5E8IA

Crystal structure of the dna binding domain of human transcription factor fli1 in complex with a 10-mer dna accggaagtg
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
93
structure length
93
Chain Sequence
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Friend leukemia integration 1 transcription factor
total genus 26
structure length 93
sequence length 93
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e8iA00
2MLGA 1O3QA 3BP8A 3VFZA 3IKVA 3MFKA 4LMYA 3KP4A 3SFZA 2ZBKA 1ZREA 4MNUA 5HDKA 1TNTA 4IHSA 1XGMA 3EUHA 4ON0A 2AXLA 3GX4X 1P2FA 3F22A 2GIVA 2L4AA 4I2OA 2ZMEB 1S3JA 1Z1DA 4P5OA 3F6VA 4HLXA 4RAYA 4MQ9F 1XSXA 1WSUA 6PAXA 2J5OA 1HKTA 3GEZA 1EH7A 2BGCA 3WTSC 1EH6A 1J59A 2H94A 5DCMA 4LK0F 1MGTA 4I02A 1K78B 3L2CA 2GA1A 2V6CA 2RC4A 2UWMA 4RB2C 1HBXG 4I0BA 3VODA 2FBIA 5HVQC 5CVRA 1FYKA 2W25A 4HAMA 1D8JA 4S04A 2NAZA 1MDMB 1SAXA 2P4WA 5K1YA 1FP1D 2KKOA 5FFZA 4A0ZA 3M9AA 5DCFA 5D4SA 1XDSA 1F4KA 4D0PA 4A6DA 4AVPA 3IL2A 2ZJ2A 2HKOA 3DXJF 3GFJA 2E7WA 2Y48A 3DFGA 1J5YA 4I01A 4TV7A 3WGGA 3B02A 2K4JA 1LEAA 1J9IA 2XAFA 1O7LA 2P7VB 5KVRA 1FZPB 3IRRA 5CVVA 4MEYF 2IRFG 1CF7B 2PMUA 4XLNF 3L09A 2GWRA 1U6GA 2BV6A 1TLHB 1K79A 3HUGA 2H27A 2FSWA 4OIPF 5LRRA 2OA4A 2VE8A 3ZP5A 3S2WA 1DPRA 2G9WA 4RB0A 4WF2A 2C6YA 1XDUA 5H6RA 1QNTA 3P9IA 4G7ZF 2D1VA 4CDGA 4U7DA 2B0LA 4CXFA 2CSOA 2F5EA 4AIKA 1YIOA 1Q1HA 1S6LA 3KP6A 1L0OC 1T98A 1KU3A 2P5VA 2PG4A 3I5UA 3ZMDA 3E6MA 5D4RA 5JFRA 4E70A 4UHTA 1ZRDA 3RKWA 1XN7A 2HQRA 1G3SA 3SHFA 2X4HA 2H09A 3RKYA 3DP7A 1BN5A 3C18A 3D0SA 4Y13A 1HQCA 3ABTA 4OIQF 1HSTA 1S8NA 4KUMA 3R61A 1FLIA 1RUOA 1TW3A 4RGXA 1XSDA 4ZYGA 4BH9A 3IWFA 1JHFA 2IA1A 3N97A 2PMHA 3J7AO 3LA2A 3W6JB 4EJTA 2KJCA 5K5RA 5F1RA 3D5LA 5FO5A 3GZ6A 4G6QA 5HLIA 4ENMA 1G3TA 4FX4A 1R22A 3KP3A 4AIJA 1REPC 3M7GA 1KQ0A 2PFBA 1W5SA 4L0YB 4ZZDA 3C1DA 2A5YB 1OYIA 2QBYB 2A07F 4M9SA 1FT9A 1BBYA 3U1DA 3F72A 4HV6A 4EQQA 4O3MA 2W57A 1QZYA 4ZH4F 1Y0UA 1AWCA 1BIBA 1O3SA 1TQIA 4R1HA 3WU0A 2HKXA 3V8JA 1QZZA 2F5DA 2XKOA 4YIFA 3FXUA 4HZFA 3WTUC 3I54A 1ON2A 1J7KA 3IHUA 1D3YA 2LKPA 3KEQA 1FYMA 5CYVA 1KQ9A 2IP2A 1UB9A 2DT5A 3FXRA 3CUOA 1L3LA 1TTYA 2A61A 2TDXA 4M9ZA 1U5TA 2F2EA 2CWEA 4RGRA 4KMUX 4A12A 3JSPA 5FB2A 4ESFA 4P9UA 3G73A 3HTSB 3WE2A 2YU3A 1C0WA 3I58A 2CQKA 2LSOA 1FP2A 3KE2A 4MTEA 2EV5A 3LFKA 2DK8A 1FC3A 4CICA 2OQGA 2CYYA 2VBWA 2GA2A 4LK1F 3FM3A 4IRGA 4BYYA 3KEOA 4P96A 2V9VA 4RB3C 4AIHA 5HOOA 2ZNZA 3F8MA 1IXCA 4WX9A 1OR7A 2BEOA 2XASA 5L3BA 3KFWX 1YS6A 3CJNA 2DPUA 1ZLJA 4AWXB 1SD4A 3DQVC 4S05A 1FBSA 3ZMUA 1B59A 2FQ3A 2MA3A 2W24A 3RYRA 3GLXA 3P9KA 2Z33A 2IA2A 3HOSA 3IWZA 2DQRA 1ZGAA 3F8BA 2ZO4A 3MEXA 4HF0A 1PUEE 1YO5C 4OINF 1KYZA 2XRNA 3QU6A 2H6CA 1XB4A 3WGHA 5FLXZ 1W5TA 5IT3A 4GO1A 4PGGA 3JTHA 4KIGA 4GCVA 1FX7A 3J80K 4XLPF 2EFWA 2GZWA 1OYWA 4EJWA 1LDKB 5E1XA 1SFXA 2M87A 2O8XA 2EFOA 2XROA 1FYLA 2K7LA 5F6FA 1K6OA 1JXSA 5BPIA 3VOEA 5DD8A 3CDHA 1RNLA 1YS7A 4BHPA 1R36A 1U5TB 1ZG1A 2O61A 2ESNA 2EA4A 3KP5A 4KICA 1HXDA 4M71A 2K02A 2XVCA 3QPHA 1XMAA 2YR2A 5BMZA 1STZA 4OMZA 4IF4A 5HDGA 5E17F 1WRJA 1X3UA 3EQLF 3P9CA 2ELHA 3EETA 2HQNA 4U0YA 1KQ8A 5FD5A 3MWMA 1W7PA 1IF1A 2VC1A 3ZN0A 5IT9K 2KRFA 5LEJA 3V4GA 1P4XA 4K2EA 2HZTA 2GAUA 3GYHX 1MZBA 2WC2A 1VTNC 1SD6A 5DCMB 5H6QA 3LSTA 3CUQC 4GXOA 3DPTA 3ELKA 3I53A 3Q5FA 1KGSA 1I5ZA 4RGUA 1KU7A 2BE5F 3K69A 2XHKA 4ZYHA 5AONA 3I0TA 2DW4A 1HW5A 4KYWA 3C3WA 5D8KB 4IVNA 3HYIA 3VEPA 2YSRA 2M45A 3OV8A 3HSEA 3LAPA 1U3EM 1F5TA 2VT3A 3GZ5A 3JSOA 3BY6A 1B1BA 5HS9A 2HOEA 5JVTA 1MJ9A 2KJBA 3F8FA 4OMYA 1LJ9A 2VBXA 1KYWA 4L9JA 3ECHA 5TJJA 4GGGA 1R5HA 2OZ6A 3KZYA 3F21A 1FOKA 4CZZA 3ZMTA 2VODA 4FHTA 1F1ZA 2DTRA 2FNAA 4RB1A 2MBFA 1BI2A 4U7BA 3VB2A 2PJPA 2EA2A 2QVOA 3FMSA 4ESJA 2VBZA 2WV0A 1G6NA 5LGUA 3L7WA 2QM3A 4U88A 4ENNA 3T8RA 5BS6A 1R1TA 1Z9CA 2GQQA 4BQAA 1OYYA 2IA0A 1T2KA 2OU2A 3RTRA 3BROA 1HW2A 4KDPA 4I09A 1UHWA 3GFMA 3L9FA 1V3FA 3DV8A 2FU4A 2VOPA 2VONA 1ZGJA 4JBAA 2M5WA 3BZ6A 3SZPA 2HWVA 3KP7A 4HA8A 1TQMA 5LHGA 2J5PA 1ZHFA 3HIFA 5K5OA 1XD7A 4XBFA 3WODF 4HV5A 3BJ6A 2YX7A 3PFIA 4EM2A 1W7PB 1Z6RA 1IW7F 5ILUA 2M1BA 2LF7A 5BOXA 5FFXA 1D5VA 2WWYA 3EYYA 5E8IA 2PI0A 5EEHA 1RZ4A 2DAOA 4RGSA 1G3YA 1U5TC 3GFLA 3TDZC 5J8CA 1WWXA 1ZG3A 5DDGA 5ED4A 2JTVA 4CO8A 4MEXF 5D5WB 3ISPA 1XCVA 3OOPA 3EYIA 1XGOA 3E6DA 4EJUA 4QLCU 2K86A 5E1WA 3KETA 4RS8A 4U0VA 3R60A 4KIBA 4MQVA 1J2XA 3HSFA 1LDJA 3WU1B 2M30A 5ICEA 4L9NA 4Q48A 1XGNA 1ZLKA 1ZAOA 1IN4A 2RV8A 1T39A 2ACJA 5HLHA 3ZMZA 1XGSA 4M74A 2PBIA 5D5VB 2FNPA 3C7JA 2FMYA 3O6BB 2HYGD 3H92A 3FHZA 2W84A 2Y0MA 1J75A 3KP2A 5LLQA 2L3DA 3SQNA 1ODDA 1ZH5A 2L02A 4Q5SF 2P7CB 2XV4S 2V1XA 1IAWA 3V8LA 1IRFA 3ZN1A 4AD9A 4KMFA 4U0WA 3FF5A 1IZ1A 3COAC 2FF4A 4O6JA 1P4AA 4IHTA 4PZJA 1B6AA 1NHAA 3BWGA 4JK1X 2FOKA 1S29A 2Z3YA 5L3FA 1BC8C 1QO0D 5HS8A 2FBKA 3REOA 1SMYF 2O3FA 3U9GA 2GXBA 5L3DA 4FX0A 2ZFWA 3AAFA 3MQ0A 1SD7A 2XUBA 3TO9A 1LVAA 2M8EA 3FZVA 4G8XA 1DUXC 4UV9A 3FWEA 3GW2A 3NEUA 1T38A 1RUNA 2XAJA 2YPRA 1PP7U 1R1UA 2CO5A 3MZYA 4KIFA 4Y17A 4A2UA 3I4PA 3IC7A 1BI3A 4L5IA 2KIMA 1IN8A 3TOAA 4G94A 4HOBA 3WTZA 3R0JA 1KU2A 2QQAA 2CFXA 5DUIA 3ZMSA 4I7HA 4PGHA 5E1ZB 4YFNF 2DPDA 2IVMA 3FX3A 5DYMA 3QPTA 3F8NA 5CJ9A 5L3GA 2STWA 3ERED 4N9HA 3T8TA 3SXYA 2PN6A 4EGZA 2UXXA 4UVCA 5BQTA 3NQOA 3GVAA 3T5XA 2V79A 2BYVE 4MGRA 4PDKA 1SMTA 4M6YA 4IJAA 3ROUA 2FMLA 3CUQB 3O2PE 1ONVA 2E1CA 2JSCA 1Z05A 2NS0A 1ULYA 3U2RA 4A6EA 2DBBA 5DV5A 4G7OF 3V7SA 2QLZA 5CVUA 3QP5A 3DEUA 3L00A 3E5UA 4IRIA 2O0YA 2FE3A 3RIRA 3IRQA 1FPQA 4H0EA 4LFUA 4OOIA 4CGZA 4XSXF 1OMIA 1USTA 4OU0A 2X0LA 4Q4ZF 4R79A 4LD5A 1O3TA 4DQ2A 5HLGA 1LDDA 2HGCA 5ICCA 2O6GE 4ENJA 1P4WA 4BHBA 3CO7C 3K1PA 4MHGA 2LDUA 1LNWA 1HKSA 1GXPA 4M73A 4NHJA 3K2ZA 2QWWA 3WTTC 5EEGA 1KA8A 5HS7A 4UUVA 1QQIA 2MH2A 2EFQA 3E5XA 2EWNA 2IW5A 2FA5A 3TO7A 1AOYA 2FEZA 2DQLA 3ML6A 1SD5A 1ZN2A 2RKHA 3WG9A 2RN7A 3K9TA 3LWFA 4BAYA 3WGIA 2QQ9A 4IRHA 5FD6A 2XGXA 4G7HF 1PDNC 1S7OA 2XAGA 3WE3A 2K27A 1A04A 4OIRF 1UHMA 1BC7C 1IUYA 1J0RA 4BXUA 2OZUA 1BIAA 3HRTA 3K0LA 4HDVA 1I1GA 2VE9A 4LGWA 1W4MA 4WXCA 3V7CA 4LG0B 5D6EA 4LB5A 3I59B 2ISYA 4EMSA 4UNOA 3E5QA 4FT8A 4WWCA 4HF2A 4UVAA 3W6KB 2COMA 2VXZA 4UXNA 4I0AA 3LQQA 3DKWA 4XRFA 2JPBA 4DNCA 2A6EF 1IXRC 3QOPA 1O3RA 4EM1A 1GVJA 2QUFA 4P55A 2NNYA 2JPCA 2P5LC 3IKTA 5E18F 4QWQA 4HYEA 5DUKA 1GXQA 2HR3A 1UCRA 3EDPA 1EH8A 1B9MA 1Z7UA 2DLLA 2G7HA 2G7UA 2O03A 1MJAA 2EV0A 3F6OA 4HLYA 2Y75A 2OQRA 3GUDA 2ZNYA 1SFUA 1U8RA 2OAZA 3QAHA 5LGNA 3PQJA 4KNYA 3GO5A 1ZRCA 1O57A 4KN4X 5LGTA 2P5KA 2STTA 3BPXA 3F8CA 1H0MA 3MZHA 2XAQA 4YIIA 2Q2EA 4G9YA 1LEBA 2EFNA 4M9XA 3J81K 4WCGA 1JE8A 1ZRFA 3T0YA 1BI1A 4ESBA 1H9TA 3LAJA 1R5GA 1DPUA 1QGPA 4LLLA 1YW8A 4M72A 1QBJA 1E2XA 3TO6A 1U78A 3RI4A 2RGVA 3CTAA 4A0XA 5K5QA 1QPMA 4GYGA 5DD4A 3TOBA 3R6SA 3J80Z 3M8FA 2L4MA 1USSA 1DDNA 2V1DA 1I27A 4F7ZA 1IN7A 3I59A 2K4BA 2QZ8A 4HX7A 2XAHA 2ETHA 2A68F 4HX8A 4LLNA 2BBYA 2R7DA 4HQMA 5D8LB 1SFEA 3M1EA 4HX4A 3JW4A 4ZYEA 1ZARA 3J81Z 5L3EA 5A2QZ 4BNCA 3PQKA 1BM9A 1HW1A 5J6XA 4A5MA 3CLOA 3JAMZ 1MKMA 2QYOA 2L54A 4R8HA 5LEKA 2FRHA 1R00A 3FXQA 3O3KA 5CLSA 4ENKA 3E6BA 4L18B 1I6XA 3V7RA 4A0YA 5ILSA 3F23A 2L01A 2F5FA 3CO6C 1OPCA 1BI0A 3RDIA 2EK5A 2MLKA 5H20A 4O5VA 3WTXC 4KN7X 1MJBA 3K1NA 1JHHA 4N0BA 5ICGA 2A3SA 1IRGA 4B09A 1WKMA 3WTYC 3RYPA 1YG2A 3GF2A 2ESHA 4RAZA 4HDUA 4L9TA 2D2WA 1TNSA 4Y15A 4IXAA 1WI9A 1K7AA 3JTGA 1IXSB 2XIGA 3LA3A 1XCBA 2DFIA 2ZXJA 2R3SA 4M6XA 5E20A 1S7AA 3FMQA 1KU9A 1RI7A 2MC3A 3GXOA 1T0FA 1ZYRF 5A2QK 5CVIA 2EJRA 3LQRA 2RDPA 1TQPA 3I64A 1B4AA 2UZKA 1FBQA 1YW7A 2NRAC 1DP7P 2CW0F 1LB2A 4ZYDA 4XSZF 2OBPA 5FLXK 4L5JA 1TW2A 4HF1A 1ON1A 3SZTA 2ISZA 2JZYA 5JI6A 5DEQA 5D6FA 2NNNA 5ICFA 1E17A 3BJAA 2PLYA 3HHGA 5LHIA 2VBYA 4JQFA 5LBQA 2FBHA 3WTWC 1XSVA 3HRUA 3M8EA 2HS5A 2QBYA 4EJVA 5LRSA 3T1BA 1W7PD 1B9NA 5LHHA 3Q9VA 5L3CA 2MH9A 1UFMA 3QP6A 1G3WA 2VOOA 3ULQB 4YFKF 3GWZA 4L9VA 3R0AA 1FY7A 4LB6B 2EV6A 1FSEA 4KFCA 4LLGF 5J8FA 1H9GA 1ZG5A 1O7FA 1TBXA 4ASNA 2E7XA 4HBLA 2Q8KA 5ILVA 3BOQA 1LQ1A 2FXAA 3N4MA 3DF8A 3TGNA 2EFPA 2Q0OA 1R23A 2GXGA 3B73A 3V8KA 1R1VA 5IT9Z 2E1NA 5JR3A 3E97A 4GYIA 4N9IA 4YG2F 5KK1A 5D5UB 3QRFF 3BJOA 4EM0B 3TQNA 2YX4A 1FSHA 2IPQX 4WK8F 3JAMK 2HDCA 2AS5F 2R7FA 1WQ2A 3BDDA 2DU9A 2QENA 2CGPA 2RNJA 1OKRA 2KIUA 2P6TA 5HDNA 4B8XA 3ABUA 1FWZA 2CG4A 4WXHA 2DK5A 3FMRA 3DPLC 2IJLA 3TDUC 3K1MA 2MD5A 4IPAA 4HW0A 1U2WA 3I71A 2PEXA 2QQBA 3KLOA 4G6DA 3RKXA 1HKQA 2Z99A 1CF7A 4NB5A 2Z9OA 3ECOA 2HTSA 1XMKA 4ETSA 4BHCA 2JRTA 2HTJA 2NYXA 5FGMA 4LG0A 4KT5C 5F64A 4NQWA 1YLFA 3RPUA 4UV8A 3LA7A 2P8TA 1PP8F 4EV0A 4A5NA 4HQEA 1I1SA 2HFHA 2VC0A 5AIPA 1GHCA 3KLNA 3E3VA 3MCZA 3HRMA 3ZQ7A 2D1HA 1Z91A 1YQAA 1F9NA 4CYDA 1Z6TA 1IN6A 3Q9SA 4LJZF 1YTYA 2OD5A 3KCCA 3HOTA 1P6RA 2IT0A 4CHUA 3P7NA 1K78A 2ZCWA 2H6BA 5E8GA 2P6SA 2PQ8A 5TRDA 1CGPA 1V4RA 2VT2A 3H3ZA 2LF8A 1IN5A 3TKYA 1FNNA 2DI3A 3HHHA 2VN2A 4YFXF 2A6HF 4L0ZB 2HEOA 4EJOA 1R7JA 1MD0A 3HSRA 1RIOH 2V1UA 2RQPA 3RJPA 4MTDA 3FM5A 3H3UA 1D8KA 3HTUA 3KZZA 4OIOF 2WTEA 2A69F 2ADUA 4EVIA 1MDMA 3R4KA 4ZZLA 5BPDA 2RVCA 2W85A 4UVBA 1P92A 1EV7A 1G4DA 3ZPLA 1BJAA 3WTVC 4WXDA 1BOAA 2Z5UA 3HRSA 3QU3A 5ERIA 1FBUA 3NRVA 1YYVA 5JHUA 2DO7A 4Q47A 1YFHA 3CUQA 2UXNA 5D5XB 4KA4A 3MAJA 1JGSA 2HYFA 1YW9A 5AIQA 1T6SA 3G3ZA 3RPQA 4PCQA 2EB7A 2ZKZA 2JT1A 2ZMEA 2LNBA 5CVJA 1HSJA 3E6CC 2KIFA 4EGYA 3F3XA 2D45A 1R58A 3BPVA 2XKPA 3GFIA 2F5CA 4I98B 3ZMVA 4Z2YA 4P9FA
chains in the Genus database with same CATH superfamily
3CMAI 2MLGA 1O3QA 4PFOA 3BP8A 1BL0A 3VFZA 2ZJRF 1R4MB 2JA7J 3IKVA 3OL3A 3A1YA 1QHHD 3MFKA 4LMYA 1YE9A 3HC7A 3HJEA 1NK3P 4DBRA 3BLYA 3KP4A 2DFHA 3SFZA 2ZBKA 3BCAA 4MNUA 1ZREA 2ID3A 3CJQB 5HDKA 1TNTA 2X9DA 4IHSA 1W1WE 2GLOA 1XGMA 3EUHA 3GMEA 3H0DA 4ON0A 1E3HA 2AXLA 3GX4X 1P2FA 2F5VA 3F22A 1LE8A 1VQ8I 2GIVA 2EZIA 2L4AA 1TWHJ 4I2OA 1X2NA 2X6YA 2ZMEB 1S3JA 2VUMJ 1Z1DA 3CMEI 4P5OA 2ECBA 5M5XJ 3F6VA 3OS0A 1WHUA 4HLXA 4HSTA 3AG2H 3NAUA 4RAYA 4V2FA 5M3FJ 4CCNA 4MQ9F 2JA5J 1XSXA 4XM3A 1WSUA 6PAXA 4CSWA 2J5OA 2R0QC 1HKTA 5IPAA 2KP6A 3GEZA 3CF5F 1EH7A 1T0FC 3OR2C 1R5ID 2BGCA 2XF7A 3WTSC 1EH6A 1J59A 5M3MJ 2VPLA 2H94A 5DCMA 3BQZA 4LK0F 2H1KA 3JRBA 1MGTA 2LK2A 4I02A 1K78B 4Z6YA 1H89C 3L2CA 1QRYA 1F43A 2GA1A 2V6CA 1PJRA 2RC4A 2UWMA 4RB2C 4E7SA 1HBXG 4I0BA 5E3LA 3VODA 2FBIA 5HVQC 4A3FJ 1MSFC 5CVRA 3ZXSA 1FYKA 4DJAA 1V55H 2W25A 4DZJA 2EZLA 4HAMA 1RR8C 1D8JA 1MNMC 1SVLA 3HEFA 3SDBA 4S04A 2NAZA 3W6VA 4GRIA 1U9OA 2ME6A 1MDMB 1SAXA 4MFDA 2KL4A 1AU7A 2P4WA 4BDZA 4QTRA 5K1YA 2B9SA 3AG4H 4LIUA 1FP1D 3FBNB 2KKOA 5FFZA 3DU5A 4A0ZA 3M9AA 5DCFA 2XSDC 5D4SA 1XDSA 1F4KA 4D0PA 2ZXWH 1MBGA 2V9PA 5C4JJ 1TZLA 4A6DA 4AVPA 2LD5A 3IL2A 2ZJ2A 5E3OA 3MZ8A 2HKOA 3DXJF 3HOUJ 1UJ8A 5KCMA 2E7WA 4RAFA 4II2A 2Y48A 3DFGA 1J5YA 4I01A 4TV7A 1UAAA 3WGGA 3JRIA 2PJRB 2TCTA 3B02A 3ZRGA 2K4JA 4BBSJ 4A3BJ 3UR3C 2JMWA 1LEAA 1J9IA 2XAFA 1DQUA 1O7LA 2P7VB 5KVRA 1FZPB 3IRRA 5CVVA 3HUGB 4MEYF 1Z21A 2IRFG 1CF7B 2PMUA 2LG4A 3QPLA 4KITB 4X1EA 4XLNF 3L09A 4IQ4A 2CUZA 2BVLA 3HOZJ 2GWRA 2X6WA 2DFFA 3SEQA 2LKXA 1U6GA 2BV6A 1BR1A 3OIQA 1TLHB 1Z0XA 1K79A 3HUGA 2H27A 2FSWA 5GTHC 1WVRA 4OIPF 5LRRA 1K83J 4D5FA 2XDVA 3JCUC 2OA4A 2VE8A 4ANJA 3ZP5A 3ZCOA 1IV8A 3S2WA 3U1KA 3VPRA 1DPRA 2G9WA 1U0JA 3NARA 4RB0A 4WF2A 2C6YA 1XDUA 5H6RA 1QNTA 3EUHC 3P9IA 4G7ZF 2D1VA 2RNGA 4BDYA 4CDGA 4BJ5C 3S1NJ 4U7DA 1W5CC 2B0LA 4CXFA 2CSOA 4F92B 2F5EA 4AIKA 3BG5A 2ZXIA 1YIOA 1Q1HA 4XMYA 1S6LA 3H0GJ 3KP6A 4OWRB 1QU3A 1L0OC 2IGNA 2OCEA 3DTIA 3BCBA 3I4NJ 4KT6A 1T98A 1KU3A 3OSFA 1VQNI 2P5VA 2PG4A 3I5UA 3ZMDA 1XPXA 3TEDA 3E6MA 4IL6C 5D4RA 5JFRA 4E70A 4NNJA 5GP9A 4UHTA 1B8IA 1ZRDA 3OYHA 3L2RA 4V2GA 3RKWA 3ABMH 1Y1WJ 2XF6A 3BZKA 1MNEA 1XN7A 1D5YA 2HQRA 1G3SA 