3KP7A

Staphylococcus epidermidis tcar (apo form)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
140
Chain Sequence
MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
molecule tags Transcription regulator
total genus 54
structure length 140
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp7A00
1UHWA 4RGUA 3TO9A 2L01A 4ZZLA 4G9YA 2FMYA 5DYMA 3QU6A 3PQJA 5JI6A 4GYGA 3GFIA 1FBQA 1ZRCA 1U2WA 3E3VA 2P7CB 5E1WA 2HZTA 4WX9A 1PDNC 1TTYA 3JTHA 1XSXA 2YX7A 2K27A 3HOSA 1OMIA 2XUBA 1QQIA 3DXJF 3CDHA 1U8RA 4EJTA 5JR3A 1E17A 3C18A 1KU7A 2GXGA 2KIFA 3NRVA 5E20A 3GO5A 1I5ZA 4LFUA 1B4AA 1EH8A 3KEQA 4G8XA 3SZPA 4ZH4F 4B09A 1IZ1A 3M8EA 3NEUA 2FNPA 1YW8A 1HBXG 2FNAA 4IXAA 2RVCA 2K4BA 3WGHA 1ZHFA 2COMA 1U5TB 2P6SA 5DCMB 4XSZF 1R5GA 2RN7A 1DPUA 1K6OA 1PP7U 3FWEA 1K7AA 1GVJA 3P9IA 1EV7A 2Z9OA 1Y0UA 1G3YA 4M6YA 4KDPA 4BXUA 1K79A 2JPBA 1L0OC 1CF7A 2PJPA 4LMYA 4IF4A 1Z6RA 4ZYEA 2KKOA 1IUYA 4OIQF 5EEHA 4Q4ZF 3WTSC 1ZLKA 2JPCA 1W7PB 5HS8A 1VTNC 1IN4A 3R61A 2EFOA 2PG4A 1ON2A 4UNOA 1I27A 3F72A 1HKTA 1D8KA 2HEOA 1LNWA 2ZNYA 4KMFA 1B6AA 2A5YB 3R6SA 1Q1HA 5F1RA 2IA2A 2OBPA 3FM3A 1B59A 1RUNA 1XSDA 1QBJA 2VONA 1AOYA 3BP8A 3RPQA 4L9TA 4BAYA 3FXRA 4NQWA 3HRTA 2G7HA 2Q0OA 1HW2A 2QENA 1MZBA 2DQLA 2B0LA 4I01A 2DTRA 5K5OA 3BROA 3J80K 3JSOA 3U1DA 4L18B 3KP7A 2OZ6A 4M9ZA 1R22A 2DW4A 2MLGA 2W57A 3L00A 5HS9A 1FP2A 3T5XA 3K69A 4IRIA 1K78B 4WF2A 3IL2A 3HRUA 2EFQA 3HRMA 5ILSA 4LB5A 3GFMA 2DK8A 2FSWA 4PZJA 3TO7A 3FF5A 4UHTA 2GIVA 2K4JA 3GLXA 3I4PA 3RKWA 3ECOA 1ZN2A 2L3DA 2O61A 3IWFA 1XGNA 1TQIA 2STWA 3FM5A 2RKHA 3TKYA 2XAGA 4Q48A 2PBIA 4N9HA 1WWXA 2Q8KA 2GXBA 2VT3A 3O3KA 4WXCA 3WTXC 1LDKB 5CVUA 5D5VB 3D0SA 4BYYA 1HW5A 3R4KA 5AONA 3GZ5A 2KIUA 4R1HA 5E8IA 3FHZA 3WG9A 4UXNA 1LEBA 3L09A 2FU4A 2QQAA 3CO6C 2JRTA 3FZVA 4EJVA 1XCVA 3QP5A 2FQ3A 4Z2YA 5HLGA 1HKQA 1FBUA 1IN6A 1Z9CA 3BOQA 4G7ZF 1DPRA 2P7VB 4M9SA 4S04A 2XKOA 4KN4X 1RZ4A 4RAZA 4XSXF 5ICCA 2Q2EA 3HUGA 1R1UA 3S2WA 3J81Z 4IHSA 1ONVA 4HF2A 4ESFA 2ETHA 2LSOA 1ZG1A 5K1YA 1PUEE 2CWEA 3I64A 4BQAA 2D1VA 3VFZA 1BJAA 3T1BA 3SFZA 4U0WA 4EM2A 1KU9A 3SQNA 2BGCA 3V8LA 4LK0F 1T39A 2MA3A 3KP3A 2A3SA 2X0LA 1WI9A 3I53A 2HKOA 1IN8A 1I1GA 1T98A 4HF0A 2OU2A 4L0YB 4L9JA 1O3TA 3ECHA 1J59A 1W5TA 1KYZA 2L54A 4OIOF 2DBBA 1RUOA 5HOOA 5FD5A 2DI3A 4M71A 3V7SA 4KNYA 1YYVA 5HLIA 3QPHA 4CYDA 3KP4A 4EJWA 2CQKA 4MEXF 2BYVE 3HTUA 2G7UA 5D5WB 1IRFA 4EMSA 1R00A 3LFKA 3IKVA 1TQMA 3H3UA 3WODF 4D0PA 2VXZA 1QNTA 4L5JA 2WV0A 1NHAA 4MHGA 1FZPB 4CDGA 5DUIA 4QLCU 2FMLA 5HLHA 1BIAA 4ZZDA 3V7CA 4KUMA 4G94A 3BWGA 3I54A 3WE3A 1LB2A 1USTA 5JHUA 2IPQX 2XAJA 1S3JA 5F6FA 1ZRDA 3DF8A 4BH9A 3M9AA 4MGRA 2GQQA 5HVQC 1MDMB 2HKXA 1GXPA 2CG4A 1JHFA 1S8NA 1T0FA 5H6RA 4LLNA 5ICFA 1FC3A 3MWMA 2CSOA 5DDGA 4HQEA 5FD6A 1S6LA 3PQKA 5IT9Z 3C3WA 5F64A 3DPLC 2V1XA 2E1CA 3WGGA 3BPXA 5D8LB 2FEZA 2LKPA 1TW3A 1USSA 2X4HA 4H0EA 1L3LA 3IHUA 3ZQ7A 5CLSA 5JFRA 2PI0A 1F5TA 1BM9A 1Z91A 3EETA 5JVTA 2O3FA 1B1BA 4L9NA 4YIIA 5H20A 3VB2A 4FHTA 3JSPA 1IN7A 2ZJ2A 3BPVA 5LGUA 3G73A 5KVRA 2OQGA 4I2OA 5CJ9A 4MQVA 3T8TA 3ROUA 5A2QZ 2C6YA 1XB4A 2VOOA 3CTAA 3W6KB 5BMZA 2PN6A 2HFHA 4M72A 3BDDA 2M45A 3LWFA 2ACJA 1LQ1A 2R7FA 3CLOA 3JW4A 3I0TA 3M8FA 2EV5A 4UVAA 4IRGA 3QRFF 1IXCA 3F8MA 1X3UA 3WTZA 3B73A 3K9TA 3I59A 3GXOA 1H9TA 3JTGA 3QU3A 2A69F 1R23A 2A68F 5E18F 3E5UA 1WSUA 2EV6A 2QQBA 2OZUA 1BOAA 2PEXA 4RGRA 2W24A 3LA2A 2UXXA 3TOAA 1V3FA 1IAWA 1E2XA 1KYWA 2BEOA 5ILUA 1ZREA 3Q9SA 4KIGA 1O57A 4PDKA 2R7DA 3KZZA 3KE2A 5LGNA 4NHJA 2XAFA 3MAJA 5LGTA 4HX4A 2DQRA 4HDUA 5DEQA 4BHPA 2YX4A 4BHCA 3KFWX 3FXUA 3C1DA 2EB7A 4LD5A 2HWVA 1FY7A 4CGZA 3V7RA 1LDJA 4MEYF 2RV8A 4EJUA 1F4KA 4GO1A 1XN7A 4I7HA 2H94A 2FF4A 4R79A 2ZBKA 2VODA 2DFIA 3E6DA 1CGPA 4P9UA 2FBKA 4BHBA 1UB9A 4GGGA 4FX0A 1IXSB 4I0BA 3D5LA 2UXNA 5D8KB 3DFGA 2J5PA 1KGSA 2HDCA 1P2FA 3I71A 1ZGJA 1V4RA 2XKPA 5AIQA 1Z6TA 1JGSA 2DPUA 4Y13A 2HYGD 1FWZA 3DP7A 4A5MA 4YG2F 3BJ6A 5LHIA 1R58A 3E6BA 4G7OF 5BPIA 5J8FA 1MJBA 3ZMZA 2PMUA 2XVCA 4HV6A 1ZRFA 2GWRA 3RYRA 1J7KA 4PGGA 2H6CA 2YU3A 1U78A 2QBYB 4RB0A 2GA2A 4MTEA 1W4MA 1YW7A 3CJNA 1J0RA 3EQLF 2EJRA 2F5CA 1A04A 3JAMK 1DUXC 1B9NA 1QZYA 5CVJA 2HR3A 4HYEA 3KP6A 4ZYDA 4R8HA 1T2KA 3EUHA 3K1MA 2XASA 3JAMZ 4Q5SF 3H3ZA 1O3SA 2O6GE 4CO8A 2VBWA 2OD5A 5ICGA 4HBLA 2V1UA 3ABTA 3LAJA 2E7XA 3Q5FA 3NQOA 4JBAA 4YFNF 1G3TA 1MJ9A 2NAZA 3WTYC 1QGPA 1G3SA 2EK5A 2RDPA 2EFNA 4B8XA 1TNTA 1R36A 3HOTA 1J75A 3DV8A 5FFZA 1C0WA 5HS7A 3F8NA 4LG0A 3I58A 3CUOA 2AXLA 2JTVA 5L3CA 3RJPA 2ESHA 2HYFA 2ZMEB 1TBXA 1T38A 4JQFA 5FO5A 3ZMDA 4RB3C 4UVCA 1H9GA 2YPRA 2VC0A 2QQ9A 1W5SA 4XLPF 4HLYA 3P9KA 1QPMA 3T0YA 5D4SA 4RB2C 2A6HF 4HLXA 2LF8A 2Z99A 2ELHA 4NB5A 2FE3A 3LA3A 3CUQB 1STZA 3GEZA 1O3RA 3HIFA 1Z05A 4U7BA 1PP8F 2GAUA 1DDNA 1S7AA 5EEGA 4ENMA 3TO6A 4AVPA 1YLFA 4YFKF 3J81K 2KRFA 1IXRC 4IPAA 2DPDA 3ZPLA 3M1EA 3HTSB 1EH6A 4WXHA 3PFIA 3HSFA 5D5XB 2FBIA 5E1XA 5L3GA 1O3QA 4MQ9F 1FP1D 5E8GA 2XGXA 2V9VA 2ZXJA 4GXOA 4UV8A 3ZMVA 4LK1F 4P9FA 2Z33A 2P8TA 2K7LA 3KLNA 3C7JA 3MQ0A 5BS6A 3K1PA 3E6CC 1KA8A 1U5TC 1B9MA 1DP7P 2IT0A 2NS0A 4HZFA 3DQVC 2P6TA 3HSRA 3VOEA 3GFLA 2BBYA 4I02A 2CYYA 1R1TA 1MJAA 2XV4S 4HDVA 4GCVA 3BJAA 4ZYGA 1MKMA 3EYIA 1ULYA 3V8JA 5LHGA 4WWCA 2M1BA 2K86A 4O3MA 3WTVC 4IVNA 1U5TA 3U9GA 5DCMA 2Y0MA 4KIFA 1TNSA 2LF7A 1TW2A 3N97A 2RQPA 1D8JA 3IKTA 1SD5A 1HKSA 4Y15A 4M9XA 1HSTA 3F8CA 3ELKA 1RNLA 3TDUC 1BC7C 3VEPA 5HDKA 2HOEA 4LLLA 1W7PA 5LBQA 1G6NA 1IN5A 1CF7B 2CGPA 2A61A 3F6VA 2VT2A 3RIRA 3E97A 3GYHX 3U2RA 1MGTA 2VBYA 4HAMA 1LJ9A 2QWWA 1UFMA 2Z3YA 3MEXA 1SFEA 1ON1A 1LEAA 1HSJA 2YR2A 2GZWA 4OIPF 5DUKA 1I6XA 1I1SA 3O2PE 1JE8A 3OOPA 2QLZA 1W7PD 1XDUA 5E17F 1BIBA 2ZO4A 2RGVA 1ZGAA 2W25A 4CXFA 4U0YA 2ISZA 4BNCA 1QO0D 2HQRA 5LLQA 5D4RA 4A6DA 3HRSA 4LB6B 1TLHB 2ZFWA 1XGOA 5K5QA 3M7GA 4WXDA 1SFXA 2F2EA 3COAC 1Z1DA 1FLIA 3H92A 3ZN1A 5IT9K 5BOXA 1G3WA 1AWCA 1KQ8A 5FLXK 1K78A 5KK1A 3MZYA 4OOIA 1ZG3A 5LEJA 3KEOA 5L3DA 5D6EA 3G3ZA 5FLXZ 4MNUA 4O5VA 2QZ8A 5D5UB 1H0MA 1IF1A 4EM0B 3W6JB 4FT8A 1SFUA 1Z7UA 2O03A 2QUFA 3QP6A 2Z5UA 2WWYA 2MBFA 1OYYA 4RGSA 2GA1A 2FA5A 1LDDA 1F1ZA 1SD6A 3F3XA 1JHHA 1D5VA 2M30A 5A2QK 2IP2A 4OINF 2F5EA 2EA2A 1J9IA 4G7HF 1BN5A 2QVOA 4KN7X 3KP5A 2P5VA 1LVAA 1YTYA 3ABUA 1YS7A 1D3YA 3TOBA 4AIJA 4KICA 4HV5A 2J5OA 4ZYHA 4ENNA 3WE2A 3CUQC 2UZKA 3MZHA 2HTSA 3V8KA 2Y75A 2M5WA 5L3BA 1SAXA 3BJOA 1P92A 4UV9A 1FNNA 1RI7A 4RAYA 5L3EA 2O8XA 1FSEA 4MTDA 2JT1A 4HX7A 1UCRA 3DPTA 2IJLA 3O6BB 2QYOA 2XAQA 3ZMTA 2EA4A 1YIOA 2MC3A 4WCGA 1SMTA 2DO7A 1TQPA 1BI0A 3HHHA 2H09A 1FSHA 4EGZA 4CHUA 5LHHA 3J7AO 2A6EF 4DNCA 1S29A 3BZ6A 2VBXA 1QZZA 2IA1A 3B02A 3L9FA 4L9VA 4RS8A 4O6JA 3QAHA 4N9IA 1P4WA 5E1ZB 5BQTA 1XD7A 2EFPA 2HGCA 2VBZA 4ETSA 4EJOA 2IVMA 5IT3A 3LAPA 5DV5A 3F8BA 5HDNA 2LDUA 4P5OA 2MH2A 3KZYA 1YFHA 2MH9A 1XMKA 2FRHA 1BBYA 2NNYA 2D1HA 2L4AA 2HQNA 2ESNA 4OMZA 3IWZA 4PGHA 1XSVA 4HX8A 4LLGF 4KFCA 2VE8A 1MD0A 2BV6A 1T6SA 2NYXA 3GZ6A 2M87A 4N0BA 3V4GA 4HF1A 1WQ2A 1G4DA 5LRSA 2D2WA 2PFBA 2EWNA 5J6XA 3P9CA 1BI3A 2VC1A 1XDSA 2H6BA 4EQQA 2CO5A 3K1NA 2OAZA 4U7DA 2H27A 1ZYRF 1OPCA 2W85A 4L0ZB 2D45A 2P5LC 4YIFA 2MLKA 4Y17A 2STTA 1BC8C 2DLLA 4ESJA 4IHTA 3VODA 2KIMA 1MDMA 3E6MA 3R60A 4P55A 2DAOA 2P5KA 2VN2A 3KLOA 1YW9A 3P7NA 4F7ZA 5LEKA 1P6RA 2V79A 5AIPA 3FMSA 2FXAA 2OQRA 1HXDA 1KU3A 1J5YA 4Q47A 1FYMA 1YQAA 1F9NA 2ISYA 5J8CA 3LQQA 1U3EM 1KQ0A 3WGIA 2EFWA 3RKYA 4LJZF 3N4MA 5TJJA 3EYYA 4A5NA 3RYPA 3ISPA 3OV8A 2UWMA 2QM3A 3LSTA 3F8FA 4A12A 3LQRA 3IC7A 3J80Z 4XLNF 3GVAA 2AS5F 1FT9A 2IW5A 3WU1B 2NNNA 1FBSA 2KJCA 3DKWA 3AAFA 4EGYA 2E7WA 4HQMA 2PLYA 2ZNZA 1UHMA 3DEUA 2JSCA 4EVIA 5CVVA 2P4WA 5CYVA 4KA4A 4KIBA 2WC2A 5ERIA 3WTUC 1OYIA 4HA8A 2MD5A 5DCFA 3WTTC 3IRQA 4EV0A 2JZYA 4TV7A 4UUVA 2M8EA 3F22A 1SMYF 3GF2A 6PAXA 3ZMUA 4E70A 4AIKA 3RI4A 1XGSA 2ADUA 3GFJA 1SD4A 4A2UA 5ICEA 2CW0F 3RKXA 1ZH5A 3E5QA 1XCBA 2DT5A 1O7FA 1WRJA 3MCZA 3E5XA 1HQCA 2PMHA 5H6QA 4WK8F 3TQNA 4YFXF 3I59B 1YG2A 3REOA 3GUDA 1P4XA 3KP2A 2R3SA 4U88A 3HSEA 5ED4A 4AWXB 1R1VA 4AD9A 5FB2A 5HDGA 3RDIA 1U6GA 3WU0A 3ZN0A 3ZP5A 2VOPA 3SZTA 2O0YA 4CZZA 4A0YA 5DD4A 4AIHA 4G6DA 1SD7A 2BE5F 2XAHA 4ENJA 2E1NA 4RGXA 3RTRA 2A07F 4DQ2A 1ODDA 4M73A 3GX4X 3LA7A 3ULQB 2L4MA 1FYLA 2G9WA 1J2XA 4M74A 3GWZA 2IA0A 1FOKA 1BI1A 5DD8A 3MFKA 4IJAA 1KQ9A 1WKMA 2OA4A 3IRRA 2W84A 1XGMA 2NRAC 1HW1A 4ASNA 1R5HA 3L7WA 3SHFA 3R0AA 2XRNA 1GHCA 5FGMA 5FFXA 4ENKA 3Q9VA 2RNJA 4S05A 4I0AA 1OYWA 5TRDA 4A6EA 3FMRA 2FBHA 4UVBA 1ZAOA 1YO5C 5K5RA 4JK1X 1ZG5A 2F5DA 4P96A 1P4AA 3HYIA 3K0LA 4XBFA 1IRGA 3F23A 2QBYA 2TDXA 1ZARA 5LRRA 2IRFG 3RPUA 3SXYA 3TGNA 3KETA 3QPTA 1KU2A 3F21A 4XRFA 5CVIA 2WTEA 4RB1A 1O7LA 4U0VA 2Y48A 2VE9A 1OKRA 3KCCA 2L02A 2ZKZA 2V6CA 3ERED 1RIOH 2PQ8A 3T8RA 3TDZC 2DU9A 3CO7C 3FMQA 4K2EA 4G6QA 4HOBA 4KT5C 3BY6A 2XROA 2KJBA 1FX7A 4ON0A 3K2ZA 4ESBA 1OR7A 1YS6A 2LNBA 5D6FA 4GYIA 4QWQA 4A0ZA 4EM1A 2CFXA 3L2CA 2HS5A 4KMUX 5L3FA 4I09A 1FYKA 2EV0A 2XIGA 1JXSA 3GW2A 1GXQA 1S7OA 4LGWA 2DK5A 1FPQA 2ZMEA 3R0JA 3HHGA 3ML6A 4FX4A 4OU0A 1REPC 4LG0B 4I98B 4KYWA 4OMYA 2V1DA 4HW0A 4OIRF 2ZCWA 2F5FA 3I5UA 3QOPA 4IRHA 3EDPA 3FX3A 4CICA 3FXQA 4PCQA 2HTJA 5ILVA 4A0XA 1BI2A 2YSRA 1R7JA 3ZMSA 4M6XA 4L5IA 1IW7F 1ZLJA 1EH7A 2RC4A 2XHKA 2K02A 5BPDA 3WTWC 3F6OA 3CUQA 5CVRA 1XMAA 2FOKA
chains in the Genus database with same CATH superfamily
1VQOI 1GDTA 1UMQA 3BZCA 1F36A 3ZQHA 1UHWA 4RGUA 3TO9A 1VNDA 2L01A 4ZZLA 4G9YA 1WJFA 1RETA 3A4CA 2VI6A 2FMYA 3GCMA 4OWRB 1BW5A 1MNDA 2AHQA 2BW3A 5DYMA 2LBFB 2MC4A 3QU6A 3PQJA 5CKTA 2E1MB 3H9QA 1DU0A 5JI6A 4GYGA 3GFIA 1GVDA 2NVTJ 2GM4A 3BZKA 1FBQA 4CYCA 2CQXA 4E7KA 1ZRCA 1U2WA 1M1EB 3HKZN 3E3VA 3SJMA 3L2RA 2CQ7A 2P7CB 5E1WA 1NTCA 2HZTA 4WX9A 1VQKI 1PDNC 1TTYA 3JTHA 3TEDA 1XSXA 3S1NJ 2X51A 2YX7A 2K27A 4FASD 3K7AJ 3HUGB 4UUSA 3HOSA 1OMIA 2XUBA 3GTKJ 1QQIA 3DXJF 3CDHA 1S9HA 2WBMA 1U8RA 4EJTA 2VIXA 5JR3A 5CQGA 1E17A 3C18A 1KU7A 2GXGA 3FHNA 3O8GA 2KIFA 1N25A 2LY1A 3FKIJ 4XOTA 3NRVA 2HQ5A 5E20A 3S16J 3GO5A 1I5ZA 4LFUA 5KHDA 1FMWA 1B4AA 2XGEA 1EH8A 2Y2ZA 2XPVA 3KEQA 2DN0A 4G8XA 3G4SI 1CQTA 3SZPA 4ZH4F 4A3MJ 4B09A 1OJLA 1IZ1A 2CS3A 3M8EA 4OAYA 3NEUA 3DTIA 4XKWA 4RM2A 2FNPA 1MMDA 5GP9A 5M3FJ 3G2BA 4XM3A 1VQLI 4IHXA 4BDYA 3ASNH 1YX3A 1E3PA 2DJNA 2R7ZJ 1YW8A 3OY9A 1HBXG 2FNAA 4IXAA 4D7MA 3CMMA 4DGWB 5C3EJ 3S17J 2RVCA 2K4BA 3OSFA 2JJ7A 1JJ8C 3WGHA 1ZHFA 2COMA 1U5TB 2Y0SN 1YRNB 5IPAA 2EH3A 3HZJA 2P6SA 1YX5A 1LUJB 3CJRB 4A3EJ 5DCMB 4XSZF 1R5GA 2LFBA 2RN7A 1DPUA 3BLYA 1JT0A 2FQ4A 1PP7U 3FWEA 1K6OA 1K7AA 1GVJA 3CDLA 1EV7A 3P9IA 2Z9OA 1Y0UA 1G3YA 4A3JJ 1B8IA 4M6YA 2H1KA 2BVMA 4KDPA 4BXUA 3CCRI 4YEJA 2WV1A 2RQQA 1K79A 2JPBA 2IS2A 1L0OC 1CF7A 1VZ0A 2PJPA 4LMYA 4IF4A 5GTIC 4E7SA 1Z6RA 4FETA 3OYDA 5J1YA 3CESA 4ZYEA 3TP0A 2MFZA 4BS9A 2O8KA 2KKOA 2L2OA 1SEUA 1MMAA 1IUYA 2EZLA 4IO9F 4OIQF 5EEHA 5B3SH 4F93B 3OYFA 4HNUA 3WTSC 4Q4ZF 1YI2I 1ZLKA 1EKEA 2JPCA 1W7PB 3ABLH 4FQGA 5HS8A 1IN4A 3R61A 3HL2A 1VTNC 2EFOA 2PG4A 2M7BA 1ON2A 4UNOA 3MKZA 3SEZA 1I27A 3F72A 1HKTA 1D8KA 3DKXA 3KPHA 3ZQFA 1A35A 1LNWA 2ZNYA 2HEOA 4KMFA 4X6AJ 1FMVA 1B6AA 2A5YB 3R6SA 2P0WA 1Q1HA 2JQ7A 5F1RA 2CQNA 3A0HC 2CUJA 2IA2A 2OBPA 3KYLA 2JRMA 1SFKA 3FM3A 3BTCA 1ETOA 1B59A 1SC7A 1RUNA 2QSGX 3OMYA 2ZJQF 4C2MJ 1X3WB 5J1RA 2VJ4A 1XSDA 4XN0A 3I4NJ 5HNFA 1QBJA 4BXXJ 2VONA 3QYFA 1OCTC 3CLQA 1N77A 2QGUA 1AOYA 3D1NI 2GOXB 3KYDB 3BP8A 3QOEA 5GAEJ 3RPQA 4L9TA 1ACIA 4A3DJ 4BAYA 3FXRA 1IRZA 3CDIA 4NQWA 3HRTA 4NC7A 2UV1A 2G7HA 2PJRA 2Q0OA 1Z3YA 3EUHC 1HW2A 2QENA 3GBGA 1MZBA 2DQLA 4BEHB 2B0LA 4I01A 2CFOA 2DTRA 5K5OA 1HF0A 3BROA 3HOUJ 3J80K 2K9MA 3JSOA 3U1DA 4L18B 3KP7A 2OZ6A 4M9ZA 1R22A 2DW4A 2MLGA 2W57A 1ETKA 3L2WA 3A2KA 3DBRB 3L00A 5HS9A 4B1RA 