5E8IA

Crystal structure of the dna binding domain of human transcription factor fli1 in complex with a 10-mer dna accggaagtg
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
93
structure length
93
Chain Sequence
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Friend leukemia integration 1 transcription factor
publication title Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 93
sequence length 93
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e8iA00
2PMUA 4HX8A 3V7RA 1KYWA 4D0PA 2HR3A 3RYRA 3WG9A 3F22A 3DFGA 2Q2EA 5LRRA 1H0MA 2EV6A 4DQ2A 4LGWA 3WU0A 4L5IA 4G9YA 3O2PE 1I1SA 1KQ8A 4M9SA 2V1UA 4RAYA 2BGCA 2IA2A 1ZRCA 2XAQA 4HLXA 2LNBA 2NS0A 1K78A 1MJAA 2ELHA 4CGZA 3SXYA 4HW0A 3K0LA 1LDKB 3GX4X 1HKSA 2FF4A 3ABUA 3H92A 4UV9A 4YFXF 4WXCA 2QENA 4O3MA 2V9VA 3GFLA 3L09A 2Y48A 2X0LA 4G7HF 2XHKA 5DV5A 3QAHA 1R22A 5DD8A 4WX9A 1W4MA 1R1UA 4BAYA 1W7PA 5FGMA 5TJJA 1QZYA 4IHTA 4ON0A 4UHTA 5ICEA 3H3ZA 2XAGA 3PQKA 2HKOA 3WTSC 3RYPA 4AVPA 2A6HF 1Z91A 2YX7A 2NYXA 2HYGD 1SFEA 2OAZA 1IRFA 3L00A 1W5TA 2QBYA 4DNCA 3F8CA 2V1DA 4HA8A 2XAFA 2WC2A 1BOAA 3G3ZA 3GFJA 3WTTC 3FM5A 2W57A 2Y0MA 3KE2A 2H6CA 2DFIA 5HDGA 4EGYA 2RGVA 2L4AA 5D6FA 2GA1A 1O3TA 1U6GA 5J6XA 3RKYA 1YS7A 2VODA 4HOBA 4LG0A 2FEZA 4GXOA 1B6AA 1I1GA 2WWYA 3COAC 2FQ3A 3I58A 4CO8A 1D8KA 1MJ9A 2KJBA 4L5JA 1TBXA 4XLPF 1K78B 1TLHB 5IT9K 1FZPB 2DU9A 2W85A 3HTSB 2XASA 2O61A 2P5VA 2HEOA 3F8BA 1STZA 3QP6A 2E1NA 2IA0A 2OQGA 1QPMA 4M9ZA 4Y13A 1LJ9A 5LGUA 3CUOA 1JXSA 1BN5A 1SD7A 3E6CC 1R58A 2ISYA 1SD4A 1W7PB 1PP7U 3MZHA 5LHIA 2KKOA 4I0AA 1SMYF 4I09A 3FXRA 2D1VA 3KP7A 2HQRA 4MTDA 1ODDA 1K7AA 1YW8A 3WGGA 5FLXZ 5LHHA 4R8HA 3RI4A 1D8JA 3P9CA 2RQPA 2ESHA 2STWA 4A0XA 1FBSA 3C3WA 5EEGA 1EH6A 4ESFA 3FX3A 2IRFG 4OIPF 3HRUA 1ZGAA 5ICFA 4P55A 4YIFA 2FU4A 3KZYA 5D4RA 5FO5A 3DV8A 4PZJA 4B8XA 4FX0A 4EJUA 1G3WA 3C18A 3N97A 3SHFA 1QBJA 2C6YA 1UHWA 2YR2A 1VTNC 3E5QA 4LG0B 1Z7UA 2X4HA 1Y0UA 2QQ9A 4HZFA 3BROA 3WGIA 1FC3A 2M1BA 2VOPA 3GFIA 4EJTA 3ABTA 2ZCWA 2COMA 3Q5FA 5BPDA 2VE9A 3HOTA 1HSTA 4EJVA 3KFWX 3WTVC 4S05A 4ASNA 4KDPA 4ZH4F 5IT9Z 2BV6A 3DKWA 2VC0A 2F5CA 2VONA 4L0ZB 1R23A 3WU1B 3ROUA 4ENNA 2GZWA 1F1ZA 2VE8A 4XBFA 3V4GA 5K5RA 3RKWA 3F8MA 5JR3A 2XGXA 5HLIA 5J8CA 2O6GE 1MD0A 3W6KB 2J5OA 1G3SA 4ZYGA 2FSWA 3KZZA 5CJ9A 1EH8A 4A6DA 3ECOA 4IF4A 1EV7A 5AIQA 5L3GA 1XGMA 2FXAA 2PEXA 1K6OA 1IXSB 4A0YA 3HYIA 4HAMA 2Z33A 4CXFA 5D5XB 1LEBA 2B0LA 4EGZA 3HUGA 1L0OC 2XRNA 4WXDA 3F23A 2P8TA 5H6RA 5H6QA 3JW4A 1SD6A 3TDZC 5BS6A 2P7CB 3P9KA 3KLNA 1ZG1A 3ULQB 1XB4A 3U9GA 5D8KB 2DPUA 1QQIA 4KMFA 2IT0A 5LGNA 1FYKA 2FNPA 1PUEE 2PMHA 1ZYRF 4A2UA 1XDSA 3CTAA 1RIOH 3NEUA 1O3RA 3BJ6A 2NNNA 3ELKA 4PDKA 4RGXA 4BNCA 2MH2A 3OV8A 2Z5UA 2A6EF 3HRTA 4R79A 1BM9A 3Q9SA 1H9TA 2QYOA 1PDNC 3WE3A 3IC7A 1LB2A 2A61A 3E5UA 3KCCA 4FHTA 2A5YB 2IVMA 1QO0D 3LFKA 3GVAA 2FA5A 4HF2A 3GWZA 2M87A 2G7HA 2P6TA 5CYVA 4OINF 3LWFA 4JBAA 1ZH5A 4U0VA 2AS5F 2L02A 1TW3A 3HRSA 1FX7A 1PP8F 1RZ4A 2XKOA 3BJAA 3QPHA 4RGUA 1FPQA 5L3CA 4UVCA 1XSDA 5ICGA 4H0EA 2V79A 1WRJA 4GGGA 1WI9A 2HFHA 2PJPA 1TQPA 2EA4A 5D5UB 4AIKA 4RB2C 4L9JA 1ZREA 1KYZA 1LEAA 5DEQA 1FY7A 3GEZA 4BQAA 5E1XA 4L0YB 3D0SA 3R6SA 2P5LC 4LLNA 3E97A 2KIUA 3GF2A 1IW7F 2RV8A 1KA8A 4L9NA 3LSTA 5DUIA 1T2KA 3E6MA 3ZP5A 2WV0A 5L3EA 2JPCA 1IN7A 5F64A 2A07F 3VEPA 1FP2A 5FD6A 1QNTA 5BPIA 2MLGA 1MJBA 2ETHA 3REOA 2QM3A 1XSXA 2O03A 3BP8A 2O8XA 3I54A 3PFIA 2DW4A 5L3FA 1XSVA 5HLHA 1FBQA 4BHPA 2GIVA 3KP6A 1OMIA 5E20A 2PFBA 1G4DA 2LF7A 1RUNA 2W84A 4OIOF 3C1DA 3GXOA 4EVIA 2PG4A 4Y17A 1ZLKA 3DXJF 1V3FA 3K1PA 2ZNYA 3MAJA 4OMZA 4ZYEA 1ULYA 4HLYA 4G7OF 1Z9CA 4AIJA 2OD5A 1U3EM 2KIMA 5H20A 1BI3A 3NQOA 5BMZA 3IHUA 3MQ0A 3LAPA 4I02A 4WF2A 3WODF 3FZVA 1NHAA 2DLLA 4I2OA 2XAJA 2XUBA 1DDNA 2QZ8A 2HDCA 1HW5A 4P96A 4ZZDA 1RUOA 1XN7A 4LK1F 3HIFA 4IPAA 3VB2A 4M74A 3I64A 3MWMA 2ZMEA 3ZMVA 3IRQA 3LQRA 1U78A 3M1EA 3E6BA 1X3UA 4LLGF 1Z6RA 3P9IA 2FE3A 4KIBA 5FD5A 4RB3C 1G3YA 1ON2A 2OZ6A 3MZYA 2ZXJA 2K4BA 1E2XA 2IW5A 3K9TA 2GQQA 2L54A 2DO7A 3KETA 3T8TA 4ENJA 2JZYA 3QOPA 2EV0A 3ERED 1WQ2A 3TGNA 3BPXA 5FFXA 4LD5A 3J81K 4ZYHA 1ZGJA 3BPVA 4A12A 4CICA 3R0JA 4U7BA 5JI6A 1I6XA 4YFNF 2DT5A 4A5NA 1BIBA 1D5VA 2FBKA 1FBUA 1HXDA 2JSCA 4UVBA 1OYIA 3H3UA 2CGPA 2M30A 2MBFA 3FMSA 3GZ6A 4RB0A 2RVCA 4LJZF 4GCVA 3KEOA 1IZ1A 1V4RA 1SD5A 5LHGA 2VOOA 4EQQA 4HDUA 1D3YA 4NHJA 2E7XA 2PQ8A 1WWXA 2KIFA 2JTVA 3FF5A 1OPCA 1OR7A 2NAZA 2LF8A 1TW2A 1Z1DA 5A2QK 3IWZA 4FX4A 2K27A 3WGHA 1ZAOA 2JPBA 2ZMEB 3N4MA 3U2RA 4AWXB 2V6CA 5HS8A 1XGNA 3T5XA 3ZPLA 1J59A 2Z3YA 1P4AA 1WKMA 3M9AA 4HQMA 4IHSA 1ZARA 3FXQA 4YFKF 1OKRA 2KJCA 4G6QA 4NQWA 1U8RA 2L3DA 1R00A 4L18B 1QGPA 2R7FA 1YS6A 4M72A 2F5DA 1IUYA 2L01A 4I7HA 1J2XA 3RDIA 2K02A 2RDPA 2E7WA 2E1CA 2EA2A 3CO7C 4ESBA 2K86A 3J81Z 4HX4A 3GW2A 3MFKA 4GO1A 4XRFA 2HZTA 2A3SA 4RGRA 3DQVC 1S6LA 4MGRA 5EEHA 1WSUA 3V8JA 4WXHA 5LEJA 4U0YA 3M8FA 3BJOA 4RS8A 4RAZA 4XLNF 1TNSA 4MQVA 1GHCA 1SMTA 2EFWA 2H6BA 4KA4A 4UV8A 4Q48A 2KRFA 4Y15A 1Q1HA 3L9FA 5K5QA 1LQ1A 2OU2A 2ZKZA 3T1BA 4EJWA 3HSRA 3F8NA 1SFUA 4OOIA 4M9XA 2VBZA 4AIHA 5LBQA 3TOBA 3JTHA 4KICA 4CYDA 2H09A 2UXXA 3KP4A 3IWFA 2DK5A 2M5WA 3DPTA 1JHHA 1B59A 1E17A 5DD4A 1DPUA 1XDUA 1B4AA 4G6DA 1REPC 1H9GA 4YIIA 2FNAA 4LK0F 1MKMA 1OYYA 2PI0A 3F72A 1W7PD 3I4PA 5DYMA 3JSOA 3IRRA 2RNJA 2MA3A 2OZUA 2BE5F 1Z6TA 4MEXF 3HSEA 4O6JA 1R1VA 1BC8C 1OYWA 3GLXA 2CWEA 5FFZA 6PAXA 1FSEA 1J5YA 4F7ZA 3CO6C 1FYLA 1IAWA 2Y75A 2W24A 5HS9A 3QU3A 3LA3A 4N9IA 3J80K 1R1TA 4PGHA 1IF1A 1XGSA 1CF7A 3M8EA 3T0YA 3TO7A 4EMSA 1IN6A 2HGCA 2TDXA 1MGTA 2FMYA 3ISPA 3R60A 4P9FA 4P9UA 2IA1A 5LEKA 2Q0OA 1IXCA 3I5UA 2A68F 1R5HA 5IT3A 2EWNA 4L9VA 5D8LB 1EH7A 1FSHA 1K79A 2XIGA 2JRTA 2XV4S 3BZ6A 3GUDA 1HKTA 5AONA 1T6SA 1J0RA 2OBPA 2YU3A 2F2EA 4HV6A 4CDGA 3FMQA 3IKTA 3E3VA 3ZMDA 1IXRC 4AD9A 1UB9A 1GXQA 2UXNA 5HS7A 3VOEA 3U1DA 2LSOA 2HYFA 1RI7A 2HKXA 3ZQ7A 4LB5A 4BH9A 1YG2A 4IXAA 1USSA 5E1WA 3RTRA 1KGSA 3B73A 4KMUX 4Q4ZF 4XSZF 3AAFA 1CGPA 3F3XA 5D6EA 2F5FA 5LLQA 4LLLA 4HBLA 3ZMZA 3TQNA 1TNTA 1ON1A 3T8RA 4ZYDA 3VFZA 1R7JA 3F6VA 3LQQA 3WE2A 1ONVA 1P4XA 4I01A 1BC7C 1HSJA 5JHUA 2G7UA 1CF7B 3V8LA 5KVRA 4MNUA 1SFXA 1MDMB 1U5TA 2FBIA 3EUHA 2OQRA 4UNOA 2PBIA 4ESJA 3LAJA 3I59B 5HOOA 2D45A 1AOYA 1YW7A 4KFCA 4U0WA 1YO5C 3J80Z 1S7OA 1HBXG 4OMYA 2L4MA 4IJAA 1ZN2A 3WTWC 3IL2A 3K2ZA 5LGTA 4M6XA 3ZMUA 1P2FA 1ZLJA 2ESNA 2GXBA 5K5OA 1LDJA 2ZNZA 3JTGA 2MLKA 4QLCU 4N9HA 3K69A 4A0ZA 5BOXA 5ILUA 2YPRA 2F5EA 5E8GA 3WTYC 1F9NA 2QQBA 3C7JA 1GVJA 1T98A 3WTXC 2P7VB 3K1MA 2EFQA 3KP3A 4KIFA 4OIQF 2H94A 3J7AO 5D5VB 3BY6A 4QWQA 1J7KA 3O6BB 3QU6A 2CFXA 2FBHA 3SQNA 5DCMA 1KQ0A 4EM0B 1O3QA 5DCFA 2RN7A 1XCVA 4MHGA 2VBXA 2JT1A 3L7WA 4CZZA 5HVQC 3NRVA 4UXNA 4IRHA 3D5LA 3GO5A 3RIRA 5ICCA 1FNNA 2IPQX 2P5KA 1I27A 5FLXK 1A04A 2DI3A 5K1YA 2EV5A 4HQEA 4L9TA 1FOKA 1BI0A 3R61A 1B1BA 2FRHA 3R0AA 2VN2A 2STTA 1YLFA 3LA7A 5CVVA 5ED4A 3WTUC 4IRIA 1G3TA 3E5XA 1U5TB 5FB2A 5E18F 2DQRA 2EFOA 3I0TA 1L3LA 1GXPA 2UZKA 4A5MA 1USTA 1S7AA 1IN8A 2GAUA 4IRGA 2ADUA 4MTEA 2XKPA 3BWGA 1T39A 4CHUA 2EK5A 4M73A 1ZRDA 2CO5A 4FT8A 4I98B 4LFUA 3QPTA 3VODA 5E1ZB 1JGSA 1P92A 4RB1A 3HRMA 5KK1A 2LKPA 1UHMA 4KUMA 3HSFA 5DUKA 3LA2A 4I0BA 4G7ZF 1U5TC 1R5GA 5ILVA 1XMKA 2ZFWA 2Q8KA 3ZMSA 4NB5A 4BYYA 2K4JA 4UUVA 4EM1A 3S2WA 3FXUA 2DBBA 2M8EA 5E8IA 3MCZA 3TKYA 1LDDA 2MD5A 3TOAA 1B9MA 4EJOA 1BI2A 2NNYA 1BIAA 4MEYF 3EQLF 3DF8A 2VT2A 1QZZA 2QWWA 2GWRA 5DCMB 4WCGA 3BDDA 1BJAA 2EJRA 4GYIA 2ZJ2A 1O57A 1FLIA 3PQJA 3Q9VA 2R3SA 5D4SA 5ERIA 1O7FA 4M6YA 4EM2A 1IRGA 3P7NA 3V7CA 2QUFA 2H27A 1KU7A 1B9NA 3CDHA 3ZN0A 1UFMA 2O0YA 3O3KA 1BBYA 2PN6A 2XROA 4KT5C 3DP7A 3IKVA 2HTSA 4BHCA 1ZHFA 2Z9OA 2QBYB 2FOKA 1DP7P 1YYVA 1C0WA 2XAHA 2XVCA 2MC3A 3CUQA 5CVRA 1J75A 3HOSA 3EDPA 3KP5A 1P4WA 3G73A 1SAXA 2EB7A 4RGSA 1TQMA 1YIOA 4KIGA 5CVIA 3WTZA 1R36A 2NRAC 1YW9A 2M45A 1YQAA 3TO9A 3W6JB 4G94A 2D1HA 2D2WA 3RPQA 1FYMA 3F8FA 1DUXC 2J5PA 2YSRA 3FM3A 2G9WA 4YG2F 2MH9A 1T38A 3MEXA 2BBYA 1O7LA 3ECHA 4BXUA 3SZPA 3TDUC 2DK8A 4HV5A 1IN4A 2GA2A 3L2CA 4OIRF 1YFHA 2HOEA 3DEUA 2DAOA 1HW2A 3QRFF 5DDGA 1XMAA 3RPUA 5L3BA 2VBWA 3FHZA 4BHBA 2WTEA 1TTYA 2P4WA 3HTUA 1KU3A 4K2EA 5CVUA 1Z05A 4KNYA 3GFMA 3KP2A 5A2QZ 5CLSA 3CJNA 5HDKA 5LRSA 1LNWA 5JFRA 1BI1A 4HX7A 2HS5A 2ZBKA 3R4KA 1KQ9A 2W25A 1RNLA 2RKHA 3JAMK 5AIPA 3V8KA 1I5ZA 5L3DA 3ZMTA 4Z2YA 3GZ5A 1HQCA 4O5VA 2VT3A 4P5OA 1F5TA 3I53A 1AWCA 3CUQB 1ZG5A 4E70A 4WK8F 3EYYA 4HDVA 4HF0A 1UCRA 5J8FA 4U88A 2OA4A 1XCBA 1KU9A 1ZG3A 2AXLA 1G6NA 3RJPA 5BQTA 3B02A 1O3SA 3FMRA 3E6DA 3M7GA 5ILSA 2P6SA 1YTYA 3EYIA 4ZZLA 1MDMA 3CUQC 4G8XA 1ZRFA 2IP2A 3I59A 4R1HA 4MQ9F 3K1NA 3KEQA 2BYVE 4U7DA 5F1RA 4HYEA 4ETSA 4OU0A 2O3FA 3ML6A 3CLOA 2BEOA 2CSOA 1F4KA 3JSPA 4LMYA 5CVJA 3RKXA 2YX4A 4JK1X 2ACJA 4EV0A 4S04A 3F21A 2QLZA 1TQIA 2QQAA 4GYGA 2DQLA 3HHHA 1W5SA 1MZBA 2R7DA 1XD7A 1LVAA 2CW0F 2LDUA 2VXZA 4UVAA 5HDNA 3EETA 4PGGA 2FMLA 1FP1D 3ZN1A 2EFPA 2HWVA 1J9IA 4ENMA 1JE8A 4A6EA 2EFNA 2DTRA 3QP5A 2VC1A 1S29A 4KYWA 3I71A 3SZTA 2DPDA 3JAMZ 2CG4A 1T0FA 1XGOA 2V1XA 3V7SA 2QVOA 1HKQA 1JHFA 5TRDA 2ISZA 4PCQA 1FT9A 4TV7A 2K7LA 5D5WB 4Q5SF 2CYYA 2IJLA 5F6FA 1P6RA 3BOQA 1U2WA 3HHGA 2HTJA 5HLGA 4KN7X 3KLOA 3SFZA 2HQNA 4Q47A 1S8NA 3OOPA 3FWEA 5E17F 5JVTA 2A69F 3GYHX 4B09A 3DPLC 2RC4A 1KU2A 4JQFA 4IVNA 3TO6A 4N0BA 2VBYA 1S3JA 2ZO4A 1DPRA 4KN4X 2UWMA 4XSXF 1HW1A 2Z99A 4WWCA 4M71A 1FWZA 4ENKA 2PLYA 2CQKA 1IN5A 4HF1A 2GXGA 3F6OA 4LB6B
chains in the Genus database with same CATH superfamily
2PMUA 4HX8A 2LRDA 3V7RA 1KYWA 2HVRA 4D0PA 3LOCA 2HR3A 5HODA 3RYRA 2LKXA 2HDDA 1T95A 1ACIA 2Q1ZB 3WG9A 2BZTA 3F22A 3DFGA 2Q2EA 1UZCA 5LRRA 1H0MA 1G59A 2EV6A 4DQ2A 4LGWA 3WU0A 3JRFA 4L5IA 3ONQA 4G9YA 1ORKA 1WVRA 2HZDA 3O2PE 3S15J 1I1SA 1KQ8A 1Y8QB 4XORA 4M9SA 2V1UA 5KNLA 4RAYA 4JX6A 2BGCA 4DW6A 2IA2A 3S16J 1ZRCA 4AUXA 3IH2A 2XAQA 5C3EJ 3PO3J 9ANTA 4HLXA 3B6AA 2LNBA 3CCVI 1OQYA 2NS0A 1K78A 2MYSA 1MJAA 2ELHA 1SAUA 4CGZA 4NBQA 3SXYA 4HW0A 3H5RA 2JWTA 3KYDB 3H0DA 1QVUA 3K0LA 1IRZA 1LDKB 5E3MA 4NUBA 3H9JA 3GX4X 3PNYA 2Y0SN 2ME6A 1HKSA 4A3DJ 2FF4A 4XQFA 3ABUA 3H92A 1QVTA 3MKLA 4UV9A 4XOTA 2EH3A 3W3CA 4YFXF 4XONA 4WXCA 1OCOH 1ZK8A 2QENA 2QA4I 2ICWG 4O3MA 4UUSA 2QKMB 2V9VA 2X6WA 2DFHA 2WADA 2DOAA 3GFLA 3L09A 2Y48A 2X0LA 4G7HF 2XHKA 5DV5A 3QAHA 4BUPA 1R22A 5DD8A 2JA8J 5CKTA 4WX9A 2BW3B 3HGYA 1W4MA 1R1UA 4BAYA 4AU7A 5B66C 5CPRB 1QRYA 1W7PA 3L2VA 3K70D 1MSEC 5FGMA 5TJJA 1QZYA 4IHTA 4ON0A 4UHTA 5ICEA 3G1OA 3H3ZA 2XAGA 1VQOI 3PQKA 2HKOA 1E0EA 3Q0WA 3WTSC 3RYPA 4AVPA 3EUAA 1X1DA 2A6HF 1TWCJ 1Z91A 4D9JA 2YX7A 2ECBA 2GOXB 2NYXA 4XKCA 2HYGD 1SFEA 2L9SA 2OAZA 1IRFA 1DQUA 1R5ID 1UELB 3L00A 1W5TA 2CS3A 2V9PA 1T0FC 2QBYA 4DNCA 5IOZA 3F8CA 2V1DA 4HA8A 3GCMA 2K9SA 2XAFA 2WC2A 1BOAA 1GV2A 4IO9F 2G0EA 4ABZA 3G3ZA 4AC0A 3GFJA 1WGXA 4ANJA 4XM3A 2M34A 3WTTC 1NK2P 3FM5A 5IP6A 2R92J 4DZPA 4A3CJ 2R7SA 2W57A 2N8GA 5EGOA 5FRNA 2Y0MA 1VQLI 4JOMA 3BG3A 3KE2A 2DCEA 2L7ZA 3DLLF 3S1RJ 4B1RA 1RR7A 1X58A 2H6CA 2DFIA 5HDGA 4F92B 4J01A 4EGYA 2W1OA 2RGVA 2Q2EB 2L4AA 4XRSG 5D6FA 3OYFA 3HB9A 2GA1A 1O3TA 5E3OA 3M07A 1U6GA 3ABLH 1Y0NA 2DJNA 5J6XA 4BACA 2QSGX 3RKYA 1YS7A 2VODA 4HPQA 4HOBA 2VL8A 3CCSI 2FEZA 4GXOA 4PJLA 4LG0A 1B6AA 1I1GA 2WWYA 1DGRM 3COAC 2FQ3A 3I58A 2VJJA 4ZYAA 4CO8A 3LSMA 1D8KA 1MJ9A 2KJBA 2CFOA 4L5JA 1TBXA 4XLPF 3NWTA 3JRAA 1K78B 1TLHB 1X1PA 2DT7B 2IGKA 3ZXSA 2IS2A 2XF7A 2R7ZJ 3H36A 5IT9K 5CQEA 1FZPB 2DU9A 2W85A 1R4NB 2Y31A 3HTSB 2TRTA 2XASA 2O61A 4ZTJA 3FK6A 4C3HJ 2P5VA 1EA3A 2HEOA 3F8BA 4JX4A 1STZA 1I50J 3QP6A 4GDFA 2E1NA 2MW8A 2IA0A 4KITB 2H1KA 4PUSA 2OQGA 1QPMA 4M9ZA 4Y13A 1LJ9A 2Y0SA 4DGWB 5LGUA 4ZDLA 3CUOA 2IS4A 4UUSB 3HXLA 1JXSA 4ZC3A 1BN5A 2LP0A 4RLFA 