1IJWC

Testing the water-mediated hin recombinase dna recognition by systematic mutations.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*TP*AP*AP*GP*A)-3'
total genus 13
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2001-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ijwC00
3LNQA 5EZGA 2CQQA 3JRFA 2HYJA 3Q0UA 2XGCA 2LY9A 3FIWA 2R0QC 2ELKA 5IYCJ 1ZKGA 5K7ZA 2TCTA 5E3MA 4IHVA 1ZTRA 1U8BA 1GV2A 4CYCA 3JRCA 3G1MA 2ME6A 4I76A 3I4MJ 2D5VA 1TWGJ 4DW6A 2NS8A 4JYKA 2XB0X 3HOUJ 1OJLA 3TEDA 5FLMJ 1SFOJ 2XGDA 1NK2P 2K9QA 1R9TJ 3JRGA 2EBIA 2EZIA 5F1JA 4QSHA 4LOCA 2DN0A 2Y30A 1UMQA 4MIMA 5IP9J 5F04A 4M3GA 2JWTA 3TW7A 1Z77A 1X2MA 2DMUA 4A3KJ 2GLOA 1ZR2A 1TWCJ 2VI6A 3ZQGA 3IH4A 2M0CA 2HOSA 4Y7NJ 3S16J 4M3EA 3GTJJ 3WHBA 1MBEA 4DYQA 1VF9A 2DA4A 3SJMA 5C4JJ 3S2DJ 4AUXA 5FKMA 4G12A 2WB1N 1IRZA 2L7ZA 1X2NA 3F0CA 2WV1A 4QTRA 3ZQIA 1FTTA 3RZOJ 2IAIA 1ORKA 4A69C 1IG7A 5IOYA 5EG0A 2CUEA 3L1PA 2R92J 1WPKA 4C3JJ 1OFCX 3VPRA 1JKQC 1NK3P 5J1RA 2DA5A 1FJLA 1K61A 2ID3A 2Y2ZA 2M34A 2Y0SN 1IC8A 2X48A 4S0HB 4AYBN 3G1LA 3HOZJ 2ID6A 3ZQHA 3JRDA 2X9DA 1VFCA 4A3CJ 2XPUA 1FTZA 4B4CA 3A01B 3K7AJ 5F08A 1BL0A 2COBA 2OPTA 3SFIA 1XG1A 1B72B 2FD5A 2YUSA 2MGQA 1IDZA 2HXOA 1HCRA 2NVTJ 4UUSB 2ME0A 1RETA 4UUSA 1Q1VA 2DMPA 5IOZA 3OOUA 1TWHJ 3S1MJ 2DA2A 3I4NJ 4BBRJ 1BW5A 2EQRA 3CDLA 4UUTA 4A3JJ 1YRNB 2X6OA 3Q0VA 4A3DJ 2R7ZJ 3S1QJ 4JX4A 4BBSJ 2NOGA 3LSRA 2FQ4A 4A3MJ 5J1UA 1H8AC 3BR3A 4B3AA 4Y52J 1YRNA 4JP0A 3UKGA 1PUFB 1K83J 3A03A 3HGYA 5DS9A 2OF7A 1EF4A 4XRSA 1LFUP 3S1RJ 2NVXJ 2O8KA 1JT6A 3BTJA 5IPAA 3TP0A 4XICA 2LLKA 2JMWA 2WAQN 5M3FJ 2CRGA 3BG3A 2JA8J 1I6HJ 1BJZA 1RPWA 5E3LA 4D5CA 3IH3A 5C44J 2EZHA 2GBYA 1U9OA 1OCPA 3M3YJ 3GTPJ 3JREA 2L7MP 2RAEA 2IBDA 4FCYA 2R5YB 2R5YA 4IHYA 4D7MA 4D7NA 3NARA 2ECBA 3S15J 1AU7A 2LTPA 4EEFG 4M6VA 1QVTA 3HOVJ 1UG2A 2HOTA 2VUMJ 2I10A 3H3VK 3GTKJ 3HOWJ 1JTXA 5J1YA 3NAUA 2R5ZA 2FJ1A 1MNMC 1MBGA 2VKEA 5F0CA 3ZQLA 1ETQA 1MBJA 1P7JA 1ETXA 2Y31A 5JLWA 1QVUA 1T56A 5IP6A 5C3EJ 1CQTA 1IJWC 3IH2A 3S1NJ 4X6AJ 5M5XJ 4XRMA 3GBGA 3GTOJ 5C4XJ 3CQZJ 5IP7J 4CYCB 1TWFJ 4BKXA 2DMQA 3WHCA 1P7IA 5EF6A 3BQZA 1MSFC 3D1NI 1JT0A 1GDTA 2P81A 1I3QJ 3C2BA 2E19A 2EZLA 2K9SA 1ZR4A 4W97A 3RKQA 4MFEA 2L7FP 3TW6A 4A3LJ 3BQYA 1JKOC 1O4XA 1AKHA 3OSFA 2EH3A 2IEKA 3GTQJ 1JGGA 2O9LA 3W6VA 4XIDA 2K9NA 4IHXA 4HNVA 1MH4A 1ETVA 4A3EJ 1TC3C 3FK7A 5E3NA 2DA6A 1F43A 1MBHA 3BR0A 4C2MJ 4FISA 1GT0C 5GPAA 1WI3A 1RESA 1RKWA 1H89C 3FISA 2TRTA 1A6IA 1HLVA 1ENHA 5HODA 3RZDJ 2B63J 2CQXA 3ZQFA 2JK3A 2CU7A 1B8IA 4DYRA 3O8HA 1RKTA 3CMYA 1VNDA 3Q0WA 1G2HA 5FLVA 3JRBA 1MSEC 2DA3A 1W0UA 5EDNA 1E3OC 3MVPA 3K2AA 1Y1WJ 2R93J 1JKPC 2HI3A 2E2IJ 1QRYA 4C3HJ 2MW8A 3GTGJ 2HXIA 4JX6A 1HDDC 2JA7J 3LOCA 1JUMA 1WH7A 1ZQ3P 5BNGA 3GTMJ 1TWAJ 3HDDA 1APLC 1NTCA 4AC0A 1B8IB 5EGOB 1BW6A 4A3GJ 1WH5A 4XRSG 2DTZA 4RDUA 2XGEA 3PM1A 3A01A 2QF7A 2M2EA 3SDGA 2NVQJ 3FK6A 4A3IJ 2LR8A 1B72A 3BT9A 4L5EA 3BTIA 3HOYJ 1MBKA 5JLXA 2JN6A 2Y9ZA 1GV5A 2H1KA 3QQAA 2MG4A 4FE7A 2H8RA 2ECCA 3HBLA 4V2FA 4DZJA 4QIWN 2LFBA 2DA1A 3M4OJ 3HOXJ 3QPSA 1LE8B 3PO3J 5F27A 3B6AA 1AKHB 1HDPA 3OIOA 3HGGA 1ETYA 5DTDA 1IDYA 4M3BA 5IYDJ 2CJJA 3BTCA 1A5JA 5EG0B 1JKRC 3JRAA 4A3BJ 5EGOA 3H0GJ 1FIAA 5M5YJ 1HOMA 3PO2J 1BA5A 3BR1A 3FKIJ 1FEXA 2PMZN 1HF0A 4FTHA 3E7LA 5K7HA 5M3MJ 3CCYA 3ZQCA 1XS9A 4C3IJ 5FJ8J 3S17J 2KDZA 3BG9A 1S7EA 5K7FA 1Z0XA 4BY1J 3RQIA 1ZGWA 2LK2A 1IV6A 3HKZN 1DU0A 4V2GA 5EZHA 1WGXA 3BR6A 3HEFA 4I6ZA 1U78A 2Y9YA 2R5ZB 4XK4A 2HDDA 1MH3A 1ETOA 2HOAA 4ABZA 3OSGA 4GFBA 3HB9A 3MKLA 3DEWA 2M9HA 4DYCA 1D5YA 4RBOA 3LSPA 2AO9A 2HQ5A 3TP3A 3HM5A 2YU9J 2GM4A 1ITYA 5EYRA 1LE8A 5FKKA 4BY7J 3BTLA 2VKVA 4MFDA 1T33A 1RR7A 2CUFA 2DMTA 2EZKA 1I50J 2E1OA 1AHDP 2XB5A 2JA6J 3G1OA 3ZOBA 2N8GA 5GPCA 1X58A 1IUFA 1JTYA 1U9NA 5GP9A 1W0TA 4JX5A 1ETWA 1UHSA 2DJNA 4B1RA 1GVDA 1ZK8A 9ANTA 4J19A 4W1UA 5F0HA 2W48A 2FX0A 3JRHA 2YS9A 5E3OA 5EEAA 2MSYA 2JA5J 4IHWA 1LFBA 3BG5A 1MBFA 2QCOA 4MO7A 3GTLJ 1F36A 3JRIA 2LP0A 3O8GA 3LSGA 1JUSA 2VPRA 4IEJA 1JUPA 2XPVA 3BR5A 2M8GX 3A02A 2LVSA 2ZB9A 3JR9A 3MN2A 1DU6A 1GUUA 4BXXJ 4A93J 1Y1VJ 1QPIA 4DZPA 2K40A 2NS7A 5FKLA 2L0KA 1ETKA 1XC5A 2XSDC 2XPWA 5FKNA 4FE4A 4X1EA 5M5WJ 1JJ6C 2E2HJ 4A3FJ 1FIPA 1SANA 2XRLA 3LSJA 2JJ7A 2O7OA 3BR2A 5IYBJ 1IGNA 1PUFA 5F0FA 1OCTC 4D5FA 3B6CA 2DA7A 3QPLA 4NDLA 2G0EA 4M3DA 5J3LA 4M3FA 1POGA 1WCMJ 2LD5A 2DMNA 1VI0A 3S2HJ 2L9RA 2KT0A 3DCFA 5FKOA 2NVYJ 3IV5A 3S14J 1H88C 1JJ8C 3Q3SA 4MLOA 2E2JJ 2LKXA 2AHQA
chains in the Genus database with same CATH superfamily
3LNQA 4ZYAA 4PDKA 1DGRM 5B1BH 2XGCA 1BOBA 1YW7A 3DEEA 3WGIA 2QQ8A 3HPGA 5K7ZA 3S3NA 2OZUA 4IHVA 5E3MA 5HDKA 1ZTRA 2ICWG 3JRCA 1EV7A 1UZCA 4MTDA 2P5LC 3C7JA 4A0XA 3OYAA 2OQRA 1BI1A 2L3DA 1A6QA 2EV5A 4ON0A 4B09A 4DW6A 3V8KA 2XB0X 3HRUA 4HSRA 1W7PB 2O8XA 5FLMJ 2XSJC 1MMGA 2M5WA 4BJ5C 3VYRB 1X1AA 3JTGA 1R9TJ 3K4NA 3A1YA 2LDUA 3ZMVA 2EZIA 5F1JA 5K1YA 1MDMA 3FBNB 1PP8F 3OYLA 4AIDA 2OQGA 2Y30A 2KIFA 3ECHA 1UMQA 1AOYA 4MIMA 3AKZA 1MJ9A 5IP9J 3VYTB 4YIIA 3DXJF 1O3RA 4L9JA 2O3FA 2XAFA 4BYYA 1RZ4A 4XSXF 3CO6C 1ZR2A 1S8NA 2VI6A 2YR2A 3J80Z 3OYCA 4B8XA 4NQWA 4IO9F 4EATA 3M1EA 1UAAA 5KK1A 2HOSA 3S16J 3PQKA 3NRVA 2DTRA 3GTJJ 3I54A 4HF0A 4P55A 4I0BA 3T8TA 3A0HC 2MD5A 4UY8I 1MIJA 2MD0A 4IL6C 1LDDA 5L3DA 5C4JJ 3S2DJ 3EUHA 2P7CB 3PSFA 1ZH5A 4Q48A 2L54A 3OYBA 2EB7A 2ZSHB 1QPMA 1K4SA 2ESNA 5EG0A 1FY7A 3I9V2 1LFPA 2ELHA 3GX4X 3VWBA 2FNPA 2KHMA 1OFCX 2BXYA 3ESWB 5E8GA 2M0MA 3WG7H 1XX5A 4YRVA 3VB2A 1FJLA 2WY7Q 1Y0UA 2BW3B 1SFUA 3VYUB 2FRHA 4CSWA 2Y0SN 3L9FA 1KU7A 5BMZA 3LQQA 2HU9A 4BAYA 4DBRA 4XKWA 2Y75A 1U2WA 4J00A 4A3CJ 3ZN0A 4PUSA 4F91B 4UV9A 1X4OA 1FTZA 4IF4A 4M9XA 2QQAA 3NWSA 5H20A 4XMYA 2Q0OA 2YUSA 1ON1A 1IDZA 2HXOA 2RC4A 2ZCWA 4HX7A 4UUSB 1RETA 2ZXWH 2DMPA 4ASNA 2DCEA 5IOZA 1Z9CA 5EEGA 1OLTA 4OIRF 2ZJPF 2X1CA 2EQRA 4IOAF 4HRIA 4A12A 4RM2A 4A3DJ 2R7ZJ 2E60A 3CO7C 1IF1A 4BBSJ 3LL7A 1BR2A 2QM3A 3FM5A 5HLHA 4A3MJ 5FLXZ 1H8AC 2HFHA 2EFQA 4IRHA 1E17A 3D0SA 1ZAOA 4JP0A 2A68F 4UB6C 3QP5A 4Q5SF 3A03A 2IS6A 1D1CA 2JVGA 1DP3A 5ILUA 4XRSA 2ZFWA 1PUEE 5IPAA 2ZKZA 4XKBA 1Y0NA 2GZWA 4LB6B 4ESFA 2DYSH 2AS5F 1X1BA 2V79A 3COAC 1EH7A 2EZHA 2ZMEA 4Z2YA 2K3FA 2PX9A 1U9OA 1LKXA 2VXDA 4DOZA 3WTVC 1ZARA 4A2UA 1YG2A 1DPRA 2JSCA 4D7MA 4D7NA 2E34A 2KRFA 2LNBA 4ZYGA 3S15J 5FGMA 4EEFG 3MZHA 1QVTA 5LBQA 1E3HA 4OAZA 2D1HA 1NH3A 2CQNA 4JQFA 1XCBA 1R5HA 3LSTA 3F72A 2ZJ2A 2P7VB 2V7FA 2EJRA 2V9KA 4B47A 3SHFA 2FJ1A 1D8JA 2VKEA 3HUGA 1MBJA 4FETA 1L0OC 1ETXA 3HSEA 3IHUA 1WRJA 1FMWA 1QVUA 1T56A 4FQGA 4CGZA 1QZYA 3BDDA 1VTNC 1IJWC 1OCCH 3S1NJ 5E8IA 2XAHA 4X6AJ 3WG9A 5M5XJ 4XRMA 3GTOJ 3J7ZI 5B5EC 5L3EA 3I71A 2P8TA 4OIOF 4F7ZA 1U5TA 1B9MA 2LF7A 1G3TA 5GAEJ 4OINF 4A0ZA 4CCOA 2PN6A 3GFIA 5EJCA 3V7RA 1MSFC 1X19A 4IKFA 5JHUA 3D1NI 3FBIB 2CW7A 2UXXA 4P96A 2KMUA 3QP6A 2K3PA 2EZLA 3W2VA 2B0LA 3F8CA 2VB6A 5HLIA 4MEXF 3H92A 3LSIA 1IN8A 3I0TA 1MDMB 1QA6A 4XLHA 3RYRA 3AFHA 2D2WA 3FZVA 4CA0A 2OCCH 2PMUA 2CGPA 2IEKA 4RA2A 3FXOA 1Z21A 2O5RA 3MD2A 2CUZA 4MHGA 4IQJA 3W6VA 1OKRA 3HRTA 2K9NA 4XIDA 4HNVA 1R58A 2IA0A 2K02A 3ISPA 5D4RA 1R7JA 1D8KA 2A69F 3BJAA 4F93B 3G4SI 1TNSA 1WJBA 2V1NA 1WI3A 1Y8QB 4HZFA 3E5UA 4BE2A 2OD5A 1A6IA 5IT3A 4OMYA 3L2QA 2E36A 2FF4A 3G3ZA 3H9QA 5GAGJ 3RZDJ 2O6GE 1Z05A 2CUJA 3WGGA 3ZQFA 1WJEA 5FD6A 4XOTA 2BHYA 1VNDA 4IHSA 2V9PA 3JRBA 3KFWX 1W4MA 4HX8A 2RDPA 5K5QA 3UNGC 2R93J 1FC3A 2FSWA 2WB1A 1JKPC 2HZDA 5TGTA 1XGSA 2JPBA 2MW8A 3D5RC 2DAOA 3K1MA 4JX6A 4XRFA 4LIVA 2CFOA 4PJJA 1ZRCA 2R7WA 2K86A 1QQIA 3GVAA 5BNGA 3T8RA 4E6KG 1TWAJ 2IS4A 3H36A 4AC0A 5EGOB 1N75A 2QBYB 3GZ5A 1WJDA 1ZRDA 1BBYA 3DLAA 3FXRA 4A3GJ 4XRSG 1B4AA 2ZXJA 5DEQA 3PM1A 3A01A 2QF7A 5HS8A 3SDGA 3FK6A 1SVLA 4E70A 4N4OB 3BTIA 5J8CA 1MBKA 4BEHA 3J80K 5JLXA 3K69A 1R22A 4R1HA 3PFYA 3N4MA 3QYBA 3H5RA 3QQAA 5LGNA 1T0FA 3S32A 1RNLA 3T1BA 4V2FA 4DNCA 4QIWN 1F9NA 3OYHA 2LFBA 2DA1A 5FFZA 3I55I 3P7NA 3FHNA 3PO3J 1AA7A 2D1VA 3B6AA 5F27A 4BQQA 5LD2C 2L02A 4BEHB 5E1WA 3CJRB 2Q8KA 2X51A 3E3VA 2DFIA 4FHTA 3VOEA 4CO8A 4YIRX 3S8PA 2Q2EB 2DBBA 5EGOA 2R3SA 4DJAA 1VQOI 2VBXA 3IL2A 3F3XA 3ZP5A 4A5NA 5BOXA 3EYIA 1RI7A 5F6FA 2GOMA 1YS7A 1FEXA 2PMZN 3E7LA 2XGXA 3ZQCA 2L9VA 1XS9A 2MLKA 5FJ8J 3B02A 1WHUA 2KDZA 2CV1A 3GF2A 1IZ1A 1Y6IA 1VQ5I 1IXSB 1YLFA 4BXFA 3HKZN 1KU3A 1FYMA 3CESA 4I09A 1WGXA 2Y9YA 4EJTA 2HDDA 3E6MA 3KLNA 4ABZA 5D5WB 4MQVA 1YX3A 1KGSA 5FROA 2VXZA 3LSPA 3D5SC 4D9JA 4HQMA 2WC2A 4UNOA 1UHMA 5GTIC 4G6QA 3X2QH 4I2OA 3I5UA 3OYGA 2BY3A 4O3MA 3GMEA 4HLYA 4MFDA 1SVMA 1T33A 4U87A 1TW3A 4BNCA 2VQGA 5TRDA 1WFXA 2M3AA 2VN2A 1AHDP 1YS6A 2N8GA 2X6WA 1SAXA 3KIOA 1IUFA 2CO5A 2V4JC 2HQNA 1X4PA 2MABA 4W1UA 3W3CA 2OTLI 2ISYA 2FX0A 2FUG2 3JRHA 2YS9A 