3TDZC

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-stapled acetylated ubc12n complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
SNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/inhibitor
molecule keywords DCN1-like protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tdzC00
2LKPA 3I5UA 2DTRA 3PQJA 5ILSA 3TO9A 3LAJA 2IP2A 3E5XA 1FX7A 1QPMA 3LSTA 3PFIA 4P96A 2F5DA 3AAFA 1YS7A 4L9TA 4U7DA 1TW3A 1XGMA 4LMYA 1JE8A 1I6XA 2HOEA 2XAHA 4KUMA 3GZ6A 5FLXZ 4L18B 5DCMA 4XSXF 5FGMA 3KLNA 1IRFA 1JXSA 1HQCA 1D8JA 3REOA 1DDNA 2OBPA 1IXCA 4EM0B 5BQTA 3GFLA 3LAPA 3OV8A 4KN7X 1FP2A 2YSRA 3QRFF 2A6EF 4I09A 2ZKZA 2V1UA 3QAHA 2PMHA 2HTSA 2DPUA 3F6OA 3ZN1A 2E7WA 4A2UA 3R6SA 2VE9A 2UWMA 4YFKF 1OYWA 2Y0MA 4BHCA 2FMYA 2LSOA 2JT1A 3WTWC 4RB0A 4G7OF 3VEPA 1L3LA 2P7CB 3SFZA 4LK0F 3T1BA 5HLHA 1U3EM 1TNTA 1FYKA 4HW0A 2CGPA 3BPXA 4F7ZA 3E5QA 5E8GA 1U78A 3NRVA 3T8RA 4ZH4F 2HYFA 1SFEA 5HDKA 1ODDA 1KU3A 3TQNA 2K4JA 3ECHA 2XVCA 3V7CA 3V7RA 2IVMA 5DUIA 4EJWA 1T6SA 3WU0A 1GXQA 3BJOA 2M5WA 4MHGA 5CVVA 1I27A 3DPLC 3LWFA 4R79A 1XMKA 5D5VB 1SD7A 2L4AA 3C18A 3FWEA 2ZJ2A 3HSRA 5KVRA 2F5CA 1IAWA 3W6KB 3ZQ7A 3G3ZA 2DT5A 3BROA 3GXOA 3MZYA 1O3TA 3ZN0A 5JVTA 2VC0A 5FD5A 4M6YA 4HAMA 2CO5A 1S29A 5L3GA 1B6AA 2PJPA 2FRHA 3HRTA 1D8KA 3DF8A 4BQAA 4O6JA 2J5PA 2HQNA 2FBIA 2MH9A 2EFQA 4I2OA 4RAYA 2OU2A 3P9IA 1W7PD 4BHBA 3IHUA 4BAYA 5E1ZB 2MD5A 4LB6B 5DD8A 1OYYA 3J80Z 1IN8A 1FY7A 3CUQB 2GA1A 2QQBA 3ZMSA 1RZ4A 5DYMA 3F8CA 2YX4A 1IRGA 1LQ1A 4A5MA 3H3UA 4PDKA 1OKRA 5K5RA 2O61A 2X4HA 5FLXK 2LF7A 2EV6A 3F72A 2PMUA 1IXRC 2FEZA 1CGPA 2QYOA 1ONVA 2CYYA 1YIOA 2Q2EA 5D5WB 4CHUA 2Z3YA 4JK1X 4WK8F 4U0YA 3SZTA 4HQMA 4G7HF 5E1XA 5H6QA 1ZN2A 1V3FA 5FB2A 1STZA 5DUKA 4IXAA 2BEOA 2IRFG 2XASA 2QBYA 4KIBA 2VOPA 2D2WA 5D4SA 2KIUA 2LNBA 3BZ6A 1V4RA 3FM3A 4AIHA 2P7VB 1YYVA 1HW1A 1KYWA 1O3SA 4AIKA 3TOAA 1I1SA 3RYRA 1W7PA 1RUNA 5ICFA 2PI0A 1UHWA 3E6BA 3O6BB 5BS6A 4Q5SF 1R22A 4Y17A 2IA0A 5J8FA 1RIOH 1BJAA 4P5OA 2BE5F 2L02A 2EWNA 2L01A 2JRTA 3FX3A 4KN4X 1YG2A 1B4AA 1KU2A 1XSVA 2HR3A 3LA2A 5JR3A 4XSZF 5DD4A 2Q8KA 1ON2A 4JBAA 2DW4A 4EJVA 3WU1B 3FMQA 4N9HA 1HSTA 4DNCA 4UV8A 4EM2A 4M9XA 1R58A 5CYVA 1MJAA 3G73A 1GXPA 2STTA 2Z9OA 1U5TA 2W85A 3ML6A 2H27A 4O3MA 4RS8A 1QZYA 3FM5A 3H92A 3N97A 3FF5A 4A5NA 5L3CA 3I4PA 1S8NA 2EV5A 2YR2A 1SD6A 1FYLA 3GX4X 2A61A 1USSA 2IT0A 2D45A 1G3TA 4LJZF 5LGUA 5E8IA 1TQMA 5HOOA 3WGHA 2XAJA 4A0XA 4CICA 1FNNA 3CTAA 5BMZA 1G3WA 1J2XA 2EFWA 1ON1A 3ROUA 3VFZA 3J80K 1CF7B 1ULYA 2FNPA 2VT2A 3FXQA 4I01A 4UHTA 5LLQA 3ULQB 5H6RA 2H6BA 4GO1A 1IN5A 4M71A 1FP1D 1Y0UA 4HF2A 3I64A 2EA4A 4G6DA 1AOYA 3RIRA 3I59B 4NB5A 4K2EA 2NNNA 2R7DA 5HVQC 2PN6A 1OMIA 4ZZLA 5D8LB 1IN7A 3T8TA 2F5EA 4PCQA 1QQIA 2ACJA 5D6FA 3Q9VA 1U5TC 1BN5A 2K7LA 5JHUA 1FLIA 4P9UA 1IN6A 2MLGA 3KP2A 1WSUA 1QBJA 5ED4A 2ELHA 2NYXA 5IT9Z 2FNAA 2KKOA 2A07F 3F6VA 4WXHA 3D0SA 2CFXA 2J5OA 4HLYA 3JSPA 1SFXA 5ILVA 4I7HA 4CGZA 5BPDA 4R8HA 3EYIA 1S6LA 1WI9A 2HKOA 4B09A 2FMLA 2HYGD 3WE3A 3ISPA 4G6QA 4LG0A 2DFIA 1R1UA 3V8KA 2DO7A 3FMSA 4HA8A 5HLIA 4I0BA 1B1BA 2FF4A 1O57A 2M30A 1BI3A 2UXXA 3HSFA 1FBQA 4HX7A 4BNCA 2XAQA 3K2ZA 3WE2A 2YPRA 2MC3A 2VXZA 3CJNA 4YFNF 5LBQA 2ZO4A 2DK8A 3MQ0A 3LA7A 1QO0D 1U8RA 1YO5C 1W4MA 3P7NA 1T98A 4CDGA 4A0ZA 4MTDA 1SMYF 2H94A 5FFZA 4CZZA 3R0AA 1MJBA 4QLCU 1ZHFA 3RKWA 3ERED 2HWVA 2FXAA 4RGRA 1EH8A 4L0YB 3HHHA 1XCVA 1LJ9A 5CVJA 2X0LA 3SQNA 1O7FA 1BI0A 4HLXA 5EEHA 1XDUA 1HSJA 3WGIA 3M7GA 2XAGA 4M74A 1ZRCA 3KZYA 2EK5A 4I0AA 5CVUA 2XHKA 2O6GE 1KYZA 3V8LA 2H6CA 2MBFA 1XGSA 3ZMUA 3KP3A 3GZ5A 4IF4A 4Q48A 5E18F 2Z33A 4LK1F 1MD0A 2ZCWA 2ZNZA 2QZ8A 2HZTA 4KMUX 1XCBA 4DQ2A 4Q4ZF 1MJ9A 2CQKA 2NAZA 4OOIA 3FMRA 4ETSA 4KICA 2EFPA 5LHIA 1PP8F 1T38A 1MDMA 2AS5F 1J0RA 2DQLA 5E20A 4IRGA 4S05A 2PBIA 2RV8A 2KJBA 4HYEA 2XV4S 2V6CA 4Y15A 2HKXA 3BY6A 1FC3A 1FBSA 3GO5A 3O2PE 1DP7P 5DCMB 1HKSA 5CVRA 4P9FA 3DFGA 2VC1A 1YTYA 1Z05A 2DQRA 4ZYHA 2KRFA 4RGXA 2ZFWA 2CSOA 1BI1A 1WQ2A 4WF2A 5LHGA 3TKYA 3FXRA 3KZZA 2IA1A 4HBLA 4CYDA 2NNYA 4D0PA 2F5FA 1OR7A 1VTNC 1XD7A 2P5VA 2JPCA 4TV7A 2H09A 2NS0A 2A68F 2VBZA 2RNJA 5CJ9A 4MQ9F 3IWFA 1T39A 3BP8A 4GCVA 3CLOA 1WKMA 4CO8A 4ENJA 2OZ6A 3F21A 1LEAA 3GW2A 1KA8A 5LEJA 1FOKA 2BYVE 4LFUA 3T0YA 5LHHA 2M8EA 4LGWA 3BDDA 2JTVA 1BIAA 2QENA 2VONA 2WTEA 1BIBA 2Z5UA 1AWCA 3R4KA 4E70A 2E1CA 2FA5A 3I58A 2QLZA 2VBXA 2IJLA 1ZREA 5F1RA 3F22A 5J8CA 2DBBA 4HX8A 4R1HA 4IPAA 2QQAA 3JAMZ 4HZFA 1ZLKA 2V1DA 2E1NA 2HGCA 3FHZA 2W25A 3O3KA 3KCCA 1S3JA 2GA2A 3BJ6A 2BGCA 3WG9A 3NEUA 1HKTA 3H3ZA 3BOQA 1FPQA 1LEBA 4XBFA 3MZHA 3Q5FA 1RNLA 2MA3A 4U88A 4ESBA 4NHJA 1J7KA 2EB7A 4OU0A 4I02A 1O7LA 2DI3A 5AIPA 3J81Z 1EV7A 1HBXG 1UHMA 1L0OC 2STWA 2ETHA 2ZMEB 4AWXB 2GAUA 1ZAOA 1OYIA 3WTXC 3GVAA 3B02A 3HHGA 1KQ0A 4IRHA 5L3BA 1K78B 3CUOA 2KIMA 3MEXA 3KLOA 4WWCA 5ICGA 4A6DA 4KDPA 2OQGA 3R60A 3TDUC 3M9AA 3TDZC 1ZRDA 2ZBKA 4PGHA 1BBYA 4OMZA 3KFWX 3F3XA 1LVAA 3KEOA 5F6FA 3DV8A 5EEGA 2K4BA 2MH2A 2QM3A 1P2FA 3ECOA 4OIQF 3KP4A 1YS6A 2GXBA 2HEOA 1XDSA 4MEXF 1YW9A 4YIFA 3SZPA 1S7OA 1LB2A 1H9TA 4OINF 2QBYB 2PLYA 2O8XA 3B73A 4G94A 3WTSC 4GYGA 4IJAA 4KA4A 5BOXA 2F2EA 1YW8A 5IT3A 2QQ9A 4ENNA 1WWXA 3WODF 2DPDA 2VODA 4KMFA 5FFXA 2HFHA 3L00A 4UNOA 1MKMA 1W7PB 4IVNA 5LRRA 2W84A 2VBWA 1BC8C 1Z9CA 3RPUA 4ZYGA 4WX9A 4HV6A 4EJTA 1KQ8A 2YX7A 3LA3A 1U6GA 3QOPA 4KIGA 4EJOA 2LDUA 4M9SA 3MWMA 3I71A 4Q47A 5LEKA 4HF0A 1R5HA 3W6JB 1I1GA 4N9IA 4UVAA 3VB2A 5DDGA 2GIVA 4B8XA 3DEUA 5E17F 5HDGA 3EUHA 4L5JA 1F9NA 2RVCA 4BHPA 1U5TB 4RAZA 4U0WA 2HS5A 3MAJA 5HS7A 4CXFA 3F8MA 3K9TA 3BWGA 1EH7A 1IXSB 3K1NA 1F1ZA 1J9IA 2JZYA 3K1PA 4EVIA 4YIIA 2HQRA 1DUXC 3VOEA 2E7XA 3F8NA 3J81K 5F64A 3HOTA 4RB1A 1B59A 3V4GA 3K1MA 5AIQA 2CWEA 1B9MA 1IN4A 5D8KB 1F5TA 5ICEA 2ISYA 3ZMVA 4QWQA 3WGGA 2FSWA 2OQRA 3SXYA 4L0ZB 3E3VA 3U9GA 3QPHA 1FBUA 4FX0A 3TGNA 2KIFA 2UXNA 5A2QZ 1TQPA 1SMTA 2VN2A 4HQEA 4M72A 2O3FA 1LDDA 1MGTA 4FX4A 4HX4A 2HTJA 1KU9A 4KT5C 2P6SA 2QWWA 3E6DA 3HSEA 2VT3A 1P4WA 3QU3A 1IF1A 1FSHA 2XKPA 3K69A 1K7AA 1F4KA 4MTEA 4FHTA 2XKOA 2GZWA 2W57A 2UZKA 5ILUA 1R1TA 3KP6A 1J59A 2O03A 3QP6A 6PAXA 3HRMA 1R23A 4EQQA 1E17A 2A6HF 2K86A 3L2CA 4ENKA 4L9VA 3TO7A 2XUBA 3ZMDA 3PQKA 2XROA 4XLPF 4OIOF 3LQQA 1BOAA 4RGSA 1H9GA 1W5SA 4M9ZA 4LB5A 1NHAA 2CW0F 1D5VA 1J75A 1P6RA 2XGXA 2V79A 2DLLA 1T2KA 5HS9A 4H0EA 1G3SA 4HF1A 4GGGA 4LLLA 3KE2A 4AIJA 3D5LA 1ZLJA 3Q9SA 2V9VA 3V8JA 1HKQA 2XAFA 1XSDA 1B9NA 5L3EA 1REPC 4L5IA 1R00A 4XLNF 1I5ZA 1QZZA 4HV5A 4EM1A 1K6OA 1C0WA 1HW2A 1SD5A 2FBHA 1R7JA 2BBYA 1JHHA 4KFCA 2JSCA 1TBXA 3RDIA 2Y48A 3KP5A 4O5VA 3K0LA 3R0JA 2PG4A 2A5YB 3RPQA 2Y75A 1FZPB 2HDCA 3DXJF 4Z2YA 2D1HA 4AD9A 1SD4A 3NQOA 2EFOA 2RQPA 1T0FA 4IHSA 3DKWA 3I54A 3ELKA 3RKYA 4OIPF 4KYWA 4BH9A 3JTGA 1UB9A 1ZGAA 5A2QK 2FOKA 5K5QA 4M6XA 5D5XB 4L9NA 4Y13A 4ENMA 1E2XA 1BI2A 1FSEA 4OIRF 5IT9K 3N4MA 3CDHA 3HRSA 4BXUA 2K02A 1GVJA 1ZH5A 3E6MA 3I0TA 4YG2F 1Z6TA 2RGVA 3EDPA 4AVPA 3ABTA 3GFJA 1H0MA 4MNUA 1FYMA 4MGRA 1JGSA 1XGNA 1D3YA 1MDMB 5HLGA 1SFUA 1P4AA 5HS8A 2P4WA 3QU6A 5ERIA 4G7ZF 1Z7UA 3IRRA 2IW5A 2ZNYA 5CVIA 4A0YA 2FQ3A 4UUVA 2M1BA 5HDNA 4HOBA 2FU4A 2XIGA 3M1EA 1J5YA 1O3RA 3RI4A 3P9KA 2COMA 1EH6A 3GFIA 2O0YA 3CUQA 5JI6A 1RI7A 4ESFA 2Z99A 3GEZA 4EGYA 1FWZA 5KK1A 4RB2C 1BM9A 2A69F 2B0LA 4S04A 3IKTA 3VODA 2OD5A 5DEQA 4RGUA 4EJUA 3SHFA 1XSXA 4GYIA 2WV0A 4XRFA 2EA2A 5K1YA 1IW7F 3GFMA 4EGZA 2ZMEA 5AONA 2R3SA 1KU7A 1XN7A 5H20A 2QVOA 3BJAA 1TNSA 2KJCA 4L9JA 1K78A 1KGSA 4MEYF 3F8BA 1R36A 4ZYDA 4UVBA 3FZVA 2IA2A 2XRNA 2RC4A 4U7BA 1YLFA 2EFNA 3CO7C 1ZGJA 2V1XA 1LDJA 4ON0A 1Z1DA 4WCGA 2YU3A 3RYPA 3RJPA 2LF8A 2R7FA 3QP5A 1IUYA 2OAZA 3IL2A 2L3DA 3R61A 1W5TA 2P5LC 2RDPA 1OPCA 3T5XA 3E97A 2L4MA 3IRQA 1Z6RA 1ZARA 3IWZA 3V7SA 4OMYA 1O3QA 4ZYEA 4HDVA 2C6YA 3CUQC 1KQ9A 1A04A 3GYHX 3DQVC 1TLHB 5ICCA 2VBYA 4KNYA 3F8FA 2GWRA 5CLSA 1LNWA 4N0BA 1Q1HA 3MCZA 1TW2A 1UCRA 2Q0OA 2ADUA 4FT8A 3E5UA 1HXDA 2P5KA 2D1VA 4IRIA 1R1VA 4HDUA 2M45A 3JW4A 4M73A 4GXOA 2JPBA 3MFKA 3HYIA 1P92A 5DCFA 1PP7U 2OA4A 3I53A 2ESHA 4YFXF 1JHFA 4G9YA 2VOOA 2WWYA 2ZXJA 4EMSA 4U0VA 5TJJA 1TTYA 3KETA 3BPVA 2GQQA 3OOPA 1CF7A 4A6EA 5JFRA 2L54A 3WTVC 3HRUA 2RKHA 3ABUA 5FO5A 5J6XA 2ESNA 1S7AA 3IC7A 3WTYC 3HOSA 5LGTA 3I59A 2IPQX 3L09A 3L7WA 3ZPLA 3HTUA 2FE3A 1YFHA 3JAMK 5TRDA 4LD5A 1R5GA 3U1DA 1ZRFA 2EJRA 3KP7A 3DPTA 1ZG5A 3CO6C 4UVCA 1ZG1A 4A12A 1BC7C 3J7AO 4PGGA 3TOBA 5L3FA 4WXCA 4MQVA 3TO6A 4LLNA 1HW5A 2VE8A 3U2RA 4NQWA 2W24A 2MLKA 1PUEE 3LQRA 3KEQA 1QNTA 1ZYRF 1FT9A 4LLGF 2WC2A 2P6TA 2DU9A 3ZP5A 5D5UB 1K79A 5LGNA 3C7JA 3RTRA 1P4XA 2QUFA 3M8FA 3C1DA 3GUDA 4G8XA 1LDKB 1X3UA 1XB4A 3L9FA 4UV9A 1G3YA 2FBKA 1G4DA 3RKXA 2EV0A 1XMAA 3F23A 3C3WA 4UXNA 4I98B 1UFMA 2M87A 4EV0A 3IKVA 2PFBA 2P8TA 3P9CA 3JSOA 3COAC 2CG4A 4ESJA 1RUOA 5BPIA 2AXLA 2TDXA 3JTHA 3ZMZA 3GF2A 1MZBA 2PQ8A 2BV6A 1ZG3A 2G9WA 3ZMTA 3FXUA 1DPRA 3HTSB 3EQLF 3HIFA 4ZZDA 3QPTA 1SAXA 4ASNA 1PDNC 5D4RA 1QGPA 4IHTA 2DAOA 1YW7A 5L3DA 2K27A 1IZ1A 2G7HA 4KIFA 1GHCA 3GLXA 1U2WA 5E1WA 5LRSA 3HUGA 3E6CC 5K5OA 5D6EA 3WTTC 2PEXA 2G7UA 1DPUA 2OZUA 1G6NA 2A3SA 5DV5A 4PZJA 3WTZA 2NRAC 4JQFA 4RB3C 4P55A 1USTA 1YQAA 5FD6A 1Z91A 1XGOA 1TQIA 3DP7A 3LFKA 2DK5A 3S2WA 2RN7A 4LG0B 3WTUC 2ISZA 3EYYA 3EETA 4WXDA 3M8EA 3GWZA 1WRJA 2GXGA 4BYYA
chains in the Genus database with same CATH superfamily
2LKPA 3I5UA 2RREA 2DTRA 3PQJA 3RQ4A 2RQQA 5ILSA 4V2GA 1FMVA 3JRHA 3BZKA 2X1DA 3M4OJ 3TO9A 1HF0A 3LAJA 1ETVA 3BTCA 2IP2A 4QTRA 3E5XA 3I4MJ 3S14J 1FX7A 1QPMA 3LSTA 1I3QJ 3PFIA 4P96A 3FHNA 1W36D 2F5DA 2CV0A 3AAFA 3LOCA 3BLYA 1ZTRA 1YS7A 4L9TA 4U7DA 1A36A 4XKVA 3OYFA 1TW3A 4XLCA 1X4PA 1XGMA 4LMYA 4F3QA 4DBRA 4IZZA 1JE8A 2TRTA 1I6XA 2HOEA 4EEFG 2XAHA 5F1JA 1LFUP 2A05A 3EUAA 3GLLA 1FEXA 4KUMA 3GZ6A 4II3A 5FLXZ 4L18B 5DCMA 2PJRB 3S2HJ 2IGNA 4XSXF 5FGMA 3KLNA 1IRFA 2ID6A 4UB8C 1JXSA 2HDWA 4C3JJ 2OCEA 1HQCA 3NWTA 2DFFA 4X1EA 1D8JA 3REOA 3BTJA 3RZOJ 3EPZA 2CRGA 2DA7A 1DDNA 1FMWA 1QHHD 5F08A 2DMNA 2OBPA 3MVPA 3TP0A 1IXCA 5FKOA 4PSXA 4EM0B 2FQ4A 3I3LA 3K4KA 5BQTA 3GFLA 3MN2A 4AYBN 1IV6A 3WHCA 2QCOA 5K7ZA 3LAPA 1F43A 3OV8A 2K9NA 4KN7X 5BNGA 1FP2A 3PIPF 1UZCA 2YSRA 3QRFF 1Y1VJ 2X1CA 3E0JB 2A6EF 4I09A 3LSPA 2ZKZA 4C2UA 3GBGA 1VQ8I 2V1UA 3QAHA 2PMHA 3I9V2 2HTSA 2JUGA 2DPUA 3F6OA 3ZN1A 2E7WA 1JKPC 3TW6A 3L2QA 4A2UA 3R6SA 2CQQA 2Y69H 2VE9A 2R5YB 2UWMA 4YFKF 3ZQFA 1OYWA 1S7EA 1TP4A 2Y0MA 2E2JJ 5B1BH 4BHCA 2FMYA 2LSOA 2JT1A 3TMOA 2VJ5A 2XSJC 3WTWC 4RB0A 4G7OF 3VEPA 2HQ5A 4E7HA 1L3LA 3SFZA 2P7CB 4LK0F 3T1BA 4RDUA 5HLHA 1U0JA 1QZEA 1U3EM 4XORA 4L5EA 1TNTA 4ITVA 4HW0A 1FYKA 1JTXA 2CGPA 3BPXA 3K70C 4F7ZA 3E5QA 2JMWA 5E8GA 2IGKA 2R5ZB 1U78A 2DOEA 3NRVA 1TZLA 3T8RA 4ZH4F 1D1AA 2HYFA 2WAFA 4XONA 2HYJA 1TWAJ 1SFEA 5HDKA 3BR1A 1ODDA 1KU3A 2EIJH 2LTPA 2NOGA 3TQNA 2K4JA 3ECHA 3FXMA 2DFHA 2VKEA 2DFEA 4XLHA 4A3MJ 2XVCA 1BR1A 1NTCA 3V7CA 3V7RA 2IVMA 2F4MB 5DUIA 2LH9A 4EJWA 1T6SA 5E3LA 3WU0A 1GXQA 3BJOA 1ZGWA 2M5WA 4MHGA 1NK2P 5CVVA 5FLMJ 2W1OA 1Y0NA 3K4LA 1I27A 3DPLC 3LWFA 4R79A 2XB0X 3BC8A 1XMKA 5D5VB 1SD7A 2L4AA 3C18A 2X6WA 2ZJ2A 3FWEA 3HSRA 5KVRA 2F5CA 1IAWA 1ETWA 3W6KB 3ZQ7A 3G3ZA 1MH4A 2DT5A 3BROA 5DM6F 3GXOA 1RETA 3MZYA 1JT6A 3U21A 1O3TA 3W3CA 3ZN0A 4H4KC 5JVTA 2X48A 2VC0A 4X0GA 1WJAA 2VPRA 4NUBA 4HEA2 5FD5A 4M6YA 4HAMA 2CO5A 1K4TA 3SYTA 2XGDA 4A3BJ 3TL4X 5HNHA 1S29A 5L3GA 1D5YA 2V7FA 1B6AA 2PJPA 4FE7A 2FRHA 2R7VA 3HRTA 2PX9A 1D8KA 1S9HA 3DF8A 4BQAA 4O6JA 2FJ1A 2V9KA 2J5PA 2HQNA 2FBIA 2MH9A 3A01A 3CDLA 4G6TB 2EFQA 5EG0B 4XLAA 4RAYA 4I2OA 2WY8Q 3BG3A 1AA7A 3DBRB 1WH7A 3VYTB 2OU2A 3P9IA 1W7PD 4BHBA 3IHUA 4HNUA 4BAYA 5HLTA 2E71A 5E1ZB 2MD5A 1H89C 2ID3A 3CLQA 3DEWA 4LB6B 2BZTA 1JTYA 4XKCA 5DD8A 1OYYA 3J80Z 