1IJWC

Testing the water-mediated hin recombinase dna recognition by systematic mutations.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*TP*AP*AP*GP*A)-3'
publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 13
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2001-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ijwC00
2DA3A 2VKVA 2R5YB 4IHWA 3I4NJ 5C3EJ 5J1RA 3SFIA 4X1EA 1XG1A 2HDDA 2R93J 1I6HJ 2XRLA 1I3QJ 1YRNB 2DMTA 2COBA 2R7ZJ 1SANA 3E7LA 4XRSG 1Y1VJ 1IC8A 1ZKGA 5BNGA 3OIOA 1F43A 3RKQA 2JJ7A 5EDNA 4XRMA 3HOYJ 3TP0A 3JRDA 2M34A 4XK4A 1K61A 1T56A 2EH3A 1VFCA 2NVYJ 2NOGA 1JKPC 1ITYA 1MNMC 3S2HJ 3G1LA 2OF7A 5C4JJ 1RR7A 3LSJA 2VUMJ 4L5EA 1MH3A 3S1MJ 1MBGA 1B8IA 4A93J 2NS8A 5K7ZA 2FJ1A 4C3JJ 2R92J 3BT9A 4BBRJ 4DZPA 1BA5A 3IH4A 1ZR4A 2E19A 3S17J 1FEXA 1TWAJ 1DU6A 3ZQLA 3M3YJ 9ANTA 1GT0C 3JRAA 1TWCJ 3LOCA 1RESA 4A3DJ 1JKRC 1MBJA 3HOZJ 2LFBA 2CRGA 1O4XA 1MSFC 5FKNA 2DJNA 1POGA 2L0KA 3CQZJ 3DCFA 2IAIA 2LTPA 3S2DJ 2Y9YA 1BW5A 4A3KJ 1WI3A 2L7FP 3QPSA 2M2EA 1U9NA 3MKLA 5J1UA 5E3NA 4CYCA 3HB9A 3HDDA 1VNDA 1D5YA 1ETKA 3BG3A 2K9NA 1Z77A 3K7AJ 5F27A 3FKIJ 5JLWA 4ABZA 3QPLA 3S1RJ 3C2BA 2LK2A 3CCYA 1OCPA 1JJ6C 2LKXA 2G0EA 1HOMA 3W6VA 4M3FA 2M8GX 2EZHA 2R5ZA 1UG2A 1JUMA 2E2HJ 3JRGA 2MW8A 1OJLA 1IRZA 4I6ZA 4A3MJ 2FQ4A 2GBYA 4JYKA 1W0UA 2HYJA 3S1NJ 3SDGA 5EZHA 2JA5J 1T33A 3ZQHA 2NVXJ 3BR6A 4C2MJ 4MIMA 1LE8A 1JTYA 3HM5A 3LSGA 1ORKA 1BW6A 3A01B 1QVUA 2KDZA 3BR0A 3IV5A 2CUFA 1ETWA 1IDYA 2O8KA 2DTZA 2YU9J 4AYBN 3JRFA 1WH7A 2NVQJ 1X2NA 1TWFJ 3PO2J 1GUUA 1A5JA 1U8BA 4GFBA 2ELKA 3CMYA 5K7HA 2E2JJ 1W0TA 2DA7A 1U78A 3BR1A 2Y2ZA 5FKOA 3HKZN 3H3VK 5E3MA 1IDZA 3JREA 3OSFA 3TW7A 5F0CA 2QF7A 4UUSA 3RZDJ 1TWGJ 1UHSA 1WPKA 4A3IJ 1P7JA 2CUEA 1MBFA 3ZQCA 5EGOB 2IBDA 5M3MJ 3BG9A 2Y0SN 2E2IJ 3BR2A 2ECCA 4BXXJ 4A3FJ 5IOZA 4RDUA 2VKEA 5F08A 4BY1J 1IUFA 4A69C 1QRYA 4J19A 1TWHJ 1WGXA 5E3OA 5IP7J 1FIAA 4HNVA 3MN2A 1ZQ3P 3I4MJ 1JKOC 1LFUP 2WV1A 4NDLA 3S1QJ 1MSEC 2H1KA 2DA6A 5EF6A 2DMPA 3S16J 1MBKA 5EG0A 1E3OC 2X48A 3TEDA 3Q0VA 1RKWA 1PUFA 1B72B 1X2MA 4QIWN 1XS9A 1NK2P 3LSPA 1CQTA 3G1OA 5F04A 3JRCA 3FIWA 3H0GJ 4A3JJ 1AKHB 2LY9A 1HDDC 2JA6J 1JUPA 3ZQFA 2ZB9A 2FD5A 5IYCJ 2L7MP 2JWTA 1RETA 5F1JA 3GTGJ 2WAQN 4QTRA 1OCTC 2GM4A 3PO3J 2IEKA 2ID3A 3RZOJ 5FKLA 1H89C 3BTJA 4FISA 2JA7J 1JT0A 2CU7A 2Y31A 1Y1WJ 5FJ8J 1GDTA 3JRHA 1ETOA 3VPRA 1NK3P 4S0HB 1ENHA 3BQZA 3ZQGA 5IPAA 4DYQA 1UMQA 4C3HJ 3BR5A 4DYCA 1JT6A 4Y52J 2CJJA 3OSGA 3HOVJ 1WH5A 5IP9J 3FK6A 3JRBA 3ZQIA 4A3BJ 4FCYA 1ZR2A 1IV6A 4UUTA 5DS9A 4A3LJ 1GV2A 3BR3A 1IJWC 1GVDA 4A3EJ 3MVPA 4D7MA 2CQXA 2HOTA 4B3AA 2WB1N 4BBSJ 4DZJA 3BG5A 2R5YA 1B8IB 5FLVA 3WHBA 2KT0A 4FTHA 1BJZA 3FISA 1JKQC 3BTCA 2ECBA 4BKXA 2E1OA 1MBEA 1X58A 5IYBJ 5M3FJ 1ZGWA 1YRNA 4QSHA 3S15J 4DW6A 3HGGA 1R9TJ 4JX6A 1NTCA 2HI3A 5DTDA 2K9SA 2W48A 4X6AJ 2XB5A 2JMWA 1ZTRA 4BY7J 3DEWA 3M4OJ 2M9HA 3JRIA 3HOWJ 2TRTA 4W97A 2CQQA 1GV5A 1ZK8A 2RAEA 5IOYA 2XSDC 2ID6A 1A6IA 2L7ZA 3FK7A 3CDLA 3Q0UA 2JK3A 4IHXA 1G2HA 3RQIA 4CYCB 1IG7A 3PM1A 3GTOJ 5EEAA 3UKGA 1QPIA 3A02A 2I10A 2XGEA 2FX0A 1HLVA 1FTTA 5GP9A 3G1MA 1APLC 2TCTA 5F0HA 2DMQA 2XPWA 2R5ZB 1EF4A 4D7NA 3WHCA 4IHVA 3ZOBA 2XGCA 5IYDJ 2XPUA 2DA5A 4FE4A 5FKMA 4M3EA 3HOXJ 5J3LA 3GTPJ 3OOUA 2R0QC 2NVTJ 2D5VA 4D5FA 4G12A 2Y30A 1LE8B 4XICA 2AHQA 4MLOA 4JX4A 2ME0A 1H8AC 3K2AA 4IHYA 1ETQA 4EEFG 2HXIA 4FE7A 1LFBA 1FTZA 4Y7NJ 3O8GA 2Y9ZA 2YS9A 3O8HA 1ETYA 2EBIA 5IP6A 5GPCA 5C44J 1HCRA 2M0CA 3HBLA 2JA8J 2VPRA 3HGYA 3LNQA 3IH2A 3Q3SA 5HODA 2QCOA 1IGNA 4M6VA 1QVTA 2GLOA 2VI6A 2L9RA 3B6AA 4M3BA 4UUSB 1JJ8C 1FJLA 5M5XJ 3F0CA 2XPVA 3TP3A 4C3IJ 3HOUJ 1OFCX 2O7OA 4MFEA 3A01A 2O9LA 3A03A 3BTLA 1F36A 4M3GA 5K7FA 3GTQJ 1RPWA 2HQ5A 1I50J 2LVSA 1DU0A 2X6OA 1U9OA 2K40A 3IH3A 2HXOA 2LLKA 2XB0X 5M5WJ 2B63J 4DYRA 3LSRA 4JP0A 3HEFA 3NAUA 5M5YJ 1VF9A 4AC0A 2EZIA 4W1UA 3GTMJ 4JX5A 1HDPA 2K9QA 2OPTA 5EZGA 2EZKA 2DN0A 2LP0A 3GBGA 1BL0A 4B1RA 5FLMJ 2DMNA 5EG0B 3BQYA 1K83J 3SJMA 1MBHA 1PUFB 4D5CA 5E3LA 5EGOA 4XRSA 3BTIA 5FKKA 2P81A 1Q1VA 1SFOJ 2MGQA 5EYRA 3QQAA 3TW6A 3D1NI 4MO7A 2YUSA 1H88C 4I76A 1TC3C 2EQRA 4XIDA 2LD5A 4IEJA 1WCMJ 4AUXA 2JN6A 3GTLJ 1Z0XA 3B6CA 4A3GJ 1VI0A 2MSYA 3JR9A 1ETVA 3NARA 2EZLA 2HOSA 2DMUA 1XC5A 4M3DA 4V2GA 2XGDA 5J1YA 1JUSA 1AU7A 1JTXA 2ME6A 5JLXA 4RBOA 1HF0A 2H8RA 3GTJJ 2PMZN 1P7IA 1B72A 4A3CJ 2HOAA 2MG4A 4LOCA 3GTKJ 2N8GA 1ETXA 1JGGA 2DA2A 4MFDA 1AKHA 2NS7A 4B4CA 1S7EA 3S14J 5GPAA 2DA4A 3L1PA 1FIPA 2X9DA 5C4XJ 2DA1A 4V2FA 1RKTA 1AHDP 1MH4A 2AO9A 2LR8A 3Q0WA 5F0FA
chains in the Genus database with same CATH superfamily
3ELKA 3ERMA 3IWZA 4IHWA 2UXXA 5J1RA 5C3EJ 1HW2A 3CP8A 1V5GA 2E34A 3P5JA 2L2OA 4CCLA 1XGOA 5ILSA 1ZKGA 2DU9A 2LH9A 1HW1A 1S8NA 1FBUA 1Z7UA 4NQWA 5L3DA 3G4SI 1ZH5A 3HOYJ 1VQ4I 2A5YB 2KZGA 2M34A 1K61A 5CVRA 1VFCA 4XLFA 5J4YA 2HZTA 2CWEA 3MZHA 3S2HJ 4BHBA 2CV0A 2NRAC 3G1LA 4YRVA 3DP7A 2FE3A 4G7ZF 1RR7A 4GCVA 3UNGC 1T8IA 3C18A 4BQOA 2K4JA 1MBGA 2WB1A 3TBIA 1B8IA 3R0JA 2Z33A 2DOAA 1BR2A 2R92J 2STTA 4YG2F 4RB1A 2L9VA 4ZJZA 4MGRA 2XKPA 1SVLA 1B59A 4DZPA 2LKPA 2PEXA 1CF7B 1KQ8A 3SEZA 1ZHFA 1TWCJ 3DF8A 4ZDOA 3D5SC 4A3DJ 2LFBA 1PYVA 3V7CA 3B73A 1VQ9I 4N4NB 2CRGA 4YFKF 5L3EA 3K6GA 2R7OA 1O4XA 3HOSA 3GYHX 2ZFUA 3DPUA 1OYIA 4HRIA 1G3SA 2KKOA 3CQZJ 1SFEA 1YOVB 2IA2A 2VIXA 3I56I 1H9TA 2A6HF 2F4OB 2IGOA 6PAXA 2R7SA 3EQLF 4OIOF 2DFFA 1ZGJA 1YFHA 2K02A 4BNCA 2MC4A 3CMEI 1U9NA 2VONA 3KEOA 4B47A 1R71A 4R79A 1MJAA 1MJ9A 4A6EA 4CXFA 1R7JA 2CO5A 3K7AJ 4YELA 5F27A 4PGHA 4ABZA 4WWCA 1J09A 2H6CA 3WGHA 3CCYA 2ACJA 4U0VA 2LKXA 3SZGA 4XMYA 4M3FA 4BJTA 3HL2A 3E6BA 5CVJA 1UG2A 2H09A 2E2HJ 3JRGA 2OTJI 2VQLA 5CLSA 1OJLA 1T98A 5DCMA 1W0UA 2HYJA 2XAJA 2VJ5A 2L4AA 3FBIB 1V5FA 4XQFA 1KU7A 3DKYA 1RI7A 2HKXA 2RGVA 4I2OA 3VFZA 5FB2A 4AVPA 3BR6A 2Q8KA 4C2MJ 1JTYA 3T8RA 4AU7A 2QGUA 2VC1A 1XMKA 4XONA 1JJ8C 3A01B 1BW6A 2HZDA 4CSWA 4XN3A 2VODA 3BR0A 5HVQC 4ENNA 5E1ZB 2O8KA 4Z6YA 2P6TA 3TQNA 5KVRA 4I0BA 1VQKI 1J5YA 5D5XB 4IRGA 1R4MB 2QSGX 2NVQJ 1X2NA 2XAHA 1GUUA 3OYDA 3NRVA 5KAFC 4BQAA 4UUVA 2EFWA 1W0TA 1TW3A 4KDPA 5F1RA 1U78A 5TISC 1UELB 3EUHA 1Z7LA 5E3MA 1W5CC 1SVMA 3K4CA 3TW7A 1LDJA 1TLHB 2O5RA 2QF7A 1YG2A 3TMOA 1P7JA 2CUEA 1MBFA 2UZKA 3ZQCA 5EGOB 4E7KA 1BIBA 1HBXG 2IBDA 5M3MJ 1BI0A 4O5VA 1FWZA 2QEXI 2QWWA 4BXXJ 1X19A 3OOPA 1DQUA 3F6OA 1RUOA 2FU4A 4RDUA 2HU9A 2Z99A 5HOOA 2DT6A 1QRYA 4G6DA 2NXNB 3T8TA 4ZTFA 3AAFA 4J19A 5E3OA 3D0SA 3CCEI 4HNVA 3CC7I 3ROUA 1R1TA 3FM5A 3D5RC 3ECOA 5HLTA 2IS1A 2WV1A 3L7WA 1MSEC 2DMPA 2XDVA 1OCOH 2X1EA 1MBKA 4IVNA 1FBSA 2BHYA 5EG0A 3MFKA 4ZDLA 3TO7A 3HPGA 1MMGA 3Q0VA 4WXDA 1PUFA 2E35A 2VT3A 1XSXA 3L2RA 4QIWN 1OLTA 4XRFA 4P96A 2KDOA 3H0GJ 3I9V2 1AKHB 1X4PA 3LSHA 3FDYA 2Z9OA 3KP2A 1ODDA 1Z3XA 1V54H 2CMPA 3GO5A 2JWTA 4RAYA 3CCJI 2W4SA 5LD2C 1RETA 2OCEA 2PJPA 2CSOA 1DPRA 2WAQN 3KP3A 3M7GA 2IEKA 4S05A 4LJZF 2FUG2 3CLQA 5FKLA 1NH3A 1H89C 1JT0A 1JGSA 2BW3A 1I1GA 2Y31A 3CCSI 5FJ8J 3BY6A 3FM3A 2YPRA 4S0HB 3CP2A 4I7HA 1WJEA 2V7FA 1ENHA 1QPMA 4A0XA 1VQLI 1UMQA 4LK0F 2XIGA 1OYYA 3QU6A 1HKQA 2Q1ZB 2VBYA 3HPHA 4LITA 3HOVJ 3PJRA 2E5NA 1MJBA 5CPRB 1UZCA 1ZR2A 1ERDA 4MHGA 1QQIA 1ZAOA 4KN4X 4CCKA 2E1CA 2JPBA 5LHHA 5D6FA 1LQ1A 2HVRA 1ON2A 3DEEA 3HC7A 1SEUA 4RM3A 2CQXA 3O3KA 3K4LA 2Q2EA 2HQAA 2KJBA 1U8RA 4R8HA 3ABLH 3WHBA 5L3BA 4FTHA 4PGGA 4CHUA 1Q1HA 4BKXA 1QZEA 3OWTA 4RLQA 3BOQA 2XV4S 1BJAA 1KYZA 3WTXC 5M3FJ 4B09A 1ZGWA 1YRNA 3K9TA 3CF2A 4DW6A 1MD0A 3S2WA 3CJNA 1FOWA 4MEXF 4JX6A 1NTCA 3E6CC 2RNGA 3FXRA 2FOWA 2R7FA 2HTSA 5GADJ 2QKLB 4UVBA 2M4GA 3LSTA 3LSMA 4I0AA 3KYDB 1HXDA 2RV8A 2V9VA 4HEA2 4M72A 2M7BA 4W97A 2EA2A 2DODA 3RJPA 1GV5A 1FC3A 4KICA 4LFUA 4D0PA 1TP4A 2X6WA 1D1CA 2ID6A 3EDPA 3L9FA 2L7ZA 4BU2A 2JK3A 1VQ8I 1BM9A 4EM1A 5IY5H 3DWLE 1IG7A 3CD6I 1IUYA 1X3UA 2LREA 4RB3C 2KRHA 3E1SA 3PM1A 2PMHA 1BR4A 3UKGA 2ETHA 3I55I 4DQ2A 4E7JA 1QPIA 1ZELA 2XGEA 1QO0D 2P4WA 2KIMA 1DUXC 1YJNI 1FTTA 3FKJA 3NEUA 3OYHA 2TCTA 4RA2A 2R5ZB 4D7NA 3WHCA 3GW2A 4Y17A 2L01A 2I5UA 2XAFA 1CGPA 3GTPJ 1U3EM 2DK8A 2X6XA 3OOUA 1YIJI 3BG6A 2O8XA 2VJJA 4OU0A 4UVAA 2QZ8A 2BGCA 4D5FA 4G12A 2EB7A 4LG3A 2EK5A 2Y30A 3PUBA 2DCEA 3IL2A 1H8AC 4JX4A 2ME0A 2BY0A 4Y3OA 3X2QH 3CDIA 4PJ0C 2ZJPF 4OOIA 4FE7A 1LFBA 1X4OA 2FXAA 2Y9ZA 3QOEA 2FNAA 2FOKA 2XSJC 4IKFA 5GPCA 1SAXA 4XKVA 3HGYA 1IV8A 2ZSIB 3F8CA 2LSOA 4HG2A 3GFJA 4F3QA 2P5LC 1YHQI 1I3AA 4NNJA 3OYCA 1SD4A 1OCZH 2GIZA 1Z67A 3I59A 4M6VA 4RB0A 1QVTA 3WGGA 3F22A 2VI6A 2OCCH 2M4KA 2R7UA 3GEZA 3WODF 3C1DA 3F23A 1D3YA 2BYVE 3KETA 3F8BA 2BXZA 1BI3A 2F2EA 1OFCX 4UXNA 2VE8A 1KA8A 3BTLA 2WTEA 1F36A 4M3GA 4HLXA 4P9FA 1U9OA 4BL0B 2CUJA 2DPUA 4N9IA 1FYLA 3H92A 1A35A 2K85A 2X4HA 3HRMA 2B63J 2FMLA 3ZMUA 4WCGA 1P4XA 2F5VA 4EM0B 