1RRJA 1JTXA 4BE0A 1HC8A 1SD7A 5EZGA 5GPCA 2HOSA 3E6CC 1R58A 3HZJA 4ZDPA 2M8GX 2ISYA 1S5LC 2JQ7A 3HOZJ 2R7VA 4BQOA 1SD4A 1W7PB 2CQ7A 2OCCH 3MZHA 1PP7U 2K3PA 5LHIA 2KKOA 3K4KA 4I0AA 1DU0A 1SMYF 4I09A 3FXRA 2D1VA 3KP7A 2HQRA 4V19K 4MTDA 2P0WA 1GDTA 2DFEA 1ODDA 2HQAA 3HL2A 1K7AA 3W2AA 1YW8A 3WGGA 5FLXZ 5LHHA 4R8HA 3PIOF 3FBIB 3RI4A 4BBSJ 1D8JA 3P9CA 4D1QA 4B43A 4CSWA 2RQPA 1GT0C 2ESHA 2XPUA 4PK4A 2X85A 2STWA 2KPMA 3AG1H 3BR3A 1HCRA 4DIQA 3ZQQA 2E2JJ 1SC7A 4A0XA 2CUEA 4BDYA 2CV0A 1FBSA 3PNVA 1TWAJ 3C3WA 5EEGA 1EH6A 4ITVA 3HOVJ 3GTGJ 3CP8A 3MD2A 1ZTRA 4ESFA 2WB1N 3AL0B 3FX3A 4E6KG 1TT0A 1A36A 5EGOB 1IRXA 2IRFG 4IKFA 2VKHA 4OIPF 3HRUA 1ZGAA 5ICFA 3U21A 4P55A 1W0UA 2X51A 4YIFA 3MKZA 2FU4A 4MIMA 3KZYA 1U9OA 2Y9YA 1T56A 5D4RA 1Z21A 5FO5A 3DV8A 4PZJA 4B8XA 3WHCA 2HQ5A 4FX0A 4EJUA 3OIPA 1G3WA 1Q1VA 3TW7A 1V54H 3C18A 3N97A 2W4SA 5JHFA 5KCMA 4CCKA 1VNDA 3SHFA 1N77A 2DMPA 4BEHA 2M0CA 1QBJA 1UHWA 2YR2A 2C6YA 3CF2A 2IGOA 2V6EA 3E0JB 4C2MJ 3DEWA 2JRMA 3CC7I 1VTNC 3CMAI 3ASNH 3E5QA 2F4OB 2EZHA 4LG0B 3S17J 1WJBA 2VKDA 1Z7UA 2KL4A 2X4HA 1Y0UA 2R7UA 5LFAA 4FASD 2QQ9A 4HZFA 3BROA 4EEFG 2GIZA 3WGIA 1FC3A 3AL0C 2M1BA 5E3LA 3ZRGA 2I5UA 2VOPA 3GFIA 2CU7A 3I4MJ 4PJ0C 2XGCA 4EJTA 3ABTA 2ZCWA 2COMA 3Q5FA 5BPDA 3RZOJ 2VE9A 4AM3A 2K9NA 3HOTA 3LL7A 1HSTA 3OY9A 4BQQA 4EJVA 1D1AA 2WY8Q 3KFWX 3WTVC 2IS1A 3W2VA 1P7JA 4IHXA 3CC4I 4S05A 4P1WA 4ASNA 4KDPA 4ZH4F 2AHQA 5IT9Z 2BV6A 3DKWA 2VC0A 2ID3A 5TISC 2F5CA 4BL0B 3CCRI 2VONA 4L0ZB 3IAM2 3BTCA 1HOMA 1R23A 4HNUA 3WU1B 3ROUA 4ENNA 2YUSA 1NH3A 2GZWA 2MC4A 3AFHA 1LE8A 2HVQA 2BVMA 1F1ZA 2VE8A 4XBFA 3IAS2 3V4GA 2WAFA 5K5RA 1UG0A 3RKWA 3PL8A 2LKSA 3F8MA 1XPXA 5H2FC 5JR3A 2XGXA 5HLIA 3J7YJ 5J8CA 1UAAA 4FE7A 4QTRA 2O6GE 3H1CA 1MD0A 1OCPA 2LTPA 2M4KA 3W6KB 3ZOBA 2RREA 2J5OA 5J40A 4IOCF 5DM7F 1G3SA 4ZYGA 4NDLA 2CW8A 2FSWA 4C2TA 3KZZA 5CJ9A 1X4OA 1EH8A 4A6DA 3ECOA 4IF4A 3MMYB 2VQHA 1X1CA 1EV7A 5AIQA 1XMXA 5L3GA 3CDLA 1XGMA 4QIWN 2VPRA 4OWRB 3G71I 2PEXA 2FXAA 1HDDC 4IHVA 4DOZA 1K6OA 2BVLA 4MFEA 1IXSB 1NK3P 4A0YA 3HYIA 2VPLA 4HAMA 2Z33A 4UUTA 3MN2A 1TZLA 3OYHA 2QCOA 3IV5A 2BHZA 4CXFA 5D5XB 1LEBA 1A6QA 1WJCA 2B0LA 3AKZA 4EGZA 1P7IA 5EG0A 3QODA 3K7AJ 4XR6A 3I3LA 3HUGA 3ZQHA 2LFBA 3CLQA 4DJAA 1L0OC 4RAFA 2XRNA 2WB1A 4WXDA 3F23A 2P8TA 5H6RA 4IHWA 1RKTA 5H6QA 3JW4A 5EJCA 1SD6A 4BE1A 3TDZC 3K4BA 4BY7J 1A5JA 5BS6A 2IAIA 4AYBN 2P7CB 1VI0A 3P9KA 1Y1VJ 5DM6F 3KLNA 1ZG1A 2UUZA 3PO2J 3ULQB 1XB4A 3U9GA 4BEHB 5D8KB 1FOXA 4HSTA 3LSJA 2DPUA 1QQIA 4XN0A 2CJJA 4KMFA 3HOUJ 2IT0A 1POGA 5LGNA 5IY5H 1FYKA 2V26A 2FNPA 2X6OA 3C2GA 3IH3A 1QA6A 1PUEE 2PMHA 1ZYRF 4A2UA 1XDSA 3CTAA 1QZEA 4FETA 4Y33A 3CCLI 1RIOH 3NEUA 1O3RA 1YRNA 3BJ6A 2R7QA 2E19A 2NNNA 2MSYA 3ELKA 4JYKA 3LSRA 4PDKA 1WI3A 2L5QA 4RGXA 1RR8C 4BNCA 2MH2A 3OV8A 2Z5UA 3HPHA 2A6EF 3LNQA 3HRTA 4R79A 1BM9A 3Q9SA 1U8BA 1H9TA 3QPLA 4DBRA 2R7TA 2QYOA 1E3HA 1PDNC 3WE3A 2JA5J 1MBFA 3IC7A 1LB2A 2A61A 4A3EJ 5B3SH 3E5UA 3KCCA 2GBYA 3HOYJ 4FHTA 2A5YB 2IVMA 2XPWA 3RKQA 4E7KA 1QO0D 1Z7LA 1PJRA 3LFKA 1IV6A 3GVAA 1LE8B 5IYBJ 2Y2ZA 2FA5A 3TW6A 4HF2A 3GWZA 3ZQFA 2M87A 2G7HA 1VQKI 2P6TA 5CYVA 3FBNB 4OINF 5F0HA 3LWFA 4JBAA 5KHDA 1JKRC 1ZH5A 4U0VA 2AS5F 4B44A 4XOPA 2L02A 1YI2I 1TW3A 1ENHA 3NWSA 3HRSA 1FX7A 1PP8F 1RZ4A 2XKOA 4OAZA 3BJAA 2DMNA 2RAEA 3DU6A 3H5AA 3QPHA 4DYQA 4RGUA 1AKHA 2GXAA 2DA3A 3H0GJ 2L9VA 1FPQA 5L3CA 1OCRH 4UVCA 1AA7A 1XSDA 4C9YA 3K4CA 5ICGA 3K4JA 4H0EA 2KT0A 3NARA 4LIUA 1IDZA 1JUSA 1AU7A 4YEJA 2V79A 1WRJA 2K3FA 4GGGA 1JKOC 5EG0B 2DA1A 1VFCA 1WI9A 2HFHA 2QGUA 3F9KA 3OR1C 4XRMA 2PJPA 2V1NA 1TQPA 2EA4A 2NVXJ 5D5UB 3GTKJ 4AIKA 4RB2C 4L9JA 3J7ZI 4GRIA 1ZREA 1R71A 1KYZA 1LEAA 4N4OB 3FXJA 5DEQA 1FY7A 1V5FA 2K40A 2MABA 2VI6A 3GEZA 4BQAA 4IHYA 5E1XA 4L0YB 2Z1DA 3D0SA 4C30A 3R6SA 2KFDA 2P5LC 4AYBA 4LLNA 4IZZA 2JA6J 3J7AY 3E97A 4CCMA 2KIUA 2A05A 3GF2A 1X1BA 2OF7A 3RQIA 1IW7F 2RV8A 2R93J 1OCZH 1KA8A 1FTTA 4L9NA 2FJ1A 3LSTA 3FISA 5DUIA 1T2KA 3E6MA 1HLVA 4HG2A 2JJ7A 3BG9A 1IC8A 3ZP5A 2WV0A 4JX5A 5L3EA 2JPCA 3M8JA 2X48A 5F1JA 3SEQA 1IN7A 5F64A 2M0MA 2A07F 3VEPA 1FP2A 4M3GA 3BT9A 5FD6A 1QNTA 5K7HA 4BJ5C 2MLGA 5BPIA 1WZ2A 1MJBA 2ETHA 3REOA 1CQTA 3CCEI 2QM3A 1XSXA 2NVUB 2O03A 4M6VA 3BP8A 4A3KJ 4CCJA 4KJZA 2O8XA 2MGQA 3I54A 3PFIA 2DW4A 2CV2A 4E4HA 1D0ZA 5L3FA 1XSVA 5HLHA 1FBQA 2VB6A 4XN3A 1ZKGA 4BHPA 2GIVA 3CCJI 3CJTB 3KP6A 1OMIA 1EF4A 5E20A 2PFBA 4XKBA 1G4DA 4XLCA 2LF7A 1RUNA 3ABMH 3A01B 2RQQA 1SFOJ 2W84A 4OIOF 2W00A 1LUJB 3C1DA 5FKLA 2GM4A 3CMMA 3GXOA 4EVIA 1WH7A 3D5RC 2WA0A 3BZCA 2PG4A 4Y17A 1ZLKA 1IUFA 3GLLA 3DXJF 1V3FA 3K1PA 2ZNYA 5BNGA 3HDDA 3MAJA 4OMZA 4ZYEA 2E34A 1ULYA 4HLYA 5FKOA 4G7OF 1Z9CA 4AIJA 3OYBA 1TP4A 1AKHB 4H4KC 2OD5A 1U3EM 2KIMA 3V42A 1WJFA 5H20A 1BI3A 3RPUD 3NQOA 3CCMI 5BMZA 2JSPA 2ZSHB 3IHUA 3MQ0A 3LAPA 4I02A 4WF2A 3WODF 2OPTA 3FZVA 1NHAA 1MNMC 2DLLA 4I2OA 1T08B 1LFBA 2XAJA 2XUBA 3OIQA 1DDNA 2QZ8A 2R7WA 3CQZJ 3QQAA 2NVTJ 3O8GA 1RPWA 2HDCA 1HW5A 3Q0VA 4I6ZA 4B47A 4P96A 4ZZDA 1RUOA 1XN7A 1VF9A 2B63J 4LK1F 3HIFA 2EQRA 4IPAA 3VB2A 2COBA 2E1OA 1K4TA 5F08A 4M74A 3I64A 3HGGA 3MWMA 2ZMEA 3ZMVA 3IRQA 2HDWA 3LQRA 1U78A 3H9GA 3M1EA 2HOTA 3E6BA 1X3UA 5K7FA 2VKEA 2M4GA 4LLGF 1WJDA 4X1EA 1Z6RA 1W36C 3JRCA 3P9IA 3LSPA 2F4MB 2FE3A 4A3GJ 4KIBA 4CYCA 5FD5A 4RB3C 3L2QA 1Y6IA 1G3YA 1I3QJ 1ON2A 3IH4A 3VSLA 2OZ6A 3MZYA 3G2BA 1MIJA 1QU3A 1JKPC 2ZXJA 2K4BA 2Z2SB 1E2XA 2ECCA 2IW5A 3P5JA 3K9TA 5J47A 1MMAA 2GQQA 2L54A 2DO7A 3KETA 2AQEA 3T8TA 4ENJA 2JZYA 2X6XA 3QOPA 2NS8A 3OYKA 2EV0A 3ERED 3DLAA 1ETWA 1WQ2A 2XF5A 2BOLA 2VUMJ 3TGNA 3BPXA 5FFXA 3JREA 2ZC2A 1AOYA 4LD5A 3J81K 4ZYHA 4HEA2 1ZGJA 3BPVA 3IP4B 4A12A 2GOMA 3K4NA 3R0JA 4CICA 4DZJA 4CCOA 4U7BA 2HXOA 5JI6A 2OCEA 3TP0A 1I6XA 4YFNF 1J09A 2DT5A 1X2MA 4A5NA 2CW7A 3CD6I 1T33A 1BIBA 1EJ9A 1MBJA 1K61A 1D5VA 2FBKA 2DA5A 5IP7J 1RESA 2DT6A 1FBUA 1HXDA 2Y30A 2Z16A 2JSCA 4UVBA 2I8DA 1IGNA 3A0BC 3OS0A 2IS6A 3JRBA 1R4MB 1OYIA 3H3UA 2CGPA 2M30A 3B6CA 3OSGA 4Z6YA 1JJ8C 4CZCA 3S8PA 2MBFA 3KPHA 3FMSA 1UMQA 4RB0A 3GZ6A 1Y8RB 3GMEA 2RVCA 2E60A 3KYLA 4LJZF 1Z0XA 2KP6A 2XSJC 4GCVA 3KEOA 1IZ1A 3A0HC 1V4RA 1LFUP 1SD5A 4CH7A 5F04A 5LHGA 3CP2A 4BXFA 2VOOA 5J3LA 4EQQA 2XF6A 3CCYA 4HDUA 3SFIA 4GFBA 3ZQGA 1D3YA 4NHJA 2E7XA 2HNHA 2PQ8A 4RBOA 1WWXA 2KIFA 2JTVA 3FF5A 1OPCA 1OR7A 2E5ZA 4E7LA 5M3FJ 2NAZA 2TCTA 1UG2A 1TWGJ 2LF8A 4D7MA 4UY8I 3OL4A 3L1PA 2L9RA 2MFZA 1TW2A 2PX9A 3G1LA 1Z1DA 5A2QK 3IWZA 2HVSA 5IYDJ 4FX4A 2K27A 4FISA 3MKWB 2CH0A 3WGHA 1ZAOA 2JPBA 3GTMJ 2ZMEB 1W0TA 4PSXA 3N4MA 3U2RA 3HG9A 4RMNA 3H5NA 2CQXA 2EINH 2LYCA 4J00A 1B72A 5GP9A 4AWXB 2V6CA 4MO7A 5HS8A 1XGNA 4M3DA 3T5XA 1U0JA 3ZPLA 3TL4X 3HOXJ 4CYCB 1IJWC 1J59A 2EBIA 2JVHA 4Y7NJ 1X19A 1IV8A 1MBEA 2XC7A 2Z3YA 1P4AA 1WKMA 3BCAA 3M9AA 4HQMA 4ZDOA 1FMWA 4M3FA 4IHSA 2E1MB 2OTLI 1ZARA 3FXQA 1NG7A 4FQGA 1OKRA 4YFKF 2KJCA 5GPAA 1MBHA 4G6QA 2XRLA 4NQWA 3L2WA 1U8RA 4I99C 4NNJA 2L3DA 1R00A 2ZMEC 4L18B 1QGPA 3OYEA 2R7FA 1YS6A 3HPGA 4XMYA 2R5ZB 5EDNA 3PSIA 4M72A 2F5DA 1IUYA 2L01A 1WPKA 4I7HA 1ETYA 1MNEA 1FMVA 3JRGA 1J2XA 2ZXHA 3CMEI 3RDIA 3VWBA 2K02A 2RDPA 3WG7H 1VZ0A 2BY2A 2E7WA 2EZKA 2E1CA 4D5CA 2EA2A 4ESBA 3CO7C 1WJEA 3C2HA 3DBHB 2K86A 1SVMA 2DYSH 2IEKA 4HX4A 3J81Z 2E1MC 3SYTA 3GW2A 3OYDA 4L5EA 4GO1A 3MFKA 2ZJRF 1PUFB 3HJEA 1A35A 3BCBA 3QOEA 4XRFA 2HZTA 3W2WA 2A3SA 4RGRA 1VQ7I 1F43A 3DQVC 1S6LA 4MGRA 2X6YA 1X4PA 5EEHA 2Y69H 1WSUA 3V8JA 4WXHA 1SVLA 1WHUA 5LEJA 2CUFA 4U0YA 2VJIA 2CMPA 3M8FA 4E7HA 2BHYA 3RZDJ 3CCQI 3BJOA 4RS8A 2X9DA 4RAZA 3G4SI 4XLNF 3S1MJ 1TNSA 4MQVA 1GHCA 3RQ4A 2HPIA 1SMTA 2EFWA 1MBGA 2H6BA 4KA4A 2OJED 3DTIA 5KAIC 4E7JA 4II2A 5C4JJ 2XSDC 3I4NJ 3PM1A 4UV8A 4KISA 1NG6A 2DA2A 2LC2A 4Q48A 5E79C 1BOBA 2KRFA 4Y15A 3I9V2 1Q1HA 1PYVA 3L9FA 3PUBA 5K5QA 1LQ1A 2OU2A 3S3NA 2ZKZA 3T1BA 4EJWA 2F5VA 3HSRA 3TBIA 3G6EI 3F8NA 2Y9ZA 1EKEA 2LY2A 3SEZA 5F0CA 2LBFB 1SFUA 4OOIA 2F48A 4M9XA 2VBZA 2DODA 1YIJI 1ERDA 1TWHJ 2XGDA 1IG7A 4AIHA 2XDVA 5LBQA 3TOBA 3JTHA 4BY1J 1B72B 4KICA 2KZVA 4CYDA 2H09A 2KDZA 3A1YA 5FROA 4XK4A 2UXXA 4EATA 3KP4A 3IWFA 2DK5A 4CCNA 3JRIA 2M5WA 4QPOA 1BW5A 3DPTA 1JHHA 1B59A 1E17A 5DD4A 1OR7C 1DPUA 1RETA 1XDUA 2K9MA 1B4AA 4G6DA 1REPC 1H9GA 2OTJI 4YIIA 2FNAA 1XG1A 3K4MA 1SANA 4MLOA 2KMUA 4LK0F 2ZSIB 2OC6A 1UJ8A 1MKMA 2VJ5A 4NQWB 4MFDA 1OYYA 2PI0A 1D1BA 4BJTA 2UV1A 3F72A 4PJNA 1W7PD 2KISA 2K9QA 2KLOA 3ASOH 3I4PA 5DYMA 2B9SA 2IBDA 3JSOA 3IRRA 3GBGA 2RNJA 5J4VA 4UB8C 2MA3A 3CJQB 2OZUA 3SJMA 2FQ4A 2BE5F 4F3QA 1Z6TA 4PJMA 4MEXF 3HSEA 2LY1A 4O6JA 2VQGA 3OYJA 2E2IJ 2EZLA 4BDZA 5K7ZA 2DN0A 1R1VA 1BC8C 1OYWA 4YRVA 2R7OA 1VQ5I 3GLXA 4RAGA 5J1UA 3OMYA 4G6TB 1FTZA 2CWEA 2HI3A 1YOVB 2HOAA 2JVGA 2ELJA 1JI8A 5B5EC 5FFZA 1GVDA 1BR2A 6PAXA 1FSEA 3JRDA 1J5YA 4F7ZA 3CO6C 1FYLA 1IAWA 2Y75A 2W24A 5HS9A 2KHMA 3QU3A 5B1AH 1XS9A 4NC8A 3LA3A 4N9IA 4LITA 1OISA 1R1TA 4PGHA 3J80K 1IF1A 1XGSA 3LSHA 4PFOA 1CF7A 1QHHD 3M8EA 1JT0A 1WJAA 4BXXJ 3T0YA 1B8IA 3TO7A 1I39A 1IN6A 4Y3OA 2HGCA 2VQCA 4EMSA 2F6CA 4AVZA 2TDXA 1MGTA 2FMYA 2VQLA 2WBMA 3ISPA 3Q0UA 1D0YA 3R60A 4M3BA 4P9FA 2JA7J 1N78A 4P9UA 2IA1A 5GTIC 5LEKA 1MW7A 4E7SA 3OYMA 2Q0OA 3FXMA 2DXIA 2JN6A 1IXCA 3I5UA 2A68F 1R5HA 5IT3A 2EWNA 2L7KA 1GUUA 4L9VA 3VYRB 2NOJB 2W82A 5D8LB 5LD2C 1EH7A 4CA0A 4FTHA 1FSHA 4CCLA 1JJ6C 1K79A 2XIGA 2JRTA 1TC3C 2XV4S 3A01A 2X1DA 3BZ6A 3GUDA 4S0HB 1HKTA 5AONA 2RNGA 1T6SA 5HNHA 1J0RA 1K4SA 5FLVA 1DP3A 2OBPA 2YU3A 3JRHA 1R9TJ 4QSHA 2F2EA 2F4IA 4F91B 4HV6A 1IDYA 3BR5A 3DWLE 4CDGA 3FMQA 3IKTA 3E3VA 3ZMDA 1IXRC 4AD9A 1UB9A 1GXQA 2DTZA 2UXNA 1BR4A 4G12A 4A93J 5HS7A 3VOEA 1WCMJ 1WH5A 2LSOA 3F6OA 3U1DA 3K4LA 2HYFA 1RI7A 2HKXA 3CCUI 4N4NB 1HF0A 3ZQ7A 4LB5A 3RCOA 4BH9A 1YG2A 1K83J 1E3PA 4IXAA 1USSA 2LREA 4F55A 4OAYA 3W6VA 3QWLA 5E1WA 3RTRA 1ITYA 2KRCA 1KGSA 3ZR8X 3B73A 4KMUX 1I3AA 4Q4ZF 4QPQA 1W5CC 4XSZF 5FKMA 3AAFA 1CGPA 3F3XA 5D6EA 2F5FA 1OCCH 5LLQA 4LLLA 4HBLA 3ZQIA 3TQNA 1Z67A 3ZMZA 5HLTA 5F27A 3K70C 3ZQLA 3GTQJ 3KX2A 1TNTA 4HNVA 1YX5A 1ON1A 3GTPJ 3T8RA 4ZYDA 3VFZA 3PSFA 2V7FA 2ZXIA 3TEDA 4BU2A 4HSRA 1R7JA 3BLYA 2NXNB 2ZJPF 1N75A 2A6TA 3F6VA 3LQQA 2DMUA 3WE2A 1ONVA 1P4XA 4I01A 4ZTFA 4BJ6C 1BC7C 1HSJA 1Y56A 5JHUA 2G7UA 2DOFA 1CF7B 2GLOA 3V8LA 1MH3A 3A4CA 5KVRA 3K6GA 2W7NA 4MNUA 4A69C 1B8IB 4V2GA 1SFXA 3BTLA 1MDMB 1U5TA 2FBIA 3EUHA 4LG3A 2JUCA 1JT6A 2OQRA 4UNOA 3OYLA 2PBIA 4ESJA 3LAJA 3OR2C 1FOYA 1Y1WJ 3I59B 2HXIA 2B7EA 5IP9J 5HOOA 2EIJH 2D45A 2E2HJ 1MBKA 1WJ5A 1YW7A 3D1NI 2W48A 4KFCA 4U0WA 1YO5C 3J80Z 1S7OA 1HBXG 1BW6A 4OMYA 2WAQN 2L4MA 4XRSA 3NAUA 3BQZA 1JUPA 4IJAA 2LD5A 1ZN2A 3BTIA 3WTWC 3BTJA 3IL2A 1D5YA 1E3OC 5IOYA 3K2ZA 4XLFA 5LGTA 2ZFUA 4M6XA 3ZMUA 1VQPI 1F36A 4BKXA 1P2FA 3C2BA 2FUG2 1ZLJA 2ZXWH 2R7RA 2PJRA 2ESNA 2GXBA 2R5YA 5K5OA 2DYRH 1LDJA 4XLAA 2IGMA 4YELA 2CQNA 2ZNZA 5GAHJ 3JTGA 4NC7A 2ELKA 2MLKA 4QLCU 3ZQCA 4N9HA 3HC7A 3K69A 4A0ZA 5BOXA 5ILUA 3FHNA 2K9LA 2F5EA 2YPRA 5E8GA 3WTYC 3FKJA 1F9NA 2R4GA 1P9QC 2QQBA 3C7JA 3OYIA 3UKGA 1GVJA 1ETXA 1T98A 4PSWA 3WTXC 2P7VB 3K1MA 2EFQA 3KP3A 4KIFA 2NVYJ 3CESA 4OIQF 2BY0A 2H94A 1VQ4I 1Z3YA 1KONA 3J7AO 5D5VB 3BY6A 1OCTC 1YX3A 4QWQA 4M3EA 1J7KA 1MH4A 2BXYA 2O9LA 3O6BB 3QU6A 4RM2A 3L2UA 2CUZA 2CFXA 3DPUA 3OS1A 5TGTA 2KDOA 2EPFA 2FBHA 3SQNA 1XX5A 5DCMA 1KQ0A 1LFPA 3AG2H 4EM0B 1O3QA 5DCFA 2RN7A 1XCVA 4MHGA 2DFFA 2BY1A 2VBXA 2JT1A 3L7WA 5J4YA 4C3IJ 4CZZA 5HVQC 3NRVA 4UXNA 4IRHA 3D5LA 2H1LA 3GO5A 2QF7A 1FIAA 2ZB9A 2XGEA 4RA2A 3JCUC 3RIRA 5ICCA 3SDGA 1FNNA 2IPQX 2P5KA 1I27A 4I76A 5FLXK 1A04A 2O7OA 3S3OA 4XICA 2DI3A 4IQ4A 5K1YA 1BL0A 2EV5A 4HQEA 3FK7A 4L9TA 1FOKA 1BI0A 3R61A 1B1BA 2FRHA 3R0AA 2IXSA 2P81A 2YU9J 2VN2A 4XIDA 2FX0A 1X2NA 3MZ8A 2FOWA 2V9KA 2STTA 3BR6A 1YLFA 3KIOA 3OWTA 4BGDA 2R0QC 2D5VA 1BJZA 