5E8IA

Crystal structure of the dna binding domain of human transcription factor fli1 in complex with a 10-mer dna accggaagtg
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
93
structure length
93
Chain Sequence
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Friend leukemia integration 1 transcription factor
publication title Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 26
structure length 93
sequence length 93
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e8iA00
3DEUA 1H9GA 2EV5A 4U0VA 1YFHA 1RI7A 3WE3A 1KQ0A 2GIVA 1U5TB 3REOA 5DUIA 4IRGA 4FHTA 1ZG3A 4ENKA 2OU2A 3GFMA 3TOAA 3BJAA 4CYDA 4HF2A 4OMZA 2M45A 1D8JA 1LQ1A 4LLGF 1FYMA 4AD9A 5F1RA 2HOEA 1XCBA 3CTAA 2STWA 4RB0A 2EV0A 2L3DA 5FLXZ 5K5QA 5CVIA 3IRRA 3DKWA 1GHCA 2VC0A 2FQ3A 3CJNA 1KU2A 1FSHA 1R23A 1BIAA 3U1DA 1J7KA 3QRFF 3T0YA 3DPTA 3WGIA 2BYVE 3W6JB 2A5YB 2DU9A 2A6HF 2IRFG 3ABUA 4KDPA 2PMUA 4BQAA 1HKSA 1WWXA 2HGCA 3CO7C 3I5UA 1XSXA 1ZARA 3T1BA 3IHUA 4PCQA 4Y15A 1P2FA 3JAMK 2HDCA 3MCZA 3HRTA 1W4MA 4LG0B 3P9KA 1DPRA 1LEBA 3O3KA 1P6RA 1JHFA 3GFLA 5HS8A 3I53A 2Y0MA 2YX4A 2HR3A 1F5TA 5AIPA 3GFIA 1C0WA 1J75A 5D8KB 5LRRA 1ZRDA 2OZUA 4HX7A 1ZREA 2V1DA 2V79A 2XVCA 4MGRA 4GGGA 3PQJA 1SFEA 5DDGA 1HW1A 4U0WA 1SMTA 1IN5A 2VBXA 4UVBA 4EV0A 5FO5A 1HSJA 5CYVA 3HTSB 3EDPA 1JGSA 1I5ZA 5E18F 1USTA 2E1CA 3JSPA 2CSOA 4NQWA 4JBAA 2C6YA 3KP2A 4LFUA 2KIUA 2MLKA 2PFBA 2CW0F 1O3TA 4ESJA 1GVJA 1HSTA 1XDSA 1KA8A 2P7CB 1HQCA 5LGUA 3WTSC 3W6KB 3MEXA 4I98B 1R5HA 4GXOA 4G7HF 2R7FA 1IXSB 5FFXA 1JXSA 1TNSA 3WTTC 3ULQB 1FYLA 2RC4A 5D6EA 2FF4A 3IKTA 4OOIA 5LEJA 3FXQA 2DPDA 3LFKA 2DQRA 2IPQX 1QGPA 5L3EA 3J7AO 1XMKA 1TQIA 4M6YA 2ADUA 3V8LA 2MBFA 4MQVA 4JQFA 5DCMA 1IRGA 2L4AA 4E70A 3TO9A 4A12A 1CGPA 1YTYA 3QPTA 3FM3A 5ILUA 4HX4A 5L3BA 1G3SA 1RUNA 5ILVA 2H6BA 2BE5F 4R79A 2IA2A 2K27A 1FNNA 1J59A 1UB9A 2NNNA 2PN6A 4HW0A 4A0XA 2QQAA 1KQ8A 4AIHA 2P5VA 1VTNC 1YW9A 3E5XA 1K6OA 1ZLJA 1XSVA 4RB3C 3OV8A 4BNCA 3FF5A 3DXJF 3V8JA 5D5VB 2LF8A 3RKYA 2XGXA 1HW2A 4UV8A 1TBXA 1ZHFA 1CF7A 2K7LA 2ZCWA 3GWZA 2J5OA 5JI6A 3GFJA 2P6SA 3KLOA 2XV4S 2HTSA 2VBZA 3FMQA 5J6XA 2FE3A 3KP6A 3B02A 4ESFA 1TW2A 4UVCA 5HLHA 4P55A 5DEQA 4MQ9F 5HDKA 1KYWA 2F5EA 3LA7A 3J80K 2DI3A 1L3LA 4HDVA 1J9IA 4ZYDA 3BJ6A 2O8XA 2ZNZA 4HX8A 1HXDA 1KU3A 3M7GA 1T38A 2LF7A 2ELHA 3BY6A 2Q2EA 4LK0F 1YO5C 4PGGA 2XROA 3LA2A 2EFOA 1BIBA 5AIQA 4RAZA 3E6BA 1S3JA 4N9HA 1QZZA 3FHZA 3F8CA 3ISPA 3F6OA 2IT0A 4I01A 3FWEA 2MC3A 1ODDA 3ZQ7A 2EFWA 1ZGAA 2PEXA 4M6XA 4S05A 3JAMZ 4L5JA 3V4GA 5IT9K 1OPCA 3M9AA 5J8CA 3SZPA 2NYXA 3ABTA 4A5NA 1G3TA 1KQ9A 4RB2C 2NAZA 3H3ZA 2ZXJA 1IF1A 2PLYA 2J5PA 1UHWA 3RYPA 4P5OA 4GCVA 4EGYA 2HFHA 3MWMA 3I59A 3V7SA 2V1XA 4QLCU 2EJRA 4DQ2A 1Y0UA 3C3WA 3O2PE 3V8KA 4BAYA 2NNYA 3CUQC 1F1ZA 4IXAA 2XAGA 1XGSA 3K2ZA 2MLGA 4L9JA 3I58A 4ZZLA 3KFWX 3CDHA 3F6VA 1TQPA 1E2XA 5FD6A 1O3RA 3G3ZA 4PDKA 3NEUA 3VODA 4JK1X 1STZA 4EJOA 1Z9CA 2H09A 1REPC 1KU9A 5E8GA 4GYGA 3J81K 3KETA 2EWNA 4ESBA 3BROA 1O7LA 1S8NA 2OQRA 3JW4A 2Y48A 1XN7A 1MKMA 2DT5A 2Z3YA 2Q0OA 2OQGA 2NRAC 2FMLA 2D45A 2O03A 4XSZF 5CVVA 1QO0D 1IN4A 3ERED 1YS7A 3HHGA 2OZ6A 2ETHA 4XLPF 4CZZA 4RGRA 1LDJA 2DLLA 5F64A 5LRSA 1B6AA 2KKOA 5CVJA 2JSCA 4GYIA 2A69F 1Z7UA 2XKOA 3EETA 3DQVC 1KGSA 3AAFA 2H94A 2M5WA 2QENA 1MJ9A 5E1WA 3F22A 3E6CC 2HQNA 3E97A 1B9MA 4LMYA 5JFRA 2KRFA 4MTDA 2D1VA 2O61A 1LDDA 2E7XA 2RV8A 3IKVA 1WI9A 3MZHA 4XRFA 4ASNA 3RPUA 5HDGA 4WXDA 4U88A 4L18B 2YU3A 3Q9SA 4B09A 2GXBA 2KIMA 4L9TA 4HLYA 1R7JA 4N0BA 4K2EA 2CG4A 1WQ2A 4RGUA 3FXUA 3TDUC 3R6SA 3ECOA 3FX3A 4EM2A 3LAJA 4M71A 1PP8F 3N97A 1BI2A 2R3SA 3P9IA 1MJBA 2K4JA 2VT3A 3ECHA 2Y75A 3O6BB 3SHFA 1UHMA 1P4WA 3ZMVA 3ELKA 4WXCA 3J80Z 1F9NA 3LQRA 1JE8A 4HQMA 1IZ1A 4AIKA 2TDXA 2A61A 2EFQA 2WTEA 1X3UA 2HEOA 3EYIA 2XAQA 2P7VB 2FNPA 5EEGA 3MZYA 1DPUA 3HSRA 3T5XA 2XASA 2DTRA 3HOTA 3EQLF 3E6MA 5L3FA 4RS8A 4YIIA 1K78B 4ZH4F 2EFNA 3KZYA 2PG4A 3D5LA 2DW4A 5D5UB 3ZP5A 1U2WA 4KN4X 3RDIA 2ZO4A 2DPUA 2YSRA 3DF8A 2FOKA 1LJ9A 4EQQA 2O6GE 2EA2A 1Z05A 2W24A 5IT9Z 4AWXB 2HZTA 3E5QA 3H92A 1GXPA 2AS5F 4MEXF 2YR2A 3NRVA 3ZPLA 1IN8A 4P96A 1CF7B 1LB2A 4P9FA 2W57A 5JR3A 2CWEA 3EYYA 2XAJA 5IT3A 2JRTA 1R58A 5HVQC 1U8RA 1TTYA 2VN2A 4AIJA 2W25A 3DV8A 5E20A 1FZPB 2E7WA 3KE2A 2FNAA 2QVOA 5H20A 2IP2A 3G73A 3JTGA 4WXHA 3L2CA 3SZTA 4L0YB 3F8NA 4UVAA 1LEAA 3RPQA 1LVAA 2D2WA 1IUYA 1K79A 4P9UA 4HV5A 2X0LA 4HF1A 3HYIA 3F21A 2ZFWA 2ZNYA 3WTZA 3SQNA 5E17F 1T2KA 4D0PA 5DV5A 2UXNA 2QBYA 2DQLA 1S29A 4OIOF 3M1EA 1EH8A 3TGNA 1XB4A 3J81Z 5BOXA 4LLLA 2VBYA 2CYYA 4DNCA 1FBUA 2A07F 2ACJA 4G9YA 5KK1A 4RB1A 2XKPA 2L4MA 3LWFA 5JVTA 1J5YA 1U5TC 1F4KA 2VOOA 1DP7P 2G7HA 5FB2A 4BH9A 3SXYA 2JZYA 2BV6A 1FT9A 2VBWA 2FBIA 4MNUA 4I02A 1SD5A 3I59B 5ILSA 4A0ZA 3BPVA 2RNJA 3U9GA 2HYGD 3MFKA 4EMSA 4HLXA 3ZN0A 3KP7A 1SD6A 1SMYF 3WE2A 3WTYC 1D5VA 3M8EA 2PJPA 5FD5A 3ZMSA 3KEOA 3ZMTA 2F5DA 4IPAA 1GXQA 2XHKA 3Q5FA 4S04A 1Z1DA 4CGZA 1YG2A 4HOBA 5HLGA 2XRNA 1O7FA 2OAZA 2WC2A 4LD5A 5HDNA 2FXAA 4XLNF 4OU0A 4ZYGA 2AXLA 4IRHA 1L0OC 2K4BA 3C1DA 2A68F 3KP3A 2NS0A 4ENMA 4U0YA 1XDUA 4CICA 1KYZA 3E6DA 4WF2A 1W5TA 5AONA 4CO8A 2EV6A 4L9VA 3RYRA 2VODA 5A2QK 1E17A 1B9NA 4HBLA 5HLIA 2V6CA 3FMRA 5D5WB 2DBBA 1H0MA 2FBKA 1OYWA 2ZJ2A 4AVPA 1ZH5A 4UUVA 3GZ6A 2VONA 4KIBA 1WRJA 5JHUA 1YIOA 3L7WA 1SFXA 5BMZA 3VFZA 4ENNA 3PFIA 3F8FA 1OMIA 3M8FA 4O6JA 1P4AA 3P7NA 5J8FA 1ON1A 1YW8A 5LHIA 2P4WA 4Y13A 3GYHX 4YIFA 4OINF 4XSXF 4G6QA 1IW7F 1IXRC 4EGZA 3RI4A 4KMUX 3WGHA 2IJLA 3FZVA 4G6DA 3HTUA 4BHCA 2Z5UA 4WWCA 4M9XA 1FBQA 2JPCA 2VT2A 3CUQA 3VOEA 1MGTA 3VB2A 1K7AA 4O3MA 4U7DA 2KIFA 1ZGJA 4U7BA 3MAJA 3BOQA 1AOYA 4ZYHA 2L01A 4LB6B 4A6DA 4MTEA 2M30A 4CXFA 3DP7A 2V9VA 2HTJA 3RIRA 1FC3A 4KNYA 1FP1D 4KA4A 2H6CA 1TLHB 5ED4A 2P5LC 4KICA 2Q8KA 5ICFA 2JPBA 3WU1B 2GQQA 1G3WA 4IVNA 2QZ8A 2P8TA 1R36A 1IRFA 2MH2A 3C7JA 3Q9VA 3R0AA 5E8IA 1YW7A 2EFPA 4B8XA 3F8MA 4LGWA 1DDNA 2XAFA 2IW5A 4IJAA 1U78A 2WWYA 1SFUA 3HSEA 3RJPA 1IN7A 3QP6A 1PP7U 4M9SA 1ZYRF 3N4MA 5CVRA 4IF4A 4A2UA 4L0ZB 2H27A 2M1BA 1EV7A 1OYIA 2UWMA 3ZN1A 4OIPF 2QWWA 1MZBA 1R1UA 4EVIA 4KIFA 1HKTA 3HRSA 4KYWA 1BOAA 1EH6A 1MJAA 3JSOA 3S2WA 3GZ5A 3BPXA 3QP5A 2M8EA 4UXNA 3K1PA 2GXGA 3QPHA 4ZYEA 2G9WA 2HYFA 2VE9A 1O57A 4WCGA 5D5XB 1BI3A 1ZN2A 2FSWA 4KIGA 3CLOA 3LQQA 2PI0A 4NB5A 2BEOA 5K5OA 3MQ0A 4OIRF 2EK5A 3SFZA 1BN5A 1Q1HA 3KP5A 1ZG5A 3LSTA 5TJJA 4XBFA 1RNLA 1ONVA 2K86A 1ZRFA 4QWQA 4R1HA 5CVUA 1R5GA 5D6FA 1WSUA 3BJOA 2DFIA 3CUOA 3GLXA 4LK1F 1HKQA 2RN7A 1EH7A 5H6RA 3QOPA 1OKRA 4IHTA 4M74A 4Q48A 1XGNA 1A04A 2ESHA 1U3EM 2P6TA 1YYVA 2O3FA 2CQKA 1UFMA 1U6GA 2XIGA 1JHHA 2DK8A 2L54A 1USSA 4LLNA 5BPIA 4MEYF 2Z9OA 1YS6A 1R22A 3TQNA 3RTRA 2QBYB 3ZMDA 3C18A 4PZJA 2BGCA 2EA4A 1XSDA 4I2OA 3F72A 5TRDA 4EJTA 2MA3A 3RKXA 3R61A 4KT5C 5DD8A 1B59A 2Z99A 5ICGA 2K02A 1V3FA 4I7HA 4RAYA 2WV0A 2EB7A 4Q47A 5A2QZ 4F7ZA 1FLIA 5D8LB 2A3SA 1MDMA 2RGVA 2UXXA 3GEZA 3R0JA 1MD0A 1O3SA 2A6EF 5E1ZB 5DCMB 2E1NA 3WGGA 1WKMA 2ISZA 4BYYA 2VXZA 3COAC 4EM1A 3V7CA 3I4PA 3B73A 1FY7A 2KJBA 2FEZA 4EJUA 1XGOA 2VC1A 3WTVC 1I1SA 3K1NA 2F2EA 3FXRA 1I1GA 2CO5A 3I54A 4YFXF 4L9NA 5ERIA 4UHTA 3VEPA 2QLZA 3IRQA 3TO6A 1BM9A 1FBSA 4PGHA 4KN7X 3HSFA 4EJVA 2HQRA 3TO7A 2OBPA 2LDUA 5HOOA 3QAHA 4A5MA 1TQMA 3R60A 3HOSA 1TW3A 2ZMEA 4CHUA 3GVAA 1BBYA 1FOKA 1T6SA 1XGMA 3TKYA 2GA1A 2FBHA 2FA5A 1BI1A 1V4RA 3D0SA 4OMYA 1W7PA 1ZG1A 3IWZA 5BPDA 2QUFA 1SAXA 3L09A 2LKPA 3EUHA 2QQBA 2R7DA 4HQEA 2QM3A 3NQOA 4ON0A 5LLQA 4YFKF 3KEQA 4ZZDA 1S6LA 4HDUA 4TV7A 1Z6TA 2XAHA 4OIQF 2PQ8A 2IA1A 1NHAA 2DO7A 3HHHA 5DUKA 2VOPA 3WODF 3JTHA 5HS7A 1IXCA 1U5TA 3TDZC 1FYKA 2LSOA 3HUGA 4HA8A 1O3QA 1H9TA 1UCRA 1SD4A 1RUOA 1B4AA 2YX7A 3E3VA 1ZAOA 1R1VA 4Z2YA 3IC7A 2RKHA 2IA0A 3BWGA 4Q5SF 2STTA 1XCVA 3LAPA 3QU3A 1PDNC 3CUQB 2CFXA 3K0LA 5CJ9A 1LNWA 3DPLC 3DFGA 1QPMA 3ML6A 1P92A 1XMAA 3K69A 4FX4A 3I0TA 1KU7A 2GA2A 1BJAA 2ZBKA 2Z33A 2GZWA 2X4HA 2IVMA 1T0FA 3K1MA 4M73A 3GO5A 3V7RA 1YLFA 2PMHA 1FX7A 1FP2A 2UZKA 1DUXC 2KJCA 3T8TA 4IRIA 4FX0A 5E1XA 4M9ZA 1RIOH 2LNBA 5EEHA 5LGTA 4MHGA 2RVCA 3LA3A 3F3XA 2ZKZA 4WK8F 1XD7A 5LBQA 3WU0A 1FWZA 1K78A 3K9TA 5LEKA 2DK5A 1OR7A 1S7AA 5F6FA 4LG0A 1ULYA 3FM5A 4R8HA 3E5UA 4L5IA 1Z6RA 3IWFA 1AWCA 3I71A 4A0YA 2ISYA 3CO6C 4GO1A 3F23A 5FLXK 2RDPA 1G3YA 3HIFA 2RQPA 2HS5A 5L3DA 1RZ4A 1QNTA 4I0BA 4Y17A 2BBYA 3L9FA 5DYMA 1P4XA 3R4KA 1ON2A 2M87A 5LHGA 1W5SA 5H6QA 1BI0A 1FSEA 1I27A 3WG9A 1PUEE 5LHHA 4LB5A 4HYEA 3U2RA 1BC7C 1D3YA 2D1HA 2HKOA 5KVRA 4O5VA 4KMFA 4BHBA 2W85A 2F5CA 4LJZF 1G6NA 4KUMA 3I64A 2P5KA 5FFZA 3ZMUA 2VE8A 2QYOA 3BZ6A 5LGNA 3PQKA 2GWRA 4RGSA 4YFNF 4EM0B 1B1BA 4EJWA 3GW2A 4H0EA 4YG2F 4CDGA 5BS6A 1W7PD 1T39A 1I6XA 1HW5A 4FT8A 1HBXG 2OA4A 2COMA 3KLNA 3P9CA 1IN6A 1QBJA 1FPQA 5HS9A 2F5FA 2MH9A 5DCFA 3L00A 1LDKB 3WTUC 3OOPA 3WTXC 3GXOA 2FU4A 4M72A 4BHPA 4IHSA 5K1YA 2W84A 4KFCA 2MD5A 3H3UA 2ESNA 5L3CA 2V1UA 1G4DA 4I0AA 4I09A 2HWVA 4HZFA 5K5RA 5DD4A 4NHJA 1ZLKA 1ZRCA 1J2XA 3KP4A 1SD7A 3BP8A 1MDMB 4G7ZF 3HRMA 2HKXA 4G7OF 4RGXA 3KZZA 5D4RA 4UV9A 2L02A 1D8KA 3GX4X 3ROUA 4N9IA 1Z91A 4G8XA 4ENJA 1BC8C 4BXUA 5CLSA 1T98A 4UNOA 1S7OA 3BDDA 5ICCA 2CGPA 3FMSA 5BQTA 1J0RA 1YQAA 1OYYA 3RKWA 3ZMZA 6PAXA 1R00A 4G94A 2FRHA 5D4SA 2GAUA 3HRUA 1R1TA 2G7UA 2PBIA 3QU6A 3WTWC 2ZMEB 5L3GA 3T8RA 2JTVA 2O0YA 2OD5A 3F8BA 3GUDA 4HAMA 2QQ9A 2B0LA 1QQIA 5FGMA 2YPRA 3KCCA 1W7PB 2FMYA 4A6EA 4ETSA 2JT1A 1IAWA 4HF0A 3IL2A 5ICEA 1QZYA 4WX9A 3GF2A 3TOBA 2DAOA 4HV6A 4Q4ZF 2XUBA 1TNTA
chains in the Genus database with same CATH superfamily
3DEUA 1H9GA 3WU2C 1V54H 2EV5A 3KZIC 3K4BA 2R0QC 4U0VA 4XLFA 1YFHA 1RI7A 3WE3A 1IC8A 1GLNA 4QIWN 4UY8I 1KQ0A 2GIVA 1U5TB 3REOA 2EZKA 4M3FA 1S5LC 5DUIA 4RBOA 2X1CA 4IRGA 5IYDJ 3D1NI 4HNVA 3B6AA 4FHTA 2HPIA 3CC4I 4PUSA 1ZG3A 3GTJJ 3K6GA 3H35A 4ENKA 3GTKJ 2OU2A 1W36D 2V9KA 2ZC2A 3DKYA 3GFMA 1LE8B 3TOAA 1YIJI 3BJAA 4CYDA 1W5CC 3H0GJ 2JA2A 4HF2A 2XSJC 4OMZA 2M45A 1D8JA 5JLXA 2Y9ZA 1LQ1A 4LLGF 1FYMA 4AD9A 4HNUA 3HZJA 5F1RA 4BACA 1ETYA 3GTMJ 2HOEA 4F55A 1XCBA 3CTAA 4E7HA 1R9TJ 1Z67A 2STWA 4RB0A 5FKKA 2EV0A 2QCOA 4GRIA 2L3DA 4QTRA 5FLXZ 5K5QA 5CVIA 2E19A 3IRRA 5H2FC 5JLWA 1A31A 2R7SA 3DKWA 1PYVA 1GHCA 3LSPA 2VC0A 2FQ3A 2NOGA 3CJNA 1KU2A 2LREA 2MFZA 3S2DJ 4DBQA 3H1CA 1TT0A 1FSHA 1R23A 1RR7A 1BIAA 4MFEA 3DU5A 3U1DA 4BJTA 1J7KA 3K7AJ 4BE1A 3QRFF 2XPWA 3WHCA 3T0YA 3DPTA 3J7ZI 3WGIA 2BYVE 2KZVA 3W6JB 2DA7A 2XAUA 1T08B 2VKEA 2A5YB 2DU9A 1HF0A 2GLOA 2A6HF 2HXOA 1IRZA 1MMAA 2IRFG 3ABUA 3GTQJ 3IAM2 3BR6A 3FK6A 4KDPA 2TCTA 1MH4A 3S8PA 3VWBA 3OL3A 4FASD 4A3EJ 2PMUA 4BQAA 2UV1A 1HKSA 1WWXA 2HGCA 3RCOA 4F91B 3CO7C 3QQAA 3I5UA 1MH3A 3OYHA 1XSXA 2E5NA 3UKGA 1ZARA 2WAQA 1F43A 3T1BA 3IHUA 4PCQA 3HG9A 5KAIC 2M2EA 4Y15A 1K61A 2LOOA 4XNFA 3DPUA 5KNLA 1MMDA 1K83J 1P2FA 2HDWA 3FHNA 5K7FA 3CJTB 5F0FA 1XS9A 3JAMK 3L2VA 2Y0SA 2HDCA 3MCZA 3HRTA 1W4MA 3SYTA 3LL7A 4LG0B 2CUEA 2LLKA 4JX6A 4JX5A 3H9GA 3P9KA 2EZLA 4M6VA 1DPRA 3JRCA 1LEBA 3O3KA 1P6RA 1JHFA 3OS0A 2IBDA 3GFLA 1TWGJ 5HS8A 3I53A 4I6ZA 2Y0MA 1IJWC 2YX4A 2CU7A 4NC8A 2HR3A 2K9MA 1F5TA 3M3YJ 1I3QJ 5AIPA 3GFIA 1C0WA 3DU6A 2WAEA 2X6XA 3FIWA 3FISA 1J75A 5D8KB 5F27A 5LRRA 2VQCA 1ZRDA 2BW3A 5EG0A 2OZUA 4HX7A 4XM3A 1ZREA 3W2VA 2V1DA 2V79A 2BHZA 2XVCA 2JJ7A 4MGRA 4GGGA 3PQJA 1SFEA 2DT6A 5DDGA 1HW1A 4U0WA 3VSLA 2JA7J 2P0WA 1SMTA 1IN5A 2DA3A 2VBXA 2FX0A 3P5JA 4UVBA 5FO5A 2BY2A 4EV0A 1HSJA 5CYVA 3HTSB 3EDPA 1BJZA 4IX7A 5J1YA 1JGSA 1J09A 1I5ZA 5E18F 2JVHA 3PL8A 1USTA 4KISA 2E1CA 1LFPA 5M5YJ 2DOAA 4PJNA 3OMYA 2NVQJ 3JSPA 1AU7A 2CSOA 4NQWA 1Y1WJ 1MNMC 1RESA 3G1MA 4JBAA 5GPAA 3TEDA 1JJ8C 2K9SA 2C6YA 1Z3XA 3KP2A 4LFUA 1JUPA 1T8IA 4PFPA 2YS9A 3Q3SA 3AG3H 1FTZA 2KIUA 2UUZA 5B3SH 3IUOA 2MLKA 3GMEA 1WJBA 2DJNA 