1VF9A 2NVUB 4A0YA 2KMUA 4C2TA 4JX5A 2EFOA 2K9QA 3BROA 5EZGA 3FHZA 5HNFA 1BBYA 4B1RA 2K3PA 2DMNA 3IAM2 4HNTA 3BQYA 1K83J 2DI3A 3ABMH 4OIPF 1NG7A 1SMYF 5FFZA 4D5CA 1T0FA 1FMVA 1T2KA 3AG1H 5L3GA 1XSDA 3I53A 1G59A 3JTHA 1WJFA 3LA7A 3U1DA 3QQAA 1TT5B 2BY3A 2UV1A 4HDVA 4J01A 3DXJF 3OYJA 3CF5F 5CKTA 1WCMJ 1ZARA 5FFXA 2JN6A 1T38A 3D5LA 1YITI 5FD5A 3RYRA 1VI0A 5HS7A 1U6GA 2DW4A 3JR9A 1FP1D 3G71I 4BUPA 2GOXB 1XC5A 1MKMA 4FT8A 2K86A 2L9NA 3VDXA 5HLGA 1JUSA 2X6YA 2LNBA 3CUOA 4WK8F 3FXUA 1ZREA 3DKWA 2WADA 4CCOA 4A3CJ 2HOAA 2MG4A 4LOCA 4G6QA 3ZP5A 3GTKJ 1W36D 1JGGA 1Z05A 2KIUA 3OYGA 4II3A 4AWXB 4DGWB 1X1AA 2E36A 5DUKA 5K5QA 1IN8A 2XF6A 3JSPA 1XSVA 1S7EA 4NHJA 2LY1A 2AXTC 3S14J 1FSHA 3FMQA 2ZXIA 4I02A 4P9UA 5C4XJ 4ESFA 2DA1A 4HAMA 1RKTA 1ZG5A 1IN4A 1MH4A 3FXOA 1S9HA 4ZH4F 2WAQA 2KP6A 3Q0WA 2IRFG 4JOMA 3WG7H 3WTVC 3I4NJ 2DYRH 2MFZA 4XNFA 3H3ZA 1XG1A 2HDDA 2R93J 2X51A 3LSKA 1I3QJ 4ZYAA 1D1AA 2DMTA 2RQQA 3RPUA 2A07F 1SANA 3N05A 3E7LA 1R6RA 3TOAA 2HQNA 4DJAA 2MLGA 1FOKA 3LWFA 5JHFA 2XUBA 1UHMA 4Y4RA 3RKQA 3GZ5A 3SZPA 4XLPF 3JRDA 4XK4A 4LK1F 1T56A 2B9SA 3CZ6A 4G6TB 1JKPC 1MNMC 1M1EB 2EIMH 1XDSA 1Y56A 1D0ZA 2H27A 1B9MA 2JT1A 4A0ZA 2VUMJ 1MH3A 2AS5F 1O3TA 2GIVA 2NS8A 4LGWA 2R7RA 4C3JJ 4BQQA 1BOAA 1WSUA 3NQOA 2G9WA 1XX5A 4RGSA 3LAPA 4OIQF 3ZQQA 3S17J 2EFNA 2RQPA 3K0LA 1K7AA 2LY2A 3HYIA 3EPZA 2VL8A 3FWEA 4P5OA 3DBRB 4BHPA 2OC6A 4E7ZA 1XGNA 2KRFA 2FSWA 3I54A 2EV0A 1KGSA 2XF7A 2ZNYA 1RRJA 3B02A 2ZKZA 3PQKA 5DM7F 2GXAA 2IS2A 3R6SA 3ONQA 5BS6A 3IWFA 1EKEA 2IAIA 5E8IA 3S2DJ 3OY9A 1WWXA 2WAFA 5EEHA 3BJAA 2VKDA 1EH7A 1J7KA 5B1AH 2DXIA 3MZYA 2XKOA 1IN5A 3R60A 5J1UA 1NHAA 4CYCA 1VQ7I 4UB6C 4MTDA 3M1CA 4LIVA 2VOPA 2VN2A 5JLWA 1J59A 3H9JA 3QPLA 4KMFA 3A0BC 2MC3A 2O03A 1OCPA 3GUDA 3S3OA 1OCCH 5ERIA 4F7ZA 3CJQB 2DQLA 1HOMA 1YE9A 2EIJH 3W6VA 3CO7C 2M8GX 2OU2A 1FSEA 1OMIA 1JUMA 4GO1A 2KLOA 2LBFA 2FQ4A 2GBYA 4JYKA 1WQ2A 2DBBA 2F6CA 5LEKA 2BEOA 1SMTA 4EVIA 3HZJA 2JA5J 4L0YB 3RQ4A 1SD7A 2BE5F 2IA0A 2MBFA 2ZXHA 5D8LB 1LE8A 4L18B 2OA4A 2M0MA 1Y8QB 4KIFA 2KDZA 4HX8A 2VT2A 4X0GA 3DTKA 1ETWA 3W6JB 3HHGA 4M74A 4AYBN 3CUQA 1U2WA 1WH7A 3OYBA 4YIRX 5LFAA 1SD6A 1R58A 4GFBA 2K5CA 3CMYA 5K7HA 2DA7A 2G7UA 1YX5A 3BR1A 2C6YA 3BCAA 3ZMTA 5H6QA 3JREA 4BEHB 4FETA 5CJ9A 2CV1A 5F0CA 3RZDJ 1TWGJ 1RR8C 3K4BA 1UHSA 3Q9VA 3WGIA 3OYNA 2NNYA 3NWSA 1UHWA 3DTIA 5KK1A 5LRRA 2Y0SN 3K1PA 3VSKA 3BR2A 2ECCA 1TNSA 4EGYA 5D8KB 4A12A 4A3FJ 3ABUA 5IOZA 5LLQA 2V9KA 3T1BA 4BY1J 3RI4A 2MLKA 2R7TA 1EH8A 1R1VA 1DDNA 5FLXZ 4EM2A 1FIAA 5B3SH 1ZQ3P 2O0YA 2D1VA 3ABTA 1LFUP 4NDLA 2VXDA 3S1QJ 2DA6A 1IN6A 2OQRA 3OYKA 2ZJRF 2A6EF 2CFOA 1K6OA 3I5UA 3TEDA 1RKWA 2H8WA 1X2MA 3KLNA 5J40A 1CQTA 5TGTA 1GLNA 4BHCA 1YX3A 1R4NB 1XMXA 2L54A 3EUAA 1HDDC 3EYIA 3G73A 1JUPA 1E3PA 3KEQA 3DTEA 5ICFA 3FF5A 2HPMA 3HRTA 3S93A 1TW2A 5LBQA 3I64A 1RIOH 2L7MP 2J5PA 4LG0B 4CGZA 2ZMEB 4A2UA 5J4VA 1P9QC 2GM4A 1LDKB 3PO3J 1PP7U 2V1DA 2ID3A 1Z91A 4N0BA 1DP7P 3BTJA 4ETSA 4E7SA 1Y1WJ 1JXSA 4RGUA 4IXAA 4F52A 2E60A 3JRHA 3MKYB 5DDGA 1NK3P 1YQAA 3DQVC 5E17F 3HRUA 2OTLI 1ZG3A 4RAGA 3HHHA 3LL7A 4LIUA 2CJJA 3LFKA 1JHHA 1A6QA 1WH5A 2OBPA 4RMNA 4LLLA 4BYYA 5IP9J 4A3BJ 4D9JA 1U5TB 2BOLA 4FCYA 2WA0A 1XGSA 4UUTA 5ED4A 2Z1DA 2A5WA 2IP2A 1IJWC 2ELHA 1GVDA 4CZZA 3MVPA 4YFNF 4D7MA 3U9GA 2Z5UA 3A1YA 5AIPA 2HOTA 3J7AY 4KITB 2FNPA 2DPDA 4IO9F 1F9NA 4BBSJ 4NB5A 2ZNZA 3DU6A 2VJIA 4UHTA 4IL6C 3ZMZA 4DNCA 3GX4X 4AM3A 2E1NA 3DBHB 3V42A 3BDDA 2W24A 3K4MA 4TV7A 4IQJA 1WRJA 2JPCA 4M6YA 3CMAI 1MNEA 3ZXSA 4XORA 3S15J 1WJBA 1Y0NA 2MA3A 5IT3A 1E0EA 1Y6IA 1WVRA 2QUFA 3IAS2 5DTDA 4A5MA 3I71A 1L0OC 3M8FA 1YLFA 4X6AJ 2XB5A 2VLAA 5FLXK 1F1ZA 5BMZA 2HTJA 4BDYA 4BY7J 4IX7A 3DEWA 2VJ4A 1DP3A 3JRIA 2FA5A 2UXNA 1R5HA 2B0LA 2TRTA 1OR7C 2CW8A 1VQOI 4F93B 3DKXA 3G2BA 4S04A 1ZRFA 1YS6A 1ZK8A 2RAEA 2P7CB 3MWMA 5JFRA 5KNLA 2ZC2A 3KCCA 2KRCA 1K78B 1XDUA 3CDLA 3Q0UA 2Z2SB 4IHXA 1LNWA 4E7HA 1CF7A 3WTZA 2XROA 3PFYA 4QPQA 4ASNA 5EEAA 4ENKA 3CCLI 2FX0A 2GXGA 3QODA 3WU0A 2V1UA 4E6KG 2DT5A 4BS9A 3GWZA 1APLC 4BH9A 2DMQA 1EF4A 3KP4A 4ZTJA 2XGCA 1Z1DA 2DA5A 3FXKA 1Y39A 3PUFA 3HOXJ 4AIDA 2HDWA 2YSRA 4CZCA 2QBYB 3C3WA 1P4AA 4FHTA 5FO5A 4RAZA 2R0QC 1BI2A 2LOOA 4RGRA 1H0MA 2HVSA 2FEZA 2NVTJ 4HF0A 1F5TA 3WTWC 4XICA 2F4IA 2VQGA 4MLOA 3OIQA 5K5OA 3K2AA 3IC7A 5ICEA 2QLZA 2DFHA 1ETQA 4EEFG 5B5EC 5E1WA 2V1NA 1I1SA 1FTZA 4Y7NJ 1WKMA 4CUGA 3BP8A 1Z21A 1IXCA 3O8HA 4OAZA 2JA8J 3HBLA 1N77A 3J81Z 3SDBA 1VQNI 3LNQA 4KN7X 3IH2A 1KQ9A 3GVAA 3Q3SA 4MEYF 4O6JA 5HODA 2D45A 4XKBA 1IGNA 2Z16A 4XLHA 1JI8A 3QPHA 2L9RA 1F4KA 3V8LA 3OYEA 4UUSB 1ULYA 3PIOF 1FJLA 3TDZC 1PUEE 1T95A 3KLOA 3I58A 2CH0A 2L4MA 2W1OA 2FF4A 4OWRB 3A01A 3HOUJ 3VEPA 3A03A 2OJED 5K7FA 3HSFA 2PMUA 2COMA 2HQ5A 2VB6A 2UWMA 3MEXA 2DYSH 1J9IA 2HXOA 1H9GA 2ELJA 2ADUA 3L2WA 1FY7A 2DOEA 2XB0X 4AYBA 3K1MA 3E6MA 1WI9A 1SFUA 2YX4A 3FXMA 4CA0A 3F72A 5M5YJ 2PJRB 4XBFA 1YW9A 5L3FA 2EZIA 2V4JC 3GTMJ 3SQNA 2LP0A 2DN0A 3H5AA 1T08B 3GBGA 1G4DA 1MBHA 3HUGB 3RDIA 5E3LA 5IT9Z 5EGOA 2IVMA 1XTAA 2VQHA 4AIKA 2VASA 3BTIA 1OCRH 5FKKA 1Q1VA 5EYRA 1PVEA 3V8KA 5K1YA 2I8DA 2CG4A 5J8FA 2CUZA 2Y0SA 1Y0UA 2ZO4A 5E79C 2YUSA 3FHNA 5HDKA 1B9NA 1PP8F 2XAQA 1FP2A 4XIDA 4IEJA 4AUXA 2EA4A 3AL0B 3B6CA 4A3GJ 2MSYA 3I59B 3FXQA 2HOSA 4ON0A 3OR2C 2DMUA 2PQ8A 4PSXA 1OPCA 2XGDA 2OZUA 2AXLA 4U7DA 1USSA 2ME6A 4IOCF 1IO2A 5LGNA 2L02A 2QQAA 3GLXA 3BJ6A 1MMNA 3TO9A 2F48A 1P7IA 2GZWA 2ZBKA 3HG9A 2EWNA 4HX4A 2M1BA 2OD5A 2N8GA 1ETXA 2K9LA 2DA2A 3OS1A 2JRTA 4M9ZA 1AKHA 1IZ1A 2JUCA 4UV8A 5GAHJ 1KU2A 5L3CA 2NS7A 4B4CA 5D5UB 2PN6A 1VQMI 3J81K 3OYFA 1G3TA 4KIGA 4KIBA 2W25A 4UV9A 2X9DA 3NWTA 2E5ZA 2LKSA 1AHDP 4KMUX 2LR8A 1GHCA 5F0FA 3RIRA 3C2GA 2R5YB 4Y13A 2VC0A 4B44A 1DGWY 4FX0A 1V5EA 4PFPA 3CCVI 1O3QA 1R1UA 2KIFA 2XRLA 2ZMEC 3RSNA 3IKVA 1QBJA 1X3WB 2COBA 2P5KA 3EUHC 2R7ZJ 1XD7A 5CQEA 3K10A 1IC8A 4IPAA 1SAUA 2FBIA 4Q47A 5EDNA 2MABA 2VBWA 3TP0A 1MNDA 3AG2H 4QWQA 2NVYJ 2NOGA 5EEGA 4H0EA 2CQ7A 5C4JJ 2FQ3A 3KP7A 3F9KA 1HW5A 2XASA 2JRMA 4L5EA 3S1MJ 3R61A 4A93J 3KE2A 1U5TC 5FD6A 5K7ZA 3K70C 2FJ1A 3QYBA 5IT9K 1KU3A 1LKXA 3K2ZA 2HPIA 5B1BH 1BA5A 3QP5A 4G7HF 1ZR4A 1O3SA 2QA4I 2NNNA 3QOPA 2A69F 4CCNA 1KZHA 1FEXA 1TWAJ 3H9QA 1DU6A 3J7ZI 3JRAA 1ACIA 2K3FA 2IGKA 1MBJA 2ZJ2A 3ZN1A 1FZPB 1W7PB 3MKZA 5DEQA 1IRXA 5LEJA 3OYLA 4BAYA 3AKZA 3LA2A 1MIJA 5J47A 1OYWA 2DJNA 4ZYGA 2RREA 4HOBA 1R5GA 1U0JA 3DCFA 1P6RA 4WXCA 4OMZA 3RKXA 4A3KJ 1AOYA 2KFDA 1WI3A 2CW0F 2HDCA 1W1WE 2L7FP 2M7AA 2QQBA 3QPSA 3RKWA 5KCMA 4WF2A 4BE0A 3S3NA 4KNYA 1DPUA 3F21A 2XAGA 3HDDA 2FBKA 1D5YA 1ETKA 1MZBA 3VOEA 5ICCA 4EJOA 3KFWX 3C2BA 5D4RA 2H6BA 5H6RA 3LMMA 2QQ9A 2R5ZA 2MW8A 2HKOA 1Z3YA 4I6ZA 3KYLA 2QQ8A 4HDUA 5EJCA 3FXJA 2JA2A 4MQ9F 3LQRA 3W2AA 3WTSC 1YS7A 5EZHA 3BWGA 1T33A 2VXZA 3PFIA 2JZYA 3BC8A 2W84A 3E0JB 2PG4A 2BXYA 2W82A 3EUKL 4QPOA 3A4CA 3HM5A 2JSCA 5BPIA 1QVUA 4CDGA 4FASD 1SVOA 3OV8A 3IV5A 2A61A 3P9IA 3CCQI 1IDYA 1PJRA 3W2VA 1N78A 2K4BA 3C2HA 2LDUA 2OAZA 5TJJA 5DD8A 3DBLB 1TWFJ 1D0XA 4BE1A 4PDKA 1S29A 3BZ6A 4RAFA 4I99C 2E2JJ 3S3MA 4LB6B 5FKOA 3DPLC 5TRDA 3H3VK 3WG9A 3CCRI 1IDZA 3OSFA 4ENJA 2EILH 3W3CA 2NS0A 1ZG1A 3VYTB 1K4TA 3GLLA 1WPKA 4E7IA 4A3IJ 2GWRA 4Q4ZF 3COAC 3I3LA 1G3YA 4WXHA 4PJJA 1KU9A 3BG9A 2W00A 2E2IJ 4BJ5C 4ZYHA 3ASOH 3QPTA 3ABKH 3KP5A 4D1QA 2WY8Q 2VBXA 4I01A 3BZKA 1IUFA 5JVGF 4PSWA 1TWHJ 2HS5A 4E70A 2AQFA 5IP7J 1WZ2A 2LBFB 3O2PE 1WJDA 1LVAA 2HYFA 1IXRC 3DV8A 3I4MJ 1JKOC 2LC2A 2JVHA 2H1LA 5EF6A 1P2FA 5D6EA 2XC7A 5FRMA 3SXYA 4HQEA 3K1NA 1FT9A 2DFEA 2X48A 2JUGA 1B1BA 1B72B 4L9JA 1BC8C 4IF4A 1NK2P 4F92B 3G1OA 1W7PD 5F04A 3SZTA 2CV2A 2LY9A 2FMYA 2JA6J 2YR2A 1KQ0A 2MD0A 4G8XA 4IQ4A 4RLFA 1Z6TA 4XM3A 4ZYDA 4CH7A 3BCBA 3E97A 4EJWA 5LGTA 4B8XA 2EFQA 4NUBA 5IYCJ 4WX9A 3P7NA 3BLYA 5D5WB 4QTRA 3M1EA 3VODA 5J8CA 2JTVA 4HV6A 3RZOJ 1LUJB 2JA7J 4GYGA 2CU7A 4H4KC 4EQQA 2DTRA 4XLAA 3W2WA 1XCBA 2RN7A 2KZVA 1ETOA 2HR3A 3VPRA 3AL0C 3DEUA 3SHFA 2K27A 3ZQGA 5IPAA 3DPTA 3W6KB 4BXFA 2Q0OA 1XPXA 1UG0A 4JQFA 4C3HJ 2BZTA 2CW7A 3BR5A 4DYCA 3FXLA 3OSGA 2VQCA 3JRBA 1BI1A 3RPQA 3TOBA 4NQWB 5DS9A 3H35A 2ZSHB 2ISZA 2IPQX 1GV2A 3U1KA 3BR3A 5BPDA 4XL9A 2M3AA 4IJAA 2GA1A 4A3EJ 4DBQA 2A6TA 1V4RA 2CS3A 5DYMA 1ZLKA 1TQMA 4B3AA 2LYCA 1I6XA 3BG5A 4IHSA 4IZZA 2EINH 3ECHA 1B8IB 1BJZA 3FISA 3OS0A 2ZCWA 4PJLA 4LMYA 1ONVA 2L3DA 1JKQC 3HIFA 4IOAF 2EFPA 1S5LC 1X58A 5IYBJ 1MDMA 3AG3H 1ZRCA 2AQEA 3HGGA 3ZRGA 2KISA 1D1BA 4M71A 1YJ9I 3VSLA 5B66C 2D1HA 2W48A 1QHHD 1TT0A 3E5QA 1ZTRA 4XOPA 1K4SA 1LDDA 5GTIC 4P55A 3VWBA 3HOWJ 3CMMA 2E7XA 1LJ9A 1A36A 3MMYB 3A2KA 3TL4X 2R7VA 2JSPA 2F5CA 2KPMA 3H0DA 1R00A 3ISPA 1L3LA 1N75A 2MD5A 1A6IA 1SFKA 3OR1C 3JTGA 2Y0MA 3V7RA 1LEAA 1ZLJA 1FNNA 3GCMA 3GTOJ 