3TDZC

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-stapled acetylated ubc12n complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
SNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DCN1-like protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 27
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tdzC00
1XDUA 1O3TA 5J8CA 2XASA 3M9AA 3DPTA 2F5EA 3ZN0A 2J5OA 1UHMA 3JSOA 2GAUA 4XRFA 4HLYA 2Q8KA 3WGIA 2RKHA 4UUVA 1OYWA 1V4RA 1TQIA 2FSWA 2FF4A 4Y13A 2K02A 4U88A 2FEZA 3IKVA 2OZUA 1T2KA 1ZGAA 1CF7A 2IVMA 5AIPA 4G9YA 2CFXA 3MCZA 3HYIA 3FWEA 5EEHA 1KYZA 1OR7A 3F8BA 5K1YA 2E1CA 4MQVA 2OBPA 2ACJA 3N97A 1YIOA 2EFQA 4I02A 4BXUA 4ZYGA 2RDPA 3EDPA 3HUGA 3TDUC 1SD6A 1MJAA 1XD7A 3L9FA 2IJLA 1TNSA 4OIQF 2Y48A 2YSRA 5F6FA 2STWA 2DU9A 2L02A 2PG4A 4I0BA 2F5CA 2LKPA 1LB2A 1R5HA 4KUMA 3VOEA 2JZYA 3ZMVA 1KQ0A 2VE9A 3V7CA 2K7LA 3GZ5A 1TBXA 3ERED 2R7FA 2ZO4A 4A0YA 1IAWA 4CYDA 3ZPLA 2H27A 5ILSA 2DK5A 4F7ZA 3E5QA 2BYVE 5EEGA 1BM9A 4LLGF 1ZGJA 3J80K 1P6RA 2UXNA 1A04A 3BROA 5H6QA 2V6CA 3LWFA 4OMYA 3QP6A 4OIOF 1MJ9A 2HQNA 3K1MA 4GCVA 5DYMA 4BHPA 4AIKA 2KJCA 1OMIA 1R1UA 3P7NA 2KJBA 4GXOA 2P5LC 2H09A 2P6TA 1XN7A 1IRFA 2OQRA 1B9MA 3LQRA 5D5WB 3BOQA 3QOPA 5E1WA 5E8IA 1BN5A 5D4SA 1FX7A 4A2UA 1TNTA 3TO9A 1HXDA 4JBAA 4L9TA 3MWMA 1Y0UA 3SFZA 3EYYA 5K5OA 1HSTA 2V9VA 2GZWA 3ULQB 1IXRC 1U8RA 2K27A 1UCRA 1MKMA 4ON0A 4EMSA 4EJVA 5LHGA 3C7JA 2RVCA 3O3KA 1XSXA 2CQKA 1RNLA 3R0JA 5FFXA 1R23A 5TRDA 1TLHB 3BP8A 4WCGA 1GXQA 5FD6A 4IPAA 2A6HF 4FHTA 1HSJA 1J75A 4MGRA 4ENJA 4U7BA 2QQBA 1Z9CA 1XGOA 2OA4A 3RIRA 4LLNA 3QPTA 4PGGA 5LGTA 5JHUA 3LA2A 4I2OA 1LDKB 1YO5C 2E7WA 2H94A 3RYPA 5DCFA 1I6XA 1FBSA 2ISZA 3Q5FA 2ESNA 2FBHA 3BZ6A 2BBYA 2UXXA 2W85A 1KU2A 3J80Z 1D5VA 1J0RA 3ZP5A 2FOKA 5FO5A 1RUNA 3JW4A 5ICGA 3HHHA 3KE2A 2M87A 3CUOA 2LF8A 1D8JA 2EA2A 3ZMSA 1DDNA 2AXLA 3MEXA 4LFUA 3TQNA 2CWEA 3F8NA 3MQ0A 4EGYA 4XLPF 4EJWA 4HDVA 2KIMA 1DUXC 1BC7C 5HDKA 2EJRA 1H9TA 3JAMK 1P4WA 4ENNA 3I59B 1SFUA 3GF2A 1QZYA 2B0LA 4ZYHA 3IRRA 4AVPA 5L3FA 4IHSA 2FU4A 3RPUA 3M1EA 1KYWA 1LJ9A 4ZH4F 1GVJA 4RS8A 1FBUA 2M1BA 3O6BB 1L3LA 4EM2A 1ULYA 2DI3A 4YIFA 2ESHA 4N9HA 4NHJA 5ED4A 5D6EA 3E5UA 4UVCA 4WK8F 3KP5A 1IN6A 1BIBA 5D5VB 1I5ZA 5DCMA 3T0YA 