5GADJ

Rnc-srp-sr complex early state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
134
structure length
134
Chain Sequence
YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords ESRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
total genus 24
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
J PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5gadJ02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5gadJ01
2E34A 3CMAI 1VQOI 1VQ9I 3CMEI 5GADJ 3CF5F 5GAGJ 1VQPI 1FOYA 3I56I 3CD6I 3G6EI 1YI2I 4IOCF 5DM6F 2ZJRF 2E35A 2QA4I 3CCRI 3I55I 1YJNI 2H8WA 3DLLF 3J7YJ 4IOAF 1VQ8I 1HC8A 2OTJI 3CJSB 2ZJQF 2QEXI 3CCMI 2K3FA 3PIPF 1QA6A 3CJTB 3G4SI 1VQ7I 4IO9F 3CCVI 3CCEI 3CCJI 3EGVB 2E36A 1VQMI 1VQLI 3J7ZI 3CC7I 1MMSA 2NXNB 5DM7F 5GAHJ 1YJ9I 3CJRB 1YHQI 2ZJPF 3CC2I 3CCUI 5GAEJ 2OTLI 1Y39A 2FOWA 1VQ5I 1S72I 3CC4I 4V19K 3CCLI 1VQ6I 1YIJI 2JQ7A 4UY8I 1ACIA 3PIOF 3G71I 1VQNI 3CJQB 3CCSI 5JVGF 1YITI 1FOXA 1WIBA 1FOWA 3CCQI 1VQ4I 1YJWI 1VQKI
chains in the Genus database with same CATH superfamily
1Z3XA 2IS4A 2H6BA 1XDSA 3BOQA 4BE1A 1MJAA 5CVIA 4YG2F 4BBRJ 1IXRC 1G3WA 2M45A 2IVMA 1P9QC 2VBXA 3F21A 2DOEA 2NAZA 3JRFA 3WTWC 3V7CA 2F2EA 4M74A 3JW4A 3JSOA 4IL6C 4O3MA 1Y1VJ 2JUGA 1P7JA 2KLOA 1R49A 1UELB 4I01A 1LE8A 1QNTA 2VASA 4EM2A 5A2QK 1IXCA 1QHHD 5FRMA 4OIOF 1WJEA 3B73A 2H1KA 3PO2J 2NS7A 2KIQA 4LD5A 2VE8A 4FHTA 3KLOA 3MKZA 1FC3A 5LD2C 3QP5A 2QF7A 2BY2A 1G6NA 5IT3A 2BYVE 2LF8A 2A6TA 3TO6A 2OTJI 2JRMA 3BR1A 2QEXI 2GXAA 3SJMA 2VJ5A 5FB2A 4KICA 4C9YA 3CQZJ 3CESA 3LFUA 4IJAA 5BS6A 4M3DA 4U7BA 1OMIA 1TTYA 4PSWA 1YFHA 2L9NA 2Q1ZB 3E97A 4UV9A 1T6SA 1HW2A 4FE4A 2CO5A 1NK3P 2ZC2A 2IBDA 2CW0F 4M6VA 1OCZH 1HKTA 3OMYA 2Q8KA 4P55A 4UUSA 3L2WA 2BXYA 2QVOA 1Y8RB 2UV1A 4FETA 3GFIA 2VC1A 1R5ID 2LBFB 2YPRA 2K3PA 2KZGA 4XK4A 2F5VA 3QU3A 4WWCA 3CP8A 3M1CA 3B6AA 4M71A 3HZJA 1A5JA 2CQQA 3KEYA 2JRTA 2Z5UA 1CF7B 1O7LA 2YSRA 4RDUA 1VQ5I 1FNNA 2HQNA 5ILUA 1XGOA 2Z3YA 1R1TA 4KMUX 3SHFA 3WGGA 1JUPA 5DV5A 2FMYA 3O6BB 5L3EA 3JRDA 3KYLA 2V1UA 2L4AA 4Q47A 2QCOA 3FHZA 4ESJA 2V6CA 1JJ8C 4YEJA 3S8PA 3IAM2 1XTAA 1K4SA 2BOLA 1MBEA 3DBRB 4A3CJ 3IH2A 2D1VA 5EYRA 1CGPA 3A0BC 1A31A 3FM5A 2NOJB 2X85A 4CGZA 4XIDA 1ENHA 3GZNB 1B1BA 1OLTA 4Q4ZF 5FFZA 3LSIA 2HYJA 4RAZA 1G59A 5GP9A 1FEXA 3QQAA 3AG2H 3J7AO 4QTRA 1S6LA 5LHHA 3CLQA 2R7ZJ 3GLXA 3ELKA 3FXUA 3T8TA 4XBFA 1PUFB 1X19A 2QQ8A 4W97A 1LKXA 4CCOA 2RREA 2KRFA 2KIFA 2ZJRF 3LSJA 2L54A 2L7KA 2PMZA 2BY1A 1FX7A 1PP8F 1N78A 3DPUA 3VEPA 3QP6A 2PJRA 1RKTA 1F43A 4XN0A 2JA5J 4UVCA 1U2WA 4UHTA 1QZEA 2LMDA 2XUBA 3HL2A 4QLCU 1QBJA 2OUMA 1V5FA 3EUAA 3I54A 4WF2A 3RDIA 2RDPA 3CJTB 1K79A 4LIUA 3CTAA 4M9XA 1ETXA 3BC8A 1JXSA 3L2CA 2GA2A 5IOZA 5HLGA 2R7RA 3CUOA 4GDFA 2XAQA 1WH5A 2MD5A 3U2RA 4XLPF 2ADUA 3GXOA 3J7ZI 2O03A 2WADA 5ICCA 2VBZA 4CYCB 2BHYA 1BC7C 1UHMA 2FQ3A 2PX9A 2HZTA 3D1NI 5DM7F 2EQRA 3OYFA 1S8NA 4JX5A 2ZMEA 1IW7F 4A3JJ 3A2KA 3F6OA 3VDXA 4GYIA 2GWRA 4L9JA 2ZXWH 3MCZA 4UB8C 2M34A 4XQFA 2OTLI 1R23A 3S32A 2B7EA 3DKWA 4L18B 2M2EA 3OR1C 1XGNA 3H92A 4BXUA 2TRTA 2FOKA 3GTOJ 5J1UA 5DUKA 4DOZA 1TL8A 3P9KA 1PJRA 1K83J 3PJRA 5K5OA 3G71I 3CUQA 1IV6A 2JA6J 2HEOA 4UV8A 5D5UB 3FXOA 4ZDLA 2DYRH 4HSRA 4BUPA 2Z9OA 1FWZA 5FROA 2CUFA 3K70C 4EGYA 1MSEC 3F8BA 5C44J 1BR4A 3DTIA 2E5ZA 1SVLA 4Y33A 3OWTA 1VQ4I 2X6OA 2CFXA 1XGMA 2PN6A 2PMZN 2HVRA 2Q0OA 4XRSG 3KETA 1S3JA 2W82A 3L2UA 1FBQA 4L9TA 1VQOI 3HRUA 4V2GA 1ZG1A 1ZAOA 4RLFA 4AYBA 1Z3YA 2AS5F 2VT3A 3T1BA 1X1CA 1YLFA 2XDVA 5J8FA 5E3OA 3RKWA 1EKEA 1V5EA 3K6GA 2EPFA 2M0CA 1KGSA 1Z77A 1IAWA 3KYDB 3KP7A 2L2OA 4JOMA 3S93A 4ENNA 4I99C 3ZQFA 2E35A 1EF4A 2XKOA 4LIVA 1NG6A 2VBYA 3HUGB 4NDLA 4AVPA 4GO1A 3WHCA 3TOAA 1O3SA 2F48A 3ZQCA 4MTDA 3DEEA 4A93J 5F27A 2DK8A 3R6SA 1PDNC 1B4AA 2BBYA 2Z2SB 3BT9A 4QWQA 1GDTA 1DPUA 2YU3A 1XMKA 4IF4A 3OR2C 1LFUP 2XRNA 4Y4RA 4HQEA 1OR7A 4BACA 4RGRA 3BG5A 3QU6A 3OYLA 1VNDA 2D1HA 4S04A 1GT0C 3E6BA 2X9DA 1LPQA 5FKOA 3K1MA 5LGTA 1Z67A 1YTYA 2YX7A 2LKXA 4CCJA 1R00A 2DTRA 3DKXA 1WJAA 2A6EF 1D8KA 5HVQC 3ZQIA 2ID6A 4M73A 4NQWB 4U88A 3F72A 3EETA 2HVSA 2FF4A 2ZSIB 3K70D 1T08B 2KISA 3GTJJ 1T56A 3TO7A 3U21A 2E1MC 1TWGJ 2GOMA 2TDXA 2KT0A 3HXLA 2OV7A 2Y75A 1YHQI 1W0UA 2E7XA 1IF1A 2KRHA 3K2ZA 5KVRA 3ROUA 3RPUA 3CF2A 3FXMA 1EV7A 2O9LA 2VKEA 3QPHA 1YRNB 2M4KA 2LY2A 2XPVA 4BL0B 2IT0A 2FOWA 5H2FC 3E6DA 2KIMA 4LMYA 3BG9A 1JJ6C 2CYYA 3CO6C 4JP0A 2WB1A 1A6QA 4P1WA 3DFGA 5FKNA 5DCMA 3PQKA 2DPDA 3HGYA 4UY8I 2DI3A 1VQNI 2DMTA 4AYBN 4CCKA 4X6AJ 1YITI 2DTZA 2HS5A 1QQIA 1SMTA 1FOXA 2RQQA 3EDPA 2FU4A 3I59A 4PDKA 4ABZA 2DA4A 3L7WA 1MH4A 1Y0UA 3BR6A 1KYZA 2NOGA 4YIIA 4DGWB 2B9SA 2IW5A 2CUJA 5H6QA 2VLAA 1G3TA 3I0TA 1VQKI 2E34A 3OYMA 1VQ9I 3PFYA 3PSFA 1RRJA 3BCBA 4XLHA 1KU9A 2VPLA 1RR8C 3JREA 5K7HA 1RR7A 3MZHA 3E3VA 4O5VA 4BBSJ 3TO9A 3HOXJ 4ENMA 2PMUA 4IPAA 1SFOJ 4ZYEA 5LEKA 2HNHA 2CWEA 3EYIA 5C4JJ 4KMFA 2OC6A 2F5DA 4CDGA 1MDMB 1EH7A 1OCCH 5HOOA 4PCQA 2XSDC 1R7JA 1R6RA 4MFEA 5JLWA 3CCMI 2K3FA 4S05A 4BKXA 3ZMUA 3BP8A 2DK5A 4FX0A 5LHIA 1OFCX 4E7IA 5BOXA 4A3LJ 2KP6A 2JSCA 3S2HJ 2ETHA 2E71A 4F92B 2LOOA 4WXDA 5IP6A 2H94A 4OIRF 4RAFA 1R5GA 4KIBA 1FBSA 2JTVA 1D0YA 3CDHA 1CF7A 2Y69H 3AG3H 4C2TA 4KNYA 4ZDPA 5K7FA 1XDUA 4G7HF 4QSHA 4HRIA 1X3ZB 1LUJB 1S29A 1BL0A 1FP1D 2JVHA 2WB1N 3MEXA 4BJ6C 3QOPA 1ON2A 3QPSA 2GOXB 3CJRB 4BEHB 2DJNA 5L3DA 2CQ7A 3OIQA 3ZN0A 5IT9K 3O3KA 4PSXA 2O6GE 3LSRA 4IEJA 4A0YA 2DT6A 5GPCA 2GAUA 1AA7A 2ME0A 2ZFWA 4PGHA 1TWAJ 5JVTA 1J0RA 4U0YA 3FXLA 2VUMJ 2KQRA 2BGCA 2OD5A 3QODA 1S7OA 3ZOBA 1FMWA 2WTEA 2KPMA 4CCNA 3ULQB 1QU3A 5LHGA 2A6HF 3ZRGA 2ISZA 4XONA 1PUFA 4ZC3A 1J7KA 1R58A 2R7QA 2EFOA 4L5EA 3DCFA 5CPRB 3BROA 1BI1A 1LFBA 4KA4A 2ACJA 3EUHA 3H5RA 2CMPA 1VF9A 1A6IA 4G6DA 1HLVA 3LQRA 1S7EA 2LKPA 4II3A 2KHMA 1D3YA 3JAMK 1P7IA 4XRFA 1VZ0A 2E2HJ 3S16J 2XGEA 4XICA 1HQCA 4XSXF 3ZMDA 5CVUA 1FOYA 2P5VA 3L9FA 1USTA 5E1ZB 4XN3A 4CCMA 3G6EI 1ZR2A 3WTTC 3JTHA 1IRGA 5D4SA 4ON0A 2LFBA 2O8XA 1XD7A 3HSFA 1IJWC 3BPXA 4BY1J 3GEZA 1K6OA 1KYWA 3F23A 2W4SA 1T95A 2F5FA 2UXXA 1G8XA 4MO7A 4LLGF 3ABTA 3CO7C 1U5TC 5FJ8J 2WV0A 1UMQA 2K4BA 3DP7A 3O8GA 2P0WA 1C0WA 2LDUA 2XF7A 2LSOA 3CJNA 4CYCA 1K7AA 5KNLA 4DYRA 3JRBA 3J7AY 5LRRA 2FNPA 1XC5A 4NC6A 3W2VA 1DP7P 1WJDA 3FKJA 1JI8A 2MG4A 2A5WA 5DYMA 2FX0A 1HKSA 4OAZA 3OIOA 3CMYA 1SFKA 2HFHA 4B4CA 4B43A 2NYXA 2QYOA 3F8MA 1O7FA 2IRFG 3EGVB 2RKHA 3CDLA 3LA7A 2DA6A 2M87A 2CJJA 4LOCA 4IHXA 1FY7A 5D6FA 2MFZA 3HOTA 3QRFF 