4RGXA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 3,4-dihydroxy bezoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with 3,4-dihydroxy bezoic acid
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
molecule keywords Repressor protein
total genus 44
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgxA00
3FZVA 3IC7A 1XGMA 1TQMA 2HQRA 1YIOA 2Z33A 3K1PA 3KP6A 3WE2A 4UVBA 2IT0A 2IP2A 1B59A 4RAZA 3QP6A 1P6RA 4IF4A 1XGSA 2L54A 5EEGA 1WSUA 3TO9A 3V7SA 4Q5SF 5IT3A 1J9IA 3T0YA 1REPC 1U5TC 2OU2A 4JQFA 3WTUC 4UVAA 2VE8A 5D4SA 1I27A 3L00A 3L09A 2ESNA 5CVUA 3R61A 4HOBA 2FQ3A 1ZARA 3ZP5A 3ZN0A 1FYMA 1P2FA 2ZNYA 1USSA 2XASA 4KMUX 5E17F 2K4BA 4LLGF 1IW7F 3ELKA 1KQ9A 3O3KA 4EJOA 3CO7C 4RB3C 3KZZA 1ZG3A 2L4AA 1FP1D 5TRDA 1UFMA 1MJ9A 2O0YA 1HKQA 2QUFA 5E18F 3GF2A 1LDJA 1Z7UA 1IN5A 5F1RA 4MEYF 4HF2A 2EJRA 3DXJF 1XSVA 4AIKA 2QZ8A 1TBXA 4MHGA 4HAMA 2GQQA 2QWWA 3ABUA 2MH9A 2P4WA 1FT9A 2IRFG 4G6QA 4I02A 1L3LA 2HFHA 1ZREA 5FFZA 4GCVA 3RKWA 3G73A 5EEHA 2XVCA 3M7GA 3GO5A 2QBYB 2V6CA 2ZNZA 2P6SA 3ML6A 3D5LA 3EQLF 1SD7A 3TDUC 1I6XA 5FO5A 1J75A 5IT9Z 4KT5C 2BEOA 4IVNA 3LA3A 3M9AA 1F4KA 4BQAA 2ZBKA 5FGMA 1FWZA 2DPUA 1FBSA 4BNCA 2EV0A 4CICA 1RUOA 2QVOA 5FLXK 1XDUA 5ICFA 1SAXA 3PFIA 2RN7A 1UHWA 3TDZC 3H92A 3ZMSA 1C0WA 4IHTA 3ABTA 1TNTA 4HYEA 5J8CA 4O5VA 1AWCA 4MTDA 2ESHA 3KE2A 1ULYA 4YFNF 4A0XA 4P9UA 3HRTA 4OIPF 1IRGA 3V7CA 2KRFA 4CHUA 2JTVA 1FC3A 2FEZA 4RS8A 1P4XA 1O7FA 3DFGA 3T5XA 1G3TA 4XSXF 1PUEE 4EGYA 1YYVA 2KKOA 4ZZLA 3HRUA 3RIRA 4Y15A 5LHGA 5HVQC 2VONA 1A04A 3L2CA 2PFBA 3ULQB 3QPTA 5ICGA 3O2PE 1I1GA 1IAWA 1QZYA 2A5YB 1YS7A 3V8LA 3FXUA 3OOPA 3FMQA 1J5YA 1OMIA 3R4KA 1GHCA 2A61A 1EV7A 1H9TA 3N97A 4M73A 3VOEA 3BZ6A 5H6RA 1R00A 1WI9A 3F3XA 3C1DA 3F6VA 1NHAA 3J80Z 3LSTA 1QPMA 3GXOA 2XAHA 3GZ6A 2HYFA 2NYXA 3FMSA 4RB1A 1FPQA 2ADUA 1EH6A 2IA2A 4I2OA 1X3UA 1QQIA 4AD9A 4MGRA 1WWXA 1XMKA 4M9SA 2HQNA 5HS8A 4M6YA 4ESBA 1CF7B 2K7LA 2FU4A 2CYYA 3PQJA 2EFPA 3F8CA 1OYYA 1R22A 2QQBA 5DV5A 1O7LA 4U88A 4N9IA 4ZZDA 2IA1A 5LRSA 5JVTA 1ZGAA 2HTSA 5L3FA 4U0WA 2HEOA 4B09A 3U1DA 2G9WA 2E1CA 2DK8A 1WRJA 4RB0A 2OZUA 3U9GA 4OIQF 1D8KA 2K27A 3O6BB 2OQGA 2DPDA 1B9MA 4LG0A 2W57A 5D5VB 2ISZA 3ZMVA 1ZG1A 2BE5F 1YS6A 3VEPA 5DUKA 4QLCU 4PZJA 3WU1B 2P5LC 1MJBA 4L9VA 3I54A 4F7ZA 4P55A 5DYMA 1D3YA 5K5OA 1DPUA 3R60A 2VODA 2PMHA 1D5VA 2OA4A 1LDKB 2IPQX 4XLPF 1JHHA 2P7VB 2O3FA 4I0BA 3LAJA 1W7PA 5JR3A 1RIOH 2M1BA 3HTSB 5ILSA 2VOOA 2RKHA 2EFNA 4K2EA 1BJAA 1BI1A 1OPCA 1Q1HA 1KU7A 2CO5A 3P7NA 2EA4A 2D45A 3FHZA 5FD6A 1K78B 4XRFA 4EM1A 4XBFA 2HKOA 2DW4A 1LVAA 5K1YA 1Y0UA 4ZYGA 3ERED 3J81Z 1T38A 3V7RA 5A2QZ 4P5OA 2GIVA 2XKOA 3RI4A 3E6BA 5CVRA 5L3DA 3LQRA 2VE9A 2M45A 1P4WA 2P5KA 3HOSA 1K79A 3H3UA 2HZTA 3F8NA 1W7PD 4KICA 4U7DA 1DPRA 4KNYA 3HRSA 3TOBA 4ON0A 4I98B 4HV5A 5E1WA 2BBYA 2A69F 2ISYA 4BHBA 2VC1A 2WWYA 5H20A 4CGZA 4BYYA 1T98A 2Q2EA 2HR3A 4DNCA 4I0AA 1ZHFA 3F8MA 1W4MA 4HA8A 3SZPA 3SFZA 2D2WA 1XN7A 2Z99A 4MEXF 2ZJ2A 1TNSA 3RYRA 3HYIA 3H3ZA 3WTVC 2A3SA 4FX4A 3E5XA 2OAZA 2Z9OA 5BPIA 3CDHA 2OBPA 1R58A 2JT1A 1I1SA 1XD7A 1HW1A 5AONA 4U0VA 3F72A 1YTYA 1GXPA 4ENNA 3I0TA 2XAFA 2XV4S 3KP2A 1XGNA 1BIBA 4IRIA 4EGZA 1IXRC 4Q48A 4EJUA 3LWFA 1J0RA 4L0YB 5F6FA 2EWNA 4A0ZA 1U3EM 4L9TA 2EA2A 2GZWA 5HOOA 3IL2A 1U5TA 3LA2A 5KK1A 3FXRA 4G7ZF 1IUYA 4M72A 4L5IA 5FFXA 4BHCA 2DT5A 4ESFA 1Z6RA 2WV0A 2BGCA 1ZN2A 3WU0A 4LJZF 1IN7A 5HLHA 3IWZA 2F5CA 4ENJA 1ZH5A 3LFKA 5E8GA 1FBQA 2M30A 5LEJA 4HLYA 2CW0F 3I5UA 1YO5C 3EUHA 1I5ZA 1HXDA 5DEQA 3BPXA 2A68F 1RNLA 2M5WA 5TJJA 1W7PB 1RI7A 2DBBA 3P9KA 2GA2A 3F8BA 1HW2A 4KFCA 4RAYA 4WX9A 5L3EA 5CVJA 3JSOA 2FNAA 4EJWA 4KN4X 2VC0A 4NQWA 3TKYA 2NRAC 1SMTA 1FSEA 2HGCA 4PGGA 4U0YA 1IRFA 2STWA 1FBUA 4WXCA 1QNTA 5JHUA 5LGUA 5AIPA 2E1NA 5D5UB 2H94A 2X0LA 3Q9SA 1QZZA 1BC7C 2HKXA 3K9TA 4HX4A 1ON2A 3KP3A 2KIUA 2BYVE 3GFJA 1IN6A 2IJLA 2VOPA 4CO8A 2CFXA 2JZYA 5BQTA 2KJBA 3DKWA 4EM2A 5CVIA 5ED4A 1G3SA 1FZPB 4MNUA 2OZ6A 4L9JA 2LF8A 3RJPA 3CO6C 3GLXA 1TTYA 1YLFA 1KQ0A 2IW5A 4HZFA 2DO7A 2E7WA 2XAGA 1PP7U 4KMFA 2PQ8A 2CWEA 2WTEA 3M8FA 4GGGA 2P6TA 2X4HA 4S05A 4M6XA 1O3QA 3RYPA 2Y0MA 3I71A 1FP2A 1H0MA 5HLIA 2BV6A 3E97A 1V3FA 4L5JA 4OIRF 1B6AA 4Y17A 2YPRA 3WTYC 1S7AA 4RGXA 1ZGJA 1F1ZA 1Z91A 2V1DA 3JTGA 3U2RA 2FBIA 2M8EA 5BS6A 1E2XA 3LA7A 4EMSA 3CLOA 4L0ZB 1KU2A 4LK0F 4KUMA 1KYZA 1G3YA 2P7CB 3DV8A 4OMZA 2QQAA 3ZMTA 2EFOA 1FY7A 2HWVA 5DD4A 3Q5FA 2HTJA 2F5EA 5E8IA 6PAXA 4A5NA 3R6SA 1BI2A 2CGPA 5H6QA 3BJAA 1BOAA 3VB2A 2Y75A 2YR2A 1F9NA 2H27A 4O3MA 3GFIA 4A6EA 2MC3A 1T6SA 3EDPA 1ONVA 1KA8A 1HKTA 1R1UA 3W6KB 2FBKA 2UXNA 2QENA 3WTSC 4RGRA 4JBAA 4OOIA 3COAC 4ESJA 1SD6A 3KP5A 2PLYA 1YW7A 3DP7A 1VTNC 4R1HA 4NB5A 4O6JA 4ETSA 2F2EA 1DUXC 1R7JA 2L01A 2LSOA 3QRFF 4H0EA 1O3RA 4WCGA 2GAUA 4HV6A 3CUQC 2VBZA 5HDGA 2CQKA 2QBYA 1ZAOA 1Z1DA 1Z05A 2DQRA 1S3JA 2L3DA 5K5QA 3M8EA 4E70A 5DD8A 2RV8A 3B73A 2DTRA 3BJOA 2Y48A 3E3VA 3MWMA 2MBFA 5K5RA 4ZYDA 2DU9A 1HBXG 1R5GA 3ECOA 1BI0A 3DPTA 3LAPA 4M74A 3IHUA 1XSXA 5LEKA 5E1XA 2RQPA 4LLLA 2A6HF 3M1EA 3C3WA 3TO6A 1YFHA 1XGOA 3KETA 2DLLA 5FB2A 5HLGA 4KIFA 1KGSA 3GEZA 2C6YA 1J7KA 1FNNA 4LD5A 5LHIA 3JAMZ 1J59A 2P5VA 1MZBA 4N0BA 1BBYA 4KDPA 2DAOA 2KIFA 1D8JA 2FA5A 3R0JA 4KA4A 1FSHA 4ENKA 4RB2C 3HHHA 4IRHA 1BC8C 1IN8A 1UCRA 2ZXJA 4HW0A 5L3BA 1IN4A 2RVCA 3KFWX 3F23A 4GXOA 1MKMA 2XIGA 3SZTA 2ELHA 3LQQA 4I09A 1JGSA 1TQIA 3ZQ7A 2L4MA 2AS5F 1LEBA 4I01A 3GZ5A 2Q8KA 1U6GA 3WTWC 3V8KA 1V4RA 4PGHA 5HS9A 3QU6A 5L3CA 3GWZA 3HSRA 5D6EA 4LB6B 4A6DA 2V79A 1R1TA 4D0PA 4UV9A 4KIBA 3EETA 3MAJA 1HSTA 2LDUA 3W6JB 4Q4ZF 3QOPA 4AIHA 1BN5A 2MD5A 1XCBA 3I58A 5D4RA 4EVIA 5ILVA 1ZRDA 1FLIA 4A12A 3L9FA 1TW3A 2G7HA 2QLZA 4OIOF 3TGNA 5D5XB 4M71A 3HHGA 2FOKA 1OR7A 4Y13A 3AAFA 2NAZA 1RZ4A 3C7JA 2NS0A 5CJ9A 2JPCA 1KU3A 3ECHA 4G7HF 1IF1A 4BH9A 3FWEA 3KP4A 4AIJA 2QQ9A 3KEQA 3IWFA 1PDNC 3WGGA 5J8FA 3KCCA 4L9NA 2O03A 2UWMA 2FMYA 3RTRA 5CLSA 3MZYA 4ZH4F 3IRRA 4MTEA 1T0FA 1W5SA 1E17A 5D8LB 4IHSA 3EYYA 3ZMDA 3IKTA 4AWXB 2V1XA 3WTZA 4HF1A 3K1MA 1OYWA 4LK1F 3P9CA 3SHFA 3E6CC 2PG4A 1IZ1A 2WC2A 3QP5A 4WXDA 3VFZA 3WE3A 1HKSA 1H9GA 2PN6A 3J7AO 2DFIA 2R7FA 3CUOA 3MEXA 3FXQA 3L7WA 1F5TA 1YW8A 2VBWA 1BM9A 1TW2A 3WGHA 1BIAA 2ZO4A 4G94A 1K7AA 4HX8A 4IXAA 1G3WA 3BPVA 2MA3A 3RDIA 3T8TA 4ASNA 3QAHA 2UZKA 4M9XA 2PJPA 1P4AA 3NEUA 3KP7A 4LFUA 2COMA 1G4DA 4UV8A 2H6CA 2H6BA 2JRTA 4ZYEA 2V1UA 2XAJA 4ZYHA 1R1VA 2B0LA 4JK1X 5DCFA 2UXXA 1MD0A 1O57A 3QPHA 4HBLA 3F6OA 4HQMA 3JSPA 3ZPLA 4UVCA 4P9FA 2VBXA 2YU3A 2YX4A 2O8XA 5L3GA 3J81K 5JFRA 2XGXA 5LBQA 4EJVA 4CDGA 4A5MA 5FLXZ 3F21A 2ZMEB 3OV8A 2LF7A 5CVVA 2F5DA 2PMUA 3F8FA 4YIFA 5HDKA 3HTUA 1FX7A 1JE8A 3IKVA 2FF4A 3SQNA 4MQ9F 3MFKA 1SD4A 1PP8F 3C18A 4TV7A 4AVPA 2ZKZA 5HS7A 1U5TB 4GYIA 5E1ZB 1R36A 3JAMK 4HLXA 5FD5A 4RGUA 2HYGD 3T8RA 3WTTC 1O3TA 2NNYA 2ACJA 2HDCA 2IA0A 3G3ZA 3R0AA 3CTAA 5LHHA 3E6DA 1R23A 3KEOA 1B1BA 1S7OA 1XSDA 3B02A 4CXFA 3MQ0A 1UHMA 3BROA 3K0LA 4BHPA 4G6DA 2F5FA 2TDXA 2XAQA 1XDSA 1FOKA 2VT2A 4I7HA 1U2WA 4LLNA 3F22A 5D6FA 4OMYA 3KLNA 2IVMA 1LJ9A 4DQ2A 2K86A 1EH7A 3ZMZA 1WKMA 1T2KA 3TQNA 2GWRA 3REOA 3DPLC 1S8NA 2XROA 1ZLJA 4P96A 4IJAA 2CSOA 4GYGA 2J5PA 3GFMA 3ROUA 4G9YA 4CYDA 1QBJA 2ETHA 3GYHX 4A2UA 1O3SA 2RDPA 2A6EF 4YFKF 3S2WA 3NRVA 1S29A 5ILUA 3I4PA 5HDNA 2LKPA 1L0OC 2XRNA 4PCQA 4IRGA 2VN2A 4EJTA 3KZYA 1RUNA 1ZRFA 3FF5A 5BOXA 3FMRA 3HIFA 3HUGA 2G7UA 5LGTA 1ZLKA 2H09A 1SMYF 1EH8A 1QGPA 3FM3A 5E20A 1MDMB 3VODA 1ZG5A 3QU3A 2EFQA 3TOAA 4LG0B 4FT8A 3BY6A 1J2XA 4L18B 4R8HA 3DEUA 3CUQB 4WF2A 2J5OA 2NNNA 1ON1A 4A0YA 3GVAA 1SFXA 1MDMA 2YSRA 3K69A 1LQ1A 2MH2A 2VT3A 2K02A 3WGIA 2GA1A 2D1HA 3BWGA 2EB7A 3HSFA 4KIGA 3CUQA 2VXZA 3GX4X 4EV0A 2EV5A 5JI6A 4EQQA 1OYIA 1B9NA 5DDGA 3IRQA 1Z6TA 3BOQA 4ENMA 4CZZA 2PEXA 3GUDA 4M9ZA 1KYWA 2W85A 3I59B 3JTHA 5DCMA 2OD5A 2XUBA 2OQRA 4KN7X 1JHFA 2KIMA 1B4AA 1CGPA 1HSJA 1LNWA 4Z2YA 2RGVA 2VBYA 4XLNF 2PBIA 2Z5UA 5CYVA 2D1VA 3NQOA 5DCMB 5KVRA 1SFEA 4WK8F 3J80K 3RKYA 5AIQA 4QWQA 3HOTA 3EYIA 4HQEA 4YFXF 4UNOA 3I59A 2GXGA 3MZHA 3DQVC 2FBHA 1TQPA 5D5WB 3DF8A 2K4JA 4HDUA 1ODDA 3K2ZA 4GO1A 1GVJA 1QO0D 2ZCWA 5ICEA 1K6OA 2YX7A 4YG2F 5J6XA 3WG9A 2STTA 1HW5A 2JPBA 3RPQA 1YW9A 1TLHB 2FRHA 3I64A 3RKXA 2DI3A 3ZN1A 4LGWA 1AOYA 1IXCA 2LNBA 3WODF 3I53A 5ICCA 3Q9VA 1USTA 1IXSB 2DQLA 3V4GA 1U78A 4EM0B 3HSEA 3V8JA 3T1BA 4OU0A 4U7BA 4IPAA 1FYLA 1XMAA 1LDDA 4WXHA 1SFUA 1Z9CA 2P8TA 1XCVA 5LRRA 4S04A 1W5TA 2ZFWA 4BAYA 1KU9A 3SXYA 1FYKA 2XHKA 2PI0A 2XKPA 2R3SA 4Q47A 4OINF 4B8XA 1GXQA 1G6NA 2JSCA 3E5QA 2FMLA 4WWCA 3KLOA 4UHTA 5BPDA 3GFLA 5IT9K 3JW4A 4FX0A 1R5HA 2FNPA 1DP7P 4UUVA 1DDNA 3E5UA 1STZA 2EK5A 2KJCA 1YQAA 1JXSA 4FHTA 5BMZA 2FSWA 1T39A 4LB5A 2EV6A 2A07F 2MLKA 2W84A 1K78A 3HRMA 4HF0A 3MCZA 2Q0OA 5ERIA 3GW2A 1MGTA 1U8RA 2CG4A 2W25A 3ISPA 3TO7A 3BJ6A 1BI3A 3BP8A 3K1NA 3FX3A 2E7XA 3E6MA 3RPUA 4NHJA 2O61A 4R79A 5LLQA 5F64A 5A2QK 2O6GE 1ZRCA 2HS5A 2RC4A 2QM3A 1HQCA 2V9VA 4RGSA 1CF7A 2AXLA 3PQKA 2Z3YA 2DK5A 4MQVA 4G7OF 2GXBA 5D8KB 3ZMUA 5DUIA 4HDVA 1P92A 3WTXC 4XSZF 3N4MA 1S6LA 1SD5A 3CJNA 4UXNA 1OKRA 2HOEA 1ZYRF 1YG2A 2FE3A 4KYWA 3BDDA 2RNJA 3D0SA 4YIIA 5LGNA 1WQ2A 4G8XA 1KQ8A 1MJAA 1UB9A 2W24A 2EFWA 2MLGA 3FM5A 2L02A 1XB4A 4LMYA 2QYOA 1LEAA 2FXAA 1LB2A 4PDKA 2ZMEA 2R7DA 4N9HA 4HX7A 2M87A 3P9IA 4BXUA
chains in the Genus database with same CATH superfamily
3FZVA 2DYSH 1MNDA 3G1MA 3A01A 3M4OJ 4JX5A 4F91B 2ZMEC 3IC7A 1XGMA 1WI3A 2L7ZA 1TQMA 2HQRA 1I6HJ 2F4OB 1YIOA 1QU3A 2Z33A 3K1PA 3KP6A 3WE2A 4E7SA 3S1NJ 1J09A 4UVBA 2IT0A 3DU6A 4IOCF 2IP2A 4XKVA 1B59A 3CC4I 4RAZA 3QP6A 1Y8QB 1P6RA 2XSJC 4IF4A 2LKXA 2K9MA 1XGSA 2L54A 5EEGA 1QPIA 1WSUA 3TO9A 3V7SA 4Q5SF 5IT3A 2Q1ZB 3CD6I 1XS9A 1J9IA 3CCEI 3T0YA 1REPC 4M3BA 3S3NA 2GXAA 4C3JJ 3VSKA 1U5TC 2OU2A 4JQFA 2XRLA 3WTUC 1H88C 4UVAA 2VE8A 1IDYA 1MMNA 5D4SA 1I27A 1MMGA 3G1LA 3L00A 3L09A 5CPRB 2ESNA 5CVUA 3K4BA 3R61A 4HOBA 2FQ3A 2BVMA 2W48A 1ZARA 3ZP5A 3ZN0A 2KP6A 1IJWC 1X3WB 4IEJA 1YHQI 1FYMA 4NDLA 1P2FA 3M3YJ 2VUMJ 2ZFUA 2ZNYA 5B1BH 2JVGA 1USSA 2XASA 4KMUX 3DTIA 3HPHA 4BDZA 5E17F 2K4BA 4LLGF 4RAGA 4MLOA 3LSMA 2KFDA 2DA6A 3C2HA 3ELKA 1IW7F 1KQ9A 1R4NB 4RBOA 2CRGA 2M4GA 3O3KA 5FKLA 1OJLA 4EJOA 2H1KA 1T0FC 5IOYA 4RB3C 3CO7C 4KJZA 2DJIA 4B48A 1VQLI 3KZZA 2M2EA 1ZG3A 4EEFG 5GAHJ 2EIJH 4F3QA 2L4AA 1FP1D 2VJIA 5TRDA 1UFMA 1MJ9A 2O0YA 1HKQA 3KPHA 2QUFA 4GRIA 5KAIC 3GF2A 4JYKA 1LDJA 5E18F 4P1WA 1Z7UA 1IN5A 2Y31A 5F1RA 4MEYF 4LITA 4PFPA 4HF2A 2CQQA 1ETXA 5EEAA 2EJRA 3BCAA 3DXJF 4Z6YA 2F4IA 3OY9A 1XSVA 4AIKA 2I5UA 2QZ8A 3H36A 2CQNA 1TBXA 4MHGA 4HAMA 2GQQA 1X4PA 4B3AA 2QWWA 3PJRA 5EGOB 4BE0A 1RKWA 4D7NA 3ABUA 2E1OA 3L2RA 4J00A 2MH9A 2P4WA 2LD5A 1FT9A 2IRFG 4G6QA 4II3A 2L9NA 2MYSA 3JRBA 4I02A 1L3LA 2HFHA 1ZREA 5FFZA 4XR6A 4GCVA 3RKWA 4DBRA 3G73A 5B5EC 2R0QC 5EEHA 1MBHA 2XVCA 3M7GA 2MGQA 3GO5A 5GAEJ 3HGGA 2QBYB 2OCEA 1WPKA 2JA8J 4NC6A 1FMWA 2MFZA 2JUGA 3FXLA 1DQUA 2HQAA 2V6CA 2ZNZA 2P6SA 3ML6A 4M6VA 2L9SA 4D5FA 3D5LA 2KL4A 3EQLF 1QRYA 1SD7A 2LH9A 3TDUC 4FCYA 4NQWB 1I6XA 2P81A 5FO5A 4DW6A 1J75A 3DKXA 5IT9Z 4KT5C 4IQJA 2BEOA 4IVNA 3LA3A 3M9AA 2F48A 2E5ZA 1A6QA 1MNEA 1F4KA 2M9HA 4BQAA 2ZBKA 1OQYA 5FGMA 1FWZA 2DPUA 1FBSA 4BNCA 2EV0A 2R7ZJ 2DA5A 4PJMA 2JN6A 4CICA 4X0GA 1RUOA 4CCNA 1TT5B 2QVOA 5FLXK 3MKZA 1XDUA 2HDWA 4UUSB 4IOAF 5ICFA 1SAXA 3PFIA 2DA3A 2EILH 2RN7A 1UHWA 3KYDB 3K2AA 3WHCA 2R7XA 3BG6A 3TDZC 3A4CA 3H92A 3ZMSA 1C0WA 4IHTA 3ABTA 1TNTA 4HYEA 1VQ4I 5J8CA 5FKMA 3SZGA 2ME0A 4O5VA 3VYUB 2DMUA 1AWCA 4MTDA 3SEZA 2ESHA 3CCJI 3KE2A 1ULYA 5GPCA 1S7EA 3H1CA 4YFNF 4A0XA 1IUFA 1VQ6I 5E3LA 4P9UA 3HRTA 4OIPF 1V54H 5J1RA 1IRGA 3ZQFA 3RPUD 3L1PA 3TBIA 3V7CA 4RMNA 2K5CA 2L9RA 4IHVA 2BZTA 2KRFA 3IAS2 