIA 2IS4A 1FOKA 1RC9A 5FFZA 2WB1N 5C3EJ 3OV8A 2JSPA 3J80Z 2EB7A 1UG0A 4ZYGA 2EIMH 3B6AA 4AIJA 2K86A 2D45A 2NRAC 4ZDOA 1KYZA 2X48A 2VE8A 2RN7A 2BE5F 3ZQFA 2W7NA 4C3IJ 2XGCA 1YJ9I 1MZBA 4A3KJ 5D5XB 5C44J 3J7AY 3HB9A 2CW8A 3AG4H 4YEJA 2K9QA 1YRNA 2O0YA 2R7QA 1WPKA 2Q2EA 1NHAA 3MKYB 1Z3XA 4RLQA 1T56A 3X2QH 2G9WA 3CCLI 2VONA 3BG3A 3D1NI 2VIXA 3OSFA 3PO2J 1IZ1A 4B1RA 1NG7A 3OYHA 2R5YB 3I71A 4JK1X 1HW1A 3LAJA 2IRFG 4BAYA 1D0YA 3CQZJ 4IQ4A 3KP4A 1Y8RB 3N4MA 4Q48A 1LDDA 2ECCA 2Z99A 2OAZA 1IAWA 3CCMI 4E7IA 3GTKJ 2FBHA 1LKXA 2EA4A 2QQ8A 2X1CA 4NB5A 5H6QA 3FXUA 2IPQX 2QSGX 3F23A 2KP6A 4JBAA 1BW6A 1YG2A 2M0CA 3DPTA 4DIQA 2XROA 1DU6A 2K3FA 1PDNC 4ETSA 5FD5A 1G6NA 2V6CA 2KPMA 3BG6A 5CKTA 3CJNA 1PUFA 1NK2P 4L5IA 3BOQA 3L2QA 2LC2A 3RSNA 1MJBA 2XKPA 1TT5B 1PJRA 2QQ9A 3VB2A 2L5QA 3H1CA 2QENA 1R22A 1QQIA 1Y1VJ 1HKQA 3RI4A 3QPTA 3F0CA 3QODA 1ETXA 4AIDA 5J4YA 4FCYA 2F4OB 5E3OA 2K85A 3NARA 2MD5A 3DU6A 2KL4A 1WWXA 1P7IA 1R6RA 4EGYA 3JRDA 3CCVI 3LA7A 4M3GA 3DBHB 4QLCU 1XX5A 3ERED 3OSGA 4LD5A 1JUMA 3L2VA 1E2XA 2QKMB 2K27A 2GZWA 3TO7A 3B73A 1MMNA 1IDYA 3C2BA 4D0PA 4EATA 2ME0A 4CO8A 3HPHA 3BJAA 3O8HA 1KU2A 5TISC 2CQ7A 2XAHA 2FOWA 3P9IA 4HX7A 3C7JA 4EVIA 4A3DJ 2VBXA 2FXAA 2KHMA 3S15J 1TW2A 3A0HC 2XAQA 4XK4A 3R60A 5HODA 4KIBA 1KONA 2VLAA 1XD7A 2E5ZA 2HPIA 2XGEA 5KCMA 3OS0A 4HG2A 3HSFA 3OOPA 1X1CA 3U1DA 2HXOA 5C4XJ 4QPOA 4UUTA 2LR8A 5BQTA 3D5RC 9ANTA 1RUNA 4N9IA 5KVRA 3DBLB 4LLLA 1PP7U 3TBIA 2E2HJ 2AXTC 2VPRA 3F8BA 4YIFA 3HUGB 1SD7A 3BTLA 3VODA 2KIFA 5IT3A 3LMMA 4KFCA 1FIAA 4KIGA 1MH4A 1RKTA 3VOEA 5E3LA 2K9SA 4N4NB 1BJAA 2PJRB 1SD4A 1W7PB 2HYJA 2P6TA 4S04A 1I1GA 3IWFA 1R4NB 4HF0A 2CV1A 3BR1A 5K7HA 1FIPA 4R8HA 2X1DA 3PIOF 1Z0XA 3GFLA 2CGPA 2VODA 3I59A 1W5SA 3J80K 1U2WA 5LGTA 2NNYA 3DBRB 3L2UA 1V5GA 3AG3H 3K4NA 4ZYAA 2VPLA 4WCGA 1LE8A 1ZRFA 3OIPA 3JAMZ 2IS6A 5EG0A 1R4MB 3MZ8A 4F55A 1IO2A 2BHYA 4OAYA 4D5FA 2X9DA 3HKZN 3UKGA 2AQEA 1ZLKA 2MG4A 1G3TA 4KISA 1ZRCA 2VKEA 2VKDA 3M1CA 4ZTJA 3Q3SA 3ZQ7A 1U8BA 4BJTA 1FSHA 1TWFJ 1KYWA 5L3DA 5CVUA 4P9FA 2FMYA 2FUG2 3KZYA 4IX7A 1TQIA 2LF8A 4M9ZA 4RM3A 4L18B 1IW7F 4A3GJ 3HOYJ 1KU9A 2E1MC 1B72A 1EKEA 4NUBA 1J0RA 3BR0A 4QTRA 1X2MA 1VQPI 1ONVA 3DFGA 1S5LC 2X6WA 2CQXA 2MBFA 2DA1A 1IN5A 1LB2A 2JQ7A 4MTEA 1EF4A 2HOTA 1Y0UA 3TW6A 3WG9A 1ERDA 4C3HJ 3A0BC 3BJ6A 2M30A 2OZUA 3H3ZA 2VBZA 3IRQA 1REPC 2EWNA 2MSYA 3DTKA 5AIQA 2OQRA 1FX7A 2QBYB 5E20A 1XGSA 1JT6A 3ZMSA 5D5WB 5FLXZ 4I0AA 5HS9A 2QSHX 4A0ZA 2Z5UA 4BXFA 3WODF 4RB2C 3CDLA 3IV5A 3HL2A 4XONA 1WJCA 3OYBA 1JT0A 3QYFA 3TO9A 4WXHA 3FXRA 4IO9F 5B66C 3CJRB 1DQUA 1W1WE 3R6SA 3MVPA 2Z3YA 3V4GA 4E7LA 1LJ9A 5H20A 2CQKA 1BOAA 1QVTA 4BUPA 1AU7A 1TLHB 3ELKA 3BPXA 1LVKA 3FISA 4G7ZF 4CDGA 2CJJA 2FQ3A 3WGHA 2EH3A 2E1CA 1ORKA 4UY8I 2OBPA 4BBSJ 3IH2A 2WBMA 5JLXA 3PNTA 3LSHA 3K1MA 3JSPA 1HXDA 1LUJB 4BJ6C 3SZGA 4GO1A 3ASOH 3VYSB 1K6OA 3P9KA 3LAPA 1FYLA 5J47A 3AL0B 1BIBA 4MFDA 5CJ9A 4S05A 3MN2A 2V7FA 3BR6A 2Y75A 3S32A 2K7LA 2XVCA 4XOTA 1X3UA 4FQGA 2A3SA 5K5QA 1H89C 1DP3A 2VI6A 2VT2A 1WGXA 1D8JA 1QO0D 3RPUA 2B7EA 3FMQA 3G4SI 4ZZDA 2WAQN 3H36A 1D1BA 3LA2A 3LNQA 5ILSA 3M4OJ 5D5UB 1WJBA 1KGSA 4OMZA 2LYCA 3LSKA 1EH6A 2EIJH 3FM5A 4EJWA 5FLVA 1RPWA 4RBOA 3JTHA 1U78A 1HA8A 4IHTA 2X4HA 2COMA 4XKCA 4HLXA 3HHGA 5LRSA 2L2OA 2FEZA 4U7DA 4ZTFA 1ZR2A 1IV6A 4HX8A 1ON1A 1Z7UA 1WVRA 3E97A 3PQJA 1SEUA 1JGGA 1O57A 3TEDA 1I5ZA 3OYKA 4AUXA 5J1YA 2FOKA 1X1DA 2WADA 3SFZA 4HLYA 1YS6A 3OL4A 3I58A 3PFIA 2OA4A 3ROUA 3L2RA 2HPMA 2X0LA 4XMYA 5CVVA 4Z6YA 1FJLA 4LLGF 2JA8J 3GZNB 3OYAA 2JPBA 1CQTA 4LIUA 1CF7B 1VZ0A 1R1VA 2LKPA 3E6MA 4HV6A 4B4CA 3GXOA 2XSDC 1O4XA 2VASA 5F04A 2QA4I 1W36C 3QPHA 2JZYA 3W2AA 2ZMEC 2V1XA 3LFKA 1YX3A 2A07F 5EZGA 1VNDA 5JVTA 2BY1A 3DQVC 2GIZA 3MMYB 2LKSA 4C9YA 2NOJB 2OQGA 3JAMK 3H35A 4DOZA 2R3SA 3CUQB 2KMUA 1TP4A 1MBJA 3IHUA 4ESFA 4B3XA 1P92A 3VEPA 2OTLI 2R5ZB 1FY7A 3L7WA 1ULYA 1P2FA 3BTIA 4ENJA 1PVEA 3ECHA 3GW2A 2E19A 4CICA 2DK8A 2BVLA 2HQNA 4M3BA 1T95A 5EYRA 2M7AA 3BT9A 4KMUX 3ZCOA 4D5CA 2DDBA 2DMPA 3AG1H 1H8AC 2H6CA 1OCZH 3FXLA 1WRJA 3CZ6A 4KN7X 4Y13A 3L9FA 2P7CB 1T38A 1BR2A 1BW5A 1WJFA 1JKOC 1USSA 2BV6A 5DD8A 1SD5A 3MEXA 2HDWA 3WTTC 4HRIA 2R7VA 4B44A 1SVOA 3F3XA 1E3HA 2R93J 2PI0A 3U21A 1KZHA 1ETQA 2M2EA 1O3QA 3S1MJ 1T39A 5LHHA 1D1CA 3CP8A 4L9TA 4GDFA 2VOPA 1XMKA 5F08A 2AQFA 3FM3A 2XASA 3KLNA 4G6DA 4OAZA 2R7XA 1D5YA 4PZJA 5BNGA 2WB1A 2DOFA 1ODDA 5FLXK 2J5PA 3DLAA 5JHUA 4BDYA 3H9QA 3RZDJ 4LLNA 2DU9A 5GAHJ 2JTVA 2RREA 3V42A 4YFKF 4MEYF 4KITB 2ACJA 1WI3A 3M07A 5F1JA 3OIOA 1S72I 2HVQA 4PJLA 5DTDA 2RNJA 1T6SA 5KK1A 5GP9A 2K4JA 2M7BA 2KT0A 4BQNA 3DU5A 5E1XA 2KIUA 4A2UA 1KQ8A 2IW5A 3VYUB 2LF7A 5E3NA 3E3VA 2E1NA 2OC6A 2ICWG 4X0GA 5M5YJ 3WHBA 3LQQA 3COAC 3DP7A 5J40A 1BOBA 3DTEA 3HGYA 5E18F 3GEZA 3QYBA 1O3SA 5L3BA 5HLIA 5FRNA 3IP4B 2E60A 3J7AO 1BR4A 1OJLA 3GF2A 1T08B 4DNCA 3C2GA 3DTIA 3C2HA 5H2FC 2KIQA 4MFEA 2M45A 1YITI 2MYSA 4FASD 2DTZA 2QSFX 2FMLA 2K9LA 4BBRJ 2VQHA 2Y0SN 1HBXG 3M3YJ 1Y6IA 4AM3A 4G7OF 1JKQC 3G2BA 2ZMEA 3W6VA 4JOMA 1Z05A 5FKKA 2VOOA 1QBJA 1MMAA 1YW7A 5IT9Z 1ENHA 4A0XA 1YX5A 4XBFA 4BHPA 2EFOA 2VL8A 4MQ9F 2LOOA 2A61A 1RRJA 4JX5A 1TL8A 2VKHA 3ZQLA 1S6LA 5LD2C 1S7AA 3RDIA 1XTAA 1FOWA 4OIOF 3GUDA 2KJCA 3S3NA 3T5XA 2A6TA 3ZQIA 2NYXA 3RCOA 3TOBA 1U9NA 4GRIA 1MJAA 2DBBA 3IH3A 2QEXI 1AKHB 5GAGJ 2MGQA 4LG3A 1WH7A 1QRYA 1JKPC 2A69F 5ICCA 2V79A 4AU7A 1W0UA 1LFUP 4A3CJ 1R5HA 4Y52J 1KQ0A 4H0EA 4F7ZA 4X1EA 2MW8A 2RQQA 5BPDA 3TDUC 5LHGA 1W5TA 2EFQA 3EETA 3LSIA 2R5YA 3RPQA 5D4RA 2H1LA 1X19A 4IHVA 3J7ZI 2W82A 2M87A 1OPCA 3KZIC 2DA5A 1SANA 1BI1A 1HW2A 1XSVA 3E7LA 2XKOA 1H9GA 5FKMA 1L0OC 3LSMA 3LSRA 4QPQA 4HA8A 1LFBA 2CUFA 3VSLA 3WU0A 3WTZA 1J59A 3KYCB 3QU3A 3SDGA 1MMGA 2I5UA 3HXLA 2B63J 5ILUA 4OIQF 1YOVB 2Y0MA 2P5LC 3H3VK 1WJ5A 3Q0VA 1UJ8A 1HSJA 1UHMA 3BDDA 4F3QA 2DOEA 2LVSA 1S7EA 3JRAA 4ENKA 5BPIA 5D6EA 1DU0A 2K5CA 2ZXIA 2W57A 4PGHA 3V7SA 1NG6A 3OY9A 3GTJJ 5DV5A 1RNLA 4UNOA 2E35A 2VQCA 3P7NA 1GXQA 2YSRA 2GLOA 2CW0F 4J19A 4QWQA 4RMNA 2G0EA 5EZHA 5F27A 4CYCA 4O6JA 4RGRA 4B48A 3NAUA 3JRIA 2O61A 4K2EA 4E6KG 3I4NJ 1FEXA 3PL8A 4ENMA 4RGSA 1ZN2A 2O6GE 2D1VA 4G94A 2OZ6A 1OCOH 2VJIA 3PFYA 4HOBA 1XPXA 2KRHA 2KKOA 2BBYA 5BOXA 4U0YA 4UVCA 4ZYHA 1WHUA 2AHQA 3CD6I 2LK2A 2R7DA 1JJ6C 2UXXA 2R92J 1LPQA 1MNEA 2HEOA 1RR7A 2ZMEB 3WGIA 2AXLA 2WC2A 4PUSA 3U2RA 2LKXA 1MBFA 2XF5A 4HNUA 5DUIA 4S0HB 2E2IJ 1A31A 1OCRH 1Y1WJ 1OMIA 2XAFA 2NOGA 5D8LB 4G6TB 3BTCA 2Z2SB 1HC8A 3MWMA 3H5RA 1GVDA 2HU9A 4GCVA 3CC7I 3HUGA 3RKYA 2XAGA 1D8KA 1ZG3A 2BY0A 3GZ5A 1MIJA 1QGPA 4B8XA 2VC1A 1R1TA 3AL0C 1SFXA 3RQIA 1W7PA 2PJRA 1FZPB 4XLNF 4UV9A 1JUPA 3DPUA 2KZVA 2ELHA 5LGNA 2WV0A 3IL2A 4IOAF 4BU2A 1FMVA 1JHFA 2KRFA 4YELA 5IT9K 3CCUI 1GVJA 2KJBA 4UXNA 4EQQA 4IF4A 3S17J 2OD5A 3B02A 4L0ZB 3CESA 3FXKA 4LJZF 3G3ZA 1FOYA 2IGMA 3KP7A 1SFUA 3W2VA 2JA7J 3K1NA 1I27A 3DEEA 3F8NA 3M8FA 3HYIA 4FE4A 4GGGA 1VQMI 1TWGJ 1YIJI 1IDZA 1I6HJ 2GXGA 2V1DA 1LNWA 1IG7A 4IOCF 4U87A 2NXNB 1QZYA 4M9XA 4XRSG 5IPAA 1I1SA 3I5UA 1U6GA 2DT5A 1O7LA 4A0YA 2UXNA 2DFHA 4RGXA 2DMQA 3CP2A 3HGGA 1ZYRF 4FX4A 4HQMA 4KYWA 2DODA 4BDZA 1I3QJ 3JSOA 2MFZA 4DBRA 4A6EA 1SFOJ 4IPAA 1STZA 1YYVA 2YX4A 2A05A 1MMSA 2M9HA 1X58A 2DFFA 3RJPA 4BXUA 1Z6RA 5E1WA 4II3A 1H9TA 1YTYA 3KP3A 2A6HF 1HKTA 1IN7A 2JPCA 2WAQA 4CCMA 4ESJA 2QBYA 1X2NA 3CUQC 3O6BB 4NC8A 4CYCB 1OFCX 3LSTA 2CUJA 3D5SC 2HXIA 3CMMA 2EFWA 5HLTA 4XM3A 5F64A 2DO7A 3R61A 4HAMA 1FBQA 1SFKA 1AA7A 1J9IA 1MBEA 5HS8A 2QUFA 4ENNA 4C2MJ 5GTIC 3OYMA 5L3CA 2NS7A 2KDZA 2NVTJ 4D9JA 5J1UA 3DWLE 3HSRA 4LK0F 2V6EA 5CPRB 2UWMA 1SAUA 2EFNA 4KIFA 1BIAA 2A5WA 1IXSB 3N97A 1UAAA 4RAZA 4MLOA 3C3WA 3HOZJ 3G1OA 3KETA 2RGVA 3ZQQA 5FKNA 2QKLB 5DCFA 2COBA 2HI3A 4L5EA 1MNDA 3CO7C 5ILVA 3QPLA 2CRGA 4KDPA 2JA2A 1C0WA 1R5ID 4ZJZA 3GTOJ 3H5AA 4DJAA 2PFBA 4F92B 1OQYA 1Q1VA 4HZFA 2BY2A 1QHGA 1YHQI 4AC0A 2VQGA 1PP8F 5IP6A 4M72A 3FBNB 1LVAA 3K70C 3VWBA 2F5CA 5KNLA 3AKZA 1K78B 3CJQB 2JUGA 3PSFA 1ETVA 1VQ7I 4FTHA 4NDLA 4A69C 4LMYA 2HGCA 1XMXA 1UB9A 3ZR8X 1MDMA 3DKXA 3EYYA 1Y8QB 2JVGA 3WE2A 2CO5A 2X6YA 1WJEA 4YFXF 4I6ZA 1W0TA 3IAM2 2HFHA 1GXPA 2Y69H 3PUFA 3PNVA 1A35A 2VJJA 4ESBA 3HBLA 3GTGJ 3HG9A 3JRBA 2E7XA 1D3YA 2EV6A 5L3EA 1CF7A 4BACA 3HOSA 3C18A 2W84A 1R23A 1ETOA 3ABLH 1KU3A 4CHUA 1Y39A 4M6YA 3HRTA 3DCFA 4V2FA 1BC7C 2WY8Q 3IKVA 3P5JA 3CUQA 1RETA 2VB6A 2IA0A 4KICA 3OR2C 3FXOA 2R5ZA 4N0BA 2L3DA 1QVUA 3I54A 3K4CA 3S16J 3H0DA 4MEXF 2R7OA 1VQ8I 3BG5A 5JR3A 3OL3A 1TC3C 3H3UA 3EUAA 2VBWA 2X51A 4BGDA 2F2EA 3WTUC 3Q0UA 2O8XA 5FRMA 4XL9A 2FX0A 1TBXA 2K4BA 1N77A 4R79A 1JTXA 3FIWA 2CMPA 1B1BA 2XRLA 3G73A 2HNHA 2EIKH 2F5EA 1HDDC 3IRRA 5D6FA 1XGNA 4I09A 1ZH5A 1IRXA 3FWEA 5IYCJ 2FBKA 3F6VA 1RR8C 2L7KA 2DFEA 1QZZA 1XC5A 1GHCA 2Y0SA 4EJVA 4A5NA 1HKSA 5HDKA 4EM1A 4MNUA 4UUSB 4XN3A 2Y2ZA 3S8PA 3BROA 2XUBA 1V4RA 2UV1A 3ZRGA 4ABZA 4IHSA 3LQRA 3GTLJ 2JN6A 4LK1F 2ISZA 1VQKI 3CC4I 3F72A 2WA0A 2HR3A 4BKXA 4ON0A 2QF7A 2NAZA 2LBFB 2HQ5A 2M4KA 1B8IA 5FLMJ 4V2GA 3TQNA 3VPRA 2DK5A 4HYEA 4MGRA 4XR6A 1O7FA 2PJPA 4NQWB 1XSDA 2ZJPF 2RKHA 4BEHB 1VQ6I 3F22A 4BY7J 1XDSA 3S1RJ 2HYFA 4I01A 2DA4A 2PMUA 3I3LA 4JYKA 5A2QZ 3U9GA 1J5YA 2Z16A 3Q9SA 4E4HA 2IA1A 1OYYA 3HPGA 5DM6F 2HKOA 4I7HA 5ED4A 3BG7A 3KYLA 3TP0A 4E7SA 3OYDA 2LP0A 2EZIA 3PJRA 3S1QJ 3RYRA 4M71A 4XLEA 4FT8A 1MDMB 2QGUA 2QQAA 3KEOA 4P5OA 3EUKL 2O9LA 3QOEA 2DTRA 1EA3A 1WJAA 1B9NA 1Z9CA 3K10A 4G8XA 3ASNH 5IYBJ 2XDVA 3VFZA 3TKYA 4U0VA 4BQOA 2YU3A 4GFBA 4I99C 4D7NA 2VE9A 6PAXA 3B6CA 3ZMUA 1E17A 3I55I 2Y31A 2ZSIB 1YO5C 1GDTA 4UB6C 3SDBA 3ZXSA 1A6QA 1D5VA 1KA8A 3CDHA 2HQRA 3PIPF 2IEKA 3OR1C 2H1KA 1SMYF 4IHWA 5M5XJ 1IXRC 5CVJA 3RQ4A 5K1YA 4BXXJ 4RS8A 4OWRB 3RPUD 1UMQA 4RB1A 5KHDA 2JRTA 4XICA 1K4TA 5LEKA 1Z67A 4Q47A 3SFIA 2CV2A 2O7OA 2LFBA 2WY7Q 2YS9A 2HZTA 4KT5C 1AKHA 1PUEE 3PQKA 4CH7A 1B6AA 1J75A 2CFXA 2L9SA 5TGTA 3ABTA 2Z1DA 3CLQA 3WGGA 1QNTA 2CFOA 2HWVA 5FD6A 5ERIA 1DGWY 2VC0A 4HSTA 1K83J 2KLOA 2XPWA 3JR9A 1G3YA 4EJOA 5J4VA 2LRDA 4P55A 4HNVA 2ZJ2A 3OOUA 1ZG1A 5AONA 4EJUA 1VQNI 2ESHA 5HDNA 3OYNA 4EJTA 4BL0B 4BHBA 3HTSB 5EEGA 1FWZA 4WWCA 3CCYA 1XN7A 