2UUZA 3A02A 4YIIA 2I10A 2W57A 1UFMA 3GFIA 3BZCA 2VBZA 3AFHA 2XPWA 3P9KA 2ZJQF 4IHVA 2DO7A 5IYDJ 4KFCA 2XPUA 3N97A 4FE4A 1B4AA 3HSEA 5DCMB 5J3LA 2GA2A 2J5OA 2BY2A 3IP4B 4PFOA 1WFXA 1TL8A 1S72I 1VQPI 4BJ6C 1T6SA 2IGMA 4M6XA 3QAHA 1BIAA 1X1DA 3ULQB 4IHYA 3EETA 4HLYA 3DLAA 2HXIA 4KT6A 4ZZDA 4F91B 1HC8A 3GFMA 2YS9A 4QLCU 4BE2A 2A68F 5ILUA 1ETYA 3IUOA 5IP6A 5C44J 1HCRA 3BG7A 4LD5A 2VPRA 3QWLA 3PSIA 2O61A 2QCOA 4DBRA 3HTUA 5DUIA 2KQRA 1I39A 3C7JA 1TQIA 4NC7A 3SEQA 5FRNA 2FBHA 3B6AA 4KA4A 3KP6A 3VYRB 4HF1A 5M5XJ 2G7HA 3F0CA 3QU3A 1LPQA 3OYMA 3TP3A 3RCOA 2A3SA 1FLIA 1IF1A 2P0WA 1S3JA 1RUNA 4K2EA 3L2CA 1RPWA 1I50J 2LVSA 3WE3A 1DU0A 4L9TA 2GAUA 2BVLA 4N9HA 4OAYA 2K40A 5LHGA 3GZ6A 1YO5C 2QSHX 1MMSA 4I98B 3I4PA 4EJTA 4L5IA 5A2QZ 5ICGA 3Q9SA 4DYRA 3KPHA 4JP0A 3HEFA 3NAUA 1LB2A 1YI2I 4AC0A 4KT5C 3JAMZ 3Q5FA 2OPTA 2DAOA 4BEHA 5J6XA 5EG0B 2QSFX 1O7LA 4AD9A 4HBLA 1X1BA 3SJMA 2WBMA 3OL3A 4A5NA 1PUFB 4CO8A 3PNYA 3F3XA 4GRIA 2Y48A 3OYIA 4FQGA 1YYVA 2MGQA 3BPVA 4ZDPA 3TW6A 3V4GA 2FRHA 2ISYA 3S32A 4MO7A 3UR3C 1H88C 4I76A 2XVCA 2EQRA 1TQPA 4RM2A 3GTLJ 1VQ6I 2EJRA 3ERED 3NARA 2KIQA 3PSFA 1KYWA 4XLCA 2WV0A 4M3DA 4PZJA 2E1MB 4CICA 3DU5A 3R4KA 3KX2A 4ESJA 5J1YA 1AU7A 1IAWA 2BW3B 4XSXF 4NC8A 2H8RA 2PMZN 3KZIC 4GYIA 2X0LA 2BHZA 3V8JA 3KZZA 1JE8A 5HS8A 2F5EA 4MFDA 1IN7A 1J2XA 3H36A 2M5WA 1R23A 3FX3A 4EV0A 2HYGD 3L2VA 2Y69H 4LLNA 3BPXA 2DA4A 4Y15A 3L1PA 3HTSB 4ZC3A 1FIPA 1LEBA 4MTEA 4LG0A 3P9CA 2ZMEA 3ESWB 4PCQA 2Q2EB 4XLNF 2D2WA 4L9VA 2PBIA 1I27A 2DA3A 3QYEA 2VKVA 3M8JA 3U2RA 1O3RA 3TDUC 3CUQC 4XSZF 3SFIA 3FMRA 4X1EA 3SYTA 1HKSA 5HLHA 1I6HJ 1YJWI 2DT7B 3L09A 2LRDA 1YRNB 3KIOA 2P6SA 4HYEA 3IHUA 2F5DA 2EV5A 4XRSG 1ZGAA 4PK4A 1Y1VJ 1QZZA 5BNGA 1O7FA 3OIOA 1U5TA 1F43A 2JJ7A 3AG4H 4XRMA 3M8EA 5A2QK 2EH3A 1EJ9A 4E4HA 1ITYA 1HQCA 2IW5A 4GGGA 2OF7A 3JAMK 1B6AA 4C9YA 4B3XA 2KHMA 2CQNA 1IRGA 4U0WA 5H20A 4EGZA 4F55A 2DOFA 3HJEA 3LSJA 4BACA 1ZRDA 2K9MA 2LMDA 3ZN0A 3F8NA 1NG6A 2CGPA 3BT9A 4BBRJ 2GQQA 3K4NA 1FMWA 2TDXA 3IH4A 3LFUA 1OQYA 1S7OA 3LSIA 3MD2A 3CO6C 2HNHA 5HS9A 2E19A 2R7XA 5ILVA 4YEJA 3K70D 3CCUI 3ZQLA 3A0HC 3M3YJ 3OIPA 9ANTA 1GT0C 3LOCA 2ZFWA 1RESA 1C0WA 4LLGF 1JKRC 3WU1B 3HOZJ 1D5VA 3F8MA 1V55H 4CCMA 1WJ5A 1UB9A 4AIHA 1MSFC 5FKNA 1O57A 3CDHA 1TBXA 1G3WA 1K6YA 2L7KA 2M30A 2BVMA 4ZZLA 1POGA 2L0KA 5AIQA 3ZMDA 2LTPA 3IRQA 4XN0A 2Y9YA 1BW5A 1YW8A 3M9AA 3VYUB 1QU3A 2CFXA 1RNLA 4UB8C 3ML6A 2ICWG 3T0YA 2M2EA 1W5TA 1K78A 1X1CA 2R3SA 4LB5A 3MKLA 3WTUC 2QENA 2B7EA 4KJZA 5E3NA 3HB9A 1VNDA 1HKTA 3H1CA 3WTYC 3BG3A 4EJVA 2K9NA 1XMAA 1Z77A 1A04A 3FKIJ 1QHGA 1R49A 3S1RJ 2M87A 2LK2A 4EATA 2HFHA 1JJ6C 2G0EA 1P4WA 4PJMA 2EZHA 1Y8RB 3CC2I 1V3FA 1HA8A 2KL4A 1IRZA 4A3MJ 1R36A 4HSRA 3WTTC 2QBYA 3S1NJ 3SDGA 1X3ZB 5E8GA 1LVKA 3ZQHA 5CQGA 2Z3YA 4BXUA 2NVXJ 1FX7A 2GXBA 4MIMA 1GVJA 3JCUC 3LSGA 1ORKA 5E18F 4OIRF 3OS2A 3CC4I 2HWVA 1T39A 2ESNA 2CUFA 4M9XA 2ZXWH 4FX4A 1I5ZA 2DTZA 2YU9J 3JRFA 3GZNB 1IW7F 2YX7A 4XKCA 4AVZA 2BV6A 3E5UA 3PO2J 1A5JA 1U8BA 1EH6A 2ELKA 3O6BB 1SC7A 3HOTA 4ANJA 2CQKA 3KEYA 2Y2ZA 5LRSA 3HKZN 2M8EA 2KJCA 3PNVA 1A31A 1J75A 4UUSA 5D5VB 4HZFA 4E7LA 2L9SA 3ZPLA 2E71A 2BBYA 3VB2A 1G6NA 1D8JA 4I09A 2OV7A 4O3MA 2NOJB 4M9SA 4GDFA 4M73A 4G9YA 2VKEA 3L2QA 5F08A 5BQTA 3REOA 4A69C 5JHUA 5GAGJ 2PI0A 3IRRA 1WGXA 3SFZA 4IRIA 1LFPA 3MN2A 3QYFA 2PJRA 5K5RA 1TNTA 2PLYA 4B43A 1VZ0A 3KYCB 5H2FC 2H1KA 3S16J 3H5NA 1E3OC 2V9PA 3HSRA 2RVCA 3HUGA 3FMSA 3OYAA 1FOYA 1XS9A 2DJIA 1FYMA 3CCMI 3LSPA 3F8FA 3JRCA 4PJNA 3FIWA 4A3JJ 2JQ7A 5HDGA 3ZQFA 2R7DA 3S8PA 2LF7A 3ASNH 2ZB9A 5HNHA 3MAJA 1ZYRF 5JR3A 1K79A 2FD5A 4R1HA 5F1JA 3GTGJ 2EV6A 4HW0A 1OCTC 1N25A 3CESA 3LQQA 2W7NA 1WJCA 4Y33A 4FISA 4C2UA 1GXPA 1R5ID 1VTNC 1GDTA 1QNTA 2ESHA 4ZYEA 2OUMA 2QM3A 1MGTA 2IXSA 2HEOA 1S7AA 2EPFA 2PMZA 3MCZA 4DYQA 2W85A 1PDNC 4G7OF 1REPC 1VQ5I 4L0ZB 1JT6A 3PQJA 3GXOA 4Y52J 2ZXJA 2DK5A 2E1MC 3FK6A 1TZLA 3ZQIA 4HX7A 1IV6A 1XGMA 1Z6RA 4HPQA 4A3LJ 3E6DA 3HXLA 1UJ8A 1IXSB 3GMEA 5AONA 1BOBA 2IS6A 4IRHA 3WE2A 1RC9A 3G3ZA 2V6EA 4XR6A 3CLOA 5F64A 2WB1N 4G94A 2MYSA 4DZJA 3JSOA 5BOXA 1UCRA 2LG4A 3GF2A 5E20A 2X1DA 2R5YA 5FLVA 4JBAA 2KT0A 5FGMA 2F4MB 4RGXA 4BQNA 3JW4A 4ENMA 3ZR8X 2Y75A 2RNJA 4ESBA 3BTCA 4BDZA 2ECBA 3RKYA 2E1OA 1MBEA 3K4KA 4XKWA 5DM6F 3GFLA 2STWA 1D0YA 4QSHA 4UY8I 3HRSA 1EA3A 2WC2A 1R9TJ 2YU3A 2HI3A 1AWCA 2DFIA 4YFXF 2BY1A 1FPQA 2HVQA 2K9SA 4U7BA 5DV5A 2JMWA 1YTYA 4Q48A 4OMYA 4GXOA 3ZMSA 3M4OJ 2M9HA 4IHTA 5JVTA 1YIOA 4EJUA 5FROA 4EMSA 2MH2A 3R0AA 5GAEJ 2CQQA 2EIKH 2HQRA 2NAZA 3KZYA 5DCFA 2V1XA 5IOYA 1KONA 1X1PA 3MZ8A 5KHDA 2XSDC 2HOEA 2P8TA 1BN5A 2LF8A 4DIQA 2DLLA 2DDAA 3FK7A 2E7WA 3K69A 1HSTA 5F6FA 1G2HA 1OISA 3K4JA 3MQ0A 3RQIA 4CYCB 2VE9A 4DOZA 4YIFA 3J7AO 5CVUA 3M07A 1USTA 2VKHA 4C30A 3CJTB 3L00A 2X85A 3OL4A 1BR1A 1WJAA 4PUSA 1HLVA 1W7PA 3E3VA 3VYSB 1J0RA 5GP9A 3G1MA 3H9GA 5F0HA 2DDBA 2A05A 4A6DA 1JHFA 3J80Z 2NYXA 2GOMA 3ZOBA 2F5FA 5FKMA 4M3EA 2XGXA 3J7YJ 3H5RA 2XRNA 4U0YA 3V7SA 1ON1A 4L9NA 2D5VA 4U88A 2VOOA 2OQGA 3I0TA 1LE8B 4N4OB 3L2UA 4UVCA 2XHKA 2AHQA 4JK1X 1MDMB 5KAIC 3FZVA 2R7QA 2QKMB 1WHUA 4J00A 3O8GA 1BC7C 4MQVA 5CVVA 2EBIA 2M0CA 3CUQB 5CYVA 5E1XA 1E2XA 1MMDA 4HSTA 4ITVA 1E17A 1QZYA 1FBQA 5LHIA 1XN7A 2GLOA 2V26A 1QA6A 2R4GA 2K7LA 3FBNB 4HQMA 4M3BA 4NBQA 3ZCOA 3H3UA 3RPUD 5GTHC 1YW7A 1ZN2A 2M45A 2QVOA 1OKRA 3U21A 2V6CA 2XPVA 1HSJA 4C3IJ 3CJRB 2O7OA 4MFEA 2O9LA 2WAEA 3G6EI 3E5XA 4HF2A 2PFBA 1AA7A 5D4SA 3GTQJ 2X1CA 2X6OA 1IRFA 2R7WA 1XCVA 3IH3A 3PNTA 1DGRM 1P92A 1E3HA 2LLKA 5M5WJ 2VPLA 2QYOA 3LSRA 3MKWB 4W1UA 2IS4A 1TTYA 1HDPA 3F6VA 4MNUA 1UAAA 2EZKA 2H94A 4RB2C 3HKZA 4U87A 1BL0A 2IA1A 2HGCA 5FLMJ 4UNOA 2MH9A 2P7VB 2RC4A 2RKHA 3RYPA 1FYKA 3TKYA 4Z2YA 1MW7A 4L5JA 4XRSA 5DD4A 4KYWA 2P81A 3N4MA 1SFOJ 4AIJA 3QRFF 3D1NI 1SFXA 2L5QA 2WY7Q 3T5XA 3EYYA 4V19K 1OR7A 1TC3C 2LD5A 2OZ6A 4HNUA 1GXQA 2IGNA 1RZ4A 2XAUA 4OINF 3ZMVA 1Z0XA 3ZGKA 3ZQ7A 3J80K 4Q5SF 1ETVA 1T0FC 2P5VA 2JVGA 2EZLA 4II2A 4CCJA 1MMAA 1G8XA 2RDPA 4V2GA 4CYDA 3OMYA 3LAJA 1QGPA 3TGNA 4XLEA 1D8KA 1W4MA 1W36C 1JTXA 1EV7A 3LA3A 1XB4A 2IJLA 4XOTA 2WWYA 1STZA 1S6LA 2V79A 5JLXA 4RBOA 1HF0A 3RTRA 3BJOA 2DQRA 3GTJJ 1B72A 3TO6A 3DLLF 2XF5A 3DFGA 4HA8A 1Z9CA 4KUMA 5JI6A 3PIPF 3QP6A 3PL8A 4NC6A 3IKTA 5HLIA 1R22A 4HV5A 3CTAA 2CYYA 4B48A 5LGUA 5GPAA 3WU2C 4KISA 1FOXA 2IT0A 1W5SA 5HDNA 4RS8A 1SD5A 4P1WA 4BGDA 2O3FA 4V2FA 5CVIA 2O6GE 2AO9A 2PX9A 3BQZA
chains in the Genus database with same CATH topology
2DA3A 2VKVA 2R5YB 4IHWA 3I4NJ 5C3EJ 5J1RA 3SFIA 4X1EA 1XG1A 2HDDA 2R93J 1I6HJ 2XRLA 1I3QJ 1YRNB 2DMTA 2COBA 2R7ZJ 1SANA 3E7LA 4XRSG 1Y1VJ 1IC8A 1ZKGA 5BNGA 3OIOA 1F43A 3RKQA 2JJ7A 5EDNA 4XRMA 3HOYJ 3TP0A 3JRDA 2M34A 4XK4A 1K61A 1T56A 2EH3A 1VFCA 2NVYJ 2NOGA 1JKPC 1ITYA 1MNMC 3S2HJ 3G1LA 2OF7A 5C4JJ 1RR7A 3LSJA 2VUMJ 4L5EA 1MH3A 3S1MJ 1MBGA 1B8IA 4A93J 2NS8A 5K7ZA 2FJ1A 4C3JJ 2R92J 3BT9A 4BBRJ 4DZPA 1BA5A 3IH4A 1ZR4A 2E19A 3S17J 1FEXA 1TWAJ 1DU6A 3ZQLA 3M3YJ 9ANTA 1GT0C 3JRAA 1TWCJ 3LOCA 1RESA 4A3DJ 1JKRC 1MBJA 3HOZJ 2LFBA 2CRGA 1O4XA 1MSFC 5FKNA 2DJNA 1POGA 2L0KA 3CQZJ 3DCFA 2IAIA 2LTPA 3S2DJ 2Y9YA 1BW5A 4A3KJ 1WI3A 2L7FP 3QPSA 2M2EA 1U9NA 3MKLA 5J1UA 5E3NA 4CYCA 3HB9A 3HDDA 1VNDA 1D5YA 1ETKA 3BG3A 2K9NA 1Z77A 3K7AJ 5F27A 3FKIJ 5JLWA 4ABZA 3QPLA 3S1RJ 3C2BA 2LK2A 3CCYA 1OCPA 1JJ6C 2LKXA 2G0EA 1HOMA 3W6VA 4M3FA 2M8GX 2EZHA 2R5ZA 1UG2A 1JUMA 2E2HJ 3JRGA 2MW8A 1OJLA 1IRZA 4I6ZA 4A3MJ 2FQ4A 2GBYA 4JYKA 1W0UA 2HYJA 3S1NJ 3SDGA 5EZHA 2JA5J 1T33A 3ZQHA 2NVXJ 3BR6A 4C2MJ 4MIMA 1LE8A 1JTYA 3HM5A 3LSGA 1ORKA 1BW6A 3A01B 1QVUA 2KDZA 3BR0A 3IV5A 2CUFA 1ETWA 1IDYA 2O8KA 2DTZA 2YU9J 4AYBN 3JRFA 1WH7A 2NVQJ 1X2NA 1TWFJ 3PO2J 1GUUA 1A5JA 1U8BA 4GFBA 2ELKA 3CMYA 5K7HA 2E2JJ 1W0TA 2DA7A 1U78A 3BR1A 2Y2ZA 5FKOA 3HKZN 3H3VK 5E3MA 1IDZA 3JREA 3OSFA 3TW7A 5F0CA 2QF7A 4UUSA 3RZDJ 1TWGJ 1UHSA 1WPKA 4A3IJ 1P7JA 2CUEA 1MBFA 3ZQCA 5EGOB 2IBDA 5M3MJ 3BG9A 2Y0SN 2E2IJ 3BR2A 2ECCA 4BXXJ 4A3FJ 5IOZA 4RDUA 2VKEA 5F08A 4BY1J 1IUFA 4A69C 1QRYA 4J19A 1TWHJ 1WGXA 5E3OA 5IP7J 1FIAA 4HNVA 3MN2A 1ZQ3P 3I4MJ 1JKOC 1LFUP 2WV1A 4NDLA 3S1QJ 1MSEC 2H1KA 2DA6A 5EF6A 2DMPA 3S16J 1MBKA 5EG0A 1E3OC 2X48A 3TEDA 3Q0VA 1RKWA 1PUFA 1B72B 1X2MA 4QIWN 1XS9A 1NK2P 3LSPA 1CQTA 3G1OA 5F04A 3JRCA 3FIWA 3H0GJ 4A3JJ 1AKHB 2LY9A 1HDDC 2JA6J 1JUPA 3ZQFA 2ZB9A 2FD5A 5IYCJ 2L7MP 2JWTA 1RETA 5F1JA 3GTGJ 2WAQN 4QTRA 1OCTC 2GM4A 3PO3J 2IEKA 2ID3A 3RZOJ 5FKLA 1H89C 3BTJA 4FISA 2JA7J 1JT0A 2CU7A 2Y31A 1Y1WJ 5FJ8J 1GDTA 3JRHA 1ETOA 3VPRA 1NK3P 4S0HB 1ENHA 3BQZA 3ZQGA 5IPAA 4DYQA 1UMQA 4C3HJ 3BR5A 4DYCA 1JT6A 4Y52J 2CJJA 3OSGA 3HOVJ 1WH5A 5IP9J 3FK6A 3JRBA 3ZQIA 4A3BJ 4FCYA 1ZR2A 1IV6A 4UUTA 5DS9A 4A3LJ 1GV2A 3BR3A 1IJWC 1GVDA 