4RGXA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 3,4-dihydroxy bezoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with 3,4-dihydroxy bezoic acid
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
total genus 44
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgxA00
4GYGA 3J81Z 2RDPA 1TLHB 5LGUA 4EQQA 3JTGA 4M9SA 4GYIA 3GEZA 2ZMEA 3I64A 3ZMDA 4U88A 3BDDA 4KIFA 4HDVA 2QVOA 5CLSA 4Q47A 5FFXA 1FBSA 4HF2A 4G94A 1K78B 4UVCA 1U5TB 4Q5SF 2K4BA 4NB5A 4LG0A 3WTUC 3KP6A 2YR2A 1BOAA 3GFLA 4LLLA 3E6DA 4O5VA 4OIRF 4I0BA 5CVVA 3I53A 4KN4X 3P9IA 4LGWA 3IWFA 4PGGA 4L9NA 5D5UB 1ZG5A 4KICA 4G7OF 2GXGA 3C18A 1OYIA 1W7PD 2ADUA 4BXUA 4Q4ZF 3COAC 1IRGA 3I59A 4UVAA 2W84A 2DQLA 4B8XA 5J6XA 1D8JA 2M30A 2L4AA 1WSUA 2W24A 2VN2A 2Q8KA 2O61A 3FXUA 1NHAA 4K2EA 5DEQA 5HS9A 4BHBA 4OINF 4EJUA 4ENKA 3JAMK 2EFNA 3HHHA 3HTSB 1JXSA 1IN7A 3SXYA 3M9AA 3WTZA 4ZYDA 5K5RA 3C7JA 3KEOA 2E7XA 2HR3A 5ICCA 2CGPA 3DQVC 5ED4A 4PDKA 1R7JA 1H9GA 3HTUA 2WTEA 1WI9A 1S8NA 4ZH4F 2EV0A 3M1EA 4CZZA 4CHUA 3VODA 1XB4A 1FYKA 2Z99A 3KP7A 5ILUA 2ZNZA 1OYYA 5IT3A 3E6BA 4R1HA 3KZZA 2XIGA 5DCFA 3EETA 5D5WB 2XUBA 3WE2A 1S7AA 2VOPA 4CGZA 5FGMA 2FXAA 5DCMA 2HZTA 1IAWA 1IN4A 4GCVA 1PP8F 4IHTA 2XAGA 4L0ZB 4GGGA 1USTA 2D1HA 2OZUA 3GZ5A 5DV5A 3R0AA 4UUVA 3E97A 1IN5A 5K5QA 4HF0A 2FBKA 2A61A 4RGUA 4BHCA 2ZO4A 3WTXC 4EGYA 4I98B 5DD4A 2VOOA 4CDGA 4M71A 4ZYGA 5A2QK 4U0VA 2QZ8A 2CFXA 1XD7A 3ZMVA 1BM9A 1QBJA 4G8XA 1ON2A 3LQQA 1P4WA 4LLGF 1DDNA 2EV5A 5BPIA 2HOEA 2EFWA 3RYRA 4RB3C 3IKVA 4N0BA 3QRFF 1T2KA 4HQEA 2JTVA 2NYXA 5FLXZ 2HQRA 2A68F 4ASNA 3F6VA 1YQAA 3VEPA 2QBYB 3RI4A 4HX7A 1FSHA 5HLHA 3P9KA 2HTJA 1I5ZA 3LA3A 2GWRA 2JPBA 1T38A 5DYMA 3BP8A 1R1TA 4EM2A 4IF4A 1LDDA 4UVBA 2F5CA 1FBQA 3WGIA 2P8TA 2MLGA 2O0YA 1TQMA 2GXBA 4Y13A 3JSOA 1I6XA 3LWFA 5FB2A 2V1DA 5LBQA 3ERED 3BROA 5AONA 3IRRA 4RAZA 2GA1A 1RI7A 2WV0A 2F5DA 3IHUA 3KCCA 4EVIA 2QUFA 4HDUA 3ECOA 4O3MA 3ZN1A 2A5YB 3KZYA 3T0YA 1MDMA 1XCVA 1QQIA 3F8FA 4HF1A 3M8FA 2IRFG 5LLQA 3IC7A 2A07F 5TRDA 3MCZA 2P7CB 2TDXA 2VODA 3BJAA 5AIPA 1HSTA 4B09A 2JPCA 4ZYEA 2HGCA 3K2ZA 1E2XA 1X3UA 2OD5A 1ZG1A 1BI2A 3MAJA 3RIRA 5LHGA 1KGSA 2GIVA 2M8EA 2BGCA 4MHGA 1TW2A 3Q9SA 1FLIA 2RC4A 4JBAA 3W6JB 3R61A 2ISZA 1KU3A 1R00A 3CJNA 1S3JA 1YS7A 2P6TA 2YSRA 3H92A 2EK5A 4A0ZA 1JGSA 3CUOA 1LDKB 3CTAA 2HYFA 2XVCA 2L4MA 3GX4X 4M74A 5CYVA 1P92A 4FHTA 3PQJA 3C3WA 3RPQA 5ICFA 4KYWA 5AIQA 3BPVA 4G6QA 1FY7A 2XROA 3EYYA 3KLOA 2RNJA 3GWZA 1SFXA 4G6DA 5CVRA 1DUXC 3O6BB 2IVMA 4G9YA 1IN6A 2HWVA 3R4KA 2AS5F 4RGRA 5LHIA 2MLKA 4U7BA 2FE3A 3FM3A 1SD4A 1R23A 5LEJA 2L54A 1O3QA 4MQVA 1DPRA 1RNLA 1J9IA 2CYYA 1ZARA 2FF4A 3HSRA 3U9GA 4ESBA 1ZRDA 3RKYA 1ZLKA 1KU2A 2KRFA 4OOIA 3DPTA 4KA4A 1IUYA 5EEGA 1KQ0A 3SZTA 3FXQA 5HDGA 2FBIA 3CUQA 1RUOA 5HOOA 1UFMA 4LB5A 3OV8A 1TW3A 1UCRA 4KT5C 4CXFA 3J81K 1Z7UA 2IW5A 4O6JA 2OQGA 4WXHA 2STTA 5DUKA 2OBPA 2MC3A 1V3FA 2OA4A 1IW7F 1G3WA 1BIAA 6PAXA 3R60A 1LVAA 3HRMA 3GLXA 2VBZA 2NNYA 1Z05A 1W7PA 3KFWX 3WGHA 2Z5UA 3EUHA 3ZP5A 3KP4A 1YFHA 1EV7A 5D4RA 2Y0MA 1XSDA 2O03A 5HS8A 4IPAA 4PCQA 4UV9A 1BI0A 3WU1B 2QYOA 1F4KA 3KE2A 2PG4A 5D6FA 1U5TC 3BJOA 4IRIA 4Q48A 4NQWA 1GVJA 2VT2A 2E1CA 1FP2A 2V1XA 2RV8A 4DQ2A 4BNCA 4GO1A 3T8RA 2LF7A 2STWA 5JFRA 4RB1A 5HS7A 3FHZA 4L5IA 4CYDA 1I1SA 2WC2A 4HLXA 4M9ZA 5HLGA 2PI0A 2K7LA 2HYGD 1JHHA 3DF8A 2NS0A 2DAOA 4MEXF 2NNNA 2FNAA 3DP7A 5CVJA 5CJ9A 5BMZA 4LJZF 1A04A 4FX0A 4AIJA 2XHKA 2ELHA 5E18F 5DUIA 3BPXA 1FSEA 1EH8A 2ESHA 2FQ3A 5F64A 2CW0F 2X0LA 3ZMSA 1RUNA 1LEBA 1ZLJA 2BEOA 4LB6B 1ZRCA 4HW0A 4JQFA 1Z91A 1O3TA 1YW8A 5E8GA 1B59A 4JK1X 4OMZA 2DFIA 2LSOA 4I7HA 4XRFA 5H6QA 3HYIA 1TQIA 2EB7A 3I0TA 1KQ9A 4EGZA 3B02A 4YFNF 2AXLA 1U2WA 1S7OA 3TKYA 2KIFA 4M9XA 4RGSA 2VONA 1D5VA 4AWXB 2LNBA 4Y17A 1QZYA 3F8BA 1YIOA 4HZFA 5JHUA 3F23A 2X4HA 4MTEA 1ZYRF 4G7HF 5BQTA 2RN7A 4TV7A 3GFMA 3FMSA 4NHJA 1IZ1A 4HOBA 4D0PA 2UWMA 1V4RA 2QQBA 4UHTA 2YX7A 2RGVA 3D0SA 3F6OA 4XBFA 2EA4A 2L3DA 3NRVA 3LAJA 4AVPA 2R3SA 4ETSA 3VB2A 5FLXK 1ZAOA 4LLNA 5BOXA 3E5UA 2OU2A 4Y15A 1ZH5A 2V79A 1MGTA 4FT8A 3PFIA 5K5OA 1J0RA 2KIMA 2OZ6A 3ROUA 3V7RA 4L9VA 3SQNA 2OQRA 2VE9A 4IXAA 1HBXG 1W4MA 5E1ZB 3F3XA 2A69F 4IVNA 3I54A 2GA2A 4IJAA 4A2UA 3SHFA 1B9NA 2BBYA 2D2WA 3BZ6A 3H3ZA 3H3UA 3ML6A 5FD6A 1TNSA 1MKMA 4ON0A 4I02A 3HOTA 3QP6A 2L01A 1ZGJA 2Q2EA 2MH2A 5BS6A 1STZA 1WKMA 4P5OA 3QU3A 4HA8A 2PJPA 4P96A 1F9NA 1FYMA 2G9WA 3MZHA 1ZHFA 1HW5A 3GFIA 2DQRA 4CO8A 3U2RA 4H0EA 3FMRA 3V7CA 1T6SA 5HVQC 1FBUA 1LEAA 3FMQA 3ECHA 4P9FA 3WODF 2CSOA 1YG2A 2YX4A 1I1GA 2VBXA 4MNUA 1O7LA 2BE5F 3QPHA 4IRGA 2COMA 4OMYA 5LGTA 3JAMZ 3KP3A 1CF7B 1HKTA 2IPQX 2F2EA 3ZMZA 1F5TA 2VC0A 2W85A 2ZMEB 4WK8F 1LQ1A 3ZMTA 3ZN0A 4RB0A 3IL2A 4LFUA 1SD6A 1UHMA 3CO6C 2MD5A 4KIGA 4ESFA 4HV5A 1LNWA 5JVTA 1UHWA 2A6EF 1FYLA 3I71A 4LG0B 3FZVA 3OOPA 5E17F 3MFKA 5HDKA 2O6GE 1YW7A 4I0AA 1E17A 1R5HA 2XASA 3I5UA 4HAMA 4YIFA 3ULQB 1ODDA 4ENJA 3N4MA 1HKSA 3GF2A 1OYWA 3KETA 1CGPA 3Q5FA 3BWGA 1BN5A 3K9TA 4YG2F 1ULYA 5L3EA 1WRJA 3WTTC 3I59B 4ESJA 1SD7A 5ICEA 2W25A 4KMUX 1B6AA 4KUMA 3RDIA 2MH9A 1FPQA 3PQKA 1XGOA 1R1VA 2Y48A 2RQPA 2FBHA 1ZREA 1XDUA 5HDNA 1GXQA 5ILSA 4BHPA 2Z3YA 2JSCA 4F7ZA 1EH6A 1BI3A 2QENA 3E5QA 3G73A 4M6XA 3DEUA 4LMYA 3EDPA 1SFEA 3JW4A 3FX3A 5ERIA 4U0WA 5LRSA 1MZBA 1XGMA 2R7DA 1SMYF 3TO6A 1IF1A 1XGSA 4XLPF 2A3SA 4N9HA 4BH9A 2R7FA 3J7AO 1XMAA 3K1PA 3QAHA 4AIHA 2XKOA 3K1MA 3TGNA 4A0YA 1QO0D 1ON1A 1K78A 1B1BA 2H27A 3LAPA 4WF2A 1U5TA 3QU6A 5DCMB 2M1BA 3ZPLA 5E1WA 3O2PE 2O3FA 4P9UA 2PN6A 5D5XB 2J5PA 3TQNA 2MA3A 2HDCA 1YO5C 2EFPA 2D45A 3RTRA 3V8LA 4OU0A 5IT9K 2Q0OA 2H09A 3IRQA 1ZRFA 4BQAA 4EM0B 1J75A 3BJ6A 1HSJA 5FO5A 3BOQA 1R22A 3T1BA 2PMHA 2EFOA 3V4GA 2XAHA 4ZZLA 4LK0F 2A6HF 3TDUC 2PFBA 1LDJA 1GHCA 4WXCA 5F6FA 1FP1D 3ZMUA 2P7VB 1XSXA 2F5FA 1U78A 2M5WA 3M7GA 1GXPA 4KMFA 3MEXA 2P4WA 4AIKA 4EMSA 4YIIA 1VTNC 4HX8A 1ZG3A 1T0FA 1P4AA 3DKWA 3K0LA 1RZ4A 3NEUA 3MZYA 5L3CA 1O7FA 1SD5A 2K86A 2DW4A 1BC8C 2VT3A 2HKOA 4WCGA 3KEQA 4N9IA 4L18B 3RPUA 4AD9A 4MGRA 4ZYHA 3RKXA 3I58A 1ZGAA 4ENMA 5FD5A 1YLFA 3N97A 4RAYA 3TOAA 2DU9A 5CVIA 1YTYA 1P2FA 3HHGA 3LSTA 4LD5A 3JSPA 2QWWA 2ETHA 1Z6TA 2M87A 1XDSA 4EJOA 3WGGA 1G3SA 3EYIA 3V8JA 4P55A 1MDMB 4E70A 3CLOA 3VFZA 2XRNA 5TJJA 3P7NA 1FOKA 3ELKA 1XGNA 1P4XA 3DV8A 4IRHA 1UB9A 3O3KA 2UXXA 2LDUA 1HW2A 5J8FA 1MJ9A 4R8HA 2IA0A 3E6CC 5D8LB 2E1NA 3TOBA 2HS5A 3K1NA 3G3ZA 2CWEA 3CUQC 2D1VA 2EWNA 3WTWC 5ICGA 4ENNA 1G4DA 2EFQA 5DD8A 3J80Z 2DT5A 2QBYA 3P9CA 2XV4S 2BYVE 2HTSA 2ISYA 1L0OC 2P6SA 3E3VA 2BV6A 1PP7U 1KU9A 4BYYA 1HKQA 4EJWA 5E20A 3FM5A 3EQLF 1DPUA 4A6EA 1ONVA 3DFGA 2YU3A 2G7UA 2DPUA 3HSFA 3SZPA 3GW2A 3W6KB 1K79A 3RYPA 4U7DA 3WTYC 2JZYA 3E6MA 4XSXF 2ZJ2A 2FOKA 1TNTA 4MEYF 4RB2C 5F1RA 1XSVA 3MWMA 3F8NA 5D5VB 1RIOH 1AOYA 1REPC 2ZXJA 3TO7A 4L5JA 3CO7C 2ZNYA 3CUQB 2RVCA 1J2XA 3V8KA 4DNCA 2V9VA 2P5KA 4L9JA 1EH7A 2UZKA 2UXNA 4HYEA 1P6RA 3C1DA 4XLNF 1FZPB 1D8KA 2Z33A 3WTSC 4A0XA 1MJBA 1IXRC 3RKWA 4U0YA 1W7PB 4KFCA 3ABUA 1BI1A 3HSEA 3U1DA 2VBYA 1XN7A 3LFKA 1FWZA 2M45A 4M73A 4BAYA 4UXNA 5L3GA 5DDGA 3F72A 3I4PA 4I09A 1J5YA 1S29A 2PMUA 2YPRA 2DO7A 3HOSA 2DI3A 4EJVA 4RGXA 1KYWA 3ABTA 1T98A 2XAQA 2HEOA 2K02A 2L02A 1PDNC 1R36A 3D5LA 4PGHA 5LEKA 2KKOA 1BC7C 3T8TA 3T5XA 2P5LC 1O3SA 4I2OA 1OPCA 5H20A 3GFJA 3R6SA 4A5NA 3K69A 5HLIA 2NAZA 4OIPF 2IP2A 2FU4A 5LGNA 4MTDA 3CDHA 4KN7X 3WE3A 5K1YA 3KLNA 2CG4A 3F8MA 4A5MA 2FA5A 3QPTA 4A6DA 4IHSA 2EJRA 3LA2A 1C0WA 3HUGA 4EM1A 2P5VA 3KP5A 3GYHX 2E7WA 1Z9CA 2PEXA 1QPMA 4G7ZF 5ILVA 5FFZA 2CQKA 4I01A 4M72A 3Q9VA 2DK8A 4OIQF 1XMKA 3F8CA 2LF8A 3GZ6A 2EA2A 1J7KA 1SMTA 1OKRA 1ZN2A 3FXRA 2IA1A 3GVAA 4ZZDA 2NRAC 4L0YB 2IJLA 1PUEE 2VXZA 2PQ8A 2QLZA 4S04A 1B4AA 3GO5A 3HRTA 1G3YA 1B9MA 3TO9A 2K27A 3L00A 2FNPA 2KJBA 1MJAA 3ZQ7A 2KJCA 2F5EA 4CICA 1MD0A 3WG9A 1R58A 2OAZA 4HV6A 1IXCA 2XKPA 1SFUA 1BJAA 2V6CA 5LHHA 3DPLC 4WXDA 2VBWA 5EEHA 1WWXA 4YFXF 1T39A 4EV0A 5D6EA 4A12A 1LB2A 4HX4A 2LKPA 3AAFA 2WWYA 1W5TA 4UV8A 2ACJA 3HRUA 5A2QZ 5KK1A 2HQNA 1LJ9A 3L2CA 1BBYA 1KQ8A 1Y0UA 5CVUA 3M8EA 2IA2A 3R0JA 1K6OA 2IT0A 1Z6RA 2G7HA 3IKTA 5KVRA 1HW1A 1D3YA 1FC3A 2DTRA 2FEZA 1YS6A 2GQQA 2H94A 4FX4A 2FRHA 1J59A 2CO5A 2H6BA 2DPDA 4M6YA 2HFHA 4MQ9F 4WX9A 4L9TA 5D8KB 2ZBKA 2DBBA 1KA8A 4Z2YA 4S05A 3QOPA 1Q1HA 2Z9OA 3MQ0A 2VE8A 1R1UA 1HQCA 2EV6A 1I27A 3LA7A 4EJTA 1FT9A 4KDPA 1Z1DA 5D4SA 1DP7P 1W5SA 2ZCWA 4HQMA 1O3RA 2QQAA 2ZFWA 1YYVA 3HRSA 2FMYA 3RJPA 4PZJA 1JHFA 1U8RA 1TTYA 4YFKF 1R5GA 3VOEA 2DLLA 5BPDA 2XGXA 5LRRA 3HIFA 1BIBA 1KU7A 4QWQA 3FF5A 1O57A 3V7SA 1U3EM 1F1ZA 2GZWA 3GUDA 3F22A 1U6GA 1KYZA 5E1XA 1USSA 5JR3A 3F21A 3GXOA 2K4JA 4XSZF 1QZZA 2JRTA 2XAFA 2JT1A 3B73A 4GXOA 2DK5A 3SFZA 1K7AA 3L7WA 4LK1F 1IXSB 1FNNA 3ISPA 4QLCU 3E5XA 3KP2A 3S2WA 2QM3A 2VC1A 1H9TA 1WQ2A 4WWCA 1HXDA 3REOA 4R79A 2QQ9A 4HLYA 2Y75A 1TQPA 5L3FA 1G6NA 3J80K 2C6YA 1YW9A 2KIUA 3WU0A 1FX7A 1OR7A 4OIOF 1G3TA 1H0MA 2ESNA 2O8XA 1IN8A 1QGPA 1QNTA 1L3LA 4UNOA 2MBFA 2B0LA 2PLYA 5E8IA 1TBXA 3DXJF 3WTVC 3FWEA 4KIBA 1AWCA 3LQRA 4RS8A 2ZKZA 2GAUA 2J5OA 1XCBA 5IT9Z 2FSWA 2H6CA 5J8CA 3BY6A 2RKHA 3L09A 5H6RA 2FMLA 3IWZA 4KNYA 3L9FA 3TDZC 3JTHA 1SAXA 2XAJA 5JI6A 2W57A 4HBLA 1JE8A 3QP5A 5L3BA 1S6LA 2PBIA 5L3DA 2V1UA 2HKXA 1IRFA 1OMIA 1CF7A 3NQOA
chains in the Genus database with same CATH superfamily
4GYGA 3J81Z 2RDPA 1TLHB 5LGUA 2A05A 4EQQA 3JTGA 4M9SA 4GYIA 3GEZA 3ZRGA 2ZMEA 3I64A 4I6ZA 3ZMDA 2QA4I 4U88A 2L7MP 3BDDA 4KIFA 2R5ZB 3OYGA 4HDVA 1H8AC 3DCFA 2QVOA 3GLLA 1I50J 2JA2A 5CLSA 1WJCA 4Q47A 1YE9A 5FFXA 3WHBA 3HOVJ 4B4CA 1FBSA 1WCMJ 3CP8A 5GAGJ 4HF2A 3JR9A 4G94A 1Y8RB 2JK3A 4FE7A 5FKKA 3G1MA 5DTDA 1HC8A 3NAUA 4RAFA 1K78B 2V26A 3H5RA 4RBOA 3JREA 4UVCA 3LFUA 1U5TB 4Q5SF 2K4BA 4NB5A 4LG0A 3WTUC 3KP6A 2BHZA 3LSHA 4CZCA 2YR2A 2F6CA 1BOAA 3GFLA 4LLLA 3E6DA 4O5VA 4OIRF 5M5WJ 2CRGA 4I0BA 5CVVA 4XRMA 2JRMA 2CQ7A 3I53A 4KN4X 3P9IA 3L2WA 3EUHC 3FHNA 3IWFA 4LGWA 4M3BA 4PGGA 2KMUA 1G2HA 3PUFA 4L9NA 5D5UB 1JUPA 1R4NB 3HG9A 3X2QH 1X1DA 1ZG5A 2PMZA 3EPZA 4KICA 4XLAA 4G7OF 1LPQA 5H2FC 3CCYA 2GXGA 4A3BJ 3C18A 4V2GA 1OYIA 1W7PD 2ADUA 1VNDA 3GMEA 1I39A 4BXUA 4Q4ZF 3COAC 2DA3A 1IRGA 3OSFA 3I59A 4UVAA 4A3KJ 1WJBA 1ERDA 5C4XJ 1WVRA 2W84A 3QOEA 5CKTA 2DQLA 4B8XA 1ZGWA 3FK7A 5J6XA 1VQ4I 1X19A 1D8JA 3MMYB 2M30A 2L4AA 1WSUA 2W24A 2VN2A 1MH4A 4GRIA 4BQQA 2Q8KA 2O61A 3FXUA 1NHAA 1N78A 2NVQJ 3BR2A 4K2EA 5DEQA 5HS9A 4BHBA 4OINF 4EJUA 4ENKA 3JAMK 1B72B 3CF2A 1YRNB 2EFNA 1RKTA 3H0GJ 1Z3XA 3HHHA 4YEJA 4C9YA 3HTSB 1HOMA 1JXSA 1IN7A 3SXYA 3M9AA 1ETOA 2EILH 3WTZA 3RKQA 4ITVA 3ZQHA 4ZYDA 4YRVA 2EZIA 5K5RA 4XLEA 4XN0A 4IHXA 1VQ5I 4LIUA 3OSGA 3C7JA 3KEOA 2QF7A 2E7XA 3EUAA 2HR3A 5ICCA 1LE8B 1D0YA 2CGPA 3DQVC 4XICA 3LSMA 5ED4A 4PDKA 1BJZA 3BTJA 2ZSIB 1R7JA 1H9GA 1Z77A 3HTUA 2WTEA 1WI9A 3E7LA 1S8NA 3HBLA 4ZH4F 2EV0A 2DDBA 3M1EA 2OJED 4KITB 2X6XA 4CZZA 4CHUA 2DA5A 3VODA 1D0XA 3W2WA 1XB4A 4OAZA 1GDTA 1FYKA 2Z99A 1V5FA 3KP7A 5ILUA 2ZNZA 1OYYA 5E3NA 5IT3A 3E6BA 4MLOA 4R1HA 2NOGA 2EIKH 3GCMA 3KZZA 2XIGA 4XORA 5DCFA 3EETA 3FKJA 5D5WB 2XUBA 3WE2A 2L5QA 1S7AA 2VOPA 2X6OA 1FIAA 1QRYA 4CGZA 5FGMA 3TP3A 2R7WA 2FXAA 5DCMA 5J1RA 1WI3A 2HZTA 1IAWA 1IN4A 4GCVA 1PP8F 4IHTA 2XAGA 3Q0WA 4L0ZB 1EA3A 2Y30A 4GGGA 1USTA 2D1HA 2OZUA 3I55I 4C30A 3GZ5A 5DV5A 3R0AA 5GAEJ 1WJAA 5GTHC 2HU9A 3S3OA 2FJ1A 1V55H 5K7FA 4ABZA 3HL2A 2QGUA 4UUVA 2R7ZJ 2M4KA 1JUMA 5HNFA 4XNFA 2XSDC 3E97A 1IN5A 3L2VA 2K9MA 5K5QA 4HF0A 4BDYA 2FBKA 2A61A 4RGUA 4RMNA 4BHCA 3FK6A 2ZO4A 3KYDB 2XPWA 3WTXC 2DA4A 1ZKGA 4EGYA 4II2A 4I98B 5DD4A 1WPKA 1TL8A 5TGTA 4CUGA 2VOOA 3HOUJ 2L9VA 4CDGA 3IV5A 4M71A 3I4MJ 3BC8A 4NUBA 4ZYGA 5A2QK 4U0VA 2E5ZA 4FTHA 3NWSA 2DMPA 1WH5A 4E7HA 2QZ8A 2CFXA 