4A3MJ

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3mJ00
4NDLA 2E19A 4M6VA 5IP7J 1MBGA 5IOYA 1WGXA 1GDTA 2HOTA 2M8GX 2AO9A 2Y9YA 4LOCA 4BXXJ 1A6IA 2NVTJ 1IC8A 2EH3A 2DN0A 1FJLA 3FK6A 2Y9ZA 3B6AA 4RBOA 3HOYJ 1UG2A 2NVQJ 2L7MP 4FE4A 4IHXA 4XRSG 1JJ8C 5IYDJ 3S16J 2CUFA 3ZOBA 3HOUJ 3RQIA 2CQQA 3CQZJ 1NK3P 3BTJA 1G2HA 2EZHA 1AKHA 3BG3A 3LSRA 4EEFG 4DYRA 4AC0A 1QVTA 1BW6A 1ORKA 1TWHJ 5FKMA 5DTDA 1F43A 1ETVA 1EF4A 1JTYA 1ETYA 1ETXA 2X48A 5F1JA 1ENHA 2DA4A 3FISA 2ID6A 1Z0XA 1ZKGA 3PO3J 2O9LA 2G0EA 3WHCA 5EEAA 2KDZA 1IJWC 3B6CA 2OPTA 1HDDC 3BTLA 5IP9J 2CJJA 5M3FJ 2VPRA 1FTZA 5J3LA 4W97A 3IH4A 3TEDA 2VI6A 3ZQLA 1UHSA 1E3OC 4JX6A 4A3LJ 1U9OA 1Z77A 2O7OA 1XS9A 3HGGA 1I3QJ 3BR5A 1JKPC 2YS9A 3JRFA 3OSGA 4X6AJ 3LSJA 2H8RA 3HB9A 4J19A 3NAUA 3OIOA 4CYCA 3JRDA 3CMYA 1AHDP 1JGGA 1YRNB 2ME6A 3K2AA 1OFCX 1ZR2A 2HOAA 4GFBA 2R93J 4C3IJ 1Q1VA 2NS7A 5M5YJ 2L7ZA 1CQTA 1I50J 1IDZA 5HODA 4I76A 4Y7NJ 3G1MA 5GPAA 4BY7J 2YUSA 3LNQA 4D7NA 3GTQJ 3IV5A 4XRMA 3Q0WA 1RETA 2LTPA 2NVYJ 2E2IJ 3S1QJ 1U9NA 3GBGA 1TWFJ 2HI3A 4A3KJ 1VF9A 2W48A 2MSYA 4XIDA 1JKOC 2DA1A 2M34A 1FEXA 1XG1A 3I4MJ 4JX4A 3GTKJ 1JUPA 3S2HJ 2ID3A 5IOZA 3RZOJ 2NOGA 2LD5A 1SANA 5GP9A 5IPAA 3VPRA 2MG4A 2OF7A 1MBHA 2EZKA 2LP0A 4BBRJ 3TW7A 1B72A 5FJ8J 1JJ6C 4XRSA 2HQ5A 2ELKA 4MIMA 4IHYA 5EG0A 4UUSB 3JRIA 5M3MJ 1NK2P 2JMWA 1MH4A 2QF7A 2NS8A 3HEFA 3BG9A 2LFBA 3W6VA 3GTLJ 1LE8B 5C44J 1HOMA 2Y30A 3JRCA 2IAIA 3MVPA 1RESA 2XPWA 1B8IA 3HOXJ 1GUUA 5E3NA 1GV2A 1DU0A 4FE7A 1MBFA 3CCYA 5C3EJ 5J1RA 1HDPA 2M0CA 3HKZN 1K83J 4JP0A 3MN2A 4MFDA 1T56A 4FTHA 3GTPJ 2XPUA 3BR0A 1Y1WJ 1VFCA 5IYCJ 4X1EA 1XC5A 4AYBN 1ETQA 1JUMA 2FQ4A 1MBJA 3BR6A 4MFEA 5C4XJ 2LR8A 2X6OA 3CDLA 2R5YA 4A93J 4DZPA 2CUEA 5GPCA 3ZQIA 1QVUA 1P7IA 2JA5J 3GTGJ 3WHBA 2ZB9A 4Y52J 3ZQCA 1IRZA 5EZHA 1WPKA 3SDGA 2JK3A 4IHVA 1LFBA 2EQRA 3H3VK 4M3EA 2NVXJ 1QRYA 3PO2J 1RKWA 1I6HJ 1P7JA 1TWAJ 2JA7J 1PUFA 2O8KA 4V2FA 1FTTA 4A3IJ 2JA8J 1DU6A 3FKIJ 3ZQGA 1BJZA 1POGA 5FKLA 5K7ZA 2VKVA 2LY9A 5FKKA 1RKTA 3JRHA 5E3MA 3GTMJ 3S2DJ 2XRLA 4D5CA 1IV6A 1HF0A 1JT0A 2R7ZJ 4IHWA 4B4CA 5EZGA 2JA6J 2WV1A 3JREA 3RKQA 3H0GJ 5K7HA 2WAQN 2X9DA 3JRGA 2MW8A 3G1LA 1OCTC 3E7LA 1AKHB 4M3GA 1Y1VJ 2FX0A 1JKQC 2R5YB 3Q0UA 4M3FA 1RR7A 2Y0SN 5JLWA 1ITYA 2DMQA 4BY1J 2HXIA 5DS9A 4A3FJ 1BL0A 3BTIA 5F0FA 3BR1A 2EBIA 2H1KA 5EGOA 2PMZN 2TRTA 2L7FP 1LFUP 3O8GA 4JX5A 3TP0A 4B3AA 1R9TJ 3BT9A 2R92J 4V2GA 2LVSA 5M5WJ 4FCYA 1PUFB 1WH7A 3TP3A 2DMTA 3HOWJ 2DA3A 2XSDC 1APLC 2N8GA 3HGYA 3C2BA 2MGQA 1D5YA 4A3MJ 1S7EA 4CYCB 1W0UA 1U8BA 4C3HJ 3A03A 5EF6A 2LKXA 2EZIA 1NTCA 2K9QA 1FIAA 2E2HJ 3BTCA 1GT0C 1MNMC 4XK4A 2TCTA 4BBSJ 3BQYA 1QPIA 2JN6A 3LOCA 3LSGA 4A3GJ 3IH3A 3QPLA 2XB0X 3UKGA 3FIWA 2K9SA 1ZR4A 4UUTA 1IGNA 3F0CA 3D1NI 3LSPA 2EZLA 2R5ZA 4W1UA 2HDDA 4S0HB 2FJ1A 4A3CJ 5EYRA 1X58A 5FLVA 3MKLA 5C4JJ 2DA2A 4MO7A 2B63J 2DMNA 1H8AC 5F04A 2COBA 2DA7A 2KT0A 1TWCJ 4D7MA 2LLKA 1ZK8A 2L9RA 4A3EJ 3S15J 3HM5A 2R0QC 2I10A 2DTZA 5EDNA 5F08A 2GLOA 3GTOJ 1H88C 1OJLA 1BW5A 3GTJJ 1UMQA 3QQAA 2GBYA 3SFIA 3FK7A 5IYBJ 1MSEC 4HNVA 2XGCA 3HDDA 3M3YJ 4QIWN 2Y2ZA 2JWTA 5F0HA 2XB5A 1F36A 1WI3A 1T33A 1IDYA 2IEKA 3PM1A 2CRGA 2LK2A 1B72B 1YRNA 3S1MJ 2DMPA 1SFOJ 1A5JA 3Q3SA 1OCPA 2E2JJ 5EG0B 4A69C 5F27A 1HLVA 2E1OA 3OOUA 1ZTRA 3JR9A 4I6ZA 4C3JJ 2XGEA 1GV5A 5BNGA 2CQXA 3HOVJ 2R5ZB 2ECBA 4D5FA 1TC3C 1B8IB 2GM4A 2VKEA 3S1NJ 2M9HA 3BR3A 3BG5A 4M3DA 2RAEA 3SJMA 3JRAA 3NARA 5E3LA 1JTXA 4DW6A 1JKRC 3K7AJ 3S17J 2HYJA 4M3BA 2ME0A 2DMUA 1VI0A 1MSFC 4QTRA 5J1UA 3I4NJ 1AU7A 1X2NA 1ZGWA 3ZQFA 5E3OA 2DJNA 4A3JJ 4ABZA 3HBLA 4QSHA 4B1RA 2HOSA 1ETKA 4XICA 1WH5A 2XPVA 4FISA 2XGDA 1WCMJ 2HXOA 3M4OJ 1ZQ3P 3RZDJ 1IG7A 4UUSA 4A3BJ 2DA6A 3A01A 5K7FA 4BKXA 1RPWA 2L0KA 2ECCA 2M2EA 1MH3A 3IH2A 4C2MJ 5FKOA 4A3DJ 1LE8A 1BA5A 2IBDA 4G12A 1MBEA 3QPSA 5FKNA 3OSFA 3DCFA 1W0TA 4DYQA 4JYKA 5FLMJ 2K9NA 2K40A 3BQZA 4L5EA 1H89C 3HOZJ 5F0CA 3TW6A 1X2MA 2AHQA 3L1PA 2CU7A 1JUSA 1K61A 5J1YA 4DYCA 4IEJA 2WB1N 2D5VA 4RDUA 2VUMJ 1ETWA 3Q0VA 1TWGJ 4MLOA 1ETOA 5M5XJ 4DZJA 3BR2A 2QCOA 3A02A 5EGOB 4AUXA 2P81A 3S1RJ 1VNDA 5IP6A 2YU9J 3O8HA 1HCRA 2DA5A 3ZQHA 3JRBA 3G1OA 3S14J 1O4XA 1FIPA 2FD5A 5JLXA 3A01B 1U78A 2Y31A 2JJ7A 1GVDA 1MBKA 1JT6A 9ANTA 1IUFA 3DEWA
chains in the Genus database with same CATH superfamily
2P5LC 3CP2A 4M6VA 2K9LA 2AXTC 2NNYA 2QVOA 5IOYA 3R60A 1U2WA 4ESJA 1WGXA 4LITA 1LUJB 2WY7Q 2ZJRF 4M9XA 1GDTA 3BDDA 3KEOA 1SMTA 1XMAA 1FSEA 2K27A 3EUAA 2NRAC 3WTYC 5FLXZ 4RGRA 1UCRA 1A6IA 3E5UA 4EJUA 2NVTJ 1STZA 4NUBA 3HKZA 5CVIA 1FJLA 3FK6A 3B6AA 2CFXA 3HSRA 1K4SA 2L7MP 3IKVA 3W2WA 1BOBA 3E6MA 3E0JB 3FXRA 4P9FA 2FRHA 1JJ8C 5K5RA 5IYDJ 1YX5A 3PNTA 2E1CA 2EZHA 2ESNA 5BOXA 3BG3A 2DOFA 4MTEA 4HQEA 3CO6C 2FMLA 3RJPA 2E1MC 4WF2A 1KYWA 1JTYA 1ETYA 2RDPA 1BN5A 4P9UA 1PP8F 1ENHA 3FISA 2V9PA 3K4CA 2ID6A 3QOPA 2FF4A 3FZVA 4O6JA 5CQGA 2UWMA 1ZKGA 1A36A 2O9LA 2IRFG 2KDZA 3CDHA 2I8DA 1I5ZA 1SVMA 2OPTA 5DM7F 3FXLA 1NG6A 3K9TA 4IVNA 2J5OA 3QOEA 3TEDA 1IN4A 2LNBA 1E3OC 2D1VA 4XLEA 3CJNA 2ZKZA 3OSGA 4X6AJ 5GAEJ 2LBFA 2B0LA 3U2RA 4GO1A 1OCOH 3HB9A 4HG2A 3E97A 3OIOA 3FXMA 1W1WE 2ZBKA 4RS8A 5E8GA 2L54A 1YOVB 3VDXA 1JE8A 2R7UA 4GFBA 3H3UA 5KAFC 2LY1A 5M5YJ 3CD6I 1NH3A 1P4XA 3LMMA 1HW5A 2CG4A 3CC7I 4M6XA 3R4KA 4XLPF 1U5TC 3OS0A 1K6OA 4KIFA 5EEGA 3IV5A 4ENMA 4UNOA 2EFPA 3CDIA 2DI3A 1Z7UA 3SFZA 3GXOA 4ZTFA 3VEPA 1FOKA 5AIQA 1MMSA 2X6XA 2FA5A 5AIPA 2HI3A 3DEUA 1VF9A 1JHHA 3CC2I 4X0GA 2M87A 2FOKA 4RM3A 5CVVA 2EFQA 4FASD 1D5VA 3IUOA 1XG1A 1JUPA 3C3WA 2Y48A 2LBFB 1ZREA 3IC7A 2L02A 3S8PA 3OIQA 2NS0A 1HW2A 5FGMA 1A04A 1R4MB 4L9NA 3PQJA 1IN6A 4ZYEA 5CJ9A 1S5LC 3CF5F 3TL4X 2JVHA 5LRRA 3TW7A 3DBRB 5JR3A 3DKXA 1DPRA 5D5VB 3ONQA 1P9QC 3ML6A 4IO9F 4HW0A 3W6JB 2JA2A 3SEQA 3LL7A 2IS1A 1XD7A 1MH4A 2AS5F 2K3PA 3HEFA 5C44J 2K86A 3JAMZ 1HOMA 2IAIA 2BXZA 2DFFA 3QU6A 2DDBA 5B1BH 1XGNA 3PNVA 1GUUA 2H94A 5E3NA 1MIJA 4FE7A 1KU7A 2A6EF 1R36A 2FQ3A 1FOYA 5J1RA 5C3EJ 3VSKA 2P6SA 1T08B 3PSIA 4JP0A 2CSOA 3MN2A 4ZDLA 4AWXB 2DXIA 3GCMA 3K4JA 4EM2A 1R49A 1XSDA 1BR1A 3TQNA 2M45A 2LF8A 1ON1A 3L09A 4ENKA 1DGRM 4X1EA 2DW4A 2DK5A 5HS8A 2KRFA 3K70C 1JUMA 2FQ4A 3BR6A 1XGMA 3FMQA 4MFEA 5EEHA 2VKHA 3RI4A 1SD4A 4DZPA 2CUEA 3F3XA 1ULYA 3ZQIA 2JA5J 1P4WA 3WTTC 2HFHA 3L9FA 2Z9OA 2V1NA 4RMNA 1FYKA 3GFMA 4R1HA 3SZTA 2BHYA 4Y52J 3ULQB 1FP1D 2MABA 3OS1A 3T5XA 2UXNA 3H3VK 2HS5A 3ISPA 1X3ZB 4M3EA 2NVXJ 1RKWA 1TWAJ 3RCOA 2JA7J 3KYDB 4MNUA 1PUFA 1V3FA 3FBIB 3CLQA 2CWEA 1IUYA 3VB2A 3JCUC 2JA8J 3FKIJ 2W00A 4Y3OA 1BJZA 2XAFA 1FT9A 2DT5A 1UHWA 2QWWA 5E79C 2EK5A 5FKLA 5K7ZA 2HTJA 4HDVA 2XKOA 5KVRA 5FKKA 1FNNA 1N75A 3CO7C 1T38A 4RM2A 3G6EI 2M7BA 1JHFA 3A0BC 3BOQA 4L9VA 1HF0A 4NNJA 2IGOA 5DCFA 3OWTA 1BI0A 3D0SA 2VOOA 1R23A 4ZH4F 3BZKA 2HKXA 4HX4A 3H92A 4A6DA 3COAC 4GRIA 2WAQN 3JRGA 2MW8A 3G1LA 5LFAA 2OJED 3K4KA 4G7HF 1JXSA 1T98A 2JUCA 1KZHA 4ANJA 1YO5C 2LF7A 1FC3A 5JLWA 4I01A 2DMQA 2Y75A 5DDGA 4BY1J 1VQKI 4GXOA 4WXDA 3T8RA 1WJFA 4H4KC 2IGKA 3ZXSA 1RRJA 2L7FP 1K79A 3O8GA 1I1GA 3CMAI 3W2AA 2R92J 1TQIA 2LVSA 4FCYA 1PUFB 1XTAA 3TP3A 3HOWJ 4MHGA 3E5QA 2DBBA 3LSHA 4OU0A 3WODF 1APLC 3SZGA 2N8GA 2QYOA 3C2BA 2RVCA 4IOAF 3FX3A 5J4YA 5DEQA 2Z99A 1U8BA 4C3HJ 4XQFA 2W1OA 1SFXA 1J59A 3PFYA 2EZIA 4HYEA 3UNGC 3TOAA 3UR3C 3ECOA 4I0AA 4XK4A 2GOMA 4BBSJ 3MKZA 1O57A 1BIAA 4BXFA 1WJEA 3LOCA 4A3GJ 2VBZA 1X1AA 3O3KA 1LVKA 3DPLC 1D1CA 4BNCA 2XAQA 2DO7A 3AG4H 1USTA 4FT8A 1ZR4A 2VLAA 2YX7A 1CF7A 3HHGA 2XSJC 3RIRA 2ZXWH 4DNCA 4L0YB 2QSFX 2KMUA 4XOPA 4CXFA 4MO7A 2TDXA 1GHCA 1P2FA 4RB2C 2PN6A 2DA7A 2XC7A 4G8XA 2PQ8A 2L2OA 3ZN1A 3HRTA 1YS7A 3CUQB 2H8WA 4A3EJ 1YQAA 4Y17A 4NQWB 4YFNF 2DTZA 5EDNA 3GTOJ 2J5PA 2X1DA 5D8LB 3P9KA 2P7CB 3QQAA 1K7AA 4I02A 1O3SA 3CCQI 3QRFF 5IYBJ 2LY2A 2FNPA 3HDDA 1E17A 1Z21A 2L4AA 1OQYA 5JFRA 2HQRA 3KLOA 1FWZA 2P7VB 1P4AA 3OYMA 1WI3A 5JHFA 1QZYA 2BZTA 1B72B 1YRNA 2G9WA 5D5XB 4S04A 3TKYA 2QM3A 4L18B 4EJVA 4BJ5C 4A69C 2EPFA 2PMUA 1VQPI 2E60A 1HLVA 1WJBA 3OOUA 2XGEA 5ERIA 3VSLA 2P8TA 5LRSA 2ISYA 4IXAA 2FBIA 3M9AA 2FE3A 3LQRA 1S7OA 1TC3C 2Z3YA 1WRJA 3KYCB 2OC6A 4M3DA 3BG5A 2MLKA 2HGCA 2RAEA 5E3LA 5CLSA 2V7FA 5IT3A 4BQNA 3E6BA 2HTSA 1X1PA 1F1ZA 2JSCA 3QYFA 5E20A 1JKRC 1HBXG 3DU6A 2QSHX 1QBJA 3S17J 2HYJA 4M3BA 4OIOF 2VPLA 1SVLA 1FX7A 2DMUA 4XNFA 1IN8A 3CMEI 3EYIA 4E7JA 3SQNA 3ZQFA 5E3OA 3FF5A 3CCLI 4A3JJ 3FXUA 3H9GA 3HBLA 4IPAA 2CW8A 1BI2A 3ABLH 4LG0A 4ETSA 1YTYA 1SEUA 3QYBA 3KZYA 1TP4A 1HSJA 4R8HA 2XPVA 3ERED 3BJAA 3CCJI 3C2GA 1BC7C 1ODDA 1TW2A 3WGHA 3CJTB 3DF8A 3OR1C 1DP3A 1H0MA 3KP5A 1O3QA 4UHTA 2VIXA 1OMIA 1RPWA 1X1CA 2ECCA 1ZAOA 4L5IA 4E7IA 1MBEA 4E70A 4NC8A 1YJ9I 2HQAA 1J7KA 1YX3A 1ZLJA 2K9NA 3DKWA 3I59A 3Q9VA 