2PFBA 3PUBA 2CW0F 4XONA 2LD5A 1O3TA 1JGGA 2HOTA 4ESJA 1GVJA 1TWFJ 1HSTA 1XDSA 5E3LA 1KA8A 2V9PA 3Q0UA 1HQCA 4CA0A 5LGUA 3WTSC 2P7CB 3W6KB 3MEXA 1IDYA 4I98B 4RLFA 1R5HA 2Y0SN 4GXOA 4G7HF 1LKXA 2R7FA 4XKVA 1IXSB 1IRXA 1EF4A 5FFXA 1JXSA 1TNSA 1WJFA 5JVGF 3WTTC 3ULQB 1FYLA 2JA8J 2VJJA 5IP7J 2RC4A 5D6EA 2DA6A 1Y8RB 2FF4A 2E5ZA 2CV0A 4OOIA 5LEJA 3IKTA 3FXQA 3C2GA 2DPDA 2VQLA 3LFKA 2DQRA 2IPQX 1QGPA 5L3EA 3J7AO 3OL4A 3MKZA 1XMKA 3UR3C 3A01A 3S16J 1TQIA 4FQGA 1VFCA 2OV7A 4M6YA 2ADUA 3V8LA 4A3BJ 2MBFA 3K4MA 4MQVA 4JQFA 4RMNA 2QSHX 4E7KA 5DCMA 3FKJA 1IRGA 4CCJA 1I6HJ 4AIDA 1FOXA 2HU9A 4DYCA 3CZ6A 2B9SA 2R93J 3DLLF 2L4AA 4E70A 3TO9A 3ZQLA 2DOEA 2MGQA 3K4CA 2XDVA 4A12A 2CRGA 5J40A 1IV6A 1CGPA 2DMTA 4E7LA 3CF5F 1YTYA 2QF7A 3QPTA 3TP0A 3OS1A 3FM3A 5ILUA 4HX4A 5L3BA 5EGOA 3JRDA 1G3SA 3VPRA 5IYBJ 4ZTJA 1RUNA 1DQUA 2OCEA 3GTGJ 1G8XA 3GTPJ 3GCMA 5ILVA 2H6BA 2BE5F 4R79A 2DT7B 4RM2A 2IA2A 2K27A 1FNNA 3CDLA 5GTIC 1J59A 2JSPA 1UB9A 2NNNA 1UZCA 2PN6A 3BZCA 4HW0A 1B8IA 1F36A 4A0XA 2QQAA 2ZFUA 5FLMJ 3DLAA 1KQ8A 2PJRA 3DTKA 4N4OB 4AIHA 5DS9A 1E3PA 3FXLA 2P5VA 3ONQA 1VTNC 1YW9A 3FBNB 4V2GA 1MMSA 3E5XA 1K6OA 4X0GA 1ZLJA 3IAS2 1XSVA 4RB3C 3BQYA 4XN0A 3OV8A 3OYEA 3PM1A 4BNCA 3FF5A 3N05A 3DXJF 3V8JA 5D5VB 2L7MP 2LF8A 3RKYA 2XGXA 3NAUA 1HW2A 4UV8A 2RREA 3BTJA 1TBXA 1ZHFA 1CF7A 1PUFB 2K7LA 4FE4A 2ZCWA 3GWZA 2J5OA 5JI6A 3GFJA 1LUJB 2M4GA 2P6SA 3KLOA 5F1JA 2XV4S 3RKQA 1JT0A 2HTSA 1JKRC 1H89C 2VBZA 1N77A 2XB0X 3FMQA 5J6XA 2ZB9A 2FE3A 3KP6A 2Y31A 3K70C 3H9JA 1YRNA 3B02A 4ESFA 1TW2A 3JRGA 4UVCA 5HLHA 2CJJA 5IPAA 4P55A 5IOZA 5DEQA 4MQ9F 5HDKA 1KYWA 3ZQCA 5GADJ 2F5EA 4S0HB 3GLLA 1K4TA 3A03A 3LA7A 3BR2A 5FKLA 3J80K 3DBLB 2DI3A 1L3LA 2WADA 4HDVA 1J9IA 2GOXB 3HC7A 4LIVA 4ZYDA 3BJ6A 2YU9J 2O8XA 2ZNZA 4HX8A 1HXDA 1KU3A 3M7GA 2ZXIA 2V6EA 1T38A 2LF7A 2ELHA 3BY6A 5EZHA 2LTPA 2Q2EA 2CQ7A 4LK0F 1YO5C 1BW6A 2OC6A 3WG7H 4PGGA 3SDGA 1X2MA 2XROA 3LA2A 2EFOA 1BIBA 3AFHA 4ANJA 1R71A 4BQOA 5AIQA 4RAZA 3E6BA 1HCRA 5E3MA 3JRHA 1YX5A 1S3JA 2F4IA 4G12A 2LMDA 3PIOF 4N9HA 1QZZA 3PNVA 3FHZA 3F8CA 3ISPA 1GUUA 5CQEA 4A3GJ 1VF9A 3F6OA 2IT0A 4I01A 1H8AC 2VIXA 3FWEA 2IS6A 2MC3A 2HDDA 1ODDA 3ZQ7A 2EFWA 2L7ZA 1ZGAA 3FK7A 1LPQA 2PEXA 4M6XA 4S05A 3JAMZ 4L5JA 1NK2P 2FQ4A 3V4GA 5IT9K 3HBLA 1UHSA 4E7IA 1OPCA 3M9AA 5J8CA 2KHMA 3SZPA 3ESWB 3PUFA 2NYXA 3ABTA 4MO7A 2KRHA 4A5NA 2HQ5A 1X3WB 5J4VA 1G3TA 3H5RA 1SC7A 1KQ9A 1NG6A 3BCAA 5HNFA 2NAZA 3H3ZA 4RB2C 1WPKA 3LOCA 2ZXJA 1IF1A 1OQYA 2PLYA 1U9NA 2J5PA 1UHWA 1JI8A 2ECCA 4XORA 3RYPA 1X1DA 2JUGA 4P5OA 4GCVA 4EGYA 2HFHA 4HRIA 1V5GA 3FKIJ 2R7WA 3S1RJ 2LG4A 2FD5A 2NXNB 3BZKA 1QA6A 3MWMA 3I59A 2CQQA 3V7SA 3HOVJ 2V1XA 4QLCU 2EJRA 4IQ4A 4DQ2A 1Y0UA 3GTLJ 4XOPA 3C3WA 2XRLA 3O2PE 3V8KA 4BAYA 2KDZA 3BG3A 4H4KC 3CUQC 2NNYA 4XMYA 1F1ZA 1XTAA 3TBIA 4IXAA 2H8WA 4IOCF 1BOBA 4NDLA 1VNDA 3MKYB 1Y0NA 2ID3A 2OUMA 2XAGA 4BXFA 1XGSA 1SFKA 4E4HA 4D9JA 1JTYA 4RLQA 1VQ5I 3K2ZA 4I76A 2MLGA 4L9JA 1IV8A 3I58A 1MBJA 4BXXJ 4ZZLA 1GV5A 1FOWA 3KFWX 3OYDA 3CDHA 3UNGC 2LY9A 3F6VA 1TQPA 1E2XA 5FD6A 1MSFC 1O3RA 3G3ZA 4PDKA 4RAFA 3NEUA 1GVDA 2VKDA 3VODA 4JK1X 1STZA 2R7VA 4EJOA 3BTIA 3W6VA 1Z9CA 2H09A 4ZTFA 1REPC 1KU9A 5E8GA 3HKZA 4GYGA 3J81K 2ZSIB 3SZGA 1MIJA 3KETA 2K5CA 3CCYA 3CC7I 3QYEA 1VQMI 3VYRB 1WZ2A 2EWNA 3A2KA 4ESBA 3BROA 3KYCB 3HM5A 1O7LA 1S8NA 2OQRA 3JW4A 3CCMI 5IP6A 1DGRM 3CJQB 1B72A 2Y48A 1XN7A 1MKMA 1RKTA 1X3ZB 2DT5A 2V7FA 2Z3YA 2XF5A 2DMUA 4DOZA 3OYKA 2Q0OA 2CUZA 2OQGA 2FMLA 4UUTA 4XKBA 2D45A 2O03A 3ZXSA 2NRAC 3I9V2 4XSZF 5CVVA 3JRBA 3Q0VA 1QO0D 1IN4A 2CW7A 3ERED 4EATA 4C30A 1YS7A 3M07A 3HHGA 2OZ6A 2ETHA 4XLPF 3DKXA 4CZZA 4RGRA 1LDJA 2DLLA 1TWHJ 4YEJA 1MNEA 5J4YA 3AG4H 2MYSA 5F64A 4B3AA 2X85A 3CCRI 5LRSA 1B6AA 2KKOA 5CVJA 2JSCA 1WCMJ 3MMYB 3H3VK 4GYIA 2A69F 3BR1A 2JRMA 1Z7UA 2BW3B 2XKOA 4BEHA 1QHGA 3EETA 3DQVC 1KGSA 4F3QA 3QYFA 3AAFA 3HPHA 1XMXA 3AKZA 2R5YA 4IO9F 2H94A 2M5WA 2DDBA 3HOYJ 2QENA 1A35A 1MJ9A 5E1WA 5IYCJ 3F22A 3E6CC 2W1OA 4X6AJ 2HQNA 1D0ZA 3G1LA 2I8DA 3CMAI 3E97A 3K10A 3S14J 1B9MA 4MIMA 3I4NJ 3U1KA 2KISA 2JA6J 5FKNA 4LMYA 3HUGB 2DA1A 5JFRA 5DM6F 2LVSA 3H0DA 2AO9A 2KRFA 1X1CA 4MTDA 2R5ZA 2V4JC 1TWCJ 2VQGA 1PVEA 2D1VA 4NQWB 2O61A 1LDDA 2E7XA 2CS3A 2RV8A 1WJCA 4Y4RA 1OFCX 3IKVA 1WI9A 1VQOI 1ACIA 3MZHA 4XRFA 4ASNA 3RPUA 1WJDA 2OTLI 2R7OA 5HDGA 4WXDA 4U88A 4L18B 2YU3A 5J47A 3M4OJ 5GAHJ 4CCOA 3Q9SA 3HKZN 5EYRA 2KZGA 2FOWA 2XB5A 4B09A 5K7ZA 1AKHB 2GXBA 2KIMA 2ICWG 1XX5A 1NTCA 4L9TA 4XR6A 1W1WE 4HLYA 1R7JA 4N0BA 2E2IJ 4K2EA 2CG4A 1WQ2A 4BQQA 4DYRA 4RGUA 3FXUA 3TDUC 4PFOA 5GAGJ 3R6SA 3ECOA 3FX3A 4EM2A 3LAJA 4PJ0C 4M71A 3QODA 4UB8C 3VYTB 4XICA 3G71I 1PP8F 3N97A 1BI2A 4C9YA 2R3SA 4CYCA 3HJEA 4DZPA 3P9IA 4A3LJ 4B44A 1MJBA 2K4JA 3A0BC 4CUGA 1XC5A 2KPMA 2BOLA 2VT3A 2Y75A 3ECHA 3A01B 3ZGKA 3O6BB 2DMPA 3SHFA 2X6YA 4Y3OA 1UHMA 2JA5J 1P4WA 3ZMVA 3ELKA 3CCUI 2M9HA 4WXCA 3ASOH 4XKWA 2VASA 3KX2A 2Y69H 4NUBA 3J80Z 1F9NA 2E2HJ 3OYLA 3S15J 3LQRA 4ZDOA 4A3JJ 1E3HA 4HQMA 1IZ1A 4AIKA 1JE8A 3BTCA 2NS8A 2TDXA 1ZR2A 2IS2A 3CMEI 2X6WA 2A61A 2EFQA 2WTEA 1X3UA 5HLTA 3A4CA 2MSYA 2HEOA 1VQKI 3EYIA 2XAQA 2P7VB 3I55I 2LKSA 2GXAA 1MNDA 5EZGA 2FNPA 5EEGA 3MZYA 1DPUA 3HSRA 3T5XA 3AL0B 2XASA 2DTRA 1EA3A 3BQZA 1YITI 3HOTA 3RZDJ 3EQLF 3E6MA 5EGOB 2DDAA 1SVLA 5L3FA 1U9OA 1V5FA 4RS8A 3LSJA 4YIIA 2Z2SB 1K78B 4ZH4F 2L9NA 4DZJA 1IUFA 3OIQA 2EFNA 3KZYA 2JN6A 3LMMA 3TP3A 2E1MC 2PG4A 3D5LA 3CP8A 2DW4A 5D5UB 1B8IB 4OWRB 3ZP5A 4C3IJ 1RC9A 2R7XA 1U2WA 4KN4X 3RDIA 4M3DA 2ZO4A 2DPUA 2YSRA 3DF8A 1RRJA 2FOKA 1LJ9A 5B1AH 4EQQA 1Z3YA 2O6GE 1SAUA 3BG6A 2EA2A 1Z05A 2W24A 5IT9Z 3RQ4A 3JCUC 4AWXB 2HZTA 3E5QA 3H92A 2QEXI 4LG3A 1WJAA 3A02A 2Z1DA 1Z77A 1GXPA 2Y9YA 2AS5F 4MEXF 2YR2A 1YX3A 3NRVA 3ASNH 1IN8A 3BG7A 4P96A 2AHQA 3SFIA 3FXKA 1CF7B 3ZPLA 1MBEA 2GOMA 3QWLA 1LB2A 2ZXWH 1R5ID 4P9FA 2E35A 1QVTA 2W57A 5JR3A 2CWEA 3BR3A 3IH2A 2HYJA 1WJEA 3EYYA 2XAJA 2A5WA 4HPQA 5IT3A 1VQ7I 2JRTA 1R58A 5HVQC 2Y2ZA 4BKXA 1U8RA 2W4SA 1GDTA 1TTYA 2ECBA 2VN2A 4AIJA 2ME0A 2I10A 2W25A 3DV8A 5E20A 1MSEC 1FZPB 2E7WA 2FJ1A 3KE2A 2FNAA 2QVOA 2MABA 3H5NA 3CCLI 3J7YJ 4UB6C 5H20A 2IP2A 2EINH 3G73A 3JTGA 4WXHA 3L2CA 3SZTA 3PO3J 2OTJI 4L0YB 3F8NA 3OYAA 2W82A 4UVAA 1QVUA 1DU0A 2WB1A 1E0EA 3CMYA 1LEAA 3RPQA 3W2WA 5E3NA 1LVAA 1QHHD 2D2WA 1TP4A 1IUYA 1K79A 2R7ZJ 4P9UA 4HV5A 3CD6I 4B4CA 2X0LA 4HF1A 3HYIA 3F21A 2ZFWA 2XGCA 2WAQN 2BY3A 2ZNYA 3CJRB 3WTZA 5TISC 5F0HA 3SQNA 5E17F 2CQNA 4D0PA 1T2KA 1TL8A 4C3JJ 5DV5A 2NVTJ 2UXNA 2IXSA 2DOFA 1Z7LA 2QBYA 2DQLA 2JUCA 5DTDA 4DW6A 4XK4A 1S29A 4OIOF 1POGA 3M1EA 2XGEA 3PSIA 1EH8A 3TGNA 4A93J 2L7FP 1XB4A 5J3LA 4X1EA 3J81Z 3CDIA 1KONA 2X48A 5BOXA 4LLLA 2VBYA 4YRVA 2CYYA 4DNCA 3S3OA 1FBUA 5C3EJ 2V26A 2A07F 2ACJA 2AQFA 4V19K 4OAYA 5IY5H 1X1PA 4G9YA 4PSWA 5KK1A 1NK3P 4RB1A 2XKPA 5IOYA 2GIZA 2L4MA 3LWFA 4NNJA 5JVTA 1J5YA 1U5TC 4GDFA 3BC8A 2KQRA 1F4KA 1QRYA 2IGMA 2M7BA 1RETA 2MG4A 3ZQGA 2VOOA 4DYQA 2KMUA 4XRSA 1DP7P 2G7HA 3PNYA 3CCVI 2OCCH 5FB2A 4BDZA 4BH9A 1OCRH 2DMNA 1XPXA 3ZQHA 3SXYA 2JZYA 2ID6A 2IS1A 5GPCA 4ABZA 3TMOA 2BV6A 5FLVA 2R92J 2VKVA 1MW7A 1FT9A 1ETOA 2VBWA 2FBIA 2ZSHB 2X1DA 4MNUA 4I02A 1SD5A 1D1CA 1WFXA 2EZIA 2A05A 3I59B 5ILSA 2RNJA 3BPVA 4A0ZA 3U9GA 2HYGD 3MFKA 2G0EA 2WAFA 4EMSA 4HLXA 3KEYA 4RDUA 3ZN0A 3KP7A 1SD6A 1SMYF 3RPUD 3WE2A 3WTYC 1D5VA 3M8EA 2PJPA 1V5EA 2E2JJ 3OS2A 5FD5A 2BVMA 1BR4A 3ZMSA 4LIUA 3KEOA 2LRDA 2LK2A 3ZMTA 2F5DA 4IPAA 1GXQA 2WB1N 1RPWA 2XHKA 3K4LA 3Q5FA 4S04A 1Z1DA 4CGZA 1YG2A 4J01A 3G4SI 3I4MJ 3H36A 4HOBA 3B6CA 5HLGA 2ME6A 2XRNA 1O7FA 4IHVA 2OAZA 2WC2A 1ZQ3P 1ZKGA 4LD5A 1U8BA 3MKWB 3HXLA 5HDNA 2FXAA 4I99C 4XLNF 4OU0A 4ZYGA 2AXLA 4ZDLA 4IRHA 1L0OC 1T0FC 2K4BA 3C1DA 3S32A 5M5XJ 4A3DJ 2A68F 2XF7A 3KP3A 2NS0A 2ZJRF 4XQFA 4ENMA 4U0YA 1XDUA 1A5JA 2M7AA 4F92B 2WV1A 2LFBA 2R4GA 2LKXA 4IOAF 1R6RA 1UG2A 4CICA 1KYZA 3E6DA 4WF2A 3ZOBA 4BQNA 1W5TA 3S3NA 5AONA 3ABMH 4CO8A 3W2AA 1B72B 2A6TA 1M1EB 2EV6A 4L9VA 3S1QJ 2WBMA 3FBIB 1K4SA 3RYRA 2VODA 1X58A 5A2QK 1E17A 1I50J 4IEJA 3MN2A 3CQZJ 1D5YA 1B9NA 4HBLA 5HLIA 2V6CA 3FMRA 5D5WB 4HSTA 2DBBA 1H0MA 2FBKA 1CQTA 1OYWA 2ZJ2A 4AVPA 1OISA 4UUSA 1ZH5A 4PJMA 2O5RA 1H88C 2NVUB 2R7RA 5IP9J 3CC2I 4UUVA 2DXIA 2QQ8A 3GZ6A 2VONA 3TL4X 4KIBA 2PMZA 1WRJA 2HI3A 5JHUA 1YIOA 3L7WA 2BZTA 1SANA 1SFXA 3NARA 5BMZA 3VFZA 2BY0A 4ENNA 4D1QA 1OCOH 3PFIA 9ANTA 3F8FA 1OMIA 3M8FA 4O6JA 1P4AA 3CESA 3OWTA 3OIPA 3P7NA 5J8FA 1ON1A 1YW8A 5LHIA 2P4WA 4AU7A 4Y13A 2R5YB 3GYHX 2HNHA 4YIFA 4OINF 1YOVB 3KYLA 4XSXF 2EILH 3CMMA 3FDYA 4G6QA 4XKCA 3OYCA 1IDZA 1IW7F 1IXRC 4EGZA 1BL0A 3RI4A 1PJRA 4KMUX 3WGHA 2IJLA 2L9SA 2X9DA 2DA4A 4ZYAA 3FZVA 4G6DA 4AVZA 1JKQC 3HTUA 4BHCA 3OOUA 2KFDA 1ZK8A 4V2FA 1X2NA 2Z5UA 4RAGA 1W36C 5TGTA 4WWCA 1DGWY 4M9XA 5GTHC 1FBQA 2JPCA 2VT2A 2MC4A 2L2OA 1I3AA 4E7ZA 3CUQA 2NOJB 3VOEA 1MGTA 3VB2A 2B7EA 1K7AA 1Y6IA 2KL4A 4M3EA 4U7DA 4O3MA 2KIFA 1ZGJA 4U7BA 3QPSA 3MAJA 3BOQA 3K4NA 4M3BA 1AOYA 4ZYHA 5CQGA 3JRIA 2L01A 4LB6B 2XF6A 1O4XA 4A6DA 4MTEA 3V42A 2D5VA 2M30A 4CXFA 3CLQA 3DP7A 2ZJPF 2V9VA 3LNQA 2HTJA 3RIRA 1NG7A 1FC3A 4KNYA 2R7TA 1FP1D 1WVRA 3F9KA 4KA4A 4IHWA 5F0CA 2H6CA 1TLHB 2WY8Q 5ED4A 2P5LC 2LH9A 4KICA 2M3AA 1T56A 1WGXA 2Q8KA 4IHXA 5ICFA 2JPBA 3IH4A 2HPMA 4FETA 2GQQA 1G3WA 4IVNA 3WU1B 2DCEA 2QZ8A 2P8TA 1R36A 1IRFA 3C7JA 2MH2A 3Q9VA 3R0AA 4PJLA 5E8IA 4CCLA 1YW7A 2EFPA 4B3XA 4B43A 4B8XA 2K9NA 3F8MA 4LGWA 1DDNA 2VQHA 2XAFA 4QSHA 3D5SC 4CYCB 2IW5A 4ZJZA 4IJAA 4Y33A 1YHQI 1U78A 4CCMA 2P81A 2WWYA 1SVMA 3HSEA 1SFUA 3RJPA 1IN7A 3QP6A 1PP7U 1V55H 1ZTRA 4M9SA 1ZYRF 3QPLA 3N4MA 5CVRA 5LD2C 2PMZN 1OJLA 4IF4A 4A2UA 5B5EC 4L0ZB 2H27A 3TW7A 2M1BA 1EV7A 1Z0XA 1ENHA 1OYIA 3D5RC 2UWMA 3ZN1A 4OIPF 2QWWA 1MZBA 2R7UA 5GAEJ 1R1UA 1Y8QB 4EVIA 4KIFA 4XLHA 3QOEA 1HKTA 4XRSG 3HRSA 4E7SA 4KYWA 1BOAA 3FXJA 1EH6A 1MJAA 3JSOA 3S2WA 3GZ5A 3BPXA 2COBA 3ZRGA 1G2HA 1SVOA 5EJCA 3QP5A 3EPZA 4ITVA 3LSRA 1LFUP 2DFHA 2M8EA 1JUSA 4UXNA 3K1PA 4NBQA 2GXGA 4CSWA 3QPHA 3K4KA 2G9WA 4ZYEA 1VQ6I 4KJZA 2HYFA 3OR1C 4M3GA 4EEFG 2VE9A 1O57A 4WCGA 1ETKA 3OY9A 5D5XB 1BI3A 1LFBA 1HLVA 3HOUJ 1ZN2A 2HVRA 2FSWA 2VJ4A 4W97A 1N25A 4KIGA 5HODA 3CLOA 3LQQA 2PI0A 4NB5A 2BEOA 5K5OA 3MQ0A 5FRNA 4OIRF 2EK5A 1FIPA 3SFZA 2EBIA 1BN5A 1Q1HA 3KP5A 1ZG5A 3LSTA 1ETWA 2CMPA 5TJJA 5J1UA 4XBFA 2DTZA 1RNLA 1ONVA 1UELB 2K86A 1ZRFA 3S17J 2K85A 1SFOJ 5EF6A 2K3PA 3I3LA 1A6QA 4QWQA 1MBKA 5EG0B 4R1HA 3K70D 5CVUA 1R5GA 3IV5A 3LSGA 5D6FA 5F04A 3AG2H 3BJOA 5DM7F 1WSUA 3IP4B 2DFIA 3ABLH 3CUOA 3GLXA 4AM3A 2EIKH 3W3CA 3DWLE 4LK1F 1HKQA 2DODA 1WI3A 3PSFA 4Y52J 2RN7A 3A1YA 1EH7A 3CCEI 4XN3A 5H6RA 2L5QA 3QOPA 1OKRA 4IHTA 3X2QH 1VQNI 1JT6A 4M74A 4Q48A 1XGNA 4AC0A 1A04A 2ESHA 1U3EM 2KP6A 3Q0WA 2P6TA 1YYVA 2O3FA 2CQKA 2QKMB 1UFMA 1U6GA 2XIGA 5KCMA 2OPTA 1JHHA 2HOAA 2O9LA 5M3MJ 2RAEA 4YELA 2IGOA 2PX9A 2DK8A 1D0YA 4BU2A 2L54A 3ZQFA 1USSA 4LLNA 3KYDB 2K9LA 1N75A 1GT0C 4DGWB 3L2UA 3U21A 5BPIA 2BXZA 4MEYF 2Z9OA 1YS6A 1R22A 3TQNA 3RTRA 4E7JA 2QBYB 3ZMDA 3C18A 3H5AA 4PZJA 2VJIA 2BGCA 2EA4A 3OYBA 1QU3A 3DTEA 1XSDA 3HGGA 2XSDC 4I2OA 3F72A 5TRDA 3RZOJ 4EJTA 4U87A 1QPIA 3OYGA 1D1BA 2MA3A 1NH3A 3S1NJ 3RKXA 3JR9A 3R61A 2W7NA 4KT5C 5DD8A 1APLC 1B59A 2Z99A 5ICGA 2DMQA 4B48A 2K02A 4P1WA 2F4OB 1V3FA 2HQAA 4I7HA 4RAYA 1IG7A 2WY7Q 2WV0A 2EB7A 4HSRA 1EKEA 2AXTC 3L2QA 4Q47A 2CV1A 4B47A 5A2QZ 4C2TA 4F52A 2CW8A 4QPOA 3M8JA 1I39A 4F7ZA 3VYSB 1FLIA 5D8LB 2A3SA 1MDMA 1X1BA 2RGVA 1GV2A 3BLYA 2B63J 3OYMA 3WHBA 2UXXA 3GEZA 3R0JA 2R7QA 2E34A 1MD0A 2DA2A 4ZC3A 1O3SA 2A6EF 2F48A 2M0MA 5E1ZB 3ABKH 5KHDA 5DCMB 2DN0A 1A6IA 2E1NA 4JX4A 3HOWJ 2NS7A 3WGGA 1WKMA 2ISZA 2JK3A 4BYYA 2VXZA 4A3IJ 4CCNA 4BGDA 2ELKA 3COAC 4FE7A 3JRAA 4EM1A 3V7CA 2E60A 3I4PA 2H1LA 2E36A 3B73A 