1W5CC 1R23A 5E3OA 2FNAA 3KZZA 2JA5J 2KDOA 3BG5A 4ITVA 3CC7I 1F36A 3LAJA 3R60A 1G3SA 2X85A 3O8GA 2P5VA 4KIGA 2G7HA 3PUBA 1TBXA 4EJVA 3BR5A 5LFAA 3JR9A 1VQMI 5JVTA 2IRFG 3DTKA 4CZZA 4XLPF 4EV0A 5CLSA 3ABLH 1S29A 2K40A 5ED4A 2H6CA 1LUJB 1XSVA 3CCQI 2NS7A 2W4SA 2L0KA 3D5LA 1KU2A 4TV7A 2XPWA 3H9JA 4FE4A 4X1EA 2MH9A 2B7EA 1JJ6C 2E2HJ 2GQQA 4A3FJ 1FIPA 3H3UA 5LHHA 2VE9A 2V1XA 3BR2A 3RQ4A 1IRXA 4BDZA 2BVMA 1QZZA 1QNTA 2IP2A 4NDLA 3E6DA 1LQ1A 3KP5A 1VI0A 1O7FA 1R1UA 3ECOA 4QPOA 3VFZA 3AAFA 3ABUA 1MJBA 2Y69H 4N9HA 4XN0A 3S14J 3FXLA 3ERED 1H88C 1IN5A 1MNDA 2WADA 3ULQB 4E7ZA 2X6OA 3KP3A 1EA3A 1QGPA 4RAGA 4Y15A 1R49A 3ONQA 1O7LA 1PP7U 3FIWA 1HW5A 5HOOA 2ELKA 2R0QC 3MZ8A 4AYBA 2LY1A 3RSNA 1R71A 4FT8A 2TCTA 3ZCOA 4M9SA 2Q1ZB 1O57A 4YG2F 1FLIA 3I4MJ 2DI3A 1OPCA 5J40A 4IX7A 2NS8A 1ZLJA 1I3AA 3S3OA 3CJQB 2EINH 2EILH 2NOJB 1NK2P 2K9QA 3F23A 4RLFA 2XVCA 1DDNA 2PBIA 2XDVA 2YPRA 4MEYF 4UV8A 3ROUA 1BC8C 4QSHA 3M7GA 3HKZA 2DN0A 2RNJA 4LOCA 3K70C 3FXKA 1BR1A 2JWTA 4AIHA 1Y8RB 1Z77A 5AONA 3SZTA 1X2MA 4YEJA 4UVBA 2QYOA 3CP2A 3RJPA 5DD8A 2HDWA 3IH4A 1USTA 2UXNA 2DDBA 2Z99A 4KIFA 3ELKA 4DYQA 3N05A 1S6LA 3RI4A 1MMNA 1YO5C 1QU3A 3OL4A 1YQAA 1FWZA 2QWWA 2WB1N 3IP4B 1LB2A 3E97A 3GLLA 1ZN2A 3OV8A 1ZG3A 1IUYA 5HLGA 3F0CA 4NC8A 2XC7A 3ZQIA 3K1PA 2IAIA 4AU7A 4BE1A 4L18B 3CUOA 3JSPA 2R92J 4WX9A 1Z7UA 1FZPB 2R7XA 4C3JJ 4B44A 1U5TC 1DP7P 2Y48A 2E1MB 1JKQC 2VL8A 1NK3P 1FOKA 4KFCA 2WA0A 2R7OA 1JE8A 2L7KA 3SYTA 3HC7A 3O2PE 4ESJA 5DDGA 2PJRA 2DO7A 1YITI 1IC8A 2X48A 4HAMA 2W82A 4S0HB 4AYBN 3E0JB 1OYIA 1H0MA 2JT1A 2ZMEB 3JRDA 1VFCA 3FXMA 1UHWA 3A4CA 2XPUA 1BL0A 1DGWY 3EUAA 2EA2A 3W2WA 2OPTA 1SFXA 2EIKH 2LG4A 3QYEA 3VSKA 4A5MA 5HVQC 2ZJRF 1HCRA 4B48A 2NVTJ 4E7LA 2ME0A 2L5QA 4UUSA 1Q1VA 2CQKA 3OOUA 2GIVA 4JBAA 1TWHJ 4HDVA 2EV0A 3IAM2 1T39A 4UUTA 4LFUA 1YRNB 2IS1A 5E17F 1UCRA 2X0LA 2M7BA 5ICCA 1Z6TA 3GO5A 3CLQA 4N0BA 3LSRA 4LGWA 2M4GA 3QPHA 3AG1H 4ENJA 1TLHB 2RQQA 2DK8A 3DTIA 5J1UA 3K4JA 4B3AA 1YJWI 1W1WE 4EM2A 5BS6A 5F64A 4DQ2A 2WBMA 5L3CA 1YRNA 2KKOA 4NQWB 2P4WA 3CZ6A 1OCRH 1R1VA 2VE8A 4IJAA 3DBRB 1EF4A 1LFUP 4MGRA 2RNGA 3P5JA 4R8HA 5DCMB 2DU9A 4U7BA 2KRCA 3TP0A 3ABTA 2DK5A 3OWTA 5M3FJ 2J5OA 2BBYA 3BG3A 1MZBA 2VT2A 1G3WA 3U9GA 3PIOF 2A6HF 1XN7A 2K9MA 3AG4H 3WODF 3I59B 4GO1A 1OCPA 1LNWA 3GTPJ 4I01A 3OY9A 3P9KA 4KN4X 5J8FA 2VKHA 2IBDA 2XAJA 4FCYA 2BW3A 4EJOA 4IHYA 2A5WA 2XUBA 2VQCA 3NARA 2ECBA 1ZG5A 4CCMA 3W6KB 3JW4A 4M6VA 3BP8A 3I59A 3R61A 1MW7A 1UG2A 2VBWA 3GFMA 3GTKJ 2CV0A 3DLLF 4KA4A 1M1EB 2DFEA 3IRQA 5D5UB 1MBGA 3OYIA 5F0CA 4HPQA 2X1DA 1ETQA 1XPXA 2GA1A 3HTUA 2WAQA 5IP6A 5CKTA 4GRIA 5C3EJ 5DUIA 4DGWB 1K4TA 4KN7X 2R7DA 4EJWA 5CPRB 1BC7C 3R0AA 4IZZA 2DT5A 3TBIA 3ZMSA 4F3QA 1OR7C 2UZKA 1TWFJ 4BKXA 1HSJA 1I6XA 4XSZF 1FOWA 2LBFB 2GA2A 2RREA 3OS0A 3HOSA 2BE5F 1P7IA 4PFOA 3V4GA 4BJ6C 3TQNA 5EF6A 2CG4A 3TDUC 3C2BA 5DCFA 4KDPA 1Z6RA 2M4KA 4NBQA 3EPZA 4W97A 3C3WA 1STZA 2L7FP 2R7QA 3TW6A 3BQYA 4II2A 4D1QA 1O4XA 2EH3A 3EETA 4IHTA 2F2EA 1VQ6I 3HL2A 1TL8A 2M7AA 4IHXA 5ILVA 2LYCA 1T8IA 1CF7A 1T98A 4N4NB 4WWCA 4RS8A 3VYSB 1UB9A 1BOAA 2DA6A 4WF2A 1FP2A 4GCVA 5ILSA 3GYHX 1ZGAA 3CCMI 2O61A 3P9CA 1HLVA 1BI3A 5HDGA 4CYDA 2B63J 2VC1A 4BHCA 5L3BA 3L00A 2IGMA 1XGNA 2CU7A 3F22A 1LVKA 3M8JA 1F4KA 2TDXA 3M9AA 4NC7A 1B8IA 1V54H 3C1DA 2PJPA 2M30A 3Q0WA 5KCMA 5FLVA 1MSEC 4XLAA 2DA3A 3MVPA 2LBFA 1WKMA 1Y1WJ 2JVHA 2HVSA 2HI3A 3LA2A 1R5ID 2IGKA 2W25A 4XLCA 2VKDA 2XAUA 4C3HJ 3M1CA 3WE2A 3KYCB 1YFHA 1HDDC 5D8KB 3LOCA 3OYNA 3HSFA 3OYMA 3WTSC 1SFEA 3PJRA 4E7JA 1IAWA 4V19K 2FMYA 3IC7A 3DKXA 1YIOA 1APLC 4I02A 1X3UA 3EYYA 4LG0B 5BPDA 4PJ0C 1WH5A 3KEQA 2STTA 1ZHFA 2GIZA 1VQLI 2FBHA 2DTZA 3CUQA 5LGUA 5E1XA 2ZXIA 2BV6A 5LGTA 3JCUC 4A3IJ 3BT9A 1IRFA 2H1LA 4I99C 2JTVA 2VC0A 2H8WA 2JN6A 3C2GA 2Y9ZA 1G6NA 2MG4A 3GW2A 1KQ9A 4DZJA 2E1NA 3G2BA 2K5CA 2KJCA 3HXLA 4NNJA 4RLQA 4ANJA 1TW2A 4MTEA 1BR4A 1WSUA 4E7SA 5KHDA 3H5NA 4H4KC 4OMZA 4ZDPA 3OIOA 3I3LA 2AQFA 2ZFUA 4LITA 1B9NA 1J0RA 3BY6A 2A5YB 2JQ7A 3HJEA 2CJJA 2PEXA 4CCNA 4C30A 4P1WA 1A5JA 5EG0B 2XKPA 4HW0A 1JKRC 3OYFA 4LG0A 2ZNYA 3WGHA 4RMNA 1HOMA 1I27A 4PSXA 3BR1A 3FKIJ 3C2HA 1G8XA 4YIFA 4FTHA 5K7HA 2VBZA 2COMA 2MYSA 5M3MJ 1WI9A 3HOTA 4WK8F 3S17J 4UVCA 1UELB 3BG9A 3OS1A 1FBQA 1S7EA 1FPQA 3K2ZA 4LB5A 2K85A 3S2WA 4I98B 4CHUA 1H9GA 5HNFA 5EZHA 3BR6A 4I6ZA 1U78A 1VQNI 4KICA 3AG3H 1LDJA 1YJ9I 1J59A 3MKLA 4DYCA 4RBOA 5BPIA 4RB3C 1XSDA 5A2QK 3F8FA 2HQ5A 3LSKA 2IA1A 2RVCA 2VJJA 2GM4A 5FKKA 3QYFA 2KZVA 2RV8A 1Y56A 2X6XA 3BTLA 2VKVA 4QPQA 3OYKA 1S72I 4XN3A 1REPC 1A36A 1RR7A 1Q1HA 4BGDA 1BIAA 5GPCA 1X58A 4Q4ZF 5E79C 2KIUA 1W0TA 4S05A 2VJIA 1ETWA 3G73A 3WTUC 2BZTA 4LIUA 3OR1C 2DJNA 4OIPF 1ZK8A 3GZNB 3GEZA 1TP4A 5GAHJ 1BM9A 3DFGA 4O6JA 5EEAA 2MSYA 5H6QA 2E1CA 4XORA 1LFBA 2QCOA 3T5XA 4IOCF 2K9LA 3R0JA 5A2QZ 2RQPA 2NYXA 2ELJA 4KIBA 5ICFA 1T2KA 3C18A 4IEJA 1JUPA 2WTEA 4AVPA 3U1DA 1U3EM 2O03A 3A02A 4ZJZA 2E1MC 2ZBKA 2MA3A 1WJ5A 2MC3A 3GWZA 2IS2A 3MN2A 3P9IA 4AD9A 4LK1F 1Y1VJ 1QPIA 3MEXA 3K4MA 3Q9SA 2F5VA 3ERMA 1RUNA 3ZR8X 5KNLA 2DDAA 2W57A 4HX4A 2ZJQF 2GAUA 4A0YA 3E6CC 2R4GA 1X1CA 1XC5A 2QQ9A 4II3A 2FBKA 3F8NA 1EH6A 1T38A 5M5WJ 2GOXB 3HIFA 1OYYA 5CVVA 3V8LA 3HPHA 4ZTJA 1RUOA 1SANA 2A3SA 2XRLA 3LSJA 5IYBJ 1HA8A 1OISA 3MZYA 1PUFA 3ZMZA 4O5VA 1K6OA 4D5FA 1XTAA 3B6CA 2Z1DA 2G0EA 1POGA 1WCMJ 2KQRA 3ZXSA 2ZO4A 2OAZA 2ZNZA 2QENA 4HG2A 2L9RA 1YHQI 4QLCU 2A05A 3DCFA 2MLGA 5FKOA 2NAZA 2LMDA 3LSHA 1JJ8C 1O3QA 1HKQA 3KP7A 1ON2A 4EM0B 3OMYA 1S3JA 2E2JJ 2AHQA 2ZC2A 1U0JA 1FOXA 5EZGA 1P92A 2NNNA 5B3SH 3JRFA 4H0EA 3Q0UA 3HSRA 2LY9A 3K9TA 3DQVC 2QGUA 1ZKGA 2PFBA 4N9IA 4Y17A 5J4YA 4CYCA 2W24A 1TT0A 4JOMA 3RYPA 3G1MA 1R6RA 2ME6A 3OIPA 4I76A 5DUKA 4GYIA 1TWGJ 4RAZA 2HPMA 1DQUA 2D5VA 1X3WB 2FBIA 2PI0A 4M71A 1V4RA 1EJ9A 3HOUJ 4B3XA 3J7AY 2E7WA 1LJ9A 3KZIC 3S3MA 3DU6A 1YTYA 2EBIA 3BG7A 5LEJA 1WVRA 3DP7A 3Q5FA 1JI8A 3F9KA 3BPVA 1KYWA 3LWFA 3FKJA 3BPXA 1ONVA 2BGCA 4U0YA 4G6DA 1V55H 4HF2A 2G7UA 2CWEA 2L9SA 1ZG1A 2DLLA 2GLOA 2F4OB 2W84A 3T0YA 1SC7A 1IXCA 3CTAA 3M8EA 1OQYA 4WXCA 4BU2A 3OR2C 4XLFA 4ZZLA 2NNYA 1USSA 3FM3A 4Y7NJ 1I1SA 4EGYA 1MBEA 1T6SA 2QUFA 3CD6I 2OC6A 4P9UA 3WU0A 4KT6A 4AUXA 5FKMA 4G12A 2BXZA 4E7HA 1TT5B 3Q9VA 1IRZA 2H6BA 3O6BB 2Z3YA 4HQEA 3I64A 1X2NA 2WV1A 1FSEA 3RPUD 4QTRA 2XHKA 3ASNH 3UR3C 1FTTA 3RZOJ 4A69C 1ORKA 2F5CA 2OJED 4RGXA 3ABMH 4RAFA 2CUEA 3SEQA 1WPKA 2QLZA 2V6CA 2XF6A 3H3ZA 3PL8A 4XBFA 3VPRA 4PJLA 4ZDLA 3ZMUA 2Z9OA 4NC6A 2DA5A 4MNUA 4M73A 5K5RA 2VJ4A 1K61A 2EA4A 2M34A 2V6EA 3L2CA 3LFKA 1ZLKA 3SQNA 1HW2A 3HOZJ 2BY2A 2ESHA 1QHGA 2ID6A 5LRRA 3DEUA 2HDCA 1FP1D 4UVAA 2A61A 1R00A 1LVAA 1D0ZA 3SDBA 2IW5A 5B1AH 4B4CA 4EMSA 3KEOA 1ZELA 2M8EA 1XG1A 1B72B 2FD5A 3DKWA 2FXAA 3RIRA 2MGQA 3OOPA 5FRNA 4KISA 1BI0A 4CUGA 3CP8A 3CDLA 5E1ZB 3VDXA 2XIGA 3PIPF 1YIJI 6PAXA 2BHZA 2VOOA 2XAQA 3PUFA 2FQ4A 3FMRA 2QSGX 1EH8A 5JHFA 2QA4I 3CCRI 3ZQ7A 1DPUA 2VJ5A 4FX0A 1LEAA 2IGNA 4BQNA 1PUFB 3A2KA 1Z67A 1K83J 2PQ8A 3HGYA 2OF7A 4CH7A 2AXTC 5HNHA 2QVOA 3DPLC 1U8RA 2NVXJ 2O8KA 2BEOA 3IAS2 4HYEA 3SXYA 3I58A 1JT6A 4PJMA 4U0VA 2LLKA 1YJNI 2JMWA 2WAQN 3J7YJ 2CRGA 1BJZA 4ZH4F 2LKSA 2HR3A 5C44J 3ML6A 1LEBA 2GBYA 3R4KA 1J2XA 1J5YA 4BJTA 2XV4S 2L7MP 4RB1A 3F8MA 2R5YB 5FB2A 3DPUA 4M74A 1F5TA 1HXDA 3M8FA 4HF1A 1FOYA 1T08B 3ASOH 1TQIA 1XDSA 5DM6F 5B66C 4HDUA 3K4LA 3HOVJ 2V1DA 2HOTA 1I1GA 1IXRC 4KITB 2EFPA 3H3VK 3N97A 1JTXA 1R5GA 4A6DA 1D0XA 2KZGA 3J81Z 3NAUA 1UFMA 2K4JA 1ULYA 2I8DA 4XOPA 3ZQLA 2ISZA 1XCVA 2HZTA 5LRSA 5D5XB 4F55A 2Y31A 3K70D 4HBLA 3U2RA 4XL9A 3L2RA 1CQTA 3BLYA 4XLEA 3JAMZ 3IH2A 3GXOA 4E4HA 1B1BA 1ZRFA 1VQ7I 1NG6A 4E7KA 5C4XJ 3CDIA 2JUGA 3CQZJ 5IP7J 2O0YA 3FMSA 2BOLA 2XAGA 2DMQA 3WHCA 2R7RA 5CVJA 5IY5H 5D5VB 3AL0B 3K4CA 4BXUA 1JT0A 1P9QC 1S9HA 4LMYA 4RB0A 2E19A 4WXHA 2OU2A 3V8JA 4EJUA 1FSHA 2K9SA 3OS2A 3QWLA 1ZR4A 4RGSA 1G4DA 4MFEA 2HKXA 1QO0D 3MMYB 1SMTA 4UXNA 4KNYA 4UHTA 1JKOC 4PK4A 3B73A 3OSFA 1VZ0A 1JGGA 2DOFA 4A3EJ 3FK7A 2DODA 1F43A 2Z33A 1I5ZA 1XSXA 2PJRB 3GUDA 2KP6A 3BR0A 4G6TB 4C2MJ 4FISA 2W7NA 1IRGA 5AIPA 4U88A 4DBQA 1RKWA 1GXPA 1PJRA 4U7DA 1W5SA 3FISA 1JHFA 2TRTA 4GDFA 1RRJA 3RPUA 5HODA 3BZ6A 2BY0A 2JK3A 2WWYA 2UWMA 2DT6A 4Y3OA 4DYRA 3O8HA 3H35A 1G2HA 2IVMA 1W0UA 1Z91A 2FMLA 3TDZC 5EDNA 2HVRA 1SAUA 1XMAA 3G71I 3EDPA 2V26A 2DPDA 5TISC 1XMKA 4KT5C 3GZ6A 4BQAA 3F6VA 1UG0A 1QRYA 2CSOA 2VLAA 3GTGJ 3HYIA 2HXIA 3LMMA 1J09A 4C9YA 1A31A 2F4MB 3BZCA 5J6XA 2KJBA 2R7FA 3FXUA 1H9TA 1WH7A 3K6GA 1OMIA 2C6YA 4XQFA 3BCAA 4OWRB 3GTMJ 4HEA2 3HDDA 4GXOA 4LLNA 3MWMA 4L5IA 3SZPA 3J81K 1BI2A 4A6EA 2F6CA 2QKLB 1RR8C 4RDUA 4BHPA 2M2EA 3RDIA 1BN5A 2NXNB 3ZPLA 1IN7A 4ENKA 4XM3A 3HOYJ 3FDYA 2X6YA 1NG7A 2GXAA 3WTWC 