2P6SA 3G1MA 4EGZA 3UNGC 5LRRA 2YR2A 4ZYEA 4HV5A 4M9SA 2X85A 2ELKA 2P5VA 3HRMA 3S1NJ 1Z7LA 1ZELA 3DKYA 3I64A 5HS7A 2JJ7A 1X4PA 1HSTA 4II2A 3V7RA 1SC7A 1ZK8A 2PBIA 2XPVA 4KNYA 1HDPA 1R7JA 4Y4RA 5DD4A 3LA3A 3K4JA 1E3PA 1MJ9A 4XLPF 2Y9YA 5ICEA 3GFJA 2M34A 3WU1B 1TQPA 1POGA 4RAFA 1IUFA 2KZGA 3JREA 1FOXA 3ZP5A 1FTTA 3ZMVA 3PNYA 1VQLI 4KT6A 1K6YA 2BHZA 3GZ6A 1T98A 2M8EA 4I0BA 3V8LA 4AIKA 1FP2A 3KEYA 1FLIA 2E2JJ 2N8GA 1I50J 4FISA 4OIRF 4ZH4F 4LG0A 1UFMA 5AIPA 3KYDB 4CUGA 2LY1A 2QCOA 2QM3A 1Y56A 3DXJF 1FP1D 3K1PA 3SJMA 1S8NA 4WXDA 2R7WA 4XLAA 4BS9A 1BC8C 3CCJI 4E7JA 1MKMA 1FMWA 3R4KA 5B1AH 4ZC3A 1O3TA 3BC8A 1KQ9A 3KEQA 5F0CA 5J3LA 5HDGA 3IH4A 4C2UA 1K4SA 5EEHA 3FX3A 2GWRA 2B0LA 3GTQJ 2EZKA 2Q1ZB 3OWTA 3ZGKA 3MKZA 4E7KA 3QAHA 3CO6C 3HOUJ 1EJ9A 4XRMA 5A2QK 3M8JA 3LL7A 2HTSA 3W6KB 2G7UA 1JGSA 2EK5A 2ADUA 4CCKA 2RDPA 1B8IB 1XCBA 3P9CA 3SYTA 2L54A 1DP7P 3JRFA 2EV0A 2DW4A 4AVZA 2BVMA 2I8DA 4IHXA 3IC7A 1Z3YA 3FZVA 5B5EC 5LFAA 3EUHC 2BW3B 2L7FP 5K7FA 2W4SA 3T8TA 3HIFA 1UHSA 1FYKA 4PFOA 2YX7A 4D1QA 3CLOA 5FKLA 3ABKH 1YIOA 2STWA 3OYEA 1BI3A 1BA5A 3S3MA 3ZMZA 3BCBA 2C6YA 4RAGA 4M3EA 1RI7A 1IN4A 1H88C 4PJ0C 1D0XA 3K2ZA 4IRIA 2KDOA 2P0WA 1FNNA 3L00A 2HDCA 2YPRA 1L3LA 4MO7A 1MBGA 2XB5A 5H6RA 1T0FC 4M6XA 5J6XA 5F1RA 2W00A 2XGXA 2GM4A 4L9NA 2R7UA 1APLC 3GTMJ 1I6XA 3FK7A 1W36D 2P7VB 2HVSA 4RDUA 1SD6A 3WHCA 1V5EA 1IC8A 3KCCA 3JCUC 3KX2A 4RGUA 2M5WA 2CQQA 3E1SA 3QYEA 1J7KA 4DYQA 2DMTA 4G7HF 3FHZA 2FRHA 1XG1A 3L2WA 3NRVA 2HOEA 1JI8A 2GBYA 5DCMA 2HYGD 3RTRA 1V3FA 4XIDA 4HDUA 1VQ5I 1G8XA 3ZOBA 3BPVA 4B3AA 3K4KA 2OCCH 4PSWA 2BGCA 3EQLF 3WTWC 1U5TC 4U88A 4RA2A 2NVUB 1IXCA 3LSGA 2WAEA 2IBDA 4XORA 1S7OA 1V54H 2L9VA 3CCEI 3FXJA 3TW7A 1MBKA 2I10A 3GMEA 4DQ2A 1XGMA 2ZKZA 2OJED 3F6OA 2VN2A 4ANJA 3VYRB 3MKLA 4EM0B 2V1NA 5GAEJ 3Q5FA 1W4MA 3HRSA 2A6EF 2H94A 1Z91A 1IV8A 1LFPA 2W1OA 4YG2F 1AWCA 3Q0WA 1SFEA 3I4PA 4XLFA 3CC2I 4DZJA 4XRFA 4J00A 3FXMA 4LG0B 3R0JA 5EDNA 5E1ZB 2EBIA 3HTUA 2ZJRF 3FF5A 4X6AJ 3S3OA 2QYOA 4ITVA 3HZJA 4CCJA 3ZMDA 3HHHA 1XSXA 2GAUA 3FMRA 2CQNA 5FJ8J 2PMZN 2O3FA 2DAOA 3FHNA 4C2TA 1ZGWA 1YQAA 2CWEA 4W97A 2GIVA 3RYPA 2STTA 2RNGA 1V5FA 3HKZA 3VDXA 3CMYA 5L3FA 1YW8A 1LQ1A 4V19K 2IGNA 1EH7A 2HTJA 3L09A 3F21A 3TP3A 2JRMA 1FPQA 5LGUA 3GTPJ 3SHFA 2V1UA 3N05A 2FD5A 3HSEA 2K9NA 2VKVA 3IUOA 4IRHA 2X6XA 3E6BA 1G4DA 3ULQB 4CCNA 2KFDA 2X6OA 2G7HA 3IWZA 3E5XA 1R36A 1MMDA 3S93A 4QSHA 4HW0A 1X1BA 1MNMC 3QP5A 1R1UA 1F1ZA 2DI3A 2EQRA 1Z21A 2P4WA 3FDYA 3GLLA 3M9AA 4CSWA 3LFUA 1QU3A 2ZSHB 2ID6A 2VBYA 4U0WA 1UCRA 3I4MJ 4YFNF 5FFXA 3PSIA 3MKWB 4RB0A 5C4JJ 4IHYA 4IQJA 1GV5A 3CMEI 3NWTA 3BWGA 3WE3A 4C3JJ 2R7ZJ 4A93J 1T0FA 1T33A 2W85A 4U7BA 4JX4A 4Y33A 4HF1A 4A3LJ 1YE9A 1K78A 3OS2A 2DA2A 1A36A 2FE3A 5K5RA 1G2HA 4XLCA 4RB3C 1Y0NA 4DYCA 5K5OA 3M7GA 2CG4A 1P4WA 2ETHA 2GQQA 4A12A 1WH5A 2CW7A 1K61A 4O3MA 2L01A 3ERMA 3FKJA 4LFUA 4W1UA 4B43A 4HNTA 4MIMA 4N9HA 4EV0A 4UHTA 5GTHC 1YI2I 3SXYA 4F52A 3CMAI 3DEWA 4BNCA 2F48A 2PG4A 4PSXA 1LDJA 3CJTB 1MGTA 2XV4S 5JHFA 1XGOA 3HOXJ 4HQEA 3GFMA 1MSEC 3EDPA 1ZARA 2Q0OA 3MFKA 2WV1A 2RV8A 1YJNI 2RAEA 1F9NA 1ETYA 1U5TA 3A01B 1QPIA 2VXZA 3ABUA 2JMWA 4EEFG 2GA2A 2OV7A 2FU4A 1JJ8C 3KLOA 3S2HJ 4Z2YA 2PLYA 5DCMB 2XF7A 2YUSA 1VQOI 3QP6A 4L5JA 2PN6A 4DW6A 3L1PA 1SAXA 3RIRA 4XKWA 3CTAA 1W7PD 5M3MJ 2R7SA 3BQYA 2L02A 1RZ4A 4C30A 5DS9A 2MH9A 3ZQCA 1BL0A 5EEAA 3H0GJ 3BTJA 5GPCA 1WKMA 4DBQA 3JRHA 1BN5A 1N78A 1IRGA 4J01A 3Q9VA 3K4BA 5D4SA 4M74A 2CV0A 2XSJC 2JT1A 1OYIA 3K2AA 2O03A 1IRFA 1VTNC 1P7JA 5GADJ 2JSCA 3S2WA 2DN0A 1ON2A 5CQGA 3CF5F 3K0LA 1ZREA 5HNFA 1X3WB 3I9V2 5E17F 2V4JC 3OYJA 3TMOA 3VSKA 3WG7H 3BZ6A 3ISPA 5DEQA 4IXAA 1HF0A 4FHTA 4ASNA 3KPHA 1ZGJA 3AFHA 4HSRA 2GOMA 2AS5F 1HOMA 2DYRH 3TL4X 2PEXA 3GWZA 3RZOJ 2F5FA 4DGWB 3TGNA 5B3SH 1JUSA 3A02A 2CUEA 1G59A 4UUSA 4EMSA 3BR2A 2D1HA 4JQFA 2DA7A 3HOVJ 1G3SA 1ZG5A 5LBQA 2LLKA 4CZZA 1OR7C 2DLLA 3QPSA 5CVIA 1ZLJA 2IVMA 4R1HA 4BYYA 3ONQA 3S14J 2ZCWA 3LSPA 5FO5A 2LBFA 3HDDA 1O3RA 4LB5A 2PMHA 1Z6TA 4BJ5C 2MC4A 3GBGA 4NQWA 1Q1HA 3F8MA 4BEHA 2EFPA 3ZN0A 3M1EA 4EM2A 2V9VA 3TO6A 1UELB 3NWSA 4KUMA 4FE7A 5LLQA 3V8KA 2W24A 1TNSA 4M3DA 1OCPA 3MCZA 4FX0A 5BMZA 2D5VA 3F8CA 2L9RA 3GVAA 4A3IJ 3WTSC 1RIOH 2J5OA 3GO5A 1R58A 3T0YA 3ECOA 2E7WA 5E8IA 3HOTA 2LNBA 3O3KA 2H8WA 1F36A 3G1LA 3VYTB 3L2CA 3I53A 2ZXJA 2L7ZA 3PM1A 4A3JJ 2ZFWA 2PX9A 3KP5A 1DDNA 2VJ4A 2FQ4A 2RQPA 2CH0A 1Z77A 4IL6C 1JTYA 2RVCA 4AIHA 4BQAA 4I98B 4RAYA 2DJIA 1YRNB 3BR3A 1X4OA 2Q2EB 4ZDPA 2L4MA 2E71A 3OS1A 1R49A 1X1PA 2NS8A 2DMNA 2UZKA 4NBQA 4PJJA 4P1WA 2DQLA 4F91B 1XS9A 5B1BH 1BI0A 1U5TB 4PJNA 2L4AA 1ACIA 2HKXA 1YFHA 5J1RA 1RUOA 2EZHA 3M8EA 1OKRA 4FETA 1UZCA 2LSOA 2QZ8A 1FBSA 4AYBN 1U3EM 2BOLA 2K9MA 1B59A 3ESWB 1P4XA 2ZBKA 4CXFA 4OINF 3U1KA 1ZGAA 2IAIA 1P9QC 3E5UA 1DGRM 2FF4A 4TV7A 2NNNA 3K7AJ 4XQFA 1J2XA 3JTGA 2FBIA 1IF1A 4XSZF 4N4OB 3MAJA 2OUMA 3I0TA 1A5JA 4HPQA 3JW4A 1D1AA 2LDUA 2HDDA 4M73A 5E79C 2KISA 5HLGA 4WK8F 2DT7B 3E6CC 4XKVA 3H92A 4LB6B 2JA5J 2NVXJ 5IP7J 4G9YA 5F6FA 1WCMJ 3HRUA 4IVNA 3QOPA 5HVQC 1CGPA 1PUFB 3E6DA 2DMUA 3EYIA 2MABA 3OIQA 3V8JA 3CCRI 5LEJA 2Z33A 3BLYA 1EV7A 4P96A 5CYVA 1E0EA 5DDGA 2JVHA 2KRCA 2XF6A 1QHHD 3KP2A 2JWTA 1XCVA 1JXSA 1OR7A 3FBIB 1OISA 1B9MA 2BY3A 2O8KA 2V9PA 3EPZA 1FTZA 2MLGA 3J81Z 1RESA 2FJ1A 2X1EA 4H4KC 2DFIA 1T8IA 1RKWA 1MW7A 4QIWN 2E34A 2XHKA 2IP2A 3S2DJ 2MC3A 2OU2A 3W2WA 1FT9A 1MD0A 2D2WA 3QWLA 3HOWJ 3O8GA 2F4IA 1YJWI 4OMYA 3ZQHA 4E7HA 4IEJA 4L9VA 3TDZC 3BR5A 3AAFA 4XLHA 1HCRA 2GXAA 1XDUA 1ZRDA 3DF8A 1WZ2A 1R71A 4YIRX 1YLFA 1N75A 2F5VA 4NC6A 3RKXA 3O2PE 2QQBA 3CDIA 2R4GA 3HEFA 3E0JB 2DOAA 5E8GA 1S3JA 2WWYA 4Y15A 5IYDJ 2MD0A 1JE8A 1S9HA 4XN0A 5EGOA 2V26A 5ICFA 3BZKA 5D5VB 2M0MA 3GCMA 2K02A 1VF9A 4LGWA 5HLHA 1TT0A 1MBHA
chains in the Genus database with same CATH topology
1B4AA 2FNAA 3LWFA 4L9JA 4A5MA 3W6JB 1F4KA 1F5TA 1XMAA 1LEBA 3GYHX 4WXCA 5DYMA 5TJJA 2HS5A 1S29A 1P6RA 4GXOA 1WSUA 2IT0A 4YIIA 4NHJA 3I59B 1IN6A 4CYDA 1TTYA 2RC4A 4P9UA 1OYWA 2DPUA 4HF2A 2ESNA 2Z9OA 2ZO4A 1JHHA 3DKWA 2QLZA 4MTDA 2R7FA 4BH9A 2CYYA 4O5VA 1P4AA 1ZAOA 4HBLA 1TNTA 3MQ0A 1QPMA 2WTEA 2EV5A 3WTXC 1K79A 3ZN1A 1LDKB 2FA5A 1WQ2A 2GXBA 3F8FA 4HDVA 4WF2A 1R00A 1SMTA 1YS7A 3GLXA 4E70A 1FC3A 4B09A 3KZZA 2A5YB 5HOOA 2XIGA 3GFIA 5J8CA 2XRNA 2ISYA 4G6QA 1FSEA 1AOYA 3SZTA 1XB4A 4OIPF 2BYVE 1EH8A 3BY6A 1WI9A 2MH2A 4PGGA 4UUVA 3R0AA 3SZPA 4Y17A 2FNPA 1YW9A 2PQ8A 1USTA 1BM9A 4XSXF 3J81K 2MLKA 3MZYA 2ZNYA 1HQCA 3BP8A 5BS6A 2A68F 5FGMA 3KFWX 3ML6A 4L0YB 3E5QA 1H0MA 3ZMTA 3WTYC 2M1BA 1TW3A 3WTVC 4IRGA 2P8TA 1U8RA 5L3GA 3KE2A 3K69A 1DPUA 3REOA 2IJLA 2DQRA 3QU6A 1BI2A 4OOIA 2GA1A 2BEOA 1LEAA 1Z1DA 1ZHFA 4PCQA 3DPLC 4UVBA 2CSOA 4HX4A 4CGZA 2TDXA 2H27A 4I02A 3DEUA 1IN8A 5JFRA 2NS0A 4PDKA 4IJAA 2EJRA 3SQNA 1DUXC 4UV8A 3V7CA 4ZYDA 1FBUA 1A04A 2VT3A 3T8RA 4AWXB 3NQOA 4A6DA 3D0SA 1TQMA 1BBYA 3IKTA 2FSWA 2IA2A 5LHIA 3FXQA 4I2OA 3QRFF 3RKWA 4KA4A 3D5LA 5CVRA 4WX9A 4ZZLA 4KMFA 4Q4ZF 3T1BA 1T2KA 5TRDA 2ZNZA 4GYGA 3MZHA 2XAJA 2H6BA 3BJOA 3FMSA 3KP6A 4BHCA 2DPDA 1UHWA 1K7AA 5CLSA 1HW5A 4AD9A 5FB2A 2F5DA 1FYMA 3ZPLA 2P5KA 3CUOA 2KIMA 4UVAA 3NEUA 4Q5SF 5D8KB 5JI6A 2QWWA 5DUKA 1DPRA 3C1DA 2H09A 2EA2A 3K9TA 3EUHA 3TOAA 3GX4X 4GYIA 1IUYA 2Y48A 2MA3A 2W25A 5J8FA 4MHGA 2QVOA 4KN4X 4MQVA 2Q8KA 1R5GA 1KU7A 5ICGA 4AVPA 3DV8A 1G3WA 4OU0A 1FOKA 5FFZA 3OV8A 3J80Z 2EB7A 4ZYGA 2D45A 4AIJA 2K86A 2NRAC 1KYZA 2VE8A 2RN7A 2BE5F 1MZBA 5D5XB 2O0YA 2Q2EA 1NHAA 2G9WA 2VONA 1IZ1A 3I71A 4JK1X 1HW1A 3LAJA 2IRFG 4BAYA 3KP4A 3N4MA 4Q48A 1LDDA 2Z99A 2OAZA 1IAWA 2FBHA 2EA4A 4NB5A 5H6QA 3FXUA 2IPQX 3F23A 4JBAA 1YG2A 3DPTA 2XROA 1PDNC 4ETSA 5FD5A 1G6NA 2V6CA 3CJNA 4L5IA 3BOQA 1MJBA 2XKPA 2QQ9A 3VB2A 2QENA 1R22A 1QQIA 1HKQA 3RI4A 3QPTA 2MD5A 1WWXA 4EGYA 3LA7A 4QLCU 3ERED 4LD5A 1E2XA 2K27A 2GZWA 3TO7A 3B73A 4D0PA 4CO8A 3BJAA 1KU2A 2XAHA 3P9IA 4HX7A 3C7JA 4EVIA 2VBXA 2FXAA 1TW2A 2XAQA 3R60A 4KIBA 1XD7A 3HSFA 3OOPA 3U1DA 5BQTA 1RUNA 4N9IA 5KVRA 4LLLA 1PP7U 3F8BA 4YIFA 1SD7A 3VODA 2KIFA 5IT3A 4KFCA 4KIGA 3VOEA 1BJAA 1SD4A 1W7PB 2P6TA 4S04A 1I1GA 3IWFA 4HF0A 4R8HA 3GFLA 2CGPA 2VODA 3I59A 1W5SA 3J80K 1U2WA 5LGTA 2NNYA 4WCGA 1ZRFA 3JAMZ 1ZLKA 1G3TA 1ZRCA 3ZQ7A 1FSHA 1KYWA 5L3DA 5CVUA 4P9FA 2FMYA 3KZYA 1TQIA 2LF8A 4M9ZA 4L18B 1IW7F 1KU9A 1J0RA 1ONVA 3DFGA 2MBFA 1IN5A 1LB2A 4MTEA 1Y0UA 3WG9A 3BJ6A 2M30A 2OZUA 3H3ZA 2VBZA 3IRQA 1REPC 2EWNA 5AIQA 2OQRA 1FX7A 2QBYB 5E20A 1XGSA 3ZMSA 5D5WB 5FLXZ 4I0AA 5HS9A 4A0ZA 2Z5UA 3WODF 4RB2C 3TO9A 4WXHA 3FXRA 3R6SA 2Z3YA 3V4GA 1LJ9A 5H20A 2CQKA 1BOAA 1TLHB 3ELKA 3BPXA 4G7ZF 4CDGA 2FQ3A 3WGHA 2E1CA 2OBPA 3K1MA 3JSPA 1HXDA 4GO1A 1K6OA 3P9KA 3LAPA 1FYLA 1BIBA 5CJ9A 4S05A 2Y75A 2K7LA 2XVCA 1X3UA 2A3SA 5K5QA 2VT2A 1D8JA 1QO0D 3RPUA 3FMQA 4ZZDA 3LA2A 5ILSA 5D5UB 1KGSA 4OMZA 1EH6A 3FM5A 4EJWA 1U78A 3JTHA 4IHTA 2X4HA 2COMA 4HLXA 3HHGA 5LRSA 2FEZA 4U7DA 4HX8A 1ON1A 1Z7UA 3E97A 3PQJA 1O57A 1I5ZA 2FOKA 3SFZA 4HLYA 1YS6A 3I58A 3PFIA 2OA4A 3ROUA 2X0LA 5CVVA 4LLGF 2JPBA 1CF7B 1R1VA 2LKPA 3E6MA 4HV6A 3GXOA 3QPHA 2JZYA 2V1XA 3LFKA 2A07F 5JVTA 3DQVC 3JAMK 2OQGA 2R3SA 3CUQB 3IHUA 4ESFA 1P92A 3VEPA 1FY7A 3L7WA 1ULYA 1P2FA 4ENJA 3ECHA 3GW2A 4CICA 2DK8A 2HQNA 4KMUX 2H6CA 1WRJA 4KN7X 4Y13A 3L9FA 2P7CB 1T38A 1USSA 2BV6A 5DD8A 1SD5A 3MEXA 3WTTC 3F3XA 2PI0A 1O3QA 1T39A 5LHHA 4L9TA 2VOPA 1XMKA 4G6DA 3FM3A 2XASA 3KLNA 4PZJA 5FLXK 1ODDA 2J5PA 5JHUA 4LLNA 2DU9A 2JTVA 4YFKF 4MEYF 2ACJA 2RNJA 1T6SA 5KK1A 2K4JA 5E1XA 2KIUA 4A2UA 1KQ8A 2IW5A 2LF7A 3E3VA 2E1NA 3COAC 3LQQA 3DP7A 5E18F 3GEZA 1O3SA 5L3BA 5HLIA 3J7AO 3GF2A 4DNCA 2M45A 2FMLA 1HBXG 4G7OF 2ZMEA 1Z05A 2VOOA 1QBJA 1YW7A 5IT9Z 4A0XA 4XBFA 4BHPA 2EFOA 4MQ9F 2A61A 1S6LA 1S7AA 3RDIA 4OIOF 3GUDA 2KJCA 3T5XA 2NYXA 3TOBA 1MJAA 2DBBA 2A69F 5ICCA 2V79A 1R5HA 1KQ0A 4H0EA 4F7ZA 5BPDA 3TDUC 5LHGA 1W5TA 2EFQA 3EETA 3RPQA 5D4RA 2M87A 1OPCA 1BI1A 1HW2A 1XSVA 2XKOA 1H9GA 1L0OC 4HA8A 3WU0A 3WTZA 1J59A 3QU3A 5ILUA 4OIQF 2Y0MA 2P5LC 1HSJA 1UHMA 3BDDA 4ENKA 5BPIA 5D6EA 2W57A 4PGHA 3V7SA 5DV5A 1RNLA 4UNOA 3P7NA 1GXQA 2YSRA 2CW0F 4QWQA 4O6JA 4RGRA 2O61A 