4CHUA 2JTVA 4UUSA 1FC3A 2FEZA 4RS8A 2DOAA 1A36A 2V6EA 1P4XA 1ACIA 1O7FA 2AXTC 3DFGA 3T5XA 3OYDA 1G3TA 4XSXF 1FOYA 3OYMA 4NUBA 1PUEE 1Y1WJ 2M4KA 3OYJA 3G6EI 1YYVA 3NWSA 4EGYA 4B44A 2OTLI 2KKOA 3BR3A 4ZZLA 5IY5H 3HRUA 3AG1H 4XKWA 1D1CA 3RIRA 1ZGWA 1VNDA 5K7ZA 4Y15A 3OYFA 1GDTA 5LHGA 3I56I 5GTIC 5HVQC 3JRAA 2VONA 3ZQIA 2X6WA 3W2AA 1A04A 2DYRH 1BL0A 3L2CA 2PFBA 3ULQB 4J19A 3QPTA 5ICGA 2CQXA 3O2PE 4AVZA 2DN0A 1I1GA 4C3IJ 1T8IA 1VQNI 1IAWA 4PSWA 1QZYA 3TEDA 2A5YB 1YS7A 2W82A 1YI2I 3V8LA 5EZGA 3FXUA 3G1OA 3OOPA 2O5RA 3FMQA 1J5YA 1OMIA 2K40A 1WJDA 2PJRA 2NS8A 2X85A 2E1MB 3R4KA 1GHCA 2A61A 1EV7A 1H9TA 3N97A 4M73A 3BZ6A 3VOEA 4CCLA 5H6RA 1R00A 1WI9A 4OWRB 3FBNB 3F3XA 3C1DA 1B72A 2OPTA 3F6VA 1NHAA 1QHGA 4BBRJ 2M0CA 3J80Z 4XICA 3LSTA 1IV8A 1QPMA 1T95A 2VJJA 3GXOA 2XAHA 2HYFA 2NYXA 3FMSA 4RB1A 3GZ6A 1FPQA 2ADUA 1EH6A 2DA7A 2IA2A 2HZDA 2HOSA 4I2OA 2DFHA 3CCSI 1X3UA 2R5YB 3PFYA 2KDOA 1QQIA 3RQ4A 4AD9A 4MGRA 2ZC2A 5JVGF 3QYBA 3H0GJ 1WWXA 1IDZA 1XMKA 4M9SA 4RLFA 2HQNA 1XTAA 4OAZA 5HS8A 4M6YA 2X6OA 4ESBA 1CF7B 2K7LA 2FU4A 2NS7A 2CYYA 2OC6A 2FD5A 3PQJA 4ZTFA 3QYFA 2EZHA 1BOBA 2EFPA 2ECCA 1IRXA 2JWTA 2KQRA 3F8CA 1OYYA 1Z3YA 1R22A 2QQBA 5DV5A 3PUBA 1O7LA 5EJCA 4U88A 1N75A 4N9IA 4ZZDA 2HU9A 2IA1A 5LRSA 5JVTA 2AQFA 1ZGAA 2HTSA 5L3FA 3JRCA 1Z3XA 3ZQLA 4U0WA 1VFCA 2HEOA 4B09A 3U1DA 2G9WA 2E1CA 2DK8A 2H8WA 1WRJA 4RB0A 2OZUA 3U9GA 3H5RA 2E2JJ 4OIQF 5GP9A 2XDVA 1D8KA 2CUFA 2K27A 3O6BB 2DTZA 2OQGA 2DPDA 1B9MA 3H0DA 4LG0A 2W57A 4F93B 4CCOA 5D5VB 1UELB 4XQFA 1G59A 5CKTA 4IL6C 3MVPA 3S3OA 2ISZA 3ZMVA 3G2BA 1ZG1A 4DOZA 4FQGA 1ZKGA 2BY2A 2XGEA 1G8XA 5FKNA 4KT6A 2BE5F 1YS6A 3VEPA 5DUKA 4QLCU 4PZJA 3WU1B 1BJZA 1UMQA 2P5LC 1MJBA 3S2DJ 4F52A 4L9VA 3ESWB 1JTYA 3I54A 4F7ZA 4AUXA 4P55A 5DYMA 3CMEI 1D3YA 5K5OA 1DPUA 4PFOA 3R60A 2VODA 2PMHA 2QSHX 1D5VA 1TZLA 2ZXHA 4E7JA 4HG2A 2OA4A 4CSWA 1LDKB 2IPQX 4XLPF 1ETWA 1JHHA 2ZSIB 2P7VB 5EYRA 2O3FA 2ZXIA 4I0BA 3J7AY 4A93J 4AU7A 3LAJA 1W7PA 5JR3A 1RIOH 4ZDOA 2M1BA 2WB1N 5ILSA 3HTSB 4BY1J 3A2KA 2VOOA 4PJLA 1Z7LA 1SC7A 2RKHA 4XN0A 3H35A 2EFNA 4K2EA 3S32A 2LREA 1BJAA 1VQMI 1WJCA 1BI1A 3DBLB 1OPCA 4XKCA 2JMWA 1Q1HA 1KU7A 2CO5A 3P7NA 4ZDPA 2EA4A 2D45A 3FHZA 1W1WE 2QKMB 5FD6A 1ENHA 1K78B 4XRFA 1MSEC 4EM1A 2ECBA 4XBFA 2HKOA 3SDBA 1OCOH 1R6RA 4CCMA 1B8IA 2DW4A 1K6YA 1VQKI 1LVAA 1PUFB 4IHXA 3LSGA 4LG3A 2K9QA 1ZQ3P 5K1YA 1Y0UA 4XMYA 3S8PA 4ZYGA 3V7RA 5A2QZ 3J81Z 4P5OA 3ERED 1T38A 3PSIA 3V42A 2GIVA 3A03A 1HOMA 2XKOA 3RI4A 3E6BA 5CVRA 5E79C 5L3DA 3BG9A 3LQRA 2VE9A 2O9LA 1FEXA 2M45A 1P4WA 4PUSA 2DOFA 2P5KA 1E3PA 3HOSA 1K79A 3H3UA 2HZTA 3F8NA 2EBIA 2ELJA 3K4NA 4E4HA 2V1NA 1W7PD 4KICA 4U7DA 3LOCA 2ZSHB 4LIUA 1DPRA 2K3FA 3BTIA 4RAFA 1H89C 4LOCA 4KNYA 2EZLA 1TC3C 3HRSA 3TOBA 4ON0A 1QZEA 4I98B 3TP3A 1WHUA 4HV5A 5E1WA 3EUAA 3AG2H 2BBYA 4UUTA 1NK3P 2A69F 2ISYA 4BHBA 1VQ5I 2VC1A 1KZHA 2WWYA 1R4MB 5B66C 5H20A 4CGZA 4BYYA 4HRIA 2BW3A 2Z16A 1T98A 2Q2EA 1RESA 1UJ8A 2HR3A 2E19A 3K70D 4DNCA 4V2GA 4I0AA 5BNGA 3CCYA 1N25A 1ZHFA 5EGOA 3F8MA 1SFOJ 1RRJA 1W4MA 4HA8A 3SZPA 3SFZA 2D2WA 3SYTA 3J7YJ 3RZOJ 4QPOA 1XN7A 2Z99A 1GVDA 4MEXF 2M7BA 2ZJ2A 1TNSA 3RYRA 3HYIA 1G2HA 1R9TJ 3CP8A 3H3ZA 3U1KA 3WTVC 3K4JA 2A3SA 4CCKA 3JRFA 5F1JA 5B3SH 4FX4A 2Q2EB 3E5XA 2LBFA 2OAZA 1IO2A 4Y3OA 3GBGA 2Y0SA 2Z9OA 5BPIA 2WAEA 3CDHA 2WB1A 3JCUC 3WG7H 2OBPA 5FRNA 1R58A 2JT1A 1I1SA 1XD7A 2COBA 3UKGA 5FROA 1HW1A 5AONA 1OCRH 2EZIA 4U0VA 3C2BA 3RSNA 3F72A 3K7AJ 3DKYA 4CA0A 1YTYA 1GXPA 4ENNA 3I0TA 2XAFA 2XV4S 4XL9A 2WADA 3KP2A 1XGNA 1BIBA 4IRIA 2CJJA 4EGZA 1S72I 1IXRC 4HSRA 4Q48A 2KPMA 4EJUA 1ITYA 2WY8Q 1P9QC 1J0RA 3LWFA 4XIDA 5F6FA 3DWLE 4L0YB 2EWNA 2XF7A 4HSTA 4A0ZA 1U3EM 4QIWN 2B63J 2LYCA 3QQAA 2EA2A 4L9TA 2GZWA 4XLEA 4AC0A 5HOOA 3IL2A 1U5TA 5GAGJ 2CFOA 3LA2A 5KK1A 1GV2A 1RPWA 2CUEA 2MC4A 5E3NA 3FXRA 1LKXA 2JUCA 4G7ZF 3HB9A 1IUYA 4M72A 5J3LA 3OYLA 2ID6A 4L5IA 4S0HB 2DMPA 2P0WA 5FFXA 4BHCA 1MSFC 2DT5A 3K70C 1JGGA 4ESFA 1Z6RA 2WV0A 2BGCA 1ZN2A 3WU0A 1NG7A 2LY2A 4LJZF 3OYEA 3RCOA 1IN7A 5HLHA 2LY9A 4XLHA 3IWZA 1Y8RB 2F5CA 4ENJA 4FISA 1ZH5A 3LFKA 3GTQJ 2BVLA 1UZCA 3DU5A 5E8GA 2CV0A 1FBQA 5EF6A 1HCRA 2M30A 5LEJA 4HLYA 3DTKA 2CW0F 3JR9A 1IG7A 3I5UA 1JT0A 5DM7F 4AM3A 1YO5C 3EUHA 4FASD 1I5ZA 1HXDA 5DEQA 1SANA 2A68F 3BPXA 2JVHA 4BACA 2KT0A 2X9DA 1RNLA 2M5WA 5TJJA 3ASOH 1W7PB 1LE8B 2EH3A 2L7MP 1RI7A 1W36D 2DBBA 3EUHC 3TP0A 3HG9A 2GA2A 3P9KA 3F8BA 1HW2A 4A3LJ 1LFPA 3KX2A 4RAYA 4KFCA 4WX9A 3K4KA 2HNHA 2MD0A 2MSYA 1RKTA 5L3EA 5CVJA 2H8RA 3JSOA 4ZYAA 2FNAA 4EJWA 4A3IJ 4KN4X 1DP3A 2VC0A 4NQWA 2ICWG 1OFCX 3QYEA 5DS9A 3CCVI 2IGOA 3TKYA 2K9LA 1HDPA 2X51A 2HYJA 1TWAJ 1V5EA 2X1DA 2NRAC 1DGRM 1SMTA 1FSEA 1FIAA 2HGCA 4PGGA 4U0YA 1IRFA 1QVTA 1FBUA 4WXCA 4XOPA 1QNTA 2STWA 5JHUA 5LGUA 3LSRA 2XC7A 3OYBA 4E7HA 5AIPA 2E1NA 5D5UB 2H94A 2X0LA 4AIDA 2M8GX 3Q9SA 5IOZA 4DJAA 1QZZA 1BC7C 2HKXA 5JLXA 3X2QH 3K9TA 4HX4A 1ON2A 3CJQB 2IGKA 2LKSA 3OYCA 1WVRA 1Z0XA 3KP3A 2LG4A 2KIUA 2BYVE 3GFJA 1IN6A 1TT0A 3EPZA 3DCFA 3JRHA 2IJLA 1MH4A 2YU9J 4FTHA 3CMAI 2VOPA 4FE4A 2BY0A 3ZGKA 4BEHB 1JJ6C 4NC8A 3HUGB 4XNFA 3CZ6A 4CO8A 5LD2C 2CFXA 5EG0A 2JZYA 5BQTA 2KJBA 4YRVA 3DKWA 4EM2A 5CVIA 2VQLA 5ED4A 1SEUA 1G3SA 1FZPB 2WAQA 3JRDA 4MNUA 5F0FA 2OZ6A 1WGXA 4L9JA 2LF8A 3RJPA 3CO6C 3GLXA 1TTYA 1YLFA 3FHNA 3CMYA 3C2GA 1KQ0A 2R7RA 2R7SA 2IW5A 4HZFA 2DO7A 2E7WA 5HODA 2EZKA 3FXMA 2XAGA 4D5CA 2VQCA 1X1AA 1PP7U 2R93J 3JRIA 4KMFA 2PQ8A 3QODA 1X2MA 1X3ZB 4BL0B 2CW7A 1BW5A 2CWEA 2WTEA 3M8FA 4XM3A 4NBQA 2H1LA 2E60A 2CU7A 1YX5A 2CUJA 5C44J 4GGGA 2P6TA 2X4HA 4S05A 1XX5A 1X1DA 4M3DA 1W36C 3BG7A 2VPLA 3I9V2 4M6XA 2Y2ZA 1O3QA 3RYPA 1EF4A 1MNMC 4BE1A 4XKBA 2Y0MA 4F55A 3I71A 4GDFA 1FP2A 1H0MA 5HLIA 2BV6A 3E97A 2Y9YA 1V3FA 4L5JA 4OIRF 1B6AA 2RREA 5IYDJ 4Y17A 1LFUP 5GTHC 2YPRA 2VKHA 4ZDLA 1VQ8I 2MW8A 4JX4A 3WTYC 1S7AA 4RGXA 3CCQI 1ZGJA 3MN2A 4BKXA 3OR1C 3MKWB 1F1ZA 4X6AJ 1Z91A 4CH7A 2V1DA 3JTGA 5F08A 4G12A 3U2RA 2FBIA 2VIXA 2M8EA 4PK4A 2DT7B 2KIQA 3HOXJ 3BG3A 5BS6A 1E2XA 2Z1DA 3LA7A 4EMSA 3CLOA 3KZIC 1KU2A 1VF9A 4LK0F 4L0ZB 4KUMA 3I4NJ 1KYZA 3B6CA 4F92B 2E35A 5J4YA 3HPGA 1G3YA 4D9JA 3DV8A 4OMZA 2EQRA 2QQAA 2P7CB 3ZMTA 3I55I 2EFOA 1FY7A 2HWVA 2JQ7A 5JLWA 2IAIA 4ZC3A 5DD4A 3Q5FA 2HTJA 2F5EA 5E8IA 6PAXA 4A5NA 3R6SA 5EDNA 1BI2A 1FOWA 2CGPA 2NOJB 5H6QA 2DOEA 5KHDA 4A3EJ 3BJAA 4Y33A 5K7HA 1BOAA 3VB2A 2Y75A 2X1CA 1VI0A 2YR2A 1GLNA 3W2WA 4XORA 2PMZN 3NAUA 3CF2A 1Z21A 1F9NA 2H27A 4O3MA 3ONQA 2BOLA 1ETKA 3CDIA 3HJEA 3GFIA 3HOUJ 4A6EA 3AKZA 3OR2C 1IV6A 2MC3A 1T6SA 1S9HA 1HDDC 3VYTB 3A0BC 1TP4A 4JP0A 2VL8A 1WFXA 2Y0SN 2JA7J 2WBMA 2GBYA 3B6AA 1LE8A 9ANTA 1I50J 1VQPI 3EDPA 3FXJA 1ONVA 3GTPJ 4MFEA 1KA8A 5J47A 3OS1A 1HKTA 4BE2A 1R1UA 3W6KB 4RA2A 3BZCA 2FBKA 4BBSJ 1OLTA 2BHYA 4YELA 1JJ8C 2UXNA 2QENA 3WTSC 4RGRA 4JBAA 4AYBA 2NVUB 2E36A 4CCJA 4OOIA 4ZJZA 2DDBA 1VZ0A 3COAC 4XLFA 1QHHD 2E5NA 4ESJA 1SD6A 3KP5A 2PLYA 1YW7A 3DP7A 1VTNC 4R1HA 4NB5A 3PL8A 4O6JA 5LFAA 4ETSA 3OSFA 4FE7A 2F2EA 4CUGA 1DUXC 1MIJA 1R7JA 1HLVA 2L01A 2W7NA 4RLQA 2LSOA 3QRFF 4C2UA 4H0EA 5F04A 1O3RA 3M07A 2HVQA 2Z2SB 3TMOA 4WCGA 4HPQA 2HVSA 2UV1A 2GAUA 2VKDA 3GTJJ 4DZPA 3PNVA 2W4SA 4HV6A 3CUQC 4A3FJ 2VBZA 5HDGA 1N77A 2CQKA 2QBYA 1MBGA 1ZAOA 2EINH 1X1CA 1Z1DA 3HOVJ 3NWTA 1Z05A 2DQRA 1S3JA 1MW7A 1D0YA 5IYBJ 2L3DA 5K5QA 3M8EA 4HEA2 4E70A 5EG0B 5DD8A 1FTZA 2RV8A 5FLMJ 2E71A 3H5AA 2R5ZB 4BEHA 5GADJ 3B73A 2DTRA 3P5JA 2O7OA 3A1YA 1P7JA 3BJOA 2DA2A 2CQ7A 3LFUA 5TISC 4D1QA 2Y48A 3E3VA 3MWMA 2MBFA 5K5RA 4ZYDA 2DU9A 1HBXG 1R5GA 3ECOA 1BI0A 2QA4I 2VJ5A 3HOYJ 3DPTA 3TL4X 3LAPA 4M74A 1U9OA 3IHUA 2CW8A 2HXOA 3CESA 1XSXA 2X1EA 1HA8A 4DBQA 1X4OA 1R5ID 4XN3A 3VDXA 5C4JJ 4E7IA 5LEKA 5E1XA 3OYIA 2FQ4A 2RQPA 4LLLA 2R7VA 2OF7A 3OMYA 4C2MJ 2A6HF 3PNYA 4I76A 3K6GA 3M1EA 3C3WA 3TO6A 1YFHA 1XGOA 3KETA 2K9SA 2A6TA 2DLLA 2LVSA 2IS1A 1ZR2A 1APLC 1S5LC 5FB2A 5HLGA 3OSGA 1OCTC 4KIFA 3ZQQA 1KGSA 3K10A 3GEZA 2C6YA 5H2FC 1J7KA 3DPUA 1FNNA 4LD5A 4PJNA 5LHIA 3JAMZ 1JKPC 5FKKA 1J59A 1ORKA 4A3DJ 2P5VA 3CC7I 2IS2A 1MZBA 4DGWB 4N0BA 1BBYA 3ZOBA 3IH4A 4KDPA 3HKZA 2DAOA 2KIFA 4KISA 1UAAA 1MH3A 2HOAA 4UY8I 1D8JA 2FA5A 3GMEA 3R0JA 4KA4A 1FSHA 3MMYB 2BHZA 1T56A 3BTJA 4ENKA 3GTKJ 3FXKA 2L7FP 4RB2C 3BLYA 3HHHA 1YOVB 1YJ9I 3GCMA 4IRHA 3VYSB 3L2QA 1WH7A 3E0JB 1BC8C 2LC2A 1IN8A 1UCRA 3BR5A 3ZQCA 3SEQA 3A02A 2ZXJA 4HW0A 5L3BA 2OV7A 3ZRGA 1IN4A 2RVCA 3KFWX 2I8DA 2VKEA 3S93A 3M8JA 5M3MJ 3F23A 4GXOA 1MKMA 2XIGA 3VPRA 3SZTA 1OISA 2ELHA 2DMQA 2FX0A 3FDYA 3LQQA 1WJ5A 3IH3A 5J40A 2F5VA 4I09A 1JGSA 4N4OB 3MKLA 1TQIA 2K9NA 2PMZA 1R71A 3Q0UA 5M3FJ 2NVQJ 3ZQ7A 3OOUA 1WJAA 2VLAA 2L4MA 1SVMA 2AS5F 3OYAA 4MIMA 4I01A 1LEBA 4C9YA 1A35A 3GZ5A 4PSXA 4OAYA 2Q8KA 1U6GA 3WTWC 5TGTA 3V8KA 1V4RA 4PGHA 4JX6A 3OWTA 1LUJB 4RM3A 5HS9A 3QU6A 5IP6A 2KZVA 5L3CA 3QOEA 1F36A 3BT9A 3GWZA 3HSRA 5D6EA 4LB6B 4M3EA 4A6DA 2V79A 1R1TA 4D0PA 2R7WA 3AL0C 4UV9A 2F6CA 4KIBA 1OCZH 3EETA 1ZR4A 3KEYA 3MAJA 1HSTA 3QWLA 2LDUA 3W6JB 2BXZA 4Q4ZF 3QOPA 1PJRA 4AIHA 3IP4B 1BN5A 1Q1VA 2MD5A 2R5ZA 1XCBA 3I58A 5D4RA 2WAFA 4EVIA 5ILVA 1ZRDA 1FLIA 1ZTRA 5KNLA 4A12A 3L9FA 1TW3A 2OCCH 2G7HA 2QLZA 4XRSG 4RDUA 4OIOF 3OIPA 3NARA 4BJTA 3TGNA 5D5XB 3PIPF 4M71A 3M1CA 3HHGA 4IQ4A 2FOKA 4Y4RA 3KYLA 1OR7A 3FIWA 4Y13A 3AAFA 4BJ6C 2NAZA 1RZ4A 1V5GA 3C7JA 3RZDJ 2NS0A 5CJ9A 2JPCA 3I3LA 2VASA 4U87A 2VQHA 4XONA 1NK2P 1KU3A 2HXIA 2IEKA 3ECHA 2JK3A 2WA0A 4G7HF 3VYRB 1IF1A 3CCMI 4BH9A 4A3CJ 3FWEA 3KP4A 4AIJA 2QQ9A 3KEQA 3OS2A 3DLLF 3IWFA 1PDNC 1PYVA 3IUOA 1FMVA 3WGGA 5J8FA 3BZKA 3KCCA 3PSFA 4L9NA 2O03A 4ANJA 2UWMA 2FMYA 3RTRA 5CLSA 3MZYA 1YIJI 4ZH4F 2DA4A 2BXYA 3IRRA 4MTEA 5FJ8J 1T0FA 1W5SA 2TRTA 1E17A 2EPFA 4ITVA 5D8LB 4IHSA 3EYYA 2IXSA 3ZMDA 3IKTA 3PO3J 2VB6A 3S14J 2RAEA 4AWXB 2V1XA 3WTZA 3D5RC 3K1MA 3ZCOA 1OYWA 1ETQA 1D1AA 5IPAA 3PIOF 4HF1A 2JA6J 2ZJPF 4LK1F 3CCUI 5M5WJ 3P9CA 3SHFA 3E6CC 2PG4A 2E2HJ 1IZ1A 2WC2A 3QP5A 4WXDA 3Q0VA 3VFZA 3WE3A 1TL8A 1HKSA 1H9GA 2PN6A 3E1SA 3J7AO 4XK4A 2DFIA 2R7FA 3CUOA 2XGCA 3MEXA 3FXQA 4M3GA 3DBHB 3L7WA 1F5TA 1YW8A 2VBWA 2LMDA 3BR2A 1BM9A 1TW2A 4PJJA 1BIAA 3HXLA 4FETA 2ZO4A 3WGHA 1FTTA 3CCRI 4G94A 1K7AA 4HX8A 4IXAA 3L2WA 1G3WA 1X1BA 3BPVA 2M0MA 3H5NA 3H9QA 3O8HA 1Y0NA 3CCLI 1AU7A 2MA3A 3RDIA 3T8TA 3S1MJ 4BUPA 2DFFA 1UG0A 4ASNA 2CMPA 3QAHA 1YJNI 1XMXA 2R4GA 2UZKA 3OYHA 2O8KA 3W2VA 4M9XA 2HPIA 2CV1A 2PJPA 4GFBA 1P4AA 4QTRA 2K85A 3NEUA 3KP7A 4LFUA 2COMA 1G4DA 3HM5A 4UV8A 2XF6A 3WU2C 2H6CA 2BY3A 2H6BA 2JRTA 4C3HJ 4ZYEA 2V1UA 4E6KG 3G71I 2XAJA 4ZYHA 3FXOA 1TWHJ 4XOTA 3ABKH 4BS9A 1R1VA 5HNHA 3LNQA 3LMMA 1ERDA 2B0LA 4JK1X 2A05A 3O8GA 5DCFA 2UXXA 4A3JJ 1MD0A 3OIOA 3KIOA 2QCOA 4E7ZA 1Z67A 1O57A 5EZHA 4BJ5C 3QPHA 3DEEA 4HBLA 4X1EA 1WH5A 3F6OA 1AKHA 1X58A 1MBKA 1U8BA 2NVXJ 4HQMA 2AQEA 2XSDC 3JSPA 3ZPLA 2XPVA 1U0JA 4UVCA 4P9FA 2VBXA 1JTXA 1BR4A 2YU3A 3BG5A 4B3XA 1M1EB 2YX4A 2O8XA 5L3GA 4EATA 1TWCJ 1W0TA 3J81K 2HDDA 5JFRA 4AYBN 2L9VA 2LP0A 2XGXA 5LBQA 1NG6A 1MMSA 1X1PA 4EJVA 2WY7Q 4CDGA 4A5MA 2DDAA 2FJ1A 5FLXZ 2V9PA 3LSPA 3F21A 2ZMEB 3A01B 3OV8A 2CV2A 1FOXA 2LF7A 3D5SC 5CVVA 1IGNA 1X19A 2IGNA 3CP2A 2IBDA 4W97A 4N4NB 2F5DA 2LBFB 2PMUA 4E7KA 3F8FA 4YIFA 5HDKA 3HTUA 4A3BJ 1FX7A 1JE8A 1XC5A 1X2NA 2JJ7A 4NC7A 3IKVA 2FF4A 3SQNA 3PM1A 2N8GA 5J4VA 2Y30A 4MQ9F 3MFKA 5C4XJ 1RC9A 4IKFA 2JRMA 1SD4A 1PP8F 3C18A 1SFKA 4TV7A 4NNJA 4AVPA 2ZKZA 1U5TB 1YX3A 4GYIA 5E1ZB 1R36A 5HS7A 3JAMK 1OR7C 4HLXA 2E1MC 5FD5A 4RGUA 2HI3A 2QQ8A 2HYGD 3T8RA 4A3KJ 5HLTA 1T08B 3WTTC 4ABZA 1O3TA 2NNYA 5FKOA 2ACJA 2HDCA 5J1YA 2IA0A 3IH2A 3G3ZA 4C30A 3R0AA 2YUSA 3CTAA 5LHHA 3E6DA 1Z77A 1R23A 2RNGA 2XB5A 4E7LA 3CQZJ 5GPAA 1RR8C 3BR0A 3KEOA 1B1BA 1S7OA 3K4LA 4BQOA 4RM2A 3FK7A 2NXNB 1ZK8A 3ABLH 