3SHFA 2X4HA 4DZPA 2XRLA 2H09A 2HQ5A 2VKHA 2P81A 3RKYA 3DP7A 1BN5A 2CV1A 2VIXA 3C18A 3D0SA 3K6GA 1HQCA 3ABTA 3HGYA 4Y13A 5F1JA 2HXOA 4OIQF 1HSTA 1S8NA 3DLAA 4KJZA 5IYCJ 1QVTA 4KUMA 1LUJB 3R61A 1FLIA 1RUOA 1TW3A 4RGXA 1XSDA 4DYCA 4ZYGA 3CMMA 2KPMA 4BH9A 2CQ7A 3IP4B 3IWFA 1JHFA 2IA1A 3N97A 1TC3C 2PMHA 1VQ4I 1HC8A 3IAS2 3J7AO 4JP0A 1JUSA 3C2GA 3H36A 3LA2A 1D1CA 3ZQCA 2AO9A 3BC8A 3W6JB 3AL0C 4EJTA 1F36A 2XB5A 1S9HA 2KJCA 5K5RA 5F1RA 3D5LA 5FO5A 2Y30A 2R7XA 2EILH 1LE8B 3GZ6A 4G6QA 5HLIA 3QPSA 4ENMA 1G3TA 4FX4A 1R22A 3OIOA 2EBIA 3KP3A 4NDLA 4AIJA 1REPC 3FK6A 2AHQA 2MD0A 3M7GA 2VQHA 3S1QJ 1KQ0A 3CJTB 2PFBA 1JJ8C 1W5SA 4L0YB 4ZZDA 2CJJA 4X6AJ 3D5SC 3C1DA 3SYTA 1I3QJ 2A5YB 1OYIA 2QBYB 2A07F 5IYBJ 1MBJA 1R4NB 2M7AA 2QF7A 2A05A 4M9SA 1FT9A 3AFHA 2Q1ZB 4E7KA 1BBYA 3F0CA 1VQLI 1VQ6I 3HOYJ 4ZDOA 2ZMEC 3U1DA 3F72A 4F55A 4HV6A 3CLQA 1AHDP 1X1PA 2EIMH 4FQGA 4EQQA 4I76A 1QPIA 5B3SH 4O3MA 2QCOA 3HKZA 3VYSB 2Z1DA 4M3EA 2R5ZB 4CZCA 2W57A 1QZYA 2DMQA 5EYRA 3G1LA 3W2AA 4BEHB 2WY8Q 4Y52J 2JJ7A 4XLAA 3G1MA 4ZH4F 1U9NA 1Y0UA 1AWCA 3ZQHA 1BIBA 4FTHA 3S1MJ 2PMZA 1O3SA 4DYRA 2TRTA 1TQIA 4R1HA 3WU0A 1NG7A 2HKXA 5E79C 2R5YB 3V8JA 4NQWB 4XICA 1POGA 1QZZA 4CCLA 2F5DA 2XKOA 4YIFA 1A35A 3FXUA 4HZFA 1X4OA 3WTUC 3I54A 1ON2A 3OS1A 4JX4A 3FXOA 1J7KA 3JRCA 3PIPF 3IHUA 1OR7C 1D3YA 1ENHA 2NVXJ 2LKPA 3KYLA 4XKWA 3KEQA 1FYMA 5CYVA 1KQ9A 1ZQ3P 4BEHA 2IP2A 3OYIA 1UB9A 2DT5A 2ZB9A 3FXRA 4FCYA 2F4MB 3CUOA 4XQFA 3JRAA 1WJEA 1L3LA 1TTYA 4Y7NJ 1JJ6C 2L5QA 3UNGC 2A61A 3I4MJ 2TDXA 4M9ZA 4M3DA 1JKRC 3WHBA 1U5TA 2F2EA 3RKQA 2CWEA 4RGRA 1N78A 1ETOA 4KMUX 4A12A 3JSPA 5FB2A 2O8KA 1ETVA 1QVUA 2HU9A 4ESFA 4P9UA 1Z67A 3G73A 3HTSB 3L2VA 3WE2A 4XN3A 5M5YJ 4AC0A 2EIJH 2K9LA 3I55I 4W97A 3SFIA 2YU3A 3K70D 1C0WA 4XRMA 5IP6A 3I58A 2CQKA 2LSOA 2GM4A 2WADA 1FP2A 1TT0A 3KE2A 2LTPA 5KNLA 2V4JC 1IRZA 4MTEA 2EV5A 2BHYA 3CCSI 3LFKA 5LFAA 2DK8A 1FC3A 4CICA 2OQGA 2ID6A 2CYYA 2Q2EB 1A5JA 1RPWA 1LVKA 2VBWA 2GA2A 2EIKH 1P7JA 3K2AA 4LK1F 3HDDA 2HXIA 1PVEA 2VB6A 5GTIC 1MMGA 4BKXA 2P0WA 3FM3A 1TWCJ 4CCKA 4XLHA 3IV5A 4IRGA 4E7JA 4BYYA 1Z3XA 2DA5A 1EJ9A 2DN0A 3KEOA 2HPIA 4RM3A 4P96A 2V9VA 4RB3C 1VQMI 3D5RC 4AIHA 5HOOA 1IJWC 2ZNZA 3F8MA 1IXCA 1OR7A 4WX9A 2BEOA 2XASA 1E0EA 2JA6J 5L3BA 3DLLF 1GUUA 3KFWX 3AG1H 2WAQN 1YS6A 3BTJA 3CJNA 2DPUA 1R6RA 4B3XA 1ZLJA 4AWXB 1SD4A 4RBOA 3DQVC 4DBQA 2K40A 3DEWA 3OYAA 1NG6A 2EINH 4N4OB 4S05A 3CCMI 2AQEA 4IOCF 5EG0B 1FBSA 3ZMUA 2DDBA 1B59A 2ZC2A 2FQ3A 2W7NA 2VKVA 2MA3A 2W24A 1GLNA 3PNTA 3RYRA 2DA6A 3GLXA 1GV5A 2CQNA 2NVQJ 1AA7A 3P9KA 2FX0A 2Z33A 2BY0A 2IA2A 3NWTA 3HOSA 3IWZA 2DQRA 1HF0A 5EJCA 4PUSA 1ZGAA 3F8BA 3DEEA 2ZO4A 1YHQI 3MEXA 2DMTA 4HF0A 4J01A 1PUEE 1DGRM 4QIWN 1KYZA 4OINF 1YO5C 3LSMA 2K5CA 2XRNA 2H6CA 3QU6A 5GAHJ 1XB4A 3WGHA 5B5EC 4MIMA 5FLXZ 3B6AA 1W5TA 5B1BH 1EF4A 5IT3A 4GO1A 3LMMA 4PGGA 3JTHA 4KIGA 1ETWA 2Y2ZA 4GCVA 1FX7A 3J80K 2O9LA 4XLPF 4I6ZA 2EFWA 2GZWA 1OYWA 3QYBA 4EJWA 3OYKA 3MMYB 1LDKB 5E1XA 2R7ZJ 1OCPA 1SFXA 2M87A 4AM3A 2O8XA 2EFOA 4BE2A 3BR5A 2XB0X 3FKJA 4XIDA 2XROA 3H5NA 1FYLA 1S5LC 1JUMA 3H1CA 2VASA 3HG9A 2K7LA 5F6FA 2HNHA 3D1NI 1K6OA 2W82A 1JXSA 5BPIA 3VOEA 5DD8A 4A69C 4DYQA 2V9KA 3CDHA 1RNLA 4BE1A 3BR1A 3J7AY 1YS7A 3KZIC 1H8AC 5IP7J 4BHPA 3QODA 3AL0B 1R36A 1U5TB 1ZG1A 2O61A 3K4JA 2M9HA 1FTTA 4B44A 2ESNA 5GAEJ 1ETKA 1JTXA 2EA4A 2FD5A 2KMUA 2MFZA 3KP5A 2VL8A 4KICA 4RDUA 1I3AA 1HXDA 2COBA 2I5UA 2DFEA 3ZQGA 4M71A 2K02A 1OISA 2XVCA 1W0UA 3FDYA 2NS8A 2VXDA 1FOYA 3QPHA 1XMAA 1MMNA 4CA0A 2YR2A 5BMZA 4QSHA 1STZA 2DTZA 3IH2A 1D0YA 3HZJA 4OMZA 5DM6F 5E3MA 4IF4A 5HDGA 5FJ8J 5E17F 1WRJA 4NC7A 2R5YA 4RA2A 4F52A 1X3UA 3EQLF 3P9CA 2ELHA 3CDLA 3EETA 2HQNA 2M7BA 4OAYA 3OS2A 4U0YA 1LFUP 1KQ8A 1X2MA 5FD5A 4HNVA 3OL4A 3MWMA 1W7PA 1IF1A 2VC1A 2HYJA 1ITYA 2LP0A 2IGKA 4XRSG 3OOUA 4DGWB 3ZN0A 5IT9K 1RKTA 2KRFA 3ZQLA 2ELJA 3V4GA 3M1CA 5LEJA 1P4XA 4K2EA 1FJLA 2HZTA 1VQKI 2R7OA 4CH7A 2GAUA 3GYHX 2LY2A 5J3LA 4ZYAA 2DOEA 2W48A 3HL2A 4GFBA 5F04A 1MZBA 5J1YA 2WC2A 1VTNC 1SD6A 5DCMB 1VQ7I 5H6QA 3BR6A 3LSTA 3B6CA 1XMXA 3CUQC 4GXOA 1VQOI 3DPTA 5IOZA 3ELKA 3I53A 5FLMJ 3Q5FA 1KGSA 1I5ZA 4B47A 2WAQA 1OCTC 4RGUA 1KU7A 2BE5F 2M4GA 2VQCA 3CQZJ 3HBLA 3K69A 1X1BA 2XHKA 2VJIA 4ZYHA 4ZDLA 1TWFJ 5AONA 3L2QA 3S15J 3I0TA 2D5VA 4BY1J 2DW4A 4NC6A 1HW5A 4KYWA 3C3WA 2X1DA 3GCMA 5D8KB 4IVNA 3HYIA 3VEPA 2YSRA 2DT7B 3LFUA 4W1UA 2M45A 3OV8A 1MMAA 3HSEA 1I6HJ 3LAPA 1ZGWA 3WG7H 1U3EM 1F5TA 2L9NA 2VT3A 3GZ5A 1IDYA 3JSOA 2EZHA 3BY6A 1B1BA 1VZ0A 2M4KA 3EUKL 2ELKA 3PM1A 2HOEA 5HS9A 3UKGA 4XORA 2O7OA 2E35A 5JVTA 1Y39A 1MJ9A 2KJBA 3F8FA 4OMYA 1KZHA 1LJ9A 2VBXA 3PFYA 1KYWA 4L9JA 3ECHA 5TJJA 4GGGA 1R5HA 5C3EJ 2OZ6A 3KZYA 3F21A 1FOKA 2IS2A 5HODA 4BJTA 4CZZA 3ZMTA 2VODA 3QYEA 4FHTA 3CCRI 1F1ZA 2DTRA 3ZQQA 2HOAA 2FNAA 4RB1A 2MBFA 3IH3A 4C3JJ 1FOXA 1BI2A 5K7FA 4U7BA 3VB2A 1XC5A 2PJPA 2EA2A 2QVOA 3FMSA 4ESJA 1SC7A 2VBZA 2GOMA 1VFCA 2WV0A 1VF9A 1G6NA 2M2EA 5LGUA 3L7WA 2A5WA 2QM3A 2IXSA 4U88A 4ENNA 1YITI 4IHYA 3T8RA 5BS6A 1PYVA 1WJCA 1R1TA 1Z9CA 3BQYA 2KDZA 2GQQA 4BQAA 1OYYA 2IA0A 1T2KA 2OU2A 3RTRA 3BROA 3G1OA 1HW2A 3QYFA 4E4HA 4KDPA 1TWAJ 4I09A 1UHWA 3GFMA 3LSJA 3JREA 1VQ9I 3L9FA 1V3FA 3DV8A 2FU4A 4Y33A 4XKBA 3MVPA 1BJZA 2VOPA 2XGDA 2VONA 1ZGJA 4JBAA 2M5WA 3BZ6A 3SZPA 1GT0C 2UV1A 1Y56A 1ERDA 4N4NB 2HWVA 3G2BA 3L1PA 3BTCA 4IHVA 3FBIB 4BXFA 3KP7A 3PNYA 1K61A 3DTEA 1WJDA 5H2FC 3HGGA 2E2HJ 3K70C 4HA8A 3H5AA 1X19A 2Y0SN 4OAZA 4AVZA 2VQGA 2HOSA 1YX5A 4IOAF 1R9TJ 1X3WB 1TQMA 5LHGA 2J5PA 3HIFA 1ZHFA 5K5OA 2AXTC 3OYCA 1XD7A 2DODA 4XBFA 3WODF 4HV5A 3BJ6A 2E71A 2YX7A 3PFIA 1W7PB 4EM2A 1Z6RA 1IW7F 1JTYA 5ILUA 2M1BA 2LF7A 5BOXA 5FFXA 4XOTA 4CYCA 1D5VA 2BY2A 3RSNA 3EYYA 1OQYA 3CCYA 2E36A 3LSPA 5E8IA 2WWYA 2FJ1A 3GBGA 2PI0A 5EEHA 4RLQA 1RZ4A 2QSGX 2DAOA 2LY9A 4RGSA 1G3YA 1U5TC 1X1DA 1J09A 3GFLA 3HOVJ 2KFDA 3TDZC 2WV1A 5J8CA 1O4XA 1WWXA 1BA5A 1ZG3A 5DDGA 2JTVA 4CO8A 5ED4A 4MEXF 3A01B 5D5WB 1IUFA 3SEZA 3ISPA 2DXIA 1S72I 2F4OB 1XCVA 3OOPA 3W3CA 3EYIA 1XGOA 3E6DA 4EJUA 4QLCU 2K86A 2DOAA 2WB1N 5J40A 4J00A 5E1WA 2JA8J 3KETA 4RS8A 1QA6A 4U0VA 3Q0WA 3R60A 4KIBA 1Y8QB 4MQVA 4PJLA 3S32A 3BR2A 4E7ZA 1SEUA 1J2XA 3HSFA 1LDJA 3WU1B 1IRXA 2M30A 5ICEA 4BE0A 4NC8A 4L9NA 4AIDA 2R93J 4Q48A 1FOWA 3CCEI 1SFKA 1XGNA 1ZLKA 1ZAOA 4XLEA 2YS9A 2KZGA 1IN4A 1T8IA 4A3DJ 2RV8A 3VYTB 2CV2A 2WB1A 3PO2J 1T39A 3RQIA 2PJRA 2ACJA 3TL4X 5HLHA 3M8JA 3ZMZA 1XGSA 4M74A 2PBIA 5D5VB 2B63J 2FNPA 3C7JA 4MLOA 2FMYA 5EEAA 2HVRA 3O6BB 1Z3YA 2HYGD 3H92A 3FHZA 2W84A 2Y0MA 4S0HB 1J75A 4LITA 4C9YA 2EZKA 1V5FA 3KP2A 2JVGA 4BY7J 2FUG2 4LIVA 3FXJA 2CV0A 5LLQA 2L3DA 3SQNA 1FTZA 3BG7A 3A03A 4PJMA 1MBHA 1ODDA 1ZH5A 4F93B 2L02A 3BZCA 4Q5SF 2B7EA 1UMQA 3DPUA 3OY9A 2JA2A 2P7CB 3RZOJ 2XV4S 3SZGA 2V1XA 1IAWA 1ZR2A 2BW3B 1DGWY 3V8LA 1IRFA 3ZN1A 4AD9A 2KRCA 5GAGJ 2L2OA 4KMFA 2X85A 3FF5A 4U0WA 4XLCA 1IZ1A 3COAC 2HZDA 2FF4A 4O6JA 5J4VA 1IG7A 1RKWA 1P4AA 4IHTA 1LFPA 4PZJA 1B6AA 2ZSHB 3E0JB 1NHAA 3BWGA 4JK1X 3PO3J 1D1AA 2FOKA 1S29A 3LSKA 2Z3YA 5L3FA 5EGOB 3KYDB 4D1QA 1BC8C 1QO0D 2KISA 1EKEA 4ABZA 1X3ZB 5HS8A 5HNFA 2FBKA 3REOA 2K9MA 2Y9ZA 4JX6A 4J19A 1X1CA 2VKEA 4PSXA 1SMYF 2HVSA 2O3FA 3M07A 3U9GA 2GXBA 2XGCA 5L3DA 4FX0A 2JN6A 2ZFWA 3AAFA 3MQ0A 3S3NA 1SD7A 2OUMA 3VSKA 4D7MA 2XUBA 3HB9A 3TO9A 3S93A 1LVAA 2M8EA 3FZVA 4G8XA 2CW7A 4C3HJ 2IS6A 2K3FA 5LD2C 1TL8A 3HPGA 4UV9A 3FWEA 1DUXC 2GXAA 3PJRA 4LOCA 3GTLJ 3HM5A 2V7FA 3GW2A 2M3AA 2RQQA 3NEUA 3IH4A 1T38A 2QKMB 1RUNA 4BJ6C 2XAJA 2YPRA 5IP9J 1E3PA 1PP7U 1R1UA 2CO5A 3MZYA 1JGGA 1E3OC 4KIFA 4Y17A 3JRDA 4A2UA 3I4PA 3IC7A 3LSRA 4II3A 1BI3A 4L5IA 2KIMA 2K3PA 1IN8A 2BY1A 3TOAA 4G94A 2LC2A 4HOBA 1UG0A 3WTZA 2L0KA 1IDZA 1G8XA 4FE7A 3R0JA 1OLTA 4E7IA 1KU2A 1UHSA 2QQAA 3K4CA 2CFXA 2KIQA 1HLVA 5DUIA 3ZMSA 4I7HA 3N05A 4IKFA 1FMWA 4PGHA 4AU7A 4BUPA 5E1ZB 4YFNF 2ECCA 2DPDA 2IVMA 2Y9YA 3FX3A 2IAIA 1FIAA 5DYMA 3L2WA 3QPTA 4AYBA 1WGXA 1XS9A 3F8NA 9ANTA 1GDTA 5CJ9A 5L3GA 2STWA 2V1NA 3ERED 4N9HA 3OYGA 3T8TA 3SXYA 3Q0UA 2PN6A 1YJWI 1RETA 4EGZA 2UXXA 4UVCA 1Y6IA 3NQOA 5BQTA 2R5ZA 3GVAA 3T5XA 2V79A 2BYVE 4MGRA 2Z2SB 2QA4I 2VI6A 4PDKA 2DJIA 1SMTA 2OJED 1K4SA 2RREA 4M6YA 4IJAA 3ROUA 1NK2P 2CU7A 2FMLA 3CUQB 3O2PE 1LFBA 4DOZA 1ONVA 1K4TA 2E1CA 2X6OA 2JSCA 1Z05A 2NS0A 1ULYA 2LY1A 3U2RA 4A6EA 2DBBA 4A3JJ 5DV5A 4G7OF 3V7SA 2QLZA 2ME0A 5CVUA 3DBLB 2QGUA 2WAEA 2Y31A 4Y4RA 3QP5A 3A2KA 5B1AH 5EZHA 3DEUA 3L00A 3CCQI 3E5UA 4IRIA 2CS3A 2FE3A 2O0YA 3EUAA 4M3BA 3RIRA 1WPKA 1G59A 3IRQA 3OIPA 1FPQA 2BVMA 4H0EA 4LFUA 2OV7A 3C2HA 4OOIA 4XSXF 4CGZA 1OMIA 1USTA 4OU0A 2X0LA 3K4BA 3MD2A 4Q4ZF 3A0HC 4R79A 4A3IJ 4LD5A 1MBFA 1O3TA 4DQ2A 2E5NA 5HLGA 3LSGA 1LDDA 2HGCA 4XR6A 5ICCA 4MFEA 3CC4I 5J4YA 2O6GE 4ENJA 4NUBA 3BR3A 3MKYB 1VQPI 2I8DA 1A36A 2R7UA 1P4WA 4BHBA 3PSFA 3CO7C 5GPAA 3K1PA 4MHGA 2LDUA 1LNWA 5DS9A 3H9JA 3DTKA 2LBFB 1HKSA 2XF5A 3X2QH 1GXPA 4M73A 2K9NA 3EPZA 4NHJA 5GPCA 2RAEA 3K2ZA 2JK3A 3GTPJ 2EPFA 2V6EA 2QWWA 2HOTA 3CZ6A 3WTTC 5EEGA 5E3NA 2KDOA 5K7ZA 3FISA 2OTLI 4XLFA 3S3MA 3HKZN 1KA8A 3A01A 4GDFA 2PMZN 5HS7A 1QQIA 4UUVA 1WCMJ 2MH2A 4DW6A 2EFQA 3E5XA 2EWNA 3PIOF 1WJFA 2IW5A 1BR2A 3TP0A 1IO2A 1YX3A 3K10A 2FA5A 2LR8A 3TO7A 3WHCA 2CQXA 2CMPA 1AOYA 2G0EA 1X4PA 4P9FA 1TP4A 2FEZA 1YRNB 2DQLA 2K85A 1OCRH 4MO7A 3ML6A 1SD5A 1OCCH 3O8GA 2GBYA 1Y1VJ 1IV6A 3CF2A 4XRSA 4IHWA 1ZN2A 2RKHA 4C3IJ 3WG9A 2RN7A 2VJ4A 3K9TA 3LWFA 3OYBA 3SDGA 4BAYA 2L9VA 3F9KA 3WGIA 3HXLA 2QQ9A 3FIWA 4IRHA 3ERMA 5FD6A 2XGXA 4G7HF 1PDNC 4A3MJ 1S7OA 2XAGA 3WE3A 4X0GA 3FXKA 2DT6A 2K27A 3BTLA 1A04A 4XOPA 4OIRF 4BQQA 2R7SA 2IS1A 1UHMA 2H1LA 3V42A 1BC7C 4CCOA 1IUYA 1Z7LA 1J0RA 4BXUA 4RMNA 1JKOC 1WJ5A 2LOOA 2ICWG 2OZUA 1BIAA 5CKTA 3HRTA 3LSHA 3JR9A 4C2TA 2LVSA 2QKLB 2DMPA 3K0LA 4HDVA 1I1GA 1FIPA 2VE9A 1FMVA 2DDAA 3CP2A 5F08A 4LGWA 2XGEA 1W4MA 2WAFA 4WXCA 3V7CA 4LG0B 1YJNI 5D6EA 2BHZA 5CQGA 2KT0A 3FK7A 2VKDA 4XL9A 4LB5A 3I59B 1OJLA 2ISYA 4EMSA 4UNOA 3E5QA 3BTIA 4FT8A 3TW6A 4WWCA 1VQ5I 4HF2A 4UVAA 2F48A 3W6KB 4A3LJ 2NOJB 2COMA 2VXZA 3DCFA 4UXNA 1PUFB 3BG3A 2E19A 4I0AA 4UUSA 5J1RA 3CJRB 4JYKA 3LQQA 3DKWA 4XRFA 2JPBA 4DNCA 1Q1VA 2A6EF 2MABA 1HOMA 5J1UA 1JI8A 1IXRC 2DA4A 3QOPA 1O3RA 2JRMA 4EM1A 1GVJA 2QUFA 4ZTFA 5JVGF 3WU2C 2W4SA 4P55A 2R7VA 4XONA 3H9GA 2DMNA 3FXMA 1FEXA 2NNYA 2JPCA 2P5LC 2WY7Q 3VSLA 5E18F 3IKTA 5BNGA 1BW6A 4QWQA 4HYEA 4B1RA 2E1MB 5FRNA 5DUKA 1GXQA 2HR3A 1UCRA 3EDPA 1EH8A 1IGNA 2YUSA 2L7KA 2H8RA 1XG1A 3RQ4A 1B9MA 1Z7UA 2DLLA 2G7HA 4HNUA 2G7UA 2O03A 1MJAA 2EV0A 3F6OA 5FKKA 4HLYA 2NOGA 2Y75A 3J7ZI 2OQRA 2BOLA 3GLLA 3GUDA 2ZNYA 3Q0VA 3MKZA 3OYLA 1SFUA 3OR1C 3CDIA 1DU0A 1U8RA 2OAZA 3QAHA 4FASD 1G2HA 5LGNA 3PQJA 4KNYA 3GO5A 5EGOA 2NXNB 1O57A 5LGTA 2CH0A 4KN4X 4QPQA 1ZRCA 2E2JJ 1QHGA 2CQQA 3PUBA 2P5KA 2E1OA 4HEA2 3ZOBA 4A3EJ 2STTA 2CRGA 2R7QA 3BPXA 4XNFA 3F8CA 1H0MA 4UB8C 3MZHA 2XAQA 1NH3A 3S16J 4YIIA 2Q2EA 4XK4A 4ITVA 4G9YA 1LEBA 2EFNA 4M9XA 3J81K 1UZCA 2M0CA 4WCGA 3VDXA 4HPQA 5C44J 3VYRB 1JE8A 2O5RA 1ZRFA 3T0YA 1BI1A 3LSIA 4ESBA 4PFPA 1H9TA 5IYDJ 1ORKA 1ETXA 2IGOA 3LAJA 1BOBA 5EZGA 1MBKA 4M3GA 1R5GA 2MW8A 1UG2A 1DPUA 5FKNA 1A6IA 1T33A 3S3OA 2DYRH 1QGPA 4LLLA 1YW8A 5F0FA 3E1SA 4M72A 2X48A 1QBJA 1E2XA 3TO6A 1UELB 4D7NA 3VYUB 2IS4A 2X6XA 1WH5A 1U78A 4F91B 5F27A 4PJ0C 3DWLE 3RI4A 2RGVA 3CTAA 1W36C 3ABLH 4A0XA 5K5QA 1QPMA 1PUFA 4GYGA 4IX7A 5DTDA 3KX2A 5DD4A 2L9SA 2DA3A 3OYEA 5DM7F 1RC9A 3TOBA 3R6SA 1I50J 3J80Z 3M8FA 2L4MA 2NVTJ 1USSA 1DDNA 2CUEA 1T95A 3PUFA 2V1DA 1B8IB 1I27A 2MC4A 4F7ZA 3CC7I 1IN7A 3I59A 2K4BA 2GIZA 3AG3H 2QZ8A 4HX7A 2XAHA 2ETHA 3K7AJ 3KEYA 2A68F 4HX8A 3ZQFA 2V26A 2CFOA 2I10A 4LLNA 2BBYA 4E6KG 3RZDJ 2R7DA 2KLOA 4BQOA 4HQMA 5D8LB 1SFEA 4PJJA 2X1CA 3M1EA 3K4KA 1V5GA 2DA2A 2MG4A 