1FP2A 3T5XA 3K69A 4IRIA 1K78B 4QTRA 4ZDLA 4WF2A 3FISA 1UG2A 2E36A 5C44J 5H2FC 3IL2A 3HRUA 2EFQA 3HRMA 5ILSA 4IX7A 4HRIA 2O9LA 4LB5A 3GFMA 2DK8A 2FSWA 3OYAA 4PSXA 4PZJA 3TO7A 3DBHB 3FF5A 4UHTA 3WG7H 1U9OA 5IYCJ 2GIVA 4Y52J 1U0JA 2K4JA 5M5XJ 5J1UA 3GLXA 3I4PA 5JLWA 2XDVA 1JUSA 2ZJRF 4V2FA 2KDZA 3BG9A 3RKWA 3ECOA 1ZN2A 3HEFA 1ZELA 2L3DA 2M7AA 3OS1A 3QPSA 4XLCA 2O61A 3IWFA 1UHSA 1XGNA 1TQIA 1AA7A 1WJEA 2STWA 3FM5A 1JT6A 2EQRA 2RKHA 3TKYA 4M3GA 2XAGA 4E7JA 3BR0A 2DA1A 4Q48A 3J7AY 5DM6F 2PBIA 3CJTB 2KLOA 4N9HA 2V9KA 3CCUI 1WWXA 1SAUA 4XR6A 5JLXA 3E0JB 2Q8KA 2GXBA 2VT3A 4D7NA 3GTQJ 1FIPA 2ZXIA 1BR1A 3KIOA 3O3KA 4WXCA 3WTXC 1LDKB 1RKTA 2R7TA 3CC2I 1D0XA 5CVUA 2R7OA 5D5VB 4XL9A 3D0SA 4BYYA 1HW5A 2DYRH 2JK3A 3SZGA 1I50J 1B72A 3M8JA 1NK3P 3R4KA 2MGQA 5AONA 3CF2A 3GZ5A 2LKSA 3WHBA 4J19A 1WGXA 1MNEA 1FTTA 2KIUA 4R1HA 5E8IA 3FHZA 5M5YJ 1JJ6C 5E3OA 3QYBA 3WG9A 3PIPF 2R7WA 4UXNA 3VYRB 1K4TA 1LEBA 3A01A 2W48A 3Q0WA 3L09A 2FU4A 2F6CA 2QQAA 1X1DA 2R92J 1AU7A 3CO6C 2JRTA 1TT0A 4E4HA 3JRAA 2M34A 3FZVA 2HYJA 4EJVA 1DGRM 1TWHJ 1IV8A 1XCVA 3HGYA 3QP5A 2FQ3A 4Z2YA 4FCYA 5HLGA 2BY2A 1HKQA 1YIJI 1FBUA 1IN6A 1Z9CA 2WAQN 3BOQA 4G7ZF 1DPRA 2DMQA 2P7VB 4M9SA 3G1OA 4HNVA 4S04A 2LREA 2JA8J 2M0CA 2XKOA 4KN4X 1MMGA 1RZ4A 3N05A 4E7IA 3BT9A 4RAZA 4XSXF 4IQJA 5ICCA 3U21A 3H5RA 1GV5A 2Q2EA 3HUGA 4LIVA 1R1UA 3S2WA 3J81Z 2NVXJ 4P1WA 3MKWB 4IHSA 1OCRH 1ONVA 4HF2A 1VFCA 4ESFA 2ETHA 2LSOA 1ETYA 1ZG1A 5K1YA 1PUEE 2DMNA 2CWEA 1GUUA 3I64A 3LSPA 4BQAA 2D1VA 1SVOA 2MABA 2K85A 2NS7A 3H9GA 3VFZA 1BJAA 3QPLA 1GV2A 3T1BA 4U0WA 3SFZA 2E60A 3BG7A 4EM2A 2O5RA 1OFCX 4XLFA 2EZIA 1KU9A 3SQNA 2XF5A 2BGCA 5EG0B 2MG4A 2ID3A 3V8LA 1PYVA 1ETVA 3DEEA 5EGOB 1FEXA 4LK0F 1T39A 1VQ5I 2MA3A 3KP3A 2E2IJ 2A3SA 2X0LA 2HVSA 4ZDOA 5IOZA 1WI9A 3I53A 2HKOA 1MH4A 1IN8A 1HDPA 1I1GA 3FXOA 1T98A 2JVHA 4HF0A 3CMAI 2OU2A 1UJ8A 4L0YB 3ZQQA 1BR4A 4L9JA 1QHGA 1O3TA 3GTOJ 3ECHA 1J59A 1W5TA 1KYZA 2R4GA 3CQZJ 2F4MB 2L54A 2XC7A 4OIOF 2DBBA 1RUOA 2DTZA 5HOOA 1TWCJ 5FD5A 3ABKH 2DI3A 2Q1ZB 5EEAA 1Y1VJ 2AO9A 4M71A 1QVTA 1W36C 1BOBA 5FJ8J 5CQEA 3HKZA 3V7SA 1YYVA 5HLIA 4KNYA 2HVQA 4CCOA 3CF5F 2WY8Q 3QPHA 1QA6A 3SEQA 3FXKA 4CYDA 3KP4A 3K4KA 4AUXA 4EJWA 2CQKA 4W97A 3RZOJ 4MEXF 3BG5A 3BTIA 1K83J 2BYVE 3HTUA 3S2HJ 2G7UA 4GRIA 3TMOA 4YIRX 2JA7J 1MMSA 3F0CA 1I39A 5D5WB 1IRFA 1WHUA 4EMSA 1R00A 2BY3A 3K4JA 3I56I 3LFKA 1K6YA 1WJBA 3IKVA 2JMWA 1TQMA 3HG9A 2DXIA 3H3UA 4V19K 3WODF 3DTKA 4D0PA 2VXZA 1QNTA 4L5JA 5J4VA 1P7IA 1D1AA 3VYTB 4RAGA 2WV0A 2QEXI 2K9SA 3SDGA 3W2AA 5GPAA 1NHAA 4DZPA 3AL0B 1W36D 4ZYAA 4MHGA 3HPGA 1FZPB 4CDGA 4YRVA 4A3BJ 5DUIA 4QLCU 3HOWJ 1ETWA 4XRMA 2FMLA 2CJJA 4DIQA 5HLHA 1BIAA 4ZZDA 1A6QA 1RC9A 3RSNA 3V7CA 1H89C 4KUMA 1ZQ3P 4G94A 2FD5A 2H8RA 2EPFA 3VSKA 3BWGA 3I54A 3WE3A 3MN2A 2M2EA 1USTA 5JHUA 3KZIC 2IPQX 1LB2A 3LSRA 2XAJA 1S3JA 5F04A 5F6FA 2F4OB 1ZRDA 5FKOA 3AG4H 4XNFA 4CH7A 2CUZA 4B43A 1SANA 2Y0SA 3DF8A 4BH9A 4BE0A 4PJLA 3G1MA 1WJCA 1T0FC 4YELA 1GT0C 3M9AA 4MGRA 2M3AA 2GQQA 5HVQC 3HBLA 2R93J 1MDMB 9ANTA 2HKXA 1GXPA 5F27A 2CG4A 3DU5A 1JHFA 1S8NA 4XRSA 2KZVA 1T0FA 5H6RA 3ASOH 4LLNA 5ICFA 1OCZH 4HPQA 3JRGA 1FC3A 3MWMA 2CSOA 5DDGA 4BBRJ 4HQEA 3A02A 3OL3A 5FD6A 3IAS2 1S6LA 4IQ4A 3PQKA 2V9PA 4AIDA 2RNGA 5IT9Z 3C3WA 2QKLB 2CRGA 1QZEA 5F64A 2QCOA 3DPLC 2V1XA 2E1CA 3WGGA 3H5AA 4QIWN 3BPXA 2IEKA 5K7ZA 4CCKA 4GDFA 4LITA 5D8LB 3BTJA 1OLTA 2FEZA 4C3HJ 3S3MA 4ITVA 3JCUC 2DDBA 4A3CJ 2LKPA 4C9YA 1TW3A 1USSA 2X4HA 2DT7B 4JP0A 4H0EA 4D9JA 2TRTA 3U1KA 2Z2SB 1L3LA 4A69C 3OIPA 1D0ZA 2ID6A 3IHUA 2GOMA 3ZQ7A 3FK7A 3A1YA 5CLSA 5JFRA 1R49A 2PI0A 4FE7A 1F5TA 4Y4RA 1BM9A 1Z91A 3EETA 5JVTA 2O3FA 1B1BA 4L9NA 4YIIA 5H20A 3VB2A 4FHTA 2W7NA 3JSPA 3FDYA 3HOZJ 1IN7A 2ZJ2A 3IH2A 3BPVA 5LGUA 2VKVA 2BHYA 3O8HA 3G73A 4PK4A 5KVRA 1XG1A 2OQGA 2OPTA 1WI3A 4I2OA 3CZ6A 5CJ9A 4MQVA 5B1AH 3DEWA 4B47A 3GLLA 4AVZA 3T8TA 3HC7A 3ROUA 5A2QZ 2C6YA 1XB4A 3S93A 3CTAA 2VOOA 3W6KB 1MSFC 2XPWA 2DOFA 3G71I 5BMZA 2PN6A 3IV5A 2HFHA 3ABMH 3EUKL 4M72A 3BDDA 3KYCB 3LSIA 5BNGA 2M45A 3LWFA 2ACJA 1LQ1A 3QODA 2R7FA 1ZK8A 4NDLA 2I10A 4M3BA 3CLOA 3ZR8X 2KMUA 4CSWA 3JW4A 1QVUA 3I0TA 3M8FA 2EV5A 2GBYA 2HOAA 1HOMA 2EIMH 4UVAA 3TP3A 3JRIA 4IRGA 3QRFF 3GZNB 2VASA 4DW6A 1IXCA 2IBDA 3CMYA 3F8MA 1X3UA 1V5EA 1Z77A 1QU3A 1P7JA 3WTZA 3B73A 4IHVA 3K9TA 3OYCA 2HZDA 3CP8A 3I59A 3GXOA 1H9TA 3JTGA 3VPRA 3QU3A 2A69F 3HOYJ 3ESWB 2EILH 1R23A 1WFXA 2A68F 5E18F 2JSPA 4QPOA 3E5UA 1WSUA 2HNHA 2EV6A 4ZDPA 1WH5A 2QQBA 2XF6A 2OZUA 1BOAA 1TWAJ 2PEXA 1FJLA 4RGRA 2VJJA 2W24A 3LA2A 2UXXA 3TOAA 1V3FA 4RM3A 3CC7I 1IAWA 1E2XA 1KYWA 4MIMA 2BEOA 5GAGJ 1ITYA 5ILUA 1ZREA 3Q9SA 4BJ6C 3BQYA 3CJQB 4ZTFA 1VQ9I 4KIGA 1O57A 2QSFX 4PDKA 1YHQI 1MBJA 5LD2C 2L9VA 2R7DA 2DMUA 2HOSA 4XKBA 3HB9A 3KZZA 3KE2A 5LGNA 3G1LA 4JOMA 4C30A 2DOEA 1P9QC 4NHJA 2XAFA 3MAJA 3OYIA 5LGTA 4HX4A 2DQRA 1V5GA 4HDUA 5DEQA 4BHPA 4NC8A 4NUBA 2WB1N 1XMXA 2YX4A 4XLHA 4BHCA 3KFWX 2DMPA 3FXUA 3C1DA 2EB7A 2X6WA 3A0BC 4LD5A 2R5YA 3L2UA 2HOTA 2HWVA 1FY7A 1WJDA 3H9JA 4CGZA 1Y56A 4MO7A 3M1CA 3V7RA 2BY0A 2AXTC 2M4KA 1LDJA 3OIQA 4MEYF 3WU2C 2RV8A 4EJUA 1F4KA 2IAIA 1TT5B 3ONQA 1Z7LA 2OCEA 4GO1A 1XN7A 4I7HA 2H94A 2FF4A 1Q1VA 2R5ZB 4DJAA 4R79A 1D5YA 2ZBKA 2WAQA 1Y1WJ 2VODA 3E7LA 2DFIA 3E6DA 1CGPA 4P9UA 3NWSA 3D5SC 2FBKA 4BHBA 1UB9A 3B6CA 3DLLF 4GGGA 5FKNA 4JX4A 4FX0A 1IXSB 4HEA2 1X2NA 1Y0NA 1WJAA 2K3PA 4I0BA 3D5LA 1A31A 2UXNA 1E0EA 5D8KB 2CU7A 3DFGA 2LP0A 2J5PA 1KGSA 1MIJA 4F91B 2HDCA 1P2FA 1TZLA 3I71A 2K3FA 1ZGJA 1V4RA 2XKPA 4BU2A 3EUAA 5AIQA 2KHMA 1Z6TA 1JGSA 2DPUA 4DYRA 3PO3J 1LE8A 4Y13A 4XORA 2HYGD 2N8GA 1FWZA 1JKRC 3DP7A 4A5MA 1DQUA 3FXLA 2CW8A 3S14J 1T56A 4XK4A 4YG2F 2DA3A 2I8DA 2KQRA 2V1NA 3BJ6A 2LOOA 5LHIA 1R58A 2B7EA 3E6BA 4G7OF 4BDZA 2BHZA 5BPIA 3X2QH 5J8FA 1MJBA 1UELB 3ZMZA 2PMUA 2XVCA 3BTLA 4HV6A 2XF7A 5HLTA 1ZRFA 2GWRA 3Q0VA 3HDDA 3RYRA 2HI3A 1J7KA 4PGGA 4II2A 2H6CA 2FJ1A 2YU3A 3W2WA 4KJZA 3C2HA 2GXAA 1U78A 2QBYB 1MBFA 3BR6A 4RB0A 2GA2A 1V54H 4MTEA 1W4MA 1YW7A 1MMNA 4CCMA 3CJNA 3VDXA 4XKCA 3PSIA 1J0RA 4FE4A 3EQLF 2EJRA 1A6IA 2F5CA 1A04A 3ZRGA 3JAMK 1DUXC 1B9NA 3M4OJ 1QZYA 1IC8A 5CVJA 1LKXA 1RPWA 2HR3A 4HYEA 2KL4A 2CW7A 3KP6A 4ZYDA 1Z0XA 1HDDC 2V7FA 4R8HA 1T2KA 3EUHA 1FOXA 4F52A 3K1MA 2XASA 3MKLA 3JAMZ 4Q5SF 3H3ZA 3JRCA 1O3SA 1D0YA 2O6GE 3GMEA 2YUSA 4CO8A 2VBWA 1XPXA 5IP7J 2OD5A 5ICGA 4HBLA 3C2GA 5IOYA 2V1UA 3ABTA 3LAJA 2E7XA 3Q5FA 4D1QA 2Y69H 5EZGA 1IDYA 3H0GJ 3NQOA 1PUFB 5DS9A 4JBAA 4BE1A 1FTZA 5KNLA 1ERDA 4YFNF 3H36A 2ZXHA 1G3TA 1MJ9A 2NAZA 3WTYC 1QGPA 2VLAA 1LVKA 1AKHA 1HLVA 1G3SA 2EK5A 1G2HA 2RDPA 2EFNA 4B8XA 1TNTA 2W00A 5M3MJ 2K40A 2ME6A 1SVMA 1Y8RB 4XRSG 1R36A 2DMTA 3HOTA 1J75A 3DV8A 5FFZA 4I76A 1DGWY 4BY7J 4BQNA 1C0WA 5HS7A 4RMNA 3F8NA 4LG0A 3I58A 3CUOA 2AXLA 2JTVA 2V26A 5L3CA 2CUEA 2KT0A 4XKVA 3RJPA 2ESHA 4IHWA 2E19A 3S2DJ 1IV6A 5KAIC 2HYFA 5J3LA 4E6KG 3M3YJ 3JRDA 2IS6A 2ZMEB 2V6EA 3AG3H 1TBXA 4Z6YA 4HSRA 1T38A 4ANJA 4JQFA 5FO5A 3ZMDA 4RB3C 4UVCA 2R7UA 1H9GA 1HCRA 2JUCA 3OWTA 2YPRA 2VC0A 2QQ9A 1W5SA 2E1MC 2JA2A 3RQ4A 4XLPF 4HLYA 3P9KA 1QPMA 3T0YA 3GTGJ 3SFIA 5D4SA 1X19A 4RB2C 2A6HF 4HLXA 2LF8A 2Z99A 2ELHA 4NB5A 4BGDA 3M07A 2FE3A 4CCNA 3LA3A 3S15J 3CUQB 2WY7Q 1STZA 2LBFA 2BXZA 2X48A 3GEZA 1Z05A 3HIFA 1O3RA 4U7BA 1PP8F 2GAUA 3H35A 2XRLA 1TWFJ 3HXLA 1DDNA 1S7AA 5EEGA 4ENMA 3TO6A 4AVPA 1YLFA 4QSHA 1EF4A 2MD0A 4YFKF 3VYUB 4C2TA 3J81K 2KRFA 1IXRC 4NBQA 2EZKA 3F9KA 4XICA 4IPAA 4J01A 4N4NB 2WADA 2BW3B 2DPDA 3ZPLA 2DFEA 4Y33A 4V2GA 3M1EA 3PNVA 5B5EC 3BG6A 3HTSB 1EH6A 4WXHA 3PFIA 2CV1A 4CYCB 3HSFA 3S3NA 3E1SA 2ZSIB 5D5XB 2HU9A 4B3XA 2FBIA 5E1XA 5L3GA 1O3QA 3LSMA 4MQ9F 1FP1D 2HDWA 5E8GA 1YOVB 1JKQC 4MFDA 2XGXA 2V9VA 3UNGC 3D5RC 4JYKA 2ZXJA 4GXOA 1XC5A 1ETQA 4UB6C 4UV8A 4UUSB 2MSYA 3BCBA 3ZMVA 1MNMC 3FKJA 4LK1F 4P9FA 2R7RA 2Z33A 2P8TA 2K7LA 5FKMA 2A05A 3C7JA 3KLNA 3JRFA 3MQ0A 3NWTA 1JKOC 4DOZA 2E35A 5BS6A 3K1PA 3E6CC 2XB5A 3HOXJ 1KA8A 2WAEA 1U5TC 1B9MA 1DP7P 2IT0A 2MYSA 2NS0A 4HZFA 3VSLA 1R6RA 3DQVC 2P6TA 3HSRA 3VOEA 3GFLA 4IOAF 2BBYA 5FLVA 4I02A 2CYYA 1R1TA 4A3LJ 4J00A 1IG7A 1MJAA 2XV4S 4HDVA 2VQHA 4GCVA 3BJAA 3CCMI 4ZYGA 1MKMA 3EYIA 1ULYA 2X1EA 3V8JA 5LHGA 4WWCA 2M1BA 2K86A 3LOCA 3WTVC 4IVNA 4O3MA 1U5TA 1YRNA 2DDAA 3U9GA 4BJ5C 5M5WJ 5DCMA 2Y0MA 4AC0A 4KIFA 1TNSA 2R7QA 2LF7A 1IDZA 3ZQCA 1TW2A 2HXIA 2EINH 3N97A 2RQPA 1RR8C 3CCQI 3PNYA 2BXYA 2VJIA 1D8JA 3IKTA 1SD5A 1HKSA 3PFYA 3I9V2 4M9XA 4Y15A 1MBKA 1Y8QB 4XQFA 1HSTA 3F8CA 2QKMB 3ELKA 1RNLA 3TDUC 2E5NA 1TL8A 4JX5A 1BC7C 3VEPA 4LIUA 2DCEA 1B8IB 5HDKA 2HOEA 3QQAA 4LLLA 1G8XA 1W7PA 5LBQA 1G6NA 1W0UA 1VF9A 3W3CA 4ZC3A 1IN5A 1CF7B 2CGPA 2A61A 1Y6IA 3HPHA 3IAM2 3F6VA 2VT2A 2VL8A 2Y9ZA 3RIRA 3E97A 3GYHX 4S0HB 4HSTA 3U2RA 2BZTA 1T8IA 1MGTA 2X6OA 2VBYA 4C3IJ 2W1OA 4B3AA 2R7XA 4HAMA 1LJ9A 1X4PA 5E3NA 2QWWA 1UFMA 3BR2A 3OYMA 1I3QJ 2X85A 2Z3YA 3MEXA 1VQNI 1SFEA 3BR3A 1ON1A 2ZJPF 3AG1H 1LEAA 1HSJA 2M4GA 2YR2A 2GZWA 4OIPF 1FIAA 1X1AA 2LMDA 1I6XA 5DUKA 1VQ4I 2P81A 1I1SA 3O2PE 1JE8A 3OOPA 2QLZA 1W7PD 1XDUA 2OUMA 5LFAA 3K4CA 5E17F 2WB1A 1BIBA 2ZO4A 2RGVA 1ZGAA 1S5LC 2Y31A 2YU9J 2LY2A 2W25A 4CXFA 4U0YA 2ISZA 4BNCA 5FLMJ 1QO0D 2HQRA 1MBHA 5LLQA 4XLEA 5D4RA 4GFBA 4A6DA 1D1BA 3L2VA 4BJTA 3HRSA 4LB6B 1TLHB 2ZFWA 1XGOA 4RA2A 5J40A 5J4YA 5K5QA 2ICWG 3M7GA 2HPIA 3OYLA 2KRCA 2VPRA 4IHYA 4BEHA 4D5CA 4WXDA 1SFXA 2E1OA 2F2EA 3JRHA 2Z16A 3COAC 1Z1DA 1MBEA 1FLIA 3H92A 2QQ8A 3ZN1A 5IT9K 3LSJA 5EJCA 5BOXA 4NQWB 1ZR2A 1G3WA 2KRHA 2PJRB 3CCVI 1AWCA 3J7YJ 1NG6A 2DYSH 1N78A 1KQ8A 1WZ2A 3MD2A 5FLXK 1K78A 5KK1A 2UUZA 3OYEA 2HDDA 2KFDA 1MBGA 3MZYA 2VKHA 4OOIA 1ZG3A 5LEJA 3KEOA 5L3DA 2VUMJ 3PM1A 3ZOBA 5D6EA 2ELKA 3H3VK 3G3ZA 3G6EI 3LFUA 5FLXZ 5C4XJ 4M3DA 3OS2A 4MNUA 4O5VA 2QZ8A 1WPKA 2DFHA 2VKEA 3OS0A 5D5UB 1IGNA 2FX0A 4UUTA 3PUFA 4N4OB 1H0MA 2XGCA 4EM0B 1IF1A 4IEJA 3W6JB 4CCJA 4FT8A 2Y30A 3PNTA 4I99C 1Z7UA 2O03A 2PMZN 2QUFA 1SFUA 4BACA 2X1DA 3QP6A 3OYGA 4DZJA 1A36A 2Z5UA 2EIJH 2DFFA 2VQCA 5B66C 1JTXA 2WWYA 2MBFA 1XS9A 3K4NA 5E3MA 4M3FA 2E2JJ 1OYYA 4RGSA 2GA1A 2RREA 1J09A 2FA5A 1LDDA 1F1ZA 2CQQA 1SD6A 3UR3C 1W5CC 1XX5A 3F3XA 1JHHA 1D5VA 2CV0A 2M30A 5A2QK 3W6VA 2IP2A 1LFUP 3KX2A 1RRJA 2D5VA 4IOCF 4OINF 1JTYA 2F5EA 2EA2A 1J9IA 2F5VA 2K9LA 1BN5A 2O7OA 1ZKGA 2QVOA 3K2AA 4KN7X 4G7HF 1PVEA 2JA6J 1ETXA 3KP5A 2DA4A 3BC8A 2P5VA 1LVAA 1YTYA 3QYEA 3ABUA 1YS7A 1D3YA 3TOBA 1G59A 4AIJA 4KICA 4HNTA 4HV5A 2OJED 2J5OA 4ZYHA 4ENNA 3QWLA 3OYBA 1VI0A 3WE2A 4PUSA 3CUQC 3I4MJ 2UZKA 3MZHA 2FOWA 4E7LA 3IUOA 2HTSA 3V8KA 1Z67A 1ENHA 2LC2A 2DA7A 1B72B 2Y75A 2M5WA 3BR1A 2W4SA 5L3BA 3K10A 3FXJA 2M8GX 2DA5A 1SAXA 4MLOA 3BJOA 2M0MA 2DA2A 1YJWI 1BL0A 4RLFA 4C3JJ 1P92A 4UV9A 1FNNA 1RI7A 1OCCH 2LH9A 3VYSB 3LNQA 3A01B 4RAYA 2IGKA 5TGTA 5L3EA 2O8XA 2L7KA 4PJMA 2W82A 3Q3SA 1ZTRA 1E3HA 4U87A 1YE9A 1QHHD 4QPQA 2K5CA 1FSEA 3OOUA 4MTDA 3OYJA 2JT1A 3CCJI 4HX7A 1UCRA 3DPTA 3S3OA 2IJLA 3O6BB 4F92B 2QYOA 3CCSI 3ZQGA 5C4JJ 2L9RA 2XAQA 3I3LA 2CV2A 2EIKH 4NC6A 3ZMTA 2XSDC 3UKGA 2EA4A 1YIOA 3J7ZI 1APLC 5IYDJ 2LKXA 4PSWA 5FROA 2MC3A 4WCGA 1SMTA 2LY9A 2DO7A 3S1MJ 2Q2EB 1SVLA 1TQPA 3OR2C 3FXMA 5F0CA 2DJIA 1BI0A 2Z1DA 3HHHA 4BE2A 2H09A 2LD5A 3S1QJ 4MFEA 4FTHA 1FSHA 5EG0A 4EGZA 2GLOA 4CHUA 5LHHA 3J7AO 5EGOA 2A6EF 2BOLA 4E7ZA 4DNCA 3IP4B 1S29A 4G12A 3GTMJ 3ZGKA 1KZHA 3MZ8A 3K4MA 3LMMA 3BZ6A 2VBXA 1TC3C 1QZZA 3DKYA 2KZGA 1JKPC 2IA1A 3B02A 3L9FA 1EA3A 4L9VA 4RS8A 2NOJB 1ZR4A 5EF6A 3DCFA 4O6JA 1KONA 1FOYA 3QAHA 4H4KC 4N9IA 1P4WA 3A03A 5E1ZB 4BBSJ 5BQTA 1XD7A 2EFPA 2HGCA 2L5QA 1E3OC 2IS1A 1DP3A 2XB0X 2VBZA 2XGDA 5FKLA 5CPRB 4ETSA 4EJOA 2IVMA 5IT3A 4XLAA 3LAPA 5DV5A 3F8BA 5HDNA 2LDUA 2XSJC 4P5OA 2VJ5A 2MH2A 2NS8A 5EYRA 3KZYA 