5E8IA

Crystal structure of the dna binding domain of human transcription factor fli1 in complex with a 10-mer dna accggaagtg
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
93
structure length
93
Chain Sequence
b'GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Friend leukemia integration 1 transcription factor
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
pubmed doi rcsb
total genus 26
structure length 93
sequence length 93
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e8iA00
4YFKF 1QGPA 3I59B 4PCQA 5LHHA 3GVAA 1FWZA 5ICCA 2GXBA 1T38A 1J9IA 5E1WA 1I1SA 3KLOA 1PP7U 2XAFA 3IRRA 3WE3A 1U2WA 1V4RA 1MJ9A 2VONA 2F5DA 4AIKA 1GHCA 2M8EA 4Q5SF 3ECHA 4RGUA 1JHHA 1WI9A 2QQBA 4IRHA 1BBYA 3KP6A 2X4HA 3WGIA 5TRDA 4HZFA 2GZWA 2JZYA 4ON0A 1B1BA 3WODF 2ADUA 3LAJA 3E97A 1IAWA 2DAOA 2ISZA 3M1EA 4A5MA 1XSVA 2GWRA 1FBSA 3LA3A 2GA1A 1FBUA 4HV5A 2VC0A 4ENNA 1KGSA 2D45A 1C0WA 1MD0A 4GXOA 5D5WB 1UHWA 1FBQA 3MQ0A 4HF0A 3K1MA 4WWCA 4HYEA 3JW4A 3ABTA 3VEPA 3K9TA 4YIIA 5CYVA 2QM3A 1T0FA 5HLGA 5HLHA 2FEZA 5AONA 1SAXA 2STWA 3JTHA 1BN5A 3LSTA 1IZ1A 4IPAA 1USTA 2VN2A 2O3FA 1HW1A 2ZCWA 2Q2EA 2V9VA 1R36A 1OYIA 4EV0A 5L3FA 3GFMA 2ZKZA 4NQWA 3EETA 1DDNA 2A68F 2XAJA 2B0LA 1TNSA 1JHFA 2QUFA 1QPMA 5J6XA 3AAFA 4HLXA 3GW2A 3QPHA 1SFEA 3WTYC 4KIBA 2QQ9A 1FYLA 2L02A 2YX4A 2PMHA 1LNWA 4R79A 5JFRA 4UV9A 1GXPA 2UWMA 5DD8A 1FP1D 2CQKA 3IRQA 3H3ZA 2O8XA 3P9KA 3I58A 2VBWA 2HZTA 1WWXA 4L9TA 2BBYA 5D6EA 2ESHA 2QENA 2YSRA 2HTJA 1SD6A 2EK5A 3BJ6A 4R8HA 4HQEA 1BOAA 5LBQA 4GYGA 2EV6A 4LJZF 3T5XA 1T39A 3HHGA 5KK1A 4N0BA 2EJRA 2VOPA 2M1BA 1FNNA 2MH9A 5KVRA 1ON1A 1XGMA 2Z99A 3TGNA 1Z05A 2MLGA 2XKOA 2STTA 1R1UA 2OU2A 4OIQF 1T98A 2LF7A 1TW2A 2FU4A 3HRSA 3C1DA 1WSUA 5CVJA 1BIAA 2KKOA 4A6EA 2IP2A 3M8FA 2ZNYA 3HHHA 5DUIA 3WE2A 3RTRA 2XVCA 1SFXA 5K5QA 4BH9A 3CJNA 3DPLC 4PGGA 4G6QA 5AIPA 1YTYA 1R00A 4ENKA 1Z91A 3U9GA 2QBYA 3ZN1A 1LVAA 4ZZLA 2E1CA 1RNLA 4MHGA 3EUHA 3WTWC 1YS6A 1LDKB 2A69F 1U3EM 2EFPA 3GYHX 5L3BA 4I7HA 2L3DA 3D0SA 1BI2A 2Y0MA 1G3WA 2Q0OA 1P92A 3QP5A 3BWGA 1I5ZA 4Y17A 2ZO4A 2P8TA 4I0BA 4UXNA 1TQPA 1P4WA 2ZNZA 3R0JA 3F72A 3KP4A 4L9NA 4IHTA 4HAMA 3KZZA 3GFJA 4I2OA 1HXDA 4WXCA 1E2XA 1F4KA 5LEKA 3T0YA 2OA4A 4ASNA 2O03A 4CDGA 4KMFA 2A61A 3CO6C 2P7CB 2CFXA 4B09A 1O3QA 3L09A 4EGZA 4ZH4F 5ED4A 2HYFA 1K79A 1YIOA 3LWFA 4L5IA 1MKMA 2EFQA 1H9GA 4AD9A 1J2XA 3P9CA 4P96A 1J0RA 4NHJA 4G9YA 2BV6A 2R3SA 5FD5A 5LRSA 3WTSC 3EYIA 2LDUA 1BJAA 1SFUA 1ZRFA 4HF2A 3O2PE 3K1PA 4ENMA 2VT2A 1Z6RA 1KU7A 3GWZA 1ZAOA 5FB2A 1PDNC 5H20A 4GYIA 5HDNA 3I53A 3ZMUA 3RPQA 5K5RA 4LGWA 1XMAA 4ZYEA 2RNJA 1R7JA 4FX4A 3BJAA 2VBYA 2BEOA 1E17A 3P7NA 2E7XA 3ZP5A 4Y15A 4QLCU 4WX9A 1SD4A 4U0WA 1TQIA 3MEXA 4P5OA 4EJTA 1TW3A 1IRGA 4LD5A 1W7PB 4YFNF 1V3FA 3F3XA 5DD4A 4FX0A 4OIRF 2H6BA 3JSPA 3P9IA 1R23A 1FP2A 1L0OC 4LMYA 5J8CA 5E1ZB 5L3DA 1J7KA 4IF4A 2UXNA 3G3ZA 2A07F 2CYYA 2DFIA 2P4WA 1P2FA 1XGSA 1XDSA 1KU9A 3V7CA 2W84A 1R1TA 3MZYA 2H94A 2MC3A 1ZH5A 1AOYA 3RI4A 2A6HF 2K7LA 4Q47A 4A6DA 2QZ8A 4U7BA 3SZTA 1O7FA 2NS0A 4Z2YA 5LGTA 3MFKA 5BPIA 3WU0A 4RB0A 4L18B 3BP8A 2PLYA 4TV7A 1IUYA 2K86A 4ETSA 5E8GA 2ZJ2A 2OQRA 3I64A 1IRFA 3FMQA 2IW5A 4CGZA 3E6DA 3TOBA 1Z7UA 1MDMA 5LGNA 1ZLKA 5D5UB 2KJCA 3MZHA 3K69A 1MDMB 2XUBA 1G3YA 4EJUA 3BY6A 3WU1B 3I71A 2LF8A 3R4KA 2JPBA 3QU3A 2X0LA 5DEQA 2XRNA 2F5EA 4KUMA 4G8XA 5K5OA 4ZYHA 1LB2A 3LFKA 5A2QK 2JT1A 1HQCA 3FXUA 2M87A 1R5HA 2EWNA 3RKYA 4M74A 2FNAA 4N9HA 2QYOA 5D4SA 2KIUA 1XD7A 5HDKA 2COMA 4L5JA 3BDDA 2F2EA 2TDXA 1WQ2A 2V1XA 3CUOA 4S04A 1TLHB 5L3CA 2O6GE 2CW0F 1TTYA 4I98B 3J81Z 2Y48A 4EJWA 1CF7B 1S29A 4ZZDA 3C18A 4O3MA 1YW9A 5E18F 1MJBA 3OOPA 4I01A 5LEJA 2HDCA 2JPCA 1NHAA 4FT8A 1LEAA 2L01A 3SXYA 2PMUA 5HS9A 2RN7A 4UV8A 2W85A 3O6BB 4EGYA 1ZARA 1REPC 3DEUA 3WGGA 4BHPA 1YYVA 4U0YA 4HX8A 4IJAA 2ELHA 2VC1A 4RGSA 3GFLA 4U88A 3K2ZA 1O3SA 1W5TA 1DPUA 4UVAA 1IF1A 2JTVA 1IN5A 2DQRA 4ESFA 2HS5A 3KCCA 1RUOA 3FX3A 3RJPA 2K27A 1ODDA 1KU2A 2VOOA 4EMSA 5E20A 1BI3A 3EQLF 3F22A 4KIFA 1O3TA 2G7UA 3KP2A 4FHTA 3V8JA 3L9FA 1J5YA 3LAPA 1LQ1A 3IWZA 1O7LA 5CVRA 2ACJA 2VBZA 1T6SA 3F8CA 1W7PA 5L3EA 3KLNA 3PQJA 3HSFA 1S7OA 2P6SA 2M5WA 1RIOH 1DP7P 1XMKA 3RKWA 1IW7F 2XGXA 1VTNC 1JE8A 1MZBA 3TDUC 2L4MA 3ROUA 4MQ9F 3VOEA 5ERIA 3BZ6A 3KEQA 5JR3A 2HYGD 1IXSB 2RKHA 5DCMB 1U5TC 5E8IA 5DYMA 5FFXA 2XIGA 1ZHFA 4GCVA 4KN4X 3U2RA 5HS8A 1ZG5A 2PJPA 4OMZA 2EV0A 1MGTA 5TJJA 2KIMA 3GUDA 4M71A 5AIQA 2O0YA 4XBFA 2EFNA 3ABUA 1BI0A 3WTZA 4CICA 2K02A 3R0AA 4M73A 1WKMA 4OINF 2PI0A 5LRRA 2DI3A 4MQVA 1JXSA 4U0VA 1S7AA 3K1NA 2XHKA 2F5CA 2R7DA 4MEYF 1D8JA 1O57A 3ZPLA 1KA8A 4LLNA 2RDPA 2DPDA 4H0EA 5F64A 2GIVA 2O61A 4ZYGA 1FSEA 5D5XB 5DCMA 4PGHA 2XAQA 3GLXA 5ICGA 1XCBA 3BOQA 4L9JA 1HSTA 1RUNA 1K78B 2FSWA 4KIGA 3SQNA 4ESJA 5FLXK 5FLXZ 4KICA 4RAYA 3FHZA 3F8BA 5FO5A 1LDJA 2HR3A 3JTGA 1UB9A 4GO1A 3V7RA 2AS5F 2PN6A 3CTAA 1A04A 5DDGA 1FOKA 2DT5A 3IKTA 1FC3A 4WCGA 3EYYA 2HQRA 2HKOA 1U5TA 2YU3A 1XN7A 3REOA 2VE9A 3HUGA 1IN6A 4P9FA 3GF2A 3I0TA 4BHCA 4IVNA 1HKTA 3VB2A 3TKYA 4I0AA 5IT9K 1R22A 4HA8A 2PQ8A 3CUQC 4EM2A 3W6KB 1K78A 5BPDA 4EVIA 4M9ZA 2UZKA 4HOBA 5H6QA 1IN7A 4RB3C 3SZPA 1OKRA 2DU9A 3GXOA 5JI6A 2M45A 3JAMK 2G7HA 4G7HF 4BHBA 1K6OA 4M6XA 4E70A 3E5XA 3PQKA 3F8MA 3HSEA 1T2KA 4O5VA 2HTSA 4UVBA 1ZG1A 1SD7A 3CUQB 2J5OA 1SMYF 1LEBA 1ON2A 5HLIA 2RGVA 2FQ3A 3K0LA 3KP3A 1OYYA 1IXRC 4F7ZA 3CUQA 1ULYA 2W57A 5E1XA 3O3KA 4NB5A 3F23A 4RB2C 2CO5A 2HFHA 4KFCA 4A2UA 4BAYA 3KZYA 1GXQA 1KQ9A 1S6LA 1QNTA 1J59A 2ZMEB 3F8NA 2GA2A 1QBJA 3FM3A 5BS6A 2Q8KA 4RS8A 3I5UA 2VE8A 4XSZF 1I6XA 5F6FA 4AVPA 2WC2A 4EQQA 3VFZA 4RGRA 3FMSA 2K4BA 5ILSA 2FBIA 1P6RA 3F6VA 1B4AA 1IN8A 2A3SA 4A0XA 4I09A 3KP7A 3HOSA 2QQAA 2A5YB 4MTEA 2HGCA 2P5KA 1YLFA 2EB7A 4M72A 2DO7A 1Z6TA 1EH7A 3LQRA 3J80K 5DV5A 2Y75A 2IA0A 3ML6A 1EH6A 2E7WA 2OD5A 1XGNA 2IA2A 3QP6A 4WK8F 3WTXC 3LA7A 1P4XA 5JHUA 3QU6A 1W4MA 1YS7A 2V79A 4MGRA 3SFZA 1BC7C 2CWEA 1UCRA 1Z9CA 3E5UA 1W7PD 3KE2A 2WWYA 4HDUA 4G94A 1GVJA 3QRFF 2EFOA 1BM9A 4JBAA 2ZFWA 1ZRCA 2QLZA 1FY7A 3ELKA 2JRTA 3GZ6A 5LHGA 2CSOA 3FXQA 4UNOA 1SD5A 4KDPA 1X3UA 2HEOA 4RGXA 1U78A 5EEHA 3B73A 2ZXJA 4OOIA 1AWCA 4KYWA 2E1NA 2OZ6A 3TO6A 2GXGA 3WGHA 3N97A 1G3SA 2XAGA 1PUEE 5EEGA 3CDHA 5HDGA 2IPQX 1Q1HA 3HRTA 4M9SA 4L9VA 2JSCA 3M9AA 2NRAC 4KT5C 3BPVA 5LGUA 3C3WA 4CO8A 1KQ8A 3ERED 3IKVA 3Q5FA 1Y0UA 3M7GA 3DP7A 4BQAA 1FYMA 3V4GA 4CHUA 1B59A 3H92A 2ETHA 3DXJF 4XSXF 2D1HA 5K1YA 3HRUA 3L2CA 1YFHA 1PP8F 4KNYA 3J81K 2LNBA 2H27A 1HKQA 3T8RA 1TBXA 1HSJA 4JQFA 1R1VA 1KQ0A 2Z3YA 3QAHA 4LG0B 1G4DA 3DF8A 1G3TA 3TO7A 3L00A 2DK5A 4Y13A 1B9MA 2PEXA 1ZG3A 2MBFA 3F8FA 2LKPA 2P7VB 2OZUA 4A0YA 1ZN2A 5CVUA 5E17F 2NYXA 3IC7A 5A2QZ 4YFXF 1FSHA 3NEUA 4B8XA 1CGPA 2W25A 1QO0D 3BROA 3L7WA 4LFUA 3RYPA 3HYIA 3TQNA 3ISPA 2PFBA 3KP5A 2KRFA 2VXZA 2V6CA 4EM0B 1HBXG 1W5SA 4M6YA 4K2EA 5BOXA 3R61A 4L0YB 2XAHA 5D8KB 4EJVA 3T1BA 1DPRA 3CO7C 4Q4ZF 3J80Z 3MAJA 2OAZA 3WTVC 2Z9OA 3T8TA 4HX7A 3KETA 2FA5A 4HLYA 4CZZA 3U1DA 3V7SA 1YO5C 1XCVA 1U6GA 3DKWA 5F1RA 3TO9A 4M9XA 3ZMDA 4HQMA 2FMLA 1IXCA 2EV5A 1DUXC 4D0PA 3ZMTA 1HW5A 2H6CA 5ILUA 1ONVA 1HKSA 4GGGA 4ZYDA 4UHTA 4WF2A 4N9IA 4AWXB 5BMZA 2D2WA 2KIFA 1QQIA 4PDKA 2WTEA 2GAUA 4HV6A 1FT9A 3V8LA 3BPXA 2QWWA 2XV4S 4A5NA 2R7FA 3DPTA 3HRMA 1HW2A 4PZJA 3HOTA 3S2WA 2BYVE 5ICFA 1G6NA 2NNNA 4I02A 3GO5A 4KA4A 2IVMA 2P5VA 3V8KA 1USSA 1B9NA 1FLIA 4XRFA 4BXUA 3R60A 3E6CC 1U5TB 2HWVA 1YW7A 1Z1DA 3FWEA 3B02A 5H6RA 3RDIA 4IHSA 1S8NA 3KFWX 2P5LC 2FBKA 2BGCA 1FX7A 3NRVA 5IT3A 5LLQA 1XB4A 5DUKA 2K4JA 5J8FA 3F21A 2V1DA 1S3JA 2FRHA 5FGMA 1QZYA 3E6MA 1YQAA 3RYRA 4CXFA 3E6BA 3RIRA 2DBBA 3TOAA 1LJ9A 2BE5F 4WXHA 4P55A 2V1UA 1U8RA 4S05A 2DTRA 1P4AA 4BYYA 5CVIA 4L0ZB 2IRFG 3I59A 3LQQA 4A0ZA 4CYDA 2MA3A 2P6TA 1RI7A 2FNPA 2EA4A 1TNTA 4LB5A 1R5GA 5D4RA 3GX4X 2J5PA 1TQMA 2ZBKA 1KU3A 4RAZA 2XASA 5FD6A 3SHFA 4MEXF 1OYWA 2DK8A 1O3RA 4HX4A 1OMIA 2LSOA 2FMYA 1I27A 1F5TA 4UUVA 3ZN0A 3HIFA 4XLNF 1UHMA 1YW8A 2FE3A 4OU0A 2GQQA 3FXRA 1D3YA 2FBHA 3IHUA 3ZMSA 3Q9SA 2VBXA 4DQ2A 3GZ5A 2FF4A 3ECOA 3R6SA 5D8LB 2ZMEA 3FF5A 5DCFA 1ZGAA 3HTSB 1LDDA 1OR7A 1BIBA 2Z33A 2MH2A 4U7DA 4ESBA 4IRIA 3MWMA 2OBPA 5HS7A 4LG0A 3ZQ7A 2QBYB 1EH8A 2UXXA 1XSDA 5CVVA 4LLLA 2YPRA 5ICEA 4LK0F 2OQGA 2WV0A 3H3UA 4LK1F 1IN4A 5CJ9A 1UFMA 3WTUC 2DQLA 2CG4A 3JAMZ 2CGPA 3GEZA 1OPCA 3DQVC 5D6FA 1EV7A 2IJLA 2XROA 2YR2A 4KMUX 2ESNA 2F5FA 4QWQA 4WXDA 1RZ4A 1L3LA 3CLOA 2AXLA 2D1VA 3JSOA 5IT9Z 3RPUA 1KYWA 1MJAA 2M30A 1BC8C 4UVCA 3N4MA 2VODA 3HTUA 5L3GA 4HDVA 1XSXA 4EM1A 4DNCA 1FYKA 1D8KA 1F1ZA 4Q48A 1ZRDA 2PBIA 4IRGA 2Z5UA 3NQOA 3TDZC 5FFZA 4HF1A 3FZVA 4RB1A 2EFWA 4ENJA 1XGOA 1ZYRF 2NAZA 4IXAA 3C7JA 2NNYA 4KN7X 1J75A 2DPUA 3M8EA 3I4PA 4HBLA 2FOKA 5HVQC 3BJOA 1K7AA 2MD5A 5LHIA 2L4AA 4G7ZF 1B6AA 4AIHA 2EA2A 2MLKA 1QZZA 4YIFA 3WTTC 5ILVA 4OMYA 2A6EF 3ZMVA 1KYZA 4MNUA 1YG2A 4P9UA 2L54A 3E5QA 2ISYA 2G9WA 3F6OA 1R58A 3Q9VA 3QOPA 3GFIA 1F9NA 3KEOA 1ZLJA 3OV8A 1H0MA 1SMTA 2PG4A 1XDUA 4OIOF 4EJOA 5CLSA 4XLPF 3HSRA 4MTDA 5HOOA 1STZA 3QPTA 2IA1A 4JK1X 2HKXA 3VODA 3J7AO 3DFGA 3IL2A 2DW4A 3G73A 2RV8A 3RKXA 2XKPA 4R1HA 1I1GA 1ZGJA 2KJBA 3FMRA 3FM5A 3PFIA 2YX7A 1FZPB 3MCZA 1BI1A 4G7OF 1JGSA 2DLLA 4YG2F 2W24A 3ULQB 6PAXA 4A12A 3ZMZA 2RQPA 1H9TA 1ZREA 2RC4A 3DV8A 3EDPA 2FXAA 2QVOA 4HW0A 2HQNA 3LA2A 4G6DA 1FPQA 4OIPF 3I54A 2C6YA 4BNCA 2H09A 3E3VA 4O6JA 3IWFA 4LB6B 4AIJA 3D5LA 3W6JB 2VT3A 5JVTA 5BQTA 1D5VA 5D5VB 2RVCA 3WG9A 2IT0A 3COAC 2HOEA 1WRJA 4LLGF 1CF7A
chains in the Genus database with same CATH superfamily
4YFKF 5F04A 1QGPA 3I59B 5FLMJ 3LSPA 4PCQA 4QTRA 5LHHA 2WA0A 1DU0A 3GVAA 2QKLB 1B72B 1FWZA 5ICCA 2OC6A 2GXBA 3SEQA 1T38A 2XB0X 3TL4X 2M4GA 1J9IA 5E1WA 1LE8B 1I1SA 1MNDA 2L7KA 3KLOA 2K5CA 1PP7U 2XAFA 2KMUA 3IRRA 3HEFA 2EIMH 3WE3A 1U2WA 1V5FA 3DBLB 3H5NA 1V4RA 1MJ9A 2VONA 3A2KA 2F5DA 4AIKA 3HKZN 1GHCA 2M8EA 4Q5SF 3ECHA 3P5JA 4RGUA 5K7FA 2VIXA 1JHHA 1WI9A 2QQBA 4IRHA 2ECCA 2GOMA 1BBYA 2DT7B 2X6OA 3KP6A 2KPMA 3RZOJ 2X4HA 2QKMB 3VPRA 3H5RA 3WGIA 1E3OC 4A3DJ 2L7ZA 2X1CA 4CCLA 2BZTA 5TRDA 4HZFA 1MMNA 3LSHA 5M5XJ 2GZWA 2JZYA 4ON0A 4Y3OA 2DTZA 3ABKH 3FXOA 1B1BA 3WODF 2DMTA 2WADA 2ADUA 3LAJA 1X4PA 3E97A 3OYGA 4IZZA 3KYLA 1IAWA 2JQ7A 4M6VA 2DAOA 2ISZA 3M1EA 3GZNB 2R4GA 4A5MA 1XSVA 4DOZA 2GWRA 4XLHA 1FBSA 3LA3A 2GA1A 1FBUA 4HV5A 2WB1A 3ABMH 3CJTB 3B6CA 2VC0A 3S1NJ 4FISA 3H9JA 3K4CA 3DU5A 2Y9ZA 2CH0A 1KGSA 2LY9A 4ENNA 2D45A 1C0WA 1MD0A 4GXOA 1W0UA 5CPRB 5D5WB 5IY5H 1UHWA 1FBQA 2AO9A 3MQ0A 3PNYA 4HF0A 4UUTA 3A01B 2XGDA 3K1MA 2DA2A 4WWCA 4I6ZA 3PIPF 3CMAI 4HYEA 3QQAA 3JW4A 2H8WA 3ABTA 2ZXHA 4OAZA 3VEPA 4AM3A 2HQAA 3K9TA 2MYSA 5CYVA 2QM3A 1T0FA 4YIIA 4IL6C 5HLGA 5HLHA 4XRSA 4RM3A 2FEZA 2KQRA 5AONA 1SAXA 2F4MB 4XKWA 3H1CA 3I4MJ 1E3PA 2STWA 3JTHA 3S2DJ 1BN5A 3LSTA 1IZ1A 2Z1DA 4IPAA 4Y7NJ 1USTA 4IOAF 2VN2A 2O3FA 2DXIA 4CZCA 3D5SC 5BNGA 1HW1A 2ZCWA 1Q1VA 2Q2EA 2EPFA 2V9VA 1R36A 5EZGA 1X19A 5FRMA 3M07A 3GMEA 1OYIA 2CW8A 3HZJA 4EV0A 4CSWA 4A3IJ 2E2JJ 5L3FA 2XB5A 3GFMA 2ZKZA 4LITA 1MNEA 4NQWA 2BXYA 3L2UA 1KZHA 3EETA 1DDNA 4XORA 1MIJA 2A68F 2XAJA 2B0LA 1TNSA 1JHFA 2QUFA 1QPMA 5J6XA 2IXSA 4JP0A 3AAFA 3K2AA 4HLXA 4PK4A 1GDTA 2CU7A 2K85A 3GW2A 3QPHA 1BL0A 1SFEA 5B1BH 3WTYC 4D5FA 4KIBA 2QQ9A 1FYLA 4DYQA 2YU9J 1Z77A 2L02A 2YX4A 5E3MA 1N77A 2PMHA 1LNWA 2LYCA 4R79A 5JFRA 4UV9A 3HGYA 1GXPA 2UWMA 2CW7A 2ME0A 5DD8A 1E0EA 1SFOJ 4NNJA 2PJRA 3ZR8X 5DM7F 1FP1D 4BKXA 3CCLI 4NBQA 2CQKA 3BG7A 2COBA 3IRQA 3H3ZA 2O8XA 3P9KA 3I58A 2VBWA 2OTLI 4GRIA 4E7SA 1YX3A 2VASA 1WPKA 2HZTA 4BY1J 1WWXA 4L9TA 2BBYA 4BJ6C 3S93A 1BW6A 5D6EA 1MBJA 1F43A 2ESHA 3HJEA 2QENA 2YSRA 1YHQI 2HTJA 1SD6A 2EK5A 3BJ6A 4CCNA 4R8HA 4HQEA 3PNVA 4NQWB 1ZKGA 3K7AJ 2JWTA 1BOAA 