1Y39A

Co-evolution of protein and rna structures within a highly conserved ribosomal domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
TFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARNMGIVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/rna
molecule keywords 58 Nucleotide Ribosomal 23S RNA Domain
publication title Coevolution of Protein and RNA Structures within a Highly Conserved Ribosomal Domain
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 21
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1y39A00
3CCEI 3I55I 4IOAF 3CCRI 1FOXA 5DM6F 1VQPI 1VQ8I 2OTJI 3CMEI 3PIOF 1YITI 1HC8A 1ACIA 1VQ9I 3I56I 5DM7F 3CD6I 1VQ4I 2E34A 3CCUI 2JQ7A 1FOWA 1VQ6I 4IOCF 1MMSA 3CCJI 3CC4I 4UY8I 4IO9F 2QA4I 2ZJPF 1VQLI 3CJTB 3CCQI 3CCMI 3CC7I 1Y39A 1S72I 3PIPF 1YJWI 3CMAI 3CCVI 3G4SI 2E35A 5GAGJ 1FOYA 3G71I 3DLLF 5GADJ 1YJNI 3J7ZI 1VQNI 2H8WA 3CCSI 3CF5F 5GAHJ 3J7YJ 5JVGF 2ZJQF 3CC2I 2NXNB 4V19K 2FOWA 2OTLI 1QA6A 1VQKI 3CCLI 2E36A 2K3FA 2ZJRF 3G6EI 1YHQI 1YIJI 1VQ7I 1VQ5I 5GAEJ 1YI2I 1YJ9I 1VQOI 1VQMI 2QEXI
chains in the Genus database with same CATH superfamily
3AG2H 1R1UA 1U78A 3TO6A 3KZYA 2WBMA 1OCCH 3QQAA 2DA2A 4RBOA 4IOAF 3PFYA 1UAAA 4ZJZA 1BR1A 1F36A 3C2GA 4KISA 3GTLJ 4EM0B 2EIJH 3NQOA 2L7KA 4OIPF 4GFBA 1XMAA 5ILSA 2QGUA 2Q2EA 3BR6A 2XPUA 2BBYA 1LE8B 4HQMA 3CMEI 1JKPC 1IRXA 4AIKA 2HZTA 2M0MA 5DCMB 3S16J 1KQ9A 2DW4A 4ZDPA 4B43A 4BEHA 4OIQF 1Z1DA 1LDDA 2E7WA 2QUFA 3L2WA 1WZ2A 2M7BA 4II3A 1EKEA 3BLYA 4OINF 1MH4A 1VQ4I 4BL0B 3RZOJ 4G6DA 5K5QA 1YRNB 3AG4H 5ICEA 4KMFA 2KJCA 1FT9A 3OYFA 1D5VA 4KITB 3OL4A 4U88A 3S2DJ 3PNVA 2RDPA 5DCFA 1HF0A 1X19A 3QODA 1DP3A 3HG9A 3OYDA 1DGRM 4XBFA 2IPQX 5H2FC 5EG0A 3I4MJ 2R7SA 2LP0A 4OAYA 4BGDA 1ZGJA 1K6YA 5EEAA 1XX5A 3W2AA 1O57A 2KQRA 2XPVA 4E7JA 4FX0A 2HVQA 4N4OB 2XRLA 1O3RA 2ZMEA 4OIOF 5B3SH 1TC3C 2QM3A 4EV0A 4RDUA 2JVHA 1WQ2A 3RPUD 1GT0C 3P9IA 3VWBA 4AIJA 2OZUA 4XKBA 3CLOA 3F6VA 4OIRF 3A0HC 2XSDC 5GAGJ 4JQFA 4FETA 1MMNA 4LLGF 4PJJA 1Y6IA 2YSRA 1GV5A 2GA2A 3OYBA 2DK8A 2AXTC 4XLAA 4IHWA 1JTYA 1W7PA 4E7IA 4Y4RA 5GTHC 3CJRB 5IOZA 2WAFA 1FTZA 2HOEA 3BTJA 1PDNC 5LHIA 3ZPLA 3M1CA 1CF7B 2P8TA 2ZXWH 4CCLA 5E1ZB 1HKQA 3FXQA 1YQAA 2JA8J 2KRFA 5F1JA 4XL9A 5LEKA 4C9YA 4Y3OA 3KYLA 1R49A 5AONA 4XR6A 1NK3P 2B7EA 3D0SA 1OPCA 2A5WA 2CU7A 4KIFA 5FRNA 3B73A 3MAJA 1I50J 2HQAA 2DJIA 3CCLI 3BT9A 4P55A 2HXIA 2K02A 2DFFA 4HSRA 5CVIA 4V2FA 2WY7Q 3DTIA 4DZJA 3FXKA 2CQKA 4BXFA 1YJ9I 1K78A 1YW7A 3ISPA 1SMYF 1T08B 2LFBA 2M8GX 1JJ8C 1ON2A 1G3WA 4DBRA 4YELA 1JKOC 5D5WB 2JN6A 3W2VA 2IAIA 3S3OA 1WJFA 2UXXA 3RTRA 2HTSA 2P6TA 3WG9A 4Q5SF 3JRHA 1VQPI 5JFRA 2Z5UA 5KHDA 4HNVA 3K9TA 2WAQN 4E7LA 3UKGA 4CICA 4OOIA 3MWMA 1J9IA 4A6EA 3HPHA 1TW2A 2YU3A 3R4KA 5HLTA 1AA7A 5F04A 2NVXJ 1ZRDA 2M9HA 1T0FC 2A5YB 1BR4A 3BQYA 3WU2C 3ABLH 3KETA 3V7CA 4QWQA 3LSIA 3QOPA 3OR1C 2J5PA 1SMTA 4L0ZB 2V1XA 3CUQC 4HV6A 3FMSA 4MIMA 5J3LA 2CUEA 4DW6A 1OQYA 4I76A 5E8IA 3KP6A 3QP5A 4CZZA 5J4VA 1MBJA 1K83J 3FM5A 3KYDB 4CSWA 3OYIA 3LL7A 3AG1H 3M4OJ 2OC6A 1IRFA 1OCTC 5DD4A 4BKXA 2IXSA 3SYTA 1G2HA 1IG7A 2MC3A 1WJBA 4FQGA 4U0VA 4YFKF 1D8JA 1VZ0A 3PUFA 2BW3B 3M9AA 4J01A 3S1RJ 2Y9YA 1X3ZB 2H6CA 5BPDA 2P0WA 3T8TA 3GTKJ 4QPOA 3ABMH 2DMNA 2LF7A 1X3WB 2EFWA 2LD5A 1F9NA 1YX5A 2Y31A 3K4NA 4I0BA 5ICFA 3SEZA 5FLVA 3DKXA 3CP8A 3H3VK 2R7VA 4EEFG 4B4CA 2WV0A 5KCMA 1FBUA 3J7YJ 2W85A 1YO5C 3ABUA 1IUYA 1J2XA 3ZR8X 3IHUA 1ETKA 2Q8KA 1PUEE 1T0FA 4Y7NJ 2L9NA 3JREA 1H8AC 3F3XA 2X6WA 3HOVJ 1OLTA 1WKMA 3D1NI 3K70C 3C7JA 2PMHA 1G4DA 1T6SA 4AD9A 4XKWA 1JTXA 4A12A 1ZRCA 3AL0B 2W4SA 3NAUA 1PUFA 3CUQA 3BROA 1ULYA 3OV8A 4I09A 2KDZA 2HKOA 2M4KA 4HLYA 2D1VA 1BJZA 2QEXI 2NVQJ 2PI0A 3RKYA 1R1TA 2GWRA 2FU4A 3TBIA 2F2EA 4BXUA 5IT9K 5E17F 2L7MP 3S2WA 4KYWA 1FOXA 3ZQ7A 2AHQA 1Y1VJ 3GF2A 4PCQA 2A07F 1P7IA 4ZC3A 1R5ID 2DOEA 3H92A 1VQ8I 1WJ5A 2P6SA 5EJCA 4KN7X 3ZOBA 1VQ9I 2PN6A 1ZLJA 1MNEA 1IRGA 1XGOA 3SQNA 1PP8F 5KAIC 1YW8A 2M34A 2CO5A 4DIQA 2R5YB 3S3NA 1AKHA 3E7LA 2YU9J 3LA2A 4BH9A 1WGXA 2VJIA 4C2MJ 1GXQA 3HSFA 2DT5A 4NDLA 4PJMA 5CVRA 1I3QJ 3SDGA 2JQ7A 2EIKH 2KT0A 3B6AA 1XCVA 4MEYF 4XK4A 2KJBA 2E2JJ 3ZGKA 2DT6A 2K3PA 3DEEA 3K0LA 3HXLA 3FXRA 2FQ3A 1ONVA 4IO9F 2FXAA 2AXLA 2KISA 4LJZF 2ICWG 2IGMA 3O8HA 2LBFB 5C44J 1FLIA 1MIJA 5L3FA 1QHGA 2XASA 3PJRA 3BOQA 4Z2YA 4A5MA 3IH3A 3JAMK 5HVQC 3GLLA 4UV8A 1ZAOA 1XGNA 4JX6A 4V2GA 1Y0NA 2JMWA 4RLFA 2E35A 2BXZA 2VJJA 1FMWA 3I5UA 1RRJA 2CSOA 1IN4A 5CQGA 1XTAA 3HHGA 4W97A 3IP4B 2DA7A 3I59B 3ONQA 5J40A 2XAQA 4J00A 1IGNA 3V8KA 2KRCA 1XB4A 1MNMC 1OMIA 4U0YA 5HDKA 2EZIA 3IUOA 4B47A 5JVGF 2Z9OA 2XUBA 3JTGA 1H0MA 1SEUA 1U6GA 3GTOJ 2W82A 1QRYA 2WAQA 3TO7A 3HRTA 1X1AA 5GPCA 2FOWA 2VPLA 3HGYA 1XDUA 4NB5A 2XHKA 2CV2A 3ZMTA 5KAFC 1BIAA 2GOXB 3CZ6A 4LB5A 4LLLA 3JCUC 2HDWA 1MBEA 2VQGA 5M3MJ 3U9GA 4AWXB 1P9QC 2V26A 1QPMA 2V1DA 2KHMA 4M3BA 2DBBA 5E1XA 4E4HA 3A01A 2BV6A 2A6EF 3I55I 3HSRA 2IGKA 3H9QA 1AU7A 2JTVA 2XGCA 4MFDA 4BQQA 3L2QA 3HOUJ 3CUOA 2CUFA 2D2WA 3D5RC 3OSFA 2NNNA 3H5RA 2DTZA 3HJEA 1BA5A 2HU9A 4IHTA 3IC7A 2JVGA 1D8KA 4BU2A 5AIPA 3SZGA 4ETSA 2IVMA 3WGGA 3JRFA 1WJEA 2EFNA 2AO9A 1O7LA 1MBFA 3OYEA 4I6ZA 3PO2J 4CXFA 1BIBA 1JUMA 2KIMA 2JA7J 1KYWA 3WTVC 2O8KA 2QVOA 1ZK8A 1TW3A 4XMYA 3X2QH 2E1MB 4CCOA 1SAXA 1VQ6I 2HYJA 1SD7A 4QTRA 4KICA 3VSKA 4F91B 1JHHA 3IAM2 4M9SA 2QA4I 2XVCA 1X4OA 4BJ5C 3K69A 1LE8A 1ZG5A 2V1NA 1XD7A 3CCQI 2L54A 2RKHA 4ITVA 1RNLA 5DCMA 4ZZLA 1Z91A 2HQ5A 4PJ0C 1JE8A 1B6AA 1A35A 2QQBA 2VKEA 4NUBA 2V9PA 4BHCA 4HX7A 1IO2A 4EQQA 3OS2A 3QWLA 4PK4A 1YRNA 2BY2A 4C3HJ 2DTRA 2BXYA 4IPAA 2P5VA 3FBNB 3D5LA 1X3UA 2QQ8A 2FD5A 1D1CA 2PEXA 4LOCA 4L18B 3WTTC 4GGGA 3ABTA 1X2NA 3CCSI 4KIBA 4DBQA 5J47A 2XC7A 3L9FA 4I01A 1FP1D 5D5VB 4IQJA 2JPCA 2O8XA 5FKMA 5JLWA 5FKKA 3J80K 1EH6A 2HFHA 3G3ZA 4M74A 1R71A 1HKSA 3E6DA 4KUMA 4BE0A 4WXCA 1ZKGA 2LTPA 3H0DA 1QA6A 4XOPA 5JLXA 4MO7A 4CCNA 4ZYAA 1N25A 4FISA 3HIFA 3E3VA 4RB3C 2XRNA 2EFOA 3CDIA 3K4KA 4XN0A 4S04A 3HEFA 5K7HA 3H5NA 4XLEA 4LG0A 2QZ8A 1ZH5A 3K2AA 4CYDA 4S05A 3OYGA 1KZHA 5CQEA 1CF7A 2PMUA 1MJAA 3HKZA 1KQ8A 1P7JA 2O3FA 1TTYA 2XV4S 5E79C 3ZQCA 4UUVA 1YS7A 4ESBA 2GM4A 5ICGA 1PP7U 4LITA 1HC8A 2WWYA 1ITYA 2W24A 4QIWN 5J6XA 5K1YA 3LA7A 1HW1A 1OR7C 5FLXZ 1UFMA 3GTMJ 4L9JA 5L3CA 4UVCA 3P5JA 4M71A 1HBXG 2VJ4A 3VYRB 2O0YA 3J81Z 2R93J 3BDDA 1S8NA 3DPTA 1LEAA 3FDYA 3KP2A 5CVVA 3JSOA 4HA8A 4BE2A 2HYFA 1PJRA 1I1SA 3VYUB 3TW7A 4ZH4F 4IL6C 1N78A 4IOCF 