2VIXA 1XD7A 4HSRA 2QSHX 3J7AY 3ZMVA 1BM9A 5F08A 2COBA 4G8XA 1R9TJ 1QBJA 1ON2A 2DFHA 3LQQA 5KNLA 4KT6A 1P4WA 4LLGF 4XRSA 5FRMA 2Z1DA 5IYBJ 1JUSA 1DDNA 1U8BA 4KISA 2EV5A 5BPIA 2HOEA 3CMEI 1AKHA 2EFWA 3RYRA 3ZOBA 4RB3C 3IKVA 4N0BA 5FKLA 3QRFF 1T2KA 4HQEA 2JTVA 2NYXA 3A0BC 5FLXZ 2V7FA 2HQRA 2A68F 4ASNA 3S3MA 2FUG2 3J7YJ 1UELB 3F6VA 1YQAA 2E1MC 3O8HA 3VEPA 5B5EC 1EJ9A 2QBYB 2LTPA 2OTLI 2HOTA 3U1KA 3RI4A 4HX7A 1FSHA 5FLMJ 3BCBA 5HLHA 2ME6A 3P9KA 2HTJA 1I5ZA 2R7TA 2VKDA 4W1UA 3LA3A 3IAS2 4J00A 2XAUA 2GWRA 3W2AA 4RDUA 3OMYA 2JPBA 1T38A 4XOPA 5DYMA 2CV1A 3S1RJ 2LC2A 3BP8A 1R1TA 4EM2A 4IF4A 1LDDA 3CF5F 4UVBA 3A01B 4IO9F 2F5CA 1FBQA 3WGIA 4XIDA 2P8TA 1IUFA 2MLGA 2O0YA 1TQMA 2GXBA 4DBRA 4Y13A 3JSOA 4B43A 1I6XA 3LWFA 5FB2A 3WG7H 1XTAA 2V1DA 5LBQA 3ERED 2EINH 3BROA 5AONA 2DA6A 3IRRA 3H1CA 1KZHA 4RAZA 2R92J 2GA1A 1RI7A 2WV0A 2F5DA 3IHUA 3KCCA 1R71A 4EVIA 2LH9A 4JP0A 1PUFB 1IO2A 2OCCH 2QUFA 4HDUA 3ECOA 2X1EA 2ZSHB 1NK3P 4O3MA 2OV7A 3BTCA 2DJIA 3ZN1A 3OWTA 2A5YB 3DBHB 1S9HA 4YELA 1X3ZB 3KZYA 1JT0A 3T0YA 1MDMA 3DBLB 3Q3SA 1XCVA 2P81A 2NS8A 1QQIA 3F8FA 4HF1A 4D5FA 3M8FA 3LSRA 3BG5A 2IRFG 3JRGA 5IYDJ 5LLQA 2WAQN 2W00A 2L7FP 2YU9J 3IC7A 2I5UA 2A07F 2VQCA 5TRDA 3MCZA 2P7CB 3CJQB 4IHYA 2TDXA 2VODA 3BJAA 5AIPA 1HSTA 4B09A 2JPCA 4ZYEA 2HGCA 1NTCA 3K2ZA 2EPFA 2KDZA 2WB1N 1E2XA 1X3UA 3CZ6A 1FTZA 4LITA 2OD5A 3CD6I 3F9KA 1BW6A 4M6VA 1ZG1A 1BI2A 3S1QJ 3AG1H 3MAJA 3RIRA 5LHGA 2QQ8A 2IS4A 1KGSA 3CQZJ 2GIVA 2M8EA 2BGCA 4MHGA 4DW6A 2IGKA 1TW2A 3Q9SA 2VASA 3ASNH 2Y0SA 3K4NA 1FLIA 1VZ0A 2RC4A 3BTIA 3A2KA 4JBAA 4BE1A 1WJEA 3W6JB 3R61A 3H3VK 2HXOA 2ISZA 1KU3A 1O4XA 2IXSA 3C2HA 2L9NA 1R00A 3CJNA 2XC7A 1S3JA 4J01A 2LK2A 4NBQA 1YS7A 2P6TA 2YSRA 3H92A 5E3LA 2EK5A 3I3LA 4A0ZA 1S72I 1JGSA 2CJJA 1LDKB 2ID6A 2YS9A 3CUOA 2Y9YA 3CTAA 3M1CA 2HYFA 1Z3YA 2XVCA 2HOSA 2L4MA 3GX4X 4PFOA 4M74A 5CYVA 1BA5A 1P92A 2LD5A 1VQKI 4FHTA 3PQJA 4D5CA 3C3WA 4AM3A 2QSGX 1ETXA 3RPQA 3S2DJ 4B47A 4M3GA 2BXZA 2X1CA 4XL9A 1ACIA 5ICFA 4XKCA 3ZXSA 1IGNA 2K9NA 4KYWA 5AIQA 3BPVA 4G6QA 3ZQLA 1FY7A 2XROA 4PK4A 3EYYA 3KLOA 4BXXJ 3DU5A 2RNJA 3E0JB 1BR2A 3CMYA 3GWZA 1IDYA 1VQ8I 5J1YA 1SFXA 3K4JA 5J40A 3GTKJ 3KYLA 3ZQQA 4OWRB 4G6DA 1MMAA 5CVRA 2A5WA 1BR1A 1W0TA 1DUXC 2HQAA 3O6BB 2IVMA 4G9YA 1IN6A 2HWVA 3R4KA 2AS5F 3Q0UA 4RGRA 5B1BH 5M5XJ 5LHIA 1P7IA 3S8PA 2MLKA 2CUEA 4U7BA 2FE3A 1X4OA 3FM3A 1SD4A 3A4CA 1N75A 1R23A 2L54A 4B44A 5LEJA 4A93J 2ZXIA 4MQVA 1O3QA 1DPRA 1MMNA 1RNLA 3OY9A 1J9IA 2M0CA 1YX3A 3BZKA 2CYYA 2R7QA 1ZARA 2FF4A 3HSRA 3U9GA 3M8JA 1OFCX 1OCRH 4BQOA 4ESBA 1ZRDA 2PJRB 5EZHA 3VYTB 4HNTA 1XS9A 5EJCA 3OYBA 3RKYA 1ZLKA 1KU2A 2R7OA 3OYHA 1B8IB 2DA1A 2KRFA 4OOIA 3DPTA 4C2TA 4KA4A 3OYAA 3HUGB 1WJ5A 1IUYA 2IGOA 5EEGA 3HZJA 4HNVA 1KQ0A 3SZTA 5EG0B 3FXQA 3MKLA 5HDGA 2FBIA 3CUQA 1RUOA 2DOAA 4S0HB 3ZGKA 5HOOA 1UFMA 4LB5A 3OV8A 1TW3A 2DMUA 1UCRA 4KT5C 4CXFA 3BR3A 3J81K 3ONQA 1Z7UA 3BR5A 1SVOA 2MC4A 2JA7J 5HLTA 2IW5A 2PMZN 2OQGA 4O6JA 2MW8A 2K9SA 4WXHA 2STTA 4FQGA 4AVZA 1HCRA 2LREA 3CCRI 5DUKA 2OBPA 2E5NA 1SC7A 2MC3A 1V3FA 2OA4A 1IW7F 1G3WA 1BIAA 3K4BA 6PAXA 3HOXJ 3R60A 1LVAA 3HRMA 3GLXA 2BY2A 2VBZA 2NNYA 1Z05A 1W7PA 1OCPA 2HYJA 4W97A 3KFWX 3WGHA 2Z2SB 4IOAF 2Z5UA 2WADA 3EUHA 4D1QA 3RZOJ 3ZP5A 3KYCB 5JLXA 3ZR8X 3KP4A 1YFHA 2DODA 1EV7A 4FCYA 3FISA 4DOZA 3P5JA 5D4RA 1QVUA 4A3LJ 1I6HJ 3ZCOA 2Y0MA 1AU7A 3GZNB 2QCOA 4OAYA 1XSDA 4CYCA 4BJ5C 1YJWI 1BW5A 2Y9ZA 2O03A 4IHWA 2EIJH 4HSTA 5HS8A 4IPAA 4PCQA 4UV9A 1BI0A 3WU1B 2QYOA 2ELJA 1EKEA 2LMDA 5KCMA 1F4KA 3KE2A 2PG4A 5D6FA 2JA5J 1U5TC 2ZB9A 1SVMA 1Y56A 4CH7A 5LFAA 1BR4A 3BJOA 2LRDA 4IRIA 4ZC3A 4Q48A 3G1OA 2JN6A 4NQWA 1GVJA 2FX0A 2QKMB 2GBYA 2VT2A 2E1CA 4M3FA 4XKWA 1FP2A 2V1XA 4B48A 3DU6A 4AYBA 1POGA 2RV8A 4DQ2A 4BNCA 4GO1A 3T8RA 2LF7A 2STWA 2JA8J 1MBFA 3OYJA 4YIRX 2CV0A 5JFRA 4RB1A 5HS7A 1K83J 4C2MJ 4QSHA 3FHZA 4L5IA 4CYDA 3K7AJ 1I1SA 1V54H 2MABA 2WC2A 4HLXA 3DLAA 4M9ZA 5HLGA 2PI0A 2RNGA 2IBDA 2K7LA 2HYGD 4H4KC 4BE2A 1JHHA 2WAFA 3DF8A 2R5YB 2NS0A 2DAOA 2JVGA 4MEXF 1U9OA 2XGDA 2NNNA 4JOMA 2FNAA 2DOFA 3DP7A 5CVJA 5CJ9A 1X1PA 5BMZA 4LJZF 1A04A 4FX0A 4AIJA 2CV2A 2KISA 2KZVA 1A6IA 1UZCA 1CQTA 2XHKA 3CC4I 2ELHA 2DFEA 5E18F 5DUIA 4E7JA 3BPXA 3OS2A 1MMGA 1IC8A 1FSEA 2KRCA 1EH8A 2ESHA 2FD5A 2FQ3A 5F64A 2CW0F 2KDOA 1SEUA 1VQ9I 3KEYA 2X0LA 3HPHA 4PFPA 3ZMSA 3VSKA 1RUNA 1A5JA 5FJ8J 4DIQA 1LEBA 5FRNA 1ZLJA 5FLVA 1MNEA 2BEOA 4LB6B 4MO7A 1ZRCA 4HW0A 1T0FC 4JQFA 1WGXA 1X4PA 4B3XA 2W1OA 1W36C 1TT5B 2M34A 3QYBA 1AHDP 2AQEA 1Z91A 1O3TA 1YW8A 5E8GA 4A3EJ 5F0FA 1B59A 3K4MA 3JRBA 2R0QC 3G6EI 4JK1X 3PO2J 2QSFX 4OMZA 1GVDA 2DFIA 2LSOA 4MIMA 3M4OJ 4I7HA 4XRFA 3S3NA 2DT6A 5H6QA 3HYIA 1TQIA 3S1MJ 2EB7A 3GTJJ 2P0WA 4BBRJ 1DP3A 1Y6IA 3I0TA 1KQ9A 4EGZA 3B02A 4YFNF 2AXLA 1U2WA 1S7OA 2L7ZA 2I10A 3PNVA 3TKYA 2VKHA 2KIFA 3PIPF 2W82A 4M9XA 4RGSA 2VONA 4XN3A 3L2RA 1D5VA 4AWXB 2LNBA 4Y17A 1QZYA 4XMYA 3F8BA 1YIOA 4HZFA 5JHUA 3NWTA 2D5VA 2O8KA 4QPQA 3F23A 4IX7A 3MN2A 1ENHA 2F5VA 3RPUD 2X4HA 2NS7A 4UUSA 2X6WA 4MTEA 4ZDPA 1ITYA 4BDZA 1ZYRF 4G7HF 5BQTA 2RN7A 2H8RA 4TV7A 5F0HA 2K3FA 3GFMA 4GDFA 1JT6A 3FMSA 1OJLA 4NHJA 3OYLA 1IZ1A 4RLQA 3IAM2 4HOBA 2OCEA 4D0PA 2UWMA 1V4RA 2QQBA 1OCTC 3HOYJ 4UHTA 2YX7A 2CU7A 2V9KA 2RGVA 2XGEA 3RQIA 2NOJB 3D0SA 3F6OA 3J7ZI 2LY1A 2X48A 4M3DA 4X1EA 4BY1J 3HM5A 4XBFA 2EA4A 2IGNA 5IPAA 5EF6A 1RPWA 3PNTA 4F91B 2L3DA 1MH3A 2VJIA 3DEWA 5DM7F 3NRVA 3LAJA 2NVXJ 3BG6A 4LG3A 4AVPA 2R3SA 4ETSA 1FMWA 4A3GJ 3VB2A 1SFOJ 5FLXK 1ZAOA 2L0KA 4LLNA 5BOXA 4BEHB 3E5UA 2OU2A 1UHSA 2KRHA 4Y15A 3UNGC 1TC3C 1JKRC 1ZH5A 2V79A 1MGTA 4FT8A 1OQYA 2ZMEC 3PFIA 3K4KA 5K5OA 1J0RA 4EATA 2KIMA 3JRHA 2OZ6A 1YHQI 3ROUA 3V7RA 4L9VA 3SQNA 2OQRA 2VE9A 1JTYA 4IXAA 3TP0A 1HBXG 5JHFA 1W4MA 5F0CA 5E1ZB 2IAIA 2MSYA 3F3XA 3B6CA 4C3JJ 2A69F 1Y1WJ 1S5LC 2VI6A 4IVNA 3I54A 3PNYA 2GA2A 1X1BA 4IJAA 1Z7LA 1Z0XA 4A2UA 2EH3A 3VWBA 3SHFA 1B9NA 4IOCF 1Y8QB 2BBYA 2D2WA 3IP4B 2X51A 3BZ6A 3S93A 3H3ZA 3H3UA 1KONA 3ML6A 1ZQ3P 3N05A 2HVSA 5FD6A 1TNSA 1MKMA 2GM4A 4ON0A 4I02A 3HOTA 1R4MB 3QP6A 1G8XA 2L01A 3CCEI 3S14J 1ZGJA 2Q2EA 3CMAI 2K40A 2MH2A 3QQAA 5BS6A 1STZA 1MNDA 1WKMA 4P5OA 3ESWB 1K4SA 3QU3A 4BKXA 4HA8A 2PJPA 2E60A 4BY7J 3IH4A 4P96A 1QVTA 2E71A 2UV1A 1F9NA 1FYMA 2G9WA 4UUTA 2KZGA 3MZHA 1ZHFA 4UB6C 2QKLB 1HW5A 3GFIA 2DQRA 4CO8A 3SYTA 3U2RA 2BOLA 2Y0SN 4H0EA 3LMMA 3FMRA 3RCOA 1T6SA 3V7CA 5HVQC 2CFOA 1FBUA 1LEAA 3FMQA 3ECHA 3CC7I 4P9FA 3WODF 2O9LA 2A6TA 2JJ7A 3LSPA 2CSOA 1YG2A 2YX4A 2M0MA 3H9GA 4ZJZA 3ERMA 3JCUC 3I56I 1I1GA 2VBXA 4MNUA 5BNGA 1O7LA 1K6YA 4HRIA 2BE5F 4Y33A 3QPHA 4IRGA 2COMA 4OMYA 5LGTA 3JAMZ 2K3PA 2ZJRF 2IEKA 3KP3A 1CF7B 1HKTA 1RKWA 2IPQX 3CP2A 2F2EA 4BGDA 3ZMZA 2EIMH 1K61A 3OYEA 1F5TA 2KQRA 2VC0A 2W85A 2ZMEB 4WK8F 3DTIA 3TL4X 1LQ1A 3SZGA 5FROA 3ZMTA 3ZN0A 2CMPA 4RB0A 1E3PA 3PSIA 3PL8A 5F1JA 3IL2A 3PM1A 4LFUA 1ZR4A 1SD6A 1YOVB 1UHMA 3HC7A 3CO6C 2MD5A 3MD2A 4KIGA 2AXTC 4ESFA 2F48A 3B6AA 3FXKA 4XR6A 4HV5A 2VKVA 1IV8A 1LNWA 2E35A 5E3MA 2KIQA 5IP9J 1OCZH 5JVTA 4X6AJ 1UHWA 2VL8A 1J09A 2A6EF 5FKNA 3GTOJ 4E7LA 3WHCA 1FYLA 3I71A 1V5EA 2VPRA 1JKPC 4LG0B 3FZVA 3OOPA 2BY3A 2EQRA 5E17F 3MFKA 4E6KG 5HDKA 2O6GE 4LIVA 5E79C 1YW7A 4I0AA 1AA7A 3L1PA 1U0JA 3QYFA 2EZHA 1E17A 1R5HA 2XASA 4FETA 3W3CA 3I5UA 4HAMA 4YIFA 3ULQB 3OYKA 2R7VA 1ODDA 4ENJA 2BXYA 3N4MA 4ZDOA 1HKSA 3GF2A 1OYWA 3H5AA 3KETA 1CGPA 3Q5FA 3BWGA 1OLTA 2IGMA 1BN5A 2WBMA 3JRFA 3K9TA 4YG2F 1ULYA 4PJNA 5L3EA 2VXDA 4PSXA 1WRJA 3WTTC 3I59B 1JI8A 1I3AA 4ESJA 1SD7A 2X6YA 2V4JC 3D5SC 5ICEA 2AQFA 2W25A 4KMUX 1D0ZA 1B6AA 3H36A 4KUMA 3RDIA 1X1AA 3HKZA 4A3CJ 2MH9A 3OL4A 2M9HA 1FPQA 4PJ0C 5TISC 3FIWA 3BQYA 3PFYA 3OS0A 4CCNA 3H5NA 3Q0VA 3PQKA 3KZIC 4ZTJA 2LBFA 5EGOA 1XGOA 2Q1ZB 1MW7A 1YIJI 1R1VA 2TCTA 4XM3A 4E4HA 4F55A 1TT0A 2BW3A 2Y48A 2RQPA 2FBHA 1D1AA 1ZREA 1XDUA 5HDNA 1GXQA 1TWFJ 5ILSA 4BHPA 2Z3YA 2JSCA 4F7ZA 1EH6A 2X85A 2R7XA 4F92B 4ZDLA 4AC0A 3S16J 1BI3A 4CCOA 2QENA 3E5QA 3G73A 1P7JA 4M6XA 3DEUA 1ETVA 3EDPA 1SFEA 4LMYA 2WY7Q 3JW4A 3FX3A 2HPMA 5ERIA 1IG7A 1SVLA 1MBEA 4U0WA 5LRSA 2DN0A 1MZBA 1ZTRA 2H8WA 2G0EA 1XGMA 1P9QC 2R7DA 2R93J 4RA2A 3I4NJ 1SMYF 3TO6A 1IF1A 2R5ZA 1XGSA 4XLPF 2A3SA 2PX9A 3K4LA 4N9HA 2R7FA 3ZQIA 4BH9A 1UG0A 3J7AO 3CLQA 4AYBN 2XF7A 3V42A 1XMAA 3K1PA 3ASOH 4BBSJ 1ETQA 5IOYA 3S1NJ 3KPHA 3QAHA 4B1RA 4AIHA 3CCUI 2XKOA 3K1MA 3TGNA 5EZGA 5CQGA 1A6QA 1MMSA 3HEFA 4A0YA 1QO0D 1ON1A 1K78A 1NG6A 1B1BA 5J47A 2H27A 3LAPA 3HOZJ 1NG7A 3VYRB 4WF2A 3LSJA 1U5TA 3QU6A 2WV1A 3BT9A 1MSFC 4C3HJ 1JTXA 2BZTA 2CUJA 5DCMB 4BJTA 2M1BA 3ZPLA 1QPIA 3NARA 5E1WA 3O2PE 2O3FA 3PUBA 4P9UA 2PN6A 5D5XB 4PJLA 3GBGA 2O7OA 3BLYA 4A69C 4J19A 2J5PA 1BL0A 3TQNA 1TP4A 2M3AA 2W4SA 2MA3A 2HDCA 1YO5C 2EFPA 3BQZA 2D45A 3RTRA 3V8LA 3CCSI 4OU0A 5IT9K 2Q0OA 2H09A 4V19K 3IRQA 1ZRFA 4BQAA 1Z21A 2MD0A 4B3AA 4EM0B 1MNMC 1J75A 3BJ6A 1HSJA 3K4CA 4XOTA 5FO5A 2BVMA 3UKGA 3BOQA 1R22A 3IH3A 3GTQJ 5JLWA 2KFDA 3T1BA 1MMDA 3SDGA 2PMHA 1FOXA 4F93B 1GT0C 1XX5A 2EFOA 2ME0A 3OL3A 3V4GA 2XAHA 4ZZLA 4LK0F 2A6HF 3TDUC 3FXMA 2JVHA 2PFBA 4ZYAA 1TWAJ 1LDJA 3VYSB 1LUJB 2K85A 3L2UA 1GHCA 4WXCA 2ICWG 4XQFA 5F6FA 3BTLA 2LY9A 3BR0A 1FP1D 3JRDA 1N77A 3ZMUA 2HDWA 1B72A 1YRNA 2E36A 2P7VB 1T95A 1Y39A 1XSXA 3OR2C 1JGGA 2F5FA 1U78A 3DBRB 2GOMA 2LLKA 2M5WA 3M7GA 1GXPA 1AKHB 4KMFA 2MG4A 3MEXA 2B63J 2P4WA 2X1DA 4AIKA 1DGRM 3H0DA 2CQXA 2VJJA 3CMMA 4EMSA 3K70C 3C2BA 3H35A 4YIIA 1X1CA 1VTNC 2NVUB 4CCJA 2HZDA 1LE8A 4HX8A 3QYEA 1IV6A 1ZG3A 1T0FA 1P4AA 5LD2C 3ZQGA 3DKWA 2OTJI 3K0LA 1RZ4A 3NEUA 3PJRA 3MZYA 2XB5A 3IH2A 3ZQCA 3QPSA 5L3CA 5F27A 1O7FA 1UG2A 4FISA 2HOAA 3HPGA 1SD5A 2DTZA 2KT0A 2K86A 2XB0X 2K9QA 3AG2H 2XGCA 2DW4A 2WY8Q 1BC8C 4AU7A 2VT3A 2KLOA 2HKOA 1WHUA 4WCGA 2FOWA 2M7BA 3KEQA 4L5EA 4XKVA 1XC5A 4N9IA 2N8GA 4L18B 2KPMA 3RPUA 1VQNI 4AD9A 4MGRA 4ZYHA 3RKXA 2M4GA 3MVPA 3I58A 2Y2ZA 1ZGAA 4ENMA 2YUSA 5FD5A 1YLFA 3N97A 3FBIB 4RAYA 1HF0A 3TOAA 2DU9A 5CVIA 5DM6F 1YTYA 1P2FA 3HHGA 3LSTA 4LD5A 4F52A 3JSPA 2QWWA 2ETHA 3AL0B 1E3HA 1SFKA 1Z6TA 3HXLA 2M87A 1XDSA 4EJOA 3WGGA 1G3SA 3EYIA 3V8JA 3JRAA 4XONA 3PSFA 4P55A 4PJJA 3D5RC 3S15J 1MDMB 3C2GA 4E70A 3VDXA 5F04A 1RC9A 3CLOA 5K7ZA 3OIOA 3VSLA 1QZEA 2EBIA 2WA0A 3I9V2 3VFZA 2XRNA 5TJJA 4DZPA 5EYRA 5GTIC 3P7NA 1FOKA 1A36A 3A1YA 2VQGA 3ELKA 3TEDA 4G6TB 1LKXA 1XGNA 1JKOC 1P4XA 2Z16A 3DV8A 3DPUA 4IRHA 1PJRA 1UB9A 1M1EB 2LFBA 3O3KA 2MFZA 1VQ6I 5EEAA 2WAEA 3HOWJ 2V1NA 2UXXA 1OISA 1Y1VJ 3A02A 2LDUA 1HW2A 1R49A 3DLLF 2CH0A 5J8FA 1MJ9A 1UAAA 2DT7B 3DKYA 4I76A 3CESA 4A3MJ 5FKOA 1X2NA 4R8HA 5J4YA 2IA0A 3E6CC 4V2FA 5D8LB 3HGGA 2E1NA 2L9SA 2HS5A 3TOBA 2BY0A 3K1NA 2VQHA 9ANTA 1APLC 1G59A 3G3ZA 1IRXA 2CWEA 2M2EA 3CUQC 2D1VA 2EWNA 4QPOA 3WTWC 2BVLA 5ICGA 4ENNA 1G4DA 2EFQA 5CPRB 4RM3A 1XMXA 5DD8A 3J80Z 2DT5A 2QBYA 2F4OB 3P9CA 2XV4S 1V5GA 2BYVE 3FXOA 4HEA2 4PUSA 2HTSA 4BL0B 3SDBA 3G71I 2ISYA 1L0OC 2P6SA 2VKEA 1BOBA 1YJNI 3E3VA 2BV6A 1PP7U 2XSJC 3DWLE 4Y3OA 2DYSH 2CW7A 2ECCA 1KU9A 1TWCJ 4BYYA 1JJ6C 2CQQA 1HKQA 1RR7A 3TBIA 1W36D 4EJWA 3CDLA 1F43A 5E20A 3FM5A 3EQLF 3QWLA 1A35A 1DPUA 4A6EA 4XRSG 2EZKA 5EDNA 1OR7C 1ONVA 3A01A 3K10A 3DFGA 5J4VA 2YU3A 2G7UA 2CS3A 2R4GA 2CQNA 3GTGJ 2DPUA 3HSFA 1PVEA 4BU2A 3SZPA 1DGWY 3GW2A 3W6KB 1K79A 3RYPA 4U7DA 1MBHA 4MFEA 3DKXA 3WTYC 3SEZA 3WU2C 1VFCA 2JZYA 3RSNA 3E6MA 1ZK8A 4XSXF 2ZJ2A 2FOKA 2R7RA 1TNTA 1PUFA 4MEYF 4RB2C 2OPTA 5F1RA 3A03A 1A31A 1XSVA 4FASD 3MWMA 1FEXA 1QHGA 4JYKA 4DYQA 3F8NA 5D5VB 4M3EA 1RIOH 1AOYA 1XG1A 2VPLA 1REPC 2ZXJA 2W7NA 3SFIA 3TO7A 1VQOI 4L5JA 3CO7C 3CCVI 1JKQC 3S32A 2ZNYA 2CUZA 2XF6A 1ZR2A 3CUQB 2RVCA 2HXIA 1J2XA 3CC2I 3V8KA 5KAIC 3AKZA 4DNCA 1VQMI 4I99C 2DMTA 3OYDA 4IQ4A 2V9VA 2P5KA 4L9JA 1EH7A 2UZKA 2UXNA 