5LBQA 4GYGA 2EV6A 4LJZF 3T5XA 1UMQA 2ZSIB 3HHGA 1T39A 2L9NA 5EYRA 5KK1A 4N0BA 2KLOA 2GXAA 2EJRA 2VOPA 2M1BA 3OS0A 1FNNA 4IQJA 2DMUA 2XGEA 2JN6A 2MH9A 2EZHA 2LBFB 5KVRA 1ON1A 1XGMA 1X3WB 2Z99A 4UB8C 3TGNA 1Z05A 4CCOA 2MLGA 2XKOA 3S17J 1WHUA 2STTA 1R1UA 5CKTA 2OU2A 3GTQJ 2DA1A 2NS8A 4EATA 4OIQF 1T98A 2HOTA 2LF7A 1TW2A 4E7LA 2FU4A 2DJIA 3HRSA 3QPLA 4XIDA 3C1DA 1QZEA 4BACA 2JRMA 1WSUA 5CVJA 1BIAA 2KKOA 4A6EA 4DW6A 2L7FP 1XMXA 2IP2A 3M8FA 2DOEA 2ZNYA 4Z6YA 3H5AA 3HHHA 3PUFA 3PSFA 5DUIA 3WE2A 3RTRA 2XVCA 1SFXA 2VKHA 4BJ5C 5K5QA 4BH9A 4BXXJ 3CJNA 3DPLC 4BEHA 2KP6A 2XRLA 1VF9A 3BR5A 4PGGA 4XL9A 4G12A 1YRNB 4G6QA 1IDZA 1MBHA 5AIPA 3OS2A 3MD2A 1YTYA 1R00A 4ENKA 1Z91A 3U9GA 2QBYA 2Y69H 4XK4A 3ZN1A 1LVAA 4ZZLA 3M3YJ 2L9SA 3CCJI 2E1CA 1BJZA 4FTHA 3CCEI 3CCMI 3S3OA 1R49A 4BQQA 1RNLA 4MHGA 1WCMJ 2EH3A 3EUHA 1LKXA 3WTWC 2CRGA 1YS6A 1LDKB 2A69F 4AC0A 1U3EM 3F0CA 1XTAA 1WFXA 2EFPA 3K4BA 3GYHX 1OFCX 4P1WA 1VQNI 5L3BA 4XKCA 3L2QA 4A3FJ 4I7HA 5FRNA 2L3DA 2E1MC 3D0SA 2L2OA 1BI2A 3H0DA 2XF5A 4A3KJ 2H1LA 3AFHA 4FASD 2Y0MA 1G3WA 2Q0OA 1P92A 3QP5A 3BWGA 4MFEA 1I5ZA 4Y17A 2ZO4A 2ICWG 4FCYA 1PUFA 3HB9A 3ZXSA 2P8TA 4I0BA 4UXNA 3CJQB 4KISA 4II2A 3CDLA 1TQPA 1JUPA 5HNFA 4LIVA 1MSEC 2UUZA 1D0ZA 3U1KA 2LKXA 3S16J 4V2GA 4CA0A 3HOZJ 1P4WA 3M1CA 3IH4A 2ZNZA 2KZVA 3H36A 2O8KA 3R0JA 3DTIA 3F72A 3KP4A 3S2HJ 4L9NA 1MMAA 1TWCJ 2XC7A 1DP3A 1GV2A 2OCEA 5CQEA 5GADJ 1EJ9A 4IHTA 1JGGA 4HAMA 5IOYA 3KZZA 3GFJA 4I2OA 5FJ8J 1HXDA 4WXCA 1E2XA 2K3FA 1F4KA 1WVRA 5LEKA 3T0YA 1SVOA 2OA4A 1PJRA 4ASNA 2VQCA 2O03A 4CDGA 4XKVA 4KMFA 2W00A 2A61A 3CO6C 2P7CB 3PM1A 2CFXA 3E7LA 3LL7A 1YJWI 4B09A 2P81A 4D5CA 3L09A 4EGZA 1O3QA 4ZH4F 5F0FA 2CMPA 1LUJB 5ED4A 4ZYAA 2HYFA 1K79A 3WU2C 1QA6A 3OYBA 3MVPA 1YIOA 1MNMC 2IS1A 1IGNA 3LWFA 5C4JJ 2HDDA 4L5IA 4ANJA 1JKRC 1MKMA 2EFQA 3CJRB 2HU9A 1H9GA 4AD9A 1J2XA 3P9CA 4P96A 1ENHA 1J0RA 4NHJA 4Y4RA 2GM4A 4G9YA 2BV6A 3EPZA 3AL0C 2QA4I 2R3SA 1VQ5I 3W2AA 5FD5A 5LRSA 5GAGJ 3WTSC 3EYIA 2BW3A 2LDUA 1BJAA 1SFUA 3TP0A 1ZRFA 1YOVB 3FK6A 4HF2A 2F48A 2IS6A 2VJ4A 3O2PE 1ETYA 5IP6A 3K1PA 4ENMA 4XLCA 2VT2A 1Z6RA 1I6HJ 2EIKH 3FXMA 3GWZA 1KU7A 3TBIA 2EQRA 4E4HA 2BW3B 1ZAOA 5FB2A 1PDNC 2JK3A 5H20A 3F9KA 2LG4A 4GYIA 4I76A 5HDNA 3I53A 4A3MJ 3OYNA 2CUEA 1QU3A 4N4OB 4XICA 3I9V2 3CC7I 2W4SA 4A3BJ 1RKWA 3ZMUA 3RPQA 1Y39A 2LC2A 5EG0A 5K5RA 4LGWA 1SANA 1XMAA 2E71A 3Q0UA 1TWHJ 4ZYEA 1WJCA 2RNJA 1R7JA 2PJRB 4RAGA 4FX4A 3BJAA 4BU2A 2VBYA 1VZ0A 3LSIA 1K4SA 3AG1H 1JTXA 3VYTB 2BEOA 3J7AY 3BQZA 1E17A 2DYSH 3P7NA 2E7XA 3ZP5A 4Y15A 1VQPI 3DKYA 4QLCU 4WX9A 3BCBA 1SD4A 2DFFA 4ZTFA 4U0WA 1TQIA 4BE2A 2Y2ZA 3AL0B 2DODA 3MEXA 4P5OA 5DTDA 1IUFA 4EJTA 3BR1A 1TW3A 2CUFA 1HCRA 5FKLA 1BR1A 2DT6A 1IRGA 4LD5A 1W7PB 4YFNF 1GV5A 1V3FA 3F3XA 1Y56A 2X1EA 5DD4A 2CUZA 3FXLA 3NWSA 1XX5A 2X6WA 2LR8A 3AKZA 3GTLJ 1QRYA 2Y31A 4FX0A 4OIRF 1MMSA 2H6BA 1VI0A 2DDAA 2JVHA 2V26A 3DKXA 2X9DA 4JX4A 3CESA 3JSPA 3P9IA 2E35A 1R23A 5IYDJ 4HG2A 1FP2A 1Y8RB 1L0OC 1X1BA 4LMYA 3L1PA 5J8CA 4XOTA 5E1ZB 5L3DA 1J7KA 2JA7J 4IF4A 3RQIA 2UXNA 3G3ZA 2A07F 4HPQA 1BR2A 2CYYA 2DFIA 2BHZA 2P4WA 4XQFA 1P2FA 4AYBN 1XGSA 4ZTJA 3CC2I 1XDSA 1KU9A 3HUGB 3V7CA 2W84A 3HOYJ 1R1TA 3MZYA 2H94A 2MC3A 2R7QA 1ZH5A 1AOYA 3RI4A 2A6HF 2K7LA 2EINH 4Q47A 2QZ8A 3ZOBA 4A6DA 4U7BA 3SZTA 3ZQLA 1JTYA 1V5GA 1O7FA 2NS0A 3S3NA 4Z2YA 5LGTA 3MFKA 5BPIA 3WU0A 4RB0A 1D1BA 2BOLA 4L18B 1OQYA 1T33A 3BP8A 2PLYA 3VDXA 4PJMA 5M5WJ 5KNLA 1TWAJ 2E34A 4JOMA 2K86A 4TV7A 1IUYA 1IV6A 4ETSA 5EGOB 5E8GA 2ZJ2A 2OQRA 3I64A 2NVQJ 2HYJA 1TP4A 1IRFA 2R7WA 3FMQA 1Z67A 2IW5A 1QHHD 4CGZA 1A35A 1YE9A 1NK3P 1S5LC 5J3LA 3E6DA 2ZC2A 1MSFC 4ABZA 4A3GJ 2AXTC 2VJIA 2HQ5A 2Q2EB 2IS2A 3TOBA 1Z7UA 1MDMA 2BY0A 5B5EC 5LGNA 3PL8A 2CS3A 1FOYA 4XN0A 1ZLKA 2KDZA 1ETWA 2CQXA 1WJDA 3OIPA 5E3OA 5D5UB 3TP3A 1JJ6C 1AKHB 2R7XA 2X6YA 2KJCA 2QSGX 3MZHA 3K69A 3A0BC 2WAQN 3CCSI 2MGQA 1MDMB 2XUBA 1G59A 1G3YA 3TW7A 4EJUA 2PMZN 3BY6A 3WU1B 3I71A 4XMYA 2HI3A 2LF8A 2LH9A 2K9LA 4HEA2 2MW8A 4A3CJ 2R5YA 3GCMA 3R4KA 2JPBA 3QU3A 2X0LA 5DEQA 1IG7A 2XRNA 2AHQA 2F5EA 4KUMA 3DEWA 4G8XA 2IAIA 3E0JB 3JCUC 4PUSA 5K5OA 2VJJA 3DU6A 4ZYHA 1LB2A 3LFKA 5A2QK 4I99C 3CD6I 4NDLA 2WAQA 2JT1A 1HQCA 4II3A 3FXUA 1UELB 2M87A 3BT9A 1R5HA 4XNFA 3VYUB 2EWNA 1R4MB 1VFCA 4KJZA 3RKYA 4M74A 3RPUD 2FNAA 4N9HA 2QYOA 5D4SA 4W97A 1FIAA 3CF2A 3DTEA 2KIUA 3C2GA 3OR1C 1XD7A 5HDKA 2COMA 4L5JA 3BDDA 2F2EA 2TDXA 1WZ2A 3VWBA 1WQ2A 2B7EA 3AG4H 2V1XA 2R5ZB 3CUOA 3HM5A 2F4OB 4S04A 1TLHB 9ANTA 5L3CA 5IYBJ 2O6GE 2CW0F 1TTYA 4I98B 1AHDP 3BR0A 3ASOH 3J81Z 2Y48A 1Y0NA 4EJWA 2KISA 1CF7B 2QF7A 1S29A 3FBIB 4IOCF 4ZZDA 3C18A 4O3MA 5FKKA 1T95A 1YW9A 5E18F 1MJBA 3OOPA 3D1NI 4I01A 1RKTA 5LEJA 2CJJA 2GOXB 2HDCA 2JPCA 5GP9A 3DBRB 1NHAA 4FT8A 1R71A 1LEAA 2PX9A 2L01A 3DLLF 5KAFC 2ZJPF 2E5NA 3SXYA 3ZQGA 2JA2A 2QQ8A 2LOOA 2PMUA 2CV2A 5HS9A 2RN7A 5GPCA 4UV8A 2W85A 4FQGA 3O6BB 4J01A 4EGYA 1ZARA 1LFBA 4ZC3A 3OWTA 2XDVA 3DEUA 3WGGA 1REPC 3TEDA 3VSLA 4BHPA 1YYVA 2K40A 2RNGA 3CCVI 1OISA 4U0YA 4HX8A 3BC8A 4M3EA 4IJAA 3LNQA 1SVLA 2ELHA 2LTPA 1ETVA 2VC1A 4FE4A 3A4CA 4C3HJ 3IV5A 4RGSA 3GFLA 4U88A 3K2ZA 4QPOA 1O3SA 1W5TA 2AQFA 2V6EA 4F91B 4UY8I 3IUOA 1DPUA 3S15J 2K9QA 1SVMA 2I5UA 2OCCH 4UVAA 5C44J 1IF1A 1W0TA 2JTVA 3H3VK 4GFBA 1IN5A 2DQRA 4ESFA 2HS5A 1IRXA 3KCCA 3FX3A 3RJPA 1RUOA 3GTPJ 5M3MJ 2FUG2 2K27A 1ODDA 1KU2A 2VOOA 2KT0A 5E20A 4EMSA 1BI3A 3EQLF 3F22A 4KIFA 1O3TA 2G7UA 2OUMA 4D1QA 3KP2A 2DFHA 1WGXA 4FHTA 4BBRJ 1WH5A 3V8JA 3L9FA 1MMDA 1J5YA 3LAPA 1LQ1A 4C3IJ 3IWZA 1O7LA 5CVRA 2ACJA 2G0EA 2VBZA 2V9PA 1T6SA 3CLQA 3F8CA 2Y0SN 3PSIA 4G6TB 1W7PA 2VKEA 5L3EA 3KLNA 2ZJRF 3PQJA 3HSFA 1LPQA 2IS4A 4A93J 1U8BA 1S7OA 2P6SA 4C2MJ 3OR2C 2M5WA 2QSHX 1A36A 1RIOH 3Q0WA 1DP7P 1XMKA 2Q1ZB 3OL4A 3SZGA 1TL8A 2GIZA 3EUHC 2JMWA 3RKWA 1IW7F 1Z3XA 2XGXA 1VTNC 1JE8A 1MZBA 1HF0A 3TDUC 2L4MA 1X58A 4MQ9F 4RA2A 3ROUA 1ACIA 3VOEA 5ERIA 3BZ6A 2X51A 1PUFB 2IGNA 3KEQA 1HLVA 1HC8A 5M5YJ 2R7TA 5JR3A 1VQLI 2HYGD 1IXSB 2RKHA 5DCMB 1U5TC 1YJNI 3WHCA 5E8IA 5J4YA 4A3JJ 5DYMA 1AU7A 5FFXA 4EEFG 3KPHA 2XIGA 2V4JC 2L9VA 1ZHFA 2XSJC 4GCVA 4KN4X 4M3GA 3U2RA 5B1AH 5HS8A 2JSPA 2R93J 1ZG5A 2PJPA 4OMZA 2EV0A 1MGTA 3GTJJ 3MKZA 5TJJA 4RLQA 1RESA 2KIMA 1ZK8A 3GUDA 4M71A 5AIQA 2JA6J 2O0YA 4XBFA 4BDYA 4NC8A 1R9TJ 2EFNA 3ABUA 1BI0A 2IBDA 3WTZA 2F4IA 4CICA 2K02A 3R0AA 3DWLE 4M73A 3JRGA 1WKMA 5F27A 2OPTA 4OINF 2PI0A 5F0HA 5LRRA 2DI3A 4OAYA 3E1SA 4MQVA 4PFOA 1JXSA 4U0VA 4V19K 1S7AA 1X1DA 3K1NA 2XHKA 2F5CA 5FKOA 2R7DA 4MEYF 3DTKA 1D8JA 1O57A 4B44A 3ZPLA 2VLAA 1KA8A 4LLNA 2RDPA 1WH7A 3KYDB 2ME6A 2LY1A 2DPDA 1OLTA 2OJED 3L2WA 1EA3A 4H0EA 5F64A 2N8GA 2ELKA 2GIVA 4MLOA 2O61A 4ZYGA 1FSEA 2LD5A 3H35A 5D5XB 5DCMA 4PGHA 2XAQA 3GLXA 2HZDA 3DCFA 5ICGA 2JVGA 3K70C 1XCBA 3BOQA 1VQOI 1SFKA 4L9JA 1HSTA 1RUNA 1K78B 2TCTA 3CZ6A 1XG1A 3G71I 2FSWA 4KIGA 3SQNA 4ESJA 2WV1A 1LVKA 5FLXK 5GAEJ 4KICA 4RAYA 5FLXZ 3CQZJ 3FHZA 2LLKA 3F8BA 1R4NB 5FO5A 2WAFA 1LDJA 4RDUA 2CQ7A 4XM3A 4NC7A 2HR3A 3JTGA 1UB9A 4GO1A 3V7RA 2AS5F 2PN6A 3CTAA 1A04A 2E5ZA 5DDGA 1FOKA 2DT5A 2A5WA 3GTGJ 3IKTA 1D0YA 1FC3A 4WCGA 1FIPA 3EYYA 2HQRA 2HKOA 2EBIA 1U5TA 3JREA 1LFPA 2YU3A 4CH7A 3OYMA 1SAUA 1RPWA 2F6CA 4HNUA 3JRDA 3PIOF 3W6VA 1XN7A 3REOA 2VE9A 3HUGA 4X1EA 1IN6A 4P9FA 3GF2A 3LFUA 3UKGA 4D7MA 4IHXA 3I0TA 4BHCA 3J7ZI 4IVNA 2F5VA 2HXIA 1HKTA 3VB2A 1GVDA 3TKYA 4I0AA 4C2TA 2A6TA 5IT9K 1MBEA 1R22A 4HA8A 1XPXA 4DBRA 2LFBA 2PQ8A 2DA3A 4BDZA 3ZQQA 3CUQC 4A3LJ 4EM2A 3HKZA 3W6KB 3C2HA 3S3MA 1K78A 1PVEA 3A1YA 3ABLH 4B43A 3CMMA 2QGUA 2HNHA 4B4CA 2NOGA 4X0GA 5BPDA 3H9QA 4EVIA 4M9ZA 1N25A 3BG3A 3GLLA 1W36C 2UZKA 3OYAA 4ZDOA 1TWGJ 4XLFA 4HOBA 2O7OA 5H6QA 3HOUJ 3HG9A 1X4OA 3NWTA 1IN7A 3ZQCA 4RB3C 3A0HC 3SZPA 1NG6A 1P9QC 1OKRA 3FISA 2DU9A 2FJ1A 3GXOA 5JI6A 2M45A 3JAMK 2JUCA 2DA5A 4XLAA 5F1JA 2ECBA 3JRHA 1K83J 1T08B 3I55I 2XAUA 3DLAA 2VQLA 2G7HA 4G7HF 4BHBA 1JUMA 2NXNB 3CMYA 1Y8QB 2JUGA 1K6OA 4M6XA 4E70A 3E5XA 3S1QJ 3PQKA 2R7SA 1U9NA 3F8MA 3S8PA 3HSEA 1T2KA 4F55A 4O5VA 2KZGA 3FKJA 4MFDA 3UR3C 1MH3A 3ERMA 2HTSA 4UVBA 4J00A 1ZG1A 2HOSA 1SD7A 3CUQB 2J5OA 4QIWN 2R5ZA 3BG5A 1SMYF 1LEBA 1ZR2A 2L5QA 1ON2A 5HLIA 3J7YJ 2RGVA 4UUSB 2FQ3A 3BTLA 1YX5A 3K0LA 3KP3A 3A01A 1OYYA 2L7MP 1IXRC 1FJLA 1ERDA 4DGWB 4F7ZA 1WJEA 3CUQA 1K4TA 1ULYA 2W57A 4DBQA 5LD2C 4DYCA 5E1XA 3OY9A 3GTKJ 2ZXWH 4ZDLA 1YITI 1LE8A 3O3KA 1ZGWA 4NB5A 2MD0A 3F23A 3LMMA 3BCAA 1VNDA 4BQNA 4RB2C 1BW5A 2CO5A 2HFHA 4KFCA 4A2UA 4BAYA 3X2QH 4UB6C 3KZYA 1OCOH 2BY3A 1GXQA 1KQ9A 1S6LA 1QNTA 2DYRH 3BG6A 1UZCA 1J59A 2ZMEB 4YEJA 1IV8A 3F8NA 3BTJA 2GA2A 1QBJA 3FM3A 5BS6A 5GPAA 2Q8KA 4RS8A 2WAEA 1FMVA 2MG4A 3I5UA 5GAHJ 2VE8A 4XSZF 1QHGA 4BJTA 1JKOC 4GDFA 5KCMA 1I6XA 3A03A 5F6FA 3BR6A 2JA5J 2LVSA 3BG9A 4U87A 3MN2A 1KONA 2BY2A 4NUBA 4AVPA 3L2RA 3OSGA 3Q3SA 2ZFUA 2WC2A 4EQQA 3QYEA 4IHWA 2YUSA 3OIOA 1X1PA 4RGRA 3VFZA 4AVZA 2DN0A 1BR4A 3FMSA 4C2UA 4H4KC 2K4BA 3K4JA 5ILSA 2FBIA 1P6RA 2LRDA 3F6VA 2VUMJ 1V55H 1B4AA 1IN8A 2DFEA 2CQNA 2VJ5A 2A3SA 4IKFA 1SEUA 3K4MA 1Z0XA 2LREA 4A0XA 4I09A 3KP7A 4XLEA 4RLFA 3HOSA 2P0WA 3RQ4A 2QQAA 2A5YB 1RETA 4MTEA 1Y1VJ 2HGCA 2P5KA 3K70D 1YLFA 2EB7A 1OJLA 4M72A 2DO7A 1Z6TA 1EH7A 3LQRA 3FK7A 1RC9A 3J80K 2E1MB 5DV5A 4QPQA 2Y75A 2IA0A 1FTZA 3ML6A 1EH6A 2E7WA 2QCOA 1TT0A 1FOWA 2CUJA 2OD5A 3BTCA 2X85A 1ETQA 4PJLA 1XGNA 2FOWA 1FTTA 2ID3A 5F08A 1VQ9I 2RQQA 2IA2A 3QP6A 4MIMA 2M3AA 4WK8F 3WTXC 3LA7A 3FXKA 1J09A 1AA7A 3MZ8A 1P4XA 5C4XJ 1T56A 5JHUA 4E7HA 3QU6A 4BQOA 1U9OA 1W4MA 1YS7A 2V79A 4MGRA 2GLOA 3SFZA 3RCOA 1IC8A 1BC7C 1MW7A 1UG0A 2DMQA 3PJRA 2CWEA 1UCRA 1Z9CA 3E5UA 1ITYA 1W7PD 1F36A 3KE2A 4E7KA 3G4SI 2WWYA 4HDUA 4G94A 1GVJA 3VYRB 2HPMA 3QRFF 3N05A 2EFOA 1BM9A 4JBAA 2B9SA 2ZFWA 2NVYJ 5JLWA 1ZRCA 2QLZA 1FY7A 3ELKA 5TGTA 2JRTA 3GZ6A 5LHGA 1AKHA 3NARA 2CSOA 3IH2A 2XPWA 3FXQA 3G1OA 4OWRB 3CC4I 2ZSHB 3HPGA 4UNOA 1SD5A 3IP4B 4KDPA 1X3UA 2HEOA 3NAUA 4RGXA 1U78A 1K6YA 4S0HB 3S1RJ 5EEHA 4E7ZA 3B73A 2ZXJA 4OOIA 1AWCA 4KYWA 2BY1A 2E1NA 2OZ6A 1ETKA 5HLTA 3HOVJ 3B6AA 1BOBA 1Y6IA 3TO6A 5J1RA 3OMYA 3OYFA 2GXGA 3WGHA 1JKPC 3N97A 2R7UA 3BR3A 3PO2J 3QODA 3QWLA 1G3SA 1GUUA 2XAGA 5FLVA 5EEGA 3CDHA 5HDGA 2IPQX 5EZHA 2DOAA 1Q1HA 1PUEE 2O9LA 1IRZA 3HRTA 4M9SA 4L9VA 2M7BA 2JSCA 3M9AA 2NRAC 1OCCH 3FBNB 4FE7A 4KT5C 3MKYB 3BPVA 2HVRA 4RM2A 3JRAA 5LGUA 1DGWY 3C3WA 4CO8A 5KHDA 1KQ8A 3QYBA 3ERED 5M3FJ 1V5EA 3IKVA 3Q5FA 1Y0UA 5EGOA 3M7GA 3DP7A 4BQAA 5IOZA 1FYMA 3V4GA 4CHUA 1B59A 4BXFA 3H92A 4BEHB 2ETHA 2UV1A 3PNTA 2VPLA 1VQKI 3LSRA 3DXJF 4XSXF 1HDDC 2DA6A 5E79C 3OS1A 2D1HA 5K1YA 3HRUA 3L2CA 1YFHA 3TW6A 2LBFA 4XONA 3J81K 1PP8F 4KNYA 3KIOA 2LNBA 2TRTA 1VQ8I 2H27A 2M34A 1TT5B 1WJAA 4BGDA 1HKQA 4XOPA 3T8RA 5KAIC 1TBXA 3FIWA 1HSJA 2VQGA 4JQFA 1R1VA 3HBLA 1KQ0A 2Z3YA 3QAHA 4LG0B 3SDGA 3SDBA 1G4DA 3DF8A 3W2VA 1G3TA 4IO9F 3TO7A 2HXOA 2M2EA 3L00A 3I3LA 2MFZA 2DK5A 4Y13A 1IO2A 1B9MA 2PEXA 4DJAA 2LMDA 1ZG3A 2MBFA 3F8FA 4E7JA 2LKPA 1JJ8C 2P7VB 3SYTA 2OZUA 2K9SA 3FDYA 4A0YA 1ZN2A 5CVUA 1DQUA 5E17F 2DOFA 2NYXA 1PYVA 3IC7A 3ZQHA 3OYLA 3LSGA 3UNGC 4YFXF 5A2QZ 1FSHA 3NEUA 3ZRGA 4B8XA 2HPIA 5K7ZA 1CGPA 2W25A 1QO0D 2E60A 3BROA 5JHFA 3L7WA 1VQ4I 4LFUA 3RYPA 2M0CA 4KITB 2E2IJ 3OYIA 4RBOA 3HYIA 3TQNA 2R7RA 2IEKA 3HOWJ 4UUSA 3ISPA 3Q0VA 3S14J 2EIJH 1D5YA 2PFBA 3KP5A 4BE1A 2KRFA 1VQ6I 2KDOA 2OV7A 3EUAA 4HSTA 2VXZA 2HVSA 2V6CA 4EM0B 2M8GX 1HBXG 1TWFJ 1W5SA 3HXLA 4PJ0C 4M6YA 4K2EA 2MABA 1YJ9I 5BOXA 3R61A 2EZIA 4L0YB 4C9YA 2I8DA 2XAHA 5D8KB 3CCQI 2CQQA 2W1OA 4EJVA 1V54H 2ZXIA 2MC4A 3T1BA 1DPRA 3CO7C 4Q4ZF 3J80Z 3K4KA 3MAJA 4B3AA 2OAZA 3OYKA 3WTVC 5K7HA 2Z9OA 2M9HA 1N78A 3RZDJ 3U21A 3BR2A 3T8TA 4HX7A 3KETA 2FA5A 1I3QJ 2WBMA 1D1AA 2JJ7A 4HLYA 4CZZA 1JT6A 3D5RC 3ZGKA 2CFOA 3U1DA 