2KKOA 3GXOA 1F9NA 3GVAA 1O3QA 5FFZA 4CICA 2O03A 4BQAA 2FNPA 4G6DA 4EJTA 1YTYA 5H20A 5J8FA 1IUYA 2QVOA 3HRUA 1R1TA 2P5VA 4ESFA 3FXQA 2ETHA 1QBJA 1IRGA 2R7DA 4FT8A 2VBXA 1C0WA 4HLXA 3DXJF 3ML6A 4HQMA 4I09A 1K79A 5JVTA 3SZTA 1TQMA 1PUEE 4U7DA 3M7GA 1G6NA 2NS0A 4M6XA 4M9XA 4KA4A 4M73A 3K69A 3KCCA 3LSTA 1BI2A 1YW8A 1VTNC 2XRNA 2DBBA 5K5RA 4ESBA 2RNJA 3WTZA 2CO5A 4MTDA 3T8RA 4UXNA 3F6OA 1IXSB 1S6LA 3FX3A 4KMUX 4RGUA 1T98A 4CGZA 1MGTA 4KIBA 4KT5C 4HW0A 5DUKA 2IT0A 4Z2YA 3RTRA 3JAMZ 2V1DA 3SHFA 3TDZC 5ICFA 1GHCA 2HTSA 3N4MA 2ZMEB 1PP7U 2H6BA 4EJUA 4KYWA 5BS6A 4LGWA 3GLXA 4BHCA 3HHGA 5DEQA 2HZTA 1QNTA 1W7PA 3I54A 2D45A 3QRFF 1BC8C 2VN2A 2MC3A 4YFNF 1WI9A 2K4BA 5E1XA 5ICCA 2W84A 3MZHA 1IN7A 1K6OA 3ECHA 3ZQ7A 4HX7A 4MQ9F 2VOOA 1O3RA 2TDXA 2K4JA 2XROA 1KU3A 3T8TA 4YIIA 3KP4A 1FSEA 4LLLA 2P7VB 3CLOA 5CVUA 2QZ8A 1LVAA 2V79A 2IRFG 1LNWA 3KP6A 4HQEA 2J5PA 4ENMA 4R8HA 2LSOA 2DAOA 1ZH5A 1E2XA 2MH2A 1L0OC 3PQJA 1EV7A 4ENKA 4WX9A 4H0EA 4UV8A 4XLNF 2DW4A 1J5YA 4S05A 2PFBA 2IA1A 2MH9A 4OINF 1E17A 1NHAA 2HYFA 3IWFA 2G7HA 2D2WA 4OU0A 2VBWA 3P9KA 3CUQB 2HQRA 3IL2A 2EWNA 5LEKA 3JTGA 4JK1X 2PLYA 1HW1A 5JR3A 4Q47A 2D1VA 1QQIA 5ILUA 2L4MA 3D0SA 2HDCA 1JXSA 1FSHA 4BH9A 3L00A 1TW3A 1S3JA 3FMRA 3KLOA 3IHUA 3HTSB 1T6SA 3GYHX 3AAFA 3WGHA 1BI1A 4Q48A 3EYIA 2X4HA 4OOIA 4P96A 1D3YA 3F3XA 3F72A 1SD4A 2A69F 3DFGA 2IA0A 1ODDA 2WC2A 2LNBA 2C6YA 4IHTA 1WKMA 2DPDA 2XKOA 4RB0A 1O57A 6PAXA 1FBQA 2BEOA 1YW9A 1PP8F 3RKYA 5ICEA 3KEOA 4E70A 1FP1D 2L3DA 3DP7A 3EETA 3GUDA 2PQ8A 5E17F 5K5QA 3P9CA 2QLZA 2EB7A 4LMYA 2IA2A 5BMZA 1LDJA 1HQCA 4OIPF 1QGPA 3JTHA 5D5XB 3RKWA 1DP7P 4IJAA 2AS5F 4GYGA 2XAHA 4HAMA 1R58A 4PCQA 4HA8A 3FXRA 2CG4A 4I0AA 2HOEA 3F8MA 5A2QK 1B1BA 2HR3A 3RKXA 1U5TA 4ETSA 2KIFA 4XSXF 3EQLF 3BPXA 4UHTA 2XV4S 2QENA 5BPDA 4YFKF 1EH8A 2DK8A 2WWYA 3E6BA 2DFIA 4BHBA 3E6MA 2XAFA 3LA7A 3FMSA 1LDDA 2WV0A 3KP2A 1G3WA 2Q0OA 2EK5A 4LB6B 4FX0A 1K7AA 1ON1A 3QPHA 3QAHA 4IRHA 3W6JB 3ECOA 2ZKZA 3L7WA 1FYLA 2A61A 1U5TB 4KICA 5HVQC 2H6CA 2OAZA 5L3CA 2KIUA 2IP2A 1F5TA 2CGPA 3NRVA 1MD0A 3KP3A 4OMZA 1SD7A 3F21A 2BE5F 2XAQA 4CZZA 2Z99A 2RQPA 1K78B 3B73A 2MLGA 3GFLA 3V7RA 1P92A 5IT9K 1XDSA 3ABUA 4P9UA 4UVBA 2JSCA 3MZYA 5FB2A 1B59A 3ZMUA 3HTUA 1ZARA 