2OCCH 3OYJA 5L3GA 2DDAA 1HDDC 1BR2A 4MIMA 2VN2A 3MKWB 1YJ9I 1G2HA 3C7JA 2P4WA 1TQPA 3OYNA 3OYDA 3DTEA 5K5QA 3W6KB 2OQGA 1X3UA 1IC8A 1B8IB 3BG6A 2WBMA 1DDNA 1Z6TA 2TCTA 2VQLA 1TZLA 3GTMJ 3FXRA 3MAJA 5F0FA 3BCAA 3HC7A 4WXCA 2QQAA 2FSWA 4DZJA 1O3RA 2XV4S 3GFLA 2AO9A 3I4PA 3PIOF 2STTA 1MD0A 1WH7A 1CQTA 1RC9A 2G9WA 3MZ8A 4LB6B 4OOIA 1USSA 4PGGA 3OV8A 5DDGA 4OU0A 2HDCA 2IXSA 3K4KA 4E6KG 2FA5A 3HUGA 1ETVA 4UNOA 4KFCA 1MSFC 5GADJ 3CF5F 3D5LA 4MQ9F 2HQRA 1XN7A 1V55H 2LY9A 1FYKA 3D5RC 2QUFA 5F0CA 4B1RA 5ICFA 3PM1A 2XRLA 1WKMA 2DOFA 2G7UA 2OBPA 2QKLB 4M6XA 4PFOA 3C1DA 2R7DA 4KDPA 3FK6A 1W5SA 1KQ9A 1X4PA 3Q3SA 2DLLA 4G8XA 4BH9A 2R7XA 4A3KJ 2JVGA 3I4NJ 5GTHC 2EFQA 4HNTA 2EFPA 1MNDA 1Z9CA 1BM9A 4IRHA 1WSUA 1D1AA 5E1WA 3E5XA 2H8RA 1V5GA 4NQWA 3TL4X 5HNHA 1KQ0A 1W36C 3Q0UA 4HAMA 3RCOA 2GLOA 1WVRA 2W85A 3DKYA 2MA3A 4BQQA 4RB2C 3IWZA 2Q2EB 1RUOA 1IUYA 4H0EA 3HOZJ 1Z6RA 4FTHA 3TP0A 1SVMA 1ZHFA 2JK3A 3G2BA 3CCVI 3MZYA 4FT8A 5F6FA 1TT0A 2KJBA 2NRAC 3ABUA 2ZJ2A 5EEHA 4DQ2A 1ONVA 2E1NA 1V4RA 3KX2A 5EG0B 4MQVA 3U1KA 5L3CA 2VXZA 2EJRA 2DT5A 5EZGA 3I58A 4XOPA 5TRDA 2DAOA 3M8JA 3OL3A 1EA3A 3H9QA 4W1UA 3GBGA 4BXFA 2FBKA 2KZVA 2EIKH 2VBWA 2HTJA 3REOA 1HBXG 1DU0A 1HF0A 3KIOA 2HYFA 3IRQA 3MVPA 3WTXC 4XSZF 1YE9A 4ASNA 2IPQX 2K85A 2CV1A 2MYSA 3KFWX 2EV5A 3ASNH 3LAJA 4A3EJ 4JBAA 2L0KA 2OPTA 1QZYA 2GXBA 3BR0A 5EEGA 1O4XA 3UR3C 4QPOA 1RUNA 3V42A 4A3MJ 3V8JA 1P4XA 2VJIA 3S2DJ 3O8HA 3BPVA 3RKYA 2HWVA 3GTPJ 1SD6A 2IA0A 4IHTA 2HOEA 2XKPA 2QZ8A 1M1EB 4EJOA 3SFIA 2UWMA 1W7PB 4BDZA 1FBUA 2OU2A 1NH3A 2OA4A 2IEKA 4G7OF 3HM5A 4AIJA 1E3PA 4I76A 5H20A 1W36D 4XOTA 1K4TA 2FBIA 2ZMEC 2P5KA 1H0MA 1O57A 1QO0D 1A36A 5E79C 3S17J 4YELA 1X2MA 3I9V2 1B59A 3AFHA 4ZYAA 1MDMA 1G4DA 1SFXA 4BXXJ 1Z7UA 1R9TJ 2GIVA 2ZXJA 3H0GJ 1W5TA 3CD6I 2PBIA 2DA2A 3K69A 4P9FA 3FXKA 2KMUA 3VPRA 3F0CA 3Q9VA 1DPRA 4H4KC 1VTNC 1D5VA 3ZQLA 1XG1A 4BHCA 2JA7J 3CUQC 1R22A 2UUZA 3IC7A 3PFIA 4BGDA 1YJNI 1IXSB 3K2AA 1ZKGA 5J4VA 1SD4A 1X1AA 3JRIA 4BHBA 2L7MP 3WGIA 2EH3A 2P81A 2P8TA 1KONA 3IL2A 1J75A 3BJAA 1GVJA 1HC8A 1VQ8I 5HODA 3GTGJ 1YW7A 2B0LA 2PQ8A 5JFRA 5F64A 2BXZA 1X1BA 4Z6YA 3K4JA 4Y52J 4C2MJ 3ERMA 5E3MA 3K4MA 4MLOA 4R1HA 3VB2A 2R7UA 3KP3A 2M0MA 3EYYA 4V2FA 4BEHA 1BIBA 1SVOA 2M5WA 1JUSA 4ETSA 1T0FC 4XRMA 4RMNA 5ICEA 3B02A 1WCMJ 1K78B 2G0EA 2K02A 4MFDA 1VQMI 3S1MJ 1QZZA 3A03A 4HV6A 3RKXA 4F55A 6PAXA 4RLQA 1WJ5A 2LVSA 5DEQA 3LSTA 1WI3A 3OL4A 3K7AJ 4QPQA 5DTDA 5LBQA 2LKSA 4A69C 3GX4X 2IS1A 3CLOA 4BDYA 2QBYB 1WJFA 1H88C 1KU2A 5D8KB 2ZJPF 3SDGA 5F0HA 2P6TA 3PNTA 3L2QA 1OR7C 3HOUJ 3MKYB 5JHUA 2GA1A 4G94A 3AL0C 3SZGA 2RAEA 1RPWA 5HLTA 2JMWA 2XHKA 2R93J 2H09A 2W84A 5LFAA 1YIJI 1LDJA 3A1YA 1J5YA 3K10A 3OSGA 4EV0A 3HRMA 2DT7B 2PMHA 2NVYJ 3ONQA 3QAHA 1BIAA 4UXNA 2HOSA 2JA2A 3G1OA 5CVVA 4RM2A 3DQVC 2N8GA 3FK7A 3GUDA 4RB3C 3M8FA 3FWEA 1MIJA 3GFMA 5LLQA 3GTQJ 1BW5A 4OIQF 5K5RA 3BZCA 2IAIA 2CW7A 4BAYA 4CA0A 2FE3A 1Z05A 2KL4A 2XPWA 2E7WA 4HLYA 3DF8A 3GCMA 3W3CA 1DP3A 2VKVA 3ML6A 4HZFA 2YS9A 1HOMA 3PUFA 4BYYA 3HIFA 2CSOA 2W57A 1SMYF 4XMYA 5HDGA 1TLHB 2GIZA 4BY7J 1MMNA 2ZBKA 4ZDOA 5CYVA 2V26A 2OZUA 1UAAA 1E17A 4XNFA 3BTIA 4I7HA 4AVZA 2A61A 2VI6A 2L7ZA 4BQNA 2EK5A 5FKLA 1FPQA 3TW7A 4IOAF 4EM0B 2FRHA 5E20A 5FKKA 2L4MA 4RB0A 3JRAA 1EJ9A 1B6AA 4DZPA 3NAUA 5ILVA 1QPIA 3EUKL 2MD0A 2X1CA 2R4GA 1UHSA 2DQLA 2R5YB 1KU7A 1VQ7I 5BPDA 5HS9A 3WTUC 1ZGWA 3BDDA 2NNYA 1S9HA 1WFXA 2GQQA 1B8IA 1LEAA 3OYCA 3HB9A 2XPUA 4L5IA 3RJPA 3W2AA 4XM3A 4C30A 3RQ4A 1K61A 4EJUA 4A5NA 3KE2A 2RNGA 4WCGA 3KCCA 4QIWN 5J1YA 4XLFA 2YUSA 1R1VA 5JI6A 2WWYA 1R36A 2VKDA 2XF6A 3D0SA 1S5LC 1OYYA 4BQOA 5EF6A 3RPUD 3JTGA 1QPMA 5B1AH 3QPTA 3CCUI 4BU2A 1WHUA 3RYRA 2BZTA 2JT1A 4B47A 3LQQA 3NRVA 2JUCA 4HNUA 1ZLKA 3DPTA 5CVJA 4HNVA 3LL7A 2R7TA 1T98A 1SANA 1IN8A 2HQ5A 2LD5A 4PK4A 3ABMH 2K4JA 4HLXA 2F6CA 1OKRA 3DEWA 4XL9A 3NQOA 4NHJA 2FEZA 2WC2A 2GM4A 4A12A 3WU2C 4KIFA 1W1WE 5HS7A 4ANJA 1NK2P 4AM3A 2WAFA 1U5TB 1R5HA 1TWCJ 4MGRA 2RGVA 1BA5A 3R60A 2NVQJ 5E3LA 5HNFA 5FGMA 3MD2A 2DCEA 3K1NA 4ZTJA 3LAPA 3COAC 5EJCA 2LK2A 3CCQI 1D0ZA 3LWFA 2XVCA 2ICWG 4RAGA 4LFUA 2HPMA 2O8KA 3A01B 4IKFA 3ZMTA 4O6JA 4EEFG 3CMEI 2IS2A 2VE9A 2AHQA 1QVTA 2BEOA 2AXTC 3I56I 4Y15A 1P4WA 3H9GA 1H9TA 4M3GA 4IOCF 2QSFX 2Q2EA 5E8IA 1R1UA 2R7SA 1XS9A 2QA4I 2EV0A 3SEZA 3S3OA 5M3FJ 5K1YA 4KT5C 1BC8C 5GPAA 1I3AA 1ZG5A 1I1SA 3BWGA 2PLYA 1UJ8A 3ZXSA 2L02A 2ZNYA 1ZRCA 1YX5A 3F8NA 2CQXA 3HHHA 5EG0A 1MBKA 3MMYB 4RB1A 2NNNA 3BG3A 3QYBA 3ZGKA 4HEA2 3AG4H 1YW8A 1WQ2A 1QA6A 1OYIA 1YW9A 3C2GA 1XX5A 4I02A 2STWA 2QLZA 5E18F 2JSPA 3VYTB 2X0LA 3R4KA 1K6YA 2L9RA 3FKIJ 2EIJH 4NC7A 2DXIA 1XMAA 2JN6A 2XB0X 4IQ4A 2CV0A 1FIPA 1ERDA 1POGA 1XCVA 2XF5A 1SAUA 2VJJA 3BZ6A 4XLNF 2D5VA 2WY8Q 3PO3J 3GZ5A 3ESWB 4PJJA 5JR3A 4XKVA 5J8CA 2HR3A 3OOUA 2LF7A 1E3OC 2R7WA 2O5RA 5ERIA 3F3XA 1LB2A 2LBFA 5ILSA 1YS6A 1W7PA 5LRSA 2LC2A 3K4NA 4LLNA 1PUEE 3JRGA 4I0AA 1XGSA 1U6GA 4KYWA 3ZQ7A 5BPIA 3ASOH 1S72I 3CC4I 4V19K 5FLMJ 2F5CA 2HKXA 2NVTJ 3H35A 2GXGA 3ECHA 2R7VA 1BR1A 4GCVA 1XSDA 4I2OA 4RGUA 1BI3A 3L2VA 2BHZA 2Z16A 5DUIA 4ZZDA 2CFOA 3HOWJ 5ED4A 1AOYA 2L9SA 9ANTA 1UCRA 4G12A 1MKMA 1S7AA 3C2BA 1H89C 2QSHX 4HSTA 3H3VK 5KAFC 1Z21A 1DQUA 3CMAI 2ESNA 1B9NA 3OSFA 1NG7A 2M9HA 4Q48A 1QVUA 3GFJA 5AONA 1FP2A 3F8FA 5K7ZA 4CXFA 1AU7A 1WJBA 3I4MJ 2EBIA 4JX4A 3GTKJ 1FZPB 1L0OC 3ZMSA 4I6ZA 1FJLA 2MH2A 5J47A 1ZREA 2QENA 4P96A 2H8WA 4HOBA 3DLLF 2R92J 1OYWA 1BOBA 2DA3A 4HX8A 2UXNA 4F93B 2A07F 4BHPA 1K78A 5IYDJ 2MGQA 1YYVA 4JX6A 1Y8QB 2R0QC 4D9JA 1JKRC 4HBLA 4CZCA 3BG7A 2KIUA 3X2QH 2VQGA 4MNUA 1E0EA 1AKHB 2ME6A 2L9VA 1Y6IA 3CP2A 1X58A 4J01A 2QBYA 3MN2A 4E7JA 3W6JB 2HPIA 3N4MA 2O3FA 1RESA 2IGNA 2DFFA 2DA1A 3CCEI 1TW3A 2Y9YA 2WAQA 1SFUA 5ICGA 5JHFA 3IUOA 4HG2A 4XLEA 2HYGD 1XSXA 3E7LA 3ERED 2MBFA 5FLXZ 2XAFA 2DFHA 3G1LA 4MEYF 3JR9A 1UFMA 2EZLA 1TW2A 2KDZA 2VQHA 4HQMA 3MFKA 2CUEA 3QOEA 3KZIC 4ZZLA 3LNQA 3P9CA 1JHFA 4MHGA 2MLGA 5IP7J 2EINH 3TQNA 4OMZA 4AC0A 3LSPA 5F1RA 2CW8A 1YIOA 1OCOH 5BMZA 2K9MA 1U0JA 4B44A 1NHAA 1RIOH 2O0YA 3V4GA 4EATA 3GWZA 1ZK8A 3MWMA 3HJEA 3TKYA 1W4MA 4I09A 1JT0A 3RKQA 3KZZA 3S15J 3CUQB 3QYEA 2OCEA 2KRCA 3RSNA 1IRXA 5M5WJ 3R0JA 3TMOA 1ETKA 5CLSA 2L3DA 1U8BA 1YO5C 1RKWA 2XAUA 3I3LA 1MGTA 1BN5A 3UNGC 3WGHA 2MC3A 2LNBA 4KN4X 4L9VA 4HA8A 4NC8A 3Q9SA 1BI2A 2EFWA 4LITA 2YR2A 5GTIC 4Y3OA 3JCUC 4E7KA 4BJ5C 3GMEA 1FYMA 1XMXA 3IP4B 1D1BA 4F7ZA 2JZYA 3HBLA 4R79A 5D5WB 2DODA 3WTYC 1X1PA 2DFIA 