2O5RA 3LA7A 5CVVA 5ED4A 3WTUC 4IRIA 1G3TA 1QHGA 3E5XA 2WV1A 4PJJA 1U5TB 1ETVA 2JK3A 3M4OJ 5FB2A 5E18F 2DQRA 2EFOA 1VQNI 3I0TA 1L3LA 1YJNI 2WAEA 2UZKA 3DKXA 1GXPA 1X3ZB 4A5MA 1USTA 3U1KA 3KEYA 1S7AA 2R5ZA 1IN8A 2GAUA 4IRGA 2ADUA 2XAUA 3HKZN 2EILH 1S9HA 3ZCOA 4MTEA 3UR3C 2XKPA 3BWGA 1T39A 1ZR2A 2WAQA 4CHUA 2EIMH 2EK5A 3KYCB 2CO5A 3CDIA 4FT8A 4I98B 4LFUA 3FXOA 4M73A 1ZRDA 2OV7A 3QPTA 3VODA 5E1ZB 3GTOJ 3S93A 1JGSA 1P92A 4A3FJ 4RB1A 3DBLB 3HRMA 5J1YA 1VQ8I 2LKPA 5KK1A 2PJRB 3K10A 2R5YB 1TWFJ 1ZELA 4A3MJ 1PUFA 1UHMA 3A03A 4KUMA 1JGGA 1MMGA 3OS2A 3HSFA 5DUKA 3LA2A 4I0BA 4G7ZF 2DDAA 1U5TC 3EUHC 1JTYA 3LSKA 1R5GA 5ILVA 3AG4H 1XMKA 2ZFWA 1ZR4A 2AQFA 1IO2A 2Q8KA 3ZMSA 4NB5A 1M1EB 4BQNA 4BYYA 1FEXA 2K4JA 3M1CA 4UUVA 4EM1A 3S2WA 3FXUA 2DBBA 5C44J 3A02A 1XC5A 3S3MA 1G8XA 3CC2I 3QYBA 2M8EA 5E8IA 3MCZA 2O8KA 3TKYA 5IYCJ 1LDDA 1W1WE 3PIPF 2MD5A 2E5NA 3TOAA 1B9MA 4EJOA 1BI2A 3WU2C 1ZGWA 2NNYA 1BIAA 4MEYF 3EQLF 2L9NA 3OOUA 2EIKH 3DF8A 3FXLA 1R49A 2JMWA 3L2RA 2VT2A 4B3AA 2VLAA 1N25A 1A6IA 1QZZA 5M3MJ 2QWWA 1H8AC 2GWRA 5DCMB 4F52A 2VXDA 4WCGA 5FLMJ 2I10A 3BDDA 1BJAA 2CQQA 4HRIA 2LR8A 2EJRA 4GYIA 2EZIA 2ZJ2A 3BG7A 3LSGA 4CUGA 1FIPA 2LBFA 4IOAF 1D1CA 5HNFA 1APLC 2MD0A 1X3WB 4XKWA 1O57A 1FLIA 2HU9A 1UHSA 3IUOA 2VASA 5M5YJ 1S7EA 2DMTA 2X1CA 1LKXA 3PQJA 3Q9VA 2R3SA 3ABKH 3DEEA 2XPVA 3VPRA 5D4SA 1V5EA 5ERIA 1OJLA 1O7FA 3BR1A 4M6YA 4EM2A 1IRGA 1WFXA 3P7NA 3V7CA 1W36D 2QUFA 2H27A 1KU7A 4W97A 1B9NA 3ERMA 1YJ9I 3CDHA 3ZN0A 1S72I 1BA5A 3GTLJ 1UFMA 4B4CA 2O0YA 4A3LJ 4IEJA 4KT6A 4X6AJ 3O3KA 1BBYA 2PN6A 2DA6A 4XL9A 2XROA 4KT5C 3DP7A 3AG3H 3IKVA 2HTSA 1DGWY 4BHCA 3S1QJ 1ZHFA 2Z9OA 2QBYB 3GZNB 2FOKA 1DP7P 4E7IA 3E1SA 2QSFX 3G1MA 1YYVA 2VKVA 1C0WA 2XAHA 2XVCA 2MC3A 5CQGA 3WHBA 1MMSA 3CUQA 2LMDA 2LH9A 1X1AA 3HBLA 3Q3SA 2K5CA 4W1UA 1Z77A 3HM5A 5CVRA 1J75A 3HOSA 3EDPA 3KP5A 1Z3XA 1SVOA 1G2HA 3HKZA 1P4WA 3G73A 2DDBA 4DYCA 1SAXA 2AXTC 3FIWA 1FOWA 3VDXA 2EB7A 4RGSA 1TQMA 5F0FA 3CF5F 4A3IJ 3PFYA 3HEFA 3S1NJ 1YIOA 1ETQA 4KIGA 5JLXA 3I55I 4PFPA 3OYGA 5CVIA 2KIQA 3OYAA 3WTZA 1R36A 2NRAC 1YW9A 1PVEA 3K2AA 2M45A 3VSKA 5KAFC 1YQAA 2M2EA 3TO9A 1GLNA 2MG4A 3DTEA 1U9NA 3W6JB 4G94A 2D1HA 2D2WA 2LOOA 1HA8A 3D5SC 3RPQA 1FYMA 3F8FA 1DUXC 2J5PA 4JP0A 1DU6A 2YSRA 3FM3A 2G9WA 4YG2F 2MH9A 5JVGF 1T38A 3MEXA 4RDUA 2BBYA 1O7LA 3ECHA 4BXUA 3SZPA 3LFUA 5J1RA 3TDUC 2DK8A 1RKWA 4HV5A 1IN4A 2GA2A 3L2CA 5C4XJ 3QYFA 5E3NA 2QEXI 4OIRF 1YFHA 2NVQJ 2A5WA 2HOEA 3DEUA 2DAOA 1HW2A 2XB5A 3CJRB 3QRFF 5DDGA 2NS7A 2L2OA 1OLTA 1XMAA 3RPUA 5L3BA 4DYRA 2OUMA 2VBWA 4IL6C 4YIRX 4BHBA 3DKYA 2WTEA 1TTYA 4DBQA 3FHZA 2P4WA 3BR2A 3DU5A 3HTUA 3LSIA 1KU3A 2JA2A 4K2EA 5CVUA 1Z05A 3LMMA 4KNYA 4BBRJ 2XB0X 3GFMA 2V4JC 3KP2A 5A2QZ 5CLSA 3CJNA 5HDKA 3MVPA 5LRSA 1LNWA 3BG5A 5JFRA 1BI1A 4IQJA 4HX7A 2HS5A 4A3JJ 2ZBKA 1V55H 1AHDP 3QYEA 2PMZN 3R4KA 4D7NA 1KQ9A 2W25A 1NTCA 5B1BH 1QPIA 1H89C 4B48A 1RNLA 2RKHA 3S32A 1GV5A 2LK2A 5AIPA 3V8KA 3JAMK 1I5ZA 5L3DA 3ZMTA 3CZ6A 3TMOA 3HOWJ 3S2DJ 5GTHC 1YITI 4Z2YA 3UNGC 2LY9A 3VYSB 3GZ5A 1HQCA 1T8IA 4O5VA 2VT3A 4P5OA 1F5TA 3I53A 1AWCA 3ZGKA 2LG4A 3CUQB 3H3VK 2WY7Q 1ZG5A 1Y39A 2CRGA 2M7BA 4E70A 4WK8F 3EYYA 4HDVA 4HF0A 2L7FP 1MMDA 3H9QA 4F93B 1UCRA 5J8FA 4U88A 1LVKA 3RSNA 3OIOA 1JKQC 1H88C 2BY3A 2OA4A 1YE9A 1XCBA 1KU9A 1ZG3A 2AXLA 4AIDA 2DOEA 1G6NA 3N05A 3RJPA 3VYTB 5BQTA 2YS9A 3DBRB 3B02A 1O3SA 2DMQA 4LOCA 3FMRA 2CUJA 3E6DA 4XKVA 3M7GA 1XTAA 3S2HJ 5ILSA 3BG6A 3SDBA 2P6SA 1D0XA 5FKNA 1YTYA 3DCFA 3EYIA 4ZZLA 3E7LA 4J19A 1YHQI 1MDMA 3CUQC 4G8XA 3BZKA 1ZRFA 2X1EA 5EYRA 5DTDA 4C2UA 2IP2A 3I59A 4R1HA 2ZJQF 4FE4A 4MQ9F 2NOGA 4BS9A 3K1NA 3KEQA 2M7AA 1A31A 4XLEA 2BYVE 1SFKA 3BR0A 4Y52J 2BXZA 4U7DA 5F1RA 4NC6A 4HYEA 4ETSA 3PUFA 2O3FA 4OU0A 2ID6A 3ML6A 1ETOA 2DA7A 2QSHX 1I6HJ 3CLOA 3BC8A 2BEOA 3FXKA 2CSOA 2L7MP 4U87A 1F4KA 3VYUB 3JSPA 5IPAA 5FJ8J 3ESWB 2VJ4A 1SEUA 4LMYA 5CVJA 3RKXA 1VQMI 2YX4A 4JK1X 2ACJA 4EV0A 4II3A 4S04A 3F21A 2QLZA 1TQIA 2E36A 2QQAA 2DJIA 4GYGA 1O4XA 2DQLA 4XLHA 3HHHA 1MSFC 1W5SA 1MZBA 2R7DA 1XD7A 2H8RA 1LVAA 2CW0F 2LDUA 2HYJA 2VXZA 3A2KA 4FCYA 4XNFA 2HPMA 5M5XJ 4V2FA 1MNDA 4UVAA 5HDNA 3EETA 4PGGA 2FMLA 3OYCA 4IX7A 1FP1D 3ZN1A 3PJRA 2EFPA 5EF6A 1OFCX 3O8HA 4C3JJ 2LLKA 2QQ8A 3EPZA 4RM3A 2HWVA 3PNTA 3QPSA 3I56I 4D5FA 1J9IA 4ENMA 2PMZA 1LPQA 1RC9A 5FKKA 1JE8A 4A6EA 2EFNA 1KZHA 2DTRA 3TP3A 3JR9A 3QP5A 2CV1A 3FDYA 1R6RA 5GADJ 2VC1A 1S29A 2QKLB 4KYWA 2JUGA 2R7XA 1TT5B 3SZGA 2ME0A 5GAGJ 3MKYB 3I71A 2E71A 4UB6C 3SZTA 2DPDA 1ZQ3P 5JLWA 3JAMZ 2CG4A 3DTKA 1T0FA 1XGOA 4LIVA 3GTJJ 2V1XA 2QVOA 2AO9A 3V7SA 1HKQA 1JHFA 3S14J 5TRDA 2ISZA 2VIXA 4PCQA 4Y4RA 4RLQA 3F0CA 3CMYA 1FT9A 4X0GA 2FD5A 4TV7A 1K6YA 2K7LA 5D5WB 1VQ9I 3HUGB 1VQ6I 3H35A 4Q5SF 2CYYA 2IJLA 2M9HA 5FRMA 5F6FA 1P6RA 2BW3A 1V5GA 3BOQA 1BR1A 2KZGA 2DA4A 1U2WA 5GAEJ 3M3YJ 2K85A 3KZIC 3HHGA 3X2QH 3EUKL 1TL8A 2HTJA 1ETKA 5HLGA 4KN7X 3KLOA 3SFZA 2HQNA 5M5WJ 4Q47A 1S8NA 3OOPA 3FWEA 5E17F 5EZHA 2H8WA 5JVTA 2A69F 3GYHX 2L0KA 4B09A 1JUMA 3DPLC 3OL3A 2RC4A 1KU2A 2KRHA 3OYNA 4JQFA 4BE2A 4IVNA 3TO6A 3BQYA 4N0BA 4HNTA 4B3XA 1FJLA 4ZJZA 2VBYA 1S3JA 2ZO4A 4A3BJ 5EEAA 1DPRA 4KN4X 1HDPA 2E35A 1YJWI 2UWMA 4XSXF 2IGNA 1HW1A 2Z99A 4WWCA 5DS9A 1YRNB 4M71A 1FWZA 4E7ZA 4ENKA 3OSFA 2PLYA 2KQRA 2CQKA 1IN5A 4HF1A 2GXGA 2LVSA 4LB6B 1MMNA 3FKIJ 2M3AA
chains in the Genus database with same CATH topology
2PMUA 4HX8A 3V7RA 1KYWA 4D0PA 2HR3A 3RYRA 3WG9A 3F22A 3DFGA 2Q2EA 5LRRA 1H0MA 2EV6A 4DQ2A 4LGWA 3WU0A 4L5IA 4G9YA 3O2PE 1I1SA 1KQ8A 4M9SA 2V1UA 4RAYA 2BGCA 2IA2A 1ZRCA 2XAQA 4HLXA 2LNBA 2NS0A 1K78A 1MJAA 2ELHA 4CGZA 3SXYA 4HW0A 3K0LA 1LDKB 3GX4X 1HKSA 2FF4A 3ABUA 3H92A 4UV9A 4YFXF 4WXCA 2QENA 4O3MA 2V9VA 3GFLA 3L09A 2Y48A 2X0LA 4G7HF 2XHKA 5DV5A 3QAHA 1R22A 5DD8A 4WX9A 1W4MA 1R1UA 4BAYA 1W7PA 5FGMA 5TJJA 1QZYA 4IHTA 4ON0A 4UHTA 5ICEA 3H3ZA 2XAGA 3PQKA 2HKOA 3WTSC 3RYPA 4AVPA 2A6HF 1Z91A 2YX7A 2NYXA 2HYGD 1SFEA 2OAZA 1IRFA 3L00A 1W5TA 2QBYA 4DNCA 3F8CA 2V1DA 4HA8A 2XAFA 2WC2A 1BOAA 3G3ZA 3GFJA 3WTTC 3FM5A 2W57A 2Y0MA 3KE2A 2H6CA 2DFIA 5HDGA 4EGYA 2RGVA 2L4AA 5D6FA 2GA1A 1O3TA 1U6GA 5J6XA 3RKYA 1YS7A 2VODA 4HOBA 4LG0A 2FEZA 4GXOA 1B6AA 1I1GA 2WWYA 3COAC 2FQ3A 3I58A 4CO8A 1D8KA 1MJ9A 2KJBA 4L5JA 1TBXA 4XLPF 1K78B 1TLHB 5IT9K 1FZPB 2DU9A 2W85A 3HTSB 2XASA 2O61A 2P5VA 2HEOA 3F8BA 1STZA 3QP6A 2E1NA 2IA0A 2OQGA 1QPMA 4M9ZA 4Y13A 1LJ9A 5LGUA 3CUOA 1JXSA 1BN5A 1SD7A 3E6CC 1R58A 2ISYA 1SD4A 1W7PB 1PP7U 3MZHA 5LHIA 2KKOA 4I0AA 1SMYF 4I09A 3FXRA 2D1VA 3KP7A 2HQRA 4MTDA 1ODDA 1K7AA 1YW8A 3WGGA 5FLXZ 5LHHA 4R8HA 3RI4A 1D8JA 3P9CA 2RQPA 2ESHA 2STWA 4A0XA 1FBSA 3C3WA 5EEGA 1EH6A 4ESFA 3FX3A 2IRFG 4OIPF 3HRUA 1ZGAA 5ICFA 4P55A 4YIFA 2FU4A 3KZYA 5D4RA 5FO5A 3DV8A 4PZJA 4B8XA 4FX0A 4EJUA 1G3WA 3C18A 3N97A 3SHFA 1QBJA 2C6YA 1UHWA 2YR2A 1VTNC 3E5QA 4LG0B 1Z7UA 2X4HA 1Y0UA 2QQ9A 4HZFA 3BROA 3WGIA 1FC3A 2M1BA 2VOPA 3GFIA 4EJTA 3ABTA 2ZCWA 2COMA 3Q5FA 5BPDA 2VE9A 3HOTA 1HSTA 4EJVA 3KFWX 3WTVC 4S05A 4ASNA 4KDPA 4ZH4F 5IT9Z 2BV6A 3DKWA 2VC0A 2F5CA 2VONA 4L0ZB 1R23A 3WU1B 3ROUA 4ENNA 2GZWA 1F1ZA 2VE8A 4XBFA 3V4GA 5K5RA 3RKWA 3F8MA 5JR3A 2XGXA 5HLIA 5J8CA 2O6GE 1MD0A 3W6KB 2J5OA 1G3SA 4ZYGA 2FSWA 3KZZA 5CJ9A 1EH8A 4A6DA 3ECOA 4IF4A 1EV7A 5AIQA 5L3GA 1XGMA 2FXAA 2PEXA 1K6OA 1IXSB 4A0YA 3HYIA 4HAMA 2Z33A 4CXFA 5D5XB 1LEBA 2B0LA 4EGZA 3HUGA 1L0OC 2XRNA 4WXDA 3F23A 2P8TA 5H6RA 5H6QA 3JW4A 1SD6A 3TDZC 5BS6A 2P7CB 3P9KA 3KLNA 1ZG1A 3ULQB 1XB4A 3U9GA 5D8KB 2DPUA 1QQIA 4KMFA 2IT0A 5LGNA 1FYKA 2FNPA 1PUEE 2PMHA 1ZYRF 4A2UA 1XDSA 3CTAA 1RIOH 3NEUA 1O3RA 3BJ6A 2NNNA 3ELKA 4PDKA 4RGXA 4BNCA 2MH2A 3OV8A 2Z5UA 2A6EF 3HRTA 4R79A 1BM9A 3Q9SA 1H9TA 2QYOA 1PDNC 3WE3A 3IC7A 1LB2A 2A61A 3E5UA 3KCCA 4FHTA 2A5YB 2IVMA 1QO0D 3LFKA 3GVAA 2FA5A 4HF2A 3GWZA 2M87A 2G7HA 2P6TA 5CYVA 4OINF 3LWFA 4JBAA 1ZH5A 4U0VA 2AS5F 2L02A 1TW3A 3HRSA 1FX7A 1PP8F 1RZ4A 2XKOA 3BJAA 3QPHA 4RGUA 1FPQA 5L3CA 4UVCA 1XSDA 5ICGA 4H0EA 2V79A 1WRJA 4GGGA 1WI9A 2HFHA 2PJPA 1TQPA 2EA4A 5D5UB 4AIKA 4RB2C 4L9JA 1ZREA 1KYZA 1LEAA 5DEQA 1FY7A 3GEZA 4BQAA 5E1XA 4L0YB 3D0SA 3R6SA 2P5LC 4LLNA 3E97A 2KIUA 3GF2A 1IW7F 2RV8A 1KA8A 4L9NA 3LSTA 5DUIA 1T2KA 3E6MA 3ZP5A 2WV0A 5L3EA 2JPCA 1IN7A 5F64A 2A07F 3VEPA 1FP2A 5FD6A 1QNTA 5BPIA 2MLGA 1MJBA 2ETHA 3REOA 2QM3A 1XSXA 2O03A 3BP8A 2O8XA 3I54A 3PFIA 2DW4A 5L3FA 1XSVA 5HLHA 1FBQA 4BHPA 2GIVA 3KP6A 1OMIA 5E20A 2PFBA 1G4DA 2LF7A 1RUNA 2W84A 4OIOF 3C1DA 3GXOA 4EVIA 2PG4A 4Y17A 1ZLKA 3DXJF 1V3FA 3K1PA 2ZNYA 3MAJA 4OMZA 4ZYEA 1ULYA 4HLYA 4G7OF 1Z9CA 4AIJA 2OD5A 1U3EM 2KIMA 5H20A 1BI3A 3NQOA 5BMZA 3IHUA 3MQ0A 3LAPA 4I02A 4WF2A 3WODF 3FZVA 1NHAA 2DLLA 4I2OA 2XAJA 2XUBA 1DDNA 2QZ8A 2HDCA 1HW5A 4P96A 4ZZDA 1RUOA 1XN7A 4LK1F 3HIFA 4IPAA 3VB2A 4M74A 3I64A 3MWMA 2ZMEA 3ZMVA 3IRQA 3LQRA 1U78A 3M1EA 3E6BA 1X3UA 4LLGF 1Z6RA 3P9IA 2FE3A 4KIBA 5FD5A 4RB3C 1G3YA 1ON2A 2OZ6A 3MZYA 2ZXJA 2K4BA 1E2XA 2IW5A 3K9TA 2GQQA 2L54A 2DO7A 3KETA 3T8TA 4ENJA 2JZYA 3QOPA 2EV0A 3ERED 1WQ2A 3TGNA 3BPXA 5FFXA 4LD5A 3J81K 4ZYHA 1ZGJA 3BPVA 4A12A 4CICA 3R0JA 4U7BA 5JI6A 1I6XA 4YFNF 2DT5A 4A5NA 1BIBA 1D5VA 2FBKA 1FBUA 1HXDA 2JSCA 4UVBA 1OYIA 3H3UA 2CGPA 2M30A 2MBFA 3FMSA 3GZ6A 4RB0A 2RVCA 4LJZF 4GCVA 3KEOA 1IZ1A 1V4RA 1SD5A 5LHGA 2VOOA 4EQQA 4HDUA 1D3YA 4NHJA 2E7XA 2PQ8A 1WWXA 2KIFA 2JTVA 3FF5A 1OPCA 1OR7A 2NAZA 2LF8A 1TW2A 1Z1DA 5A2QK 3IWZA 4FX4A 2K27A 3WGHA 1ZAOA 2JPBA 2ZMEB 3N4MA 3U2RA 4AWXB 2V6CA 5HS8A 1XGNA 3T5XA 3ZPLA 1J59A 2Z3YA 1P4AA 1WKMA 3M9AA 4HQMA 4IHSA 1ZARA 3FXQA 4YFKF 1OKRA 2KJCA 4G6QA 4NQWA 1U8RA 2L3DA 1R00A 4L18B 1QGPA 2R7FA 1YS6A 4M72A 2F5DA 1IUYA 2L01A 4I7HA 1J2XA 3RDIA 2K02A 2RDPA 2E7WA 2E1CA 2EA2A 3CO7C 4ESBA 2K86A 3J81Z 4HX4A 3GW2A 3MFKA 4GO1A 4XRFA 2HZTA 2A3SA 4RGRA 3DQVC 1S6LA 4MGRA 5EEHA 1WSUA 3V8JA 4WXHA 5LEJA 4U0YA 3M8FA 3BJOA 4RS8A 4RAZA 4XLNF 1TNSA 4MQVA 1GHCA 1SMTA 2EFWA 2H6BA 4KA4A 4UV8A 4Q48A 2KRFA 4Y15A 1Q1HA 3L9FA 5K5QA 1LQ1A 2OU2A 2ZKZA 3T1BA 4EJWA 3HSRA 3F8NA 1SFUA 4OOIA 4M9XA 2VBZA 4AIHA 5LBQA 3TOBA 3JTHA 4KICA 4CYDA 2H09A 2UXXA 3KP4A 3IWFA 2DK5A 2M5WA 3DPTA 1JHHA 1B59A 1E17A 5DD4A 1DPUA 1XDUA 1B4AA 4G6DA 1REPC 1H9GA 4YIIA 2FNAA 4LK0F 1MKMA 1OYYA 2PI0A 3F72A 1W7PD 3I4PA 5DYMA 3JSOA 3IRRA 2RNJA 2MA3A 2OZUA 2BE5F 1Z6TA 4MEXF 3HSEA 4O6JA 1R1VA 1BC8C 1OYWA 3GLXA 2CWEA 5FFZA 6PAXA 1FSEA 1J5YA 4F7ZA 3CO6C 1FYLA 1IAWA 2Y75A 2W24A 5HS9A 3QU3A 3LA3A 4N9IA 3J80K 1R1TA 4PGHA 1IF1A 1XGSA 1CF7A 3M8EA 3T0YA 3TO7A 4EMSA 1IN6A 2HGCA 2TDXA 1MGTA 2FMYA 3ISPA 3R60A 4P9FA 4P9UA 2IA1A 5LEKA 2Q0OA 1IXCA 3I5UA 2A68F 1R5HA 5IT3A 2EWNA 4L9VA 5D8LB 1EH7A 1FSHA 1K79A 2XIGA 2JRTA 2XV4S 3BZ6A 3GUDA 1HKTA 5AONA 1T6SA 1J0RA 2OBPA 2YU3A 2F2EA 4HV6A 4CDGA 3FMQA 3IKTA 3E3VA 3ZMDA 1IXRC 4AD9A 1UB9A 1GXQA 2UXNA 5HS7A 3VOEA 3U1DA 2LSOA 2HYFA 1RI7A 2HKXA 3ZQ7A 4LB5A 4BH9A 1YG2A 4IXAA 1USSA 5E1WA 3RTRA 1KGSA 3B73A 4KMUX 4Q4ZF 4XSZF 3AAFA 1CGPA 3F3XA 5D6EA 2F5FA 5LLQA 4LLLA 4HBLA 3ZMZA 3TQNA 1TNTA 1ON1A 3T8RA 4ZYDA 3VFZA 1R7JA 3F6VA 3LQQA 3WE2A 1ONVA 1P4XA 4I01A 1BC7C 1HSJA 5JHUA 2G7UA 1CF7B 3V8LA 5KVRA 4MNUA 1SFXA 1MDMB 1U5TA 2FBIA 3EUHA 2OQRA 4UNOA 2PBIA 4ESJA 3LAJA 3I59B 5HOOA 2D45A 1AOYA 1YW7A 4KFCA 4U0WA 1YO5C 3J80Z 1S7OA 1HBXG 4OMYA 2L4MA 4IJAA 1ZN2A 3WTWC 3IL2A 3K2ZA 5LGTA 4M6XA 3ZMUA 1P2FA 1ZLJA 2ESNA 2GXBA 5K5OA 1LDJA 2ZNZA 3JTGA 2MLKA 4QLCU 4N9HA 3K69A 4A0ZA 5BOXA 5ILUA 2YPRA 2F5EA 5E8GA 3WTYC 1F9NA 2QQBA 3C7JA 1GVJA 1T98A 3WTXC 2P7VB 3K1MA 2EFQA 3KP3A 4KIFA 4OIQF 2H94A 3J7AO 5D5VB 3BY6A 4QWQA 1J7KA 3O6BB 3QU6A 2CFXA 2FBHA 3SQNA 5DCMA 1KQ0A 4EM0B 1O3QA 5DCFA 2RN7A 1XCVA 4MHGA 2VBXA 2JT1A 3L7WA 4CZZA 5HVQC 3NRVA 4UXNA 4IRHA 3D5LA 3GO5A 3RIRA 5ICCA 1FNNA 2IPQX 2P5KA 1I27A 5FLXK 1A04A 2DI3A 5K1YA 