3RZDJ 3HOVJ 1YFHA 2MH9A 2BVLA 3H5NA 1XMKA 2FRHA 3OYKA 1BBYA 3TW6A 4IKFA 2NNYA 2D1HA 2VB6A 2L4AA 2HQNA 4F55A 2ESNA 4OMZA 1OQYA 3HJEA 3H0DA 1NH3A 2EZHA 3IWZA 3AL0C 2ZC2A 4PGHA 5EDNA 1XSVA 4E7HA 4HX8A 4LLGF 4KFCA 2VE8A 1MD0A 4Y7NJ 2BV6A 1T6SA 2NYXA 3GZ6A 2M87A 3EPZA 3B6AA 4N0BA 1YITI 3V4GA 1OCOH 1T08B 5B1BH 1IO2A 1T95A 4HF1A 3S32A 5GADJ 3DLAA 5KAFC 2OF7A 1WQ2A 1G4DA 5LRSA 2D2WA 2PFBA 2EWNA 4BQOA 1WCMJ 3PL8A 5J6XA 4EEFG 5JHFA 3GTJJ 2JWTA 3P9CA 1BI3A 1D1CA 2VC1A 3FK6A 1XDSA 2H6BA 1H88C 4EQQA 2CO5A 3K1NA 1Z3XA 3K4BA 1U8BA 2OAZA 4U7DA 4A3IJ 4W1UA 4NNJA 2H27A 1ZYRF 4X1EA 1OPCA 2W85A 4L0ZB 3L1PA 2D45A 2P5LC 4YIFA 3NARA 1EJ9A 2KP6A 2QF7A 2DOAA 1LFBA 4AYBN 2MLKA 4Y17A 3OSGA 2STTA 1BC8C 2IXSA 5IP9J 2L7FP 2DLLA 4ESJA 4IHTA 3VODA 2KIMA 1MDMA 3E6MA 3R60A 4P55A 2DAOA 2P5KA 2VN2A 4LG3A 3KLOA 1YW9A 3P7NA 2LTPA 2NVYJ 4F7ZA 5LEKA 3GTLJ 1P6RA 2V79A 2K9NA 5AIPA 3FMSA 2FXAA 2OQRA 1HXDA 1IUFA 2IGNA 2LLKA 1KU3A 2ECBA 2OC6A 1J5YA 4Q47A 3S8PA 3ERMA 1FYMA 1YQAA 1F9NA 2ISYA 4RLQA 5J8CA 3LQQA 1RKWA 1U3EM 1KQ0A 2FUG2 3WGIA 2EFWA 1W0TA 2RAEA 3RKYA 1BJZA 4LJZF 3N4MA 5TJJA 3EYYA 2R7VA 1JI8A 2L9SA 3SYTA 4A5NA 3RYPA 2AQFA 3ISPA 3OV8A 4XOPA 2B9SA 2UWMA 2QM3A 3LSTA 3F8FA 5K7FA 1WJ5A 2LR8A 4A12A 1VQMI 3LQRA 3IC7A 3J80Z 3MVPA 3TL4X 4DYCA 1UZCA 1PJRA 4XLNF 3GVAA 2WAFA 2AS5F 1FT9A 2IW5A 3RCOA 1I6HJ 3WU1B 2NNNA 4AM3A 1FBSA 1WVRA 2KJCA 2HPMA 3JRBA 3DKWA 3OYHA 3OL4A 3AAFA 4EGYA 3PSFA 2OTJI 3DU6A 1U9NA 2E7WA 1DU6A 4HG2A 3C2BA 3HM5A 2VQLA 2ELJA 4DBRA 1O4XA 2LK2A 3DPUA 5FKKA 1HA8A 3BG3A 4HQMA 1OCPA 2PLYA 1R5ID 2ZNZA 1UHMA 3DEUA 3FBIB 3MKYB 3SDBA 2JSCA 4EVIA 5CVVA 2ZSHB 4KISA 3DTEA 2P4WA 5CYVA 4ABZA 4KA4A 2R0QC 2E71A 2F48A 3DBLB 5DTDA 2LRDA 4KIBA 2WC2A 1VQ6I 5ERIA 2LG4A 3WTUC 3PJRA 1OYIA 2H8WA 2LVSA 3PUBA 5F0HA 1UAAA 4HA8A 3RKQA 2MD5A 3PIOF 2I5UA 5DCFA 2ECCA 3WTTC 3IRQA 4UB8C 4I6ZA 4EV0A 4ZTJA 2JZYA 1NK2P 1X3ZB 4TV7A 4G6TB 3DWLE 4UUVA 1VQ7I 1X4OA 3P5JA 2M8EA 1A5JA 2E34A 2OTLI 2NVQJ 3F22A 1SMYF 3GF2A 2CMPA 6PAXA 3ZMUA 4E70A 1X1CA 4A3KJ 2MW8A 3LL7A 2X6XA 4AIKA 3RI4A 1XGSA 4C2UA 2ADUA 3CC4I 5DM7F 3GFJA 1SD4A 1XTAA 5TISC 4PJJA 4A2UA 5ICEA 1F43A 3ZXSA 2CUFA 1POGA 2XAUA 2PMZA 2CW0F 2OV7A 3RKXA 1ZH5A 3BR5A 3E5QA 3FIWA 1XCBA 2DT5A 2OCCH 2ZB9A 1O7FA 3VWBA 1WRJA 3MCZA 3E5XA 1HQCA 2COBA 2PMHA 5H6QA 2A5WA 4WK8F 1X1PA 4M6VA 3TQNA 3ZQIA 4YFXF 4M3EA 1OISA 1QRYA 3I59B 5IY5H 4RDUA 5F1JA 4A3GJ 4BKXA 3CMEI 1YG2A 3REOA 3GUDA 3PO2J 2IGMA 2GIZA 1P4XA 3KP2A 2X1CA 2R7SA 1X2MA 4BY1J 5GAHJ 2R3SA 4U88A 3HSEA 5KCMA 5ED4A 1UG0A 4AWXB 1R1VA 1JUMA 4AD9A 5FB2A 1AHDP 5HDGA 2NXNB 3RDIA 1U6GA 3WU0A 4BUPA 4A93J 3ZN0A 3ZP5A 2VOPA 3SZTA 4JX6A 2O0YA 4CZZA 2IS4A 4CUGA 1HC8A 1WH7A 1VQ8I 2VKDA 2G0EA 5GTHC 4BQQA 4UY8I 4DYQA 2A6TA 4A0YA 1MW7A 1BW6A 5DD4A 4AIHA 4G6DA 2NVUB 1SD7A 1ZGWA 2BE5F 3LSKA 2XAHA 4ENJA 1V55H 5HODA 3NAUA 2E1NA 4RGXA 3RTRA 2R5YB 2A07F 5IP6A 4DQ2A 2X6YA 2LYCA 2R5ZA 1ODDA 3MMYB 4D5FA 1GLNA 4M73A 3GX4X 3ZCOA 3LA7A 3ULQB 2L4MA 1BR2A 3I55I 2E2HJ 2ZFUA 2ME0A 5K7HA 1FYLA 2L9NA 2G9WA 3AG2H 1J2XA 2KDOA 4BXFA 4M74A 3GWZA 1S7EA 2IA0A 1FOKA 1BI1A 4OAZA 5DD8A 1RR7A 3MFKA 4AU7A 4F3QA 4IJAA 4XN3A 1KQ9A 4PJ0C 1WKMA 1V5FA 2L7ZA 2OA4A 3AKZA 3IRRA 2W84A 3CD6I 1XGMA 1X1BA 1X58A 2JN6A 3TBIA 2NRAC 2EBIA 1HW1A 2M9HA 3HGGA 4ASNA 3CCEI 1R5HA 2DA6A 3L7WA 3R0AA 3SHFA 2VPLA 2XRNA 1H8AC 1GHCA 5FGMA 4L5EA 5FFXA 4ENKA 2NOGA 3BCAA 3JREA 1LFPA 2RNJA 3Q9VA 4S05A 4I0AA 1OYWA 5TRDA 4A6EA 5EZHA 3TW7A 4EATA 2H1LA 3FMRA 5E3LA 2FBHA 1R4NB 4UVBA 2VQGA 4LOCA 1ZAOA 4PFOA 4IL6C 1YO5C 1LE8B 1I3AA 3LSHA 5K5RA 2QSHX 4JK1X 1ZG5A 1TWGJ 2F5DA 3LSGA 4FISA 1R4MB 4P96A 1N75A 3IH3A 1P4AA 2PX9A 4B44A 4KT6A 3HYIA 4XIDA 3K0LA 4XBFA 1IRGA 2HVRA 3F23A 2QBYA 3K4LA 2TDXA 1ZARA 5LRRA 2IRFG 3RPUA 3SXYA 3TGNA 4KITB 2HQAA 3W2VA 3KETA 3K70C 3QPTA 1KU2A 3F21A 2JVGA 4XRFA 4XONA 5CVIA 4DBQA 2B63J 2WTEA 3RQIA 4RB1A 4A3FJ 4PFPA 1O7LA 4Y3OA 4U0VA 4X0GA 2Y48A 2VE9A 1OKRA 3KCCA 1Y39A 1R71A 2L02A 2ZKZA 1ORKA 1TP4A 1NG7A 2V6CA 3ERED 3CP2A 2HXOA 2DODA 3WHCA 1RIOH 2PQ8A 3T8RA 3RPUD 2IGOA 5J47A 3GTPJ 3TDZC 1K61A 2QA4I 1OR7C 2DU9A 4IZZA 2E5ZA 2XPUA 5IYBJ 3CO7C 4II3A 3FMQA 4RBOA 4K2EA 3IH4A 2KPMA 1Z21A 4G6QA 4HOBA 3S1RJ 1PUFA 3ZQLA 4KT5C 4B4CA 3K70D 2X9DA 3BY6A 2XROA 2KJBA 1YJNI 1FX7A 2L0KA 3AFHA 4ON0A 5FRMA 5GPCA 2L7MP 3K2ZA 4ESBA 1OR7A 1YS6A 2LNBA 5D6FA 4RAFA 4CA0A 4GYIA 4QWQA 2CH0A 3OR1C 5F08A 4A0ZA 3KEYA 2KISA 2BY1A 4EM1A 2ZXWH 1YJ9I 3V42A 2AQEA 3JR9A 2CFXA 3L2QA 1R9TJ 3L2CA 2HS5A 4ZJZA 5JVGF 2TCTA 1AKHB 4KMUX 1JGGA 1W1WE 2ZMEC 4XMYA 1T33A 5L3FA 3FBNB 1SFOJ 4I09A 1FYKA 2EV0A 2XIGA 3Q0UA 1K4SA 1JXSA 3GW2A 4B48A 1GXQA 1S72I 3CCLI 1S7OA 4LGWA 1FOWA 1QPIA 1LPQA 1JUPA 4AYBA 5HNHA 2DK5A 3K6GA 1FPQA 2F4IA 1BA5A 2VXDA 2ZMEA 3R0JA 2JA5J 3HHGA 3ML6A 4FX4A 4OU0A 1REPC 3OIOA 4LG0B 4I98B 4KYWA 4OMYA 2V1DA 4HW0A 2YS9A 4OIRF 2ZCWA 2DT6A 2F5FA 2KIQA 3I5UA 3QOPA 4IRHA 3EDPA 3FX3A 5F0FA 2K9QA 3FXQA 4CICA 4PCQA 2HTJA 4A0XA 5ILVA 1BI2A 2WA0A 2YSRA 3H1CA 1R7JA 1IJWC 3ZMSA 4M6XA 4L5IA 1MSEC 1MH3A 5E79C 1IW7F 1ZLJA 4BL0B 1EH7A 2Y9YA 5FRNA 2RC4A 4CZCA 2XHKA 4CCLA 1RESA 3OYNA 1IRXA 1VQPI 2K02A 2JUGA 5BPDA 2V4JC 3BQZA 3CCYA 4PJNA 3WTWC 3F6OA 3CUQA 5CVRA 1XMAA 2FOKA
chains in the Genus database with same CATH topology
1UHWA 4RGUA 3TO9A 2L01A 4ZZLA 4G9YA 2FMYA 5DYMA 3QU6A 3PQJA 5JI6A 4GYGA 3GFIA 1FBQA 1ZRCA 1U2WA 3E3VA 2P7CB 5E1WA 2HZTA 4WX9A 1PDNC 1TTYA 3JTHA 1XSXA 2YX7A 2K27A 3HOSA 1OMIA 2XUBA 1QQIA 3DXJF 3CDHA 1U8RA 4EJTA 5JR3A 1E17A 3C18A 1KU7A 2GXGA 2KIFA 3NRVA 5E20A 3GO5A 1I5ZA 4LFUA 1B4AA 1EH8A 3KEQA 4G8XA 3SZPA 4ZH4F 4B09A 1IZ1A 3M8EA 3NEUA 2FNPA 1YW8A 1HBXG 2FNAA 4IXAA 2RVCA 2K4BA 3WGHA 1ZHFA 2COMA 1U5TB 2P6SA 5DCMB 4XSZF 1R5GA 2RN7A 1DPUA 1K6OA 1PP7U 3FWEA 1K7AA 1GVJA 3P9IA 1EV7A 2Z9OA 1Y0UA 1G3YA 4M6YA 4KDPA 4BXUA 1K79A 2JPBA 1L0OC 1CF7A 2PJPA 4LMYA 4IF4A 1Z6RA 4ZYEA 2KKOA 1IUYA 4OIQF 5EEHA 4Q4ZF 3WTSC 1ZLKA 2JPCA 1W7PB 5HS8A 1VTNC 1IN4A 3R61A 2EFOA 2PG4A 1ON2A 4UNOA 1I27A 3F72A 1HKTA 1D8KA 2HEOA 1LNWA 2ZNYA 4KMFA 1B6AA 2A5YB 3R6SA 1Q1HA 5F1RA 2IA2A 2OBPA 3FM3A 1B59A 1RUNA 1XSDA 1QBJA 2VONA 1AOYA 3BP8A 3RPQA 4L9TA 4BAYA 3FXRA 4NQWA 3HRTA 2G7HA 2Q0OA 1HW2A 2QENA 1MZBA 2DQLA 2B0LA 4I01A 2DTRA 5K5OA 3BROA 3J80K 3JSOA 3U1DA 4L18B 3KP7A 2OZ6A 4M9ZA 1R22A 2DW4A 2MLGA 2W57A 3L00A 5HS9A 1FP2A 3T5XA 3K69A 4IRIA 1K78B 4WF2A 3IL2A 3HRUA 2EFQA 3HRMA 5ILSA 4LB5A 3GFMA 2DK8A 2FSWA 4PZJA 3TO7A 3FF5A 4UHTA 2GIVA 2K4JA 3GLXA 3I4PA 3RKWA 3ECOA 1ZN2A 2L3DA 2O61A 3IWFA 1XGNA 1TQIA 2STWA 3FM5A 2RKHA 3TKYA 2XAGA 4Q48A 2PBIA 4N9HA 1WWXA 2Q8KA 2GXBA 2VT3A 3O3KA 4WXCA 3WTXC 1LDKB 5CVUA 5D5VB 3D0SA 4BYYA 1HW5A 3R4KA 5AONA 3GZ5A 2KIUA 4R1HA 5E8IA 3FHZA 3WG9A 4UXNA 1LEBA 3L09A 2FU4A 2QQAA 3CO6C 2JRTA 3FZVA 4EJVA 1XCVA 3QP5A 2FQ3A 4Z2YA 5HLGA 1HKQA 1FBUA 1IN6A 1Z9CA 3BOQA 4G7ZF 1DPRA 2P7VB 4M9SA 4S04A 2XKOA 4KN4X 1RZ4A 4RAZA 4XSXF 5ICCA 2Q2EA 3HUGA 1R1UA 3S2WA 3J81Z 4IHSA 1ONVA 4HF2A 4ESFA 2ETHA 2LSOA 1ZG1A 5K1YA 1PUEE 2CWEA 3I64A 4BQAA 2D1VA 3VFZA 1BJAA 3T1BA 3SFZA 4U0WA 4EM2A 1KU9A 3SQNA 2BGCA 3V8LA 4LK0F 1T39A 2MA3A 3KP3A 2A3SA 2X0LA 1WI9A 3I53A 2HKOA 1IN8A 1I1GA 1T98A 4HF0A 2OU2A 4L0YB 4L9JA 1O3TA 3ECHA 1J59A 1W5TA 1KYZA 2L54A 4OIOF 2DBBA 1RUOA 5HOOA 5FD5A 2DI3A 4M71A 3V7SA 4KNYA 1YYVA 5HLIA 3QPHA 4CYDA 3KP4A 4EJWA 2CQKA 4MEXF 2BYVE 3HTUA 2G7UA 5D5WB 1IRFA 4EMSA 1R00A 3LFKA 3IKVA 1TQMA 3H3UA 3WODF 4D0PA 2VXZA 1QNTA 4L5JA 2WV0A 1NHAA 4MHGA 1FZPB 4CDGA 5DUIA 4QLCU 2FMLA 5HLHA 1BIAA 4ZZDA 3V7CA 4KUMA 4G94A 3BWGA 3I54A 3WE3A 1LB2A 1USTA 5JHUA 2IPQX 2XAJA 1S3JA 5F6FA 1ZRDA 3DF8A 4BH9A 3M9AA 4MGRA 2GQQA 5HVQC 1MDMB 2HKXA 1GXPA 2CG4A 1JHFA 1S8NA 1T0FA 5H6RA 4LLNA 5ICFA 1FC3A 3MWMA 2CSOA 5DDGA 4HQEA 5FD6A 1S6LA 3PQKA 5IT9Z 3C3WA 5F64A 3DPLC 2V1XA 2E1CA 3WGGA 3BPXA 5D8LB 2FEZA 2LKPA 1TW3A 1USSA 2X4HA 4H0EA 1L3LA 3IHUA 3ZQ7A 5CLSA 5JFRA 2PI0A 1F5TA 1BM9A 1Z91A 3EETA 5JVTA 2O3FA 1B1BA 4L9NA 4YIIA 5H20A 3VB2A 4FHTA 3JSPA 1IN7A 2ZJ2A 3BPVA 5LGUA 3G73A 5KVRA 2OQGA 4I2OA 5CJ9A 4MQVA 3T8TA 3ROUA 5A2QZ 2C6YA 1XB4A 2VOOA 3CTAA 3W6KB 5BMZA 2PN6A 2HFHA 4M72A 3BDDA 2M45A 3LWFA 2ACJA 1LQ1A 2R7FA 3CLOA 3JW4A 3I0TA 3M8FA 2EV5A 4UVAA 4IRGA 3QRFF 1IXCA 3F8MA 1X3UA 3WTZA 3B73A 3K9TA 3I59A 3GXOA 1H9TA 3JTGA 3QU3A 2A69F 1R23A 2A68F 5E18F 3E5UA 1WSUA 2EV6A 2QQBA 2OZUA 1BOAA 2PEXA 4RGRA 2W24A 3LA2A 2UXXA 3TOAA 1V3FA 1IAWA 1E2XA 1KYWA 2BEOA 5ILUA 1ZREA 3Q9SA 4KIGA 1O57A 4PDKA 2R7DA 3KZZA 3KE2A 5LGNA 4NHJA 2XAFA 3MAJA 5LGTA 4HX4A 2DQRA 4HDUA 5DEQA 4BHPA 2YX4A 4BHCA 3KFWX 3FXUA 3C1DA 2EB7A 4LD5A 2HWVA 1FY7A 4CGZA 3V7RA 1LDJA 4MEYF 2RV8A 4EJUA 1F4KA 4GO1A 1XN7A 4I7HA 2H94A 2FF4A 4R79A 2ZBKA 2VODA 2DFIA 3E6DA 1CGPA 4P9UA 2FBKA 4BHBA 1UB9A 4GGGA 4FX0A 1IXSB 4I0BA 3D5LA 2UXNA 5D8KB 3DFGA 2J5PA 1KGSA 2HDCA 1P2FA 3I71A 1ZGJA 1V4RA 2XKPA 5AIQA 1Z6TA 1JGSA 2DPUA 4Y13A 2HYGD 1FWZA 3DP7A 4A5MA 4YG2F 3BJ6A 5LHIA 1R58A 3E6BA 4G7OF 5BPIA 5J8FA 1MJBA 3ZMZA 2PMUA 2XVCA 4HV6A 1ZRFA 2GWRA 3RYRA 1J7KA 4PGGA 2H6CA 2YU3A 1U78A 2QBYB 4RB0A 2GA2A 4MTEA 1W4MA 1YW7A 3CJNA 1J0RA 3EQLF 2EJRA 2F5CA 1A04A 3JAMK 1DUXC 1B9NA 1QZYA 5CVJA 2HR3A 4HYEA 3KP6A 4ZYDA 4R8HA 1T2KA 3EUHA 3K1MA 2XASA 3JAMZ 4Q5SF 3H3ZA 1O3SA 2O6GE 4CO8A 2VBWA 2OD5A 5ICGA 4HBLA 2V1UA 3ABTA 3LAJA 2E7XA 3Q5FA 3NQOA 4JBAA 4YFNF 1G3TA 1MJ9A 2NAZA 3WTYC 1QGPA 1G3SA 2EK5A 2RDPA 2EFNA 4B8XA 1TNTA 1R36A 3HOTA 1J75A 3DV8A 5FFZA 1C0WA 5HS7A 3F8NA 4LG0A 3I58A 3CUOA 2AXLA 2JTVA 5L3CA 3RJPA 2ESHA 2HYFA 2ZMEB 1TBXA 1T38A 4JQFA 5FO5A 3ZMDA 4RB3C 4UVCA 1H9GA 2YPRA 2VC0A 2QQ9A 1W5SA 4XLPF 4HLYA 3P9KA 1QPMA 3T0YA 5D4SA 4RB2C 2A6HF 4HLXA 2LF8A 2Z99A 2ELHA 4NB5A 2FE3A 3LA3A 3CUQB 1STZA 3GEZA 1O3RA 3HIFA 1Z05A 4U7BA 1PP8F 2GAUA 1DDNA 1S7AA 5EEGA 4ENMA 3TO6A 4AVPA 1YLFA 4YFKF 3J81K 2KRFA 1IXRC 4IPAA 2DPDA 3ZPLA 3M1EA 3HTSB 1EH6A 4WXHA 3PFIA 3HSFA 5D5XB 2FBIA 5E1XA 5L3GA 1O3QA 4MQ9F 1FP1D 5E8GA 2XGXA 2V9VA 2ZXJA 4GXOA 4UV8A 3ZMVA 4LK1F 4P9FA 2Z33A 2P8TA 2K7LA 3KLNA 3C7JA 3MQ0A 5BS6A 3K1PA 3E6CC 1KA8A 1U5TC 1B9MA 1DP7P 2IT0A 2NS0A 4HZFA 3DQVC 2P6TA 3HSRA 3VOEA 3GFLA 2BBYA 4I02A 2CYYA 1R1TA 1MJAA 2XV4S 4HDVA 4GCVA 3BJAA 4ZYGA 1MKMA 3EYIA 1ULYA 3V8JA 5LHGA 4WWCA 2M1BA 2K86A 4O3MA 3WTVC 4IVNA 1U5TA 3U9GA 5DCMA 2Y0MA 4KIFA 1TNSA 2LF7A 1TW2A 3N97A 2RQPA 1D8JA 3IKTA 1SD5A 1HKSA 4Y15A 4M9XA 1HSTA 3F8CA 3ELKA 1RNLA 3TDUC 1BC7C 3VEPA 5HDKA 2HOEA 4LLLA 1W7PA 5LBQA 1G6NA 1IN5A 1CF7B 2CGPA 2A61A 3F6VA 2VT2A 3RIRA 3E97A 3GYHX 3U2RA 1MGTA 2VBYA 4HAMA 1LJ9A 2QWWA 1UFMA 2Z3YA 3MEXA 1SFEA 1ON1A 1LEAA 1HSJA 2YR2A 2GZWA 4OIPF 5DUKA 1I6XA 1I1SA 3O2PE 1JE8A 3OOPA 2QLZA 1W7PD 1XDUA 5E17F 1BIBA 2ZO4A 2RGVA 1ZGAA 2W25A 4CXFA 4U0YA 2ISZA 4BNCA 1QO0D 2HQRA 5LLQA 5D4RA 4A6DA 3HRSA 4LB6B 1TLHB 2ZFWA 1XGOA 5K5QA 3M7GA 4WXDA 1SFXA 2F2EA 3COAC 1Z1DA 1FLIA 3H92A 3ZN1A 5IT9K 5BOXA 1G3WA 1AWCA 1KQ8A 5FLXK 1K78A 5KK1A 3MZYA 4OOIA 1ZG3A 5LEJA 3KEOA 5L3DA 5D6EA 3G3ZA 5FLXZ 4MNUA 4O5VA 2QZ8A 5D5UB 1H0MA 1IF1A 4EM0B 3W6JB 4FT8A 1SFUA 1Z7UA 2O03A 2QUFA 3QP6A 2Z5UA 2WWYA 2MBFA 1OYYA 4RGSA 2GA1A 2FA5A 1LDDA 1F1ZA 1SD6A 3F3XA 1JHHA 1D5VA 2M30A 5A2QK 2IP2A 4OINF 2F5EA 2EA2A 1J9IA 4G7HF 1BN5A 2QVOA 4KN7X 3KP5A 2P5VA 1LVAA 1YTYA 3ABUA 1YS7A 1D3YA 3TOBA 4AIJA 4KICA 4HV5A 2J5OA 4ZYHA 4ENNA 3WE2A 3CUQC 2UZKA 3MZHA 2HTSA 3V8KA 2Y75A 2M5WA 5L3BA 1SAXA 3BJOA 1P92A 4UV9A 1FNNA 1RI7A 4RAYA 5L3EA 2O8XA 1FSEA 4MTDA 2JT1A 4HX7A 1UCRA 3DPTA 2IJLA 3O6BB 2QYOA 2XAQA 3ZMTA 2EA4A 1YIOA 2MC3A 4WCGA 1SMTA 2DO7A 1TQPA 1BI0A 3HHHA 2H09A 1FSHA 4EGZA 4CHUA 5LHHA 3J7AO 2A6EF 4DNCA 1S29A 3BZ6A 2VBXA 1QZZA 2IA1A 3B02A 3L9FA 4L9VA 4RS8A 4O6JA 3QAHA 4N9IA 1P4WA 5E1ZB 5BQTA 1XD7A 2EFPA 2HGCA 2VBZA 4ETSA 4EJOA 2IVMA 5IT3A 3LAPA 5DV5A 