4RGXA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 3,4-dihydroxy bezoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with 3,4-dihydroxy bezoic acid
rcsb
source organism Acinetobacter sp. adp1
total genus 44
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgxA00
1PUEE 1ZYRF 2D45A 5D5XB 1FZPB 1LVAA 3BPXA 2RN7A 3IKTA 4XRFA 3I54A 3ULQB 2Z9OA 1Z1DA 2GQQA 3MEXA 2P5LC 3JTHA 3JAMK 1OYWA 1K79A 4LK1F 2PN6A 2RKHA 5ILUA 3RYPA 1Z6RA 5TJJA 1W7PA 3F72A 3WTUC 1B9MA 1V4RA 4N0BA 4GCVA 5A2QZ 5FO5A 3BWGA 5J6XA 1FWZA 3MZYA 1FP2A 4DQ2A 2NRAC 1GHCA 2J5OA 3ZP5A 3PQJA 1KGSA 1HXDA 3CDHA 3L2CA 3J7AO 1AWCA 2EV0A 3L7WA 1RI7A 3B02A 1ZGJA 1ON1A 3I71A 4HF1A 2HYFA 1SMTA 2QYOA 3WTWC 3Q9SA 1F9NA 3VOEA 1KA8A 2CYYA 3PQKA 3LA7A 2AXLA 2VT3A 2GXBA 3F22A 1T0FA 5LHGA 3KEQA 2DW4A 4RAYA 3CO6C 5ERIA 1W5SA 4B09A 1SFUA 4RGRA 2FEZA 3QP5A 2ZCWA 3K9TA 1FSEA 1J2XA 3KETA 3DPLC 1G3TA 4LB6B 5BPDA 1ZRFA 2RVCA 5JVTA 2OAZA 1P4WA 3C18A 2XV4S 1Z91A 2BBYA 4Q5SF 2DAOA 3P9KA 3J80Z 4ASNA 2ZJ2A 1O3SA 2ZXJA 1RNLA 2XIGA 1C0WA 5KVRA 2ZMEB 4LMYA 1IXRC 4R79A 2R7DA 3F8BA 2MLGA 2DPUA 1ZHFA 1X3UA 3BROA 3RI4A 1IZ1A 2O0YA 4A5MA 1D8JA 5FD6A 5FD5A 1EH6A 1LDJA 2AS5F 4EM1A 2IT0A 5ILVA 5HLGA 3JTGA 1YQAA 3P7NA 2A07F 3C1DA 2P8TA 2A5YB 4LG0A 4XSXF 1K6OA 3RYRA 1W7PD 2E1NA 4LD5A 3WTZA 2G7UA 3R0AA 3O2PE 2P4WA 4EMSA 1FP1D 4HYEA 3WTVC 2PBIA 3IRQA 1B6AA 3M8FA 4A2UA 3WTSC 1WRJA 3J81Z 5LGUA 5J8CA 2VBXA 3WE3A 2M45A 1RIOH 1HKQA 1KYWA 3QAHA 1GVJA 2IP2A 1L0OC 2KJCA 4KT5C 2E7XA 2JSCA 2WTEA 4Q4ZF 5EEHA 2FU4A 3DPTA 3FX3A 4ENMA 1EV7A 4BXUA 3V8LA 4CICA 2R3SA 1FOKA 3IKVA 2PJPA 2CSOA 5E1XA 1ZLJA 4I0BA 2DU9A 5E18F 1TTYA 4AIHA 2FSWA 4EGYA 1USTA 2KIMA 4I01A 4M9XA 3RDIA 4RB1A 3ML6A 5JFRA 2OZUA 3E5XA 2A6EF 4CDGA 3HRMA 1P6RA 4CXFA 4G7OF 1ON2A 3HSRA 3Q5FA 3E6MA 3GZ6A 2HQNA 5HDNA 4OIRF 4LK0F 1R7JA 4I0AA 4KDPA 2ZNYA 5HS9A 3HRUA 4I98B 4HF0A 3Q9VA 1AOYA 3HRSA 2A3SA 2LSOA 3FHZA 4OINF 2UWMA 1LB2A 1YW9A 3BJ6A 3HSEA 5BPIA 2Y48A 2LDUA 2YX7A 3MZHA 4G94A 2F5EA 5K5QA 1XB4A 3F8NA 3W6JB 1YG2A 4L9JA 4K2EA 3MQ0A 3K69A 2IW5A 3GFIA 3IWFA 5ICCA 3TGNA 5D6EA 2FA5A 4A0XA 1O3RA 1UFMA 1Q1HA 5AIQA 3HIFA 5K5OA 3TDUC 4O3MA 1BC7C 1GXPA 1OYYA 2ADUA 3ECHA 2GXGA 3I59B 4BHPA 1OMIA 2O8XA 4JQFA 3E97A 3TO9A 1SAXA 1SFXA 2HGCA 4EM2A 1O3TA 1IN8A 2RV8A 4O6JA 5DD8A 4BHCA 3HYIA 1EH8A 1FY7A 5DCFA 1IW7F 2YU3A 3P9IA 4N9HA 2DQLA 2PG4A 3KLOA 4WF2A 4RB0A 5A2QK 1TLHB 1ZG5A 2PQ8A 1V3FA 3BOQA 4KIBA 4M73A 1YFHA 5CVIA 1CF7A 2V1XA 1MDMA 3FZVA 3ZMVA 2VODA 2XKPA 2EFWA 3ROUA 4I7HA 2L54A 3MAJA 4M9ZA 5K5RA 1W4MA 3F8MA 4AWXB 3SFZA 4AIJA 1K78B 2F5DA 3ZPLA 2WWYA 3GO5A 4IRHA 4OU0A 1XMKA 5FGMA 3RJPA 4A6EA 1QGPA 3FM3A 5D5UB 2QLZA 2D1HA 4YFNF 3HTSB 2FXAA 1J0RA 4KFCA 1UHWA 4MTDA 3I4PA 1J9IA 2XHKA 1ZRCA 2XVCA 3ZMDA 2IVMA 4IVNA 1F1ZA 1KQ9A 1H9GA 1DP7P 2HFHA 4PGGA 3G73A 4HV6A 2JPBA 1T39A 3M1EA 2QBYB 4OMYA 2KIFA 1DPRA 3AAFA 1IUYA 2MBFA 1ZG3A 1XSVA 1S7AA 3BZ6A 4HX4A 2GA1A 3V8KA 1FT9A 2IA0A 5L3DA 4A5NA 2WC2A 5E20A 4QWQA 1G4DA 1ZGAA 4ETSA 4AIKA 1RUOA 4R1HA 3J80K 4OIPF 4OOIA 4HQEA 3FXUA 2BV6A 2ISZA 2JT1A 3ZN0A 3M7GA 1OR7A 1HW2A 1MKMA 1UHMA 5ICEA 2G9WA 2W24A 2Q8KA 4HQMA 1FBUA 1IN4A 4MQVA 3TQNA 4ENKA 1G6NA 3C7JA 3RPQA 1J59A 2HS5A 2HR3A 3GFJA 4JBAA 4HDVA 2K4BA 5DCMA 2L3DA 2H27A 4GGGA 5LEKA 2QVOA 4L5JA 2Q2EA 2K02A 2HYGD 5H6QA 4N9IA 4ZYGA 2MH9A 2ZKZA 5D5VB 5AONA 1XN7A 5DYMA 1T98A 1PP7U 3KCCA 1SFEA 4MHGA 5D5WB 4PZJA 3J81K 3L09A 4U0VA 4L18B 3NQOA 2XAQA 5CVUA 5D6FA 2P6TA 4IRIA 5DDGA 3F3XA 1W5TA 3H3UA 3HHGA 3JSOA 3FXQA 5HDKA 1MJ9A 1MGTA 3FWEA 3KP2A 3ZN1A 3SQNA 4M71A 2A6HF 4ZZDA 1R5HA 3DFGA 2W84A 3EETA 3TKYA 3QPTA 3KP4A 2EFNA 1FYLA 3BY6A 1U78A 4GYGA 1U5TA 2Q0OA 5DEQA 3GF2A 3R6SA 2BEOA 1HQCA 3KP6A 4L0ZB 3I64A 1CGPA 2OQRA 1KQ8A 3ZMUA 2XKOA 5BOXA 3FF5A 1TQIA 1ZLKA 2D2WA 4ZZLA 1R00A 2IPQX 3MFKA 1RUNA 2K27A 4A12A 3GWZA 2UXXA 2PMUA 5ICFA 4XLPF 4OMZA 4M74A 1I1GA 2KRFA 1BIAA 1IAWA 5E1WA 2MC3A 4B8XA 2O3FA 2FE3A 1IRGA 2XASA 5AIPA 3D5LA 3DXJF 2R7FA 2LF8A 4U0YA 3IHUA 2MLKA 3I5UA 4M6XA 3LWFA 1XSDA 2LF7A 1WI9A 2P5KA 3KFWX 1S8NA 2VN2A 2X0LA 5H6RA 1QZZA 2ESNA 2VT2A 3E6CC 1BIBA 3SHFA 5LGNA 1EH7A 5BMZA 1LEBA 1B59A 1UCRA 2EJRA 4Q48A 1Z6TA 1YTYA 3DP7A 1FX7A 2GZWA 4HF2A 3EYIA 2HOEA 3O6BB 2E1CA 1BC8C 1IXCA 3ELKA 4OIQF 4UVCA 2DPDA 1OPCA 2W25A 3SXYA 3V4GA 3I53A 3RPUA 4WCGA 1B9NA 2DI3A 2XAHA 3DV8A 2DO7A 3NRVA 3E3VA 1ZREA 2QZ8A 2RQPA 5LHHA 2RC4A 1ONVA 2CO5A 3O3KA 5F1RA 5CVJA 3LA2A 3F6VA 5D8KB 1XCBA 2KIUA 1U8RA 4PDKA 5FFZA 4M72A 1T2KA 4L9VA 1U3EM 4BYYA 5CYVA 1PDNC 1R1UA 3IWZA 2CG4A 1DPUA 4LB5A 1L3LA 3CUQB 2COMA 1WSUA 2KKOA 1IN7A 3ZMTA 2VC1A 3V7CA 2XROA 3GYHX 2HTSA 3LSTA 4WK8F 3FM5A 1D8KA 2HZTA 2QENA 2ZNZA 2XAGA 3U2RA 2NYXA 4EJTA 3DEUA 1B4AA 5KK1A 4G7HF 2H6CA 2H94A 1G3SA 2CFXA 3RKYA 1JHHA 2GA2A 3BPVA 4EVIA 1ODDA 3OOPA 3K2ZA 2HEOA 3WE2A 5HLHA 2F2EA 4I02A 1O7LA 4AD9A 1JXSA 1HW1A 1FBSA 4EGZA 1H9TA 2DK5A 1UB9A 1OYIA 2F5FA 1LJ9A 1KU7A 3FMRA 3TOAA 4GXOA 4EV0A 2BE5F 3GVAA 5D4RA 5JI6A 3TOBA 4HW0A 4GO1A 4HDUA 1SMYF 1K7AA 5FFXA 3SZTA 2L01A 1TNSA 1J7KA 4QLCU 3QOPA 2ESHA 2CW0F 2QM3A 4MGRA 2JRTA 4LFUA 3B73A 3RKXA 4WXCA 2O61A 2ELHA 4LLLA 1W7PB 3EQLF 2FQ3A 2YR2A 1MJAA 1MZBA 4D0PA 4EJUA 4UUVA 1KU9A 5CVVA 3G3ZA 1Z05A 5DD4A 2L4AA 3M8EA 3KP7A 5ILSA 3EDPA 2K4JA 2V1DA 2OZ6A 5H20A 1TQPA 4TV7A 5HLIA 2ZMEA 4JK1X 1IXSB 1SD4A 4HX8A 1FPQA 3R61A 1USSA 4BAYA 2XGXA 3COAC 2BGCA 4HOBA 5E8IA 3ISPA 5EEGA 4IHSA 2B0LA 2M5WA 2L02A 2EFQA 4P5OA 1G3YA 2FOKA 4U7DA 1XMAA 1NHAA 3K1MA 5DUIA 2VC0A 3WU1B 1HKSA 1XGMA 2RNJA 1QPMA 1S6LA 1JHFA 2QQBA 1XGNA 1LDKB 3U1DA 1R5GA 3JW4A 2LKPA 4EQQA 3CO7C 2PLYA 1R1VA 4ON0A 2C6YA 4HZFA 3QP6A 1O3QA 3WTYC 2NAZA 2XRNA 4RAZA 1G3WA 2E7WA 1R58A 3KP5A 5CVRA 4YG2F 2GAUA 2GIVA 2FBKA 4EJVA 3RKWA 4KA4A 2VE9A 1J75A 1BN5A 4HLYA 4UHTA 3D0SA 1JE8A 4MNUA 3GZ5A 2JTVA 4I09A 4L5IA 3U9GA 2DK8A 2PMHA 3BP8A 4Y17A 2H6BA 3JSPA 3H3ZA 3T0YA 1LNWA 3KZZA 5ICGA 1Z7UA 3LQRA 1XCVA 1LEAA 1D3YA 4M6YA 5E8GA 1S7OA 1YW8A 2IJLA 4HAMA 1P4AA 2FNAA 1R23A 4OIOF 3TO6A 1E17A 1WQ2A 2P5VA 4ENNA 1I6XA 1BI1A 2CQKA 5HDGA 3CLOA 4BQAA 4FHTA 5F64A 4MTEA 2VBZA 2OD5A 1JGSA 4KICA 3V7SA 4CZZA 5F6FA 1XGSA 2EK5A 4HV5A 4UXNA 3WGIA 1H0MA 3TO7A 1VTNC 5K1YA 2IA1A 4LG0B 2Z99A 4HLXA 3K1PA 2JPCA 1WWXA 2V6CA 3HOSA 1U5TC 1REPC 3LA3A 4S04A 3FMSA 3WODF 2OBPA 4RS8A 4UVAA 3F8CA 5LRSA 3H92A 2P7CB 1MJBA 2FMYA 4NQWA 3GEZA 3BDDA 2Z3YA 3T8RA 3S2WA 5LLQA 2WV0A 2M87A 3OV8A 1QO0D 3QPHA 2UZKA 5CJ9A 1IRFA 2RGVA 2HDCA 1ZAOA 4IXAA 2QQ9A 1YIOA 4P9UA 1ZN2A 1YLFA 5ED4A 3HUGA 2EWNA 4UNOA 5D8LB 3EYYA 2HKXA 3I59A 3IRRA 2VE8A 3QU6A 3ECOA 2ETHA 5LBQA 4WXHA 4GYIA 1PP8F 3RIRA 1TQMA 3I58A 2ZFWA 1XGOA 3WTXC 3E5QA 1SD6A 2M30A 4RB3C 5LGTA 5L3GA 1HKTA 2VOOA 4BHBA 1BI0A 1LQ1A 4U88A 1BBYA 4IJAA 3WGHA 1TNTA 4EJOA 4LLNA 1LDDA 4PGHA 2EB7A 3R0JA 4WX9A 2V79A 1FYKA 1KQ0A 2W85A 2TDXA 2A69F 1ULYA 4O5VA 3LAPA 1YO5C 1KU3A 2EV5A 2XUBA 4Y13A 3VFZA 2RDPA 3K1NA 3V7RA 4HX7A 1K78A 4KN7X 4G6QA 2EV6A 4A0YA 4YFKF 2OU2A 5J8FA 2DBBA 3F21A 4ENJA 1U2WA 2K86A 4IPAA 3FMQA 2XAFA 5FLXZ 4XSZF 2VBYA 1XSXA 1R22A 4ZH4F 2QWWA 4I2OA 2FBHA 2W57A 2O03A 1R36A 2MH2A 1QQIA 1HW5A 2HTJA 1DUXC 3R60A 3F8FA 3K0LA 2NNYA 2PFBA 2QBYA 3L9FA 5FB2A 2MA3A 3KEOA 4L9TA 2G7HA 3EUHA 5HVQC 3GUDA 3IL2A 1IF1A 2F5CA 4Q47A 2HKOA 5BQTA 2ACJA 2ISYA 3CTAA 3ABTA 5L3CA 1I27A 1IN6A 1TBXA 3HTUA 3WU0A 3REOA 4KYWA 5D4SA 3GX4X 2FMLA 1CF7B 3KE2A 1MDMB 1WKMA 2J5PA 3HOTA 4KUMA 1BI2A 3W6KB 5DV5A 3JAMZ 2YPRA 3VB2A 3HHHA 5JHUA 2H09A 4P55A 1FC3A 3WG9A 2ZO4A 2V9VA 3KZYA 4RGSA 3QU3A 5BS6A 4XBFA 1QBJA 1QZYA 1FSHA 2CGPA 4EM0B 2L4MA 1ZH5A 4HBLA 1FBQA 3HSFA 1TW3A 4U7BA 2UXNA 2EFOA 5IT9K 4CO8A 4UVBA 4L9NA 2Z33A 2DLLA 2FRHA 5L3FA 3F23A 4S05A 1R1TA 3T5XA 4KNYA 1XDUA 2QQAA 1YYVA 4E70A 5L3BA 5DUKA 3HRTA 1YS7A 1YW7A 4CHUA 3ZQ7A 1ZG1A 2STWA 1BJAA 1KYZA 1HSTA 2CWEA 1S29A 4CGZA 2Y0MA 4DNCA 4PCQA 4G8XA 3GXOA 4KIGA 5HS8A 3PFIA 4ZYDA 4L0YB 3TDZC 1T38A 5LHIA 4R8HA 4Y15A 2K7LA 4MEYF 5E1ZB 2PI0A 3BJOA 5TRDA 1P4XA 2DQRA 1RZ4A 1J5YA 2X4HA 4RGXA 3T8TA 1O7FA 1XDSA 1Z9CA 3GFMA 4RGUA 3GLXA 5DCMB 4IRGA 5HOOA 2O6GE 4EJWA 1P92A 5HS7A 2V1UA 2M1BA 3QRFF 3N4MA 3IC7A 3KP3A 4F7ZA 2QUFA 3KLNA 5CLSA 3WGGA 3ZMSA 3DF8A 5JR3A 2Y75A 4G9YA 4ESFA 1T6SA 2DFIA 3WTTC 3V8JA 3GW2A 2IRFG 3R4KA 2A61A 4UV9A 4WWCA 3MWMA 3CJNA 4AVPA 2ZBKA 2VONA 1GXQA 1E2XA 1U6GA 2Z5UA 5IT3A 3E5UA 3E6BA 3FXRA 3CUQC 2VOPA 1BI3A 3NEUA 4YIIA 4NHJA 1ZARA 5L3EA 1B1BA 1QNTA 2JZYA 4P9FA 2HWVA 1HSJA 3GFLA 1SD5A 3E6DA 3ERED 4KMUX 4KMFA 4ZYEA 4LLGF 4HA8A 1OKRA 3LFKA 4G7ZF 4RB2C 2HQRA 1ZRDA 2M8EA 4KIFA 1I1SA 1F5TA 1KU2A 1U5TB 3RTRA 3N97A 2GWRA 1SD7A 4P96A 1FYMA 3VEPA 2EA4A 5IT9Z 1D5VA 4YFXF 4UV8A 2DT5A 2YX4A 1I5ZA 2YSRA 3DKWA 4YIFA 2OQGA 4ZYHA 2KJBA 4KN4X 2LNBA 1TW2A 4XLNF 1O57A 3MCZA 1HBXG 4ESBA 1A04A 5E17F 2NNNA 3ZMZA 3L00A 4A6DA 2PEXA 5LRRA 1Y0UA 3I0TA 2FBIA 2VXZA 1P2FA 4CYDA 1F4KA 2IA2A 2P7VB 2A68F 4FX0A 1STZA 2BYVE 4LJZF 3CUQA 1XD7A 6PAXA 1BM9A 4WXDA 1FNNA 1IN5A 3F6OA 1BOAA 4Z2YA 4MEXF 2EFPA 3SZPA 4BNCA 2P6SA 3ABUA 4NB5A 4U0WA 4FT8A 4A0ZA 3LAJA 3VODA 4M9SA 2FF4A 2STTA 1S3JA 4G6DA 2EA2A 5FLXK 2VBWA 5LEJA 2MD5A 4FX4A 1MD0A 2XAJA 3LQQA 4BH9A 2NS0A 1DDNA 4H0EA 4ESJA 3CUOA 3T1BA 3C3WA 3P9CA 3BJAA 3M9AA 3DQVC 2FNPA 2OA4A 4LGWA 2DTRA 4MQ9F 4IF4A 4IHTA 2D1VA 1FLIA 1YS6A
chains in the Genus database with same CATH superfamily
1PUEE 2I5UA 1ZYRF 3L2UA 2D45A 5D5XB 3PO2J 5J40A 1D0XA 1TWAJ 3ESWB 3S3MA 1FZPB 1LVAA 2JWTA 4XL9A 2WY7Q 5IYBJ 3Q0WA 3TL4X 3BPXA 3OY9A 2RN7A 3IKTA 4XRFA 3I54A 2V6EA 4ZDPA 3ULQB 1D1BA 1Z1DA 2GQQA 3MEXA 2P5LC 2Z9OA 3H5AA 3JTHA 2DA2A 3S3NA 2R7UA 1JUSA 1JT0A 3BC8A 3JAMK 1OYWA 1K79A 2LC2A 3NARA 4DZJA 4LK1F 2KRCA 2PN6A 2RKHA 4YIRX 5ILUA 2E1OA 3RYPA 1RR7A 4FE7A 1Z6RA 4F93B 3KYCB 3GMEA 3S14J 2RAEA 1QVTA 5TJJA 1VQ8I 3IP4B 1WJDA 3SEZA 1X1AA 4CCJA 1JUPA 1W7PA 4MFDA 2JVHA 2JJ7A 2DOAA 4E7IA 3NWSA 3LNQA 2K9QA 3F72A 5HLTA 1Y8RB 2JMWA 2ZSIB 2HVQA 1RKTA 3WTUC 1B9MA 3BTCA 4IHYA 1V4RA 1MNEA 2R4GA 4N0BA 4W1UA 3N05A 4GCVA 2Z16A 3OSGA 1WJBA 2XF5A 5A2QZ 3FHNA 5FO5A 2HOSA 3LMMA 2V26A 1AKHA 1Y6IA 2FX0A 3BWGA 5J6XA 1FWZA 3MZYA 1RC9A 4DYCA 2EZHA 1FP2A 1V5GA 3AG1H 1OCCH 4DQ2A 2NRAC 3OOUA 1GHCA 2LY1A 2J5OA 3K4BA 2M7BA 1FOXA 3ZP5A 3FXMA 1KGSA 1HXDA 3PQJA 3CDHA 1V5FA 3L2CA 2NOJB 1LVKA 3J7AO 1AWCA 4II2A 4FTHA 3EUHC 4B4CA 3MZ8A 1JJ8C 2EV0A 3DLAA 2MD0A 3FKIJ 4F52A 3L7WA 1RI7A 3B02A 5B3SH 1ZGJA 3LSHA 2ELKA 1ON1A 3I71A 3M07A 4IZZA 1VQOI 4HF1A 2HYFA 1SMTA 2QYOA 3WTWC 3Q9SA 1D1AA 1T95A 1LPQA 1F9NA 3B6CA 3VOEA 2XC7A 4A69C 1KA8A 2CYYA 4I76A 3FXLA 3PQKA 5FKOA 2CJJA 2Y9ZA 1GV5A 3D5RC 4CCLA 4CCOA 3BR3A 3CJRB 3LA7A 2AXLA 3ASOH 2M4GA 4BEHA 2VT3A 3QODA 3L2WA 4IOCF 4JYKA 3F22A 2GXBA 1T0FA 5LHGA 4M3EA 2EIKH 3KEQA 2OV7A 2DW4A 4RAYA 2L9VA 4AU7A 5GTIC 4E4HA 4YEJA 4A3CJ 3CO6C 4IHWA 5ERIA 1W5SA 1UJ8A 4ANJA 3CCLI 4B09A 1SFUA 3AL0C 4RGRA 3CMYA 2FEZA 3GLLA 1WH7A 3QP5A 2ZCWA 3K9TA 2OC6A 1FSEA 1HDPA 1J2XA 3KETA 1GT0C 3DPLC 4NC7A 1G3TA 4LB6B 2NVXJ 4NNJA 5BPDA 4RLFA 2HXIA 2RVCA 3BT9A 1ZRFA 1ORKA 5JVTA 1QHHD 2OAZA 1P4WA 4G6TB 3PM1A 4AIDA 1SVOA 3C18A 2CMPA 2XV4S 2LH9A 1Z91A 2XPWA 2BBYA 2ZJQF 4Q5SF 2AXTC 1OJLA 2HNHA 2DAOA 3P9KA 1QHGA 3J80Z 3MKZA 4ASNA 2ZJ2A 5FRMA 1IUFA 1O3SA 3W3CA 2ZXJA 1RNLA 2XIGA 1NK3P 1BW6A 1Y8QB 5KVRA 1R9TJ 1C0WA 2K85A 2ZMEB 4LMYA 1U8BA 1IXRC 4II3A 4R79A 2R7DA 3F8BA 4X0GA 2MLGA 4BDZA 1I39A 1YIJI 2HPMA 2DPUA 2E2HJ 1ZHFA 3SJMA 1X3UA 3BROA 3ONQA 1IZ1A 2O0YA 3RI4A 1DU0A 4A5MA 4BU2A 1E3PA 2MSYA 1DP3A 1D8JA 5FD6A 5FD5A 4ABZA 2ME0A 1EH6A 1LDJA 2AS5F 3SZGA 3CQZJ 4EM1A 5EZGA 2IT0A 5ILVA 4IQJA 1SANA 5EJCA 1BW5A 3IAS2 3I9V2 2ID3A 1I3QJ 5HLGA 3JTGA 3ABLH 2NVTJ 1T56A 1YQAA 2R7ZJ 3ABMH 1VQMI 3P7NA 2A07F 3C1DA 2P8TA 1U9OA 2A5YB 2I10A 4LG0A 4XSXF 1K6OA 