2EV5A 4HQEA 4L9TA 1FOKA 1BI0A 3R61A 1B1BA 2FRHA 3R0AA 2VN2A 2STTA 1YLFA 3LA7A 5CVVA 5ED4A 3WTUC 4IRIA 1G3TA 3E5XA 1U5TB 5FB2A 5E18F 2DQRA 2EFOA 3I0TA 1L3LA 1GXPA 2UZKA 4A5MA 1USTA 1S7AA 1IN8A 2GAUA 4IRGA 2ADUA 4MTEA 2XKPA 3BWGA 1T39A 4CHUA 2EK5A 4M73A 1ZRDA 2CO5A 4FT8A 4I98B 4LFUA 3QPTA 3VODA 5E1ZB 1JGSA 1P92A 4RB1A 3HRMA 5KK1A 2LKPA 1UHMA 4KUMA 3HSFA 5DUKA 3LA2A 4I0BA 4G7ZF 1U5TC 1R5GA 5ILVA 1XMKA 2ZFWA 2Q8KA 3ZMSA 4NB5A 4BYYA 2K4JA 4UUVA 4EM1A 3S2WA 3FXUA 2DBBA 2M8EA 5E8IA 3MCZA 3TKYA 1LDDA 2MD5A 3TOAA 1B9MA 4EJOA 1BI2A 2NNYA 1BIAA 4MEYF 3EQLF 3DF8A 2VT2A 1QZZA 2QWWA 2GWRA 5DCMB 4WCGA 3BDDA 1BJAA 2EJRA 4GYIA 2ZJ2A 1O57A 1FLIA 3PQJA 3Q9VA 2R3SA 5D4SA 5ERIA 1O7FA 4M6YA 4EM2A 1IRGA 3P7NA 3V7CA 2QUFA 2H27A 1KU7A 1B9NA 3CDHA 3ZN0A 1UFMA 2O0YA 3O3KA 1BBYA 2PN6A 2XROA 4KT5C 3DP7A 3IKVA 2HTSA 4BHCA 1ZHFA 2Z9OA 2QBYB 2FOKA 1DP7P 1YYVA 1C0WA 2XAHA 2XVCA 2MC3A 3CUQA 5CVRA 1J75A 3HOSA 3EDPA 3KP5A 1P4WA 3G73A 1SAXA 2EB7A 4RGSA 1TQMA 1YIOA 4KIGA 5CVIA 3WTZA 1R36A 2NRAC 1YW9A 2M45A 1YQAA 3TO9A 3W6JB 4G94A 2D1HA 2D2WA 3RPQA 1FYMA 3F8FA 1DUXC 2J5PA 2YSRA 3FM3A 2G9WA 4YG2F 2MH9A 1T38A 3MEXA 2BBYA 1O7LA 3ECHA 4BXUA 3SZPA 3TDUC 2DK8A 4HV5A 1IN4A 2GA2A 3L2CA 4OIRF 1YFHA 2HOEA 3DEUA 2DAOA 1HW2A 3QRFF 5DDGA 1XMAA 3RPUA 5L3BA 2VBWA 3FHZA 4BHBA 2WTEA 1TTYA 2P4WA 3HTUA 1KU3A 4K2EA 5CVUA 1Z05A 4KNYA 3GFMA 3KP2A 5A2QZ 5CLSA 3CJNA 5HDKA 5LRSA 1LNWA 5JFRA 1BI1A 4HX7A 2HS5A 2ZBKA 3R4KA 1KQ9A 2W25A 1RNLA 2RKHA 3JAMK 5AIPA 3V8KA 1I5ZA 5L3DA 3ZMTA 4Z2YA 3GZ5A 1HQCA 4O5VA 2VT3A 4P5OA 1F5TA 3I53A 1AWCA 3CUQB 1ZG5A 4E70A 4WK8F 3EYYA 4HDVA 4HF0A 1UCRA 5J8FA 4U88A 2OA4A 1XCBA 1KU9A 1ZG3A 2AXLA 1G6NA 3RJPA 5BQTA 3B02A 1O3SA 3FMRA 3E6DA 3M7GA 5ILSA 2P6SA 1YTYA 3EYIA 4ZZLA 1MDMA 3CUQC 4G8XA 1ZRFA 2IP2A 3I59A 4R1HA 4MQ9F 3K1NA 3KEQA 2BYVE 4U7DA 5F1RA 4HYEA 4ETSA 4OU0A 2O3FA 3ML6A 3CLOA 2BEOA 2CSOA 1F4KA 3JSPA 4LMYA 5CVJA 3RKXA 2YX4A 4JK1X 2ACJA 4EV0A 4S04A 3F21A 2QLZA 1TQIA 2QQAA 4GYGA 2DQLA 3HHHA 1W5SA 1MZBA 2R7DA 1XD7A 1LVAA 2CW0F 2LDUA 2VXZA 4UVAA 5HDNA 3EETA 4PGGA 2FMLA 1FP1D 3ZN1A 2EFPA 2HWVA 1J9IA 4ENMA 1JE8A 4A6EA 2EFNA 2DTRA 3QP5A 2VC1A 1S29A 4KYWA 3I71A 3SZTA 2DPDA 3JAMZ 2CG4A 1T0FA 1XGOA 2V1XA 3V7SA 2QVOA 1HKQA 1JHFA 5TRDA 2ISZA 4PCQA 1FT9A 4TV7A 2K7LA 5D5WB 4Q5SF 2CYYA 2IJLA 5F6FA 1P6RA 3BOQA 1U2WA 3HHGA 2HTJA 5HLGA 4KN7X 3KLOA 3SFZA 2HQNA 4Q47A 1S8NA 3OOPA 3FWEA 5E17F 5JVTA 2A69F 3GYHX 4B09A 3DPLC 2RC4A 1KU2A 4JQFA 4IVNA 3TO6A 4N0BA 2VBYA 1S3JA 2ZO4A 1DPRA 4KN4X 2UWMA 4XSXF 1HW1A 2Z99A 4WWCA 4M71A 1FWZA 4ENKA 2PLYA 2CQKA 1IN5A 4HF1A 2GXGA 3F6OA 4LB6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMU A;  4HX8 A;  3V7R A;  1KYW A;  4D0P A;  2HR3 A;  3RYR A;  3WG9 A;  3F22 A;  3DFG A;  2Q2E A;  5LRR A;  1H0M A;  2EV6 A;  4DQ2 A;  4LGW A;  3WU0 A;  4L5I A;  4G9Y A;  3O2P E;  1I1S A;  1KQ8 A;  4M9S A;  2V1U A;  4RAY A;  2BGC A;  2IA2 A;  1ZRC A;  2XAQ A;  4HLX A;  2LNB A;  2NS0 A;  1K78 A;  1MJA A;  2ELH A;  4CGZ A;  3SXY A;  4HW0 A;  3K0L A;  1LDK B;  3GX4 X;  1HKS A;  2FF4 A;  3ABU A;  3H92 A;  4UV9 A;  4YFX F;  4WXC A;  2QEN A;  4O3M A;  2V9V A;  3GFL A;  3L09 A;  2Y48 A;  2X0L A;  4G7H F;  2XHK A;  5DV5 A;  3QAH A;  1R22 A;  5DD8 A;  4WX9 A;  1W4M A;  1R1U A;  4BAY A;  1W7P A;  5FGM A;  5TJJ A;  1QZY A;  4IHT A;  4ON0 A;  4UHT A;  5ICE A;  3H3Z A;  2XAG A;  3PQK A;  2HKO A;  3WTS C;  3RYP A;  4AVP A;  2A6H F;  1Z91 A;  2YX7 A;  2NYX A;  2HYG D;  1SFE A;  2OAZ A;  1IRF A;  3L00 A;  1W5T A;  2QBY A;  4DNC A;  3F8C A;  2V1D A;  4HA8 A;  2XAF A;  2WC2 A;  1BOA A;  3G3Z A;  3GFJ A;  3WTT C;  3FM5 A;  2W57 A;  2Y0M A;  3KE2 A;  2H6C A;  2DFI A;  5HDG A;  4EGY A;  2RGV A;  2L4A A;  5D6F A;  2GA1 A;  1O3T A;  1U6G A;  5J6X A;  3RKY A;  1YS7 A;  2VOD A;  4HOB A;  4LG0 A;  2FEZ A;  4GXO A;  1B6A A;  1I1G A;  2WWY A;  3COA C;  2FQ3 A;  3I58 A;  4CO8 A;  1D8K A;  1MJ9 A;  2KJB A;  4L5J A;  1TBX A;  4XLP F;  1K78 B;  1TLH B;  5IT9 K;  1FZP B;  2DU9 A;  2W85 A;  3HTS B;  2XAS A;  2O61 A;  2P5V A;  2HEO A;  3F8B A;  1STZ A;  3QP6 A;  2E1N A;  2IA0 A;  2OQG A;  1QPM A;  4M9Z A;  4Y13 A;  1LJ9 A;  5LGU A;  3CUO A;  1JXS A;  1BN5 A;  1SD7 A;  3E6C C;  1R58 A;  2ISY A;  1SD4 A;  1W7P B;  1PP7 U;  3MZH A;  5LHI A;  2KKO A;  4I0A A;  1SMY F;  4I09 A;  3FXR A;  2D1V A;  3KP7 A;  2HQR A;  4MTD A;  1ODD A;  1K7A A;  1YW8 A;  3WGG A;  5FLX Z;  5LHH A;  4R8H A;  3RI4 A;  1D8J A;  3P9C A;  2RQP A;  2ESH A;  2STW A;  4A0X A;  1FBS A;  3C3W A;  5EEG A;  1EH6 A;  4ESF A;  3FX3 A;  2IRF G;  4OIP F;  3HRU A;  1ZGA A;  5ICF A;  4P55 A;  4YIF A;  2FU4 A;  3KZY A;  5D4R A;  5FO5 A;  3DV8 A;  4PZJ A;  4B8X A;  4FX0 A;  4EJU A;  1G3W A;  3C18 A;  3N97 A;  3SHF A;  1QBJ A;  2C6Y A;  1UHW A;  2YR2 A;  1VTN C;  3E5Q A;  4LG0 B;  1Z7U A;  2X4H A;  1Y0U A;  2QQ9 A;  4HZF A;  3BRO A;  3WGI A;  1FC3 A;  2M1B A;  2VOP A;  3GFI A;  4EJT A;  3ABT A;  2ZCW A;  2COM A;  3Q5F A;  5BPD A;  2VE9 A;  3HOT A;  1HST A;  4EJV A;  3KFW X;  3WTV C;  4S05 A;  4ASN A;  4KDP A;  4ZH4 F;  5IT9 Z;  2BV6 A;  3DKW A;  2VC0 A;  2F5C A;  2VON A;  4L0Z B;  1R23 A;  3WU1 B;  3ROU A;  4ENN A;  2GZW A;  1F1Z A;  2VE8 A;  4XBF A;  3V4G A;  5K5R A;  3RKW A;  3F8M A;  5JR3 A;  2XGX A;  5HLI A;  5J8C A;  2O6G E;  1MD0 A;  3W6K B;  2J5O A;  1G3S A;  4ZYG A;  2FSW A;  3KZZ A;  5CJ9 A;  1EH8 A;  4A6D A;  3ECO A;  4IF4 A;  1EV7 A;  5AIQ A;  5L3G A;  1XGM A;  2FXA A;  2PEX A;  1K6O A;  1IXS B;  4A0Y A;  3HYI A;  4HAM A;  2Z33 A;  4CXF A;  5D5X B;  1LEB A;  2B0L A;  4EGZ A;  3HUG A;  1L0O C;  2XRN A;  4WXD A;  3F23 A;  2P8T A;  5H6R A;  5H6Q A;  3JW4 A;  1SD6 A;  3TDZ C;  5BS6 A;  2P7C B;  3P9K A;  3KLN A;  1ZG1 A;  3ULQ B;  1XB4 A;  3U9G A;  5D8K B;  2DPU A;  1QQI A;  4KMF A;  2IT0 A;  5LGN A;  1FYK A;  2FNP A;  1PUE E;  2PMH A;  1ZYR F;  4A2U A;  1XDS A;  3CTA A;  1RIO H;  3NEU A;  1O3R A;  3BJ6 A;  2NNN A;  3ELK A;  4PDK A;  4RGX A;  4BNC A;  2MH2 A;  3OV8 A;  2Z5U A;  2A6E F;  3HRT A;  4R79 A;  1BM9 A;  3Q9S A;  1H9T A;  2QYO A;  1PDN C;  3WE3 A;  3IC7 A;  1LB2 A;  2A61 A;  3E5U A;  3KCC A;  4FHT A;  2A5Y B;  2IVM A;  1QO0 D;  3LFK A;  3GVA A;  2FA5 A;  4HF2 A;  3GWZ A;  2M87 A;  2G7H A;  2P6T A;  5CYV A;  4OIN F;  3LWF A;  4JBA A;  1ZH5 A;  4U0V A;  2AS5 F;  2L02 A;  1TW3 A;  3HRS A;  1FX7 A;  1PP8 F;  1RZ4 A;  2XKO A;  3BJA A;  3QPH A;  4RGU A;  1FPQ A;  5L3C A;  4UVC A;  1XSD A;  5ICG A;  4H0E A;  2V79 A;  1WRJ A;  4GGG A;  1WI9 A;  2HFH A;  2PJP A;  1TQP A;  2EA4 A;  5D5U B;  4AIK A;  4RB2 C;  4L9J A;  1ZRE A;  1KYZ A;  1LEA A;  5DEQ A;  1FY7 A;  3GEZ A;  4BQA A;  5E1X A;  4L0Y B;  3D0S A;  3R6S A;  2P5L C;  4LLN A;  3E97 A;  2KIU A;  3GF2 A;  1IW7 F;  2RV8 A;  1KA8 A;  4L9N A;  3LST A;  5DUI A;  1T2K A;  3E6M A;  3ZP5 A;  2WV0 A;  5L3E A;  2JPC A;  1IN7 A;  5F64 A;  2A07 F;  3VEP A;  1FP2 A;  5FD6 A;  1QNT A;  5BPI A;  2MLG A;  1MJB A;  2ETH A;  3REO A;  2QM3 A;  1XSX A;  2O03 A;  3BP8 A;  2O8X A;  3I54 A;  3PFI A;  2DW4 A;  5L3F A;  1XSV A;  5HLH A;  1FBQ A;  4BHP A;  2GIV A;  3KP6 A;  1OMI A;  5E20 A;  2PFB A;  1G4D A;  2LF7 A;  1RUN A;  2W84 A;  4OIO F;  3C1D A;  3GXO A;  4EVI A;  2PG4 A;  4Y17 A;  1ZLK A;  3DXJ F;  1V3F A;  3K1P A;  2ZNY A;  3MAJ A;  4OMZ A;  4ZYE A;  1ULY A;  4HLY A;  4G7O F;  1Z9C A;  4AIJ A;  2OD5 A;  1U3E M;  2KIM A;  5H20 A;  1BI3 A;  3NQO A;  5BMZ A;  3IHU A;  3MQ0 A;  3LAP A;  4I02 A;  4WF2 A;  3WOD F;  3FZV A;  1NHA A;  2DLL A;  4I2O A;  2XAJ A;  2XUB A;  1DDN A;  2QZ8 A;  2HDC A;  1HW5 A;  4P96 A;  4ZZD A;  1RUO A;  1XN7 A;  4LK1 F;  3HIF A;  4IPA A;  3VB2 A;  4M74 A;  3I64 A;  3MWM A;  2ZME A;  3ZMV A;  3IRQ A;  3LQR A;  1U78 A;  3M1E A;  3E6B A;  1X3U A;  4LLG F;  1Z6R A;  3P9I A;  2FE3 A;  4KIB A;  5FD5 A;  4RB3 C;  1G3Y A;  1ON2 A;  2OZ6 A;  3MZY A;  2ZXJ A;  2K4B A;  1E2X A;  2IW5 A;  3K9T A;  2GQQ A;  2L54 A;  2DO7 A;  3KET A;  3T8T A;  4ENJ A;  2JZY A;  3QOP A;  2EV0 A;  3ERE D;  1WQ2 A;  3TGN A;  3BPX A;  5FFX A;  4LD5 A;  3J81 K;  4ZYH A;  1ZGJ A;  3BPV A;  4A12 A;  4CIC A;  3R0J A;  4U7B A;  5JI6 A;  1I6X A;  4YFN F;  2DT5 A;  4A5N A;  1BIB A;  1D5V A;  2FBK A;  1FBU A;  1HXD A;  2JSC A;  4UVB A;  1OYI A;  3H3U A;  2CGP A;  2M30 A;  2MBF A;  3FMS A;  3GZ6 A;  4RB0 A;  2RVC A;  4LJZ F;  4GCV A;  3KEO A;  1IZ1 A;  1V4R A;  1SD5 A;  5LHG A;  2VOO A;  4EQQ A;  4HDU A;  1D3Y A;  4NHJ A;  2E7X A;  2PQ8 A;  1WWX A;  2KIF A;  2JTV A;  3FF5 A;  1OPC A;  1OR7 A;  2NAZ A;  2LF8 A;  1TW2 A;  1Z1D A;  5A2Q K;  3IWZ A;  4FX4 A;  2K27 A;  3WGH A;  1ZAO A;  2JPB A;  2ZME B;  3N4M A;  3U2R A;  4AWX B;  2V6C A;  5HS8 A;  1XGN A;  3T5X A;  3ZPL A;  1J59 A;  2Z3Y A;  1P4A A;  1WKM A;  3M9A A;  4HQM A;  4IHS A;  1ZAR A;  3FXQ A;  4YFK F;  1OKR A;  2KJC A;  4G6Q A;  4NQW A;  1U8R A;  2L3D A;  1R00 A;  4L18 B;  1QGP A;  2R7F A;  1YS6 A;  4M72 A;  2F5D A;  1IUY A;  2L01 A;  4I7H A;  1J2X A;  3RDI A;  2K02 A;  2RDP A;  2E7W A;  2E1C A;  2EA2 A;  3CO7 C;  4ESB A;  2K86 A;  3J81 Z;  4HX4 A;  3GW2 A;  3MFK A;  4GO1 A;  4XRF A;  2HZT A;  2A3S A;  4RGR A;  3DQV C;  1S6L A;  4MGR A;  5EEH A;  1WSU A;  3V8J A;  4WXH A;  5LEJ A;  4U0Y A;  3M8F A;  3BJO A;  4RS8 A;  4RAZ A;  4XLN F;  1TNS A;  4MQV A;  1GHC A;  1SMT A;  2EFW A;  2H6B A;  4KA4 A;  4UV8 A;  4Q48 A;  2KRF A;  4Y15 A;  1Q1H A;  3L9F A;  5K5Q A;  1LQ1 A;  2OU2 A;  2ZKZ A;  3T1B A;  4EJW A;  3HSR A;  3F8N A;  1SFU A;  4OOI A;  4M9X A;  2VBZ A;  4AIH A;  5LBQ A;  3TOB A;  3JTH A;  4KIC A;  4CYD A;  2H09 A;  2UXX A;  3KP4 A;  3IWF A;  2DK5 A;  2M5W A;  3DPT A;  1JHH A;  1B59 A;  1E17 A;  5DD4 A;  1DPU A;  1XDU A;  1B4A A;  4G6D A;  1REP C;  1H9G A;  4YII A;  2FNA A;  4LK0 F;  1MKM A;  1OYY A;  2PI0 A;  3F72 A;  1W7P D;  3I4P A;  5DYM A;  3JSO A;  3IRR A;  2RNJ A;  2MA3 A;  2OZU A;  2BE5 F;  1Z6T A;  4MEX F;  3HSE A;  4O6J A;  1R1V A;  1BC8 C;  1OYW A;  3GLX A;  2CWE A;  5FFZ A;  6PAX A;  1FSE A;  1J5Y A;  4F7Z A;  3CO6 C;  1FYL A;  1IAW A;  2Y75 A;  2W24 A;  5HS9 A;  3QU3 A;  3LA3 A;  4N9I A;  3J80 K;  1R1T A;  4PGH A;  1IF1 A;  1XGS A;  1CF7 A;  3M8E A;  3T0Y A;  3TO7 A;  4EMS A;  1IN6 A;  2HGC A;  2TDX A;  1MGT A;  2FMY A;  3ISP A;  3R60 A;  4P9F A;  4P9U A;  2IA1 A;  5LEK A;  2Q0O A;  1IXC A;  3I5U A;  2A68 F;  1R5H A;  5IT3 A;  2EWN A;  4L9V A;  5D8L B;  1EH7 A;  1FSH A;  1K79 A;  2XIG A;  2JRT A;  2XV4 S;  3BZ6 A;  3GUD A;  1HKT A;  5AON A;  1T6S A;  1J0R A;  2OBP A;  2YU3 A;  2F2E A;  4HV6 A;  4CDG A;  3FMQ A;  3IKT A;  3E3V A;  3ZMD A;  1IXR C;  4AD9 A;  1UB9 A;  1GXQ A;  2UXN A;  5HS7 A;  3VOE A;  3U1D A;  2LSO A;  2HYF A;  1RI7 A;  2HKX A;  3ZQ7 A;  4LB5 A;  4BH9 A;  1YG2 A;  4IXA A;  1USS A;  5E1W A;  3RTR A;  1KGS A;  3B73 A;  4KMU X;  4Q4Z F;  4XSZ F;  3AAF A;  1CGP A;  3F3X A;  5D6E A;  2F5F A;  5LLQ A;  4LLL A;  4HBL A;  3ZMZ A;  3TQN A;  1TNT A;  1ON1 A;  3T8R A;  4ZYD A;  3VFZ A;  1R7J A;  3F6V A;  3LQQ A;  3WE2 A;  1ONV A;  1P4X A;  4I01 A;  1BC7 C;  1HSJ A;  5JHU A;  2G7U A;  1CF7 B;  3V8L A;  5KVR A;  4MNU A;  1SFX A;  1MDM B;  1U5T A;  2FBI A;  3EUH A;  2OQR A;  4UNO A;  2PBI A;  4ESJ A;  3LAJ A;  3I59 B;  5HOO A;  2D45 A;  1AOY A;  1YW7 A;  4KFC A;  4U0W A;  1YO5 C;  3J80 Z;  1S7O A;  1HBX G;  4OMY A;  2L4M A;  4IJA A;  1ZN2 A;  3WTW C;  3IL2 A;  3K2Z A;  5LGT A;  4M6X A;  3ZMU A;  1P2F A;  1ZLJ A;  2ESN A;  2GXB A;  5K5O A;  1LDJ A;  2ZNZ A;  3JTG A;  2MLK A;  4QLC U;  4N9H A;  3K69 A;  4A0Z A;  5BOX A;  5ILU A;  2YPR A;  2F5E A;  5E8G A;  3WTY C;  1F9N A;  2QQB A;  3C7J A;  1GVJ A;  1T98 