2IGKA 3JRFA 1FY7A 2EPFA 2RNGA 2KJBA 2FEZA 4EJUA 1XGOA 2VC1A 3WTVC 1I1SA 3ZQIA 2IEKA 1P7IA 3K1NA 2F2EA 4D5CA 4QPQA 3FXRA 2HZDA 1DP3A 1TT5B 3VDXA 4G6TB 1I1GA 2CO5A 2XGDA 2CH0A 2LBFA 3I54A 5C4JJ 4YFXF 1TZLA 3DTIA 4L9NA 3S93A 5ERIA 4UHTA 5FROA 3VEPA 2QLZA 3BR5A 2M34A 1S9HA 4XOTA 3IRQA 3AG1H 4XIDA 3TO6A 1BM9A 2HVSA 2IS4A 2XPVA 1FBSA 2JVGA 2GM4A 2PJRB 4PGHA 4KN7X 1MBGA 2F5VA 3HSFA 2KIQA 4EJVA 3DEWA 2HQRA 3TO7A 1WH5A 4RM3A 2OBPA 2LDUA 5HOOA 5FKMA 1YE9A 4XLCA 1MMNA 3QAHA 1Y1VJ 4A5MA 1TQMA 4BY7J 3R60A 1FIAA 4BBRJ 3PFYA 3HOSA 1JJ6C 3E1SA 2XC7A 1TW3A 3RSNA 2ZMEA 5B66C 2EIJH 4CHUA 3GVAA 1BBYA 1A36A 1FOKA 2Z16A 1ITYA 4B1RA 1T6SA 4A3KJ 1XGMA 4D7NA 2LY2A 4C2UA 3TKYA 2EQRA 2GA1A 2FBHA 5CKTA 3OSGA 3C2HA 3VYUB 4PSXA 2FA5A 1BI1A 1V4RA 4IKFA 4DBRA 3D0SA 2E1OA 4OMYA 1W7PA 4JP0A 1FEXA 1QZEA 3PNTA 4XLEA 1ZG1A 3BT9A 3IWZA 5BPDA 2QUFA 1SAXA 3PJRA 4XL9A 3K2AA 3L09A 3O8HA 2LKPA 3EUHA 2QQBA 2R7DA 4HQEA 1JKPC 2QM3A 3NQOA 1YRNB 1LVKA 2QA4I 4ON0A 2LYCA 4W1UA 5LLQA 2DYSH 4YFKF 3KEQA 3MD2A 4ZZDA 3G6EI 1S6LA 1X4PA 2W00A 4UUSB 4HDUA 1S72I 4A3MJ 3BTLA 4JOMA 4TV7A 2H1KA 1Z6TA 1FMWA 4YIRX 1XG1A 4AYBA 5FRMA 2XAHA 2VB6A 4OIQF 2PQ8A 2IA1A 1OCZH 1NHAA 2DO7A 5F08A 3HHHA 2ZMEC 4LOCA 5CPRB 5DUKA 3WODF 2L9RA 4E6KG 2Q2EB 2VOPA 3JTHA 2BVLA 5E79C 5HS7A 1IXCA 1U5TA 3NWTA 4IHYA 3JREA 1N78A 3L2WA 3TDZC 2KDOA 1FYKA 2LSOA 2VL8A 5E3OA 1WJ5A 1VQ8I 3HUGA 2OF7A 4HA8A 1O3QA 3E0JB 3S2HJ 1TWAJ 1RR8C 3EUHC 1H9TA 1UCRA 1FJLA 2F6CA 3MVPA 2LR8A 1SD4A 1K6YA 4OAZA 1RUOA 2F4MB 1LE8A 1B4AA 2O7OA 2YX7A 3E3VA 4RA2A 1KZHA 1ZAOA 2HVQA 2VKHA 1R1VA 2DA5A 2XPUA 1ETVA 1ZGWA 1Q1VA 3IC7A 2RKHA 3HEFA 4Z2YA 3HOZJ 2IA0A 3BWGA 2TRTA 5BNGA 4Q5SF 2STTA 3OYJA 1XCVA 2DFFA 2O8KA 1ZELA 3F0CA 3KIOA 3LAPA 2VPLA 3QU3A 1PDNC 3CUQB 2JQ7A 2CFXA 3K0LA 2ZJQF 5CJ9A 1AKHA 2EH3A 1LNWA 3DPLC 4FTHA 2Y30A 3DFGA 1QPMA 3ML6A 2CV2A 1P92A 1XMAA 2W48A 3I56I 4IZZA 3K69A 4FX4A 2L9VA 3I0TA 1T95A 1UAAA 1OLTA 4A69C 5EEAA 2VLAA 1Z21A 1KU7A 2GA2A 1MBFA 2X6OA 2VUMJ 1BJAA 2ZBKA 2Z33A 1U0JA 4BL0B 2GZWA 2X4HA 3PO2J 2IVMA 1T0FA 3K1MA 4M73A 3GO5A 2CUJA 2BXYA 3V7RA 1ERDA 2CUFA 2QGUA 1YLFA 2PMHA 1FX7A 1FP2A 2VI6A 2UZKA 1DUXC 3S1MJ 2KJCA 3DBRB 3A0HC 4FX0A 5E1XA 3T8TA 3ZR8X 4HEA2 5EDNA 4IRIA 3GTOJ 4M9ZA 1RIOH 2LNBA 2MD0A 4XRMA 5EEHA 4AYBN 3CCSI 5B1BH 5LGTA 3J7AY 4MHGA 2RVCA 3LA3A 4A3CJ 1OCPA 1JTXA 3L2RA 4HNTA 2VJ5A 3F3XA 1BA5A 2M0CA 5FKOA 2ZKZA 4WK8F 2BY1A 3BR0A 3PIPF 1XD7A 4NC7A 3HGYA 4PJJA 2EIMH 5LBQA 3WU0A 1G59A 1ORKA 1OCCH 1UG0A 2M4KA 1FWZA 2LP0A 1K78A 3G2BA 3K9TA 5LEKA 2DK5A 3FXMA 1OR7A 1S7AA 1YJNI 5F6FA 1JKOC 4LG0A 3SDBA 1ULYA 4AUXA 4MLOA 4BBSJ 3FM5A 4R8HA 1X1AA 3HB9A 4FISA 2IGNA 3E5UA 4L5IA 3SJMA 4DJAA 1Z6RA 3IWFA 1HOMA 2WA0A 2YUSA 1AWCA 2LY1A 3I71A 2CQXA 2ISYA 4A0YA 3CO6C 4GO1A 3F23A 3OIOA 3HL2A 3BG5A 5FLXK 2RDPA 1G3YA 3HIFA 2RQPA 2LC2A 2JWTA 2NVYJ 3ZQQA 2HS5A 5L3DA 1RZ4A 3AL0C 1QNTA 5HNHA 4I0BA 4II3A 4Y17A 4BE0A 2BBYA 3L9FA 5DYMA 1P4XA 3R4KA 1ON2A 2M87A 5LHGA 2EZHA 1IO2A 3C2BA 1RKWA 1W5SA 2MW8A 5H6QA 1BI0A 3OYNA 1OR7C 1FSEA 4HG2A 3RQIA 4L5EA 4C3HJ 1BR2A 4BY1J 1I27A 1DU6A 3WG9A 1S7EA 5LHHA 1PUEE 4HYEA 4LB5A 1FTTA 1P7JA 3DBHB 2DFEA 4BEHB 3U2RA 3SEZA 1BC7C 1D3YA 2D1HA 2ELJA 2HKOA 4F93B 1BW5A 2Q1ZB 5KVRA 4O5VA 1E3OC 4KMFA 5M5WJ 4BHBA 2W85A 1VI0A 2F5CA 2V1NA 3DCFA 4LJZF 1G6NA 2FUG2 4KUMA 1HDDC 1ETXA 3I64A 2P5KA 5FFZA 1X19A 3LSKA 4BS9A 3ZMUA 3IH3A 2VE8A 2QYOA 3BZ6A 3S3MA 2E71A 5LGNA 1W0TA 1HC8A 3PQKA 2GWRA 4RGSA 4YFNF 1OCTC 5LFAA 1T33A 5KAFC 1B1BA 4EM0B 2R5ZB 4EJWA 5JHFA 4DIQA 3GW2A 4Y7NJ 4H0EA 2GBYA 4YG2F 4N4NB 4BJ6C 4LITA 2M8GX 4CDGA 1D1AA 2IAIA 5BS6A 1W7PD 1T39A 1I6XA 1HW5A 4FT8A 2KRCA 3ZCOA 1HBXG 2OA4A 1R49A 2COMA 2QKLB 3KLNA 1ETQA 3P9CA 1HDPA 1IN6A 1QBJA 3GZNB 3HPGA 1FPQA 5HS9A 2F5FA 3FXOA 1UMQA 2HXIA 2MH9A 2HOSA 5DCFA 1Y39A 1VZ0A 3L00A 4FCYA 1LDKB 3WTUC 1VQ9I 2ZXHA 3OYFA 3SEQA 3OOPA 3WTXC 3GXOA 2KLOA 3OYIA 4BJ5C 2I5UA 4BDYA 2DYRH 2RQQA 4KT6A 2FU4A 5C4XJ 4M72A 4BHPA 4IHSA 1TC3C 5GP9A 3LSHA 2W84A 5K1YA 4KFCA 1WH7A 2MD5A 3H3UA 2ESNA 4ZDPA 5L3CA 2OJED 1R4NB 3VSKA 2V1UA 1G4DA 4I0AA 4I09A 2HWVA 4HZFA 5K5RA 5DD4A 4NHJA 3OR2C 3LFUA 1R4MB 2N8GA 3K4JA 1ZLKA 3H9QA 1UJ8A 1ZRCA 1J2XA 1BR1A 3KP4A 1YI2I 1SD7A 3O8GA 3BP8A 3BG9A 1MDMB 2E1MB 5C44J 3OSFA 2DJIA 4G7ZF 4D5FA 1ZR4A 3HRMA 1WHUA 3CCJI 4PK4A 1W0UA 2HKXA 1FMVA 3GBGA 4G7OF 4C2MJ 3EUAA 4RGXA 3KZZA 4XLAA 4CCKA 4UV9A 5D4RA 2L02A 1Y56A 1D8KA 1P9QC 2L0KA 1VQPI 3GX4X 4KITB 1JUMA 2AQEA 3ROUA 4N9IA 2K9QA 4GFBA 3EUKL 3MKLA 1Z91A 3HOXJ 1AHDP 4G8XA 4ENJA 4BUPA 4MFDA 3CCQI 1BC8C 4BXUA 3MZ8A 3QYBA 3G1OA 1AA7A 5CLSA 1MBHA 2X51A 1T98A 3CF2A 2QSGX 3L1PA 2QSFX 4UNOA 2LBFB 1S7OA 3DEEA 2K3FA 3BDDA 4CZCA 2JMWA 5ICCA 2CGPA 4IL6C 2K40A 4II2A 2VXDA 4CH7A 3FMSA 5BQTA 1J0RA 1YQAA 1OYYA 3RKWA 3ZMZA 6PAXA 1R00A 4G94A 5FJ8J 2FRHA 1YJWI 3CP2A 1IGNA 1VQLI 5D4SA 3ERMA 3HDDA 2GAUA 3HRUA 3LSIA 1R1TA 5J1RA 3E7LA 2G7UA 4JYKA 2L7KA 2PBIA 3KPHA 4IQJA 3M1CA 3BCBA 2X1EA 3NWSA 3QU6A 1PUFA 3WTWC 2ZMEB 5L3GA 3T8RA 2JTVA 1EJ9A 1VQ4I 2KT0A 2O0YA 2OD5A 3F8BA 4J00A 1YJ9I 3TW6A 4NC6A 3GUDA 4HAMA 2QQ9A 2B0LA 1QQIA 2BHYA 2YPRA 5FGMA 2NVXJ 4D7MA 2H8RA 3KCCA 3LSMA 1X4OA 1D0XA 1W7PB 1FOYA 2FMYA 4A6EA 4A3FJ 4ETSA 2JT1A 1IAWA 1MMGA 4HF0A 3IL2A 5ICEA 1QZYA 5K7HA 4WX9A 3GF2A 2VPRA 3TOBA 4J19A 1HA8A 2DAOA 4HV6A 4Z6YA 4Q4ZF 5M3FJ 2CFOA 2XUBA 1TNTA 4BE2A 1SEUA
chains in the Genus database with same CATH topology
3DEUA 1H9GA 2EV5A 4U0VA 1YFHA 1RI7A 3WE3A 1KQ0A 2GIVA 1U5TB 3REOA 5DUIA 4IRGA 4FHTA 1ZG3A 4ENKA 2OU2A 3GFMA 3TOAA 3BJAA 4CYDA 4HF2A 4OMZA 2M45A 1D8JA 1LQ1A 4LLGF 1FYMA 4AD9A 5F1RA 2HOEA 1XCBA 3CTAA 2STWA 4RB0A 2EV0A 2L3DA 5FLXZ 5K5QA 5CVIA 3IRRA 3DKWA 1GHCA 2VC0A 2FQ3A 3CJNA 1KU2A 1FSHA 1R23A 1BIAA 3U1DA 1J7KA 3QRFF 3T0YA 3DPTA 3WGIA 2BYVE 3W6JB 2A5YB 2DU9A 2A6HF 2IRFG 3ABUA 4KDPA 2PMUA 4BQAA 1HKSA 1WWXA 2HGCA 3CO7C 3I5UA 1XSXA 1ZARA 3T1BA 3IHUA 4PCQA 4Y15A 1P2FA 3JAMK 2HDCA 3MCZA 3HRTA 1W4MA 4LG0B 3P9KA 1DPRA 1LEBA 3O3KA 1P6RA 1JHFA 3GFLA 5HS8A 3I53A 2Y0MA 2YX4A 2HR3A 1F5TA 5AIPA 3GFIA 1C0WA 1J75A 5D8KB 5LRRA 1ZRDA 2OZUA 4HX7A 1ZREA 2V1DA 2V79A 2XVCA 4MGRA 4GGGA 3PQJA 1SFEA 5DDGA 1HW1A 4U0WA 1SMTA 1IN5A 2VBXA 4UVBA 4EV0A 5FO5A 1HSJA 5CYVA 3HTSB 3EDPA 1JGSA 1I5ZA 5E18F 1USTA 2E1CA 3JSPA 2CSOA 4NQWA 4JBAA 2C6YA 3KP2A 4LFUA 2KIUA 2MLKA 2PFBA 2CW0F 1O3TA 4ESJA 1GVJA 1HSTA 1XDSA 1KA8A 2P7CB 1HQCA 5LGUA 3WTSC 3W6KB 3MEXA 4I98B 1R5HA 4GXOA 4G7HF 2R7FA 1IXSB 5FFXA 1JXSA 1TNSA 3WTTC 3ULQB 1FYLA 2RC4A 5D6EA 2FF4A 3IKTA 4OOIA 5LEJA 3FXQA 2DPDA 3LFKA 2DQRA 2IPQX 1QGPA 5L3EA 3J7AO 1XMKA 1TQIA 4M6YA 2ADUA 3V8LA 2MBFA 4MQVA 4JQFA 5DCMA 1IRGA 2L4AA 4E70A 3TO9A 4A12A 1CGPA 1YTYA 3QPTA 3FM3A 5ILUA 4HX4A 5L3BA 1G3SA 1RUNA 5ILVA 2H6BA 2BE5F 4R79A 2IA2A 2K27A 1FNNA 1J59A 1UB9A 2NNNA 2PN6A 4HW0A 4A0XA 2QQAA 1KQ8A 4AIHA 2P5VA 1VTNC 1YW9A 3E5XA 1K6OA 1ZLJA 1XSVA 4RB3C 3OV8A 4BNCA 3FF5A 3DXJF 3V8JA 5D5VB 2LF8A 3RKYA 2XGXA 1HW2A 4UV8A 1TBXA 1ZHFA 1CF7A 2K7LA 2ZCWA 3GWZA 2J5OA 5JI6A 3GFJA 2P6SA 3KLOA 2XV4S 2HTSA 2VBZA 3FMQA 5J6XA 2FE3A 3KP6A 3B02A 4ESFA 1TW2A 4UVCA 5HLHA 4P55A 5DEQA 4MQ9F 5HDKA 1KYWA 2F5EA 3LA7A 3J80K 2DI3A 1L3LA 4HDVA 1J9IA 4ZYDA 3BJ6A 2O8XA 2ZNZA 4HX8A 1HXDA 1KU3A 3M7GA 1T38A 2LF7A 2ELHA 3BY6A 2Q2EA 4LK0F 1YO5C 4PGGA 2XROA 3LA2A 2EFOA 1BIBA 5AIQA 4RAZA 3E6BA 1S3JA 4N9HA 1QZZA 3FHZA 3F8CA 3ISPA 3F6OA 2IT0A 4I01A 3FWEA 2MC3A 1ODDA 3ZQ7A 2EFWA 1ZGAA 2PEXA 4M6XA 4S05A 3JAMZ 4L5JA 3V4GA 5IT9K 1OPCA 3M9AA 5J8CA 3SZPA 2NYXA 3ABTA 4A5NA 1G3TA 1KQ9A 4RB2C 2NAZA 3H3ZA 2ZXJA 1IF1A 2PLYA 2J5PA 1UHWA 3RYPA 4P5OA 4GCVA 4EGYA 2HFHA 3MWMA 3I59A 3V7SA 2V1XA 4QLCU 2EJRA 4DQ2A 1Y0UA 3C3WA 3O2PE 3V8KA 4BAYA 2NNYA 3CUQC 1F1ZA 4IXAA 2XAGA 1XGSA 3K2ZA 2MLGA 4L9JA 3I58A 4ZZLA 3KFWX 3CDHA 3F6VA 1TQPA 1E2XA 5FD6A 1O3RA 3G3ZA 4PDKA 3NEUA 3VODA 4JK1X 1STZA 4EJOA 1Z9CA 2H09A 1REPC 1KU9A 5E8GA 4GYGA 3J81K 3KETA 2EWNA 4ESBA 3BROA 1O7LA 1S8NA 2OQRA 3JW4A 2Y48A 1XN7A 1MKMA 2DT5A 2Z3YA 2Q0OA 2OQGA 2NRAC 2FMLA 2D45A 2O03A 4XSZF 5CVVA 1QO0D 1IN4A 3ERED 1YS7A 3HHGA 2OZ6A 2ETHA 4XLPF 4CZZA 4RGRA 1LDJA 2DLLA 5F64A 5LRSA 1B6AA 2KKOA 5CVJA 2JSCA 4GYIA 2A69F 1Z7UA 2XKOA 3EETA 3DQVC 1KGSA 3AAFA 2H94A 2M5WA 2QENA 1MJ9A 5E1WA 3F22A 3E6CC 2HQNA 3E97A 1B9MA 4LMYA 5JFRA 2KRFA 4MTDA 2D1VA 2O61A 1LDDA 2E7XA 2RV8A 3IKVA 1WI9A 3MZHA 4XRFA 4ASNA 3RPUA 5HDGA 4WXDA 4U88A 4L18B 2YU3A 3Q9SA 4B09A 2GXBA 2KIMA 4L9TA 4HLYA 1R7JA 4N0BA 4K2EA 2CG4A 1WQ2A 4RGUA 3FXUA 3TDUC 3R6SA 3ECOA 3FX3A 4EM2A 3LAJA 4M71A 1PP8F 3N97A 1BI2A 2R3SA 3P9IA 1MJBA 2K4JA 2VT3A 3ECHA 2Y75A 3O6BB 3SHFA 1UHMA 1P4WA 3ZMVA 3ELKA 4WXCA 3J80Z 1F9NA 3LQRA 1JE8A 4HQMA 1IZ1A 4AIKA 2TDXA 2A61A 2EFQA 2WTEA 1X3UA 2HEOA 3EYIA 2XAQA 2P7VB 2FNPA 5EEGA 3MZYA 1DPUA 3HSRA 3T5XA 2XASA 2DTRA 3HOTA 3EQLF 3E6MA 5L3FA 4RS8A 4YIIA 1K78B 4ZH4F 2EFNA 3KZYA 2PG4A 3D5LA 2DW4A 5D5UB 3ZP5A 1U2WA 4KN4X 3RDIA 2ZO4A 2DPUA 2YSRA 3DF8A 2FOKA 1LJ9A 4EQQA 2O6GE 2EA2A 1Z05A 2W24A 5IT9Z 4AWXB 2HZTA 3E5QA 3H92A 1GXPA 2AS5F 4MEXF 2YR2A 3NRVA 3ZPLA 1IN8A 4P96A 1CF7B 1LB2A 4P9FA 2W57A 5JR3A 2CWEA 3EYYA 2XAJA 5IT3A 2JRTA 1R58A 5HVQC 1U8RA 1TTYA 2VN2A 4AIJA 2W25A 3DV8A 5E20A 1FZPB 2E7WA 3KE2A 2FNAA 2QVOA 5H20A 2IP2A 3G73A 3JTGA 4WXHA 3L2CA 3SZTA 4L0YB 3F8NA 4UVAA 1LEAA 3RPQA 1LVAA 2D2WA 1IUYA 1K79A 4P9UA 4HV5A 2X0LA 4HF1A 3HYIA 3F21A 2ZFWA 2ZNYA 3WTZA 3SQNA 5E17F 1T2KA 4D0PA 5DV5A 2UXNA 2QBYA 2DQLA 1S29A 4OIOF 3M1EA 1EH8A 3TGNA 1XB4A 3J81Z 5BOXA 4LLLA 2VBYA 2CYYA 4DNCA 1FBUA 2A07F 2ACJA 4G9YA 5KK1A 4RB1A 2XKPA 2L4MA 3LWFA 5JVTA 1J5YA 1U5TC 1F4KA 2VOOA 1DP7P 2G7HA 5FB2A 4BH9A 3SXYA 2JZYA 2BV6A 1FT9A 2VBWA 2FBIA 4MNUA 4I02A 1SD5A 3I59B 5ILSA 4A0ZA 3BPVA 2RNJA 3U9GA 2HYGD 3MFKA 4EMSA 4HLXA 3ZN0A 3KP7A 1SD6A 1SMYF 3WE2A 3WTYC 1D5VA 3M8EA 2PJPA 5FD5A 3ZMSA 3KEOA 3ZMTA 2F5DA 4IPAA 1GXQA 2XHKA 3Q5FA 4S04A 1Z1DA 4CGZA 1YG2A 4HOBA 5HLGA 2XRNA 1O7FA 2OAZA 2WC2A 4LD5A 5HDNA 2FXAA 4XLNF 4OU0A 4ZYGA 2AXLA 4IRHA 1L0OC 2K4BA 3C1DA 2A68F 3KP3A 2NS0A 4ENMA 4U0YA 1XDUA 4CICA 1KYZA 3E6DA 4WF2A 1W5TA 5AONA 4CO8A 2EV6A 4L9VA 3RYRA 2VODA 5A2QK 1E17A 1B9NA 4HBLA 5HLIA 2V6CA 3FMRA 5D5WB 2DBBA 1H0MA 2FBKA 1OYWA 2ZJ2A 4AVPA 1ZH5A 4UUVA 3GZ6A 2VONA 4KIBA 1WRJA 5JHUA 1YIOA 3L7WA 1SFXA 5BMZA 3VFZA 4ENNA 3PFIA 3F8FA 1OMIA 3M8FA 4O6JA 1P4AA 3P7NA 5J8FA 1ON1A 1YW8A 5LHIA 2P4WA 4Y13A 3GYHX 4YIFA 4OINF 4XSXF 4G6QA 1IW7F 1IXRC 4EGZA 3RI4A 4KMUX 3WGHA 2IJLA 3FZVA 4G6DA 3HTUA 4BHCA 2Z5UA 4WWCA 4M9XA 1FBQA 2JPCA 2VT2A 3CUQA 3VOEA 1MGTA 3VB2A 1K7AA 4O3MA 4U7DA 2KIFA 1ZGJA 4U7BA 3MAJA 3BOQA 1AOYA 4ZYHA 2L01A 4LB6B 4A6DA 4MTEA 2M30A 4CXFA 3DP7A 2V9VA 2HTJA 3RIRA 1FC3A 4KNYA 1FP1D 4KA4A 2H6CA 1TLHB 5ED4A 2P5LC 4KICA 2Q8KA 5ICFA 2JPBA 3WU1B 2GQQA 1G3WA 4IVNA 2QZ8A 2P8TA 1R36A 1IRFA 2MH2A 3C7JA 3Q9VA 3R0AA 5E8IA 1YW7A 2EFPA 4B8XA 3F8MA 4LGWA 1DDNA 2XAFA 2IW5A 4IJAA 1U78A 2WWYA 1SFUA 3HSEA 3RJPA 1IN7A 3QP6A 1PP7U 4M9SA 1ZYRF 3N4MA 5CVRA 4IF4A 4A2UA 4L0ZB 2H27A 2M1BA 1EV7A 1OYIA 2UWMA 3ZN1A 4OIPF 2QWWA 1MZBA 1R1UA 4EVIA 4KIFA 1HKTA 3HRSA 4KYWA 1BOAA 1EH6A 1MJAA 3JSOA 3S2WA 3GZ5A 3BPXA 3QP5A 2M8EA 4UXNA 3K1PA 2GXGA 3QPHA 4ZYEA 2G9WA 2HYFA 2VE9A 1O57A 4WCGA 5D5XB 1BI3A 1ZN2A 2FSWA 4KIGA 3CLOA 3LQQA 2PI0A 4NB5A 2BEOA 5K5OA 3MQ0A 4OIRF 2EK5A 3SFZA 1BN5A 1Q1HA 3KP5A 1ZG5A 3LSTA 5TJJA 4XBFA 1RNLA 1ONVA 2K86A 1ZRFA 4QWQA 4R1HA 5CVUA 1R5GA 5D6FA 1WSUA 3BJOA 2DFIA 3CUOA 3GLXA 4LK1F 1HKQA 2RN7A 1EH7A 5H6RA 3QOPA 1OKRA 4IHTA 4M74A 4Q48A 1XGNA 1A04A 2ESHA 1U3EM 2P6TA 1YYVA 2O3FA 2CQKA 1UFMA 1U6GA 2XIGA 1JHHA 2DK8A 2L54A 1USSA 4LLNA 5BPIA 4MEYF 2Z9OA 1YS6A 1R22A 3TQNA 3RTRA 2QBYB 3ZMDA 3C18A 4PZJA 2BGCA 2EA4A 1XSDA 4I2OA 3F72A 5TRDA 4EJTA 2MA3A 3RKXA 3R61A 4KT5C 5DD8A 1B59A 2Z99A 5ICGA 2K02A 1V3FA 