3F8BA 5HDNA 2LDUA 4P5OA 2MH2A 3KZYA 1YFHA 2MH9A 1XMKA 2FRHA 1BBYA 2NNYA 2D1HA 2L4AA 2HQNA 2ESNA 4OMZA 3IWZA 4PGHA 1XSVA 4HX8A 4LLGF 4KFCA 2VE8A 1MD0A 2BV6A 1T6SA 2NYXA 3GZ6A 2M87A 4N0BA 3V4GA 4HF1A 1WQ2A 1G4DA 5LRSA 2D2WA 2PFBA 2EWNA 5J6XA 3P9CA 1BI3A 2VC1A 1XDSA 2H6BA 4EQQA 2CO5A 3K1NA 2OAZA 4U7DA 2H27A 1ZYRF 1OPCA 2W85A 4L0ZB 2D45A 2P5LC 4YIFA 2MLKA 4Y17A 2STTA 1BC8C 2DLLA 4ESJA 4IHTA 3VODA 2KIMA 1MDMA 3E6MA 3R60A 4P55A 2DAOA 2P5KA 2VN2A 3KLOA 1YW9A 3P7NA 4F7ZA 5LEKA 1P6RA 2V79A 5AIPA 3FMSA 2FXAA 2OQRA 1HXDA 1KU3A 1J5YA 4Q47A 1FYMA 1YQAA 1F9NA 2ISYA 5J8CA 3LQQA 1U3EM 1KQ0A 3WGIA 2EFWA 3RKYA 4LJZF 3N4MA 5TJJA 3EYYA 4A5NA 3RYPA 3ISPA 3OV8A 2UWMA 2QM3A 3LSTA 3F8FA 4A12A 3LQRA 3IC7A 3J80Z 4XLNF 3GVAA 2AS5F 1FT9A 2IW5A 3WU1B 2NNNA 1FBSA 2KJCA 3DKWA 3AAFA 4EGYA 2E7WA 4HQMA 2PLYA 2ZNZA 1UHMA 3DEUA 2JSCA 4EVIA 5CVVA 2P4WA 5CYVA 4KA4A 4KIBA 2WC2A 5ERIA 3WTUC 1OYIA 4HA8A 2MD5A 5DCFA 3WTTC 3IRQA 4EV0A 2JZYA 4TV7A 4UUVA 2M8EA 3F22A 1SMYF 3GF2A 6PAXA 3ZMUA 4E70A 4AIKA 3RI4A 1XGSA 2ADUA 3GFJA 1SD4A 4A2UA 5ICEA 2CW0F 3RKXA 1ZH5A 3E5QA 1XCBA 2DT5A 1O7FA 1WRJA 3MCZA 3E5XA 1HQCA 2PMHA 5H6QA 4WK8F 3TQNA 4YFXF 3I59B 1YG2A 3REOA 3GUDA 1P4XA 3KP2A 2R3SA 4U88A 3HSEA 5ED4A 4AWXB 1R1VA 4AD9A 5FB2A 5HDGA 3RDIA 1U6GA 3WU0A 3ZN0A 3ZP5A 2VOPA 3SZTA 2O0YA 4CZZA 4A0YA 5DD4A 4AIHA 4G6DA 1SD7A 2BE5F 2XAHA 4ENJA 2E1NA 4RGXA 3RTRA 2A07F 4DQ2A 1ODDA 4M73A 3GX4X 3LA7A 3ULQB 2L4MA 1FYLA 2G9WA 1J2XA 4M74A 3GWZA 2IA0A 1FOKA 1BI1A 5DD8A 3MFKA 4IJAA 1KQ9A 1WKMA 2OA4A 3IRRA 2W84A 1XGMA 2NRAC 1HW1A 4ASNA 1R5HA 3L7WA 3SHFA 3R0AA 2XRNA 1GHCA 5FGMA 5FFXA 4ENKA 3Q9VA 2RNJA 4S05A 4I0AA 1OYWA 5TRDA 4A6EA 3FMRA 2FBHA 4UVBA 1ZAOA 1YO5C 5K5RA 4JK1X 1ZG5A 2F5DA 4P96A 1P4AA 3HYIA 3K0LA 4XBFA 1IRGA 3F23A 2QBYA 2TDXA 1ZARA 5LRRA 2IRFG 3RPUA 3SXYA 3TGNA 3KETA 3QPTA 1KU2A 3F21A 4XRFA 5CVIA 2WTEA 4RB1A 1O7LA 4U0VA 2Y48A 2VE9A 1OKRA 3KCCA 2L02A 2ZKZA 2V6CA 3ERED 1RIOH 2PQ8A 3T8RA 3TDZC 2DU9A 3CO7C 3FMQA 4K2EA 4G6QA 4HOBA 4KT5C 3BY6A 2XROA 2KJBA 1FX7A 4ON0A 3K2ZA 4ESBA 1OR7A 1YS6A 2LNBA 5D6FA 4GYIA 4QWQA 4A0ZA 4EM1A 2CFXA 3L2CA 2HS5A 4KMUX 5L3FA 4I09A 1FYKA 2EV0A 2XIGA 1JXSA 3GW2A 1GXQA 1S7OA 4LGWA 2DK5A 1FPQA 2ZMEA 3R0JA 3HHGA 3ML6A 4FX4A 4OU0A 1REPC 4LG0B 4I98B 4KYWA 4OMYA 2V1DA 4HW0A 4OIRF 2ZCWA 2F5FA 3I5UA 3QOPA 4IRHA 3EDPA 3FX3A 4CICA 3FXQA 4PCQA 2HTJA 5ILVA 4A0XA 1BI2A 2YSRA 1R7JA 3ZMSA 4M6XA 4L5IA 1IW7F 1ZLJA 1EH7A 2RC4A 2XHKA 2K02A 5BPDA 3WTWC 3F6OA 3CUQA 5CVRA 1XMAA 2FOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHW A;  4RGU A;  3TO9 A;  2L01 A;  4ZZL A;  4G9Y A;  2FMY A;  5DYM A;  3QU6 A;  3PQJ A;  5JI6 A;  4GYG A;  3GFI A;  1FBQ A;  1ZRC A;  1U2W A;  3E3V A;  2P7C B;  5E1W A;  2HZT A;  4WX9 A;  1PDN C;  1TTY A;  3JTH A;  1XSX A;  2YX7 A;  2K27 A;  3HOS A;  1OMI A;  2XUB A;  1QQI A;  3DXJ F;  3CDH A;  1U8R A;  4EJT A;  5JR3 A;  1E17 A;  3C18 A;  1KU7 A;  2GXG A;  2KIF A;  3NRV A;  5E20 A;  3GO5 A;  1I5Z A;  4LFU A;  1B4A A;  1EH8 A;  3KEQ A;  4G8X A;  3SZP A;  4ZH4 F;  4B09 A;  1IZ1 A;  3M8E A;  3NEU A;  2FNP A;  1YW8 A;  1HBX G;  2FNA A;  4IXA A;  2RVC A;  2K4B A;  3WGH A;  1ZHF A;  2COM A;  1U5T B;  2P6S A;  5DCM B;  4XSZ F;  1R5G A;  2RN7 A;  1DPU A;  1K6O A;  1PP7 U;  3FWE A;  1K7A A;  1GVJ A;  3P9I A;  1EV7 A;  2Z9O A;  1Y0U A;  1G3Y A;  4M6Y A;  4KDP A;  4BXU A;  1K79 A;  2JPB A;  1L0O C;  1CF7 A;  2PJP A;  4LMY A;  4IF4 A;  1Z6R A;  4ZYE A;  2KKO A;  1IUY A;  4OIQ F;  5EEH A;  4Q4Z F;  3WTS C;  1ZLK A;  2JPC A;  1W7P B;  5HS8 A;  1VTN C;  1IN4 A;  3R61 A;  2EFO A;  2PG4 A;  1ON2 A;  4UNO A;  1I27 A;  3F72 A;  1HKT A;  1D8K A;  2HEO A;  1LNW A;  2ZNY A;  4KMF A;  1B6A A;  2A5Y B;  3R6S A;  1Q1H A;  5F1R A;  2IA2 A;  2OBP A;  3FM3 A;  1B59 A;  1RUN A;  1XSD A;  1QBJ A;  2VON A;  1AOY A;  3BP8 A;  3RPQ A;  4L9T A;  4BAY A;  3FXR A;  4NQW A;  3HRT A;  2G7H A;  2Q0O A;  1HW2 A;  2QEN A;  1MZB A;  2DQL A;  2B0L A;  4I01 A;  2DTR A;  5K5O A;  3BRO A;  3J80 K;  3JSO A;  3U1D A;  4L18 B;  3KP7 A;  2OZ6 A;  4M9Z A;  1R22 A;  2DW4 A;  2MLG A;  2W57 A;  3L00 A;  5HS9 A;  1FP2 A;  3T5X A;  3K69 A;  4IRI A;  1K78 B;  4WF2 A;  3IL2 A;  3HRU A;  2EFQ A;  3HRM A;  5ILS A;  4LB5 A;  3GFM A;  2DK8 A;  2FSW A;  4PZJ A;  3TO7 A;  3FF5 A;  4UHT A;  2GIV A;  2K4J A;  3GLX A;  3I4P A;  3RKW A;  3ECO A;  1ZN2 A;  2L3D A;  2O61 A;  3IWF A;  1XGN A;  1TQI A;  2STW A;  3FM5 A;  2RKH A;  3TKY A;  2XAG A;  4Q48 A;  2PBI A;  4N9H A;  1WWX A;  2Q8K A;  2GXB A;  2VT3 A;  3O3K A;  4WXC A;  3WTX C;  1LDK B;  5CVU A;  5D5V B;  3D0S A;  4BYY A;  1HW5 A;  3R4K A;  5AON A;  3GZ5 A;  2KIU A;  4R1H A;  5E8I A;  3FHZ A;  3WG9 A;  4UXN A;  1LEB A;  3L09 A;  2FU4 A;  2QQA A;  3CO6 C;  2JRT A;  3FZV A;  4EJV A;  1XCV A;  3QP5 A;  2FQ3 A;  4Z2Y A;  5HLG A;  1HKQ A;  1FBU A;  1IN6 A;  1Z9C A;  3BOQ A;  4G7Z F;  1DPR A;  2P7V B;  4M9S A;  4S04 A;  2XKO A;  4KN4 X;  1RZ4 A;  4RAZ A;  4XSX F;  5ICC A;  2Q2E A;  3HUG A;  1R1U A;  3S2W A;  3J81 Z;  4IHS A;  1ONV A;  4HF2 A;  4ESF A;  2ETH A;  2LSO A;  1ZG1 A;  5K1Y A;  1PUE E;  2CWE A;  3I64 A;  4BQA A;  2D1V A;  3VFZ A;  1BJA A;  3T1B A;  3SFZ A;  4U0W A;  4EM2 A;  1KU9 A;  3SQN A;  2BGC A;  3V8L A;  4LK0 F;  1T39 A;  2MA3 A;  3KP3 A;  2A3S A;  2X0L A;  1WI9 A;  3I53 A;  2HKO A;  1IN8 A;  1I1G A;  1T98 A;  4HF0 A;  2OU2 A;  4L0Y B;  4L9J A;  1O3T A;  3ECH A;  1J59 A;  1W5T A;  1KYZ A;  2L54 A;  4OIO F;  2DBB A;  1RUO A;  5HOO A;  5FD5 A;  2DI3 A;  4M71 A;  3V7S A;  4KNY A;  1YYV A;  5HLI A;  3QPH A;  4CYD A;  3KP4 A;  4EJW A;  2CQK A;  4MEX F;  2BYV E;  3HTU A;  2G7U A;  5D5W B;  1IRF A;  4EMS A;  1R00 A;  3LFK A;  3IKV A;  1TQM A;  3H3U A;  3WOD F;  4D0P A;  2VXZ A;  1QNT A;  4L5J A;  2WV0 A;  1NHA A;  4MHG A;  1FZP B;  4CDG A;  5DUI A;  4QLC U;  2FML A;  5HLH A;  1BIA A;  4ZZD A;  3V7C A;  4KUM A;  4G94 A;  3BWG A;  3I54 A;  3WE3 A;  1LB2 A;  1UST A;  5JHU A;  2IPQ X;  2XAJ A;  1S3J A;  5F6F A;  1ZRD A;  3DF8 A;  4BH9 A;  3M9A A;  4MGR A;  2GQQ A;  5HVQ C;  1MDM B;  2HKX A;  1GXP A;  2CG4 A;  1JHF A;  1S8N A;  1T0F A;  5H6R A;  4LLN A;  5ICF A;  1FC3 A;  3MWM A;  2CSO A;  5DDG A;  4HQE A;  5FD6 A;  1S6L A;  3PQK A;  5IT9 Z;  3C3W A;  5F64 A;  3DPL C;  2V1X A;  2E1C A;  3WGG A;  3BPX A;  5D8L B;  2FEZ A;  2LKP A;  1TW3 A;  1USS A;  2X4H A;  4H0E A;  1L3L A;  3IHU A;  3ZQ7 A;  5CLS A;  5JFR A;  2PI0 A;  1F5T A;  1BM9 A;  1Z91 A;  3EET A;  5JVT A;  2O3F A;  1B1B A;  4L9N A;  4YII A;  5H20 A;  3VB2 A;  4FHT A;  3JSP A;  1IN7 A;  2ZJ2 A;  3BPV A;  5LGU A;  3G73 A;  5KVR A;  2OQG A;  4I2O A;  5CJ9 A;  4MQV A;  3T8T A;  3ROU A;  5A2Q Z;  2C6Y A;  1XB4 A;  2VOO A;  3CTA A;  3W6K B;  5BMZ A;  2PN6 A;  2HFH A;  4M72 A;  3BDD A;  2M45 A;  3LWF A;  2ACJ A;  1LQ1 A;  2R7F A;  3CLO A;  3JW4 A;  3I0T A;  3M8F A;  2EV5 A;  4UVA A;  4IRG A;  3QRF F;  1IXC A;  3F8M A;  1X3U A;  3WTZ A;  3B73 A;  3K9T A;  3I59 A;  3GXO A;  1H9T A;  3JTG A;  3QU3 A;  2A69 F;  1R23 A;  2A68 F;  5E18 F;  3E5U A;  1WSU A;  2EV6 A;  2QQB A;  2OZU A;  1BOA A;  2PEX A;  4RGR A;  2W24 A;  3LA2 A;  2UXX A;  3TOA A;  1V3F A;  1IAW A;  1E2X A;  1KYW A;  2BEO A;  5ILU A;  1ZRE A;  3Q9S A;  4KIG A;  1O57 A;  4PDK A;  2R7D A;  3KZZ A;  3KE2 A;  5LGN A;  4NHJ A;  2XAF A;  3MAJ A;  5LGT A;  4HX4 A;  2DQR A;  4HDU A;  5DEQ A;  4BHP A;  2YX4 A;  4BHC A;  3KFW X;  3FXU A;  3C1D A;  2EB7 A;  4LD5 A;  2HWV A;  1FY7 A;  4CGZ A;  3V7R A;  1LDJ A;  4MEY F;  2RV8 A;  4EJU A;  1F4K A;  4GO1 A;  1XN7 A;  4I7H A;  2H94 A;  2FF4 A;  4R79 A;  2ZBK A;  2VOD A;  2DFI A;  3E6D A;  1CGP A;  4P9U A;  2FBK A;  4BHB A;  1UB9 A;  4GGG A;  4FX0 A;  1IXS B;  4I0B A;  3D5L A;  2UXN A;  5D8K B;  3DFG A;  2J5P A;  1KGS A;  2HDC A;  1P2F A;  3I71 A;  1ZGJ A;  1V4R A;  2XKP A;  5AIQ A;  1Z6T A;  1JGS A;  2DPU A;  4Y13 A;  2HYG D;  1FWZ A;  3DP7 A;  4A5M A;  4YG2 F;  3BJ6 A;  5LHI A;  1R58 A;  3E6B A;  4G7O F;  5BPI A;  5J8F A;  1MJB A;  3ZMZ A;  2PMU A;  2XVC A;  4HV6 A;  1ZRF A;  2GWR A;  3RYR A;  1J7K A;  4PGG A;  2H6C A;  2YU3 A;  1U78 A;  2QBY B;  4RB0 A;  2GA2 A;  4MTE A;  1W4M A;  1YW7 A;  3CJN A;  1J0R A;  3EQL F;  2EJR A;  2F5C A;  1A04 A;  3JAM K;  1DUX C;  1B9N A;  1QZY A;  5CVJ A;  2HR3 A;  4HYE A;  3KP6 A;  4ZYD A;  4R8H A;  1T2K A;  3EUH A;  3K1M A;  2XAS A;  3JAM Z;  4Q5S F;  3H3Z A;  1O3S A;  2O6G E;  4CO8 A;  2VBW A;  2OD5 A;  5ICG A;  4HBL A;  2V1U A;  3ABT A;  3LAJ A;  2E7X A;  3Q5F A;  3NQO A;  4JBA A;  4YFN F;  1G3T A;  1MJ9 A;  2NAZ A;  3WTY C;  1QGP A;  1G3S A;  2EK5 A;  2RDP A;  2EFN A;  4B8X A;  1TNT A;  1R36 A;  3HOT A;  1J75 A;  3DV8 A;  5FFZ A;  1C0W A;  5HS7 A;  3F8N A;  4LG0 A;  3I58 A;  3CUO A;  2AXL A;  2JTV A;  5L3C A;  3RJP A;  2ESH A;  2HYF A;  2ZME B;  1TBX A;  1T38 A;  4JQF A;  5FO5 A;  3ZMD A;  4RB3 C;  4UVC A;  1H9G A;  2YPR A;  2VC0 A;  2QQ9 A;  1W5S A;  4XLP F;  4HLY A;  3P9K A;  1QPM A;  3T0Y A;  5D4S A;  4RB2 C;  2A6H F;  4HLX A;  2LF8 A;  2Z99 A;  2ELH A;  4NB5 A;  2FE3 A;  3LA3 A;  3CUQ B;  1STZ A;  3GEZ A;  1O3R A;  3HIF A;  1Z05 A;  4U7B A;  1PP8 F;  2GAU A;  1DDN A;  1S7A A;  5EEG A;  4ENM A;  3TO6 A;  4AVP A;  1YLF A;  4YFK F;  3J81 K;  2KRF A;  1IXR C;  4IPA A;  2DPD A;  3ZPL A;  3M1E A;  3HTS B;  1EH6 A;  4WXH A;  3PFI A;  3HSF A;  5D5X B;  2FBI A;  5E1X A;  5L3G A;  1O3Q A;  4MQ9 F;  1FP1 D;  5E8G A;  2XGX A;  2V9V A;  2ZXJ A;  4GXO A;  4UV8 A;  3ZMV A;  4LK1 F;  4P9F A;  2Z33 A;  2P8T A;  2K7L A;  3KLN A;  3C7J A;  3MQ0 A;  5BS6 A;  3K1P A;  3E6C C;  1KA8 A;  1U5T C;  1B9M A;  1DP7 P;  2IT0 A;  2NS0 A;  4HZF A;  3DQV C;  2P6T A;  3HSR A;  3VOE A;  3GFL A;  2BBY A;  4I02 A;  2CYY A;  1R1T A;  1MJA A;  2XV4 S;  4HDV A;  4GCV A;  3BJA A;  4ZYG A;  1MKM A;  3EYI A;  1ULY A;  3V8J A;  5LHG A;  4WWC A;  2M1B A;  2K86 A;  4O3M A;  3WTV C;  4IVN A;  1U5T A;  3U9G A;  5DCM A;  2Y0M A;  4KIF A;  1TNS A;  2LF7 A;  1TW2 A;  3N97 A;  2RQP A;  1D8J A;  3IKT A;  1SD5 A;  1HKS A;  4Y15 A;  4M9X A;  1HST A;  3F8C A;  3ELK A;  1RNL A;  3TDU C;  1BC7 C;  3VEP A;  5HDK A;  2HOE A;  4LLL A;  1W7P A;  5LBQ A;  1G6N A;  1IN5 A;  1CF7 B;  2CGP A;  2A61 A;  3F6V A;  2VT2 A;  3RIR A;  3E97 A;  3GYH X;  3U2R A;  1MGT A;  2VBY A;  4HAM A;  1LJ9 A;  2QWW A;  1UFM A;  2Z3Y A;  3MEX A;  1SFE A;  1ON1 A;  1LEA A;  1HSJ A;  2YR2 A;  2GZW A;  4OIP F;  5DUK A;  1I6X A;  1I1S A;  3O2P E;  1JE8 A;  3OOP A;  2QLZ A;  1W7P D;  1XDU A;  5E17 F;  1BIB A;  2ZO4 A;  2RGV A;  1ZGA A;  2W25 A;  4CXF A;  4U0Y A;  2ISZ A;  4BNC A;  1QO0 D;  2HQR A;  5LLQ A;  5D4R A;  4A6D A;  3HRS A;  4LB6 B;  1TLH B;  2ZFW A;  1XGO A;  5K5Q A;  3M7G A;  4WXD A;  1SFX A;  2F2E A;  3COA C;  1Z1D A;  1FLI A;  3H92 A;  3ZN1 A;  5IT9 K;  5BOX A;  1G3W A;  1AWC A;  1KQ8 A;  5FLX K;  1K78 A;  5KK1 A;  3MZY A;  4OOI A;  1ZG3 A;  5LEJ A;  3KEO A;  5L3D A;  5D6E A;  3G3Z A;  5FLX Z;  4MNU A;  4O5V A;  2QZ8 A;  5D5U B;  1H0M A;  1IF1 A;  4EM0 B;  3W6J B;  4FT8 A;  1SFU A;  1Z7U A;  2O03 A;  2QUF A;  3QP6 A;  2Z5U A;  2WWY A;  2MBF A;  1OYY A;  4RGS A;  2GA1 A;  2FA5 A;  1LDD A;  1F1Z A;  1SD6 A;  3F3X A;  1JHH A;  1D5V A;  2M30 A;  5A2Q K;  2IP2 A;  4OIN F;  2F5E A;  2EA2 A;  1J9I A;  4G7H F;  1BN5 A;  2QVO A;  4KN7 X;  3KP5 A;  2P5V A;  1LVA A;  1YTY A;  3ABU A;  1YS7 A;  1D3Y A;  3TOB A;  4AIJ A;  4KIC A;  4HV5 A;  2J5O A;  4ZYH A;  4ENN A;  3WE2 A;  3CUQ C;  2UZK A;  3MZH A;  2HTS A;  3V8K A;  2Y75 A;  2M5W A;  5L3B A;  1SAX A;  3BJO A;  1P92 A;  4UV9 A;  1FNN A;  1RI7 A;  4RAY A;  5L3E