4K2EA 4ENMA 4RGSA 1ZN2A 2O6GE 2D1VA 4G94A 2OZ6A 4HOBA 2KKOA 2BBYA 5BOXA 4U0YA 4UVCA 4ZYHA 2R7DA 2UXXA 2HEOA 2ZMEB 3WGIA 2AXLA 2WC2A 3U2RA 5DUIA 1OMIA 2XAFA 5D8LB 3MWMA 4GCVA 3HUGA 3RKYA 2XAGA 1D8KA 1ZG3A 3GZ5A 1QGPA 4B8XA 2VC1A 1R1TA 1SFXA 1W7PA 1FZPB 4XLNF 4UV9A 5LGNA 2ELHA 2WV0A 3IL2A 1JHFA 2KRFA 5IT9K 1GVJA 2KJBA 4UXNA 4EQQA 4IF4A 2OD5A 3B02A 4L0ZB 4LJZF 3G3ZA 3KP7A 1SFUA 3K1NA 1I27A 3F8NA 3M8FA 3HYIA 4GGGA 2GXGA 2V1DA 1LNWA 1QZYA 4M9XA 1I1SA 3I5UA 1U6GA 2DT5A 1O7LA 4A0YA 2UXNA 4RGXA 1ZYRF 4FX4A 4HQMA 4KYWA 3JSOA 4A6EA 4IPAA 1STZA 1YYVA 2YX4A 3RJPA 4BXUA 1Z6RA 5E1WA 1H9TA 1HKTA 1YTYA 3KP3A 2A6HF 1IN7A 2JPCA 4ESJA 2QBYA 3CUQC 3O6BB 3LSTA 2EFWA 5F64A 2DO7A 3R61A 4HAMA 1FBQA 1J9IA 5HS8A 2QUFA 4ENNA 5L3CA 2UWMA 3HSRA 4LK0F 2EFNA 4KIFA 1BIAA 1IXSB 3N97A 4RAZA 3C3WA 3KETA 2RGVA 5DCFA 3CO7C 5ILVA 4KDPA 1C0WA 2PFBA 4HZFA 1PP8F 4M72A 1LVAA 2F5CA 1K78B 4LMYA 2HGCA 1UB9A 1MDMA 3EYYA 3WE2A 2CO5A 4YFXF 2HFHA 1GXPA 4ESBA 2E7XA 1D3YA 2EV6A 5L3EA 1CF7A 3HOSA 3C18A 2W84A 1R23A 1KU3A 4CHUA 4M6YA 3HRTA 1BC7C 3IKVA 3CUQA 2IA0A 4KICA 4N0BA 2L3DA 3I54A 4MEXF 5JR3A 3H3UA 2VBWA 2F2EA 3WTUC 2O8XA 1TBXA 2K4BA 4R79A 1B1BA 3G73A 2F5EA 3IRRA 5D6FA 1XGNA 4I09A 1ZH5A 3FWEA 2FBKA 3F6VA 1QZZA 1GHCA 4EJVA 4A5NA 1HKSA 5HDKA 4EM1A 4MNUA 3BROA 2XUBA 1V4RA 4IHSA 3LQRA 4LK1F 2ISZA 3F72A 2HR3A 4ON0A 2NAZA 3TQNA 2DK5A 4HYEA 4MGRA 1O7FA 2PJPA 1XSDA 2RKHA 3F22A 1XDSA 2HYFA 4I01A 2PMUA 5A2QZ 3U9GA 1J5YA 3Q9SA 2IA1A 1OYYA 2HKOA 4I7HA 5ED4A 3RYRA 4M71A 1MDMB 4FT8A 2QQAA 3KEOA 4P5OA 2DTRA 1B9NA 1Z9CA 4G8XA 3VFZA 3TKYA 4U0VA 2YU3A 2VE9A 6PAXA 3ZMUA 1E17A 1YO5C 1D5VA 1KA8A 3CDHA 2HQRA 1SMYF 1IXRC 5CVJA 5K1YA 4RS8A 4RB1A 2JRTA 5LEKA 4Q47A 4KT5C 2HZTA 1PUEE 3PQKA 1B6AA 1J75A 2CFXA 3ABTA 3WGGA 1QNTA 2HWVA 5FD6A 5ERIA 2VC0A 1G3YA 4EJOA 4P55A 2ZJ2A 1ZG1A 5AONA 4EJUA 2ESHA 5HDNA 4EJTA 3HTSB 4BHBA 5EEGA 1FWZA 4WWCA 1XN7A 2P6SA 4EGZA 5LRRA 2YR2A 4ZYEA 4HV5A 4M9SA 2P5VA 3HRMA 3I64A 5HS7A 1HSTA 3V7RA 2PBIA 4KNYA 1R7JA 5DD4A 3LA3A 1MJ9A 4XLPF 5ICEA 3GFJA 3WU1B 1TQPA 3ZP5A 3ZMVA 3GZ6A 1T98A 2M8EA 4I0BA 3V8LA 4AIKA 1FP2A 1FLIA 4OIRF 4ZH4F 4LG0A 1UFMA 5AIPA 2QM3A 3DXJF 1FP1D 3K1PA 1S8NA 4WXDA 1BC8C 1MKMA 3R4KA 1O3TA 3KEQA 1KQ9A 5HDGA 5EEHA 3FX3A 2GWRA 2B0LA 3QAHA 3CO6C 5A2QK 2HTSA 3W6KB 2G7UA 1JGSA 2EK5A 2ADUA 2RDPA 1XCBA 3P9CA 2L54A 1DP7P 2EV0A 2DW4A 3IC7A 3FZVA 3T8TA 3HIFA 1FYKA 2YX7A 3CLOA 2STWA 1YIOA 1BI3A 3ZMZA 2C6YA 1RI7A 1IN4A 3K2ZA 4IRIA 1FNNA 3L00A 2HDCA 2YPRA 1L3LA 5H6RA 4M6XA 5J6XA 5F1RA 2XGXA 4L9NA 1I6XA 2P7VB 1SD6A 3KCCA 4RGUA 2M5WA 1J7KA 4G7HF 3FHZA 2FRHA 3NRVA 2HOEA 5DCMA 2HYGD 3RTRA 1V3FA 4HDUA 3BPVA 2BGCA 3EQLF 3WTWC 1U5TC 4U88A 1IXCA 1S7OA 4DQ2A 1XGMA 2ZKZA 3F6OA 2VN2A 3Q5FA 4EM0B 1W4MA 3HRSA 2A6EF 2H94A 1Z91A 4YG2F 1AWCA 1SFEA 3I4PA 4XRFA 4LG0B 3R0JA 5E1ZB 3HTUA 3FF5A 2QYOA 3ZMDA 3HHHA 1XSXA 2GAUA 3FMRA 2O3FA 2DAOA 1YQAA 2CWEA 2GIVA 3RYPA 2STTA 1LQ1A 5L3FA 1YW8A 1EH7A 2HTJA 3L09A 3F21A 1FPQA 5LGUA 3SHFA 2V1UA 3HSEA 4IRHA 3E6BA 1G4DA 3ULQB 2G7HA 3IWZA 3E5XA 1R36A 4HW0A 3QP5A 1R1UA 1F1ZA 2DI3A 2P4WA 3M9AA 2VBYA 4U0WA 1UCRA 4YFNF 5FFXA 4RB0A 3BWGA 3WE3A 1T0FA 2W85A 4U7BA 4HF1A 1K78A 2FE3A 5K5RA 4RB3C 5K5OA 3M7GA 2CG4A 1P4WA 2ETHA 2GQQA 4A12A 4O3MA 2L01A 4LFUA 4N9HA 4EV0A 4UHTA 3SXYA 4BNCA 2PG4A 1LDJA 1MGTA 2XV4S 4HQEA 1XGOA 3GFMA 3EDPA 1ZARA 2Q0OA 3MFKA 2RV8A 1F9NA 1U5TA 2VXZA 3ABUA 2GA2A 2FU4A 3KLOA 4Z2YA 2PLYA 5DCMB 3QP6A 4L5JA 2PN6A 1SAXA 3RIRA 3CTAA 1W7PD 2L02A 1RZ4A 2MH9A 1WKMA 1BN5A 1IRGA 3Q9VA 5D4SA 4M74A 2JT1A 1OYIA 2O03A 1IRFA 1VTNC 2JSCA 3S2WA 1ZREA 1ON2A 3K0LA 5E17F 3BZ6A 3ISPA 5DEQA 4IXAA 4FHTA 4ASNA 1ZGJA 2AS5F 2PEXA 3GWZA 2F5FA 3TGNA 4EMSA 2D1HA 4JQFA 1G3SA 1ZG5A 5LBQA 4CZZA 2DLLA 5CVIA 1ZLJA 2IVMA 4R1HA 4BYYA 2ZCWA 5FO5A 1O3RA 4LB5A 2PMHA 1Z6TA 4NQWA 1Q1HA 3F8MA 2EFPA 3ZN0A 3M1EA 4EM2A 2V9VA 3TO6A 4KUMA 5LLQA 3V8KA 2W24A 1TNSA 3MCZA 4FX0A 5BMZA 3F8CA 1RIOH 3GVAA 3WTSC 2J5OA 3GO5A 1R58A 3T0YA 3ECOA 2E7WA 5E8IA 3HOTA 2LNBA 3O3KA 3L2CA 3I53A 2ZXJA 2ZFWA 3KP5A 1DDNA 2RQPA 2RVCA 4AIHA 4BQAA 4I98B 4RAYA 2L4MA 2UZKA 2DQLA 1BI0A 1U5TB 2L4AA 2HKXA 1YFHA 1RUOA 3M8EA 1OKRA 2LSOA 2QZ8A 1FBSA 1U3EM 1B59A 1P4XA 2ZBKA 4CXFA 4OINF 1ZGAA 3E5UA 2FF4A 4TV7A 2NNNA 1J2XA 3JTGA 2FBIA 1IF1A 4XSZF 3MAJA 3I0TA 3JW4A 2LDUA 4M73A 5HLGA 4WK8F 3E6CC 3H92A 4LB6B 5F6FA 4G9YA 3HRUA 1CGPA 5HVQC 3QOPA 4IVNA 3E6DA 3EYIA 3V8JA 5LEJA 2Z33A 5CYVA 1EV7A 4P96A 5DDGA 3KP2A 1XCVA 1JXSA 1OR7A 1B9MA 2MLGA 3J81Z 2DFIA 2XHKA 2IP2A 2MC3A 2OU2A 1FT9A 1MD0A 2D2WA 4OMYA 3TDZC 4L9VA 3AAFA 1XDUA 1ZRDA 3DF8A 1YLFA 3RKXA 3O2PE 2QQBA 5E8GA 1S3JA 2WWYA 4Y15A 1JE8A 5ICFA 5D5VB 2K02A 4LGWA 5HLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4A A;  2FNA A;  3LWF A;  4L9J A;  4A5M A;  3W6J B;  1F4K A;  1F5T A;  1XMA A;  1LEB A;  3GYH X;  4WXC A;  5DYM A;  5TJJ A;  2HS5 A;  1S29 A;  1P6R A;  4GXO A;  1WSU A;  2IT0 A;  4YII A;  4NHJ A;  3I59 B;  1IN6 A;  4CYD A;  1TTY A;  2RC4 A;  4P9U A;  1OYW A;  2DPU A;  4HF2 A;  2ESN A;  2Z9O A;  2ZO4 A;  1JHH A;  3DKW A;  2QLZ A;  4MTD A;  2R7F A;  4BH9 A;  2CYY A;  4O5V A;  1P4A A;  1ZAO A;  4HBL A;  1TNT A;  3MQ0 A;  1QPM A;  2WTE A;  2EV5 A;  3WTX C;  1K79 A;  3ZN1 A;  1LDK B;  2FA5 A;  1WQ2 A;  2GXB A;  3F8F A;  4HDV A;  4WF2 A;  1R00 A;  1SMT A;  1YS7 A;  3GLX A;  4E70 A;  1FC3 A;  4B09 A;  3KZZ A;  2A5Y B;  5HOO A;  2XIG A;  3GFI A;  5J8C A;  2XRN A;  2ISY A;  4G6Q A;  1FSE A;  1AOY A;  3SZT A;  1XB4 A;  4OIP F;  2BYV E;  1EH8 A;  3BY6 A;  1WI9 A;  2MH2 A;  4PGG A;  4UUV A;  3R0A A;  3SZP A;  4Y17 A;  2FNP A;  1YW9 A;  2PQ8 A;  1UST A;  1BM9 A;  4XSX F;  3J81 K;  2MLK A;  3MZY A;  2ZNY A;  1HQC A;  3BP8 A;  5BS6 A;  2A68 F;  5FGM A;  3KFW X;  3ML6 A;  4L0Y B;  3E5Q A;  1H0M A;  3ZMT A;  3WTY C;  2M1B A;  1TW3 A;  3WTV C;  4IRG A;  2P8T A;  1U8R A;  5L3G A;  3KE2 A;  3K69 A;  1DPU A;  3REO A;  2IJL A;  2DQR A;  3QU6 A;  1BI2 A;  4OOI A;  2GA1 A;  2BEO A;  1LEA A;  1Z1D A;  1ZHF A;  4PCQ A;  3DPL C;  4UVB A;  2CSO A;  4HX4 A;  4CGZ A;  2TDX A;  2H27 A;  4I02 A;  3DEU A;  1IN8 A;  5JFR A;  2NS0 A;  4PDK A;  4IJA A;  2EJR A;  3SQN A;  1DUX C;  4UV8 A;  3V7C A;  4ZYD A;  1FBU A;  1A04 A;  2VT3 A;  3T8R A;  4AWX B;  3NQO A;  4A6D A;  3D0S A;  1TQM A;  1BBY A;  3IKT A;  2FSW A;  2IA2 A;  5LHI A;  3FXQ A;  4I2O A;  3QRF F;  3RKW A;  4KA4 A;  3D5L A;  5CVR A;  4WX9 A;  4ZZL A;  4KMF A;  4Q4Z F;  3T1B A;  1T2K A;  5TRD A;  2ZNZ A;  4GYG A;  3MZH A;  2XAJ A;  2H6B A;  3BJO A;  3FMS A;  3KP6 A;  4BHC A;  2DPD A;  1UHW A;  1K7A A;  5CLS A;  1HW5 A;  4AD9 A;  5FB2 A;  2F5D A;  1FYM A;  3ZPL A;  2P5K A;  3CUO A;  2KIM A;  4UVA A;  3NEU A;  4Q5S F;  5D8K B;  5JI6 A;  2QWW A;  5DUK A;  1DPR A;  3C1D A;  2H09 A;  2EA2 A;  3K9T A;  3EUH A;  3TOA A;  3GX4 X;  4GYI A;  1IUY A;  2Y48 A;  2MA3 A;  2W25 A;  5J8F A;  4MHG A;  2QVO A;  4KN4 X;  4MQV A;  2Q8K A;  1R5G A;  1KU7 A;  5ICG A;  4AVP A;  3DV8 A;  1G3W A;  4OU0 A;  1FOK A;  5FFZ A;  3OV8 A;  3J80 Z;  2EB7 A;  4ZYG A;  2D45 A;  4AIJ A;  2K86 A;  2NRA C;  1KYZ A;  2VE8 A;  2RN7 A;  2BE5 F;  1MZB A;  5D5X B;  2O0Y A;  2Q2E A;  1NHA A;  2G9W A;  2VON A;  1IZ1 A;  3I71 A;  4JK1 X;  1HW1 A;  3LAJ A;  2IRF G;  4BAY A;  3KP4 A;  3N4M A;  4Q48 A;  1LDD A;  2Z99 A;  2OAZ A;  1IAW A;  2FBH A;  2EA4 A;  4NB5 A;  5H6Q A;  3FXU A;  2IPQ X;  3F23 A;  4JBA A;  1YG2 A;  3DPT A;  2XRO A;  1PDN C;  4ETS A;  5FD5 A;  1G6N A;  2V6C A;  3CJN A;  4L5I A;  3BOQ A;  1MJB A;  2XKP A;  2QQ9 A;  3VB2 A;  2QEN A;  1R22 A;  1QQI A;  1HKQ A;  3RI4 A;  3QPT A;  2MD5 A;  1WWX A;  4EGY A;  3LA7 A;  4QLC U;  3ERE D;  4LD5 A;  1E2X A;  2K27 A;  2GZW A;  3TO7 A;  3B73 A;  4D0P A;  4CO8 A;  3BJA A;  1KU2 A;  2XAH A;  3P9I A;  4HX7 A;  3C7J A;  4EVI A;  2VBX A;  2FXA A;  1TW2 A;  2XAQ A;  3R60 A;  4KIB A;  1XD7 A;  3HSF A;  3OOP A;  3U1D A;  5BQT A;  1RUN A;  4N9I A;  5KVR A;  4LLL A;  1PP7 U;  3F8B A;  4YIF A;  1SD7 A;  3VOD A;  2KIF A;  5IT3 A;  4KFC A;  4KIG A;  3VOE A;  1BJA A;  1SD4 A;  1W7P B;  2P6T A;  4S04 A;  1I1G A;  3IWF A;  4HF0 A;  4R8H A;  3GFL A;  2CGP A;  2VOD A;  3I59 A;  1W5S A;  3J80 K;  1U2W A;  5LGT A;  2NNY A;  4WCG A;  1ZRF A;  3JAM Z;  1ZLK A;  1G3T A;  1ZRC A;  3ZQ7 A;  1FSH A;  1KYW A;  5L3D A;  5CVU A;  4P9F A;  2FMY A;  3KZY A;  1TQI A;  2LF8 A;  4M9Z A;  4L18 B;  1IW7 F;  1KU9 A;  1J0R A;  1ONV A;  3DFG A;  2MBF A;  1IN5 A;  1LB2 A;  4MTE A;  1Y0U A;  3WG9 A;  3BJ6 A;  2M30 A;  2OZU A;  3H3Z A;  2VBZ A;  3IRQ A;  1REP C;  2EWN A;  5AIQ A;  2OQR A;  1FX7 A;  2QBY B;  5E20 A;  1XGS A;  3ZMS A;  5D5W B;  5FLX Z;  4I0A A;  5HS9 A;  4A0Z A;  2Z5U A;  3WOD F;  4RB2 C;  3TO9 A;  4WXH A;  3FXR A;  3R6S A;  2Z3Y A;  3V4G A;  1LJ9 A;  5H20 A;  2CQK A;  1BOA A;  1TLH B;  3ELK A;  3BPX A;  4G7Z F;  4CDG A;  2FQ3 A;  3WGH A;  2E1C A;  2OBP A;  3K1M A;  3JSP A;  1HXD A;  4GO1 A;  1K6O A;  3P9K A;  3LAP A;  1FYL A;  1BIB A;  5CJ9 A;  4S05 A;  2Y75 A;  2K7L A;  2XVC A;  1X3U A;  2A3S A;  5K5Q A;  2VT2 A;  1D8J A;  1QO0 D;  3RPU A;  3FMQ A;  4ZZD A;  3LA2 A;  5ILS A;  5D5U B;  1KGS A;  4OMZ A;  1EH6 A;  3FM5 A;  4EJW A;  1U78 A;  3JTH A;  4IHT A;  2X4H A;  2COM A;  4HLX A;  3HHG A;  5LRS A;  2FEZ A;  4U7D A;  4HX8 A;  1ON1 A;  1Z7U A;  3E97 A;  3PQJ A;  1O57 A;  1I5Z A;  2FOK A;  3SFZ A;  4HLY A;  1YS6 A;  3I58 A;  3PFI A;  2OA4 A;  3ROU A;  2X0L A;  5CVV A;  4LLG F;  2JPB A;  1CF7 B;  1R1V A;  2LKP A;  3E6M A;  4HV6 A;  3GXO A;  3QPH A;  2JZY A;  2V1X A;  3LFK A;  2A07 F;  5JVT A;  3DQV C;  3JAM K;  2OQG A;  2R3S A;  3CUQ B;  3IHU A;  4ESF A;  1P92 A;  3VEP A;  1FY7 A;  3L7W A;  1ULY A;  1P2F A;  4ENJ A;  3ECH A;  3GW2 A;  4CIC A;  2DK8 A;  2HQN A;  4KMU X;  2H6C A;  1WRJ A;  4KN7 X;  4Y13 A;  3L9F A;  2P7C B;  1T38 A;  1USS A;  2BV6 A;  5DD8 A;  1SD5 A;  3MEX A;  3WTT C;  3F3X A;  2PI0 A;  1O3Q A;  1T39 A;  5LHH A;  4L9T A;  2VOP A;  1XMK A;  4G6D A;  3FM3 A;  2XAS A;  3KLN A;  4PZJ A;  5FLX K;  1ODD A;  2J5P A;  5JHU A;  4LLN