4IL6C 2WC2A 4WWCA 1VQLI 4S05A 2Z2SB 5F0CA 4IHTA 2AHQA 4XR6A 3ZMTA 1X4OA 4ASNA 2CU7A 1JUSA 2XAGA 5J1YA 1YJNI 2WB1A 4PZJA 2KRHA 3J80K 2QSGX 4DYCA 2EV6A 4ON0A 4FX0A 1Y0NA 1CGPA 2BY1A 1ZRCA 1TWGJ 4MLOA 3G2BA 1ERDA 3A1YA 2K7LA 3BR2A 3FXOA 4E6KG 2Z33A 2FUG2 5F1RA 2B7EA 1ACIA 2YU9J 4XN3A 2M0MA 3HTUA 3VFZA 5HLIA 5DM6F 3G1OA 5HDNA 4ZYGA 1R4NB 2GA1A 4I0BA 1R5HA 3K1PA 3JSPA 1GVDA 3N05A 1IUFA 3GF2A 4KT6A 3DBHB 2HKOA 4B47A 1IAWA 2AO9A 1SD6A 4HNTA 2HVSA 3I59B 5E8IA 2BVMA 1B9NA 2F5VA 1G6NA 3DPTA 3J81Z 2DN0A 4MQVA 3C1DA 3HOYJ 2DQRA 3W3CA 5DD4A 1N77A 1NHAA 4FE4A 1XGOA 4IHXA 1FYLA 2HOEA 2DJIA 3ZOBA 4AVZA 4A5NA 3CQZJ 4JQFA 2EJRA 1AKHA 3LSRA 2R7XA 2MC4A 1QVTA 4AC0A 5DTDA 1Z3XA 1FSHA 2WWYA 1EF4A 2RREA 5F1JA 4M74A 1Z0XA 1ZRDA 2V9VA 2KIQA 2CV1A 3MAJA 4ITVA 3WHCA 5ICFA 2KISA 5FFZA 3ZMZA 2PBIA 1REPC 1HDDC 4PK4A 2QBYA 4EGYA 2F6CA 1FTZA 1P92A 1MGTA 1QU3A 1HQCA 4IOCF 4M9SA 2W85A 3OYKA 4A3LJ 1U9OA 1Z77A 1O3RA 1I3QJ 1JKPC 2DAOA 4GGGA 4II2A 1PUEE 3LSJA 4J19A 1LNWA 2ZFWA 2ZNZA 3NAUA 3JRDA 4H0EA 1JGGA 5HDGA 4IF4A 2LRDA 3S2WA 4ZZDA 1OFCX 4HV5A 1OISA 5J4VA 2OD5A 2WAQA 1CQTA 1F5TA 2QQBA 4BGDA 3SXYA 2NYXA 1N78A 1IDZA 5HODA 3PQKA 2OAZA 4I76A 4II3A 4IQJA 4KNYA 3G1MA 1VQ9I 1BI3A 4LB6B 3A0HC 4XRMA 2CFOA 3PIPF 4KMFA 2L5QA 2EILH 4BACA 1ZN2A 3KZIC 1R00A 2IJLA 3X2QH 3CTAA 3GBGA 1C0WA 3OR2C 4HX8A 2VBXA 4A0YA 3L2WA 3RDIA 1ZGAA 3KEQA 5J8FA 2FBKA 4ESBA 2W48A 2STTA 1IXCA 3WG7H 2M7AA 2KP6A 2M34A 1FEXA 4RAFA 3S32A 1AWCA 1RUOA 2E7XA 2CQ7A 3H36A 3GTKJ 3S2HJ 2ID3A 3R6SA 2HQNA 3NEUA 4XN0A 2DYSH 1R1TA 1SANA 3K2ZA 2MG4A 1O3TA 1A31A 4M71A 1EJ9A 2OF7A 2HVQA 2EZKA 3H35A 2A6TA 2EA4A 1EH7A 2IXSA 2V6CA 3W2VA 4BBRJ 2W25A 2QQ9A 1JJ6C 2VN2A 2HQ5A 4BJTA 1GXQA 3T0YA 2ELKA 4IHYA 2JRTA 5EG0A 4UUSB 3S3OA 2DT6A 5J8CA 2E34A 1K4TA 3FWEA 5D6FA 2QF7A 3GFIA 2ZNYA 3I58A 2O8XA 3W6VA 3GTLJ 4XM3A 1YFHA 1LE8B 3QP6A 2VBYA 5TISC 4V19K 1OCRH 1RESA 5JI6A 3DEEA 4I09A 4FX4A 1V4RA 3FHNA 4G9YA 1MNEA 1GV2A 1DU0A 3HUGB 4AIDA 3QAHA 2DPDA 2F4IA 4BS9A 3RQ4A 2M0CA 2EFOA 2JRMA 4PJLA 4BEHB 2A05A 4KDPA 1TZLA 1K83J 3CESA 3D5SC 3IAS2 1MDMA 3BR0A 4KN7X 1EKEA 3BG7A 1VFCA 2OTJI 3OYJA 3FMSA 1WJCA 2UUZA 4AYBN 1IN7A 1MBJA 1QO0D 5HLGA 1UB9A 2QEXI 3V4GA 3OYAA 3V7RA 4U7DA 3GFJA 5L3BA 3KP6A 2PEXA 1IZ1A 3H5NA 4YRVA 3WHBA 4LB5A 1DUXC 1WPKA 3SDGA 4Z6YA 4IHVA 1LFBA 3CJQB 4DBQA 1QRYA 4PJJA 3BP8A 3DWLE 2O8KA 1D1BA 1FTTA 3DTKA 1LFPA 3GW2A 1FYMA 3ZQGA 1RUNA 4L0ZB 1IN5A 3KP2A 2VKVA 1YYVA 1R1UA 5ICCA 3JRHA 2VXDA 3F9KA 4RB1A 3ZQQA 3GTMJ 2PMHA 4IHWA 4B4CA 1RZ4A 2WV1A 3J7ZI 1MDMB 3MWMA 3RKQA 4LK1F 3H0GJ 3V8KA 3WTVC 1Q1HA 2X9DA 3LSIA 2BY2A 3L2RA 3GLLA 2JVGA 5E1XA 2LC2A 1D8JA 2K5CA 4HRIA 1JKQC 1LJ9A 3L7WA 3Q0UA 4HAMA 1RR7A 2Y0SN 3DLAA 1ITYA 1N25A 3ZMVA 5DS9A 4A3FJ 4JOMA 2XAJA 2FMYA 5D6EA 1D0XA 2CUZA 3NQOA 3KCCA 2V4JC 3K4LA 4PFOA 1U5TA 5HLHA 2H1KA 2K02A 2PMZN 1Y39A 4L5JA 4HF1A 4JX5A 4B3AA 1XCVA 2E1MB 1EA3A 3ESWB 3ZCOA 3M8FA 2DYRH 4R79A 2DA3A 4BQAA 1Y8RB 2O61A 2XSDC 2HYGD 3L2QA 2W4SA 2K4BA 4BJ6C 3PSFA 3I3LA 4GCVA 2MD5A 4A3MJ 1S7EA 3FKJA 2XAHA 4EM0B 2VQHA 2F5EA 3TGNA 5EF6A 2DLLA 1NTCA 2K9QA 2LDUA 1VQ4I 1FIAA 3P5JA 3WU2C 2CQNA 4CUGA 1GT0C 2DPUA 3QPHA 2XROA 3ABKH 3RYPA 1V5EA 3BPVA 3LSGA 3TO9A 2C6YA 3IH3A 3REOA 4PGHA 2PI0A 5ICEA 2K9SA 2LKSA 2HDWA 2X6YA 4MGRA 3SEZA 1UHMA 1S29A 4UV8A 3AKZA 3D1NI 3K4BA 3LSPA 4W1UA 2VJJA 4S0HB 1FY7A 3TO7A 1I27A 4HQMA 1X4PA 4BE0A 1X1DA 2DMNA 4KN4X 2COBA 2DODA 3S15J 3HM5A 4PUSA 1E0EA 2I10A 2IT0A 1EV7A 1H88C 1S9HA 1ZGJA 1OJLA 1TT0A 1BIBA 2E36A 2GBYA 4IZZA 2O03A 5GTIC 3FK7A 3KETA 1MSEC 3WGGA 4HNVA 2XGCA 3OV8A 2HZTA 1R5GA 3M3YJ 3L00A 4CSWA 2UXXA 3OIPA 5ED4A 2H27A 1BM9A 3QWLA 3HSFA 5F0HA 4BHPA 2PJRA 3F8BA 2XB5A 3R0JA 1T33A 1IDYA 2IEKA 4B48A 2X85A 2LK2A 2F5DA 4EMSA 4CCKA 1VQOI 3DLLF 2O5RA 1SFOJ 1OCPA 4J00A 1J2XA 2BV6A 4NBQA 4C2UA 3BZCA 4O3MA 2DTRA 2JZYA 1YS6A 5IY5H 4I6ZA 4C3JJ 1BR2A 2H09A 3EUHC 4XMYA 2PX9A 3HOVJ 5ILVA 1MJ9A 1KQ9A 1T0FC 2GIZA 3H1CA 3MMYB 5LLQA 3GWZA 2VKEA 4UVBA 3LSMA 1IF1A 4E4HA 3ZP5A 3BR3A 4AD9A 2EV0A 3AG1H 4M73A 2CW0F 1SFKA 2K3FA 4DW6A 2OV7A 2XF7A 2QUFA 3FXKA 4Y15A 5GTHC 4ENJA 3AL0B 4NHJA 1S7AA 4IJAA 1BOAA 2R7QA 3P7NA 4F92B 1KGSA 3W6KB 1UFMA 3HRSA 1D0ZA 2ZSIB 3LA2A 2MH2A 2ZJQF 1VI0A 1WQ2A 1MSFC 5J1UA 2P5KA 3I4NJ 1X2NA 1ZGWA 5L3DA 1S6LA 2NXNB 1LEAA 2EWNA 2DJNA 4ABZA 2WY8Q 1A35A 4AIJA 3FXJA 3F22A 4B1RA 2HOSA 3M8EA 1XSXA 5LHIA 3E6CC 1WH5A 1WSUA 3E1SA 1VQ7I 2IS4A 4UVAA 1WCMJ 2PJPA 3M4OJ 1G3YA 4F52A 4F3QA 2FU4A 2MC3A 2W84A 4ZYHA 2V79A 3QU3A 5FRNA 4FETA 3DKYA 4CA0A 2V6EA 2OQRA 2M2EA 1MH3A 2MH9A 3Q5FA 3GZNB 5FKOA 4A3DJ 3WG9A 3C2HA 1T6SA 3CUQC 4G12A 1Z7LA 2ETHA 3OSFA 3I56I 3DCFA 1QNTA 2EV5A 3GYHX 2R7WA 4DYQA 2A07F 4XLFA 1JI8A 4D1QA 2M30A 3E5XA 3V8JA 2D2WA 3KEYA 2K40A 3OMYA 2M4KA 3WTWC 3SYTA 2Q2EA 3TDZC 3HOZJ 4IRGA 3L1PA 2LREA 3M8JA 4G6DA 4JK1X 3KFWX 2F5CA 3DP7A 3M07A 3IL2A 5H20A 1T39A 1K61A 3RPUA 3F8NA 4E7KA 4IEJA 5E18F 2IGNA 1YIJI 1W7PA 5B1AH 2KHMA 4LFUA 4IRHA 3HOSA 3DTIA 5L3CA 5EJCA 5M5XJ 4DZJA 2XAUA 1OR7C 2IS2A 4AIKA 4A12A 4OMYA 2MA3A 2XGXA 3S1RJ 3D5RC 1T2KA 3AFHA 3O8HA 4KMUX 1ZG5A 1HCRA 5DCMA 2QLZA 1OCCH 2DOAA 4CZCA 3J81K 1PJRA 1XB4A 3IWFA 1FIPA 1YW7A 3MQ0A 5JLXA 2LOOA 4LLNA 5BPDA 1U78A 2Y31A 2CS3A 3RKWA 1MBKA 2CO5A 1JT6A 2X1EA 9ANTA 1O7LA 1FMWA 1O7FA 1Z91A 3DEWA 4XL9A 5TJJA 1ZG1A 3ABUA 5B66C 1MBGA 4CO8A 2HOTA 4UXNA 2M8GX 4LOCA 2BEOA 1TT5B 4CCMA 1QA6A 4BXXJ 4UB6C 2M3AA 3RYRA 2ZXIA 1SFEA 2Q2EB 2NVUB 1IC8A 3CF2A 4AM3A 4BU2A 2QGUA 1UG2A 4E7SA 3B02A 1KA8A 4I7HA 1LB2A 5LHHA 3S16J 2CUFA 1W7PB 3F6OA 2ZFUA 1DP7P 2VXZA 2CQQA 4EGZA 1NK3P 3BTJA 1FZPB 1CF7B 5KAIC 4HF2A 5KK1A 4EEFG 1BW6A 1ORKA 1ETVA 1ETXA 2FSWA 3MD2A 4KICA 4XLHA 3KP3A 5FROA 4HA8A 4F91B 3ASNH 3U21A 1UELB 2G0EA 3I55I 1R58A 5L3FA 1G3TA 5LEJA 5FO5A 5FFXA 3B6CA 1IJWC 1XMXA 1Y6IA 2IA0A 4E7LA 4LD5A 2VKDA 1MMNA 3GZ5A 4OWRB 3S3MA 1PP7U 3BTLA 2CJJA 3DPUA 4U0VA 2VPRA 5J6XA 1X3WB 5J3LA 3IH4A 2XUBA 4IKFA 2VI6A 1UHSA 2F4MB 1IV8A 1AOYA 4F55A 2O7OA 1XSVA 1XS9A 3HGGA 2V1XA 2ZXJA 4PCQA 2OZ6A 3ZGKA 5TRDA 2H8RA 4CYCA 3CMYA 1AHDP 1YRNB 2ME6A 3T8TA 3P9IA 3M7GA 2HOAA 2R93J 2DFEA 3U1KA 1X3UA 4HBLA 1Q1VA 4U0WA 4XRFA 5CVRA 4YFXF 2A5WA 2OQGA 1IRFA 4KJZA 3IRQA 2LSOA 3NRVA 2KRCA 4PFPA 4M9ZA 3GMEA 5GADJ 4Y7NJ 5GPAA 4BY7J 3LAJA 2K4JA 4YIIA 2Y0SA 4D7NA 3LNQA 3CCMI 3N4MA 3FM3A 3JSOA 1IRGA 1GVJA 2Z1DA 1D1AA 3LA3A 3Q0WA 1XPXA 1UG0A 3S93A 5HVQC 1K6YA 1FLIA 2E2IJ 2MYSA 3S1QJ 1U9NA 1K78A 3FXQA 2WAEA 3FBNB 2HWVA 3MZYA 2IS6A 3BCBA 4XKWA 1FBUA 3RTRA 2MSYA 4XIDA 1L3LA 2GZWA 2K85A 4C9YA 1WVRA 2E35A 4Y4RA 2ELHA 2QZ8A 1FMVA 3DQVC 4JX4A 5L3EA 2P0WA 2COMA 2KZVA 5B3SH 3T1BA 3N97A 2JPCA 1M1EB 5GP9A 4HZFA 1Z3YA 4LG0B 3OYDA 4Z2YA 4F7ZA 1XMKA 1TQPA 1LPQA 3LSTA 1W36D 2DU9A 3QYEA 4BQOA 2LP0A 3WTSC 3B73A 4YFKF 2IW5A 4XRSA 1W4MA 3BWGA 3CCVI 4MIMA 1KONA 1TQMA 2K9MA 3DTEA 2ZMEC 1D8KA 1HKQA 1PYVA 1NK2P 3SZPA 2DFHA 2NS8A 4G6TB 4G6QA 5LBQA 2Y30A 3H9JA 3JRCA 4P96A 2XPWA 3O2PE 1B8IA 3HOXJ 2YU3A 4HV6A 4OINF 3QPTA 3HC7A 2AQFA 5KHDA 1MBFA 4BAYA 3CCYA 4C2TA 4N4NB 3CZ6A 1HDPA 3ZMSA 5D4SA 5ILSA 3AG2H 2BVLA 1ONVA 2BXYA 1XCBA 3WTXC 2OU2A 3DV8A 1T56A 3GTPJ 1AA7A 4D9JA 2KPMA 4MTDA 1OCZH 4KUMA 3K1NA 2PG4A 5C4XJ 4KIGA 2JQ7A 2WAFA 2Q8KA 5GPCA 1KQ0A 3HPGA 1S3JA 2JSPA 4NC6A 1QVUA 1P7IA 4U88A 2R7VA 3GEZA 1BBYA 2VT3A 5E1WA 3U9GA 2O6GE 4DQ2A 2ZB9A 4P55A 3ZQCA 1IRZA 2Y0MA 5EZHA 4EQQA 1E3PA 2X6WA 4RAZA 2JK3A 4UVCA 2EQRA 3H5AA 4LG3A 1RNLA 2ADUA 4AU7A 4YIFA 1P7JA 1R22A 4OAYA 3MEXA 4EJOA 2W7NA 3H0DA 3E3VA 2V9KA 1TBXA 4U7BA 4A3IJ 4HEA2 2B9SA 2BHZA 1MMAA 1E3HA 3R0AA 5HDKA 2ZJ2A 3PL8A 2A3SA 3GUDA 1JGSA 2LY9A 4P1WA 1VQMI 1X19A 5FB2A 3RKYA 1Y56A 1IV6A 2EFWA 2OBPA 2R7ZJ 5F6FA 3JREA 1PDNC 2X4HA 3ZRGA 4A5MA 1J9IA 2R7OA 2Z5UA 2AXLA 3HXLA 1B4AA 4I98B 3HSEA 4LLLA 4FHTA 4QWQA 2BY3A 2GIVA 3HZJA 1AKHB 2DDAA 2OCCH 4M3GA 4LIUA 1HSTA 4M3FA 2R7FA 2M1BA 4PSWA 2HXIA 3G71I 1BL0A 5B5EC 1HC8A 3BTIA 2HVRA 2FNAA 5F0FA 3FHZA 3OYLA 2QQAA 5EGOA 2HPMA 3QP5A 1OKRA 1LFUP 3TP0A 3M1EA 1SVOA 1BC8C 1VQ8I 5JVTA 2QBYB 3CCRI 1OYWA 2DQLA 1OYYA 3OS2A 2NNNA 3S3NA 5ICGA 1WH7A 4Q48A 3CC4I 1DPUA 2IVMA 3BJOA 5AONA 4G94A 3WGIA 4QPOA 4BH9A 1H9GA 2LKPA 1Z1DA 5F64A 3HGYA 4KIBA 3NWTA 2PFBA 3GO5A 1VQ5I 2DT7B 2F5FA 4XSXF 4OMZA 5TGTA 1W0UA 2L3DA 3RKXA 2RKHA 2AQEA 3A03A 1U0JA 2ZSHB 2LKXA 5HOOA 1MNMC 2CGPA 2TCTA 4EJWA 3BQYA 1QPIA 2JN6A 4OOIA 2ICWG 3FMRA 2R7TA 2VASA 2VT2A 3UKGA 1I3AA 3GX4X 5IT9Z 4UUTA 4WXHA 5BMZA 1IGNA 2H6CA 2X51A 4Q4ZF 2GAUA 2R5ZA 2HDDA 4CCOA 2FJ1A 4A3CJ 1X58A 4KFCA 4RA2A 3I53A 3MKLA 2DA2A 3D5LA 5F04A 1Z05A 3G73A 4ZTJA 4MEXF 1TWCJ 2RV8A 2QENA 1R7JA 3L2VA 3CJRB 1WJDA 5F08A 2GLOA 2W57A 4XLAA 1BW5A 5HNHA 2EFNA 3GLXA 2V1DA 4IQ4A 3SFIA 4YEJA 5LEKA 