1YX5A 1GV5A 2H1KA 1Z3XA 4FE7A 2H8RA 2ECCA 3HBLA 2LF8A 3KE2A 3HOXJ 4LJZF 3U1KA 1E2XA 2R7TA 1AKHB 4RB2C 4F92B 2BYVE 1ETYA 5DTDA 4KYWA 4M3BA 2DPUA 4X0GA 2JPCA 4OAYA 1GVJA 1Z3YA 2PG4A 2DFFA 2J5PA 4HSTA 4ZDOA 2QBYA 3H0GJ 4G7HF 1FIAA 3PNYA 3W6JB 2OCEA 3QOEA 5LLQA 3PO2J 3RKXA 1IO2A 4ETSA 1D3YA 4KMUX 2LOOA 4RGUA 3CCYA 4RAYA 3CDHA 3VEPA 3LAPA 4M72A 1TQPA 3DBLB 3RCOA 2W00A 3HZJA 4LG3A 5K7FA 2LKPA 1Z0XA 4BY1J 3RQIA 5K5OA 2LK2A 4AWXB 5L3GA 1IV6A 1DU0A 1P4XA 4V2GA 4ZC3A 2GWRA 1SEUA 2R5ZB 4XK4A 2X4HA 4Z6YA 1ETOA 4IVNA 5LHGA 4L0YB 3A0BC 2WY8Q 4IRGA 2ZSIB 3HB9A 1R1TA 4D0PA 2QSFX 5DCMA 4PGHA 3S93A 4ENMA 2JRTA 3EUHC 2AO9A 3KCCA 3TMOA 3HM5A 4ZYHA 3BG6A 2FA5A 3WTZA 1ITYA 1LE8A 2F48A 2RN7A 4Y4RA 5CVUA 3TO9A 2L4AA 1X3ZB 2QQBA 2I5UA 3LSMA 4PFPA 2EZKA 2CUFA 1PVEA 2OZ6A 1I50J 2JA2A 2CW0F 2JA6J 2A6TA 3G1OA 3QOPA 3RTRA 1JTYA 1U9NA 2OV7A 1K6YA 2XASA 5LHIA 1W36D 1SD6A 2YU3A 2MH2A 4B1RA 3HHHA 4NHJA 3E5XA 5F0HA 4XR6A 4CDGA 3CCEI 3E5QA 4BE0A 5DD4A 3ZGKA 1MBFA 5KAIC 1C0WA 3GTLJ 3ZQQA 1FX7A 1WQ2A 4M6XA 2HWVA 3PQJA 2LC2A 3SEZA 2VPRA 3V42A 2B9SA 3CCUI 1O3SA 3SFZA 3ZMDA 1U5TB 2KPMA 3GFJA 3DWLE 2CQ7A 2PMZA 1DU6A 4XKVA 4CICA 2M87A 2JZYA 3TL4X 3LA7A 4BS9A 3HRMA 1WJCA 3VSLA 1D5VA 5FKLA 3CC4I 2FOKA 1OR7A 2Q2EA 2JUCA 1TZLA 1HQCA 1YE9A 2XSDC 5JI6A 2JSPA 4Y13A 3CMAI 2IJLA 5F0FA 4RGRA 3FF5A 3QU3A 3NWTA 2DA7A 5L3FA 5GTHC 2LY2A 5J3LA 4M3FA 2WV0A 2LD5A 2DMNA 3L2UA 4ENNA 2XF5A 4BQOA 2L2OA 2CV2A 3REOA 3W2AA 2VODA 2NVYJ 4HNTA 2FU4A 2QZ8A 4WCGA 2YX7A 1ZREA 3SZGA 1SD4A 3Q3SA 5FD5A 3ZRGA 2LKXA 2CQQA 1VQ4I 3GLXA 3ZN1A 2CMPA 2HYJA 3JTHA 5IYCJ 4YFNF 3IUOA 1A04A 2XF7A 1XGMA 3K1NA 2WAFA 3GCMA 2G9WA 2LRDA 2VT3A 5BQTA 1GV2A 1U8BA 1N78A 2Y0SA 1E0EA 1VQPI 1G3YA 2HVQA 1W36C 2KISA 2Y0MA 2EFOA 3CJNA 1LDKB 4JYKA 3CCSI 3MKWB 1JGSA 4HV6A 1OJLA 3TEDA 2HKOA 1SFOJ 2XGDA 2LH9A 3U21A 3JRGA 3BC8A 1MMDA 2HYGD 2YX4A 2DT7B 4DIQA 4RM3A 4BUPA 3KLOA 4AIKA 5F04A 1MKMA 4M3GA 3TW7A 2DMUA 2DQLA 3BZKA 4A3KJ 4M6YA 4G7ZF 2JRMA 1TWCJ 2EFNA 1XD7A 5LEKA 1VQKI 3IWFA 3KP6A 4PJNA 1HW1A 3CF5F 3ZQGA 1QBJA 4BL0B 3IKVA 2M0CA 1ACIA 4PGGA 1W7PA 2DOEA 4EM1A 4M3EA 1WJFA 3WHBA 1OCZH 5CJ9A 2R7VA 4CCJA 4KUMA 2DOAA 2DQRA 1VF9A 5HLTA 3QAHA 1LPQA 2DA4A 3SJMA 1MD0A 5CQEA 2AQEA 5FFXA 4HNUA 2L7ZA 2UUZA 3WTXC 3HUGB 1VQ9I 5ICGA 5CYVA 3CMMA 3K10A 3AL0C 2XRNA 3CUQB 1IG7A 5IOYA 5KAFC 2VBYA 2DXIA 1KU9A 1OYWA 3L1PA 4XKCA 1MMAA 1KONA 2RGVA 3EUKL 1ERDA 5J1RA 5D4SA 2ID3A 2Y2ZA 3BOQA 3DF8A 2HQAA 3G1LA 2W85A 4G9YA 3ZQHA 3KYLA 3ABKH 2X9DA 1JXSA 1FBSA 5ICEA 2MC4A 2IXSA 1NHAA 3A01B 3K7AJ 5F08A 3V7SA 2OTJI 4EQQA 2COBA 3SFIA 1F1ZA 2OBPA 2QSHX 4IPAA 3LFUA 3OYEA 3H0DA 3NQOA 1K79A 3S1MJ 2DA2A 2IPQX 5JFRA 3I4NJ 4BBRJ 1HKTA 1PYVA 1BW5A 5CQGA 4A3JJ 3HRSA 1D1BA 4YELA 3K4BA 3Q0VA 1V5EA 3S1QJ 3OYDA 2W1OA 4JX4A 2NOGA 5GADJ 2L9NA 3RPQA 2ZXHA 3F6OA 1S7OA 4KJZA 5J4VA 3BR3A 3DTEA 4AM3A 4CCLA 4Y52J 4FX4A 4G8XA 2NS0A 3L2WA 3UKGA 2HNHA 4OIQF 1XGOA 5DS9A 2STWA 4L9NA 2M1BA 1T95A 3S1RJ 3MQ0A 2P6TA 3BTJA 4XICA 4U0WA 3IWZA 2EIJH 2F4IA 3WU1B 2JA8J 2VQLA 1I6HJ 1RPWA 1S7AA 3E6BA 2MFZA 5E3LA 2EK5A 4D5CA 1GHCA 5D6EA 1QZEA 3IH3A 4PCQA 4CCKA 3QODA 2VOPA 2KRHA 3KPHA 1HC8A 3M3YJ 4LK0F 3JREA 3F21A 2F5FA 2RAEA 1V5FA 4QWQA 2F5DA 2R5YA 5E20A 1R4MB 2VONA 4UB8C 1SD5A 3GFLA 3ZMTA 2DJIA 4ZTFA 3CUQC 1SFKA 1AU7A 4G7OF 2LTPA 2XROA 3BROA 2VUMJ 2I10A 1EKEA 4BH9A 1HKSA 2IT0A 3HOWJ 4BHBA 5J1YA 1L3LA 4YFKF 2R5ZA 1XMXA 3H9GA 1MNMC 2K4BA 1P7JA 2KLOA 4P9FA 4ZYDA 3LQRA 1J9IA 1D1AA 2VQHA 5JLWA 3WU2C 1RC9A 2L01A 2Z16A 3TKYA 4BDYA 2QKMB 3DKYA 2HS5A 3QRFF 5FLXK 2HEOA 3GBGA 1ZGJA 1B59A 3TGNA 4CYCB 5ERIA 3FXJA 3H1CA 2D45A 4I7HA 1FMVA 1KYZA 1ODDA 3L7WA 4S04A 2EWNA 4P5OA 3IRRA 2XKOA 2E7XA 2EIMH 3BQZA 3FHZA 4C2TA 4M9ZA 1GDTA 2P81A 1I3QJ 1FNNA 2WAEA 2NVUB 3PNTA 4F52A 3RKQA 3KP4A 1DUXC 3IKTA 2P5KA 5KVRA 3TOAA 4A3LJ 1KZHA 1V3FA 1AKHA 3GTQJ 3MKYB 3JSOA 1KQ0A 2H09A 3BJ6A 2O9LA 3FWEA 1MH4A 4HOBA 1ETVA 2K27A 2KFDA 1SVOA 4L0ZB 1TC3C 2M45A 2R7UA 5E3NA 3PNVA 4IQ4A 2VASA 1MBHA 4IRIA 1I39A 4FASD 1GT0C 3VODA 5GPAA 5IT9Z 3CMEI 1RESA 2HTSA 2CW8A 4J01A 3L09A 2LREA 1H89C 2EFWA 1ENHA 1FBUA 3PFIA 2CQXA 3OYJA 1T0FC 3CF2A 2P6SA 1IW7F 1P2FA 1RKTA 3WE3A 3CMYA 3FXQA 3O3KA 2OA4A 1RIOH 2VPLA 4PZJA 1E3OC 3BJOA 3K2AA 3BWGA 5JR3A 5D8LB 3E1SA 2E2IJ 1QHHD 2BVLA 2MBFA 3DV8A 5DV5A 5FRMA 3L2VA 1X1DA 1Z1DA 2ACJA 2JA7J 5HDNA 1GXQA 2ETHA 1CF7B 1JUMA 1ZQ3P 4BACA 2ZMEC 2H94A 1HBXG 1TQMA 2E5NA 3KZYA 2FOWA 2HGCA 1NTCA 4L9TA 1N25A 1P4WA 1B8IB 1BW6A 1JHHA 3DBHB 4G94A 3I53A 5H6RA 3TO6A 3OIQA 4C2UA 2FEZA 5E18F 2XGEA 1YI2I 2HQRA 2R7SA 3QU6A 3TOBA 3HTSB 2LR8A 1B72A 2NVQJ 1U6GA 1WJAA 4HA8A 3FX3A 4L5EA 4Y33A 1P6RA 2DFHA 3BCBA 2UV1A 5DM7F 4ZZDA 4UUVA 2FQ3A 1SD7A 3CJTB 5D6FA 3M4OJ 4MQ9F 3QPSA 2V1UA 5EEHA 4ESBA 1LE8B 1KA8A 3AG2H 1HDPA 1UJ8A 5DYMA 3HGGA 3EQLF 3MFKA 4GYGA 3OL3A 1IDYA 3MKZA 1W7PD 2KL4A 1AWCA 5IYDJ 5CVRA 1IN6A 2RKHA 3BTCA 3RKYA 1BIBA 2EV6A 1Y39A 2CFXA 3JRAA 1IN4A 2CH0A 3DPTA 4B43A 1G59A 2GXBA 3G6EI 4A3BJ 4XNFA 4R79A 2CYYA 5AIQA 2V9VA 5M5YJ 1K78B 1ZYRF 4K2EA 5TJJA 1BA5A 3J7AO 1HF0A 2A07F 1O3TA 3WTYC 1D0YA 1MGTA 1YW9A 1J7KA 2H27A 4C3IJ 2E71A 1MMSA 5IT9K 1OCOH 2P0WA 5HS7A 3H5AA 3NEUA 1K78A 1WWXA 1GLNA 1ZGWA 1N77A 1WZ2A 3HEFA 1X1PA 4EVIA 1MJAA 2DYRH 1IV8A 3WTTC 1MH3A 1MNEA 2HOAA 4YFXF 3OSGA 3TO7A 4IXAA 4GFBA 3CLOA 1CGPA 4CXFA 3I56I 3DEWA 3KEYA 2AXLA 2M9HA 1D5YA 2E5ZA 2HTJA 2KIMA 2HPIA 4ZYEA 3TP3A 4CZCA 2YU9J 2HYFA 2IA2A 5EYRA 4NB5A 4BY7J 3I4PA 2ADUA 4L9VA 4HV5A 1V5GA 1PDNC 1BJAA 4LLGF 2LSOA 2DMTA 2CS3A 2E1OA 3PSIA 1TTYA 2XB5A 3K0LA 4PSWA 4LLLA 3ZOBA 2PLYA 1R4NB 1VQ8I 5GP9A 4JX5A 4OOIA 1J75A 2Z5UA 1UHSA 4JK1X 1GVDA 1B6AA 1FT9A 4WXDA 9ANTA 4J19A 2W48A 1HSTA 3MCZA 4I0AA 1XB4A 4L5JA 4E7IA 4IHWA 1W5TA 4MO7A 3CC2I 2K7LA 3RKWA 2DW4A 3JRIA 5J47A 1P4AA 2LP0A 3LSGA 3CCVI 1JUSA 3JAMK 2XPVA 1K7AA 2M8GX 2LVSA 2ZB9A 1XDUA 2X1EA 1Z7LA 2QEXI 3KP2A 5CVIA 1A35A 4KMFA 3KX2A 1GUUA 4BXXJ 4A93J 1FYLA 3DU5A 1TNTA 1FYKA 4DZPA 2L4MA 1S5LC 3R6SA 2HOEA 2KIQA 5HS9A 2OUMA 2GXGA 3V7CA 4AVZA 2E35A 3HG9A 1R36A 1ETKA 4NUBA 3FMQA 3KYDB 5FKNA 5JVGF 2A6EF 3HHGA 4XLNF 3KETA 1YYVA 4XONA 4AIJA 2JJ7A 2O7OA 3CCJI 3CCLI 1IGNA 2NRAC 2EPFA 1KQ8A 2IGOA 2PMHA 2FE3A 3LA3A 4HLXA 1OCTC 3F8BA 3QPLA 5FO5A 4M3DA 2YSRA 3S2HJ 3QPTA 4LD5A 4EGZA 1YOVB 2KT0A 5H2FC 2VIXA 1SMYF 4Q47A 3IV5A 1YW8A 4GGGA 1E3PA 2Z2SB 3K4KA 3MAJA 5F1RA 4OU0A 4MLOA 2F5EA 2BY1A 3M07A
chains in the Genus database with same CATH topology
3LNQA 5EZGA 2CQQA 3JRFA 2HYJA 3Q0UA 2XGCA 2LY9A 3FIWA 2R0QC 2ELKA 5IYCJ 1ZKGA 5K7ZA 2TCTA 5E3MA 4IHVA 1ZTRA 1U8BA 1GV2A 4CYCA 3JRCA 3G1MA 2ME6A 4I76A 3I4MJ 2D5VA 1TWGJ 4DW6A 2NS8A 4JYKA 2XB0X 3HOUJ 1OJLA 3TEDA 5FLMJ 1SFOJ 2XGDA 1NK2P 2K9QA 1R9TJ 3JRGA 2EBIA 2EZIA 5F1JA 4QSHA 4LOCA 2DN0A 2Y30A 1UMQA 4MIMA 5IP9J 5F04A 4M3GA 2JWTA 3TW7A 1Z77A 1X2MA 2DMUA 4A3KJ 2GLOA 1ZR2A 1TWCJ 2VI6A 3ZQGA 3IH4A 2M0CA 2HOSA 4Y7NJ 3S16J 4M3EA 3GTJJ 3WHBA 1MBEA 4DYQA 1VF9A 2DA4A 3SJMA 5C4JJ 3S2DJ 4AUXA 5FKMA 4G12A 2WB1N 1IRZA 2L7ZA 1X2NA 3F0CA 2WV1A 4QTRA 3ZQIA 1FTTA 3RZOJ 2IAIA 1ORKA 4A69C 1IG7A 5IOYA 5EG0A 2CUEA 3L1PA 2R92J 1WPKA 4C3JJ 1OFCX 3VPRA 1JKQC 1NK3P 5J1RA 2DA5A 1FJLA 1K61A 2ID3A 2Y2ZA 2M34A 2Y0SN 1IC8A 2X48A 4S0HB 4AYBN 3G1LA 3HOZJ 2ID6A 3ZQHA 3JRDA 2X9DA 1VFCA 4A3CJ 2XPUA 1FTZA 4B4CA 3A01B 3K7AJ 5F08A 1BL0A 2COBA 2OPTA 3SFIA 1XG1A 1B72B 2FD5A 2YUSA 2MGQA 1IDZA 2HXOA 1HCRA 2NVTJ 4UUSB 2ME0A 1RETA 4UUSA 1Q1VA 2DMPA 5IOZA 3OOUA 1TWHJ 3S1MJ 2DA2A 3I4NJ 4BBRJ 1BW5A 2EQRA 3CDLA 4UUTA 4A3JJ 1YRNB 2X6OA 3Q0VA 4A3DJ 2R7ZJ 3S1QJ 4JX4A 4BBSJ 2NOGA 3LSRA 2FQ4A 4A3MJ 5J1UA 1H8AC 3BR3A 4B3AA 4Y52J 1YRNA 4JP0A 3UKGA 1PUFB 1K83J 3A03A 3HGYA 5DS9A 2OF7A 1EF4A 4XRSA 1LFUP 3S1RJ 2NVXJ 2O8KA 1JT6A 3BTJA 5IPAA 3TP0A 4XICA 2LLKA 2JMWA 2WAQN 5M3FJ 2CRGA 3BG3A 2JA8J 1I6HJ 1BJZA 1RPWA 5E3LA 4D5CA 3IH3A 5C44J 2EZHA 2GBYA 1U9OA 1OCPA 3M3YJ 3GTPJ 3JREA 2L7MP 2RAEA 2IBDA 4FCYA 2R5YB 2R5YA 4IHYA 4D7MA 4D7NA 3NARA 2ECBA 3S15J 1AU7A 2LTPA 4EEFG 4M6VA 1QVTA 3HOVJ 1UG2A 2HOTA 2VUMJ 2I10A 3H3VK 3GTKJ 3HOWJ 1JTXA 5J1YA 3NAUA 2R5ZA 2FJ1A 1MNMC 1MBGA 2VKEA 5F0CA 3ZQLA 1ETQA 1MBJA 1P7JA 1ETXA 2Y31A 5JLWA 1QVUA 1T56A 5IP6A 5C3EJ 1CQTA 1IJWC 3IH2A 3S1NJ 4X6AJ 5M5XJ 4XRMA 3GBGA 3GTOJ 5C4XJ 3CQZJ 5IP7J 4CYCB 1TWFJ 4BKXA 2DMQA 3WHCA 1P7IA 5EF6A 3BQZA 1MSFC 3D1NI 1JT0A 1GDTA 2P81A 1I3QJ 3C2BA 2E19A 2EZLA 2K9SA 1ZR4A 4W97A 3RKQA 4MFEA 2L7FP 3TW6A 4A3LJ 3BQYA 1JKOC 1O4XA 1AKHA 3OSFA 2EH3A 2IEKA 3GTQJ 1JGGA 2O9LA 3W6VA 4XIDA 2K9NA 4IHXA 4HNVA 1MH4A 1ETVA 4A3EJ 1TC3C 3FK7A 5E3NA 2DA6A 1F43A 1MBHA 3BR0A 4C2MJ 4FISA 1GT0C 5GPAA 1WI3A 1RESA 1RKWA 1H89C 3FISA 2TRTA 1A6IA 1HLVA 1ENHA 5HODA 3RZDJ 2B63J 2CQXA 3ZQFA 2JK3A 2CU7A 1B8IA 4DYRA 3O8HA 1RKTA 