4HYEA 4Y4RA 4JX4A 2ELKA 2Y31A 1P6RA 3C1DA 3BG9A 4XLNF 3SEQA 4CSWA 4HNUA 5IP7J 3GTLJ 3OR1C 1FZPB 1D8KA 4F3QA 2Z33A 3AG4H 1VQLI 1YITI 3WTSC 2DDAA 4A0XA 3BG3A 4N4OB 1MJBA 3DTEA 5KHDA 4CCKA 4NC6A 3CDIA 1QHHD 1IXRC 4IQJA 2JA6J 3RKWA 4U0YA 2E2JJ 1W7PB 4KFCA 3ABUA 2XPUA 2XF5A 1IRZA 3HKZN 1NK2P 1BI1A 3HSEA 4DBQA 3U1DA 2VBYA 3QODA 4BE0A 4BACA 1XN7A 3U21A 3LFKA 2AHQA 1FWZA 2M45A 4M73A 4CYCB 2ZC2A 5CQEA 2HVQA 3PIOF 1R6RA 3W6VA 4XK4A 4BAYA 2XDVA 4UXNA 5L3GA 2F4IA 5DDGA 3F72A 1DU0A 3I4PA 4I09A 1J5YA 1S29A 3K6GA 2PMUA 1XPXA 2YPRA 2E2HJ 2DO7A 3HOSA 2DI3A 4EJVA 4RGXA 1KYWA 3ABTA 1T98A 1WJFA 2XAQA 3LNQA 2HEOA 2IS1A 1X58A 4NQWB 3S17J 3JRCA 3GTMJ 2K02A 2L02A 1PDNC 3G1LA 2JUGA 1R36A 3D5LA 4PGHA 5LEKA 2KKOA 1BC7C 1QA6A 3T8TA 2BHYA 2FQ4A 3T5XA 2P5LC 1O3SA 4I2OA 1OPCA 3E1SA 4HPQA 5H20A 3GFJA 3R6SA 4BJ6C 4A5NA 2LKXA 4RM2A 3BZCA 3CJTB 2MGQA 4JX6A 3K69A 1WZ2A 4ANJA 5HLIA 4PJMA 2NAZA 2E2IJ 4OIPF 2IP2A 2B9SA 2K9LA 3OIPA 2FU4A 5LGNA 5GPCA 5M5YJ 4MTDA 3KX2A 3CDHA 1DU6A 4KN7X 5HNHA 3WE3A 5K1YA 3TW6A 3KLNA 2CG4A 4BQNA 3F8MA 2PJRA 4A5MA 4C2UA 2FA5A 3PO3J 3QPTA 4A6DA 4IHSA 2EJRA 3HJEA 4D7NA 2F4MB 3LA2A 1B8IA 1E0EA 2JWTA 1C0WA 3HUGA 3OYIA 4EM1A 2P5VA 3KP5A 5EG0A 3GYHX 3OS1A 4DYRA 3MKYB 2E7WA 1Z9CA 2E1OA 1ETKA 4DYCA 5JVGF 4A3FJ 2PEXA 1QPMA 3H9QA 2CW8A 4II3A 4G7ZF 1U9NA 5GP9A 5ILVA 5FFZA 1E3OC 2CQKA 5GAHJ 4I01A 2L7KA 3BR1A 2V9PA 3OYMA 4M72A 3G2BA 3ZQFA 2HNHA 3Q9VA 1LFUP 3RQ4A 1ETYA 2KP6A 5HODA 2DK8A 5K7HA 1XMKA 3F8CA 2LF8A 3GZ6A 4OIQF 2EA2A 4G12A 1J7KA 1SMTA 1OKRA 1LFPA 1ZN2A 3FXRA 3BCAA 2H1LA 2IA1A 3GVAA 4ZZDA 2NRAC 4L0YB 2IJLA 5IOZA 1PUEE 4NC8A 3HGYA 2VXZA 2IS6A 4C3IJ 2PQ8A 2QLZA 4S04A 1B4AA 1T56A 3GO5A 3HRTA 4XKBA 1G3YA 2DCEA 1B9MA 3TO9A 1X3WB 2K27A 3ABKH 2R7UA 5M3FJ 3L00A 2LOOA 2FNPA 1GUUA 2KJBA 1MJAA 1T33A 3ZQ7A 2KJCA 1YI2I 2F5EA 1GV2A 4CICA 1H88C 2GIZA 1LVKA 2DFFA 2E19A 2RREA 2XRLA 1MD0A 3WG9A 3VYUB 4HG2A 1R58A 1MBGA 2HI3A 3A0HC 4U87A 4XLFA 2OAZA 4HV6A 4GFBA 1IXCA 2XKPA 1SFUA 1BJAA 3AG3H 4BS9A 2K5CA 2V6CA 3LSKA 5LHHA 3DPLC 4WXDA 2VBWA 4A3JJ 1GV5A 4MFDA 5EEHA 4FE4A 1WWXA 2IS2A 1FIPA 3FDYA 3H9JA 4YFXF 4UUSB 4ZTFA 1T39A 4EV0A 5KAFC 5D6EA 1RR8C 4A12A 1LB2A 1PYVA 4HX4A 3OIQA 2KL4A 2LKPA 3M07A 1T08B 3AAFA 2JMWA 2VJ4A 2WWYA 3GTPJ 4DGWB 1Z67A 1W5TA 4UV8A 5GPAA 2V6EA 5GADJ 4E7IA 1N25A 2ACJA 3HRUA 3CCLI 5A2QZ 5KK1A 4RLFA 2HQNA 2OC6A 1LJ9A 3L2CA 3SJMA 1BBYA 1KQ8A 1Y0UA 5CVUA 2DJNA 2TRTA 3HDDA 2LP0A 2R5YA 3M8EA 2IA2A 3R0JA 2Y69H 1S7EA 1K6OA 2IT0A 2MYSA 5M3MJ 1Z6RA 3D1NI 3G4SI 2E1MB 3OYNA 2G7HA 3IKTA 1IDZA 5KVRA 3F0CA 2DXIA 4QIWN 1TWHJ 2JQ7A 1RESA 1RETA 4CCLA 2HVRA 4BUPA 4EEFG 4IZZA 1GLNA 2GXAA 2DMQA 1HW1A 2I8DA 2UUZA 2X9DA 3ABLH 1D3YA 1FC3A 2DTRA 2FEZA 2GLOA 1YS6A 2GQQA 2H94A 2VB6A 3O8GA 4FX4A 2FRHA 2DYRH 1J59A 2LYCA 4RAGA 2CO5A 2NVTJ 1HA8A 3EUKL 1X2MA 2H6BA 2DPDA 4M6YA 2HFHA 4MQ9F 4WX9A 3M3YJ 3FKIJ 4L9TA 5D8KB 2ZBKA 3TW7A 2XPVA 2DBBA 1KA8A 4Z2YA 2NVYJ 4XLCA 2HDDA 5C3EJ 2DMNA 4S05A 1SAUA 3L2QA 5C4JJ 1VQPI 2JSPA 3QOPA 1Q1HA 3TMOA 3MQ0A 2VE8A 2Z9OA 1R1UA 1HQCA 2EV6A 2L2OA 5B3SH 2M8GX 1I27A 4A3IJ 2LKSA 4JX5A 2ZFUA 5J1UA 3JRIA 2RQQA 4CCMA 3LA7A 4QTRA 4EJTA 1FT9A 4KDPA 1Z1DA 2QEXI 4NDLA 5D4SA 3VPRA 1DP7P 2DA7A 1MBKA 1W5SA 2ZCWA 4HQMA 4Y7NJ 1O3RA 2QQAA 2ZFWA 1FMVA 5E3OA 4UY8I 2Q2EB 1ETWA 1YYVA 3HRSA 5IY5H 2FMYA 3RJPA 4Z6YA 1TZLA 4PZJA 1JHFA 1YX5A 1U8RA 1D5YA 1TTYA 4YFKF 3LOCA 1W0UA 1R5GA 4N4NB 2ZXWH 3VOEA 1K4TA 3AFHA 3DTKA 2CUFA 2DLLA 2NXNB 3OYCA 5BPDA 2XGXA 1D1BA 2M7AA 4E7KA 5LRRA 5B66C 4NNJA 1VF9A 1H89C 3HIFA 4LOCA 1FOYA 1BIBA 1KU7A 2HQ5A 2E34A 4D7MA 3AL0C 4QWQA 2B7EA 5B1AH 1JJ8C 2DOEA 3FF5A 3LL7A 1O57A 3V7SA 1U3EM 1WH7A 3ABMH 4IEJA 2OF7A 2ZXHA 4A3DJ 1F1ZA 2GZWA 3GUDA 5FKMA 3F22A 5IP6A 1U6GA 1F36A 3DEEA 1KYZA 5E1XA 1MBJA 1FTTA 1USSA 1OCCH 3MKWB 5JR3A 3F21A 3GXOA 4NC7A 2K4JA 4XSZF 1QZZA 2JRTA 2KHMA 2JT1A 2XAFA 3B73A 4GXOA 2DK5A 3SFZA 1LFBA 1Y0NA 1VI0A 1DQUA 4BXFA 1K7AA 1HDPA 2L9RA 3L7WA 4LK1F 1IXSB 4XLHA 1FNNA 3ISPA 4QLCU 2R7SA 3E5XA 3FXLA 3KP2A 4D9JA 2VLAA 2VQLA 3OOUA 2QM3A 3S2WA 2VC1A 2RAEA 1H9TA 1TWGJ 1HDDC 4CA0A 1WQ2A 3K70D 4WWCA 1FJLA 2BY1A 1HXDA 2HPIA 1ORKA 1W1WE 3IUOA 4IHVA 3REOA 4R79A 4BEHA 2QQ9A 4HLYA 2Y75A 1TQPA 5L3FA 1G6NA 3J80K 1IJWC 1ZELA 2JUCA 2VJ5A 2WAQA 1WJDA 3UR3C 4E7SA 2C6YA 1YW9A 2KIUA 3WU0A 1FX7A 5C44J 1OR7A 3BR6A 4OIOF 2H1KA 1T8IA 3CJRB 1G3TA 3FBNB 1H0MA 2DA2A 3K2AA 2ESNA 3FXJA 2O8XA 3MKZA 1IN8A 1QGPA 3S2HJ 2ECBA 3BG7A 2WB1A 5IYCJ 3W2VA 1QNTA 1L3LA 4UNOA 1MSEC 4AIDA 2LG4A 2MBFA 2B0LA 2PLYA 2OUMA 5E8IA 1TBXA 2LVSA 3DXJF 4DJAA 2ZJPF 3WTVC 3LSGA 2LR8A 3FWEA 2LY2A 4KIBA 2ZJQF 1RRJA 1AWCA 3LQRA 4PSWA 4IKFA 2AO9A 4KJZA 1WFXA 4RS8A 1YJ9I 1OCOH 3HB9A 1NH3A 1VQ7I 2ZKZA 5DS9A 2GAUA 2J5OA 2O5RA 5J3LA 1Q1VA 1XCBA 5IT9Z 3CCMI 1D1CA 2FSWA 1EF4A 2VUMJ 4DZJA 4E7ZA 2ID3A 1UMQA 2H6CA 2LBFB 5J8CA 5EGOB 3RZDJ 3BY6A 2RKHA 3CCJI 3MZ8A 4IL6C 3LSIA 1W5CC 3L09A 2GOXB 5H6RA 2FMLA 1R5ID 4UB8C 1SANA 4X0GA 2BW3B 3IWZA 1MIJA 4KNYA 3L9FA 3TDZC 3JTHA 1SAXA 2XAJA 5JI6A 1QU3A 2W48A 2W57A 4HBLA 1JE8A 3QP5A 5L3BA 1S6LA 2PBIA 3OYFA 4P1WA 2EZLA 1I3QJ 5L3DA 2V1UA 1HLVA 4Y52J 1FOWA 2HKXA 1UJ8A 3CCQI 1IRFA 1OMIA 1CF7A 3NQOA 4AUXA 3QPLA 3KIOA
chains in the Genus database with same CATH topology
4GYGA 3J81Z 2RDPA 1TLHB 5LGUA 4EQQA 3JTGA 4M9SA 4GYIA 3GEZA 2ZMEA 3I64A 3ZMDA 4U88A 3BDDA 4KIFA 4HDVA 2QVOA 5CLSA 4Q47A 5FFXA 1FBSA 4HF2A 4G94A 1K78B 4UVCA 1U5TB 4Q5SF 2K4BA 4NB5A 4LG0A 3WTUC 3KP6A 2YR2A 1BOAA 3GFLA 4LLLA 3E6DA 4O5VA 4OIRF 4I0BA 5CVVA 3I53A 4KN4X 3P9IA 4LGWA 3IWFA 4PGGA 4L9NA 5D5UB 1ZG5A 4KICA 4G7OF 2GXGA 3C18A 1OYIA 1W7PD 2ADUA 4BXUA 4Q4ZF 3COAC 1IRGA 3I59A 4UVAA 2W84A 2DQLA 4B8XA 5J6XA 1D8JA 2M30A 2L4AA 1WSUA 2W24A 2VN2A 2Q8KA 2O61A 3FXUA 1NHAA 4K2EA 5DEQA 5HS9A 4BHBA 4OINF 4EJUA 4ENKA 3JAMK 2EFNA 3HHHA 3HTSB 1JXSA 1IN7A 3SXYA 3M9AA 3WTZA 4ZYDA 5K5RA 3C7JA 3KEOA 2E7XA 2HR3A 5ICCA 2CGPA 3DQVC 5ED4A 4PDKA 1R7JA 1H9GA 3HTUA 2WTEA 1WI9A 1S8NA 4ZH4F 2EV0A 3M1EA 4CZZA 4CHUA 3VODA 1XB4A 1FYKA 2Z99A 3KP7A 5ILUA 2ZNZA 1OYYA 5IT3A 3E6BA 4R1HA 3KZZA 2XIGA 5DCFA 3EETA 5D5WB 2XUBA 3WE2A 1S7AA 2VOPA 4CGZA 5FGMA 2FXAA 5DCMA 2HZTA 1IAWA 1IN4A 4GCVA 1PP8F 4IHTA 2XAGA 4L0ZB 4GGGA 1USTA 2D1HA 2OZUA 3GZ5A 5DV5A 3R0AA 4UUVA 3E97A 1IN5A 5K5QA 4HF0A 2FBKA 2A61A 4RGUA 4BHCA 2ZO4A 3WTXC 4EGYA 4I98B 5DD4A 2VOOA 4CDGA 4M71A 4ZYGA 5A2QK 4U0VA 2QZ8A 2CFXA 1XD7A 3ZMVA 1BM9A 1QBJA 4G8XA 1ON2A 3LQQA 1P4WA 4LLGF 1DDNA 2EV5A 5BPIA 2HOEA 2EFWA 3RYRA 4RB3C 3IKVA 4N0BA 3QRFF 1T2KA 4HQEA 2JTVA 2NYXA 5FLXZ 2HQRA 2A68F 4ASNA 3F6VA 1YQAA 3VEPA 2QBYB 3RI4A 4HX7A 1FSHA 5HLHA 3P9KA 2HTJA 1I5ZA 3LA3A 2GWRA 2JPBA 1T38A 5DYMA 3BP8A 1R1TA 4EM2A 4IF4A 1LDDA 4UVBA 2F5CA 1FBQA 3WGIA 2P8TA 2MLGA 2O0YA 1TQMA 2GXBA 4Y13A 3JSOA 1I6XA 3LWFA 5FB2A 2V1DA 5LBQA 3ERED 3BROA 5AONA 3IRRA 4RAZA 2GA1A 1RI7A 2WV0A 2F5DA 3IHUA 3KCCA 4EVIA 2QUFA 4HDUA 3ECOA 4O3MA 3ZN1A 2A5YB 3KZYA 3T0YA 1MDMA 1XCVA 1QQIA 3F8FA 4HF1A 3M8FA 2IRFG 5LLQA 3IC7A 2A07F 5TRDA 3MCZA 2P7CB 2TDXA 2VODA 3BJAA 5AIPA 1HSTA 4B09A 2JPCA 4ZYEA 2HGCA 3K2ZA 1E2XA 1X3UA 2OD5A 1ZG1A 1BI2A 3MAJA 3RIRA 5LHGA 1KGSA 2GIVA 2M8EA 2BGCA 4MHGA 1TW2A 3Q9SA 1FLIA 2RC4A 4JBAA 3W6JB 3R61A 2ISZA 1KU3A 1R00A 3CJNA 1S3JA 1YS7A 2P6TA 2YSRA 3H92A 2EK5A 4A0ZA 1JGSA 3CUOA 1LDKB 3CTAA 2HYFA 2XVCA 2L4MA 3GX4X 4M74A 5CYVA 1P92A 4FHTA 3PQJA 3C3WA 3RPQA 5ICFA 4KYWA 5AIQA 3BPVA 4G6QA 1FY7A 2XROA 3EYYA 3KLOA 2RNJA 3GWZA 1SFXA 4G6DA 5CVRA 1DUXC 3O6BB 2IVMA 4G9YA 1IN6A 2HWVA 3R4KA 2AS5F 4RGRA 5LHIA 2MLKA 4U7BA 2FE3A 3FM3A 1SD4A 1R23A 5LEJA 2L54A 1O3QA 4MQVA 1DPRA 1RNLA 1J9IA 2CYYA 1ZARA 2FF4A 3HSRA 3U9GA 4ESBA 1ZRDA 3RKYA 1ZLKA 1KU2A 2KRFA 4OOIA 3DPTA 4KA4A 1IUYA 5EEGA 1KQ0A 3SZTA 3FXQA 5HDGA 2FBIA 3CUQA 1RUOA 5HOOA 1UFMA 4LB5A 3OV8A 1TW3A 1UCRA 4KT5C 4CXFA 3J81K 1Z7UA 2IW5A 4O6JA 2OQGA 4WXHA 2STTA 5DUKA 2OBPA 2MC3A 1V3FA 2OA4A 1IW7F 1G3WA 1BIAA 6PAXA 3R60A 1LVAA 3HRMA 3GLXA 2VBZA 2NNYA 1Z05A 1W7PA 3KFWX 3WGHA 2Z5UA 3EUHA 3ZP5A 3KP4A 1YFHA 1EV7A 5D4RA 2Y0MA 1XSDA 2O03A 5HS8A 4IPAA 4PCQA 4UV9A 1BI0A 3WU1B 2QYOA 1F4KA 3KE2A 2PG4A 5D6FA 1U5TC 3BJOA 4IRIA 4Q48A 4NQWA 1GVJA 2VT2A 2E1CA 1FP2A 2V1XA 2RV8A 4DQ2A 4BNCA 4GO1A 3T8RA 2LF7A 2STWA 5JFRA 4RB1A 5HS7A 3FHZA 4L5IA 4CYDA 1I1SA 2WC2A 4HLXA 4M9ZA 5HLGA 2PI0A 2K7LA 2HYGD 1JHHA 3DF8A 2NS0A 2DAOA 4MEXF 2NNNA 2FNAA 3DP7A 5CVJA 5CJ9A 5BMZA 4LJZF 1A04A 4FX0A 4AIJA 2XHKA 2ELHA 5E18F 5DUIA 3BPXA 1FSEA 1EH8A 2ESHA 2FQ3A 5F64A 2CW0F 2X0LA 3ZMSA 1RUNA 1LEBA 1ZLJA 2BEOA 4LB6B 1ZRCA 4HW0A 4JQFA 1Z91A 1O3TA 1YW8A 5E8GA 1B59A 4JK1X 4OMZA 2DFIA 2LSOA 4I7HA 4XRFA 5H6QA 3HYIA 1TQIA 2EB7A 3I0TA 1KQ9A 4EGZA 3B02A 4YFNF 2AXLA 1U2WA 1S7OA 3TKYA 2KIFA 4M9XA 4RGSA 2VONA 1D5VA 4AWXB 2LNBA 4Y17A 1QZYA 3F8BA 1YIOA 4HZFA 5JHUA 3F23A 2X4HA 4MTEA 1ZYRF 4G7HF 5BQTA 2RN7A 4TV7A 3GFMA 3FMSA 4NHJA 1IZ1A 4HOBA 4D0PA 2UWMA 1V4RA 2QQBA 4UHTA 2YX7A 2RGVA 3D0SA 3F6OA 4XBFA 2EA4A 2L3DA 3NRVA 3LAJA 4AVPA 2R3SA 4ETSA 3VB2A 5FLXK 1ZAOA 4LLNA 5BOXA 3E5UA 2OU2A 4Y15A 1ZH5A 2V79A 1MGTA 4FT8A 3PFIA 5K5OA 1J0RA 2KIMA 2OZ6A 3ROUA 3V7RA 4L9VA 3SQNA 2OQRA 2VE9A 4IXAA 1HBXG 1W4MA 5E1ZB 3F3XA 2A69F 4IVNA 3I54A 2GA2A 4IJAA 4A2UA 3SHFA 1B9NA 2BBYA 2D2WA 3BZ6A 3H3ZA 3H3UA 3ML6A 5FD6A 1TNSA 1MKMA 4ON0A 4I02A 3HOTA 3QP6A 2L01A 1ZGJA 2Q2EA 2MH2A 5BS6A 1STZA 1WKMA 4P5OA 3QU3A 4HA8A 2PJPA 4P96A 1F9NA 1FYMA 2G9WA 3MZHA 1ZHFA 1HW5A 3GFIA 2DQRA 4CO8A 3U2RA 4H0EA 3FMRA 3V7CA 1T6SA 5HVQC 1FBUA 1LEAA 3FMQA 3ECHA 4P9FA 3WODF 2CSOA 1YG2A 2YX4A 1I1GA 2VBXA 4MNUA 1O7LA 2BE5F 3QPHA 4IRGA 2COMA 4OMYA 5LGTA 3JAMZ 3KP3A 1CF7B 1HKTA 2IPQX 2F2EA 3ZMZA 1F5TA 2VC0A 2W85A 2ZMEB 4WK8F 1LQ1A 3ZMTA 3ZN0A 4RB0A 3IL2A 4LFUA 1SD6A 1UHMA 3CO6C 2MD5A 4KIGA 4ESFA 4HV5A 1LNWA 5JVTA 1UHWA 2A6EF 1FYLA 3I71A 4LG0B 3FZVA 3OOPA 5E17F 3MFKA 5HDKA 2O6GE 1YW7A 4I0AA 1E17A 1R5HA 2XASA 3I5UA 4HAMA 4YIFA 3ULQB 1ODDA 4ENJA 3N4MA 1HKSA 3GF2A 1OYWA 3KETA 1CGPA 3Q5FA 3BWGA 1BN5A 3K9TA 4YG2F 1ULYA 5L3EA 1WRJA 3WTTC 3I59B 4ESJA 1SD7A 5ICEA 2W25A 4KMUX 1B6AA 4KUMA 3RDIA 2MH9A 1FPQA 3PQKA 1XGOA 1R1VA 2Y48A 2RQPA 2FBHA 1ZREA 1XDUA 5HDNA 1GXQA 5ILSA 4BHPA 2Z3YA 2JSCA 4F7ZA 1EH6A 1BI3A 2QENA 3E5QA 3G73A 4M6XA 3DEUA 4LMYA 3EDPA 1SFEA 3JW4A 3FX3A 5ERIA 4U0WA 5LRSA 1MZBA 1XGMA 2R7DA 1SMYF 3TO6A 1IF1A 1XGSA 4XLPF 2A3SA 4N9HA 4BH9A 2R7FA 3J7AO 1XMAA 3K1PA 3QAHA 4AIHA 2XKOA 3K1MA 3TGNA 4A0YA 1QO0D 1ON1A 1K78A 1B1BA 2H27A 3LAPA 4WF2A 1U5TA 3QU6A 5DCMB 2M1BA 3ZPLA 5E1WA 3O2PE 2O3FA 4P9UA 2PN6A 5D5XB 2J5PA 3TQNA 2MA3A 2HDCA 1YO5C 2EFPA 2D45A 3RTRA 3V8LA 4OU0A 5IT9K 2Q0OA 2H09A 3IRQA 1ZRFA 4BQAA 4EM0B 1J75A 3BJ6A 1HSJA 5FO5A 3BOQA 1R22A 3T1BA 2PMHA 2EFOA 3V4GA 2XAHA 4ZZLA 4LK0F 2A6HF 3TDUC 2PFBA 1LDJA 1GHCA 4WXCA 5F6FA 1FP1D 3ZMUA 2P7VB 1XSXA 2F5FA 1U78A 2M5WA 3M7GA 1GXPA 4KMFA 3MEXA 2P4WA 4AIKA 4EMSA 4YIIA 1VTNC 4HX8A 1ZG3A 1T0FA 1P4AA 3DKWA 3K0LA 1RZ4A 3NEUA 3MZYA 5L3CA 1O7FA 1SD5A 2K86A 2DW4A 1BC8C 2VT3A 2HKOA 4WCGA 3KEQA 4N9IA 4L18B 3RPUA 4AD9A 4MGRA 4ZYHA 3RKXA 3I58A 1ZGAA 4ENMA 5FD5A 1YLFA 3N97A 4RAYA 3TOAA 2DU9A 5CVIA 1YTYA 1P2FA 3HHGA 3LSTA 4LD5A 3JSPA 2QWWA 2ETHA 1Z6TA 2M87A 1XDSA 4EJOA 3WGGA 1G3SA 3EYIA 3V8JA 4P55A 1MDMB 4E70A 3CLOA 3VFZA 2XRNA 5TJJA 3P7NA 1FOKA 3ELKA 1XGNA 1P4XA 3DV8A 4IRHA 1UB9A 3O3KA 2UXXA 2LDUA 1HW2A 5J8FA 1MJ9A 4R8HA 2IA0A 3E6CC 5D8LB 2E1NA 3TOBA 2HS5A 3K1NA 3G3ZA 2CWEA 3CUQC 2D1VA 2EWNA 3WTWC 5ICGA 4ENNA 1G4DA 2EFQA 5DD8A 3J80Z 2DT5A 2QBYA 3P9CA 2XV4S 2BYVE 2HTSA 2ISYA 1L0OC 2P6SA 3E3VA 2BV6A 1PP7U 1KU9A 4BYYA 1HKQA 4EJWA 5E20A 3FM5A 3EQLF 1DPUA 4A6EA 1ONVA 3DFGA 2YU3A 2G7UA 2DPUA 3HSFA 3SZPA 3GW2A 3W6KB 1K79A 3RYPA 4U7DA 3WTYC 2JZYA 3E6MA 4XSXF 2ZJ2A 2FOKA 1TNTA 4MEYF 4RB2C 5F1RA 1XSVA 