4A3EJ 3MVPA 4D7MA 2CQXA 2HOTA 4B3AA 2WB1N 4BBSJ 4DZJA 3BG5A 2R5YA 1B8IB 5FLVA 3WHBA 2KT0A 4FTHA 1BJZA 3FISA 1JKQC 3BTCA 2ECBA 4BKXA 2E1OA 1MBEA 1X58A 5IYBJ 5M3FJ 1ZGWA 1YRNA 4QSHA 3S15J 4DW6A 3HGGA 1R9TJ 4JX6A 1NTCA 2HI3A 5DTDA 2K9SA 2W48A 4X6AJ 2XB5A 2JMWA 1ZTRA 4BY7J 3DEWA 3M4OJ 2M9HA 3JRIA 3HOWJ 2TRTA 4W97A 2CQQA 1GV5A 1ZK8A 2RAEA 5IOYA 2XSDC 2ID6A 1A6IA 2L7ZA 3FK7A 3CDLA 3Q0UA 2JK3A 4IHXA 1G2HA 3RQIA 4CYCB 1IG7A 3PM1A 3GTOJ 5EEAA 3UKGA 1QPIA 3A02A 2I10A 2XGEA 2FX0A 1HLVA 1FTTA 5GP9A 3G1MA 1APLC 2TCTA 5F0HA 2DMQA 2XPWA 2R5ZB 1EF4A 4D7NA 3WHCA 4IHVA 3ZOBA 2XGCA 5IYDJ 2XPUA 2DA5A 4FE4A 5FKMA 4M3EA 3HOXJ 5J3LA 3GTPJ 3OOUA 2R0QC 2NVTJ 2D5VA 4D5FA 4G12A 2Y30A 1LE8B 4XICA 2AHQA 4MLOA 4JX4A 2ME0A 1H8AC 3K2AA 4IHYA 1ETQA 4EEFG 2HXIA 4FE7A 1LFBA 1FTZA 4Y7NJ 3O8GA 2Y9ZA 2YS9A 3O8HA 1ETYA 2EBIA 5IP6A 5GPCA 5C44J 1HCRA 2M0CA 3HBLA 2JA8J 2VPRA 3HGYA 3LNQA 3IH2A 3Q3SA 5HODA 2QCOA 1IGNA 4M6VA 1QVTA 2GLOA 2VI6A 2L9RA 3B6AA 4M3BA 4UUSB 1JJ8C 1FJLA 5M5XJ 3F0CA 2XPVA 3TP3A 4C3IJ 3HOUJ 1OFCX 2O7OA 4MFEA 3A01A 2O9LA 3A03A 3BTLA 1F36A 4M3GA 5K7FA 3GTQJ 1RPWA 2HQ5A 1I50J 2LVSA 1DU0A 2X6OA 1U9OA 2K40A 3IH3A 2HXOA 2LLKA 2XB0X 5M5WJ 2B63J 4DYRA 3LSRA 4JP0A 3HEFA 3NAUA 5M5YJ 1VF9A 4AC0A 2EZIA 4W1UA 3GTMJ 4JX5A 1HDPA 2K9QA 2OPTA 5EZGA 2EZKA 2DN0A 2LP0A 3GBGA 1BL0A 4B1RA 5FLMJ 2DMNA 5EG0B 3BQYA 1K83J 3SJMA 1MBHA 1PUFB 4D5CA 5E3LA 5EGOA 4XRSA 3BTIA 5FKKA 2P81A 1Q1VA 1SFOJ 2MGQA 5EYRA 3QQAA 3TW6A 3D1NI 4MO7A 2YUSA 1H88C 4I76A 1TC3C 2EQRA 4XIDA 2LD5A 4IEJA 1WCMJ 4AUXA 2JN6A 3GTLJ 1Z0XA 3B6CA 4A3GJ 1VI0A 2MSYA 3JR9A 1ETVA 3NARA 2EZLA 2HOSA 2DMUA 1XC5A 4M3DA 4V2GA 2XGDA 5J1YA 1JUSA 1AU7A 1JTXA 2ME6A 5JLXA 4RBOA 1HF0A 2H8RA 3GTJJ 2PMZN 1P7IA 1B72A 4A3CJ 2HOAA 2MG4A 4LOCA 3GTKJ 2N8GA 1ETXA 1JGGA 2DA2A 4MFDA 1AKHA 2NS7A 4B4CA 1S7EA 3S14J 5GPAA 2DA4A 3L1PA 1FIPA 2X9DA 5C4XJ 2DA1A 4V2FA 1RKTA 1AHDP 1MH4A 2AO9A 2LR8A 3Q0WA 5F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA3 A;  2VKV A;  2R5Y B;  4IHW A;  3I4N J;  5C3E J;  5J1R A;  3SFI A;  4X1E A;  1XG1 A;  2HDD A;  2R93 J;  1I6H J;  2XRL A;  1I3Q J;  1YRN B;  2DMT A;  2COB A;  2R7Z J;  1SAN A;  3E7L A;  4XRS G;  1Y1V J;  1IC8 A;  1ZKG A;  5BNG A;  3OIO A;  1F43 A;  3RKQ A;  2JJ7 A;  5EDN A;  4XRM A;  3HOY J;  3TP0 A;  3JRD A;  2M34 A;  4XK4 A;  1K61 A;  1T56 A;  2EH3 A;  1VFC A;  2NVY J;  2NOG A;  1JKP C;  1ITY A;  1MNM C;  3S2H J;  3G1L A;  2OF7 A;  5C4J J;  1RR7 A;  3LSJ A;  2VUM J;  4L5E A;  1MH3 A;  3S1M J;  1MBG A;  1B8I A;  4A93 J;  2NS8 A;  5K7Z A;  2FJ1 A;  4C3J J;  2R92 J;  3BT9 A;  4BBR J;  4DZP A;  1BA5 A;  3IH4 A;  1ZR4 A;  2E19 A;  3S17 J;  1FEX A;  1TWA J;  1DU6 A;  3ZQL A;  3M3Y J;  9ANT A;  1GT0 C;  3JRA A;  1TWC J;  3LOC A;  1RES A;  4A3D J;  1JKR C;  1MBJ A;  3HOZ J;  2LFB A;  2CRG A;  1O4X A;  1MSF C;  5FKN A;  2DJN A;  1POG A;  2L0K A;  3CQZ J;  3DCF A;  2IAI A;  2LTP A;  3S2D J;  2Y9Y A;  1BW5 A;  4A3K J;  1WI3 A;  2L7F P;  3QPS A;  2M2E A;  1U9N A;  3MKL A;  5J1U A;  5E3N A;  4CYC A;  3HB9 A;  3HDD A;  1VND A;  1D5Y A;  1ETK A;  3BG3 A;  2K9N A;  1Z77 A;  3K7A J;  5F27 A;  3FKI J;  5JLW A;  4ABZ A;  3QPL A;  3S1R J;  3C2B A;  2LK2 A;  3CCY A;  1OCP A;  1JJ6 C;  2LKX A;  2G0E A;  1HOM A;  3W6V A;  4M3F A;  2M8G X;  2EZH A;  2R5Z A;  1UG2 A;  1JUM A;  2E2H J;  3JRG A;  2MW8 A;  1OJL A;  1IRZ A;  4I6Z A;  4A3M J;  2FQ4 A;  2GBY A;  4JYK A;  1W0U A;  2HYJ A;  3S1N J;  3SDG A;  5EZH A;  2JA5 J;  1T33 A;  3ZQH A;  2NVX J;  3BR6 A;  4C2M J;  4MIM A;  1LE8 A;  1JTY A;  3HM5 A;  3LSG A;  1ORK A;  1BW6 A;  3A01 B;  1QVU A;  2KDZ A;  3BR0 A;  3IV5 A;  2CUF A;  1ETW A;  1IDY A;  2O8K A;  2DTZ A;  2YU9 J;  4AYB N;  3JRF A;  1WH7 A;  2NVQ J;  1X2N A;  1TWF J;  3PO2 J;  1GUU A;  1A5J A;  1U8B A;  4GFB A;  2ELK A;  3CMY A;  5K7H A;  2E2J J;  1W0T A;  2DA7 A;  1U78 A;  3BR1 A;  2Y2Z A;  5FKO A;  3HKZ N;  3H3V K;  5E3M A;  1IDZ A;  3JRE A;  3OSF A;  3TW7 A;  5F0C A;  2QF7 A;  4UUS A;  3RZD J;  1TWG J;  1UHS A;  1WPK A;  4A3I J;  1P7J A;  2CUE A;  1MBF A;  3ZQC A;  5EGO B;  2IBD A;  5M3M J;  3BG9 A;  2Y0S N;  2E2I J;  3BR2 A;  2ECC A;  4BXX J;  4A3F J;  5IOZ A;  4RDU A;  2VKE A;  5F08 A;  4BY1 J;  1IUF A;  4A69 C;  1QRY A;  4J19 A;  1TWH J;  1WGX A;  5E3O A;  5IP7 J;  1FIA A;  4HNV A;  3MN2 A;  1ZQ3 P;  3I4M J;  1JKO C;  1LFU P;  2WV1 A;  4NDL A;  3S1Q J;  1MSE C;  2H1K A;  2DA6 A;  5EF6 A;  2DMP A;  3S16 J;  1MBK A;  5EG0 A;  1E3O C;  2X48 A;  3TED A;  3Q0V A;  1RKW A;  1PUF A;  1B72 B;  1X2M A;  4QIW N;  1XS9 A;  1NK2 P;  3LSP A;  1CQT A;  3G1O A;  5F04 A;  3JRC A;  3FIW A;  3H0G J;  4A3J J;  1AKH B;  2LY9 A;  1HDD C;  2JA6 J;  1JUP A;  3ZQF A;  2ZB9 A;  2FD5 A;  5IYC J;  2L7M P;  2JWT A;  1RET A;  5F1J A;  3GTG J;  2WAQ N;  4QTR A;  1OCT C;  2GM4 A;  3PO3 J;  2IEK A;  2ID3 A;  3RZO J;  5FKL A;  1H89 C;  3BTJ A;  4FIS A;  2JA7 J;  1JT0 A;  2CU7 A;  2Y31 A;  1Y1W J;  5FJ8 J;  1GDT A;  3JRH A;  1ETO A;  3VPR A;  1NK3 P;  4S0H B;  1ENH A;  3BQZ A;  3ZQG A;  5IPA A;  4DYQ A;  1UMQ A;  4C3H J;  3BR5 A;  4DYC A;  1JT6 A;  4Y52 J;  2CJJ A;  3OSG A;  3HOV J;  1WH5 A;  5IP9 J;  3FK6 A;  3JRB A;  3ZQI A;  4A3B J;  4FCY A;  1ZR2 A;  1IV6 A;  4UUT A;  5DS9 A;  4A3L J;  1GV2 A;  3BR3 A;  1IJW C;  1GVD A;  4A3E J;  3MVP A;  4D7M A;  2CQX A;  2HOT A;  4B3A A;  2WB1 N;  4BBS J;  4DZJ A;  3BG5 A;  2R5Y A;  1B8I B;  5FLV A;  3WHB A;  2KT0 A;  4FTH A;  1BJZ A;  3FIS A;  1JKQ C;  3BTC A;  2ECB A;  4BKX A;  2E1O A;  1MBE A;  1X58 A;  5IYB J;  5M3F J;  1ZGW A;  1YRN A;  4QSH A;  3S15 J;  4DW6 A;  3HGG A;  1R9T J;  4JX6 A;  1NTC A;  2HI3 A;  5DTD A;  2K9S A;  2W48 A;  4X6A J;  2XB5 A;  2JMW A;  1ZTR A;  4BY7 J;  3DEW A;  3M4O J;  2M9H A;  3JRI A;  3HOW J;  2TRT A;  4W97 A;  2CQQ A;  1GV5 A;  1ZK8 A;  2RAE A;  5IOY A;  2XSD C;  2ID6 A;  1A6I A;  2L7Z A;  3FK7 A;  3CDL A;  3Q0U A;  2JK3 A;  4IHX A;  1G2H A;  3RQI A;  4CYC B;  1IG7 A;  3PM1 A;  3GTO J;  5EEA A;  3UKG A;  1QPI A;  3A02 A;  2I10 A;  2XGE A;  2FX0 A;  1HLV A;  1FTT A;  5GP9 A;  3G1M A;  1APL C;  2TCT A;  5F0H A;  2DMQ A;  2XPW A;  2R5Z B;  1EF4 A;  4D7N A;  3WHC A;  4IHV A;  3ZOB A;  2XGC A;  5IYD J;  2XPU A;  2DA5 A;  4FE4 A;  5FKM A;  4M3E A;  3HOX J;  5J3L A;  3GTP J;  3OOU A;  2R0Q C;  2NVT J;  2D5V A;  4D5F A;  4G12 A;  2Y30 A;  1LE8 B;  4XIC A;  2AHQ A;  4MLO A;  4JX4 A;  2ME0 A;  1H8A C;  3K2A A;  4IHY A;  1ETQ A;  4EEF G;  2HXI A;  4FE7 A;  1LFB A;  1FTZ A;  4Y7N J;  3O8G A;  2Y9Z A;  2YS9 A;  3O8H A;  1ETY A;  2EBI A;  5IP6 A;  5GPC A;  5C44 J;  1HCR A;  2M0C A;  3HBL A;  2JA8 J;  2VPR A;  3HGY A;  3LNQ A;  3IH2 A;  3Q3S A;  5HOD A;  2QCO A;  1IGN A;  4M6V A;  1QVT A;  2GLO A;  2VI6 A;  2L9R A;  3B6A A;  4M3B A;  4UUS B;  1JJ8 C;  1FJL A;  5M5X J;  3F0C A;  2XPV A;  3TP3 A;  4C3I J;  3HOU J;  1OFC X;  2O7O A;  4MFE A;  3A01 A;  2O9L A;  3A03 A;  3BTL A;  1F36 A;  4M3G A;  5K7F A;  3GTQ J;  1RPW A;  2HQ5 A;  1I50 J;  2LVS A;  1DU0 A;  2X6O A;  1U9O A;  2K40 A;  3IH3 A;  2HXO A;  2LLK A;  2XB0 X;  5M5W J;  2B63 J;  4DYR A;  3LSR A;  4JP0 A;  3HEF A;  3NAU A;  5M5Y J;  1VF9 A;  4AC0 A;  2EZI A;  4W1U A;  3GTM J;  4JX5 A;  1HDP A;  2K9Q A;  2OPT A;  5EZG A;  2EZK A;  2DN0 A;  2LP0 A;  3GBG A;  1BL0 A;  4B1R A;  5FLM J;  2DMN A;  5EG0 B;  3BQY A;  1K83 J;  3SJM A;  1MBH A;  1PUF B;  4D5C A;  5E3L A;  5EGO A;  4XRS A;  3BTI A;  5FKK A;  2P81 A;  1Q1V A;  1SFO J;  2MGQ A;  5EYR A;  3QQA A;  3TW6 A;  3D1N I;  4MO7 A;  2YUS A;  1H88 C;  4I76 A;  1TC3 C;  2EQR A;  4XID A;  2LD5 A;  4IEJ A;  1WCM J;  4AUX A;  2JN6 A;  3GTL J;  1Z0X A;  3B6C A;  4A3G J;  1VI0 A;  2MSY A;  3JR9 A;  1ETV A;  3NAR A;  2EZL A;  2HOS A;  2DMU A;  1XC5 A;  4M3D A;  4V2G A;  2XGD A;  5J1Y A;  1JUS A;  1AU7 A;  1JTX A;  2ME6 A;  5JLX A;  4RBO A;  1HF0 A;  2H8R A;  3GTJ J;  2PMZ N;  1P7I A;  1B72 A;  4A3C J;  2HOA A;  2MG4 A;  4LOC A;  3GTK J;  2N8G A;  1ETX A;  1JGG A;  2DA2 A;  4MFD A;  1AKH A;  2NS7 A;  4B4C A;  1S7E A;  3S14 J;  5GPA A;  2DA4 A;  3L1P A;  1FIP A;  2X9D A;  5C4X J;  2DA1 A;  4V2F A;  1RKT A;  1AHD P;  1MH4 A;  2AO9 A;  2LR8 A;  3Q0W A;  5F0F A; 
#chains in the Genus database with same CATH topology
