4A3MJ

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3mJ00
1OCTC 2WV1A 2KT0A 1QVUA 2K40A 1K83J 2ECBA 3BR3A 5JLXA 1FIPA 1S7EA 2Y9YA 3HOUJ 2MG4A 3MN2A 5E3LA 4JX6A 3GTOJ 2GBYA 3G1OA 2XGDA 2YU9J 2JA6J 4J19A 5M5XJ 1U78A 1B72B 1AHDP 3RQIA 3ZQGA 2VUMJ 1ZKGA 4X1EA 2DA4A 2X9DA 1UG2A 2EZLA 5J1UA 2Y31A 1ZR4A 1OJLA 3Q0VA 5IP6A 2Y0SN 4BBRJ 2EZIA 5GP9A 4MFDA 4IEJA 2XPUA 4M3DA 3HOYJ 1IGNA 2DMQA 2CQXA 9ANTA 4IHWA 2DA5A 4W1UA 2LD5A 4BY1J 2B63J 2L7ZA 1ETYA 1SANA 1QVTA 2XPVA 3GTLJ 2DA3A 1XG1A 2M9HA 3BR2A 2O9LA 1WPKA 2Y2ZA 1T33A 3QPSA 3RZDJ 3BR1A 5IYDJ 1HOMA 1WH7A 1JJ6C 5F0FA 2R5ZA 1A5JA 3HB9A 2R7ZJ 1FIAA 3OSFA 3BG3A 2L7MP 1H88C 5EG0B 2LTPA 1EF4A 1JUPA 1MNMC 2RAEA 3DEWA 4M3GA 1JGGA 5E3NA 3LOCA 1Y1WJ 1TWFJ 2HOSA 2AO9A 4CYCA 2OPTA 1BJZA 3H0GJ 1G2HA 5E3MA 3CMYA 5EZGA 1MBKA 3HGGA 4MIMA 2FD5A 3C2BA 3CCYA 4UUTA 4A69C 1FEXA 1U9NA 2HYJA 2NVTJ 4JP0A 2M8GX 2WB1N 3PM1A 1Z77A 3W6VA 1GT0C 2O7OA 3S1MJ 1RPWA 2CUFA 2XPWA 1H89C 1FTZA 1JUSA 3OSGA 2HDDA 1TWAJ 2LR8A 2NVQJ 2R5ZB 3IH3A 1OFCX 5IYCJ 1ENHA 2JK3A 3QQAA 2JA7J 3JRCA 1AKHA 1MBGA 3M4OJ 3FISA 5IP7J 3ZQHA 4XK4A 3A01A 2DMUA 4XRSA 1ETVA 4CYCB 2LLKA 1VI0A 2E19A 3JRGA 5C3EJ 3TW7A 1WGXA 2HXIA 2X48A 3RKQA 2EZKA 3GTJJ 2XGCA 2R5YA 4MFEA 4DYRA 3ZOBA 2IAIA 2XB5A 5J3LA 1LFUP 1VNDA 1TWHJ 4MO7A 3S16J 3F0CA 5K7HA 5FKNA 3UKGA 4ABZA 4QSHA 1ETWA 2O8KA 3K7AJ 4A3CJ 1APLC 2HOAA 5EZHA 3S15J 3S17J 5FLMJ 3VPRA 5F1JA 5BNGA 4IHXA 3NAUA 5EG0A 2CRGA 4DW6A 3JRFA 3L1PA 1RETA 1X2MA 2DMNA 2WAQN 3A03A 4X6AJ 4I76A 4V2FA 1IUFA 4JX4A 5J1RA 4XRSG 4DYCA 1JTYA 4EEFG 3BTCA 1ETXA 1HCRA 1Q1VA 1Z0XA 4M3BA 2M2EA 5GPAA 3JREA 2EZHA 1JJ8C 3LSJA 3WHBA 2L0KA 2H1KA 4B4CA 2LVSA 2XB0X 3I4NJ 5EYRA 2KDZA 2JA5J 3ZQCA 5FJ8J 2COBA 1Y1VJ 1IV6A 4A93J 3HOVJ 2E1OA 1POGA 2Y30A 3M3YJ 2R5YB 1RKTA 5E3OA 3HOZJ 2Y9ZA 2N8GA 1LFBA 2XGEA 2IEKA 2CUEA 4W97A 3JRHA 4HNVA 1BW6A 1YRNA 2HOTA 4C3IJ 1HDDC 2JN6A 1JTXA 4UUSA 1HLVA 5IP9J 5IYBJ 3GTMJ 3WHCA 2FQ4A 1CQTA 2CQQA 2GM4A 1IRZA 1H8AC 3IH2A 1ORKA 4D7NA 4BY7J 4MLOA 3S14J 3FIWA 4BBSJ 3BQYA 3A01B 4FE7A 2HXOA 3RZOJ 1GVDA 3G1LA 1X58A 1JKPC 4DZJA 2L7FP 3SDGA 3H3VK 5F0CA 5J1YA 5EGOB 1F36A 3O8HA 1HDPA 1MH3A 2JA8J 4A3BJ 1IC8A 2I10A 4C3HJ 1PUFA 1MSFC 2P81A 3HOXJ 5IOYA 1MSEC 3BTJA 5EEAA 2EQRA 2E2HJ 3GTKJ 2AHQA 1IG7A 1WH5A 3BQZA 4IHVA 3E7LA 2ME6A 3LSGA 4AYBN 3SJMA 2NS7A 3JRDA 4DYQA 5FLVA 2VKEA 2TCTA 1I6HJ 2YUSA 2FX0A 3JR9A 2IBDA 2H8RA 1X2NA 4A3LJ 2ME0A 2JJ7A 4GFBA 5F0HA 4D7MA 1FJLA 5M5YJ 3DCFA 1QPIA 2ELKA 2MGQA 4RDUA 2X6OA 2L9RA 4FTHA 3TEDA 1XC5A 1TWCJ 5DTDA 4JX5A 3S2HJ 4V2GA 3FK6A 3PO2J 4A3JJ 5HODA 1IDZA 4M3FA 3TW6A 3OOUA 1NK2P 2XSDC 2EBIA 2NOGA 3FK7A 3IH4A 3HGYA 1TC3C 3IV5A 2ID3A 3Q0WA 1RKWA 1ZK8A 2LP0A 1LE8B 4Y7NJ 3HOWJ 1IDYA 4B3AA 4A3EJ 2M0CA 2ZB9A 3G1MA 3JRBA 5C4XJ 1AU7A 2CU7A 2DA1A 3BG9A 1ETOA 3LSPA 2LK2A 4Y52J 1VF9A 4G12A 1O4XA 1ZQ3P 1JKOC 5GPCA 3LSRA 1LE8A 1JKRC 1RR7A 2M34A 1ETQA 1MBEA 1W0UA 1NTCA 1QRYA 2VPRA 3GTQJ 2E2IJ 2K9QA 3HEFA 1ZTRA 1RESA 3O8GA 4FISA 4QIWN 3HKZN 3LNQA 1ZGWA 1MBFA 2K9SA 5IPAA 1K61A 2DTZA 2VKVA 1W0TA 1NK3P 5FKMA 1OCPA 5K7ZA 1VFCA 5F04A 3A02A 1JT0A 2LY9A 4QTRA 1GUUA 2YS9A 3OIOA 4A3KJ 1GV2A 2R93J 3D1NI 1B8IA 2R0QC 2E2JJ 3HM5A 3Q0UA 1WI3A 1MBJA 1YRNB 4FCYA 1D5YA 2HI3A 5EGOA 4A3DJ 2QCOA 5F08A 1TWGJ 3JRIA 2NVYJ 1BW5A 3Q3SA 5C44J 2K9NA 3PO3J 1WCMJ 4XICA 1SFOJ 1JKQC 2ID6A 4A3MJ 3GTGJ 2VI6A 1E3OC 4C3JJ 3ZQLA 1JUMA 1HF0A 3BTIA 5JLWA 2DA6A 3I4MJ 4A3GJ 3TP3A 5M3MJ 1T56A 2DJNA 3TP0A 4D5CA 1FTTA 2XRLA 3ZQIA 3HBLA 5F27A 1R9TJ 2NS8A 4BXXJ 3BTLA 2LFBA 4AUXA 1ZR2A 3BR5A 3NARA 3FKIJ 4L5EA 2NVXJ 3QPLA 2R92J 3S2DJ 3GBGA 1MBHA 4AC0A 3BR6A 4M3EA 1BA5A 3CDLA 4C2MJ 3MKLA 2TRTA 4I6ZA 2W48A 2PMZN 3S1NJ 4IHYA 3JRAA 5FKOA 4B1RA 5M3FJ 4RBOA 2DA7A 3BG5A 2ECCA 4A3IJ 5FKLA 4FE4A 5IOZA 4D5FA 1BL0A 3S1QJ 5DS9A 1U8BA 3S1RJ 4S0HB 2QF7A 3CQZJ 3BT9A 2FJ1A 2HQ5A 1ETKA 5EDNA 1I3QJ 4JYKA 1B8IB 1UMQA 2G0EA 2MW8A 1UHSA 5FKKA 5C4JJ 5M5WJ 4A3FJ 1PUFB 1GDTA 1I50J 5K7FA 5EF6A 2MSYA 3BR0A 4LOCA 3K2AA 4BKXA 2JMWA 1P7JA 2EH3A 1XS9A 2GLOA 1A6IA 2JWTA 2OF7A 1DU6A 1U9OA 3B6AA 1DU0A 2DMTA 4NDLA 3B6CA 3SFIA 1AKHB 1JT6A 2LKXA 1MH4A 1IJWC 2DA2A 2DN0A 3ZQFA 3HDDA 4M6VA 4XIDA 2CJJA 4UUSB 1ITYA 3MVPA 1P7IA 4XRMA 4DZPA 1F43A 1GV5A 2D5VA 1B72A 3GTPJ 2DMPA
chains in the Genus database with same CATH superfamily
1OCTC 1LDKB 4YIIA 4A5NA 1QVUA 4FT8A 2K40A 1ON1A 3VSLA 1USTA 5JLXA 4A6EA 2Y9YA 2WAFA 3KLOA 5DYMA 3UNGC 3DFGA 4F7ZA 5HLHA 3G1OA 4P96A 1Z3XA 2X0LA 1QHHD 4NQWB 5M5XJ 1B72B 1AHDP 2COMA 3ZQGA 3RJPA 2VUMJ 3I54A 1R00A 2ZFUA 4LD5A 1YITI 2GAUA 1WRJA 3CLQA 2HOEA 1XMAA 2R7VA 2ZJQF 2EZIA 4XONA 4ENNA 3TO6A 3CJRB 4MEYF 1RC9A 4LK0F 2DMQA 1IZ1A 2WB1A 3CUOA 9ANTA 1LJ9A 1NG6A 4IHWA 4XLCA 4Y15A 2UUZA 5DUIA 2L7ZA 1SANA 4KIBA 4DJAA 5DM7F 2P5LC 5FLXK 3RYPA 3GTLJ 3BR2A 1ZGAA 2O9LA 3RZDJ 1OQYA 3KP5A 1XSXA 1PP8F 4OAZA 5CKTA 1BR1A 1WH7A 5F0FA 3S3MA 3WU0A 2R7ZJ 3HOSA 3ZMUA 3OSFA 2VL8A 3BG3A 2NNYA 1D1CA 1V5GA 3L2UA 2CH0A 1J5YA 1MNMC 1OR7C 2RAEA 1JGGA 1AWCA 2A68F 3P9IA 2HOSA 1OCCH 3CESA 1GLNA 3KYLA 2FNAA 2PMHA 4I0AA 1BJZA 4E7SA 4IO9F 2PJRB 3R60A 4RM2A 2Q2EA 2K27A 3R0AA 5J8FA 2KIUA 1MBKA 1OYYA 2AXTC 3KFWX 4UUTA 4IOCF 1MJ9A 1U9NA 3RYRA 3OYCA 3H35A 2AS5F 1Z77A 2K3FA 2F4MB 3QPTA 1QA6A 3Q9VA 3I59A 3AG1H 4A12A 1CF7A 3LA7A 1TQPA 3LAPA 1TQIA 2FNPA 2CV0A 5DV5A 1JUSA 2A05A 5HOOA 2XGXA 3F6VA 4CA0A 4I09A 4IHTA 4OINF 3WTSC 4EGZA 2QENA 2KIMA 5K5RA 2NVQJ 5H6QA 2DO7A 3K4JA 4LG3A 3AKZA 4BHBA 2WTEA 2JK3A 3G2BA 5A2QK 3JRCA 2ZMEB 4OMZA 3FM5A 1T38A 1XDSA 2IS4A 4L5IA 3MQ0A 4LITA 1BOBA 2KL4A 2DJIA 2LLKA 1VI0A 3JRGA 3COAC 5C3EJ 5GAHJ 1BOAA 2HXIA 2QQ8A 4PZJA 4PJLA 4CCKA 4BACA 3J80Z 3GTJJ 1X1CA 3RKQA 2R5YA 4MFEA 4DYRA 2XB5A 2YX4A 4XSXF 2CW8A 2F2EA 1VNDA 2JUCA 4IXAA 1TWHJ 4MO7A 2A61A 3V7CA 3TOBA 2Y0SA 3F0CA 3FMSA 3D5LA 2J5PA 4UV9A 2PBIA 1ETWA 1F1ZA 2GA1A 3GYHX 4A3CJ 1APLC 1M1EB 5EZHA 4M9XA 1WFXA 3VPRA 4EJWA 3OL4A 4UV8A 1UJ8A 3F72A 3NAUA 5EG0A 3L1PA 2DMNA 4X6AJ 1UCRA 2MA3A 3KZYA 4V2FA 5K5QA 4XRSG 1FWZA 4DYCA 4EEFG 3BCBA 2GIZA 2VB6A 4M3BA 1XGSA 3JREA 4BE2A 4M73A 1JJ8C 2HVQA 2L0KA 2H1KA 3CMAI 2M4KA 2GXBA 5EJCA 4BH9A 1O3QA 3KYCB 2KDZA 3TBIA 3W3CA 4BAYA 5FJ8J 1Y1VJ 2K3PA 4KA4A 1ZARA 3HOVJ 4R1HA 1POGA 1LB2A 1G8XA 3M3YJ 2XDVA 1RKTA 3WODF 1TZLA 4NHJA 4L0YB 2HEOA 1IF1A 1JHHA 1TNTA 2CUEA 4G94A 4W97A 4HNVA 3JRHA 1YRNA 2HOTA 3FXJA 3CMEI 4C3IJ 1BJAA 1IW7F 2DFHA 4RGRA 1OCOH 2GQQA 2WWYA 1IRGA 4UUSA 2ADUA 1RUOA 3GTMJ 2WAEA 3WHCA 3R0JA 2FRHA 4Z2YA 4KMFA 1IRZA 2V9PA 1H8AC 4HQEA 2RV8A 1XSDA 1OCZH 2CUJA 1NH3A 2LKPA 4WXDA 3HTUA 5DM6F 3TOAA 4D7NA 1X4PA 5JR3A 1N75A 5JHUA 2X1EA 4MGRA 1B9MA 3NQOA 4GXOA 4HF1A 2HXOA 1X58A 4RAZA 3W2WA 2L7FP 2WV0A 2IGOA 1E2XA 2IRFG 1HDPA 1ZREA 1MH3A 2HU9A 2VC1A 5BPDA 3FMQA 2V6CA 2XV4S 5FFZA 4CCLA 2RNJA 4ZH4F 4Y13A 3ZPLA 3V7RA 5IOYA 4N9HA 3CCSI 3W6KB 1P4AA 4M6XA 2H1LA 3J7ZI 2VQHA 1FYMA 4AM3A 4MNUA 4A0ZA 3T5XA 3LSKA 3BQZA 3ZXSA 3ZN0A 2EFNA 3HPGA 3I58A 3QPHA 5D4RA 5FLVA 2VC0A 1O3TA 1BIBA 1D8JA 4N9IA 2IBDA 2H8RA 4B8XA 1BI1A 1X2NA 4ESJA 2X1CA 1U5TA 1EKEA 3I9V2 5F0HA 4D7MA 1SVOA 1YHQI 2GOMA 1OKRA 2X6OA 2XAFA 3OYHA 3TEDA 2V1XA 2R7DA 3C1DA 2PJPA 2M1BA 3NEUA 4XKBA 1O3SA 4RLFA 3GUDA 2Z1DA 2UXNA 1YX5A 2EBIA 2RN7A 3I3LA 3MKZA 2L54A 3K70C 1O7FA 3IH4A 2Y69H 4NQWA 2HQRA 3EUHC 2M87A 3L00A 2R7SA 2ESNA 3A0BC 1RKWA 1LNWA 5LBQA 4F55A 3A4CA 3KP2A 1ONVA 1IDYA 1W5SA 2PG4A 2FUG2 4U87A 2ZB9A 1AU7A 1D0ZA 3BPXA 1YJWI 2C6YA 2E36A 1TBXA 2LK2A 3C2HA 3DXJF 4IHSA 1S72I 4Y52J 4BNCA 4N4OB 4G12A 1LKXA 5LHIA 3FXQA 2BY0A 2H94A 5ICEA 3GFMA 3LSRA 5TGTA 1FYLA 1GHCA 4HV5A 1LE8A 1SFXA 1JKRC 4OU0A 1RR7A 2M34A 2D2WA 2I8DA 3DPLC 2XROA 2E2IJ 3OOPA 3B73A 1X4OA 2RREA 2X6YA 1ZN2A 3HEFA 1RESA 3O8GA 5CVRA 4QIWN 3HKZN 3LNQA 4HX8A 1MBFA 2QSGX 2VKVA 3WGGA 5FRNA 2QGUA 3ZGKA 4ZZLA 5K7ZA 2QYOA 3MKWB 2LY9A 4B47A 3TGNA 2H27A 3CTAA 4EJVA 1JXSA 1ON2A 2LF7A 5LGUA 1GUUA 4ZC3A 4XL9A 3OS1A 3KLNA 1TQMA 1B8IA 2K4BA 2R0QC 2Q2EB 3ABMH 5E79C 3JSPA 4U0WA 2P7VB 1Y39A 4MTEA 5EEHA 1SD5A 5GTHC 4I99C 2QCOA 3E6CC 2DFEA 5F08A 3ZQ7A 1YQAA 3JRIA 2OQGA 4PK4A 2OCCH 2K9NA 3CD6I 2BV6A 5JVTA 4XICA 1XGOA 1QGPA 1R22A 4AVZA 1S3JA 3B02A 3REOA 1OYWA 5FB2A 1FOYA 1MMGA 1O3RA 3BTIA 3I4MJ 1DGRM 3TP3A 2P6SA 2DJNA 4NC6A 3BJ6A 5JFRA 2Y0MA 2CUZA 2XRLA 4WK8F 3U21A 3IL2A 3DEEA 3DTKA 2XF6A 3TDZC 4BXXJ 2YPRA 3BTLA 2D45A 4RS8A 2GWRA 3MZ8A 5IT9Z 4DIQA 2IJLA 2R7XA 2R7TA 4XRFA 2CFOA 3QYFA 4ZDPA 3HSFA 3QPLA 1F9NA 4CHUA 3S2DJ 1MBHA 4KDPA 4PFOA 3H9QA 3D5RC 2NOJB 4M3EA 3IKVA 3PIPF 2WY8Q 1KU7A 4GYGA 2OQRA 4XKVA 4I6ZA 1FPQA 2A69F 5DCMB 4HW0A 4IHYA 1FMWA 1V5EA 2XASA 3JRAA 3L2VA 3DU5A 5AONA 2UXXA 3O6BB 1ZRCA 1V54H 5FKLA 5D5XB 5ILVA 3RPUA 2HPMA 1GXQA 1G3YA 1U8BA 4PJMA 1WJ5A 3RKYA 4OIPF 