4XLFA 1IN8A 1FY7A 3CUQB 1DGWY 3LSRA 2I5UA 2GA1A 1W5CC 2QQBA 3H9QA 5F0FA 3ZMSA 3KZIC 1RZ4A 5DYMA 1QA6A 3F8CA 2L9SA 2YX4A 5J47A 2LY1A 3DBHB 1IRGA 3L2WA 1LQ1A 4A5MA 4PSWA 3H3UA 2JRMA 4PDKA 4IOCF 1OKRA 5K5RA 2ZJRF 2O61A 2X4HA 5FLXK 2LF7A 2EV6A 2V1NA 3F72A 2PMUA 1IXRC 3GTQJ 2FEZA 1CGPA 1NK3P 2QYOA 1ONVA 2CYYA 3ZCOA 1YIOA 2Q2EA 5D5WB 4XICA 2V4JC 2R0QC 4CHUA 5CKTA 3ZRGA 2VASA 2Z3YA 4JK1X 1RPWA 2VI6A 3CMMA 4LITA 3SZTA 2E34A 4HQMA 4U0YA 5E1XA 4WK8F 4G7HF 5H6QA 3FK6A 4XM3A 1ZN2A 3OY9A 2ZJQF 2LBFB 3LMMA 1V3FA 1QU3A 2Y30A 1D0XA 5FB2A 1STZA 2LYCA 5GTHC 1XMXA 1IG7A 5DUKA 4IXAA 2BEOA 2IRFG 4Y7NJ 2IS1A 2XASA 2FUG2 5C4JJ 2QBYA 4KIBA 2VOPA 3BTIA 3LL7A 3GTJJ 5K7FA 1D1CA 4LIUA 2D2WA 3G2BA 5D4SA 3ONQA 2KIUA 2LNBA 3BZ6A 3CZ6A 2HPMA 1XX5A 2DA1A 4RLQA 1IGNA 1V4RA 1WPKA 3FM3A 5LD2C 4AIHA 2P7VB 1YYVA 4MO7A 5EEAA 1HW1A 3ABMH 1KYWA 3CMYA 3HGGA 1O3SA 3KPHA 4AIKA 3TOAA 1I1SA 3RYRA 1W7PA 2JVGA 5J4VA 1RUNA 5ICFA 4RLFA 2PI0A 3LSGA 1SFOJ 1UHWA 3E6BA 3O6BB 5BS6A 2KRHA 4KT6A 4Q5SF 1R22A 4Y17A 1Q1VA 1JUMA 2IA0A 5J8FA 1RIOH 2ZMEC 2VKVA 1OJLA 1BJAA 3W2WA 3BR6A 5E3OA 4P5OA 2BE5F 2F48A 4QIWN 3A0BC 2KFDA 2L02A 3IV5A 2EWNA 2KLOA 2JRTA 2L01A 4XRSA 1WJCA 3FX3A 4KN4X 1YG2A 1B4AA 1KU2A 1XSVA 2HR3A 3LA2A 5JR3A 4XSZF 5DD4A 3JR9A 2Q8KA 1ON2A 1IUFA 4JBAA 2DW4A 4EJVA 1N25A 3WU1B 3FMQA 4N9HA 1HSTA 1RKWA 4DNCA 4UV8A 4EM2A 4M9XA 1R58A 5CYVA 2AQFA 1MJAA 2KPMA 2W82A 3G73A 4DYQA 1GXPA 2STTA 5GP9A 2Z9OA 4BUPA 1U5TA 2W85A 5EGOA 3ML6A 1MNDA 2H27A 3PNTA 3BCAA 4O3MA 4RS8A 1OQYA 1QZYA 3GTLJ 3FM5A 3QWLA 3H92A 3MZ8A 3S8PA 2HXIA 3W6VA 3GCMA 1QRYA 1VQOI 3N97A 2DMUA 3FF5A 1R71A 9ANTA 4A5NA 1B72A 2MD0A 5L3CA 3MKLA 2CW8A 1M1EB 4A3GJ 3I4PA 1LE8A 1S8NA 2EV5A 2YR2A 3BG9A 2Y9ZA 1MBKA 4XN3A 3JRAA 1A6IA 1SD6A 3B6CA 1FYLA 2CUJA 3GX4X 2R7OA 2HVRA 2BVMA 1SFKA 4QSHA 2A61A 3ZGKA 1USSA 2IT0A 1ETKA 5EJCA 2GLOA 2M2EA 2CW7A 2IAIA 2D45A 1G3TA 3BG6A 4PJNA 2MW8A 1G2HA 4AUXA 4CH7A 4LJZF 5LGUA 2DODA 5E8IA 1TQMA 1SVMA 1DP3A 1MBGA 3F0CA 1RESA 5HOOA 3WGHA 2XAJA 3PSFA 2H8WA 3OYMA 4A0XA 4CICA 3DTIA 1JJ8C 2EZKA 3CTAA 1FNNA 1R4NB 1K83J 2KHMA 3HGYA 5BMZA 2X1EA 4BDYA 1G3WA 3S3MA 1J2XA 2EFWA 1ON1A 3ROUA 2VQLA 3VFZA 1U9NA 3J80K 1CF7B 1ENHA 3KYDB 4KITB 1ULYA 1X3WB 2FNPA 4XKBA 3S16J 2VT2A 3FXQA 2M7AA 4I01A 4UHTA 4FETA 5LLQA 2M3AA 3BT9A 3ULQB 5H6RA 3S2DJ 3SDBA 2WV1A 2B9SA 2H6BA 3BCBA 4BJTA 4GO1A 1IN5A 2KMUA 4I6ZA 2HOTA 1YOVB 2K9QA 4M71A 1FP1D 1Y0UA 4HF2A 4YEJA 3KEYA 3I64A 4A3EJ 3A4CA 2EA4A 4G6DA 1AOYA 3RIRA 3EUKL 3I59B 4NB5A 2I8DA 3LFUA 1BR2A 5F27A 4OWRB 2Z2SB 4K2EA 2NNNA 2R7DA 2KZVA 5HVQC 1X3ZB 2PN6A 3VWBA 1OMIA 3FBIB 3IH3A 4NC8A 4ZZLA 5D8LB 1IN7A 3T8TA 2F5EA 5FJ8J 3CCEI 4PCQA 2KDZA 1D1BA 3DBLB 5DTDA 1TWHJ 1QQIA 4UUSA 4B47A 2ACJA 3GZNB 5D6FA 3Q0UA 3Q9VA 1U5TC 3FKIJ 3K70D 1BN5A 4XLEA 2V6EA 2LY2A 3QYBA 2K7LA 1BW6A 5JHUA 1OCCH 1FLIA 2XF6A 3BQYA 1IN6A 2MLGA 4P9UA 3KP2A 1WSUA 3BQZA 3K10A 4NQWB 1QBJA 5ED4A 2ELHA 4JX5A 2JWTA 2NYXA 1HLVA 5IT9Z 2FNAA 1ZQ3P 2KQRA 2KKOA 1LFBA 2A07F 2O8KA 3F6VA 4WXHA 3D0SA 2CFXA 2CV1A 2J5OA 2NVQJ 3VSKA 1FTTA 4HLYA 5J3LA 3JSPA 3C2BA 1SFXA 4BY1J 2DN0A 3C2GA 5ILVA 4I7HA 1VQPI 4CGZA 5BPDA 4R8HA 2DOAA 3EYIA 4FTHA 1S6LA 3OL4A 3N05A 5IP7J 1WI9A 2FX0A 2HKOA 4B09A 2FMLA 2W00A 2HYGD 3WE3A 3ISPA 2DOFA 4G6QA 1YX5A 4LG0A 3G4SI 2DT7B 1R1UA 2DFIA 2VKDA 3V8KA 1VQNI 2DO7A 2BW3A 3FMSA 1GUUA 4HA8A 5HLIA 4I0BA 1B1BA 2QEXI 4XRSG 2FF4A 2R7QA 1O57A 4F93B 2M30A 1E0EA 1BI3A 2UXXA 4G12A 1ETQA 4GDFA 2R7TA 3HSFA 1FBQA 5F0HA 1WI3A 4HX7A 4BNCA 2XAQA 3K2ZA 3WE2A 1JUPA 2YPRA 3FISA 4HSRA 2MC3A 2VXZA 3CJNA 4XKWA 2B7EA 4YFNF 2M9HA 5LBQA 2ZO4A 3HPGA 2CH0A 2K3PA 2DK8A 1AKHB 3MQ0A 2ELJA 4GFBA 3LA7A 1Y56A 2HI3A 5FKMA 1LKXA 4DZPA 1QO0D 1U8RA 3M3YJ 1YO5C 3W2AA 5B66C 1W4MA 1ZK8A 3P7NA 3PNVA 1T98A 4AVZA 4CDGA 4A0ZA 4MTDA 1SMYF 3CJTB 2H94A 3ZXSA 3GTPJ 1V5GA 5FFZA 4CZZA 4I99C 3R0AA 1MJBA 4CCKA 4QLCU 1ZHFA 3RKWA 3ERED 2HWVA 2FXAA 4A3IJ 1X4OA 2FD5A 4RGRA 2ZXHA 3OIPA 2VIXA 3HUGB 1EH8A 2HOAA 3S1QJ 5M3FJ 4L0YB 3HHHA 1XCVA 5B5EC 5IYCJ 4BXXJ 1LJ9A 4W1UA 4E6KG 5CVJA 2X0LA 3SQNA 4IL6C 1O7FA 1BI0A 1Z77A 1B8IA 1IRZA 4HLXA 5EEHA 4IO9F 1Y1WJ 1OCZH 1HSJA 1XDUA 3A1YA 4RAFA 3WGIA 3GTOJ 5E3NA 3M7GA 4HPQA 5IYBJ 2XAGA 4M74A 3JREA 1ZRCA 3KZYA 2EK5A 4I0AA 5CVUA 2XHKA 1GLNA 5JHFA 1Z7LA 1JGGA 2O6GE 2HQAA 1KYZA 3V8LA 2H6CA 4BBRJ 2MBFA 1VI0A 2E1OA 1YRNA 1XGSA 3ZMUA 3KP3A 3GZ5A 4IF4A 2X6OA 2H1KA 3PUFA 2IEKA 4Q48A 1QVUA 4A69C 1JKRC 2R5YA 5E18F 3BG5A 4XMYA 2Z33A 4LK1F 3S17J 1MD0A 4BU2A 3TBIA 3DLLF 1RR7A 2ZCWA 3W2VA 2ZNZA 2L7FP 2QZ8A 2OUMA 2HZTA 4KMUX 1XCBA 1OISA 1FOXA 4DQ2A 4Q4ZF 1GT0C 1MJ9A 2CQKA 4OAZA 2NAZA 4OOIA 4RM3A 3FMRA 4ETSA 4KICA 2EFPA 4YELA 3CCRI 3AL0C 2IS2A 2WB1N 2QA4I 5KAFC 2COBA 5LHIA 1PP8F 1T38A 1MDMA 2AS5F 1F36A 1J0RA 2DQLA 5E20A 1VQKI 3CP8A 1YJWI 4IRGA 5GAHJ 4S05A 2PBIA 3H5RA 3DWLE 2RV8A 4BEHA 2EINH 2KJBA 1LFPA 4HYEA 4B44A 3K6GA 2MC4A 3IH4A 3ZOBA 2XV4S 3CCQI 2A5WA 2V6CA 4Y15A 2QSGX 2HKXA 2R4GA 3BY6A 1FC3A 5M5WJ 3CCMI 1FBSA 4BXFA 3GO5A 3QPSA 3O2PE 1DP7P 4C2MJ 5DCMB 4E7KA 5B3SH 2EZLA 5IY5H 3AKZA 1HKSA 5CVRA 4BE0A 4P9FA 4GRIA 2LLKA 3DFGA 2VC1A 1YTYA 1Z05A 2CUZA 2DQRA 4ZYHA 1GDTA 2KRFA 4PK4A 4RGXA 3G6EI 5GPCA 1UJ8A 2K9LA 4DBQA 2CUFA 1YJNI 2ZFWA 1SANA 3BR5A 2CSOA 1BI1A 3ESWB 4DJAA 2LC2A 1WQ2A 4WF2A 5LHGA 3TKYA 3FXRA 2EZIA 2W48A 5KCMA 2YU9J 3KZZA 2IA1A 4HBLA 3TEDA 3NWSA 2L9RA 2GXAA 4CYDA 2NNYA 2GBYA 2F5FA 3LSIA 4D0PA 2M4KA 2QKMB 1OR7A 2JN6A 3H0DA 3GTMJ 1VTNC 1XD7A 2P5VA 4JOMA 2JPCA 4TV7A 3OOUA 2LRDA 3AG3H 2H09A 2NS0A 2A68F 2VBZA 2RNJA 1W0UA 3WHBA 4RA2A 2R92J 4CCLA 2BY2A 4Z6YA 5CJ9A 4MQ9F 3IWFA 1T39A 3BP8A 5EZGA 1BJZA 3OS2A 4CCJA 1Y8RB 4GCVA 4C3IJ 3D1NI 4PJ0C 3CLOA 1WKMA 3J7AY 4CO8A 4ENJA 2OZ6A 3F21A 4BACA 1LEAA 3GW2A 1KA8A 2R7SA 2E36A 4AU7A 5LEJA 1FOKA 1ITYA 2BYVE 1T08B 2L2OA 4LFUA 3T0YA 3UR3C 2IS4A 5LHHA 2WBMA 2PMZN 2M8EA 4LGWA 2BHYA 3BDDA 2JTVA 1BIAA 2QENA 4D5CA 1POGA 2VONA 4D7NA 2HDDA 3OIOA 2WTEA 2JSPA 1BIBA 1S5LC 2Z5UA 1IDYA 1GV2A 3S32A 1AWCA 1Z21A 3CCJI 1ZR4A 2QSHX 3R4KA 4E70A 2E1CA 2FA5A 1EKEA 3I58A 2QLZA 2VBXA 2IJLA 4CA0A 1ZREA 5F1RA 1YE9A 5EZHA 3F22A 5J8CA 5EF6A 2X85A 1VQ6I 2KP6A 2OV7A 4A3KJ 2ICWG 2DBBA 4HX8A 4R1HA 1WCMJ 4IPAA 2QQAA 2RAEA 4HZFA 3JAMZ 1ZLKA 2V1DA 2E1NA 3BR3A 2HGCA 4B3XA 3IP4B 3FHZA 4V19K 2K9MA 4XR6A 1W1WE 2W25A 3O3KA 3KCCA 1S3JA 3UKGA 1ZR2A 2GA2A 3BJ6A 2BGCA 3PL8A 4LG3A 3NEUA 3WG9A 2BY3A 1OCTC 1HKTA 1QHGA 3H3ZA 3PSIA 3BOQA 3HM5A 2MABA 1FPQA 1LEBA 3WG7H 2A6TA 2MFZA 4XBFA 3MZHA 1RNLA 5GTIC 3Q5FA 2DA6A 1HA8A 2MA3A 4U88A 3KYLA 3S15J 1V55H 4ESBA 2YS9A 4NHJA 2DDAA 1J7KA 1WVRA 2EB7A 4OU0A 3A2KA 4BKXA 4I02A 4A3JJ 1O7LA 2DI3A 5AIPA 4E7SA 1EV7A 3J81Z 1HBXG 3AG4H 1UHMA 1L0OC 2STWA 2IS6A 3DEEA 3BR0A 2ETHA 2OJED 4M6VA 2ZMEB 4ZTFA 4AWXB 2GAUA 2Z16A 2DCEA 1ZAOA 3A01B 4ABZA 3V42A 4B43A 1OYIA 3WTXC 2K40A 3GVAA 4UY8I 2CQNA 1A5JA 2YUSA 3B02A 1OR7C 2LY9A 1KQ0A 2ELKA 3DPUA 3HHGA 3ASOH 1ZKGA 2XF5A 4IRHA 5L3BA 1K78B 3MMYB 5FROA 2M4GA 3DU6A 3CUOA 2KIMA 3MEXA 3KLOA 4WWCA 2HVQA 5ICGA 4B4CA 4A6DA 4KDPA 2OQGA 3RPUD 4BL0B 3R60A 2R7RA 2JA8J 4XK4A 3S1MJ 3TDUC 1NG7A 5J1RA 2CQXA 3M9AA 4HNTA 5GAEJ 1K61A 3TDZC 1ZRDA 2ZBKA 1WZ2A 1Z3YA 3VYSB 2O5RA 2WA0A 2XAUA 4PGHA 1TWCJ 2OTLI 3DU5A 3HC7A 3QYEA 3X2QH 1BBYA 4OMZA 3KFWX 5J40A 3F3XA 2Y2ZA 1LVAA 3OSGA 1OFCX 3KEOA 2VUMJ 3H5AA 4BDZA 4C30A 5F6FA 2CFOA 3DV8A 5EEGA 2K4BA 1PUFA 2MH2A 1MBEA 1TT0A 2QM3A 1P2FA 2NS7A 3ECOA 4OIQF 1MW7A 3KP4A 1YS6A 2Q2EB 1UAAA 2BOLA 2GXBA 2HEOA 1XDSA 4MEXF 2DJIA 4HSTA 1YW9A 4YIFA 3GTGJ 2OTJI 1EF4A 2ZJPF 1FIPA 3LSMA 3SZPA 3MKZA 1S7OA 1YJ9I 3SZGA 4BY7J 1LB2A 1H9TA 3D5RC 2P81A 4OINF 2QBYB 3CJRB 2PLYA 2O8XA 4NNJA 2DA4A 3B73A 4G94A 1IO2A 3WTSC 2LKXA 4GYGA 4A3DJ 4IJAA 4KA4A 4J19A 3H5NA 3OYDA 5BOXA 2F2EA 2E2HJ 1YW8A 3FXOA 2M0MA 5IT3A 2QQ9A 1DGRM 2IGMA 5KAIC 4ENNA 3FKJA 1WWXA 3WODF 5LFAA 2DPDA 1BL0A 2VODA 4KMFA 4NDLA 1MBHA 2HFHA 5FFXA 4FCYA 3L00A 4UNOA 1MKMA 4BJ6C 1W7PB 4IVNA 4MLOA 5LRRA 2IGOA 4QPOA 2W84A 3FK7A 2VBWA 1BC8C 5C3EJ 1FJLA 1UG2A 2KL4A 1WH5A 1Z9CA 2JA6J 2V9PA 3RPUA 1TT5B 4ZYGA 4WX9A 1VZ0A 4HV6A 4EJTA 1KQ8A 4ZDOA 2NVTJ 2AQEA 2YX7A 3LA3A 1LVKA 1WHUA 4IHWA 1U6GA 1LPQA 3QOPA 4KIGA 4EJOA 2LDUA 2M8GX 3MWMA 4M9SA 3I71A 4ZJZA 4Q47A 5LEKA 1KZHA 1NH3A 4HF0A 1R5HA 3W6JB 2L7KA 1I1GA 4N9IA 4CSWA 4UVAA 4JP0A 1YHQI 3VB2A 3O8HA 2Y0SA 5DDGA 2GIVA 3UNGC 2LFBA 4B8XA 5IPAA 4PFOA 5EYRA 2HNHA 1G59A 4JX4A 1HCRA 3HB9A 1R6RA 3DEUA 2MGQA 5E17F 3ERMA 5HDGA 3EUHA 4L5JA 1F9NA 2RVCA 4V2FA 2VPLA 3A03A 3HKZA 1I6HJ 4XOTA 4BHPA 5TGTA 5KNLA 1U5TB 2VJIA 1H8AC 4RAZA 5EGOB 4U0WA 4D5FA 2HS5A 3MAJA 5HS7A 4CXFA 3L2UA 3F8MA 3CMEI 2XSDC 2HPIA 1V5FA 3K9TA 1XS9A 1X1CA 3NARA 1MSFC 3BWGA 1EH7A 2LP0A 3IAS2 1IXSB 3K1NA 3OL3A 1F1ZA 1U9OA 4CZCA 1W0TA 1J9IA 2JZYA 3K1PA 4EVIA 3ABKH 4YIIA 1IJWC 5IP9J 1B72B 1UELB 2ME6A 2HQRA 1DUXC 1AU7A 3VOEA 1LE8B 3OYEA 2E7XA 3F8NA 3J81K 2DMPA 2DYSH 5F64A 2M0CA 5IP6A 2VQHA 3HOTA 2XPWA 4C3HJ 4RB1A 4IKFA 1B59A 3V4GA 3K1MA 5AIQA 2CWEA 4IHVA 1B9MA 2CJJA 1IN4A 2F4OB 1LUJB 5D8KB 3M1CA 1F5TA 3P5JA 5ICEA 1ACIA 2K85A 2ISYA 4BGDA 3MKYB 1XPXA 3ZMVA 4QWQA 3WGGA 2CS3A 2FSWA 2OQRA 4AYBA 3SXYA 4L0ZB 1FTZA 1XG1A 3E3VA 3U9GA 4DIQA 3QPHA 1HDDC 4BE1A 3H3VK 1FBUA 2IBDA 4FX0A 3TGNA 2KIFA 2XF7A 4DZJA 2UXNA 5A2QZ 1MNEA 1TQPA 1SMTA 2E5NA 2VN2A 4HQEA 2XDVA 4M72A 4ANJA 2O3FA 3JRCA 2EIMH 2I10A 3O8GA 1LDDA 3IAM2 1MIJA 1MGTA 1VQ9I 4FX4A 1PVEA 5EDNA 4HX4A 2HTJA 1SVOA 1KU9A 4KT5C 2BXZA 2P6SA 1VQLI 2JVHA 1HC8A 2QWWA 3M07A 4B1RA 1Z67A 2ZB9A 3E6DA 3HSEA 2VT3A 1P4WA 3CD6I 2LK2A 2WAQA 3QU3A 2AHQA 4B3AA 3JRBA 1IF1A 3FIWA 1FSHA 2GIZA 2XKPA 2XGCA 1GVDA 3RCOA 1TWFJ 3S93A 3K69A 1K7AA 1F4KA 4MTEA 1Y6IA 4FHTA 2CQ7A 4E7JA 2E1MC 2XKOA 1N78A 2GZWA 2W57A 2UZKA 2RNGA 2L7ZA 5ILUA 1R1TA 2CV2A 2R7XA 1WFXA 1K4SA 2LOOA 2UV1A 3KP6A 3CCSI 1J59A 2O03A 3QP6A 1N77A 6PAXA 1X2NA 3EUHC 3HRMA 1D0YA 5GAGJ 1DU0A 4UUSB 2JQ7A 1R23A 4DOZA 1ORKA 4EQQA 4E7IA 3G1LA 5IYDJ 3I4NJ 4DW6A 2F4IA 2A6HF 2K86A 2ME0A 1E17A 3L2CA 4ENKA 4L9VA 3TO7A 2XUBA 2VQCA 2CUEA 3LSJA 3ZMDA 3PQKA 3ABLH 2XROA 1K6YA 1X1PA 5GADJ 4XLPF 3JRDA 4OIOF 1ETYA 2KIQA 3LQQA 1BOAA 4RGSA 1WJEA 2OF7A 2JJ7A 3CF2A 1H9GA 5M5YJ 3ZQCA 5FKNA 1W5SA 4XIDA 4AC0A 4M9ZA 2EBIA 4LB5A 1NHAA 2CW0F 4IX7A 3H9GA 1D5VA 3FBNB 2EPFA 3PIOF 1J75A 1P6RA 3HOVJ 1E3OC 4RMNA 2BHZA 4A3CJ 3VYRB 2LKSA 2XGXA 1QVTA 2V79A 4CYCB 2DLLA 1T2KA 2PJRA 5HS9A 4H0EA 1G3SA 4HF1A 4GGGA 4LLLA 2X6YA 3KE2A 4AIJA 5B1AH 3D5LA 1ZLJA 3J7ZI 3OYLA 3Q9SA 4P1WA 2V9VA 3V8JA 5J1UA 1HKQA 2BW3B 2XAFA 3AL0B 1XSDA 2LD5A 1B9NA 3G1OA 2ZXWH 1X2MA 3VPRA 1BA5A 5L3EA 2NXNB 4XNFA 1REPC 2Y0SN 5C44J 4FASD 4L5IA 1R00A 4II2A 2KISA 3OYCA 3Q3SA 4XLNF 1I5ZA 1QZZA 4HV5A 4BBSJ 3ZQHA 2R7UA 3QYFA 4EM1A 1K6OA 2X9DA 1C0WA 1PYVA 1HW2A 2Y31A 2FBHA 1SD5A 2E35A 1MMNA 4MIMA 4BQQA 2R93J 3HKZN 1R7JA 2BBYA 3I55I 4A3FJ 2DA5A 2QGUA 1JHHA 4KFCA 2X6XA 2JSCA 2KZGA 3WU2C 2L7MP 2O7OA 1TBXA 2QF7A 2Y48A 3RDIA 1ZELA 4XL9A 4BE2A 3F9KA 1S72I 3L2RA 1MH3A 3KP5A 1T33A 2ZC2A 3QOEA 4O5VA 3HDDA 3K0LA 3R0JA 3LNQA 2PG4A 2A5YB 2L9NA 3SEZA 3RPQA 2Y75A 1FZPB 3J7YJ 2HDCA 3DXJF 4YRVA 2R5ZA 3CESA 4PJLA 4E4HA 1MMDA 4Z2YA 1VNDA 1Y8QB 1FOWA 1UG0A 1OCPA 3AFHA 2E5ZA 2D1HA 4AD9A 3JRGA 1B8IB 1SD4A 3NQOA 2EFOA 4F91B 2RQPA 1T0FA 4IHSA 3DKWA 3I54A 3GTKJ 2AO9A 3ELKA 3RKYA 4OIPF 4KYWA 4BH9A 1TWGJ 1IC8A 3JTGA 1Y39A 5F04A 4YIRX 4M3FA 1UB9A 2DDBA 1X19A 1ZGAA 3K4MA 2GOXB 5A2QK 3RSNA 2FOKA 2XB5A 5K5QA 4I76A 4M6XA 5D5XB 4L9NA 1JKOC 5CQEA 4Y13A 4IOAF 1YRNB 1OCOH 3PNYA 3B6AA 1E2XA 1BI2A 1FSEA 4ENMA 3FXJA 4OIRF 2OPTA 5IT9K 2D5VA 3N4MA 3CDHA 3PM1A 3TW7A 1P7IA 2CMPA 1P7JA 4AM3A 3HRSA 3VDXA 3BG7A 4BXUA 2E2IJ 2R7WA 3HOYJ 2K02A 2XRLA 5GPAA 3S1RJ 1GVJA 1ZH5A 1TL8A 3E6MA 3I0TA 2DT6A 4YG2F 4FISA 4XRMA 1Z6TA 