4RGXA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 3,4-dihydroxy bezoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with 3,4-dihydroxy bezoic acid
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
total genus 44
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgxA00
4RB1A 5HOOA 3LWFA 3O2PE 2A69F 1F4KA 5HVQC 2P7CB 2Y48A 3WGHA 1J0RA 2EB7A 2HQNA 3BROA 2ZJ2A 4CHUA 2A3SA 2ISYA 2VBXA 3MZYA 1ZRFA 5D5WB 5FFZA 2IA0A 3CUOA 1R7JA 2Y0MA 1FLIA 4R79A 5K5RA 2KKOA 1S8NA 3SQNA 4O5VA 4BHBA 2XIGA 4M9ZA 4B09A 3P9KA 2HWVA 1YO5C 5FO5A 3BJOA 2W25A 5FD6A 3IHUA 5BMZA 3M8FA 3FMQA 1KU9A 1W5TA 1GHCA 4ON0A 1ZLKA 1MD0A 2BEOA 2ESHA 2H94A 4RGUA 4MQ9F 3K0LA 3ECOA 1D8KA 1JE8A 1R36A 2HOEA 4S05A 1MKMA 1MJAA 2JPBA 1J2XA 4S04A 3F8FA 3ISPA 2GAUA 1Z91A 1S6LA 3S2WA 5LGTA 5HLGA 3D5LA 4G9YA 2QM3A 3W6KB 4L0YB 5DCMB 2RNJA 2QQAA 2FF4A 4XSZF 5E1ZB 3WODF 1H9TA 4Y13A 4QLCU 4WF2A 4HDVA 2XGXA 2IP2A 1T98A 3L7WA 5TJJA 2IVMA 5HS7A 1P4AA 1SFXA 1XCVA 4YFKF 2P6TA 1HXDA 2GXGA 1G3YA 3T0YA 1TW2A 3GFLA 1OMIA 3ROUA 3VODA 1OYWA 2PLYA 4BNCA 4RS8A 5F64A 1S7OA 4I98B 2HTJA 2EA4A 2VC0A 2ADUA 3QP5A 1HW5A 2L3DA 5CVJA 4GCVA 4RAZA 4IPAA 1IN5A 3GZ6A 5KVRA 1QPMA 2ZMEA 1K7AA 4AIJA 2HQRA 4EQQA 3H92A 5FLXZ 3N4MA 2M30A 3RKYA 3U9GA 2MC3A 2ZXJA 1E2XA 1KQ8A 3Q9VA 2C6YA 2F2EA 2ETHA 4JBAA 2XAHA 4WXCA 1KQ9A 4IJAA 1RI7A 3BJ6A 1LEBA 1TQIA 1MZBA 2VBWA 2OQRA 4I02A 4I0BA 5FLXK 4I7HA 1G3SA 1O7LA 2DI3A 4UV9A 1BC7C 4OIPF 1ZHFA 3ZMTA 4RGXA 3TO9A 3GLXA 4R8HA 4EJOA 2M45A 4KIBA 2XAFA 5E17F 3KP5A 1DP7P 3F3XA 5H20A 2FRHA 1IXRC 2JRTA 3NQOA 2FMLA 2K02A 1R1UA 3PFIA 1W7PA 3GYHX 4QWQA 3U2RA 4L5IA 1R1VA 4EGYA 3IWFA 1G3WA 4DNCA 4KFCA 2P5VA 3QU6A 5FB2A 1ZRCA 3KETA 2EV5A 2OA4A 1FP1D 5BS6A 2TDXA 3E6DA 4P9FA 1P4XA 3KP7A 2VT2A 3L2CA 1P6RA 4ZH4F 1LDKB 3DKWA 4L9TA 2VBYA 4LFUA 5JHUA 1IN7A 1IUYA 4OINF 1I27A 3K2ZA 4ESFA 1HW1A 5J6XA 3FHZA 4G6QA 5LEJA 4WWCA 4XLNF 1I1SA 1FZPB 1TTYA 3ULQB 3WTTC 1FT9A 4M72A 1T0FA 3BZ6A 1FWZA 2W57A 5K5OA 4A6DA 4BYYA 4BQAA 3R60A 2PI0A 2OBPA 2DQRA 1WKMA 5CVUA 1IXCA 1ZG3A 1SD5A 4ZYHA 2MD5A 2H27A 4ENNA 1USSA 1R23A 1MDMB 2PEXA 2UXNA 3ZMDA 4A5NA 2IT0A 3QRFF 2K86A 2ZNZA 1GXQA 3QOPA 2FNAA 1CGPA 1W7PD 1C0WA 1SMTA 2YX7A 3OOPA 3GXOA 4CXFA 5L3DA 1KA8A 1FSHA 1UHMA 2XAGA 3I4PA 2VE9A 3I58A 3T1BA 2QLZA 1TQMA 5EEGA 1KU2A 4G7OF 1QQIA 1R22A 1UHWA 5ICGA 1SAXA 1Z9CA 1D5VA 2L02A 1ZARA 5D6EA 2OZ6A 1YW8A 1OYIA 2VXZA 3U1DA 2K7LA 5E1WA 4KICA 3DP7A 1YIOA 2A68F 3ABTA 2RV8A 2F5DA 2CG4A 3DQVC 1U6GA 5FFXA 2O61A 2FE3A 2J5OA 3KZYA 3HOSA 1P4WA 4U7BA 4MQVA 2CYYA 3SZPA 1YW7A 3F8BA 2PQ8A 5LBQA 1F5TA 1EH7A 2IPQX 1IRFA 2XV4S 3ABUA 1R5GA 4I0AA 2HYFA 1B1BA 4KN7X 5D4RA 3F23A 2A6HF 2ZMEB 2O3FA 3CUQC 4FHTA 3T8RA 3VEPA 3ZMSA 1ULYA 2JT1A 1KQ0A 4NQWA 2RKHA 4B8XA 1E17A 1DDNA 4LB6B 1Z1DA 2DQLA 1BIBA 2JPCA 3HHHA 1PDNC 1ZGAA 2LKPA 4JQFA 4XBFA 1D8JA 1ZREA 4UUVA 5CYVA 5L3FA 2QVOA 3CO7C 2ACJA 3RTRA 2A5YB 3VFZA 3BWGA 3DPLC 1T39A 4PGGA 4UXNA 4MTEA 1ZAOA 4MNUA 2WV0A 2NYXA 1FBSA 2PG4A 1J9IA 4A0YA 1LEAA 2BGCA 2P5KA 1LDJA 1YS7A 3ML6A 2OQGA 4Q5SF 5CLSA 1PUEE 5DD4A 2IW5A 5HDKA 4I01A 1W7PB 3HTSB 3I59A 4HX8A 2HS5A 1LB2A 4ENMA 1PP8F 1I1GA 3HRSA 3GFMA 4KIFA 4L5JA 4CDGA 2NAZA 2QBYA 1U5TC 1LVAA 4EJTA 5DCFA 3M9AA 1RUNA 3KE2A 2NNNA 2R7DA 1BIAA 1U5TA 1TLHB 1J75A 1Z6TA 4ETSA 3IRQA 2HEOA 3I64A 1U78A 4RGRA 1MJ9A 3FM3A 1ONVA 1IXSB 2HKOA 4LMYA 3F21A 3CDHA 1I5ZA 3OV8A 3WGIA 1FBUA 2AS5F 3E5UA 4HAMA 5F6FA 2EFNA 2Z5UA 3K9TA 5ICEA 1QO0D 4ZZDA 2QWWA 4OIQF 1IN4A 1LQ1A 5EEHA 1U2WA 2QQBA 4FX4A 1P92A 2CWEA 1REPC 2XVCA 4YIIA 1XB4A 1Z7UA 2ZNYA 4Y17A 4LLGF 4A6EA 1YLFA 4YG2F 1IN8A 4I2OA 3W6JB 2CW0F 1V4RA 3BPXA 3TDUC 2UZKA 1MGTA 4HF2A 2XUBA 2KJCA 4IHTA 1XSXA 4FT8A 3KLOA 3CO6C 3V7CA 1K78A 3M1EA 4LLNA 1RZ4A 3IKTA 1TNTA 2P8TA 2OU2A 2L01A 3SZTA 1FP2A 1WRJA 1WWXA 2EV0A 4PZJA 1TNSA 3WU1B 1Z05A 4ESBA 1S29A 1R58A 4LB5A 2FXAA 1A04A 2HKXA 3K1MA 2FEZA 2AXLA 5D5UB 2B0LA 2PFBA 2CQKA 4M74A 1FBQA 5LGNA 1QBJA 3E97A 3TOAA 5DV5A 2ZCWA 2JZYA 5E1XA 5CVVA 3KCCA 3R6SA 4U0WA 4GYGA 5ILUA 3J7AO 4M71A 5L3BA 3R61A 3D0SA 5LHHA 4DQ2A 3WU0A 4PCQA 3IRRA 5TRDA 2L4AA 1ZH5A 2GZWA 5E18F 1B6AA 3HRMA 4OMZA 3NRVA 3DPTA 2UWMA 2E7XA 2G7HA 4WXDA 2ELHA 2XKPA 5BPIA 2GQQA 5D5XB 2EA2A 4EGZA 5DYMA 3JAMZ 5ED4A 5L3EA 4L0ZB 1NHAA 3RYRA 4UVBA 1XGNA 2WWYA 1I6XA 2XAQA 1B4AA 1ZYRF 1UFMA 3V8JA 5JFRA 2MBFA 1UCRA 4G8XA 2PN6A 2FNPA 3MAJA 3WTUC 1BC8C 1F1ZA 5H6QA 5HS8A 3WGGA 4LD5A 3JAMK 2RN7A 2ZBKA 1J7KA 2FU4A 4OOIA 4IRGA 3TOBA 2GA1A 4PDKA 2NRAC 4BHPA 2Z9OA 2EFPA 4HDUA 3QU3A 4Q47A 4R1HA 4HV6A 1FYMA 2EWNA 1V3FA 3VB2A 1UB9A 1T2KA 4UV8A 4LG0A 4M6XA 3T5XA 1SD7A 2VOOA 2E1NA 4TV7A 3EYIA 2DO7A 1YQAA 2FBKA 3CJNA 2J5PA 1XDSA 4HLYA 1RUOA 4GO1A 1YW9A 1FYKA 4ZYEA 3MZHA 2HYGD 1YYVA 4RB3C 1LDDA 2FBIA 3HOTA 3I71A 5LRRA 4AVPA 3IKVA 4KMUX 3KEOA 3I59B 1SMYF 5LGUA 2P6SA 4IRHA 1BOAA 4HW0A 2DTRA 1JHHA 1WQ2A 4A12A 5CJ9A 1USTA 5CVRA 2O8XA 2M8EA 2FMYA 3O3KA 4HQEA 3EDPA 3E5XA 1SD6A 2K4BA 3KEQA 2QBYB 3K69A 3DXJF 3KP6A 2PMUA 4P5OA 4MEYF 2ZFWA 5ILVA 4PGHA 4EV0A 1IF1A 1XGSA 2V6CA 2R7FA 3HRUA 1ODDA 2IA1A 1J59A 3J80Z 2XHKA 4WCGA 2STWA 1XSVA 3C18A 3LFKA 1MJBA 2V1DA 3IL2A 3WTZA 1ZRDA 2VE8A 4MTDA 4EVIA 3P9IA 2R3SA 1BI3A 1R1TA 4ENKA 2E7WA 4KA4A 5HS9A 5K5QA 3MCZA 3E6CC 4OU0A 2RGVA 3I54A 3J80K 2VT3A 2F5CA 3GX4X 2P4WA 4ESJA 1XMKA 2PJPA 3C1DA 2DBBA 4CO8A 1KYWA 2PBIA 2XRNA 5J8FA 3V8LA 3BY6A 3EYYA 1U3EM 4MEXF 3DFGA 3RI4A 2DT5A 3T8TA 3LA2A 2ZO4A 3TQNA 2FOKA 1G3TA 3ZMUA 1P2FA 1ZN2A 4HBLA 4P9UA 1K78B 1XGOA 3R0AA 3DF8A 4U0YA 4BXUA 4MHGA 2Z33A 1WSUA 3TKYA 4XSXF 1OR7A 3L00A 3RPUA 2Z99A 2KRFA 1KYZA 3JTHA 3REOA 4JK1X 4RAYA 2IRFG 5ERIA 2CFXA 4LLLA 1DPUA 2EV6A 1FX7A 3ZN0A 4ZYGA 4L18B 5HDGA 1TW3A 1B59A 3I53A 1FY7A 4AWXB 1H9GA 3F8NA 3EUHA 4M6YA 1TBXA 2YSRA 2LF8A 4OIRF 2D1VA 3TO6A 4EMSA 2WC2A 3ELKA 2M87A 5DUIA 3LAJA 1SFUA 2ESNA 3G3ZA 3ZMZA 1J5YA 2KIFA 5ICCA 5F1RA 2LNBA 1IN6A 4G7HF 3RPQA 3ZQ7A 3F6VA 2NS0A 2DW4A 1DPRA 2QQ9A 5D8LB 3V4GA 3GF2A 2LF7A 1IZ1A 1KU3A 2VOPA 2GIVA 3CUQA 1O3TA 4KUMA 3G73A 2OAZA 1O3QA 3L9FA 1BI0A 4GXOA 3WTSC 1ON2A 5LHGA 2ZKZA 1EH6A 3QPTA 4IF4A 2CSOA 5LHIA 1ZG1A 3MWMA 3SHFA 3DEUA 2MLKA 3ZMVA 1H0MA 3WTWC 2MH2A 4Y15A 5IT3A 5L3CA 1VTNC 3ZN1A 1SFEA 2D1HA 4HA8A 1XGMA 1JHFA 3RDIA 4AIKA 4O3MA 1EV7A 2GWRA 1GVJA 1CF7A 1W5SA 1JGSA 5DDGA 2EJRA 4IVNA 4AIHA 4NB5A 4EJWA 4KDPA 4K2EA 3K1PA 4WX9A 4AD9A 1ON1A 5E20A 4WK8F 4Q4ZF 3MFKA 4LG0B 3ERED 4YFXF 1W4MA 4CYDA 4LGWA 1IRGA 5E8GA 2VONA 5D8KB 1OKRA 4HV5A 5FGMA 1OPCA 1XDUA 1AWCA 4RGSA 1D3YA 5JR3A 3FXUA 4G6DA 2EK5A 4NHJA 2BYVE 2QYOA 4ZYDA 4M9SA 3N97A 3P9CA 2FBHA 1RIOH 1TQPA 4CGZA 3BJAA 4ASNA 3MQ0A 4G7ZF 4EM1A 4D0PA 2QUFA 4LK1F 3RKWA 2V9VA 3QP6A 4MGRA 2YX4A 3HSRA 3HRTA 1HKSA 2QENA 4EJUA 3GO5A 1XN7A 4L9JA 2FQ3A 3TDZC 4M73A 2BBYA 2ISZA 2K4JA 1YG2A 1YS6A 3LSTA 3V7SA 2EFOA 2OZUA 4WXHA 4LK0F 1MDMA 2L54A 3KP3A 2VBZA 2DU9A 3V8KA 2F5FA 4ZZLA 2A61A 4YFNF 2H6CA 2WTEA 6PAXA 2W85A 2V1XA 5LEKA 4EJVA 1AOYA 3GFIA 2YR2A 1S7AA 2IJLA 3K1NA 2HR3A 3GFJA 3WG9A 3M8EA 2EFQA 1LJ9A 2VN2A 3WE2A 2K27A 2E1CA 2MA3A 2QZ8A 1XD7A 5E8IA 3QAHA 4U0VA 5D4SA 4KIGA 4ENJA 2L4MA 1BN5A 3HYIA 3CLOA 5D6FA 4A0XA 1KU7A 2P7VB 4N9IA 2O6GE 2O0YA 1LNWA 2HGCA 3FWEA 3QPHA 1F9NA 4FX0A 1XSDA 1ZLJA 3NEUA 2W24A 1RNLA 5H6RA 1KGSA 2DAOA 1GXPA 2DPDA 2Y75A 2JSCA 2DK8A 1FC3A 4Q48A 5BOXA 3F8MA 3JTGA 2X0LA 3E3VA 1B9MA 3DV8A 1BI1A 2FA5A 3FM5A 1G4DA 4A2UA 3R4KA 1JXSA 5L3GA 1SD4A 1QZYA 5D5VB 4L9VA 3CUQB 3C3WA 5DEQA 3FXQA 4CZZA 3FMRA 2LSOA 3KP4A 2MH9A 2V79A 4KYWA 3P7NA 3E6MA 2D45A 4YIFA 2XKOA 1S3JA 2IA2A 4RB0A 2KJBA 3CTAA 3HSFA 4Z2YA 3AAFA 1O3RA 3KLNA 3ZPLA 3M7GA 2Q2EA 5AIPA 4UVCA 4HF1A 3LAPA 2YPRA 3PQKA 1CF7B 2RC4A 2O03A 3RYPA 1BJAA 4A5MA 2XROA 5HLIA 3JW4A 2NNYA 2M5WA 4E70A 3JSPA 1FSEA 1R5HA 3HHGA 1K6OA 2STTA 3GZ5A 4HX4A 1O57A 1QZZA 3SXYA 5A2QZ 1OYYA 5DUKA 2OD5A 3PQJA 3BOQA 2CGPA 4HLXA 4H0EA 3FMSA 1BI2A 1U5TB 5ILSA 4EM0B 5DD8A 3EQLF 3FF5A 3KZZA 2A07F 3F8CA 3WTXC 5J8CA 1FPQA 3FZVA 3RJPA 1QGPA 1HKQA 2DFIA 2XASA 3KFWX 5A2QK 4BAYA 2H09A 3HIFA 3FXRA 3HUGA 4EM2A 4U7DA 1WI9A 1O3SA 3RIRA 4HYEA 5BQTA 3B73A 2M1BA 1L3LA 4O6JA 2DK5A 1ZGJA 2KIUA 1R00A 2Z3YA 3C7JA 4CICA 1STZA 3COAC 2X4HA 1Q1HA 2Q8KA 1L0OC 2COMA 5DCMA 3O6BB 4I09A 3BP8A 5LRSA 3LQQA 1B9NA 5ICFA 2HDCA 2KIMA 3GW2A 3IC7A 5AONA 4XRFA 1DUXC 3BDDA 2G7UA 1ZG5A 2A6EF 2GA2A 4F7ZA 4N9HA 1HSJA 3WTVC 4BHCA 4LJZF 4XLPF 4KMFA 3V7RA 2UXXA 1XCBA 3J81Z 4HX7A 2Q0OA 4GGGA 3LQRA 2G9WA 3GVAA 2EFWA 3F22A 4N0BA 5JVTA 2GXBA 1Y0UA 3RKXA 4RB2C 1HQCA 3GEZA 3WTYC 1K79A 3JSOA 3L09A 4HQMA 2RVCA 5AIQA 4GYIA 4OMYA 3H3UA 3J81K 5HLHA 3BPVA 2RQPA 3LA7A 2H6BA 3R0JA 1FOKA 5HDNA 2XAJA 3F72A 2HZTA 1HKTA 4KNYA 3E5QA 5BPDA 3I5UA 1FNNA 4HZFA 4KT5C 2BV6A 3H3ZA 1YTYA 4G94A 3E6BA 1QNTA 2VODA 3HSEA 2D2WA 5IT9Z 4OIOF 2DLLA 1HBXG 5K1YA 2V1UA 1Z6RA 4A0ZA 1BBYA 3ZP5A 3HTUA 5KK1A 3B02A 1O7FA 4HF0A 1IW7F 5LLQA 4P96A 3LA3A 2RDPA 5FD5A 1T6SA 1G6NA 3VOEA 2F5EA 3EETA 3GUDA 4KN4X 5IT9K 4IHSA 1T38A 2P5LC 1YFHA 4L9NA 3GWZA 3IWZA 2JTVA 3WE3A 1XMAA 5CVIA 2W84A 3Q9SA 4IRIA 4U88A 2BE5F 3ECHA 3KP2A 3SFZA 2MLGA 2YU3A 1IAWA 3Q5FA 2DPUA 2VC1A 1BM9A 3F6OA 5JI6A 2FSWA 1EH8A 4UNOA 4UVAA 1U8RA 3FX3A 4IXAA 3TO7A 1FYLA 4P55A 4BH9A 2HFHA 1PP7U 2PMHA 2LDUA 1X3UA 1HSTA 4HOBA 4M9XA 2HTSA 3MEXA 3I0TA 4UHTA 3TGNA 1HW2A 2CO5A
chains in the Genus database with same CATH superfamily
4RB1A 3Q3SA 3GMEA 5HOOA 4RA2A 3HM5A 2GLOA 3LWFA 3O2PE 2A69F 1F4KA 5HVQC 1Q1VA 2P7CB 3H9QA 2DMQA 2JMWA 2Y48A 4BQQA 3WGHA 1MBKA 4HRIA 3QYBA 1BJZA 1J0RA 2EB7A 4MFEA 5KCMA 4C2UA 4HSTA 2HXOA 1VF9A 2E1OA 2HQNA 3BROA 2ZJ2A 3E1SA 1R4NB 4CHUA 3HOWJ 2IS2A 2A3SA 2ISYA 2VBXA 1ZK8A 3MZYA 3G6EI 1ZRFA 5D5WB 3CCLI 2EZLA 5FFZA 2QEXI 2LRDA 2IA0A 4PSXA 3RCOA 3PM1A 3CUOA 1R7JA 3CJRB 2Y0MA 4M3GA 4I6ZA 1FLIA 4R79A 5K5RA 3BC8A 4AYBN 2KKOA 3ESWB 3HXLA 1S8NA 2Z2SB 3SQNA 4O5VA 4J19A 4BHBA 5GAGJ 2XIGA 4M9ZA 4D9JA 4B09A 3P9KA 2HWVA 1VZ0A 1YO5C 5FO5A 3CCVI 3BJOA 2W25A 1WFXA 1R6RA 3MD2A 5FD6A 3IHUA 3U21A 3LL7A 5BMZA 1FIAA 2EZIA 3M8FA 3FMQA 1D5YA 1KU9A 1W5TA 1GHCA 3M8JA 4ON0A 1ZLKA 1MD0A 2BEOA 4BS9A 2ESHA 2CV2A 2H94A 4RGUA 4MQ9F 2ZSHB 3K0LA 2BY2A 2F6CA 3ECOA 1D8KA 2DA3A 4AUXA 1JE8A 1R36A 2M7AA 2VXDA 4IHYA 2HOEA 4B3AA 4RMNA 4S05A 3IAS2 1MKMA 1MJAA 4XM3A 2JPBA 1J2XA 4S04A 3K4CA 3F8FA 3ISPA 2GAUA 2HPMA 1Z91A 2X1CA 1S6LA 2OCCH 3S2WA 5LGTA 5HLGA 4FCYA 2V1NA 5EDNA 3D5LA 3LSJA 1DU0A 4DZPA 4G9YA 3OYJA 2BVLA 2QM3A 3W6KB 2LR8A 5DCMB 3FHNA 4L0YB 1FTTA 2VQCA 4BBSJ 2RNJA 3KEYA 2QQAA 4A3KJ 2DA4A 2FF4A 4XSZF 4RAFA 4HPQA 5E1ZB 3WODF 4UY8I 3VWBA 1H9TA 2FQ4A 1FEXA 5E3MA 4C2MJ 4Y13A 4DJAA 4BXXJ 1MIJA 1WVRA 4QLCU 4PJJA 4WF2A 4JP0A 2O7OA 1MNEA 2EZKA 4HDVA 2E2HJ 1TWFJ 3TW6A 1UELB 2XGXA 2IP2A 4A3DJ 1T98A 3E7LA 3L7WA 5GTIC 1JKQC 5TJJA 3S93A 2IVMA 5HS7A 2Y30A 1P4AA 1SFXA 1XCVA 4YFKF 2P6TA 1B8IA 1HXDA 2GXGA 1XPXA 1G3YA 3JRAA 3L2RA 3T0YA 2ZXHA 3KPHA 1TW2A 3GFLA 1OMIA 3GCMA 5CKTA 2L0KA 3ROUA 2BVMA 3DTEA 5KAIC 3VODA 4D1QA 1OYWA 5GTHC 1JJ8C 2PLYA 3JRFA 4BNCA 2VJ5A 3CCRI 1I6HJ 2MC4A 4RS8A 2B63J 1ETKA 5F64A 3HJEA 1S7OA 5M3FJ 4I98B 2HTJA 2I10A 2EA4A 2VC0A 2ADUA 3QP5A 1HW5A 2L3DA 5CVJA 4GCVA 2R93J 4LIUA 4RAZA 1OLTA 5EG0A 1VQLI 3G1OA 4IPAA 3W6VA 1IN5A 2ZMEC 1KONA 1X2MA 2MFZA 3GZ6A 2YS9A 2NVQJ 5KVRA 1QPMA 2EPFA 4CCMA 2ZMEA 3TP0A 1K7AA 4AIJA 1MNDA 2HQRA 3VPRA 1UMQA 4Y4RA 4EQQA 5K7ZA 1LUJB 4YEJA 3H92A 5J47A 2XC7A 5FLXZ 4X0GA 3N4MA 4DYQA 2LKXA 4ZTFA 2M30A 3DU5A 3JRCA 3RKYA 3K4LA 3TP3A 3U9GA 1X3ZB 3DBLB 2MC3A 2PMZA 2ZXJA 1WJFA 1IRXA 2W82A 3BR3A 1ETVA 5CQEA 5EF6A 1E2XA 1KQ8A 2OF7A 4IOCF 2DOFA 3HPHA 5M3MJ 4XICA 3CESA 3Q9VA 2C6YA 1JUMA 2ETHA 2F2EA 1ZELA 2XAHA 4JBAA 2NS7A 4WXCA 2DYRH 2F4OB 1KQ9A 4IJAA 1RI7A 3BJ6A 3C2HA 4E7ZA 1LEBA 1TQIA 1JUPA 1MZBA 4IQ4A 3TW7A 