2R92J 1F43A 1FYLA 2CW7A 1X1CA 2ZXIA 3VB2A 4IHVA 2K40A 4KFCA 2IGOA 4DQ2A 3F23A 5FKLA 1O7FA 2MFZA 2LKSA 1OCZH 2EPFA 3CCMI 4E70A 3H36A 1G3TA 2JA6J 3ESWB 3BWGA 5FO5A 2KFDA 2FQ4A 4EM2A 1BI2A 2NS0A 3HBLA 3ZCOA 2XAJA 3F21A 3P9CA 3KP4A 3ELKA 5IP9J 3AL0C 3GTGJ 4L9NA 3K4MA 2K9NA 4EGZA 1ZRFA 3RYRA 3GTQJ 5FD6A 2QENA 1TWAJ 1G3YA 1VF9A 3BJAA 1OR7A 4IJAA 1AOYA 3FX3A 3VFZA 1BL0A 3CJQB 3WE3A 2F5EA 2L5QA 3BR2A 2A3SA 1USSA 1TT0A 2ZFWA 4DOZA 5J1RA 3M8JA 1W0UA 1YYVA 1RPWA 1HLVA 4A3MJ 5B5EC 3W6JB 1G3SA 2VBYA 5JVTA 1R1VA 3I0TA 4DYCA 1M1EB 3BZCA 3ZMDA 2I10A 1J75A 4N9HA 4F92B 1LFUP 3S3MA 2O61A 3BCBA 1YIJI 1FY7A 2QSFX 5GAEJ 5J4YA 2UWMA 5IOYA 3WTUC 3OL3A 3JRBA 1WH7A 3G2BA 1K7AA 1S29A 3OYAA 1X2MA 4IX7A 3EUKL 1OCRH 1XSXA 4UV9A 4G7HF 3N4MA 1VTNC 3TO9A 3VEPA 2E7XA 3DPUA 1P4XA 4O6JA 3OIPA 4ZYDA 5ILVA 3ZMVA 3S1QJ 4U87A 1BOBA 5FKOA 3OYCA 3MKYB 1ACIA 4BY7J 2Y0SA 1ODDA 3WG7H 5F6FA 4RGUA 1J59A 2HI3A 4M6XA 1QBJA 3CMYA 2FF4A 2KIFA 3R0AA 4A3CJ 3DV8A 4AVZA 3F8NA 2CWEA 1KU2A 2DMTA 4Y33A 4S0HB 2R7ZJ 3TGNA 1UHWA 3O3KA 2UV1A 1IV8A 1FOKA 1S7EA 3PNTA 2VC0A 3BR3A 3SXYA 4K2EA 1SD6A 3H9JA 4HF1A 2TDXA 3W2WA 5HS8A 1UB9A 1X58A 1HCRA 9ANTA 4UY8I 1S9HA 1DPRA 1RKWA 2ZJPF 2EZKA 2P5LC 1N77A 4XM3A 1ZYRF 1IJWC 1E2XA 2RNGA 4EJTA 1ZTRA 2JPBA 2R5YA 1XG1A 4UHTA 1RIOH 3F22A 5FB2A 1T39A 2O6GE 1OYWA 3CESA 1ENHA 3BG3A 2WA0A 2RN7A 2DYRH 5BMZA 5DEQA 3DLLF 2P5KA 2VKVA 3EUHC 1I39A 2M7AA 3NWSA 4HEA2 3T1BA 3V8JA 3ZN0A 2GAUA 1Z3YA 2YPRA 4G8XA 2MSYA 3RZDJ 5HODA 3TP0A 2AS5F 3KEQA 4OWRB 2JZYA 3GTPJ 2BE5F 1LQ1A 2MGQA 1Z3XA 2O9LA 4P96A 3HRUA 1ZR2A 2R5ZB 3TMOA 3F8FA 3C1DA 2EINH 3OYNA 1MKMA 1P4AA 2LBFA 4GYGA 4HX8A 2K85A 4L9TA 2DA5A 1W4MA 4D7NA 2XROA 1TZLA 3BR5A 1KA8A 2F6CA 1HSJA 3E0JB 1VNDA 4A3IJ 4HDVA 4UUSB 2R7UA 3DWLE 3P9KA 1Z6TA 1WJDA 2XB0X 4HZFA 2QBYB 4LGWA 3I59A 1IN6A 4NC7A 3K1PA 3L09A 1ORKA 2HKXA 3BJ6A 5D6FA 1I3AA 4OMZA 2KZGA 4F7ZA 2B9SA 2ZO4A 3VYSB 1W1WE 1NHAA 4L0YB 4G7OF 2K4BA 2E1MC 3W6VA 2FSWA 3E97A 3GVAA 2FA5A 4RB1A 1B72B 4DZPA 1YITI 3OYHA 2XF5A 1V4RA 1FIPA 3L2RA 4BE1A 1AWCA 3HSEA 4ZYHA 4A0XA 4QPQA 1POGA 4XN3A 3EUHA 4M6VA 5DDGA 3H0GJ 4CYCB 1YTYA 2DA1A 4XKCA 2M87A 2OCCH 1LVAA 2CFXA 1P4WA 1RR8C 1YFHA 5DD8A 3CTAA 2ELJA 2HXOA 4Y13A 2E19A 3LA3A 3QP6A 3JW4A 4B3AA 1A31A 1A6IA 3LAPA 2EZHA 1ETOA 3QPHA 4GCVA 4M73A 4BQNA 4BBRJ 2Q1ZB 1MD0A 2Y0MA 3CF2A 3T8RA 4JX4A 4HW0A 4A0YA 2EILH 5KK1A 2JJ7A 1DUXC 3GO5A 1FJLA 1P6RA 1TQPA 5HOOA 2XSJC 1HSTA 2ZJ2A 1TWFJ 2F5CA 2AQEA 5J8FA 4CGZA 4JX5A 4UVBA 5L3EA 5J1YA 2KLOA 4II2A 3OS0A 4MTDA 3G73A 3PIPF 4I98B 3CMAI 3ZMZA 2X1EA 3SFZA 3ABKH 3G4SI 3S14J 2BYVE 2CGPA 5M5WJ 2JUGA 5F1RA 4YRVA 2FBHA 3WU0A 2OCEA 1FSHA 4PGGA 4QSHA 4AIDA 2Y30A 2RNJA 1TWCJ 1AHDP 1U5TB 2LVSA 4LD5A 2XDVA 4B09A 4D9JA 3COAC 3Q3SA 2VOPA 1LFBA 4RAGA 3CC2I 2DOAA 3KPHA 3RJPA 2VOOA 3J7AO 2K9LA 2GBYA 3E1SA 1BI3A 3FISA 4LK0F 2LK2A 3BR0A 1YOVB 2B0LA 3GBGA 2EBIA 2RAEA 4Z6YA 1I5ZA 5D5UB 3EETA 3K4JA 3KEYA 1Z9CA 1F4KA 3K6GA 3G1LA 1D3YA 4HAMA 5IP6A 3LQRA 1LDJA 1OCOH 2KIUA 3RKQA 2ELKA 3BTCA 2BVMA 2EA2A 3ECOA 1GXPA 3GUDA 3SEQA 1R58A 3Q5FA 1NTCA 2D45A 2DA4A 1WCMJ 5A2QZ 2DT7B 1REPC 5M3FJ 5LFAA 3ZN1A 3LSJA 5BQTA 4HDUA 3BQZA 2VKDA 3TDZC 2K9MA 2HOTA 1ZGAA 1W5CC 2OF7A 3FWEA 3CMMA 5EGOB 3LSRA 3O2PE 1ERDA 1D0YA 4LG3A 5D6EA 2QLZA 2IGNA 2IW5A 3T5XA 1D1AA 1IN5A 1KONA 3FXMA 1L3LA 3FKIJ 2ID3A 3HDDA 3GYHX 2QQAA 2YS9A 3L2VA 1BN5A 3FMQA 2FEZA 3QYBA 3BZKA 3CCUI 4A3DJ 1A04A 4XONA 2L9VA 4XLFA 1SFUA 1TWGJ 2EB7A 3PSIA 1FBQA 1J0RA 2F5DA 2X9DA 3Q0UA 1W36C 3PUBA 3C3WA 2E1CA 1IDZA 3AG3H 2NVYJ 4A6DA 3FHNA 5FRMA 4DYQA 1MJBA 3GZNB 1JKRC 2C6YA 1MSEC 2DJNA 1T33A 4XLHA 4CUGA 1EF4A 3EQLF 4WF2A 2XAUA 2LYCA 3B02A 4Q4ZF 2L0KA 4I99C 2Y48A 3TOBA 2H27A 3MFKA 3HTSB 4BY1J 2MG4A 4XORA 3ZRGA 2LKXA 1WJCA 2DO7A 2G7HA 4F55A 2Q0OA 2M2EA 1FP2A 4G6QA 3HPGA 4FT8A 3I64A 2DCEA 3BG9A 2HZDA 4L9VA 4LLNA 1LNWA 2CUJA 2DYSH 1SVMA 4P5OA 5DUIA 3HKZN 3RDIA 3K1NA 4UXNA 6PAXA 1G6NA 1SC7A 1MJ9A 2H1KA 1LPQA 2FJ1A 3P7NA 2L02A 3TOAA 1LB2A 4EATA 3KP3A 3NEUA 4Q47A 4RB0A 2L3DA 2X4HA 3K2ZA 1BJAA 3CF5F 2STTA 2WY8Q 1FX7A 3R61A 4NQWB 2OUMA 1GHCA 3AKZA 1JT0A 1WI9A 1ZG3A 2W25A 2FUG2 3K4BA 1ZQ3P 4GXOA 1UELB 3DF8A 3IH4A 1JGGA 4XLPF 1ZGWA 2VODA 5EEGA 4N9IA 2DPDA 3CP2A 2HVSA 2KP6A 2ZXJA 4A93J 4HSTA 4HQEA 2VUMJ 1YS6A 1VQ5I 3HL2A 1IV6A 4IF4A 2RV8A 5AIQA 1P92A 2ECCA 2PQ8A 2R3SA 3O8GA 1MGTA 2XIGA 2CYYA 5FROA 3R6SA 3CCRI 2F4MB 2Y75A 2VT2A 2ZXHA 3ROUA 3JRAA 5GP9A 1U9NA 2F48A 2DN0A 4A3BJ 2LKPA 4BJ6C 2IRFG 2CQQA 4PUSA 2M5WA 3I4PA 4YIIA 4G9YA 4DGWB 4FTHA 2P81A 2R7OA 3L1PA 1D1BA 5E3LA 5DM7F 3BPXA 4HLXA 2V6EA 2NRAC 3IKVA 3CCYA 2M1BA 2RQQA 2Y2ZA 1IF1A 3LQQA 3IKTA 2HTJA 3MQ0A 1R7JA 4LIUA 4ANJA 4NNJA 3MVPA 1GLNA 3H3ZA 2PJRB 1TNSA 4IRGA 3JRDA 1DQUA 2VIXA 3ASOH 2ME0A 4ESJA 3LNQA 4Y52J 2HS5A 5DV5A 3SJMA 3M7GA 4CO8A 1R9TJ 2H1LA 3ZMUA 5KNLA 3EYYA 4NC6A 4XKVA 4XSXF 1MSFC 4ZYGA 2DDAA 1D0XA 5BOXA 3ERMA 1RUNA 2OQGA 5K7FA 3FK7A 3IV5A 5E3OA 4IHSA 3MZHA 1Y56A 2XAFA 5TISC 4B8XA 3TQNA 5HNHA 1YJWI 2VT3A 3OMYA 2CW0F 2OU2A 2PMZN 1Y1WJ 1RESA 2DXIA 2HPIA 5JR3A 3G71I 2YX4A 3GWZA 4C3JJ 1IUFA 1WFXA 3Q0WA 3U21A 3JRGA 4AM3A 3GZ5A 1JHFA 1ETXA 4YIRX 3E6MA 1ETQA 4RLQA 3A1YA 3AAFA 2P7CB 4YEJA 3RYPA 3HHHA 3DBLB 2Y0SN 4D1QA 1IRZA 2JRTA 3OIOA 4ENKA 2HYGD 1V5FA 4B48A 4IHXA 5CLSA 1IXCA 2X6OA 2CQXA 2OV7A 1WPKA 2JSCA 1T8IA 5E18F 3OS1A 3WTWC 1KQ0A 3RPQA 2WAEA 5E8GA 4UB6C 3SHFA 5L3BA 1S3JA 2ZCWA 2IT0A 2K9QA 4XNFA 2ZJRF 3HGGA 1R5HA 3IWFA 2DK5A 1VQ7I 1H9TA 2CQNA 3BR1A 1YX3A 4XLCA 3WGHA 1YI2I 3I4NJ 1YE9A 1H89C 1UHMA 1XGMA 4KNYA 3HOZJ 3HOWJ 5EDNA 2CW8A 4A3JJ 4M9ZA 3KLNA 4OAZA 1E3PA 2BHYA 1R4MB 2LY9A 3WTSC 2MH9A 3OYKA 1T56A 2DFHA 2QQ9A 3V42A 3CO6C 2ME6A 2R5ZA 3NARA 3HRMA 3SFIA 5L3GA 5E20A 2DI3A 2LMDA 3EPZA 1GVDA 2RVCA 5CYVA 2CV0A 3RQ4A 4EMSA 1K6OA 1BR2A 2ELHA 3J7AY 4EJWA 1FZPB 4XRSG 3G1MA 3RCOA 4C3IJ 1PVEA 3DLAA 2IS2A 1GVJA 1QVUA 1RKTA 5HLHA 1QNTA 2QBYA 3ECHA 4BUPA 3WTYC 2V6CA 2DMUA 1SVOA 3SZPA 5FD5A 5HDGA 3C2BA 2XAHA 3EDPA 3G1OA 4PSWA 4IEJA 2WB1N 1VQLI 3BC8A 4TV7A 2X6YA 1B72A 1JKQC 3DCFA 2J5OA 3VPRA 1OFCX 1A5JA 4P9FA 1R00A 1U5TC 2O03A 3HC7A 4CYCA 1X1DA 5C4XJ 3VODA 2M45A 1QPIA 4IRIA 3CCVI 2KKOA 1HA8A 1Z67A 3FHZA 2DQLA 1FPQA 2FBKA 1LFPA 2VASA 3W6KB 1AKHB 1U8BA 3CLQA 2H8RA 1V3FA 4NC8A 5ILUA 2XGXA 1NK2P 2GXBA 2LC2A 5IYBJ 1H88C 2XKPA 2KPMA 3S15J 2BOLA 1GDTA 1OYYA 2GOMA 2VQCA 4BYYA 5IP7J 5FLMJ 1YW9A 3U2RA 2K27A 1UJ8A 3QAHA 4A5NA 3MZYA 3W3CA 3HZJA 3H9GA 1TP4A 5EEHA 3V7SA 3JRIA 