2JQ7A 2VJJA 4HX4A 4M3FA 3JW4A 4ZYEA 4CCJA 2JUCA 4XN0A 5HLTA 4FE4A 4A3GJ 1ZARA 3J81Z 5L3EA 5A2QZ 1MW7A 4BNCA 2R7RA 3PQKA 2OC6A 1BM9A 3KPHA 3QWLA 4B3AA 3ESWB 1OFCX 1TT5B 1HW1A 5J6XA 4A5MA 3CLOA 3JAMZ 1MKMA 2QYOA 3CCVI 2L54A 1K6YA 4R8HA 3AKZA 3M3YJ 2FRHA 1R00A 3O3KA 3FXQA 5LEKA 4YIRX 2BZTA 4UB6C 2UUZA 5CLSA 4L5EA 3FHNA 1YI2I 1HDPA 5CQEA 2DYSH 3H9QA 1YOVB 4ENKA 3E6BA 4L18B 1YRNA 1I6XA 1ETQA 1LKXA 2HDWA 3V7RA 4A0YA 4CYCB 3H3VK 4XKVA 5JLWA 4JOMA 5ILSA 1D1BA 3A0BC 3F23A 2ZXHA 2L01A 3TBIA 2F5FA 3CO6C 1OPCA 1BI0A 4ZTJA 3RDIA 1ZR4A 2EK5A 2MLKA 5H20A 3ONQA 3CC2I 4O5VA 1HCRA 5GADJ 3WTXC 4KN7X 1MJBA 3K1NA 1JHHA 3VWBA 1NTCA 4EATA 2X51A 4N0BA 5ICGA 2LREA 2A3SA 1IRGA 4B09A 3OYFA 1HA8A 1WKMA 2FOWA 2ZFUA 3WTYC 3RYPA 1YG2A 3MKLA 2HVQA 3GF2A 2XPVA 2DMUA 3S14J 2ESHA 1MH4A 4RAZA 1JKQC 1MMDA 1TWGJ 4HDUA 4L9TA 2LYCA 2D2WA 1TNSA 4Y15A 4IXAA 5FKMA 3OYMA 2DA7A 1WI9A 4M6VA 1K7AA 2DCEA 5HNHA 2HDDA 3JTGA 1IXSB 2XIGA 3LA3A 2PX9A 5J47A 4HRIA 2JUGA 2VLAA 1W36D 1XCBA 1RR7A 2DFIA 4B43A 2ZXJA 2R3SA 2VQLA 2YU9J 1YJ9I 4M6XA 2HI3A 3H35A 5E20A 1S7AA 3FMQA 5CPRB 4Y3OA 1KU9A 4YEJA 2E5ZA 1RI7A 2MC3A 3P5JA 3CD6I 3GXOA 1T0FA 1ZYRF 2MYSA 3PSIA 2LH9A 4UUTA 5A2QK 3BT9A 4UY8I 2IGMA 5CVIA 5F0CA 4RM2A 5FLVA 2EJRA 3LQRA 1H88C 2RDPA 1QZEA 1TQPA 5KHDA 4D5CA 3I64A 1B4AA 3TMOA 2UZKA 3W2VA 3I3LA 1JT0A 3DKXA 1FBQA 1YW7A 2NRAC 1DP7P 1D0ZA 2CW0F 4BS9A 4C2MJ 3O8HA 1MIJA 1LB2A 4ZYDA 2E1MC 4XSZF 2GOXB 3A02A 2OBPA 3BG9A 4FETA 2LRDA 2L9RA 5FLXK 1Y0NA 2Z16A 4HSRA 1TW2A 1Y8RB 4L5JA 1ON1A 4HF1A 3SZTA 5TGTA 4HNTA 2ISZA 3HOXJ 2JZYA 5JI6A 5DEQA 5D6FA 2NNNA 5ICFA 2K9SA 1E17A 2BW3A 3BJAA 5KAIC 2M34A 1N77A 2PLYA 1WI3A 1BW5A 3HHGA 4E7HA 2DJNA 1HDDC 5TISC 1P7IA 5LHIA 2VBYA 4P1WA 3DBHB 3GZNB 1S7EA 4JQFA 5LBQA 2FBHA 2QSHX 3WTWC 1XSVA 3HRUA 3M8EA 4IEJA 2HS5A 3OYNA 4EJVA 2QBYA 5LRSA 2X1EA 2XPUA 5M5WJ 3T1BA 1W7PD 2JSPA 1B9NA 2NVUB 5LHHA 3Q9VA 3ZR8X 1JUPA 2K9QA 1APLC 5L3CA 2MH9A 3LL7A 1UFMA 3QP6A 1V54H 3I9V2 5FKOA 4UUSB 1WJBA 1G3WA 2VOOA 3ULQB 4YFKF 1MMSA 3GTJJ 3GWZA 4L9VA 1ACIA 2IBDA 4NBQA 1ZK8A 3H5RA 3HPHA 3R0AA 4I99C 1FY7A 4LB6B 2EV6A 2WA0A 1FSEA 4KFCA 2OCCH 1ZELA 2IEKA 4LLGF 5J8FA 1RRJA 1H9GA 1ZG5A 2W1OA 1O7FA 1X1AA 2R4GA 3L2UA 4BBRJ 4ZC3A 1OCZH 1TBXA 4ASNA 2E7XA 4HBLA 2Q8KA 3OYJA 4B4CA 2OTJI 5ILVA 3BOQA 4A3KJ 1ETYA 1LQ1A 2VPRA 2FXAA 4H4KC 3K4NA 3FXLA 5EG0A 3N4MA 2R7TA 3DF8A 3TGNA 2KHMA 4DIQA 1U8BA 3GTGJ 1A6QA 2EFPA 2Q0OA 3J7YJ 1R23A 2GXGA 2L7FP 1LPQA 3B73A 4BQNA 3V8KA 2LMDA 3HOWJ 1R1VA 2F6CA 2KZVA 4KISA 1R49A 5IT9Z 3TW7A 3TP3A 2Y0SA 2E1NA 5JR3A 3E97A 4GYIA 4N9IA 4YG2F 5KK1A 5JLXA 4AYBN 5D5UB 3QRFF 3BJOA 4EM0B 4FISA 3TQNA 2HPMA 2YX4A 1FSHA 2EH3A 2IPQX 4WK8F 3JAMK 2HDCA 5EDNA 2AS5F 1JT6A 2Y69H 2CUFA 3A4CA 3C2BA 1XX5A 2R7FA 1WQ2A 3BDDA 2DU9A 2QENA 3RCOA 2CGPA 2FQ4A 2RNJA 1OKRA 2BXZA 4ZJZA 1R71A 2R92J 2E34A 3PNVA 3BR0A 3S2HJ 2ZJQF 2MSYA 2KIUA 4BL0B 2P6TA 5HDNA 4B8XA 3ABUA 2VJ5A 3GTKJ 1FWZA 1WH7A 3CCUI 1X58A 5IY5H 1MSEC 2CG4A 3CCLI 3ZQIA 3KIOA 4WXHA 3MN2A 3NWSA 2DK5A 1Z77A 3FMRA 2DOFA 3DPLC 2IJLA 3TDUC 2NS7A 3K1MA 2MD5A 4IPAA 3QOEA 4EEFG 3U21A 4HW0A 1AKHA 1M1EB 1ZKGA 1U2WA 3I71A 2WBMA 1MNDA 2KRHA 2PEXA 5C4XJ 2QQBA 3KLOA 4F3QA 4G6DA 1N25A 3ABKH 5FROA 3RKXA 1HKQA 2Z99A 1CF7A 3E7LA 3ZGKA 4NB5A 2H8WA 2Z9OA 1WFXA 3GTMJ 4IZZA 3ECOA 1CQTA 2M8GX 3DBRB 4BXXJ 1YIJI 2HTSA 2W00A 1XMKA 2JWTA 4ETSA 2OPTA 4BHCA 2JRTA 2HTJA 3JRGA 2NYXA 2ZSIB 5FGMA 1SAUA 3PL8A 4LG0A 4KT5C 4RLFA 4YRVA 5IOYA 5F64A 3OYDA 4NQWA 2AQFA 1YLFA 3RPUA 4UV8A 3LA7A 2P8TA 1PP8F 4EV0A 3SJMA 3G4SI 4A5NA 4HQEA 3G71I 1I1SA 2HFHA 2VC0A 5AIPA 1GHCA 4PJNA 1N75A 4LG3A 2HQAA 2L7ZA 1I39A 3KLNA 2BXYA 3E3VA 5FRMA 4YELA 3MCZA 3HRMA 3ZQ7A 4BGDA 2M0MA 3OWTA 1RESA 4C30A 2NVYJ 2D1HA 1Z91A 1YQAA 3G6EI 1F9NA 1WZ2A 1GVDA 2CUJA 2BY3A 4CYDA 1Z6TA 1D0XA 1IN6A 3Q9SA 3JRHA 4LJZF 1YTYA 4G6TB 3DU6A 1MBEA 2QEXI 2OD5A 2E2IJ 2R7WA 1VI0A 3KCCA 3HOTA 3M4OJ 1P6RA 3DKYA 2IT0A 4CHUA 3P7NA 1K78A 2ZCWA 2H6BA 2QSFX 1WJAA 5E8GA 2P6SA 2PQ8A 2OF7A 4G12A 5TRDA 1CGPA 1V4RA 1VNDA 2VT2A 3H3ZA 2LF8A 1IN5A 3TKYA 2JVHA 1FNNA 2DI3A 3HHHA 3GTOJ 4A93J 5FKLA 2VN2A 4YFXF 2A6HF 4L0ZB 5JHFA 2HEOA 4EJOA 1R7JA 2F4IA 1MD0A 3HSRA 3IUOA 1RIOH 2V1UA 2RQPA 4U87A 3RJPA 4MTDA 3FM5A 3ASNH 3H3UA 1A31A 2LBFA 1T56A 4IQJA 1D8KA 1AKHB 3HTUA 3KZZA 1DP3A 4OIOF 3OMYA 2WTEA 4B48A 1MH3A 4E7LA 3IAM2 3Q3SA 2A69F 2ADUA 1SVOA 4BU2A 1T08B 4EVIA 3R4KA 1MDMA 4ZZLA 5BPDA 1OCOH 4PK4A 3K4LA 2E60A 3K4MA 2LFBA 2RVCA 2W85A 2KQRA 1DU6A 4UVBA 4HG2A 3CMYA 3I56I 4CUGA 1P92A 1EV7A 1G4DA 4BACA 3FKIJ 1IC8A 2A6TA 3ZPLA 2XAUA 2MGQA 1BJAA 3WTVC 4WXDA 4C2UA 1BOAA 1B72B 3S2DJ 2Z5UA 1V5EA 3HRSA 3QU3A 5ERIA 3S8PA 1FBUA 1GV2A 3NRVA 3GTQJ 2L7MP 3ASOH 1YYVA 1EA3A 3JRFA 2ZJPF 5JHUA 4IHXA 2DO7A 4Q47A 2LKSA 3MKWB 1YFHA 1W0TA 3CUQA 5KAFC 2UXNA 3RPUD 4CCMA 5D5XB 2EQRA 4KA4A 2XSJC 2XPWA 3MAJA 3OSGA 2LLKA 2CW8A 3CESA 1JGSA 5EF6A 1XTAA 2HYFA 1YW9A 1JKPC 5AIQA 1P9QC 1T6SA 2XC7A 4V19K 1BR4A 3QQAA 1ZTRA 3G3ZA 3RPQA 4IO9F 4PCQA 3KYCB 4PSWA 1SFOJ 2EB7A 4JX5A 2ZKZA 4AUXA 2JT1A 4XKCA 3LNQA 2N8GA 4A3CJ 2ZMEA 4QPOA 3S17J 2LNBA 5CVJA 1HSJA 3E6CC 2DA1A 2KIFA 4D9JA 4EGYA 3F3XA 3S1RJ 5K7HA 2D45A 1B72A 3BG6A 1R58A 3BPVA 4RAGA 2XKPA 3GFIA 1SVMA 5F0HA 2F5CA 3CCJI 3LOCA 3W2WA 4I98B 3ZMVA 1SANA 2QQ8A 4Z2YA 5B66C 3CP8A 4ZDPA 3GFJA 1KONA
chains in the Genus database with same CATH topology
2MLGA 1O3QA 3BP8A 3VFZA 3IKVA 3MFKA 4LMYA 3KP4A 3SFZA 2ZBKA 1ZREA 4MNUA 5HDKA 1TNTA 4IHSA 1XGMA 3EUHA 4ON0A 2AXLA 3GX4X 1P2FA 3F22A 2GIVA 2L4AA 4I2OA 2ZMEB 1S3JA 1Z1DA 4P5OA 3F6VA 4HLXA 4RAYA 4MQ9F 1XSXA 1WSUA 6PAXA 2J5OA 1HKTA 3GEZA 1EH7A 2BGCA 3WTSC 1EH6A 1J59A 2H94A 5DCMA 4LK0F 1MGTA 4I02A 1K78B 3L2CA 2GA1A 2V6CA 2RC4A 2UWMA 4RB2C 1HBXG 4I0BA 3VODA 2FBIA 5HVQC 5CVRA 1FYKA 2W25A 4HAMA 1D8JA 4S04A 2NAZA 1MDMB 1SAXA 2P4WA 5K1YA 1FP1D 2KKOA 5FFZA 4A0ZA 3M9AA 5DCFA 5D4SA 1XDSA 1F4KA 4D0PA 4A6DA 4AVPA 3IL2A 2ZJ2A 2HKOA 3DXJF 3GFJA 2E7WA 2Y48A 3DFGA 1J5YA 4I01A 4TV7A 3WGGA 3B02A 2K4JA 1LEAA 1J9IA 2XAFA 1O7LA 2P7VB 5KVRA 1FZPB 3IRRA 5CVVA 4MEYF 2IRFG 1CF7B 2PMUA 4XLNF 3L09A 2GWRA 1U6GA 2BV6A 1TLHB 1K79A 3HUGA 2H27A 2FSWA 4OIPF 5LRRA 2OA4A 2VE8A 3ZP5A 3S2WA 1DPRA 2G9WA 4RB0A 4WF2A 2C6YA 1XDUA 5H6RA 1QNTA 3P9IA 4G7ZF 2D1VA 4CDGA 4U7DA 2B0LA 4CXFA 2CSOA 2F5EA 4AIKA 1YIOA 1Q1HA 1S6LA 3KP6A 1L0OC 1T98A 1KU3A 2P5VA 2PG4A 3I5UA 3ZMDA 3E6MA 5D4RA 5JFRA 4E70A 4UHTA 1ZRDA 3RKWA 1XN7A 2HQRA 1G3SA 3SHFA 2X4HA 2H09A 3RKYA 3DP7A 1BN5A 3C18A 3D0SA 4Y13A 1HQCA 3ABTA 4OIQF 1HSTA 1S8NA 4KUMA 3R61A 1FLIA 1RUOA 1TW3A 4RGXA 1XSDA 4ZYGA 4BH9A 3IWFA 1JHFA 2IA1A 3N97A 2PMHA 3J7AO 3LA2A 3W6JB 4EJTA 2KJCA 5K5RA 5F1RA 3D5LA 5FO5A 3GZ6A 4G6QA 5HLIA 4ENMA 1G3TA 4FX4A 1R22A 3KP3A 4AIJA 1REPC 3M7GA 1KQ0A 2PFBA 1W5SA 4L0YB 4ZZDA 3C1DA 2A5YB 1OYIA 2QBYB 2A07F 4M9SA 1FT9A 1BBYA 3U1DA 3F72A 4HV6A 4EQQA 4O3MA 2W57A 1QZYA 4ZH4F 1Y0UA 1AWCA 1BIBA 1O3SA 1TQIA 4R1HA 3WU0A 2HKXA 3V8JA 1QZZA 2F5DA 2XKOA 4YIFA 3FXUA 4HZFA 3WTUC 3I54A 1ON2A 1J7KA 3IHUA 1D3YA 2LKPA 3KEQA 1FYMA 5CYVA 1KQ9A 2IP2A 1UB9A 2DT5A 3FXRA 3CUOA 1L3LA 1TTYA 2A61A 2TDXA 4M9ZA 1U5TA 2F2EA 2CWEA 4RGRA 4KMUX 4A12A 3JSPA 5FB2A 4ESFA 4P9UA 3G73A 3HTSB 3WE2A 2YU3A 1C0WA 3I58A 2CQKA 2LSOA 1FP2A 3KE2A 4MTEA 2EV5A 3LFKA 2DK8A 1FC3A 4CICA 2OQGA 2CYYA 2VBWA 2GA2A 4LK1F 3FM3A 4IRGA 4BYYA 3KEOA 4P96A 2V9VA 4RB3C 4AIHA 5HOOA 2ZNZA 3F8MA 1IXCA 4WX9A 1OR7A 2BEOA 2XASA 5L3BA 3KFWX 1YS6A 3CJNA 2DPUA 1ZLJA 4AWXB 1SD4A 3DQVC 4S05A 1FBSA 3ZMUA 1B59A 2FQ3A 2MA3A 2W24A 3RYRA 3GLXA 3P9KA 2Z33A 2IA2A 3HOSA 3IWZA 2DQRA 1ZGAA 3F8BA 2ZO4A 3MEXA 4HF0A 1PUEE 1YO5C 4OINF 1KYZA 2XRNA 3QU6A 2H6CA 1XB4A 3WGHA 5FLXZ 1W5TA 5IT3A 4GO1A 4PGGA 3JTHA 4KIGA 4GCVA 1FX7A 3J80K 4XLPF 2EFWA 2GZWA 1OYWA 4EJWA 1LDKB 5E1XA 1SFXA 2M87A 2O8XA 2EFOA 2XROA 1FYLA 2K7LA 5F6FA 1K6OA 1JXSA 5BPIA 3VOEA 5DD8A 3CDHA 1RNLA 1YS7A 4BHPA 1R36A 1U5TB 1ZG1A 2O61A 2ESNA 2EA4A 3KP5A 4KICA 1HXDA 4M71A 2K02A 2XVCA 3QPHA 1XMAA 2YR2A 5BMZA 1STZA 4OMZA 4IF4A 5HDGA 5E17F 1WRJA 1X3UA 3EQLF 3P9CA 2ELHA 3EETA 2HQNA 4U0YA 1KQ8A 5FD5A 3MWMA 1W7PA 1IF1A 2VC1A 3ZN0A 5IT9K 2KRFA 5LEJA 3V4GA 1P4XA 4K2EA 2HZTA 2GAUA 3GYHX 1MZBA 2WC2A 1VTNC 1SD6A 5DCMB 5H6QA 3LSTA 3CUQC 4GXOA 3DPTA 3ELKA 3I53A 3Q5FA 1KGSA 1I5ZA 4RGUA 1KU7A 2BE5F 3K69A 2XHKA 4ZYHA 5AONA 3I0TA 2DW4A 1HW5A 4KYWA 3C3WA 5D8KB 4IVNA 3HYIA 3VEPA 2YSRA 2M45A 3OV8A 3HSEA 3LAPA 1U3EM 1F5TA 2VT3A 3GZ5A 3JSOA 3BY6A 1B1BA 5HS9A 2HOEA 5JVTA 1MJ9A 2KJBA 3F8FA 4OMYA 1LJ9A 2VBXA 1KYWA 4L9JA 3ECHA 5TJJA 4GGGA 1R5HA 2OZ6A 3KZYA 3F21A 1FOKA 4CZZA 3ZMTA 2VODA 4FHTA 1F1ZA 2DTRA 2FNAA 4RB1A 2MBFA 1BI2A 4U7BA 3VB2A 2PJPA 2EA2A 2QVOA 3FMSA 4ESJA 2VBZA 2WV0A 1G6NA 5LGUA 3L7WA 2QM3A 4U88A 4ENNA 3T8RA 5BS6A 1R1TA 1Z9CA 2GQQA 4BQAA 1OYYA 2IA0A 1T2KA 2OU2A 3RTRA 3BROA 1HW2A 4KDPA 4I09A 1UHWA 3GFMA 3L9FA 1V3FA 3DV8A 2FU4A 2VOPA 2VONA 1ZGJA 4JBAA 2M5WA 3BZ6A 3SZPA 2HWVA 3KP7A 4HA8A 1TQMA 5LHGA 2J5PA 1ZHFA 3HIFA 5K5OA 1XD7A 4XBFA 3WODF 4HV5A 3BJ6A 2YX7A 3PFIA 4EM2A 1W7PB 1Z6RA 1IW7F 5ILUA 2M1BA 2LF7A 5BOXA 5FFXA 1D5VA 2WWYA 3EYYA 5E8IA 2PI0A 5EEHA 1RZ4A 2DAOA 4RGSA 1G3YA 1U5TC 3GFLA 3TDZC 5J8CA 1WWXA 1ZG3A 5DDGA 5ED4A 2JTVA 4CO8A 4MEXF 5D5WB 3ISPA 1XCVA 3OOPA 3EYIA 1XGOA 3E6DA 4EJUA 4QLCU 2K86A 5E1WA 3KETA 4RS8A 4U0VA 3R60A 4KIBA 4MQVA 1J2XA 3HSFA 1LDJA 3WU1B 2M30A 5ICEA 4L9NA 4Q48A 1XGNA 1ZLKA 1ZAOA 1IN4A 2RV8A 1T39A 2ACJA 5HLHA 3ZMZA 1XGSA 4M74A 2PBIA 5D5VB 2FNPA 3C7JA 2FMYA 3O6BB 2HYGD 3H92A 3FHZA 2W84A 2Y0MA 1J75A 3KP2A 5LLQA 2L3DA 3SQNA 1ODDA 1ZH5A 2L02A 4Q5SF 2P7CB 2XV4S 2V1XA 1IAWA 3V8LA 1IRFA 3ZN1A 4AD9A 4KMFA 4U0WA 3FF5A 1IZ1A 3COAC 2FF4A 4O6JA 1P4AA 4IHTA 4PZJA 1B6AA 1NHAA 3BWGA 4JK1X 2FOKA 1S29A 2Z3YA 5L3FA 1BC8C 1QO0D 5HS8A 2FBKA 3REOA 1SMYF 2O3FA 3U9GA 2GXBA 5L3DA 4FX0A 2ZFWA 3AAFA 3MQ0A 1SD7A 2XUBA 3TO9A 1LVAA 2M8EA 3FZVA 4G8XA 1DUXC 4UV9A 3FWEA 3GW2A 3NEUA 1T38A 1RUNA 2XAJA 2YPRA 1PP7U 1R1UA 2CO5A 3MZYA 4KIFA 4Y17A 4A2UA 3I4PA 3IC7A 1BI3A 4L5IA 2KIMA 1IN8A 3TOAA 4G94A 4HOBA 3WTZA 3R0JA 1KU2A 2QQAA 2CFXA 5DUIA 3ZMSA 4I7HA 4PGHA 5E1ZB 4YFNF 2DPDA 2IVMA 3FX3A 5DYMA 3QPTA 3F8NA 5CJ9A 5L3GA 2STWA 3ERED 4N9HA 3T8TA 3SXYA 2PN6A 4EGZA 2UXXA 4UVCA 5BQTA 3NQOA 3GVAA 3T5XA 2V79A 2BYVE 4MGRA 4PDKA 1SMTA 4M6YA 4IJAA 3ROUA 2FMLA 3CUQB 3O2PE 1ONVA 2E1CA 2JSCA 1Z05A 2NS0A 1ULYA 3U2RA 4A6EA 2DBBA 5DV5A 4G7OF 3V7SA 2QLZA 5CVUA 3QP5A 3DEUA 3L00A 3E5UA 4IRIA 2O0YA 2FE3A 3RIRA 3IRQA 1FPQA 4H0EA 4LFUA 4OOIA 4CGZA 4XSXF 1OMIA 1USTA 4OU0A 2X0LA 4Q4ZF 4R79A 4LD5A 1O3TA 4DQ2A 5HLGA 1LDDA 2HGCA 5ICCA 2O6GE 4ENJA 1P4WA 4BHBA 3CO7C 3K1PA 4MHGA 2LDUA 1LNWA 1HKSA 1GXPA 4M73A 4NHJA 3K2ZA 2QWWA 3WTTC 5EEGA 1KA8A 5HS7A 4UUVA 1QQIA 2MH2A 2EFQA 3E5XA 2EWNA 2IW5A 2FA5A 3TO7A 1AOYA 2FEZA 2DQLA 3ML6A 1SD5A 1ZN2A 2RKHA 3WG9A 2RN7A 3K9TA 3LWFA 4BAYA 3WGIA 2QQ9A 4IRHA 5FD6A 2XGXA 4G7HF 1PDNC 1S7OA 2XAGA 3WE3A 2K27A 1A04A 4OIRF 1UHMA 1BC7C 1IUYA 1J0RA 4BXUA 2OZUA 1BIAA 3HRTA 3K0LA 4HDVA 1I1GA 2VE9A 4LGWA 1W4MA 4WXCA 3V7CA 4LG0B 5D6EA 4LB5A 3I59B 2ISYA 4EMSA 4UNOA 3E5QA 4FT8A 4WWCA 4HF2A 4UVAA 3W6KB 2COMA 2VXZA 4UXNA 4I0AA 3LQQA 3DKWA 4XRFA 2JPBA 4DNCA 2A6EF 1IXRC 3QOPA 1O3RA 4EM1A 1GVJA 2QUFA 4P55A 2NNYA 2JPCA 2P5LC 3IKTA 5E18F 4QWQA 4HYEA 5DUKA 1GXQA 2HR3A 1UCRA 3EDPA 1EH8A 1B9MA 1Z7UA 2DLLA 2G7HA 2G7UA 2O03A 1MJAA 2EV0A 3F6OA 4HLYA 2Y75A 2OQRA 3GUDA 2ZNYA 1SFUA 1U8RA 2OAZA 3QAHA 5LGNA 3PQJA 4KNYA 3GO5A 1ZRCA 1O57A 4KN4X 5LGTA 2P5KA 2STTA 3BPXA 3F8CA 1H0MA 3MZHA 2XAQA 4YIIA 2Q2EA 4G9YA 1LEBA 2EFNA 4M9XA 3J81K 4WCGA 1JE8A 1ZRFA 3T0YA 1BI1A 4ESBA 1H9TA 3LAJA 1R5GA 1DPUA 1QGPA 4LLLA 1YW8A 4M72A 1QBJA 1E2XA 3TO6A 1U78A 3RI4A 2RGVA 3CTAA 4A0XA 5K5QA 1QPMA 4GYGA 5DD4A 3TOBA 3R6SA 3J80Z 3M8FA 2L4MA 