1UJ8A 3O8HA 4PFPA 3MMYB 3V7SA 1GT0C 2W82A 5HODA 1YO5C 1ETOA 1XCVA 1U6GA 1M1EB 3DKWA 5F1RA 3HL2A 2Z16A 3TO9A 4M9XA 3ZMDA 3FKIJ 1I39A 1VQ7I 4ZJZA 1S9HA 4HQMA 2R7VA 4HNVA 2FMLA 1IXCA 2EV5A 3BZCA 1DUXC 4D0PA 1T8IA 3ZMTA 1NH3A 1HW5A 1MH4A 4CYCB 1X3ZB 2H6CA 4XKBA 5ILUA 1ONVA 1HKSA 4GGGA 4CUGA 4UHTA 4ZYDA 1HA8A 4ITVA 1UAAA 4WF2A 4N9IA 4AWXB 5BMZA 3OSFA 2M4KA 2D2WA 4DZJA 2KIFA 1QQIA 2FD5A 1IDYA 4PDKA 2WTEA 2WY8Q 2L9RA 2K3PA 2WB1N 2GAUA 3K6GA 4HV6A 1ZQ3P 1FT9A 4Y52J 3V8LA 4XRSG 3FXJA 3JRIA 1ZTRA 2E36A 3BPXA 2QWWA 4X6AJ 2XV4S 4A5NA 2R7FA 3WG7H 4J19A 5EJCA 3DPTA 4W1UA 3QOEA 3HRMA 3DPUA 1HW2A 3RSNA 1OR7C 4M3DA 4PZJA 3G1MA 4C30A 4QSHA 3S2WA 3HOTA 5F0CA 2BYVE 1GLNA 1IJWC 1G8XA 3G1LA 5ICFA 1G6NA 2NNNA 4D9JA 2OTJI 4I02A 3PUBA 4BE0A 4IHYA 5J4VA 3GO5A 2NVXJ 4KA4A 2R5YB 2Y30A 4JX5A 2KL4A 2IVMA 2P5VA 3V8KA 1USSA 4AYBA 1B9NA 5GTIC 1ZR4A 3A02A 2XGCA 1W36D 2EZLA 5LFAA 4CYCA 2EZKA 1FLIA 2LK2A 3ONQA 1EF4A 4XRFA 2DMNA 4BXUA 2QEXI 1TZLA 1WJ5A 3H0GJ 3R60A 3E6CC 1U5TB 4DIQA 2NVTJ 2E19A 2HWVA 1YW7A 1Z1DA 3OYHA 3FWEA 3B02A 3JR9A 3IAS2 3K4NA 5H6RA 1MBGA 3RDIA 2X1DA 1RR8C 1NK2P 3O8GA 4IHSA 1S8NA 3KFWX 4FETA 2FBKA 2P5LC 2KRCA 3HGGA 2BGCA 1FX7A 3NRVA 5IT3A 5LLQA 1XB4A 1Z21A 5DUKA 2K9NA 2VKVA 2K4JA 3VSKA 2DJNA 4C3JJ 5J8FA 1Z3YA 3F21A 1RRJA 5IYCJ 2LY2A 2V1DA 1R6RA 1S3JA 2FRHA 5FGMA 4BS9A 1QZYA 2GBYA 5EDNA 1CQTA 3E6MA 1YQAA 2O5RA 3IH3A 5HNHA 3RYRA 4CXFA 4E7IA 2HVQA 3E6BA 4RMNA 3OOUA 3RIRA 1Y1WJ 3MKLA 2LKSA 2DBBA 3C2BA 3TOAA 1LJ9A 2BE5F 2HOAA 2A05A 5E3LA 1JT0A 4WXHA 4P55A 2V1UA 1U8RA 4S05A 2DTRA 1P4AA 3CP2A 3JRFA 4BYYA 4Y33A 1UHSA 2PMZA 4XR6A 5CVIA 3S32A 5E3NA 4L0ZB 2IGKA 2IRFG 1BA5A 2X6XA 5IP9J 3I59A 4PSXA 2HDWA 3LQQA 4A0ZA 4CYDA 2ZJQF 3CCUI 1S72I 3SFIA 4JX6A 3S1MJ 2R92J 5JLXA 2MA3A 2P6TA 1R5ID 1WJFA 2VKDA 1RI7A 2FNPA 1UG2A 2R7OA 4LIUA 2BVLA 2EA4A 1TNTA 2ZB9A 4XRMA 4HRIA 1R5GA 4LB5A 2ID6A 5D4RA 1QPIA 3GX4X 2J5PA 1TQMA 3LSKA 2ZBKA 1A5JA 1KU3A 4RAZA 3ZQFA 4B1RA 2VQHA 2XASA 2DMPA 1O4XA 5FD6A 5DS9A 3SHFA 1MBFA 4B48A 2CV0A 3W2WA 4MEXF 1HDPA 1X1CA 4PJNA 1OCTC 1SC7A 4M3FA 2NVUB 1OYWA 4F93B 1W1WE 3M4OJ 2DK8A 3SJMA 1O3RA 4IQ4A 4HX4A 1OMIA 5CQGA 2LSOA 4L5EA 2FMYA 1I27A 2RAEA 1F5TA 4UUVA 3ZN0A 3HIFA 4XLNF 2L0KA 1UHMA 1YW8A 2AQEA 5IPAA 2FE3A 2OF7A 2XPUA 4OU0A 2GQQA 1JI8A 3OYDA 3FXRA 5EG0B 1D3YA 2FBHA 1YI2I 1YRNA 3IHUA 4F52A 3ZMSA 3Q9SA 2VBXA 4DQ2A 3GZ5A 4KT6A 1POGA 2KIQA 1APLC 2FF4A 5J47A 2XF7A 4YIRX 3ECOA 3R6SA 1WI3A 4A69C 5D8LB 3QYFA 2XSDC 2ZMEA 3FF5A 3CF5F 2NS7A 2XPVA 2VL8A 5DCFA 1ZGAA 1LDDA 3HTSB 1OR7A 3M8JA 2QSFX 3ZCOA 2MSYA 1BIBA 4BBSJ 2Z33A 1MBKA 5DM6F 2MH2A 4U7DA 1TC3C 4ESBA 2IGMA 2DA7A 1DGRM 4IRIA 3GTOJ 1QVTA 3I4NJ 3MWMA 3G6EI 2OBPA 5HS7A 4LG0A 3ZQ7A 2QBYB 3GBGA 1EH8A 1Z7LA 2UXXA 5IP7J 1XSDA 3QPSA 5TISC 5CVVA 4LLLA 2YPRA 4LG3A 5ICEA 4LK0F 2OQGA 2WV0A 2LP0A 3H3UA 4LK1F 2H1KA 1IN4A 2DDBA 5CJ9A 1UFMA 3WTUC 2DQLA 2CG4A 2CV1A 2V7FA 1ETXA 3JAMZ 4B47A 2V9KA 2CGPA 1T0FC 1I50J 1QVUA 2R0QC 1P7IA 5FKNA 3CCRI 4D7NA 3GEZA 1OPCA 3DQVC 1D1CA 5D6FA 1EV7A 2IJLA 2XROA 2YR2A 4PJJA 3CMEI 2KHMA 4KMUX 4NC6A 5J1YA 2M0MA 1G2HA 1E3HA 2ESNA 1N75A 4IHVA 2F5FA 4QWQA 4WXDA 4HSRA 3BTIA 3G2BA 1HOMA 1RZ4A 4E6KG 1L3LA 4CCKA 2V1NA 3CLOA 3ASNH 5H2FC 4XN3A 2AXLA 4F3QA 2D1VA 3JSOA 1X1AA 1OCPA 5IT9Z 1A31A 3RPUA 1KYWA 1MJAA 2M30A 1BC8C 4UVCA 3N4MA 4AIDA 3MKWB 2VODA 3HTUA 3GTMJ 5L3GA 2Y0SA 4HDVA 2WY7Q 1XSXA 4EM1A 1FMWA 3FHNA 4DNCA 4A3EJ 2BHYA 1VQMI 4RAFA 1EKEA 3DEEA 4CCJA 2W7NA 1FYKA 2VXDA 1D8KA 1F1ZA 3L2VA 4Q48A 1ZRDA 2PBIA 1X2MA 4IRGA 2Z5UA 3NQOA 3TDZC 5FFZA 1DU6A 3FZVA 4HF1A 2H8RA 5B3SH 3OYEA 3I56I 4RB1A 2EFWA 4ENJA 2EILH 4N4NB 1XGOA 1ZYRF 2NAZA 3DBHB 2VPRA 3IAM2 3LSJA 2DCEA 1B72A 4IXAA 3C7JA 2BXZA 4YELA 2NNYA 4KN7X 4AU7A 3HOXJ 2FX0A 3OIQA 1J75A 2ZMEC 2DPUA 3M8EA 3I4PA 3SEZA 4HBLA 2FOKA 2FQ4A 3CP8A 5HVQC 2VB6A 3V42A 3BJOA 3WHBA 1K7AA 3PO3J 2RREA 2MD5A 5LHIA 1X2NA 3AG2H 2L4AA 3HC7A 4G7ZF 2W48A 1B6AA 4AIHA 2VI6A 1D0XA 2EA2A 2MLKA 1NTCA 1JUSA 2DA4A 2XF6A 5FROA 1YIJI 3KEYA 3KZIC 1QZZA 5EEAA 4YIFA 1U0JA 3WTTC 2JA8J 5ILVA 3LSMA 4OMYA 3HPHA 3HDDA 4LOCA 2A6EF 3ZMVA 5B66C 1KYZA 3LOCA 4MNUA 1YG2A 4AUXA 4P9UA 2YS9A 2L54A 1MMGA 3E5QA 2ISYA 2X48A 2Z2SB 2G9WA 4HNTA 3F6OA 2BVMA 1R58A 3BZKA 3JRCA 3Q9VA 3QOPA 1S7EA 3GFIA 3K4LA 4PSWA 1F9NA 3KEOA 1ZLJA 3OV8A 4M3BA 4JYKA 1H0MA 1SMTA 2ELJA 2PG4A 1LFUP 1XDUA 4OIOF 2KRHA 5J1UA 4DYRA 4EJOA 1RR7A 5C3EJ 5CLSA 4MO7A 4XLPF 3HSRA 4MTDA 5HOOA 1STZA 3QPTA 4DZPA 2IA1A 4JK1X 3BLYA 4F92B 1A6IA 1XS9A 3RKQA 2HKXA 3VODA 3J7AO 3DFGA 3IL2A 2DW4A 3G73A 1A6QA 2RV8A 1ORKA 3RKXA 3OYCA 2K9MA 3KYCB 1H88C 3JRBA 2XKPA 4R1HA 1I1GA 1ZGJA 4BY7J 2KJBA 3FMRA 1H89C 4CCMA 3FM5A 3K10A 3VYSB 5EF6A 3PFIA 3EUKL 4IEJA 1OCZH 2YX7A 3H9GA 1FZPB 1OCRH 1K61A 3CDIA 3MCZA 1BI1A 2D5VA 4ZDPA 4G7OF 1JGSA 2DLLA 4YG2F 2B63J 2W24A 3ULQB 6PAXA 3TMOA 5FKMA 4A12A 3ZMZA 2RQPA 1H9TA 2E2HJ 5J40A 3ZQIA 3PFYA 5GTHC 1H8AC 2RC4A 3DV8A 1B8IA 1ZREA 3EDPA 2FXAA 1WJBA 2QVOA 4HW0A 3KX2A 2HQNA 3LA2A 1ZELA 4G6DA 1B8IB 5JVGF 1FPQA 3OYJA 1FEXA 1NG7A 3CCYA 2R7ZJ 4OIPF 3W3CA 2Y9YA 3I54A 2C6YA 2KFDA 4BNCA 2H09A 3E3VA 3BQYA 4V2FA 4O6JA 3IWFA 1JKQC 2M7AA 4LB6B 4BL0B 4AIJA 1W5CC 4B3XA 2E1OA 3D5LA 3W6JB 4YRVA 1I3AA 1P7JA 2VT3A 5JVTA 5BQTA 1XC5A 3ESWB 2NOJB 1D5VA 3AG3H 5D5VB 1FOXA 2RVCA 3WG9A 4BUPA 2IT0A 2I10A 3COAC 2HOEA 1WRJA 4LLGF 2IGOA 4IX7A 1CF7A 3OL3A
chains in the Genus database with same CATH topology
4YFKF 1QGPA 3I59B 4PCQA 5LHHA 3GVAA 1FWZA 5ICCA 2GXBA 1T38A 1J9IA 5E1WA 1I1SA 3KLOA 1PP7U 2XAFA 3IRRA 3WE3A 1U2WA 1V4RA 1MJ9A 2VONA 2F5DA 4AIKA 1GHCA 2M8EA 4Q5SF 3ECHA 4RGUA 1JHHA 1WI9A 2QQBA 4IRHA 1BBYA 3KP6A 2X4HA 3WGIA 5TRDA 4HZFA 2GZWA 2JZYA 4ON0A 1B1BA 3WODF 2ADUA 3LAJA 3E97A 1IAWA 2DAOA 2ISZA 3M1EA 4A5MA 1XSVA 2GWRA 1FBSA 3LA3A 2GA1A 1FBUA 4HV5A 2VC0A 4ENNA 1KGSA 2D45A 1C0WA 1MD0A 4GXOA 5D5WB 1UHWA 1FBQA 3MQ0A 4HF0A 3K1MA 4WWCA 4HYEA 3JW4A 3ABTA 3VEPA 3K9TA 4YIIA 5CYVA 2QM3A 1T0FA 5HLGA 5HLHA 2FEZA 5AONA 1SAXA 2STWA 3JTHA 1BN5A 3LSTA 1IZ1A 4IPAA 1USTA 2VN2A 2O3FA 1HW1A 2ZCWA 2Q2EA 2V9VA 1R36A 1OYIA 4EV0A 5L3FA 3GFMA 2ZKZA 4NQWA 3EETA 1DDNA 2A68F 2XAJA 2B0LA 1TNSA 1JHFA 2QUFA 1QPMA 5J6XA 3AAFA 4HLXA 3GW2A 3QPHA 1SFEA 3WTYC 4KIBA 2QQ9A 1FYLA 2L02A 2YX4A 2PMHA 1LNWA 4R79A 5JFRA 4UV9A 1GXPA 2UWMA 5DD8A 1FP1D 2CQKA 3IRQA 3H3ZA 2O8XA 3P9KA 3I58A 2VBWA 2HZTA 1WWXA 4L9TA 2BBYA 5D6EA 2ESHA 2QENA 2YSRA 2HTJA 1SD6A 2EK5A 3BJ6A 4R8HA 4HQEA 1BOAA 5LBQA 4GYGA 2EV6A 4LJZF 3T5XA 1T39A 3HHGA 5KK1A 4N0BA 2EJRA 2VOPA 2M1BA 1FNNA 2MH9A 5KVRA 1ON1A 1XGMA 2Z99A 3TGNA 1Z05A 2MLGA 2XKOA 2STTA 1R1UA 2OU2A 4OIQF 1T98A 2LF7A 1TW2A 2FU4A 3HRSA 3C1DA 1WSUA 5CVJA 1BIAA 2KKOA 4A6EA 2IP2A 3M8FA 2ZNYA 3HHHA 5DUIA 3WE2A 3RTRA 2XVCA 1SFXA 5K5QA 4BH9A 3CJNA 3DPLC 4PGGA 4G6QA 5AIPA 1YTYA 1R00A 4ENKA 1Z91A 3U9GA 2QBYA 3ZN1A 1LVAA 4ZZLA 2E1CA 1RNLA 4MHGA 3EUHA 3WTWC 1YS6A 1LDKB 2A69F 1U3EM 2EFPA 3GYHX 5L3BA 4I7HA 2L3DA 3D0SA 1BI2A 2Y0MA 1G3WA 2Q0OA 1P92A 3QP5A 3BWGA 1I5ZA 4Y17A 2ZO4A 2P8TA 4I0BA 4UXNA 1TQPA 1P4WA 2ZNZA 3R0JA 3F72A 3KP4A 4L9NA 4IHTA 4HAMA 3KZZA 3GFJA 4I2OA 1HXDA 4WXCA 1E2XA 1F4KA 5LEKA 3T0YA 2OA4A 4ASNA 2O03A 4CDGA 4KMFA 2A61A 3CO6C 2P7CB 2CFXA 4B09A 1O3QA 3L09A 4EGZA 4ZH4F 5ED4A 2HYFA 1K79A 1YIOA 3LWFA 4L5IA 1MKMA 2EFQA 1H9GA 4AD9A 1J2XA 3P9CA 4P96A 1J0RA 4NHJA 4G9YA 2BV6A 2R3SA 5FD5A 5LRSA 3WTSC 3EYIA 2LDUA 1BJAA 1SFUA 1ZRFA 4HF2A 3O2PE 3K1PA 4ENMA 2VT2A 1Z6RA 1KU7A 3GWZA 1ZAOA 5FB2A 1PDNC 5H20A 4GYIA 5HDNA 3I53A 3ZMUA 3RPQA 5K5RA 4LGWA 1XMAA 4ZYEA 2RNJA 1R7JA 4FX4A 3BJAA 2VBYA 2BEOA 1E17A 3P7NA 2E7XA 3ZP5A 4Y15A 4QLCU 4WX9A 1SD4A 4U0WA 1TQIA 3MEXA 4P5OA 4EJTA 1TW3A 1IRGA 4LD5A 1W7PB 4YFNF 1V3FA 3F3XA 5DD4A 4FX0A 4OIRF 2H6BA 3JSPA 3P9IA 1R23A 1FP2A 1L0OC 4LMYA 5J8CA 5E1ZB 5L3DA 1J7KA 4IF4A 2UXNA 3G3ZA 2A07F 2CYYA 2DFIA 2P4WA 1P2FA 1XGSA 1XDSA 1KU9A 3V7CA 2W84A 1R1TA 3MZYA 2H94A 2MC3A 1ZH5A 1AOYA 3RI4A 2A6HF 2K7LA 4Q47A 4A6DA 2QZ8A 4U7BA 3SZTA 1O7FA 2NS0A 4Z2YA 5LGTA 3MFKA 5BPIA 3WU0A 4RB0A 4L18B 3BP8A 2PLYA 4TV7A 1IUYA 2K86A 4ETSA 5E8GA 2ZJ2A 2OQRA 3I64A 1IRFA 3FMQA 2IW5A 4CGZA 3E6DA 3TOBA 1Z7UA 1MDMA 5LGNA 1ZLKA 5D5UB 2KJCA 3MZHA 3K69A 1MDMB 2XUBA 1G3YA 4EJUA 3BY6A 3WU1B 3I71A 2LF8A 3R4KA 2JPBA 3QU3A 2X0LA 5DEQA 2XRNA 2F5EA 4KUMA 4G8XA 5K5OA 4ZYHA 1LB2A 3LFKA 5A2QK 2JT1A 1HQCA 3FXUA 2M87A 1R5HA 2EWNA 3RKYA 4M74A 2FNAA 4N9HA 2QYOA 5D4SA 2KIUA 1XD7A 5HDKA 2COMA 4L5JA 3BDDA 2F2EA 2TDXA 1WQ2A 2V1XA 3CUOA 4S04A 1TLHB 5L3CA 2O6GE 2CW0F 1TTYA 4I98B 3J81Z 2Y48A 4EJWA 1CF7B 1S29A 4ZZDA 3C18A 4O3MA 1YW9A 5E18F 1MJBA 3OOPA 4I01A 5LEJA 2HDCA 2JPCA 1NHAA 4FT8A 1LEAA 2L01A 3SXYA 2PMUA 5HS9A 2RN7A 4UV8A 2W85A 3O6BB 4EGYA 1ZARA 1REPC 3DEUA 3WGGA 4BHPA 1YYVA 4U0YA 4HX8A 4IJAA 2ELHA 2VC1A 4RGSA 3GFLA 4U88A 3K2ZA 1O3SA 1W5TA 1DPUA 4UVAA 1IF1A 2JTVA 1IN5A 2DQRA 4ESFA 2HS5A 3KCCA 1RUOA 3FX3A 3RJPA 2K27A 1ODDA 1KU2A 2VOOA 4EMSA 5E20A 1BI3A 3EQLF 3F22A 4KIFA 1O3TA 2G7UA 3KP2A 4FHTA 3V8JA 3L9FA 1J5YA 3LAPA 1LQ1A 3IWZA 1O7LA 5CVRA 2ACJA 2VBZA 1T6SA 3F8CA 1W7PA 5L3EA 3KLNA 3PQJA 3HSFA 1S7OA 2P6SA 2M5WA 1RIOH 1DP7P 1XMKA 3RKWA 1IW7F 2XGXA 1VTNC 1JE8A 1MZBA 3TDUC 2L4MA 3ROUA 4MQ9F 3VOEA 5ERIA 3BZ6A 3KEQA 5JR3A 2HYGD 1IXSB 2RKHA 5DCMB 1U5TC 5E8IA 5DYMA 5FFXA 2XIGA 1ZHFA 4GCVA 4KN4X 3U2RA 5HS8A 1ZG5A 2PJPA 4OMZA 2EV0A 1MGTA 5TJJA 2KIMA 3GUDA 4M71A 5AIQA 2O0YA 4XBFA 2EFNA 3ABUA 1BI0A 3WTZA 4CICA 2K02A 3R0AA 4M73A 1WKMA 4OINF 2PI0A 5LRRA 2DI3A 4MQVA 1JXSA 4U0VA 1S7AA 3K1NA 2XHKA 2F5CA 2R7DA 4MEYF 1D8JA 1O57A 3ZPLA 1KA8A 4LLNA 2RDPA 2DPDA 4H0EA 5F64A 2GIVA 2O61A 4ZYGA 1FSEA 5D5XB 5DCMA 4PGHA 2XAQA 3GLXA 5ICGA 1XCBA 3BOQA 4L9JA 1HSTA 1RUNA 1K78B 2FSWA 4KIGA 3SQNA 4ESJA 5FLXK 5FLXZ 4KICA 4RAYA 3FHZA 3F8BA 5FO5A 1LDJA 2HR3A 3JTGA 1UB9A 4GO1A 3V7RA 2AS5F 2PN6A 3CTAA 1A04A 5DDGA 1FOKA 2DT5A 3IKTA 1FC3A 4WCGA 3EYYA 2HQRA 2HKOA 1U5TA 2YU3A 1XN7A 3REOA 2VE9A 3HUGA 1IN6A 4P9FA 3GF2A 3I0TA 4BHCA 4IVNA 1HKTA 3VB2A 3TKYA 4I0AA 5IT9K 1R22A 4HA8A 2PQ8A 3CUQC 4EM2A 3W6KB 1K78A 5BPDA 4EVIA 4M9ZA 2UZKA 4HOBA 5H6QA 1IN7A 4RB3C 3SZPA 1OKRA 2DU9A 3GXOA 5JI6A 2M45A 3JAMK 2G7HA 4G7HF 4BHBA 1K6OA 4M6XA 4E70A 3E5XA 3PQKA 3F8MA 3HSEA 1T2KA 4O5VA 2HTSA 4UVBA 1ZG1A 1SD7A 3CUQB 2J5OA 1SMYF 1LEBA 1ON2A 5HLIA 2RGVA 2FQ3A 3K0LA 3KP3A 1OYYA 1IXRC 4F7ZA 3CUQA 1ULYA 2W57A 5E1XA 3O3KA 4NB5A 3F23A 4RB2C 2CO5A 2HFHA 4KFCA 4A2UA 4BAYA 3KZYA 1GXQA 1KQ9A 1S6LA 1QNTA 1J59A 2ZMEB 3F8NA 2GA2A 1QBJA 3FM3A 5BS6A 2Q8KA 4RS8A 3I5UA 2VE8A 4XSZF 1I6XA 5F6FA 4AVPA 2WC2A 4EQQA 3VFZA 4RGRA 3FMSA 2K4BA 5ILSA 2FBIA 1P6RA 3F6VA 1B4AA 1IN8A 2A3SA 4A0XA 4I09A 3KP7A 3HOSA 2QQAA 2A5YB 4MTEA 2HGCA 2P5KA 1YLFA 2EB7A 4M72A 2DO7A 1Z6TA 1EH7A 3LQRA 3J80K 5DV5A 2Y75A 2IA0A 3ML6A 1EH6A 2E7WA 2OD5A 1XGNA 2IA2A 3QP6A 4WK8F 3WTXC 3LA7A 1P4XA 5JHUA 3QU6A 1W4MA 1YS7A 2V79A 4MGRA 3SFZA 1BC7C 2CWEA 1UCRA 1Z9CA 3E5UA 1W7PD 3KE2A 2WWYA 4HDUA 4G94A 1GVJA 3QRFF 2EFOA 1BM9A 4JBAA 2ZFWA 1ZRCA 2QLZA 1FY7A 3ELKA 2JRTA 3GZ6A 5LHGA 2CSOA 3FXQA 4UNOA 1SD5A 4KDPA 1X3UA 2HEOA 4RGXA 1U78A 5EEHA 3B73A 2ZXJA 4OOIA 1AWCA 4KYWA 2E1NA 2OZ6A 3TO6A 2GXGA 3WGHA 3N97A 1G3SA 2XAGA 1PUEE 5EEGA 3CDHA 5HDGA 2IPQX 1Q1HA 3HRTA 4M9SA 4L9VA 2JSCA 3M9AA 2NRAC 4KT5C 3BPVA 5LGUA 3C3WA 4CO8A 1KQ8A 3ERED 3IKVA 3Q5FA 1Y0UA 3M7GA 3DP7A 4BQAA 1FYMA 3V4GA 4CHUA 1B59A 3H92A 2ETHA 3DXJF 4XSXF 2D1HA 5K1YA 3HRUA 3L2CA 1YFHA 1PP8F 4KNYA 3J81K 2LNBA 2H27A 1HKQA 3T8RA 1TBXA 1HSJA 4JQFA 1R1VA 1KQ0A 2Z3YA 3QAHA 4LG0B 1G4DA 3DF8A 1G3TA 3TO7A 3L00A 2DK5A 4Y13A 1B9MA 2PEXA 1ZG3A 2MBFA 3F8FA 2LKPA 2P7VB 2OZUA 4A0YA 1ZN2A 5CVUA 5E17F 2NYXA 3IC7A 5A2QZ 4YFXF 1FSHA 3NEUA 4B8XA 1CGPA 2W25A 1QO0D 3BROA 3L7WA 4LFUA 3RYPA 3HYIA 3TQNA 3ISPA 2PFBA 3KP5A 2KRFA 2VXZA 2V6CA 4EM0B 