2GLOA 1BW6A 1XSDA 3B02A 3HL2A 1UG2A 5F0CA 3SDGA 4CXFA 4B43A 3H9GA 2KDZA 3FKIJ 3MQ0A 1UHMA 4BXXJ 3BROA 1SAUA 3K0LA 3FISA 4BHPA 5IP9J 4UB8C 4B4CA 4G6DA 3ABMH 2F5FA 4D7MA 2TDXA 3D1NI 3GLLA 1JI8A 2XAQA 2F4MB 3OYGA 1XDSA 3K4MA 1FOKA 2FUG2 2VT2A 1VQOI 4G6TB 3BR6A 4I7HA 1W5CC 1U2WA 2VXDA 2DMTA 2R7TA 4LLNA 2DT6A 2HVRA 3AL0B 3HOWJ 2W1OA 3F22A 3LL7A 3ZQGA 3BR1A 5D6FA 4OMYA 1ZELA 3KLNA 4MO7A 1BR1A 1LJ9A 2IVMA 4DQ2A 3GTMJ 2K86A 3FKJA 2E34A 1NTCA 1E3OC 3RQIA 3IV5A 1D0XA 1JKOC 1EH7A 3ZMZA 1WKMA 1YRNA 4BQQA 3CMMA 1T2KA 3TQNA 2JA5J 2GWRA 3REOA 3DPLC 1S8NA 2XROA 1ZLJA 3TW7A 4P96A 1D5YA 2R7UA 4IJAA 2CSOA 3MD2A 1R49A 4GYGA 2ID3A 2J5PA 3AFHA 3GFMA 3ROUA 3N05A 3L2VA 4G9YA 4CYDA 1QBJA 3ZQHA 2ETHA 3GYHX 2LLKA 4A2UA 2DXIA 4II2A 1O3SA 1RR7A 1MMAA 2A6EF 2RDPA 4YFKF 1MBFA 3S2WA 3GZNB 3NRVA 2Y9ZA 1S29A 1JKQC 2LRDA 2GM4A 1WZ2A 3S1QJ 5ILUA 4BQNA 2XF5A 3I4PA 3HEFA 4V2FA 2KLOA 5HDNA 1K61A 2LKPA 2B9SA 1L0OC 1T33A 2XRNA 4IRGA 1UHSA 2VN2A 4PCQA 3J7ZI 4EJTA 3KZYA 4IO9F 1RUNA 4CZCA 1AA7A 1ZRFA 3FF5A 4QSHA 2X6XA 5BOXA 2MABA 3FMRA 3F0CA 3HIFA 2G7UA 3HUGA 5LGTA 1ZLKA 1SMYF 2H09A 3OYNA 1F43A 4LIVA 1EH8A 1QGPA 2IGMA 3FM3A 2QSFX 5E20A 1MDMB 3VODA 1ZG5A 5IYCJ 1VQ7I 3QU3A 4DZJA 1AKHB 5FLVA 2EFQA 1KONA 1D1BA 2OJED 3TOAA 2DODA 4LG0B 4FT8A 1D0ZA 1LFBA 3DLAA 3BY6A 1TWGJ 1J2XA 3DBRB 2PX9A 4R8HA 3AG4H 2QEXI 4L18B 3DEUA 3CUQB 4WF2A 2J5OA 3BC8A 2NNNA 5JHFA 1ON1A 4A0YA 1W0UA 3GVAA 3BTCA 1GT0C 1SFXA 4I6ZA 2EIKH 2YSRA 1MDMA 3K69A 1LQ1A 3ASNH 2B7EA 3S15J 2KZGA 2VPRA 4KITB 2MH2A 2VT3A 3ZR8X 1ETVA 2KHMA 4ZTJA 2K02A 3WGIA 2CH0A 2GA1A 2D1HA 3BWGA 4XRSA 2EB7A 1IRZA 3HSFA 1NH3A 4KIGA 4J01A 2X6YA 3MKYB 3CUQA 2VXZA 4H4KC 3GX4X 2OUMA 4EV0A 2EV5A 5JI6A 5F27A 3CF5F 1Y6IA 4EQQA 2IS4A 1OYIA 2X48A 1B9NA 5DDGA 3IRQA 1Z6TA 2UUZA 1LPQA 2XPUA 1K4TA 3BOQA 4ENMA 2VI6A 4JOMA 4CZZA 2PEXA 3GUDA 4M9ZA 1KYWA 2W85A 4HNTA 1QVUA 3I59B 3JTHA 5CQEA 5DCMA 3PNTA 2OD5A 1GV5A 2DCEA 2XUBA 2NVYJ 5FRMA 2OQRA 4KN7X 2KRHA 2ME6A 1JHFA 2KISA 2KIMA 3S3MA 5DTDA 1DGWY 1B4AA 3KYCB 5IP7J 1CGPA 2QF7A 4UB6C 5M5XJ 4QPQA 1HSJA 1PVEA 1LNWA 3S16J 4Z2YA 2RGVA 2TCTA 1B8IB 2VBYA 4XLNF 1WJEA 3GTLJ 2JSPA 2PBIA 1K4SA 2Z5UA 5CYVA 1I39A 3HOZJ 2D1VA 1WJBA 3BCBA 1XG1A 3NQOA 4Y7NJ 3S2HJ 3BTLA 5DCMB 1I3AA 2L0KA 1P7IA 1SFEA 5KVRA 4WK8F 5B1AH 3J80K 2R92J 5HNFA 3RKYA 5AIQA 4QWQA 3UNGC 3HOTA 4BXFA 4A3MJ 3EYIA 2DA1A 2PJRB 1DU0A 4HQEA 4YFXF 4UNOA 2CUZA 3I59A 3PO2J 2Y69H 2GXGA 3MZHA 1A6IA 1WCMJ 1JUPA 1H8AC 1OCCH 3DQVC 2ZJRF 1SVLA 1TQPA 2FBHA 5D5WB 1ETYA 3DF8A 4DYQA 2K4JA 4HDUA 3AG3H 1ODDA 3K2ZA 4GO1A 1GVJA 1QO0D 3IAM2 2ZCWA 4DIQA 1B72B 2L5QA 5ICEA 1U9NA 3OL4A 1OCPA 3HGYA 1MMDA 4BY7J 2YX7A 1K6OA 3CJTB 3QPLA 4YG2F 5J6XA 3WG9A 3CC2I 1SVOA 1N78A 3FBIB 2LK2A 2STTA 2XB0X 3Q0WA 5KAFC 1AHDP 1HW5A 2JPBA 3RPQA 1YW9A 1TLHB 2FRHA 3I64A 3RKXA 2RQQA 2DI3A 3ZN1A 4LGWA 1AOYA 4A69C 1RETA 1DU6A 2BW3B 1IXCA 2LNBA 2NOGA 3GTGJ 3WODF 3I53A 5ICCA 3Q9VA 1USTA 1QA6A 2QGUA 1IXSB 2WAQN 2DFEA 2DQLA 4PJ0C 3G4SI 3V4GA 1XPXA 1U78A 4EM0B 3HSEA 1CQTA 2D5VA 3V8JA 5CQGA 3WHBA 3T1BA 2WV1A 1YRNB 1K83J 4OU0A 2LY1A 4U7BA 4IPAA 3OYKA 1FYLA 1XMAA 4I99C 1LDDA 4WXHA 1SFUA 2E2IJ 1TWFJ 4BGDA 1Z9CA 3MZ8A 2P8TA 1XCVA 4MFDA 2XGDA 3F9KA 3HKZN 2OTJI 3OS0A 2GOMA 2EIMH 5LRRA 2BY1A 4IHWA 4S04A 1W5TA 2ZFWA 5J1UA 4BAYA 3W3CA 2DJNA 2XPWA 2K3PA 1KU9A 1MBEA 3SXYA 2LOOA 1FYKA 1GUUA 3Q3SA 4XRMA 2QSGX 2XHKA 2HOTA 2PI0A 1YITI 3JREA 2M3AA 2HQ5A 1YE9A 2VKVA 2XKPA 3S1RJ 2R3SA 4Q47A 4OINF 2MG4A 2V4JC 5E3MA 2YS9A 2HPMA 4B8XA 1Y1VJ 1GXQA 1BA5A 1G6NA 3EUKL 2AO9A 2JSCA 3E5QA 2V26A 3LSHA 1I3QJ 2FMLA 4WWCA 2ZXWH 3KLOA 3W6VA 4UHTA 1E0EA 3BQYA 5BPDA 2A5WA 3GFLA 3HBLA 4BU2A 3OL3A 5IT9K 3UR3C 3JW4A 4M3FA 2LTPA 1R5HA 2FNPA 4FX0A 1DP7P 4B47A 4UUVA 2M34A 1DDNA 1JKRC 3CJRB 3E5UA 1STZA 2EK5A 1E3HA 5F0HA 3DTEA 2KJCA 1YQAA 1JXSA 2KRCA 3FK6A 1EA3A 1Y56A 4FHTA 2V9KA 3VWBA 5BMZA 4L5EA 4CYCB 4DYCA 2FSWA 4XLAA 4IHYA 2QKLB 1POGA 1T39A 4DYRA 1PUFA 4LB5A 1EJ9A 2EV6A 2A07F 3U21A 2MLKA 2W84A 3K4CA 1K78A 3HRMA 4HF0A 5C3EJ 3MCZA 4IZZA 2ZJQF 2Q0OA 2V7FA 1O4XA 3RKQA 2L7KA 3LSKA 1WJFA 5ERIA 3A0HC 3GW2A 3LSIA 1MGTA 4HNVA 3ERMA 2G0EA 1U8RA 2CG4A 4CYCA 3CDLA 2W25A 3ISPA 3BJ6A 3TO7A 1BI3A 3S17J 3BP8A 4HNUA 3H9JA 3SJMA 5K7FA 3K1NA 1FIPA 2KMUA 3FX3A 2CS3A 2E7XA 5DM6F 4C2TA 3L2UA 1A31A 3E6MA 3HZJA 3RPUA 4NHJA 2FOWA 4R79A 1JUMA 2VJ4A 1IC8A 2O61A 5LLQA 3LSJA 5F64A 5A2QK 4IX7A 2R7QA 2O6GE 2DMNA 1ZRCA 2HS5A 4YEJA 2GOXB 2M7AA 2RC4A 1BR2A 2QM3A 3DEWA 3HDDA 1HQCA 1EKEA 2V9VA 4RGSA 1HC8A 2W00A 2AXLA 1CF7A 2ZB9A 2IS6A 3PQKA 2Z3YA 2DK5A 1JT6A 3HC7A 4MQVA 3PUFA 4G7OF 2GXBA 1LVKA 5D8KB 3JRGA 3ZMUA 5DUIA 3GTOJ 2VQGA 4HDVA 5E3OA 2NVTJ 1P92A 3WTXC 4XSZF 3N4MA 1V55H 3OIQA 1S6LA 1SD5A 4Y52J 3VSLA 3CJNA 1A5JA 4UXNA 1OKRA 4YIRX 2HOEA 3SFIA 1ZYRF 1YG2A 3H3VK 2LFBA 1ETOA 2I10A 3ZXSA 1V5FA 2FE3A 4KYWA 3BDDA 2RNJA 1Y39A 3I4MJ 3TW6A 4W1UA 3D0SA 5M5YJ 1JUSA 4YIIA 5LGNA 1WQ2A 2LR8A 2AHQA 2XAUA 3E7LA 4BDYA 4B1RA 1MBJA 4G8XA 3CLQA 1KQ8A 5KCMA 1UB9A 1MJAA 2W24A 4V19K 2R7OA 1VQ9I 3QPSA 2EFWA 2JA2A 2ELKA 2MLGA 3FM5A 2L02A 1XB4A 4LMYA 2R5YA 2QYOA 1HF0A 1LEAA 2FXAA 4PDKA 1LB2A 2ZMEA 2R7DA 1YJWI 4A3GJ 4N9HA 3BQZA 2L2OA 4XLCA 1FJLA 4HX7A 2GIZA 2M87A 3P9IA 4BXUA
chains in the Genus database with same CATH topology
3FZVA 3IC7A 1XGMA 1TQMA 2HQRA 1YIOA 2Z33A 3K1PA 3KP6A 3WE2A 4UVBA 2IT0A 2IP2A 1B59A 4RAZA 3QP6A 1P6RA 4IF4A 1XGSA 2L54A 5EEGA 1WSUA 3TO9A 3V7SA 4Q5SF 5IT3A 1J9IA 3T0YA 1REPC 1U5TC 2OU2A 4JQFA 3WTUC 4UVAA 2VE8A 5D4SA 1I27A 3L00A 3L09A 2ESNA 5CVUA 3R61A 4HOBA 2FQ3A 1ZARA 3ZP5A 3ZN0A 1FYMA 1P2FA 2ZNYA 1USSA 2XASA 4KMUX 5E17F 2K4BA 4LLGF 1IW7F 3ELKA 1KQ9A 3O3KA 4EJOA 3CO7C 4RB3C 3KZZA 1ZG3A 2L4AA 1FP1D 5TRDA 1UFMA 1MJ9A 2O0YA 1HKQA 2QUFA 5E18F 3GF2A 1LDJA 1Z7UA 1IN5A 5F1RA 4MEYF 4HF2A 2EJRA 3DXJF 1XSVA 4AIKA 2QZ8A 1TBXA 4MHGA 4HAMA 2GQQA 2QWWA 3ABUA 2MH9A 2P4WA 1FT9A 2IRFG 4G6QA 4I02A 1L3LA 2HFHA 1ZREA 5FFZA 4GCVA 3RKWA 3G73A 5EEHA 2XVCA 3M7GA 3GO5A 2QBYB 2V6CA 2ZNZA 2P6SA 3ML6A 3D5LA 3EQLF 1SD7A 3TDUC 1I6XA 5FO5A 1J75A 5IT9Z 4KT5C 2BEOA 4IVNA 3LA3A 3M9AA 1F4KA 4BQAA 2ZBKA 5FGMA 1FWZA 2DPUA 1FBSA 4BNCA 2EV0A 4CICA 1RUOA 2QVOA 5FLXK 1XDUA 5ICFA 1SAXA 3PFIA 2RN7A 1UHWA 3TDZC 3H92A 3ZMSA 1C0WA 4IHTA 3ABTA 1TNTA 4HYEA 5J8CA 4O5VA 1AWCA 4MTDA 2ESHA 3KE2A 1ULYA 4YFNF 4A0XA 4P9UA 3HRTA 4OIPF 1IRGA 3V7CA 2KRFA 4CHUA 2JTVA 1FC3A 2FEZA 4RS8A 1P4XA 1O7FA 3DFGA 3T5XA 1G3TA 4XSXF 1PUEE 4EGYA 1YYVA 2KKOA 4ZZLA 3HRUA 3RIRA 4Y15A 5LHGA 5HVQC 2VONA 1A04A 3L2CA 2PFBA 3ULQB 3QPTA 5ICGA 3O2PE 1I1GA 1IAWA 1QZYA 2A5YB 1YS7A 3V8LA 3FXUA 3OOPA 3FMQA 1J5YA 1OMIA 3R4KA 1GHCA 2A61A 1EV7A 1H9TA 3N97A 4M73A 3VOEA 3BZ6A 5H6RA 1R00A 1WI9A 3F3XA 3C1DA 3F6VA 1NHAA 3J80Z 3LSTA 1QPMA 3GXOA 2XAHA 3GZ6A 2HYFA 2NYXA 3FMSA 4RB1A 1FPQA 2ADUA 1EH6A 2IA2A 4I2OA 1X3UA 1QQIA 4AD9A 4MGRA 1WWXA 1XMKA 4M9SA 2HQNA 5HS8A 4M6YA 4ESBA 1CF7B 2K7LA 2FU4A 2CYYA 3PQJA 2EFPA 3F8CA 1OYYA 1R22A 2QQBA 5DV5A 1O7LA 4U88A 4N9IA 4ZZDA 2IA1A 5LRSA 5JVTA 1ZGAA 2HTSA 5L3FA 4U0WA 2HEOA 4B09A 3U1DA 2G9WA 2E1CA 2DK8A 1WRJA 4RB0A 2OZUA 3U9GA 4OIQF 1D8KA 2K27A 3O6BB 2OQGA 2DPDA 1B9MA 4LG0A 2W57A 5D5VB 2ISZA 3ZMVA 1ZG1A 2BE5F 1YS6A 3VEPA 5DUKA 4QLCU 4PZJA 3WU1B 2P5LC 1MJBA 4L9VA 3I54A 4F7ZA 4P55A 5DYMA 1D3YA 5K5OA 1DPUA 3R60A 2VODA 2PMHA 1D5VA 2OA4A 1LDKB 2IPQX 4XLPF 1JHHA 2P7VB 2O3FA 4I0BA 3LAJA 1W7PA 5JR3A 1RIOH 2M1BA 3HTSB 5ILSA 2VOOA 2RKHA 2EFNA 4K2EA 1BJAA 1BI1A 1OPCA 1Q1HA 1KU7A 2CO5A 3P7NA 2EA4A 2D45A 3FHZA 5FD6A 1K78B 4XRFA 4EM1A 4XBFA 2HKOA 2DW4A 1LVAA 5K1YA 1Y0UA 4ZYGA 3ERED 3J81Z 1T38A 3V7RA 5A2QZ 4P5OA 2GIVA 2XKOA 3RI4A 3E6BA 5CVRA 5L3DA 3LQRA 2VE9A 2M45A 1P4WA 2P5KA 3HOSA 1K79A 3H3UA 2HZTA 3F8NA 1W7PD 4KICA 4U7DA 1DPRA 4KNYA 3HRSA 3TOBA 4ON0A 4I98B 4HV5A 5E1WA 2BBYA 2A69F 2ISYA 4BHBA 2VC1A 2WWYA 5H20A 4CGZA 4BYYA 1T98A 2Q2EA 2HR3A 4DNCA 4I0AA 1ZHFA 3F8MA 1W4MA 4HA8A 3SZPA 3SFZA 2D2WA 1XN7A 2Z99A 4MEXF 2ZJ2A 1TNSA 3RYRA 3HYIA 3H3ZA 3WTVC 2A3SA 4FX4A 3E5XA 2OAZA 2Z9OA 5BPIA 3CDHA 2OBPA 1R58A 2JT1A 1I1SA 1XD7A 1HW1A 5AONA 4U0VA 3F72A 1YTYA 1GXPA 4ENNA 3I0TA 2XAFA 2XV4S 3KP2A 1XGNA 1BIBA 4IRIA 4EGZA 1IXRC 4Q48A 4EJUA 3LWFA 1J0RA 4L0YB 5F6FA 2EWNA 4A0ZA 1U3EM 4L9TA 2EA2A 2GZWA 5HOOA 3IL2A 1U5TA 3LA2A 5KK1A 3FXRA 4G7ZF 1IUYA 4M72A 4L5IA 5FFXA 4BHCA 2DT5A 4ESFA 1Z6RA 2WV0A 2BGCA 1ZN2A 3WU0A 4LJZF 1IN7A 5HLHA 3IWZA 2F5CA 4ENJA 1ZH5A 3LFKA 5E8GA 1FBQA 2M30A 5LEJA 4HLYA 2CW0F 3I5UA 1YO5C 3EUHA 1I5ZA 1HXDA 5DEQA 3BPXA 2A68F 1RNLA 2M5WA 5TJJA 1W7PB 1RI7A 2DBBA 3P9KA 2GA2A 3F8BA 1HW2A 4KFCA 4RAYA 4WX9A 5L3EA 5CVJA 3JSOA 2FNAA 4EJWA 4KN4X 2VC0A 4NQWA 3TKYA 2NRAC 1SMTA 1FSEA 2HGCA 4PGGA 4U0YA 1IRFA 2STWA 1FBUA 4WXCA 1QNTA 5JHUA 5LGUA 5AIPA 2E1NA 5D5UB 2H94A 2X0LA 3Q9SA 1QZZA 1BC7C 2HKXA 3K9TA 4HX4A 1ON2A 3KP3A 2KIUA 2BYVE 3GFJA 1IN6A 2IJLA 2VOPA 4CO8A 2CFXA 2JZYA 5BQTA 2KJBA 3DKWA 4EM2A 5CVIA 5ED4A 1G3SA 1FZPB 4MNUA 2OZ6A 4L9JA 2LF8A 3RJPA 3CO6C 3GLXA 1TTYA 1YLFA 1KQ0A 2IW5A 4HZFA 2DO7A 2E7WA 2XAGA 1PP7U 4KMFA 2PQ8A 2CWEA 2WTEA 3M8FA 4GGGA 2P6TA 2X4HA 4S05A 4M6XA 1O3QA 3RYPA 2Y0MA 3I71A 1FP2A 1H0MA 5HLIA 2BV6A 3E97A 1V3FA 4L5JA 4OIRF 1B6AA 4Y17A 2YPRA 3WTYC 1S7AA 4RGXA 1ZGJA 1F1ZA 1Z91A 2V1DA 3JTGA 3U2RA 2FBIA 2M8EA 5BS6A 1E2XA 3LA7A 4EMSA 3CLOA 4L0ZB 1KU2A 4LK0F 4KUMA 1KYZA 1G3YA 2P7CB 3DV8A 4OMZA 2QQAA 3ZMTA 2EFOA 1FY7A 2HWVA 5DD4A 3Q5FA 2HTJA 2F5EA 5E8IA 6PAXA 4A5NA 3R6SA 1BI2A 2CGPA 5H6QA 3BJAA 1BOAA 3VB2A 2Y75A 2YR2A 1F9NA 2H27A 4O3MA 3GFIA 4A6EA 2MC3A 1T6SA 3EDPA 1ONVA 1KA8A 1HKTA 1R1UA 3W6KB 2FBKA 2UXNA 2QENA 3WTSC 4RGRA 4JBAA 4OOIA 3COAC 4ESJA 1SD6A 3KP5A 2PLYA 1YW7A 3DP7A 1VTNC 4R1HA 4NB5A 4O6JA 4ETSA 2F2EA 1DUXC 1R7JA 2L01A 2LSOA 3QRFF 4H0EA 1O3RA 4WCGA 2GAUA 4HV6A 3CUQC 2VBZA 5HDGA 2CQKA 2QBYA 1ZAOA 1Z1DA 1Z05A 2DQRA 1S3JA 2L3DA 5K5QA 3M8EA 4E70A 5DD8A 2RV8A 3B73A 2DTRA 3BJOA 2Y48A 3E3VA 3MWMA 2MBFA 5K5RA 4ZYDA 2DU9A 1HBXG 1R5GA 3ECOA 1BI0A 3DPTA 3LAPA 4M74A 3IHUA 1XSXA 5LEKA 5E1XA 2RQPA 4LLLA 2A6HF 3M1EA 3C3WA 3TO6A 1YFHA 1XGOA 3KETA 2DLLA 5FB2A 5HLGA 4KIFA 1KGSA 3GEZA 2C6YA 1J7KA 1FNNA 4LD5A 5LHIA 3JAMZ 1J59A 2P5VA 1MZBA 4N0BA 1BBYA 4KDPA 2DAOA 2KIFA 1D8JA 2FA5A 3R0JA 4KA4A 1FSHA 4ENKA 4RB2C 3HHHA 4IRHA 1BC8C 1IN8A 1UCRA 2ZXJA 4HW0A 5L3BA 1IN4A 2RVCA 3KFWX 3F23A 4GXOA 1MKMA 2XIGA 3SZTA 2ELHA 3LQQA 4I09A 1JGSA 1TQIA 3ZQ7A 2L4MA 2AS5F 1LEBA 4I01A 3GZ5A 2Q8KA 1U6GA 3WTWC 3V8KA 1V4RA 4PGHA 5HS9A 3QU6A 5L3CA 3GWZA 3HSRA 5D6EA 4LB6B 4A6DA 2V79A 1R1TA 4D0PA 4UV9A 4KIBA 3EETA 3MAJA 1HSTA 2LDUA 3W6JB 4Q4ZF 3QOPA 4AIHA 1BN5A 2MD5A 1XCBA 3I58A 5D4RA 4EVIA 5ILVA 1ZRDA 1FLIA 4A12A 3L9FA 1TW3A 2G7HA 2QLZA 4OIOF 3TGNA 5D5XB 4M71A 3HHGA 2FOKA 1OR7A 4Y13A 3AAFA 2NAZA 1RZ4A 3C7JA 2NS0A 5CJ9A 2JPCA 1KU3A 3ECHA 4G7HF 1IF1A 4BH9A 3FWEA 3KP4A 4AIJA 2QQ9A 3KEQA 3IWFA 1PDNC 3WGGA 5J8FA 3KCCA 4L9NA 2O03A 2UWMA 2FMYA 3RTRA 5CLSA 3MZYA 4ZH4F 3IRRA 4MTEA 1T0FA 1W5SA 1E17A 5D8LB 4IHSA 3EYYA 3ZMDA 3IKTA 4AWXB 2V1XA 3WTZA 4HF1A 3K1MA 1OYWA 4LK1F 3P9CA 3SHFA 3E6CC 2PG4A 1IZ1A 2WC2A 3QP5A 4WXDA 3VFZA 3WE3A 1HKSA 1H9GA 2PN6A 3J7AO 2DFIA 2R7FA 3CUOA 3MEXA 3FXQA 3L7WA 1F5TA 1YW8A 2VBWA 1BM9A 1TW2A 3WGHA 1BIAA 2ZO4A 4G94A 1K7AA 4HX8A 4IXAA 1G3WA 3BPVA 2MA3A 3RDIA 3T8TA 4ASNA 3QAHA 2UZKA 4M9XA 2PJPA 1P4AA 3NEUA 3KP7A 4LFUA 2COMA 1G4DA 4UV8A 2H6CA 2H6BA 2JRTA 4ZYEA 2V1UA 2XAJA 4ZYHA 1R1VA 2B0LA 4JK1X 5DCFA 2UXXA 1MD0A 1O57A 3QPHA 4HBLA 3F6OA 4HQMA 3JSPA 3ZPLA 4UVCA 4P9FA 2VBXA 2YU3A 2YX4A 2O8XA 5L3GA 3J81K 5JFRA 2XGXA 5LBQA 4EJVA 4CDGA 4A5MA 5FLXZ 3F21A 2ZMEB 3OV8A 2LF7A 5CVVA 2F5DA 2PMUA 3F8FA 4YIFA 5HDKA 3HTUA 1FX7A 1JE8A 3IKVA 2FF4A 3SQNA 4MQ9F 3MFKA 1SD4A 1PP8F 3C18A 4TV7A 4AVPA 2ZKZA 5HS7A 1U5TB 4GYIA 5E1ZB 