4I7HA 4RAYA 2WV0A 2EB7A 4Q47A 5A2QZ 4F7ZA 1FLIA 5D8LB 2A3SA 1MDMA 2RGVA 2UXXA 3GEZA 3R0JA 1MD0A 1O3SA 2A6EF 5E1ZB 5DCMB 2E1NA 3WGGA 1WKMA 2ISZA 4BYYA 2VXZA 3COAC 4EM1A 3V7CA 3I4PA 3B73A 1FY7A 2KJBA 2FEZA 4EJUA 1XGOA 2VC1A 3WTVC 1I1SA 3K1NA 2F2EA 3FXRA 1I1GA 2CO5A 3I54A 4YFXF 4L9NA 5ERIA 4UHTA 3VEPA 2QLZA 3IRQA 3TO6A 1BM9A 1FBSA 4PGHA 4KN7X 3HSFA 4EJVA 2HQRA 3TO7A 2OBPA 2LDUA 5HOOA 3QAHA 4A5MA 1TQMA 3R60A 3HOSA 1TW3A 2ZMEA 4CHUA 3GVAA 1BBYA 1FOKA 1T6SA 1XGMA 3TKYA 2GA1A 2FBHA 2FA5A 1BI1A 1V4RA 3D0SA 4OMYA 1W7PA 1ZG1A 3IWZA 5BPDA 2QUFA 1SAXA 3L09A 2LKPA 3EUHA 2QQBA 2R7DA 4HQEA 2QM3A 3NQOA 4ON0A 5LLQA 4YFKF 3KEQA 4ZZDA 1S6LA 4HDUA 4TV7A 1Z6TA 2XAHA 4OIQF 2PQ8A 2IA1A 1NHAA 2DO7A 3HHHA 5DUKA 2VOPA 3WODF 3JTHA 5HS7A 1IXCA 1U5TA 3TDZC 1FYKA 2LSOA 3HUGA 4HA8A 1O3QA 1H9TA 1UCRA 1SD4A 1RUOA 1B4AA 2YX7A 3E3VA 1ZAOA 1R1VA 4Z2YA 3IC7A 2RKHA 2IA0A 3BWGA 4Q5SF 2STTA 1XCVA 3LAPA 3QU3A 1PDNC 3CUQB 2CFXA 3K0LA 5CJ9A 1LNWA 3DPLC 3DFGA 1QPMA 3ML6A 1P92A 1XMAA 3K69A 4FX4A 3I0TA 1KU7A 2GA2A 1BJAA 2ZBKA 2Z33A 2GZWA 2X4HA 2IVMA 1T0FA 3K1MA 4M73A 3GO5A 3V7RA 1YLFA 2PMHA 1FX7A 1FP2A 2UZKA 1DUXC 2KJCA 3T8TA 4IRIA 4FX0A 5E1XA 4M9ZA 1RIOH 2LNBA 5EEHA 5LGTA 4MHGA 2RVCA 3LA3A 3F3XA 2ZKZA 4WK8F 1XD7A 5LBQA 3WU0A 1FWZA 1K78A 3K9TA 5LEKA 2DK5A 1OR7A 1S7AA 5F6FA 4LG0A 1ULYA 3FM5A 4R8HA 3E5UA 4L5IA 1Z6RA 3IWFA 1AWCA 3I71A 4A0YA 2ISYA 3CO6C 4GO1A 3F23A 5FLXK 2RDPA 1G3YA 3HIFA 2RQPA 2HS5A 5L3DA 1RZ4A 1QNTA 4I0BA 4Y17A 2BBYA 3L9FA 5DYMA 1P4XA 3R4KA 1ON2A 2M87A 5LHGA 1W5SA 5H6QA 1BI0A 1FSEA 1I27A 3WG9A 1PUEE 5LHHA 4LB5A 4HYEA 3U2RA 1BC7C 1D3YA 2D1HA 2HKOA 5KVRA 4O5VA 4KMFA 4BHBA 2W85A 2F5CA 4LJZF 1G6NA 4KUMA 3I64A 2P5KA 5FFZA 3ZMUA 2VE8A 2QYOA 3BZ6A 5LGNA 3PQKA 2GWRA 4RGSA 4YFNF 4EM0B 1B1BA 4EJWA 3GW2A 4H0EA 4YG2F 4CDGA 5BS6A 1W7PD 1T39A 1I6XA 1HW5A 4FT8A 1HBXG 2OA4A 2COMA 3KLNA 3P9CA 1IN6A 1QBJA 1FPQA 5HS9A 2F5FA 2MH9A 5DCFA 3L00A 1LDKB 3WTUC 3OOPA 3WTXC 3GXOA 2FU4A 4M72A 4BHPA 4IHSA 5K1YA 2W84A 4KFCA 2MD5A 3H3UA 2ESNA 5L3CA 2V1UA 1G4DA 4I0AA 4I09A 2HWVA 4HZFA 5K5RA 5DD4A 4NHJA 1ZLKA 1ZRCA 1J2XA 3KP4A 1SD7A 3BP8A 1MDMB 4G7ZF 3HRMA 2HKXA 4G7OF 4RGXA 3KZZA 5D4RA 4UV9A 2L02A 1D8KA 3GX4X 3ROUA 4N9IA 1Z91A 4G8XA 4ENJA 1BC8C 4BXUA 5CLSA 1T98A 4UNOA 1S7OA 3BDDA 5ICCA 2CGPA 3FMSA 5BQTA 1J0RA 1YQAA 1OYYA 3RKWA 3ZMZA 6PAXA 1R00A 4G94A 2FRHA 5D4SA 2GAUA 3HRUA 1R1TA 2G7UA 2PBIA 3QU6A 3WTWC 2ZMEB 5L3GA 3T8RA 2JTVA 2O0YA 2OD5A 3F8BA 3GUDA 4HAMA 2QQ9A 2B0LA 1QQIA 5FGMA 2YPRA 3KCCA 1W7PB 2FMYA 4A6EA 4ETSA 2JT1A 1IAWA 4HF0A 3IL2A 5ICEA 1QZYA 4WX9A 3GF2A 3TOBA 2DAOA 4HV6A 4Q4ZF 2XUBA 1TNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEU A;  1H9G A;  2EV5 A;  4U0V A;  1YFH A;  1RI7 A;  3WE3 A;  1KQ0 A;  2GIV A;  1U5T B;  3REO A;  5DUI A;  4IRG A;  4FHT A;  1ZG3 A;  4ENK A;  2OU2 A;  3GFM A;  3TOA A;  3BJA A;  4CYD A;  4HF2 A;  4OMZ A;  2M45 A;  1D8J A;  1LQ1 A;  4LLG F;  1FYM A;  4AD9 A;  5F1R A;  2HOE A;  1XCB A;  3CTA A;  2STW A;  4RB0 A;  2EV0 A;  2L3D A;  5FLX Z;  5K5Q A;  5CVI A;  3IRR A;  3DKW A;  1GHC A;  2VC0 A;  2FQ3 A;  3CJN A;  1KU2 A;  1FSH A;  1R23 A;  1BIA A;  3U1D A;  1J7K A;  3QRF F;  3T0Y A;  3DPT A;  3WGI A;  2BYV E;  3W6J B;  2A5Y B;  2DU9 A;  2A6H F;  2IRF G;  3ABU A;  4KDP A;  2PMU A;  4BQA A;  1HKS A;  1WWX A;  2HGC A;  3CO7 C;  3I5U A;  1XSX A;  1ZAR A;  3T1B A;  3IHU A;  4PCQ A;  4Y15 A;  1P2F A;  3JAM K;  2HDC A;  3MCZ A;  3HRT A;  1W4M A;  4LG0 B;  3P9K A;  1DPR A;  1LEB A;  3O3K A;  1P6R A;  1JHF A;  3GFL A;  5HS8 A;  3I53 A;  2Y0M A;  2YX4 A;  2HR3 A;  1F5T A;  5AIP A;  3GFI A;  1C0W A;  1J75 A;  5D8K B;  5LRR A;  1ZRD A;  2OZU A;  4HX7 A;  1ZRE A;  2V1D A;  2V79 A;  2XVC A;  4MGR A;  4GGG A;  3PQJ A;  1SFE A;  5DDG A;  1HW1 A;  4U0W A;  1SMT A;  1IN5 A;  2VBX A;  4UVB A;  4EV0 A;  5FO5 A;  1HSJ A;  5CYV A;  3HTS B;  3EDP A;  1JGS A;  1I5Z A;  5E18 F;  1UST A;  2E1C A;  3JSP A;  2CSO A;  4NQW A;  4JBA A;  2C6Y A;  3KP2 A;  4LFU A;  2KIU A;  2MLK A;  2PFB A;  2CW0 F;  1O3T A;  4ESJ A;  1GVJ A;  1HST A;  1XDS A;  1KA8 A;  2P7C B;  1HQC A;  5LGU A;  3WTS C;  3W6K B;  3MEX A;  4I98 B;  1R5H A;  4GXO A;  4G7H F;  2R7F A;  1IXS B;  5FFX A;  1JXS A;  1TNS A;  3WTT C;  3ULQ B;  1FYL A;  2RC4 A;  5D6E A;  2FF4 A;  3IKT A;  4OOI A;  5LEJ A;  3FXQ A;  2DPD A;  3LFK A;  2DQR A;  2IPQ X;  1QGP A;  5L3E A;  3J7A O;  1XMK A;  1TQI A;  4M6Y A;  2ADU A;  3V8L A;  2MBF A;  4MQV A;  4JQF A;  5DCM A;  1IRG A;  2L4A A;  4E70 A;  3TO9 A;  4A12 A;  1CGP A;  1YTY A;  3QPT A;  3FM3 A;  5ILU A;  4HX4 A;  5L3B A;  1G3S A;  1RUN A;  5ILV A;  2H6B A;  2BE5 F;  4R79 A;  2IA2 A;  2K27 A;  1FNN A;  1J59 A;  1UB9 A;  2NNN A;  2PN6 A;  4HW0 A;  4A0X A;  2QQA A;  1KQ8 A;  4AIH A;  2P5V A;  1VTN C;  1YW9 A;  3E5X A;  1K6O A;  1ZLJ A;  1XSV A;  4RB3 C;  3OV8 A;  4BNC A;  3FF5 A;  3DXJ F;  3V8J A;  5D5V B;  2LF8 A;  3RKY A;  2XGX A;  1HW2 A;  4UV8 A;  1TBX A;  1ZHF A;  1CF7 A;  2K7L A;  2ZCW A;  3GWZ A;  2J5O A;  5JI6 A;  3GFJ A;  2P6S A;  3KLO A;  2XV4 S;  2HTS A;  2VBZ A;  3FMQ A;  5J6X A;  2FE3 A;  3KP6 A;  3B02 A;  4ESF A;  1TW2 A;  4UVC A;  5HLH A;  4P55 A;  5DEQ A;  4MQ9 F;  5HDK A;  1KYW A;  2F5E A;  3LA7 A;  3J80 K;  2DI3 A;  1L3L A;  4HDV A;  1J9I A;  4ZYD A;  3BJ6 A;  2O8X A;  2ZNZ A;  4HX8 A;  1HXD A;  1KU3 A;  3M7G A;  1T38 A;  2LF7 A;  2ELH A;  3BY6 A;  2Q2E A;  4LK0 F;  1YO5 C;  4PGG A;  2XRO A;  3LA2 A;  2EFO A;  1BIB A;  5AIQ A;  4RAZ A;  3E6B A;  1S3J A;  4N9H A;  1QZZ A;  3FHZ A;  3F8C A;  3ISP A;  3F6O A;  2IT0 A;  4I01 A;  3FWE A;  2MC3 A;  1ODD A;  3ZQ7 A;  2EFW A;  1ZGA A;  2PEX A;  4M6X A;  4S05 A;  3JAM Z;  4L5J A;  3V4G A;  5IT9 K;  1OPC A;  3M9A A;  5J8C A;  3SZP A;  2NYX A;  3ABT A;  4A5N A;  1G3T A;  1KQ9 A;  4RB2 C;  2NAZ A;  3H3Z A;  2ZXJ A;  1IF1 A;  2PLY A;  2J5P A;  1UHW A;  3RYP A;  4P5O A;  4GCV A;  4EGY A;  2HFH A;  3MWM A;  3I59 A;  3V7S A;  2V1X A;  4QLC U;  2EJR A;  4DQ2 A;  1Y0U A;  3C3W A;  3O2P E;  3V8K A;  4BAY A;  2NNY A;  3CUQ C;  1F1Z A;  4IXA A;  2XAG A;  1XGS A;  3K2Z A;  2MLG A;  4L9J A;  3I58 A;  4ZZL A;  3KFW X;  3CDH A;  3F6V A;  1TQP A;  1E2X A;  5FD6 A;  1O3R A;  3G3Z A;  4PDK A;  3NEU A;  3VOD A;  4JK1 X;  1STZ A;  4EJO A;  1Z9C A;  2H09 A;  1REP C;  1KU9 A;  5E8G A;  4GYG A;  3J81 K;  3KET A;  2EWN A;  4ESB A;  3BRO A;  1O7L A;  1S8N A;  2OQR A;  3JW4 A;  2Y48 A;  1XN7 A;  1MKM A;  2DT5 A;  2Z3Y A;  2Q0O A;  2OQG A;  2NRA C;  2FML A;  2D45 A;  2O03 A;  4XSZ F;  5CVV A;  1QO0 D;  1IN4 A;  3ERE D;  1YS7 A;  3HHG A;  2OZ6 A;  2ETH A;  4XLP F;  4CZZ A;  4RGR A;  1LDJ A;  2DLL A;  5F64 A;  5LRS A;  1B6A A;  2KKO A;  5CVJ A;  2JSC A;  4GYI A;  2A69 F;  1Z7U A;  2XKO A;  3EET A;  3DQV C;  1KGS A;  3AAF A;  2H94 A;  2M5W A;  2QEN A;  1MJ9 A;  5E1W A;  3F22 A;  3E6C C;  2HQN A;  3E97 A;  1B9M A;  4LMY A;  5JFR A;  2KRF A;  4MTD A;  2D1V A;  2O61 A;  1LDD A;  2E7X A;  2RV8 A;  3IKV A;  1WI9 A;  3MZH A;  4XRF A;  4ASN A;  3RPU A;  5HDG A;  4WXD A;  4U88 A;  4L18 B;  2YU3 A;  3Q9S A;  4B09 A;  2GXB A;  2KIM A;  4L9T A;  4HLY A;  1R7J A;  4N0B A;  4K2E A;  2CG4 A;  1WQ2 A;  4RGU A;  3FXU A;  3TDU C;  3R6S A;  3ECO A;  3FX3 A;  4EM2 A;  3LAJ A;  4M71 A;  1PP8 F;  3N97 A;  1BI2 A;  2R3S A;  3P9I A;  1MJB A;  2K4J A;  2VT3 A;  3ECH A;  2Y75 A;  3O6B B;  3SHF A;  1UHM A;  1P4W A;  3ZMV A;  3ELK A;  4WXC A;  3J80 Z;  1F9N A;  3LQR A;  1JE8 A;  4HQM A;  1IZ1 A;  4AIK A;  2TDX A;  2A61 A;  2EFQ A;  2WTE A;  1X3U A;  2HEO A;  3EYI A;  2XAQ A;  2P7V B;  2FNP A;  5EEG A;  3MZY A;  1DPU A;  3HSR A;  3T5X A;  2XAS A;  2DTR A;  3HOT A;  3EQL F;  3E6M A;  5L3F A;  4RS8 A;  4YII A;  1K78 B;  4ZH4 F;  2EFN A;  3KZY A;  2PG4 A;  3D5L A;  2DW4 A;  5D5U B;  3ZP5 A;  1U2W A;  4KN4 X;  3RDI A;  2ZO4 A;  2DPU A;  2YSR A;  3DF8 A;  2FOK A;  1LJ9 A;  4EQQ A;  2O6G E;  2EA2 A;  1Z05 A;  2W24 A;  5IT9 Z;  4AWX B;  2HZT A;  3E5Q A;  3H92 A;  1GXP A;  2AS5 F;  4MEX F;  2YR2 A;  3NRV A;  3ZPL A;  1IN8 A;  4P96 A;  1CF7 B;  1LB2 A;  4P9F A;  2W57 A;  5JR3 A;  2CWE A;  3EYY A;  2XAJ A;  5IT3 A;  2JRT A;  1R58 A;  5HVQ C;  1U8R A;  1TTY A;  2VN2 A;  4AIJ A;  2W25 A;  3DV8 A;  5E20 A;  1FZP B;  2E7W A;  3KE2 A;  2FNA A;  2QVO A;  5H20 A;  2IP2 A;  3G73 A;  3JTG A;  4WXH A;  3L2C A;  3SZT A;  4L0Y B;  3F8N A;  4UVA A;  1LEA A;  3RPQ A;  1LVA A;  2D2W A;  1IUY A;  1K79 A;  4P9U A;  4HV5 A;  2X0L A;  4HF1 A;  3HYI A;  3F21 A;  2ZFW A;  2ZNY A;  3WTZ A;  3SQN A;  5E17 F;  1T2K A;  4D0P A;  5DV5 A;  2UXN A;  2QBY A;  2DQL A;  1S29 A;  4OIO F;  3M1E A;  1EH8 A;  3TGN A;  1XB4 A;  3J81 Z;  5BOX A;  4LLL A;  2VBY A;  2CYY A;  4DNC A;  1FBU A;  2A07 F;  2ACJ A;  4G9Y A;  5KK1 A;  4RB1 A;  2XKP A;  2L4M A;  3LWF A;  5JVT A;  1J5Y A;  1U5T C;  1F4K A;  2VOO A;  1DP7 P;  2G7H A;  5FB2 A;  4BH9 A;  3SXY A;  2JZY A;  2BV6 A;  1FT9 A;  2VBW A;  2FBI A;  4MNU A;  4I02 A;  1SD5 A;  3I59 B;  5ILS A;  4A0Z A;  3BPV A;  2RNJ A;  3U9G A;  2HYG D;  3MFK A;  4EMS A;  4HLX A;  3ZN0 A;  3KP7 A;  1SD6 A;  1SMY F;  3WE2 A;  3WTY C;  1D5V A;  3M8E A;  2PJP A;  5FD5 A;  3ZMS A;  3KEO A;  3ZMT A;  2F5D A;  4IPA A;  1GXQ A;  2XHK A;  3Q5F A;  4S04 A;  1Z1D A;  4CGZ A;  1YG2 A;  4HOB A;  5HLG A;  2XRN A;  1O7F A;  2OAZ A;  2WC2 A;  4LD5 A;  5HDN A;  2FXA A;  4XLN F;  4OU0 A;  4ZYG A;  2AXL A;  4IRH A;  1L0O C;  2K4B A;  3C1D A;  2A68 F;  3KP3 A;  2NS0 A;  4ENM A;  4U0Y A;  1XDU A;  4CIC A;  1KYZ A;  3E6D A;  4WF2 A;  1W5T A;  5AON A;  4CO8 A;  2EV6 A;  4L9V A;  3RYR A;  2VOD A;  5A2Q K;  1E17 A;  1B9N A;  4HBL A;  5HLI A;  2V6C A;  3FMR A;  5D5W B;  2DBB A;  1H0M A;  2FBK A;  1OYW A;  2ZJ2 A;  4AVP A;  1ZH5 A;  4UUV A;  3GZ6 A;  2VON A;  4KIB A;  1WRJ A;  5JHU A;  1YIO A;  3L7W A;  1SFX A;  5BMZ A;  3VFZ A;  4ENN A;  3PFI A;  3F8F A;  1OMI A;  3M8F A;  4O6J A;  1P4A A;  3P7N A;  5J8F A;  1ON1 A;  1YW8 A;  5LHI A;  2P4W A;  4Y13 A;  3GYH X;  4YIF A;  4OIN F;  4XSX F;  4G6Q A;  1IW7 F;  1IXR C;  4EGZ A;  3RI4 A;  4KMU X;  3WGH A;  2IJL A;  3FZV A;  4G6D A;  3HTU A;  4BHC A;  2Z5U A;  4WWC A;  4M9X A;  1FBQ A;  2JPC A;  2VT2 A;  3CUQ A;  3VOE A;  1MGT A;  3VB2 A;  1K7A A;  4O3M A;  4U7D A;  2KIF A;  1ZGJ A;  4U7B A;  3MAJ A;  3BOQ A;  1AOY A;  4ZYH A;  2L01 A;  4LB6 B;  4A6D A;  4MTE A;  2M30 A;  4CXF A;  3DP7 A;  2V9V A;  2HTJ A;  3RIR A;  1FC3 A;  4KNY A;  1FP1 D;  4KA4 A;  2H6C A;  1TLH B;  5ED4 A;  2P5L C;  4KIC A;  2Q8K A;  5ICF A;  2JPB A;  3WU1 B;  2GQQ A;  1G3W A;  4IVN A;  2QZ8 A;  2P8T A;  1R36 A;  1IRF A;  2MH2 A;  3C7J A;  3Q9V A;  3R0A A;  5E8I A;  1YW7 A;  2EFP A;  4B8X A;  3F8M A;  4LGW A;  1DDN A;  2XAF A;  2IW5 A;  4IJA A;  1U78 A;  2WWY A;  1SFU A;  3HSE A;  3RJP A;  1IN7 A;  3QP6 A;  1PP7 U;  4M9S A;  1ZYR F;  3N4M A;  5CVR A;  4IF4 A;  4A2U A;  4L0Z B;  2H27 A;  2M1B A;  1EV7 A;  1OYI A;  2UWM A;  3ZN1 A;  4OIP F;  2QWW A;  1MZB A;  1R1U A;  4EVI A;  4KIF A;  1HKT A;  3HRS A;  4KYW A;  1BOA A;  1EH6 A;  1MJA A;  3JSO A;  3S2W A;  3GZ5 A;  3BPX A;  3QP5 A;  2M8E A;  4UXN A;  3K1P A;  2GXG A;  3QPH A;  4ZYE A;  2G9W A;  2HYF A;  2VE9 A;  1O57 A;  4WCG A;  5D5X B;  1BI3 A;  1ZN2 A;  2FSW A;  4KIG A;  3CLO A;  3LQQ A;  2PI0 A;  4NB5 A;  2BEO A;  5K5O A;  3MQ0 A;  4OIR F;  2EK5 A;  3SFZ A;  1BN5 A;  1Q1H A;  3KP5 A;  1ZG5 A;  3LST A;  5TJJ A;  4XBF A;  1RNL A;  1ONV A;  2K86 A;  1ZRF A;  4QWQ A;  4R1H A;  5CVU A;  1R5G A;  5D6F A;  1WSU A;  3BJO A;  2DFI A;  3CUO A;  3GLX A;  4LK1 F;  1HKQ A;  2RN7 A;  1EH7 A;  5H6R A;  3QOP A;  1OKR A;  4IHT A;  4M74 