2VBWA 2OQRA 2OC6A 4I02A 4I0BA 1TT0A 3Q0WA 5FLXK 3D5SC 4XRMA 2DN0A 2WY7Q 4I7HA 1AHDP 1G3SA 1O7LA 1ORKA 2HNHA 2DI3A 4UV9A 5FKKA 1BC7C 4OIPF 1ZHFA 3ZMTA 4RGXA 3TO9A 3GLXA 3S1NJ 1D1AA 4R8HA 4EJOA 2M45A 4KIBA 1PJRA 3HEFA 3DKXA 1I50J 3OR2C 4ZJZA 3OYFA 4A69C 2XAFA 5E17F 2L7ZA 1QPIA 2WB1N 3KP5A 1DP7P 4XR6A 1O4XA 3F3XA 5H20A 2FRHA 1IXRC 4Y52J 2JRTA 3NQOA 2FMLA 1WH5A 2K02A 1WZ2A 3HGGA 1R1UA 4BJ5C 3FBIB 3MZ8A 3PFIA 1HF0A 1W7PA 1MW7A 3CCUI 5J3LA 2DFHA 2WA0A 3GYHX 2VKEA 4QWQA 4L5IA 3U2RA 5IOYA 1R1VA 4EGYA 2QF7A 1G3WA 3IWFA 3FDYA 1RETA 1U0JA 4M6VA 4DNCA 5C4XJ 4KFCA 2P5VA 1S72I 2V9PA 2E35A 3QU6A 1MBHA 5FB2A 3KETA 2EINH 1ZRCA 1MSFC 3W2AA 2EV5A 2OA4A 4BUPA 2R7SA 2OV7A 3RQIA 1FP1D 2HOAA 1VQ7I 5BS6A 1VI0A 2TDXA 3E6DA 3LMMA 4P9FA 1P4XA 3G71I 3S3NA 4B3XA 4XN0A 5KNLA 1BW5A 3KP7A 5J1YA 2VT2A 5LFAA 3CMEI 4F93B 4J00A 3L2CA 2V6EA 5FJ8J 1P6RA 4ZH4F 1LDKB 1QHGA 3NWTA 3DKWA 1VQOI 4L9TA 2VBYA 3OSFA 4YELA 4LFUA 3H35A 5JHUA 1IN7A 4FE4A 1A35A 4CH7A 1IUYA 4OINF 4EEFG 1I27A 3H0DA 1OCPA 2R92J 1MBJA 1E3HA 3K2ZA 4ESFA 1HW1A 5J6XA 3FHZA 4IHWA 4G6QA 1QHHD 1T56A 2CQNA 5LEJA 3FBNB 4CYCA 4XLNF 4WWCA 1I1SA 1FZPB 2LC2A 4XK4A 1TTYA 3ULQB 3A03A 2K3FA 3WTTC 1FT9A 4M72A 1T0FA 3BZ6A 1FWZA 4A3IJ 1JJ6C 2VASA 2W57A 5K5OA 1V54H 4A6DA 4BYYA 5M5WJ 3S2HJ 4BQAA 3FK7A 3R60A 4B43A 4BEHA 4Z6YA 4A3GJ 3Q0VA 2PI0A 4JOMA 5C44J 4E7LA 2OBPA 4XOPA 2BHZA 2DQRA 1GUUA 3BG6A 2Z16A 5J4VA 1WKMA 1X1DA 3K2AA 5CVUA 1MMGA 1IXCA 1ZG3A 1SD5A 4ZYHA 2MD5A 3CP8A 2H27A 1R4MB 4ENNA 2O8KA 1USSA 3BTIA 3C2BA 2BZTA 2RQQA 1YJWI 3S1RJ 1TWGJ 3OOUA 1R23A 1MDMB 2PEXA 1UG2A 1OJLA 1T08B 2UXNA 2X51A 3ZMDA 1XC5A 1TC3C 4A5NA 3JRIA 3BG7A 2IT0A 3QRFF 2K86A 5E79C 2ZNZA 4ZDOA 1GXQA 3QOPA 2FNAA 1CGPA 1W7PD 1C0WA 2NS8A 3F0CA 1SMTA 2YX7A 1IUFA 2FUG2 3A01A 2ID3A 2K5CA 2KHMA 3OOPA 3GXOA 4CXFA 5L3DA 2ZFUA 1KA8A 4BJTA 4MIMA 4PJ0C 1TT5B 1W0TA 1FSHA 1UHMA 2KT0A 2XAGA 4XOTA 2KFDA 4GFBA 3AL0C 2K9MA 3I4PA 1IJWC 4QPQA 2VE9A 3I58A 2LOOA 1RR8C 1IO2A 2L7KA 3JREA 5E3LA 4AIDA 3T1BA 2QLZA 1TQMA 4A3BJ 1MBGA 1JGGA 5EEGA 2VI6A 1OR7C 2ZJQF 2KRHA 1KU2A 4G7OF 2JUGA 1QQIA 4LIVA 1R22A 1UHWA 5ICGA 1SAXA 3CDIA 2G0EA 2BY1A 1Z9CA 2JA6J 3QYFA 1D5VA 2L02A 4CSWA 1R9TJ 1ZARA 3J7AY 2VL8A 5D6EA 4KISA 1X4PA 2OZ6A 1YW8A 1OYIA 2VXZA 4A3MJ 3VDXA 3U1DA 4FE7A 2K7LA 5E1WA 4KICA 4B1RA 1YIOA 3DP7A 1HOMA 2A68F 3ABTA 4RBOA 4RAGA 1FIPA 3MKWB 2RV8A 2TRTA 2F5DA 2CG4A 1MMDA 3NAUA 3DQVC 3X2QH 4DGWB 4S0HB 3OYEA 1U6GA 4Y7NJ 5BNGA 1FOYA 2BY0A 1JTXA 2L2OA 5FFXA 2CUJA 4LOCA 3K4NA 2O61A 2FE3A 2CS3A 2I8DA 2J5OA 2V7FA 3KZYA 1S9HA 4JX5A 4IEJA 4KJZA 2HVSA 1YRNA 2JSPA 3FKJA 3HOSA 1P4WA 4ANJA 2VQGA 4U7BA 1OISA 4MQVA 1MBEA 1SVLA 2CYYA 2HOSA 4HG2A 2KISA 4E7SA 3S15J 3SZPA 1YW7A 3F8BA 2PQ8A 5LBQA 3I56I 2OTJI 3FXLA 1F5TA 1EH7A 2IPQX 1IRFA 3CMMA 2XV4S 3CC7I 3ABUA 1R5GA 4I0AA 2ECCA 2HYFA 3J7ZI 1B1BA 3SDBA 4ZYAA 4KN7X 5D4RA 3F23A 2A6HF 2ZMEB 1UG0A 2O3FA 3CUQC 4FHTA 3T8RA 3GTKJ 2L7MP 4CCJA 3NARA 1UHSA 3VEPA 3ZMSA 1ULYA 2KL4A 2JT1A 5IOZA 1KQ0A 4OAYA 4NQWA 2RKHA 2VJJA 3BLYA 1IV8A 4B8XA 1E17A 4BQNA 5EZGA 3HKZA 4LB6B 1Z1DA 2DQLA 3H5AA 1DDNA 1OCZH 3OYIA 2JQ7A 3O8GA 2L7FP 1BIBA 2JPCA 1YI2I 3HHHA 3BT9A 3H0GJ 3I55I 1PDNC 1ZGAA 2BXYA 2LKPA 4W97A 4JQFA 4XBFA 5F0FA 5GADJ 1D8JA 4XLHA 3KX2A 1ZREA 4UUVA 2VQHA 3B6CA 3CCJI 3FISA 2EBIA 3PSIA 1W36C 1PVEA 5CYVA 5L3FA 2QVOA 2XPUA 5EYRA 2ZJRF 3L2UA 3CO7C 3CF2A 1Z77A 4DBRA 2ACJA 1QA6A 2HU9A 3RTRA 2A5YB 3BG9A 3VFZA 3BWGA 3DPLC 1T39A 4PGGA 2L9SA 1DGRM 1Z3XA 4UXNA 4MTEA 3VSKA 2JA2A 1LFPA 1ZAOA 4JX6A 4MNUA 2WV0A 2NYXA 2YU9J 2XF6A 4P1WA 1FBSA 2X6YA 2PG4A 3GTPJ 1GLNA 1J9IA 4A0YA 1LEAA 1RC9A 1TWHJ 2Z1DA 2BGCA 1MH4A 2P5KA 1LDJA 1YS7A 3ML6A 1RESA 4XKCA 2H1LA 2OQGA 3CCQI 1VQNI 4Q5SF 3BTLA 5CLSA 2NVXJ 4IHVA 1PUEE 5DD4A 4U87A 3S1MJ 2IW5A 4BDYA 5HDKA 4I01A 1YX3A 2DYSH 5IYCJ 1ZGWA 1W7PB 1Y1WJ 3CC4I 1TWAJ 3FXOA 3D1NI 2OJED 3HTSB 3OIOA 2F4MB 4NBQA 2LK2A 2ZXIA 3I59A 4HX8A 2HS5A 1LB2A 2IGNA 4ENMA 1N77A 2XGEA 1PP8F 1I1GA 3HRSA 4BXFA 3GFMA 2Y69H 4BACA 4KIFA 5FRMA 4L5JA 4CDGA 2NAZA 3CCMI 2QBYA 1U5TC 1LVAA 4EJTA 2AHQA 2E5ZA 2CJJA 5DCFA 3M9AA 1RUNA 3KE2A 2NNNA 2R7DA 1APLC 1BIAA 1U5TA 1TLHB 1J75A 1Z6TA 4CUGA 4ETSA 3IRQA 2HEOA 3I64A 1U78A 4RGRA 5F0CA 1MJ9A 3GLLA 3WHCA 4F52A 2V9KA 3FM3A 1ONVA 1IXSB 2HKOA 1F36A 1TZLA 4LMYA 3F21A 4BE1A 3CDHA 2DCEA 1U9NA 1I5ZA 3OV8A 3VSLA 3WGIA 2K9NA 1SC7A 1FBUA 2AS5F 2NXNB 3E5UA 2PJRA 4X6AJ 2E2JJ 1Y8QB 4HAMA 3L2VA 1JI8A 3HPGA 5F6FA 5IYBJ 2EFNA 2Z5UA 3K9TA 3OYMA 4F55A 5ICEA 1QO0D 4W1UA 4ZZDA 2RREA 3K70C 2QWWA 4OIQF 2WAEA 1YE9A 3PO2J 1IN4A 5JLXA 1LQ1A 5EEHA 5DM6F 1U2WA 2QQBA 1W0UA 4FX4A 2DXIA 1DQUA 1P92A 2CWEA 4MFDA 1REPC 2JVHA 4CYCB 2E71A 3AKZA 2XVCA 4YIIA 2JA8J 1XB4A 1Z7UA 2ZNYA 3HUGB 3I3LA 3ABLH 4Y17A 5FKLA 3LSMA 4LLGF 4A6EA 1YLFA 1OCCH 5HNFA 4YG2F 1IN8A 2E2IJ 4I2OA 2IGMA 3W6JB 2CW0F 1KZHA 3KYLA 4E4HA 2E19A 1W36D 1V4RA 3BPXA 3TDUC 1A31A 1T95A 2UZKA 1MGTA 1MMAA 2EILH 4HF2A 2XUBA 3EUAA 4A3EJ 1FOXA 2KJCA 4IHTA 3A2KA 1XSXA 4FT8A 3IH2A 3KLOA 1D0XA 4A3JJ 3CO6C 3V7CA 4C3IJ 1K78A 2CV0A 3M1EA 2ZSIB 4LLNA 2XGDA 1RZ4A 3IKTA 4V19K 3GZNB 4DBQA 1TNTA 2P8TA 2OU2A 2L01A 3ZQIA 3SZTA 1FP2A 1WRJA 1WWXA 2N8GA 3VYRB 2EV0A 4PZJA 1TNSA 2R4GA 1Y0NA 2O5RA 4RM2A 1Z05A 4ESBA 3WU1B 2R7UA 1S29A 1R58A 4LB5A 1JT0A 2FXAA 3A01B 1A04A 2HKXA 2X85A 3BTJA 1X4OA 1RRJA 3K1MA 3K4MA 2FEZA 2VPLA 1WJEA 1P7JA 1X1BA 3UNGC 2AXLA 3BR2A 1UAAA 5D5UB 2DOEA 2B0LA 2PFBA 2AO9A 2CQKA 2UUZA 3VYUB 2QSHX 4M74A 1FBQA 3DTIA 5LGNA 1QBJA 3E97A 3TOAA 5DV5A 2QCOA 5HLTA 2ZCWA 2K9QA 2JZYA 5E1XA 1BR1A 3OYKA 5CVVA 3I4NJ 4QTRA 3KCCA 3ONQA 3R6SA 4M3BA 4U0WA 4ZC3A 4GYGA 5ILUA 4I76A 3J7AO 5C4JJ 2XDVA 1BR2A 4PK4A 3OYNA 3IH3A 3OYGA 3PNVA 4M71A 5L3BA 2JVGA 3R61A 3S14J 3D0SA 4A3FJ 5LHHA 2X9DA 4DQ2A 3WU0A 3IUOA 2QSGX 4PCQA 3IRRA 5TRDA 5KHDA 3OL3A 1W5CC 2L4AA 3CP2A 1NTCA 1ZH5A 4PUSA 2GZWA 2MYSA 3BQZA 1IDYA 5E18F 1B6AA 3K70D 3RQ4A 2MGQA 3HRMA 5F0HA 4OMZA 5J4YA 3NRVA 2NOGA 3DPTA 3HOZJ 3ZXSA 4LG3A 2UWMA 2E7XA 2G7HA 2GOMA 2ELHA 2W4SA 2CRGA 2XKPA 1JUSA 2GQQA 3CZ6A 4WXDA 5D5XB 5BPIA 9ANTA 1LKXA 3OIQA 2EA2A 4EGZA 1ERDA 4HNTA 3CMAI 5DYMA 4ZTJA 3W3CA 1P9QC 3JAMZ 3DTKA 5ED4A 4JYKA 5L3EA 3OYBA 4HEA2 4L0ZB 1NHAA 3RYRA 4UVBA 1XGNA 3GTGJ 2WWYA 1I6XA 2XAQA 1B4AA 2Y0SA 4M3FA 4A3CJ 5FROA 1ZYRF 1UFMA 3V8JA 2DA1A 5M5YJ 1VFCA 5JFRA 2WBMA 2MBFA 1UCRA 4UUTA 2MABA 4G8XA 2PN6A 1PYVA 2FNPA 2WB1A 2XPWA 3MAJA 2VJ4A 3WTUC 1GDTA 3MKLA 3PNTA 1BC8C 1EA3A 1F1ZA 2GBYA 5H6QA 1SAUA 5HS8A 1A36A 3WGGA 4LD5A 1YJ9I 5FLMJ 3JAMK 2RN7A 3DLLF 2ZBKA 1GT0C 3HL2A 3OYCA 4XLCA 2WADA 1G8XA 3PIOF 2XSDC 1WJDA 1J7KA 2FU4A 4OOIA 2DMNA 4IRGA 3TOBA 2NVTJ 4Y33A 1T8IA 2GA1A 3CC2I 4XLEA 2XB0X 2YUSA 1NG6A 4PDKA 3ZQCA 3DU6A 2NRAC 4BHPA 4IQJA 3A4CA 3OMYA 2Z9OA 2EFPA 2PMZN 5IP9J 4HDUA 5F1JA 3QU3A 4Q47A 4R1HA 1S5LC 3S3OA 1ZQ3P 2M4KA 4HV6A 4XKWA 3CCSI 2ME0A 1FYMA 2EWNA 1ETWA 2LVSA 1V3FA 3BR1A 3VB2A 3LOCA 1UB9A 2GM4A 1T2KA 3BTCA 2VJIA 1N75A 4UV8A 2HYJA 4AC0A 4LG0A 4M6XA 3T5XA 1U8BA 1JTYA 1SD7A 2VOOA 2E1NA 1PUFB 4TV7A 3EYIA 2DO7A 3H1CA 1YQAA 2FBKA 1WJBA 3CJNA 1ACIA 3GTJJ 2J5PA 1XDSA 3S8PA 5EEAA 4HLYA 1RUOA 4GO1A 1YW9A 3RKQA 1FYKA 3S1QJ 2JJ7A 3SZGA 4ZYEA 1LE8A 3ABKH 1SVOA 1DU6A 3MZHA 5GPAA 2HYGD 1YYVA 4RB3C 1LDDA 2FBIA 3FK6A 3KIOA 3LSGA 4II2A 3HOTA 3I71A 3NWSA 5LRRA 3HDDA 3IKVA 4AVPA 4KMUX 3BZCA 5KAFC 3KEOA 3DWLE 2A05A 3I59B 1ETQA 1SMYF 1XMXA 2P6SA 4IRHA 1BOAA 4HW0A 5LGUA 2DTRA 1JHHA 1SFKA 1WQ2A 4A12A 5CJ9A 1USTA 5CVRA 2DA2A 2O8XA 2M8EA 4DIQA 4V2FA 2FMYA 3O3KA 2LTPA 4HQEA 2WAQA 3EDPA 3I9V2 3E5XA 1SD6A 2DOAA 3A0BC 2K4BA 3KEQA 1VQPI 2QBYB 2X6OA 3L2WA 3K69A 4PFPA 4CCLA 3OR1C 3DXJF 3KP6A 2COBA 3QPLA 2DA5A 1Z21A 2PMUA 4P5OA 1QU3A 4MEYF 1FTZA 2ZFWA 5ILVA 2ID6A 4PGHA 4EV0A 1IF1A 3L1PA 1WGXA 1XGSA 2KRCA 2R7FA 2V6CA 3HRUA 1ODDA 2IA1A 1J59A 3HOUJ 3J80Z 2XHKA 3PSFA 4WCGA 2STWA 1XSVA 3C18A 2QSFX 2KDZA 3K4JA 3LFKA 4BY7J 1GVDA 1MJBA 1S7EA 4X1EA 2V1DA 5IYDJ 2LFBA 3IL2A 5FLVA 5J1UA 5GPCA 5GAHJ 3EPZA 3WTZA 4XLFA 1ZRDA 2L9VA 2VE8A 4MTDA 4C3HJ 1X3WB 4EVIA 4DOZA 3P9IA 2R3SA 4V2GA 2KP6A 1ZR4A 1BI3A 1R1TA 3KZIC 4ENKA 1ETOA 2E7WA 3VYSB 3OYHA 3LFUA 4KA4A 5HS9A 5K5QA 2LH9A 3MCZA 2W7NA 3E6CC 2KIQA 3QODA 3WU2C 1R71A 3TMOA 4OU0A 2VUMJ 1FJLA 2RGVA 4RDUA 4D7MA 3I54A 3J80K 2QQ8A 4E7JA 2VT3A 3ZCOA 5EGOA 3OWTA 2HDDA 4C3JJ 2BXZA 2F5CA 5HNHA 3GX4X 2P4WA 4ESJA 3M3YJ 1XMKA 2HQ5A 2PJPA 3G4SI 2KMUA 3C1DA 2LY9A 2DBBA 4CO8A 1KYWA 2PBIA 2XRNA 1UJ8A 5J8FA 3S16J 3V8LA 3BY6A 3EYYA 1I3QJ 3FXMA 1U3EM 4MEXF 1GV5A 3DFGA 3RI4A 1K61A 2DT5A 3T8TA 3LA2A 2F4IA 2ZO4A 2IGKA 3TQNA 3ABMH 2FOKA 5TISC 1G3TA 3ZMUA 2VKVA 1P2FA 2XF5A 1ZN2A 4HBLA 3LSHA 3U1KA 4P9UA 1K78B 1WJCA 3S2DJ 1XGOA 1V5GA 1HLVA 1VQKI 3KYDB 4IOAF 4BDZA 3R0AA 3DF8A 4M3DA 4AVZA 4U0YA 4Y3OA 4BXUA 4MHGA 2Z33A 1WSUA 2JUCA 4XSXF 1AA7A 1OR7A 3TKYA 1CQTA 3L00A 2EIMH 3RPUA 2Z99A 2KRFA 3J7YJ 1KYZA 2UV1A 3JTHA 3REOA 4PFOA 1K4SA 1H8AC 1IG7A 4JK1X 4RAYA 2IRFG 5ERIA 2CFXA 3DKYA 1K4TA 4F3QA 3LSKA 4LLLA 1DPUA 2EV6A 2HQAA 1P7IA 2M7BA 1B8IB 1FX7A 2X6XA 4JX4A 1A6QA 2XF7A 3ZN0A 4ZYGA 4L18B 5HDGA 1A5JA 1TW3A 1GV2A 2KPMA 2IBDA 3EUHC 1B59A 3I53A 1HC8A 1FY7A 4AWXB 1H9GA 3H5RA 2NVYJ 2ZC2A 2W1OA 3F8NA 2LMDA 1MNMC 3JRDA 2TCTA 3EUHA 1Y8RB 2JA7J 4M6YA 1TBXA 2H1KA 3PIPF 2YSRA 2LF8A 4OIRF 3DEWA 4GRIA 1MSEC 2CH0A 2D1VA 1QVUA 4D7NA 3TO6A 4EMSA 2WC2A 3ELKA 3HG9A 1Z7LA 2M87A 2ICWG 1OQYA 5DUIA 3LAJA 1SFUA 3DLAA 2KQRA 2P81A 3JR9A 2ESNA 2Y9YA 2VQLA 3G3ZA 3ZMZA 5DM7F 1J5YA 1SANA 5EG0B 2BW3A 2KIFA 1LPQA 5ICCA 2LBFA 1I39A 4XRSG 5F1RA 2LNBA 2HI3A 1IN6A 1DP3A 2R5YA 2X1EA 2R7TA 4G7HF 3RPQA 3ZQ7A 3F6VA 2CQXA 2NS0A 2DW4A 3DBHB 1M1EB 1DPRA 3OS1A 2QQ9A 5D8LB 4XIDA 2LLKA 3M1CA 3V4GA 3GF2A 2LF7A 3H3VK 3M07A 1IZ1A 2BOLA 2DMUA 3DCFA 1JT6A 1KU3A 2DDBA 2VOPA 2I5UA 4PSWA 2GIVA 3CUQA 1O3TA 1POGA 1WJAA 3OYLA 1G2HA 2R7QA 4KUMA 2HVQA 2R5ZA 1A6IA 4PJLA 1EKEA 3G73A 3JRGA 2OAZA 2M3AA 1O3QA 1N78A 3L9FA 1RKTA 2AXTC 1BI0A 4GXOA 3WTSC 1ON2A 5LHGA 2ZKZA 5F27A 1EH6A 3QPTA 4IF4A 3MKYB 2CSOA 5LHIA 2QKLB 1ZG1A 4HNVA 2EZHA 3MWMA 1SFOJ 3SHFA 3DEUA 2IS4A 1RR7A 1E3PA 2BY3A 2MLKA 2NOJB 3ZMVA 1H0MA 3ZRGA 3WTWC 2MH2A 4Y15A 5IT3A 5L3CA 1VNDA 5K7HA 2DJNA 3QYEA 1VTNC 3CCEI 3ZN1A 2DJIA 1SFEA 2K9LA 4PJMA 2K9SA 1FMVA 3BR5A 2D1HA 3ZQHA 4HA8A 1XGMA 3V42A 2GOXB 1ETXA 1JHFA 3RPUD 3RDIA 4AIKA 4O3MA 1EV7A 5TGTA 2GWRA 1GVJA 4NC6A 4M3EA 3UKGA 1CF7A 1BL0A 4C2TA 1W5SA 3D5RC 2GXAA 1JGSA 5DDGA 1U9OA 1MMSA 2FJ1A 3G1MA 2EJRA 4IVNA 3HKZN 4AIHA 4NB5A 3HOVJ 4EJWA 3OY9A 4KDPA 4K2EA 3ASOH 3K1PA 4WX9A 2CUFA 4J01A 3H9GA 2W00A 4AD9A 1ON1A 2DFEA 4HSRA 5E20A 1X1PA 4N4NB 4WK8F 4Q4ZF 3MFKA 4LG0B 3LSPA 2L9NA 3ERED 4YFXF 1W4MA 4CYDA 4F92B 4LGWA 1D1CA 4AYBA 4QIWN 1ZR2A 1IRGA 2OPTA 5C3EJ 5E8GA 2VONA 4CZCA 5D8KB 3N05A 1OKRA 4HV5A 5FGMA 1YHQI 3CJQB 3HB9A 4YRVA 2B7EA 3JRBA 3ASNH 1OPCA 1XDUA 1AWCA 2CQQA 4RLFA 1LE8B 4RGSA 2L5QA 1D3YA 2OCEA 5JR3A 3FXUA 4G6DA 1E3OC 1VQ5I 2EK5A 4CCKA 4NHJA 2BYVE 4IO9F 2QYOA 4ZYDA 2V4JC 2BHYA 4M9SA 3N97A 4GDFA 2DT6A 3P9CA 1DGWY 1HA8A 2FBHA 1RIOH 1HCRA 1TQPA 4CGZA 3SDGA 3BJAA 4BY1J 4ASNA 3MQ0A 4G7ZF 5IY5H 4EM1A 4XN3A 2VKHA 4E7KA 2ELJA 4D0PA 2QUFA 4LK1F 3RKWA 2V9VA 3QP6A 4RLQA 2KZVA 2CV1A 4MGRA 2YX4A 3HSRA 3HRTA 1G59A 1HKSA 2QENA 4EJUA 3GO5A 5LD2C 2X48A 1Y1VJ 1NG7A 1XN7A 4L9JA 3K10A 2FQ3A 3TDZC 2IS6A 4M73A 3M4OJ 1MMNA 2M0MA 3SEZA 1WPKA 1XTAA 4KITB 2BBYA 1AU7A 2EIKH 5CPRB 3BG5A 3QWLA 4NC7A 1YITI 1JKOC 4XKVA 1BOBA 3KYCB 1R49A 2F5VA 3IV5A 2A6TA 2K4JA 2ISZA 1YG2A 2RAEA 4BEHB 1YS6A 3LSTA 3LSIA 2EFOA 4XORA 3V7SA 2V26A 1LFBA 2OZUA 4WXHA 3IAM2 2XB5A 4LK0F 5GP9A 1MDMA 3CCYA 2QA4I 2L54A 2NVUB 1XG1A 2CU7A 3MVPA 3KP3A 4UB8C 5IP7J 4BE2A 2LY1A 2VBZA 2DU9A 3TL4X 3V8KA 2DTZA 2DA7A 3P5JA 2F5FA 3IH4A 2E60A 4ZZLA 3BR6A 2A61A 2JA5J 