1W7PD 2E1NA 3RYRA 4LD5A 3WTZA 2E1MC 2G7UA 2QKMB 4A3MJ 3R0AA 3O2PE 2P4WA 3K6GA 3K4JA 1MMSA 1FTZA 4EMSA 3X2QH 3D5SC 2CQ7A 1FP1D 4HYEA 3WTVC 2KFDA 2BY3A 2COBA 4CCMA 4C9YA 3OIQA 1Z3YA 2PBIA 3IRQA 2VQLA 1B6AA 3M8FA 4A2UA 3WTSC 1WRJA 1TWCJ 1UMQA 2M7AA 4FQGA 3J81Z 3OYMA 1NG7A 5LGUA 1JKRC 2R7TA 5J8CA 4CSWA 2VBXA 3WE3A 3G1OA 2LTPA 2M45A 1RIOH 1HKQA 3QYEA 2CRGA 1Q1VA 1GVDA 1KYWA 1WJCA 3QAHA 1GVJA 2IP2A 1ETKA 1L0OC 2KJCA 2XSJC 2MYSA 4KT5C 2E7XA 3LFUA 5E3MA 3K2AA 2JSCA 2WTEA 4Q4ZF 2F4OB 5EEHA 2FU4A 3DPTA 3FX3A 4ENMA 3KZIC 1EV7A 1MIJA 3QYFA 3V8LA 4BXUA 4CICA 3JR9A 3PSFA 2R3SA 4J19A 2GOXB 3IKVA 1FOKA 2AQFA 2PJPA 2B9SA 2CSOA 3FK6A 2ZJPF 5E1XA 4DIQA 2A6TA 1ZLJA 3HOYJ 1FIPA 4I0BA 3H5NA 2DU9A 5E18F 3DKYA 1TTYA 1W1WE 4AIHA 2FSWA 1MBKA 4EGYA 1USTA 2HDWA 2KIMA 4I01A 4M9XA 4ZTJA 3RDIA 4RB1A 2NVUB 3LSKA 1K4TA 3ASNH 3FDYA 2XAUA 1XC5A 3ML6A 5JFRA 2OZUA 3E5XA 2A6EF 4CDGA 4XOTA 3WU2C 2XGEA 3BTLA 1YRNA 3HRMA 1P6RA 4CXFA 5M5WJ 5KAFC 1WGXA 4G7OF 1HA8A 1ON2A 5GPCA 3HSRA 3OIPA 2HYJA 3Q5FA 4XLCA 3E6MA 2MW8A 3GZ6A 2LY9A 2HQNA 2ECCA 2BVMA 5HDNA 4KJZA 4OIRF 1NTCA 1FMWA 4LK0F 1R7JA 3HL2A 2VIXA 1ETVA 2Z1DA 2LMDA 3DU6A 1ETYA 2ZJRF 1DGRM 4J01A 2RNGA 4I0AA 4W97A 3ZQLA 2LKSA 2CW8A 3EPZA 3A0HC 3CCSI 4KDPA 2ZNYA 4XN0A 1ZQ3P 3S1QJ 5FLMJ 1M1EB 3CJQB 5HS9A 1JGGA 3HRUA 5IP7J 1T33A 4I98B 4HF0A 3W2AA 2CH0A 2XB0X 3Q9VA 4D5FA 1AOYA 1EKEA 2QSGX 2DFHA 3RZOJ 3CCYA 3HRSA 2A3SA 2LSOA 2CUEA 2ZSHB 3FHZA 4OINF 2UWMA 1A36A 4ZDLA 1N78A 1LB2A 4NQWB 1YW9A 3GTKJ 5F04A 3BJ6A 3HSEA 5BPIA 2Y48A 2X6WA 2LDUA 2LREA 5IY5H 5K7FA 2YX7A 1RKWA 3MZHA 4G94A 1IAWA 1IDZA 2F5EA 5K5QA 1XB4A 3F8NA 3W6JB 1YG2A 1JUMA 3DLLF 4L9JA 4K2EA 3M1CA 2IAIA 2BVLA 3MQ0A 3K69A 2IW5A 3GFIA 1BL0A 5IPAA 3IWFA 3K4MA 4BXFA 2VXDA 3FBNB 3Q3SA 5ICCA 1R4NB 2QQ8A 2AHQA 2DN0A 3TGNA 5D6EA 1TT0A 2LP0A 2FA5A 3HC7A 3OS2A 4XM3A 2LK2A 1R6RA 4A0XA 1UELB 1ETWA 1Z77A 3BG9A 1O3RA 1UFMA 1Q1HA 1TT5B 3HIFA 5AIQA 5K5OA 2JA5J 3TDUC 4O3MA 3CMEI 1BC7C 1GXPA 4U87A 1OYYA 1N25A 2ADUA 3ECHA 2GXGA 3JCUC 2Z2SB 2BXYA 3BG6A 3GZNB 1RR8C 1ITYA 3I59B 4BHPA 1OMIA 2PMZA 3UNGC 3VPRA 2O8XA 4BGDA 4UUSB 3HPHA 4JQFA 2JQ7A 2VLAA 3E97A 3EUAA 5JVGF 2DYSH 1BJZA 2M8GX 2Y31A 3TO9A 5IP9J 1SAXA 4A3BJ 1SFXA 2HGCA 1E0EA 4EM2A 1O3TA 1IN8A 2RV8A 3HB9A 4O6JA 5DD8A 2JA6J 4BHCA 3HYIA 3DTKA 1EH8A 1VQ4I 1FY7A 4BACA 2MC4A 4UB8C 1Z67A 2B63J 5DCFA 5B1BH 1IW7F 2EQRA 2YU3A 2GOMA 3P9IA 3S8PA 4N9HA 3QWLA 3M8JA 2KDOA 2LBFB 2XPUA 1WVRA 4XRSA 2R7WA 2DQLA 2PG4A 3CJTB 3KLOA 4WF2A 4RB0A 5A2QK 1HCRA 1TLHB 1ZG5A 2PQ8A 3K7AJ 1V3FA 3BOQA 1ETOA 3MMYB 4KIBA 4M73A 1YFHA 4HSTA 5CVIA 1YX3A 1CF7A 2GLOA 2V1XA 3C2HA 1MDMA 3FZVA 3ZMVA 2VODA 4JOMA 1FTTA 2XKPA 5FKNA 4A3LJ 2DFFA 2EFWA 3M3YJ 3VYTB 2EZKA 3CP8A 5GAHJ 3W2WA 1J09A 4L5EA 4B43A 3ROUA 2JA8J 4I7HA 2L54A 2TRTA 3MAJA 1XPXA 1B8IB 4M9ZA 4ZDOA 4D9JA 2CQQA 4LIUA 3ZRGA 2OF7A 5K5RA 2KHMA 1W4MA 2I8DA 3LOCA 3F8MA 3VSKA 2XSDC 4AWXB 3C2GA 3SFZA 4AIJA 2A5WA 3BG7A 5FKLA 1K78B 1MMDA 2F5DA 2Y69H 1UAAA 3OYKA 3ZPLA 2WWYA 3GO5A 4IRHA 2GXAA 4HNTA 2ICWG 1XMKA 4OU0A 5FGMA 3RJPA 4A6EA 1QGPA 3MKLA 3FM3A 4CUGA 2OTLI 3KPHA 3OL4A 5D5UB 5BNGA 2R7XA 2QLZA 5LD2C 3B6AA 5KHDA 2D1HA 3BR2A 4YFNF 3HTSB 2FXAA 4Y4RA 1J0RA 4KFCA 3KYDB 1UHWA 4MTDA 9ANTA 3I4PA 1J9IA 2XHKA 1ZRCA 1K61A 4HNUA 1PYVA 2XVCA 3ZMDA 2IVMA 4IVNA 1FIAA 1F1ZA 4XKWA 1KQ9A 3DTIA 1H9GA 2R7OA 1T08B 5GAGJ 1DP7P 4HSRA 2HFHA 1MSFC 4PGGA 1AHDP 2VASA 3G73A 4I6ZA 4HV6A 2JPBA 1T39A 3M1EA 1PUFA 2QBYB 4OMYA 2KIFA 3JRDA 1H88C 1DPRA 1F36A 3AAFA 1IUYA 2MBFA 1ZG3A 1ZKGA 1XSVA 4QSHA 2H1KA 1S7AA 4C3IJ 3BZ6A 2F6CA 1G59A 1R5ID 4HX4A 4A3DJ 2GA1A 2W00A 3V8KA 1FT9A 2IA0A 2OCCH 3K10A 5L3DA 4A5NA 4RM3A 3G71I 2WC2A 5E20A 4QWQA 5JLXA 1G4DA 3BR0A 2KMUA 1POGA 1ZGAA 4ETSA 4AIKA 5F0FA 4JX4A 4R1HA 1RUOA 3J80K 2WAFA 4HPQA 4OIPF 2L9RA 1IJWC 4OOIA 3UR3C 3I4NJ 2Y0SN 3ZXSA 4HQEA 1RESA 3FXUA 2VJ5A 4RLQA 3AFHA 4DOZA 2BV6A 2ISZA 2B7EA 5EG0A 4LOCA 2JT1A 3ZN0A 3M7GA 1OR7A 1HW2A 3JRHA 1MKMA 1UHMA 5ICEA 1X2MA 1RRJA 2G9WA 2W24A 1X19A 3OYIA 3LSGA 2EZLA 2Q8KA 1Z0XA 4HQMA 5E3NA 5DS9A 4ITVA 3OYCA 3A1YA 5CQGA 1FBUA 2LG4A 3VYUB 1IN4A 4V19K 2L0KA 3H9QA 3A4CA 4MQVA 2GM4A 4IOAF 3TQNA 4ENKA 1G6NA 3OYGA 3C7JA 1GLNA 3RPQA 2BW3A 1J59A 2E35A 3A01A 2HS5A 1OCRH 2HR3A 3GFJA 4JBAA 4HDVA 1W0TA 2K4BA 5DCMA 2L3DA 3OIOA 2H27A 1T0FC 3GTOJ 4GGGA 5LEKA 2QVOA 4L5JA 2Q2EA 2NVQJ 2PX9A 2BOLA 1SAUA 2K02A 2HI3A 2HYGD 5H6QA 4N9IA 4ZYGA 5FLVA 2MH9A 1BR1A 5F08A 5IOZA 3VSLA 2O7OA 3IAM2 2ZKZA 4IL6C 5D5VB 3HOXJ 3HPGA 4XMYA 2VKHA 5AONA 1TWFJ 1XN7A 2L9SA 5DYMA 1T98A 4KT6A 4MLOA 1PP7U 1PVEA 1SFEA 3KCCA 4MHGA 1R71A 5D5WB 3PL8A 2WAEA 2MABA 4GDFA 5J4YA 4PSXA 4PZJA 1X1PA 5IYCJ 3J81K 3F9KA 3L09A 4U0VA 4L18B 3NQOA 1V55H 1H8AC 2QSFX 2XAQA 1NG6A 5CVUA 5D6FA 2P6TA 4IRIA 5DDGA 4C2UA 3F3XA 1W5TA 3H3UA 3HHGA 4RDUA 3JSOA 4JP0A 3K70C 4PUSA 1RPWA 3FXQA 5HDKA 1MJ9A 2ZXIA 1MGTA 3FWEA 3KP2A 4BQNA 3WHBA 3ZN1A 3HDDA 3SQNA 3DBHB 4M71A 3OSFA 3GTQJ 4G12A 2A6HF 4ZZDA 2JA2A 1R5HA 3DFGA 3OR2C 2W84A 4JX6A 1MNDA 4PSWA 1LE8A 5J4VA 1IGNA 4GRIA 2HU9A 3EETA 3TKYA 3SFIA 4F3QA 3QPTA 3KP4A 4LG3A 3VYSB 2EFNA 5GP9A 1FYLA 3BY6A 4XICA 3DBLB 1MNMC 1U78A 1WJEA 4GYGA 4BS9A 1U5TA 1W36C 2Q0OA 3CCQI 2K3FA 3DBRB 5DEQA 3PNTA 3GF2A 4XQFA 5JHFA 3R6SA 2BEOA 1W5CC 1HQCA 3KP6A 2E2IJ 3JRBA 1WHUA 1EJ9A 4L0ZB 3I64A 1V5EA 3P5JA 2DJNA 1Y1WJ 3CD6I 2PMZN 1HLVA 1OCPA 4BE0A 1CGPA 2R5YB 2FQ4A 2OQRA 2DMUA 1KQ8A 3ZMUA 1JKPC 2XKOA 4XLEA 4XORA 2EH3A 2OCEA 5BOXA 3FF5A 1MBJA 4BE1A 3DEEA 3ERMA 1TQIA 3KEYA 1ZLKA 2D2WA 1VI0A 3FXKA 4ZZLA 2R5ZB 1R00A 2QF7A 2IPQX 4D7NA 3MFKA 1RUNA 2K27A 4A12A 2CQNA 3GWZA 3L2RA 2UXXA 3G2BA 3A03A 5F1JA 4PJLA 2PMUA 5TGTA 3BZKA 5ICFA 1WJFA 3FXOA 3DWLE 4M3FA 4XLPF 4OMZA 4M74A 2ZB9A 3OS0A 1JKOC 1XMXA 1I1GA 2KRFA 1BIAA 1N77A 5E1WA 2MC3A 4KITB 1X58A 2O3FA 4B8XA 1A6IA 2FE3A 2WB1A 3I3LA 4Y33A 3TW6A 5B1AH 3ZQCA 1IRGA 2XASA 5AIPA 3D5LA 3DXJF 4E7JA 2R7FA 1R4MB 2LF8A 3BQYA 1K4SA 1LFPA 2KRHA 3GCMA 4RMNA 1E3HA 4U0YA 4H4KC 3IHUA 2MLKA 3I5UA 1E3OC 3FKJA 1GV2A 4M6XA 3CDIA 3OYBA 3TW7A 5EGOA 3LWFA 4FASD 3S16J 1XSDA 3CCEI 2LF7A 4CCKA 1WI9A 2P5KA 3KFWX 1S8NA 2VN2A 2FJ1A 5CPRB 2X0LA 1RETA 5H6RA 2K5CA 1QZZA 2ESNA 3PNVA 5IOYA 2QA4I 2VT2A 3Q0VA 4BJTA 3E6CC 3SEQA 1O4XA 1BIBA 3SHFA 4BQOA 5LGNA 1EH7A 5BMZA 1LEBA 3CMAI 2DA6A 1F43A 1B59A 2VB6A 4QIWN 1UCRA 2EJRA 1VF9A 4Q48A 1Z6TA 2ID6A 1YTYA 3DP7A 3QPSA 2HOAA 3O8GA 1FX7A 2GZWA 4HF2A 4B47A 4E7LA 2HOEA 3O6BB 3EYIA 3SYTA 2NXNB 2E1CA 3QYBA 4N4OB 1BC8C 2V1NA 4A93J 1IXCA 3ELKA 4BE2A 2X6OA 4OIQF 3BCAA 4NC6A 4UVCA 1MBEA 2DPDA 4PK4A 2R93J 1Y56A 1JT6A 4MFEA 1OPCA 4ZYAA 2DMQA 2W25A 5B5EC 3SXYA 2VKVA 3H5RA 3V4GA 3I53A 3RPUA 4IEJA 4WCGA 2ZFUA 4P1WA 3S2DJ 2LD5A 1QRYA 1B9NA 1Y1VJ 2DI3A 2FD5A 2XAHA 3DV8A 2DO7A 3NRVA 3E3VA 1ZREA 2QZ8A 2RQPA 2DA1A 5LHHA 1B72A 2CFOA 1ONVA 2RC4A 5KNLA 4HRIA 2HQ5A 2EINH 1IO2A 2KLOA 2CO5A 2ELJA 3O3KA 5F1RA 5CVJA 3PUBA 3LA2A 3F6VA 3S93A 2E5NA 3W2VA 3LSMA 2DDBA 1XCBA 5D8KB 2KIUA 1U8RA 4PDKA 5FFZA 4M72A 2X85A 3WG7H 3J7ZI 1T2KA 4L9VA 1U3EM 4BYYA 2IGOA 3HOZJ 3C2BA 5CYVA 1VFCA 1PDNC 4UB6C 2Y0SA 1YI2I 4C3JJ 5F0CA 2IGMA 1R1UA 4PFOA 3BTIA 3IWZA 2CG4A 1DPUA 2QCOA 1N75A 3TP0A 4HG2A 2F5VA 2KT0A 4E6KG 2E2JJ 4LB5A 3AG4H 1L3LA 3CUQB 2COMA 5IP6A 3HOUJ 1WSUA 2KKOA 3FK7A 4JX5A 1IN7A 4DJAA 1ZK8A 3ZMTA 3JRAA 2VC1A 3V7CA 3DCFA 2XROA 3W6VA 1S9HA 3GYHX 2E71A 5M3MJ 4QPOA 4M3DA 1SC7A 2HTSA 4DW6A 3LSTA 4WK8F 3FM5A 1D8KA 2HZTA 2QENA 2PJRB 2ZNZA 4CCNA 2XAGA 3U2RA 4XKBA 1TWGJ 3RSNA 2NYXA 2X9DA 5EDNA 4EJTA 2LR8A 3DEUA 2KP6A 1B4AA 1P7IA 5KK1A 4CYCB 3S1RJ 4G7HF 1LFBA 1Y39A 1VQLI 2H6CA 2H94A 1G3SA 5E3LA 4FETA 2CFXA 4A3IJ 3RKYA 1KONA 1U9NA 1JHHA 1WH5A 2GA2A 3BPVA 4OWRB 3HG9A 4EVIA 2CUZA 3KX2A 1ODDA 2A05A 3K2ZA 3OOPA 2HEOA 3WE2A 5M5YJ 3S2HJ 4DYRA 5HLHA 1DU6A 1EF4A 2CU7A 2F2EA 4I02A 1O7LA 4AD9A 1JXSA 2FUG2 1HW1A 1FBSA 2CV1A 4BBSJ 4EGZA 1LKXA 1H9TA 4OAYA 2DK5A 1UB9A 1OYIA 2F5FA 1LJ9A 2K9SA 1KU7A 2KIQA 3FMRA 1VQ5I 3TOAA 4GXOA 3CC4I 3K4LA 4ZC3A 4EV0A 3L1PA 3U1KA 2BE5F 3GVAA 1HF0A 5D4RA 5JI6A 3TOBA 2VPLA 1TL8A 2F4IA 1BR4A 3BG3A 4HW0A 5E3OA 4M3BA 4GO1A 4HDUA 3GTMJ 1SMYF 1K7AA 5FFXA 3SZTA 2L01A 1TNSA 1J7KA 1X4OA 4QLCU 3QOPA 1WJ5A 2ESHA 2K40A 1S7EA 4C3HJ 2CW0F 2VL8A 2QM3A 4MGRA 2JRTA 2UV1A 4LFUA 3B73A 3RKXA 4WXCA 5C4JJ 2O61A 4D1QA 2ELHA 1MH3A 4LLLA 2VJ4A 2L2OA 1W7PB 3EQLF 1W36D 1D1CA 2FQ3A 2YR2A 3UKGA 1MJAA 1MZBA 2BHZA 4D0PA 1SEUA 4M3GA 3GTPJ 4EJUA 4UUVA 3FISA 5IYDJ 2BY0A 1KU9A 2NOGA 5CVVA 4I99C 3G3ZA 3RZDJ 1Z05A 5DD4A 2L4AA 2JRMA 3NAUA 3ZR8X 3M8EA 3KP7A 5K7HA 5ILSA 3G6EI 3E7LA 1MSEC 3EDPA 3S15J 1AKHB 2K4JA 2EBIA 2V1DA 2OZ6A 5H20A 2GIZA 2AQEA 1TQPA 2XF7A 5FJ8J 4TV7A 1YOVB 5HLIA 2ZMEA 4JK1X 4D5CA 4RM2A 1IXSB 1SD4A 3JRCA 1FEXA 1AA7A 1AU7A 4HX8A 2WY8Q 1FPQA 1I6HJ 3R61A 1A5JA 1USSA 4BAYA 2XGXA 1JJ6C 3GTGJ 3COAC 2BGCA 3OYDA 1XS9A 4HOBA 1TZLA 5E8IA 3ISPA 2LLKA 5EEGA 1LE8B 4IHSA 2B0LA 2M5WA 2L02A 2EFQA 2LRDA 1ETQA 4P5OA 5GPAA 1G3YA 2FOKA 3A02A 3RCOA 3BZCA 1IG7A 3CCRI 4U7DA 1XMAA 1NHAA 2VJIA 3K1MA 3ZQFA 5DUIA 2D5VA 3ABKH 2VC0A 3WU1B 1HKSA 1XGMA 1Z7LA 2RNJA 3G1LA 4A3JJ 3A0BC 1NK2P 1KZHA 1QPMA 1S6LA 3SDBA 1JHFA 3OYJA 2QQBA 1XGNA 1LDKB 2WB1N 3U1DA 1R5GA 4PJNA 1D0YA 1OR7C 1VNDA 1ZTRA 1ZR2A 3JW4A 2LKPA 4EQQA 3CO7C 3JREA 2PLYA 2K3PA 4BEHB 1R1VA 4ON0A 2C6YA 2BZTA 4HZFA 2Q1ZB 3QP6A 3HOWJ 4XLFA 1O3QA 2IS4A 3WTYC 2NAZA 2XRNA 4RAZA 4FCYA 4XLAA 1G3WA 2IS6A 2E7WA 3OYFA 1R58A 3TMOA 3KP5A 3BR5A 3IH3A 1G8XA 5CVRA 4YG2F 2IS1A 1OISA 4AVZA 1VQNI 2GAUA 2GIVA 2FBKA 3ZQHA 4EJVA 3RKWA 2H8RA 4UUTA 3BR1A 2VUMJ 4KA4A 4XLHA 2QEXI 2VE9A 4A3EJ 1J75A 2WAQA 2X1EA 1FJLA 1BN5A 1IV8A 4HLYA 2RREA 4UHTA 2L5QA 3D0SA 1JE8A 2KDZA 4MNUA 2DT6A 3GZ5A 4XIDA 1A6QA 2JTVA 3PIPF 1YJNI 5DM7F 4I09A 2M2EA 2W1OA 4L5IA 3U9GA 1HOMA 2L7FP 3DTEA 2DK8A 1MMAA 2O9LA 2PMHA 2P81A 1U0JA 3BP8A 2H6BA 1DGWY 3HXLA 3MN2A 4Y17A 3JSPA 3H3ZA 3T0YA 3RKQA 1LNWA 3KZZA 5ICGA 1Z7UA 4N4NB 3LQRA 1XCVA 1LEAA 1BR2A 1D3YA 4M6YA 5E8GA 1T8IA 2QSHX 2GBYA 1S7OA 1YW8A 4DGWB 2EILH 2IJLA 2HVSA 4HAMA 2HVRA 5B66C 1P4AA 2FNAA 1R23A 2CUJA 2WBMA 4CA0A 4OIOF 2M4KA 3TO6A 3LSJA 1E17A 1WQ2A 2P5VA 1K83J 4ENNA 2R0QC 1I6XA 1BI1A 1WPKA 2YU9J 3F0CA 2CQKA 5HDGA 1UZCA 3CLOA 3OMYA 4XN3A 4BQAA 4FHTA 1FOWA 5F64A 4MTEA 2VBZA 3L2VA 2CV2A 1WI3A 3CESA 2OD5A 1BA5A 1IRZA 1X1CA 1JGSA 4KICA 3V7SA 2DMNA 4CZZA 3OS1A 3LSRA 1S5LC 1XGSA 2EK5A 4HV5A 5F6FA 2DCEA 4UXNA 2W7NA 2OJED 3WGIA 1H0MA 3TO7A 1VTNC 2DA4A 5K1YA 2IA1A 1OCOH 2DA3A 2HPIA 2DOEA 5EF6A 4LG0B 2Z99A 3MVPA 4HLXA 3K1PA 2X6YA 2JPCA 3AG3H 4NC8A 1WWXA 3BCBA 2V6CA 3BG5A 3HOSA 1U5TC 1REPC 4YRVA 3HM5A 3LA3A 4S04A 3FMSA 2DXIA 2JN6A 3WODF 2CS3A 2OBPA 2WV1A 4RS8A 5HNHA 3AL0B 4UVAA 3OYNA 2ME6A 5E79C 3F8CA 5LRSA 2DDAA 1VQPI 3H92A 2P7CB 4AUXA 1MJBA 3I55I 1D0ZA 2FMYA 4NQWA 2XGCA 2IXSA 4BDYA 3GEZA 4V2GA 3BDDA 2K9LA 2Z3YA 3DKXA 3T8RA 1QA6A 2KZGA 3S2WA 1SVMA 2CV0A 5LLQA 2WV0A 3I4MJ 3S1MJ 2M87A 3OV8A 1QO0D 2IBDA 2YS9A 3QPHA 1EA3A 3GBGA 2UZKA 4BY1J 1WJAA 4XKCA 4RA2A 1ZELA 5CJ9A 4A3FJ 3DEWA 5JLWA 4Z6YA 2TCTA 1IRFA 2RGVA 2VQCA 1UG0A 3HOVJ 2HDCA 1WCMJ 2VJJA 1ZAOA 1R49A 4IXAA 4ZTFA 1QU3A 2QQ9A 3V42A 4LITA 1YIOA 4P9UA 4BBRJ 1ZR4A 3J7AY 2HOTA 1ZN2A 5FROA 1YLFA 5ED4A 3HUGA 2EWNA 5M3FJ 3K4KA 4UNOA 5D8LB 4C2MJ 2OTJI 3EYYA 4M6VA 4S0HB 2HKXA 1IRXA 3I59A 3IRRA 1PJRA 1YRNB 2VE8A 4UUSA 1Z3XA 3OWTA 4ZJZA 5FKKA 3FBIB 3GTJJ 3DU5A 3QU6A 3ECOA 3CCVI 3IH4A 1V54H 2ETHA 2H8WA 2W48A 5LBQA 5J47A 4WXHA 4GYIA 1PP8F 4UY8I 3E1SA 3RIRA 2DA7A 4NUBA 1TQMA 2FOWA 3I58A 2F48A 1MBHA 2ZFWA 2LVSA 1XGOA 2HZDA 3WTXC 3E5QA 1CQTA 2E1MB 4FE4A 1SD6A 1YX5A 2M30A 4RB3C 2OPTA 3MKYB 1P7JA 2CUFA 2LBFA 5LGTA 4DBQA 2EPFA 5L3GA 3Q0UA 3MKWB 1HKTA 1HC8A 5J3LA 4AYBN 2M3AA 1S72I 1JTYA 2VOOA 1X4PA 4BHBA 3CF5F 1BI0A 1LQ1A 