1WJAA 4OIPF 2LMDA 2W82A 2JWTA 3GFLA 4Y33A 3MZ8A 1PVEA 6PAXA 4DJAA 2XRNA 1YHQI 1LKXA 2CRGA 1HXDA 1YG2A 5J47A 4NB5A 1ZYRF 2DMPA 3CP8A 5JVGF 3S1MJ 1A5JA 2XF5A 1J75A 3LAPA 4N9HA 2F4OB 2YPRA 3EETA 2Q1ZB 5HS9A 5ILUA 5EG0B 3J7AO 4KITB 1ZTRA 2CV2A 1GV5A 1OYIA 2DOEA 5BNGA 3JTGA 4N4OB 2ECBA 3OYCA 2R5ZB 2GXBA 4A6EA 2JT1A 1XN7A 2YR2A 4B43A 4ENNA 1E2XA 2L9VA 1OPCA 1QPMA 3HG9A 4BQQA 3S1NJ 5JHUA 3H9QA 3NARA 2JTVA 2HNHA 2VB6A 2XHKA 3PFIA 2CV0A 4E7ZA 2VC1A 1B9MA 3IKTA 4AIHA 2HPIA 2EINH 1SAUA 3WU0A 2VC0A 4RGSA 2UV1A 4D0PA 3BLYA 3TBIA 1KYZA 4QTRA 1QZEA 3JW4A 2P5VA 4ZZLA 3K4MA 1MD0A 2ISZA 2ESHA 3VODA 3OYHA 2L9SA 3C7JA 2CW7A 4FISA 4GYIA 4IX7A 4OIRF 3I9V2 2HR3A 2XGDA 2IGMA 2OTLI 4XKBA 1ZQ3P 1SFUA 2L4MA 1IG7A 5HNFA 2EB7A 2GA2A 2QKMB 2E5ZA 4A3BJ 2DA6A 5K1YA 3A01A 4EVIA 4ESFA 5J40A 2L9NA 2Q0OA 2L0KA 4RGUA 3IH2A 3DXJF 4WX9A 3LA7A 2IBDA 1R1VA 1LDKB 3QPSA 5FKNA 1H9TA 2H1LA 1D0YA 3V42A 4RAGA 3K4NA 4ZDPA 3A2KA 2H6BA 5FLMJ 2YX4A 1R5ID 2L01A 3FDYA 2IA1A 1F9NA 1X2MA 2V26A 1XDSA 2CMPA 2ZO4A 4BE1A 4N9IA 1BJAA 2WB1N 1SAXA 2KLOA 2RQPA 3I0TA 2D5VA 3KE2A 2VUMJ 5CQEA 2JUGA 3CCEI 4KT5C 1WZ2A 3G4SI 4O5VA 2OZUA 5KCMA 3GVAA 1ETOA 2P4WA 5D5WB 1FPQA 1KU2A 4UB8C 4CCLA 1U5TB 2QCOA 4AUXA 3BC8A 3F6VA 5IP6A 3OL3A 1QGPA 1A6QA 1J09A 3JRBA 3OYEA 2VE9A 2CQKA 3S14J 4HSRA 3AAFA 2FD5A 4PJ0C 3DFGA 3A01B 2VJIA 4XOTA 5K5OA 2JJ7A 2CUJA 4XSZF 4LJZF 4NDLA 3V7CA 1BI1A 2E19A 1V55H 5IP7J 3R61A 2EA2A 3F72A 3AL0C 2WV0A 4G7OF 2Y9YA 5DUIA 1FP2A 1EH6A 4NC7A 1TL8A 5E17F 5LD2C 5A2QZ 3HHHA 4A2UA 2EH3A 4C30A 2Y9ZA 4RBOA 2BW3A 2NVQJ 3HRMA 3PJRA 4RGXA 3OY9A 1WJ5A 1MKMA 1HKTA 1RIOH 4QPQA 4EV0A 4WK8F 4XRSG 1YW8A 1TNTA 5DD8A 3VYUB 1LQ1A 1W5CC 3HOUJ 1FBQA 3RQIA 1G2HA 1J0RA 2OCEA 1YW9A 3OOPA 1YJWI 2QQ8A 1ON2A 4N0BA 3HL2A 4DYRA 3WTUC 2JPBA 4RB0A 1TWHJ 5FKMA 3CLOA 3JTHA 3TOBA 2ELJA 4E7HA 4ZDOA 1F43A 1IXRC 1ZLKA 2X48A 4L9JA 3C18A 1W5SA 2DA4A 3EUHA 3PNYA 4XLCA 3F8MA 3PO3J 1B59A 1T0FA 5EEAA 3J7AY 2WA0A 1RC9A 2V1UA 5IP9J 3PUBA 2L7KA 5M3FJ 1WKMA 2VL8A 4W97A 2FXAA 3ZQLA 4JX6A 2X1CA 2VQLA 2BGCA 3BR5A 3HTSB 2PJRB 1NG7A 2M8EA 2YS9A 3JRFA 5D5UB 2VONA 3I4PA 4XONA 2BW3B 3K2AA 4YIRX 1ZR2A 2XVCA 2WADA 4PJMA 1RI7A 4C3IJ 5H2FC 2NS7A 2L7ZA 1MZBA 1I50J 3TO6A 4RLQA 1SMYF 1X1BA 2YUSA 3EDPA 3F8CA 3GTQJ 5DUKA 3VYTB 1RETA 2LTPA 2NVYJ 1ZELA 2GXAA 2FEZA 2OUMA 4CICA 2QA4I 4HDUA 1TWFJ 1G59A 3BCAA 4BHBA 3FM5A 5CKTA 4A3KJ 1IO2A 5CVUA 4J01A 3CUQA 1JKOC 4NQWA 1P6RA 2DA1A 4U0YA 3J7YJ 3ZMUA 3I4MJ 5CVJA 4A0ZA 2VJ4A 4WCGA 2D45A 5IOZA 1W36C 3RZOJ 1IW7F 2HEOA 2NOGA 2KJCA 2O0YA 2LD5A 4JBAA 3IAM2 3LFUA 5IPAA 3VPRA 5L3GA 2KFDA 3RSNA 1MBHA 2KJBA 2VBWA 2MFZA 3HOTA 4EATA 3EUKL 4F93B 2WTEA 1B72A 5FJ8J 2P6TA 1DQUA 3KZZA 2A61A 3ERMA 3ZMDA 3HRUA 3JRIA 1OR7A 3K69A 5M3MJ 1TNSA 2JMWA 1SC7A 1MJBA 2EIMH 1LVAA 4BYYA 3KYLA 3BG9A 2LFBA 1KU3A 2YSRA 4YG2F 4UY8I 5FD6A 2A68F 3CUOA 3MVPA 3BPXA 2RGVA 3BZ6A 3I5UA 3RPQA 5LHGA 4BXUA 4BE2A 1WWXA 3CMMA 2ZC2A 3KP4A 5FD5A 1Y8QB 2VOPA 1MJAA 1B6AA 1D3YA 3IWZA 3DU5A 1MNDA 3HKZN 4HLXA 4QLCU 4EM1A 1R6RA 1I39A 2KIFA 4MFDA 3QODA 3AG3H 1TLHB 4FTHA 2XPUA 2O3FA 2VQGA 1Y1WJ 1VQ6I 2KQRA 3ZPLA 2X0LA 4AYBA 5IYCJ 3CCUI 1XC5A 1ETQA 2LR8A 2DCEA 2X6OA 3CDLA 2A6HF 2BY0A 2R5YA 1L0OC 4IHSA 4A93J 4M72A 2ZJPF 1B1BA 5BQTA 4UUVA 5DCMB 3GTGJ 4XKCA 3MFKA 2GQQA 3K70D 1DGWY 1HKSA 2HDCA 3BROA 3ASOH 3V8LA 1MMDA 3LFKA 4CDGA 3PO2J 1I6HJ 1UZCA 2NOJB 4GYGA 5BPIA 5CYVA 1S72I 4V2FA 2IA2A 2Z16A 1G8XA 2KZGA 2RQQA 4CCJA 1DU6A 2G7UA 1POGA 4DBRA 3I71A 1WFXA 1ZRFA 3ECHA 1RKTA 3IP4B 5CPRB 1MW7A 3OYFA 5E3MA 2XASA 3S2DJ 4DGWB 2XRLA 4D5CA 1GXPA 2A69F 2M4GA 1I6XA 4HNUA 3SDBA 5D4RA 1JT0A 3K1MA 5EZGA 2JA6J 3NWSA 2BYVE 1YIOA 5K7HA 2DFIA 4G7ZF 1OCTC 3E7LA 3F21A 4AVPA 1WI9A 3ABTA 1V5GA 1Y1VJ 2FX0A 3K0LA 5H6QA 2R5YB 1XX5A 3BY6A 5KNLA 4OIQF 5LGNA 2R4GA 3ROUA 3VYSB 2BOLA 4CCNA 1SD7A 3PIOF 3BR1A 2PMZA 2ZCWA 2EBIA 2KDOA 2TRTA 3KLNA 4DOZA 2EIJH 4ZJZA 1T95A 4B3XA 1R9TJ 4EJTA 3U1DA 3BT9A 1Z9CA 4HPQA 4LGWA 4V2GA 5M5WJ 5E1ZB 3WTZA 2DMTA 2FBHA 2R3SA 1MMGA 1FOWA 5K5QA 3KX2A 4Y13A 1FBSA 1USSA 2MD0A 1Z67A 2G7HA 1RR8C 1VZ0A 2MGQA 3EYYA 2GXGA 1D5YA 1KQ8A 3H5RA 4CYCB 3H3ZA 5IT9K 1OLTA 2LG4A 1Z6TA 4P5OA 4I2OA 3L2CA 4K2EA 1U3EM 1VTNC 4XBFA 3EQLF 1VQNI 3OL4A 4YELA 2E2HJ 1ZG3A 2QKLB 3BTCA 4DIQA 1UJ8A 3DBLB 3RPUD 2VE8A 4LK0F 1KU9A 2M5WA 3QPLA 2XB0X 3FIWA 1W7PD 4MEYF 2WBMA 1T8IA 2E5NA 2GWRA 4KA4A 3F0CA 2EZLA 2EIKH 4HF0A 3ZQ7A 2LYCA 3BG6A 3ZN0A 5EYRA 2RNJA 1K78B 3F23A 5FLVA 3L2UA 2ZMEA 4LLGF 5C4JJ 2B63J 2RN7A 4CGZA 2Y69H 1H8AC 2KT0A 2RNGA 3MCZA 2MBFA 4BHCA 3K6GA 4D7MA 2LLKA 1ZK8A 3EPZA 2L9RA 4I99C 4ZYAA 5FLXK 1YLFA 4HOBA 3CCSI 4M6YA 2R0QC 3OYGA 2STWA 1WHUA 4HSTA 3VYRB 3GTJJ 1UMQA 4TV7A 4B44A 3ELKA 3LWFA 3WU1B 1QHHD 3Q9SA 2VJ5A 4QIWN 2Y2ZA 3IRRA 1DDNA 1BR4A 2I5UA 4RAYA 2RC4A 5H6RA 1QQIA 3SHFA 3OYIA 1F36A 1G3WA 4BL0B 2R7RA 3PM1A 1LDJA 4XLNF 1LDDA 4OAZA 3VWBA 1W5TA 1XDUA 3Q3SA 3E6DA 4U87A 1HW1A 2E2JJ 4CH7A 2VODA 3O6BB 5F27A 1YITI 1SD5A 5HS7A 3WE3A 4BUPA 1ZH5A 2E1OA 3M1CA 3TDUC 3JR9A 4LIVA 3KP7A 1IXSB 5FRMA 2E71A 2CQXA 3V7SA 4D5FA 2MLGA 4PDKA 3P9CA 1B8IB 2GM4A 2ZMEB 2BBYA 2PLYA 2M9HA 1IRXA 3SJMA 3JRAA 3KPHA 2ZXHA 1JTXA 1TTYA 1V54H 2CYYA 4UV9A 1V5FA 3HJEA 2XKPA 5DYMA 3K7AJ 1R71A 2ME0A 1U8RA 2HZDA 4KYWA 3MKYB 2NAZA 5GAGJ 2XV4S 2E1NA 1ZHFA 2HYFA 1AU7A 3ZR8X 3LSKA 1G3SA 4HX7A 1G4DA 2DK8A 4QSHA 2VQCA 2XIGA 1UAAA 1ETKA 4IRIA 3K10A 4XICA 2E7WA 4RB3C 3MZHA 1GLNA 1EH8A 2HXOA 2F48A 3HIFA 2D1HA 3RZDJ 3G3ZA 1QHGA 2A5YB 3ABMH 4PJNA 4XKVA 4UUSA 4RLFA 1TW3A 1XGSA 5K7FA 2F2EA 1U6GA 1Y0UA 4BKXA 4LMYA 5D8KB 4B8XA 4C2MJ 3GZ6A 4Q5SF 1LE8A 1LEBA 1BA5A 2XDVA 4BDYA 3TMOA 4GDFA 1HA8A 3OYNA 4BDZA 5HLTA 5GAHJ 2OA4A 2KIUA 2LH9A 4ZC3A 3I54A 4FQGA 5BS6A 3OYBA 1W0TA 2UZKA 3HYIA 4JYKA 4A0XA 4B09A 2CH0A 1F4KA 4PSXA 4L5EA 3BQZA 1H89C 3HUGA 2FOWA 3PUFA 3WE2A 2R7DA 2XF6A 5LGTA 2BE5F 3TW6A 4BEHA 2KIMA 2W24A 3LQQA 1YE9A 2GOXB 3F8FA 1S8NA 2KL4A 3IHUA 3VOEA 4RDUA 5DV5A 4XORA 2ACJA 1ETWA 2R7SA 4CZZA 3Q0VA 4Q47A 3I64A 3MKWB 4KISA 4L9TA 3JAMK 3A02A 5EGOB 2P81A 1VNDA 1Z6RA 3BJ6A 4CYDA 2IPQX 2IP2A 1FOXA 2DA5A 4ZYDA 3ZQHA 2KKOA 2HU9A 5LGUA 3J80Z 1O4XA 5A2QK 4WXCA 3HPHA 3A4CA 1YI2I 4PGGA 1J5YA 1QZZA 4MQ9F 3KIOA 4HLYA 1I1SA 1ZARA 4CHUA
chains in the Genus database with same CATH topology
4NDLA 2E19A 4M6VA 5IP7J 1MBGA 5IOYA 1WGXA 1GDTA 2HOTA 2M8GX 2AO9A 2Y9YA 4LOCA 4BXXJ 1A6IA 2NVTJ 1IC8A 2EH3A 2DN0A 1FJLA 3FK6A 2Y9ZA 3B6AA 4RBOA 3HOYJ 1UG2A 2NVQJ 2L7MP 4FE4A 4IHXA 4XRSG 1JJ8C 5IYDJ 3S16J 2CUFA 3ZOBA 3HOUJ 3RQIA 2CQQA 3CQZJ 1NK3P 3BTJA 1G2HA 2EZHA 1AKHA 3BG3A 3LSRA 4EEFG 4DYRA 4AC0A 1QVTA 1BW6A 1ORKA 1TWHJ 5FKMA 5DTDA 1F43A 1ETVA 1EF4A 1JTYA 1ETYA 1ETXA 2X48A 5F1JA 1ENHA 2DA4A 3FISA 2ID6A 1Z0XA 1ZKGA 3PO3J 2O9LA 2G0EA 3WHCA 5EEAA 2KDZA 1IJWC 3B6CA 2OPTA 1HDDC 3BTLA 5IP9J 2CJJA 5M3FJ 2VPRA 1FTZA 5J3LA 4W97A 3IH4A 3TEDA 2VI6A 3ZQLA 1UHSA 1E3OC 4JX6A 4A3LJ 1U9OA 1Z77A 2O7OA 1XS9A 3HGGA 1I3QJ 3BR5A 1JKPC 2YS9A 3JRFA 3OSGA 4X6AJ 3LSJA 2H8RA 3HB9A 4J19A 3NAUA 3OIOA 4CYCA 3JRDA 3CMYA 1AHDP 1JGGA 1YRNB 2ME6A 3K2AA 1OFCX 1ZR2A 2HOAA 4GFBA 2R93J 4C3IJ 1Q1VA 2NS7A 5M5YJ 2L7ZA 1CQTA 1I50J 1IDZA 5HODA 4I76A 4Y7NJ 3G1MA 5GPAA 4BY7J 2YUSA 3LNQA 4D7NA 3GTQJ 3IV5A 4XRMA 3Q0WA 1RETA 2LTPA 2NVYJ 2E2IJ 3S1QJ 1U9NA 3GBGA 1TWFJ 2HI3A 4A3KJ 1VF9A 2W48A 2MSYA 4XIDA 1JKOC 2DA1A 2M34A 1FEXA 1XG1A 3I4MJ 4JX4A 3GTKJ 1JUPA 3S2HJ 2ID3A 5IOZA 3RZOJ 2NOGA 2LD5A 1SANA 5GP9A 5IPAA 3VPRA 2MG4A 2OF7A 1MBHA 2EZKA 2LP0A 4BBRJ 3TW7A 1B72A 5FJ8J 1JJ6C 4XRSA 2HQ5A 2ELKA 4MIMA 4IHYA 5EG0A 4UUSB 3JRIA 5M3MJ 1NK2P 2JMWA 1MH4A 2QF7A 2NS8A 3HEFA 3BG9A 2LFBA 3W6VA 3GTLJ 1LE8B 5C44J 1HOMA 2Y30A 3JRCA 2IAIA 3MVPA 1RESA 2XPWA 1B8IA 3HOXJ 1GUUA 5E3NA 1GV2A 1DU0A 4FE7A 1MBFA 3CCYA 5C3EJ 5J1RA 1HDPA 2M0CA 3HKZN 1K83J 4JP0A 3MN2A 4MFDA 1T56A 4FTHA 3GTPJ 2XPUA 3BR0A 1Y1WJ 1VFCA 5IYCJ 4X1EA 1XC5A 4AYBN 1ETQA 1JUMA 2FQ4A 1MBJA 3BR6A 4MFEA 5C4XJ 2LR8A 2X6OA 3CDLA 2R5YA 4A93J 4DZPA 2CUEA 5GPCA 3ZQIA 1QVUA 1P7IA 2JA5J 3GTGJ 3WHBA 2ZB9A 4Y52J 3ZQCA 1IRZA 5EZHA 1WPKA 3SDGA 2JK3A 4IHVA 1LFBA 2EQRA 3H3VK 4M3EA 2NVXJ 1QRYA 3PO2J 1RKWA 1I6HJ 1P7JA 1TWAJ 2JA7J 1PUFA 2O8KA 4V2FA 1FTTA 4A3IJ 2JA8J 1DU6A 3FKIJ 3ZQGA 1BJZA 1POGA 5FKLA 5K7ZA 2VKVA 2LY9A 5FKKA 1RKTA 3JRHA 5E3MA 3GTMJ 3S2DJ 2XRLA 4D5CA 1IV6A 1HF0A 1JT0A 2R7ZJ 4IHWA 4B4CA 5EZGA 2JA6J 2WV1A 3JREA 3RKQA 3H0GJ 5K7HA 2WAQN 2X9DA 3JRGA 2MW8A 3G1LA 1OCTC 3E7LA 1AKHB 4M3GA 1Y1VJ 2FX0A 1JKQC 2R5YB 3Q0UA 4M3FA 1RR7A 2Y0SN 5JLWA 1ITYA 2DMQA 4BY1J 2HXIA 5DS9A 4A3FJ 1BL0A 3BTIA 5F0FA 3BR1A 2EBIA 2H1KA 5EGOA 2PMZN 2TRTA 2L7FP 1LFUP 3O8GA 4JX5A 3TP0A 4B3AA 1R9TJ 3BT9A 2R92J 4V2GA 2LVSA 5M5WJ 4FCYA 1PUFB 1WH7A 3TP3A 2DMTA 3HOWJ 2DA3A 