2RGVA 3CCUI 1Z0XA 5CPRB 3EDPA 4AVPA 2NS8A 2WAQN 3ABTA 4RM2A 4UB6C 1X1AA 3MKWB 1A31A 3GFJA 1H0MA 4LIVA 4MNUA 1EJ9A 3JRIA 4XQFA 1FYMA 4MGRA 2P0WA 1E3HA 1JGSA 1XGNA 1D3YA 1MDMB 5HLGA 4M3GA 1SFUA 3CC7I 1P4AA 2O9LA 5HS8A 2P4WA 3A02A 3QU6A 5ERIA 2JA2A 4D9JA 4G7ZF 1J09A 4BS9A 3SDGA 1Z7UA 3HG9A 3HZJA 2IW5A 2ZNYA 3IRRA 5CVIA 4BEHB 5EG0A 4A0YA 1UHSA 2FQ3A 3K4BA 4UUVA 2M1BA 1FOYA 5HDNA 1BR4A 4HOBA 1D0ZA 5FKKA 5IOYA 3PO3J 3OYKA 3HOXJ 3DKYA 2FU4A 2XIGA 3M1EA 1VQ4I 2FOWA 1J5YA 1O3RA 3RI4A 1I39A 3E1SA 3P9KA 4QPQA 3M8JA 3ZQIA 2COMA 2F6CA 1EH6A 3GFIA 3H36A 4CCOA 5F0CA 4N4NB 2O0YA 3CUQA 3Q0VA 1DU6A 5JI6A 1RI7A 4ESFA 3AG2H 4IQ4A 1OCRH 2Z99A 3KIOA 4NC6A 3GEZA 4EGYA 4Y33A 4IHYA 1FWZA 5KK1A 3OWTA 4RB2C 1BM9A 1WJDA 2A69F 2B0LA 4S04A 3IKTA 3VODA 1MMSA 1UMQA 2OD5A 2WADA 3K2AA 5DEQA 4RGUA 4EJUA 3SHFA 3PFYA 1XSXA 2K3FA 4GYIA 2WV0A 1T0FC 4XRFA 2EA2A 4W97A 1R4MB 2QSFX 5K1YA 3OYJA 1IW7F 1YITI 3L2VA 5J4YA 2ECBA 3GFMA 4EGZA 2ZMEA 5DM7F 2CU7A 1JUSA 5AONA 3FXLA 3VYUB 2R3SA 1KU7A 1XN7A 5FKLA 3CMAI 3G71I 2LBFA 5H20A 2QVOA 1FIAA 2HVSA 4RAGA 3BJAA 1TNSA 1T95A 2KJCA 4L9JA 2NVUB 1K78A 2H8RA 2HU9A 1RR8C 1KGSA 1O4XA 4MEYF 3F8BA 1R36A 3JRFA 4ZYDA 2LG4A 4UVBA 2JK3A 3FZVA 3H1CA 3HEFA 4MFEA 2IA2A 2XRNA 4ZTJA 2RC4A 3CCLI 1JKQC 4U87A 2Q1ZB 4U7BA 1APLC 4MFDA 5IOZA 4JYKA 1YLFA 5K7HA 2L0KA 2EFNA 3CO7C 1ZGJA 1BOBA 2V1XA 2VL8A 3OYHA 3U1KA 1AHDP 4X6AJ 1BW5A 1LDJA 1N75A 4A3LJ 3SFIA 4ON0A 1W36C 1Z1DA 4IHXA 4WCGA 3QPLA 2YU3A 3RYPA 4NBQA 3RJPA 3NAUA 1VQ7I 4E7ZA 2LF8A 2R7FA 1RKTA 3OMYA 1MMAA 2QKLB 3QP5A 1IUYA 1HOMA 2OAZA 4KJZA 3GMEA 3IL2A 2L3DA 3R61A 1W5TA 2P5LC 2B63J 2RDPA 1OPCA 3CP2A 3ZQQA 3T5XA 3E97A 3OYIA 2L4MA 2WY7Q 3IRQA 3HOUJ 3DTEA 3H0GJ 2JA7J 1Z6RA 4NC7A 1ZARA 4N4OB 4J00A 4Y52J 3IWZA 3V7SA 5E3MA 4XOPA 4OMYA 2DA3A 1O3QA 2ZSIB 4ZYEA 4HDVA 2MG4A 3MD2A 2C6YA 3CUQC 1KQ9A 3OSFA 1A04A 3GYHX 3DQVC 1TLHB 3HBLA 2VBYA 5ICCA 3OYGA 3L1PA 3S3OA 4KNYA 3F8FA 2GWRA 5CLSA 2KRCA 1LNWA 3CDIA 2ZSHB 3LSKA 2MYSA 3CC4I 4N0BA 1Q1HA 1WJFA 2Y9YA 3MCZA 1TW2A 4F52A 3Q0WA 1UCRA 2XGEA 5DS9A 2BVLA 3OYAA 2Q0OA 2ADUA 1DQUA 4FT8A 3OS1A 3PJRA 3E5UA 1X1DA 3DTKA 1HXDA 2DTZA 2P5KA 4A93J 1H88C 2D1VA 4IRIA 4J01A 1G8XA 1R1VA 4HDUA 3OYBA 1HDPA 2M45A 3JW4A 1YX3A 3DKXA 3K4JA 2K5CA 2EQRA 4GXOA 4M73A 2AXTC 2JPBA 3MFKA 1MNMC 3HYIA 1P92A 1WGXA 2KDOA 4CCMA 2KT0A 5DCFA 1VF9A 2BY1A 1PP7U 1A6QA 3SJMA 1E3PA 2OA4A 2NVXJ 1V54H 2XPUA 2EH3A 2ESHA 3I53A 3DLAA 4YFXF 1JHFA 1WJ5A 1R9TJ 1I50J 3A0HC 4OAYA 4JX6A 4G9YA 4DGWB 2VOOA 1YIJI 4IEJA 2WWYA 4BQNA 4AIDA 2ZXJA 4EMSA 1KONA 1I3AA 4U0VA 5TJJA 1TTYA 2OC6A 1PUFB 3KETA 4PJJA 3HL2A 2W4SA 1ETOA 2VJ4A 3BPVA 3BTLA 3OS0A 2GQQA 3OOPA 2DA2A 1CF7A 4A6EA 3IUOA 5JFRA 2TCTA 2M34A 1SVLA 2L54A 2JUCA 1JI8A 3HXLA 2BXYA 3WTVC 3HRUA 2DXIA 3RKQA 1Z3XA 3JCUC 1MMGA 2VQGA 3OR2C 3OYNA 2VLAA 2RKHA 4D1QA 5JVGF 3ABUA 1T8IA 1V5EA 5FO5A 2ESNA 5J6XA 3CF5F 1YI2I 4C2TA 1S7AA 3IC7A 4E7LA 3WTYC 4DYRA 3BR2A 5M3MJ 3HOZJ 3ZQGA 4D7MA 3HOSA 4M3EA 5LGTA 3I59A 2IPQX 4ZYAA 4BJ5C 3L09A 3L7WA 4ZC3A 3ZPLA 3TP3A 1XC5A 2M7BA 3HTUA 2FE3A 1YFHA 3JAMK 5TRDA 4S0HB 4LD5A 1SC7A 1R5GA 5J1YA 3FXKA 3AG1H 3U1DA 5JLWA 1RRJA 1ZRFA 2VB6A 1U8BA 2EJRA 3KP7A 3ZQLA 2HXOA 2L9VA 2DMTA 3DPTA 4CUGA 3CQZJ 1ZG5A 1R5ID 1RC9A 3K4NA 4UUTA 3CO6C 4UVCA 3SEQA 3HOWJ 1ZG1A 4A12A 2DYRH 1BC7C 1R49A 4PGGA 3J7AO 3CCYA 4IQJA 2EILH 3TOBA 5L3FA 3OR1C 4WXCA 5M5XJ 4MQVA 3FDYA 2H1LA 3TO6A 2IXSA 4LLNA 1MBJA 3KX2A 2LMDA 5JLXA 1P9QC 2QQ8A 3K4CA 1MBFA 1HW5A 2VE8A 4B48A 5FLVA 3U2RA 4NQWA 2W24A 2MLKA 1PUEE 3LQRA 3KEQA 1QNTA 1ZYRF 4FE4A 1SEUA 1FT9A 4LLGF 2WC2A 2P6TA 2DU9A 4ZDLA 3ZP5A 5D5UB 4BQOA 1A35A 1EA3A 1K79A 2VKHA 2JA5J 5LGNA 3C7JA 3RTRA 1P4XA 2QUFA 2E1MB 4KISA 3M8FA 3PUBA 3C1DA 3GUDA 3C2HA 2BY0A 2OCCH 4G8XA 2HOSA 1LDKB 1X3UA 1XB4A 5HNFA 2EIKH 4HG2A 2WB1A 3L9FA 2GOMA 4UV9A 1G3YA 3CJQB 2FBKA 1G4DA 3RKXA 2EV0A 1VQMI 1XMAA 3F23A 3C3WA 4UXNA 3VSLA 4I98B 1UFMA 4FQGA 2M87A 4EV0A 3RZDJ 1SAUA 3S1NJ 2VXDA 1WJBA 3IKVA 4Y4RA 2PFBA 4DYCA 2F5VA 2P8TA 2W7NA 3P9CA 4HRIA 4F92B 4PJMA 3JSOA 3COAC 4EATA 5FRMA 2CG4A 1T56A 4ESJA 1RUOA 5BPIA 2AXLA 2NVYJ 2TDXA 3RQIA 3JTHA 3ZMZA 3GF2A 1MZBA 1ERDA 2E19A 4M3BA 5C4XJ 1ETXA 2BV6A 2PQ8A 1JT0A 3QODA 1ZG3A 2G9WA 3ZMTA 2K9SA 1AKHA 2Z1DA 3FXUA 1DPRA 1PJRA 3K7AJ 2G0EA 3HTSB 3EQLF 3HIFA 3H35A 4ZZDA 3QPTA 1SAXA 4ASNA 5CQGA 4F55A 1PDNC 5D4RA 2E60A 3HPHA 1QGPA 1CQTA 4PFPA 4IHTA 1NG6A 2DAOA 1YW7A 5L3DA 2K27A 2L5QA 1IZ1A 2ZXIA 2G7HA 1QPIA 4KIFA 5H2FC 2DJNA 3KYCB 1JJ6C 1GHCA 1TC3C 3GLXA 1U2WA 3PO2J 3BZCA 2ZFUA 5E1WA 5TISC 3S3NA 4CYCA 5LRSA 3HUGA 3E6CC 2LREA 5K5OA 4M3DA 5D6EA 2ECCA 4PUSA 2WAEA 2XPVA 3WTTC 3D5SC 1GV5A 2R7ZJ 1X58A 2PEXA 4Y3OA 3DCFA 2G7UA 2VJJA 3ZR8X 1X1BA 1DPUA 2OZUA 5E79C 1IRXA 5HODA 1G6NA 2A3SA 2LVSA 5DV5A 3OIQA 4C9YA 4CCNA 2V26A 4PZJA 3WTZA 2NRAC 1IV8A 4ZDPA 2NOJB 3G1MA 4JQFA 4RB3C 4P55A 4HNVA 4XN0A 3LSHA 1USTA 3CC2I 1YQAA 2X51A 2GM4A 2UUZA 1OLTA 3ASNH 5FD6A 1Z91A 5FRNA 1XGOA 1TQIA 2HZDA 2LR8A 3IH2A 2PMZA 2DMQA 2MSYA 4LOCA 5KHDA 3HJEA 2N8GA 3E7LA 1VFCA 3DP7A 3LFKA 2DK5A 3S2WA 2RN7A 2XC7A 1IDZA 4LG0B 3WTUC 2ISZA 1XTAA 2EZHA 3EYYA 3EETA 4WXDA 3M8EA 3GWZA 3CCVI 3H9JA 1WRJA 1MSEC 2GXGA 4BYYA 1VQ5I 3I56I 3QQAA 4RBOA
chains in the Genus database with same CATH topology
2LKPA 3I5UA 2DTRA 3PQJA 5ILSA 3TO9A 3LAJA 2IP2A 3E5XA 1FX7A 1QPMA 3LSTA 3PFIA 4P96A 2F5DA 3AAFA 1YS7A 4L9TA 4U7DA 1TW3A 1XGMA 4LMYA 1JE8A 1I6XA 2HOEA 2XAHA 4KUMA 3GZ6A 5FLXZ 4L18B 5DCMA 4XSXF 5FGMA 3KLNA 1IRFA 1JXSA 1HQCA 1D8JA 3REOA 1DDNA 2OBPA 1IXCA 4EM0B 5BQTA 3GFLA 3LAPA 3OV8A 4KN7X 1FP2A 2YSRA 3QRFF 2A6EF 4I09A 2ZKZA 2V1UA 3QAHA 2PMHA 2HTSA 2DPUA 3F6OA 3ZN1A 2E7WA 4A2UA 3R6SA 2VE9A 2UWMA 4YFKF 1OYWA 2Y0MA 4BHCA 2FMYA 2LSOA 2JT1A 3WTWC 4RB0A 4G7OF 3VEPA 1L3LA 2P7CB 3SFZA 4LK0F 3T1BA 5HLHA 1U3EM 1TNTA 1FYKA 4HW0A 2CGPA 3BPXA 4F7ZA 3E5QA 5E8GA 1U78A 3NRVA 3T8RA 4ZH4F 2HYFA 1SFEA 5HDKA 1ODDA 1KU3A 3TQNA 2K4JA 3ECHA 2XVCA 3V7CA 3V7RA 2IVMA 5DUIA 4EJWA 1T6SA 3WU0A 1GXQA 3BJOA 2M5WA 4MHGA 5CVVA 1I27A 3DPLC 3LWFA 4R79A 1XMKA 5D5VB 1SD7A 2L4AA 3C18A 3FWEA 2ZJ2A 3HSRA 5KVRA 2F5CA 1IAWA 3W6KB 3ZQ7A 3G3ZA 2DT5A 3BROA 3GXOA 3MZYA 1O3TA 3ZN0A 5JVTA 2VC0A 5FD5A 4M6YA 4HAMA 2CO5A 1S29A 5L3GA 1B6AA 2PJPA 2FRHA 3HRTA 1D8KA 3DF8A 4BQAA 4O6JA 2J5PA 2HQNA 2FBIA 2MH9A 2EFQA 4I2OA 4RAYA 2OU2A 3P9IA 1W7PD 4BHBA 3IHUA 4BAYA 5E1ZB 2MD5A 4LB6B 5DD8A 1OYYA 3J80Z 1IN8A 1FY7A 3CUQB 2GA1A 2QQBA 3ZMSA 1RZ4A 5DYMA 3F8CA 2YX4A 1IRGA 1LQ1A 4A5MA 3H3UA 4PDKA 1OKRA 5K5RA 2O61A 2X4HA 5FLXK 2LF7A 2EV6A 3F72A 2PMUA 1IXRC 2FEZA 1CGPA 2QYOA 1ONVA 2CYYA 1YIOA 2Q2EA 5D5WB 4CHUA 2Z3YA 4JK1X 4WK8F 4U0YA 3SZTA 4HQMA 4G7HF 5E1XA 5H6QA 1ZN2A 1V3FA 5FB2A 1STZA 5DUKA 4IXAA 2BEOA 2IRFG 2XASA 2QBYA 4KIBA 2VOPA 2D2WA 5D4SA 2KIUA 2LNBA 3BZ6A 1V4RA 3FM3A 4AIHA 2P7VB 1YYVA 1HW1A 1KYWA 1O3SA 4AIKA 3TOAA 1I1SA 3RYRA 1W7PA 1RUNA 5ICFA 2PI0A 1UHWA 3E6BA 3O6BB 5BS6A 4Q5SF 1R22A 4Y17A 2IA0A 5J8FA 1RIOH 1BJAA 4P5OA 2BE5F 2L02A 2EWNA 2L01A 2JRTA 3FX3A 4KN4X 1YG2A 1B4AA 1KU2A 1XSVA 2HR3A 3LA2A 5JR3A 4XSZF 5DD4A 2Q8KA 1ON2A 4JBAA 2DW4A 4EJVA 3WU1B 3FMQA 4N9HA 1HSTA 4DNCA 4UV8A 4EM2A 4M9XA 1R58A 5CYVA 1MJAA 3G73A 1GXPA 2STTA 2Z9OA 1U5TA 2W85A 3ML6A 2H27A 4O3MA 4RS8A 1QZYA 3FM5A 3H92A 3N97A 3FF5A 4A5NA 5L3CA 3I4PA 1S8NA 2EV5A 2YR2A 1SD6A 1FYLA 3GX4X 2A61A 1USSA 2IT0A 2D45A 1G3TA 4LJZF 5LGUA 5E8IA 1TQMA 5HOOA 3WGHA 2XAJA 4A0XA 4CICA 1FNNA 3CTAA 5BMZA 1G3WA 1J2XA 2EFWA 1ON1A 3ROUA 3VFZA 3J80K 1CF7B 1ULYA 2FNPA 2VT2A 3FXQA 4I01A 4UHTA 5LLQA 3ULQB 5H6RA 2H6BA 4GO1A 1IN5A 4M71A 1FP1D 1Y0UA 4HF2A 3I64A 2EA4A 4G6DA 1AOYA 3RIRA 3I59B 4NB5A 4K2EA 2NNNA 2R7DA 5HVQC 2PN6A 1OMIA 4ZZLA 5D8LB 1IN7A 3T8TA 2F5EA 4PCQA 1QQIA 2ACJA 5D6FA 3Q9VA 1U5TC 1BN5A 2K7LA 5JHUA 1FLIA 4P9UA 1IN6A 2MLGA 3KP2A 1WSUA 1QBJA 5ED4A 2ELHA 2NYXA 5IT9Z 2FNAA 2KKOA 2A07F 3F6VA 4WXHA 3D0SA 2CFXA 2J5OA 4HLYA 3JSPA 1SFXA 5ILVA 4I7HA 4CGZA 5BPDA 4R8HA 3EYIA 1S6LA 1WI9A 2HKOA 4B09A 2FMLA 2HYGD 3WE3A 3ISPA 4G6QA 4LG0A 2DFIA 1R1UA 3V8KA 2DO7A 3FMSA 4HA8A 5HLIA 4I0BA 1B1BA 2FF4A 1O57A 2M30A 1BI3A 2UXXA 3HSFA 1FBQA 4HX7A 4BNCA 2XAQA 3K2ZA 3WE2A 2YPRA 2MC3A 2VXZA 3CJNA 4YFNF 5LBQA 2ZO4A 2DK8A 3MQ0A 3LA7A 1QO0D 1U8RA 1YO5C 1W4MA 3P7NA 1T98A 4CDGA 4A0ZA 4MTDA 1SMYF 2H94A 5FFZA 4CZZA 3R0AA 1MJBA 4QLCU 1ZHFA 3RKWA 3ERED 2HWVA 2FXAA 4RGRA 1EH8A 4L0YB 3HHHA 1XCVA 1LJ9A 5CVJA 2X0LA 3SQNA 1O7FA 1BI0A 4HLXA 5EEHA 1XDUA 1HSJA 3WGIA 3M7GA 2XAGA 4M74A 1ZRCA 3KZYA 2EK5A 4I0AA 5CVUA 2XHKA 2O6GE 1KYZA 3V8LA 2H6CA 2MBFA 1XGSA 3ZMUA 3KP3A 3GZ5A 4IF4A 4Q48A 5E18F 2Z33A 4LK1F 1MD0A 2ZCWA 2ZNZA 2QZ8A 2HZTA 4KMUX 1XCBA 4DQ2A 4Q4ZF 1MJ9A 2CQKA 2NAZA 4OOIA 3FMRA 4ETSA 4KICA 2EFPA 5LHIA 1PP8F 1T38A 1MDMA 2AS5F 1J0RA 2DQLA 5E20A 4IRGA 4S05A 2PBIA 2RV8A 2KJBA 4HYEA 2XV4S 2V6CA 4Y15A 2HKXA 3BY6A 1FC3A 1FBSA 3GO5A 3O2PE 1DP7P 5DCMB 1HKSA 5CVRA 4P9FA 3DFGA 2VC1A 1YTYA 1Z05A 2DQRA 4ZYHA 2KRFA 4RGXA 2ZFWA 2CSOA 1BI1A 1WQ2A 4WF2A 5LHGA 3TKYA 3FXRA 3KZZA 2IA1A 4HBLA 4CYDA 2NNYA 4D0PA 2F5FA 1OR7A 1VTNC 1XD7A 2P5VA 2JPCA 4TV7A 2H09A 2NS0A 2A68F 2VBZA 2RNJA 5CJ9A 4MQ9F 3IWFA 1T39A 3BP8A 4GCVA 3CLOA 1WKMA 4CO8A 4ENJA 2OZ6A 3F21A 1LEAA 3GW2A 1KA8A 5LEJA 1FOKA 2BYVE 4LFUA 3T0YA 5LHHA 2M8EA 4LGWA 3BDDA 2JTVA 1BIAA 2QENA 2VONA 2WTEA 1BIBA 2Z5UA 1AWCA 3R4KA 4E70A 2E1CA 2FA5A 3I58A 2QLZA 2VBXA 2IJLA 1ZREA 5F1RA 3F22A 5J8CA 2DBBA 4HX8A 4R1HA 4IPAA 2QQAA 3JAMZ 4HZFA 1ZLKA 2V1DA 2E1NA 2HGCA 3FHZA 2W25A 3O3KA 3KCCA 1S3JA 2GA2A 3BJ6A 2BGCA 3WG9A 3NEUA 1HKTA 3H3ZA 3BOQA 1FPQA 1LEBA 4XBFA 3MZHA 3Q5FA 1RNLA 2MA3A 4U88A 4ESBA 4NHJA 1J7KA 2EB7A 4OU0A 4I02A 1O7LA 2DI3A 5AIPA 3J81Z 1EV7A 1HBXG 1UHMA 1L0OC 2STWA 2ETHA 2ZMEB 4AWXB 2GAUA 1ZAOA 1OYIA 3WTXC 3GVAA 3B02A 3HHGA 1KQ0A 4IRHA 5L3BA 1K78B 3CUOA 2KIMA 3MEXA 3KLOA 4WWCA 5ICGA 4A6DA 4KDPA 2OQGA 3R60A 3TDUC 3M9AA 3TDZC 1ZRDA 2ZBKA 4PGHA 1BBYA 4OMZA 3KFWX 3F3XA 1LVAA 3KEOA 5F6FA 3DV8A 5EEGA 2K4BA 2MH2A 2QM3A 1P2FA 3ECOA 4OIQF 3KP4A 1YS6A 2GXBA 2HEOA 1XDSA 4MEXF 1YW9A 4YIFA 3SZPA 1S7OA 1LB2A 1H9TA 4OINF 2QBYB 2PLYA 2O8XA 3B73A 4G94A 3WTSC 4GYGA 4IJAA 4KA4A 5BOXA 2F2EA 1YW8A 5IT3A 2QQ9A 4ENNA 1WWXA 3WODF 2DPDA 2VODA 4KMFA 5FFXA 2HFHA 3L00A 4UNOA 1MKMA 1W7PB 4IVNA 5LRRA 2W84A 2VBWA 1BC8C 1Z9CA 3RPUA 4ZYGA 4WX9A 4HV6A 4EJTA 1KQ8A 2YX7A 3LA3A 1U6GA 3QOPA 4KIGA 4EJOA 2LDUA 4M9SA 3MWMA 3I71A 4Q47A 5LEKA 4HF0A 1R5HA 3W6JB 1I1GA 4N9IA 4UVAA 3VB2A 5DDGA 2GIVA 4B8XA 3DEUA 5E17F 5HDGA 3EUHA 4L5JA 1F9NA 2RVCA 4BHPA 1U5TB 4RAZA 4U0WA 2HS5A 3MAJA 5HS7A 4CXFA 3F8MA 3K9TA 3BWGA 1EH7A 1IXSB 3K1NA 1F1ZA 1J9IA 2JZYA 3K1PA 4EVIA 4YIIA 2HQRA 1DUXC 3VOEA 2E7XA 3F8NA 3J81K 5F64A 3HOTA 4RB1A 1B59A 3V4GA 3K1MA 5AIQA 2CWEA 1B9MA 1IN4A 5D8KB 1F5TA 5ICEA 2ISYA 3ZMVA 4QWQA 3WGGA 2FSWA 2OQRA 3SXYA 4L0ZB 3E3VA 3U9GA 3QPHA 1FBUA 4FX0A 3TGNA 2KIFA 2UXNA 5A2QZ 1TQPA 1SMTA 2VN2A 4HQEA 4M72A 2O3FA 1LDDA 1MGTA 4FX4A 4HX4A 2HTJA 1KU9A 4KT5C 2P6SA 2QWWA 3E6DA 3HSEA 2VT3A 1P4WA 3QU3A 1IF1A 1FSHA 2XKPA 3K69A 1K7AA 1F4KA 4MTEA 4FHTA 2XKOA 2GZWA 2W57A 2UZKA 5ILUA 1R1TA 3KP6A 1J59A 2O03A 3QP6A 6PAXA 3HRMA 1R23A 4EQQA 1E17A 2A6HF 2K86A 3L2CA 4ENKA 4L9VA 3TO7A 2XUBA 3ZMDA 3PQKA 2XROA 4XLPF 4OIOF 3LQQA 1BOAA 4RGSA 1H9GA 1W5SA 4M9ZA 4LB5A 1NHAA 2CW0F 1D5VA 1J75A 1P6RA 2XGXA 2V79A 2DLLA 1T2KA 5HS9A 4H0EA 1G3SA 4HF1A 4GGGA 4LLLA 3KE2A 4AIJA 3D5LA 1ZLJA 3Q9SA 2V9VA 3V8JA 1HKQA 2XAFA 1XSDA 1B9NA 5L3EA 1REPC 4L5IA 1R00A 4XLNF 1I5ZA 1QZZA 4HV5A 4EM1A 1K6OA 1C0WA 1HW2A 1SD5A 2FBHA 1R7JA 2BBYA 1JHHA 4KFCA 2JSCA 1TBXA 3RDIA 2Y48A 3KP5A 4O5VA 3K0LA 3R0JA 2PG4A 2A5YB 3RPQA 2Y75A 1FZPB 2HDCA 3DXJF 4Z2YA 2D1HA 4AD9A 1SD4A 3NQOA 2EFOA 2RQPA 1T0FA 4IHSA 3DKWA 3I54A 3ELKA 3RKYA 4OIPF 4KYWA 4BH9A 3JTGA 