4E6KG 1ZG1A 3NRVA 4EVIA 3QRFF 2NYXA 4I7HA 4UUTA 2R7WA 3K10A 4Y17A 4HRIA 2E1OA 3FIWA 5HLGA 1XS9A 5CKTA 3DP7A 1Y8QB 1ETVA 2L9RA 2LLKA 4HF2A 2UZKA 2HQRA 3EUAA 2LY1A 2A05A 5H20A 2PG4A 4ZDLA 2YX7A 2BEOA 5IT9Z 2XGEA 1IZ1A 2NXNB 2IBDA 2FX0A 2NVUB 2ETHA 3H5AA 1TBXA 1Z05A 1K4TA 4LIVA 2MYSA 4M3EA 2EFPA 1U5TA 3TKYA 3PQKA 4ABZA 4CCMA 4C2TA 4IHYA 3QYEA 5ERIA 1WH5A 2EA4A 3N05A 3ZMSA 3M07A 4KA4A 2E2IJ 1TLHB 1Z0XA 2K9SA 4LFUA 1XMKA 2BW3A 4R8HA 4R1HA 4UNOA 4BNCA 2W7NA 3KFWX 3I56I 1OYIA 5HDNA 4ZTFA 2W1OA 4FX4A 2BY1A 4JP0A 2CFOA 1OKRA 2JT1A 2E34A 1UG2A 5F0CA 2IA1A 3DBHB 3F72A 4E7HA 4F93B 2PMZA 2X51A 3S2HJ 2P4WA 2ZNYA 4CH7A 2ZBKA 1Y0UA 1CQTA 1W36D 3Q0VA 2CH0A 4ENMA 4P1WA 1JI8A 2O7OA 1MMSA 3M8FA 1E3HA 2FNAA 4RB2C 3PNYA 2CRGA 4DNCA 4RGXA 5B1AH 3VOEA 4ASNA 2CUZA 4HG2A 2X6XA 4IVNA 5L3DA 4M6YA 2HOAA 4HBLA 5DUKA 2UXNA 4PZJA 2EH3A 5C4JJ 4MNUA 5LD2C 5D8KB 3JAMZ 1WI3A 1MBGA 5EGOA 1ZHFA 3CC7I 1XSVA 4XIDA 3LFKA 4A3FJ 2GZWA 3E5XA 5IYDJ 3HYIA 3RSNA 3DEUA 4YG2F 4ZYEA 2V4JC 3F6OA 3BZ6A 1T95A 5FFZA 1T98A 4U7BA 4CHUA 5IPAA 5D4RA 1X4PA 1B1BA 1BW5A 4IXAA 2XF6A 4B44A 3U1DA 2JRMA 3F8MA 4HOBA 3L2UA 4A3GJ 3OOPA 3GCMA 1S7OA 2RC4A 3IRRA 3ZQIA 3FM3A 4RAYA 4RGRA 2MA3A 3KP7A 3V4GA 2LG4A 1DGWY 1R23A 1DU6A 1A36A 3MKWB 3KLOA 1XGSA 2FMLA 3WHCA 4WCGA 4KT6A 4YIFA 4W1UA 3TEDA 3F0CA 2K86A 2XKOA 2DPUA 3MZ8A 2IS1A 1G59A 2DA3A 3KZZA 2G9WA 2TCTA 1SFKA 4F3QA 1FTTA 2Z16A 2V9KA 5CVJA 1TQMA 3I54A 1S7AA 2AQFA 2X0LA 2W84A 2GLOA 4GDFA 1FNNA 3V7RA 4BQAA 2BY0A 3B6CA 1ZR4A 1RC9A 1GUUA 2CJJA 2DFEA 1QZYA 2F4OB 3PSFA 5LBQA 4NQWA 1USTA 2ISZA 2JA2A 3C2HA 2OPTA 2CQ7A 5DTDA 5JHFA 3OYMA 1B9MA 2WB1A 3GXOA 3I53A 2E2HJ 1V5GA 3FF5A 4WWCA 3WE2A 2HOSA 3SZTA 1TT5B 2UUZA 3HUGB 4NHJA 4BDZA 4U0WA 1TWHJ 4PFPA 3CD6I 1O4XA 3DKYA 3KIOA 3LSGA 1B4AA 3FBIB 3VDXA 3ZQHA 3C18A 3QPSA 1BOAA 5LEJA 5EZHA 1U0JA 2PFBA 3MCZA 2BVLA 1VFCA 2E1NA 1X1PA 1KGSA 2EJRA 5IY5H 4M72A 2EIMH 4JBAA 5LHGA 3M3YJ 1O3TA 5DS9A 4LG0B 2MABA 3SDBA 2I8DA 3LSMA 1SD4A 4M3GA 3CC4I 2CS3A 2VE8A 3L7WA 2ECBA 5F0FA 4AYBA 2D1HA 2IP2A 1H9GA 1FEXA 1IN8A 3CDHA 3FXLA 4E7KA 2HDDA 2R7DA 3QPLA 3ZQLA 5BPIA 3ERED 1YIOA 2W48A 1HXDA 3D5SC 4MFEA 1BC8C 2PBIA 3K1MA 1BM9A 4UVAA 2E5NA 2KRHA 2LR8A 2P7VB 3CO7C 3CDLA 2RREA 2IA0A 2H09A 2PJRA 1BI1A 4FE7A 2EV6A 2DLLA 2VBZA 3J7ZI 3E6CC 1DPUA 2W00A 5LGNA 2FNPA 3DEWA 5K5OA 1DU0A 1VQNI 3BG7A 4IRHA 4EGYA 1E0EA 3NWTA 5CVUA 4CA0A 3KEOA 1ZLKA 3J80Z 2DAOA 2VBWA 2NS7A 4AVPA 2L9SA 2GQQA 1C0WA 1Z7UA 1JGSA 3KYCB 4BBSJ 1FYKA 2EZLA 4ON0A 3WU1B 3MD2A 1J09A 2VN2A 1HDDC 1MMGA 1SFXA 3DPLC 3E5QA 2E36A 2MBFA 3GFJA 3UNGC 4FASD 5HS7A 4JK1X 3OYJA 1OJLA 2O5RA 1YHQI 3U1KA 2X1CA 2XB5A 2ID6A 3HOTA 2X85A 1MBHA 2LOOA 2OA4A 2VQLA 2VJ5A 1SFOJ 2LRDA 2M30A 4N4NB 3RKWA 2MLKA 4RAFA 4EM1A 2ZNZA 5ICCA 4DYRA 1MMAA 2DMPA 2OAZA 3E6BA 3KCCA 5H6RA 2JA5J 3JSPA 1R36A 1F1ZA 5HLIA 2MLGA 2ADUA 3L00A 4EJOA 5ED4A 1BBYA 2KZVA 3LSHA 4MQ9F 3PIOF 3KP5A 1ZELA 4WXDA 4AU7A 2MD0A 2ESNA 4XRSA 2E60A 2HQNA 4MGRA 3GEZA 5FLXK 4IQ4A 1ZREA 4HV5A 1E17A 3BP8A 1R6RA 2GIVA 3FZVA 1XSDA 2DFIA 3GFIA 2HR3A 5LRRA 1BC7C 3OIQA 1I1GA 3J81K 3DU6A 2YR2A 4MHGA 3GZ6A 2NNYA 5F0HA 3M1EA 2L7FP 3ZXSA 2M0CA 5LGTA 1FWZA 1LEBA 3A2KA 3ML6A 2DA6A 4PSXA 3PFIA 3IWZA 2EV0A 1PYVA 2QSHX 1Z7LA 2WADA 1NH3A 3A0BC 4ENJA 4BACA 4KMUX 2Y9ZA 4FCYA 2Z3YA 5HS9A 2V1UA 4XLNF 5BNGA 3JRCA 4B3XA 2M3AA 2ZC2A 1SANA 3BTLA 1CGPA 3QOEA 4D0PA 3WGIA 4AC0A 5LRSA 1MDMB 4Q48A 1FMVA 1U9OA 1ZARA 3PL8A 1B8IB 2XF7A 5M5XJ 2M4GA 4M3DA 3JR9A 3IRQA 3VYTB 2QKLB 4LMYA 3LAJA 4C2UA 3BG5A 1HQCA 5J8CA 2FE3A 3HOSA 3HOYJ 1S5LC 2Q2EB 2IA2A 4V19K 3I9V2 2WC2A 3MEXA 1STZA 3TDUC 1V54H 5TGTA 4X0GA 1XC5A 3GW2A 4BEHB 1IN7A 2LDUA 2COMA 5LLQA 1EA3A 1L0OC 4XRFA 2QCOA 2BGCA 4IZZA 2VB6A 4GYIA 2V79A 4DJAA 1EH7A 4RS8A 1SVLA 1KU7A 2QYOA 2Z2SB 2LF8A 3KZIC 4KN4X 2BY3A 4RM2A 4D5FA 4L5EA 1VQOI 4PGHA 1VQMI 1R22A 4XSZF 4HNTA 3ZP5A 2IS6A 1Z21A 4B1RA 4CCJA 3T0YA 5F27A 3ULQB 5GTIC 5EG0B 2EV5A 1JJ6C 3UR3C 1XN7A 4E7ZA 3H3UA 1ON1A 1LDKB 2L7ZA 4KIGA 1FBSA 1SD5A 3BG6A 3BTIA 3IAS2 1Q1VA 2ZMEB 4KDPA 4A69C 2R7XA 3FK6A 2KIQA 1IW7F 4H0EA 1WJAA 4ZTJA 2PLYA 3DXJF 3F8CA 3LWFA 3ASNH 3TP3A 1N75A 1IC8A 4RGSA 4ZDOA 1A6QA 3S8PA 4R79A 2MW8A 4I02A 1W7PB 2ZFUA 1EH8A 2DMQA 5E3NA 2R0QC 3TL4X 1UCRA 2QKMB 1RZ4A 5C3EJ 3QYFA 2FOKA 3OY9A 2VKHA 5EYRA 3S1MJ 4MLOA 1JT6A 1FSEA 3CCJI 1XDSA 2HPMA 2GXAA 2WTEA 2G7UA 3QU6A 2PJPA 4A3EJ 1XPXA 1MW7A 1IAWA 2DU9A 3OOUA 3DFGA 2EWNA 4RAZA 1Y39A 1T2KA 1S72I 3S32A 4J19A 1WVRA 2KL4A 4BQOA 4HYEA 5B66C 5E1WA 1JXSA 3DTEA 5EF6A 1WWXA 4RM3A 3AFHA 4O3MA 5K7ZA 5LGUA 3KX2A 1G8XA 2R7TA 3H35A 1R5GA 2VXDA 3OYLA 2JK3A 1K78B 3OSGA 1WHUA 3A02A 4BAYA 4BS9A 4F52A 2MC4A 2H8WA 5FGMA 3A4CA 2NVTJ 4UB8C 3FXOA 2WV1A 2E71A 3GLXA 3TW6A 2QWWA 2LNBA 1P2FA 2I5UA 1FIAA 2ZSHB 3DBRB 4M3FA 2ZJQF 1BI0A 3RKXA 4OMYA 4HX4A 4AUXA 3Q9VA 4FHTA 1W7PD 2VE9A 3O6BB 1J5YA 2OTLI 1I27A 1E3OC 4WX9A 2EK5A 1NG6A 3MMYB 1BW6A 3F9KA 2B63J 4L5IA 1O3QA 2OQRA 1RETA 2R7QA 3S93A 1EV7A 2V9VA 5TJJA 1J7KA 4A3LJ 4XICA 5HNFA 3WTXC 1W5SA 1FC3A 1OISA 1ZN2A 2LREA 3DQVC 4O5VA 2LSOA 2GIZA 3I58A 1Z6RA 1K79A 2VONA 2H94A 1D0ZA 1ETWA 2PX9A 3VSLA 2YUSA 3RPUA 5CPRB 4C30A 2VLAA 3ZQQA 1TQIA 1YG2A 2RGVA 1QHHD 2Z99A 3RQIA 4M9XA 3WODF 1FYMA 1UZCA 2STWA 3BPVA 3ZQFA 2VPRA 3ZQGA 1V55H 3OWTA 1SAUA 2VBXA 2TRTA 2DOFA 2Z1DA 2F5FA 4YFNF 2K7LA 3HRSA 1K4SA 4I2OA 3MKLA 1HKTA 2OD5A 4IKFA 5CJ9A 2X1DA 4EJVA 4BDYA 1UG0A 2IJLA 2MD5A 1MZBA 3HTUA 3DKWA 1UHSA 1KU3A 1W5TA 1QZZA 4CZCA 2CG4A 1FOWA 1Y8RB 4L5JA 3E5UA 2CV1A 2M8EA 1EJ9A 1TNTA 2G0EA 1XMXA 3FKJA 2GXGA 2GA1A 1R4NB 1RI7A 5IYCJ 4JYKA 2R7RA 4G94A 5F08A 5LHHA 3CJTB 4E7SA 3PO3J 3HOXJ 3HUGA 5B1BH 4ZZDA 5M5YJ 2CMPA 1S6LA 2NS8A 1TL8A 4HF0A 4UUSA 1HW2A 2VL8A 1I6HJ 2NOGA 5GPAA 1MBKA 5DYMA 1PUFB 3CUQB 1MH3A 2ESHA 2V7FA 5D4SA 1U8RA 1O3SA 2MH2A 4XRMA 5JHUA 2L2OA 1KU9A 3R0JA 3S1NJ 5GADJ 4XOTA 2JUCA 3L2CA 1IDYA 5D8LB 4KT5C 2VI6A 1QO0D 4RMNA 1DDNA 3QPTA 3K4LA 4BHBA 4U7DA 2ACJA 1IXSB 2K5CA 4ENNA 1B9NA 1Q1HA 2W57A 5E3MA 3PQJA 1YLFA 3WHBA 5GAHJ 3A03A 1NG7A 2XAGA 4H4KC 5D5XB 2A6TA 1MNDA 3MKZA 2BHZA 4A2UA 2A68F 2DODA 3KE2A 4FE4A 4PDKA 4PJLA 3REOA 5TRDA 2KMUA 2VC1A 2ZKZA 3Q9SA 2L4AA 4MTEA 1X1BA 4HPQA 5BS6A 4KJZA 3RI4A 2HDCA 3LSKA 2A69F 3CJNA 2K3FA 1QVTA 2Y69H 3LSTA 2L4MA 3BCAA 4PFOA 1LUJB 2L01A 2F4IA 4CCKA 4AYBN 4A3KJ 1HDPA 1V5EA 2EFQA 3HM5A 4XQFA 3CCEI 1JUPA 1QGPA 1B59A 2HNHA 2OZ6A 2E5ZA 3QU3A 2N8GA 2R7FA 5K5RA 2A6HF 1I6XA 4X6AJ 1QU3A 5A2QK 5DM6F 2QF7A 2RQPA 5IT3A 