A;  4Q48 A;  1XGN A;  1A04 A;  2ESH A;  1U3E M;  2P6T A;  1YYV A;  2O3F A;  2CQK A;  1UFM A;  1U6G A;  2XIG A;  1JHH A;  2DK8 A;  2L54 A;  1USS A;  4LLN A;  5BPI A;  4MEY F;  2Z9O A;  1YS6 A;  1R22 A;  3TQN A;  3RTR A;  2QBY B;  3ZMD A;  3C18 A;  4PZJ A;  2BGC A;  2EA4 A;  1XSD A;  4I2O A;  3F72 A;  5TRD A;  4EJT A;  2MA3 A;  3RKX A;  3R61 A;  4KT5 C;  5DD8 A;  1B59 A;  2Z99 A;  5ICG A;  2K02 A;  1V3F A;  4I7H A;  4RAY A;  2WV0 A;  2EB7 A;  4Q47 A;  5A2Q Z;  4F7Z A;  1FLI A;  5D8L B;  2A3S A;  1MDM A;  2RGV A;  2UXX A;  3GEZ A;  3R0J A;  1MD0 A;  1O3S A;  2A6E F;  5E1Z B;  5DCM B;  2E1N A;  3WGG A;  1WKM A;  2ISZ A;  4BYY A;  2VXZ A;  3COA C;  4EM1 A;  3V7C A;  3I4P A;  3B73 A;  1FY7 A;  2KJB A;  2FEZ A;  4EJU A;  1XGO A;  2VC1 A;  3WTV C;  1I1S A;  3K1N A;  2F2E A;  3FXR A;  1I1G A;  2CO5 A;  3I54 A;  4YFX F;  4L9N A;  5ERI A;  4UHT A;  3VEP A;  2QLZ A;  3IRQ A;  3TO6 A;  1BM9 A;  1FBS A;  4PGH A;  4KN7 X;  3HSF A;  4EJV A;  2HQR A;  3TO7 A;  2OBP A;  2LDU A;  5HOO A;  3QAH A;  4A5M A;  1TQM A;  3R60 A;  3HOS A;  1TW3 A;  2ZME A;  4CHU A;  3GVA A;  1BBY A;  1FOK A;  1T6S A;  1XGM A;  3TKY A;  2GA1 A;  2FBH A;  2FA5 A;  1BI1 A;  1V4R A;  3D0S A;  4OMY A;  1W7P A;  1ZG1 A;  3IWZ A;  5BPD A;  2QUF A;  1SAX A;  3L09 A;  2LKP A;  3EUH A;  2QQB A;  2R7D A;  4HQE A;  2QM3 A;  3NQO A;  4ON0 A;  5LLQ A;  4YFK F;  3KEQ A;  4ZZD A;  1S6L A;  4HDU A;  4TV7 A;  1Z6T A;  2XAH A;  4OIQ F;  2PQ8 A;  2IA1 A;  1NHA A;  2DO7 A;  3HHH A;  5DUK A;  2VOP A;  3WOD F;  3JTH A;  5HS7 A;  1IXC A;  1U5T A;  3TDZ C;  1FYK A;  2LSO A;  3HUG A;  4HA8 A;  1O3Q A;  1H9T A;  1UCR A;  1SD4 A;  1RUO A;  1B4A A;  2YX7 A;  3E3V A;  1ZAO A;  1R1V A;  4Z2Y A;  3IC7 A;  2RKH A;  2IA0 A;  3BWG A;  4Q5S F;  2STT A;  1XCV A;  3LAP A;  3QU3 A;  1PDN C;  3CUQ B;  2CFX A;  3K0L A;  5CJ9 A;  1LNW A;  3DPL C;  3DFG A;  1QPM A;  3ML6 A;  1P92 A;  1XMA A;  3K69 A;  4FX4 A;  3I0T A;  1KU7 A;  2GA2 A;  1BJA A;  2ZBK A;  2Z33 A;  2GZW A;  2X4H A;  2IVM A;  1T0F A;  3K1M A;  4M73 A;  3GO5 A;  3V7R A;  1YLF A;  2PMH A;  1FX7 A;  1FP2 A;  2UZK A;  1DUX C;  2KJC A;  3T8T A;  4IRI A;  4FX0 A;  5E1X A;  4M9Z A;  1RIO H;  2LNB A;  5EEH A;  5LGT A;  4MHG A;  2RVC A;  3LA3 A;  3F3X A;  2ZKZ A;  4WK8 F;  1XD7 A;  5LBQ A;  3WU0 A;  1FWZ A;  1K78 A;  3K9T A;  5LEK A;  2DK5 A;  1OR7 A;  1S7A A;  5F6F A;  4LG0 A;  1ULY A;  3FM5 A;  4R8H A;  3E5U A;  4L5I A;  1Z6R A;  3IWF A;  1AWC A;  3I71 A;  4A0Y A;  2ISY A;  3CO6 C;  4GO1 A;  3F23 A;  5FLX K;  2RDP A;  1G3Y A;  3HIF A;  2RQP A;  2HS5 A;  5L3D A;  1RZ4 A;  1QNT A;  4I0B A;  4Y17 A;  2BBY A;  3L9F A;  5DYM A;  1P4X A;  3R4K A;  1ON2 A;  2M87 A;  5LHG A;  1W5S A;  5H6Q A;  1BI0 A;  1FSE A;  1I27 A;  3WG9 A;  1PUE E;  5LHH A;  4LB5 A;  4HYE A;  3U2R A;  1BC7 C;  1D3Y A;  2D1H A;  2HKO A;  5KVR A;  4O5V A;  4KMF A;  4BHB A;  2W85 A;  2F5C A;  4LJZ F;  1G6N A;  4KUM A;  3I64 A;  2P5K A;  5FFZ A;  3ZMU A;  2VE8 A;  2QYO A;  3BZ6 A;  5LGN A;  3PQK A;  2GWR A;  4RGS A;  4YFN F;  4EM0 B;  1B1B A;  4EJW A;  3GW2 A;  4H0E A;  4YG2 F;  4CDG A;  5BS6 A;  1W7P D;  1T39 A;  1I6X A;  1HW5 A;  4FT8 A;  1HBX G;  2OA4 A;  2COM A;  3KLN A;  3P9C A;  1IN6 A;  1QBJ A;  1FPQ A;  5HS9 A;  2F5F A;  2MH9 A;  5DCF A;  3L00 A;  1LDK B;  3WTU C;  3OOP A;  3WTX C;  3GXO A;  2FU4 A;  4M72 A;  4BHP A;  4IHS A;  5K1Y A;  2W84 A;  4KFC A;  2MD5 A;  3H3U A;  2ESN A;  5L3C A;  2V1U A;  1G4D A;  4I0A A;  4I09 A;  2HWV A;  4HZF A;  5K5R A;  5DD4 A;  4NHJ A;  1ZLK A;  1ZRC A;  1J2X A;  3KP4 A;  1SD7 A;  3BP8 A;  1MDM B;  4G7Z F;  3HRM A;  2HKX A;  4G7O F;  4RGX A;  3KZZ A;  5D4R A;  4UV9 A;  2L02 A;  1D8K A;  3GX4 X;  3ROU A;  4N9I A;  1Z91 A;  4G8X A;  4ENJ A;  1BC8 C;  4BXU A;  5CLS A;  1T98 A;  4UNO A;  1S7O A;  3BDD A;  5ICC A;  2CGP A;  3FMS A;  5BQT A;  1J0R A;  1YQA A;  1OYY A;  3RKW A;  3ZMZ A;  6PAX A;  1R00 A;  4G94 A;  2FRH A;  5D4S A;  2GAU A;  3HRU A;  1R1T A;  2G7U A;  2PBI A;  3QU6 A;  3WTW C;  2ZME B;  5L3G A;  3T8R A;  2JTV A;  2O0Y A;  2OD5 A;  3F8B A;  3GUD A;  4HAM A;  2QQ9 A;  2B0L A;  1QQI A;  5FGM A;  2YPR A;  3KCC A;  1W7P B;  2FMY A;  4A6E A;  4ETS A;  2JT1 A;  1IAW A;  4HF0 A;  3IL2 A;  5ICE A;  1QZY A;  4WX9 A;  3GF2 A;  3TOB A;  2DAO A;  4HV6 A;  4Q4Z F;  2XUB A;  1TNT A; 
#chains in the Genus database with same CATH topology
 3DEU A;  1H9G A;  3WU2 C;  1V54 H;  2EV5 A;  3KZI C;  3K4B A;  2R0Q C;  4U0V A;  4XLF A;  1YFH A;  1RI7 A;  3WE3 A;  1IC8 A;  1GLN A;  4QIW N;  4UY8 I;  1KQ0 A;  2GIV A;  1U5T B;  3REO A;  2EZK A;  4M3F A;  1S5L C;  5DUI A;  4RBO A;  2X1C A;  4IRG A;  5IYD J;  3D1N I;  4HNV A;  3B6A A;  4FHT A;  2HPI A;  3CC4 I;  4PUS A;  1ZG3 A;  3GTJ J;  3K6G A;  3H35 A;  4ENK A;  3GTK J;  2OU2 A;  1W36 D;  2V9K A;  2ZC2 A;  3DKY A;  3GFM A;  1LE8 B;  3TOA A;  1YIJ I;  3BJA A;  4CYD A;  1W5C C;  3H0G J;  2JA2 A;  4HF2 A;  2XSJ C;  4OMZ A;  2M45 A;  1D8J A;  5JLX A;  2Y9Z A;  1LQ1 A;  4LLG F;  1FYM A;  4AD9 A;  4HNU A;  3HZJ A;  5F1R A;  4BAC A;  1ETY A;  3GTM J;  2HOE A;  4F55 A;  1XCB A;  3CTA A;  4E7H A;  1R9T J;  1Z67 A;  2STW A;  4RB0 A;  5FKK A;  2EV0 A;  2QCO A;  4GRI A;  2L3D A;  4QTR A;  5FLX Z;  5K5Q A;  5CVI A;  2E19 A;  3IRR A;  5H2F C;  5JLW A;  1A31 A;  2R7S A;  3DKW A;  1PYV A;  1GHC A;  3LSP A;  2VC0 A;  2FQ3 A;  2NOG A;  3CJN A;  1KU2 A;  2LRE A;  2MFZ A;  3S2D J;  4DBQ A;  3H1C A;  1TT0 A;  1FSH A;  1R23 A;  1RR7 A;  1BIA A;  4MFE A;  3DU5 A;  3U1D A;  4BJT A;  1J7K A;  3K7A J;  4BE1 A;  3QRF F;  2XPW A;  3WHC A;  3T0Y A;  3DPT A;  3J7Z I;  3WGI A;  2BYV E;  2KZV A;  3W6J B;  2DA7 A;  2XAU A;  1T08 B;  2VKE A;  2A5Y B;  2DU9 A;  1HF0 A;  2GLO A;  2A6H F;  2HXO A;  1IRZ A;  1MMA A;  2IRF G;  3ABU A;  3GTQ J;  3IAM 2;  3BR6 A;  3FK6 A;  4KDP A;  2TCT A;  1MH4 A;  3S8P A;  3VWB A;  3OL3 A;  4FAS D;  4A3E J;  2PMU A;  4BQA A;  2UV1 A;  1HKS A;  1WWX A;  2HGC A;  3RCO A;  4F91 B;  3CO7 C;  3QQA A;  3I5U A;  1MH3 A;  3OYH A;  1XSX A;  2E5N A;  3UKG A;  1ZAR A;  2WAQ A;  1F43 A;  3T1B A;  3IHU A;  4PCQ A;  3HG9 A;  5KAI C;  2M2E A;  4Y15 A;  1K61 A;  2LOO A;  4XNF A;  3DPU A;  5KNL A;  1MMD A;  1K83 J;  1P2F A;  2HDW A;  3FHN A;  5K7F A;  3CJT B;  5F0F A;  1XS9 A;  3JAM K;  3L2V A;  2Y0S A;  2HDC A;  3MCZ A;  3HRT A;  1W4M A;  3SYT A;  3LL7 A;  4LG0 B;  2CUE A;  2LLK A;  4JX6 A;  4JX5 A;  3H9G A;  3P9K A;  2EZL A;  4M6V A;  1DPR A;  3JRC A;  1LEB A;  3O3K A;  1P6R A;  1JHF A;  3OS0 A;  2IBD A;  3GFL A;  1TWG J;  5HS8 A;  3I53 A;  4I6Z A;  2Y0M A;  1IJW C;  2YX4 A;  2CU7 A;  4NC8 A;  2HR3 A;  2K9M A;  1F5T A;  3M3Y J;  1I3Q J;  5AIP A;  3GFI A;  1C0W A;  3DU6 A;  2WAE A;  2X6X A;  3FIW A;  3FIS A;  1J75 A;  5D8K B;  5F27 A;  5LRR A;  2VQC A;  1ZRD A;  2BW3 A;  5EG0 A;  2OZU A;  4HX7 A;  4XM3 A;  1ZRE A;  3W2V A;  2V1D A;  2V79 A;  2BHZ A;  2XVC A;  2JJ7 A;  4MGR A;  4GGG A;  3PQJ A;  1SFE A;  2DT6 A;  5DDG A;  1HW1 A;  4U0W A;  3VSL A;  2JA7 J;  2P0W A;  1SMT A;  1IN5 A;  2DA3 A;  2VBX A;  2FX0 A;  3P5J A;  4UVB A;  5FO5 A;  2BY2 A;  4EV0 A;  1HSJ A;  5CYV A;  3HTS B;  3EDP A;  1BJZ A;  4IX7 A;  5J1Y A;  1JGS A;  1J09 A;  1I5Z A;  5E18 F;  2JVH A;  3PL8 A;  1UST A;  4KIS A;  2E1C A;  1LFP A;  5M5Y J;  2DOA A;  4PJN A;  3OMY A;  2NVQ J;  3JSP A;  1AU7 A;  2CSO A;  4NQW A;  1Y1W J;  1MNM C;  1RES A;  3G1M A;  4JBA A;  5GPA A;  3TED A;  1JJ8 C;  2K9S A;  2C6Y A;  1Z3X A;  3KP2 A;  4LFU A;  1JUP A;  1T8I A;  4PFP A;  2YS9 A;  3Q3S A;  3AG3 H;  1FTZ A;  2KIU A;  2UUZ A;  5B3S H;  3IUO A;  2MLK A;  3GME A;  1WJB A;  2DJN A;  2PFB A;  3PUB A;  2CW0 F;  4XON A;  2LD5 A;  1O3T A;  1JGG A;  2HOT A;  4ESJ A;  1GVJ A;  1TWF J;  1HST A;  1XDS A;  5E3L A;  1KA8 A;  2V9P A;  3Q0U A;  1HQC A;  4CA0 A;  5LGU A;  3WTS C;  2P7C B;  3W6K B;  3MEX A;  1IDY A;  4I98 B;  4RLF A;  1R5H A;  2Y0S N;  4GXO A;  4G7H F;  1LKX A;  2R7F A;  4XKV A;  1IXS B;  1IRX A;  1EF4 A;  5FFX A;  1JXS A;  1TNS A;  1WJF A;  5JVG F;  3WTT C;  3ULQ B;  1FYL A;  2JA8 J;  2VJJ A;  5IP7 J;  2RC4 A;  5D6E A;  2DA6 A;  1Y8R B;  2FF4 A;  2E5Z A;  2CV0 A;  4OOI A;  5LEJ A;  3IKT A;  3FXQ A;  3C2G A;  2DPD A;  2VQL A;  3LFK A;  2DQR A;  2IPQ X;  1QGP A;  5L3E A;  3J7A O;  3OL4 A;  3MKZ A;  1XMK A;  3UR3 C;  3A01 A;  3S16 J;  1TQI A;  4FQG A;  1VFC A;  2OV7 A;  4M6Y A;  2ADU A;  3V8L A;  4A3B J;  2MBF A;  3K4M A;  4MQV A;  4JQF A;  4RMN A;  2QSH X;  4E7K A;  5DCM A;  3FKJ A;  1IRG A;  4CCJ A;  1I6H J;  4AID A;  1FOX A;  2HU9 A;  4DYC A;  3CZ6 A;  2B9S A;  2R93 J;  3DLL F;  2L4A A;  4E70 A;  3TO9 A;  3ZQL A;  2DOE A;  2MGQ A;  3K4C A;  2XDV A;  4A12 A;  2CRG A;  5J40 A;  1IV6 A;  1CGP A;  2DMT A;  4E7L A;  3CF5 F;  1YTY A;  2QF7 A;  3QPT A;  3TP0 A;  3OS1 A;  3FM3 A;  5ILU A;  4HX4 A;  5L3B A;  5EGO A;  3JRD A;  1G3S A;  3VPR A;  5IYB J;  4ZTJ A;  1RUN A;  1DQU A;  2OCE A;  3GTG J;  1G8X A;  3GTP J;  3GCM A;  5ILV A;  2H6B A;  2BE5 F;  4R79 A;  2DT7 B;  4RM2 A;  2IA2 A;  2K27 A;  1FNN A;  3CDL A;  5GTI C;  1J59 A;  2JSP A;  1UB9 A;  2NNN A;  1UZC A;  2PN6 A;  3BZC A;  4HW0 A;  1B8I A;  1F36 A;  4A0X A;  2QQA A;  2ZFU A;  5FLM J;  3DLA A;  1KQ8 A;  2PJR A;  3DTK A;  4N4O B;  4AIH A;  5DS9 A;  1E3P A;  3FXL A;  2P5V A;  3ONQ A;  1VTN C;  1YW9 A;  3FBN B;  4V2G A;  1MMS A;  3E5X A;  1K6O A;  4X0G A;  1ZLJ A;  3IAS 2;  1XSV A;  4RB3 C;  3BQY A;  4XN0 A;  3OV8 A;  3OYE A;  3PM1 A;  4BNC A;  3FF5 A;  3N05 A;  3DXJ F;  3V8J A;  5D5V B;  2L7M P;  2LF8 A;  3RKY A;  2XGX A;  3NAU A;  1HW2 A;  4UV8 A;  2RRE A;  3BTJ A;  1TBX A;  1ZHF A;  1CF7 A;  1PUF B;  2K7L A;  4FE4 A;  2ZCW A;  3GWZ A;  2J5O A;  5JI6 A;  3GFJ A;  1LUJ B;  2M4G A;  2P6S A;  3KLO A;  5F1J A;  2XV4 S;  3RKQ A;  1JT0 A;  2HTS A;  1JKR C;  1H89 C;  2VBZ A;  1N77 A;  2XB0 X;  3FMQ A;  5J6X A;  2ZB9 A;  2FE3 A;  3KP6 A;  2Y31 A;  3K70 C;  3H9J A;  1YRN A;  3B02 A;  4ESF A;  1TW2 A;  3JRG A;  4UVC A;  5HLH A;  2CJJ A;  5IPA A;  4P55 A;  5IOZ A;  5DEQ A;  4MQ9 F;  5HDK A;  1KYW A;  3ZQC A;  5GAD J;  2F5E A;  4S0H B;  3GLL A;  1K4T A;  3A03 A;  3LA7 A;  3BR2 A;  5FKL A;  3J80 K;  3DBL B;  2DI3 A;  1L3L A;  2WAD A;  4HDV A;  1J9I A;  2GOX B;  3HC7 A;  4LIV A;  4ZYD A;  3BJ6 A;  2YU9 J;  2O8X A;  2ZNZ A;  4HX8 A;  1HXD A;  1KU3 A;  3M7G A;  2ZXI A;  2V6E A;  1T38 A;  2LF7 A;  2ELH A;  3BY6 A;  5EZH A;  2LTP A;  2Q2E A;  2CQ7 A;  4LK0 F;  1YO5 C;  1BW6 A;  2OC6 A;  3WG7 H;  4PGG A;  3SDG A;  1X2M A;  2XRO A;  3LA2 A;  2EFO A;  1BIB A;  3AFH A;  4ANJ A;  1R71 A;  4BQO A;  5AIQ A;  4RAZ A;  3E6B A;  1HCR A;  5E3M A;  3JRH A;  1YX5 A;  1S3J A;  2F4I A;  4G12 A;  2LMD A;  3PIO F;  4N9H A;  1QZZ A;  3PNV A;  3FHZ A;  3F8C A;  3ISP A;  1GUU A;  5CQE A;  4A3G J;  1VF9 A;  3F6O A;  2IT0 A;  4I01 A;  1H8A C;  2VIX A;  3FWE A;  2IS6 A;  2MC3 A;  2HDD A;  1ODD A;  3ZQ7 A;  2EFW A;  2L7Z A;  1ZGA A;  3FK7 A;  1LPQ A;  2PEX A;  4M6X A;  4S05 A;  3JAM Z;  4L5J A;  1NK2 P;  2FQ4 A;  3V4G A;  5IT9 K;  3HBL A;  1UHS A;  4E7I A;  1OPC A;  3M9A A;  5J8C A;  2KHM A;  3SZP A;  3ESW B;  3PUF A;  2NYX A;  3ABT A;  4MO7 A;  2KRH A;  4A5N A;  2HQ5 A;  1X3W B;  5J4V A;  1G3T A;  3H5R A;  1SC7 A;  1KQ9 A;  1NG6 A;  3BCA A;  5HNF A;  2NAZ A;  3H3Z A;  4RB2 C;  1WPK A;  3LOC A;  2ZXJ A;  1IF1 A;  1OQY A;  2PLY A;  1U9N A;  2J5P A;  1UHW A;  1JI8 A;  2ECC A;  4XOR A;  3RYP A;  1X1D A;  2JUG A;  4P5O A;  4GCV A;  4EGY A;  2HFH A;  4HRI A;  1V5G A;  3FKI J;  2R7W A;  3S1R J;  2LG4 A;  2FD5 A;  2NXN B;  3BZK A;  1QA6 A;  3MWM