1R36A 3JAMK 4HLXA 5FD5A 4RGUA 2HYGD 3T8RA 3WTTC 1O3TA 2NNYA 2ACJA 2HDCA 2IA0A 3G3ZA 3R0AA 3CTAA 5LHHA 3E6DA 1R23A 3KEOA 1B1BA 1S7OA 1XSDA 3B02A 4CXFA 3MQ0A 1UHMA 3BROA 3K0LA 4BHPA 4G6DA 2F5FA 2TDXA 2XAQA 1XDSA 1FOKA 2VT2A 4I7HA 1U2WA 4LLNA 3F22A 5D6FA 4OMYA 3KLNA 2IVMA 1LJ9A 4DQ2A 2K86A 1EH7A 3ZMZA 1WKMA 1T2KA 3TQNA 2GWRA 3REOA 3DPLC 1S8NA 2XROA 1ZLJA 4P96A 4IJAA 2CSOA 4GYGA 2J5PA 3GFMA 3ROUA 4G9YA 4CYDA 1QBJA 2ETHA 3GYHX 4A2UA 1O3SA 2RDPA 2A6EF 4YFKF 3S2WA 3NRVA 1S29A 5ILUA 3I4PA 5HDNA 2LKPA 1L0OC 2XRNA 4PCQA 4IRGA 2VN2A 4EJTA 3KZYA 1RUNA 1ZRFA 3FF5A 5BOXA 3FMRA 3HIFA 3HUGA 2G7UA 5LGTA 1ZLKA 2H09A 1SMYF 1EH8A 1QGPA 3FM3A 5E20A 1MDMB 3VODA 1ZG5A 3QU3A 2EFQA 3TOAA 4LG0B 4FT8A 3BY6A 1J2XA 4L18B 4R8HA 3DEUA 3CUQB 4WF2A 2J5OA 2NNNA 1ON1A 4A0YA 3GVAA 1SFXA 1MDMA 2YSRA 3K69A 1LQ1A 2MH2A 2VT3A 2K02A 3WGIA 2GA1A 2D1HA 3BWGA 2EB7A 3HSFA 4KIGA 3CUQA 2VXZA 3GX4X 4EV0A 2EV5A 5JI6A 4EQQA 1OYIA 1B9NA 5DDGA 3IRQA 1Z6TA 3BOQA 4ENMA 4CZZA 2PEXA 3GUDA 4M9ZA 1KYWA 2W85A 3I59B 3JTHA 5DCMA 2OD5A 2XUBA 2OQRA 4KN7X 1JHFA 2KIMA 1B4AA 1CGPA 1HSJA 1LNWA 4Z2YA 2RGVA 2VBYA 4XLNF 2PBIA 2Z5UA 5CYVA 2D1VA 3NQOA 5DCMB 5KVRA 1SFEA 4WK8F 3J80K 3RKYA 5AIQA 4QWQA 3HOTA 3EYIA 4HQEA 4YFXF 4UNOA 3I59A 2GXGA 3MZHA 3DQVC 2FBHA 1TQPA 5D5WB 3DF8A 2K4JA 4HDUA 1ODDA 3K2ZA 4GO1A 1GVJA 1QO0D 2ZCWA 5ICEA 1K6OA 2YX7A 4YG2F 5J6XA 3WG9A 2STTA 1HW5A 2JPBA 3RPQA 1YW9A 1TLHB 2FRHA 3I64A 3RKXA 2DI3A 3ZN1A 4LGWA 1AOYA 1IXCA 2LNBA 3WODF 3I53A 5ICCA 3Q9VA 1USTA 1IXSB 2DQLA 3V4GA 1U78A 4EM0B 3HSEA 3V8JA 3T1BA 4OU0A 4U7BA 4IPAA 1FYLA 1XMAA 1LDDA 4WXHA 1SFUA 1Z9CA 2P8TA 1XCVA 5LRRA 4S04A 1W5TA 2ZFWA 4BAYA 1KU9A 3SXYA 1FYKA 2XHKA 2PI0A 2XKPA 2R3SA 4Q47A 4OINF 4B8XA 1GXQA 1G6NA 2JSCA 3E5QA 2FMLA 4WWCA 3KLOA 4UHTA 5BPDA 3GFLA 5IT9K 3JW4A 4FX0A 1R5HA 2FNPA 1DP7P 4UUVA 1DDNA 3E5UA 1STZA 2EK5A 2KJCA 1YQAA 1JXSA 4FHTA 5BMZA 2FSWA 1T39A 4LB5A 2EV6A 2A07F 2MLKA 2W84A 1K78A 3HRMA 4HF0A 3MCZA 2Q0OA 5ERIA 3GW2A 1MGTA 1U8RA 2CG4A 2W25A 3ISPA 3TO7A 3BJ6A 1BI3A 3BP8A 3K1NA 3FX3A 2E7XA 3E6MA 3RPUA 4NHJA 2O61A 4R79A 5LLQA 5F64A 5A2QK 2O6GE 1ZRCA 2HS5A 2RC4A 2QM3A 1HQCA 2V9VA 4RGSA 1CF7A 2AXLA 3PQKA 2Z3YA 2DK5A 4MQVA 4G7OF 2GXBA 5D8KB 3ZMUA 5DUIA 4HDVA 1P92A 3WTXC 4XSZF 3N4MA 1S6LA 1SD5A 3CJNA 4UXNA 1OKRA 2HOEA 1ZYRF 1YG2A 2FE3A 4KYWA 3BDDA 2RNJA 3D0SA 4YIIA 5LGNA 1WQ2A 4G8XA 1KQ8A 1MJAA 1UB9A 2W24A 2EFWA 2MLGA 3FM5A 2L02A 1XB4A 4LMYA 2QYOA 1LEAA 2FXAA 1LB2A 4PDKA 2ZMEA 2R7DA 4N9HA 4HX7A 2M87A 3P9IA 4BXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZV A;  3IC7 A;  1XGM A;  1TQM A;  2HQR A;  1YIO A;  2Z33 A;  3K1P A;  3KP6 A;  3WE2 A;  4UVB A;  2IT0 A;  2IP2 A;  1B59 A;  4RAZ A;  3QP6 A;  1P6R A;  4IF4 A;  1XGS A;  2L54 A;  5EEG A;  1WSU A;  3TO9 A;  3V7S A;  4Q5S F;  5IT3 A;  1J9I A;  3T0Y A;  1REP C;  1U5T C;  2OU2 A;  4JQF A;  3WTU C;  4UVA A;  2VE8 A;  5D4S A;  1I27 A;  3L00 A;  3L09 A;  2ESN A;  5CVU A;  3R61 A;  4HOB A;  2FQ3 A;  1ZAR A;  3ZP5 A;  3ZN0 A;  1FYM A;  1P2F A;  2ZNY A;  1USS A;  2XAS A;  4KMU X;  5E17 F;  2K4B A;  4LLG F;  1IW7 F;  3ELK A;  1KQ9 A;  3O3K A;  4EJO A;  3CO7 C;  4RB3 C;  3KZZ A;  1ZG3 A;  2L4A A;  1FP1 D;  5TRD A;  1UFM A;  1MJ9 A;  2O0Y A;  1HKQ A;  2QUF A;  5E18 F;  3GF2 A;  1LDJ A;  1Z7U A;  1IN5 A;  5F1R A;  4MEY F;  4HF2 A;  2EJR A;  3DXJ F;  1XSV A;  4AIK A;  2QZ8 A;  1TBX A;  4MHG A;  4HAM A;  2GQQ A;  2QWW A;  3ABU A;  2MH9 A;  2P4W A;  1FT9 A;  2IRF G;  4G6Q A;  4I02 A;  1L3L A;  2HFH A;  1ZRE A;  5FFZ A;  4GCV A;  3RKW A;  3G73 A;  5EEH A;  2XVC A;  3M7G A;  3GO5 A;  2QBY B;  2V6C A;  2ZNZ A;  2P6S A;  3ML6 A;  3D5L A;  3EQL F;  1SD7 A;  3TDU C;  1I6X A;  5FO5 A;  1J75 A;  5IT9 Z;  4KT5 C;  2BEO A;  4IVN A;  3LA3 A;  3M9A A;  1F4K A;  4BQA A;  2ZBK A;  5FGM A;  1FWZ A;  2DPU A;  1FBS A;  4BNC A;  2EV0 A;  4CIC A;  1RUO A;  2QVO A;  5FLX K;  1XDU A;  5ICF A;  1SAX A;  3PFI A;  2RN7 A;  1UHW A;  3TDZ C;  3H92 A;  3ZMS A;  1C0W A;  4IHT A;  3ABT A;  1TNT A;  4HYE A;  5J8C A;  4O5V A;  1AWC A;  4MTD A;  2ESH A;  3KE2 A;  1ULY A;  4YFN F;  4A0X A;  4P9U A;  3HRT A;  4OIP F;  1IRG A;  3V7C A;  2KRF A;  4CHU A;  2JTV A;  1FC3 A;  2FEZ A;  4RS8 A;  1P4X A;  1O7F A;  3DFG A;  3T5X A;  1G3T A;  4XSX F;  1PUE E;  4EGY A;  1YYV A;  2KKO A;  4ZZL A;  3HRU A;  3RIR A;  4Y15 A;  5LHG A;  5HVQ C;  2VON A;  1A04 A;  3L2C A;  2PFB A;  3ULQ B;  3QPT A;  5ICG A;  3O2P E;  1I1G A;  1IAW A;  1QZY A;  2A5Y B;  1YS7 A;  3V8L A;  3FXU A;  3OOP A;  3FMQ A;  1J5Y A;  1OMI A;  3R4K A;  1GHC A;  2A61 A;  1EV7 A;  1H9T A;  3N97 A;  4M73 A;  3VOE A;  3BZ6 A;  5H6R A;  1R00 A;  1WI9 A;  3F3X A;  3C1D A;  3F6V A;  1NHA A;  3J80 Z;  3LST A;  1QPM A;  3GXO A;  2XAH A;  3GZ6 A;  2HYF A;  2NYX A;  3FMS A;  4RB1 A;  1FPQ A;  2ADU A;  1EH6 A;  2IA2 A;  4I2O A;  1X3U A;  1QQI A;  4AD9 A;  4MGR A;  1WWX A;  1XMK A;  4M9S A;  2HQN A;  5HS8 A;  4M6Y A;  4ESB A;  1CF7 B;  2K7L A;  2FU4 A;  2CYY A;  3PQJ A;  2EFP A;  3F8C A;  1OYY A;  1R22 A;  2QQB A;  5DV5 A;  1O7L A;  4U88 A;  4N9I A;  4ZZD A;  2IA1 A;  5LRS A;  5JVT A;  1ZGA A;  2HTS A;  5L3F A;  4U0W A;  2HEO A;  4B09 A;  3U1D A;  2G9W A;  2E1C A;  2DK8 A;  1WRJ A;  4RB0 A;  2OZU A;  3U9G A;  4OIQ F;  1D8K A;  2K27 A;  3O6B B;  2OQG A;  2DPD A;  1B9M A;  4LG0 A;  2W57 A;  5D5V B;  2ISZ A;  3ZMV A;  1ZG1 A;  2BE5 F;  1YS6 A;  3VEP A;  5DUK A;  4QLC U;  4PZJ A;  3WU1 B;  2P5L C;  1MJB A;  4L9V A;  3I54 A;  4F7Z A;  4P55 A;  5DYM A;  1D3Y A;  5K5O A;  1DPU A;  3R60 A;  2VOD A;  2PMH A;  1D5V A;  2OA4 A;  1LDK B;  2IPQ X;  4XLP F;  1JHH A;  2P7V B;  2O3F A;  4I0B A;  3LAJ A;  1W7P A;  5JR3 A;  1RIO H;  2M1B A;  3HTS B;  5ILS A;  2VOO A;  2RKH A;  2EFN A;  4K2E A;  1BJA A;  1BI1 A;  1OPC A;  1Q1H A;  1KU7 A;  2CO5 A;  3P7N A;  2EA4 A;  2D45 A;  3FHZ A;  5FD6 A;  1K78 B;  4XRF A;  4EM1 A;  4XBF A;  2HKO A;  2DW4 A;  1LVA A;  5K1Y A;  1Y0U A;  4ZYG A;  3ERE D;  3J81 Z;  1T38 A;  3V7R A;  5A2Q Z;  4P5O A;  2GIV A;  2XKO A;  3RI4 A;  3E6B A;  5CVR A;  5L3D A;  3LQR A;  2VE9 A;  2M45 A;  1P4W A;  2P5K A;  3HOS A;  1K79 A;  3H3U A;  2HZT A;  3F8N A;  1W7P D;  4KIC A;  4U7D A;  1DPR A;  4KNY A;  3HRS A;  3TOB A;  4ON0 A;  4I98 B;  4HV5 A;  5E1W A;  2BBY A;  2A69 F;  2ISY A;  4BHB A;  2VC1 A;  2WWY A;  5H20 A;  4CGZ A;  4BYY A;  1T98 A;  2Q2E A;  2HR3 A;  4DNC A;  4I0A A;  1ZHF A;  3F8M A;  1W4M A;  4HA8 A;  3SZP A;  3SFZ A;  2D2W A;  1XN7 A;  2Z99 A;  4MEX F;  2ZJ2 A;  1TNS A;  3RYR A;  3HYI A;  3H3Z A;  3WTV C;  2A3S A;  4FX4 A;  3E5X A;  2OAZ A;  2Z9O A;  5BPI A;  3CDH A;  2OBP A;  1R58 A;  2JT1 A;  1I1S A;  1XD7 A;  1HW1 A;  5AON A;  4U0V A;  3F72 A;  1YTY A;  1GXP A;  4ENN A;  3I0T A;  2XAF A;  2XV4 S;  3KP2 A;  1XGN A;  1BIB A;  4IRI A;  4EGZ A;  1IXR C;  4Q48 A;  4EJU A;  3LWF A;  1J0R A;  4L0Y B;  5F6F A;  2EWN A;  4A0Z A;  1U3E M;  4L9T A;  2EA2 A;  2GZW A;  5HOO A;  3IL2 A;  1U5T A;  3LA2 A;  5KK1 A;  3FXR A;  4G7Z F;  1IUY A;  4M72 A;  4L5I A;  5FFX A;  4BHC A;  2DT5 A;  4ESF A;  1Z6R A;  2WV0 A;  2BGC A;  1ZN2 A;  3WU0 A;  4LJZ F;  1IN7 A;  5HLH A;  3IWZ A;  2F5C A;  4ENJ A;  1ZH5 A;  3LFK A;  5E8G A;  1FBQ A;  2M30 A;  5LEJ A;  4HLY A;  2CW0 F;  3I5U A;  1YO5 C;  3EUH A;  1I5Z A;  1HXD A;  5DEQ A;  3BPX A;  2A68 F;  1RNL A;  2M5W A;  5TJJ A;  1W7P B;  1RI7 A;  2DBB A;  3P9K A;  2GA2 A;  3F8B A;  1HW2 A;  4KFC A;  4RAY A;  4WX9 A;  5L3E A;  5CVJ A;  3JSO A;  2FNA A;  4EJW A;  4KN4 X;  2VC0 A;  4NQW A;  3TKY A;  2NRA C;  1SMT A;  1FSE A;  2HGC A;  4PGG A;  4U0Y A;  1IRF A;  2STW A;  1FBU A;  4WXC A;  1QNT A;  5JHU A;  5LGU A;  5AIP A;  2E1N A;  5D5U B;  2H94 A;  2X0L A;  3Q9S A;  1QZZ A;  1BC7 C;  2HKX A;  3K9T A;  4HX4 A;  1ON2 A;  3KP3 A;  2KIU A;  2BYV E;  3GFJ A;  1IN6 A;  2IJL A;  2VOP A;  4CO8 A;  2CFX A;  2JZY A;  5BQT A;  2KJB A;  3DKW A;  4EM2 A;  5CVI A;  5ED4 A;  1G3S A;  1FZP B;  4MNU A;  2OZ6 A;  4L9J A;  2LF8 A;  3RJP A;  3CO6 C;  3GLX A;  1TTY A;  1YLF A;  1KQ0 A;  2IW5 A;  4HZF A;  2DO7 A;  2E7W A;  2XAG A;  1PP7 U;  4KMF A;  2PQ8 A;  2CWE A;  2WTE A;  3M8F A;  4GGG A;  2P6T A;  2X4H A;  4S05 A;  4M6X A;  1O3Q A;  3RYP A;  2Y0M A;  3I71 A;  1FP2 A;  1H0M A;  5HLI A;  2BV6 A;  3E97 A;  1V3F A;  4L5J A;  4OIR F;  1B6A A;  4Y17 A;  2YPR A;  3WTY C;  1S7A A;  4RGX A;  1ZGJ A;  1F1Z A;  1Z91 A;  2V1D A;  3JTG A;  3U2R A;  2FBI A;  2M8E A;  5BS6 A;  1E2X A;  3LA7 A;  4EMS A;  3CLO A;  4L0Z B;  1KU2 A;  4LK0 F;  4KUM A;  1KYZ A;  1G3Y A;  2P7C B;  3DV8 A;  4OMZ A;  2QQA A;  3ZMT A;  2EFO A;  1FY7 A;  2HWV A;  5DD4 A;  3Q5F A;  2HTJ A;  2F5E A;  5E8I A;  6PAX A;  4A5N A;  3R6S A;  1BI2 A;  2CGP A;  5H6Q A;  3BJA A;  1BOA A;  3VB2 A;  2Y75 A;  2YR2 A;  1F9N A;  2H27 A;  4O3M A;  3GFI A;  4A6E A;  2MC3 A;  1T6S A;  3EDP A;  1ONV A;  1KA8 A;  1HKT A;  1R1U A;  3W6K B;  2FBK A;  2UXN A;  2QEN A;  3WTS C;  4RGR A;  4JBA A;  4OOI A;  3COA C;  4ESJ A;  1SD6 A;  3KP5 A;  2PLY A;  1YW7 A;  3DP7 A;  1VTN C;  4R1H A;  4NB5 A;  4O6J A;  4ETS A;  2F2E A;  1DUX C;  1R7J A;  2L01 A;  2LSO A;  3QRF F;  4H0E A;  1O3R A;  4WCG A;  2GAU A;  4HV6 A;  3CUQ C;  2VBZ A;  5HDG A;  2CQK A;  2QBY A;  1ZAO A;  1Z1D A;  1Z05 A;  2DQR A;  1S3J A;  2L3D A;  5K5Q A;  3M8E A;  4E70 A;  5DD8 A;  2RV8 A;  3B73 A;  2DTR A;  3BJO A;  2Y48 A;  3E3V A;  3MWM A;  2MBF A;  5K5R A;  4ZYD A;  2DU9 A;  1HBX G;  1R5G A;  3ECO A;  1BI0 A;  3DPT A;  3LAP A;  4M74 A;  3IHU A;  1XSX A;  5LEK A;  5E1X A;  2RQP A;  4LLL A;  2A6H F;  3M1E A;  3C3W A;  3TO6 A;  1YFH A;  1XGO A;  3KET A;  2DLL A;  5FB2 A;  5HLG A;  4KIF A;  1KGS A;  3GEZ A;  2C6Y A;  1J7K A;  1FNN A;  4LD5 A;  5LHI A;  3JAM Z;  1J59 A;  2P5V A;  1MZB A;  4N0B A;  1BBY A;  4KDP A;  2DAO A;  2KIF A;  1D8J A;  2FA5 A;  3R0J A;  4KA4 A;  1FSH A;  4ENK A;  4RB2 C;  3HHH A;  4IRH A;  1BC8 C;  1IN8 A;  1UCR A;  2ZXJ A;  4HW0 A;  5L3B A;  1IN4 A;  2RVC A;  3KFW X;  3F23 A;  4GXO A;  1MKM A;  2XIG A;  3SZT A;  2ELH A;  3LQQ A;  4I09 A;  1JGS A;  1TQI A;  3ZQ7 A;  2L4M A;  2AS5 F;  1LEB A;  4I01 A;  3GZ5 A;  2Q8K A;  1U6G A;  3WTW C;  3V8K A;  1V4R A;  4PGH A;  5HS9 A;  3QU6 A;  5L3C A;  3GWZ A;  3HSR A;  5D6E A;  4LB6 B;  4A6D A;  2V79 A;  1R1T A;  4D0P A;  4UV9 A;  4KIB A;  3EET A;  3MAJ A;  1HST A;  2LDU A;  3W6J B;  4Q4Z F;  3QOP A;  4AIH A;  1BN5 A;  2MD5 A;  1XCB A;  3I58 A;  5D4R A;  4EVI A;  5ILV A;  1ZRD A;  1FLI A;  4A12 A;  3L9F A;  1TW3 A;  2G7H A;  2QLZ A;  4OIO F;  3TGN A;  5D5X B;  4M71 A;  3HHG A;  2FOK A;  1OR7 A;  4Y13 A;  3AAF A;  2NAZ A;  1RZ4 A;  3C7J A;  2NS0 A;  5CJ9 A;  2JPC A;  1KU3 A;  3ECH A;  4G7H F;  1IF1 A;  4BH9 A;  3FWE A;  3KP4 A;  4AIJ A;  2QQ9 A;  3KEQ A;  3IWF A;  1PDN C;  3WGG A;  5J8F A;  3KCC A;  4L9N A;  2O03 A;  2UWM A;  2FMY A;  3RTR A;  5CLS A;  3MZY A;  4ZH4 F;  3IRR A;  4MTE A;  1T0F A;  1W5S A;  1E17 A;  5D8L B;  4IHS A;  3EYY A;  3ZMD A;  3IKT A;  4AWX B;  2V1X A;  3WTZ A;  4HF1 A;  3K1M A;  1OYW A;  4LK1 F;  3P9C A;  3SHF A;  3E6C C;  2PG4 A;  1IZ1 A;  2WC2 A;  3QP5 A;  4WXD A;  3VFZ A;  3WE3 A;  1HKS A;  1H9G A;  2PN6 A;  3J7A O;  2DFI A;  2R7F A;  3CUO A;  3MEX A;  3FXQ A;  3L7W A;  1F5T A;  1YW8 A;  2VBW A;  1BM9 A;  1TW2 A;  3WGH A;  1BIA A;  2ZO4 A;  4G94 A;  1K7A A;  4HX8 A;  4IXA A;  1G3W A;  3BPV A;  2MA3 A;  3RDI A;  3T8T A;  4ASN A;  3QAH A;  2UZK A;  4M9X A;  2PJP A;  1P4A A;  3NEU A;  3KP7 A;  4LFU A;  2COM A;  1G4D A;  4UV8 A;  2H6C A;  2H6B A;  2JRT A;  4ZYE A;  2V1U A;  2XAJ A;  4ZYH A;  1R1V A;  2B0L A;  