3MWMA 3F8NA 5D5VB 1RIOH 1AOYA 1REPC 2ZXJA 3TO7A 4L5JA 3CO7C 2ZNYA 3CUQB 2RVCA 1J2XA 3V8KA 4DNCA 2V9VA 2P5KA 4L9JA 1EH7A 2UZKA 2UXNA 4HYEA 1P6RA 3C1DA 4XLNF 1FZPB 1D8KA 2Z33A 3WTSC 4A0XA 1MJBA 1IXRC 3RKWA 4U0YA 1W7PB 4KFCA 3ABUA 1BI1A 3HSEA 3U1DA 2VBYA 1XN7A 3LFKA 1FWZA 2M45A 4M73A 4BAYA 4UXNA 5L3GA 5DDGA 3F72A 3I4PA 4I09A 1J5YA 1S29A 2PMUA 2YPRA 2DO7A 3HOSA 2DI3A 4EJVA 4RGXA 1KYWA 3ABTA 1T98A 2XAQA 2HEOA 2K02A 2L02A 1PDNC 1R36A 3D5LA 4PGHA 5LEKA 2KKOA 1BC7C 3T8TA 3T5XA 2P5LC 1O3SA 4I2OA 1OPCA 5H20A 3GFJA 3R6SA 4A5NA 3K69A 5HLIA 2NAZA 4OIPF 2IP2A 2FU4A 5LGNA 4MTDA 3CDHA 4KN7X 3WE3A 5K1YA 3KLNA 2CG4A 3F8MA 4A5MA 2FA5A 3QPTA 4A6DA 4IHSA 2EJRA 3LA2A 1C0WA 3HUGA 4EM1A 2P5VA 3KP5A 3GYHX 2E7WA 1Z9CA 2PEXA 1QPMA 4G7ZF 5ILVA 5FFZA 2CQKA 4I01A 4M72A 3Q9VA 2DK8A 4OIQF 1XMKA 3F8CA 2LF8A 3GZ6A 2EA2A 1J7KA 1SMTA 1OKRA 1ZN2A 3FXRA 2IA1A 3GVAA 4ZZDA 2NRAC 4L0YB 2IJLA 1PUEE 2VXZA 2PQ8A 2QLZA 4S04A 1B4AA 3GO5A 3HRTA 1G3YA 1B9MA 3TO9A 2K27A 3L00A 2FNPA 2KJBA 1MJAA 3ZQ7A 2KJCA 2F5EA 4CICA 1MD0A 3WG9A 1R58A 2OAZA 4HV6A 1IXCA 2XKPA 1SFUA 1BJAA 2V6CA 5LHHA 3DPLC 4WXDA 2VBWA 5EEHA 1WWXA 4YFXF 1T39A 4EV0A 5D6EA 4A12A 1LB2A 4HX4A 2LKPA 3AAFA 2WWYA 1W5TA 4UV8A 2ACJA 3HRUA 5A2QZ 5KK1A 2HQNA 1LJ9A 3L2CA 1BBYA 1KQ8A 1Y0UA 5CVUA 3M8EA 2IA2A 3R0JA 1K6OA 2IT0A 1Z6RA 2G7HA 3IKTA 5KVRA 1HW1A 1D3YA 1FC3A 2DTRA 2FEZA 1YS6A 2GQQA 2H94A 4FX4A 2FRHA 1J59A 2CO5A 2H6BA 2DPDA 4M6YA 2HFHA 4MQ9F 4WX9A 4L9TA 5D8KB 2ZBKA 2DBBA 1KA8A 4Z2YA 4S05A 3QOPA 1Q1HA 2Z9OA 3MQ0A 2VE8A 1R1UA 1HQCA 2EV6A 1I27A 3LA7A 4EJTA 1FT9A 4KDPA 1Z1DA 5D4SA 1DP7P 1W5SA 2ZCWA 4HQMA 1O3RA 2QQAA 2ZFWA 1YYVA 3HRSA 2FMYA 3RJPA 4PZJA 1JHFA 1U8RA 1TTYA 4YFKF 1R5GA 3VOEA 2DLLA 5BPDA 2XGXA 5LRRA 3HIFA 1BIBA 1KU7A 4QWQA 3FF5A 1O57A 3V7SA 1U3EM 1F1ZA 2GZWA 3GUDA 3F22A 1U6GA 1KYZA 5E1XA 1USSA 5JR3A 3F21A 3GXOA 2K4JA 4XSZF 1QZZA 2JRTA 2XAFA 2JT1A 3B73A 4GXOA 2DK5A 3SFZA 1K7AA 3L7WA 4LK1F 1IXSB 1FNNA 3ISPA 4QLCU 3E5XA 3KP2A 3S2WA 2QM3A 2VC1A 1H9TA 1WQ2A 4WWCA 1HXDA 3REOA 4R79A 2QQ9A 4HLYA 2Y75A 1TQPA 5L3FA 1G6NA 3J80K 2C6YA 1YW9A 2KIUA 3WU0A 1FX7A 1OR7A 4OIOF 1G3TA 1H0MA 2ESNA 2O8XA 1IN8A 1QGPA 1QNTA 1L3LA 4UNOA 2MBFA 2B0LA 2PLYA 5E8IA 1TBXA 3DXJF 3WTVC 3FWEA 4KIBA 1AWCA 3LQRA 4RS8A 2ZKZA 2GAUA 2J5OA 1XCBA 5IT9Z 2FSWA 2H6CA 5J8CA 3BY6A 2RKHA 3L09A 5H6RA 2FMLA 3IWZA 4KNYA 3L9FA 3TDZC 3JTHA 1SAXA 2XAJA 5JI6A 2W57A 4HBLA 1JE8A 3QP5A 5L3BA 1S6LA 2PBIA 5L3DA 2V1UA 2HKXA 1IRFA 1OMIA 1CF7A 3NQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYG A;  3J81 Z;  2RDP A;  1TLH B;  5LGU A;  4EQQ A;  3JTG A;  4M9S A;  4GYI A;  3GEZ A;  2ZME A;  3I64 A;  3ZMD A;  4U88 A;  3BDD A;  4KIF A;  4HDV A;  2QVO A;  5CLS A;  4Q47 A;  5FFX A;  1FBS A;  4HF2 A;  4G94 A;  1K78 B;  4UVC A;  1U5T B;  4Q5S F;  2K4B A;  4NB5 A;  4LG0 A;  3WTU C;  3KP6 A;  2YR2 A;  1BOA A;  3GFL A;  4LLL A;  3E6D A;  4O5V A;  4OIR F;  4I0B A;  5CVV A;  3I53 A;  4KN4 X;  3P9I A;  4LGW A;  3IWF A;  4PGG A;  4L9N A;  5D5U B;  1ZG5 A;  4KIC A;  4G7O F;  2GXG A;  3C18 A;  1OYI A;  1W7P D;  2ADU A;  4BXU A;  4Q4Z F;  3COA C;  1IRG A;  3I59 A;  4UVA A;  2W84 A;  2DQL A;  4B8X A;  5J6X A;  1D8J A;  2M30 A;  2L4A A;  1WSU A;  2W24 A;  2VN2 A;  2Q8K A;  2O61 A;  3FXU A;  1NHA A;  4K2E A;  5DEQ A;  5HS9 A;  4BHB A;  4OIN F;  4EJU A;  4ENK A;  3JAM K;  2EFN A;  3HHH A;  3HTS B;  1JXS A;  1IN7 A;  3SXY A;  3M9A A;  3WTZ A;  4ZYD A;  5K5R A;  3C7J A;  3KEO A;  2E7X A;  2HR3 A;  5ICC A;  2CGP A;  3DQV C;  5ED4 A;  4PDK A;  1R7J A;  1H9G A;  3HTU A;  2WTE A;  1WI9 A;  1S8N A;  4ZH4 F;  2EV0 A;  3M1E A;  4CZZ A;  4CHU A;  3VOD A;  1XB4 A;  1FYK A;  2Z99 A;  3KP7 A;  5ILU A;  2ZNZ A;  1OYY A;  5IT3 A;  3E6B A;  4R1H A;  3KZZ A;  2XIG A;  5DCF A;  3EET A;  5D5W B;  2XUB A;  3WE2 A;  1S7A A;  2VOP A;  4CGZ A;  5FGM A;  2FXA A;  5DCM A;  2HZT A;  1IAW A;  1IN4 A;  4GCV A;  1PP8 F;  4IHT A;  2XAG A;  4L0Z B;  4GGG A;  1UST A;  2D1H A;  2OZU A;  3GZ5 A;  5DV5 A;  3R0A A;  4UUV A;  3E97 A;  1IN5 A;  5K5Q A;  4HF0 A;  2FBK A;  2A61 A;  4RGU A;  4BHC A;  2ZO4 A;  3WTX C;  4EGY A;  4I98 B;  5DD4 A;  2VOO A;  4CDG A;  4M71 A;  4ZYG A;  5A2Q K;  4U0V A;  2QZ8 A;  2CFX A;  1XD7 A;  3ZMV A;  1BM9 A;  1QBJ A;  4G8X A;  1ON2 A;  3LQQ A;  1P4W A;  4LLG F;  1DDN A;  2EV5 A;  5BPI A;  2HOE A;  2EFW A;  3RYR A;  4RB3 C;  3IKV A;  4N0B A;  3QRF F;  1T2K A;  4HQE A;  2JTV A;  2NYX A;  5FLX Z;  2HQR A;  2A68 F;  4ASN A;  3F6V A;  1YQA A;  3VEP A;  2QBY B;  3RI4 A;  4HX7 A;  1FSH A;  5HLH A;  3P9K A;  2HTJ A;  1I5Z A;  3LA3 A;  2GWR A;  2JPB A;  1T38 A;  5DYM A;  3BP8 A;  1R1T A;  4EM2 A;  4IF4 A;  1LDD A;  4UVB A;  2F5C A;  1FBQ A;  3WGI A;  2P8T A;  2MLG A;  2O0Y A;  1TQM A;  2GXB A;  4Y13 A;  3JSO A;  1I6X A;  3LWF A;  5FB2 A;  2V1D A;  5LBQ A;  3ERE D;  3BRO A;  5AON A;  3IRR A;  4RAZ A;  2GA1 A;  1RI7 A;  2WV0 A;  2F5D A;  3IHU A;  3KCC A;  4EVI A;  2QUF A;  4HDU A;  3ECO A;  4O3M A;  3ZN1 A;  2A5Y B;  3KZY A;  3T0Y A;  1MDM A;  1XCV A;  1QQI A;  3F8F A;  4HF1 A;  3M8F A;  2IRF G;  5LLQ A;  3IC7 A;  2A07 F;  5TRD A;  3MCZ A;  2P7C B;  2TDX A;  2VOD A;  3BJA A;  5AIP A;  1HST A;  4B09 A;  2JPC A;  4ZYE A;  2HGC A;  3K2Z A;  1E2X A;  1X3U A;  2OD5 A;  1ZG1 A;  1BI2 A;  3MAJ A;  3RIR A;  5LHG A;  1KGS A;  2GIV A;  2M8E A;  2BGC A;  4MHG A;  1TW2 A;  3Q9S A;  1FLI A;  2RC4 A;  4JBA A;  3W6J B;  3R61 A;  2ISZ A;  1KU3 A;  1R00 A;  3CJN A;  1S3J A;  1YS7 A;  2P6T A;  2YSR A;  3H92 A;  2EK5 A;  4A0Z A;  1JGS A;  3CUO A;  1LDK B;  3CTA A;  2HYF A;  2XVC A;  2L4M A;  3GX4 X;  4M74 A;  5CYV A;  1P92 A;  4FHT A;  3PQJ A;  3C3W A;  3RPQ A;  5ICF A;  4KYW A;  5AIQ A;  3BPV A;  4G6Q A;  1FY7 A;  2XRO A;  3EYY A;  3KLO A;  2RNJ A;  3GWZ A;  1SFX A;  4G6D A;  5CVR A;  1DUX C;  3O6B B;  2IVM A;  4G9Y A;  1IN6 A;  2HWV A;  3R4K A;  2AS5 F;  4RGR A;  5LHI A;  2MLK A;  4U7B A;  2FE3 A;  3FM3 A;  1SD4 A;  1R23 A;  5LEJ A;  2L54 A;  1O3Q A;  4MQV A;  1DPR A;  1RNL A;  1J9I A;  2CYY A;  1ZAR A;  2FF4 A;  3HSR A;  3U9G A;  4ESB A;  1ZRD A;  3RKY A;  1ZLK A;  1KU2 A;  2KRF A;  4OOI A;  3DPT A;  4KA4 A;  1IUY A;  5EEG A;  1KQ0 A;  3SZT A;  3FXQ A;  5HDG A;  2FBI A;  3CUQ A;  1RUO A;  5HOO A;  1UFM A;  4LB5 A;  3OV8 A;  1TW3 A;  1UCR A;  4KT5 C;  4CXF A;  3J81 K;  1Z7U A;  2IW5 A;  4O6J A;  2OQG A;  4WXH A;  2STT A;  5DUK A;  2OBP A;  2MC3 A;  1V3F A;  2OA4 A;  1IW7 F;  1G3W A;  1BIA A;  6PAX A;  3R60 A;  1LVA A;  3HRM A;  3GLX A;  2VBZ A;  2NNY A;  1Z05 A;  1W7P A;  3KFW X;  3WGH A;  2Z5U A;  3EUH A;  3ZP5 A;  3KP4 A;  1YFH A;  1EV7 A;  5D4R A;  2Y0M A;  1XSD A;  2O03 A;  5HS8 A;  4IPA A;  4PCQ A;  4UV9 A;  1BI0 A;  3WU1 B;  2QYO A;  1F4K A;  3KE2 A;  2PG4 A;  5D6F A;  1U5T C;  3BJO A;  4IRI A;  4Q48 A;  4NQW A;  1GVJ A;  2VT2 A;  2E1C A;  1FP2 A;  2V1X A;  2RV8 A;  4DQ2 A;  4BNC A;  4GO1 A;  3T8R A;  2LF7 A;  2STW A;  5JFR A;  4RB1 A;  5HS7 A;  3FHZ A;  4L5I A;  4CYD A;  1I1S A;  2WC2 A;  4HLX A;  4M9Z A;  5HLG A;  2PI0 A;  2K7L A;  2HYG D;  1JHH A;  3DF8 A;  2NS0 A;  2DAO A;  4MEX F;  2NNN A;  2FNA A;  3DP7 A;  5CVJ A;  5CJ9 A;  5BMZ A;  4LJZ F;  1A04 A;  4FX0 A;  4AIJ A;  2XHK A;  2ELH A;  5E18 F;  5DUI A;  3BPX A;  1FSE A;  1EH8 A;  2ESH A;  2FQ3 A;  5F64 A;  2CW0 F;  2X0L A;  3ZMS A;  1RUN A;  1LEB A;  1ZLJ A;  2BEO A;  4LB6 B;  1ZRC A;  4HW0 A;  4JQF A;  1Z91 A;  1O3T A;  1YW8 A;  5E8G A;  1B59 A;  4JK1 X;  4OMZ A;  2DFI A;  2LSO A;  4I7H A;  4XRF A;  5H6Q A;  3HYI A;  1TQI A;  2EB7 A;  3I0T A;  1KQ9 A;  4EGZ A;  3B02 A;  4YFN F;  2AXL A;  1U2W A;  1S7O A;  3TKY A;  2KIF A;  4M9X A;  4RGS A;  2VON A;  1D5V A;  4AWX B;  2LNB A;  4Y17 A;  1QZY A;  3F8B A;  1YIO A;  4HZF A;  5JHU A;  3F23 A;  2X4H A;  4MTE A;  1ZYR F;  4G7H F;  5BQT A;  2RN7 A;  4TV7 A;  3GFM A;  3FMS A;  4NHJ A;  1IZ1 A;  4HOB A;  4D0P A;  2UWM A;  1V4R A;  2QQB A;  4UHT A;  2YX7 A;  2RGV A;  3D0S A;  3F6O A;  4XBF A;  2EA4 A;  2L3D A;  3NRV A;  3LAJ A;  4AVP A;  2R3S A;  4ETS A;  3VB2 A;  5FLX K;  1ZAO A;  4LLN A;  5BOX A;  3E5U A;  2OU2 A;  4Y15 A;  1ZH5 A;  2V79 A;  1MGT A;  4FT8 A;  3PFI A;  5K5O A;  1J0R A;  2KIM A;  2OZ6 A;  3ROU A;  3V7R A;  4L9V A;  3SQN A;  2OQR A;  2VE9 A;  4IXA A;  1HBX G;  1W4M A;  5E1Z B;  3F3X A;  2A69 F;  4IVN A;  3I54 A;  2GA2 A;  4IJA A;  4A2U A;  3SHF A;  1B9N A;  2BBY A;  2D2W A;  3BZ6 A;  3H3Z A;  3H3U A;  3ML6 A;  5FD6 A;  1TNS A;  1MKM A;  4ON0 A;  4I02 A;  3HOT A;  3QP6 A;  2L01 A;  1ZGJ A;  2Q2E A;  2MH2 A;  5BS6 A;  1STZ A;  1WKM A;  4P5O A;  3QU3 A;  4HA8 A;  2PJP A;  4P96 A;  1F9N A;  1FYM A;  2G9W A;  3MZH A;  1ZHF A;  1HW5 A;  3GFI A;  2DQR A;  4CO8 A;  3U2R A;  4H0E A;  3FMR A;  3V7C A;  1T6S A;  5HVQ C;  1FBU A;  1LEA A;  3FMQ A;  3ECH A;  4P9F A;  3WOD F;  2CSO A;  1YG2 A;  2YX4 A;  1I1G A;  2VBX A;  4MNU A;  1O7L A;  2BE5 F;  3QPH A;  4IRG A;  2COM A;  4OMY A;  5LGT A;  3JAM Z;  3KP3 A;  1CF7 B;  1HKT A;  2IPQ X;  2F2E A;  3ZMZ A;  1F5T A;  2VC0 A;  2W85 A;  2ZME B;  4WK8 F;  1LQ1 A;  3ZMT A;  3ZN0 A;  4RB0 A;  3IL2 A;  4LFU A;  1SD6 A;  1UHM A;  3CO6 C;  2MD5 A;  4KIG A;  4ESF A;  4HV5 A;  1LNW A;  5JVT A;  1UHW A;  2A6E F;  1FYL A;  3I71 A;  4LG0 B;  3FZV A;  3OOP A;  5E17 F;  3MFK A;  5HDK A;  2O6G E;  1YW7 A;  4I0A A;  1E17 A;  1R5H A;  2XAS A;  3I5U A;  4HAM A;  4YIF A;  3ULQ B;  1ODD A;  4ENJ A;  3N4M A;  1HKS A;  3GF2 A;  1OYW A;  3KET A;  1CGP A;  3Q5F A;  3BWG A;  1BN5 A;  3K9T A;  4YG2 F;  1ULY A;  5L3E A;  1WRJ A;  3WTT C;  3I59 B;  4ESJ A;  1SD7 A;  5ICE A;  2W25 A;  4KMU X;  1B6A A;  4KUM A;  3RDI A;  2MH9 A;  1FPQ A;  3PQK A;  1XGO A;  1R1V A;  2Y48 A;  2RQP A;  2FBH A;  1ZRE A;  1XDU A;  5HDN A;  1GXQ A;  5ILS A;  4BHP A;  2Z3Y A;  2JSC A;  4F7Z A;  1EH6 A;  1BI3 A;  2QEN A;  3E5Q A;  3G73 A;  4M6X A;  3DEU A;  4LMY A;  3EDP A;  1SFE A;  3JW4 A;  3FX3 A;  5ERI A;  4U0W A;  5LRS A;  1MZB A;  1XGM A;  2R7D A;  1SMY F;  3TO6 A;  1IF1 A;  1XGS A;  4XLP F;  2A3S A;  4N9H A;  4BH9 A;  2R7F A;  3J7A O;  1XMA A;  3K1P A;  3QAH A;  4AIH A;  2XKO A;  3K1M A;  3TGN A;  4A0Y A;  1QO0 D;  1ON1 A;  1K78 A;  1B1B A;  2H27 A;  3LAP A;  4WF2 A;  1U5T A;  3QU6 A;  5DCM B;  2M1B A;  3ZPL A;  5E1W A;  3O2P E;  2O3F A;  4P9U A;  2PN6 A;  5D5X B;  2J5P A;  3TQN A;  2MA3 A;  2HDC A;  1YO5 C;  2EFP A;  2D45 A;  3RTR A;  3V8L A;  4OU0 A;  5IT9 K;  2Q0O A;  2H09 A;  3IRQ A;  1ZRF A;  4BQA A;  4EM0 B;  1J75 A;  3BJ6 A;  1HSJ A;  5FO5 A;  3BOQ A;  1R22 A;  3T1B A;  2PMH A;  2EFO A;  3V4G A;  2XAH A;  4ZZL A;  4LK0 F;  2A6H F;  3TDU C;  2PFB A;  1LDJ A;  1GHC A;  4WXC A;  5F6F A;  1FP1 D;  3ZMU A;  2P7V B;  1XSX A;  2F5F A;  1U78 A;  2M5W A;  3M7G A;  1GXP A;  4KMF A;  3MEX A;  2P4W A;  4AIK A;  4EMS A;  4YII A;  1VTN C;  4HX8 A;  1ZG3 A;  1T0F A;  1P4A A;  3DKW A;  3K0L A;  1RZ4 A;  3NEU A;  3MZY A;  5L3C A;  1O7F A;  1SD5 A;  2K86 A;  2DW4 A;  1BC8 C;  2VT3 A;  2HKO A;  4WCG A;  3KEQ A;  4N9I A;  4L18 B;  3RPU A;  4AD9 A;  4MGR A;  4ZYH A;  3RKX A;  3I58 A;  1ZGA A;  4ENM A;  5FD5 A;  1YLF A;  3N97 A;  4RAY A;  3TOA A;  2DU9 A;  5CVI A;  1YTY A;  1P2F A;  3HHG A;  3LST A;  4LD5 A;  3JSP A;  2QWW A;  2ETH A;  1Z6T A;  2M87 A;  1XDS A;  4EJO A;  3WGG A;  1G3S A;  3EYI A;  3V8J A;  4P55 A;  1MDM B;  4E70 A;  3CLO A;  3VFZ A;  2XRN A;  5TJJ A;  3P7N A;  1FOK A;  3ELK A;  1XGN A;  1P4X A;  3DV8 A;  4IRH A;  1UB9 A;  3O3K A;  2UXX A;  2LDU A;  1HW2 A;  5J8F A;  1MJ9 A;  4R8H A;  2IA0 A;  3E6C C;  5D8L B;  2E1N A;  3TOB A;  2HS5 A;  3K1N A;  