3S1RJ 1S9HA 4XN0A 4QPQA 2QA4I 2FJ1A 2LSOA 1JHFA 3SFZA 1I3QJ 2ZNYA 4X0GA 4HYEA 4Q47A 1I5ZA 4G6DA 1B1BA 2MW8A 4IRGA 5M5WJ 2RKHA 5D6FA 1SMTA 3OYNA 4KUMA 3BLYA 5DEQA 3EUKL 3K2AA 5HNHA 2XUBA 2VBXA 4HRIA 4LLGF 4P9FA 1O7LA 2HGCA 3LFKA 1P7JA 2CV2A 5K5OA 4ETSA 3W2VA 5HDGA 3ONQA 1A31A 3N97A 3MZYA 1SAXA 2LG4A 5B1BH 4DOZA 4BQAA 3B6CA 3L7WA 5CYVA 3SFIA 1AKHB 4I0BA 3EUAA 3L2QA 1V5FA 1T0FA 4DBRA 5HS8A 2KRFA 2ZJ2A 5D5WB 1IN7A 3HDDA 4XIDA 2BW3B 1ACIA 1MKMA 2KZVA 1F43A 2LY2A 2D5VA 1S7AA 3HC7A 2J5OA 2E5ZA 4WXHA 2Q1ZB 4E6KG 2IGMA 2WV1A 4G6TB 3LFUA 5KK1A 3VYRB 3J80K 3BG7A 2IPQX 2E71A 4CDGA 1FBUA 1ZLJA 3MN2A 5E3LA 3W6JB 3GTOJ 2YU9J 2R7OA 1QZZA 2QQ9A 4P9UA 3MCZA 2HTJA 5CVVA 2P0WA 3EDPA 1R5ID 2W4SA 3RCOA 1ZR4A 3I0TA 3SEQA 1OJLA 4A6DA 3S3NA 1RUNA 2Y0SN 2UWMA 2X51A 5GP9A 2R4GA 4AIHA 3JAMZ 3GWZA 2O6GE 5LEJA 3LL7A 3MKYB 3QRFF 3BZ6A 4CCMA 3V8JA 2VKHA 3KETA 5HLGA 4LIVA 2AQEA 4BY1J 5HNFA 2DA3A 1XG1A 1SAUA 2MFZA 2Y2ZA 2L9NA 1UG0A 1PJRA 5IYDJ 1BR4A 1A5JA 1J7KA 3ASOH 1UAAA 3KP6A 4HX4A 3DF8A 4LB5A 2L7MP 4M71A 1WZ2A 1T8IA 4ESFA 1H88C 3MAJA 1I1GA 2LTPA 1JUPA 2NNNA 1R49A 3KIOA 1Z1DA 4M3GA 4O3MA 1XCVA 3LOCA 1PDNC 2AO9A 2WBMA 1R4MB 4J01A 3JTGA 3CLOA 3NRVA 4ITVA 1G2HA 4XR6A 5E3MA 3CMYA 3HGGA 5ILUA 1FEXA 2MD5A 1P92A 1EA3A 2M8GX 3TO9A 2WB1N 3AG2H 4DBQA 3CJTB 4LLLA 5HDNA 4OMYA 5LGTA 4B3XA 4HQMA 2QEXI 4BQOA 1BR2A 2IS2A 5J8CA 3BJAA 4Q48A 2L4AA 1L3LA 4AIKA 4JBAA 2NRAC 1LVAA 1Y8QB 2VJIA 1FZPB 2R5ZB 2ZXJA 1SVLA 1TNSA 1R4NB 4F52A 2ZXHA 3BROA 1SMYF 4I02A 3U2RA 4M6YA 1UHMA 2L2OA 4B09A 3BP8A 2CG4A 2DMUA 2F48A 3GFLA 2A6EF 2OC6A 3FXKA 4ZTJA 4UVCA 5CPRB 4FX4A 1YJ9I 3OYDA 2XGCA 2HVSA 1J2XA 2V7FA 3OWTA 5J3LA 1LFUP 2KDOA 5GADJ 2A6HF 2A07F 1WJFA 3HZJA 5K7HA 5FKNA 1VQ5I 4ABZA 1HXDA 1W7PA 4FASD 4A0YA 2WY7Q 1R1UA 3BG6A 2W7NA 1K79A 2R7FA 3FXLA 3OS2A 3S15J 3S17J 3F8NA 4HSRA 5FLMJ 2EV5A 5BNGA 5F1JA 2EB7A 4IHXA 2MLKA 4EATA 1UHWA 3JRFA 2H09A 4KMUX 1RETA 1X2MA 2IP2A 3CC7I 4HOBA 4I76A 4UNOA 2OAZA 1IN4A 5J1RA 1HSTA 1HQCA 5HVQC 2VJ4A 1TT5B 5E8IA 1HCRA 1Z0XA 4YIFA 5GPAA 2W1OA 3LSJA 3KPHA 3WHBA 4HPQA 2PN6A 1YS7A 1QPMA 4ANJA 2RNGA 1Y0UA 1Y56A 2JT1A 3K9TA 2JA5J 1EJ9A 2COBA 2HKOA 2IGNA 1Z6TA 4XLEA 1TP4A 3ULQB 5LGNA 4A93J 4LJZF 1IRFA 1L0OC 1MJAA 2HWVA 2E7XA 2L01A 3CP2A 5HDKA 3P5JA 4B48A 3E3VA 2FMLA 2DK8A 1LFBA 2Q8KA 2DOEA 3I53A 5FO5A 3MEXA 5J40A 3F22A 5B3SH 1HW2A 1X1AA 3R4KA 1WHUA 4KICA 2JN6A 3RTRA 3WE2A 2P7CB 4AU7A 2FBIA 2Z2SB 4ZYHA 2VBYA 3FZVA 1MMDA 2Z16A 1VQOI 2FQ4A 1CQTA 3RIRA 3T1BA 2E5NA 3IWZA 3JSOA 1QZEA 4P55A 5LHGA 1NHAA 4BE0A 1FBSA 4YFXF 2R7QA 4MLOA 5JHFA 3ZN1A 1WVRA 5DD8A 3VFZA 5D5VB 3F6OA 3HRSA 1MD0A 1EH7A 4WXCA 1GVDA 2DQLA 4H4KC 4DZJA 3EYYA 4HA8A 3TMOA 1T98A 2QUFA 3NWSA 5F0CA 5J1YA 3O8HA 2JSCA 3GMEA 3HSEA 1IC8A 4BXFA 3K4MA 4C3HJ 2OD5A 2E1NA 4HF0A 2PMZA 2P81A 1WJBA 1ZRDA 3BTJA 4KN4X 2E2HJ 2I5UA 5KAIC 4YRVA 2K9LA 3HUGA 4RGXA 4DNCA 2ME6A 3ABUA 3LSGA 3BDDA 4HLXA 3JRDA 2XAGA 1FYKA 4GO1A 2VKEA 2YUSA 2QM3A 6PAXA 3F8BA 4DQ2A 3DBRB 1USSA 2JJ7A 3V4GA 4GFBA 4HX7A 5HLTA 2BW3A 2Z9OA 1SFKA 4D1QA 1YOVB 3M1CA 1QPIA 1A35A 2ELKA 1VZ0A 4XLNF 4RDUA 1YO5C 3U1DA 3FHZA 2Y75A 1E17A 4NB5A 4UUVA 3S2HJ 4CSWA 1B59A 3OYKA 4V2GA 5ILSA 2XKOA 5H6RA 1VQ7I 2M4GA 4A3JJ 1YIJI 1IDZA 4M3FA 4LG0A 1B9NA 3VODA 1U5TB 2XAJA 4EQQA 2BBYA 1S6LA 3IV5A 1X3ZB 4XMYA 1BN5A 3SZTA 4E7JA 5E1ZB 1LE8B 3ZP5A 4G7HF 1TW2A 1FSHA 4A3EJ 4BJ6C 3JRBA 1LFPA 5HS7A 1OLTA 2DA1A 1R71A 3A0HC 3BG9A 4G7ZF 2O8XA 2D1VA 2ZKZA 4EJOA 2EFPA 5K1YA 1VF9A 1O4XA 1RNLA 1ZQ3P 3K4NA 4LMYA 5GPCA 3IWFA 5BPIA 4HLYA 2VT3A 3IAS2 2V9KA 2ZXIA 4NC7A 4ZYAA 3H0DA 2IXSA 1W0UA 2FU4A 2VPRA 1HW5A 2EIMH 4LLNA 1ZTRA 5HLIA 4PCQA 2K9SA 4IF4A 1J75A 1XDUA 2DTZA 1W0TA 5FKMA 1OCPA 1LDJA 2W82A 2M3AA 3DQVC 2MABA 1VFCA 5F04A 3HHHA 2VBZA 4KNYA 3KP3A 3RI4A 3EETA 4XLPF 4FX0A 2R93J 3HSRA 3D1NI 2L9SA 5H2FC 4L9JA 3Q0UA 1WI3A 1IN8A 1MBJA 2STTA 2E1MC 3OYGA 1VQ6I 3WGIA 4PSWA 4A3DJ 1IN6A 1TWGJ 2M30A 2XVCA 4Y4RA 1BW5A 3J7AY 3Q3SA 3CJNA 3MZHA 4XORA 1WCMJ 2ZSHB 5TRDA 1C0WA 2L3DA 2PEXA 4AVPA 1FOWA 2E7WA 2DYSH 2QKMB 1LPQA 1A04A 4PGGA 3UR3C 4E7ZA 4A3GJ 5L3DA 5CLSA 3TP0A 3KEQA 1OYIA 3ZQIA 3FWEA 4RB2C 2FMYA 1R9TJ 4G9YA 4Q5SF 2LBFB 2O3FA 3ABKH 2HYGD 1QHGA 2JTVA 5CVIA 1X1PA 3ABTA 4AUXA 4M74A 3BR5A 3K70D 2V1DA 3FXUA 2DBBA 4A2UA 1S29A 4D0PA 5KHDA 3DKXA 2KRCA 2R92J 1WJEA 2ZJRF 1YFHA 3GBGA 4BL0B 2M8EA 3PFYA 3ROUA 2JA2A 2NAZA 3DLLF 2E1CA 5DUKA 3FBNB 2BXZA 3JAMK 4HNTA 4II3A 3MKLA 3PNVA 2W48A 1YYVA 1XGMA 5FKOA 5L3CA 2IW5A 4B1RA 4OWRB 2ELHA 2DA7A 2V9VA 3L09A 3VEPA 3WTWC 1KA8A 4BDZA 4A3IJ 3FF5A 3S1QJ 1IXRC 5F6FA 2KKOA 3CP8A 4O6JA 4RAGA 3F8CA 3QP6A 5AIPA 3AAFA 4G7OF 2R7UA 3G3ZA 1ETKA 2GZWA 3PIOF 2F5EA 4CCOA 4R79A 1ZELA 4JYKA 1B8IB 5E1WA 1UHSA 3H3UA 1I50J 3OYMA 1DUXC 5EF6A 2MSYA 3BR0A 1P6RA 2H6CA 4LK1F 3CO7C 2FSWA 4BKXA 4GDFA 3VB2A 3IHUA 5D8LB 2EH3A 1B4AA 5DCFA 2JWTA 3K4CA 1DU0A 3HPHA 3WU1B 1P4WA 4KIGA 5H20A 2DMTA 3KYDB 4NDLA 3SEZA 3SQNA 4XOTA 4A5MA 2X1DA 3K4BA 3GVAA 2LKXA 2KRHA 1D3YA 5FROA 2EILH 2LYCA 4C2UA 3AG3H 2DN0A 3ZQFA 4BJ5C 1ITYA 1U0JA 4XLHA 4YFKF 1P7IA 2JSPA 4DZPA 3HXLA 3PUBA 2W25A 1GXPA 3RSNA 4E7HA 1Y6IA 4GRIA 3FHNA 4LGWA 2DMPA 2D1HA 3WG7H 4UY8I 2OA4A 2KT0A 4UB6C 3ZMVA 3AL0C 3BY6A 1SFEA 2R7RA 3GFJA 1K83J 2ECBA 1N25A 2LBFA 1W5CC 5E1XA 3ZR8X 5KAFC 1S7EA 2QLZA 3HOUJ 1E3PA 1WSUA 2MG4A 2DOAA 2LOOA 1H9GA 5ERIA 3I55I 2DFFA 2GBYA 2ACJA 3ECHA 2EFQA 2IA2A 3LA3A 3WTUC 2Z33A 2X6WA 3DKWA 2KQRA 1I1SA 5CQEA 1ZGJA 2ZXWH 5DCMA 1PP7U 2GA2A 3CUQA 4KJZA 4X1EA 2VOOA 2X9DA 1S7OA 1UG2A 2EZLA 2F5DA 3PUFA 2G7HA 2Y31A 5J1UA 3Q0VA 2JPBA 4HBLA 5IP6A 1DQUA 5ICFA 4FQGA 3H5NA 3K10A 4MFDA 4RB0A 3ELKA 2X4HA 4PJJA 4I98B 3HOYJ 2RQPA 1IGNA 2EIKH 2CQXA 4KT5C 2DA5A 4BU2A 2LD5A 4BEHA 4EM2A 2CWEA 2FBKA 1ETYA 1D0YA 1QVTA 3C3WA 4C30A 2M9HA 2IVMA 1EH6A 2AXLA 3EPZA 3RPQA 3N4MA 2R5ZA 1RZ4A 3SHFA 3HB9A 1UFMA 3F9KA 3PNTA 2VODA 3LA2A 4XLFA 1V4RA 2W84A 3FKJA 3KE2A 3J7AO 3DEWA 3LSTA 4WWCA 5E3NA 1Y1WJ 1TWFJ 2DAOA 2VIXA 2L02A 1UELB 2KPMA 3VYSB 3M9AA 1TTYA 3H0GJ 1HBXG 4MEXF 1JE8A 1MZBA 3H92A 5D5UB 1G6NA 2VQCA 5A2QZ 5EZGA 2FD5A 3C2BA 4MIMA 3CCYA 4AIDA 1Z6RA 4A69C 2PI0A 4UXNA 5TISC 2EFOA 5F64A 4XKCA 2DOFA 2NVTJ 4JP0A 1T39A 1LVKA 1FC3A 3PM1A 4BDYA 2VT2A 1LEBA 2VASA 1BI3A 3TO7A 2O7OA 4GGGA 4ENMA 1KQ8A 3OY9A 2W85A 4KN7X 2DT7B 2VLAA 3BWGA 3VSKA 2CUFA 1Y8RB 1FNNA 3BCAA 3QYBA 5BQTA 1H89C 1FTZA 2F5VA 3GEZA 3E5QA 1X19A 3OSGA 1TWAJ 1P4XA 1G59A 3ESWB 1I39A 1D0XA 2FXAA 3BC8A 3T8RA 2CFXA 3AG4H 2YU3A 1KZHA 2JA7J 4L9VA 1MBGA 1GVJA 4D9JA 1I6XA 2DQRA 5IP7J 2JPCA 3M4OJ 1CF7B 5TJJA 1DP3A 2KIQA 4XRSA 2OUMA 3L2CA 1WJAA 4CYCB 1EV7A 2XSJC 1J09A 2NXNB 4EVIA 4WF2A 2CGPA 2V1UA 4XOPA 2EPFA 4UVBA 2LC2A 4EV0A 3I56I 2X48A 3M07A 2EZKA 2JVHA 1OISA 2Q0OA 3D0SA 2LDUA 1TLHB 1X3WB 4I01A 3E6MA 3S16J 3M8FA 1R7JA 3VYUB 3OYBA 4J00A 3UKGA 4QSHA 2XHKA 2BEOA 3K7AJ 4XBFA 1ULYA 3WE3A 3WTTC 2MYSA 2ICWG 4HEA2 3F23A 2HOAA 3C18A 2OBPA 3M8EA 3E1SA 3DV8A 4IQJA 1T08B 4DW6A 1KYWA 3N05A 1ZHFA 5B66C 3A03A 3HUGB 5J6XA 1IUFA 4JX4A 3S93A 1JTYA 3BTCA 3ZRGA 1ETXA 1X1DA 3PSIA 1VQPI 2VQLA 4QLCU 2M2EA 4R8HA 2ZNZA 2JQ7A 4AWXB 4B4CA 3A1YA 1SD6A 4EJTA 3GW2A 2LVSA 1K4TA 3I4NJ 2PJRA 4M72A 3U1KA 4PSXA 3E6BA 3LSHA 5L3GA 3ZQCA 3JW4A 2RGVA 3K6GA 1J0RA 3IP4B 4BEHB 2E1OA 3H36A 2Y30A 5LD2C 1OCRH 2YSRA 3QYEA 3I5UA 2BVLA 1U2WA 3F21A 2N8GA 2XGEA 1D1BA 2IEKA 3CF5F 2Z99A 5BOXA 1W36C 2VXDA 2DFIA 1FX7A 1HDDC 4GYIA 4KFCA 4BGDA 5IP9J 5AIQA 5IYBJ 1Z7UA 1E0EA 2HQAA 2V79A 2EJRA 3CUQC 3PNYA 5FRMA 2XAUA 3Q5FA 2E60A 1K78A 3IH2A 2CSOA 2JZYA 3S14J 3FIWA 1QBJA 3I4PA 3MWMA 2XAHA 4KISA 2HZTA 2HDCA 5LRRA 1JGSA 3OS0A 2CQ7A 3RKWA 2XAQA 3HJEA 2G9WA 3LAJA 1YG2A 4F92B 3L2RA 3SDGA 3H3VK 4L5JA 1F36A 5D8KB 1W7PB 2VJJA 2V4JC 2JA8J 2JVGA 4NC8A 5IT3A 3T8TA 1FT9A 4XKWA 1PUFA 1N77A 4ZJZA 1DPUA 1MSFC 3FBIB 2M0MA 1KGSA 2P5KA 1MSEC 1SVMA 1TT0A 2W57A 2AHQA 2LMDA 1IG7A 3H9JA 4BYYA 4CZCA 4BUPA 1HKQA 3U9GA 1Z9CA 1VQ8I 1KQ0A 3E7LA 4RA2A 3IRRA 2W00A 2Z3YA 5LLQA 5LFAA 4RAYA 2EK5A 2NS7A 2BOLA 2HYFA 2TCTA 1U3EM 1V3FA 1HW1A 3ZMZA 1I6HJ 3RDIA 4CZZA 5DD4A 3E97A 5LEKA 1VTNC 1K6YA 1LEAA 1ZLKA 4ON0A 1FJLA 3PQJA 3J7YJ 4KYWA 3X2QH 2QWWA 4PJNA 3H9GA 4BXUA 4ZDOA 2L9RA 2MH9A 1WWXA 3ERED 3FXMA 1TWCJ 4JX5A 2QQAA 1G3WA 1XMKA 2HDWA 3FK6A 3PO2J 5HODA 3CZ6A 3TW6A 2XSDC 5D6EA 3HL2A 1IXCA 2EFWA 2LY1A 1RR8C 2NOGA 4L18B 2NYXA 3NWTA 4YG2F 1TC3C 3Q0WA 4F93B 4PFPA 1G3TA 1I27A 1A6QA 1KU9A 1MNEA 1P9QC 3HRUA 3HOWJ 3A2KA 1G3SA 3P7NA 4RAFA 3G1MA 2DDAA 5E18F 3V8KA 2CU7A 3GLXA 4WX9A 2CQNA 5KNLA 2IA1A 4YELA 4ZYEA 3LSPA 2F4OB 1MMAA 2K02A 4BHPA 5CVJA 4H0EA 1ETQA 1XCBA 1MBEA 1HSJA 2E35A 3GLLA 1NTCA 1QRYA 3GTQJ 4IVNA 2K9QA 3EQLF 2VE9A 5IPAA 5J47A 4E7IA 1K61A 4IZZA 3KP4A 3FM3A 2RVCA 