5J1RA 4U88A 1BBYA 3PFYA 5TISC 2VKEA 4IJAA 3WGHA 1MMNA 4XNFA 3QOEA 1A35A 1TNTA 2BY2A 2JVGA 4EJOA 3VWBA 4LLNA 1LDDA 4PGHA 2EB7A 3R0JA 4WX9A 1WFXA 2V79A 4EEFG 3J7YJ 2MGQA 1FYKA 1TP4A 1KQ0A 2W85A 2HQAA 5CKTA 2TDXA 3HKZN 1HDDC 4F55A 2A69F 1ULYA 4O5VA 1Y0NA 3LAPA 1B8IA 1YO5C 1KU3A 2EV5A 2XUBA 3BTJA 4Y13A 4RAGA 3VFZA 2CW7A 2RDPA 4BL0B 3K1NA 1IC8A 3OL3A 3V7RA 4E7HA 4HX7A 1K78A 2O5RA 4KN7X 2X51A 4G6QA 4E7SA 2EV6A 4Y52J 4A0YA 4YFKF 2OU2A 2M0MA 4XKVA 3BR6A 4KISA 5J8FA 2DBBA 3F21A 4ENJA 1U2WA 2K86A 4IPAA 3FMQA 4A3KJ 3H0GJ 2XAFA 5FLXZ 4XSZF 2VBYA 2DYRH 1XSXA 1R22A 3HGYA 4ZH4F 2IGKA 2QWWA 4I2OA 2LOOA 4DBRA 2QKLB 2BXZA 2FBHA 2W57A 4B1RA 2O03A 1R36A 1LFUP 4AM3A 2MH2A 2XB5A 1QQIA 1HW5A 2CQXA 2HTJA 1DUXC 1YHQI 1YITI 3R60A 1GUUA 3F8FA 2VI6A 3K0LA 2V4JC 2G0EA 4HEA2 2NNYA 2W82A 2WA0A 2PFBA 3ZGKA 2QBYA 2YUSA 2UUZA 3L9FA 5FB2A 2MA3A 3KEOA 2VKDA 4CZCA 4L9TA 2G7HA 3OYEA 1QZEA 3TEDA 3EUHA 3CF2A 5HVQC 2N8GA 3QQAA 2KISA 3GUDA 3IL2A 1IF1A 2F5CA 4Q47A 2HKOA 2WAQN 2Y30A 4IKFA 5LFAA 2EIJH 5BQTA 1ACIA 3AKZA 2ACJA 1APLC 2ISYA 3CTAA 3ABTA 5L3CA 1I27A 1IN6A 1TBXA 3HTUA 3WU0A 3REOA 4KYWA 3FXJA 5D4SA 3GX4X 2FMLA 5GTHC 1CF7B 2JA7J 4B3XA 3KE2A 5FRNA 3S1NJ 4MIMA 1K6YA 1MDMB 1WKMA 2J5PA 3HOTA 4KUMA 1ERDA 1BI2A 3W6KB 1JTXA 3ZCOA 5DV5A 1VQ9I 2MFZA 3JAMZ 1P9QC 2YPRA 4BQQA 2KL4A 2ZXWH 3I56I 3VB2A 3HHHA 2M0CA 1YJ9I 5JHUA 2H09A 4P55A 2ECBA 1FC3A 3WG9A 2ZO4A 2V9VA 3HBLA 4B44A 3KZYA 3NWTA 4RGSA 5DM6F 4E7KA 3QU3A 2X1DA 5BS6A 4XBFA 1QBJA 1QZYA 4DYQA 3U21A 1G2HA 3OR1C 3CC7I 3PO3J 1FSHA 2CGPA 4Y3OA 4EM0B 4C30A 3H9JA 2R7SA 4IQ4A 2L4MA 1ZH5A 2R7RA 4HBLA 5EYRA 1FBQA 3HSFA 1TW3A 4U7BA 2UXNA 2Y2ZA 4XOPA 3ZQIA 3H0DA 2EFOA 2XDVA 5IT9K 4CO8A 4UVBA 4L9NA 2Z33A 2DLLA 2FRHA 5L3FA 3F23A 2VQHA 3JRGA 3LSIA 4S05A 1R1TA 3T5XA 5C3EJ 4KNYA 1XDUA 2QQAA 2DMPA 3IH2A 4PJJA 2ZC2A 3CCMI 4XONA 1YYVA 4E70A 3A2KA 5L3BA 5FKMA 4XRMA 2V9PA 5DUKA 3HRTA 3FIWA 2LKXA 1YS7A 1YW7A 4CHUA 1PUFB 2ZXHA 1I3AA 3ZQ7A 1D5YA 4BJ5C 1MBGA 1ZG1A 2STWA 3S17J 1BJAA 1VQ6I 2K9NA 1KYZA 4AC0A 4HNVA 4YELA 3HGGA 1HSTA 2CWEA 1XG1A 2NS8A 1S29A 4CGZA 2Y0MA 2ZMEC 3S32A 1BOBA 4DNCA 4PCQA 4G8XA 3H1CA 2DODA 4D7MA 3ZQQA 5F0HA 3GXOA 4KIGA 5HS8A 5F27A 2X6XA 3PFIA 3VDXA 2M9HA 4ZYDA 2XPVA 2KZVA 4L0YB 3TDZC 2W4SA 1X3WB 2E5ZA 4MO7A 3G4SI 1MH4A 2WADA 1ENHA 5EG0B 1T38A 2X48A 1YE9A 5LHIA 1IDYA 3H3VK 4R8HA 2NVYJ 4Y15A 2K7LA 3CCUI 4MEYF 5M5XJ 5E1ZB 2PI0A 4IHVA 3BJOA 5J1UA 3K70D 4IO9F 5TRDA 1P4XA 3RQIA 2DQRA 1RZ4A 1J5YA 2X4HA 4QPQA 3TBIA 1JKQC 1SVLA 4RGXA 5HNFA 3T8TA 4X1EA 3JRIA 1O7FA 1XDSA 4BXXJ 3CZ6A 1Z9CA 2BW3B 3GFMA 4RGUA 3A01B 3GLXA 4XK4A 3CCJI 5DCMB 2NS7A 4IRGA 2DA5A 5HOOA 2R5YA 2O6GE 2Q2EB 1ZGWA 4EJWA 1P92A 1A31A 4X6AJ 5HS7A 2V1UA 4NBQA 2M1BA 3BQZA 3N4MA 3QRFF 3IC7A 1VQ7I 3KP3A 4F7ZA 2QUFA 3KLNA 5CLSA 3L2QA 1TC3C 3PJRA 3WGGA 3ZMSA 3DF8A 5JR3A 2BY1A 2R7VA 2Y75A 4G9YA 2VQGA 4ESFA 1T6SA 1LUJB 2DFEA 2R5ZA 1H89C 2DFIA 4AYBA 3HEFA 3WTTC 3CC2I 3V8JA 3E0JB 3GW2A 4BJ6C 2IRFG 2IS2A 1OCZH 3H35A 3R4KA 2A61A 4UV9A 2VPRA 4WWCA 3MWMA 2HDDA 3CJNA 2JK3A 4AVPA 2ZBKA 1QPIA 3IUOA 2VONA 4XR6A 1GXQA 3RPUD 3PIOF 1E2XA 2KPMA 1UHSA 1U6GA 2Z5UA 5IT3A 1X3ZB 2L7MP 4LIVA 4RAFA 2E34A 3E5UA 3HKZA 3E6BA 3FXRA 2HXOA 3CUQC 2VOPA 1BI3A 2QGUA 2E19A 3NEUA 4YIIA 1UG2A 4NHJA 2DMTA 2V7FA 3HUGB 3QPLA 2LYCA 2DT7B 1ZARA 5L3EA 1B1BA 1QNTA 2EIMH 2JZYA 3HJEA 4P9FA 2HWVA 2LFBA 1IV6A 5CQEA 3EUKL 5J1YA 5K7ZA 3M4OJ 1HSJA 1MW7A 1SD5A 3GFLA 3E6DA 3H9GA 1XTAA 3ERED 4KMUX 4KMFA 2IGNA 4ZYEA 4LLGF 4HA8A 1OKRA 1Z21A 2BHYA 3LFKA 3WHCA 4EATA 4G7ZF 5KCMA 2OUMA 3CP2A 4RB2C 2HQRA 1ZRDA 2M8EA 4KIFA 5C4XJ 1I1SA 1F5TA 1KU2A 3K4CA 1U5TB 3RTRA 2L7ZA 3N97A 4IHXA 2GWRA 3GTLJ 1TWHJ 4B3AA 1SD7A 2XGDA 4P96A 1FYMA 2Y9YA 2E36A 4PJ0C 3VEPA 5KAIC 3CMMA 1X1DA 2EA4A 5C44J 5IT9Z 2JSPA 3H36A 2E60A 3D1NI 1D5VA 2JUCA 2IEKA 4DZPA 4F92B 1X2NA 2RQQA 3KIOA 4YFXF 4UV8A 2L7KA 2DT5A 2YX4A 3CLQA 1I5ZA 3PSIA 2YSRA 1MMGA 3K4NA 3DKWA 2DTZA 1ETXA 4YIFA 2OQGA 4ZYHA 1X1BA 2KJBA 2JUGA 4B48A 4KN4X 2M34A 1OLTA 2LNBA 5HODA 1TW2A 5GAEJ 1YJWI 4XLNF 1O57A 3OYAA 3MCZA 1HBXG 1GDTA 4ESBA 1A04A 5H2FC 5E17F 2NNNA 3LSPA 3PUFA 5EEAA 3ZMZA 3L00A 4XRSG 4PFPA 3RQ4A 3TP3A 3ZQGA 4BY7J 2XRLA 1NH3A 1FOYA 4GFBA 1FMVA 3PNYA 1DQUA 4A6DA 3HZJA 2PEXA 5LRRA 2R92J 1Y0UA 3I0TA 2FBIA 2EZIA 2VXZA 1JI8A 1P2FA 2R7QA 4CYDA 3BLYA 4QTRA 3KYLA 1F4KA 4FISA 2IA2A 4BKXA 4A3GJ 1VQKI 2P7VB 2A68F 4V2FA 1OFCX 4FX0A 1STZA 2BYVE 4LJZF 3OYHA 1W0UA 3CUQA 2AO9A 1XD7A 6PAXA 1BM9A 4WXDA 1FNNA 1SFKA 1I50J 1IN5A 4C2TA 3F6OA 1BOAA 3G1MA 2DOFA 1SFOJ 1WZ2A 2KQRA 4Z2YA 1OCTC 3SDGA 3O8HA 2F4MB 4OAZA 4MEXF 5EGOB 2EFPA 4J00A 1QVUA 3SZPA 5EZHA 4CH7A 3MD2A 4BNCA 2P6SA 3ABUA 4NB5A 4U0WA 3JRFA 2P0WA 2K9MA 4FT8A 4A0ZA 3LAJA 4RBOA 3VODA 3IV5A 4M9SA 2PJRA 2FF4A 3CDLA 3DPUA 1S3JA 2STTA 4G6DA 2EA2A 5FLXK 2VBWA 5LEJA 1MBFA 2MD5A 2V9KA 4CYCA 4FX4A 1MD0A 2XAJA 3LQQA 2LY2A 1OQYA 2X1CA 3S3OA 3ZOBA 4BH9A 4F91B 2NS0A 1DDNA 4H0EA 4ESJA 3OYLA 2H1LA 3LL7A 4E7ZA 2O8KA 3CUOA 4Y7NJ 3T1BA 2XF6A 5GADJ 2L9NA 3C3WA 4IX7A 3P9CA 2MG4A 3BJAA 5DTDA 3AG2H 3M9AA 1XX5A 3DQVC 4NDLA 2FNPA 3VYRB 4PJMA 2OA4A 4BUPA 4LGWA 2DTRA 4MQ9F 4IF4A 4IHTA 1VZ0A 2D1VA 1B72B 1FLIA 1YS6A 2DJIA
chains in the Genus database with same CATH topology
1PUEE 1ZYRF 2D45A 5D5XB 1FZPB 1LVAA 3BPXA 2RN7A 3IKTA 4XRFA 3I54A 3ULQB 2Z9OA 1Z1DA 2GQQA 3MEXA 2P5LC 3JTHA 3JAMK 1OYWA 1K79A 4LK1F 2PN6A 2RKHA 5ILUA 3RYPA 1Z6RA 5TJJA 1W7PA 3F72A 3WTUC 1B9MA 1V4RA 4N0BA 4GCVA 5A2QZ 5FO5A 3BWGA 5J6XA 1FWZA 3MZYA 1FP2A 4DQ2A 2NRAC 1GHCA 2J5OA 3ZP5A 3PQJA 1KGSA 1HXDA 3CDHA 3L2CA 3J7AO 1AWCA 2EV0A 3L7WA 1RI7A 3B02A 1ZGJA 1ON1A 3I71A 4HF1A 2HYFA 1SMTA 2QYOA 3WTWC 3Q9SA 1F9NA 3VOEA 1KA8A 2CYYA 3PQKA 3LA7A 2AXLA 2VT3A 2GXBA 3F22A 1T0FA 5LHGA 3KEQA 2DW4A 4RAYA 3CO6C 5ERIA 1W5SA 4B09A 1SFUA 4RGRA 2FEZA 3QP5A 2ZCWA 3K9TA 1FSEA 1J2XA 3KETA 3DPLC 1G3TA 4LB6B 5BPDA 1ZRFA 2RVCA 5JVTA 2OAZA 1P4WA 3C18A 2XV4S 1Z91A 2BBYA 4Q5SF 2DAOA 3P9KA 3J80Z 4ASNA 2ZJ2A 1O3SA 2ZXJA 1RNLA 2XIGA 1C0WA 5KVRA 2ZMEB 4LMYA 1IXRC 4R79A 2R7DA 3F8BA 2MLGA 2DPUA 1ZHFA 1X3UA 3BROA 3RI4A 1IZ1A 2O0YA 4A5MA 1D8JA 5FD6A 5FD5A 1EH6A 1LDJA 2AS5F 4EM1A 2IT0A 5ILVA 5HLGA 3JTGA 1YQAA 3P7NA 2A07F 3C1DA 2P8TA 2A5YB 4LG0A 4XSXF 1K6OA 3RYRA 1W7PD 2E1NA 4LD5A 3WTZA 2G7UA 3R0AA 3O2PE 2P4WA 4EMSA 1FP1D 4HYEA 3WTVC 2PBIA 3IRQA 1B6AA 3M8FA 4A2UA 3WTSC 1WRJA 3J81Z 5LGUA 5J8CA 2VBXA 3WE3A 2M45A 1RIOH 1HKQA 1KYWA 3QAHA 1GVJA 2IP2A 1L0OC 2KJCA 4KT5C 2E7XA 2JSCA 2WTEA 4Q4ZF 5EEHA 2FU4A 3DPTA 3FX3A 4ENMA 1EV7A 4BXUA 3V8LA 4CICA 2R3SA 1FOKA 3IKVA 2PJPA 2CSOA 5E1XA 1ZLJA 4I0BA 2DU9A 5E18F 1TTYA 4AIHA 2FSWA 4EGYA 1USTA 2KIMA 4I01A 4M9XA 3RDIA 4RB1A 3ML6A 5JFRA 2OZUA 3E5XA 2A6EF 4CDGA 3HRMA 1P6RA 4CXFA 4G7OF 1ON2A 3HSRA 3Q5FA 3E6MA 3GZ6A 2HQNA 5HDNA 4OIRF 4LK0F 1R7JA 4I0AA 4KDPA 2ZNYA 5HS9A 3HRUA 4I98B 4HF0A 3Q9VA 1AOYA 3HRSA 2A3SA 2LSOA 3FHZA 4OINF 2UWMA 1LB2A 1YW9A 3BJ6A 3HSEA 5BPIA 2Y48A 2LDUA 2YX7A 3MZHA 4G94A 2F5EA 5K5QA 1XB4A 3F8NA 3W6JB 1YG2A 4L9JA 4K2EA 3MQ0A 3K69A 2IW5A 3GFIA 3IWFA 5ICCA 3TGNA 5D6EA 2FA5A 4A0XA 1O3RA 1UFMA 1Q1HA 5AIQA 3HIFA 5K5OA 3TDUC 4O3MA 1BC7C 1GXPA 1OYYA 2ADUA 3ECHA 2GXGA 3I59B 4BHPA 1OMIA 2O8XA 4JQFA 3E97A 3TO9A 1SAXA 1SFXA 2HGCA 4EM2A 1O3TA 1IN8A 2RV8A 4O6JA 5DD8A 4BHCA 3HYIA 1EH8A 1FY7A 5DCFA 1IW7F 2YU3A 3P9IA 4N9HA 2DQLA 2PG4A 3KLOA 4WF2A 4RB0A 5A2QK 1TLHB 1ZG5A 2PQ8A 1V3FA 3BOQA 4KIBA 4M73A 1YFHA 5CVIA 1CF7A 2V1XA 1MDMA 3FZVA 3ZMVA 2VODA 2XKPA 2EFWA 3ROUA 4I7HA 2L54A 3MAJA 4M9ZA 5K5RA 1W4MA 3F8MA 4AWXB 3SFZA 4AIJA 1K78B 2F5DA 3ZPLA 2WWYA 3GO5A 4IRHA 4OU0A 1XMKA 5FGMA 3RJPA 4A6EA 1QGPA 3FM3A 5D5UB 2QLZA 2D1HA 4YFNF 3HTSB 2FXAA 1J0RA 4KFCA 1UHWA 4MTDA 3I4PA 1J9IA 2XHKA 1ZRCA 2XVCA 3ZMDA 2IVMA 4IVNA 1F1ZA 1KQ9A 1H9GA 1DP7P 2HFHA 4PGGA 3G73A 4HV6A 2JPBA 1T39A 3M1EA 2QBYB 4OMYA 2KIFA 1DPRA 3AAFA 1IUYA 2MBFA 1ZG3A 1XSVA 1S7AA 3BZ6A 4HX4A 2GA1A 3V8KA 1FT9A 2IA0A 5L3DA 4A5NA 2WC2A 5E20A 4QWQA 1G4DA 1ZGAA 4ETSA 4AIKA 1RUOA 4R1HA 3J80K 4OIPF 4OOIA 4HQEA 3FXUA 2BV6A 2ISZA 2JT1A 3ZN0A 3M7GA 1OR7A 1HW2A 1MKMA 1UHMA 5ICEA 2G9WA 2W24A 2Q8KA 4HQMA 1FBUA 1IN4A 4MQVA 3TQNA 4ENKA 1G6NA 3C7JA 3RPQA 1J59A 2HS5A 2HR3A 3GFJA 4JBAA 4HDVA 2K4BA 5DCMA 2L3DA 2H27A 4GGGA 5LEKA 2QVOA 4L5JA 2Q2EA 2K02A 2HYGD 5H6QA 4N9IA 4ZYGA 2MH9A 2ZKZA 5D5VB 5AONA 1XN7A 5DYMA 1T98A 1PP7U 3KCCA 1SFEA 4MHGA 5D5WB 4PZJA 3J81K 3L09A 4U0VA 4L18B 3NQOA 2XAQA 5CVUA 5D6FA 2P6TA 4IRIA 5DDGA 3F3XA 1W5TA 3H3UA 3HHGA 3JSOA 3FXQA 5HDKA 1MJ9A 1MGTA 3FWEA 3KP2A 3ZN1A 3SQNA 4M71A 2A6HF 4ZZDA 1R5HA 3DFGA 2W84A 3EETA 3TKYA 3QPTA 3KP4A 2EFNA 1FYLA 3BY6A 1U78A 4GYGA 1U5TA 2Q0OA 5DEQA 3GF2A 3R6SA 2BEOA 1HQCA 3KP6A 4L0ZB 3I64A 1CGPA 2OQRA 1KQ8A 3ZMUA 2XKOA 5BOXA 3FF5A 1TQIA 1ZLKA 2D2WA 4ZZLA 1R00A 2IPQX 3MFKA 1RUNA 2K27A 4A12A 3GWZA 2UXXA 2PMUA 5ICFA 4XLPF 4OMZA 4M74A 1I1GA 2KRFA 1BIAA 1IAWA 5E1WA 2MC3A 4B8XA 2O3FA 2FE3A 1IRGA 2XASA 5AIPA 3D5LA 3DXJF 2R7FA 2LF8A 4U0YA 3IHUA 2MLKA 3I5UA 4M6XA 3LWFA 1XSDA 2LF7A 1WI9A 2P5KA 3KFWX 1S8NA 2VN2A 2X0LA 5H6RA 1QZZA 2ESNA 2VT2A 3E6CC 1BIBA 3SHFA 5LGNA 1EH7A 5BMZA 1LEBA 1B59A 1UCRA 2EJRA 4Q48A 1Z6TA 1YTYA 3DP7A 1FX7A 2GZWA 4HF2A 3EYIA 2HOEA 3O6BB 2E1CA 1BC8C 1IXCA 3ELKA 4OIQF 4UVCA 2DPDA 1OPCA 2W25A 3SXYA 3V4GA 3I53A 3RPUA 4WCGA 1B9NA 2DI3A 2XAHA 3DV8A 2DO7A 3NRVA 3E3VA 1ZREA 2QZ8A 2RQPA 5LHHA 2RC4A 1ONVA 2CO5A 3O3KA 5F1RA 5CVJA 3LA2A 3F6VA 5D8KB 1XCBA 2KIUA 1U8RA 4PDKA 5FFZA 4M72A 1T2KA 4L9VA 1U3EM 4BYYA 5CYVA 1PDNC 1R1UA 3IWZA 2CG4A 1DPUA 4LB5A 1L3LA 3CUQB 2COMA 1WSUA 2KKOA 1IN7A 3ZMTA 2VC1A 3V7CA 2XROA 3GYHX 2HTSA 3LSTA 4WK8F 3FM5A 1D8KA 2HZTA 2QENA 2ZNZA 2XAGA 3U2RA 2NYXA 4EJTA 3DEUA 1B4AA 5KK1A 4G7HF 2H6CA 2H94A 1G3SA 2CFXA 3RKYA 1JHHA 2GA2A 3BPVA 4EVIA 1ODDA 3OOPA 3K2ZA 2HEOA 3WE2A 5HLHA 2F2EA 4I02A 1O7LA 4AD9A 1JXSA 1HW1A 1FBSA 4EGZA 1H9TA 2DK5A 1UB9A 1OYIA 2F5FA 1LJ9A 1KU7A 3FMRA 3TOAA 4GXOA 4EV0A 2BE5F 3GVAA 5D4RA 5JI6A 3TOBA 4HW0A 4GO1A 4HDUA 1SMYF 1K7AA 5FFXA 3SZTA 2L01A 1TNSA 1J7KA 4QLCU 3QOPA 2ESHA 2CW0F 2QM3A 4MGRA 2JRTA 4LFUA 3B73A 3RKXA 4WXCA 2O61A 2ELHA 4LLLA 1W7PB 3EQLF 2FQ3A 2YR2A 1MJAA 1MZBA 4D0PA 4EJUA 4UUVA 1KU9A 5CVVA 3G3ZA 1Z05A 5DD4A 2L4AA 3M8EA 3KP7A 5ILSA 3EDPA 2K4JA 2V1DA 2OZ6A 5H20A 1TQPA 4TV7A 5HLIA 2ZMEA 4JK1X 1IXSB 1SD4A 4HX8A 1FPQA 3R61A 1USSA 4BAYA 2XGXA 3COAC 2BGCA 4HOBA 5E8IA 3ISPA 5EEGA 4IHSA 2B0LA 2M5WA 2L02A 2EFQA 4P5OA 1G3YA 2FOKA 4U7DA 1XMAA 1NHAA 3K1MA 5DUIA 2VC0A 3WU1B 1HKSA 1XGMA 2RNJA 1QPMA 1S6LA 1JHFA 2QQBA 1XGNA 1LDKB 3U1DA 1R5GA 3JW4A 2LKPA 4EQQA 3CO7C 2PLYA 1R1VA 4ON0A 2C6YA 4HZFA 3QP6A 1O3QA 3WTYC 2NAZA 2XRNA 4RAZA 1G3WA 2E7WA 1R58A 3KP5A 5CVRA 4YG2F 2GAUA 2GIVA 2FBKA 4EJVA 3RKWA 4KA4A 2VE9A 1J75A 1BN5A 4HLYA 4UHTA 3D0SA 1JE8A 4MNUA 3GZ5A 2JTVA 4I09A 4L5IA 3U9GA 2DK8A 2PMHA 3BP8A 4Y17A 2H6BA 3JSPA 3H3ZA 3T0YA 1LNWA 3KZZA 5ICGA 1Z7UA 3LQRA 1XCVA 1LEAA 1D3YA 4M6YA 5E8GA 1S7OA 1YW8A 2IJLA 4HAMA 1P4AA 2FNAA 1R23A 4OIOF 3TO6A 1E17A 1WQ2A 2P5VA 4ENNA 1I6XA 1BI1A 2CQKA 5HDGA 3CLOA 4BQAA 4FHTA 5F64A 4MTEA 2VBZA 2OD5A 1JGSA 4KICA 3V7SA 4CZZA 5F6FA 1XGSA 2EK5A 4HV5A 4UXNA 3WGIA 1H0MA 3TO7A 1VTNC 5K1YA 2IA1A 4LG0B 2Z99A 4HLXA 3K1PA 2JPCA 1WWXA 2V6CA 3HOSA 1U5TC 1REPC 3LA3A 4S04A 3FMSA 3WODF 2OBPA 4RS8A 4UVAA 3F8CA 5LRSA 3H92A 2P7CB 1MJBA 2FMYA 4NQWA 3GEZA 3BDDA 2Z3YA 3T8RA 3S2WA 5LLQA 2WV0A 2M87A 3OV8A 1QO0D 3QPHA 2UZKA 5CJ9A 1IRFA 2RGVA 2HDCA 1ZAOA 4IXAA 2QQ9A 1YIOA 4P9UA 1ZN2A 1YLFA 5ED4A 3HUGA 2EWNA 4UNOA 5D8LB 3EYYA 2HKXA 3I59A 3IRRA 2VE8A 3QU6A 3ECOA 2ETHA 5LBQA 4WXHA 4GYIA 1PP8F 3RIRA 1TQMA 3I58A 2ZFWA 1XGOA 3WTXC 3E5QA 1SD6A 2M30A 4RB3C 5LGTA 5L3GA 1HKTA 2VOOA 4BHBA 1BI0A 1LQ1A 4U88A 1BBYA 4IJAA 3WGHA 1TNTA 4EJOA 4LLNA 