A;  3WTX C;  2P7V B;  3K1M A;  2EFQ A;  3KP3 A;  4KIF A;  4OIQ F;  2H94 A;  3J7A O;  5D5V B;  3BY6 A;  4QWQ A;  1J7K A;  3O6B B;  3QU6 A;  2CFX A;  2FBH A;  3SQN A;  5DCM A;  1KQ0 A;  4EM0 B;  1O3Q A;  5DCF A;  2RN7 A;  1XCV A;  4MHG A;  2VBX A;  2JT1 A;  3L7W A;  4CZZ A;  5HVQ C;  3NRV A;  4UXN A;  4IRH A;  3D5L A;  3GO5 A;  3RIR A;  5ICC A;  1FNN A;  2IPQ X;  2P5K A;  1I27 A;  5FLX K;  1A04 A;  2DI3 A;  5K1Y A;  2EV5 A;  4HQE A;  4L9T A;  1FOK A;  1BI0 A;  3R61 A;  1B1B A;  2FRH A;  3R0A A;  2VN2 A;  2STT A;  1YLF A;  3LA7 A;  5CVV A;  5ED4 A;  3WTU C;  4IRI A;  1G3T A;  3E5X A;  1U5T B;  5FB2 A;  5E18 F;  2DQR A;  2EFO A;  3I0T A;  1L3L A;  1GXP A;  2UZK A;  4A5M A;  1UST A;  1S7A A;  1IN8 A;  2GAU A;  4IRG A;  2ADU A;  4MTE A;  2XKP A;  3BWG A;  1T39 A;  4CHU A;  2EK5 A;  4M73 A;  1ZRD A;  2CO5 A;  4FT8 A;  4I98 B;  4LFU A;  3QPT A;  3VOD A;  5E1Z B;  1JGS A;  1P92 A;  4RB1 A;  3HRM A;  5KK1 A;  2LKP A;  1UHM A;  4KUM A;  3HSF A;  5DUK A;  3LA2 A;  4I0B A;  4G7Z F;  1U5T C;  1R5G A;  5ILV A;  1XMK A;  2ZFW A;  2Q8K A;  3ZMS A;  4NB5 A;  4BYY A;  2K4J A;  4UUV A;  4EM1 A;  3S2W A;  3FXU A;  2DBB A;  2M8E A;  5E8I A;  3MCZ A;  3TKY A;  1LDD A;  2MD5 A;  3TOA A;  1B9M A;  4EJO A;  1BI2 A;  2NNY A;  1BIA A;  4MEY F;  3EQL F;  3DF8 A;  2VT2 A;  1QZZ A;  2QWW A;  2GWR A;  5DCM B;  4WCG A;  3BDD A;  1BJA A;  2EJR A;  4GYI A;  2ZJ2 A;  1O57 A;  1FLI A;  3PQJ A;  3Q9V A;  2R3S A;  5D4S A;  5ERI A;  1O7F A;  4M6Y A;  4EM2 A;  1IRG A;  3P7N A;  3V7C A;  2QUF A;  2H27 A;  1KU7 A;  1B9N A;  3CDH A;  3ZN0 A;  1UFM A;  2O0Y A;  3O3K A;  1BBY A;  2PN6 A;  2XRO A;  4KT5 C;  3DP7 A;  3IKV A;  2HTS A;  4BHC A;  1ZHF A;  2Z9O A;  2QBY B;  2FOK A;  1DP7 P;  1YYV A;  1C0W A;  2XAH A;  2XVC A;  2MC3 A;  3CUQ A;  5CVR A;  1J75 A;  3HOS A;  3EDP A;  3KP5 A;  1P4W A;  3G73 A;  1SAX A;  2EB7 A;  4RGS A;  1TQM A;  1YIO A;  4KIG A;  5CVI A;  3WTZ A;  1R36 A;  2NRA C;  1YW9 A;  2M45 A;  1YQA A;  3TO9 A;  3W6J B;  4G94 A;  2D1H A;  2D2W A;  3RPQ A;  1FYM A;  3F8F A;  1DUX C;  2J5P A;  2YSR A;  3FM3 A;  2G9W A;  4YG2 F;  2MH9 A;  1T38 A;  3MEX A;  2BBY A;  1O7L A;  3ECH A;  4BXU A;  3SZP A;  3TDU C;  2DK8 A;  4HV5 A;  1IN4 A;  2GA2 A;  3L2C A;  4OIR F;  1YFH A;  2HOE A;  3DEU A;  2DAO A;  1HW2 A;  3QRF F;  5DDG A;  1XMA A;  3RPU A;  5L3B A;  2VBW A;  3FHZ A;  4BHB A;  2WTE A;  1TTY A;  2P4W A;  3HTU A;  1KU3 A;  4K2E A;  5CVU A;  1Z05 A;  4KNY A;  3GFM A;  3KP2 A;  5A2Q Z;  5CLS A;  3CJN A;  5HDK A;  5LRS A;  1LNW A;  5JFR A;  1BI1 A;  4HX7 A;  2HS5 A;  2ZBK A;  3R4K A;  1KQ9 A;  2W25 A;  1RNL A;  2RKH A;  3JAM K;  5AIP A;  3V8K A;  1I5Z A;  5L3D A;  3ZMT A;  4Z2Y A;  3GZ5 A;  1HQC A;  4O5V A;  2VT3 A;  4P5O A;  1F5T A;  3I53 A;  1AWC A;  3CUQ B;  1ZG5 A;  4E70 A;  4WK8 F;  3EYY A;  4HDV A;  4HF0 A;  1UCR A;  5J8F A;  4U88 A;  2OA4 A;  1XCB A;  1KU9 A;  1ZG3 A;  2AXL A;  1G6N A;  3RJP A;  5BQT A;  3B02 A;  1O3S A;  3FMR A;  3E6D A;  3M7G A;  5ILS A;  2P6S A;  1YTY A;  3EYI A;  4ZZL A;  1MDM A;  3CUQ C;  4G8X A;  1ZRF A;  2IP2 A;  3I59 A;  4R1H A;  4MQ9 F;  3K1N A;  3KEQ A;  2BYV E;  4U7D A;  5F1R A;  4HYE A;  4ETS A;  4OU0 A;  2O3F A;  3ML6 A;  3CLO A;  2BEO A;  2CSO A;  1F4K A;  3JSP A;  4LMY A;  5CVJ A;  3RKX A;  2YX4 A;  4JK1 X;  2ACJ A;  4EV0 A;  4S04 A;  3F21 A;  2QLZ A;  1TQI A;  2QQA A;  4GYG A;  2DQL A;  3HHH A;  1W5S A;  1MZB A;  2R7D A;  1XD7 A;  1LVA A;  2CW0 F;  2LDU A;  2VXZ A;  4UVA A;  5HDN A;  3EET A;  4PGG A;  2FML A;  1FP1 D;  3ZN1 A;  2EFP A;  2HWV A;  1J9I A;  4ENM A;  1JE8 A;  4A6E A;  2EFN A;  2DTR A;  3QP5 A;  2VC1 A;  1S29 A;  4KYW A;  3I71 A;  3SZT A;  2DPD A;  3JAM Z;  2CG4 A;  1T0F A;  1XGO A;  2V1X A;  3V7S A;  2QVO A;  1HKQ A;  1JHF A;  5TRD A;  2ISZ A;  4PCQ A;  1FT9 A;  4TV7 A;  2K7L A;  5D5W B;  4Q5S F;  2CYY A;  2IJL A;  5F6F A;  1P6R A;  3BOQ A;  1U2W A;  3HHG A;  2HTJ A;  5HLG A;  4KN7 X;  3KLO A;  3SFZ A;  2HQN A;  4Q47 A;  1S8N A;  3OOP A;  3FWE A;  5E17 F;  5JVT A;  2A69 F;  3GYH X;  4B09 A;  3DPL C;  2RC4 A;  1KU2 A;  4JQF A;  4IVN A;  3TO6 A;  4N0B A;  2VBY A;  1S3J A;  2ZO4 A;  1DPR A;  4KN4 X;  2UWM A;  4XSX F;  1HW1 A;  2Z99 A;  4WWC A;  4M71 A;  1FWZ A;  4ENK A;  2PLY A;  2CQK A;  1IN5 A;  4HF1 A;  2GXG A;  3F6O A;  4LB6 B; 
#chains in the Genus database with same CATH topology
 2PMU A;  4HX8 A;  2LRD A;  3V7R A;  1KYW A;  2HVR A;  4D0P A;  3LOC A;  2HR3 A;  5HOD A;  3RYR A;  2LKX A;  2HDD A;  1T95 A;  1ACI A;  2Q1Z B;  3WG9 A;  2BZT A;  3F22 A;  3DFG A;  2Q2E A;  1UZC A;  5LRR A;  1H0M A;  1G59 A;  2EV6 A;  4DQ2 A;  4LGW A;  3WU0 A;  3JRF A;  4L5I A;  3ONQ A;  4G9Y A;  1ORK A;  1WVR A;  2HZD A;  3O2P E;  3S15 J;  1I1S A;  1KQ8 A;  1Y8Q B;  4XOR A;  4M9S A;  2V1U A;  5KNL A;  4RAY A;  4JX6 A;  2BGC A;  4DW6 A;  2IA2 A;  3S16 J;  1ZRC A;  4AUX A;  3IH2 A;  2XAQ A;  5C3E J;  3PO3 J;  9ANT A;  4HLX A;  3B6A A;  2LNB A;  3CCV I;  1OQY A;  2NS0 A;  1K78 A;  2MYS A;  1MJA A;  2ELH A;  1SAU A;  4CGZ A;  4NBQ A;  3SXY A;  4HW0 A;  3H5R A;  2JWT A;  3KYD B;  3H0D A;  1QVU A;  3K0L A;  1IRZ A;  1LDK B;  5E3M A;  4NUB A;  3H9J A;  3GX4 X;  3PNY A;  2Y0S N;  2ME6 A;  1HKS A;  4A3D J;  2FF4 A;  4XQF A;  3ABU A;  3H92 A;  1QVT A;  3MKL A;  4UV9 A;  4XOT A;  2EH3 A;  3W3C A;  4YFX F;  4XON A;  4WXC A;  1OCO H;  1ZK8 A;  2QEN A;  2QA4 I;  2ICW G;  4O3M A;  4UUS A;  2QKM B;  2V9V A;  2X6W A;  2DFH A;  2WAD A;  2DOA A;  3GFL A;  3L09 A;  2Y48 A;  2X0L A;  4G7H F;  2XHK A;  5DV5 A;  3QAH A;  4BUP A;  1R22 A;  5DD8 A;  2JA8 J;  5CKT A;  4WX9 A;  2BW3 B;  3HGY A;  1W4M A;  1R1U A;  4BAY A;  4AU7 A;  5B66 C;  5CPR B;  1QRY A;  1W7P A;  3L2V A;  3K70 D;  1MSE C;  5FGM A;  5TJJ A;  1QZY A;  4IHT A;  4ON0 A;  4UHT A;  5ICE A;  3G1O A;  3H3Z A;  2XAG A;  1VQO I;  3PQK A;  2HKO A;  1E0E A;  3Q0W A;  3WTS C;  3RYP A;  4AVP A;  3EUA A;  1X1D A;  2A6H F;  1TWC J;  1Z91 A;  4D9J A;  2YX7 A;  2ECB A;  2GOX B;  2NYX A;  4XKC A;  2HYG D;  1SFE A;  2L9S A;  2OAZ A;  1IRF A;  1DQU A;  1R5I D;  1UEL B;  3L00 A;  1W5T A;  2CS3 A;  2V9P A;  1T0F C;  2QBY A;  4DNC A;  5IOZ A;  3F8C A;  2V1D A;  4HA8 A;  3GCM A;  2K9S A;  2XAF A;  2WC2 A;  1BOA A;  1GV2 A;  4IO9 F;  2G0E A;  4ABZ A;  3G3Z A;  4AC0 A;  3GFJ A;  1WGX A;  4ANJ A;  4XM3 A;  2M34 A;  3WTT C;  1NK2 P;  3FM5 A;  5IP6 A;  2R92 J;  4DZP A;  4A3C J;  2R7S A;  2W57 A;  2N8G A;  5EGO A;  5FRN A;  2Y0M A;  1VQL I;  4JOM A;  3BG3 A;  3KE2 A;  2DCE A;  2L7Z A;  3DLL F;  3S1R J;  4B1R A;  1RR7 A;  1X58 A;  2H6C A;  2DFI A;  5HDG A;  4F92 B;  4J01 A;  4EGY A;  2W1O A;  2RGV A;  2Q2E B;  2L4A A;  4XRS G;  5D6F A;  3OYF A;  3HB9 A;  2GA1 A;  1O3T A;  5E3O A;  3M07 A;  1U6G A;  3ABL H;  1Y0N A;  2DJN A;  5J6X A;  4BAC A;  2QSG X;  3RKY A;  1YS7 A;  2VOD A;  4HPQ A;  4HOB A;  2VL8 A;  3CCS I;  2FEZ A;  4GXO A;  4PJL A;  4LG0 A;  1B6A A;  1I1G A;  2WWY A;  1DGR M;  3COA C;  2FQ3 A;  3I58 A;  2VJJ A;  4ZYA A;  4CO8 A;  3LSM A;  1D8K A;  1MJ9 A;  2KJB A;  2CFO A;  4L5J A;  1TBX A;  4XLP F;  3NWT A;  3JRA A;  1K78 B;  1TLH B;  1X1P A;  2DT7 B;  2IGK A;  3ZXS A;  2IS2 A;  2XF7 A;  2R7Z J;  3H36 A;  5IT9 K;  5CQE A;  1FZP B;  2DU9 A;  2W85 A;  1R4N B;  2Y31 A;  3HTS B;  2TRT A;  2XAS A;  2O61 A;  4ZTJ A;  3FK6 A;  4C3H J;  2P5V A;  1EA3 A;  2HEO A;  3F8B A;  4JX4 A;  1STZ A;  1I50 J;  3QP6 A;  4GDF A;  2E1N A;  2MW8 A;  2IA0 A;  4KIT B;  2H1K A;  4PUS A;  2OQG A;  1QPM A;  4M9Z A;  4Y13 A;  1LJ9 A;  2Y0S A;  4DGW B;  5LGU A;  4ZDL A;  3CUO A;  2IS4 A;  4UUS B;  3HXL A;  1JXS A;  4ZC3 A;  1BN5 A;  2LP0 A;  4RLF A;  1RRJ A;  1JTX A;  4BE0 A;  1HC8 A;  1SD7 A;  5EZG A;  5GPC A;  2HOS A;  3E6C C;  1R58 A;  3HZJ A;  4ZDP A;  2M8G X;  2ISY A;  1S5L C;  2JQ7 A;  3HOZ J;  2R7V A;  4BQO A;  1SD4 A;  1W7P B;  2CQ7 A;  2OCC H;  3MZH A;  1PP7 U;  2K3P A;  5LHI A;  2KKO A;  3K4K A;  4I0A A;  1DU0 A;  1SMY F;  4I09 A;  3FXR A;  2D1V A;  3KP7 A;  2HQR A;  4V19 K;  4MTD A;  2P0W A;  1GDT A;  2DFE A;  1ODD A;  2HQA A;  3HL2 A;  1K7A A;  3W2A A;  1YW8 A;  3WGG A;  5FLX Z;  5LHH A;  4R8H A;  3PIO F;  3FBI B;  3RI4 A;  4BBS J;  1D8J A;  3P9C A;  4D1Q A;  4B43 A;  4CSW A;  2RQP A;  1GT0 C;  2ESH A;  2XPU A;  4PK4 A;  2X85 A;  2STW A;  2KPM A;  3AG1 H;  3BR3 A;  1HCR A;  4DIQ A;  3ZQQ A;  2E2J J;  1SC7 A;  4A0X A;  2CUE A;  4BDY A;  2CV0 A;  1FBS A;  3PNV A;  1TWA J;  3C3W A;  5EEG A;  1EH6 A;  4ITV A;  3HOV J;  3GTG J;  3CP8 A;  3MD2 A;  1ZTR A;  4ESF A;  2WB1 N;  3AL0 B;  3FX3 A;  4E6K G;  1TT0 A;  1A36 A;  5EGO B;  1IRX A;  2IRF G;  4IKF A;  2VKH A;  4OIP F;  3HRU A;  1ZGA A;  5ICF A;  3U21 A;  4P55 A;  1W0U A;  2X51 A;  4YIF A;  3MKZ A;  2FU4 A;  4MIM A;  3KZY A;  1U9O A;  2Y9Y A;  1T56 A;  5D4R A;  1Z21 A;  5FO5 A;  3DV8 A;  4PZJ A;  4B8X A;  3WHC A;  2HQ5 A;  4FX0 A;  4EJU A;  3OIP A;  1G3W A;  1Q1V A;  3TW7 A;  1V54 H;  3C18 A;  3N97 A;  2W4S A;  5JHF A;  5KCM A;  4CCK A;  1VND A;  3SHF A;  1N77 A;  2DMP A;  4BEH A;  2M0C A;  1QBJ A;  1UHW A;  2YR2 A;  2C6Y A;  3CF2 A;  2IGO A;  2V6E A;  3E0J B;  4C2M J;  3DEW A;  2JRM A;  3CC7 I;  1VTN C;  3CMA I;  3ASN H;  3E5Q A;  2F4O B;  2EZH A;  4LG0 B;  3S17 J;  1WJB A;  2VKD A;  1Z7U A;  2KL4 A;  2X4H A;  1Y0U A;  2R7U A;  5LFA A;  4FAS D;  2QQ9 A;  4HZF A;  3BRO A;  4EEF G;  2GIZ A;  3WGI A;  1FC3 A;  3AL0 C;  2M1B A;  5E3L A;  3ZRG A;  2I5U A;  2VOP A;  3GFI A;  2CU7 A;  3I4M J;  4PJ0 C;  2XGC A;  4EJT A;  3ABT A;  2ZCW A;  2COM A;  3Q5F A;  5BPD A;  3RZO J;  2VE9 A;  4AM3 A;  2K9N A;  3HOT A;  3LL7 A;  1HST A;  3OY9 A;  4BQQ A;  4EJV A;  1D1A A;  2WY8 Q;  3KFW X;  3WTV C;  2IS1 A;  3W2V A;  1P7J A;  4IHX A;  3CC4 I;  4S05 A;  4P1W A;  4ASN A;  4KDP A;  4ZH4 F;  2AHQ A;  5IT9 Z;  2BV6 A;  3DKW A;  2VC0 A;  2ID3 A;  5TIS C;  2F5C A;  4BL0 B;  3CCR I;  2VON A;  4L0Z B;  3IAM 2;  3BTC A;  1HOM A;  1R23 A;  4HNU A;  3WU1 B;  3ROU A;  4ENN A;  2YUS A;  1NH3 A;  2GZW A;  2MC4 A;  3AFH A;  1LE8 A;  2HVQ A;  2BVM A;  1F1Z A;  2VE8 A;  4XBF A;  3IAS 2;  3V4G A;  2WAF A;  5K5R A;  1UG0 A;  3RKW A;  3PL8 A;  2LKS A;  3F8M A;  1XPX A;  5H2F C;  5JR3 A;  2XGX A;  5HLI A;  3J7Y J;  5J8C A;  1UAA A;  4FE7 A;  4QTR A;  2O6G E;  3H1C A;  1MD0 A;  1OCP A;  2LTP A;  2M4K A;  3W6K B;  3ZOB A;  2RRE A;  2J5O A;  5J40 A;  4IOC F;  5DM7 F;  1G3S A;  4ZYG A;  4NDL A;  2CW8 A;  2FSW A;  4C2T A;  3KZZ A;  5CJ9 A;  1X4O A;  1EH8 A;  4A6D A;  3ECO A;  4IF4 A;  3MMY B;  2VQH A;  1X1C A;  1EV7 A;  5AIQ A;  1XMX A;  5L3G A;  3CDL A;  1XGM A;  4QIW N;  2VPR A;  4OWR B;  3G71 I;  2PEX A;  2FXA A;  1HDD C;  4IHV A;  4DOZ A;  1K6O A;  2BVL A;  4MFE A;  1IXS B;  1NK3 P;  4A0Y A;  3HYI A;  2VPL A;  4HAM A;  2Z33 A;  4UUT A;  3MN2 A;  1TZL A;  3OYH A;  2QCO A;  3IV5 A;  2BHZ A;  4CXF A;  5D5X B;  1LEB A;  1A6Q A;  1WJC A;  2B0L A;  3AKZ A;  4EGZ A;  1P7I A;  5EG0 A;  3QOD A;  3K7A J;  4XR6 A;  3I3L A;  3HUG A;  3ZQH A;  2LFB A;  3CLQ A;  4DJA A;  1L0O C;  4RAF A;  2XRN A;  2WB1 A;  4WXD A;  3F23 A;  2P8T A;  5H6R A;  4IHW A;  1RKT A;  5H6Q A;  3JW4 A;  5EJC A;  1SD6 A;  4BE1 A;  3TDZ C;  3K4B A;  4BY7 J;  1A5J A;  5BS6 A;  2IAI A;  4AYB N;  2P7C B;  1VI0 A;  3P9K A;  1Y1V J;  5DM6 F;  3KLN A;  1ZG1 A;  2UUZ A;  3PO2 J;  3ULQ B;  1XB4 A;  3U9G A;  4BEH B;  5D8K B;  1FOX A;  4HST A;  3LSJ A;  2DPU A;  1QQI A;  4XN0 A;  2CJJ A;  4KMF A;  3HOU J;  2IT0 A;  1POG A;  5LGN A;  5IY5 H;  1FYK A;  2V26 A;  2FNP A;  2X6O A;  3C2G A;  3IH3 A;  1QA6 A;  1PUE E;  2PMH A;  1ZYR F;  4A2U