2OU2A 2VQGA 4A0XA 2JUGA 4GCVA 4AD9A 3WTVC 2K7LA 3IUOA 4QTRA 1FBQA 4OIOF 2B7EA 3OIOA 3FX3A 4A3KJ 2KIFA 4OOIA 3ZMDA 2STWA 1LDDA 1MW7A 3HM5A 1YRNB 4PDKA 3GZ6A 4AYBA 2M7BA 4FCYA 1V55H 1D5YA 3S3OA 2HI3A 1R1VA 1W1WE 1IN5A 2LF8A 2E1MB 3H5AA 5IY5H 1TW3A 4IRHA 3ML6A 2OTJI 1K78B 2Y48A 3H1CA 2HTSA 3SZPA 4A3MJ 3VOEA 1Z3YA 2VI6A 1XN7A 1RRJA 4C3JJ 3GZ5A 1OR7A 5FGMA 3CC4I 5B1AH 3EYIA 2VJ5A 5JLWA 3AFHA 4TV7A 1QU3A 2VKDA 1T56A 4CO8A 5M3MJ 3G6EI 2A5YB 1T2KA 3HTSB 2FQ3A 3F3XA 2FA5A 3ERMA 4IKFA 1BI0A 3FXRA 4U0VA 1ZH5A 4RGUA 2BYVE 1ZR2A 5GAGJ 1H0MA 3OR2C 2IS1A 4L5EA 2NVXJ 1T6SA 3IC7A 2RC4A 3M7GA 3DLAA 3HG9A 2DI3A 1QO0D 1S5LC 3BR6A 3BZCA 3DU6A 1OMIA 2CO5A 1BA5A 3CDLA 4C2MJ 2TRTA 1VQNI 1D8KA 1MMNA 4NBQA 5M3FJ 1BC8C 1D5VA 3BG5A 2ECCA 1CGPA 3KZIC 5HS9A 4D5FA 2BY3A 3KP7A 5B5EC 5DS9A 2B9SA 3LSMA 2F5CA 1REPC 4IL6C 1STZA 2TDXA 2MC3A 1A36A 2OTLI 3CJQB 4CCNA 2HQ5A 3QAHA 5DDGA 2CW7A 4OIQF 4I7HA 1UMQA 5FKKA 5C4JJ 3QU3A 3P9KA 4EJUA 5K7FA 2O61A 2XRNA 1R23A 2HR3A 4LOCA 4PUSA 3CCLI 2V1NA 4HG2A 1YIOA 1K6OA 2KHMA 2XKPA 1ZG5A 1VQKI 4RMNA 2OZUA 1XS9A 4Z6YA 1P2FA 2GLOA 1VQ9I 2OV7A 3B6AA 3KEYA 4XLAA 2M45A 3C2GA 4BQQA 3OYFA 3LQQA 4YFNF 1MH4A 4UB8C 4EM0B 4JK1X 2DA2A 2A3SA 4UUSB 2CJJA 2ZBKA 1I3AA 4XRMA 4LFUA 1YE9A 2NVUB 2K9MA 3E5XA 1PUEE 1B6AA 4XM3A 1ZRFA 3OYAA 4ESBA 3MD2A 3K2ZA 3PQKA 1R6RA 1KQ9A 2L4MA 3GZNB 4FETA 3BR3A 1FIPA 1KU3A 4MQVA 4JX6A 3WU2C 3VWBA 3W2AA 3HYIA 4ZDLA 3QU6A 1BIAA 2XGDA 2JA6J 4J19A 1U78A 3P9CA 1FLIA 3RQIA 4E70A 2CV1A 1ZKGA 3I71A 2OZ6A 4CH7A 2DA4A 3IRQA 4B43A 3SZGA 3JCUC 4II2A 4OAYA 4RB3C 4BBRJ 3R61A 2ZMEC 4BJTA 5ICGA 1BC7C 4IEJA 2EIJH 3DPUA 2XPUA 5FLXZ 4HZFA 4M3DA 3QOEA 1YS6A 3I59B 2FOKA 2ZC2A 2HFHA 5FFXA 4W1UA 2P6TA 4U0YA 2ISYA 2B63J 4BS9A 2K86A 4EM1A 1Z7LA 2XPVA 3LQRA 2UV1A 3SXYA 1WPKA 3QPSA 1T33A 4XNFA 1IAWA 3BR1A 1Q1HA 4C9YA 1HOMA 3LWFA 4G8XA 1R36A 2WA0A 3S8PA 1JJ6C 3CCMI 4EGYA 1J59A 1FIAA 2VXZA 3GCMA 1O57A 4JOMA 3DBLB 5EG0B 1EF4A 1XGNA 5JVGF 2BY2A 1ODDA 3LMMA 3M8JA 4C2TA 3QWLA 3HIFA 2ZCWA 3CF2A 3IKTA 4CYCA 1YJNI 1T0FC 2OPTA 3DTEA 3HRMA 1VQ4I 2CMPA 2A6TA 3CUQB 3G4SI 4F3QA 3MMYB 2DK5A 3KCCA 4FHTA 2QSFX 3H3ZA 2Z5UA 3E0JB 1SEUA 3BZKA 3G73A 3ASNH 3K1MA 5KVRA 2HYJA 1QZYA 4P1WA 4PGHA 3W6VA 3OL3A 1GT0C 3RPUD 1MGTA 3S1MJ 1KYZA 1S8NA 2HKXA 3C7JA 1RPWA 4V19K 2H6BA 1FOXA 4Y17A 2DXIA 3ZMSA 2XPWA 4IPAA 4BHCA 1YI2I 3F8FA 4HF2A 2HDDA 2UZKA 2LR8A 4HV6A 2YX7A 5L3FA 3K1NA 3IH3A 2QKLB 1OFCX 5IYCJ 4U7DA 1ENHA 3QQAA 2DU9A 1AKHA 4G6QA 3FISA 3ZQHA 2FE3A 4XK4A 4HSTA 3A01A 2P8TA 3FDYA 1ZG1A 2B0LA 1ETVA 5KCMA 2E19A 1FY7A 1X1BA 4YEJA 3TW7A 1RI7A 1WGXA 3FXOA 2K4JA 3HRTA 2DYRH 2EA4A 3TL4X 2L9VA 2QQBA 3WTXC 4RLQA 3ZOBA 2IAIA 3KEOA 4EMSA 3CCJI 1DPRA 4O5VA 5EEGA 3SYTA 3BPVA 1UB9A 2VBWA 2O8KA 4NNJA 3ISPA 3QODA 3F8MA 3MFKA 2FF4A 1ZYRF 1RIOH 2DW4A 4LG0B 4CYDA 2QSHX 1BM9A 2CRGA 2HVRA 2BY1A 4HAMA 1WJDA 1Z21A 1D1AA 2WC2A 2WAQN 2ZJPF 2X85A 2IGKA 5J4YA 4CGZA 2CQKA 2V26A 3GXOA 1XTAA 3D5SC 1VQLI 3R6SA 1Q1VA 2K85A 3WG9A 2FBHA 5L3EA 2EZHA 1IUYA 1ERDA 4M9ZA 2ZO4A 3K1PA 3G71I 2P5VA 2GIVA 2RDPA 2JRTA 2XB0X 5EYRA 2LH9A 1JI8A 1AOYA 4ENJA 3GX4X 1IV6A 2F4IA 2R7WA 2KP6A 3QP5A 1X3UA 2QVOA 1EH8A 2R5YB 5E3OA 1U5TC 3HOZJ 2Y9ZA 4IJAA 1R58A 1BW6A 1G4DA 1XB4A 1KU2A 3PFIA 1JTXA 2MD0A 1OPCA 4E7KA 1HLVA 4Y3OA 4S05A 3KZZA 2HQNA 3PSFA 1HKTA 2BHZA 2GM4A 2CQQA 2VN2A 4L9TA 3VDXA 2X6XA 1NG7A 2EV0A 1U8RA 1ORKA 5L3BA 4BY7J 2ELJA 3CCVI 2GXGA 2L7KA 3GO5A 3IAM2 4BBSJ 2XIGA 3BQYA 4RB1A 1KONA 3FMRA 3A01B 4FE7A 4BQNA 4UHTA 3CMMA 4S04A 3RZOJ 3DEUA 3G1LA 4AIJA 1JKPC 5FD5A 1WI9A 5EGOB 5CQGA 3CCEI 1FOKA 3HHGA 2ZFWA 3OIQA 1HA8A 2DT5A 4U88A 4NUBA 4A3BJ 2O03A 1MIJA 2I10A 3OIPA 2H8WA 2XF5A 1MMSA 3HOXJ 1QQIA 2LNBA 3J81K 5BS6A 4N4NB 5EEAA 3V7SA 2EQRA 3GTKJ 2KFDA 1DGWY 1WH5A 2JRMA 2G7UA 1SD4A 2F6CA 2MLGA 3CCUI 4UVAA 1AA7A 1YW7A 4IHVA 4P5OA 2XF7A 1Z91A 4AYBN 3EUHA 3SJMA 4MHGA 2PX9A 4DYQA 1FMVA 3V42A 3WTYC 1VQMI 2CW0F 1R5HA 2FOWA 2FX0A 2EV6A 2CS3A 2GOXB 4N0BA 1E3HA 3JR9A 1W5TA 4M9SA 1FP2A 1IXSB 4A3LJ 2ME0A 1N78A 1ZAOA 3SDBA 1SD7A 1W4MA 5J4VA 1LQ1A 4QPOA 3VYTB 5M5YJ 1K4SA 3AL0B 3DCFA 4HDUA 2MGQA 2ETHA 3S2WA 2QBYA 2HS5A 4FTHA 1XC5A 3CCRI 5DTDA 2OCEA 3K69A 4ZTFA 4YIRX 1R1TA 1Z67A 2PQ8A 3OOUA 2DDBA 1NK2P 1F4KA 3FK7A 3WGHA 1IRXA 2K5CA 3HGYA 4LB6B 1F5TA 3JTHA 2ID3A 3RQ4A 1DP7P 4ASNA 2EINH 1H9TA 1YX3A 1ZK8A 1FSEA 2LP0A 2P4WA 3L2WA 2OJED 4WCGA 4OIRF 4Y7NJ 2M7AA 2RQQA 4B3AA 4MTDA 1YW9A 2CYYA 2M0CA 5ED4A 5D4SA 5C4XJ 1WKMA 5E20A 2BGCA 4KITB 2R3SA 3GFIA 3GF2A 1ETOA 4LIUA 2EA2A 4JQFA 1XD7A 3OYLA 2BZTA 2V6EA 4E7LA 3BJOA 3CDIA 1PYVA 1JKOC 3OYEA 4KIFA 3CDHA 1MNDA 3M1EA 5LHHA 2MC4A 1TL8A 2PMUA 3K4LA 3H5RA 2NS0A 3QOPA 2XC7A 2KMUA 3ZCOA 3K0LA 2KZGA 4IQ4A 3OYJA 1YTYA 4FISA 1ZGWA 2QZ8A 1Y0NA 1NK3P 1YLFA 1R5GA 3A02A 1JT0A 3L9FA 1T95A 1QNTA 3WTZA 4HNUA 2O0YA 3PJRA 3DKYA 2IA0A 2YS9A 2PLYA 3OMYA 5F1RA 1J9IA 1GV2A 1DDNA 4F91B 2E2JJ 2M5WA 1YW8A 4QWQA 1BI2A 3TQNA 1W36D 3V8LA 2BXYA 1MJBA 1U6GA 4ENKA 5EGOA 4CUGA 3J81Z 5IT9K 3ZMTA 3Q9SA 2VONA 2NVYJ 5C44J 2W24A 3PO3J 4MQ9F 3O2PE 5CVUA 2QBYB 2VPLA 2MH2A 1SFOJ 3DTIA 1JKQC 4HDVA 2ID6A 4PJ0C 5BMZA 3GTGJ 1E3OC 1SFUA 4XQFA 3ZQLA 1JUMA 2BHYA 1HF0A 4ZZDA 2DA6A 2LREA 2BE5F 1IO2A 3S32A 4D5CA 2DPUA 1FTTA 3HBLA 5F27A 2DPDA 4XSZF 4ZYGA 2DTRA 2NS8A 4CCJA 4Q4ZF 2ZSIB 1LUJB 2LFBA 3E5UA 1PVEA 3O3KA 3NARA 2WAQA 3FKIJ 2L5QA 5CJ9A 4CICA 2KISA 4XN3A 2DT6A 2LRDA 2HPIA 2KJBA 2MBFA 3CO6C 2ISZA 2GXAA 3OV8A 2VE8A 4AC0A 4B44A 4Y33A 2KLOA 4DGWB 1XPXA 2O5RA 2BVMA 3DP7A 2PMZN 3S1NJ 1FP1D 2E34A 3E6DA 3DBHB 3TDUC 1XSVA 4RBOA 4BE1A 2PFBA 4FE4A 5IOZA 3DPTA 1ZG3A 1UZCA 1BL0A 4IX7A 1WJCA 1MDMB 4S0HB 2QF7A 3LSIA 3CQZJ 3BT9A 5GAEJ 3ABLH 2ZMEA 3TKYA 4E4HA 1WQ2A 5EDNA 2DLLA 1SC7A 4I2OA 3ZQQA 3ECOA 2G0EA 1PUFB 1GDTA 2HZDA 2AQFA 4A3FJ 3CCQI 1K7AA 5JI6A 2VOPA 2FEZA 5ICCA 3DWLE 4U7BA 2JMWA 3K4KA 1MDMA 4ZYDA 1A6IA 3CC2I 2OF7A 1DU6A 1U9OA 4IOAF 2HNHA 2LKSA 1XX5A 2IT0A 4L0ZB 2ESHA 4KT6A 2EWNA 3PL8A 3T0YA 4RM3A 4RGSA 3KX2A 2WADA 2F5FA 1BBYA 5GTIC 1JT6A 3HKZA 4CXFA 5LRSA 1IV8A 2DODA 5FD6A 4K2EA 4IRIA 3OR1C 1IJWC 1Z05A 2DCEA 4M6VA 3HOTA 1HC8A 1W7PD 3MVPA 3I64A 1XMXA 2IS6A 2A5WA 3OYIA 3BOQA 1GV5A 5E17F 1HKSA 4L9NA 1B72A 2YR2A 3GTPJ 3RKXA 2KJCA 5E8GA
chains in the Genus database with same CATH topology
1OCTC 2WV1A 2KT0A 1QVUA 2K40A 1K83J 2ECBA 3BR3A 5JLXA 1FIPA 1S7EA 2Y9YA 3HOUJ 2MG4A 3MN2A 5E3LA 4JX6A 3GTOJ 2GBYA 3G1OA 2XGDA 2YU9J 2JA6J 4J19A 5M5XJ 1U78A 1B72B 1AHDP 3RQIA 3ZQGA 2VUMJ 1ZKGA 4X1EA 2DA4A 2X9DA 1UG2A 2EZLA 5J1UA 2Y31A 1ZR4A 1OJLA 3Q0VA 5IP6A 2Y0SN 4BBRJ 2EZIA 5GP9A 4MFDA 4IEJA 2XPUA 4M3DA 3HOYJ 1IGNA 2DMQA 2CQXA 9ANTA 4IHWA 2DA5A 4W1UA 2LD5A 4BY1J 2B63J 2L7ZA 1ETYA 1SANA 1QVTA 2XPVA 3GTLJ 2DA3A 1XG1A 2M9HA 3BR2A 2O9LA 1WPKA 2Y2ZA 1T33A 3QPSA 3RZDJ 3BR1A 5IYDJ 1HOMA 1WH7A 1JJ6C 5F0FA 2R5ZA 1A5JA 3HB9A 2R7ZJ 1FIAA 3OSFA 3BG3A 2L7MP 1H88C 5EG0B 2LTPA 1EF4A 1JUPA 1MNMC 2RAEA 3DEWA 4M3GA 1JGGA 5E3NA 3LOCA 1Y1WJ 1TWFJ 2HOSA 2AO9A 4CYCA 2OPTA 1BJZA 3H0GJ 1G2HA 5E3MA 3CMYA 5EZGA 1MBKA 3HGGA 4MIMA 2FD5A 3C2BA 3CCYA 4UUTA 4A69C 1FEXA 1U9NA 2HYJA 2NVTJ 4JP0A 2M8GX 2WB1N 3PM1A 1Z77A 3W6VA 1GT0C 2O7OA 3S1MJ 1RPWA 2CUFA 2XPWA 1H89C 1FTZA 1JUSA 3OSGA 2HDDA 1TWAJ 2LR8A 2NVQJ 2R5ZB 3IH3A 1OFCX 5IYCJ 1ENHA 2JK3A 3QQAA 2JA7J 3JRCA 1AKHA 1MBGA 3M4OJ 3FISA 5IP7J 3ZQHA 4XK4A 3A01A 2DMUA 4XRSA 1ETVA 4CYCB 2LLKA 1VI0A 2E19A 3JRGA 5C3EJ 3TW7A 1WGXA 2HXIA 2X48A 3RKQA 2EZKA 3GTJJ 2XGCA 2R5YA 4MFEA 4DYRA 3ZOBA 2IAIA 2XB5A 5J3LA 1LFUP 1VNDA 1TWHJ 4MO7A 3S16J 3F0CA 5K7HA 5FKNA 3UKGA 4ABZA 4QSHA 1ETWA 2O8KA 3K7AJ 4A3CJ 1APLC 2HOAA 5EZHA 3S15J 3S17J 5FLMJ 3VPRA 5F1JA 5BNGA 4IHXA 3NAUA 5EG0A 2CRGA 4DW6A 3JRFA 3L1PA 1RETA 1X2MA 2DMNA 2WAQN 3A03A 4X6AJ 4I76A 4V2FA 1IUFA 4JX4A 5J1RA 4XRSG 4DYCA 1JTYA 4EEFG 3BTCA 1ETXA 1HCRA 1Q1VA 1Z0XA 4M3BA 2M2EA 5GPAA 3JREA 2EZHA 1JJ8C 3LSJA 3WHBA 2L0KA 2H1KA 4B4CA 2LVSA 2XB0X 3I4NJ 5EYRA 2KDZA 2JA5J 3ZQCA 5FJ8J 2COBA 1Y1VJ 1IV6A 4A93J 3HOVJ 2E1OA 1POGA 2Y30A 3M3YJ 2R5YB 1RKTA 5E3OA 3HOZJ 2Y9ZA 2N8GA 1LFBA 2XGEA 2IEKA 2CUEA 4W97A 3JRHA 4HNVA 1BW6A 1YRNA 2HOTA 4C3IJ 1HDDC 2JN6A 1JTXA 4UUSA 1HLVA 5IP9J 5IYBJ 3GTMJ 3WHCA 2FQ4A 1CQTA 2CQQA 2GM4A 1IRZA 1H8AC 3IH2A 1ORKA 4D7NA 4BY7J 4MLOA 3S14J 3FIWA 4BBSJ 3BQYA 3A01B 4FE7A 2HXOA 3RZOJ 1GVDA 3G1LA 1X58A 1JKPC 4DZJA 2L7FP 3SDGA 3H3VK 5F0CA 5J1YA 5EGOB 1F36A 3O8HA 1HDPA 1MH3A 2JA8J 4A3BJ 1IC8A 2I10A 4C3HJ 1PUFA 1MSFC 2P81A 3HOXJ 5IOYA 1MSEC 3BTJA 5EEAA 2EQRA 2E2HJ 3GTKJ 2AHQA 1IG7A 1WH5A 3BQZA 4IHVA 3E7LA 2ME6A 3LSGA 4AYBN 3SJMA 2NS7A 3JRDA 4DYQA 5FLVA 2VKEA 2TCTA 1I6HJ 2YUSA 2FX0A 3JR9A 2IBDA 2H8RA 1X2NA 4A3LJ 2ME0A 2JJ7A 4GFBA 5F0HA 4D7MA 1FJLA 5M5YJ 3DCFA 1QPIA 2ELKA 2MGQA 4RDUA 2X6OA 2L9RA 4FTHA 3TEDA 1XC5A 1TWCJ 5DTDA 4JX5A 3S2HJ 4V2GA 3FK6A 3PO2J 4A3JJ 5HODA 1IDZA 4M3FA 3TW6A 3OOUA 1NK2P 2XSDC 2EBIA 2NOGA 3FK7A 3IH4A 3HGYA 1TC3C 3IV5A 2ID3A 3Q0WA 1RKWA 1ZK8A 2LP0A 1LE8B 4Y7NJ 3HOWJ 1IDYA 4B3AA 4A3EJ 2M0CA 2ZB9A 3G1MA 3JRBA 5C4XJ 1AU7A 2CU7A 2DA1A 3BG9A 1ETOA 3LSPA 2LK2A 4Y52J 1VF9A 4G12A 1O4XA 1ZQ3P 1JKOC 5GPCA 3LSRA 1LE8A 1JKRC 1RR7A 2M34A 1ETQA 1MBEA 1W0UA 1NTCA 1QRYA 2VPRA 3GTQJ 2E2IJ 2K9QA 3HEFA 1ZTRA 1RESA 3O8GA 4FISA 4QIWN 3HKZN 3LNQA 1ZGWA 1MBFA 2K9SA 5IPAA 1K61A 2DTZA 2VKVA 1W0TA 1NK3P 5FKMA 1OCPA 5K7ZA 1VFCA 5F04A 3A02A 1JT0A 2LY9A 4QTRA 1GUUA 2YS9A 3OIOA 4A3KJ 1GV2A 2R93J 3D1NI 1B8IA 2R0QC 2E2JJ 3HM5A 3Q0UA 1WI3A 1MBJA 1YRNB 4FCYA 1D5YA 2HI3A 5EGOA 4A3DJ 2QCOA 5F08A 1TWGJ 3JRIA 2NVYJ 1BW5A 3Q3SA 5C44J 2K9NA 3PO3J 1WCMJ 4XICA 1SFOJ 1JKQC 2ID6A 4A3MJ 3GTGJ 2VI6A 1E3OC 4C3JJ 3ZQLA 1JUMA 1HF0A 3BTIA 5JLWA 2DA6A 3I4MJ 4A3GJ 3TP3A 5M3MJ 1T56A 2DJNA 3TP0A 4D5CA 1FTTA 2XRLA 3ZQIA 3HBLA 5F27A 1R9TJ 2NS8A 4BXXJ 3BTLA 2LFBA 4AUXA 1ZR2A 3BR5A 3NARA 3FKIJ 4L5EA 2NVXJ 3QPLA 2R92J 3S2DJ 3GBGA 1MBHA 4AC0A 3BR6A 4M3EA 1BA5A 3CDLA 4C2MJ 3MKLA 2TRTA 4I6ZA 2W48A 2PMZN 3S1NJ 4IHYA 3JRAA 5FKOA 4B1RA 5M3FJ 4RBOA 2DA7A 3BG5A 2ECCA 4A3IJ 5FKLA 4FE4A 5IOZA 4D5FA 1BL0A 3S1QJ 5DS9A 1U8BA 3S1RJ 4S0HB 2QF7A 3CQZJ 3BT9A 2FJ1A 2HQ5A 1ETKA 5EDNA 1I3QJ 4JYKA 1B8IB 1UMQA 2G0EA 2MW8A 1UHSA 5FKKA 5C4JJ 5M5WJ 4A3FJ 1PUFB 1GDTA 1I50J 5K7FA 5EF6A 2MSYA 3BR0A 4LOCA 3K2AA 4BKXA 2JMWA 1P7JA 2EH3A 1XS9A 2GLOA 1A6IA 2JWTA 2OF7A 1DU6A 1U9OA 3B6AA 1DU0A 2DMTA 4NDLA 3B6CA 3SFIA 1AKHB 1JT6A 2LKXA 1MH4A 1IJWC 2DA2A 2DN0A 3ZQFA 3HDDA 4M6VA 4XIDA 2CJJA 4UUSB 1ITYA 3MVPA 1P7IA 4XRMA 4DZPA 1F43A 1GV5A 2D5VA 1B72A 3GTPJ 2DMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCT C;  2WV1 A;  2KT0 A;  1QVU A;  2K40 A;  1K83 J;  2ECB A;  3BR3 A;  5JLX A;  1FIP A;  1S7E A;  2Y9Y A;  3HOU J;  2MG4 A;  3MN2 A;  5E3L A;  4JX6 A;  3GTO J;  2GBY A;  3G1O A;  2XGD A;  2YU9 J;  2JA6 J;  4J19 A;  5M5X J;  1U78 A;  1B72 B;  1AHD P;  3RQI A;  3ZQG A;  2VUM J;  1ZKG A;  4X1E A;  2DA4 A;  2X9D A;  1UG2 A;  2EZL A;  5J1U A;  2Y31 A;  1ZR4 A;  1OJL A;  3Q0V A;  5IP6 A;  2Y0S N;  4BBR J;  2EZI A;  5GP9 A;  4MFD A;  4IEJ A;  2XPU A;  4M3D A;  3HOY J;  1IGN A;  2DMQ A;  2CQX A;  9ANT A;  4IHW A;  2DA5 A;  4W1U A;  2LD5 A;  4BY1 J;  2B63 J;  2L7Z A;  1ETY A;  1SAN A;  1QVT A;  2XPV A;  3GTL J;  2DA3 A;  1XG1 A;  2M9H A;  3BR2 A;  2O9L A;  1WPK A;  2Y2Z A;  1T33 A;  3QPS A;  3RZD J;  3BR1 A;  5IYD J;  1HOM A;  1WH7 A;  1JJ6 C;  5F0F A;  2R5Z A;  1A5J A;  3HB9 A;  2R7Z J;  1FIA A;  3OSF A;  3BG3 A;  2L7M P;  1H88 C;  5EG0 B;  2LTP A;  1EF4 A;  1JUP A;  1MNM C;  2RAE A;  3DEW A;  4M3G A;  1JGG A;  5E3N A;  3LOC A;  1Y1W J;  1TWF J;  2HOS A;  2AO9 A;  4CYC A;  2OPT A;  1BJZ A;  3H0G J;  1G2H A;  5E3M A;  3CMY A;  5EZG A;  1MBK A;  3HGG A;  4MIM A;  2FD5 A;  3C2B A;  3CCY A;  4UUT A;  4A69 C;  1FEX A;  1U9N A;  2HYJ A;  2NVT J;  4JP0 A;  2M8G X;  2WB1 N;  3PM1 A;  1Z77 A;  3W6V A;  1GT0 C;  2O7O A;  3S1M J;  1RPW A;  2CUF A;  2XPW A;  1H89 C;  1FTZ A;  1JUS A;  3OSG A;  2HDD A;  1TWA J;  2LR8 A;  2NVQ J;  2R5Z B;  3IH3 A;  1OFC X;  5IYC J;  1ENH A;  2JK3 A;  3QQA A;  2JA7 J;  3JRC A;  1AKH A;  1MBG A;  3M4O J;  3FIS A;  5IP7 J;  3ZQH A;  4XK4 A;  3A01 A;  2DMU A;  4XRS A;  1ETV A;  4CYC B;  2LLK A;  1VI0 A;  2E19 A;  3JRG A;  5C3E J;  3TW7 A;  1WGX A;  2HXI A;  2X48 A;  3RKQ A;  2EZK A;  3GTJ J;  2XGC A;  2R5Y A;  4MFE A;  4DYR A;  3ZOB A;  2IAI A;  2XB5 A;  5J3L A;  1LFU P;  1VND A;  1TWH J;  4MO7 A;  3S16 J;  3F0C A;  5K7H A;  5FKN A;  3UKG A;  4ABZ A;  4QSH A;  1ETW A;  2O8K A;  3K7A J;  4A3C J;  1APL C;  2HOA A;  5EZH A;  3S15 J;  3S17 J;  5FLM J;  3VPR A;  5F1J A;  5BNG A;  4IHX A;  3NAU A;  5EG0 A;  2CRG A;  4DW6 A;  3JRF A;  3L1P A;  1RET A;  1X2M A;  2DMN A;  2WAQ N;  3A03 A;  4X6A J;  4I76 A;  4V2F A;  1IUF A;  4JX4 A;  5J1R A;  4XRS G;  4DYC A;  1JTY A;  4EEF G;  3BTC A;  1ETX A;  1HCR A;  1Q1V A;  1Z0X A;  4M3B A;  2M2E A;  5GPA A;  3JRE A;  2EZH A;  1JJ8 C;  3LSJ A;  3WHB A;  2L0K A;  2H1K A;  4B4C A;  2LVS A;  2XB0 X;  3I4N J;  5EYR A;  2KDZ A;  2JA5 J;  3ZQC A;  5FJ8 J;  2COB A;  1Y1V J;  1IV6 A;  4A93 J;  3HOV J;  2E1O A;  1POG A;  2Y30 A;  3M3Y J;  2R5Y B;  1RKT A;  5E3O A;  3HOZ J;  2Y9Z A;  2N8G A;  1LFB A;  2XGE A;  2IEK A;  2CUE A;  4W97 A;  3JRH A;  4HNV A;  1BW6 A;  1YRN A;  2HOT A;  4C3I J;  1HDD C;  2JN6 A;  1JTX A;  4UUS A;  1HLV A;  5IP9 J;  5IYB J;  3GTM J;  3WHC A;  2FQ4 A;  1CQT A;  2CQQ A;  2GM4 A;  1IRZ A;  1H8A C;  3IH2 A;  1ORK A;  4D7N A;  4BY7 J;  4MLO A;  3S14 J;  3FIW A;  4BBS J;  3BQY A;  3A01 B;  4FE7 A;  2HXO A;  3RZO J;  1GVD A;  3G1L A;  1X58 A;  1JKP C;  4DZJ A;  2L7F P;  3SDG A;  3H3V K;  5F0C A;  5J1Y A;  5EGO B;  1F36 A;  3O8H A;  1HDP A;  1MH3 A;  2JA8 J;  4A3B J;  1IC8 A;  2I10 A;  4C3H J;  1PUF A;  1MSF C;  2P81 A;  3HOX J;  5IOY A;  1MSE C;  3BTJ A;  5EEA A;  2EQR A;  2E2H J;  3GTK J;  2AHQ A;  1IG7 A;  1WH5 A;  3BQZ A;  4IHV A;  3E7L A;  2ME6 A;  3LSG A;  4AYB N;  3SJM A;  2NS7 A;  3JRD A;  4DYQ A;  5FLV A;  2VKE A;  2TCT A;  1I6H J;  2YUS A;  2FX0 A;  3JR9 A;  2IBD A;  2H8R A;  1X2N A;  4A3L J;  2ME0 A;  2JJ7 A;  4GFB A;  5F0H A;  4D7M A;  1FJL A;  5M5Y J;  3DCF A;  1QPI A;  2ELK A;  2MGQ A;  4RDU A;  2X6O A;  2L9R A;  4FTH A;  3TED A;  1XC5 A;  1TWC J;  5DTD A;  4JX5 A;  3S2H J;  4V2G A;  3FK6 A;  3PO2 J;  4A3J J;  5HOD A;  1IDZ A;  4M3F A;  3TW6 A;  3OOU A;  1NK2 P;  2XSD C;  2EBI A;  2NOG A;  3FK7 A;  3IH4 A;  3HGY A;  1TC3 C;  3IV5 A;  2ID3 A;  3Q0W A;  1RKW A;  1ZK8 A;  2LP0 A;  1LE8 B;  4Y7N J;  3HOW J;  1IDY A;  4B3A A;  4A3E J;  2M0C A;  2ZB9 A;  3G1M A;  3JRB A;  5C4X J;  1AU7 A;  2CU7 A;  2DA1 A;  3BG9 A;  1ETO A;  3LSP A;  2LK2 A;  4Y52 J;  1VF9 A;  4G12 A;  1O4X A;  1ZQ3 P;  1JKO C;  5GPC A;  3LSR A;  1LE8 A;  1JKR C;  1RR7 A;  2M34 A;  1ETQ A;  1MBE A;  1W0U A;  1NTC A;  1QRY A;  2VPR A;  3GTQ J;  2E2I J;  2K9Q A;  3HEF A;  1ZTR A;  1RES A;  3O8G A;  4FIS A;  4QIW N;  3HKZ N;  3LNQ A;  1ZGW A;  1MBF A;  2K9S A;  5IPA A;  1K61 A;  2DTZ A;  2VKV A;  1W0T A;  1NK3 P;  5FKM A;  1OCP A;  5K7Z A;  1VFC A;  5F04 A;  3A02 A;  1JT0 A;  2LY9 A;  4QTR A;  1GUU A;  2YS9 A;  3OIO A;  4A3K J;  1GV2 A;  2R93 J;  3D1N I;  1B8I A;  2R0Q C;  2E2J J;  3HM5 A;  3Q0U A;  1WI3 A;  1MBJ A;  1YRN B;  4FCY A;  1D5Y A;  2HI3 A;  5EGO A;  4A3D J;  2QCO A;  5F08 A;  1TWG J;  3JRI A;  2NVY J;  1BW5 A;  3Q3S A;  5C44 J;  2K9N A;  3PO3 J;  1WCM J;  4XIC A;  1SFO J;  1JKQ C;  2ID6 A;  4A3M J;  3GTG J;  2VI6 A;  1E3O C;  4C3J J;  3ZQL A;  1JUM A;  1HF0 A;  3BTI A;  5JLW A;  2DA6 A;  3I4M J;  4A3G J;  3TP3 A;  5M3M J;  1T56 A;  2DJN A;  3TP0 A;  4D5C A;  1FTT A;  2XRL A;  3ZQI A;  3HBL A;  5F27 A;  1R9T J;  2NS8 A;  4BXX J;  3BTL A;  2LFB A;  4AUX A;  1ZR2 A;  3BR5 A;  3NAR A;  3FKI J;  4L5E A;  2NVX J;  3QPL A;  2R92 J;  3S2D J;  3GBG A;  1MBH A;  4AC0 A;  3BR6 A;  4M3E A;  1BA5 A;  3CDL A;  4C2M J;  3MKL A;  2TRT A;  4I6Z A;  2W48 A;  2PMZ N;  3S1N J;  4IHY A;  3JRA A;  5FKO A;  4B1R A;  5M3F J;  4RBO A;  2DA7 A;  3BG5 A;  2ECC A;  4A3I J;  5FKL A;  4FE4 A;  5IOZ A;  4D5F A;  1BL0 A;  3S1Q J;  5DS9 A;  1U8B A;  3S1R J;  4S0H B;  2QF7 A;  3CQZ J;  3BT9 A;  2FJ1 A;  2HQ5 A;  1ETK A;  5EDN A;  1I3Q J;  4JYK A;  1B8I B;  1UMQ A;  2G0E A;  2MW8 A;  1UHS A;  5FKK A;  5C4J J;  5M5W J;  4A3F J;  1PUF B;  1GDT A;  1I50 J;  5K7F A;  5EF6 A;  2MSY A;  3BR0 A;  4LOC A;  3K2A A;  4BKX A;  2JMW A;  1P7J A;  2EH3 A;  1XS9 A;  2GLO A;  1A6I A;  2JWT A;  2OF7 A;  1DU6 A;  1U9O A;  3B6A A;  1DU0 A;  2DMT A;  4NDL A;  3B6C A;  3SFI A;  1AKH B;  1JT6 A;  2LKX A;  1MH4 A;  1IJW C;  2DA2 A;  2DN0 A;  3ZQF A;  3HDD A;  4M6V A;  4XID A;  2CJJ A;  4UUS B;  1ITY A;  3MVP A;  1P7I A;  4XRM A;  4DZP A;  1F43 A;  1GV5 A;  2D5V A;  1B72 A;  3GTP J;  2DMP A; 
#chains in the Genus database with same CATH topology