 3ELK A;  3ERM A;  3IWZ A;  4IHW A;  2UXX A;  5J1R A;  5C3E J;  1HW2 A;  3CP8 A;  1V5G A;  2E34 A;  3P5J A;  2L2O A;  4CCL A;  1XGO A;  5ILS A;  1ZKG A;  2DU9 A;  2LH9 A;  1HW1 A;  1S8N A;  1FBU A;  1Z7U A;  4NQW A;  5L3D A;  3G4S I;  1ZH5 A;  3HOY J;  1VQ4 I;  2A5Y B;  2KZG A;  2M34 A;  1K61 A;  5CVR A;  1VFC A;  4XLF A;  5J4Y A;  2HZT A;  2CWE A;  3MZH A;  3S2H J;  4BHB A;  2CV0 A;  2NRA C;  3G1L A;  4YRV A;  3DP7 A;  2FE3 A;  4G7Z F;  1RR7 A;  4GCV A;  3UNG C;  1T8I A;  3C18 A;  4BQO A;  2K4J A;  1MBG A;  2WB1 A;  3TBI A;  1B8I A;  3R0J A;  2Z33 A;  2DOA A;  1BR2 A;  2R92 J;  2STT A;  4YG2 F;  4RB1 A;  2L9V A;  4ZJZ A;  4MGR A;  2XKP A;  1SVL A;  1B59 A;  4DZP A;  2LKP A;  2PEX A;  1CF7 B;  1KQ8 A;  3SEZ A;  1ZHF A;  1TWC J;  3DF8 A;  4ZDO A;  3D5S C;  4A3D J;  2LFB A;  1PYV A;  3V7C A;  3B73 A;  1VQ9 I;  4N4N B;  2CRG A;  4YFK F;  5L3E A;  3K6G A;  2R7O A;  1O4X A;  3HOS A;  3GYH X;  2ZFU A;  3DPU A;  1OYI A;  4HRI A;  1G3S A;  2KKO A;  3CQZ J;  1SFE A;  1YOV B;  2IA2 A;  2VIX A;  3I56 I;  1H9T A;  2A6H F;  2F4O B;  2IGO A;  6PAX A;  2R7S A;  3EQL F;  4OIO F;  2DFF A;  1ZGJ A;  1YFH A;  2K02 A;  4BNC A;  2MC4 A;  3CME I;  1U9N A;  2VON A;  3KEO A;  4B47 A;  1R71 A;  4R79 A;  1MJA A;  1MJ9 A;  4A6E A;  4CXF A;  1R7J A;  2CO5 A;  3K7A J;  4YEL A;  5F27 A;  4PGH A;  4ABZ A;  4WWC A;  1J09 A;  2H6C A;  3WGH A;  3CCY A;  2ACJ A;  4U0V A;  2LKX A;  3SZG A;  4XMY A;  4M3F A;  4BJT A;  3HL2 A;  3E6B A;  5CVJ A;  1UG2 A;  2H09 A;  2E2H J;  3JRG A;  2OTJ I;  2VQL A;  5CLS A;  1OJL A;  1T98 A;  5DCM A;  1W0U A;  2HYJ A;  2XAJ A;  2VJ5 A;  2L4A A;  3FBI B;  1V5F A;  4XQF A;  1KU7 A;  3DKY A;  1RI7 A;  2HKX A;  2RGV A;  4I2O A;  3VFZ A;  5FB2 A;  4AVP A;  3BR6 A;  2Q8K A;  4C2M J;  1JTY A;  3T8R A;  4AU7 A;  2QGU A;  2VC1 A;  1XMK A;  4XON A;  1JJ8 C;  3A01 B;  1BW6 A;  2HZD A;  4CSW A;  4XN3 A;  2VOD A;  3BR0 A;  5HVQ C;  4ENN A;  5E1Z B;  2O8K A;  4Z6Y A;  2P6T A;  3TQN A;  5KVR A;  4I0B A;  1VQK I;  1J5Y A;  5D5X B;  4IRG A;  1R4M B;  2QSG X;  2NVQ J;  1X2N A;  2XAH A;  1GUU A;  3OYD A;  3NRV A;  5KAF C;  4BQA A;  4UUV A;  2EFW A;  1W0T A;  1TW3 A;  4KDP A;  5F1R A;  1U78 A;  5TIS C;  1UEL B;  3EUH A;  1Z7L A;  5E3M A;  1W5C C;  1SVM A;  3K4C A;  3TW7 A;  1LDJ A;  1TLH B;  2O5R A;  2QF7 A;  1YG2 A;  3TMO A;  1P7J A;  2CUE A;  1MBF A;  2UZK A;  3ZQC A;  5EGO B;  4E7K A;  1BIB A;  1HBX G;  2IBD A;  5M3M J;  1BI0 A;  4O5V A;  1FWZ A;  2QEX I;  2QWW A;  4BXX J;  1X19 A;  3OOP A;  1DQU A;  3F6O A;  1RUO A;  2FU4 A;  4RDU A;  2HU9 A;  2Z99 A;  5HOO A;  2DT6 A;  1QRY A;  4G6D A;  2NXN B;  3T8T A;  4ZTF A;  3AAF A;  4J19 A;  5E3O A;  3D0S A;  3CCE I;  4HNV A;  3CC7 I;  3ROU A;  1R1T A;  3FM5 A;  3D5R C;  3ECO A;  5HLT A;  2IS1 A;  2WV1 A;  3L7W A;  1MSE C;  2DMP A;  2XDV A;  1OCO H;  2X1E A;  1MBK A;  4IVN A;  1FBS A;  2BHY A;  5EG0 A;  3MFK A;  4ZDL A;  3TO7 A;  3HPG A;  1MMG A;  3Q0V A;  4WXD A;  1PUF A;  2E35 A;  2VT3 A;  1XSX A;  3L2R A;  4QIW N;  1OLT A;  4XRF A;  4P96 A;  2KDO A;  3H0G J;  3I9V 2;  1AKH B;  1X4P A;  3LSH A;  3FDY A;  2Z9O A;  3KP2 A;  1ODD A;  1Z3X A;  1V54 H;  2CMP A;  3GO5 A;  2JWT A;  4RAY A;  3CCJ I;  2W4S A;  5LD2 C;  1RET A;  2OCE A;  2PJP A;  2CSO A;  1DPR A;  2WAQ N;  3KP3 A;  3M7G A;  2IEK A;  4S05 A;  4LJZ F;  2FUG 2;  3CLQ A;  5FKL A;  1NH3 A;  1H89 C;  1JT0 A;  1JGS A;  2BW3 A;  1I1G A;  2Y31 A;  3CCS I;  5FJ8 J;  3BY6 A;  3FM3 A;  2YPR A;  4S0H B;  3CP2 A;  4I7H A;  1WJE A;  2V7F A;  1ENH A;  1QPM A;  4A0X A;  1VQL I;  1UMQ A;  4LK0 F;  2XIG A;  1OYY A;  3QU6 A;  1HKQ A;  2Q1Z B;  2VBY A;  3HPH A;  4LIT A;  3HOV J;  3PJR A;  2E5N A;  1MJB A;  5CPR B;  1UZC A;  1ZR2 A;  1ERD A;  4MHG A;  1QQI A;  1ZAO A;  4KN4 X;  4CCK A;  2E1C A;  2JPB A;  5LHH A;  5D6F A;  1LQ1 A;  2HVR A;  1ON2 A;  3DEE A;  3HC7 A;  1SEU A;  4RM3 A;  2CQX A;  3O3K A;  3K4L A;  2Q2E A;  2HQA A;  2KJB A;  1U8R A;  4R8H A;  3ABL H;  3WHB A;  5L3B A;  4FTH A;  4PGG A;  4CHU A;  1Q1H A;  4BKX A;  1QZE A;  3OWT A;  4RLQ A;  3BOQ A;  2XV4 S;  1BJA A;  1KYZ A;  3WTX C;  5M3F J;  4B09 A;  1ZGW A;  1YRN A;  3K9T A;  3CF2 A;  4DW6 A;  1MD0 A;  3S2W A;  3CJN A;  1FOW A;  4MEX F;  4JX6 A;  1NTC A;  3E6C C;  2RNG A;  3FXR A;  2FOW A;  2R7F A;  2HTS A;  5GAD J;  2QKL B;  4UVB A;  2M4G A;  3LST A;  3LSM A;  4I0A A;  3KYD B;  1HXD A;  2RV8 A;  2V9V A;  4HEA 2;  4M72 A;  2M7B A;  4W97 A;  2EA2 A;  2DOD A;  3RJP A;  1GV5 A;  1FC3 A;  4KIC A;  4LFU A;  4D0P A;  1TP4 A;  2X6W A;  1D1C A;  2ID6 A;  3EDP A;  3L9F A;  2L7Z A;  4BU2 A;  2JK3 A;  1VQ8 I;  1BM9 A;  4EM1 A;  5IY5 H;  3DWL E;  1IG7 A;  3CD6 I;  1IUY A;  1X3U A;  2LRE A;  4RB3 C;  2KRH A;  3E1S A;  3PM1 A;  2PMH A;  1BR4 A;  3UKG A;  2ETH A;  3I55 I;  4DQ2 A;  4E7J A;  1QPI A;  1ZEL A;  2XGE A;  1QO0 D;  2P4W A;  2KIM A;  1DUX C;  1YJN I;  1FTT A;  3FKJ A;  3NEU A;  3OYH A;  2TCT A;  4RA2 A;  2R5Z B;  4D7N A;  3WHC A;  3GW2 A;  4Y17 A;  2L01 A;  2I5U A;  2XAF A;  1CGP A;  3GTP J;  1U3E M;  2DK8 A;  2X6X A;  3OOU A;  1YIJ I;  3BG6 A;  2O8X A;  2VJJ A;  4OU0 A;  4UVA A;  2QZ8 A;  2BGC A;  4D5F A;  4G12 A;  2EB7 A;  4LG3 A;  2EK5 A;  2Y30 A;  3PUB A;  2DCE A;  3IL2 A;  1H8A C;  4JX4 A;  2ME0 A;  2BY0 A;  4Y3O A;  3X2Q H;  3CDI A;  4PJ0 C;  2ZJP F;  4OOI A;  4FE7 A;  1LFB A;  1X4O A;  2FXA A;  2Y9Z A;  3QOE A;  2FNA A;  2FOK A;  2XSJ C;  4IKF A;  5GPC A;  1SAX A;  4XKV A;  3HGY A;  1IV8 A;  2ZSI B;  3F8C A;  2LSO A;  4HG2 A;  3GFJ A;  4F3Q A;  2P5L C;  1YHQ I;  1I3A A;  4NNJ A;  3OYC A;  1SD4 A;  1OCZ H;  2GIZ A;  1Z67 A;  3I59 A;  4M6V A;  4RB0 A;  1QVT A;  3WGG A;  3F22 A;  2VI6 A;  2OCC H;  2M4K A;  2R7U A;  3GEZ A;  3WOD F;  3C1D A;  3F23 A;  1D3Y A;  2BYV E;  3KET A;  3F8B A;  2BXZ A;  1BI3 A;  2F2E A;  1OFC X;  4UXN A;  2VE8 A;  1KA8 A;  3BTL A;  2WTE A;  1F36 A;  4M3G A;  4HLX A;  4P9F A;  1U9O A;  4BL0 B;  2CUJ A;  2DPU A;  4N9I A;  1FYL A;  3H92 A;  1A35 A;  2K85 A;  2X4H A;  3HRM A;  2B63 J;  2FML A;  3ZMU A;  4WCG A;  1P4X A;  2F5V A;  4EM0 B;  1VF9 A;  2NVU B;  4A0Y A;  2KMU A;  4C2T A;  4JX5 A;  2EFO A;  2K9Q A;  3BRO A;  5EZG A;  3FHZ A;  5HNF A;  1BBY A;  4B1R A;  2K3P A;  2DMN A;  3IAM 2;  4HNT A;  3BQY A;  1K83 J;  2DI3 A;  3ABM H;  4OIP F;  1NG7 A;  1SMY F;  5FFZ A;  4D5C A;  1T0F A;  1FMV A;  1T2K A;  3AG1 H;  5L3G A;  1XSD A;  3I53 A;  1G59 A;  3JTH A;  1WJF A;  3LA7 A;  3U1D A;  3QQA A;  1TT5 B;  2BY3 A;  2UV1 A;  4HDV A;  4J01 A;  3DXJ F;  3OYJ A;  3CF5 F;  5CKT A;  1WCM J;  1ZAR A;  5FFX A;  2JN6 A;  1T38 A;  3D5L A;  1YIT I;  5FD5 A;  3RYR A;  1VI0 A;  5HS7 A;  1U6G A;  2DW4 A;  3JR9 A;  1FP1 D;  3G71 I;  4BUP A;  2GOX B;  1XC5 A;  1MKM A;  4FT8 A;  2K86 A;  2L9N A;  3VDX A;  5HLG A;  1JUS A;  2X6Y A;  2LNB A;  3CUO A;  4WK8 F;  3FXU A;  1ZRE A;  3DKW A;  2WAD A;  4CCO A;  4A3C J;  2HOA A;  2MG4 A;  4LOC A;  4G6Q A;  3ZP5 A;  3GTK J;  1W36 D;  1JGG A;  1Z05 A;  2KIU A;  3OYG A;  4II3 A;  4AWX B;  4DGW B;  1X1A A;  2E36 A;  5DUK A;  5K5Q A;  1IN8 A;  2XF6 A;  3JSP A;  1XSV A;  1S7E A;  4NHJ A;  2LY1 A;  2AXT C;  3S14 J;  1FSH A;  3FMQ A;  2ZXI A;  4I02 A;  4P9U A;  5C4X J;  4ESF A;  2DA1 A;  4HAM A;  1RKT A;  1ZG5 A;  1IN4 A;  1MH4 A;  3FXO A;  1S9H A;  4ZH4 F;  2WAQ A;  2KP6 A;  3Q0W A;  2IRF G;  4JOM A;  3WG7 H;  3WTV C;  3I4N J;  2DYR H;  2MFZ A;  4XNF A;  3H3Z A;  1XG1 A;  2HDD A;  2R93 J;  2X51 A;  3LSK A;  1I3Q J;  4ZYA A;  1D1A A;  2DMT A;  2RQQ A;  3RPU A;  2A07 F;  1SAN A;  3N05 A;  3E7L A;  1R6R A;  3TOA A;  2HQN A;  4DJA A;  2MLG A;  1FOK A;  3LWF A;  5JHF A;  2XUB A;  1UHM A;  4Y4R A;  3RKQ A;  3GZ5 A;  3SZP A;  4XLP F;  3JRD A;  4XK4 A;  4LK1 F;  1T56 A;  2B9S A;  3CZ6 A;  4G6T B;  1JKP C;  1MNM C;  1M1E B;  2EIM H;  1XDS A;  1Y56 A;  1D0Z A;  2H27 A;  1B9M A;  2JT1 A;  4A0Z A;  2VUM J;  1MH3 A;  2AS5 F;  1O3T A;  2GIV A;  2NS8 A;  4LGW A;  2R7R A;  4C3J J;  4BQQ A;  1BOA A;  1WSU A;  3NQO A;  2G9W A;  1XX5 A;  4RGS A;  3LAP A;  4OIQ F;  3ZQQ A;  3S17 J;  2EFN A;  2RQP A;  3K0L A;  1K7A A;  2LY2 A;  3HYI A;  3EPZ A;  2VL8 A;  3FWE A;  4P5O A;  3DBR B;  4BHP A;  2OC6 A;  4E7Z A;  1XGN A;  2KRF A;  2FSW A;  3I54 A;  2EV0 A;  1KGS A;  2XF7 A;  2ZNY A;  1RRJ A;  3B02 A;  2ZKZ A;  3PQK A;  5DM7 F;  2GXA A;  2IS2 A;  3R6S A;  3ONQ A;  5BS6 A;  3IWF A;  1EKE A;  2IAI A;  5E8I A;  3S2D J;  3OY9 A;  1WWX A;  2WAF A;  5EEH A;  3BJA A;  2VKD A;  1EH7 A;  1J7K A;  5B1A H;  2DXI A;  3MZY A;  2XKO A;  1IN5 A;  3R60 A;  5J1U A;  1NHA A;  4CYC A;  1VQ7 I;  4UB6 C;  4MTD A;  3M1C A;  4LIV A;  2VOP A;  2VN2 A;  5JLW A;  1J59 A;  3H9J A;  3QPL A;  4KMF A;  3A0B C;  2MC3 A;  2O03 A;  1OCP A;  3GUD A;  3S3O A;  1OCC H;  5ERI A;  4F7Z A;  3CJQ B;  2DQL A;  1HOM A;  1YE9 A;  2EIJ H;  3W6V A;  3CO7 C;  2M8G X;  2OU2 A;  1FSE A;  1OMI A;  1JUM A;  4GO1 A;  2KLO A;  2LBF A;  2FQ4 A;  2GBY A;  4JYK A;  1WQ2 A;  2DBB A;  2F6C A;  5LEK A;  2BEO A;  1SMT