2XSDC 1APLC 2N8GA 3HGYA 3C2BA 2MGQA 1D5YA 4A3MJ 1S7EA 4CYCB 1W0UA 1U8BA 4C3HJ 3A03A 5EF6A 2LKXA 2EZIA 1NTCA 2K9QA 1FIAA 2E2HJ 3BTCA 1GT0C 1MNMC 4XK4A 2TCTA 4BBSJ 3BQYA 1QPIA 2JN6A 3LOCA 3LSGA 4A3GJ 3IH3A 3QPLA 2XB0X 3UKGA 3FIWA 2K9SA 1ZR4A 4UUTA 1IGNA 3F0CA 3D1NI 3LSPA 2EZLA 2R5ZA 4W1UA 2HDDA 4S0HB 2FJ1A 4A3CJ 5EYRA 1X58A 5FLVA 3MKLA 5C4JJ 2DA2A 4MO7A 2B63J 2DMNA 1H8AC 5F04A 2COBA 2DA7A 2KT0A 1TWCJ 4D7MA 2LLKA 1ZK8A 2L9RA 4A3EJ 3S15J 3HM5A 2R0QC 2I10A 2DTZA 5EDNA 5F08A 2GLOA 3GTOJ 1H88C 1OJLA 1BW5A 3GTJJ 1UMQA 3QQAA 2GBYA 3SFIA 3FK7A 5IYBJ 1MSEC 4HNVA 2XGCA 3HDDA 3M3YJ 4QIWN 2Y2ZA 2JWTA 5F0HA 2XB5A 1F36A 1WI3A 1T33A 1IDYA 2IEKA 3PM1A 2CRGA 2LK2A 1B72B 1YRNA 3S1MJ 2DMPA 1SFOJ 1A5JA 3Q3SA 1OCPA 2E2JJ 5EG0B 4A69C 5F27A 1HLVA 2E1OA 3OOUA 1ZTRA 3JR9A 4I6ZA 4C3JJ 2XGEA 1GV5A 5BNGA 2CQXA 3HOVJ 2R5ZB 2ECBA 4D5FA 1TC3C 1B8IB 2GM4A 2VKEA 3S1NJ 2M9HA 3BR3A 3BG5A 4M3DA 2RAEA 3SJMA 3JRAA 3NARA 5E3LA 1JTXA 4DW6A 1JKRC 3K7AJ 3S17J 2HYJA 4M3BA 2ME0A 2DMUA 1VI0A 1MSFC 4QTRA 5J1UA 3I4NJ 1AU7A 1X2NA 1ZGWA 3ZQFA 5E3OA 2DJNA 4A3JJ 4ABZA 3HBLA 4QSHA 4B1RA 2HOSA 1ETKA 4XICA 1WH5A 2XPVA 4FISA 2XGDA 1WCMJ 2HXOA 3M4OJ 1ZQ3P 3RZDJ 1IG7A 4UUSA 4A3BJ 2DA6A 3A01A 5K7FA 4BKXA 1RPWA 2L0KA 2ECCA 2M2EA 1MH3A 3IH2A 4C2MJ 5FKOA 4A3DJ 1LE8A 1BA5A 2IBDA 4G12A 1MBEA 3QPSA 5FKNA 3OSFA 3DCFA 1W0TA 4DYQA 4JYKA 5FLMJ 2K9NA 2K40A 3BQZA 4L5EA 1H89C 3HOZJ 5F0CA 3TW6A 1X2MA 2AHQA 3L1PA 2CU7A 1JUSA 1K61A 5J1YA 4DYCA 4IEJA 2WB1N 2D5VA 4RDUA 2VUMJ 1ETWA 3Q0VA 1TWGJ 4MLOA 1ETOA 5M5XJ 4DZJA 3BR2A 2QCOA 3A02A 5EGOB 4AUXA 2P81A 3S1RJ 1VNDA 5IP6A 2YU9J 3O8HA 1HCRA 2DA5A 3ZQHA 3JRBA 3G1OA 3S14J 1O4XA 1FIPA 2FD5A 5JLXA 3A01B 1U78A 2Y31A 2JJ7A 1GVDA 1MBKA 1JT6A 9ANTA 1IUFA 3DEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDL A;  2E19 A;  4M6V A;  5IP7 J;  1MBG A;  5IOY A;  1WGX A;  1GDT A;  2HOT A;  2M8G X;  2AO9 A;  2Y9Y A;  4LOC A;  4BXX J;  1A6I A;  2NVT J;  1IC8 A;  2EH3 A;  2DN0 A;  1FJL A;  3FK6 A;  2Y9Z A;  3B6A A;  4RBO A;  3HOY J;  1UG2 A;  2NVQ J;  2L7M P;  4FE4 A;  4IHX A;  4XRS G;  1JJ8 C;  5IYD J;  3S16 J;  2CUF A;  3ZOB A;  3HOU J;  3RQI A;  2CQQ A;  3CQZ J;  1NK3 P;  3BTJ A;  1G2H A;  2EZH A;  1AKH A;  3BG3 A;  3LSR A;  4EEF G;  4DYR A;  4AC0 A;  1QVT A;  1BW6 A;  1ORK A;  1TWH J;  5FKM A;  5DTD A;  1F43 A;  1ETV A;  1EF4 A;  1JTY A;  1ETY A;  1ETX A;  2X48 A;  5F1J A;  1ENH A;  2DA4 A;  3FIS A;  2ID6 A;  1Z0X A;  1ZKG A;  3PO3 J;  2O9L A;  2G0E A;  3WHC A;  5EEA A;  2KDZ A;  1IJW C;  3B6C A;  2OPT A;  1HDD C;  3BTL A;  5IP9 J;  2CJJ A;  5M3F J;  2VPR A;  1FTZ A;  5J3L A;  4W97 A;  3IH4 A;  3TED A;  2VI6 A;  3ZQL A;  1UHS A;  1E3O C;  4JX6 A;  4A3L J;  1U9O A;  1Z77 A;  2O7O A;  1XS9 A;  3HGG A;  1I3Q J;  3BR5 A;  1JKP C;  2YS9 A;  3JRF A;  3OSG A;  4X6A J;  3LSJ A;  2H8R A;  3HB9 A;  4J19 A;  3NAU A;  3OIO A;  4CYC A;  3JRD A;  3CMY A;  1AHD P;  1JGG A;  1YRN B;  2ME6 A;  3K2A A;  1OFC X;  1ZR2 A;  2HOA A;  4GFB A;  2R93 J;  4C3I J;  1Q1V A;  2NS7 A;  5M5Y J;  2L7Z A;  1CQT A;  1I50 J;  1IDZ A;  5HOD A;  4I76 A;  4Y7N J;  3G1M A;  5GPA A;  4BY7 J;  2YUS A;  3LNQ A;  4D7N A;  3GTQ J;  3IV5 A;  4XRM A;  3Q0W A;  1RET A;  2LTP A;  2NVY J;  2E2I J;  3S1Q J;  1U9N A;  3GBG A;  1TWF J;  2HI3 A;  4A3K J;  1VF9 A;  2W48 A;  2MSY A;  4XID A;  1JKO C;  2DA1 A;  2M34 A;  1FEX A;  1XG1 A;  3I4M J;  4JX4 A;  3GTK J;  1JUP A;  3S2H J;  2ID3 A;  5IOZ A;  3RZO J;  2NOG A;  2LD5 A;  1SAN A;  5GP9 A;  5IPA A;  3VPR A;  2MG4 A;  2OF7 A;  1MBH A;  2EZK A;  2LP0 A;  4BBR J;  3TW7 A;  1B72 A;  5FJ8 J;  1JJ6 C;  4XRS A;  2HQ5 A;  2ELK A;  4MIM A;  4IHY A;  5EG0 A;  4UUS B;  3JRI A;  5M3M J;  1NK2 P;  2JMW A;  1MH4 A;  2QF7 A;  2NS8 A;  3HEF A;  3BG9 A;  2LFB A;  3W6V A;  3GTL J;  1LE8 B;  5C44 J;  1HOM A;  2Y30 A;  3JRC A;  2IAI A;  3MVP A;  1RES A;  2XPW A;  1B8I A;  3HOX J;  1GUU A;  5E3N A;  1GV2 A;  1DU0 A;  4FE7 A;  1MBF A;  3CCY A;  5C3E J;  5J1R A;  1HDP A;  2M0C A;  3HKZ N;  1K83 J;  4JP0 A;  3MN2 A;  4MFD A;  1T56 A;  4FTH A;  3GTP J;  2XPU A;  3BR0 A;  1Y1W J;  1VFC A;  5IYC J;  4X1E A;  1XC5 A;  4AYB N;  1ETQ A;  1JUM A;  2FQ4 A;  1MBJ A;  3BR6 A;  4MFE A;  5C4X J;  2LR8 A;  2X6O A;  3CDL A;  2R5Y A;  4A93 J;  4DZP A;  2CUE A;  5GPC A;  3ZQI A;  1QVU A;  1P7I A;  2JA5 J;  3GTG J;  3WHB A;  2ZB9 A;  4Y52 J;  3ZQC A;  1IRZ A;  5EZH A;  1WPK A;  3SDG A;  2JK3 A;  4IHV A;  1LFB A;  2EQR A;  3H3V K;  4M3E A;  2NVX J;  1QRY A;  3PO2 J;  1RKW A;  1I6H J;  1P7J A;  1TWA J;  2JA7 J;  1PUF A;  2O8K A;  4V2F A;  1FTT A;  4A3I J;  2JA8 J;  1DU6 A;  3FKI J;  3ZQG A;  1BJZ A;  1POG A;  5FKL A;  5K7Z A;  2VKV A;  2LY9 A;  5FKK A;  1RKT A;  3JRH A;  5E3M A;  3GTM J;  3S2D J;  2XRL A;  4D5C A;  1IV6 A;  1HF0 A;  1JT0 A;  2R7Z J;  4IHW A;  4B4C A;  5EZG A;  2JA6 J;  2WV1 A;  3JRE A;  3RKQ A;  3H0G J;  5K7H A;  2WAQ N;  2X9D A;  3JRG A;  2MW8 A;  3G1L A;  1OCT C;  3E7L A;  1AKH B;  4M3G A;  1Y1V J;  2FX0 A;  1JKQ C;  2R5Y B;  3Q0U A;  4M3F A;  1RR7 A;  2Y0S N;  5JLW A;  1ITY A;  2DMQ A;  4BY1 J;  2HXI A;  5DS9 A;  4A3F J;  1BL0 A;  3BTI A;  5F0F A;  3BR1 A;  2EBI A;  2H1K A;  5EGO A;  2PMZ N;  2TRT A;  2L7F P;  1LFU P;  3O8G A;  4JX5 A;  3TP0 A;  4B3A A;  1R9T J;  3BT9 A;  2R92 J;  4V2G A;  2LVS A;  5M5W J;  4FCY A;  1PUF B;  1WH7 A;  3TP3 A;  2DMT A;  3HOW J;  2DA3 A;  2XSD C;  1APL C;  2N8G A;  3HGY A;  3C2B A;  2MGQ A;  1D5Y A;  4A3M J;  1S7E A;  4CYC B;  1W0U A;  1U8B A;  4C3H J;  3A03 A;  5EF6 A;  2LKX A;  2EZI A;  1NTC A;  2K9Q A;  1FIA A;  2E2H J;  3BTC A;  1GT0 C;  1MNM C;  4XK4 A;  2TCT A;  4BBS J;  3BQY A;  1QPI A;  2JN6 A;  3LOC A;  3LSG A;  4A3G J;  3IH3 A;  3QPL A;  2XB0 X;  3UKG A;  3FIW A;  2K9S A;  1ZR4 A;  4UUT A;  1IGN A;  3F0C A;  3D1N I;  3LSP A;  2EZL A;  2R5Z A;  4W1U A;  2HDD A;  4S0H B;  2FJ1 A;  4A3C J;  5EYR A;  1X58 A;  5FLV A;  3MKL A;  5C4J J;  2DA2 A;  4MO7 A;  2B63 J;  2DMN A;  1H8A C;  5F04 A;  2COB A;  2DA7 A;  2KT0 A;  1TWC J;  4D7M A;  2LLK A;  1ZK8 A;  2L9R A;  4A3E J;  3S15 J;  3HM5 A;  2R0Q C;  2I10 A;  2DTZ A;  5EDN A;  5F08 A;  2GLO A;  3GTO J;  1H88 C;  1OJL A;  1BW5 A;  3GTJ J;  1UMQ A;  3QQA A;  2GBY A;  3SFI A;  3FK7 A;  5IYB J;  1MSE C;  4HNV A;  2XGC A;  3HDD A;  3M3Y J;  4QIW N;  2Y2Z A;  2JWT A;  5F0H A;  2XB5 A;  1F36 A;  1WI3 A;  1T33 A;  1IDY A;  2IEK A;  3PM1 A;  2CRG A;  2LK2 A;  1B72 B;  1YRN A;  3S1M J;  2DMP A;  1SFO J;  1A5J A;  3Q3S A;  1OCP A;  2E2J J;  5EG0 B;  4A69 C;  5F27 A;  1HLV A;  2E1O A;  3OOU A;  1ZTR A;  3JR9 A;  4I6Z A;  4C3J J;  2XGE A;  1GV5 A;  5BNG A;  2CQX A;  3HOV J;  2R5Z B;  2ECB A;  4D5F A;  1TC3 C;  1B8I B;  2GM4 A;  2VKE A;  3S1N J;  2M9H A;  3BR3 A;  3BG5 A;  4M3D A;  2RAE A;  3SJM A;  3JRA A;  3NAR A;  5E3L A;  1JTX A;  4DW6 A;  1JKR C;  3K7A J;  3S17 J;  2HYJ A;  4M3B A;  2ME0 A;  2DMU A;  1VI0 A;  1MSF C;  4QTR A;  5J1U A;  3I4N J;  1AU7 A;  1X2N A;  1ZGW A;  3ZQF A;  5E3O A;  2DJN A;  4A3J J;  4ABZ A;  3HBL A;  4QSH A;  4B1R A;  2HOS A;  1ETK A;  4XIC A;  1WH5 A;  2XPV A;  4FIS A;  2XGD A;  1WCM J;  2HXO A;  3M4O J;  1ZQ3 P;  3RZD J;  1IG7 A;  4UUS A;  4A3B J;  2DA6 A;  3A01 A;  5K7F A;  4BKX A;  1RPW A;  2L0K A;  2ECC A;  2M2E A;  1MH3 A;  3IH2 A;  4C2M J;  5FKO A;  4A3D J;  1LE8 A;  1BA5 A;  2IBD A;  4G12 A;  1MBE A;  3QPS A;  5FKN A;  3OSF A;  3DCF A;  1W0T A;  4DYQ A;  4JYK A;  5FLM J;  2K9N A;  2K40 A;  3BQZ A;  4L5E A;  1H89 C;  3HOZ J;  5F0C A;  3TW6 A;  1X2M A;  2AHQ A;  3L1P A;  2CU7 A;  1JUS A;  1K61 A;  5J1Y A;  4DYC A;  4IEJ A;  2WB1 N;  2D5V A;  4RDU A;  2VUM J;  1ETW A;  3Q0V A;  1TWG J;  4MLO A;  1ETO A;  5M5X J;  4DZJ A;  3BR2 A;  2QCO A;  3A02 A;  5EGO B;  4AUX A;  2P81 A;  3S1R J;  1VND A;  5IP6 A;  2YU9 J;  3O8H A;  1HCR A;  2DA5 A;  3ZQH A;  3JRB A;  3G1O A;  3S14 J;  1O4X A;  1FIP A;  2FD5 A;  5JLX A;  3A01 B;  1U78 A;  2Y31 A;  2JJ7 A;  1GVD A;  1MBK A;  1JT6 A;  9ANT A;  1IUF A;  3DEW A; 
#chains in the Genus database with same CATH topology
