4RGXA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 3,4-dihydroxy bezoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
b'REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with 3,4-dihydroxy bezoic acid
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
total genus 44
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgxA00
3KFWX 1YS6A 3U2RA 5LHGA 1R22A 4AVPA 2R7FA 3WTYC 4PGGA 1T2KA 1GXQA 4ZZLA 1YLFA 1EV7A 2LDUA 3R0JA 1J0RA 4EM0B 2UWMA 3ZMUA 1C0WA 3Q9SA 2Q0OA 2Y48A 2UXXA 1K78B 5DEQA 3WGIA 2HTSA 1D5VA 2DK8A 1XB4A 1GXPA 3J80Z 2HYGD 2OU2A 3L7WA 3GZ6A 1FYLA 1U5TC 3P7NA 3WTVC 5KK1A 4WXHA 1QPMA 1QNTA 5EEGA 3C7JA 4QLCU 4JBAA 1SD7A 4G6QA 2STWA 3I5UA 3E6BA 2E1NA 2DAOA 2QQBA 3T8RA 4A2UA 5L3BA 2EV6A 1YW7A 4LLGF 3RIRA 4LD5A 2M30A 3M9AA 2FEZA 3DPTA 4CZZA 5BS6A 2P8TA 4LB5A 4XLPF 1JHFA 4KN4X 4WF2A 1KQ8A 1DPRA 4ZYHA 1Z6RA 2ZNYA 3ZN1A 4ESBA 2ACJA 2C6YA 4HX7A 2YU3A 1UCRA 4LG0B 1B9NA 2RGVA 3O6BB 2HKXA 3KLNA 2ZMEB 5HVQC 5D5WB 2DTRA 3I64A 4MTEA 4YIFA 2IT0A 4Q5SF 2ZO4A 1BIAA 2RDPA 5D4SA 3OOPA 1ULYA 2E1CA 4I2OA 3CUOA 4KIFA 3WTZA 1BN5A 3GZ5A 1ZGAA 2X0LA 2QUFA 1O7FA 3LA2A 2EFOA 3FMQA 3FXQA 2ZXJA 2WTEA 4A0YA 2VOOA 4KDPA 4XLNF 3HOTA 2FBIA 2NNYA 2XAFA 2HOEA 2F5CA 5A2QZ 3RPQA 5LRSA 1DUXC 2D45A 1OYIA 5ILSA 1P4WA 1FX7A 4E70A 2VC1A 2CQKA 2XROA 1Z9CA 5K1YA 1B6AA 1GVJA 4U7DA 3DEUA 1IZ1A 2EB7A 4IJAA 5JR3A 5ICFA 4MEYF 2PFBA 3GYHX 4FHTA 2BBYA 2OD5A 3ZMTA 1V3FA 1QZZA 4ENNA 3ZMSA 4AWXB 2V1XA 2CFXA 4LJZF 2ESNA 4IXAA 3C18A 5D6FA 3V8JA 1XSVA 5L3EA 4RGRA 1UHWA 1XCVA 4JQFA 5K5RA 1TNSA 3R61A 3SXYA 2FBHA 3H3UA 5ERIA 4XSXF 4H0EA 5E8IA 4B09A 3HRMA 2VBXA 2LF7A 2VC0A 3EYIA 1IXSB 1USSA 1TW3A 1WI9A 5F6FA 4G7HF 3ECOA 1JE8A 4U0YA 3O3KA 1STZA 2BE5F 4L9JA 3RPUA 3RKXA 1HKQA 2W85A 5FD6A 3HOSA 1IW7F 1KU3A 1KU9A 3IC7A 1P4AA 4FT8A 4L0ZB 1FPQA 3B02A 4PCQA 2GA2A 4IF4A 3NRVA 1U8RA 3CJNA 1KQ0A 3E5UA 1BI0A 2RN7A 4RGXA 4A6EA 4EJWA 3GEZA 2FNAA 2RV8A 2KIFA 4U0WA 4YFXF 5LEJA 1RNLA 3ZMZA 4IHTA 2W25A 1T38A 3SHFA 2XKOA 3BJOA 3LA3A 1RUNA 3SQNA 2GWRA 2QVOA 5D5UB 1DPUA 2PMHA 3GXOA 3CLOA 2PLYA 3V7RA 2VBZA 3H3ZA 4UHTA 1IN5A 3HSFA 3GF2A 3ABTA 5E18F 3O2PE 2J5PA 1G3SA 2CW0F 2ELHA 1IF1A 4O3MA 3WTTC 3MCZA 3HSRA 3ROUA 4M9SA 3DXJF 2GQQA 1ZLJA 1VTNC 1YS7A 3CO7C 1FYKA 2FXAA 5ICGA 3LFKA 2EJRA 1WSUA 4Y15A 4ENMA 2HFHA 3E5XA 3F8MA 3BY6A 4LFUA 1LDKB 3WTUC 4N0BA 4Y17A 1R36A 2P5VA 2DQRA 1JGSA 4NQWA 3I58A 1RUOA 2DK5A 4G8XA 1MD0A 4AD9A 2VN2A 2YPRA 3GLXA 3FF5A 2V1DA 1R1UA 1HW2A 3F22A 2V79A 1FBSA 3KEOA 2XAQA 3BZ6A 1D8JA 3ZMVA 4KYWA 2CYYA 3FXRA 3KP5A 1IXRC 2DPDA 1TLHB 2KJCA 1FP1D 1A04A 1S7OA 1USTA 2FBKA 2KRFA 1K6OA 1MJBA 3G73A 1RI7A 1W4MA 2DLLA 4BHBA 2VXZA 2FNPA 2MLKA 2M8EA 1DP7P 2ZMEA 3N97A 1SFUA 3F6VA 5LBQA 4KT5C 2COMA 4ZH4F 4EV0A 2ZBKA 4I01A 3HUGA 1ZAOA 3DQVC 1U5TB 1YTYA 3V8KA 3P9CA 4AIKA 1LQ1A 5LHHA 2VT2A 2P5LC 5HDKA 2GAUA 5DV5A 1W5SA 2DFIA 2ZNZA 4XBFA 4LB6B 3RKYA 2M45A 1XGOA 4RB3C 4P96A 3HSEA 3E5QA 1UB9A 5DCMB 5FGMA 1H9TA 1OYWA 4RB2C 1OPCA 3MZYA 5LGUA 2FU4A 3U9GA 3F8CA 2VE9A 2QBYA 2F5FA 2A6HF 2O3FA 3F6OA 2VE8A 2L01A 3LAPA 4HF0A 4ENKA 1ZREA 2W84A 4Q4ZF 5HLGA 5L3DA 2V1UA 1HQCA 2NNNA 2K86A 2D1VA 3GFJA 1BI2A 3CO6C 1EH7A 3MZHA 1R7JA 4M9ZA 5BOXA 1BIBA 1Z91A 4ASNA 3TDZC 1YFHA 1Z1DA 3N4MA 3QAHA 1FT9A 5FO5A 4G7OF 3K69A 1ZG5A 1B59A 4OMYA 3LQQA 3F72A 3M8FA 1QQIA 1IXCA 3T8TA 4HV5A 2OQRA 3QU3A 1OR7A 1CF7A 1P4XA 2XKPA 3OV8A 1UHMA 2A6EF 4G9YA 2GXBA 3IKVA 4LLLA 2L3DA 3K1PA 1XDUA 2L02A 2XV4S 1S6LA 1Z05A 2HQRA 3RKWA 3WTSC 2ZFWA 3EQLF 3T5XA 1IAWA 2LF8A 2ZKZA 4I7HA 1ON2A 2H27A 3L09A 3BPVA 4R79A 2XVCA 1EH6A 3H92A 4R1HA 3F21A 5LGNA 5ILVA 5DUKA 5FB2A 3F8FA 5F64A 3EDPA 5HS7A 3GW2A 2NYXA 3L9FA 2B0LA 1Y0UA 1LEBA 1B1BA 1Q1HA 2JRTA 5LRRA 4WXCA 2G9WA 2L4MA 4WXDA 3ULQB 3F23A 3KEQA 1KQ9A 4ON0A 3BROA 2P7CB 1TW2A 1R5HA 3W6KB 2RC4A 2XHKA 4CDGA 4RGUA 5JI6A 2A5YB 3Q9VA 2JT1A 2WV0A 3CUQC 2O0YA 2R7DA 5BPIA 3HTUA 4HLXA 1J5YA 3IRRA 4MQ9F 1W7PA 4UVBA 2Z3YA 1HW1A 3COAC 2UZKA 3HHGA 3MQ0A 3P9IA 1QZYA 1XGSA 4GGGA 1GHCA 4YG2F 4Q48A 1KU7A 1L3LA 1F5TA 2NRAC 3I59A 2WC2A 3SZPA 2HZTA 4WCGA 2ESHA 1TQMA 2NS0A 1BBYA 1YYVA 3KCCA 3MEXA 4OIRF 1S29A 2YX4A 4ZYEA 2XAJA 3M1EA 2PQ8A 5H20A 2Z5UA 5HS8A 1IRGA 2M5WA 5EEHA 2FQ3A 4BQAA 2IW5A 2JZYA 1KA8A 2CSOA 5TJJA 2KJBA 1MJ9A 1MDMB 1MGTA 3IKTA 5CVVA 1XDSA 2M1BA 5JHUA 2E7WA 2VOPA 4ENJA 1BM9A 5LGTA 3SZTA 4L5JA 2STTA 3P9KA 5H6QA 4EJUA 3QPHA 5LHIA 2MBFA 2Y75A 2TDXA 3E97A 2HKOA 3ECHA 3QOPA 4D0PA 1H9GA 5JVTA 3TQNA 3TKYA 2WWYA 4P5OA 2IPQX 4B8XA 2QZ8A 4U0VA 1ZN2A 3K0LA 1TTYA 2W57A 3JW4A 2MC3A 1WWXA 5FFZA 3NQOA 1DDNA 4L9NA 1U3EM 4UNOA 2FSWA 5E8GA 2ISZA 2JPCA 4YFKF 1BC8C 4HF1A 4WWCA 1MKMA 4OIPF 2M87A 2DO7A 4A5NA 5DD4A 4MHGA 5HLIA 2GXGA 1HKSA 1JXSA 4OU0A 2OBPA 3TOAA 3KZYA 3LA7A 3ZP5A 2QYOA 3VFZA 3CTAA 4LMYA 3WTWC 5E20A 4UUVA 1O3RA 1KYZA 1R58A 2O61A 2EFWA 1T39A 4ETSA 2D2WA 2CO5A 1XGNA 2RKHA 4M6XA 1E2XA 3VB2A 2QLZA 3RI4A 4KMFA 1H0MA 3WGHA 2QM3A 1TQIA 1FY7A 2IJLA 2YR2A 5AONA 4HLYA 4EMSA 3VODA 4L18B 1F9NA 3FM5A 4RS8A 3JTGA 2ZCWA 1J59A 6PAXA 2QWWA 1HSJA 4IHSA 4BHCA 3HIFA 3ZPLA 1HKTA 3GVAA 1G6NA 4NHJA 1BI3A 5E17F 2XIGA 4HV6A 3IWFA 1K78A 1O57A 2H09A 3EETA 4OIOF 3C1DA 2DW4A 4I98B 3JSPA 2A69F 2DI3A 3F8BA 5AIQA 1S8NA 1R5GA 2HEOA 4RB0A 1I27A 5E1ZB 2P7VB 5ILUA 4P55A 4UV8A 5K5OA 3I0TA 1FYMA 2HDCA 1O3SA 1B9MA 1HXDA 3GO5A 5FFXA 2PN6A 5FLXK 4HX8A 3FM3A 4HOBA 3FWEA 3L2CA 3V7CA 3MWMA 1FLIA 5AIPA 3IWZA 5BPDA 1B4AA 5CLSA 3RJPA 1RIOH 5FLXZ 3LAJA 1HBXG 5CVUA 3HRSA 2XAHA 4U88A 4M9XA 3FXUA 4PZJA 1SFXA 2EA4A 2EFQA 3C3WA 2CG4A 1FWZA 4F7ZA 1I1SA 4LG0A 1KYWA 4M74A 2RNJA 4N9IA 4Z2YA 2JTVA 3HTSB 3BDDA 2F5DA 2MD5A 4A12A 1I6XA 1IN4A 2HWVA 1R1VA 4WK8F 4HW0A 1BC7C 3HRTA 2ZJ2A 1ZLKA 4DQ2A 3Q5FA 4G6DA 1IN7A 4BHPA 4CHUA 1P92A 2MH9A 4M71A 2W24A 3WE2A 1S3JA 3NEUA 5CVRA 1FSHA 3J81K 4GO1A 2EA2A 5J8FA 4Y13A 4P9UA 3CUQB 2YX7A 4MNUA 3S2WA 2FMLA 1WRJA 5BMZA 3VEPA 4UVAA 4HA8A 3JSOA 5CVJA 3DFGA 1WKMA 3JAMK 2IVMA 3J81Z 4L9TA 1FSEA 4HX4A 3GX4X 4K2EA 3R6SA 1OMIA 1T0FA 4AIJA 3JAMZ 4AIHA 2YSRA 1TNTA 1RZ4A 4PGHA 5HDNA 2QENA 4YIIA 4HF2A 2PMUA 1BOAA 4HAMA 1YQAA 5HS9A 1K79A 2O03A 1AWCA 1G3WA 4P9FA 3T0YA 1K7AA 3GFLA 3KP3A 4CO8A 5DDGA 2DBBA 2PG4A 1ZRCA 3GFMA 3DKWA 5HDGA 1TBXA 1ZGJA 4A0ZA 4NB5A 4RAYA 2KIUA 4KA4A 3LSTA 3PFIA 4ZYGA 1J7KA 1FBUA 3ISPA 5CYVA 1SD6A 3FMRA 3PQKA 2EK5A 1KGSA 3WTXC 5LLQA 3B73A 3BJ6A 3T1BA 4BAYA 4HBLA 3BWGA 4ESFA 3J80K 4ZYDA 5TRDA 4M72A 2J5OA 5E1XA 2D1HA 4EGZA 4A6DA 2IP2A 4LK0F 1ZHFA 3WODF 1R23A 1OKRA 2QQ9A 3ZMDA 1LB2A 4G94A 5IT3A 4ESJA 3HRUA 5L3CA 5D8KB 4IRGA 2GZWA 2EWNA 3E6MA 2VT3A 1SMTA 3FMSA 1ZG1A 4L0YB 3GFIA 2GA1A 1TQPA 5DUIA 2IA2A 2HS5A 4GYGA 2O8XA 2FA5A 1AOYA 3HHHA 4HQMA 4M6YA 1W5TA 3PQJA 2P6SA 2K7LA 4BYYA 2KIMA 3MAJA 4OMZA 1FZPB 2UXNA 4IVNA 4CYDA 4EGYA 2V9VA 3BP8A 2H94A 2XUBA 1D8KA 4KUMA 1YW9A 1IN8A 2Q8KA 2LKPA 3G3ZA 1SAXA 3ELKA 2P4WA 1LJ9A 2A07F 2IA1A 5KVRA 1E17A 5D5XB 4OIQF 2ETHA 2H6CA 5A2QK 4HYEA 3WG9A 1ON1A 4LLNA 1NHAA 2QQAA 3AAFA 4EJTA 3TOBA 3L00A 3JTHA 3V4GA 1O3TA 4DNCA 1F4KA 1PP7U 3WGGA 4UVCA 2QBYB 1XGMA 4XSZF 2BYVE 1YG2A 3E6CC 3KLOA 4CXFA 2MLGA 1LDJA 2IRFG 2HYFA 1FNNA 2JPBA 1O7LA 1QO0D 4I0BA 5ED4A 2VBYA 3R0AA 4KMUX 4OOIA 5BQTA 4KN7X 2Z33A 5IT9K 5H6RA 3EYYA 2BGCA 3RYPA 4R8HA 3I4PA 1ZRFA 1U5TA 3E3VA 2Z99A 2RVCA 1QGPA 5HOOA 3ML6A 1I5ZA 5IT9Z 3VOEA 1CF7B 4IPAA 1QBJA 4KFCA 3TO7A 1XSDA 5K5QA 1SD5A 4FX0A 4RGSA 2XASA 3KP6A 5L3FA 2AXLA 3FHZA 3ERED 3W6JB 2IA0A 4HZFA 2BEOA 5DCMA 5LEKA 3QP6A 1YIOA 5HLHA 4BXUA 3DP7A 3CUQA 2CWEA 3V8LA 1BJAA 1XCBA 3M7GA 1ZG3A 1XSXA 2FE3A 2OZUA 3E6DA 2NAZA 3GUDA 3TO6A 1ZARA 2F5EA 2XGXA 1Z7UA 1G3TA 3WU0A 1SMYF 2MH2A 3U1DA 4FX4A 1HSTA 1U6GA 3CDHA 3HYIA 4RAZA 3QU6A 3ZN0A 1R00A 5E1WA 2OQGA 4CGZA 3QP5A 1HW5A 4PDKA 2EV5A 3GWZA 1V4RA 5J6XA 4IRIA 3TO9A 1XMAA 3K2ZA 2XRNA 5F1RA 2F2EA 4M73A 4ZZDA 2OZ6A 5J8CA 3I71A 2DQLA 2BV6A 4N9HA 2PI0A 1BI1A 1P2FA 1ZYRF 1W7PB 2FF4A 3D5LA 4I09A 2PBIA 5FD5A 1T98A 3DPLC 2JSCA 3QRFF 1LVAA 2Q2EA 2HR3A 3F8NA 4TV7A 1PP8F 1YO5C 4QWQA 1IUYA 2O6GE 4I0AA 2ISYA 4HQEA 1F1ZA 3ABUA 5D6EA 5L3GA 3IRQA 2DU9A 3K1NA 3KETA 2E7XA 1R1TA 3QPTA 4HDUA 1XN7A 3I59B 3IL2A 3ZQ7A 4UV9A 4EM2A 5D5VB 3RTRA 1YW8A 2OA4A 3WE3A 1J9IA 4HDVA 4O5VA 4A5MA 2VODA 3F3XA 2P6TA 2HQNA 1O3QA 1U2WA 2X4HA 3I53A 2PJPA 2Z9OA 1S7AA 3DF8A 3FZVA 2KKOA 1J75A 4GXOA 4GYIA 4KNYA 1KU2A 2V6CA 3K9TA 4S05A 3DV8A 4I02A 1D3YA 4U7BA 1U78A 3TDUC 3BJAA 1W7PD 1LEAA 1LDDA 4CICA 5D8LB 2DPUA 3KZZA 4S04A 2A68F 2RQPA 4L9VA 3I54A 2DT5A 4MGRA 1XD7A 2EV0A 2K4BA 4EM1A 1SD4A 5JFRA 4JK1X 4G7ZF 5CVIA 1G3YA 1UFMA 4EJOA 2FMYA 3K1MA 1L0OC 1P6RA 1T6SA 5DD8A 2HGCA 3WU1B 1X3UA 2PEXA 5D4RA 4IRHA 4MTDA 3IHUA 1EH8A 4A0XA 2OAZA 3BOQA 3KP7A 4MEXF 2G7HA 4BH9A 2R3SA 2VBWA 1FOKA 4O6JA 4KIGA 4L5IA 3KP4A 2K27A 4Q47A 2L54A 1IRFA 2AS5F 4LGWA 2K4JA 4LK1F 5CJ9A 1LNWA 1ONVA 2XAGA 4YFNF 1WQ2A 2MA3A 3R60A 2VONA 1MDMA 5ICCA 4EVIA 1PUEE 3KE2A 1Z6TA 2LNBA 4UXNA 1ZH5A 3LQRA 2HTJA 2EFNA 3BPXA 1G4DA 4EQQA 2H6BA 1OYYA 3RYRA 2CGPA 4RB1A 2P5KA 2A3SA 4BNCA 3D0SA 4KICA 2FOKA 1CGPA 2L4AA 1JHHA 4MQVA 3KP2A 3V7SA 5ICEA 4EJVA 3J7AO 3LWFA 4GCVA 1SFEA 5DCFA 2K02A 3R4KA 1FC3A 2Y0MA 2ADUA 1REPC 4XRFA 2G7UA 2FRHA 3SFZA 2GIVA 3EUHA 1FBQA 2LSOA 4KIBA 3REOA 1XMKA 2EFPA 1MJAA 4WX9A 1IN6A 1I1GA 1ODDA 3TGNA 3MFKA 1FP2A 1PDNC 1ZRDA 3RDIA 3FX3A 1J2XA 4OINF 5DYMA 1MZBA 3M8EA 2A61A
chains in the Genus database with same CATH superfamily
3KFWX 4CCOA 1YS6A 3U2RA 5LHGA 1R22A 4AVPA 2R7FA 3WTYC 3OS1A 4PGGA 2DXIA 5GAHJ 1SAUA 1T2KA 1DP3A 1GXQA 4ZZLA 4EATA 1YLFA 2N8GA 1EV7A 2LDUA 2WBMA 3R0JA 2HOTA 1J0RA 4EM0B 3K70C 1B72B 3HEFA 3OR1C 3OS2A 1R9TJ 2UWMA 2M2EA 3S8PA 1FJLA 1NG6A 3QOEA 4UUSB 3ZMUA 1C0WA 2HOAA 1OLTA 4XOTA 3Q9SA 3FDYA 2Q0OA 2Y48A 5K7HA 2MG4A 2VLAA 2DJNA 2R4GA 2UXXA 3K7AJ 3M4OJ 1K78B 5DEQA 4F93B 1IG7A 3WGIA 2GOMA 2HTSA 1D5VA 2EIMH 2DK8A 1Z3XA 3ZQGA 3ASNH 1XB4A 1HCRA 1GXPA 3J80Z 2HYGD 2OU2A 4XICA 2I8DA 2LYCA 1ETXA 3E0JB 3L7WA 3GZ6A 1FYLA 1U5TC 2X1EA 3P7NA 4NUBA 3WTVC 1TC3C 5KK1A 1VQLI 4WXHA 3ZQFA 2B7EA 1QPMA 2BOLA 1QNTA 5EEGA 3C7JA 4NQWB 3PO2J 2VPRA 4QLCU 5F08A 4JBAA 3CCSI 1RPWA 3LSIA 1SD7A 3CC2I 3KYLA 4G6QA 2STWA 3I5UA 4DYQA 3E6BA 3DBRB 1X3ZB 2E1NA 2DAOA 5EGOA 2QQBA 4LITA 3T8RA 4A2UA 5FLVA 5L3BA 2EV6A 1D0ZA 4ZC3A 1MNDA 1WH7A 1VQMI 1YW7A 4JOMA 4LLGF 4OAZA 3RIRA 4LD5A 2M30A 3M9AA 1YJNI 3H0DA 2FEZA 3DPTA 2JA2A 4CZZA 3AG3H 3S15J 2KMUA 5BS6A 2P8TA 5KHDA 4LB5A 4XLPF 1JHFA 4AIDA 4KN4X 2EIKH 4WF2A 3HKZA 1KQ8A 4FTHA 2VKVA 1DPRA 4ZYHA 1Z6RA 2ZNYA 5FKNA 3ZN1A 4ESBA 2WAFA 4JP0A 2ACJA 4B3AA 2HVQA 2C6YA 3AG1H 4HX7A 1X1CA 2YU3A 1UCRA 4PJ0C 1LE8B 4LG0B 1B9NA 2B63J 3LSRA 2RGVA 3ERMA 4DGWB 3O6BB 2HKXA 3KLNA 2ZMEB 3CP8A 5IOZA 1H89C 5HVQC 1EA3A 5CQEA 5D5WB 4D5FA 1PUFA 2DTRA 3I64A 4MTEA 2DMUA 3A03A 4YIFA 2IT0A 4Q5SF 4A93J 2ZO4A 1BIAA 2RDPA 4XN3A 2XSDC 5D4SA 3OOPA 1ULYA 3OYMA 2E1CA 4I2OA 3CUOA 1ZR4A 2GLOA 4D7NA 4KIFA 3ZCOA 1OCTC 4OWRB 2OUMA 2O7OA 1BN5A 3WTZA 3GZ5A 1ZGAA 2W1OA 4CYCA 2X0LA 2BY2A 5J1YA 2M3AA 2QUFA 1O7FA 3LA2A 3I56I 2EFOA 2Z1DA 3FMQA 2ZXJA 2WTEA 3FXQA 2HZDA 5C4XJ 4MIMA 4A0YA 3FXLA 2VOOA 5M3FJ 4KDPA 1FIAA 4XLNF 3HOTA 2FBIA 2NNYA 3S2DJ 2XAFA 2HOEA 2F5CA 3CMYA 1V5EA 5A2QZ 3RPQA 5LRSA 1DUXC 1MMSA 3OS0A 3CF5F 2D45A 1OYIA 4XR6A 5ILSA 1P4WA 2JN6A 1FX7A 4E70A 2VC1A 1Y1VJ 2CQKA 2XROA 1Z9CA 5K1YA 3PNYA 1B6AA 1GVJA 4D7MA 4XLHA 5J1RA 1HLVA 4U7DA 1TP4A 5J4VA 2FD5A 3DEUA 2FOWA 3K4KA 3K4MA 1IZ1A 5GPCA 1ERDA 2EB7A 3M8JA 2AXTC 3PNVA 4IJAA 2HVRA 2K3PA 5JR3A 5ICFA 3DBLB 4MEYF 1QPIA 2PFBA 3GYHX 4FHTA 2BBYA 2VQGA 2OD5A 3ZMTA 1V3FA 1QZZA 3AL0C 4IO9F 4ENNA 3ZMSA 4AWXB 2V1XA 3GTLJ 4DBRA 2HPIA 2CFXA 2NVTJ 2M0CA 3HOUJ 4LJZF 2ESNA 4IXAA 2FX0A 3C18A 4FCYA 5D6FA 3DLLF 3V8JA 3L2VA 3H9JA 1XSVA 2DT7B 5L3EA 