A;  4EVI A;  3HZJ A;  2JA5 J;  4L0Y B;  3RQ4 A;  1SD7 A;  2BE5 F;  2IA0 A;  2MBF A;  2ZXH A;  5D8L B;  1LE8 A;  4L18 B;  2OA4 A;  2M0M A;  1Y8Q B;  4KIF A;  2KDZ A;  4HX8 A;  2VT2 A;  4X0G A;  3DTK A;  1ETW A;  3W6J B;  3HHG A;  4M74 A;  4AYB N;  3CUQ A;  1U2W A;  1WH7 A;  3OYB A;  4YIR X;  5LFA A;  1SD6 A;  1R58 A;  4GFB A;  2K5C A;  3CMY A;  5K7H A;  2DA7 A;  2G7U A;  1YX5 A;  3BR1 A;  2C6Y A;  3BCA A;  3ZMT A;  5H6Q A;  3JRE A;  4BEH B;  4FET A;  5CJ9 A;  2CV1 A;  5F0C A;  3RZD J;  1TWG J;  1RR8 C;  3K4B A;  1UHS A;  3Q9V A;  3WGI A;  3OYN A;  2NNY A;  3NWS A;  1UHW A;  3DTI A;  5KK1 A;  5LRR A;  2Y0S N;  3K1P A;  3VSK A;  3BR2 A;  2ECC A;  1TNS A;  4EGY A;  5D8K B;  4A12 A;  4A3F J;  3ABU A;  5IOZ A;  5LLQ A;  2V9K A;  3T1B A;  4BY1 J;  3RI4 A;  2MLK A;  2R7T A;  1EH8 A;  1R1V A;  1DDN A;  5FLX Z;  4EM2 A;  1FIA A;  5B3S H;  1ZQ3 P;  2O0Y A;  2D1V A;  3ABT A;  1LFU P;  4NDL A;  2VXD A;  3S1Q J;  2DA6 A;  1IN6 A;  2OQR A;  3OYK A;  2ZJR F;  2A6E F;  2CFO A;  1K6O A;  3I5U A;  3TED A;  1RKW A;  2H8W A;  1X2M A;  3KLN A;  5J40 A;  1CQT A;  5TGT A;  1GLN A;  4BHC A;  1YX3 A;  1R4N B;  1XMX A;  2L54 A;  3EUA A;  1HDD C;  3EYI A;  3G73 A;  1JUP A;  1E3P A;  3KEQ A;  3DTE A;  5ICF A;  3FF5 A;  2HPM A;  3HRT A;  3S93 A;  1TW2 A;  5LBQ A;  3I64 A;  1RIO H;  2L7M P;  2J5P A;  4LG0 B;  4CGZ A;  2ZME B;  4A2U A;  5J4V A;  1P9Q C;  2GM4 A;  1LDK B;  3PO3 J;  1PP7 U;  2V1D A;  2ID3 A;  1Z91 A;  4N0B A;  1DP7 P;  3BTJ A;  4ETS A;  4E7S A;  1Y1W J;  1JXS A;  4RGU A;  4IXA A;  4F52 A;  2E60 A;  3JRH A;  3MKY B;  5DDG A;  1NK3 P;  1YQA A;  3DQV C;  5E17 F;  3HRU A;  2OTL I;  1ZG3 A;  4RAG A;  3HHH A;  3LL7 A;  4LIU A;  2CJJ A;  3LFK A;  1JHH A;  1A6Q A;  1WH5 A;  2OBP A;  4RMN A;  4LLL A;  4BYY A;  5IP9 J;  4A3B J;  4D9J A;  1U5T B;  2BOL A;  4FCY A;  2WA0 A;  1XGS A;  4UUT A;  5ED4 A;  2Z1D A;  2A5W A;  2IP2 A;  1IJW C;  2ELH A;  1GVD A;  4CZZ A;  3MVP A;  4YFN F;  4D7M A;  3U9G A;  2Z5U A;  3A1Y A;  5AIP A;  2HOT A;  3J7A Y;  4KIT B;  2FNP A;  2DPD A;  4IO9 F;  1F9N A;  4BBS J;  4NB5 A;  2ZNZ A;  3DU6 A;  2VJI A;  4UHT A;  4IL6 C;  3ZMZ A;  4DNC A;  3GX4 X;  4AM3 A;  2E1N A;  3DBH B;  3V42 A;  3BDD A;  2W24 A;  3K4M A;  4TV7 A;  4IQJ A;  1WRJ A;  2JPC A;  4M6Y A;  3CMA I;  1MNE A;  3ZXS A;  4XOR A;  3S15 J;  1WJB A;  1Y0N A;  2MA3 A;  5IT3 A;  1E0E A;  1Y6I A;  1WVR A;  2QUF A;  3IAS 2;  5DTD A;  4A5M A;  3I71 A;  1L0O C;  3M8F A;  1YLF A;  4X6A J;  2XB5 A;  2VLA A;  5FLX K;  1F1Z A;  5BMZ A;  2HTJ A;  4BDY A;  4BY7 J;  4IX7 A;  3DEW A;  2VJ4 A;  1DP3 A;  3JRI A;  2FA5 A;  2UXN A;  1R5H A;  2B0L A;  2TRT A;  1OR7 C;  2CW8 A;  1VQO I;  4F93 B;  3DKX A;  3G2B A;  4S04 A;  1ZRF A;  1YS6 A;  1ZK8 A;  2RAE A;  2P7C B;  3MWM A;  5JFR A;  5KNL A;  2ZC2 A;  3KCC A;  2KRC A;  1K78 B;  1XDU A;  3CDL A;  3Q0U A;  2Z2S B;  4IHX A;  1LNW A;  4E7H A;  1CF7 A;  3WTZ A;  2XRO A;  3PFY A;  4QPQ A;  4ASN A;  5EEA A;  4ENK A;  3CCL I;  2FX0 A;  2GXG A;  3QOD A;  3WU0 A;  2V1U A;  4E6K G;  2DT5 A;  4BS9 A;  3GWZ A;  1APL C;  4BH9 A;  2DMQ A;  1EF4 A;  3KP4 A;  4ZTJ A;  2XGC A;  1Z1D A;  2DA5 A;  3FXK A;  1Y39 A;  3PUF A;  3HOX J;  4AID A;  2HDW A;  2YSR A;  4CZC A;  2QBY B;  3C3W A;  1P4A A;  4FHT A;  5FO5 A;  4RAZ A;  2R0Q C;  1BI2 A;  2LOO A;  4RGR A;  1H0M A;  2HVS A;  2FEZ A;  2NVT J;  4HF0 A;  1F5T A;  3WTW C;  4XIC A;  2F4I A;  2VQG A;  4MLO A;  3OIQ A;  5K5O A;  3K2A A;  3IC7 A;  5ICE A;  2QLZ A;  2DFH A;  1ETQ A;  4EEF G;  5B5E C;  5E1W A;  2V1N A;  1I1S A;  1FTZ A;  4Y7N J;  1WKM A;  4CUG A;  3BP8 A;  1Z21 A;  1IXC A;  3O8H A;  4OAZ A;  2JA8 J;  3HBL A;  1N77 A;  3J81 Z;  3SDB A;  1VQN I;  3LNQ A;  4KN7 X;  3IH2 A;  1KQ9 A;  3GVA A;  3Q3S A;  4MEY F;  4O6J A;  5HOD A;  2D45 A;  4XKB A;  1IGN A;  2Z16 A;  4XLH A;  1JI8 A;  3QPH A;  2L9R A;  1F4K A;  3V8L A;  3OYE A;  4UUS B;  1ULY A;  3PIO F;  1FJL A;  3TDZ C;  1PUE E;  1T95 A;  3KLO A;  3I58 A;  2CH0 A;  2L4M A;  2W1O A;  2FF4 A;  4OWR B;  3A01 A;  3HOU J;  3VEP A;  3A03 A;  2OJE D;  5K7F A;  3HSF A;  2PMU A;  2COM A;  2HQ5 A;  2VB6 A;  2UWM A;  3MEX A;  2DYS H;  1J9I A;  2HXO A;  1H9G A;  2ELJ A;  2ADU A;  3L2W A;  1FY7 A;  2DOE A;  2XB0 X;  4AYB A;  3K1M A;  3E6M A;  1WI9 A;  1SFU A;  2YX4 A;  3FXM A;  4CA0 A;  3F72 A;  5M5Y J;  2PJR B;  4XBF A;  1YW9 A;  5L3F A;  2EZI A;  2V4J C;  3GTM J;  3SQN A;  2LP0 A;  2DN0 A;  3H5A A;  1T08 B;  3GBG A;  1G4D A;  1MBH A;  3HUG B;  3RDI A;  5E3L A;  5IT9 Z;  5EGO A;  2IVM A;  1XTA A;  2VQH A;  4AIK A;  2VAS A;  3BTI A;  1OCR H;  5FKK A;  1Q1V A;  5EYR A;  1PVE A;  3V8K A;  5K1Y A;  2I8D A;  2CG4 A;  5J8F A;  2CUZ A;  2Y0S A;  1Y0U A;  2ZO4 A;  5E79 C;  2YUS A;  3FHN A;  5HDK A;  1B9N A;  1PP8 F;  2XAQ A;  1FP2 A;  4XID A;  4IEJ A;  4AUX A;  2EA4 A;  3AL0 B;  3B6C A;  4A3G J;  2MSY A;  3I59 B;  3FXQ A;  2HOS A;  4ON0 A;  3OR2 C;  2DMU A;  2PQ8 A;  4PSX A;  1OPC A;  2XGD A;  2OZU A;  2AXL A;  4U7D A;  1USS A;  2ME6 A;  4IOC F;  1IO2 A;  5LGN A;  2L02 A;  2QQA A;  3GLX A;  3BJ6 A;  1MMN A;  3TO9 A;  2F48 A;  1P7I A;  2GZW A;  2ZBK A;  3HG9 A;  2EWN A;  4HX4 A;  2M1B A;  2OD5 A;  2N8G A;  1ETX A;  2K9L A;  2DA2 A;  3OS1 A;  2JRT A;  4M9Z A;  1AKH A;  1IZ1 A;  2JUC A;  4UV8 A;  5GAH J;  1KU2 A;  5L3C A;  2NS7 A;  4B4C A;  5D5U B;  2PN6 A;  1VQM I;  3J81 K;  3OYF A;  1G3T A;  4KIG A;  4KIB A;  2W25 A;  4UV9 A;  2X9D A;  3NWT A;  2E5Z A;  2LKS A;  1AHD P;  4KMU X;  2LR8 A;  1GHC A;  5F0F A;  3RIR A;  3C2G A;  2R5Y B;  4Y13 A;  2VC0 A;  4B44 A;  1DGW Y;  4FX0 A;  1V5E A;  4PFP A;  3CCV I;  1O3Q A;  1R1U A;  2KIF A;  2XRL A;  2ZME C;  3RSN A;  3IKV A;  1QBJ A;  1X3W B;  2COB A;  2P5K A;  3EUH C;  2R7Z J;  1XD7 A;  5CQE A;  3K10 A;  1IC8 A;  4IPA A;  1SAU A;  2FBI A;  4Q47 A;  5EDN A;  2MAB A;  2VBW A;  3TP0 A;  1MND A;  3AG2 H;  4QWQ A;  2NVY J;  2NOG A;  5EEG A;  4H0E A;  2CQ7 A;  5C4J J;  2FQ3 A;  3KP7 A;  3F9K A;  1HW5 A;  2XAS A;  2JRM A;  4L5E A;  3S1M J;  3R61 A;  4A93 J;  3KE2 A;  1U5T C;  5FD6 A;  5K7Z A;  3K70 C;  2FJ1 A;  3QYB A;  5IT9 K;  1KU3 A;  1LKX A;  3K2Z A;  2HPI A;  5B1B H;  1BA5 A;  3QP5 A;  4G7H F;  1ZR4 A;  1O3S A;  2QA4 I;  2NNN A;  3QOP A;  2A69 F;  4CCN A;  1KZH A;  1FEX A;  1TWA J;  3H9Q A;  1DU6 A;  3J7Z I;  3JRA A;  1ACI A;  2K3F A;  2IGK A;  1MBJ A;  2ZJ2 A;  3ZN1 A;  1FZP B;  1W7P B;  3MKZ A;  5DEQ A;  1IRX A;  5LEJ A;  3OYL A;  4BAY A;  3AKZ A;  3LA2 A;  1MIJ A;  5J47 A;  1OYW A;  2DJN A;  4ZYG A;  2RRE A;  4HOB A;  1R5G A;  1U0J A;  3DCF A;  1P6R A;  4WXC A;  4OMZ A;  3RKX A;  4A3K J;  1AOY A;  2KFD A;  1WI3 A;  2CW0 F;  2HDC A;  1W1W E;  2L7F P;  2M7A A;  2QQB A;  3QPS A;  3RKW A;  5KCM A;  4WF2 A;  4BE0 A;  3S3N A;  4KNY A;  1DPU A;  3F21 A;  2XAG A;  3HDD A;  2FBK A;  1D5Y A;  1ETK A;  1MZB A;  3VOE A;  5ICC A;  4EJO A;  3KFW X;  3C2B A;  5D4R A;  2H6B A;  5H6R A;  3LMM A;  2QQ9 A;  2R5Z A;  2MW8 A;  2HKO A;  1Z3Y A;  4I6Z A;  3KYL A;  2QQ8 A;  4HDU A;  5EJC A;  3FXJ A;  2JA2 A;  4MQ9 F;  3LQR A;  3W2A A;  3WTS C;  1YS7 A;  5EZH A;  3BWG A;  1T33 A;  2VXZ A;  3PFI A;  2JZY A;  3BC8 A;  2W84 A;  3E0J B;  2PG4 A;  2BXY A;  2W82 A;  3EUK L;  4QPO A;  3A4C A;  3HM5 A;  2JSC A;  5BPI A;  1QVU A;  4CDG A;  4FAS D;  1SVO A;  3OV8 A;  3IV5 A;  2A61 A;  3P9I A;  3CCQ I;  1IDY A;  1PJR A;  3W2V A;  1N78 A;  2K4B A;  3C2H A;  2LDU A;  2OAZ A;  5TJJ A;  5DD8 A;  3DBL B;  1TWF J;  1D0X A;  4BE1 A;  4PDK A;  1S29 A;  3BZ6 A;  4RAF A;  4I99 C;  2E2J J;  3S3M A;  4LB6 B;  5FKO A;  3DPL C;  5TRD A;  3H3V K;  3WG9 A;  3CCR I;  1IDZ A;  3OSF A;  4ENJ A;  2EIL H;  3W3C A;  2NS0 A;  1ZG1 A;  3VYT B;  1K4T A;  3GLL A;  1WPK A;  4E7I A;  4A3I J;  2GWR A;  4Q4Z F;  3COA C;  3I3L A;  1G3Y A;  4WXH A;  4PJJ A;  1KU9 A;  3BG9 A;  2W00 A;  2E2I J;  4BJ5 C;  4ZYH A;  3ASO H;  3QPT A;  3ABK H;  3KP5 A;  4D1Q A;  2WY8 Q;  2VBX A;  4I01 A;  3BZK A;  1IUF A;  5JVG F;  4PSW A;  1TWH J;  2HS5 A;  4E70 A;  2AQF A;  5IP7 J;  1WZ2 A;  2LBF B;  3O2P E;  1WJD A;  1LVA A;  2HYF A;  1IXR C;  3DV8 A;  3I4M J;  1JKO C;  2LC2 A;  2JVH A;  2H1L A;  5EF6 A;  1P2F A;  5D6E A;  2XC7 A;  5FRM A;  3SXY A;  4HQE A;  3K1N A;  1FT9 A;  2DFE A;  2X48 A;  2JUG A;  1B1B A;  1B72 B;  4L9J A;  1BC8 C;  4IF4 A;  1NK2 P;  4F92 B;  3G1O A;  1W7P D;  5F04 A;  3SZT A;  2CV2 A;  2LY9 A;  2FMY A;  2JA6 J;  2YR2 A;  1KQ0 A;  2MD0 A;  4G8X A;  4IQ4 A;  4RLF A;  1Z6T A;  4XM3 A;  4ZYD A;  4CH7 A;  3BCB A;  3E97 A;  4EJW A;  5LGT A;  4B8X A;  2EFQ A;  4NUB A;  5IYC J;  4WX9 A;  3P7N A;  3BLY