4YFNF 2H6CA 2WTEA 6PAXA 2W85A 1TWCJ 2V1XA 4BGDA 5LEKA 5EGOB 4YIRX 4EJVA 1AOYA 4NDLA 3GFIA 2YR2A 1I3AA 1S7AA 4OWRB 2IJLA 3BG3A 2M0CA 3K1NA 2HR3A 1YIJI 3GFJA 3W2WA 3SYTA 3WG9A 3ERMA 3H9JA 3M8EA 5J40A 2EFQA 1LJ9A 4ITVA 2VN2A 3K6GA 3WE2A 2K27A 2E1CA 4XQFA 2MA3A 3DEEA 2M4GA 3I4MJ 2QZ8A 1XD7A 3GTLJ 3AL0B 3MMYB 1RPWA 3C2GA 3LNQA 5E8IA 3QAHA 2ZJPF 3OS0A 4U0VA 1YJNI 3S32A 2LYCA 5D4SA 4KIGA 5JHFA 2E1MC 2D5VA 4CA0A 5FKNA 3DPUA 1D0YA 2L4MA 4ENJA 1BN5A 3PUFA 4NNJA 3HYIA 3CLOA 5D6FA 4A0XA 4IX7A 1Y39A 1KU7A 2P7VB 4N9IA 3BZKA 2O6GE 2ELKA 2O0YA 1LNWA 4D5CA 1BA5A 4BJ6C 2H8RA 2HGCA 3JRHA 3FWEA 3QPHA 1F9NA 4BBRJ 2MSYA 4FX0A 1XSDA 1ZLJA 2M8GX 2DA6A 3NEUA 1TL8A 2ECBA 2W24A 2WAFA 2LKSA 1RNLA 1W1WE 5H6RA 4C9YA 2IS1A 1KGSA 2DAOA 1GXPA 1B72A 4UB6C 4OAZA 2DPDA 2M2EA 2Y75A 1LVKA 2JSCA 3AG4H 1YRNB 2FOWA 4B47A 2R7WA 2KLOA 1ZTRA 2O9LA 1YOVB 2DK8A 1FC3A 3MKZA 1X1CA 4Q48A 5BOXA 3F8MA 2JN6A 3JTGA 2X0LA 2BW3B 4N4OB 3PO3J 2GIZA 2LBFB 1Z0XA 4HNUA 5B5EC 2R5YB 3E3VA 1B9MA 4AM3A 3DV8A 1BI1A 1D1BA 4E6KG 2FA5A 3FM5A 1G4DA 4A2UA 3R4KA 1J09A 3MN2A 5GAEJ 5EZHA 1JXSA 5CQGA 4XLAA 4XONA 5L3GA 1SD4A 1QZYA 3ZGKA 5D5VB 4L9VA 3BCAA 1MH3A 2F48A 3CUQB 2E5NA 3C3WA 5DEQA 3FXQA 4NQWB 4CZZA 3PUBA 2XSJC 3FMRA 1V5FA 2JWTA 2LSOA 2MH9A 2V79A 3IP4B 3KP4A 2R5ZB 4A93J 3FXKA 4MLOA 1FMWA 4CCNA 4KYWA 3P7NA 2HOTA 1T33A 5IPAA 3E6MA 2D45A 2K40A 1LFUP 3PJRA 3JCUC 4YIFA 3B6AA 2AQFA 4LITA 4UUSA 2XKOA 2R0QC 3WHBA 1S3JA 2HXIA 3AFHA 3QPSA 1OCTC 5JLWA 1IGNA 2L9RA 2Y0SN 2XPVA 2IA2A 5B66C 4IKFA 1ETYA 1R5ID 4RB0A 2MG4A 2KJBA 3CTAA 3HSFA 3G2BA 4Z2YA 3AAFA 1O3RA 3KLNA 3ZPLA 5JVGF 2WY8Q 3GTQJ 1Z67A 4C30A 3M7GA 4II3A 2Q2EA 5IP6A 5AIPA 4UVCA 5M5XJ 2QKMB 1AKHA 4HF1A 2WV1A 4BQOA 1OCRH 4XRSA 4BE0A 3LAPA 2YPRA 2CW8A 1TP4A 4NUBA 3K4BA 3PQKA 5FKOA 1CF7B 2RC4A 3VYTB 2O03A 3RYPA 1BJAA 2CUZA 4A5MA 2XROA 2LD5A 2HVRA 5HLIA 3JW4A 2NNYA 2XRLA 4QSHA 1VQ4I 2M5WA 4E70A 3PNYA 3AG3H 2IAIA 3JSPA 1FSEA 1R5HA 3TEDA 3HHGA 1K6OA 1D0ZA 2STTA 3GZ5A 2CFOA 1BW6A 4HX4A 3OYDA 1O57A 4DW6A 1QZZA 2DMPA 3SXYA 5A2QZ 1OYYA 4DYCA 5DUKA 2OD5A 3PQJA 2DT7B 3BOQA 2CGPA 3K7AJ 4HLXA 4H0EA 3FIWA 3FMSA 4NC8A 3FXJA 1QVTA 1BI2A 3S17J 4IZZA 1U5TB 5ILSA 3QQAA 4EM0B 3CLQA 2IXSA 3HZJA 4MO7A 5DD8A 3EQLF 3FF5A 3KZZA 1OFCX 2KDOA 2A07F 5FRNA 3F8CA 3WTXC 3A0HC 2ME6A 5J8CA 1FPQA 2JRMA 2VPRA 3FZVA 2PJRB 3RJPA 1H89C 5B1BH 2MD0A 1JKPC 1QGPA 1HKQA 3RZDJ 2DFIA 2XASA 1T0FC 1IRZA 3KFWX 5A2QK 1FOWA 4BAYA 3CF5F 2LG4A 2H09A 3HIFA 3FXRA 3HUGA 4FASD 4EM2A 2LP0A 4U7DA 3OIPA 3SFIA 1WI9A 3HC7A 1O3SA 3RIRA 4HYEA 5BQTA 1VQ8I 3B73A 2M1BA 1L3LA 4O6JA 1HDPA 1VQ9I 3FKIJ 2DK5A 3F9KA 3A1YA 1ZGJA 2KIUA 1R00A 2WAQN 2EIJH 2Q1ZB 2Z3YA 1E0EA 1BR4A 3C7JA 4XKBA 4IL6C 2VLAA 4CICA 1HDDC 4E7HA 1STZA 3COAC 1SVMA 2X4HA 2EH3A 1QZEA 4FETA 5FKMA 3OL4A 1Q1HA 2Q8KA 1L0OC 2COMA 3W2VA 3ZQGA 5DCMA 3O6BB 3Q0UA 3BP8A 4I09A 5F04A 2H8WA 3CJTB 5LRSA 3LQQA 1ITYA 2Y31A 1B9NA 3CD6I 4FISA 3WG7H 2LY2A 5DTDA 2R7VA 3ZQLA 4L5EA 2CMPA 5ICFA 2HDCA 2VKDA 2KIMA 3GW2A 1X19A 4RM3A 3IC7A 3PFYA 5AONA 4XRFA 1DUXC 3BDDA 2G7UA 1ZG5A 2A6EF 2GA2A 4F7ZA 4FTHA 4N9HA 1HSJA 3WTVC 4ZDPA 4BHCA 2CQ7A 3OSGA 5E3OA 4LJZF 2R7XA 4XLPF 4KMFA 1K83J 3EUKL 2FD5A 3S3MA 3V7RA 2UXXA 2VB6A 1XCBA 3J81Z 4HX7A 4E7IA 4F91B 2KZGA 2Q0OA 4B4CA 2QGUA 4GGGA 2HZDA 3LQRA 1JKRC 2G9WA 3GVAA 2EFWA 1IC8A 1VQMI 3F22A 3OS2A 4N0BA 3OYAA 2CUEA 5JVTA 1EF4A 2GXBA 1Y0UA 2FX0A 3RKXA 3LSRA 2OTLI 3HOYJ 4RB2C 1RKWA 1HQCA 2DDAA 4A3LJ 3GEZA 3WTYC 1K79A 2P0WA 3JSOA 1X1AA 3L09A 4HQMA 1NK2P 2RVCA 3H5NA 5AIQA 3DBRB 4D5FA 2X6WA 3A02A 4GYIA 2IEKA 4OMYA 3H3UA 3CQZJ 1H88C 3J81K 2M9HA 4IHXA 5HLHA 5F08A 1X58A 3BPVA 2HDWA 2RQPA 3LA7A 2H6BA 2E1MB 2R7RA 3R0JA 1FOKA 4XNFA 5HDNA 1EJ9A 1ZKGA 2K85A 2IGOA 2XAJA 3ZQQA 3F72A 2HZTA 2B9SA 2JK3A 2W48A 4BL0B 1HKTA 3GTOJ 4DYRA 3PL8A 4KNYA 3E5QA 5BPDA 3I5UA 2E36A 1FNNA 2E34A 4HZFA 4KT5C 2BV6A 1ENHA 3BQYA 3H3ZA 1YTYA 4G94A 1QRYA 1Y6IA 3E6BA 1QNTA 1B72B 1YX5A 2M34A 5HODA 2VODA 3UR3C 3HSEA 2D2WA 4DZJA 2VIXA 2X1DA 3CDLA 3ZOBA 5IT9Z 1V5EA 2MW8A 2R7OA 2DFFA 2HPIA 2EQRA 4OIOF 2DLLA 2ZXWH 3G1LA 1K6YA 1HBXG 5K1YA 2OUMA 3E0JB 2V1UA 1N25A 2A5WA 1WJ5A 2DODA 1Z6RA 4A0ZA 1BBYA 3ZP5A 3HTUA 1VQ6I 5KK1A 3HBLA 3SEQA 3B02A 1NH3A 1O7FA 2XAUA 4HF0A 3CMYA 1IW7F 5LLQA 1WI3A 4P96A 2RNGA 3HGYA 3ZQFA 4KT6A 4EATA 3LA3A 2RDPA 5FD5A 1XS9A 1WH7A 1T6SA 4G6TB 1G6NA 2Y9ZA 4XMYA 4QPOA 2XGCA 3VOEA 2F5EA 5E3NA 3EETA 3GUDA 2PX9A 3BCBA 3O8HA 2LREA 3QOEA 4KN4X 3TBIA 5IT9K 4IHSA 3K4KA 1T38A 2P5LC 3GBGA 4B48A 1YFHA 1NK3P 4L9NA 3GWZA 2ZB9A 3IWZA 3L2QA 2JTVA 5J1RA 1IDZA 4BU2A 3WE3A 1XMAA 3AG1H 2K3PA 5CVIA 5B3SH 2W84A 3Q9SA 4IRIA 1X2NA 4U88A 5DS9A 2BE5F 3ECHA 1XX5A 3SJMA 3KP2A 3SFZA 1MBFA 4H4KC 3BR0A 2DMTA 2MLGA 1Z3YA 2YU3A 4UUSB 1SEUA 1IAWA 3Q5FA 2DPUA 2VC1A 1PUFA 1BM9A 2Y2ZA 1F43A 1OCOH 1WHUA 3F6OA 4B44A 5JI6A 5B1AH 2FSWA 4PJNA 1V55H 1EH8A 4G12A 4UNOA 1IV6A 4UVAA 3RZOJ 4XL9A 1Y56A 5EJCA 1U8RA 3FX3A 4IXAA 3TO7A 3H36A 4P55A 1FYLA 4BH9A 3RSNA 2Q2EB 2HFHA 2AQEA 4CCOA 1AKHB 3AG2H 5H2FC 1PP7U 2PMHA 4FQGA 3ZR8X 2LDUA 1UZCA 1X3UA 1HSTA 1WCMJ 4HOBA 4ABZA 4ZDLA 4M9XA 2HTSA 3MEXA 4AU7A 3HOXJ 4I99C 3I0TA 5K7FA 4BKXA 4UHTA 3GTMJ 3TGNA 2R7ZJ 2CW7A 1HW2A 2CO5A
chains in the Genus database with same CATH topology
4RB1A 5HOOA 3LWFA 3O2PE 2A69F 1F4KA 5HVQC 2P7CB 2Y48A 3WGHA 1J0RA 2EB7A 2HQNA 3BROA 2ZJ2A 4CHUA 2A3SA 2ISYA 2VBXA 3MZYA 1ZRFA 5D5WB 5FFZA 2IA0A 3CUOA 1R7JA 2Y0MA 1FLIA 4R79A 5K5RA 2KKOA 1S8NA 3SQNA 4O5VA 4BHBA 2XIGA 4M9ZA 4B09A 3P9KA 2HWVA 1YO5C 5FO5A 3BJOA 2W25A 5FD6A 3IHUA 5BMZA 3M8FA 3FMQA 1KU9A 1W5TA 1GHCA 4ON0A 1ZLKA 1MD0A 2BEOA 2ESHA 2H94A 4RGUA 4MQ9F 3K0LA 3ECOA 1D8KA 1JE8A 1R36A 2HOEA 4S05A 1MKMA 1MJAA 2JPBA 1J2XA 4S04A 3F8FA 3ISPA 2GAUA 1Z91A 1S6LA 3S2WA 5LGTA 5HLGA 3D5LA 4G9YA 2QM3A 3W6KB 4L0YB 5DCMB 2RNJA 2QQAA 2FF4A 4XSZF 5E1ZB 3WODF 1H9TA 4Y13A 4QLCU 4WF2A 4HDVA 2XGXA 2IP2A 1T98A 3L7WA 5TJJA 2IVMA 5HS7A 1P4AA 1SFXA 1XCVA 4YFKF 2P6TA 1HXDA 2GXGA 1G3YA 3T0YA 1TW2A 3GFLA 1OMIA 3ROUA 3VODA 1OYWA 2PLYA 4BNCA 4RS8A 5F64A 1S7OA 4I98B 2HTJA 2EA4A 2VC0A 2ADUA 3QP5A 1HW5A 2L3DA 5CVJA 4GCVA 4RAZA 4IPAA 1IN5A 3GZ6A 5KVRA 1QPMA 2ZMEA 1K7AA 4AIJA 2HQRA 4EQQA 3H92A 5FLXZ 3N4MA 2M30A 3RKYA 3U9GA 2MC3A 2ZXJA 1E2XA 1KQ8A 3Q9VA 2C6YA 2F2EA 2ETHA 4JBAA 2XAHA 4WXCA 1KQ9A 4IJAA 1RI7A 3BJ6A 1LEBA 1TQIA 1MZBA 2VBWA 2OQRA 4I02A 4I0BA 5FLXK 4I7HA 1G3SA 1O7LA 2DI3A 4UV9A 1BC7C 4OIPF 1ZHFA 3ZMTA 4RGXA 3TO9A 3GLXA 4R8HA 4EJOA 2M45A 4KIBA 2XAFA 5E17F 3KP5A 1DP7P 3F3XA 5H20A 2FRHA 1IXRC 2JRTA 3NQOA 2FMLA 2K02A 1R1UA 3PFIA 1W7PA 3GYHX 4QWQA 3U2RA 4L5IA 1R1VA 4EGYA 3IWFA 1G3WA 4DNCA 4KFCA 2P5VA 3QU6A 5FB2A 1ZRCA 3KETA 2EV5A 2OA4A 1FP1D 5BS6A 2TDXA 3E6DA 4P9FA 1P4XA 3KP7A 2VT2A 3L2CA 1P6RA 4ZH4F 1LDKB 3DKWA 4L9TA 2VBYA 4LFUA 5JHUA 1IN7A 1IUYA 4OINF 1I27A 3K2ZA 4ESFA 1HW1A 5J6XA 3FHZA 4G6QA 5LEJA 4WWCA 4XLNF 1I1SA 1FZPB 1TTYA 3ULQB 3WTTC 1FT9A 4M72A 1T0FA 3BZ6A 1FWZA 2W57A 5K5OA 4A6DA 4BYYA 4BQAA 3R60A 2PI0A 2OBPA 2DQRA 1WKMA 5CVUA 1IXCA 1ZG3A 1SD5A 4ZYHA 2MD5A 2H27A 4ENNA 1USSA 1R23A 1MDMB 2PEXA 2UXNA 3ZMDA 4A5NA 2IT0A 3QRFF 2K86A 2ZNZA 1GXQA 3QOPA 2FNAA 1CGPA 1W7PD 1C0WA 1SMTA 2YX7A 3OOPA 3GXOA 4CXFA 5L3DA 1KA8A 1FSHA 1UHMA 2XAGA 3I4PA 2VE9A 3I58A 3T1BA 2QLZA 1TQMA 5EEGA 1KU2A 4G7OF 1QQIA 1R22A 1UHWA 5ICGA 1SAXA 1Z9CA 1D5VA 2L02A 1ZARA 5D6EA 2OZ6A 1YW8A 1OYIA 2VXZA 3U1DA 2K7LA 5E1WA 4KICA 3DP7A 1YIOA 2A68F 3ABTA 2RV8A 2F5DA 2CG4A 3DQVC 1U6GA 5FFXA 2O61A 2FE3A 2J5OA 3KZYA 3HOSA 1P4WA 4U7BA 4MQVA 2CYYA 3SZPA 1YW7A 3F8BA 2PQ8A 5LBQA 1F5TA 1EH7A 2IPQX 1IRFA 2XV4S 3ABUA 1R5GA 4I0AA 2HYFA 1B1BA 4KN7X 5D4RA 3F23A 2A6HF 2ZMEB 2O3FA 3CUQC 4FHTA 3T8RA 3VEPA 3ZMSA 1ULYA 2JT1A 1KQ0A 4NQWA 2RKHA 4B8XA 1E17A 1DDNA 4LB6B 1Z1DA 2DQLA 1BIBA 2JPCA 3HHHA 1PDNC 1ZGAA 2LKPA 4JQFA 4XBFA 1D8JA 1ZREA 4UUVA 5CYVA 5L3FA 2QVOA 3CO7C 2ACJA 3RTRA 2A5YB 3VFZA 3BWGA 3DPLC 1T39A 4PGGA 4UXNA 4MTEA 1ZAOA 4MNUA 2WV0A 2NYXA 1FBSA 2PG4A 1J9IA 4A0YA 1LEAA 2BGCA 2P5KA 1LDJA 1YS7A 3ML6A 2OQGA 4Q5SF 5CLSA 1PUEE 5DD4A 2IW5A 5HDKA 4I01A 1W7PB 3HTSB 3I59A 4HX8A 2HS5A 1LB2A 4ENMA 1PP8F 1I1GA 3HRSA 3GFMA 4KIFA 4L5JA 4CDGA 2NAZA 2QBYA 1U5TC 1LVAA 4EJTA 5DCFA 3M9AA 1RUNA 3KE2A 2NNNA 2R7DA 1BIAA 1U5TA 1TLHB 1J75A 1Z6TA 4ETSA 3IRQA 2HEOA 3I64A 1U78A 4RGRA 1MJ9A 3FM3A 1ONVA 1IXSB 2HKOA 4LMYA 3F21A 3CDHA 1I5ZA 3OV8A 3WGIA 1FBUA 2AS5F 3E5UA 4HAMA 5F6FA 2EFNA 2Z5UA 3K9TA 5ICEA 1QO0D 4ZZDA 2QWWA 4OIQF 1IN4A 1LQ1A 5EEHA 1U2WA 2QQBA 4FX4A 1P92A 2CWEA 1REPC 2XVCA 4YIIA 1XB4A 1Z7UA 2ZNYA 4Y17A 4LLGF 4A6EA 1YLFA 4YG2F 1IN8A 4I2OA 3W6JB 2CW0F 1V4RA 3BPXA 3TDUC 2UZKA 1MGTA 4HF2A 2XUBA 2KJCA 4IHTA 1XSXA 4FT8A 3KLOA 3CO6C 3V7CA 1K78A 3M1EA 4LLNA 1RZ4A 3IKTA 1TNTA 2P8TA 2OU2A 2L01A 3SZTA 1FP2A 1WRJA 1WWXA 2EV0A 4PZJA 1TNSA 3WU1B 1Z05A 4ESBA 1S29A 1R58A 4LB5A 2FXAA 1A04A 2HKXA 3K1MA 2FEZA 2AXLA 5D5UB 2B0LA 2PFBA 2CQKA 4M74A 1FBQA 5LGNA 1QBJA 3E97A 3TOAA 5DV5A 2ZCWA 2JZYA 5E1XA 5CVVA 3KCCA 3R6SA 4U0WA 4GYGA 5ILUA 3J7AO 4M71A 5L3BA 3R61A 3D0SA 5LHHA 4DQ2A 3WU0A 4PCQA 3IRRA 5TRDA 2L4AA 1ZH5A 2GZWA 5E18F 1B6AA 3HRMA 4OMZA 3NRVA 3DPTA 2UWMA 2E7XA 2G7HA 4WXDA 2ELHA 2XKPA 5BPIA 2GQQA 5D5XB 2EA2A 4EGZA 5DYMA 3JAMZ 5ED4A 5L3EA 4L0ZB 1NHAA 3RYRA 4UVBA 1XGNA 2WWYA 1I6XA 2XAQA 1B4AA 1ZYRF 1UFMA 3V8JA 5JFRA 2MBFA 1UCRA 4G8XA 2PN6A 2FNPA 3MAJA 3WTUC 1BC8C 1F1ZA 5H6QA 5HS8A 3WGGA 4LD5A 3JAMK 2RN7A 2ZBKA 1J7KA 2FU4A 4OOIA 4IRGA 3TOBA 2GA1A 4PDKA 2NRAC 4BHPA 2Z9OA 2EFPA 4HDUA 3QU3A 4Q47A 4R1HA 4HV6A 1FYMA 2EWNA 1V3FA 3VB2A 1UB9A 1T2KA 4UV8A 4LG0A 4M6XA 3T5XA 1SD7A 2VOOA 2E1NA 4TV7A 3EYIA 2DO7A 1YQAA 2FBKA 3CJNA 2J5PA 1XDSA 4HLYA 1RUOA 4GO1A 1YW9A 1FYKA 4ZYEA 3MZHA 2HYGD 1YYVA 4RB3C 1LDDA 2FBIA 3HOTA 3I71A 5LRRA 4AVPA 3IKVA 4KMUX 3KEOA 3I59B 1SMYF 5LGUA 2P6SA 4IRHA 1BOAA 4HW0A 2DTRA 1JHHA 1WQ2A 4A12A 5CJ9A 1USTA 5CVRA 2O8XA 2M8EA 2FMYA 3O3KA 4HQEA 3EDPA 3E5XA 1SD6A 2K4BA 3KEQA 2QBYB 3K69A 3DXJF 3KP6A 2PMUA 4P5OA 4MEYF 2ZFWA 5ILVA 4PGHA 4EV0A 1IF1A 1XGSA 2V6CA 2R7FA 3HRUA 1ODDA 2IA1A 1J59A 3J80Z 2XHKA 4WCGA 2STWA 1XSVA 3C18A 3LFKA 1MJBA 2V1DA 3IL2A 3WTZA 1ZRDA 2VE8A 4MTDA 4EVIA 3P9IA 2R3SA 1BI3A 1R1TA 4ENKA 2E7WA 4KA4A 5HS9A 5K5QA 3MCZA 3E6CC 4OU0A 2RGVA 3I54A 3J80K 2VT3A 2F5CA 3GX4X 2P4WA 4ESJA 1XMKA 2PJPA 3C1DA 2DBBA 4CO8A 1KYWA 2PBIA 2XRNA 5J8FA 3V8LA 3BY6A 3EYYA 1U3EM 4MEXF 3DFGA 3RI4A 2DT5A 3T8TA 3LA2A 2ZO4A 3TQNA 2FOKA 1G3TA 3ZMUA 1P2FA 1ZN2A 4HBLA 4P9UA 1K78B 1XGOA 3R0AA 3DF8A 4U0YA 4BXUA 4MHGA 2Z33A 1WSUA 3TKYA 4XSXF 1OR7A 3L00A 3RPUA 2Z99A 2KRFA 1KYZA 3JTHA 3REOA 4JK1X 4RAYA 2IRFG 5ERIA 2CFXA 4LLLA 1DPUA 2EV6A 1FX7A 3ZN0A 4ZYGA 4L18B 5HDGA 1TW3A 1B59A 3I53A 1FY7A 4AWXB 1H9GA 3F8NA 3EUHA 4M6YA 1TBXA 2YSRA 2LF8A 4OIRF 2D1VA 3TO6A 4EMSA 2WC2A 3ELKA 2M87A 5DUIA 3LAJA 1SFUA 2ESNA 3G3ZA 3ZMZA 1J5YA 2KIFA 5ICCA 5F1RA 2LNBA 1IN6A 4G7HF 3RPQA 3ZQ7A 3F6VA 2NS0A 2DW4A 1DPRA 2QQ9A 5D8LB 3V4GA 3GF2A 2LF7A 1IZ1A 1KU3A 2VOPA 2GIVA 3CUQA 1O3TA 4KUMA 3G73A 2OAZA 1O3QA 3L9FA 1BI0A 4GXOA 3WTSC 1ON2A 5LHGA 2ZKZA 1EH6A 3QPTA 4IF4A 2CSOA 5LHIA 1ZG1A 3MWMA 3SHFA 3DEUA 2MLKA 3ZMVA 1H0MA 3WTWC 2MH2A 4Y15A 5IT3A 5L3CA 1VTNC 3ZN1A 1SFEA 2D1HA 4HA8A 1XGMA 1JHFA 3RDIA 4AIKA 4O3MA 1EV7A 2GWRA 1GVJA 1CF7A 1W5SA 1JGSA 5DDGA 2EJRA 4IVNA 4AIHA 4NB5A 4EJWA 4KDPA 4K2EA 3K1PA 4WX9A 4AD9A 1ON1A 5E20A 4WK8F 4Q4ZF 3MFKA 4LG0B 3ERED 4YFXF 1W4MA 4CYDA 4LGWA 1IRGA 5E8GA 2VONA 5D8KB 1OKRA 4HV5A 5FGMA 1OPCA 1XDUA 1AWCA 4RGSA 1D3YA 5JR3A 3FXUA 4G6DA 2EK5A 4NHJA 2BYVE 2QYOA 4ZYDA 4M9SA 3N97A 3P9CA 2FBHA 1RIOH 1TQPA 4CGZA 3BJAA 4ASNA 3MQ0A 4G7ZF 4EM1A 4D0PA 2QUFA 4LK1F 3RKWA 2V9VA 3QP6A 4MGRA 2YX4A 3HSRA 3HRTA 1HKSA 2QENA 4EJUA 3GO5A 1XN7A 4L9JA 2FQ3A 3TDZC 4M73A 2BBYA 2ISZA 