1LDDA 4PGHA 2EB7A 3R0JA 4WX9A 2V79A 1FYKA 1KQ0A 2W85A 2TDXA 2A69F 1ULYA 4O5VA 3LAPA 1YO5C 1KU3A 2EV5A 2XUBA 4Y13A 3VFZA 2RDPA 3K1NA 3V7RA 4HX7A 1K78A 4KN7X 4G6QA 2EV6A 4A0YA 4YFKF 2OU2A 5J8FA 2DBBA 3F21A 4ENJA 1U2WA 2K86A 4IPAA 3FMQA 2XAFA 5FLXZ 4XSZF 2VBYA 1XSXA 1R22A 4ZH4F 2QWWA 4I2OA 2FBHA 2W57A 2O03A 1R36A 2MH2A 1QQIA 1HW5A 2HTJA 1DUXC 3R60A 3F8FA 3K0LA 2NNYA 2PFBA 2QBYA 3L9FA 5FB2A 2MA3A 3KEOA 4L9TA 2G7HA 3EUHA 5HVQC 3GUDA 3IL2A 1IF1A 2F5CA 4Q47A 2HKOA 5BQTA 2ACJA 2ISYA 3CTAA 3ABTA 5L3CA 1I27A 1IN6A 1TBXA 3HTUA 3WU0A 3REOA 4KYWA 5D4SA 3GX4X 2FMLA 1CF7B 3KE2A 1MDMB 1WKMA 2J5PA 3HOTA 4KUMA 1BI2A 3W6KB 5DV5A 3JAMZ 2YPRA 3VB2A 3HHHA 5JHUA 2H09A 4P55A 1FC3A 3WG9A 2ZO4A 2V9VA 3KZYA 4RGSA 3QU3A 5BS6A 4XBFA 1QBJA 1QZYA 1FSHA 2CGPA 4EM0B 2L4MA 1ZH5A 4HBLA 1FBQA 3HSFA 1TW3A 4U7BA 2UXNA 2EFOA 5IT9K 4CO8A 4UVBA 4L9NA 2Z33A 2DLLA 2FRHA 5L3FA 3F23A 4S05A 1R1TA 3T5XA 4KNYA 1XDUA 2QQAA 1YYVA 4E70A 5L3BA 5DUKA 3HRTA 1YS7A 1YW7A 4CHUA 3ZQ7A 1ZG1A 2STWA 1BJAA 1KYZA 1HSTA 2CWEA 1S29A 4CGZA 2Y0MA 4DNCA 4PCQA 4G8XA 3GXOA 4KIGA 5HS8A 3PFIA 4ZYDA 4L0YB 3TDZC 1T38A 5LHIA 4R8HA 4Y15A 2K7LA 4MEYF 5E1ZB 2PI0A 3BJOA 5TRDA 1P4XA 2DQRA 1RZ4A 1J5YA 2X4HA 4RGXA 3T8TA 1O7FA 1XDSA 1Z9CA 3GFMA 4RGUA 3GLXA 5DCMB 4IRGA 5HOOA 2O6GE 4EJWA 1P92A 5HS7A 2V1UA 2M1BA 3QRFF 3N4MA 3IC7A 3KP3A 4F7ZA 2QUFA 3KLNA 5CLSA 3WGGA 3ZMSA 3DF8A 5JR3A 2Y75A 4G9YA 4ESFA 1T6SA 2DFIA 3WTTC 3V8JA 3GW2A 2IRFG 3R4KA 2A61A 4UV9A 4WWCA 3MWMA 3CJNA 4AVPA 2ZBKA 2VONA 1GXQA 1E2XA 1U6GA 2Z5UA 5IT3A 3E5UA 3E6BA 3FXRA 3CUQC 2VOPA 1BI3A 3NEUA 4YIIA 4NHJA 1ZARA 5L3EA 1B1BA 1QNTA 2JZYA 4P9FA 2HWVA 1HSJA 3GFLA 1SD5A 3E6DA 3ERED 4KMUX 4KMFA 4ZYEA 4LLGF 4HA8A 1OKRA 3LFKA 4G7ZF 4RB2C 2HQRA 1ZRDA 2M8EA 4KIFA 1I1SA 1F5TA 1KU2A 1U5TB 3RTRA 3N97A 2GWRA 1SD7A 4P96A 1FYMA 3VEPA 2EA4A 5IT9Z 1D5VA 4YFXF 4UV8A 2DT5A 2YX4A 1I5ZA 2YSRA 3DKWA 4YIFA 2OQGA 4ZYHA 2KJBA 4KN4X 2LNBA 1TW2A 4XLNF 1O57A 3MCZA 1HBXG 4ESBA 1A04A 5E17F 2NNNA 3ZMZA 3L00A 4A6DA 2PEXA 5LRRA 1Y0UA 3I0TA 2FBIA 2VXZA 1P2FA 4CYDA 1F4KA 2IA2A 2P7VB 2A68F 4FX0A 1STZA 2BYVE 4LJZF 3CUQA 1XD7A 6PAXA 1BM9A 4WXDA 1FNNA 1IN5A 3F6OA 1BOAA 4Z2YA 4MEXF 2EFPA 3SZPA 4BNCA 2P6SA 3ABUA 4NB5A 4U0WA 4FT8A 4A0ZA 3LAJA 3VODA 4M9SA 2FF4A 2STTA 1S3JA 4G6DA 2EA2A 5FLXK 2VBWA 5LEJA 2MD5A 4FX4A 1MD0A 2XAJA 3LQQA 4BH9A 2NS0A 1DDNA 4H0EA 4ESJA 3CUOA 3T1BA 3C3WA 3P9CA 3BJAA 3M9AA 3DQVC 2FNPA 2OA4A 4LGWA 2DTRA 4MQ9F 4IF4A 4IHTA 2D1VA 1FLIA 1YS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUE E;  1ZYR F;  2D45 A;  5D5X B;  1FZP B;  1LVA A;  3BPX A;  2RN7 A;  3IKT A;  4XRF A;  3I54 A;  3ULQ B;  2Z9O A;  1Z1D A;  2GQQ A;  3MEX A;  2P5L C;  3JTH A;  3JAM K;  1OYW A;  1K79 A;  4LK1 F;  2PN6 A;  2RKH A;  5ILU A;  3RYP A;  1Z6R A;  5TJJ A;  1W7P A;  3F72 A;  3WTU C;  1B9M A;  1V4R A;  4N0B A;  4GCV A;  5A2Q Z;  5FO5 A;  3BWG A;  5J6X A;  1FWZ A;  3MZY A;  1FP2 A;  4DQ2 A;  2NRA C;  1GHC A;  2J5O A;  3ZP5 A;  3PQJ A;  1KGS A;  1HXD A;  3CDH A;  3L2C A;  3J7A O;  1AWC A;  2EV0 A;  3L7W A;  1RI7 A;  3B02 A;  1ZGJ A;  1ON1 A;  3I71 A;  4HF1 A;  2HYF A;  1SMT A;  2QYO A;  3WTW C;  3Q9S A;  1F9N A;  3VOE A;  1KA8 A;  2CYY A;  3PQK A;  3LA7 A;  2AXL A;  2VT3 A;  2GXB A;  3F22 A;  1T0F A;  5LHG A;  3KEQ A;  2DW4 A;  4RAY A;  3CO6 C;  5ERI A;  1W5S A;  4B09 A;  1SFU A;  4RGR A;  2FEZ A;  3QP5 A;  2ZCW A;  3K9T A;  1FSE A;  1J2X A;  3KET A;  3DPL C;  1G3T A;  4LB6 B;  5BPD A;  1ZRF A;  2RVC A;  5JVT A;  2OAZ A;  1P4W A;  3C18 A;  2XV4 S;  1Z91 A;  2BBY A;  4Q5S F;  2DAO A;  3P9K A;  3J80 Z;  4ASN A;  2ZJ2 A;  1O3S A;  2ZXJ A;  1RNL A;  2XIG A;  1C0W A;  5KVR A;  2ZME B;  4LMY A;  1IXR C;  4R79 A;  2R7D A;  3F8B A;  2MLG A;  2DPU A;  1ZHF A;  1X3U A;  3BRO A;  3RI4 A;  1IZ1 A;  2O0Y A;  4A5M A;  1D8J A;  5FD6 A;  5FD5 A;  1EH6 A;  1LDJ A;  2AS5 F;  4EM1 A;  2IT0 A;  5ILV A;  5HLG A;  3JTG A;  1YQA A;  3P7N A;  2A07 F;  3C1D A;  2P8T A;  2A5Y B;  4LG0 A;  4XSX F;  1K6O A;  3RYR A;  1W7P D;  2E1N A;  4LD5 A;  3WTZ A;  2G7U A;  3R0A A;  3O2P E;  2P4W A;  4EMS A;  1FP1 D;  4HYE A;  3WTV C;  2PBI A;  3IRQ A;  1B6A A;  3M8F A;  4A2U A;  3WTS C;  1WRJ A;  3J81 Z;  5LGU A;  5J8C A;  2VBX A;  3WE3 A;  2M45 A;  1RIO H;  1HKQ A;  1KYW A;  3QAH A;  1GVJ A;  2IP2 A;  1L0O C;  2KJC A;  4KT5 C;  2E7X A;  2JSC A;  2WTE A;  4Q4Z F;  5EEH A;  2FU4 A;  3DPT A;  3FX3 A;  4ENM A;  1EV7 A;  4BXU A;  3V8L A;  4CIC A;  2R3S A;  1FOK A;  3IKV A;  2PJP A;  2CSO A;  5E1X A;  1ZLJ A;  4I0B A;  2DU9 A;  5E18 F;  1TTY A;  4AIH A;  2FSW A;  4EGY A;  1UST A;  2KIM A;  4I01 A;  4M9X A;  3RDI A;  4RB1 A;  3ML6 A;  5JFR A;  2OZU A;  3E5X A;  2A6E F;  4CDG A;  3HRM A;  1P6R A;  4CXF A;  4G7O F;  1ON2 A;  3HSR A;  3Q5F A;  3E6M A;  3GZ6 A;  2HQN A;  5HDN A;  4OIR F;  4LK0 F;  1R7J A;  4I0A A;  4KDP A;  2ZNY A;  5HS9 A;  3HRU A;  4I98 B;  4HF0 A;  3Q9V A;  1AOY A;  3HRS A;  2A3S A;  2LSO A;  3FHZ A;  4OIN F;  2UWM A;  1LB2 A;  1YW9 A;  3BJ6 A;  3HSE A;  5BPI A;  2Y48 A;  2LDU A;  2YX7 A;  3MZH A;  4G94 A;  2F5E A;  5K5Q A;  1XB4 A;  3F8N A;  3W6J B;  1YG2 A;  4L9J A;  4K2E A;  3MQ0 A;  3K69 A;  2IW5 A;  3GFI A;  3IWF A;  5ICC A;  3TGN A;  5D6E A;  2FA5 A;  4A0X A;  1O3R A;  1UFM A;  1Q1H A;  5AIQ A;  3HIF A;  5K5O A;  3TDU C;  4O3M A;  1BC7 C;  1GXP A;  1OYY A;  2ADU A;  3ECH A;  2GXG A;  3I59 B;  4BHP A;  1OMI A;  2O8X A;  4JQF A;  3E97 A;  3TO9 A;  1SAX A;  1SFX A;  2HGC A;  4EM2 A;  1O3T A;  1IN8 A;  2RV8 A;  4O6J A;  5DD8 A;  4BHC A;  3HYI A;  1EH8 A;  1FY7 A;  5DCF A;  1IW7 F;  2YU3 A;  3P9I A;  4N9H A;  2DQL A;  2PG4 A;  3KLO A;  4WF2 A;  4RB0 A;  5A2Q K;  1TLH B;  1ZG5 A;  2PQ8 A;  1V3F A;  3BOQ A;  4KIB A;  4M73 A;  1YFH A;  5CVI A;  1CF7 A;  2V1X A;  1MDM A;  3FZV A;  3ZMV A;  2VOD A;  2XKP A;  2EFW A;  3ROU A;  4I7H A;  2L54 A;  3MAJ A;  4M9Z A;  5K5R A;  1W4M A;  3F8M A;  4AWX B;  3SFZ A;  4AIJ A;  1K78 B;  2F5D A;  3ZPL A;  2WWY A;  3GO5 A;  4IRH A;  4OU0 A;  1XMK A;  5FGM A;  3RJP A;  4A6E A;  1QGP A;  3FM3 A;  5D5U B;  2QLZ A;  2D1H A;  4YFN F;  3HTS B;  2FXA A;  1J0R A;  4KFC A;  1UHW A;  4MTD A;  3I4P A;  1J9I A;  2XHK A;  1ZRC A;  2XVC A;  3ZMD A;  2IVM A;  4IVN A;  1F1Z A;  1KQ9 A;  1H9G A;  1DP7 P;  2HFH A;  4PGG A;  3G73 A;  4HV6 A;  2JPB A;  1T39 A;  3M1E A;  2QBY B;  4OMY A;  2KIF A;  1DPR A;  3AAF A;  1IUY A;  2MBF A;  1ZG3 A;  1XSV A;  1S7A A;  3BZ6 A;  4HX4 A;  2GA1 A;  3V8K A;  1FT9 A;  2IA0 A;  5L3D A;  4A5N A;  2WC2 A;  5E20 A;  4QWQ A;  1G4D A;  1ZGA A;  4ETS A;  4AIK A;  1RUO A;  4R1H A;  3J80 K;  4OIP F;  4OOI A;  4HQE A;  3FXU A;  2BV6 A;  2ISZ A;  2JT1 A;  3ZN0 A;  3M7G A;  1OR7 A;  1HW2 A;  1MKM A;  1UHM A;  5ICE A;  2G9W A;  2W24 A;  2Q8K A;  4HQM A;  1FBU A;  1IN4 A;  4MQV A;  3TQN A;  4ENK A;  1G6N A;  3C7J A;  3RPQ A;  1J59 A;  2HS5 A;  2HR3 A;  3GFJ A;  4JBA A;  4HDV A;  2K4B A;  5DCM A;  2L3D A;  2H27 A;  4GGG A;  5LEK A;  2QVO A;  4L5J A;  2Q2E A;  2K02 A;  2HYG D;  5H6Q A;  4N9I A;  4ZYG A;  2MH9 A;  2ZKZ A;  5D5V B;  5AON A;  1XN7 A;  5DYM A;  1T98 A;  1PP7 U;  3KCC A;  1SFE A;  4MHG A;  5D5W B;  4PZJ A;  3J81 K;  3L09 A;  4U0V A;  4L18 B;  3NQO A;  2XAQ A;  5CVU A;  5D6F A;  2P6T A;  4IRI A;  5DDG A;  3F3X A;  1W5T A;  3H3U A;  3HHG A;  3JSO A;  3FXQ A;  5HDK A;  1MJ9 A;  1MGT A;  3FWE A;  3KP2 A;  3ZN1 A;  3SQN A;  4M71 A;  2A6H F;  4ZZD A;  1R5H A;  3DFG A;  2W84 A;  3EET A;  3TKY A;  3QPT A;  3KP4 A;  2EFN A;  1FYL A;  3BY6 A;  1U78 A;  4GYG A;  1U5T A;  2Q0O A;  5DEQ A;  3GF2 A;  3R6S A;  2BEO A;  1HQC A;  3KP6 A;  4L0Z B;  3I64 A;  1CGP A;  2OQR A;  1KQ8 A;  3ZMU A;  2XKO A;  5BOX A;  3FF5 A;  1TQI A;  1ZLK A;  2D2W A;  4ZZL A;  1R00 A;  2IPQ X;  3MFK A;  1RUN A;  2K27 A;  4A12 A;  3GWZ A;  2UXX A;  2PMU A;  5ICF A;  4XLP F;  4OMZ A;  4M74 A;  1I1G A;  2KRF A;  1BIA A;  1IAW A;  5E1W A;  2MC3 A;  4B8X A;  2O3F A;  2FE3 A;  1IRG A;  2XAS A;  5AIP A;  3D5L A;  3DXJ F;  2R7F A;  2LF8 A;  4U0Y A;  3IHU A;  2MLK A;  3I5U A;  4M6X A;  3LWF A;  1XSD A;  2LF7 A;  1WI9 A;  2P5K A;  3KFW X;  1S8N A;  2VN2 A;  2X0L A;  5H6R A;  1QZZ A;  2ESN A;  2VT2 A;  3E6C C;  1BIB A;  3SHF A;  5LGN A;  1EH7 A;  5BMZ A;  1LEB A;  1B59 A;  1UCR A;  2EJR A;  4Q48 A;  1Z6T A;  1YTY A;  3DP7 A;  1FX7 A;  2GZW A;  4HF2 A;  3EYI A;  2HOE A;  3O6B B;  2E1C A;  1BC8 C;  1IXC A;  3ELK A;  4OIQ F;  4UVC A;  2DPD A;  1OPC A;  2W25 A;  3SXY A;  3V4G A;  3I53 A;  3RPU A;  4WCG A;  1B9N A;  2DI3 A;  2XAH A;  3DV8 A;  2DO7 A;  3NRV A;  3E3V A;  1ZRE A;  2QZ8 A;  2RQP A;  5LHH A;  2RC4 A;  1ONV A;  2CO5 A;  3O3K A;  5F1R A;  5CVJ A;  3LA2 A;  3F6V A;  5D8K B;  1XCB A;  2KIU A;  1U8R A;  4PDK A;  5FFZ A;  4M72 A;  1T2K A;  4L9V A;  1U3E M;  4BYY A;  5CYV A;  1PDN C;  1R1U A;  3IWZ A;  2CG4 A;  1DPU A;  4LB5 A;  1L3L A;  3CUQ B;  2COM A;  1WSU A;  2KKO A;  1IN7 A;  3ZMT A;  2VC1 A;  3V7C A;  2XRO A;  3GYH X;  2HTS A;  3LST A;  4WK8 F;  3FM5 A;  1D8K A;  2HZT A;  2QEN A;  2ZNZ A;  2XAG A;  3U2R A;  2NYX A;  4EJT A;  3DEU A;  1B4A A;  5KK1 A;  4G7H F;  2H6C A;  2H94 A;  1G3S A;  2CFX A;  3RKY A;  1JHH A;  2GA2 A;  3BPV A;  4EVI A;  1ODD A;  3OOP A;  3K2Z A;  2HEO A;  3WE2 A;  5HLH A;  2F2E A;  4I02 A;  1O7L A;  4AD9 A;  1JXS A;  1HW1 A;  1FBS A;  4EGZ A;  1H9T A;  2DK5 A;  1UB9 A;  1OYI A;  2F5F A;  1LJ9 A;  1KU7 A;  3FMR A;  3TOA A;  4GXO A;  4EV0 A;  2BE5 F;  3GVA A;  5D4R A;  5JI6 A;  3TOB A;  4HW0 A;  4GO1 A;  4HDU A;  1SMY F;  1K7A A;  5FFX A;  3SZT A;  2L01 A;  1TNS A;  1J7K A;  4QLC U;  3QOP A;  2ESH A;  2CW0 F;  2QM3 A;  4MGR A;  2JRT A;  4LFU A;  3B73 A;  3RKX A;  4WXC A;  2O61 A;  2ELH A;  4LLL A;  1W7P B;  3EQL F;  2FQ3 A;  2YR2 A;  1MJA A;  1MZB A;  4D0P A;  4EJU A;  4UUV A;  1KU9 A;  5CVV A;  3G3Z A;  1Z05 A;  5DD4 A;  2L4A A;  3M8E A;  3KP7 A;  5ILS A;  3EDP A;  2K4J A;  2V1D A;  2OZ6 A;  5H20 A;  1TQP A;  4TV7 A;  5HLI A;  2ZME A;  4JK1 X;  1IXS B;  1SD4 A;  4HX8 A;  1FPQ A;  3R61 A;  1USS A;  4BAY A;  2XGX A;  3COA C;  2BGC A;  4HOB A;  5E8I A;  3ISP A;  5EEG A;  4IHS A;  2B0L A;  2M5W A;  2L02 A;  2EFQ A;  4P5O A;  1G3Y A;  2FOK A;  4U7D A;  1XMA A;  1NHA A;  3K1M A;  5DUI A;  2VC0 A;  3WU1 B;  1HKS A;  1XGM A;  2RNJ A;  1QPM A;  1S6L A;  1JHF A;  2QQB A;  1XGN A;  1LDK B;  3U1D A;  1R5G A;  3JW4 A;  2LKP A;  4EQQ A;  3CO7 C;  2PLY A;  1R1V A;  4ON0 A;  2C6Y A;  4HZF A;  3QP6 A;  1O3Q A;  3WTY C;  2NAZ A;  2XRN A;  4RAZ A;  1G3W A;  2E7W A;  1R58 A;  3KP5 A;  5CVR A;  4YG2 F;  2GAU A;  2GIV A;  2FBK A;  4EJV A;  3RKW A;  4KA4 A;  2VE9 A;  1J75 A;  1BN5 A;  4HLY A;  4UHT A;  3D0S A;  1JE8 A;  4MNU A;  3GZ5 A;  2JTV A;  4I09 A;  4L5I A;  3U9G A;  2DK8 A;  2PMH A;  3BP8 A;  4Y17 A;  2H6B A;  3JSP A;  3H3Z A;  3T0Y A;  1LNW A;  3KZZ A;  5ICG A;  1Z7U A;  3LQR A;  1XCV A;  1LEA A;  1D3Y A;  4M6Y A;  5E8G A;  1S7O A;  1YW8 A;  2IJL A;  4HAM A;  1P4A A;  2FNA A;  1R23 A;  4OIO F;  3TO6 A;  1E17 A;  1WQ2 A;  2P5V A;  4ENN A;  1I6X A;  1BI1 A;  2CQK A;  5HDG A;  3CLO A;  4BQA A;  4FHT A;  5F64 A;  4MTE A;  2VBZ A;  2OD5 A;  1JGS A;  4KIC A;  3V7S A;  4CZZ A;  5F6F A;  1XGS A;  2EK5 A;  4HV5 A;  4UXN A;  3WGI A;  1H0M A;  3TO7 A;  1VTN C;  5K1Y A;  2IA1 A;  4LG0 B;  2Z99 A;  4HLX A;  3K1P A;  2JPC A;  1WWX A;  2V6C A;  3HOS A;  1U5T C;  1REP C;  3LA3 A;  4S04 A;  3FMS A;  3WOD F;  2OBP A;  4RS8 A;  4UVA A;  3F8C A;  5LRS A;  3H92 A;  2P7C B;  1MJB A;  2FMY A;  4NQW A;  3GEZ A;  3BDD A;  2Z3Y A;  3T8R A;  3S2W A;  5LLQ A;  2WV0 A;  2M87 