 1OCT C;  1LDK B;  4YII A;  4A5N A;  1QVU A;  4FT8 A;  2K40 A;  1ON1 A;  3VSL A;  1UST A;  5JLX A;  4A6E A;  2Y9Y A;  2WAF A;  3KLO A;  5DYM A;  3UNG C;  3DFG A;  4F7Z A;  5HLH A;  3G1O A;  4P96 A;  1Z3X A;  2X0L A;  1QHH D;  4NQW B;  5M5X J;  1B72 B;  1AHD P;  2COM A;  3ZQG A;  3RJP A;  2VUM J;  3I54 A;  1R00 A;  2ZFU A;  4LD5 A;  1YIT I;  2GAU A;  1WRJ A;  3CLQ A;  2HOE A;  1XMA A;  2R7V A;  2ZJQ F;  2EZI A;  4XON A;  4ENN A;  3TO6 A;  3CJR B;  4MEY F;  1RC9 A;  4LK0 F;  2DMQ A;  1IZ1 A;  2WB1 A;  3CUO A;  9ANT A;  1LJ9 A;  1NG6 A;  4IHW A;  4XLC A;  4Y15 A;  2UUZ A;  5DUI A;  2L7Z A;  1SAN A;  4KIB A;  4DJA A;  5DM7 F;  2P5L C;  5FLX K;  3RYP A;  3GTL J;  3BR2 A;  1ZGA A;  2O9L A;  3RZD J;  1OQY A;  3KP5 A;  1XSX A;  1PP8 F;  4OAZ A;  5CKT A;  1BR1 A;  1WH7 A;  5F0F A;  3S3M A;  3WU0 A;  2R7Z J;  3HOS A;  3ZMU A;  3OSF A;  2VL8 A;  3BG3 A;  2NNY A;  1D1C A;  1V5G A;  3L2U A;  2CH0 A;  1J5Y A;  1MNM C;  1OR7 C;  2RAE A;  1JGG A;  1AWC A;  2A68 F;  3P9I A;  2HOS A;  1OCC H;  3CES A;  1GLN A;  3KYL A;  2FNA A;  2PMH A;  4I0A A;  1BJZ A;  4E7S A;  4IO9 F;  2PJR B;  3R60 A;  4RM2 A;  2Q2E A;  2K27 A;  3R0A A;  5J8F A;  2KIU A;  1MBK A;  1OYY A;  2AXT C;  3KFW X;  4UUT A;  4IOC F;  1MJ9 A;  1U9N A;  3RYR A;  3OYC A;  3H35 A;  2AS5 F;  1Z77 A;  2K3F A;  2F4M B;  3QPT A;  1QA6 A;  3Q9V A;  3I59 A;  3AG1 H;  4A12 A;  1CF7 A;  3LA7 A;  1TQP A;  3LAP A;  1TQI A;  2FNP A;  2CV0 A;  5DV5 A;  1JUS A;  2A05 A;  5HOO A;  2XGX A;  3F6V A;  4CA0 A;  4I09 A;  4IHT A;  4OIN F;  3WTS C;  4EGZ A;  2QEN A;  2KIM A;  5K5R A;  2NVQ J;  5H6Q A;  2DO7 A;  3K4J A;  4LG3 A;  3AKZ A;  4BHB A;  2WTE A;  2JK3 A;  3G2B A;  5A2Q K;  3JRC A;  2ZME B;  4OMZ A;  3FM5 A;  1T38 A;  1XDS A;  2IS4 A;  4L5I A;  3MQ0 A;  4LIT A;  1BOB A;  2KL4 A;  2DJI A;  2LLK A;  1VI0 A;  3JRG A;  3COA C;  5C3E J;  5GAH J;  1BOA A;  2HXI A;  2QQ8 A;  4PZJ A;  4PJL A;  4CCK A;  4BAC A;  3J80 Z;  3GTJ J;  1X1C A;  3RKQ A;  2R5Y A;  4MFE A;  4DYR A;  2XB5 A;  2YX4 A;  4XSX F;  2CW8 A;  2F2E A;  1VND A;  2JUC A;  4IXA A;  1TWH J;  4MO7 A;  2A61 A;  3V7C A;  3TOB A;  2Y0S A;  3F0C A;  3FMS A;  3D5L A;  2J5P A;  4UV9 A;  2PBI A;  1ETW A;  1F1Z A;  2GA1 A;  3GYH X;  4A3C J;  1APL C;  1M1E B;  5EZH A;  4M9X A;  1WFX A;  3VPR A;  4EJW A;  3OL4 A;  4UV8 A;  1UJ8 A;  3F72 A;  3NAU A;  5EG0 A;  3L1P A;  2DMN A;  4X6A J;  1UCR A;  2MA3 A;  3KZY A;  4V2F A;  5K5Q A;  4XRS G;  1FWZ A;  4DYC A;  4EEF G;  3BCB A;  2GIZ A;  2VB6 A;  4M3B A;  1XGS A;  3JRE A;  4BE2 A;  4M73 A;  1JJ8 C;  2HVQ A;  2L0K A;  2H1K A;  3CMA I;  2M4K A;  2GXB A;  5EJC A;  4BH9 A;  1O3Q A;  3KYC B;  2KDZ A;  3TBI A;  3W3C A;  4BAY A;  5FJ8 J;  1Y1V J;  2K3P A;  4KA4 A;  1ZAR A;  3HOV J;  4R1H A;  1POG A;  1LB2 A;  1G8X A;  3M3Y J;  2XDV A;  1RKT A;  3WOD F;  1TZL A;  4NHJ A;  4L0Y B;  2HEO A;  1IF1 A;  1JHH A;  1TNT A;  2CUE A;  4G94 A;  4W97 A;  4HNV A;  3JRH A;  1YRN A;  2HOT A;  3FXJ A;  3CME I;  4C3I J;  1BJA A;  1IW7 F;  2DFH A;  4RGR A;  1OCO H;  2GQQ A;  2WWY A;  1IRG A;  4UUS A;  2ADU A;  1RUO A;  3GTM J;  2WAE A;  3WHC A;  3R0J A;  2FRH A;  4Z2Y A;  4KMF A;  1IRZ A;  2V9P A;  1H8A C;  4HQE A;  2RV8 A;  1XSD A;  1OCZ H;  2CUJ A;  1NH3 A;  2LKP A;  4WXD A;  3HTU A;  5DM6 F;  3TOA A;  4D7N A;  1X4P A;  5JR3 A;  1N75 A;  5JHU A;  2X1E A;  4MGR A;  1B9M A;  3NQO A;  4GXO A;  4HF1 A;  2HXO A;  1X58 A;  4RAZ A;  3W2W A;  2L7F P;  2WV0 A;  2IGO A;  1E2X A;  2IRF G;  1HDP A;  1ZRE A;  1MH3 A;  2HU9 A;  2VC1 A;  5BPD A;  3FMQ A;  2V6C A;  2XV4 S;  5FFZ A;  4CCL A;  2RNJ A;  4ZH4 F;  4Y13 A;  3ZPL A;  3V7R A;  5IOY A;  4N9H A;  3CCS I;  3W6K B;  1P4A A;  4M6X A;  2H1L A;  3J7Z I;  2VQH A;  1FYM A;  4AM3 A;  4MNU A;  4A0Z A;  3T5X A;  3LSK A;  3BQZ A;  3ZXS A;  3ZN0 A;  2EFN A;  3HPG A;  3I58 A;  3QPH A;  5D4R A;  5FLV A;  2VC0 A;  1O3T A;  1BIB A;  1D8J A;  4N9I A;  2IBD A;  2H8R A;  4B8X A;  1BI1 A;  1X2N A;  4ESJ A;  2X1C A;  1U5T A;  1EKE A;  3I9V 2;  5F0H A;  4D7M A;  1SVO A;  1YHQ I;  2GOM A;  1OKR A;  2X6O A;  2XAF A;  3OYH A;  3TED A;  2V1X A;  2R7D A;  3C1D A;  2PJP A;  2M1B A;  3NEU A;  4XKB A;  1O3S A;  4RLF A;  3GUD A;  2Z1D A;  2UXN A;  1YX5 A;  2EBI A;  2RN7 A;  3I3L A;  3MKZ A;  2L54 A;  3K70 C;  1O7F A;  3IH4 A;  2Y69 H;  4NQW A;  2HQR A;  3EUH C;  2M87 A;  3L00 A;  2R7S A;  2ESN A;  3A0B C;  1RKW A;  1LNW A;  5LBQ A;  4F55 A;  3A4C A;  3KP2 A;  1ONV A;  1IDY A;  1W5S A;  2PG4 A;  2FUG 2;  4U87 A;  2ZB9 A;  1AU7 A;  1D0Z A;  3BPX A;  1YJW I;  2C6Y A;  2E36 A;  1TBX A;  2LK2 A;  3C2H A;  3DXJ F;  4IHS A;  1S72 I;  4Y52 J;  4BNC A;  4N4O B;  4G12 A;  1LKX A;  5LHI A;  3FXQ A;  2BY0 A;  2H94 A;  5ICE A;  3GFM A;  3LSR A;  5TGT A;  1FYL A;  1GHC A;  4HV5 A;  1LE8 A;  1SFX A;  1JKR C;  4OU0 A;  1RR7 A;  2M34 A;  2D2W A;  2I8D A;  3DPL C;  2XRO A;  2E2I J;  3OOP A;  3B73 A;  1X4O A;  2RRE A;  2X6Y A;  1ZN2 A;  3HEF A;  1RES A;  3O8G A;  5CVR A;  4QIW N;  3HKZ N;  3LNQ A;  4HX8 A;  1MBF A;  2QSG X;  2VKV A;  3WGG A;  5FRN A;  2QGU A;  3ZGK A;  4ZZL A;  5K7Z A;  2QYO A;  3MKW B;  2LY9 A;  4B47 A;  3TGN A;  2H27 A;  3CTA A;  4EJV A;  1JXS A;  1ON2 A;  2LF7 A;  5LGU A;  1GUU A;  4ZC3 A;  4XL9 A;  3OS1 A;  3KLN A;  1TQM A;  1B8I A;  2K4B A;  2R0Q C;  2Q2E B;  3ABM H;  5E79 C;  3JSP A;  4U0W A;  2P7V B;  1Y39 A;  4MTE A;  5EEH A;  1SD5 A;  5GTH C;  4I99 C;  2QCO A;  3E6C C;  2DFE A;  5F08 A;  3ZQ7 A;  1YQA A;  3JRI A;  2OQG A;  4PK4 A;  2OCC H;  2K9N A;  3CD6 I;  2BV6 A;  5JVT A;  4XIC A;  1XGO A;  1QGP A;  1R22 A;  4AVZ A;  1S3J A;  3B02 A;  3REO A;  1OYW A;  5FB2 A;  1FOY A;  1MMG A;  1O3R A;  3BTI A;  3I4M J;  1DGR M;  3TP3 A;  2P6S A;  2DJN A;  4NC6 A;  3BJ6 A;  5JFR A;  2Y0M A;  2CUZ A;  2XRL A;  4WK8 F;  3U21 A;  3IL2 A;  3DEE A;  3DTK A;  2XF6 A;  3TDZ C;  4BXX J;  2YPR A;  3BTL A;  2D45 A;  4RS8 A;  2GWR A;  3MZ8 A;  5IT9 Z;  4DIQ A;  2IJL A;  2R7X A;  2R7T A;  4XRF A;  2CFO A;  3QYF A;  4ZDP A;  3HSF A;  3QPL A;  1F9N A;  4CHU A;  3S2D J;  1MBH A;  4KDP A;  4PFO A;  3H9Q A;  3D5R C;  2NOJ B;  4M3E A;  3IKV A;  3PIP F;  2WY8 Q;  1KU7 A;  4GYG A;  2OQR A;  4XKV A;  4I6Z A;  1FPQ A;  2A69 F;  5DCM B;  4HW0 A;  4IHY A;  1FMW A;  1V5E A;  2XAS A;  3JRA A;  3L2V A;  3DU5 A;  5AON A;  2UXX A;  3O6B B;  1ZRC A;  1V54 H;  5FKL A;  5D5X B;  5ILV A;  3RPU A;  2HPM A;  1GXQ A;  1G3Y A;  1U8B A;  4PJM A;  1WJ5 A;  3RKY A;  4OIP F;  3S1R J;  1S9H A;  4XN0 A;  4QPQ A;  2QA4 I;  2FJ1 A;  2LSO A;  1JHF A;  3SFZ A;  1I3Q J;  2ZNY A;  4X0G A;  4HYE A;  4Q47 A;  1I5Z A;  4G6D A;  1B1B A;  2MW8 A;  4IRG A;  5M5W J;  2RKH A;  5D6F A;  1SMT A;  3OYN A;  4KUM A;  3BLY A;  5DEQ A;  3EUK L;  3K2A A;  5HNH A;  2XUB A;  2VBX A;  4HRI A;  4LLG F;  4P9F A;  1O7L A;  2HGC A;  3LFK A;  1P7J A;  2CV2 A;  5K5O A;  4ETS A;  3W2V A;  5HDG A;  3ONQ A;  1A31 A;  3N97 A;  3MZY A;  1SAX A;  2LG4 A;  5B1B H;  4DOZ A;  4BQA A;  3B6C A;  3L7W A;  5CYV A;  3SFI A;  1AKH B;  4I0B A;  3EUA A;  3L2Q A;  1V5F A;  1T0F A;  4DBR A;  5HS8 A;  2KRF A;  2ZJ2 A;  5D5W B;  1IN7 A;  3HDD A;  4XID A;  2BW3 B;  1ACI A;  1MKM A;  2KZV A;  1F43 A;  2LY2 A;  2D5V A;  1S7A A;  3HC7 A;  2J5O A;  2E5Z A;  4WXH A;  2Q1Z B;  4E6K G;  2IGM A;  2WV1 A;  4G6T B;  3LFU A;  5KK1 A;  3VYR B;  3J80 K;  3BG7 A;  2IPQ X;  2E71 A;  4CDG A;  1FBU A;  1ZLJ A;  3MN2 A;  5E3L A;  3W6J B;  3GTO J;  2YU9 J;  2R7O A;  1QZZ A;  2QQ9 A;  4P9U A;  3MCZ A;  2HTJ A;  5CVV A;  2P0W A;  3EDP A;  1R5I D;  2W4S A;  3RCO A;  1ZR4 A;  3I0T A;  3SEQ A;  1OJL A;  4A6D A;  3S3N A;  1RUN A;  2Y0S N;  2UWM A;  2X51 A;  5GP9 A;  2R4G A;  4AIH A;  3JAM Z;  3GWZ A;  2O6G E;  5LEJ A;  3LL7 A;  3MKY B;  3QRF F;  3BZ6 A;  4CCM A;  3V8J A;  2VKH A;  3KET A;  5HLG A;  4LIV A;  2AQE A;  4BY1 J;  5HNF A;  2DA3 A;  1XG1 A;  1SAU A;  2MFZ A;  2Y2Z A;  2L9N A;  1UG0 A;  1PJR A;  5IYD J;  1BR4 A;  1A5J A;  1J7K A;  3ASO H;  1UAA A;  3KP6 A;  4HX4 A;  3DF8 A;  4LB5 A;  2L7M P;  4M71 A;  1WZ2 A;  1T8I A;  4ESF A;  1H88 C;  3MAJ A;  1I1G A;  2LTP A;  1JUP A;  2NNN A;  1R49 A;  3KIO A;  1Z1D A;  4M3G A;  4O3M A;  1XCV A;  3LOC A;  1PDN C;  2AO9 A;  2WBM A;  1R4M B;  4J01 A;  3JTG A;  3CLO A;  3NRV A;  4ITV A;  1G2H A;  4XR6 A;  5E3M A;  3CMY A;  3HGG A;  5ILU A;  1FEX A;  2MD5 A;  1P92 A;  1EA3 A;  2M8G X;  3TO9 A;  2WB1 N;  3AG2 H;  4DBQ A;  3CJT B;  4LLL A;  5HDN A;  4OMY A;  5LGT A;  4B3X A;  4HQM A;  2QEX I;  4BQO A;  1BR2 A;  2IS2 A;  5J8C A;  3BJA A;  4Q48 A;  2L4A A;  1L3L A;  4AIK A;  4JBA A;  2NRA C;  1LVA A;  1Y8Q B;  2VJI A;  1FZP B;  2R5Z B;  2ZXJ A;  1SVL A;  1TNS A;  1R4N B;  4F52 A;  2ZXH A;  3BRO A;  1SMY F;  4I02 A;  3U2R A;  4M6Y A;  1UHM A;  2L2O A;  4B09 A;  3BP8 A;  2CG4 A;  2DMU A;  2F48 A;  3GFL A;  2A6E F;  2OC6 A;  3FXK A;  4ZTJ A;  4UVC A;  5CPR B;  4FX4 A;  1YJ9 I;  3OYD A;  2XGC A;  2HVS A;  1J2X A;  2V7F A;  3OWT A;  5J3L A;  1LFU P;  2KDO A;  5GAD J;  2A6H F;  2A07 F;  1WJF A;  3HZJ A;  5K7H A;  5FKN A;  1VQ5 I;  4ABZ A;  1HXD A;  1W7P A;  4FAS D;  4A0Y A;  