3CMYA 1VNDA 3Q0WA 1G2HA 5FLVA 3JRBA 1MSEC 2DA3A 1W0UA 5EDNA 1E3OC 3MVPA 3K2AA 1Y1WJ 2R93J 1JKPC 2HI3A 2E2IJ 1QRYA 4C3HJ 2MW8A 3GTGJ 2HXIA 4JX6A 1HDDC 2JA7J 3LOCA 1JUMA 1WH7A 1ZQ3P 5BNGA 3GTMJ 1TWAJ 3HDDA 1APLC 1NTCA 4AC0A 1B8IB 5EGOB 1BW6A 4A3GJ 1WH5A 4XRSG 2DTZA 4RDUA 2XGEA 3PM1A 3A01A 2QF7A 2M2EA 3SDGA 2NVQJ 3FK6A 4A3IJ 2LR8A 1B72A 3BT9A 4L5EA 3BTIA 3HOYJ 1MBKA 5JLXA 2JN6A 2Y9ZA 1GV5A 2H1KA 3QQAA 2MG4A 4FE7A 2H8RA 2ECCA 3HBLA 4V2FA 4DZJA 4QIWN 2LFBA 2DA1A 3M4OJ 3HOXJ 3QPSA 1LE8B 3PO3J 5F27A 3B6AA 1AKHB 1HDPA 3OIOA 3HGGA 1ETYA 5DTDA 1IDYA 4M3BA 5IYDJ 2CJJA 3BTCA 1A5JA 5EG0B 1JKRC 3JRAA 4A3BJ 5EGOA 3H0GJ 1FIAA 5M5YJ 1HOMA 3PO2J 1BA5A 3BR1A 3FKIJ 1FEXA 2PMZN 1HF0A 4FTHA 3E7LA 5K7HA 5M3MJ 3CCYA 3ZQCA 1XS9A 4C3IJ 5FJ8J 3S17J 2KDZA 3BG9A 1S7EA 5K7FA 1Z0XA 4BY1J 3RQIA 1ZGWA 2LK2A 1IV6A 3HKZN 1DU0A 4V2GA 5EZHA 1WGXA 3BR6A 3HEFA 4I6ZA 1U78A 2Y9YA 2R5ZB 4XK4A 2HDDA 1MH3A 1ETOA 2HOAA 4ABZA 3OSGA 4GFBA 3HB9A 3MKLA 3DEWA 2M9HA 4DYCA 1D5YA 4RBOA 3LSPA 2AO9A 2HQ5A 3TP3A 3HM5A 2YU9J 2GM4A 1ITYA 5EYRA 1LE8A 5FKKA 4BY7J 3BTLA 2VKVA 4MFDA 1T33A 1RR7A 2CUFA 2DMTA 2EZKA 1I50J 2E1OA 1AHDP 2XB5A 2JA6J 3G1OA 3ZOBA 2N8GA 5GPCA 1X58A 1IUFA 1JTYA 1U9NA 5GP9A 1W0TA 4JX5A 1ETWA 1UHSA 2DJNA 4B1RA 1GVDA 1ZK8A 9ANTA 4J19A 4W1UA 5F0HA 2W48A 2FX0A 3JRHA 2YS9A 5E3OA 5EEAA 2MSYA 2JA5J 4IHWA 1LFBA 3BG5A 1MBFA 2QCOA 4MO7A 3GTLJ 1F36A 3JRIA 2LP0A 3O8GA 3LSGA 1JUSA 2VPRA 4IEJA 1JUPA 2XPVA 3BR5A 2M8GX 3A02A 2LVSA 2ZB9A 3JR9A 3MN2A 1DU6A 1GUUA 4BXXJ 4A93J 1Y1VJ 1QPIA 4DZPA 2K40A 2NS7A 5FKLA 2L0KA 1ETKA 1XC5A 2XSDC 2XPWA 5FKNA 4FE4A 4X1EA 5M5WJ 1JJ6C 2E2HJ 4A3FJ 1FIPA 1SANA 2XRLA 3LSJA 2JJ7A 2O7OA 3BR2A 5IYBJ 1IGNA 1PUFA 5F0FA 1OCTC 4D5FA 3B6CA 2DA7A 3QPLA 4NDLA 2G0EA 4M3DA 5J3LA 4M3FA 1POGA 1WCMJ 2LD5A 2DMNA 1VI0A 3S2HJ 2L9RA 2KT0A 3DCFA 5FKOA 2NVYJ 3IV5A 3S14J 1H88C 1JJ8C 3Q3SA 4MLOA 2E2JJ 2LKXA 2AHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNQ A;  5EZG A;  2CQQ A;  3JRF A;  2HYJ A;  3Q0U A;  2XGC A;  2LY9 A;  3FIW A;  2R0Q C;  2ELK A;  5IYC J;  1ZKG A;  5K7Z A;  2TCT A;  5E3M A;  4IHV A;  1ZTR A;  1U8B A;  1GV2 A;  4CYC A;  3JRC A;  3G1M A;  2ME6 A;  4I76 A;  3I4M J;  2D5V A;  1TWG J;  4DW6 A;  2NS8 A;  4JYK A;  2XB0 X;  3HOU J;  1OJL A;  3TED A;  5FLM J;  1SFO J;  2XGD A;  1NK2 P;  2K9Q A;  1R9T J;  3JRG A;  2EBI A;  2EZI A;  5F1J A;  4QSH A;  4LOC A;  2DN0 A;  2Y30 A;  1UMQ A;  4MIM A;  5IP9 J;  5F04 A;  4M3G A;  2JWT A;  3TW7 A;  1Z77 A;  1X2M A;  2DMU A;  4A3K J;  2GLO A;  1ZR2 A;  1TWC J;  2VI6 A;  3ZQG A;  3IH4 A;  2M0C A;  2HOS A;  4Y7N J;  3S16 J;  4M3E A;  3GTJ J;  3WHB A;  1MBE A;  4DYQ A;  1VF9 A;  2DA4 A;  3SJM A;  5C4J J;  3S2D J;  4AUX A;  5FKM A;  4G12 A;  2WB1 N;  1IRZ A;  2L7Z A;  1X2N A;  3F0C A;  2WV1 A;  4QTR A;  3ZQI A;  1FTT A;  3RZO J;  2IAI A;  1ORK A;  4A69 C;  1IG7 A;  5IOY A;  5EG0 A;  2CUE A;  3L1P A;  2R92 J;  1WPK A;  4C3J J;  1OFC X;  3VPR A;  1JKQ C;  1NK3 P;  5J1R A;  2DA5 A;  1FJL A;  1K61 A;  2ID3 A;  2Y2Z A;  2M34 A;  2Y0S N;  1IC8 A;  2X48 A;  4S0H B;  4AYB N;  3G1L A;  3HOZ J;  2ID6 A;  3ZQH A;  3JRD A;  2X9D A;  1VFC A;  4A3C J;  2XPU A;  1FTZ A;  4B4C A;  3A01 B;  3K7A J;  5F08 A;  1BL0 A;  2COB A;  2OPT A;  3SFI A;  1XG1 A;  1B72 B;  2FD5 A;  2YUS A;  2MGQ A;  1IDZ A;  2HXO A;  1HCR A;  2NVT J;  4UUS B;  2ME0 A;  1RET A;  4UUS A;  1Q1V A;  2DMP A;  5IOZ A;  3OOU A;  1TWH J;  3S1M J;  2DA2 A;  3I4N J;  4BBR J;  1BW5 A;  2EQR A;  3CDL A;  4UUT A;  4A3J J;  1YRN B;  2X6O A;  3Q0V A;  4A3D J;  2R7Z J;  3S1Q J;  4JX4 A;  4BBS J;  2NOG A;  3LSR A;  2FQ4 A;  4A3M J;  5J1U A;  1H8A C;  3BR3 A;  4B3A A;  4Y52 J;  1YRN A;  4JP0 A;  3UKG A;  1PUF B;  1K83 J;  3A03 A;  3HGY A;  5DS9 A;  2OF7 A;  1EF4 A;  4XRS A;  1LFU P;  3S1R J;  2NVX J;  2O8K A;  1JT6 A;  3BTJ A;  5IPA A;  3TP0 A;  4XIC A;  2LLK A;  2JMW A;  2WAQ N;  5M3F J;  2CRG A;  3BG3 A;  2JA8 J;  1I6H J;  1BJZ A;  1RPW A;  5E3L A;  4D5C A;  3IH3 A;  5C44 J;  2EZH A;  2GBY A;  1U9O A;  1OCP A;  3M3Y J;  3GTP J;  3JRE A;  2L7M P;  2RAE A;  2IBD A;  4FCY A;  2R5Y B;  2R5Y A;  4IHY A;  4D7M A;  4D7N A;  3NAR A;  2ECB A;  3S15 J;  1AU7 A;  2LTP A;  4EEF G;  4M6V A;  1QVT A;  3HOV J;  1UG2 A;  2HOT A;  2VUM J;  2I10 A;  3H3V K;  3GTK J;  3HOW J;  1JTX A;  5J1Y A;  3NAU A;  2R5Z A;  2FJ1 A;  1MNM C;  1MBG A;  2VKE A;  5F0C A;  3ZQL A;  1ETQ A;  1MBJ A;  1P7J A;  1ETX A;  2Y31 A;  5JLW A;  1QVU A;  1T56 A;  5IP6 A;  5C3E J;  1CQT A;  1IJW C;  3IH2 A;  3S1N J;  4X6A J;  5M5X J;  4XRM A;  3GBG A;  3GTO J;  5C4X J;  3CQZ J;  5IP7 J;  4CYC B;  1TWF J;  4BKX A;  2DMQ A;  3WHC A;  1P7I A;  5EF6 A;  3BQZ A;  1MSF C;  3D1N I;  1JT0 A;  1GDT A;  2P81 A;  1I3Q J;  3C2B A;  2E19 A;  2EZL A;  2K9S A;  1ZR4 A;  4W97 A;  3RKQ A;  4MFE A;  2L7F P;  3TW6 A;  4A3L J;  3BQY A;  1JKO C;  1O4X A;  1AKH A;  3OSF A;  2EH3 A;  2IEK A;  3GTQ J;  1JGG A;  2O9L A;  3W6V A;  4XID A;  2K9N A;  4IHX A;  4HNV A;  1MH4 A;  1ETV A;  4A3E J;  1TC3 C;  3FK7 A;  5E3N A;  2DA6 A;  1F43 A;  1MBH A;  3BR0 A;  4C2M J;  4FIS A;  1GT0 C;  5GPA A;  1WI3 A;  1RES A;  1RKW A;  1H89 C;  3FIS A;  2TRT A;  1A6I A;  1HLV A;  1ENH A;  5HOD A;  3RZD J;  2B63 J;  2CQX A;  3ZQF A;  2JK3 A;  2CU7 A;  1B8I A;  4DYR A;  3O8H A;  1RKT A;  3CMY A;  1VND A;  3Q0W A;  1G2H A;  5FLV A;  3JRB A;  1MSE C;  2DA3 A;  1W0U A;  5EDN A;  1E3O C;  3MVP A;  3K2A A;  1Y1W J;  2R93 J;  1JKP C;  2HI3 A;  2E2I J;  1QRY A;  4C3H J;  2MW8 A;  3GTG J;  2HXI A;  4JX6 A;  1HDD C;  2JA7 J;  3LOC A;  1JUM A;  1WH7 A;  1ZQ3 P;  5BNG A;  3GTM J;  1TWA J;  3HDD A;  1APL C;  1NTC A;  4AC0 A;  1B8I B;  5EGO B;  1BW6 A;  4A3G J;  1WH5 A;  4XRS G;  2DTZ A;  4RDU A;  2XGE A;  3PM1 A;  3A01 A;  2QF7 A;  2M2E A;  3SDG A;  2NVQ J;  3FK6 A;  4A3I J;  2LR8 A;  1B72 A;  3BT9 A;  4L5E A;  3BTI A;  3HOY J;  1MBK A;  5JLX A;  2JN6 A;  2Y9Z A;  1GV5 A;  2H1K A;  3QQA A;  2MG4 A;  4FE7 A;  2H8R A;  2ECC A;  3HBL A;  4V2F A;  4DZJ A;  4QIW N;  2LFB A;  2DA1 A;  3M4O J;  3HOX J;  3QPS A;  1LE8 B;  3PO3 J;  5F27 A;  3B6A A;  1AKH B;  1HDP A;  3OIO A;  3HGG A;  1ETY A;  5DTD A;  1IDY A;  4M3B A;  5IYD J;  2CJJ A;  3BTC A;  1A5J A;  5EG0 B;  1JKR C;  3JRA A;  4A3B J;  5EGO A;  3H0G J;  1FIA A;  5M5Y J;  1HOM A;  3PO2 J;  1BA5 A;  3BR1 A;  3FKI J;  1FEX A;  2PMZ N;  1HF0 A;  4FTH A;  3E7L A;  5K7H A;  5M3M J;  3CCY A;  3ZQC A;  1XS9 A;  4C3I J;  5FJ8 J;  3S17 J;  2KDZ A;  3BG9 A;  1S7E A;  5K7F A;  1Z0X A;  4BY1 J;  3RQI A;  1ZGW A;  2LK2 A;  1IV6 A;  3HKZ N;  1DU0 A;  4V2G A;  5EZH A;  1WGX A;  3BR6 A;  3HEF A;  4I6Z A;  1U78 A;  2Y9Y A;  2R5Z B;  4XK4 A;  2HDD A;  1MH3 A;  1ETO A;  2HOA A;  4ABZ A;  3OSG A;  4GFB A;  3HB9 A;  3MKL A;  3DEW A;  2M9H A;  4DYC A;  1D5Y A;  4RBO A;  3LSP A;  2AO9 A;  2HQ5 A;  3TP3 A;  3HM5 A;  2YU9 J;  2GM4 A;  1ITY A;  5EYR A;  1LE8 A;  5FKK A;  4BY7 J;  3BTL A;  2VKV A;  4MFD A;  1T33 A;  1RR7 A;  2CUF A;  2DMT A;  2EZK A;  1I50 J;  2E1O A;  1AHD P;  2XB5 A;  2JA6 J;  3G1O A;  3ZOB A;  2N8G A;  5GPC A;  1X58 A;  1IUF A;  1JTY A;  1U9N A;  5GP9 A;  1W0T A;  4JX5 A;  1ETW A;  1UHS A;  2DJN A;  4B1R A;  1GVD A;  1ZK8 A;  9ANT A;  4J19 A;  4W1U A;  5F0H A;  2W48 A;  2FX0 A;  3JRH A;  2YS9 A;  5E3O A;  5EEA A;  2MSY A;  2JA5 J;  4IHW A;  1LFB A;  3BG5 A;  1MBF A;  2QCO A;  4MO7 A;  3GTL J;  1F36 A;  3JRI A;  2LP0 A;  3O8G A;  3LSG A;  1JUS A;  2VPR A;  4IEJ A;  1JUP A;  2XPV A;  3BR5 A;  2M8G X;  3A02 A;  2LVS A;  2ZB9 A;  3JR9 A;  3MN2 A;  1DU6 A;  1GUU A;  4BXX J;  4A93 J;  1Y1V J;  1QPI A;  4DZP A;  2K40 A;  2NS7 A;  5FKL A;  2L0K A;  1ETK A;  1XC5 A;  2XSD C;  2XPW A;  5FKN A;  4FE4 A;  4X1E A;  5M5W J;  1JJ6 C;  2E2H J;  4A3F J;  1FIP A;  1SAN A;  2XRL A;  3LSJ A;  2JJ7 A;  2O7O A;  3BR2 A;  5IYB J;  1IGN A;  1PUF A;  5F0F A;  1OCT C;  4D5F A;  3B6C A;  2DA7 A;  3QPL A;  4NDL A;  2G0E A;  4M3D A;  5J3L A;  4M3F A;  1POG A;  1WCM J;  2LD5 A;  2DMN A;  1VI0 A;  3S2H J;  2L9R A;  2KT0 A;  3DCF A;  5FKO A;  2NVY J;  3IV5 A;  3S14 J;  1H88 C;  1JJ8 C;  3Q3S A;  4MLO A;  2E2J J;  2LKX A;  2AHQ A; 
#chains in the Genus database with same CATH topology