A;  2DU9 A;  2JTV A;  4YFK F;  4MEY F;  2ACJ A;  2RNJ A;  1T6S A;  5KK1 A;  2K4J A;  5E1X A;  2KIU A;  4A2U A;  1KQ8 A;  2IW5 A;  2LF7 A;  3E3V A;  2E1N A;  3COA C;  3LQQ A;  3DP7 A;  5E18 F;  3GEZ A;  1O3S A;  5L3B A;  5HLI A;  3J7A O;  3GF2 A;  4DNC A;  2M45 A;  2FML A;  1HBX G;  4G7O F;  2ZME A;  1Z05 A;  2VOO A;  1QBJ A;  1YW7 A;  5IT9 Z;  4A0X A;  4XBF A;  4BHP A;  2EFO A;  4MQ9 F;  2A61 A;  1S6L A;  1S7A A;  3RDI A;  4OIO F;  3GUD A;  2KJC A;  3T5X A;  2NYX A;  3TOB A;  1MJA A;  2DBB A;  2A69 F;  5ICC A;  2V79 A;  1R5H A;  1KQ0 A;  4H0E A;  4F7Z A;  5BPD A;  3TDU C;  5LHG A;  1W5T A;  2EFQ A;  3EET A;  3RPQ A;  5D4R A;  2M87 A;  1OPC A;  1BI1 A;  1HW2 A;  1XSV A;  2XKO A;  1H9G A;  1L0O C;  4HA8 A;  3WU0 A;  3WTZ A;  1J59 A;  3QU3 A;  5ILU A;  4OIQ F;  2Y0M A;  2P5L C;  1HSJ A;  1UHM A;  3BDD A;  4ENK A;  5BPI A;  5D6E A;  2W57 A;  4PGH A;  3V7S A;  5DV5 A;  1RNL A;  4UNO A;  3P7N A;  1GXQ A;  2YSR A;  2CW0 F;  4QWQ A;  4O6J A;  4RGR A;  2O61 A;  4K2E A;  4ENM A;  4RGS A;  1ZN2 A;  2O6G E;  2D1V A;  4G94 A;  2OZ6 A;  4HOB A;  2KKO A;  2BBY A;  5BOX A;  4U0Y A;  4UVC A;  4ZYH A;  2R7D A;  2UXX A;  2HEO A;  2ZME B;  3WGI A;  2AXL A;  2WC2 A;  3U2R A;  5DUI A;  1OMI A;  2XAF A;  5D8L B;  3MWM A;  4GCV A;  3HUG A;  3RKY A;  2XAG A;  1D8K A;  1ZG3 A;  3GZ5 A;  1QGP A;  4B8X A;  2VC1 A;  1R1T A;  1SFX A;  1W7P A;  1FZP B;  4XLN F;  4UV9 A;  5LGN A;  2ELH A;  2WV0 A;  3IL2 A;  1JHF A;  2KRF A;  5IT9 K;  1GVJ A;  2KJB A;  4UXN A;  4EQQ A;  4IF4 A;  2OD5 A;  3B02 A;  4L0Z B;  4LJZ F;  3G3Z A;  3KP7 A;  1SFU A;  3K1N A;  1I27 A;  3F8N A;  3M8F A;  3HYI A;  4GGG A;  2GXG A;  2V1D A;  1LNW A;  1QZY A;  4M9X A;  1I1S A;  3I5U A;  1U6G A;  2DT5 A;  1O7L A;  4A0Y A;  2UXN A;  4RGX A;  1ZYR F;  4FX4 A;  4HQM A;  4KYW A;  3JSO A;  4A6E A;  4IPA A;  1STZ A;  1YYV A;  2YX4 A;  3RJP A;  4BXU A;  1Z6R A;  5E1W A;  1H9T A;  1HKT A;  1YTY A;  3KP3 A;  2A6H F;  1IN7 A;  2JPC A;  4ESJ A;  2QBY A;  3CUQ C;  3O6B B;  3LST A;  2EFW A;  5F64 A;  2DO7 A;  3R61 A;  4HAM A;  1FBQ A;  1J9I A;  5HS8 A;  2QUF A;  4ENN A;  5L3C A;  2UWM A;  3HSR A;  4LK0 F;  2EFN A;  4KIF A;  1BIA A;  1IXS B;  3N97 A;  4RAZ A;  3C3W A;  3KET A;  2RGV A;  5DCF A;  3CO7 C;  5ILV A;  4KDP A;  1C0W A;  2PFB A;  4HZF A;  1PP8 F;  4M72 A;  1LVA A;  2F5C A;  1K78 B;  4LMY A;  2HGC A;  1UB9 A;  1MDM A;  3EYY A;  3WE2 A;  2CO5 A;  4YFX F;  2HFH A;  1GXP A;  4ESB A;  2E7X A;  1D3Y A;  2EV6 A;  5L3E A;  1CF7 A;  3HOS A;  3C18 A;  2W84 A;  1R23 A;  1KU3 A;  4CHU A;  4M6Y A;  3HRT A;  1BC7 C;  3IKV A;  3CUQ A;  2IA0 A;  4KIC A;  4N0B A;  2L3D A;  3I54 A;  4MEX F;  5JR3 A;  3H3U A;  2VBW A;  2F2E A;  3WTU C;  2O8X A;  1TBX A;  2K4B A;  4R79 A;  1B1B A;  3G73 A;  2F5E A;  3IRR A;  5D6F A;  1XGN A;  4I09 A;  1ZH5 A;  3FWE A;  2FBK A;  3F6V A;  1QZZ A;  1GHC A;  4EJV A;  4A5N A;  1HKS A;  5HDK A;  4EM1 A;  4MNU A;  3BRO A;  2XUB A;  1V4R A;  4IHS A;  3LQR A;  4LK1 F;  2ISZ A;  3F72 A;  2HR3 A;  4ON0 A;  2NAZ A;  3TQN A;  2DK5 A;  4HYE A;  4MGR A;  1O7F A;  2PJP A;  1XSD A;  2RKH A;  3F22 A;  1XDS A;  2HYF A;  4I01 A;  2PMU A;  5A2Q Z;  3U9G A;  1J5Y A;  3Q9S A;  2IA1 A;  1OYY A;  2HKO A;  4I7H A;  5ED4 A;  3RYR A;  4M71 A;  1MDM B;  4FT8 A;  2QQA A;  3KEO A;  4P5O A;  2DTR A;  1B9N A;  1Z9C A;  4G8X A;  3VFZ A;  3TKY A;  4U0V A;  2YU3 A;  2VE9 A;  6PAX A;  3ZMU A;  1E17 A;  1YO5 C;  1D5V A;  1KA8 A;  3CDH A;  2HQR A;  1SMY F;  1IXR C;  5CVJ A;  5K1Y A;  4RS8 A;  4RB1 A;  2JRT A;  5LEK A;  4Q47 A;  4KT5 C;  2HZT A;  1PUE E;  3PQK A;  1B6A A;  1J75 A;  2CFX A;  3ABT A;  3WGG A;  1QNT A;  2HWV A;  5FD6 A;  5ERI A;  2VC0 A;  1G3Y A;  4EJO A;  4P55 A;  2ZJ2 A;  1ZG1 A;  5AON A;  4EJU A;  2ESH A;  5HDN A;  4EJT A;  3HTS B;  4BHB A;  5EEG A;  1FWZ A;  4WWC A;  1XN7 A;  2P6S A;  4EGZ A;  5LRR A;  2YR2 A;  4ZYE A;  4HV5 A;  4M9S A;  2P5V A;  3HRM A;  3I64 A;  5HS7 A;  1HST A;  3V7R A;  2PBI A;  4KNY A;  1R7J A;  5DD4 A;  3LA3 A;  1MJ9 A;  4XLP F;  5ICE A;  3GFJ A;  3WU1 B;  1TQP A;  3ZP5 A;  3ZMV A;  3GZ6 A;  1T98 A;  2M8E A;  4I0B A;  3V8L A;  4AIK A;  1FP2 A;  1FLI A;  4OIR F;  4ZH4 F;  4LG0 A;  1UFM A;  5AIP A;  2QM3 A;  3DXJ F;  1FP1 D;  3K1P A;  1S8N A;  4WXD A;  1BC8 C;  1MKM A;  3R4K A;  1O3T A;  3KEQ A;  1KQ9 A;  5HDG A;  5EEH A;  3FX3 A;  2GWR A;  2B0L A;  3QAH A;  3CO6 C;  5A2Q K;  2HTS A;  3W6K B;  2G7U A;  1JGS A;  2EK5 A;  2ADU A;  2RDP A;  1XCB A;  3P9C A;  2L54 A;  1DP7 P;  2EV0 A;  2DW4 A;  3IC7 A;  3FZV A;  3T8T A;  3HIF A;  1FYK A;  2YX7 A;  3CLO A;  2STW A;  1YIO A;  1BI3 A;  3ZMZ A;  2C6Y A;  1RI7 A;  1IN4 A;  3K2Z A;  4IRI A;  1FNN A;  3L00 A;  2HDC A;  2YPR A;  1L3L A;  5H6R A;  4M6X A;  5J6X A;  5F1R A;  2XGX A;  4L9N A;  1I6X A;  2P7V B;  1SD6 A;  3KCC A;  4RGU A;  2M5W A;  1J7K A;  4G7H F;  3FHZ A;  2FRH A;  3NRV A;  2HOE A;  5DCM A;  2HYG D;  3RTR A;  1V3F A;  4HDU A;  3BPV A;  2BGC A;  3EQL F;  3WTW C;  1U5T C;  4U88 A;  1IXC A;  1S7O A;  4DQ2 A;  1XGM A;  2ZKZ A;  3F6O A;  2VN2 A;  3Q5F A;  4EM0 B;  1W4M A;  3HRS A;  2A6E F;  2H94 A;  1Z91 A;  4YG2 F;  1AWC A;  1SFE A;  3I4P A;  4XRF A;  4LG0 B;  3R0J A;  5E1Z B;  3HTU A;  3FF5 A;  2QYO A;  3ZMD A;  3HHH A;  1XSX A;  2GAU A;  3FMR A;  2O3F A;  2DAO A;  1YQA A;  2CWE A;  2GIV A;  3RYP A;  2STT A;  1LQ1 A;  5L3F A;  1YW8 A;  1EH7 A;  2HTJ A;  3L09 A;  3F21 A;  1FPQ A;  5LGU A;  3SHF A;  2V1U A;  3HSE A;  4IRH A;  3E6B A;  1G4D A;  3ULQ B;  2G7H A;  3IWZ A;  3E5X A;  1R36 A;  4HW0 A;  3QP5 A;  1R1U A;  1F1Z A;  2DI3 A;  2P4W A;  3M9A A;  2VBY A;  4U0W A;  1UCR A;  4YFN F;  5FFX A;  4RB0 A;  3BWG A;  3WE3 A;  1T0F A;  2W85 A;  4U7B A;  4HF1 A;  1K78 A;  2FE3 A;  5K5R A;  4RB3 C;  5K5O A;  3M7G A;  2CG4 A;  1P4W A;  2ETH A;  2GQQ A;  4A12 A;  4O3M A;  2L01 A;  4LFU A;  4N9H A;  4EV0 A;  4UHT A;  3SXY A;  4BNC A;  2PG4 A;  1LDJ A;  1MGT A;  2XV4 S;  4HQE A;  1XGO A;  3GFM A;  3EDP A;  1ZAR A;  2Q0O A;  3MFK A;  2RV8 A;  1F9N A;  1U5T A;  2VXZ A;  3ABU A;  2GA2 A;  2FU4 A;  3KLO A;  4Z2Y A;  2PLY A;  5DCM B;  3QP6 A;  4L5J A;  2PN6 A;  1SAX A;  3RIR A;  3CTA A;  1W7P D;  2L02 A;  1RZ4 A;  2MH9 A;  1WKM A;  1BN5 A;  1IRG A;  3Q9V A;  5D4S A;  4M74 A;  2JT1 A;  1OYI A;  2O03 A;  1IRF A;  1VTN C;  2JSC A;  3S2W A;  1ZRE A;  1ON2 A;  3K0L A;  5E17 F;  3BZ6 A;  3ISP A;  5DEQ A;  4IXA A;  4FHT A;  4ASN A;  1ZGJ A;  2AS5 F;  2PEX A;  3GWZ A;  2F5F A;  3TGN A;  4EMS A;  2D1H A;  4JQF A;  1G3S A;  1ZG5 A;  5LBQ A;  4CZZ A;  2DLL A;  5CVI A;  1ZLJ A;  2IVM A;  4R1H A;  4BYY A;  2ZCW A;  5FO5 A;  1O3R A;  4LB5 A;  2PMH A;  1Z6T A;  4NQW A;  1Q1H A;  3F8M A;  2EFP A;  3ZN0 A;  3M1E A;  4EM2 A;  2V9V A;  3TO6 A;  4KUM A;  5LLQ A;  3V8K A;  2W24 A;  1TNS A;  3MCZ A;  4FX0 A;  5BMZ A;  3F8C A;  1RIO H;  3GVA A;  3WTS C;  2J5O A;  3GO5 A;  1R58 A;  3T0Y A;  3ECO A;  2E7W A;  5E8I A;  3HOT A;  2LNB A;  3O3K A;  3L2C A;  3I53 A;  2ZXJ A;  2ZFW A;  3KP5 A;  1DDN A;  2RQP A;  2RVC A;  4AIH A;  4BQA A;  4I98 B;  4RAY A;  2L4M A;  2UZK A;  2DQL A;  1BI0 A;  1U5T B;  2L4A A;  2HKX A;  1YFH A;  1RUO A;  3M8E A;  1OKR A;  2LSO A;  2QZ8 A;  1FBS A;  1U3E M;  1B59 A;  1P4X A;  2ZBK A;  4CXF A;  4OIN F;  1ZGA A;  3E5U A;  2FF4 A;  4TV7 A;  2NNN A;  1J2X A;  3JTG A;  2FBI A;  1IF1 A;  4XSZ F;  3MAJ A;  3I0T A;  3JW4 A;  2LDU A;  4M73 A;  5HLG A;  4WK8 F;  3E6C C;  3H92 A;  4LB6 B;  5F6F A;  4G9Y A;  3HRU A;  1CGP A;  5HVQ C;  3QOP A;  4IVN A;  3E6D A;  3EYI A;  3V8J A;  5LEJ A;  2Z33 A;  5CYV A;  1EV7 A;  4P96 A;  5DDG A;  3KP2 A;  1XCV A;  1JXS A;  1OR7 A;  1B9M A;  2MLG A;  3J81 Z;  2DFI A;  2XHK A;  2IP2 A;  2MC3 A;  2OU2 A;  1FT9 A;  1MD0 A;  2D2W A;  4OMY A;  3TDZ C;  4L9V A;  3AAF A;  1XDU A;  1ZRD A;  3DF8 A;  1YLF A;  3RKX A;  3O2P E;  2QQB A;  5E8G A;  1S3J A;  2WWY A;  4Y15 A;  1JE8 A;  5ICF A;  5D5V B;  2K02 A;  4LGW A;  5HLH A; 
#chains in the Genus database with same CATH topology
 1B4A A;  2FNA A;  2LRE A;  3LWF A;  3QQA A;  4L9J A;  2VJ5 A;  4BY1 J;  3ZQG A;  4A5M A;  2LTP A;  3W6J B;  1F4K A;  1F5T A;  1IGN A;  1XMA A;  1LEB A;  5EF6 A;  3GYH X;  1UG2 A;  4WXC A;  1W5C C;  5DYM A;  5TJJ A;  2CS3 A;  2HS5 A;  2TRT A;  1OCT C;  3SEQ A;  1BJZ A;  2K40 A;  1S29 A;  2OTJ I;  1P6R A;  4GXO A;  1WSU A;  5FKO A;  2ELJ A;  4YII A;  1NTC A;  3BCA A;  2IT0 A;  4IKF A;  3OYG A;  4NHJ A;  5F0H A;  3I59 B;  1IN6 A;  4KJZ A;  3AG2 H;  4CYD A;  3OYC A;  1OLT A;  1LE8 B;  3K70 D;  5M5W J;  1TTY A;  2RC4 A;  5EG0 B;  4P9U A;  1OYW A;  2VQL A;  2DPU A;  2HOS A;  4LIV A;  2DYS H;  4LOC A;  2BXY A;  4I76 A;  5IP9 J;  4HF2 A;  2ESN A;  2R7T A;  1QA6 A;  2BW3 A;  2ZO4 A;  2Z9O A;  2M8G X;  1JHH A;  2L0K A;  4RM2 A;  1A6I A;  3DKW A;  3CCQ I;  2QLZ A;  5M3F J;  4MTD A;  2R7F A;  4BH9 A;  2CYY A;  4O5V A;  1P4A A;  1ZAO A;  4HBL A;  5JLW A;  1TNT A;  4NC7 A;  1B72 B;  3MQ0 A;  4CCL A;  3IAS 2;  4JX6 A;  2LH9 A;  2ME6 A;  1QPM A;  2WTE A;  3H5N A;  3DLL F;  2EPF A;  3KIO A;  2EV5 A;  3WTX C;  1ZQ3 P;  1WJD A;  1K79 A;  2LY2 A;  3ZN1 A;  1LDK B;  2FA5 A;  2BXZ A;  2PMZ A;  1WQ2 A;  3LOC A;  2GXB A;  3F8F A;  4HDV A;  2EIL H;  2ZC2 A;  3BZC A;  4WF2 A;  1R00 A;  1SMT A;  1GV2 A;  1YS7 A;  3FK6 A;  3GLX A;  1FC3 A;  4E70 A;  2B9S A;  4B09 A;  3OYI A;  1PYV A;  4HEA 2;  1WFX A;  3KZZ A;  2OPT A;  5K7Z A;  2DT6 A;  2JK3 A;  2XGD A;  2A5Y B;  3BQZ A;  5HOO A;  2XIG A;  4G12 A;  2E5N A;  3GFI A;  5J8C A;  3MD2 A;  3BG9 A;  4ZDL A;  3OYF A;  2XRN A;  2NVY J;  2ISY A;  4G6Q A;  1FSE A;  1AOY A;  4B47 A;  3SZT A;  1X1A A;  2CU7 A;  1XB4 A;  4OIP F;  2K3P A;  1ZTR A;  2BYV E;  2HOA A;  2DA6 A;  1EH8 A;  4A3M J;  3BY6 A;  2JA6 J;  3UR3 C;  1WI9 A;  2MH2 A;  1M1E B;  4PGG A;  3JRG A;  4UUV A;  1OCC H;  1X3Z B;  3R0A A;  3H9J A;  3SZP A;  4DZP A;  4Y17 A;  2FNP A;  3H9G A;  1YW9 A;  2IGK A;  2Y30 A;  1NK3 P;  5E3M A;  2PQ8 A;  1UST A;  1BM9 A;  4XSX