1USSA 1DDNA 2V1DA 1I27A 4F7ZA 1IN7A 3I59A 2K4BA 2QZ8A 4HX7A 2XAHA 2ETHA 2A68F 4HX8A 4LLNA 2BBYA 2R7DA 4HQMA 5D8LB 1SFEA 3M1EA 4HX4A 3JW4A 4ZYEA 1ZARA 3J81Z 5L3EA 5A2QZ 4BNCA 3PQKA 1BM9A 1HW1A 5J6XA 4A5MA 3CLOA 3JAMZ 1MKMA 2QYOA 2L54A 4R8HA 5LEKA 2FRHA 1R00A 3FXQA 3O3KA 5CLSA 4ENKA 3E6BA 4L18B 1I6XA 3V7RA 4A0YA 5ILSA 3F23A 2L01A 2F5FA 3CO6C 1OPCA 1BI0A 3RDIA 2EK5A 2MLKA 5H20A 4O5VA 3WTXC 4KN7X 1MJBA 3K1NA 1JHHA 4N0BA 5ICGA 2A3SA 1IRGA 4B09A 1WKMA 3WTYC 3RYPA 1YG2A 3GF2A 2ESHA 4RAZA 4HDUA 4L9TA 2D2WA 1TNSA 4Y15A 4IXAA 1WI9A 1K7AA 3JTGA 1IXSB 2XIGA 3LA3A 1XCBA 2DFIA 2ZXJA 2R3SA 4M6XA 5E20A 1S7AA 3FMQA 1KU9A 1RI7A 2MC3A 3GXOA 1T0FA 1ZYRF 5A2QK 5CVIA 2EJRA 3LQRA 2RDPA 1TQPA 3I64A 1B4AA 2UZKA 1FBQA 1YW7A 2NRAC 1DP7P 2CW0F 1LB2A 4ZYDA 4XSZF 2OBPA 5FLXK 4L5JA 1TW2A 4HF1A 1ON1A 3SZTA 2ISZA 2JZYA 5JI6A 5DEQA 5D6FA 2NNNA 5ICFA 1E17A 3BJAA 2PLYA 3HHGA 5LHIA 2VBYA 4JQFA 5LBQA 2FBHA 3WTWC 1XSVA 3HRUA 3M8EA 2HS5A 2QBYA 4EJVA 5LRSA 3T1BA 1W7PD 1B9NA 5LHHA 3Q9VA 5L3CA 2MH9A 1UFMA 3QP6A 1G3WA 2VOOA 3ULQB 4YFKF 3GWZA 4L9VA 3R0AA 1FY7A 4LB6B 2EV6A 1FSEA 4KFCA 4LLGF 5J8FA 1H9GA 1ZG5A 1O7FA 1TBXA 4ASNA 2E7XA 4HBLA 2Q8KA 5ILVA 3BOQA 1LQ1A 2FXAA 3N4MA 3DF8A 3TGNA 2EFPA 2Q0OA 1R23A 2GXGA 3B73A 3V8KA 1R1VA 5IT9Z 2E1NA 5JR3A 3E97A 4GYIA 4N9IA 4YG2F 5KK1A 5D5UB 3QRFF 3BJOA 4EM0B 3TQNA 2YX4A 1FSHA 2IPQX 4WK8F 3JAMK 2HDCA 2AS5F 2R7FA 1WQ2A 3BDDA 2DU9A 2QENA 2CGPA 2RNJA 1OKRA 2KIUA 2P6TA 5HDNA 4B8XA 3ABUA 1FWZA 2CG4A 4WXHA 2DK5A 3FMRA 3DPLC 2IJLA 3TDUC 3K1MA 2MD5A 4IPAA 4HW0A 1U2WA 3I71A 2PEXA 2QQBA 3KLOA 4G6DA 3RKXA 1HKQA 2Z99A 1CF7A 4NB5A 2Z9OA 3ECOA 2HTSA 1XMKA 4ETSA 4BHCA 2JRTA 2HTJA 2NYXA 5FGMA 4LG0A 4KT5C 5F64A 4NQWA 1YLFA 3RPUA 4UV8A 3LA7A 2P8TA 1PP8F 4EV0A 4A5NA 4HQEA 1I1SA 2HFHA 2VC0A 5AIPA 1GHCA 3KLNA 3E3VA 3MCZA 3HRMA 3ZQ7A 2D1HA 1Z91A 1YQAA 1F9NA 4CYDA 1Z6TA 1IN6A 3Q9SA 4LJZF 1YTYA 2OD5A 3KCCA 3HOTA 1P6RA 2IT0A 4CHUA 3P7NA 1K78A 2ZCWA 2H6BA 5E8GA 2P6SA 2PQ8A 5TRDA 1CGPA 1V4RA 2VT2A 3H3ZA 2LF8A 1IN5A 3TKYA 1FNNA 2DI3A 3HHHA 2VN2A 4YFXF 2A6HF 4L0ZB 2HEOA 4EJOA 1R7JA 1MD0A 3HSRA 1RIOH 2V1UA 2RQPA 3RJPA 4MTDA 3FM5A 3H3UA 1D8KA 3HTUA 3KZZA 4OIOF 2WTEA 2A69F 2ADUA 4EVIA 1MDMA 3R4KA 4ZZLA 5BPDA 2RVCA 2W85A 4UVBA 1P92A 1EV7A 1G4DA 3ZPLA 1BJAA 3WTVC 4WXDA 1BOAA 2Z5UA 3HRSA 3QU3A 5ERIA 1FBUA 3NRVA 1YYVA 5JHUA 2DO7A 4Q47A 1YFHA 3CUQA 2UXNA 5D5XB 4KA4A 3MAJA 1JGSA 2HYFA 1YW9A 5AIQA 1T6SA 3G3ZA 3RPQA 4PCQA 2EB7A 2ZKZA 2JT1A 2ZMEA 2LNBA 5CVJA 1HSJA 3E6CC 2KIFA 4EGYA 3F3XA 2D45A 1R58A 3BPVA 2XKPA 3GFIA 2F5CA 4I98B 3ZMVA 4Z2YA 4P9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLG A;  1O3Q A;  3BP8 A;  3VFZ A;  3IKV A;  3MFK A;  4LMY A;  3KP4 A;  3SFZ A;  2ZBK A;  1ZRE A;  4MNU A;  5HDK A;  1TNT A;  4IHS A;  1XGM A;  3EUH A;  4ON0 A;  2AXL A;  3GX4 X;  1P2F A;  3F22 A;  2GIV A;  2L4A A;  4I2O A;  2ZME B;  1S3J A;  1Z1D A;  4P5O A;  3F6V A;  4HLX A;  4RAY A;  4MQ9 F;  1XSX A;  1WSU A;  6PAX A;  2J5O A;  1HKT A;  3GEZ A;  1EH7 A;  2BGC A;  3WTS C;  1EH6 A;  1J59 A;  2H94 A;  5DCM A;  4LK0 F;  1MGT A;  4I02 A;  1K78 B;  3L2C A;  2GA1 A;  2V6C A;  2RC4 A;  2UWM A;  4RB2 C;  1HBX G;  4I0B A;  3VOD A;  2FBI A;  5HVQ C;  5CVR A;  1FYK A;  2W25 A;  4HAM A;  1D8J A;  4S04 A;  2NAZ A;  1MDM B;  1SAX A;  2P4W A;  5K1Y A;  1FP1 D;  2KKO A;  5FFZ A;  4A0Z A;  3M9A A;  5DCF A;  5D4S A;  1XDS A;  1F4K A;  4D0P A;  4A6D A;  4AVP A;  3IL2 A;  2ZJ2 A;  2HKO A;  3DXJ F;  3GFJ A;  2E7W A;  2Y48 A;  3DFG A;  1J5Y A;  4I01 A;  4TV7 A;  3WGG A;  3B02 A;  2K4J A;  1LEA A;  1J9I A;  2XAF A;  1O7L A;  2P7V B;  5KVR A;  1FZP B;  3IRR A;  5CVV A;  4MEY F;  2IRF G;  1CF7 B;  2PMU A;  4XLN F;  3L09 A;  2GWR A;  1U6G A;  2BV6 A;  1TLH B;  1K79 A;  3HUG A;  2H27 A;  2FSW A;  4OIP F;  5LRR A;  2OA4 A;  2VE8 A;  3ZP5 A;  3S2W A;  1DPR A;  2G9W A;  4RB0 A;  4WF2 A;  2C6Y A;  1XDU A;  5H6R A;  1QNT A;  3P9I A;  4G7Z F;  2D1V A;  4CDG A;  4U7D A;  2B0L A;  4CXF A;  2CSO A;  2F5E A;  4AIK A;  1YIO A;  1Q1H A;  1S6L A;  3KP6 A;  1L0O C;  1T98 A;  1KU3 A;  2P5V A;  2PG4 A;  3I5U A;  3ZMD A;  3E6M A;  5D4R A;  5JFR A;  4E70 A;  4UHT A;  1ZRD A;  3RKW A;  1XN7 A;  2HQR A;  1G3S A;  3SHF A;  2X4H A;  2H09 A;  3RKY A;  3DP7 A;  1BN5 A;  3C18 A;  3D0S A;  4Y13 A;  1HQC A;  3ABT A;  4OIQ F;  1HST A;  1S8N A;  4KUM A;  3R61 A;  1FLI A;  1RUO A;  1TW3 A;  4RGX A;  1XSD A;  4ZYG A;  4BH9 A;  3IWF A;  1JHF A;  2IA1 A;  3N97 A;  2PMH A;  3J7A O;  3LA2 A;  3W6J B;  4EJT A;  2KJC A;  5K5R A;  5F1R A;  3D5L A;  5FO5 A;  3GZ6 A;  4G6Q A;  5HLI A;  4ENM A;  1G3T A;  4FX4 A;  1R22 A;  3KP3 A;  4AIJ A;  1REP C;  3M7G A;  1KQ0 A;  2PFB A;  1W5S A;  4L0Y B;  4ZZD A;  3C1D A;  2A5Y B;  1OYI A;  2QBY B;  2A07 F;  4M9S A;  1FT9 A;  1BBY A;  3U1D A;  3F72 A;  4HV6 A;  4EQQ A;  4O3M A;  2W57 A;  1QZY A;  4ZH4 F;  1Y0U A;  1AWC A;  1BIB A;  1O3S A;  1TQI A;  4R1H A;  3WU0 A;  2HKX A;  3V8J A;  1QZZ A;  2F5D A;  2XKO A;  4YIF A;  3FXU A;  4HZF A;  3WTU C;  3I54 A;  1ON2 A;  1J7K A;  3IHU A;  1D3Y A;  2LKP A;  3KEQ A;  1FYM A;  5CYV A;  1KQ9 A;  2IP2 A;  1UB9 A;  2DT5 A;  3FXR A;  3CUO A;  1L3L A;  1TTY A;  2A61 A;  2TDX A;  4M9Z A;  1U5T A;  2F2E A;  2CWE A;  4RGR A;  4KMU X;  4A12 A;  3JSP A;  5FB2 A;  4ESF A;  4P9U A;  3G73 A;  3HTS B;  3WE2 A;  2YU3 A;  1C0W A;  3I58 A;  2CQK A;  2LSO A;  1FP2 A;  3KE2 A;  4MTE A;  2EV5 A;  3LFK A;  2DK8 A;  1FC3 A;  4CIC A;  2OQG A;  2CYY A;  2VBW A;  2GA2 A;  4LK1 F;  3FM3 A;  4IRG A;  4BYY A;  3KEO A;  4P96 A;  2V9V A;  4RB3 C;  4AIH A;  5HOO A;  2ZNZ A;  3F8M A;  1IXC A;  4WX9 A;  1OR7 A;  2BEO A;  2XAS A;  5L3B A;  3KFW X;  1YS6 A;  3CJN A;  2DPU A;  1ZLJ A;  4AWX B;  1SD4 A;  3DQV C;  4S05 A;  1FBS A;  3ZMU A;  1B59 A;  2FQ3 A;  2MA3 A;  2W24 A;  3RYR A;  3GLX A;  3P9K A;  2Z33 A;  2IA2 A;  3HOS A;  3IWZ A;  2DQR A;  1ZGA A;  3F8B A;  2ZO4 A;  3MEX A;  4HF0 A;  1PUE E;  1YO5 C;  4OIN F;  1KYZ A;  2XRN A;  3QU6 A;  2H6C A;  1XB4 A;  3WGH A;  5FLX Z;  1W5T A;  5IT3 A;  4GO1 A;  4PGG A;  3JTH A;  4KIG A;  4GCV A;  1FX7 A;  3J80 K;  4XLP F;  2EFW A;  2GZW A;  1OYW A;  4EJW A;  1LDK B;  5E1X A;  1SFX A;  2M87 A;  2O8X A;  2EFO A;  2XRO A;  1FYL A;  2K7L A;  5F6F A;  1K6O A;  1JXS A;  5BPI A;  3VOE A;  5DD8 A;  3CDH A;  1RNL A;  1YS7 A;  4BHP A;  1R36 A;  1U5T B;  1ZG1 A;  2O61 A;  2ESN A;  2EA4 A;  3KP5 A;  4KIC A;  1HXD A;  4M71 A;  2K02 A;  2XVC A;  3QPH A;  1XMA A;  2YR2 A;  5BMZ A;  1STZ A;  4OMZ A;  4IF4 A;  5HDG A;  5E17 F;  1WRJ A;  1X3U A;  3EQL F;  3P9C A;  2ELH A;  3EET A;  2HQN A;  4U0Y A;  1KQ8 A;  5FD5 A;  3MWM A;  1W7P A;  1IF1 A;  2VC1 A;  3ZN0 A;  5IT9 K;  2KRF A;  5LEJ A;  3V4G A;  1P4X A;  4K2E A;  2HZT A;  2GAU A;  3GYH X;  1MZB A;  2WC2 A;  1VTN C;  1SD6 A;  5DCM B;  5H6Q A;  3LST A;  3CUQ C;  4GXO A;  3DPT A;  3ELK A;  3I53 A;  3Q5F A;  1KGS A;  1I5Z A;  4RGU A;  1KU7 A;  2BE5 F;  3K69 A;  2XHK A;  4ZYH A;  5AON A;  3I0T A;  2DW4 A;  1HW5 A;  4KYW A;  3C3W A;  5D8K B;  4IVN A;  3HYI A;  3VEP A;  2YSR A;  2M45 A;  3OV8 A;  3HSE A;  3LAP A;  1U3E M;  1F5T A;  2VT3 A;  3GZ5 A;  3JSO A;  3BY6 A;  1B1B A;  5HS9 A;  2HOE A;  5JVT A;  1MJ9 A;  2KJB A;  3F8F A;  4OMY A;  1LJ9 A;  2VBX A;  1KYW A;  4L9J A;  3ECH A;  5TJJ A;  4GGG A;  1R5H A;  2OZ6 A;  3KZY A;  3F21 A;  1FOK A;  4CZZ A;  3ZMT A;  2VOD A;  4FHT A;  1F1Z A;  2DTR A;  2FNA A;  4RB1 A;  2MBF A;  1BI2 A;  4U7B A;  3VB2 A;  2PJP A;  2EA2 A;  2QVO A;  3FMS A;  4ESJ A;  2VBZ A;  2WV0 A;  1G6N A;  5LGU A;  3L7W A;  2QM3 A;  4U88 A;  4ENN A;  3T8R A;  5BS6 A;  1R1T A;  1Z9C A;  2GQQ A;  4BQA A;  1OYY A;  2IA0 A;  1T2K A;  2OU2 A;  3RTR A;  3BRO A;  1HW2 A;  4KDP A;  4I09 A;  1UHW A;  3GFM A;  3L9F A;  1V3F A;  3DV8 A;  2FU4 A;  2VOP A;  2VON A;  1ZGJ A;  4JBA A;  2M5W A;  3BZ6 A;  3SZP A;  2HWV A;  3KP7 A;  4HA8 A;  1TQM A;  5LHG A;  2J5P A;  1ZHF A;  3HIF A;  5K5O A;  1XD7 A;  4XBF A;  3WOD F;  4HV5 A;  3BJ6 A;  2YX7 A;  3PFI A;  4EM2 A;  1W7P B;  1Z6R A;  1IW7 F;  5ILU A;  2M1B A;  2LF7 A;  5BOX A;  5FFX A;  1D5V A;  2WWY A;  3EYY A;  5E8I A;  2PI0 A;  5EEH A;  1RZ4 A;  2DAO A;  4RGS A;  1G3Y A;  1U5T C;  3GFL A;  3TDZ C;  5J8C A;  1WWX A;  1ZG3 A;  5DDG A;  5ED4 A;  2JTV A;  4CO8 A;  4MEX F;  5D5W B;  3ISP A;  1XCV A;  3OOP A;  3EYI A;  1XGO A;  3E6D A;  4EJU A;  4QLC U;  2K86 A;  5E1W A;  3KET A;  4RS8 A;  4U0V A;  3R60 A;  4KIB A;  4MQV A;  1J2X A;  3HSF A;  1LDJ A;  3WU1 B;  2M30 A;  5ICE A;  4L9N A;  4Q48 A;  1XGN A;  1ZLK A;  1ZAO A;  1IN4 A;  2RV8 A;  1T39 A;  2ACJ A;  5HLH A;  3ZMZ A;  1XGS A;  4M74 A;  2PBI A;  5D5V B;  2FNP A;  3C7J A;  2FMY A;  3O6B B;  2HYG D;  3H92 A;  3FHZ A;  2W84 A;  2Y0M A;  1J75 A;  3KP2 A;  5LLQ A;  2L3D A;  3SQN A;  1ODD A;  1ZH5 A;  2L02 A;  4Q5S F;  2P7C B;  2XV4 S;  2V1X A;  1IAW A;  3V8L A;  1IRF A;  3ZN1 A;  4AD9 A;  4KMF A;  4U0W A;  3FF5 A;  1IZ1 A;  3COA C;  2FF4 A;  4O6J A;  1P4A A;  4IHT A;  4PZJ A;  1B6A A;  1NHA A;  3BWG A;  4JK1 X;  2FOK A;  1S29 A;  2Z3Y A;  5L3F A;  1BC8 C;  1QO0 D;  5HS8 A;  2FBK A;  3REO A;  1SMY F;  2O3F A;  3U9G A;  2GXB A;  5L3D A;  4FX0 A;  2ZFW A;  3AAF A;  3MQ0 A;  1SD7 A;  2XUB A;  3TO9 A;  1LVA A;  2M8E A;  3FZV A;  4G8X A;  1DUX C;  4UV9 A;  3FWE A;  3GW2 A;  3NEU A;  1T38 A;  1RUN A;  2XAJ A;  2YPR A;  1PP7 U;  1R1U A;  2CO5 A;  3MZY A;  4KIF A;  4Y17 A;  4A2U A;  3I4P A;  3IC7 A;  1BI3 A;  4L5I A;  2KIM A;  1IN8 A;  3TOA A;  4G94 A;  4HOB A;  3WTZ A;  3R0J A;  1KU2 A;  2QQA A;  2CFX A;  5DUI A;  3ZMS A;  4I7H A;  4PGH A;  5E1Z B;  4YFN F;  2DPD A;  2IVM A;  3FX3 A;  5DYM A;  3QPT A;  3F8N A;  5CJ9 A;  5L3G A;  2STW A;  3ERE D;  4N9H A;  3T8T A;  3SXY A;  2PN6 A;  4EGZ A;  2UXX A;  4UVC A;  5BQT A;  3NQO A;  3GVA A;  3T5X A;  2V79 A;  2BYV E;  4MGR A;  4PDK A;  1SMT A;  4M6Y A;  4IJA A;  3ROU A;  2FML A;  3CUQ B;  3O2P E;  1ONV A;  2E1C A;  2JSC A;  1Z05 A;  2NS0 A;  1ULY A;  3U2R A;  4A6E A;  2DBB A;  5DV5 A;  4G7O F;  3V7S A;  2QLZ A;  5CVU A;  3QP5 A;  3DEU A;  3L00 A;  3E5U A;  4IRI A;  2O0Y A;  2FE3 A;  3RIR A;  3IRQ A;  1FPQ A;  4H0E A;  4LFU A;  4OOI A;  4CGZ A;  4XSX F;  1OMI A;  1UST A;  4OU0 A;  2X0L A;  4Q4Z F;  4R79 A;  4LD5 A;  1O3T A;  4DQ2 A;  5HLG A;  1LDD A;  2HGC A;  5ICC A;  2O6G E;  4ENJ A;  1P4W A;  4BHB A;  3CO7 C;  3K1P A;  4MHG A;  2LDU A;  1LNW A;  1HKS A;  1GXP A;  4M73 A;  4NHJ A;  3K2Z A;  2QWW A;  3WTT C;  5EEG A;  1KA8 A;  5HS7 A;  4UUV A;  1QQI A;  2MH2 A;  2EFQ A;  3E5X A;  2EWN A;  2IW5 A;  2FA5 A;  3TO7 A;  1AOY A;  2FEZ A;  2DQL A;  3ML6 A;  1SD5 A;  1ZN2 A;  2RKH A;  3WG9 A;  2RN7 A;  3K9T A;  3LWF A;  4BAY A;  3WGI A;  2QQ9 A;  4IRH A;  5FD6 A;  2XGX A;  4G7H F;  1PDN C;  1S7O A;  2XAG A;  3WE3 A;  2K27 A;  1A04 A;  4OIR F;  1UHM A;  1BC7 C;  1IUY A;  1J0R A;  4BXU A;  2OZU A;  1BIA A;  3HRT A;  3K0L A;  4HDV A;  1I1G A;  2VE9 A;  4LGW A;  1W4M A;  4WXC A;  3V7C A;  4LG0 B;  5D6E A;  4LB5 A;  3I59 B;  2ISY A;  4EMS A;  4UNO A;  3E5Q A;  4FT8 A;  4WWC A;  4HF2 A;  4UVA A;  3W6K B;  2COM A;  2VXZ A;  4UXN A;  4I0A A;  3LQQ A;  3DKW A;  4XRF A;  2JPB A;  4DNC A;  2A6E F;  1IXR C;  3QOP A;  1O3R A;  4EM1 A;  1GVJ A;  2QUF A;  4P55 A;  2NNY A;  2JPC A;  2P5L C;  3IKT A;  5E18 F;  4QWQ A;  4HYE A;  5DUK A;  1GXQ A;  2HR3 A;  1UCR A;  3EDP A;  1EH8 A;  1B9M A;  1Z7U A;  2DLL A;  2G7H A;  2G7U A;  2O03 A;  1MJA A;  2EV0 A;  3F6O A;  4HLY A;  2Y75 A;  2OQR A;  3GUD A;  2ZNY A;  1SFU A;  1U8R A;  2OAZ A;  3QAH A;  5LGN A;  3PQJ A;  4KNY A;  3GO5 A;  1ZRC