A;  1XDS A;  3CTA A;  1QZE A;  4FET A;  4Y33 A;  3CCL I;  1RIO H;  3NEU A;  1O3R A;  1YRN A;  3BJ6 A;  2R7Q A;  2E19 A;  2NNN A;  2MSY A;  3ELK A;  4JYK A;  3LSR A;  4PDK A;  1WI3 A;  2L5Q A;  4RGX A;  1RR8 C;  4BNC A;  2MH2 A;  3OV8 A;  2Z5U A;  3HPH A;  2A6E F;  3LNQ A;  3HRT A;  4R79 A;  1BM9 A;  3Q9S A;  1U8B A;  1H9T A;  3QPL A;  4DBR A;  2R7T A;  2QYO A;  1E3H A;  1PDN C;  3WE3 A;  2JA5 J;  1MBF A;  3IC7 A;  1LB2 A;  2A61 A;  4A3E J;  5B3S H;  3E5U A;  3KCC A;  2GBY A;  3HOY J;  4FHT A;  2A5Y B;  2IVM A;  2XPW A;  3RKQ A;  4E7K A;  1QO0 D;  1Z7L A;  1PJR A;  3LFK A;  1IV6 A;  3GVA A;  1LE8 B;  5IYB J;  2Y2Z A;  2FA5 A;  3TW6 A;  4HF2 A;  3GWZ A;  3ZQF A;  2M87 A;  2G7H A;  1VQK I;  2P6T A;  5CYV A;  3FBN B;  4OIN F;  5F0H A;  3LWF A;  4JBA A;  5KHD A;  1JKR C;  1ZH5 A;  4U0V A;  2AS5 F;  4B44 A;  4XOP A;  2L02 A;  1YI2 I;  1TW3 A;  1ENH A;  3NWS A;  3HRS A;  1FX7 A;  1PP8 F;  1RZ4 A;  2XKO A;  4OAZ A;  3BJA A;  2DMN A;  2RAE A;  3DU6 A;  3H5A A;  3QPH A;  4DYQ A;  4RGU A;  1AKH A;  2GXA A;  2DA3 A;  3H0G J;  2L9V A;  1FPQ A;  5L3C A;  1OCR H;  4UVC A;  1AA7 A;  1XSD A;  4C9Y A;  3K4C A;  5ICG A;  3K4J A;  4H0E A;  2KT0 A;  3NAR A;  4LIU A;  1IDZ A;  1JUS A;  1AU7 A;  4YEJ A;  2V79 A;  1WRJ A;  2K3F A;  4GGG A;  1JKO C;  5EG0 B;  2DA1 A;  1VFC A;  1WI9 A;  2HFH A;  2QGU A;  3F9K A;  3OR1 C;  4XRM A;  2PJP A;  2V1N A;  1TQP A;  2EA4 A;  2NVX J;  5D5U B;  3GTK J;  4AIK A;  4RB2 C;  4L9J A;  3J7Z I;  4GRI A;  1ZRE A;  1R71 A;  1KYZ A;  1LEA A;  4N4O B;  3FXJ A;  5DEQ A;  1FY7 A;  1V5F A;  2K40 A;  2MAB A;  2VI6 A;  3GEZ A;  4BQA A;  4IHY A;  5E1X A;  4L0Y B;  2Z1D A;  3D0S A;  4C30 A;  3R6S A;  2KFD A;  2P5L C;  4AYB A;  4LLN A;  4IZZ A;  2JA6 J;  3J7A Y;  3E97 A;  4CCM A;  2KIU A;  2A05 A;  3GF2 A;  1X1B A;  2OF7 A;  3RQI A;  1IW7 F;  2RV8 A;  2R93 J;  1OCZ H;  1KA8 A;  1FTT A;  4L9N A;  2FJ1 A;  3LST A;  3FIS A;  5DUI A;  1T2K A;  3E6M A;  1HLV A;  4HG2 A;  2JJ7 A;  3BG9 A;  1IC8 A;  3ZP5 A;  2WV0 A;  4JX5 A;  5L3E A;  2JPC A;  3M8J A;  2X48 A;  5F1J A;  3SEQ A;  1IN7 A;  5F64 A;  2M0M A;  2A07 F;  3VEP A;  1FP2 A;  4M3G A;  3BT9 A;  5FD6 A;  1QNT A;  5K7H A;  4BJ5 C;  2MLG A;  5BPI A;  1WZ2 A;  1MJB A;  2ETH A;  3REO A;  1CQT A;  3CCE I;  2QM3 A;  1XSX A;  2NVU B;  2O03 A;  4M6V A;  3BP8 A;  4A3K J;  4CCJ A;  4KJZ A;  2O8X A;  2MGQ A;  3I54 A;  3PFI A;  2DW4 A;  2CV2 A;  4E4H A;  1D0Z A;  5L3F A;  1XSV A;  5HLH A;  1FBQ A;  2VB6 A;  4XN3 A;  1ZKG A;  4BHP A;  2GIV A;  3CCJ I;  3CJT B;  3KP6 A;  1OMI A;  1EF4 A;  5E20 A;  2PFB A;  4XKB A;  1G4D A;  4XLC A;  2LF7 A;  1RUN A;  3ABM H;  3A01 B;  2RQQ A;  1SFO J;  2W84 A;  4OIO F;  2W00 A;  1LUJ B;  3C1D A;  5FKL A;  2GM4 A;  3CMM A;  3GXO A;  4EVI A;  1WH7 A;  3D5R C;  2WA0 A;  3BZC A;  2PG4 A;  4Y17 A;  1ZLK A;  1IUF A;  3GLL A;  3DXJ F;  1V3F A;  3K1P A;  2ZNY A;  5BNG A;  3HDD A;  3MAJ A;  4OMZ A;  4ZYE A;  2E34 A;  1ULY A;  4HLY A;  5FKO A;  4G7O F;  1Z9C A;  4AIJ A;  3OYB A;  1TP4 A;  1AKH B;  4H4K C;  2OD5 A;  1U3E M;  2KIM A;  3V42 A;  1WJF A;  5H20 A;  1BI3 A;  3RPU D;  3NQO A;  3CCM I;  5BMZ A;  2JSP A;  2ZSH B;  3IHU A;  3MQ0 A;  3LAP A;  4I02 A;  4WF2 A;  3WOD F;  2OPT A;  3FZV A;  1NHA A;  1MNM C;  2DLL A;  4I2O A;  1T08 B;  1LFB A;  2XAJ A;  2XUB A;  3OIQ A;  1DDN A;  2QZ8 A;  2R7W A;  3CQZ J;  3QQA A;  2NVT J;  3O8G A;  1RPW A;  2HDC A;  1HW5 A;  3Q0V A;  4I6Z A;  4B47 A;  4P96 A;  4ZZD A;  1RUO A;  1XN7 A;  1VF9 A;  2B63 J;  4LK1 F;  3HIF A;  2EQR A;  4IPA A;  3VB2 A;  2COB A;  2E1O A;  1K4T A;  5F08 A;  4M74 A;  3I64 A;  3HGG A;  3MWM A;  2ZME A;  3ZMV A;  3IRQ A;  2HDW A;  3LQR A;  1U78 A;  3H9G A;  3M1E A;  2HOT A;  3E6B A;  1X3U A;  5K7F A;  2VKE A;  2M4G A;  4LLG F;  1WJD A;  4X1E A;  1Z6R A;  1W36 C;  3JRC A;  3P9I A;  3LSP A;  2F4M B;  2FE3 A;  4A3G J;  4KIB A;  4CYC A;  5FD5 A;  4RB3 C;  3L2Q A;  1Y6I A;  1G3Y A;  1I3Q J;  1ON2 A;  3IH4 A;  3VSL A;  2OZ6 A;  3MZY A;  3G2B A;  1MIJ A;  1QU3 A;  1JKP C;  2ZXJ A;  2K4B A;  2Z2S B;  1E2X A;  2ECC A;  2IW5 A;  3P5J A;  3K9T A;  5J47 A;  1MMA A;  2GQQ A;  2L54 A;  2DO7 A;  3KET A;  2AQE A;  3T8T A;  4ENJ A;  2JZY A;  2X6X A;  3QOP A;  2NS8 A;  3OYK A;  2EV0 A;  3ERE D;  3DLA A;  1ETW A;  1WQ2 A;  2XF5 A;  2BOL A;  2VUM J;  3TGN A;  3BPX A;  5FFX A;  3JRE A;  2ZC2 A;  1AOY A;  4LD5 A;  3J81 K;  4ZYH A;  4HEA 2;  1ZGJ A;  3BPV A;  3IP4 B;  4A12 A;  2GOM A;  3K4N A;  3R0J A;  4CIC A;  4DZJ A;  4CCO A;  4U7B A;  2HXO A;  5JI6 A;  2OCE A;  3TP0 A;  1I6X A;  4YFN F;  1J09 A;  2DT5 A;  1X2M A;  4A5N A;  2CW7 A;  3CD6 I;  1T33 A;  1BIB A;  1EJ9 A;  1MBJ A;  1K61 A;  1D5V A;  2FBK A;  2DA5 A;  5IP7 J;  1RES A;  2DT6 A;  1FBU A;  1HXD A;  2Y30 A;  2Z16 A;  2JSC A;  4UVB A;  2I8D A;  1IGN A;  3A0B C;  3OS0 A;  2IS6 A;  3JRB A;  1R4M B;  1OYI A;  3H3U A;  2CGP A;  2M30 A;  3B6C A;  3OSG A;  4Z6Y A;  1JJ8 C;  4CZC A;  3S8P A;  2MBF A;  3KPH A;  3FMS A;  1UMQ A;  4RB0 A;  3GZ6 A;  1Y8R B;  3GME A;  2RVC A;  2E60 A;  3KYL A;  4LJZ F;  1Z0X A;  2KP6 A;  2XSJ C;  4GCV A;  3KEO A;  1IZ1 A;  3A0H C;  1V4R A;  1LFU P;  1SD5 A;  4CH7 A;  5F04 A;  5LHG A;  3CP2 A;  4BXF A;  2VOO A;  5J3L A;  4EQQ A;  2XF6 A;  3CCY A;  4HDU A;  3SFI A;  4GFB A;  3ZQG A;  1D3Y A;  4NHJ A;  2E7X A;  2HNH A;  2PQ8 A;  4RBO A;  1WWX A;  2KIF A;  2JTV A;  3FF5 A;  1OPC A;  1OR7 A;  2E5Z A;  4E7L A;  5M3F J;  2NAZ A;  2TCT A;  1UG2 A;  1TWG J;  2LF8 A;  4D7M A;  4UY8 I;  3OL4 A;  3L1P A;  2L9R A;  2MFZ A;  1TW2 A;  2PX9 A;  3G1L A;  1Z1D A;  5A2Q K;  3IWZ A;  2HVS A;  5IYD J;  4FX4 A;  2K27 A;  4FIS A;  3MKW B;  2CH0 A;  3WGH A;  1ZAO A;  2JPB A;  3GTM J;  2ZME B;  1W0T A;  4PSX A;  3N4M A;  3U2R A;  3HG9 A;  4RMN A;  3H5N A;  2CQX A;  2EIN H;  2LYC A;  4J00 A;  1B72 A;  5GP9 A;  4AWX B;  2V6C A;  4MO7 A;  5HS8 A;  1XGN A;  4M3D A;  3T5X A;  1U0J A;  3ZPL A;  3TL4 X;  3HOX J;  4CYC B;  1IJW C;  1J59 A;  2EBI A;  2JVH A;  4Y7N J;  1X19 A;  1IV8 A;  1MBE A;  2XC7 A;  2Z3Y A;  1P4A A;  1WKM A;  3BCA A;  3M9A A;  4HQM A;  4ZDO A;  1FMW A;  4M3F A;  4IHS A;  2E1M B;  2OTL I;  1ZAR A;  3FXQ A;  1NG7 A;  4FQG A;  1OKR A;  4YFK F;  2KJC A;  5GPA A;  1MBH A;  4G6Q A;  2XRL A;  4NQW A;  3L2W A;  1U8R A;  4I99 C;  4NNJ A;  2L3D A;  1R00 A;  2ZME C;  4L18 B;  1QGP A;  3OYE A;  2R7F A;  1YS6 A;  3HPG A;  4XMY A;  2R5Z B;  5EDN A;  3PSI A;  4M72 A;  2F5D A;  1IUY A;  2L01 A;  1WPK A;  4I7H A;  1ETY A;  1MNE A;  1FMV A;  3JRG A;  1J2X A;  2ZXH A;  3CME I;  3RDI A;  3VWB A;  2K02 A;  2RDP A;  3WG7 H;  1VZ0 A;  2BY2 A;  2E7W A;  2EZK A;  2E1C A;  4D5C A;  2EA2 A;  4ESB A;  3CO7 C;  1WJE A;  3C2H A;  3DBH B;  2K86 A;  1SVM A;  2DYS H;  2IEK A;  4HX4 A;  3J81 Z;  2E1M C;  3SYT A;  3GW2 A;  3OYD A;  4L5E A;  4GO1 A;  3MFK A;  2ZJR F;  1PUF B;  3HJE A;  1A35 A;  3BCB A;  3QOE A;  4XRF A;  2HZT A;  3W2W A;  2A3S A;  4RGR A;  1VQ7 I;  1F43 A;  3DQV C;  1S6L A;  4MGR A;  2X6Y A;  1X4P A;  5EEH A;  2Y69 H;  1WSU A;  3V8J A;  4WXH A;  1SVL A;  1WHU A;  5LEJ A;  2CUF A;  4U0Y A;  2VJI A;  2CMP A;  3M8F A;  4E7H A;  2BHY A;  3RZD J;  3CCQ I;  3BJO A;  4RS8 A;  2X9D A;  4RAZ A;  3G4S I;  4XLN F;  3S1M J;  1TNS A;  4MQV A;  1GHC A;  3RQ4 A;  2HPI A;  1SMT A;  2EFW A;  1MBG A;  2H6B A;  4KA4 A;  2OJE D;  3DTI A;  5KAI C;  4E7J A;  4II2 A;  5C4J J;  2XSD C;  3I4N J;  3PM1 A;  4UV8 A;  4KIS A;  1NG6 A;  2DA2 A;  2LC2 A;  4Q48 A;  5E79 C;  1BOB A;  2KRF A;  4Y15 A;  3I9V 2;  1Q1H A;  1PYV A;  3L9F A;  3PUB A;  5K5Q A;  1LQ1 A;  2OU2 A;  3S3N A;  2ZKZ A;  3T1B A;  4EJW A;  2F5V A;  3HSR A;  3TBI A;  3G6E I;  3F8N A;  2Y9Z A;  1EKE A;  2LY2 A;  3SEZ A;  5F0C A;  2LBF B;  1SFU A;  4OOI A;  2F48 A;  4M9X A;  2VBZ A;  2DOD A;  1YIJ I;  1ERD A;  1TWH J;  2XGD A;  1IG7 A;  4AIH A;  2XDV A;  5LBQ A;  3TOB A;  3JTH A;  4BY1 J;  1B72 B;  4KIC A;  2KZV A;  4CYD A;  2H09 A;  2KDZ A;  3A1Y A;  5FRO A;  4XK4 A;  2UXX A;  4EAT A;  3KP4 A;  3IWF A;  2DK5 A;  4CCN A;  3JRI A;  2M5W A;  4QPO A;  1BW5 A;  3DPT A;  1JHH A;  1B59 A;  1E17 A;  5DD4 A;  1OR7 C;  1DPU A;  1RET A;  1XDU A;  2K9M A;  1B4A A;  4G6D A;  1REP C;  1H9G A;  2OTJ I;  4YII A;  2FNA A;  1XG1 A;  3K4M A;  1SAN A;  4MLO A;  2KMU A;  4LK0 F;  2ZSI B;  2OC6 A;  1UJ8 A;  1MKM A;  2VJ5 A;  4NQW B;  4MFD A;  1OYY A;  2PI0 A;  1D1B A;  4BJT A;  2UV1 A;  3F72 A;  4PJN A;  1W7P D;  2KIS A;  2K9Q A;  2KLO A;  3ASO H;  3I4P A;  5DYM A;  2B9S A;  2IBD A;  3JSO A;  3IRR A;  3GBG A;  2RNJ A;  5J4V A;  4UB8 C;  2MA3 A;  3CJQ B;  2OZU A;  3SJM A;  2FQ4 A;  2BE5 F;  4F3Q A;  1Z6T A;  4PJM A;  4MEX F;  3HSE A;  2LY1 A;  4O6J A;  2VQG A;  3OYJ A;  2E2I J;  2EZL A;  4BDZ A;  5K7Z A;  2DN0 A;  1R1V A;  1BC8 C;  1OYW A;  4YRV A;  2R7O A;  1VQ5 I;  3GLX A;  4RAG A;  5J1U A;  3OMY A;  4G6T B;  1FTZ A;  2CWE A;  2HI3 A;  1YOV B;  2HOA A;  2JVG A;  2ELJ A;  1JI8 A;  5B5E C;  5FFZ A;  1GVD A;  1BR2 A;  6PAX A;  1FSE A;  3JRD A;  1J5Y A;  4F7Z A;  3CO6 C;  1FYL A;  1IAW A;  2Y75 A;  2W24 A;  5HS9 A;  2KHM A;  3QU3 A;  5B1A H;  1XS9 A;  4NC8 A;  3LA3 A;  4N9I A;  4LIT A;  1OIS A;  1R1T A;  4PGH A;  3J80 K;  1IF1 A;  1XGS A;  3LSH A;  4PFO A;  1CF7 A;  1QHH D;  3M8E A;  1JT0 A;  1WJA A;  4BXX J;  3T0Y A;  1B8I A;  3TO7 A;  1I39 A;  1IN6 A;  4Y3O A;  2HGC A;  2VQC A;  4EMS A;  2F6C A;  4AVZ A;  2TDX A;  1MGT A;  2FMY A;  2VQL A;  2WBM A;  3ISP A;  3Q0U A;  1D0Y A;  3R60 A;  4M3B A;  4P9F A;  2JA7 J;  1N78 A;  4P9U A;  2IA1 A;  5GTI C;  5LEK A;  1MW7 A;  4E7S A;  3OYM A;  2Q0O A;  3FXM A;  2DXI A;  2JN6 A;  1IXC A;  3I5U A;  2A68 F;  1R5H A;  5IT3 A;  2EWN A;  2L7K A;  1GUU A;  4L9V A;  3VYR B;  2NOJ B;  2W82 A;  5D8L B;  5LD2 C;  1EH7 A;  4CA0 A;  4FTH A;  1FSH A;  4CCL A;  1JJ6 C;  1K79 A;  2XIG A;  2JRT A;  1TC3 C;  2XV4 S;  3A01 A;  2X1D A;  3BZ6 A;  3GUD A;  4S0H B;  1HKT A;  5AON A;  2RNG A;  1T6S A;  5HNH A;  1J0R A;  1K4S A;  5FLV A;  1DP3 A;  2OBP A;  2YU3 A;  3JRH A;  1R9T J;  4QSH A;  2F2E A;  2F4I A;  4F91 B;  4HV6 A;  1IDY A;  3BR5 A;  3DWL E;  4CDG A;  3FMQ A;  3IKT A;  3E3V A;  3ZMD A;  1IXR C;  4AD9 A;  1UB9 A;  1GXQ A;  2DTZ A;  2UXN A;  1BR4 A;  4G12 A;  4A93 J;  5HS7 A;  3VOE A;  1WCM J;  1WH5 A;  2LSO A;  3F6O A;  3U1D A;  3K4L A;  2HYF A;  1RI7 A;  2HKX A;  3CCU I;  4N4N B;  1HF0 A;  3ZQ7 A;  4LB5 A;  3RCO A;  4BH9 A;  1YG2 A;  1K83 J;  1E3P A;  4IXA A;  1USS A;  2LRE A;  4F55 A;  4OAY A;  3W6V A;  3QWL A;  5E1W A;  3RTR A;  1ITY A;  2KRC A;  1KGS A;  3ZR8 X;  3B73 A;  4KMU X;  1I3A A;  4Q4Z F;  4QPQ A;  1W5C C;  4XSZ F;  5FKM A;  3AAF A;  1CGP A;  3F3X A;  5D6E A;  2F5F A;  1OCC H;  5LLQ A;  4LLL A;  4HBL A;  3ZQI A;  3TQN A;  1Z67 A;  3ZMZ A;  5HLT A;  5F27 A;  3K70 C;  3ZQL A;  3GTQ J;  3KX2 A;  1TNT A;  4HNV A;  1YX5 A;  1ON1 A;  3GTP J;  3T8R A;  4ZYD A;  3VFZ A;  3PSF A;  2V7F A;  2ZXI A;  3TED A;  4BU2 A;  4HSR A;  1R7J A;  3BLY A;  2NXN B;  2ZJP F;  1N75 A;  2A6T A;  3F6V A;  3LQQ A;  2DMU A;  3WE2 A;  1ONV A;  1P4X A;  4I01 A;  4ZTF A;  4BJ6 C;  1BC7 C;  1HSJ A;  1Y56 A;  5JHU A;  2G7U A;  2DOF A;  1CF7 B;  2GLO A;  3V8L A;  1MH3 A;  3A4C A;  5KVR A;  3K6G A;  2W7N A;  4MNU A;  4A69 C;  1B8I B;  4V2G A;  1SFX A;  3BTL A;  1MDM B;  1U5T A;  2FBI A;  3EUH A;  4LG3 A;  2JUC A;  1JT6 A;  2OQR A;  4UNO A;  3OYL A;  2PBI A;  4ESJ A;  3LAJ A;  3OR2 C;  1FOY A;  1Y1W J;  3I59 B;  2HXI A;  2B7E A;  5IP9 J;  5HOO A;  2EIJ H;  2D45 A;  2E2H J;  1MBK A;  1WJ5 A;  1YW7 A;  3D1N I;  2W48 A;  4KFC A;  