4RA2A 1F5TA 2OTJI 3R60A 3OR2C 5JI6A 1LVKA 2OJED 3I3LA 1HW5A 2IEKA 5FFXA 2K4JA 1HOMA 4WXHA 2QSGX 3JTHA 4EJUA 3LFUA 3PM1A 1U2WA 3DU5A 3F8BA 1VI0A 2ZB9A 4LK1F 4BHPA 1SFEA 1MMDA 1GV2A 3MN2A 4LB6B 2LH9A 4GO1A 4HNUA 2HVRA 2Z33A 3DTKA 2HWVA 2JWTA 5FKNA 2COBA 2HGCA 5J1UA 1U3EM 4Y15A 4OU0A 3M8EA 3FXUA 2BZTA 4G7ZF 1UMQA 3GFMA 4JOMA 4PJNA 2R4GA 3HB9A 3GFLA 2NOJB 4WK8F 3K4CA 5FJ8J 2JSPA 3GTJJ 1T38A 1KYZA 4G12A 3BY6A 3I71A 1QQIA 2FMYA 3GMEA 5H6QA 4ESFA 1OCPA 1QZEA 3H1CA 1RUOA 1D5YA 2EQRA 2VQHA 3K70D 4GRIA 4A0ZA 1WRJA 2X48A 4MEXF 2LY2A 5EZGA 2FRHA 4G6TB 1DP7P 1FOYA 4X1EA 2A61A 2H6BA 3RIRA 1LKXA 3CQZJ 3S17J 2VXZA 1YJNI 1JUSA 3A01B 3EYIA 2IS4A 2NAZA 1ETYA 4AIHA 1XCBA 2D5VA 2FBIA 4CDGA 1APLC 4NBQA 3WTZA 5F64A 2KDOA 4D5CA 4I0AA 3LOCA 3FXJA 1K61A 5KVRA 2DDBA 2OBPA 2F5VA 4N0BA 2HEOA 1Z77A 1WSUA 3BJOA 2ISYA 2XPWA 4MQVA 1VQKI 3K7AJ 3IL2A 2XGDA 4D7MA 3FMRA 1IXRC 1W0TA 4BJTA 3LMMA 4YFXF 1LJ9A 3LSPA 3N97A 2ZSIB 3G6EI 2ZMEC 3IH2A 3GX4X 1MDMA 4BXXJ 2DQRA 4P9UA 3V8LA 1B8IA 4QLCU 1RR7A
chains in the Genus database with same CATH topology
3CCEI 3I55I 4IOAF 3CCRI 1FOXA 5DM6F 1VQPI 1VQ8I 2OTJI 3CMEI 3PIOF 1YITI 1HC8A 1ACIA 1VQ9I 3I56I 5DM7F 3CD6I 1VQ4I 2E34A 3CCUI 2JQ7A 1FOWA 1VQ6I 4IOCF 1MMSA 3CCJI 3CC4I 4UY8I 4IO9F 2QA4I 2ZJPF 1VQLI 3CJTB 3CCQI 3CCMI 3CC7I 1Y39A 1S72I 3PIPF 1YJWI 3CMAI 3CCVI 3G4SI 2E35A 5GAGJ 1FOYA 3G71I 3DLLF 5GADJ 1YJNI 3J7ZI 1VQNI 2H8WA 3CCSI 3CF5F 5GAHJ 3J7YJ 5JVGF 2ZJQF 3CC2I 2NXNB 4V19K 2FOWA 2OTLI 1QA6A 1VQKI 3CCLI 2E36A 2K3FA 2ZJRF 3G6EI 1YHQI 1YIJI 1VQ7I 1VQ5I 5GAEJ 1YI2I 1YJ9I 1VQOI 1VQMI 2QEXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE I;  3I55 I;  4IOA F;  3CCR I;  1FOX A;  5DM6 F;  1VQP I;  1VQ8 I;  2OTJ I;  3CME I;  3PIO F;  1YIT I;  1HC8 A;  1ACI A;  1VQ9 I;  3I56 I;  5DM7 F;  3CD6 I;  1VQ4 I;  2E34 A;  3CCU I;  2JQ7 A;  1FOW A;  1VQ6 I;  4IOC F;  1MMS A;  3CCJ I;  3CC4 I;  4UY8 I;  4IO9 F;  2QA4 I;  2ZJP F;  1VQL I;  3CJT B;  3CCQ I;  3CCM I;  3CC7 I;  1Y39 A;  1S72 I;  3PIP F;  1YJW I;  3CMA I;  3CCV I;  3G4S I;  2E35 A;  5GAG J;  1FOY A;  3G71 I;  3DLL F;  5GAD J;  1YJN I;  3J7Z I;  1VQN I;  2H8W A;  3CCS I;  3CF5 F;  5GAH J;  3J7Y J;  5JVG F;  2ZJQ F;  3CC2 I;  2NXN B;  4V19 K;  2FOW A;  2OTL I;  1QA6 A;  1VQK I;  3CCL I;  2E36 A;  2K3F A;  2ZJR F;  3G6E I;  1YHQ I;  1YIJ I;  1VQ7 I;  1VQ5 I;  5GAE J;  1YI2 I;  1YJ9 I;  1VQO I;  1VQM I;  2QEX I; 
#chains in the Genus database with same CATH topology
 3AG2 H;  1R1U A;  1U78 A;  3TO6 A;  3KZY A;  2WBM A;  1OCC H;  3QQA A;  2DA2 A;  4RBO A;  4IOA F;  3PFY A;  1UAA A;  4ZJZ A;  1BR1 A;  1F36 A;  3C2G A;  4KIS A;  3GTL J;  4EM0 B;  2EIJ H;  3NQO A;  2L7K A;  4OIP F;  4GFB A;  1XMA A;  5ILS A;  2QGU A;  2Q2E A;  3BR6 A;  2XPU A;  2BBY A;  1LE8 B;  4HQM A;  3CME I;  1JKP C;  1IRX A;  4AIK A;  2HZT A;  2M0M A;  5DCM B;  3S16 J;  1KQ9 A;  2DW4 A;  4ZDP A;  4B43 A;  4BEH A;  4OIQ F;  1Z1D A;  1LDD A;  2E7W A;  2QUF A;  3L2W A;  1WZ2 A;  2M7B A;  4II3 A;  1EKE A;  3BLY A;  4OIN F;  1MH4 A;  1VQ4 I;  4BL0 B;  3RZO J;  4G6D A;  5K5Q A;  1YRN B;  3AG4 H;  5ICE A;  4KMF A;  2KJC A;  1FT9 A;  3OYF A;  1D5V A;  4KIT B;  3OL4 A;  4U88 A;  3S2D J;  3PNV A;  2RDP A;  5DCF A;  1HF0 A;  1X19 A;  3QOD A;  1DP3 A;  3HG9 A;  3OYD A;  1DGR M;  4XBF A;  2IPQ X;  5H2F C;  5EG0 A;  3I4M J;  2R7S A;  2LP0 A;  4OAY A;  4BGD A;  1ZGJ A;  1K6Y A;  5EEA A;  1XX5 A;  3W2A A;  1O57 A;  2KQR A;  2XPV A;  4E7J A;  4FX0 A;  2HVQ A;  4N4O B;  2XRL A;  1O3R A;  2ZME A;  4OIO F;  5B3S H;  1TC3 C;  2QM3 A;  4EV0 A;  4RDU A;  2JVH A;  1WQ2 A;  3RPU D;  1GT0 C;  3P9I A;  3VWB A;  4AIJ A;  2OZU A;  4XKB A;  3CLO A;  3F6V A;  4OIR F;  3A0H C;  2XSD C;  5GAG J;  4JQF A;  4FET A;  1MMN A;  4LLG F;  4PJJ A;  1Y6I A;  2YSR A;  1GV5 A;  2GA2 A;  3OYB A;  2DK8 A;  2AXT C;  4XLA A;  4IHW A;  1JTY A;  1W7P A;  4E7I A;  4Y4R A;  5GTH C;  3CJR B;  5IOZ A;  2WAF A;  1FTZ A;  2HOE A;  3BTJ A;  1PDN C;  5LHI A;  3ZPL A;  3M1C A;  1CF7 B;  2P8T A;  2ZXW H;  4CCL A;  5E1Z B;  1HKQ A;  3FXQ A;  1YQA A;  2JA8 J;  2KRF A;  5F1J A;  4XL9 A;  5LEK A;  4C9Y A;  4Y3O A;  3KYL A;  1R49 A;  5AON A;  4XR6 A;  1NK3 P;  2B7E A;  3D0S A;  1OPC A;  2A5W A;  2CU7 A;  4KIF A;  5FRN A;  3B73 A;  3MAJ A;  1I50 J;  2HQA A;  2DJI A;  3CCL I;  3BT9 A;  4P55 A;  2HXI A;  2K02 A;  2DFF A;  4HSR A;  5CVI A;  4V2F A;  2WY7 Q;  3DTI A;  4DZJ A;  3FXK A;  2CQK A;  4BXF A;  1YJ9 I;  1K78 A;  1YW7 A;  3ISP A;  1SMY F;  1T08 B;  2LFB A;  2M8G X;  1JJ8 C;  1ON2 A;  1G3W A;  4DBR A;  4YEL A;  1JKO C;  5D5W B;  2JN6 A;  3W2V A;  2IAI A;  3S3O A;  1WJF A;  2UXX A;  3RTR A;  2HTS A;  2P6T A;  3WG9 A;  4Q5S F;  3JRH A;  1VQP I;  5JFR A;  2Z5U A;  5KHD A;  4HNV A;  3K9T A;  2WAQ N;  4E7L A;  3UKG A;  4CIC A;  4OOI A;  3MWM A;  1J9I A;  4A6E A;  3HPH A;  1TW2 A;  2YU3 A;  3R4K A;  5HLT A;  1AA7 A;  5F04 A;  2NVX J;  1ZRD A;  2M9H A;  1T0F C;  2A5Y B;  1BR4 A;  3BQY A;  3WU2 C;  3ABL H;  3KET A;  3V7C A;  4QWQ A;  3LSI A;  3QOP A;  3OR1 C;  2J5P A;  1SMT A;  4L0Z B;  2V1X A;  3CUQ C;  4HV6 A;  3FMS A;  4MIM A;  5J3L A;  2CUE A;  4DW6 A;  1OQY A;  4I76 A;  5E8I A;  3KP6 A;  3QP5 A;  4CZZ A;  5J4V A;  1MBJ A;  1K83 J;  3FM5 A;  3KYD B;  4CSW A;  3OYI A;  3LL7 A;  3AG1 H;  3M4O J;  2OC6 A;  1IRF A;  1OCT C;  5DD4 A;  4BKX A;  2IXS A;  3SYT A;  1G2H A;  1IG7 A;  2MC3 A;  1WJB A;  4FQG A;  4U0V A;  4YFK F;  1D8J A;  1VZ0 A;  3PUF A;  2BW3 B;  3M9A A;  4J01 A;  3S1R J;  2Y9Y A;  1X3Z B;  2H6C A;  5BPD A;  2P0W A;  3T8T A;  3GTK J;  4QPO A;  3ABM H;  2DMN A;  2LF7 A;  1X3W B;  2EFW A;  2LD5 A;  1F9N A;  1YX5 A;  2Y31 A;  3K4N A;  4I0B A;  5ICF A;  3SEZ A;  5FLV A;  3DKX A;  3CP8 A;  3H3V K;  2R7V A;  4EEF G;  4B4C A;  2WV0 A;  5KCM A;  1FBU A;  3J7Y J;  2W85 A;  1YO5 C;  3ABU A;  1IUY A;  1J2X A;  3ZR8 X;  3IHU A;  1ETK A;  2Q8K A;  1PUE E;  1T0F A;  4Y7N J;  2L9N A;  3JRE A;  1H8A C;  3F3X A;  2X6W A;  3HOV J;  1OLT A;  1WKM A;  3D1N I;  3K70 C;  3C7J A;  2PMH A;  1G4D A;  1T6S A;  4AD9 A;  4XKW A;  1JTX A;  4A12 A;  1ZRC A;  3AL0 B;  2W4S A;  3NAU A;  1PUF A;  3CUQ A;  3BRO A;  1ULY A;  3OV8 A;  4I09 A;  2KDZ A;  2HKO A;  2M4K A;  4HLY A;  2D1V A;  1BJZ A;  2QEX I;  2NVQ J;  2PI0 A;  3RKY A;  1R1T A;  2GWR A;  2FU4 A;  3TBI A;  2F2E A;  4BXU A;  5IT9 K;  5E17 F;  2L7M P;  3S2W A;  