 2P5L C;  3CP2 A;  4M6V A;  2K9L A;  2AXT C;  2NNY A;  2QVO A;  5IOY A;  3R60 A;  1U2W A;  4ESJ A;  1WGX A;  4LIT A;  1LUJ B;  2WY7 Q;  2ZJR F;  4M9X A;  1GDT A;  3BDD A;  3KEO A;  1SMT A;  1XMA A;  1FSE A;  2K27 A;  3EUA A;  2NRA C;  3WTY C;  5FLX Z;  4RGR A;  1UCR A;  1A6I A;  3E5U A;  4EJU A;  2NVT J;  1STZ A;  4NUB A;  3HKZ A;  5CVI A;  1FJL A;  3FK6 A;  3B6A A;  2CFX A;  3HSR A;  1K4S A;  2L7M P;  3IKV A;  3W2W A;  1BOB A;  3E6M A;  3E0J B;  3FXR A;  4P9F A;  2FRH A;  1JJ8 C;  5K5R A;  5IYD J;  1YX5 A;  3PNT A;  2E1C A;  2EZH A;  2ESN A;  5BOX A;  3BG3 A;  2DOF A;  4MTE A;  4HQE A;  3CO6 C;  2FML A;  3RJP A;  2E1M C;  4WF2 A;  1KYW A;  1JTY A;  1ETY A;  2RDP A;  1BN5 A;  4P9U A;  1PP8 F;  1ENH A;  3FIS A;  2V9P A;  3K4C A;  2ID6 A;  3QOP A;  2FF4 A;  3FZV A;  4O6J A;  5CQG A;  2UWM A;  1ZKG A;  1A36 A;  2O9L A;  2IRF G;  2KDZ A;  3CDH A;  2I8D A;  1I5Z A;  1SVM A;  2OPT A;  5DM7 F;  3FXL A;  1NG6 A;  3K9T A;  4IVN A;  2J5O A;  3QOE A;  3TED A;  1IN4 A;  2LNB A;  1E3O C;  2D1V A;  4XLE A;  3CJN A;  2ZKZ A;  3OSG A;  4X6A J;  5GAE J;  2LBF A;  2B0L A;  3U2R A;  4GO1 A;  1OCO H;  3HB9 A;  4HG2 A;  3E97 A;  3OIO A;  3FXM A;  1W1W E;  2ZBK A;  4RS8 A;  5E8G A;  2L54 A;  1YOV B;  3VDX A;  1JE8 A;  2R7U A;  4GFB A;  3H3U A;  5KAF C;  2LY1 A;  5M5Y J;  3CD6 I;  1NH3 A;  1P4X A;  3LMM A;  1HW5 A;  2CG4 A;  3CC7 I;  4M6X A;  3R4K A;  4XLP F;  1U5T C;  3OS0 A;  1K6O A;  4KIF A;  5EEG A;  3IV5 A;  4ENM A;  4UNO A;  2EFP A;  3CDI A;  2DI3 A;  1Z7U A;  3SFZ A;  3GXO A;  4ZTF A;  3VEP A;  1FOK A;  5AIQ A;  1MMS A;  2X6X A;  2FA5 A;  5AIP A;  2HI3 A;  3DEU A;  1VF9 A;  1JHH A;  3CC2 I;  4X0G A;  2M87 A;  2FOK A;  4RM3 A;  5CVV A;  2EFQ A;  4FAS D;  1D5V A;  3IUO A;  1XG1 A;  1JUP A;  3C3W A;  2Y48 A;  2LBF B;  1ZRE A;  3IC7 A;  2L02 A;  3S8P A;  3OIQ A;  2NS0 A;  1HW2 A;  5FGM A;  1A04 A;  1R4M B;  4L9N A;  3PQJ A;  1IN6 A;  4ZYE A;  5CJ9 A;  1S5L C;  3CF5 F;  3TL4 X;  2JVH A;  5LRR A;  3TW7 A;  3DBR B;  5JR3 A;  3DKX A;  1DPR A;  5D5V B;  3ONQ A;  1P9Q C;  3ML6 A;  4IO9 F;  4HW0 A;  3W6J B;  2JA2 A;  3SEQ A;  3LL7 A;  2IS1 A;  1XD7 A;  1MH4 A;  2AS5 F;  2K3P A;  3HEF A;  5C44 J;  2K86 A;  3JAM Z;  1HOM A;  2IAI A;  2BXZ A;  2DFF A;  3QU6 A;  2DDB A;  5B1B H;  1XGN A;  3PNV A;  1GUU A;  2H94 A;  5E3N A;  1MIJ A;  4FE7 A;  1KU7 A;  2A6E F;  1R36 A;  2FQ3 A;  1FOY A;  5J1R A;  5C3E J;  3VSK A;  2P6S A;  1T08 B;  3PSI A;  4JP0 A;  2CSO A;  3MN2 A;  4ZDL A;  4AWX B;  2DXI A;  3GCM A;  3K4J A;  4EM2 A;  1R49 A;  1XSD A;  1BR1 A;  3TQN A;  2M45 A;  2LF8 A;  1ON1 A;  3L09 A;  4ENK A;  1DGR M;  4X1E A;  2DW4 A;  2DK5 A;  5HS8 A;  2KRF A;  3K70 C;  1JUM A;  2FQ4 A;  3BR6 A;  1XGM A;  3FMQ A;  4MFE A;  5EEH A;  2VKH A;  3RI4 A;  1SD4 A;  4DZP A;  2CUE A;  3F3X A;  1ULY A;  3ZQI A;  2JA5 J;  1P4W A;  3WTT C;  2HFH A;  3L9F A;  2Z9O A;  2V1N A;  4RMN A;  1FYK A;  3GFM A;  4R1H A;  3SZT A;  2BHY A;  4Y52 J;  3ULQ B;  1FP1 D;  2MAB A;  3OS1 A;  3T5X A;  2UXN A;  3H3V K;  2HS5 A;  3ISP A;  1X3Z B;  4M3E A;  2NVX J;  1RKW A;  1TWA J;  3RCO A;  2JA7 J;  3KYD B;  4MNU A;  1PUF A;  1V3F A;  3FBI B;  3CLQ A;  2CWE A;  1IUY A;  3VB2 A;  3JCU C;  2JA8 J;  3FKI J;  2W00 A;  4Y3O A;  1BJZ A;  2XAF A;  1FT9 A;  2DT5 A;  1UHW A;  2QWW A;  5E79 C;  2EK5 A;  5FKL A;  5K7Z A;  2HTJ A;  4HDV A;  2XKO A;  5KVR A;  5FKK A;  1FNN A;  1N75 A;  3CO7 C;  1T38 A;  4RM2 A;  3G6E I;  2M7B A;  1JHF A;  3A0B C;  3BOQ A;  4L9V A;  1HF0 A;  4NNJ A;  2IGO A;  5DCF A;  3OWT A;  1BI0 A;  3D0S A;  2VOO A;  1R23 A;  4ZH4 F;  3BZK A;  2HKX A;  4HX4 A;  3H92 A;  4A6D A;  3COA C;  4GRI A;  2WAQ N;  3JRG A;  2MW8 A;  3G1L A;  5LFA A;  2OJE D;  3K4K A;  4G7H F;  1JXS A;  1T98 A;  2JUC A;  1KZH A;  4ANJ A;  1YO5 C;  2LF7 A;  1FC3 A;  5JLW A;  4I01 A;  2DMQ A;  2Y75 A;  5DDG A;  4BY1 J;  1VQK I;  4GXO A;  4WXD A;  3T8R A;  1WJF A;  4H4K C;  2IGK A;  3ZXS A;  1RRJ A;  2L7F P;  1K79 A;  3O8G A;  1I1G A;  3CMA I;  3W2A A;  2R92 J;  1TQI A;  2LVS A;  4FCY A;  1PUF B;  1XTA A;  3TP3 A;  3HOW J;  4MHG A;  3E5Q A;  2DBB A;  3LSH A;  4OU0 A;  3WOD F;  1APL C;  3SZG A;  2N8G A;  2QYO A;  3C2B A;  2RVC A;  4IOA F;  3FX3 A;  5J4Y A;  5DEQ A;  2Z99 A;  1U8B A;  4C3H J;  4XQF A;  2W1O A;  1SFX A;  1J59 A;  3PFY A;  2EZI A;  4HYE A;  3UNG C;  3TOA A;  3UR3 C;  3ECO A;  4I0A A;  4XK4 A;  2GOM A;  4BBS J;  3MKZ A;  1O57 A;  1BIA A;  4BXF A;  1WJE A;  3LOC A;  4A3G J;  2VBZ A;  1X1A A;  3O3K A;  1LVK A;  3DPL C;  1D1C A;  4BNC A;  2XAQ A;  2DO7 A;  3AG4 H;  1UST A;  4FT8 A;  1ZR4 A;  2VLA A;  2YX7 A;  1CF7 A;  3HHG A;  2XSJ C;  3RIR A;  2ZXW H;  4DNC A;  4L0Y B;  2QSF X;  2KMU A;  4XOP A;  4CXF A;  4MO7 A;  2TDX A;  1GHC A;  1P2F A;  4RB2 C;  2PN6 A;  2DA7 A;  2XC7 A;  4G8X A;  2PQ8 A;  2L2O A;  3ZN1 A;  3HRT A;  1YS7 A;  3CUQ B;  2H8W A;  4A3E J;  1YQA A;  4Y17 A;  4NQW B;  4YFN F;  2DTZ A;  5EDN A;  3GTO J;  2J5P A;  2X1D A;  5D8L B;  3P9K A;  2P7C B;  3QQA A;  1K7A A;  4I02 A;  1O3S A;  3CCQ I;  3QRF F;  5IYB J;  2LY2 A;  2FNP A;  3HDD A;  1E17 A;  1Z21 A;  2L4A A;  1OQY A;  5JFR A;  2HQR A;  3KLO A;  1FWZ A;  2P7V B;  1P4A A;  3OYM A;  1WI3 A;  5JHF A;  1QZY A;  2BZT A;  1B72 B;  1YRN A;  2G9W A;  5D5X B;  4S04 A;  3TKY A;  2QM3 A;  4L18 B;  4EJV A;  4BJ5 C;  4A69 C;  2EPF A;  2PMU A;  1VQP I;  2E60 A;  1HLV A;  1WJB A;  3OOU A;  2XGE A;  5ERI A;  3VSL A;  2P8T A;  5LRS A;  2ISY A;  4IXA A;  2FBI A;  3M9A A;  2FE3 A;  3LQR A;  1S7O A;  1TC3 C;  2Z3Y A;  1WRJ A;  3KYC B;  2OC6 A;  4M3D A;  3BG5 A;  2MLK A;  2HGC A;  2RAE A;  5E3L A;  5CLS A;  2V7F A;  5IT3 A;  4BQN A;  3E6B A;  2HTS A;  1X1P A;  1F1Z A;  2JSC A;  3QYF A;  5E20 A;  1JKR C;  1HBX G;  3DU6 A;  2QSH X;  1QBJ A;  3S17 J;  2HYJ A;  4M3B A;  4OIO F;  2VPL A;  1SVL A;  1FX7 A;  2DMU A;  4XNF A;  1IN8 A;  3CME I;  3EYI A;  4E7J A;  3SQN A;  3ZQF A;  5E3O A;  3FF5 A;  3CCL I;  4A3J J;  3FXU A;  3H9G A;  3HBL A;  4IPA A;  2CW8 A;  1BI2 A;  3ABL H;  4LG0 A;  4ETS A;  1YTY A;  1SEU A;  3QYB A;  3KZY A;  1TP4 A;  1HSJ A;  4R8H A;  2XPV A;  3ERE D;  3BJA A;  3CCJ I;  3C2G A;  1BC7 C;  1ODD A;  1TW2 A;  3WGH A;  3CJT B;  3DF8 A;  3OR1 C;  1DP3 A;  1H0M A;  3KP5 A;  1O3Q A;  4UHT A;  2VIX A;  1OMI A;  1RPW A;  1X1C A;  2ECC A;  1ZAO A;  4L5I A;  4E7I A;  1MBE A;  4E70 A;  4NC8 A;  1YJ9 I;  2HQA A;  1J7K A;  1YX3 A;  1ZLJ A;  2K9N A;  3DKW A;  3I59 A;  3Q9V A;  4IL6 C;  2WC2 A;  4WWC A;  1VQL I;  4S05 A;  2Z2S B;  5F0C A;  4IHT A;  2AHQ A;  4XR6 A;  3ZMT A;  1X4O A;  4ASN A;  2CU7 A;  1JUS A;  2XAG A;  5J1Y A;  1YJN I;  2WB1 A;  4PZJ A;  2KRH A;  3J80 K;  2QSG X;  4DYC A;  2EV6 A;  4ON0 A;  4FX0 A;  1Y0N A;  1CGP A;  2BY1 A;  1ZRC A;  1TWG J;  4MLO A;  3G2B A;  1ERD A;  3A1Y A;  2K7L A;  3BR2 A;  3FXO A;  4E6K G;  2Z33 A;  2FUG 2;  5F1R A;  2B7E A;  1ACI A;  2YU9 J;  4XN3 A;  2M0M A;  3HTU A;  3VFZ A;  5HLI A;  5DM6 F;  3G1O A;  5HDN A;  4ZYG A;  1R4N B;  2GA1 A;  4I0B A;  1R5H A;  3K1P A;  3JSP A;  1GVD A;  3N05 A;  1IUF A;  3GF2 A;  4KT6 A;  3DBH B;  2HKO A;  4B47 A;  1IAW A;  2AO9 A;  1SD6 A;  4HNT A;  2HVS A;  3I59 B;  5E8I A;  2BVM A;  1B9N A;  2F5V A;  1G6N A;  3DPT A;  3J81 Z;  2DN0 A;  4MQV A;  3C1D A;  3HOY J;  2DQR A;  3W3C A;  5DD4 A;  1N77 A;  1NHA A;  4FE4 A;  1XGO A;  4IHX A;  1FYL A;  2HOE A;  2DJI A;  3ZOB A;  4AVZ A;  4A5N A;  3CQZ J;  4JQF A;  2EJR A;  1AKH A;  3LSR A;  2R7X A;  2MC4 A;  1QVT A;  4AC0 A;  5DTD A;  1Z3X A;  1FSH A;  2WWY A;  1EF4 A;  2RRE A;  5F1J A;  4M74 A;  1Z0X A;  1ZRD A;  2V9V A;  2KIQ A;  2CV1 A;  3MAJ A;  4ITV A;  3WHC A;  5ICF A;  2KIS A;  5FFZ A;  3ZMZ A;  2PBI A;  1REP C;  1HDD C;  4PK4 A;  2QBY A;  4EGY A;  2F6C A;  1FTZ A;  1P92 A;  1MGT A;  1QU3 A;  1HQC A;  4IOC F;  4M9S A;  2W85 A;  3OYK A;  4A3L J;  1U9O A;  1Z77 A;  1O3R A;  1I3Q J;  1JKP C;  2DAO A;  4GGG A;  4II2 A;  1PUE E;  3LSJ A;  4J19 A;  1LNW A;  2ZFW A;  2ZNZ A;  3NAU A;  3JRD A;  4H0E A;  1JGG A;  5HDG A;  4IF4 A;  2LRD A;  3S2W A;  4ZZD A;  1OFC X;  4HV5 A;  1OIS A;  5J4V A;  2OD5 A;  2WAQ A;  1CQT A;  1F5T A;  2QQB A;  4BGD A;  3SXY A;  2NYX A;  1N78 A;  1IDZ A;  5HOD A;  3PQK A;  2OAZ A;  4I76 A;  4II3 A;  4IQJ A;  4KNY A;  3G1M A;  1VQ9 I;  1BI3 A;  4LB6 B;  3A0H C;  4XRM A;  2CFO A;  3PIP F;  4KMF A;  2L5Q A;  2EIL H;  4BAC A;  1ZN2 A;  3KZI C;  1R00 A;  2IJL A;  3X2Q H;  3CTA A;  3GBG A;  1C0W A;  3OR2 C;  4HX8 A;  2VBX A;  4A0Y A;  3L2W A;  3RDI A;  1ZGA A;  3KEQ A;  5J8F A;  2FBK A;  4ESB A;  2W48 A;  2STT A;  1IXC A;  3WG7 H;  2M7A A;  2KP6 A;  2M34 A;  1FEX A;  4RAF A;  3S32 A;  1AWC A;  1RUO A;  2E7X A;  2CQ7 A;  3H36 A;  3GTK J;  3S2H J;  2ID3 A;  3R6S A;  2HQN A;  3NEU A;  4XN0 A;  2DYS H;  1R1T A;  1SAN A;  3K2Z A;  2MG4 A;  1O3T A;  1A31 A;  4M71 A;  1EJ9 A;  2OF7 A;  2HVQ A;  2EZK A;  3H35 A;  2A6T A;  2EA4 A;  1EH7 A;  2IXS A;  2V6C A;  3W2V A;  4BBR J;  2W25 A;  2QQ9 A;  1JJ6 C;  2VN2 A;  2HQ5 A;  4BJT A;  1GXQ A;  3T0Y A;  2ELK A;  4IHY A;  2JRT A;  5EG0 A;  4UUS B;  3S3O A;  2DT6 A;  