F;  3J81 K;  2MLK A;  3MZY A;  5KAI C;  2LD5 A;  2V9K A;  3FKI J;  4RLF A;  2ZNY A;  3PUB A;  3OYL A;  1HQC A;  5EGO B;  3BP8 A;  3A1Y A;  2UUZ A;  3W3C A;  5BS6 A;  2A68 F;  1BR1 A;  5FGM A;  1ZR4 A;  2IXS A;  3KFW X;  4JP0 A;  1U9O A;  3ML6 A;  4L0Y B;  2DCE A;  3E5Q A;  1H0M A;  3ZMT A;  5HNH A;  3WTY C;  2M1B A;  2LMD A;  1TW3 A;  3WTV C;  4UB8 C;  1MSF C;  5FRO A;  2EIN H;  4IRG A;  2DDA A;  2R7R A;  2P8T A;  1VI0 A;  5L3G A;  3KE2 A;  1U8R A;  1TWA J;  3K69 A;  2VUM J;  1DPU A;  3K4M A;  3REO A;  2IJL A;  2DQR A;  2E1O A;  1TZL A;  3QU6 A;  1BI2 A;  2XAU A;  5IY5 H;  3SEZ A;  4OOI A;  2GA1 A;  3HM5 A;  2BEO A;  1LEA A;  1Z1D A;  1SVL A;  1ZHF A;  2TCT A;  3DPL C;  4PCQ A;  4UVB A;  2E1M B;  3JRC A;  5JVG F;  5F0F A;  2CSO A;  2XB0 X;  2F6C A;  2W48 A;  4HX4 A;  2AO9 A;  4CGZ A;  2P81 A;  2M3A A;  2TDX A;  1F43 A;  3F9K A;  2H27 A;  4XRS A;  4IZZ A;  1GLN A;  2CUZ A;  1VFC A;  4I02 A;  1ZKG A;  4Y3O A;  2Y9Z A;  2ZXW H;  2WAF A;  2HZD A;  3ABM H;  4YRV A;  4D7M A;  2LY9 A;  2L9N A;  3DEU A;  4E7Z A;  3A03 A;  1IN8 A;  5JFR A;  2NS0 A;  4PDK A;  2ZFU A;  4IJA A;  5EJC A;  2EJR A;  3SQN A;  1DUX C;  2VXD A;  2M4G A;  4UV8 A;  1I3A A;  2XC7 A;  3I56 I;  3V7C A;  4A3F J;  2XPU A;  1IJW C;  4ZYD A;  1FBU A;  1A04 A;  1TWH J;  2VT3 A;  3T8R A;  4AWX B;  3HC7 A;  3NQO A;  3A01 A;  4A6D A;  1U0J A;  3D0S A;  4PFP A;  1TQM A;  2L7M P;  3OMY A;  1BBY A;  3IKT A;  4BE1 A;  4A3B J;  2FSW A;  2IA2 A;  5LHI A;  2GOX B;  4LIT A;  3FXQ A;  1GT0 C;  2O5R A;  4NNJ A;  2YU9 J;  4I2O A;  3QRF F;  3RKW A;  4KA4 A;  1E3O C;  3D5L A;  2LG4 A;  2ZB9 A;  5CVR A;  3RKQ A;  4WX9 A;  1QZE A;  5KAF C;  4ZZL A;  1I39 A;  4KMF A;  4BQQ A;  1ETK A;  3J7Y J;  3CF2 A;  3T1B A;  4Q4Z F;  2KQR A;  2OF7 A;  3K6G A;  1T2K A;  1J09 A;  2DA3 A;  3A2K A;  5TRD A;  3K4L A;  2ZNZ A;  1SVM A;  4GYG A;  2HVR A;  3MZH A;  3WU2 C;  4CA0 A;  2XAJ A;  2H6B A;  1ITY A;  1HLV A;  3BJO A;  3FMS A;  3KP6 A;  4BHC A;  4BE2 A;  1GUU A;  4CZC A;  1UHW A;  2DPD A;  1K7A A;  5CLS A;  4BE0 A;  2IS2 A;  1HW5 A;  1MH3 A;  4M3F A;  4AD9 A;  1JKR C;  2E36 A;  3G71 I;  2ZXH A;  5FB2 A;  2F5D A;  1D0Z A;  2F4M B;  1ETW A;  2OCE A;  3LSJ A;  1FYM A;  3ZPL A;  2P5K A;  2H8R A;  3CUO A;  2KIM A;  1VQ4 I;  1R9T J;  4UVA A;  1NH3 A;  3NEU A;  4XKB A;  3PO3 J;  4Q5S F;  5D8K B;  4DYR A;  5JI6 A;  2R0Q C;  2DJN A;  4M6V A;  2QWW A;  5IOY A;  5DUK A;  2IGO A;  4CCO A;  1DPR A;  2ID3 A;  5CQE A;  1V55 H;  4F93 B;  3C1D A;  1TWC J;  2H09 A;  5GPA A;  1VQ9 I;  2EA2 A;  3K9T A;  3EUH A;  3CCS I;  4A3E J;  2IS1 A;  2JUC A;  4XNF A;  3G6E I;  3TOA A;  1IRZ A;  2BZT A;  4AYB A;  3GX4 X;  4GYI A;  1IUY A;  2Y48 A;  4Y7N J;  2MA3 A;  5IOZ A;  2ZJQ F;  2EZL A;  2W25 A;  5J8F A;  4XOP A;  2QVO A;  4MHG A;  4KN4 X;  1N25 A;  4MQV A;  4PJM A;  2Q8K A;  1AHD P;  1R5G A;  2HQA A;  1KU7 A;  5DM7 F;  5ICG A;  2NVQ J;  4AVP A;  3DV8 A;  1G3W A;  2ECB A;  4OU0 A;  4PK4 A;  3A4C A;  3HJE A;  2DXI A;  2IS4 A;  1FOK A;  1RC9 A;  5FFZ A;  2WB1 N;  5C3E J;  3OV8 A;  2JSP A;  3J80 Z;  2EB7 A;  1UG0 A;  4ZYG A;  2EIM H;  3B6A A;  4AIJ A;  2K86 A;  2D45 A;  2NRA C;  4ZDO A;  1KYZ A;  2X48 A;  2VE8 A;  2RN7 A;  2BE5 F;  3ZQF A;  2W7N A;  4C3I J;  2XGC A;  1YJ9 I;  1MZB A;  4A3K J;  5D5X B;  5C44 J;  3J7A Y;  3HB9 A;  2CW8 A;  3AG4 H;  4YEJ A;  2K9Q A;  1YRN A;  2O0Y A;  2R7Q A;  1WPK A;  2Q2E A;  1NHA A;  3MKY B;  1Z3X A;  4RLQ A;  1T56 A;  3X2Q H;  2G9W A;  3CCL I;  2VON A;  3BG3 A;  3D1N I;  2VIX A;  3OSF A;  3PO2 J;  1IZ1 A;  4B1R A;  1NG7 A;  3OYH A;  2R5Y B;  3I71 A;  4JK1 X;  1HW1 A;  3LAJ A;  2IRF G;  4BAY A;  1D0Y A;  3CQZ J;  4IQ4 A;  3KP4 A;  1Y8R B;  3N4M A;  4Q48 A;  1LDD A;  2ECC A;  2Z99 A;  2OAZ A;  1IAW A;  3CCM I;  4E7I A;  3GTK J;  2FBH A;  1LKX A;  2EA4 A;  2QQ8 A;  2X1C A;  4NB5 A;  5H6Q A;  3FXU A;  2IPQ X;  2QSG X;  3F23 A;  2KP6 A;  4JBA A;  1BW6 A;  1YG2 A;  2M0C A;  3DPT A;  4DIQ A;  2XRO A;  1DU6 A;  2K3F A;  1PDN C;  4ETS A;  5FD5 A;  1G6N A;  2V6C A;  2KPM A;  3BG6 A;  5CKT A;  3CJN A;  1PUF A;  1NK2 P;  4L5I A;  3BOQ A;  3L2Q A;  2LC2 A;  3RSN A;  1MJB A;  2XKP A;  1TT5 B;  1PJR A;  2QQ9 A;  3VB2 A;  2L5Q A;  3H1C A;  2QEN A;  1R22 A;  1QQI A;  1Y1V J;  1HKQ A;  3RI4 A;  3QPT A;  3F0C A;  3QOD A;  1ETX A;  4AID A;  5J4Y A;  4FCY A;  2F4O B;  5E3O A;  2K85 A;  3NAR A;  2MD5 A;  3DU6 A;  2KL4 A;  1WWX A;  1P7I A;  1R6R A;  4EGY A;  3JRD A;  3CCV I;  3LA7 A;  4M3G A;  3DBH B;  4QLC U;  1XX5 A;  3ERE D;  3OSG A;  4LD5 A;  1JUM A;  3L2V A;  1E2X A;  2QKM B;  2K27 A;  2GZW A;  3TO7 A;  3B73 A;  1MMN A;  1IDY A;  3C2B A;  4D0P A;  4EAT A;  2ME0 A;  4CO8 A;  3HPH A;  3BJA A;  3O8H A;  1KU2 A;  5TIS C;  2CQ7 A;  2XAH A;  2FOW A;  3P9I A;  4HX7 A;  3C7J A;  4EVI A;  4A3D J;  2VBX A;  2FXA A;  2KHM A;  3S15 J;  1TW2 A;  3A0H C;  2XAQ A;  4XK4 A;  3R60 A;  5HOD A;  4KIB A;  1KON A;  2VLA A;  1XD7 A;  2E5Z A;  2HPI A;  2XGE A;  5KCM A;  3OS0 A;  4HG2 A;  3HSF A;  3OOP A;  1X1C A;  3U1D A;  2HXO A;  5C4X J;  4QPO A;  4UUT A;  2LR8 A;  5BQT A;  3D5R C;  9ANT A;  1RUN A;  4N9I A;  5KVR A;  3DBL B;  4LLL A;  1PP7 U;  3TBI A;  2E2H J;  2AXT C;  2VPR A;  3F8B A;  4YIF A;  3HUG B;  1SD7 A;  3BTL A;  3VOD A;  2KIF A;  5IT3 A;  3LMM A;  4KFC A;  1FIA A;  4KIG A;  1MH4 A;  1RKT A;  3VOE A;  5E3L A;  2K9S A;  4N4N B;  1BJA A;  2PJR B;  1SD4 A;  1W7P B;  2HYJ A;  2P6T A;  4S04 A;  1I1G A;  3IWF A;  1R4N B;  4HF0 A;  2CV1 A;  3BR1 A;  5K7H A;  1FIP A;  4R8H A;  2X1D A;  3PIO F;  1Z0X A;  3GFL A;  2CGP A;  2VOD A;  3I59 A;  1W5S A;  3J80 K;  1U2W A;  5LGT A;  2NNY A;  3DBR B;  3L2U A;  1V5G A;  3AG3 H;  3K4N A;  4ZYA A;  2VPL A;  4WCG A;  1LE8 A;  1ZRF A;  3OIP A;  3JAM Z;  2IS6 A;  5EG0 A;  1R4M B;  3MZ8 A;  4F55 A;  1IO2 A;  2BHY A;  4OAY A;  4D5F A;  2X9D A;  3HKZ N;  3UKG A;  2AQE A;  1ZLK A;  2MG4 A;  1G3T A;  4KIS A;  1ZRC A;  2VKE A;  2VKD A;  3M1C A;  4ZTJ A;  3Q3S A;  3ZQ7 A;  1U8B A;  4BJT A;  1FSH A;  1TWF J;  1KYW A;  5L3D A;  5CVU A;  4P9F A;  2FMY A;  2FUG 2;  3KZY A;  4IX7 A;  1TQI A;  2LF8 A;  4M9Z A;  4RM3 A;  4L18 B;  1IW7 F;  4A3G J;  3HOY J;  1KU9 A;  2E1M C;  1B72 A;  1EKE A;  4NUB A;  1J0R A;  3BR0 A;  4QTR A;  1X2M A;  1VQP I;  1ONV A;  3DFG A;  1S5L C;  2X6W A;  2CQX A;  2MBF A;  2DA1 A;  1IN5 A;  1LB2 A;  2JQ7 A;  4MTE A;  1EF4 A;  2HOT A;  1Y0U A;  3TW6 A;  3WG9 A;  1ERD A;  4C3H J;  3A0B C;  3BJ6 A;  2M30 A;  2OZU A;  3H3Z A;  2VBZ A;  3IRQ A;  1REP C;  2EWN A;  2MSY A;  3DTK A;  5AIQ A;  2OQR A;  1FX7 A;  2QBY B;  5E20 A;  1XGS A;  1JT6 A;  3ZMS A;  5D5W B;  5FLX Z;  4I0A A;  5HS9 A;  2QSH X;  4A0Z A;  2Z5U A;  4BXF A;  3WOD F;  4RB2 C;  3CDL A;  3IV5 A;  3HL2 A;  4XON A;  1WJC A;  3OYB A;  1JT0 A;  3QYF A;  3TO9 A;  4WXH A;  3FXR A;  4IO9 F;  5B66 C;  3CJR B;  1DQU A;  1W1W E;  3R6S A;  3MVP A;  2Z3Y A;  3V4G A;  4E7L A;  1LJ9 A;  5H20 A;  2CQK A;  1BOA A;  1QVT A;  4BUP A;  1AU7 A;  1TLH B;  3ELK A;  3BPX A;  1LVK A;  3FIS A;  4G7Z F;  4CDG A;  2CJJ A;  2FQ3 A;  3WGH A;  2EH3 A;  2E1C A;  1ORK A;  4UY8 I;  2OBP A;  4BBS J;  3IH2 A;  2WBM A;  5JLX A;  3PNT A;  3LSH A;  3K1M A;  3JSP A;  1HXD A;  1LUJ B;  4BJ6 C;  3SZG A;  4GO1 A;  3ASO H;  3VYS B;  1K6O A;  3P9K A;  3LAP A;  1FYL A;  5J47 A;  3AL0 B;  1BIB A;  4MFD A;  5CJ9 A;  4S05 A;  3MN2 A;  2V7F A;  3BR6 A;  2Y75 A;  3S32 A;  2K7L A;  2XVC A;  4XOT A;  1X3U A;  4FQG A;  2A3S A;  5K5Q A;  1H89 C;  1DP3 A;  2VI6 A;  2VT2 A;  1WGX A;  1D8J A;  1QO0 D;  3RPU A;  2B7E A;  3FMQ A;  3G4S I;  4ZZD A;  2WAQ N;  3H36 A;  1D1B A;  3LA2 A;  3LNQ A;  5ILS A;  3M4O J;  5D5U B;  1WJB A;  1KGS A;  4OMZ A;  2LYC A;  3LSK A;  1EH6 A;  2EIJ H;  3FM5 A;  4EJW A;  5FLV A;  1RPW A;  4RBO A;  3JTH A;  1U78 A;  1HA8 A;  4IHT A;  2X4H A;  2COM A;  4XKC A;  4HLX A;  3HHG A;  5LRS A;  2L2O A;  2FEZ A;  4U7D A;  4ZTF A;  1ZR2 A;  1IV6 A;  4HX8 A;  1ON1 A;  1Z7U A;  1WVR A;  3E97 A;  3PQJ A;  1SEU A;  1JGG A;  1O57 A;  3TED A;  1I5Z A;  3OYK A;  4AUX A;  5J1Y A;  2FOK A;  1X1D A;  2WAD A;  3SFZ A;  4HLY A;  1YS6 A;  3OL4 A;  3I58 A;  3PFI A;  2OA4 A;  3ROU A;  3L2R A;  2HPM A;  2X0L A;  4XMY A;  5CVV A;  4Z6Y A;  1FJL A;  4LLG F;  2JA8 J;  3GZN B;  3OYA A;  2JPB A;  1CQT A;  4LIU A;  1CF7 B;  1VZ0 A;  1R1V A;  2LKP A;  3E6M A;  4HV6 A;  4B4C A;  3GXO A;  2XSD C;  1O4X A;  2VAS A;  5F04 A;  2QA4 I;  1W36 C;  3QPH A;  2JZY A;  3W2A A;  2ZME C;  2V1X A;  3LFK A;  1YX3 A;  2A07 F;  5EZG A;  1VND A;  5JVT A;  2BY1 A;  3DQV C;  2GIZ A;  3MMY B;  2LKS A;  4C9Y A;  2NOJ B;  2OQG A;  3JAM K;  3H35 A;  4DOZ A;  2R3S A;  3CUQ B;  2KMU A;  1TP4 A;  1MBJ A;  3IHU A;  4ESF A;  4B3X A;  1P92 A;  3VEP A;  2OTL I;  2R5Z B;  1FY7 A;  3L7W A;  1ULY A;  1P2F A;  3BTI A;  4ENJ A;  1PVE A;  3ECH A;  3GW2 A;  2E19 A;  4CIC A;  2DK8 A;  2BVL A;  2HQN A;  4M3B A;  1T95 A;  5EYR A;  2M7A A;  3BT9 A;  4KMU X;  3ZCO A;  4D5C A;  2DDB A;  2DMP A;  3AG1 H;  1H8A C;  2H6C A;  1OCZ H;  3FXL A;  1WRJ A;  3CZ6 A;  4KN7 X;  4Y13 A;  3L9F A;  2P7C B;  1T38 A;  1BR2 A;  1BW5 A;  1WJF A;  1JKO C;  1USS A;  2BV6 A;  5DD8 A;  1SD5 A;  3MEX A;  2HDW A;  3WTT C;  4HRI A;  2R7V A;  4B44 A;  1SVO A;  3F3X A;  1E3H A;  2R93 J;  2PI0 A;  3U21 A;  1KZH A;  1ETQ A;  2M2E A;  1O3Q A;  3S1M J;  1T39 A;  5LHH A;  1D1C A;  3CP8 A;  4L9T A;  4GDF A;  2VOP A;  1XMK A;  5F08 A;  2AQF A;  3FM3 A;  2XAS A;  3KLN A;  4G6D A;  4OAZ A;  2R7X A;  1D5Y A;  4PZJ A;  5BNG A;  2WB1 A;  2DOF A;  1ODD A;  5FLX K;  2J5P A;  3DLA A;  5JHU A;  4BDY A;  3H9Q A;  3RZD J;  4LLN A;  2DU9 A;  5GAH J;  2JTV A;  2RRE A;  3V42 A;  4YFK F;  4MEY F;  4KIT B;  2ACJ A;  1WI3 A;  3M07 A;  5F1J A;  3OIO A;  1S72 I;  2HVQ A;  4PJL A;  5DTD A;  2RNJ A;  1T6S A;  5KK1 A;  5GP9 A;  2K4J A;  2M7B A;  2KT0 A;  4BQN A;  3DU5 A;  5E1X A;  2KIU A;  4A2U A;  1KQ8 A;  2IW5 A;  3VYU B;  2LF7 A;  5E3N A;  3E3V A;  2E1N A;  2OC6 