1HBXG 1W5SA 4M6YA 4K2EA 5BOXA 3R61A 4L0YB 2XAHA 5D8KB 4EJVA 3T1BA 1DPRA 3CO7C 4Q4ZF 3J80Z 3MAJA 2OAZA 3WTVC 2Z9OA 3T8TA 4HX7A 3KETA 2FA5A 4HLYA 4CZZA 3U1DA 3V7SA 1YO5C 1XCVA 1U6GA 3DKWA 5F1RA 3TO9A 4M9XA 3ZMDA 4HQMA 2FMLA 1IXCA 2EV5A 1DUXC 4D0PA 3ZMTA 1HW5A 2H6CA 5ILUA 1ONVA 1HKSA 4GGGA 4ZYDA 4UHTA 4WF2A 4N9IA 4AWXB 5BMZA 2D2WA 2KIFA 1QQIA 4PDKA 2WTEA 2GAUA 4HV6A 1FT9A 3V8LA 3BPXA 2QWWA 2XV4S 4A5NA 2R7FA 3DPTA 3HRMA 1HW2A 4PZJA 3HOTA 3S2WA 2BYVE 5ICFA 1G6NA 2NNNA 4I02A 3GO5A 4KA4A 2IVMA 2P5VA 3V8KA 1USSA 1B9NA 1FLIA 4XRFA 4BXUA 3R60A 3E6CC 1U5TB 2HWVA 1YW7A 1Z1DA 3FWEA 3B02A 5H6RA 3RDIA 4IHSA 1S8NA 3KFWX 2P5LC 2FBKA 2BGCA 1FX7A 3NRVA 5IT3A 5LLQA 1XB4A 5DUKA 2K4JA 5J8FA 3F21A 2V1DA 1S3JA 2FRHA 5FGMA 1QZYA 3E6MA 1YQAA 3RYRA 4CXFA 3E6BA 3RIRA 2DBBA 3TOAA 1LJ9A 2BE5F 4WXHA 4P55A 2V1UA 1U8RA 4S05A 2DTRA 1P4AA 4BYYA 5CVIA 4L0ZB 2IRFG 3I59A 3LQQA 4A0ZA 4CYDA 2MA3A 2P6TA 1RI7A 2FNPA 2EA4A 1TNTA 4LB5A 1R5GA 5D4RA 3GX4X 2J5PA 1TQMA 2ZBKA 1KU3A 4RAZA 2XASA 5FD6A 3SHFA 4MEXF 1OYWA 2DK8A 1O3RA 4HX4A 1OMIA 2LSOA 2FMYA 1I27A 1F5TA 4UUVA 3ZN0A 3HIFA 4XLNF 1UHMA 1YW8A 2FE3A 4OU0A 2GQQA 3FXRA 1D3YA 2FBHA 3IHUA 3ZMSA 3Q9SA 2VBXA 4DQ2A 3GZ5A 2FF4A 3ECOA 3R6SA 5D8LB 2ZMEA 3FF5A 5DCFA 1ZGAA 3HTSB 1LDDA 1OR7A 1BIBA 2Z33A 2MH2A 4U7DA 4ESBA 4IRIA 3MWMA 2OBPA 5HS7A 4LG0A 3ZQ7A 2QBYB 1EH8A 2UXXA 1XSDA 5CVVA 4LLLA 2YPRA 5ICEA 4LK0F 2OQGA 2WV0A 3H3UA 4LK1F 1IN4A 5CJ9A 1UFMA 3WTUC 2DQLA 2CG4A 3JAMZ 2CGPA 3GEZA 1OPCA 3DQVC 5D6FA 1EV7A 2IJLA 2XROA 2YR2A 4KMUX 2ESNA 2F5FA 4QWQA 4WXDA 1RZ4A 1L3LA 3CLOA 2AXLA 2D1VA 3JSOA 5IT9Z 3RPUA 1KYWA 1MJAA 2M30A 1BC8C 4UVCA 3N4MA 2VODA 3HTUA 5L3GA 4HDVA 1XSXA 4EM1A 4DNCA 1FYKA 1D8KA 1F1ZA 4Q48A 1ZRDA 2PBIA 4IRGA 2Z5UA 3NQOA 3TDZC 5FFZA 4HF1A 3FZVA 4RB1A 2EFWA 4ENJA 1XGOA 1ZYRF 2NAZA 4IXAA 3C7JA 2NNYA 4KN7X 1J75A 2DPUA 3M8EA 3I4PA 4HBLA 2FOKA 5HVQC 3BJOA 1K7AA 2MD5A 5LHIA 2L4AA 4G7ZF 1B6AA 4AIHA 2EA2A 2MLKA 1QZZA 4YIFA 3WTTC 5ILVA 4OMYA 2A6EF 3ZMVA 1KYZA 4MNUA 1YG2A 4P9UA 2L54A 3E5QA 2ISYA 2G9WA 3F6OA 1R58A 3Q9VA 3QOPA 3GFIA 1F9NA 3KEOA 1ZLJA 3OV8A 1H0MA 1SMTA 2PG4A 1XDUA 4OIOF 4EJOA 5CLSA 4XLPF 3HSRA 4MTDA 5HOOA 1STZA 3QPTA 2IA1A 4JK1X 2HKXA 3VODA 3J7AO 3DFGA 3IL2A 2DW4A 3G73A 2RV8A 3RKXA 2XKPA 4R1HA 1I1GA 1ZGJA 2KJBA 3FMRA 3FM5A 3PFIA 2YX7A 1FZPB 3MCZA 1BI1A 4G7OF 1JGSA 2DLLA 4YG2F 2W24A 3ULQB 6PAXA 4A12A 3ZMZA 2RQPA 1H9TA 1ZREA 2RC4A 3DV8A 3EDPA 2FXAA 2QVOA 4HW0A 2HQNA 3LA2A 4G6DA 1FPQA 4OIPF 3I54A 2C6YA 4BNCA 2H09A 3E3VA 4O6JA 3IWFA 4LB6B 4AIJA 3D5LA 3W6JB 2VT3A 5JVTA 5BQTA 1D5VA 5D5VB 2RVCA 3WG9A 2IT0A 3COAC 2HOEA 1WRJA 4LLGF 1CF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFK F;  1QGP A;  3I59 B;  4PCQ A;  5LHH A;  3GVA A;  1FWZ A;  5ICC A;  2GXB A;  1T38 A;  1J9I A;  5E1W A;  1I1S A;  3KLO A;  1PP7 U;  2XAF A;  3IRR A;  3WE3 A;  1U2W A;  1V4R A;  1MJ9 A;  2VON A;  2F5D A;  4AIK A;  1GHC A;  2M8E A;  4Q5S F;  3ECH A;  4RGU A;  1JHH A;  1WI9 A;  2QQB A;  4IRH A;  1BBY A;  3KP6 A;  2X4H A;  3WGI A;  5TRD A;  4HZF A;  2GZW A;  2JZY A;  4ON0 A;  1B1B A;  3WOD F;  2ADU A;  3LAJ A;  3E97 A;  1IAW A;  2DAO A;  2ISZ A;  3M1E A;  4A5M A;  1XSV A;  2GWR A;  1FBS A;  3LA3 A;  2GA1 A;  1FBU A;  4HV5 A;  2VC0 A;  4ENN A;  1KGS A;  2D45 A;  1C0W A;  1MD0 A;  4GXO A;  5D5W B;  1UHW A;  1FBQ A;  3MQ0 A;  4HF0 A;  3K1M A;  4WWC A;  4HYE A;  3JW4 A;  3ABT A;  3VEP A;  3K9T A;  4YII A;  5CYV A;  2QM3 A;  1T0F A;  5HLG A;  5HLH A;  2FEZ A;  5AON A;  1SAX A;  2STW A;  3JTH A;  1BN5 A;  3LST A;  1IZ1 A;  4IPA A;  1UST A;  2VN2 A;  2O3F A;  1HW1 A;  2ZCW A;  2Q2E A;  2V9V A;  1R36 A;  1OYI A;  4EV0 A;  5L3F A;  3GFM A;  2ZKZ A;  4NQW A;  3EET A;  1DDN A;  2A68 F;  2XAJ A;  2B0L A;  1TNS A;  1JHF A;  2QUF A;  1QPM A;  5J6X A;  3AAF A;  4HLX A;  3GW2 A;  3QPH A;  1SFE A;  3WTY C;  4KIB A;  2QQ9 A;  1FYL A;  2L02 A;  2YX4 A;  2PMH A;  1LNW A;  4R79 A;  5JFR A;  4UV9 A;  1GXP A;  2UWM A;  5DD8 A;  1FP1 D;  2CQK A;  3IRQ A;  3H3Z A;  2O8X A;  3P9K A;  3I58 A;  2VBW A;  2HZT A;  1WWX A;  4L9T A;  2BBY A;  5D6E A;  2ESH A;  2QEN A;  2YSR A;  2HTJ A;  1SD6 A;  2EK5 A;  3BJ6 A;  4R8H A;  4HQE A;  1BOA A;  5LBQ A;  4GYG A;  2EV6 A;  4LJZ F;  3T5X A;  1T39 A;  3HHG A;  5KK1 A;  4N0B A;  2EJR A;  2VOP A;  2M1B A;  1FNN A;  2MH9 A;  5KVR A;  1ON1 A;  1XGM A;  2Z99 A;  3TGN A;  1Z05 A;  2MLG A;  2XKO A;  2STT A;  1R1U A;  2OU2 A;  4OIQ F;  1T98 A;  2LF7 A;  1TW2 A;  2FU4 A;  3HRS A;  3C1D A;  1WSU A;  5CVJ A;  1BIA A;  2KKO A;  4A6E A;  2IP2 A;  3M8F A;  2ZNY A;  3HHH A;  5DUI A;  3WE2 A;  3RTR A;  2XVC A;  1SFX A;  5K5Q A;  4BH9 A;  3CJN A;  3DPL C;  4PGG A;  4G6Q A;  5AIP A;  1YTY A;  1R00 A;  4ENK A;  1Z91 A;  3U9G A;  2QBY A;  3ZN1 A;  1LVA A;  4ZZL A;  2E1C A;  1RNL A;  4MHG A;  3EUH A;  3WTW C;  1YS6 A;  1LDK B;  2A69 F;  1U3E M;  2EFP A;  3GYH X;  5L3B A;  4I7H A;  2L3D A;  3D0S A;  1BI2 A;  2Y0M A;  1G3W A;  2Q0O A;  1P92 A;  3QP5 A;  3BWG A;  1I5Z A;  4Y17 A;  2ZO4 A;  2P8T A;  4I0B A;  4UXN A;  1TQP A;  1P4W A;  2ZNZ A;  3R0J A;  3F72 A;  3KP4 A;  4L9N A;  4IHT A;  4HAM A;  3KZZ A;  3GFJ A;  4I2O A;  1HXD A;  4WXC A;  1E2X A;  1F4K A;  5LEK A;  3T0Y A;  2OA4 A;  4ASN A;  2O03 A;  4CDG A;  4KMF A;  2A61 A;  3CO6 C;  2P7C B;  2CFX A;  4B09 A;  1O3Q A;  3L09 A;  4EGZ A;  4ZH4 F;  5ED4 A;  2HYF A;  1K79 A;  1YIO A;  3LWF A;  4L5I A;  1MKM A;  2EFQ A;  1H9G A;  4AD9 A;  1J2X A;  3P9C A;  4P96 A;  1J0R A;  4NHJ A;  4G9Y A;  2BV6 A;  2R3S A;  5FD5 A;  5LRS A;  3WTS C;  3EYI A;  2LDU A;  1BJA A;  1SFU A;  1ZRF A;  4HF2 A;  3O2P E;  3K1P A;  4ENM A;  2VT2 A;  1Z6R A;  1KU7 A;  3GWZ A;  1ZAO A;  5FB2 A;  1PDN C;  5H20 A;  4GYI A;  5HDN A;  3I53 A;  3ZMU A;  3RPQ A;  5K5R A;  4LGW A;  1XMA A;  4ZYE A;  2RNJ A;  1R7J A;  4FX4 A;  3BJA A;  2VBY A;  2BEO A;  1E17 A;  3P7N A;  2E7X A;  3ZP5 A;  4Y15 A;  4QLC U;  4WX9 A;  1SD4 A;  4U0W A;  1TQI A;  3MEX A;  4P5O A;  4EJT A;  1TW3 A;  1IRG A;  4LD5 A;  1W7P B;  4YFN F;  1V3F A;  3F3X A;  5DD4 A;  4FX0 A;  4OIR F;  2H6B A;  3JSP A;  3P9I A;  1R23 A;  1FP2 A;  1L0O C;  4LMY A;  5J8C A;  5E1Z B;  5L3D A;  1J7K A;  4IF4 A;  2UXN A;  3G3Z A;  2A07 F;  2CYY A;  2DFI A;  2P4W A;  1P2F A;  1XGS A;  1XDS A;  1KU9 A;  3V7C A;  2W84 A;  1R1T A;  3MZY A;  2H94 A;  2MC3 A;  1ZH5 A;  1AOY A;  3RI4 A;  2A6H F;  2K7L A;  4Q47 A;  4A6D A;  2QZ8 A;  4U7B A;  3SZT A;  1O7F A;  2NS0 A;  4Z2Y A;  5LGT A;  3MFK A;  5BPI A;  3WU0 A;  4RB0 A;  4L18 B;  3BP8 A;  2PLY A;  4TV7 A;  1IUY A;  2K86 A;  4ETS A;  5E8G A;  2ZJ2 A;  2OQR A;  3I64 A;  1IRF A;  3FMQ A;  2IW5 A;  4CGZ A;  3E6D A;  3TOB A;  1Z7U A;  1MDM A;  5LGN A;  1ZLK A;  5D5U B;  2KJC A;  3MZH A;  3K69 A;  1MDM B;  2XUB A;  1G3Y A;  4EJU A;  3BY6 A;  3WU1 B;  3I71 A;  2LF8 A;  3R4K A;  2JPB A;  3QU3 A;  2X0L A;  5DEQ A;  2XRN A;  2F5E A;  4KUM A;  4G8X A;  5K5O A;  4ZYH A;  1LB2 A;  3LFK A;  5A2Q K;  2JT1 A;  1HQC A;  3FXU A;  2M87 A;  1R5H A;  2EWN A;  3RKY A;  4M74 A;  2FNA A;  4N9H A;  2QYO A;  5D4S A;  2KIU A;  1XD7 A;  5HDK A;  2COM A;  4L5J A;  3BDD A;  2F2E A;  2TDX A;  1WQ2 A;  2V1X A;  3CUO A;  4S04 A;  1TLH B;  5L3C A;  2O6G E;  2CW0 F;  1TTY A;  4I98 B;  3J81 Z;  2Y48 A;  4EJW A;  1CF7 B;  1S29 A;  4ZZD A;  3C18 A;  4O3M A;  1YW9 A;  5E18 F;  1MJB A;  3OOP A;  4I01 A;  5LEJ A;  2HDC A;  2JPC A;  1NHA A;  4FT8 A;  1LEA A;  2L01 A;  3SXY A;  2PMU A;  5HS9 A;  2RN7 A;  4UV8 A;  2W85 A;  3O6B B;  4EGY A;  1ZAR A;  1REP C;  3DEU A;  3WGG A;  4BHP A;  1YYV A;  4U0Y A;  4HX8 A;  4IJA A;  2ELH A;  2VC1 A;  4RGS A;  3GFL A;  4U88 A;  3K2Z A;  1O3S A;  1W5T A;  1DPU A;  4UVA A;  1IF1 A;  2JTV A;  1IN5 A;  2DQR A;  4ESF A;  2HS5 A;  3KCC A;  1RUO A;  3FX3 A;  3RJP A;  2K27 A;  1ODD A;  1KU2 A;  2VOO A;  4EMS A;  5E20 A;  1BI3 A;  3EQL F;  3F22 A;  4KIF A;  1O3T A;  2G7U A;  3KP2 A;  4FHT A;  3V8J A;  3L9F A;  1J5Y A;  3LAP A;  1LQ1 A;  3IWZ A;  1O7L A;  5CVR A;  2ACJ A;  2VBZ A;  1T6S A;  3F8C A;  1W7P A;  5L3E A;  3KLN A;  3PQJ A;  3HSF A;  1S7O A;  2P6S A;  2M5W A;  1RIO H;  1DP7 P;  1XMK A;  3RKW A;  1IW7 F;  2XGX A;  1VTN C;  1JE8 A;  1MZB A;  3TDU C;  2L4M A;  3ROU A;  4MQ9 F;  3VOE A;  5ERI A;  3BZ6 A;  3KEQ A;  5JR3 A;  2HYG D;  1IXS B;  2RKH A;  5DCM B;  1U5T C;  5E8I A;  5DYM A;  5FFX A;  2XIG A;  1ZHF A;  4GCV A;  4KN4 X;  3U2R A;  5HS8 A;  1ZG5 A;  2PJP A;  4OMZ A;  2EV0 A;  1MGT A;  5TJJ A;  2KIM A;  3GUD A;  4M71 A;  5AIQ A;  2O0Y A;  4XBF A;  2EFN A;  3ABU A;  1BI0 A;  3WTZ A;  4CIC A;  2K02 A;  3R0A A;  4M73 A;  1WKM A;  4OIN F;  2PI0 A;  5LRR A;  2DI3 A;  4MQV A;  1JXS A;  4U0V A;  1S7A A;  3K1N A;  2XHK A;  2F5C A;  2R7D A;  4MEY F;  1D8J A;  1O57 A;  3ZPL A;  1KA8 A;  4LLN A;  2RDP A;  2DPD A;  4H0E A;  5F64 A;  2GIV A;  2O61 A;  4ZYG A;  1FSE A;  5D5X B;  5DCM A;  4PGH A;  2XAQ A;  3GLX A;  5ICG A;  1XCB A;  3BOQ A;  4L9J A;  1HST A;  1RUN A;  1K78 B;  2FSW A;  4KIG A;  3SQN A;  4ESJ A;  5FLX K;  5FLX Z;  4KIC A;  4RAY A;  3FHZ A;  3F8B A;  5FO5 A;  1LDJ A;  2HR3 A;  3JTG A;  1UB9 A;  4GO1 A;  3V7R A;  2AS5 F;  2PN6 A;  3CTA A;  1A04 A;  5DDG A;  1FOK A;  2DT5 A;  3IKT A;  1FC3 A;  4WCG A;  3EYY A;  2HQR A;  2HKO A;  1U5T A;  2YU3 A;  1XN7 A;  3REO A;  2VE9 A;  3HUG A;  1IN6 A;  4P9F A;  3GF2 A;  3I0T A;  4BHC A;  4IVN A;  1HKT A;  3VB2 A;  3TKY A;  4I0A A;  5IT9 K;  1R22 A;  4HA8 A;  2PQ8 A;  3CUQ C;  4EM2 A;  3W6K B;  1K78 A;  5BPD A;  4EVI A;  4M9Z A;  2UZK A;  4HOB A;  5H6Q A;  1IN7 A;  4RB3 C;  3SZP A;  1OKR A;  2DU9 A;  3GXO A;  5JI6 A;  2M45 A;  3JAM K;  2G7H A;  4G7H F;  4BHB A;  1K6O A;  4M6X A;  4E70 A;  3E5X A;  3PQK A;  3F8M A;  3HSE A;  1T2K A;  4O5V A;  2HTS A;  4UVB A;  1ZG1 A;  1SD7 A;  3CUQ B;  2J5O A;  1SMY F;  1LEB A;  1ON2 A;  5HLI A;  2RGV A;  2FQ3 A;  3K0L A;  3KP3 A;  1OYY A;  1IXR C;  4F7Z A;  3CUQ A;  1ULY A;  2W57 A;  5E1X A;  3O3K A;  4NB5 A;  3F23 A;  4RB2 C;  2CO5 A;  2HFH A;  4KFC A;  4A2U A;  4BAY A;  3KZY A;  1GXQ A;  1KQ9 A;  1S6L A;  1QNT A;  1J59 A;  2ZME B;  3F8N A;  2GA2 A;  1QBJ A;  3FM3 A;  5BS6 A;  2Q8K A;  4RS8 A;  3I5U A;  2VE8 A;  4XSZ F;  1I6X A;  5F6F A;  4AVP A;  2WC2 A;  4EQQ A;  3VFZ A;  4RGR A;  3FMS A;  2K4B A;  5ILS A;  2FBI A;  1P6R A;  3F6V A;  1B4A A;  1IN8 A;  2A3S A;  4A0X A;  4I09 A;  3KP7 A;  3HOS A;  2QQA A;  2A5Y B;  4MTE A;  2HGC A;  2P5K A;  1YLF A;  2EB7 A;  4M72 A;  2DO7 A;  1Z6T A;  1EH7 A;  3LQR A;  3J80 K;  5DV5 A;  2Y75 A;  2IA0 A;  3ML6 A;  1EH6 A;  2E7W A;  2OD5 A;  1XGN A;  2IA2 A;  3QP6 A;  4WK8 F;  3WTX C;  3LA7 A;  1P4X A;  5JHU A;  3QU6 A;  1W4M A;  1YS7 A;  2V79 A;  4MGR A;  3SFZ A;  1BC7 C;  2CWE A;  1UCR A;  1Z9C A;  3E5U A;  1W7P D;  3KE2 A;  2WWY A;  4HDU A;  4G94 A;  1GVJ A;  3QRF F;  2EFO A;  1BM9 A;  4JBA A;  2ZFW A;  1ZRC A;  2QLZ A;  1FY7 A;  3ELK A;  2JRT A;  3GZ6 A;  5LHG A;  2CSO A;  3FXQ A;  4UNO A;  1SD5 A;  4KDP A;  1X3U A;  2HEO A;  4RGX A;  1U78 A;  5EEH A;  3B73 A;  2ZXJ A;  4OOI A;  1AWC A;  4KYW A;  2E1N A;  2OZ6 A;  3TO6 A;  2GXG A;  3WGH A;  3N97 A;  1G3S A;  2XAG A;  1PUE E;  5EEG A;  3CDH A;  5HDG A;  2IPQ X;  1Q1H A;  3HRT A;  4M9S A;  4L9V A;  2JSC A;  3M9A A;  2NRA C;  4KT5 C;  3BPV A;  5LGU A;  3C3W A;  4CO8 A;  1KQ8 A;  3ERE D;  3IKV A;  3Q5F A;  1Y0U A;  3M7G A;  3DP7 A;  4BQA A;  1FYM A;  3V4G A;  4CHU A;  1B59 A;  3H92 A;  2ETH A;  3DXJ F;  4XSX F;  2D1H A;  5K1Y A;  3HRU A;  3L2C A;  1YFH A;  1PP8 F;  4KNY A;  3J81 K;  2LNB A;  2H27 A;  1HKQ A;  3T8R A;  1TBX A;  1HSJ A;  4JQF A;  1R1V A;  1KQ0 