3G3Z A;  2CWE A;  3CUQ C;  2D1V A;  2EWN A;  3WTW C;  5ICG A;  4ENN A;  1G4D A;  2EFQ A;  5DD8 A;  3J80 Z;  2DT5 A;  2QBY A;  3P9C A;  2XV4 S;  2BYV E;  2HTS A;  2ISY A;  1L0O C;  2P6S A;  3E3V A;  2BV6 A;  1PP7 U;  1KU9 A;  4BYY A;  1HKQ A;  4EJW A;  5E20 A;  3FM5 A;  3EQL F;  1DPU A;  4A6E A;  1ONV A;  3DFG A;  2YU3 A;  2G7U A;  2DPU A;  3HSF A;  3SZP A;  3GW2 A;  3W6K B;  1K79 A;  3RYP A;  4U7D A;  3WTY C;  2JZY A;  3E6M A;  4XSX F;  2ZJ2 A;  2FOK A;  1TNT A;  4MEY F;  4RB2 C;  5F1R A;  1XSV A;  3MWM A;  3F8N A;  5D5V B;  1RIO H;  1AOY A;  1REP C;  2ZXJ A;  3TO7 A;  4L5J A;  3CO7 C;  2ZNY A;  3CUQ B;  2RVC A;  1J2X A;  3V8K A;  4DNC A;  2V9V A;  2P5K A;  4L9J A;  1EH7 A;  2UZK A;  2UXN A;  4HYE A;  1P6R A;  3C1D A;  4XLN F;  1FZP B;  1D8K A;  2Z33 A;  3WTS C;  4A0X A;  1MJB A;  1IXR C;  3RKW A;  4U0Y A;  1W7P B;  4KFC A;  3ABU A;  1BI1 A;  3HSE A;  3U1D A;  2VBY A;  1XN7 A;  3LFK A;  1FWZ A;  2M45 A;  4M73 A;  4BAY A;  4UXN A;  5L3G A;  5DDG A;  3F72 A;  3I4P A;  4I09 A;  1J5Y A;  1S29 A;  2PMU A;  2YPR A;  2DO7 A;  3HOS A;  2DI3 A;  4EJV A;  4RGX A;  1KYW A;  3ABT A;  1T98 A;  2XAQ A;  2HEO A;  2K02 A;  2L02 A;  1PDN C;  1R36 A;  3D5L A;  4PGH A;  5LEK A;  2KKO A;  1BC7 C;  3T8T A;  3T5X A;  2P5L C;  1O3S A;  4I2O A;  1OPC A;  5H20 A;  3GFJ A;  3R6S A;  4A5N A;  3K69 A;  5HLI A;  2NAZ A;  4OIP F;  2IP2 A;  2FU4 A;  5LGN A;  4MTD A;  3CDH A;  4KN7 X;  3WE3 A;  5K1Y A;  3KLN A;  2CG4 A;  3F8M A;  4A5M A;  2FA5 A;  3QPT A;  4A6D A;  4IHS A;  2EJR A;  3LA2 A;  1C0W A;  3HUG A;  4EM1 A;  2P5V A;  3KP5 A;  3GYH X;  2E7W A;  1Z9C A;  2PEX A;  1QPM A;  4G7Z F;  5ILV A;  5FFZ A;  2CQK A;  4I01 A;  4M72 A;  3Q9V A;  2DK8 A;  4OIQ F;  1XMK A;  3F8C A;  2LF8 A;  3GZ6 A;  2EA2 A;  1J7K A;  1SMT A;  1OKR A;  1ZN2 A;  3FXR A;  2IA1 A;  3GVA A;  4ZZD A;  2NRA C;  4L0Y B;  2IJL A;  1PUE E;  2VXZ A;  2PQ8 A;  2QLZ A;  4S04 A;  1B4A A;  3GO5 A;  3HRT A;  1G3Y A;  1B9M A;  3TO9 A;  2K27 A;  3L00 A;  2FNP A;  2KJB A;  1MJA A;  3ZQ7 A;  2KJC A;  2F5E A;  4CIC A;  1MD0 A;  3WG9 A;  1R58 A;  2OAZ A;  4HV6 A;  1IXC A;  2XKP A;  1SFU A;  1BJA A;  2V6C A;  5LHH A;  3DPL C;  4WXD A;  2VBW A;  5EEH A;  1WWX A;  4YFX F;  1T39 A;  4EV0 A;  5D6E A;  4A12 A;  1LB2 A;  4HX4 A;  2LKP A;  3AAF A;  2WWY A;  1W5T A;  4UV8 A;  2ACJ A;  3HRU A;  5A2Q Z;  5KK1 A;  2HQN A;  1LJ9 A;  3L2C A;  1BBY A;  1KQ8 A;  1Y0U A;  5CVU A;  3M8E A;  2IA2 A;  3R0J A;  1K6O A;  2IT0 A;  1Z6R A;  2G7H A;  3IKT A;  5KVR A;  1HW1 A;  1D3Y A;  1FC3 A;  2DTR A;  2FEZ A;  1YS6 A;  2GQQ A;  2H94 A;  4FX4 A;  2FRH A;  1J59 A;  2CO5 A;  2H6B A;  2DPD A;  4M6Y A;  2HFH A;  4MQ9 F;  4WX9 A;  4L9T A;  5D8K B;  2ZBK A;  2DBB A;  1KA8 A;  4Z2Y A;  4S05 A;  3QOP A;  1Q1H A;  2Z9O A;  3MQ0 A;  2VE8 A;  1R1U A;  1HQC A;  2EV6 A;  1I27 A;  3LA7 A;  4EJT A;  1FT9 A;  4KDP A;  1Z1D A;  5D4S A;  1DP7 P;  1W5S A;  2ZCW A;  4HQM A;  1O3R A;  2QQA A;  2ZFW A;  1YYV A;  3HRS A;  2FMY A;  3RJP A;  4PZJ A;  1JHF A;  1U8R A;  1TTY A;  4YFK F;  1R5G A;  3VOE A;  2DLL A;  5BPD A;  2XGX A;  5LRR A;  3HIF A;  1BIB A;  1KU7 A;  4QWQ A;  3FF5 A;  1O57 A;  3V7S A;  1U3E M;  1F1Z A;  2GZW A;  3GUD A;  3F22 A;  1U6G A;  1KYZ A;  5E1X A;  1USS A;  5JR3 A;  3F21 A;  3GXO A;  2K4J A;  4XSZ F;  1QZZ A;  2JRT A;  2XAF A;  2JT1 A;  3B73 A;  4GXO A;  2DK5 A;  3SFZ A;  1K7A A;  3L7W A;  4LK1 F;  1IXS B;  1FNN A;  3ISP A;  4QLC U;  3E5X A;  3KP2 A;  3S2W A;  2QM3 A;  2VC1 A;  1H9T A;  1WQ2 A;  4WWC A;  1HXD A;  3REO A;  4R79 A;  2QQ9 A;  4HLY A;  2Y75 A;  1TQP A;  5L3F A;  1G6N A;  3J80 K;  2C6Y A;  1YW9 A;  2KIU A;  3WU0 A;  1FX7 A;  1OR7 A;  4OIO F;  1G3T A;  1H0M A;  2ESN A;  2O8X A;  1IN8 A;  1QGP A;  1QNT A;  1L3L A;  4UNO A;  2MBF A;  2B0L A;  2PLY A;  5E8I A;  1TBX A;  3DXJ F;  3WTV C;  3FWE A;  4KIB A;  1AWC A;  3LQR A;  4RS8 A;  2ZKZ A;  2GAU A;  2J5O A;  1XCB A;  5IT9 Z;  2FSW A;  2H6C A;  5J8C A;  3BY6 A;  2RKH A;  3L09 A;  5H6R A;  2FML A;  3IWZ A;  4KNY A;  3L9F A;  3TDZ C;  3JTH A;  1SAX A;  2XAJ A;  5JI6 A;  2W57 A;  4HBL A;  1JE8 A;  3QP5 A;  5L3B A;  1S6L A;  2PBI A;  5L3D A;  2V1U A;  2HKX A;  1IRF A;  1OMI A;  1CF7 A;  3NQO A; 
#chains in the Genus database with same CATH topology
 4GYG A;  3J81 Z;  2RDP A;  1TLH B;  5LGU A;  2A05 A;  4EQQ A;  3JTG A;  4M9S A;  4GYI A;  3GEZ A;  3ZRG A;  2ZME A;  3I64 A;  4I6Z A;  3ZMD A;  2QA4 I;  4U88 A;  2L7M P;  3BDD A;  4KIF A;  2R5Z B;  3OYG A;  4HDV A;  1H8A C;  3DCF A;  2QVO A;  3GLL A;  1I50 J;  2JA2 A;  5CLS A;  1WJC A;  4Q47 A;  1YE9 A;  5FFX A;  3WHB A;  3HOV J;  4B4C A;  1FBS A;  1WCM J;  3CP8 A;  5GAG J;  4HF2 A;  3JR9 A;  4G94 A;  1Y8R B;  2JK3 A;  4FE7 A;  5FKK A;  3G1M A;  5DTD A;  1HC8 A;  3NAU A;  4RAF A;  1K78 B;  2V26 A;  3H5R A;  4RBO A;  3JRE A;  4UVC A;  3LFU A;  1U5T B;  4Q5S F;  2K4B A;  4NB5 A;  4LG0 A;  3WTU C;  3KP6 A;  2BHZ A;  3LSH A;  4CZC A;  2YR2 A;  2F6C A;  1BOA A;  3GFL A;  4LLL A;  3E6D A;  4O5V A;  4OIR F;  5M5W J;  2CRG A;  4I0B A;  5CVV A;  4XRM A;  2JRM A;  2CQ7 A;  3I53 A;  4KN4 X;  3P9I A;  3L2W A;  3EUH C;  3FHN A;  3IWF A;  4LGW A;  4M3B A;  4PGG A;  2KMU A;  1G2H A;  3PUF A;  4L9N A;  5D5U B;  1JUP A;  1R4N B;  3HG9 A;  3X2Q H;  1X1D A;  1ZG5 A;  2PMZ A;  3EPZ A;  4KIC A;  4XLA A;  4G7O F;  1LPQ A;  5H2F C;  3CCY A;  2GXG A;  4A3B J;  3C18 A;  4V2G A;  1OYI A;  1W7P D;  2ADU A;  1VND A;  3GME A;  1I39 A;  4BXU A;  4Q4Z F;  3COA C;  2DA3 A;  1IRG A;  3OSF A;  3I59 A;  4UVA A;  4A3K J;  1WJB A;  1ERD A;  5C4X J;  1WVR A;  2W84 A;  3QOE A;  5CKT A;  2DQL A;  4B8X A;  1ZGW A;  3FK7 A;  5J6X A;  1VQ4 I;  1X19 A;  1D8J A;  3MMY B;  2M30 A;  2L4A A;  1WSU A;  2W24 A;  2VN2 A;  1MH4 A;  4GRI A;  4BQQ A;  2Q8K A;  2O61 A;  3FXU A;  1NHA A;  1N78 A;  2NVQ J;  3BR2 A;  4K2E A;  5DEQ A;  5HS9 A;  4BHB A;  4OIN F;  4EJU A;  4ENK A;  3JAM K;  1B72 B;  3CF2 A;  1YRN B;  2EFN A;  1RKT A;  3H0G J;  1Z3X A;  3HHH A;  4YEJ A;  4C9Y A;  3HTS B;  1HOM A;  1JXS A;  1IN7 A;  3SXY A;  3M9A A;  1ETO A;  2EIL H;  3WTZ A;  3RKQ A;  4ITV A;  3ZQH A;  4ZYD A;  4YRV A;  2EZI A;  5K5R A;  4XLE A;  4XN0 A;  4IHX A;  1VQ5 I;  4LIU A;  3OSG A;  3C7J A;  3KEO A;  2QF7 A;  2E7X A;  3EUA A;  2HR3 A;  5ICC A;  1LE8 B;  1D0Y A;  2CGP A;  3DQV C;  4XIC A;  3LSM A;  5ED4 A;  4PDK A;  1BJZ A;  3BTJ A;  2ZSI B;  1R7J A;  1H9G A;  1Z77 A;  3HTU A;  2WTE A;  1WI9 A;  3E7L A;  1S8N A;  3HBL A;  4ZH4 F;  2EV0 A;  2DDB A;  3M1E A;  2OJE D;  4KIT B;  2X6X A;  4CZZ A;  4CHU A;  2DA5 A;  3VOD A;  1D0X A;  3W2W A;  1XB4 A;  4OAZ A;  1GDT A;  1FYK A;  2Z99 A;  1V5F A;  3KP7 A;  5ILU A;  2ZNZ A;  1OYY A;  5E3N A;  5IT3 A;  3E6B A;  4MLO A;  4R1H A;  2NOG A;  2EIK H;  3GCM A;  3KZZ A;  2XIG A;  4XOR A;  5DCF A;  3EET A;  3FKJ A;  5D5W B;  2XUB A;  3WE2 A;  2L5Q A;  1S7A A;  2VOP A;  2X6O A;  1FIA A;  1QRY A;  4CGZ A;  5FGM A;  3TP3 A;  2R7W A;  2FXA A;  5DCM A;  5J1R A;  1WI3 A;  2HZT A;  1IAW A;  1IN4 A;  4GCV A;  1PP8 F;  4IHT A;  2XAG A;  3Q0W A;  4L0Z B;  1EA3 A;  2Y30 A;  4GGG A;  1UST A;  2D1H A;  2OZU A;  3I55 I;  4C30 A;  3GZ5 A;  5DV5 A;  3R0A A;  5GAE J;  1WJA A;  5GTH C;  2HU9 A;  3S3O A;  2FJ1 A;  1V55 H;  5K7F A;  4ABZ A;  3HL2 A;  2QGU A;  4UUV A;  2R7Z J;  2M4K A;  1JUM A;  5HNF A;  4XNF A;  2XSD C;  3E97 A;  1IN5 A;  3L2V A;  2K9M A;  5K5Q A;  4HF0 A;  4BDY A;  2FBK A;  2A61 A;  4RGU A;  4RMN A;  4BHC A;  3FK6 A;  2ZO4 A;  3KYD B;  2XPW A;  3WTX C;  2DA4 A;  1ZKG A;  4EGY A;  4II2 A;  4I98 B;  5DD4 A;  1WPK A;  1TL8 A;  5TGT A;  4CUG A;  2VOO A;  3HOU J;  2L9V A;  4CDG A;  3IV5 A;  4M71 A;  3I4M J;  3BC8 A;  4NUB A;  4ZYG A;  5A2Q K;  4U0V A;  2E5Z A;  4FTH A;  3NWS A;  2DMP A;  1WH5 A;  4E7H A;  2QZ8 A;  2CFX A;  2VIX A;  1XD7 A;  4HSR A;  2QSH X;  3J7A Y;  3ZMV A;  1BM9 A;  5F08 A;  2COB A;  4G8X A;  1R9T J;  1QBJ A;  1ON2 A;  2DFH A;  3LQQ A;  5KNL A;  4KT6 A;  1P4W A;  4LLG F;  4XRS A;  5FRM A;  2Z1D A;  5IYB J;  1JUS A;  1DDN A;  1U8B A;  4KIS A;  2EV5 A;  5BPI A;  2HOE A;  3CME I;  1AKH A;  2EFW A;  3RYR A;  3ZOB A;  4RB3 C;  3IKV A;  4N0B A;  5FKL A;  3QRF F;  1T2K A;  4HQE A;  2JTV A;  2NYX A;  3A0B C;  5FLX Z;  2V7F A;  2HQR A;  2A68 F;  4ASN A;  3S3M A;  2FUG 2;  3J7Y J;  1UEL B;  3F6V A;  1YQA A;  2E1M C;  3O8H A;  3VEP A;  5B5E C;  1EJ9 A;  2QBY B;  2LTP A;  2OTL I;  2HOT A;  3U1K A;  3RI4 A;  4HX7 A;  1FSH A;  5FLM J;  3BCB A;  5HLH A;  2ME6 A;  3P9K A;  2HTJ A;  1I5Z A;  2R7T A;  2VKD A;  4W1U A;  3LA3 A;  3IAS 2;  4J00 A;  2XAU A;  2GWR A;  3W2A A;  4RDU A;  3OMY A;  2JPB A;  1T38 A;  4XOP A;  5DYM A;  2CV1 A;  3S1R J;  2LC2 A;  3BP8 A;  1R1T A;  4EM2 A;  4IF4 A;  1LDD A;  3CF5 F;  4UVB A;  3A01 B;  4IO9 F;  2F5C A;  1FBQ A;  3WGI A;  4XID A;  2P8T A;  1IUF A;  2MLG A;  2O0Y A;  1TQM A;  2GXB A;  4DBR A;  4Y13 A;  3JSO A;  4B43 A;  1I6X A;  3LWF A;  5FB2 A;  3WG7 H;  1XTA A;  2V1D A;  5LBQ A;  3ERE D;  2EIN H;  3BRO A;  5AON A;  2DA6 A;  3IRR A;  3H1C A;  1KZH A;  4RAZ A;  2R92 J;  2GA1 A;  1RI7 A;  2WV0 A;  2F5D A;  3IHU A;  3KCC A;  1R71 A;  4EVI A;  2LH9 A;  4JP0 A;  1PUF B;  1IO2 A;  2OCC H;  2QUF A;  4HDU A;  3ECO A;  2X1E A;  2ZSH B;  1NK3 P;  4O3M A;  2OV7 A;  3BTC A;  2DJI A;  3ZN1 A;  3OWT A;  2A5Y B;  3DBH B;  1S9H A;  4YEL A;  1X3Z B;  3KZY A;  1JT0 A;  3T0Y A;  1MDM A;  3DBL B;  3Q3S A;  1XCV A;  2P81 A;  2NS8 A;  1QQI A;  3F8F A;  4HF1 A;  4D5F A;  3M8F A;  3LSR A;  3BG5 A;  2IRF G;  3JRG A;  5IYD J;  5LLQ A;  2WAQ N;  2W00 A;  2L7F P;  2YU9 J;  3IC7 A;  2I5U A;  2A07 F;  2VQC A;  5TRD A;  3MCZ A;  2P7C B;  3CJQ B;  4IHY A;  2TDX A;  2VOD A;  3BJA A;  5AIP A;  1HST A;  4B09 A;  2JPC A;  4ZYE A;  2HGC A;  1NTC A;  3K2Z A;  2EPF A;  2KDZ A;  2WB1 N;  1E2X A;  1X3U A;  3CZ6 A;  1FTZ A;  4LIT A;  2OD5 A;  3CD6 I;  3F9K A;  1BW6 A;  4M6V A;  1ZG1 A;  1BI2 A;  3S1Q J;  3AG1 H;  3MAJ A;  3RIR A;  5LHG A;  2QQ8 A;  2IS4 A;  1KGS A;  3CQZ J;  2GIV A;  2M8E A;  2BGC A;  4MHG A;  4DW6 A;  2IGK A;  1TW2 A;  3Q9S A;  2VAS A;  3ASN H;  2Y0S A;  3K4N A;  1FLI A;  1VZ0 A;  2RC4 A;  3BTI A;  3A2K A;  4JBA A;  4BE1 A;  1WJE A;  3W6J B;  3R61 A;  3H3V K;  2HXO A;  2ISZ A;  1KU3 A;  1O4X A;  2IXS A;  3C2H A;  2L9N A;  1R00 A;  3CJN A;  2XC7 A;  1S3J A;  4J01 A;  2LK2 A;  4NBQ A;  1YS7 A;  2P6T A;  2YSR A;  3H92 A;  5E3L A;  2EK5 A;  3I3L A;  4A0Z A;  1S72 I;  1JGS A;  2CJJ A;  1LDK B;  2ID6 A;  2YS9 A;  3CUO A;  2Y9Y A;  3CTA A;  3M1C A;  2HYF A;  1Z3Y A;  2XVC A;  2HOS A;  2L4M A;  3GX4 X;  4PFO A;  4M74 A;  5CYV A;  1BA5 A;  1P92 A;  2LD5 A;  1VQK I;  4FHT A;  3PQJ A;  4D5C A;  3C3W A;  4AM3 A;  2QSG X;  1ETX A;  3RPQ A;  3S2D J;  4B47 A;  4M3G A;  2BXZ A;  2X1C A;  4XL9 A;  1ACI A;  5ICF A;  4XKC A;  3ZXS A;  1IGN A;  2K9N A;  4KYW A;  5AIQ A;  3BPV A;  4G6Q A;  3ZQL A;  1FY7 A;  2XRO A;  4PK4 A;  3EYY A;  3KLO A;  4BXX J;  3DU5 A;  2RNJ A;  3E0J B;  1BR2 A;  3CMY A;  3GWZ A;  1IDY A;  1VQ8 I;  5J1Y A;  1SFX A;  3K4J A;  5J40 A;  3GTK J;  3KYL A;  3ZQQ A;  4OWR B;  4G6D A;  1MMA A;  5CVR A;  2A5W A;  1BR1 A;  1W0T A;  1DUX C;  2HQA A;  3O6B B;  2IVM A;  4G9Y A;  1IN6 A;  2HWV A;  3R4K A;  2AS5 F;  3Q0U A;  4RGR A;  5B1B H;  5M5X J;  5LHI A;  1P7I A;  3S8P A;  2MLK A;  2CUE A;  4U7B A;  2FE3 A;  1X4O A;  3FM3 A;  1SD4 A;  3A4C A;  1N75 A;  1R23 A;  2L54 A;  4B44 A;  5LEJ A;  4A93 J;  2ZXI A;  4MQV A;  1O3Q A;  1DPR A;  1MMN A;  1RNL A;  3OY9 A;  1J9I A;  2M0C A;  1YX3 A;  3BZK A;  