4JK1 X;  5DCF A;  2UXX A;  1MD0 A;  1O57 A;  3QPH A;  4HBL A;  3F6O A;  4HQM A;  3JSP A;  3ZPL A;  4UVC A;  4P9F A;  2VBX A;  2YU3 A;  2YX4 A;  2O8X A;  5L3G A;  3J81 K;  5JFR A;  2XGX A;  5LBQ A;  4EJV A;  4CDG A;  4A5M A;  5FLX Z;  3F21 A;  2ZME B;  3OV8 A;  2LF7 A;  5CVV A;  2F5D A;  2PMU A;  3F8F A;  4YIF A;  5HDK A;  3HTU A;  1FX7 A;  1JE8 A;  3IKV A;  2FF4 A;  3SQN A;  4MQ9 F;  3MFK A;  1SD4 A;  1PP8 F;  3C18 A;  4TV7 A;  4AVP A;  2ZKZ A;  5HS7 A;  1U5T B;  4GYI A;  5E1Z B;  1R36 A;  3JAM K;  4HLX A;  5FD5 A;  4RGU A;  2HYG D;  3T8R A;  3WTT C;  1O3T A;  2NNY A;  2ACJ A;  2HDC A;  2IA0 A;  3G3Z A;  3R0A A;  3CTA A;  5LHH A;  3E6D A;  1R23 A;  3KEO A;  1B1B A;  1S7O A;  1XSD A;  3B02 A;  4CXF A;  3MQ0 A;  1UHM A;  3BRO A;  3K0L A;  4BHP A;  4G6D A;  2F5F A;  2TDX A;  2XAQ A;  1XDS A;  1FOK A;  2VT2 A;  4I7H A;  1U2W A;  4LLN A;  3F22 A;  5D6F A;  4OMY A;  3KLN A;  2IVM A;  1LJ9 A;  4DQ2 A;  2K86 A;  1EH7 A;  3ZMZ A;  1WKM A;  1T2K A;  3TQN A;  2GWR A;  3REO A;  3DPL C;  1S8N A;  2XRO A;  1ZLJ A;  4P96 A;  4IJA A;  2CSO A;  4GYG A;  2J5P A;  3GFM A;  3ROU A;  4G9Y A;  4CYD A;  1QBJ A;  2ETH A;  3GYH X;  4A2U A;  1O3S A;  2RDP A;  2A6E F;  4YFK F;  3S2W A;  3NRV A;  1S29 A;  5ILU A;  3I4P A;  5HDN A;  2LKP A;  1L0O C;  2XRN A;  4PCQ A;  4IRG A;  2VN2 A;  4EJT A;  3KZY A;  1RUN A;  1ZRF A;  3FF5 A;  5BOX A;  3FMR A;  3HIF A;  3HUG A;  2G7U A;  5LGT A;  1ZLK A;  2H09 A;  1SMY F;  1EH8 A;  1QGP A;  3FM3 A;  5E20 A;  1MDM B;  3VOD A;  1ZG5 A;  3QU3 A;  2EFQ A;  3TOA A;  4LG0 B;  4FT8 A;  3BY6 A;  1J2X A;  4L18 B;  4R8H A;  3DEU A;  3CUQ B;  4WF2 A;  2J5O A;  2NNN A;  1ON1 A;  4A0Y A;  3GVA A;  1SFX A;  1MDM A;  2YSR A;  3K69 A;  1LQ1 A;  2MH2 A;  2VT3 A;  2K02 A;  3WGI A;  2GA1 A;  2D1H A;  3BWG A;  2EB7 A;  3HSF A;  4KIG A;  3CUQ A;  2VXZ A;  3GX4 X;  4EV0 A;  2EV5 A;  5JI6 A;  4EQQ A;  1OYI A;  1B9N A;  5DDG A;  3IRQ A;  1Z6T A;  3BOQ A;  4ENM A;  4CZZ A;  2PEX A;  3GUD A;  4M9Z A;  1KYW A;  2W85 A;  3I59 B;  3JTH A;  5DCM A;  2OD5 A;  2XUB A;  2OQR A;  4KN7 X;  1JHF A;  2KIM A;  1B4A A;  1CGP A;  1HSJ A;  1LNW A;  4Z2Y A;  2RGV A;  2VBY A;  4XLN F;  2PBI A;  2Z5U A;  5CYV A;  2D1V A;  3NQO A;  5DCM B;  5KVR A;  1SFE A;  4WK8 F;  3J80 K;  3RKY A;  5AIQ A;  4QWQ A;  3HOT A;  3EYI A;  4HQE A;  4YFX F;  4UNO A;  3I59 A;  2GXG A;  3MZH A;  3DQV C;  2FBH A;  1TQP A;  5D5W B;  3DF8 A;  2K4J A;  4HDU A;  1ODD A;  3K2Z A;  4GO1 A;  1GVJ A;  1QO0 D;  2ZCW A;  5ICE A;  1K6O A;  2YX7 A;  4YG2 F;  5J6X A;  3WG9 A;  2STT A;  1HW5 A;  2JPB A;  3RPQ A;  1YW9 A;  1TLH B;  2FRH A;  3I64 A;  3RKX A;  2DI3 A;  3ZN1 A;  4LGW A;  1AOY A;  1IXC A;  2LNB A;  3WOD F;  3I53 A;  5ICC A;  3Q9V A;  1UST A;  1IXS B;  2DQL A;  3V4G A;  1U78 A;  4EM0 B;  3HSE A;  3V8J A;  3T1B A;  4OU0 A;  4U7B A;  4IPA A;  1FYL A;  1XMA A;  1LDD A;  4WXH A;  1SFU A;  1Z9C A;  2P8T A;  1XCV A;  5LRR A;  4S04 A;  1W5T A;  2ZFW A;  4BAY A;  1KU9 A;  3SXY A;  1FYK A;  2XHK A;  2PI0 A;  2XKP A;  2R3S A;  4Q47 A;  4OIN F;  4B8X A;  1GXQ A;  1G6N A;  2JSC A;  3E5Q A;  2FML A;  4WWC A;  3KLO A;  4UHT A;  5BPD A;  3GFL A;  5IT9 K;  3JW4 A;  4FX0 A;  1R5H A;  2FNP A;  1DP7 P;  4UUV A;  1DDN A;  3E5U A;  1STZ A;  2EK5 A;  2KJC A;  1YQA A;  1JXS A;  4FHT A;  5BMZ A;  2FSW A;  1T39 A;  4LB5 A;  2EV6 A;  2A07 F;  2MLK A;  2W84 A;  1K78 A;  3HRM A;  4HF0 A;  3MCZ A;  2Q0O A;  5ERI A;  3GW2 A;  1MGT A;  1U8R A;  2CG4 A;  2W25 A;  3ISP A;  3TO7 A;  3BJ6 A;  1BI3 A;  3BP8 A;  3K1N A;  3FX3 A;  2E7X A;  3E6M A;  3RPU A;  4NHJ A;  2O61 A;  4R79 A;  5LLQ A;  5F64 A;  5A2Q K;  2O6G E;  1ZRC A;  2HS5 A;  2RC4 A;  2QM3 A;  1HQC A;  2V9V A;  4RGS A;  1CF7 A;  2AXL A;  3PQK A;  2Z3Y A;  2DK5 A;  4MQV A;  4G7O F;  2GXB A;  5D8K B;  3ZMU A;  5DUI A;  4HDV A;  1P92 A;  3WTX C;  4XSZ F;  3N4M A;  1S6L A;  1SD5 A;  3CJN A;  4UXN A;  1OKR A;  2HOE A;  1ZYR F;  1YG2 A;  2FE3 A;  4KYW A;  3BDD A;  2RNJ A;  3D0S A;  4YII A;  5LGN A;  1WQ2 A;  4G8X A;  1KQ8 A;  1MJA A;  1UB9 A;  2W24 A;  2EFW A;  2MLG A;  3FM5 A;  2L02 A;  1XB4 A;  4LMY A;  2QYO A;  1LEA A;  2FXA A;  1LB2 A;  4PDK A;  2ZME A;  2R7D A;  4N9H A;  4HX7 A;  2M87 A;  3P9I A;  4BXU A; 
#chains in the Genus database with same CATH topology
 3FZV A;  2DYS H;  1MND A;  3G1M A;  3A01 A;  3M4O J;  4JX5 A;  4F91 B;  2ZME C;  3IC7 A;  1XGM A;  1WI3 A;  2L7Z A;  1TQM A;  2HQR A;  1I6H J;  2F4O B;  1YIO A;  1QU3 A;  2Z33 A;  3K1P A;  3KP6 A;  3WE2 A;  4E7S A;  3S1N J;  1J09 A;  4UVB A;  2IT0 A;  3DU6 A;  4IOC F;  2IP2 A;  4XKV A;  1B59 A;  3CC4 I;  4RAZ A;  3QP6 A;  1Y8Q B;  1P6R A;  2XSJ C;  4IF4 A;  2LKX A;  2K9M A;  1XGS A;  2L54 A;  5EEG A;  1QPI A;  1WSU A;  3TO9 A;  3V7S A;  4Q5S F;  5IT3 A;  2Q1Z B;  3CD6 I;  1XS9 A;  1J9I A;  3CCE I;  3T0Y A;  1REP C;  4M3B A;  3S3N A;  2GXA A;  4C3J J;  3VSK A;  1U5T C;  2OU2 A;  4JQF A;  2XRL A;  3WTU C;  1H88 C;  4UVA A;  2VE8 A;  1IDY A;  1MMN A;  5D4S A;  1I27 A;  1MMG A;  3G1L A;  3L00 A;  3L09 A;  5CPR B;  2ESN A;  5CVU A;  3K4B A;  3R61 A;  4HOB A;  2FQ3 A;  2BVM A;  2W48 A;  1ZAR A;  3ZP5 A;  3ZN0 A;  2KP6 A;  1IJW C;  1X3W B;  4IEJ A;  1YHQ I;  1FYM A;  4NDL A;  1P2F A;  3M3Y J;  2VUM J;  2ZFU A;  2ZNY A;  5B1B H;  2JVG A;  1USS A;  2XAS A;  4KMU X;  3DTI A;  3HPH A;  4BDZ A;  5E17 F;  2K4B A;  4LLG F;  4RAG A;  4MLO A;  3LSM A;  2KFD A;  2DA6 A;  3C2H A;  3ELK A;  1IW7 F;  1KQ9 A;  1R4N B;  4RBO A;  2CRG A;  2M4G A;  3O3K A;  5FKL A;  1OJL A;  4EJO A;  2H1K A;  1T0F C;  5IOY A;  4RB3 C;  3CO7 C;  4KJZ A;  2DJI A;  4B48 A;  1VQL I;  3KZZ A;  2M2E A;  1ZG3 A;  4EEF G;  5GAH J;  2EIJ H;  4F3Q A;  2L4A A;  1FP1 D;  2VJI A;  5TRD A;  1UFM A;  1MJ9 A;  2O0Y A;  1HKQ A;  3KPH A;  2QUF A;  4GRI A;  5KAI C;  3GF2 A;  4JYK A;  1LDJ A;  5E18 F;  4P1W A;  1Z7U A;  1IN5 A;  2Y31 A;  5F1R A;  4MEY F;  4LIT A;  4PFP A;  4HF2 A;  2CQQ A;  1ETX A;  5EEA A;  2EJR A;  3BCA A;  3DXJ F;  4Z6Y A;  2F4I A;  3OY9 A;  1XSV A;  4AIK A;  2I5U A;  2QZ8 A;  3H36 A;  2CQN A;  1TBX A;  4MHG A;  4HAM A;  2GQQ A;  1X4P A;  4B3A A;  2QWW A;  3PJR A;  5EGO B;  4BE0 A;  1RKW A;  4D7N A;  3ABU A;  2E1O A;  3L2R A;  4J00 A;  2MH9 A;  2P4W A;  2LD5 A;  1FT9 A;  2IRF G;  4G6Q A;  4II3 A;  2L9N A;  2MYS A;  3JRB A;  4I02 A;  1L3L A;  2HFH A;  1ZRE A;  5FFZ A;  4XR6 A;  4GCV A;  3RKW A;  4DBR A;  3G73 A;  5B5E C;  2R0Q C;  5EEH A;  1MBH A;  2XVC A;  3M7G A;  2MGQ A;  3GO5 A;  5GAE J;  3HGG A;  2QBY B;  2OCE A;  1WPK A;  2JA8 J;  4NC6 A;  1FMW A;  2MFZ A;  2JUG A;  3FXL A;  1DQU A;  2HQA A;  2V6C A;  2ZNZ A;  2P6S A;  3ML6 A;  4M6V A;  2L9S A;  4D5F A;  3D5L A;  2KL4 A;  3EQL F;  1QRY A;  1SD7 A;  2LH9 A;  3TDU C;  4FCY A;  4NQW B;  1I6X A;  2P81 A;  5FO5 A;  4DW6 A;  1J75 A;  3DKX A;  5IT9 Z;  4KT5 C;  4IQJ A;  2BEO A;  4IVN A;  3LA3 A;  3M9A A;  2F48 A;  2E5Z A;  1A6Q A;  1MNE A;  1F4K A;  2M9H A;  4BQA A;  2ZBK A;  1OQY A;  5FGM A;  1FWZ A;  2DPU A;  1FBS A;  4BNC A;  2EV0 A;  2R7Z J;  2DA5 A;  4PJM A;  2JN6 A;  4CIC A;  4X0G A;  1RUO A;  4CCN A;  1TT5 B;  2QVO A;  5FLX K;  3MKZ A;  1XDU A;  2HDW A;  4UUS B;  4IOA F;  5ICF A;  1SAX A;  3PFI A;  2DA3 A;  2EIL H;  2RN7 A;  1UHW A;  3KYD B;  3K2A A;  3WHC A;  2R7X A;  3BG6 A;  3TDZ C;  3A4C A;  3H92 A;  3ZMS A;  1C0W A;  4IHT A;  3ABT A;  1TNT A;  4HYE A;  1VQ4 I;  5J8C A;  5FKM A;  3SZG A;  2ME0 A;  4O5V A;  3VYU B;  2DMU A;  1AWC A;  4MTD A;  3SEZ A;  2ESH A;  3CCJ I;  3KE2 A;  1ULY A;  5GPC A;  1S7E A;  3H1C A;  4YFN F;  4A0X A;  1IUF A;  1VQ6 I;  5E3L A;  4P9U A;  3HRT A;  4OIP F;  1V54 H;  5J1R A;  1IRG A;  3ZQF A;  3RPU D;  3L1P A;  3TBI A;  3V7C A;  4RMN A;  2K5C A;  2L9R A;  4IHV A;  2BZT A;  2KRF A;  3IAS 2;  4CHU A;  2JTV A;  4UUS A;  1FC3 A;  2FEZ A;  4RS8 A;  2DOA A;  1A36 A;  2V6E A;  1P4X A;  1ACI A;  1O7F A;  2AXT C;  3DFG A;  3T5X A;  3OYD A;  1G3T A;  4XSX F;  1FOY A;  3OYM A;  4NUB A;  1PUE E;  1Y1W J;  2M4K A;  3OYJ A;  3G6E I;  1YYV A;  3NWS A;  4EGY A;  4B44 A;  2OTL I;  2KKO A;  3BR3 A;  4ZZL A;  5IY5 H;  3HRU A;  3AG1 H;  4XKW A;  1D1C A;  3RIR A;  1ZGW A;  1VND A;  5K7Z A;  4Y15 A;  3OYF A;  1GDT A;  5LHG A;  3I56 I;  5GTI C;  5HVQ C;  3JRA A;  2VON A;  3ZQI A;  2X6W A;  3W2A A;  1A04 A;  2DYR H;  1BL0 A;  3L2C A;  2PFB A;  3ULQ B;  4J19 A;  3QPT A;  5ICG A;  2CQX A;  3O2P E;  4AVZ A;  2DN0 A;  1I1G A;  4C3I J;  1T8I A;  1VQN I;  1IAW A;  4PSW A;  1QZY A;  3TED A;  2A5Y B;  1YS7 A;  2W82 A;  1YI2 I;  3V8L A;  5EZG A;  3FXU A;  3G1O A;  3OOP A;  2O5R A;  3FMQ A;  1J5Y A;  1OMI A;  2K40 A;  1WJD A;  2PJR A;  2NS8 A;  2X85 A;  2E1M B;  3R4K A;  1GHC A;  2A61 A;  1EV7 A;  1H9T A;  3N97 A;  4M73 A;  3BZ6 A;  3VOE A;  4CCL A;  5H6R A;  1R00 A;  1WI9 A;  4OWR B;  3FBN B;  3F3X A;  3C1D A;  1B72 A;  2OPT A;  3F6V A;  1NHA A;  1QHG A;  4BBR J;  2M0C A;  3J80 Z;  4XIC A;  3LST A;  1IV8 A;  1QPM A;  1T95 A;  2VJJ A;  3GXO A;  2XAH A;  2HYF A;  2NYX A;  3FMS A;  4RB1 A;  3GZ6 A;  1FPQ A;  2ADU A;  1EH6 A;  2DA7 A;  2IA2 A;  2HZD A;  2HOS A;  4I2O A;  2DFH A;  3CCS I;  1X3U A;  2R5Y B;  3PFY A;  2KDO A;  1QQI A;  3RQ4 A;  4AD9 A;  4MGR A;  2ZC2 A;  5JVG F;  3QYB A;  3H0G J;  1WWX A;  1IDZ A;  1XMK A;  4M9S A;  4RLF A;  2HQN A;  1XTA A;  4OAZ A;  5HS8 A;  4M6Y A;  2X6O A;  4ESB A;  1CF7 B;  2K7L A;  2FU4 A;  2NS7 A;  2CYY A;  2OC6 A;  2FD5 A;  3PQJ A;  4ZTF A;  3QYF A;  2EZH A;  1BOB A;  2EFP A;  2ECC A;  1IRX A;  2JWT A;  2KQR A;  3F8C A;  1OYY A;  1Z3Y A;  1R22 A;  2QQB A;  5DV5 A;  3PUB A;  1O7L A;  5EJC A;  4U88 A;  1N75 A;  4N9I A;  4ZZD A;  2HU9 A;  2IA1 A;  5LRS A;  5JVT A;  2AQF A;  1ZGA A;  2HTS A;  5L3F A;  3JRC A;  1Z3X A;  3ZQL A;  4U0W A;  1VFC A;  2HEO A;  4B09 A;  3U1D A;  2G9W A;  2E1C A;  2DK8 A;  2H8W A;  1WRJ A;  4RB0 A;  2OZU A;  3U9G A;  3H5R A;  2E2J J;  4OIQ F;  5GP9 A;  2XDV A;  1D8K A;  2CUF A;  2K27 A;  3O6B B;  2DTZ A;  2OQG A;  2DPD A;  1B9M A;  3H0D A;  4LG0 A;  2W57 A;  4F93 B;  4CCO A;  5D5V B;  1UEL B;  4XQF A;  1G59 A;  5CKT A;  4IL6 C;  3MVP A;  3S3O A;  2ISZ A;  3ZMV A;  3G2B A;  1ZG1 A;  4DOZ A;  4FQG A;  1ZKG A;  2BY2 A;  2XGE A;  1G8X A;  5FKN A;  4KT6 A;  2BE5 F;  1YS6 A;  3VEP A;  5DUK A;  4QLC U;  4PZJ A;  3WU1 B;  1BJZ A;  1UMQ A;  2P5L C;  1MJB A;  3S2D J;  4F52 A;  4L9V A;  3ESW B;  1JTY A;  3I54 A;  4F7Z A;  4AUX A;  4P55 A;  5DYM A;  3CME I;  1D3Y A;  5K5O A;  1DPU A;  4PFO A;  3R60 A;  2VOD A;  2PMH A;  2QSH X;  1D5V A;  1TZL A;  2ZXH A;  4E7J A;  4HG2 A;  2OA4 A;  4CSW A;  1LDK B;  2IPQ X;  4XLP F;  1ETW A;  1JHH A;  2ZSI B;  2P7V B;  5EYR A;  2O3F A;  2ZXI A;  4I0B A;  3J7A Y;  4A93 J;  4AU7 A;  3LAJ A;  1W7P A;  5JR3 A;  1RIO H;  4ZDO A;  2M1B A;  2WB1 N;  5ILS A;  3HTS B;  4BY1 J;  3A2K A;  2VOO A;  4PJL A;  1Z7L A;  1SC7 A;  2RKH A;  4XN0 A;  3H35 A;  2EFN A;  4K2E A;  3S32 A;  2LRE A;  1BJA A;  1VQM I;  1WJC A;  1BI1 A;  3DBL B;  1OPC A;  4XKC A;  2JMW A;  1Q1H A;  1KU7 A;  2CO5 A;  3P7N A;  4ZDP A;  2EA4 A;  2D45 A;  3FHZ A;  1W1W E;  2QKM B;  5FD6 A;  1ENH A;  1K78 B;  4XRF A;  1MSE C;  4EM1 A;  2ECB A;  4XBF A;  2HKO A;  3SDB A;  1OCO H;  1R6R A;  4CCM A;  1B8I A;  2DW4 A;  1K6Y A;  1VQK I;  1LVA A;  1PUF B;  4IHX A;  3LSG A;  4LG3 A;  2K9Q A;  1ZQ3 P;  5K1Y A;  1Y0U A;  4XMY A;  3S8P A;  4ZYG A;  3V7R A;  5A2Q Z;  3J81 Z;  4P5O A;  3ERE D;  1T38 A;  3PSI A;  3V42 A;  2GIV A;  3A03 A;  1HOM A;  2XKO A;  3RI4 A;  3E6B A;  5CVR A;  5E79 C;  5L3D A;  3BG9 A;  3LQR