A;  2ICW G;  4X0G A;  5M5Y J;  3WHB A;  3LQQ A;  3COA C;  3DP7 A;  5J40 A;  1BOB A;  3DTE A;  3HGY A;  5E18 F;  3GEZ A;  3QYB A;  1O3S A;  5L3B A;  5HLI A;  5FRN A;  3IP4 B;  2E60 A;  3J7A O;  1BR4 A;  1OJL A;  3GF2 A;  1T08 B;  4DNC A;  3C2G A;  3DTI A;  3C2H A;  5H2F C;  2KIQ A;  4MFE A;  2M45 A;  1YIT I;  2MYS A;  4FAS D;  2DTZ A;  2QSF X;  2FML A;  2K9L A;  4BBR J;  2VQH A;  2Y0S N;  1HBX G;  3M3Y J;  1Y6I A;  4AM3 A;  4G7O F;  1JKQ C;  3G2B A;  2ZME A;  3W6V A;  4JOM A;  1Z05 A;  5FKK A;  2VOO A;  1QBJ A;  1MMA A;  1YW7 A;  5IT9 Z;  1ENH A;  4A0X A;  1YX5 A;  4XBF A;  4BHP A;  2EFO A;  2VL8 A;  4MQ9 F;  2LOO A;  2A61 A;  1RRJ A;  4JX5 A;  1TL8 A;  2VKH A;  3ZQL A;  1S6L A;  5LD2 C;  1S7A A;  3RDI A;  1XTA A;  1FOW A;  4OIO F;  3GUD A;  2KJC A;  3S3N A;  3T5X A;  2A6T A;  3ZQI A;  2NYX A;  3RCO A;  3TOB A;  1U9N A;  4GRI A;  1MJA A;  2DBB A;  3IH3 A;  2QEX I;  1AKH B;  5GAG J;  2MGQ A;  4LG3 A;  1WH7 A;  1QRY A;  1JKP C;  2A69 F;  5ICC A;  2V79 A;  4AU7 A;  1W0U A;  1LFU P;  4A3C J;  1R5H A;  4Y52 J;  1KQ0 A;  4H0E A;  4F7Z A;  4X1E A;  2MW8 A;  2RQQ A;  5BPD A;  3TDU C;  5LHG A;  1W5T A;  2EFQ A;  3EET A;  3LSI A;  2R5Y A;  3RPQ A;  5D4R A;  2H1L A;  1X19 A;  4IHV A;  3J7Z I;  2W82 A;  2M87 A;  1OPC A;  3KZI C;  2DA5 A;  1SAN A;  1BI1 A;  1HW2 A;  1XSV A;  3E7L A;  2XKO A;  1H9G A;  5FKM A;  1L0O C;  3LSM A;  3LSR A;  4QPQ A;  4HA8 A;  1LFB A;  2CUF A;  3VSL A;  3WU0 A;  3WTZ A;  1J59 A;  3KYC B;  3QU3 A;  3SDG A;  1MMG A;  2I5U A;  3HXL A;  2B63 J;  5ILU A;  4OIQ F;  1YOV B;  2Y0M A;  2P5L C;  3H3V K;  1WJ5 A;  3Q0V A;  1UJ8 A;  1HSJ A;  1UHM A;  3BDD A;  4F3Q A;  2DOE A;  2LVS A;  1S7E A;  3JRA A;  4ENK A;  5BPI A;  5D6E A;  1DU0 A;  2K5C A;  2ZXI A;  2W57 A;  4PGH A;  3V7S A;  1NG6 A;  3OY9 A;  3GTJ J;  5DV5 A;  1RNL A;  4UNO A;  2E35 A;  2VQC A;  3P7N A;  1GXQ A;  2YSR A;  2GLO A;  2CW0 F;  4J19 A;  4QWQ A;  4RMN A;  2G0E A;  5EZH A;  5F27 A;  4CYC A;  4O6J A;  4RGR A;  4B48 A;  3NAU A;  3JRI A;  2O61 A;  4K2E A;  4E6K G;  3I4N J;  1FEX A;  3PL8 A;  4ENM A;  4RGS A;  1ZN2 A;  2O6G E;  2D1V A;  4G94 A;  2OZ6 A;  1OCO H;  2VJI A;  3PFY A;  4HOB A;  1XPX A;  2KRH A;  2KKO A;  2BBY A;  5BOX A;  4U0Y A;  4UVC A;  4ZYH A;  1WHU A;  2AHQ A;  3CD6 I;  2LK2 A;  2R7D A;  1JJ6 C;  2UXX A;  2R92 J;  1LPQ A;  1MNE A;  2HEO A;  1RR7 A;  2ZME B;  3WGI A;  2AXL A;  2WC2 A;  4PUS A;  3U2R A;  2LKX A;  1MBF A;  2XF5 A;  4HNU A;  5DUI A;  4S0H B;  2E2I J;  1A31 A;  1OCR H;  1Y1W J;  1OMI A;  2XAF A;  2NOG A;  5D8L B;  4G6T B;  3BTC A;  2Z2S B;  1HC8 A;  3MWM A;  3H5R A;  1GVD A;  2HU9 A;  4GCV A;  3CC7 I;  3HUG A;  3RKY A;  2XAG A;  1D8K A;  1ZG3 A;  2BY0 A;  3GZ5 A;  1MIJ A;  1QGP A;  4B8X A;  2VC1 A;  1R1T A;  3AL0 C;  1SFX A;  3RQI A;  1W7P A;  2PJR A;  1FZP B;  4XLN F;  4UV9 A;  1JUP A;  3DPU A;  2KZV A;  2ELH A;  5LGN A;  2WV0 A;  3IL2 A;  4IOA F;  4BU2 A;  1FMV A;  1JHF A;  2KRF A;  4YEL A;  5IT9 K;  3CCU I;  1GVJ A;  2KJB A;  4UXN A;  4EQQ A;  4IF4 A;  3S17 J;  2OD5 A;  3B02 A;  4L0Z B;  3CES A;  3FXK A;  4LJZ F;  3G3Z A;  1FOY A;  2IGM A;  3KP7 A;  1SFU A;  3W2V A;  2JA7 J;  3K1N A;  1I27 A;  3DEE A;  3F8N A;  3M8F A;  3HYI A;  4FE4 A;  4GGG A;  1VQM I;  1TWG J;  1YIJ I;  1IDZ A;  1I6H J;  2GXG A;  2V1D A;  1LNW A;  1IG7 A;  4IOC F;  4U87 A;  2NXN B;  1QZY A;  4M9X A;  4XRS G;  5IPA A;  1I1S A;  3I5U A;  1U6G A;  2DT5 A;  1O7L A;  4A0Y A;  2UXN A;  2DFH A;  4RGX A;  2DMQ A;  3CP2 A;  3HGG A;  1ZYR F;  4FX4 A;  4HQM A;  4KYW A;  2DOD A;  4BDZ A;  1I3Q J;  3JSO A;  2MFZ A;  4DBR A;  4A6E A;  1SFO J;  4IPA A;  1STZ A;  1YYV A;  2YX4 A;  2A05 A;  1MMS A;  2M9H A;  1X58 A;  2DFF A;  3RJP A;  4BXU A;  1Z6R A;  5E1W A;  4II3 A;  1H9T A;  1YTY A;  3KP3 A;  2A6H F;  1HKT A;  1IN7 A;  2JPC A;  2WAQ A;  4CCM A;  4ESJ A;  2QBY A;  1X2N A;  3CUQ C;  3O6B B;  4NC8 A;  4CYC B;  1OFC X;  3LST A;  2CUJ A;  3D5S C;  2HXI A;  3CMM A;  2EFW A;  5HLT A;  4XM3 A;  5F64 A;  2DO7 A;  3R61 A;  4HAM A;  1FBQ A;  1SFK A;  1AA7 A;  1J9I A;  1MBE A;  5HS8 A;  2QUF A;  4ENN A;  4C2M J;  5GTI C;  3OYM A;  5L3C A;  2NS7 A;  2KDZ A;  2NVT J;  4D9J A;  5J1U A;  3DWL E;  3HSR A;  4LK0 F;  2V6E A;  5CPR B;  2UWM A;  1SAU A;  2EFN A;  4KIF A;  1BIA A;  2A5W A;  1IXS B;  3N97 A;  1UAA A;  4RAZ A;  4MLO A;  3C3W A;  3HOZ J;  3G1O A;  3KET A;  2RGV A;  3ZQQ A;  5FKN A;  2QKL B;  5DCF A;  2COB A;  2HI3 A;  4L5E A;  1MND A;  3CO7 C;  5ILV A;  3QPL A;  2CRG A;  4KDP A;  2JA2 A;  1C0W A;  1R5I D;  4ZJZ A;  3GTO J;  3H5A A;  4DJA A;  2PFB A;  4F92 B;  1OQY A;  1Q1V A;  4HZF A;  2BY2 A;  1QHG A;  1YHQ I;  4AC0 A;  2VQG A;  1PP8 F;  5IP6 A;  4M72 A;  3FBN B;  1LVA A;  3K70 C;  3VWB A;  2F5C A;  5KNL A;  3AKZ A;  1K78 B;  3CJQ B;  2JUG A;  3PSF A;  1ETV A;  1VQ7 I;  4FTH A;  4NDL A;  4A69 C;  4LMY A;  2HGC A;  1XMX A;  1UB9 A;  3ZR8 X;  1MDM A;  3DKX A;  3EYY A;  1Y8Q B;  2JVG A;  3WE2 A;  2CO5 A;  2X6Y A;  1WJE A;  4YFX F;  4I6Z A;  1W0T A;  3IAM 2;  2HFH A;  1GXP A;  2Y69 H;  3PUF A;  3PNV A;  1A35 A;  2VJJ A;  4ESB A;  3HBL A;  3GTG J;  3HG9 A;  3JRB A;  2E7X A;  1D3Y A;  2EV6 A;  5L3E A;  1CF7 A;  4BAC A;  3HOS A;  3C18 A;  2W84 A;  1R23 A;  1ETO A;  3ABL H;  1KU3 A;  4CHU A;  1Y39 A;  4M6Y A;  3HRT A;  3DCF A;  4V2F A;  1BC7 C;  2WY8 Q;  3IKV A;  3P5J A;  3CUQ A;  1RET A;  2VB6 A;  2IA0 A;  4KIC A;  3OR2 C;  3FXO A;  2R5Z A;  4N0B A;  2L3D A;  1QVU A;  3I54 A;  3K4C A;  3S16 J;  3H0D A;  4MEX F;  2R7O A;  1VQ8 I;  3BG5 A;  5JR3 A;  3OL3 A;  1TC3 C;  3H3U A;  3EUA A;  2VBW A;  2X51 A;  4BGD A;  2F2E A;  3WTU C;  3Q0U A;  2O8X A;  5FRM A;  4XL9 A;  2FX0 A;  1TBX A;  2K4B A;  1N77 A;  4R79 A;  1JTX A;  3FIW A;  2CMP A;  1B1B A;  2XRL A;  3G73 A;  2HNH A;  2EIK H;  2F5E A;  1HDD C;  3IRR A;  5D6F A;  1XGN A;  4I09 A;  1ZH5 A;  1IRX A;  3FWE A;  5IYC J;  2FBK A;  3F6V A;  1RR8 C;  2L7K A;  2DFE A;  1QZZ A;  1XC5 A;  1GHC A;  2Y0S A;  4EJV A;  4A5N A;  1HKS A;  5HDK A;  4EM1 A;  4MNU A;  4UUS B;  4XN3 A;  2Y2Z A;  3S8P A;  3BRO A;  2XUB A;  1V4R A;  2UV1 A;  3ZRG A;  4ABZ A;  4IHS A;  3LQR A;  3GTL J;  2JN6 A;  4LK1 F;  2ISZ A;  1VQK I;  3CC4 I;  3F72 A;  2WA0 A;  2HR3 A;  4BKX A;  4ON0 A;  2QF7 A;  2NAZ A;  2LBF B;  2HQ5 A;  2M4K A;  1B8I A;  5FLM J;  4V2G A;  3TQN A;  3VPR A;  2DK5 A;  4HYE A;  4MGR A;  4XR6 A;  1O7F A;  2PJP A;  4NQW B;  1XSD A;  2ZJP F;  2RKH A;  4BEH B;  1VQ6 I;  3F22 A;  4BY7 J;  1XDS A;  3S1R J;  2HYF A;  4I01 A;  2DA4 A;  2PMU A;  3I3L A;  4JYK A;  5A2Q Z;  3U9G A;  1J5Y A;  2Z16 A;  3Q9S A;  4E4H A;  2IA1 A;  1OYY A;  3HPG A;  5DM6 F;  2HKO A;  4I7H A;  5ED4 A;  3BG7 A;  3KYL A;  3TP0 A;  4E7S A;  3OYD A;  2LP0 A;  2EZI A;  3PJR A;  3S1Q J;  3RYR A;  4M71 A;  4XLE A;  4FT8 A;  1MDM B;  2QGU A;  2QQA A;  3KEO A;  4P5O A;  3EUK L;  2O9L A;  3QOE A;  2DTR A;  1EA3 A;  1WJA A;  1B9N A;  1Z9C A;  3K10 A;  4G8X A;  3ASN H;  5IYB J;  2XDV A;  3VFZ A;  3TKY A;  4U0V A;  4BQO A;  2YU3 A;  4GFB A;  4I99 C;  4D7N A;  2VE9 A;  6PAX A;  3B6C A;  3ZMU A;  1E17 A;  3I55 I;  2Y31 A;  2ZSI B;  1YO5 C;  1GDT A;  4UB6 C;  3SDB A;  3ZXS A;  1A6Q A;  1D5V A;  1KA8 A;  3CDH A;  2HQR A;  3PIP F;  2IEK A;  3OR1 C;  2H1K A;  1SMY F;  4IHW A;  5M5X J;  1IXR C;  5CVJ A;  3RQ4 A;  5K1Y A;  4BXX J;  4RS8 A;  4OWR B;  3RPU D;  1UMQ A;  4RB1 A;  5KHD A;  2JRT A;  4XIC A;  1K4T A;  5LEK A;  1Z67 A;  4Q47 A;  3SFI A;  2CV2 A;  2O7O A;  2LFB A;  2WY7 Q;  2YS9 A;  2HZT A;  4KT5 C;  1AKH A;  1PUE E;  3PQK A;  4CH7 A;  1B6A A;  1J75 A;  2CFX A;  2L9S A;  5TGT A;  3ABT A;  2Z1D A;  3CLQ A;  3WGG A;  1QNT A;  2CFO A;  2HWV A;  5FD6 A;  5ERI A;  1DGW Y;  2VC0 A;  4HST A;  1K83 J;  2KLO A;  2XPW A;  3JR9 A;  1G3Y A;  4EJO A;  5J4V A;  2LRD A;  4P55 A;  4HNV A;  2ZJ2 A;  3OOU A;  1ZG1 A;  5AON A;  4EJU A;  1VQN I;  2ESH A;  5HDN A;  3OYN A;  4EJT A;  4BL0 B;  4BHB A;  3HTS B;  5EEG A;  1FWZ A;  4WWC A;  3CCY A;  1XN7 A;  2P6S A;  3G1M A;  4EGZ A;  3UNG C;  5LRR A;  2YR2 A;  4ZYE A;  4HV5 A;  4M9S A;  2X85 A;  2ELK A;  2P5V A;  3HRM A;  3S1N J;  1Z7L A;  1ZEL A;  3DKY A;  3I64 A;  5HS7 A;  2JJ7 A;  1X4P A;  1HST A;  4II2 A;  3V7R A;  1SC7 A;  1ZK8 A;  2PBI A;  2XPV A;  4KNY A;  1HDP A;  1R7J A;  4Y4R A;  5DD4 A;  3LA3 A;  3K4J A;  1E3P A;  1MJ9 A;  4XLP F;  2Y9Y A;  5ICE A;  3GFJ A;  2M34 A;  3WU1 B;  1TQP A;  1POG A;  4RAF A;  1IUF A;  2KZG A;  3JRE A;  1FOX A;  3ZP5 A;  1FTT A;  3ZMV A;  3PNY A;  1VQL I;  4KT6 A;  1K6Y A;  2BHZ A;  3GZ6 A;  1T98 A;  2M8E A;  4I0B A;  3V8L A;  4AIK A;  1FP2 A;  3KEY A;  1FLI A;  2E2J J;  2N8G A;  1I50 J;  4FIS A;  4OIR F;  4ZH4 F;  4LG0 A;  1UFM A;  5AIP A;  3KYD B;  4CUG A;  2LY1 A;  2QCO A;  2QM3 A;  1Y56 A;  3DXJ F;  1FP1 D;  3K1P A;  3SJM A;  1S8N A;  4WXD A;  2R7W A;  4XLA A;  4BS9 A;  1BC8 C;  3CCJ I;  4E7J A;  1MKM A;  1FMW A;  3R4K A;  5B1A H;  4ZC3 A;  1O3T A;  3BC8 A;  1KQ9 A;  3KEQ A;  5F0C A;  5J3L A;  5HDG A;  3IH4 A;  4C2U A;  1K4S A;  5EEH A;  3FX3 A;  2GWR A;  2B0L A;  3GTQ J;  2EZK A;  2Q1Z B;  3OWT A;  3ZGK A;  3MKZ A;  4E7K A;  3QAH A;  3CO6 C;  3HOU J;  1EJ9 A;  4XRM A;  5A2Q K;  3M8J A;  3LL7 A;  2HTS A;  3W6K B;  2G7U A;  1JGS A;  2EK5 A;  2ADU A;  4CCK A;  2RDP A;  1B8I B;  1XCB A;  3P9C A;  3SYT A;  2L54 A;  1DP7 P;  3JRF A;  2EV0 A;  2DW4 A;  4AVZ A;  2BVM A;  2I8D A;  4IHX A;  3IC7 A;  1Z3Y A;  3FZV A;  5B5E C;  5LFA A;  3EUH C;  2BW3 B;  2L7F P;  5K7F A;  2W4S A;  3T8T A;  3HIF A;  1UHS A;  1FYK A;  4PFO A;  2YX7 A;  4D1Q A;  3CLO A;  5FKL A;  3ABK H;  1YIO A;  2STW A;  3OYE A;  1BI3 A;  1BA5 A;  3S3M A;  3ZMZ A;  3BCB A;  2C6Y A;  4RAG A;  4M3E A;  1RI7 A;  1IN4 A;  1H88 C;  4PJ0 C;  1D0X A;  3K2Z A;  4IRI A;  2KDO A;  2P0W A;  1FNN A;  3L00 A;  2HDC A;  2YPR A;  1L3L A;  4MO7 A;  1MBG A;  2XB5 A;  5H6R A;  1T0F C;  4M6X A;  5J6X A;  5F1R A;  2W00 A;  2XGX A;  2GM4 A;  4L9N A;  2R7U A;  1APL C;  3GTM