A;  2O8X A;  1FSE A;  4MTD A;  2JT1 A;  4HX7 A;  1UCR A;  3DPT A;  2IJL A;  3O6B B;  2QYO A;  2XAQ A;  3ZMT A;  2EA4 A;  1YIO A;  2MC3 A;  4WCG A;  1SMT A;  2DO7 A;  1TQP A;  1BI0 A;  3HHH A;  2H09 A;  1FSH A;  4EGZ A;  4CHU A;  5LHH A;  3J7A O;  2A6E F;  4DNC A;  1S29 A;  3BZ6 A;  2VBX A;  1QZZ A;  2IA1 A;  3B02 A;  3L9F A;  4L9V A;  4RS8 A;  4O6J A;  3QAH A;  4N9I A;  1P4W A;  5E1Z B;  5BQT A;  1XD7 A;  2EFP A;  2HGC A;  2VBZ A;  4ETS A;  4EJO A;  2IVM A;  5IT3 A;  3LAP A;  5DV5 A;  3F8B A;  5HDN A;  2LDU A;  4P5O A;  2MH2 A;  3KZY A;  1YFH A;  2MH9 A;  1XMK A;  2FRH A;  1BBY A;  2NNY A;  2D1H A;  2L4A A;  2HQN A;  2ESN A;  4OMZ A;  3IWZ A;  4PGH A;  1XSV A;  4HX8 A;  4LLG F;  4KFC A;  2VE8 A;  1MD0 A;  2BV6 A;  1T6S A;  2NYX A;  3GZ6 A;  2M87 A;  4N0B A;  3V4G A;  4HF1 A;  1WQ2 A;  1G4D A;  5LRS A;  2D2W A;  2PFB A;  2EWN A;  5J6X A;  3P9C A;  1BI3 A;  2VC1 A;  1XDS A;  2H6B A;  4EQQ A;  2CO5 A;  3K1N A;  2OAZ A;  4U7D A;  2H27 A;  1ZYR F;  1OPC A;  2W85 A;  4L0Z B;  2D45 A;  2P5L C;  4YIF A;  2MLK A;  4Y17 A;  2STT A;  1BC8 C;  2DLL A;  4ESJ A;  4IHT A;  3VOD A;  2KIM A;  1MDM A;  3E6M A;  3R60 A;  4P55 A;  2DAO A;  2P5K A;  2VN2 A;  3KLO A;  1YW9 A;  3P7N A;  4F7Z A;  5LEK A;  1P6R A;  2V79 A;  5AIP A;  3FMS A;  2FXA A;  2OQR A;  1HXD A;  1KU3 A;  1J5Y A;  4Q47 A;  1FYM A;  1YQA A;  1F9N A;  2ISY A;  5J8C A;  3LQQ A;  1U3E M;  1KQ0 A;  3WGI A;  2EFW A;  3RKY A;  4LJZ F;  3N4M A;  5TJJ A;  3EYY A;  4A5N A;  3RYP A;  3ISP A;  3OV8 A;  2UWM A;  2QM3 A;  3LST A;  3F8F A;  4A12 A;  3LQR A;  3IC7 A;  3J80 Z;  4XLN F;  3GVA A;  2AS5 F;  1FT9 A;  2IW5 A;  3WU1 B;  2NNN A;  1FBS A;  2KJC A;  3DKW A;  3AAF A;  4EGY A;  2E7W A;  4HQM A;  2PLY A;  2ZNZ A;  1UHM A;  3DEU A;  2JSC A;  4EVI A;  5CVV A;  2P4W A;  5CYV A;  4KA4 A;  4KIB A;  2WC2 A;  5ERI A;  3WTU C;  1OYI A;  4HA8 A;  2MD5 A;  5DCF A;  3WTT C;  3IRQ A;  4EV0 A;  2JZY A;  4TV7 A;  4UUV A;  2M8E A;  3F22 A;  1SMY F;  3GF2 A;  6PAX A;  3ZMU A;  4E70 A;  4AIK A;  3RI4 A;  1XGS A;  2ADU A;  3GFJ A;  1SD4 A;  4A2U A;  5ICE A;  2CW0 F;  3RKX A;  1ZH5 A;  3E5Q A;  1XCB A;  2DT5 A;  1O7F A;  1WRJ A;  3MCZ A;  3E5X A;  1HQC A;  2PMH A;  5H6Q A;  4WK8 F;  3TQN A;  4YFX F;  3I59 B;  1YG2 A;  3REO A;  3GUD A;  1P4X A;  3KP2 A;  2R3S A;  4U88 A;  3HSE A;  5ED4 A;  4AWX B;  1R1V A;  4AD9 A;  5FB2 A;  5HDG A;  3RDI A;  1U6G A;  3WU0 A;  3ZN0 A;  3ZP5 A;  2VOP A;  3SZT A;  2O0Y A;  4CZZ A;  4A0Y A;  5DD4 A;  4AIH A;  4G6D A;  1SD7 A;  2BE5 F;  2XAH A;  4ENJ A;  2E1N A;  4RGX A;  3RTR A;  2A07 F;  4DQ2 A;  1ODD A;  4M73 A;  3GX4 X;  3LA7 A;  3ULQ B;  2L4M A;  1FYL A;  2G9W A;  1J2X A;  4M74 A;  3GWZ A;  2IA0 A;  1FOK A;  1BI1 A;  5DD8 A;  3MFK A;  4IJA A;  1KQ9 A;  1WKM A;  2OA4 A;  3IRR A;  2W84 A;  1XGM A;  2NRA C;  1HW1 A;  4ASN A;  1R5H A;  3L7W A;  3SHF A;  3R0A A;  2XRN A;  1GHC A;  5FGM A;  5FFX A;  4ENK A;  3Q9V A;  2RNJ A;  4S05 A;  4I0A A;  1OYW A;  5TRD A;  4A6E A;  3FMR A;  2FBH A;  4UVB A;  1ZAO A;  1YO5 C;  5K5R A;  4JK1 X;  1ZG5 A;  2F5D A;  4P96 A;  1P4A A;  3HYI A;  3K0L A;  4XBF A;  1IRG A;  3F23 A;  2QBY A;  2TDX A;  1ZAR A;  5LRR A;  2IRF G;  3RPU A;  3SXY A;  3TGN A;  3KET A;  3QPT A;  1KU2 A;  3F21 A;  4XRF A;  5CVI A;  2WTE A;  4RB1 A;  1O7L A;  4U0V A;  2Y48 A;  2VE9 A;  1OKR A;  3KCC A;  2L02 A;  2ZKZ A;  2V6C A;  3ERE D;  1RIO H;  2PQ8 A;  3T8R A;  3TDZ C;  2DU9 A;  3CO7 C;  3FMQ A;  4K2E A;  4G6Q A;  4HOB A;  4KT5 C;  3BY6 A;  2XRO A;  2KJB A;  1FX7 A;  4ON0 A;  3K2Z A;  4ESB A;  1OR7 A;  1YS6 A;  2LNB A;  5D6F A;  4GYI A;  4QWQ A;  4A0Z A;  4EM1 A;  2CFX A;  3L2C A;  2HS5 A;  4KMU X;  5L3F A;  4I09 A;  1FYK A;  2EV0 A;  2XIG A;  1JXS A;  3GW2 A;  1GXQ A;  1S7O A;  4LGW A;  2DK5 A;  1FPQ A;  2ZME A;  3R0J A;  3HHG A;  3ML6 A;  4FX4 A;  4OU0 A;  1REP C;  4LG0 B;  4I98 B;  4KYW A;  4OMY A;  2V1D A;  4HW0 A;  4OIR F;  2ZCW A;  2F5F A;  3I5U A;  3QOP A;  4IRH A;  3EDP A;  3FX3 A;  4CIC A;  3FXQ A;  4PCQ A;  2HTJ A;  5ILV A;  4A0X A;  1BI2 A;  2YSR A;  1R7J A;  3ZMS A;  4M6X A;  4L5I A;  1IW7 F;  1ZLJ A;  1EH7 A;  2RC4 A;  2XHK A;  2K02 A;  5BPD A;  3WTW C;  3F6O A;  3CUQ A;  5CVR A;  1XMA A;  2FOK A; 
#chains in the Genus database with same CATH topology
 1VQO I;  1GDT A;  1UMQ A;  3BZC A;  1F36 A;  3ZQH A;  1UHW A;  4RGU A;  3TO9 A;  1VND A;  2L01 A;  4ZZL A;  4G9Y A;  1WJF A;  1RET A;  3A4C A;  2VI6 A;  2FMY A;  3GCM A;  4OWR B;  1BW5 A;  1MND A;  2AHQ A;  2BW3 A;  5DYM A;  2LBF B;  2MC4 A;  3QU6 A;  3PQJ A;  5CKT A;  2E1M B;  3H9Q A;  1DU0 A;  5JI6 A;  4GYG A;  3GFI A;  1GVD A;  2NVT J;  2GM4 A;  3BZK A;  1FBQ A;  4CYC A;  2CQX A;  4E7K A;  1ZRC A;  1U2W A;  1M1E B;  3HKZ N;  3E3V A;  3SJM A;  3L2R A;  2CQ7 A;  2P7C B;  5E1W A;  1NTC A;  2HZT A;  4WX9 A;  1VQK I;  1PDN C;  1TTY A;  3JTH A;  3TED A;  1XSX A;  3S1N J;  2X51 A;  2YX7 A;  2K27 A;  4FAS D;  3K7A J;  3HUG B;  4UUS A;  3HOS A;  1OMI A;  2XUB A;  3GTK J;  1QQI A;  3DXJ F;  3CDH A;  1S9H A;  2WBM A;  1U8R A;  4EJT A;  2VIX A;  5JR3 A;  5CQG A;  1E17 A;  3C18 A;  1KU7 A;  2GXG A;  3FHN A;  3O8G A;  2KIF A;  1N25 A;  2LY1 A;  3FKI J;  4XOT A;  3NRV A;  2HQ5 A;  5E20 A;  3S16 J;  3GO5 A;  1I5Z A;  4LFU A;  5KHD A;  1FMW A;  1B4A A;  2XGE A;  1EH8 A;  2Y2Z A;  2XPV A;  3KEQ A;  2DN0 A;  4G8X A;  3G4S I;  1CQT A;  3SZP A;  4ZH4 F;  4A3M J;  4B09 A;  1OJL A;  1IZ1 A;  2CS3 A;  3M8E A;  4OAY A;  3NEU A;  3DTI A;  4XKW A;  4RM2 A;  2FNP A;  1MMD A;  5GP9 A;  5M3F J;  3G2B A;  4XM3 A;  1VQL I;  4IHX A;  4BDY A;  3ASN H;  1YX3 A;  1E3P A;  2DJN A;  2R7Z J;  1YW8 A;  3OY9 A;  1HBX G;  2FNA A;  4IXA A;  4D7M A;  3CMM A;  4DGW B;  5C3E J;  3S17 J;  2RVC A;  2K4B A;  3OSF A;  2JJ7 A;  1JJ8 C;  3WGH A;  1ZHF A;  2COM A;  1U5T B;  2Y0S N;  1YRN B;  5IPA A;  2EH3 A;  3HZJ A;  2P6S A;  1YX5 A;  1LUJ B;  3CJR B;  4A3E J;  5DCM B;  4XSZ F;  1R5G A;  2LFB A;  2RN7 A;  1DPU A;  3BLY A;  1JT0 A;  2FQ4 A;  1PP7 U;  3FWE A;  1K6O A;  1K7A A;  1GVJ A;  3CDL A;  1EV7 A;  3P9I A;  2Z9O A;  1Y0U A;  1G3Y A;  4A3J J;  1B8I A;  4M6Y A;  2H1K A;  2BVM A;  4KDP A;  4BXU A;  3CCR I;  4YEJ A;  2WV1 A;  2RQQ A;  1K79 A;  2JPB A;  2IS2 A;  1L0O C;  1CF7 A;  1VZ0 A;  2PJP A;  4LMY A;  4IF4 A;  5GTI C;  4E7S A;  1Z6R A;  4FET A;  3OYD A;  5J1Y A;  3CES A;  4ZYE A;  3TP0 A;  2MFZ A;  4BS9 A;  2O8K A;  2KKO A;  2L2O A;  1SEU A;  1MMA A;  1IUY A;  2EZL A;  4IO9 F;  4OIQ F;  5EEH A;  5B3S H;  4F93 B;  3OYF A;  4HNU A;  3WTS C;  4Q4Z F;  1YI2 I;  1ZLK A;  1EKE A;  2JPC A;  1W7P B;  3ABL H;  4FQG A;  5HS8 A;  1IN4 A;  3R61 A;  3HL2 A;  1VTN C;  2EFO A;  2PG4 A;  2M7B A;  1ON2 A;  4UNO A;  3MKZ A;  3SEZ A;  1I27 A;  3F72 A;  1HKT A;  1D8K A;  3DKX A;  3KPH A;  3ZQF A;  1A35 A;  1LNW A;  2ZNY A;  2HEO A;  4KMF A;  4X6A J;  1FMV A;  1B6A A;  2A5Y B;  3R6S A;  2P0W A;  1Q1H A;  2JQ7 A;  5F1R A;  2CQN A;  3A0H C;  2CUJ A;  2IA2 A;  2OBP A;  3KYL A;  2JRM A;  1SFK A;  3FM3 A;  3BTC A;  1ETO A;  1B59 A;  1SC7 A;  1RUN A;  2QSG X;  3OMY A;  2ZJQ F;  4C2M J;  1X3W B;  5J1R A;  2VJ4 A;  1XSD A;  4XN0 A;  3I4N J;  5HNF A;  1QBJ A;  4BXX J;  2VON A;  3QYF A;  1OCT C;  3CLQ A;  1N77 A;  2QGU A;  1AOY A;  3D1N I;  2GOX B;  3KYD B;  3BP8 A;  3QOE A;  5GAE J;  3RPQ A;  4L9T A;  1ACI A;  4A3D J;  4BAY A;  3FXR A;  1IRZ A;  3CDI A;  4NQW A;  3HRT A;  4NC7 A;  2UV1 A;  2G7H A;  2PJR A;  2Q0O A;  1Z3Y A;  3EUH C;  1HW2 A;  2QEN A;  3GBG A;  1MZB A;  2DQL A;  4BEH B;  2B0L A;  4I01 A;  2CFO A;  2DTR A;  5K5O A;  1HF0 A;  3BRO A;  3HOU J;  3J80 K;  2K9M A;  3JSO A;  3U1D A;  4L18 B;  3KP7 A;  2OZ6 A;  4M9Z A;  1R22 A;  2DW4 A;  2MLG A;  2W57 A;  1ETK A;  3L2W A;  3A2K A;  3DBR B;  3L00 A;  5HS9 A;  4B1R A;  1FP2 A;  3T5X A;  3K69 A;  4IRI A;  1K78 B;  4QTR A;  4ZDL A;  4WF2 A;  3FIS A;  1UG2 A;  2E36 A;  5C44 J;  5H2F C;  3IL2 A;  3HRU A;  2EFQ A;  3HRM A;  5ILS A;  4IX7 A;  4HRI A;  2O9L A;  4LB5 A;  3GFM A;  2DK8 A;  2FSW A;  3OYA A;  4PSX A;  4PZJ A;  3TO7 A;  3DBH B;  3FF5 A;  4UHT A;  3WG7 H;  1U9O A;  5IYC J;  2GIV A;  4Y52 J;  1U0J A;  2K4J A;  5M5X J;  5J1U A;  3GLX A;  3I4P A;  5JLW A;  2XDV A;  1JUS A;  2ZJR F;  4V2F A;  2KDZ A;  3BG9 A;  3RKW A;  3ECO A;  1ZN2 A;  3HEF A;  1ZEL A;  2L3D A;  2M7A A;  3OS1 A;  3QPS A;  4XLC A;  2O61 A;  3IWF A;  1UHS A;  1XGN A;  1TQI A;  1AA7 A;  1WJE A;  2STW A;  3FM5 A;  1JT6 A;  2EQR A;  2RKH A;  3TKY A;  4M3G A;  2XAG A;  4E7J A;  3BR0 A;  2DA1 A;  4Q48 A;  3J7A Y;  5DM6 F;  2PBI A;  3CJT B;  2KLO A;  4N9H A;  2V9K A;  3CCU I;  1WWX A;  1SAU A;  4XR6 A;  5JLX A;  3E0J B;  2Q8K A;  2GXB A;  2VT3 A;  4D7N A;  3GTQ J;  1FIP A;  2ZXI A;  1BR1 A;  3KIO A;  3O3K A;  4WXC A;  3WTX C;  1LDK B;  1RKT A;  2R7T A;  3CC2 I;  1D0X A;  5CVU A;  2R7O A;  5D5V B;  4XL9 A;  3D0S A;  4BYY A;  1HW5 A;  2DYR H;  2JK3 A;  3SZG A;  1I50 J;  1B72 A;  3M8J A;  1NK3 P;  3R4K A;  2MGQ A;  5AON A;  3CF2 A;  3GZ5 A;  2LKS A;  3WHB A;  4J19 A;  1WGX A;  1MNE A;  1FTT A;  2KIU A;  4R1H A;  5E8I A;  3FHZ A;  5M5Y J;  1JJ6 C;  5E3O A;  3QYB A;  3WG9 A;  3PIP F;  2R7W A;  4UXN A;  3VYR B;  1K4T A;  1LEB A;  3A01 A;  2W48 A;  3Q0W A;  3L09 A;  2FU4 A;  2F6C A;  2QQA A;  1X1D A;  2R92 J;  1AU7 A;  3CO6 C;  2JRT A;  1TT0 A;  4E4H A;  3JRA A;  2M34 A;  3FZV A;  2HYJ A;  4EJV A;  1DGR M;  1TWH J;  1IV8 A;  1XCV A;  3HGY A;  3QP5 A;  2FQ3 A;  4Z2Y A;  4FCY A;  5HLG A;  2BY2 A;  1HKQ A;  1YIJ I;  1FBU A;  1IN6 A;  1Z9C A;  2WAQ N;  3BOQ A;  4G7Z F;  1DPR A;  2DMQ A;  2P7V B;  4M9S A;  3G1O A;  4HNV A;  4S04 A;  2LRE A;  2JA8 J;  2M0C A;  2XKO A;  4KN4 X;  1MMG A;  1RZ4 A;  3N05 A;  4E7I A;  3BT9 A;  4RAZ A;  4XSX F;  4IQJ A;  5ICC A;  3U21 A;  3H5R A;  1GV5 A;  2Q2E A;  3HUG A;  4LIV A;  1R1U A;  3S2W A;  3J81 Z;  2NVX J;  4P1W A;  3MKW B;  4IHS A;  1OCR H;  1ONV A;  4HF2 A;  1VFC A;  4ESF A;  2ETH A;  2LSO A;  1ETY A;  1ZG1 A;  5K1Y A;  1PUE E;  2DMN A;  2CWE A;  1GUU A;  3I64 A;  3LSP A;  4BQA A;  2D1V A;  1SVO A;  2MAB A;  2K85 A;  2NS7 A;  3H9G A;  3VFZ A;  1BJA A;  3QPL A;  1GV2 A;  3T1B A;  4U0W A;  3SFZ A;  2E60 A;  3BG7 A;  4EM2 A;  2O5R A;  1OFC X;  4XLF A;  2EZI A;  1KU9 A;  3SQN A;  2XF5 A;  2BGC A;  5EG0 B;  2MG4 A;  2ID3 A;  3V8L A;  1PYV A;  1ETV A;  3DEE A;  5EGO B;  1FEX A;  4LK0 F;  1T39 A;  1VQ5 I;  2MA3 A;  3KP3 A;  2E2I J;  2A3S A;  2X0L A;  2HVS A;  4ZDO A;  5IOZ A;  1WI9 A;  3I53 A;  2HKO A;  1MH4 A;  1IN8 A;  1HDP A;  1I1G A;  3FXO A;  1T98 A;  2JVH A;  4HF0 A;  3CMA I;  2OU2 A;  1UJ8 A;  4L0Y B;  3ZQQ A;  1BR4 A;  4L9J A;  1QHG A;  1O3T A;  3GTO J;  3ECH A;  1J59 A;  1W5T A;  1KYZ A;  2R4G A;  3CQZ J;  2F4M B;  2L54 A;  2XC7 A;  4OIO F;  2DBB A;  1RUO A;  2DTZ A;  5HOO A;  1TWC J;  5FD5 A;  3ABK H;  2DI3 A;  2Q1Z B;  5EEA A;  1Y1V J;  2AO9 A;  4M71 A;  1QVT A;  1W36 C;  1BOB A;  5FJ8 J;  5CQE A;  3HKZ A;  3V7S A;  1YYV A;  5HLI A;  4KNY A;  2HVQ A;  4CCO A;  3CF5 F;  2WY8 Q;  3QPH A;  1QA6 A;  3SEQ A;  3FXK A;  4CYD A;  3KP4 A;  3K4K A;  4AUX A;  4EJW A;  2CQK A;  4W97 A;  3RZO J;  4MEX F;  3BG5 A;  3BTI A;  1K83 J;  2BYV E;  3HTU A;  3S2H J;  2G7U A;  4GRI A;  3TMO A;  4YIR X;  2JA7 J;  1MMS A;  3F0C A;  1I39 A;  5D5W B;  1IRF A;  1WHU A;  4EMS A;  1R00 A;  2BY3 A;  3K4J A;  3I56 I;  3LFK A;  1K6Y A;  1WJB A;  3IKV A;  2JMW A;  1TQM A;  3HG9 A;  2DXI A;  3H3U A;  4V19 K;  3WOD F;  3DTK A;  4D0P A;  2VXZ A;  1QNT A;  4L5J A;  5J4V A;  1P7I A;  1D1A A;  3VYT B;  4RAG A;  