4KYW A;  1FOX A;  3ZQ7 A;  2AHQ A;  1Y1V J;  3GF2 A;  4PCQ A;  2A07 F;  1P7I A;  4ZC3 A;  1R5I D;  2DOE A;  3H92 A;  1VQ8 I;  1WJ5 A;  2P6S A;  5EJC A;  4KN7 X;  3ZOB A;  1VQ9 I;  2PN6 A;  1ZLJ A;  1MNE A;  1IRG A;  1XGO A;  3SQN A;  1PP8 F;  5KAI C;  1YW8 A;  2M34 A;  2CO5 A;  4DIQ A;  2R5Y B;  3S3N A;  1AKH A;  3E7L A;  2YU9 J;  3LA2 A;  4BH9 A;  1WGX A;  2VJI A;  4C2M J;  1GXQ A;  3HSF A;  2DT5 A;  4NDL A;  4PJM A;  5CVR A;  1I3Q J;  3SDG A;  2JQ7 A;  2EIK H;  2KT0 A;  3B6A A;  1XCV A;  4MEY F;  4XK4 A;  2KJB A;  2E2J J;  3ZGK A;  2DT6 A;  2K3P A;  3DEE A;  3K0L A;  3HXL A;  3FXR A;  2FQ3 A;  1ONV A;  4IO9 F;  2FXA A;  2AXL A;  2KIS A;  4LJZ F;  2ICW G;  2IGM A;  3O8H A;  2LBF B;  5C44 J;  1FLI A;  1MIJ A;  5L3F A;  1QHG A;  2XAS A;  3PJR A;  3BOQ A;  4Z2Y A;  4A5M A;  3IH3 A;  3JAM K;  5HVQ C;  3GLL A;  4UV8 A;  1ZAO A;  1XGN A;  4JX6 A;  4V2G A;  1Y0N A;  2JMW A;  4RLF A;  2E35 A;  2BXZ A;  2VJJ A;  1FMW A;  3I5U A;  1RRJ A;  2CSO A;  1IN4 A;  5CQG A;  1XTA A;  3HHG A;  4W97 A;  3IP4 B;  2DA7 A;  3I59 B;  3ONQ A;  5J40 A;  2XAQ A;  4J00 A;  1IGN A;  3V8K A;  2KRC A;  1XB4 A;  1MNM C;  1OMI A;  4U0Y A;  5HDK A;  2EZI A;  3IUO A;  4B47 A;  5JVG F;  2Z9O A;  2XUB A;  3JTG A;  1H0M A;  1SEU A;  1U6G A;  3GTO J;  2W82 A;  1QRY A;  2WAQ A;  3TO7 A;  3HRT A;  1X1A A;  5GPC A;  2FOW A;  2VPL A;  3HGY A;  1XDU A;  4NB5 A;  2XHK A;  2CV2 A;  3ZMT A;  5KAF C;  1BIA A;  2GOX B;  3CZ6 A;  4LB5 A;  4LLL A;  3JCU C;  2HDW A;  1MBE A;  2VQG A;  5M3M J;  3U9G A;  4AWX B;  1P9Q C;  2V26 A;  1QPM A;  2V1D A;  2KHM A;  4M3B A;  2DBB A;  5E1X A;  4E4H A;  3A01 A;  2BV6 A;  2A6E F;  3I55 I;  3HSR A;  2IGK A;  3H9Q A;  1AU7 A;  2JTV A;  2XGC A;  4MFD A;  4BQQ A;  3L2Q A;  3HOU J;  3CUO A;  2CUF A;  2D2W A;  3D5R C;  3OSF A;  2NNN A;  3H5R A;  2DTZ A;  3HJE A;  1BA5 A;  2HU9 A;  4IHT A;  3IC7 A;  2JVG A;  1D8K A;  4BU2 A;  5AIP A;  3SZG A;  4ETS A;  2IVM A;  3WGG A;  3JRF A;  1WJE A;  2EFN A;  2AO9 A;  1O7L A;  1MBF A;  3OYE A;  4I6Z A;  3PO2 J;  4CXF A;  1BIB A;  1JUM A;  2KIM A;  2JA7 J;  1KYW A;  3WTV C;  2O8K A;  2QVO A;  1ZK8 A;  1TW3 A;  4XMY A;  3X2Q H;  2E1M B;  4CCO A;  1SAX A;  1VQ6 I;  2HYJ A;  1SD7 A;  4QTR A;  4KIC A;  3VSK A;  4F91 B;  1JHH A;  3IAM 2;  4M9S A;  2QA4 I;  2XVC A;  1X4O A;  4BJ5 C;  3K69 A;  1LE8 A;  1ZG5 A;  2V1N A;  1XD7 A;  3CCQ I;  2L54 A;  2RKH A;  4ITV A;  1RNL A;  5DCM A;  4ZZL A;  1Z91 A;  2HQ5 A;  4PJ0 C;  1JE8 A;  1B6A A;  1A35 A;  2QQB A;  2VKE A;  4NUB A;  2V9P A;  4BHC A;  4HX7 A;  1IO2 A;  4EQQ A;  3OS2 A;  3QWL A;  4PK4 A;  1YRN A;  2BY2 A;  4C3H J;  2DTR A;  2BXY A;  4IPA A;  2P5V A;  3FBN B;  3D5L A;  1X3U A;  2QQ8 A;  2FD5 A;  1D1C A;  2PEX A;  4LOC A;  4L18 B;  3WTT C;  4GGG A;  3ABT A;  1X2N A;  3CCS I;  4KIB A;  4DBQ A;  5J47 A;  2XC7 A;  3L9F A;  4I01 A;  1FP1 D;  5D5V B;  4IQJ A;  2JPC A;  2O8X A;  5FKM A;  5JLW A;  5FKK A;  3J80 K;  1EH6 A;  2HFH A;  3G3Z A;  4M74 A;  1R71 A;  1HKS A;  3E6D A;  4KUM A;  4BE0 A;  4WXC A;  1ZKG A;  2LTP A;  3H0D A;  1QA6 A;  4XOP A;  5JLX A;  4MO7 A;  4CCN A;  4ZYA A;  1N25 A;  4FIS A;  3HIF A;  3E3V A;  4RB3 C;  2XRN A;  2EFO A;  3CDI A;  3K4K A;  4XN0 A;  4S04 A;  3HEF A;  5K7H A;  3H5N A;  4XLE A;  4LG0 A;  2QZ8 A;  1ZH5 A;  3K2A A;  4CYD A;  4S05 A;  3OYG A;  1KZH A;  5CQE A;  1CF7 A;  2PMU A;  1MJA A;  3HKZ A;  1KQ8 A;  1P7J A;  2O3F A;  1TTY A;  2XV4 S;  5E79 C;  3ZQC A;  4UUV A;  1YS7 A;  4ESB A;  2GM4 A;  5ICG A;  1PP7 U;  4LIT A;  1HC8 A;  2WWY A;  1ITY A;  2W24 A;  4QIW N;  5J6X A;  5K1Y A;  3LA7 A;  1HW1 A;  1OR7 C;  5FLX Z;  1UFM A;  3GTM J;  4L9J A;  5L3C A;  4UVC A;  3P5J A;  4M71 A;  1HBX G;  2VJ4 A;  3VYR B;  2O0Y A;  3J81 Z;  2R93 J;  3BDD A;  1S8N A;  3DPT A;  1LEA A;  3FDY A;  3KP2 A;  5CVV A;  3JSO A;  4HA8 A;  4BE2 A;  2HYF A;  1PJR A;  1I1S A;  3VYU B;  3TW7 A;  4ZH4 F;  4IL6 C;  1N78 A;  4IOC F;  2R92 J;  1F43 A;  1FYL A;  2CW7 A;  1X1C A;  2ZXI A;  3VB2 A;  4IHV A;  2K40 A;  4KFC A;  2IGO A;  4DQ2 A;  3F23 A;  5FKL A;  1O7F A;  2MFZ A;  2LKS A;  1OCZ H;  2EPF A;  3CCM I;  4E70 A;  3H36 A;  1G3T A;  2JA6 J;  3ESW B;  3BWG A;  5FO5 A;  2KFD A;  2FQ4 A;  4EM2 A;  1BI2 A;  2NS0 A;  3HBL A;  3ZCO A;  2XAJ A;  3F21 A;  3P9C A;  3KP4 A;  3ELK A;  5IP9 J;  3AL0 C;  3GTG J;  4L9N A;  3K4M A;  2K9N A;  4EGZ A;  1ZRF A;  3RYR A;  3GTQ J;  5FD6 A;  2QEN A;  1TWA J;  1G3Y A;  1VF9 A;  3BJA A;  1OR7 A;  4IJA A;  1AOY A;  3FX3 A;  3VFZ A;  1BL0 A;  3CJQ B;  3WE3 A;  2F5E A;  2L5Q A;  3BR2 A;  2A3S A;  1USS A;  1TT0 A;  2ZFW A;  4DOZ A;  5J1R A;  3M8J A;  1W0U A;  1YYV A;  1RPW A;  1HLV A;  4A3M J;  5B5E C;  3W6J B;  1G3S A;  2VBY A;  5JVT A;  1R1V A;  3I0T A;  4DYC A;  1M1E B;  3BZC A;  3ZMD A;  2I10 A;  1J75 A;  4N9H A;  4F92 B;  1LFU P;  3S3M A;  2O61 A;  3BCB A;  1YIJ I;  1FY7 A;  2QSF X;  5GAE J;  5J4Y A;  2UWM A;  5IOY A;  3WTU C;  3OL3 A;  3JRB A;  1WH7 A;  3G2B A;  1K7A A;  1S29 A;  3OYA A;  1X2M A;  4IX7 A;  3EUK L;  1OCR H;  1XSX A;  4UV9 A;  4G7H F;  3N4M A;  1VTN C;  3TO9 A;  3VEP A;  2E7X A;  3DPU A;  1P4X A;  4O6J A;  3OIP A;  4ZYD A;  5ILV A;  3ZMV A;  3S1Q J;  4U87 A;  1BOB A;  5FKO A;  3OYC A;  3MKY B;  1ACI A;  4BY7 J;  2Y0S A;  1ODD A;  3WG7 H;  5F6F A;  4RGU A;  1J59 A;  2HI3 A;  4M6X A;  1QBJ A;  3CMY A;  2FF4 A;  2KIF A;  3R0A A;  4A3C J;  3DV8 A;  4AVZ A;  3F8N A;  2CWE A;  1KU2 A;  2DMT A;  4Y33 A;  4S0H B;  2R7Z J;  3TGN A;  1UHW A;  3O3K A;  2UV1 A;  1IV8 A;  1FOK A;  1S7E A;  3PNT A;  2VC0 A;  3BR3 A;  3SXY A;  4K2E A;  1SD6 A;  3H9J A;  4HF1 A;  2TDX A;  3W2W A;  5HS8 A;  1UB9 A;  1X58 A;  1HCR A;  9ANT A;  4UY8 I;  1S9H A;  1DPR A;  1RKW A;  2ZJP F;  2EZK A;  2P5L C;  1N77 A;  4XM3 A;  1ZYR F;  1IJW C;  1E2X A;  2RNG A;  4EJT A;  1ZTR A;  2JPB A;  2R5Y A;  1XG1 A;  4UHT A;  1RIO H;  3F22 A;  5FB2 A;  1T39 A;  2O6G E;  1OYW A;  3CES A;  1ENH A;  3BG3 A;  2WA0 A;  2RN7 A;  2DYR H;  5BMZ A;  5DEQ A;  3DLL F;  2P5K A;  2VKV A;  3EUH C;  1I39 A;  2M7A A;  3NWS A;  4HEA 2;  3T1B A;  3V8J A;  3ZN0 A;  2GAU A;  1Z3Y A;  2YPR A;  4G8X A;  2MSY A;  3RZD J;  5HOD A;  3TP0 A;  2AS5 F;  3KEQ A;  4OWR B;  2JZY A;  3GTP J;  2BE5 F;  1LQ1 A;  2MGQ A;  1Z3X A;  2O9L A;  4P96 A;  3HRU A;  1ZR2 A;  2R5Z B;  3TMO A;  3F8F A;  3C1D A;  2EIN H;  3OYN A;  1MKM A;  