 3LNQ A;  4ZYA A;  4PDK A;  1DGR M;  5B1B H;  2XGC A;  1BOB A;  1YW7 A;  3DEE A;  3WGI A;  2QQ8 A;  3HPG A;  5K7Z A;  3S3N A;  2OZU A;  4IHV A;  5E3M A;  5HDK A;  1ZTR A;  2ICW G;  3JRC A;  1EV7 A;  1UZC A;  4MTD A;  2P5L C;  3C7J A;  4A0X A;  3OYA A;  2OQR A;  1BI1 A;  2L3D A;  1A6Q A;  2EV5 A;  4ON0 A;  4B09 A;  4DW6 A;  3V8K A;  2XB0 X;  3HRU A;  4HSR A;  1W7P B;  2O8X A;  5FLM J;  2XSJ C;  1MMG A;  2M5W A;  4BJ5 C;  3VYR B;  1X1A A;  3JTG A;  1R9T J;  3K4N A;  3A1Y A;  2LDU A;  3ZMV A;  2EZI A;  5F1J A;  5K1Y A;  1MDM A;  3FBN B;  1PP8 F;  3OYL A;  4AID A;  2OQG A;  2Y30 A;  2KIF A;  3ECH A;  1UMQ A;  1AOY A;  4MIM A;  3AKZ A;  1MJ9 A;  5IP9 J;  3VYT B;  4YII A;  3DXJ F;  1O3R A;  4L9J A;  2O3F A;  2XAF A;  4BYY A;  1RZ4 A;  4XSX F;  3CO6 C;  1ZR2 A;  1S8N A;  2VI6 A;  2YR2 A;  3J80 Z;  3OYC A;  4B8X A;  4NQW A;  4IO9 F;  4EAT A;  3M1E A;  1UAA A;  5KK1 A;  2HOS A;  3S16 J;  3PQK A;  3NRV A;  2DTR A;  3GTJ J;  3I54 A;  4HF0 A;  4P55 A;  4I0B A;  3T8T A;  3A0H C;  2MD5 A;  4UY8 I;  1MIJ A;  2MD0 A;  4IL6 C;  1LDD A;  5L3D A;  5C4J J;  3S2D J;  3EUH A;  2P7C B;  3PSF A;  1ZH5 A;  4Q48 A;  2L54 A;  3OYB A;  2EB7 A;  2ZSH B;  1QPM A;  1K4S A;  2ESN A;  5EG0 A;  1FY7 A;  3I9V 2;  1LFP A;  2ELH A;  3GX4 X;  3VWB A;  2FNP A;  2KHM A;  1OFC X;  2BXY A;  3ESW B;  5E8G A;  2M0M A;  3WG7 H;  1XX5 A;  4YRV A;  3VB2 A;  1FJL A;  2WY7 Q;  1Y0U A;  2BW3 B;  1SFU A;  3VYU B;  2FRH A;  4CSW A;  2Y0S N;  3L9F A;  1KU7 A;  5BMZ A;  3LQQ A;  2HU9 A;  4BAY A;  4DBR A;  4XKW A;  2Y75 A;  1U2W A;  4J00 A;  4A3C J;  3ZN0 A;  4PUS A;  4F91 B;  4UV9 A;  1X4O A;  1FTZ A;  4IF4 A;  4M9X A;  2QQA A;  3NWS A;  5H20 A;  4XMY A;  2Q0O A;  2YUS A;  1ON1 A;  1IDZ A;  2HXO A;  2RC4 A;  2ZCW A;  4HX7 A;  4UUS B;  1RET A;  2ZXW H;  2DMP A;  4ASN A;  2DCE A;  5IOZ A;  1Z9C A;  5EEG A;  1OLT A;  4OIR F;  2ZJP F;  2X1C A;  2EQR A;  4IOA F;  4HRI A;  4A12 A;  4RM2 A;  4A3D J;  2R7Z J;  2E60 A;  3CO7 C;  1IF1 A;  4BBS J;  3LL7 A;  1BR2 A;  2QM3 A;  3FM5 A;  5HLH A;  4A3M J;  5FLX Z;  1H8A C;  2HFH A;  2EFQ A;  4IRH A;  1E17 A;  3D0S A;  1ZAO A;  4JP0 A;  2A68 F;  4UB6 C;  3QP5 A;  4Q5S F;  3A03 A;  2IS6 A;  1D1C A;  2JVG A;  1DP3 A;  5ILU A;  4XRS A;  2ZFW A;  1PUE E;  5IPA A;  2ZKZ A;  4XKB A;  1Y0N A;  2GZW A;  4LB6 B;  4ESF A;  2DYS H;  2AS5 F;  1X1B A;  2V79 A;  3COA C;  1EH7 A;  2EZH A;  2ZME A;  4Z2Y A;  2K3F A;  2PX9 A;  1U9O A;  1LKX A;  2VXD A;  4DOZ A;  3WTV C;  1ZAR A;  4A2U A;  1YG2 A;  1DPR A;  2JSC A;  4D7M A;  4D7N A;  2E34 A;  2KRF A;  2LNB A;  4ZYG A;  3S15 J;  5FGM A;  4EEF G;  3MZH A;  1QVT A;  5LBQ A;  1E3H A;  4OAZ A;  2D1H A;  1NH3 A;  2CQN A;  4JQF A;  1XCB A;  1R5H A;  3LST A;  3F72 A;  2ZJ2 A;  2P7V B;  2V7F A;  2EJR A;  2V9K A;  4B47 A;  3SHF A;  2FJ1 A;  1D8J A;  2VKE A;  3HUG A;  1MBJ A;  4FET A;  1L0O C;  1ETX A;  3HSE A;  3IHU A;  1WRJ A;  1FMW A;  1QVU A;  1T56 A;  4FQG A;  4CGZ A;  1QZY A;  3BDD A;  1VTN C;  1IJW C;  1OCC H;  3S1N J;  5E8I A;  2XAH A;  4X6A J;  3WG9 A;  5M5X J;  4XRM A;  3GTO J;  3J7Z I;  5B5E C;  5L3E A;  3I71 A;  2P8T A;  4OIO F;  4F7Z A;  1U5T A;  1B9M A;  2LF7 A;  1G3T A;  5GAE J;  4OIN F;  4A0Z A;  4CCO A;  2PN6 A;  3GFI A;  5EJC A;  3V7R A;  1MSF C;  1X19 A;  4IKF A;  5JHU A;  3D1N I;  3FBI B;  2CW7 A;  2UXX A;  4P96 A;  2KMU A;  3QP6 A;  2K3P A;  2EZL A;  3W2V A;  2B0L A;  3F8C A;  2VB6 A;  5HLI A;  4MEX F;  3H92 A;  3LSI A;  1IN8 A;  3I0T A;  1MDM B;  1QA6 A;  4XLH A;  3RYR A;  3AFH A;  2D2W A;  3FZV A;  4CA0 A;  2OCC H;  2PMU A;  2CGP A;  2IEK A;  4RA2 A;  3FXO A;  1Z21 A;  2O5R A;  3MD2 A;  2CUZ A;  4MHG A;  4IQJ A;  3W6V A;  1OKR A;  3HRT A;  2K9N A;  4XID A;  4HNV A;  1R58 A;  2IA0 A;  2K02 A;  3ISP A;  5D4R A;  1R7J A;  1D8K A;  2A69 F;  3BJA A;  4F93 B;  3G4S I;  1TNS A;  1WJB A;  2V1N A;  1WI3 A;  1Y8Q B;  4HZF A;  3E5U A;  4BE2 A;  2OD5 A;  1A6I A;  5IT3 A;  4OMY A;  3L2Q A;  2E36 A;  2FF4 A;  3G3Z A;  3H9Q A;  5GAG J;  3RZD J;  2O6G E;  1Z05 A;  2CUJ A;  3WGG A;  3ZQF A;  1WJE A;  5FD6 A;  4XOT A;  2BHY A;  1VND A;  4IHS A;  2V9P A;  3JRB A;  3KFW X;  1W4M A;  4HX8 A;  2RDP A;  5K5Q A;  3UNG C;  2R93 J;  1FC3 A;  2FSW A;  2WB1 A;  1JKP C;  2HZD A;  5TGT A;  1XGS A;  2JPB A;  2MW8 A;  3D5R C;  2DAO A;  3K1M A;  4JX6 A;  4XRF A;  4LIV A;  2CFO A;  4PJJ A;  1ZRC A;  2R7W A;  2K86 A;  1QQI A;  3GVA A;  5BNG A;  3T8R A;  4E6K G;  1TWA J;  2IS4 A;  3H36 A;  4AC0 A;  5EGO B;  1N75 A;  2QBY B;  3GZ5 A;  1WJD A;  1ZRD A;  1BBY A;  3DLA A;  3FXR A;  4A3G J;  4XRS G;  1B4A A;  2ZXJ A;  5DEQ A;  3PM1 A;  3A01 A;  2QF7 A;  5HS8 A;  3SDG A;  3FK6 A;  1SVL A;  4E70 A;  4N4O B;  3BTI A;  5J8C A;  1MBK A;  4BEH A;  3J80 K;  5JLX A;  3K69 A;  1R22 A;  4R1H A;  3PFY A;  3N4M A;  3QYB A;  3H5R A;  3QQA A;  5LGN A;  1T0F A;  3S32 A;  1RNL A;  3T1B A;  4V2F A;  4DNC A;  4QIW N;  1F9N A;  3OYH A;  2LFB A;  2DA1 A;  5FFZ A;  3I55 I;  3P7N A;  3FHN A;  3PO3 J;  1AA7 A;  2D1V A;  3B6A A;  5F27 A;  4BQQ A;  5LD2 C;  2L02 A;  4BEH B;  5E1W A;  3CJR B;  2Q8K A;  2X51 A;  3E3V A;  2DFI A;  4FHT A;  3VOE A;  4CO8 A;  4YIR X;  3S8P A;  2Q2E B;  2DBB A;  5EGO A;  2R3S A;  4DJA A;  1VQO I;  2VBX A;  3IL2 A;  3F3X A;  3ZP5 A;  4A5N A;  5BOX A;  3EYI A;  1RI7 A;  5F6F A;  2GOM A;  1YS7 A;  1FEX A;  2PMZ N;  3E7L A;  2XGX A;  3ZQC A;  2L9V A;  1XS9 A;  2MLK A;  5FJ8 J;  3B02 A;  1WHU A;  2KDZ A;  2CV1 A;  3GF2 A;  1IZ1 A;  1Y6I A;  1VQ5 I;  1IXS B;  1YLF A;  4BXF A;  3HKZ N;  1KU3 A;  1FYM A;  3CES A;  4I09 A;  1WGX A;  2Y9Y A;  4EJT A;  2HDD A;  3E6M A;  3KLN A;  4ABZ A;  5D5W B;  4MQV A;  1YX3 A;  1KGS A;  5FRO A;  2VXZ A;  3LSP A;  3D5S C;  4D9J A;  4HQM A;  2WC2 A;  4UNO A;  1UHM A;  5GTI C;  4G6Q A;  3X2Q H;  4I2O A;  3I5U A;  3OYG A;  2BY3 A;  4O3M A;  3GME A;  4HLY A;  4MFD A;  1SVM A;  1T33 A;  4U87 A;  1TW3 A;  4BNC A;  2VQG A;  5TRD A;  1WFX A;  2M3A A;  2VN2 A;  1AHD P;  1YS6 A;  2N8G A;  2X6W A;  1SAX A;  3KIO A;  1IUF A;  2CO5 A;  2V4J C;  2HQN A;  1X4P A;  2MAB A;  4W1U A;  3W3C A;  2OTL I;  2ISY A;  2FX0 A;  2FUG 2;  3JRH A;  2YS9 A;  1W5C C;  1R23 A;  5E3O A;  2FNA A;  3KZZ A;  2JA5 J;  2KDO A;  3BG5 A;  4ITV A;  3CC7 I;  1F36 A;  3LAJ A;  3R60 A;  1G3S A;  2X85 A;  3O8G A;  2P5V A;  4KIG A;  2G7H A;  3PUB A;  1TBX A;  4EJV A;  3BR5 A;  5LFA A;  3JR9 A;  1VQM I;  5JVT A;  2IRF G;  3DTK A;  4CZZ A;  4XLP F;  4EV0 A;  5CLS A;  3ABL H;  1S29 A;  2K40 A;  5ED4 A;  2H6C A;  1LUJ B;  1XSV A;  3CCQ I;  2NS7 A;  2W4S A;  2L0K A;  3D5L A;  1KU2 A;  4TV7 A;  2XPW A;  3H9J A;  4FE4 A;  4X1E A;  2MH9 A;  2B7E A;  1JJ6 C;  2E2H J;  2GQQ A;  4A3F J;  1FIP A;  3H3U A;  5LHH A;  2VE9 A;  2V1X A;  3BR2 A;  3RQ4 A;  1IRX A;  4BDZ A;  2BVM A;  1QZZ A;  1QNT A;  2IP2 A;  4NDL A;  3E6D A;  1LQ1 A;  3KP5 A;  1VI0 A;  1O7F A;  1R1U A;  3ECO A;  4QPO A;  3VFZ A;  3AAF A;  3ABU A;  1MJB A;  2Y69 H;  4N9H A;  4XN0 A;  3S14 J;  3FXL A;  3ERE D;  1H88 C;  1IN5 A;  1MND A;  2WAD A;  3ULQ B;  4E7Z A;  2X6O A;  3KP3 A;  1EA3 A;  1QGP A;  4RAG A;  4Y15 A;  1R49 A;  3ONQ A;  1O7L A;  1PP7 U;  3FIW A;  1HW5 A;  5HOO A;  2ELK A;  2R0Q C;  3MZ8 A;  4AYB A;  2LY1 A;  3RSN A;  1R71 A;  4FT8 A;  2TCT A;  3ZCO A;  4M9S A;  2Q1Z B;  1O57 A;  4YG2 F;  1FLI A;  3I4M J;  2DI3 A;  1OPC A;  5J40 A;  4IX7 A;  2NS8 A;  1ZLJ A;  1I3A A;  3S3O A;  3CJQ B;  2EIN H;  2EIL H;  2NOJ B;  1NK2 P;  2K9Q A;  3F23 A;  4RLF A;  2XVC A;  1DDN A;  2PBI A;  2XDV A;  2YPR A;  4MEY F;  4UV8 A;  3ROU A;  1BC8 C;  4QSH A;  3M7G A;  3HKZ A;  2DN0 A;  2RNJ A;  4LOC A;  3K70 C;  3FXK A;  1BR1 A;  2JWT A;  4AIH A;  1Y8R B;  1Z77 A;  5AON A;  3SZT A;  1X2M A;  4YEJ A;  4UVB A;  2QYO A;  3CP2 A;  3RJP A;  5DD8 A;  2HDW A;  3IH4 A;  1UST A;  2UXN A;  2DDB A;  2Z99 A;  4KIF A;  3ELK A;  4DYQ A;  3N05 A;  1S6L A;  3RI4 A;  1MMN A;  1YO5 C;  1QU3 A;  3OL4 A;  1YQA A;  1FWZ A;  2QWW A;  2WB1 N;  3IP4 B;  1LB2 A;  3E97 A;  3GLL A;  1ZN2 A;  3OV8 A;  1ZG3 A;  1IUY A;  5HLG A;  3F0C A;  4NC8 A;  2XC7 A;  3ZQI A;  3K1P A;  2IAI A;  4AU7 A;  4BE1 A;  4L18 B;  3CUO A;  3JSP A;  2R92 J;  4WX9 A;  1Z7U A;  1FZP B;  2R7X A;  4C3J J;  4B44 A;  1U5T C;  1DP7 P;  2Y48 A;  2E1M B;  1JKQ C;  2VL8 A;  1NK3 P;  1FOK A;  4KFC A;  2WA0 A;  2R7O A;  1JE8 A;  2L7K A;  3SYT A;  3HC7 A;  3O2P E;  4ESJ A;  5DDG A;  2PJR A;  2DO7 A;  1YIT I;  1IC8 A;  2X48 A;  4HAM A;  2W82 A;  4S0H B;  4AYB N;  3E0J B;  1OYI A;  1H0M A;  2JT1 A;  2ZME B;  3JRD A;  1VFC A;  3FXM A;  1UHW A;  3A4C A;  2XPU A;  1BL0 A;  1DGW Y;  3EUA A;  2EA2 A;  3W2W A;  2OPT A;  1SFX A;  2EIK H;  2LG4 A;  3QYE A;  3VSK A;  4A5M A;  5HVQ C;  2ZJR F;  1HCR A;  4B48 A;  2NVT J;  4E7L A;  2ME0 A;  2L5Q A;  4UUS A;  1Q1V A;  2CQK A;  3OOU A;  2GIV A;  4JBA A;  1TWH J;  4HDV A;  2EV0 A;  3IAM 2;  1T39 A;  4UUT A;  4LFU A;  1YRN B;  2IS1 A;  5E17 F;  1UCR A;  2X0L A;  2M7B A;  5ICC A;  1Z6T A;  3GO5 A;  3CLQ A;  4N0B A;  3LSR A;  4LGW