3WHCA 4RGRA 1QA6A 1UHWA 1XCVA 3SYTA 1JUMA 2WADA 3GTOJ 4JQFA 5K5RA 1TNSA 3BR2A 3R61A 3SXYA 2FBHA 4C3HJ 1MMAA 2DOFA 3H3UA 5ERIA 2KHMA 4FQGA 4XLEA 3VSKA 3H5AA 4XSXF 4H0EA 5E8IA 4B09A 3HRMA 2VBXA 2LF7A 2VC0A 3EYIA 4CCMA 3BG5A 1IXSB 2XB0X 3PNTA 1USSA 5J3LA 2Y9YA 2K9NA 1TW3A 2ZXIA 1WI9A 1ETYA 5F6FA 2XAUA 4G7HF 3SFIA 2IGKA 3ECOA 1JE8A 5B1AH 4U0YA 3O3KA 1STZA 2CW8A 2BE5F 4L9JA 3I4NJ 2K85A 3RPUA 4RLQA 3RKXA 3DTIA 2IGNA 3HPGA 3J7YJ 3BLYA 1HKQA 4EEFG 5GTHC 1GVDA 2W85A 4M3EA 4E7SA 5FD6A 3HOSA 2XF5A 1IW7F 2VPLA 1KU3A 2Y0SN 4C30A 1KU9A 4E7HA 3IC7A 4BEHA 3CCLI 1P4AA 4FT8A 3H1CA 4L0ZB 4CZCA 2V6EA 3DEWA 1FPQA 3B02A 4PCQA 2GA2A 4IF4A 3NRVA 1U8RA 3CJNA 5F0FA 4PFOA 2QEXI 1VQ4I 2G0EA 2XF7A 4J01A 1KQ0A 3E5UA 3LSHA 3K4LA 2LH9A 1BI0A 2RN7A 4M3FA 4RGXA 4A6EA 4EJWA 3GEZA 3OYFA 3RQIA 2FNAA 4C3IJ 1XC5A 2NVQJ 2R5YA 2RV8A 2KIFA 4U0WA 4C2MJ 5HLTA 1K4SA 1X1DA 3GLLA 2ICWG 5DTDA 4YFXF 4AVZA 5LEJA 3BCBA 1RNLA 2OC6A 3ZMZA 4IHTA 2W25A 3TP0A 5DM6F 1T38A 4BKXA 4QPQA 3SHFA 1X3WB 2XKOA 3BJOA 3LA3A 5HNFA 1RUNA 3OR2C 3SQNA 2EIJH 4BACA 1MBFA 4CA0A 2GWRA 2QVOA 3S3MA 5D5UB 1DPUA 1S9HA 2CUZA 2PMHA 2WB1A 4RMNA 4F55A 2LY1A 3GXOA 3HOZJ 4UUTA 1MSEC 3C2GA 4M3GA 1ACIA 3CLOA 2BHZA 2PLYA 2JA6J 1SEUA 1BW5A 4ZDLA 1YI2I 3V7RA 2VBZA 1W0UA 3QODA 1DGWY 1HA8A 3H3ZA 4UHTA 4CCLA 1IN5A 1I6HJ 3HSFA 1VQNI 3GF2A 3ABTA 5E18F 3O2PE 3A01B 2J5PA 1G3SA 4UB8C 2CW0F 1OJLA 4FETA 2RNGA 2X6YA 1W1WE 2ELHA 3SZGA 1IF1A 3DU5A 3MKWB 4O3MA 1SFOJ 3WTTC 2KIQA 5LD2C 2HQAA 3MCZA 2F4MB 3HSRA 4XLCA 3B6CA 3ROUA 4M9SA 2EZIA 1KONA 3DXJF 4G6TB 2GQQA 1ZLJA 1VTNC 1I39A 4XRSG 1YS7A 2R7UA 1D0YA 2NOJB 3GMEA 2RREA 3CO7C 4P1WA 3GTJJ 4UUSA 2KL4A 1FYKA 5C4JJ 2FXAA 2A5WA 5ICGA 1JUSA 2H1LA 3LFKA 1IV6A 2EJRA 1WSUA 4Y15A 4CUGA 2ECCA 3KPHA 2X9DA 4ENMA 2BY1A 1WJ5A 2HFHA 2HI3A 3E5XA 3F8MA 3EUHC 3FXJA 4PK4A 2GXAA 3BY6A 4LFUA 1LDKB 3WTUC 3LSJA 4N0BA 4Y17A 1R36A 2DA7A 2KT0A 4HNUA 2XPUA 2P5VA 2ZSIB 1S5LC 5M5WJ 1IRZA 2DQRA 1JGSA 4NQWA 4X1EA 3MD2A 2IS1A 3I58A 3FXOA 1RUOA 2DK5A 4G8XA 1MD0A 4AD9A 2VN2A 2YPRA 3GLXA 3S16J 4LG3A 3FF5A 4QPOA 2V1DA 1R1UA 3GTGJ 1HW2A 1RR8C 3F22A 2V79A 1V55H 3IP4B 1FBSA 3KEOA 2XAQA 3BZ6A 3JRHA 1D8JA 1VZ0A 3ZMVA 3CZ6A 4KYWA 2CYYA 4A3CJ 3BZCA 4XKWA 3G2BA 1YITI 3FXRA 2XPVA 1T8IA 3KP5A 1IXRC 2QSFX 4DJAA 2ZJRF 2DPDA 1UJ8A 3CC7I 3ZQCA 2KJCA 1TLHB 1FP1D 1A04A 1S7OA 1JUPA 1USTA 2O5RA 3WU2C 2FBKA 4IX7A 3W2WA 2KRFA 1K6OA 3HZJA 2LMDA 1VQ7I 1MJBA 3G73A 1QHGA 2R93J 1RI7A 1W4MA 2TCTA 2DLLA 1LE8A 4BHBA 2VXZA 5IYBJ 3HOWJ 2FNPA 3VWBA 2MLKA 2M8EA 1DP7P 2ZMEA 4DZPA 2XPWA 3N97A 4C9YA 1SFUA 4A3FJ 1BA5A 3CDIA 3S93A 2CV1A 3F6VA 3RZOJ 5LBQA 1Z67A 2E60A 4KT5C 1YX5A 2XGDA 2COMA 2V9KA 4ZH4F 4MO7A 4EV0A 2ZBKA 3QQAA 4I01A 3HUGA 4BE1A 1ZAOA 3DQVC 2WAQN 2R7WA 1NH3A 4PJMA 1U5TB 1YTYA 3SJMA 3V8KA 3P9CA 4AIKA 3BQZA 1W36C 5CQGA 1LQ1A 4A3BJ 5LHHA 4M3DA 2VT2A 1DU6A 2P5LC 1FOWA 1SVMA 4AM3A 2IGMA 3B6AA 1JTXA 5HDKA 2KDZA 2GAUA 5DV5A 1B8IB 1W5SA 2DFIA 4A3DJ 1RKWA 2ZNZA 4CH7A 4XBFA 4LB6B 3RKYA 2KPMA 2PJRB 1WVRA 2M45A 1XGOA 4RB3C 1MNEA 2ZJPF 4P96A 3KIOA 3HSEA 3E5QA 3OYJA 1UB9A 4U87A 5DCMB 1QZEA 5FGMA 1OYWA 4RB2C 1OPCA 1H9TA 3MZYA 3K4NA 5LGUA 3ZQIA 2FU4A 3U9GA 2MFZA 3F0CA 3F8CA 2VE9A 3RSNA 2QBYA 2F5FA 2A6HF 3F9KA 2O3FA 3F6OA 4Y7NJ 2VE8A 4Y3OA 2V4JC 2L01A 4OAYA 1MBJA 3LAPA 4HF0A 4ENKA 1ZREA 2W84A 4Q4ZF 2HXOA 5HLGA 5L3DA 4B3XA 2V7FA 2V1UA 2VJ4A 4BL0B 1HQCA 2NNNA 2K86A 5FKLA 2D1VA 3GFJA 1BI2A 3AKZA 3K70D 3CO6C 5J4YA 4BXXJ 1EH7A 3MZHA 3M07A 4JYKA 3PUBA 1R7JA 2OJED 4M9ZA 5BOXA 4BY1J 1BIBA 1Z91A 4ASNA 3I55I 3TDZC 1YFHA 2CUFA 1Z1DA 1HF0A 3N4MA 2LRDA 3QAHA 1TWFJ 1FT9A 5FO5A 4G7OF 2DA6A 3K69A 1ZG5A 1B59A 1U8BA 2EQRA 4OMYA 2W4SA 2LY2A 3LQQA 1OFCX 2ID6A 3TBIA 3F72A 3M8FA 1QQIA 1IXCA 4YRVA 3T8TA 4HV5A 2UUZA 2OQRA 3L2RA 3QU3A 1OR7A 1CF7A 1P4XA 2XKPA 3OV8A 1UHMA 2A6EF 2OPTA 4G9YA 2GXBA 3IKVA 1I3QJ 4LLLA 2L3DA 1VQKI 3K1PA 2YUSA 2CFOA 1XDUA 4B4CA 2JA8J 3GTKJ 3CCRI 3NAUA 2L02A 2XV4S 3IH2A 3KYDB 1S6LA 2DTZA 1Z05A 2HQRA 3RKWA 3WTSC 2ZFWA 3EQLF 3T5XA 1IAWA 2LF8A 3QWLA 1YRNB 4J00A 5IP7J 1RESA 2ZKZA 4I7HA 1ON2A 2E19A 3BTJA 3FK6A 3FXMA 3L09A 3BPVA 2H27A 4R79A 4NC7A 1WJAA 2XVCA 1EH6A 2L7ZA 3H92A 4R1HA 3F21A 1X1AA 5LGNA 4X0GA 3OYCA 3BG6A 2Q2EB 5ILVA 3Q3SA 4XLAA 1VQ9I 1N78A 5DUKA 5FB2A 3F8FA 5E3MA 5F64A 2MABA 3EDPA 4Y4RA 5HS7A 1VQ5I 3GW2A 2NYXA 3L9FA 3MKZA 2B0LA 1Y0UA 1AA7A 1LEBA 1B1BA 1Q1HA 1RRJA 2JRTA 4IKFA 3CJTB 5LRRA 2X6WA 1WPKA 4WXCA 3IUOA 2G9WA 2L4MA 4QTRA 1IDYA 1Y1WJ 1FMWA 3BTLA 3I9V2 2VKEA 4WXDA 2GBYA 3ULQB 3F23A 3KEQA 2CRGA 1X1BA 3AL0B 3IAM2 1KQ9A 1OCCH 1IDZA 2KZGA 5EDNA 4E7KA 4ON0A 4PJNA 1Z0XA 4II2A 3CCQI 4ZDOA 1SVLA 3RKQA 3S1RJ 3BROA 1X4OA 2P7CB 1TW2A 3PM1A 3CCVI 2VUMJ 4CCKA 5B1BH 3PL8A 3KYCB 4N4NB 2YU9J 5EG0B 1YE9A 1R5HA 2O9LA 1IV8A 3W6KB 5M5YJ 2RC4A 4L5EA 2XHKA 3JRCA 4CDGA 3GBGA 4RGUA 5JI6A 2PX9A 2A5YB 2VQHA 5KAFC 3Q9VA 2JT1A 3S1QJ 2WV0A 3CUQC 4MLOA 1LFUP 2O0YA 1A35A 2R7DA 5BPIA 3PSIA 2DA2A 3HTUA 4HLXA 2L9VA 1J5YA 3PJRA 3CLQA 3IRRA 1U0JA 4MQ9F 1W7PA 3PIPF 2CQXA 2V9PA 4W97A 4Y33A 4UVBA 5JVGF 2Z3YA 1HW1A 2DDAA 1AU7A 3HPHA 3H9QA 4DW6A 3LNQA 2VL8A 5IYCJ 3COAC 4BS9A 2UZKA 3HHGA 3MQ0A 3BG9A 3P9IA 2TRTA 1QZYA 2KDOA 1V54H 2BY3A 2H1KA 1XGSA 3EPZA 1E0EA 4GGGA 2BW3B 1GHCA 4YG2F 2ZXHA 4Q48A 5IOYA 1N25A 4MFEA 1DGRM 2OCEA 2ZSHB 2ZFUA 1A31A 3OYHA 1KU7A 1L3LA 1F5TA 2CQ7A 2NRAC 3I59A 2WC2A 3SZPA 1Y56A 3DTKA 3VYUB 4CSWA 2HZTA 4WCGA 1H88C 2ESHA 2CV2A 2EPFA 1TQMA 2HXIA 2JVGA 4KISA 2NS0A 4QIWN 1BBYA 1YYVA 3KCCA 2F5VA 1U9NA 3OL4A 2R5ZA 3MEXA 4OIRF 1S29A 1JKOC 3JRIA 5HNHA 2YX4A 2KP6A 5EEAA 4ZYEA 5DM7F 2GIZA 2XAJA 3M1EA 1OCRH 2PQ8A 4IQ4A 5H20A 1LVKA 4HG2A 2Z5UA 2E5ZA 5HS8A 1IRGA 1BR4A 1ZK8A 3OIPA 2M5WA 5EEHA 2FQ3A 3RQ4A 3RZDJ 2DJIA 5EF6A 4BQAA 2IW5A 2JZYA 1KA8A 4F3QA 2CSOA 4BJTA 4XKCA 2CUJA 5TJJA 3GTPJ 2AHQA 1TZLA 5DS9A 2QSHX 2KJBA 1MJ9A 1OISA 1Y6IA 2KFDA 3TW6A 1MGTA 1MDMB 5E3NA 3IKTA 2E36A 3JRGA 1RKTA 5CVVA 1XDSA 3HKZN 2DCEA 1VQ6I 1X4PA 2M1BA 3L1PA 5JHUA 2RAEA 2E7WA 3DKXA 2VOPA 2MYSA 3G1LA 4ENJA 4ZTFA 1BM9A 2ZXWH 5LGTA 3SZTA 5F1JA 5HODA 4L5JA 1K4TA 3H9GA 3V42A 2STTA 2QSGX 3P9KA 2KZVA 3Q0WA 5H6QA 3G4SI 1ITYA 3H0GJ 1TWAJ 2LLKA 4EJUA 2PMZA 3QPHA 5LHIA 2HOSA 3TEDA 2MBFA 4E4HA 2Y75A 2TDXA 3E97A 2HKOA 3ECHA 3QOPA 4BY7J 3HOYJ 4HRIA 4W1UA 2GM4A 1JKPC 4D0PA 1H9GA 5JVTA 3TQNA 1ZTRA 3TKYA 2WWYA 4P5OA 1Z7LA 3HOXJ 2IPQX 4B8XA 4LIVA 1JGGA 2QZ8A 1BW6A 3NWTA 4U0VA 1ZN2A 3HM5A 3W2VA 3K0LA 1YJWI 2QQ8A 1TTYA 2ID3A 2W57A 4D1QA 2JSPA 4HSRA 3L2WA 2JQ7A 3JW4A 2R0QC 4A3LJ 4XLFA 1AKHA 2MC3A 1HDDC 1JI8A 2QGUA 1WWXA 2E1MC 4UB6C 5FFZA 5CPRB 3HGGA 3SEZA 3NQOA 1B8IA 3AG2H 1DDNA 4L9NA 2LKXA 3LSMA 3MMYB 3W3CA 4AUXA 1IJWC 4A3JJ 1IGNA 1U3EM 1EJ9A 4UNOA 2LY9A 2FSWA 3O8HA 3N05A 2LBFB 4QSHA 5E8GA 3W6VA 1LFPA 1XX5A 2ISZA 1U9OA 4XMYA 2JPCA 3HXLA 4NNJA 2HPMA 2KQRA 2QF7A 4RM2A 1A6QA 4YFKF 1BC8C 1AHDP 4HF1A 4WWCA 1MKMA 1WHUA 4RA2A 3GTMJ 4OIPF 2M87A 2O8KA 2DO7A 4A5NA 5DD4A 4MHGA 5HLIA 2GXGA 1HKSA 4KITB 1JXSA 4OU0A 2OBPA 3GCMA 4DYRA 2KLOA 1Z77A 3TOAA 3KZYA 3LA7A 1WJCA 3ZP5A 1MBHA 2FJ1A 1KZHA 2QYOA 3VFZA 3CTAA 4H4KC 4LMYA 3WTWC 1WZ2A 3CJRB 3BZKA 2A05A 5E20A 4UUVA 3G6EI 2Y31A 1O3RA 4MFDA 2X85A 3D5SC 1VQPI 1KYZA 1R58A 2O61A 2EFWA 2HNHA 1T39A 4ETSA 2M4GA 2D2WA 3FKIJ 2E35A 2CO5A 2Z2SB 1XGNA 2RKHA 3BTIA 3HB9A 4DIQA 3IH4A 1UMQA 4M6XA 1E2XA 3PFYA 3VB2A 2Y9ZA 3VYSB 2DA5A 2QLZA 3OMYA 3RI4A 4KMFA 3A0BC 1H0MA 2ECBA 5EGOB 3WGHA 2QM3A 1TQIA 1SFKA 1FY7A 2X1CA 2IJLA 2XGEA 4XN0A 1E3OC 3A2KA 2YR2A 5AONA 5E3LA 2HQ5A 5J47A 4HLYA 4EMSA 1GDTA 2WA0A 3VODA 2W48A 4L18B 1BR1A 5GAGJ 2X1DA 3FXKA 2EZHA 1F9NA 2K3FA 3FM5A 4RS8A 2L7MP 3BG7A 3JTGA 3OYAA 2ZCWA 1J59A 6PAXA 2QWWA 1X58A 1LKXA 3OIOA 5C44J 1EF4A 1HSJA 4IHSA 2K40A 3HIFA 4BHCA 4V2GA 3ZPLA 1HKTA 2BHYA 2DFEA 2JVHA 2BY0A 3GVAA 1G6NA 2DFFA 4NHJA 5FRMA 2VB6A 3ONQA 1B72A 4F52A 4JX4A 4M6VA 3J7ZI 1BI3A 2NVUB 1MSFC 2LR8A 5E17F 2XIGA 4HV6A 3IWFA 4IOCF 1K78A 1O57A 5F0HA 2H09A 3EETA 4OIOF 3C1DA 2DW4A 4I98B 3JSPA 2R7XA 2A69F 2DI3A 3OYIA 1K61A 3SDGA 4C3JJ 2L5QA 3MKLA 3HG9A 3F8BA 5AIQA 1YOVB 3BG3A 1GV2A 1S8NA 1R5GA 2HEOA 2Y30A 4RB0A 3CCEI 1RETA 3K4JA 2K9QA 2H8WA 4CYCB 1OR7C 1FMVA 2Z16A 5B3SH 1I27A 2VJIA 1A6IA 2WB1N 1UELB 5E1ZB 1Q1VA 2P7VB 5ILUA 4P55A 4UV8A 1XPXA 5K5OA 3I0TA 4XKVA 1D1AA 1FYMA 2HDCA 4PSXA 1B9MA 1O3SA 5M5XJ 2JK3A 1HXDA 3GO5A 3JR9A 2M34A 5FFXA 2PN6A 4D9JA 1W36D 5FLXK 3CDLA 4HX8A 3FM3A 1YHQI 4HOBA 3FWEA 2QKLB 5GTIC 3L2CA 3V7CA 2DODA 3OYDA 1ORKA 3OYGA 2AQEA 4C2UA 3MWMA 1FLIA 3JCUC 5AIPA 3I3LA 3IWZA 4NC6A 3BC8A 3MKYB 3OIQA 5BPDA 2LREA 1B4AA 1TWCJ 1ZQ3P 5CLSA 1Y39A 3RJPA 2MGQA 1RIOH 2R92J 4PJJA 3BR3A 5FLXZ 1JKRC 3LAJA 1MH3A 4N4OB 5CVUA 3HRSA 1HBXG 2XAHA 3K2AA 2LOOA 4U88A 4M9XA 3FXUA 4PZJA 1SFXA 2EA4A 1ZR2A 2Y2ZA 4I76A 3FHNA 2EFQA 3C3WA 5LFAA 1WI3A 2CG4A 3HL2A 2DN0A 1FWZA 4F7ZA 1I1SA 4LG0A 1KYWA 4M74A 2RNJA 5GP9A 4N9IA 1Y8QB 2JTVA 5F04A 4Z2YA 3HTSB 2ZB9A 3BDDA 2F5DA 2MD5A 3VSLA 2P0WA 4A12A 3W2AA 3U1KA 3BR0A 3C2BA 1I6XA 1Z3YA 4DBQA 3PO3J 1IN4A 5GPAA 1TT0A 2HWVA 1R4NB 1R1VA 1YX3A 4WK8F 4HW0A 2LK2A 1BC7C 5GAEJ 3A1YA 3OOUA 1R6RA 3OYBA 5FJ8J 3HRTA 2ZJ2A 3PUFA 2BXYA 4KJZA 3PIOF 4DOZA 1ZLKA 4II3A 4DQ2A 3Q5FA 4IHXA 2OTLI 2X51A 4G6DA 3CF2A 1IN7A 4BHPA 1HDPA 1MH4A 2M8GX 4CHUA 1N77A 1P92A 3ZGKA 2MH9A 4M71A 2W24A 2XDVA 3ASOH 3WE2A 3OSFA 1S3JA 1UG2A 4IZZA 4XOPA 3NEUA 2CW7A 1WJDA 3TMOA 1MIJA 5CVRA 3DKYA 2L2OA 1FSHA 1WCMJ 4YELA 4RAGA 3J81K 2H8RA 4GO1A 2EA2A 5J8FA 2VJ5A 2DMTA 4Y13A 4P9UA 3CUQB 2YX7A 4MNUA 5M3MJ 2EBIA 3S2WA 2FMLA 2NOGA 2VKDA 1WRJA 4A3MJ 3G1OA 5BMZA 1JJ8C 2WY7Q 4BEHB 4IQJA 3VEPA 3LMMA 4UVAA 4HA8A 4BBRJ 3JSOA 3TP3A 3FKJA 5CVJA 3DFGA 4B43A 1WKMA 3GZNB 3JAMK 2IVMA 1DU0A 3KZIC 3J81Z 2ZJQF 4L9TA 5K7ZA 1FSEA 4ITVA 4HX4A 2BVMA 3GX4X 1IC8A 3ESWB 3K4CA 4K2EA 3R6SA 2KRHA 2VQCA 1OMIA 1MBEA 5F27A 2CS3A 4PJLA 5KCMA 2NVXJ 2IS4A 3ZQLA 1T0FA 4AIJA 3DWLE 3JAMZ 4AIHA 2YSRA 1TNTA 2R5YB 1RZ4A 4F92B 4PGHA 1JJ6C 2D5VA 5HDNA 4XRSA 1FIPA 2K9SA 2MW8A 3ABKH 3DBHB 4RBOA 1QHHD 2L7FP 2QENA 4YIIA 3LSPA 4A69C 4A3GJ 4NBQA 4HF2A 2QKMB 2PMUA 1LPQA 1BOAA 4HAMA 2E2JJ 1YQAA 5HS9A 2HU9A 1TL8A 1GUUA 3BQYA 1K79A 2O03A 1AWCA 1G3WA 1A36A 4P9FA 3T0YA 1K7AA 1HC8A 2LC2A 4JX6A 3GFLA 3KP3A 4CO8A 5DDGA 2DBBA 1WJFA 2L7KA 2PG4A 1HOMA 1ZRCA 3GFMA 4XIDA 4FE4A 3DKWA 3S32A 1NTCA 3JRBA 5HDGA 1TBXA 1ZGJA 3H35A 2X6OA 3RPUD 4BGDA 3NWSA 3H3VK 2I10A 4A0ZA 4DYCA 4NB5A 2WY8Q 2LKSA 2CQQA 3HOVJ 4G12A 4RAYA 3OSGA 2KIUA 2WAEA 3ZRGA 2AO9A 3Q0UA 4KA4A 3LSTA 3DPUA 3PFIA 3FBNB 4ZYGA 1J7KA 1FBUA 3ISPA 5CYVA 1SD6A 3FMRA 3PQKA 2LBFA 2CMPA 1ETWA 2RQQA 2EK5A 1KGSA 2EZKA 2KRCA 3WTXC 5LLQA 3DEEA 3B73A 3BJ6A 3T1BA 1X2MA 1SC7A 4BAYA 2Y69H 4HBLA 2NVYJ 1VQOI 3BWGA 3NARA 4ESFA 3J80K 3K4BA 4ZYDA 4BE0A 1ZKGA 4AU7A 5IY5H 3JRAA 5E79C 5TRDA 2R7RA 3VYTB 2XRLA 4M72A 2J5OA 3Q0VA 2K9LA 3HBLA 5E1XA 1QVUA 2D1HA 4EGZA 3LOCA 3OYNA 3ZOBA 4A6DA 2IP2A 4LK0F 1ZHFA 3WODF 3JREA 1R23A 1OKRA 2QQ9A 3ZMDA 3G1MA 1LB2A 4G94A 4BXFA 5IT3A 4ESJA 1VQ8I 3HRUA 5L3CA 3DTEA 2R7ZJ 5D8KB 2DMQA 4IRGA 2GZWA 4GDFA 2EWNA 2JWTA 3H36A 3E6MA 4YEJA 2VT3A 3LL7A 2K9MA 2LP0A 1SMTA 3S17J 3OL3A 3FMSA 1ZG1A 2JJ7A 4L0YB 1V5FA 3TL4X 3GFIA 2GA1A 1TQPA 2OTJI 3S3NA 3BR1A 5DUIA 2V1NA 2E1MB 3HDDA 3A01A 4IHWA 1WGXA 2IA2A 1BL0A 2HS5A 4GYGA 2O8XA 2FA5A 1WH5A 1AOYA 3HHHA 5FLMJ 1T95A 4HQMA 1LUJB 2E5NA 4M6YA 1W5TA 3PQJA 5EJCA 2P6SA 3BR5A 2IAIA 2K7LA 2R7SA 4BYYA 2KIMA 4IL6C 1M1EB 2MSYA 3MAJA 4Z6YA 2IS6A 1D0XA 4GRIA 4OMZA 1FZPB 1VFCA 3CQZJ 2UXNA 4IVNA 4CYDA 3CCUI 4EGYA 5JLXA 2VQLA 2V9VA 3OY9A 3BP8A 2H94A 4NC8A 3IV5A 2XUBA 1UZCA 1D8KA 3S1MJ 4KUMA 3IAS2 1YW9A 1N75A 1IN8A 3S14J 3D1NI 2Q8KA 2P81A 4PSWA 2LKPA 3G3ZA 2UV1A 1SAXA 3ELKA 2DYRH 2P4WA 1LJ9A 1WJBA 3CP2A 3EUKL 2IA1A 2A07F 5TGTA 3I4MJ 3FIWA 3HUGB 