A;  2Z3Y A;  3QAH A;  4LG0 B;  1G4D A;  3DF8 A;  1G3T A;  3TO7 A;  3L00 A;  2DK5 A;  4Y13 A;  1B9M A;  2PEX A;  1ZG3 A;  2MBF A;  3F8F A;  2LKP A;  2P7V B;  2OZU A;  4A0Y A;  1ZN2 A;  5CVU A;  5E17 F;  2NYX A;  3IC7 A;  5A2Q Z;  4YFX F;  1FSH A;  3NEU A;  4B8X A;  1CGP A;  2W25 A;  1QO0 D;  3BRO A;  3L7W A;  4LFU A;  3RYP A;  3HYI A;  3TQN A;  3ISP A;  2PFB A;  3KP5 A;  2KRF A;  2VXZ A;  2V6C A;  4EM0 B;  1HBX G;  1W5S A;  4M6Y A;  4K2E A;  5BOX A;  3R61 A;  4L0Y B;  2XAH A;  5D8K B;  4EJV A;  3T1B A;  1DPR A;  3CO7 C;  4Q4Z F;  3J80 Z;  3MAJ A;  2OAZ A;  3WTV C;  2Z9O A;  3T8T A;  4HX7 A;  3KET A;  2FA5 A;  4HLY A;  4CZZ A;  3U1D A;  3V7S A;  1YO5 C;  1XCV A;  1U6G A;  3DKW A;  5F1R A;  3TO9 A;  4M9X A;  3ZMD A;  4HQM A;  2FML A;  1IXC A;  2EV5 A;  1DUX C;  4D0P A;  3ZMT A;  1HW5 A;  2H6C A;  5ILU A;  1ONV A;  1HKS A;  4GGG A;  4ZYD A;  4UHT A;  4WF2 A;  4N9I A;  4AWX B;  5BMZ A;  2D2W A;  2KIF A;  1QQI A;  4PDK A;  2WTE A;  2GAU A;  4HV6 A;  1FT9 A;  3V8L A;  3BPX A;  2QWW A;  2XV4 S;  4A5N A;  2R7F A;  3DPT A;  3HRM A;  1HW2 A;  4PZJ A;  3HOT A;  3S2W A;  2BYV E;  5ICF A;  1G6N A;  2NNN A;  4I02 A;  3GO5 A;  4KA4 A;  2IVM A;  2P5V A;  3V8K A;  1USS A;  1B9N A;  1FLI A;  4XRF A;  4BXU A;  3R60 A;  3E6C C;  1U5T B;  2HWV A;  1YW7 A;  1Z1D A;  3FWE A;  3B02 A;  5H6R A;  3RDI A;  4IHS A;  1S8N A;  3KFW X;  2P5L C;  2FBK A;  2BGC A;  1FX7 A;  3NRV A;  5IT3 A;  5LLQ A;  1XB4 A;  5DUK A;  2K4J A;  5J8F A;  3F21 A;  2V1D A;  1S3J A;  2FRH A;  5FGM A;  1QZY A;  3E6M A;  1YQA A;  3RYR A;  4CXF A;  3E6B A;  3RIR A;  2DBB A;  3TOA A;  1LJ9 A;  2BE5 F;  4WXH A;  4P55 A;  2V1U A;  1U8R A;  4S05 A;  2DTR A;  1P4A A;  4BYY A;  5CVI A;  4L0Z B;  2IRF G;  3I59 A;  3LQQ A;  4A0Z A;  4CYD A;  2MA3 A;  2P6T A;  1RI7 A;  2FNP A;  2EA4 A;  1TNT A;  4LB5 A;  1R5G A;  5D4R A;  3GX4 X;  2J5P A;  1TQM A;  2ZBK A;  1KU3 A;  4RAZ A;  2XAS A;  5FD6 A;  3SHF A;  4MEX F;  1OYW A;  2DK8 A;  1O3R A;  4HX4 A;  1OMI A;  2LSO A;  2FMY A;  1I27 A;  1F5T A;  4UUV A;  3ZN0 A;  3HIF A;  4XLN F;  1UHM A;  1YW8 A;  2FE3 A;  4OU0 A;  2GQQ A;  3FXR A;  1D3Y A;  2FBH A;  3IHU A;  3ZMS A;  3Q9S A;  2VBX A;  4DQ2 A;  3GZ5 A;  2FF4 A;  3ECO A;  3R6S A;  5D8L B;  2ZME A;  3FF5 A;  5DCF A;  1ZGA A;  3HTS B;  1LDD A;  1OR7 A;  1BIB A;  2Z33 A;  2MH2 A;  4U7D A;  4ESB A;  4IRI A;  3MWM A;  2OBP A;  5HS7 A;  4LG0 A;  3ZQ7 A;  2QBY B;  1EH8 A;  2UXX A;  1XSD A;  5CVV A;  4LLL A;  2YPR A;  5ICE A;  4LK0 F;  2OQG A;  2WV0 A;  3H3U A;  4LK1 F;  1IN4 A;  5CJ9 A;  1UFM A;  3WTU C;  2DQL A;  2CG4 A;  3JAM Z;  2CGP A;  3GEZ A;  1OPC A;  3DQV C;  5D6F A;  1EV7 A;  2IJL A;  2XRO A;  2YR2 A;  4KMU X;  2ESN A;  2F5F A;  4QWQ A;  4WXD A;  1RZ4 A;  1L3L A;  3CLO A;  2AXL A;  2D1V A;  3JSO A;  5IT9 Z;  3RPU A;  1KYW A;  1MJA A;  2M30 A;  1BC8 C;  4UVC A;  3N4M A;  2VOD A;  3HTU A;  5L3G A;  4HDV A;  1XSX A;  4EM1 A;  4DNC A;  1FYK A;  1D8K A;  1F1Z A;  4Q48 A;  1ZRD A;  2PBI A;  4IRG A;  2Z5U A;  3NQO A;  3TDZ C;  5FFZ A;  4HF1 A;  3FZV A;  4RB1 A;  2EFW A;  4ENJ A;  1XGO A;  1ZYR F;  2NAZ A;  4IXA A;  3C7J A;  2NNY A;  4KN7 X;  1J75 A;  2DPU A;  3M8E A;  3I4P A;  4HBL A;  2FOK A;  5HVQ C;  3BJO A;  1K7A A;  2MD5 A;  5LHI A;  2L4A A;  4G7Z F;  1B6A A;  4AIH A;  2EA2 A;  2MLK A;  1QZZ A;  4YIF A;  3WTT C;  5ILV A;  4OMY A;  2A6E F;  3ZMV A;  1KYZ A;  4MNU A;  1YG2 A;  4P9U A;  2L54 A;  3E5Q A;  2ISY A;  2G9W A;  3F6O A;  1R58 A;  3Q9V A;  3QOP A;  3GFI A;  1F9N A;  3KEO A;  1ZLJ A;  3OV8 A;  1H0M A;  1SMT A;  2PG4 A;  1XDU A;  4OIO F;  4EJO A;  5CLS A;  4XLP F;  3HSR A;  4MTD A;  5HOO A;  1STZ A;  3QPT A;  2IA1 A;  4JK1 X;  2HKX A;  3VOD A;  3J7A O;  3DFG A;  3IL2 A;  2DW4 A;  3G73 A;  2RV8 A;  3RKX A;  2XKP A;  4R1H A;  1I1G A;  1ZGJ A;  2KJB A;  3FMR A;  3FM5 A;  3PFI A;  2YX7 A;  1FZP B;  3MCZ A;  1BI1 A;  4G7O F;  1JGS A;  2DLL A;  4YG2 F;  2W24 A;  3ULQ B;  6PAX A;  4A12 A;  3ZMZ A;  2RQP A;  1H9T A;  1ZRE A;  2RC4 A;  3DV8 A;  3EDP A;  2FXA A;  2QVO A;  4HW0 A;  2HQN A;  3LA2 A;  4G6D A;  1FPQ A;  4OIP F;  3I54 A;  2C6Y A;  4BNC A;  2H09 A;  3E3V A;  4O6J A;  3IWF A;  4LB6 B;  4AIJ A;  3D5L A;  3W6J B;  2VT3 A;  5JVT A;  5BQT A;  1D5V A;  5D5V B;  2RVC A;  3WG9 A;  2IT0 A;  3COA C;  2HOE A;  1WRJ A;  4LLG F;  1CF7 A; 
#chains in the Genus database with same CATH topology
 4YFK F;  5F04 A;  1QGP A;  3I59 B;  5FLM J;  3LSP A;  4PCQ A;  4QTR A;  5LHH A;  2WA0 A;  1DU0 A;  3GVA A;  2QKL B;  1B72 B;  1FWZ A;  5ICC A;  2OC6 A;  2GXB A;  3SEQ A;  1T38 A;  2XB0 X;  3TL4 X;  2M4G A;  1J9I A;  5E1W A;  1LE8 B;  1I1S A;  1MND A;  2L7K A;  3KLO A;  2K5C A;  1PP7 U;  2XAF A;  2KMU A;  3IRR A;  3HEF A;  2EIM H;  3WE3 A;  1U2W A;  1V5F A;  3DBL B;  3H5N A;  1V4R A;  1MJ9 A;  2VON A;  3A2K A;  2F5D A;  4AIK A;  3HKZ N;  1GHC A;  2M8E A;  4Q5S F;  3ECH A;  3P5J A;  4RGU A;  5K7F A;  2VIX A;  1JHH A;  1WI9 A;  2QQB A;  4IRH A;  2ECC A;  2GOM A;  1BBY A;  2DT7 B;  2X6O A;  3KP6 A;  2KPM A;  3RZO J;  2X4H A;  2QKM B;  3VPR A;  3H5R A;  3WGI A;  1E3O C;  4A3D J;  2L7Z A;  2X1C A;  4CCL A;  2BZT A;  5TRD A;  4HZF A;  1MMN A;  3LSH A;  5M5X J;  2GZW A;  2JZY A;  4ON0 A;  4Y3O A;  2DTZ A;  3ABK H;  3FXO A;  1B1B A;  3WOD F;  2DMT A;  2WAD A;  2ADU A;  3LAJ A;  1X4P A;  3E97 A;  3OYG A;  4IZZ A;  3KYL A;  1IAW A;  2JQ7 A;  4M6V A;  2DAO A;  2ISZ A;  3M1E A;  3GZN B;  2R4G A;  4A5M A;  1XSV A;  4DOZ A;  2GWR A;  4XLH A;  1FBS A;  3LA3 A;  2GA1 A;  1FBU A;  4HV5 A;  2WB1 A;  3ABM H;  3CJT B;  3B6C A;  2VC0 A;  3S1N J;  4FIS A;  3H9J A;  3K4C A;  3DU5 A;  2Y9Z A;  2CH0 A;  1KGS A;  2LY9 A;  4ENN A;  2D45 A;  1C0W A;  1MD0 A;  4GXO A;  1W0U A;  5CPR B;  5D5W B;  5IY5 H;  1UHW A;  1FBQ A;  2AO9 A;  3MQ0 A;  3PNY A;  4HF0 A;  4UUT A;  3A01 B;  2XGD A;  3K1M A;  2DA2 A;  4WWC A;  4I6Z A;  3PIP F;  3CMA I;  4HYE A;  3QQA A;  3JW4 A;  2H8W A;  3ABT A;  2ZXH A;  4OAZ A;  3VEP A;  4AM3 A;  2HQA A;  3K9T A;  2MYS A;  5CYV A;  2QM3 A;  1T0F A;  4YII A;  4IL6 C;  5HLG A;  5HLH A;  4XRS A;  4RM3 A;  2FEZ A;  2KQR A;  5AON A;  1SAX A;  2F4M B;  4XKW A;  3H1C A;  3I4M J;  1E3P A;  2STW A;  3JTH A;  3S2D J;  1BN5 A;  3LST A;  1IZ1 A;  2Z1D A;  4IPA A;  4Y7N J;  1UST A;  4IOA F;  2VN2 A;  2O3F A;  2DXI A;  4CZC A;  3D5S C;  5BNG A;  1HW1 A;  2ZCW A;  1Q1V A;  2Q2E A;  2EPF A;  2V9V A;  1R36 A;  5EZG A;  1X19 A;  5FRM A;  3M07 A;  3GME A;  1OYI A;  2CW8 A;  3HZJ A;  4EV0 A;  4CSW A;  4A3I J;  2E2J J;  5L3F A;  2XB5 A;  3GFM A;  2ZKZ A;  4LIT A;  1MNE A;  4NQW A;  2BXY A;  3L2U A;  1KZH A;  3EET A;  1DDN A;  4XOR A;  1MIJ A;  2A68 F;  2XAJ A;  2B0L A;  1TNS A;  1JHF A;  2QUF A;  1QPM A;  5J6X A;  2IXS A;  4JP0 A;  3AAF A;  3K2A A;  4HLX A;  4PK4 A;  1GDT A;  2CU7 A;  2K85 A;  3GW2 A;  3QPH A;  1BL0 A;  1SFE A;  5B1B H;  3WTY C;  4D5F A;  4KIB A;  2QQ9 A;  1FYL A;  4DYQ A;  2YU9 J;  1Z77 A;  2L02 A;  2YX4 A;  5E3M A;  1N77 A;  2PMH A;  1LNW A;  2LYC A;  4R79 A;  5JFR A;  4UV9 A;  3HGY A;  1GXP A;  2UWM A;  2CW7 A;  2ME0 A;  5DD8 A;  1E0E A;  1SFO J;  4NNJ A;  2PJR A;  3ZR8 X;  5DM7 F;  1FP1 D;  4BKX A;  3CCL I;  4NBQ A;  2CQK A;  3BG7 A;  2COB A;  3IRQ A;  3H3Z A;  2O8X A;  3P9K A;  3I58 A;  2VBW A;  2OTL I;  4GRI A;  4E7S A;  1YX3 A;  2VAS A;  1WPK A;  2HZT A;  4BY1 J;  1WWX A;  4L9T A;  2BBY A;  4BJ6 C;  3S93 A;  1BW6 A;  5D6E A;  1MBJ A;  1F43 A;  2ESH A;  3HJE A;  2QEN A;  2YSR A;  1YHQ I;  2HTJ A;  1SD6 A;  2EK5 A;  3BJ6 A;  4CCN A;  4R8H A;  4HQE A;  3PNV A;  4NQW B;  1ZKG A;  3K7A J;  2JWT A;  1BOA A;  5LBQ A;  4GYG A;  2EV6 A;  4LJZ F;  3T5X A;  1UMQ A;  2ZSI B;  3HHG A;  1T39 A;  2L9N A;  5EYR A;  5KK1 A;  4N0B A;  2KLO A;  2GXA A;  2EJR A;  2VOP A;  2M1B A;  3OS0 A;  1FNN A;  4IQJ A;  2DMU A;  2XGE A;  2JN6 A;  2MH9 A;  2EZH A;  2LBF B;  5KVR A;  1ON1 A;  1XGM A;  1X3W B;  2Z99 A;  4UB8 C;  3TGN A;  1Z05 A;  4CCO A;  2MLG A;  2XKO A;  3S17 J;  1WHU A;  2STT A;  1R1U A;  5CKT A;  2OU2 A;  3GTQ J;  2DA1 A;  2NS8 A;  4EAT A;  4OIQ F;  1T98 A;  2HOT A;  2LF7 A;  1TW2 A;  4E7L A;  2FU4 A;  2DJI A;  3HRS A;  3QPL A;  4XID A;  3C1D A;  1QZE A;  4BAC A;  2JRM A;  1WSU A;  5CVJ A;  1BIA A;  2KKO A;  4A6E A;  4DW6 A;  2L7F P;  1XMX A;  2IP2 A;  3M8F A;  2DOE A;  2ZNY A;  4Z6Y A;  3H5A A;  3HHH A;  3PUF A;  3PSF A;  5DUI A;  3WE2 A;  3RTR A;  2XVC A;  1SFX A;  2VKH A;  4BJ5 C;  5K5Q A;  4BH9 A;  4BXX J;  3CJN A;  3DPL C;  4BEH A;  2KP6 A;  2XRL A;  1VF9 A;  3BR5 A;  4PGG A;  4XL9 A;  4G12 A;  1YRN B;  4G6Q A;  1IDZ A;  1MBH A;  5AIP A;  3OS2 A;  3MD2 A;  1YTY A;  1R00 A;  4ENK A;  1Z91 A;  3U9G A;  2QBY A;  2Y69 H;  4XK4 A;  3ZN1 A;  1LVA A;  4ZZL A;  3M3Y J;  2L9S A;  3CCJ I;  2E1C A;  1BJZ A;  4FTH A;  3CCE I;  3CCM I;  3S3O A;  1R49 A;  4BQQ A;  1RNL A;  4MHG A;  1WCM J;  2EH3 A;  3EUH A;  1LKX A;  3WTW C;  2CRG A;  1YS6 A;  1LDK B;  2A69 F;  4AC0 A;  1U3E M;  3F0C A;  1XTA A;  1WFX A;  2EFP A;  3K4B A;  3GYH X;  1OFC X;  4P1W A;  1VQN I;  5L3B A;  4XKC A;  3L2Q A;  4A3F J;  4I7H A;  5FRN A;  2L3D A;  2E1M C;  3D0S A;  2L2O A;  1BI2 A;  3H0D A;  2XF5 A;  4A3K J;  2H1L A;  3AFH A;  4FAS D;  2Y0M A;  1G3W A;  2Q0O A;  1P92 A;  3QP5 A;  3BWG A;  4MFE A;  1I5Z A;  4Y17 A;  2ZO4 A;  2ICW G;  4FCY A;  1PUF A;  3HB9 A;  3ZXS A;  2P8T A;  4I0B A;  4UXN A;  3CJQ B;  4KIS A;  4II2 A;  3CDL A;  1TQP A;  1JUP A;  5HNF A;  4LIV A;  1MSE C;  2UUZ A;  1D0Z A;  3U1K A;  2LKX A;  3S16 J;  4V2G A;  4CA0 A;  3HOZ J;  1P4W A;  3M1C A;  3IH4 A;  2ZNZ A;  2KZV A;  3H36 A;  2O8K A;  3R0J A;  3DTI A;  3F72 A;  3KP4 A;  3S2H J;  4L9N A;  1MMA A;  1TWC J;  2XC7 A;  1DP3 A;  1GV2 A;  2OCE A;  5CQE A;  5GAD J;  1EJ9 A;  4IHT A;  1JGG A;  4HAM A;  5IOY A;  3KZZ A;  3GFJ A;  4I2O A;  5FJ8 J;  1HXD A;  4WXC A;  1E2X A;  2K3F A;  1F4K A;  1WVR A;  5LEK A;  3T0Y A;  1SVO A;  2OA4 A;  1PJR A;  4ASN A;  2VQC A;  2O03 A;  4CDG A;  4XKV A;  4KMF A;  2W00 A;  2A61 A;  3CO6 C;  2P7C B;  3PM1 A;  2CFX A;  3E7L A;  3LL7 A;  1YJW I;  4B09 A;  2P81 A;  4D5C A;  3L09 A;  4EGZ A;  1O3Q A;  4ZH4 F;  5F0F A;  2CMP A;  1LUJ B;  5ED4 A;  4ZYA A;  2HYF A;  1K79 A;  3WU2 C;  1QA6 A;  3OYB A;  3MVP A;  1YIO A;  1MNM C;  2IS1 A;  1IGN A;  3LWF A;  5C4J J;  2HDD A;  4L5I A;  4ANJ A;  1JKR C;  1MKM A;  2EFQ A;  3CJR B;  2HU9 A;  1H9G A;  4AD9 A;  1J2X A;  3P9C A;  4P96 A;  1ENH A;  1J0R A;  4NHJ A;  4Y4R A;  2GM4 A;  4G9Y A;  2BV6 A;  3EPZ A;  3AL0 C;  2QA4 I;  2R3S A;  1VQ5 I;  3W2A A;  5FD5 A;  5LRS A;  5GAG J;  3WTS C;  3EYI A;  2BW3 A;  2LDU A;  1BJA A;  1SFU A;  3TP0 A;  1ZRF A;  1YOV B;  3FK6 A;  4HF2 A;  2F48 A;  2IS6 A;  2VJ4 A;  3O2P E;  1ETY A;  5IP6 A;  3K1P A;  4ENM A;  4XLC A;  2VT2 A;  1Z6R A;  1I6H J;  2EIK H;  3FXM A;  3GWZ A;  1KU7 A;  3TBI A;  2EQR A;  4E4H A;  2BW3 B;  1ZAO A;  5FB2 A;  1PDN C;  2JK3 A;  5H20 A;  3F9K A;  2LG4 A;  4GYI A;  4I76 A;  5HDN A;  3I53 A;  4A3M J;  3OYN A;  2CUE A;  1QU3 A;  4N4O B;  4XIC A;  3I9V 2;  3CC7 I;  2W4S A;  4A3B J;  1RKW A;  3ZMU A;  3RPQ A;  1Y39 A;  2LC2 A;  5EG0 A;  5K5R A;  4LGW A;  1SAN A;  1XMA A;  2E71 A;  3Q0U A;  1TWH J;  4ZYE A;  1WJC A;  2RNJ A;  1R7J A;  2PJR B;  4RAG A;  4FX4 A;  3BJA A;  4BU2 A;  2VBY A;  1VZ0 A;  3LSI A;  1K4S A;  3AG1 H;  1JTX A;  3VYT B;  2BEO A;  3J7A Y;  3BQZ A;  1E17 A;  2DYS H;  3P7N A;  2E7X A;  3ZP5 A;  4Y15 A;  1VQP I;  3DKY A;  4QLC U;  4WX9 A;  3BCB A;  1SD4 A;  2DFF A;  4ZTF A;  4U0W A;  1TQI A;  4BE2 A;  2Y2Z A;  3AL0 B;  2DOD A;  3MEX A;  