A;  3I59 A;  2CQQ A;  3V7S A;  3HOV J;  2V1X A;  4QLC U;  2EJR A;  4IQ4 A;  4DQ2 A;  1Y0U A;  3GTL J;  4XOP A;  3C3W A;  2XRL A;  3O2P E;  3V8K A;  4BAY A;  2KDZ A;  3BG3 A;  4H4K C;  3CUQ C;  2NNY A;  4XMY A;  1F1Z A;  1XTA A;  3TBI A;  4IXA A;  2H8W A;  4IOC F;  1BOB A;  4NDL A;  1VND A;  3MKY B;  1Y0N A;  2ID3 A;  2OUM A;  2XAG A;  4BXF A;  1XGS A;  1SFK A;  4E4H A;  4D9J A;  1JTY A;  4RLQ A;  1VQ5 I;  3K2Z A;  4I76 A;  2MLG A;  4L9J A;  1IV8 A;  3I58 A;  1MBJ A;  4BXX J;  4ZZL A;  1GV5 A;  1FOW A;  3KFW X;  3OYD A;  3CDH A;  3UNG C;  2LY9 A;  3F6V A;  1TQP A;  1E2X A;  5FD6 A;  1MSF C;  1O3R A;  3G3Z A;  4PDK A;  4RAF A;  3NEU A;  1GVD A;  2VKD A;  3VOD A;  4JK1 X;  1STZ A;  2R7V A;  4EJO A;  3BTI A;  3W6V A;  1Z9C A;  2H09 A;  4ZTF A;  1REP C;  1KU9 A;  5E8G A;  3HKZ A;  4GYG A;  3J81 K;  2ZSI B;  3SZG A;  1MIJ A;  3KET A;  2K5C A;  3CCY A;  3CC7 I;  3QYE A;  1VQM I;  3VYR B;  1WZ2 A;  2EWN A;  3A2K A;  4ESB A;  3BRO A;  3KYC B;  3HM5 A;  1O7L A;  1S8N A;  2OQR A;  3JW4 A;  3CCM I;  5IP6 A;  1DGR M;  3CJQ B;  1B72 A;  2Y48 A;  1XN7 A;  1MKM A;  1RKT A;  1X3Z B;  2DT5 A;  2V7F A;  2Z3Y A;  2XF5 A;  2DMU A;  4DOZ A;  3OYK A;  2Q0O A;  2CUZ A;  2OQG A;  2FML A;  4UUT A;  4XKB A;  2D45 A;  2O03 A;  3ZXS A;  2NRA C;  3I9V 2;  4XSZ F;  5CVV A;  3JRB A;  3Q0V A;  1QO0 D;  1IN4 A;  2CW7 A;  3ERE D;  4EAT A;  4C30 A;  1YS7 A;  3M07 A;  3HHG A;  2OZ6 A;  2ETH A;  4XLP F;  3DKX A;  4CZZ A;  4RGR A;  1LDJ A;  2DLL A;  1TWH J;  4YEJ A;  1MNE A;  5J4Y A;  3AG4 H;  2MYS A;  5F64 A;  4B3A A;  2X85 A;  3CCR I;  5LRS A;  1B6A A;  2KKO A;  5CVJ A;  2JSC A;  1WCM J;  3MMY B;  3H3V K;  4GYI A;  2A69 F;  3BR1 A;  2JRM A;  1Z7U A;  2BW3 B;  2XKO A;  4BEH A;  1QHG A;  3EET A;  3DQV C;  1KGS A;  4F3Q A;  3QYF A;  3AAF A;  3HPH A;  1XMX A;  3AKZ A;  2R5Y A;  4IO9 F;  2H94 A;  2M5W A;  2DDB A;  3HOY J;  2QEN A;  1A35 A;  1MJ9 A;  5E1W A;  5IYC J;  3F22 A;  3E6C C;  2W1O A;  4X6A J;  2HQN A;  1D0Z A;  3G1L A;  2I8D A;  3CMA I;  3E97 A;  3K10 A;  3S14 J;  1B9M A;  4MIM A;  3I4N J;  3U1K A;  2KIS A;  2JA6 J;  5FKN A;  4LMY A;  3HUG B;  2DA1 A;  5JFR A;  5DM6 F;  2LVS A;  3H0D A;  2AO9 A;  2KRF A;  1X1C A;  4MTD A;  2R5Z A;  2V4J C;  1TWC J;  2VQG A;  1PVE A;  2D1V A;  4NQW B;  2O61 A;  1LDD A;  2E7X A;  2CS3 A;  2RV8 A;  1WJC A;  4Y4R A;  1OFC X;  3IKV A;  1WI9 A;  1VQO I;  1ACI A;  3MZH A;  4XRF A;  4ASN A;  3RPU A;  1WJD A;  2OTL I;  2R7O A;  5HDG A;  4WXD A;  4U88 A;  4L18 B;  2YU3 A;  5J47 A;  3M4O J;  5GAH J;  4CCO A;  3Q9S A;  3HKZ N;  5EYR A;  2KZG A;  2FOW A;  2XB5 A;  4B09 A;  5K7Z A;  1AKH B;  2GXB A;  2KIM A;  2ICW G;  1XX5 A;  1NTC A;  4L9T A;  4XR6 A;  1W1W E;  4HLY A;  1R7J A;  4N0B A;  2E2I J;  4K2E A;  2CG4 A;  1WQ2 A;  4BQQ A;  4DYR A;  4RGU A;  3FXU A;  3TDU C;  4PFO A;  5GAG J;  3R6S A;  3ECO A;  3FX3 A;  4EM2 A;  3LAJ A;  4PJ0 C;  4M71 A;  3QOD A;  4UB8 C;  3VYT B;  4XIC A;  3G71 I;  1PP8 F;  3N97 A;  1BI2 A;  4C9Y A;  2R3S A;  4CYC A;  3HJE A;  4DZP A;  3P9I A;  4A3L J;  4B44 A;  1MJB A;  2K4J A;  3A0B C;  4CUG A;  1XC5 A;  2KPM A;  2BOL A;  2VT3 A;  2Y75 A;  3ECH A;  3A01 B;  3ZGK A;  3O6B B;  2DMP A;  3SHF A;  2X6Y A;  4Y3O A;  1UHM A;  2JA5 J;  1P4W A;  3ZMV A;  3ELK A;  3CCU I;  2M9H A;  4WXC A;  3ASO H;  4XKW A;  2VAS A;  3KX2 A;  2Y69 H;  4NUB A;  3J80 Z;  1F9N A;  2E2H J;  3OYL A;  3S15 J;  3LQR A;  4ZDO A;  4A3J J;  1E3H A;  4HQM A;  1IZ1 A;  4AIK A;  1JE8 A;  3BTC A;  2NS8 A;  2TDX A;  1ZR2 A;  2IS2 A;  3CME I;  2X6W A;  2A61 A;  2EFQ A;  2WTE A;  1X3U A;  5HLT A;  3A4C A;  2MSY A;  2HEO A;  1VQK I;  3EYI A;  2XAQ A;  2P7V B;  3I55 I;  2LKS A;  2GXA A;  1MND A;  5EZG A;  2FNP A;  5EEG A;  3MZY A;  1DPU A;  3HSR A;  3T5X A;  3AL0 B;  2XAS A;  2DTR A;  1EA3 A;  3BQZ A;  1YIT I;  3HOT A;  3RZD J;  3EQL F;  3E6M A;  5EGO B;  2DDA A;  1SVL A;  5L3F A;  1U9O A;  1V5F A;  4RS8 A;  3LSJ A;  4YII A;  2Z2S B;  1K78 B;  4ZH4 F;  2L9N A;  4DZJ A;  1IUF A;  3OIQ A;  2EFN A;  3KZY A;  2JN6 A;  3LMM A;  3TP3 A;  2E1M C;  2PG4 A;  3D5L A;  3CP8 A;  2DW4 A;  5D5U B;  1B8I B;  4OWR B;  3ZP5 A;  4C3I J;  1RC9 A;  2R7X A;  1U2W A;  4KN4 X;  3RDI A;  4M3D A;  2ZO4 A;  2DPU A;  2YSR A;  3DF8 A;  1RRJ A;  2FOK A;  1LJ9 A;  5B1A H;  4EQQ A;  1Z3Y A;  2O6G E;  1SAU A;  3BG6 A;  2EA2 A;  1Z05 A;  2W24 A;  5IT9 Z;  3RQ4 A;  3JCU C;  4AWX B;  2HZT A;  3E5Q A;  3H92 A;  2QEX I;  4LG3 A;  1WJA A;  3A02 A;  2Z1D A;  1Z77 A;  1GXP A;  2Y9Y A;  2AS5 F;  4MEX F;  2YR2 A;  1YX3 A;  3NRV A;  3ASN H;  1IN8 A;  3BG7 A;  4P96 A;  2AHQ A;  3SFI A;  3FXK A;  1CF7 B;  3ZPL A;  1MBE A;  2GOM A;  3QWL A;  1LB2 A;  2ZXW H;  1R5I D;  4P9F A;  2E35 A;  1QVT A;  2W57 A;  5JR3 A;  2CWE A;  3BR3 A;  3IH2 A;  2HYJ A;  1WJE A;  3EYY A;  2XAJ A;  2A5W A;  4HPQ A;  5IT3 A;  1VQ7 I;  2JRT A;  1R58 A;  5HVQ C;  2Y2Z A;  4BKX A;  1U8R A;  2W4S A;  1GDT A;  1TTY A;  2ECB A;  2VN2 A;  4AIJ A;  2ME0 A;  2I10 A;  2W25 A;  3DV8 A;  5E20 A;  1MSE C;  1FZP B;  2E7W A;  2FJ1 A;  3KE2 A;  2FNA A;  2QVO A;  2MAB A;  3H5N A;  3CCL I;  3J7Y J;  4UB6 C;  5H20 A;  2IP2 A;  2EIN H;  3G73 A;  3JTG A;  4WXH A;  3L2C A;  3SZT A;  3PO3 J;  2OTJ I;  4L0Y B;  3F8N A;  3OYA A;  2W82 A;  4UVA A;  1QVU A;  1DU0 A;  2WB1 A;  1E0E A;  3CMY A;  1LEA A;  3RPQ A;  3W2W A;  5E3N A;  1LVA A;  1QHH D;  2D2W A;  1TP4 A;  1IUY A;  1K79 A;  2R7Z J;  4P9U A;  4HV5 A;  3CD6 I;  4B4C A;  2X0L A;  4HF1 A;  3HYI A;  3F21 A;  2ZFW A;  2XGC A;  2WAQ N;  2BY3 A;  2ZNY A;  3CJR B;  3WTZ A;  5TIS C;  5F0H A;  3SQN A;  5E17 F;  2CQN A;  4D0P A;  1T2K A;  1TL8 A;  4C3J J;  5DV5 A;  2NVT J;  2UXN A;  2IXS A;  2DOF A;  1Z7L A;  2QBY A;  2DQL A;  2JUC A;  5DTD A;  4DW6 A;  4XK4 A;  1S29 A;  4OIO F;  1POG A;  3M1E A;  2XGE A;  3PSI A;  1EH8 A;  3TGN A;  4A93 J;  2L7F P;  1XB4 A;  5J3L A;  4X1E A;  3J81 Z;  3CDI A;  1KON A;  2X48 A;  5BOX A;  4LLL A;  2VBY A;  4YRV A;  2CYY A;  4DNC A;  3S3O A;  1FBU A;  5C3E J;  2V26 A;  2A07 F;  2ACJ A;  2AQF A;  4V19 K;  4OAY A;  5IY5 H;  1X1P A;  4G9Y A;  4PSW A;  5KK1 A;  1NK3 P;  4RB1 A;  2XKP A;  5IOY A;  2GIZ A;  2L4M A;  3LWF A;  4NNJ A;  5JVT A;  1J5Y A;  1U5T C;  4GDF A;  3BC8 A;  2KQR A;  1F4K A;  1QRY A;  2IGM A;  2M7B A;  1RET A;  2MG4 A;  3ZQG A;  2VOO A;  4DYQ A;  2KMU A;  4XRS A;  1DP7 P;  2G7H A;  3PNY A;  3CCV I;  2OCC H;  5FB2 A;  4BDZ A;  4BH9 A;  1OCR H;  2DMN A;  1XPX A;  3ZQH A;  3SXY A;  2JZY A;  2ID6 A;  2IS1 A;  5GPC A;  4ABZ A;  3TMO A;  2BV6 A;  5FLV A;  2R92 J;  2VKV A;  1MW7 A;  1FT9 A;  1ETO A;  2VBW A;  2FBI A;  2ZSH B;  2X1D A;  4MNU A;  4I02 A;  1SD5 A;  1D1C A;  1WFX A;  2EZI A;  2A05 A;  3I59 B;  5ILS A;  2RNJ A;  3BPV A;  4A0Z A;  3U9G A;  2HYG D;  3MFK A;  2G0E A;  2WAF A;  4EMS A;  4HLX A;  3KEY A;  4RDU A;  3ZN0 A;  3KP7 A;  1SD6 A;  1SMY F;  3RPU D;  3WE2 A;  3WTY C;  1D5V A;  3M8E A;  2PJP A;  1V5E A;  2E2J J;  3OS2 A;  5FD5 A;  2BVM A;  1BR4 A;  3ZMS A;  4LIU A;  3KEO A;  2LRD A;  2LK2 A;  3ZMT A;  2F5D A;  4IPA A;  1GXQ A;  2WB1 N;  1RPW A;  2XHK A;  3K4L A;  3Q5F A;  4S04 A;  1Z1D A;  4CGZ A;  1YG2 A;  4J01 A;  3G4S I;  3I4M J;  3H36 A;  4HOB A;  3B6C A;  5HLG A;  2ME6 A;  2XRN A;  1O7F A;  4IHV A;  2OAZ A;  2WC2 A;  1ZQ3 P;  1ZKG A;  4LD5 A;  1U8B A;  3MKW B;  3HXL A;  5HDN A;  2FXA A;  4I99 C;  4XLN F;  4OU0 A;  4ZYG A;  2AXL A;  4ZDL A;  4IRH A;  1L0O C;  1T0F C;  2K4B A;  3C1D A;  3S32 A;  5M5X J;  4A3D J;  2A68 F;  2XF7 A;  3KP3 A;  2NS0 A;  2ZJR F;  4XQF A;  4ENM A;  4U0Y A;  1XDU A;  1A5J A;  2M7A A;  4F92 B;  2WV1 A;  2LFB A;  2R4G A;  2LKX A;  4IOA F;  1R6R A;  1UG2 A;  4CIC A;  1KYZ A;  3E6D A;  4WF2 A;  3ZOB A;  4BQN A;  1W5T A;  3S3N A;  5AON A;  3ABM H;  4CO8 A;  3W2A A;  1B72 B;  2A6T A;  1M1E B;  2EV6 A;  4L9V A;  3S1Q J;  2WBM A;  3FBI B;  1K4S A;  3RYR A;  2VOD A;  1X58 A;  5A2Q K;  1E17 A;  1I50 J;  4IEJ A;  3MN2 A;  3CQZ J;  1D5Y A;  1B9N A;  4HBL A;  5HLI A;  2V6C A;  3FMR A;  5D5W B;  4HST A;  2DBB A;  1H0M A;  2FBK A;  1CQT A;  1OYW A;  2ZJ2 A;  4AVP A;  1OIS A;  4UUS A;  1ZH5 A;  4PJM A;  2O5R A;  1H88 C;  2NVU B;  2R7R A;  5IP9 J;  3CC2 I;  4UUV A;  2DXI A;  2QQ8 A;  3GZ6 A;  2VON A;  3TL4 X;  4KIB A;  2PMZ A;  1WRJ A;  2HI3 A;  5JHU A;  1YIO A;  3L7W A;  2BZT A;  1SAN A;  1SFX A;  3NAR A;  5BMZ A;  3VFZ A;  2BY0 A;  4ENN A;  4D1Q A;  1OCO H;  3PFI A;  9ANT A;  3F8F A;  1OMI A;  3M8F A;  4O6J A;  1P4A A;  3CES A;  3OWT A;  3OIP A;  3P7N A;  5J8F A;  1ON1 A;  1YW8 A;  5LHI A;  2P4W A;  4AU7 A;  4Y13 A;  2R5Y B;  3GYH X;  2HNH A;  4YIF A;  4OIN F;  1YOV B;  3KYL A;  4XSX F;  2EIL H;  3CMM A;  3FDY A;  4G6Q A;  4XKC A;  3OYC A;  1IDZ A;  1IW7 F;  1IXR C;  4EGZ A;  1BL0 A;  3RI4 A;  1PJR A;  4KMU X;  3WGH A;  2IJL A;  2L9S A;  2X9D A;  2DA4 A;  4ZYA A;  3FZV A;  4G6D A;  4AVZ A;  1JKQ C;  3HTU A;  4BHC A;  3OOU A;  2KFD A;  1ZK8 A;  4V2F A;  1X2N A;  2Z5U A;  4RAG A;  1W36 C;  5TGT A;  4WWC A;  1DGW Y;  4M9X A;  5GTH C;  1FBQ A;  2JPC A;  2VT2 A;  2MC4 A;  2L2O A;  1I3A A;  4E7Z A;  3CUQ A;  2NOJ B;  3VOE A;  1MGT A;  3VB2 A;  2B7E A;  1K7A A;  1Y6I A;  2KL4 A;  4M3E A;  4U7D A;  4O3M A;  2KIF A;  1ZGJ A;  4U7B A;  3QPS A;  3MAJ A;  3BOQ A;  3K4N A;  4M3B A;  1AOY A;  4ZYH A;  5CQG A;  3JRI A;  2L01 A;  4LB6 B;  2XF6 A;  1O4X A;  4A6D A;  4MTE A;  3V42 A;  2D5V A;  2M30 A;  4CXF A;  3CLQ A;  3DP7 A;  2ZJP F;  2V9V A;  3LNQ A;  2HTJ A;  3RIR A;  1NG7 A;  1FC3 A;  4KNY A;  2R7T A;  1FP1 D;  1WVR A;  3F9K A;  4KA4 A;  4IHW A;  5F0C A;  2H6C A;  1TLH B;  2WY8 Q;  5ED4 A;  2P5L C;  2LH9 A;  4KIC A;  2M3A A;  1T56 A;  1WGX A;  2Q8K A;  4IHX A;  5ICF A;  2JPB A;  3IH4 A;  2HPM A;  4FET A;  2GQQ A;  1G3W A;  4IVN A;  3WU1 B;  2DCE A;  2QZ8 A;  2P8T A;  1R36 A;  1IRF A;  3C7J A;  2MH2 A;  3Q9V A;  3R0A A;  4PJL A;  5E8I A;  4CCL A;  1YW7 A;  2EFP A;  4B3X A;  4B43 A;  4B8X A;  2K9N A;  3F8M A;  4LGW A;  1DDN A;  2VQH A;  2XAF A;  4QSH A;  3D5S C;  4CYC B;  2IW5 A;  4ZJZ A;  4IJA A;  4Y33 A;  1YHQ I;  1U78 A;  4CCM A;  2P81 A;  2WWY A;  1SVM A;  3HSE A;  1SFU A;  3RJP A;  1IN7 A;  3QP6 A;  1PP7 U;  1V55 H;  1ZTR A;  4M9S A;  1ZYR F;  3QPL A;  3N4M A;  5CVR A;  5LD2 C;  2PMZ N;  1OJL A;  4IF4 A;  4A2U A;  5B5E C;  4L0Z B;  2H27 A;  3TW7 A;  2M1B A;  1EV7 A;  1Z0X A;  1ENH A;  1OYI A;  3D5R C;  2UWM A;  3ZN1 A;  4OIP F;  2QWW A;  1MZB A;  2R7U A;  5GAE J;  1R1U A;  1Y8Q B;  4EVI A;  4KIF A;  4XLH A;  3QOE A;  1HKT A;  4XRS G;  3HRS A;  4E7S A;  4KYW A;  1BOA A;  3FXJ A;  1EH6 A;  1MJA A;  3JSO A;  3S2W A;  3GZ5 A;  3BPX A;  2COB A;  3ZRG A;  1G2H A;  1SVO A;  5EJC A;  3QP5 A;  3EPZ A;  4ITV A;  3LSR A;  1LFU P;  2DFH A;  2M8E A;  1JUS A;  4UXN A;  3K1P A;  4NBQ A;  2GXG A;  4CSW A;  3QPH A;  3K4K A;  2G9W A;  4ZYE A;  1VQ6 I;  4KJZ A;  2HYF A;  3OR1 C;  4M3G A;  4EEF G;  2VE9 A;  1O57 A;  4WCG A;  1ETK A;  3OY9 A;  5D5X B;  1BI3 A;  1LFB A;  1HLV A;  3HOU J;  1ZN2 A;  2HVR A;  2FSW A;  2VJ4 A;  4W97 A;  1N25 A;  4KIG A;  5HOD A;  3CLO A;  3LQQ A;  2PI0 A;  4NB5 A;  2BEO A;  5K5O A;  3MQ0 A;  5FRN A;  4OIR F;  2EK5 A;  1FIP A;  3SFZ A;  2EBI A;  1BN5 A;  1Q1H A;  3KP5 A;  1ZG5 A;  3LST A;  1ETW A;  2CMP A;  5TJJ A;  5J1U A;  4XBF A;  2DTZ A;  1RNL A;  1ONV A;  1UEL B;  2K86 A;  1ZRF A;  3S17 J;  2K85 A;  1SFO J;  5EF6 A;  2K3P A;  3I3L A;  1A6Q A;  4QWQ A;  1MBK A;  5EG0 B;  4R1H A;  3K70 D;  5CVU A;  1R5G A;  3IV5 A;  3LSG A;  5D6F A;  5F04 A;  3AG2 H;  3BJO A;  5DM7 F;  1WSU A;  3IP4 B;  2DFI