1X2NA 5KVRA 1E17A 5D5XB 3CESA 5FKOA 4OIQF 2ETHA 4BE2A 2H6CA 3ABMH 1WJEA 4A3EJ 5A2QK 3M1CA 4HYEA 4IHYA 4ANJA 4ZTJA 3WG9A 1ON1A 3CMMA 5EZHA 1NHAA 4LLNA 2E2IJ 3AG4H 2QQAA 3AAFA 3MZ8A 3QYBA 4E7IA 1MBKA 4B48A 1G59A 3AFHA 1T33A 4EJTA 4XK4A 3M3YJ 1E3PA 2X6XA 3QYEA 1H8AC 3TOBA 1QVTA 4XRMA 4BDYA 3L00A 3JTHA 3V4GA 3TW7A 1O3TA 4DNCA 2OV7A 2AQFA 1W0TA 3JRDA 1V5GA 1XMXA 1JT6A 1F4KA 5J1UA 2BZTA 2Y0SA 1PP7U 3WGGA 4UVCA 2QBYB 1XGMA 4A3KJ 2DOAA 1OCOH 1I3AA 4XSZF 2BYVE 1YG2A 2VIXA 3E6CC 3KLOA 2I5UA 1MMNA 4CXFA 1P7IA 2OCCH 2MLGA 1LDJA 2IRFG 3WG7H 2HYFA 1FNNA 1BR2A 1I50J 2M9HA 3WHBA 4RM3A 1F43A 1PVEA 2FQ4A 1S72I 4E7LA 2CJJA 3UNGC 2JPBA 1O7LA 1QO0D 2IXSA 4I0BA 4XONA 5ED4A 2VBYA 3R0AA 5CKTA 4KMUX 4OOIA 3G71I 4BBSJ 1F36A 5BQTA 4KN7X 2Z33A 3CC4I 5IT9K 5H6RA 3EYYA 1SANA 4CCJA 3L2QA 2BGCA 3RYPA 4BJ5C 4V19K 3CJQB 4R8HA 2ME0A 4BQQA 3I4PA 1FOXA 3ZXSA 3DCFA 2K5CA 1ZRFA 2ELKA 2YS9A 1YIJI 1J09A 3VYRB 3QPSA 4GFBA 1U5TA 3E3VA 2Z99A 2RVCA 1QGPA 1XTAA 4B47A 5HOOA 3ML6A 2QA4I 4J19A 2XB5A 1I5ZA 1BOBA 2F6CA 4LIUA 3VOEA 1CF7B 5IT9Z 4ABZA 4IPAA 2DOEA 4XKBA 1QBJA 4KFCA 3TO7A 1XSDA 5K5QA 2DA3A 1SD5A 1ENHA 4FX0A 4RGSA 3U21A 2XASA 3LSGA 3LFUA 3KP6A 5EYRA 3O8GA 2AXLA 2W82A 1RR7A 5L3FA 2CU7A 3FHZA 3ERED 2PJRA 1T08B 2DDBA 3W6JB 2IA0A 4HZFA 3OWTA 2BEOA 4V2FA 5DCMA 5LEKA 4FISA 3QP6A 2NS7A 2DA1A 1YIOA 3SDBA 4BQNA 5HLHA 5IP9J 4LOCA 5IYDJ 4BXUA 4XL9A 3DP7A 3CUQA 4HNVA 3H5RA 2CWEA 3V8LA 1BJAA 4A3IJ 4RLFA 1X1PA 1XCBA 3M7GA 5B66C 5EZGA 1ZG3A 1XSXA 2FE3A 2OZUA 2CH0A 3E6DA 3PSFA 2VASA 2VI6A 3UKGA 2NAZA 3GUDA 1TT5B 1ETOA 2ZMEC 1K6YA 3TO6A 1ZARA 3KEYA 1FTTA 1R49A 1BJZA 3CD6I 1Y0NA 4PFPA 2F5EA 1JT0A 1O4XA 2XGXA 1S7EA 3DU6A 1Z7UA 2IEKA 1G3TA 3LSKA 3SEQA 3HC7A 1SMYF 3WU0A 5F0CA 3ABLH 2PMZN 2MH2A 3MVPA 1TWGJ 3U1DA 4FX4A 1HSTA 1U6GA 3QYFA 2EZLA 1IRXA 2BXZA 3CDHA 1DQUA 3HYIA 1R71A 1QU3A 4RAZA 4IHVA 3QU6A 2F48A 2L9RA 1OQYA 3ZN0A 1R00A 5E1WA 2ZC2A 4PUSA 2OQGA 4CGZA 4I99C 1T56A 1HW5A 3QP5A 2L9SA 4Y52J 4PDKA 2EV5A 3GWZA 4AC0A 4KT6A 1V4RA 2KISA 2L0KA 5J6XA 4FASD 2M0MA 2JA7J 1QRYA 4IRIA 3TO9A 2JUGA 1XMAA 3K2ZA 2XRNA 5F1RA 4CCNA 1RC9A 2MD0A 2JMWA 4BDZA 2F2EA 2HDDA 4M73A 4ZZDA 5KNLA 2A6TA 4HEA2 2OZ6A 4BJ6C 5J8CA 3I71A 2DQLA 2F4OB 2BV6A 4N9HA 2PI0A 2CQNA 2CUEA 1BI1A 1LFBA 1YRNA 1NK3P 1P2FA 5K7FA 1ZYRF 1TWHJ 4ZDPA 1W7PB 2EH3A 2M7AA 2FF4A 1MNMC 3GTQJ 4XORA 5KAIC 3D5LA 4I09A 2PBIA 5FD5A 1T98A 3DPLC 2B9SA 2JSCA 4AYBA 3ZR8X 3QRFF 1EKEA 1LVAA 2Q2EA 3P5JA 3CCJI 3VDXA 2JA5J 2EINH 2HR3A 3F8NA 2DYSH 4TV7A 1PP8F 1YO5C 1ETQA 3BCAA 4QWQA 1IUYA 2O6GE 2W00A 4I0AA 2ISYA 4HQEA 1OCPA 3FBIB 1F1ZA 3BT9A 3ABUA 1PJRA 5D6EA 5L3GA 3IRQA 4DZJA 1D5YA 1A5JA 1PUFB 1T0FC 2DU9A 3CMEI 2FUG2 3K1NA 3L2UA 3KETA 2E7XA 5GADJ 1R1TA 2HYJA 4HNTA 4C2TA 3QPTA 3ZQQA 1FOYA 2XC7A 4HDUA 1XN7A 3I59B 3MN2A 2EILH 2Q1ZB 2LG4A 3IL2A 2OF7A 3KX2A 4ZYAA 2COBA 3ZQ7A 5JLWA 4UV9A 4EM2A 5D5VB 3K10A 3RTRA 1YW8A 2OA4A 3JRFA 4B1RA 2R5ZB 4IOAF 3WE3A 1J9IA 4HDVA 2GOXB 3E7LA 4O5VA 1D1BA 5EG0A 2WAQA 2LTPA 2R7QA 3A4CA 4A5MA 1JTYA 2VODA 1SVOA 3F3XA 2VJJA 2P6TA 2HQNA 4D5CA 4XNFA 1O3QA 2DMPA 3FISA 1VNDA 1U2WA 2X4HA 2E71A 3I53A 2PJPA 2Z9OA 1S7AA 1UHSA 2W7NA 3DF8A 1WFXA 2M4KA 3HJEA 3FZVA 3ZQHA 3S3OA 2KKOA 1J75A 4GXOA 2R7TA 2DA4A 4GYIA 2HDWA 3QPLA 3CMAI 4KNYA 1KU2A 2V6CA 3K9TA 4S05A 5FRNA 4F91B 1UG0A 3DV8A 4HSTA 1D3YA 1ETKA 4I02A 5J40A 4U7BA 4JX5A 1YJ9I 1U78A 3TDUC 3BJAA 4E7ZA 4B44A 1W7PD 1LEAA 1LDDA 3S1NJ 4CICA 1JKQC 5D8LB 2JRMA 2DPUA 3KZZA 4S04A 2A68F 3OYEA 2RQPA 3EUAA 4L9VA 3I54A 2DT5A 2NXNB 3HGYA 2VXDA 4MGRA 1XD7A 4E6KG 4RDUA 2V26A 4FE7A 2EV0A 1XS9A 4AYBN 2X48A 2QCOA 5B5EC 3DLAA 2LD5A 2K4BA 1D1CA 1GV5A 2BW3A 1UAAA 4EM1A 1SD4A 5JFRA 4JK1X 4G7ZF 5CVIA 4BQOA 1G3YA 1UFMA 1VF9A 4IEJA 4EJOA 2FMYA 3A0HC 3K1MA 3RCOA 1L0OC 1P6RA 2HVSA 1T6SA 3CCMI 1IO2A 2R7OA 4XM3A 5DD8A 3A02A 2HGCA 4UY8I 1ZGWA 3X2QH 4I6ZA 3WU1B 1X3UA 2PEXA 2NS8A 1VI0A 2R7VA 5FKMA 5D4RA 9ANTA 4IRHA 4MTDA 3OYLA 3IHUA 1MMDA 1EH8A 2E34A 3E1SA 4A0XA 2XSJC 1NG7A 2OAZA 3BOQA 3KP7A 4MEXF 2IS2A 2G7HA 4BH9A 1FEXA 1W5CC 2LFBA 3IH3A 2R3SA 3FK7A 2VBWA 1FOKA 4O6JA 3CCYA 4KIGA 4L5IA 1POGA 5FKKA 3KP4A 2K27A 4YIRX 4Q47A 2L54A 2L9NA 1IRFA 1MW7A 2AS5F 1AKHB 4LGWA 2K4JA 4LK1F 1OCZH 5CJ9A 1X19A 1LNWA 1ONVA 2XAGA 1ZELA 4YFNF 1WQ2A 2WV1A 2MA3A 3R60A 2VONA 4HPQA 3VPRA 1R5ID 5ICCA 1MDMA 4EVIA 1PUEE 4M3BA 1G2HA 5IP6A 3UR3C 1GT0C 3KE2A 4NDLA 3C2HA 2F4IA 1GLNA 1Z6TA 2DMNA 2LNBA 4UXNA 1NK2P 1ZH5A 4RAFA 5IPAA 3LQRA 4BUPA 3D5RC 2HTJA 2EFNA 3BPXA 1G4DA 4EQQA 1IUFA 2H6BA 1OYYA 1ETVA 1PYVA 2XF6A 3RYRA 3J7AY 2CGPA 4RB1A 1APLC 1XG1A 2P5KA 3BTCA 2A3SA 4BNCA 1P7JA 2LVSA 3D0SA 2FOKA 3H5NA 4KICA 1CGPA 2L4AA 1JHHA 1G8XA 2DT6A 5JHFA 4MQVA 3KP2A 3V7SA 5ICEA 4EJVA 3J7AO 3LWFA 3BR6A 4GCVA 1MBGA 1SFEA 5DCFA 5C3EJ 2K02A 3R4KA 1R4MB 1FC3A 2Y0MA 1CQTA 2ADUA 5H2FC 4ZJZA 1REPC 2E2HJ 4XRFA 2G7UA 2JUCA 2FRHA 5FROA 3SFZA 2CV0A 3S2HJ 2GIVA 4S0HB 2XGCA 3EUHA 4BU2A 1FBQA 2M7BA 2LSOA 4KIBA 3REOA 2E1OA 4X6AJ 1XMKA 1Y8RB 3K6GA 5BNGA 4XQFA 2EFPA 1MJAA 2VKHA 4WX9A 3OYKA 1ODDA 1IN6A 1E3HA 1I1GA 1FTZA 3TGNA 1K83J 5TISC 3MFKA 2MC4A 1FP2A 4E7JA 2IBDA 1PDNC 1ZRDA 3RDIA 2BVLA 3FX3A 2IGOA 1J2XA 4OINF 2ME6A 5DYMA 1MZBA 1P9QC 1MMGA 2ELJA 2DFHA 1Z21A 3M8EA 2A61A 5E3OA
chains in the Genus database with same CATH topology
3KFWX 1YS6A 3U2RA 5LHGA 1R22A 4AVPA 2R7FA 3WTYC 4PGGA 1T2KA 1GXQA 4ZZLA 1YLFA 1EV7A 2LDUA 3R0JA 1J0RA 4EM0B 2UWMA 3ZMUA 1C0WA 3Q9SA 2Q0OA 2Y48A 2UXXA 1K78B 5DEQA 3WGIA 2HTSA 1D5VA 2DK8A 1XB4A 1GXPA 3J80Z 2HYGD 2OU2A 3L7WA 3GZ6A 1FYLA 1U5TC 3P7NA 3WTVC 5KK1A 4WXHA 1QPMA 1QNTA 5EEGA 3C7JA 4QLCU 4JBAA 1SD7A 4G6QA 2STWA 3I5UA 3E6BA 2E1NA 2DAOA 2QQBA 3T8RA 4A2UA 5L3BA 2EV6A 1YW7A 4LLGF 3RIRA 4LD5A 2M30A 3M9AA 2FEZA 3DPTA 4CZZA 5BS6A 2P8TA 4LB5A 4XLPF 1JHFA 4KN4X 4WF2A 1KQ8A 1DPRA 4ZYHA 1Z6RA 2ZNYA 3ZN1A 4ESBA 2ACJA 2C6YA 4HX7A 2YU3A 1UCRA 4LG0B 1B9NA 2RGVA 3O6BB 2HKXA 3KLNA 2ZMEB 5HVQC 5D5WB 2DTRA 3I64A 4MTEA 4YIFA 2IT0A 4Q5SF 2ZO4A 1BIAA 2RDPA 5D4SA 3OOPA 1ULYA 2E1CA 4I2OA 3CUOA 4KIFA 3WTZA 1BN5A 3GZ5A 1ZGAA 2X0LA 2QUFA 1O7FA 3LA2A 2EFOA 3FMQA 3FXQA 2ZXJA 2WTEA 4A0YA 2VOOA 4KDPA 4XLNF 3HOTA 2FBIA 2NNYA 2XAFA 2HOEA 2F5CA 5A2QZ 3RPQA 5LRSA 1DUXC 2D45A 1OYIA 5ILSA 1P4WA 1FX7A 4E70A 2VC1A 2CQKA 2XROA 1Z9CA 5K1YA 1B6AA 1GVJA 4U7DA 3DEUA 1IZ1A 2EB7A 4IJAA 5JR3A 5ICFA 4MEYF 2PFBA 3GYHX 4FHTA 2BBYA 2OD5A 3ZMTA 1V3FA 1QZZA 4ENNA 3ZMSA 4AWXB 2V1XA 2CFXA 4LJZF 2ESNA 4IXAA 3C18A 5D6FA 3V8JA 1XSVA 5L3EA 4RGRA 1UHWA 1XCVA 4JQFA 5K5RA 1TNSA 3R61A 3SXYA 2FBHA 3H3UA 5ERIA 4XSXF 4H0EA 5E8IA 4B09A 3HRMA 2VBXA 2LF7A 2VC0A 3EYIA 1IXSB 1USSA 1TW3A 1WI9A 5F6FA 4G7HF 3ECOA 1JE8A 4U0YA 3O3KA 1STZA 2BE5F 4L9JA 3RPUA 3RKXA 1HKQA 2W85A 5FD6A 3HOSA 1IW7F 1KU3A 1KU9A 3IC7A 1P4AA 4FT8A 4L0ZB 1FPQA 3B02A 4PCQA 2GA2A 4IF4A 3NRVA 1U8RA 3CJNA 1KQ0A 3E5UA 1BI0A 2RN7A 4RGXA 4A6EA 4EJWA 3GEZA 2FNAA 2RV8A 2KIFA 4U0WA 4YFXF 5LEJA 1RNLA 3ZMZA 4IHTA 2W25A 1T38A 3SHFA 2XKOA 3BJOA 3LA3A 1RUNA 3SQNA 2GWRA 2QVOA 5D5UB 1DPUA 2PMHA 3GXOA 3CLOA 2PLYA 3V7RA 2VBZA 3H3ZA 4UHTA 1IN5A 3HSFA 3GF2A 3ABTA 5E18F 3O2PE 2J5PA 1G3SA 2CW0F 2ELHA 1IF1A 4O3MA 3WTTC 3MCZA 3HSRA 3ROUA 4M9SA 3DXJF 2GQQA 1ZLJA 1VTNC 1YS7A 3CO7C 1FYKA 2FXAA 5ICGA 3LFKA 2EJRA 1WSUA 4Y15A 4ENMA 2HFHA 3E5XA 3F8MA 3BY6A 4LFUA 1LDKB 3WTUC 4N0BA 4Y17A 1R36A 2P5VA 2DQRA 1JGSA 4NQWA 3I58A 1RUOA 2DK5A 4G8XA 1MD0A 4AD9A 2VN2A 2YPRA 3GLXA 3FF5A 2V1DA 1R1UA 1HW2A 3F22A 2V79A 1FBSA 3KEOA 2XAQA 3BZ6A 1D8JA 3ZMVA 4KYWA 2CYYA 3FXRA 3KP5A 1IXRC 2DPDA 1TLHB 2KJCA 1FP1D 1A04A 1S7OA 1USTA 2FBKA 2KRFA 1K6OA 1MJBA 3G73A 1RI7A 1W4MA 2DLLA 4BHBA 2VXZA 2FNPA 2MLKA 2M8EA 1DP7P 2ZMEA 3N97A 1SFUA 3F6VA 5LBQA 4KT5C 2COMA 4ZH4F 4EV0A 2ZBKA 4I01A 3HUGA 1ZAOA 3DQVC 1U5TB 1YTYA 3V8KA 3P9CA 4AIKA 1LQ1A 5LHHA 2VT2A 2P5LC 5HDKA 2GAUA 5DV5A 1W5SA 2DFIA 2ZNZA 4XBFA 4LB6B 3RKYA 2M45A 1XGOA 4RB3C 4P96A 3HSEA 3E5QA 1UB9A 5DCMB 5FGMA 1H9TA 1OYWA 4RB2C 1OPCA 3MZYA 5LGUA 2FU4A 3U9GA 3F8CA 2VE9A 2QBYA 2F5FA 2A6HF 2O3FA 3F6OA 2VE8A 2L01A 3LAPA 4HF0A 4ENKA 1ZREA 2W84A 4Q4ZF 5HLGA 5L3DA 2V1UA 1HQCA 2NNNA 2K86A 2D1VA 3GFJA 1BI2A 3CO6C 1EH7A 3MZHA 1R7JA 4M9ZA 5BOXA 1BIBA 1Z91A 4ASNA 3TDZC 1YFHA 1Z1DA 3N4MA 3QAHA 1FT9A 5FO5A 4G7OF 3K69A 1ZG5A 1B59A 4OMYA 3LQQA 3F72A 3M8FA 1QQIA 1IXCA 3T8TA 4HV5A 2OQRA 3QU3A 1OR7A 1CF7A 1P4XA 2XKPA 3OV8A 1UHMA 2A6EF 4G9YA 2GXBA 3IKVA 4LLLA 2L3DA 3K1PA 1XDUA 2L02A 2XV4S 1S6LA 1Z05A 2HQRA 3RKWA 3WTSC 2ZFWA 3EQLF 3T5XA 1IAWA 2LF8A 2ZKZA 4I7HA 1ON2A 2H27A 3L09A 3BPVA 4R79A 2XVCA 1EH6A 3H92A 4R1HA 3F21A 5LGNA 5ILVA 5DUKA 5FB2A 3F8FA 5F64A 3EDPA 5HS7A 3GW2A 2NYXA 3L9FA 2B0LA 1Y0UA 1LEBA 1B1BA 1Q1HA 2JRTA 5LRRA 4WXCA 2G9WA 2L4MA 4WXDA 3ULQB 3F23A 3KEQA 1KQ9A 4ON0A 3BROA 2P7CB 1TW2A 1R5HA 3W6KB 2RC4A 2XHKA 4CDGA 4RGUA 5JI6A 2A5YB 3Q9VA 2JT1A 2WV0A 3CUQC 2O0YA 2R7DA 5BPIA 3HTUA 4HLXA 1J5YA 3IRRA 4MQ9F 1W7PA 4UVBA 2Z3YA 1HW1A 3COAC 2UZKA 3HHGA 3MQ0A 3P9IA 1QZYA 1XGSA 4GGGA 1GHCA 4YG2F 4Q48A 1KU7A 1L3LA 1F5TA 2NRAC 3I59A 2WC2A 3SZPA 2HZTA 4WCGA 2ESHA 1TQMA 2NS0A 1BBYA 1YYVA 3KCCA 3MEXA 4OIRF 1S29A 2YX4A 4ZYEA 2XAJA 3M1EA 2PQ8A 5H20A 2Z5UA 5HS8A 1IRGA 2M5WA 5EEHA 2FQ3A 4BQAA 2IW5A 2JZYA 1KA8A 2CSOA 5TJJA 2KJBA 1MJ9A 1MDMB 1MGTA 3IKTA 5CVVA 1XDSA 2M1BA 5JHUA 2E7WA 2VOPA 4ENJA 1BM9A 5LGTA 3SZTA 4L5JA 2STTA 3P9KA 5H6QA 4EJUA 3QPHA 5LHIA 2MBFA 2Y75A 2TDXA 3E97A 2HKOA 3ECHA 3QOPA 4D0PA 1H9GA 5JVTA 3TQNA 3TKYA 2WWYA 4P5OA 2IPQX 4B8XA 2QZ8A 4U0VA 1ZN2A 3K0LA 1TTYA 2W57A 3JW4A 2MC3A 1WWXA 5FFZA 3NQOA 1DDNA 4L9NA 1U3EM 4UNOA 2FSWA 5E8GA 2ISZA 2JPCA 4YFKF 1BC8C 4HF1A 4WWCA 1MKMA 4OIPF 2M87A 2DO7A 4A5NA 5DD4A 4MHGA 5HLIA 2GXGA 1HKSA 1JXSA 4OU0A 2OBPA 3TOAA 3KZYA 3LA7A 3ZP5A 2QYOA 3VFZA 3CTAA 4LMYA 3WTWC 5E20A 4UUVA 1O3RA 1KYZA 1R58A 2O61A 2EFWA 1T39A 4ETSA 2D2WA 2CO5A 1XGNA 2RKHA 4M6XA 1E2XA 3VB2A 2QLZA 3RI4A 4KMFA 1H0MA 3WGHA 2QM3A 1TQIA 1FY7A 2IJLA 2YR2A 5AONA 4HLYA 4EMSA 3VODA 4L18B 1F9NA 3FM5A 4RS8A 3JTGA 2ZCWA 1J59A 6PAXA 2QWWA 1HSJA 4IHSA 4BHCA 3HIFA 3ZPLA 1HKTA 3GVAA 1G6NA 4NHJA 1BI3A 5E17F 2XIGA 4HV6A 3IWFA 1K78A 1O57A 2H09A 3EETA 4OIOF 3C1DA 2DW4A 4I98B 3JSPA 2A69F 2DI3A 3F8BA 5AIQA 1S8NA 1R5GA 2HEOA 4RB0A 1I27A 5E1ZB 2P7VB 5ILUA 4P55A 4UV8A 5K5OA 3I0TA 1FYMA 2HDCA 1O3SA 1B9MA 1HXDA 3GO5A 5FFXA 2PN6A 5FLXK 4HX8A 3FM3A 4HOBA 3FWEA 3L2CA 3V7CA 3MWMA 1FLIA 5AIPA 3IWZA 5BPDA 1B4AA 5CLSA 3RJPA 1RIOH 5FLXZ 3LAJA 1HBXG 5CVUA 3HRSA 2XAHA 4U88A 4M9XA 3FXUA 4PZJA 1SFXA 2EA4A 2EFQA 3C3WA 2CG4A 1FWZA 4F7ZA 1I1SA 4LG0A 1KYWA 4M74A 2RNJA 4N9IA 4Z2YA 2JTVA 3HTSB 3BDDA 2F5DA 2MD5A 4A12A 1I6XA 1IN4A 2HWVA 1R1VA 4WK8F 4HW0A 1BC7C 3HRTA 2ZJ2A 1ZLKA 4DQ2A 3Q5FA 4G6DA 1IN7A 4BHPA 4CHUA 1P92A 2MH9A 4M71A 2W24A 3WE2A 1S3JA 3NEUA 5CVRA 1FSHA 3J81K 4GO1A 2EA2A 5J8FA 4Y13A 4P9UA 3CUQB 2YX7A 4MNUA 3S2WA 2FMLA 1WRJA 5BMZA 3VEPA 4UVAA 4HA8A 3JSOA 5CVJA 3DFGA 1WKMA 3JAMK 2IVMA 3J81Z 4L9TA 1FSEA 4HX4A 3GX4X 4K2EA 3R6SA 1OMIA 1T0FA 4AIJA 3JAMZ 4AIHA 2YSRA 1TNTA 1RZ4A 4PGHA 5HDNA 2QENA 4YIIA 4HF2A 2PMUA 1BOAA 4HAMA 1YQAA 5HS9A 1K79A 2O03A 1AWCA 1G3WA 4P9FA 3T0YA 1K7AA 3GFLA 3KP3A 4CO8A 5DDGA 2DBBA 2PG4A 1ZRCA 3GFMA 3DKWA 5HDGA 1TBXA 1ZGJA 4A0ZA 4NB5A 4RAYA 2KIUA 4KA4A 3LSTA 3PFIA 4ZYGA 1J7KA 1FBUA 3ISPA 5CYVA 1SD6A 3FMRA 3PQKA 2EK5A 1KGSA 3WTXC 5LLQA 3B73A 3BJ6A 3T1BA 4BAYA 4HBLA 3BWGA 4ESFA 3J80K 4ZYDA 5TRDA 4M72A 2J5OA 5E1XA 2D1HA 4EGZA 4A6DA 2IP2A 4LK0F 1ZHFA 3WODF 1R23A 1OKRA 2QQ9A 3ZMDA 1LB2A 4G94A 5IT3A 4ESJA 3HRUA 5L3CA 5D8KB 4IRGA 2GZWA 2EWNA 3E6MA 2VT3A 1SMTA 3FMSA 1ZG1A 4L0YB 3GFIA 2GA1A 1TQPA 5DUIA 2IA2A 2HS5A 4GYGA 2O8XA 2FA5A 1AOYA 3HHHA 4HQMA 4M6YA 1W5TA 3PQJA 2P6SA 2K7LA 4BYYA 2KIMA 3MAJA 4OMZA 1FZPB 2UXNA 4IVNA 4CYDA 4EGYA 2V9VA 3BP8A 