A;  3OV8 A;  1QO0 D;  3QPH A;  2UZK A;  5CJ9 A;  1IRF A;  2RGV A;  2HDC A;  1ZAO A;  4IXA A;  2QQ9 A;  1YIO A;  4P9U A;  1ZN2 A;  1YLF A;  5ED4 A;  3HUG A;  2EWN A;  4UNO A;  5D8L B;  3EYY A;  2HKX A;  3I59 A;  3IRR A;  2VE8 A;  3QU6 A;  3ECO A;  2ETH A;  5LBQ A;  4WXH A;  4GYI A;  1PP8 F;  3RIR A;  1TQM A;  3I58 A;  2ZFW A;  1XGO A;  3WTX C;  3E5Q A;  1SD6 A;  2M30 A;  4RB3 C;  5LGT A;  5L3G A;  1HKT A;  2VOO A;  4BHB A;  1BI0 A;  1LQ1 A;  4U88 A;  1BBY A;  4IJA A;  3WGH A;  1TNT A;  4EJO A;  4LLN A;  1LDD A;  4PGH A;  2EB7 A;  3R0J A;  4WX9 A;  2V79 A;  1FYK A;  1KQ0 A;  2W85 A;  2TDX A;  2A69 F;  1ULY A;  4O5V A;  3LAP A;  1YO5 C;  1KU3 A;  2EV5 A;  2XUB A;  4Y13 A;  3VFZ A;  2RDP A;  3K1N A;  3V7R A;  4HX7 A;  1K78 A;  4KN7 X;  4G6Q A;  2EV6 A;  4A0Y A;  4YFK F;  2OU2 A;  5J8F A;  2DBB A;  3F21 A;  4ENJ A;  1U2W A;  2K86 A;  4IPA A;  3FMQ A;  2XAF A;  5FLX Z;  4XSZ F;  2VBY A;  1XSX A;  1R22 A;  4ZH4 F;  2QWW A;  4I2O A;  2FBH A;  2W57 A;  2O03 A;  1R36 A;  2MH2 A;  1QQI A;  1HW5 A;  2HTJ A;  1DUX C;  3R60 A;  3F8F A;  3K0L A;  2NNY A;  2PFB A;  2QBY A;  3L9F A;  5FB2 A;  2MA3 A;  3KEO A;  4L9T A;  2G7H A;  3EUH A;  5HVQ C;  3GUD A;  3IL2 A;  1IF1 A;  2F5C A;  4Q47 A;  2HKO A;  5BQT A;  2ACJ A;  2ISY A;  3CTA A;  3ABT A;  5L3C A;  1I27 A;  1IN6 A;  1TBX A;  3HTU A;  3WU0 A;  3REO A;  4KYW A;  5D4S A;  3GX4 X;  2FML A;  1CF7 B;  3KE2 A;  1MDM B;  1WKM A;  2J5P A;  3HOT A;  4KUM A;  1BI2 A;  3W6K B;  5DV5 A;  3JAM Z;  2YPR A;  3VB2 A;  3HHH A;  5JHU A;  2H09 A;  4P55 A;  1FC3 A;  3WG9 A;  2ZO4 A;  2V9V A;  3KZY A;  4RGS A;  3QU3 A;  5BS6 A;  4XBF A;  1QBJ A;  1QZY A;  1FSH A;  2CGP A;  4EM0 B;  2L4M A;  1ZH5 A;  4HBL A;  1FBQ A;  3HSF A;  1TW3 A;  4U7B A;  2UXN A;  2EFO A;  5IT9 K;  4CO8 A;  4UVB A;  4L9N A;  2Z33 A;  2DLL A;  2FRH A;  5L3F A;  3F23 A;  4S05 A;  1R1T A;  3T5X A;  4KNY A;  1XDU A;  2QQA A;  1YYV A;  4E70 A;  5L3B A;  5DUK A;  3HRT A;  1YS7 A;  1YW7 A;  4CHU A;  3ZQ7 A;  1ZG1 A;  2STW A;  1BJA A;  1KYZ A;  1HST A;  2CWE A;  1S29 A;  4CGZ A;  2Y0M A;  4DNC A;  4PCQ A;  4G8X A;  3GXO A;  4KIG A;  5HS8 A;  3PFI A;  4ZYD A;  4L0Y B;  3TDZ C;  1T38 A;  5LHI A;  4R8H A;  4Y15 A;  2K7L A;  4MEY F;  5E1Z B;  2PI0 A;  3BJO A;  5TRD A;  1P4X A;  2DQR A;  1RZ4 A;  1J5Y A;  2X4H A;  4RGX A;  3T8T A;  1O7F A;  1XDS A;  1Z9C A;  3GFM A;  4RGU A;  3GLX A;  5DCM B;  4IRG A;  5HOO A;  2O6G E;  4EJW A;  1P92 A;  5HS7 A;  2V1U A;  2M1B A;  3QRF F;  3N4M A;  3IC7 A;  3KP3 A;  4F7Z A;  2QUF A;  3KLN A;  5CLS A;  3WGG A;  3ZMS A;  3DF8 A;  5JR3 A;  2Y75 A;  4G9Y A;  4ESF A;  1T6S A;  2DFI A;  3WTT C;  3V8J A;  3GW2 A;  2IRF G;  3R4K A;  2A61 A;  4UV9 A;  4WWC A;  3MWM A;  3CJN A;  4AVP A;  2ZBK A;  2VON A;  1GXQ A;  1E2X A;  1U6G A;  2Z5U A;  5IT3 A;  3E5U A;  3E6B A;  3FXR A;  3CUQ C;  2VOP A;  1BI3 A;  3NEU A;  4YII A;  4NHJ A;  1ZAR A;  5L3E A;  1B1B A;  1QNT A;  2JZY A;  4P9F A;  2HWV A;  1HSJ A;  3GFL A;  1SD5 A;  3E6D A;  3ERE D;  4KMU X;  4KMF A;  4ZYE A;  4LLG F;  4HA8 A;  1OKR A;  3LFK A;  4G7Z F;  4RB2 C;  2HQR A;  1ZRD A;  2M8E A;  4KIF A;  1I1S A;  1F5T A;  1KU2 A;  1U5T B;  3RTR A;  3N97 A;  2GWR A;  1SD7 A;  4P96 A;  1FYM A;  3VEP A;  2EA4 A;  5IT9 Z;  1D5V A;  4YFX F;  4UV8 A;  2DT5 A;  2YX4 A;  1I5Z A;  2YSR A;  3DKW A;  4YIF A;  2OQG A;  4ZYH A;  2KJB A;  4KN4 X;  2LNB A;  1TW2 A;  4XLN F;  1O57 A;  3MCZ A;  1HBX G;  4ESB A;  1A04 A;  5E17 F;  2NNN A;  3ZMZ A;  3L00 A;  4A6D A;  2PEX A;  5LRR A;  1Y0U A;  3I0T A;  2FBI A;  2VXZ A;  1P2F A;  4CYD A;  1F4K A;  2IA2 A;  2P7V B;  2A68 F;  4FX0 A;  1STZ A;  2BYV E;  4LJZ F;  3CUQ A;  1XD7 A;  6PAX A;  1BM9 A;  4WXD A;  1FNN A;  1IN5 A;  3F6O A;  1BOA A;  4Z2Y A;  4MEX F;  2EFP A;  3SZP A;  4BNC A;  2P6S A;  3ABU A;  4NB5 A;  4U0W A;  4FT8 A;  4A0Z A;  3LAJ A;  3VOD A;  4M9S A;  2FF4 A;  2STT A;  1S3J A;  4G6D A;  2EA2 A;  5FLX K;  2VBW A;  5LEJ A;  2MD5 A;  4FX4 A;  1MD0 A;  2XAJ A;  3LQQ A;  4BH9 A;  2NS0 A;  1DDN A;  4H0E A;  4ESJ A;  3CUO A;  3T1B A;  3C3W A;  3P9C A;  3BJA A;  3M9A A;  3DQV C;  2FNP A;  2OA4 A;  4LGW A;  2DTR A;  4MQ9 F;  4IF4 A;  4IHT A;  2D1V A;  1FLI A;  1YS6 A; 
#chains in the Genus database with same CATH topology
 1PUE E;  2I5U A;  1ZYR F;  3L2U A;  2D45 A;  5D5X B;  3PO2 J;  5J40 A;  1D0X A;  1TWA J;  3ESW B;  3S3M A;  1FZP B;  1LVA A;  2JWT A;  4XL9 A;  2WY7 Q;  5IYB J;  3Q0W A;  3TL4 X;  3BPX A;  3OY9 A;  2RN7 A;  3IKT A;  4XRF A;  3I54 A;  2V6E A;  4ZDP A;  3ULQ B;  1D1B A;  1Z1D A;  2GQQ A;  3MEX A;  2P5L C;  2Z9O A;  3H5A A;  3JTH A;  2DA2 A;  3S3N A;  2R7U A;  1JUS A;  1JT0 A;  3BC8 A;  3JAM K;  1OYW A;  1K79 A;  2LC2 A;  3NAR A;  4DZJ A;  4LK1 F;  2KRC A;  2PN6 A;  2RKH A;  4YIR X;  5ILU A;  2E1O A;  3RYP A;  1RR7 A;  4FE7 A;  1Z6R A;  4F93 B;  3KYC B;  3GME A;  3S14 J;  2RAE A;  1QVT A;  5TJJ A;  1VQ8 I;  3IP4 B;  1WJD A;  3SEZ A;  1X1A A;  4CCJ A;  1JUP A;  1W7P A;  4MFD A;  2JVH A;  2JJ7 A;  2DOA A;  4E7I A;  3NWS A;  3LNQ A;  2K9Q A;  3F72 A;  5HLT A;  1Y8R B;  2JMW A;  2ZSI B;  2HVQ A;  1RKT A;  3WTU C;  1B9M A;  3BTC A;  4IHY A;  1V4R A;  1MNE A;  2R4G A;  4N0B A;  4W1U A;  3N05 A;  4GCV A;  2Z16 A;  3OSG A;  1WJB A;  2XF5 A;  5A2Q Z;  3FHN A;  5FO5 A;  2HOS A;  3LMM A;  2V26 A;  1AKH A;  1Y6I A;  2FX0 A;  3BWG A;  5J6X A;  1FWZ A;  3MZY A;  1RC9 A;  4DYC A;  2EZH A;  1FP2 A;  1V5G A;  3AG1 H;  1OCC H;  4DQ2 A;  2NRA C;  3OOU A;  1GHC A;  2LY1 A;  2J5O A;  3K4B A;  2M7B A;  1FOX A;  3ZP5 A;  3FXM A;  1KGS A;  1HXD A;  3PQJ A;  3CDH A;  1V5F A;  3L2C A;  2NOJ B;  1LVK A;  3J7A O;  1AWC A;  4II2 A;  4FTH A;  3EUH C;  4B4C A;  3MZ8 A;  1JJ8 C;  2EV0 A;  3DLA A;  2MD0 A;  3FKI J;  4F52 A;  3L7W A;  1RI7 A;  3B02 A;  5B3S H;  1ZGJ A;  3LSH A;  2ELK A;  1ON1 A;  3I71 A;  3M07 A;  4IZZ A;  1VQO I;  4HF1 A;  2HYF A;  1SMT A;  2QYO A;  3WTW C;  3Q9S A;  1D1A A;  1T95 A;  1LPQ A;  1F9N A;  3B6C A;  3VOE A;  2XC7 A;  4A69 C;  1KA8 A;  2CYY A;  4I76 A;  3FXL A;  3PQK A;  5FKO A;  2CJJ A;  2Y9Z A;  1GV5 A;  3D5R C;  4CCL A;  4CCO A;  3BR3 A;  3CJR B;  3LA7 A;  2AXL A;  3ASO H;  2M4G A;  4BEH A;  2VT3 A;  3QOD A;  3L2W A;  4IOC F;  4JYK A;  3F22 A;  2GXB A;  1T0F A;  5LHG A;  4M3E A;  2EIK H;  3KEQ A;  2OV7 A;  2DW4 A;  4RAY A;  2L9V A;  4AU7 A;  5GTI C;  4E4H A;  4YEJ A;  4A3C J;  3CO6 C;  4IHW A;  5ERI A;  1W5S A;  1UJ8 A;  4ANJ A;  3CCL I;  4B09 A;  1SFU A;  3AL0 C;  4RGR A;  3CMY A;  2FEZ A;  3GLL A;  1WH7 A;  3QP5 A;  2ZCW A;  3K9T A;  2OC6 A;  1FSE A;  1HDP A;  1J2X A;  3KET A;  1GT0 C;  3DPL C;  4NC7 A;  1G3T A;  4LB6 B;  2NVX J;  4NNJ A;  5BPD A;  4RLF A;  2HXI A;  2RVC A;  3BT9 A;  1ZRF A;  1ORK A;  5JVT A;  1QHH D;  2OAZ A;  1P4W A;  4G6T B;  3PM1 A;  4AID A;  1SVO A;  3C18 A;  2CMP A;  2XV4 S;  2LH9 A;  1Z91 A;  2XPW A;  2BBY A;  2ZJQ F;  4Q5S F;  2AXT C;  1OJL A;  2HNH A;  2DAO A;  3P9K A;  1QHG A;  3J80 Z;  3MKZ A;  4ASN A;  2ZJ2 A;  5FRM A;  1IUF A;  1O3S A;  3W3C A;  2ZXJ A;  1RNL A;  2XIG A;  1NK3 P;  1BW6 A;  1Y8Q B;  5KVR A;  1R9T J;  1C0W A;  2K85 A;  2ZME B;  4LMY A;  1U8B A;  1IXR C;  4II3 A;  4R79 A;  2R7D A;  3F8B A;  4X0G A;  2MLG A;  4BDZ A;  1I39 A;  1YIJ I;  2HPM A;  2DPU A;  2E2H J;  1ZHF A;  3SJM A;  1X3U A;  3BRO A;  3ONQ A;  1IZ1 A;  2O0Y A;  3RI4 A;  1DU0 A;  4A5M A;  4BU2 A;  1E3P A;  2MSY A;  1DP3 A;  1D8J A;  5FD6 A;  5FD5 A;  4ABZ A;  2ME0 A;  1EH6 A;  1LDJ A;  2AS5 F;  3SZG A;  3CQZ J;  4EM1 A;  5EZG A;  2IT0 A;  5ILV A;  4IQJ A;  1SAN A;  5EJC A;  1BW5 A;  3IAS 2;  3I9V 2;  2ID3 A;  1I3Q J;  5HLG A;  3JTG A;  3ABL H;  2NVT J;  1T56 A;  1YQA A;  2R7Z J;  3ABM H;  1VQM I;  3P7N A;  2A07 F;  3C1D A;  2P8T A;  1U9O A;  2A5Y B;  2I10 A;  4LG0 A;  4XSX F;  1K6O A;  1W7P D;  2E1N A;  3RYR A;  4LD5 A;  3WTZ A;  2E1M C;  2G7U A;  2QKM B;  4A3M J;  3R0A A;  3O2P E;  2P4W A;  3K6G A;  3K4J A;  1MMS A;  1FTZ A;  4EMS A;  3X2Q H;  3D5S C;  2CQ7 A;  1FP1 D;  4HYE A;  3WTV C;  2KFD A;  2BY3 A;  2COB A;  4CCM A;  4C9Y A;  3OIQ A;  1Z3Y A;  2PBI A;  3IRQ A;  2VQL A;  1B6A A;  3M8F A;  4A2U A;  3WTS C;  1WRJ A;  1TWC J;  1UMQ A;  2M7A A;  4FQG A;  3J81 Z;  3OYM A;  1NG7 A;  5LGU A;  1JKR C;  2R7T A;  5J8C A;  4CSW A;  2VBX A;  3WE3 A;  3G1O A;  2LTP A;  2M45 A;  1RIO H;  1HKQ A;  3QYE A;  2CRG A;  1Q1V A;  1GVD A;  1KYW A;  1WJC A;  3QAH A;  1GVJ A;  2IP2 A;  1ETK A;  1L0O C;  2KJC A;  2XSJ C;  2MYS A;  4KT5 C;  2E7X A;  3LFU A;  5E3M A;  3K2A A;  2JSC A;  2WTE A;  4Q4Z F;  2F4O B;  5EEH A;  2FU4 A;  3DPT A;  3FX3 A;  4ENM A;  3KZI C;  1EV7 A;  1MIJ A;  3QYF A;  3V8L A;  4BXU A;  4CIC A;  3JR9 A;  3PSF A;  2R3S A;  4J19 A;  2GOX B;  3IKV A;  1FOK A;  2AQF A;  2PJP A;  2B9S A;  2CSO A;  3FK6 A;  2ZJP F;  5E1X A;  4DIQ A;  2A6T A;  1ZLJ A;  3HOY J;  1FIP A;  4I0B A;  3H5N A;  2DU9 A;  5E18 F;  3DKY A;  1TTY A;  1W1W E;  4AIH A;  2FSW A;  1MBK A;  4EGY A;  1UST A;  2HDW A;  2KIM A;  4I01 A;  4M9X A;  4ZTJ A;  3RDI A;  4RB1 A;  2NVU B;  3LSK A;  1K4T A;  3ASN H;  3FDY A;  2XAU A;  1XC5 A;  3ML6 A;  5JFR A;  2OZU A;  3E5X A;  2A6E F;  4CDG A;  4XOT A;  3WU2 C;  2XGE A;  3BTL A;  1YRN A;  3HRM A;  1P6R A;  4CXF A;  5M5W J;  5KAF C;  1WGX A;  4G7O F;  1HA8 A;  1ON2 A;  5GPC A;  3HSR A;  3OIP A;  2HYJ A;  3Q5F A;  4XLC A;  3E6M A;  2MW8 A;  3GZ6 A;  2LY9 A;  2HQN A;  2ECC A;  2BVM A;  5HDN A;  4KJZ A;  4OIR F;  1NTC A;  1FMW A;  4LK0 F;  1R7J A;  3HL2 A;  2VIX A;  1ETV A;  2Z1D A;  2LMD A;  3DU6 A;  1ETY A;  2ZJR F;  1DGR M;  4J01 A;  2RNG A;  4I0A A;  4W97 A;  3ZQL A;  2LKS A;  2CW8 A;  3EPZ A;  3A0H C;  3CCS I;  4KDP A;  2ZNY A;  4XN0 A;  1ZQ3 P;  3S1Q J;  5FLM J;  1M1E B;  3CJQ B;  5HS9 A;  1JGG A;  3HRU A;  5IP7 J;  1T33 A;  4I98 B;  4HF0 A;  3W2A A;  2CH0 A;  2XB0 X;  3Q9V A;  4D5F A;  1AOY A;  1EKE A;  2QSG X;  2DFH A;  3RZO J;  3CCY A;  3HRS A;  2A3S A;  2LSO A;  2CUE A;  2ZSH B;  3FHZ A;  4OIN F;  2UWM A;  1A36 A;  4ZDL A;  1N78 A;  1LB2 A;  4NQW B;  1YW9 A;  3GTK J;  5F04 A;  3BJ6 A;  3HSE A;  5BPI A;  2Y48 A;  2X6W A;  2LDU A;  2LRE A;  5IY5 H;  5K7F A;  2YX7 A;  1RKW A;  3MZH A;  4G94 A;  1IAW A;  1IDZ A;  2F5E A;  5K5Q A;  1XB4 A;  3F8N A;  3W6J B;  1YG2 A;  1JUM A;  3DLL F;  4L9J A;  4K2E A;  3M1C A;  2IAI A;  2BVL A;  3MQ0 A;  3K69 A;  2IW5 A;  3GFI A;  1BL0 A;  5IPA A;  3IWF A;  3K4M A;  4BXF A;  2VXD A;  3FBN B;  3Q3S A;  5ICC A;  1R4N B;  2QQ8 A;  2AHQ A;  2DN0 A;  3TGN A;  5D6E A;  1TT0 A;  2LP0 A;  2FA5 A;  3HC7 A;  3OS2 A;  4XM3 A;  2LK2 A;  1R6R A;  4A0X A;  1UEL B;  1ETW A;  1Z77 A;  3BG9 A;  1O3R A;  1UFM A;  1Q1H A;  1TT5 B;  3HIF A;  5AIQ A;  5K5O A;  2JA5 J;  3TDU C;  4O3M A;  3CME I;  1BC7 C;  1GXP A;  4U87 A;  1OYY A;  1N25 A;  2ADU A;  3ECH A;  2GXG A;  3JCU C;  2Z2S B;  2BXY A;  3BG6 A;  3GZN B;  1RR8 C;  1ITY A;  3I59 B;  4BHP A;  1OMI A;  2PMZ A;  3UNG C;  3VPR A;  2O8X A;  4BGD A;  4UUS B;  3HPH A;  4JQF A;  2JQ7 A;  2VLA A;  3E97 A;  3EUA A;  5JVG F;  2DYS H;  1BJZ A;  2M8G X;  2Y31 A;  3TO9 A;  5IP9 J;  1SAX A;  4A3B J;  1SFX A;  2HGC A;  1E0E A;  4EM2 A;  1O3T A;  1IN8 A;  2RV8 A;  3HB9 A;  4O6J A;  5DD8 A;  2JA6 J;  4BHC A;  3HYI A;  3DTK A;  1EH8 A;  1VQ4 I;  1FY7 A;  4BAC A;  2MC4 A;  4UB8 C;  1Z67 A;  2B63 J;  5DCF A;  5B1B H;  1IW7 F;  2EQR A;  2YU3 A;  2GOM A;  3P9I A;  3S8P A;  4N9H A;  3QWL A;  3M8J A;  2KDO A;  2LBF B;  2XPU A;  1WVR A;  4XRS A;  2R7W A;  2DQL A;  2PG4 A;  3CJT B;  3KLO A;  4WF2 A;  4RB0 A;  5A2Q