2WV0 A;  2QEX I;  2K9S A;  3SDG A;  3W2A A;  5GPA A;  1NHA A;  4DZP A;  3AL0 B;  1W36 D;  4ZYA A;  4MHG A;  3HPG A;  1FZP B;  4CDG A;  4YRV A;  4A3B J;  5DUI A;  4QLC U;  3HOW J;  1ETW A;  4XRM A;  2FML A;  2CJJ A;  4DIQ A;  5HLH A;  1BIA A;  4ZZD A;  1A6Q A;  1RC9 A;  3RSN A;  3V7C A;  1H89 C;  4KUM A;  1ZQ3 P;  4G94 A;  2FD5 A;  2H8R A;  2EPF A;  3VSK A;  3BWG A;  3I54 A;  3WE3 A;  3MN2 A;  2M2E A;  1UST A;  5JHU A;  3KZI C;  2IPQ X;  1LB2 A;  3LSR A;  2XAJ A;  1S3J A;  5F04 A;  5F6F A;  2F4O B;  1ZRD A;  5FKO A;  3AG4 H;  4XNF A;  4CH7 A;  2CUZ A;  4B43 A;  1SAN A;  2Y0S A;  3DF8 A;  4BH9 A;  4BE0 A;  4PJL A;  3G1M A;  1WJC A;  1T0F C;  4YEL A;  1GT0 C;  3M9A A;  4MGR A;  2M3A A;  2GQQ A;  5HVQ C;  3HBL A;  2R93 J;  1MDM B;  9ANT A;  2HKX A;  1GXP A;  5F27 A;  2CG4 A;  3DU5 A;  1JHF A;  1S8N A;  4XRS A;  2KZV A;  1T0F A;  5H6R A;  3ASO H;  4LLN A;  5ICF A;  1OCZ H;  4HPQ A;  3JRG A;  1FC3 A;  3MWM A;  2CSO A;  5DDG A;  4BBR J;  4HQE A;  3A02 A;  3OL3 A;  5FD6 A;  3IAS 2;  1S6L A;  4IQ4 A;  3PQK A;  2V9P A;  4AID A;  2RNG A;  5IT9 Z;  3C3W A;  2QKL B;  2CRG A;  1QZE A;  5F64 A;  2QCO A;  3DPL C;  2V1X A;  2E1C A;  3WGG A;  3H5A A;  4QIW N;  3BPX A;  2IEK A;  5K7Z A;  4CCK A;  4GDF A;  4LIT A;  5D8L B;  3BTJ A;  1OLT A;  2FEZ A;  4C3H J;  3S3M A;  4ITV A;  3JCU C;  2DDB A;  4A3C J;  2LKP A;  4C9Y A;  1TW3 A;  1USS A;  2X4H A;  2DT7 B;  4JP0 A;  4H0E A;  4D9J A;  2TRT A;  3U1K A;  2Z2S B;  1L3L A;  4A69 C;  3OIP A;  1D0Z A;  2ID6 A;  3IHU A;  2GOM A;  3ZQ7 A;  3FK7 A;  3A1Y A;  5CLS A;  5JFR A;  1R49 A;  2PI0 A;  4FE7 A;  1F5T A;  4Y4R A;  1BM9 A;  1Z91 A;  3EET A;  5JVT A;  2O3F A;  1B1B A;  4L9N A;  4YII A;  5H20 A;  3VB2 A;  4FHT A;  2W7N A;  3JSP A;  3FDY A;  3HOZ J;  1IN7 A;  2ZJ2 A;  3IH2 A;  3BPV A;  5LGU A;  2VKV A;  2BHY A;  3O8H A;  3G73 A;  4PK4 A;  5KVR A;  1XG1 A;  2OQG A;  2OPT A;  1WI3 A;  4I2O A;  3CZ6 A;  5CJ9 A;  4MQV A;  5B1A H;  3DEW A;  4B47 A;  3GLL A;  4AVZ A;  3T8T A;  3HC7 A;  3ROU A;  5A2Q Z;  2C6Y A;  1XB4 A;  3S93 A;  3CTA A;  2VOO A;  3W6K B;  1MSF C;  2XPW A;  2DOF A;  3G71 I;  5BMZ A;  2PN6 A;  3IV5 A;  2HFH A;  3ABM H;  3EUK L;  4M72 A;  3BDD A;  3KYC B;  3LSI A;  5BNG A;  2M45 A;  3LWF A;  2ACJ A;  1LQ1 A;  3QOD A;  2R7F A;  1ZK8 A;  4NDL A;  2I10 A;  4M3B A;  3CLO A;  3ZR8 X;  2KMU A;  4CSW A;  3JW4 A;  1QVU A;  3I0T A;  3M8F A;  2EV5 A;  2GBY A;  2HOA A;  1HOM A;  2EIM H;  4UVA A;  3TP3 A;  3JRI A;  4IRG A;  3QRF F;  3GZN B;  2VAS A;  4DW6 A;  1IXC A;  2IBD A;  3CMY A;  3F8M A;  1X3U A;  1V5E A;  1Z77 A;  1QU3 A;  1P7J A;  3WTZ A;  3B73 A;  4IHV A;  3K9T A;  3OYC A;  2HZD A;  3CP8 A;  3I59 A;  3GXO A;  1H9T A;  3JTG A;  3VPR A;  3QU3 A;  2A69 F;  3HOY J;  3ESW B;  2EIL H;  1R23 A;  1WFX A;  2A68 F;  5E18 F;  2JSP A;  4QPO A;  3E5U A;  1WSU A;  2HNH A;  2EV6 A;  4ZDP A;  1WH5 A;  2QQB A;  2XF6 A;  2OZU A;  1BOA A;  1TWA J;  2PEX A;  1FJL A;  4RGR A;  2VJJ A;  2W24 A;  3LA2 A;  2UXX A;  3TOA A;  1V3F A;  4RM3 A;  3CC7 I;  1IAW A;  1E2X A;  1KYW A;  4MIM A;  2BEO A;  5GAG J;  1ITY A;  5ILU A;  1ZRE A;  3Q9S A;  4BJ6 C;  3BQY A;  3CJQ B;  4ZTF A;  1VQ9 I;  4KIG A;  1O57 A;  2QSF X;  4PDK A;  1YHQ I;  1MBJ A;  5LD2 C;  2L9V A;  2R7D A;  2DMU A;  2HOS A;  4XKB A;  3HB9 A;  3KZZ A;  3KE2 A;  5LGN A;  3G1L A;  4JOM A;  4C30 A;  2DOE A;  1P9Q C;  4NHJ A;  2XAF A;  3MAJ A;  3OYI A;  5LGT A;  4HX4 A;  2DQR A;  1V5G A;  4HDU A;  5DEQ A;  4BHP A;  4NC8 A;  4NUB A;  2WB1 N;  1XMX A;  2YX4 A;  4XLH A;  4BHC A;  3KFW X;  2DMP A;  3FXU A;  3C1D A;  2EB7 A;  2X6W A;  3A0B C;  4LD5 A;  2R5Y A;  3L2U A;  2HOT A;  2HWV A;  1FY7 A;  1WJD A;  3H9J A;  4CGZ A;  1Y56 A;  4MO7 A;  3M1C A;  3V7R A;  2BY0 A;  2AXT C;  2M4K A;  1LDJ A;  3OIQ A;  4MEY F;  3WU2 C;  2RV8 A;  4EJU A;  1F4K A;  2IAI A;  1TT5 B;  3ONQ A;  1Z7L A;  2OCE A;  4GO1 A;  1XN7 A;  4I7H A;  2H94 A;  2FF4 A;  1Q1V A;  2R5Z B;  4DJA A;  4R79 A;  1D5Y A;  2ZBK A;  2WAQ A;  1Y1W J;  2VOD A;  3E7L A;  2DFI A;  3E6D A;  1CGP A;  4P9U A;  3NWS A;  3D5S C;  2FBK A;  4BHB A;  1UB9 A;  3B6C A;  3DLL F;  4GGG A;  5FKN A;  4JX4 A;  4FX0 A;  1IXS B;  4HEA 2;  1X2N A;  1Y0N A;  1WJA A;  2K3P A;  4I0B A;  3D5L A;  1A31 A;  2UXN A;  1E0E A;  5D8K B;  2CU7 A;  3DFG A;  2LP0 A;  2J5P A;  1KGS A;  1MIJ A;  4F91 B;  2HDC A;  1P2F A;  1TZL A;  3I71 A;  2K3F A;  1ZGJ A;  1V4R A;  2XKP A;  4BU2 A;  3EUA A;  5AIQ A;  2KHM A;  1Z6T A;  1JGS A;  2DPU A;  4DYR A;  3PO3 J;  1LE8 A;  4Y13 A;  4XOR A;  2HYG D;  2N8G A;  1FWZ A;  1JKR C;  3DP7 A;  4A5M A;  1DQU A;  3FXL A;  2CW8 A;  3S14 J;  1T56 A;  4XK4 A;  4YG2 F;  2DA3 A;  2I8D A;  2KQR A;  2V1N A;  3BJ6 A;  2LOO A;  5LHI A;  1R58 A;  2B7E A;  3E6B A;  4G7O F;  4BDZ A;  2BHZ A;  5BPI A;  3X2Q H;  5J8F A;  1MJB A;  1UEL B;  3ZMZ A;  2PMU A;  2XVC A;  3BTL A;  4HV6 A;  2XF7 A;  5HLT A;  1ZRF A;  2GWR A;  3Q0V A;  3HDD A;  3RYR A;  2HI3 A;  1J7K A;  4PGG A;  4II2 A;  2H6C A;  2FJ1 A;  2YU3 A;  3W2W A;  4KJZ A;  3C2H A;  2GXA A;  1U78 A;  2QBY B;  1MBF A;  3BR6 A;  4RB0 A;  2GA2 A;  1V54 H;  4MTE A;  1W4M A;  1YW7 A;  1MMN A;  4CCM A;  3CJN A;  3VDX A;  4XKC A;  3PSI A;  1J0R A;  4FE4 A;  3EQL F;  2EJR A;  1A6I A;  2F5C A;  1A04 A;  3ZRG A;  3JAM K;  1DUX C;  1B9N A;  3M4O J;  1QZY A;  1IC8 A;  5CVJ A;  1LKX A;  1RPW A;  2HR3 A;  4HYE A;  2KL4 A;  2CW7 A;  3KP6 A;  4ZYD A;  1Z0X A;  1HDD C;  2V7F A;  4R8H A;  1T2K A;  3EUH A;  1FOX A;  4F52 A;  3K1M A;  2XAS A;  3MKL A;  3JAM Z;  4Q5S F;  3H3Z A;  3JRC A;  1O3S A;  1D0Y A;  2O6G E;  3GME A;  2YUS A;  4CO8 A;  2VBW A;  1XPX A;  5IP7 J;  2OD5 A;  5ICG A;  4HBL A;  3C2G A;  5IOY A;  2V1U A;  3ABT A;  3LAJ A;  2E7X A;  3Q5F A;  4D1Q A;  2Y69 H;  5EZG A;  1IDY A;  3H0G J;  3NQO A;  1PUF B;  5DS9 A;  4JBA A;  4BE1 A;  1FTZ A;  5KNL A;  1ERD A;  4YFN F;  3H36 A;  2ZXH A;  1G3T A;  1MJ9 A;  2NAZ A;  3WTY C;  1QGP A;  2VLA A;  1LVK A;  1AKH A;  1HLV A;  1G3S A;  2EK5 A;  1G2H A;  2RDP A;  2EFN A;  4B8X A;  1TNT A;  2W00 A;  5M3M J;  2K40 A;  2ME6 A;  1SVM A;  1Y8R B;  4XRS G;  1R36 A;  2DMT A;  3HOT A;  1J75 A;  3DV8 A;  5FFZ A;  4I76 A;  1DGW Y;  4BY7 J;  4BQN A;  1C0W A;  5HS7 A;  4RMN A;  3F8N A;  4LG0 A;  3I58 A;  3CUO A;  2AXL A;  2JTV A;  2V26 A;  5L3C A;  2CUE A;  2KT0 A;  4XKV A;  3RJP A;  2ESH A;  4IHW A;  2E19 A;  3S2D J;  1IV6 A;  5KAI C;  2HYF A;  5J3L A;  4E6K G;  3M3Y J;  3JRD A;  2IS6 A;  2ZME B;  2V6E A;  3AG3 H;  1TBX A;  4Z6Y A;  4HSR A;  1T38 A;  4ANJ A;  4JQF A;  5FO5 A;  3ZMD A;  4RB3 C;  4UVC A;  2R7U A;  1H9G A;  1HCR A;  2JUC A;  3OWT A;  2YPR A;  2VC0 A;  2QQ9 A;  1W5S A;  2E1M C;  2JA2 A;  3RQ4 A;  4XLP F;  4HLY A;  3P9K A;  1QPM A;  3T0Y A;  3GTG J;  3SFI A;  5D4S A;  1X19 A;  4RB2 C;  2A6H F;  4HLX A;  2LF8 A;  2Z99 A;  2ELH A;  4NB5 A;  4BGD A;  3M07 A;  2FE3 A;  4CCN A;  3LA3 A;  3S15 J;  3CUQ B;  2WY7 Q;  1STZ A;  2LBF A;  2BXZ A;  2X48 A;  3GEZ A;  1Z05 A;  3HIF A;  1O3R A;  4U7B A;  1PP8 F;  2GAU A;  3H35 A;  2XRL A;  1TWF J;  3HXL A;  1DDN A;  1S7A A;  5EEG A;  4ENM A;  3TO6 A;  4AVP A;  1YLF A;  4QSH A;  1EF4 A;  2MD0 A;  4YFK F;  3VYU B;  4C2T A;  3J81 K;  2KRF A;  1IXR C;  4NBQ A;  2EZK A;  3F9K A;  4XIC A;  4IPA A;  4J01 A;  4N4N B;  2WAD A;  2BW3 B;  2DPD A;  3ZPL A;  2DFE A;  4Y33 A;  4V2G A;  3M1E A;  3PNV A;  5B5E C;  3BG6 A;  3HTS B;  1EH6 A;  4WXH A;  3PFI A;  2CV1 A;  4CYC B;  3HSF A;  3S3N A;  3E1S A;  2ZSI B;  5D5X B;  2HU9 A;  4B3X A;  2FBI A;  5E1X A;  5L3G A;  1O3Q A;  3LSM A;  4MQ9 F;  1FP1 D;  2HDW A;  5E8G A;  1YOV B;  1JKQ C;  4MFD A;  2XGX A;  2V9V A;  3UNG C;  3D5R C;  4JYK A;  2ZXJ A;  4GXO A;  1XC5 A;  1ETQ A;  4UB6 C;  4UV8 A;  4UUS B;  2MSY A;  3BCB A;  3ZMV A;  1MNM C;  3FKJ A;  4LK1 F;  4P9F A;  2R7R A;  2Z33 A;  2P8T A;  2K7L A;  5FKM A;  2A05 A;  3C7J A;  3KLN A;  3JRF A;  3MQ0 A;  3NWT A;  1JKO C;  4DOZ A;  2E35 A;  5BS6 A;  3K1P A;  3E6C C;  2XB5 A;  3HOX J;  1KA8 A;  2WAE A;  1U5T C;  1B9M A;  1DP7 P;  2IT0 A;  2MYS A;  2NS0 A;  4HZF A;  3VSL A;  1R6R A;  3DQV C;  2P6T A;  3HSR A;  3VOE A;  3GFL A;  4IOA F;  2BBY A;  5FLV A;  4I02 A;  2CYY A;  1R1T A;  4A3L J;  4J00 A;  1IG7 A;  1MJA A;  2XV4 S;  4HDV A;  2VQH A;  4GCV A;  3BJA A;  3CCM I;  4ZYG A;  1MKM A;  3EYI A;  1ULY A;  2X1E A;  3V8J A;  5LHG A;  4WWC A;  2M1B A;  2K86 A;  3LOC A;  3WTV C;  4IVN A;  4O3M A;  1U5T A;  1YRN A;  2DDA A;  3U9G A;  4BJ5 C;  5M5W J;  5DCM A;  2Y0M A;  4AC0 A;  4KIF A;  1TNS A;  2R7Q A;  2LF7 A;  1IDZ A;  3ZQC A;  1TW2 A;  2HXI A;  2EIN H;  3N97 A;  2RQP A;  1RR8 C;  3CCQ I;  3PNY A;  2BXY A;  2VJI A;  1D8J A;  3IKT A;  1SD5 A;  1HKS A;  3PFY A;  3I9V 2;  4M9X A;  4Y15 A;  1MBK A;  1Y8Q B;  4XQF A;  1HST A;  3F8C A;  2QKM B;  3ELK A;  1RNL A;  3TDU C;  2E5N A;  1TL8 A;  4JX5 A;  1BC7 C;  3VEP A;  4LIU A;  2DCE A;  1B8I B;  5HDK A;  2HOE A;  3QQA A;  4LLL A;  1G8X A;  1W7P A;  5LBQ A;  1G6N A;  1W0U A;  1VF9 A;  3W3C A;  4ZC3 A;  1IN5 A;  1CF7 B;  2CGP A;  2A61 A;  1Y6I A;  3HPH A;  3IAM 2;  3F6V A;  2VT2 A;  2VL8 A;  2Y9Z A;  3RIR A;  3E97 A;  3GYH X;  4S0H B;  4HST A;  3U2R A;  2BZT A;  1T8I A;  1MGT A;  2X6O A;  2VBY A;  4C3I J;  2W1O A;  4B3A A;  2R7X A;  4HAM A;  1LJ9 A;  1X4P A;  5E3N A;  2QWW A;  1UFM A;  3BR2 A;  3OYM A;  1I3Q J;  2X85 A;  2Z3Y A;  3MEX A;  1VQN I;  1SFE A;  3BR3 A;  1ON1 A;  2ZJP F;  3AG1 H;  1LEA A;  1HSJ A;  2M4G A;  2YR2 A;  2GZW A;  4OIP F;  1FIA A;  1X1A A;  2LMD A;  1I6X A;  5DUK A;  1VQ4 I;  2P81 A;  1I1S A;  3O2P E;  1JE8 A;  3OOP A;  2QLZ A;  1W7P D;  1XDU A;  2OUM A;  5LFA A;  3K4C A;  5E17 F;  2WB1 A;  1BIB A;  2ZO4 A;  2RGV A;  1ZGA A;  1S5L C;  2Y31 A;  2YU9 J;  2LY2 A;  2W25 A;  4CXF A;  4U0Y A;  2ISZ A;  4BNC A;  5FLM J;  1QO0 D;  2HQR A;  1MBH A;  5LLQ A;  4XLE A;  5D4R A;  4GFB A;  4A6D A;  1D1B A;  3L2V A;  4BJT A;  3HRS A;  4LB6 B;  1TLH B;  2ZFW A;  1XGO A;  4RA2 A;  5J40 A;  5J4Y A;  5K5Q A;  2ICW G;  3M7G A;  2HPI A;  3OYL A;  2KRC A;  2VPR A;  4IHY A;  4BEH A;  4D5C A;  4WXD A;  1SFX A;  2E1O A;  2F2E A;  3JRH A;  2Z16 A;  3COA C;  1Z1D A;  1MBE A;  1FLI A;  3H92 A;  2QQ8 A;  3ZN1 A;  5IT9 K;  3LSJ A;  5EJC A;  5BOX A;  4NQW B;  1ZR2 A;  1G3W A;  2KRH A;  2PJR B;  3CCV I;  1AWC A;  3J7Y J;  1NG6 A;  2DYS H;  1N78 A;  1KQ8 A;  1WZ2 A;  3MD2 A;  5FLX K;  1K78 A;  5KK1 A;  2UUZ A;  3OYE A;  2HDD A;  2KFD A;  1MBG A;  3MZY A;  2VKH A;  4OOI A;  1ZG3 A;  5LEJ A;  3KEO A;  5L3D A;  2VUM J;  3PM1 A;  3ZOB A;  5D6E A;  2ELK A;  3H3V K;  3G3Z A;  3G6E I;  3LFU A;  5FLX Z;  5C4X J;  4M3D A;  3OS2 A;  4MNU A;  4O5V A;  2QZ8 A;  1WPK A;  2DFH A;  2VKE A;  3OS0 A;  5D5U B;  1IGN A;  2FX0 A;  4UUT A;  3PUF A;  4N4O B;  1H0M A;  2XGC A;  4EM0 B;  1IF1 A;  4IEJ A;  3W6J B;  4CCJ A;  4FT8 A;  2Y30 A;  3PNT A;  4I99 C;  1Z7U A;  2O03 A;  2PMZ N;  2QUF A;  1SFU A;  4BAC A;  2X1D A;  3QP6 A;  3OYG A;  4DZJ A;  1A36 A;  2Z5U A;  2EIJ H;  2DFF A;  2VQC A;  5B66 C;  1JTX A;  2WWY A;  2MBF A;  1XS9 A;  3K4N A;  5E3M A;  4M3F A;  2E2J J;  1OYY A;  4RGS A;  2GA1 A;  2RRE A;  1J09 A;  2FA5 A;  1LDD A;  1F1Z A;  2CQQ A;  1SD6 A;  3UR3 C;  1W5C C;  1XX5 A;  3F3X A;  1JHH A;  1D5V A;  2CV0 A;  2M30 A;  5A2Q K;  3W6V A;  2IP2 A;  1LFU P;  3KX2 A;  1RRJ A;  2D5V A;  4IOC F;  4OIN F;  1JTY A;  2F5E A;  2EA2 A;  1J9I A;  2F5V A;  2K9L A;  1BN5 A;  2O7O A;  1ZKG A;  2QVO A;  3K2A A;  4KN7 X;  4G7H F;  1PVE A;  2JA6 J;  1ETX A;  3KP5 A;  2DA4 A;  3BC8 A;  2P5V