4U0W A;  1YO5 C;  3J80 Z;  1S7O A;  1HBX G;  1BW6 A;  4OMY A;  2WAQ N;  2L4M A;  4XRS A;  3NAU A;  3BQZ A;  1JUP A;  4IJA A;  2LD5 A;  1ZN2 A;  3BTI A;  3WTW C;  3BTJ A;  3IL2 A;  1D5Y A;  1E3O C;  5IOY A;  3K2Z A;  4XLF A;  5LGT A;  2ZFU A;  4M6X A;  3ZMU A;  1VQP I;  1F36 A;  4BKX A;  1P2F A;  3C2B A;  2FUG 2;  1ZLJ A;  2ZXW H;  2R7R A;  2PJR A;  2ESN A;  2GXB A;  2R5Y A;  5K5O A;  2DYR H;  1LDJ A;  4XLA A;  2IGM A;  4YEL A;  2CQN A;  2ZNZ A;  5GAH J;  3JTG A;  4NC7 A;  2ELK A;  2MLK A;  4QLC U;  3ZQC A;  4N9H A;  3HC7 A;  3K69 A;  4A0Z A;  5BOX A;  5ILU A;  3FHN A;  2K9L A;  2F5E A;  2YPR A;  5E8G A;  3WTY C;  3FKJ A;  1F9N A;  2R4G A;  1P9Q C;  2QQB A;  3C7J A;  3OYI A;  3UKG A;  1GVJ A;  1ETX A;  1T98 A;  4PSW A;  3WTX C;  2P7V B;  3K1M A;  2EFQ A;  3KP3 A;  4KIF A;  2NVY J;  3CES A;  4OIQ F;  2BY0 A;  2H94 A;  1VQ4 I;  1Z3Y A;  1KON A;  3J7A O;  5D5V B;  3BY6 A;  1OCT C;  1YX3 A;  4QWQ A;  4M3E A;  1J7K A;  1MH4 A;  2BXY A;  2O9L A;  3O6B B;  3QU6 A;  4RM2 A;  3L2U A;  2CUZ A;  2CFX A;  3DPU A;  3OS1 A;  5TGT A;  2KDO A;  2EPF A;  2FBH A;  3SQN A;  1XX5 A;  5DCM A;  1KQ0 A;  1LFP A;  3AG2 H;  4EM0 B;  1O3Q A;  5DCF A;  2RN7 A;  1XCV A;  4MHG A;  2DFF A;  2BY1 A;  2VBX A;  2JT1 A;  3L7W A;  5J4Y A;  4C3I J;  4CZZ A;  5HVQ C;  3NRV A;  4UXN A;  4IRH A;  3D5L A;  2H1L A;  3GO5 A;  2QF7 A;  1FIA A;  2ZB9 A;  2XGE A;  4RA2 A;  3JCU C;  3RIR A;  5ICC A;  3SDG A;  1FNN A;  2IPQ X;  2P5K A;  1I27 A;  4I76 A;  5FLX K;  1A04 A;  2O7O A;  3S3O A;  4XIC A;  2DI3 A;  4IQ4 A;  5K1Y A;  1BL0 A;  2EV5 A;  4HQE A;  3FK7 A;  4L9T A;  1FOK A;  1BI0 A;  3R61 A;  1B1B A;  2FRH A;  3R0A A;  2IXS A;  2P81 A;  2YU9 J;  2VN2 A;  4XID A;  2FX0 A;  1X2N A;  3MZ8 A;  2FOW A;  2V9K A;  2STT A;  3BR6 A;  1YLF A;  3KIO A;  3OWT A;  4BGD A;  2R0Q C;  2D5V A;  1BJZ A;  2O5R A;  3LA7 A;  5CVV A;  5ED4 A;  3WTU C;  4IRI A;  1G3T A;  1QHG A;  3E5X A;  2WV1 A;  4PJJ A;  1U5T B;  1ETV A;  2JK3 A;  3M4O J;  5FB2 A;  5E18 F;  2DQR A;  2EFO A;  1VQN I;  3I0T A;  1L3L A;  1YJN I;  2WAE A;  2UZK A;  3DKX A;  1GXP A;  1X3Z B;  4A5M A;  1UST A;  3U1K A;  3KEY A;  1S7A A;  2R5Z A;  1IN8 A;  2GAU A;  4IRG A;  2ADU A;  2XAU A;  3HKZ N;  2EIL H;  1S9H A;  3ZCO A;  4MTE A;  3UR3 C;  2XKP A;  3BWG A;  1T39 A;  1ZR2 A;  2WAQ A;  4CHU A;  2EIM H;  2EK5 A;  3KYC B;  2CO5 A;  3CDI A;  4FT8 A;  4I98 B;  4LFU A;  3FXO A;  4M73 A;  1ZRD A;  2OV7 A;  3QPT A;  3VOD A;  5E1Z B;  3GTO J;  3S93 A;  1JGS A;  1P92 A;  4A3F J;  4RB1 A;  3DBL B;  3HRM A;  5J1Y A;  1VQ8 I;  2LKP A;  5KK1 A;  2PJR B;  3K10 A;  2R5Y B;  1TWF J;  1ZEL A;  4A3M J;  1PUF A;  1UHM A;  3A03 A;  4KUM A;  1JGG A;  1MMG A;  3OS2 A;  3HSF A;  5DUK A;  3LA2 A;  4I0B A;  4G7Z F;  2DDA A;  1U5T C;  3EUH C;  1JTY A;  3LSK A;  1R5G A;  5ILV A;  3AG4 H;  1XMK A;  2ZFW A;  1ZR4 A;  2AQF A;  1IO2 A;  2Q8K A;  3ZMS A;  4NB5 A;  1M1E B;  4BQN A;  4BYY A;  1FEX A;  2K4J A;  3M1C A;  4UUV A;  4EM1 A;  3S2W A;  3FXU A;  2DBB A;  5C44 J;  3A02 A;  1XC5 A;  3S3M A;  1G8X A;  3CC2 I;  3QYB A;  2M8E A;  5E8I A;  3MCZ A;  2O8K A;  3TKY A;  5IYC J;  1LDD A;  1W1W E;  3PIP F;  2MD5 A;  2E5N A;  3TOA A;  1B9M A;  4EJO A;  1BI2 A;  3WU2 C;  1ZGW A;  2NNY A;  1BIA A;  4MEY F;  3EQL F;  2L9N A;  3OOU A;  2EIK H;  3DF8 A;  3FXL A;  1R49 A;  2JMW A;  3L2R A;  2VT2 A;  4B3A A;  2VLA A;  1N25 A;  1A6I A;  1QZZ A;  5M3M J;  2QWW A;  1H8A C;  2GWR A;  5DCM B;  4F52 A;  2VXD A;  4WCG A;  5FLM J;  2I10 A;  3BDD A;  1BJA A;  2CQQ A;  4HRI A;  2LR8 A;  2EJR A;  4GYI A;  2EZI A;  2ZJ2 A;  3BG7 A;  3LSG A;  4CUG A;  1FIP A;  2LBF A;  4IOA F;  1D1C A;  5HNF A;  1APL C;  2MD0 A;  1X3W B;  4XKW A;  1O57 A;  1FLI A;  2HU9 A;  1UHS A;  3IUO A;  2VAS A;  5M5Y J;  1S7E A;  2DMT A;  2X1C A;  1LKX A;  3PQJ A;  3Q9V A;  2R3S A;  3ABK H;  3DEE A;  2XPV A;  3VPR A;  5D4S A;  1V5E A;  5ERI A;  1OJL A;  1O7F A;  3BR1 A;  4M6Y A;  4EM2 A;  1IRG A;  1WFX A;  3P7N A;  3V7C A;  1W36 D;  2QUF A;  2H27 A;  1KU7 A;  4W97 A;  1B9N A;  3ERM A;  1YJ9 I;  3CDH A;  3ZN0 A;  1S72 I;  1BA5 A;  3GTL J;  1UFM A;  4B4C A;  2O0Y A;  4A3L J;  4IEJ A;  4KT6 A;  4X6A J;  3O3K A;  1BBY A;  2PN6 A;  2DA6 A;  4XL9 A;  2XRO A;  4KT5 C;  3DP7 A;  3AG3 H;  3IKV A;  2HTS A;  1DGW Y;  4BHC A;  3S1Q J;  1ZHF A;  2Z9O A;  2QBY B;  3GZN B;  2FOK A;  1DP7 P;  4E7I A;  3E1S A;  2QSF X;  3G1M A;  1YYV A;  2VKV A;  1C0W A;  2XAH A;  2XVC A;  2MC3 A;  5CQG A;  3WHB A;  1MMS A;  3CUQ A;  2LMD A;  2LH9 A;  1X1A A;  3HBL A;  3Q3S A;  2K5C A;  4W1U A;  1Z77 A;  3HM5 A;  5CVR A;  1J75 A;  3HOS A;  3EDP A;  3KP5 A;  1Z3X A;  1SVO A;  1G2H A;  3HKZ A;  1P4W A;  3G73 A;  2DDB A;  4DYC A;  1SAX A;  2AXT C;  3FIW A;  1FOW A;  3VDX A;  2EB7 A;  4RGS A;  1TQM A;  5F0F A;  3CF5 F;  4A3I J;  3PFY A;  3HEF A;  3S1N J;  1YIO A;  1ETQ A;  4KIG A;  5JLX A;  3I55 I;  4PFP A;  3OYG A;  5CVI A;  2KIQ A;  3OYA A;  3WTZ A;  1R36 A;  2NRA C;  1YW9 A;  1PVE A;  3K2A A;  2M45 A;  3VSK A;  5KAF C;  1YQA A;  2M2E A;  3TO9 A;  1GLN A;  2MG4 A;  3DTE A;  1U9N A;  3W6J B;  4G94 A;  2D1H A;  2D2W A;  2LOO A;  1HA8 A;  3D5S C;  3RPQ A;  1FYM A;  3F8F A;  1DUX C;  2J5P A;  4JP0 A;  1DU6 A;  2YSR A;  3FM3 A;  2G9W A;  4YG2 F;  2MH9 A;  5JVG F;  1T38 A;  3MEX A;  4RDU A;  2BBY A;  1O7L A;  3ECH A;  4BXU A;  3SZP A;  3LFU A;  5J1R A;  3TDU C;  2DK8 A;  1RKW A;  4HV5 A;  1IN4 A;  2GA2 A;  3L2C A;  5C4X J;  3QYF A;  5E3N A;  2QEX I;  4OIR F;  1YFH A;  2NVQ J;  2A5W A;  2HOE A;  3DEU A;  2DAO A;  1HW2 A;  2XB5 A;  3CJR B;  3QRF F;  5DDG A;  2NS7 A;  2L2O A;  1OLT A;  1XMA A;  3RPU A;  5L3B A;  4DYR A;  2OUM A;  2VBW A;  4IL6 C;  4YIR X;  4BHB A;  3DKY A;  2WTE A;  1TTY A;  4DBQ A;  3FHZ A;  2P4W A;  3BR2 A;  3DU5 A;  3HTU A;  3LSI A;  1KU3 A;  2JA2 A;  4K2E A;  5CVU A;  1Z05 A;  3LMM A;  4KNY A;  4BBR J;  2XB0 X;  3GFM A;  2V4J C;  3KP2 A;  5A2Q Z;  5CLS A;  3CJN A;  5HDK A;  3MVP A;  5LRS A;  1LNW A;  3BG5 A;  5JFR A;  1BI1 A;  4IQJ A;  4HX7 A;  2HS5 A;  4A3J J;  2ZBK A;  1V55 H;  1AHD P;  3QYE A;  2PMZ N;  3R4K A;  4D7N A;  1KQ9 A;  2W25 A;  1NTC A;  5B1B H;  1QPI A;  1H89 C;  4B48 A;  1RNL A;  2RKH A;  3S32 A;  1GV5 A;  2LK2 A;  5AIP A;  3V8K A;  3JAM K;  1I5Z A;  5L3D A;  3ZMT A;  3CZ6 A;  3TMO A;  3HOW J;  3S2D J;  5GTH C;  1YIT I;  4Z2Y A;  3UNG C;  2LY9 A;  3VYS B;  3GZ5 A;  1HQC A;  1T8I A;  4O5V A;  2VT3 A;  4P5O A;  1F5T A;  3I53 A;  1AWC A;  3ZGK A;  2LG4 A;  3CUQ B;  3H3V K;  2WY7 Q;  1ZG5 A;  1Y39 A;  2CRG A;  2M7B A;  4E70 A;  4WK8 F;  3EYY A;  4HDV A;  4HF0 A;  2L7F P;  1MMD A;  3H9Q A;  4F93 B;  1UCR A;  5J8F A;  4U88 A;  1LVK A;  3RSN A;  3OIO A;  1JKQ C;  1H88 C;  2BY3 A;  2OA4 A;  1YE9 A;  1XCB A;  1KU9 A;  1ZG3 A;  2AXL A;  4AID A;  2DOE A;  1G6N A;  3N05 A;  3RJP A;  3VYT B;  5BQT A;  2YS9 A;  3DBR B;  3B02 A;  1O3S A;  2DMQ A;  4LOC A;  3FMR A;  2CUJ A;  3E6D A;  4XKV A;  3M7G A;  1XTA A;  3S2H J;  5ILS A;  3BG6 A;  3SDB A;  2P6S A;  1D0X A;  5FKN A;  1YTY A;  3DCF A;  3EYI A;  4ZZL A;  3E7L A;  4J19 A;  1YHQ I;  1MDM A;  3CUQ C;  4G8X A;  3BZK A;  1ZRF A;  2X1E A;  5EYR A;  5DTD A;  4C2U A;  2IP2 A;  3I59 A;  4R1H A;  2ZJQ F;  4FE4 A;  4MQ9 F;  2NOG A;  4BS9 A;  3K1N A;  3KEQ A;  2M7A A;  1A31 A;  4XLE A;  2BYV E;  1SFK A;  3BR0 A;  4Y52 J;  2BXZ A;  4U7D A;  5F1R A;  4NC6 A;  4HYE A;  4ETS A;  3PUF A;  2O3F A;  4OU0 A;  2ID6 A;  3ML6 A;  1ETO A;  2DA7 A;  2QSH X;  1I6H J;  3CLO A;  3BC8 A;  2BEO A;  3FXK A;  2CSO A;  2L7M P;  4U87 A;  1F4K A;  3VYU B;  3JSP A;  5IPA A;  5FJ8 J;  3ESW B;  2VJ4 A;  1SEU A;  4LMY A;  5CVJ A;  3RKX A;  1VQM I;  2YX4 A;  4JK1 X;  2ACJ A;  4EV0 A;  4II3 A;  4S04 A;  3F21 A;  2QLZ A;  1TQI A;  2E36 A;  2QQA A;  2DJI A;  4GYG A;  1O4X A;  2DQL A;  4XLH A;  3HHH A;  1MSF C;  1W5S A;  1MZB A;  2R7D A;  1XD7 A;  2H8R A;  1LVA A;  2CW0 F;  2LDU A;  2HYJ A;  2VXZ A;  3A2K A;  4FCY A;  4XNF A;  2HPM A;  5M5X J;  4V2F A;  1MND A;  4UVA A;  5HDN A;  3EET A;  4PGG A;  2FML A;  3OYC A;  4IX7 A;  1FP1 D;  3ZN1 A;  3PJR A;  2EFP A;  5EF6 A;  1OFC X;  3O8H A;  4C3J J;  2LLK A;  2QQ8 A;  3EPZ A;  4RM3 A;  2HWV A;  3PNT A;  3QPS A;  3I56 I;  4D5F A;  1J9I A;  4ENM A;  2PMZ A;  1LPQ A;  1RC9 A;  5FKK A;  1JE8 A;  4A6E A;  2EFN A;  1KZH A;  2DTR A;  3TP3 A;  3JR9 A;  3QP5 A;  2CV1 A;  3FDY A;  1R6R A;  5GAD J;  2VC1 A;  1S29 A;  2QKL B;  4KYW A;  2JUG A;  2R7X A;  1TT5 B;  3SZG A;  2ME0 A;  5GAG J;  3MKY B;  3I71 A;  2E71 A;  4UB6 C;  3SZT A;  2DPD A;  1ZQ3 P;  5JLW A;  3JAM Z;  2CG4 A;  3DTK A;  1T0F A;  1XGO A;  4LIV A;  3GTJ J;  2V1X A;  2QVO A;  2AO9 A;  3V7S A;  1HKQ A;  1JHF A;  3S14 J;  5TRD A;  2ISZ A;  2VIX A;  4PCQ A;  4Y4R A;  4RLQ A;  3F0C A;  3CMY A;  1FT9 A;  4X0G A;  2FD5 A;  4TV7 A;  1K6Y A;  2K7L A;  5D5W B;  1VQ9 I;  3HUG B;  1VQ6 I;  3H35 A;  4Q5S F;  2CYY A;  2IJL A;  2M9H A;  5FRM A;  5F6F A;  1P6R A;  2BW3 A;  1V5G A;  3BOQ A;  1BR1 A;  2KZG A;  2DA4 A;  1U2W A;  5GAE J;  3M3Y J;  2K85 A;  3KZI C;  3HHG A;  3X2Q H;  3EUK L;  1TL8 A;  2HTJ A;  1ETK A;  5HLG A;  4KN7 X;  3KLO A;  3SFZ A;  2HQN A;  5M5W J;  4Q47 A;  1S8N A;  3OOP A;  3FWE A;  5E17 F;  5EZH A;  2H8W A;  5JVT A;  2A69 F;  3GYH X;  2L0K A;  4B09 A;  1JUM A;  3DPL C;  3OL3 A;  2RC4 A;  1KU2 A;  2KRH A;  3OYN A;  4JQF A;  4BE2 A;  4IVN A;  3TO6 A;  3BQY A;  4N0B A;  4HNT A;  4B3X A;  1FJL A;  4ZJZ A;  2VBY A;  1S3J A;  2ZO4 A;  4A3B J;  5EEA A;  1DPR A;  4KN4 X;  1HDP A;  2E35 A;  1YJW I;  2UWM A;  4XSX F;  2IGN A;  1HW1 A;  2Z99 A;  4WWC A;  5DS9 A;  1YRN B;  4M71 A;  1FWZ A;  4E7Z A;  4ENK A;  3OSF A;  2PLY A;  2KQR A;  2CQK A;  1IN5 A;  4HF1 A;  2GXG A;  2LVS A;  4LB6 B;  1MMN A;  3FKI J;  2M3A A; 
#chains in the Genus database with same CATH homology
 2PMU A;  4HX8 A;  3V7R A;  1KYW A;  4D0P A;  2HR3 A;  3RYR A;  3WG9 A;  3F22 A;  3DFG A;  2Q2E A;  5LRR A;  1H0M A;  2EV6 A;  4DQ2 A;  4LGW A;  3WU0 A;  4L5I A;  4G9Y A;  3O2P E;  1I1S A;  1KQ8 A;  4M9S A;  2V1U A;  4RAY A;  2BGC A;  2IA2 A;  1ZRC A;  2XAQ A;  4HLX A;  2LNB A;  2NS0 A;  1K78 A;  1MJA A;  2ELH A;  4CGZ A;  3SXY A;  4HW0 A;  3K0L A;  1LDK B;  3GX4 X;  1HKS A;  2FF4 A;  3ABU A;  3H92 A;  4UV9 A;  4YFX F;  4WXC A;  2QEN A;  4O3M A;  2V9V A;  3GFL A;  3L09 A;  2Y48 A;  2X0L A;  4G7H F;  2XHK A;  5DV5 A;  3QAH A;  1R22 A;  5DD8 A;  4WX9 A;  1W4M A;  1R1U A;  4BAY A;  1W7P A;  5FGM A;  5TJJ A;  1QZY A;  4IHT A;  4ON0 A;  4UHT A;  5ICE A;  3H3Z A;  2XAG A;  3PQK A;  2HKO A;  3WTS C;  3RYP A;  4AVP A;  2A6H F;  1Z91 A;  2YX7 A;  2NYX A;  2HYG D;  1SFE A;  2OAZ A;  1IRF A;  3L00 A;  1W5T A;  2QBY A;  4DNC A;  3F8C A;  2V1D A;  4HA8 A;  2XAF A;  2WC2 A;  1BOA A;  3G3Z A;  3GFJ A;  3WTT C;  3FM5 A;  2W57 A;  2Y0M A;  3KE2 A;  2H6C A;  2DFI A;  5HDG A;  4EGY A;  2RGV A;  2L4A A;  5D6F A;  2GA1 A;  1O3T A;  1U6G A;  5J6X A;  3RKY A;  1YS7 A;  2VOD A;  4HOB A;  4LG0 A;  2FEZ A;  4GXO A;  1B6A A;  1I1G A;  2WWY A;  3COA C;  2FQ3 A;  3I58 A;  4CO8 A;  1D8K A;  1MJ9 A;  2KJB A;  4L5J A;  1TBX A;  4XLP F;  1K78 B;  1TLH B;  5IT9 K;  1FZP B;  2DU9 A;  2W85 A;  3HTS B;  2XAS A;  2O61 A;  2P5V A;  2HEO A;  3F8B A;  1STZ A;  3QP6 A;  2E1N A;  2IA0 A;  2OQG A;  1QPM A;  4M9Z A;  4Y13 A;  1LJ9 A;  5LGU A;  3CUO A;  1JXS A;  1BN5 A;  1SD7 A;  3E6C C;  1R58 A;  2ISY A;  1SD4 A;  1W7P B;  1PP7 U;  3MZH A;  5LHI A;  2KKO A;  4I0A A;  1SMY F;  4I09 A;  3FXR A;  2D1V A;  3KP7 A;  2HQR A;  4MTD A;  1ODD A;  1K7A A;  1YW8 A;  3WGG A;  5FLX Z;  