A;  1O57 A;  4KN4 X;  5LGT A;  2P5K A;  2STT A;  3BPX A;  3F8C A;  1H0M A;  3MZH A;  2XAQ A;  4YII A;  2Q2E A;  4G9Y A;  1LEB A;  2EFN A;  4M9X A;  3J81 K;  4WCG A;  1JE8 A;  1ZRF A;  3T0Y A;  1BI1 A;  4ESB A;  1H9T A;  3LAJ A;  1R5G A;  1DPU A;  1QGP A;  4LLL A;  1YW8 A;  4M72 A;  1QBJ A;  1E2X A;  3TO6 A;  1U78 A;  3RI4 A;  2RGV A;  3CTA A;  4A0X A;  5K5Q A;  1QPM A;  4GYG A;  5DD4 A;  3TOB A;  3R6S A;  3J80 Z;  3M8F A;  2L4M A;  1USS A;  1DDN A;  2V1D A;  1I27 A;  4F7Z A;  1IN7 A;  3I59 A;  2K4B A;  2QZ8 A;  4HX7 A;  2XAH A;  2ETH A;  2A68 F;  4HX8 A;  4LLN A;  2BBY A;  2R7D A;  4HQM A;  5D8L B;  1SFE A;  3M1E A;  4HX4 A;  3JW4 A;  4ZYE A;  1ZAR A;  3J81 Z;  5L3E A;  5A2Q Z;  4BNC A;  3PQK A;  1BM9 A;  1HW1 A;  5J6X A;  4A5M A;  3CLO A;  3JAM Z;  1MKM A;  2QYO A;  2L54 A;  4R8H A;  5LEK A;  2FRH A;  1R00 A;  3FXQ A;  3O3K A;  5CLS A;  4ENK A;  3E6B A;  4L18 B;  1I6X A;  3V7R A;  4A0Y A;  5ILS A;  3F23 A;  2L01 A;  2F5F A;  3CO6 C;  1OPC A;  1BI0 A;  3RDI A;  2EK5 A;  2MLK A;  5H20 A;  4O5V A;  3WTX C;  4KN7 X;  1MJB A;  3K1N A;  1JHH A;  4N0B A;  5ICG A;  2A3S A;  1IRG A;  4B09 A;  1WKM A;  3WTY C;  3RYP A;  1YG2 A;  3GF2 A;  2ESH A;  4RAZ A;  4HDU A;  4L9T A;  2D2W A;  1TNS A;  4Y15 A;  4IXA A;  1WI9 A;  1K7A A;  3JTG A;  1IXS B;  2XIG A;  3LA3 A;  1XCB A;  2DFI A;  2ZXJ A;  2R3S A;  4M6X A;  5E20 A;  1S7A A;  3FMQ A;  1KU9 A;  1RI7 A;  2MC3 A;  3GXO A;  1T0F A;  1ZYR F;  5A2Q K;  5CVI A;  2EJR A;  3LQR A;  2RDP A;  1TQP A;  3I64 A;  1B4A A;  2UZK A;  1FBQ A;  1YW7 A;  2NRA C;  1DP7 P;  2CW0 F;  1LB2 A;  4ZYD A;  4XSZ F;  2OBP A;  5FLX K;  4L5J A;  1TW2 A;  4HF1 A;  1ON1 A;  3SZT A;  2ISZ A;  2JZY A;  5JI6 A;  5DEQ A;  5D6F A;  2NNN A;  5ICF A;  1E17 A;  3BJA A;  2PLY A;  3HHG A;  5LHI A;  2VBY A;  4JQF A;  5LBQ A;  2FBH A;  3WTW C;  1XSV A;  3HRU A;  3M8E A;  2HS5 A;  2QBY A;  4EJV A;  5LRS A;  3T1B A;  1W7P D;  1B9N A;  5LHH A;  3Q9V A;  5L3C A;  2MH9 A;  1UFM A;  3QP6 A;  1G3W A;  2VOO A;  3ULQ B;  4YFK F;  3GWZ A;  4L9V A;  3R0A A;  1FY7 A;  4LB6 B;  2EV6 A;  1FSE A;  4KFC A;  4LLG F;  5J8F A;  1H9G A;  1ZG5 A;  1O7F A;  1TBX A;  4ASN A;  2E7X A;  4HBL A;  2Q8K A;  5ILV A;  3BOQ A;  1LQ1 A;  2FXA A;  3N4M A;  3DF8 A;  3TGN A;  2EFP A;  2Q0O A;  1R23 A;  2GXG A;  3B73 A;  3V8K A;  1R1V A;  5IT9 Z;  2E1N A;  5JR3 A;  3E97 A;  4GYI A;  4N9I A;  4YG2 F;  5KK1 A;  5D5U B;  3QRF F;  3BJO A;  4EM0 B;  3TQN A;  2YX4 A;  1FSH A;  2IPQ X;  4WK8 F;  3JAM K;  2HDC A;  2AS5 F;  2R7F A;  1WQ2 A;  3BDD A;  2DU9 A;  2QEN A;  2CGP A;  2RNJ A;  1OKR A;  2KIU A;  2P6T A;  5HDN A;  4B8X A;  3ABU A;  1FWZ A;  2CG4 A;  4WXH A;  2DK5 A;  3FMR A;  3DPL C;  2IJL A;  3TDU C;  3K1M A;  2MD5 A;  4IPA A;  4HW0 A;  1U2W A;  3I71 A;  2PEX A;  2QQB A;  3KLO A;  4G6D A;  3RKX A;  1HKQ A;  2Z99 A;  1CF7 A;  4NB5 A;  2Z9O A;  3ECO A;  2HTS A;  1XMK A;  4ETS A;  4BHC A;  2JRT A;  2HTJ A;  2NYX A;  5FGM A;  4LG0 A;  4KT5 C;  5F64 A;  4NQW A;  1YLF A;  3RPU A;  4UV8 A;  3LA7 A;  2P8T A;  1PP8 F;  4EV0 A;  4A5N A;  4HQE A;  1I1S A;  2HFH A;  2VC0 A;  5AIP A;  1GHC A;  3KLN A;  3E3V A;  3MCZ A;  3HRM A;  3ZQ7 A;  2D1H A;  1Z91 A;  1YQA A;  1F9N A;  4CYD A;  1Z6T A;  1IN6 A;  3Q9S A;  4LJZ F;  1YTY A;  2OD5 A;  3KCC A;  3HOT A;  1P6R A;  2IT0 A;  4CHU A;  3P7N A;  1K78 A;  2ZCW A;  2H6B A;  5E8G A;  2P6S A;  2PQ8 A;  5TRD A;  1CGP A;  1V4R A;  2VT2 A;  3H3Z A;  2LF8 A;  1IN5 A;  3TKY A;  1FNN A;  2DI3 A;  3HHH A;  2VN2 A;  4YFX F;  2A6H F;  4L0Z B;  2HEO A;  4EJO A;  1R7J A;  1MD0 A;  3HSR A;  1RIO H;  2V1U A;  2RQP A;  3RJP A;  4MTD A;  3FM5 A;  3H3U A;  1D8K A;  3HTU A;  3KZZ A;  4OIO F;  2WTE A;  2A69 F;  2ADU A;  4EVI A;  1MDM A;  3R4K A;  4ZZL A;  5BPD A;  2RVC A;  2W85 A;  4UVB A;  1P92 A;  1EV7 A;  1G4D A;  3ZPL A;  1BJA A;  3WTV C;  4WXD A;  1BOA A;  2Z5U A;  3HRS A;  3QU3 A;  5ERI A;  1FBU A;  3NRV A;  1YYV A;  5JHU A;  2DO7 A;  4Q47 A;  1YFH A;  3CUQ A;  2UXN A;  5D5X B;  4KA4 A;  3MAJ A;  1JGS A;  2HYF A;  1YW9 A;  5AIQ A;  1T6S A;  3G3Z A;  3RPQ A;  4PCQ A;  2EB7 A;  2ZKZ A;  2JT1 A;  2ZME A;  2LNB A;  5CVJ A;  1HSJ A;  3E6C C;  2KIF A;  4EGY A;  3F3X A;  2D45 A;  1R58 A;  3BPV A;  2XKP A;  3GFI A;  2F5C A;  4I98 B;  3ZMV A;  4Z2Y A;  4P9F A; 
#chains in the Genus database with same CATH topology
 3CMA I;  2MLG A;  1O3Q A;  4PFO A;  3BP8 A;  1BL0 A;  3VFZ A;  2ZJR F;  1R4M B;  2JA7 J;  3IKV A;  3OL3 A;  3A1Y A;  1QHH D;  3MFK A;  4LMY A;  1YE9 A;  3HC7 A;  3HJE A;  1NK3 P;  4DBR A;  3BLY A;  3KP4 A;  2DFH A;  3SFZ A;  2ZBK A;  3BCA A;  4MNU A;  1ZRE A;  2ID3 A;  3CJQ B;  5HDK A;  1TNT A;  2X9D A;  4IHS A;  1W1W E;  2GLO A;  1XGM A;  3EUH A;  3GME A;  3H0D A;  4ON0 A;  1E3H A;  2AXL A;  3GX4 X;  1P2F A;  2F5V A;  3F22 A;  1LE8 A;  1VQ8 I;  2GIV A;  2EZI A;  2L4A A;  1TWH J;  4I2O A;  1X2N A;  2X6Y A;  2ZME B;  1S3J A;  2VUM J;  1Z1D A;  3CME I;  4P5O A;  2ECB A;  5M5X J;  3F6V A;  3OS0 A;  1WHU A;  4HLX A;  4HST A;  3AG2 H;  3NAU A;  4RAY A;  4V2F A;  5M3F J;  4CCN A;  4MQ9 F;  2JA5 J;  1XSX A;  4XM3 A;  1WSU A;  6PAX A;  4CSW A;  2J5O A;  2R0Q C;  1HKT A;  5IPA A;  2KP6 A;  3GEZ A;  3CF5 F;  1EH7 A;  1T0F C;  3OR2 C;  1R5I D;  2BGC A;  2XF7 A;  3WTS C;  1EH6 A;  1J59 A;  5M3M J;  2VPL A;  2H94 A;  5DCM A;  3BQZ A;  4LK0 F;  2H1K A;  3JRB A;  1MGT A;  2LK2 A;  4I02 A;  1K78 B;  4Z6Y A;  1H89 C;  3L2C A;  1QRY A;  1F43 A;  2GA1 A;  2V6C A;  1PJR A;  2RC4 A;  2UWM A;  4RB2 C;  4E7S A;  1HBX G;  4I0B A;  5E3L A;  3VOD A;  2FBI A;  5HVQ C;  4A3F J;  1MSF C;  5CVR A;  3ZXS A;  1FYK A;  4DJA A;  1V55 H;  2W25 A;  4DZJ A;  2EZL A;  4HAM A;  1RR8 C;  1D8J A;  1MNM C;  1SVL A;  3HEF A;  3SDB A;  4S04 A;  2NAZ A;  3W6V A;  4GRI A;  1U9O A;  2ME6 A;  1MDM B;  1SAX A;  4MFD A;  2KL4 A;  1AU7 A;  2P4W A;  4BDZ A;  4QTR A;  5K1Y A;  2B9S A;  3AG4 H;  4LIU A;  1FP1 D;  3FBN B;  2KKO A;  5FFZ A;  3DU5 A;  4A0Z A;  3M9A A;  5DCF A;  2XSD C;  5D4S A;  1XDS A;  1F4K A;  4D0P A;  2ZXW H;  1MBG A;  2V9P A;  5C4J J;  1TZL A;  4A6D A;  4AVP A;  2LD5 A;  3IL2 A;  2ZJ2 A;  5E3O A;  3MZ8 A;  2HKO A;  3DXJ F;  3HOU J;  1UJ8 A;  5KCM A;  2E7W A;  4RAF A;  4II2 A;  2Y48 A;  3DFG A;  1J5Y A;  4I01 A;  4TV7 A;  1UAA A;  3WGG A;  3JRI A;  2PJR B;  2TCT A;  3B02 A;  3ZRG A;  2K4J A;  4BBS J;  4A3B J;  3UR3 C;  2JMW A;  1LEA A;  1J9I A;  2XAF A;  1DQU A;  1O7L A;  2P7V B;  5KVR A;  1FZP B;  3IRR A;  5CVV A;  3HUG B;  4MEY F;  1Z21 A;  2IRF G;  1CF7 B;  2PMU A;  2LG4 A;  3QPL A;  4KIT B;  4X1E A;  4XLN F;  3L09 A;  4IQ4 A;  2CUZ A;  2BVL A;  3HOZ J;  2GWR A;  2X6W A;  2DFF A;  3SEQ A;  2LKX A;  1U6G A;  2BV6 A;  1BR1 A;  3OIQ A;  1TLH B;  1Z0X A;  1K79 A;  3HUG A;  2H27 A;  2FSW A;  5GTH C;  1WVR A;  4OIP F;  5LRR A;  1K83 J;  4D5F A;  2XDV A;  3JCU C;  2OA4 A;  2VE8 A;  4ANJ A;  3ZP5 A;  3ZCO A;  1IV8 A;  3S2W A;  3U1K A;  3VPR A;  1DPR A;  2G9W A;  1U0J A;  3NAR A;  4RB0 A;  4WF2 A;  2C6Y A;  1XDU A;  5H6R A;  1QNT A;  3EUH C;  3P9I A;  4G7Z F;  2D1V A;  2RNG A;  4BDY A;  4CDG A;  4BJ5 C;  3S1N J;  4U7D A;  1W5C C;  2B0L A;  4CXF A;  2CSO A;  4F92 B;  2F5E A;  4AIK A;  3BG5 A;  2ZXI A;  1YIO A;  1Q1H A;  4XMY A;  1S6L A;  3H0G J;  3KP6 A;  4OWR B;  1QU3 A;  1L0O C;  2IGN A;  2OCE A;  3DTI A;  3BCB A;  3I4N J;  4KT6 A;  1T98 A;  1KU3 A;  3OSF A;  1VQN I;  2P5V A;  2PG4 A;  3I5U A;  3ZMD A;  1XPX A;  3TED A;  3E6M A;  4IL6 C;  5D4R A;  5JFR A;  4E70 A;  4NNJ A;  5GP9 A;  4UHT A;  1B8I A;  1ZRD A;  3OYH A;  3L2R A;  4V2G A;  3RKW A;  3ABM H;  1Y1W J;  2XF6 A;  3BZK A;  1MNE A;  1XN7 A;  1D5Y A;  2HQR A;  1G3S A;  3SHF A;  2X4H A;  4DZP A;  2XRL A;  2H09 A;  2HQ5 A;  2VKH A;  2P81 A;  3RKY A;  3DP7 A;  1BN5 A;  2CV1 A;  2VIX A;  3C18 A;  3D0S A;  3K6G A;  1HQC A;  3ABT A;  3HGY A;  4Y13 A;  5F1J A;  2HXO A;  4OIQ F;  1HST A;  1S8N A;  3DLA A;  4KJZ A;  5IYC J;  1QVT A;  4KUM A;  1LUJ B;  3R61 A;  1FLI A;  1RUO A;  1TW3 A;  4RGX A;  1XSD A;  4DYC A;  4ZYG A;  3CMM A;  2KPM A;  4BH9 A;  2CQ7 A;  3IP4 B;  3IWF A;  1JHF A;  2IA1 A;  3N97 A;  1TC3 C;  2PMH A;  1VQ4 I;  1HC8 A;  3IAS 2;  3J7A O;  4JP0 A;  1JUS A;  3C2G A;  3H36 A;  3LA2 A;  1D1C A;  3ZQC A;  2AO9 A;  3BC8 A;  3W6J B;  3AL0 C;  4EJT A;  1F36 A;  2XB5 A;  1S9H A;  2KJC A;  5K5R A;  5F1R A;  3D5L A;  5FO5 A;  2Y30 A;  2R7X A;  2EIL H;  1LE8 B;  3GZ6 A;  4G6Q A;  5HLI A;  3QPS A;  4ENM A;  1G3T A;  4FX4 A;  1R22 A;  3OIO A;  2EBI A;  3KP3 A;  4NDL A;  4AIJ A;  1REP C;  3FK6 A;  2AHQ A;  2MD0 A;  3M7G A;  2VQH A;  3S1Q J;  1KQ0 A;  3CJT B;  2PFB A;  1JJ8 C;  1W5S A;  4L0Y B;  4ZZD A;  2CJJ A;  4X6A J;  3D5S C;  3C1D A;  3SYT A;  1I3Q J;  2A5Y B;  1OYI A;  2QBY B;  2A07 F;  5IYB J;  1MBJ A;  1R4N B;  2M7A A;  2QF7 A;  2A05 A;  4M9S A;  1FT9 A;  3AFH A;  2Q1Z B;  4E7K A;  1BBY A;  3F0C A;  1VQL I;  1VQ6 I;  3HOY J;  4ZDO A;  2ZME C;  3U1D A;  3F72 A;  4F55 A;  4HV6 A;  3CLQ A;  1AHD P;  1X1P A;  2EIM H;  4FQG A;  4EQQ A;  4I76 A;  1QPI A;  5B3S H;  4O3M A;  2QCO A;  3HKZ A;  3VYS B;  2Z1D A;  4M3E A;  2R5Z B;  4CZC A;  2W57 A;  1QZY A;  2DMQ A;  5EYR A;  3G1L A;  3W2A A;  4BEH B;  2WY8 Q;  4Y52 J;  2JJ7 A;  4XLA A;  3G1M A;  4ZH4 F;  1U9N A;  1Y0U A;  1AWC A;  3ZQH A;  1BIB A;  4FTH A;  3S1M J;  2PMZ A;  1O3S A;  4DYR A;  2TRT A;  1TQI A;  4R1H A;  3WU0 A;  1NG7 A;  2HKX A;  5E79 C;  2R5Y B;  3V8J A;  4NQW B;  4XIC A;  1POG A;  1QZZ A;  4CCL A;  2F5D A;  2XKO A;  4YIF A;  1A35 A;  3FXU A;  4HZF A;  1X4O A;  3WTU C;  3I54 A;  1ON2 A;  3OS1 A;  4JX4 A;  3FXO A;  1J7K A;  3JRC A;  3PIP F;  3IHU A;  1OR7 C;  1D3Y A;  1ENH A;  2NVX J;  2LKP A;  3KYL A;  4XKW A;  3KEQ A;  1FYM A;  5CYV A;  1KQ9 A;  1ZQ3 P;  4BEH A;  2IP2 A;  3OYI A;  1UB9 A;  2DT5 A;  2ZB9 A;  3FXR A;  4FCY A;  2F4M B;  3CUO A;  4XQF A;  3JRA A;  1WJE A;  1L3L A;  1TTY A;  4Y7N J;  1JJ6 C;  2L5Q A;  3UNG C;  2A61 A;  3I4M J;  2TDX A;  4M9Z A;  4M3D A;  1JKR C;  3WHB A;  1U5T A;  2F2E A;  3RKQ A;  2CWE A;  4RGR A;  1N78 A;  1ETO A;  4KMU X;  4A12 A;  3JSP A;  5FB2 A;  2O8K A;  1ETV A;  1QVU A;  2HU9 A;  4ESF A;  4P9U A;  1Z67 A;  3G73 A;  3HTS B;  3L2V A;  3WE2 A;  4XN3 A;  5M5Y J;  4AC0 A;  2EIJ H;  2K9L A;  3I55 I;  4W97 A;  3SFI A;  2YU3 A;  3K70 D;  1C0W A;  4XRM A;  5IP6 A;  3I58 A;  2CQK A;  2LSO A;  2GM4 A;  2WAD A;  1FP2 A;  1TT0 A;  3KE2 A;  2LTP A;  5KNL A;  2V4J C;  1IRZ A;  4MTE A;  2EV5 A;  2BHY A;  3CCS I;  3LFK A;  5LFA A;  2DK8 A;  1FC3 A;  4CIC A;  2OQG A;  2ID6 A;  2CYY A;  2Q2E B;  1A5J A;  1RPW A;  1LVK A;  2VBW A;  2GA2 A;  2EIK H;  1P7J A;  3K2A A;  4LK1 F;  3HDD A;  2HXI A;  1PVE A;  2VB6 A;  5GTI C;  1MMG A;  4BKX A;  2P0W A;  3FM3 A;  1TWC J;  4CCK A;  4XLH A;  3IV5 A;  4IRG A;  4E7J A;  4BYY A;  1Z3X A;  2DA5 A;  1EJ9 A;  2DN0 A;  3KEO A;  2HPI A;  4RM3 A;  4P96 A;  2V9V A;  4RB3 C;  1VQM I;  3D5R C;  4AIH A;  5HOO A;  1IJW C;  2ZNZ A;  3F8M A;  1IXC A;  1OR7 A;  4WX9 A;  2BEO A;  2XAS A;  1E0E A;  2JA6 J;  5L3B A;  3DLL F;  1GUU A;  3KFW X;  3AG1 H;  2WAQ N;  1YS6 A;  3BTJ A;  3CJN A;  2DPU A;  1R6R A;  4B3X A;  1ZLJ A;  4AWX B;  1SD4 A;  4RBO A;  3DQV C;  4DBQ A;  2K40 A;  3DEW A;  3OYA A;  1NG6 A;  2EIN H;  4N4O B;  4S05 A;  3CCM I;  2AQE A;  4IOC F;  5EG0 B;  1FBS A;  3ZMU A;  2DDB A;  1B59 A;  2ZC2 A;  2FQ3 A;  2W7N A;  2VKV A;  2MA3 A;  2W24 A;  1GLN A;  3PNT A;  3RYR A;  2DA6 A;  3GLX A;  1GV5 A;  2CQN A;  2NVQ J;  1AA7 A;  3P9K A;  2FX0 A;  2Z33 A;  2BY0 A;  2IA2 A;  3NWT A;  3HOS A;  