2K4JA 1YG2A 1YS6A 3LSTA 3V7SA 2EFOA 2OZUA 4WXHA 4LK0F 1MDMA 2L54A 3KP3A 2VBZA 2DU9A 3V8KA 2F5FA 4ZZLA 2A61A 4YFNF 2H6CA 2WTEA 6PAXA 2W85A 2V1XA 5LEKA 4EJVA 1AOYA 3GFIA 2YR2A 1S7AA 2IJLA 3K1NA 2HR3A 3GFJA 3WG9A 3M8EA 2EFQA 1LJ9A 2VN2A 3WE2A 2K27A 2E1CA 2MA3A 2QZ8A 1XD7A 5E8IA 3QAHA 4U0VA 5D4SA 4KIGA 4ENJA 2L4MA 1BN5A 3HYIA 3CLOA 5D6FA 4A0XA 1KU7A 2P7VB 4N9IA 2O6GE 2O0YA 1LNWA 2HGCA 3FWEA 3QPHA 1F9NA 4FX0A 1XSDA 1ZLJA 3NEUA 2W24A 1RNLA 5H6RA 1KGSA 2DAOA 1GXPA 2DPDA 2Y75A 2JSCA 2DK8A 1FC3A 4Q48A 5BOXA 3F8MA 3JTGA 2X0LA 3E3VA 1B9MA 3DV8A 1BI1A 2FA5A 3FM5A 1G4DA 4A2UA 3R4KA 1JXSA 5L3GA 1SD4A 1QZYA 5D5VB 4L9VA 3CUQB 3C3WA 5DEQA 3FXQA 4CZZA 3FMRA 2LSOA 3KP4A 2MH9A 2V79A 4KYWA 3P7NA 3E6MA 2D45A 4YIFA 2XKOA 1S3JA 2IA2A 4RB0A 2KJBA 3CTAA 3HSFA 4Z2YA 3AAFA 1O3RA 3KLNA 3ZPLA 3M7GA 2Q2EA 5AIPA 4UVCA 4HF1A 3LAPA 2YPRA 3PQKA 1CF7B 2RC4A 2O03A 3RYPA 1BJAA 4A5MA 2XROA 5HLIA 3JW4A 2NNYA 2M5WA 4E70A 3JSPA 1FSEA 1R5HA 3HHGA 1K6OA 2STTA 3GZ5A 4HX4A 1O57A 1QZZA 3SXYA 5A2QZ 1OYYA 5DUKA 2OD5A 3PQJA 3BOQA 2CGPA 4HLXA 4H0EA 3FMSA 1BI2A 1U5TB 5ILSA 4EM0B 5DD8A 3EQLF 3FF5A 3KZZA 2A07F 3F8CA 3WTXC 5J8CA 1FPQA 3FZVA 3RJPA 1QGPA 1HKQA 2DFIA 2XASA 3KFWX 5A2QK 4BAYA 2H09A 3HIFA 3FXRA 3HUGA 4EM2A 4U7DA 1WI9A 1O3SA 3RIRA 4HYEA 5BQTA 3B73A 2M1BA 1L3LA 4O6JA 2DK5A 1ZGJA 2KIUA 1R00A 2Z3YA 3C7JA 4CICA 1STZA 3COAC 2X4HA 1Q1HA 2Q8KA 1L0OC 2COMA 5DCMA 3O6BB 4I09A 3BP8A 5LRSA 3LQQA 1B9NA 5ICFA 2HDCA 2KIMA 3GW2A 3IC7A 5AONA 4XRFA 1DUXC 3BDDA 2G7UA 1ZG5A 2A6EF 2GA2A 4F7ZA 4N9HA 1HSJA 3WTVC 4BHCA 4LJZF 4XLPF 4KMFA 3V7RA 2UXXA 1XCBA 3J81Z 4HX7A 2Q0OA 4GGGA 3LQRA 2G9WA 3GVAA 2EFWA 3F22A 4N0BA 5JVTA 2GXBA 1Y0UA 3RKXA 4RB2C 1HQCA 3GEZA 3WTYC 1K79A 3JSOA 3L09A 4HQMA 2RVCA 5AIQA 4GYIA 4OMYA 3H3UA 3J81K 5HLHA 3BPVA 2RQPA 3LA7A 2H6BA 3R0JA 1FOKA 5HDNA 2XAJA 3F72A 2HZTA 1HKTA 4KNYA 3E5QA 5BPDA 3I5UA 1FNNA 4HZFA 4KT5C 2BV6A 3H3ZA 1YTYA 4G94A 3E6BA 1QNTA 2VODA 3HSEA 2D2WA 5IT9Z 4OIOF 2DLLA 1HBXG 5K1YA 2V1UA 1Z6RA 4A0ZA 1BBYA 3ZP5A 3HTUA 5KK1A 3B02A 1O7FA 4HF0A 1IW7F 5LLQA 4P96A 3LA3A 2RDPA 5FD5A 1T6SA 1G6NA 3VOEA 2F5EA 3EETA 3GUDA 4KN4X 5IT9K 4IHSA 1T38A 2P5LC 1YFHA 4L9NA 3GWZA 3IWZA 2JTVA 3WE3A 1XMAA 5CVIA 2W84A 3Q9SA 4IRIA 4U88A 2BE5F 3ECHA 3KP2A 3SFZA 2MLGA 2YU3A 1IAWA 3Q5FA 2DPUA 2VC1A 1BM9A 3F6OA 5JI6A 2FSWA 1EH8A 4UNOA 4UVAA 1U8RA 3FX3A 4IXAA 3TO7A 1FYLA 4P55A 4BH9A 2HFHA 1PP7U 2PMHA 2LDUA 1X3UA 1HSTA 4HOBA 4M9XA 2HTSA 3MEXA 3I0TA 4UHTA 3TGNA 1HW2A 2CO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RB1 A;  5HOO A;  3LWF A;  3O2P E;  2A69 F;  1F4K A;  5HVQ C;  2P7C B;  2Y48 A;  3WGH A;  1J0R A;  2EB7 A;  2HQN A;  3BRO A;  2ZJ2 A;  4CHU A;  2A3S A;  2ISY A;  2VBX A;  3MZY A;  1ZRF A;  5D5W B;  5FFZ A;  2IA0 A;  3CUO A;  1R7J A;  2Y0M A;  1FLI A;  4R79 A;  5K5R A;  2KKO A;  1S8N A;  3SQN A;  4O5V A;  4BHB A;  2XIG A;  4M9Z A;  4B09 A;  3P9K A;  2HWV A;  1YO5 C;  5FO5 A;  3BJO A;  2W25 A;  5FD6 A;  3IHU A;  5BMZ A;  3M8F A;  3FMQ A;  1KU9 A;  1W5T A;  1GHC A;  4ON0 A;  1ZLK A;  1MD0 A;  2BEO A;  2ESH A;  2H94 A;  4RGU A;  4MQ9 F;  3K0L A;  3ECO A;  1D8K A;  1JE8 A;  1R36 A;  2HOE A;  4S05 A;  1MKM A;  1MJA A;  2JPB A;  1J2X A;  4S04 A;  3F8F A;  3ISP A;  2GAU A;  1Z91 A;  1S6L A;  3S2W A;  5LGT A;  5HLG A;  3D5L A;  4G9Y A;  2QM3 A;  3W6K B;  4L0Y B;  5DCM B;  2RNJ A;  2QQA A;  2FF4 A;  4XSZ F;  5E1Z B;  3WOD F;  1H9T A;  4Y13 A;  4QLC U;  4WF2 A;  4HDV A;  2XGX A;  2IP2 A;  1T98 A;  3L7W A;  5TJJ A;  2IVM A;  5HS7 A;  1P4A A;  1SFX A;  1XCV A;  4YFK F;  2P6T A;  1HXD A;  2GXG A;  1G3Y A;  3T0Y A;  1TW2 A;  3GFL A;  1OMI A;  3ROU A;  3VOD A;  1OYW A;  2PLY A;  4BNC A;  4RS8 A;  5F64 A;  1S7O A;  4I98 B;  2HTJ A;  2EA4 A;  2VC0 A;  2ADU A;  3QP5 A;  1HW5 A;  2L3D A;  5CVJ A;  4GCV A;  4RAZ A;  4IPA A;  1IN5 A;  3GZ6 A;  5KVR A;  1QPM A;  2ZME A;  1K7A A;  4AIJ A;  2HQR A;  4EQQ A;  3H92 A;  5FLX Z;  3N4M A;  2M30 A;  3RKY A;  3U9G A;  2MC3 A;  2ZXJ A;  1E2X A;  1KQ8 A;  3Q9V A;  2C6Y A;  2F2E A;  2ETH A;  4JBA A;  2XAH A;  4WXC A;  1KQ9 A;  4IJA A;  1RI7 A;  3BJ6 A;  1LEB A;  1TQI A;  1MZB A;  2VBW A;  2OQR A;  4I02 A;  4I0B A;  5FLX K;  4I7H A;  1G3S A;  1O7L A;  2DI3 A;  4UV9 A;  1BC7 C;  4OIP F;  1ZHF A;  3ZMT A;  4RGX A;  3TO9 A;  3GLX A;  4R8H A;  4EJO A;  2M45 A;  4KIB A;  2XAF A;  5E17 F;  3KP5 A;  1DP7 P;  3F3X A;  5H20 A;  2FRH A;  1IXR C;  2JRT A;  3NQO A;  2FML A;  2K02 A;  1R1U A;  3PFI A;  1W7P A;  3GYH X;  4QWQ A;  3U2R A;  4L5I A;  1R1V A;  4EGY A;  3IWF A;  1G3W A;  4DNC A;  4KFC A;  2P5V A;  3QU6 A;  5FB2 A;  1ZRC A;  3KET A;  2EV5 A;  2OA4 A;  1FP1 D;  5BS6 A;  2TDX A;  3E6D A;  4P9F A;  1P4X A;  3KP7 A;  2VT2 A;  3L2C A;  1P6R A;  4ZH4 F;  1LDK B;  3DKW A;  4L9T A;  2VBY A;  4LFU A;  5JHU A;  1IN7 A;  1IUY A;  4OIN F;  1I27 A;  3K2Z A;  4ESF A;  1HW1 A;  5J6X A;  3FHZ A;  4G6Q A;  5LEJ A;  4WWC A;  4XLN F;  1I1S A;  1FZP B;  1TTY A;  3ULQ B;  3WTT C;  1FT9 A;  4M72 A;  1T0F A;  3BZ6 A;  1FWZ A;  2W57 A;  5K5O A;  4A6D A;  4BYY A;  4BQA A;  3R60 A;  2PI0 A;  2OBP A;  2DQR A;  1WKM A;  5CVU A;  1IXC A;  1ZG3 A;  1SD5 A;  4ZYH A;  2MD5 A;  2H27 A;  4ENN A;  1USS A;  1R23 A;  1MDM B;  2PEX A;  2UXN A;  3ZMD A;  4A5N A;  2IT0 A;  3QRF F;  2K86 A;  2ZNZ A;  1GXQ A;  3QOP A;  2FNA A;  1CGP A;  1W7P D;  1C0W A;  1SMT A;  2YX7 A;  3OOP A;  3GXO A;  4CXF A;  5L3D A;  1KA8 A;  1FSH A;  1UHM A;  2XAG A;  3I4P A;  2VE9 A;  3I58 A;  3T1B A;  2QLZ A;  1TQM A;  5EEG A;  1KU2 A;  4G7O F;  1QQI A;  1R22 A;  1UHW A;  5ICG A;  1SAX A;  1Z9C A;  1D5V A;  2L02 A;  1ZAR A;  5D6E A;  2OZ6 A;  1YW8 A;  1OYI A;  2VXZ A;  3U1D A;  2K7L A;  5E1W A;  4KIC A;  3DP7 A;  1YIO A;  2A68 F;  3ABT A;  2RV8 A;  2F5D A;  2CG4 A;  3DQV C;  1U6G A;  5FFX A;  2O61 A;  2FE3 A;  2J5O A;  3KZY A;  3HOS A;  1P4W A;  4U7B A;  4MQV A;  2CYY A;  3SZP A;  1YW7 A;  3F8B A;  2PQ8 A;  5LBQ A;  1F5T A;  1EH7 A;  2IPQ X;  1IRF A;  2XV4 S;  3ABU A;  1R5G A;  4I0A A;  2HYF A;  1B1B A;  4KN7 X;  5D4R A;  3F23 A;  2A6H F;  2ZME B;  2O3F A;  3CUQ C;  4FHT A;  3T8R A;  3VEP A;  3ZMS A;  1ULY A;  2JT1 A;  1KQ0 A;  4NQW A;  2RKH A;  4B8X A;  1E17 A;  1DDN A;  4LB6 B;  1Z1D A;  2DQL A;  1BIB A;  2JPC A;  3HHH A;  1PDN C;  1ZGA A;  2LKP A;  4JQF A;  4XBF A;  1D8J A;  1ZRE A;  4UUV A;  5CYV A;  5L3F A;  2QVO A;  3CO7 C;  2ACJ A;  3RTR A;  2A5Y B;  3VFZ A;  3BWG A;  3DPL C;  1T39 A;  4PGG A;  4UXN A;  4MTE A;  1ZAO A;  4MNU A;  2WV0 A;  2NYX A;  1FBS A;  2PG4 A;  1J9I A;  4A0Y A;  1LEA A;  2BGC A;  2P5K A;  1LDJ A;  1YS7 A;  3ML6 A;  2OQG A;  4Q5S F;  5CLS A;  1PUE E;  5DD4 A;  2IW5 A;  5HDK A;  4I01 A;  1W7P B;  3HTS B;  3I59 A;  4HX8 A;  2HS5 A;  1LB2 A;  4ENM A;  1PP8 F;  1I1G A;  3HRS A;  3GFM A;  4KIF A;  4L5J A;  4CDG A;  2NAZ A;  2QBY A;  1U5T C;  1LVA A;  4EJT A;  5DCF A;  3M9A A;  1RUN A;  3KE2 A;  2NNN A;  2R7D A;  1BIA A;  1U5T A;  1TLH B;  1J75 A;  1Z6T A;  4ETS A;  3IRQ A;  2HEO A;  3I64 A;  1U78 A;  4RGR A;  1MJ9 A;  3FM3 A;  1ONV A;  1IXS B;  2HKO A;  4LMY A;  3F21 A;  3CDH A;  1I5Z A;  3OV8 A;  3WGI A;  1FBU A;  2AS5 F;  3E5U A;  4HAM A;  5F6F A;  2EFN A;  2Z5U A;  3K9T A;  5ICE A;  1QO0 D;  4ZZD A;  2QWW A;  4OIQ F;  1IN4 A;  1LQ1 A;  5EEH A;  1U2W A;  2QQB A;  4FX4 A;  1P92 A;  2CWE A;  1REP C;  2XVC A;  4YII A;  1XB4 A;  1Z7U A;  2ZNY A;  4Y17 A;  4LLG F;  4A6E A;  1YLF A;  4YG2 F;  1IN8 A;  4I2O A;  3W6J B;  2CW0 F;  1V4R A;  3BPX A;  3TDU C;  2UZK A;  1MGT A;  4HF2 A;  2XUB A;  2KJC A;  4IHT A;  1XSX A;  4FT8 A;  3KLO A;  3CO6 C;  3V7C A;  1K78 A;  3M1E A;  4LLN A;  1RZ4 A;  3IKT A;  1TNT A;  2P8T A;  2OU2 A;  2L01 A;  3SZT A;  1FP2 A;  1WRJ A;  1WWX A;  2EV0 A;  4PZJ A;  1TNS A;  3WU1 B;  1Z05 A;  4ESB A;  1S29 A;  1R58 A;  4LB5 A;  2FXA A;  1A04 A;  2HKX A;  3K1M A;  2FEZ A;  2AXL A;  5D5U B;  2B0L A;  2PFB A;  2CQK A;  4M74 A;  1FBQ A;  5LGN A;  1QBJ A;  3E97 A;  3TOA A;  5DV5 A;  2ZCW A;  2JZY A;  5E1X A;  5CVV A;  3KCC A;  3R6S A;  4U0W A;  4GYG A;  5ILU A;  3J7A O;  4M71 A;  5L3B A;  3R61 A;  3D0S A;  5LHH A;  4DQ2 A;  3WU0 A;  4PCQ A;  3IRR A;  5TRD A;  2L4A A;  1ZH5 A;  2GZW A;  5E18 F;  1B6A A;  3HRM A;  4OMZ A;  3NRV A;  3DPT A;  2UWM A;  2E7X A;  2G7H A;  4WXD A;  2ELH A;  2XKP A;  5BPI A;  2GQQ A;  5D5X B;  2EA2 A;  4EGZ A;  5DYM A;  3JAM Z;  5ED4 A;  5L3E A;  4L0Z B;  1NHA A;  3RYR A;  4UVB A;  1XGN A;  2WWY A;  1I6X A;  2XAQ A;  1B4A A;  1ZYR F;  1UFM A;  3V8J A;  5JFR A;  2MBF A;  1UCR A;  4G8X A;  2PN6 A;  2FNP A;  3MAJ A;  3WTU C;  1BC8 C;  1F1Z A;  5H6Q A;  5HS8 A;  3WGG A;  4LD5 A;  3JAM K;  2RN7 A;  2ZBK A;  1J7K A;  2FU4 A;  4OOI A;  4IRG A;  3TOB A;  2GA1 A;  4PDK A;  2NRA C;  4BHP A;  2Z9O A;  2EFP A;  4HDU A;  3QU3 A;  4Q47 A;  4R1H A;  4HV6 A;  1FYM A;  2EWN A;  1V3F A;  3VB2 A;  1UB9 A;  1T2K A;  4UV8 A;  4LG0 A;  4M6X A;  3T5X A;  1SD7 A;  2VOO A;  2E1N A;  4TV7 A;  3EYI A;  2DO7 A;  1YQA A;  2FBK A;  3CJN A;  2J5P A;  1XDS A;  4HLY A;  1RUO A;  4GO1 A;  1YW9 A;  1FYK A;  4ZYE A;  3MZH A;  2HYG D;  1YYV A;  4RB3 C;  1LDD A;  2FBI A;  3HOT A;  3I71 A;  5LRR A;  4AVP A;  3IKV A;  4KMU X;  3KEO A;  3I59 B;  1SMY F;  5LGU A;  2P6S A;  4IRH A;  1BOA A;  4HW0 A;  2DTR A;  1JHH A;  1WQ2 A;  4A12 A;  5CJ9 A;  1UST A;  5CVR A;  2O8X A;  2M8E A;  2FMY A;  3O3K A;  4HQE A;  3EDP A;  3E5X A;  1SD6 A;  2K4B A;  3KEQ A;  2QBY B;  3K69 A;  3DXJ F;  3KP6 A;  2PMU A;  4P5O A;  4MEY F;  2ZFW A;  5ILV A;  4PGH A;  4EV0 A;  1IF1 A;  1XGS A;  2V6C A;  2R7F A;  3HRU A;  1ODD A;  2IA1 A;  1J59 A;  3J80 Z;  2XHK A;  4WCG A;  2STW A;  1XSV A;  3C18 A;  3LFK A;  1MJB A;  2V1D A;  3IL2 A;  3WTZ A;  1ZRD A;  2VE8 A;  4MTD A;  4EVI A;  3P9I A;  2R3S A;  1BI3 A;  1R1T A;  4ENK A;  2E7W A;  4KA4 A;  5HS9 A;  5K5Q A;  3MCZ A;  3E6C C;  4OU0 A;  2RGV A;  3I54 A;  3J80 K;  2VT3 A;  2F5C A;  3GX4 X;  2P4W A;  4ESJ A;  1XMK A;  2PJP A;  3C1D A;  2DBB A;  4CO8 A;  1KYW A;  2PBI A;  2XRN A;  5J8F A;  3V8L A;  3BY6 A;  3EYY A;  1U3E M;  4MEX F;  3DFG A;  3RI4 A;  2DT5 A;  3T8T A;  3LA2 A;  2ZO4 A;  3TQN A;  2FOK A;  1G3T A;  3ZMU A;  1P2F A;  1ZN2 A;  4HBL A;  4P9U A;  1K78 B;  1XGO A;  3R0A A;  3DF8 A;  4U0Y A;  4BXU A;  4MHG A;  2Z33 A;  1WSU A;  3TKY A;  4XSX F;  1OR7 A;  3L00 A;  3RPU A;  2Z99 A;  2KRF A;  1KYZ A;  3JTH A;  3REO A;  4JK1 X;  4RAY A;  2IRF G;  5ERI A;  2CFX A;  4LLL A;  1DPU A;  2EV6 A;  1FX7 A;  3ZN0 A;  4ZYG A;  4L18 B;  5HDG A;  1TW3 A;  1B59 A;  3I53 A;  1FY7 A;  4AWX B;  1H9G A;  3F8N A;  3EUH A;  4M6Y A;  1TBX A;  2YSR A;  2LF8 A;  4OIR F;  2D1V A;  3TO6 A;  4EMS A;  2WC2 A;  3ELK A;  2M87 A;  5DUI A;  3LAJ A;  1SFU A;  2ESN A;  3G3Z A;  3ZMZ A;  1J5Y A;  2KIF A;  5ICC A;  5F1R A;  2LNB A;  1IN6 A;  4G7H F;  3RPQ A;  3ZQ7 A;  3F6V A;  2NS0 A;  2DW4 A;  1DPR A;  2QQ9 A;  5D8L B;  3V4G A;  3GF2 A;  2LF7 A;  1IZ1 A;  1KU3 A;  2VOP A;  2GIV A;  3CUQ A;  1O3T A;  4KUM A;  3G73 A;  2OAZ A;  1O3Q A;  3L9F A;  1BI0 A;  4GXO A;  3WTS C;  1ON2 A;  5LHG A;  2ZKZ A;  1EH6 A;  3QPT A;  4IF4 A;  2CSO A;  5LHI A;  1ZG1 A;  3MWM A;  3SHF A;  3DEU A;  2MLK A;  3ZMV A;  1H0M A;  3WTW C;  2MH2 A;  4Y15 A;  5IT3 A;  5L3C A;  1VTN C;  3ZN1 A;  1SFE A;  2D1H A;  4HA8 A;  1XGM A;  1JHF A;  3RDI A;  4AIK A;  4O3M A;  1EV7 A;  2GWR A;  1GVJ A;  1CF7 A;  1W5S A;  1JGS A;  5DDG A;  2EJR A;  4IVN A;  4AIH A;  4NB5 A;  4EJW A;  4KDP A;  4K2E A;  3K1P A;  4WX9 A;  4AD9 A;  1ON1 A;  5E20 A;  4WK8 F;  4Q4Z F;  3MFK A;  4LG0 B;  3ERE D;  4YFX F;  