A;  5D5W B;  4QTR A;  3M1E A;  3VOD A;  5J8C A;  2JTV A;  4HV6 A;  3RZO J;  1LUJ B;  2JA7 J;  4GYG A;  2CU7 A;  4H4K C;  4EQQ A;  2DTR A;  4XLA A;  3W2W A;  1XCB A;  2RN7 A;  2KZV A;  1ETO A;  2HR3 A;  3VPR A;  3AL0 C;  3DEU A;  3SHF A;  2K27 A;  3ZQG A;  5IPA A;  3DPT A;  3W6K B;  4BXF A;  2Q0O A;  1XPX A;  1UG0 A;  4JQF A;  4C3H J;  2BZT A;  2CW7 A;  3BR5 A;  4DYC A;  3FXL A;  3OSG A;  2VQC A;  3JRB A;  1BI1 A;  3RPQ A;  3TOB A;  4NQW B;  5DS9 A;  3H35 A;  2ZSH B;  2ISZ A;  2IPQ X;  1GV2 A;  3U1K A;  3BR3 A;  5BPD A;  4XL9 A;  2M3A A;  4IJA A;  2GA1 A;  4A3E J;  4DBQ A;  2A6T A;  1V4R A;  2CS3 A;  5DYM A;  1ZLK A;  1TQM A;  4B3A A;  2LYC A;  1I6X A;  3BG5 A;  4IHS A;  4IZZ A;  2EIN H;  3ECH A;  1B8I B;  1BJZ A;  3FIS A;  3OS0 A;  2ZCW A;  4PJL A;  4LMY A;  1ONV A;  2L3D A;  1JKQ C;  3HIF A;  4IOA F;  2EFP A;  1S5L C;  1X58 A;  5IYB J;  1MDM A;  3AG3 H;  1ZRC A;  2AQE A;  3HGG A;  3ZRG A;  2KIS A;  1D1B A;  4M71 A;  1YJ9 I;  3VSL A;  5B66 C;  2D1H A;  2W48 A;  1QHH D;  1TT0 A;  3E5Q A;  1ZTR A;  4XOP A;  1K4S A;  1LDD A;  5GTI C;  4P55 A;  3VWB A;  3HOW J;  3CMM A;  2E7X A;  1LJ9 A;  1A36 A;  3MMY B;  3A2K A;  3TL4 X;  2R7V A;  2JSP A;  2F5C A;  2KPM A;  3H0D A;  1R00 A;  3ISP A;  1L3L A;  1N75 A;  2MD5 A;  1A6I A;  1SFK A;  3OR1 C;  3JTG A;  2Y0M A;  3V7R A;  1LEA A;  1ZLJ A;  1FNN A;  3GCM A;  3GTO J;  2UUZ A;  3A02 A;  4YII A;  2I10 A;  2W57 A;  1UFM A;  3GFI A;  3BZC A;  2VBZ A;  3AFH A;  2XPW A;  3P9K A;  2ZJQ F;  4IHV A;  2DO7 A;  5IYD J;  4KFC A;  2XPU A;  3N97 A;  4FE4 A;  1B4A A;  3HSE A;  5DCM B;  5J3L A;  2GA2 A;  2J5O A;  2BY2 A;  3IP4 B;  4PFO A;  1WFX A;  1TL8 A;  1S72 I;  1VQP I;  4BJ6 C;  1T6S A;  2IGM A;  4M6X A;  3QAH A;  1BIA A;  1X1D A;  3ULQ B;  4IHY A;  3EET A;  4HLY A;  3DLA A;  2HXI A;  4KT6 A;  4ZZD A;  4F91 B;  1HC8 A;  3GFM A;  2YS9 A;  4QLC U;  4BE2 A;  2A68 F;  5ILU A;  1ETY A;  3IUO A;  5IP6 A;  5C44 J;  1HCR A;  3BG7 A;  4LD5 A;  2VPR A;  3QWL A;  3PSI A;  2O61 A;  2QCO A;  4DBR A;  3HTU A;  5DUI A;  2KQR A;  1I39 A;  3C7J A;  1TQI A;  4NC7 A;  3SEQ A;  5FRN A;  2FBH A;  3B6A A;  4KA4 A;  3KP6 A;  3VYR B;  4HF1 A;  5M5X J;  2G7H A;  3F0C A;  3QU3 A;  1LPQ A;  3OYM A;  3TP3 A;  3RCO A;  2A3S A;  1FLI A;  1IF1 A;  2P0W A;  1S3J A;  1RUN A;  4K2E A;  3L2C A;  1RPW A;  1I50 J;  2LVS A;  3WE3 A;  1DU0 A;  4L9T A;  2GAU A;  2BVL A;  4N9H A;  4OAY A;  2K40 A;  5LHG A;  3GZ6 A;  1YO5 C;  2QSH X;  1MMS A;  4I98 B;  3I4P A;  4EJT A;  4L5I A;  5A2Q Z;  5ICG A;  3Q9S A;  4DYR A;  3KPH A;  4JP0 A;  3HEF A;  3NAU A;  1LB2 A;  1YI2 I;  4AC0 A;  4KT5 C;  3JAM Z;  3Q5F A;  2OPT A;  2DAO A;  4BEH A;  5J6X A;  5EG0 B;  2QSF X;  1O7L A;  4AD9 A;  4HBL A;  1X1B A;  3SJM A;  2WBM A;  3OL3 A;  4A5N A;  1PUF B;  4CO8 A;  3PNY A;  3F3X A;  4GRI A;  2Y48 A;  3OYI A;  4FQG A;  1YYV A;  2MGQ A;  3BPV A;  4ZDP A;  3TW6 A;  3V4G A;  2FRH A;  2ISY A;  3S32 A;  4MO7 A;  3UR3 C;  1H88 C;  4I76 A;  2XVC A;  2EQR A;  1TQP A;  4RM2 A;  3GTL J;  1VQ6 I;  2EJR A;  3ERE D;  3NAR A;  2KIQ A;  3PSF A;  1KYW A;  4XLC A;  2WV0 A;  4M3D A;  4PZJ A;  2E1M B;  4CIC A;  3DU5 A;  3R4K A;  3KX2 A;  4ESJ A;  5J1Y A;  1AU7 A;  1IAW A;  2BW3 B;  4XSX F;  4NC8 A;  2H8R A;  2PMZ N;  3KZI C;  4GYI A;  2X0L A;  2BHZ A;  3V8J A;  3KZZ A;  1JE8 A;  5HS8 A;  2F5E A;  4MFD A;  1IN7 A;  1J2X A;  3H36 A;  2M5W A;  1R23 A;  3FX3 A;  4EV0 A;  2HYG D;  3L2V A;  2Y69 H;  4LLN A;  3BPX A;  2DA4 A;  4Y15 A;  3L1P A;  3HTS B;  4ZC3 A;  1FIP A;  1LEB A;  4MTE A;  4LG0 A;  3P9C A;  2ZME A;  3ESW B;  4PCQ A;  2Q2E B;  4XLN F;  2D2W A;  4L9V A;  2PBI A;  1I27 A;  2DA3 A;  3QYE A;  2VKV A;  3M8J A;  3U2R A;  1O3R A;  3TDU C;  3CUQ C;  4XSZ F;  3SFI A;  3FMR A;  4X1E A;  3SYT A;  1HKS A;  5HLH A;  1I6H J;  1YJW I;  2DT7 B;  3L09 A;  2LRD A;  1YRN B;  3KIO A;  2P6S A;  4HYE A;  3IHU A;  2F5D A;  2EV5 A;  4XRS G;  1ZGA A;  4PK4 A;  1Y1V J;  1QZZ A;  5BNG A;  1O7F A;  3OIO A;  1U5T A;  1F43 A;  2JJ7 A;  3AG4 H;  4XRM A;  3M8E A;  5A2Q K;  2EH3 A;  1EJ9 A;  4E4H A;  1ITY A;  1HQC A;  2IW5 A;  4GGG A;  2OF7 A;  3JAM K;  1B6A A;  4C9Y A;  4B3X A;  2KHM A;  2CQN A;  1IRG A;  4U0W A;  5H20 A;  4EGZ A;  4F55 A;  2DOF A;  3HJE A;  3LSJ A;  4BAC A;  1ZRD A;  2K9M A;  2LMD A;  3ZN0 A;  3F8N A;  1NG6 A;  2CGP A;  3BT9 A;  4BBR J;  2GQQ A;  3K4N A;  1FMW A;  2TDX A;  3IH4 A;  3LFU A;  1OQY A;  1S7O A;  3LSI A;  3MD2 A;  3CO6 C;  2HNH A;  5HS9 A;  2E19 A;  2R7X A;  5ILV A;  4YEJ A;  3K70 D;  3CCU I;  3ZQL A;  3A0H C;  3M3Y J;  3OIP A;  9ANT A;  1GT0 C;  3LOC A;  2ZFW A;  1RES A;  1C0W A;  4LLG F;  1JKR C;  3WU1 B;  3HOZ J;  1D5V A;  3F8M A;  1V55 H;  4CCM A;  1WJ5 A;  1UB9 A;  4AIH A;  1MSF C;  5FKN A;  1O57 A;  3CDH A;  1TBX A;  1G3W A;  1K6Y A;  2L7K A;  2M30 A;  2BVM A;  4ZZL A;  1POG A;  2L0K A;  5AIQ A;  3ZMD A;  2LTP A;  3IRQ A;  4XN0 A;  2Y9Y A;  1BW5 A;  1YW8 A;  3M9A A;  3VYU B;  1QU3 A;  2CFX A;  1RNL A;  4UB8 C;  3ML6 A;  2ICW G;  3T0Y A;  2M2E A;  1W5T A;  1K78 A;  1X1C A;  2R3S A;  4LB5 A;  3MKL A;  3WTU C;  2QEN A;  2B7E A;  4KJZ A;  5E3N A;  3HB9 A;  1VND A;  1HKT A;  3H1C A;  3WTY C;  3BG3 A;  4EJV A;  2K9N A;  1XMA A;  1Z77 A;  1A04 A;  3FKI J;  1QHG A;  1R49 A;  3S1R J;  2M87 A;  2LK2 A;  4EAT A;  2HFH A;  1JJ6 C;  2G0E A;  1P4W A;  4PJM A;  2EZH A;  1Y8R B;  3CC2 I;  1V3F A;  1HA8 A;  2KL4 A;  1IRZ A;  4A3M J;  1R36 A;  4HSR A;  3WTT C;  2QBY A;  3S1N J;  3SDG A;  1X3Z B;  5E8G A;  1LVK A;  3ZQH A;  5CQG A;  2Z3Y A;  4BXU A;  2NVX J;  1FX7 A;  2GXB A;  4MIM A;  1GVJ A;  3JCU C;  3LSG A;  1ORK A;  5E18 F;  4OIR F;  3OS2 A;  3CC4 I;  2HWV A;  1T39 A;  2ESN A;  2CUF A;  4M9X A;  2ZXW H;  4FX4 A;  1I5Z A;  2DTZ A;  2YU9 J;  3JRF A;  3GZN B;  1IW7 F;  2YX7 A;  4XKC A;  4AVZ A;  2BV6 A;  3E5U A;  3PO2 J;  1A5J A;  1U8B A;  1EH6 A;  2ELK A;  3O6B B;  1SC7 A;  3HOT A;  4ANJ A;  2CQK A;  3KEY A;  2Y2Z A;  5LRS A;  3HKZ N;  2M8E A;  2KJC A;  3PNV A;  1A31 A;  1J75 A;  4UUS A;  5D5V B;  4HZF A;  4E7L A;  2L9S A;  3ZPL A;  2E71 A;  2BBY A;  3VB2 A;  1G6N A;  1D8J A;  4I09 A;  2OV7 A;  4O3M A;  2NOJ B;  4M9S A;  4GDF A;  4M73 A;  4G9Y A;  2VKE A;  3L2Q A;  5F08 A;  5BQT A;  3REO A;  4A69 C;  5JHU A;  5GAG J;  2PI0 A;  3IRR A;  1WGX A;  3SFZ A;  4IRI A;  1LFP A;  3MN2 A;  3QYF A;  2PJR A;  5K5R A;  1TNT A;  2PLY A;  4B43 A;  1VZ0 A;  3KYC B;  5H2F C;  2H1K A;  3S16 J;  3H5N A;  1E3O C;  2V9P A;  3HSR A;  2RVC A;  3HUG A;  3FMS A;  3OYA A;  1FOY A;  1XS9 A;  2DJI A;  1FYM A;  3CCM I;  3LSP A;  3F8F A;  3JRC A;  4PJN A;  3FIW A;  4A3J J;  2JQ7 A;  5HDG A;  3ZQF A;  2R7D A;  3S8P A;  2LF7 A;  3ASN H;  2ZB9 A;  5HNH A;  3MAJ A;  1ZYR F;  5JR3 A;  1K79 A;  2FD5 A;  4R1H A;  5F1J A;  3GTG J;  2EV6 A;  4HW0 A;  1OCT C;  1N25 A;  3CES A;  3LQQ A;  2W7N A;  1WJC A;  4Y33 A;  4FIS A;  4C2U A;  1GXP A;  1R5I D;  1VTN C;  1GDT A;  1QNT A;  2ESH A;  4ZYE A;  2OUM A;  2QM3 A;  1MGT A;  2IXS A;  2HEO A;  1S7A A;  2EPF A;  2PMZ A;  3MCZ A;  4DYQ A;  2W85 A;  1PDN C;  4G7O F;  1REP C;  1VQ5 I;  4L0Z B;  1JT6 A;  3PQJ A;  3GXO A;  4Y52 J;  2ZXJ A;  2DK5 A;  2E1M C;  3FK6 A;  1TZL A;  3ZQI A;  4HX7 A;  1IV6 A;  1XGM A;  1Z6R A;  4HPQ A;  4A3L J;  3E6D A;  3HXL A;  1UJ8 A;  1IXS B;  3GME A;  5AON A;  1BOB A;  2IS6 A;  4IRH A;  3WE2 A;  1RC9 A;  3G3Z A;  2V6E A;  4XR6 A;  3CLO A;  5F64 A;  2WB1 N;  4G94 A;  2MYS A;  4DZJ A;  3JSO A;  5BOX A;  1UCR A;  2LG4 A;  3GF2 A;  5E20 A;  2X1D A;  2R5Y A;  5FLV A;  4JBA A;  2KT0 A;  5FGM A;  2F4M B;  4RGX A;  4BQN A;  3JW4 A;  4ENM A;  3ZR8 X;  2Y75 A;  2RNJ A;  4ESB A;  3BTC A;  4BDZ A;  2ECB A;  3RKY A;  2E1O A;  1MBE A;  3K4K A;  4XKW A;  5DM6 F;  3GFL A;  2STW A;  1D0Y A;  4QSH A;  4UY8 I;  3HRS A;  1EA3 A;  2WC2 A;  1R9T J;  2YU3 A;  2HI3 A;  1AWC A;  2DFI A;  4YFX F;  2BY1 A;  1FPQ A;  2HVQ A;  2K9S A;  4U7B A;  5DV5 A;  2JMW A;  1YTY A;  4Q48 A;  4OMY A;  4GXO A;  3ZMS A;  3M4O J;  2M9H A;  4IHT A;  5JVT A;  1YIO A;  4EJU A;  5FRO A;  4EMS A;  2MH2 A;  3R0A A;  5GAE J;  2CQQ A;  2EIK H;  2HQR A;  2NAZ A;  3KZY A;  5DCF A;  2V1X A;  5IOY A;  1KON A;  1X1P A;  3MZ8 A;  5KHD A;  2XSD C;  2HOE A;  2P8T A;  1BN5 A;  2LF8 A;  4DIQ A;  2DLL A;  2DDA A;  3FK7 A;  2E7W A;  3K69 A;  1HST A;  5F6F A;  1G2H A;  1OIS A;  3K4J A;  3MQ0 A;  3RQI A;  4CYC B;  2VE9 A;  4DOZ A;  4YIF A;  3J7A O;  5CVU A;  3M07 A;  1UST A;  2VKH A;  4C30 A;  3CJT B;  3L00 A;  2X85 A;  3OL4 A;  1BR1 A;  1WJA A;  4PUS A;  1HLV A;  1W7P A;  3E3V A;  3VYS B;  1J0R A;  5GP9 A;  3G1M