2WY7 Q;  1R1U A;  3BG6 A;  2W7N A;  1K79 A;  2R7F A;  3FXL A;  3OS2 A;  3S15 J;  3S17 J;  3F8N A;  4HSR A;  5FLM J;  2EV5 A;  5BNG A;  5F1J A;  2EB7 A;  4IHX A;  2MLK A;  4EAT A;  1UHW A;  3JRF A;  2H09 A;  4KMU X;  1RET A;  1X2M A;  2IP2 A;  3CC7 I;  4HOB A;  4I76 A;  4UNO A;  2OAZ A;  1IN4 A;  5J1R A;  1HST A;  1HQC A;  5HVQ C;  2VJ4 A;  1TT5 B;  5E8I A;  1HCR A;  1Z0X A;  4YIF A;  5GPA A;  2W1O A;  3LSJ A;  3KPH A;  3WHB A;  4HPQ A;  2PN6 A;  1YS7 A;  1QPM A;  4ANJ A;  2RNG A;  1Y0U A;  1Y56 A;  2JT1 A;  3K9T A;  2JA5 J;  1EJ9 A;  2COB A;  2HKO A;  2IGN A;  1Z6T A;  4XLE A;  1TP4 A;  3ULQ B;  5LGN A;  4A93 J;  4LJZ F;  1IRF A;  1L0O C;  1MJA A;  2HWV A;  2E7X A;  2L01 A;  3CP2 A;  5HDK A;  3P5J A;  4B48 A;  3E3V A;  2FML A;  2DK8 A;  1LFB A;  2Q8K A;  2DOE A;  3I53 A;  5FO5 A;  3MEX A;  5J40 A;  3F22 A;  5B3S H;  1HW2 A;  1X1A A;  3R4K A;  1WHU A;  4KIC A;  2JN6 A;  3RTR A;  3WE2 A;  2P7C B;  4AU7 A;  2FBI A;  2Z2S B;  4ZYH A;  2VBY A;  3FZV A;  1MMD A;  2Z16 A;  1VQO I;  2FQ4 A;  1CQT A;  3RIR A;  3T1B A;  2E5N A;  3IWZ A;  3JSO A;  1QZE A;  4P55 A;  5LHG A;  1NHA A;  4BE0 A;  1FBS A;  4YFX F;  2R7Q A;  4MLO A;  5JHF A;  3ZN1 A;  1WVR A;  5DD8 A;  3VFZ A;  5D5V B;  3F6O A;  3HRS A;  1MD0 A;  1EH7 A;  4WXC A;  1GVD A;  2DQL A;  4H4K C;  4DZJ A;  3EYY A;  4HA8 A;  3TMO A;  1T98 A;  2QUF A;  3NWS A;  5F0C A;  5J1Y A;  3O8H A;  2JSC A;  3GME A;  3HSE A;  1IC8 A;  4BXF A;  3K4M A;  4C3H J;  2OD5 A;  2E1N A;  4HF0 A;  2PMZ A;  2P81 A;  1WJB A;  1ZRD A;  3BTJ A;  4KN4 X;  2E2H J;  2I5U A;  5KAI C;  4YRV A;  2K9L A;  3HUG A;  4RGX A;  4DNC A;  2ME6 A;  3ABU A;  3LSG A;  3BDD A;  4HLX A;  3JRD A;  2XAG A;  1FYK A;  4GO1 A;  2VKE A;  2YUS A;  2QM3 A;  6PAX A;  3F8B A;  4DQ2 A;  3DBR B;  1USS A;  2JJ7 A;  3V4G A;  4GFB A;  4HX7 A;  5HLT A;  2BW3 A;  2Z9O A;  1SFK A;  4D1Q A;  1YOV B;  3M1C A;  1QPI A;  1A35 A;  2ELK A;  1VZ0 A;  4XLN F;  4RDU A;  1YO5 C;  3U1D A;  3FHZ A;  2Y75 A;  1E17 A;  4NB5 A;  4UUV A;  3S2H J;  4CSW A;  1B59 A;  3OYK A;  4V2G A;  5ILS A;  2XKO A;  5H6R A;  1VQ7 I;  2M4G A;  4A3J J;  1YIJ I;  1IDZ A;  4M3F A;  4LG0 A;  1B9N A;  3VOD A;  1U5T B;  2XAJ A;  4EQQ A;  2BBY A;  1S6L A;  3IV5 A;  1X3Z B;  4XMY A;  1BN5 A;  3SZT A;  4E7J A;  5E1Z B;  1LE8 B;  3ZP5 A;  4G7H F;  1TW2 A;  1FSH A;  4A3E J;  4BJ6 C;  3JRB A;  1LFP A;  5HS7 A;  1OLT A;  2DA1 A;  1R71 A;  3A0H C;  3BG9 A;  4G7Z F;  2O8X A;  2D1V A;  2ZKZ A;  4EJO A;  2EFP A;  5K1Y A;  1VF9 A;  1O4X A;  1RNL A;  1ZQ3 P;  3K4N A;  4LMY A;  5GPC A;  3IWF A;  5BPI A;  4HLY A;  2VT3 A;  3IAS 2;  2V9K A;  2ZXI A;  4NC7 A;  4ZYA A;  3H0D A;  2IXS A;  1W0U A;  2FU4 A;  2VPR A;  1HW5 A;  2EIM H;  4LLN A;  1ZTR A;  5HLI A;  4PCQ A;  2K9S A;  4IF4 A;  1J75 A;  1XDU A;  2DTZ A;  1W0T A;  5FKM A;  1OCP A;  1LDJ A;  2W82 A;  2M3A A;  3DQV C;  2MAB A;  1VFC A;  5F04 A;  3HHH A;  2VBZ A;  4KNY A;  3KP3 A;  3RI4 A;  3EET A;  4XLP F;  4FX0 A;  2R93 J;  3HSR A;  3D1N I;  2L9S A;  5H2F C;  4L9J A;  3Q0U A;  1WI3 A;  1IN8 A;  1MBJ A;  2STT A;  2E1M C;  3OYG A;  1VQ6 I;  3WGI A;  4PSW A;  4A3D J;  1IN6 A;  1TWG J;  2M30 A;  2XVC A;  4Y4R A;  1BW5 A;  3J7A Y;  3Q3S A;  3CJN A;  3MZH A;  4XOR A;  1WCM J;  2ZSH B;  5TRD A;  1C0W A;  2L3D A;  2PEX A;  4AVP A;  1FOW A;  2E7W A;  2DYS H;  2QKM B;  1LPQ A;  1A04 A;  4PGG A;  3UR3 C;  4E7Z A;  4A3G J;  5L3D A;  5CLS A;  3TP0 A;  3KEQ A;  1OYI A;  3ZQI A;  3FWE A;  4RB2 C;  2FMY A;  1R9T J;  4G9Y A;  4Q5S F;  2LBF B;  2O3F A;  3ABK H;  2HYG D;  1QHG A;  2JTV A;  5CVI A;  1X1P A;  3ABT A;  4AUX A;  4M74 A;  3BR5 A;  3K70 D;  2V1D A;  3FXU A;  2DBB A;  4A2U A;  1S29 A;  4D0P A;  5KHD A;  3DKX A;  2KRC A;  2R92 J;  1WJE A;  2ZJR F;  1YFH A;  3GBG A;  4BL0 B;  2M8E A;  3PFY A;  3ROU A;  2JA2 A;  2NAZ A;  3DLL F;  2E1C A;  5DUK A;  3FBN B;  2BXZ A;  3JAM K;  4HNT A;  4II3 A;  3MKL A;  3PNV A;  2W48 A;  1YYV A;  1XGM A;  5FKO A;  5L3C A;  2IW5 A;  4B1R A;  4OWR B;  2ELH A;  2DA7 A;  2V9V A;  3L09 A;  3VEP A;  3WTW C;  1KA8 A;  4BDZ A;  4A3I J;  3FF5 A;  3S1Q J;  1IXR C;  5F6F A;  2KKO A;  3CP8 A;  4O6J A;  4RAG A;  3F8C A;  3QP6 A;  5AIP A;  3AAF A;  4G7O F;  2R7U A;  3G3Z A;  1ETK A;  2GZW A;  3PIO F;  2F5E A;  4CCO A;  4R79 A;  1ZEL A;  4JYK A;  1B8I B;  5E1W A;  1UHS A;  3H3U A;  1I50 J;  3OYM A;  1DUX C;  5EF6 A;  2MSY A;  3BR0 A;  1P6R A;  2H6C A;  4LK1 F;  3CO7 C;  2FSW A;  4BKX A;  4GDF A;  3VB2 A;  3IHU A;  5D8L B;  2EH3 A;  1B4A A;  5DCF A;  2JWT A;  3K4C A;  1DU0 A;  3HPH A;  3WU1 B;  1P4W A;  4KIG A;  5H20 A;  2DMT A;  3KYD B;  4NDL A;  3SEZ A;  3SQN A;  4XOT A;  4A5M A;  2X1D A;  3K4B A;  3GVA A;  2LKX A;  2KRH A;  1D3Y A;  5FRO A;  2EIL H;  2LYC A;  4C2U A;  3AG3 H;  2DN0 A;  3ZQF A;  4BJ5 C;  1ITY A;  1U0J A;  4XLH A;  4YFK F;  1P7I A;  2JSP A;  4DZP A;  3HXL A;  3PUB A;  2W25 A;  1GXP A;  3RSN A;  4E7H A;  1Y6I A;  4GRI A;  3FHN A;  4LGW A;  2DMP A;  2D1H A;  3WG7 H;  4UY8 I;  2OA4 A;  2KT0 A;  4UB6 C;  3ZMV A;  3AL0 C;  3BY6 A;  1SFE A;  2R7R A;  3GFJ A;  1K83 J;  2ECB A;  1N25 A;  2LBF A;  1W5C C;  5E1X A;  3ZR8 X;  5KAF C;  1S7E A;  2QLZ A;  3HOU J;  1E3P A;  1WSU A;  2MG4 A;  2DOA A;  2LOO A;  1H9G A;  5ERI A;  3I55 I;  2DFF A;  2GBY A;  2ACJ A;  3ECH A;  2EFQ A;  2IA2 A;  3LA3 A;  3WTU C;  2Z33 A;  2X6W A;  3DKW A;  2KQR A;  1I1S A;  5CQE A;  1ZGJ A;  2ZXW H;  5DCM A;  1PP7 U;  2GA2 A;  3CUQ A;  4KJZ A;  4X1E A;  2VOO A;  2X9D A;  1S7O A;  1UG2 A;  2EZL A;  2F5D A;  3PUF A;  2G7H A;  2Y31 A;  5J1U A;  3Q0V A;  2JPB A;  4HBL A;  5IP6 A;  1DQU A;  5ICF A;  4FQG A;  3H5N A;  3K10 A;  4MFD A;  4RB0 A;  3ELK A;  2X4H A;  4PJJ A;  4I98 B;  3HOY J;  2RQP A;  1IGN A;  2EIK H;  2CQX A;  4KT5 C;  2DA5 A;  4BU2 A;  2LD5 A;  4BEH A;  4EM2 A;  2CWE A;  2FBK A;  1ETY A;  1D0Y A;  1QVT A;  3C3W A;  4C30 A;  2M9H A;  2IVM A;  1EH6 A;  2AXL A;  3EPZ A;  3RPQ A;  3N4M A;  2R5Z A;  1RZ4 A;  3SHF A;  3HB9 A;  1UFM A;  3F9K A;  3PNT A;  2VOD A;  3LA2 A;  4XLF A;  1V4R A;  2W84 A;  3FKJ A;  3KE2 A;  3J7A O;  3DEW A;  3LST A;  4WWC A;  5E3N A;  1Y1W J;  1TWF J;  2DAO A;  2VIX A;  2L02 A;  1UEL B;  2KPM A;  3VYS B;  3M9A A;  1TTY A;  3H0G J;  1HBX G;  4MEX F;  1JE8 A;  1MZB A;  3H92 A;  5D5U B;  1G6N A;  2VQC A;  5A2Q Z;  5EZG A;  2FD5 A;  3C2B A;  4MIM A;  3CCY A;  4AID A;  1Z6R A;  4A69 C;  2PI0 A;  4UXN A;  5TIS C;  2EFO A;  5F64 A;  4XKC A;  2DOF A;  2NVT J;  4JP0 A;  1T39 A;  1LVK A;  1FC3 A;  3PM1 A;  4BDY A;  2VT2 A;  1LEB A;  2VAS A;  1BI3 A;  3TO7 A;  2O7O A;  4GGG A;  4ENM A;  1KQ8 A;  3OY9 A;  2W85 A;  4KN7 X;  2DT7 B;  2VLA A;  3BWG A;  3VSK A;  2CUF A;  1Y8R B;  1FNN A;  3BCA A;  3QYB A;  5BQT A;  1H89 C;  1FTZ A;  2F5V A;  3GEZ A;  3E5Q A;  1X19 A;  3OSG A;  1TWA J;  1P4X A;  1G59 A;  3ESW B;  1I39 A;  1D0X A;  2FXA A;  3BC8 A;  3T8R A;  2CFX A;  3AG4 H;  2YU3 A;  1KZH A;  2JA7 J;  4L9V A;  1MBG A;  1GVJ A;  4D9J A;  1I6X A;  2DQR A;  5IP7 J;  2JPC A;  3M4O J;  1CF7 B;  5TJJ A;  1DP3 A;  2KIQ A;  4XRS A;  2OUM A;  3L2C A;  1WJA A;  4CYC B;  1EV7 A;  2XSJ C;  1J09 A;  2NXN B;  4EVI A;  4WF2 A;  2CGP A;  2V1U A;  4XOP A;  2EPF A;  4UVB A;  2LC2 A;  4EV0 A;  3I56 I;  2X48 A;  3M07 A;  2EZK A;  2JVH A;  1OIS A;  2Q0O A;  3D0S A;  2LDU A;  1TLH B;  1X3W B;  4I01 A;  3E6M A;  3S16 J;  3M8F A;  1R7J A;  3VYU B;  3OYB A;  4J00 A;  3UKG A;  4QSH A;  2XHK A;  2BEO A;  3K7A J;  4XBF A;  1ULY A;  3WE3 A;  3WTT C;  2MYS A;  2ICW G;  4HEA 2;  3F23 A;  2HOA A;  3C18 A;  2OBP A;  3M8E A;  3E1S A;  3DV8 A;  4IQJ A;  1T08 B;  4DW6 A;  1KYW A;  3N05 A;  1ZHF A;  5B66 C;  3A03 A;  3HUG B;  5J6X A;  1IUF A;  4JX4 A;  3S93 A;  1JTY A;  3BTC A;  3ZRG A;  1ETX A;  1X1D A;  3PSI A;  1VQP I;  2VQL A;  4QLC U;  2M2E A;  4R8H A;  2ZNZ A;  2JQ7 A;  4AWX B;  4B4C A;  3A1Y A;  1SD6 A;  4EJT A;  3GW2 A;  2LVS A;  1K4T A;  3I4N J;  2PJR A;  4M72 A;  3U1K A;  4PSX A;  3E6B A;  3LSH A;  5L3G A;  3ZQC A;  3JW4 A;  2RGV A;  3K6G A;  1J0R A;  3IP4 B;  4BEH B;  2E1O A;  3H36 A;  2Y30 A;  5LD2 C;  1OCR H;  2YSR A;  3QYE A;  3I5U A;  2BVL A;  1U2W A;  3F21 A;  2N8G A;  2XGE A;  1D1B A;  2IEK A;  3CF5 F;  2Z99 A;  5BOX A;  1W36 C;  2VXD A;  2DFI A;  1FX7 A;  1HDD C;  4GYI A;  4KFC A;  4BGD A;  5IP9 J;  5AIQ A;  5IYB J;  1Z7U A;  1E0E A;  2HQA A;  2V79 A;  2EJR A;  3CUQ C;  3PNY A;  5FRM A;  2XAU A;  3Q5F A;  2E60 A;  1K78 A;  3IH2 A;  2CSO A;  2JZY A;  3S14 J;  3FIW A;  1QBJ A;  3I4P A;  3MWM A;  2XAH A;  4KIS A;  2HZT A;  2HDC A;  