5J8C A;  2E34 A;  1K4T A;  3FWE A;  5D6F A;  2QF7 A;  3GFI A;  2ZNY A;  3I58 A;  2O8X A;  3W6V A;  3GTL J;  4XM3 A;  1YFH A;  1LE8 B;  3QP6 A;  2VBY A;  5TIS C;  4V19 K;  1OCR H;  1RES A;  5JI6 A;  3DEE A;  4I09 A;  4FX4 A;  1V4R A;  3FHN A;  4G9Y A;  1MNE A;  1GV2 A;  1DU0 A;  3HUG B;  4AID A;  3QAH A;  2DPD A;  2F4I A;  4BS9 A;  3RQ4 A;  2M0C A;  2EFO A;  2JRM A;  4PJL A;  4BEH B;  2A05 A;  4KDP A;  1TZL A;  1K83 J;  3CES A;  3D5S C;  3IAS 2;  1MDM A;  3BR0 A;  4KN7 X;  1EKE A;  3BG7 A;  1VFC A;  2OTJ I;  3OYJ A;  3FMS A;  1WJC A;  2UUZ A;  4AYB N;  1IN7 A;  1MBJ A;  1QO0 D;  5HLG A;  1UB9 A;  2QEX I;  3V4G A;  3OYA A;  3V7R A;  4U7D A;  3GFJ A;  5L3B A;  3KP6 A;  2PEX A;  1IZ1 A;  3H5N A;  4YRV A;  3WHB A;  4LB5 A;  1DUX C;  1WPK A;  3SDG A;  4Z6Y A;  4IHV A;  1LFB A;  3CJQ B;  4DBQ A;  1QRY A;  4PJJ A;  3BP8 A;  3DWL E;  2O8K A;  1D1B A;  1FTT A;  3DTK A;  1LFP A;  3GW2 A;  1FYM A;  3ZQG A;  1RUN A;  4L0Z B;  1IN5 A;  3KP2 A;  2VKV A;  1YYV A;  1R1U A;  5ICC A;  3JRH A;  2VXD A;  3F9K A;  4RB1 A;  3ZQQ A;  3GTM J;  2PMH A;  4IHW A;  4B4C A;  1RZ4 A;  2WV1 A;  3J7Z I;  1MDM B;  3MWM A;  3RKQ A;  4LK1 F;  3H0G J;  3V8K A;  3WTV C;  1Q1H A;  2X9D A;  3LSI A;  2BY2 A;  3L2R A;  3GLL A;  2JVG A;  5E1X A;  2LC2 A;  1D8J A;  2K5C A;  4HRI A;  1JKQ C;  1LJ9 A;  3L7W A;  3Q0U A;  4HAM A;  1RR7 A;  2Y0S N;  3DLA A;  1ITY A;  1N25 A;  3ZMV A;  5DS9 A;  4A3F J;  4JOM A;  2XAJ A;  2FMY A;  5D6E A;  1D0X A;  2CUZ A;  3NQO A;  3KCC A;  2V4J C;  3K4L A;  4PFO A;  1U5T A;  5HLH A;  2H1K A;  2K02 A;  2PMZ N;  1Y39 A;  4L5J A;  4HF1 A;  4JX5 A;  4B3A A;  1XCV A;  2E1M B;  1EA3 A;  3ESW B;  3ZCO A;  3M8F A;  2DYR H;  4R79 A;  2DA3 A;  4BQA A;  1Y8R B;  2O61 A;  2XSD C;  2HYG D;  3L2Q A;  2W4S A;  2K4B A;  4BJ6 C;  3PSF A;  3I3L A;  4GCV A;  2MD5 A;  4A3M J;  1S7E A;  3FKJ A;  2XAH A;  4EM0 B;  2VQH A;  2F5E A;  3TGN A;  5EF6 A;  2DLL A;  1NTC A;  2K9Q A;  2LDU A;  1VQ4 I;  1FIA A;  3P5J A;  3WU2 C;  2CQN A;  4CUG A;  1GT0 C;  2DPU A;  3QPH A;  2XRO A;  3ABK H;  3RYP A;  1V5E A;  3BPV A;  3LSG A;  3TO9 A;  2C6Y A;  3IH3 A;  3REO A;  4PGH A;  2PI0 A;  5ICE A;  2K9S A;  2LKS A;  2HDW A;  2X6Y A;  4MGR A;  3SEZ A;  1UHM A;  1S29 A;  4UV8 A;  3AKZ A;  3D1N I;  3K4B A;  3LSP A;  4W1U A;  2VJJ A;  4S0H B;  1FY7 A;  3TO7 A;  1I27 A;  4HQM A;  1X4P A;  4BE0 A;  1X1D A;  2DMN A;  4KN4 X;  2COB A;  2DOD A;  3S15 J;  3HM5 A;  4PUS A;  1E0E A;  2I10 A;  2IT0 A;  1EV7 A;  1H88 C;  1S9H A;  1ZGJ A;  1OJL A;  1TT0 A;  1BIB A;  2E36 A;  2GBY A;  4IZZ A;  2O03 A;  5GTI C;  3FK7 A;  3KET A;  1MSE C;  3WGG A;  4HNV A;  2XGC A;  3OV8 A;  2HZT A;  1R5G A;  3M3Y J;  3L00 A;  4CSW A;  2UXX A;  3OIP A;  5ED4 A;  2H27 A;  1BM9 A;  3QWL A;  3HSF A;  5F0H A;  4BHP A;  2PJR A;  3F8B A;  2XB5 A;  3R0J A;  1T33 A;  1IDY A;  2IEK A;  4B48 A;  2X85 A;  2LK2 A;  2F5D A;  4EMS A;  4CCK A;  1VQO I;  3DLL F;  2O5R A;  1SFO J;  1OCP A;  4J00 A;  1J2X A;  2BV6 A;  4NBQ A;  4C2U A;  3BZC A;  4O3M A;  2DTR A;  2JZY A;  1YS6 A;  5IY5 H;  4I6Z A;  4C3J J;  1BR2 A;  2H09 A;  3EUH C;  4XMY A;  2PX9 A;  3HOV J;  5ILV A;  1MJ9 A;  1KQ9 A;  1T0F C;  2GIZ A;  3H1C A;  3MMY B;  5LLQ A;  3GWZ A;  2VKE A;  4UVB A;  3LSM A;  1IF1 A;  4E4H A;  3ZP5 A;  3BR3 A;  4AD9 A;  2EV0 A;  3AG1 H;  4M73 A;  2CW0 F;  1SFK A;  2K3F A;  4DW6 A;  2OV7 A;  2XF7 A;  2QUF A;  3FXK A;  4Y15 A;  5GTH C;  4ENJ A;  3AL0 B;  4NHJ A;  1S7A A;  4IJA A;  1BOA A;  2R7Q A;  3P7N A;  4F92 B;  1KGS A;  3W6K B;  1UFM A;  3HRS A;  1D0Z A;  2ZSI B;  3LA2 A;  2MH2 A;  2ZJQ F;  1VI0 A;  1WQ2 A;  1MSF C;  5J1U A;  2P5K A;  3I4N J;  1X2N A;  1ZGW A;  5L3D A;  1S6L A;  2NXN B;  1LEA A;  2EWN A;  2DJN A;  4ABZ A;  2WY8 Q;  1A35 A;  4AIJ A;  3FXJ A;  3F22 A;  4B1R A;  2HOS A;  3M8E A;  1XSX A;  5LHI A;  3E6C C;  1WH5 A;  1WSU A;  3E1S A;  1VQ7 I;  2IS4 A;  4UVA A;  1WCM J;  2PJP A;  3M4O J;  1G3Y A;  4F52 A;  4F3Q A;  2FU4 A;  2MC3 A;  2W84 A;  4ZYH A;  2V79 A;  3QU3 A;  5FRN A;  4FET A;  3DKY A;  4CA0 A;  2V6E A;  2OQR A;  2M2E A;  1MH3 A;  2MH9 A;  3Q5F A;  3GZN B;  5FKO A;  4A3D J;  3WG9 A;  3C2H A;  1T6S A;  3CUQ C;  4G12 A;  1Z7L A;  2ETH A;  3OSF A;  3I56 I;  3DCF A;  1QNT A;  2EV5 A;  3GYH X;  2R7W A;  4DYQ A;  2A07 F;  4XLF A;  1JI8 A;  4D1Q A;  2M30 A;  3E5X A;  3V8J A;  2D2W A;  3KEY A;  2K40 A;  3OMY A;  2M4K A;  3WTW C;  3SYT A;  2Q2E A;  3TDZ C;  3HOZ J;  4IRG A;  3L1P A;  2LRE A;  3M8J A;  4G6D A;  4JK1 X;  3KFW X;  2F5C A;  3DP7 A;  3M07 A;  3IL2 A;  5H20 A;  1T39 A;  1K61 A;  3RPU A;  3F8N A;  4E7K A;  4IEJ A;  5E18 F;  2IGN A;  1YIJ I;  1W7P A;  5B1A H;  2KHM A;  4LFU A;  4IRH A;  3HOS A;  3DTI A;  5L3C A;  5EJC A;  5M5X J;  4DZJ A;  2XAU A;  1OR7 C;  2IS2 A;  4AIK A;  4A12 A;  4OMY A;  2MA3 A;  2XGX A;  3S1R J;  3D5R C;  1T2K A;  3AFH A;  3O8H A;  4KMU X;  1ZG5 A;  1HCR A;  5DCM A;  2QLZ A;  1OCC H;  2DOA A;  4CZC A;  3J81 K;  1PJR A;  1XB4 A;  3IWF A;  1FIP A;  1YW7 A;  3MQ0 A;  5JLX A;  2LOO A;  4LLN A;  5BPD A;  1U78 A;  2Y31 A;  2CS3 A;  3RKW A;  1MBK A;  2CO5 A;  1JT6 A;  2X1E A;  9ANT A;  1O7L A;  1FMW A;  1O7F A;  1Z91 A;  3DEW A;  4XL9 A;  5TJJ A;  1ZG1 A;  3ABU A;  5B66 C;  1MBG A;  4CO8 A;  2HOT A;  4UXN A;  2M8G X;  4LOC A;  2BEO A;  1TT5 B;  4CCM A;  1QA6 A;  4BXX J;  4UB6 C;  2M3A A;  3RYR A;  2ZXI A;  1SFE A;  2Q2E B;  2NVU B;  1IC8 A;  3CF2 A;  4AM3 A;  4BU2 A;  2QGU A;  1UG2 A;  4E7S A;  3B02 A;  1KA8 A;  4I7H A;  1LB2 A;  5LHH A;  3S16 J;  2CUF A;  1W7P B;  3F6O A;  2ZFU A;  1DP7 P;  2VXZ A;  2CQQ A;  4EGZ A;  1NK3 P;  3BTJ A;  1FZP B;  1CF7 B;  5KAI C;  4HF2 A;  5KK1 A;  4EEF G;  1BW6 A;  1ORK A;  1ETV A;  1ETX A;  2FSW A;  3MD2 A;  4KIC A;  4XLH A;  3KP3 A;  5FRO A;  4HA8 A;  4F91 B;  3ASN H;  3U21 A;  1UEL B;  2G0E A;  3I55 I;  1R58 A;  5L3F A;  1G3T A;  5LEJ A;  5FO5 A;  5FFX A;  3B6C A;  1IJW C;  1XMX A;  1Y6I A;  2IA0 A;  4E7L A;  4LD5 A;  2VKD A;  1MMN A;  3GZ5 A;  4OWR B;  3S3M A;  1PP7 U;  3BTL A;  2CJJ A;  3DPU A;  4U0V A;  2VPR A;  5J6X A;  1X3W B;  5J3L A;  3IH4 A;  2XUB A;  4IKF A;  2VI6 A;  1UHS A;  2F4M B;  1IV8 A;  1AOY A;  4F55 A;  2O7O A;  1XSV A;  1XS9 A;  3HGG A;  2V1X A;  2ZXJ A;  4PCQ A;  2OZ6 A;  3ZGK A;  5TRD A;  2H8R A;  4CYC A;  3CMY A;  1AHD P;  1YRN B;  2ME6 A;  3T8T A;  3P9I A;  3M7G A;  2HOA A;  2R93 J;  2DFE A;  3U1K A;  1X3U A;  4HBL A;  1Q1V A;  4U0W A;  4XRF A;  5CVR A;  4YFX F;  2A5W A;  2OQG A;  1IRF A;  4KJZ A;  3IRQ A;  2LSO A;  3NRV A;  2KRC A;  4PFP A;  4M9Z A;  3GME A;  5GAD J;  4Y7N J;  5GPA A;  4BY7 J;  3LAJ A;  2K4J A;  4YII A;  2Y0S A;  4D7N A;  3LNQ A;  3CCM I;  3N4M A;  3FM3 A;  3JSO A;  1IRG A;  1GVJ A;  2Z1D A;  1D1A A;  3LA3 A;  3Q0W A;  1XPX A;  1UG0 A;  3S93 A;  5HVQ C;  1K6Y A;  1FLI A;  2E2I J;  2MYS A;  3S1Q J;  1U9N A;  1K78 A;  3FXQ A;  2WAE A;  3FBN B;  2HWV A;  3MZY A;  2IS6 A;  3BCB A;  4XKW A;  1FBU A;  3RTR A;  2MSY A;  4XID A;  1L3L A;  2GZW A;  2K85 A;  4C9Y A;  1WVR A;  2E35 A;  4Y4R A;  2ELH A;  2QZ8 A;  1FMV A;  3DQV C;  4JX4 A;  5L3E A;  2P0W A;  2COM A;  2KZV A;  5B3S H;  3T1B A;  3N97 A;  2JPC A;  1M1E B;  5GP9 A;  4HZF A;  1Z3Y A;  4LG0 B;  3OYD A;  4Z2Y A;  4F7Z A;  1XMK A;  1TQP A;  1LPQ A;  3LST A;  1W36 D;  2DU9 A;  3QYE A;  4BQO A;  2LP0 A;  3WTS C;  3B73 A;  4YFK F;  2IW5 A;  4XRS A;  1W4M A;  3BWG A;  3CCV I;  4MIM A;  1KON A;  1TQM A;  2K9M A;  3DTE A;  2ZME C;  1D8K A;  1HKQ A;  1PYV A;  1NK2 P;  3SZP A;  2DFH A;  2NS8 A;  4G6T B;  4G6Q A;  5LBQ A;  2Y30 A;  3H9J A;  3JRC A;  4P96 A;  2XPW A;  3O2P E;  1B8I A;  3HOX J;  2YU3 A;  4HV6 A;  4OIN F;  3QPT A;  3HC7 A;  2AQF A;  5KHD A;  1MBF A;  4BAY A;  3CCY A;  4C2T A;  4N4N B;  3CZ6 A;  1HDP A;  3ZMS A;  5D4S A;  5ILS A;  3AG2 H;  2BVL A;  1ONV A;  2BXY A;  1XCB A;  3WTX C;  2OU2 A;  3DV8 A;  1T56 A;  3GTP J;  1AA7 A;  4D9J A;  2KPM A;  4MTD A;  1OCZ H;  4KUM A;  3K1N A;  2PG4 A;  5C4X J;  4KIG A;  2JQ7 A;  2WAF A;  2Q8K A;  5GPC A;  1KQ0 A;  3HPG A;  1S3J A;  2JSP A;  4NC6 A;  1QVU A;  1P7I A;  4U88 A;  2R7V A;  3GEZ A;  1BBY A;  2VT3 A;  5E1W A;  3U9G A;  2O6G E;  4DQ2 A;  2ZB9 A;  4P55 A;  3ZQC A;  1IRZ A;  2Y0M A;  5EZH A;  4EQQ A;  1E3P A;  2X6W A;  4RAZ A;  2JK3 A;  4UVC A;  2EQR A;  3H5A A;  4LG3 A;  1RNL A;  2ADU A;  4AU7 A;  4YIF A;  1P7J A;  1R22 A;  4OAY A;  3MEX A;  4EJO A;  2W7N A;  3H0D A;  3E3V A;  2V9K A;  1TBX A;  4U7B A;  4A3I J;  4HEA 2;  2B9S A;  2BHZ A;  1MMA A;  1E3H A;  3R0A A;  5HDK A;  2ZJ2 A;  3PL8 A;  