A;  3ABL H;  3CUO A;  3GLX A;  4AM3 A;  2EIK H;  3W3C A;  3DWL E;  4LK1 F;  1HKQ A;  2DOD A;  1WI3 A;  3PSF A;  4Y52 J;  2RN7 A;  3A1Y A;  1EH7 A;  3CCE I;  4XN3 A;  5H6R A;  2L5Q A;  3QOP A;  1OKR A;  4IHT A;  3X2Q H;  1VQN I;  1JT6 A;  4M74 A;  4Q48 A;  1XGN A;  4AC0 A;  1A04 A;  2ESH A;  1U3E M;  2KP6 A;  3Q0W A;  2P6T A;  1YYV A;  2O3F A;  2CQK A;  2QKM B;  1UFM A;  1U6G A;  2XIG A;  5KCM A;  2OPT A;  1JHH A;  2HOA A;  2O9L A;  5M3M J;  2RAE A;  4YEL A;  2IGO A;  2PX9 A;  2DK8 A;  1D0Y A;  4BU2 A;  2L54 A;  3ZQF A;  1USS A;  4LLN A;  3KYD B;  2K9L A;  1N75 A;  1GT0 C;  4DGW B;  3L2U A;  3U21 A;  5BPI A;  2BXZ A;  4MEY F;  2Z9O A;  1YS6 A;  1R22 A;  3TQN A;  3RTR A;  4E7J A;  2QBY B;  3ZMD A;  3C18 A;  3H5A A;  4PZJ A;  2VJI A;  2BGC A;  2EA4 A;  3OYB A;  1QU3 A;  3DTE A;  1XSD A;  3HGG A;  2XSD C;  4I2O A;  3F72 A;  5TRD A;  3RZO J;  4EJT A;  4U87 A;  1QPI A;  3OYG A;  1D1B A;  2MA3 A;  1NH3 A;  3S1N J;  3RKX A;  3JR9 A;  3R61 A;  2W7N A;  4KT5 C;  5DD8 A;  1APL C;  1B59 A;  2Z99 A;  5ICG A;  2DMQ A;  4B48 A;  2K02 A;  4P1W A;  2F4O B;  1V3F A;  2HQA A;  4I7H A;  4RAY A;  1IG7 A;  2WY7 Q;  2WV0 A;  2EB7 A;  4HSR A;  1EKE A;  2AXT C;  3L2Q A;  4Q47 A;  2CV1 A;  4B47 A;  5A2Q Z;  4C2T A;  4F52 A;  2CW8 A;  4QPO A;  3M8J A;  1I39 A;  4F7Z A;  3VYS B;  1FLI A;  5D8L B;  2A3S A;  1MDM A;  1X1B A;  2RGV A;  1GV2 A;  3BLY A;  2B63 J;  3OYM A;  3WHB A;  2UXX A;  3GEZ A;  3R0J A;  2R7Q A;  2E34 A;  1MD0 A;  2DA2 A;  4ZC3 A;  1O3S A;  2A6E F;  2F48 A;  2M0M A;  5E1Z B;  3ABK H;  5KHD A;  5DCM B;  2DN0 A;  1A6I A;  2E1N A;  4JX4 A;  3HOW J;  2NS7 A;  3WGG A;  1WKM A;  2ISZ A;  2JK3 A;  4BYY A;  2VXZ A;  4A3I J;  4CCN A;  4BGD A;  2ELK A;  3COA C;  4FE7 A;  3JRA A;  4EM1 A;  3V7C A;  2E60 A;  3I4P A;  2H1L A;  2E36 A;  3B73 A;  2IGK A;  3JRF A;  1FY7 A;  2EPF A;  2RNG A;  2KJB A;  2FEZ A;  4EJU A;  1XGO A;  2VC1 A;  3WTV C;  1I1S A;  3ZQI A;  2IEK A;  1P7I A;  3K1N A;  2F2E A;  4D5C A;  4QPQ A;  3FXR A;  2HZD A;  1DP3 A;  1TT5 B;  3VDX A;  4G6T B;  1I1G A;  2CO5 A;  2XGD A;  2CH0 A;  2LBF A;  3I54 A;  5C4J J;  4YFX F;  1TZL A;  3DTI A;  4L9N A;  3S93 A;  5ERI A;  4UHT A;  5FRO A;  3VEP A;  2QLZ A;  3BR5 A;  2M34 A;  1S9H A;  4XOT A;  3IRQ A;  3AG1 H;  4XID A;  3TO6 A;  1BM9 A;  2HVS A;  2IS4 A;  2XPV A;  1FBS A;  2JVG A;  2GM4 A;  2PJR B;  4PGH A;  4KN7 X;  1MBG A;  2F5V A;  3HSF A;  2KIQ A;  4EJV A;  3DEW A;  2HQR A;  3TO7 A;  1WH5 A;  4RM3 A;  2OBP A;  2LDU A;  5HOO A;  5FKM A;  1YE9 A;  4XLC A;  1MMN A;  3QAH A;  1Y1V J;  4A5M A;  1TQM A;  4BY7 J;  3R60 A;  1FIA A;  4BBR J;  3PFY A;  3HOS A;  1JJ6 C;  3E1S A;  2XC7 A;  1TW3 A;  3RSN A;  2ZME A;  5B66 C;  2EIJ H;  4CHU A;  3GVA A;  1BBY A;  1A36 A;  1FOK A;  2Z16 A;  1ITY A;  4B1R A;  1T6S A;  4A3K J;  1XGM A;  4D7N A;  2LY2 A;  4C2U A;  3TKY A;  2EQR A;  2GA1 A;  2FBH A;  5CKT A;  3OSG A;  3C2H A;  3VYU B;  4PSX A;  2FA5 A;  1BI1 A;  1V4R A;  4IKF A;  4DBR A;  3D0S A;  2E1O A;  4OMY A;  1W7P A;  4JP0 A;  1FEX A;  1QZE A;  3PNT A;  4XLE A;  1ZG1 A;  3BT9 A;  3IWZ A;  5BPD A;  2QUF A;  1SAX A;  3PJR A;  4XL9 A;  3K2A A;  3L09 A;  3O8H A;  2LKP A;  3EUH A;  2QQB A;  2R7D A;  4HQE A;  1JKP C;  2QM3 A;  3NQO A;  1YRN B;  1LVK A;  2QA4 I;  4ON0 A;  2LYC A;  4W1U A;  5LLQ A;  2DYS H;  4YFK F;  3KEQ A;  3MD2 A;  4ZZD A;  3G6E I;  1S6L A;  1X4P A;  2W00 A;  4UUS B;  4HDU A;  1S72 I;  4A3M J;  3BTL A;  4JOM A;  4TV7 A;  2H1K A;  1Z6T A;  1FMW A;  4YIR X;  1XG1 A;  4AYB A;  5FRM A;  2XAH A;  2VB6 A;  4OIQ F;  2PQ8 A;  2IA1 A;  1OCZ H;  1NHA A;  2DO7 A;  5F08 A;  3HHH A;  2ZME C;  4LOC A;  5CPR B;  5DUK A;  3WOD F;  2L9R A;  4E6K G;  2Q2E B;  2VOP A;  3JTH A;  2BVL A;  5E79 C;  5HS7 A;  1IXC A;  1U5T A;  3NWT A;  4IHY A;  3JRE A;  1N78 A;  3L2W A;  3TDZ C;  2KDO A;  1FYK A;  2LSO A;  2VL8 A;  5E3O A;  1WJ5 A;  1VQ8 I;  3HUG A;  2OF7 A;  4HA8 A;  1O3Q A;  3E0J B;  3S2H J;  1TWA J;  1RR8 C;  3EUH C;  1H9T A;  1UCR A;  1FJL A;  2F6C A;  3MVP A;  2LR8 A;  1SD4 A;  1K6Y A;  4OAZ A;  1RUO A;  2F4M B;  1LE8 A;  1B4A A;  2O7O A;  2YX7 A;  3E3V A;  4RA2 A;  1KZH A;  1ZAO A;  2HVQ A;  2VKH A;  1R1V A;  2DA5 A;  2XPU A;  1ETV A;  1ZGW A;  1Q1V A;  3IC7 A;  2RKH A;  3HEF A;  4Z2Y A;  3HOZ J;  2IA0 A;  3BWG A;  2TRT A;  5BNG A;  4Q5S F;  2STT A;  3OYJ A;  1XCV A;  2DFF A;  2O8K A;  1ZEL A;  3F0C A;  3KIO A;  3LAP A;  2VPL A;  3QU3 A;  1PDN C;  3CUQ B;  2JQ7 A;  2CFX A;  3K0L A;  2ZJQ F;  5CJ9 A;  1AKH A;  2EH3 A;  1LNW A;  3DPL C;  4FTH A;  2Y30 A;  3DFG A;  1QPM A;  3ML6 A;  2CV2 A;  1P92 A;  1XMA A;  2W48 A;  3I56 I;  4IZZ A;  3K69 A;  4FX4 A;  2L9V A;  3I0T A;  1T95 A;  1UAA A;  1OLT A;  4A69 C;  5EEA A;  2VLA A;  1Z21 A;  1KU7 A;  2GA2 A;  1MBF A;  2X6O A;  2VUM J;  1BJA A;  2ZBK A;  2Z33 A;  1U0J A;  4BL0 B;  2GZW A;  2X4H A;  3PO2 J;  2IVM A;  1T0F A;  3K1M A;  4M73 A;  3GO5 A;  2CUJ A;  2BXY A;  3V7R A;  1ERD A;  2CUF A;  2QGU A;  1YLF A;  2PMH A;  1FX7 A;  1FP2 A;  2VI6 A;  2UZK A;  1DUX C;  3S1M J;  2KJC A;  3DBR B;  3A0H C;  4FX0 A;  5E1X A;  3T8T A;  3ZR8 X;  4HEA 2;  5EDN A;  4IRI A;  3GTO J;  4M9Z A;  1RIO H;  2LNB A;  2MD0 A;  4XRM A;  5EEH A;  4AYB N;  3CCS I;  5B1B H;  5LGT A;  3J7A Y;  4MHG A;  2RVC A;  3LA3 A;  4A3C J;  1OCP A;  1JTX A;  3L2R A;  4HNT A;  2VJ5 A;  3F3X A;  1BA5 A;  2M0C A;  5FKO A;  2ZKZ A;  4WK8 F;  2BY1 A;  3BR0 A;  3PIP F;  1XD7 A;  4NC7 A;  3HGY A;  4PJJ A;  2EIM H;  5LBQ A;  3WU0 A;  1G59 A;  1ORK A;  1OCC H;  1UG0 A;  2M4K A;  1FWZ A;  2LP0 A;  1K78 A;  3G2B A;  3K9T A;  5LEK A;  2DK5 A;  3FXM A;  1OR7 A;  1S7A A;  1YJN I;  5F6F A;  1JKO C;  4LG0 A;  3SDB A;  1ULY A;  4AUX A;  4MLO A;  4BBS J;  3FM5 A;  4R8H A;  1X1A A;  3HB9 A;  4FIS A;  2IGN A;  3E5U A;  4L5I A;  3SJM A;  4DJA A;  1Z6R A;  3IWF A;  1HOM A;  2WA0 A;  2YUS A;  1AWC A;  2LY1 A;  3I71 A;  2CQX A;  2ISY A;  4A0Y A;  3CO6 C;  4GO1 A;  3F23 A;  3OIO A;  3HL2 A;  3BG5 A;  5FLX K;  2RDP A;  1G3Y A;  3HIF A;  2RQP A;  2LC2 A;  2JWT A;  2NVY J;  3ZQQ A;  2HS5 A;  5L3D A;  1RZ4 A;  3AL0 C;  1QNT A;  5HNH A;  4I0B A;  4II3 A;  4Y17 A;  4BE0 A;  2BBY A;  3L9F A;  5DYM A;  1P4X A;  3R4K A;  1ON2 A;  2M87 A;  5LHG A;  2EZH A;  1IO2 A;  3C2B A;  1RKW A;  1W5S A;  2MW8 A;  5H6Q A;  1BI0 A;  3OYN A;  1OR7 C;  1FSE A;  4HG2 A;  3RQI A;  4L5E A;  4C3H J;  1BR2 A;  4BY1 J;  1I27 A;  1DU6 A;  3WG9 A;  1S7E A;  5LHH A;  1PUE E;  4HYE A;  4LB5 A;  1FTT A;  1P7J A;  3DBH B;  2DFE A;  4BEH B;  3U2R A;  3SEZ A;  1BC7 C;  1D3Y A;  2D1H A;  2ELJ A;  2HKO A;  4F93 B;  1BW5 A;  2Q1Z B;  5KVR A;  4O5V A;  1E3O C;  4KMF A;  5M5W J;  4BHB A;  2W85 A;  1VI0 A;  2F5C A;  2V1N A;  3DCF A;  4LJZ F;  1G6N A;  2FUG 2;  4KUM A;  1HDD C;  1ETX A;  3I64 A;  2P5K A;  5FFZ A;  1X19 A;  3LSK A;  4BS9 A;  3ZMU A;  3IH3 A;  2VE8 A;  2QYO A;  3BZ6 A;  3S3M A;  2E71 A;  5LGN A;  1W0T A;  1HC8 A;  3PQK A;  2GWR A;  4RGS A;  4YFN F;  1OCT C;  5LFA A;  1T33 A;  5KAF C;  1B1B A;  4EM0 B;  2R5Z B;  4EJW A;  5JHF A;  4DIQ A;  3GW2 A;  4Y7N J;  4H0E A;  2GBY A;  4YG2 F;  4N4N B;  4BJ6 C;  4LIT A;  2M8G X;  4CDG A;  1D1A A;  2IAI A;  5BS6 A;  1W7P D;  1T39 A;  1I6X A;  1HW5 A;  4FT8 A;  2KRC A;  3ZCO A;  1HBX G;  2OA4 A;  1R49 A;  2COM A;  2QKL B;  3KLN A;  1ETQ A;  3P9C A;  1HDP A;  1IN6 A;  1QBJ A;  3GZN B;  3HPG A;  1FPQ A;  5HS9 A;  2F5F A;  3FXO A;  1UMQ A;  2HXI A;  2MH9 A;  2HOS A;  5DCF A;  1Y39 A;  1VZ0 A;  3L00 A;  4FCY A;  1LDK B;  3WTU C;  1VQ9 I;  2ZXH A;  3OYF A;  3SEQ A;  3OOP A;  3WTX C;  3GXO A;  2KLO A;  3OYI A;  4BJ5 C;  2I5U A;  4BDY A;  2DYR H;  2RQQ A;  4KT6 A;  2FU4 A;  5C4X J;  4M72 A;  4BHP A;  4IHS A;  1TC3 C;  5GP9 A;  3LSH A;  2W84 A;  5K1Y A;  4KFC A;  1WH7 A;  2MD5 A;  3H3U A;  2ESN A;  4ZDP A;  5L3C A;  2OJE D;  1R4N B;  3VSK A;  2V1U A;  1G4D A;  4I0A A;  4I09 A;  2HWV A;  4HZF A;  5K5R A;  5DD4 A;  4NHJ A;  3OR2 C;  3LFU A;  1R4M B;  2N8G A;  3K4J A;  1ZLK A;  3H9Q A;  1UJ8 A;  1ZRC A;  1J2X A;  1BR1 A;  3KP4 A;  1YI2 I;  1SD7 A;  3O8G A;  3BP8 A;  3BG9 A;  1MDM B;  2E1M B;  5C44 J;  3OSF A;  2DJI A;  4G7Z F;  4D5F A;  1ZR4 A;  3HRM A;  1WHU A;  3CCJ I;  4PK4 A;  1W0U A;  2HKX A;  1FMV A;  3GBG A;  4G7O F;  4C2M J;  3EUA A;  4RGX A;  3KZZ A;  4XLA A;  4CCK A;  4UV9 A;  5D4R A;  2L02 A;  1Y56 A;  1D8K A;  1P9Q C;  2L0K A;  1VQP I;  3GX4 X;  4KIT B;  1JUM A;  2AQE A;  3ROU A;  4N9I A;  2K9Q A;  4GFB A;  3EUK L;  3MKL A;  1Z91 A;  3HOX J;  1AHD P;  4G8X A;  4ENJ A;  4BUP A;  4MFD A;  3CCQ I;  1BC8 C;  4BXU A;  3MZ8 A;  3QYB A;  3G1O A;  1AA7 A;  5CLS A;  1MBH A;  2X51 A;  1T98 A;  3CF2 A;  2QSG X;  3L1P A;  2QSF X;  4UNO A;  2LBF B;  1S7O A;  3DEE A;  2K3F A;  3BDD A;  4CZC A;  2JMW A;  5ICC A;  2CGP A;  4IL6 C;  2K40 A;  4II2 A;  2VXD A;  4CH7 A;  3FMS A;  5BQT A;  1J0R A;  1YQA A;  1OYY A;  3RKW A;  3ZMZ A;  6PAX A;  1R00 A;  4G94 A;  5FJ8 J;  2FRH A;  1YJW I;  3CP2 A;  1IGN A;  1VQL I;  5D4S A;  3ERM A;  3HDD A;  2GAU A;  3HRU A;  3LSI A;  1R1T A;  5J1R A;  3E7L A;  2G7U A;  4JYK A;  2L7K A;  2PBI A;  3KPH A;  4IQJ A;  3M1C A;  3BCB A;  2X1E A;  3NWS A;  3QU6 A;  1PUF A;  3WTW C;  2ZME B;  5L3G A;  3T8R A;  2JTV A;  1EJ9 A;  1VQ4 I;  2KT0 A;  2O0Y A;  2OD5 A;  3F8B A;  4J00 A;  1YJ9 I;  3TW6 A;  4NC6 A;  3GUD A;  4HAM A;  2QQ9 A;  2B0L A;  1QQI A;  2BHY A;  2YPR A;  5FGM A;  2NVX J;  4D7M A;  2H8R A;  3KCC A;  3LSM A;  1X4O A;  1D0X A;  1W7P B;  1FOY A;  2FMY A;  4A6E A;  4A3F J;  4ETS A;  2JT1 A;  1IAW A;  1MMG A;  4HF0 A;  3IL2 A;  5ICE A;  1QZY A;  5K7H A;  4WX9 A;  3GF2 A;  2VPR A;  3TOB A;  4J19 A;  1HA8 A;  2DAO A;  4HV6 A;  4Z6Y A;  4Q4Z F;  5M3F J;  2CFO A;  2XUB A;  1TNT A;  4BE2 A;  1SEU A; 
#chains in the Genus database with same CATH homology
 3DEU A;  1H9G A;  2EV5 A;  4U0V A;  1YFH A;  1RI7 A;  3WE3 A;  1KQ0 A;  2GIV A;  1U5T B;  3REO A;  5DUI A;  4IRG A;  4FHT A;  1ZG3 A;  4ENK A;  2OU2 A;  3GFM A;  3TOA A;  3BJA A;  4CYD A;  4HF2 A;  4OMZ A;  2M45 A;  1D8J A;  1LQ1 A;  4LLG F;  1FYM A;  4AD9 A;  5F1R A;  2HOE A;  1XCB A;  3CTA A;  2STW A;  4RB0 A;  2EV0 A;  2L3D A;  5FLX Z;  5K5Q A;  5CVI A;  3IRR A;  3DKW A;  1GHC A;  2VC0 A;  2FQ3 A;  3CJN A;  1KU2 A;  1FSH A;  1R23 A;  1BIA A;  3U1D A;  1J7K A;  3QRF F;  3T0Y A;  3DPT A;  3WGI A;  2BYV E;  3W6J B;  2A5Y B;  2DU9 A;  2A6H F;  2IRF G;  3ABU A;  4KDP A;  2PMU A;  4BQA A;  1HKS A;  1WWX A;  2HGC A;  3CO7 C;  3I5U A;  1XSX A;  1ZAR A;  3T1B A;  3IHU A;  4PCQ A;  4Y15 A;  1P2F A;  3JAM K;  2HDC A;  3MCZ A;  3HRT A;  1W4M A;  4LG0 B;  3P9K A;  1DPR A;  1LEB A;  3O3K A;  1P6R A;  1JHF A;  3GFL A;  5HS8 A;  3I53 A;  2Y0M A;  2YX4 A;  2HR3 A;  1F5T A;  5AIP A;  3GFI A;  1C0W A;  1J75 A;  5D8K B;  5LRR A;  1ZRD A;  2OZU A;  4HX7 A;  1ZRE A;  2V1D A;  2V79 A;  2XVC A;  4MGR A;  4GGG A;  3PQJ A;  1SFE A;  5DDG A;  1HW1 A;  4U0W A;  1SMT A;  1IN5 A;  2VBX A;  4UVB A;  4EV0 A;  5FO5 A;  1HSJ A;  5CYV A;  3HTS B;  3EDP A;  1JGS A;  1I5Z A;  5E18 F;  1UST A;  2E1C A;  3JSP A;  2CSO A;  4NQW A;  4JBA A;  2C6Y A;  3KP2 A;  4LFU A;  2KIU A;  2MLK A;  2PFB A;  2CW0 F;  1O3T A;  4ESJ A;  1GVJ A;  1HST A;  1XDS A;  1KA8 A;  2P7C B;  1HQC A;  5LGU A;  3WTS C;  3W6K B;  3MEX A;  4I98 B;  1R5H A;  4GXO A;  4G7H F;  2R7F A;  1IXS B;  5FFX A;  1JXS A;  1TNS A;  3WTT C;  3ULQ B;  1FYL A;  2RC4 A;  5D6E A;  2FF4 A;  3IKT A;  4OOI A;  5LEJ A;  3FXQ A;  2DPD A;  3LFK A;  2DQR A;  2IPQ X;  1QGP A;  5L3E A;  3J7A O;  1XMK A;  1TQI A;  4M6Y