1P4A A;  2LBF A;  4GYG A;  4HX8 A;  2K85 A;  4L9T A;  2DA5 A;  1W4M A;  4D7N A;  2XRO A;  1TZL A;  3BR5 A;  1KA8 A;  2F6C A;  1HSJ A;  3E0J B;  1VND A;  4A3I J;  4HDV A;  4UUS B;  2R7U A;  3DWL E;  3P9K A;  1Z6T A;  1WJD A;  2XB0 X;  4HZF A;  2QBY B;  4LGW A;  3I59 A;  1IN6 A;  4NC7 A;  3K1P A;  3L09 A;  1ORK A;  2HKX A;  3BJ6 A;  5D6F A;  1I3A A;  4OMZ A;  2KZG A;  4F7Z A;  2B9S A;  2ZO4 A;  3VYS B;  1W1W E;  1NHA A;  4L0Y B;  4G7O F;  2K4B A;  2E1M C;  3W6V A;  2FSW A;  3E97 A;  3GVA A;  2FA5 A;  4RB1 A;  1B72 B;  4DZP A;  1YIT I;  3OYH A;  2XF5 A;  1V4R A;  1FIP A;  3L2R A;  4BE1 A;  1AWC A;  3HSE A;  4ZYH A;  4A0X A;  4QPQ A;  1POG A;  4XN3 A;  3EUH A;  4M6V A;  5DDG A;  3H0G J;  4CYC B;  1YTY A;  2DA1 A;  4XKC A;  2M87 A;  2OCC H;  1LVA A;  2CFX A;  1P4W A;  1RR8 C;  1YFH A;  5DD8 A;  3CTA A;  2ELJ A;  2HXO A;  4Y13 A;  2E19 A;  3LA3 A;  3QP6 A;  3JW4 A;  4B3A A;  1A31 A;  1A6I A;  3LAP A;  2EZH A;  1ETO A;  3QPH A;  4GCV A;  4M73 A;  4BQN A;  4BBR J;  2Q1Z B;  1MD0 A;  2Y0M A;  3CF2 A;  3T8R A;  4JX4 A;  4HW0 A;  4A0Y A;  2EIL H;  5KK1 A;  2JJ7 A;  1DUX C;  3GO5 A;  1FJL A;  1P6R A;  1TQP A;  5HOO A;  2XSJ C;  1HST A;  2ZJ2 A;  1TWF J;  2F5C A;  2AQE A;  5J8F A;  4CGZ A;  4JX5 A;  4UVB A;  5L3E A;  5J1Y A;  2KLO A;  4II2 A;  3OS0 A;  4MTD A;  3G73 A;  3PIP F;  4I98 B;  3CMA I;  3ZMZ A;  2X1E A;  3SFZ A;  3ABK H;  3G4S I;  3S14 J;  2BYV E;  2CGP A;  5M5W J;  2JUG A;  5F1R A;  4YRV A;  2FBH A;  3WU0 A;  2OCE A;  1FSH A;  4PGG A;  4QSH A;  4AID A;  2Y30 A;  2RNJ A;  1TWC J;  1AHD P;  1U5T B;  2LVS A;  4LD5 A;  2XDV A;  4B09 A;  4D9J A;  3COA C;  3Q3S A;  2VOP A;  1LFB A;  4RAG A;  3CC2 I;  2DOA A;  3KPH A;  3RJP A;  2VOO A;  3J7A O;  2K9L A;  2GBY A;  3E1S A;  1BI3 A;  3FIS A;  4LK0 F;  2LK2 A;  3BR0 A;  1YOV B;  2B0L A;  3GBG A;  2EBI A;  2RAE A;  4Z6Y A;  1I5Z A;  5D5U B;  3EET A;  3K4J A;  3KEY A;  1Z9C A;  1F4K A;  3K6G A;  3G1L A;  1D3Y A;  4HAM A;  5IP6 A;  3LQR A;  1LDJ A;  1OCO H;  2KIU A;  3RKQ A;  2ELK A;  3BTC A;  2BVM A;  2EA2 A;  3ECO A;  1GXP A;  3GUD A;  3SEQ A;  1R58 A;  3Q5F A;  1NTC A;  2D45 A;  2DA4 A;  1WCM J;  5A2Q Z;  2DT7 B;  1REP C;  5M3F J;  5LFA A;  3ZN1 A;  3LSJ A;  5BQT A;  4HDU A;  3BQZ A;  2VKD A;  3TDZ C;  2K9M A;  2HOT A;  1ZGA A;  1W5C C;  2OF7 A;  3FWE A;  3CMM A;  5EGO B;  3LSR A;  3O2P E;  1ERD A;  1D0Y A;  4LG3 A;  5D6E A;  2QLZ A;  2IGN A;  2IW5 A;  3T5X A;  1D1A A;  1IN5 A;  1KON A;  3FXM A;  1L3L A;  3FKI J;  2ID3 A;  3HDD A;  3GYH X;  2QQA A;  2YS9 A;  3L2V A;  1BN5 A;  3FMQ A;  2FEZ A;  3QYB A;  3BZK A;  3CCU I;  4A3D J;  1A04 A;  4XON A;  2L9V A;  4XLF A;  1SFU A;  1TWG J;  2EB7 A;  3PSI A;  1FBQ A;  1J0R A;  2F5D A;  2X9D A;  3Q0U A;  1W36 C;  3PUB A;  3C3W A;  2E1C A;  1IDZ A;  3AG3 H;  2NVY J;  4A6D A;  3FHN A;  5FRM A;  4DYQ A;  1MJB A;  3GZN B;  1JKR C;  2C6Y A;  1MSE C;  2DJN A;  1T33 A;  4XLH A;  4CUG A;  1EF4 A;  3EQL F;  4WF2 A;  2XAU A;  2LYC A;  3B02 A;  4Q4Z F;  2L0K A;  4I99 C;  2Y48 A;  3TOB A;  2H27 A;  3MFK A;  3HTS B;  4BY1 J;  2MG4 A;  4XOR A;  3ZRG A;  2LKX A;  1WJC A;  2DO7 A;  2G7H A;  4F55 A;  2Q0O A;  2M2E A;  1FP2 A;  4G6Q A;  3HPG A;  4FT8 A;  3I64 A;  2DCE A;  3BG9 A;  2HZD A;  4L9V A;  4LLN A;  1LNW A;  2CUJ A;  2DYS H;  1SVM A;  4P5O A;  5DUI A;  3HKZ N;  3RDI A;  3K1N A;  4UXN A;  6PAX A;  1G6N A;  1SC7 A;  1MJ9 A;  2H1K A;  1LPQ A;  2FJ1 A;  3P7N A;  2L02 A;  3TOA A;  1LB2 A;  4EAT A;  3KP3 A;  3NEU A;  4Q47 A;  4RB0 A;  2L3D A;  2X4H A;  3K2Z A;  1BJA A;  3CF5 F;  2STT A;  2WY8 Q;  1FX7 A;  3R61 A;  4NQW B;  2OUM A;  1GHC A;  3AKZ A;  1JT0 A;  1WI9 A;  1ZG3 A;  2W25 A;  2FUG 2;  3K4B A;  1ZQ3 P;  4GXO A;  1UEL B;  3DF8 A;  3IH4 A;  1JGG A;  4XLP F;  1ZGW A;  2VOD A;  5EEG A;  4N9I A;  2DPD A;  3CP2 A;  2HVS A;  2KP6 A;  2ZXJ A;  4A93 J;  4HST A;  4HQE A;  2VUM J;  1YS6 A;  1VQ5 I;  3HL2 A;  1IV6 A;  4IF4 A;  2RV8 A;  5AIQ A;  1P92 A;  2ECC A;  2PQ8 A;  2R3S A;  3O8G A;  1MGT A;  2XIG A;  2CYY A;  5FRO A;  3R6S A;  3CCR I;  2F4M B;  2Y75 A;  2VT2 A;  2ZXH A;  3ROU A;  3JRA A;  5GP9 A;  1U9N A;  2F48 A;  2DN0 A;  4A3B J;  2LKP A;  4BJ6 C;  2IRF G;  2CQQ A;  4PUS A;  2M5W A;  3I4P A;  4YII A;  4G9Y A;  4DGW B;  4FTH A;  2P81 A;  2R7O A;  3L1P A;  1D1B A;  5E3L A;  5DM7 F;  3BPX A;  4HLX A;  2V6E A;  2NRA C;  3IKV A;  3CCY A;  2M1B A;  2RQQ A;  2Y2Z A;  1IF1 A;  3LQQ A;  3IKT A;  2HTJ A;  3MQ0 A;  1R7J A;  4LIU A;  4ANJ A;  4NNJ A;  3MVP A;  1GLN A;  3H3Z A;  2PJR B;  1TNS A;  4IRG A;  3JRD A;  1DQU A;  2VIX A;  3ASO H;  2ME0 A;  4ESJ A;  3LNQ A;  4Y52 J;  2HS5 A;  5DV5 A;  3SJM A;  3M7G A;  4CO8 A;  1R9T J;  2H1L A;  3ZMU A;  5KNL A;  3EYY A;  4NC6 A;  4XKV A;  4XSX F;  1MSF C;  4ZYG A;  2DDA A;  1D0X A;  5BOX A;  3ERM A;  1RUN A;  2OQG A;  5K7F A;  3FK7 A;  3IV5 A;  5E3O A;  4IHS A;  3MZH A;  1Y56 A;  2XAF A;  5TIS C;  4B8X A;  3TQN A;  5HNH A;  1YJW I;  2VT3 A;  3OMY A;  2CW0 F;  2OU2 A;  2PMZ N;  1Y1W J;  1RES A;  2DXI A;  2HPI A;  5JR3 A;  3G71 I;  2YX4 A;  3GWZ A;  4C3J J;  1IUF A;  1WFX A;  3Q0W A;  3U21 A;  3JRG A;  4AM3 A;  3GZ5 A;  1JHF A;  1ETX A;  4YIR X;  3E6M A;  1ETQ A;  4RLQ A;  3A1Y A;  3AAF A;  2P7C B;  4YEJ A;  3RYP A;  3HHH A;  3DBL B;  2Y0S N;  4D1Q A;  1IRZ A;  2JRT A;  3OIO A;  4ENK A;  2HYG D;  1V5F A;  4B48 A;  4IHX A;  5CLS A;  1IXC A;  2X6O A;  2CQX A;  2OV7 A;  1WPK A;  2JSC A;  1T8I A;  5E18 F;  3OS1 A;  3WTW C;  1KQ0 A;  3RPQ A;  2WAE A;  5E8G A;  4UB6 C;  3SHF A;  5L3B A;  1S3J A;  2ZCW A;  2IT0 A;  2K9Q A;  4XNF A;  2ZJR F;  3HGG A;  1R5H A;  3IWF A;  2DK5 A;  1VQ7 I;  1H9T A;  2CQN A;  3BR1 A;  1YX3 A;  4XLC A;  3WGH A;  1YI2 I;  3I4N J;  1YE9 A;  1H89 C;  1UHM A;  1XGM A;  4KNY A;  3HOZ J;  3HOW J;  5EDN A;  2CW8 A;  4A3J J;  4M9Z A;  3KLN A;  4OAZ A;  1E3P A;  2BHY A;  1R4M B;  2LY9 A;  3WTS C;  2MH9 A;  3OYK A;  1T56 A;  2DFH A;  2QQ9 A;  3V42 A;  3CO6 C;  2ME6 A;  2R5Z A;  3NAR A;  3HRM A;  3SFI A;  5L3G A;  5E20 A;  2DI3 A;  2LMD A;  3EPZ A;  1GVD A;  2RVC A;  5CYV A;  2CV0 A;  3RQ4 A;  4EMS A;  1K6O A;  1BR2 A;  2ELH A;  3J7A Y;  4EJW A;  1FZP B;  4XRS G;  3G1M A;  3RCO A;  4C3I J;  1PVE A;  3DLA A;  2IS2 A;  1GVJ A;  1QVU A;  1RKT A;  5HLH A;  1QNT A;  2QBY A;  3ECH A;  4BUP A;  3WTY C;  2V6C A;  2DMU A;  1SVO A;  3SZP A;  5FD5 A;  