1UB9A 1ZGAA 5A2QK 2FOKA 5K5QA 4M6XA 5D5XB 4L9NA 4Y13A 4ENMA 1E2XA 1BI2A 1FSEA 4OIRF 5IT9K 3N4MA 3CDHA 3HRSA 4BXUA 2K02A 1GVJA 1ZH5A 3E6MA 3I0TA 4YG2F 1Z6TA 2RGVA 3EDPA 4AVPA 3ABTA 3GFJA 1H0MA 4MNUA 1FYMA 4MGRA 1JGSA 1XGNA 1D3YA 1MDMB 5HLGA 1SFUA 1P4AA 5HS8A 2P4WA 3QU6A 5ERIA 4G7ZF 1Z7UA 3IRRA 2IW5A 2ZNYA 5CVIA 4A0YA 2FQ3A 4UUVA 2M1BA 5HDNA 4HOBA 2FU4A 2XIGA 3M1EA 1J5YA 1O3RA 3RI4A 3P9KA 2COMA 1EH6A 3GFIA 2O0YA 3CUQA 5JI6A 1RI7A 4ESFA 2Z99A 3GEZA 4EGYA 1FWZA 5KK1A 4RB2C 1BM9A 2A69F 2B0LA 4S04A 3IKTA 3VODA 2OD5A 5DEQA 4RGUA 4EJUA 3SHFA 1XSXA 4GYIA 2WV0A 4XRFA 2EA2A 5K1YA 1IW7F 3GFMA 4EGZA 2ZMEA 5AONA 2R3SA 1KU7A 1XN7A 5H20A 2QVOA 3BJAA 1TNSA 2KJCA 4L9JA 1K78A 1KGSA 4MEYF 3F8BA 1R36A 4ZYDA 4UVBA 3FZVA 2IA2A 2XRNA 2RC4A 4U7BA 1YLFA 2EFNA 3CO7C 1ZGJA 2V1XA 1LDJA 4ON0A 1Z1DA 4WCGA 2YU3A 3RYPA 3RJPA 2LF8A 2R7FA 3QP5A 1IUYA 2OAZA 3IL2A 2L3DA 3R61A 1W5TA 2P5LC 2RDPA 1OPCA 3T5XA 3E97A 2L4MA 3IRQA 1Z6RA 1ZARA 3IWZA 3V7SA 4OMYA 1O3QA 4ZYEA 4HDVA 2C6YA 3CUQC 1KQ9A 1A04A 3GYHX 3DQVC 1TLHB 5ICCA 2VBYA 4KNYA 3F8FA 2GWRA 5CLSA 1LNWA 4N0BA 1Q1HA 3MCZA 1TW2A 1UCRA 2Q0OA 2ADUA 4FT8A 3E5UA 1HXDA 2P5KA 2D1VA 4IRIA 1R1VA 4HDUA 2M45A 3JW4A 4M73A 4GXOA 2JPBA 3MFKA 3HYIA 1P92A 5DCFA 1PP7U 2OA4A 3I53A 2ESHA 4YFXF 1JHFA 4G9YA 2VOOA 2WWYA 2ZXJA 4EMSA 4U0VA 5TJJA 1TTYA 3KETA 3BPVA 2GQQA 3OOPA 1CF7A 4A6EA 5JFRA 2L54A 3WTVC 3HRUA 2RKHA 3ABUA 5FO5A 5J6XA 2ESNA 1S7AA 3IC7A 3WTYC 3HOSA 5LGTA 3I59A 2IPQX 3L09A 3L7WA 3ZPLA 3HTUA 2FE3A 1YFHA 3JAMK 5TRDA 4LD5A 1R5GA 3U1DA 1ZRFA 2EJRA 3KP7A 3DPTA 1ZG5A 3CO6C 4UVCA 1ZG1A 4A12A 1BC7C 3J7AO 4PGGA 3TOBA 5L3FA 4WXCA 4MQVA 3TO6A 4LLNA 1HW5A 2VE8A 3U2RA 4NQWA 2W24A 2MLKA 1PUEE 3LQRA 3KEQA 1QNTA 1ZYRF 1FT9A 4LLGF 2WC2A 2P6TA 2DU9A 3ZP5A 5D5UB 1K79A 5LGNA 3C7JA 3RTRA 1P4XA 2QUFA 3M8FA 3C1DA 3GUDA 4G8XA 1LDKB 1X3UA 1XB4A 3L9FA 4UV9A 1G3YA 2FBKA 1G4DA 3RKXA 2EV0A 1XMAA 3F23A 3C3WA 4UXNA 4I98B 1UFMA 2M87A 4EV0A 3IKVA 2PFBA 2P8TA 3P9CA 3JSOA 3COAC 2CG4A 4ESJA 1RUOA 5BPIA 2AXLA 2TDXA 3JTHA 3ZMZA 3GF2A 1MZBA 2PQ8A 2BV6A 1ZG3A 2G9WA 3ZMTA 3FXUA 1DPRA 3HTSB 3EQLF 3HIFA 4ZZDA 3QPTA 1SAXA 4ASNA 1PDNC 5D4RA 1QGPA 4IHTA 2DAOA 1YW7A 5L3DA 2K27A 1IZ1A 2G7HA 4KIFA 1GHCA 3GLXA 1U2WA 5E1WA 5LRSA 3HUGA 3E6CC 5K5OA 5D6EA 3WTTC 2PEXA 2G7UA 1DPUA 2OZUA 1G6NA 2A3SA 5DV5A 4PZJA 3WTZA 2NRAC 4JQFA 4RB3C 4P55A 1USTA 1YQAA 5FD6A 1Z91A 1XGOA 1TQIA 3DP7A 3LFKA 2DK5A 3S2WA 2RN7A 4LG0B 3WTUC 2ISZA 3EYYA 3EETA 4WXDA 3M8EA 3GWZA 1WRJA 2GXGA 4BYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKP A;  3I5U A;  2DTR A;  3PQJ A;  5ILS A;  3TO9 A;  3LAJ A;  2IP2 A;  3E5X A;  1FX7 A;  1QPM A;  3LST A;  3PFI A;  4P96 A;  2F5D A;  3AAF A;  1YS7 A;  4L9T A;  4U7D A;  1TW3 A;  1XGM A;  4LMY A;  1JE8 A;  1I6X A;  2HOE A;  2XAH A;  4KUM A;  3GZ6 A;  5FLX Z;  4L18 B;  5DCM A;  4XSX F;  5FGM A;  3KLN A;  1IRF A;  1JXS A;  1HQC A;  1D8J A;  3REO A;  1DDN A;  2OBP A;  1IXC A;  4EM0 B;  5BQT A;  3GFL A;  3LAP A;  3OV8 A;  4KN7 X;  1FP2 A;  2YSR A;  3QRF F;  2A6E F;  4I09 A;  2ZKZ A;  2V1U A;  3QAH A;  2PMH A;  2HTS A;  2DPU A;  3F6O A;  3ZN1 A;  2E7W A;  4A2U A;  3R6S A;  2VE9 A;  2UWM A;  4YFK F;  1OYW A;  2Y0M A;  4BHC A;  2FMY A;  2LSO A;  2JT1 A;  3WTW C;  4RB0 A;  4G7O F;  3VEP A;  1L3L A;  2P7C B;  3SFZ A;  4LK0 F;  3T1B A;  5HLH A;  1U3E M;  1TNT A;  1FYK A;  4HW0 A;  2CGP A;  3BPX A;  4F7Z A;  3E5Q A;  5E8G A;  1U78 A;  3NRV A;  3T8R A;  4ZH4 F;  2HYF A;  1SFE A;  5HDK A;  1ODD A;  1KU3 A;  3TQN A;  2K4J A;  3ECH A;  2XVC A;  3V7C A;  3V7R A;  2IVM A;  5DUI A;  4EJW A;  1T6S A;  3WU0 A;  1GXQ A;  3BJO A;  2M5W A;  4MHG A;  5CVV A;  1I27 A;  3DPL C;  3LWF A;  4R79 A;  1XMK A;  5D5V B;  1SD7 A;  2L4A A;  3C18 A;  3FWE A;  2ZJ2 A;  3HSR A;  5KVR A;  2F5C A;  1IAW A;  3W6K B;  3ZQ7 A;  3G3Z A;  2DT5 A;  3BRO A;  3GXO A;  3MZY A;  1O3T A;  3ZN0 A;  5JVT A;  2VC0 A;  5FD5 A;  4M6Y A;  4HAM A;  2CO5 A;  1S29 A;  5L3G A;  1B6A A;  2PJP A;  2FRH A;  3HRT A;  1D8K A;  3DF8 A;  4BQA A;  4O6J A;  2J5P A;  2HQN A;  2FBI A;  2MH9 A;  2EFQ A;  4I2O A;  4RAY A;  2OU2 A;  3P9I A;  1W7P D;  4BHB A;  3IHU A;  4BAY A;  5E1Z B;  2MD5 A;  4LB6 B;  5DD8 A;  1OYY A;  3J80 Z;  1IN8 A;  1FY7 A;  3CUQ B;  2GA1 A;  2QQB A;  3ZMS A;  1RZ4 A;  5DYM A;  3F8C A;  2YX4 A;  1IRG A;  1LQ1 A;  4A5M A;  3H3U A;  4PDK A;  1OKR A;  5K5R A;  2O61 A;  2X4H A;  5FLX K;  2LF7 A;  2EV6 A;  3F72 A;  2PMU A;  1IXR C;  2FEZ A;  1CGP A;  2QYO A;  1ONV A;  2CYY A;  1YIO A;  2Q2E A;  5D5W B;  4CHU A;  2Z3Y A;  4JK1 X;  4WK8 F;  4U0Y A;  3SZT A;  4HQM A;  4G7H F;  5E1X A;  5H6Q A;  1ZN2 A;  1V3F A;  5FB2 A;  1STZ A;  5DUK A;  4IXA A;  2BEO A;  2IRF G;  2XAS A;  2QBY A;  4KIB A;  2VOP A;  2D2W A;  5D4S A;  2KIU A;  2LNB A;  3BZ6 A;  1V4R A;  3FM3 A;  4AIH A;  2P7V B;  1YYV A;  1HW1 A;  1KYW A;  1O3S A;  4AIK A;  3TOA A;  1I1S A;  3RYR A;  1W7P A;  1RUN A;  5ICF A;  2PI0 A;  1UHW A;  3E6B A;  3O6B B;  5BS6 A;  4Q5S F;  1R22 A;  4Y17 A;  2IA0 A;  5J8F A;  1RIO H;  1BJA A;  4P5O A;  2BE5 F;  2L02 A;  2EWN A;  2L01 A;  2JRT A;  3FX3 A;  4KN4 X;  1YG2 A;  1B4A A;  1KU2 A;  1XSV A;  2HR3 A;  3LA2 A;  5JR3 A;  4XSZ F;  5DD4 A;  2Q8K A;  1ON2 A;  4JBA A;  2DW4 A;  4EJV A;  3WU1 B;  3FMQ A;  4N9H A;  1HST A;  4DNC A;  4UV8 A;  4EM2 A;  4M9X A;  1R58 A;  5CYV A;  1MJA A;  3G73 A;  1GXP A;  2STT A;  2Z9O A;  1U5T A;  2W85 A;  3ML6 A;  2H27 A;  4O3M A;  4RS8 A;  1QZY A;  3FM5 A;  3H92 A;  3N97 A;  3FF5 A;  4A5N A;  5L3C A;  3I4P A;  1S8N A;  2EV5 A;  2YR2 A;  1SD6 A;  1FYL A;  3GX4 X;  2A61 A;  1USS A;  2IT0 A;  2D45 A;  1G3T A;  4LJZ F;  5LGU A;  5E8I A;  1TQM A;  5HOO A;  3WGH A;  2XAJ A;  4A0X A;  4CIC A;  1FNN A;  3CTA A;  5BMZ A;  1G3W A;  1J2X A;  2EFW A;  1ON1 A;  3ROU A;  3VFZ A;  3J80 K;  1CF7 B;  1ULY A;  2FNP A;  2VT2 A;  3FXQ A;  4I01 A;  4UHT A;  5LLQ A;  3ULQ B;  5H6R A;  2H6B A;  4GO1 A;  1IN5 A;  4M71 A;  1FP1 D;  1Y0U A;  4HF2 A;  3I64 A;  2EA4 A;  4G6D A;  1AOY A;  3RIR A;  3I59 B;  4NB5 A;  4K2E A;  2NNN A;  2R7D A;  5HVQ C;  2PN6 A;  1OMI A;  4ZZL A;  5D8L B;  1IN7 A;  3T8T A;  2F5E A;  4PCQ A;  1QQI A;  2ACJ A;  5D6F A;  3Q9V A;  1U5T C;  1BN5 A;  2K7L A;  5JHU A;  1FLI A;  4P9U A;  1IN6 A;  2MLG A;  3KP2 A;  1WSU A;  1QBJ A;  5ED4 A;  2ELH A;  2NYX A;  5IT9 Z;  2FNA A;  2KKO A;  2A07 F;  3F6V A;  4WXH A;  3D0S A;  2CFX A;  2J5O A;  4HLY A;  3JSP A;  1SFX A;  5ILV A;  4I7H A;  4CGZ A;  5BPD A;  4R8H A;  3EYI A;  1S6L A;  1WI9 A;  2HKO A;  4B09 A;  2FML A;  2HYG D;  3WE3 A;  3ISP A;  4G6Q A;  4LG0 A;  2DFI A;  1R1U A;  3V8K A;  2DO7 A;  3FMS A;  4HA8 A;  5HLI A;  4I0B A;  1B1B A;  2FF4 A;  1O57 A;  2M30 A;  1BI3 A;  2UXX A;  3HSF A;  1FBQ A;  4HX7 A;  4BNC A;  2XAQ A;  3K2Z A;  3WE2 A;  2YPR A;  2MC3 A;  2VXZ A;  3CJN A;  4YFN F;  5LBQ A;  2ZO4 A;  2DK8 A;  3MQ0 A;  3LA7 A;  1QO0 D;  1U8R A;  1YO5 C;  1W4M A;  3P7N A;  1T98 A;  4CDG A;  4A0Z A;  4MTD A;  1SMY F;  2H94 A;  5FFZ A;  4CZZ A;  3R0A A;  1MJB A;  4QLC U;  1ZHF A;  3RKW A;  3ERE D;  2HWV A;  2FXA A;  4RGR A;  1EH8 A;  4L0Y B;  3HHH A;  1XCV A;  1LJ9 A;  5CVJ A;  2X0L A;  3SQN A;  1O7F A;  1BI0 A;  4HLX A;  5EEH A;  1XDU A;  1HSJ A;  3WGI A;  3M7G A;  2XAG A;  4M74 A;  1ZRC A;  3KZY A;  2EK5 A;  4I0A A;  5CVU A;  2XHK A;  2O6G E;  1KYZ A;  3V8L A;  2H6C A;  2MBF A;  1XGS A;  3ZMU A;  3KP3 A;  3GZ5 A;  4IF4 A;  4Q48 A;  5E18 F;  2Z33 A;  4LK1 F;  1MD0 A;  2ZCW A;  2ZNZ A;  2QZ8 A;  2HZT A;  4KMU X;  1XCB A;  4DQ2 A;  4Q4Z F;  1MJ9 A;  2CQK A;  2NAZ A;  4OOI A;  3FMR A;  4ETS A;  4KIC A;  2EFP A;  5LHI A;  1PP8 F;  1T38 A;  1MDM A;  2AS5 F;  1J0R A;  2DQL A;  5E20 A;  4IRG A;  4S05 A;  2PBI A;  2RV8 A;  2KJB A;  4HYE A;  2XV4 S;  2V6C A;  4Y15 A;  2HKX A;  3BY6 A;  1FC3 A;  1FBS A;  3GO5 A;  3O2P E;  1DP7 P;  5DCM B;  1HKS A;  5CVR A;  4P9F A;  3DFG A;  2VC1 A;  1YTY A;  1Z05 A;  2DQR A;  4ZYH A;  2KRF A;  4RGX A;  2ZFW A;  2CSO A;  1BI1 A;  1WQ2 A;  4WF2 A;  5LHG A;  3TKY A;  3FXR A;  3KZZ A;  2IA1 A;  4HBL A;  4CYD A;  2NNY A;  4D0P A;  2F5F A;  1OR7 A;  1VTN C;  1XD7 A;  2P5V A;  2JPC A;  4TV7 A;  2H09 A;  2NS0 A;  2A68 F;  2VBZ A;  2RNJ A;  5CJ9 A;  4MQ9 F;  3IWF A;  1T39 A;  3BP8 A;  4GCV A;  3CLO A;  1WKM A;  4CO8 A;  4ENJ A;  2OZ6 A;  3F21 A;  1LEA A;  3GW2 A;  1KA8 A;  5LEJ A;  1FOK A;  2BYV E;  4LFU A;  3T0Y A;  5LHH A;  2M8E A;  4LGW A;  3BDD A;  2JTV A;  1BIA A;  2QEN A;  2VON A;  2WTE A;  1BIB A;  2Z5U A;  1AWC A;  3R4K A;  4E70 A;  2E1C A;  2FA5 A;  3I58 A;  2QLZ A;  2VBX A;  2IJL A;  1ZRE A;  5F1R A;  3F22 A;  5J8C A;  2DBB A;  4HX8 A;  4R1H A;  4IPA A;  2QQA A;  3JAM Z;  4HZF A;  1ZLK A;  2V1D A;  2E1N A;  2HGC A;  3FHZ A;  2W25 A;  3O3K A;  3KCC A;  1S3J A;  2GA2 A;  3BJ6 A;  2BGC A;  3WG9 A;  3NEU A;  1HKT A;  3H3Z A;  3BOQ A;  1FPQ A;  1LEB A;  4XBF A;  3MZH A;  3Q5F A;  1RNL A;  2MA3 A;  4U88 A;  4ESB A;  4NHJ A;  1J7K A;  2EB7 A;  4OU0 A;  4I02 A;  1O7L A;  2DI3 A;  5AIP A;  3J81 Z;  1EV7 A;  1HBX G;  1UHM A;  1L0O C;  2STW A;  2ETH A;  2ZME B;  4AWX B;  2GAU A;  1ZAO A;  1OYI A;  3WTX C;  3GVA A;  3B02 A;  3HHG A;  1KQ0 A;  4IRH A;  5L3B A;  1K78 B;  3CUO A;  2KIM A;  3MEX A;  3KLO A;  4WWC A;  5ICG A;  4A6D A;  4KDP A;  2OQG A;  3R60 A;  3TDU C;  3M9A A;  3TDZ C;  1ZRD A;  2ZBK A;  4PGH A;  1BBY A;  4OMZ A;  3KFW X;  3F3X A;  1LVA A;  3KEO A;  5F6F A;  3DV8 A;  5EEG A;  2K4B A;  2MH2 A;  2QM3 A;  1P2F A;  3ECO A;  4OIQ F;  3KP4 A;  1YS6 A;  2GXB A;  2HEO A;  1XDS A;  4MEX F;  1YW9 A;  4YIF A;  3SZP A;  1S7O A;  1LB2 A;  1H9T A;  4OIN F;  2QBY B;  2PLY A;  2O8X A;  3B73 A;  4G94 A;  3WTS C;  4GYG A;  4IJA A;  4KA4 A;  5BOX A;  2F2E A;  1YW8 A;  5IT3 A;  2QQ9 A;  4ENN A;  1WWX A;  3WOD F;  2DPD A;  2VOD A;  4KMF A;  5FFX A;  2HFH A;  3L00 A;  4UNO A;  1MKM A;  1W7P B;  4IVN A;  5LRR A;  2W84 A;  2VBW A;  1BC8 C;  1Z9C A;  3RPU A;  4ZYG A;  4WX9 A;  4HV6 A;  4EJT A;  1KQ8 A;  2YX7 A;  3LA3 A;  1U6G A;  3QOP A;  4KIG A;  4EJO A;  2LDU A;  4M9S A;  3MWM A;  3I71 A;  4Q47 A;  5LEK A;  4HF0 A;  1R5H A;  3W6J B;  1I1G A;  4N9I A;  4UVA A;  3VB2 A;  5DDG A;  2GIV A;  4B8X A;  3DEU A;  5E17 F;  5HDG A;  3EUH A;  4L5J A;  1F9N A;  2RVC A;  4BHP A;  1U5T B;  4RAZ A;  4U0W A;  2HS5 A;  3MAJ A;  5HS7 A;  4CXF A;  3F8M A;  3K9T A;  3BWG A;  1EH7 A;  1IXS B;  3K1N A;  1F1Z A;  1J9I A;  2JZY A;  3K1P A;  4EVI A;  4YII A;  2HQR A;  1DUX C;  3VOE A;  2E7X A;  3F8N A;  3J81 K;  5F64 A;  3HOT A;  4RB1 A;  1B59 A;  3V4G A;  3K1M A;  5AIQ A;  2CWE A;  1B9M A;  1IN4 A;  5D8K B;  1F5T A;  5ICE A;  2ISY A;  3ZMV A;  4QWQ A;  3WGG A;  2FSW A;  2OQR A;  3SXY A;  4L0Z B;  3E3V A;  3U9G A;  3QPH A;  1FBU A;  4FX0 A;  3TGN A;  2KIF A;  2UXN A;  5A2Q Z;  1TQP A;  1SMT A;  2VN2 A;  4HQE A;  4M72 A;  2O3F A;  1LDD A;  1MGT A;  4FX4 A;  4HX4 A;  2HTJ A;  1KU9 A;  4KT5 C;  2P6S A;  2QWW A;  3E6D A;  3HSE A;  2VT3 A;  1P4W A;  3QU3 A;  1IF1 A;  1FSH A;  2XKP A;  3K69 A;  1K7A A;  1F4K A;  4MTE A;  4FHT A;  2XKO A;  2GZW A;  2W57 A;  2UZK A;  5ILU A;  1R1T A;  3KP6 A;  1J59 A;  2O03 A;  3QP6 A;  6PAX A;  3HRM A;  1R23 A;  4EQQ A;  1E17 A;  2A6H F;  2K86 A;  3L2C A;  4ENK A;  4L9V A;  3TO7 A;  2XUB A;  3ZMD A;  3PQK A;  2XRO A;  4XLP F;  4OIO F;  3LQQ A;  1BOA A;  4RGS A;  1H9G A;  1W5S A;  4M9Z A;  4LB5 A;  1NHA A;  2CW0 F;  1D5V A;  1J75 A;  1P6R A;  2XGX A;  2V79 A;  2DLL A;  1T2K A;  5HS9 A;  4H0E A;  1G3S A;  4HF1 A;  4GGG A;  4LLL A;  3KE2 A;  4AIJ A;  3D5L A;  1ZLJ A;  3Q9S A;  2V9V A;  3V8J A;  1HKQ A;  2XAF A;  1XSD A;  1B9N A;  5L3E A;  1REP C;  4L5I A;  1R00 A;  4XLN F;  1I5Z A;  1QZZ A;  4HV5 A;  4EM1 A;  1K6O A;  1C0W A;  1HW2 A;  1SD5 A;  2FBH A;  1R7J A;  2BBY A;  1JHH A;  4KFC A;  2JSC A;  1TBX A;  3RDI A;  2Y48 A;  3KP5 A;  4O5V A;  3K0L A;  3R0J A;  2PG4 A;  2A5Y B;  3RPQ A;  2Y75 A;  1FZP B;  2HDC A;  3DXJ F;  4Z2Y A;  2D1H A;  4AD9 A;  1SD4 A;  3NQO A;  2EFO A;  2RQP A;  1T0F A;  4IHS A;  3DKW A;  3I54 A;  3ELK A;  3RKY A;  4OIP F;  4KYW A;  4BH9 A;  3JTG A;  1UB9 A;  1ZGA A;  5A2Q K;  2FOK A;  5K5Q A;  4M6X A;  5D5X B;  4L9N A;  4Y13 A;  4ENM A;  1E2X A;  1BI2 A;  1FSE A;  4OIR F;  5IT9 K;  3N4M A;  3CDH A;  3HRS A;  4BXU A;  2K02 A;  1GVJ A;  1ZH5 A;  3E6M A;  3I0T A;  4YG2 F;  1Z6T A;  2RGV A;  3EDP A;  4AVP A;  3ABT A;  3GFJ A;  1H0M A;  4MNU A;  1FYM A;  4MGR A;  1JGS A;  1XGN A;  1D3Y A;  1MDM B;  5HLG A;  1SFU A;  1P4A A;  5HS8 A;  2P4W A;  3QU6 A;  5ERI A;  4G7Z F;  1Z7U A;  3IRR A;  2IW5 A;  2ZNY A;  5CVI A;  4A0Y A;  2FQ3 A;  4UUV A;  2M1B A;  5HDN A;  4HOB A;  2FU4 A;  2XIG A;  3M1E A;  1J5Y A;  1O3R A;  3RI4 A;  3P9K A;  2COM A;  1EH6 A;  3GFI A;  2O0Y A;  3CUQ A;  5JI6 A;  1RI7 A;  4ESF A;  2Z99 A;  3GEZ A;  4EGY A;  1FWZ A;  5KK1 A;  4RB2 C;  1BM9 A;  2A69 F;  2B0L A;  4S04 A;  3IKT A;  3VOD A;  2OD5 A;  5DEQ A;  4RGU A;  4EJU A;  3SHF A;  1XSX A;  4GYI A;  2WV0 A;  4XRF A;  2EA2 A;  5K1Y A;  1IW7 F;  3GFM A;  4EGZ A;  2ZME A;  5AON A;  2R3S A;  1KU7 A;  1XN7 A;  5H20 A;  2QVO A;  3BJA A;  1TNS A;  2KJC A;  4L9J A;  1K78 A;  1KGS A;  4MEY F;  3F8B A;  1R36 A;  4ZYD A;  4UVB A;  3FZV A;  2IA2 A;  2XRN A;  2RC4 A;  4U7B A;  1YLF A;  2EFN A;  3CO7 C;  1ZGJ A;  2V1X A;  1LDJ A;  4ON0 A;  1Z1D A;  4WCG A;  2YU3 A;  3RYP A;  3RJP A;  2LF8 A;  2R7F A;  3QP5 A;  1IUY A;  2OAZ A;  3IL2 A;  2L3D A;  3R61 A;  1W5T A;  2P5L C;  2RDP A;  1OPC A;  3T5X A;  3E97 A;  2L4M A;  3IRQ A;  1Z6R A;  1ZAR A;  3IWZ A;  3V7S A;  4OMY A;  1O3Q A;  4ZYE A;  4HDV A;  2C6Y A;  3CUQ C;  1KQ9 A;  1A04 A;  3GYH X;  3DQV C;  1TLH B;  5ICC A;  2VBY A;  4KNY A;  3F8F A;  2GWR A;  5CLS A;  1LNW A;  4N0B A;  1Q1H A;  3MCZ A;  1TW2 A;  1UCR A;  2Q0O A;  2ADU A;  4FT8 A;  3E5U A;  1HXD A;  2P5K A;  2D1V A;  4IRI A;  1R1V A;  4HDU A;  2M45 A;  3JW4 A;  4M73 A;  4GXO A;  2JPB A;  3MFK A;  3HYI A;  1P92 A;  5DCF A;  1PP7 U;  2OA4 A;  3I53 A;  2ESH A;  4YFX F;  1JHF A;  4G9Y A;  2VOO A;  2WWY A;  2ZXJ A;  4EMS A;  4U0V A;  5TJJ A;  1TTY A;  3KET A;  3BPV A;  2GQQ A;  3OOP A;  1CF7 A;  4A6E A;  5JFR A;  2L54 A;  3WTV C;  3HRU A;  2RKH A;  3ABU A;  5FO5 A;  5J6X A;  2ESN A;  1S7A A;  3IC7 A;  3WTY C;  3HOS A;  5LGT A;  3I59 A;  2IPQ X;  3L09 A;  3L7W A;  3ZPL A;  3HTU A;  2FE3 A;  1YFH A;  3JAM K;  5TRD A;  4LD5 A;  1R5G A;  3U1D A;  1ZRF A;  2EJR A;  3KP7 A;  3DPT A;  1ZG5 A;  3CO6 C;  4UVC A;  1ZG1 A;  4A12 A;  1BC7 C;  3J7A O;  4PGG A;  3TOB A;  5L3F A;  4WXC A;  4MQV A;  3TO6 A;  4LLN A;  1HW5 A;  2VE8 A;  3U2R A;  4NQW A;  2W24 A;  2MLK A;  1PUE E;  3LQR A;  3KEQ A;  1QNT A;  1ZYR F;  1FT9 A;  4LLG F;  2WC2 A;  2P6T A;  2DU9 A;  3ZP5 A;  5D5U B;  1K79 A;  5LGN A;  3C7J A;  3RTR A;  1P4X A;  2QUF A;  3M8F A;  3C1D A;  3GUD A;  4G8X A;  1LDK B;  1X3U A;  1XB4 A;  3L9F A;  4UV9 A;  1G3Y A;  2FBK A;  1G4D A;  3RKX A;  2EV0 A;  1XMA A;  3F23 A;  3C3W A;  4UXN A;  4I98 B;  1UFM A;  2M87 A;  4EV0 A;  3IKV A;  2PFB A;  2P8T A;  3P9C A;  3JSO A;  3COA C;  2CG4 A;  4ESJ A;  1RUO A;  5BPI A;  2AXL A;  2TDX A;  3JTH A;  3ZMZ A;  3GF2 A;  1MZB A;  2PQ8 A;  2BV6 A;  1ZG3 A;  2G9W A;  3ZMT A;  3FXU A;  1DPR A;  3HTS B;  3EQL F;  3HIF A;  4ZZD A;  3QPT A;  1SAX A;  4ASN A;  1PDN C;  5D4R A;  1QGP A;  4IHT A;  2DAO A;  1YW7 A;  5L3D A;  2K27 A;  1IZ1 A;  2G7H A;  4KIF A;  1GHC A;  3GLX A;  1U2W A;  5E1W A;  5LRS A;  3HUG A;  3E6C C;  5K5O A;  5D6E A;  3WTT C;  2PEX A;  2G7U A;  1DPU A;  2OZU A;  1G6N A;  2A3S A;  5DV5 A;  4PZJ A;  3WTZ A;  2NRA C;  4JQF A;  4RB3 C;  4P55 A;  1UST A;  1YQA A;  5FD6 A;  1Z91 A;  1XGO A;  1TQI A;  3DP7 A;  3LFK A;  2DK5 A;  3S2W A;  2RN7 A;  4LG0 B;  3WTU C;  2ISZ A;  3EYY A;  3EET A;  4WXD A;  3M8E A;  3GWZ A;  1WRJ A;  2GXG A;  4BYY A; 
#chains in the Genus database with same CATH topology
 2LKP A;  3I5U A;  2RRE A;  2DTR A;  3PQJ A;  3RQ4 A;  2RQQ A;  5ILS A;  4V2G A;  1FMV A;  3JRH A;  3BZK A;  2X1D A;  3M4O J;  3TO9 A;  1HF0 A;  3LAJ A;  1ETV A;  3BTC A;  2IP2 A;  4QTR A;  3E5X A;  3I4M J;  3S14 J;  1FX7 A;  1QPM A;  3LST A;  1I3Q J;  3PFI A;  4P96 A;  3FHN A;  1W36 D;  2F5D A;  2CV0 A;  3AAF A;  3LOC A;  3BLY A;  1ZTR A;  1YS7 A;  4L9T A;  4U7D A;  1A36 A;  4XKV A;  3OYF A;  1TW3 A;  4XLC A;  1X4P A;  1XGM A;  4LMY A;  4F3Q A;  4DBR A;  4IZZ A;  1JE8 A;  2TRT A;  1I6X A;  2HOE A;  4EEF G;  2XAH A;  5F1J A;  1LFU P;  2A05 A;  3EUA A;  3GLL A;  1FEX A;  4KUM A;  3GZ6 A;  4II3 A;  5FLX Z;  4L18 B;  5DCM A;  2PJR B;  3S2H J;  2IGN A;  4XSX F;  5FGM A;  3KLN A;  1IRF A;  2ID6 A;  4UB8 C;  1JXS A;  2HDW A;  4C3J J;  2OCE A;  1HQC A;  3NWT A;  2DFF A;  4X1E A;  1D8J A;  3REO A;  3BTJ A;  3RZO J;  3EPZ A;  2CRG A;  2DA7 A;  1DDN A;  1FMW A;  1QHH D;  5F08 A;  2DMN A;  2OBP A;  3MVP A;  3TP0 A;  1IXC A;  5FKO A;  4PSX A;  4EM0 B;  2FQ4 A;  3I3L A;  3K4K A;  5BQT A;  3GFL A;  3MN2 A;  4AYB N;  1IV6 A;  3WHC A;  2QCO A;  5K7Z A;  3LAP A;  1F43 A;  3OV8 A;  2K9N A;  4KN7 X;  5BNG A;  1FP2 A;  3PIP F;  1UZC A;  2YSR A;  3QRF F;  1Y1V J;  2X1C A;  3E0J B;  2A6E F;  4I09 A;  3LSP A;  2ZKZ A;  4C2U A;  3GBG A;  1VQ8 I;  2V1U A;  3QAH A;  2PMH A;  3I9V 2;  2HTS A;  2JUG A;  2DPU A;  3F6O A;  3ZN1 A;  2E7W A;  1JKP C;  3TW6 A;  3L2Q A;  4A2U A;  3R6S A;  2CQQ A;  2Y69 H;  2VE9 A;  2R5Y B;  2UWM A;  4YFK F;  3ZQF A;  1OYW A;  1S7E A;  1TP4 A;  2Y0M A;  2E2J J;  5B1B H;  4BHC A;  2FMY A;  2LSO A;  2JT1 A;  3TMO A;  2VJ5 A;  2XSJ C;  3WTW C;  4RB0 A;  4G7O F;  3VEP A;  2HQ5 A;  4E7H A;  1L3L A;  3SFZ A;  2P7C B;  4LK0 F;  3T1B A;  4RDU A;  5HLH A;  1U0J A;  1QZE A;  1U3E M;  4XOR A;  4L5E A;  1TNT A;  4ITV A;  4HW0 A;  1FYK A;  1JTX A;  2CGP A;  3BPX A;  3K70 C;  4F7Z A;  3E5Q A;  2JMW A;  5E8G A;  2IGK A;  2R5Z B;  1U78 A;  2DOE A;  3NRV A;  1TZL A;  3T8R A;  4ZH4 F;  1D1A A;  2HYF A;  2WAF A;  4XON A;  2HYJ A;  1TWA J;  1SFE A;  5HDK A;  3BR1 A;  1ODD A;  1KU3 A;  2EIJ H;  2LTP A;  2NOG A;  3TQN A;  2K4J A;  3ECH A;  3FXM A;  2DFH A;  2VKE A;  2DFE A;  4XLH A;  4A3M J;  2XVC A;  1BR1 A;  1NTC A;  3V7C A;  3V7R A;  2IVM A;  2F4M B;  5DUI A;  2LH9 A;  4EJW A;  1T6S A;  5E3L A;  3WU0 A;  1GXQ A;  3BJO A;  1ZGW A;  2M5W A;  4MHG A;  1NK2 P;  5CVV A;  5FLM J;  2W1O A;  1Y0N A;  3K4L A;  1I27 A;  3DPL C;  3LWF A;  4R79 A;  2XB0 X;  3BC8 A;  1XMK A;  5D5V B;  1SD7 A;  2L4A A;  3C18 A;  2X6W A;  2ZJ2 A;  3FWE A;  3HSR A;  5KVR A;  2F5C A;  1IAW A;  1ETW A;  3W6K B;  3ZQ7 A;  3G3Z A;  1MH4 A;  2DT5 A;  3BRO A;  5DM6 F;  3GXO A;  1RET A;  3MZY A;  1JT6 A;  3U21 A;  1O3T A;  3W3C A;  3ZN0 A;  4H4K C;  5JVT A;  2X48 A;  2VC0 A;  4X0G A;  1WJA A;  2VPR A;  4NUB A;  4HEA 2;  5FD5 A;  4M6Y A;  4HAM A;  2CO5 A;  1K4T A;  3SYT A;  2XGD A;  4A3B J;  3TL4 X;  5HNH A;  1S29 A;  5L3G A;  1D5Y A;  2V7F A;  1B6A A;  2PJP A;  4FE7 A;  2FRH A;  2R7V A;  3HRT A;  2PX9 A;  1D8K A;  1S9H A;  3DF8 A;  4BQA A;  4O6J A;  2FJ1 A;  2V9K A;  2J5P A;  2HQN A;  2FBI A;  2MH9 A;  3A01 A;  3CDL A;  4G6T B;  2EFQ A;  5EG0 B;  4XLA A;  4RAY A;  4I2O A;  2WY8 Q;  3BG3 A;  1AA7 A;  3DBR B;  1WH7 A;  3VYT B;  2OU2 A;  3P9I A;  1W7P D;  4BHB A;  3IHU A;  4HNU A;  4BAY A;  5HLT A;  2E71 A;  5E1Z B;  2MD5 A;  1H89 C;  2ID3 A;  3CLQ A;  3DEW A;  4LB6 B;  2BZT A;  1JTY A;  4XKC A;  5DD8 A;  1OYY A;  3J80 Z;  4XLF A;  1IN8 A;  1FY7 A;  3CUQ B;  1DGW Y;  3LSR A;  2I5U A;  2GA1 A;  1W5C C;  2QQB A;  3H9Q A;  5F0F A;  3ZMS A;  3KZI C;  1RZ4 A;  5DYM A;  1QA6 A;  3F8C A;  2L9S A;  2YX4 A;  5J47 A;  2LY1 A;  3DBH B;  1IRG A;  3L2W A;  1LQ1 A;  4A5M A;  4PSW A;  3H3U A;  2JRM A;  4PDK A;  4IOC F;  1OKR A;  5K5R A;  2ZJR F;  2O61 A;  2X4H A;  5FLX K;  2LF7 A;  2EV6 A;  2V1N A;  3F72 A;  2PMU A;  1IXR C;  3GTQ J;  2FEZ A;  1CGP A;  1NK3 P;  2QYO A;  1ONV A;  2CYY A;  3ZCO A;  1YIO A;  2Q2E A;  5D5W B;  4XIC A;  2V4J C;  2R0Q C;  4CHU A;  5CKT A;  3ZRG A;  2VAS A;  2Z3Y A;  4JK1 X;  1RPW A;  2VI6 A;  3CMM A;  4LIT A;  3SZT A;  2E34 A;  4HQM A;  4U0Y A;  5E1X A;  4WK8 F;  4G7H F;  5H6Q A;  3FK6 A;  4XM3 A;  1ZN2 A;  3OY9 A;  2ZJQ F;  2LBF B;  3LMM A;  1V3F A;  1QU3 A;  2Y30 A;  1D0X A;  5FB2 A;  1STZ A;  2LYC A;  5GTH C;  1XMX A;  1IG7 A;  5DUK A;  4IXA A;  2BEO A;  2IRF G;  4Y7N J;  2IS1 A;  2XAS A;  2FUG 2;  5C4J J;  2QBY A;  4KIB A;  2VOP A;  3BTI A;  3LL7 A;  3GTJ J;  5K7F A;  1D1C A;  4LIU A;  2D2W A;  3G2B A;  5D4S A;  3ONQ A;  2KIU A;  2LNB A;  3BZ6 A;  3CZ6 A;  2HPM A;  1XX5 A;  2DA1 A;  4RLQ A;  1IGN A;  1V4R A;  1WPK A;  3FM3 A;  5LD2 C;  4AIH A;  2P7V B;  1YYV A;  4MO7 A;  5EEA A;  1HW1 A;  3ABM H;  1KYW A;  3CMY A;  3HGG A;  1O3S A;  3KPH A;  4AIK A;  3TOA A;  1I1S A;  3RYR A;  1W7P A;  2JVG A;  5J4V A;  1RUN A;  5ICF A;  4RLF A;  2PI0 A;  3LSG A;  1SFO J;  1UHW A;  3E6B A;  3O6B B;  5BS6 A;  2KRH A;  4KT6 A;  4Q5S F;  1R22 A;  4Y17 A;  1Q1V A;  1JUM A;  2IA0 A;  5J8F A;  1RIO H;  2ZME C;  2VKV A;  1OJL A;  1BJA A;  3W2W A;  3BR6 A;  5E3O A;  4P5O A;  2BE5 F;  2F48 A;  4QIW N;  3A0B C;  2KFD A;  2L02 A;  3IV5 A;  2EWN A;  2KLO A;  2JRT A;  2L01 A;  4XRS A;  1WJC A;  3FX3 A;  4KN4 X;  1YG2 A;  1B4A A;  1KU2 A;  1XSV A;  2HR3 A;  3LA2 A;  5JR3 A;  4XSZ F;  5DD4 A;  3JR9 A;  2Q8K A;  1ON2 A;  1IUF A;  4JBA A;  2DW4 A;  4EJV A;  1N25 A;  3WU1 B;  3FMQ A;  4N9H A;  1HST A;  1RKW A;  4DNC A;  4UV8 A;  4EM2 A;  4M9X A;  1R58 A;  5CYV A;  2AQF A;  1MJA A;  2KPM A;  2W82 A;  3G73 A;  4DYQ A;  1GXP A;  2STT A;  5GP9 A;  2Z9O A;  4BUP A;  1U5T A;  2W85 A;  5EGO A;  3ML6 A;  1MND A;  2H27 A;  3PNT A;  3BCA A;  4O3M A;  4RS8 A;  1OQY A;  1QZY A;  3GTL J;  3FM5 A;  3QWL A;  3H92 A;  3MZ8 A;  3S8P A;  2HXI A;  3W6V A;  3GCM A;  1QRY A;  1VQO I;  3N97 A;  2DMU A;  3FF5 A;  1R71 A;  9ANT A;  4A5N A;  1B72 A;  2MD0 A;  5L3C A;  3MKL A;  2CW8 A;  1M1E B;  4A3G J;  3I4P A;  1LE8 A;  1S8N A;  2EV5 A;  2YR2 A;  3BG9 A;  2Y9Z A;  1MBK A;  4XN3 A;  3JRA A;  1A6I A;  1SD6 A;  3B6C A;  1FYL A;  2CUJ A;  3GX4 X;  2R7O A;  2HVR A;  2BVM A;  1SFK A;  4QSH A;  2A61 A;  3ZGK A;  1USS A;  2IT0 A;  1ETK A;  5EJC A;  2GLO A;  2M2E A;  2CW7 A;  2IAI A;  2D45 A;  1G3T A;  3BG6 A;  4PJN A;  2MW8 A;  1G2H A;  4AUX A;  4CH7 A;  4LJZ F;  5LGU A;  2DOD A;  5E8I A;  1TQM A;  1SVM A;  1DP3 A;  1MBG A;  3F0C A;  1RES A;  5HOO A;  3WGH A;  2XAJ A;  3PSF A;  2H8W A;  3OYM A;  4A0X A;  4CIC A;  3DTI A;  1JJ8 C;  2EZK A;  3CTA A;  1FNN A;  1R4N B;  1K83 J;  2KHM A;  3HGY A;  5BMZ A;  2X1E A;  4BDY A;  1G3W A;  3S3M A;  1J2X A;  2EFW A;  1ON1 A;  3ROU A;  2VQL A;  3VFZ A;  1U9N A;  3J80 K;  1CF7 B;  1ENH A;  3KYD B;  4KIT B;  1ULY A;  1X3W B;  2FNP A;  4XKB A;  3S16 J;  2VT2 A;  3FXQ A;  2M7A A;  4I01 A;  4UHT A;  4FET A;  5LLQ A;  2M3A A;  3BT9 A;  3ULQ B;  5H6R A;  3S2D J;  3SDB A;  2WV1 A;  2B9S A;  2H6B A;  3BCB A;  4BJT A;  4GO1 A;  1IN5 A;  2KMU A;  4I6Z A;  2HOT A;  1YOV B;  2K9Q A;  4M71 A;  1FP1 D;  1Y0U A;  4HF2 A;  4YEJ A;  3KEY A;  3I64 A;  4A3E J;  3A4C A;  2EA4 A;  4G6D A;  1AOY A;  3RIR A;  3EUK L;  3I59 B;  4NB5 A;  2I8D A;  3LFU