2CYY A;  2R7Q A;  1ZAR A;  2FF4 A;  3HSR A;  3U9G A;  3M8J A;  1OFC X;  1OCR H;  4BQO A;  4ESB A;  1ZRD A;  2PJR B;  5EZH A;  3VYT B;  4HNT A;  1XS9 A;  5EJC A;  3OYB A;  3RKY A;  1ZLK A;  1KU2 A;  2R7O A;  3OYH A;  1B8I B;  2DA1 A;  2KRF A;  4OOI A;  3DPT A;  4C2T A;  4KA4 A;  3OYA A;  3HUG B;  1WJ5 A;  1IUY A;  2IGO A;  5EEG A;  3HZJ A;  4HNV A;  1KQ0 A;  3SZT A;  5EG0 B;  3FXQ A;  3MKL A;  5HDG A;  2FBI A;  3CUQ A;  1RUO A;  2DOA A;  4S0H B;  3ZGK A;  5HOO A;  1UFM A;  4LB5 A;  3OV8 A;  1TW3 A;  2DMU A;  1UCR A;  4KT5 C;  4CXF A;  3BR3 A;  3J81 K;  3ONQ A;  1Z7U A;  3BR5 A;  1SVO A;  2MC4 A;  2JA7 J;  5HLT A;  2IW5 A;  2PMZ N;  2OQG A;  4O6J A;  2MW8 A;  2K9S A;  4WXH A;  2STT A;  4FQG A;  4AVZ A;  1HCR A;  2LRE A;  3CCR I;  5DUK A;  2OBP A;  2E5N A;  1SC7 A;  2MC3 A;  1V3F A;  2OA4 A;  1IW7 F;  1G3W A;  1BIA A;  3K4B A;  6PAX A;  3HOX J;  3R60 A;  1LVA A;  3HRM A;  3GLX A;  2BY2 A;  2VBZ A;  2NNY A;  1Z05 A;  1W7P A;  1OCP A;  2HYJ A;  4W97 A;  3KFW X;  3WGH A;  2Z2S B;  4IOA F;  2Z5U A;  2WAD A;  3EUH A;  4D1Q A;  3RZO J;  3ZP5 A;  3KYC B;  5JLX A;  3ZR8 X;  3KP4 A;  1YFH A;  2DOD A;  1EV7 A;  4FCY A;  3FIS A;  4DOZ A;  3P5J A;  5D4R A;  1QVU A;  4A3L J;  1I6H J;  3ZCO A;  2Y0M A;  1AU7 A;  3GZN B;  2QCO A;  4OAY A;  1XSD A;  4CYC A;  4BJ5 C;  1YJW I;  1BW5 A;  2Y9Z A;  2O03 A;  4IHW A;  2EIJ H;  4HST A;  5HS8 A;  4IPA A;  4PCQ A;  4UV9 A;  1BI0 A;  3WU1 B;  2QYO A;  2ELJ A;  1EKE A;  2LMD A;  5KCM A;  1F4K A;  3KE2 A;  2PG4 A;  5D6F A;  2JA5 J;  1U5T C;  2ZB9 A;  1SVM A;  1Y56 A;  4CH7 A;  5LFA A;  1BR4 A;  3BJO A;  2LRD A;  4IRI A;  4ZC3 A;  4Q48 A;  3G1O A;  2JN6 A;  4NQW A;  1GVJ A;  2FX0 A;  2QKM B;  2GBY A;  2VT2 A;  2E1C A;  4M3F A;  4XKW A;  1FP2 A;  2V1X A;  4B48 A;  3DU6 A;  4AYB A;  1POG A;  2RV8 A;  4DQ2 A;  4BNC A;  4GO1 A;  3T8R A;  2LF7 A;  2STW A;  2JA8 J;  1MBF A;  3OYJ A;  4YIR X;  2CV0 A;  5JFR A;  4RB1 A;  5HS7 A;  1K83 J;  4C2M J;  4QSH A;  3FHZ A;  4L5I A;  4CYD A;  3K7A J;  1I1S A;  1V54 H;  2MAB A;  2WC2 A;  4HLX A;  3DLA A;  4M9Z A;  5HLG A;  2PI0 A;  2RNG A;  2IBD A;  2K7L A;  2HYG D;  4H4K C;  4BE2 A;  1JHH A;  2WAF A;  3DF8 A;  2R5Y B;  2NS0 A;  2DAO A;  2JVG A;  4MEX F;  1U9O A;  2XGD A;  2NNN A;  4JOM A;  2FNA A;  2DOF A;  3DP7 A;  5CVJ A;  5CJ9 A;  1X1P A;  5BMZ A;  4LJZ F;  1A04 A;  4FX0 A;  4AIJ A;  2CV2 A;  2KIS A;  2KZV A;  1A6I A;  1UZC A;  1CQT A;  2XHK A;  3CC4 I;  2ELH A;  2DFE A;  5E18 F;  5DUI A;  4E7J A;  3BPX A;  3OS2 A;  1MMG A;  1IC8 A;  1FSE A;  2KRC A;  1EH8 A;  2ESH A;  2FD5 A;  2FQ3 A;  5F64 A;  2CW0 F;  2KDO A;  1SEU A;  1VQ9 I;  3KEY A;  2X0L A;  3HPH A;  4PFP A;  3ZMS A;  3VSK A;  1RUN A;  1A5J A;  5FJ8 J;  4DIQ A;  1LEB A;  5FRN A;  1ZLJ A;  5FLV A;  1MNE A;  2BEO A;  4LB6 B;  4MO7 A;  1ZRC A;  4HW0 A;  1T0F C;  4JQF A;  1WGX A;  1X4P A;  4B3X A;  2W1O A;  1W36 C;  1TT5 B;  2M34 A;  3QYB A;  1AHD P;  2AQE A;  1Z91 A;  1O3T A;  1YW8 A;  5E8G A;  4A3E J;  5F0F A;  1B59 A;  3K4M A;  3JRB A;  2R0Q C;  3G6E I;  4JK1 X;  3PO2 J;  2QSF X;  4OMZ A;  1GVD A;  2DFI A;  2LSO A;  4MIM A;  3M4O J;  4I7H A;  4XRF A;  3S3N A;  2DT6 A;  5H6Q A;  3HYI A;  1TQI A;  3S1M J;  2EB7 A;  3GTJ J;  2P0W A;  4BBR J;  1DP3 A;  1Y6I A;  3I0T A;  1KQ9 A;  4EGZ A;  3B02 A;  4YFN F;  2AXL A;  1U2W A;  1S7O A;  2L7Z A;  2I10 A;  3PNV A;  3TKY A;  2VKH A;  2KIF A;  3PIP F;  2W82 A;  4M9X A;  4RGS A;  2VON A;  4XN3 A;  3L2R A;  1D5V A;  4AWX B;  2LNB A;  4Y17 A;  1QZY A;  4XMY A;  3F8B A;  1YIO A;  4HZF A;  5JHU A;  3NWT A;  2D5V A;  2O8K A;  4QPQ A;  3F23 A;  4IX7 A;  3MN2 A;  1ENH A;  2F5V A;  3RPU D;  2X4H A;  2NS7 A;  4UUS A;  2X6W A;  4MTE A;  4ZDP A;  1ITY A;  4BDZ A;  1ZYR F;  4G7H F;  5BQT A;  2RN7 A;  2H8R A;  4TV7 A;  5F0H A;  2K3F A;  3GFM A;  4GDF A;  1JT6 A;  3FMS A;  1OJL A;  4NHJ A;  3OYL A;  1IZ1 A;  4RLQ A;  3IAM 2;  4HOB A;  2OCE A;  4D0P A;  2UWM A;  1V4R A;  2QQB A;  1OCT C;  3HOY J;  4UHT A;  2YX7 A;  2CU7 A;  2V9K A;  2RGV A;  2XGE A;  3RQI A;  2NOJ B;  3D0S A;  3F6O A;  3J7Z I;  2LY1 A;  2X48 A;  4M3D A;  4X1E A;  4BY1 J;  3HM5 A;  4XBF A;  2EA4 A;  2IGN A;  5IPA A;  5EF6 A;  1RPW A;  3PNT A;  4F91 B;  2L3D A;  1MH3 A;  2VJI A;  3DEW A;  5DM7 F;  3NRV A;  3LAJ A;  2NVX J;  3BG6 A;  4LG3 A;  4AVP A;  2R3S A;  4ETS A;  1FMW A;  4A3G J;  3VB2 A;  1SFO J;  5FLX K;  1ZAO A;  2L0K A;  4LLN A;  5BOX A;  4BEH B;  3E5U A;  2OU2 A;  1UHS A;  2KRH A;  4Y15 A;  3UNG C;  1TC3 C;  1JKR C;  1ZH5 A;  2V79 A;  1MGT A;  4FT8 A;  1OQY A;  2ZME C;  3PFI A;  3K4K A;  5K5O A;  1J0R A;  4EAT A;  2KIM A;  3JRH A;  2OZ6 A;  1YHQ I;  3ROU A;  3V7R A;  4L9V A;  3SQN A;  2OQR A;  2VE9 A;  1JTY A;  4IXA A;  3TP0 A;  1HBX G;  5JHF A;  1W4M A;  5F0C A;  5E1Z B;  2IAI A;  2MSY A;  3F3X A;  3B6C A;  4C3J J;  2A69 F;  1Y1W J;  1S5L C;  2VI6 A;  4IVN A;  3I54 A;  3PNY A;  2GA2 A;  1X1B A;  4IJA A;  1Z7L A;  1Z0X A;  4A2U A;  2EH3 A;  3VWB A;  3SHF A;  1B9N A;  4IOC F;  1Y8Q B;  2BBY A;  2D2W A;  3IP4 B;  2X51 A;  3BZ6 A;  3S93 A;  3H3Z A;  3H3U A;  1KON A;  3ML6 A;  1ZQ3 P;  3N05 A;  2HVS A;  5FD6 A;  1TNS A;  1MKM A;  2GM4 A;  4ON0 A;  4I02 A;  3HOT A;  1R4M B;  3QP6 A;  1G8X A;  2L01 A;  3CCE I;  3S14 J;  1ZGJ A;  2Q2E A;  3CMA I;  2K40 A;  2MH2 A;  3QQA A;  5BS6 A;  1STZ A;  1MND A;  1WKM A;  4P5O A;  3ESW B;  1K4S A;  3QU3 A;  4BKX A;  4HA8 A;  2PJP A;  2E60 A;  4BY7 J;  3IH4 A;  4P96 A;  1QVT A;  2E71 A;  2UV1 A;  1F9N A;  1FYM A;  2G9W A;  4UUT A;  2KZG A;  3MZH A;  1ZHF A;  4UB6 C;  2QKL B;  1HW5 A;  3GFI A;  2DQR A;  4CO8 A;  3SYT A;  3U2R A;  2BOL A;  2Y0S N;  4H0E A;  3LMM A;  3FMR A;  3RCO A;  1T6S A;  3V7C A;  5HVQ C;  2CFO A;  1FBU A;  1LEA A;  3FMQ A;  3ECH A;  3CC7 I;  4P9F A;  3WOD F;  2O9L A;  2A6T A;  2JJ7 A;  3LSP A;  2CSO A;  1YG2 A;  2YX4 A;  2M0M A;  3H9G A;  4ZJZ A;  3ERM A;  3JCU C;  3I56 I;  1I1G A;  2VBX A;  4MNU A;  5BNG A;  1O7L A;  1K6Y A;  4HRI A;  2BE5 F;  4Y33 A;  3QPH A;  4IRG A;  2COM A;  4OMY A;  5LGT A;  3JAM Z;  2K3P A;  2ZJR F;  2IEK A;  3KP3 A;  1CF7 B;  1HKT A;  1RKW A;  2IPQ X;  3CP2 A;  2F2E A;  4BGD A;  3ZMZ A;  2EIM H;  1K61 A;  3OYE A;  1F5T A;  2KQR A;  2VC0 A;  2W85 A;  2ZME B;  4WK8 F;  3DTI A;  3TL4 X;  1LQ1 A;  3SZG A;  5FRO A;  3ZMT A;  3ZN0 A;  2CMP A;  4RB0 A;  1E3P A;  3PSI A;  3PL8 A;  5F1J A;  3IL2 A;  3PM1 A;  4LFU A;  1ZR4 A;  1SD6 A;  1YOV B;  1UHM A;  3HC7 A;  3CO6 C;  2MD5 A;  3MD2 A;  4KIG A;  2AXT C;  4ESF A;  2F48 A;  3B6A A;  3FXK A;  4XR6 A;  4HV5 A;  2VKV A;  1IV8 A;  1LNW A;  2E35 A;  5E3M A;  2KIQ A;  5IP9 J;  1OCZ H;  5JVT A;  4X6A J;  1UHW A;  2VL8 A;  1J09 A;  2A6E F;  5FKN A;  3GTO J;  4E7L A;  3WHC A;  1FYL A;  3I71 A;  1V5E A;  2VPR A;  1JKP C;  4LG0 B;  3FZV A;  3OOP A;  2BY3 A;  2EQR A;  5E17 F;  3MFK A;  4E6K G;  5HDK A;  2O6G E;  4LIV A;  5E79 C;  1YW7 A;  4I0A A;  1AA7 A;  3L1P A;  1U0J A;  3QYF A;  2EZH A;  1E17 A;  1R5H A;  2XAS A;  4FET A;  3W3C A;  3I5U A;  4HAM A;  4YIF A;  3ULQ B;  3OYK A;  2R7V A;  1ODD A;  4ENJ A;  2BXY A;  3N4M A;  4ZDO A;  1HKS A;  3GF2 A;  1OYW A;  3H5A A;  3KET A;  1CGP A;  3Q5F A;  3BWG A;  1OLT A;  2IGM A;  1BN5 A;  2WBM A;  3JRF A;  3K9T A;  4YG2 F;  1ULY A;  4PJN A;  5L3E A;  2VXD A;  4PSX A;  1WRJ A;  3WTT C;  3I59 B;  1JI8 A;  1I3A A;  4ESJ A;  1SD7 A;  2X6Y A;  2V4J C;  3D5S C;  5ICE A;  2AQF A;  2W25 A;  4KMU X;  1D0Z A;  1B6A A;  3H36 A;  4KUM A;  3RDI A;  1X1A A;  3HKZ A;  4A3C J;  2MH9 A;  3OL4 A;  2M9H A;  1FPQ A;  4PJ0 C;  5TIS C;  3FIW A;  3BQY A;  3PFY A;  3OS0 A;  4CCN A;  3H5N A;  3Q0V A;  3PQK A;  3KZI C;  4ZTJ A;  2LBF A;  5EGO A;  1XGO A;  2Q1Z B;  1MW7 A;  1YIJ I;  1R1V A;  2TCT A;  4XM3 A;  4E4H A;  4F55 A;  1TT0 A;  2BW3 A;  2Y48 A;  2RQP A;  2FBH A;  1D1A A;  1ZRE A;  1XDU A;  5HDN A;  1GXQ A;  1TWF J;  5ILS A;  4BHP A;  2Z3Y A;  2JSC A;  4F7Z A;  1EH6 A;  2X85 A;  2R7X A;  4F92 B;  4ZDL A;  4AC0 A;  3S16 J;  1BI3 A;  4CCO A;  2QEN A;  3E5Q A;  3G73 A;  1P7J A;  4M6X A;  3DEU A;  1ETV A;  3EDP A;  1SFE A;  4LMY A;  2WY7 Q;  3JW4 A;  3FX3 A;  2HPM A;  5ERI A;  1IG7 A;  1SVL A;  1MBE A;  4U0W A;  5LRS A;  2DN0 A;  1MZB A;  1ZTR A;  2H8W A;  2G0E A;  1XGM A;  1P9Q C;  2R7D A;  2R93 J;  4RA2 A;  3I4N J;  1SMY F;  3TO6 A;  1IF1 A;  2R5Z A;  1XGS A;  4XLP F;  2A3S A;  2PX9 A;  3K4L A;  4N9H A;  2R7F A;  3ZQI A;  4BH9 A;  1UG0 A;  3J7A O;  3CLQ A;  4AYB N;  2XF7 A;  3V42 A;  1XMA A;  3K1P A;  3ASO H;  4BBS J;  1ETQ A;  5IOY A;  3S1N J;  3KPH A;  3QAH A;  4B1R A;  4AIH A;  3CCU I;  2XKO A;  3K1M A;  3TGN A;  5EZG A;  5CQG A;  1A6Q A;  1MMS A;  3HEF A;  4A0Y A;  1QO0 D;  1ON1 A;  1K78 A;  1NG6 A;  1B1B A;  5J47 A;  2H27 A;  3LAP A;  3HOZ J;  1NG7 A;  3VYR B;  4WF2 A;  3LSJ A;  1U5T A;  3QU6 A;  2WV1 A;  3BT9 A;  1MSF C;  4C3H J;  1JTX A;  2BZT A;  2CUJ A;  5DCM B;  4BJT A;  2M1B A;  3ZPL A;  1QPI A;  3NAR A;  5E1W A;  3O2P E;  2O3F A;  3PUB A;  4P9U A;  2PN6 A;  5D5X B;  4PJL A;  3GBG A;  2O7O A;  3BLY A;  4A69 C;  4J19 A;  2J5P A;  1BL0 A;  3TQN A;  1TP4 A;  2M3A A;  2W4S A;  2MA3 A;  2HDC A;  1YO5 C;  2EFP A;  3BQZ A;  2D45 A;  3RTR A;  3V8L A;  3CCS I;  4OU0 A;  5IT9 K;  2Q0O A;  2H09 A;  4V19 K;  3IRQ A;  1ZRF A;  4BQA A;  1Z21 A;  2MD0 A;  4B3A A;  4EM0 B;  1MNM C;  1J75 A;  3BJ6 A;  1HSJ A;  3K4C A;  4XOT A;  5FO5 A;  2BVM A;  3UKG A;  3BOQ A;  1R22 A;  3IH3 A;  3GTQ J;  5JLW A;  2KFD A;  3T1B A;  1MMD A;  3SDG A;  2PMH A;  1FOX A;  4F93 B;  1GT0 C;  1XX5 A;  2EFO A;  2ME0 A;  3OL3 A;  3V4G A;  2XAH A;  4ZZL A;  4LK0 F;  2A6H F;  3TDU C;  3FXM A;  2JVH A;  2PFB A;  4ZYA A;  1TWA J;  1LDJ A;  3VYS B;  1LUJ B;  2K85 A;  3L2U A;  1GHC A;  4WXC A;  2ICW G;  4XQF A;  5F6F A;  3BTL A;  2LY9 A;  3BR0 A;  1FP1 D;  3JRD A;  1N77 A;  3ZMU A;  2HDW A;  1B72 A;  1YRN A;  2E36 A;  2P7V B;  1T95 A;  1Y39 A;  1XSX A;  3OR2 C;  1JGG A;  2F5F A;  1U78 A;  3DBR B;  2GOM A;  2LLK A;  2M5W A;  3M7G A;  1GXP A;  1AKH B;  4KMF A;  2MG4 A;  3MEX A;  2B63 J;  2P4W A;  2X1D A;  4AIK A;  1DGR M;  3H0D A;  2CQX A;  2VJJ A;  3CMM A;  4EMS A;  3K70 C;  3C2B A;  3H35 A;  4YII A;  1X1C A;  1VTN C;  2NVU B;  4CCJ A;  2HZD A;  1LE8 A;  4HX8 A;  3QYE A;  1IV6 A;  1ZG3 A;  1T0F A;  1P4A A;  5LD2 C;  3ZQG A;  3DKW A;  2OTJ I;  3K0L A;  1RZ4 A;  3NEU A;  3PJR A;  3MZY A;  2XB5 A;  3IH2 A;  3ZQC A;  3QPS A;  5L3C A;  5F27 A;  1O7F A;  1UG2 A;  4FIS A;  2HOA A;  3HPG A;  1SD5 A;  2DTZ A;  2KT0 A;  2K86 A;  2XB0 X;  2K9Q A;  3AG2 H;  2XGC A;  2DW4 A;  2WY8 Q;  1BC8 C;  4AU7 A;  2VT3 A;  2KLO A;  2HKO A;  1WHU A;  4WCG A;  2FOW A;  2M7B A;  3KEQ A;  4L5E A;  4XKV A;  1XC5 A;  4N9I A;  2N8G A;  4L18 B;  2KPM A;  3RPU A;  1VQN I;  4AD9 A;  4MGR A;  4ZYH A;  3RKX A;  2M4G A;  3MVP A;  3I58 A;  2Y2Z A;  1ZGA A;  4ENM A;  2YUS A;  5FD5 A;  1YLF A;  3N97 A;  3FBI B;  4RAY A;  1HF0 A;  3TOA A;  2DU9 A;  5CVI A;  5DM6 F;  1YTY A;  1P2F A;  3HHG A;  3LST A;  4LD5 A;  4F52 A;  3JSP A;  2QWW A;  2ETH A;  3AL0 B;  1E3H A;  1SFK A;  1Z6T A;  3HXL A;  2M87 A;  1XDS A;  4EJO A;  3WGG A;  1G3S A;  3EYI A;  3V8J A;  3JRA A;  4XON A;  3PSF A;  4P55 A;  4PJJ A;  3D5R C;  3S15 J;  1MDM B;  3C2G A;  4E70 A;  3VDX A;  5F04 A;  1RC9 A;  3CLO A;  5K7Z A;  3OIO A;  3VSL A;  1QZE A;  2EBI A;  2WA0 A;  3I9V 2;  3VFZ A;  2XRN A;  5TJJ A;  4DZP A;  5EYR A;  5GTI C;  3P7N A;  1FOK A;  1A36 A;  3A1Y A;  2VQG A;  3ELK A;  3TED A;  4G6T B;  1LKX A;  1XGN A;  1JKO C;  1P4X A;  2Z16 A;  