5LRR A;  1JGS A;  3OS0 A;  2CQ7 A;  3RKW A;  2XAQ A;  3HJE A;  2G9W A;  3LAJ A;  1YG2 A;  4F92 B;  3L2R A;  3SDG A;  3H3V K;  4L5J A;  1F36 A;  5D8K B;  1W7P B;  2VJJ A;  2V4J C;  2JA8 J;  2JVG A;  4NC8 A;  5IT3 A;  3T8T A;  1FT9 A;  4XKW A;  1PUF A;  1N77 A;  4ZJZ A;  1DPU A;  1MSF C;  3FBI B;  2M0M A;  1KGS A;  2P5K A;  1MSE C;  1SVM A;  1TT0 A;  2W57 A;  2AHQ A;  2LMD A;  1IG7 A;  3H9J A;  4BYY A;  4CZC A;  4BUP A;  1HKQ A;  3U9G A;  1Z9C A;  1VQ8 I;  1KQ0 A;  3E7L A;  4RA2 A;  3IRR A;  2W00 A;  2Z3Y A;  5LLQ A;  5LFA A;  4RAY A;  2EK5 A;  2NS7 A;  2BOL A;  2HYF A;  2TCT A;  1U3E M;  1V3F A;  1HW1 A;  3ZMZ A;  1I6H J;  3RDI A;  4CZZ A;  5DD4 A;  3E97 A;  5LEK A;  1VTN C;  1K6Y A;  1LEA A;  1ZLK A;  4ON0 A;  1FJL A;  3PQJ A;  3J7Y J;  4KYW A;  3X2Q H;  2QWW A;  4PJN A;  3H9G A;  4BXU A;  4ZDO A;  2L9R A;  2MH9 A;  1WWX A;  3ERE D;  3FXM A;  1TWC J;  4JX5 A;  2QQA A;  1G3W A;  1XMK A;  2HDW A;  3FK6 A;  3PO2 J;  5HOD A;  3CZ6 A;  3TW6 A;  2XSD C;  5D6E A;  3HL2 A;  1IXC A;  2EFW A;  2LY1 A;  1RR8 C;  2NOG A;  4L18 B;  2NYX A;  3NWT A;  4YG2 F;  1TC3 C;  3Q0W A;  4F93 B;  4PFP A;  1G3T A;  1I27 A;  1A6Q A;  1KU9 A;  1MNE A;  1P9Q C;  3HRU A;  3HOW J;  3A2K A;  1G3S A;  3P7N A;  4RAF A;  3G1M A;  2DDA A;  5E18 F;  3V8K A;  2CU7 A;  3GLX A;  4WX9 A;  2CQN A;  5KNL A;  2IA1 A;  4YEL A;  4ZYE A;  3LSP A;  2F4O B;  1MMA A;  2K02 A;  4BHP A;  5CVJ A;  4H0E A;  1ETQ A;  1XCB A;  1MBE A;  1HSJ A;  2E35 A;  3GLL A;  1NTC A;  1QRY A;  3GTQ J;  4IVN A;  2K9Q A;  3EQL F;  2VE9 A;  5IPA A;  5J47 A;  4E7I A;  1K61 A;  4IZZ A;  3KP4 A;  3FM3 A;  2RVC A;  2OU2 A;  2VQG A;  4A0X A;  2JUG A;  4GCV A;  4AD9 A;  3WTV C;  2K7L A;  3IUO A;  4QTR A;  1FBQ A;  4OIO F;  2B7E A;  3OIO A;  3FX3 A;  4A3K J;  2KIF A;  4OOI A;  3ZMD A;  2STW A;  1LDD A;  1MW7 A;  3HM5 A;  1YRN B;  4PDK A;  3GZ6 A;  4AYB A;  2M7B A;  4FCY A;  1V55 H;  1D5Y A;  3S3O A;  2HI3 A;  1R1V A;  1W1W E;  1IN5 A;  2LF8 A;  2E1M B;  3H5A A;  5IY5 H;  1TW3 A;  4IRH A;  3ML6 A;  2OTJ I;  1K78 B;  2Y48 A;  3H1C A;  2HTS A;  3SZP A;  4A3M J;  3VOE A;  1Z3Y A;  2VI6 A;  1XN7 A;  1RRJ A;  4C3J J;  3GZ5 A;  1OR7 A;  5FGM A;  3CC4 I;  5B1A H;  3EYI A;  2VJ5 A;  5JLW A;  3AFH A;  4TV7 A;  1QU3 A;  2VKD A;  1T56 A;  4CO8 A;  5M3M J;  3G6E I;  2A5Y B;  1T2K A;  3HTS B;  2FQ3 A;  3F3X A;  2FA5 A;  3ERM A;  4IKF A;  1BI0 A;  3FXR A;  4U0V A;  1ZH5 A;  4RGU A;  2BYV E;  1ZR2 A;  5GAG J;  1H0M A;  3OR2 C;  2IS1 A;  4L5E A;  2NVX J;  1T6S A;  3IC7 A;  2RC4 A;  3M7G A;  3DLA A;  3HG9 A;  2DI3 A;  1QO0 D;  1S5L C;  3BR6 A;  3BZC A;  3DU6 A;  1OMI A;  2CO5 A;  1BA5 A;  3CDL A;  4C2M J;  2TRT A;  1VQN I;  1D8K A;  1MMN A;  4NBQ A;  5M3F J;  1BC8 C;  1D5V A;  3BG5 A;  2ECC A;  1CGP A;  3KZI C;  5HS9 A;  4D5F A;  2BY3 A;  3KP7 A;  5B5E C;  5DS9 A;  2B9S A;  3LSM A;  2F5C A;  1REP C;  4IL6 C;  1STZ A;  2TDX A;  2MC3 A;  1A36 A;  2OTL I;  3CJQ B;  4CCN A;  2HQ5 A;  3QAH A;  5DDG A;  2CW7 A;  4OIQ F;  4I7H A;  1UMQ A;  5FKK A;  5C4J J;  3QU3 A;  3P9K A;  4EJU A;  5K7F A;  2O61 A;  2XRN A;  1R23 A;  2HR3 A;  4LOC A;  4PUS A;  3CCL I;  2V1N A;  4HG2 A;  1YIO A;  1K6O A;  2KHM A;  2XKP A;  1ZG5 A;  1VQK I;  4RMN A;  2OZU A;  1XS9 A;  4Z6Y A;  1P2F A;  2GLO A;  1VQ9 I;  2OV7 A;  3B6A A;  3KEY A;  4XLA A;  2M45 A;  3C2G A;  4BQQ A;  3OYF A;  3LQQ A;  4YFN F;  1MH4 A;  4UB8 C;  4EM0 B;  4JK1 X;  2DA2 A;  2A3S A;  4UUS B;  2CJJ A;  2ZBK A;  1I3A A;  4XRM A;  4LFU A;  1YE9 A;  2NVU B;  2K9M A;  3E5X A;  1PUE E;  1B6A A;  4XM3 A;  1ZRF A;  3OYA A;  4ESB A;  3MD2 A;  3K2Z A;  3PQK A;  1R6R A;  1KQ9 A;  2L4M A;  3GZN B;  4FET A;  3BR3 A;  1FIP A;  1KU3 A;  4MQV A;  4JX6 A;  3WU2 C;  3VWB A;  3W2A A;  3HYI A;  4ZDL A;  3QU6 A;  1BIA A;  2XGD A;  2JA6 J;  4J19 A;  1U78 A;  3P9C A;  1FLI A;  3RQI A;  4E70 A;  2CV1 A;  1ZKG A;  3I71 A;  2OZ6 A;  4CH7 A;  2DA4 A;  3IRQ A;  4B43 A;  3SZG A;  3JCU C;  4II2 A;  4OAY A;  4RB3 C;  4BBR J;  3R61 A;  2ZME C;  4BJT A;  5ICG A;  1BC7 C;  4IEJ A;  2EIJ H;  3DPU A;  2XPU A;  5FLX Z;  4HZF A;  4M3D A;  3QOE A;  1YS6 A;  3I59 B;  2FOK A;  2ZC2 A;  2HFH A;  5FFX A;  4W1U A;  2P6T A;  4U0Y A;  2ISY A;  2B63 J;  4BS9 A;  2K86 A;  4EM1 A;  1Z7L A;  2XPV A;  3LQR A;  2UV1 A;  3SXY A;  1WPK A;  3QPS A;  1T33 A;  4XNF A;  1IAW A;  3BR1 A;  1Q1H A;  4C9Y A;  1HOM A;  3LWF A;  4G8X A;  1R36 A;  2WA0 A;  3S8P A;  1JJ6 C;  3CCM I;  4EGY A;  1J59 A;  1FIA A;  2VXZ A;  3GCM A;  1O57 A;  4JOM A;  3DBL B;  5EG0 B;  1EF4 A;  1XGN A;  5JVG F;  2BY2 A;  1ODD A;  3LMM A;  3M8J A;  4C2T A;  3QWL A;  3HIF A;  2ZCW A;  3CF2 A;  3IKT A;  4CYC A;  1YJN I;  1T0F C;  2OPT A;  3DTE A;  3HRM A;  1VQ4 I;  2CMP A;  2A6T A;  3CUQ B;  3G4S I;  4F3Q A;  3MMY B;  2DK5 A;  3KCC A;  4FHT A;  2QSF X;  3H3Z A;  2Z5U A;  3E0J B;  1SEU A;  3BZK A;  3G73 A;  3ASN H;  3K1M A;  5KVR A;  2HYJ A;  1QZY A;  4P1W A;  4PGH A;  3W6V A;  3OL3 A;  1GT0 C;  3RPU D;  1MGT A;  3S1M J;  1KYZ A;  1S8N A;  2HKX A;  3C7J A;  1RPW A;  4V19 K;  2H6B A;  1FOX A;  4Y17 A;  2DXI A;  3ZMS A;  2XPW A;  4IPA A;  4BHC A;  1YI2 I;  3F8F A;  4HF2 A;  2HDD A;  2UZK A;  2LR8 A;  4HV6 A;  2YX7 A;  5L3F A;  3K1N A;  3IH3 A;  2QKL B;  1OFC X;  5IYC J;  4U7D A;  1ENH A;  3QQA A;  2DU9 A;  1AKH A;  4G6Q A;  3FIS A;  3ZQH A;  2FE3 A;  4XK4 A;  4HST A;  3A01 A;  2P8T A;  3FDY A;  1ZG1 A;  2B0L A;  1ETV A;  5KCM A;  2E19 A;  1FY7 A;  1X1B A;  4YEJ A;  3TW7 A;  1RI7 A;  1WGX A;  3FXO A;  2K4J A;  3HRT A;  2DYR H;  2EA4 A;  3TL4 X;  2L9V A;  2QQB A;  3WTX C;  4RLQ A;  3ZOB A;  2IAI A;  3KEO A;  4EMS A;  3CCJ I;  1DPR A;  4O5V A;  5EEG A;  3SYT A;  3BPV A;  1UB9 A;  2VBW A;  2O8K A;  4NNJ A;  3ISP A;  3QOD A;  3F8M A;  3MFK A;  2FF4 A;  1ZYR F;  1RIO H;  2DW4 A;  4LG0 B;  4CYD A;  2QSH X;  1BM9 A;  2CRG A;  2HVR A;  2BY1 A;  4HAM A;  1WJD A;  1Z21 A;  1D1A A;  2WC2 A;  2WAQ N;  2ZJP F;  2X85 A;  2IGK A;  5J4Y A;  4CGZ A;  2CQK A;  2V26 A;  3GXO A;  1XTA A;  3D5S C;  1VQL I;  3R6S A;  1Q1V A;  2K85 A;  3WG9 A;  2FBH A;  5L3E A;  2EZH A;  1IUY A;  1ERD A;  4M9Z A;  2ZO4 A;  3K1P A;  3G71 I;  2P5V A;  2GIV A;  2RDP A;  2JRT A;  2XB0 X;  5EYR A;  2LH9 A;  1JI8 A;  1AOY A;  4ENJ A;  3GX4 X;  1IV6 A;  2F4I A;  2R7W A;  2KP6 A;  3QP5 A;  1X3U A;  2QVO A;  1EH8 A;  2R5Y B;  5E3O A;  1U5T C;  3HOZ J;  2Y9Z A;  4IJA A;  1R58 A;  1BW6 A;  1G4D A;  1XB4 A;  1KU2 A;  3PFI A;  1JTX A;  2MD0 A;  1OPC A;  4E7K A;  1HLV A;  4Y3O A;  4S05 A;  3KZZ A;  2HQN A;  3PSF A;  1HKT A;  2BHZ A;  2GM4 A;  2CQQ A;  2VN2 A;  4L9T A;  3VDX A;  2X6X A;  1NG7 A;  2EV0 A;  1U8R A;  1ORK A;  5L3B A;  4BY7 J;  2ELJ A;  3CCV I;  2GXG A;  2L7K A;  3GO5 A;  3IAM 2;  4BBS J;  2XIG A;  3BQY A;  4RB1 A;  1KON A;  3FMR A;  3A01 B;  4FE7 A;  4BQN A;  4UHT A;  3CMM A;  4S04 A;  3RZO J;  3DEU A;  3G1L A;  4AIJ A;  1JKP C;  5FD5 A;  1WI9 A;  5EGO B;  5CQG A;  3CCE I;  1FOK A;  3HHG A;  2ZFW A;  3OIQ A;  1HA8 A;  2DT5 A;  4U88 A;  4NUB A;  4A3B J;  2O03 A;  1MIJ A;  2I10 A;  3OIP A;  2H8W A;  2XF5 A;  1MMS A;  3HOX J;  1QQI A;  2LNB A;  3J81 K;  5BS6 A;  4N4N B;  5EEA A;  3V7S A;  2EQR A;  3GTK J;  2KFD A;  1DGW Y;  1WH5 A;  2JRM A;  2G7U A;  1SD4 A;  2F6C A;  2MLG A;  3CCU I;  4UVA A;  1AA7 A;  1YW7 A;  4IHV A;  4P5O A;  2XF7 A;  1Z91 A;  4AYB N;  3EUH A;  3SJM A;  4MHG A;  2PX9 A;  4DYQ A;  1FMV A;  3V42 A;  3WTY C;  1VQM I;  2CW0 F;  1R5H A;  2FOW A;  2FX0 A;  2EV6 A;  2CS3 A;  2GOX B;  4N0B A;  1E3H A;  3JR9 A;  1W5T A;  4M9S A;  1FP2 A;  1IXS B;  4A3L J;  2ME0 A;  1N78 A;  1ZAO A;  3SDB A;  1SD7 A;  1W4M A;  5J4V A;  1LQ1 A;  4QPO A;  3VYT B;  5M5Y J;  1K4S A;  3AL0 B;  3DCF A;  4HDU A;  2MGQ A;  2ETH A;  3S2W A;  2QBY A;  2HS5 A;  4FTH A;  1XC5 A;  3CCR I;  5DTD A;  2OCE A;  3K69 A;  4ZTF A;  4YIR X;  1R1T A;  1Z67 A;  2PQ8 A;  3OOU A;  2DDB A;  1NK2 P;  1F4K A;  3FK7 A;  3WGH A;  1IRX A;  2K5C A;  3HGY A;  4LB6 B;  1F5T A;  3JTH A;  2ID3 A;  3RQ4 A;  1DP7 P;  4ASN A;  2EIN H;  1H9T A;  1YX3 A;  1ZK8 A;  1FSE A;  2LP0 A;  2P4W A;  3L2W A;  2OJE D;  4WCG A;  4OIR F;  4Y7N J;  2M7A A;  2RQQ A;  4B3A A;  4MTD A;  1YW9 A;  2CYY A;  2M0C A;  5ED4 A;  5D4S A;  5C4X J;  1WKM A;  5E20 A;  2BGC A;  4KIT B;  2R3S A;  3GFI A;  3GF2 A;  1ETO A;  4LIU A;  2EA2 A;  4JQF A;  1XD7 A;  3OYL A;  2BZT A;  2V6E A;  4E7L A;  3BJO A;  3CDI A;  1PYV A;  1JKO C;  3OYE A;  4KIF A;  3CDH A;  1MND A;  3M1E A;  5LHH A;  2MC4 A;  1TL8 A;  2PMU A;  3K4L A;  3H5R A;  2NS0 A;  3QOP A;  2XC7 A;  2KMU