J;  1I6X A;  3FK7 A;  1W36 D;  2P7V B;  2HVS A;  4RDU A;  1SD6 A;  3WHC A;  1V5E A;  1IC8 A;  3KCC A;  3JCU C;  3KX2 A;  4RGU A;  2M5W A;  2CQQ A;  3E1S A;  3QYE A;  1J7K A;  4DYQ A;  2DMT A;  4G7H F;  3FHZ A;  2FRH A;  1XG1 A;  3L2W A;  3NRV A;  2HOE A;  1JI8 A;  2GBY A;  5DCM A;  2HYG D;  3RTR A;  1V3F A;  4XID A;  4HDU A;  1VQ5 I;  1G8X A;  3ZOB A;  3BPV A;  4B3A A;  3K4K A;  2OCC H;  4PSW A;  2BGC A;  3EQL F;  3WTW C;  1U5T C;  4U88 A;  4RA2 A;  2NVU B;  1IXC A;  3LSG A;  2WAE A;  2IBD A;  4XOR A;  1S7O A;  1V54 H;  2L9V A;  3CCE I;  3FXJ A;  3TW7 A;  1MBK A;  2I10 A;  3GME A;  4DQ2 A;  1XGM A;  2ZKZ A;  2OJE D;  3F6O A;  2VN2 A;  4ANJ A;  3VYR B;  3MKL A;  4EM0 B;  2V1N A;  5GAE J;  3Q5F A;  1W4M A;  3HRS A;  2A6E F;  2H94 A;  1Z91 A;  1IV8 A;  1LFP A;  2W1O A;  4YG2 F;  1AWC A;  3Q0W A;  1SFE A;  3I4P A;  4XLF A;  3CC2 I;  4DZJ A;  4XRF A;  4J00 A;  3FXM A;  4LG0 B;  3R0J A;  5EDN A;  5E1Z B;  2EBI A;  3HTU A;  2ZJR F;  3FF5 A;  4X6A J;  3S3O A;  2QYO A;  4ITV A;  3HZJ A;  4CCJ A;  3ZMD A;  3HHH A;  1XSX A;  2GAU A;  3FMR A;  2CQN A;  5FJ8 J;  2PMZ N;  2O3F A;  2DAO A;  3FHN A;  4C2T A;  1ZGW A;  1YQA A;  2CWE A;  4W97 A;  2GIV A;  3RYP A;  2STT A;  2RNG A;  1V5F A;  3HKZ A;  3VDX A;  3CMY A;  5L3F A;  1YW8 A;  1LQ1 A;  4V19 K;  2IGN A;  1EH7 A;  2HTJ A;  3L09 A;  3F21 A;  3TP3 A;  2JRM A;  1FPQ A;  5LGU A;  3GTP J;  3SHF A;  2V1U A;  3N05 A;  2FD5 A;  3HSE A;  2K9N A;  2VKV A;  3IUO A;  4IRH A;  2X6X A;  3E6B A;  1G4D A;  3ULQ B;  4CCN A;  2KFD A;  2X6O A;  2G7H A;  3IWZ A;  3E5X A;  1R36 A;  1MMD A;  3S93 A;  4QSH A;  4HW0 A;  1X1B A;  1MNM C;  3QP5 A;  1R1U A;  1F1Z A;  2DI3 A;  2EQR A;  1Z21 A;  2P4W A;  3FDY A;  3GLL A;  3M9A A;  4CSW A;  3LFU A;  1QU3 A;  2ZSH B;  2ID6 A;  2VBY A;  4U0W A;  1UCR A;  3I4M J;  4YFN F;  5FFX A;  3PSI A;  3MKW B;  4RB0 A;  5C4J J;  4IHY A;  4IQJ A;  1GV5 A;  3CME I;  3NWT A;  3BWG A;  3WE3 A;  4C3J J;  2R7Z J;  4A93 J;  1T0F A;  1T33 A;  2W85 A;  4U7B A;  4JX4 A;  4Y33 A;  4HF1 A;  4A3L J;  1YE9 A;  1K78 A;  3OS2 A;  2DA2 A;  1A36 A;  2FE3 A;  5K5R A;  1G2H A;  4XLC A;  4RB3 C;  1Y0N A;  4DYC A;  5K5O A;  3M7G A;  2CG4 A;  1P4W A;  2ETH A;  2GQQ A;  4A12 A;  1WH5 A;  2CW7 A;  1K61 A;  4O3M A;  2L01 A;  3ERM A;  3FKJ A;  4LFU A;  4W1U A;  4B43 A;  4HNT A;  4MIM A;  4N9H A;  4EV0 A;  4UHT A;  5GTH C;  1YI2 I;  3SXY A;  4F52 A;  3CMA I;  3DEW A;  4BNC A;  2F48 A;  2PG4 A;  4PSX A;  1LDJ A;  3CJT B;  1MGT A;  2XV4 S;  5JHF A;  1XGO A;  3HOX J;  4HQE A;  3GFM A;  1MSE C;  3EDP A;  1ZAR A;  2Q0O A;  3MFK A;  2WV1 A;  2RV8 A;  1YJN I;  2RAE A;  1F9N A;  1ETY A;  1U5T A;  3A01 B;  1QPI A;  2VXZ A;  3ABU A;  2JMW A;  4EEF G;  2GA2 A;  2OV7 A;  2FU4 A;  1JJ8 C;  3KLO A;  3S2H J;  4Z2Y A;  2PLY A;  5DCM B;  2XF7 A;  2YUS A;  1VQO I;  3QP6 A;  4L5J A;  2PN6 A;  4DW6 A;  3L1P A;  1SAX A;  3RIR A;  4XKW A;  3CTA A;  1W7P D;  5M3M J;  2R7S A;  3BQY A;  2L02 A;  1RZ4 A;  4C30 A;  5DS9 A;  2MH9 A;  3ZQC A;  1BL0 A;  5EEA A;  3H0G J;  3BTJ A;  5GPC A;  1WKM A;  4DBQ A;  3JRH A;  1BN5 A;  1N78 A;  1IRG A;  4J01 A;  3Q9V A;  3K4B A;  5D4S A;  4M74 A;  2CV0 A;  2XSJ C;  2JT1 A;  1OYI A;  3K2A A;  2O03 A;  1IRF A;  1VTN C;  1P7J A;  5GAD J;  2JSC A;  3S2W A;  2DN0 A;  1ON2 A;  5CQG A;  3CF5 F;  3K0L A;  1ZRE A;  5HNF A;  1X3W B;  3I9V 2;  5E17 F;  2V4J C;  3OYJ A;  3TMO A;  3VSK A;  3WG7 H;  3BZ6 A;  3ISP A;  5DEQ A;  4IXA A;  1HF0 A;  4FHT A;  4ASN A;  3KPH A;  1ZGJ A;  3AFH A;  4HSR A;  2GOM A;  2AS5 F;  1HOM A;  2DYR H;  3TL4 X;  2PEX A;  3GWZ A;  3RZO J;  2F5F A;  4DGW B;  3TGN A;  5B3S H;  1JUS A;  3A02 A;  2CUE A;  1G59 A;  4UUS A;  4EMS A;  3BR2 A;  2D1H A;  4JQF A;  2DA7 A;  3HOV J;  1G3S A;  1ZG5 A;  5LBQ A;  2LLK A;  4CZZ A;  1OR7 C;  2DLL A;  3QPS A;  5CVI A;  1ZLJ A;  2IVM A;  4R1H A;  4BYY A;  3ONQ A;  3S14 J;  2ZCW A;  3LSP A;  5FO5 A;  2LBF A;  3HDD A;  1O3R A;  4LB5 A;  2PMH A;  1Z6T A;  4BJ5 C;  2MC4 A;  3GBG A;  4NQW A;  1Q1H A;  3F8M A;  4BEH A;  2EFP A;  3ZN0 A;  3M1E A;  4EM2 A;  2V9V A;  3TO6 A;  1UEL B;  3NWS A;  4KUM A;  4FE7 A;  5LLQ A;  3V8K A;  2W24 A;  1TNS A;  4M3D A;  1OCP A;  3MCZ A;  4FX0 A;  5BMZ A;  2D5V A;  3F8C A;  2L9R A;  3GVA A;  4A3I J;  3WTS C;  1RIO H;  2J5O A;  3GO5 A;  1R58 A;  3T0Y A;  3ECO A;  2E7W A;  5E8I A;  3HOT A;  2LNB A;  3O3K A;  2H8W A;  1F36 A;  3G1L A;  3VYT B;  3L2C A;  3I53 A;  2ZXJ A;  2L7Z A;  3PM1 A;  4A3J J;  2ZFW A;  2PX9 A;  3KP5 A;  1DDN A;  2VJ4 A;  2FQ4 A;  2RQP A;  2CH0 A;  1Z77 A;  4IL6 C;  1JTY A;  2RVC A;  4AIH A;  4BQA A;  4I98 B;  4RAY A;  2DJI A;  1YRN B;  3BR3 A;  1X4O A;  2Q2E B;  4ZDP A;  2L4M A;  2E71 A;  3OS1 A;  1R49 A;  1X1P A;  2NS8 A;  2DMN A;  2UZK A;  4NBQ A;  4PJJ A;  4P1W A;  2DQL A;  4F91 B;  1XS9 A;  5B1B H;  1BI0 A;  1U5T B;  4PJN A;  2L4A A;  1ACI A;  2HKX A;  1YFH A;  5J1R A;  1RUO A;  2EZH A;  3M8E A;  1OKR A;  4FET A;  1UZC A;  2LSO A;  2QZ8 A;  1FBS A;  4AYB N;  1U3E M;  2BOL A;  2K9M A;  1B59 A;  3ESW B;  1P4X A;  2ZBK A;  4CXF A;  4OIN F;  3U1K A;  1ZGA A;  2IAI A;  1P9Q C;  3E5U A;  1DGR M;  2FF4 A;  4TV7 A;  2NNN A;  3K7A J;  4XQF A;  1J2X A;  3JTG A;  2FBI A;  1IF1 A;  4XSZ F;  4N4O B;  3MAJ A;  2OUM A;  3I0T A;  1A5J A;  4HPQ A;  3JW4 A;  1D1A A;  2LDU A;  2HDD A;  4M73 A;  5E79 C;  2KIS A;  5HLG A;  4WK8 F;  2DT7 B;  3E6C C;  4XKV A;  3H92 A;  4LB6 B;  2JA5 J;  2NVX J;  5IP7 J;  4G9Y A;  5F6F A;  1WCM J;  3HRU A;  4IVN A;  3QOP A;  5HVQ C;  1CGP A;  1PUF B;  3E6D A;  2DMU A;  3EYI A;  2MAB A;  3OIQ A;  3V8J A;  3CCR I;  5LEJ A;  2Z33 A;  3BLY A;  1EV7 A;  4P96 A;  5CYV A;  1E0E A;  5DDG A;  2JVH A;  2KRC A;  2XF6 A;  1QHH D;  3KP2 A;  2JWT A;  1XCV A;  1JXS A;  1OR7 A;  3FBI B;  1OIS A;  1B9M A;  2BY3 A;  2O8K A;  2V9P A;  3EPZ A;  1FTZ A;  2MLG A;  3J81 Z;  1RES A;  2FJ1 A;  2X1E A;  4H4K C;  2DFI A;  1T8I A;  1RKW A;  1MW7 A;  4QIW N;  2E34 A;  2XHK A;  2IP2 A;  3S2D J;  2MC3 A;  2OU2 A;  3W2W A;  1FT9 A;  1MD0 A;  2D2W A;  3QWL A;  3HOW J;  3O8G A;  2F4I A;  1YJW I;  4OMY A;  3ZQH A;  4E7H A;  4IEJ A;  4L9V A;  3TDZ C;  3BR5 A;  3AAF A;  4XLH A;  1HCR A;  2GXA A;  1XDU A;  1ZRD A;  3DF8 A;  1WZ2 A;  1R71 A;  4YIR X;  1YLF A;  1N75 A;  2F5V A;  4NC6 A;  3RKX A;  3O2P E;  2QQB A;  3CDI A;  2R4G A;  3HEF A;  3E0J B;  2DOA A;  5E8G A;  1S3J A;  2WWY A;  4Y15 A;  5IYD J;  2MD0 A;  1JE8 A;  1S9H A;  4XN0 A;  5EGO A;  2V26 A;  5ICF A;  3BZK A;  5D5V B;  2M0M A;  3GCM A;  2K02 A;  1VF9 A;  4LGW A;  5HLH A;  1TT0 A;  1MBH A; 
#chains in the Genus database with same CATH homology
 1B4A A;  2FNA A;  3LWF A;  4L9J A;  4A5M A;  3W6J B;  1F4K A;  1F5T A;  1XMA A;  1LEB A;  3GYH X;  4WXC A;  5DYM A;  5TJJ A;  2HS5 A;  1S29 A;  1P6R A;  4GXO A;  1WSU A;  2IT0 A;  4YII A;  4NHJ A;  3I59 B;  1IN6 A;  4CYD A;  1TTY A;  2RC4 A;  4P9U A;  1OYW A;  2DPU A;  4HF2 A;  2ESN A;  2Z9O A;  2ZO4 A;  1JHH A;  3DKW A;  2QLZ A;  4MTD A;  2R7F A;  4BH9 A;  2CYY A;  4O5V A;  1P4A A;  1ZAO A;  4HBL A;  1TNT A;  3MQ0 A;  1QPM A;  2WTE A;  2EV5 A;  3WTX C;  1K79 A;  3ZN1 A;  1LDK B;  2FA5 A;  1WQ2 A;  2GXB A;  3F8F A;  4HDV A;  4WF2 A;  1R00 A;  1SMT A;  1YS7 A;  3GLX A;  4E70 A;  1FC3 A;  4B09 A;  3KZZ A;  2A5Y B;  5HOO A;  2XIG A;  3GFI A;  5J8C A;  2XRN A;  2ISY A;  4G6Q A;  1FSE A;  1AOY A;  3SZT A;  1XB4 A;  4OIP F;  2BYV E;  1EH8 A;  3BY6 A;  1WI9 A;  2MH2 A;  4PGG A;  4UUV A;  3R0A A;  3SZP A;  4Y17 A;  2FNP A;  1YW9 A;  2PQ8 A;  1UST A;  1BM9 A;  4XSX F;  3J81 K;  2MLK A;  3MZY A;  2ZNY A;  1HQC A;  3BP8 A;  5BS6 A;  2A68 F;  5FGM A;  3KFW X;  3ML6 A;  4L0Y B;  3E5Q A;  1H0M A;  3ZMT A;  3WTY C;  2M1B A;  1TW3 A;  3WTV C;  4IRG A;  2P8T A;  1U8R A;  5L3G A;  3KE2 A;  3K69 A;  1DPU A;  3REO A;  2IJL A;  2DQR A;  3QU6 A;  1BI2 A;  4OOI A;  2GA1 A;  2BEO A;  1LEA A;  1Z1D A;  1ZHF A;  4PCQ A;  3DPL C;  4UVB A;  2CSO A;  4HX4 A;  4CGZ A;  2TDX A;  2H27 A;  4I02 A;  3DEU A;  1IN8 A;  5JFR A;  2NS0 A;  4PDK A;  4IJA A;  2EJR A;  3SQN A;  1DUX C;  4UV8 A;  3V7C A;  4ZYD A;  1FBU A;  1A04 A;  2VT3 A;  3T8R A;  4AWX B;  3NQO A;  4A6D A;  3D0S A;  1TQM A;  1BBY A;  3IKT A;  2FSW A;  2IA2 A;  5LHI A;  3FXQ A;  4I2O A;  3QRF F;  3RKW A;  4KA4 A;  3D5L A;  5CVR A;  4WX9 A;  4ZZL A;  4KMF A;  4Q4Z F;  3T1B A;  1T2K A;  5TRD A;  2ZNZ A;  4GYG A;  3MZH A;  2XAJ A;  2H6B A;  3BJO A;  3FMS A;  3KP6 A;  4BHC A;  2DPD A;  1UHW A;  1K7A A;  5CLS A;  1HW5 A;  4AD9 A;  5FB2 A;  2F5D A;  1FYM A;  3ZPL A;  2P5K A;  3CUO A;  2KIM A;  4UVA A;  3NEU A;  4Q5S F;  5D8K B;  5JI6 A;  2QWW A;  5DUK A;  1DPR A;  3C1D A;  2H09 A;  2EA2 A;  3K9T A;  3EUH A;  3TOA A;  3GX4 X;  4GYI A;  1IUY A;  2Y48 A;  2MA3 A;  2W25 A;  5J8F A;  4MHG A;  2QVO A;  4KN4 X;  4MQV A;  2Q8K A;  1R5G A;  1KU7 A;  5ICG A;  4AVP A;  3DV8 A;  1G3W A;  4OU0 A;  1FOK A;  5FFZ A;  3OV8 A;  3J80 Z;  2EB7 A;  4ZYG A;  2D45 A;  4AIJ A;  2K86 A;  2NRA C;  1KYZ A;  2VE8 A;  2RN7 A;  2BE5 F;  1MZB A;  5D5X B;  2O0Y A;  2Q2E A;  1NHA A;  2G9W A;  2VON A;  1IZ1 A;  3I71 A;  4JK1 X;  1HW1 A;  3LAJ A;  2IRF G;  4BAY A;  3KP4 A;  3N4M A;  4Q48 A;  1LDD A;  2Z99 A;  2OAZ A;  1IAW A;  2FBH A;  2EA4 A;  4NB5 A;  5H6Q A;  3FXU A;  2IPQ X;  3F23 A;  4JBA A;  1YG2 A;  3DPT A;  2XRO A;  1PDN C;  4ETS A;  5FD5 A;  1G6N A;  2V6C A;  3CJN A;  4L5I A;  3BOQ A;  1MJB A;  2XKP A;  2QQ9 A;  3VB2 A;  2QEN A;  1R22 A;  1QQI A;  1HKQ A;  3RI4 A;  3QPT A;  2MD5 A;  1WWX A;  4EGY A;  3LA7 A;  4QLC U;  3ERE D;  4LD5 A;  1E2X A;  2K27 A;  2GZW A;  3TO7 A;  3B73 A;  4D0P A;  4CO8 A;  3BJA A;  1KU2 A;  2XAH A;  3P9I A;  4HX7 A;  3C7J A;  4EVI A;  2VBX A;  2FXA A;  1TW2 A;  2XAQ A;  3R60 A;  4KIB A;  1XD7 A;  3HSF A;  3OOP A;  3U1D A;  5BQT A;  1RUN A;  4N9I A;  5KVR A;  4LLL A;  1PP7 U;  3F8B A;  4YIF A;  1SD7 A;  3VOD A;  2KIF A;  5IT3 A;  4KFC A;  4KIG A;  3VOE A;  1BJA A;  1SD4 A;  1W7P B;  2P6T