A;  2VE9 A;  2O9L A;  1FEX A;  2M45 A;  1P4W A;  4PUS A;  2DOF A;  2P5K A;  1E3P A;  3HOS A;  1K79 A;  3H3U A;  2HZT A;  3F8N A;  2EBI A;  2ELJ A;  3K4N A;  4E4H A;  2V1N A;  1W7P D;  4KIC A;  4U7D A;  3LOC A;  2ZSH B;  4LIU A;  1DPR A;  2K3F A;  3BTI A;  4RAF A;  1H89 C;  4LOC A;  4KNY A;  2EZL A;  1TC3 C;  3HRS A;  3TOB A;  4ON0 A;  1QZE A;  4I98 B;  3TP3 A;  1WHU A;  4HV5 A;  5E1W A;  3EUA A;  3AG2 H;  2BBY A;  4UUT A;  1NK3 P;  2A69 F;  2ISY A;  4BHB A;  1VQ5 I;  2VC1 A;  1KZH A;  2WWY A;  1R4M B;  5B66 C;  5H20 A;  4CGZ A;  4BYY A;  4HRI A;  2BW3 A;  2Z16 A;  1T98 A;  2Q2E A;  1RES A;  1UJ8 A;  2HR3 A;  2E19 A;  3K70 D;  4DNC A;  4V2G A;  4I0A A;  5BNG A;  3CCY A;  1N25 A;  1ZHF A;  5EGO A;  3F8M A;  1SFO J;  1RRJ A;  1W4M A;  4HA8 A;  3SZP A;  3SFZ A;  2D2W A;  3SYT A;  3J7Y J;  3RZO J;  4QPO A;  1XN7 A;  2Z99 A;  1GVD A;  4MEX F;  2M7B A;  2ZJ2 A;  1TNS A;  3RYR A;  3HYI A;  1G2H A;  1R9T J;  3CP8 A;  3H3Z A;  3U1K A;  3WTV C;  3K4J A;  2A3S A;  4CCK A;  3JRF A;  5F1J A;  5B3S H;  4FX4 A;  2Q2E B;  3E5X A;  2LBF A;  2OAZ A;  1IO2 A;  4Y3O A;  3GBG A;  2Y0S A;  2Z9O A;  5BPI A;  2WAE A;  3CDH A;  2WB1 A;  3JCU C;  3WG7 H;  2OBP A;  5FRN A;  1R58 A;  2JT1 A;  1I1S A;  1XD7 A;  2COB A;  3UKG A;  5FRO A;  1HW1 A;  5AON A;  1OCR H;  2EZI A;  4U0V A;  3C2B A;  3RSN A;  3F72 A;  3K7A J;  3DKY A;  4CA0 A;  1YTY A;  1GXP A;  4ENN A;  3I0T A;  2XAF A;  2XV4 S;  4XL9 A;  2WAD A;  3KP2 A;  1XGN A;  1BIB A;  4IRI A;  2CJJ A;  4EGZ A;  1S72 I;  1IXR C;  4HSR A;  4Q48 A;  2KPM A;  4EJU A;  1ITY A;  2WY8 Q;  1P9Q C;  1J0R A;  3LWF A;  4XID A;  5F6F A;  3DWL E;  4L0Y B;  2EWN A;  2XF7 A;  4HST A;  4A0Z A;  1U3E M;  4QIW N;  2B63 J;  2LYC A;  3QQA A;  2EA2 A;  4L9T A;  2GZW A;  4XLE A;  4AC0 A;  5HOO A;  3IL2 A;  1U5T A;  5GAG J;  2CFO A;  3LA2 A;  5KK1 A;  1GV2 A;  1RPW A;  2CUE A;  2MC4 A;  5E3N A;  3FXR A;  1LKX A;  2JUC A;  4G7Z F;  3HB9 A;  1IUY A;  4M72 A;  5J3L A;  3OYL A;  2ID6 A;  4L5I A;  4S0H B;  2DMP A;  2P0W A;  5FFX A;  4BHC A;  1MSF C;  2DT5 A;  3K70 C;  1JGG A;  4ESF A;  1Z6R A;  2WV0 A;  2BGC A;  1ZN2 A;  3WU0 A;  1NG7 A;  2LY2 A;  4LJZ F;  3OYE A;  3RCO A;  1IN7 A;  5HLH A;  2LY9 A;  4XLH A;  3IWZ A;  1Y8R B;  2F5C A;  4ENJ A;  4FIS A;  1ZH5 A;  3LFK A;  3GTQ J;  2BVL A;  1UZC A;  3DU5 A;  5E8G A;  2CV0 A;  1FBQ A;  5EF6 A;  1HCR A;  2M30 A;  5LEJ A;  4HLY A;  3DTK A;  2CW0 F;  3JR9 A;  1IG7 A;  3I5U A;  1JT0 A;  5DM7 F;  4AM3 A;  1YO5 C;  3EUH A;  4FAS D;  1I5Z A;  1HXD A;  5DEQ A;  1SAN A;  2A68 F;  3BPX A;  2JVH A;  4BAC A;  2KT0 A;  2X9D A;  1RNL A;  2M5W A;  5TJJ A;  3ASO H;  1W7P B;  1LE8 B;  2EH3 A;  2L7M P;  1RI7 A;  1W36 D;  2DBB A;  3EUH C;  3TP0 A;  3HG9 A;  2GA2 A;  3P9K A;  3F8B A;  1HW2 A;  4A3L J;  1LFP A;  3KX2 A;  4RAY A;  4KFC A;  4WX9 A;  3K4K A;  2HNH A;  2MD0 A;  2MSY A;  1RKT A;  5L3E A;  5CVJ A;  2H8R A;  3JSO A;  4ZYA A;  2FNA A;  4EJW A;  4A3I J;  4KN4 X;  1DP3 A;  2VC0 A;  4NQW A;  2ICW G;  1OFC X;  3QYE A;  5DS9 A;  3CCV I;  2IGO A;  3TKY A;  2K9L A;  1HDP A;  2X51 A;  2HYJ A;  1TWA J;  1V5E A;  2X1D A;  2NRA C;  1DGR M;  1SMT A;  1FSE A;  1FIA A;  2HGC A;  4PGG A;  4U0Y A;  1IRF A;  1QVT A;  1FBU A;  4WXC A;  4XOP A;  1QNT A;  2STW A;  5JHU A;  5LGU A;  3LSR A;  2XC7 A;  3OYB A;  4E7H A;  5AIP A;  2E1N A;  5D5U B;  2H94 A;  2X0L A;  4AID A;  2M8G X;  3Q9S A;  5IOZ A;  4DJA A;  1QZZ A;  1BC7 C;  2HKX A;  5JLX A;  3X2Q H;  3K9T A;  4HX4 A;  1ON2 A;  3CJQ B;  2IGK A;  2LKS A;  3OYC A;  1WVR A;  1Z0X A;  3KP3 A;  2LG4 A;  2KIU A;  2BYV E;  3GFJ A;  1IN6 A;  1TT0 A;  3EPZ A;  3DCF A;  3JRH A;  2IJL A;  1MH4 A;  2YU9 J;  4FTH A;  3CMA I;  2VOP A;  4FE4 A;  2BY0 A;  3ZGK A;  4BEH B;  1JJ6 C;  4NC8 A;  3HUG B;  4XNF A;  3CZ6 A;  4CO8 A;  5LD2 C;  2CFX A;  5EG0 A;  2JZY A;  5BQT A;  2KJB A;  4YRV A;  3DKW A;  4EM2 A;  5CVI A;  2VQL A;  5ED4 A;  1SEU A;  1G3S A;  1FZP B;  2WAQ A;  3JRD A;  4MNU A;  5F0F A;  2OZ6 A;  1WGX A;  4L9J A;  2LF8 A;  3RJP A;  3CO6 C;  3GLX A;  1TTY A;  1YLF A;  3FHN A;  3CMY A;  3C2G A;  1KQ0 A;  2R7R A;  2R7S A;  2IW5 A;  4HZF A;  2DO7 A;  2E7W A;  5HOD A;  2EZK A;  3FXM A;  2XAG A;  4D5C A;  2VQC A;  1X1A A;  1PP7 U;  2R93 J;  3JRI A;  4KMF A;  2PQ8 A;  3QOD A;  1X2M A;  1X3Z B;  4BL0 B;  2CW7 A;  1BW5 A;  2CWE A;  2WTE A;  3M8F A;  4XM3 A;  4NBQ A;  2H1L A;  2E60 A;  2CU7 A;  1YX5 A;  2CUJ A;  5C44 J;  4GGG A;  2P6T A;  2X4H A;  4S05 A;  1XX5 A;  1X1D A;  4M3D A;  1W36 C;  3BG7 A;  2VPL A;  3I9V 2;  4M6X A;  2Y2Z A;  1O3Q A;  3RYP A;  1EF4 A;  1MNM C;  4BE1 A;  4XKB A;  2Y0M A;  4F55 A;  3I71 A;  4GDF A;  1FP2 A;  1H0M A;  5HLI A;  2BV6 A;  3E97 A;  2Y9Y A;  1V3F A;  4L5J A;  4OIR F;  1B6A A;  2RRE A;  5IYD J;  4Y17 A;  1LFU P;  5GTH C;  2YPR A;  2VKH A;  4ZDL A;  1VQ8 I;  2MW8 A;  4JX4 A;  3WTY C;  1S7A A;  4RGX A;  3CCQ I;  1ZGJ A;  3MN2 A;  4BKX A;  3OR1 C;  3MKW B;  1F1Z A;  4X6A J;  1Z91 A;  4CH7 A;  2V1D A;  3JTG A;  5F08 A;  4G12 A;  3U2R A;  2FBI A;  2VIX A;  2M8E A;  4PK4 A;  2DT7 B;  2KIQ A;  3HOX J;  3BG3 A;  5BS6 A;  1E2X A;  2Z1D A;  3LA7 A;  4EMS A;  3CLO A;  3KZI C;  1KU2 A;  1VF9 A;  4LK0 F;  4L0Z B;  4KUM A;  3I4N J;  1KYZ A;  3B6C A;  4F92 B;  2E35 A;  5J4Y A;  3HPG A;  1G3Y A;  4D9J A;  3DV8 A;  4OMZ A;  2EQR A;  2QQA A;  2P7C B;  3ZMT A;  3I55 I;  2EFO A;  1FY7 A;  2HWV A;  2JQ7 A;  5JLW A;  2IAI A;  4ZC3 A;  5DD4 A;  3Q5F A;  2HTJ A;  2F5E A;  5E8I A;  6PAX A;  4A5N A;  3R6S A;  5EDN A;  1BI2 A;  1FOW A;  2CGP A;  2NOJ B;  5H6Q A;  2DOE A;  5KHD A;  4A3E J;  3BJA A;  4Y33 A;  5K7H A;  1BOA A;  3VB2 A;  2Y75 A;  2X1C A;  1VI0 A;  2YR2 A;  1GLN A;  3W2W A;  4XOR A;  2PMZ N;  3NAU A;  3CF2 A;  1Z21 A;  1F9N A;  2H27 A;  4O3M A;  3ONQ A;  2BOL A;  1ETK A;  3CDI A;  3HJE A;  3GFI A;  3HOU J;  4A6E A;  3AKZ A;  3OR2 C;  1IV6 A;  2MC3 A;  1T6S A;  1S9H A;  1HDD C;  3VYT B;  3A0B C;  1TP4 A;  4JP0 A;  2VL8 A;  1WFX A;  2Y0S N;  2JA7 J;  2WBM A;  2GBY A;  3B6A A;  1LE8 A;  9ANT A;  1I50 J;  1VQP I;  3EDP A;  3FXJ A;  1ONV A;  3GTP J;  4MFE A;  1KA8 A;  5J47 A;  3OS1 A;  1HKT A;  4BE2 A;  1R1U A;  3W6K B;  4RA2 A;  3BZC A;  2FBK A;  4BBS J;  1OLT A;  2BHY A;  4YEL A;  1JJ8 C;  2UXN A;  2QEN A;  3WTS C;  4RGR A;  4JBA A;  4AYB A;  2NVU B;  2E36 A;  4CCJ A;  4OOI A;  4ZJZ A;  2DDB A;  1VZ0 A;  3COA C;  4XLF A;  1QHH D;  2E5N A;  4ESJ A;  1SD6 A;  3KP5 A;  2PLY A;  1YW7 A;  3DP7 A;  1VTN C;  4R1H A;  4NB5 A;  3PL8 A;  4O6J A;  5LFA A;  4ETS A;  3OSF A;  4FE7 A;  2F2E A;  4CUG A;  1DUX C;  1MIJ A;  1R7J A;  1HLV A;  2L01 A;  2W7N A;  4RLQ A;  2LSO A;  3QRF F;  4C2U A;  4H0E A;  5F04 A;  1O3R A;  3M07 A;  2HVQ A;  2Z2S B;  3TMO A;  4WCG A;  4HPQ A;  2HVS A;  2UV1 A;  2GAU A;  2VKD A;  3GTJ J;  4DZP A;  3PNV A;  2W4S A;  4HV6 A;  3CUQ C;  4A3F J;  2VBZ A;  5HDG A;  1N77 A;  2CQK A;  2QBY A;  1MBG A;  1ZAO A;  2EIN H;  1X1C A;  1Z1D A;  3HOV J;  3NWT A;  1Z05 A;  2DQR A;  1S3J A;  1MW7 A;  1D0Y A;  5IYB J;  2L3D A;  5K5Q A;  3M8E A;  4HEA 2;  4E70 A;  5EG0 B;  5DD8 A;  1FTZ A;  2RV8 A;  5FLM J;  2E71 A;  3H5A A;  2R5Z B;  4BEH A;  5GAD J;  3B73 A;  2DTR A;  3P5J A;  2O7O A;  3A1Y A;  1P7J A;  3BJO A;  2DA2 A;  2CQ7 A;  3LFU A;  5TIS C;  4D1Q A;  2Y48 A;  3E3V A;  3MWM A;  2MBF A;  5K5R A;  4ZYD A;  2DU9 A;  1HBX G;  1R5G A;  3ECO A;  1BI0 A;  2QA4 I;  2VJ5 A;  3HOY J;  3DPT A;  3TL4 X;  3LAP A;  4M74 A;  1U9O A;  3IHU A;  2CW8 A;  2HXO A;  3CES A;  1XSX A;  2X1E A;  1HA8 A;  4DBQ A;  1X4O A;  1R5I D;  4XN3 A;  3VDX A;  5C4J J;  4E7I A;  5LEK A;  5E1X A;  3OYI A;  2FQ4 A;  2RQP A;  4LLL A;  2R7V A;  2OF7 A;  3OMY A;  4C2M J;  2A6H F;  3PNY A;  4I76 A;  3K6G A;  3M1E A;  3C3W A;  3TO6 A;  1YFH A;  1XGO A;  3KET A;  2K9S A;  2A6T A;  2DLL A;  2LVS A;  2IS1 A;  1ZR2 A;  1APL C;  1S5L C;  5FB2 A;  5HLG A;  3OSG A;  1OCT C;  4KIF A;  3ZQQ A;  1KGS A;  3K10 A;  3GEZ A;  2C6Y A;  5H2F C;  1J7K A;  3DPU A;  1FNN A;  4LD5 A;  4PJN A;  5LHI A;  3JAM Z;  1JKP C;  5FKK A;  1J59 A;  1ORK A;  4A3D J;  2P5V A;  3CC7 I;  2IS2 A;  1MZB A;  4DGW B;  4N0B A;  1BBY A;  3ZOB A;  3IH4 A;  4KDP A;  3HKZ A;  2DAO A;  2KIF A;  4KIS A;  1UAA A;  1MH3 A;  2HOA A;  4UY8 I;  1D8J A;  2FA5 A;  3GME A;  3R0J A;  4KA4 A;  1FSH A;  3MMY B;  2BHZ A;  1T56 A;  3BTJ A;  4ENK A;  3GTK J;  3FXK A;  2L7F P;  4RB2 C;  3BLY A;  3HHH A;  1YOV B;  1YJ9 I;  3GCM A;  4IRH A;  3VYS B;  3L2Q A;  1WH7 A;  3E0J B;  1BC8 C;  2LC2 A;  1IN8 A;  1UCR A;  3BR5 A;  3ZQC A;  3SEQ A;  3A02 A;  2ZXJ A;  4HW0 A;  5L3B A;  2OV7 A;  3ZRG A;  1IN4 A;  2RVC A;  3KFW X;  2I8D A;  2VKE A;  3S93 A;  3M8J A;  5M3M J;  3F23 A;  4GXO A;  1MKM A;  2XIG A;  3VPR A;  3SZT A;  1OIS A;  2ELH A;  2DMQ A;  2FX0 A;  3FDY A;  3LQQ A;  1WJ5 A;  3IH3 A;  5J40 A;  2F5V A;  4I09 A;  1JGS A;  4N4O B;  3MKL A;  1TQI A;  2K9N A;  2PMZ A;  1R71 A;  3Q0U A;  5M3F J;  2NVQ J;  3ZQ7 A;  3OOU A;  1WJA A;  2VLA A;  2L4M A;  1SVM A;  2AS5 F;  3OYA A;  4MIM A;  4I01 A;  1LEB A;  4C9Y A;  1A35 A;  3GZ5 A;  4PSX A;  4OAY A;  2Q8K A;  1U6G A;  3WTW C;  5TGT A;  3V8K A;  1V4R A;  4PGH A;  4JX6 A;  3OWT A;  1LUJ B;  4RM3 A;  5HS9 A;  3QU6 A;  5IP6 A;  2KZV A;  5L3C A;  3QOE A;  1F36 A;  3BT9 A;  3GWZ A;  3HSR A;  5D6E A;  4LB6 B;  4M3E A;  4A6D A;  2V79 A;  1R1T A;  4D0P A;  2R7W A;  3AL0 C;  4UV9 A;  2F6C A;  4KIB A;  1OCZ H;  3EET A;  1ZR4 A;  3KEY A;  3MAJ A;  1HST A;  3QWL A;  2LDU A;  3W6J B;  2BXZ A;  4Q4Z F;  3QOP A;  1PJR A;  4AIH A;  3IP4 B;  1BN5 A;  1Q1V A;  2MD5 A;  2R5Z A;  1XCB A;  3I58 A;  5D4R A;  2WAF A;  4EVI A;  5ILV A;  1ZRD A;  1FLI A;  1ZTR A;  5KNL A;  4A12 A;  3L9F A;  1TW3 A;  2OCC H;  2G7H A;  2QLZ A;  4XRS G;  4RDU A;  4OIO F;  3OIP A;  3NAR A;  4BJT A;  3TGN A;  5D5X B;  3PIP F;  4M71 A;  3M1C A;  3HHG A;  4IQ4 A;  2FOK A;  4Y4R A;  3KYL A;  1OR7 A;  3FIW A;  4Y13 A;  3AAF A;  4BJ6 C;  2NAZ A;  1RZ4 A;  1V5G A;  3C7J A;  3RZD J;  2NS0 A;  5CJ9 A;  2JPC A;  3I3L A;  2VAS A;  4U87 A;  2VQH A;  4XON A;  1NK2 P;  1KU3 A;  2HXI A;  2IEK A;  3ECH A;  2JK3 A;  2WA0 A;  4G7H F;  3VYR B;  1IF1 A;  3CCM I;  4BH9 A;  4A3C J;  3FWE A;  3KP4 A;  4AIJ A;  2QQ9 A;  3KEQ A;  3OS2 A;  3DLL F;  3IWF A;  1PDN C;  1PYV A;  3IUO A;  1FMV A;  3WGG A;  5J8F A;  3BZK A;  3KCC A;  3PSF A;  4L9N A;  2O03 A;  4ANJ A;  2UWM A;  2FMY A;  3RTR A;  5CLS A;  3MZY A;  1YIJ I;  4ZH4 F;  2DA4 A;  2BXY A;  3IRR A;  4MTE A;  5FJ8 J;  1T0F A;  1W5S A;  2TRT A;  1E17 A;  2EPF A;  4ITV A;  5D8L B;  4IHS A;  3EYY A;  2IXS A;  3ZMD A;  3IKT A;  3PO3 J;  2VB6 A;  3S14 J;  2RAE A;  4AWX B;  2V1X A;  3WTZ A;  3D5R C;  3K1M A;  3ZCO A;  1OYW A;  1ETQ A;  1D1A A;  5IPA A;  3PIO F;  4HF1 A;  2JA6 J;  2ZJP F;  4LK1 F;  3CCU I;  5M5W J;  3P9C A;  3SHF A;  3E6C C;  2PG4 A;  2E2H J;  1IZ1 A;  2WC2 A;  3QP5 A;  4WXD A;  3Q0V A;  3VFZ A;  3WE3 A;  1TL8 A;  1HKS A;  1H9G A;  2PN6 A;  3E1S A;  3J7A O;  4XK4 A;  2DFI A;  2R7F A;  3CUO A;  2XGC A;  3MEX A;  3FXQ A;  4M3G A;  3DBH B;  3L7W A;  1F5T A;  1YW8 A;  2VBW A;  2LMD A;  3BR2 A;  1BM9 A;  1TW2 A;  4PJJ A;  1BIA A;  3HXL A;  4FET A;  2ZO4 A;  3WGH A;  1FTT A;  3CCR I;  4G94 A;  1K7A A;  4HX8 A;  4IXA A;  3L2W A;  1G3W A;  1X1B A;  3BPV A;  2M0M A;  3H5N A;  3H9Q A;  3O8H A;  1Y0N A;  3CCL I;  1AU7 A;  2MA3 A;  3RDI A;  3T8T A;  3S1M J;  4BUP A;  2DFF A;  1UG0 A;  4ASN A;  2CMP A;  3QAH A;  1YJN I;  1XMX A;  2R4G A;  2UZK A;  3OYH A;  2O8K A;  3W2V A;  4M9X A;  2HPI A;  