2H94A 2XUBA 1D8KA 4KUMA 1YW9A 1IN8A 2Q8KA 2LKPA 3G3ZA 1SAXA 3ELKA 2P4WA 1LJ9A 2A07F 2IA1A 5KVRA 1E17A 5D5XB 4OIQF 2ETHA 2H6CA 5A2QK 4HYEA 3WG9A 1ON1A 4LLNA 1NHAA 2QQAA 3AAFA 4EJTA 3TOBA 3L00A 3JTHA 3V4GA 1O3TA 4DNCA 1F4KA 1PP7U 3WGGA 4UVCA 2QBYB 1XGMA 4XSZF 2BYVE 1YG2A 3E6CC 3KLOA 4CXFA 2MLGA 1LDJA 2IRFG 2HYFA 1FNNA 2JPBA 1O7LA 1QO0D 4I0BA 5ED4A 2VBYA 3R0AA 4KMUX 4OOIA 5BQTA 4KN7X 2Z33A 5IT9K 5H6RA 3EYYA 2BGCA 3RYPA 4R8HA 3I4PA 1ZRFA 1U5TA 3E3VA 2Z99A 2RVCA 1QGPA 5HOOA 3ML6A 1I5ZA 5IT9Z 3VOEA 1CF7B 4IPAA 1QBJA 4KFCA 3TO7A 1XSDA 5K5QA 1SD5A 4FX0A 4RGSA 2XASA 3KP6A 5L3FA 2AXLA 3FHZA 3ERED 3W6JB 2IA0A 4HZFA 2BEOA 5DCMA 5LEKA 3QP6A 1YIOA 5HLHA 4BXUA 3DP7A 3CUQA 2CWEA 3V8LA 1BJAA 1XCBA 3M7GA 1ZG3A 1XSXA 2FE3A 2OZUA 3E6DA 2NAZA 3GUDA 3TO6A 1ZARA 2F5EA 2XGXA 1Z7UA 1G3TA 3WU0A 1SMYF 2MH2A 3U1DA 4FX4A 1HSTA 1U6GA 3CDHA 3HYIA 4RAZA 3QU6A 3ZN0A 1R00A 5E1WA 2OQGA 4CGZA 3QP5A 1HW5A 4PDKA 2EV5A 3GWZA 1V4RA 5J6XA 4IRIA 3TO9A 1XMAA 3K2ZA 2XRNA 5F1RA 2F2EA 4M73A 4ZZDA 2OZ6A 5J8CA 3I71A 2DQLA 2BV6A 4N9HA 2PI0A 1BI1A 1P2FA 1ZYRF 1W7PB 2FF4A 3D5LA 4I09A 2PBIA 5FD5A 1T98A 3DPLC 2JSCA 3QRFF 1LVAA 2Q2EA 2HR3A 3F8NA 4TV7A 1PP8F 1YO5C 4QWQA 1IUYA 2O6GE 4I0AA 2ISYA 4HQEA 1F1ZA 3ABUA 5D6EA 5L3GA 3IRQA 2DU9A 3K1NA 3KETA 2E7XA 1R1TA 3QPTA 4HDUA 1XN7A 3I59B 3IL2A 3ZQ7A 4UV9A 4EM2A 5D5VB 3RTRA 1YW8A 2OA4A 3WE3A 1J9IA 4HDVA 4O5VA 4A5MA 2VODA 3F3XA 2P6TA 2HQNA 1O3QA 1U2WA 2X4HA 3I53A 2PJPA 2Z9OA 1S7AA 3DF8A 3FZVA 2KKOA 1J75A 4GXOA 4GYIA 4KNYA 1KU2A 2V6CA 3K9TA 4S05A 3DV8A 4I02A 1D3YA 4U7BA 1U78A 3TDUC 3BJAA 1W7PD 1LEAA 1LDDA 4CICA 5D8LB 2DPUA 3KZZA 4S04A 2A68F 2RQPA 4L9VA 3I54A 2DT5A 4MGRA 1XD7A 2EV0A 2K4BA 4EM1A 1SD4A 5JFRA 4JK1X 4G7ZF 5CVIA 1G3YA 1UFMA 4EJOA 2FMYA 3K1MA 1L0OC 1P6RA 1T6SA 5DD8A 2HGCA 3WU1B 1X3UA 2PEXA 5D4RA 4IRHA 4MTDA 3IHUA 1EH8A 4A0XA 2OAZA 3BOQA 3KP7A 4MEXF 2G7HA 4BH9A 2R3SA 2VBWA 1FOKA 4O6JA 4KIGA 4L5IA 3KP4A 2K27A 4Q47A 2L54A 1IRFA 2AS5F 4LGWA 2K4JA 4LK1F 5CJ9A 1LNWA 1ONVA 2XAGA 4YFNF 1WQ2A 2MA3A 3R60A 2VONA 1MDMA 5ICCA 4EVIA 1PUEE 3KE2A 1Z6TA 2LNBA 4UXNA 1ZH5A 3LQRA 2HTJA 2EFNA 3BPXA 1G4DA 4EQQA 2H6BA 1OYYA 3RYRA 2CGPA 4RB1A 2P5KA 2A3SA 4BNCA 3D0SA 4KICA 2FOKA 1CGPA 2L4AA 1JHHA 4MQVA 3KP2A 3V7SA 5ICEA 4EJVA 3J7AO 3LWFA 4GCVA 1SFEA 5DCFA 2K02A 3R4KA 1FC3A 2Y0MA 2ADUA 1REPC 4XRFA 2G7UA 2FRHA 3SFZA 2GIVA 3EUHA 1FBQA 2LSOA 4KIBA 3REOA 1XMKA 2EFPA 1MJAA 4WX9A 1IN6A 1I1GA 1ODDA 3TGNA 3MFKA 1FP2A 1PDNC 1ZRDA 3RDIA 3FX3A 1J2XA 4OINF 5DYMA 1MZBA 3M8EA 2A61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFW X;  1YS6 A;  3U2R A;  5LHG A;  1R22 A;  4AVP A;  2R7F A;  3WTY C;  4PGG A;  1T2K A;  1GXQ A;  4ZZL A;  1YLF A;  1EV7 A;  2LDU A;  3R0J A;  1J0R A;  4EM0 B;  2UWM A;  3ZMU A;  1C0W A;  3Q9S A;  2Q0O A;  2Y48 A;  2UXX A;  1K78 B;  5DEQ A;  3WGI A;  2HTS A;  1D5V A;  2DK8 A;  1XB4 A;  1GXP A;  3J80 Z;  2HYG D;  2OU2 A;  3L7W A;  3GZ6 A;  1FYL A;  1U5T C;  3P7N A;  3WTV C;  5KK1 A;  4WXH A;  1QPM A;  1QNT A;  5EEG A;  3C7J A;  4QLC U;  4JBA A;  1SD7 A;  4G6Q A;  2STW A;  3I5U A;  3E6B A;  2E1N A;  2DAO A;  2QQB A;  3T8R A;  4A2U A;  5L3B A;  2EV6 A;  1YW7 A;  4LLG F;  3RIR A;  4LD5 A;  2M30 A;  3M9A A;  2FEZ A;  3DPT A;  4CZZ A;  5BS6 A;  2P8T A;  4LB5 A;  4XLP F;  1JHF A;  4KN4 X;  4WF2 A;  1KQ8 A;  1DPR A;  4ZYH A;  1Z6R A;  2ZNY A;  3ZN1 A;  4ESB A;  2ACJ A;  2C6Y A;  4HX7 A;  2YU3 A;  1UCR A;  4LG0 B;  1B9N A;  2RGV A;  3O6B B;  2HKX A;  3KLN A;  2ZME B;  5HVQ C;  5D5W B;  2DTR A;  3I64 A;  4MTE A;  4YIF A;  2IT0 A;  4Q5S F;  2ZO4 A;  1BIA A;  2RDP A;  5D4S A;  3OOP A;  1ULY A;  2E1C A;  4I2O A;  3CUO A;  4KIF A;  3WTZ A;  1BN5 A;  3GZ5 A;  1ZGA A;  2X0L A;  2QUF A;  1O7F A;  3LA2 A;  2EFO A;  3FMQ A;  3FXQ A;  2ZXJ A;  2WTE A;  4A0Y A;  2VOO A;  4KDP A;  4XLN F;  3HOT A;  2FBI A;  2NNY A;  2XAF A;  2HOE A;  2F5C A;  5A2Q Z;  3RPQ A;  5LRS A;  1DUX C;  2D45 A;  1OYI A;  5ILS A;  1P4W A;  1FX7 A;  4E70 A;  2VC1 A;  2CQK A;  2XRO A;  1Z9C A;  5K1Y A;  1B6A A;  1GVJ A;  4U7D A;  3DEU A;  1IZ1 A;  2EB7 A;  4IJA A;  5JR3 A;  5ICF A;  4MEY F;  2PFB A;  3GYH X;  4FHT A;  2BBY A;  2OD5 A;  3ZMT A;  1V3F A;  1QZZ A;  4ENN A;  3ZMS A;  4AWX B;  2V1X A;  2CFX A;  4LJZ F;  2ESN A;  4IXA A;  3C18 A;  5D6F A;  3V8J A;  1XSV A;  5L3E A;  4RGR A;  1UHW A;  1XCV A;  4JQF A;  5K5R A;  1TNS A;  3R61 A;  3SXY A;  2FBH A;  3H3U A;  5ERI A;  4XSX F;  4H0E A;  5E8I A;  4B09 A;  3HRM A;  2VBX A;  2LF7 A;  2VC0 A;  3EYI A;  1IXS B;  1USS A;  1TW3 A;  1WI9 A;  5F6F A;  4G7H F;  3ECO A;  1JE8 A;  4U0Y A;  3O3K A;  1STZ A;  2BE5 F;  4L9J A;  3RPU A;  3RKX A;  1HKQ A;  2W85 A;  5FD6 A;  3HOS A;  1IW7 F;  1KU3 A;  1KU9 A;  3IC7 A;  1P4A A;  4FT8 A;  4L0Z B;  1FPQ A;  3B02 A;  4PCQ A;  2GA2 A;  4IF4 A;  3NRV A;  1U8R A;  3CJN A;  1KQ0 A;  3E5U A;  1BI0 A;  2RN7 A;  4RGX A;  4A6E A;  4EJW A;  3GEZ A;  2FNA A;  2RV8 A;  2KIF A;  4U0W A;  4YFX F;  5LEJ A;  1RNL A;  3ZMZ A;  4IHT A;  2W25 A;  1T38 A;  3SHF A;  2XKO A;  3BJO A;  3LA3 A;  1RUN A;  3SQN A;  2GWR A;  2QVO A;  5D5U B;  1DPU A;  2PMH A;  3GXO A;  3CLO A;  2PLY A;  3V7R A;  2VBZ A;  3H3Z A;  4UHT A;  1IN5 A;  3HSF A;  3GF2 A;  3ABT A;  5E18 F;  3O2P E;  2J5P A;  1G3S A;  2CW0 F;  2ELH A;  1IF1 A;  4O3M A;  3WTT C;  3MCZ A;  3HSR A;  3ROU A;  4M9S A;  3DXJ F;  2GQQ A;  1ZLJ A;  1VTN C;  1YS7 A;  3CO7 C;  1FYK A;  2FXA A;  5ICG A;  3LFK A;  2EJR A;  1WSU A;  4Y15 A;  4ENM A;  2HFH A;  3E5X A;  3F8M A;  3BY6 A;  4LFU A;  1LDK B;  3WTU C;  4N0B A;  4Y17 A;  1R36 A;  2P5V A;  2DQR A;  1JGS A;  4NQW A;  3I58 A;  1RUO A;  2DK5 A;  4G8X A;  1MD0 A;  4AD9 A;  2VN2 A;  2YPR A;  3GLX A;  3FF5 A;  2V1D A;  1R1U A;  1HW2 A;  3F22 A;  2V79 A;  1FBS A;  3KEO A;  2XAQ A;  3BZ6 A;  1D8J A;  3ZMV A;  4KYW A;  2CYY A;  3FXR A;  3KP5 A;  1IXR C;  2DPD A;  1TLH B;  2KJC A;  1FP1 D;  1A04 A;  1S7O A;  1UST A;  2FBK A;  2KRF A;  1K6O A;  1MJB A;  3G73 A;  1RI7 A;  1W4M A;  2DLL A;  4BHB A;  2VXZ A;  2FNP A;  2MLK A;  2M8E A;  1DP7 P;  2ZME A;  3N97 A;  1SFU A;  3F6V A;  5LBQ A;  4KT5 C;  2COM A;  4ZH4 F;  4EV0 A;  2ZBK A;  4I01 A;  3HUG A;  1ZAO A;  3DQV C;  1U5T B;  1YTY A;  3V8K A;  3P9C A;  4AIK A;  1LQ1 A;  5LHH A;  2VT2 A;  2P5L C;  5HDK A;  2GAU A;  5DV5 A;  1W5S A;  2DFI A;  2ZNZ A;  4XBF A;  4LB6 B;  3RKY A;  2M45 A;  1XGO A;  4RB3 C;  4P96 A;  3HSE A;  3E5Q A;  1UB9 A;  5DCM B;  5FGM A;  1H9T A;  1OYW A;  4RB2 C;  1OPC A;  3MZY A;  5LGU A;  2FU4 A;  3U9G A;  3F8C A;  2VE9 A;  2QBY A;  2F5F A;  2A6H F;  2O3F A;  3F6O A;  2VE8 A;  2L01 A;  3LAP A;  4HF0 A;  4ENK A;  1ZRE A;  2W84 A;  4Q4Z F;  5HLG A;  5L3D A;  2V1U A;  1HQC A;  2NNN A;  2K86 A;  2D1V A;  3GFJ A;  1BI2 A;  3CO6 C;  1EH7 A;  3MZH A;  1R7J A;  4M9Z A;  5BOX A;  1BIB A;  1Z91 A;  4ASN A;  3TDZ C;  1YFH A;  1Z1D A;  3N4M A;  3QAH A;  1FT9 A;  5FO5 A;  4G7O F;  3K69 A;  1ZG5 A;  1B59 A;  4OMY A;  3LQQ A;  3F72 A;  3M8F A;  1QQI A;  1IXC A;  3T8T A;  4HV5 A;  2OQR A;  3QU3 A;  1OR7 A;  1CF7 A;  1P4X A;  2XKP A;  3OV8 A;  1UHM A;  2A6E F;  4G9Y A;  2GXB A;  3IKV A;  4LLL A;  2L3D A;  3K1P A;  1XDU A;  2L02 A;  2XV4 S;  1S6L A;  1Z05 A;  2HQR A;  3RKW A;  3WTS C;  2ZFW A;  3EQL F;  3T5X A;  1IAW A;  2LF8 A;  2ZKZ A;  4I7H A;  1ON2 A;  2H27 A;  3L09 A;  3BPV A;  4R79 A;  2XVC A;  1EH6 A;  3H92 A;  4R1H A;  3F21 A;  5LGN A;  5ILV A;  5DUK A;  5FB2 A;  3F8F A;  5F64 A;  3EDP A;  5HS7 A;  3GW2 A;  2NYX A;  3L9F A;  2B0L A;  1Y0U A;  1LEB A;  1B1B A;  1Q1H A;  2JRT A;  5LRR A;  4WXC A;  2G9W A;  2L4M A;  4WXD A;  3ULQ B;  3F23 A;  3KEQ A;  1KQ9 A;  4ON0 A;  3BRO A;  2P7C B;  1TW2 A;  1R5H A;  3W6K B;  2RC4 A;  2XHK A;  4CDG A;  4RGU A;  5JI6 A;  2A5Y B;  3Q9V A;  2JT1 A;  2WV0 A;  3CUQ C;  2O0Y A;  2R7D A;  5BPI A;  3HTU A;  4HLX A;  1J5Y A;  3IRR A;  4MQ9 F;  1W7P A;  4UVB A;  2Z3Y A;  1HW1 A;  3COA C;  2UZK A;  3HHG A;  3MQ0 A;  3P9I A;  1QZY A;  1XGS A;  4GGG A;  1GHC A;  4YG2 F;  4Q48 A;  1KU7 A;  1L3L A;  1F5T A;  2NRA C;  3I59 A;  2WC2 A;  3SZP A;  2HZT A;  4WCG A;  2ESH A;  1TQM A;  2NS0 A;  1BBY A;  1YYV A;  3KCC A;  3MEX A;  4OIR F;  1S29 A;  2YX4 A;  4ZYE A;  2XAJ A;  3M1E A;  2PQ8 A;  5H20 A;  2Z5U A;  5HS8 A;  1IRG A;  2M5W A;  5EEH A;  2FQ3 A;  4BQA A;  2IW5 A;  2JZY A;  1KA8 A;  2CSO A;  5TJJ A;  2KJB A;  1MJ9 A;  1MDM B;  1MGT A;  3IKT A;  5CVV A;  1XDS A;  2M1B A;  5JHU A;  2E7W A;  2VOP A;  4ENJ A;  1BM9 A;  5LGT A;  3SZT A;  4L5J A;  2STT A;  3P9K A;  5H6Q A;  4EJU A;  3QPH A;  5LHI A;  2MBF A;  2Y75 A;  2TDX A;  3E97 A;  2HKO A;  3ECH A;  3QOP A;  4D0P A;  1H9G A;  5JVT A;  3TQN A;  3TKY A;  2WWY A;  4P5O A;  2IPQ X;  4B8X A;  2QZ8 A;  4U0V A;  1ZN2 A;  3K0L A;  1TTY A;  2W57 A;  3JW4 A;  2MC3 A;  1WWX A;  5FFZ A;  3NQO A;  1DDN A;  4L9N A;  1U3E M;  4UNO A;  2FSW A;  5E8G A;  2ISZ A;  2JPC A;  4YFK F;  1BC8 C;  4HF1 A;  4WWC A;  1MKM A;  4OIP F;  2M87 A;  2DO7 A;  4A5N A;  5DD4 A;  4MHG A;  5HLI A;  2GXG A;  1HKS A;  1JXS A;  4OU0 A;  2OBP A;  3TOA A;  3KZY A;  3LA7 A;  3ZP5 A;  2QYO A;  3VFZ A;  3CTA A;  4LMY A;  3WTW C;  5E20 A;  4UUV A;  1O3R A;  1KYZ A;  1R58 A;  2O61 A;  2EFW A;  1T39 A;  4ETS A;  2D2W A;  2CO5 A;  1XGN A;  2RKH A;  4M6X A;  1E2X A;  3VB2 A;  2QLZ A;  3RI4 A;  4KMF A;  1H0M A;  3WGH A;  2QM3 A;  1TQI A;  1FY7 A;  2IJL A;  2YR2 A;  5AON A;  4HLY A;  4EMS A;  3VOD A;  4L18 B;  1F9N A;  3FM5 A;  4RS8 A;  3JTG A;  2ZCW A;  1J59 A;  6PAX A;  2QWW A;  1HSJ A;  4IHS A;  4BHC A;  3HIF A;  3ZPL A;  1HKT A;  3GVA A;  1G6N A;  4NHJ A;  1BI3 A;  5E17 F;  2XIG A;  4HV6 A;  3IWF A;  1K78 A;  1O57 A;  2H09 A;  3EET A;  4OIO F;  3C1D A;  2DW4 A;  4I98 B;  3JSP A;  2A69 F;  2DI3 A;  3F8B A;  5AIQ A;  1S8N A;  1R5G A;  2HEO A;  4RB0 A;  1I27 A;  5E1Z B;  2P7V B;  5ILU A;  4P55 A;  4UV8 A;  5K5O A;  3I0T A;  1FYM A;  2HDC A;  1O3S A;  1B9M A;  1HXD A;  3GO5 A;  5FFX A;  2PN6 A;  5FLX K;  4HX8 A;  3FM3 A;  4HOB A;  3FWE A;  3L2C A;  3V7C A;  3MWM A;  1FLI A;  5AIP A;  3IWZ A;  5BPD A;  1B4A A;  5CLS A;  3RJP A;  1RIO H;  5FLX Z;  3LAJ A;  1HBX G;  5CVU A;  3HRS A;  2XAH A;  4U88 A;  4M9X A;  3FXU A;  4PZJ A;  1SFX A;  2EA4 A;  2EFQ A;  3C3W A;  2CG4 A;  1FWZ A;  4F7Z A;  1I1S A;  4LG0 A;  1KYW A;  4M74 A;  2RNJ A;  4N9I A;  4Z2Y A;  2JTV A;  3HTS B;  3BDD A;  2F5D A;  2MD5 A;  4A12 A;  1I6X A;  1IN4 A;  2HWV A;  1R1V A;  4WK8 F;  4HW0 A;  1BC7 C;  3HRT A;  2ZJ2 A;  1ZLK A;  4DQ2 A;  3Q5F A;  4G6D A;  1IN7 A;  4BHP A;  4CHU A;  1P92 A;  2MH9 A;  4M71 A;  2W24 A;  3WE2 A;  1S3J A;  3NEU A;  5CVR A;  1FSH A;  3J81 K;  4GO1 A;  2EA2 A;  5J8F A;  4Y13 A;  4P9U A;  3CUQ B;  2YX7 A;  4MNU A;  3S2W A;  2FML A;  1WRJ A;  5BMZ A;  3VEP A;  4UVA A;  4HA8 A;  3JSO A;  5CVJ A;  3DFG A;  1WKM A;  3JAM K;  2IVM A;  3J81 Z;  4L9T A;  1FSE A;  4HX4 A;  3GX4 X;  4K2E A;  3R6S A;  1OMI A;  1T0F A;  4AIJ A;  3JAM Z;  4AIH A;  2YSR A;  1TNT A;  1RZ4 A;  4PGH A;  5HDN A;  2QEN A;  4YII A;  4HF2 A;  2PMU A;  1BOA A;  4HAM A;  1YQA A;  5HS9 A;  1K79 A;  2O03 A;  1AWC A;  1G3W A;  4P9F A;  3T0Y A;  1K7A A;  3GFL A;  3KP3 A;  4CO8 A;  5DDG A;  2DBB A;  2PG4 A;  1ZRC A;  3GFM A;  3DKW A;  5HDG A;  1TBX A;  1ZGJ A;  4A0Z A;  4NB5 A;  4RAY A;  2KIU A;  4KA4 A;  3LST A;  3PFI A;  4ZYG A;  1J7K A;  1FBU A;  3ISP A;  5CYV A;  1SD6 A;  3FMR A;  3PQK A;  2EK5 A;  1KGS A;  3WTX C;  5LLQ A;  3B73 A;  3BJ6 A;  3T1B A;  4BAY A;  4HBL A;  3BWG A;  4ESF A;  3J80 K;  4ZYD A;  5TRD A;  4M72 A;  2J5O A;  5E1X A;  2D1H A;  4EGZ A;  4A6D A;  2IP2 A;  4LK0 F;  1ZHF A;  3WOD F;  1R23 A;  1OKR A;  2QQ9 A;  3ZMD A;  1LB2 A;  4G94 A;  5IT3 A;  4ESJ A;  3HRU A;  5L3C A;  5D8K B;  4IRG A;  2GZW A;  2EWN A;  3E6M A;  2VT3 A;  1SMT A;  3FMS A;  1ZG1 A;  4L0Y B;  3GFI A;  2GA1 A;  1TQP A;  5DUI A;  2IA2 A;  2HS5 A;  4GYG A;  2O8X A;  2FA5 A;  1AOY A;  3HHH A;  4HQM A;  4M6Y A;  1W5T A;  3PQJ A;  2P6S A;  2K7L A;  4BYY A;  2KIM A;  3MAJ A;  4OMZ A;  1FZP B;  2UXN A;  4IVN A;  4CYD A;  4EGY A;  2V9V A;  3BP8 A;  2H94 A;  2XUB A;  1D8K A;  4KUM A;  1YW9 A;  1IN8 A;  2Q8K A;  2LKP A;  3G3Z A;  1SAX A;  3ELK A;  2P4W A;  1LJ9 A;  2A07 F;  2IA1 A;  5KVR A;  1E17 A;  5D5X B;  4OIQ F;  2ETH A;  2H6C A;  5A2Q K;  4HYE A;  3WG9 A;  1ON1 A;  4LLN A;  1NHA A;  2QQA A;  3AAF A;  4EJT A;  3TOB A;  3L00 A;  3JTH A;  3V4G A;  1O3T A;  4DNC A;  1F4K A;  1PP7 U;  3WGG A;  4UVC A;  2QBY B;  1XGM A;  4XSZ F;  2BYV E;  1YG2 A;  3E6C C;  3KLO A;  4CXF A;  2MLG A;  1LDJ A;  2IRF G;  2HYF A;  1FNN A;  2JPB A;  1O7L A;  1QO0 D;  4I0B A;  5ED4 A;  2VBY A;  3R0A A;  4KMU X;  4OOI A;  5BQT A;  4KN7 X;  2Z33 A;  5IT9 K;  5H6R A;  3EYY A;  2BGC A;  3RYP A;  4R8H A;  3I4P A;  1ZRF A;  1U5T A;  3E3V A;  2Z99 A;  2RVC A;  1QGP A;  5HOO A;  3ML6 A;  1I5Z A;  5IT9 Z;  3VOE A;  1CF7 B;  4IPA A;  1QBJ A;  4KFC A;  3TO7 A;  1XSD A;  5K5Q A;  1SD5 A;  4FX0 A;  4RGS A;  2XAS A;  3KP6 A;  5L3F A;  2AXL A;  3FHZ A;  3ERE D;  3W6J B;  2IA0 A;  4HZF A;  2BEO A;  5DCM A;  5LEK A;  3QP6 A;  1YIO A;  5HLH A;  4BXU A;  3DP7 A;  3CUQ A;  2CWE A;  3V8L A;  1BJA A;  1XCB A;  3M7G A;  1ZG3 A;  1XSX A;  2FE3 A;  2OZU A;  3E6D A;  2NAZ A;  3GUD A;  3TO6 A;  1ZAR A;  2F5E A;  2XGX A;  1Z7U A;  1G3T A;  3WU0 A;  1SMY F;  2MH2 A;  3U1D A;  4FX4 A;  1HST A;  1U6G A;  3CDH A;  3HYI A;  4RAZ A;  3QU6 A;  3ZN0 A;  1R00 A;  5E1W A;  2OQG A;  4CGZ A;  3QP5 A;  1HW5 A;  4PDK A;  2EV5 A;  3GWZ A;  1V4R A;  5J6X A;  4IRI A;  3TO9 A;  1XMA A;  3K2Z A;  2XRN A;  5F1R A;  2F2E A;  4M73 A;  4ZZD A;  2OZ6 A;  5J8C A;  3I71 A;  2DQL A;  2BV6 A;  4N9H A;  2PI0 A;  1BI1 A;  1P2F A;  1ZYR F;  1W7P B;  2FF4 A;  3D5L A;  4I09 A;  2PBI A;  5FD5 A;  1T98 A;  3DPL C;  2JSC A;  3QRF F;  1LVA A;  2Q2E A;  2HR3 A;  3F8N A;  4TV7 A;  1PP8 F;  1YO5 C;  4QWQ A;  1IUY A;  2O6G E;  4I0A A;  2ISY A;  4HQE A;  1F1Z A;  3ABU A;  5D6E A;  5L3G A;  3IRQ A;  2DU9 A;  3K1N A;  3KET A;  2E7X A;  1R1T A;  3QPT A;  4HDU A;  1XN7 A;  3I59 B;  3IL2 A;  3ZQ7 A;  4UV9 A;  4EM2 A;  5D5V B;  3RTR A;  1YW8 A;  2OA4 A;  3WE3 A;  1J9I A;  4HDV A;  4O5V A;  4A5M A;  2VOD A;  3F3X A;  2P6T A;  2HQN A;  1O3Q A;  1U2W A;  2X4H A;  3I53 A;  2PJP A;  2Z9O A;  1S7A A;  3DF8 A;  3FZV A;  2KKO A;  1J75 A;  4GXO A;  4GYI A;  4KNY A;  1KU2 A;  2V6C A;  3K9T A;  4S05 A;  3DV8 A;  4I02 A;  1D3Y A;  4U7B A;  1U78 A;  3TDU C;  3BJA A;  1W7P D;  1LEA A;  1LDD A;  4CIC A;  5D8L B;  2DPU A;  3KZZ A;  4S04 A;  2A68 F;  2RQP A;  4L9V A;  3I54 A;  2DT5 A;  4MGR A;  1XD7 A;  2EV0 A;  2K4B A;  4EM1 A;  1SD4 A;  5JFR A;  4JK1 X;  4G7Z F;  5CVI A;  1G3Y A;  1UFM A;  4EJO A;  2FMY A;  3K1M A;  1L0O C;  1P6R A;  1T6S A;  5DD8 A;  2HGC A;  3WU1 B;  1X3U A;  2PEX A;  5D4R A;  4IRH A;  4MTD A;  3IHU A;  1EH8 A;  4A0X A;  2OAZ A;  3BOQ A;  3KP7 A;  4MEX F;  2G7H A;  4BH9 A;  2R3S A;  2VBW A;  1FOK A;  4O6J A;  4KIG A;  4L5I A;  3KP4 A;  2K27 A;  4Q47 A;  2L54 A;  1IRF A;  2AS5 F;  4LGW A;  2K4J A;  4LK1 F;  5CJ9 A;  1LNW A;  1ONV A;  2XAG A;  4YFN F;  1WQ2 A;  2MA3 A;  3R60 A;  2VON A;  1MDM A;  5ICC A;  4EVI A;  1PUE E;  3KE2 A;  1Z6T A;  2LNB A;  4UXN A;  1ZH5 A;  3LQR A;  2HTJ A;  2EFN A;  3BPX A;  1G4D A;  4EQQ A;  2H6B A;  1OYY A;  3RYR A;  2CGP A;  4RB1 A;  2P5K A;  2A3S A;  4BNC A;  3D0S A;  4KIC A;  2FOK A;  1CGP A;  2L4A A;  1JHH A;  4MQV A;  3KP2 A;  3V7S A;  5ICE A;  4EJV A;  3J7A O;  3LWF A;  4GCV A;  1SFE A;  5DCF A;  2K02 A;  3R4K A;  1FC3 A;  2Y0M A;  2ADU A;  1REP C;  4XRF A;  2G7U A;  2FRH A;  3SFZ A;  2GIV A;  3EUH A;  1FBQ A;  2LSO A;  4KIB A;  3REO A;  1XMK A;  2EFP A;  1MJA A;  4WX9 A;  1IN6 A;  1I1G A;  1ODD A;  3TGN A;  3MFK A;  1FP2 A;  1PDN C;  1ZRD A;  3RDI A;  3FX3 A;  1J2X A;  4OIN F;  5DYM A;  1MZB A;  3M8E A;  2A61 A; 
#chains in the Genus database with same CATH topology
 3KFW X;  4CCO A;  1YS6 A;  3U2R A;  5LHG A;  1R22 A;  4AVP A;  2R7F A;  3WTY C;  3OS1 A;  4PGG A;  2DXI A;  5GAH J;  1SAU A;  1T2K A;  1DP3 A;  1GXQ A;  4ZZL A;  4EAT A;  1YLF A;  2N8G A;  1EV7 A;  2LDU A;  2WBM A;  3R0J A;  2HOT A;  1J0R A;  4EM0 B;  3K70 C;  1B72 B;  3HEF A;  3OR1 C;  3OS2 A;  1R9T J;  2UWM A;  2M2E A;  3S8P A;  1FJL A;  1NG6 A;  3QOE A;  4UUS B;  3ZMU A;  1C0W A;  2HOA A;  1OLT A;  4XOT A;  3Q9S A;  3FDY A;  2Q0O A;  2Y48 A;  5K7H A;  2MG4 A;  2VLA A;  2DJN A;  2R4G A;  2UXX A;  3K7A J;  3M4O J;  1K78 B;  5DEQ A;  4F93 B;  1IG7 A;  3WGI A;  2GOM A;  2HTS A;  1D5V A;  2EIM H;  2DK8 A;  1Z3X A;  3ZQG A;  3ASN H;  1XB4 A;  1HCR A;  1GXP A;  3J80 Z;  2HYG D;  2OU2 A;  4XIC A;  2I8D A;  2LYC A;  1ETX A;  3E0J B;  3L7W A;  3GZ6 A;  1FYL A;  1U5T C;  2X1E A;  3P7N A;  4NUB A;  3WTV C;  1TC3 C;  5KK1 A;  1VQL I;  4WXH A;  3ZQF A;  2B7E A;  1QPM A;  2BOL A;  1QNT A;  5EEG A;  3C7J A;  4NQW B;  3PO2 J;  2VPR A;  4QLC U;  5F08 A;  4JBA A;  3CCS I;  1RPW A;  3LSI A;  1SD7 A;  3CC2 I;  3KYL A;  4G6Q A;  2STW A;  3I5U A;  4DYQ A;  3E6B A;  3DBR B;  1X3Z B;  2E1N A;  2DAO A;  5EGO A;  2QQB A;  4LIT A;  3T8R A;  4A2U A;  5FLV A;  5L3B A;  2EV6 A;  1D0Z A;  4ZC3 A;  1MND A;  1WH7 A;  1VQM I;  1YW7 A;  4JOM A;  4LLG F;  4OAZ A;  3RIR A;  4LD5 A;  2M30 A;  3M9A A;  1YJN I;  3H0D A;  2FEZ A;  3DPT A;  2JA2 A;  4CZZ A;  3AG3 H;  3S15 J;  2KMU A;  5BS6 A;  2P8T A;  5KHD A;  4LB5 A;  4XLP F;  1JHF A;  4AID A;  4KN4 X;  2EIK H;  4WF2 A;  3HKZ A;  1KQ8 A;  4FTH A;  2VKV A;  1DPR A;  4ZYH A;  1Z6R A;  2ZNY A;  5FKN A;  3ZN1 A;  4ESB A;  2WAF A;  4JP0 A;  2ACJ A;  4B3A A;  2HVQ A;  2C6Y A;  3AG1 H;  4HX7 A;  1X1C A;  2YU3 A;  1UCR A;  4PJ0 C;  1LE8 B;  4LG0 B;  1B9N A;  2B63 J;  3LSR A;  2RGV A;  3ERM A;  4DGW B;  3O6B B;  2HKX A;  3KLN A;  2ZME B;  3CP8 A;  5IOZ A;  1H89 C;  5HVQ C;  1EA3 A;  5CQE A;  5D5W B;  4D5F A;  1PUF A;  2DTR A;  3I64 A;  4MTE A;  2DMU A;  3A03 A;  4YIF A;  2IT0 A;  4Q5S F;  4A93 J;  2ZO4 A;  1BIA A;  2RDP A;  4XN3 A;  2XSD C;  5D4S A;  3OOP A;  1ULY A;  3OYM A;  2E1C A;  4I2O A;  3CUO A;  1ZR4 A;  2GLO A;  4D7N A;  4KIF A;  3ZCO A;  1OCT C;  4OWR B;  2OUM A;  2O7O A;  1BN5 A;  3WTZ A;  3GZ5 A;  1ZGA A;  2W1O A;  4CYC A;  2X0L A;  2BY2 A;  5J1Y A;  2M3A A;  2QUF A;  1O7F A;  3LA2 A;  3I56 I;  2EFO A;  2Z1D A;  3FMQ A;  2ZXJ A;  2WTE A;  3FXQ A;  2HZD A;  5C4X J;  4MIM A;  4A0Y A;  3FXL A;  2VOO A;  5M3F J;  4KDP A;  1FIA A;  4XLN F;  3HOT A;  2FBI A;  2NNY A;  3S2D J;  2XAF A;  2HOE A;  2F5C A;  3CMY A;  1V5E A;  5A2Q Z;  3RPQ A;  5LRS A;  1DUX C;  1MMS A;  3OS0 A;  3CF5 F;  2D45 A;  1OYI A;  4XR6 A;  5ILS A;  1P4W A;  2JN6 A;  1FX7 A;  4E70 A;  2VC1 A;  1Y1V J;  2CQK A;  2XRO A;  1Z9C A;  5K1Y A;  3PNY A;  1B6A A;  1GVJ A;  4D7M A;  4XLH A;  5J1R A;  1HLV A;  4U7D A;  1TP4 A;  5J4V A;  2FD5 A;  3DEU A;  2FOW A;  3K4K A;  3K4M A;  1IZ1 A;  5GPC A;  1ERD A;  2EB7 A;  3M8J A;  2AXT C;  3PNV A;  4IJA A;  2HVR A;  2K3P A;  5JR3 A;  5ICF A;  3DBL B;  4MEY F;  1QPI A;  2PFB A;  3GYH X;  4FHT A;  2BBY A;  2VQG A;  2OD5 A;  3ZMT A;  1V3F A;  1QZZ A;  3AL0 C;  4IO9 F;  4ENN A;  3ZMS A;  4AWX B;  2V1X A;  3GTL J;  4DBR A;  2HPI A;  2CFX A;  2NVT J;  2M0C A;  3HOU J;  4LJZ F;  2ESN A;  4IXA A;  2FX0 A;  3C18 A;  4FCY A;  5D6F A;  3DLL F;  3V8J A;  3L2V A;  3H9J A;  1XSV A;  2DT7 B;  5L3E A;  3WHC A;  4RGR A;  1QA6 A;  1UHW A;  1XCV A;  3SYT A;  1JUM A;  2WAD A;  3GTO J;  4JQF A;  5K5R A;  1TNS A;  3BR2 A;  3R61 A;  3SXY A;  2FBH A;  4C3H J;  1MMA A;  2DOF A;  3H3U A;  5ERI A;  2KHM A;  4FQG A;  4XLE A;  3VSK A;  3H5A A;  4XSX F;  4H0E A;  5E8I A;  4B09 A;  3HRM A;  2VBX A;  2LF7 A;  2VC0 A;  3EYI A;  4CCM A;  3BG5 A;  1IXS B;  2XB0 X;  3PNT A;  1USS A;  5J3L A;  2Y9Y A;  2K9N A;  1TW3 A;  2ZXI A;  1WI9 A;  1ETY A;  5F6F A;  2XAU A;  4G7H F;  3SFI A;  2IGK A;  3ECO A;  1JE8 A;  5B1A H;  4U0Y A;  3O3K A;  1STZ A;  2CW8 A;  2BE5 F;  4L9J A;  3I4N J;  2K85 A;  3RPU A;  4RLQ A;  3RKX A;  3DTI A;  2IGN A;  3HPG A;  3J7Y J;  3BLY A;  1HKQ A;  4EEF G;  5GTH C;  1GVD A;  2W85 A;  4M3E A;  4E7S A;  5FD6 A;  3HOS A;  2XF5 A;  1IW7 F;  2VPL A;  1KU3 A;  2Y0S N;  4C30 A;  1KU9 A;  4E7H A;  3IC7 A;  4BEH A;  3CCL I;  1P4A A;  4FT8 A;  3H1C A;  4L0Z B;  4CZC A;  2V6E A;  3DEW A;  1FPQ A;  3B02 A;  4PCQ A;  2GA2 A;  4IF4 A;  3NRV A;  1U8R A;  3CJN A;  5F0F A;  4PFO A;  2QEX I;  1VQ4 I;  2G0E A;  2XF7 A;  4J01 A;  1KQ0 A;  3E5U A;  3LSH A;  3K4L A;  2LH9 A;  1BI0 A;  2RN7 A;  4M3F A;  4RGX A;  4A6E A;  4EJW A;  3GEZ A;  3OYF A;  3RQI A;  2FNA A;  4C3I J;  1XC5 A;  2NVQ J;  2R5Y A;  2RV8 A;  2KIF A;  4U0W A;  4C2M J;  5HLT A;  1K4S A;  1X1D A;  3GLL A;  2ICW G;  5DTD A;  4YFX F;  4AVZ A;  5LEJ A;  3BCB A;  1RNL A;  2OC6 A;  3ZMZ A;  4IHT A;  2W25 A;  3TP0 A;  5DM6 F;  1T38 A;  4BKX A;  4QPQ A;  3SHF A;  1X3W B;  2XKO A;  3BJO A;  3LA3 A;  5HNF A;  1RUN A;  3OR2 C;  3SQN A;  2EIJ H;  4BAC A;  1MBF A;  4CA0 A;  2GWR A;  2QVO A;  3S3M A;  5D5U B;  1DPU A;  1S9H A;  2CUZ A;  2PMH A;  2WB1 A;  4RMN A;  4F55 A;  2LY1 A;  3GXO A;  3HOZ J;  4UUT A;  1MSE C;  3C2G A;  4M3G A;  1ACI A;  3CLO A;  2BHZ A;  2PLY A;  2JA6 J;  1SEU A;  1BW5 A;  4ZDL A;  1YI2 I;  3V7R A;  2VBZ A;  1W0U A;  3QOD A;  1DGW Y;  1HA8 A;  3H3Z A;  4UHT A;  4CCL A;  1IN5 A;  1I6H J;  3HSF A;  1VQN I;  3GF2 A;  3ABT A;  5E18 F;  3O2P E;  3A01 B;  2J5P A;  1G3S A;  4UB8 C;  2CW0 F;  1OJL A;  4FET A;  2RNG A;  2X6Y A;  1W1W E;  2ELH A;  3SZG A;  1IF1 A;  3DU5 A;  3MKW B;  4O3M A;  1SFO J;  3WTT C;  2KIQ A;  5LD2 C;  2HQA A;  3MCZ A;  2F4M B;  3HSR A;  4XLC A;  3B6C A;  3ROU A;  4M9S A;  2EZI A;  1KON A;  3DXJ F;  4G6T B;  2GQQ A;  1ZLJ A;  1VTN C;  1I39 A;  4XRS G;  1YS7 A;  2R7U A;  1D0Y A;  2NOJ B;  3GME A;  2RRE A;  3CO7 C;  4P1W A;  3GTJ J;  4UUS A;  2KL4 A;  1FYK A;  5C4J J;  2FXA A;  2A5W A;  5ICG A;  1JUS A;  2H1L A;  3LFK A;  1IV6 A;  2EJR A;  1WSU A;  4Y15 A;  4CUG A;  2ECC A;  3KPH A;  2X9D A;  4ENM A;  2BY1 A;  1WJ5 A;  2HFH A;  2HI3 A;  3E5X A;  3F8M A;  3EUH C;  3FXJ A;  4PK4 A;  2GXA A;  3BY6 A;  4LFU A;  1LDK B;  3WTU C;  3LSJ A;  4N0B A;  4Y17 A;  1R36 A;  2DA7 A;  2KT0 A;  4HNU A;  2XPU A;  2P5V A;  2ZSI B;  1S5L C;  5M5W J;  1IRZ A;  2DQR A;  1JGS A;  4NQW A;  4X1E A;  3MD2 A;  2IS1 A;  3I58 A;  3FXO A;  1RUO A;  2DK5 A;  4G8X A;  1MD0 A;  4AD9 A;  2VN2 A;  2YPR A;  3GLX A;  3S16 J;  4LG3 A;  3FF5 A;  4QPO A;  2V1D A;  1R1U A;  3GTG J;  1HW2 A;  1RR8 C;  3F22 A;  2V79 A;  1V55 H;  3IP4 B;  1FBS A;  3KEO A;  2XAQ A;  3BZ6 A;  3JRH A;  1D8J A;  1VZ0 A;  3ZMV A;  3CZ6 A;  4KYW A;  2CYY A;  4A3C J;  3BZC A;  4XKW A;  3G2B A;  1YIT I;  3FXR A;  2XPV A;  1T8I A;  3KP5 A;  1IXR C;  2QSF X;  4DJA A;  2ZJR F;  2DPD A;  1UJ8 A;  3CC7 I;  3ZQC A;  2KJC A;  1TLH B;  1FP1 D;  1A04 A;  1S7O A;  1JUP A;  1UST A;  2O5R A;  3WU2 C;  2FBK A;  4IX7 A;  3W2W A;  2KRF A;  1K6O A;  3HZJ A;  2LMD A;  1VQ7 I;  1MJB A;  3G73 A;  1QHG A;  2R93 J;  1RI7 A;  1W4M A;  2TCT A;  2DLL A;  1LE8 A;  4BHB A;  2VXZ A;  5IYB J;  3HOW J;  2FNP A;  3VWB A;  2MLK A;  2M8E A;  1DP7 P;  2ZME A;  4DZP A;  2XPW