3DV8 A;  3DPU A;  4IRH A;  1PJR A;  1UB9 A;  1M1E B;  2LFB A;  3O3K A;  2MFZ A;  1VQ6 I;  5EEA A;  2WAE A;  3HOW J;  2V1N A;  2UXX A;  1OIS A;  1Y1V J;  3A02 A;  2LDU A;  1HW2 A;  1R49 A;  3DLL F;  2CH0 A;  5J8F A;  1MJ9 A;  1UAA A;  2DT7 B;  3DKY A;  4I76 A;  3CES A;  4A3M J;  5FKO A;  1X2N A;  4R8H A;  5J4Y A;  2IA0 A;  3E6C C;  4V2F A;  5D8L B;  3HGG A;  2E1N A;  2L9S A;  2HS5 A;  3TOB A;  2BY0 A;  3K1N A;  2VQH A;  9ANT A;  1APL C;  1G59 A;  3G3Z A;  1IRX A;  2CWE A;  2M2E A;  3CUQ C;  2D1V A;  2EWN A;  4QPO A;  3WTW C;  2BVL A;  5ICG A;  4ENN A;  1G4D A;  2EFQ A;  5CPR B;  4RM3 A;  1XMX A;  5DD8 A;  3J80 Z;  2DT5 A;  2QBY A;  2F4O B;  3P9C A;  2XV4 S;  1V5G A;  2BYV E;  3FXO A;  4HEA 2;  4PUS A;  2HTS A;  4BL0 B;  3SDB A;  3G71 I;  2ISY A;  1L0O C;  2P6S A;  2VKE A;  1BOB A;  1YJN I;  3E3V A;  2BV6 A;  1PP7 U;  2XSJ C;  3DWL E;  4Y3O A;  2DYS H;  2CW7 A;  2ECC A;  1KU9 A;  1TWC J;  4BYY A;  1JJ6 C;  2CQQ A;  1HKQ A;  1RR7 A;  3TBI A;  1W36 D;  4EJW A;  3CDL A;  1F43 A;  5E20 A;  3FM5 A;  3EQL F;  3QWL A;  1A35 A;  1DPU A;  4A6E A;  4XRS G;  2EZK A;  5EDN A;  1OR7 C;  1ONV A;  3A01 A;  3K10 A;  3DFG A;  5J4V A;  2YU3 A;  2G7U A;  2CS3 A;  2R4G A;  2CQN A;  3GTG J;  2DPU A;  3HSF A;  1PVE A;  4BU2 A;  3SZP A;  1DGW Y;  3GW2 A;  3W6K B;  1K79 A;  3RYP A;  4U7D A;  1MBH A;  4MFE A;  3DKX A;  3WTY C;  3SEZ A;  3WU2 C;  1VFC A;  2JZY A;  3RSN A;  3E6M A;  1ZK8 A;  4XSX F;  2ZJ2 A;  2FOK A;  2R7R A;  1TNT A;  1PUF A;  4MEY F;  4RB2 C;  2OPT A;  5F1R A;  3A03 A;  1A31 A;  1XSV A;  4FAS D;  3MWM A;  1FEX A;  1QHG A;  4JYK A;  4DYQ A;  3F8N A;  5D5V B;  4M3E A;  1RIO H;  1AOY A;  1XG1 A;  2VPL A;  1REP C;  2ZXJ A;  2W7N A;  3SFI A;  3TO7 A;  1VQO I;  4L5J A;  3CO7 C;  3CCV I;  1JKQ C;  3S32 A;  2ZNY A;  2CUZ A;  2XF6 A;  1ZR2 A;  3CUQ B;  2RVC A;  2HXI A;  1J2X A;  3CC2 I;  3V8K A;  5KAI C;  3AKZ A;  4DNC A;  1VQM I;  4I99 C;  2DMT A;  3OYD A;  4IQ4 A;  2V9V A;  2P5K A;  4L9J A;  1EH7 A;  2UZK A;  2UXN A;  4HYE A;  4Y4R A;  4JX4 A;  2ELK A;  2Y31 A;  1P6R A;  3C1D A;  3BG9 A;  4XLN F;  3SEQ A;  4CSW A;  4HNU A;  5IP7 J;  3GTL J;  3OR1 C;  1FZP B;  1D8K A;  4F3Q A;  2Z33 A;  3AG4 H;  1VQL I;  1YIT I;  3WTS C;  2DDA A;  4A0X A;  3BG3 A;  4N4O B;  1MJB A;  3DTE A;  5KHD A;  4CCK A;  4NC6 A;  3CDI A;  1QHH D;  1IXR C;  4IQJ A;  2JA6 J;  3RKW A;  4U0Y A;  2E2J J;  1W7P B;  4KFC A;  3ABU A;  2XPU A;  2XF5 A;  1IRZ A;  3HKZ N;  1NK2 P;  1BI1 A;  3HSE A;  4DBQ A;  3U1D A;  2VBY A;  3QOD A;  4BE0 A;  4BAC A;  1XN7 A;  3U21 A;  3LFK A;  2AHQ A;  1FWZ A;  2M45 A;  4M73 A;  4CYC B;  2ZC2 A;  5CQE A;  2HVQ A;  3PIO F;  1R6R A;  3W6V A;  4XK4 A;  4BAY A;  2XDV A;  4UXN A;  5L3G A;  2F4I A;  5DDG A;  3F72 A;  1DU0 A;  3I4P A;  4I09 A;  1J5Y A;  1S29 A;  3K6G A;  2PMU A;  1XPX A;  2YPR A;  2E2H J;  2DO7 A;  3HOS A;  2DI3 A;  4EJV A;  4RGX A;  1KYW A;  3ABT A;  1T98 A;  1WJF A;  2XAQ A;  3LNQ A;  2HEO A;  2IS1 A;  1X58 A;  4NQW B;  3S17 J;  3JRC A;  3GTM J;  2K02 A;  2L02 A;  1PDN C;  3G1L A;  2JUG A;  1R36 A;  3D5L A;  4PGH A;  5LEK A;  2KKO A;  1BC7 C;  1QA6 A;  3T8T A;  2BHY A;  2FQ4 A;  3T5X A;  2P5L C;  1O3S A;  4I2O A;  1OPC A;  3E1S A;  4HPQ A;  5H20 A;  3GFJ A;  3R6S A;  4BJ6 C;  4A5N A;  2LKX A;  4RM2 A;  3BZC A;  3CJT B;  2MGQ A;  4JX6 A;  3K69 A;  1WZ2 A;  4ANJ A;  5HLI A;  4PJM A;  2NAZ A;  2E2I J;  4OIP F;  2IP2 A;  2B9S A;  2K9L A;  3OIP A;  2FU4 A;  5LGN A;  5GPC A;  5M5Y J;  4MTD A;  3KX2 A;  3CDH A;  1DU6 A;  4KN7 X;  5HNH A;  3WE3 A;  5K1Y A;  3TW6 A;  3KLN A;  2CG4 A;  4BQN A;  3F8M A;  2PJR A;  4A5M A;  4C2U A;  2FA5 A;  3PO3 J;  3QPT A;  4A6D A;  4IHS A;  2EJR A;  3HJE A;  4D7N A;  2F4M B;  3LA2 A;  1B8I A;  1E0E A;  2JWT A;  1C0W A;  3HUG A;  3OYI A;  4EM1 A;  2P5V A;  3KP5 A;  5EG0 A;  3GYH X;  3OS1 A;  4DYR A;  3MKY B;  2E7W A;  1Z9C A;  2E1O A;  1ETK A;  4DYC A;  5JVG F;  4A3F J;  2PEX A;  1QPM A;  3H9Q A;  2CW8 A;  4II3 A;  4G7Z F;  1U9N A;  5GP9 A;  5ILV A;  5FFZ A;  1E3O C;  2CQK A;  5GAH J;  4I01 A;  2L7K A;  3BR1 A;  2V9P A;  3OYM A;  4M72 A;  3G2B A;  3ZQF A;  2HNH A;  3Q9V A;  1LFU P;  3RQ4 A;  1ETY A;  2KP6 A;  5HOD A;  2DK8 A;  5K7H A;  1XMK A;  3F8C A;  2LF8 A;  3GZ6 A;  4OIQ F;  2EA2 A;  4G12 A;  1J7K A;  1SMT A;  1OKR A;  1LFP A;  1ZN2 A;  3FXR A;  3BCA A;  2H1L A;  2IA1 A;  3GVA A;  4ZZD A;  2NRA C;  4L0Y B;  2IJL A;  5IOZ A;  1PUE E;  4NC8 A;  3HGY A;  2VXZ A;  2IS6 A;  4C3I J;  2PQ8 A;  2QLZ A;  4S04 A;  1B4A A;  1T56 A;  3GO5 A;  3HRT A;  4XKB A;  1G3Y A;  2DCE A;  1B9M A;  3TO9 A;  1X3W B;  2K27 A;  3ABK H;  2R7U A;  5M3F J;  3L00 A;  2LOO A;  2FNP A;  1GUU A;  2KJB A;  1MJA A;  1T33 A;  3ZQ7 A;  2KJC A;  1YI2 I;  2F5E A;  1GV2 A;  4CIC A;  1H88 C;  2GIZ A;  1LVK A;  2DFF A;  2E19 A;  2RRE A;  2XRL A;  1MD0 A;  3WG9 A;  3VYU B;  4HG2 A;  1R58 A;  1MBG A;  2HI3 A;  3A0H C;  4U87 A;  4XLF A;  2OAZ A;  4HV6 A;  4GFB A;  1IXC A;  2XKP A;  1SFU A;  1BJA A;  3AG3 H;  4BS9 A;  2K5C A;  2V6C A;  3LSK A;  5LHH A;  3DPL C;  4WXD A;  2VBW A;  4A3J J;  1GV5 A;  4MFD A;  5EEH A;  4FE4 A;  1WWX A;  2IS2 A;  1FIP A;  3FDY A;  3H9J A;  4YFX F;  4UUS B;  4ZTF A;  1T39 A;  4EV0 A;  5KAF C;  5D6E A;  1RR8 C;  4A12 A;  1LB2 A;  1PYV A;  4HX4 A;  3OIQ A;  2KL4 A;  2LKP A;  3M07 A;  1T08 B;  3AAF A;  2JMW A;  2VJ4 A;  2WWY A;  3GTP J;  4DGW B;  1Z67 A;  1W5T A;  4UV8 A;  5GPA A;  2V6E A;  5GAD J;  4E7I A;  1N25 A;  2ACJ A;  3HRU A;  3CCL I;  5A2Q Z;  5KK1 A;  4RLF A;  2HQN A;  2OC6 A;  1LJ9 A;  3L2C A;  3SJM A;  1BBY A;  1KQ8 A;  1Y0U A;  5CVU A;  2DJN A;  2TRT A;  3HDD A;  2LP0 A;  2R5Y A;  3M8E A;  2IA2 A;  3R0J A;  2Y69 H;  1S7E A;  1K6O A;  2IT0 A;  2MYS A;  5M3M J;  1Z6R A;  3D1N I;  3G4S I;  2E1M B;  3OYN A;  2G7H A;  3IKT A;  1IDZ A;  5KVR A;  3F0C A;  2DXI A;  4QIW N;  1TWH J;  2JQ7 A;  1RES A;  1RET A;  4CCL A;  2HVR A;  4BUP A;  4EEF G;  4IZZ A;  1GLN A;  2GXA A;  2DMQ A;  1HW1 A;  2I8D A;  2UUZ A;  2X9D A;  3ABL H;  1D3Y A;  1FC3 A;  2DTR A;  2FEZ A;  2GLO A;  1YS6 A;  2GQQ A;  2H94 A;  2VB6 A;  3O8G A;  4FX4 A;  2FRH A;  2DYR H;  1J59 A;  2LYC A;  4RAG A;  2CO5 A;  2NVT J;  1HA8 A;  3EUK L;  1X2M A;  2H6B A;  2DPD A;  4M6Y A;  2HFH A;  4MQ9 F;  4WX9 A;  3M3Y J;  3FKI J;  4L9T A;  5D8K B;  2ZBK A;  3TW7 A;  2XPV A;  2DBB A;  1KA8 A;  4Z2Y A;  2NVY J;  4XLC A;  2HDD A;  5C3E J;  2DMN A;  4S05 A;  1SAU A;  3L2Q A;  5C4J J;  1VQP I;  2JSP A;  3QOP A;  1Q1H A;  3TMO A;  3MQ0 A;  2VE8 A;  2Z9O A;  1R1U A;  1HQC A;  2EV6 A;  2L2O A;  5B3S H;  2M8G X;  1I27 A;  4A3I J;  2LKS A;  4JX5 A;  2ZFU A;  5J1U A;  3JRI A;  2RQQ A;  4CCM A;  3LA7 A;  4QTR A;  4EJT A;  1FT9 A;  4KDP A;  1Z1D A;  2QEX I;  4NDL A;  5D4S A;  3VPR A;  1DP7 P;  2DA7 A;  1MBK A;  1W5S A;  2ZCW A;  4HQM A;  4Y7N J;  1O3R A;  2QQA A;  2ZFW A;  1FMV A;  5E3O A;  4UY8 I;  2Q2E B;  1ETW A;  1YYV A;  3HRS A;  5IY5 H;  2FMY A;  3RJP A;  4Z6Y A;  1TZL A;  4PZJ A;  1JHF A;  1YX5 A;  1U8R A;  1D5Y A;  1TTY A;  4YFK F;  3LOC A;  1W0U A;  1R5G A;  4N4N B;  2ZXW H;  3VOE A;  1K4T A;  3AFH A;  3DTK A;  2CUF A;  2DLL A;  2NXN B;  3OYC A;  5BPD A;  2XGX A;  1D1B A;  2M7A A;  4E7K A;  5LRR A;  5B66 C;  4NNJ A;  1VF9 A;  1H89 C;  3HIF A;  4LOC A;  1FOY A;  1BIB A;  1KU7 A;  2HQ5 A;  2E34 A;  4D7M A;  3AL0 C;  4QWQ A;  2B7E A;  5B1A H;  1JJ8 C;  2DOE A;  3FF5 A;  3LL7 A;  1O57 A;  3V7S A;  1U3E M;  1WH7 A;  3ABM H;  4IEJ A;  2OF7 A;  2ZXH A;  4A3D J;  1F1Z A;  2GZW A;  3GUD A;  5FKM A;  3F22 A;  5IP6 A;  1U6G A;  1F36 A;  3DEE A;  1KYZ A;  5E1X A;  1MBJ A;  1FTT A;  1USS A;  1OCC H;  3MKW B;  5JR3 A;  3F21 A;  3GXO A;  4NC7 A;  2K4J A;  4XSZ F;  1QZZ A;  2JRT A;  2KHM A;  2JT1 A;  2XAF A;  3B73 A;  4GXO A;  2DK5 A;  3SFZ A;  1LFB A;  1Y0N A;  1VI0 A;  1DQU A;  4BXF A;  1K7A A;  1HDP A;  2L9R A;  3L7W A;  4LK1 F;  1IXS B;  4XLH A;  1FNN A;  3ISP A;  4QLC U;  2R7S A;  3E5X A;  3FXL A;  3KP2 A;  4D9J A;  2VLA A;  2VQL A;  3OOU A;  2QM3 A;  3S2W A;  2VC1 A;  2RAE A;  1H9T A;  1TWG J;  1HDD C;  4CA0 A;  1WQ2 A;  3K70 D;  4WWC A;  1FJL A;  2BY1 A;  1HXD A;  2HPI A;  1ORK A;  1W1W E;  3IUO A;  4IHV A;  3REO A;  4R79 A;  4BEH A;  2QQ9 A;  4HLY A;  2Y75 A;  1TQP A;  5L3F A;  1G6N A;  3J80 K;  1IJW C;  1ZEL A;  2JUC A;  2VJ5 A;  2WAQ A;  1WJD A;  3UR3 C;  4E7S A;  2C6Y A;  1YW9 A;  2KIU A;  3WU0 A;  1FX7 A;  5C44 J;  1OR7 A;  3BR6 A;  4OIO F;  2H1K A;  1T8I A;  3CJR B;  1G3T A;  3FBN B;  1H0M A;  2DA2 A;  3K2A A;  2ESN A;  3FXJ A;  2O8X A;  3MKZ A;  1IN8 A;  1QGP A;  3S2H J;  2ECB A;  3BG7 A;  2WB1 A;  5IYC J;  3W2V A;  1QNT A;  1L3L A;  4UNO A;  1MSE C;  4AID A;  2LG4 A;  2MBF A;  2B0L A;  2PLY A;  2OUM A;  5E8I A;  1TBX A;  2LVS A;  3DXJ F;  4DJA A;  2ZJP F;  3WTV C;  3LSG A;  2LR8 A;  3FWE A;  2LY2 A;  4KIB A;  2ZJQ F;  1RRJ A;  1AWC A;  3LQR A;  4PSW A;  4IKF A;  2AO9 A;  4KJZ A;  1WFX A;  4RS8 A;  1YJ9 I;  1OCO H;  3HB9 A;  1NH3 A;  1VQ7 I;  2ZKZ A;  5DS9 A;  2GAU A;  2J5O A;  2O5R A;  5J3L A;  1Q1V A;  1XCB A;  5IT9 Z;  3CCM I;  1D1C A;  2FSW A;  1EF4 A;  2VUM J;  4DZJ A;  4E7Z A;  2ID3 A;  1UMQ A;  2H6C A;  2LBF B;  5J8C A;  5EGO B;  3RZD J;  3BY6 A;  2RKH A;  3CCJ I;  3MZ8 A;  4IL6 C;  3LSI A;  1W5C C;  3L09 A;  2GOX B;  5H6R A;  2FML A;  1R5I D;  4UB8 C;  1SAN A;  4X0G A;  2BW3 B;  3IWZ A;  1MIJ A;  4KNY A;  3L9F A;  3TDZ C;  3JTH A;  1SAX A;  2XAJ A;  5JI6 A;  1QU3 A;  2W48 A;  2W57 A;  4HBL A;  1JE8 A;  3QP5 A;  5L3B A;  1S6L A;  2PBI A;  3OYF A;  4P1W A;  2EZL A;  1I3Q J;  5L3D A;  2V1U A;  1HLV A;  4Y52 J;  1FOW A;  2HKX A;  1UJ8 A;  3CCQ I;  1IRF A;  1OMI A;  1CF7 A;  3NQO A;  4AUX A;  3QPL A;  3KIO A; 
#chains in the Genus database with same CATH homology
 4GYG A;  3J81 Z;  2RDP A;  1TLH B;  5LGU A;  4EQQ A;  3JTG A;  4M9S A;  4GYI A;  3GEZ A;  2ZME A;  3I64 A;  3ZMD A;  4U88 A;  3BDD A;  4KIF A;  4HDV A;  2QVO A;  5CLS A;  4Q47 A;  5FFX A;  1FBS A;  4HF2 A;  4G94 A;  1K78 B;  4UVC A;  1U5T B;  4Q5S F;  2K4B A;  4NB5 A;  4LG0 A;  3WTU C;  3KP6 A;  2YR2 A;  1BOA A;  3GFL A;  4LLL A;  3E6D A;  4O5V A;  4OIR F;  4I0B A;  5CVV A;  3I53 A;  4KN4 X;  3P9I A;  4LGW A;  3IWF A;  4PGG A;  4L9N A;  5D5U B;  1ZG5 A;  4KIC A;  4G7O F;  2GXG A;  3C18 A;  1OYI A;  1W7P D;  2ADU A;  4BXU A;  4Q4Z F;  3COA C;  1IRG A;  3I59 A;  4UVA A;  2W84 A;  2DQL A;  4B8X A;  5J6X A;  1D8J A;  2M30 A;  2L4A A;  1WSU A;  2W24 A;  2VN2 A;  2Q8K A;  2O61 A;  3FXU A;  1NHA A;  4K2E A;  5DEQ A;  5HS9 A;  4BHB A;  4OIN F;  4EJU A;  4ENK A;  3JAM K;  2EFN A;  3HHH A;  3HTS B;  1JXS A;  1IN7 A;  3SXY A;  3M9A A;  3WTZ A;  4ZYD A;  5K5R A;  3C7J A;  3KEO A;  2E7X A;  2HR3 A;  5ICC A;  2CGP A;  3DQV C;  5ED4 A;  4PDK A;  1R7J A;  1H9G A;  3HTU A;  2WTE A;  1WI9 A;  1S8N A;  4ZH4 F;  2EV0 A;  3M1E A;  4CZZ A;  4CHU A;  3VOD A;  1XB4 A;  1FYK A;  2Z99 A;  3KP7 A;  5ILU A;  2ZNZ A;  1OYY A;  5IT3 A;  3E6B A;  4R1H A;  3KZZ A;  2XIG A;  5DCF A;  3EET A;  5D5W B;  2XUB A;  3WE2 A;  1S7A A;  2VOP A;  4CGZ A;  5FGM A;  2FXA A;  5DCM A;  2HZT A;  1IAW A;  1IN4 A;  4GCV A;  1PP8 F;  4IHT A;  2XAG A;  4L0Z B;  4GGG A;  1UST A;  2D1H A;  2OZU A;  3GZ5 A;  5DV5 A;  3R0A A;  4UUV A;  3E97 A;  1IN5 A;  5K5Q A;  4HF0 A;  2FBK A;  2A61 A;  4RGU A;  4BHC A;  2ZO4 A;  3WTX C;  4EGY A;  4I98 B;  5DD4 A;  2VOO A;  4CDG A;  4M71 A;  4ZYG A;  5A2Q K;  4U0V A;  2QZ8 A;  2CFX A;  1XD7 A;  3ZMV A;  1BM9 A;  1QBJ A;  4G8X A;  1ON2 A;  3LQQ A;  1P4W A;  4LLG F;  1DDN