2CV1 A;  2PJP A;  4GFB A;  1P4A A;  4QTR A;  2K85 A;  3NEU A;  3KP7 A;  4LFU A;  2COM A;  1G4D A;  3HM5 A;  4UV8 A;  2XF6 A;  3WU2 C;  2H6C A;  2BY3 A;  2H6B A;  2JRT A;  4C3H J;  4ZYE A;  2V1U A;  4E6K G;  3G71 I;  2XAJ A;  4ZYH A;  3FXO A;  1TWH J;  4XOT A;  3ABK H;  4BS9 A;  1R1V A;  5HNH A;  3LNQ A;  3LMM A;  1ERD A;  2B0L A;  4JK1 X;  2A05 A;  3O8G A;  5DCF A;  2UXX A;  4A3J J;  1MD0 A;  3OIO A;  3KIO A;  2QCO A;  4E7Z A;  1Z67 A;  1O57 A;  5EZH A;  4BJ5 C;  3QPH A;  3DEE A;  4HBL A;  4X1E A;  1WH5 A;  3F6O A;  1AKH A;  1X58 A;  1MBK A;  1U8B A;  2NVX J;  4HQM A;  2AQE A;  2XSD C;  3JSP A;  3ZPL A;  2XPV A;  1U0J A;  4UVC A;  4P9F A;  2VBX A;  1JTX A;  1BR4 A;  2YU3 A;  3BG5 A;  4B3X A;  1M1E B;  2YX4 A;  2O8X A;  5L3G A;  4EAT A;  1TWC J;  1W0T A;  3J81 K;  2HDD A;  5JFR A;  4AYB N;  2L9V A;  2LP0 A;  2XGX A;  5LBQ A;  1NG6 A;  1MMS A;  1X1P A;  4EJV A;  2WY7 Q;  4CDG A;  4A5M A;  2DDA A;  2FJ1 A;  5FLX Z;  2V9P A;  3LSP A;  3F21 A;  2ZME B;  3A01 B;  3OV8 A;  2CV2 A;  1FOX A;  2LF7 A;  3D5S C;  5CVV A;  1IGN A;  1X19 A;  2IGN A;  3CP2 A;  2IBD A;  4W97 A;  4N4N B;  2F5D A;  2LBF B;  2PMU A;  4E7K A;  3F8F A;  4YIF A;  5HDK A;  3HTU A;  4A3B J;  1FX7 A;  1JE8 A;  1XC5 A;  1X2N A;  2JJ7 A;  4NC7 A;  3IKV A;  2FF4 A;  3SQN A;  3PM1 A;  2N8G A;  5J4V A;  2Y30 A;  4MQ9 F;  3MFK A;  5C4X J;  1RC9 A;  4IKF A;  2JRM A;  1SD4 A;  1PP8 F;  3C18 A;  1SFK A;  4TV7 A;  4NNJ A;  4AVP A;  2ZKZ A;  1U5T B;  1YX3 A;  4GYI A;  5E1Z B;  1R36 A;  5HS7 A;  3JAM K;  1OR7 C;  4HLX A;  2E1M C;  5FD5 A;  4RGU A;  2HI3 A;  2QQ8 A;  2HYG D;  3T8R A;  4A3K J;  5HLT A;  1T08 B;  3WTT C;  4ABZ A;  1O3T A;  2NNY A;  5FKO A;  2ACJ A;  2HDC A;  5J1Y A;  2IA0 A;  3IH2 A;  3G3Z A;  4C30 A;  3R0A A;  2YUS A;  3CTA A;  5LHH A;  3E6D A;  1Z77 A;  1R23 A;  2RNG A;  2XB5 A;  4E7L A;  3CQZ J;  5GPA A;  1RR8 C;  3BR0 A;  3KEO A;  1B1B A;  1S7O A;  3K4L A;  4BQO A;  4RM2 A;  3FK7 A;  2NXN B;  1ZK8 A;  3ABL H;  2GLO A;  1BW6 A;  1XSD A;  3B02 A;  3HL2 A;  1UG2 A;  5F0C A;  3SDG A;  4CXF A;  4B43 A;  3H9G A;  2KDZ A;  3FKI J;  3MQ0 A;  1UHM A;  4BXX J;  3BRO A;  1SAU A;  3K0L A;  3FIS A;  4BHP A;  5IP9 J;  4UB8 C;  4B4C A;  4G6D A;  3ABM H;  2F5F A;  4D7M A;  2TDX A;  3D1N I;  3GLL A;  1JI8 A;  2XAQ A;  2F4M B;  3OYG A;  1XDS A;  3K4M A;  1FOK A;  2FUG 2;  2VT2 A;  1VQO I;  4G6T B;  3BR6 A;  4I7H A;  1W5C C;  1U2W A;  2VXD A;  2DMT A;  2R7T A;  4LLN A;  2DT6 A;  2HVR A;  3AL0 B;  3HOW J;  2W1O A;  3F22 A;  3LL7 A;  3ZQG A;  3BR1 A;  5D6F A;  4OMY A;  1ZEL A;  3KLN A;  4MO7 A;  1BR1 A;  1LJ9 A;  2IVM A;  4DQ2 A;  3GTM J;  2K86 A;  3FKJ A;  2E34 A;  1NTC A;  1E3O C;  3RQI A;  3IV5 A;  1D0X A;  1JKO C;  1EH7 A;  3ZMZ A;  1WKM A;  1YRN A;  4BQQ A;  3CMM A;  1T2K A;  3TQN A;  2JA5 J;  2GWR A;  3REO A;  3DPL C;  1S8N A;  2XRO A;  1ZLJ A;  3TW7 A;  4P96 A;  1D5Y A;  2R7U A;  4IJA A;  2CSO A;  3MD2 A;  1R49 A;  4GYG A;  2ID3 A;  2J5P A;  3AFH A;  3GFM A;  3ROU A;  3N05 A;  3L2V A;  4G9Y A;  4CYD A;  1QBJ A;  3ZQH A;  2ETH A;  3GYH X;  2LLK A;  4A2U A;  2DXI A;  4II2 A;  1O3S A;  1RR7 A;  1MMA A;  2A6E F;  2RDP A;  4YFK F;  1MBF A;  3S2W A;  3GZN B;  3NRV A;  2Y9Z A;  1S29 A;  1JKQ C;  2LRD A;  2GM4 A;  1WZ2 A;  3S1Q J;  5ILU A;  4BQN A;  2XF5 A;  3I4P A;  3HEF A;  4V2F A;  2KLO A;  5HDN A;  1K61 A;  2LKP A;  2B9S A;  1L0O C;  1T33 A;  2XRN A;  4IRG A;  1UHS A;  2VN2 A;  4PCQ A;  3J7Z I;  4EJT A;  3KZY A;  4IO9 F;  1RUN A;  4CZC A;  1AA7 A;  1ZRF A;  3FF5 A;  4QSH A;  2X6X A;  5BOX A;  2MAB A;  3FMR A;  3F0C A;  3HIF A;  2G7U A;  3HUG A;  5LGT A;  1ZLK A;  1SMY F;  2H09 A;  3OYN A;  1F43 A;  4LIV A;  1EH8 A;  1QGP A;  2IGM A;  3FM3 A;  2QSF X;  5E20 A;  1MDM B;  3VOD A;  1ZG5 A;  5IYC J;  1VQ7 I;  3QU3 A;  4DZJ A;  1AKH B;  5FLV A;  2EFQ A;  1KON A;  1D1B A;  2OJE D;  3TOA A;  2DOD A;  4LG0 B;  4FT8 A;  1D0Z A;  1LFB A;  3DLA A;  3BY6 A;  1TWG J;  1J2X A;  3DBR B;  2PX9 A;  4R8H A;  3AG4 H;  2QEX I;  4L18 B;  3DEU A;  3CUQ B;  4WF2 A;  2J5O A;  3BC8 A;  2NNN A;  5JHF A;  1ON1 A;  4A0Y A;  1W0U A;  3GVA A;  3BTC A;  1GT0 C;  1SFX A;  4I6Z A;  2EIK H;  2YSR A;  1MDM A;  3K69 A;  1LQ1 A;  3ASN H;  2B7E A;  3S15 J;  2KZG A;  2VPR A;  4KIT B;  2MH2 A;  2VT3 A;  3ZR8 X;  1ETV A;  2KHM A;  4ZTJ A;  2K02 A;  3WGI A;  2CH0 A;  2GA1 A;  2D1H A;  3BWG A;  4XRS A;  2EB7 A;  1IRZ A;  3HSF A;  1NH3 A;  4KIG A;  4J01 A;  2X6Y A;  3MKY B;  3CUQ A;  2VXZ A;  4H4K C;  3GX4 X;  2OUM A;  4EV0 A;  2EV5 A;  5JI6 A;  5F27 A;  3CF5 F;  1Y6I A;  4EQQ A;  2IS4 A;  1OYI A;  2X48 A;  1B9N A;  5DDG A;  3IRQ A;  1Z6T A;  2UUZ A;  1LPQ A;  2XPU A;  1K4T A;  3BOQ A;  4ENM A;  2VI6 A;  4JOM A;  4CZZ A;  2PEX A;  3GUD A;  4M9Z A;  1KYW A;  2W85 A;  4HNT A;  1QVU A;  3I59 B;  3JTH A;  5CQE A;  5DCM A;  3PNT A;  2OD5 A;  1GV5 A;  2DCE A;  2XUB A;  2NVY J;  5FRM A;  2OQR A;  4KN7 X;  2KRH A;  2ME6 A;  1JHF A;  2KIS A;  2KIM A;  3S3M A;  5DTD A;  1DGW Y;  1B4A A;  3KYC B;  5IP7 J;  1CGP A;  2QF7 A;  4UB6 C;  5M5X J;  4QPQ A;  1HSJ A;  1PVE A;  1LNW A;  3S16 J;  4Z2Y A;  2RGV A;  2TCT A;  1B8I B;  2VBY A;  4XLN F;  1WJE A;  3GTL J;  2JSP A;  2PBI A;  1K4S A;  2Z5U A;  5CYV A;  1I39 A;  3HOZ J;  2D1V A;  1WJB A;  3BCB A;  1XG1 A;  3NQO A;  4Y7N J;  3S2H J;  3BTL A;  5DCM B;  1I3A A;  2L0K A;  1P7I A;  1SFE A;  5KVR A;  4WK8 F;  5B1A H;  3J80 K;  2R92 J;  5HNF A;  3RKY A;  5AIQ A;  4QWQ A;  3UNG C;  3HOT A;  4BXF A;  4A3M J;  3EYI A;  2DA1 A;  2PJR B;  1DU0 A;  4HQE A;  4YFX F;  4UNO A;  2CUZ A;  3I59 A;  3PO2 J;  2Y69 H;  2GXG A;  3MZH A;  1A6I A;  1WCM J;  1JUP A;  1H8A C;  1OCC H;  3DQV C;  2ZJR F;  1SVL A;  1TQP A;  2FBH A;  5D5W B;  1ETY A;  3DF8 A;  4DYQ A;  2K4J A;  4HDU A;  3AG3 H;  1ODD A;  3K2Z A;  4GO1 A;  1GVJ A;  1QO0 D;  3IAM 2;  2ZCW A;  4DIQ A;  1B72 B;  2L5Q A;  5ICE A;  1U9N A;  3OL4 A;  1OCP A;  3HGY A;  1MMD A;  4BY7 J;  2YX7 A;  1K6O A;  3CJT B;  3QPL A;  4YG2 F;  5J6X A;  3WG9 A;  3CC2 I;  1SVO A;  1N78 A;  3FBI B;  2LK2 A;  2STT A;  2XB0 X;  3Q0W A;  5KAF C;  1AHD P;  1HW5 A;  2JPB A;  3RPQ A;  1YW9 A;  1TLH B;  2FRH A;  3I64 A;  3RKX A;  2RQQ A;  2DI3 A;  3ZN1 A;  4LGW A;  1AOY A;  4A69 C;  1RET A;  1DU6 A;  2BW3 B;  1IXC A;  2LNB A;  2NOG A;  3GTG J;  3WOD F;  3I53 A;  5ICC A;  3Q9V A;  1UST A;  1QA6 A;  2QGU A;  1IXS B;  2WAQ N;  2DFE A;  2DQL A;  4PJ0 C;  3G4S I;  3V4G A;  1XPX A;  1U78 A;  4EM0 B;  3HSE A;  1CQT A;  2D5V A;  3V8J A;  5CQG A;  3WHB A;  3T1B A;  2WV1 A;  1YRN B;  1K83 J;  4OU0 A;  2LY1 A;  4U7B A;  4IPA A;  3OYK A;  1FYL A;  1XMA A;  4I99 C;  1LDD A;  4WXH A;  1SFU A;  2E2I J;  1TWF J;  4BGD A;  1Z9C A;  3MZ8 A;  2P8T A;  1XCV A;  4MFD A;  2XGD A;  3F9K A;  3HKZ N;  2OTJ I;  3OS0 A;  2GOM A;  2EIM H;  5LRR A;  2BY1 A;  4IHW A;  4S04 A;  1W5T A;  2ZFW A;  5J1U A;  4BAY A;  3W3C A;  2DJN A;  2XPW A;  2K3P A;  1KU9 A;  1MBE A;  3SXY A;  2LOO A;  1FYK A;  1GUU A;  3Q3S A;  4XRM A;  2QSG X;  2XHK A;  2HOT A;  2PI0 A;  1YIT I;  3JRE A;  2M3A A;  2HQ5 A;  1YE9 A;  2VKV A;  2XKP A;  3S1R J;  2R3S A;  4Q47 A;  4OIN F;  2MG4 A;  2V4J C;  5E3M A;  2YS9 A;  2HPM A;  4B8X A;  1Y1V J;  1GXQ A;  1BA5 A;  1G6N A;  3EUK L;  2AO9 A;  2JSC A;  3E5Q A;  2V26 A;  3LSH A;  1I3Q J;  2FML A;  4WWC A;  2ZXW H;  3KLO A;  3W6V A;  4UHT A;  1E0E A;  3BQY A;  5BPD A;  2A5W A;  3GFL A;  3HBL A;  4BU2 A;  3OL3 A;  5IT9 K;  3UR3 C;  3JW4 A;  4M3F A;  2LTP A;  1R5H A;  2FNP A;  4FX0 A;  1DP7 P;  4B47 A;  4UUV A;  2M34 A;  1DDN A;  1JKR C;  3CJR B;  3E5U A;  1STZ A;  2EK5 A;  1E3H A;  5F0H A;  3DTE A;  2KJC A;  1YQA A;  1JXS A;  2KRC A;  3FK6 A;  1EA3 A;  1Y56 A;  4FHT A;  2V9K A;  3VWB A;  5BMZ A;  4L5E A;  4CYC B;  4DYC A;  2FSW A;  4XLA A;  4IHY A;  2QKL B;  1POG A;  1T39 A;  4DYR A;  1PUF A;  4LB5 A;  1EJ9 A;  2EV6 A;  2A07 F;  3U21 A;  2MLK A;  2W84 A;  3K4C A;  1K78 A;  3HRM A;  4HF0 A;  5C3E J;  3MCZ A;  4IZZ A;  2ZJQ F;  2Q0O A;  2V7F A;  1O4X A;  3RKQ A;  2L7K A;  3LSK A;  1WJF A;  5ERI A;  3A0H C;  3GW2 A;  3LSI A;  1MGT A;  4HNV A;  3ERM A;  2G0E A;  1U8R A;  2CG4 A;  4CYC A;  3CDL A;  2W25 A;  3ISP A;  3BJ6 A;  3TO7 A;  1BI3 A;  3S17 J;  3BP8 A;  4HNU A;  3H9J A;  3SJM A;  5K7F A;  3K1N A;  1FIP A;  2KMU A;  3FX3 A;  2CS3 A;  2E7X A;  5DM6 F;  4C2T A;  3L2U A;  1A31 A;  3E6M A;  3HZJ A;  3RPU A;  4NHJ A;  2FOW A;  4R79 A;  1JUM A;  2VJ4 A;  1IC8 A;  2O61 A;  5LLQ A;  3LSJ A;  5F64 A;  5A2Q K;  4IX7 A;  2R7Q A;  2O6G E;  2DMN A;  1ZRC A;  2HS5 A;  4YEJ A;  2GOX B;  2M7A A;  2RC4 A;  1BR2 A;  2QM3 A;  3DEW A;  3HDD A;  1HQC A;  1EKE A;  2V9V A;  4RGS A;  1HC8 A;  2W00 A;  2AXL A;  1CF7 A;  2ZB9 A;  2IS6 A;  3PQK A;  2Z3Y A;  2DK5 A;  1JT6 A;  3HC7 A;  4MQV A;  3PUF A;  4G7O F;  2GXB A;  1LVK A;  5D8K B;  3JRG A;  3ZMU A;  5DUI A;  3GTO J;  2VQG A;  4HDV A;  5E3O A;  2NVT J;  1P92 A;  3WTX C;  4XSZ F;  3N4M A;  1V55 H;  3OIQ A;  1S6L A;  1SD5 A;  4Y52 J;  3VSL A;  3CJN A;  1A5J A;  4UXN A;  1OKR A;  4YIR X;  2HOE A;  3SFI A;  1ZYR F;  1YG2 A;  3H3V K;  2LFB A;  1ETO A;  2I10 A;  3ZXS A;  1V5F A;  2FE3 A;  4KYW A;  3BDD A;  2RNJ A;  1Y39 A;  3I4M J;  3TW6 A;  4W1U A;  3D0S A;  5M5Y J;  1JUS A;  4YII A;  5LGN A;  1WQ2 A;  2LR8 A;  2AHQ A;  2XAU A;  3E7L A;  4BDY A;  4B1R A;  1MBJ A;  4G8X A;  3CLQ A;  1KQ8 A;  5KCM A;  1UB9 A;  1MJA A;  2W24 A;  4V19 K;  2R7O A;  1VQ9 I;  3QPS A;  2EFW A;  2JA2 A;  2ELK A;  2MLG A;  3FM5 A;  2L02 A;  1XB4 A;  4LMY A;  2R5Y A;  2QYO A;  1HF0 A;  1LEA A;  2FXA A;  4PDK A;  1LB2 A;  2ZME A;  2R7D A;  1YJW I;  4A3G J;  4N9H A;  3BQZ A;  2L2O A;  4XLC A;  1FJL A;  4HX7 A;  2GIZ A;  2M87 A;  3P9I A;  4BXU A; 
#chains in the Genus database with same CATH homology
 3FZV A;  3IC7 A;  1XGM A;  1TQM A;  2HQR A;  1YIO A;  2Z33 A;  3K1P A;  3KP6 A;  3WE2 A;  4UVB A;  2IT0 A;  2IP2 A;  1B59 A;  4RAZ A;  3QP6 A;  1P6R A;  4IF4 A;  1XGS A;  2L54 A;  5EEG A;  1WSU A;  3TO9 A;  3V7S A;  4Q5S F;  5IT3 A;  1J9I A;  3T0Y A;  1REP C;  1U5T C;  2OU2 A;  4JQF A;  3WTU C;  4UVA A;  2VE8 A;  5D4S A;  1I27 A;  3L00 A;  3L09 A;  2ESN A;  5CVU A;  3R61 A;  4HOB A;  2FQ3 A;  1ZAR A;  3ZP5 A;  3ZN0 A;  1FYM A;  1P2F A;  2ZNY A;  1USS A;  2XAS A;  4KMU X;  5E17 F;  2K4B A;  4LLG F;  1IW7 F;  3ELK A;  1KQ9 A;  3O3K A;  4EJO A;  3CO7 C;  4RB3 C;  3KZZ A;  1ZG3 A;  2L4A A;  1FP1 D;  5TRD A;  1UFM A;  1MJ9 A;  2O0Y A;  1HKQ A;  2QUF A;  5E18 F;  3GF2 A;  1LDJ A;  1Z7U A;  1IN5 A;  5F1R A;  4MEY F;  4HF2 A;  2EJR A;  3DXJ F;  1XSV A;  4AIK A;  2QZ8 A;  1TBX A;  4MHG A;  4HAM A;  2GQQ A;  2QWW A;  3ABU A;  2MH9 A;  2P4W A;  1FT9 A;  2IRF G;  4G6Q A;  4I02 A;  1L3L A;  2HFH A;  1ZRE A;  5FFZ A;  4GCV A;  3RKW A;  3G73 A;  5EEH A;  2XVC A;  3M7G A;  3GO5 A;  2QBY B;  2V6C A;  2ZNZ A;  2P6S A;  3ML6 A;  3D5L A;  3EQL F;  1SD7 A;  3TDU C;  1I6X A;  5FO5 A;  1J75 A;  5IT9 Z;  4KT5 C;  2BEO A;  4IVN A;  3LA3 A;  3M9A A;  1F4K A;  4BQA A;  2ZBK A;  5FGM A;  1FWZ A;  2DPU A;  1FBS A;  4BNC A;  2EV0 A;  4CIC A;  1RUO A;  2QVO A;  5FLX K;  1XDU A;  5ICF A;  1SAX A;  3PFI A;  2RN7 A;  1UHW A;  3TDZ C;  3H92 A;  3ZMS A;  1C0W A;  4IHT A;  3ABT A;  1TNT A;  4HYE A;  5J8C A;  4O5V A;  1AWC A;  4MTD A;  2ESH A;  3KE2 A;  1ULY A;  4YFN F;  4A0X A;  4P9U A;  3HRT A;  4OIP F;  1IRG A;  3V7C A;  2KRF A;  4CHU A;  2JTV A;  1FC3 A;  2FEZ A;  4RS8 A;  1P4X A;  1O7F A;  3DFG A;  3T5X A;  1G3T A;  4XSX F;  1PUE E;  4EGY A;  1YYV A;  2KKO A;  4ZZL A;  3HRU A;  