A;  3N97 A;  4C9Y A;  1SFU A;  4A3F J;  1BA5 A;  3CDI A;  3S93 A;  2CV1 A;  3F6V A;  3RZO J;  5LBQ A;  1Z67 A;  2E60 A;  4KT5 C;  1YX5 A;  2XGD A;  2COM A;  2V9K A;  4ZH4 F;  4MO7 A;  4EV0 A;  2ZBK A;  3QQA A;  4I01 A;  3HUG A;  4BE1 A;  1ZAO A;  3DQV C;  2WAQ N;  2R7W A;  1NH3 A;  4PJM A;  1U5T B;  1YTY A;  3SJM A;  3V8K A;  3P9C A;  4AIK A;  3BQZ A;  1W36 C;  5CQG A;  1LQ1 A;  4A3B J;  5LHH A;  4M3D A;  2VT2 A;  1DU6 A;  2P5L C;  1FOW A;  1SVM A;  4AM3 A;  2IGM A;  3B6A A;  1JTX A;  5HDK A;  2KDZ A;  2GAU A;  5DV5 A;  1B8I B;  1W5S A;  2DFI A;  4A3D J;  1RKW A;  2ZNZ A;  4CH7 A;  4XBF A;  4LB6 B;  3RKY A;  2KPM A;  2PJR B;  1WVR A;  2M45 A;  1XGO A;  4RB3 C;  1MNE A;  2ZJP F;  4P96 A;  3KIO A;  3HSE A;  3E5Q A;  3OYJ A;  1UB9 A;  4U87 A;  5DCM B;  1QZE A;  5FGM A;  1OYW A;  4RB2 C;  1OPC A;  1H9T A;  3MZY A;  3K4N A;  5LGU A;  3ZQI A;  2FU4 A;  3U9G A;  2MFZ A;  3F0C A;  3F8C A;  2VE9 A;  3RSN A;  2QBY A;  2F5F A;  2A6H F;  3F9K A;  2O3F A;  3F6O A;  4Y7N J;  2VE8 A;  4Y3O A;  2V4J C;  2L01 A;  4OAY A;  1MBJ A;  3LAP A;  4HF0 A;  4ENK A;  1ZRE A;  2W84 A;  4Q4Z F;  2HXO A;  5HLG A;  5L3D A;  4B3X A;  2V7F A;  2V1U A;  2VJ4 A;  4BL0 B;  1HQC A;  2NNN A;  2K86 A;  5FKL A;  2D1V A;  3GFJ A;  1BI2 A;  3AKZ A;  3K70 D;  3CO6 C;  5J4Y A;  4BXX J;  1EH7 A;  3MZH A;  3M07 A;  4JYK A;  3PUB A;  1R7J A;  2OJE D;  4M9Z A;  5BOX A;  4BY1 J;  1BIB A;  1Z91 A;  4ASN A;  3I55 I;  3TDZ C;  1YFH A;  2CUF A;  1Z1D A;  1HF0 A;  3N4M A;  2LRD A;  3QAH A;  1TWF J;  1FT9 A;  5FO5 A;  4G7O F;  2DA6 A;  3K69 A;  1ZG5 A;  1B59 A;  1U8B A;  2EQR A;  4OMY A;  2W4S A;  2LY2 A;  3LQQ A;  1OFC X;  2ID6 A;  3TBI A;  3F72 A;  3M8F A;  1QQI A;  1IXC A;  4YRV A;  3T8T A;  4HV5 A;  2UUZ A;  2OQR A;  3L2R A;  3QU3 A;  1OR7 A;  1CF7 A;  1P4X A;  2XKP A;  3OV8 A;  1UHM A;  2A6E F;  2OPT A;  4G9Y A;  2GXB A;  3IKV A;  1I3Q J;  4LLL A;  2L3D A;  1VQK I;  3K1P A;  2YUS A;  2CFO A;  1XDU A;  4B4C A;  2JA8 J;  3GTK J;  3CCR I;  3NAU A;  2L02 A;  2XV4 S;  3IH2 A;  3KYD B;  1S6L A;  2DTZ A;  1Z05 A;  2HQR A;  3RKW A;  3WTS C;  2ZFW A;  3EQL F;  3T5X A;  1IAW A;  2LF8 A;  3QWL A;  1YRN B;  4J00 A;  5IP7 J;  1RES A;  2ZKZ A;  4I7H A;  1ON2 A;  2E19 A;  3BTJ A;  3FK6 A;  3FXM A;  3L09 A;  3BPV A;  2H27 A;  4R79 A;  4NC7 A;  1WJA A;  2XVC A;  1EH6 A;  2L7Z A;  3H92 A;  4R1H A;  3F21 A;  1X1A A;  5LGN A;  4X0G A;  3OYC A;  3BG6 A;  2Q2E B;  5ILV A;  3Q3S A;  4XLA A;  1VQ9 I;  1N78 A;  5DUK A;  5FB2 A;  3F8F A;  5E3M A;  5F64 A;  2MAB A;  3EDP A;  4Y4R A;  5HS7 A;  1VQ5 I;  3GW2 A;  2NYX A;  3L9F A;  3MKZ A;  2B0L A;  1Y0U A;  1AA7 A;  1LEB A;  1B1B A;  1Q1H A;  1RRJ A;  2JRT A;  4IKF A;  3CJT B;  5LRR A;  2X6W A;  1WPK A;  4WXC A;  3IUO A;  2G9W A;  2L4M A;  4QTR A;  1IDY A;  1Y1W J;  1FMW A;  3BTL A;  3I9V 2;  2VKE A;  4WXD A;  2GBY A;  3ULQ B;  3F23 A;  3KEQ A;  2CRG A;  1X1B A;  3AL0 B;  3IAM 2;  1KQ9 A;  1OCC H;  1IDZ A;  2KZG A;  5EDN A;  4E7K A;  4ON0 A;  4PJN A;  1Z0X A;  4II2 A;  3CCQ I;  4ZDO A;  1SVL A;  3RKQ A;  3S1R J;  3BRO A;  1X4O A;  2P7C B;  1TW2 A;  3PM1 A;  3CCV I;  2VUM J;  4CCK A;  5B1B H;  3PL8 A;  3KYC B;  4N4N B;  2YU9 J;  5EG0 B;  1YE9 A;  1R5H A;  2O9L A;  1IV8 A;  3W6K B;  5M5Y J;  2RC4 A;  4L5E A;  2XHK A;  3JRC A;  4CDG A;  3GBG A;  4RGU A;  5JI6 A;  2PX9 A;  2A5Y B;  2VQH A;  5KAF C;  3Q9V A;  2JT1 A;  3S1Q J;  2WV0 A;  3CUQ C;  4MLO A;  1LFU P;  2O0Y A;  1A35 A;  2R7D A;  5BPI A;  3PSI A;  2DA2 A;  3HTU A;  4HLX A;  2L9V A;  1J5Y A;  3PJR A;  3CLQ A;  3IRR A;  1U0J A;  4MQ9 F;  1W7P A;  3PIP F;  2CQX A;  2V9P A;  4W97 A;  4Y33 A;  4UVB A;  5JVG F;  2Z3Y A;  1HW1 A;  2DDA A;  1AU7 A;  3HPH A;  3H9Q A;  4DW6 A;  3LNQ A;  2VL8 A;  5IYC J;  3COA C;  4BS9 A;  2UZK A;  3HHG A;  3MQ0 A;  3BG9 A;  3P9I A;  2TRT A;  1QZY A;  2KDO A;  1V54 H;  2BY3 A;  2H1K A;  1XGS A;  3EPZ A;  1E0E A;  4GGG A;  2BW3 B;  1GHC A;  4YG2 F;  2ZXH A;  4Q48 A;  5IOY A;  1N25 A;  4MFE A;  1DGR M;  2OCE A;  2ZSH B;  2ZFU A;  1A31 A;  3OYH A;  1KU7 A;  1L3L A;  1F5T A;  2CQ7 A;  2NRA C;  3I59 A;  2WC2 A;  3SZP A;  1Y56 A;  3DTK A;  3VYU B;  4CSW A;  2HZT A;  4WCG A;  1H88 C;  2ESH A;  2CV2 A;  2EPF A;  1TQM A;  2HXI A;  2JVG A;  4KIS A;  2NS0 A;  4QIW N;  1BBY A;  1YYV A;  3KCC A;  2F5V A;  1U9N A;  3OL4 A;  2R5Z A;  3MEX A;  4OIR F;  1S29 A;  1JKO C;  3JRI A;  5HNH A;  2YX4 A;  2KP6 A;  5EEA A;  4ZYE A;  5DM7 F;  2GIZ A;  2XAJ A;  3M1E A;  1OCR H;  2PQ8 A;  4IQ4 A;  5H20 A;  1LVK A;  4HG2 A;  2Z5U A;  2E5Z A;  5HS8 A;  1IRG A;  1BR4 A;  1ZK8 A;  3OIP A;  2M5W A;  5EEH A;  2FQ3 A;  3RQ4 A;  3RZD J;  2DJI A;  5EF6 A;  4BQA A;  2IW5 A;  2JZY A;  1KA8 A;  4F3Q A;  2CSO A;  4BJT A;  4XKC A;  2CUJ A;  5TJJ A;  3GTP J;  2AHQ A;  1TZL A;  5DS9 A;  2QSH X;  2KJB A;  1MJ9 A;  1OIS A;  1Y6I A;  2KFD A;  3TW6 A;  1MGT A;  1MDM B;  5E3N A;  3IKT A;  2E36 A;  3JRG A;  1RKT A;  5CVV A;  1XDS A;  3HKZ N;  2DCE A;  1VQ6 I;  1X4P A;  2M1B A;  3L1P A;  5JHU A;  2RAE A;  2E7W A;  3DKX A;  2VOP A;  2MYS A;  3G1L A;  4ENJ A;  4ZTF A;  1BM9 A;  2ZXW H;  5LGT A;  3SZT A;  5F1J A;  5HOD A;  4L5J A;  1K4T A;  3H9G A;  3V42 A;  2STT A;  2QSG X;  3P9K A;  2KZV A;  3Q0W A;  5H6Q A;  3G4S I;  1ITY A;  3H0G J;  1TWA J;  2LLK A;  4EJU A;  2PMZ A;  3QPH A;  5LHI A;  2HOS A;  3TED A;  2MBF A;  4E4H A;  2Y75 A;  2TDX A;  3E97 A;  2HKO A;  3ECH A;  3QOP A;  4BY7 J;  3HOY J;  4HRI A;  4W1U A;  2GM4 A;  1JKP C;  4D0P A;  1H9G A;  5JVT A;  3TQN A;  1ZTR A;  3TKY A;  2WWY A;  4P5O A;  1Z7L A;  3HOX J;  2IPQ X;  4B8X A;  4LIV A;  1JGG A;  2QZ8 A;  1BW6 A;  3NWT A;  4U0V A;  1ZN2 A;  3HM5 A;  3W2V A;  3K0L A;  1YJW I;  2QQ8 A;  1TTY A;  2ID3 A;  2W57 A;  4D1Q A;  2JSP A;  4HSR A;  3L2W A;  2JQ7 A;  3JW4 A;  2R0Q C;  4A3L J;  4XLF A;  1AKH A;  2MC3 A;  1HDD C;  1JI8 A;  2QGU A;  1WWX A;  2E1M C;  4UB6 C;  5FFZ A;  5CPR B;  3HGG A;  3SEZ A;  3NQO A;  1B8I A;  3AG2 H;  1DDN A;  4L9N A;  2LKX A;  3LSM A;  3MMY B;  3W3C A;  4AUX A;  1IJW C;  4A3J J;  1IGN A;  1U3E M;  1EJ9 A;  4UNO A;  2LY9 A;  2FSW A;  3O8H A;  3N05 A;  2LBF B;  4QSH A;  5E8G A;  3W6V A;  1LFP A;  1XX5 A;  2ISZ A;  1U9O A;  4XMY A;  2JPC A;  3HXL A;  4NNJ A;  2HPM A;  2KQR A;  2QF7 A;  4RM2 A;  1A6Q A;  4YFK F;  1BC8 C;  1AHD P;  4HF1 A;  4WWC A;  1MKM A;  1WHU A;  4RA2 A;  3GTM J;  4OIP F;  2M87 A;  2O8K A;  2DO7 A;  4A5N A;  5DD4 A;  4MHG A;  5HLI A;  2GXG A;  1HKS A;  4KIT B;  1JXS A;  4OU0 A;  2OBP A;  3GCM A;  4DYR A;  2KLO A;  1Z77 A;  3TOA A;  3KZY A;  3LA7 A;  1WJC A;  3ZP5 A;  1MBH A;  2FJ1 A;  1KZH A;  2QYO A;  3VFZ A;  3CTA A;  4H4K C;  4LMY A;  3WTW C;  1WZ2 A;  3CJR B;  3BZK A;  2A05 A;  5E20 A;  4UUV A;  3G6E I;  2Y31 A;  1O3R A;  4MFD A;  2X85 A;  3D5S C;  1VQP I;  1KYZ A;  1R58 A;  2O61 A;  2EFW A;  2HNH A;  1T39 A;  4ETS A;  2M4G A;  2D2W A;  3FKI J;  2E35 A;  2CO5 A;  2Z2S B;  1XGN A;  2RKH A;  3BTI A;  3HB9 A;  4DIQ A;  3IH4 A;  1UMQ A;  4M6X A;  1E2X A;  3PFY A;  3VB2 A;  2Y9Z A;  3VYS B;  2DA5 A;  2QLZ A;  3OMY A;  3RI4 A;  4KMF A;  3A0B C;  1H0M A;  2ECB A;  5EGO B;  3WGH A;  2QM3 A;  1TQI A;  1SFK A;  1FY7 A;  2X1C A;  2IJL A;  2XGE A;  4XN0 A;  1E3O C;  3A2K A;  2YR2 A;  5AON A;  5E3L A;  2HQ5 A;  5J47 A;  4HLY A;  4EMS A;  1GDT A;  2WA0 A;  3VOD A;  2W48 A;  4L18 B;  1BR1 A;  5GAG J;  2X1D A;  3FXK A;  2EZH A;  1F9N A;  2K3F A;  3FM5 A;  4RS8 A;  2L7M P;  3BG7 A;  3JTG A;  3OYA A;  2ZCW A;  1J59 A;  6PAX A;  2QWW A;  1X58 A;  1LKX A;  3OIO A;  5C44 J;  1EF4 A;  1HSJ A;  4IHS A;  2K40 A;  3HIF A;  4BHC A;  4V2G A;  3ZPL A;  1HKT A;  2BHY A;  2DFE A;  2JVH A;  2BY0 A;  3GVA A;  1G6N A;  2DFF A;  4NHJ A;  5FRM A;  2VB6 A;  3ONQ A;  1B72 A;  4F52 A;  4JX4 A;  4M6V A;  3J7Z I;  1BI3 A;  2NVU B;  1MSF C;  2LR8 A;  5E17 F;  2XIG A;  4HV6 A;  3IWF A;  4IOC F;  1K78 A;  1O57 A;  5F0H A;  2H09 A;  3EET A;  4OIO F;  3C1D A;  2DW4 A;  4I98 B;  3JSP A;  2R7X A;  2A69 F;  2DI3 A;  3OYI A;  1K61 A;  3SDG A;  4C3J J;  2L5Q A;  3MKL A;  3HG9 A;  3F8B A;  5AIQ A;  1YOV B;  3BG3 A;  1GV2 A;  1S8N A;  1R5G A;  2HEO A;  2Y30 A;  4RB0 A;  3CCE I;  1RET A;  3K4J A;  2K9Q A;  2H8W A;  4CYC B;  1OR7 C;  1FMV A;  2Z16 A;  5B3S H;  1I27 A;  2VJI A;  1A6I A;  2WB1 N;  1UEL B;  5E1Z B;  1Q1V A;  2P7V B;  5ILU A;  4P55 A;  4UV8 A;  1XPX A;  5K5O A;  3I0T A;  4XKV A;  1D1A A;  1FYM A;  2HDC A;  4PSX A;  1B9M A;  1O3S A;  5M5X J;  2JK3 A;  1HXD A;  3GO5 A;  3JR9 A;  2M34 A;  5FFX A;  2PN6 A;  4D9J A;  1W36 D;  5FLX K;  3CDL A;  4HX8 A;  3FM3 A;  1YHQ I;  4HOB A;  3FWE A;  2QKL B;  5GTI C;  3L2C A;  3V7C A;  2DOD A;  3OYD A;  1ORK A;  3OYG A;  2AQE A;  4C2U A;  3MWM A;  1FLI A;  3JCU C;  5AIP A;  3I3L A;  3IWZ A;  4NC6 A;  3BC8 A;  3MKY B;  3OIQ A;  5BPD A;  2LRE A;  1B4A A;  1TWC J;  1ZQ3 P;  5CLS A;  1Y39 A;  3RJP A;  2MGQ A;  1RIO H;  2R92 J;  4PJJ A;  3BR3 A;  5FLX Z;  1JKR C;  3LAJ A;  1MH3 A;  4N4O B;  5CVU A;  3HRS A;  1HBX G;  2XAH A;  3K2A A;  2LOO A;  4U88 A;  4M9X A;  3FXU A;  4PZJ A;  1SFX A;  2EA4 A;  1ZR2 A;  2Y2Z A;  4I76 A;  3FHN A;  2EFQ A;  3C3W A;  5LFA A;  1WI3 A;  2CG4 A;  3HL2 A;  2DN0 A;  1FWZ A;  4F7Z A;  1I1S A;  4LG0 A;  1KYW A;  4M74 A;  2RNJ A;  5GP9 A;  4N9I A;  1Y8Q B;  2JTV A;  5F04 A;  4Z2Y A;  3HTS B;  2ZB9 A;  3BDD A;  2F5D A;  2MD5 A;  3VSL A;  2P0W A;  4A12 A;  3W2A A;  3U1K A;  3BR0 A;  3C2B A;  1I6X A;  1Z3Y A;  4DBQ A;  3PO3 J;  1IN4 A;  5GPA A;  1TT0 A;  2HWV A;  1R4N B;  1R1V A;  1YX3 A;  4WK8 F;  4HW0 A;  2LK2 A;  1BC7 C;  5GAE J;  3A1Y A;  3OOU A;  1R6R A;  3OYB A;  5FJ8 J;  3HRT A;  2ZJ2 A;  3PUF A;  2BXY A;  4KJZ A;  3PIO F;  4DOZ A;  1ZLK A;  4II3 A;  4DQ2 A;  3Q5F A;  4IHX A;  2OTL I;  2X51 A;  4G6D A;  3CF2 A;  1IN7 A;  4BHP A;  1HDP A;  1MH4 A;  2M8G X;  4CHU A;  1N77 A;  1P92 A;  3ZGK A;  2MH9 A;  4M71 A;  2W24 A;  2XDV A;  3ASO H;  3WE2 A;  3OSF A;  1S3J A;  1UG2 A;  4IZZ A;  4XOP A;  3NEU A;  2CW7 A;  1WJD A;  3TMO A;  1MIJ A;  5CVR A;  3DKY A;  2L2O A;  1FSH A;  1WCM J;  4YEL A;  4RAG A;  3J81 K;  2H8R A;  4GO1 A;  2EA2 A;  5J8F A;  2VJ5 A;  2DMT A;  4Y13 A;  4P9U A;  3CUQ B;  2YX7 A;  4MNU A;  5M3M J;  2EBI A;  3S2W A;  2FML A;  2NOG A;  2VKD A;  1WRJ A;  4A3M J;  3G1O A;  5BMZ A;  1JJ8 C;  2WY7 Q;  4BEH B;  4IQJ A;  3VEP A;  3LMM A;  4UVA A;  4HA8 A;  4BBR J;  3JSO A;  3TP3 A;  3FKJ A;  5CVJ A;  3DFG A;  4B43 A;  1WKM A;  3GZN B;  3JAM K;  2IVM A;  1DU0 A;  3KZI C;  3J81 Z;  2ZJQ F;  4L9T A;  5K7Z A;  1FSE A;  4ITV A;  4HX4 A;  2BVM A;  3GX4 X;  1IC8 A;  3ESW B;  3K4C A;  4K2E A;  3R6S A;  2KRH A;  2VQC A;  1OMI A;  1MBE A;  5F27 A;  2CS3 A;  4PJL A;  5KCM A;  2NVX J;  2IS4 A;  3ZQL A;  1T0F A;  4AIJ A;  3DWL E;  3JAM Z;  4AIH A;  2YSR A;  1TNT A;  2R5Y B;  1RZ4 A;  4F92 B;  4PGH A;  1JJ6 C;  2D5V A;  5HDN A;  4XRS A;  1FIP A;  2K9S A;  2MW8 A;  3ABK H;  3DBH B;  4RBO A;  1QHH D;  2L7F P;  2QEN A;  4YII A;  3LSP A;  4A69 C;  4A3G J;  4NBQ A;  4HF2 A;  2QKM B;  2PMU A;  1LPQ A;  1BOA A;  4HAM A;  2E2J J;  1YQA A;  5HS9 A;  2HU9 A;  1TL8 A;  1GUU A;  3BQY A;  1K79 A;  2O03 A;  1AWC A;  1G3W A;  1A36 A;  4P9F A;  3T0Y A;  1K7A A;  1HC8 A;  2LC2 A;  4JX6 A;  3GFL A;  3KP3 A;  4CO8 A;  5DDG A;  2DBB A;  1WJF A;  2L7K A;  2PG4 A;  1HOM A;  1ZRC A;  3GFM A;  4XID A;  4FE4 A;  3DKW A;  3S32 A;  1NTC A;  3JRB A;  5HDG A;  1TBX A;  1ZGJ A;  3H35 A;  2X6O A;  3RPU D;  4BGD A;  3NWS A;  3H3V K;  2I10 A;  4A0Z A;  4DYC A;  4NB5 A;  2WY8 Q;  2LKS A;  2CQQ A;  3HOV J;  4G12 A;  4RAY A;  3OSG A;  2KIU A;  2WAE A;  3ZRG A;  2AO9 A;  3Q0U A;  4KA4 A;  3LST A;  3DPU A;  3PFI A;  3FBN B;  4ZYG A;  1J7K A;  1FBU A;  3ISP A;  5CYV A;  1SD6 A;  3FMR A;  3PQK A;  2LBF A;  2CMP A;  1ETW A;  2RQQ A;  2EK5 A;  1KGS A;  2EZK A;  2KRC A;  3WTX C;  5LLQ A;  3DEE A;  3B73 A;  3BJ6 A;  3T1B A;  1X2M A;  1SC7 A;  4BAY A;  2Y69 H;  4HBL A;  2NVY J;  1VQO I;  3BWG A;  3NAR A;  4ESF A;  3J80 K;  3K4B A;  4ZYD A;  4BE0 A;  1ZKG A;  4AU7 A;  5IY5 H;  3JRA A;  5E79 C;  5TRD A;  2R7R A;  3VYT B;  2XRL A;  4M72 A;  2J5O A;  3Q0V A;  2K9L A;  3HBL A;  5E1X A;  1QVU A;  2D1H A;  4EGZ A;  3LOC A;  3OYN A;  3ZOB A;  4A6D A;  2IP2 A;  4LK0 F;  1ZHF A;  3WOD F;  3JRE A;  1R23 A;  1OKR A;  2QQ9 A;  3ZMD A;  3G1M A;  1LB2 A;  4G94 A;  4BXF A;  5IT3 A;  4ESJ A;  1VQ8 I;  3HRU A;  5L3C A;  3DTE A;  2R7Z J;  5D8K B;  2DMQ A;  4IRG A;  2GZW A;  4GDF A;  2EWN A;  2JWT A;  3H36 A;  3E6M A;  4YEJ A;  2VT3 A;  3LL7 A;  2K9M A;  2LP0 A;  1SMT A;  3S17 J;  3OL3 A;  3FMS A;  1ZG1 A;  2JJ7 A;  4L0Y B;  1V5F A;  3TL4 X;  3GFI A;  2GA1 A;  1TQP A;  2OTJ I;  3S3N A;  3BR1 A;  5DUI A;  2V1N A;  2E1M B;  3HDD A;  3A01 A;  4IHW A;  1WGX A;  2IA2 A;  1BL0 A;  2HS5 A;  4GYG A;  2O8X A;  2FA5 A;  1WH5 A;  1AOY A;  3HHH A;  5FLM J;  1T95 A;  4HQM A;  1LUJ B;  2E5N A;  4M6Y A;  1W5T A;  3PQJ A;  5EJC A;  2P6S A;  3BR5 A;  2IAI A;  2K7L A;  2R7S A;  4BYY A;  2KIM A;  4IL6 C;  1M1E B;  2MSY A;  3MAJ A;  4Z6Y A;  2IS6 A;  1D0X A;  4GRI A;  4OMZ A;  1FZP B;  1VFC A;  3CQZ J;  2UXN A;  4IVN A;  4CYD A;  3CCU I;  4EGY A;  5JLX A;  2VQL A;  2V9V A;  3OY9 A;  3BP8 A;  2H94 A;  4NC8 A;  3IV5 A;  2XUB A;  1UZC A;  1D8K A;  3S1M J;  4KUM A;  3IAS 2;  1YW9 A;  1N75 A;  1IN8 A;  3S14 J;  3D1N I;  2Q8K A;  2P81 A;  4PSW A;  2LKP A;  3G3Z A;  2UV1 A;  1SAX A;  3ELK A;  2DYR H;  2P4W A;  1LJ9 A;  1WJB A;  3CP2 A;  3EUK L;  2IA1 A;  2A07 F;  5TGT A;  3I4M J;  3FIW A;  3HUG B;  1X2N A;  5KVR A;  1E17 A;  5D5X B;  3CES A;  5FKO A;  4OIQ F;  2ETH A;  4BE2 A;  2H6C A;  3ABM H;  1WJE A;  4A3E J;  5A2Q K;  3M1C A;  4HYE A;  4IHY A;  4ANJ A;  4ZTJ A;  3WG9 A;  1ON1 A;  3CMM A;  5EZH A;  1NHA A;  4LLN A;  2E2I J;  3AG4 H;  2QQA A;  3AAF A;  3MZ8 A;  3QYB A;  4E7I A;  1MBK A;  4B48 A;  1G59 A;  3AFH A;  1T33 A;  4EJT A;  4XK4 A;  3M3Y J;  1E3P A;  2X6X A;  3QYE A;  1H8A C;  3TOB A;  1QVT A;  4XRM A;  4BDY A;  3L00 A;  3JTH A;  3V4G A;  3TW7 A;  1O3T A;  4DNC A;  2OV7 A;  2AQF A;  1W0T A;  3JRD A;  1V5G A;  1XMX A;  1JT6 A;  1F4K A;  5J1U A;  2BZT A;  2Y0S A;  1PP7 U;  3WGG A;  4UVC A;  2QBY B;  1XGM A;  4A3K J;  2DOA A;  1OCO H;  1I3A A;  4XSZ F;  2BYV E;  1YG2 A;  2VIX A;  3E6C C;  3KLO A;  2I5U A;  1MMN A;  4CXF A;  1P7I A;  2OCC H;  2MLG A;  1LDJ A;  2IRF G;  3WG7 H;  2HYF A;  1FNN A;  1BR2 A;  1I50 J;  2M9H A;  3WHB A;  4RM3 A;  1F43 A;  1PVE A;  2FQ4 A;  1S72 I;  4E7L A;  2CJJ A;  3UNG C;  2JPB A;  1O7L A;  1QO0 D;  2IXS A;  4I0B A;  4XON A;  5ED4 A;  2VBY A;  3R0A A;  5CKT A;  4KMU X;  4OOI A;  3G71 I;  4BBS J;  1F36 A;  5BQT A;  4KN7 X;  2Z33 A;  3CC4 I;  5IT9 K;  5H6R A;  3EYY A;  1SAN A;  4CCJ A;  3L2Q A;  2BGC A;  3RYP A;  4BJ5 C;  4V19 K;  3CJQ B;  4R8H A;  2ME0 A;  4BQQ A;  3I4P A;  1FOX A;  3ZXS A;  3DCF A;  2K5C A;  1ZRF A;  2ELK A;  2YS9 A;  1YIJ I;  1J09 A;  3VYR B;  3QPS A;  4GFB A;  1U5T A;  3E3V A;  2Z99 A;  2RVC A;  1QGP A;  1XTA A;  4B47 A;  5HOO A;  3ML6 A;  2QA4 I;  4J19 A;  2XB5 A;  1I5Z A;  1BOB A;  2F6C A;  4LIU A;  3VOE A;  1CF7 B;  5IT9 Z;  4ABZ A;  4IPA A;  2DOE A;  4XKB A;  1QBJ A;  4KFC A;  3TO7 A;  1XSD A;  5K5Q A;  2DA3 A;  1SD5 A;  1ENH A;  4FX0 A;  4RGS A;  3U21 A;  2XAS A;  3LSG A;  3LFU A;  3KP6 A;  5EYR A;  3O8G A;  2AXL A;  2W82 A;  1RR7 A;  5L3F A;  2CU7 A;  3FHZ A;  3ERE D;  2PJR A;  1T08 B;  2DDB A;  3W6J B;  2IA0 A;  4HZF A;  3OWT A;  2BEO A;  4V2F A;  5DCM A;  5LEK A;  4FIS A;  3QP6 A;  2NS7 A;  2DA1 A;  1YIO A;  3SDB A;  4BQN A;  5HLH A;  5IP9 J;  4LOC A;  5IYD J;  4BXU A;  4XL9 A;  3DP7 A;  3CUQ A;  4HNV A;  3H5R A;  2CWE A;  3V8L A;  1BJA A;  4A3I J;  4RLF A;  1X1P A;  1XCB A;  3M7G A;  5B66 C;  5EZG A;  1ZG3 A;  1XSX A;  2FE3 A;  2OZU A;  2CH0 A;  3E6D A;  3PSF A;  2VAS A;  2VI6 A;  3UKG A;  2NAZ A;  3GUD A;  1TT5 B;  1ETO A;  2ZME C;  1K6Y A;  3TO6 A;  1ZAR A;  3KEY A;  1FTT A;  1R49 A;  1BJZ A;  3CD6 I;  1Y0N A;  4PFP A;  2F5E A;  1JT0 A;  1O4X A;  2XGX A;  1S7E A;  3DU6 A;  1Z7U A;  2IEK A;  1G3T A;  3LSK A;  3SEQ A;  3HC7 A;  1SMY F;  3WU0 A;  5F0C A;  3ABL H;  2PMZ N;  2MH2 A;  3MVP A;  1TWG J;  3U1D A;  4FX4 A;  1HST A;  1U6G A;  3QYF A;  2EZL A;  1IRX A;  2BXZ A;  3CDH A;  1DQU A;  3HYI A;  1R71 A;  1QU3 A;  4RAZ A;  4IHV A;  3QU6 A;  2F48 A;  2L9R A;  1OQY A;  3ZN0 A;  1R00 A;  5E1W A;  2ZC2 A;  4PUS A;  2OQG A;  4CGZ A;  4I99 C;  1T56 A;  1HW5 A;  3QP5 A;  2L9S A;  4Y52 J;  4PDK A;  2EV5 A;  3GWZ A;  4AC0 A;  4KT6 A;  1V4R A;  2KIS A;  2L0K A;  5J6X A;  4FAS D;  2M0M A;  2JA7 J;  1QRY A;  4IRI A;  3TO9 A;  2JUG A;  1XMA A;  3K2Z A;  2XRN A;  5F1R A;  4CCN A;  1RC9 A;  2MD0 A;  2JMW A;  4BDZ A;  2F2E A;  2HDD A;  4M73 A;  4ZZD A;  5KNL A;  2A6T A;  4HEA 2;  2OZ6 A;  4BJ6 C;  5J8C A;  3I71 A;  2DQL A;  2F4O B;  2BV6 A;  4N9H A;  2PI0 A;  2CQN A;  2CUE A;  1BI1 A;  1LFB A;  1YRN A;  1NK3 P;  1P2F A;  5K7F A;  1ZYR F;  1TWH J;  4ZDP A;  1W7P B;  2EH3 A;  2M7A A;  2FF4 A;  1MNM C;  3GTQ J;  4XOR A;  5KAI C;  3D5L A;  4I09 A;  2PBI A;  5FD5 A;  1T98 A;  3DPL C;  2B9S A;  2JSC A;  4AYB A;  3ZR8 X;  3QRF F;  1EKE A;  1LVA A;  2Q2E A;  3P5J A;  3CCJ I;  3VDX A;  2JA5 J;  2EIN H;  2HR3 A;  3F8N A;  2DYS H;  4TV7 A;  1PP8 F;  1YO5 C;  1ETQ A;  3BCA A;  4QWQ A;  1IUY A;  2O6G E;  2W00 A;  4I0A A;  2ISY A;  4HQE A;  1OCP A;  3FBI B;  1F1Z A;  3BT9 A;  3ABU A;  1PJR A;  5D6E A;  5L3G A;  3IRQ A;  4DZJ A;  1D5Y A;  1A5J A;  1PUF B;  1T0F C;  2DU9 A;  3CME I;  2FUG 2;  3K1N A;  3L2U A;  3KET A;  2E7X A;  5GAD J;  1R1T A;  2HYJ A;  4HNT A;  4C2T A;  3QPT A;  3ZQQ A;  1FOY A;  2XC7 A;  4HDU A;  1XN7 A;  3I59 B;  3MN2 A;  2EIL H;  2Q1Z B;  2LG4 A;  3IL2 A;  2OF7 A;  3KX2 A;  4ZYA A;  2COB A;  3ZQ7 A;  5JLW A;  4UV9 A;  4EM2 A;  5D5V B;  3K10 A;  3RTR A;  1YW8 A;  2OA4 A;  3JRF A;  4B1R A;  2R5Z B;  4IOA F;  3WE3 A;  1J9I A;  4HDV A;  2GOX B;  3E7L A;  4O5V A;  1D1B A;  5EG0 A;  2WAQ A;  2LTP A;  2R7Q A;  3A4C A;  4A5M A;  1JTY A;  2VOD A;  1SVO A;  3F3X A;  2VJJ A;  2P6T A;  2HQN A;  4D5C A;  4XNF A;  1O3Q A;  2DMP A;  3FIS A;  1VND A;  1U2W A;  2X4H A;  2E71 A;  3I53 A;  2PJP A;  2Z9O A;  1S7A A;  1UHS A;  2W7N A;  3DF8 A;  1WFX A;  2M4K A;  3HJE A;  3FZV A;  3ZQH A;  3S3O A;  2KKO A;  1J75 A;  4GXO A;  2R7T A;  2DA4 A;  4GYI A;  2HDW A;  3QPL A;  3CMA I;  4KNY A;  1KU2 A;  2V6C A;  3K9T A;  4S05 A;  5FRN A;  4F91 B;  1UG0 A;  3DV8 A;  4HST A;  1D3Y A;  1ETK A;  4I02 A;  5J40 A;  4U7B A;  4JX5 A;  1YJ9 I;  1U78 A;  3TDU C;  3BJA A;  4E7Z A;  4B44 A;  1W7P D;  1LEA A;  1LDD A;  3S1N J;  4CIC A;  1JKQ C;  5D8L B;  2JRM A;  2DPU A;  3KZZ A;  4S04 A;  2A68 F;  3OYE A;  2RQP A;  3EUA A;  4L9V A;  3I54 A;  2DT5 A;  2NXN B;  3HGY A;  2VXD A;  4MGR A;  1XD7 A;  4E6K G;  4RDU A;  2V26 A;  4FE7 A;  2EV0 A;  1XS9 A;  4AYB N;  2X48 A;  2QCO A;  5B5E C;  3DLA A;  2LD5 A;  2K4B A;  1D1C A;  1GV5 A;  2BW3 A;  1UAA A;  4EM1 A;  1SD4 A;  5JFR A;  4JK1 X;  4G7Z F;  5CVI A;  4BQO A;  1G3Y A;  1UFM A;  1VF9 A;  4IEJ A;  4EJO A;  2FMY A;  3A0H C;  3K1M A;  3RCO A;  1L0O C;  1P6R A;  2HVS A;  1T6S A;  3CCM I;  1IO2 A;  2R7O A;  4XM3 A;  5DD8 A;  3A02 A;  2HGC A;  4UY8 I;  1ZGW A;  3X2Q H;  4I6Z A;  3WU1 B;  1X3U A;  2PEX A;  2NS8 A;  1VI0 A;  2R7V A;  5FKM A;  5D4R A;  9ANT A;  4IRH A;  4MTD A;  3OYL A;  3IHU A;  1MMD A;  1EH8 A;  2E34 A;  3E1S A;  4A0X A;  2XSJ C;  1NG7 A;  2OAZ A;  3BOQ A;  3KP7 A;  4MEX F;  2IS2 A;  2G7H A;  4BH9 A;  1FEX A;  1W5C C;  2LFB A;  3IH3 A;  2R3S A;  3FK7 A;  2VBW A;  1FOK A;  4O6J A;  3CCY A;  4KIG A;  4L5I A;  1POG A;  5FKK A;  3KP4 A;  2K27 A;  4YIR X;  4Q47 A;  2L54 A;  2L9N A;  1IRF A;  1MW7 A;  2AS5 F;  1AKH B;  4LGW A;  2K4J A;  4LK1 F;  1OCZ H;  5CJ9 A;  1X19 A;  1LNW A;  1ONV A;  2XAG A;  1ZEL A;  4YFN F;  1WQ2 A;  2WV1 A;  2MA3 A;  3R60 A;  2VON A;  4HPQ A;  3VPR A;  1R5I D;  5ICC A;  1MDM A;  4EVI A;  1PUE E;  4M3B A;  1G2H A;  5IP6 A;  3UR3 C;  1GT0 C;  3KE2 A;  4NDL A;  3C2H A;  2F4I A;  1GLN A;  1Z6T A;  2DMN A;  2LNB A;  4UXN A;  1NK2 P;  1ZH5 A;  4RAF A;  5IPA A;  3LQR A;  4BUP A;  3D5R C;  2HTJ A;  2EFN A;  3BPX A;  1G4D A;  4EQQ A;  1IUF A;  2H6B A;  1OYY A;  1ETV A;  1PYV A;  2XF6 A;  3RYR A;  3J7A Y;  2CGP A;  4RB1 A;  1APL C;  1XG1 A;  2P5K A;  3BTC A;  2A3S A;  4BNC A;  1P7J A;  2LVS A;  3D0S A;  2FOK A;  3H5N A;  4KIC A;  1CGP A;  2L4A A;  1JHH A;  1G8X A;  2DT6 A;  5JHF A;  4MQV A;  3KP2 A;  3V7S A;  5ICE A;  4EJV A;  3J7A O;  3LWF A;  3BR6 A;  4GCV A;  1MBG A;  1SFE A;  5DCF A;  5C3E J;  2K02 A;  3R4K A;  1R4M B;  1FC3 A;  2Y0M A;  1CQT A;  2ADU A;  5H2F C;  4ZJZ A;  1REP C;  2E2H J;  4XRF A;  2G7U A;  2JUC A;  2FRH A;  5FRO A;  3SFZ A;  2CV0 A;  3S2H J;  2GIV A;  4S0H B;  2XGC A;  3EUH A;  4BU2 A;  1FBQ A;  2M7B A;  2LSO A;  4KIB A;  3REO A;  2E1O A;  4X6A J;  1XMK A;  1Y8R B;  3K6G A;  5BNG A;  4XQF A;  2EFP A;  1MJA A;  2VKH A;  4WX9 A;  3OYK A;  1ODD A;  1IN6 A;  1E3H A;  1I1G A;  1FTZ A;  3TGN A;  1K83 J;  5TIS C;  3MFK A;  2MC4 A;  1FP2 A;  4E7J A;  2IBD A;  1PDN C;  1ZRD A;  3RDI A;  2BVL A;  3FX3 A;  2IGO A;  1J2X A;  4OIN F;  2ME6 A;  5DYM A;  1MZB A;  1P9Q C;  1MMG A;  2ELJ A;  2DFH A;  1Z21 A;  3M8E A;  2A61 A;  5E3O A; 
#chains in the Genus database with same CATH homology
 3KFW X;  1YS6 A;  3U2R A;  5LHG A;  1R22 A;  4AVP A;  2R7F A;  3WTY C;  4PGG A;  1T2K A;  1GXQ A;  4ZZL A;  1YLF A;  1EV7 A;  2LDU A;  3R0J A;  1J0R A;  4EM0 B;  2UWM A;  3ZMU A;  1C0W A;  3Q9S A;  2Q0O A;  2Y48 A;  2UXX A;  1K78 B;  5DEQ A;  3WGI A;  2HTS A;  1D5V A;  2DK8 A;  1XB4 A;  1GXP A;  3J80 Z;  2HYG D;  2OU2 A;  3L7W A;  3GZ6 A;  1FYL A;  1U5T C;  3P7N A;  3WTV C;  5KK1 A;  4WXH A;  1QPM A;  1QNT A;  5EEG A;  3C7J A;  4QLC U;  4JBA A;  1SD7 A;  4G6Q A;  2STW A;  3I5U A;  3E6B A;  2E1N A;  2DAO A;  2QQB A;  3T8R A;  4A2U A;  5L3B A;  2EV6 A;  1YW7 A;  4LLG F;  3RIR A;  4LD5 A;  2M30 A;  3M9A A;  2FEZ A;  3DPT A;  4CZZ A;  5BS6 A;  2P8T A;  4LB5 A;  4XLP F;  1JHF A;  4KN4 X;  4WF2 A;  1KQ8 A;  1DPR A;  4ZYH A;  1Z6R A;  2ZNY A;  3ZN1 A;  4ESB A;  2ACJ A;  2C6Y A;  4HX7 A;  2YU3 A;  1UCR A;  4LG0 B;  1B9N A;  2RGV A;  3O6B B;  2HKX A;  3KLN A;  2ZME B;  5HVQ C;  5D5W B;  2DTR A;  3I64 A;  4MTE A;  4YIF A;  2IT0 A;  4Q5S F;  2ZO4 A;  1BIA A;  2RDP A;  5D4S A;  3OOP A;  1ULY A;  2E1C A;  4I2O A;  3CUO A;  4KIF A;  3WTZ A;  1BN5 A;  3GZ5 A;  1ZGA A;  2X0L A;  2QUF A;  1O7F A;  3LA2 A;  2EFO A;  3FMQ A;  3FXQ A;  2ZXJ A;  2WTE A;  4A0Y A;  2VOO A;  4KDP A;  4XLN F;  3HOT A;  2FBI A;  2NNY A;  2XAF A;  2HOE A;  2F5C A;  5A2Q Z;  3RPQ A;  5LRS A;  1DUX C;  2D45 A;  1OYI A;  5ILS A;  1P4W A;  1FX7 A;  4E70 A;  2VC1 A;  2CQK A;  2XRO A;  1Z9C A;  5K1Y A;  1B6A A;  1GVJ A;  4U7D A;  3DEU A;  1IZ1 A;  2EB7 A;  4IJA A;  5JR3 A;  5ICF A;  4MEY F;  2PFB A;  3GYH X;  4FHT A;  2BBY A;  2OD5 A;  3ZMT A;  1V3F A;  1QZZ A;  4ENN A;  3ZMS A;  4AWX B;  2V1X A;  2CFX A;  4LJZ F;  2ESN A;  4IXA A;  3C18 A;  5D6F A;  3V8J A;  1XSV A;  5L3E A;  4RGR A;  1UHW