A;  1BR2 A;  5F27 A;  4OWR B;  2Z2S B;  4K2E A;  2NNN A;  2R7D A;  2KZV A;  5HVQ C;  1X3Z B;  2PN6 A;  3VWB A;  1OMI A;  3FBI B;  3IH3 A;  4NC8 A;  4ZZL A;  5D8L B;  1IN7 A;  3T8T A;  2F5E A;  5FJ8 J;  3CCE I;  4PCQ A;  2KDZ A;  1D1B A;  3DBL B;  5DTD A;  1TWH J;  1QQI A;  4UUS A;  4B47 A;  2ACJ A;  3GZN B;  5D6F A;  3Q0U A;  3Q9V A;  1U5T C;  3FKI J;  3K70 D;  1BN5 A;  4XLE A;  2V6E A;  2LY2 A;  3QYB A;  2K7L A;  1BW6 A;  5JHU A;  1OCC H;  1FLI A;  2XF6 A;  3BQY A;  1IN6 A;  2MLG A;  4P9U A;  3KP2 A;  1WSU A;  3BQZ A;  3K10 A;  4NQW B;  1QBJ A;  5ED4 A;  2ELH A;  4JX5 A;  2JWT A;  2NYX A;  1HLV A;  5IT9 Z;  2FNA A;  1ZQ3 P;  2KQR A;  2KKO A;  1LFB A;  2A07 F;  2O8K A;  3F6V A;  4WXH A;  3D0S A;  2CFX A;  2CV1 A;  2J5O A;  2NVQ J;  3VSK A;  1FTT A;  4HLY A;  5J3L A;  3JSP A;  3C2B A;  1SFX A;  4BY1 J;  2DN0 A;  3C2G A;  5ILV A;  4I7H A;  1VQP I;  4CGZ A;  5BPD A;  4R8H A;  2DOA A;  3EYI A;  4FTH A;  1S6L A;  3OL4 A;  3N05 A;  5IP7 J;  1WI9 A;  2FX0 A;  2HKO A;  4B09 A;  2FML A;  2W00 A;  2HYG D;  3WE3 A;  3ISP A;  2DOF A;  4G6Q A;  1YX5 A;  4LG0 A;  3G4S I;  2DT7 B;  1R1U A;  2DFI A;  2VKD A;  3V8K A;  1VQN I;  2DO7 A;  2BW3 A;  3FMS A;  1GUU A;  4HA8 A;  5HLI A;  4I0B A;  1B1B A;  2QEX I;  4XRS G;  2FF4 A;  2R7Q A;  1O57 A;  4F93 B;  2M30 A;  1E0E A;  1BI3 A;  2UXX A;  4G12 A;  1ETQ A;  4GDF A;  2R7T A;  3HSF A;  1FBQ A;  5F0H A;  1WI3 A;  4HX7 A;  4BNC A;  2XAQ A;  3K2Z A;  3WE2 A;  1JUP A;  2YPR A;  3FIS A;  4HSR A;  2MC3 A;  2VXZ A;  3CJN A;  4XKW A;  2B7E A;  4YFN F;  2M9H A;  5LBQ A;  2ZO4 A;  3HPG A;  2CH0 A;  2K3P A;  2DK8 A;  1AKH B;  3MQ0 A;  2ELJ A;  4GFB A;  3LA7 A;  1Y56 A;  2HI3 A;  5FKM A;  1LKX A;  4DZP A;  1QO0 D;  1U8R A;  3M3Y J;  1YO5 C;  3W2A A;  5B66 C;  1W4M A;  1ZK8 A;  3P7N A;  3PNV A;  1T98 A;  4AVZ A;  4CDG A;  4A0Z A;  4MTD A;  1SMY F;  3CJT B;  2H94 A;  3ZXS A;  3GTP J;  1V5G A;  5FFZ A;  4CZZ A;  4I99 C;  3R0A A;  1MJB A;  4CCK A;  4QLC U;  1ZHF A;  3RKW A;  3ERE D;  2HWV A;  2FXA A;  4A3I J;  1X4O A;  2FD5 A;  4RGR A;  2ZXH A;  3OIP A;  2VIX A;  3HUG B;  1EH8 A;  2HOA A;  3S1Q J;  5M3F J;  4L0Y B;  3HHH A;  1XCV A;  5B5E C;  5IYC J;  4BXX J;  1LJ9 A;  4W1U A;  4E6K G;  5CVJ A;  2X0L A;  3SQN A;  4IL6 C;  1O7F A;  1BI0 A;  1Z77 A;  1B8I A;  1IRZ A;  4HLX A;  5EEH A;  4IO9 F;  1Y1W J;  1OCZ H;  1HSJ A;  1XDU A;  3A1Y A;  4RAF A;  3WGI A;  3GTO J;  5E3N A;  3M7G A;  4HPQ A;  5IYB J;  2XAG A;  4M74 A;  3JRE A;  1ZRC A;  3KZY A;  2EK5 A;  4I0A A;  5CVU A;  2XHK A;  1GLN A;  5JHF A;  1Z7L A;  1JGG A;  2O6G E;  2HQA A;  1KYZ A;  3V8L A;  2H6C A;  4BBR J;  2MBF A;  1VI0 A;  2E1O A;  1YRN A;  1XGS A;  3ZMU A;  3KP3 A;  3GZ5 A;  4IF4 A;  2X6O A;  2H1K A;  3PUF A;  2IEK A;  4Q48 A;  1QVU A;  4A69 C;  1JKR C;  2R5Y A;  5E18 F;  3BG5 A;  4XMY A;  2Z33 A;  4LK1 F;  3S17 J;  1MD0 A;  4BU2 A;  3TBI A;  3DLL F;  1RR7 A;  2ZCW A;  3W2V A;  2ZNZ A;  2L7F P;  2QZ8 A;  2OUM A;  2HZT A;  4KMU X;  1XCB A;  1OIS A;  1FOX A;  4DQ2 A;  4Q4Z F;  1GT0 C;  1MJ9 A;  2CQK A;  4OAZ A;  2NAZ A;  4OOI A;  4RM3 A;  3FMR A;  4ETS A;  4KIC A;  2EFP A;  4YEL A;  3CCR I;  3AL0 C;  2IS2 A;  2WB1 N;  2QA4 I;  5KAF C;  2COB A;  5LHI A;  1PP8 F;  1T38 A;  1MDM A;  2AS5 F;  1F36 A;  1J0R A;  2DQL A;  5E20 A;  1VQK I;  3CP8 A;  1YJW I;  4IRG A;  5GAH J;  4S05 A;  2PBI A;  3H5R A;  3DWL E;  2RV8 A;  4BEH A;  2EIN H;  2KJB A;  1LFP A;  4HYE A;  4B44 A;  3K6G A;  2MC4 A;  3IH4 A;  3ZOB A;  2XV4 S;  3CCQ I;  2A5W A;  2V6C A;  4Y15 A;  2QSG X;  2HKX A;  2R4G A;  3BY6 A;  1FC3 A;  5M5W J;  3CCM I;  1FBS A;  4BXF A;  3GO5 A;  3QPS A;  3O2P E;  1DP7 P;  4C2M J;  5DCM B;  4E7K A;  5B3S H;  2EZL A;  5IY5 H;  3AKZ A;  1HKS A;  5CVR A;  4BE0 A;  4P9F A;  4GRI A;  2LLK A;  3DFG A;  2VC1 A;  1YTY A;  1Z05 A;  2CUZ A;  2DQR A;  4ZYH A;  1GDT A;  2KRF A;  4PK4 A;  4RGX A;  3G6E I;  5GPC A;  1UJ8 A;  2K9L A;  4DBQ A;  2CUF A;  1YJN I;  2ZFW A;  1SAN A;  3BR5 A;  2CSO A;  1BI1 A;  3ESW B;  4DJA A;  2LC2 A;  1WQ2 A;  4WF2 A;  5LHG A;  3TKY A;  3FXR A;  2EZI A;  2W48 A;  5KCM A;  2YU9 J;  3KZZ A;  2IA1 A;  4HBL A;  3TED A;  3NWS A;  2L9R A;  2GXA A;  4CYD A;  2NNY A;  2GBY A;  2F5F A;  3LSI A;  4D0P A;  2M4K A;  2QKM B;  1OR7 A;  2JN6 A;  3H0D A;  3GTM J;  1VTN C;  1XD7 A;  2P5V A;  4JOM A;  2JPC A;  4TV7 A;  3OOU A;  2LRD A;  3AG3 H;  2H09 A;  2NS0 A;  2A68 F;  2VBZ A;  2RNJ A;  1W0U A;  3WHB A;  4RA2 A;  2R92 J;  4CCL A;  2BY2 A;  4Z6Y A;  5CJ9 A;  4MQ9 F;  3IWF A;  1T39 A;  3BP8 A;  5EZG A;  1BJZ A;  3OS2 A;  4CCJ A;  1Y8R B;  4GCV A;  4C3I J;  3D1N I;  4PJ0 C;  3CLO A;  1WKM A;  3J7A Y;  4CO8 A;  4ENJ A;  2OZ6 A;  3F21 A;  4BAC A;  1LEA A;  3GW2 A;  1KA8 A;  2R7S A;  2E36 A;  4AU7 A;  5LEJ A;  1FOK A;  1ITY A;  2BYV E;  1T08 B;  2L2O A;  4LFU A;  3T0Y A;  3UR3 C;  2IS4 A;  5LHH A;  2WBM A;  2PMZ N;  2M8E A;  4LGW A;  2BHY A;  3BDD A;  2JTV A;  1BIA A;  2QEN A;  4D5C A;  1POG A;  2VON A;  4D7N A;  2HDD A;  3OIO A;  2WTE A;  2JSP A;  1BIB A;  1S5L C;  2Z5U A;  1IDY A;  1GV2 A;  3S32 A;  1AWC A;  1Z21 A;  3CCJ I;  1ZR4 A;  2QSH X;  3R4K A;  4E70 A;  2E1C A;  2FA5 A;  1EKE A;  3I58 A;  2QLZ A;  2VBX A;  2IJL A;  4CA0 A;  1ZRE A;  5F1R A;  1YE9 A;  5EZH A;  3F22 A;  5J8C A;  5EF6 A;  2X85 A;  1VQ6 I;  2KP6 A;  2OV7 A;  4A3K J;  2ICW G;  2DBB A;  4HX8 A;  4R1H A;  1WCM J;  4IPA A;  2QQA A;  2RAE A;  4HZF A;  3JAM Z;  1ZLK A;  2V1D A;  2E1N A;  3BR3 A;  2HGC A;  4B3X A;  3IP4 B;  3FHZ A;  4V19 K;  2K9M A;  4XR6 A;  1W1W E;  2W25 A;  3O3K A;  3KCC A;  1S3J A;  3UKG A;  1ZR2 A;  2GA2 A;  3BJ6 A;  2BGC A;  3PL8 A;  4LG3 A;  3NEU A;  3WG9 A;  2BY3 A;  1OCT C;  1HKT A;  1QHG A;  3H3Z A;  3PSI A;  3BOQ A;  3HM5 A;  2MAB A;  1FPQ A;  1LEB A;  3WG7 H;  2A6T A;  2MFZ A;  4XBF A;  3MZH A;  1RNL A;  5GTI C;  3Q5F A;  2DA6 A;  1HA8 A;  2MA3 A;  4U88 A;  3KYL A;  3S15 J;  1V55 H;  4ESB A;  2YS9 A;  4NHJ A;  2DDA A;  1J7K A;  1WVR A;  2EB7 A;  4OU0 A;  3A2K A;  4BKX A;  4I02 A;  4A3J J;  1O7L A;  2DI3 A;  5AIP A;  4E7S A;  1EV7 A;  3J81 Z;  1HBX G;  3AG4 H;  1UHM A;  1L0O C;  2STW A;  2IS6 A;  3DEE A;  3BR0 A;  2ETH A;  2OJE D;  4M6V A;  2ZME B;  4ZTF A;  4AWX B;  2GAU A;  2Z16 A;  2DCE A;  1ZAO A;  3A01 B;  4ABZ A;  3V42 A;  4B43 A;  1OYI A;  3WTX C;  2K40 A;  3GVA A;  4UY8 I;  2CQN A;  1A5J A;  2YUS A;  3B02 A;  1OR7 C;  2LY9 A;  1KQ0 A;  2ELK A;  3DPU A;  3HHG A;  3ASO H;  1ZKG A;  2XF5 A;  4IRH A;  5L3B A;  1K78 B;  3MMY B;  5FRO A;  2M4G A;  3DU6 A;  3CUO A;  2KIM A;  3MEX A;  3KLO A;  4WWC A;  2HVQ A;  5ICG A;  4B4C A;  4A6D A;  4KDP A;  2OQG A;  3RPU D;  4BL0 B;  3R60 A;  2R7R A;  2JA8 J;  4XK4 A;  3S1M J;  3TDU C;  1NG7 A;  5J1R A;  2CQX A;  3M9A A;  4HNT A;  5GAE J;  1K61 A;  3TDZ C;  1ZRD A;  2ZBK A;  1WZ2 A;  1Z3Y A;  3VYS B;  2O5R A;  2WA0 A;  2XAU A;  4PGH A;  1TWC J;  2OTL I;  3DU5 A;  3HC7 A;  3QYE A;  3X2Q H;  1BBY A;  4OMZ A;  3KFW X;  5J40 A;  3F3X A;  2Y2Z A;  1LVA A;  3OSG A;  1OFC X;  3KEO A;  2VUM J;  3H5A A;  4BDZ A;  4C30 A;  5F6F A;  2CFO A;  3DV8 A;  5EEG A;  2K4B A;  1PUF A;  2MH2 A;  1MBE A;  1TT0 A;  2QM3 A;  1P2F A;  2NS7 A;  3ECO A;  4OIQ F;  1MW7 A;  3KP4 A;  1YS6 A;  2Q2E B;  1UAA A;  2BOL A;  2GXB A;  2HEO A;  1XDS A;  4MEX F;  2DJI A;  4HST A;  1YW9 A;  4YIF A;  3GTG J;  2OTJ I;  1EF4 A;  2ZJP F;  1FIP A;  3LSM A;  3SZP A;  3MKZ A;  1S7O A;  1YJ9 I;  3SZG A;  4BY7 J;  1LB2 A;  1H9T A;  3D5R C;  2P81 A;  4OIN F;  2QBY B;  3CJR B;  2PLY A;  2O8X A;  4NNJ A;  2DA4 A;  3B73 A;  4G94 A;  1IO2 A;  3WTS C;  2LKX A;  4GYG A;  4A3D J;  4IJA A;  4KA4 A;  4J19 A;  3H5N A;  3OYD A;  5BOX A;  2F2E A;  2E2H J;  1YW8 A;  3FXO A;  2M0M A;  5IT3 A;  2QQ9 A;  1DGR M;  2IGM A;  5KAI C;  4ENN A;  3FKJ A;  1WWX A;  3WOD F;  5LFA A;  2DPD A;  1BL0 A;  2VOD A;  4KMF A;  4NDL A;  1MBH A;  2HFH A;  5FFX A;  4FCY A;  3L00 A;  4UNO A;  1MKM A;  4BJ6 C;  1W7P B;  4IVN A;  4MLO A;  5LRR A;  2IGO A;  4QPO A;  2W84 A;  3FK7 A;  2VBW A;  1BC8 C;  5C3E J;  1FJL A;  1UG2 A;  2KL4 A;  1WH5 A;  1Z9C A;  2JA6 J;  2V9P A;  3RPU A;  1TT5 B;  4ZYG A;  4WX9 A;  1VZ0 A;  4HV6 A;  4EJT A;  1KQ8 A;  4ZDO A;  2NVT J;  2AQE A;  2YX7 A;  3LA3 A;  1LVK A;  1WHU A;  4IHW A;  1U6G A;  1LPQ A;  3QOP A;  4KIG A;  4EJO A;  2LDU A;  2M8G X;  3MWM A;  4M9S A;  3I71 A;  4ZJZ A;  4Q47 A;  5LEK A;  1KZH A;  1NH3 A;  4HF0 A;  1R5H A;  3W6J B;  2L7K A;  1I1G A;  4N9I A;  4CSW A;  4UVA A;  4JP0 A;  1YHQ I;  3VB2 A;  3O8H A;  2Y0S A;  5DDG A;  2GIV A;  3UNG C;  2LFB A;  4B8X A;  5IPA A;  4PFO A;  5EYR A;  2HNH A;  1G59 A;  4JX4 A;  1HCR A;  3HB9 A;  1R6R A;  3DEU A;  2MGQ A;  5E17 F;  3ERM A;  5HDG A;  3EUH A;  4L5J A;  1F9N A;  2RVC A;  4V2F A;  2VPL A;  3A03 A;  3HKZ A;  1I6H J;  4XOT A;  4BHP A;  5TGT A;  5KNL A;  1U5T B;  2VJI A;  1H8A C;  4RAZ A;  5EGO B;  4U0W A;  4D5F A;  2HS5 A;  3MAJ A;  5HS7 A;  4CXF A;  3L2U A;  3F8M A;  3CME I;  2XSD C;  2HPI A;  1V5F A;  3K9T A;  1XS9 A;  1X1C A;  3NAR A;  1MSF C;  3BWG A;  1EH7 A;  2LP0 A;  3IAS 2;  1IXS B;  3K1N A;  3OL3 A;  1F1Z A;  1U9O A;  4CZC A;  1W0T A;  1J9I A;  2JZY A;  3K1P A;  4EVI A;  3ABK H;  4YII A;  1IJW C;  5IP9 J;  1B72 B;  1UEL B;  2ME6 A;  2HQR A;  1DUX C;  1AU7 A;  3VOE A;  1LE8 B;  3OYE A;  2E7X A;  3F8N A;  3J81 K;  2DMP A;  2DYS H;  5F64 A;  2M0C A;  5IP6 A;  2VQH A;  3HOT A;  2XPW A;  4C3H J;  4RB1 A;  4IKF A;  1B59 A;  3V4G A;  3K1M A;  5AIQ A;  2CWE A;  4IHV A;  1B9M A;  2CJJ A;  1IN4 A;  2F4O B;  1LUJ B;  5D8K B;  3M1C A;  1F5T A;  3P5J A;  5ICE A;  1ACI A;  2K85 A;  2ISY A;  4BGD A;  3MKY B;  1XPX A;  3ZMV A;  4QWQ A;  3WGG A;  2CS3 A;  2FSW A;  2OQR A;  4AYB A;  3SXY A;  4L0Z B;  1FTZ A;  1XG1 A;  3E3V A;  3U9G A;  4DIQ A;  3QPH A;  1HDD C;  4BE1 A;  3H3V K;  1FBU A;  2IBD A;  4FX0 A;  3TGN A;  2KIF A;  2XF7 A;  4DZJ A;  2UXN A;  5A2Q Z;  1MNE A;  1TQP A;  1SMT A;  2E5N A;  2VN2 A;  4HQE A;  2XDV A;  4M72 A;  4ANJ A;  2O3F A;  3JRC A;  2EIM H;  2I10 A;  3O8G A;  1LDD A;  3IAM 2;  1MIJ A;  1MGT A;  1VQ9 I;  4FX4 A;  1PVE A;  5EDN A;  4HX4 A;  2HTJ A;  1SVO A;  1KU9 A;  4KT5 C;  2BXZ A;  2P6S A;  1VQL I;  2JVH A;  1HC8 A;  2QWW A;  3M07 A;  4B1R A;  1Z67 A;  2ZB9 A;  3E6D A;  3HSE A;  2VT3 A;  1P4W A;  3CD6 I;  2LK2 A;  2WAQ A;  3QU3 A;  2AHQ A;  4B3A A;  3JRB A;  1IF1 A;  3FIW A;  1FSH A;  2GIZ A;  2XKP A;  2XGC A;  1GVD A;  3RCO A;  1TWF J;  3S93 A;  3K69 A;  1K7A A;  1F4K A;  4MTE A;  1Y6I A;  4FHT A;  2CQ7 A;  4E7J A;  2E1M C;  2XKO A;  1N78 A;  2GZW A;  2W57 A;  2UZK A;  2RNG A;  2L7Z A;  5ILU A;  1R1T A;  2CV2 A;  2R7X A;  1WFX A;  1K4S A;  2LOO A;  2UV1 A;  3KP6 A;  3CCS I;  1J59 A;  2O03 A;  3QP6 A;  1N77 A;  6PAX A;  1X2N A;  3EUH C;  3HRM A;  1D0Y A;  5GAG J;  1DU0 A;  4UUS B;  2JQ7 A;  1R23 A;  4DOZ A;  1ORK A;  4EQQ A;  4E7I A;  3G1L A;  5IYD J;  3I4N J;  4DW6 A;  2F4I A;  2A6H F;  2K86 A;  2ME0 A;  1E17 A;  3L2C A;  4ENK A;  4L9V A;  3TO7 A;  2XUB A;  2VQC A;  2CUE A;  3LSJ A;  3ZMD A;  3PQK A;  3ABL H;  2XRO A;  1K6Y A;  1X1P A;  5GAD J;  4XLP F;  3JRD A;  4OIO F;  1ETY A;  2KIQ A;  3LQQ A;  1BOA A;  4RGS A;  1WJE A;  2OF7 A;  2JJ7 A;  3CF2 A;  1H9G A;  5M5Y J;  3ZQC A;  5FKN A;  1W5S A;  4XID A;  4AC0 A;  4M9Z A;  2EBI A;  4LB5 A;  1NHA A;  2CW0 F;  4IX7 A;  3H9G A;  1D5V A;  3FBN B;  2EPF A;  3PIO F;  1J75 A;  1P6R A;  3HOV J;  1E3O C;  4RMN A;  2BHZ A;  4A3C J;  3VYR B;  2LKS A;  2XGX A;  1QVT A;  2V79 A;  4CYC B;  2DLL A;  1T2K A;  2PJR A;  