4P5O A;  5DTD A;  1IUF A;  4EJT A;  3BR1 A;  1TW3 A;  2CUF A;  1HCR A;  5FKL A;  1BR1 A;  2DT6 A;  1IRG A;  4LD5 A;  1W7P B;  4YFN F;  1GV5 A;  1V3F A;  3F3X A;  1Y56 A;  2X1E A;  5DD4 A;  2CUZ A;  3FXL A;  3NWS A;  1XX5 A;  2X6W A;  2LR8 A;  3AKZ A;  3GTL J;  1QRY A;  2Y31 A;  4FX0 A;  4OIR F;  1MMS A;  2H6B A;  1VI0 A;  2DDA A;  2JVH A;  2V26 A;  3DKX A;  2X9D A;  4JX4 A;  3CES A;  3JSP A;  3P9I A;  2E35 A;  1R23 A;  5IYD J;  4HG2 A;  1FP2 A;  1Y8R B;  1L0O C;  1X1B A;  4LMY A;  3L1P A;  5J8C A;  4XOT A;  5E1Z B;  5L3D A;  1J7K A;  2JA7 J;  4IF4 A;  3RQI A;  2UXN A;  3G3Z A;  2A07 F;  4HPQ A;  1BR2 A;  2CYY A;  2DFI A;  2BHZ A;  2P4W A;  4XQF A;  1P2F A;  4AYB N;  1XGS A;  4ZTJ A;  3CC2 I;  1XDS A;  1KU9 A;  3HUG B;  3V7C A;  2W84 A;  3HOY J;  1R1T A;  3MZY A;  2H94 A;  2MC3 A;  2R7Q A;  1ZH5 A;  1AOY A;  3RI4 A;  2A6H F;  2K7L A;  2EIN H;  4Q47 A;  2QZ8 A;  3ZOB A;  4A6D A;  4U7B A;  3SZT A;  3ZQL A;  1JTY A;  1V5G A;  1O7F A;  2NS0 A;  3S3N A;  4Z2Y A;  5LGT A;  3MFK A;  5BPI A;  3WU0 A;  4RB0 A;  1D1B A;  2BOL A;  4L18 B;  1OQY A;  1T33 A;  3BP8 A;  2PLY A;  3VDX A;  4PJM A;  5M5W J;  5KNL A;  1TWA J;  2E34 A;  4JOM A;  2K86 A;  4TV7 A;  1IUY A;  1IV6 A;  4ETS A;  5EGO B;  5E8G A;  2ZJ2 A;  2OQR A;  3I64 A;  2NVQ J;  2HYJ A;  1TP4 A;  1IRF A;  2R7W A;  3FMQ A;  1Z67 A;  2IW5 A;  1QHH D;  4CGZ A;  1A35 A;  1YE9 A;  1NK3 P;  1S5L C;  5J3L A;  3E6D A;  2ZC2 A;  1MSF C;  4ABZ A;  4A3G J;  2AXT C;  2VJI A;  2HQ5 A;  2Q2E B;  2IS2 A;  3TOB A;  1Z7U A;  1MDM A;  2BY0 A;  5B5E C;  5LGN A;  3PL8 A;  2CS3 A;  1FOY A;  4XN0 A;  1ZLK A;  2KDZ A;  1ETW A;  2CQX A;  1WJD A;  3OIP A;  5E3O A;  5D5U B;  3TP3 A;  1JJ6 C;  1AKH B;  2R7X A;  2X6Y A;  2KJC A;  2QSG X;  3MZH A;  3K69 A;  3A0B C;  2WAQ N;  3CCS I;  2MGQ A;  1MDM B;  2XUB A;  1G59 A;  1G3Y A;  3TW7 A;  4EJU A;  2PMZ N;  3BY6 A;  3WU1 B;  3I71 A;  4XMY A;  2HI3 A;  2LF8 A;  2LH9 A;  2K9L A;  4HEA 2;  2MW8 A;  4A3C J;  2R5Y A;  3GCM A;  3R4K A;  2JPB A;  3QU3 A;  2X0L A;  5DEQ A;  1IG7 A;  2XRN A;  2AHQ A;  2F5E A;  4KUM A;  3DEW A;  4G8X A;  2IAI A;  3E0J B;  3JCU C;  4PUS A;  5K5O A;  2VJJ A;  3DU6 A;  4ZYH A;  1LB2 A;  3LFK A;  5A2Q K;  4I99 C;  3CD6 I;  4NDL A;  2WAQ A;  2JT1 A;  1HQC A;  4II3 A;  3FXU A;  1UEL B;  2M87 A;  3BT9 A;  1R5H A;  4XNF A;  3VYU B;  2EWN A;  1R4M B;  1VFC A;  4KJZ A;  3RKY A;  4M74 A;  3RPU D;  2FNA A;  4N9H A;  2QYO A;  5D4S A;  4W97 A;  1FIA A;  3CF2 A;  3DTE A;  2KIU A;  3C2G A;  3OR1 C;  1XD7 A;  5HDK A;  2COM A;  4L5J A;  3BDD A;  2F2E A;  2TDX A;  1WZ2 A;  3VWB A;  1WQ2 A;  2B7E A;  3AG4 H;  2V1X A;  2R5Z B;  3CUO A;  3HM5 A;  2F4O B;  4S04 A;  1TLH B;  9ANT A;  5L3C A;  5IYB J;  2O6G E;  2CW0 F;  1TTY A;  4I98 B;  1AHD P;  3BR0 A;  3ASO H;  3J81 Z;  2Y48 A;  1Y0N A;  4EJW A;  2KIS A;  1CF7 B;  2QF7 A;  1S29 A;  3FBI B;  4IOC F;  4ZZD A;  3C18 A;  4O3M A;  5FKK A;  1T95 A;  1YW9 A;  5E18 F;  1MJB A;  3OOP A;  3D1N I;  4I01 A;  1RKT A;  5LEJ A;  2CJJ A;  2GOX B;  2HDC A;  2JPC A;  5GP9 A;  3DBR B;  1NHA A;  4FT8 A;  1R71 A;  1LEA A;  2PX9 A;  2L01 A;  3DLL F;  5KAF C;  2ZJP F;  2E5N A;  3SXY A;  3ZQG A;  2JA2 A;  2QQ8 A;  2LOO A;  2PMU A;  2CV2 A;  5HS9 A;  2RN7 A;  5GPC A;  4UV8 A;  2W85 A;  4FQG A;  3O6B B;  4J01 A;  4EGY A;  1ZAR A;  1LFB A;  4ZC3 A;  3OWT A;  2XDV A;  3DEU A;  3WGG A;  1REP C;  3TED A;  3VSL A;  4BHP A;  1YYV A;  2K40 A;  2RNG A;  3CCV I;  1OIS A;  4U0Y A;  4HX8 A;  3BC8 A;  4M3E A;  4IJA A;  3LNQ A;  1SVL A;  2ELH A;  2LTP A;  1ETV A;  2VC1 A;  4FE4 A;  3A4C A;  4C3H J;  3IV5 A;  4RGS A;  3GFL A;  4U88 A;  3K2Z A;  4QPO A;  1O3S A;  1W5T A;  2AQF A;  2V6E A;  4F91 B;  4UY8 I;  3IUO A;  1DPU A;  3S15 J;  2K9Q A;  1SVM A;  2I5U A;  2OCC H;  4UVA A;  5C44 J;  1IF1 A;  1W0T A;  2JTV A;  3H3V K;  4GFB A;  1IN5 A;  2DQR A;  4ESF A;  2HS5 A;  1IRX A;  3KCC A;  3FX3 A;  3RJP A;  1RUO A;  3GTP J;  5M3M J;  2FUG 2;  2K27 A;  1ODD A;  1KU2 A;  2VOO A;  2KT0 A;  5E20 A;  4EMS A;  1BI3 A;  3EQL F;  3F22 A;  4KIF A;  1O3T A;  2G7U A;  2OUM A;  4D1Q A;  3KP2 A;  2DFH A;  1WGX A;  4FHT A;  4BBR J;  1WH5 A;  3V8J A;  3L9F A;  1MMD A;  1J5Y A;  3LAP A;  1LQ1 A;  4C3I J;  3IWZ A;  1O7L A;  5CVR A;  2ACJ A;  2G0E A;  2VBZ A;  2V9P A;  1T6S A;  3CLQ A;  3F8C A;  2Y0S N;  3PSI A;  4G6T B;  1W7P A;  2VKE A;  5L3E A;  3KLN A;  2ZJR F;  3PQJ A;  3HSF A;  1LPQ A;  2IS4 A;  4A93 J;  1U8B A;  1S7O A;  2P6S A;  4C2M J;  3OR2 C;  2M5W A;  2QSH X;  1A36 A;  1RIO H;  3Q0W A;  1DP7 P;  1XMK A;  2Q1Z B;  3OL4 A;  3SZG A;  1TL8 A;  2GIZ A;  3EUH C;  2JMW A;  3RKW A;  1IW7 F;  1Z3X A;  2XGX A;  1VTN C;  1JE8 A;  1MZB A;  1HF0 A;  3TDU C;  2L4M A;  1X58 A;  4MQ9 F;  4RA2 A;  3ROU A;  1ACI A;  3VOE A;  5ERI A;  3BZ6 A;  2X51 A;  1PUF B;  2IGN A;  3KEQ A;  1HLV A;  1HC8 A;  5M5Y J;  2R7T A;  5JR3 A;  1VQL I;  2HYG D;  1IXS B;  2RKH A;  5DCM B;  1U5T C;  1YJN I;  3WHC A;  5E8I A;  5J4Y A;  4A3J J;  5DYM A;  1AU7 A;  5FFX A;  4EEF G;  3KPH A;  2XIG A;  2V4J C;  2L9V A;  1ZHF A;  2XSJ C;  4GCV A;  4KN4 X;  4M3G A;  3U2R A;  5B1A H;  5HS8 A;  2JSP A;  2R93 J;  1ZG5 A;  2PJP A;  4OMZ A;  2EV0 A;  1MGT A;  3GTJ J;  3MKZ A;  5TJJ A;  4RLQ A;  1RES A;  2KIM A;  1ZK8 A;  3GUD A;  4M71 A;  5AIQ A;  2JA6 J;  2O0Y A;  4XBF A;  4BDY A;  4NC8 A;  1R9T J;  2EFN A;  3ABU A;  1BI0 A;  2IBD A;  3WTZ A;  2F4I A;  4CIC A;  2K02 A;  3R0A A;  3DWL E;  4M73 A;  3JRG A;  1WKM A;  5F27 A;  2OPT A;  4OIN F;  2PI0 A;  5F0H A;  5LRR A;  2DI3 A;  4OAY A;  3E1S A;  4MQV A;  4PFO A;  1JXS A;  4U0V A;  4V19 K;  1S7A A;  1X1D A;  3K1N A;  2XHK A;  2F5C A;  5FKO A;  2R7D A;  4MEY F;  3DTK A;  1D8J A;  1O57 A;  4B44 A;  3ZPL A;  2VLA A;  1KA8 A;  4LLN A;  2RDP A;  1WH7 A;  3KYD B;  2ME6 A;  2LY1 A;  2DPD A;  1OLT A;  2OJE D;  3L2W A;  1EA3 A;  4H0E A;  5F64 A;  2N8G A;  2ELK A;  2GIV A;  4MLO A;  2O61 A;  4ZYG A;  1FSE A;  2LD5 A;  3H35 A;  5D5X B;  5DCM A;  4PGH A;  2XAQ A;  3GLX A;  2HZD A;  3DCF A;  5ICG A;  2JVG A;  3K70 C;  1XCB A;  3BOQ A;  1VQO I;  1SFK A;  4L9J A;  1HST A;  1RUN A;  1K78 B;  2TCT A;  3CZ6 A;  1XG1 A;  3G71 I;  2FSW A;  4KIG A;  3SQN A;  4ESJ A;  2WV1 A;  1LVK A;  5FLX K;  5GAE J;  4KIC A;  4RAY A;  5FLX Z;  3CQZ J;  3FHZ A;  2LLK A;  3F8B A;  1R4N B;  5FO5 A;  2WAF A;  1LDJ A;  4RDU A;  2CQ7 A;  4XM3 A;  4NC7 A;  2HR3 A;  3JTG A;  1UB9 A;  4GO1 A;  3V7R A;  2AS5 F;  2PN6 A;  3CTA A;  1A04 A;  2E5Z A;  5DDG A;  1FOK A;  2DT5 A;  2A5W A;  3GTG J;  3IKT A;  1D0Y A;  1FC3 A;  4WCG A;  1FIP A;  3EYY A;  2HQR A;  2HKO A;  2EBI A;  1U5T A;  3JRE A;  1LFP A;  2YU3 A;  4CH7 A;  3OYM A;  1SAU A;  1RPW A;  2F6C A;  4HNU A;  3JRD A;  3PIO F;  3W6V A;  1XN7 A;  3REO A;  2VE9 A;  3HUG A;  4X1E A;  1IN6 A;  4P9F A;  3GF2 A;  3LFU A;  3UKG A;  4D7M A;  4IHX A;  3I0T A;  4BHC A;  3J7Z I;  4IVN A;  2F5V A;  2HXI A;  1HKT A;  3VB2 A;  1GVD A;  3TKY A;  4I0A A;  4C2T A;  2A6T A;  5IT9 K;  1MBE A;  1R22 A;  4HA8 A;  1XPX A;  4DBR A;  2LFB A;  2PQ8 A;  2DA3 A;  4BDZ A;  3ZQQ A;  3CUQ C;  4A3L J;  4EM2 A;  3HKZ A;  3W6K B;  3C2H A;  3S3M A;  1K78 A;  1PVE A;  3A1Y A;  3ABL H;  4B43 A;  3CMM A;  2QGU A;  2HNH A;  4B4C A;  2NOG A;  4X0G A;  5BPD A;  3H9Q A;  4EVI A;  4M9Z A;  1N25 A;  3BG3 A;  3GLL A;  1W36 C;  2UZK A;  3OYA A;  4ZDO A;  1TWG J;  4XLF A;  4HOB A;  2O7O A;  5H6Q A;  3HOU J;  3HG9 A;  1X4O A;  3NWT A;  1IN7 A;  3ZQC A;  4RB3 C;  3A0H C;  3SZP A;  1NG6 A;  1P9Q C;  1OKR A;  3FIS A;  2DU9 A;  2FJ1 A;  3GXO A;  5JI6 A;  2M45 A;  3JAM K;  2JUC A;  2DA5 A;  4XLA A;  5F1J A;  2ECB A;  3JRH A;  1K83 J;  1T08 B;  3I55 I;  2XAU A;  3DLA A;  2VQL A;  2G7H A;  4G7H F;  4BHB A;  1JUM A;  2NXN B;  3CMY A;  1Y8Q B;  2JUG A;  1K6O A;  4M6X A;  4E70 A;  3E5X A;  3S1Q J;  3PQK A;  2R7S A;  1U9N A;  3F8M A;  3S8P A;  3HSE A;  1T2K A;  4F55 A;  4O5V A;  2KZG A;  3FKJ A;  4MFD A;  3UR3 C;  1MH3 A;  3ERM A;  2HTS A;  4UVB A;  4J00 A;  1ZG1 A;  2HOS A;  1SD7 A;  3CUQ B;  2J5O A;  4QIW N;  2R5Z A;  3BG5 A;  1SMY F;  1LEB A;  1ZR2 A;  2L5Q A;  1ON2 A;  5HLI A;  3J7Y J;  2RGV A;  4UUS B;  2FQ3 A;  3BTL A;  1YX5 A;  3K0L A;  3KP3 A;  3A01 A;  1OYY A;  2L7M P;  1IXR C;  1FJL A;  1ERD A;  4DGW B;  4F7Z A;  1WJE A;  3CUQ A;  1K4T A;  1ULY A;  2W57 A;  4DBQ A;  5LD2 C;  4DYC A;  5E1X A;  3OY9 A;  3GTK J;  2ZXW H;  4ZDL A;  1YIT I;  1LE8 A;  3O3K A;  1ZGW A;  4NB5 A;  2MD0 A;  3F23 A;  3LMM A;  3BCA A;  1VND A;  4BQN A;  4RB2 C;  1BW5 A;  2CO5 A;  2HFH A;  4KFC A;  4A2U A;  4BAY A;  3X2Q H;  4UB6 C;  3KZY A;  1OCO H;  2BY3 A;  1GXQ A;  1KQ9 A;  1S6L A;  1QNT A;  2DYR H;  3BG6 A;  1UZC A;  1J59 A;  2ZME B;  4YEJ A;  1IV8 A;  3F8N A;  3BTJ A;  2GA2 A;  1QBJ A;  3FM3 A;  5BS6 A;  5GPA A;  2Q8K A;  4RS8 A;  2WAE A;  1FMV A;  2MG4 A;  3I5U A;  5GAH J;  2VE8 A;  4XSZ F;  1QHG A;  4BJT A;  1JKO C;  4GDF A;  5KCM A;  1I6X A;  3A03 A;  5F6F A;  3BR6 A;  2JA5 J;  2LVS A;  3BG9 A;  4U87 A;  3MN2 A;  1KON A;  2BY2 A;  4NUB A;  4AVP A;  3L2R A;  3OSG A;  3Q3S A;  2ZFU A;  2WC2 A;  4EQQ A;  3QYE A;  4IHW A;  2YUS A;  3OIO A;  1X1P A;  4RGR A;  3VFZ A;  4AVZ A;  2DN0 A;  1BR4 A;  3FMS A;  4C2U A;  4H4K C;  2K4B A;  3K4J A;  5ILS A;  2FBI A;  1P6R A;  2LRD A;  3F6V A;  2VUM J;  1V55 H;  1B4A A;  1IN8 A;  2DFE A;  2CQN A;  2VJ5 A;  2A3S A;  4IKF A;  1SEU A;  3K4M A;  1Z0X A;  2LRE A;  4A0X A;  4I09 A;  3KP7 A;  4XLE A;  4RLF A;  3HOS A;  2P0W A;  3RQ4 A;  2QQA A;  2A5Y B;  1RET A;  4MTE A;  1Y1V J;  2HGC A;  2P5K A;  3K70 D;  1YLF A;  2EB7 A;  1OJL A;  4M72 A;  2DO7 A;  1Z6T A;  1EH7 A;  3LQR A;  3FK7 A;  1RC9 A;  3J80 K;  2E1M B;  5DV5 A;  4QPQ A;  2Y75 A;  2IA0 A;  1FTZ A;  3ML6 A;  1EH6 A;  2E7W A;  2QCO A;  1TT0 A;  1FOW A;  2CUJ A;  2OD5 A;  3BTC A;  2X85 A;  1ETQ A;  4PJL A;  1XGN A;  2FOW A;  1FTT A;  2ID3 A;  5F08 A;  1VQ9 I;  2RQQ A;  2IA2 A;  3QP6 A;  4MIM A;  2M3A A;  4WK8 F;  3WTX C;  3LA7 A;  3FXK A;  1J09 A;  1AA7 A;  3MZ8 A;  1P4X A;  5C4X J;  1T56 A;  5JHU A;  4E7H A;  3QU6 A;  4BQO A;  1U9O A;  1W4M A;  1YS7 A;  2V79 A;  4MGR A;  2GLO A;  3SFZ A;  3RCO A;  1IC8 A;  1BC7 C;  1MW7 A;  1UG0 A;  2DMQ A;  3PJR A;  2CWE A;  1UCR A;  1Z9C A;  3E5U A;  1ITY A;  1W7P D;  1F36 A;  3KE2 A;  4E7K A;  3G4S I;  2WWY A;  4HDU A;  4G94 A;  1GVJ A;  3VYR B;  2HPM A;  3QRF F;  3N05 A;  2EFO A;  1BM9 A;  4JBA A;  2B9S A;  2ZFW A;  2NVY J;  5JLW A;  1ZRC A;  2QLZ A;  1FY7 A;  3ELK A;  5TGT A;  2JRT A;  3GZ6 A;  5LHG A;  1AKH A;  3NAR A;  2CSO A;  3IH2 A;  2XPW A;  3FXQ A;  3G1O A;  4OWR B;  3CC4 I;  2ZSH B;  3HPG A;  4UNO A;  1SD5 A;  3IP4 B;  4KDP A;  1X3U A;  2HEO A;  3NAU A;  4RGX A;  1U78 A;  1K6Y A;  4S0H B;  3S1R J;  5EEH A;  4E7Z A;  3B73 A;  2ZXJ A;  4OOI A;  1AWC A;  4KYW A;  2BY1 A;  2E1N A;  2OZ6 A;  1ETK A;  5HLT A;  3HOV J;  3B6A A;  1BOB A;  1Y6I A;  3TO6 A;  5J1R A;  3OMY A;  3OYF A;  2GXG A;  3WGH A;  1JKP C;  3N97 A;  2R7U A;  3BR3 A;  3PO2 J;  3QOD A;  3QWL A;  1G3S A;  1GUU A;  2XAG A;  5FLV A;  5EEG A;  3CDH A;  5HDG A;  2IPQ X;  5EZH A;  2DOA A;  1Q1H A;  1PUE E;  2O9L A;  1IRZ A;  3HRT A;  4M9S A;  4L9V A;  2M7B A;  2JSC A;  3M9A A;  2NRA C;  1OCC H;  3FBN B;  4FE7 A;  4KT5 C;  3MKY B;  3BPV A;  2HVR A;  4RM2 A;  3JRA A;  5LGU A;  1DGW Y;  3C3W A;  4CO8 A;  5KHD A;  1KQ8 A;  3QYB A;  3ERE D;  5M3F J;  1V5E A;  3IKV A;  3Q5F A;  1Y0U A;  5EGO A;  3M7G A;  3DP7 A;  4BQA A;  5IOZ A;  1FYM A;  3V4G A;  4CHU A;  1B59 A;  4BXF A;  3H92 A;  4BEH B;  2ETH A;  2UV1 A;  