A;  3ZCO A;  3K0L A;  2KZG A;  4IQ4 A;  3OYJ A;  1YTY A;  4FIS A;  1ZGW A;  2QZ8 A;  1Y0N A;  1NK3 P;  1YLF A;  1R5G A;  3A02 A;  1JT0 A;  3L9F A;  1T95 A;  1QNT A;  3WTZ A;  4HNU A;  2O0Y A;  3PJR A;  3DKY A;  2IA0 A;  2YS9 A;  2PLY A;  3OMY A;  5F1R A;  1J9I A;  1GV2 A;  1DDN A;  4F91 B;  2E2J J;  2M5W A;  1YW8 A;  4QWQ A;  1BI2 A;  3TQN A;  1W36 D;  3V8L A;  2BXY A;  1MJB A;  1U6G A;  4ENK A;  5EGO A;  4CUG A;  3J81 Z;  5IT9 K;  3ZMT A;  3Q9S A;  2VON A;  2NVY J;  5C44 J;  2W24 A;  3PO3 J;  4MQ9 F;  3O2P E;  5CVU A;  2QBY B;  2VPL A;  2MH2 A;  1SFO J;  3DTI A;  1JKQ C;  4HDV A;  2ID6 A;  4PJ0 C;  5BMZ A;  3GTG J;  1E3O C;  1SFU A;  4XQF A;  3ZQL A;  1JUM A;  2BHY A;  1HF0 A;  4ZZD A;  2DA6 A;  2LRE A;  2BE5 F;  1IO2 A;  3S32 A;  4D5C A;  2DPU A;  1FTT A;  3HBL A;  5F27 A;  2DPD A;  4XSZ F;  4ZYG A;  2DTR A;  2NS8 A;  4CCJ A;  4Q4Z F;  2ZSI B;  1LUJ B;  2LFB A;  3E5U A;  1PVE A;  3O3K A;  3NAR A;  2WAQ A;  3FKI J;  2L5Q A;  5CJ9 A;  4CIC A;  2KIS A;  4XN3 A;  2DT6 A;  2LRD A;  2HPI A;  2KJB A;  2MBF A;  3CO6 C;  2ISZ A;  2GXA A;  3OV8 A;  2VE8 A;  4AC0 A;  4B44 A;  4Y33 A;  2KLO A;  4DGW B;  1XPX A;  2O5R A;  2BVM A;  3DP7 A;  2PMZ N;  3S1N J;  1FP1 D;  2E34 A;  3E6D A;  3DBH B;  3TDU C;  1XSV A;  4RBO A;  4BE1 A;  2PFB A;  4FE4 A;  5IOZ A;  3DPT A;  1ZG3 A;  1UZC A;  1BL0 A;  4IX7 A;  1WJC A;  1MDM B;  4S0H B;  2QF7 A;  3LSI A;  3CQZ J;  3BT9 A;  5GAE J;  3ABL H;  2ZME A;  3TKY A;  4E4H A;  1WQ2 A;  5EDN A;  2DLL A;  1SC7 A;  4I2O A;  3ZQQ A;  3ECO A;  2G0E A;  1PUF B;  1GDT A;  2HZD A;  2AQF A;  4A3F J;  3CCQ I;  1K7A A;  5JI6 A;  2VOP A;  2FEZ A;  5ICC A;  3DWL E;  4U7B A;  2JMW A;  3K4K A;  1MDM A;  4ZYD A;  1A6I A;  3CC2 I;  2OF7 A;  1DU6 A;  1U9O A;  4IOA F;  2HNH A;  2LKS A;  1XX5 A;  2IT0 A;  4L0Z B;  2ESH A;  4KT6 A;  2EWN A;  3PL8 A;  3T0Y A;  4RM3 A;  4RGS A;  3KX2 A;  2WAD A;  2F5F A;  1BBY A;  5GTI C;  1JT6 A;  3HKZ A;  4CXF A;  5LRS A;  1IV8 A;  2DOD A;  5FD6 A;  4K2E A;  4IRI A;  3OR1 C;  1IJW C;  1Z05 A;  2DCE A;  4M6V A;  3HOT A;  1HC8 A;  1W7P D;  3MVP A;  3I64 A;  1XMX A;  2IS6 A;  2A5W A;  3OYI A;  3BOQ A;  1GV5 A;  5E17 F;  1HKS A;  4L9N A;  1B72 A;  2YR2 A;  3GTP J;  3RKX A;  2KJC A;  5E8G A; 
#chains in the Genus database with same CATH homology
 1OCT C;  2WV1 A;  2KT0 A;  1QVU A;  2K40 A;  1K83 J;  2ECB A;  3BR3 A;  5JLX A;  1FIP A;  1S7E A;  2Y9Y A;  3HOU J;  2MG4 A;  3MN2 A;  5E3L A;  4JX6 A;  3GTO J;  2GBY A;  3G1O A;  2XGD A;  2YU9 J;  2JA6 J;  4J19 A;  5M5X J;  1U78 A;  1B72 B;  1AHD P;  3RQI A;  3ZQG A;  2VUM J;  1ZKG A;  4X1E A;  2DA4 A;  2X9D A;  1UG2 A;  2EZL A;  5J1U A;  2Y31 A;  1ZR4 A;  1OJL A;  3Q0V A;  5IP6 A;  2Y0S N;  4BBR J;  2EZI A;  5GP9 A;  4MFD A;  4IEJ A;  2XPU A;  4M3D A;  3HOY J;  1IGN A;  2DMQ A;  2CQX A;  9ANT A;  4IHW A;  2DA5 A;  4W1U A;  2LD5 A;  4BY1 J;  2B63 J;  2L7Z A;  1ETY A;  1SAN A;  1QVT A;  2XPV A;  3GTL J;  2DA3 A;  1XG1 A;  2M9H A;  3BR2 A;  2O9L A;  1WPK A;  2Y2Z A;  1T33 A;  3QPS A;  3RZD J;  3BR1 A;  5IYD J;  1HOM A;  1WH7 A;  1JJ6 C;  5F0F A;  2R5Z A;  1A5J A;  3HB9 A;  2R7Z J;  1FIA A;  3OSF A;  3BG3 A;  2L7M P;  1H88 C;  5EG0 B;  2LTP A;  1EF4 A;  1JUP A;  1MNM C;  2RAE A;  3DEW A;  4M3G A;  1JGG A;  5E3N A;  3LOC A;  1Y1W J;  1TWF J;  2HOS A;  2AO9 A;  4CYC A;  2OPT A;  1BJZ A;  3H0G J;  1G2H A;  5E3M A;  3CMY A;  5EZG A;  1MBK A;  3HGG A;  4MIM A;  2FD5 A;  3C2B A;  3CCY A;  4UUT A;  4A69 C;  1FEX A;  1U9N A;  2HYJ A;  2NVT J;  4JP0 A;  2M8G X;  2WB1 N;  3PM1 A;  1Z77 A;  3W6V A;  1GT0 C;  2O7O A;  3S1M J;  1RPW A;  2CUF A;  2XPW A;  1H89 C;  1FTZ A;  1JUS A;  3OSG A;  2HDD A;  1TWA J;  2LR8 A;  2NVQ J;  2R5Z B;  3IH3 A;  1OFC X;  5IYC J;  1ENH A;  2JK3 A;  3QQA A;  2JA7 J;  3JRC A;  1AKH A;  1MBG A;  3M4O J;  3FIS A;  5IP7 J;  3ZQH A;  4XK4 A;  3A01 A;  2DMU A;  4XRS A;  1ETV A;  4CYC B;  2LLK A;  1VI0 A;  2E19 A;  3JRG A;  5C3E J;  3TW7 A;  1WGX A;  2HXI A;  2X48 A;  3RKQ A;  2EZK A;  3GTJ J;  2XGC A;  2R5Y A;  4MFE A;  4DYR A;  3ZOB A;  2IAI A;  2XB5 A;  5J3L A;  1LFU P;  1VND A;  1TWH J;  4MO7 A;  3S16 J;  3F0C A;  5K7H A;  5FKN A;  3UKG A;  4ABZ A;  4QSH A;  1ETW A;  2O8K A;  3K7A J;  4A3C J;  1APL C;  2HOA A;  5EZH A;  3S15 J;  3S17 J;  5FLM J;  3VPR A;  5F1J A;  5BNG A;  4IHX A;  3NAU A;  5EG0 A;  2CRG A;  4DW6 A;  3JRF A;  3L1P A;  1RET A;  1X2M A;  2DMN A;  2WAQ N;  3A03 A;  4X6A J;  4I76 A;  4V2F A;  1IUF A;  4JX4 A;  5J1R A;  4XRS G;  4DYC A;  1JTY A;  4EEF G;  3BTC A;  1ETX A;  1HCR A;  1Q1V A;  1Z0X A;  4M3B A;  2M2E A;  5GPA A;  3JRE A;  2EZH A;  1JJ8 C;  3LSJ A;  3WHB A;  2L0K A;  2H1K A;  4B4C A;  2LVS A;  2XB0 X;  3I4N J;  5EYR A;  2KDZ A;  2JA5 J;  3ZQC A;  5FJ8 J;  2COB A;  1Y1V J;  1IV6 A;  4A93 J;  3HOV J;  2E1O A;  1POG A;  2Y30 A;  3M3Y J;  2R5Y B;  1RKT A;  5E3O A;  3HOZ J;  2Y9Z A;  2N8G A;  1LFB A;  2XGE A;  2IEK A;  2CUE A;  4W97 A;  3JRH A;  4HNV A;  1BW6 A;  1YRN A;  2HOT A;  4C3I J;  1HDD C;  2JN6 A;  1JTX A;  4UUS A;  1HLV A;  5IP9 J;  5IYB J;  3GTM J;  3WHC A;  2FQ4 A;  1CQT A;  2CQQ A;  2GM4 A;  1IRZ A;  1H8A C;  3IH2 A;  1ORK A;  4D7N A;  4BY7 J;  4MLO A;  3S14 J;  3FIW A;  4BBS J;  3BQY A;  3A01 B;  4FE7 A;  2HXO A;  3RZO J;  1GVD A;  3G1L A;  1X58 A;  1JKP C;  4DZJ A;  2L7F P;  3SDG A;  3H3V K;  5F0C A;  5J1Y A;  5EGO B;  1F36 A;  3O8H A;  1HDP A;  1MH3 A;  2JA8 J;  4A3B J;  1IC8 A;  2I10 A;  4C3H J;  1PUF A;  1MSF C;  2P81 A;  3HOX J;  5IOY A;  1MSE C;  3BTJ A;  5EEA A;  2EQR A;  2E2H J;  3GTK J;  2AHQ A;  1IG7 A;  1WH5 A;  3BQZ A;  4IHV A;  3E7L A;  2ME6 A;  3LSG A;  4AYB N;  3SJM A;  2NS7 A;  3JRD A;  4DYQ A;  5FLV A;  2VKE A;  2TCT A;  1I6H J;  2YUS A;  2FX0 A;  3JR9 A;  2IBD A;  2H8R A;  1X2N A;  4A3L J;  2ME0 A;  2JJ7 A;  4GFB A;  5F0H A;  4D7M A;  1FJL A;  5M5Y J;  3DCF A;  1QPI A;  2ELK A;  2MGQ A;  4RDU A;  2X6O A;  2L9R A;  4FTH A;  3TED A;  1XC5 A;  1TWC J;  5DTD A;  4JX5 A;  3S2H J;  4V2G A;  3FK6 A;  3PO2 J;  4A3J J;  5HOD A;  1IDZ A;  4M3F A;  3TW6 A;  3OOU A;  1NK2 P;  2XSD C;  2EBI A;  2NOG A;  3FK7 A;  3IH4 A;  3HGY A;  1TC3 C;  3IV5 A;  2ID3 A;  3Q0W A;  1RKW A;  1ZK8 A;  2LP0 A;  1LE8 B;  4Y7N J;  3HOW J;  1IDY A;  4B3A A;  4A3E J;  2M0C A;  2ZB9 A;  3G1M A;  3JRB A;  5C4X J;  1AU7 A;  2CU7 A;  2DA1 A;  3BG9 A;  1ETO A;  3LSP A;  2LK2 A;  4Y52 J;  1VF9 A;  4G12 A;  1O4X A;  1ZQ3 P;  1JKO C;  5GPC A;  3LSR A;  1LE8 A;  1JKR C;  1RR7 A;  2M34 A;  1ETQ A;  1MBE A;  1W0U A;  1NTC A;  1QRY A;  2VPR A;  3GTQ J;  2E2I J;  2K9Q A;  3HEF A;  1ZTR A;  1RES A;  3O8G A;  4FIS A;  4QIW N;  3HKZ N;  3LNQ A;  1ZGW A;  1MBF A;  2K9S A;  5IPA A;  1K61 A;  2DTZ A;  2VKV A;  1W0T A;  1NK3 P;  5FKM A;  1OCP A;  5K7Z A;  1VFC A;  5F04 A;  3A02 A;  1JT0 A;  2LY9 A;  4QTR A;  1GUU A;  2YS9 A;  3OIO A;  4A3K J;  1GV2 A;  2R93 J;  3D1N I;  1B8I A;  2R0Q C;  2E2J J;  3HM5 A;  3Q0U A;  1WI3 A;  1MBJ A;  1YRN B;  4FCY A;  1D5Y A;  2HI3 A;  5EGO A;  4A3D J;  2QCO A;  5F08 A;  1TWG J;  3JRI A;  2NVY J;  1BW5 A;  3Q3S A;  5C44 J;  2K9N A;  3PO3 J;  1WCM J;  4XIC A;  1SFO J;  1JKQ C;  2ID6 A;  4A3M J;  3GTG J;  2VI6 A;  1E3O C;  4C3J J;  3ZQL A;  1JUM A;  1HF0 A;  3BTI A;  5JLW A;  2DA6 A;  3I4M J;  4A3G J;  3TP3 A;  5M3M J;  1T56 A;  2DJN A;  3TP0 A;  4D5C A;  1FTT A;  2XRL A;  3ZQI A;  3HBL A;  5F27 A;  1R9T J;  2NS8 A;  4BXX J;  3BTL A;  2LFB A;  4AUX A;  1ZR2 A;  3BR5 A;  3NAR A;  3FKI J;  4L5E A;  2NVX J;  3QPL A;  2R92 J;  3S2D J;  3GBG A;  1MBH A;  4AC0 A;  3BR6 A;  4M3E A;  1BA5 A;  3CDL A;  4C2M J;  3MKL A;  2TRT A;  4I6Z A;  2W48 A;  2PMZ N;  3S1N J;  4IHY A;  3JRA A;  5FKO A;  4B1R A;  5M3F J;  4RBO A;  2DA7 A;  3BG5 A;  2ECC A;  4A3I J;  5FKL A;  4FE4 A;  5IOZ A;  4D5F A;  1BL0 A;  3S1Q J;  5DS9 A;  1U8B A;  3S1R J;  4S0H B;  2QF7 A;  3CQZ J;  3BT9 A;  2FJ1 A;  2HQ5 A;  1ETK A;  5EDN A;  1I3Q J;  4JYK A;  1B8I B;  1UMQ A;  2G0E A;  2MW8 A;  1UHS A;  5FKK A;  5C4J J;  5M5W J;  4A3F J;  1PUF B;  1GDT A;  1I50 J;  5K7F A;  5EF6 A;  2MSY A;  3BR0 A;  4LOC A;  3K2A A;  4BKX A;  2JMW A;  1P7J A;  2EH3 A;  1XS9 A;  2GLO A;  1A6I A;  2JWT A;  2OF7 A;  1DU6 A;  1U9O A;  3B6A A;  1DU0 A;  2DMT A;  4NDL A;  3B6C A;  3SFI A;  1AKH B;  1JT6 A;  2LKX A;  1MH4 A;  1IJW C;  2DA2 A;  2DN0 A;  3ZQF A;  3HDD A;  4M6V A;  4XID A;  2CJJ A;  4UUS B;  1ITY A;  3MVP A;  1P7I A;  4XRM A;  4DZP A;  1F43 A;  1GV5 A;  2D5V A;  1B72 A;  3GTP J;  2DMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...