K;  1HCR A;  1TLH B;  1ZG5 A;  2PQ8 A;  3K7A J;  1V3F A;  3BOQ A;  1ETO A;  3MMY B;  4KIB A;  4M73 A;  1YFH A;  4HST A;  5CVI A;  1YX3 A;  1CF7 A;  2GLO A;  2V1X A;  3C2H A;  1MDM A;  3FZV A;  3ZMV A;  2VOD A;  4JOM A;  1FTT A;  2XKP A;  5FKN A;  4A3L J;  2DFF A;  2EFW A;  3M3Y J;  3VYT B;  2EZK A;  3CP8 A;  5GAH J;  3W2W A;  1J09 A;  4L5E A;  4B43 A;  3ROU A;  2JA8 J;  4I7H A;  2L54 A;  2TRT A;  3MAJ A;  1XPX A;  1B8I B;  4M9Z A;  4ZDO A;  4D9J A;  2CQQ A;  4LIU A;  3ZRG A;  2OF7 A;  5K5R A;  2KHM A;  1W4M A;  2I8D A;  3LOC A;  3F8M A;  3VSK A;  2XSD C;  4AWX B;  3C2G A;  3SFZ A;  4AIJ A;  2A5W A;  3BG7 A;  5FKL A;  1K78 B;  1MMD A;  2F5D A;  2Y69 H;  1UAA A;  3OYK A;  3ZPL A;  2WWY A;  3GO5 A;  4IRH A;  2GXA A;  4HNT A;  2ICW G;  1XMK A;  4OU0 A;  5FGM A;  3RJP A;  4A6E A;  1QGP A;  3MKL A;  3FM3 A;  4CUG A;  2OTL I;  3KPH A;  3OL4 A;  5D5U B;  5BNG A;  2R7X A;  2QLZ A;  5LD2 C;  3B6A A;  5KHD A;  2D1H A;  3BR2 A;  4YFN F;  3HTS B;  2FXA A;  4Y4R A;  1J0R A;  4KFC A;  3KYD B;  1UHW A;  4MTD A;  9ANT A;  3I4P A;  1J9I A;  2XHK A;  1ZRC A;  1K61 A;  4HNU A;  1PYV A;  2XVC A;  3ZMD A;  2IVM A;  4IVN A;  1FIA A;  1F1Z A;  4XKW A;  1KQ9 A;  3DTI A;  1H9G A;  2R7O A;  1T08 B;  5GAG J;  1DP7 P;  4HSR A;  2HFH A;  1MSF C;  4PGG A;  1AHD P;  2VAS A;  3G73 A;  4I6Z A;  4HV6 A;  2JPB A;  1T39 A;  3M1E A;  1PUF A;  2QBY B;  4OMY A;  2KIF A;  3JRD A;  1H88 C;  1DPR A;  1F36 A;  3AAF A;  1IUY A;  2MBF A;  1ZG3 A;  1ZKG A;  1XSV A;  4QSH A;  2H1K A;  1S7A A;  4C3I J;  3BZ6 A;  2F6C A;  1G59 A;  1R5I D;  4HX4 A;  4A3D J;  2GA1 A;  2W00 A;  3V8K A;  1FT9 A;  2IA0 A;  2OCC H;  3K10 A;  5L3D A;  4A5N A;  4RM3 A;  3G71 I;  2WC2 A;  5E20 A;  4QWQ A;  5JLX A;  1G4D A;  3BR0 A;  2KMU A;  1POG A;  1ZGA A;  4ETS A;  4AIK A;  5F0F A;  4JX4 A;  4R1H A;  1RUO A;  3J80 K;  2WAF A;  4HPQ A;  4OIP F;  2L9R A;  1IJW C;  4OOI A;  3UR3 C;  3I4N J;  2Y0S N;  3ZXS A;  4HQE A;  1RES A;  3FXU A;  2VJ5 A;  4RLQ A;  3AFH A;  4DOZ A;  2BV6 A;  2ISZ A;  2B7E A;  5EG0 A;  4LOC A;  2JT1 A;  3ZN0 A;  3M7G A;  1OR7 A;  1HW2 A;  3JRH A;  1MKM A;  1UHM A;  5ICE A;  1X2M A;  1RRJ A;  2G9W A;  2W24 A;  1X19 A;  3OYI A;  3LSG A;  2EZL A;  2Q8K A;  1Z0X A;  4HQM A;  5E3N A;  5DS9 A;  4ITV A;  3OYC A;  3A1Y A;  5CQG A;  1FBU A;  2LG4 A;  3VYU B;  1IN4 A;  4V19 K;  2L0K A;  3H9Q A;  3A4C A;  4MQV A;  2GM4 A;  4IOA F;  3TQN A;  4ENK A;  1G6N A;  3OYG A;  3C7J A;  1GLN A;  3RPQ A;  2BW3 A;  1J59 A;  2E35 A;  3A01 A;  2HS5 A;  1OCR H;  2HR3 A;  3GFJ A;  4JBA A;  4HDV A;  1W0T A;  2K4B A;  5DCM A;  2L3D A;  3OIO A;  2H27 A;  1T0F C;  3GTO J;  4GGG A;  5LEK A;  2QVO A;  4L5J A;  2Q2E A;  2NVQ J;  2PX9 A;  2BOL A;  1SAU A;  2K02 A;  2HI3 A;  2HYG D;  5H6Q A;  4N9I A;  4ZYG A;  5FLV A;  2MH9 A;  1BR1 A;  5F08 A;  5IOZ A;  3VSL A;  2O7O A;  3IAM 2;  2ZKZ A;  4IL6 C;  5D5V B;  3HOX J;  3HPG A;  4XMY A;  2VKH A;  5AON A;  1TWF J;  1XN7 A;  2L9S A;  5DYM A;  1T98 A;  4KT6 A;  4MLO A;  1PP7 U;  1PVE A;  1SFE A;  3KCC A;  4MHG A;  1R71 A;  5D5W B;  3PL8 A;  2WAE A;  2MAB A;  4GDF A;  5J4Y A;  4PSX A;  4PZJ A;  1X1P A;  5IYC J;  3J81 K;  3F9K A;  3L09 A;  4U0V A;  4L18 B;  3NQO A;  1V55 H;  1H8A C;  2QSF X;  2XAQ A;  1NG6 A;  5CVU A;  5D6F A;  2P6T A;  4IRI A;  5DDG A;  4C2U A;  3F3X A;  1W5T A;  3H3U A;  3HHG A;  4RDU A;  3JSO A;  4JP0 A;  3K70 C;  4PUS A;  1RPW A;  3FXQ A;  5HDK A;  1MJ9 A;  2ZXI A;  1MGT A;  3FWE A;  3KP2 A;  4BQN A;  3WHB A;  3ZN1 A;  3HDD A;  3SQN A;  3DBH B;  4M71 A;  3OSF A;  3GTQ J;  4G12 A;  2A6H F;  4ZZD A;  2JA2 A;  1R5H A;  3DFG A;  3OR2 C;  2W84 A;  4JX6 A;  1MND A;  4PSW A;  1LE8 A;  5J4V A;  1IGN A;  4GRI A;  2HU9 A;  3EET A;  3TKY A;  3SFI A;  4F3Q A;  3QPT A;  3KP4 A;  4LG3 A;  3VYS B;  2EFN A;  5GP9 A;  1FYL A;  3BY6 A;  4XIC A;  3DBL B;  1MNM C;  1U78 A;  1WJE A;  4GYG A;  4BS9 A;  1U5T A;  1W36 C;  2Q0O A;  3CCQ I;  2K3F A;  3DBR B;  5DEQ A;  3PNT A;  3GF2 A;  4XQF A;  5JHF A;  3R6S A;  2BEO A;  1W5C C;  1HQC A;  3KP6 A;  2E2I J;  3JRB A;  1WHU A;  1EJ9 A;  4L0Z B;  3I64 A;  1V5E A;  3P5J A;  2DJN A;  1Y1W J;  3CD6 I;  2PMZ N;  1HLV A;  1OCP A;  4BE0 A;  1CGP A;  2R5Y B;  2FQ4 A;  2OQR A;  2DMU A;  1KQ8 A;  3ZMU A;  1JKP C;  2XKO A;  4XLE A;  4XOR A;  2EH3 A;  2OCE A;  5BOX A;  3FF5 A;  1MBJ A;  4BE1 A;  3DEE A;  3ERM A;  1TQI A;  3KEY A;  1ZLK A;  2D2W A;  1VI0 A;  3FXK A;  4ZZL A;  2R5Z B;  1R00 A;  2QF7 A;  2IPQ X;  4D7N A;  3MFK A;  1RUN A;  2K27 A;  4A12 A;  2CQN A;  3GWZ A;  3L2R A;  2UXX A;  3G2B A;  3A03 A;  5F1J A;  4PJL A;  2PMU A;  5TGT A;  3BZK A;  5ICF A;  1WJF A;  3FXO A;  3DWL E;  4M3F A;  4XLP F;  4OMZ A;  4M74 A;  2ZB9 A;  3OS0 A;  1JKO C;  1XMX A;  1I1G A;  2KRF A;  1BIA A;  1N77 A;  5E1W A;  2MC3 A;  4KIT B;  1X58 A;  2O3F A;  4B8X A;  1A6I A;  2FE3 A;  2WB1 A;  3I3L A;  4Y33 A;  3TW6 A;  5B1A H;  3ZQC A;  1IRG A;  2XAS A;  5AIP A;  3D5L A;  3DXJ F;  4E7J A;  2R7F A;  1R4M B;  2LF8 A;  3BQY A;  1K4S A;  1LFP A;  2KRH A;  3GCM A;  4RMN A;  1E3H A;  4U0Y A;  4H4K C;  3IHU A;  2MLK A;  3I5U A;  1E3O C;  3FKJ A;  1GV2 A;  4M6X A;  3CDI A;  3OYB A;  3TW7 A;  5EGO A;  3LWF A;  4FAS D;  3S16 J;  1XSD A;  3CCE I;  2LF7 A;  4CCK A;  1WI9 A;  2P5K A;  3KFW X;  1S8N A;  2VN2 A;  2FJ1 A;  5CPR B;  2X0L A;  1RET A;  5H6R A;  2K5C A;  1QZZ A;  2ESN A;  3PNV A;  5IOY A;  2QA4 I;  2VT2 A;  3Q0V A;  4BJT A;  3E6C C;  3SEQ A;  1O4X A;  1BIB A;  3SHF A;  4BQO A;  5LGN A;  1EH7 A;  5BMZ A;  1LEB A;  3CMA I;  2DA6 A;  1F43 A;  1B59 A;  2VB6 A;  4QIW N;  1UCR A;  2EJR A;  1VF9 A;  4Q48 A;  1Z6T A;  2ID6 A;  1YTY A;  3DP7 A;  3QPS A;  2HOA A;  3O8G A;  1FX7 A;  2GZW A;  4HF2 A;  4B47 A;  4E7L A;  2HOE A;  3O6B B;  3EYI A;  3SYT A;  2NXN B;  2E1C A;  3QYB A;  4N4O B;  1BC8 C;  2V1N A;  4A93 J;  1IXC A;  3ELK A;  4BE2 A;  2X6O A;  4OIQ F;  3BCA A;  4NC6 A;  4UVC A;  1MBE A;  2DPD A;  4PK4 A;  2R93 J;  1Y56 A;  1JT6 A;  4MFE A;  1OPC A;  4ZYA A;  2DMQ A;  2W25 A;  5B5E C;  3SXY A;  2VKV A;  3H5R A;  3V4G A;  3I53 A;  3RPU A;  4IEJ A;  4WCG A;  2ZFU A;  4P1W A;  3S2D J;  2LD5 A;  1QRY A;  1B9N A;  1Y1V J;  2DI3 A;  2FD5 A;  2XAH A;  3DV8 A;  2DO7 A;  3NRV A;  3E3V A;  1ZRE A;  2QZ8 A;  2RQP A;  2DA1 A;  5LHH A;  1B72 A;  2CFO A;  1ONV A;  2RC4 A;  5KNL A;  4HRI A;  2HQ5 A;  2EIN H;  1IO2 A;  2KLO A;  2CO5 A;  2ELJ A;  3O3K A;  5F1R A;  5CVJ A;  3PUB A;  3LA2 A;  3F6V A;  3S93 A;  2E5N A;  3W2V A;  3LSM A;  2DDB A;  1XCB A;  5D8K B;  2KIU A;  1U8R A;  4PDK A;  5FFZ A;  4M72 A;  2X85 A;  3WG7 H;  3J7Z I;  1T2K A;  4L9V A;  1U3E M;  4BYY A;  2IGO A;  3HOZ J;  3C2B A;  5CYV A;  1VFC A;  1PDN C;  4UB6 C;  2Y0S A;  1YI2 I;  4C3J J;  5F0C A;  2IGM A;  1R1U A;  4PFO A;  3BTI A;  3IWZ A;  2CG4 A;  1DPU A;  2QCO A;  1N75 A;  3TP0 A;  4HG2 A;  2F5V A;  2KT0 A;  4E6K G;  2E2J J;  4LB5 A;  3AG4 H;  1L3L A;  3CUQ B;  2COM A;  5IP6 A;  3HOU J;  1WSU A;  2KKO A;  3FK7 A;  4JX5 A;  1IN7 A;  4DJA A;  1ZK8 A;  3ZMT A;  3JRA A;  2VC1 A;  3V7C A;  3DCF A;  2XRO A;  3W6V A;  1S9H A;  3GYH X;  2E71 A;  5M3M J;  4QPO A;  4M3D A;  1SC7 A;  2HTS A;  4DW6 A;  3LST A;  4WK8 F;  3FM5 A;  1D8K A;  2HZT A;  2QEN A;  2PJR B;  2ZNZ A;  4CCN A;  2XAG A;  3U2R A;  4XKB A;  1TWG J;  3RSN A;  2NYX A;  2X9D A;  5EDN A;  4EJT A;  2LR8 A;  3DEU A;  2KP6 A;  1B4A A;  1P7I A;  5KK1 A;  4CYC B;  3S1R J;  4G7H F;  1LFB A;  1Y39 A;  1VQL I;  2H6C A;  2H94 A;  1G3S A;  5E3L A;  4FET A;  2CFX A;  4A3I J;  3RKY A;  1KON A;  1U9N A;  1JHH A;  1WH5 A;  2GA2 A;  3BPV A;  4OWR B;  3HG9 A;  4EVI A;  2CUZ A;  3KX2 A;  1ODD A;  2A05 A;  3K2Z A;  3OOP A;  2HEO A;  3WE2 A;  5M5Y J;  3S2H J;  4DYR A;  5HLH A;  1DU6 A;  1EF4 A;  2CU7 A;  2F2E A;  4I02 A;  1O7L A;  4AD9 A;  1JXS A;  2FUG 2;  1HW1 A;  1FBS A;  2CV1 A;  4BBS J;  4EGZ A;  1LKX A;  1H9T A;  4OAY A;  2DK5 A;  1UB9 A;  1OYI A;  2F5F A;  1LJ9 A;  2K9S A;  1KU7 A;  2KIQ A;  3FMR A;  1VQ5 I;  3TOA A;  4GXO A;  3CC4 I;  3K4L A;  4ZC3 A;  4EV0 A;  3L1P A;  3U1K A;  2BE5 F;  3GVA A;  1HF0 A;  5D4R A;  5JI6 A;  3TOB A;  2VPL A;  1TL8 A;  2F4I A;  1BR4 A;  3BG3 A;  4HW0 A;  5E3O A;  4M3B A;  4GO1 A;  4HDU A;  3GTM J;  1SMY F;  1K7A A;  5FFX A;  3SZT A;  2L01 A;  1TNS A;  1J7K A;  1X4O A;  4QLC U;  3QOP A;  1WJ5 A;  2ESH A;  2K40 A;  1S7E A;  4C3H J;  2CW0 F;  2VL8 A;  2QM3 A;  4MGR A;  2JRT A;  2UV1 A;  4LFU A;  3B73 A;  3RKX A;  4WXC A;  5C4J J;  2O61 A;  4D1Q A;  2ELH A;  1MH3 A;  4LLL A;  2VJ4 A;  2L2O A;  1W7P B;  3EQL F;  1W36 D;  1D1C A;  2FQ3 A;  2YR2 A;  3UKG A;  1MJA A;  1MZB A;  2BHZ A;  4D0P A;  1SEU A;  4M3G A;  3GTP J;  4EJU A;  4UUV A;  3FIS A;  5IYD J;  2BY0 A;  1KU9 A;  2NOG A;  5CVV A;  4I99 C;  3G3Z A;  3RZD J;  1Z05 A;  5DD4 A;  2L4A A;  2JRM A;  3NAU A;  3ZR8 X;  3M8E A;  3KP7 A;  5K7H A;  5ILS A;  3G6E I;  3E7L A;  1MSE C;  3EDP A;  3S15 J;  1AKH B;  2K4J A;  2EBI A;  2V1D A;  2OZ6 A;  5H20 A;  2GIZ A;  2AQE A;  1TQP A;  2XF7 A;  5FJ8 J;  4TV7 A;  1YOV B;  5HLI A;  2ZME A;  4JK1 X;  4D5C A;  4RM2 A;  1IXS B;  1SD4 A;  3JRC A;  1FEX A;  1AA7 A;  1AU7 A;  4HX8 A;  2WY8 Q;  1FPQ A;  1I6H J;  3R61 A;  1A5J A;  1USS A;  4BAY A;  2XGX A;  1JJ6 C;  3GTG J;  3COA C;  2BGC A;  3OYD A;  1XS9 A;  4HOB A;  1TZL A;  5E8I A;  3ISP A;  2LLK A;  5EEG A;  1LE8 B;  4IHS A;  2B0L A;  2M5W A;  2L02 A;  2EFQ A;  2LRD A;  1ETQ A;  4P5O A;  5GPA A;  1G3Y A;  2FOK A;  3A02 A;  3RCO A;  3BZC A;  1IG7 A;  3CCR I;  4U7D A;  1XMA A;  1NHA A;  2VJI A;  3K1M A;  3ZQF A;  5DUI A;  2D5V A;  3ABK H;  2VC0 A;  3WU1 B;  1HKS A;  1XGM A;  1Z7L A;  2RNJ A;  3G1L A;  4A3J J;  3A0B C;  1NK2 P;  1KZH A;  1QPM A;  1S6L A;  3SDB A;  1JHF A;  3OYJ A;  2QQB A;  1XGN A;  1LDK B;  2WB1 N;  3U1D A;  1R5G A;  4PJN A;  1D0Y A;  1OR7 C;  1VND A;  1ZTR A;  1ZR2 A;  3JW4 A;  2LKP A;  4EQQ A;  3CO7 C;  3JRE A;  2PLY A;  2K3P A;  4BEH B;  1R1V A;  4ON0 A;  2C6Y A;  2BZT A;  4HZF A;  2Q1Z B;  3QP6 A;  3HOW J;  4XLF A;  1O3Q A;  2IS4 A;  3WTY C;  2NAZ A;  2XRN A;  4RAZ A;  4FCY A;  4XLA A;  1G3W A;  2IS6 A;  2E7W A;  3OYF A;  1R58 A;  3TMO A;  3KP5 A;  3BR5 A;  3IH3 A;  1G8X A;  5CVR A;  4YG2 F;  2IS1 A;  1OIS A;  4AVZ A;  1VQN I;  2GAU A;  2GIV A;  2FBK A;  3ZQH A;  4EJV A;  3RKW A;  2H8R A;  4UUT A;  3BR1 A;  2VUM J;  4KA4 A;  4XLH A;  2QEX I;  2VE9 A;  4A3E J;  1J75 A;  2WAQ A;  2X1E A;  1FJL A;  1BN5 A;  1IV8 A;  4HLY A;  2RRE A;  4UHT A;  2L5Q A;  3D0S A;  1JE8 A;  2KDZ A;  4MNU A;  2DT6 A;  3GZ5 A;  4XID A;  1A6Q A;  2JTV A;  3PIP F;  1YJN I;  5DM7 F;  4I09 A;  2M2E A;  2W1O A;  4L5I A;  3U9G A;  1HOM A;  2L7F P;  3DTE A;  2DK8 A;  1MMA A;  2O9L A;  2PMH A;  2P81 A;  1U0J A;  3BP8 A;  2H6B A;  1DGW Y;  3HXL A;  3MN2 A;  4Y17 A;  3JSP A;  3H3Z A;  3T0Y A;  3RKQ A;  1LNW A;  3KZZ A;  5ICG A;  1Z7U A;  4N4N B;  3LQR A;  1XCV A;  1LEA A;  1BR2 A;  1D3Y A;  4M6Y A;  5E8G A;  1T8I A;  2QSH X;  2GBY A;  1S7O A;  1YW8 A;  4DGW B;  2EIL H;  2IJL A;  2HVS A;  4HAM A;  2HVR A;  5B66 C;  1P4A A;  2FNA A;  1R23 A;  2CUJ A;  2WBM A;  4CA0 A;  4OIO F;  2M4K A;  3TO6 A;  3LSJ A;  1E17 A;  1WQ2 A;  2P5V A;  1K83 J;  4ENN A;  2R0Q C;  1I6X A;  1BI1 A;  1WPK A;  2YU9 J;  3F0C A;  2CQK A;  5HDG A;  1UZC A;  3CLO A;  3OMY A;  4XN3 A;  4BQA A;  4FHT A;  1FOW A;  5F64 A;  4MTE A;  2VBZ A;  3L2V A;  2CV2 A;  1WI3 A;  3CES A;  2OD5 A;  1BA5 A;  1IRZ A;  1X1C A;  1JGS A;  4KIC A;  3V7S A;  2DMN A;  4CZZ A;  3OS1 A;  3LSR A;  1S5L C;  1XGS A;  2EK5 