A;  4S04 A;  1I1G A;  3IWF A;  4HF0 A;  4R8H A;  3GFL A;  2CGP A;  2VOD A;  3I59 A;  1W5S A;  3J80 K;  1U2W A;  5LGT A;  2NNY A;  4WCG A;  1ZRF A;  3JAM Z;  1ZLK A;  1G3T A;  1ZRC A;  3ZQ7 A;  1FSH A;  1KYW A;  5L3D A;  5CVU A;  4P9F A;  2FMY A;  3KZY A;  1TQI A;  2LF8 A;  4M9Z A;  4L18 B;  1IW7 F;  1KU9 A;  1J0R A;  1ONV A;  3DFG A;  2MBF A;  1IN5 A;  1LB2 A;  4MTE A;  1Y0U A;  3WG9 A;  3BJ6 A;  2M30 A;  2OZU A;  3H3Z A;  2VBZ A;  3IRQ A;  1REP C;  2EWN A;  5AIQ A;  2OQR A;  1FX7 A;  2QBY B;  5E20 A;  1XGS A;  3ZMS A;  5D5W B;  5FLX Z;  4I0A A;  5HS9 A;  4A0Z A;  2Z5U A;  3WOD F;  4RB2 C;  3TO9 A;  4WXH A;  3FXR A;  3R6S A;  2Z3Y A;  3V4G A;  1LJ9 A;  5H20 A;  2CQK A;  1BOA A;  1TLH B;  3ELK A;  3BPX A;  4G7Z F;  4CDG A;  2FQ3 A;  3WGH A;  2E1C A;  2OBP A;  3K1M A;  3JSP A;  1HXD A;  4GO1 A;  1K6O A;  3P9K A;  3LAP A;  1FYL A;  1BIB A;  5CJ9 A;  4S05 A;  2Y75 A;  2K7L A;  2XVC A;  1X3U A;  2A3S A;  5K5Q A;  2VT2 A;  1D8J A;  1QO0 D;  3RPU A;  3FMQ A;  4ZZD A;  3LA2 A;  5ILS A;  5D5U B;  1KGS A;  4OMZ A;  1EH6 A;  3FM5 A;  4EJW A;  1U78 A;  3JTH A;  4IHT A;  2X4H A;  2COM A;  4HLX A;  3HHG A;  5LRS A;  2FEZ A;  4U7D A;  4HX8 A;  1ON1 A;  1Z7U A;  3E97 A;  3PQJ A;  1O57 A;  1I5Z A;  2FOK A;  3SFZ A;  4HLY A;  1YS6 A;  3I58 A;  3PFI A;  2OA4 A;  3ROU A;  2X0L A;  5CVV A;  4LLG F;  2JPB A;  1CF7 B;  1R1V A;  2LKP A;  3E6M A;  4HV6 A;  3GXO A;  3QPH A;  2JZY A;  2V1X A;  3LFK A;  2A07 F;  5JVT A;  3DQV C;  3JAM K;  2OQG A;  2R3S A;  3CUQ B;  3IHU A;  4ESF A;  1P92 A;  3VEP A;  1FY7 A;  3L7W A;  1ULY A;  1P2F A;  4ENJ A;  3ECH A;  3GW2 A;  4CIC A;  2DK8 A;  2HQN A;  4KMU X;  2H6C A;  1WRJ A;  4KN7 X;  4Y13 A;  3L9F A;  2P7C B;  1T38 A;  1USS A;  2BV6 A;  5DD8 A;  1SD5 A;  3MEX A;  3WTT C;  3F3X A;  2PI0 A;  1O3Q A;  1T39 A;  5LHH A;  4L9T A;  2VOP A;  1XMK A;  4G6D A;  3FM3 A;  2XAS A;  3KLN A;  4PZJ A;  5FLX K;  1ODD A;  2J5P A;  5JHU A;  4LLN A;  2DU9 A;  2JTV A;  4YFK F;  4MEY F;  2ACJ A;  2RNJ A;  1T6S A;  5KK1 A;  2K4J A;  5E1X A;  2KIU A;  4A2U A;  1KQ8 A;  2IW5 A;  2LF7 A;  3E3V A;  2E1N A;  3COA C;  3LQQ A;  3DP7 A;  5E18 F;  3GEZ A;  1O3S A;  5L3B A;  5HLI A;  3J7A O;  3GF2 A;  4DNC A;  2M45 A;  2FML A;  1HBX G;  4G7O F;  2ZME A;  1Z05 A;  2VOO A;  1QBJ A;  1YW7 A;  5IT9 Z;  4A0X A;  4XBF A;  4BHP A;  2EFO A;  4MQ9 F;  2A61 A;  1S6L A;  1S7A A;  3RDI A;  4OIO F;  3GUD A;  2KJC A;  3T5X A;  2NYX A;  3TOB A;  1MJA A;  2DBB A;  2A69 F;  5ICC A;  2V79 A;  1R5H A;  1KQ0 A;  4H0E A;  4F7Z A;  5BPD A;  3TDU C;  5LHG A;  1W5T A;  2EFQ A;  3EET A;  3RPQ A;  5D4R A;  2M87 A;  1OPC A;  1BI1 A;  1HW2 A;  1XSV A;  2XKO A;  1H9G A;  1L0O C;  4HA8 A;  3WU0 A;  3WTZ A;  1J59 A;  3QU3 A;  5ILU A;  4OIQ F;  2Y0M A;  2P5L C;  1HSJ A;  1UHM A;  3BDD A;  4ENK A;  5BPI A;  5D6E A;  2W57 A;  4PGH A;  3V7S A;  5DV5 A;  1RNL A;  4UNO A;  3P7N A;  1GXQ A;  2YSR A;  2CW0 F;  4QWQ A;  4O6J A;  4RGR A;  2O61 A;  4K2E A;  4ENM A;  4RGS A;  1ZN2 A;  2O6G E;  2D1V A;  4G94 A;  2OZ6 A;  4HOB A;  2KKO A;  2BBY A;  5BOX A;  4U0Y A;  4UVC A;  4ZYH A;  2R7D A;  2UXX A;  2HEO A;  2ZME B;  3WGI A;  2AXL A;  2WC2 A;  3U2R A;  5DUI A;  1OMI A;  2XAF A;  5D8L B;  3MWM A;  4GCV A;  3HUG A;  3RKY A;  2XAG A;  1D8K A;  1ZG3 A;  3GZ5 A;  1QGP A;  4B8X A;  2VC1 A;  1R1T A;  1SFX A;  1W7P A;  1FZP B;  4XLN F;  4UV9 A;  5LGN A;  2ELH A;  2WV0 A;  3IL2 A;  1JHF A;  2KRF A;  5IT9 K;  1GVJ A;  2KJB A;  4UXN A;  4EQQ A;  4IF4 A;  2OD5 A;  3B02 A;  4L0Z B;  4LJZ F;  3G3Z A;  3KP7 A;  1SFU A;  3K1N A;  1I27 A;  3F8N A;  3M8F A;  3HYI A;  4GGG A;  2GXG A;  2V1D A;  1LNW A;  1QZY A;  4M9X A;  1I1S A;  3I5U A;  1U6G A;  2DT5 A;  1O7L A;  4A0Y A;  2UXN A;  4RGX A;  1ZYR F;  4FX4 A;  4HQM A;  4KYW A;  3JSO A;  4A6E A;  4IPA A;  1STZ A;  1YYV A;  2YX4 A;  3RJP A;  4BXU A;  1Z6R A;  5E1W A;  1H9T A;  1HKT A;  1YTY A;  3KP3 A;  2A6H F;  1IN7 A;  2JPC A;  4ESJ A;  2QBY A;  3CUQ C;  3O6B B;  3LST A;  2EFW A;  5F64 A;  2DO7 A;  3R61 A;  4HAM A;  1FBQ A;  1J9I A;  5HS8 A;  2QUF A;  4ENN A;  5L3C A;  2UWM A;  3HSR A;  4LK0 F;  2EFN A;  4KIF A;  1BIA A;  1IXS B;  3N97 A;  4RAZ A;  3C3W A;  3KET A;  2RGV A;  5DCF A;  3CO7 C;  5ILV A;  4KDP A;  1C0W A;  2PFB A;  4HZF A;  1PP8 F;  4M72 A;  1LVA A;  2F5C A;  1K78 B;  4LMY A;  2HGC A;  1UB9 A;  1MDM A;  3EYY A;  3WE2 A;  2CO5 A;  4YFX F;  2HFH A;  1GXP A;  4ESB A;  2E7X A;  1D3Y A;  2EV6 A;  5L3E A;  1CF7 A;  3HOS A;  3C18 A;  2W84 A;  1R23 A;  1KU3 A;  4CHU A;  4M6Y A;  3HRT A;  1BC7 C;  3IKV A;  3CUQ A;  2IA0 A;  4KIC A;  4N0B A;  2L3D A;  3I54 A;  4MEX F;  5JR3 A;  3H3U A;  2VBW A;  2F2E A;  3WTU C;  2O8X A;  1TBX A;  2K4B A;  4R79 A;  1B1B A;  3G73 A;  2F5E A;  3IRR A;  5D6F A;  1XGN A;  4I09 A;  1ZH5 A;  3FWE A;  2FBK A;  3F6V A;  1QZZ A;  1GHC A;  4EJV A;  4A5N A;  1HKS A;  5HDK A;  4EM1 A;  4MNU A;  3BRO A;  2XUB A;  1V4R A;  4IHS A;  3LQR A;  4LK1 F;  2ISZ A;  3F72 A;  2HR3 A;  4ON0 A;  2NAZ A;  3TQN A;  2DK5 A;  4HYE A;  4MGR A;  1O7F A;  2PJP A;  1XSD A;  2RKH A;  3F22 A;  1XDS A;  2HYF A;  4I01 A;  2PMU A;  5A2Q Z;  3U9G A;  1J5Y A;  3Q9S A;  2IA1 A;  1OYY A;  2HKO A;  4I7H A;  5ED4 A;  3RYR A;  4M71 A;  1MDM B;  4FT8 A;  2QQA A;  3KEO A;  4P5O A;  2DTR A;  1B9N A;  1Z9C A;  4G8X A;  3VFZ A;  3TKY A;  4U0V A;  2YU3 A;  2VE9 A;  6PAX A;  3ZMU A;  1E17 A;  1YO5 C;  1D5V A;  1KA8 A;  3CDH A;  2HQR A;  1SMY F;  1IXR C;  5CVJ A;  5K1Y A;  4RS8 A;  4RB1 A;  2JRT A;  5LEK A;  4Q47 A;  4KT5 C;  2HZT A;  1PUE E;  3PQK A;  1B6A A;  1J75 A;  2CFX A;  3ABT A;  3WGG A;  1QNT A;  2HWV A;  5FD6 A;  5ERI A;  2VC0 A;  1G3Y A;  4EJO A;  4P55 A;  2ZJ2 A;  1ZG1 A;  5AON A;  4EJU A;  2ESH A;  5HDN A;  4EJT A;  3HTS B;  4BHB A;  5EEG A;  1FWZ A;  4WWC A;  1XN7 A;  2P6S A;  4EGZ A;  5LRR A;  2YR2 A;  4ZYE A;  4HV5 A;  4M9S A;  2P5V A;  3HRM A;  3I64 A;  5HS7 A;  1HST A;  3V7R A;  2PBI A;  4KNY A;  1R7J A;  5DD4 A;  3LA3 A;  1MJ9 A;  4XLP F;  5ICE A;  3GFJ A;  3WU1 B;  1TQP A;  3ZP5 A;  3ZMV A;  3GZ6 A;  1T98 A;  2M8E A;  4I0B A;  3V8L A;  4AIK A;  1FP2 A;  1FLI A;  4OIR F;  4ZH4 F;  4LG0 A;  1UFM A;  5AIP A;  2QM3 A;  3DXJ F;  1FP1 D;  3K1P A;  1S8N A;  4WXD A;  1BC8 C;  1MKM A;  3R4K A;  1O3T A;  3KEQ A;  1KQ9 A;  5HDG A;  5EEH A;  3FX3 A;  2GWR A;  2B0L A;  3QAH A;  3CO6 C;  5A2Q K;  2HTS A;  3W6K B;  2G7U A;  1JGS A;  2EK5 A;  2ADU A;  2RDP A;  1XCB A;  3P9C A;  2L54 A;  1DP7 P;  2EV0 A;  2DW4 A;  3IC7 A;  3FZV A;  3T8T A;  3HIF A;  1FYK A;  2YX7 A;  3CLO A;  2STW A;  1YIO A;  1BI3 A;  3ZMZ A;  2C6Y A;  1RI7 A;  1IN4 A;  3K2Z A;  4IRI A;  1FNN A;  3L00 A;  2HDC A;  2YPR A;  1L3L A;  5H6R A;  4M6X A;  5J6X A;  5F1R A;  2XGX A;  4L9N A;  1I6X A;  2P7V B;  1SD6 A;  3KCC A;  4RGU A;  2M5W A;  1J7K A;  4G7H F;  3FHZ A;  2FRH A;  3NRV A;  2HOE A;  5DCM A;  2HYG D;  3RTR A;  1V3F A;  4HDU A;  3BPV A;  2BGC A;  3EQL F;  3WTW C;  1U5T C;  4U88 A;  1IXC A;  1S7O A;  4DQ2 A;  1XGM A;  2ZKZ A;  3F6O A;  2VN2 A;  3Q5F A;  4EM0 B;  1W4M A;  3HRS A;  2A6E F;  2H94 A;  1Z91 A;  4YG2 F;  1AWC A;  1SFE A;  3I4P A;  4XRF A;  4LG0 B;  3R0J A;  5E1Z B;  3HTU A;  3FF5 A;  2QYO A;  3ZMD A;  3HHH A;  1XSX A;  2GAU A;  3FMR A;  2O3F A;  2DAO A;  1YQA A;  2CWE A;  2GIV A;  3RYP A;  2STT A;  1LQ1 A;  5L3F A;  1YW8 A;  1EH7 A;  2HTJ A;  3L09 A;  3F21 A;  1FPQ A;  5LGU A;  3SHF A;  2V1U A;  3HSE A;  4IRH A;  3E6B A;  1G4D A;  3ULQ B;  2G7H A;  3IWZ A;  3E5X A;  1R36 A;  4HW0 A;  3QP5 A;  1R1U A;  1F1Z A;  2DI3 A;  2P4W A;  3M9A A;  2VBY A;  4U0W A;  1UCR A;  4YFN F;  5FFX A;  4RB0 A;  3BWG A;  3WE3 A;  1T0F A;  2W85 A;  4U7B A;  4HF1 A;  1K78 A;  2FE3 A;  5K5R A;  4RB3 C;  5K5O A;  3M7G A;  2CG4 A;  1P4W A;  2ETH A;  2GQQ A;  4A12 A;  4O3M A;  2L01 A;  4LFU A;  4N9H A;  4EV0 A;  4UHT A;  3SXY A;  4BNC A;  2PG4 A;  1LDJ A;  1MGT A;  2XV4 S;  4HQE A;  1XGO A;  3GFM A;  3EDP A;  1ZAR A;  2Q0O A;  3MFK A;  2RV8 A;  1F9N A;  1U5T A;  2VXZ A;  3ABU A;  2GA2 A;  2FU4 A;  3KLO A;  4Z2Y A;  2PLY A;  5DCM B;  3QP6 A;  4L5J A;  2PN6 A;  1SAX A;  3RIR A;  3CTA A;  1W7P D;  2L02 A;  1RZ4 A;  2MH9 A;  1WKM A;  1BN5 A;  1IRG A;  3Q9V A;  5D4S A;  4M74 A;  2JT1 A;  1OYI A;  2O03 A;  1IRF A;  1VTN C;  2JSC A;  3S2W A;  1ZRE A;  1ON2 A;  3K0L A;  5E17 F;  3BZ6 A;  3ISP A;  5DEQ A;  4IXA A;  4FHT A;  4ASN A;  1ZGJ A;  2AS5 F;  2PEX A;  3GWZ A;  2F5F A;  3TGN A;  4EMS A;  2D1H A;  4JQF A;  1G3S A;  1ZG5 A;  5LBQ A;  4CZZ A;  2DLL A;  5CVI A;  1ZLJ A;  2IVM A;  4R1H A;  4BYY A;  2ZCW A;  5FO5 A;  1O3R A;  4LB5 A;  2PMH A;  1Z6T A;  4NQW A;  1Q1H A;  3F8M A;  2EFP A;  3ZN0 A;  3M1E A;  4EM2 A;  2V9V A;  3TO6 A;  4KUM A;  5LLQ A;  3V8K A;  2W24 A;  1TNS A;  3MCZ A;  4FX0 A;  5BMZ A;  3F8C A;  1RIO H;  3GVA A;  3WTS C;  2J5O A;  3GO5 A;  1R58 A;  3T0Y A;  3ECO A;  2E7W A;  5E8I A;  3HOT A;  2LNB A;  3O3K A;  3L2C A;  3I53 A;  2ZXJ A;  2ZFW A;  3KP5 A;  1DDN A;  2RQP A;  2RVC A;  4AIH A;  4BQA A;  4I98 B;  4RAY A;  2L4M A;  2UZK A;  2DQL A;  1BI0 A;  1U5T B;  2L4A A;  2HKX A;  1YFH A;  1RUO A;  3M8E A;  1OKR A;  2LSO A;  2QZ8 A;  1FBS A;  1U3E M;  1B59 A;  1P4X A;  2ZBK A;  4CXF A;  4OIN F;  1ZGA A;  3E5U A;  2FF4 A;  4TV7 A;  2NNN A;  1J2X A;  3JTG A;  2FBI A;  1IF1 A;  4XSZ F;  3MAJ A;  3I0T A;  3JW4 A;  2LDU A;  4M73 A;  5HLG A;  4WK8 F;  3E6C C;  3H92 A;  4LB6 B;  5F6F A;  4G9Y A;  3HRU A;  1CGP A;  5HVQ C;  3QOP A;  4IVN A;  3E6D A;  3EYI A;  3V8J A;  5LEJ A;  2Z33 A;  5CYV A;  1EV7 A;  4P96 A;  5DDG A;  3KP2 A;  1XCV A;  1JXS A;  1OR7 A;  1B9M A;  2MLG A;  3J81 Z;  2DFI A;  2XHK A;  2IP2 A;  2MC3 A;  2OU2 A;  1FT9 A;  1MD0 A;  2D2W A;  4OMY A;  3TDZ C;  4L9V A;  3AAF A;  1XDU A;  1ZRD A;  3DF8 A;  1YLF A;  3RKX A;  3O2P E;  2QQB A;  5E8G A;  1S3J A;  2WWY A;  4Y15 A;  1JE8 A;  5ICF A;  5D5V B;  2K02 A;  4LGW A;  5HLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...