3RTRA 4HF0A 3N97A 5EDNA 2VPRA 5D6EA 2Y31A 3NARA 3HPHA 1MJBA 2LP0A 1BW6A 3F8CA 5EGOB 2M30A 4LK1F 1B9MA 3KYCB 1LQ1A 1F4KA 2HOTA 2W1OA 3CCRI 2HKOA 1Y1WJ 1MBFA 1MZBA 1I6XA 2R5YA 1IV8A 4ZJZA 4LK0F 2V9KA 5TJJA 3V7RA 3LSHA 2Y0SA 1N77A 4DYQA 5B1BH 2BY0A 3SDBA 1JUMA 4GGGA 2EWNA 1I3QJ 4YIRX 1LJ9A 3CJSB 2ZJQF 5E3NA 5FLVA 3I53A 2LG4A 2Y2ZA 3GTLJ 5JLXA 2LH9A 2FQ4A 2IJLA 2EZIA 3GYHX 4YFKF 4A3BJ 3BR3A 3HSRA 4P5OA 1ZR4A 5HDKA 4ZYHA 1ZELA 3CCJI 3OOPA 1H9GA 2E19A 1R4MB 4C3HJ 2F4MB 5E17F 2DA7A 2ZSHB 3NEUA 5CVRA 1T2KA 2NS8A 3CC7I 1TNTA 3AG1H 2Y30A 1F1ZA 4CSWA 1MMSA 1DUXC 3IAS2 2E2IJ 1NTCA 1HSJA 2WV1A 2V1DA 3OS1A 3BTCA 3C2HA 1FT9A 5J4YA 1GV2A 4XORA 4JYKA 2ID3A 4RGSA 1LFPA 1U5TA 2P7VB 3T5XA 3RI4A 4G7ZF 4XR6A 2V4JC 3ZR8X 4HF2A 4FE7A 1ETYA 3KP6A 1E2XA 3E5UA 1BJAA 5IY5H 1GXQA 1D0XA 1QHGA 1YRNA 3GLLA 1RNLA 3H5AA 4D1QA 4PJLA 3CCLI 1SEUA 4U0VA 3H3UA 3RIRA 4F3QA 5D4RA 4CHUA 4IHYA 2M3AA 2Y0MA 3KP2A 2JQ7A 1HCRA 3A01A 5E8GA 2K9QA 3I59B 2VOPA 5J1RA 3V7SA 3TDZC 1TT5B 4AIHA 3P7NA 1IRZA 2WA0A 2MABA 1HXDA 2AXLA 3LSGA 4LJZF 2I8DA 5IP9J 4X0GA 3S3MA 3LSMA 2A5YB 5J40A 3HYIA 3A02A 2ZB9A 2H27A 3T0YA 5CQEA 4IVNA 4YIFA 2EB7A 3FF5A 4B48A 3HSEA 2DO7A 5BQTA 2K9NA 4LLLA 2IS6A 2PJPA 3I71A 5D8LB 2XC7A 3LOCA 1GUUA 1JGGA 2VT2A 2Y0SN 3DWLE 2X6XA 1JKQC 5B66C 2ZNZA 2QQ9A 2QKMB 2X51A 4A6EA 3KEQA 4GFBA 2P5LC 3KP4A 3HHGA 3IH3A 4EJVA 4E70A 3NWSA 1IN4A 3WU1B 3Q0WA 2EV6A 2M1BA 2HOAA 1TC3C 2FXAA 3P9IA 2F5EA 5AIQA 5EEAA 4A3FJ 3IWFA 2VKHA 3GO5A 3IKTA 1UHWA 3JSPA 1PP7U 4CZZA 2XAJA 2DMPA 3CMMA 1ZRDA 3DPLC 5KCMA 1YG2A 3FX3A 3S1NJ 1Z0XA 4LGWA 2OZ6A 1MJ9A 2BV6A 3OYGA 4IHSA 3M1EA 1LVKA 2QSGX 4CO8A 4A6DA 4BE0A 4Z2YA 3SEQA 3VYUB 4AWXB 1V54H 2LREA 2RV8A 1IO2A 2HXIA 1L3LA 1YS7A 4E7SA 2R5ZB 3QWLA 2E1MB 5L3BA 5FKMA 4HX4A 4NNJA 3OY9A 1G3SA 4G6QA 2X4HA 3BJ6A 2IGOA 3MKLA 3SZPA 1I39A 3CDIA 1Y56A 4X1EA 4HPQA 1I6HJ 2NS0A 3IHUA 4J19A 3FBNB 4N9IA 3HDDA 1X2NA 2A05A 4A0ZA 1JE8A 3F22A 4FISA 3S1QJ 3FMRA 4E7LA 4OMYA 5GAHJ 1UG0A 4ENKA 3K4BA 1U9OA 2JWTA 2W24A 2V1XA 3K9TA 3TOBA 1U78A 2DN0A 3LFKA 4E4HA 4L0YB 3FMQA 1OQYA 4DBRA 2PEXA 4HW0A 1SFEA 4IX7A 2CRGA 1FYLA 4B09A 4OWRB 2I5UA 4CCLA 2ELHA 2XGXA 3FISA 2CUZA 5DCFA 1ZGAA 3E6MA 1P2FA 3HEFA 2COBA 1OCPA 1FSEA 4B3AA 1JKOC 3RPQA 3QYFA 1ODDA 2FBHA 3EQLF 5FRNA 1JHHA 1G3YA 2KJCA 3J81K 3RZDJ 3CJQB 3OYEA 2XIGA 4DNCA 2YU9J 5CKTA 2ELJA 4TV7A 1XSVA 1FOWA 2DMQA 2LR8A 2O7OA 2JA8J 3E1SA 1MH3A 2HXOA 2OQRA 3BR5A 5B3SH 1YJWI 2D2WA 5A2QZ 3I64A 2E2JJ 5KHDA 3DU6A 1ETWA 4KISA 2Z33A 1XCBA 3WU0A 3GZ6A 2B63J 4LB5A 2A69F 2DW4A 3K1PA 2W25A 1A04A 3SYTA 1U3EM 1FTTA 1XB4A 2K5CA 1AKHA 1LDKB 2HGCA 1JGSA 2CH0A 2FMLA 5DM6F 2VL8A 1UB9A 2ZXHA 1T38A 2EZKA 1LVAA 5IPAA 4RS8A 1ZH5A 2BVMA 3S2WA 3HOSA 3M3YJ 3H9JA 4ENJA 3HOVJ 2Y48A 5IYCJ 4A3IJ 1OJLA 5J3LA 2BW3B 4XKWA 1J9IA 1UG2A 5D5XB 4BE2A 4HYEA 1X4OA 4AU7A 1HKQA 4IHWA 4LG0B 1LDDA 2XAGA 4ZYDA 1JTXA 1N25A 2HDWA 4IXAA 4DJAA 4ESFA 2LLKA 3I5UA 3OYKA 3HKZA 4CICA 4BS9A 3K0LA 3HTUA 2HQAA 2FJ1A 2L5QA 2VXDA 4NB5A 4R8HA 4UUTA 1B72B 3VFZA 3TEDA 1RI7A 3M8EA 3S1RJ 1KQ8A 3CCYA 1TBXA 3U9GA 3OIPA 3WG7H 4EVIA 1YOVB 2IA1A 4C3IJ 3ABKH 2OF7A 3KLNA 1X3WB 3FM3A 3RZOJ 2D45A 3O2PE 3F9KA 3GF2A 2KFDA 1RETA 2OJED 2FD5A 2ZKZA 4D7MA 5CQGA 2MC4A 1OISA 1J59A 1ZYRF 1A35A 1FOKA 1MMDA 1I1GA 3DBHB 5GAEJ 4BQAA 2X1DA 3BTLA 4N4OB 4Q5SF 3OS2A 3V8KA 4RA2A 4KT6A 3T8RA 4FASD 2DDBA 3DBLB 4AD9A 1J2XA 2HI3A 2XGDA 1MNMC 3BQYA 1H8AC 1IDYA 2X48A 1Z91A 4PUSA 3SQNA 1T0FA 1ZARA 2EA2A 2KDOA 1JTYA 4M3FA 4PJ0C 1TQIA 2JJ7A 3OYHA 3M7GA 5IYBJ 3WTZA 2WY7Q 1IGNA 2A68F 2K7LA 1AHDP 2PI0A 4ITVA 3LA2A 5EGOA 3G73A 1IZ1A 3TW6A 3J81Z 1FSHA 1WI9A 1MMGA 5LGUA 2HDDA 4OAYA 1YQAA 2LY1A 3FMSA 3HG9A 2ELKA 2IA2A 4EM1A 4CYDA 2CV2A 3DV8A 2M8GX 3FXQA 2ESHA 3SZTA 3IKVA 5HLHA 2F4OB 3A4CA 1KU3A 1JKPC 3OYIA 2K86A 2XSJC 1OCRH 5DD8A 4EMSA 2DOAA 1IN6A 5HLIA 1YX3A 1YI2I 1ZRFA 2VONA 1SAXA 2LRDA 4IQJA 4UB6C 4RBOA 4F52A 3R0AA 1RZ4A 3ABLH 3WODF 3HKZN 4M72A 3ZMZA 3FZVA 2JPCA 4E7HA 1T33A 3KEOA 2DJIA 2VJ4A 4WXHA 1Y0NA 1T39A 3VODA 4I0BA 1ETOA 3E6CC 2HVQA 3H5NA 5J6XA 1ITYA 1T8IA 4D0PA 1XPXA 2BY3A 4XLCA 3GVAA 4G9YA 2P7CB 2F4IA 2H1LA 4D5CA 1DGRM 2R7OA 3LSKA 1IUFA 4M6YA 3PNYA 4P9UA 2EA4A 1U8RA 4UVAA 4NBQA 1LE8B 4A0XA 2VIXA 3PNVA 4B3XA 4Y7NJ 1ZG3A 2E1CA 4XRSA 1ZLJA 3ZQGA 2R3SA 2M7BA 3J80K 5FO5A 2E36A 4PZJA 1SD7A 4GXOA 4E7ZA 1F36A 1GLNA 2A3SA 4RM3A 2NXNB 1O3QA 2RVCA 4C3JJ 2W7NA 2QQBA 1TWFJ 2DPUA 2ECBA 4Y17A 1P6RA 1TP4A 3EUHC 4DW6A 4S0HB 3RQIA 3PL8A 3VSLA 2CGPA 4KIGA 2NVXJ 4GRIA 4K2EA 2XB5A 2Z99A 3CC2I 1W7PD 2M8EA 4ZYGA 2O61A 2DMNA 3JRCA 2VOOA 2RN7A 2HZDA 5FLXK 1J09A 2ZFUA 2V9PA 3WHBA 2W48A 1I50J 2OAZA 3ZQHA 3IV5A 3C3WA 3BJOA 4UUSB 1ETQA 5EZHA 2V6EA 4IHVA 1VQ6I 5AIPA 2ZCWA 3ECOA 3M4OJ 3L1PA 4A2UA 3N05A 3WG9A 5C3EJ 2C6YA 1JT6A 2FNAA 3L00A 2X6WA 3H1CA 4PJNA 5M5YJ 4L9NA 2KKOA 4XKCA 2V1NA 2DFEA 4RGXA 2RNJA 2CS3A 1WWXA 3QPLA 2MLKA 1LEBA 1WIBA 1N75A 2DMUA 2MH9A 4BJTA 1W0TA 2ISYA 2XROA 1U9NA 2QGUA 1F5TA 1IRFA 2E5NA 5F04A 3L09A 2EFNA 5F08A 1OPCA 4L0ZB 2PFBA 1MBJA 4FQGA 3Q0VA 3ZMVA 1APLC 3RYPA 1WGXA 1REPC 4KN7X 4KUMA 2LYCA 3SFZA 2Z1DA 2K9SA 5F1JA 2CG4A 2EIMH 5E1XA 1BOAA 2XGCA 4CH7A 5IOYA 4LG3A 4AUXA 1PVEA 2V7FA 1IN7A 5FFXA 3IH4A 3AAFA 2COMA 2R5ZA 4U87A 1WPKA 3E5QA 5TISC 4MTEA 2L01A 3E0JB 4M9ZA 1BBYA 2EILH 3S14J 2ZO4A 3M07A 4M3BA 2DU9A 1VFCA 1MBHA 2X1EA 4HDVA 1IDZA 4DIQA 1P4AA 1R4NB 2MSYA 3FXJA 3PSIA 5KAIC 3HRTA 3LMMA 3ZQQA 3PIPF 2RC4A 4PFPA 1TNSA 1FLIA 1HDPA 4MEXF 3PQJA 1WZ2A 2MW8A 5LGNA 2PJRB 2HTSA 2XAHA 1WJCA 2H6CA 4UUVA 1MW7A 3BR2A 1HA8A 5B5EC 2EZHA 3DXJF 3GW2A 4Y13A 2M7AA 3DLAA 3VYRB 1TQMA 1Z1DA 2XASA 4PJMA 1DGWY 5FD5A 4D5FA 3J80Z 1D5YA 2E60A 4BNCA 3ZPLA 1V3FA 1WRJA 1I5ZA 3FDYA 4F91B 1ZN2A 3JRHA 3PUBA 3TDUC 2CQKA 4FCYA 1Q1HA 3W6VA 3R61A 3VYSB 4AIKA 4U0WA 3UKGA 3G3ZA 4B8XA 2L7FP 4EJTA 1FTZA 4DBQA 1Y39A 2QM3A 1DU6A 4M3EA 3LA3A 4AIDA 1ZQ3P 3OYBA 2ZXIA 3HTSB 3V8LA 2NVUB 3HOYJ 5TGTA 4HF1A 1OCTC 1TWHJ 3AKZA 3BZKA 1PYVA 3KPHA 1W5CC 2HU9A 4I98B 3S3NA 1HW1A 2ZMEB 4RAYA 4U7DA 1ACIA 1IG7A 3H36A 4YFXF 4WX9A 4HDUA 2J5OA 4A5MA 1I27A 1F9NA 5JVGF 2AQEA 4XKBA 5LEJA 2E1OA 3HRSA 5HDNA 2AQFA 1O3TA 1GVDA 1FMVA 2DA5A 4DYCA 3BY6A 2Y9ZA 3M9AA 3ZN1A 2FUG2 2IP2A 1MMAA 3B6CA 2K40A 1Q1VA 4OINF 4N4NB 5HS8A 1MNEA 5GAGJ 1VQPI 4IRIA 2BW3A 5KK1A 2P6SA 4HV5A 1GV5A 2G7HA 3FBIB 2PG4A 4LG0A 1HW5A 3FIWA 2BE5F 1AWCA 1D8JA 3NWTA 2VQCA 4XLAA 3TBIA 1EH6A 4YRVA 1IN5A 2J5PA 5DS9A 3I55I 3ZP5A 2W00A 1X1DA 3A0HC 1LNWA 2ECCA 2X6YA 2DBBA 2V79A 4ESBA 3DU5A 4FX4A 1B72A 1QRYA 2RQPA 3ZCOA 5M5XJ 2IGMA 3J7YJ 3C18A 3KZYA 4IZZA 4A3DJ 2I10A 3KP5A 2V9VA 2DYSH 2GZWA 2K27A 3BQZA 4II2A 3TGNA 2K9LA 2CU7A 3K4CA 1FIAA 1EH8A 3IRRA 3MQ0A 4J00A 4C2UA 1D1CA 5L3FA 3DEUA 1ULYA 4WK8F 1SD5A 1MBGA 3G4SI 4IO9F 5H6RA 2DQRA 3WTSC 1VI0A 4UVBA 1E3HA 3K4LA 3H3ZA 4IRGA 4D7NA 2JPBA 1KZHA 5IT9Z 1VQLI 4NUBA 4CUGA 2CQNA 3U1DA 4N9HA 1R71A 2WAQN 5M3MJ 4N0BA 4L5JA 3OS0A 5D5VB 2VB6A 4A3GJ 4JQFA 1KA8A 3DTKA 3AL0B 4ZTFA 2QWWA 4JK1X 3BLYA 1ON1A 2GBYA 4KJZA 2LTPA 3CZ6A 2YX4A 2VC0A 1Z7LA 1BI0A 5DD4A 3ISPA 5C4XJ 4ZH4F 4HX7A 1GHCA 1STZA 3HGGA 3VWBA 3WTVC 3H0DA 1HSTA 3L2RA 3EPZA 2R7FA 1QGPA 3P5JA 2UZKA 2IGKA 1ORKA 3D5SC 3VOEA 1GXPA 4EJWA 1ZGJA 3JAMZ 2VODA 5CJ9A 3FHNA 3CCSI 4M9SA 5FD6A 4EGZA 1P92A 3WE3A 2BVLA 3WE2A 5BNGA 1UZCA 1SC7A 1BJZA 4OIPF 3W2WA 4GYGA 3VSKA 3BTJA 4KITB 3OYAA 4G6TB 4YFNF 3HPGA 3TP3A 3Q5FA 1ZTRA 3G1MA 3SXYA 2WAEA 3F6VA 5DCMB 4EQQA 2M4GA