A;  4HV5 A;  5F6F A;  2DCE A;  4UXN A;  2W7N A;  2OJE D;  3WGI A;  1H0M A;  3TO7 A;  1VTN C;  2DA4 A;  5K1Y A;  2IA1 A;  1OCO H;  2DA3 A;  2HPI A;  2DOE A;  5EF6 A;  4LG0 B;  2Z99 A;  3MVP A;  4HLX A;  3K1P A;  2X6Y A;  2JPC A;  3AG3 H;  4NC8 A;  1WWX A;  3BCB A;  2V6C A;  3BG5 A;  3HOS A;  1U5T C;  1REP C;  4YRV A;  3HM5 A;  3LA3 A;  4S04 A;  3FMS A;  2DXI A;  2JN6 A;  3WOD F;  2CS3 A;  2OBP A;  2WV1 A;  4RS8 A;  5HNH A;  3AL0 B;  4UVA A;  3OYN A;  2ME6 A;  5E79 C;  3F8C A;  5LRS A;  2DDA A;  1VQP I;  3H92 A;  2P7C B;  4AUX A;  1MJB A;  3I55 I;  1D0Z A;  2FMY A;  4NQW A;  2XGC A;  2IXS A;  4BDY A;  3GEZ A;  4V2G A;  3BDD A;  2K9L A;  2Z3Y A;  3DKX A;  3T8R A;  1QA6 A;  2KZG A;  3S2W A;  1SVM A;  2CV0 A;  5LLQ A;  2WV0 A;  3I4M J;  3S1M J;  2M87 A;  3OV8 A;  1QO0 D;  2IBD A;  2YS9 A;  3QPH A;  1EA3 A;  3GBG A;  2UZK A;  4BY1 J;  1WJA A;  4XKC A;  4RA2 A;  1ZEL A;  5CJ9 A;  4A3F J;  3DEW A;  5JLW A;  4Z6Y A;  2TCT A;  1IRF A;  2RGV A;  2VQC A;  1UG0 A;  3HOV J;  2HDC A;  1WCM J;  2VJJ A;  1ZAO A;  1R49 A;  4IXA A;  4ZTF A;  1QU3 A;  2QQ9 A;  3V42 A;  4LIT A;  1YIO A;  4P9U A;  4BBR J;  1ZR4 A;  3J7A Y;  2HOT A;  1ZN2 A;  5FRO A;  1YLF A;  5ED4 A;  3HUG A;  2EWN A;  5M3F J;  3K4K A;  4UNO A;  5D8L B;  4C2M J;  2OTJ I;  3EYY A;  4M6V A;  4S0H B;  2HKX A;  1IRX A;  3I59 A;  3IRR A;  1PJR A;  1YRN B;  2VE8 A;  4UUS A;  1Z3X A;  3OWT A;  4ZJZ A;  5FKK A;  3FBI B;  3GTJ J;  3DU5 A;  3QU6 A;  3ECO A;  3CCV I;  3IH4 A;  1V54 H;  2ETH A;  2H8W A;  2W48 A;  5LBQ A;  5J47 A;  4WXH A;  4GYI A;  1PP8 F;  4UY8 I;  3E1S A;  3RIR A;  2DA7 A;  4NUB A;  1TQM A;  2FOW A;  3I58 A;  2F48 A;  1MBH A;  2ZFW A;  2LVS A;  1XGO A;  2HZD A;  3WTX C;  3E5Q A;  1CQT A;  2E1M B;  4FE4 A;  1SD6 A;  1YX5 A;  2M30 A;  4RB3 C;  2OPT A;  3MKY B;  1P7J A;  2CUF A;  2LBF A;  5LGT A;  4DBQ A;  2EPF A;  5L3G A;  3Q0U A;  3MKW B;  1HKT A;  1HC8 A;  5J3L A;  4AYB N;  2M3A A;  1S72 I;  1JTY A;  2VOO A;  1X4P A;  4BHB A;  3CF5 F;  1BI0 A;  1LQ1 A;  5J1R A;  4U88 A;  1BBY A;  3PFY A;  5TIS C;  2VKE A;  4IJA A;  3WGH A;  1MMN A;  4XNF A;  3QOE A;  1A35 A;  1TNT A;  2BY2 A;  2JVG A;  4EJO A;  3VWB A;  4LLN A;  1LDD A;  4PGH A;  2EB7 A;  3R0J A;  4WX9 A;  1WFX A;  2V79 A;  4EEF G;  3J7Y J;  2MGQ A;  1FYK A;  1TP4 A;  1KQ0 A;  2W85 A;  2HQA A;  5CKT A;  2TDX A;  3HKZ N;  1HDD C;  4F55 A;  2A69 F;  1ULY A;  4O5V A;  1Y0N A;  3LAP A;  1B8I A;  1YO5 C;  1KU3 A;  2EV5 A;  2XUB A;  3BTJ A;  4Y13 A;  4RAG A;  3VFZ A;  2CW7 A;  2RDP A;  4BL0 B;  3K1N A;  1IC8 A;  3OL3 A;  3V7R A;  4E7H A;  4HX7 A;  1K78 A;  2O5R A;  4KN7 X;  2X51 A;  4G6Q A;  4E7S A;  2EV6 A;  4Y52 J;  4A0Y A;  4YFK F;  2OU2 A;  2M0M A;  4XKV A;  3BR6 A;  4KIS A;  5J8F A;  2DBB A;  3F21 A;  4ENJ A;  1U2W A;  2K86 A;  4IPA A;  3FMQ A;  4A3K J;  3H0G J;  2XAF A;  5FLX Z;  4XSZ F;  2VBY A;  2DYR H;  1XSX A;  1R22 A;  3HGY A;  4ZH4 F;  2IGK A;  2QWW A;  4I2O A;  2LOO A;  4DBR A;  2QKL B;  2BXZ A;  2FBH A;  2W57 A;  4B1R A;  2O03 A;  1R36 A;  1LFU P;  4AM3 A;  2MH2 A;  2XB5 A;  1QQI A;  1HW5 A;  2CQX A;  2HTJ A;  1DUX C;  1YHQ I;  1YIT I;  3R60 A;  1GUU A;  3F8F A;  2VI6 A;  3K0L A;  2V4J C;  2G0E A;  4HEA 2;  2NNY A;  2W82 A;  2WA0 A;  2PFB A;  3ZGK A;  2QBY A;  2YUS A;  2UUZ A;  3L9F A;  5FB2 A;  2MA3 A;  3KEO A;  2VKD A;  4CZC A;  4L9T A;  2G7H A;  3OYE A;  1QZE A;  3TED A;  3EUH A;  3CF2 A;  5HVQ C;  2N8G A;  3QQA A;  2KIS A;  3GUD A;  3IL2 A;  1IF1 A;  2F5C A;  4Q47 A;  2HKO A;  2WAQ N;  2Y30 A;  4IKF A;  5LFA A;  2EIJ H;  5BQT A;  1ACI A;  3AKZ A;  2ACJ A;  1APL C;  2ISY A;  3CTA A;  3ABT A;  5L3C A;  1I27 A;  1IN6 A;  1TBX A;  3HTU A;  3WU0 A;  3REO A;  4KYW A;  3FXJ A;  5D4S A;  3GX4 X;  2FML A;  5GTH C;  1CF7 B;  2JA7 J;  4B3X A;  3KE2 A;  5FRN A;  3S1N J;  4MIM A;  1K6Y A;  1MDM B;  1WKM A;  2J5P A;  3HOT A;  4KUM A;  1ERD A;  1BI2 A;  3W6K B;  1JTX A;  3ZCO A;  5DV5 A;  1VQ9 I;  2MFZ A;  3JAM Z;  1P9Q C;  2YPR A;  4BQQ A;  2KL4 A;  2ZXW H;  3I56 I;  3VB2 A;  3HHH A;  2M0C A;  1YJ9 I;  5JHU A;  2H09 A;  4P55 A;  2ECB A;  1FC3 A;  3WG9 A;  2ZO4 A;  2V9V A;  3HBL A;  4B44 A;  3KZY A;  3NWT A;  4RGS A;  5DM6 F;  4E7K A;  3QU3 A;  2X1D A;  5BS6 A;  4XBF A;  1QBJ A;  1QZY A;  4DYQ A;  3U21 A;  1G2H A;  3OR1 C;  3CC7 I;  3PO3 J;  1FSH A;  2CGP A;  4Y3O A;  4EM0 B;  4C30 A;  3H9J A;  2R7S A;  4IQ4 A;  2L4M A;  1ZH5 A;  2R7R A;  4HBL A;  5EYR A;  1FBQ A;  3HSF A;  1TW3 A;  4U7B A;  2UXN A;  2Y2Z A;  4XOP A;  3ZQI A;  3H0D A;  2EFO A;  2XDV A;  5IT9 K;  4CO8 A;  4UVB A;  4L9N A;  2Z33 A;  2DLL A;  2FRH A;  5L3F A;  3F23 A;  2VQH A;  3JRG A;  3LSI A;  4S05 A;  1R1T A;  3T5X A;  5C3E J;  4KNY A;  1XDU A;  2QQA A;  2DMP A;  3IH2 A;  4PJJ A;  2ZC2 A;  3CCM I;  4XON A;  1YYV A;  4E70 A;  3A2K A;  5L3B A;  5FKM A;  4XRM A;  2V9P A;  5DUK A;  3HRT A;  3FIW A;  2LKX A;  1YS7 A;  1YW7 A;  4CHU A;  1PUF B;  2ZXH A;  1I3A A;  3ZQ7 A;  1D5Y A;  4BJ5 C;  1MBG A;  1ZG1 A;  2STW A;  3S17 J;  1BJA A;  1VQ6 I;  2K9N A;  1KYZ A;  4AC0 A;  4HNV A;  4YEL A;  3HGG A;  1HST A;  2CWE A;  1XG1 A;  2NS8 A;  1S29 A;  4CGZ A;  2Y0M A;  2ZME C;  3S32 A;  1BOB A;  4DNC A;  4PCQ A;  4G8X A;  3H1C A;  2DOD A;  4D7M A;  3ZQQ A;  5F0H A;  3GXO A;  4KIG A;  5HS8 A;  5F27 A;  2X6X A;  3PFI A;  3VDX A;  2M9H A;  4ZYD A;  2XPV A;  2KZV A;  4L0Y B;  3TDZ C;  2W4S A;  1X3W B;  2E5Z A;  4MO7 A;  3G4S I;  1MH4 A;  2WAD A;  1ENH A;  5EG0 B;  1T38 A;  2X48 A;  1YE9 A;  5LHI A;  1IDY A;  3H3V K;  4R8H A;  2NVY J;  4Y15 A;  2K7L A;  3CCU I;  4MEY F;  5M5X J;  5E1Z B;  2PI0 A;  4IHV A;  3BJO A;  5J1U A;  3K70 D;  4IO9 F;  5TRD A;  1P4X A;  3RQI A;  2DQR A;  1RZ4 A;  1J5Y A;  2X4H A;  4QPQ A;  3TBI A;  1JKQ C;  1SVL A;  4RGX A;  5HNF A;  3T8T A;  4X1E A;  3JRI A;  1O7F A;  1XDS A;  4BXX J;  3CZ6 A;  1Z9C A;  2BW3 B;  3GFM A;  4RGU A;  3A01 B;  3GLX A;  4XK4 A;  3CCJ I;  5DCM B;  2NS7 A;  4IRG A;  2DA5 A;  5HOO A;  2R5Y A;  2O6G E;  2Q2E B;  1ZGW A;  4EJW A;  1P92 A;  1A31 A;  4X6A J;  5HS7 A;  2V1U A;  4NBQ A;  2M1B A;  3BQZ A;  3N4M A;  3QRF F;  3IC7 A;  1VQ7 I;  3KP3 A;  4F7Z A;  2QUF A;  3KLN A;  5CLS A;  3L2Q A;  1TC3 C;  3PJR A;  3WGG A;  3ZMS A;  3DF8 A;  5JR3 A;  2BY1 A;  2R7V A;  2Y75 A;  4G9Y A;  2VQG A;  4ESF A;  1T6S A;  1LUJ B;  2DFE A;  2R5Z A;  1H89 C;  2DFI A;  4AYB A;  3HEF A;  3WTT C;  3CC2 I;  3V8J A;  3E0J B;  3GW2 A;  4BJ6 C;  2IRF G;  2IS2 A;  1OCZ H;  3H35 A;  3R4K A;  2A61 A;  4UV9 A;  2VPR A;  4WWC A;  3MWM A;  2HDD A;  3CJN A;  2JK3 A;  4AVP A;  2ZBK A;  1QPI A;  3IUO A;  2VON A;  4XR6 A;  1GXQ A;  3RPU D;  3PIO F;  1E2X A;  2KPM A;  1UHS A;  1U6G A;  2Z5U A;  5IT3 A;  1X3Z B;  2L7M P;  4LIV A;  4RAF A;  2E34 A;  3E5U A;  3HKZ A;  3E6B A;  3FXR A;  2HXO A;  3CUQ C;  2VOP A;  1BI3 A;  2QGU A;  2E19 A;  3NEU A;  4YII A;  1UG2 A;  4NHJ A;  2DMT A;  2V7F A;  3HUG B;  3QPL A;  2LYC A;  2DT7 B;  1ZAR A;  5L3E A;  1B1B A;  1QNT A;  2EIM H;  2JZY A;  3HJE A;  4P9F A;  2HWV A;  2LFB A;  1IV6 A;  5CQE A;  3EUK L;  5J1Y A;  5K7Z A;  3M4O J;  1HSJ A;  1MW7 A;  1SD5 A;  3GFL A;  3E6D A;  3H9G A;  1XTA A;  3ERE D;  4KMU X;  4KMF A;  2IGN A;  4ZYE A;  4LLG F;  4HA8 A;  1OKR A;  1Z21 A;  2BHY A;  3LFK A;  3WHC A;  4EAT A;  4G7Z F;  5KCM A;  2OUM A;  3CP2 A;  4RB2 C;  2HQR A;  1ZRD A;  2M8E A;  4KIF A;  5C4X J;  1I1S A;  1F5T A;  1KU2 A;  3K4C A;  1U5T B;  3RTR A;  2L7Z A;  3N97 A;  4IHX A;  2GWR A;  3GTL J;  1TWH J;  4B3A A;  1SD7 A;  2XGD A;  4P96 A;  1FYM A;  2Y9Y A;  2E36 A;  4PJ0 C;  3VEP A;  5KAI C;  3CMM A;  1X1D A;  2EA4 A;  5C44 J;  5IT9 Z;  2JSP A;  3H36 A;  2E60 A;  3D1N I;  1D5V A;  2JUC A;  2IEK A;  4DZP A;  4F92 B;  1X2N A;  2RQQ A;  3KIO A;  4YFX F;  4UV8 A;  2L7K A;  2DT5 A;  2YX4 A;  3CLQ A;  1I5Z A;  3PSI A;  2YSR A;  1MMG A;  3K4N A;  3DKW A;  2DTZ A;  1ETX A;  4YIF A;  2OQG A;  4ZYH A;  1X1B A;  2KJB A;  2JUG A;  4B48 A;  4KN4 X;  2M34 A;  1OLT A;  2LNB A;  5HOD A;  1TW2 A;  5GAE J;  1YJW I;  4XLN F;  1O57 A;  3OYA A;  3MCZ A;  1HBX G;  1GDT A;  4ESB A;  1A04 A;  5H2F C;  5E17 F;  2NNN A;  3LSP A;  3PUF A;  5EEA A;  3ZMZ A;  3L00 A;  4XRS G;  4PFP A;  3RQ4 A;  3TP3 A;  3ZQG A;  4BY7 J;  2XRL A;  1NH3 A;  1FOY A;  4GFB A;  1FMV A;  3PNY A;  1DQU A;  4A6D A;  3HZJ A;  2PEX A;  5LRR A;  2R92 J;  1Y0U A;  3I0T A;  2FBI A;  2EZI A;  2VXZ A;  1JI8 A;  1P2F A;  2R7Q A;  4CYD A;  3BLY A;  4QTR A;  3KYL A;  1F4K A;  4FIS A;  2IA2 A;  4BKX A;  4A3G J;  1VQK I;  2P7V B;  2A68 F;  4V2F A;  1OFC X;  4FX0 A;  1STZ A;  2BYV E;  4LJZ F;  3OYH A;  1W0U A;  3CUQ A;  2AO9 A;  1XD7 A;  6PAX A;  1BM9 A;  4WXD A;  1FNN A;  1SFK A;  1I50 J;  1IN5 A;  4C2T A;  3F6O A;  1BOA A;  3G1M A;  2DOF A;  1SFO J;  1WZ2 A;  2KQR A;  4Z2Y A;  1OCT C;  3SDG A;  3O8H A;  2F4M B;  4OAZ A;  4MEX F;  5EGO B;  2EFP A;  4J00 A;  1QVU A;  3SZP A;  5EZH A;  4CH7 A;  3MD2 A;  4BNC A;  2P6S A;  3ABU A;  4NB5 A;  4U0W A;  3JRF A;  2P0W A;  2K9M A;  4FT8 A;  4A0Z A;  3LAJ A;  4RBO A;  3VOD A;  3IV5 A;  4M9S A;  2PJR A;  2FF4 A;  3CDL A;  3DPU A;  1S3J A;  2STT A;  4G6D A;  2EA2 A;  5FLX K;  2VBW A;  5LEJ A;  1MBF A;  2MD5 A;  2V9K A;  4CYC A;  4FX4 A;  1MD0 A;  2XAJ A;  3LQQ A;  2LY2 A;  1OQY A;  2X1C A;  3S3O A;  3ZOB A;  4BH9 A;  4F91 B;  2NS0 A;  1DDN A;  4H0E A;  4ESJ A;  3OYL A;  2H1L A;  3LL7 A;  4E7Z A;  2O8K A;  3CUO A;  4Y7N J;  3T1B A;  2XF6 A;  5GAD J;  2L9N A;  3C3W A;  4IX7 A;  3P9C A;  2MG4 A;  3BJA A;  5DTD A;  3AG2 H;  3M9A A;  1XX5 A;  3DQV C;  4NDL A;  2FNP A;  3VYR B;  4PJM A;  2OA4 A;  4BUP A;  4LGW A;  2DTR A;  4MQ9 F;  4IF4 A;  4IHT A;  1VZ0 A;  2D1V A;  1B72 B;  1FLI A;  1YS6 A;  2DJI A; 
#chains in the Genus database with same CATH homology
 1PUE E;  1ZYR F;  2D45 A;  5D5X B;  1FZP B;  1LVA A;  3BPX A;  2RN7 A;  3IKT A;  4XRF A;  3I54 A;  3ULQ B;  2Z9O A;  1Z1D A;  2GQQ A;  3MEX A;  2P5L C;  3JTH A;  3JAM K;  1OYW A;  1K79 A;  4LK1 F;  2PN6 A;  2RKH A;  5ILU A;  3RYP A;  1Z6R A;  5TJJ A;  1W7P A;  3F72 A;  3WTU C;  1B9M A;  1V4R A;  4N0B A;  4GCV A;  5A2Q Z;  5FO5 A;  3BWG A;  5J6X A;  1FWZ A;  3MZY A;  1FP2 A;  4DQ2 A;  2NRA C;  1GHC A;  2J5O A;  3ZP5 A;  3PQJ A;  1KGS A;  1HXD A;  3CDH A;  3L2C A;  3J7A O;  1AWC A;  2EV0 A;  3L7W A;  1RI7 A;  3B02 A;  1ZGJ A;  1ON1 A;  3I71 A;  4HF1 A;  2HYF A;  1SMT A;  2QYO A;  3WTW C;  3Q9S A;  1F9N A;  3VOE A;  1KA8 A;  2CYY A;  3PQK A;  3LA7 A;  2AXL A;  2VT3 A;  2GXB A;  3F22 A;  1T0F A;  5LHG A;  3KEQ A;  2DW4 A;  4RAY A;  3CO6 C;  5ERI A;  1W5S A;  4B09 A;  1SFU A;  4RGR A;  2FEZ A;  3QP5 A;  2ZCW A;  3K9T A;  1FSE A;  1J2X A;  3KET A;  3DPL C;  1G3T A;  4LB6 B;  5BPD A;  1ZRF A;  2RVC A;  5JVT A;  2OAZ A;  1P4W A;  3C18 A;  2XV4 S;  1Z91 A;  2BBY A;  4Q5S F;  2DAO A;  3P9K A;  3J80 Z;  4ASN A;  2ZJ2 A;  1O3S A;  2ZXJ A;  1RNL A;  2XIG A;  1C0W A;  5KVR A;  2ZME B;  4LMY A;  1IXR C;  4R79 A;  2R7D A;  3F8B A;  2MLG A;  2DPU A;  1ZHF A;  1X3U A;  3BRO A;  3RI4 A;  1IZ1 A;  2O0Y A;  4A5M A;  1D8J A;  5FD6 A;  5FD5 A;  1EH6 A;  1LDJ A;  2AS5 F;  4EM1 A;  2IT0 A;  5ILV A;  5HLG A;  3JTG A;  1YQA A;  3P7N A;  2A07 F;  3C1D A;  2P8T A;  2A5Y B;  4LG0 A;  4XSX F;  1K6O A;  3RYR A;  1W7P D;  2E1N A;  4LD5 A;  3WTZ A;  2G7U A;  3R0A A;  3O2P E;  2P4W A;  4EMS A;  1FP1 D;  4HYE A;  3WTV C;  2PBI A;  3IRQ A;  1B6A A;  3M8F A;  4A2U A;  3WTS C;  1WRJ A;  3J81 Z;  5LGU A;  5J8C A;  2VBX A;  3WE3 A;  2M45 A;  1RIO H;  1HKQ A;  1KYW A;  3QAH A;  1GVJ A;  2IP2 