A;  2M4G A;  3QPH A;  3AG1 H;  4ENJ A;  1TLH B;  2RQQ A;  2DK8 A;  3DTI A;  5J1U A;  3K4J A;  4B3A A;  1YJW I;  1W1W E;  4EM2 A;  5BS6 A;  5F64 A;  4DQ2 A;  2WBM A;  5L3C A;  1YRN A;  2KKO A;  4NQW B;  2P4W A;  3CZ6 A;  1OCR H;  1R1V A;  2VE8 A;  4IJA A;  3DBR B;  1EF4 A;  1LFU P;  4MGR A;  2RNG A;  3P5J A;  4R8H A;  5DCM B;  2DU9 A;  4U7B A;  2KRC A;  3TP0 A;  3ABT A;  2DK5 A;  3OWT A;  5M3F J;  2J5O A;  2BBY A;  3BG3 A;  1MZB A;  2VT2 A;  1G3W A;  3U9G A;  3PIO F;  2A6H F;  1XN7 A;  2K9M A;  3AG4 H;  3WOD F;  3I59 B;  4GO1 A;  1OCP A;  1LNW A;  3GTP J;  4I01 A;  3OY9 A;  3P9K A;  4KN4 X;  5J8F A;  2VKH A;  2IBD A;  2XAJ A;  4FCY A;  2BW3 A;  4EJO A;  4IHY A;  2A5W A;  2XUB A;  2VQC A;  3NAR A;  2ECB A;  1ZG5 A;  4CCM A;  3W6K B;  3JW4 A;  4M6V A;  3BP8 A;  3I59 A;  3R61 A;  1MW7 A;  1UG2 A;  2VBW A;  3GFM A;  3GTK J;  2CV0 A;  3DLL F;  4KA4 A;  1M1E B;  2DFE A;  3IRQ A;  5D5U B;  1MBG A;  3OYI A;  5F0C A;  4HPQ A;  2X1D A;  1ETQ A;  1XPX A;  2GA1 A;  3HTU A;  2WAQ A;  5IP6 A;  5CKT A;  4GRI A;  5C3E J;  5DUI A;  4DGW B;  1K4T A;  4KN7 X;  2R7D A;  4EJW A;  5CPR B;  1BC7 C;  3R0A A;  4IZZ A;  2DT5 A;  3TBI A;  3ZMS A;  4F3Q A;  1OR7 C;  2UZK A;  1TWF J;  4BKX A;  1HSJ A;  1I6X A;  4XSZ F;  1FOW A;  2LBF B;  2GA2 A;  2RRE A;  3OS0 A;  3HOS A;  2BE5 F;  1P7I A;  4PFO A;  3V4G A;  4BJ6 C;  3TQN A;  5EF6 A;  2CG4 A;  3TDU C;  3C2B A;  5DCF A;  4KDP A;  1Z6R A;  2M4K A;  4NBQ A;  3EPZ A;  4W97 A;  3C3W A;  1STZ A;  2L7F P;  2R7Q A;  3TW6 A;  3BQY A;  4II2 A;  4D1Q A;  1O4X A;  2EH3 A;  3EET A;  4IHT A;  2F2E A;  1VQ6 I;  3HL2 A;  1TL8 A;  2M7A A;  4IHX A;  5ILV A;  2LYC A;  1T8I A;  1CF7 A;  1T98 A;  4N4N B;  4WWC A;  4RS8 A;  3VYS B;  1UB9 A;  1BOA A;  2DA6 A;  4WF2 A;  1FP2 A;  4GCV A;  5ILS A;  3GYH X;  1ZGA A;  3CCM I;  2O61 A;  3P9C A;  1HLV A;  1BI3 A;  5HDG A;  4CYD A;  2B63 J;  2VC1 A;  4BHC A;  5L3B A;  3L00 A;  2IGM A;  1XGN A;  2CU7 A;  3F22 A;  1LVK A;  3M8J A;  1F4K A;  2TDX A;  3M9A A;  4NC7 A;  1B8I A;  1V54 H;  3C1D A;  2PJP A;  2M30 A;  3Q0W A;  5KCM A;  5FLV A;  1MSE C;  4XLA A;  2DA3 A;  3MVP A;  2LBF A;  1WKM A;  1Y1W J;  2JVH A;  2HVS A;  2HI3 A;  3LA2 A;  1R5I D;  2IGK A;  2W25 A;  4XLC A;  2VKD A;  2XAU A;  4C3H J;  3M1C A;  3WE2 A;  3KYC B;  1YFH A;  1HDD C;  5D8K B;  3LOC A;  3OYN A;  3HSF A;  3OYM A;  3WTS C;  1SFE A;  3PJR A;  4E7J A;  1IAW A;  4V19 K;  2FMY A;  3IC7 A;  3DKX A;  1YIO A;  1APL C;  4I02 A;  1X3U A;  3EYY A;  4LG0 B;  5BPD A;  4PJ0 C;  1WH5 A;  3KEQ A;  2STT A;  1ZHF A;  2GIZ A;  1VQL I;  2FBH A;  2DTZ A;  3CUQ A;  5LGU A;  5E1X A;  2ZXI A;  2BV6 A;  5LGT A;  3JCU C;  4A3I J;  3BT9 A;  1IRF A;  2H1L A;  4I99 C;  2JTV A;  2VC0 A;  2H8W A;  2JN6 A;  3C2G A;  2Y9Z A;  1G6N A;  2MG4 A;  3GW2 A;  1KQ9 A;  4DZJ A;  2E1N A;  3G2B A;  2K5C A;  2KJC A;  3HXL A;  4NNJ A;  4RLQ A;  4ANJ A;  1TW2 A;  4MTE A;  1BR4 A;  1WSU A;  4E7S A;  5KHD A;  3H5N A;  4H4K C;  4OMZ A;  4ZDP A;  3OIO A;  3I3L A;  2AQF A;  2ZFU A;  4LIT A;  1B9N A;  1J0R A;  3BY6 A;  2A5Y B;  2JQ7 A;  3HJE A;  2CJJ A;  2PEX A;  4CCN A;  4C30 A;  4P1W A;  1A5J A;  5EG0 B;  2XKP A;  4HW0 A;  1JKR C;  3OYF A;  4LG0 A;  2ZNY A;  3WGH A;  4RMN A;  1HOM A;  1I27 A;  4PSX A;  3BR1 A;  3FKI J;  3C2H A;  1G8X A;  4YIF A;  4FTH A;  5K7H A;  2VBZ A;  2COM A;  2MYS A;  5M3M J;  1WI9 A;  3HOT A;  4WK8 F;  3S17 J;  4UVC A;  1UEL B;  3BG9 A;  3OS1 A;  1FBQ A;  1S7E A;  1FPQ A;  3K2Z A;  4LB5 A;  2K85 A;  3S2W A;  4I98 B;  4CHU A;  1H9G A;  5HNF A;  5EZH A;  3BR6 A;  4I6Z A;  1U78 A;  1VQN I;  4KIC A;  3AG3 H;  1LDJ A;  1YJ9 I;  1J59 A;  3MKL A;  4DYC A;  4RBO A;  5BPI A;  4RB3 C;  1XSD A;  5A2Q K;  3F8F A;  2HQ5 A;  3LSK A;  2IA1 A;  2RVC A;  2VJJ A;  2GM4 A;  5FKK A;  3QYF A;  2KZV A;  2RV8 A;  1Y56 A;  2X6X A;  3BTL A;  2VKV A;  4QPQ A;  3OYK A;  1S72 I;  4XN3 A;  1REP C;  1A36 A;  1RR7 A;  1Q1H A;  4BGD A;  1BIA A;  5GPC A;  1X58 A;  4Q4Z F;  5E79 C;  2KIU A;  1W0T A;  4S05 A;  2VJI A;  1ETW A;  3G73 A;  3WTU C;  2BZT A;  4LIU A;  3OR1 C;  2DJN A;  4OIP F;  1ZK8 A;  3GZN B;  3GEZ A;  1TP4 A;  5GAH J;  1BM9 A;  3DFG A;  4O6J A;  5EEA A;  2MSY A;  5H6Q A;  2E1C A;  4XOR A;  1LFB A;  2QCO A;  3T5X A;  4IOC F;  2K9L A;  3R0J A;  5A2Q Z;  2RQP A;  2NYX A;  2ELJ A;  4KIB A;  5ICF A;  1T2K A;  3C18 A;  4IEJ A;  1JUP A;  2WTE A;  4AVP A;  3U1D A;  1U3E M;  2O03 A;  3A02 A;  4ZJZ A;  2E1M C;  2ZBK A;  2MA3 A;  1WJ5 A;  2MC3 A;  3GWZ A;  2IS2 A;  3MN2 A;  3P9I A;  4AD9 A;  4LK1 F;  1Y1V J;  1QPI A;  3MEX A;  3K4M A;  3Q9S A;  2F5V A;  3ERM A;  1RUN A;  3ZR8 X;  5KNL A;  2DDA A;  2W57 A;  4HX4 A;  2ZJQ F;  2GAU A;  4A0Y A;  3E6C C;  2R4G A;  1X1C A;  1XC5 A;  2QQ9 A;  4II3 A;  2FBK A;  3F8N A;  1EH6 A;  1T38 A;  5M5W J;  2GOX B;  3HIF A;  1OYY A;  5CVV A;  3V8L A;  3HPH A;  4ZTJ A;  1RUO A;  1SAN A;  2A3S A;  2XRL A;  3LSJ A;  5IYB J;  1HA8 A;  1OIS A;  3MZY A;  1PUF A;  3ZMZ A;  4O5V A;  1K6O A;  4D5F A;  1XTA A;  3B6C A;  2Z1D A;  2G0E A;  1POG A;  1WCM J;  2KQR A;  3ZXS A;  2ZO4 A;  2OAZ A;  2ZNZ A;  2QEN A;  4HG2 A;  2L9R A;  1YHQ I;  4QLC U;  2A05 A;  3DCF A;  2MLG A;  5FKO A;  2NAZ A;  2LMD A;  3LSH A;  1JJ8 C;  1O3Q A;  1HKQ A;  3KP7 A;  1ON2 A;  4EM0 B;  3OMY A;  1S3J A;  2E2J J;  2AHQ A;  2ZC2 A;  1U0J A;  1FOX A;  5EZG A;  1P92 A;  2NNN A;  5B3S H;  3JRF A;  4H0E A;  3Q0U A;  3HSR A;  2LY9 A;  3K9T A;  3DQV C;  2QGU A;  1ZKG A;  2PFB A;  4N9I A;  4Y17 A;  5J4Y A;  4CYC A;  2W24 A;  1TT0 A;  4JOM A;  3RYP A;  3G1M A;  1R6R A;  2ME6 A;  3OIP A;  4I76 A;  5DUK A;  4GYI A;  1TWG J;  4RAZ A;  2HPM A;  1DQU A;  2D5V A;  1X3W B;  2FBI A;  2PI0 A;  4M71 A;  1V4R A;  1EJ9 A;  3HOU J;  4B3X A;  3J7A Y;  2E7W A;  1LJ9 A;  3KZI C;  3S3M A;  3DU6 A;  1YTY A;  2EBI A;  3BG7 A;  5LEJ A;  1WVR A;  3DP7 A;  3Q5F A;  1JI8 A;  3F9K A;  3BPV A;  1KYW A;  3LWF A;  3FKJ A;  3BPX A;  1ONV A;  2BGC A;  4U0Y A;  4G6D A;  1V55 H;  4HF2 A;  2G7U A;  2CWE A;  2L9S A;  1ZG1 A;  2DLL A;  2GLO A;  2F4O B;  2W84 A;  3T0Y A;  1SC7 A;  1IXC A;  3CTA A;  3M8E A;  1OQY A;  4WXC A;  4BU2 A;  3OR2 C;  4XLF A;  4ZZL A;  2NNY A;  1USS A;  3FM3 A;  4Y7N J;  1I1S A;  4EGY A;  1MBE A;  1T6S A;  2QUF A;  3CD6 I;  2OC6 A;  4P9U A;  3WU0 A;  4KT6 A;  4AUX A;  5FKM A;  4G12 A;  2BXZ A;  4E7H A;  1TT5 B;  3Q9V A;  1IRZ A;  2H6B A;  3O6B B;  2Z3Y A;  4HQE A;  3I64 A;  1X2N A;  2WV1 A;  1FSE A;  3RPU D;  4QTR A;  2XHK A;  3ASN H;  3UR3 C;  1FTT A;  3RZO J;  4A69 C;  1ORK A;  2F5C A;  2OJE D;  4RGX A;  3ABM H;  4RAF A;  2CUE A;  3SEQ A;  1WPK A;  2QLZ A;  2V6C A;  2XF6 A;  3H3Z A;  3PL8 A;  4XBF A;  3VPR A;  4PJL A;  4ZDL A;  3ZMU A;  2Z9O A;  4NC6 A;  2DA5 A;  4MNU A;  4M73 A;  5K5R A;  2VJ4 A;  1K61 A;  2EA4 A;  2M34 A;  2V6E A;  3L2C A;  3LFK A;  1ZLK A;  3SQN A;  1HW2 A;  3HOZ J;  2BY2 A;  2ESH A;  1QHG A;  2ID6 A;  5LRR A;  3DEU A;  2HDC A;  1FP1 D;  4UVA A;  2A61 A;  1R00 A;  1LVA A;  1D0Z A;  3SDB A;  2IW5 A;  5B1A H;  4B4C A;  4EMS A;  3KEO A;  1ZEL A;  2M8E A;  1XG1 A;  1B72 B;  2FD5 A;  3DKW A;  2FXA A;  3RIR A;  2MGQ A;  3OOP A;  5FRN A;  4KIS A;  1BI0 A;  4CUG A;  3CP8 A;  3CDL A;  5E1Z B;  3VDX A;  2XIG A;  3PIP F;  1YIJ I;  6PAX A;  2BHZ A;  2VOO A;  2XAQ A;  3PUF A;  2FQ4 A;  3FMR A;  2QSG X;  1EH8 A;  5JHF A;  2QA4 I;  3CCR I;  3ZQ7 A;  1DPU A;  2VJ5 A;  4FX0 A;  1LEA A;  2IGN A;  4BQN A;  1PUF B;  3A2K A;  1Z67 A;  1K83 J;  2PQ8 A;  3HGY A;  2OF7 A;  4CH7 A;  2AXT C;  5HNH A;  2QVO A;  3DPL C;  1U8R A;  2NVX J;  2O8K A;  2BEO A;  3IAS 2;  4HYE A;  3SXY A;  3I58 A;  1JT6 A;  4PJM A;  4U0V A;  2LLK A;  1YJN I;  2JMW A;  2WAQ N;  3J7Y J;  2CRG A;  1BJZ A;  4ZH4 F;  2LKS A;  2HR3 A;  5C44 J;  3ML6 A;  1LEB A;  2GBY A;  3R4K A;  1J2X A;  1J5Y A;  4BJT A;  2XV4 S;  2L7M P;  4RB1 A;  3F8M A;  2R5Y B;  5FB2 A;  3DPU A;  4M74 A;  1F5T A;  1HXD A;  3M8F A;  4HF1 A;  1FOY A;  1T08 B;  3ASO H;  1TQI A;  1XDS A;  5DM6 F;  5B66 C;  4HDU A;  3K4L A;  3HOV J;  2V1D A;  2HOT A;  1I1G A;  1IXR C;  4KIT B;  2EFP A;  3H3V K;  3N97 A;  1JTX A;  1R5G A;  4A6D A;  1D0X A;  2KZG A;  3J81 Z;  3NAU A;  1UFM A;  2K4J A;  1ULY A;  2I8D A;  4XOP A;  3ZQL A;  2ISZ A;  1XCV A;  2HZT A;  5LRS A;  5D5X B;  4F55 A;  2Y31 A;  3K70 D;  4HBL A;  3U2R A;  4XL9 A;  3L2R A;  1CQT A;  3BLY A;  4XLE A;  3JAM Z;  3IH2 A;  3GXO A;  4E4H A;  1B1B A;  1ZRF A;  1VQ7 I;  1NG6 A;  4E7K A;  5C4X J;  3CDI A;  2JUG A;  3CQZ J;  5IP7 J;  2O0Y A;  3FMS A;  2BOL A;  2XAG A;  2DMQ A;  3WHC A;  2R7R A;  5CVJ A;  5IY5 