chains in the Genus database with same CATH topology
2E34A 3CMAI 1VQOI 1VQ9I 3CMEI 5GADJ 3CF5F 5GAGJ 1VQPI 1FOYA 3I56I 3CD6I 3G6EI 1YI2I 4IOCF 5DM6F 2ZJRF 2E35A 2QA4I 3CCRI 3I55I 1YJNI 2H8WA 3DLLF 3J7YJ 4IOAF 1VQ8I 1HC8A 2OTJI 3CJSB 2ZJQF 2QEXI 3CCMI 2K3FA 3PIPF 1QA6A 3CJTB 3G4SI 1VQ7I 4IO9F 3CCVI 3CCEI 3CCJI 3EGVB 2E36A 1VQMI 1VQLI 3J7ZI 3CC7I 1MMSA 2NXNB 5DM7F 5GAHJ 1YJ9I 3CJRB 1YHQI 2ZJPF 3CC2I 3CCUI 5GAEJ 2OTLI 1Y39A 2FOWA 1VQ5I 1S72I 3CC4I 4V19K 3CCLI 1VQ6I 1YIJI 2JQ7A 4UY8I 1ACIA 3PIOF 3G71I 1VQNI 3CJQB 3CCSI 5JVGF 1YITI 1FOXA 1WIBA 1FOWA 3CCQI 1VQ4I 1YJWI 1VQKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E34 A;  3CMA I;  1VQO I;  1VQ9 I;  3CME I;  5GAD J;  3CF5 F;  5GAG J;  1VQP I;  1FOY A;  3I56 I;  3CD6 I;  3G6E I;  1YI2 I;  4IOC F;  5DM6 F;  2ZJR F;  2E35 A;  2QA4 I;  3CCR I;  3I55 I;  1YJN I;  2H8W A;  3DLL F;  3J7Y J;  4IOA F;  1VQ8 I;  1HC8 A;  2OTJ I;  3CJS B;  2ZJQ F;  2QEX I;  3CCM I;  2K3F A;  3PIP F;  1QA6 A;  3CJT B;  3G4S I;  1VQ7 I;  4IO9 F;  3CCV I;  3CCE I;  3CCJ I;  3EGV B;  2E36 A;  1VQM I;  1VQL I;  3J7Z I;  3CC7 I;  1MMS A;  2NXN B;  5DM7 F;  5GAH J;  1YJ9 I;  3CJR B;  1YHQ I;  2ZJP F;  3CC2 I;  3CCU I;  5GAE J;  2OTL I;  1Y39 A;  2FOW A;  1VQ5 I;  1S72 I;  3CC4 I;  4V19 K;  3CCL I;  1VQ6 I;  1YIJ I;  2JQ7 A;  4UY8 I;  1ACI A;  3PIO F;  3G71 I;  1VQN I;  3CJQ B;  3CCS I;  5JVG F;  1YIT I;  1FOX A;  1WIB A;  1FOW A;  3CCQ I;  1VQ4 I;  1YJW I;  1VQK I; 
#chains in the Genus database with same CATH topology
 1Z3X A;  2IS4 A;  2H6B A;  1XDS A;  3BOQ A;  4BE1 A;  1MJA A;  5CVI A;  4YG2 F;  4BBR J;  1IXR C;  1G3W A;  2M45 A;  2IVM A;  1P9Q C;  2VBX A;  3F21 A;  2DOE A;  2NAZ A;  3JRF A;  3WTW C;  3V7C A;  2F2E A;  4M74 A;  3JW4 A;  3JSO A;  4IL6 C;  4O3M A;  1Y1V J;  2JUG A;  1P7J A;  2KLO A;  1R49 A;  1UEL B;  4I01 A;  1LE8 A;  1QNT A;  2VAS A;  4EM2 A;  5A2Q K;  1IXC A;  1QHH D;  5FRM A;  4OIO F;  1WJE A;  3B73 A;  2H1K A;  3PO2 J;  2NS7 A;  2KIQ A;  4LD5 A;  2VE8 A;  4FHT A;  3KLO A;  3MKZ A;  1FC3 A;  5LD2 C;  3QP5 A;  2QF7 A;  2BY2 A;  1G6N A;  5IT3 A;  2BYV E;  2LF8 A;  2A6T A;  3TO6 A;  2OTJ I;  2JRM A;  3BR1 A;  2QEX I;  2GXA A;  3SJM A;  2VJ5 A;  5FB2 A;  4KIC A;  4C9Y A;  3CQZ J;  3CES A;  3LFU A;  4IJA A;  5BS6 A;  4M3D A;  4U7B A;  1OMI A;  1TTY A;  4PSW A;  1YFH A;  2L9N A;  2Q1Z B;  3E97 A;  4UV9 A;  1T6S A;  1HW2 A;  4FE4 A;  2CO5 A;  1NK3 P;  2ZC2 A;  2IBD A;  2CW0 F;  4M6V A;  1OCZ H;  1HKT A;  3OMY A;  2Q8K A;  4P55 A;  4UUS A;  3L2W A;  2BXY A;  2QVO A;  1Y8R B;  2UV1 A;  4FET A;  3GFI A;  2VC1 A;  1R5I D;  2LBF B;  2YPR A;  2K3P A;  2KZG A;  4XK4 A;  2F5V A;  3QU3 A;  4WWC A;  3CP8 A;  3M1C A;  3B6A A;  4M71 A;  3HZJ A;  1A5J A;  2CQQ A;  3KEY A;  2JRT A;  2Z5U A;  1CF7 B;  1O7L A;  2YSR A;  4RDU A;  1VQ5 I;  1FNN A;  2HQN A;  5ILU A;  1XGO A;  2Z3Y A;  1R1T A;  4KMU X;  3SHF A;  3WGG A;  1JUP A;  5DV5 A;  2FMY A;  3O6B B;  5L3E A;  3JRD A;  3KYL A;  2V1U A;  2L4A A;  4Q47 A;  2QCO A;  3FHZ A;  4ESJ A;  2V6C A;  1JJ8 C;  4YEJ A;  3S8P A;  3IAM 2;  1XTA A;  1K4S A;  2BOL A;  1MBE A;  3DBR B;  4A3C J;  3IH2 A;  2D1V A;  5EYR A;  1CGP A;  3A0B C;  1A31 A;  3FM5 A;  2NOJ B;  2X85 A;  4CGZ A;  4XID A;  1ENH A;  3GZN B;  1B1B A;  1OLT A;  4Q4Z F;  5FFZ A;  3LSI A;  2HYJ A;  4RAZ A;  1G59 A;  5GP9 A;  1FEX A;  3QQA A;  3AG2 H;  3J7A O;  4QTR A;  1S6L A;  5LHH A;  3CLQ A;  2R7Z J;  3GLX A;  3ELK A;  3FXU A;  3T8T A;  4XBF A;  1PUF B;  1X19 A;  2QQ8 A;  4W97 A;  1LKX A;  4CCO A;  2RRE A;  2KRF A;  2KIF A;  2ZJR F;  3LSJ A;  2L54 A;  2L7K A;  2PMZ A;  2BY1 A;  1FX7 A;  1PP8 F;  1N78 A;  3DPU A;  3VEP A;  3QP6 A;  2PJR A;  1RKT A;  1F43 A;  4XN0 A;  2JA5 J;  4UVC A;  1U2W A;  4UHT A;  1QZE A;  2LMD A;  2XUB A;  3HL2 A;  4QLC U;  1QBJ A;  2OUM A;  1V5F A;  3EUA A;  3I54 A;  4WF2 A;  3RDI A;  2RDP A;  3CJT B;  1K79 A;  4LIU A;  3CTA A;  4M9X A;  1ETX A;  3BC8 A;  1JXS A;  3L2C A;  2GA2 A;  5IOZ A;  5HLG A;  2R7R A;  3CUO A;  4GDF A;  2XAQ A;  1WH5 A;  2MD5 A;  3U2R A;  4XLP F;  2ADU A;  3GXO A;  3J7Z I;  2O03 A;  2WAD A;  5ICC A;  2VBZ A;  4CYC B;  2BHY A;  1BC7 C;  1UHM A;  2FQ3 A;  2PX9 A;  2HZT A;  3D1N I;  5DM7 F;  2EQR A;  3OYF A;  1S8N A;  4JX5 A;  2ZME A;  1IW7 F;  4A3J J;  3A2K A;  3F6O A;  3VDX A;  4GYI A;  2GWR A;  4L9J A;  2ZXW H;  3MCZ A;  4UB8 C;  2M34 A;  4XQF A;  2OTL I;  1R23 A;  3S32 A;  2B7E A;  3DKW A;  4L18 B;  2M2E A;  3OR1 C;  1XGN A;  3H92 A;  4BXU A;  2TRT A;  2FOK A;  3GTO J;  5J1U A;  5DUK A;  4DOZ A;  1TL8 A;  3P9K A;  1PJR A;  1K83 J;  3PJR A;  5K5O A;  3G71 I;  3CUQ A;  1IV6 A;  2JA6 J;  2HEO A;  4UV8 A;  5D5U B;  3FXO A;  4ZDL A;  2DYR H;  4HSR A;  4BUP A;  2Z9O A;  1FWZ A;  5FRO A;  2CUF A;  3K70 C;  4EGY A;  1MSE C;  3F8B A;  5C44 J;  1BR4 A;  3DTI A;  2E5Z A;  1SVL A;  4Y33 A;  3OWT A;  1VQ4 I;  2X6O A;  2CFX A;  1XGM A;  2PN6 A;  2PMZ N;  2HVR A;  2Q0O A;  4XRS G;  3KET A;  1S3J A;  2W82 A;  3L2U A;  1FBQ A;  4L9T A;  1VQO I;  3HRU A;  4V2G A;  1ZG1 A;  1ZAO A;  4RLF A;  4AYB A;  1Z3Y A;  2AS5 F;  2VT3 A;  3T1B A;  1X1C A;  1YLF A;  2XDV A;  5J8F A;  5E3O A;  3RKW A;  1EKE A;  1V5E A;  3K6G A;  2EPF A;  2M0C A;  1KGS A;  1Z77 A;  1IAW A;  3KYD B;  3KP7 A;  2L2O A;  4JOM A;  3S93 A;  4ENN A;  4I99 C;  3ZQF A;  2E35 A;  1EF4 A;  2XKO A;  4LIV A;  1NG6 A;  2VBY A;  3HUG B;  4NDL A;  4AVP A;  4GO1 A;  3WHC A;  3TOA A;  1O3S