A;  1L0O C;  2KJC A;  4KT5 C;  2E7X A;  2JSC A;  2WTE A;  4Q4Z F;  5EEH A;  2FU4 A;  3DPT A;  3FX3 A;  4ENM A;  1EV7 A;  4BXU A;  3V8L A;  4CIC A;  2R3S A;  1FOK A;  3IKV A;  2PJP A;  2CSO A;  5E1X A;  1ZLJ A;  4I0B A;  2DU9 A;  5E18 F;  1TTY A;  4AIH A;  2FSW A;  4EGY A;  1UST A;  2KIM A;  4I01 A;  4M9X A;  3RDI A;  4RB1 A;  3ML6 A;  5JFR A;  2OZU A;  3E5X A;  2A6E F;  4CDG A;  3HRM A;  1P6R A;  4CXF A;  4G7O F;  1ON2 A;  3HSR A;  3Q5F A;  3E6M A;  3GZ6 A;  2HQN A;  5HDN A;  4OIR F;  4LK0 F;  1R7J A;  4I0A A;  4KDP A;  2ZNY A;  5HS9 A;  3HRU A;  4I98 B;  4HF0 A;  3Q9V A;  1AOY A;  3HRS A;  2A3S A;  2LSO A;  3FHZ A;  4OIN F;  2UWM A;  1LB2 A;  1YW9 A;  3BJ6 A;  3HSE A;  5BPI A;  2Y48 A;  2LDU A;  2YX7 A;  3MZH A;  4G94 A;  2F5E A;  5K5Q A;  1XB4 A;  3F8N A;  3W6J B;  1YG2 A;  4L9J A;  4K2E A;  3MQ0 A;  3K69 A;  2IW5 A;  3GFI A;  3IWF A;  5ICC A;  3TGN A;  5D6E A;  2FA5 A;  4A0X A;  1O3R A;  1UFM A;  1Q1H A;  5AIQ A;  3HIF A;  5K5O A;  3TDU C;  4O3M A;  1BC7 C;  1GXP A;  1OYY A;  2ADU A;  3ECH A;  2GXG A;  3I59 B;  4BHP A;  1OMI A;  2O8X A;  4JQF A;  3E97 A;  3TO9 A;  1SAX A;  1SFX A;  2HGC A;  4EM2 A;  1O3T A;  1IN8 A;  2RV8 A;  4O6J A;  5DD8 A;  4BHC A;  3HYI A;  1EH8 A;  1FY7 A;  5DCF A;  1IW7 F;  2YU3 A;  3P9I A;  4N9H A;  2DQL A;  2PG4 A;  3KLO A;  4WF2 A;  4RB0 A;  5A2Q K;  1TLH B;  1ZG5 A;  2PQ8 A;  1V3F A;  3BOQ A;  4KIB A;  4M73 A;  1YFH A;  5CVI A;  1CF7 A;  2V1X A;  1MDM A;  3FZV A;  3ZMV A;  2VOD A;  2XKP A;  2EFW A;  3ROU A;  4I7H A;  2L54 A;  3MAJ A;  4M9Z A;  5K5R A;  1W4M A;  3F8M A;  4AWX B;  3SFZ A;  4AIJ A;  1K78 B;  2F5D A;  3ZPL A;  2WWY A;  3GO5 A;  4IRH A;  4OU0 A;  1XMK A;  5FGM A;  3RJP A;  4A6E A;  1QGP A;  3FM3 A;  5D5U B;  2QLZ A;  2D1H A;  4YFN F;  3HTS B;  2FXA A;  1J0R A;  4KFC A;  1UHW A;  4MTD A;  3I4P A;  1J9I A;  2XHK A;  1ZRC A;  2XVC A;  3ZMD A;  2IVM A;  4IVN A;  1F1Z A;  1KQ9 A;  1H9G A;  1DP7 P;  2HFH A;  4PGG A;  3G73 A;  4HV6 A;  2JPB A;  1T39 A;  3M1E A;  2QBY B;  4OMY A;  2KIF A;  1DPR A;  3AAF A;  1IUY A;  2MBF A;  1ZG3 A;  1XSV A;  1S7A A;  3BZ6 A;  4HX4 A;  2GA1 A;  3V8K A;  1FT9 A;  2IA0 A;  5L3D A;  4A5N A;  2WC2 A;  5E20 A;  4QWQ A;  1G4D A;  1ZGA A;  4ETS A;  4AIK A;  1RUO A;  4R1H A;  3J80 K;  4OIP F;  4OOI A;  4HQE A;  3FXU A;  2BV6 A;  2ISZ A;  2JT1 A;  3ZN0 A;  3M7G A;  1OR7 A;  1HW2 A;  1MKM A;  1UHM A;  5ICE A;  2G9W A;  2W24 A;  2Q8K A;  4HQM A;  1FBU A;  1IN4 A;  4MQV A;  3TQN A;  4ENK A;  1G6N A;  3C7J A;  3RPQ A;  1J59 A;  2HS5 A;  2HR3 A;  3GFJ A;  4JBA A;  4HDV A;  2K4B A;  5DCM A;  2L3D A;  2H27 A;  4GGG A;  5LEK A;  2QVO A;  4L5J A;  2Q2E A;  2K02 A;  2HYG D;  5H6Q A;  4N9I A;  4ZYG A;  2MH9 A;  2ZKZ A;  5D5V B;  5AON A;  1XN7 A;  5DYM A;  1T98 A;  1PP7 U;  3KCC A;  1SFE A;  4MHG A;  5D5W B;  4PZJ A;  3J81 K;  3L09 A;  4U0V A;  4L18 B;  3NQO A;  2XAQ A;  5CVU A;  5D6F A;  2P6T A;  4IRI A;  5DDG A;  3F3X A;  1W5T A;  3H3U A;  3HHG A;  3JSO A;  3FXQ A;  5HDK A;  1MJ9 A;  1MGT A;  3FWE A;  3KP2 A;  3ZN1 A;  3SQN A;  4M71 A;  2A6H F;  4ZZD A;  1R5H A;  3DFG A;  2W84 A;  3EET A;  3TKY A;  3QPT A;  3KP4 A;  2EFN A;  1FYL A;  3BY6 A;  1U78 A;  4GYG A;  1U5T A;  2Q0O A;  5DEQ A;  3GF2 A;  3R6S A;  2BEO A;  1HQC A;  3KP6 A;  4L0Z B;  3I64 A;  1CGP A;  2OQR A;  1KQ8 A;  3ZMU A;  2XKO A;  5BOX A;  3FF5 A;  1TQI A;  1ZLK A;  2D2W A;  4ZZL A;  1R00 A;  2IPQ X;  3MFK A;  1RUN A;  2K27 A;  4A12 A;  3GWZ A;  2UXX A;  2PMU A;  5ICF A;  4XLP F;  4OMZ A;  4M74 A;  1I1G A;  2KRF A;  1BIA A;  1IAW A;  5E1W A;  2MC3 A;  4B8X A;  2O3F A;  2FE3 A;  1IRG A;  2XAS A;  5AIP A;  3D5L A;  3DXJ F;  2R7F A;  2LF8 A;  4U0Y A;  3IHU A;  2MLK A;  3I5U A;  4M6X A;  3LWF A;  1XSD A;  2LF7 A;  1WI9 A;  2P5K A;  3KFW X;  1S8N A;  2VN2 A;  2X0L A;  5H6R A;  1QZZ A;  2ESN A;  2VT2 A;  3E6C C;  1BIB A;  3SHF A;  5LGN A;  1EH7 A;  5BMZ A;  1LEB A;  1B59 A;  1UCR A;  2EJR A;  4Q48 A;  1Z6T A;  1YTY A;  3DP7 A;  1FX7 A;  2GZW A;  4HF2 A;  3EYI A;  2HOE A;  3O6B B;  2E1C A;  1BC8 C;  1IXC A;  3ELK A;  4OIQ F;  4UVC A;  2DPD A;  1OPC A;  2W25 A;  3SXY A;  3V4G A;  3I53 A;  3RPU A;  4WCG A;  1B9N A;  2DI3 A;  2XAH A;  3DV8 A;  2DO7 A;  3NRV A;  3E3V A;  1ZRE A;  2QZ8 A;  2RQP A;  5LHH A;  2RC4 A;  1ONV A;  2CO5 A;  3O3K A;  5F1R A;  5CVJ A;  3LA2 A;  3F6V A;  5D8K B;  1XCB A;  2KIU A;  1U8R A;  4PDK A;  5FFZ A;  4M72 A;  1T2K A;  4L9V A;  1U3E M;  4BYY A;  5CYV A;  1PDN C;  1R1U A;  3IWZ A;  2CG4 A;  1DPU A;  4LB5 A;  1L3L A;  3CUQ B;  2COM A;  1WSU A;  2KKO A;  1IN7 A;  3ZMT A;  2VC1 A;  3V7C A;  2XRO A;  3GYH X;  2HTS A;  3LST A;  4WK8 F;  3FM5 A;  1D8K A;  2HZT A;  2QEN A;  2ZNZ A;  2XAG A;  3U2R A;  2NYX A;  4EJT A;  3DEU A;  1B4A A;  5KK1 A;  4G7H F;  2H6C A;  2H94 A;  1G3S A;  2CFX A;  3RKY A;  1JHH A;  2GA2 A;  3BPV A;  4EVI A;  1ODD A;  3OOP A;  3K2Z A;  2HEO A;  3WE2 A;  5HLH A;  2F2E A;  4I02 A;  1O7L A;  4AD9 A;  1JXS A;  1HW1 A;  1FBS A;  4EGZ A;  1H9T A;  2DK5 A;  1UB9 A;  1OYI A;  2F5F A;  1LJ9 A;  1KU7 A;  3FMR A;  3TOA A;  4GXO A;  4EV0 A;  2BE5 F;  3GVA A;  5D4R A;  5JI6 A;  3TOB A;  4HW0 A;  4GO1 A;  4HDU A;  1SMY F;  1K7A A;  5FFX A;  3SZT A;  2L01 A;  1TNS A;  1J7K A;  4QLC U;  3QOP A;  2ESH A;  2CW0 F;  2QM3 A;  4MGR A;  2JRT A;  4LFU A;  3B73 A;  3RKX A;  4WXC A;  2O61 A;  2ELH A;  4LLL A;  1W7P B;  3EQL F;  2FQ3 A;  2YR2 A;  1MJA A;  1MZB A;  4D0P A;  4EJU A;  4UUV A;  1KU9 A;  5CVV A;  3G3Z A;  1Z05 A;  5DD4 A;  2L4A A;  3M8E A;  3KP7 A;  5ILS A;  3EDP A;  2K4J A;  2V1D A;  2OZ6 A;  5H20 A;  1TQP A;  4TV7 A;  5HLI A;  2ZME A;  4JK1 X;  1IXS B;  1SD4 A;  4HX8 A;  1FPQ A;  3R61 A;  1USS A;  4BAY A;  2XGX A;  3COA C;  2BGC A;  4HOB A;  5E8I A;  3ISP A;  5EEG A;  4IHS A;  2B0L A;  2M5W A;  2L02 A;  2EFQ A;  4P5O A;  1G3Y A;  2FOK A;  4U7D A;  1XMA A;  1NHA A;  3K1M A;  5DUI A;  2VC0 A;  3WU1 B;  1HKS A;  1XGM A;  2RNJ A;  1QPM A;  1S6L A;  1JHF A;  2QQB A;  1XGN A;  1LDK B;  3U1D A;  1R5G A;  3JW4 A;  2LKP A;  4EQQ A;  3CO7 C;  2PLY A;  1R1V A;  4ON0 A;  2C6Y A;  4HZF A;  3QP6 A;  1O3Q A;  3WTY C;  2NAZ A;  2XRN A;  4RAZ A;  1G3W A;  2E7W A;  1R58 A;  3KP5 A;  5CVR A;  4YG2 F;  2GAU A;  2GIV A;  2FBK A;  4EJV A;  3RKW A;  4KA4 A;  2VE9 A;  1J75 A;  1BN5 A;  4HLY A;  4UHT A;  3D0S A;  1JE8 A;  4MNU A;  3GZ5 A;  2JTV A;  4I09 A;  4L5I A;  3U9G A;  2DK8 A;  2PMH A;  3BP8 A;  4Y17 A;  2H6B A;  3JSP A;  3H3Z A;  3T0Y A;  1LNW A;  3KZZ A;  5ICG A;  1Z7U A;  3LQR A;  1XCV A;  1LEA A;  1D3Y A;  4M6Y A;  5E8G A;  1S7O A;  1YW8 A;  2IJL A;  4HAM A;  1P4A A;  2FNA A;  1R23 A;  4OIO F;  3TO6 A;  1E17 A;  1WQ2 A;  2P5V A;  4ENN A;  1I6X A;  1BI1 A;  2CQK A;  5HDG A;  3CLO A;  4BQA A;  4FHT A;  5F64 A;  4MTE A;  2VBZ A;  2OD5 A;  1JGS A;  4KIC A;  3V7S A;  4CZZ A;  5F6F A;  1XGS A;  2EK5 A;  4HV5 A;  4UXN A;  3WGI A;  1H0M A;  3TO7 A;  1VTN C;  5K1Y A;  2IA1 A;  4LG0 B;  2Z99 A;  4HLX A;  3K1P A;  2JPC A;  1WWX A;  2V6C A;  3HOS A;  1U5T C;  1REP C;  3LA3 A;  4S04 A;  3FMS A;  3WOD F;  2OBP A;  4RS8 A;  4UVA A;  3F8C A;  5LRS A;  3H92 A;  2P7C B;  1MJB A;  2FMY A;  4NQW A;  3GEZ A;  3BDD A;  2Z3Y A;  3T8R A;  3S2W A;  5LLQ A;  2WV0 A;  2M87 A;  3OV8 A;  1QO0 D;  3QPH A;  2UZK A;  5CJ9 A;  1IRF A;  2RGV A;  2HDC A;  1ZAO A;  4IXA A;  2QQ9 A;  1YIO A;  4P9U A;  1ZN2 A;  1YLF A;  5ED4 A;  3HUG A;  2EWN A;  4UNO A;  5D8L B;  3EYY A;  2HKX A;  3I59 A;  3IRR A;  2VE8 A;  3QU6 A;  3ECO A;  2ETH A;  5LBQ A;  4WXH A;  4GYI A;  1PP8 F;  3RIR A;  1TQM A;  3I58 A;  2ZFW A;  1XGO A;  3WTX C;  3E5Q A;  1SD6 A;  2M30 A;  4RB3 C;  5LGT A;  5L3G A;  1HKT A;  2VOO A;  4BHB A;  1BI0 A;  1LQ1 A;  4U88 A;  1BBY A;  4IJA A;  3WGH A;  1TNT A;  4EJO A;  4LLN A;  1LDD A;  4PGH A;  2EB7 A;  3R0J A;  4WX9 A;  2V79 A;  1FYK A;  1KQ0 A;  2W85 A;  2TDX A;  2A69 F;  1ULY A;  4O5V A;  3LAP A;  1YO5 C;  1KU3 A;  2EV5 A;  2XUB A;  4Y13 A;  3VFZ A;  2RDP A;  3K1N A;  3V7R A;  4HX7 A;  1K78 A;  4KN7 X;  4G6Q A;  2EV6 A;  4A0Y A;  4YFK F;  2OU2 A;  5J8F A;  2DBB A;  3F21 A;  4ENJ A;  1U2W A;  2K86 A;  4IPA A;  3FMQ A;  2XAF A;  5FLX Z;  4XSZ F;  2VBY A;  1XSX A;  1R22 A;  4ZH4 F;  2QWW A;  4I2O A;  2FBH A;  2W57 A;  2O03 A;  1R36 A;  2MH2 A;  1QQI A;  1HW5 A;  2HTJ A;  1DUX C;  3R60 A;  3F8F A;  3K0L A;  2NNY A;  2PFB A;  2QBY A;  3L9F A;  5FB2 A;  2MA3 A;  3KEO A;  4L9T A;  2G7H A;  3EUH A;  5HVQ C;  3GUD A;  3IL2 A;  1IF1 A;  2F5C A;  4Q47 A;  2HKO A;  5BQT A;  2ACJ A;  2ISY A;  3CTA A;  3ABT A;  5L3C A;  1I27 A;  1IN6 A;  1TBX A;  3HTU A;  3WU0 A;  3REO A;  4KYW A;  5D4S A;  3GX4 X;  2FML A;  1CF7 B;  3KE2 A;  1MDM B;  1WKM A;  2J5P A;  3HOT A;  4KUM A;  1BI2 A;  3W6K B;  5DV5 A;  3JAM Z;  2YPR A;  3VB2 A;  3HHH A;  5JHU A;  2H09 A;  4P55 A;  1FC3 A;  3WG9 A;  2ZO4 A;  2V9V A;  3KZY A;  4RGS A;  3QU3 A;  5BS6 A;  4XBF A;  1QBJ A;  1QZY A;  1FSH A;  2CGP A;  4EM0 B;  2L4M A;  1ZH5 A;  4HBL A;  1FBQ A;  3HSF A;  1TW3 A;  4U7B A;  2UXN A;  2EFO A;  5IT9 K;  4CO8 A;  4UVB A;  4L9N A;  2Z33 A;  2DLL A;  2FRH A;  5L3F A;  3F23 A;  4S05 A;  1R1T A;  3T5X A;  4KNY A;  1XDU A;  2QQA A;  1YYV A;  4E70 A;  5L3B A;  5DUK A;  3HRT A;  1YS7 A;  1YW7 A;  4CHU A;  3ZQ7 A;  1ZG1 A;  2STW A;  1BJA A;  1KYZ A;  1HST A;  2CWE A;  1S29 A;  4CGZ A;  2Y0M A;  4DNC A;  4PCQ A;  4G8X A;  3GXO A;  4KIG A;  5HS8 A;  3PFI A;  4ZYD A;  4L0Y B;  3TDZ C;  1T38 A;  5LHI A;  4R8H A;  4Y15 A;  2K7L A;  4MEY F;  5E1Z B;  2PI0 A;  3BJO A;  5TRD A;  1P4X A;  2DQR A;  1RZ4 A;  1J5Y A;  2X4H A;  4RGX A;  3T8T A;  1O7F A;  1XDS A;  1Z9C A;  3GFM A;  4RGU A;  3GLX A;  5DCM B;  4IRG A;  5HOO A;  2O6G E;  4EJW A;  1P92 A;  5HS7 A;  2V1U A;  2M1B A;  3QRF F;  3N4M A;  3IC7 A;  3KP3 A;  4F7Z A;  2QUF A;  3KLN A;  5CLS A;  3WGG A;  3ZMS A;  3DF8 A;  5JR3 A;  2Y75 A;  4G9Y A;  4ESF A;  1T6S A;  2DFI A;  3WTT C;  3V8J A;  3GW2 A;  2IRF G;  3R4K A;  2A61 A;  4UV9 A;  4WWC A;  3MWM A;  3CJN A;  4AVP A;  2ZBK A;  2VON A;  1GXQ A;  1E2X A;  1U6G A;  2Z5U A;  5IT3 A;  3E5U A;  3E6B A;  3FXR A;  3CUQ C;  2VOP A;  1BI3 A;  3NEU A;  4YII A;  4NHJ A;  1ZAR A;  5L3E A;  1B1B A;  1QNT A;  2JZY A;  4P9F A;  2HWV A;  1HSJ A;  3GFL A;  1SD5 A;  3E6D A;  3ERE D;  4KMU X;  4KMF A;  4ZYE A;  4LLG F;  4HA8 A;  1OKR A;  3LFK A;  4G7Z F;  4RB2 C;  2HQR A;  1ZRD A;  2M8E A;  4KIF A;  1I1S A;  1F5T A;  1KU2 A;  1U5T B;  3RTR A;  3N97 A;  2GWR A;  1SD7 A;  4P96 A;  1FYM A;  3VEP A;  2EA4 A;  5IT9 Z;  1D5V A;  4YFX F;  4UV8 A;  2DT5 A;  2YX4 A;  1I5Z A;  2YSR A;  3DKW A;  4YIF A;  2OQG A;  4ZYH A;  2KJB A;  4KN4 X;  2LNB A;  1TW2 A;  4XLN F;  1O57 A;  3MCZ A;  1HBX G;  4ESB A;  1A04 A;  5E17 F;  2NNN A;  3ZMZ A;  3L00 A;  4A6D A;  2PEX A;  5LRR A;  1Y0U A;  3I0T A;  2FBI A;  2VXZ A;  1P2F A;  4CYD A;  1F4K A;  2IA2 A;  2P7V B;  2A68 F;  4FX0 A;  1STZ A;  2BYV E;  4LJZ F;  3CUQ A;  1XD7 A;  6PAX A;  1BM9 A;  4WXD A;  1FNN A;  1IN5 A;  3F6O A;  1BOA A;  4Z2Y A;  4MEX F;  2EFP A;  3SZP A;  4BNC A;  2P6S A;  3ABU A;  4NB5 A;  4U0W A;  4FT8 A;  4A0Z A;  3LAJ A;  3VOD A;  4M9S A;  2FF4 A;  2STT A;  1S3J A;  4G6D A;  2EA2 A;  5FLX K;  2VBW A;  5LEJ A;  2MD5 A;  4FX4 A;  1MD0 A;  2XAJ A;  3LQQ A;  4BH9 A;  2NS0 A;  1DDN A;  4H0E A;  4ESJ A;  3CUO A;  3T1B A;  3C3W A;  3P9C A;  3BJA A;  3M9A A;  3DQV C;  2FNP A;  2OA4 A;  4LGW A;  2DTR A;  4MQ9 F;  4IF4 A;  4IHT A;  2D1V A;  1FLI A;  1YS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...