1W4M A;  4CYD A;  4LGW A;  1IRG A;  5E8G A;  2VON A;  5D8K B;  1OKR A;  4HV5 A;  5FGM A;  1OPC A;  1XDU A;  1AWC A;  4RGS A;  1D3Y A;  5JR3 A;  3FXU A;  4G6D A;  2EK5 A;  4NHJ A;  2BYV E;  2QYO A;  4ZYD A;  4M9S A;  3N97 A;  3P9C A;  2FBH A;  1RIO H;  1TQP A;  4CGZ A;  3BJA A;  4ASN A;  3MQ0 A;  4G7Z F;  4EM1 A;  4D0P A;  2QUF A;  4LK1 F;  3RKW A;  2V9V A;  3QP6 A;  4MGR A;  2YX4 A;  3HSR A;  3HRT A;  1HKS A;  2QEN A;  4EJU A;  3GO5 A;  1XN7 A;  4L9J A;  2FQ3 A;  3TDZ C;  4M73 A;  2BBY A;  2ISZ A;  2K4J A;  1YG2 A;  1YS6 A;  3LST A;  3V7S A;  2EFO A;  2OZU A;  4WXH A;  4LK0 F;  1MDM A;  2L54 A;  3KP3 A;  2VBZ A;  2DU9 A;  3V8K A;  2F5F A;  4ZZL A;  2A61 A;  4YFN F;  2H6C A;  2WTE A;  6PAX A;  2W85 A;  2V1X A;  5LEK A;  4EJV A;  1AOY A;  3GFI A;  2YR2 A;  1S7A A;  2IJL A;  3K1N A;  2HR3 A;  3GFJ A;  3WG9 A;  3M8E A;  2EFQ A;  1LJ9 A;  2VN2 A;  3WE2 A;  2K27 A;  2E1C A;  2MA3 A;  2QZ8 A;  1XD7 A;  5E8I A;  3QAH A;  4U0V A;  5D4S A;  4KIG A;  4ENJ A;  2L4M A;  1BN5 A;  3HYI A;  3CLO A;  5D6F A;  4A0X A;  1KU7 A;  2P7V B;  4N9I A;  2O6G E;  2O0Y A;  1LNW A;  2HGC A;  3FWE A;  3QPH A;  1F9N A;  4FX0 A;  1XSD A;  1ZLJ A;  3NEU A;  2W24 A;  1RNL A;  5H6R A;  1KGS A;  2DAO A;  1GXP A;  2DPD A;  2Y75 A;  2JSC A;  2DK8 A;  1FC3 A;  4Q48 A;  5BOX A;  3F8M A;  3JTG A;  2X0L A;  3E3V A;  1B9M A;  3DV8 A;  1BI1 A;  2FA5 A;  3FM5 A;  1G4D A;  4A2U A;  3R4K A;  1JXS A;  5L3G A;  1SD4 A;  1QZY A;  5D5V B;  4L9V A;  3CUQ B;  3C3W A;  5DEQ A;  3FXQ A;  4CZZ A;  3FMR A;  2LSO A;  3KP4 A;  2MH9 A;  2V79 A;  4KYW A;  3P7N A;  3E6M A;  2D45 A;  4YIF A;  2XKO A;  1S3J A;  2IA2 A;  4RB0 A;  2KJB A;  3CTA A;  3HSF A;  4Z2Y A;  3AAF A;  1O3R A;  3KLN A;  3ZPL A;  3M7G A;  2Q2E A;  5AIP A;  4UVC A;  4HF1 A;  3LAP A;  2YPR A;  3PQK A;  1CF7 B;  2RC4 A;  2O03 A;  3RYP A;  1BJA A;  4A5M A;  2XRO A;  5HLI A;  3JW4 A;  2NNY A;  2M5W A;  4E70 A;  3JSP A;  1FSE A;  1R5H A;  3HHG A;  1K6O A;  2STT A;  3GZ5 A;  4HX4 A;  1O57 A;  1QZZ A;  3SXY A;  5A2Q Z;  1OYY A;  5DUK A;  2OD5 A;  3PQJ A;  3BOQ A;  2CGP A;  4HLX A;  4H0E A;  3FMS A;  1BI2 A;  1U5T B;  5ILS A;  4EM0 B;  5DD8 A;  3EQL F;  3FF5 A;  3KZZ A;  2A07 F;  3F8C A;  3WTX C;  5J8C A;  1FPQ A;  3FZV A;  3RJP A;  1QGP A;  1HKQ A;  2DFI A;  2XAS A;  3KFW X;  5A2Q K;  4BAY A;  2H09 A;  3HIF A;  3FXR A;  3HUG A;  4EM2 A;  4U7D A;  1WI9 A;  1O3S A;  3RIR A;  4HYE A;  5BQT A;  3B73 A;  2M1B A;  1L3L A;  4O6J A;  2DK5 A;  1ZGJ A;  2KIU A;  1R00 A;  2Z3Y A;  3C7J A;  4CIC A;  1STZ A;  3COA C;  2X4H A;  1Q1H A;  2Q8K A;  1L0O C;  2COM A;  5DCM A;  3O6B B;  4I09 A;  3BP8 A;  5LRS A;  3LQQ A;  1B9N A;  5ICF A;  2HDC A;  2KIM A;  3GW2 A;  3IC7 A;  5AON A;  4XRF A;  1DUX C;  3BDD A;  2G7U A;  1ZG5 A;  2A6E F;  2GA2 A;  4F7Z A;  4N9H A;  1HSJ A;  3WTV C;  4BHC A;  4LJZ F;  4XLP F;  4KMF A;  3V7R A;  2UXX A;  1XCB A;  3J81 Z;  4HX7 A;  2Q0O A;  4GGG A;  3LQR A;  2G9W A;  3GVA A;  2EFW A;  3F22 A;  4N0B A;  5JVT A;  2GXB A;  1Y0U A;  3RKX A;  4RB2 C;  1HQC A;  3GEZ A;  3WTY C;  1K79 A;  3JSO A;  3L09 A;  4HQM A;  2RVC A;  5AIQ A;  4GYI A;  4OMY A;  3H3U A;  3J81 K;  5HLH A;  3BPV A;  2RQP A;  3LA7 A;  2H6B A;  3R0J A;  1FOK A;  5HDN A;  2XAJ A;  3F72 A;  2HZT A;  1HKT A;  4KNY A;  3E5Q A;  5BPD A;  3I5U A;  1FNN A;  4HZF A;  4KT5 C;  2BV6 A;  3H3Z A;  1YTY A;  4G94 A;  3E6B A;  1QNT A;  2VOD A;  3HSE A;  2D2W A;  5IT9 Z;  4OIO F;  2DLL A;  1HBX G;  5K1Y A;  2V1U A;  1Z6R A;  4A0Z A;  1BBY A;  3ZP5 A;  3HTU A;  5KK1 A;  3B02 A;  1O7F A;  4HF0 A;  1IW7 F;  5LLQ A;  4P96 A;  3LA3 A;  2RDP A;  5FD5 A;  1T6S A;  1G6N A;  3VOE A;  2F5E A;  3EET A;  3GUD A;  4KN4 X;  5IT9 K;  4IHS A;  1T38 A;  2P5L C;  1YFH A;  4L9N A;  3GWZ A;  3IWZ A;  2JTV A;  3WE3 A;  1XMA A;  5CVI A;  2W84 A;  3Q9S A;  4IRI A;  4U88 A;  2BE5 F;  3ECH A;  3KP2 A;  3SFZ A;  2MLG A;  2YU3 A;  1IAW A;  3Q5F A;  2DPU A;  2VC1 A;  1BM9 A;  3F6O A;  5JI6 A;  2FSW A;  1EH8 A;  4UNO A;  4UVA A;  1U8R A;  3FX3 A;  4IXA A;  3TO7 A;  1FYL A;  4P55 A;  4BH9 A;  2HFH A;  1PP7 U;  2PMH A;  2LDU A;  1X3U A;  1HST A;  4HOB A;  4M9X A;  2HTS A;  3MEX A;  3I0T A;  4UHT A;  3TGN A;  1HW2 A;  2CO5 A; 
#chains in the Genus database with same CATH topology
 4RB1 A;  3Q3S A;  3GME A;  5HOO A;  4RA2 A;  3HM5 A;  2GLO A;  3LWF A;  3O2P E;  2A69 F;  1F4K A;  5HVQ C;  1Q1V A;  2P7C B;  3H9Q A;  2DMQ A;  2JMW A;  2Y48 A;  4BQQ A;  3WGH A;  1MBK A;  4HRI A;  3QYB A;  1BJZ A;  1J0R A;  2EB7 A;  4MFE A;  5KCM A;  4C2U A;  4HST A;  2HXO A;  1VF9 A;  2E1O A;  2HQN A;  3BRO A;  2ZJ2 A;  3E1S A;  1R4N B;  4CHU A;  3HOW J;  2IS2 A;  2A3S A;  2ISY A;  2VBX A;  1ZK8 A;  3MZY A;  3G6E I;  1ZRF A;  5D5W B;  3CCL I;  2EZL A;  5FFZ A;  2QEX I;  2LRD A;  2IA0 A;  4PSX A;  3RCO A;  3PM1 A;  3CUO A;  1R7J A;  3CJR B;  2Y0M A;  4M3G A;  4I6Z A;  1FLI A;  4R79 A;  5K5R A;  3BC8 A;  4AYB N;  2KKO A;  3ESW B;  3HXL A;  1S8N A;  2Z2S B;  3SQN A;  4O5V A;  4J19 A;  4BHB A;  5GAG J;  2XIG A;  4M9Z A;  4D9J A;  4B09 A;  3P9K A;  2HWV A;  1VZ0 A;  1YO5 C;  5FO5 A;  3CCV I;  3BJO A;  2W25 A;  1WFX A;  1R6R A;  3MD2 A;  5FD6 A;  3IHU A;  3U21 A;  3LL7 A;  5BMZ A;  1FIA A;  2EZI A;  3M8F A;  3FMQ A;  1D5Y A;  1KU9 A;  1W5T A;  1GHC A;  3M8J A;  4ON0 A;  1ZLK A;  1MD0 A;  2BEO A;  4BS9 A;  2ESH A;  2CV2 A;  2H94 A;  4RGU A;  4MQ9 F;  2ZSH B;  3K0L A;  2BY2 A;  2F6C A;  3ECO A;  1D8K A;  2DA3 A;  4AUX A;  1JE8 A;  1R36 A;  2M7A A;  2VXD A;  4IHY A;  2HOE A;  4B3A A;  4RMN A;  4S05 A;  3IAS 2;  1MKM A;  1MJA A;  4XM3 A;  2JPB A;  1J2X A;  4S04 A;  3K4C A;  3F8F A;  3ISP A;  2GAU A;  2HPM A;  1Z91 A;  2X1C A;  1S6L A;  2OCC H;  3S2W A;  5LGT A;  5HLG A;  4FCY A;  2V1N A;  5EDN A;  3D5L A;  3LSJ A;  1DU0 A;  4DZP A;  4G9Y A;  3OYJ A;  2BVL A;  2QM3 A;  3W6K B;  2LR8 A;  5DCM B;  3FHN A;  4L0Y B;  1FTT A;  2VQC A;  4BBS J;  2RNJ A;  3KEY A;  2QQA A;  4A3K J;  2DA4 A;  2FF4 A;  4XSZ F;  4RAF A;  4HPQ A;  5E1Z B;  3WOD F;  4UY8 I;  3VWB A;  1H9T A;  2FQ4 A;  1FEX A;  5E3M A;  4C2M J;  4Y13 A;  4DJA A;  4BXX J;  1MIJ A;  1WVR A;  4QLC U;  4PJJ A;  4WF2 A;  4JP0 A;  2O7O A;  1MNE A;  2EZK A;  4HDV A;  2E2H J;  1TWF J;  3TW6 A;  1UEL B;  2XGX A;  2IP2 A;  4A3D J;  1T98 A;  3E7L A;  3L7W A;  5GTI C;  1JKQ C;  5TJJ A;  3S93 A;  2IVM A;  5HS7 A;  2Y30 A;  1P4A A;  1SFX A;  1XCV A;  4YFK F;  2P6T A;  1B8I A;  1HXD A;  2GXG A;  1XPX A;  1G3Y A;  3JRA A;  3L2R A;  3T0Y A;  2ZXH A;  3KPH A;  1TW2 A;  3GFL A;  1OMI A;  3GCM A;  5CKT A;  2L0K A;  3ROU A;  2BVM A;  3DTE A;  5KAI C;  3VOD A;  4D1Q A;  1OYW A;  5GTH C;  1JJ8 C;  2PLY A;  3JRF A;  4BNC A;  2VJ5 A;  3CCR I;  1I6H J;  2MC4 A;  4RS8 A;  2B63 J;  1ETK A;  5F64 A;  3HJE A;  1S7O A;  5M3F J;  4I98 B;  2HTJ A;  2I10 A;  2EA4 A;  2VC0 A;  2ADU A;  3QP5 A;  1HW5 A;  2L3D A;  5CVJ A;  4GCV A;  2R93 J;  4LIU A;  4RAZ A;  1OLT A;  5EG0 A;  1VQL I;  3G1O A;  4IPA A;  3W6V A;  1IN5 A;  2ZME C;  1KON A;  1X2M A;  2MFZ A;  3GZ6 A;  2YS9 A;  2NVQ J;  5KVR A;  1QPM A;  2EPF A;  4CCM A;  2ZME A;  3TP0 A;  1K7A A;  4AIJ A;  1MND A;  2HQR A;  3VPR A;  1UMQ A;  4Y4R A;  4EQQ A;  5K7Z A;  1LUJ B;  4YEJ A;  3H92 A;  5J47 A;  2XC7 A;  5FLX Z;  4X0G A;  3N4M A;  4DYQ A;  2LKX A;  4ZTF A;  2M30 A;  3DU5 A;  3JRC A;  3RKY A;  3K4L A;  3TP3 A;  3U9G A;  1X3Z B;  3DBL B;  2MC3 A;  2PMZ A;  2ZXJ A;  1WJF A;  1IRX A;  2W82 A;  3BR3 A;  1ETV A;  5CQE A;  5EF6 A;  1E2X A;  1KQ8 A;  2OF7 A;  4IOC F;  2DOF A;  3HPH A;  5M3M J;  4XIC A;  3CES A;  3Q9V A;  2C6Y A;  1JUM A;  2ETH A;  2F2E A;  1ZEL A;  2XAH A;  4JBA A;  2NS7 A;  4WXC A;  2DYR H;  2F4O B;  1KQ9 A;  4IJA A;  1RI7 A;  3BJ6 A;  3C2H A;  4E7Z A;  1LEB A;  1TQI A;  1JUP A;  1MZB A;  4IQ4 A;  3TW7 A;  2VBW A;  2OQR A;  2OC6 A;  4I02 A;  4I0B A;  1TT0 A;  3Q0W A;  5FLX K;  3D5S C;  4XRM A;  2DN0 A;  2WY7 Q;  4I7H A;  1AHD P;  1G3S A;  1O7L A;  1ORK A;  2HNH A;  2DI3 A;  4UV9 A;  5FKK A;  1BC7 C;  4OIP F;  1ZHF A;  3ZMT A;  4RGX A;  3TO9 A;  3GLX A;  3S1N J;  1D1A A;  4R8H A;  4EJO A;  2M45 A;  4KIB A;  1PJR A;  3HEF A;  3DKX A;  1I50 J;  3OR2 C;  4ZJZ A;  3OYF A;  4A69 C;  2XAF A;  5E17 F;  2L7Z A;  1QPI A;  2WB1 N;  3KP5 A;  1DP7 P;  4XR6 A;  1O4X A;  3F3X A;  5H20 A;  2FRH A;  1IXR C;  4Y52 J;  2JRT A;  3NQO A;  2FML A;  1WH5 A;  2K02 A;  1WZ2 A;  3HGG A;  1R1U A;  4BJ5 C;  3FBI B;  3MZ8 A;  3PFI A;  1HF0 A;  1W7P A;  1MW7 A;  3CCU I;  5J3L A;  2DFH A;  2WA0 A;  3GYH X;  2VKE A;  4QWQ A;  4L5I A;  3U2R A;  5IOY A;  1R1V A;  4EGY A;  2QF7 A;  1G3W A;  3IWF A;  3FDY A;  1RET A;  1U0J A;  4M6V A;  4DNC A;  5C4X J;  4KFC A;  2P5V A;  1S72 I;  2V9P A;  2E35 A;  3QU6 A;  1MBH A;  5FB2 A;  3KET A;  2EIN H;  1ZRC A;  1MSF C;  3W2A A;  2EV5 A;  2OA4 A;  4BUP A;  2R7S A;  2OV7 A;  3RQI A;  1FP1 D;  2HOA A;  1VQ7 I;  5BS6 A;  1VI0 A;  2TDX A;  3E6D A;  3LMM A;  4P9F A;  1P4X A;  3G71 I;  3S3N A;  4B3X A;  4XN0 A;  5KNL A;  1BW5 A;  3KP7 A;  5J1Y A;  2VT2 A;  5LFA A;  3CME I;  4F93 B;  4J00 A;  3L2C A;  2V6E A;  5FJ8 J;  1P6R A;  4ZH4 F;  1LDK B;  1QHG A;  3NWT A;  3DKW A;  1VQO I;  4L9T A;  2VBY A;  3OSF A;  4YEL A;  4LFU A;  3H35 A;  5JHU A;  1IN7 A;  4FE4 A;  1A35 A;  4CH7 A;  1IUY A;  4OIN F;  4EEF G;  1I27 A;  3H0D A;  1OCP A;  2R92 J;  1MBJ A;  1E3H A;  3K2Z A;  4ESF A;  1HW1 A;  5J6X A;  3FHZ A;  4IHW A;  4G6Q A;  1QHH D;  1T56 A;  2CQN A;  5LEJ A;  3FBN B;  4CYC A;  4XLN F;  4WWC A;  1I1S A;  1FZP B;  2LC2 A;  4XK4 A;  1TTY A;  3ULQ B;  3A03 A;  2K3F A;  3WTT C;  1FT9 A;  4M72 A;  1T0F A;  3BZ6 A;  1FWZ A;  4A3I J;  1JJ6 C;  2VAS A;  2W57 A;  5K5O A;  1V54 H;  4A6D A;  4BYY A;  5M5W J;  3S2H J;  4BQA A;  3FK7 A;  3R60 A;  4B43 A;  4BEH A;  4Z6Y A;  4A3G J;  3Q0V A;  2PI0 A;  4JOM A;  5C44 J;  4E7L A;  2OBP A;  4XOP A;  2BHZ A;  2DQR A;  1GUU A;  3BG6 A;  2Z16 A;  5J4V A;  1WKM A;  1X1D A;  3K2A A;  5CVU A;  1MMG A;  1IXC A;  1ZG3 A;  1SD5 A;  4ZYH A;  2MD5 A;  3CP8 A;  2H27 A;  1R4M B;  4ENN A;  2O8K A;  1USS A;  3BTI A;  3C2B A;  2BZT A;  2RQQ A;  1YJW I;  3S1R J;  1TWG J;  3OOU A;  1R23 A;  1MDM B;  2PEX A;  1UG2 A;  1OJL A;  1T08 B;  2UXN A;  2X51 A;  3ZMD A;  1XC5 A;  1TC3 C;  4A5N A;  3JRI A;  3BG7 A;  2IT0 A;  3QRF F;  2K86 A;  5E79 C;  2ZNZ A;  4ZDO A;  1GXQ A;  3QOP A;  2FNA A;  1CGP A;  1W7P D;  1C0W A;  2NS8 A;  3F0C A;  1SMT A;  2YX7 A;  1IUF A;  2FUG 2;  3A01 A;  2ID3 A;  2K5C A;  2KHM A;  3OOP A;  3GXO A;  4CXF A;  5L3D A;  2ZFU A;  1KA8 A;  4BJT A;  4MIM A;  4PJ0 C;  1TT5 B;  1W0T A;  1FSH A;  1UHM A;  2KT0 A;  2XAG A;  4XOT A;  2KFD A;  4GFB A;  3AL0 C;  2K9M A;  3I4P A;  1IJW C;  4QPQ A;  2VE9 A;  3I58 A;  2LOO A;  1RR8 C;  1IO2 A;  2L7K A;  3JRE A;  5E3L A;  4AID A;  3T1B A;  2QLZ A;  1TQM A;  4A3B J;  1MBG A;  1JGG A;  5EEG A;  2VI6 A;  1OR7 C;  2ZJQ F;  2KRH A;  1KU2 A;  4G7O F;  2JUG A;  1QQI A;  4LIV A;  1R22 A;  1UHW A;  5ICG A;  1SAX A;  3CDI A;  2G0E A;  2BY1 A;  1Z9C A;  2JA6 J;  3QYF A;  1D5V A;  2L02 A;  4CSW A;  1R9T J;  1ZAR A;  3J7A Y;  2VL8 A;  5D6E A;  4KIS A;  1X4P A;  2OZ6 A;  1YW8 A;  1OYI A;  2VXZ A;  4A3M J;  3VDX A;  3U1D A;  4FE7 A;  2K7L A;  5E1W A;  4KIC A;  4B1R A;  1YIO A;  3DP7 A;  1HOM A;  2A68 F;  3ABT A;  4RBO A;  4RAG A;  1FIP A;  3MKW B;  2RV8 A;  2TRT A;  2F5D A;  2CG4 A;  1MMD A;  3NAU A;  3DQV C;  3X2Q H;  4DGW B;  4S0H B;  3OYE A;  1U6G A;  4Y7N J;  5BNG A;  1FOY A;  2BY0 A;  1JTX A;  2L2O A;  5FFX A;  2CUJ A;  4LOC A;  3K4N A;  