A;  2EV5 A;  5BPI A;  2HOE A;  2EFW A;  3RYR A;  4RB3 C;  3IKV A;  4N0B A;  3QRF F;  1T2K A;  4HQE A;  2JTV A;  2NYX A;  5FLX Z;  2HQR A;  2A68 F;  4ASN A;  3F6V A;  1YQA A;  3VEP A;  2QBY B;  3RI4 A;  4HX7 A;  1FSH A;  5HLH A;  3P9K A;  2HTJ A;  1I5Z A;  3LA3 A;  2GWR A;  2JPB A;  1T38 A;  5DYM A;  3BP8 A;  1R1T A;  4EM2 A;  4IF4 A;  1LDD A;  4UVB A;  2F5C A;  1FBQ A;  3WGI A;  2P8T A;  2MLG A;  2O0Y A;  1TQM A;  2GXB A;  4Y13 A;  3JSO A;  1I6X A;  3LWF A;  5FB2 A;  2V1D A;  5LBQ A;  3ERE D;  3BRO A;  5AON A;  3IRR A;  4RAZ A;  2GA1 A;  1RI7 A;  2WV0 A;  2F5D A;  3IHU A;  3KCC A;  4EVI A;  2QUF A;  4HDU A;  3ECO A;  4O3M A;  3ZN1 A;  2A5Y B;  3KZY A;  3T0Y A;  1MDM A;  1XCV A;  1QQI A;  3F8F A;  4HF1 A;  3M8F A;  2IRF G;  5LLQ A;  3IC7 A;  2A07 F;  5TRD A;  3MCZ A;  2P7C B;  2TDX A;  2VOD A;  3BJA A;  5AIP A;  1HST A;  4B09 A;  2JPC A;  4ZYE A;  2HGC A;  3K2Z A;  1E2X A;  1X3U A;  2OD5 A;  1ZG1 A;  1BI2 A;  3MAJ A;  3RIR A;  5LHG A;  1KGS A;  2GIV A;  2M8E A;  2BGC A;  4MHG A;  1TW2 A;  3Q9S A;  1FLI A;  2RC4 A;  4JBA A;  3W6J B;  3R61 A;  2ISZ A;  1KU3 A;  1R00 A;  3CJN A;  1S3J A;  1YS7 A;  2P6T A;  2YSR A;  3H92 A;  2EK5 A;  4A0Z A;  1JGS A;  3CUO A;  1LDK B;  3CTA A;  2HYF A;  2XVC A;  2L4M A;  3GX4 X;  4M74 A;  5CYV A;  1P92 A;  4FHT A;  3PQJ A;  3C3W A;  3RPQ A;  5ICF A;  4KYW A;  5AIQ A;  3BPV A;  4G6Q A;  1FY7 A;  2XRO A;  3EYY A;  3KLO A;  2RNJ A;  3GWZ A;  1SFX A;  4G6D A;  5CVR A;  1DUX C;  3O6B B;  2IVM A;  4G9Y A;  1IN6 A;  2HWV A;  3R4K A;  2AS5 F;  4RGR A;  5LHI A;  2MLK A;  4U7B A;  2FE3 A;  3FM3 A;  1SD4 A;  1R23 A;  5LEJ A;  2L54 A;  1O3Q A;  4MQV A;  1DPR A;  1RNL A;  1J9I A;  2CYY A;  1ZAR A;  2FF4 A;  3HSR A;  3U9G A;  4ESB A;  1ZRD A;  3RKY A;  1ZLK A;  1KU2 A;  2KRF A;  4OOI A;  3DPT A;  4KA4 A;  1IUY A;  5EEG A;  1KQ0 A;  3SZT A;  3FXQ A;  5HDG A;  2FBI A;  3CUQ A;  1RUO A;  5HOO A;  1UFM A;  4LB5 A;  3OV8 A;  1TW3 A;  1UCR A;  4KT5 C;  4CXF A;  3J81 K;  1Z7U A;  2IW5 A;  4O6J A;  2OQG A;  4WXH A;  2STT A;  5DUK A;  2OBP A;  2MC3 A;  1V3F A;  2OA4 A;  1IW7 F;  1G3W A;  1BIA A;  6PAX A;  3R60 A;  1LVA A;  3HRM A;  3GLX A;  2VBZ A;  2NNY A;  1Z05 A;  1W7P A;  3KFW X;  3WGH A;  2Z5U A;  3EUH A;  3ZP5 A;  3KP4 A;  1YFH A;  1EV7 A;  5D4R A;  2Y0M A;  1XSD A;  2O03 A;  5HS8 A;  4IPA A;  4PCQ A;  4UV9 A;  1BI0 A;  3WU1 B;  2QYO A;  1F4K A;  3KE2 A;  2PG4 A;  5D6F A;  1U5T C;  3BJO A;  4IRI A;  4Q48 A;  4NQW A;  1GVJ A;  2VT2 A;  2E1C A;  1FP2 A;  2V1X A;  2RV8 A;  4DQ2 A;  4BNC A;  4GO1 A;  3T8R A;  2LF7 A;  2STW A;  5JFR A;  4RB1 A;  5HS7 A;  3FHZ A;  4L5I A;  4CYD A;  1I1S A;  2WC2 A;  4HLX A;  4M9Z A;  5HLG A;  2PI0 A;  2K7L A;  2HYG D;  1JHH A;  3DF8 A;  2NS0 A;  2DAO A;  4MEX F;  2NNN A;  2FNA A;  3DP7 A;  5CVJ A;  5CJ9 A;  5BMZ A;  4LJZ F;  1A04 A;  4FX0 A;  4AIJ A;  2XHK A;  2ELH A;  5E18 F;  5DUI A;  3BPX A;  1FSE A;  1EH8 A;  2ESH A;  2FQ3 A;  5F64 A;  2CW0 F;  2X0L A;  3ZMS A;  1RUN A;  1LEB A;  1ZLJ A;  2BEO A;  4LB6 B;  1ZRC A;  4HW0 A;  4JQF A;  1Z91 A;  1O3T A;  1YW8 A;  5E8G A;  1B59 A;  4JK1 X;  4OMZ A;  2DFI A;  2LSO A;  4I7H A;  4XRF A;  5H6Q A;  3HYI A;  1TQI A;  2EB7 A;  3I0T A;  1KQ9 A;  4EGZ A;  3B02 A;  4YFN F;  2AXL A;  1U2W A;  1S7O A;  3TKY A;  2KIF A;  4M9X A;  4RGS A;  2VON A;  1D5V A;  4AWX B;  2LNB A;  4Y17 A;  1QZY A;  3F8B A;  1YIO A;  4HZF A;  5JHU A;  3F23 A;  2X4H A;  4MTE A;  1ZYR F;  4G7H F;  5BQT A;  2RN7 A;  4TV7 A;  3GFM A;  3FMS A;  4NHJ A;  1IZ1 A;  4HOB A;  4D0P A;  2UWM A;  1V4R A;  2QQB A;  4UHT A;  2YX7 A;  2RGV A;  3D0S A;  3F6O A;  4XBF A;  2EA4 A;  2L3D A;  3NRV A;  3LAJ A;  4AVP A;  2R3S A;  4ETS A;  3VB2 A;  5FLX K;  1ZAO A;  4LLN A;  5BOX A;  3E5U A;  2OU2 A;  4Y15 A;  1ZH5 A;  2V79 A;  1MGT A;  4FT8 A;  3PFI A;  5K5O A;  1J0R A;  2KIM A;  2OZ6 A;  3ROU A;  3V7R A;  4L9V A;  3SQN A;  2OQR A;  2VE9 A;  4IXA A;  1HBX G;  1W4M A;  5E1Z B;  3F3X A;  2A69 F;  4IVN A;  3I54 A;  2GA2 A;  4IJA A;  4A2U A;  3SHF A;  1B9N A;  2BBY A;  2D2W A;  3BZ6 A;  3H3Z A;  3H3U A;  3ML6 A;  5FD6 A;  1TNS A;  1MKM A;  4ON0 A;  4I02 A;  3HOT A;  3QP6 A;  2L01 A;  1ZGJ A;  2Q2E A;  2MH2 A;  5BS6 A;  1STZ A;  1WKM A;  4P5O A;  3QU3 A;  4HA8 A;  2PJP A;  4P96 A;  1F9N A;  1FYM A;  2G9W A;  3MZH A;  1ZHF A;  1HW5 A;  3GFI A;  2DQR A;  4CO8 A;  3U2R A;  4H0E A;  3FMR A;  3V7C A;  1T6S A;  5HVQ C;  1FBU A;  1LEA A;  3FMQ A;  3ECH A;  4P9F A;  3WOD F;  2CSO A;  1YG2 A;  2YX4 A;  1I1G A;  2VBX A;  4MNU A;  1O7L A;  2BE5 F;  3QPH A;  4IRG A;  2COM A;  4OMY A;  5LGT A;  3JAM Z;  3KP3 A;  1CF7 B;  1HKT A;  2IPQ X;  2F2E A;  3ZMZ A;  1F5T A;  2VC0 A;  2W85 A;  2ZME B;  4WK8 F;  1LQ1 A;  3ZMT A;  3ZN0 A;  4RB0 A;  3IL2 A;  4LFU A;  1SD6 A;  1UHM A;  3CO6 C;  2MD5 A;  4KIG A;  4ESF A;  4HV5 A;  1LNW A;  5JVT A;  1UHW A;  2A6E F;  1FYL A;  3I71 A;  4LG0 B;  3FZV A;  3OOP A;  5E17 F;  3MFK A;  5HDK A;  2O6G E;  1YW7 A;  4I0A A;  1E17 A;  1R5H A;  2XAS A;  3I5U A;  4HAM A;  4YIF A;  3ULQ B;  1ODD A;  4ENJ A;  3N4M A;  1HKS A;  3GF2 A;  1OYW A;  3KET A;  1CGP A;  3Q5F A;  3BWG A;  1BN5 A;  3K9T A;  4YG2 F;  1ULY A;  5L3E A;  1WRJ A;  3WTT C;  3I59 B;  4ESJ A;  1SD7 A;  5ICE A;  2W25 A;  4KMU X;  1B6A A;  4KUM A;  3RDI A;  2MH9 A;  1FPQ A;  3PQK A;  1XGO A;  1R1V A;  2Y48 A;  2RQP A;  2FBH A;  1ZRE A;  1XDU A;  5HDN A;  1GXQ A;  5ILS A;  4BHP A;  2Z3Y A;  2JSC A;  4F7Z A;  1EH6 A;  1BI3 A;  2QEN A;  3E5Q A;  3G73 A;  4M6X A;  3DEU A;  4LMY A;  3EDP A;  1SFE A;  3JW4 A;  3FX3 A;  5ERI A;  4U0W A;  5LRS A;  1MZB A;  1XGM A;  2R7D A;  1SMY F;  3TO6 A;  1IF1 A;  1XGS A;  4XLP F;  2A3S A;  4N9H A;  4BH9 A;  2R7F A;  3J7A O;  1XMA A;  3K1P A;  3QAH A;  4AIH A;  2XKO A;  3K1M A;  3TGN A;  4A0Y A;  1QO0 D;  1ON1 A;  1K78 A;  1B1B A;  2H27 A;  3LAP A;  4WF2 A;  1U5T A;  3QU6 A;  5DCM B;  2M1B A;  3ZPL A;  5E1W A;  3O2P E;  2O3F A;  4P9U A;  2PN6 A;  5D5X B;  2J5P A;  3TQN A;  2MA3 A;  2HDC A;  1YO5 C;  2EFP A;  2D45 A;  3RTR A;  3V8L A;  4OU0 A;  5IT9 K;  2Q0O A;  2H09 A;  3IRQ A;  1ZRF A;  4BQA A;  4EM0 B;  1J75 A;  3BJ6 A;  1HSJ A;  5FO5 A;  3BOQ A;  1R22 A;  3T1B A;  2PMH A;  2EFO A;  3V4G A;  2XAH A;  4ZZL A;  4LK0 F;  2A6H F;  3TDU C;  2PFB A;  1LDJ A;  1GHC A;  4WXC A;  5F6F A;  1FP1 D;  3ZMU A;  2P7V B;  1XSX A;  2F5F A;  1U78 A;  2M5W A;  3M7G A;  1GXP A;  4KMF A;  3MEX A;  2P4W A;  4AIK A;  4EMS A;  4YII A;  1VTN C;  4HX8 A;  1ZG3 A;  1T0F A;  1P4A A;  3DKW A;  3K0L A;  1RZ4 A;  3NEU A;  3MZY A;  5L3C A;  1O7F A;  1SD5 A;  2K86 A;  2DW4 A;  1BC8 C;  2VT3 A;  2HKO A;  4WCG A;  3KEQ A;  4N9I A;  4L18 B;  3RPU A;  4AD9 A;  4MGR A;  4ZYH A;  3RKX A;  3I58 A;  1ZGA A;  4ENM A;  5FD5 A;  1YLF A;  3N97 A;  4RAY A;  3TOA A;  2DU9 A;  5CVI A;  1YTY A;  1P2F A;  3HHG A;  3LST A;  4LD5 A;  3JSP A;  2QWW A;  2ETH A;  1Z6T A;  2M87 A;  1XDS A;  4EJO A;  3WGG A;  1G3S A;  3EYI A;  3V8J A;  4P55 A;  1MDM B;  4E70 A;  3CLO A;  3VFZ A;  2XRN A;  5TJJ A;  3P7N A;  1FOK A;  3ELK A;  1XGN A;  1P4X A;  3DV8 A;  4IRH A;  1UB9 A;  3O3K A;  2UXX A;  2LDU A;  1HW2 A;  5J8F A;  1MJ9 A;  4R8H A;  2IA0 A;  3E6C C;  5D8L B;  2E1N A;  3TOB A;  2HS5 A;  3K1N A;  3G3Z A;  2CWE A;  3CUQ C;  2D1V A;  2EWN A;  3WTW C;  5ICG A;  4ENN A;  1G4D A;  2EFQ A;  5DD8 A;  3J80 Z;  2DT5 A;  2QBY A;  3P9C A;  2XV4 S;  2BYV E;  2HTS A;  2ISY A;  1L0O C;  2P6S A;  3E3V A;  2BV6 A;  1PP7 U;  1KU9 A;  4BYY A;  1HKQ A;  4EJW A;  5E20 A;  3FM5 A;  3EQL F;  1DPU A;  4A6E A;  1ONV A;  3DFG A;  2YU3 A;  2G7U A;  2DPU A;  3HSF A;  3SZP A;  3GW2 A;  3W6K B;  1K79 A;  3RYP A;  4U7D A;  3WTY C;  2JZY A;  3E6M A;  4XSX F;  2ZJ2 A;  2FOK A;  1TNT A;  4MEY F;  4RB2 C;  5F1R A;  1XSV A;  3MWM A;  3F8N A;  5D5V B;  1RIO H;  1AOY A;  1REP C;  2ZXJ A;  3TO7 A;  4L5J A;  3CO7 C;  2ZNY A;  3CUQ B;  2RVC A;  1J2X A;  3V8K A;  4DNC A;  2V9V A;  2P5K A;  4L9J A;  1EH7 A;  2UZK A;  2UXN A;  4HYE A;  1P6R A;  3C1D A;  4XLN F;  1FZP B;  1D8K A;  2Z33 A;  3WTS C;  4A0X A;  1MJB A;  1IXR C;  3RKW A;  4U0Y A;  1W7P B;  4KFC A;  3ABU A;  1BI1 A;  3HSE A;  3U1D A;  2VBY A;  1XN7 A;  3LFK A;  1FWZ A;  2M45 A;  4M73 A;  4BAY A;  4UXN A;  5L3G A;  5DDG A;  3F72 A;  3I4P A;  4I09 A;  1J5Y A;  1S29 A;  2PMU A;  2YPR A;  2DO7 A;  3HOS A;  2DI3 A;  4EJV A;  4RGX A;  1KYW A;  3ABT A;  1T98 A;  2XAQ A;  2HEO A;  2K02 A;  2L02 A;  1PDN C;  1R36 A;  3D5L A;  4PGH A;  5LEK A;  2KKO A;  1BC7 C;  3T8T A;  3T5X A;  2P5L C;  1O3S A;  4I2O A;  1OPC A;  5H20 A;  3GFJ A;  3R6S A;  4A5N A;  3K69 A;  5HLI A;  2NAZ A;  4OIP F;  2IP2 A;  2FU4 A;  5LGN A;  4MTD A;  3CDH A;  4KN7 X;  3WE3 A;  5K1Y A;  3KLN A;  2CG4 A;  3F8M A;  4A5M A;  2FA5 A;  3QPT A;  4A6D A;  4IHS A;  2EJR A;  3LA2 A;  1C0W A;  3HUG A;  4EM1 A;  2P5V A;  3KP5 A;  3GYH X;  2E7W A;  1Z9C A;  2PEX A;  1QPM A;  4G7Z F;  5ILV A;  5FFZ A;  2CQK A;  4I01 A;  4M72 A;  3Q9V A;  2DK8 A;  4OIQ F;  1XMK A;  3F8C A;  2LF8 A;  3GZ6 A;  2EA2 A;  1J7K A;  1SMT A;  1OKR A;  1ZN2 A;  3FXR A;  2IA1 A;  3GVA A;  4ZZD A;  2NRA C;  4L0Y B;  2IJL A;  1PUE E;  2VXZ A;  2PQ8 A;  2QLZ A;  4S04 A;  1B4A A;  3GO5 A;  3HRT A;  1G3Y A;  1B9M A;  3TO9 A;  2K27 A;  3L00 A;  2FNP A;  2KJB A;  1MJA A;  3ZQ7 A;  2KJC A;  2F5E A;  4CIC A;  1MD0 A;  3WG9 A;  1R58 A;  2OAZ A;  4HV6 A;  1IXC A;  2XKP A;  1SFU A;  1BJA A;  2V6C A;  5LHH A;  3DPL C;  4WXD A;  2VBW A;  5EEH A;  1WWX A;  4YFX F;  1T39 A;  4EV0 A;  5D6E A;  4A12 A;  1LB2 A;  4HX4 A;  2LKP A;  3AAF A;  2WWY A;  1W5T A;  4UV8 A;  2ACJ A;  3HRU A;  5A2Q Z;  5KK1 A;  2HQN A;  1LJ9 A;  3L2C A;  1BBY A;  1KQ8 A;  1Y0U A;  5CVU A;  3M8E A;  2IA2 A;  3R0J A;  1K6O A;  2IT0 A;  1Z6R A;  2G7H A;  3IKT A;  5KVR A;  1HW1 A;  1D3Y A;  1FC3 A;  2DTR A;  2FEZ A;  1YS6 A;  2GQQ A;  2H94 A;  4FX4 A;  2FRH A;  1J59 A;  2CO5 A;  2H6B A;  2DPD A;  4M6Y A;  2HFH A;  4MQ9 F;  4WX9 A;  4L9T A;  5D8K B;  2ZBK A;  2DBB A;  1KA8 A;  4Z2Y A;  4S05 A;  3QOP A;  1Q1H A;  2Z9O A;  3MQ0 A;  2VE8 A;  1R1U A;  1HQC A;  2EV6 A;  1I27 A;  3LA7 A;  4EJT A;  1FT9 A;  4KDP A;  1Z1D A;  5D4S A;  1DP7 P;  1W5S A;  2ZCW A;  4HQM A;  1O3R A;  2QQA A;  2ZFW A;  1YYV A;  3HRS A;  2FMY A;  3RJP A;  4PZJ A;  1JHF A;  1U8R A;  1TTY A;  4YFK F;  1R5G A;  3VOE A;  2DLL A;  5BPD A;  2XGX A;  5LRR A;  3HIF A;  1BIB A;  1KU7 A;  4QWQ A;  3FF5 A;  1O57 A;  3V7S A;  1U3E M;  1F1Z A;  2GZW A;  3GUD A;  3F22 A;  1U6G A;  1KYZ A;  5E1X A;  1USS A;  5JR3 A;  3F21 A;  3GXO A;  2K4J A;  4XSZ F;  1QZZ A;  2JRT A;  2XAF A;  2JT1 A;  3B73 A;  4GXO A;  2DK5 A;  3SFZ A;  1K7A A;  3L7W A;  4LK1 F;  1IXS B;  1FNN A;  3ISP A;  4QLC U;  3E5X A;  3KP2 A;  3S2W A;  2QM3 A;  2VC1 A;  1H9T A;  1WQ2 A;  4WWC A;  1HXD A;  3REO A;  4R79 A;  2QQ9 A;  4HLY A;  2Y75 A;  1TQP A;  5L3F A;  1G6N A;  3J80 K;  2C6Y A;  1YW9 A;  2KIU A;  3WU0 A;  1FX7 A;  1OR7 A;  4OIO F;  1G3T A;  1H0M A;  2ESN A;  2O8X A;  1IN8 A;  1QGP A;  1QNT A;  1L3L A;  4UNO A;  2MBF A;  2B0L A;  2PLY A;  5E8I A;  1TBX A;  3DXJ F;  3WTV C;  3FWE A;  4KIB A;  1AWC A;  3LQR A;  4RS8 A;  2ZKZ A;  2GAU A;  2J5O A;  1XCB A;  5IT9 Z;  2FSW A;  2H6C A;  5J8C A;  3BY6 A;  2RKH A;  3L09 A;  5H6R A;  2FML A;  3IWZ A;  4KNY A;  3L9F A;  3TDZ C;  3JTH A;  1SAX A;  2XAJ A;  5JI6 A;  2W57 A;  4HBL A;  1JE8 A;  3QP5 A;  5L3B A;  1S6L A;  2PBI A;  5L3D A;  2V1U A;  2HKX A;  1IRF A;  1OMI A;  1CF7 A;  3NQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...