A;  2ADU A;  3V8L A;  2MBF A;  4MQV A;  4JQF A;  5DCM A;  1IRG A;  2L4A A;  4E70 A;  3TO9 A;  4A12 A;  1CGP A;  1YTY A;  3QPT A;  3FM3 A;  5ILU A;  4HX4 A;  5L3B A;  1G3S A;  1RUN A;  5ILV A;  2H6B A;  2BE5 F;  4R79 A;  2IA2 A;  2K27 A;  1FNN A;  1J59 A;  1UB9 A;  2NNN A;  2PN6 A;  4HW0 A;  4A0X A;  2QQA A;  1KQ8 A;  4AIH A;  2P5V A;  1VTN C;  1YW9 A;  3E5X A;  1K6O A;  1ZLJ A;  1XSV A;  4RB3 C;  3OV8 A;  4BNC A;  3FF5 A;  3DXJ F;  3V8J A;  5D5V B;  2LF8 A;  3RKY A;  2XGX A;  1HW2 A;  4UV8 A;  1TBX A;  1ZHF A;  1CF7 A;  2K7L A;  2ZCW A;  3GWZ A;  2J5O A;  5JI6 A;  3GFJ A;  2P6S A;  3KLO A;  2XV4 S;  2HTS A;  2VBZ A;  3FMQ A;  5J6X A;  2FE3 A;  3KP6 A;  3B02 A;  4ESF A;  1TW2 A;  4UVC A;  5HLH A;  4P55 A;  5DEQ A;  4MQ9 F;  5HDK A;  1KYW A;  2F5E A;  3LA7 A;  3J80 K;  2DI3 A;  1L3L A;  4HDV A;  1J9I A;  4ZYD A;  3BJ6 A;  2O8X A;  2ZNZ A;  4HX8 A;  1HXD A;  1KU3 A;  3M7G A;  1T38 A;  2LF7 A;  2ELH A;  3BY6 A;  2Q2E A;  4LK0 F;  1YO5 C;  4PGG A;  2XRO A;  3LA2 A;  2EFO A;  1BIB A;  5AIQ A;  4RAZ A;  3E6B A;  1S3J A;  4N9H A;  1QZZ A;  3FHZ A;  3F8C A;  3ISP A;  3F6O A;  2IT0 A;  4I01 A;  3FWE A;  2MC3 A;  1ODD A;  3ZQ7 A;  2EFW A;  1ZGA A;  2PEX A;  4M6X A;  4S05 A;  3JAM Z;  4L5J A;  3V4G A;  5IT9 K;  1OPC A;  3M9A A;  5J8C A;  3SZP A;  2NYX A;  3ABT A;  4A5N A;  1G3T A;  1KQ9 A;  4RB2 C;  2NAZ A;  3H3Z A;  2ZXJ A;  1IF1 A;  2PLY A;  2J5P A;  1UHW A;  3RYP A;  4P5O A;  4GCV A;  4EGY A;  2HFH A;  3MWM A;  3I59 A;  3V7S A;  2V1X A;  4QLC U;  2EJR A;  4DQ2 A;  1Y0U A;  3C3W A;  3O2P E;  3V8K A;  4BAY A;  2NNY A;  3CUQ C;  1F1Z A;  4IXA A;  2XAG A;  1XGS A;  3K2Z A;  2MLG A;  4L9J A;  3I58 A;  4ZZL A;  3KFW X;  3CDH A;  3F6V A;  1TQP A;  1E2X A;  5FD6 A;  1O3R A;  3G3Z A;  4PDK A;  3NEU A;  3VOD A;  4JK1 X;  1STZ A;  4EJO A;  1Z9C A;  2H09 A;  1REP C;  1KU9 A;  5E8G A;  4GYG A;  3J81 K;  3KET A;  2EWN A;  4ESB A;  3BRO A;  1O7L A;  1S8N A;  2OQR A;  3JW4 A;  2Y48 A;  1XN7 A;  1MKM A;  2DT5 A;  2Z3Y A;  2Q0O A;  2OQG A;  2NRA C;  2FML A;  2D45 A;  2O03 A;  4XSZ F;  5CVV A;  1QO0 D;  1IN4 A;  3ERE D;  1YS7 A;  3HHG A;  2OZ6 A;  2ETH A;  4XLP F;  4CZZ A;  4RGR A;  1LDJ A;  2DLL A;  5F64 A;  5LRS A;  1B6A A;  2KKO A;  5CVJ A;  2JSC A;  4GYI A;  2A69 F;  1Z7U A;  2XKO A;  3EET A;  3DQV C;  1KGS A;  3AAF A;  2H94 A;  2M5W A;  2QEN A;  1MJ9 A;  5E1W A;  3F22 A;  3E6C C;  2HQN A;  3E97 A;  1B9M A;  4LMY A;  5JFR A;  2KRF A;  4MTD A;  2D1V A;  2O61 A;  1LDD A;  2E7X A;  2RV8 A;  3IKV A;  1WI9 A;  3MZH A;  4XRF A;  4ASN A;  3RPU A;  5HDG A;  4WXD A;  4U88 A;  4L18 B;  2YU3 A;  3Q9S A;  4B09 A;  2GXB A;  2KIM A;  4L9T A;  4HLY A;  1R7J A;  4N0B A;  4K2E A;  2CG4 A;  1WQ2 A;  4RGU A;  3FXU A;  3TDU C;  3R6S A;  3ECO A;  3FX3 A;  4EM2 A;  3LAJ A;  4M71 A;  1PP8 F;  3N97 A;  1BI2 A;  2R3S A;  3P9I A;  1MJB A;  2K4J A;  2VT3 A;  3ECH A;  2Y75 A;  3O6B B;  3SHF A;  1UHM A;  1P4W A;  3ZMV A;  3ELK A;  4WXC A;  3J80 Z;  1F9N A;  3LQR A;  1JE8 A;  4HQM A;  1IZ1 A;  4AIK A;  2TDX A;  2A61 A;  2EFQ A;  2WTE A;  1X3U A;  2HEO A;  3EYI A;  2XAQ A;  2P7V B;  2FNP A;  5EEG A;  3MZY A;  1DPU A;  3HSR A;  3T5X A;  2XAS A;  2DTR A;  3HOT A;  3EQL F;  3E6M A;  5L3F A;  4RS8 A;  4YII A;  1K78 B;  4ZH4 F;  2EFN A;  3KZY A;  2PG4 A;  3D5L A;  2DW4 A;  5D5U B;  3ZP5 A;  1U2W A;  4KN4 X;  3RDI A;  2ZO4 A;  2DPU A;  2YSR A;  3DF8 A;  2FOK A;  1LJ9 A;  4EQQ A;  2O6G E;  2EA2 A;  1Z05 A;  2W24 A;  5IT9 Z;  4AWX B;  2HZT A;  3E5Q A;  3H92 A;  1GXP A;  2AS5 F;  4MEX F;  2YR2 A;  3NRV A;  3ZPL A;  1IN8 A;  4P96 A;  1CF7 B;  1LB2 A;  4P9F A;  2W57 A;  5JR3 A;  2CWE A;  3EYY A;  2XAJ A;  5IT3 A;  2JRT A;  1R58 A;  5HVQ C;  1U8R A;  1TTY A;  2VN2 A;  4AIJ A;  2W25 A;  3DV8 A;  5E20 A;  1FZP B;  2E7W A;  3KE2 A;  2FNA A;  2QVO A;  5H20 A;  2IP2 A;  3G73 A;  3JTG A;  4WXH A;  3L2C A;  3SZT A;  4L0Y B;  3F8N A;  4UVA A;  1LEA A;  3RPQ A;  1LVA A;  2D2W A;  1IUY A;  1K79 A;  4P9U A;  4HV5 A;  2X0L A;  4HF1 A;  3HYI A;  3F21 A;  2ZFW A;  2ZNY A;  3WTZ A;  3SQN A;  5E17 F;  1T2K A;  4D0P A;  5DV5 A;  2UXN A;  2QBY A;  2DQL A;  1S29 A;  4OIO F;  3M1E A;  1EH8 A;  3TGN A;  1XB4 A;  3J81 Z;  5BOX A;  4LLL A;  2VBY A;  2CYY A;  4DNC A;  1FBU A;  2A07 F;  2ACJ A;  4G9Y A;  5KK1 A;  4RB1 A;  2XKP A;  2L4M A;  3LWF A;  5JVT A;  1J5Y A;  1U5T C;  1F4K A;  2VOO A;  1DP7 P;  2G7H A;  5FB2 A;  4BH9 A;  3SXY A;  2JZY A;  2BV6 A;  1FT9 A;  2VBW A;  2FBI A;  4MNU A;  4I02 A;  1SD5 A;  3I59 B;  5ILS A;  4A0Z A;  3BPV A;  2RNJ A;  3U9G A;  2HYG D;  3MFK A;  4EMS A;  4HLX A;  3ZN0 A;  3KP7 A;  1SD6 A;  1SMY F;  3WE2 A;  3WTY C;  1D5V A;  3M8E A;  2PJP A;  5FD5 A;  3ZMS A;  3KEO A;  3ZMT A;  2F5D A;  4IPA A;  1GXQ A;  2XHK A;  3Q5F A;  4S04 A;  1Z1D A;  4CGZ A;  1YG2 A;  4HOB A;  5HLG A;  2XRN A;  1O7F A;  2OAZ A;  2WC2 A;  4LD5 A;  5HDN A;  2FXA A;  4XLN F;  4OU0 A;  4ZYG A;  2AXL A;  4IRH A;  1L0O C;  2K4B A;  3C1D A;  2A68 F;  3KP3 A;  2NS0 A;  4ENM A;  4U0Y A;  1XDU A;  4CIC A;  1KYZ A;  3E6D A;  4WF2 A;  1W5T A;  5AON A;  4CO8 A;  2EV6 A;  4L9V A;  3RYR A;  2VOD A;  5A2Q K;  1E17 A;  1B9N A;  4HBL A;  5HLI A;  2V6C A;  3FMR A;  5D5W B;  2DBB A;  1H0M A;  2FBK A;  1OYW A;  2ZJ2 A;  4AVP A;  1ZH5 A;  4UUV A;  3GZ6 A;  2VON A;  4KIB A;  1WRJ A;  5JHU A;  1YIO A;  3L7W A;  1SFX A;  5BMZ A;  3VFZ A;  4ENN A;  3PFI A;  3F8F A;  1OMI A;  3M8F A;  4O6J A;  1P4A A;  3P7N A;  5J8F A;  1ON1 A;  1YW8 A;  5LHI A;  2P4W A;  4Y13 A;  3GYH X;  4YIF A;  4OIN F;  4XSX F;  4G6Q A;  1IW7 F;  1IXR C;  4EGZ A;  3RI4 A;  4KMU X;  3WGH A;  2IJL A;  3FZV A;  4G6D A;  3HTU A;  4BHC A;  2Z5U A;  4WWC A;  4M9X A;  1FBQ A;  2JPC A;  2VT2 A;  3CUQ A;  3VOE A;  1MGT A;  3VB2 A;  1K7A A;  4O3M A;  4U7D A;  2KIF A;  1ZGJ A;  4U7B A;  3MAJ A;  3BOQ A;  1AOY A;  4ZYH A;  2L01 A;  4LB6 B;  4A6D A;  4MTE A;  2M30 A;  4CXF A;  3DP7 A;  2V9V A;  2HTJ A;  3RIR A;  1FC3 A;  4KNY A;  1FP1 D;  4KA4 A;  2H6C A;  1TLH B;  5ED4 A;  2P5L C;  4KIC A;  2Q8K A;  5ICF A;  2JPB A;  3WU1 B;  2GQQ A;  1G3W A;  4IVN A;  2QZ8 A;  2P8T A;  1R36 A;  1IRF A;  2MH2 A;  3C7J A;  3Q9V A;  3R0A A;  5E8I A;  1YW7 A;  2EFP A;  4B8X A;  3F8M A;  4LGW A;  1DDN A;  2XAF A;  2IW5 A;  4IJA A;  1U78 A;  2WWY A;  1SFU A;  3HSE A;  3RJP A;  1IN7 A;  3QP6 A;  1PP7 U;  4M9S A;  1ZYR F;  3N4M A;  5CVR A;  4IF4 A;  4A2U A;  4L0Z B;  2H27 A;  2M1B A;  1EV7 A;  1OYI A;  2UWM A;  3ZN1 A;  4OIP F;  2QWW A;  1MZB A;  1R1U A;  4EVI A;  4KIF A;  1HKT A;  3HRS A;  4KYW A;  1BOA A;  1EH6 A;  1MJA A;  3JSO A;  3S2W A;  3GZ5 A;  3BPX A;  3QP5 A;  2M8E A;  4UXN A;  3K1P A;  2GXG A;  3QPH A;  4ZYE A;  2G9W A;  2HYF A;  2VE9 A;  1O57 A;  4WCG A;  5D5X B;  1BI3 A;  1ZN2 A;  2FSW A;  4KIG A;  3CLO A;  3LQQ A;  2PI0 A;  4NB5 A;  2BEO A;  5K5O A;  3MQ0 A;  4OIR F;  2EK5 A;  3SFZ A;  1BN5 A;  1Q1H A;  3KP5 A;  1ZG5 A;  3LST A;  5TJJ A;  4XBF A;  1RNL A;  1ONV A;  2K86 A;  1ZRF A;  4QWQ A;  4R1H A;  5CVU A;  1R5G A;  5D6F A;  1WSU A;  3BJO A;  2DFI A;  3CUO A;  3GLX A;  4LK1 F;  1HKQ A;  2RN7 A;  1EH7 A;  5H6R A;  3QOP A;  1OKR A;  4IHT A;  4M74 A;  4Q48 A;  1XGN A;  1A04 A;  2ESH A;  1U3E M;  2P6T A;  1YYV A;  2O3F A;  2CQK A;  1UFM A;  1U6G A;  2XIG A;  1JHH A;  2DK8 A;  2L54 A;  1USS A;  4LLN A;  5BPI A;  4MEY F;  2Z9O A;  1YS6 A;  1R22 A;  3TQN A;  3RTR A;  2QBY B;  3ZMD A;  3C18 A;  4PZJ A;  2BGC A;  2EA4 A;  1XSD A;  4I2O A;  3F72 A;  5TRD A;  4EJT A;  2MA3 A;  3RKX A;  3R61 A;  4KT5 C;  5DD8 A;  1B59 A;  2Z99 A;  5ICG A;  2K02 A;  1V3F A;  4I7H A;  4RAY A;  2WV0 A;  2EB7 A;  4Q47 A;  5A2Q Z;  4F7Z A;  1FLI A;  5D8L B;  2A3S A;  1MDM A;  2RGV A;  2UXX A;  3GEZ A;  3R0J A;  1MD0 A;  1O3S A;  2A6E F;  5E1Z B;  5DCM B;  2E1N A;  3WGG A;  1WKM A;  2ISZ A;  4BYY A;  2VXZ A;  3COA C;  4EM1 A;  3V7C A;  3I4P A;  3B73 A;  1FY7 A;  2KJB A;  2FEZ A;  4EJU A;  1XGO A;  2VC1 A;  3WTV C;  1I1S A;  3K1N A;  2F2E A;  3FXR A;  1I1G A;  2CO5 A;  3I54 A;  4YFX F;  4L9N A;  5ERI A;  4UHT A;  3VEP A;  2QLZ A;  3IRQ A;  3TO6 A;  1BM9 A;  1FBS A;  4PGH A;  4KN7 X;  3HSF A;  4EJV A;  2HQR A;  3TO7 A;  2OBP A;  2LDU A;  5HOO A;  3QAH A;  4A5M A;  1TQM A;  3R60 A;  3HOS A;  1TW3 A;  2ZME A;  4CHU A;  3GVA A;  1BBY A;  1FOK A;  1T6S A;  1XGM A;  3TKY A;  2GA1 A;  2FBH A;  2FA5 A;  1BI1 A;  1V4R A;  3D0S A;  4OMY A;  1W7P A;  1ZG1 A;  3IWZ A;  5BPD A;  2QUF A;  1SAX A;  3L09 A;  2LKP A;  3EUH A;  2QQB A;  2R7D A;  4HQE A;  2QM3 A;  3NQO A;  4ON0 A;  5LLQ A;  4YFK F;  3KEQ A;  4ZZD A;  1S6L A;  4HDU A;  4TV7 A;  1Z6T A;  2XAH A;  4OIQ F;  2PQ8 A;  2IA1 A;  1NHA A;  2DO7 A;  3HHH A;  5DUK A;  2VOP A;  3WOD F;  3JTH A;  5HS7 A;  1IXC A;  1U5T A;  3TDZ C;  1FYK A;  2LSO A;  3HUG A;  4HA8 A;  1O3Q A;  1H9T A;  1UCR A;  1SD4 A;  1RUO A;  1B4A A;  2YX7 A;  3E3V A;  1ZAO A;  1R1V A;  4Z2Y A;  3IC7 A;  2RKH A;  2IA0 A;  3BWG A;  4Q5S F;  2STT A;  1XCV A;  3LAP A;  3QU3 A;  1PDN C;  3CUQ B;  2CFX A;  3K0L A;  5CJ9 A;  1LNW A;  3DPL C;  3DFG A;  1QPM A;  3ML6 A;  1P92 A;  1XMA A;  3K69 A;  4FX4 A;  3I0T A;  1KU7 A;  2GA2 A;  1BJA A;  2ZBK A;  2Z33 A;  2GZW A;  2X4H A;  2IVM A;  1T0F A;  3K1M A;  4M73 A;  3GO5 A;  3V7R A;  1YLF A;  2PMH A;  1FX7 A;  1FP2 A;  2UZK A;  1DUX C;  2KJC A;  3T8T A;  4IRI A;  4FX0 A;  5E1X A;  4M9Z A;  1RIO H;  2LNB A;  5EEH A;  5LGT A;  4MHG A;  2RVC A;  3LA3 A;  3F3X A;  2ZKZ A;  4WK8 F;  1XD7 A;  5LBQ A;  3WU0 A;  1FWZ A;  1K78 A;  3K9T A;  5LEK A;  2DK5 A;  1OR7 A;  1S7A A;  5F6F A;  4LG0 A;  1ULY A;  3FM5 A;  4R8H A;  3E5U A;  4L5I A;  1Z6R A;  3IWF A;  1AWC A;  3I71 A;  4A0Y A;  2ISY A;  3CO6 C;  4GO1 A;  3F23 A;  5FLX K;  2RDP A;  1G3Y A;  3HIF A;  2RQP A;  2HS5 A;  5L3D A;  1RZ4 A;  1QNT A;  4I0B A;  4Y17 A;  2BBY A;  3L9F A;  5DYM A;  1P4X A;  3R4K A;  1ON2 A;  2M87 A;  5LHG A;  1W5S A;  5H6Q A;  1BI0 A;  1FSE A;  1I27 A;  3WG9 A;  1PUE E;  5LHH A;  4LB5 A;  4HYE A;  3U2R A;  1BC7 C;  1D3Y A;  2D1H A;  2HKO A;  5KVR A;  4O5V A;  4KMF A;  4BHB A;  2W85 A;  2F5C A;  4LJZ F;  1G6N A;  4KUM A;  3I64 A;  2P5K A;  5FFZ A;  3ZMU A;  2VE8 A;  2QYO A;  3BZ6 A;  5LGN A;  3PQK A;  2GWR A;  4RGS A;  4YFN F;  4EM0 B;  1B1B A;  4EJW A;  3GW2 A;  4H0E A;  4YG2 F;  4CDG A;  5BS6 A;  1W7P D;  1T39 A;  1I6X A;  1HW5 A;  4FT8 A;  1HBX G;  2OA4 A;  2COM A;  3KLN A;  3P9C A;  1IN6 A;  1QBJ A;  1FPQ A;  5HS9 A;  2F5F A;  2MH9 A;  5DCF A;  3L00 A;  1LDK B;  3WTU C;  3OOP A;  3WTX C;  3GXO A;  2FU4 A;  4M72 A;  4BHP A;  4IHS A;  5K1Y A;  2W84 A;  4KFC A;  2MD5 A;  3H3U A;  2ESN A;  5L3C A;  2V1U A;  1G4D A;  4I0A A;  4I09 A;  2HWV A;  4HZF A;  5K5R A;  5DD4 A;  4NHJ A;  1ZLK A;  1ZRC A;  1J2X A;  3KP4 A;  1SD7 A;  3BP8 A;  1MDM B;  4G7Z F;  3HRM A;  2HKX A;  4G7O F;  4RGX A;  3KZZ A;  5D4R A;  4UV9 A;  2L02 A;  1D8K A;  3GX4 X;  3ROU A;  4N9I A;  1Z91 A;  4G8X A;  4ENJ A;  1BC8 C;  4BXU A;  5CLS A;  1T98 A;  4UNO A;  1S7O A;  3BDD A;  5ICC A;  2CGP A;  3FMS A;  5BQT A;  1J0R A;  1YQA A;  1OYY A;  3RKW A;  3ZMZ A;  6PAX A;  1R00 A;  4G94 A;  2FRH A;  5D4S A;  2GAU A;  3HRU A;  1R1T A;  2G7U A;  2PBI A;  3QU6 A;  3WTW C;  2ZME B;  5L3G A;  3T8R A;  2JTV A;  2O0Y A;  2OD5 A;  3F8B A;  3GUD A;  4HAM A;  2QQ9 A;  2B0L A;  1QQI A;  5FGM A;  2YPR A;  3KCC A;  1W7P B;  2FMY A;  4A6E A;  4ETS A;  2JT1 A;  1IAW A;  4HF0 A;  3IL2 A;  5ICE A;  1QZY A;  4WX9 A;  3GF2 A;  3TOB A;  2DAO A;  4HV6 A;  4Q4Z F;  2XUB A;  1TNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...