2O61 A;  2FE3 A;  2CS3 A;  2I8D A;  2J5O A;  2V7F A;  3KZY A;  1S9H A;  4JX5 A;  4IEJ A;  4KJZ A;  2HVS A;  1YRN A;  2JSP A;  3FKJ A;  3HOS A;  1P4W A;  4ANJ A;  2VQG A;  4U7B A;  1OIS A;  4MQV A;  1MBE A;  1SVL A;  2CYY A;  2HOS A;  4HG2 A;  2KIS A;  4E7S A;  3S15 J;  3SZP A;  1YW7 A;  3F8B A;  2PQ8 A;  5LBQ A;  3I56 I;  2OTJ I;  3FXL A;  1F5T A;  1EH7 A;  2IPQ X;  1IRF A;  3CMM A;  2XV4 S;  3CC7 I;  3ABU A;  1R5G A;  4I0A A;  2ECC A;  2HYF A;  3J7Z I;  1B1B A;  3SDB A;  4ZYA A;  4KN7 X;  5D4R A;  3F23 A;  2A6H F;  2ZME B;  1UG0 A;  2O3F A;  3CUQ C;  4FHT A;  3T8R A;  3GTK J;  2L7M P;  4CCJ A;  3NAR A;  1UHS A;  3VEP A;  3ZMS A;  1ULY A;  2KL4 A;  2JT1 A;  5IOZ A;  1KQ0 A;  4OAY A;  4NQW A;  2RKH A;  2VJJ A;  3BLY A;  1IV8 A;  4B8X A;  1E17 A;  4BQN A;  5EZG A;  3HKZ A;  4LB6 B;  1Z1D A;  2DQL A;  3H5A A;  1DDN A;  1OCZ H;  3OYI A;  2JQ7 A;  3O8G A;  2L7F P;  1BIB A;  2JPC A;  1YI2 I;  3HHH A;  3BT9 A;  3H0G J;  3I55 I;  1PDN C;  1ZGA A;  2BXY A;  2LKP A;  4W97 A;  4JQF A;  4XBF A;  5F0F A;  5GAD J;  1D8J A;  4XLH A;  3KX2 A;  1ZRE A;  4UUV A;  2VQH A;  3B6C A;  3CCJ I;  3FIS A;  2EBI A;  3PSI A;  1W36 C;  1PVE A;  5CYV A;  5L3F A;  2QVO A;  2XPU A;  5EYR A;  2ZJR F;  3L2U A;  3CO7 C;  3CF2 A;  1Z77 A;  4DBR A;  2ACJ A;  1QA6 A;  2HU9 A;  3RTR A;  2A5Y B;  3BG9 A;  3VFZ A;  3BWG A;  3DPL C;  1T39 A;  4PGG A;  2L9S A;  1DGR M;  1Z3X A;  4UXN A;  4MTE A;  3VSK A;  2JA2 A;  1LFP A;  1ZAO A;  4JX6 A;  4MNU A;  2WV0 A;  2NYX A;  2YU9 J;  2XF6 A;  4P1W A;  1FBS A;  2X6Y A;  2PG4 A;  3GTP J;  1GLN A;  1J9I A;  4A0Y A;  1LEA A;  1RC9 A;  1TWH J;  2Z1D A;  2BGC A;  1MH4 A;  2P5K A;  1LDJ A;  1YS7 A;  3ML6 A;  1RES A;  4XKC A;  2H1L A;  2OQG A;  3CCQ I;  1VQN I;  4Q5S F;  3BTL A;  5CLS A;  2NVX J;  4IHV A;  1PUE E;  5DD4 A;  4U87 A;  3S1M J;  2IW5 A;  4BDY A;  5HDK A;  4I01 A;  1YX3 A;  2DYS H;  5IYC J;  1ZGW A;  1W7P B;  1Y1W J;  3CC4 I;  1TWA J;  3FXO A;  3D1N I;  2OJE D;  3HTS B;  3OIO A;  2F4M B;  4NBQ A;  2LK2 A;  2ZXI A;  3I59 A;  4HX8 A;  2HS5 A;  1LB2 A;  2IGN A;  4ENM A;  1N77 A;  2XGE A;  1PP8 F;  1I1G A;  3HRS A;  4BXF A;  3GFM A;  2Y69 H;  4BAC A;  4KIF A;  5FRM A;  4L5J A;  4CDG A;  2NAZ A;  3CCM I;  2QBY A;  1U5T C;  1LVA A;  4EJT A;  2AHQ A;  2E5Z A;  2CJJ A;  5DCF A;  3M9A A;  1RUN A;  3KE2 A;  2NNN A;  2R7D A;  1APL C;  1BIA A;  1U5T A;  1TLH B;  1J75 A;  1Z6T A;  4CUG A;  4ETS A;  3IRQ A;  2HEO A;  3I64 A;  1U78 A;  4RGR A;  5F0C A;  1MJ9 A;  3GLL A;  3WHC A;  4F52 A;  2V9K A;  3FM3 A;  1ONV A;  1IXS B;  2HKO A;  1F36 A;  1TZL A;  4LMY A;  3F21 A;  4BE1 A;  3CDH A;  2DCE A;  1U9N A;  1I5Z A;  3OV8 A;  3VSL A;  3WGI A;  2K9N A;  1SC7 A;  1FBU A;  2AS5 F;  2NXN B;  3E5U A;  2PJR A;  4X6A J;  2E2J J;  1Y8Q B;  4HAM A;  3L2V A;  1JI8 A;  3HPG A;  5F6F A;  5IYB J;  2EFN A;  2Z5U A;  3K9T A;  3OYM A;  4F55 A;  5ICE A;  1QO0 D;  4W1U A;  4ZZD A;  2RRE A;  3K70 C;  2QWW A;  4OIQ F;  2WAE A;  1YE9 A;  3PO2 J;  1IN4 A;  5JLX A;  1LQ1 A;  5EEH A;  5DM6 F;  1U2W A;  2QQB A;  1W0U A;  4FX4 A;  2DXI A;  1DQU A;  1P92 A;  2CWE A;  4MFD A;  1REP C;  2JVH A;  4CYC B;  2E71 A;  3AKZ A;  2XVC A;  4YII A;  2JA8 J;  1XB4 A;  1Z7U A;  2ZNY A;  3HUG B;  3I3L A;  3ABL H;  4Y17 A;  5FKL A;  3LSM A;  4LLG F;  4A6E A;  1YLF A;  1OCC H;  5HNF A;  4YG2 F;  1IN8 A;  2E2I J;  4I2O A;  2IGM A;  3W6J B;  2CW0 F;  1KZH A;  3KYL A;  4E4H A;  2E19 A;  1W36 D;  1V4R A;  3BPX A;  3TDU C;  1A31 A;  1T95 A;  2UZK A;  1MGT A;  1MMA A;  2EIL H;  4HF2 A;  2XUB A;  3EUA A;  4A3E J;  1FOX A;  2KJC A;  4IHT A;  3A2K A;  1XSX A;  4FT8 A;  3IH2 A;  3KLO A;  1D0X A;  4A3J J;  3CO6 C;  3V7C A;  4C3I J;  1K78 A;  2CV0 A;  3M1E A;  2ZSI B;  4LLN A;  2XGD A;  1RZ4 A;  3IKT A;  4V19 K;  3GZN B;  4DBQ A;  1TNT A;  2P8T A;  2OU2 A;  2L01 A;  3ZQI A;  3SZT A;  1FP2 A;  1WRJ A;  1WWX A;  2N8G A;  3VYR B;  2EV0 A;  4PZJ A;  1TNS A;  2R4G A;  1Y0N A;  2O5R A;  4RM2 A;  1Z05 A;  4ESB A;  3WU1 B;  2R7U A;  1S29 A;  1R58 A;  4LB5 A;  1JT0 A;  2FXA A;  3A01 B;  1A04 A;  2HKX A;  2X85 A;  3BTJ A;  1X4O A;  1RRJ A;  3K1M A;  3K4M A;  2FEZ A;  2VPL A;  1WJE A;  1P7J A;  1X1B A;  3UNG C;  2AXL A;  3BR2 A;  1UAA A;  5D5U B;  2DOE A;  2B0L A;  2PFB A;  2AO9 A;  2CQK A;  2UUZ A;  3VYU B;  2QSH X;  4M74 A;  1FBQ A;  3DTI A;  5LGN A;  1QBJ A;  3E97 A;  3TOA A;  5DV5 A;  2QCO A;  5HLT A;  2ZCW A;  2K9Q A;  2JZY A;  5E1X A;  1BR1 A;  3OYK A;  5CVV A;  3I4N J;  4QTR A;  3KCC A;  3ONQ A;  3R6S A;  4M3B A;  4U0W A;  4ZC3 A;  4GYG A;  5ILU A;  4I76 A;  3J7A O;  5C4J J;  2XDV A;  1BR2 A;  4PK4 A;  3OYN A;  3IH3 A;  3OYG A;  3PNV A;  4M71 A;  5L3B A;  2JVG A;  3R61 A;  3S14 J;  3D0S A;  4A3F J;  5LHH A;  2X9D A;  4DQ2 A;  3WU0 A;  3IUO A;  2QSG X;  4PCQ A;  3IRR A;  5TRD A;  5KHD A;  3OL3 A;  1W5C C;  2L4A A;  3CP2 A;  1NTC A;  1ZH5 A;  4PUS A;  2GZW A;  2MYS A;  3BQZ A;  1IDY A;  5E18 F;  1B6A A;  3K70 D;  3RQ4 A;  2MGQ A;  3HRM A;  5F0H A;  4OMZ A;  5J4Y A;  3NRV A;  2NOG A;  3DPT A;  3HOZ J;  3ZXS A;  4LG3 A;  2UWM A;  2E7X A;  2G7H A;  2GOM A;  2ELH A;  2W4S A;  2CRG A;  2XKP A;  1JUS A;  2GQQ A;  3CZ6 A;  4WXD A;  5D5X B;  5BPI A;  9ANT A;  1LKX A;  3OIQ A;  2EA2 A;  4EGZ A;  1ERD A;  4HNT A;  3CMA I;  5DYM A;  4ZTJ A;  3W3C A;  1P9Q C;  3JAM Z;  3DTK A;  5ED4 A;  4JYK A;  5L3E A;  3OYB A;  4HEA 2;  4L0Z B;  1NHA A;  3RYR A;  4UVB A;  1XGN A;  3GTG J;  2WWY A;  1I6X A;  2XAQ A;  1B4A A;  2Y0S A;  4M3F A;  4A3C J;  5FRO A;  1ZYR F;  1UFM A;  3V8J A;  2DA1 A;  5M5Y J;  1VFC A;  5JFR A;  2WBM A;  2MBF A;  1UCR A;  4UUT A;  2MAB A;  4G8X A;  2PN6 A;  1PYV A;  2FNP A;  2WB1 A;  2XPW A;  3MAJ A;  2VJ4 A;  3WTU C;  1GDT A;  3MKL A;  3PNT A;  1BC8 C;  1EA3 A;  1F1Z A;  2GBY A;  5H6Q A;  1SAU A;  5HS8 A;  1A36 A;  3WGG A;  4LD5 A;  1YJ9 I;  5FLM J;  3JAM K;  2RN7 A;  3DLL F;  2ZBK A;  1GT0 C;  3HL2 A;  3OYC A;  4XLC A;  2WAD A;  1G8X A;  3PIO F;  2XSD C;  1WJD A;  1J7K A;  2FU4 A;  4OOI A;  2DMN A;  4IRG A;  3TOB A;  2NVT J;  4Y33 A;  1T8I A;  2GA1 A;  3CC2 I;  4XLE A;  2XB0 X;  2YUS A;  1NG6 A;  4PDK A;  3ZQC A;  3DU6 A;  2NRA C;  4BHP A;  4IQJ A;  3A4C A;  3OMY A;  2Z9O A;  2EFP A;  2PMZ N;  5IP9 J;  4HDU A;  5F1J A;  3QU3 A;  4Q47 A;  4R1H A;  1S5L C;  3S3O A;  1ZQ3 P;  2M4K A;  4HV6 A;  4XKW A;  3CCS I;  2ME0 A;  1FYM A;  2EWN A;  1ETW A;  2LVS A;  1V3F A;  3BR1 A;  3VB2 A;  3LOC A;  1UB9 A;  2GM4 A;  1T2K A;  3BTC A;  2VJI A;  1N75 A;  4UV8 A;  2HYJ A;  4AC0 A;  4LG0 A;  4M6X A;  3T5X A;  1U8B A;  1JTY A;  1SD7 A;  2VOO A;  2E1N A;  1PUF B;  4TV7 A;  3EYI A;  2DO7 A;  3H1C A;  1YQA A;  2FBK A;  1WJB A;  3CJN A;  1ACI A;  3GTJ J;  2J5P A;  1XDS A;  3S8P A;  5EEA A;  4HLY A;  1RUO A;  4GO1 A;  1YW9 A;  3RKQ A;  1FYK A;  3S1Q J;  2JJ7 A;  3SZG A;  4ZYE A;  1LE8 A;  3ABK H;  1SVO A;  1DU6 A;  3MZH A;  5GPA A;  2HYG D;  1YYV A;  4RB3 C;  1LDD A;  2FBI A;  3FK6 A;  3KIO A;  3LSG A;  4II2 A;  3HOT A;  3I71 A;  3NWS A;  5LRR A;  3HDD A;  3IKV A;  4AVP A;  4KMU X;  3BZC A;  5KAF C;  3KEO A;  3DWL E;  2A05 A;  3I59 B;  1ETQ A;  1SMY F;  1XMX A;  2P6S A;  4IRH A;  1BOA A;  4HW0 A;  5LGU A;  2DTR A;  1JHH A;  1SFK A;  1WQ2 A;  4A12 A;  5CJ9 A;  1UST A;  5CVR A;  2DA2 A;  2O8X A;  2M8E A;  4DIQ A;  4V2F A;  2FMY A;  3O3K A;  2LTP A;  4HQE A;  2WAQ A;  3EDP A;  3I9V 2;  3E5X A;  1SD6 A;  2DOA A;  3A0B C;  2K4B A;  3KEQ A;  1VQP I;  2QBY B;  2X6O A;  3L2W A;  3K69 A;  4PFP A;  4CCL A;  3OR1 C;  3DXJ F;  3KP6 A;  2COB A;  3QPL A;  2DA5 A;  1Z21 A;  2PMU A;  4P5O A;  1QU3 A;  4MEY F;  1FTZ A;  2ZFW A;  5ILV A;  2ID6 A;  4PGH A;  4EV0 A;  1IF1 A;  3L1P A;  1WGX A;  1XGS A;  2KRC A;  2R7F A;  2V6C A;  3HRU A;  1ODD A;  2IA1 A;  1J59 A;  3HOU J;  3J80 Z;  2XHK A;  3PSF A;  4WCG A;  2STW A;  1XSV A;  3C18 A;  2QSF X;  2KDZ A;  3K4J A;  3LFK A;  4BY7 J;  1GVD A;  1MJB A;  1S7E A;  4X1E A;  2V1D A;  5IYD J;  2LFB A;  3IL2 A;  5FLV A;  5J1U A;  5GPC A;  5GAH J;  3EPZ A;  3WTZ A;  4XLF A;  1ZRD A;  2L9V A;  2VE8 A;  4MTD A;  4C3H J;  1X3W B;  4EVI A;  4DOZ A;  3P9I A;  2R3S A;  4V2G A;  2KP6 A;  1ZR4 A;  1BI3 A;  1R1T A;  3KZI C;  4ENK A;  1ETO A;  2E7W A;  3VYS B;  3OYH A;  3LFU A;  4KA4 A;  5HS9 A;  5K5Q A;  2LH9 A;  3MCZ A;  2W7N A;  3E6C C;  2KIQ A;  3QOD A;  3WU2 C;  1R71 A;  3TMO A;  4OU0 A;  2VUM J;  1FJL A;  2RGV A;  4RDU A;  4D7M A;  3I54 A;  3J80 K;  2QQ8 A;  4E7J A;  2VT3 A;  3ZCO A;  5EGO A;  3OWT A;  2HDD A;  4C3J J;  2BXZ A;  2F5C A;  5HNH A;  3GX4 X;  2P4W A;  4ESJ A;  3M3Y J;  1XMK A;  2HQ5 A;  2PJP A;  3G4S I;  2KMU A;  3C1D A;  2LY9 A;  2DBB A;  4CO8 A;  1KYW A;  2PBI A;  2XRN A;  1UJ8 A;  5J8F A;  3S16 J;  3V8L A;  3BY6 A;  3EYY A;  1I3Q J;  3FXM A;  1U3E M;  4MEX F;  1GV5 A;  3DFG A;  3RI4 A;  1K61 A;  2DT5 A;  3T8T A;  3LA2 A;  2F4I A;  2ZO4 A;  2IGK A;  3TQN A;  3ABM H;  2FOK A;  5TIS C;  1G3T A;  3ZMU A;  2VKV A;  1P2F A;  2XF5 A;  1ZN2 A;  4HBL A;  3LSH A;  3U1K A;  4P9U A;  1K78 B;  1WJC A;  3S2D J;  1XGO A;  1V5G A;  1HLV A;  1VQK I;  3KYD B;  4IOA F;  4BDZ A;  3R0A A;  3DF8 A;  4M3D A;  4AVZ A;  4U0Y A;  4Y3O A;  4BXU A;  4MHG A;  2Z33 A;  1WSU A;  2JUC A;  4XSX F;  1AA7 A;  1OR7 A;  3TKY A;  1CQT A;  3L00 A;  2EIM H;  3RPU A;  2Z99 A;  2KRF A;  3J7Y J;  1KYZ A;  2UV1 A;  3JTH A;  3REO A;  4PFO A;  1K4S A;  1H8A C;  1IG7 A;  4JK1 X;  4RAY A;  2IRF G;  5ERI A;  2CFX A;  3DKY A;  1K4T A;  4F3Q A;  3LSK A;  4LLL A;  1DPU A;  2EV6 A;  2HQA A;  1P7I A;  2M7B A;  1B8I B;  1FX7 A;  2X6X A;  4JX4 A;  1A6Q A;  2XF7 A;  3ZN0 A;  4ZYG A;  4L18 B;  5HDG A;  1A5J A;  1TW3 A;  1GV2 A;  2KPM A;  2IBD A;  3EUH C;  1B59 A;  3I53 A;  1HC8 A;  1FY7 A;  4AWX B;  1H9G A;  3H5R A;  2NVY J;  2ZC2 A;  2W1O A;  3F8N A;  2LMD A;  1MNM C;  3JRD A;  2TCT A;  3EUH A;  1Y8R B;  2JA7 J;  4M6Y A;  1TBX A;  2H1K A;  3PIP F;  2YSR A;  2LF8 A;  4OIR F;  3DEW A;  4GRI A;  1MSE C;  2CH0 A;  2D1V A;  1QVU A;  4D7N A;  3TO6 A;  4EMS A;  2WC2 A;  3ELK A;  3HG9 A;  1Z7L A;  2M87 A;  2ICW G;  1OQY A;  5DUI A;  3LAJ A;  1SFU A;  3DLA A;  2KQR A;  2P81 A;  3JR9 A;  2ESN A;  2Y9Y A;  2VQL A;  3G3Z A;  3ZMZ A;  5DM7 F;  1J5Y A;  1SAN A;  5EG0 B;  2BW3 A;  2KIF A;  1LPQ A;  5ICC A;  2LBF A;  1I39 A;  4XRS G;  5F1R A;  2LNB A;  2HI3 A;  1IN6 A;  1DP3 A;  2R5Y A;  2X1E A;  2R7T A;  4G7H F;  3RPQ A;  3ZQ7 A;  3F6V A;  2CQX A;  2NS0 A;  2DW4 A;  3DBH B;  1M1E B;  1DPR A;  3OS1 A;  2QQ9 A;  5D8L B;  4XID A;  2LLK A;  3M1C A;  3V4G A;  3GF2 A;  2LF7 A;  3H3V K;  3M07 A;  1IZ1 A;  2BOL A;  2DMU A;  3DCF A;  1JT6 A;  1KU3 A;  2DDB A;  2VOP A;  2I5U A;  4PSW A;  2GIV A;  3CUQ A;  1O3T A;  1POG A;  1WJA A;  3OYL A;  1G2H A;  2R7Q A;  4KUM A;  2HVQ A;  2R5Z A;  1A6I A;  4PJL A;  1EKE A;  3G73 A;  3JRG A;  2OAZ A;  2M3A A;  1O3Q A;  1N78 A;  3L9F A;  1RKT A;  2AXT C;  1BI0 A;  4GXO A;  3WTS C;  1ON2 A;  5LHG A;  2ZKZ A;  5F27 A;  1EH6 A;  3QPT A;  4IF4 A;  3MKY B;  2CSO A;  5LHI A;  2QKL B;  1ZG1 A;  4HNV A;  2EZH A;  3MWM A;  1SFO J;  3SHF A;  3DEU A;  2IS4 A;  1RR7 A;  1E3P A;  2BY3 A;  2MLK A;  2NOJ B;  3ZMV A;  1H0M A;  3ZRG A;  3WTW C;  2MH2 A;  4Y15 A;  5IT3 A;  5L3C A;  1VND A;  5K7H A;  2DJN A;  3QYE A;  1VTN C;  3CCE I;  3ZN1 A;  2DJI A;  1SFE A;  2K9L A;  4PJM A;  2K9S A;  1FMV A;  3BR5 A;  2D1H A;  3ZQH A;  4HA8 A;  1XGM A;  3V42 A;  2GOX B;  1ETX A;  1JHF A;  3RPU D;  3RDI A;  4AIK A;  4O3M A;  1EV7 A;  5TGT A;  2GWR A;  1GVJ A;  4NC6 A;  4M3E A;  3UKG A;  1CF7 A;  