A;  1XCV A;  4JQF A;  5K5R A;  1TNS A;  3R61 A;  3SXY A;  2FBH A;  3H3U A;  5ERI A;  4XSX F;  4H0E A;  5E8I A;  4B09 A;  3HRM A;  2VBX A;  2LF7 A;  2VC0 A;  3EYI A;  1IXS B;  1USS A;  1TW3 A;  1WI9 A;  5F6F A;  4G7H F;  3ECO A;  1JE8 A;  4U0Y A;  3O3K A;  1STZ A;  2BE5 F;  4L9J A;  3RPU A;  3RKX A;  1HKQ A;  2W85 A;  5FD6 A;  3HOS A;  1IW7 F;  1KU3 A;  1KU9 A;  3IC7 A;  1P4A A;  4FT8 A;  4L0Z B;  1FPQ A;  3B02 A;  4PCQ A;  2GA2 A;  4IF4 A;  3NRV A;  1U8R A;  3CJN A;  1KQ0 A;  3E5U A;  1BI0 A;  2RN7 A;  4RGX A;  4A6E A;  4EJW A;  3GEZ A;  2FNA A;  2RV8 A;  2KIF A;  4U0W A;  4YFX F;  5LEJ A;  1RNL A;  3ZMZ A;  4IHT A;  2W25 A;  1T38 A;  3SHF A;  2XKO A;  3BJO A;  3LA3 A;  1RUN A;  3SQN A;  2GWR A;  2QVO A;  5D5U B;  1DPU A;  2PMH A;  3GXO A;  3CLO A;  2PLY A;  3V7R A;  2VBZ A;  3H3Z A;  4UHT A;  1IN5 A;  3HSF A;  3GF2 A;  3ABT A;  5E18 F;  3O2P E;  2J5P A;  1G3S A;  2CW0 F;  2ELH A;  1IF1 A;  4O3M A;  3WTT C;  3MCZ A;  3HSR A;  3ROU A;  4M9S A;  3DXJ F;  2GQQ A;  1ZLJ A;  1VTN C;  1YS7 A;  3CO7 C;  1FYK A;  2FXA A;  5ICG A;  3LFK A;  2EJR A;  1WSU A;  4Y15 A;  4ENM A;  2HFH A;  3E5X A;  3F8M A;  3BY6 A;  4LFU A;  1LDK B;  3WTU C;  4N0B A;  4Y17 A;  1R36 A;  2P5V A;  2DQR A;  1JGS A;  4NQW A;  3I58 A;  1RUO A;  2DK5 A;  4G8X A;  1MD0 A;  4AD9 A;  2VN2 A;  2YPR A;  3GLX A;  3FF5 A;  2V1D A;  1R1U A;  1HW2 A;  3F22 A;  2V79 A;  1FBS A;  3KEO A;  2XAQ A;  3BZ6 A;  1D8J A;  3ZMV A;  4KYW A;  2CYY A;  3FXR A;  3KP5 A;  1IXR C;  2DPD A;  1TLH B;  2KJC A;  1FP1 D;  1A04 A;  1S7O A;  1UST A;  2FBK A;  2KRF A;  1K6O A;  1MJB A;  3G73 A;  1RI7 A;  1W4M A;  2DLL A;  4BHB A;  2VXZ A;  2FNP A;  2MLK A;  2M8E A;  1DP7 P;  2ZME A;  3N97 A;  1SFU A;  3F6V A;  5LBQ A;  4KT5 C;  2COM A;  4ZH4 F;  4EV0 A;  2ZBK A;  4I01 A;  3HUG A;  1ZAO A;  3DQV C;  1U5T B;  1YTY A;  3V8K A;  3P9C A;  4AIK A;  1LQ1 A;  5LHH A;  2VT2 A;  2P5L C;  5HDK A;  2GAU A;  5DV5 A;  1W5S A;  2DFI A;  2ZNZ A;  4XBF A;  4LB6 B;  3RKY A;  2M45 A;  1XGO A;  4RB3 C;  4P96 A;  3HSE A;  3E5Q A;  1UB9 A;  5DCM B;  5FGM A;  1H9T A;  1OYW A;  4RB2 C;  1OPC A;  3MZY A;  5LGU A;  2FU4 A;  3U9G A;  3F8C A;  2VE9 A;  2QBY A;  2F5F A;  2A6H F;  2O3F A;  3F6O A;  2VE8 A;  2L01 A;  3LAP A;  4HF0 A;  4ENK A;  1ZRE A;  2W84 A;  4Q4Z F;  5HLG A;  5L3D A;  2V1U A;  1HQC A;  2NNN A;  2K86 A;  2D1V A;  3GFJ A;  1BI2 A;  3CO6 C;  1EH7 A;  3MZH A;  1R7J A;  4M9Z A;  5BOX A;  1BIB A;  1Z91 A;  4ASN A;  3TDZ C;  1YFH A;  1Z1D A;  3N4M A;  3QAH A;  1FT9 A;  5FO5 A;  4G7O F;  3K69 A;  1ZG5 A;  1B59 A;  4OMY A;  3LQQ A;  3F72 A;  3M8F A;  1QQI A;  1IXC A;  3T8T A;  4HV5 A;  2OQR A;  3QU3 A;  1OR7 A;  1CF7 A;  1P4X A;  2XKP A;  3OV8 A;  1UHM A;  2A6E F;  4G9Y A;  2GXB A;  3IKV A;  4LLL A;  2L3D A;  3K1P A;  1XDU A;  2L02 A;  2XV4 S;  1S6L A;  1Z05 A;  2HQR A;  3RKW A;  3WTS C;  2ZFW A;  3EQL F;  3T5X A;  1IAW A;  2LF8 A;  2ZKZ A;  4I7H A;  1ON2 A;  2H27 A;  3L09 A;  3BPV A;  4R79 A;  2XVC A;  1EH6 A;  3H92 A;  4R1H A;  3F21 A;  5LGN A;  5ILV A;  5DUK A;  5FB2 A;  3F8F A;  5F64 A;  3EDP A;  5HS7 A;  3GW2 A;  2NYX A;  3L9F A;  2B0L A;  1Y0U A;  1LEB A;  1B1B A;  1Q1H A;  2JRT A;  5LRR A;  4WXC A;  2G9W A;  2L4M A;  4WXD A;  3ULQ B;  3F23 A;  3KEQ A;  1KQ9 A;  4ON0 A;  3BRO A;  2P7C B;  1TW2 A;  1R5H A;  3W6K B;  2RC4 A;  2XHK A;  4CDG A;  4RGU A;  5JI6 A;  2A5Y B;  3Q9V A;  2JT1 A;  2WV0 A;  3CUQ C;  2O0Y A;  2R7D A;  5BPI A;  3HTU A;  4HLX A;  1J5Y A;  3IRR A;  4MQ9 F;  1W7P A;  4UVB A;  2Z3Y A;  1HW1 A;  3COA C;  2UZK A;  3HHG A;  3MQ0 A;  3P9I A;  1QZY A;  1XGS A;  4GGG A;  1GHC A;  4YG2 F;  4Q48 A;  1KU7 A;  1L3L A;  1F5T A;  2NRA C;  3I59 A;  2WC2 A;  3SZP A;  2HZT A;  4WCG A;  2ESH A;  1TQM A;  2NS0 A;  1BBY A;  1YYV A;  3KCC A;  3MEX A;  4OIR F;  1S29 A;  2YX4 A;  4ZYE A;  2XAJ A;  3M1E A;  2PQ8 A;  5H20 A;  2Z5U A;  5HS8 A;  1IRG A;  2M5W A;  5EEH A;  2FQ3 A;  4BQA A;  2IW5 A;  2JZY A;  1KA8 A;  2CSO A;  5TJJ A;  2KJB A;  1MJ9 A;  1MDM B;  1MGT A;  3IKT A;  5CVV A;  1XDS A;  2M1B A;  5JHU A;  2E7W A;  2VOP A;  4ENJ A;  1BM9 A;  5LGT A;  3SZT A;  4L5J A;  2STT A;  3P9K A;  5H6Q A;  4EJU A;  3QPH A;  5LHI A;  2MBF A;  2Y75 A;  2TDX A;  3E97 A;  2HKO A;  3ECH A;  3QOP A;  4D0P A;  1H9G A;  5JVT A;  3TQN A;  3TKY A;  2WWY A;  4P5O A;  2IPQ X;  4B8X A;  2QZ8 A;  4U0V A;  1ZN2 A;  3K0L A;  1TTY A;  2W57 A;  3JW4 A;  2MC3 A;  1WWX A;  5FFZ A;  3NQO A;  1DDN A;  4L9N A;  1U3E M;  4UNO A;  2FSW A;  5E8G A;  2ISZ A;  2JPC A;  4YFK F;  1BC8 C;  4HF1 A;  4WWC A;  1MKM A;  4OIP F;  2M87 A;  2DO7 A;  4A5N A;  5DD4 A;  4MHG A;  5HLI A;  2GXG A;  1HKS A;  1JXS A;  4OU0 A;  2OBP A;  3TOA A;  3KZY A;  3LA7 A;  3ZP5 A;  2QYO A;  3VFZ A;  3CTA A;  4LMY A;  3WTW C;  5E20 A;  4UUV A;  1O3R A;  1KYZ A;  1R58 A;  2O61 A;  2EFW A;  1T39 A;  4ETS A;  2D2W A;  2CO5 A;  1XGN A;  2RKH A;  4M6X A;  1E2X A;  3VB2 A;  2QLZ A;  3RI4 A;  4KMF A;  1H0M A;  3WGH A;  2QM3 A;  1TQI A;  1FY7 A;  2IJL A;  2YR2 A;  5AON A;  4HLY A;  4EMS A;  3VOD A;  4L18 B;  1F9N A;  3FM5 A;  4RS8 A;  3JTG A;  2ZCW A;  1J59 A;  6PAX A;  2QWW A;  1HSJ A;  4IHS A;  4BHC A;  3HIF A;  3ZPL A;  1HKT A;  3GVA A;  1G6N A;  4NHJ A;  1BI3 A;  5E17 F;  2XIG A;  4HV6 A;  3IWF A;  1K78 A;  1O57 A;  2H09 A;  3EET A;  4OIO F;  3C1D A;  2DW4 A;  4I98 B;  3JSP A;  2A69 F;  2DI3 A;  3F8B A;  5AIQ A;  1S8N A;  1R5G A;  2HEO A;  4RB0 A;  1I27 A;  5E1Z B;  2P7V B;  5ILU A;  4P55 A;  4UV8 A;  5K5O A;  3I0T A;  1FYM A;  2HDC A;  1O3S A;  1B9M A;  1HXD A;  3GO5 A;  5FFX A;  2PN6 A;  5FLX K;  4HX8 A;  3FM3 A;  4HOB A;  3FWE A;  3L2C A;  3V7C A;  3MWM A;  1FLI A;  5AIP A;  3IWZ A;  5BPD A;  1B4A A;  5CLS A;  3RJP A;  1RIO H;  5FLX Z;  3LAJ A;  1HBX G;  5CVU A;  3HRS A;  2XAH A;  4U88 A;  4M9X A;  3FXU A;  4PZJ A;  1SFX A;  2EA4 A;  2EFQ A;  3C3W A;  2CG4 A;  1FWZ A;  4F7Z A;  1I1S A;  4LG0 A;  1KYW A;  4M74 A;  2RNJ A;  4N9I A;  4Z2Y A;  2JTV A;  3HTS B;  3BDD A;  2F5D A;  2MD5 A;  4A12 A;  1I6X A;  1IN4 A;  2HWV A;  1R1V A;  4WK8 F;  4HW0 A;  1BC7 C;  3HRT A;  2ZJ2 A;  1ZLK A;  4DQ2 A;  3Q5F A;  4G6D A;  1IN7 A;  4BHP A;  4CHU A;  1P92 A;  2MH9 A;  4M71 A;  2W24 A;  3WE2 A;  1S3J A;  3NEU A;  5CVR A;  1FSH A;  3J81 K;  4GO1 A;  2EA2 A;  5J8F A;  4Y13 A;  4P9U A;  3CUQ B;  2YX7 A;  4MNU A;  3S2W A;  2FML A;  1WRJ A;  5BMZ A;  3VEP A;  4UVA A;  4HA8 A;  3JSO A;  5CVJ A;  3DFG A;  1WKM A;  3JAM K;  2IVM A;  3J81 Z;  4L9T A;  1FSE A;  4HX4 A;  3GX4 X;  4K2E A;  3R6S A;  1OMI A;  1T0F A;  4AIJ A;  3JAM Z;  4AIH A;  2YSR A;  1TNT A;  1RZ4 A;  4PGH A;  5HDN A;  2QEN A;  4YII A;  4HF2 A;  2PMU A;  1BOA A;  4HAM A;  1YQA A;  5HS9 A;  1K79 A;  2O03 A;  1AWC A;  1G3W A;  4P9F A;  3T0Y A;  1K7A A;  3GFL A;  3KP3 A;  4CO8 A;  5DDG A;  2DBB A;  2PG4 A;  1ZRC A;  3GFM A;  3DKW A;  5HDG A;  1TBX A;  1ZGJ A;  4A0Z A;  4NB5 A;  4RAY A;  2KIU A;  4KA4 A;  3LST A;  3PFI A;  4ZYG A;  1J7K A;  1FBU A;  3ISP A;  5CYV A;  1SD6 A;  3FMR A;  3PQK A;  2EK5 A;  1KGS A;  3WTX C;  5LLQ A;  3B73 A;  3BJ6 A;  3T1B A;  4BAY A;  4HBL A;  3BWG A;  4ESF A;  3J80 K;  4ZYD A;  5TRD A;  4M72 A;  2J5O A;  5E1X A;  2D1H A;  4EGZ A;  4A6D A;  2IP2 A;  4LK0 F;  1ZHF A;  3WOD F;  1R23 A;  1OKR A;  2QQ9 A;  3ZMD A;  1LB2 A;  4G94 A;  5IT3 A;  4ESJ A;  3HRU A;  5L3C A;  5D8K B;  4IRG A;  2GZW A;  2EWN A;  3E6M A;  2VT3 A;  1SMT A;  3FMS A;  1ZG1 A;  4L0Y B;  3GFI A;  2GA1 A;  1TQP A;  5DUI A;  2IA2 A;  2HS5 A;  4GYG A;  2O8X A;  2FA5 A;  1AOY A;  3HHH A;  4HQM A;  4M6Y A;  1W5T A;  3PQJ A;  2P6S A;  2K7L A;  4BYY A;  2KIM A;  3MAJ A;  4OMZ A;  1FZP B;  2UXN A;  4IVN A;  4CYD A;  4EGY A;  2V9V A;  3BP8 A;  2H94 A;  2XUB A;  1D8K A;  4KUM A;  1YW9 A;  1IN8 A;  2Q8K A;  2LKP A;  3G3Z A;  1SAX A;  3ELK A;  2P4W A;  1LJ9 A;  2A07 F;  2IA1 A;  5KVR A;  1E17 A;  5D5X B;  4OIQ F;  2ETH A;  2H6C A;  5A2Q K;  4HYE A;  3WG9 A;  1ON1 A;  4LLN A;  1NHA A;  2QQA A;  3AAF A;  4EJT A;  3TOB A;  3L00 A;  3JTH A;  3V4G A;  1O3T A;  4DNC A;  1F4K A;  1PP7 U;  3WGG A;  4UVC A;  2QBY B;  1XGM A;  4XSZ F;  2BYV E;  1YG2 A;  3E6C C;  3KLO A;  4CXF A;  2MLG A;  1LDJ A;  2IRF G;  2HYF A;  1FNN A;  2JPB A;  1O7L A;  1QO0 D;  4I0B A;  5ED4 A;  2VBY A;  3R0A A;  4KMU X;  4OOI A;  5BQT A;  4KN7 X;  2Z33 A;  5IT9 K;  5H6R A;  3EYY A;  2BGC A;  3RYP A;  4R8H A;  3I4P A;  1ZRF A;  1U5T A;  3E3V A;  2Z99 A;  2RVC A;  1QGP A;  5HOO A;  3ML6 A;  1I5Z A;  5IT9 Z;  3VOE A;  1CF7 B;  4IPA A;  1QBJ A;  4KFC A;  3TO7 A;  1XSD A;  5K5Q A;  1SD5 A;  4FX0 A;  4RGS A;  2XAS A;  3KP6 A;  5L3F A;  2AXL A;  3FHZ A;  3ERE D;  3W6J B;  2IA0 A;  4HZF A;  2BEO A;  5DCM A;  5LEK A;  3QP6 A;  1YIO A;  5HLH A;  4BXU A;  3DP7 A;  3CUQ A;  2CWE A;  3V8L A;  1BJA A;  1XCB A;  3M7G A;  1ZG3 A;  1XSX A;  2FE3 A;  2OZU A;  3E6D A;  2NAZ A;  3GUD A;  3TO6 A;  1ZAR A;  2F5E A;  2XGX A;  1Z7U A;  1G3T A;  3WU0 A;  1SMY F;  2MH2 A;  3U1D A;  4FX4 A;  1HST A;  1U6G A;  3CDH A;  3HYI A;  4RAZ A;  3QU6 A;  3ZN0 A;  1R00 A;  5E1W A;  2OQG A;  4CGZ A;  3QP5 A;  1HW5 A;  4PDK A;  2EV5 A;  3GWZ A;  1V4R A;  5J6X A;  4IRI A;  3TO9 A;  1XMA A;  3K2Z A;  2XRN A;  5F1R A;  2F2E A;  4M73 A;  4ZZD A;  2OZ6 A;  5J8C A;  3I71 A;  2DQL A;  2BV6 A;  4N9H A;  2PI0 A;  1BI1 A;  1P2F A;  1ZYR F;  1W7P B;  2FF4 A;  3D5L A;  4I09 A;  2PBI A;  5FD5 A;  1T98 A;  3DPL C;  2JSC A;  3QRF F;  1LVA A;  2Q2E A;  2HR3 A;  3F8N A;  4TV7 A;  1PP8 F;  1YO5 C;  4QWQ A;  1IUY A;  2O6G E;  4I0A A;  2ISY A;  4HQE A;  1F1Z A;  3ABU A;  5D6E A;  5L3G A;  3IRQ A;  2DU9 A;  3K1N A;  3KET A;  2E7X A;  1R1T A;  3QPT A;  4HDU A;  1XN7 A;  3I59 B;  3IL2 A;  3ZQ7 A;  4UV9 A;  4EM2 A;  5D5V B;  3RTR A;  1YW8 A;  2OA4 A;  3WE3 A;  1J9I A;  4HDV A;  4O5V A;  4A5M A;  2VOD A;  3F3X A;  2P6T A;  2HQN A;  1O3Q A;  1U2W A;  2X4H A;  3I53 A;  2PJP A;  2Z9O A;  1S7A A;  3DF8 A;  3FZV A;  2KKO A;  1J75 A;  4GXO A;  4GYI A;  4KNY A;  1KU2 A;  2V6C A;  3K9T A;  4S05 A;  3DV8 A;  4I02 A;  1D3Y A;  4U7B A;  1U78 A;  3TDU C;  3BJA A;  1W7P D;  1LEA A;  1LDD A;  4CIC A;  5D8L B;  2DPU A;  3KZZ A;  4S04 A;  2A68 F;  2RQP A;  4L9V A;  3I54 A;  2DT5 A;  4MGR A;  1XD7 A;  2EV0 A;  2K4B A;  4EM1 A;  1SD4 A;  5JFR A;  4JK1 X;  4G7Z F;  5CVI A;  1G3Y A;  1UFM A;  4EJO A;  2FMY A;  3K1M A;  1L0O C;  1P6R A;  1T6S A;  5DD8 A;  2HGC A;  3WU1 B;  1X3U A;  2PEX A;  5D4R A;  4IRH A;  4MTD A;  3IHU A;  1EH8 A;  4A0X A;  2OAZ A;  3BOQ A;  3KP7 A;  4MEX F;  2G7H A;  4BH9 A;  2R3S A;  2VBW A;  1FOK A;  4O6J A;  4KIG A;  4L5I A;  3KP4 A;  2K27 A;  4Q47 A;  2L54 A;  1IRF A;  2AS5 F;  4LGW A;  2K4J A;  4LK1 F;  5CJ9 A;  1LNW A;  1ONV A;  2XAG A;  4YFN F;  1WQ2 A;  2MA3 A;  3R60 A;  2VON A;  1MDM A;  5ICC A;  4EVI A;  1PUE E;  3KE2 A;  1Z6T A;  2LNB A;  4UXN A;  1ZH5 A;  3LQR A;  2HTJ A;  2EFN A;  3BPX A;  1G4D A;  4EQQ A;  2H6B A;  1OYY A;  3RYR A;  2CGP A;  4RB1 A;  2P5K A;  2A3S A;  4BNC A;  3D0S A;  4KIC A;  2FOK A;  1CGP A;  2L4A A;  1JHH A;  4MQV A;  3KP2 A;  3V7S A;  5ICE A;  4EJV A;  3J7A O;  3LWF A;  4GCV A;  1SFE A;  5DCF A;  2K02 A;  3R4K A;  1FC3 A;  2Y0M A;  2ADU A;  1REP C;  4XRF A;  2G7U A;  2FRH A;  3SFZ A;  2GIV A;  3EUH A;  1FBQ A;  2LSO A;  4KIB A;  3REO A;  1XMK A;  2EFP A;  1MJA A;  4WX9 A;  1IN6 A;  1I1G A;  1ODD A;  3TGN A;  3MFK A;  1FP2 A;  1PDN C;  1ZRD A;  3RDI A;  3FX3 A;  1J2X A;  4OIN F;  5DYM A;  1MZB A;  3M8E A;  2A61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...