A;  1LVA A;  1YTY A;  3QYE A;  3ABU A;  1YS7 A;  1D3Y A;  3TOB A;  1G59 A;  4AIJ A;  4KIC A;  4HNT A;  4HV5 A;  2OJE D;  2J5O A;  4ZYH A;  4ENN A;  3QWL A;  3OYB A;  1VI0 A;  3WE2 A;  4PUS A;  3CUQ C;  3I4M J;  2UZK A;  3MZH A;  2FOW A;  4E7L A;  3IUO A;  2HTS A;  3V8K A;  1Z67 A;  1ENH A;  2LC2 A;  2DA7 A;  1B72 B;  2Y75 A;  2M5W A;  3BR1 A;  2W4S A;  5L3B A;  3K10 A;  3FXJ A;  2M8G X;  2DA5 A;  1SAX A;  4MLO A;  3BJO A;  2M0M A;  2DA2 A;  1YJW I;  1BL0 A;  4RLF A;  4C3J J;  1P92 A;  4UV9 A;  1FNN A;  1RI7 A;  1OCC H;  2LH9 A;  3VYS B;  3LNQ A;  3A01 B;  4RAY A;  2IGK A;  5TGT A;  5L3E A;  2O8X A;  2L7K A;  4PJM A;  2W82 A;  3Q3S A;  1ZTR A;  1E3H A;  4U87 A;  1YE9 A;  1QHH D;  4QPQ A;  2K5C A;  1FSE A;  3OOU A;  4MTD A;  3OYJ A;  2JT1 A;  3CCJ I;  4HX7 A;  1UCR A;  3DPT A;  3S3O A;  2IJL A;  3O6B B;  4F92 B;  2QYO A;  3CCS I;  3ZQG A;  5C4J J;  2L9R A;  2XAQ A;  3I3L A;  2CV2 A;  2EIK H;  4NC6 A;  3ZMT A;  2XSD C;  3UKG A;  2EA4 A;  1YIO A;  3J7Z I;  1APL C;  5IYD J;  2LKX A;  4PSW A;  5FRO A;  2MC3 A;  4WCG A;  1SMT A;  2LY9 A;  2DO7 A;  3S1M J;  2Q2E B;  1SVL A;  1TQP A;  3OR2 C;  3FXM A;  5F0C A;  2DJI A;  1BI0 A;  2Z1D A;  3HHH A;  4BE2 A;  2H09 A;  2LD5 A;  3S1Q J;  4MFE A;  4FTH A;  1FSH A;  5EG0 A;  4EGZ A;  2GLO A;  4CHU A;  5LHH A;  3J7A O;  5EGO A;  2A6E F;  2BOL A;  4E7Z A;  4DNC A;  3IP4 B;  1S29 A;  4G12 A;  3GTM J;  3ZGK A;  1KZH A;  3MZ8 A;  3K4M A;  3LMM A;  3BZ6 A;  2VBX A;  1TC3 C;  1QZZ A;  3DKY A;  2KZG A;  1JKP C;  2IA1 A;  3B02 A;  3L9F A;  1EA3 A;  4L9V A;  4RS8 A;  2NOJ B;  1ZR4 A;  5EF6 A;  3DCF A;  4O6J A;  1KON A;  1FOY A;  3QAH A;  4H4K C;  4N9I A;  1P4W A;  3A03 A;  5E1Z B;  4BBS J;  5BQT A;  1XD7 A;  2EFP A;  2HGC A;  2L5Q A;  1E3O C;  2IS1 A;  1DP3 A;  2XB0 X;  2VBZ A;  2XGD A;  5FKL A;  5CPR B;  4ETS A;  4EJO A;  2IVM A;  5IT3 A;  4XLA A;  3LAP A;  5DV5 A;  3F8B A;  5HDN A;  2LDU A;  2XSJ C;  4P5O A;  2VJ5 A;  2MH2 A;  2NS8 A;  5EYR A;  3KZY A;  3RZD J;  3HOV J;  1YFH A;  2MH9 A;  2BVL A;  3H5N A;  1XMK A;  2FRH A;  3OYK A;  1BBY A;  3TW6 A;  4IKF A;  2NNY A;  2D1H A;  2VB6 A;  2L4A A;  2HQN A;  4F55 A;  2ESN A;  4OMZ A;  1OQY A;  3HJE A;  3H0D A;  1NH3 A;  2EZH A;  3IWZ A;  3AL0 C;  2ZC2 A;  4PGH A;  5EDN A;  1XSV A;  4E7H A;  4HX8 A;  4LLG F;  4KFC A;  2VE8 A;  1MD0 A;  4Y7N J;  2BV6 A;  1T6S A;  2NYX A;  3GZ6 A;  2M87 A;  3EPZ A;  3B6A A;  4N0B A;  1YIT I;  3V4G A;  1OCO H;  1T08 B;  5B1B H;  1IO2 A;  1T95 A;  4HF1 A;  3S32 A;  5GAD J;  3DLA A;  5KAF C;  2OF7 A;  1WQ2 A;  1G4D A;  5LRS A;  2D2W A;  2PFB A;  2EWN A;  4BQO A;  1WCM J;  3PL8 A;  5J6X A;  4EEF G;  5JHF A;  3GTJ J;  2JWT A;  3P9C A;  1BI3 A;  1D1C A;  2VC1 A;  3FK6 A;  1XDS A;  2H6B A;  1H88 C;  4EQQ A;  2CO5 A;  3K1N A;  1Z3X A;  3K4B A;  1U8B A;  2OAZ A;  4U7D A;  4A3I J;  4W1U A;  4NNJ A;  2H27 A;  1ZYR F;  4X1E A;  1OPC A;  2W85 A;  4L0Z B;  3L1P A;  2D45 A;  2P5L C;  4YIF A;  3NAR A;  1EJ9 A;  2KP6 A;  2QF7 A;  2DOA A;  1LFB A;  4AYB N;  2MLK A;  4Y17 A;  3OSG A;  2STT A;  1BC8 C;  2IXS A;  5IP9 J;  2L7F P;  2DLL A;  4ESJ A;  4IHT A;  3VOD A;  2KIM A;  1MDM A;  3E6M A;  3R60 A;  4P55 A;  2DAO A;  2P5K A;  2VN2 A;  4LG3 A;  3KLO A;  1YW9 A;  3P7N A;  2LTP A;  2NVY J;  4F7Z A;  5LEK A;  3GTL J;  1P6R A;  2V79 A;  2K9N A;  5AIP A;  3FMS A;  2FXA A;  2OQR A;  1HXD A;  1IUF A;  2IGN A;  2LLK A;  1KU3 A;  2ECB A;  2OC6 A;  1J5Y A;  4Q47 A;  3S8P A;  3ERM A;  1FYM A;  1YQA A;  1F9N A;  2ISY A;  4RLQ A;  5J8C A;  3LQQ A;  1RKW A;  1U3E M;  1KQ0 A;  2FUG 2;  3WGI A;  2EFW A;  1W0T A;  2RAE A;  3RKY A;  1BJZ A;  4LJZ F;  3N4M A;  5TJJ A;  3EYY A;  2R7V A;  1JI8 A;  2L9S A;  3SYT A;  4A5N A;  3RYP A;  2AQF A;  3ISP A;  3OV8 A;  4XOP A;  2B9S A;  2UWM A;  2QM3 A;  3LST A;  3F8F A;  5K7F A;  1WJ5 A;  2LR8 A;  4A12 A;  1VQM I;  3LQR A;  3IC7 A;  3J80 Z;  3MVP A;  3TL4 X;  4DYC A;  1UZC A;  1PJR A;  4XLN F;  3GVA A;  2WAF A;  2AS5 F;  1FT9 A;  2IW5 A;  3RCO A;  1I6H J;  3WU1 B;  2NNN A;  4AM3 A;  1FBS A;  1WVR A;  2KJC A;  2HPM A;  3JRB A;  3DKW A;  3OYH A;  3OL4 A;  3AAF A;  4EGY A;  3PSF A;  2OTJ I;  3DU6 A;  1U9N A;  2E7W A;  1DU6 A;  4HG2 A;  3C2B A;  3HM5 A;  2VQL A;  2ELJ A;  4DBR A;  1O4X A;  2LK2 A;  3DPU A;  5FKK A;  1HA8 A;  3BG3 A;  4HQM A;  1OCP A;  2PLY A;  1R5I D;  2ZNZ A;  1UHM A;  3DEU A;  3FBI B;  3MKY B;  3SDB A;  2JSC A;  4EVI A;  5CVV A;  2ZSH B;  4KIS A;  3DTE A;  2P4W A;  5CYV A;  4ABZ A;  4KA4 A;  2R0Q C;  2E71 A;  2F48 A;  3DBL B;  5DTD A;  2LRD A;  4KIB A;  2WC2 A;  1VQ6 I;  5ERI A;  2LG4 A;  3WTU C;  3PJR A;  1OYI A;  2H8W A;  2LVS A;  3PUB A;  5F0H A;  1UAA A;  4HA8 A;  3RKQ A;  2MD5 A;  3PIO F;  2I5U A;  5DCF A;  2ECC A;  3WTT C;  3IRQ A;  4UB8 C;  4I6Z A;  4EV0 A;  4ZTJ A;  2JZY A;  1NK2 P;  1X3Z B;  4TV7 A;  4G6T B;  3DWL E;  4UUV A;  1VQ7 I;  1X4O A;  3P5J A;  2M8E A;  1A5J A;  2E34 A;  2OTL I;  2NVQ J;  3F22 A;  1SMY F;  3GF2 A;  2CMP A;  6PAX A;  3ZMU A;  4E70 A;  1X1C A;  4A3K J;  2MW8 A;  3LL7 A;  2X6X A;  4AIK A;  3RI4 A;  1XGS A;  4C2U A;  2ADU A;  3CC4 I;  5DM7 F;  3GFJ A;  1SD4 A;  1XTA A;  5TIS C;  4PJJ A;  4A2U A;  5ICE A;  1F43 A;  3ZXS A;  2CUF A;  1POG A;  2XAU A;  2PMZ A;  2CW0 F;  2OV7 A;  3RKX A;  1ZH5 A;  3BR5 A;  3E5Q A;  3FIW A;  1XCB A;  2DT5 A;  2OCC H;  2ZB9 A;  1O7F A;  3VWB A;  1WRJ A;  3MCZ A;  3E5X A;  1HQC A;  2COB A;  2PMH A;  5H6Q A;  2A5W A;  4WK8 F;  1X1P A;  4M6V A;  3TQN A;  3ZQI A;  4YFX F;  4M3E A;  1OIS A;  1QRY A;  3I59 B;  5IY5 H;  4RDU A;  5F1J A;  4A3G J;  4BKX A;  3CME I;  1YG2 A;  3REO A;  3GUD A;  3PO2 J;  2IGM A;  2GIZ A;  1P4X A;  3KP2 A;  2X1C A;  2R7S A;  1X2M A;  4BY1 J;  5GAH J;  2R3S A;  4U88 A;  3HSE A;  5KCM A;  5ED4 A;  1UG0 A;  4AWX B;  1R1V A;  1JUM A;  4AD9 A;  5FB2 A;  1AHD P;  5HDG A;  2NXN B;  3RDI A;  1U6G A;  3WU0 A;  4BUP A;  4A93 J;  3ZN0 A;  3ZP5 A;  2VOP A;  3SZT A;  4JX6 A;  2O0Y A;  4CZZ A;  2IS4 A;  4CUG A;  1HC8 A;  1WH7 A;  1VQ8 I;  2VKD A;  2G0E A;  5GTH C;  4BQQ A;  4UY8 I;  4DYQ A;  2A6T A;  4A0Y A;  1MW7 A;  1BW6 A;  5DD4 A;  4AIH A;  4G6D A;  2NVU B;  1SD7 A;  1ZGW A;  2BE5 F;  3LSK A;  2XAH A;  4ENJ A;  1V55 H;  5HOD A;  3NAU A;  2E1N A;  4RGX A;  3RTR A;  2R5Y B;  2A07 F;  5IP6 A;  4DQ2 A;  2X6Y A;  2LYC A;  2R5Z A;  1ODD A;  3MMY B;  4D5F A;  1GLN A;  4M73 A;  3GX4 X;  3ZCO A;  3LA7 A;  3ULQ B;  2L4M A;  1BR2 A;  3I55 I;  2E2H J;  2ZFU A;  2ME0 A;  5K7H A;  1FYL A;  2L9N A;  2G9W A;  3AG2 H;  1J2X A;  2KDO A;  4BXF A;  4M74 A;  3GWZ A;  1S7E A;  2IA0 A;  1FOK A;  1BI1 A;  4OAZ A;  5DD8 A;  1RR7 A;  3MFK A;  4AU7 A;  4F3Q A;  4IJA A;  4XN3 A;  1KQ9 A;  4PJ0 C;  1WKM A;  1V5F A;  2L7Z A;  2OA4 A;  3AKZ A;  3IRR A;  2W84 A;  3CD6 I;  1XGM A;  1X1B A;  1X58 A;  2JN6 A;  3TBI A;  2NRA C;  2EBI A;  1HW1 A;  2M9H A;  3HGG A;  4ASN A;  3CCE I;  1R5H A;  2DA6 A;  3L7W A;  3R0A A;  3SHF A;  2VPL A;  2XRN A;  1H8A C;  1GHC A;  5FGM A;  4L5E A;  5FFX A;  4ENK A;  2NOG A;  3BCA A;  3JRE A;  1LFP A;  2RNJ A;  3Q9V A;  4S05 A;  4I0A A;  1OYW A;  5TRD A;  4A6E A;  5EZH A;  3TW7 A;  4EAT A;  2H1L A;  3FMR A;  5E3L A;  2FBH A;  1R4N B;  4UVB A;  2VQG A;  4LOC A;  1ZAO A;  4PFO A;  4IL6 C;  1YO5 C;  1LE8 B;  1I3A A;  3LSH A;  5K5R A;  2QSH X;  4JK1 X;  1ZG5 A;  1TWG J;  2F5D A;  3LSG A;  4FIS A;  1R4M B;  4P96 A;  1N75 A;  3IH3 A;  1P4A A;  2PX9 A;  4B44 A;  4KT6 A;  3HYI A;  4XID A;  3K0L A;  4XBF A;  1IRG A;  2HVR A;  3F23 A;  2QBY A;  3K4L A;  2TDX A;  1ZAR A;  5LRR A;  2IRF G;  3RPU A;  3SXY A;  3TGN A;  4KIT B;  2HQA A;  3W2V A;  3KET A;  3K70 C;  3QPT A;  1KU2 A;  3F21 A;  2JVG A;  4XRF A;  4XON A;  5CVI A;  4DBQ A;  2B63 J;  2WTE A;  3RQI A;  4RB1 A;  4A3F J;  4PFP A;  1O7L A;  4Y3O A;  4U0V A;  4X0G A;  2Y48 A;  2VE9 A;  1OKR A;  3KCC A;  1Y39 A;  1R71 A;  2L02 A;  2ZKZ A;  1ORK A;  1TP4 A;  1NG7 A;  2V6C A;  3ERE D;  3CP2 A;  2HXO A;  2DOD A;  3WHC A;  1RIO H;  2PQ8 A;  3T8R A;  3RPU D;  2IGO A;  5J47 A;  3GTP J;  3TDZ C;  1K61 A;  2QA4 I;  1OR7 C;  2DU9 A;  4IZZ A;  2E5Z A;  2XPU A;  5IYB J;  3CO7 C;  4II3 A;  3FMQ A;  4RBO A;  4K2E A;  3IH4 A;  2KPM A;  1Z21 A;  4G6Q A;  4HOB A;  3S1R J;  1PUF A;  3ZQL A;  4KT5 C;  4B4C A;  3K70 D;  2X9D A;  3BY6 A;  2XRO A;  2KJB A;  1YJN I;  1FX7 A;  2L0K A;  3AFH A;  4ON0 A;  5FRM A;  5GPC A;  2L7M P;  3K2Z A;  4ESB A;  1OR7 A;  1YS6 A;  2LNB A;  5D6F A;  4RAF A;  4CA0 A;  4GYI A;  4QWQ A;  2CH0 A;  3OR1 C;  5F08 A;  4A0Z A;  3KEY A;  2KIS A;  2BY1 A;  4EM1 A;  2ZXW H;  1YJ9 I;  3V42 A;  2AQE A;  3JR9 A;  2CFX A;  3L2Q A;  1R9T J;  3L2C A;  2HS5 A;  4ZJZ A;  5JVG F;  2TCT A;  1AKH B;  4KMU X;  1JGG A;  1W1W E;  2ZME C;  4XMY A;  1T33 A;  5L3F A;  3FBN B;  1SFO J;  4I09 A;  1FYK A;  2EV0 A;  2XIG A;  3Q0U A;  1K4S A;  1JXS A;  3GW2 A;  4B48 A;  1GXQ A;  1S72 I;  3CCL I;  1S7O A;  4LGW A;  1FOW A;  1QPI A;  1LPQ A;  1JUP A;  4AYB A;  5HNH A;  2DK5 A;  3K6G A;  1FPQ A;  2F4I A;  1BA5 A;  2VXD A;  2ZME A;  3R0J A;  2JA5 J;  3HHG A;  3ML6 A;  4FX4 A;  4OU0 A;  1REP C;  3OIO A;  4LG0 B;  4I98 B;  4KYW A;  4OMY A;  2V1D A;  4HW0 A;  2YS9 A;  4OIR F;  2ZCW A;  2DT6 A;  2F5F A;  2KIQ A;  3I5U A;  3QOP A;  4IRH A;  3EDP A;  3FX3 A;  5F0F A;  2K9Q A;  3FXQ A;  4CIC A;  4PCQ A;  2HTJ A;  4A0X A;  5ILV A;  1BI2 A;  2WA0 A;  2YSR A;  3H1C A;  1R7J A;  1IJW C;  3ZMS A;  4M6X A;  4L5I A;  1MSE C;  1MH3 A;  5E79 C;  1IW7 F;  1ZLJ A;  4BL0 B;  1EH7 A;  2Y9Y A;  5FRN A;  2RC4 A;  4CZC A;  2XHK A;  4CCL A;  1RES A;  3OYN A;  1IRX A;  1VQP I;  2K02 A;  2JUG A;  5BPD A;  2V4J C;  3BQZ A;  3CCY A;  4PJN A;  3WTW C;  3F6O A;  3CUQ A;  5CVR A;  1XMA A;  2FOK A; 
#chains in the Genus database with same CATH homology
 1UHW A;  4RGU A;  3TO9 A;  2L01 A;  4ZZL A;  4G9Y A;  2FMY A;  5DYM A;  3QU6 A;  3PQJ A;  5JI6 A;  4GYG A;  3GFI A;  1FBQ A;  1ZRC A;  1U2W A;  3E3V A;  2P7C B;  5E1W A;  2HZT A;  4WX9 A;  1PDN C;  1TTY A;  3JTH A;  1XSX A;  2YX7 A;  2K27 A;  3HOS A;  1OMI A;  2XUB A;  1QQI A;  3DXJ F;  3CDH A;  1U8R A;  4EJT A;  5JR3 A;  1E17 A;  3C18 A;  1KU7 A;  2GXG A;  2KIF A;  3NRV A;  5E20 A;  3GO5 A;  1I5Z A;  4LFU A;  1B4A A;  1EH8 A;  3KEQ A;  4G8X A;  3SZP A;  4ZH4 F;  4B09 A;  1IZ1 A;  3M8E A;  3NEU A;  2FNP A;  1YW8 A;  1HBX G;  2FNA A;  4IXA A;  2RVC A;  2K4B A;  3WGH A;  1ZHF A;  2COM A;  1U5T B;  2P6S A;  5DCM B;  4XSZ F;  1R5G A;  2RN7 A;  1DPU A;  1K6O A;  1PP7 U;  3FWE A;  1K7A A;  1GVJ A;  3P9I A;  1EV7 A;  2Z9O A;  1Y0U A;  1G3Y A;  4M6Y A;  4KDP A;  4BXU A;  1K79 A;  2JPB A;  1L0O C;  1CF7 A;  2PJP A;  4LMY A;  4IF4 A;  1Z6R A;  4ZYE A;  2KKO A;  1IUY A;  4OIQ F;  5EEH A;  4Q4Z F;  3WTS C;  1ZLK A;  2JPC A;  1W7P B;  5HS8 A;  1VTN C;  1IN4 A;  3R61 A;  2EFO A;  2PG4 A;  1ON2 A;  4UNO A;  1I27 A;  3F72 A;  1HKT A;  1D8K A;  2HEO A;  1LNW A;  2ZNY A;  4KMF A;  1B6A A;  2A5Y B;  3R6S A;  1Q1H A;  5F1R A;  2IA2 A;  2OBP A;  3FM3 A;  1B59 A;  1RUN A;  1XSD A;  1QBJ A;  2VON A;  1AOY A;  3BP8 A;  3RPQ A;  4L9T A;  4BAY A;  3FXR A;  4NQW A;  3HRT A;  2G7H A;  2Q0O A;  1HW2 A;  2QEN A;  1MZB A;  2DQL A;  2B0L A;  4I01 A;  2DTR A;  5K5O A;  3BRO A;  3J80 K;  3JSO A;  3U1D A;  4L18 B;  3KP7 A;  2OZ6 A;  4M9Z A;  1R22 A;  2DW4 A;  2MLG A;  2W57 A;  3L00 A;  5HS9 A;  1FP2 A;  3T5X A;  3K69 A;  4IRI A;  1K78 B;  4WF2 A;  3IL2 A;  3HRU A;  2EFQ A;  3HRM A;  5ILS A;  4LB5 A;  3GFM A;  2DK8 A;  2FSW A;  4PZJ A;  3TO7 A;  3FF5 A;  4UHT A;  2GIV A;  2K4J A;  