1BL0 A;  4C2T A;  1W5S A;  3D5R C;  2GXA A;  1JGS A;  5DDG A;  1U9O A;  1MMS A;  2FJ1 A;  3G1M A;  2EJR A;  4IVN A;  3HKZ N;  4AIH A;  4NB5 A;  3HOV J;  4EJW A;  3OY9 A;  4KDP A;  4K2E A;  3ASO H;  3K1P A;  4WX9 A;  2CUF A;  4J01 A;  3H9G A;  2W00 A;  4AD9 A;  1ON1 A;  2DFE A;  4HSR A;  5E20 A;  1X1P A;  4N4N B;  4WK8 F;  4Q4Z F;  3MFK A;  4LG0 B;  3LSP A;  2L9N A;  3ERE D;  4YFX F;  1W4M A;  4CYD A;  4F92 B;  4LGW A;  1D1C A;  4AYB A;  4QIW N;  1ZR2 A;  1IRG A;  2OPT A;  5C3E J;  5E8G A;  2VON A;  4CZC A;  5D8K B;  3N05 A;  1OKR A;  4HV5 A;  5FGM A;  1YHQ I;  3CJQ B;  3HB9 A;  4YRV A;  2B7E A;  3JRB A;  3ASN H;  1OPC A;  1XDU A;  1AWC A;  2CQQ A;  4RLF A;  1LE8 B;  4RGS A;  2L5Q A;  1D3Y A;  2OCE A;  5JR3 A;  3FXU A;  4G6D A;  1E3O C;  1VQ5 I;  2EK5 A;  4CCK A;  4NHJ A;  2BYV E;  4IO9 F;  2QYO A;  4ZYD A;  2V4J C;  2BHY A;  4M9S A;  3N97 A;  4GDF A;  2DT6 A;  3P9C A;  1DGW Y;  1HA8 A;  2FBH A;  1RIO H;  1HCR A;  1TQP A;  4CGZ A;  3SDG A;  3BJA A;  4BY1 J;  4ASN A;  3MQ0 A;  4G7Z F;  5IY5 H;  4EM1 A;  4XN3 A;  2VKH A;  4E7K A;  2ELJ A;  4D0P A;  2QUF A;  4LK1 F;  3RKW A;  2V9V A;  3QP6 A;  4RLQ A;  2KZV A;  2CV1 A;  4MGR A;  2YX4 A;  3HSR A;  3HRT A;  1G59 A;  1HKS A;  2QEN A;  4EJU A;  3GO5 A;  5LD2 C;  2X48 A;  1Y1V J;  1NG7 A;  1XN7 A;  4L9J A;  3K10 A;  2FQ3 A;  3TDZ C;  2IS6 A;  4M73 A;  3M4O J;  1MMN A;  2M0M A;  3SEZ A;  1WPK A;  1XTA A;  4KIT B;  2BBY A;  1AU7 A;  2EIK H;  5CPR B;  3BG5 A;  3QWL A;  4NC7 A;  1YIT I;  1JKO C;  4XKV A;  1BOB A;  3KYC B;  1R49 A;  2F5V A;  3IV5 A;  2A6T A;  2K4J A;  2ISZ A;  1YG2 A;  2RAE A;  4BEH B;  1YS6 A;  3LST A;  3LSI A;  2EFO A;  4XOR A;  3V7S A;  2V26 A;  1LFB A;  2OZU A;  4WXH A;  3IAM 2;  2XB5 A;  4LK0 F;  5GP9 A;  1MDM A;  3CCY A;  2QA4 I;  2L54 A;  2NVU B;  1XG1 A;  2CU7 A;  3MVP A;  3KP3 A;  4UB8 C;  5IP7 J;  4BE2 A;  2LY1 A;  2VBZ A;  2DU9 A;  3TL4 X;  3V8K A;  2DTZ A;  2DA7 A;  3P5J A;  2F5F A;  3IH4 A;  2E60 A;  4ZZL A;  3BR6 A;  2A61 A;  2JA5 J;  4YFN F;  2H6C A;  2WTE A;  6PAX A;  2W85 A;  1TWC J;  2V1X A;  4BGD A;  5LEK A;  5EGO B;  4YIR X;  4EJV A;  1AOY A;  4NDL A;  3GFI A;  2YR2 A;  1I3A A;  1S7A A;  4OWR B;  2IJL A;  3BG3 A;  2M0C A;  3K1N A;  2HR3 A;  1YIJ I;  3GFJ A;  3W2W A;  3SYT A;  3WG9 A;  3ERM A;  3H9J A;  3M8E A;  5J40 A;  2EFQ A;  1LJ9 A;  4ITV A;  2VN2 A;  3K6G A;  3WE2 A;  2K27 A;  2E1C A;  4XQF A;  2MA3 A;  3DEE A;  2M4G A;  3I4M J;  2QZ8 A;  1XD7 A;  3GTL J;  3AL0 B;  3MMY B;  1RPW A;  3C2G A;  3LNQ A;  5E8I A;  3QAH A;  2ZJP F;  3OS0 A;  4U0V A;  1YJN I;  3S32 A;  2LYC A;  5D4S A;  4KIG A;  5JHF A;  2E1M C;  2D5V A;  4CA0 A;  5FKN A;  3DPU A;  1D0Y A;  2L4M A;  4ENJ A;  1BN5 A;  3PUF A;  4NNJ A;  3HYI A;  3CLO A;  5D6F A;  4A0X A;  4IX7 A;  1Y39 A;  1KU7 A;  2P7V B;  4N9I A;  3BZK A;  2O6G E;  2ELK A;  2O0Y A;  1LNW A;  4D5C A;  1BA5 A;  4BJ6 C;  2H8R A;  2HGC A;  3JRH A;  3FWE A;  3QPH A;  1F9N A;  4BBR J;  2MSY A;  4FX0 A;  1XSD A;  1ZLJ A;  2M8G X;  2DA6 A;  3NEU A;  1TL8 A;  2ECB A;  2W24 A;  2WAF A;  2LKS A;  1RNL A;  1W1W E;  5H6R A;  4C9Y A;  2IS1 A;  1KGS A;  2DAO A;  1GXP A;  1B72 A;  4UB6 C;  4OAZ A;  2DPD A;  2M2E A;  2Y75 A;  1LVK A;  2JSC A;  3AG4 H;  1YRN B;  2FOW A;  4B47 A;  2R7W A;  2KLO A;  1ZTR A;  2O9L A;  1YOV B;  2DK8 A;  1FC3 A;  3MKZ A;  1X1C A;  4Q48 A;  5BOX A;  3F8M A;  2JN6 A;  3JTG A;  2X0L A;  2BW3 B;  4N4O B;  3PO3 J;  2GIZ A;  2LBF B;  1Z0X A;  4HNU A;  5B5E C;  2R5Y B;  3E3V A;  1B9M A;  4AM3 A;  3DV8 A;  1BI1 A;  1D1B A;  4E6K G;  2FA5 A;  3FM5 A;  1G4D A;  4A2U A;  3R4K A;  1J09 A;  3MN2 A;  5GAE J;  5EZH A;  1JXS A;  5CQG A;  4XLA A;  4XON A;  5L3G A;  1SD4 A;  1QZY A;  3ZGK A;  5D5V B;  4L9V A;  3BCA A;  1MH3 A;  2F48 A;  3CUQ B;  2E5N A;  3C3W A;  5DEQ A;  3FXQ A;  4NQW B;  4CZZ A;  3PUB A;  2XSJ C;  3FMR A;  1V5F A;  2JWT A;  2LSO A;  2MH9 A;  2V79 A;  3IP4 B;  3KP4 A;  2R5Z B;  4A93 J;  3FXK A;  4MLO A;  1FMW A;  4CCN A;  4KYW A;  3P7N A;  2HOT A;  1T33 A;  5IPA A;  3E6M A;  2D45 A;  2K40 A;  1LFU P;  3PJR A;  3JCU C;  4YIF A;  3B6A A;  2AQF A;  4LIT A;  4UUS A;  2XKO A;  2R0Q C;  3WHB A;  1S3J A;  2HXI A;  3AFH A;  3QPS A;  1OCT C;  5JLW A;  1IGN A;  2L9R A;  2Y0S N;  2XPV A;  2IA2 A;  5B66 C;  4IKF A;  1ETY A;  1R5I D;  4RB0 A;  2MG4 A;  2KJB A;  3CTA A;  3HSF A;  3G2B A;  4Z2Y A;  3AAF A;  1O3R A;  3KLN A;  3ZPL A;  5JVG F;  2WY8 Q;  3GTQ J;  1Z67 A;  4C30 A;  3M7G A;  4II3 A;  2Q2E A;  5IP6 A;  5AIP A;  4UVC A;  5M5X J;  2QKM B;  1AKH A;  4HF1 A;  2WV1 A;  4BQO A;  1OCR H;  4XRS A;  4BE0 A;  3LAP A;  2YPR A;  2CW8 A;  1TP4 A;  4NUB A;  3K4B A;  3PQK A;  5FKO A;  1CF7 B;  2RC4 A;  3VYT B;  2O03 A;  3RYP A;  1BJA A;  2CUZ A;  4A5M A;  2XRO A;  2LD5 A;  2HVR A;  5HLI A;  3JW4 A;  2NNY A;  2XRL A;  4QSH A;  1VQ4 I;  2M5W A;  4E70 A;  3PNY A;  3AG3 H;  2IAI A;  3JSP A;  1FSE A;  1R5H A;  3TED A;  3HHG A;  1K6O A;  1D0Z A;  2STT A;  3GZ5 A;  2CFO A;  1BW6 A;  4HX4 A;  3OYD A;  1O57 A;  4DW6 A;  1QZZ A;  2DMP A;  3SXY A;  5A2Q Z;  1OYY A;  4DYC A;  5DUK A;  2OD5 A;  3PQJ A;  2DT7 B;  3BOQ A;  2CGP A;  3K7A J;  4HLX A;  4H0E A;  3FIW A;  3FMS A;  4NC8 A;  3FXJ A;  1QVT A;  1BI2 A;  3S17 J;  4IZZ A;  1U5T B;  5ILS A;  3QQA A;  4EM0 B;  3CLQ A;  2IXS A;  3HZJ A;  4MO7 A;  5DD8 A;  3EQL F;  3FF5 A;  3KZZ A;  1OFC X;  2KDO A;  2A07 F;  5FRN A;  3F8C A;  3WTX C;  3A0H C;  2ME6 A;  5J8C A;  1FPQ A;  2JRM A;  2VPR A;  3FZV A;  2PJR B;  3RJP A;  1H89 C;  5B1B H;  2MD0 A;  1JKP C;  1QGP A;  1HKQ A;  3RZD J;  2DFI A;  2XAS A;  1T0F C;  1IRZ A;  3KFW X;  5A2Q K;  1FOW A;  4BAY A;  3CF5 F;  2LG4 A;  2H09 A;  3HIF A;  3FXR A;  3HUG A;  4FAS D;  4EM2 A;  2LP0 A;  4U7D A;  3OIP A;  3SFI A;  1WI9 A;  3HC7 A;  1O3S A;  3RIR A;  4HYE A;  5BQT A;  1VQ8 I;  3B73 A;  2M1B A;  1L3L A;  4O6J A;  1HDP A;  1VQ9 I;  3FKI J;  2DK5 A;  3F9K A;  3A1Y A;  1ZGJ A;  2KIU A;  1R00 A;  2WAQ N;  2EIJ H;  2Q1Z B;  2Z3Y A;  1E0E A;  1BR4 A;  3C7J A;  4XKB A;  4IL6 C;  2VLA A;  4CIC A;  1HDD C;  4E7H A;  1STZ A;  3COA C;  1SVM A;  2X4H A;  2EH3 A;  1QZE A;  4FET A;  5FKM A;  3OL4 A;  1Q1H A;  2Q8K A;  1L0O C;  2COM A;  3W2V A;  3ZQG A;  5DCM A;  3O6B B;  3Q0U A;  3BP8 A;  4I09 A;  5F04 A;  2H8W A;  3CJT B;  5LRS A;  3LQQ A;  1ITY A;  2Y31 A;  1B9N A;  3CD6 I;  4FIS A;  3WG7 H;  2LY2 A;  5DTD A;  2R7V A;  3ZQL A;  4L5E A;  2CMP A;  5ICF A;  2HDC A;  2VKD A;  2KIM A;  3GW2 A;  1X19 A;  4RM3 A;  3IC7 A;  3PFY A;  5AON A;  4XRF A;  1DUX C;  3BDD A;  2G7U A;  1ZG5 A;  2A6E F;  2GA2 A;  4F7Z A;  4FTH A;  4N9H A;  1HSJ A;  3WTV C;  4ZDP A;  4BHC A;  2CQ7 A;  3OSG A;  5E3O A;  4LJZ F;  2R7X A;  4XLP F;  4KMF A;  1K83 J;  3EUK L;  2FD5 A;  3S3M A;  3V7R A;  2UXX A;  2VB6 A;  1XCB A;  3J81 Z;  4HX7 A;  4E7I A;  4F91 B;  2KZG A;  2Q0O A;  4B4C A;  2QGU A;  4GGG A;  2HZD A;  3LQR A;  1JKR C;  2G9W A;  3GVA A;  2EFW A;  1IC8 A;  1VQM I;  3F22 A;  3OS2 A;  4N0B A;  3OYA A;  2CUE A;  5JVT A;  1EF4 A;  2GXB A;  1Y0U A;  2FX0 A;  3RKX A;  3LSR A;  2OTL I;  3HOY J;  4RB2 C;  1RKW A;  1HQC A;  2DDA A;  4A3L J;  3GEZ A;  3WTY C;  1K79 A;  2P0W A;  3JSO A;  1X1A A;  3L09 A;  4HQM A;  1NK2 P;  2RVC A;  3H5N A;  5AIQ A;  3DBR B;  4D5F A;  2X6W A;  3A02 A;  4GYI A;  2IEK A;  4OMY A;  3H3U A;  3CQZ J;  1H88 C;  3J81 K;  2M9H A;  4IHX A;  5HLH A;  5F08 A;  1X58 A;  3BPV A;  2HDW A;  2RQP A;  3LA7 A;  2H6B A;  2E1M B;  2R7R A;  3R0J A;  1FOK A;  4XNF A;  5HDN A;  1EJ9 A;  1ZKG A;  2K85 A;  2IGO A;  2XAJ A;  3ZQQ A;  3F72 A;  2HZT A;  2B9S A;  2JK3 A;  2W48 A;  4BL0 B;  1HKT A;  3GTO J;  4DYR A;  3PL8 A;  4KNY A;  3E5Q A;  5BPD A;  3I5U A;  2E36 A;  1FNN A;  2E34 A;  4HZF A;  4KT5 C;  2BV6 A;  1ENH A;  3BQY A;  3H3Z A;  1YTY A;  4G94 A;  1QRY A;  1Y6I A;  3E6B A;  1QNT A;  1B72 B;  1YX5 A;  2M34 A;  5HOD A;  2VOD A;  3UR3 C;  3HSE A;  2D2W A;  4DZJ A;  2VIX A;  2X1D A;  3CDL A;  3ZOB A;  5IT9 Z;  1V5E A;  2MW8 A;  2R7O A;  2DFF A;  2HPI A;  2EQR A;  4OIO F;  2DLL A;  2ZXW H;  3G1L A;  1K6Y A;  1HBX G;  5K1Y A;  2OUM A;  3E0J B;  2V1U A;  1N25 A;  2A5W A;  1WJ5 A;  2DOD A;  1Z6R A;  4A0Z A;  1BBY A;  3ZP5 A;  3HTU A;  1VQ6 I;  5KK1 A;  3HBL A;  3SEQ A;  3B02 A;  1NH3 A;  1O7F A;  2XAU A;  4HF0 A;  3CMY A;  1IW7 F;  5LLQ A;  1WI3 A;  4P96 A;  2RNG A;  3HGY A;  3ZQF A;  4KT6 A;  4EAT A;  3LA3 A;  2RDP A;  5FD5 A;  1XS9 A;  1WH7 A;  1T6S A;  4G6T B;  1G6N A;  2Y9Z A;  4XMY A;  4QPO A;  2XGC A;  3VOE A;  2F5E A;  5E3N A;  3EET A;  3GUD A;  2PX9 A;  3BCB A;  3O8H A;  2LRE A;  3QOE A;  4KN4 X;  3TBI A;  5IT9 K;  4IHS A;  3K4K A;  1T38 A;  2P5L C;  3GBG A;  4B48 A;  1YFH A;  1NK3 P;  4L9N A;  3GWZ A;  2ZB9 A;  3IWZ A;  3L2Q A;  2JTV A;  5J1R A;  1IDZ A;  4BU2 A;  3WE3 A;  1XMA A;  3AG1 H;  2K3P A;  5CVI A;  5B3S H;  2W84 A;  3Q9S A;  4IRI A;  1X2N A;  4U88 A;  5DS9 A;  2BE5 F;  3ECH A;  1XX5 A;  3SJM A;  3KP2 A;  3SFZ A;  1MBF A;  4H4K C;  3BR0 A;  2DMT A;  2MLG A;  1Z3Y A;  2YU3 A;  4UUS B;  1SEU A;  1IAW A;  3Q5F A;  2DPU A;  2VC1 A;  1PUF A;  1BM9 A;  2Y2Z A;  1F43 A;  1OCO H;  1WHU A;  3F6O A;  4B44 A;  5JI6 A;  5B1A H;  2FSW A;  4PJN A;  1V55 H;  1EH8 A;  4G12 A;  4UNO A;  1IV6 A;  4UVA A;  3RZO J;  4XL9 A;  1Y56 A;  5EJC A;  1U8R A;  3FX3 A;  4IXA A;  3TO7 A;  3H36 A;  4P55 A;  1FYL A;  4BH9 A;  3RSN A;  2Q2E B;  2HFH A;  2AQE A;  4CCO A;  1AKH B;  3AG2 H;  5H2F C;  1PP7 U;  2PMH A;  4FQG A;  3ZR8 X;  2LDU A;  1UZC A;  1X3U A;  1HST A;  1WCM J;  4HOB A;  4ABZ A;  4ZDL A;  4M9X A;  2HTS A;  3MEX A;  4AU7 A;  3HOX J;  4I99 C;  3I0T A;  5K7F A;  4BKX A;  4UHT A;  3GTM J;  3TGN A;  2R7Z J;  2CW7 A;  1HW2 A;  2CO5 A; 
#chains in the Genus database with same CATH homology
 4RB1 A;  5HOO A;  3LWF A;  3O2P E;  2A69 F;  1F4K A;  5HVQ C;  2P7C B;  2Y48 A;  3WGH A;  1J0R A;  2EB7 A;  2HQN A;  3BRO A;  2ZJ2 A;  4CHU A;  2A3S A;  2ISY A;  2VBX A;  3MZY A;  1ZRF A;  5D5W B;  5FFZ A;  2IA0 A;  3CUO A;  1R7J A;  2Y0M A;  1FLI A;  4R79 A;  5K5R A;  2KKO A;  1S8N A;  3SQN A;  4O5V A;  4BHB A;  2XIG A;  4M9Z A;  4B09 A;  3P9K A;  2HWV A;  1YO5 C;  5FO5 A;  3BJO A;  2W25 A;  5FD6 A;  3IHU A;  5BMZ A;  3M8F A;  3FMQ A;  1KU9 A;  1W5T A;  1GHC A;  4ON0 A;  1ZLK A;  1MD0 A;  2BEO A;  2ESH A;  2H94 A;  4RGU A;  4MQ9 F;  3K0L A;  3ECO A;  1D8K A;  1JE8 A;  1R36 A;  2HOE A;  4S05 A;  1MKM A;  1MJA A;  2JPB A;  1J2X A;  4S04 A;  3F8F A;  3ISP A;  2GAU A;  1Z91 A;  1S6L A;  3S2W A;  5LGT A;  5HLG A;  3D5L A;  4G9Y A;  2QM3 A;  3W6K B;  4L0Y B;  5DCM B;  2RNJ A;  2QQA A;  2FF4 A;  4XSZ F;  5E1Z B;  3WOD F;  1H9T A;  4Y13 A;  4QLC U;  4WF2 A;  4HDV A;  2XGX A;  2IP2 A;  1T98 A;  3L7W A;  5TJJ A;  2IVM A;  5HS7 A;  1P4A A;  1SFX A;  1XCV A;  4YFK F;  2P6T A;  1HXD A;  2GXG A;  1G3Y A;  3T0Y A;  1TW2 A;  3GFL A;  1OMI A;  3ROU A;  3VOD A;  1OYW A;  2PLY A;  4BNC A;  4RS8 A;  5F64 A;  1S7O A;  4I98 B;  2HTJ A;  2EA4 A;  2VC0 A;  2ADU A;  3QP5 A;  1HW5 A;  2L3D A;  5CVJ A;  4GCV A;  4RAZ A;  4IPA A;  1IN5 A;  3GZ6 A;  5KVR A;  1QPM A;  2ZME A;  1K7A A;  4AIJ A;  2HQR A;  4EQQ A;  3H92 A;  5FLX Z;  3N4M A;  2M30 A;  3RKY A;  3U9G A;  2MC3 A;  2ZXJ A;  1E2X A;  1KQ8 A;  3Q9V A;  2C6Y A;  2F2E A;  2ETH A;  4JBA A;  2XAH A;  4WXC A;  1KQ9 A;  4IJA A;  1RI7 A;  3BJ6 A;  1LEB A;  1TQI A;  1MZB A;  2VBW A;  2OQR A;  4I02 A;  4I0B A;  5FLX K;  4I7H A;  1G3S A;  1O7L A;  2DI3 A;  4UV9 A;  1BC7 C;  4OIP F;  1ZHF A;  3ZMT A;  4RGX A;  3TO9 A;  3GLX A;  4R8H