A;  2F48 A;  3ZQC A;  4MTD A;  3DEE A;  4A93 J;  5F27 A;  2DK8 A;  3R6S A;  1PDN C;  1B4A A;  2BBY A;  2Z2S B;  3BT9 A;  4QWQ A;  1GDT A;  1DPU A;  2YU3 A;  1XMK A;  4IF4 A;  3OR2 C;  1LFU P;  2XRN A;  4Y4R A;  4HQE A;  1OR7 A;  4BAC A;  4RGR A;  3BG5 A;  3QU6 A;  3OYL A;  1VND A;  2D1H A;  4S04 A;  1GT0 C;  3E6B A;  2X9D A;  1LPQ A;  5FKO A;  3K1M A;  5LGT A;  1Z67 A;  1YTY A;  2YX7 A;  2LKX A;  4CCJ A;  1R00 A;  2DTR A;  3DKX A;  1WJA A;  2A6E F;  1D8K A;  5HVQ C;  3ZQI A;  2ID6 A;  4M73 A;  4NQW B;  4U88 A;  3F72 A;  3EET A;  2HVS A;  2FF4 A;  2ZSI B;  3K70 D;  1T08 B;  2KIS A;  3GTJ J;  1T56 A;  3TO7 A;  3U21 A;  2E1M C;  1TWG J;  2GOM A;  2TDX A;  2KT0 A;  3HXL A;  2OV7 A;  2Y75 A;  1YHQ I;  1W0U A;  2E7X A;  1IF1 A;  2KRH A;  3K2Z A;  5KVR A;  3ROU A;  3RPU A;  3CF2 A;  3FXM A;  1EV7 A;  2O9L A;  2VKE A;  3QPH A;  1YRN B;  2M4K A;  2LY2 A;  2XPV A;  4BL0 B;  2IT0 A;  2FOW A;  5H2F C;  3E6D A;  2KIM A;  4LMY A;  3BG9 A;  1JJ6 C;  2CYY A;  3CO6 C;  4JP0 A;  2WB1 A;  1A6Q A;  4P1W A;  3DFG A;  5FKN A;  5DCM A;  3PQK A;  2DPD A;  3HGY A;  4UY8 I;  2DI3 A;  1VQN I;  2DMT A;  4AYB N;  4CCK A;  4X6A J;  1YIT I;  2DTZ A;  2HS5 A;  1QQI A;  1SMT A;  1FOX A;  2RQQ A;  3EDP A;  2FU4 A;  3I59 A;  4PDK A;  4ABZ A;  2DA4 A;  3L7W A;  1MH4 A;  1Y0U A;  3BR6 A;  1KYZ A;  2NOG A;  4YII A;  4DGW B;  2B9S A;  2IW5 A;  2CUJ A;  5H6Q A;  2VLA A;  1G3T A;  3I0T A;  1VQK I;  2E34 A;  3OYM A;  1VQ9 I;  3PFY A;  3PSF A;  1RRJ A;  3BCB A;  4XLH A;  1KU9 A;  2VPL A;  1RR8 C;  3JRE A;  5K7H A;  1RR7 A;  3MZH A;  3E3V A;  4O5V A;  4BBS J;  3TO9 A;  3HOX J;  4ENM A;  2PMU A;  4IPA A;  1SFO J;  4ZYE A;  5LEK A;  2HNH A;  2CWE A;  3EYI A;  5C4J J;  4KMF A;  2OC6 A;  2F5D A;  4CDG A;  1MDM B;  1EH7 A;  1OCC H;  5HOO A;  4PCQ A;  2XSD C;  1R7J A;  1R6R A;  4MFE A;  5JLW A;  3CCM I;  2K3F A;  4S05 A;  4BKX A;  3ZMU A;  3BP8 A;  2DK5 A;  4FX0 A;  5LHI A;  1OFC X;  4E7I A;  5BOX A;  4A3L J;  2KP6 A;  2JSC A;  3S2H J;  2ETH A;  2E71 A;  4F92 B;  2LOO A;  4WXD A;  5IP6 A;  2H94 A;  4OIR F;  4RAF A;  1R5G A;  4KIB A;  1FBS A;  2JTV A;  1D0Y A;  3CDH A;  1CF7 A;  2Y69 H;  3AG3 H;  4C2T A;  4KNY A;  4ZDP A;  5K7F A;  1XDU A;  4G7H F;  4QSH A;  4HRI A;  1X3Z B;  1LUJ B;  1S29 A;  1BL0 A;  1FP1 D;  2JVH A;  2WB1 N;  3MEX A;  4BJ6 C;  3QOP A;  1ON2 A;  3QPS A;  2GOX B;  3CJR B;  4BEH B;  2DJN A;  5L3D A;  2CQ7 A;  3OIQ A;  3ZN0 A;  5IT9 K;  3O3K A;  4PSX A;  2O6G E;  3LSR A;  4IEJ A;  4A0Y A;  2DT6 A;  5GPC A;  2GAU A;  1AA7 A;  2ME0 A;  2ZFW A;  4PGH A;  1TWA J;  5JVT A;  1J0R A;  4U0Y A;  3FXL A;  2VUM J;  2KQR A;  2BGC A;  2OD5 A;  3QOD A;  1S7O A;  3ZOB A;  1FMW A;  2WTE A;  2KPM A;  4CCN A;  3ULQ B;  1QU3 A;  5LHG A;  2A6H F;  3ZRG A;  2ISZ A;  4XON A;  1PUF A;  4ZC3 A;  1J7K A;  1R58 A;  2R7Q A;  2EFO A;  4L5E A;  3DCF A;  5CPR B;  3BRO A;  1BI1 A;  1LFB A;  4KA4 A;  2ACJ A;  3EUH A;  3H5R A;  2CMP A;  1VF9 A;  1A6I A;  4G6D A;  1HLV A;  3LQR A;  1S7E A;  2LKP A;  4II3 A;  2KHM A;  1D3Y A;  3JAM K;  1P7I A;  4XRF A;  1VZ0 A;  2E2H J;  3S16 J;  2XGE A;  4XIC A;  1HQC A;  4XSX F;  3ZMD A;  5CVU A;  1FOY A;  2P5V A;  3L9F A;  1UST A;  5E1Z B;  4XN3 A;  4CCM A;  3G6E I;  1ZR2 A;  3WTT C;  3JTH A;  1IRG A;  5D4S A;  4ON0 A;  2LFB A;  2O8X A;  1XD7 A;  3HSF A;  1IJW C;  3BPX A;  4BY1 J;  3GEZ A;  1K6O A;  1KYW A;  3F23 A;  2W4S A;  1T95 A;  2F5F A;  2UXX A;  1G8X A;  4MO7 A;  4LLG F;  3ABT A;  3CO7 C;  1U5T C;  5FJ8 J;  2WV0 A;  1UMQ A;  2K4B A;  3DP7 A;  3O8G A;  2P0W A;  1C0W A;  2LDU A;  2XF7 A;  2LSO A;  3CJN A;  4CYC A;  1K7A A;  5KNL A;  4DYR A;  3JRB A;  3J7A Y;  5LRR A;  2FNP A;  1XC5 A;  4NC6 A;  3W2V A;  1DP7 P;  1WJD A;  3FKJ A;  1JI8 A;  2MG4 A;  2A5W A;  5DYM A;  2FX0 A;  1HKS A;  4OAZ A;  3OIO A;  3CMY A;  1SFK A;  2HFH A;  4B4C A;  4B43 A;  2NYX A;  2QYO A;  3F8M A;  1O7F A;  2IRF G;  3EGV B;  2RKH A;  3CDL A;  3LA7 A;  2DA6 A;  2M87 A;  2CJJ A;  4LOC A;  4IHX A;  1FY7 A;  5D6F A;  2MFZ A;  3HOT A;  3QRF F;  2OCC H;  3OYJ A;  5L3G A;  2DDA A;  1HDD C;  1BR2 A;  4MIM A;  2VN2 A;  3MKW B;  1YJ9 I;  1G2H A;  3C7J A;  2P4W A;  1TQP A;  3OYN A;  3OYD A;  3DTE A;  5K5Q A;  3W6K B;  2OQG A;  1X3U A;  1IC8 A;  1B8I B;  3BG6 A;  2WBM A;  1DDN A;  1Z6T A;  2TCT A;  2VQL A;  1TZL A;  3GTM J;  3FXR A;  3MAJ A;  5F0F A;  3BCA A;  3HC7 A;  4WXC A;  2QQA A;  2FSW A;  4DZJ A;  1O3R A;  2XV4 S;  3GFL A;  2AO9 A;  3I4P A;  3PIO F;  2STT A;  1MD0 A;  1WH7 A;  1CQT A;  1RC9 A;  2G9W A;  3MZ8 A;  4LB6 B;  4OOI A;  1USS A;  4PGG A;  3OV8 A;  5DDG A;  4OU0 A;  2HDC A;  2IXS A;  3K4K A;  4E6K G;  2FA5 A;  3HUG A;  1ETV A;  4UNO A;  4KFC A;  1MSF C;  5GAD J;  3CF5 F;  3D5L A;  4MQ9 F;  2HQR A;  1XN7 A;  1V55 H;  2LY9 A;  1FYK A;  3D5R C;  2QUF A;  5F0C A;  4B1R A;  5ICF A;  3PM1 A;  2XRL A;  1WKM A;  2DOF A;  2G7U A;  2OBP A;  2QKL B;  4M6X A;  4PFO A;  3C1D A;  2R7D A;  4KDP A;  3FK6 A;  1W5S A;  1KQ9 A;  1X4P A;  3Q3S A;  2DLL A;  4G8X A;  4BH9 A;  2R7X A;  4A3K J;  2JVG A;  3I4N J;  5GTH C;  2EFQ A;  4HNT A;  2EFP A;  1MND A;  1Z9C A;  1BM9 A;  4IRH A;  1WSU A;  1D1A A;  5E1W A;  3E5X A;  2H8R A;  1V5G A;  4NQW A;  3TL4 X;  5HNH A;  1KQ0 A;  1W36 C;  3Q0U A;  4HAM A;  3RCO A;  2GLO A;  1WVR A;  2W85 A;  3DKY A;  2MA3 A;  4BQQ A;  4RB2 C;  3IWZ A;  2Q2E B;  1RUO A;  1IUY A;  4H0E A;  3HOZ J;  1Z6R A;  4FTH A;  3TP0 A;  1SVM A;  1ZHF A;  2JK3 A;  3G2B A;  3CCV I;  3MZY A;  4FT8 A;  5F6F A;  1TT0 A;  2KJB A;  2NRA C;  3ABU A;  2ZJ2 A;  5EEH A;  4DQ2 A;  1ONV A;  2E1N A;  1V4R A;  3KX2 A;  5EG0 B;  4MQV A;  3U1K A;  5L3C A;  2VXZ A;  2EJR A;  2DT5 A;  5EZG A;  3I58 A;  4XOP A;  5TRD A;  2DAO A;  3M8J A;  3OL3 A;  1EA3 A;  3H9Q A;  4W1U A;  3GBG A;  4BXF A;  2FBK A;  2KZV A;  2EIK H;  2VBW A;  2HTJ A;  3REO A;  1HBX G;  1DU0 A;  1HF0 A;  3KIO A;  2HYF A;  3IRQ A;  3MVP A;  3WTX C;  4XSZ F;  1YE9 A;  4ASN A;  2IPQ X;  2K85 A;  2CV1 A;  2MYS A;  3KFW X;  2EV5 A;  3ASN H;  3LAJ A;  4A3E J;  4JBA A;  2L0K A;  2OPT A;  1QZY A;  2GXB A;  3BR0 A;  5EEG A;  1O4X A;  3UR3 C;  4QPO A;  1RUN A;  3V42 A;  4A3M J;  3V8J A;  1P4X A;  2VJI A;  3S2D J;  3O8H A;  3BPV A;  3RKY A;  2HWV A;  3GTP J;  1SD6 A;  2IA0 A;  4IHT A;  2HOE A;  2XKP A;  2QZ8 A;  1M1E B;  4EJO A;  3SFI A;  2UWM A;  1W7P B;  4BDZ A;  1FBU A;  2OU2 A;  