3PNT A;  2VPL A;  1VQK I;  3LSR A;  3DXJ F;  4XSX F;  1HDD C;  2DA6 A;  5E79 C;  3OS1 A;  2D1H A;  5K1Y A;  3HRU A;  3L2C A;  1YFH A;  3TW6 A;  2LBF A;  4XON A;  3J81 K;  1PP8 F;  4KNY A;  3KIO A;  2LNB A;  2TRT A;  1VQ8 I;  2H27 A;  2M34 A;  1TT5 B;  1WJA A;  4BGD A;  1HKQ A;  4XOP A;  3T8R A;  5KAI C;  1TBX A;  3FIW A;  1HSJ A;  2VQG A;  4JQF A;  1R1V A;  3HBL A;  1KQ0 A;  2Z3Y A;  3QAH A;  4LG0 B;  3SDG A;  3SDB A;  1G4D A;  3DF8 A;  3W2V A;  1G3T A;  4IO9 F;  3TO7 A;  2HXO A;  2M2E A;  3L00 A;  3I3L A;  2MFZ A;  2DK5 A;  4Y13 A;  1IO2 A;  1B9M A;  2PEX A;  4DJA A;  2LMD A;  1ZG3 A;  2MBF A;  3F8F A;  4E7J A;  2LKP A;  1JJ8 C;  2P7V B;  3SYT A;  2OZU A;  2K9S A;  3FDY A;  4A0Y A;  1ZN2 A;  5CVU A;  1DQU A;  5E17 F;  2DOF A;  2NYX A;  1PYV A;  3IC7 A;  3ZQH A;  3OYL A;  3LSG A;  3UNG C;  4YFX F;  5A2Q Z;  1FSH A;  3NEU A;  3ZRG A;  4B8X A;  2HPI A;  5K7Z A;  1CGP A;  2W25 A;  1QO0 D;  2E60 A;  3BRO A;  5JHF A;  3L7W A;  1VQ4 I;  4LFU A;  3RYP A;  2M0C A;  4KIT B;  2E2I J;  3OYI A;  4RBO A;  3HYI A;  3TQN A;  2R7R A;  2IEK A;  3HOW J;  4UUS A;  3ISP A;  3Q0V A;  3S14 J;  2EIJ H;  1D5Y A;  2PFB A;  3KP5 A;  4BE1 A;  2KRF A;  1VQ6 I;  2KDO A;  2OV7 A;  3EUA A;  4HST A;  2VXZ A;  2HVS A;  2V6C A;  4EM0 B;  2M8G X;  1HBX G;  1TWF J;  1W5S A;  3HXL A;  4PJ0 C;  4M6Y A;  4K2E A;  2MAB A;  1YJ9 I;  5BOX A;  3R61 A;  2EZI A;  4L0Y B;  4C9Y A;  2I8D A;  2XAH A;  5D8K B;  3CCQ I;  2CQQ A;  2W1O A;  4EJV A;  1V54 H;  2ZXI A;  2MC4 A;  3T1B A;  1DPR A;  3CO7 C;  4Q4Z F;  3J80 Z;  3K4K A;  3MAJ A;  4B3A A;  2OAZ A;  3OYK A;  3WTV C;  5K7H A;  2Z9O A;  2M9H A;  1N78 A;  3RZD J;  3U21 A;  3BR2 A;  3T8T A;  4HX7 A;  3KET A;  2FA5 A;  1I3Q J;  2WBM A;  1D1A A;  2JJ7 A;  4HLY A;  4CZZ A;  1JT6 A;  3D5R C;  3ZGK A;  2CFO A;  3U1D A;  1UJ8 A;  3O8H A;  4PFP A;  3MMY B;  3V7S A;  1GT0 C;  2W82 A;  5HOD A;  1YO5 C;  1ETO A;  1XCV A;  1U6G A;  1M1E B;  3DKW A;  5F1R A;  3HL2 A;  2Z16 A;  3TO9 A;  4M9X A;  3ZMD A;  3FKI J;  1I39 A;  1VQ7 I;  4ZJZ A;  1S9H A;  4HQM A;  2R7V A;  4HNV A;  2FML A;  1IXC A;  2EV5 A;  3BZC A;  1DUX C;  4D0P A;  1T8I A;  3ZMT A;  1NH3 A;  1HW5 A;  1MH4 A;  4CYC B;  1X3Z B;  2H6C A;  4XKB A;  5ILU A;  1ONV A;  1HKS A;  4GGG A;  4CUG A;  4UHT A;  4ZYD A;  1HA8 A;  4ITV A;  1UAA A;  4WF2 A;  4N9I A;  4AWX B;  5BMZ A;  3OSF A;  2M4K A;  2D2W A;  4DZJ A;  2KIF A;  1QQI A;  2FD5 A;  1IDY A;  4PDK A;  2WTE A;  2WY8 Q;  2L9R A;  2K3P A;  2WB1 N;  2GAU A;  3K6G A;  4HV6 A;  1ZQ3 P;  1FT9 A;  4Y52 J;  3V8L A;  4XRS G;  3FXJ A;  3JRI A;  1ZTR A;  2E36 A;  3BPX A;  2QWW A;  4X6A J;  2XV4 S;  4A5N A;  2R7F A;  3WG7 H;  4J19 A;  5EJC A;  3DPT A;  4W1U A;  3QOE A;  3HRM A;  3DPU A;  1HW2 A;  3RSN A;  1OR7 C;  4M3D A;  4PZJ A;  3G1M A;  4C30 A;  4QSH A;  3S2W A;  3HOT A;  5F0C A;  2BYV E;  1GLN A;  1IJW C;  1G8X A;  3G1L A;  5ICF A;  1G6N A;  2NNN A;  4D9J A;  2OTJ I;  4I02 A;  3PUB A;  4BE0 A;  4IHY A;  5J4V A;  3GO5 A;  2NVX J;  4KA4 A;  2R5Y B;  2Y30 A;  4JX5 A;  2KL4 A;  2IVM A;  2P5V A;  3V8K A;  1USS A;  4AYB A;  1B9N A;  5GTI C;  1ZR4 A;  3A02 A;  2XGC A;  1W36 D;  2EZL A;  5LFA A;  4CYC A;  2EZK A;  1FLI A;  2LK2 A;  3ONQ A;  1EF4 A;  4XRF A;  2DMN A;  4BXU A;  2QEX I;  1TZL A;  1WJ5 A;  3H0G J;  3R60 A;  3E6C C;  1U5T B;  4DIQ A;  2NVT J;  2E19 A;  2HWV A;  1YW7 A;  1Z1D A;  3OYH A;  3FWE A;  3B02 A;  3JR9 A;  3IAS 2;  3K4N A;  5H6R A;  1MBG A;  3RDI A;  2X1D A;  1RR8 C;  1NK2 P;  3O8G A;  4IHS A;  1S8N A;  3KFW X;  4FET A;  2FBK A;  2P5L C;  2KRC A;  3HGG A;  2BGC A;  1FX7 A;  3NRV A;  5IT3 A;  5LLQ A;  1XB4 A;  1Z21 A;  5DUK A;  2K9N A;  2VKV A;  2K4J A;  3VSK A;  2DJN A;  4C3J J;  5J8F A;  1Z3Y A;  3F21 A;  1RRJ A;  5IYC J;  2LY2 A;  2V1D A;  1R6R A;  1S3J A;  2FRH A;  5FGM A;  4BS9 A;  1QZY A;  2GBY A;  5EDN A;  1CQT A;  3E6M A;  1YQA A;  2O5R A;  3IH3 A;  5HNH A;  3RYR A;  4CXF A;  4E7I A;  2HVQ A;  3E6B A;  4RMN A;  3OOU A;  3RIR A;  1Y1W J;  3MKL A;  2LKS A;  2DBB A;  3C2B A;  3TOA A;  1LJ9 A;  2BE5 F;  2HOA A;  2A05 A;  5E3L A;  1JT0 A;  4WXH A;  4P55 A;  2V1U A;  1U8R A;  4S05 A;  2DTR A;  1P4A A;  3CP2 A;  3JRF A;  4BYY A;  4Y33 A;  1UHS A;  2PMZ A;  4XR6 A;  5CVI A;  3S32 A;  5E3N A;  4L0Z B;  2IGK A;  2IRF G;  1BA5 A;  2X6X A;  5IP9 J;  3I59 A;  4PSX A;  2HDW A;  3LQQ A;  4A0Z A;  4CYD A;  2ZJQ F;  3CCU I;  1S72 I;  3SFI A;  4JX6 A;  3S1M J;  2R92 J;  5JLX A;  2MA3 A;  2P6T A;  1R5I D;  1WJF A;  2VKD A;  1RI7 A;  2FNP A;  1UG2 A;  2R7O A;  4LIU A;  2BVL A;  2EA4 A;  1TNT A;  2ZB9 A;  4XRM A;  4HRI A;  1R5G A;  4LB5 A;  2ID6 A;  5D4R A;  1QPI A;  3GX4 X;  2J5P A;  1TQM A;  3LSK A;  2ZBK A;  1A5J A;  1KU3 A;  4RAZ A;  3ZQF A;  4B1R A;  2VQH A;  2XAS A;  2DMP A;  1O4X A;  5FD6 A;  5DS9 A;  3SHF A;  1MBF A;  4B48 A;  2CV0 A;  3W2W A;  4MEX F;  1HDP A;  1X1C A;  4PJN A;  1OCT C;  1SC7 A;  4M3F A;  2NVU B;  1OYW A;  4F93 B;  1W1W E;  3M4O J;  2DK8 A;  3SJM A;  1O3R A;  4IQ4 A;  4HX4 A;  1OMI A;  5CQG A;  2LSO A;  4L5E A;  2FMY A;  1I27 A;  2RAE A;  1F5T A;  4UUV A;  3ZN0 A;  3HIF A;  4XLN F;  2L0K A;  1UHM A;  1YW8 A;  2AQE A;  5IPA A;  2FE3 A;  2OF7 A;  2XPU A;  4OU0 A;  2GQQ A;  1JI8 A;  3OYD A;  3FXR A;  5EG0 B;  1D3Y A;  2FBH A;  1YI2 I;  1YRN A;  3IHU A;  4F52 A;  3ZMS A;  3Q9S A;  2VBX A;  4DQ2 A;  3GZ5 A;  4KT6 A;  1POG A;  2KIQ A;  1APL C;  2FF4 A;  5J47 A;  2XF7 A;  4YIR X;  3ECO A;  3R6S A;  1WI3 A;  4A69 C;  5D8L B;  3QYF A;  2XSD C;  2ZME A;  3FF5 A;  3CF5 F;  2NS7 A;  2XPV A;  2VL8 A;  5DCF A;  1ZGA A;  1LDD A;  3HTS B;  1OR7 A;  3M8J A;  2QSF X;  3ZCO A;  2MSY A;  1BIB A;  4BBS J;  2Z33 A;  1MBK A;  5DM6 F;  2MH2 A;  4U7D A;  1TC3 C;  4ESB A;  2IGM A;  2DA7 A;  1DGR M;  4IRI A;  3GTO J;  1QVT A;  3I4N J;  3MWM A;  3G6E I;  2OBP A;  5HS7 A;  4LG0 A;  3ZQ7 A;  2QBY B;  3GBG A;  1EH8 A;  1Z7L A;  2UXX A;  5IP7 J;  1XSD A;  3QPS A;  5TIS C;  5CVV A;  4LLL A;  2YPR A;  4LG3 A;  5ICE A;  4LK0 F;  2OQG A;  2WV0 A;  2LP0 A;  3H3U A;  4LK1 F;  2H1K A;  1IN4 A;  2DDB A;  5CJ9 A;  1UFM A;  3WTU C;  2DQL A;  2CG4 A;  2CV1 A;  2V7F A;  1ETX A;  3JAM Z;  4B47 A;  2V9K A;  2CGP A;  1T0F C;  1I50 J;  1QVU A;  2R0Q C;  1P7I A;  5FKN A;  3CCR I;  4D7N A;  3GEZ A;  1OPC A;  3DQV C;  1D1C A;  5D6F A;  1EV7 A;  2IJL A;  2XRO A;  2YR2 A;  4PJJ A;  3CME I;  2KHM A;  4KMU X;  4NC6 A;  5J1Y A;  2M0M A;  1G2H A;  1E3H A;  2ESN A;  1N75 A;  4IHV A;  2F5F A;  4QWQ A;  4WXD A;  4HSR A;  3BTI A;  3G2B A;  1HOM A;  1RZ4 A;  4E6K G;  1L3L A;  4CCK A;  2V1N A;  3CLO A;  3ASN H;  5H2F C;  4XN3 A;  2AXL A;  4F3Q A;  2D1V A;  3JSO A;  1X1A A;  1OCP A;  5IT9 Z;  1A31 A;  3RPU A;  1KYW A;  1MJA A;  2M30 A;  1BC8 C;  4UVC A;  3N4M A;  4AID A;  3MKW B;  2VOD A;  3HTU A;  3GTM J;  5L3G A;  2Y0S A;  4HDV A;  2WY7 Q;  1XSX A;  4EM1 A;  1FMW A;  3FHN A;  4DNC A;  4A3E J;  2BHY A;  1VQM I;  4RAF A;  1EKE A;  3DEE A;  4CCJ A;  2W7N A;  1FYK A;  2VXD A;  1D8K A;  1F1Z A;  3L2V A;  4Q48 A;  1ZRD A;  2PBI A;  1X2M A;  4IRG A;  2Z5U A;  3NQO A;  3TDZ C;  5FFZ A;  1DU6 A;  3FZV A;  4HF1 A;  2H8R A;  5B3S H;  3OYE A;  3I56 I;  4RB1 A;  2EFW A;  4ENJ A;  2EIL H;  4N4N B;  1XGO A;  1ZYR F;  2NAZ A;  3DBH B;  2VPR A;  3IAM 2;  3LSJ A;  2DCE A;  1B72 A;  4IXA A;  3C7J A;  2BXZ A;  4YEL A;  2NNY A;  4KN7 X;  4AU7 A;  3HOX J;  2FX0 A;  3OIQ A;  1J75 A;  2ZME C;  2DPU A;  3M8E A;  3I4P A;  3SEZ A;  4HBL A;  2FOK A;  2FQ4 A;  3CP8 A;  5HVQ C;  2VB6 A;  3V42 A;  3BJO A;  3WHB A;  1K7A A;  3PO3 J;  2RRE A;  2MD5 A;  5LHI A;  1X2N A;  3AG2 H;  2L4A A;  3HC7 A;  4G7Z F;  2W48 A;  1B6A A;  4AIH A;  2VI6 A;  1D0X A;  2EA2 A;  2MLK A;  1NTC A;  1JUS A;  2DA4 A;  2XF6 A;  5FRO A;  1YIJ I;  3KEY A;  3KZI C;  1QZZ A;  5EEA A;  4YIF A;  1U0J A;  3WTT C;  2JA8 J;  5ILV A;  3LSM A;  4OMY A;  3HPH A;  3HDD A;  4LOC A;  2A6E F;  3ZMV A;  5B66 C;  1KYZ A;  3LOC A;  4MNU A;  1YG2 A;  4AUX A;  4P9U A;  2YS9 A;  2L54 A;  1MMG A;  3E5Q A;  2ISY A;  2X48 A;  2Z2S B;  2G9W A;  4HNT A;  3F6O A;  2BVM A;  1R58 A;  3BZK A;  3JRC A;  3Q9V A;  3QOP A;  1S7E A;  3GFI A;  3K4L A;  4PSW A;  1F9N A;  3KEO A;  1ZLJ A;  3OV8 A;  4M3B A;  4JYK A;  1H0M A;  1SMT A;  2ELJ A;  2PG4 A;  1LFU P;  1XDU A;  4OIO F;  2KRH A;  5J1U A;  4DYR A;  4EJO A;  1RR7 A;  5C3E J;  5CLS A;  4MO7 A;  4XLP F;  3HSR A;  4MTD A;  5HOO A;  1STZ A;  3QPT A;  4DZP A;  2IA1 A;  4JK1 X;  3BLY A;  4F92 B;  1A6I A;  1XS9 A;  3RKQ A;  2HKX A;  3VOD A;  3J7A O;  3DFG A;  3IL2 A;  2DW4 A;  3G73 A;  1A6Q A;  2RV8 A;  1ORK A;  3RKX A;  3OYC A;  2K9M A;  3KYC B;  1H88 C;  3JRB A;  2XKP A;  4R1H A;  1I1G A;  1ZGJ A;  4BY7 J;  2KJB A;  3FMR A;  1H89 C;  4CCM A;  3FM5 A;  3K10 A;  3VYS B;  5EF6 A;  3PFI A;  3EUK L;  4IEJ A;  1OCZ H;  2YX7 A;  3H9G A;  1FZP B;  1OCR H;  1K61 A;  3CDI A;  3MCZ A;  1BI1 A;  2D5V A;  4ZDP A;  4G7O F;  1JGS A;  2DLL A;  4YG2 F;  2B63 J;  2W24 A;  3ULQ B;  6PAX A;  3TMO A;  5FKM A;  4A12 A;  3ZMZ A;  2RQP A;  1H9T A;  2E2H J;  5J40 A;  3ZQI A;  3PFY A;  5GTH C;  1H8A C;  2RC4 A;  3DV8 A;  1B8I A;  1ZRE A;  3EDP A;  2FXA A;  1WJB A;  2QVO A;  4HW0 A;  3KX2 A;  2HQN A;  3LA2 A;  1ZEL A;  4G6D A;  1B8I B;  5JVG F;  1FPQ A;  3OYJ A;  1FEX A;  1NG7 A;  3CCY A;  2R7Z J;  4OIP F;  3W3C A;  2Y9Y A;  3I54 A;  2C6Y A;  2KFD A;  4BNC A;  2H09 A;  3E3V A;  3BQY A;  4V2F A;  4O6J A;  3IWF A;  1JKQ C;  2M7A A;  4LB6 B;  4BL0 B;  4AIJ A;  1W5C C;  4B3X A;  2E1O A;  3D5L A;  3W6J B;  4YRV A;  1I3A A;  1P7J A;  2VT3 A;  5JVT A;  5BQT A;  1XC5 A;  3ESW B;  2NOJ B;  1D5V A;  3AG3 H;  5D5V B;  1FOX A;  2RVC A;  3WG9 A;  4BUP A;  2IT0 A;  2I10 A;  3COA C;  2HOE A;  1WRJ A;  4LLG F;  2IGO A;  4IX7 A;  1CF7 A;  3OL3 A; 
#chains in the Genus database with same CATH homology
 4YFK F;  1QGP A;  3I59 B;  4PCQ A;  5LHH A;  3GVA A;  1FWZ A;  5ICC A;  2GXB A;  1T38 A;  1J9I A;  5E1W A;  1I1S A;  3KLO A;  1PP7 U;  2XAF A;  3IRR A;  3WE3 A;  1U2W A;  1V4R A;  1MJ9 A;  2VON A;  2F5D A;  4AIK A;  1GHC A;  2M8E A;  4Q5S F;  3ECH A;  4RGU A;  1JHH A;  1WI9 A;  2QQB A;  4IRH A;  1BBY A;  3KP6 A;  2X4H A;  3WGI A;  5TRD A;  4HZF A;  2GZW A;  2JZY A;  4ON0 A;  1B1B A;  3WOD F;  2ADU A;  3LAJ A;  3E97 A;  1IAW A;  2DAO A;  2ISZ A;  3M1E A;  4A5M A;  1XSV A;  2GWR A;  1FBS A;  3LA3 A;  2GA1 A;  1FBU A;  4HV5 A;  2VC0 A;  4ENN A;  1KGS A;  2D45 A;  1C0W A;  1MD0 A;  4GXO A;  5D5W B;  1UHW A;  1FBQ A;  3MQ0 A;  4HF0 A;  3K1M A;  4WWC A;  4HYE A;  3JW4 A;  3ABT A;  3VEP A;  3K9T A;  4YII A;  5CYV A;  2QM3 A;  1T0F A;  5HLG A;  5HLH A;  2FEZ A;  5AON A;  1SAX A;  2STW A;  3JTH A;  1BN5 A;  3LST A;  1IZ1 A;  4IPA A;  1UST A;  2VN2 A;  2O3F A;  1HW1 A;  2ZCW A;  2Q2E A;  2V9V A;  1R36 A;  1OYI A;  4EV0 A;  5L3F A;  3GFM A;  2ZKZ A;  4NQW A;  3EET A;  1DDN A;  2A68 F;  2XAJ A;  2B0L A;  1TNS A;  1JHF A;  2QUF A;  1QPM A;  5J6X A;  3AAF A;  4HLX A;  3GW2 A;  3QPH A;  1SFE A;  3WTY C;  4KIB A;  2QQ9 A;  1FYL A;  2L02 A;  2YX4 A;  2PMH A;  1LNW A;  4R79 A;  5JFR A;  4UV9 A;  1GXP A;  2UWM A;  5DD8 A;  1FP1 D;  2CQK A;  3IRQ A;  3H3Z A;  2O8X A;  3P9K A;  3I58 A;  2VBW A;  2HZT A;  1WWX A;  4L9T A;  2BBY A;  5D6E A;  2ESH A;  2QEN A;  2YSR A;  2HTJ A;  1SD6 A;  2EK5 A;  3BJ6 A;  4R8H A;  4HQE A;  1BOA A;  5LBQ A;  4GYG A;  2EV6 A;  4LJZ F;  3T5X A;  1T39 A;  3HHG A;  5KK1 A;  4N0B A;  2EJR A;  2VOP A;  2M1B A;  1FNN A;  2MH9 A;  5KVR A;  1ON1 A;  1XGM A;  2Z99 A;  3TGN A;  1Z05 A;  2MLG A;  2XKO A;  2STT A;  1R1U A;  2OU2 