5LHH A;  4R8H A;  3RI4 A;  1D8J A;  3P9C A;  2RQP A;  2ESH A;  2STW A;  4A0X A;  1FBS A;  3C3W A;  5EEG A;  1EH6 A;  4ESF A;  3FX3 A;  2IRF G;  4OIP F;  3HRU A;  1ZGA A;  5ICF A;  4P55 A;  4YIF A;  2FU4 A;  3KZY A;  5D4R A;  5FO5 A;  3DV8 A;  4PZJ A;  4B8X A;  4FX0 A;  4EJU A;  1G3W A;  3C18 A;  3N97 A;  3SHF A;  1QBJ A;  2C6Y A;  1UHW A;  2YR2 A;  1VTN C;  3E5Q A;  4LG0 B;  1Z7U A;  2X4H A;  1Y0U A;  2QQ9 A;  4HZF A;  3BRO A;  3WGI A;  1FC3 A;  2M1B A;  2VOP A;  3GFI A;  4EJT A;  3ABT A;  2ZCW A;  2COM A;  3Q5F A;  5BPD A;  2VE9 A;  3HOT A;  1HST A;  4EJV A;  3KFW X;  3WTV C;  4S05 A;  4ASN A;  4KDP A;  4ZH4 F;  5IT9 Z;  2BV6 A;  3DKW A;  2VC0 A;  2F5C A;  2VON A;  4L0Z B;  1R23 A;  3WU1 B;  3ROU A;  4ENN A;  2GZW A;  1F1Z A;  2VE8 A;  4XBF A;  3V4G A;  5K5R A;  3RKW A;  3F8M A;  5JR3 A;  2XGX A;  5HLI A;  5J8C A;  2O6G E;  1MD0 A;  3W6K B;  2J5O A;  1G3S A;  4ZYG A;  2FSW A;  3KZZ A;  5CJ9 A;  1EH8 A;  4A6D A;  3ECO A;  4IF4 A;  1EV7 A;  5AIQ A;  5L3G A;  1XGM A;  2FXA A;  2PEX A;  1K6O A;  1IXS B;  4A0Y A;  3HYI A;  4HAM A;  2Z33 A;  4CXF A;  5D5X B;  1LEB A;  2B0L A;  4EGZ A;  3HUG A;  1L0O C;  2XRN A;  4WXD A;  3F23 A;  2P8T A;  5H6R A;  5H6Q A;  3JW4 A;  1SD6 A;  3TDZ C;  5BS6 A;  2P7C B;  3P9K A;  3KLN A;  1ZG1 A;  3ULQ B;  1XB4 A;  3U9G A;  5D8K B;  2DPU A;  1QQI A;  4KMF A;  2IT0 A;  5LGN A;  1FYK A;  2FNP A;  1PUE E;  2PMH A;  1ZYR F;  4A2U A;  1XDS A;  3CTA A;  1RIO H;  3NEU A;  1O3R A;  3BJ6 A;  2NNN A;  3ELK A;  4PDK A;  4RGX A;  4BNC A;  2MH2 A;  3OV8 A;  2Z5U A;  2A6E F;  3HRT A;  4R79 A;  1BM9 A;  3Q9S A;  1H9T A;  2QYO A;  1PDN C;  3WE3 A;  3IC7 A;  1LB2 A;  2A61 A;  3E5U A;  3KCC A;  4FHT A;  2A5Y B;  2IVM A;  1QO0 D;  3LFK A;  3GVA A;  2FA5 A;  4HF2 A;  3GWZ A;  2M87 A;  2G7H A;  2P6T A;  5CYV A;  4OIN F;  3LWF A;  4JBA A;  1ZH5 A;  4U0V A;  2AS5 F;  2L02 A;  1TW3 A;  3HRS A;  1FX7 A;  1PP8 F;  1RZ4 A;  2XKO A;  3BJA A;  3QPH A;  4RGU A;  1FPQ A;  5L3C A;  4UVC A;  1XSD A;  5ICG A;  4H0E A;  2V79 A;  1WRJ A;  4GGG A;  1WI9 A;  2HFH A;  2PJP A;  1TQP A;  2EA4 A;  5D5U B;  4AIK A;  4RB2 C;  4L9J A;  1ZRE A;  1KYZ A;  1LEA A;  5DEQ A;  1FY7 A;  3GEZ A;  4BQA A;  5E1X A;  4L0Y B;  3D0S A;  3R6S A;  2P5L C;  4LLN A;  3E97 A;  2KIU A;  3GF2 A;  1IW7 F;  2RV8 A;  1KA8 A;  4L9N A;  3LST A;  5DUI A;  1T2K A;  3E6M A;  3ZP5 A;  2WV0 A;  5L3E A;  2JPC A;  1IN7 A;  5F64 A;  2A07 F;  3VEP A;  1FP2 A;  5FD6 A;  1QNT A;  5BPI A;  2MLG A;  1MJB A;  2ETH A;  3REO A;  2QM3 A;  1XSX A;  2O03 A;  3BP8 A;  2O8X A;  3I54 A;  3PFI A;  2DW4 A;  5L3F A;  1XSV A;  5HLH A;  1FBQ A;  4BHP A;  2GIV A;  3KP6 A;  1OMI A;  5E20 A;  2PFB A;  1G4D A;  2LF7 A;  1RUN A;  2W84 A;  4OIO F;  3C1D A;  3GXO A;  4EVI A;  2PG4 A;  4Y17 A;  1ZLK A;  3DXJ F;  1V3F A;  3K1P A;  2ZNY A;  3MAJ A;  4OMZ A;  4ZYE A;  1ULY A;  4HLY A;  4G7O F;  1Z9C A;  4AIJ A;  2OD5 A;  1U3E M;  2KIM A;  5H20 A;  1BI3 A;  3NQO A;  5BMZ A;  3IHU A;  3MQ0 A;  3LAP A;  4I02 A;  4WF2 A;  3WOD F;  3FZV A;  1NHA A;  2DLL A;  4I2O A;  2XAJ A;  2XUB A;  1DDN A;  2QZ8 A;  2HDC A;  1HW5 A;  4P96 A;  4ZZD A;  1RUO A;  1XN7 A;  4LK1 F;  3HIF A;  4IPA A;  3VB2 A;  4M74 A;  3I64 A;  3MWM A;  2ZME A;  3ZMV A;  3IRQ A;  3LQR A;  1U78 A;  3M1E A;  3E6B A;  1X3U A;  4LLG F;  1Z6R A;  3P9I A;  2FE3 A;  4KIB A;  5FD5 A;  4RB3 C;  1G3Y A;  1ON2 A;  2OZ6 A;  3MZY A;  2ZXJ A;  2K4B A;  1E2X A;  2IW5 A;  3K9T A;  2GQQ A;  2L54 A;  2DO7 A;  3KET A;  3T8T A;  4ENJ A;  2JZY A;  3QOP A;  2EV0 A;  3ERE D;  1WQ2 A;  3TGN A;  3BPX A;  5FFX A;  4LD5 A;  3J81 K;  4ZYH A;  1ZGJ A;  3BPV A;  4A12 A;  4CIC A;  3R0J A;  4U7B A;  5JI6 A;  1I6X A;  4YFN F;  2DT5 A;  4A5N A;  1BIB A;  1D5V A;  2FBK A;  1FBU A;  1HXD A;  2JSC A;  4UVB A;  1OYI A;  3H3U A;  2CGP A;  2M30 A;  2MBF A;  3FMS A;  3GZ6 A;  4RB0 A;  2RVC A;  4LJZ F;  4GCV A;  3KEO A;  1IZ1 A;  1V4R A;  1SD5 A;  5LHG A;  2VOO A;  4EQQ A;  4HDU A;  1D3Y A;  4NHJ A;  2E7X A;  2PQ8 A;  1WWX A;  2KIF A;  2JTV A;  3FF5 A;  1OPC A;  1OR7 A;  2NAZ A;  2LF8 A;  1TW2 A;  1Z1D A;  5A2Q K;  3IWZ A;  4FX4 A;  2K27 A;  3WGH A;  1ZAO A;  2JPB A;  2ZME B;  3N4M A;  3U2R A;  4AWX B;  2V6C A;  5HS8 A;  1XGN A;  3T5X A;  3ZPL A;  1J59 A;  2Z3Y A;  1P4A A;  1WKM A;  3M9A A;  4HQM A;  4IHS A;  1ZAR A;  3FXQ A;  4YFK F;  1OKR A;  2KJC A;  4G6Q A;  4NQW A;  1U8R A;  2L3D A;  1R00 A;  4L18 B;  1QGP A;  2R7F A;  1YS6 A;  4M72 A;  2F5D A;  1IUY A;  2L01 A;  4I7H A;  1J2X A;  3RDI A;  2K02 A;  2RDP A;  2E7W A;  2E1C A;  2EA2 A;  3CO7 C;  4ESB A;  2K86 A;  3J81 Z;  4HX4 A;  3GW2 A;  3MFK A;  4GO1 A;  4XRF A;  2HZT A;  2A3S A;  4RGR A;  3DQV C;  1S6L A;  4MGR A;  5EEH A;  1WSU A;  3V8J A;  4WXH A;  5LEJ A;  4U0Y A;  3M8F A;  3BJO A;  4RS8 A;  4RAZ A;  4XLN F;  1TNS A;  4MQV A;  1GHC A;  1SMT A;  2EFW A;  2H6B A;  4KA4 A;  4UV8 A;  4Q48 A;  2KRF A;  4Y15 A;  1Q1H A;  3L9F A;  5K5Q A;  1LQ1 A;  2OU2 A;  2ZKZ A;  3T1B A;  4EJW A;  3HSR A;  3F8N A;  1SFU A;  4OOI A;  4M9X A;  2VBZ A;  4AIH A;  5LBQ A;  3TOB A;  3JTH A;  4KIC A;  4CYD A;  2H09 A;  2UXX A;  3KP4 A;  3IWF A;  2DK5 A;  2M5W A;  3DPT A;  1JHH A;  1B59 A;  1E17 A;  5DD4 A;  1DPU A;  1XDU A;  1B4A A;  4G6D A;  1REP C;  1H9G A;  4YII A;  2FNA A;  4LK0 F;  1MKM A;  1OYY A;  2PI0 A;  3F72 A;  1W7P D;  3I4P A;  5DYM A;  3JSO A;  3IRR A;  2RNJ A;  2MA3 A;  2OZU A;  2BE5 F;  1Z6T A;  4MEX F;  3HSE A;  4O6J A;  1R1V A;  1BC8 C;  1OYW A;  3GLX A;  2CWE A;  5FFZ A;  6PAX A;  1FSE A;  1J5Y A;  4F7Z A;  3CO6 C;  1FYL A;  1IAW A;  2Y75 A;  2W24 A;  5HS9 A;  3QU3 A;  3LA3 A;  4N9I A;  3J80 K;  1R1T A;  4PGH A;  1IF1 A;  1XGS A;  1CF7 A;  3M8E A;  3T0Y A;  3TO7 A;  4EMS A;  1IN6 A;  2HGC A;  2TDX A;  1MGT A;  2FMY A;  3ISP A;  3R60 A;  4P9F A;  4P9U A;  2IA1 A;  5LEK A;  2Q0O A;  1IXC A;  3I5U A;  2A68 F;  1R5H A;  5IT3 A;  2EWN A;  4L9V A;  5D8L B;  1EH7 A;  1FSH A;  1K79 A;  2XIG A;  2JRT A;  2XV4 S;  3BZ6 A;  3GUD A;  1HKT A;  5AON A;  1T6S A;  1J0R A;  2OBP A;  2YU3 A;  2F2E A;  4HV6 A;  4CDG A;  3FMQ A;  3IKT A;  3E3V A;  3ZMD A;  1IXR C;  4AD9 A;  1UB9 A;  1GXQ A;  2UXN A;  5HS7 A;  3VOE A;  3U1D A;  2LSO A;  2HYF A;  1RI7 A;  2HKX A;  3ZQ7 A;  4LB5 A;  4BH9 A;  1YG2 A;  4IXA A;  1USS A;  5E1W A;  3RTR A;  1KGS A;  3B73 A;  4KMU X;  4Q4Z F;  4XSZ F;  3AAF A;  1CGP A;  3F3X A;  5D6E A;  2F5F A;  5LLQ A;  4LLL A;  4HBL A;  3ZMZ A;  3TQN A;  1TNT A;  1ON1 A;  3T8R A;  4ZYD A;  3VFZ A;  1R7J A;  3F6V A;  3LQQ A;  3WE2 A;  1ONV A;  1P4X A;  4I01 A;  1BC7 C;  1HSJ A;  5JHU A;  2G7U A;  1CF7 B;  3V8L A;  5KVR A;  4MNU A;  1SFX A;  1MDM B;  1U5T A;  2FBI A;  3EUH A;  2OQR A;  4UNO A;  2PBI A;  4ESJ A;  3LAJ A;  3I59 B;  5HOO A;  2D45 A;  1AOY A;  1YW7 A;  4KFC A;  4U0W A;  1YO5 C;  3J80 Z;  1S7O A;  1HBX G;  4OMY A;  2L4M A;  4IJA A;  1ZN2 A;  3WTW C;  3IL2 A;  3K2Z A;  5LGT A;  4M6X A;  3ZMU A;  1P2F A;  1ZLJ A;  2ESN A;  2GXB A;  5K5O A;  1LDJ A;  2ZNZ A;  3JTG A;  2MLK A;  4QLC U;  4N9H A;  3K69 A;  4A0Z A;  5BOX A;  5ILU A;  2YPR A;  2F5E A;  5E8G A;  3WTY C;  1F9N A;  2QQB A;  3C7J A;  1GVJ A;  1T98 A;  3WTX C;  2P7V B;  3K1M A;  2EFQ A;  3KP3 A;  4KIF A;  4OIQ F;  2H94 A;  3J7A O;  5D5V B;  3BY6 A;  4QWQ A;  1J7K A;  3O6B B;  3QU6 A;  2CFX A;  2FBH A;  3SQN A;  5DCM A;  1KQ0 A;  4EM0 B;  1O3Q A;  5DCF A;  2RN7 A;  1XCV A;  4MHG A;  2VBX A;  2JT1 A;  3L7W A;  4CZZ A;  5HVQ C;  3NRV A;  4UXN A;  4IRH A;  3D5L A;  3GO5 A;  3RIR A;  5ICC A;  1FNN A;  2IPQ X;  2P5K A;  1I27 A;  5FLX K;  1A04 A;  2DI3 A;  5K1Y A;  2EV5 A;  4HQE A;  4L9T A;  1FOK A;  1BI0 A;  3R61 A;  1B1B A;  2FRH A;  3R0A A;  2VN2 A;  2STT A;  1YLF A;  3LA7 A;  5CVV A;  5ED4 A;  3WTU C;  4IRI A;  1G3T A;  3E5X A;  1U5T B;  5FB2 A;  5E18 F;  2DQR A;  2EFO A;  3I0T A;  1L3L A;  1GXP A;  2UZK A;  4A5M A;  1UST A;  1S7A A;  1IN8 A;  2GAU A;  4IRG A;  2ADU A;  4MTE A;  2XKP A;  3BWG A;  1T39 A;  4CHU A;  2EK5 A;  4M73 A;  1ZRD A;  2CO5 A;  4FT8 A;  4I98 B;  4LFU A;  3QPT A;  3VOD A;  5E1Z B;  1JGS A;  1P92 A;  4RB1 A;  3HRM A;  5KK1 A;  2LKP A;  1UHM A;  4KUM A;  3HSF A;  5DUK A;  3LA2 A;  4I0B A;  4G7Z F;  1U5T C;  1R5G A;  5ILV A;  1XMK A;  2ZFW A;  2Q8K A;  3ZMS A;  4NB5 A;  4BYY A;  2K4J A;  4UUV A;  4EM1 A;  3S2W A;  3FXU A;  2DBB A;  2M8E A;  5E8I A;  3MCZ A;  3TKY A;  1LDD A;  2MD5 A;  3TOA A;  1B9M A;  4EJO A;  1BI2 A;  2NNY A;  1BIA A;  4MEY F;  3EQL F;  3DF8 A;  2VT2 A;  1QZZ A;  2QWW A;  2GWR A;  5DCM B;  4WCG A;  3BDD A;  1BJA A;  2EJR A;  4GYI A;  2ZJ2 A;  1O57 A;  1FLI A;  3PQJ A;  3Q9V A;  2R3S A;  5D4S A;  5ERI A;  1O7F A;  4M6Y A;  4EM2 A;  1IRG A;  3P7N A;  3V7C A;  2QUF A;  2H27 A;  1KU7 A;  1B9N A;  3CDH A;  3ZN0 A;  1UFM A;  2O0Y A;  3O3K A;  1BBY A;  2PN6 A;  2XRO A;  4KT5 C;  3DP7 A;  3IKV A;  2HTS A;  4BHC A;  1ZHF A;  2Z9O A;  2QBY B;  2FOK A;  1DP7 P;  1YYV A;  1C0W A;  2XAH A;  2XVC A;  2MC3 A;  3CUQ A;  5CVR A;  1J75 A;  3HOS A;  3EDP A;  3KP5 A;  1P4W A;  3G73 A;  1SAX A;  2EB7 A;  4RGS A;  1TQM A;  1YIO A;  4KIG A;  5CVI A;  3WTZ A;  1R36 A;  2NRA C;  1YW9 A;  2M45 A;  1YQA A;  3TO9 A;  3W6J B;  4G94 A;  2D1H A;  2D2W A;  3RPQ A;  1FYM A;  3F8F A;  1DUX C;  2J5P A;  2YSR A;  3FM3 A;  2G9W A;  4YG2 F;  2MH9 A;  1T38 A;  3MEX A;  2BBY A;  1O7L A;  3ECH A;  4BXU A;  3SZP A;  3TDU C;  2DK8 A;  4HV5 A;  1IN4 A;  2GA2 A;  3L2C A;  4OIR F;  1YFH A;  2HOE A;  3DEU A;  2DAO A;  1HW2 A;  3QRF F;  5DDG A;  1XMA A;  3RPU A;  5L3B A;  2VBW A;  3FHZ A;  4BHB A;  2WTE A;  1TTY A;  2P4W A;  3HTU A;  1KU3 A;  4K2E A;  5CVU A;  1Z05 A;  4KNY A;  3GFM A;  3KP2 A;  5A2Q Z;  5CLS A;  3CJN A;  5HDK A;  5LRS A;  1LNW A;  5JFR A;  1BI1 A;  4HX7 A;  2HS5 A;  2ZBK A;  3R4K A;  1KQ9 A;  2W25 A;  1RNL A;  2RKH A;  3JAM K;  5AIP A;  3V8K A;  1I5Z A;  5L3D A;  3ZMT A;  4Z2Y A;  3GZ5 A;  1HQC A;  4O5V A;  2VT3 A;  4P5O A;  1F5T A;  3I53 A;  1AWC A;  3CUQ B;  1ZG5 A;  4E70 A;  4WK8 F;  3EYY A;  4HDV A;  4HF0 A;  1UCR A;  5J8F A;  4U88 A;  2OA4 A;  1XCB A;  1KU9 A;  1ZG3 A;  2AXL A;  1G6N A;  3RJP A;  5BQT A;  3B02 A;  1O3S A;  3FMR A;  3E6D A;  3M7G A;  5ILS A;  2P6S A;  1YTY A;  3EYI A;  4ZZL A;  1MDM A;  3CUQ C;  4G8X A;  1ZRF A;  2IP2 A;  3I59 A;  4R1H A;  4MQ9 F;  3K1N A;  3KEQ A;  2BYV E;  4U7D A;  5F1R A;  4HYE A;  4ETS A;  4OU0 A;  2O3F A;  3ML6 A;  3CLO A;  2BEO A;  2CSO A;  1F4K A;  3JSP A;  4LMY A;  5CVJ A;  3RKX A;  2YX4 A;  4JK1 X;  2ACJ A;  4EV0 A;  4S04 A;  3F21 A;  2QLZ A;  1TQI A;  2QQA A;  4GYG A;  2DQL A;  3HHH A;  1W5S A;  1MZB A;  2R7D A;  1XD7 A;  1LVA A;  2CW0 F;  2LDU A;  2VXZ A;  4UVA A;  5HDN A;  3EET A;  4PGG A;  2FML A;  1FP1 D;  3ZN1 A;  2EFP A;  2HWV A;  1J9I A;  4ENM A;  1JE8 A;  4A6E A;  2EFN A;  2DTR A;  3QP5 A;  2VC1 A;  1S29 A;  4KYW A;  3I71 A;  3SZT A;  2DPD A;  3JAM Z;  2CG4 A;  1T0F A;  1XGO A;  2V1X A;  3V7S A;  2QVO A;  1HKQ A;  1JHF A;  5TRD A;  2ISZ A;  4PCQ A;  1FT9 A;  4TV7 A;  2K7L A;  5D5W B;  4Q5S F;  2CYY A;  2IJL A;  5F6F A;  1P6R A;  3BOQ A;  1U2W A;  3HHG A;  2HTJ A;  5HLG A;  4KN7 X;  3KLO A;  3SFZ A;  2HQN A;  4Q47 A;  1S8N A;  3OOP A;  3FWE A;  5E17 F;  5JVT A;  2A69 F;  3GYH X;  4B09 A;  3DPL C;  2RC4 A;  1KU2 A;  4JQF A;  4IVN A;  3TO6 A;  4N0B A;  2VBY A;  1S3J A;  2ZO4 A;  1DPR A;  4KN4 X;  2UWM A;  4XSX F;  1HW1 A;  2Z99 A;  4WWC A;  4M71 A;  1FWZ A;  4ENK A;  2PLY A;  2CQK A;  1IN5 A;  4HF1 A;  2GXG A;  3F6O A;  4LB6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...