A;  4EJO A;  2M45 A;  4KIB A;  2XAF A;  5E17 F;  3KP5 A;  1DP7 P;  3F3X A;  5H20 A;  2FRH A;  1IXR C;  2JRT A;  3NQO A;  2FML A;  2K02 A;  1R1U A;  3PFI A;  1W7P A;  3GYH X;  4QWQ A;  3U2R A;  4L5I A;  1R1V A;  4EGY A;  3IWF A;  1G3W A;  4DNC A;  4KFC A;  2P5V A;  3QU6 A;  5FB2 A;  1ZRC A;  3KET A;  2EV5 A;  2OA4 A;  1FP1 D;  5BS6 A;  2TDX A;  3E6D A;  4P9F A;  1P4X A;  3KP7 A;  2VT2 A;  3L2C A;  1P6R A;  4ZH4 F;  1LDK B;  3DKW A;  4L9T A;  2VBY A;  4LFU A;  5JHU A;  1IN7 A;  1IUY A;  4OIN F;  1I27 A;  3K2Z A;  4ESF A;  1HW1 A;  5J6X A;  3FHZ A;  4G6Q A;  5LEJ A;  4WWC A;  4XLN F;  1I1S A;  1FZP B;  1TTY A;  3ULQ B;  3WTT C;  1FT9 A;  4M72 A;  1T0F A;  3BZ6 A;  1FWZ A;  2W57 A;  5K5O A;  4A6D A;  4BYY A;  4BQA A;  3R60 A;  2PI0 A;  2OBP A;  2DQR A;  1WKM A;  5CVU A;  1IXC A;  1ZG3 A;  1SD5 A;  4ZYH A;  2MD5 A;  2H27 A;  4ENN A;  1USS A;  1R23 A;  1MDM B;  2PEX A;  2UXN A;  3ZMD A;  4A5N A;  2IT0 A;  3QRF F;  2K86 A;  2ZNZ A;  1GXQ A;  3QOP A;  2FNA A;  1CGP A;  1W7P D;  1C0W A;  1SMT A;  2YX7 A;  3OOP A;  3GXO A;  4CXF A;  5L3D A;  1KA8 A;  1FSH A;  1UHM A;  2XAG A;  3I4P A;  2VE9 A;  3I58 A;  3T1B A;  2QLZ A;  1TQM A;  5EEG A;  1KU2 A;  4G7O F;  1QQI A;  1R22 A;  1UHW A;  5ICG A;  1SAX A;  1Z9C A;  1D5V A;  2L02 A;  1ZAR A;  5D6E A;  2OZ6 A;  1YW8 A;  1OYI A;  2VXZ A;  3U1D A;  2K7L A;  5E1W A;  4KIC A;  3DP7 A;  1YIO A;  2A68 F;  3ABT A;  2RV8 A;  2F5D A;  2CG4 A;  3DQV C;  1U6G A;  5FFX A;  2O61 A;  2FE3 A;  2J5O A;  3KZY A;  3HOS A;  1P4W A;  4U7B A;  4MQV A;  2CYY A;  3SZP A;  1YW7 A;  3F8B A;  2PQ8 A;  5LBQ A;  1F5T A;  1EH7 A;  2IPQ X;  1IRF A;  2XV4 S;  3ABU A;  1R5G A;  4I0A A;  2HYF A;  1B1B A;  4KN7 X;  5D4R A;  3F23 A;  2A6H F;  2ZME B;  2O3F A;  3CUQ C;  4FHT A;  3T8R A;  3VEP A;  3ZMS A;  1ULY A;  2JT1 A;  1KQ0 A;  4NQW A;  2RKH A;  4B8X A;  1E17 A;  1DDN A;  4LB6 B;  1Z1D A;  2DQL A;  1BIB A;  2JPC A;  3HHH A;  1PDN C;  1ZGA A;  2LKP A;  4JQF A;  4XBF A;  1D8J A;  1ZRE A;  4UUV A;  5CYV A;  5L3F A;  2QVO A;  3CO7 C;  2ACJ A;  3RTR A;  2A5Y B;  3VFZ A;  3BWG A;  3DPL C;  1T39 A;  4PGG A;  4UXN A;  4MTE A;  1ZAO A;  4MNU A;  2WV0 A;  2NYX A;  1FBS A;  2PG4 A;  1J9I A;  4A0Y A;  1LEA A;  2BGC A;  2P5K A;  1LDJ A;  1YS7 A;  3ML6 A;  2OQG A;  4Q5S F;  5CLS A;  1PUE E;  5DD4 A;  2IW5 A;  5HDK A;  4I01 A;  1W7P B;  3HTS B;  3I59 A;  4HX8 A;  2HS5 A;  1LB2 A;  4ENM A;  1PP8 F;  1I1G A;  3HRS A;  3GFM A;  4KIF A;  4L5J A;  4CDG A;  2NAZ A;  2QBY A;  1U5T C;  1LVA A;  4EJT A;  5DCF A;  3M9A A;  1RUN A;  3KE2 A;  2NNN A;  2R7D A;  1BIA A;  1U5T A;  1TLH B;  1J75 A;  1Z6T A;  4ETS A;  3IRQ A;  2HEO A;  3I64 A;  1U78 A;  4RGR A;  1MJ9 A;  3FM3 A;  1ONV A;  1IXS B;  2HKO A;  4LMY A;  3F21 A;  3CDH A;  1I5Z A;  3OV8 A;  3WGI A;  1FBU A;  2AS5 F;  3E5U A;  4HAM A;  5F6F A;  2EFN A;  2Z5U A;  3K9T A;  5ICE A;  1QO0 D;  4ZZD A;  2QWW A;  4OIQ F;  1IN4 A;  1LQ1 A;  5EEH A;  1U2W A;  2QQB A;  4FX4 A;  1P92 A;  2CWE A;  1REP C;  2XVC A;  4YII A;  1XB4 A;  1Z7U A;  2ZNY A;  4Y17 A;  4LLG F;  4A6E A;  1YLF A;  4YG2 F;  1IN8 A;  4I2O A;  3W6J B;  2CW0 F;  1V4R A;  3BPX A;  3TDU C;  2UZK A;  1MGT A;  4HF2 A;  2XUB A;  2KJC A;  4IHT A;  1XSX A;  4FT8 A;  3KLO A;  3CO6 C;  3V7C A;  1K78 A;  3M1E A;  4LLN A;  1RZ4 A;  3IKT A;  1TNT A;  2P8T A;  2OU2 A;  2L01 A;  3SZT A;  1FP2 A;  1WRJ A;  1WWX A;  2EV0 A;  4PZJ A;  1TNS A;  3WU1 B;  1Z05 A;  4ESB A;  1S29 A;  1R58 A;  4LB5 A;  2FXA A;  1A04 A;  2HKX A;  3K1M A;  2FEZ A;  2AXL A;  5D5U B;  2B0L A;  2PFB A;  2CQK A;  4M74 A;  1FBQ A;  5LGN A;  1QBJ A;  3E97 A;  3TOA A;  5DV5 A;  2ZCW A;  2JZY A;  5E1X A;  5CVV A;  3KCC A;  3R6S A;  4U0W A;  4GYG A;  5ILU A;  3J7A O;  4M71 A;  5L3B A;  3R61 A;  3D0S A;  5LHH A;  4DQ2 A;  3WU0 A;  4PCQ A;  3IRR A;  5TRD A;  2L4A A;  1ZH5 A;  2GZW A;  5E18 F;  1B6A A;  3HRM A;  4OMZ A;  3NRV A;  3DPT A;  2UWM A;  2E7X A;  2G7H A;  4WXD A;  2ELH A;  2XKP A;  5BPI A;  2GQQ A;  5D5X B;  2EA2 A;  4EGZ A;  5DYM A;  3JAM Z;  5ED4 A;  5L3E A;  4L0Z B;  1NHA A;  3RYR A;  4UVB A;  1XGN A;  2WWY A;  1I6X A;  2XAQ A;  1B4A A;  1ZYR F;  1UFM A;  3V8J A;  5JFR A;  2MBF A;  1UCR A;  4G8X A;  2PN6 A;  2FNP A;  3MAJ A;  3WTU C;  1BC8 C;  1F1Z A;  5H6Q A;  5HS8 A;  3WGG A;  4LD5 A;  3JAM K;  2RN7 A;  2ZBK A;  1J7K A;  2FU4 A;  4OOI A;  4IRG A;  3TOB A;  2GA1 A;  4PDK A;  2NRA C;  4BHP A;  2Z9O A;  2EFP A;  4HDU A;  3QU3 A;  4Q47 A;  4R1H A;  4HV6 A;  1FYM A;  2EWN A;  1V3F A;  3VB2 A;  1UB9 A;  1T2K A;  4UV8 A;  4LG0 A;  4M6X A;  3T5X A;  1SD7 A;  2VOO A;  2E1N A;  4TV7 A;  3EYI A;  2DO7 A;  1YQA A;  2FBK A;  3CJN A;  2J5P A;  1XDS A;  4HLY A;  1RUO A;  4GO1 A;  1YW9 A;  1FYK A;  4ZYE A;  3MZH A;  2HYG D;  1YYV A;  4RB3 C;  1LDD A;  2FBI A;  3HOT A;  3I71 A;  5LRR A;  4AVP A;  3IKV A;  4KMU X;  3KEO A;  3I59 B;  1SMY F;  5LGU A;  2P6S A;  4IRH A;  1BOA A;  4HW0 A;  2DTR A;  1JHH A;  1WQ2 A;  4A12 A;  5CJ9 A;  1UST A;  5CVR A;  2O8X A;  2M8E A;  2FMY A;  3O3K A;  4HQE A;  3EDP A;  3E5X A;  1SD6 A;  2K4B A;  3KEQ A;  2QBY B;  3K69 A;  3DXJ F;  3KP6 A;  2PMU A;  4P5O A;  4MEY F;  2ZFW A;  5ILV A;  4PGH A;  4EV0 A;  1IF1 A;  1XGS A;  2V6C A;  2R7F A;  3HRU A;  1ODD A;  2IA1 A;  1J59 A;  3J80 Z;  2XHK A;  4WCG A;  2STW A;  1XSV A;  3C18 A;  3LFK A;  1MJB A;  2V1D A;  3IL2 A;  3WTZ A;  1ZRD A;  2VE8 A;  4MTD A;  4EVI A;  3P9I A;  2R3S A;  1BI3 A;  1R1T A;  4ENK A;  2E7W A;  4KA4 A;  5HS9 A;  5K5Q A;  3MCZ A;  3E6C C;  4OU0 A;  2RGV A;  3I54 A;  3J80 K;  2VT3 A;  2F5C A;  3GX4 X;  2P4W A;  4ESJ A;  1XMK A;  2PJP A;  3C1D A;  2DBB A;  4CO8 A;  1KYW A;  2PBI A;  2XRN A;  5J8F A;  3V8L A;  3BY6 A;  3EYY A;  1U3E M;  4MEX F;  3DFG A;  3RI4 A;  2DT5 A;  3T8T A;  3LA2 A;  2ZO4 A;  3TQN A;  2FOK A;  1G3T A;  3ZMU A;  1P2F A;  1ZN2 A;  4HBL A;  4P9U A;  1K78 B;  1XGO A;  3R0A A;  3DF8 A;  4U0Y A;  4BXU A;  4MHG A;  2Z33 A;  1WSU A;  3TKY A;  4XSX F;  1OR7 A;  3L00 A;  3RPU A;  2Z99 A;  2KRF A;  1KYZ A;  3JTH A;  3REO A;  4JK1 X;  4RAY A;  2IRF G;  5ERI A;  2CFX A;  4LLL A;  1DPU A;  2EV6 A;  1FX7 A;  3ZN0 A;  4ZYG A;  4L18 B;  5HDG A;  1TW3 A;  1B59 A;  3I53 A;  1FY7 A;  4AWX B;  1H9G A;  3F8N A;  3EUH A;  4M6Y A;  1TBX A;  2YSR A;  2LF8 A;  4OIR F;  2D1V A;  3TO6 A;  4EMS A;  2WC2 A;  3ELK A;  2M87 A;  5DUI A;  3LAJ A;  1SFU A;  2ESN A;  3G3Z A;  3ZMZ A;  1J5Y A;  2KIF A;  5ICC A;  5F1R A;  2LNB A;  1IN6 A;  4G7H F;  3RPQ A;  3ZQ7 A;  3F6V A;  2NS0 A;  2DW4 A;  1DPR A;  2QQ9 A;  5D8L B;  3V4G A;  3GF2 A;  2LF7 A;  1IZ1 A;  1KU3 A;  2VOP A;  2GIV A;  3CUQ A;  1O3T A;  4KUM A;  3G73 A;  2OAZ A;  1O3Q A;  3L9F A;  1BI0 A;  4GXO A;  3WTS C;  1ON2 A;  5LHG A;  2ZKZ A;  1EH6 A;  3QPT A;  4IF4 A;  2CSO A;  5LHI A;  1ZG1 A;  3MWM A;  3SHF A;  3DEU A;  2MLK A;  3ZMV A;  1H0M A;  3WTW C;  2MH2 A;  4Y15 A;  5IT3 A;  5L3C A;  1VTN C;  3ZN1 A;  1SFE A;  2D1H A;  4HA8 A;  1XGM A;  1JHF A;  3RDI A;  4AIK A;  4O3M A;  1EV7 A;  2GWR A;  1GVJ A;  1CF7 A;  1W5S A;  1JGS A;  5DDG A;  2EJR A;  4IVN A;  4AIH A;  4NB5 A;  4EJW A;  4KDP A;  4K2E A;  3K1P A;  4WX9 A;  4AD9 A;  1ON1 A;  5E20 A;  4WK8 F;  4Q4Z F;  3MFK A;  4LG0 B;  3ERE D;  4YFX F;  1W4M A;  4CYD A;  4LGW A;  1IRG A;  5E8G A;  2VON A;  5D8K B;  1OKR A;  4HV5 A;  5FGM A;  1OPC A;  1XDU A;  1AWC A;  4RGS A;  1D3Y A;  5JR3 A;  3FXU A;  4G6D A;  2EK5 A;  4NHJ A;  2BYV E;  2QYO A;  4ZYD A;  4M9S A;  3N97 A;  3P9C A;  2FBH A;  1RIO H;  1TQP A;  4CGZ A;  3BJA A;  4ASN A;  3MQ0 A;  4G7Z F;  4EM1 A;  4D0P A;  2QUF A;  4LK1 F;  3RKW A;  2V9V A;  3QP6 A;  4MGR A;  2YX4 A;  3HSR A;  3HRT A;  1HKS A;  2QEN A;  4EJU A;  3GO5 A;  1XN7 A;  4L9J A;  2FQ3 A;  3TDZ C;  4M73 A;  2BBY A;  2ISZ A;  2K4J A;  1YG2 A;  1YS6 A;  3LST A;  3V7S A;  2EFO A;  2OZU A;  4WXH A;  4LK0 F;  1MDM A;  2L54 A;  3KP3 A;  2VBZ A;  2DU9 A;  3V8K A;  2F5F A;  4ZZL A;  2A61 A;  4YFN F;  2H6C A;  2WTE A;  6PAX A;  2W85 A;  2V1X A;  5LEK A;  4EJV A;  1AOY A;  3GFI A;  2YR2 A;  1S7A A;  2IJL A;  3K1N A;  2HR3 A;  3GFJ A;  3WG9 A;  3M8E A;  2EFQ A;  1LJ9 A;  2VN2 A;  3WE2 A;  2K27 A;  2E1C A;  2MA3 A;  2QZ8 A;  1XD7 A;  5E8I A;  3QAH A;  4U0V A;  5D4S A;  4KIG A;  4ENJ A;  2L4M A;  1BN5 A;  3HYI A;  3CLO A;  5D6F A;  4A0X A;  1KU7 A;  2P7V B;  4N9I A;  2O6G E;  2O0Y A;  1LNW A;  2HGC A;  3FWE A;  3QPH A;  1F9N A;  4FX0 A;  1XSD A;  1ZLJ A;  3NEU A;  2W24 A;  1RNL A;  5H6R A;  1KGS A;  2DAO A;  1GXP A;  2DPD A;  2Y75 A;  2JSC A;  2DK8 A;  1FC3 A;  4Q48 A;  5BOX A;  3F8M A;  3JTG A;  2X0L A;  3E3V A;  1B9M A;  3DV8 A;  1BI1 A;  2FA5 A;  3FM5 A;  1G4D A;  4A2U A;  3R4K A;  1JXS A;  5L3G A;  1SD4 A;  1QZY A;  5D5V B;  4L9V A;  3CUQ B;  3C3W A;  5DEQ A;  3FXQ A;  4CZZ A;  3FMR A;  2LSO A;  3KP4 A;  2MH9 A;  2V79 A;  4KYW A;  3P7N A;  3E6M A;  2D45 A;  4YIF A;  2XKO A;  1S3J A;  2IA2 A;  4RB0 A;  2KJB A;  3CTA A;  3HSF A;  4Z2Y A;  3AAF A;  1O3R A;  3KLN A;  3ZPL A;  3M7G A;  2Q2E A;  5AIP A;  4UVC A;  4HF1 A;  3LAP A;  2YPR A;  3PQK A;  1CF7 B;  2RC4 A;  2O03 A;  3RYP A;  1BJA A;  4A5M A;  2XRO A;  5HLI A;  3JW4 A;  2NNY A;  2M5W A;  4E70 A;  3JSP A;  1FSE A;  1R5H A;  3HHG A;  1K6O A;  2STT A;  3GZ5 A;  4HX4 A;  1O57 A;  1QZZ A;  3SXY A;  5A2Q Z;  1OYY A;  5DUK A;  2OD5 A;  3PQJ A;  3BOQ A;  2CGP A;  4HLX A;  4H0E A;  3FMS A;  1BI2 A;  1U5T B;  5ILS A;  4EM0 B;  5DD8 A;  3EQL F;  3FF5 A;  3KZZ A;  2A07 F;  3F8C A;  3WTX C;  5J8C A;  1FPQ A;  3FZV A;  3RJP A;  1QGP A;  1HKQ A;  2DFI A;  2XAS A;  3KFW X;  5A2Q K;  4BAY A;  2H09 A;  3HIF A;  3FXR A;  3HUG A;  4EM2 A;  4U7D A;  1WI9 A;  1O3S A;  3RIR A;  4HYE A;  5BQT A;  3B73 A;  2M1B A;  1L3L A;  4O6J A;  2DK5 A;  1ZGJ A;  2KIU A;  1R00 A;  2Z3Y A;  3C7J A;  4CIC A;  1STZ A;  3COA C;  2X4H A;  1Q1H A;  2Q8K A;  1L0O C;  2COM A;  5DCM A;  3O6B B;  4I09 A;  3BP8 A;  5LRS A;  3LQQ A;  1B9N A;  5ICF A;  2HDC A;  2KIM A;  3GW2 A;  3IC7 A;  5AON A;  4XRF A;  1DUX C;  3BDD A;  2G7U A;  1ZG5 A;  2A6E F;  2GA2 A;  4F7Z A;  4N9H A;  1HSJ A;  3WTV C;  4BHC A;  4LJZ F;  4XLP F;  4KMF A;  3V7R A;  2UXX A;  1XCB A;  3J81 Z;  4HX7 A;  2Q0O A;  4GGG A;  3LQR A;  2G9W A;  3GVA A;  2EFW A;  3F22 A;  4N0B A;  5JVT A;  2GXB A;  1Y0U A;  3RKX A;  4RB2 C;  1HQC A;  3GEZ A;  3WTY C;  1K79 A;  3JSO A;  3L09 A;  4HQM A;  2RVC A;  5AIQ A;  4GYI A;  4OMY A;  3H3U A;  3J81 K;  5HLH A;  3BPV A;  2RQP A;  3LA7 A;  2H6B A;  3R0J A;  1FOK A;  5HDN A;  2XAJ A;  3F72 A;  2HZT A;  1HKT A;  4KNY A;  3E5Q A;  5BPD A;  3I5U A;  1FNN A;  4HZF A;  4KT5 C;  2BV6 A;  3H3Z A;  1YTY A;  4G94 A;  3E6B A;  1QNT A;  2VOD A;  3HSE A;  2D2W A;  5IT9 Z;  4OIO F;  2DLL A;  1HBX G;  5K1Y A;  2V1U A;  1Z6R A;  4A0Z A;  1BBY A;  3ZP5 A;  3HTU A;  5KK1 A;  3B02 A;  1O7F A;  4HF0 A;  1IW7 F;  5LLQ A;  4P96 A;  3LA3 A;  2RDP A;  5FD5 A;  1T6S A;  1G6N A;  3VOE A;  2F5E A;  3EET A;  3GUD A;  4KN4 X;  5IT9 K;  4IHS A;  1T38 A;  2P5L C;  1YFH A;  4L9N A;  3GWZ A;  3IWZ A;  2JTV A;  3WE3 A;  1XMA A;  5CVI A;  2W84 A;  3Q9S A;  4IRI A;  4U88 A;  2BE5 F;  3ECH A;  3KP2 A;  3SFZ A;  2MLG A;  2YU3 A;  1IAW A;  3Q5F A;  2DPU A;  2VC1 A;  1BM9 A;  3F6O A;  5JI6 A;  2FSW A;  1EH8 A;  4UNO A;  4UVA A;  1U8R A;  3FX3 A;  4IXA A;  3TO7 A;  1FYL A;  4P55 A;  4BH9 A;  2HFH A;  1PP7 U;  2PMH A;  2LDU A;  1X3U A;  1HST A;  4HOB A;  4M9X A;  2HTS A;  3MEX A;  3I0T A;  4UHT A;  3TGN A;  1HW2 A;  2CO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...