A;  4OIQ F;  1T98 A;  2LF7 A;  1TW2 A;  2FU4 A;  3HRS A;  3C1D A;  1WSU A;  5CVJ A;  1BIA A;  2KKO A;  4A6E A;  2IP2 A;  3M8F A;  2ZNY A;  3HHH A;  5DUI A;  3WE2 A;  3RTR A;  2XVC A;  1SFX A;  5K5Q A;  4BH9 A;  3CJN A;  3DPL C;  4PGG A;  4G6Q A;  5AIP A;  1YTY A;  1R00 A;  4ENK A;  1Z91 A;  3U9G A;  2QBY A;  3ZN1 A;  1LVA A;  4ZZL A;  2E1C A;  1RNL A;  4MHG A;  3EUH A;  3WTW C;  1YS6 A;  1LDK B;  2A69 F;  1U3E M;  2EFP A;  3GYH X;  5L3B A;  4I7H A;  2L3D A;  3D0S A;  1BI2 A;  2Y0M A;  1G3W A;  2Q0O A;  1P92 A;  3QP5 A;  3BWG A;  1I5Z A;  4Y17 A;  2ZO4 A;  2P8T A;  4I0B A;  4UXN A;  1TQP A;  1P4W A;  2ZNZ A;  3R0J A;  3F72 A;  3KP4 A;  4L9N A;  4IHT A;  4HAM A;  3KZZ A;  3GFJ A;  4I2O A;  1HXD A;  4WXC A;  1E2X A;  1F4K A;  5LEK A;  3T0Y A;  2OA4 A;  4ASN A;  2O03 A;  4CDG A;  4KMF A;  2A61 A;  3CO6 C;  2P7C B;  2CFX A;  4B09 A;  1O3Q A;  3L09 A;  4EGZ A;  4ZH4 F;  5ED4 A;  2HYF A;  1K79 A;  1YIO A;  3LWF A;  4L5I A;  1MKM A;  2EFQ A;  1H9G A;  4AD9 A;  1J2X A;  3P9C A;  4P96 A;  1J0R A;  4NHJ A;  4G9Y A;  2BV6 A;  2R3S A;  5FD5 A;  5LRS A;  3WTS C;  3EYI A;  2LDU A;  1BJA A;  1SFU A;  1ZRF A;  4HF2 A;  3O2P E;  3K1P A;  4ENM A;  2VT2 A;  1Z6R A;  1KU7 A;  3GWZ A;  1ZAO A;  5FB2 A;  1PDN C;  5H20 A;  4GYI A;  5HDN A;  3I53 A;  3ZMU A;  3RPQ A;  5K5R A;  4LGW A;  1XMA A;  4ZYE A;  2RNJ A;  1R7J A;  4FX4 A;  3BJA A;  2VBY A;  2BEO A;  1E17 A;  3P7N A;  2E7X A;  3ZP5 A;  4Y15 A;  4QLC U;  4WX9 A;  1SD4 A;  4U0W A;  1TQI A;  3MEX A;  4P5O A;  4EJT A;  1TW3 A;  1IRG A;  4LD5 A;  1W7P B;  4YFN F;  1V3F A;  3F3X A;  5DD4 A;  4FX0 A;  4OIR F;  2H6B A;  3JSP A;  3P9I A;  1R23 A;  1FP2 A;  1L0O C;  4LMY A;  5J8C A;  5E1Z B;  5L3D A;  1J7K A;  4IF4 A;  2UXN A;  3G3Z A;  2A07 F;  2CYY A;  2DFI A;  2P4W A;  1P2F A;  1XGS A;  1XDS A;  1KU9 A;  3V7C A;  2W84 A;  1R1T A;  3MZY A;  2H94 A;  2MC3 A;  1ZH5 A;  1AOY A;  3RI4 A;  2A6H F;  2K7L A;  4Q47 A;  4A6D A;  2QZ8 A;  4U7B A;  3SZT A;  1O7F A;  2NS0 A;  4Z2Y A;  5LGT A;  3MFK A;  5BPI A;  3WU0 A;  4RB0 A;  4L18 B;  3BP8 A;  2PLY A;  4TV7 A;  1IUY A;  2K86 A;  4ETS A;  5E8G A;  2ZJ2 A;  2OQR A;  3I64 A;  1IRF A;  3FMQ A;  2IW5 A;  4CGZ A;  3E6D A;  3TOB A;  1Z7U A;  1MDM A;  5LGN A;  1ZLK A;  5D5U B;  2KJC A;  3MZH A;  3K69 A;  1MDM B;  2XUB A;  1G3Y A;  4EJU A;  3BY6 A;  3WU1 B;  3I71 A;  2LF8 A;  3R4K A;  2JPB A;  3QU3 A;  2X0L A;  5DEQ A;  2XRN A;  2F5E A;  4KUM A;  4G8X A;  5K5O A;  4ZYH A;  1LB2 A;  3LFK A;  5A2Q K;  2JT1 A;  1HQC A;  3FXU A;  2M87 A;  1R5H A;  2EWN A;  3RKY A;  4M74 A;  2FNA A;  4N9H A;  2QYO A;  5D4S A;  2KIU A;  1XD7 A;  5HDK A;  2COM A;  4L5J A;  3BDD A;  2F2E A;  2TDX A;  1WQ2 A;  2V1X A;  3CUO A;  4S04 A;  1TLH B;  5L3C A;  2O6G E;  2CW0 F;  1TTY A;  4I98 B;  3J81 Z;  2Y48 A;  4EJW A;  1CF7 B;  1S29 A;  4ZZD A;  3C18 A;  4O3M A;  1YW9 A;  5E18 F;  1MJB A;  3OOP A;  4I01 A;  5LEJ A;  2HDC A;  2JPC A;  1NHA A;  4FT8 A;  1LEA A;  2L01 A;  3SXY A;  2PMU A;  5HS9 A;  2RN7 A;  4UV8 A;  2W85 A;  3O6B B;  4EGY A;  1ZAR A;  1REP C;  3DEU A;  3WGG A;  4BHP A;  1YYV A;  4U0Y A;  4HX8 A;  4IJA A;  2ELH A;  2VC1 A;  4RGS A;  3GFL A;  4U88 A;  3K2Z A;  1O3S A;  1W5T A;  1DPU A;  4UVA A;  1IF1 A;  2JTV A;  1IN5 A;  2DQR A;  4ESF A;  2HS5 A;  3KCC A;  1RUO A;  3FX3 A;  3RJP A;  2K27 A;  1ODD A;  1KU2 A;  2VOO A;  4EMS A;  5E20 A;  1BI3 A;  3EQL F;  3F22 A;  4KIF A;  1O3T A;  2G7U A;  3KP2 A;  4FHT A;  3V8J A;  3L9F A;  1J5Y A;  3LAP A;  1LQ1 A;  3IWZ A;  1O7L A;  5CVR A;  2ACJ A;  2VBZ A;  1T6S A;  3F8C A;  1W7P A;  5L3E A;  3KLN A;  3PQJ A;  3HSF A;  1S7O A;  2P6S A;  2M5W A;  1RIO H;  1DP7 P;  1XMK A;  3RKW A;  1IW7 F;  2XGX A;  1VTN C;  1JE8 A;  1MZB A;  3TDU C;  2L4M A;  3ROU A;  4MQ9 F;  3VOE A;  5ERI A;  3BZ6 A;  3KEQ A;  5JR3 A;  2HYG D;  1IXS B;  2RKH A;  5DCM B;  1U5T C;  5E8I A;  5DYM A;  5FFX A;  2XIG A;  1ZHF A;  4GCV A;  4KN4 X;  3U2R A;  5HS8 A;  1ZG5 A;  2PJP A;  4OMZ A;  2EV0 A;  1MGT A;  5TJJ A;  2KIM A;  3GUD A;  4M71 A;  5AIQ A;  2O0Y A;  4XBF A;  2EFN A;  3ABU A;  1BI0 A;  3WTZ A;  4CIC A;  2K02 A;  3R0A A;  4M73 A;  1WKM A;  4OIN F;  2PI0 A;  5LRR A;  2DI3 A;  4MQV A;  1JXS A;  4U0V A;  1S7A A;  3K1N A;  2XHK A;  2F5C A;  2R7D A;  4MEY F;  1D8J A;  1O57 A;  3ZPL A;  1KA8 A;  4LLN A;  2RDP A;  2DPD A;  4H0E A;  5F64 A;  2GIV A;  2O61 A;  4ZYG A;  1FSE A;  5D5X B;  5DCM A;  4PGH A;  2XAQ A;  3GLX A;  5ICG A;  1XCB A;  3BOQ A;  4L9J A;  1HST A;  1RUN A;  1K78 B;  2FSW A;  4KIG A;  3SQN A;  4ESJ A;  5FLX K;  5FLX Z;  4KIC A;  4RAY A;  3FHZ A;  3F8B A;  5FO5 A;  1LDJ A;  2HR3 A;  3JTG A;  1UB9 A;  4GO1 A;  3V7R A;  2AS5 F;  2PN6 A;  3CTA A;  1A04 A;  5DDG A;  1FOK A;  2DT5 A;  3IKT A;  1FC3 A;  4WCG A;  3EYY A;  2HQR A;  2HKO A;  1U5T A;  2YU3 A;  1XN7 A;  3REO A;  2VE9 A;  3HUG A;  1IN6 A;  4P9F A;  3GF2 A;  3I0T A;  4BHC A;  4IVN A;  1HKT A;  3VB2 A;  3TKY A;  4I0A A;  5IT9 K;  1R22 A;  4HA8 A;  2PQ8 A;  3CUQ C;  4EM2 A;  3W6K B;  1K78 A;  5BPD A;  4EVI A;  4M9Z A;  2UZK A;  4HOB A;  5H6Q A;  1IN7 A;  4RB3 C;  3SZP A;  1OKR A;  2DU9 A;  3GXO A;  5JI6 A;  2M45 A;  3JAM K;  2G7H A;  4G7H F;  4BHB A;  1K6O A;  4M6X A;  4E70 A;  3E5X A;  3PQK A;  3F8M A;  3HSE A;  1T2K A;  4O5V A;  2HTS A;  4UVB A;  1ZG1 A;  1SD7 A;  3CUQ B;  2J5O A;  1SMY F;  1LEB A;  1ON2 A;  5HLI A;  2RGV A;  2FQ3 A;  3K0L A;  3KP3 A;  1OYY A;  1IXR C;  4F7Z A;  3CUQ A;  1ULY A;  2W57 A;  5E1X A;  3O3K A;  4NB5 A;  3F23 A;  4RB2 C;  2CO5 A;  2HFH A;  4KFC A;  4A2U A;  4BAY A;  3KZY A;  1GXQ A;  1KQ9 A;  1S6L A;  1QNT A;  1J59 A;  2ZME B;  3F8N A;  2GA2 A;  1QBJ A;  3FM3 A;  5BS6 A;  2Q8K A;  4RS8 A;  3I5U A;  2VE8 A;  4XSZ F;  1I6X A;  5F6F A;  4AVP A;  2WC2 A;  4EQQ A;  3VFZ A;  4RGR A;  3FMS A;  2K4B A;  5ILS A;  2FBI A;  1P6R A;  3F6V A;  1B4A A;  1IN8 A;  2A3S A;  4A0X A;  4I09 A;  3KP7 A;  3HOS A;  2QQA A;  2A5Y B;  4MTE A;  2HGC A;  2P5K A;  1YLF A;  2EB7 A;  4M72 A;  2DO7 A;  1Z6T A;  1EH7 A;  3LQR A;  3J80 K;  5DV5 A;  2Y75 A;  2IA0 A;  3ML6 A;  1EH6 A;  2E7W A;  2OD5 A;  1XGN A;  2IA2 A;  3QP6 A;  4WK8 F;  3WTX C;  3LA7 A;  1P4X A;  5JHU A;  3QU6 A;  1W4M A;  1YS7 A;  2V79 A;  4MGR A;  3SFZ A;  1BC7 C;  2CWE A;  1UCR A;  1Z9C A;  3E5U A;  1W7P D;  3KE2 A;  2WWY A;  4HDU A;  4G94 A;  1GVJ A;  3QRF F;  2EFO A;  1BM9 A;  4JBA A;  2ZFW A;  1ZRC A;  2QLZ A;  1FY7 A;  3ELK A;  2JRT A;  3GZ6 A;  5LHG A;  2CSO A;  3FXQ A;  4UNO A;  1SD5 A;  4KDP A;  1X3U A;  2HEO A;  4RGX A;  1U78 A;  5EEH A;  3B73 A;  2ZXJ A;  4OOI A;  1AWC A;  4KYW A;  2E1N A;  2OZ6 A;  3TO6 A;  2GXG A;  3WGH A;  3N97 A;  1G3S A;  2XAG A;  1PUE E;  5EEG A;  3CDH A;  5HDG A;  2IPQ X;  1Q1H A;  3HRT A;  4M9S A;  4L9V A;  2JSC A;  3M9A A;  2NRA C;  4KT5 C;  3BPV A;  5LGU A;  3C3W A;  4CO8 A;  1KQ8 A;  3ERE D;  3IKV A;  3Q5F A;  1Y0U A;  3M7G A;  3DP7 A;  4BQA A;  1FYM A;  3V4G A;  4CHU A;  1B59 A;  3H92 A;  2ETH A;  3DXJ F;  4XSX F;  2D1H A;  5K1Y A;  3HRU A;  3L2C A;  1YFH A;  1PP8 F;  4KNY A;  3J81 K;  2LNB A;  2H27 A;  1HKQ A;  3T8R A;  1TBX A;  1HSJ A;  4JQF A;  1R1V A;  1KQ0 A;  2Z3Y A;  3QAH A;  4LG0 B;  1G4D A;  3DF8 A;  1G3T A;  3TO7 A;  3L00 A;  2DK5 A;  4Y13 A;  1B9M A;  2PEX A;  1ZG3 A;  2MBF A;  3F8F A;  2LKP A;  2P7V B;  2OZU A;  4A0Y A;  1ZN2 A;  5CVU A;  5E17 F;  2NYX A;  3IC7 A;  5A2Q Z;  4YFX F;  1FSH A;  3NEU A;  4B8X A;  1CGP A;  2W25 A;  1QO0 D;  3BRO A;  3L7W A;  4LFU A;  3RYP A;  3HYI A;  3TQN A;  3ISP A;  2PFB A;  3KP5 A;  2KRF A;  2VXZ A;  2V6C A;  4EM0 B;  1HBX G;  1W5S A;  4M6Y A;  4K2E A;  5BOX A;  3R61 A;  4L0Y B;  2XAH A;  5D8K B;  4EJV A;  3T1B A;  1DPR A;  3CO7 C;  4Q4Z F;  3J80 Z;  3MAJ A;  2OAZ A;  3WTV C;  2Z9O A;  3T8T A;  4HX7 A;  3KET A;  2FA5 A;  4HLY A;  4CZZ A;  3U1D A;  3V7S A;  1YO5 C;  1XCV A;  1U6G A;  3DKW A;  5F1R A;  3TO9 A;  4M9X A;  3ZMD A;  4HQM A;  2FML A;  1IXC A;  2EV5 A;  1DUX C;  4D0P A;  3ZMT A;  1HW5 A;  2H6C A;  5ILU A;  1ONV A;  1HKS A;  4GGG A;  4ZYD A;  4UHT A;  4WF2 A;  4N9I A;  4AWX B;  5BMZ A;  2D2W A;  2KIF A;  1QQI A;  4PDK A;  2WTE A;  2GAU A;  4HV6 A;  1FT9 A;  3V8L A;  3BPX A;  2QWW A;  2XV4 S;  4A5N A;  2R7F A;  3DPT A;  3HRM A;  1HW2 A;  4PZJ A;  3HOT A;  3S2W A;  2BYV E;  5ICF A;  1G6N A;  2NNN A;  4I02 A;  3GO5 A;  4KA4 A;  2IVM A;  2P5V A;  3V8K A;  1USS A;  1B9N A;  1FLI A;  4XRF A;  4BXU A;  3R60 A;  3E6C C;  1U5T B;  2HWV A;  1YW7 A;  1Z1D A;  3FWE A;  3B02 A;  5H6R A;  3RDI A;  4IHS A;  1S8N A;  3KFW X;  2P5L C;  2FBK A;  2BGC A;  1FX7 A;  3NRV A;  5IT3 A;  5LLQ A;  1XB4 A;  5DUK A;  2K4J A;  5J8F A;  3F21 A;  2V1D A;  1S3J A;  2FRH A;  5FGM A;  1QZY A;  3E6M A;  1YQA A;  3RYR A;  4CXF A;  3E6B A;  3RIR A;  2DBB A;  3TOA A;  1LJ9 A;  2BE5 F;  4WXH A;  4P55 A;  2V1U A;  1U8R A;  4S05 A;  2DTR A;  1P4A A;  4BYY A;  5CVI A;  4L0Z B;  2IRF G;  3I59 A;  3LQQ A;  4A0Z A;  4CYD A;  2MA3 A;  2P6T A;  1RI7 A;  2FNP A;  2EA4 A;  1TNT A;  4LB5 A;  1R5G A;  5D4R A;  3GX4 X;  2J5P A;  1TQM A;  2ZBK A;  1KU3 A;  4RAZ A;  2XAS A;  5FD6 A;  3SHF A;  4MEX F;  1OYW A;  2DK8 A;  1O3R A;  4HX4 A;  1OMI A;  2LSO A;  2FMY A;  1I27 A;  1F5T A;  4UUV A;  3ZN0 A;  3HIF A;  4XLN F;  1UHM A;  1YW8 A;  2FE3 A;  4OU0 A;  2GQQ A;  3FXR A;  1D3Y A;  2FBH A;  3IHU A;  3ZMS A;  3Q9S A;  2VBX A;  4DQ2 A;  3GZ5 A;  2FF4 A;  3ECO A;  3R6S A;  5D8L B;  2ZME A;  3FF5 A;  5DCF A;  1ZGA A;  3HTS B;  1LDD A;  1OR7 A;  1BIB A;  2Z33 A;  2MH2 A;  4U7D A;  4ESB A;  4IRI A;  3MWM A;  2OBP A;  5HS7 A;  4LG0 A;  3ZQ7 A;  2QBY B;  1EH8 A;  2UXX A;  1XSD A;  5CVV A;  4LLL A;  2YPR A;  5ICE A;  4LK0 F;  2OQG A;  2WV0 A;  3H3U A;  4LK1 F;  1IN4 A;  5CJ9 A;  1UFM A;  3WTU C;  2DQL A;  2CG4 A;  3JAM Z;  2CGP A;  3GEZ A;  1OPC A;  3DQV C;  5D6F A;  1EV7 A;  2IJL A;  2XRO A;  2YR2 A;  4KMU X;  2ESN A;  2F5F A;  4QWQ A;  4WXD A;  1RZ4 A;  1L3L A;  3CLO A;  2AXL A;  2D1V A;  3JSO A;  5IT9 Z;  3RPU A;  1KYW A;  1MJA A;  2M30 A;  1BC8 C;  4UVC A;  3N4M A;  2VOD A;  3HTU A;  5L3G A;  4HDV A;  1XSX A;  4EM1 A;  4DNC A;  1FYK A;  1D8K A;  1F1Z A;  4Q48 A;  1ZRD A;  2PBI A;  4IRG A;  2Z5U A;  3NQO A;  3TDZ C;  5FFZ A;  4HF1 A;  3FZV A;  4RB1 A;  2EFW A;  4ENJ A;  1XGO A;  1ZYR F;  2NAZ A;  4IXA A;  3C7J A;  2NNY A;  4KN7 X;  1J75 A;  2DPU A;  3M8E A;  3I4P A;  4HBL A;  2FOK A;  5HVQ C;  3BJO A;  1K7A A;  2MD5 A;  5LHI A;  2L4A A;  4G7Z F;  1B6A A;  4AIH A;  2EA2 A;  2MLK A;  1QZZ A;  4YIF A;  3WTT C;  5ILV A;  4OMY A;  2A6E F;  3ZMV A;  1KYZ A;  4MNU A;  1YG2 A;  4P9U A;  2L54 A;  3E5Q A;  2ISY A;  2G9W A;  3F6O A;  1R58 A;  3Q9V A;  3QOP A;  3GFI A;  1F9N A;  3KEO A;  1ZLJ A;  3OV8 A;  1H0M A;  1SMT A;  2PG4 A;  1XDU A;  4OIO F;  4EJO A;  5CLS A;  4XLP F;  3HSR A;  4MTD A;  5HOO A;  1STZ A;  3QPT A;  2IA1 A;  4JK1 X;  2HKX A;  3VOD A;  3J7A O;  3DFG A;  3IL2 A;  2DW4 A;  3G73 A;  2RV8 A;  3RKX A;  2XKP A;  4R1H A;  1I1G A;  1ZGJ A;  2KJB A;  3FMR A;  3FM5 A;  3PFI A;  2YX7 A;  1FZP B;  3MCZ A;  1BI1 A;  4G7O F;  1JGS A;  2DLL A;  4YG2 F;  2W24 A;  3ULQ B;  6PAX A;  4A12 A;  3ZMZ A;  2RQP A;  1H9T A;  1ZRE A;  2RC4 A;  3DV8 A;  3EDP A;  2FXA A;  2QVO A;  4HW0 A;  2HQN A;  3LA2 A;  4G6D A;  1FPQ A;  4OIP F;  3I54 A;  2C6Y A;  4BNC A;  2H09 A;  3E3V A;  4O6J A;  3IWF A;  4LB6 B;  4AIJ A;  3D5L A;  3W6J B;  2VT3 A;  5JVT A;  5BQT A;  1D5V A;  5D5V B;  2RVC A;  3WG9 A;  2IT0 A;  3COA C;  2HOE A;  1WRJ A;  4LLG F;  1CF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...