3RIR A;  4Y15 A;  5LHG A;  5HVQ C;  2VON A;  1A04 A;  3L2C A;  2PFB A;  3ULQ B;  3QPT A;  5ICG A;  3O2P E;  1I1G A;  1IAW A;  1QZY A;  2A5Y B;  1YS7 A;  3V8L A;  3FXU A;  3OOP A;  3FMQ A;  1J5Y A;  1OMI A;  3R4K A;  1GHC A;  2A61 A;  1EV7 A;  1H9T A;  3N97 A;  4M73 A;  3VOE A;  3BZ6 A;  5H6R A;  1R00 A;  1WI9 A;  3F3X A;  3C1D A;  3F6V A;  1NHA A;  3J80 Z;  3LST A;  1QPM A;  3GXO A;  2XAH A;  3GZ6 A;  2HYF A;  2NYX A;  3FMS A;  4RB1 A;  1FPQ A;  2ADU A;  1EH6 A;  2IA2 A;  4I2O A;  1X3U A;  1QQI A;  4AD9 A;  4MGR A;  1WWX A;  1XMK A;  4M9S A;  2HQN A;  5HS8 A;  4M6Y A;  4ESB A;  1CF7 B;  2K7L A;  2FU4 A;  2CYY A;  3PQJ A;  2EFP A;  3F8C A;  1OYY A;  1R22 A;  2QQB A;  5DV5 A;  1O7L A;  4U88 A;  4N9I A;  4ZZD A;  2IA1 A;  5LRS A;  5JVT A;  1ZGA A;  2HTS A;  5L3F A;  4U0W A;  2HEO A;  4B09 A;  3U1D A;  2G9W A;  2E1C A;  2DK8 A;  1WRJ A;  4RB0 A;  2OZU A;  3U9G A;  4OIQ F;  1D8K A;  2K27 A;  3O6B B;  2OQG A;  2DPD A;  1B9M A;  4LG0 A;  2W57 A;  5D5V B;  2ISZ A;  3ZMV A;  1ZG1 A;  2BE5 F;  1YS6 A;  3VEP A;  5DUK A;  4QLC U;  4PZJ A;  3WU1 B;  2P5L C;  1MJB A;  4L9V A;  3I54 A;  4F7Z A;  4P55 A;  5DYM A;  1D3Y A;  5K5O A;  1DPU A;  3R60 A;  2VOD A;  2PMH A;  1D5V A;  2OA4 A;  1LDK B;  2IPQ X;  4XLP F;  1JHH A;  2P7V B;  2O3F A;  4I0B A;  3LAJ A;  1W7P A;  5JR3 A;  1RIO H;  2M1B A;  3HTS B;  5ILS A;  2VOO A;  2RKH A;  2EFN A;  4K2E A;  1BJA A;  1BI1 A;  1OPC A;  1Q1H A;  1KU7 A;  2CO5 A;  3P7N A;  2EA4 A;  2D45 A;  3FHZ A;  5FD6 A;  1K78 B;  4XRF A;  4EM1 A;  4XBF A;  2HKO A;  2DW4 A;  1LVA A;  5K1Y A;  1Y0U A;  4ZYG A;  3ERE D;  3J81 Z;  1T38 A;  3V7R A;  5A2Q Z;  4P5O A;  2GIV A;  2XKO A;  3RI4 A;  3E6B A;  5CVR A;  5L3D A;  3LQR A;  2VE9 A;  2M45 A;  1P4W A;  2P5K A;  3HOS A;  1K79 A;  3H3U A;  2HZT A;  3F8N A;  1W7P D;  4KIC A;  4U7D A;  1DPR A;  4KNY A;  3HRS A;  3TOB A;  4ON0 A;  4I98 B;  4HV5 A;  5E1W A;  2BBY A;  2A69 F;  2ISY A;  4BHB A;  2VC1 A;  2WWY A;  5H20 A;  4CGZ A;  4BYY A;  1T98 A;  2Q2E A;  2HR3 A;  4DNC A;  4I0A A;  1ZHF A;  3F8M A;  1W4M A;  4HA8 A;  3SZP A;  3SFZ A;  2D2W A;  1XN7 A;  2Z99 A;  4MEX F;  2ZJ2 A;  1TNS A;  3RYR A;  3HYI A;  3H3Z A;  3WTV C;  2A3S A;  4FX4 A;  3E5X A;  2OAZ A;  2Z9O A;  5BPI A;  3CDH A;  2OBP A;  1R58 A;  2JT1 A;  1I1S A;  1XD7 A;  1HW1 A;  5AON A;  4U0V A;  3F72 A;  1YTY A;  1GXP A;  4ENN A;  3I0T A;  2XAF A;  2XV4 S;  3KP2 A;  1XGN A;  1BIB A;  4IRI A;  4EGZ A;  1IXR C;  4Q48 A;  4EJU A;  3LWF A;  1J0R A;  4L0Y B;  5F6F A;  2EWN A;  4A0Z A;  1U3E M;  4L9T A;  2EA2 A;  2GZW A;  5HOO A;  3IL2 A;  1U5T A;  3LA2 A;  5KK1 A;  3FXR A;  4G7Z F;  1IUY A;  4M72 A;  4L5I A;  5FFX A;  4BHC A;  2DT5 A;  4ESF A;  1Z6R A;  2WV0 A;  2BGC A;  1ZN2 A;  3WU0 A;  4LJZ F;  1IN7 A;  5HLH A;  3IWZ A;  2F5C A;  4ENJ A;  1ZH5 A;  3LFK A;  5E8G A;  1FBQ A;  2M30 A;  5LEJ A;  4HLY A;  2CW0 F;  3I5U A;  1YO5 C;  3EUH A;  1I5Z A;  1HXD A;  5DEQ A;  3BPX A;  2A68 F;  1RNL A;  2M5W A;  5TJJ A;  1W7P B;  1RI7 A;  2DBB A;  3P9K A;  2GA2 A;  3F8B A;  1HW2 A;  4KFC A;  4RAY A;  4WX9 A;  5L3E A;  5CVJ A;  3JSO A;  2FNA A;  4EJW A;  4KN4 X;  2VC0 A;  4NQW A;  3TKY A;  2NRA C;  1SMT A;  1FSE A;  2HGC A;  4PGG A;  4U0Y A;  1IRF A;  2STW A;  1FBU A;  4WXC A;  1QNT A;  5JHU A;  5LGU A;  5AIP A;  2E1N A;  5D5U B;  2H94 A;  2X0L A;  3Q9S A;  1QZZ A;  1BC7 C;  2HKX A;  3K9T A;  4HX4 A;  1ON2 A;  3KP3 A;  2KIU A;  2BYV E;  3GFJ A;  1IN6 A;  2IJL A;  2VOP A;  4CO8 A;  2CFX A;  2JZY A;  5BQT A;  2KJB A;  3DKW A;  4EM2 A;  5CVI A;  5ED4 A;  1G3S A;  1FZP B;  4MNU A;  2OZ6 A;  4L9J A;  2LF8 A;  3RJP A;  3CO6 C;  3GLX A;  1TTY A;  1YLF A;  1KQ0 A;  2IW5 A;  4HZF A;  2DO7 A;  2E7W A;  2XAG A;  1PP7 U;  4KMF A;  2PQ8 A;  2CWE A;  2WTE A;  3M8F A;  4GGG A;  2P6T A;  2X4H A;  4S05 A;  4M6X A;  1O3Q A;  3RYP A;  2Y0M A;  3I71 A;  1FP2 A;  1H0M A;  5HLI A;  2BV6 A;  3E97 A;  1V3F A;  4L5J A;  4OIR F;  1B6A A;  4Y17 A;  2YPR A;  3WTY C;  1S7A A;  4RGX A;  1ZGJ A;  1F1Z A;  1Z91 A;  2V1D A;  3JTG A;  3U2R A;  2FBI A;  2M8E A;  5BS6 A;  1E2X A;  3LA7 A;  4EMS A;  3CLO A;  4L0Z B;  1KU2 A;  4LK0 F;  4KUM A;  1KYZ A;  1G3Y A;  2P7C B;  3DV8 A;  4OMZ A;  2QQA A;  3ZMT A;  2EFO A;  1FY7 A;  2HWV A;  5DD4 A;  3Q5F A;  2HTJ A;  2F5E A;  5E8I A;  6PAX A;  4A5N A;  3R6S A;  1BI2 A;  2CGP A;  5H6Q A;  3BJA A;  1BOA A;  3VB2 A;  2Y75 A;  2YR2 A;  1F9N A;  2H27 A;  4O3M A;  3GFI A;  4A6E A;  2MC3 A;  1T6S A;  3EDP A;  1ONV A;  1KA8 A;  1HKT A;  1R1U A;  3W6K B;  2FBK A;  2UXN A;  2QEN A;  3WTS C;  4RGR A;  4JBA A;  4OOI A;  3COA C;  4ESJ A;  1SD6 A;  3KP5 A;  2PLY A;  1YW7 A;  3DP7 A;  1VTN C;  4R1H A;  4NB5 A;  4O6J A;  4ETS A;  2F2E A;  1DUX C;  1R7J A;  2L01 A;  2LSO A;  3QRF F;  4H0E A;  1O3R A;  4WCG A;  2GAU A;  4HV6 A;  3CUQ C;  2VBZ A;  5HDG A;  2CQK A;  2QBY A;  1ZAO A;  1Z1D A;  1Z05 A;  2DQR A;  1S3J A;  2L3D A;  5K5Q A;  3M8E A;  4E70 A;  5DD8 A;  2RV8 A;  3B73 A;  2DTR A;  3BJO A;  2Y48 A;  3E3V A;  3MWM A;  2MBF A;  5K5R A;  4ZYD A;  2DU9 A;  1HBX G;  1R5G A;  3ECO A;  1BI0 A;  3DPT A;  3LAP A;  4M74 A;  3IHU A;  1XSX A;  5LEK A;  5E1X A;  2RQP A;  4LLL A;  2A6H F;  3M1E A;  3C3W A;  3TO6 A;  1YFH A;  1XGO A;  3KET A;  2DLL A;  5FB2 A;  5HLG A;  4KIF A;  1KGS A;  3GEZ A;  2C6Y A;  1J7K A;  1FNN A;  4LD5 A;  5LHI A;  3JAM Z;  1J59 A;  2P5V A;  1MZB A;  4N0B A;  1BBY A;  4KDP A;  2DAO A;  2KIF A;  1D8J A;  2FA5 A;  3R0J A;  4KA4 A;  1FSH A;  4ENK A;  4RB2 C;  3HHH A;  4IRH A;  1BC8 C;  1IN8 A;  1UCR A;  2ZXJ A;  4HW0 A;  5L3B A;  1IN4 A;  2RVC A;  3KFW X;  3F23 A;  4GXO A;  1MKM A;  2XIG A;  3SZT A;  2ELH A;  3LQQ A;  4I09 A;  1JGS A;  1TQI A;  3ZQ7 A;  2L4M A;  2AS5 F;  1LEB A;  4I01 A;  3GZ5 A;  2Q8K A;  1U6G A;  3WTW C;  3V8K A;  1V4R A;  4PGH A;  5HS9 A;  3QU6 A;  5L3C A;  3GWZ A;  3HSR A;  5D6E A;  4LB6 B;  4A6D A;  2V79 A;  1R1T A;  4D0P A;  4UV9 A;  4KIB A;  3EET A;  3MAJ A;  1HST A;  2LDU A;  3W6J B;  4Q4Z F;  3QOP A;  4AIH A;  1BN5 A;  2MD5 A;  1XCB A;  3I58 A;  5D4R A;  4EVI A;  5ILV A;  1ZRD A;  1FLI A;  4A12 A;  3L9F A;  1TW3 A;  2G7H A;  2QLZ A;  4OIO F;  3TGN A;  5D5X B;  4M71 A;  3HHG A;  2FOK A;  1OR7 A;  4Y13 A;  3AAF A;  2NAZ A;  1RZ4 A;  3C7J A;  2NS0 A;  5CJ9 A;  2JPC A;  1KU3 A;  3ECH A;  4G7H F;  1IF1 A;  4BH9 A;  3FWE A;  3KP4 A;  4AIJ A;  2QQ9 A;  3KEQ A;  3IWF A;  1PDN C;  3WGG A;  5J8F A;  3KCC A;  4L9N A;  2O03 A;  2UWM A;  2FMY A;  3RTR A;  5CLS A;  3MZY A;  4ZH4 F;  3IRR A;  4MTE A;  1T0F A;  1W5S A;  1E17 A;  5D8L B;  4IHS A;  3EYY A;  3ZMD A;  3IKT A;  4AWX B;  2V1X A;  3WTZ A;  4HF1 A;  3K1M A;  1OYW A;  4LK1 F;  3P9C A;  3SHF A;  3E6C C;  2PG4 A;  1IZ1 A;  2WC2 A;  3QP5 A;  4WXD A;  3VFZ A;  3WE3 A;  1HKS A;  1H9G A;  2PN6 A;  3J7A O;  2DFI A;  2R7F A;  3CUO A;  3MEX A;  3FXQ A;  3L7W A;  1F5T A;  1YW8 A;  2VBW A;  1BM9 A;  1TW2 A;  3WGH A;  1BIA A;  2ZO4 A;  4G94 A;  1K7A A;  4HX8 A;  4IXA A;  1G3W A;  3BPV A;  2MA3 A;  3RDI A;  3T8T A;  4ASN A;  3QAH A;  2UZK A;  4M9X A;  2PJP A;  1P4A A;  3NEU A;  3KP7 A;  4LFU A;  2COM A;  1G4D A;  4UV8 A;  2H6C A;  2H6B A;  2JRT A;  4ZYE A;  2V1U A;  2XAJ A;  4ZYH A;  1R1V A;  2B0L A;  4JK1 X;  5DCF A;  2UXX A;  1MD0 A;  1O57 A;  3QPH A;  4HBL A;  3F6O A;  4HQM A;  3JSP A;  3ZPL A;  4UVC A;  4P9F A;  2VBX A;  2YU3 A;  2YX4 A;  2O8X A;  5L3G A;  3J81 K;  5JFR A;  2XGX A;  5LBQ A;  4EJV A;  4CDG A;  4A5M A;  5FLX Z;  3F21 A;  2ZME B;  3OV8 A;  2LF7 A;  5CVV A;  2F5D A;  2PMU A;  3F8F A;  4YIF A;  5HDK A;  3HTU A;  1FX7 A;  1JE8 A;  3IKV A;  2FF4 A;  3SQN A;  4MQ9 F;  3MFK A;  1SD4 A;  1PP8 F;  3C18 A;  4TV7 A;  4AVP A;  2ZKZ A;  5HS7 A;  1U5T B;  4GYI A;  5E1Z B;  1R36 A;  3JAM K;  4HLX A;  5FD5 A;  4RGU A;  2HYG D;  3T8R A;  3WTT C;  1O3T A;  2NNY A;  2ACJ A;  2HDC A;  2IA0 A;  3G3Z A;  3R0A A;  3CTA A;  5LHH A;  3E6D A;  1R23 A;  3KEO A;  1B1B A;  1S7O A;  1XSD A;  3B02 A;  4CXF A;  3MQ0 A;  1UHM A;  3BRO A;  3K0L A;  4BHP A;  4G6D A;  2F5F A;  2TDX A;  2XAQ A;  1XDS A;  1FOK A;  2VT2 A;  4I7H A;  1U2W A;  4LLN A;  3F22 A;  5D6F A;  4OMY A;  3KLN A;  2IVM A;  1LJ9 A;  4DQ2 A;  2K86 A;  1EH7 A;  3ZMZ A;  1WKM A;  1T2K A;  3TQN A;  2GWR A;  3REO A;  3DPL C;  1S8N A;  2XRO A;  1ZLJ A;  4P96 A;  4IJA A;  2CSO A;  4GYG A;  2J5P A;  3GFM A;  3ROU A;  4G9Y A;  4CYD A;  1QBJ A;  2ETH A;  3GYH X;  4A2U A;  1O3S A;  2RDP A;  2A6E F;  4YFK F;  3S2W A;  3NRV A;  1S29 A;  5ILU A;  3I4P A;  5HDN A;  2LKP A;  1L0O C;  2XRN A;  4PCQ A;  4IRG A;  2VN2 A;  4EJT A;  3KZY A;  1RUN A;  1ZRF A;  3FF5 A;  5BOX A;  3FMR A;  3HIF A;  3HUG A;  2G7U A;  5LGT A;  1ZLK A;  2H09 A;  1SMY F;  1EH8 A;  1QGP A;  3FM3 A;  5E20 A;  1MDM B;  3VOD A;  1ZG5 A;  3QU3 A;  2EFQ A;  3TOA A;  4LG0 B;  4FT8 A;  3BY6 A;  1J2X A;  4L18 B;  4R8H A;  3DEU A;  3CUQ B;  4WF2 A;  2J5O A;  2NNN A;  1ON1 A;  4A0Y A;  3GVA A;  1SFX A;  1MDM A;  2YSR A;  3K69 A;  1LQ1 A;  2MH2 A;  2VT3 A;  2K02 A;  3WGI A;  2GA1 A;  2D1H A;  3BWG A;  2EB7 A;  3HSF A;  4KIG A;  3CUQ A;  2VXZ A;  3GX4 X;  4EV0 A;  2EV5 A;  5JI6 A;  4EQQ A;  1OYI A;  1B9N A;  5DDG A;  3IRQ A;  1Z6T A;  3BOQ A;  4ENM A;  4CZZ A;  2PEX A;  3GUD A;  4M9Z A;  1KYW A;  2W85 A;  3I59 B;  3JTH A;  5DCM A;  2OD5 A;  2XUB A;  2OQR A;  4KN7 X;  1JHF A;  2KIM A;  1B4A A;  1CGP A;  1HSJ A;  1LNW A;  4Z2Y A;  2RGV A;  2VBY A;  4XLN F;  2PBI A;  2Z5U A;  5CYV A;  2D1V A;  3NQO A;  5DCM B;  5KVR A;  1SFE A;  4WK8 F;  3J80 K;  3RKY A;  5AIQ A;  4QWQ A;  3HOT A;  3EYI A;  4HQE A;  4YFX F;  4UNO A;  3I59 A;  2GXG A;  3MZH A;  3DQV C;  2FBH A;  1TQP A;  5D5W B;  3DF8 A;  2K4J A;  4HDU A;  1ODD A;  3K2Z A;  4GO1 A;  1GVJ A;  1QO0 D;  2ZCW A;  5ICE A;  1K6O A;  2YX7 A;  4YG2 F;  5J6X A;  3WG9 A;  2STT A;  1HW5 A;  2JPB A;  3RPQ A;  1YW9 A;  1TLH B;  2FRH A;  3I64 A;  3RKX A;  2DI3 A;  3ZN1 A;  4LGW A;  1AOY A;  1IXC A;  2LNB A;  3WOD F;  3I53 A;  5ICC A;  3Q9V A;  1UST A;  1IXS B;  2DQL A;  3V4G A;  1U78 A;  4EM0 B;  3HSE A;  3V8J A;  3T1B A;  4OU0 A;  4U7B A;  4IPA A;  1FYL A;  1XMA A;  1LDD A;  4WXH A;  1SFU A;  1Z9C A;  2P8T A;  1XCV A;  5LRR A;  4S04 A;  1W5T A;  2ZFW A;  4BAY A;  1KU9 A;  3SXY A;  1FYK A;  2XHK A;  2PI0 A;  2XKP A;  2R3S A;  4Q47 A;  4OIN F;  4B8X A;  1GXQ A;  1G6N A;  2JSC A;  3E5Q A;  2FML A;  4WWC A;  3KLO A;  4UHT A;  5BPD A;  3GFL A;  5IT9 K;  3JW4 A;  4FX0 A;  1R5H A;  2FNP A;  1DP7 P;  4UUV A;  1DDN A;  3E5U A;  1STZ A;  2EK5 A;  2KJC A;  1YQA A;  1JXS A;  4FHT A;  5BMZ A;  2FSW A;  1T39 A;  4LB5 A;  2EV6 A;  2A07 F;  2MLK A;  2W84 A;  1K78 A;  3HRM A;  4HF0 A;  3MCZ A;  2Q0O A;  5ERI A;  3GW2 A;  1MGT A;  1U8R A;  2CG4 A;  2W25 A;  3ISP A;  3TO7 A;  3BJ6 A;  1BI3 A;  3BP8 A;  3K1N A;  3FX3 A;  2E7X A;  3E6M A;  3RPU A;  4NHJ A;  2O61 A;  4R79 A;  5LLQ A;  5F64 A;  5A2Q K;  2O6G E;  1ZRC A;  2HS5 A;  2RC4 A;  2QM3 A;  1HQC A;  2V9V A;  4RGS A;  1CF7 A;  2AXL A;  3PQK A;  2Z3Y A;  2DK5 A;  4MQV A;  4G7O F;  2GXB A;  5D8K B;  3ZMU A;  5DUI A;  4HDV A;  1P92 A;  3WTX C;  4XSZ F;  3N4M A;  1S6L A;  1SD5 A;  3CJN A;  4UXN A;  1OKR A;  2HOE A;  1ZYR F;  1YG2 A;  2FE3 A;  4KYW A;  3BDD A;  2RNJ A;  3D0S A;  4YII A;  5LGN A;  1WQ2 A;  4G8X A;  1KQ8 A;  1MJA A;  1UB9 A;  2W24 A;  2EFW A;  2MLG A;  3FM5 A;  2L02 A;  1XB4 A;  4LMY A;  2QYO A;  1LEA A;  2FXA A;  1LB2 A;  4PDK A;  2ZME A;  2R7D A;  4N9H A;  4HX7 A;  2M87 A;  3P9I A;  4BXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...