H;  5D5V B;  3AL0 B;  3K4C A;  4BXU A;  1JT0 A;  1P9Q C;  1S9H A;  4LMY A;  4RB0 A;  2E19 A;  4WXH A;  2OU2 A;  3V8J A;  4EJU A;  1FSH A;  2K9S A;  3OS2 A;  3QWL A;  1ZR4 A;  4RGS A;  1G4D A;  4MFE A;  2HKX A;  1QO0 D;  3MMY B;  1SMT A;  4UXN A;  4KNY A;  4UHT A;  1JKO C;  4PK4 A;  3B73 A;  3OSF A;  1VZ0 A;  1JGG A;  2DOF A;  4A3E J;  3FK7 A;  2DOD A;  1F43 A;  2Z33 A;  1I5Z A;  1XSX A;  2PJR B;  3GUD A;  2KP6 A;  3BR0 A;  4G6T B;  4C2M J;  4FIS A;  2W7N A;  1IRG A;  5AIP A;  4U88 A;  4DBQ A;  1RKW A;  1GXP A;  1PJR A;  4U7D A;  1W5S A;  3FIS A;  1JHF A;  2TRT A;  4GDF A;  1RRJ A;  3RPU A;  5HOD A;  3BZ6 A;  2BY0 A;  2JK3 A;  2WWY A;  2UWM A;  2DT6 A;  4Y3O A;  4DYR A;  3O8H A;  3H35 A;  1G2H A;  2IVM A;  1W0U A;  1Z91 A;  2FML A;  3TDZ C;  5EDN A;  2HVR A;  1SAU A;  1XMA A;  3G71 I;  3EDP A;  2V26 A;  2DPD A;  5TIS C;  1XMK A;  4KT5 C;  3GZ6 A;  4BQA A;  3F6V A;  1UG0 A;  1QRY A;  2CSO A;  2VLA A;  3GTG J;  3HYI A;  2HXI A;  3LMM A;  1J09 A;  4C9Y A;  1A31 A;  2F4M B;  3BZC A;  5J6X A;  2KJB A;  2R7F A;  3FXU A;  1H9T A;  1WH7 A;  3K6G A;  1OMI A;  2C6Y A;  4XQF A;  3BCA A;  4OWR B;  3GTM J;  4HEA 2;  3HDD A;  4GXO A;  4LLN A;  3MWM A;  4L5I A;  3SZP A;  3J81 K;  1BI2 A;  4A6E A;  2F6C A;  2QKL B;  1RR8 C;  4RDU A;  4BHP A;  2M2E A;  3RDI A;  1BN5 A;  2NXN B;  3ZPL A;  1IN7 A;  4ENK A;  4XM3 A;  3HOY J;  3FDY A;  2X6Y A;  1NG7 A;  2GXA A;  3WTW C;  1YX5 A;  1GV5 A;  2H1K A;  1Z3X A;  4FE7 A;  2H8R A;  2ECC A;  3HBL A;  2LF8 A;  3KE2 A;  3HOX J;  4LJZ F;  3U1K A;  1E2X A;  2R7T A;  1AKH B;  4RB2 C;  4F92 B;  2BYV E;  1ETY A;  5DTD A;  4KYW A;  4M3B A;  2DPU A;  4X0G A;  2JPC A;  4OAY A;  1GVJ A;  1Z3Y A;  2PG4 A;  2DFF A;  2J5P A;  4HST A;  4ZDO A;  2QBY A;  3H0G J;  4G7H F;  1FIA A;  3PNY A;  3W6J B;  2OCE A;  3QOE A;  5LLQ A;  3PO2 J;  3RKX A;  1IO2 A;  4ETS A;  1D3Y A;  4KMU X;  2LOO A;  4RGU A;  3CCY A;  4RAY A;  3CDH A;  3VEP A;  3LAP A;  4M72 A;  1TQP A;  3DBL B;  3RCO A;  2W00 A;  3HZJ A;  4LG3 A;  5K7F A;  2LKP A;  1Z0X A;  4BY1 J;  3RQI A;  5K5O A;  2LK2 A;  4AWX B;  5L3G A;  1IV6 A;  1DU0 A;  1P4X A;  4V2G A;  4ZC3 A;  2GWR A;  1SEU A;  2R5Z B;  4XK4 A;  2X4H A;  4Z6Y A;  1ETO A;  4IVN A;  5LHG A;  4L0Y B;  3A0B C;  2WY8 Q;  4IRG A;  2ZSI B;  3HB9 A;  1R1T A;  4D0P A;  2QSF X;  5DCM A;  4PGH A;  3S93 A;  4ENM A;  2JRT A;  3EUH C;  2AO9 A;  3KCC A;  3TMO A;  3HM5 A;  4ZYH A;  3BG6 A;  2FA5 A;  3WTZ A;  1ITY A;  1LE8 A;  2F48 A;  2RN7 A;  4Y4R A;  5CVU A;  3TO9 A;  2L4A A;  1X3Z B;  2QQB A;  2I5U A;  3LSM A;  4PFP A;  2EZK A;  2CUF A;  1PVE A;  2OZ6 A;  1I50 J;  2JA2 A;  2CW0 F;  2JA6 J;  2A6T A;  3G1O A;  3QOP A;  3RTR A;  1JTY A;  1U9N A;  2OV7 A;  1K6Y A;  2XAS A;  5LHI A;  1W36 D;  1SD6 A;  2YU3 A;  2MH2 A;  4B1R A;  3HHH A;  4NHJ A;  3E5X A;  5F0H A;  4XR6 A;  4CDG A;  3CCE I;  3E5Q A;  4BE0 A;  5DD4 A;  3ZGK A;  1MBF A;  5KAI C;  1C0W A;  3GTL J;  3ZQQ A;  1FX7 A;  1WQ2 A;  4M6X A;  2HWV A;  3PQJ A;  2LC2 A;  3SEZ A;  2VPR A;  3V42 A;  2B9S A;  3CCU I;  1O3S A;  3SFZ A;  3ZMD A;  1U5T B;  2KPM A;  3GFJ A;  3DWL E;  2CQ7 A;  2PMZ A;  1DU6 A;  4XKV A;  4CIC A;  2M87 A;  2JZY A;  3TL4 X;  3LA7 A;  4BS9 A;  3HRM A;  1WJC A;  3VSL A;  1D5V A;  5FKL A;  3CC4 I;  2FOK A;  1OR7 A;  2Q2E A;  2JUC A;  1TZL A;  1HQC A;  1YE9 A;  2XSD C;  5JI6 A;  2JSP A;  4Y13 A;  3CMA I;  2IJL A;  5F0F A;  4RGR A;  3FF5 A;  3QU3 A;  3NWT A;  2DA7 A;  5L3F A;  5GTH C;  2LY2 A;  5J3L A;  4M3F A;  2WV0 A;  2LD5 A;  2DMN A;  3L2U A;  4ENN A;  2XF5 A;  4BQO A;  2L2O A;  2CV2 A;  3REO A;  3W2A A;  2VOD A;  2NVY J;  4HNT A;  2FU4 A;  2QZ8 A;  4WCG A;  2YX7 A;  1ZRE A;  3SZG A;  1SD4 A;  3Q3S A;  5FD5 A;  3ZRG A;  2LKX A;  2CQQ A;  1VQ4 I;  3GLX A;  3ZN1 A;  2CMP A;  2HYJ A;  3JTH A;  5IYC J;  4YFN F;  3IUO A;  1A04 A;  2XF7 A;  1XGM A;  3K1N A;  2WAF A;  3GCM A;  2G9W A;  2LRD A;  2VT3 A;  5BQT A;  1GV2 A;  1U8B A;  1N78 A;  2Y0S A;  1E0E A;  1VQP I;  1G3Y A;  2HVQ A;  1W36 C;  2KIS A;  2Y0M A;  2EFO A;  3CJN A;  1LDK B;  4JYK A;  3CCS I;  3MKW B;  1JGS A;  4HV6 A;  1OJL A;  3TED A;  2HKO A;  1SFO J;  2XGD A;  2LH9 A;  3U21 A;  3JRG A;  3BC8 A;  1MMD A;  2HYG D;  2YX4 A;  2DT7 B;  4DIQ A;  4RM3 A;  4BUP A;  3KLO A;  4AIK A;  5F04 A;  1MKM A;  4M3G A;  3TW7 A;  2DMU A;  2DQL A;  3BZK A;  4A3K J;  4M6Y A;  4G7Z F;  2JRM A;  1TWC J;  2EFN A;  1XD7 A;  5LEK A;  1VQK I;  3IWF A;  3KP6 A;  4PJN A;  1HW1 A;  3CF5 F;  3ZQG A;  1QBJ A;  4BL0 B;  3IKV A;  2M0C A;  1ACI A;  4PGG A;  1W7P A;  2DOE A;  4EM1 A;  4M3E A;  1WJF A;  3WHB A;  1OCZ H;  5CJ9 A;  2R7V A;  4CCJ A;  4KUM A;  2DOA A;  2DQR A;  1VF9 A;  5HLT A;  3QAH A;  1LPQ A;  2DA4 A;  3SJM A;  1MD0 A;  5CQE A;  2AQE A;  5FFX A;  4HNU A;  2L7Z A;  2UUZ A;  3WTX C;  3HUG B;  1VQ9 I;  5ICG A;  5CYV A;  3CMM A;  3K10 A;  3AL0 C;  2XRN A;  3CUQ B;  1IG7 A;  5IOY A;  5KAF C;  2VBY A;  2DXI A;  1KU9 A;  1OYW A;  3L1P A;  4XKC A;  1MMA A;  1KON A;  2RGV A;  3EUK L;  1ERD A;  5J1R A;  5D4S A;  2ID3 A;  2Y2Z A;  3BOQ A;  3DF8 A;  2HQA A;  3G1L A;  2W85 A;  4G9Y A;  3ZQH A;  3KYL A;  3ABK H;  2X9D A;  1JXS A;  1FBS A;  5ICE A;  2MC4 A;  2IXS A;  1NHA A;  3A01 B;  3K7A J;  5F08 A;  3V7S A;  2OTJ I;  4EQQ A;  2COB A;  3SFI A;  1F1Z A;  2OBP A;  2QSH X;  4IPA A;  3LFU A;  3OYE A;  3H0D A;  3NQO A;  1K79 A;  3S1M J;  2DA2 A;  2IPQ X;  5JFR A;  3I4N J;  4BBR J;  1HKT A;  1PYV A;  1BW5 A;  5CQG A;  4A3J J;  3HRS A;  1D1B A;  4YEL A;  3K4B A;  3Q0V A;  1V5E A;  3S1Q J;  3OYD A;  2W1O A;  4JX4 A;  2NOG A;  5GAD J;  2L9N A;  3RPQ A;  2ZXH A;  3F6O A;  1S7O A;  4KJZ A;  5J4V A;  3BR3 A;  3DTE A;  4AM3 A;  4CCL A;  4Y52 J;  4FX4 A;  4G8X A;  2NS0 A;  3L2W A;  3UKG A;  2HNH A;  4OIQ F;  1XGO A;  5DS9 A;  2STW A;  4L9N A;  2M1B A;  1T95 A;  3S1R J;  3MQ0 A;  2P6T A;  3BTJ A;  4XIC A;  4U0W A;  3IWZ A;  2EIJ H;  2F4I A;  3WU1 B;  2JA8 J;  2VQL A;  1I6H J;  1RPW A;  1S7A A;  3E6B A;  2MFZ A;  5E3L A;  2EK5 A;  4D5C A;  1GHC A;  5D6E A;  1QZE A;  3IH3 A;  4PCQ A;  4CCK A;  3QOD A;  2VOP A;  2KRH A;  3KPH A;  1HC8 A;  3M3Y J;  4LK0 F;  3JRE A;  3F21 A;  2F5F A;  2RAE A;  1V5F A;  4QWQ A;  2F5D A;  2R5Y A;  5E20 A;  1R4M B;  2VON A;  4UB8 C;  1SD5 A;  3GFL A;  3ZMT A;  2DJI A;  4ZTF A;  3CUQ C;  1SFK A;  1AU7 A;  4G7O F;  2LTP A;  2XRO A;  3BRO A;  2VUM J;  2I10 A;  1EKE A;  4BH9 A;  1HKS A;  2IT0 A;  3HOW J;  4BHB A;  5J1Y A;  1L3L A;  4YFK F;  2R5Z A;  1XMX A;  3H9G A;  1MNM C;  2K4B A;  1P7J A;  2KLO A;  4P9F A;  4ZYD A;  3LQR A;  1J9I A;  1D1A A;  2VQH A;  5JLW A;  3WU2 C;  1RC9 A;  2L01 A;  2Z16 A;  3TKY A;  4BDY A;  2QKM B;  3DKY A;  2HS5 A;  3QRF F;  5FLX K;  2HEO A;  3GBG A;  1ZGJ A;  1B59 A;  3TGN A;  4CYC B;  5ERI A;  3FXJ A;  3H1C A;  2D45 A;  4I7H A;  1FMV A;  1KYZ A;  1ODD A;  3L7W A;  4S04 A;  2EWN A;  4P5O A;  3IRR A;  2XKO A;  2E7X A;  2EIM H;  3BQZ A;  3FHZ A;  4C2T A;  4M9Z A;  1GDT A;  2P81 A;  1I3Q J;  1FNN A;  2WAE A;  2NVU B;  3PNT A;  4F52 A;  3RKQ A;  3KP4 A;  1DUX C;  3IKT A;  2P5K A;  5KVR A;  3TOA A;  4A3L J;  1KZH A;  1V3F A;  1AKH A;  3GTQ J;  3MKY B;  3JSO A;  1KQ0 A;  2H09 A;  3BJ6 A;  2O9L A;  3FWE A;  1MH4 A;  4HOB A;  1ETV A;  2K27 A;  2KFD A;  1SVO A;  4L0Z B;  1TC3 C;  2M45 A;  2R7U A;  5E3N A;  3PNV A;  4IQ4 A;  2VAS A;  1MBH A;  4IRI A;  1I39 A;  4FAS D;  1GT0 C;  3VOD A;  5GPA A;  5IT9 Z;  3CME I;  1RES A;  2HTS A;  2CW8 A;  4J01 A;  3L09 A;  2LRE A;  1H89 C;  2EFW A;  1ENH A;  1FBU A;  3PFI A;  2CQX A;  3OYJ A;  1T0F C;  3CF2 A;  2P6S A;  1IW7 F;  1P2F A;  1RKT A;  3WE3 A;  3CMY A;  3FXQ A;  3O3K A;  2OA4 A;  1RIO H;  2VPL A;  4PZJ A;  1E3O C;  3BJO A;  3K2A A;  3BWG A;  5JR3 A;  5D8L B;  3E1S A;  2E2I J;  1QHH D;  2BVL A;  2MBF A;  3DV8 A;  5DV5 A;  5FRM A;  3L2V A;  1X1D A;  1Z1D A;  2ACJ A;  2JA7 J;  5HDN A;  1GXQ A;  2ETH A;  1CF7 B;  1JUM A;  1ZQ3 P;  4BAC A;  2ZME C;  2H94 A;  1HBX G;  1TQM A;  2E5N A;  3KZY A;  2FOW A;  2HGC A;  1NTC A;  4L9T A;  1N25 A;  1P4W A;  1B8I B;  1BW6 A;  1JHH A;  3DBH B;  4G94 A;  3I53 A;  5H6R A;  3TO6 A;  3OIQ A;  4C2U A;  2FEZ A;  5E18 F;  2XGE A;  1YI2 I;  2HQR A;  2R7S A;  3QU6 A;  3TOB A;  3HTS B;  2LR8 A;  1B72 A;  2NVQ J;  1U6G A;  1WJA A;  4HA8 A;  3FX3 A;  4L5E A;  4Y33 A;  1P6R A;  2DFH A;  3BCB A;  2UV1 A;  5DM7 F;  4ZZD A;  4UUV A;  2FQ3 A;  1SD7 A;  3CJT B;  5D6F A;  3M4O J;  4MQ9 F;  3QPS A;  2V1U A;  5EEH A;  4ESB A;  1LE8 B;  1KA8 A;  3AG2 H;  1HDP A;  1UJ8 A;  5DYM A;  3HGG A;  3EQL F;  3MFK A;  4GYG A;  3OL3 A;  1IDY A;  