3GLX A;  3I4P A;  3RKW A;  3ECO A;  1ZN2 A;  2L3D A;  2O61 A;  3IWF A;  1XGN A;  1TQI A;  2STW A;  3FM5 A;  2RKH A;  3TKY A;  2XAG A;  4Q48 A;  2PBI A;  4N9H A;  1WWX A;  2Q8K A;  2GXB A;  2VT3 A;  3O3K A;  4WXC A;  3WTX C;  1LDK B;  5CVU A;  5D5V B;  3D0S A;  4BYY A;  1HW5 A;  3R4K A;  5AON A;  3GZ5 A;  2KIU A;  4R1H A;  5E8I A;  3FHZ A;  3WG9 A;  4UXN A;  1LEB A;  3L09 A;  2FU4 A;  2QQA A;  3CO6 C;  2JRT A;  3FZV A;  4EJV A;  1XCV A;  3QP5 A;  2FQ3 A;  4Z2Y A;  5HLG A;  1HKQ A;  1FBU A;  1IN6 A;  1Z9C A;  3BOQ A;  4G7Z F;  1DPR A;  2P7V B;  4M9S A;  4S04 A;  2XKO A;  4KN4 X;  1RZ4 A;  4RAZ A;  4XSX F;  5ICC A;  2Q2E A;  3HUG A;  1R1U A;  3S2W A;  3J81 Z;  4IHS A;  1ONV A;  4HF2 A;  4ESF A;  2ETH A;  2LSO A;  1ZG1 A;  5K1Y A;  1PUE E;  2CWE A;  3I64 A;  4BQA A;  2D1V A;  3VFZ A;  1BJA A;  3T1B A;  3SFZ A;  4U0W A;  4EM2 A;  1KU9 A;  3SQN A;  2BGC A;  3V8L A;  4LK0 F;  1T39 A;  2MA3 A;  3KP3 A;  2A3S A;  2X0L A;  1WI9 A;  3I53 A;  2HKO A;  1IN8 A;  1I1G A;  1T98 A;  4HF0 A;  2OU2 A;  4L0Y B;  4L9J A;  1O3T A;  3ECH A;  1J59 A;  1W5T A;  1KYZ A;  2L54 A;  4OIO F;  2DBB A;  1RUO A;  5HOO A;  5FD5 A;  2DI3 A;  4M71 A;  3V7S A;  4KNY A;  1YYV A;  5HLI A;  3QPH A;  4CYD A;  3KP4 A;  4EJW A;  2CQK A;  4MEX F;  2BYV E;  3HTU A;  2G7U A;  5D5W B;  1IRF A;  4EMS A;  1R00 A;  3LFK A;  3IKV A;  1TQM A;  3H3U A;  3WOD F;  4D0P A;  2VXZ A;  1QNT A;  4L5J A;  2WV0 A;  1NHA A;  4MHG A;  1FZP B;  4CDG A;  5DUI A;  4QLC U;  2FML A;  5HLH A;  1BIA A;  4ZZD A;  3V7C A;  4KUM A;  4G94 A;  3BWG A;  3I54 A;  3WE3 A;  1LB2 A;  1UST A;  5JHU A;  2IPQ X;  2XAJ A;  1S3J A;  5F6F A;  1ZRD A;  3DF8 A;  4BH9 A;  3M9A A;  4MGR A;  2GQQ A;  5HVQ C;  1MDM B;  2HKX A;  1GXP A;  2CG4 A;  1JHF A;  1S8N A;  1T0F A;  5H6R A;  4LLN A;  5ICF A;  1FC3 A;  3MWM A;  2CSO A;  5DDG A;  4HQE A;  5FD6 A;  1S6L A;  3PQK A;  5IT9 Z;  3C3W A;  5F64 A;  3DPL C;  2V1X A;  2E1C A;  3WGG A;  3BPX A;  5D8L B;  2FEZ A;  2LKP A;  1TW3 A;  1USS A;  2X4H A;  4H0E A;  1L3L A;  3IHU A;  3ZQ7 A;  5CLS A;  5JFR A;  2PI0 A;  1F5T A;  1BM9 A;  1Z91 A;  3EET A;  5JVT A;  2O3F A;  1B1B A;  4L9N A;  4YII A;  5H20 A;  3VB2 A;  4FHT A;  3JSP A;  1IN7 A;  2ZJ2 A;  3BPV A;  5LGU A;  3G73 A;  5KVR A;  2OQG A;  4I2O A;  5CJ9 A;  4MQV A;  3T8T A;  3ROU A;  5A2Q Z;  2C6Y A;  1XB4 A;  2VOO A;  3CTA A;  3W6K B;  5BMZ A;  2PN6 A;  2HFH A;  4M72 A;  3BDD A;  2M45 A;  3LWF A;  2ACJ A;  1LQ1 A;  2R7F A;  3CLO A;  3JW4 A;  3I0T A;  3M8F A;  2EV5 A;  4UVA A;  4IRG A;  3QRF F;  1IXC A;  3F8M A;  1X3U A;  3WTZ A;  3B73 A;  3K9T A;  3I59 A;  3GXO A;  1H9T A;  3JTG A;  3QU3 A;  2A69 F;  1R23 A;  2A68 F;  5E18 F;  3E5U A;  1WSU A;  2EV6 A;  2QQB A;  2OZU A;  1BOA A;  2PEX A;  4RGR A;  2W24 A;  3LA2 A;  2UXX A;  3TOA A;  1V3F A;  1IAW A;  1E2X A;  1KYW A;  2BEO A;  5ILU A;  1ZRE A;  3Q9S A;  4KIG A;  1O57 A;  4PDK A;  2R7D A;  3KZZ A;  3KE2 A;  5LGN A;  4NHJ A;  2XAF A;  3MAJ A;  5LGT A;  4HX4 A;  2DQR A;  4HDU A;  5DEQ A;  4BHP A;  2YX4 A;  4BHC A;  3KFW X;  3FXU A;  3C1D A;  2EB7 A;  4LD5 A;  2HWV A;  1FY7 A;  4CGZ A;  3V7R A;  1LDJ A;  4MEY F;  2RV8 A;  4EJU A;  1F4K A;  4GO1 A;  1XN7 A;  4I7H A;  2H94 A;  2FF4 A;  4R79 A;  2ZBK A;  2VOD A;  2DFI A;  3E6D A;  1CGP A;  4P9U A;  2FBK A;  4BHB A;  1UB9 A;  4GGG A;  4FX0 A;  1IXS B;  4I0B A;  3D5L A;  2UXN A;  5D8K B;  3DFG A;  2J5P A;  1KGS A;  2HDC A;  1P2F A;  3I71 A;  1ZGJ A;  1V4R A;  2XKP A;  5AIQ A;  1Z6T A;  1JGS A;  2DPU A;  4Y13 A;  2HYG D;  1FWZ A;  3DP7 A;  4A5M A;  4YG2 F;  3BJ6 A;  5LHI A;  1R58 A;  3E6B A;  4G7O F;  5BPI A;  5J8F A;  1MJB A;  3ZMZ A;  2PMU A;  2XVC A;  4HV6 A;  1ZRF A;  2GWR A;  3RYR A;  1J7K A;  4PGG A;  2H6C A;  2YU3 A;  1U78 A;  2QBY B;  4RB0 A;  2GA2 A;  4MTE A;  1W4M A;  1YW7 A;  3CJN A;  1J0R A;  3EQL F;  2EJR A;  2F5C A;  1A04 A;  3JAM K;  1DUX C;  1B9N A;  1QZY A;  5CVJ A;  2HR3 A;  4HYE A;  3KP6 A;  4ZYD A;  4R8H A;  1T2K A;  3EUH A;  3K1M A;  2XAS A;  3JAM Z;  4Q5S F;  3H3Z A;  1O3S A;  2O6G E;  4CO8 A;  2VBW A;  2OD5 A;  5ICG A;  4HBL A;  2V1U A;  3ABT A;  3LAJ A;  2E7X A;  3Q5F A;  3NQO A;  4JBA A;  4YFN F;  1G3T A;  1MJ9 A;  2NAZ A;  3WTY C;  1QGP A;  1G3S A;  2EK5 A;  2RDP A;  2EFN A;  4B8X A;  1TNT A;  1R36 A;  3HOT A;  1J75 A;  3DV8 A;  5FFZ A;  1C0W A;  5HS7 A;  3F8N A;  4LG0 A;  3I58 A;  3CUO A;  2AXL A;  2JTV A;  5L3C A;  3RJP A;  2ESH A;  2HYF A;  2ZME B;  1TBX A;  1T38 A;  4JQF A;  5FO5 A;  3ZMD A;  4RB3 C;  4UVC A;  1H9G A;  2YPR A;  2VC0 A;  2QQ9 A;  1W5S A;  4XLP F;  4HLY A;  3P9K A;  1QPM A;  3T0Y A;  5D4S A;  4RB2 C;  2A6H F;  4HLX A;  2LF8 A;  2Z99 A;  2ELH A;  4NB5 A;  2FE3 A;  3LA3 A;  3CUQ B;  1STZ A;  3GEZ A;  1O3R A;  3HIF A;  1Z05 A;  4U7B A;  1PP8 F;  2GAU A;  1DDN A;  1S7A A;  5EEG A;  4ENM A;  3TO6 A;  4AVP A;  1YLF A;  4YFK F;  3J81 K;  2KRF A;  1IXR C;  4IPA A;  2DPD A;  3ZPL A;  3M1E A;  3HTS B;  1EH6 A;  4WXH A;  3PFI A;  3HSF A;  5D5X B;  2FBI A;  5E1X A;  5L3G A;  1O3Q A;  4MQ9 F;  1FP1 D;  5E8G A;  2XGX A;  2V9V A;  2ZXJ A;  4GXO A;  4UV8 A;  3ZMV A;  4LK1 F;  4P9F A;  2Z33 A;  2P8T A;  2K7L A;  3KLN A;  3C7J A;  3MQ0 A;  5BS6 A;  3K1P A;  3E6C C;  1KA8 A;  1U5T C;  1B9M A;  1DP7 P;  2IT0 A;  2NS0 A;  4HZF A;  3DQV C;  2P6T A;  3HSR A;  3VOE A;  3GFL A;  2BBY A;  4I02 A;  2CYY A;  1R1T A;  1MJA A;  2XV4 S;  4HDV A;  4GCV A;  3BJA A;  4ZYG A;  1MKM A;  3EYI A;  1ULY A;  3V8J A;  5LHG A;  4WWC A;  2M1B A;  2K86 A;  4O3M A;  3WTV C;  4IVN A;  1U5T A;  3U9G A;  5DCM A;  2Y0M A;  4KIF A;  1TNS A;  2LF7 A;  1TW2 A;  3N97 A;  2RQP A;  1D8J A;  3IKT A;  1SD5 A;  1HKS A;  4Y15 A;  4M9X A;  1HST A;  3F8C A;  3ELK A;  1RNL A;  3TDU C;  1BC7 C;  3VEP A;  5HDK A;  2HOE A;  4LLL A;  1W7P A;  5LBQ A;  1G6N A;  1IN5 A;  1CF7 B;  2CGP A;  2A61 A;  3F6V A;  2VT2 A;  3RIR A;  3E97 A;  3GYH X;  3U2R A;  1MGT A;  2VBY A;  4HAM A;  1LJ9 A;  2QWW A;  1UFM A;  2Z3Y A;  3MEX A;  1SFE A;  1ON1 A;  1LEA A;  1HSJ A;  2YR2 A;  2GZW A;  4OIP F;  5DUK A;  1I6X A;  1I1S A;  3O2P E;  1JE8 A;  3OOP A;  2QLZ A;  1W7P D;  1XDU A;  5E17 F;  1BIB A;  2ZO4 A;  2RGV A;  1ZGA A;  2W25 A;  4CXF A;  4U0Y A;  2ISZ A;  4BNC A;  1QO0 D;  2HQR A;  5LLQ A;  5D4R A;  4A6D A;  3HRS A;  4LB6 B;  1TLH B;  2ZFW A;  1XGO A;  5K5Q A;  3M7G A;  4WXD A;  1SFX A;  2F2E A;  3COA C;  1Z1D A;  1FLI A;  3H92 A;  3ZN1 A;  5IT9 K;  5BOX A;  1G3W A;  1AWC A;  1KQ8 A;  5FLX K;  1K78 A;  5KK1 A;  3MZY A;  4OOI A;  1ZG3 A;  5LEJ A;  3KEO A;  5L3D A;  5D6E A;  3G3Z A;  5FLX Z;  4MNU A;  4O5V A;  2QZ8 A;  5D5U B;  1H0M A;  1IF1 A;  4EM0 B;  3W6J B;  4FT8 A;  1SFU A;  1Z7U A;  2O03 A;  2QUF A;  3QP6 A;  2Z5U A;  2WWY A;  2MBF A;  1OYY A;  4RGS A;  2GA1 A;  2FA5 A;  1LDD A;  1F1Z A;  1SD6 A;  3F3X A;  1JHH A;  1D5V A;  2M30 A;  5A2Q K;  2IP2 A;  4OIN F;  2F5E A;  2EA2 A;  1J9I A;  4G7H F;  1BN5 A;  2QVO A;  4KN7 X;  3KP5 A;  2P5V A;  1LVA A;  1YTY A;  3ABU A;  1YS7 A;  1D3Y A;  3TOB A;  4AIJ A;  4KIC A;  4HV5 A;  2J5O A;  4ZYH A;  4ENN A;  3WE2 A;  3CUQ C;  2UZK A;  3MZH A;  2HTS A;  3V8K A;  2Y75 A;  2M5W A;  5L3B A;  1SAX A;  3BJO A;  1P92 A;  4UV9 A;  1FNN A;  1RI7 A;  4RAY A;  5L3E A;  2O8X A;  1FSE A;  4MTD A;  2JT1 A;  4HX7 A;  1UCR A;  3DPT A;  2IJL A;  3O6B B;  2QYO A;  2XAQ A;  3ZMT A;  2EA4 A;  1YIO A;  2MC3 A;  4WCG A;  1SMT A;  2DO7 A;  1TQP A;  1BI0 A;  3HHH A;  2H09 A;  1FSH A;  4EGZ A;  4CHU A;  5LHH A;  3J7A O;  2A6E F;  4DNC A;  1S29 A;  3BZ6 A;  2VBX A;  1QZZ A;  2IA1 A;  3B02 A;  3L9F A;  4L9V A;  4RS8 A;  4O6J A;  3QAH A;  4N9I A;  1P4W A;  5E1Z B;  5BQT A;  1XD7 A;  2EFP A;  2HGC A;  2VBZ A;  4ETS A;  4EJO A;  2IVM A;  5IT3 A;  3LAP A;  5DV5 A;  3F8B A;  5HDN A;  2LDU A;  4P5O A;  2MH2 A;  3KZY A;  1YFH A;  2MH9 A;  1XMK A;  2FRH A;  1BBY A;  2NNY A;  2D1H A;  2L4A A;  2HQN A;  2ESN A;  4OMZ A;  3IWZ A;  4PGH A;  1XSV A;  4HX8 A;  4LLG F;  4KFC A;  2VE8 A;  1MD0 A;  2BV6 A;  1T6S A;  2NYX A;  3GZ6 A;  2M87 A;  4N0B A;  3V4G A;  4HF1 A;  1WQ2 A;  1G4D A;  5LRS A;  2D2W A;  2PFB A;  2EWN A;  5J6X A;  3P9C A;  1BI3 A;  2VC1 A;  1XDS A;  2H6B A;  4EQQ A;  2CO5 A;  3K1N A;  2OAZ A;  4U7D A;  2H27 A;  1ZYR F;  1OPC A;  2W85 A;  4L0Z B;  2D45 A;  2P5L C;  4YIF A;  2MLK A;  4Y17 A;  2STT A;  1BC8 C;  2DLL A;  4ESJ A;  4IHT A;  3VOD A;  2KIM A;  1MDM A;  3E6M A;  3R60 A;  4P55 A;  2DAO A;  2P5K A;  2VN2 A;  3KLO A;  1YW9 A;  3P7N A;  4F7Z A;  5LEK A;  1P6R A;  2V79 A;  5AIP A;  3FMS A;  2FXA A;  2OQR A;  1HXD A;  1KU3 A;  1J5Y A;  4Q47 A;  1FYM A;  1YQA A;  1F9N A;  2ISY A;  5J8C A;  3LQQ A;  1U3E M;  1KQ0 A;  3WGI A;  2EFW A;  3RKY A;  4LJZ F;  3N4M A;  5TJJ A;  3EYY A;  4A5N A;  3RYP A;  3ISP A;  3OV8 A;  2UWM A;  2QM3 A;  3LST A;  3F8F A;  4A12 A;  3LQR A;  3IC7 A;  3J80 Z;  4XLN F;  3GVA A;  2AS5 F;  1FT9 A;  2IW5 A;  3WU1 B;  2NNN A;  1FBS A;  2KJC A;  3DKW A;  3AAF A;  4EGY A;  2E7W A;  4HQM A;  2PLY A;  2ZNZ A;  1UHM A;  3DEU A;  2JSC A;  4EVI A;  5CVV A;  2P4W A;  5CYV A;  4KA4 A;  4KIB A;  2WC2 A;  5ERI A;  3WTU C;  1OYI A;  4HA8 A;  2MD5 A;  5DCF A;  3WTT C;  3IRQ A;  4EV0 A;  2JZY A;  4TV7 A;  4UUV A;  2M8E A;  3F22 A;  1SMY F;  3GF2 A;  6PAX A;  3ZMU A;  4E70 A;  4AIK A;  3RI4 A;  1XGS A;  2ADU A;  3GFJ A;  1SD4 A;  4A2U A;  5ICE A;  2CW0 F;  3RKX A;  1ZH5 A;  3E5Q A;  1XCB A;  2DT5 A;  1O7F A;  1WRJ A;  3MCZ A;  3E5X A;  1HQC A;  2PMH A;  5H6Q A;  4WK8 F;  3TQN A;  4YFX F;  3I59 B;  1YG2 A;  3REO A;  3GUD A;  1P4X A;  3KP2 A;  2R3S A;  4U88 A;  3HSE A;  5ED4 A;  4AWX B;  1R1V A;  4AD9 A;  5FB2 A;  5HDG A;  3RDI A;  1U6G A;  3WU0 A;  3ZN0 A;  3ZP5 A;  2VOP A;  3SZT A;  2O0Y A;  4CZZ A;  4A0Y A;  5DD4 A;  4AIH A;  4G6D A;  1SD7 A;  2BE5 F;  2XAH A;  4ENJ A;  2E1N A;  4RGX A;  3RTR A;  2A07 F;  4DQ2 A;  1ODD A;  4M73 A;  3GX4 X;  3LA7 A;  3ULQ B;  2L4M A;  1FYL A;  2G9W A;  1J2X A;  4M74 A;  3GWZ A;  2IA0 A;  1FOK A;  1BI1 A;  5DD8 A;  3MFK A;  4IJA A;  1KQ9 A;  1WKM A;  2OA4 A;  3IRR A;  2W84 A;  1XGM A;  2NRA C;  1HW1 A;  4ASN A;  1R5H A;  3L7W A;  3SHF A;  3R0A A;  2XRN A;  1GHC A;  5FGM A;  5FFX A;  4ENK A;  3Q9V A;  2RNJ A;  4S05 A;  4I0A A;  1OYW A;  5TRD A;  4A6E A;  3FMR A;  2FBH A;  4UVB A;  1ZAO A;  1YO5 C;  5K5R A;  4JK1 X;  1ZG5 A;  2F5D A;  4P96 A;  1P4A A;  3HYI A;  3K0L A;  4XBF A;  1IRG A;  3F23 A;  2QBY A;  2TDX A;  1ZAR A;  5LRR A;  2IRF G;  3RPU A;  3SXY A;  3TGN A;  3KET A;  3QPT A;  1KU2 A;  3F21 A;  4XRF A;  5CVI A;  2WTE A;  4RB1 A;  1O7L A;  4U0V A;  2Y48 A;  2VE9 A;  1OKR A;  3KCC A;  2L02 A;  2ZKZ A;  2V6C A;  3ERE D;  1RIO H;  2PQ8 A;  3T8R A;  3TDZ C;  2DU9 A;  3CO7 C;  3FMQ A;  4K2E A;  4G6Q A;  4HOB A;  4KT5 C;  3BY6 A;  2XRO A;  2KJB A;  1FX7 A;  4ON0 A;  3K2Z A;  4ESB A;  1OR7 A;  1YS6 A;  2LNB A;  5D6F A;  4GYI A;  4QWQ A;  4A0Z A;  4EM1 A;  2CFX A;  3L2C A;  2HS5 A;  4KMU X;  5L3F A;  4I09 A;  1FYK A;  2EV0 A;  2XIG A;  1JXS A;  3GW2 A;  1GXQ A;  1S7O A;  4LGW A;  2DK5 A;  1FPQ A;  2ZME A;  3R0J A;  3HHG A;  3ML6 A;  4FX4 A;  4OU0 A;  1REP C;  4LG0 B;  4I98 B;  4KYW A;  4OMY A;  2V1D A;  4HW0 A;  4OIR F;  2ZCW A;  2F5F A;  3I5U A;  3QOP A;  4IRH A;  3EDP A;  3FX3 A;  4CIC A;  3FXQ A;  4PCQ A;  2HTJ A;  5ILV A;  4A0X A;  1BI2 A;  2YSR A;  1R7J A;  3ZMS A;  4M6X A;  4L5I A;  1IW7 F;  1ZLJ A;  1EH7 A;  2RC4 A;  2XHK A;  2K02 A;  5BPD A;  3WTW C;  3F6O A;  3CUQ A;  5CVR A;  1XMA A;  2FOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...