1NH3 A;  2OA4 A;  2IEK A;  4G7O F;  3HM5 A;  4AIJ A;  1E3P A;  4I76 A;  5H20 A;  1W36 D;  4XOT A;  1K4T A;  2FBI A;  2ZME C;  2P5K A;  1H0M A;  1O57 A;  1QO0 D;  1A36 A;  5E79 C;  3S17 J;  4YEL A;  1X2M A;  3I9V 2;  1B59 A;  3AFH A;  4ZYA A;  1MDM A;  1G4D A;  1SFX A;  4BXX J;  1Z7U A;  1R9T J;  2GIV A;  2ZXJ A;  3H0G J;  1W5T A;  3CD6 I;  2PBI A;  2DA2 A;  3K69 A;  4P9F A;  3FXK A;  2KMU A;  3VPR A;  3F0C A;  3Q9V A;  1DPR A;  4H4K C;  1VTN C;  1D5V A;  3ZQL A;  1XG1 A;  4BHC A;  2JA7 J;  3CUQ C;  1R22 A;  2UUZ A;  3IC7 A;  3PFI A;  4BGD A;  1YJN I;  1IXS B;  3K2A A;  1ZKG A;  5J4V A;  1SD4 A;  1X1A A;  3JRI A;  4BHB A;  2L7M P;  3WGI A;  2EH3 A;  2P81 A;  2P8T A;  1KON A;  3IL2 A;  1J75 A;  3BJA A;  1GVJ A;  1HC8 A;  1VQ8 I;  5HOD A;  3GTG J;  1YW7 A;  2B0L A;  2PQ8 A;  5JFR A;  5F64 A;  2BXZ A;  1X1B A;  4Z6Y A;  3K4J A;  4Y52 J;  4C2M J;  3ERM A;  5E3M A;  3K4M A;  4MLO A;  4R1H A;  3VB2 A;  2R7U A;  3KP3 A;  2M0M A;  3EYY A;  4V2F A;  4BEH A;  1BIB A;  1SVO A;  2M5W A;  1JUS A;  4ETS A;  1T0F C;  4XRM A;  4RMN A;  5ICE A;  3B02 A;  1WCM J;  1K78 B;  2G0E A;  2K02 A;  4MFD A;  1VQM I;  3S1M J;  1QZZ A;  3A03 A;  4HV6 A;  3RKX A;  4F55 A;  6PAX A;  4RLQ A;  1WJ5 A;  2LVS A;  5DEQ A;  3LST A;  1WI3 A;  3OL4 A;  3K7A J;  4QPQ A;  5DTD A;  5LBQ A;  2LKS A;  4A69 C;  3GX4 X;  2IS1 A;  3CLO A;  4BDY A;  2QBY B;  1WJF A;  1H88 C;  1KU2 A;  5D8K B;  2ZJP F;  3SDG A;  5F0H A;  2P6T A;  3PNT A;  3L2Q A;  1OR7 C;  3HOU J;  3MKY B;  5JHU A;  2GA1 A;  4G94 A;  3AL0 C;  3SZG A;  2RAE A;  1RPW A;  5HLT A;  2JMW A;  2XHK A;  2R93 J;  2H09 A;  2W84 A;  5LFA A;  1YIJ I;  1LDJ A;  3A1Y A;  1J5Y A;  3K10 A;  3OSG A;  4EV0 A;  3HRM A;  2DT7 B;  2PMH A;  2NVY J;  3ONQ A;  3QAH A;  1BIA A;  4UXN A;  2HOS A;  2JA2 A;  3G1O A;  5CVV A;  4RM2 A;  3DQV C;  2N8G A;  3FK7 A;  3GUD A;  4RB3 C;  3M8F A;  3FWE A;  1MIJ A;  3GFM A;  5LLQ A;  3GTQ J;  1BW5 A;  4OIQ F;  5K5R A;  3BZC A;  2IAI A;  2CW7 A;  4BAY A;  4CA0 A;  2FE3 A;  1Z05 A;  2KL4 A;  2XPW A;  2E7W A;  4HLY A;  3DF8 A;  3GCM A;  3W3C A;  1DP3 A;  2VKV A;  3ML6 A;  4HZF A;  2YS9 A;  1HOM A;  3PUF A;  4BYY A;  3HIF A;  2CSO A;  2W57 A;  1SMY F;  4XMY A;  5HDG A;  1TLH B;  2GIZ A;  4BY7 J;  1MMN A;  2ZBK A;  4ZDO A;  5CYV A;  2V26 A;  2OZU A;  1UAA A;  1E17 A;  4XNF A;  3BTI A;  4I7H A;  4AVZ A;  2A61 A;  2VI6 A;  2L7Z A;  4BQN A;  2EK5 A;  5FKL A;  1FPQ A;  3TW7 A;  4IOA F;  4EM0 B;  2FRH A;  5E20 A;  5FKK A;  2L4M A;  4RB0 A;  3JRA A;  1EJ9 A;  1B6A A;  4DZP A;  3NAU A;  5ILV A;  1QPI A;  3EUK L;  2MD0 A;  2X1C A;  2R4G A;  1UHS A;  2DQL A;  2R5Y B;  1KU7 A;  1VQ7 I;  5BPD A;  5HS9 A;  3WTU C;  1ZGW A;  3BDD A;  2NNY A;  1S9H A;  1WFX A;  2GQQ A;  1B8I A;  1LEA A;  3OYC A;  3HB9 A;  2XPU A;  4L5I A;  3RJP A;  3W2A A;  4XM3 A;  4C30 A;  3RQ4 A;  1K61 A;  4EJU A;  4A5N A;  3KE2 A;  2RNG A;  4WCG A;  3KCC A;  4QIW N;  5J1Y A;  4XLF A;  2YUS A;  1R1V A;  5JI6 A;  2WWY A;  1R36 A;  2VKD A;  2XF6 A;  3D0S A;  1S5L C;  1OYY A;  4BQO A;  5EF6 A;  3RPU D;  3JTG A;  1QPM A;  5B1A H;  3QPT A;  3CCU I;  4BU2 A;  1WHU A;  3RYR A;  2BZT A;  2JT1 A;  4B47 A;  3LQQ A;  3NRV A;  2JUC A;  4HNU A;  1ZLK A;  3DPT A;  5CVJ A;  4HNV A;  3LL7 A;  2R7T A;  1T98 A;  1SAN A;  1IN8 A;  2HQ5 A;  2LD5 A;  4PK4 A;  3ABM H;  2K4J A;  4HLX A;  2F6C A;  1OKR A;  3DEW A;  4XL9 A;  3NQO A;  4NHJ A;  2FEZ A;  2WC2 A;  2GM4 A;  4A12 A;  3WU2 C;  4KIF A;  1W1W E;  5HS7 A;  4ANJ A;  1NK2 P;  4AM3 A;  2WAF A;  1U5T B;  1R5H A;  1TWC J;  4MGR A;  2RGV A;  1BA5 A;  3R60 A;  2NVQ J;  5E3L A;  5HNF A;  5FGM A;  3MD2 A;  2DCE A;  3K1N A;  4ZTJ A;  3LAP A;  3COA C;  5EJC A;  2LK2 A;  3CCQ I;  1D0Z A;  3LWF A;  2XVC A;  2ICW G;  4RAG A;  4LFU A;  2HPM A;  2O8K A;  3A01 B;  4IKF A;  3ZMT A;  4O6J A;  4EEF G;  3CME I;  2IS2 A;  2VE9 A;  2AHQ A;  1QVT A;  2BEO A;  2AXT C;  3I56 I;  4Y15 A;  1P4W A;  3H9G A;  1H9T A;  4M3G A;  4IOC F;  2QSF X;  2Q2E A;  5E8I A;  1R1U A;  2R7S A;  1XS9 A;  2QA4 I;  2EV0 A;  3SEZ A;  3S3O A;  5M3F J;  5K1Y A;  4KT5 C;  1BC8 C;  5GPA A;  1I3A A;  1ZG5 A;  1I1S A;  3BWG A;  2PLY A;  1UJ8 A;  3ZXS A;  2L02 A;  2ZNY A;  1ZRC A;  1YX5 A;  3F8N A;  2CQX A;  3HHH A;  5EG0 A;  1MBK A;  3MMY B;  4RB1 A;  2NNN A;  3BG3 A;  3QYB A;  3ZGK A;  4HEA 2;  3AG4 H;  1YW8 A;  1WQ2 A;  1QA6 A;  1OYI A;  1YW9 A;  3C2G A;  1XX5 A;  4I02 A;  2STW A;  2QLZ A;  5E18 F;  2JSP A;  3VYT B;  2X0L A;  3R4K A;  1K6Y A;  2L9R A;  3FKI J;  2EIJ H;  4NC7 A;  2DXI A;  1XMA A;  2JN6 A;  2XB0 X;  4IQ4 A;  2CV0 A;  1FIP A;  1ERD A;  1POG A;  1XCV A;  2XF5 A;  1SAU A;  2VJJ A;  3BZ6 A;  4XLN F;  2D5V A;  2WY8 Q;  3PO3 J;  3GZ5 A;  3ESW B;  4PJJ A;  5JR3 A;  4XKV A;  5J8C A;  2HR3 A;  3OOU A;  2LF7 A;  1E3O C;  2R7W A;  2O5R A;  5ERI A;  3F3X A;  1LB2 A;  2LBF A;  5ILS A;  1YS6 A;  1W7P A;  5LRS A;  2LC2 A;  3K4N A;  4LLN A;  1PUE E;  3JRG A;  4I0A A;  1XGS A;  1U6G A;  4KYW A;  3ZQ7 A;  5BPI A;  3ASO H;  1S72 I;  3CC4 I;  4V19 K;  5FLM J;  2F5C A;  2HKX A;  2NVT J;  3H35 A;  2GXG A;  3ECH A;  2R7V A;  1BR1 A;  4GCV A;  1XSD A;  4I2O A;  4RGU A;  1BI3 A;  3L2V A;  2BHZ A;  2Z16 A;  5DUI A;  4ZZD A;  2CFO A;  3HOW J;  5ED4 A;  1AOY A;  2L9S A;  9ANT A;  1UCR A;  4G12 A;  1MKM A;  1S7A A;  3C2B A;  1H89 C;  2QSH X;  4HST A;  3H3V K;  5KAF C;  1Z21 A;  1DQU A;  3CMA I;  2ESN A;  1B9N A;  3OSF A;  1NG7 A;  2M9H A;  4Q48 A;  1QVU A;  3GFJ A;  5AON A;  1FP2 A;  3F8F A;  5K7Z A;  4CXF A;  1AU7 A;  1WJB A;  3I4M J;  2EBI A;  4JX4 A;  3GTK J;  1FZP B;  1L0O C;  3ZMS A;  4I6Z A;  1FJL A;  2MH2 A;  5J47 A;  1ZRE A;  2QEN A;  4P96 A;  2H8W A;  4HOB A;  3DLL F;  2R92 J;  1OYW A;  1BOB A;  2DA3 A;  4HX8 A;  2UXN A;  4F93 B;  2A07 F;  4BHP A;  1K78 A;  5IYD J;  2MGQ A;  1YYV A;  4JX6 A;  1Y8Q B;  2R0Q C;  4D9J A;  1JKR C;  4HBL A;  4CZC A;  3BG7 A;  2KIU A;  3X2Q H;  2VQG A;  4MNU A;  1E0E A;  1AKH B;  2ME6 A;  2L9V A;  1Y6I A;  3CP2 A;  1X58 A;  4J01 A;  2QBY A;  3MN2 A;  4E7J A;  3W6J B;  2HPI A;  3N4M A;  2O3F A;  1RES A;  2IGN A;  2DFF A;  2DA1 A;  3CCE I;  1TW3 A;  2Y9Y A;  2WAQ A;  1SFU A;  5ICG A;  5JHF A;  3IUO A;  4HG2 A;  4XLE A;  2HYG D;  1XSX A;  3E7L A;  3ERE D;  2MBF A;  5FLX Z;  2XAF A;  2DFH A;  3G1L A;  4MEY F;  3JR9 A;  1UFM A;  2EZL A;  1TW2 A;  2KDZ A;  2VQH A;  4HQM A;  