5HS9 A;  4H0E A;  1G3S A;  4HF1 A;  4GGG A;  4LLL A;  2X6Y A;  3KE2 A;  4AIJ A;  5B1A H;  3D5L A;  1ZLJ A;  3J7Z I;  3OYL A;  3Q9S A;  4P1W A;  2V9V A;  3V8J A;  5J1U A;  1HKQ A;  2BW3 B;  2XAF A;  3AL0 B;  1XSD A;  2LD5 A;  1B9N A;  3G1O A;  2ZXW H;  1X2M A;  3VPR A;  1BA5 A;  5L3E A;  2NXN B;  4XNF A;  1REP C;  2Y0S N;  5C44 J;  4FAS D;  4L5I A;  1R00 A;  4II2 A;  2KIS A;  3OYC A;  3Q3S A;  4XLN F;  1I5Z A;  1QZZ A;  4HV5 A;  4BBS J;  3ZQH A;  2R7U A;  3QYF A;  4EM1 A;  1K6O A;  2X9D A;  1C0W A;  1PYV A;  1HW2 A;  2Y31 A;  2FBH A;  1SD5 A;  2E35 A;  1MMN A;  4MIM A;  4BQQ A;  2R93 J;  3HKZ N;  1R7J A;  2BBY A;  3I55 I;  4A3F J;  2DA5 A;  2QGU A;  1JHH A;  4KFC A;  2X6X A;  2JSC A;  2KZG A;  3WU2 C;  2L7M P;  2O7O A;  1TBX A;  2QF7 A;  2Y48 A;  3RDI A;  1ZEL A;  4XL9 A;  4BE2 A;  3F9K A;  1S72 I;  3L2R A;  1MH3 A;  3KP5 A;  1T33 A;  2ZC2 A;  3QOE A;  4O5V A;  3HDD A;  3K0L A;  3R0J A;  3LNQ A;  2PG4 A;  2A5Y B;  2L9N A;  3SEZ A;  3RPQ A;  2Y75 A;  1FZP B;  3J7Y J;  2HDC A;  3DXJ F;  4YRV A;  2R5Z A;  3CES A;  4PJL A;  4E4H A;  1MMD A;  4Z2Y A;  1VND A;  1Y8Q B;  1FOW A;  1UG0 A;  1OCP A;  3AFH A;  2E5Z A;  2D1H A;  4AD9 A;  3JRG A;  1B8I B;  1SD4 A;  3NQO A;  2EFO A;  4F91 B;  2RQP A;  1T0F A;  4IHS A;  3DKW A;  3I54 A;  3GTK J;  2AO9 A;  3ELK A;  3RKY A;  4OIP F;  4KYW A;  4BH9 A;  1TWG J;  1IC8 A;  3JTG A;  1Y39 A;  5F04 A;  4YIR X;  4M3F A;  1UB9 A;  2DDB A;  1X19 A;  1ZGA A;  3K4M A;  2GOX B;  5A2Q K;  3RSN A;  2FOK A;  2XB5 A;  5K5Q A;  4I76 A;  4M6X A;  5D5X B;  4L9N A;  1JKO C;  5CQE A;  4Y13 A;  4IOA F;  1YRN B;  1OCO H;  3PNY A;  3B6A A;  1E2X A;  1BI2 A;  1FSE A;  4ENM A;  3FXJ A;  4OIR F;  2OPT A;  5IT9 K;  2D5V A;  3N4M A;  3CDH A;  3PM1 A;  3TW7 A;  1P7I A;  2CMP A;  1P7J A;  4AM3 A;  3HRS A;  3VDX A;  3BG7 A;  4BXU A;  2E2I J;  2R7W A;  3HOY J;  2K02 A;  2XRL A;  5GPA A;  3S1R J;  1GVJ A;  1ZH5 A;  1TL8 A;  3E6M A;  3I0T A;  2DT6 A;  4YG2 F;  4FIS A;  4XRM A;  1Z6T A;  2RGV A;  3CCU I;  1Z0X A;  5CPR B;  3EDP A;  4AVP A;  2NS8 A;  2WAQ N;  3ABT A;  4RM2 A;  4UB6 C;  1X1A A;  3MKW B;  1A31 A;  3GFJ A;  1H0M A;  4LIV A;  4MNU A;  1EJ9 A;  3JRI A;  4XQF A;  1FYM A;  4MGR A;  2P0W A;  1E3H A;  1JGS A;  1XGN A;  1D3Y A;  1MDM B;  5HLG A;  4M3G A;  1SFU A;  3CC7 I;  1P4A A;  2O9L A;  5HS8 A;  2P4W A;  3A02 A;  3QU6 A;  5ERI A;  2JA2 A;  4D9J A;  4G7Z F;  1J09 A;  4BS9 A;  3SDG A;  1Z7U A;  3HG9 A;  3HZJ A;  2IW5 A;  2ZNY A;  3IRR A;  5CVI A;  4BEH B;  5EG0 A;  4A0Y A;  1UHS A;  2FQ3 A;  3K4B A;  4UUV A;  2M1B A;  1FOY A;  5HDN A;  1BR4 A;  4HOB A;  1D0Z A;  5FKK A;  5IOY A;  3PO3 J;  3OYK A;  3HOX J;  3DKY A;  2FU4 A;  2XIG A;  3M1E A;  1VQ4 I;  2FOW A;  1J5Y A;  1O3R A;  3RI4 A;  1I39 A;  3E1S A;  3P9K A;  4QPQ A;  3M8J A;  3ZQI A;  2COM A;  2F6C A;  1EH6 A;  3GFI A;  3H36 A;  4CCO A;  5F0C A;  4N4N B;  2O0Y A;  3CUQ A;  3Q0V A;  1DU6 A;  5JI6 A;  1RI7 A;  4ESF A;  3AG2 H;  4IQ4 A;  1OCR H;  2Z99 A;  3KIO A;  4NC6 A;  3GEZ A;  4EGY A;  4Y33 A;  4IHY A;  1FWZ A;  5KK1 A;  3OWT A;  4RB2 C;  1BM9 A;  1WJD A;  2A69 F;  2B0L A;  4S04 A;  3IKT A;  3VOD A;  1MMS A;  1UMQ A;  2OD5 A;  2WAD A;  3K2A A;  5DEQ A;  4RGU A;  4EJU A;  3SHF A;  3PFY A;  1XSX A;  2K3F A;  4GYI A;  2WV0 A;  1T0F C;  4XRF A;  2EA2 A;  4W97 A;  1R4M B;  2QSF X;  5K1Y A;  3OYJ A;  1IW7 F;  1YIT I;  3L2V A;  5J4Y A;  2ECB A;  3GFM A;  4EGZ A;  2ZME A;  5DM7 F;  2CU7 A;  1JUS A;  5AON A;  3FXL A;  3VYU B;  2R3S A;  1KU7 A;  1XN7 A;  5FKL A;  3CMA I;  3G71 I;  2LBF A;  5H20 A;  2QVO A;  1FIA A;  2HVS A;  4RAG A;  3BJA A;  1TNS A;  1T95 A;  2KJC A;  4L9J A;  2NVU B;  1K78 A;  2H8R A;  2HU9 A;  1RR8 C;  1KGS A;  1O4X A;  4MEY F;  3F8B A;  1R36 A;  3JRF A;  4ZYD A;  2LG4 A;  4UVB A;  2JK3 A;  3FZV A;  3H1C A;  3HEF A;  4MFE A;  2IA2 A;  2XRN A;  4ZTJ A;  2RC4 A;  3CCL I;  1JKQ C;  4U87 A;  2Q1Z B;  4U7B A;  1APL C;  4MFD A;  5IOZ A;  4JYK A;  1YLF A;  5K7H A;  2L0K A;  2EFN A;  3CO7 C;  1ZGJ A;  1BOB A;  2V1X A;  2VL8 A;  3OYH A;  3U1K A;  1AHD P;  4X6A J;  1BW5 A;  1LDJ A;  1N75 A;  4A3L J;  3SFI A;  4ON0 A;  1W36 C;  1Z1D A;  4IHX A;  4WCG A;  3QPL A;  2YU3 A;  3RYP A;  4NBQ A;  3RJP A;  3NAU A;  1VQ7 I;  4E7Z A;  2LF8 A;  2R7F A;  1RKT A;  3OMY A;  1MMA A;  2QKL B;  3QP5 A;  1IUY A;  1HOM A;  2OAZ A;  4KJZ A;  3GME A;  3IL2 A;  2L3D A;  3R61 A;  1W5T A;  2P5L C;  2B63 J;  2RDP A;  1OPC A;  3CP2 A;  3ZQQ A;  3T5X A;  3E97 A;  3OYI A;  2L4M A;  2WY7 Q;  3IRQ A;  3HOU J;  3DTE A;  3H0G J;  2JA7 J;  1Z6R A;  4NC7 A;  1ZAR A;  4N4O B;  4J00 A;  4Y52 J;  3IWZ A;  3V7S A;  5E3M A;  4XOP A;  4OMY A;  2DA3 A;  1O3Q A;  2ZSI B;  4ZYE A;  4HDV A;  2MG4 A;  3MD2 A;  2C6Y A;  3CUQ C;  1KQ9 A;  3OSF A;  1A04 A;  3GYH X;  3DQV C;  1TLH B;  3HBL A;  2VBY A;  5ICC A;  3OYG A;  3L1P A;  3S3O A;  4KNY A;  3F8F A;  2GWR A;  5CLS A;  2KRC A;  1LNW A;  3CDI A;  2ZSH B;  3LSK A;  2MYS A;  3CC4 I;  4N0B A;  1Q1H A;  1WJF A;  2Y9Y A;  3MCZ A;  1TW2 A;  4F52 A;  3Q0W A;  1UCR A;  2XGE A;  5DS9 A;  2BVL A;  3OYA A;  2Q0O A;  2ADU A;  1DQU A;  4FT8 A;  3OS1 A;  3PJR A;  3E5U A;  1X1D A;  3DTK A;  1HXD A;  2DTZ A;  2P5K A;  4A93 J;  1H88 C;  2D1V A;  4IRI A;  4J01 A;  1G8X A;  1R1V A;  4HDU A;  3OYB A;  1HDP A;  2M45 A;  3JW4 A;  1YX3 A;  3DKX A;  3K4J A;  2K5C A;  2EQR A;  4GXO A;  4M73 A;  2AXT C;  2JPB A;  3MFK A;  1MNM C;  3HYI A;  1P92 A;  1WGX A;  2KDO A;  4CCM A;  2KT0 A;  5DCF A;  1VF9 A;  2BY1 A;  1PP7 U;  1A6Q A;  3SJM A;  1E3P A;  2OA4 A;  2NVX J;  1V54 H;  2XPU A;  2EH3 A;  2ESH A;  3I53 A;  3DLA A;  4YFX F;  1JHF A;  1WJ5 A;  1R9T J;  1I50 J;  3A0H C;  4OAY A;  4JX6 A;  4G9Y A;  4DGW B;  2VOO A;  1YIJ I;  4IEJ A;  2WWY A;  4BQN A;  4AID A;  2ZXJ A;  4EMS A;  1KON A;  1I3A A;  4U0V A;  5TJJ A;  1TTY A;  2OC6 A;  1PUF B;  3KET A;  4PJJ A;  3HL2 A;  2W4S A;  1ETO A;  2VJ4 A;  3BPV A;  3BTL A;  3OS0 A;  2GQQ A;  3OOP A;  2DA2 A;  1CF7 A;  4A6E A;  3IUO A;  5JFR A;  2TCT A;  2M34 A;  1SVL A;  2L54 A;  2JUC A;  1JI8 A;  3HXL A;  2BXY A;  3WTV C;  3HRU A;  2DXI A;  3RKQ A;  1Z3X A;  3JCU C;  1MMG A;  2VQG A;  3OR2 C;  3OYN A;  2VLA A;  2RKH A;  4D1Q A;  5JVG F;  3ABU A;  1T8I A;  1V5E A;  5FO5 A;  2ESN A;  5J6X A;  3CF5 F;  1YI2 I;  4C2T A;  1S7A A;  3IC7 A;  4E7L A;  3WTY C;  4DYR A;  3BR2 A;  5M3M J;  3HOZ J;  3ZQG A;  4D7M A;  3HOS A;  4M3E A;  5LGT A;  3I59 A;  2IPQ X;  4ZYA A;  4BJ5 C;  3L09 A;  3L7W A;  4ZC3 A;  3ZPL A;  3TP3 A;  1XC5 A;  2M7B A;  3HTU A;  2FE3 A;  1YFH A;  3JAM K;  5TRD A;  4S0H B;  4LD5 A;  1SC7 A;  1R5G A;  5J1Y A;  3FXK A;  3AG1 H;  3U1D A;  5JLW A;  1RRJ A;  1ZRF A;  2VB6 A;  1U8B A;  2EJR A;  3KP7 A;  3ZQL A;  2HXO A;  2L9V A;  2DMT A;  3DPT A;  4CUG A;  3CQZ J;  1ZG5 A;  1R5I D;  1RC9 A;  3K4N A;  4UUT A;  3CO6 C;  4UVC A;  3SEQ A;  3HOW J;  1ZG1 A;  4A12 A;  2DYR H;  1BC7 C;  1R49 A;  4PGG A;  3J7A O;  3CCY A;  4IQJ A;  2EIL H;  3TOB A;  5L3F A;  3OR1 C;  4WXC A;  5M5X J;  4MQV A;  3FDY A;  2H1L A;  3TO6 A;  2IXS A;  4LLN A;  1MBJ A;  3KX2 A;  2LMD A;  5JLX A;  1P9Q C;  2QQ8 A;  3K4C A;  1MBF A;  1HW5 A;  2VE8 A;  4B48 A;  5FLV A;  3U2R A;  4NQW A;  2W24 A;  2MLK A;  1PUE E;  3LQR A;  3KEQ A;  1QNT A;  1ZYR F;  4FE4 A;  1SEU A;  1FT9 A;  4LLG F;  2WC2 A;  2P6T A;  2DU9 A;  4ZDL A;  3ZP5 A;  5D5U B;  4BQO A;  1A35 A;  1EA3 A;  1K79 A;  2VKH A;  2JA5 J;  5LGN A;  3C7J A;  3RTR A;  1P4X A;  2QUF A;  2E1M B;  4KIS A;  3M8F A;  3PUB A;  3C1D A;  3GUD A;  3C2H A;  2BY0 A;  2OCC H;  4G8X A;  2HOS A;  1LDK B;  1X3U A;  1XB4 A;  5HNF A;  2EIK H;  4HG2 A;  2WB1 A;  3L9F A;  2GOM A;  4UV9 A;  1G3Y A;  3CJQ B;  2FBK A;  1G4D A;  3RKX A;  2EV0 A;  1VQM I;  1XMA A;  3F23 A;  3C3W A;  4UXN A;  3VSL A;  4I98 B;  1UFM A;  4FQG A;  2M87 A;  4EV0 A;  3RZD J;  1SAU A;  3S1N J;  2VXD A;  1WJB A;  3IKV A;  4Y4R A;  2PFB A;  4DYC A;  2F5V A;  2P8T A;  2W7N A;  3P9C A;  4HRI A;  4F92 B;  4PJM A;  3JSO A;  3COA C;  4EAT A;  5FRM A;  2CG4 A;  1T56 A;  4ESJ A;  1RUO A;  5BPI A;  2AXL A;  2NVY J;  2TDX A;  3RQI A;  3JTH A;  3ZMZ A;  3GF2 A;  1MZB A;  1ERD A;  2E19 A;  4M3B A;  5C4X J;  1ETX A;  2BV6 A;  2PQ8 A;  1JT0 A;  3QOD A;  1ZG3 A;  2G9W A;  3ZMT A;  2K9S A;  1AKH A;  2Z1D A;  3FXU A;  1DPR A;  1PJR A;  3K7A J;  2G0E A;  3HTS B;  3EQL F;  3HIF A;  3H35 A;  4ZZD A;  3QPT A;  1SAX A;  4ASN A;  5CQG A;  4F55 A;  1PDN C;  5D4R A;  2E60 A;  3HPH A;  1QGP A;  1CQT A;  4PFP A;  4IHT A;  1NG6 A;  2DAO A;  1YW7 A;  5L3D A;  2K27 A;  2L5Q A;  1IZ1 A;  2ZXI A;  2G7H A;  1QPI A;  4KIF A;  5H2F C;  2DJN A;  3KYC B;  1JJ6 C;  1GHC A;  1TC3 C;  3GLX A;  1U2W A;  3PO2 J;  3BZC A;  2ZFU A;  5E1W A;  5TIS C;  3S3N A;  4CYC A;  5LRS A;  3HUG A;  3E6C C;  2LRE A;  5K5O A;  4M3D A;  5D6E A;  2ECC A;  4PUS A;  2WAE A;  2XPV A;  3WTT C;  3D5S C;  1GV5 A;  2R7Z J;  1X58 A;  2PEX A;  4Y3O A;  3DCF A;  2G7U A;  2VJJ A;  3ZR8 X;  1X1B A;  1DPU A;  2OZU A;  5E79 C;  1IRX A;  5HOD A;  1G6N A;  2A3S A;  2LVS A;  5DV5 A;  3OIQ A;  4C9Y A;  4CCN A;  2V26 A;  4PZJ A;  3WTZ A;  2NRA C;  1IV8 A;  4ZDP A;  2NOJ B;  3G1M A;  4JQF A;  4RB3 C;  4P55 A;  4HNV A;  4XN0 A;  3LSH A;  1UST A;  3CC2 I;  1YQA A;  2X51 A;  2GM4 A;  2UUZ A;  1OLT A;  3ASN H;  5FD6 A;  1Z91 A;  5FRN A;  1XGO A;  1TQI A;  2HZD A;  2LR8 A;  3IH2 A;  2PMZ A;  2DMQ A;  2MSY A;  4LOC A;  5KHD A;  3HJE A;  2N8G A;  3E7L A;  1VFC A;  3DP7 A;  3LFK A;  2DK5 A;  3S2W A;  2RN7 A;  2XC7 A;  1IDZ A;  4LG0 B;  3WTU C;  2ISZ A;  1XTA A;  2EZH A;  3EYY A;  3EET A;  4WXD A;  3M8E A;  3GWZ A;  3CCV I;  3H9J A;  1WRJ A;  1MSE C;  2GXG A;  4BYY A;  1VQ5 I;  3I56 I;  3QQA A;  4RBO A; 
#chains in the Genus database with same CATH homology
 2LKP A;  3I5U A;  2DTR A;  3PQJ A;  5ILS A;  3TO9 A;  3LAJ A;  2IP2 A;  3E5X A;  1FX7 A;  1QPM A;  3LST A;  3PFI A;  4P96 A;  2F5D A;  3AAF A;  1YS7 A;  4L9T A;  4U7D A;  1TW3 A;  1XGM A;  4LMY A;  1JE8 A;  1I6X A;  2HOE A;  2XAH A;  4KUM A;  3GZ6 A;  5FLX Z;  4L18 B;  5DCM A;  4XSX F;  5FGM A;  3KLN A;  1IRF A;  1JXS A;  1HQC A;  1D8J A;  3REO A;  1DDN A;  2OBP A;  1IXC A;  4EM0 B;  5BQT A;  3GFL A;  3LAP A;  3OV8 A;  4KN7 X;  1FP2 A;  2YSR A;  3QRF F;  2A6E F;  4I09 A;  2ZKZ A;  2V1U A;  3QAH A;  2PMH A;  2HTS A;  2DPU A;  3F6O A;  3ZN1 A;  2E7W A;  4A2U A;  3R6S A;  2VE9 A;  2UWM A;  4YFK F;  1OYW A;  2Y0M A;  4BHC A;  2FMY A;  2LSO A;  2JT1 A;  3WTW C;  4RB0 A;  4G7O F;  3VEP A;  1L3L A;  2P7C B;  3SFZ A;  4LK0 F;  3T1B A;  5HLH A;  1U3E M;  1TNT A;  1FYK A;  4HW0 A;  2CGP A;  3BPX A;  4F7Z A;  3E5Q A;  5E8G A;  1U78 A;  3NRV A;  3T8R A;  4ZH4 F;  2HYF A;  1SFE A;  5HDK A;  1ODD A;  1KU3 A;  3TQN A;  2K4J A;  3ECH A;  2XVC A;  3V7C A;  3V7R A;  2IVM A;  5DUI A;  4EJW A;  1T6S A;  3WU0 A;  1GXQ A;  3BJO A;  2M5W A;  4MHG A;  5CVV A;  1I27 A;  3DPL C;  3LWF A;  4R79 A;  1XMK A;  5D5V B;  1SD7 A;  2L4A A;  3C18 A;  3FWE A;  2ZJ2 A;  3HSR A;  5KVR A;  2F5C A;  1IAW A;  3W6K B;  3ZQ7 A;  3G3Z A;  2DT5 A;  3BRO A;  3GXO A;  3MZY A;  1O3T A;  3ZN0 A;  5JVT A;  2VC0 A;  5FD5 A;  4M6Y A;  4HAM A;  2CO5 A;  1S29 A;  5L3G A;  1B6A A;  2PJP A;  2FRH A;  3HRT A;  1D8K A;  3DF8 A;  4BQA A;  4O6J A;  2J5P A;  2HQN A;  2FBI A;  2MH9 A;  2EFQ A;  4I2O A;  4RAY A;  2OU2 A;  3P9I A;  1W7P D;  4BHB A;  3IHU A;  4BAY A;  5E1Z B;  2MD5 A;  4LB6 B;  5DD8 A;  1OYY A;  3J80 Z;  1IN8 A;  1FY7 A;  3CUQ B;  2GA1 A;  2QQB A;  3ZMS A;  1RZ4 A;  5DYM A;  3F8C A;  2YX4 A;  