3MKZ A;  1W7P D;  2KL4 A;  1AWC A;  5IYD J;  5CVR A;  1IN6 A;  2RKH A;  3BTC A;  3RKY A;  1BIB A;  2EV6 A;  1Y39 A;  2CFX A;  3JRA A;  1IN4 A;  2CH0 A;  3DPT A;  4B43 A;  1G59 A;  2GXB A;  3G6E I;  4A3B J;  4XNF A;  4R79 A;  2CYY A;  5AIQ A;  2V9V A;  5M5Y J;  1K78 B;  1ZYR F;  4K2E A;  5TJJ A;  1BA5 A;  3J7A O;  1HF0 A;  2A07 F;  1O3T A;  3WTY C;  1D0Y A;  1MGT A;  1YW9 A;  1J7K A;  2H27 A;  4C3I J;  2E71 A;  1MMS A;  5IT9 K;  1OCO H;  2P0W A;  5HS7 A;  3H5A A;  3NEU A;  1K78 A;  1WWX A;  1GLN A;  1ZGW A;  1N77 A;  1WZ2 A;  3HEF A;  1X1P A;  4EVI A;  1MJA A;  2DYR H;  1IV8 A;  3WTT C;  1MH3 A;  1MNE A;  2HOA A;  4YFX F;  3OSG A;  3TO7 A;  4IXA A;  4GFB A;  3CLO A;  1CGP A;  4CXF A;  3I56 I;  3DEW A;  3KEY A;  2AXL A;  2M9H A;  1D5Y A;  2E5Z A;  2HTJ A;  2KIM A;  2HPI A;  4ZYE A;  3TP3 A;  4CZC A;  2YU9 J;  2HYF A;  2IA2 A;  5EYR A;  4NB5 A;  4BY7 J;  3I4P A;  2ADU A;  4L9V A;  4HV5 A;  1V5G A;  1PDN C;  1BJA A;  4LLG F;  2LSO A;  2DMT A;  2CS3 A;  2E1O A;  3PSI A;  1TTY A;  2XB5 A;  3K0L A;  4PSW A;  4LLL A;  3ZOB A;  2PLY A;  1R4N B;  1VQ8 I;  5GP9 A;  4JX5 A;  4OOI A;  1J75 A;  2Z5U A;  1UHS A;  4JK1 X;  1GVD A;  1B6A A;  1FT9 A;  4WXD A;  9ANT A;  4J19 A;  2W48 A;  1HST A;  3MCZ A;  4I0A A;  1XB4 A;  4L5J A;  4E7I A;  4IHW A;  1W5T A;  4MO7 A;  3CC2 I;  2K7L A;  3RKW A;  2DW4 A;  3JRI A;  5J47 A;  1P4A A;  2LP0 A;  3LSG A;  3CCV I;  1JUS A;  3JAM K;  2XPV A;  1K7A A;  2M8G X;  2LVS A;  2ZB9 A;  1XDU A;  2X1E A;  1Z7L A;  2QEX I;  3KP2 A;  5CVI A;  1A35 A;  4KMF A;  3KX2 A;  1GUU A;  4BXX J;  4A93 J;  1FYL A;  3DU5 A;  1TNT A;  1FYK A;  4DZP A;  2L4M A;  1S5L C;  3R6S A;  2HOE A;  2KIQ A;  5HS9 A;  2OUM A;  2GXG A;  3V7C A;  4AVZ A;  2E35 A;  3HG9 A;  1R36 A;  1ETK A;  4NUB A;  3FMQ A;  3KYD B;  5FKN A;  5JVG F;  2A6E F;  3HHG A;  4XLN F;  3KET A;  1YYV A;  4XON A;  4AIJ A;  2JJ7 A;  2O7O A;  3CCJ I;  3CCL I;  1IGN A;  2NRA C;  2EPF A;  1KQ8 A;  2IGO A;  2PMH A;  2FE3 A;  3LA3 A;  4HLX A;  1OCT C;  3F8B A;  3QPL A;  5FO5 A;  4M3D A;  2YSR A;  3S2H J;  3QPT A;  4LD5 A;  4EGZ A;  1YOV B;  2KT0 A;  5H2F C;  2VIX A;  1SMY F;  4Q47 A;  3IV5 A;  1YW8 A;  4GGG A;  1E3P A;  2Z2S B;  3K4K A;  3MAJ A;  5F1R A;  4OU0 A;  4MLO A;  2F5E A;  2BY1 A;  3M07 A; 
#chains in the Genus database with same CATH homology
 3LNQ A;  5EZG A;  2CQQ A;  3JRF A;  2HYJ A;  3Q0U A;  2XGC A;  2LY9 A;  3FIW A;  2R0Q C;  2ELK A;  5IYC J;  1ZKG A;  5K7Z A;  2TCT A;  5E3M A;  4IHV A;  1ZTR A;  1U8B A;  1GV2 A;  4CYC A;  3JRC A;  3G1M A;  2ME6 A;  4I76 A;  3I4M J;  2D5V A;  1TWG J;  4DW6 A;  2NS8 A;  4JYK A;  2XB0 X;  3HOU J;  1OJL A;  3TED A;  5FLM J;  1SFO J;  2XGD A;  1NK2 P;  2K9Q A;  1R9T J;  3JRG A;  2EBI A;  2EZI A;  5F1J A;  4QSH A;  4LOC A;  2DN0 A;  2Y30 A;  1UMQ A;  4MIM A;  5IP9 J;  5F04 A;  4M3G A;  2JWT A;  3TW7 A;  1Z77 A;  1X2M A;  2DMU A;  4A3K J;  2GLO A;  1ZR2 A;  1TWC J;  2VI6 A;  3ZQG A;  3IH4 A;  2M0C A;  2HOS A;  4Y7N J;  3S16 J;  4M3E A;  3GTJ J;  3WHB A;  1MBE A;  4DYQ A;  1VF9 A;  2DA4 A;  3SJM A;  5C4J J;  3S2D J;  4AUX A;  5FKM A;  4G12 A;  2WB1 N;  1IRZ A;  2L7Z A;  1X2N A;  3F0C A;  2WV1 A;  4QTR A;  3ZQI A;  1FTT A;  3RZO J;  2IAI A;  1ORK A;  4A69 C;  1IG7 A;  5IOY A;  5EG0 A;  2CUE A;  3L1P A;  2R92 J;  1WPK A;  4C3J J;  1OFC X;  3VPR A;  1JKQ C;  1NK3 P;  5J1R A;  2DA5 A;  1FJL A;  1K61 A;  2ID3 A;  2Y2Z A;  2M34 A;  2Y0S N;  1IC8 A;  2X48 A;  4S0H B;  4AYB N;  3G1L A;  3HOZ J;  2ID6 A;  3ZQH A;  3JRD A;  2X9D A;  1VFC A;  4A3C J;  2XPU A;  1FTZ A;  4B4C A;  3A01 B;  3K7A J;  5F08 A;  1BL0 A;  2COB A;  2OPT A;  3SFI A;  1XG1 A;  1B72 B;  2FD5 A;  2YUS A;  2MGQ A;  1IDZ A;  2HXO A;  1HCR A;  2NVT J;  4UUS B;  2ME0 A;  1RET A;  4UUS A;  1Q1V A;  2DMP A;  5IOZ A;  3OOU A;  1TWH J;  3S1M J;  2DA2 A;  3I4N J;  4BBR J;  1BW5 A;  2EQR A;  3CDL A;  4UUT A;  4A3J J;  1YRN B;  2X6O A;  3Q0V A;  4A3D J;  2R7Z J;  3S1Q J;  4JX4 A;  4BBS J;  2NOG A;  3LSR A;  2FQ4 A;  4A3M J;  5J1U A;  1H8A C;  3BR3 A;  4B3A A;  4Y52 J;  1YRN A;  4JP0 A;  3UKG A;  1PUF B;  1K83 J;  3A03 A;  3HGY A;  5DS9 A;  2OF7 A;  1EF4 A;  4XRS A;  1LFU P;  3S1R J;  2NVX J;  2O8K A;  1JT6 A;  3BTJ A;  5IPA A;  3TP0 A;  4XIC A;  2LLK A;  2JMW A;  2WAQ N;  5M3F J;  2CRG A;  3BG3 A;  2JA8 J;  1I6H J;  1BJZ A;  1RPW A;  5E3L A;  4D5C A;  3IH3 A;  5C44 J;  2EZH A;  2GBY A;  1U9O A;  1OCP A;  3M3Y J;  3GTP J;  3JRE A;  2L7M P;  2RAE A;  2IBD A;  4FCY A;  2R5Y B;  2R5Y A;  4IHY A;  4D7M A;  4D7N A;  3NAR A;  2ECB A;  3S15 J;  1AU7 A;  2LTP A;  4EEF G;  4M6V A;  1QVT A;  3HOV J;  1UG2 A;  2HOT A;  2VUM J;  2I10 A;  3H3V K;  3GTK J;  3HOW J;  1JTX A;  5J1Y A;  3NAU A;  2R5Z A;  2FJ1 A;  1MNM C;  1MBG A;  2VKE A;  5F0C A;  3ZQL A;  1ETQ A;  1MBJ A;  1P7J A;  1ETX A;  2Y31 A;  5JLW A;  1QVU A;  1T56 A;  5IP6 A;  5C3E J;  1CQT A;  1IJW C;  3IH2 A;  3S1N J;  4X6A J;  5M5X J;  4XRM A;  3GBG A;  3GTO J;  5C4X J;  3CQZ J;  5IP7 J;  4CYC B;  1TWF J;  4BKX A;  2DMQ A;  3WHC A;  1P7I A;  5EF6 A;  3BQZ A;  1MSF C;  3D1N I;  1JT0 A;  1GDT A;  2P81 A;  1I3Q J;  3C2B A;  2E19 A;  2EZL A;  2K9S A;  1ZR4 A;  4W97 A;  3RKQ A;  4MFE A;  2L7F P;  3TW6 A;  4A3L J;  3BQY A;  1JKO C;  1O4X A;  1AKH A;  3OSF A;  2EH3 A;  2IEK A;  3GTQ J;  1JGG A;  2O9L A;  3W6V A;  4XID A;  2K9N A;  4IHX A;  4HNV A;  1MH4 A;  1ETV A;  4A3E J;  1TC3 C;  3FK7 A;  5E3N A;  2DA6 A;  1F43 A;  1MBH A;  3BR0 A;  4C2M J;  4FIS A;  1GT0 C;  5GPA A;  1WI3 A;  1RES A;  1RKW A;  1H89 C;  3FIS A;  2TRT A;  1A6I A;  1HLV A;  1ENH A;  5HOD A;  3RZD J;  2B63 J;  2CQX A;  3ZQF A;  2JK3 A;  2CU7 A;  1B8I A;  4DYR A;  3O8H A;  1RKT A;  3CMY A;  1VND A;  3Q0W A;  1G2H A;  5FLV A;  3JRB A;  1MSE C;  2DA3 A;  1W0U A;  5EDN A;  1E3O C;  3MVP A;  3K2A A;  1Y1W J;  2R93 J;  1JKP C;  2HI3 A;  2E2I J;  1QRY A;  4C3H J;  2MW8 A;  3GTG J;  2HXI A;  4JX6 A;  1HDD C;  2JA7 J;  3LOC A;  1JUM A;  1WH7 A;  1ZQ3 P;  5BNG A;  3GTM J;  1TWA J;  3HDD A;  1APL C;  1NTC A;  4AC0 A;  1B8I B;  5EGO B;  1BW6 A;  4A3G J;  1WH5 A;  4XRS G;  2DTZ A;  4RDU A;  2XGE A;  3PM1 A;  3A01 A;  2QF7 A;  2M2E A;  3SDG A;  2NVQ J;  3FK6 A;  4A3I J;  2LR8 A;  1B72 A;  3BT9 A;  4L5E A;  3BTI A;  3HOY J;  1MBK A;  5JLX A;  2JN6 A;  2Y9Z A;  1GV5 A;  2H1K A;  3QQA A;  2MG4 A;  4FE7 A;  2H8R A;  2ECC A;  3HBL A;  4V2F A;  4DZJ A;  4QIW N;  2LFB A;  2DA1 A;  3M4O J;  3HOX J;  3QPS A;  1LE8 B;  3PO3 J;  5F27 A;  3B6A A;  1AKH B;  1HDP A;  3OIO A;  3HGG A;  1ETY A;  5DTD A;  1IDY A;  4M3B A;  5IYD J;  2CJJ A;  3BTC A;  1A5J A;  5EG0 B;  1JKR C;  3JRA A;  4A3B J;  5EGO A;  3H0G J;  1FIA A;  5M5Y J;  1HOM A;  3PO2 J;  1BA5 A;  3BR1 A;  3FKI J;  1FEX A;  2PMZ N;  1HF0 A;  4FTH A;  3E7L A;  5K7H A;  5M3M J;  3CCY A;  3ZQC A;  1XS9 A;  4C3I J;  5FJ8 J;  3S17 J;  2KDZ A;  3BG9 A;  1S7E A;  5K7F A;  1Z0X A;  4BY1 J;  3RQI A;  1ZGW A;  2LK2 A;  1IV6 A;  3HKZ N;  1DU0 A;  4V2G A;  5EZH A;  1WGX A;  3BR6 A;  3HEF A;  4I6Z A;  1U78 A;  2Y9Y A;  2R5Z B;  4XK4 A;  2HDD A;  1MH3 A;  1ETO A;  2HOA A;  4ABZ A;  3OSG A;  4GFB A;  3HB9 A;  3MKL A;  3DEW A;  2M9H A;  4DYC A;  1D5Y A;  4RBO A;  3LSP A;  2AO9 A;  2HQ5 A;  3TP3 A;  3HM5 A;  2YU9 J;  2GM4 A;  1ITY A;  5EYR A;  1LE8 A;  5FKK A;  4BY7 J;  3BTL A;  2VKV A;  4MFD A;  1T33 A;  1RR7 A;  2CUF A;  2DMT A;  2EZK A;  1I50 J;  2E1O A;  1AHD P;  2XB5 A;  2JA6 J;  3G1O A;  3ZOB A;  2N8G A;  5GPC A;  1X58 A;  1IUF A;  1JTY A;  1U9N A;  5GP9 A;  1W0T A;  4JX5 A;  1ETW A;  1UHS A;  2DJN A;  4B1R A;  1GVD A;  1ZK8 A;  9ANT A;  4J19 A;  4W1U A;  5F0H A;  2W48 A;  2FX0 A;  3JRH A;  2YS9 A;  5E3O A;  5EEA A;  2MSY A;  2JA5 J;  4IHW A;  1LFB A;  3BG5 A;  1MBF A;  2QCO A;  4MO7 A;  3GTL J;  1F36 A;  3JRI A;  2LP0 A;  3O8G A;  3LSG A;  1JUS A;  2VPR A;  4IEJ A;  1JUP A;  2XPV A;  3BR5 A;  2M8G X;  3A02 A;  2LVS A;  2ZB9 A;  3JR9 A;  3MN2 A;  1DU6 A;  1GUU A;  4BXX J;  4A93 J;  1Y1V J;  1QPI A;  4DZP A;  2K40 A;  2NS7 A;  5FKL A;  2L0K A;  1ETK A;  1XC5 A;  2XSD C;  2XPW A;  5FKN A;  4FE4 A;  4X1E A;  5M5W J;  1JJ6 C;  2E2H J;  4A3F J;  1FIP A;  1SAN A;  2XRL A;  3LSJ A;  2JJ7 A;  2O7O A;  3BR2 A;  5IYB J;  1IGN A;  1PUF A;  5F0F A;  1OCT C;  4D5F A;  3B6C A;  2DA7 A;  3QPL A;  4NDL A;  2G0E A;  4M3D A;  5J3L A;  4M3F A;  1POG A;  1WCM J;  2LD5 A;  2DMN A;  1VI0 A;  3S2H J;  2L9R A;  2KT0 A;  3DCF A;  5FKO A;  2NVY J;  3IV5 A;  3S14 J;  1H88 C;  1JJ8 C;  3Q3S A;  4MLO A;  2E2J J;  2LKX A;  2AHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...