3MFK A;  2CUE A;  3QOE A;  3KZI C;  4ZZL A;  3LNQ A;  3P9C A;  1JHF A;  4MHG A;  2MLG A;  5IP7 J;  2EIN H;  3TQN A;  4OMZ A;  4AC0 A;  3LSP A;  5F1R A;  2CW8 A;  1YIO A;  1OCO H;  5BMZ A;  2K9M A;  1U0J A;  4B44 A;  1NHA A;  1RIO H;  2O0Y A;  3V4G A;  4EAT A;  3GWZ A;  1ZK8 A;  3MWM A;  3HJE A;  3TKY A;  1W4M A;  4I09 A;  1JT0 A;  3RKQ A;  3KZZ A;  3S15 J;  3CUQ B;  3QYE A;  2OCE A;  2KRC A;  3RSN A;  1IRX A;  5M5W J;  3R0J A;  3TMO A;  1ETK A;  5CLS A;  2L3D A;  1U8B A;  1YO5 C;  1RKW A;  2XAU A;  3I3L A;  1MGT A;  1BN5 A;  3UNG C;  3WGH A;  2MC3 A;  2LNB A;  4KN4 X;  4L9V A;  4HA8 A;  4NC8 A;  3Q9S A;  1BI2 A;  2EFW A;  4LIT A;  2YR2 A;  5GTI C;  4Y3O A;  3JCU C;  4E7K A;  4BJ5 C;  3GME A;  1FYM A;  1XMX A;  3IP4 B;  1D1B A;  4F7Z A;  2JZY A;  3HBL A;  4R79 A;  5D5W B;  2DOD A;  3WTY C;  1X1P A;  2DFI A;  3RTR A;  4HF0 A;  3N97 A;  5EDN A;  2VPR A;  5D6E A;  2Y31 A;  3NAR A;  3HPH A;  1MJB A;  2LP0 A;  1BW6 A;  3F8C A;  5EGO B;  2M30 A;  4LK1 F;  1B9M A;  3KYC B;  1LQ1 A;  1F4K A;  2HOT A;  2W1O A;  3CCR I;  2HKO A;  1Y1W J;  1MBF A;  1MZB A;  1I6X A;  2R5Y A;  1IV8 A;  4ZJZ A;  4LK0 F;  2V9K A;  5TJJ A;  3V7R A;  3LSH A;  2Y0S A;  1N77 A;  4DYQ A;  5B1B H;  2BY0 A;  3SDB A;  1JUM A;  4GGG A;  2EWN A;  1I3Q J;  4YIR X;  1LJ9 A;  3CJS B;  2ZJQ F;  5E3N A;  5FLV A;  3I53 A;  2LG4 A;  2Y2Z A;  3GTL J;  5JLX A;  2LH9 A;  2FQ4 A;  2IJL A;  2EZI A;  3GYH X;  4YFK F;  4A3B J;  3BR3 A;  3HSR A;  4P5O A;  1ZR4 A;  5HDK A;  4ZYH A;  1ZEL A;  3CCJ I;  3OOP A;  1H9G A;  2E19 A;  1R4M B;  4C3H J;  2F4M B;  5E17 F;  2DA7 A;  2ZSH B;  3NEU A;  5CVR A;  1T2K A;  2NS8 A;  3CC7 I;  1TNT A;  3AG1 H;  2Y30 A;  1F1Z A;  4CSW A;  1MMS A;  1DUX C;  3IAS 2;  2E2I J;  1NTC A;  1HSJ A;  2WV1 A;  2V1D A;  3OS1 A;  3BTC A;  3C2H A;  1FT9 A;  5J4Y A;  1GV2 A;  4XOR A;  4JYK A;  2ID3 A;  4RGS A;  1LFP A;  1U5T A;  2P7V B;  3T5X A;  3RI4 A;  4G7Z F;  4XR6 A;  2V4J C;  3ZR8 X;  4HF2 A;  4FE7 A;  1ETY A;  3KP6 A;  1E2X A;  3E5U A;  1BJA A;  5IY5 H;  1GXQ A;  1D0X A;  1QHG A;  1YRN A;  3GLL A;  1RNL A;  3H5A A;  4D1Q A;  4PJL A;  3CCL I;  1SEU A;  4U0V A;  3H3U A;  3RIR A;  4F3Q A;  5D4R A;  4CHU A;  4IHY A;  2M3A A;  2Y0M A;  3KP2 A;  2JQ7 A;  1HCR A;  3A01 A;  5E8G A;  2K9Q A;  3I59 B;  2VOP A;  5J1R A;  3V7S A;  3TDZ C;  1TT5 B;  4AIH A;  3P7N A;  1IRZ A;  2WA0 A;  2MAB A;  1HXD A;  2AXL A;  3LSG A;  4LJZ F;  2I8D A;  5IP9 J;  4X0G A;  3S3M A;  3LSM A;  2A5Y B;  5J40 A;  3HYI A;  3A02 A;  2ZB9 A;  2H27 A;  3T0Y A;  5CQE A;  4IVN A;  4YIF A;  2EB7 A;  3FF5 A;  4B48 A;  3HSE A;  2DO7 A;  5BQT A;  2K9N A;  4LLL A;  2IS6 A;  2PJP A;  3I71 A;  5D8L B;  2XC7 A;  3LOC A;  1GUU A;  1JGG A;  2VT2 A;  2Y0S N;  3DWL E;  2X6X A;  1JKQ C;  5B66 C;  2ZNZ A;  2QQ9 A;  2QKM B;  2X51 A;  4A6E A;  3KEQ A;  4GFB A;  2P5L C;  3KP4 A;  3HHG A;  3IH3 A;  4EJV A;  4E70 A;  3NWS A;  1IN4 A;  3WU1 B;  3Q0W A;  2EV6 A;  2M1B A;  2HOA A;  1TC3 C;  2FXA A;  3P9I A;  2F5E A;  5AIQ A;  5EEA A;  4A3F J;  3IWF A;  2VKH A;  3GO5 A;  3IKT A;  1UHW A;  3JSP A;  1PP7 U;  4CZZ A;  2XAJ A;  2DMP A;  3CMM A;  1ZRD A;  3DPL C;  5KCM A;  1YG2 A;  3FX3 A;  3S1N J;  1Z0X A;  4LGW A;  2OZ6 A;  1MJ9 A;  2BV6 A;  3OYG A;  4IHS A;  3M1E A;  1LVK A;  2QSG X;  4CO8 A;  4A6D A;  4BE0 A;  4Z2Y A;  3SEQ A;  3VYU B;  4AWX B;  1V54 H;  2LRE A;  2RV8 A;  1IO2 A;  2HXI A;  1L3L A;  1YS7 A;  4E7S A;  2R5Z B;  3QWL A;  2E1M B;  5L3B A;  5FKM A;  4HX4 A;  4NNJ A;  3OY9 A;  1G3S A;  4G6Q A;  2X4H A;  3BJ6 A;  2IGO A;  3MKL A;  3SZP A;  1I39 A;  3CDI A;  1Y56 A;  4X1E A;  4HPQ A;  1I6H J;  2NS0 A;  3IHU A;  4J19 A;  3FBN B;  4N9I A;  3HDD A;  1X2N A;  2A05 A;  4A0Z A;  1JE8 A;  3F22 A;  4FIS A;  3S1Q J;  3FMR A;  4E7L A;  4OMY A;  5GAH J;  1UG0 A;  4ENK A;  3K4B A;  1U9O A;  2JWT A;  2W24 A;  2V1X A;  3K9T A;  3TOB A;  1U78 A;  2DN0 A;  3LFK A;  4E4H A;  4L0Y B;  3FMQ A;  1OQY A;  4DBR A;  2PEX A;  4HW0 A;  1SFE A;  4IX7 A;  2CRG A;  1FYL A;  4B09 A;  4OWR B;  2I5U A;  4CCL A;  2ELH A;  2XGX A;  3FIS A;  2CUZ A;  5DCF A;  1ZGA A;  3E6M A;  1P2F A;  3HEF A;  2COB A;  1OCP A;  1FSE A;  4B3A A;  1JKO C;  3RPQ A;  3QYF A;  1ODD A;  2FBH A;  3EQL F;  5FRN A;  1JHH A;  1G3Y A;  2KJC A;  3J81 K;  3RZD J;  3CJQ B;  3OYE A;  2XIG A;  4DNC A;  2YU9 J;  5CKT A;  2ELJ A;  4TV7 A;  1XSV A;  1FOW A;  2DMQ A;  2LR8 A;  2O7O A;  2JA8 J;  3E1S A;  1MH3 A;  2HXO A;  2OQR A;  3BR5 A;  5B3S H;  1YJW I;  2D2W A;  5A2Q Z;  3I64 A;  2E2J J;  5KHD A;  3DU6 A;  1ETW A;  4KIS A;  2Z33 A;  1XCB A;  3WU0 A;  3GZ6 A;  2B63 J;  4LB5 A;  2A69 F;  2DW4 A;  3K1P A;  2W25 A;  1A04 A;  3SYT A;  1U3E M;  1FTT A;  1XB4 A;  2K5C A;  1AKH A;  1LDK B;  2HGC A;  1JGS A;  2CH0 A;  2FML A;  5DM6 F;  2VL8 A;  1UB9 A;  2ZXH A;  1T38 A;  2EZK A;  1LVA A;  5IPA A;  4RS8 A;  1ZH5 A;  2BVM A;  3S2W A;  3HOS A;  3M3Y J;  3H9J A;  4ENJ A;  3HOV J;  2Y48 A;  5IYC J;  4A3I J;  1OJL A;  5J3L A;  2BW3 B;  4XKW A;  1J9I A;  1UG2 A;  5D5X B;  4BE2 A;  4HYE A;  1X4O A;  4AU7 A;  1HKQ A;  4IHW A;  4LG0 B;  1LDD A;  2XAG A;  4ZYD A;  1JTX A;  1N25 A;  2HDW A;  4IXA A;  4DJA A;  4ESF A;  2LLK A;  3I5U A;  3OYK A;  3HKZ A;  4CIC A;  4BS9 A;  3K0L A;  3HTU A;  2HQA A;  2FJ1 A;  2L5Q A;  2VXD A;  4NB5 A;  4R8H A;  4UUT A;  1B72 B;  3VFZ A;  3TED A;  1RI7 A;  3M8E A;  3S1R J;  1KQ8 A;  3CCY A;  1TBX A;  3U9G A;  3OIP A;  3WG7 H;  4EVI A;  1YOV B;  2IA1 A;  4C3I J;  3ABK H;  2OF7 A;  3KLN A;  1X3W B;  3FM3 A;  3RZO J;  2D45 A;  3O2P E;  3F9K A;  3GF2 A;  2KFD A;  1RET A;  2OJE D;  2FD5 A;  2ZKZ A;  4D7M A;  5CQG A;  2MC4 A;  1OIS A;  1J59 A;  1ZYR F;  1A35 A;  1FOK A;  1MMD A;  1I1G A;  3DBH B;  5GAE J;  4BQA A;  2X1D A;  3BTL A;  4N4O B;  4Q5S F;  3OS2 A;  3V8K A;  4RA2 A;  4KT6 A;  3T8R A;  4FAS D;  2DDB A;  3DBL B;  4AD9 A;  1J2X A;  2HI3 A;  2XGD A;  1MNM C;  3BQY A;  1H8A C;  1IDY A;  2X48 A;  1Z91 A;  4PUS A;  3SQN A;  1T0F A;  1ZAR A;  2EA2 A;  2KDO A;  1JTY A;  4M3F A;  4PJ0 C;  1TQI A;  2JJ7 A;  3OYH A;  3M7G A;  5IYB J;  3WTZ A;  2WY7 Q;  1IGN A;  2A68 F;  2K7L A;  1AHD P;  2PI0 A;  4ITV A;  3LA2 A;  5EGO A;  3G73 A;  1IZ1 A;  3TW6 A;  3J81 Z;  1FSH A;  1WI9 A;  1MMG A;  5LGU A;  2HDD A;  4OAY A;  1YQA A;  2LY1 A;  3FMS A;  3HG9 A;  2ELK A;  2IA2 A;  4EM1 A;  4CYD A;  2CV2 A;  3DV8 A;  2M8G X;  3FXQ A;  2ESH A;  3SZT A;  3IKV A;  5HLH A;  2F4O B;  3A4C A;  1KU3 A;  1JKP C;  3OYI A;  2K86 A;  2XSJ C;  1OCR H;  5DD8 A;  4EMS A;  2DOA A;  1IN6 A;  5HLI A;  1YX3 A;  1YI2 I;  1ZRF A;  2VON A;  1SAX A;  2LRD A;  4IQJ A;  4UB6 C;  4RBO A;  4F52 A;  3R0A A;  1RZ4 A;  3ABL H;  3WOD F;  3HKZ N;  4M72 A;  3ZMZ A;  3FZV A;  2JPC A;  4E7H A;  1T33 A;  3KEO A;  2DJI A;  2VJ4 A;  4WXH A;  1Y0N A;  1T39 A;  3VOD A;  4I0B A;  1ETO A;  3E6C C;  2HVQ A;  3H5N A;  5J6X A;  1ITY A;  1T8I A;  4D0P A;  1XPX A;  2BY3 A;  4XLC A;  3GVA A;  4G9Y A;  2P7C B;  2F4I A;  2H1L A;  4D5C A;  1DGR M;  2R7O A;  3LSK A;  1IUF A;  4M6Y A;  3PNY A;  4P9U A;  2EA4 A;  1U8R A;  4UVA A;  4NBQ A;  1LE8 B;  4A0X A;  2VIX A;  3PNV A;  4B3X A;  4Y7N J;  1ZG3 A;  2E1C A;  4XRS A;  1ZLJ A;  3ZQG A;  2R3S A;  2M7B A;  3J80 K;  5FO5 A;  2E36 A;  4PZJ A;  1SD7 A;  4GXO A;  4E7Z A;  1F36 A;  1GLN A;  2A3S A;  4RM3 A;  2NXN B;  1O3Q A;  2RVC A;  4C3J J;  2W7N A;  2QQB A;  1TWF J;  2DPU A;  2ECB A;  4Y17 A;  1P6R A;  1TP4 A;  3EUH C;  4DW6 A;  4S0H B;  3RQI A;  3PL8 A;  3VSL A;  2CGP A;  4KIG A;  2NVX J;  4GRI A;  4K2E A;  2XB5 A;  2Z99 A;  3CC2 I;  1W7P D;  2M8E A;  4ZYG A;  2O61 A;  2DMN A;  3JRC A;  2VOO A;  2RN7 A;  2HZD A;  5FLX K;  1J09 A;  2ZFU A;  2V9P A;  3WHB A;  2W48 A;  1I50 J;  2OAZ A;  3ZQH A;  3IV5 A;  3C3W A;  3BJO A;  4UUS B;  1ETQ A;  5EZH A;  2V6E A;  4IHV A;  1VQ6 I;  5AIP A;  2ZCW A;  3ECO A;  3M4O J;  3L1P A;  4A2U A;  3N05 A;  3WG9 A;  5C3E J;  2C6Y A;  1JT6 A;  2FNA A;  3L00 A;  2X6W A;  3H1C A;  4PJN A;  5M5Y J;  4L9N A;  2KKO A;  4XKC A;  2V1N A;  2DFE A;  4RGX A;  2RNJ A;  2CS3 A;  1WWX A;  3QPL A;  2MLK A;  1LEB A;  1WIB A;  1N75 A;  2DMU A;  2MH9 A;  4BJT A;  1W0T A;  2ISY A;  2XRO A;  1U9N A;  2QGU A;  1F5T A;  1IRF A;  2E5N A;  5F04 A;  3L09 A;  2EFN A;  5F08 A;  1OPC A;  4L0Z B;  2PFB A;  1MBJ A;  4FQG A;  3Q0V A;  3ZMV A;  1APL C;  3RYP A;  1WGX A;  1REP C;  4KN7 X;  4KUM A;  2LYC A;  3SFZ A;  2Z1D A;  2K9S A;  5F1J A;  2CG4 A;  2EIM H;  5E1X A;  1BOA A;  2XGC A;  4CH7 A;  5IOY A;  4LG3 A;  4AUX A;  1PVE A;  2V7F A;  1IN7 A;  5FFX A;  3IH4 A;  3AAF A;  2COM A;  2R5Z A;  4U87 A;  1WPK A;  3E5Q A;  5TIS C;  4MTE A;  2L01 A;  3E0J B;  4M9Z A;  1BBY A;  2EIL H;  3S14 J;  2ZO4 A;  3M07 A;  4M3B A;  2DU9 A;  1VFC A;  1MBH A;  2X1E A;  4HDV A;  1IDZ A;  4DIQ A;  1P4A A;  1R4N B;  2MSY A;  3FXJ A;  3PSI A;  5KAI C;  3HRT A;  3LMM A;  3ZQQ A;  3PIP F;  2RC4 A;  4PFP A;  1TNS A;  1FLI A;  1HDP A;  4MEX F;  3PQJ A;  1WZ2 A;  2MW8 A;  5LGN A;  2PJR B;  2HTS A;  2XAH A;  1WJC A;  2H6C A;  4UUV A;  1MW7 A;  3BR2 A;  1HA8 A;  5B5E C;  2EZH A;  3DXJ F;  3GW2 A;  4Y13 A;  2M7A A;  3DLA A;  3VYR B;  1TQM A;  1Z1D A;  2XAS A;  4PJM A;  1DGW Y;  5FD5 A;  4D5F A;  3J80 Z;  1D5Y A;  2E60 A;  4BNC A;  3ZPL A;  1V3F A;  1WRJ A;  1I5Z A;  3FDY A;  4F91 B;  1ZN2 A;  3JRH A;  3PUB A;  3TDU C;  2CQK A;  4FCY A;  1Q1H A;  3W6V A;  3R61 A;  3VYS B;  4AIK A;  4U0W A;  3UKG A;  3G3Z A;  4B8X A;  2L7F P;  4EJT A;  1FTZ A;  4DBQ A;  1Y39 A;  2QM3 A;  1DU6 A;  4M3E A;  3LA3 A;  4AID A;  1ZQ3 P;  3OYB A;  2ZXI A;  3HTS B;  3V8L A;  2NVU B;  3HOY J;  5TGT A;  4HF1 A;  1OCT C;  1TWH J;  3AKZ A;  3BZK A;  1PYV A;  3KPH A;  1W5C C;  2HU9 A;  4I98 B;  3S3N A;  1HW1 A;  2ZME B;  4RAY A;  4U7D A;  1ACI A;  1IG7 A;  3H36 A;  4YFX F;  4WX9 A;  4HDU A;  2J5O A;  4A5M A;  1I27 A;  1F9N A;  5JVG F;  2AQE A;  4XKB A;  5LEJ A;  2E1O A;  3HRS A;  5HDN A;  2AQF A;  1O3T A;  1GVD A;  1FMV A;  2DA5 A;  4DYC A;  3BY6 A;  2Y9Z A;  3M9A A;  3ZN1 A;  2FUG 2;  2IP2 A;  1MMA A;  3B6C A;  2K40 A;  1Q1V A;  4OIN F;  4N4N B;  5HS8 A;  1MNE A;  5GAG J;  1VQP I;  4IRI A;  2BW3 A;  5KK1 A;  2P6S A;  4HV5 A;  1GV5 A;  2G7H A;  3FBI B;  2PG4 A;  4LG0 A;  1HW5 A;  3FIW A;  2BE5 F;  1AWC A;  1D8J A;  3NWT A;  2VQC A;  4XLA A;  3TBI A;  1EH6 A;  4YRV A;  1IN5 A;  2J5P A;  5DS9 A;  3I55 I;  3ZP5 A;  2W00 A;  1X1D A;  3A0H C;  1LNW A;  2ECC A;  2X6Y A;  2DBB A;  2V79 A;  4ESB A;  3DU5 A;  4FX4 A;  1B72 A;  1QRY A;  2RQP A;  3ZCO A;  5M5X J;  2IGM A;  3J7Y J;  3C18 A;  3KZY A;  4IZZ A;  4A3D J;  2I10 A;  3KP5 A;  2V9V A;  2DYS H;  2GZW A;  2K27 A;  3BQZ A;  4II2 A;  3TGN A;  2K9L A;  2CU7 A;  3K4C A;  1FIA A;  1EH8 A;  3IRR A;  3MQ0 A;  4J00 A;  4C2U A;  1D1C A;  5L3F A;  3DEU A;  1ULY A;  4WK8 F;  1SD5 A;  1MBG A;  3G4S I;  4IO9 F;  5H6R A;  2DQR A;  3WTS C;  1VI0 A;  4UVB A;  1E3H A;  3K4L A;  3H3Z A;  4IRG A;  4D7N A;  2JPB A;  1KZH A;  5IT9 Z;  1VQL I;  4NUB A;  4CUG A;  2CQN A;  3U1D A;  4N9H A;  1R71 A;  2WAQ N;  5M3M J;  4N0B A;  4L5J A;  3OS0 A;  5D5V B;  2VB6 A;  4A3G J;  4JQF A;  1KA8 A;  3DTK A;  3AL0 B;  4ZTF A;  2QWW A;  4JK1 X;  3BLY A;  1ON1 A;  2GBY A;  4KJZ A;  2LTP A;  3CZ6 A;  2YX4 A;  2VC0 A;  1Z7L A;  1BI0 A;  5DD4 A;  3ISP A;  5C4X J;  4ZH4 F;  4HX7 A;  1GHC A;  1STZ A;  3HGG A;  3VWB A;  3WTV C;  3H0D A;  1HST A;  3L2R A;  3EPZ A;  2R7F A;  1QGP A;  3P5J A;  2UZK A;  2IGK A;  1ORK A;  3D5S C;  3VOE A;  1GXP A;  4EJW A;  1ZGJ A;  3JAM Z;  2VOD A;  5CJ9 A;  3FHN A;  3CCS I;  4M9S A;  5FD6 A;  4EGZ A;  1P92 A;  3WE3 A;  2BVL A;  3WE2 A;  5BNG A;  1UZC A;  1SC7 A;  1BJZ A;  4OIP F;  3W2W A;  4GYG A;  3VSK A;  3BTJ A;  4KIT B;  3OYA A;  4G6T B;  4YFN F;  3HPG A;  3TP3 A;  3Q5F A;  1ZTR A;  3G1M A;  3SXY A;  2WAE A;  3F6V A;  5DCM B;  4EQQ A;  2M4G A; 
#chains in the Genus database with same CATH homology
 2E34 A;  3CMA I;  1VQO I;  1VQ9 I;  3CME I;  5GAD J;  3CF5 F;  5GAG J;  1VQP I;  1FOY A;  3I56 I;  3CD6 I;  3G6E I;  1YI2 I;  4IOC F;  5DM6 F;  2ZJR F;  2E35 A;  2QA4 I;  3CCR I;  3I55 I;  1YJN I;  2H8W A;  3DLL F;  3J7Y J;  4IOA F;  1VQ8 I;  1HC8 A;  2OTJ I;  3CJS B;  2ZJQ F;  2QEX I;  3CCM I;  2K3F A;  3PIP F;  1QA6 A;  3CJT B;  3G4S I;  1VQ7 I;  4IO9 F;  3CCV I;  3CCE I;  3CCJ I;  3EGV B;  2E36 A;  1VQM I;  1VQL I;  3J7Z I;  3CC7 I;  1MMS A;  2NXN B;  5DM7 F;  5GAH J;  1YJ9 I;  3CJR B;  1YHQ I;  2ZJP F;  3CC2 I;  3CCU I;  5GAE J;  2OTL I;  1Y39 A;  2FOW A;  1VQ5 I;  1S72 I;  3CC4 I;  4V19 K;  3CCL I;  1VQ6 I;  1YIJ I;  2JQ7 A;  4UY8 I;  1ACI A;  3PIO F;  3G71 I;  1VQN I;  3CJQ B;  3CCS I;  5JVG F;  1YIT I;  1FOX A;  1WIB A;  1FOW A;  3CCQ I;  1VQ4 I;  1YJW I;  1VQK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...