3IWZ A;  2DQR A;  1HF0 A;  5EJC A;  4PUS A;  1ZGA A;  3F8B A;  3DEE A;  2ZO4 A;  1YHQ I;  3MEX A;  2DMT A;  4HF0 A;  4J01 A;  1PUE E;  1DGR M;  4QIW N;  1KYZ A;  4OIN F;  1YO5 C;  3LSM A;  2K5C A;  2XRN A;  2H6C A;  3QU6 A;  5GAH J;  1XB4 A;  3WGH A;  5B5E C;  4MIM A;  5FLX Z;  3B6A A;  1W5T A;  5B1B H;  1EF4 A;  5IT3 A;  4GO1 A;  3LMM A;  4PGG A;  3JTH A;  4KIG A;  1ETW A;  2Y2Z A;  4GCV A;  1FX7 A;  3J80 K;  2O9L A;  4XLP F;  4I6Z A;  2EFW A;  2GZW A;  1OYW A;  3QYB A;  4EJW A;  3OYK A;  3MMY B;  1LDK B;  5E1X A;  2R7Z J;  1OCP A;  1SFX A;  2M87 A;  4AM3 A;  2O8X A;  2EFO A;  4BE2 A;  3BR5 A;  2XB0 X;  3FKJ A;  4XID A;  2XRO A;  3H5N A;  1FYL A;  1S5L C;  1JUM A;  3H1C A;  2VAS A;  3HG9 A;  2K7L A;  5F6F A;  2HNH A;  3D1N I;  1K6O A;  2W82 A;  1JXS A;  5BPI A;  3VOE A;  5DD8 A;  4A69 C;  4DYQ A;  2V9K A;  3CDH A;  1RNL A;  4BE1 A;  3BR1 A;  3J7A Y;  1YS7 A;  3KZI C;  1H8A C;  5IP7 J;  4BHP A;  3QOD A;  3AL0 B;  1R36 A;  1U5T B;  1ZG1 A;  2O61 A;  3K4J A;  2M9H A;  1FTT A;  4B44 A;  2ESN A;  5GAE J;  1ETK A;  1JTX A;  2EA4 A;  2FD5 A;  2KMU A;  2MFZ A;  3KP5 A;  2VL8 A;  4KIC A;  4RDU A;  1I3A A;  1HXD A;  2COB A;  2I5U A;  2DFE A;  3ZQG A;  4M71 A;  2K02 A;  1OIS A;  2XVC A;  1W0U A;  3FDY A;  2NS8 A;  2VXD A;  1FOY A;  3QPH A;  1XMA A;  1MMN A;  4CA0 A;  2YR2 A;  5BMZ A;  4QSH A;  1STZ A;  2DTZ A;  3IH2 A;  1D0Y A;  3HZJ A;  4OMZ A;  5DM6 F;  5E3M A;  4IF4 A;  5HDG A;  5FJ8 J;  5E17 F;  1WRJ A;  4NC7 A;  2R5Y A;  4RA2 A;  4F52 A;  1X3U A;  3EQL F;  3P9C A;  2ELH A;  3CDL A;  3EET A;  2HQN A;  2M7B A;  4OAY A;  3OS2 A;  4U0Y A;  1LFU P;  1KQ8 A;  1X2M A;  5FD5 A;  4HNV A;  3OL4 A;  3MWM A;  1W7P A;  1IF1 A;  2VC1 A;  2HYJ A;  1ITY A;  2LP0 A;  2IGK A;  4XRS G;  3OOU A;  4DGW B;  3ZN0 A;  5IT9 K;  1RKT A;  2KRF A;  3ZQL A;  2ELJ A;  3V4G A;  3M1C A;  5LEJ A;  1P4X A;  4K2E A;  1FJL A;  2HZT A;  1VQK I;  2R7O A;  4CH7 A;  2GAU A;  3GYH X;  2LY2 A;  5J3L A;  4ZYA A;  2DOE A;  2W48 A;  3HL2 A;  4GFB A;  5F04 A;  1MZB A;  5J1Y A;  2WC2 A;  1VTN C;  1SD6 A;  5DCM B;  1VQ7 I;  5H6Q A;  3BR6 A;  3LST A;  3B6C A;  1XMX A;  3CUQ C;  4GXO A;  1VQO I;  3DPT A;  5IOZ A;  3ELK A;  3I53 A;  5FLM J;  3Q5F A;  1KGS A;  1I5Z A;  4B47 A;  2WAQ A;  1OCT C;  4RGU A;  1KU7 A;  2BE5 F;  2M4G A;  2VQC A;  3CQZ J;  3HBL A;  3K69 A;  1X1B A;  2XHK A;  2VJI A;  4ZYH A;  4ZDL A;  1TWF J;  5AON A;  3L2Q A;  3S15 J;  3I0T A;  2D5V A;  4BY1 J;  2DW4 A;  4NC6 A;  1HW5 A;  4KYW A;  3C3W A;  2X1D A;  3GCM A;  5D8K B;  4IVN A;  3HYI A;  3VEP A;  2YSR A;  2DT7 B;  3LFU A;  4W1U A;  2M45 A;  3OV8 A;  1MMA A;  3HSE A;  1I6H J;  3LAP A;  1ZGW A;  3WG7 H;  1U3E M;  1F5T A;  2L9N A;  2VT3 A;  3GZ5 A;  1IDY A;  3JSO A;  2EZH A;  3BY6 A;  1B1B A;  1VZ0 A;  2M4K A;  3EUK L;  2ELK A;  3PM1 A;  2HOE A;  5HS9 A;  3UKG A;  4XOR A;  2O7O A;  2E35 A;  5JVT A;  1Y39 A;  1MJ9 A;  2KJB A;  3F8F A;  4OMY A;  1KZH A;  1LJ9 A;  2VBX A;  3PFY A;  1KYW A;  4L9J A;  3ECH A;  5TJJ A;  4GGG A;  1R5H A;  5C3E J;  2OZ6 A;  3KZY A;  3F21 A;  1FOK A;  2IS2 A;  5HOD A;  4BJT A;  4CZZ A;  3ZMT A;  2VOD A;  3QYE A;  4FHT A;  3CCR I;  1F1Z A;  2DTR A;  3ZQQ A;  2HOA A;  2FNA A;  4RB1 A;  2MBF A;  3IH3 A;  4C3J J;  1FOX A;  1BI2 A;  5K7F A;  4U7B A;  3VB2 A;  1XC5 A;  2PJP A;  2EA2 A;  2QVO A;  3FMS A;  4ESJ A;  1SC7 A;  2VBZ A;  2GOM A;  1VFC A;  2WV0 A;  1VF9 A;  1G6N A;  2M2E A;  5LGU A;  3L7W A;  2A5W A;  2QM3 A;  2IXS A;  4U88 A;  4ENN A;  1YIT I;  4IHY A;  3T8R A;  5BS6 A;  1PYV A;  1WJC A;  1R1T A;  1Z9C A;  3BQY A;  2KDZ A;  2GQQ A;  4BQA A;  1OYY A;  2IA0 A;  1T2K A;  2OU2 A;  3RTR A;  3BRO A;  3G1O A;  1HW2 A;  3QYF A;  4E4H A;  4KDP A;  1TWA J;  4I09 A;  1UHW A;  3GFM A;  3LSJ A;  3JRE A;  1VQ9 I;  3L9F A;  1V3F A;  3DV8 A;  2FU4 A;  4Y33 A;  4XKB A;  3MVP A;  1BJZ A;  2VOP A;  2XGD A;  2VON A;  1ZGJ A;  4JBA A;  2M5W A;  3BZ6 A;  3SZP A;  1GT0 C;  2UV1 A;  1Y56 A;  1ERD A;  4N4N B;  2HWV A;  3G2B A;  3L1P A;  3BTC A;  4IHV A;  3FBI B;  4BXF A;  3KP7 A;  3PNY A;  1K61 A;  3DTE A;  1WJD A;  5H2F C;  3HGG A;  2E2H J;  3K70 C;  4HA8 A;  3H5A A;  1X19 A;  2Y0S N;  4OAZ A;  4AVZ A;  2VQG A;  2HOS A;  1YX5 A;  4IOA F;  1R9T J;  1X3W B;  1TQM A;  5LHG A;  2J5P A;  3HIF A;  1ZHF A;  5K5O A;  2AXT C;  3OYC A;  1XD7 A;  2DOD A;  4XBF A;  3WOD F;  4HV5 A;  3BJ6 A;  2E71 A;  2YX7 A;  3PFI A;  1W7P B;  4EM2 A;  1Z6R A;  1IW7 F;  1JTY A;  5ILU A;  2M1B A;  2LF7 A;  5BOX A;  5FFX A;  4XOT A;  4CYC A;  1D5V A;  2BY2 A;  3RSN A;  3EYY A;  1OQY A;  3CCY A;  2E36 A;  3LSP A;  5E8I A;  2WWY A;  2FJ1 A;  3GBG A;  2PI0 A;  5EEH A;  4RLQ A;  1RZ4 A;  2QSG X;  2DAO A;  2LY9 A;  4RGS A;  1G3Y A;  1U5T C;  1X1D A;  1J09 A;  3GFL A;  3HOV J;  2KFD A;  3TDZ C;  2WV1 A;  5J8C A;  1O4X A;  1WWX A;  1BA5 A;  1ZG3 A;  5DDG A;  2JTV A;  4CO8 A;  5ED4 A;  4MEX F;  3A01 B;  5D5W B;  1IUF A;  3SEZ A;  3ISP A;  2DXI A;  1S72 I;  2F4O B;  1XCV A;  3OOP A;  3W3C A;  3EYI A;  1XGO A;  3E6D A;  4EJU A;  4QLC U;  2K86 A;  2DOA A;  2WB1 N;  5J40 A;  4J00 A;  5E1W A;  2JA8 J;  3KET A;  4RS8 A;  1QA6 A;  4U0V A;  3Q0W A;  3R60 A;  4KIB A;  1Y8Q B;  4MQV A;  4PJL A;  3S32 A;  3BR2 A;  4E7Z A;  1SEU A;  1J2X A;  3HSF A;  1LDJ A;  3WU1 B;  1IRX A;  2M30 A;  5ICE A;  4BE0 A;  4NC8 A;  4L9N A;  4AID A;  2R93 J;  4Q48 A;  1FOW A;  3CCE I;  1SFK A;  1XGN A;  1ZLK A;  1ZAO A;  4XLE A;  2YS9 A;  2KZG A;  1IN4 A;  1T8I A;  4A3D J;  2RV8 A;  3VYT B;  2CV2 A;  2WB1 A;  3PO2 J;  1T39 A;  3RQI A;  2PJR A;  2ACJ A;  3TL4 X;  5HLH A;  3M8J A;  3ZMZ A;  1XGS A;  4M74 A;  2PBI A;  5D5V B;  2B63 J;  2FNP A;  3C7J A;  4MLO A;  2FMY A;  5EEA A;  2HVR A;  3O6B B;  1Z3Y A;  2HYG D;  3H92 A;  3FHZ A;  2W84 A;  2Y0M A;  4S0H B;  1J75 A;  4LIT A;  4C9Y A;  2EZK A;  1V5F A;  3KP2 A;  2JVG A;  4BY7 J;  2FUG 2;  4LIV A;  3FXJ A;  2CV0 A;  5LLQ A;  2L3D A;  3SQN A;  1FTZ A;  3BG7 A;  3A03 A;  4PJM A;  1MBH A;  1ODD A;  1ZH5 A;  4F93 B;  2L02 A;  3BZC A;  4Q5S F;  2B7E A;  1UMQ A;  3DPU A;  3OY9 A;  2JA2 A;  2P7C B;  3RZO J;  2XV4 S;  3SZG A;  2V1X A;  1IAW A;  1ZR2 A;  2BW3 B;  1DGW Y;  3V8L A;  1IRF A;  3ZN1 A;  4AD9 A;  2KRC A;  5GAG J;  2L2O A;  4KMF A;  2X85 A;  3FF5 A;  4U0W A;  4XLC A;  1IZ1 A;  3COA C;  2HZD A;  2FF4 A;  4O6J A;  5J4V A;  1IG7 A;  1RKW A;  1P4A A;  4IHT A;  1LFP A;  4PZJ A;  1B6A A;  2ZSH B;  3E0J B;  1NHA A;  3BWG A;  4JK1 X;  3PO3 J;  1D1A A;  2FOK A;  1S29 A;  3LSK A;  2Z3Y A;  5L3F A;  5EGO B;  3KYD B;  4D1Q A;  1BC8 C;  1QO0 D;  2KIS A;  1EKE A;  4ABZ A;  1X3Z B;  5HS8 A;  5HNF A;  2FBK A;  3REO A;  2K9M A;  2Y9Z A;  4JX6 A;  4J19 A;  1X1C A;  2VKE A;  4PSX A;  1SMY F;  2HVS A;  2O3F A;  3M07 A;  3U9G A;  2GXB A;  2XGC A;  5L3D A;  4FX0 A;  2JN6 A;  2ZFW A;  3AAF A;  3MQ0 A;  3S3N A;  1SD7 A;  2OUM A;  3VSK A;  4D7M A;  2XUB A;  3HB9 A;  3TO9 A;  3S93 A;  1LVA A;  2M8E A;  3FZV A;  4G8X A;  2CW7 A;  4C3H J;  2IS6 A;  2K3F A;  5LD2 C;  1TL8 A;  3HPG A;  4UV9 A;  3FWE A;  1DUX C;  2GXA A;  3PJR A;  4LOC A;  3GTL J;  3HM5 A;  2V7F A;  3GW2 A;  2M3A A;  2RQQ A;  3NEU A;  3IH4 A;  1T38 A;  2QKM B;  1RUN A;  4BJ6 C;  2XAJ A;  2YPR A;  5IP9 J;  1E3P A;  1PP7 U;  1R1U A;  2CO5 A;  3MZY A;  1JGG A;  1E3O C;  4KIF A;  4Y17 A;  3JRD A;  4A2U A;  3I4P A;  3IC7 A;  3LSR A;  4II3 A;  1BI3 A;  4L5I A;  2KIM A;  2K3P A;  1IN8 A;  2BY1 A;  3TOA A;  4G94 A;  2LC2 A;  4HOB A;  1UG0 A;  3WTZ A;  2L0K A;  1IDZ A;  1G8X A;  4FE7 A;  3R0J A;  1OLT A;  4E7I A;  1KU2 A;  1UHS A;  2QQA A;  3K4C A;  2CFX A;  2KIQ A;  1HLV A;  5DUI A;  3ZMS A;  4I7H A;  3N05 A;  4IKF A;  1FMW A;  4PGH A;  4AU7 A;  4BUP A;  5E1Z B;  4YFN F;  2ECC A;  2DPD A;  2IVM A;  2Y9Y A;  3FX3 A;  2IAI A;  1FIA A;  5DYM A;  3L2W A;  3QPT A;  4AYB A;  1WGX A;  1XS9 A;  3F8N A;  9ANT A;  1GDT A;  5CJ9 A;  5L3G A;  2STW A;  2V1N A;  3ERE D;  4N9H A;  3OYG A;  3T8T A;  3SXY A;  3Q0U A;  2PN6 A;  1YJW I;  1RET A;  4EGZ A;  2UXX A;  4UVC A;  1Y6I A;  3NQO A;  5BQT A;  2R5Z A;  3GVA A;  3T5X A;  2V79 A;  2BYV E;  4MGR A;  2Z2S B;  2QA4 I;  2VI6 A;  4PDK A;  2DJI A;  1SMT A;  2OJE D;  1K4S A;  2RRE A;  4M6Y A;  4IJA A;  3ROU A;  1NK2 P;  2CU7 A;  2FML A;  3CUQ B;  3O2P E;  1LFB A;  4DOZ A;  1ONV A;  1K4T A;  2E1C A;  2X6O A;  2JSC A;  1Z05 A;  2NS0 A;  1ULY A;  2LY1 A;  3U2R A;  4A6E A;  2DBB A;  4A3J J;  5DV5 A;  4G7O F;  3V7S A;  2QLZ A;  2ME0 A;  5CVU A;  3DBL B;  2QGU A;  2WAE A;  2Y31 A;  4Y4R A;  3QP5 A;  3A2K A;  5B1A H;  5EZH A;  3DEU A;  3L00 A;  3CCQ I;  3E5U A;  4IRI A;  2CS3 A;  2FE3 A;  2O0Y A;  3EUA A;  4M3B A;  3RIR A;  1WPK A;  1G59 A;  3IRQ A;  3OIP A;  1FPQ A;  2BVM A;  4H0E A;  4LFU A;  2OV7 A;  3C2H A;  4OOI A;  4XSX F;  4CGZ A;  1OMI A;  1UST A;  4OU0 A;  2X0L A;  3K4B A;  3MD2 A;  4Q4Z F;  3A0H C;  4R79 A;  4A3I J;  4LD5 A;  1MBF A;  1O3T A;  4DQ2 A;  2E5N A;  5HLG A;  3LSG A;  1LDD A;  2HGC A;  4XR6 A;  5ICC A;  4MFE A;  3CC4 I;  5J4Y A;  2O6G E;  4ENJ A;  4NUB A;  3BR3 A;  3MKY B;  1VQP I;  2I8D A;  1A36 A;  2R7U A;  1P4W A;  4BHB A;  3PSF A;  3CO7 C;  5GPA A;  3K1P A;  4MHG A;  2LDU A;  1LNW A;  5DS9 A;  3H9J A;  3DTK A;  2LBF B;  1HKS A;  2XF5 A;  3X2Q H;  1GXP A;  4M73 A;  2K9N A;  3EPZ A;  4NHJ A;  5GPC A;  2RAE A;  3K2Z A;  2JK3 A;  3GTP J;  2EPF A;  2V6E A;  2QWW A;  2HOT A;  3CZ6 A;  3WTT C;  5EEG A;  5E3N A;  2KDO A;  5K7Z A;  3FIS A;  2OTL I;  4XLF A;  3S3M A;  3HKZ N;  1KA8 A;  3A01 A;  4GDF A;  2PMZ N;  5HS7 A;  1QQI A;  4UUV A;  1WCM J;  2MH2 A;  4DW6 A;  2EFQ A;  3E5X A;  2EWN A;  3PIO F;  1WJF A;  2IW5 A;  1BR2 A;  3TP0 A;  1IO2 A;  1YX3 A;  3K10 A;  2FA5 A;  2LR8 A;  3TO7 A;  3WHC A;  2CQX A;  2CMP A;  1AOY A;  2G0E A;  1X4P A;  4P9F A;  1TP4 A;  2FEZ A;  1YRN B;  2DQL A;  2K85 A;  1OCR H;  4MO7 A;  3ML6 A;  1SD5 A;  1OCC H;  3O8G A;  2GBY A;  1Y1V J;  1IV6 A;  3CF2 A;  4XRS A;  4IHW A;  1ZN2 A;  2RKH A;  4C3I J;  3WG9 A;  2RN7 A;  2VJ4 A;  3K9T A;  3LWF A;  3OYB A;  3SDG A;  4BAY A;  2L9V A;  3F9K A;  3WGI A;  3HXL A;  2QQ9 A;  3FIW A;  4IRH A;  3ERM A;  5FD6 A;  2XGX A;  4G7H F;  1PDN C;  4A3M J;  1S7O A;  2XAG A;  3WE3 A;  4X0G A;  3FXK A;  2DT6 A;  2K27 A;  3BTL A;  1A04 A;  4XOP A;  4OIR F;  4BQQ A;  2R7S A;  2IS1 A;  1UHM A;  2H1L A;  3V42 A;  1BC7 C;  4CCO A;  1IUY A;  1Z7L A;  1J0R A;  4BXU A;  4RMN A;  1JKO C;  1WJ5 A;  2LOO A;  2ICW G;  2OZU A;  1BIA A;  5CKT A;  3HRT A;  3LSH A;  3JR9 A;  4C2T A;  2LVS A;  2QKL B;  2DMP A;  3K0L A;  4HDV A;  1I1G A;  1FIP A;  2VE9 A;  1FMV A;  2DDA A;  3CP2 A;  5F08 A;  4LGW A;  2XGE A;  1W4M A;  2WAF A;  4WXC A;  3V7C A;  4LG0 B;  1YJN I;  5D6E A;  2BHZ A;  5CQG A;  2KT0 A;  3FK7 A;  2VKD A;  4XL9 A;  4LB5 A;  3I59 B;  1OJL A;  2ISY A;  4EMS A;  4UNO A;  3E5Q A;  3BTI A;  4FT8 A;  3TW6 A;  4WWC A;  1VQ5 I;  4HF2 A;  4UVA A;  2F48 A;  3W6K B;  4A3L J;  2NOJ B;  2COM A;  2VXZ A;  3DCF A;  4UXN A;  1PUF B;  3BG3 A;  2E19 A;  4I0A A;  4UUS A;  5J1R A;  3CJR B;  4JYK A;  3LQQ A;  3DKW A;  4XRF A;  2JPB A;  4DNC A;  1Q1V A;  2A6E F;  2MAB A;  1HOM A;  5J1U A;  1JI8 A;  1IXR C;  2DA4 A;  3QOP A;  1O3R A;  2JRM A;  4EM1 A;  1GVJ A;  2QUF A;  4ZTF A;  5JVG F;  3WU2 C;  2W4S A;  4P55 A;  2R7V A;  4XON A;  3H9G A;  2DMN A;  3FXM A;  1FEX A;  2NNY A;  2JPC A;  2P5L C;  2WY7 Q;  3VSL A;  5E18 F;  3IKT A;  5BNG A;  1BW6 A;  4QWQ A;  4HYE A;  4B1R A;  2E1M B;  5FRN A;  5DUK A;  1GXQ A;  2HR3 A;  1UCR A;  3EDP A;  1EH8 A;  1IGN A;  2YUS A;  2L7K A;  2H8R A;  1XG1 A;  