A;  3H9G A;  5F0H A;  2DDB A;  2A05 A;  4A6D A;  1JHF A;  3J80 Z;  2NYX A;  2GOM A;  3ZOB A;  2F5F A;  5FKM A;  4M3E A;  2XGX A;  3J7Y J;  3H5R A;  2XRN A;  4U0Y A;  3V7S A;  1ON1 A;  4L9N A;  2D5V A;  4U88 A;  2VOO A;  2OQG A;  3I0T A;  1LE8 B;  4N4O B;  3L2U A;  4UVC A;  2XHK A;  2AHQ A;  4JK1 X;  1MDM B;  5KAI C;  3FZV A;  2R7Q A;  2QKM B;  1WHU A;  4J00 A;  3O8G A;  1BC7 C;  4MQV A;  5CVV A;  2EBI A;  2M0C A;  3CUQ B;  5CYV A;  5E1X A;  1E2X A;  1MMD A;  4HST A;  4ITV A;  1E17 A;  1QZY A;  1FBQ A;  5LHI A;  1XN7 A;  2GLO A;  2V26 A;  1QA6 A;  2R4G A;  2K7L A;  3FBN B;  4HQM A;  4M3B A;  4NBQ A;  3ZCO A;  3H3U A;  3RPU D;  5GTH C;  1YW7 A;  1ZN2 A;  2M45 A;  2QVO A;  1OKR A;  3U21 A;  2V6C A;  2XPV A;  1HSJ A;  4C3I J;  3CJR B;  2O7O A;  4MFE A;  2O9L A;  2WAE A;  3G6E I;  3E5X A;  4HF2 A;  2PFB A;  1AA7 A;  5D4S A;  3GTQ J;  2X1C A;  2X6O A;  1IRF A;  2R7W A;  1XCV A;  3IH3 A;  3PNT A;  1DGR M;  1P92 A;  1E3H A;  2LLK A;  5M5W J;  2VPL A;  2QYO A;  3LSR A;  3MKW B;  4W1U A;  2IS4 A;  1TTY A;  1HDP A;  3F6V A;  4MNU A;  1UAA A;  2EZK A;  2H94 A;  4RB2 C;  3HKZ A;  4U87 A;  1BL0 A;  2IA1 A;  2HGC A;  5FLM J;  4UNO A;  2MH9 A;  2P7V B;  2RC4 A;  2RKH A;  3RYP A;  1FYK A;  3TKY A;  4Z2Y A;  1MW7 A;  4L5J A;  4XRS A;  5DD4 A;  4KYW A;  2P81 A;  3N4M A;  1SFO J;  4AIJ A;  3QRF F;  3D1N I;  1SFX A;  2L5Q A;  2WY7 Q;  3T5X A;  3EYY A;  4V19 K;  1OR7 A;  1TC3 C;  2LD5 A;  2OZ6 A;  4HNU A;  1GXQ A;  2IGN A;  1RZ4 A;  2XAU A;  4OIN F;  3ZMV A;  1Z0X A;  3ZGK A;  3ZQ7 A;  3J80 K;  4Q5S F;  1ETV A;  1T0F C;  2P5V A;  2JVG A;  2EZL A;  4II2 A;  4CCJ A;  1MMA A;  1G8X A;  2RDP A;  4V2G A;  4CYD A;  3OMY A;  3LAJ A;  1QGP A;  3TGN A;  4XLE A;  1D8K A;  1W4M A;  1W36 C;  1JTX A;  1EV7 A;  3LA3 A;  1XB4 A;  2IJL A;  4XOT A;  2WWY A;  1STZ A;  1S6L A;  2V79 A;  5JLX A;  4RBO A;  1HF0 A;  3RTR A;  3BJO A;  2DQR A;  3GTJ J;  1B72 A;  3TO6 A;  3DLL F;  2XF5 A;  3DFG A;  4HA8 A;  1Z9C A;  4KUM A;  5JI6 A;  3PIP F;  3QP6 A;  3PL8 A;  4NC6 A;  3IKT A;  5HLI A;  1R22 A;  4HV5 A;  3CTA A;  2CYY A;  4B48 A;  5LGU A;  5GPA A;  3WU2 C;  4KIS A;  1FOX A;  2IT0 A;  1W5S A;  5HDN A;  4RS8 A;  1SD5 A;  4P1W A;  4BGD A;  2O3F A;  4V2F A;  5CVI A;  2O6G E;  2AO9 A;  2PX9 A;  3BQZ A; 
#chains in the Genus database with same CATH homology
 2DA3 A;  2VKV A;  2R5Y B;  4IHW A;  3I4N J;  5C3E J;  5J1R A;  3SFI A;  4X1E A;  1XG1 A;  2HDD A;  2R93 J;  1I6H J;  2XRL A;  1I3Q J;  1YRN B;  2DMT A;  2COB A;  2R7Z J;  1SAN A;  3E7L A;  4XRS G;  1Y1V J;  1IC8 A;  1ZKG A;  5BNG A;  3OIO A;  1F43 A;  3RKQ A;  2JJ7 A;  5EDN A;  4XRM A;  3HOY J;  3TP0 A;  3JRD A;  2M34 A;  4XK4 A;  1K61 A;  1T56 A;  2EH3 A;  1VFC A;  2NVY J;  2NOG A;  1JKP C;  1ITY A;  1MNM C;  3S2H J;  3G1L A;  2OF7 A;  5C4J J;  1RR7 A;  3LSJ A;  2VUM J;  4L5E A;  1MH3 A;  3S1M J;  1MBG A;  1B8I A;  4A93 J;  2NS8 A;  5K7Z A;  2FJ1 A;  4C3J J;  2R92 J;  3BT9 A;  4BBR J;  4DZP A;  1BA5 A;  3IH4 A;  1ZR4 A;  2E19 A;  3S17 J;  1FEX A;  1TWA J;  1DU6 A;  3ZQL A;  3M3Y J;  9ANT A;  1GT0 C;  3JRA A;  1TWC J;  3LOC A;  1RES A;  4A3D J;  1JKR C;  1MBJ A;  3HOZ J;  2LFB A;  2CRG A;  1O4X A;  1MSF C;  5FKN A;  2DJN A;  1POG A;  2L0K A;  3CQZ J;  3DCF A;  2IAI A;  2LTP A;  3S2D J;  2Y9Y A;  1BW5 A;  4A3K J;  1WI3 A;  2L7F P;  3QPS A;  2M2E A;  1U9N A;  3MKL A;  5J1U A;  5E3N A;  4CYC A;  3HB9 A;  3HDD A;  1VND A;  1D5Y A;  1ETK A;  3BG3 A;  2K9N A;  1Z77 A;  3K7A J;  5F27 A;  3FKI J;  5JLW A;  4ABZ A;  3QPL A;  3S1R J;  3C2B A;  2LK2 A;  3CCY A;  1OCP A;  1JJ6 C;  2LKX A;  2G0E A;  1HOM A;  3W6V A;  4M3F A;  2M8G X;  2EZH A;  2R5Z A;  1UG2 A;  1JUM A;  2E2H J;  3JRG A;  2MW8 A;  1OJL A;  1IRZ A;  4I6Z A;  4A3M J;  2FQ4 A;  2GBY A;  4JYK A;  1W0U A;  2HYJ A;  3S1N J;  3SDG A;  5EZH A;  2JA5 J;  1T33 A;  3ZQH A;  2NVX J;  3BR6 A;  4C2M J;  4MIM A;  1LE8 A;  1JTY A;  3HM5 A;  3LSG A;  1ORK A;  1BW6 A;  3A01 B;  1QVU A;  2KDZ A;  3BR0 A;  3IV5 A;  2CUF A;  1ETW A;  1IDY A;  2O8K A;  2DTZ A;  2YU9 J;  4AYB N;  3JRF A;  1WH7 A;  2NVQ J;  1X2N A;  1TWF J;  3PO2 J;  1GUU A;  1A5J A;  1U8B A;  4GFB A;  2ELK A;  3CMY A;  5K7H A;  2E2J J;  1W0T A;  2DA7 A;  1U78 A;  3BR1 A;  2Y2Z A;  5FKO A;  3HKZ N;  3H3V K;  5E3M A;  1IDZ A;  3JRE A;  3OSF A;  3TW7 A;  5F0C A;  2QF7 A;  4UUS A;  3RZD J;  1TWG J;  1UHS A;  1WPK A;  4A3I J;  1P7J A;  2CUE A;  1MBF A;  3ZQC A;  5EGO B;  2IBD A;  5M3M J;  3BG9 A;  2Y0S N;  2E2I J;  3BR2 A;  2ECC A;  4BXX J;  4A3F J;  5IOZ A;  4RDU A;  2VKE A;  5F08 A;  4BY1 J;  1IUF A;  4A69 C;  1QRY A;  4J19 A;  1TWH J;  1WGX A;  5E3O A;  5IP7 J;  1FIA A;  4HNV A;  3MN2 A;  1ZQ3 P;  3I4M J;  1JKO C;  1LFU P;  2WV1 A;  4NDL A;  3S1Q J;  1MSE C;  2H1K A;  2DA6 A;  5EF6 A;  2DMP A;  3S16 J;  1MBK A;  5EG0 A;  1E3O C;  2X48 A;  3TED A;  3Q0V A;  1RKW A;  1PUF A;  1B72 B;  1X2M A;  4QIW N;  1XS9 A;  1NK2 P;  3LSP A;  1CQT A;  3G1O A;  5F04 A;  3JRC A;  3FIW A;  3H0G J;  4A3J J;  1AKH B;  2LY9 A;  1HDD C;  2JA6 J;  1JUP A;  3ZQF A;  2ZB9 A;  2FD5 A;  5IYC J;  2L7M P;  2JWT A;  1RET A;  5F1J A;  3GTG J;  2WAQ N;  4QTR A;  1OCT C;  2GM4 A;  3PO3 J;  2IEK A;  2ID3 A;  3RZO J;  5FKL A;  1H89 C;  3BTJ A;  4FIS A;  2JA7 J;  1JT0 A;  2CU7 A;  2Y31 A;  1Y1W J;  5FJ8 J;  1GDT A;  3JRH A;  1ETO A;  3VPR A;  1NK3 P;  4S0H B;  1ENH A;  3BQZ A;  3ZQG A;  5IPA A;  4DYQ A;  1UMQ A;  4C3H J;  3BR5 A;  4DYC A;  1JT6 A;  4Y52 J;  2CJJ A;  3OSG A;  3HOV J;  1WH5 A;  5IP9 J;  3FK6 A;  3JRB A;  3ZQI A;  4A3B J;  4FCY A;  1ZR2 A;  1IV6 A;  4UUT A;  5DS9 A;  4A3L J;  1GV2 A;  3BR3 A;  1IJW C;  1GVD A;  4A3E J;  3MVP A;  4D7M A;  2CQX A;  2HOT A;  4B3A A;  2WB1 N;  4BBS J;  4DZJ A;  3BG5 A;  2R5Y A;  1B8I B;  5FLV A;  3WHB A;  2KT0 A;  4FTH A;  1BJZ A;  3FIS A;  1JKQ C;  3BTC A;  2ECB A;  4BKX A;  2E1O A;  1MBE A;  1X58 A;  5IYB J;  5M3F J;  1ZGW A;  1YRN A;  4QSH A;  3S15 J;  4DW6 A;  3HGG A;  1R9T J;  4JX6 A;  1NTC A;  2HI3 A;  5DTD A;  2K9S A;  2W48 A;  4X6A J;  2XB5 A;  2JMW A;  1ZTR A;  4BY7 J;  3DEW A;  3M4O J;  2M9H A;  3JRI A;  3HOW J;  2TRT A;  4W97 A;  2CQQ A;  1GV5 A;  1ZK8 A;  2RAE A;  5IOY A;  2XSD C;  2ID6 A;  1A6I A;  2L7Z A;  3FK7 A;  3CDL A;  3Q0U A;  2JK3 A;  4IHX A;  1G2H A;  3RQI A;  4CYC B;  1IG7 A;  3PM1 A;  3GTO J;  5EEA A;  3UKG A;  1QPI A;  3A02 A;  2I10 A;  2XGE A;  2FX0 A;  1HLV A;  1FTT A;  5GP9 A;  3G1M A;  1APL C;  2TCT A;  5F0H A;  2DMQ A;  2XPW A;  2R5Z B;  1EF4 A;  4D7N A;  3WHC A;  4IHV A;  3ZOB A;  2XGC A;  5IYD J;  2XPU A;  2DA5 A;  4FE4 A;  5FKM A;  4M3E A;  3HOX J;  5J3L A;  3GTP J;  3OOU A;  2R0Q C;  2NVT J;  2D5V A;  4D5F A;  4G12 A;  2Y30 A;  1LE8 B;  4XIC A;  2AHQ A;  4MLO A;  4JX4 A;  2ME0 A;  1H8A C;  3K2A A;  4IHY A;  1ETQ A;  4EEF G;  2HXI A;  4FE7 A;  1LFB A;  1FTZ A;  4Y7N J;  3O8G A;  2Y9Z A;  2YS9 A;  3O8H A;  1ETY A;  2EBI A;  5IP6 A;  5GPC A;  5C44 J;  1HCR A;  2M0C A;  3HBL A;  2JA8 J;  2VPR A;  3HGY A;  3LNQ A;  3IH2 A;  3Q3S A;  5HOD A;  2QCO A;  1IGN A;  4M6V A;  1QVT A;  2GLO A;  2VI6 A;  2L9R A;  3B6A A;  4M3B A;  4UUS B;  1JJ8 C;  1FJL A;  5M5X J;  3F0C A;  2XPV A;  3TP3 A;  4C3I J;  3HOU J;  1OFC X;  2O7O A;  4MFE A;  3A01 A;  2O9L A;  3A03 A;  3BTL A;  1F36 A;  4M3G A;  5K7F A;  3GTQ J;  1RPW A;  2HQ5 A;  1I50 J;  2LVS A;  1DU0 A;  2X6O A;  1U9O A;  2K40 A;  3IH3 A;  2HXO A;  2LLK A;  2XB0 X;  5M5W J;  2B63 J;  4DYR A;  3LSR A;  4JP0 A;  3HEF A;  3NAU A;  5M5Y J;  1VF9 A;  4AC0 A;  2EZI A;  4W1U A;  3GTM J;  4JX5 A;  1HDP A;  2K9Q A;  2OPT A;  5EZG A;  2EZK A;  2DN0 A;  2LP0 A;  3GBG A;  1BL0 A;  4B1R A;  5FLM J;  2DMN A;  5EG0 B;  3BQY A;  1K83 J;  3SJM A;  1MBH A;  1PUF B;  4D5C A;  5E3L A;  5EGO A;  4XRS A;  3BTI A;  5FKK A;  2P81 A;  1Q1V A;  1SFO J;  2MGQ A;  5EYR A;  3QQA A;  3TW6 A;  3D1N I;  4MO7 A;  2YUS A;  1H88 C;  4I76 A;  1TC3 C;  2EQR A;  4XID A;  2LD5 A;  4IEJ A;  1WCM J;  4AUX A;  2JN6 A;  3GTL J;  1Z0X A;  3B6C A;  4A3G J;  1VI0 A;  2MSY A;  3JR9 A;  1ETV A;  3NAR A;  2EZL A;  2HOS A;  2DMU A;  1XC5 A;  4M3D A;  4V2G A;  2XGD A;  5J1Y A;  1JUS A;  1AU7 A;  1JTX A;  2ME6 A;  5JLX A;  4RBO A;  1HF0 A;  2H8R A;  3GTJ J;  2PMZ N;  1P7I A;  1B72 A;  4A3C J;  2HOA A;  2MG4 A;  4LOC A;  3GTK J;  2N8G A;  1ETX A;  1JGG A;  2DA2 A;  4MFD A;  1AKH A;  2NS7 A;  4B4C A;  1S7E A;  3S14 J;  5GPA A;  2DA4 A;  3L1P A;  1FIP A;  2X9D A;  5C4X J;  2DA1 A;  4V2F A;  1RKT A;  1AHD P;  1MH4 A;  2AO9 A;  2LR8 A;  3Q0W A;  5F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...