5HDG A;  3C2B A;  2XAH A;  3EDP A;  3G1O A;  4PSW A;  4IEJ A;  2WB1 N;  1VQL I;  3BC8 A;  4TV7 A;  2X6Y A;  1B72 A;  1JKQ C;  3DCF A;  2J5O A;  3VPR A;  1OFC X;  1A5J A;  4P9F A;  1R00 A;  1U5T C;  2O03 A;  3HC7 A;  4CYC A;  1X1D A;  5C4X J;  3VOD A;  2M45 A;  1QPI A;  4IRI A;  3CCV I;  2KKO A;  1HA8 A;  1Z67 A;  3FHZ A;  2DQL A;  1FPQ A;  2FBK A;  1LFP A;  2VAS A;  3W6K B;  1AKH B;  1U8B A;  3CLQ A;  2H8R A;  1V3F A;  4NC8 A;  5ILU A;  2XGX A;  1NK2 P;  2GXB A;  2LC2 A;  5IYB J;  1H88 C;  2XKP A;  2KPM A;  3S15 J;  2BOL A;  1GDT A;  1OYY A;  2GOM A;  2VQC A;  4BYY A;  5IP7 J;  5FLM J;  1YW9 A;  3U2R A;  2K27 A;  1UJ8 A;  3QAH A;  4A5N A;  3MZY A;  3W3C A;  3HZJ A;  3H9G A;  1TP4 A;  5EEH A;  3V7S A;  3JRI A;  4E6K G;  1ZG1 A;  3NRV A;  4EVI A;  3QRF F;  2NYX A;  4I7H A;  4UUT A;  2R7W A;  3K10 A;  4Y17 A;  4HRI A;  2E1O A;  3FIW A;  5HLG A;  1XS9 A;  5CKT A;  3DP7 A;  1Y8Q B;  1ETV A;  2L9R A;  2LLK A;  4HF2 A;  2UZK A;  2HQR A;  3EUA A;  2LY1 A;  2A05 A;  5H20 A;  2PG4 A;  4ZDL A;  2YX7 A;  2BEO A;  5IT9 Z;  2XGE A;  1IZ1 A;  2NXN B;  2IBD A;  2FX0 A;  2NVU B;  2ETH A;  3H5A A;  1TBX A;  1Z05 A;  1K4T A;  4LIV A;  2MYS A;  4M3E A;  2EFP A;  1U5T A;  3TKY A;  3PQK A;  4ABZ A;  4CCM A;  4C2T A;  4IHY A;  3QYE A;  5ERI A;  1WH5 A;  2EA4 A;  3N05 A;  3ZMS A;  3M07 A;  4KA4 A;  2E2I J;  1TLH B;  1Z0X A;  2K9S A;  4LFU A;  1XMK A;  2BW3 A;  4R8H A;  4R1H A;  4UNO A;  4BNC A;  2W7N A;  3KFW X;  3I56 I;  1OYI A;  5HDN A;  4ZTF A;  2W1O A;  4FX4 A;  2BY1 A;  4JP0 A;  2CFO A;  1OKR A;  2JT1 A;  2E34 A;  1UG2 A;  5F0C A;  2IA1 A;  3DBH B;  3F72 A;  4E7H A;  4F93 B;  2PMZ A;  2X51 A;  3S2H J;  2P4W A;  2ZNY A;  4CH7 A;  2ZBK A;  1Y0U A;  1CQT A;  1W36 D;  3Q0V A;  2CH0 A;  4ENM A;  4P1W A;  1JI8 A;  2O7O A;  1MMS A;  3M8F A;  1E3H A;  2FNA A;  4RB2 C;  3PNY A;  2CRG A;  4DNC A;  4RGX A;  5B1A H;  3VOE A;  4ASN A;  2CUZ A;  4HG2 A;  2X6X A;  4IVN A;  5L3D A;  4M6Y A;  2HOA A;  4HBL A;  5DUK A;  2UXN A;  4PZJ A;  2EH3 A;  5C4J J;  4MNU A;  5LD2 C;  5D8K B;  3JAM Z;  1WI3 A;  1MBG A;  5EGO A;  1ZHF A;  3CC7 I;  1XSV A;  4XID A;  3LFK A;  4A3F J;  2GZW A;  3E5X A;  5IYD J;  3HYI A;  3RSN A;  3DEU A;  4YG2 F;  4ZYE A;  2V4J C;  3F6O A;  3BZ6 A;  1T95 A;  5FFZ A;  1T98 A;  4U7B A;  4CHU A;  5IPA A;  5D4R A;  1X4P A;  1B1B A;  1BW5 A;  4IXA A;  2XF6 A;  4B44 A;  3U1D A;  2JRM A;  3F8M A;  4HOB A;  3L2U A;  4A3G J;  3OOP A;  3GCM A;  1S7O A;  2RC4 A;  3IRR A;  3ZQI A;  3FM3 A;  4RAY A;  4RGR A;  2MA3 A;  3KP7 A;  3V4G A;  2LG4 A;  1DGW Y;  1R23 A;  1DU6 A;  1A36 A;  3MKW B;  3KLO A;  1XGS A;  2FML A;  3WHC A;  4WCG A;  4KT6 A;  4YIF A;  4W1U A;  3TED A;  3F0C A;  2K86 A;  2XKO A;  2DPU A;  3MZ8 A;  2IS1 A;  1G59 A;  2DA3 A;  3KZZ A;  2G9W A;  2TCT A;  1SFK A;  4F3Q A;  1FTT A;  2Z16 A;  2V9K A;  5CVJ A;  1TQM A;  3I54 A;  1S7A A;  2AQF A;  2X0L A;  2W84 A;  2GLO A;  4GDF A;  1FNN A;  3V7R A;  4BQA A;  2BY0 A;  3B6C A;  1ZR4 A;  1RC9 A;  1GUU A;  2CJJ A;  2DFE A;  1QZY A;  2F4O B;  3PSF A;  5LBQ A;  4NQW A;  1UST A;  2ISZ A;  2JA2 A;  3C2H A;  2OPT A;  2CQ7 A;  5DTD A;  5JHF A;  3OYM A;  1B9M A;  2WB1 A;  3GXO A;  3I53 A;  2E2H J;  1V5G A;  3FF5 A;  4WWC A;  3WE2 A;  2HOS A;  3SZT A;  1TT5 B;  2UUZ A;  3HUG B;  4NHJ A;  4BDZ A;  4U0W A;  1TWH J;  4PFP A;  3CD6 I;  1O4X A;  3DKY A;  3KIO A;  3LSG A;  1B4A A;  3FBI B;  3VDX A;  3ZQH A;  3C18 A;  3QPS A;  1BOA A;  5LEJ A;  5EZH A;  1U0J A;  2PFB A;  3MCZ A;  2BVL A;  1VFC A;  2E1N A;  1X1P A;  1KGS A;  2EJR A;  5IY5 H;  4M72 A;  2EIM H;  4JBA A;  5LHG A;  3M3Y J;  1O3T A;  5DS9 A;  4LG0 B;  2MAB A;  3SDB A;  2I8D A;  3LSM A;  1SD4 A;  4M3G A;  3CC4 I;  2CS3 A;  2VE8 A;  3L7W A;  2ECB A;  5F0F A;  4AYB A;  2D1H A;  2IP2 A;  1H9G A;  1FEX A;  1IN8 A;  3CDH A;  3FXL A;  4E7K A;  2HDD A;  2R7D A;  3QPL A;  3ZQL A;  5BPI A;  3ERE D;  1YIO A;  2W48 A;  1HXD A;  3D5S C;  4MFE A;  1BC8 C;  2PBI A;  3K1M A;  1BM9 A;  4UVA A;  2E5N A;  2KRH A;  2LR8 A;  2P7V B;  3CO7 C;  3CDL A;  2RRE A;  2IA0 A;  2H09 A;  2PJR A;  1BI1 A;  4FE7 A;  2EV6 A;  2DLL A;  2VBZ A;  3J7Z I;  3E6C C;  1DPU A;  2W00 A;  5LGN A;  2FNP A;  3DEW A;  5K5O A;  1DU0 A;  1VQN I;  3BG7 A;  4IRH A;  4EGY A;  1E0E A;  3NWT A;  5CVU A;  4CA0 A;  3KEO A;  1ZLK A;  3J80 Z;  2DAO A;  2VBW A;  2NS7 A;  4AVP A;  2L9S A;  2GQQ A;  1C0W A;  1Z7U A;  1JGS A;  3KYC B;  4BBS J;  1FYK A;  2EZL A;  4ON0 A;  3WU1 B;  3MD2 A;  1J09 A;  2VN2 A;  1HDD C;  1MMG A;  1SFX A;  3DPL C;  3E5Q A;  2E36 A;  2MBF A;  3GFJ A;  3UNG C;  4FAS D;  5HS7 A;  4JK1 X;  3OYJ A;  1OJL A;  2O5R A;  1YHQ I;  3U1K A;  2X1C A;  2XB5 A;  2ID6 A;  3HOT A;  2X85 A;  1MBH A;  2LOO A;  2OA4 A;  2VQL A;  2VJ5 A;  1SFO J;  2LRD A;  2M30 A;  4N4N B;  3RKW A;  2MLK A;  4RAF A;  4EM1 A;  2ZNZ A;  5ICC A;  4DYR A;  1MMA A;  2DMP A;  2OAZ A;  3E6B A;  3KCC A;  5H6R A;  2JA5 J;  3JSP A;  1R36 A;  1F1Z A;  5HLI A;  2MLG A;  2ADU A;  3L00 A;  4EJO A;  5ED4 A;  1BBY A;  2KZV A;  3LSH A;  4MQ9 F;  3PIO F;  3KP5 A;  1ZEL A;  4WXD A;  4AU7 A;  2MD0 A;  2ESN A;  4XRS A;  2E60 A;  2HQN A;  4MGR A;  3GEZ A;  5FLX K;  4IQ4 A;  1ZRE A;  4HV5 A;  1E17 A;  3BP8 A;  1R6R A;  2GIV A;  3FZV A;  1XSD A;  2DFI A;  3GFI A;  2HR3 A;  5LRR A;  1BC7 C;  3OIQ A;  1I1G A;  3J81 K;  3DU6 A;  2YR2 A;  4MHG A;  3GZ6 A;  2NNY A;  5F0H A;  3M1E A;  2L7F P;  3ZXS A;  2M0C A;  5LGT A;  1FWZ A;  1LEB A;  3A2K A;  3ML6 A;  2DA6 A;  4PSX A;  3PFI A;  3IWZ A;  2EV0 A;  1PYV A;  2QSH X;  1Z7L A;  2WAD A;  1NH3 A;  3A0B C;  4ENJ A;  4BAC A;  4KMU X;  2Y9Z A;  4FCY A;  2Z3Y A;  5HS9 A;  2V1U A;  4XLN F;  5BNG A;  3JRC A;  4B3X A;  2M3A A;  2ZC2 A;  1SAN A;  3BTL A;  1CGP A;  3QOE A;  4D0P A;  3WGI A;  4AC0 A;  5LRS A;  1MDM B;  4Q48 A;  1FMV A;  1U9O A;  1ZAR A;  3PL8 A;  1B8I B;  2XF7 A;  5M5X J;  2M4G A;  4M3D A;  3JR9 A;  3IRQ A;  3VYT B;  2QKL B;  4LMY A;  3LAJ A;  4C2U A;  3BG5 A;  1HQC A;  5J8C A;  2FE3 A;  3HOS A;  3HOY J;  1S5L C;  2Q2E B;  2IA2 A;  4V19 K;  3I9V 2;  2WC2 A;  3MEX A;  1STZ A;  3TDU C;  1V54 H;  5TGT A;  4X0G A;  1XC5 A;  3GW2 A;  4BEH B;  1IN7 A;  2LDU A;  2COM A;  5LLQ A;  1EA3 A;  1L0O C;  4XRF A;  2QCO A;  2BGC A;  4IZZ A;  2VB6 A;  4GYI A;  2V79 A;  4DJA A;  1EH7 A;  4RS8 A;  1SVL A;  1KU7 A;  2QYO A;  2Z2S B;  2LF8 A;  3KZI C;  4KN4 X;  2BY3 A;  4RM2 A;  4D5F A;  4L5E A;  1VQO I;  4PGH A;  1VQM I;  1R22 A;  4XSZ F;  4HNT A;  3ZP5 A;  2IS6 A;  1Z21 A;  4B1R A;  4CCJ A;  3T0Y A;  5F27 A;  3ULQ B;  5GTI C;  5EG0 B;  2EV5 A;  1JJ6 C;  3UR3 C;  1XN7 A;  4E7Z A;  3H3U A;  1ON1 A;  1LDK B;  2L7Z A;  4KIG A;  1FBS A;  1SD5 A;  3BG6 A;  3BTI A;  3IAS 2;  1Q1V A;  2ZME B;  4KDP A;  4A69 C;  2R7X A;  3FK6 A;  2KIQ A;  1IW7 F;  4H0E A;  1WJA A;  4ZTJ A;  2PLY A;  3DXJ F;  3F8C A;  3LWF A;  3ASN H;  3TP3 A;  1N75 A;  1IC8 A;  4RGS A;  4ZDO A;  1A6Q A;  3S8P A;  4R79 A;  2MW8 A;  4I02 A;  1W7P B;  2ZFU A;  1EH8 A;  2DMQ A;  5E3N A;  2R0Q C;  3TL4 X;  1UCR A;  2QKM B;  1RZ4 A;  5C3E J;  3QYF A;  2FOK A;  3OY9 A;  2VKH A;  5EYR A;  3S1M J;  4MLO A;  1JT6 A;  1FSE A;  3CCJ I;  1XDS A;  2HPM A;  2GXA A;  2WTE A;  2G7U A;  3QU6 A;  2PJP A;  4A3E J;  1XPX A;  1MW7 A;  1IAW A;  2DU9 A;  3OOU A;  3DFG A;  2EWN A;  4RAZ A;  1Y39 A;  1T2K A;  1S72 I;  3S32 A;  4J19 A;  1WVR A;  2KL4 A;  4BQO A;  4HYE A;  5B66 C;  5E1W A;  1JXS A;  3DTE A;  5EF6 A;  1WWX A;  4RM3 A;  3AFH A;  4O3M A;  5K7Z A;  5LGU A;  3KX2 A;  1G8X A;  2R7T A;  3H35 A;  1R5G A;  2VXD A;  3OYL A;  2JK3 A;  1K78 B;  3OSG A;  1WHU A;  3A02 A;  4BAY A;  4BS9 A;  4F52 A;  2MC4 A;  2H8W A;  5FGM A;  3A4C A;  2NVT J;  4UB8 C;  3FXO A;  2WV1 A;  2E71 A;  3GLX A;  3TW6 A;  2QWW A;  2LNB A;  1P2F A;  2I5U A;  1FIA A;  2ZSH B;  3DBR B;  4M3F A;  2ZJQ F;  1BI0 A;  3RKX A;  4OMY A;  4HX4 A;  4AUX A;  3Q9V A;  4FHT A;  1W7P D;  2VE9 A;  3O6B B;  1J5Y A;  2OTL I;  1I27 A;  1E3O C;  4WX9 A;  2EK5 A;  1NG6 A;  3MMY B;  1BW6 A;  3F9K A;  2B63 J;  4L5I A;  1O3Q A;  2OQR A;  1RET A;  2R7Q A;  3S93 A;  1EV7 A;  2V9V A;  5TJJ A;  1J7K A;  4A3L J;  4XIC A;  5HNF A;  3WTX C;  1W5S A;  1FC3 A;  1OIS A;  1ZN2 A;  2LRE A;  3DQV C;  4O5V A;  2LSO A;  2GIZ A;  3I58 A;  1Z6R A;  1K79 A;  2VON A;  2H94 A;  1D0Z A;  1ETW A;  2PX9 A;  3VSL A;  2YUS A;  3RPU A;  5CPR B;  4C30 A;  2VLA A;  3ZQQ A;  1TQI A;  1YG2 A;  2RGV A;  1QHH D;  2Z99 A;  3RQI A;  4M9X A;  3WOD F;  1FYM A;  1UZC A;  2STW A;  3BPV A;  3ZQF A;  2VPR A;  3ZQG A;  1V55 H;  3OWT A;  1SAU A;  2VBX A;  2TRT A;  2DOF A;  2Z1D A;  2F5F A;  4YFN F;  2K7L A;  3HRS A;  1K4S A;  4I2O A;  3MKL A;  1HKT A;  2OD5 A;  4IKF A;  5CJ9 A;  2X1D A;  4EJV A;  4BDY A;  1UG0 A;  2IJL A;  2MD5 A;  1MZB A;  3HTU A;  3DKW A;  1UHS A;  1KU3 A;  1W5T A;  1QZZ A;  4CZC A;  2CG4 A;  1FOW A;  1Y8R B;  4L5J A;  3E5U A;  2CV1 A;  2M8E A;  1EJ9 A;  1TNT A;  2G0E A;  1XMX A;  3FKJ A;  2GXG A;  2GA1 A;  1R4N B;  1RI7 A;  5IYC J;  4JYK A;  2R7R A;  4G94 A;  5F08 A;  5LHH A;  3CJT B;  4E7S A;  3PO3 J;  3HOX J;  3HUG A;  5B1B H;  4ZZD A;  5M5Y J;  2CMP A;  1S6L A;  2NS8 A;  1TL8 A;  4HF0 A;  4UUS A;  1HW2 A;  2VL8 A;  1I6H J;  2NOG A;  5GPA A;  1MBK A;  5DYM A;  1PUF B;  3CUQ B;  1MH3 A;  2ESH A;  2V7F A;  5D4S A;  1U8R A;  1O3S A;  2MH2 A;  4XRM A;  5JHU A;  2L2O A;  1KU9 A;  3R0J A;  3S1N J;  5GAD J;  4XOT A;  2JUC A;  3L2C A;  1IDY A;  5D8L B;  4KT5 C;  2VI6 A;  1QO0 D;  4RMN A;  1DDN A;  3QPT A;  3K4L A;  4BHB A;  4U7D A;  2ACJ A;  1IXS B;  2K5C A;  4ENN A;  1B9N A;  1Q1H A;  2W57 A;  5E3M A;  3PQJ A;  1YLF A;  3WHB A;  5GAH J;  3A03 A;  1NG7 A;  2XAG A;  4H4K C;  5D5X B;  2A6T A;  1MND A;  3MKZ A;  2BHZ A;  4A2U A;  2A68 F;  2DOD A;  3KE2 A;  4FE4 A;  4PDK A;  4PJL A;  3REO A;  5TRD A;  2KMU A;  2VC1 A;  2ZKZ A;  3Q9S A;  2L4A A;  4MTE A;  1X1B A;  4HPQ A;  5BS6 A;  4KJZ A;  3RI4 A;  2HDC A;  3LSK A;  2A69 F;  3CJN A;  2K3F A;  1QVT A;  2Y69 H;  3LST A;  2L4M A;  3BCA A;  4PFO A;  1LUJ B;  2L01 A;  2F4I A;  4CCK A;  4AYB N;  4A3K J;  1HDP A;  1V5E A;  2EFQ A;  3HM5 A;  4XQF A;  3CCE I;  1JUP A;  1QGP A;  1B59 A;  2HNH A;  2OZ6 A;  2E5Z A;  3QU3 A;  2N8G A;  2R7F A;  5K5R A;  2A6H F;  1I6X A;  4X6A J;  1QU3 A;  5A2Q K;  5DM6 F;  2QF7 A;  2RQP A;  5IT3 A;  4RA2 A;  1F5T A;  2OTJ I;  3R60 A;  3OR2 C;  5JI6 A;  1LVK A;  2OJE D;  3I3L A;  1HW5 A;  2IEK A;  5FFX A;  2K4J A;  1HOM A;  4WXH A;  2QSG X;  3JTH A;  4EJU A;  3LFU A;  3PM1 A;  1U2W A;  3DU5 A;  3F8B A;  1VI0 A;  2ZB9 A;  4LK1 F;  4BHP A;  1SFE A;  1MMD A;  1GV2 A;  3MN2 A;  4LB6 B;  2LH9 A;  4GO1 A;  4HNU A;  2HVR A;  2Z33 A;  3DTK A;  2HWV A;  2JWT A;  5FKN A;  2COB A;  2HGC A;  5J1U A;  1U3E M;  4Y15 A;  4OU0 A;  3M8E A;  3FXU A;  2BZT A;  4G7Z F;  1UMQ A;  3GFM A;  4JOM A;  4PJN A;  2R4G A;  3HB9 A;  3GFL A;  2NOJ B;  4WK8 F;  3K4C A;  5FJ8 J;  2JSP A;  3GTJ J;  1T38 A;  1KYZ A;  4G12 A;  3BY6 A;  3I71 A;  1QQI A;  2FMY A;  3GME A;  5H6Q A;  4ESF A;  1OCP A;  1QZE A;  3H1C A;  1RUO A;  1D5Y A;  2EQR A;  2VQH A;  3K70 D;  4GRI A;  4A0Z A;  1WRJ A;  2X48 A;  4MEX F;  2LY2 A;  5EZG A;  2FRH A;  4G6T B;  1DP7 P;  1FOY A;  4X1E A;  2A61 A;  2H6B A;  3RIR A;  1LKX A;  3CQZ J;  3S17 J;  2VXZ A;  1YJN I;  1JUS A;  3A01 B;  3EYI A;  2IS4 A;  2NAZ A;  1ETY A;  4AIH A;  1XCB A;  2D5V A;  2FBI A;  4CDG A;  1APL C;  4NBQ A;  3WTZ A;  5F64 A;  2KDO A;  4D5C A;  4I0A A;  3LOC A;  3FXJ A;  1K61 A;  5KVR A;  2DDB A;  2OBP A;  2F5V A;  4N0B A;  2HEO A;  1Z77 A;  1WSU A;  3BJO A;  2ISY A;  2XPW A;  4MQV A;  1VQK I;  3K7A J;  3IL2 A;  2XGD A;  4D7M A;  3FMR A;  1IXR C;  1W0T A;  4BJT A;  3LMM A;  4YFX F;  1LJ9 A;  3LSP A;  3N97 A;  2ZSI B;  3G6E I;  2ZME C;  3IH2 A;  3GX4 X;  1MDM A;  4BXX J;  2DQR A;  4P9U A;  3V8L A;  1B8I A;  4QLC U;  1RR7 A; 
#chains in the Genus database with same CATH homology
 3CCE I;  3I55 I;  4IOA F;  3CCR I;  1FOX A;  5DM6 F;  1VQP I;  1VQ8 I;  2OTJ I;  3CME I;  3PIO F;  1YIT I;  1HC8 A;  1ACI A;  1VQ9 I;  3I56 I;  5DM7 F;  3CD6 I;  1VQ4 I;  2E34 A;  3CCU I;  2JQ7 A;  1FOW A;  1VQ6 I;  4IOC F;  1MMS A;  3CCJ I;  3CC4 I;  4UY8 I;  4IO9 F;  2QA4 I;  2ZJP F;  1VQL I;  3CJT B;  3CCQ I;  3CCM I;  3CC7 I;  1Y39 A;  1S72 I;  3PIP F;  1YJW I;  3CMA I;  3CCV I;  3G4S I;  2E35 A;  5GAG J;  1FOY A;  3G71 I;  3DLL F;  5GAD J;  1YJN I;  3J7Z I;  1VQN I;  2H8W A;  3CCS I;  3CF5 F;  5GAH J;  3J7Y J;  5JVG F;  2ZJQ F;  3CC2 I;  2NXN B;  4V19 K;  2FOW A;  2OTL I;  1QA6 A;  1VQK I;  3CCL I;  2E36 A;  2K3F A;  2ZJR F;  3G6E I;  1YHQ I;  1YIJ I;  1VQ7 I;  1VQ5 I;  5GAE J;  1YI2 I;  1YJ9 I;  1VQO I;  1VQM I;  2QEX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...