2A3S A;  3GUD A;  1JGS A;  2LY9 A;  4P1W A;  1VQM I;  1X19 A;  5FB2 A;  3RKY A;  1Y56 A;  1IV6 A;  2EFW A;  2OBP A;  2R7Z J;  5F6F A;  3JRE A;  1PDN C;  2X4H A;  3ZRG A;  4A5M A;  1J9I A;  2R7O A;  2Z5U A;  2AXL A;  3HXL A;  1B4A A;  4I98 B;  3HSE A;  4LLL A;  4FHT A;  4QWQ A;  2BY3 A;  2GIV A;  3HZJ A;  1AKH B;  2DDA A;  2OCC H;  4M3G A;  4LIU A;  1HST A;  4M3F A;  2R7F A;  2M1B A;  4PSW A;  2HXI A;  3G71 I;  1BL0 A;  5B5E C;  1HC8 A;  3BTI A;  2HVR A;  2FNA A;  5F0F A;  3FHZ A;  3OYL A;  2QQA A;  5EGO A;  2HPM A;  3QP5 A;  1OKR A;  1LFU P;  3TP0 A;  3M1E A;  1SVO A;  1BC8 C;  1VQ8 I;  5JVT A;  2QBY B;  3CCR I;  1OYW A;  2DQL A;  1OYY A;  3OS2 A;  2NNN A;  3S3N A;  5ICG A;  1WH7 A;  4Q48 A;  3CC4 I;  1DPU A;  2IVM A;  3BJO A;  5AON A;  4G94 A;  3WGI A;  4QPO A;  4BH9 A;  1H9G A;  2LKP A;  1Z1D A;  5F64 A;  3HGY A;  4KIB A;  3NWT A;  2PFB A;  3GO5 A;  1VQ5 I;  2DT7 B;  2F5F A;  4XSX F;  4OMZ A;  5TGT A;  1W0U A;  2L3D A;  3RKX A;  2RKH A;  2AQE A;  3A03 A;  1U0J A;  2ZSH B;  2LKX A;  5HOO A;  1MNM C;  2CGP A;  2TCT A;  4EJW A;  3BQY A;  1QPI A;  2JN6 A;  4OOI A;  2ICW G;  3FMR A;  2R7T A;  2VAS A;  2VT2 A;  3UKG A;  1I3A A;  3GX4 X;  5IT9 Z;  4UUT A;  4WXH A;  5BMZ A;  1IGN A;  2H6C A;  2X51 A;  4Q4Z F;  2GAU A;  2R5Z A;  2HDD A;  4CCO A;  2FJ1 A;  4A3C J;  1X58 A;  4KFC A;  4RA2 A;  3I53 A;  3MKL A;  2DA2 A;  3D5L A;  5F04 A;  1Z05 A;  3G73 A;  4ZTJ A;  4MEX F;  1TWC J;  2RV8 A;  2QEN A;  1R7J A;  3L2V A;  3CJR B;  1WJD A;  5F08 A;  2GLO A;  2W57 A;  4XLA A;  1BW5 A;  5HNH A;  2EFN A;  3GLX A;  2V1D A;  4IQ4 A;  3SFI A;  4YEJ A;  5LEK A;  1WJA A;  4OIP F;  2LMD A;  2W82 A;  2JWT A;  3GFL A;  4Y33 A;  3MZ8 A;  1PVE A;  6PAX A;  4DJA A;  2XRN A;  1YHQ I;  1LKX A;  2CRG A;  1HXD A;  1YG2 A;  5J47 A;  4NB5 A;  1ZYR F;  2DMP A;  3CP8 A;  5JVG F;  3S1M J;  1A5J A;  2XF5 A;  1J75 A;  3LAP A;  4N9H A;  2F4O B;  2YPR A;  3EET A;  2Q1Z B;  5HS9 A;  5ILU A;  5EG0 B;  3J7A O;  4KIT B;  1ZTR A;  2CV2 A;  1GV5 A;  1OYI A;  2DOE A;  5BNG A;  3JTG A;  4N4O B;  2ECB A;  3OYC A;  2R5Z B;  2GXB A;  4A6E A;  2JT1 A;  1XN7 A;  2YR2 A;  4B43 A;  4ENN A;  1E2X A;  2L9V A;  1OPC A;  1QPM A;  3HG9 A;  4BQQ A;  3S1N J;  5JHU A;  3H9Q A;  3NAR A;  2JTV A;  2HNH A;  2VB6 A;  2XHK A;  3PFI A;  2CV0 A;  4E7Z A;  2VC1 A;  1B9M A;  3IKT A;  4AIH A;  2HPI A;  2EIN H;  1SAU A;  3WU0 A;  2VC0 A;  4RGS A;  2UV1 A;  4D0P A;  3BLY A;  3TBI A;  1KYZ A;  4QTR A;  1QZE A;  3JW4 A;  2P5V A;  4ZZL A;  3K4M A;  1MD0 A;  2ISZ A;  2ESH A;  3VOD A;  3OYH A;  2L9S A;  3C7J A;  2CW7 A;  4FIS A;  4GYI A;  4IX7 A;  4OIR F;  3I9V 2;  2HR3 A;  2XGD A;  2IGM A;  2OTL I;  4XKB A;  1ZQ3 P;  1SFU A;  2L4M A;  1IG7 A;  5HNF A;  2EB7 A;  2GA2 A;  2QKM B;  2E5Z A;  4A3B J;  2DA6 A;  5K1Y A;  3A01 A;  4EVI A;  4ESF A;  5J40 A;  2L9N A;  2Q0O A;  2L0K A;  4RGU A;  3IH2 A;  3DXJ F;  4WX9 A;  3LA7 A;  2IBD A;  1R1V A;  1LDK B;  3QPS A;  5FKN A;  1H9T A;  2H1L A;  1D0Y A;  3V42 A;  4RAG A;  3K4N A;  4ZDP A;  3A2K A;  2H6B A;  5FLM J;  2YX4 A;  1R5I D;  2L01 A;  3FDY A;  2IA1 A;  1F9N A;  1X2M A;  2V26 A;  1XDS A;  2CMP A;  2ZO4 A;  4BE1 A;  4N9I A;  1BJA A;  2WB1 N;  1SAX A;  2KLO A;  2RQP A;  3I0T A;  2D5V A;  3KE2 A;  2VUM J;  5CQE A;  2JUG A;  3CCE I;  4KT5 C;  1WZ2 A;  3G4S I;  4O5V A;  2OZU A;  5KCM A;  3GVA A;  1ETO A;  2P4W A;  5D5W B;  1FPQ A;  1KU2 A;  4UB8 C;  4CCL A;  1U5T B;  2QCO A;  4AUX A;  3BC8 A;  3F6V A;  5IP6 A;  3OL3 A;  1QGP A;  1A6Q A;  1J09 A;  3JRB A;  3OYE A;  2VE9 A;  2CQK A;  3S14 J;  4HSR A;  3AAF A;  2FD5 A;  4PJ0 C;  3DFG A;  3A01 B;  2VJI A;  4XOT A;  5K5O A;  2JJ7 A;  2CUJ A;  4XSZ F;  4LJZ F;  4NDL A;  3V7C A;  1BI1 A;  2E19 A;  1V55 H;  5IP7 J;  3R61 A;  2EA2 A;  3F72 A;  3AL0 C;  2WV0 A;  4G7O F;  2Y9Y A;  5DUI A;  1FP2 A;  1EH6 A;  4NC7 A;  1TL8 A;  5E17 F;  5LD2 C;  5A2Q Z;  3HHH A;  4A2U A;  2EH3 A;  4C30 A;  2Y9Z A;  4RBO A;  2BW3 A;  2NVQ J;  3HRM A;  3PJR A;  4RGX A;  3OY9 A;  1WJ5 A;  1MKM A;  1HKT A;  1RIO H;  4QPQ A;  4EV0 A;  4WK8 F;  4XRS G;  1YW8 A;  1TNT A;  5DD8 A;  3VYU B;  1LQ1 A;  1W5C C;  3HOU J;  1FBQ A;  3RQI A;  1G2H A;  1J0R A;  2OCE A;  1YW9 A;  3OOP A;  1YJW I;  2QQ8 A;  1ON2 A;  4N0B A;  3HL2 A;  4DYR A;  3WTU C;  2JPB A;  4RB0 A;  1TWH J;  5FKM A;  3CLO A;  3JTH A;  3TOB A;  2ELJ A;  4E7H A;  4ZDO A;  1F43 A;  1IXR C;  1ZLK A;  2X48 A;  4L9J A;  3C18 A;  1W5S A;  2DA4 A;  3EUH A;  3PNY A;  4XLC A;  3F8M A;  3PO3 J;  1B59 A;  1T0F A;  5EEA A;  3J7A Y;  2WA0 A;  1RC9 A;  2V1U A;  5IP9 J;  3PUB A;  2L7K A;  5M3F J;  1WKM A;  2VL8 A;  4W97 A;  2FXA A;  3ZQL A;  4JX6 A;  2X1C A;  2VQL A;  2BGC A;  3BR5 A;  3HTS B;  2PJR B;  1NG7 A;  2M8E A;  2YS9 A;  3JRF A;  5D5U B;  2VON A;  3I4P A;  4XON A;  2BW3 B;  3K2A A;  4YIR X;  1ZR2 A;  2XVC A;  2WAD A;  4PJM A;  1RI7 A;  4C3I J;  5H2F C;  2NS7 A;  2L7Z A;  1MZB A;  1I50 J;  3TO6 A;  4RLQ A;  1SMY F;  1X1B A;  2YUS A;  3EDP A;  3F8C A;  3GTQ J;  5DUK A;  3VYT B;  1RET A;  2LTP A;  2NVY J;  1ZEL A;  2GXA A;  2FEZ A;  2OUM A;  4CIC A;  2QA4 I;  4HDU A;  1TWF J;  1G59 A;  3BCA A;  4BHB A;  3FM5 A;  5CKT A;  4A3K J;  1IO2 A;  5CVU A;  4J01 A;  3CUQ A;  1JKO C;  4NQW A;  1P6R A;  2DA1 A;  4U0Y A;  3J7Y J;  3ZMU A;  3I4M J;  5CVJ A;  4A0Z A;  2VJ4 A;  4WCG A;  2D45 A;  5IOZ A;  1W36 C;  3RZO J;  1IW7 F;  2HEO A;  2NOG A;  2KJC A;  2O0Y A;  2LD5 A;  4JBA A;  3IAM 2;  3LFU A;  5IPA A;  3VPR A;  5L3G A;  2KFD A;  3RSN A;  1MBH A;  2KJB A;  2VBW A;  2MFZ A;  3HOT A;  4EAT A;  3EUK L;  4F93 B;  2WTE A;  1B72 A;  5FJ8 J;  2P6T A;  1DQU A;  3KZZ A;  2A61 A;  3ERM A;  3ZMD A;  3HRU A;  3JRI A;  1OR7 A;  3K69 A;  5M3M J;  1TNS A;  2JMW A;  1SC7 A;  1MJB A;  2EIM H;  1LVA A;  4BYY A;  3KYL A;  3BG9 A;  2LFB A;  1KU3 A;  2YSR A;  4YG2 F;  4UY8 I;  5FD6 A;  2A68 F;  3CUO A;  3MVP A;  3BPX A;  2RGV A;  3BZ6 A;  3I5U A;  3RPQ A;  5LHG A;  4BXU A;  4BE2 A;  1WWX A;  3CMM A;  2ZC2 A;  3KP4 A;  5FD5 A;  1Y8Q B;  2VOP A;  1MJA A;  1B6A A;  1D3Y A;  3IWZ A;  3DU5 A;  1MND A;  3HKZ N;  4HLX A;  4QLC U;  4EM1 A;  1R6R A;  1I39 A;  2KIF A;  4MFD A;  3QOD A;  3AG3 H;  1TLH B;  4FTH A;  2XPU A;  2O3F A;  2VQG A;  1Y1W J;  1VQ6 I;  2KQR A;  3ZPL A;  2X0L A;  4AYB A;  5IYC J;  3CCU I;  1XC5 A;  1ETQ A;  2LR8 A;  2DCE A;  2X6O A;  3CDL A;  2A6H F;  2BY0 A;  2R5Y A;  1L0O C;  4IHS A;  4A93 J;  4M72 A;  2ZJP F;  1B1B A;  5BQT A;  4UUV A;  5DCM B;  3GTG J;  4XKC A;  3MFK A;  2GQQ A;  3K70 D;  1DGW Y;  1HKS A;  2HDC A;  3BRO A;  3ASO H;  3V8L A;  1MMD A;  3LFK A;  4CDG A;  3PO2 J;  1I6H J;  1UZC A;  2NOJ B;  4GYG A;  5BPI A;  5CYV A;  1S72 I;  4V2F A;  2IA2 A;  2Z16 A;  1G8X A;  2KZG A;  2RQQ A;  4CCJ A;  1DU6 A;  2G7U A;  1POG A;  4DBR A;  3I71 A;  1WFX A;  1ZRF A;  3ECH A;  1RKT A;  3IP4 B;  5CPR B;  1MW7 A;  3OYF A;  5E3M A;  2XAS A;  3S2D J;  4DGW B;  2XRL A;  4D5C A;  1GXP A;  2A69 F;  2M4G A;  1I6X A;  4HNU A;  3SDB A;  5D4R A;  1JT0 A;  3K1M A;  5EZG A;  2JA6 J;  3NWS A;  2BYV E;  1YIO A;  5K7H A;  2DFI A;  4G7Z F;  1OCT C;  3E7L A;  3F21 A;  4AVP A;  1WI9 A;  3ABT A;  1V5G A;  1Y1V J;  2FX0 A;  3K0L A;  5H6Q A;  2R5Y B;  1XX5 A;  3BY6 A;  5KNL A;  4OIQ F;  5LGN A;  2R4G A;  3ROU A;  3VYS B;  2BOL A;  4CCN A;  1SD7 A;  3PIO F;  3BR1 A;  2PMZ A;  2ZCW A;  2EBI A;  2KDO A;  2TRT A;  3KLN A;  4DOZ A;  2EIJ H;  4ZJZ A;  1T95 A;  4B3X A;  1R9T J;  4EJT A;  3U1D A;  3BT9 A;  1Z9C A;  4HPQ A;  4LGW A;  4V2G A;  5M5W J;  5E1Z B;  3WTZ A;  2DMT A;  2FBH A;  2R3S A;  1MMG A;  1FOW A;  5K5Q A;  3KX2 A;  4Y13 A;  1FBS A;  1USS A;  2MD0 A;  1Z67 A;  2G7H A;  1RR8 C;  1VZ0 A;  2MGQ A;  3EYY A;  2GXG A;  1D5Y A;  1KQ8 A;  3H5R A;  4CYC B;  3H3Z A;  5IT9 K;  1OLT A;  2LG4 A;  1Z6T A;  4P5O A;  4I2O A;  3L2C A;  4K2E A;  1U3E M;  1VTN C;  4XBF A;  3EQL F;  1VQN I;  3OL4 A;  4YEL A;  2E2H J;  1ZG3 A;  2QKL B;  3BTC A;  4DIQ A;  1UJ8 A;  3DBL B;  3RPU D;  2VE8 A;  4LK0 F;  1KU9 A;  2M5W A;  3QPL A;  2XB0 X;  3FIW A;  1W7P D;  4MEY F;  2WBM A;  1T8I A;  2E5N A;  2GWR A;  4KA4 A;  3F0C A;  2EZL A;  2EIK H;  4HF0 A;  3ZQ7 A;  2LYC A;  3BG6 A;  3ZN0 A;  5EYR A;  2RNJ A;  1K78 B;  3F23 A;  5FLV A;  3L2U A;  2ZME A;  4LLG F;  5C4J J;  2B63 J;  2RN7 A;  4CGZ A;  2Y69 H;  1H8A C;  2KT0 A;  2RNG A;  3MCZ A;  2MBF A;  4BHC A;  3K6G A;  4D7M A;  2LLK A;  1ZK8 A;  3EPZ A;  2L9R A;  4I99 C;  4ZYA A;  5FLX K;  1YLF A;  4HOB A;  3CCS I;  4M6Y A;  2R0Q C;  3OYG A;  2STW A;  1WHU A;  4HST A;  3VYR B;  3GTJ J;  1UMQ A;  4TV7 A;  4B44 A;  3ELK A;  3LWF A;  3WU1 B;  1QHH D;  3Q9S A;  2VJ5 A;  4QIW N;  2Y2Z A;  3IRR A;  1DDN A;  1BR4 A;  2I5U A;  4RAY A;  2RC4 A;  5H6R A;  1QQI A;  3SHF A;  3OYI A;  1F36 A;  1G3W A;  4BL0 B;  2R7R A;  3PM1 A;  1LDJ A;  4XLN F;  1LDD A;  4OAZ A;  3VWB A;  1W5T A;  1XDU A;  3Q3S A;  3E6D A;  4U87 A;  1HW1 A;  2E2J J;  4CH7 A;  2VOD A;  3O6B B;  5F27 A;  1YIT I;  1SD5 A;  5HS7 A;  3WE3 A;  4BUP A;  1ZH5 A;  2E1O A;  3M1C A;  3TDU C;  3JR9 A;  4LIV A;  3KP7 A;  1IXS B;  5FRM A;  2E71 A;  2CQX A;  3V7S A;  4D5F A;  2MLG A;  4PDK A;  3P9C A;  1B8I B;  2GM4 A;  2ZME B;  2BBY A;  2PLY A;  2M9H A;  1IRX A;  3SJM A;  3JRA A;  3KPH A;  2ZXH A;  1JTX A;  1TTY A;  1V54 H;  2CYY A;  4UV9 A;  1V5F A;  3HJE A;  2XKP A;  5DYM A;  3K7A J;  1R71 A;  2ME0 A;  1U8R A;  2HZD A;  4KYW A;  3MKY B;  2NAZ A;  5GAG J;  2XV4 S;  2E1N A;  1ZHF A;  2HYF A;  1AU7 A;  3ZR8 X;  3LSK A;  1G3S A;  4HX7 A;  1G4D A;  2DK8 A;  4QSH A;  2VQC A;  2XIG A;  1UAA A;  1ETK A;  4IRI A;  3K10 A;  4XIC A;  2E7W A;  4RB3 C;  3MZH A;  1GLN A;  1EH8 A;  2HXO A;  2F48 A;  3HIF A;  2D1H A;  3RZD J;  3G3Z A;  1QHG A;  2A5Y B;  3ABM H;  4PJN A;  4XKV A;  4UUS A;  4RLF A;  1TW3 A;  1XGS A;  5K7F A;  2F2E A;  1U6G A;  1Y0U A;  4BKX A;  4LMY A;  5D8K B;  4B8X A;  4C2M J;  3GZ6 A;  4Q5S F;  1LE8 A;  1LEB A;  1BA5 A;  2XDV A;  4BDY A;  3TMO A;  4GDF A;  1HA8 A;  3OYN A;  4BDZ A;  5HLT A;  5GAH J;  2OA4 A;  2KIU A;  2LH9 A;  4ZC3 A;  3I54 A;  4FQG A;  5BS6 A;  3OYB A;  1W0T A;  2UZK A;  3HYI A;  4JYK A;  4A0X A;  4B09 A;  2CH0 A;  1F4K A;  4PSX A;  4L5E A;  3BQZ A;  1H89 C;  3HUG A;  2FOW A;  3PUF A;  3WE2 A;  2R7D A;  2XF6 A;  5LGT A;  2BE5 F;  3TW6 A;  4BEH A;  2KIM A;  2W24 A;  3LQQ A;  1YE9 A;  2GOX B;  3F8F A;  1S8N A;  2KL4 A;  3IHU A;  3VOE A;  4RDU A;  5DV5 A;  4XOR A;  2ACJ A;  1ETW A;  2R7S A;  4CZZ A;  3Q0V A;  4Q47 A;  3I64 A;  3MKW B;  4KIS A;  4L9T A;  3JAM K;  3A02 A;  5EGO B;  2P81 A;  1VND A;  1Z6R A;  3BJ6 A;  4CYD A;  2IPQ X;  2IP2 A;  1FOX A;  2DA5 A;  4ZYD A;  3ZQH A;  2KKO A;  2HU9 A;  5LGU A;  3J80 Z;  1O4X A;  5A2Q K;  4WXC A;  3HPH A;  3A4C A;  1YI2 I;  4PGG A;  1J5Y A;  1QZZ A;  4MQ9 F;  3KIO A;  4HLY A;  1I1S A;  1ZAR A;  4CHU A; 
#chains in the Genus database with same CATH homology
 4NDL A;  2E19 A;  4M6V A;  5IP7 J;  1MBG A;  5IOY A;  1WGX A;  1GDT A;  2HOT A;  2M8G X;  2AO9 A;  2Y9Y A;  4LOC A;  4BXX J;  1A6I A;  2NVT J;  1IC8 A;  2EH3 A;  2DN0 A;  1FJL A;  3FK6 A;  2Y9Z A;  3B6A A;  4RBO A;  3HOY J;  1UG2 A;  2NVQ J;  2L7M P;  4FE4 A;  4IHX A;  4XRS G;  1JJ8 C;  5IYD J;  3S16 J;  2CUF A;  3ZOB A;  3HOU J;  3RQI A;  2CQQ A;  3CQZ J;  1NK3 P;  3BTJ A;  1G2H A;  2EZH A;  1AKH A;  3BG3 A;  3LSR A;  4EEF G;  4DYR A;  4AC0 A;  1QVT A;  1BW6 A;  1ORK A;  1TWH J;  5FKM A;  5DTD A;  1F43 A;  1ETV A;  1EF4 A;  1JTY A;  1ETY A;  1ETX A;  2X48 A;  5F1J A;  1ENH A;  2DA4 A;  3FIS A;  2ID6 A;  1Z0X A;  1ZKG A;  3PO3 J;  2O9L A;  2G0E A;  3WHC A;  5EEA A;  2KDZ A;  1IJW C;  3B6C A;  2OPT A;  1HDD C;  3BTL A;  5IP9 J;  2CJJ A;  5M3F J;  2VPR A;  1FTZ A;  5J3L A;  4W97 A;  3IH4 A;  3TED A;  2VI6 A;  3ZQL A;  1UHS A;  1E3O C;  4JX6 A;  4A3L J;  1U9O A;  1Z77 A;  2O7O A;  1XS9 A;  3HGG A;  1I3Q J;  3BR5 A;  1JKP C;  2YS9 A;  3JRF A;  3OSG A;  4X6A J;  3LSJ A;  2H8R A;  3HB9 A;  4J19 A;  3NAU A;  3OIO A;  4CYC A;  3JRD A;  3CMY A;  1AHD P;  1JGG A;  1YRN B;  2ME6 A;  3K2A A;  1OFC X;  1ZR2 A;  2HOA A;  4GFB A;  2R93 J;  4C3I J;  1Q1V A;  2NS7 A;  5M5Y J;  2L7Z A;  1CQT A;  1I50 J;  1IDZ A;  5HOD A;  4I76 A;  4Y7N J;  3G1M A;  5GPA A;  4BY7 J;  2YUS A;  3LNQ A;  4D7N A;  3GTQ J;  3IV5 A;  4XRM A;  3Q0W A;  1RET A;  2LTP A;  2NVY J;  2E2I J;  3S1Q J;  1U9N A;  3GBG A;  1TWF J;  2HI3 A;  4A3K J;  1VF9 A;  2W48 A;  2MSY A;  4XID A;  1JKO C;  2DA1 A;  2M34 A;  1FEX A;  1XG1 A;  3I4M J;  4JX4 A;  3GTK J;  1JUP A;  3S2H J;  2ID3 A;  5IOZ A;  3RZO J;  2NOG A;  2LD5 A;  1SAN A;  5GP9 A;  5IPA A;  3VPR A;  2MG4 A;  2OF7 A;  1MBH A;  2EZK A;  2LP0 A;  4BBR J;  3TW7 A;  1B72 A;  5FJ8 J;  1JJ6 C;  4XRS A;  2HQ5 A;  2ELK A;  4MIM A;  4IHY A;  5EG0 A;  4UUS B;  3JRI A;  5M3M J;  1NK2 P;  2JMW A;  1MH4 A;  2QF7 A;  2NS8 A;  3HEF A;  3BG9 A;  2LFB A;  3W6V A;  3GTL J;  1LE8 B;  5C44 J;  1HOM A;  2Y30 A;  3JRC A;  2IAI A;  3MVP A;  1RES A;  2XPW A;  1B8I A;  3HOX J;  1GUU A;  5E3N A;  1GV2 A;  1DU0 A;  4FE7 A;  1MBF A;  3CCY A;  5C3E J;  5J1R A;  1HDP A;  2M0C A;  3HKZ N;  1K83 J;  4JP0 A;  3MN2 A;  4MFD A;  1T56 A;  4FTH A;  3GTP J;  2XPU A;  3BR0 A;  1Y1W J;  1VFC A;  5IYC J;  4X1E A;  1XC5 A;  4AYB N;  1ETQ A;  1JUM A;  2FQ4 A;  1MBJ A;  3BR6 A;  4MFE A;  5C4X J;  2LR8 A;  2X6O A;  3CDL A;  2R5Y A;  4A93 J;  4DZP A;  2CUE A;  5GPC A;  3ZQI A;  1QVU A;  1P7I A;  2JA5 J;  3GTG J;  3WHB A;  2ZB9 A;  4Y52 J;  3ZQC A;  1IRZ A;  5EZH A;  1WPK A;  3SDG A;  2JK3 A;  4IHV A;  1LFB A;  2EQR A;  3H3V K;  4M3E A;  2NVX J;  1QRY A;  3PO2 J;  1RKW A;  1I6H J;  1P7J A;  1TWA J;  2JA7 J;  1PUF A;  2O8K A;  4V2F A;  1FTT A;  4A3I J;  2JA8 J;  1DU6 A;  3FKI J;  3ZQG A;  1BJZ A;  1POG A;  5FKL A;  5K7Z A;  2VKV A;  2LY9 A;  5FKK A;  1RKT A;  3JRH A;  5E3M A;  3GTM J;  3S2D J;  2XRL A;  4D5C A;  1IV6 A;  1HF0 A;  1JT0 A;  2R7Z J;  4IHW A;  4B4C A;  5EZG A;  2JA6 J;  2WV1 A;  3JRE A;  3RKQ A;  3H0G J;  5K7H A;  2WAQ N;  2X9D A;  3JRG A;  2MW8 A;  3G1L A;  1OCT C;  3E7L A;  1AKH B;  4M3G A;  1Y1V J;  2FX0 A;  1JKQ C;  2R5Y B;  3Q0U A;  4M3F A;  1RR7 A;  2Y0S N;  5JLW A;  1ITY A;  2DMQ A;  4BY1 J;  2HXI A;  5DS9 A;  4A3F J;  1BL0 A;  3BTI A;  5F0F A;  3BR1 A;  2EBI A;  2H1K A;  5EGO A;  2PMZ N;  2TRT A;  2L7F P;  1LFU P;  3O8G A;  4JX5 A;  3TP0 A;  4B3A A;  1R9T J;  3BT9 A;  2R92 J;  4V2G A;  2LVS A;  5M5W J;  4FCY A;  1PUF B;  1WH7 A;  3TP3 A;  2DMT A;  3HOW J;  2DA3 A;  2XSD C;  1APL C;  2N8G A;  3HGY A;  3C2B A;  2MGQ A;  1D5Y A;  4A3M J;  1S7E A;  4CYC B;  1W0U A;  1U8B A;  4C3H J;  3A03 A;  5EF6 A;  2LKX A;  2EZI A;  1NTC A;  2K9Q A;  1FIA A;  2E2H J;  3BTC A;  1GT0 C;  1MNM C;  4XK4 A;  2TCT A;  4BBS J;  3BQY A;  1QPI A;  2JN6 A;  3LOC A;  3LSG A;  4A3G J;  3IH3 A;  3QPL A;  2XB0 X;  3UKG A;  3FIW A;  2K9S A;  1ZR4 A;  4UUT A;  1IGN A;  3F0C A;  3D1N I;  3LSP A;  2EZL A;  2R5Z A;  4W1U A;  2HDD A;  4S0H B;  2FJ1 A;  4A3C J;  5EYR A;  1X58 A;  5FLV A;  3MKL A;  5C4J J;  2DA2 A;  4MO7 A;  2B63 J;  2DMN A;  1H8A C;  5F04 A;  2COB A;  2DA7 A;  2KT0 A;  1TWC J;  4D7M A;  2LLK A;  1ZK8 A;  2L9R A;  4A3E J;  3S15 J;  3HM5 A;  2R0Q C;  2I10 A;  2DTZ A;  5EDN A;  5F08 A;  2GLO A;  3GTO J;  1H88 C;  1OJL A;  1BW5 A;  3GTJ J;  1UMQ A;  3QQA A;  2GBY A;  3SFI A;  3FK7 A;  5IYB J;  1MSE C;  4HNV A;  2XGC A;  3HDD A;  3M3Y J;  4QIW N;  2Y2Z A;  2JWT A;  5F0H A;  2XB5 A;  1F36 A;  1WI3 A;  1T33 A;  1IDY A;  2IEK A;  3PM1 A;  2CRG A;  2LK2 A;  1B72 B;  1YRN A;  3S1M J;  2DMP A;  1SFO J;  1A5J A;  3Q3S A;  1OCP A;  2E2J J;  5EG0 B;  4A69 C;  5F27 A;  1HLV A;  2E1O A;  3OOU A;  1ZTR A;  3JR9 A;  4I6Z A;  4C3J J;  2XGE A;  1GV5 A;  5BNG A;  2CQX A;  3HOV J;  2R5Z B;  2ECB A;  4D5F A;  1TC3 C;  1B8I B;  2GM4 A;  2VKE A;  3S1N J;  2M9H A;  3BR3 A;  3BG5 A;  4M3D A;  2RAE A;  3SJM A;  3JRA A;  3NAR A;  5E3L A;  1JTX A;  4DW6 A;  1JKR C;  3K7A J;  3S17 J;  2HYJ A;  4M3B A;  2ME0 A;  2DMU A;  1VI0 A;  1MSF C;  4QTR A;  5J1U A;  3I4N J;  1AU7 A;  1X2N A;  1ZGW A;  3ZQF A;  5E3O A;  2DJN A;  4A3J J;  4ABZ A;  3HBL A;  4QSH A;  4B1R A;  2HOS A;  1ETK A;  4XIC A;  1WH5 A;  2XPV A;  4FIS A;  2XGD A;  1WCM J;  2HXO A;  3M4O J;  1ZQ3 P;  3RZD J;  1IG7 A;  4UUS A;  4A3B J;  2DA6 A;  3A01 A;  5K7F A;  4BKX A;  1RPW A;  2L0K A;  2ECC A;  2M2E A;  1MH3 A;  3IH2 A;  4C2M J;  5FKO A;  4A3D J;  1LE8 A;  1BA5 A;  2IBD A;  4G12 A;  1MBE A;  3QPS A;  5FKN A;  3OSF A;  3DCF A;  1W0T A;  4DYQ A;  4JYK A;  5FLM J;  2K9N A;  2K40 A;  3BQZ A;  4L5E A;  1H89 C;  3HOZ J;  5F0C A;  3TW6 A;  1X2M A;  2AHQ A;  3L1P A;  2CU7 A;  1JUS A;  1K61 A;  5J1Y A;  4DYC A;  4IEJ A;  2WB1 N;  2D5V A;  4RDU A;  2VUM J;  1ETW A;  3Q0V A;  1TWG J;  4MLO A;  1ETO A;  5M5X J;  4DZJ A;  3BR2 A;  2QCO A;  3A02 A;  5EGO B;  4AUX A;  2P81 A;  3S1R J;  1VND A;  5IP6 A;  2YU9 J;  3O8H A;  1HCR A;  2DA5 A;  3ZQH A;  3JRB A;  3G1O A;  3S14 J;  1O4X A;  1FIP A;  2FD5 A;  5JLX A;  3A01 B;  1U78 A;  2Y31 A;  2JJ7 A;  1GVD A;  1MBK A;  1JT6 A;  9ANT A;  1IUF A;  3DEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...