1IRG A;  1LQ1 A;  4A5M A;  3H3U A;  4PDK A;  1OKR A;  5K5R A;  2O61 A;  2X4H A;  5FLX K;  2LF7 A;  2EV6 A;  3F72 A;  2PMU A;  1IXR C;  2FEZ A;  1CGP A;  2QYO A;  1ONV A;  2CYY A;  1YIO A;  2Q2E A;  5D5W B;  4CHU A;  2Z3Y A;  4JK1 X;  4WK8 F;  4U0Y A;  3SZT A;  4HQM A;  4G7H F;  5E1X A;  5H6Q A;  1ZN2 A;  1V3F A;  5FB2 A;  1STZ A;  5DUK A;  4IXA A;  2BEO A;  2IRF G;  2XAS A;  2QBY A;  4KIB A;  2VOP A;  2D2W A;  5D4S A;  2KIU A;  2LNB A;  3BZ6 A;  1V4R A;  3FM3 A;  4AIH A;  2P7V B;  1YYV A;  1HW1 A;  1KYW A;  1O3S A;  4AIK A;  3TOA A;  1I1S A;  3RYR A;  1W7P A;  1RUN A;  5ICF A;  2PI0 A;  1UHW A;  3E6B A;  3O6B B;  5BS6 A;  4Q5S F;  1R22 A;  4Y17 A;  2IA0 A;  5J8F A;  1RIO H;  1BJA A;  4P5O A;  2BE5 F;  2L02 A;  2EWN A;  2L01 A;  2JRT A;  3FX3 A;  4KN4 X;  1YG2 A;  1B4A A;  1KU2 A;  1XSV A;  2HR3 A;  3LA2 A;  5JR3 A;  4XSZ F;  5DD4 A;  2Q8K A;  1ON2 A;  4JBA A;  2DW4 A;  4EJV A;  3WU1 B;  3FMQ A;  4N9H A;  1HST A;  4DNC A;  4UV8 A;  4EM2 A;  4M9X A;  1R58 A;  5CYV A;  1MJA A;  3G73 A;  1GXP A;  2STT A;  2Z9O A;  1U5T A;  2W85 A;  3ML6 A;  2H27 A;  4O3M A;  4RS8 A;  1QZY A;  3FM5 A;  3H92 A;  3N97 A;  3FF5 A;  4A5N A;  5L3C A;  3I4P A;  1S8N A;  2EV5 A;  2YR2 A;  1SD6 A;  1FYL A;  3GX4 X;  2A61 A;  1USS A;  2IT0 A;  2D45 A;  1G3T A;  4LJZ F;  5LGU A;  5E8I A;  1TQM A;  5HOO A;  3WGH A;  2XAJ A;  4A0X A;  4CIC A;  1FNN A;  3CTA A;  5BMZ A;  1G3W A;  1J2X A;  2EFW A;  1ON1 A;  3ROU A;  3VFZ A;  3J80 K;  1CF7 B;  1ULY A;  2FNP A;  2VT2 A;  3FXQ A;  4I01 A;  4UHT A;  5LLQ A;  3ULQ B;  5H6R A;  2H6B A;  4GO1 A;  1IN5 A;  4M71 A;  1FP1 D;  1Y0U A;  4HF2 A;  3I64 A;  2EA4 A;  4G6D A;  1AOY A;  3RIR A;  3I59 B;  4NB5 A;  4K2E A;  2NNN A;  2R7D A;  5HVQ C;  2PN6 A;  1OMI A;  4ZZL A;  5D8L B;  1IN7 A;  3T8T A;  2F5E A;  4PCQ A;  1QQI A;  2ACJ A;  5D6F A;  3Q9V A;  1U5T C;  1BN5 A;  2K7L A;  5JHU A;  1FLI A;  4P9U A;  1IN6 A;  2MLG A;  3KP2 A;  1WSU A;  1QBJ A;  5ED4 A;  2ELH A;  2NYX A;  5IT9 Z;  2FNA A;  2KKO A;  2A07 F;  3F6V A;  4WXH A;  3D0S A;  2CFX A;  2J5O A;  4HLY A;  3JSP A;  1SFX A;  5ILV A;  4I7H A;  4CGZ A;  5BPD A;  4R8H A;  3EYI A;  1S6L A;  1WI9 A;  2HKO A;  4B09 A;  2FML A;  2HYG D;  3WE3 A;  3ISP A;  4G6Q A;  4LG0 A;  2DFI A;  1R1U A;  3V8K A;  2DO7 A;  3FMS A;  4HA8 A;  5HLI A;  4I0B A;  1B1B A;  2FF4 A;  1O57 A;  2M30 A;  1BI3 A;  2UXX A;  3HSF A;  1FBQ A;  4HX7 A;  4BNC A;  2XAQ A;  3K2Z A;  3WE2 A;  2YPR A;  2MC3 A;  2VXZ A;  3CJN A;  4YFN F;  5LBQ A;  2ZO4 A;  2DK8 A;  3MQ0 A;  3LA7 A;  1QO0 D;  1U8R A;  1YO5 C;  1W4M A;  3P7N A;  1T98 A;  4CDG A;  4A0Z A;  4MTD A;  1SMY F;  2H94 A;  5FFZ A;  4CZZ A;  3R0A A;  1MJB A;  4QLC U;  1ZHF A;  3RKW A;  3ERE D;  2HWV A;  2FXA A;  4RGR A;  1EH8 A;  4L0Y B;  3HHH A;  1XCV A;  1LJ9 A;  5CVJ A;  2X0L A;  3SQN A;  1O7F A;  1BI0 A;  4HLX A;  5EEH A;  1XDU A;  1HSJ A;  3WGI A;  3M7G A;  2XAG A;  4M74 A;  1ZRC A;  3KZY A;  2EK5 A;  4I0A A;  5CVU A;  2XHK A;  2O6G E;  1KYZ A;  3V8L A;  2H6C A;  2MBF A;  1XGS A;  3ZMU A;  3KP3 A;  3GZ5 A;  4IF4 A;  4Q48 A;  5E18 F;  2Z33 A;  4LK1 F;  1MD0 A;  2ZCW A;  2ZNZ A;  2QZ8 A;  2HZT A;  4KMU X;  1XCB A;  4DQ2 A;  4Q4Z F;  1MJ9 A;  2CQK A;  2NAZ A;  4OOI A;  3FMR A;  4ETS A;  4KIC A;  2EFP A;  5LHI A;  1PP8 F;  1T38 A;  1MDM A;  2AS5 F;  1J0R A;  2DQL A;  5E20 A;  4IRG A;  4S05 A;  2PBI A;  2RV8 A;  2KJB A;  4HYE A;  2XV4 S;  2V6C A;  4Y15 A;  2HKX A;  3BY6 A;  1FC3 A;  1FBS A;  3GO5 A;  3O2P E;  1DP7 P;  5DCM B;  1HKS A;  5CVR A;  4P9F A;  3DFG A;  2VC1 A;  1YTY A;  1Z05 A;  2DQR A;  4ZYH A;  2KRF A;  4RGX A;  2ZFW A;  2CSO A;  1BI1 A;  1WQ2 A;  4WF2 A;  5LHG A;  3TKY A;  3FXR A;  3KZZ A;  2IA1 A;  4HBL A;  4CYD A;  2NNY A;  4D0P A;  2F5F A;  1OR7 A;  1VTN C;  1XD7 A;  2P5V A;  2JPC A;  4TV7 A;  2H09 A;  2NS0 A;  2A68 F;  2VBZ A;  2RNJ A;  5CJ9 A;  4MQ9 F;  3IWF A;  1T39 A;  3BP8 A;  4GCV A;  3CLO A;  1WKM A;  4CO8 A;  4ENJ A;  2OZ6 A;  3F21 A;  1LEA A;  3GW2 A;  1KA8 A;  5LEJ A;  1FOK A;  2BYV E;  4LFU A;  3T0Y A;  5LHH A;  2M8E A;  4LGW A;  3BDD A;  2JTV A;  1BIA A;  2QEN A;  2VON A;  2WTE A;  1BIB A;  2Z5U A;  1AWC A;  3R4K A;  4E70 A;  2E1C A;  2FA5 A;  3I58 A;  2QLZ A;  2VBX A;  2IJL A;  1ZRE A;  5F1R A;  3F22 A;  5J8C A;  2DBB A;  4HX8 A;  4R1H A;  4IPA A;  2QQA A;  3JAM Z;  4HZF A;  1ZLK A;  2V1D A;  2E1N A;  2HGC A;  3FHZ A;  2W25 A;  3O3K A;  3KCC A;  1S3J A;  2GA2 A;  3BJ6 A;  2BGC A;  3WG9 A;  3NEU A;  1HKT A;  3H3Z A;  3BOQ A;  1FPQ A;  1LEB A;  4XBF A;  3MZH A;  3Q5F A;  1RNL A;  2MA3 A;  4U88 A;  4ESB A;  4NHJ A;  1J7K A;  2EB7 A;  4OU0 A;  4I02 A;  1O7L A;  2DI3 A;  5AIP A;  3J81 Z;  1EV7 A;  1HBX G;  1UHM A;  1L0O C;  2STW A;  2ETH A;  2ZME B;  4AWX B;  2GAU A;  1ZAO A;  1OYI A;  3WTX C;  3GVA A;  3B02 A;  3HHG A;  1KQ0 A;  4IRH A;  5L3B A;  1K78 B;  3CUO A;  2KIM A;  3MEX A;  3KLO A;  4WWC A;  5ICG A;  4A6D A;  4KDP A;  2OQG A;  3R60 A;  3TDU C;  3M9A A;  3TDZ C;  1ZRD A;  2ZBK A;  4PGH A;  1BBY A;  4OMZ A;  3KFW X;  3F3X A;  1LVA A;  3KEO A;  5F6F A;  3DV8 A;  5EEG A;  2K4B A;  2MH2 A;  2QM3 A;  1P2F A;  3ECO A;  4OIQ F;  3KP4 A;  1YS6 A;  2GXB A;  2HEO A;  1XDS A;  4MEX F;  1YW9 A;  4YIF A;  3SZP A;  1S7O A;  1LB2 A;  1H9T A;  4OIN F;  2QBY B;  2PLY A;  2O8X A;  3B73 A;  4G94 A;  3WTS C;  4GYG A;  4IJA A;  4KA4 A;  5BOX A;  2F2E A;  1YW8 A;  5IT3 A;  2QQ9 A;  4ENN A;  1WWX A;  3WOD F;  2DPD A;  2VOD A;  4KMF A;  5FFX A;  2HFH A;  3L00 A;  4UNO A;  1MKM A;  1W7P B;  4IVN A;  5LRR A;  2W84 A;  2VBW A;  1BC8 C;  1Z9C A;  3RPU A;  4ZYG A;  4WX9 A;  4HV6 A;  4EJT A;  1KQ8 A;  2YX7 A;  3LA3 A;  1U6G A;  3QOP A;  4KIG A;  4EJO A;  2LDU A;  4M9S A;  3MWM A;  3I71 A;  4Q47 A;  5LEK A;  4HF0 A;  1R5H A;  3W6J B;  1I1G A;  4N9I A;  4UVA A;  3VB2 A;  5DDG A;  2GIV A;  4B8X A;  3DEU A;  5E17 F;  5HDG A;  3EUH A;  4L5J A;  1F9N A;  2RVC A;  4BHP A;  1U5T B;  4RAZ A;  4U0W A;  2HS5 A;  3MAJ A;  5HS7 A;  4CXF A;  3F8M A;  3K9T A;  3BWG A;  1EH7 A;  1IXS B;  3K1N A;  1F1Z A;  1J9I A;  2JZY A;  3K1P A;  4EVI A;  4YII A;  2HQR A;  1DUX C;  3VOE A;  2E7X A;  3F8N A;  3J81 K;  5F64 A;  3HOT A;  4RB1 A;  1B59 A;  3V4G A;  3K1M A;  5AIQ A;  2CWE A;  1B9M A;  1IN4 A;  5D8K B;  1F5T A;  5ICE A;  2ISY A;  3ZMV A;  4QWQ A;  3WGG A;  2FSW A;  2OQR A;  3SXY A;  4L0Z B;  3E3V A;  3U9G A;  3QPH A;  1FBU A;  4FX0 A;  3TGN A;  2KIF A;  2UXN A;  5A2Q Z;  1TQP A;  1SMT A;  2VN2 A;  4HQE A;  4M72 A;  2O3F A;  1LDD A;  1MGT A;  4FX4 A;  4HX4 A;  2HTJ A;  1KU9 A;  4KT5 C;  2P6S A;  2QWW A;  3E6D A;  3HSE A;  2VT3 A;  1P4W A;  3QU3 A;  1IF1 A;  1FSH A;  2XKP A;  3K69 A;  1K7A A;  1F4K A;  4MTE A;  4FHT A;  2XKO A;  2GZW A;  2W57 A;  2UZK A;  5ILU A;  1R1T A;  3KP6 A;  1J59 A;  2O03 A;  3QP6 A;  6PAX A;  3HRM A;  1R23 A;  4EQQ A;  1E17 A;  2A6H F;  2K86 A;  3L2C A;  4ENK A;  4L9V A;  3TO7 A;  2XUB A;  3ZMD A;  3PQK A;  2XRO A;  4XLP F;  4OIO F;  3LQQ A;  1BOA A;  4RGS A;  1H9G A;  1W5S A;  4M9Z A;  4LB5 A;  1NHA A;  2CW0 F;  1D5V A;  1J75 A;  1P6R A;  2XGX A;  2V79 A;  2DLL A;  1T2K A;  5HS9 A;  4H0E A;  1G3S A;  4HF1 A;  4GGG A;  4LLL A;  3KE2 A;  4AIJ A;  3D5L A;  1ZLJ A;  3Q9S A;  2V9V A;  3V8J A;  1HKQ A;  2XAF A;  1XSD A;  1B9N A;  5L3E A;  1REP C;  4L5I A;  1R00 A;  4XLN F;  1I5Z A;  1QZZ A;  4HV5 A;  4EM1 A;  1K6O A;  1C0W A;  1HW2 A;  1SD5 A;  2FBH A;  1R7J A;  2BBY A;  1JHH A;  4KFC A;  2JSC A;  1TBX A;  3RDI A;  2Y48 A;  3KP5 A;  4O5V A;  3K0L A;  3R0J A;  2PG4 A;  2A5Y B;  3RPQ A;  2Y75 A;  1FZP B;  2HDC A;  3DXJ F;  4Z2Y A;  2D1H A;  4AD9 A;  1SD4 A;  3NQO A;  2EFO A;  2RQP A;  1T0F A;  4IHS A;  3DKW A;  3I54 A;  3ELK A;  3RKY A;  4OIP F;  4KYW A;  4BH9 A;  3JTG A;  1UB9 A;  1ZGA A;  5A2Q K;  2FOK A;  5K5Q A;  4M6X A;  5D5X B;  4L9N A;  4Y13 A;  4ENM A;  1E2X A;  1BI2 A;  1FSE A;  4OIR F;  5IT9 K;  3N4M A;  3CDH A;  3HRS A;  4BXU A;  2K02 A;  1GVJ A;  1ZH5 A;  3E6M A;  3I0T A;  4YG2 F;  1Z6T A;  2RGV A;  3EDP A;  4AVP A;  3ABT A;  3GFJ A;  1H0M A;  4MNU A;  1FYM A;  4MGR A;  1JGS A;  1XGN A;  1D3Y A;  1MDM B;  5HLG A;  1SFU A;  1P4A A;  5HS8 A;  2P4W A;  3QU6 A;  5ERI A;  4G7Z F;  1Z7U A;  3IRR A;  2IW5 A;  2ZNY A;  5CVI A;  4A0Y A;  2FQ3 A;  4UUV A;  2M1B A;  5HDN A;  4HOB A;  2FU4 A;  2XIG A;  3M1E A;  1J5Y A;  1O3R A;  3RI4 A;  3P9K A;  2COM A;  1EH6 A;  3GFI A;  2O0Y A;  3CUQ A;  5JI6 A;  1RI7 A;  4ESF A;  2Z99 A;  3GEZ A;  4EGY A;  1FWZ A;  5KK1 A;  4RB2 C;  1BM9 A;  2A69 F;  2B0L A;  4S04 A;  3IKT A;  3VOD A;  2OD5 A;  5DEQ A;  4RGU A;  4EJU A;  3SHF A;  1XSX A;  4GYI A;  2WV0 A;  4XRF A;  2EA2 A;  5K1Y A;  1IW7 F;  3GFM A;  4EGZ A;  2ZME A;  5AON A;  2R3S A;  1KU7 A;  1XN7 A;  5H20 A;  2QVO A;  3BJA A;  1TNS A;  2KJC A;  4L9J A;  1K78 A;  1KGS A;  4MEY F;  3F8B A;  1R36 A;  4ZYD A;  4UVB A;  3FZV A;  2IA2 A;  2XRN A;  2RC4 A;  4U7B A;  1YLF A;  2EFN A;  3CO7 C;  1ZGJ A;  2V1X A;  1LDJ A;  4ON0 A;  1Z1D A;  4WCG A;  2YU3 A;  3RYP A;  3RJP A;  2LF8 A;  2R7F A;  3QP5 A;  1IUY A;  2OAZ A;  3IL2 A;  2L3D A;  3R61 A;  1W5T A;  2P5L C;  2RDP A;  1OPC A;  3T5X A;  3E97 A;  2L4M A;  3IRQ A;  1Z6R A;  1ZAR A;  3IWZ A;  3V7S A;  4OMY A;  1O3Q A;  4ZYE A;  4HDV A;  2C6Y A;  3CUQ C;  1KQ9 A;  1A04 A;  3GYH X;  3DQV C;  1TLH B;  5ICC A;  2VBY A;  4KNY A;  3F8F A;  2GWR A;  5CLS A;  1LNW A;  4N0B A;  1Q1H A;  3MCZ A;  1TW2 A;  1UCR A;  2Q0O A;  2ADU A;  4FT8 A;  3E5U A;  1HXD A;  2P5K A;  2D1V A;  4IRI A;  1R1V A;  4HDU A;  2M45 A;  3JW4 A;  4M73 A;  4GXO A;  2JPB A;  3MFK A;  3HYI A;  1P92 A;  5DCF A;  1PP7 U;  2OA4 A;  3I53 A;  2ESH A;  4YFX F;  1JHF A;  4G9Y A;  2VOO A;  2WWY A;  2ZXJ A;  4EMS A;  4U0V A;  5TJJ A;  1TTY A;  3KET A;  3BPV A;  2GQQ A;  3OOP A;  1CF7 A;  4A6E A;  5JFR A;  2L54 A;  3WTV C;  3HRU A;  2RKH A;  3ABU A;  5FO5 A;  5J6X A;  2ESN A;  1S7A A;  3IC7 A;  3WTY C;  3HOS A;  5LGT A;  3I59 A;  2IPQ X;  3L09 A;  3L7W A;  3ZPL A;  3HTU A;  2FE3 A;  1YFH A;  3JAM K;  5TRD A;  4LD5 A;  1R5G A;  3U1D A;  1ZRF A;  2EJR A;  3KP7 A;  3DPT A;  1ZG5 A;  3CO6 C;  4UVC A;  1ZG1 A;  4A12 A;  1BC7 C;  3J7A O;  4PGG A;  3TOB A;  5L3F A;  4WXC A;  4MQV A;  3TO6 A;  4LLN A;  1HW5 A;  2VE8 A;  3U2R A;  4NQW A;  2W24 A;  2MLK A;  1PUE E;  3LQR A;  3KEQ A;  1QNT A;  1ZYR F;  1FT9 A;  4LLG F;  2WC2 A;  2P6T A;  2DU9 A;  3ZP5 A;  5D5U B;  1K79 A;  5LGN A;  3C7J A;  3RTR A;  1P4X A;  2QUF A;  3M8F A;  3C1D A;  3GUD A;  4G8X A;  1LDK B;  1X3U A;  1XB4 A;  3L9F A;  4UV9 A;  1G3Y A;  2FBK A;  1G4D A;  3RKX A;  2EV0 A;  1XMA A;  3F23 A;  3C3W A;  4UXN A;  4I98 B;  1UFM A;  2M87 A;  4EV0 A;  3IKV A;  2PFB A;  2P8T A;  3P9C A;  3JSO A;  3COA C;  2CG4 A;  4ESJ A;  1RUO A;  5BPI A;  2AXL A;  2TDX A;  3JTH A;  3ZMZ A;  3GF2 A;  1MZB A;  2PQ8 A;  2BV6 A;  1ZG3 A;  2G9W A;  3ZMT A;  3FXU A;  1DPR A;  3HTS B;  3EQL F;  3HIF A;  4ZZD A;  3QPT A;  1SAX A;  4ASN A;  1PDN C;  5D4R A;  1QGP A;  4IHT A;  2DAO A;  1YW7 A;  5L3D A;  2K27 A;  1IZ1 A;  2G7H A;  4KIF A;  1GHC A;  3GLX A;  1U2W A;  5E1W A;  5LRS A;  3HUG A;  3E6C C;  5K5O A;  5D6E A;  3WTT C;  2PEX A;  2G7U A;  1DPU A;  2OZU A;  1G6N A;  2A3S A;  5DV5 A;  4PZJ A;  3WTZ A;  2NRA C;  4JQF A;  4RB3 C;  4P55 A;  1UST A;  1YQA A;  5FD6 A;  1Z91 A;  1XGO A;  1TQI A;  3DP7 A;  3LFK A;  2DK5 A;  3S2W A;  2RN7 A;  4LG0 B;  3WTU C;  2ISZ A;  3EYY A;  3EET A;  4WXD A;  3M8E A;  3GWZ A;  1WRJ A;  2GXG A;  4BYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...