3RQ4 A;  1B9M A;  1Z7U A;  2DLL A;  2G7H A;  4HNU A;  2G7U A;  2O03 A;  1MJA A;  2EV0 A;  3F6O A;  5FKK A;  4HLY A;  2NOG A;  2Y75 A;  3J7Z I;  2OQR A;  2BOL A;  3GLL A;  3GUD A;  2ZNY A;  3Q0V A;  3MKZ A;  3OYL A;  1SFU A;  3OR1 C;  3CDI A;  1DU0 A;  1U8R A;  2OAZ A;  3QAH A;  4FAS D;  1G2H A;  5LGN A;  3PQJ A;  4KNY A;  3GO5 A;  5EGO A;  2NXN B;  1O57 A;  5LGT A;  2CH0 A;  4KN4 X;  4QPQ A;  1ZRC A;  2E2J J;  1QHG A;  2CQQ A;  3PUB A;  2P5K A;  2E1O A;  4HEA 2;  3ZOB A;  4A3E J;  2STT A;  2CRG A;  2R7Q A;  3BPX A;  4XNF A;  3F8C A;  1H0M A;  4UB8 C;  3MZH A;  2XAQ A;  1NH3 A;  3S16 J;  4YII A;  2Q2E A;  4XK4 A;  4ITV A;  4G9Y A;  1LEB A;  2EFN A;  4M9X A;  3J81 K;  1UZC A;  2M0C A;  4WCG A;  3VDX A;  4HPQ A;  5C44 J;  3VYR B;  1JE8 A;  2O5R A;  1ZRF A;  3T0Y A;  1BI1 A;  3LSI A;  4ESB A;  4PFP A;  1H9T A;  5IYD J;  1ORK A;  1ETX A;  2IGO A;  3LAJ A;  1BOB A;  5EZG A;  1MBK A;  4M3G A;  1R5G A;  2MW8 A;  1UG2 A;  1DPU A;  5FKN A;  1A6I A;  1T33 A;  3S3O A;  2DYR H;  1QGP A;  4LLL A;  1YW8 A;  5F0F A;  3E1S A;  4M72 A;  2X48 A;  1QBJ A;  1E2X A;  3TO6 A;  1UEL B;  4D7N A;  3VYU B;  2IS4 A;  2X6X A;  1WH5 A;  1U78 A;  4F91 B;  5F27 A;  4PJ0 C;  3DWL E;  3RI4 A;  2RGV A;  3CTA A;  1W36 C;  3ABL H;  4A0X A;  5K5Q A;  1QPM A;  1PUF A;  4GYG A;  4IX7 A;  5DTD A;  3KX2 A;  5DD4 A;  2L9S A;  2DA3 A;  3OYE A;  5DM7 F;  1RC9 A;  3TOB A;  3R6S A;  1I50 J;  3J80 Z;  3M8F A;  2L4M A;  2NVT J;  1USS A;  1DDN A;  2CUE A;  1T95 A;  3PUF A;  2V1D A;  1B8I B;  1I27 A;  2MC4 A;  4F7Z A;  3CC7 I;  1IN7 A;  3I59 A;  2K4B A;  2GIZ A;  3AG3 H;  2QZ8 A;  4HX7 A;  2XAH A;  2ETH A;  3K7A J;  3KEY A;  2A68 F;  4HX8 A;  3ZQF A;  2V26 A;  2CFO A;  2I10 A;  4LLN A;  2BBY A;  4E6K G;  3RZD J;  2R7D A;  2KLO A;  4BQO A;  4HQM A;  5D8L B;  1SFE A;  4PJJ A;  2X1C A;  3M1E A;  3K4K A;  1V5G A;  2DA2 A;  2MG4 A;  2JQ7 A;  2VJJ A;  4HX4 A;  4M3F A;  3JW4 A;  4ZYE A;  4CCJ A;  2JUC A;  4XN0 A;  5HLT A;  4FE4 A;  4A3G J;  1ZAR A;  3J81 Z;  5L3E A;  5A2Q Z;  1MW7 A;  4BNC A;  2R7R A;  3PQK A;  2OC6 A;  1BM9 A;  3KPH A;  3QWL A;  4B3A A;  3ESW B;  1OFC X;  1TT5 B;  1HW1 A;  5J6X A;  4A5M A;  3CLO A;  3JAM Z;  1MKM A;  2QYO A;  3CCV I;  2L54 A;  1K6Y A;  4R8H A;  3AKZ A;  3M3Y J;  2FRH A;  1R00 A;  3O3K A;  3FXQ A;  5LEK A;  4YIR X;  2BZT A;  4UB6 C;  2UUZ A;  5CLS A;  4L5E A;  3FHN A;  1YI2 I;  1HDP A;  5CQE A;  2DYS H;  3H9Q A;  1YOV B;  4ENK A;  3E6B A;  4L18 B;  1YRN A;  1I6X A;  1ETQ A;  1LKX A;  2HDW A;  3V7R A;  4A0Y A;  4CYC B;  3H3V K;  4XKV A;  5JLW A;  4JOM A;  5ILS A;  1D1B A;  3A0B C;  3F23 A;  2ZXH A;  2L01 A;  3TBI A;  2F5F A;  3CO6 C;  1OPC A;  1BI0 A;  4ZTJ A;  3RDI A;  1ZR4 A;  2EK5 A;  2MLK A;  5H20 A;  3ONQ A;  3CC2 I;  4O5V A;  1HCR A;  5GAD J;  3WTX C;  4KN7 X;  1MJB A;  3K1N A;  1JHH A;  3VWB A;  1NTC A;  4EAT A;  2X51 A;  4N0B A;  5ICG A;  2LRE A;  2A3S A;  1IRG A;  4B09 A;  3OYF A;  1HA8 A;  1WKM A;  2FOW A;  2ZFU A;  3WTY C;  3RYP A;  1YG2 A;  3MKL A;  2HVQ A;  3GF2 A;  2XPV A;  2DMU A;  3S14 J;  2ESH A;  1MH4 A;  4RAZ A;  1JKQ C;  1MMD A;  1TWG J;  4HDU A;  4L9T A;  2LYC A;  2D2W A;  1TNS A;  4Y15 A;  4IXA A;  5FKM A;  3OYM A;  2DA7 A;  1WI9 A;  4M6V A;  1K7A A;  2DCE A;  5HNH A;  2HDD A;  3JTG A;  1IXS B;  2XIG A;  3LA3 A;  2PX9 A;  5J47 A;  4HRI A;  2JUG A;  2VLA A;  1W36 D;  1XCB A;  1RR7 A;  2DFI A;  4B43 A;  2ZXJ A;  2R3S A;  2VQL A;  2YU9 J;  1YJ9 I;  4M6X A;  2HI3 A;  3H35 A;  5E20 A;  1S7A A;  3FMQ A;  5CPR B;  4Y3O A;  1KU9 A;  4YEJ A;  2E5Z A;  1RI7 A;  2MC3 A;  3P5J A;  3CD6 I;  3GXO A;  1T0F A;  1ZYR F;  2MYS A;  3PSI A;  2LH9 A;  4UUT A;  5A2Q K;  3BT9 A;  4UY8 I;  2IGM A;  5CVI A;  5F0C A;  4RM2 A;  5FLV A;  2EJR A;  3LQR A;  1H88 C;  2RDP A;  1QZE A;  1TQP A;  5KHD A;  4D5C A;  3I64 A;  1B4A A;  3TMO A;  2UZK A;  3W2V A;  3I3L A;  1JT0 A;  3DKX A;  1FBQ A;  1YW7 A;  2NRA C;  1DP7 P;  1D0Z A;  2CW0 F;  4BS9 A;  4C2M J;  3O8H A;  1MIJ A;  1LB2 A;  4ZYD A;  2E1M C;  4XSZ F;  2GOX B;  3A02 A;  2OBP A;  3BG9 A;  4FET A;  2LRD A;  2L9R A;  5FLX K;  1Y0N A;  2Z16 A;  4HSR A;  1TW2 A;  1Y8R B;  4L5J A;  1ON1 A;  4HF1 A;  3SZT A;  5TGT A;  4HNT A;  2ISZ A;  3HOX J;  2JZY A;  5JI6 A;  5DEQ A;  5D6F A;  2NNN A;  5ICF A;  2K9S A;  1E17 A;  2BW3 A;  3BJA A;  5KAI C;  2M34 A;  1N77 A;  2PLY A;  1WI3 A;  1BW5 A;  3HHG A;  4E7H A;  2DJN A;  1HDD C;  5TIS C;  1P7I A;  5LHI A;  2VBY A;  4P1W A;  3DBH B;  3GZN B;  1S7E A;  4JQF A;  5LBQ A;  2FBH A;  2QSH X;  3WTW C;  1XSV A;  3HRU A;  3M8E A;  4IEJ A;  2HS5 A;  3OYN A;  4EJV A;  2QBY A;  5LRS A;  2X1E A;  2XPU A;  5M5W J;  3T1B A;  1W7P D;  2JSP A;  1B9N A;  2NVU B;  5LHH A;  3Q9V A;  3ZR8 X;  1JUP A;  2K9Q A;  1APL C;  5L3C A;  2MH9 A;  3LL7 A;  1UFM A;  3QP6 A;  1V54 H;  3I9V 2;  5FKO A;  4UUS B;  1WJB A;  1G3W A;  2VOO A;  3ULQ B;  4YFK F;  1MMS A;  3GTJ J;  3GWZ A;  4L9V A;  1ACI A;  2IBD A;  4NBQ A;  1ZK8 A;  3H5R A;  3HPH A;  3R0A A;  4I99 C;  1FY7 A;  4LB6 B;  2EV6 A;  2WA0 A;  1FSE A;  4KFC A;  2OCC H;  1ZEL A;  2IEK A;  4LLG F;  5J8F A;  1RRJ A;  1H9G A;  1ZG5 A;  2W1O A;  1O7F A;  1X1A A;  2R4G A;  3L2U A;  4BBR J;  4ZC3 A;  1OCZ H;  1TBX A;  4ASN A;  2E7X A;  4HBL A;  2Q8K A;  3OYJ A;  4B4C A;  2OTJ I;  5ILV A;  3BOQ A;  4A3K J;  1ETY A;  1LQ1 A;  2VPR A;  2FXA A;  4H4K C;  3K4N A;  3FXL A;  5EG0 A;  3N4M A;  2R7T A;  3DF8 A;  3TGN A;  2KHM A;  4DIQ A;  1U8B A;  3GTG J;  1A6Q A;  2EFP A;  2Q0O A;  3J7Y J;  1R23 A;  2GXG A;  2L7F P;  1LPQ A;  3B73 A;  4BQN A;  3V8K A;  2LMD A;  3HOW J;  1R1V A;  2F6C A;  2KZV A;  4KIS A;  1R49 A;  5IT9 Z;  3TW7 A;  3TP3 A;  2Y0S A;  2E1N A;  5JR3 A;  3E97 A;  4GYI A;  4N9I A;  4YG2 F;  5KK1 A;  5JLX A;  4AYB N;  5D5U B;  3QRF F;  3BJO A;  4EM0 B;  4FIS A;  3TQN A;  2HPM A;  2YX4 A;  1FSH A;  2EH3 A;  2IPQ X;  4WK8 F;  3JAM K;  2HDC A;  5EDN A;  2AS5 F;  1JT6 A;  2Y69 H;  2CUF A;  3A4C A;  3C2B A;  1XX5 A;  2R7F A;  1WQ2 A;  3BDD A;  2DU9 A;  2QEN A;  3RCO A;  2CGP A;  2FQ4 A;  2RNJ A;  1OKR A;  2BXZ A;  4ZJZ A;  1R71 A;  2R92 J;  2E34 A;  3PNV A;  3BR0 A;  3S2H J;  2ZJQ F;  2MSY A;  2KIU A;  4BL0 B;  2P6T A;  5HDN A;  4B8X A;  3ABU A;  2VJ5 A;  3GTK J;  1FWZ A;  1WH7 A;  3CCU I;  1X58 A;  5IY5 H;  1MSE C;  2CG4 A;  3CCL I;  3ZQI A;  3KIO A;  4WXH A;  3MN2 A;  3NWS A;  2DK5 A;  1Z77 A;  3FMR A;  2DOF A;  3DPL C;  2IJL A;  3TDU C;  2NS7 A;  3K1M A;  2MD5 A;  4IPA A;  3QOE A;  4EEF G;  3U21 A;  4HW0 A;  1AKH A;  1M1E B;  1ZKG A;  1U2W A;  3I71 A;  2WBM A;  1MND A;  2KRH A;  2PEX A;  5C4X J;  2QQB A;  3KLO A;  4F3Q A;  4G6D A;  1N25 A;  3ABK H;  5FRO A;  3RKX A;  1HKQ A;  2Z99 A;  1CF7 A;  3E7L A;  3ZGK A;  4NB5 A;  2H8W A;  2Z9O A;  1WFX A;  3GTM J;  4IZZ A;  3ECO A;  1CQT A;  2M8G X;  3DBR B;  4BXX J;  1YIJ I;  2HTS A;  2W00 A;  1XMK A;  2JWT A;  4ETS A;  2OPT A;  4BHC A;  2JRT A;  2HTJ A;  3JRG A;  2NYX A;  2ZSI B;  5FGM A;  1SAU A;  3PL8 A;  4LG0 A;  4KT5 C;  4RLF A;  4YRV A;  5IOY A;  5F64 A;  3OYD A;  4NQW A;  2AQF A;  1YLF A;  3RPU A;  4UV8 A;  3LA7 A;  2P8T A;  1PP8 F;  4EV0 A;  3SJM A;  3G4S I;  4A5N A;  4HQE A;  3G71 I;  1I1S A;  2HFH A;  2VC0 A;  5AIP A;  1GHC A;  4PJN A;  1N75 A;  4LG3 A;  2HQA A;  2L7Z A;  1I39 A;  3KLN A;  2BXY A;  3E3V A;  5FRM A;  4YEL A;  3MCZ A;  3HRM A;  3ZQ7 A;  4BGD A;  2M0M A;  3OWT A;  1RES A;  4C30 A;  2NVY J;  2D1H A;  1Z91 A;  1YQA A;  3G6E I;  1F9N A;  1WZ2 A;  1GVD A;  2CUJ A;  2BY3 A;  4CYD A;  1Z6T A;  1D0X A;  1IN6 A;  3Q9S A;  3JRH A;  4LJZ F;  1YTY A;  4G6T B;  3DU6 A;  1MBE A;  2QEX I;  2OD5 A;  2E2I J;  2R7W A;  1VI0 A;  3KCC A;  3HOT A;  3M4O J;  1P6R A;  3DKY A;  2IT0 A;  4CHU A;  3P7N A;  1K78 A;  2ZCW A;  2H6B A;  2QSF X;  1WJA A;  5E8G A;  2P6S A;  2PQ8 A;  2OF7 A;  4G12 A;  5TRD A;  1CGP A;  1V4R A;  1VND A;  2VT2 A;  3H3Z A;  2LF8 A;  1IN5 A;  3TKY A;  2JVH A;  1FNN A;  2DI3 A;  3HHH A;  3GTO J;  4A93 J;  5FKL A;  2VN2 A;  4YFX F;  2A6H F;  4L0Z B;  5JHF A;  2HEO A;  4EJO A;  1R7J A;  2F4I A;  1MD0 A;  3HSR A;  3IUO A;  1RIO H;  2V1U A;  2RQP A;  4U87 A;  3RJP A;  4MTD A;  3FM5 A;  3ASN H;  3H3U A;  1A31 A;  2LBF A;  1T56 A;  4IQJ A;  1D8K A;  1AKH B;  3HTU A;  3KZZ A;  1DP3 A;  4OIO F;  3OMY A;  2WTE A;  4B48 A;  1MH3 A;  4E7L A;  3IAM 2;  3Q3S A;  2A69 F;  2ADU A;  1SVO A;  4BU2 A;  1T08 B;  4EVI A;  3R4K A;  1MDM A;  4ZZL A;  5BPD A;  1OCO H;  4PK4 A;  3K4L A;  2E60 A;  3K4M A;  2LFB A;  2RVC A;  2W85 A;  2KQR A;  1DU6 A;  4UVB A;  4HG2 A;  3CMY A;  3I56 I;  4CUG A;  1P92 A;  1EV7 A;  1G4D A;  4BAC A;  3FKI J;  1IC8 A;  2A6T A;  3ZPL A;  2XAU A;  2MGQ A;  1BJA A;  3WTV C;  4WXD A;  4C2U A;  1BOA A;  1B72 B;  3S2D J;  2Z5U A;  1V5E A;  3HRS A;  3QU3 A;  5ERI A;  3S8P A;  1FBU A;  1GV2 A;  3NRV A;  3GTQ J;  2L7M P;  3ASO H;  1YYV A;  1EA3 A;  3JRF A;  2ZJP F;  5JHU A;  4IHX A;  2DO7 A;  4Q47 A;  2LKS A;  3MKW B;  1YFH A;  1W0T A;  3CUQ A;  5KAF C;  2UXN A;  3RPU D;  4CCM A;  5D5X B;  2EQR A;  4KA4 A;  2XSJ C;  2XPW A;  3MAJ A;  3OSG A;  2LLK A;  2CW8 A;  3CES A;  1JGS A;  5EF6 A;  1XTA A;  2HYF A;  1YW9 A;  1JKP C;  5AIQ A;  1P9Q C;  1T6S A;  2XC7 A;  4V19 K;  1BR4 A;  3QQA A;  1ZTR A;  3G3Z A;  3RPQ A;  4IO9 F;  4PCQ A;  3KYC B;  4PSW A;  1SFO J;  2EB7 A;  4JX5 A;  2ZKZ A;  4AUX A;  2JT1 A;  4XKC A;  3LNQ A;  2N8G A;  4A3C J;  2ZME A;  4QPO A;  3S17 J;  2LNB A;  5CVJ A;  1HSJ A;  3E6C C;  2DA1 A;  2KIF A;  4D9J A;  4EGY A;  3F3X A;  3S1R J;  5K7H A;  2D45 A;  1B72 A;  3BG6 A;  1R58 A;  3BPV A;  4RAG A;  2XKP A;  3GFI A;  1SVM A;  5F0H A;  2F5C A;  3CCJ I;  3LOC A;  3W2W A;  4I98 B;  3ZMV A;  1SAN A;  2QQ8 A;  4Z2Y A;  5B66 C;  3CP8 A;  4ZDP A;  3GFJ A;  1KON A; 
#chains in the Genus database with same CATH homology
 2MLG A;  1O3Q A;  3BP8 A;  3VFZ A;  3IKV A;  3MFK A;  4LMY A;  3KP4 A;  3SFZ A;  2ZBK A;  1ZRE A;  4MNU A;  5HDK A;  1TNT A;  4IHS A;  1XGM A;  3EUH A;  4ON0 A;  2AXL A;  3GX4 X;  1P2F A;  3F22 A;  2GIV A;  2L4A A;  4I2O A;  2ZME B;  1S3J A;  1Z1D A;  4P5O A;  3F6V A;  4HLX A;  4RAY A;  4MQ9 F;  1XSX A;  1WSU A;  6PAX A;  2J5O A;  1HKT A;  3GEZ A;  1EH7 A;  2BGC A;  3WTS C;  1EH6 A;  1J59 A;  2H94 A;  5DCM A;  4LK0 F;  1MGT A;  4I02 A;  1K78 B;  3L2C A;  2GA1 A;  2V6C A;  2RC4 A;  2UWM A;  4RB2 C;  1HBX G;  4I0B A;  3VOD A;  2FBI A;  5HVQ C;  5CVR A;  1FYK A;  2W25 A;  4HAM A;  1D8J A;  4S04 A;  2NAZ A;  1MDM B;  1SAX A;  2P4W A;  5K1Y A;  1FP1 D;  2KKO A;  5FFZ A;  4A0Z A;  3M9A A;  5DCF A;  5D4S A;  1XDS A;  1F4K A;  4D0P A;  4A6D A;  4AVP A;  3IL2 A;  2ZJ2 A;  2HKO A;  3DXJ F;  3GFJ A;  2E7W A;  2Y48 A;  3DFG A;  1J5Y A;  4I01 A;  4TV7 A;  3WGG A;  3B02 A;  2K4J A;  1LEA A;  1J9I A;  2XAF A;  1O7L A;  2P7V B;  5KVR A;  1FZP B;  3IRR A;  5CVV A;  4MEY F;  2IRF G;  1CF7 B;  2PMU A;  4XLN F;  3L09 A;  2GWR A;  1U6G A;  2BV6 A;  1TLH B;  1K79 A;  3HUG A;  2H27 A;  2FSW A;  4OIP F;  5LRR A;  2OA4 A;  2VE8 A;  3ZP5 A;  3S2W A;  1DPR A;  2G9W A;  4RB0 A;  4WF2 A;  2C6Y A;  1XDU A;  5H6R A;  1QNT A;  3P9I A;  4G7Z F;  2D1V A;  4CDG A;  4U7D A;  2B0L A;  4CXF A;  2CSO A;  2F5E A;  4AIK A;  1YIO A;  1Q1H A;  1S6L A;  3KP6 A;  1L0O C;  1T98 A;  1KU3 A;  2P5V A;  2PG4 A;  3I5U A;  3ZMD A;  3E6M A;  5D4R A;  5JFR A;  4E70 A;  4UHT A;  1ZRD A;  3RKW A;  1XN7 A;  2HQR A;  1G3S A;  3SHF A;  2X4H A;  2H09 A;  3RKY A;  3DP7 A;  1BN5 A;  3C18 A;  3D0S A;  4Y13 A;  1HQC A;  3ABT A;  4OIQ F;  1HST A;  1S8N A;  4KUM A;  3R61 A;  1FLI A;  1RUO A;  1TW3 A;  4RGX A;  1XSD A;  4ZYG A;  4BH9 A;  3IWF A;  1JHF A;  2IA1 A;  3N97 A;  2PMH A;  3J7A O;  3LA2 A;  3W6J B;  4EJT A;  2KJC A;  5K5R A;  5F1R A;  3D5L A;  5FO5 A;  3GZ6 A;  4G6Q A;  5HLI A;  4ENM A;  1G3T A;  4FX4 A;  1R22 A;  3KP3 A;  4AIJ A;  1REP C;  3M7G A;  1KQ0 A;  2PFB A;  1W5S A;  4L0Y B;  4ZZD A;  3C1D A;  2A5Y B;  1OYI A;  2QBY B;  2A07 F;  4M9S A;  1FT9 A;  1BBY A;  3U1D A;  3F72 A;  4HV6 A;  4EQQ A;  4O3M A;  2W57 A;  1QZY A;  4ZH4 F;  1Y0U A;  1AWC A;  1BIB A;  1O3S A;  1TQI A;  4R1H A;  3WU0 A;  2HKX A;  3V8J A;  1QZZ A;  2F5D A;  2XKO A;  4YIF A;  3FXU A;  4HZF A;  3WTU C;  3I54 A;  1ON2 A;  1J7K A;  3IHU A;  1D3Y A;  2LKP A;  3KEQ A;  1FYM A;  5CYV A;  1KQ9 A;  2IP2 A;  1UB9 A;  2DT5 A;  3FXR A;  3CUO A;  1L3L A;  1TTY A;  2A61 A;  2TDX A;  4M9Z A;  1U5T A;  2F2E A;  2CWE A;  4RGR A;  4KMU X;  4A12 A;  3JSP A;  5FB2 A;  4ESF A;  4P9U A;  3G73 A;  3HTS B;  3WE2 A;  2YU3 A;  1C0W A;  3I58 A;  2CQK A;  2LSO A;  1FP2 A;  3KE2 A;  4MTE A;  2EV5 A;  3LFK A;  2DK8 A;  1FC3 A;  4CIC A;  2OQG A;  2CYY A;  2VBW A;  2GA2 A;  4LK1 F;  3FM3 A;  4IRG A;  4BYY A;  3KEO A;  4P96 A;  2V9V A;  4RB3 C;  4AIH A;  5HOO A;  2ZNZ A;  3F8M A;  1IXC A;  4WX9 A;  1OR7 A;  2BEO A;  2XAS A;  5L3B A;  3KFW X;  1YS6 A;  3CJN A;  2DPU A;  1ZLJ A;  4AWX B;  1SD4 A;  3DQV C;  4S05 A;  1FBS A;  3ZMU A;  1B59 A;  2FQ3 A;  2MA3 A;  2W24 A;  3RYR A;  3GLX A;  3P9K A;  2Z33 A;  2IA2 A;  3HOS A;  3IWZ A;  2DQR A;  1ZGA A;  3F8B A;  2ZO4 A;  3MEX A;  4HF0 A;  1PUE E;  1YO5 C;  4OIN F;  1KYZ A;  2XRN A;  3QU6 A;  2H6C A;  1XB4 A;  3WGH A;  5FLX Z;  1W5T A;  5IT3 A;  4GO1 A;  4PGG A;  3JTH A;  4KIG A;  4GCV A;  1FX7 A;  3J80 K;  4XLP F;  2EFW A;  2GZW A;  1OYW A;  4EJW A;  1LDK B;  5E1X A;  1SFX A;  2M87 A;  2O8X A;  2EFO A;  2XRO A;  1FYL A;  2K7L A;  5F6F A;  1K6O A;  1JXS A;  5BPI A;  3VOE A;  5DD8 A;  3CDH A;  1RNL A;  1YS7 A;  4BHP A;  1R36 A;  1U5T B;  1ZG1 A;  2O61 A;  2ESN A;  2EA4 A;  3KP5 A;  4KIC A;  1HXD A;  4M71 A;  2K02 A;  2XVC A;  3QPH A;  1XMA A;  2YR2 A;  5BMZ A;  1STZ A;  4OMZ A;  4IF4 A;  5HDG A;  5E17 F;  1WRJ A;  1X3U A;  3EQL F;  3P9C A;  2ELH A;  3EET A;  2HQN A;  4U0Y A;  1KQ8 A;  5FD5 A;  3MWM A;  1W7P A;  1IF1 A;  2VC1 A;  3ZN0 A;  5IT9 K;  2KRF A;  5LEJ A;  3V4G A;  1P4X A;  4K2E A;  2HZT A;  2GAU A;  3GYH X;  1MZB A;  2WC2 A;  1VTN C;  1SD6 A;  5DCM B;  5H6Q A;  3LST A;  3CUQ C;  4GXO A;  3DPT A;  3ELK A;  3I53 A;  3Q5F A;  1KGS A;  1I5Z A;  4RGU A;  1KU7 A;  2BE5 F;  3K69 A;  2XHK A;  4ZYH A;  5AON A;  3I0T A;  2DW4 A;  1HW5 A;  4KYW A;  3C3W A;  5D8K B;  4IVN A;  3HYI A;  3VEP A;  2YSR A;  2M45 A;  3OV8 A;  3HSE A;  3LAP A;  1U3E M;  1F5T A;  2VT3 A;  3GZ5 A;  3JSO A;  3BY6 A;  1B1B A;  5HS9 A;  2HOE A;  5JVT A;  1MJ9 A;  2KJB A;  3F8F A;  4OMY A;  1LJ9 A;  2VBX A;  1KYW A;  4L9J A;  3ECH A;  5TJJ A;  4GGG A;  1R5H A;  2OZ6 A;  3KZY A;  3F21 A;  1FOK A;  4CZZ A;  3ZMT A;  2VOD A;  4FHT A;  1F1Z A;  2DTR A;  2FNA A;  4RB1 A;  2MBF A;  1BI2 A;  4U7B A;  3VB2 A;  2PJP A;  2EA2 A;  2QVO A;  3FMS A;  4ESJ A;  2VBZ A;  2WV0 A;  1G6N A;  5LGU A;  3L7W A;  2QM3 A;  4U88 A;  4ENN A;  3T8R A;  5BS6 A;  1R1T A;  1Z9C A;  2GQQ A;  4BQA A;  1OYY A;  2IA0 A;  1T2K A;  2OU2 A;  3RTR A;  3BRO A;  1HW2 A;  4KDP A;  4I09 A;  1UHW A;  3GFM A;  3L9F A;  1V3F A;  3DV8 A;  2FU4 A;  2VOP A;  2VON A;  1ZGJ A;  4JBA A;  2M5W A;  3BZ6 A;  3SZP A;  2HWV A;  3KP7 A;  4HA8 A;  1TQM A;  5LHG A;  2J5P A;  1ZHF A;  3HIF A;  5K5O A;  1XD7 A;  4XBF A;  3WOD F;  4HV5 A;  3BJ6 A;  2YX7 A;  3PFI A;  4EM2 A;  1W7P B;  1Z6R A;  1IW7 F;  5ILU A;  2M1B A;  2LF7 A;  5BOX A;  5FFX A;  1D5V A;  2WWY A;  3EYY A;  5E8I A;  2PI0 A;  5EEH A;  1RZ4 A;  2DAO A;  4RGS A;  1G3Y A;  1U5T C;  3GFL A;  3TDZ C;  5J8C A;  1WWX A;  1ZG3 A;  5DDG A;  5ED4 A;  2JTV A;  4CO8 A;  4MEX F;  5D5W B;  3ISP A;  1XCV A;  3OOP A;  3EYI A;  1XGO A;  3E6D A;  4EJU A;  4QLC U;  2K86 A;  5E1W A;  3KET A;  4RS8 A;  4U0V A;  3R60 A;  4KIB A;  4MQV A;  1J2X A;  3HSF A;  1LDJ A;  3WU1 B;  2M30 A;  5ICE A;  4L9N A;  4Q48 A;  1XGN A;  1ZLK A;  1ZAO A;  1IN4 A;  2RV8 A;  1T39 A;  2ACJ A;  5HLH A;  3ZMZ A;  1XGS A;  4M74 A;  2PBI A;  5D5V B;  2FNP A;  3C7J A;  2FMY A;  3O6B B;  2HYG D;  3H92 A;  3FHZ A;  2W84 A;  2Y0M A;  1J75 A;  3KP2 A;  5LLQ A;  2L3D A;  3SQN A;  1ODD A;  1ZH5 A;  2L02 A;  4Q5S F;  2P7C B;  2XV4 S;  2V1X A;  1IAW A;  3V8L A;  1IRF A;  3ZN1 A;  4AD9 A;  4KMF A;  4U0W A;  3FF5 A;  1IZ1 A;  3COA C;  2FF4 A;  4O6J A;  1P4A A;  4IHT A;  4PZJ A;  1B6A A;  1NHA A;  3BWG A;  4JK1 X;  2FOK A;  1S29 A;  2Z3Y A;  5L3F A;  1BC8 C;  1QO0 D;  5HS8 A;  2FBK A;  3REO A;  1SMY F;  2O3F A;  3U9G A;  2GXB A;  5L3D A;  4FX0 A;  2ZFW A;  3AAF A;  3MQ0 A;  1SD7 A;  2XUB A;  3TO9 A;  1LVA A;  2M8E A;  3FZV A;  4G8X A;  1DUX C;  4UV9 A;  3FWE A;  3GW2 A;  3NEU A;  1T38 A;  1RUN A;  2XAJ A;  2YPR A;  1PP7 U;  1R1U A;  2CO5 A;  3MZY A;  4KIF A;  4Y17 A;  4A2U A;  3I4P A;  3IC7 A;  1BI3 A;  4L5I A;  2KIM A;  1IN8 A;  3TOA A;  4G94 A;  4HOB A;  3WTZ A;  3R0J A;  1KU2 A;  2QQA A;  2CFX A;  5DUI A;  3ZMS A;  4I7H A;  4PGH A;  5E1Z B;  4YFN F;  2DPD A;  2IVM A;  3FX3 A;  5DYM A;  3QPT A;  3F8N A;  5CJ9 A;  5L3G A;  2STW A;  3ERE D;  4N9H A;  3T8T A;  3SXY A;  2PN6 A;  4EGZ A;  2UXX A;  4UVC A;  5BQT A;  3NQO A;  3GVA A;  3T5X A;  2V79 A;  2BYV E;  4MGR A;  4PDK A;  1SMT A;  4M6Y A;  4IJA A;  3ROU A;  2FML A;  3CUQ B;  3O2P E;  1ONV A;  2E1C A;  2JSC A;  1Z05 A;  2NS0 A;  1ULY A;  3U2R A;  4A6E A;  2DBB A;  5DV5 A;  4G7O F;  3V7S A;  2QLZ A;  5CVU A;  3QP5 A;  3DEU A;  3L00 A;  3E5U A;  4IRI A;  2O0Y A;  2FE3 A;  3RIR A;  3IRQ A;  1FPQ A;  4H0E A;  4LFU A;  4OOI A;  4CGZ A;  4XSX F;  1OMI A;  1UST A;  4OU0 A;  2X0L A;  4Q4Z F;  4R79 A;  4LD5 A;  1O3T A;  4DQ2 A;  5HLG A;  1LDD A;  2HGC A;  5ICC A;  2O6G E;  4ENJ A;  1P4W A;  4BHB A;  3CO7 C;  3K1P A;  4MHG A;  2LDU A;  1LNW A;  1HKS A;  1GXP A;  4M73 A;  4NHJ A;  3K2Z A;  2QWW A;  3WTT C;  5EEG A;  1KA8 A;  5HS7 A;  4UUV A;  1QQI A;  2MH2 A;  2EFQ A;  3E5X A;  2EWN A;  2IW5 A;  2FA5 A;  3TO7 A;  1AOY A;  2FEZ A;  2DQL A;  3ML6 A;  1SD5 A;  1ZN2 A;  2RKH A;  3WG9 A;  2RN7 A;  3K9T A;  3LWF A;  4BAY A;  3WGI A;  2QQ9 A;  4IRH A;  5FD6 A;  2XGX A;  4G7H F;  1PDN C;  1S7O A;  2XAG A;  3WE3 A;  2K27 A;  1A04 A;  4OIR F;  1UHM A;  1BC7 C;  1IUY A;  1J0R A;  4BXU A;  2OZU A;  1BIA A;  3HRT A;  3K0L A;  4HDV A;  1I1G A;  2VE9 A;  4LGW A;  1W4M A;  4WXC A;  3V7C A;  4LG0 B;  5D6E A;  4LB5 A;  3I59 B;  2ISY A;  4EMS A;  4UNO A;  3E5Q A;  4FT8 A;  4WWC A;  4HF2 A;  4UVA A;  3W6K B;  2COM A;  2VXZ A;  4UXN A;  4I0A A;  3LQQ A;  3DKW A;  4XRF A;  2JPB A;  4DNC A;  2A6E F;  1IXR C;  3QOP A;  1O3R A;  4EM1 A;  1GVJ A;  2QUF A;  4P55 A;  2NNY A;  2JPC A;  2P5L C;  3IKT A;  5E18 F;  4QWQ A;  4HYE A;  5DUK A;  1GXQ A;  2HR3 A;  1UCR A;  3EDP A;  1EH8 A;  1B9M A;  1Z7U A;  2DLL A;  2G7H A;  2G7U A;  2O03 A;  1MJA A;  2EV0 A;  3F6O A;  4HLY A;  2Y75 A;  2OQR A;  3GUD A;  2ZNY A;  1SFU A;  1U8R A;  2OAZ A;  3QAH A;  5LGN A;  3PQJ A;  4KNY A;  3GO5 A;  1ZRC A;  1O57 A;  4KN4 X;  5LGT A;  2P5K A;  2STT A;  3BPX A;  3F8C A;  1H0M A;  3MZH A;  2XAQ A;  4YII A;  2Q2E A;  4G9Y A;  1LEB A;  2EFN A;  4M9X A;  3J81 K;  4WCG A;  1JE8 A;  1ZRF A;  3T0Y A;  1BI1 A;  4ESB A;  1H9T A;  3LAJ A;  1R5G A;  1DPU A;  1QGP A;  4LLL A;  1YW8 A;  4M72 A;  1QBJ A;  1E2X A;  3TO6 A;  1U78 A;  3RI4 A;  2RGV A;  3CTA A;  4A0X A;  5K5Q A;  1QPM A;  4GYG A;  5DD4 A;  3TOB A;  3R6S A;  3J80 Z;  3M8F A;  2L4M A;  1USS A;  1DDN A;  2V1D A;  1I27 A;  4F7Z A;  1IN7 A;  3I59 A;  2K4B A;  2QZ8 A;  4HX7 A;  2XAH A;  2ETH A;  2A68 F;  4HX8 A;  4LLN A;  2BBY A;  2R7D A;  4HQM A;  5D8L B;  1SFE A;  3M1E A;  4HX4 A;  3JW4 A;  4ZYE A;  1ZAR A;  3J81 Z;  5L3E A;  5A2Q Z;  4BNC A;  3PQK A;  1BM9 A;  1HW1 A;  5J6X A;  4A5M A;  3CLO A;  3JAM Z;  1MKM A;  2QYO A;  2L54 A;  4R8H A;  5LEK A;  2FRH A;  1R00 A;  3FXQ A;  3O3K A;  5CLS A;  4ENK A;  3E6B A;  4L18 B;  1I6X A;  3V7R A;  4A0Y A;  5ILS A;  3F23 A;  2L01 A;  2F5F A;  3CO6 C;  1OPC A;  1BI0 A;  3RDI A;  2EK5 A;  2MLK A;  5H20 A;  4O5V A;  3WTX C;  4KN7 X;  1MJB A;  3K1N A;  1JHH A;  4N0B A;  5ICG A;  2A3S A;  1IRG A;  4B09 A;  1WKM A;  3WTY C;  3RYP A;  1YG2 A;  3GF2 A;  2ESH A;  4RAZ A;  4HDU A;  4L9T A;  2D2W A;  1TNS A;  4Y15 A;  4IXA A;  1WI9 A;  1K7A A;  3JTG A;  1IXS B;  2XIG A;  3LA3 A;  1XCB A;  2DFI A;  2ZXJ A;  2R3S A;  4M6X A;  5E20 A;  1S7A A;  3FMQ A;  1KU9 A;  1RI7 A;  2MC3 A;  3GXO A;  1T0F A;  1ZYR F;  5A2Q K;  5CVI A;  2EJR A;  3LQR A;  2RDP A;  1TQP A;  3I64 A;  1B4A A;  2UZK A;  1FBQ A;  1YW7 A;  2NRA C;  1DP7 P;  2CW0 F;  1LB2 A;  4ZYD A;  4XSZ F;  2OBP A;  5FLX K;  4L5J A;  1TW2 A;  4HF1 A;  1ON1 A;  3SZT A;  2ISZ A;  2JZY A;  5JI6 A;  5DEQ A;  5D6F A;  2NNN A;  5ICF A;  1E17 A;  3BJA A;  2PLY A;  3HHG A;  5LHI A;  2VBY A;  4JQF A;  5LBQ A;  2FBH A;  3WTW C;  1XSV A;  3HRU A;  3M8E A;  2HS5 A;  2QBY A;  4EJV A;  5LRS A;  3T1B A;  1W7P D;  1B9N A;  5LHH A;  3Q9V A;  5L3C A;  2MH9 A;  1UFM A;  3QP6 A;  1G3W A;  2VOO A;  3ULQ B;  4YFK F;  3GWZ A;  4L9V A;  3R0A A;  1FY7 A;  4LB6 B;  2EV6 A;  1FSE A;  4KFC A;  4LLG F;  5J8F A;  1H9G A;  1ZG5 A;  1O7F A;  1TBX A;  4ASN A;  2E7X A;  4HBL A;  2Q8K A;  5ILV A;  3BOQ A;  1LQ1 A;  2FXA A;  3N4M A;  3DF8 A;  3TGN A;  2EFP A;  2Q0O A;  1R23 A;  2GXG A;  3B73 A;  3V8K A;  1R1V A;  5IT9 Z;  2E1N A;  5JR3 A;  3E97 A;  4GYI A;  4N9I A;  4YG2 F;  5KK1 A;  5D5U B;  3QRF F;  3BJO A;  4EM0 B;  3TQN A;  2YX4 A;  1FSH A;  2IPQ X;  4WK8 F;  3JAM K;  2HDC A;  2AS5 F;  2R7F A;  1WQ2 A;  3BDD A;  2DU9 A;  2QEN A;  2CGP A;  2RNJ A;  1OKR A;  2KIU A;  2P6T A;  5HDN A;  4B8X A;  3ABU A;  1FWZ A;  2CG4 A;  4WXH A;  2DK5 A;  3FMR A;  3DPL C;  2IJL A;  3TDU C;  3K1M A;  2MD5 A;  4IPA A;  4HW0 A;  1U2W A;  3I71 A;  2PEX A;  2QQB A;  3KLO A;  4G6D A;  3RKX A;  1HKQ A;  2Z99 A;  1CF7 A;  4NB5 A;  2Z9O A;  3ECO A;  2HTS A;  1XMK A;  4ETS A;  4BHC A;  2JRT A;  2HTJ A;  2NYX A;  5FGM A;  4LG0 A;  4KT5 C;  5F64 A;  4NQW A;  1YLF A;  3RPU A;  4UV8 A;  3LA7 A;  2P8T A;  1PP8 F;  4EV0 A;  4A5N A;  4HQE A;  1I1S A;  2HFH A;  2VC0 A;  5AIP A;  1GHC A;  3KLN A;  3E3V A;  3MCZ A;  3HRM A;  3ZQ7 A;  2D1H A;  1Z91 A;  1YQA A;  1F9N A;  4CYD A;  1Z6T A;  1IN6 A;  3Q9S A;  4LJZ F;  1YTY A;  2OD5 A;  3KCC A;  3HOT A;  1P6R A;  2IT0 A;  4CHU A;  3P7N A;  1K78 A;  2ZCW A;  2H6B A;  5E8G A;  2P6S A;  2PQ8 A;  5TRD A;  1CGP A;  1V4R A;  2VT2 A;  3H3Z A;  2LF8 A;  1IN5 A;  3TKY A;  1FNN A;  2DI3 A;  3HHH A;  2VN2 A;  4YFX F;  2A6H F;  4L0Z B;  2HEO A;  4EJO A;  1R7J A;  1MD0 A;  3HSR A;  1RIO H;  2V1U A;  2RQP A;  3RJP A;  4MTD A;  3FM5 A;  3H3U A;  1D8K A;  3HTU A;  3KZZ A;  4OIO F;  2WTE A;  2A69 F;  2ADU A;  4EVI A;  1MDM A;  3R4K A;  4ZZL A;  5BPD A;  2RVC A;  2W85 A;  4UVB A;  1P92 A;  1EV7 A;  1G4D A;  3ZPL A;  1BJA A;  3WTV C;  4WXD A;  1BOA A;  2Z5U A;  3HRS A;  3QU3 A;  5ERI A;  1FBU A;  3NRV A;  1YYV A;  5JHU A;  2DO7 A;  4Q47 A;  1YFH A;  3CUQ A;  2UXN A;  5D5X B;  4KA4 A;  3MAJ A;  1JGS A;  2HYF A;  1YW9 A;  5AIQ A;  1T6S A;  3G3Z A;  3RPQ A;  4PCQ A;  2EB7 A;  2ZKZ A;  2JT1 A;  2ZME A;  2LNB A;  5CVJ A;  1HSJ A;  3E6C C;  2KIF A;  4EGY A;  3F3X A;  2D45 A;  1R58 A;  3BPV A;  2XKP A;  3GFI A;  2F5C A;  4I98 B;  3ZMV A;  4Z2Y A;  4P9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...