2FMYA 4FX4A 1G4DA 2A07F 3QU3A 1IZ1A 1F1ZA 1ZYRF 1USTA 3K1NA 3V4GA 3TO7A 2GWRA 4P55A 5F64A 1XGSA 1P4XA 4WWCA 1FOKA 2MD5A 2GXBA 2X0LA 5DUIA 4Y15A 1YG2A 4GO1A 4KFCA 3F6VA 5DD8A 4WXHA 3Q9SA 3I59A 5E18F 2DPUA 1MDMB 5HDGA 5D4RA 3P9IA 4YG2F 1U6GA 2FXAA 1Q1HA 2HWVA 5A2QZ 1IN5A 4G7HF 4IRIA 2M8EA 3BJOA 4L0ZB 3J7AO 3R60A 2EFPA 2E7XA 2GXGA 2GIVA 4KN4X 1IN4A 1SD5A 1STZA 4TV7A 1BOAA 4IVNA 1ZREA 3VEPA 3WTVC 2V1UA 4CXFA 3GO5A 3O2PE 4CHUA 1Z05A 2Y75A 3WTXC 2ZNZA 4A6DA 3OOPA 1R7JA 2FBIA 2MA3A 3K9TA 5CVJA 1O3SA 1I1SA 2RV8A 4LD5A 5CVRA 4IXAA 2COMA 4RGSA 2YPRA 5ILVA 3DQVC 5BOXA 3WTUC 4M6YA 2UZKA 3V7SA 4CO8A 1MZBA 1SFXA 5IT9Z 2O0YA 1JGSA 1ZAOA 1AOYA 2W25A 5D8KB 2L4AA 3NQOA 1XSDA 3V8KA 3GZ6A 3FF5A 2ISYA 1BI0A 3BY6A 4KMFA 1CGPA 4NB5A 1KGSA 2QM3A 4I01A 3L09A 3G73A 1Z91A 3RYRA 3C1DA 3QU6A 2O3FA 5HOOA 3WODF 3GEZA 2QBYB 2FNAA 3SXYA 4RAYA 1XMKA 1HW2A 2ZMEA 5LRRA 5CYVA 3FMQA 1HKQA 4B8XA 1FYKA 5D6FA 4EGZA 2XHKA 3C18A 4A0ZA 2W57A 2UWMA 3GFMA 2V1XA 3DKWA 2ZXJA 4LJZF 4QWQA 1ZG3A 2XUBA 1XSVA 3VFZA 1WQ2A 4MEXF 1DPRA 1HW5A 3U9GA 3HIFA 1SMTA 2M30A 1T38A 1HBXG 3MAJA 2EA4A 4B09A 4G94A 2PBIA 3ZMTA 2YR2A 4RB1A 4PGHA 2XGXA 1XCVA 4M71A 3KEQA 1G3SA 2QWWA 5DDGA 5FGMA 4GGGA 2VC1A 3COAC 1ONVA 2A68F 3WU1B 4M9ZA 3HOSA 3HSFA 3K2ZA 1ZG5A 1HKTA 1IW7F 2CSOA 4O3MA 3M8EA 4UV9A 1SMYF 3WTTC 3WE3A 3B02A 4DQ2A 1S7OA 2XKPA 5L3DA 5LGNA 1HKSA 1ZLKA 2HGCA 4MHGA 2HTJA 2ZJ2A 3TO6A 2XAJA 4HBLA 2Z3YA 4ZYEA 2VOPA 5E8GA 4G7ZF 3CUQA 1B6AA 2Z5UA 2STTA 4EV0A 3FZVA 3LA3A 1B4AA 1BBYA 1QPMA 5E20A 4L5JA 4UVAA 2OD5A 3I64A 1FT9A 1U2WA 2DO7A 5KVRA 3GFIA 3S2WA 5LBQA 1ZG1A 1KU9A 3QP5A 2GA1A 4XBFA 2RC4A 1REPC 3ZMDA 4G7OF 4AWXB 3ZN1A 4KN7X 4MTEA 5H6RA 4WXCA 5AONA 1WSUA 1H0MA 3TGNA 3GWZA 1AWCA 2HS5A 4U0VA 5JFRA 3F22A 4CDGA 4N0BA 5HLHA 1FNNA 4QLCU 4G6QA 3RI4A 3E97A 1YW7A 2Z9OA 2ZCWA 1LQ1A 1TQPA 2FA5A 3H3ZA 3I53A 1QZZA 1J59A 1BIAA 2L01A 5L3BA 4L0YB 3CUQC 2P8TA 1T0FA 2LF7A 4M9SA 4HF1A 4R1HA 2BGCA 3HSEA 5IT3A 3WG9A 2WTEA 5L3GA 2ADUA 5LRSA 2VC0A 1U3EM 4ZZLA 1FLIA 2EV5A 3J81K 4HOBA 2BV6A 1P2FA 2EFWA 1ON2A 3I71A 2FRHA 4N9IA 4EJOA 4A6EA 2OZ6A 1D8KA 3FM3A 4AD9A 5LEJA 3R61A 4GYIA 4K2EA 3WE2A 4M74A 4PDKA 1CF7B 3T5XA 3BPVA 3LQQA 1GXPA 4M72A 5TJJA 2P4WA 4KNYA 3BDDA 3K1PA 5FD5A 4BAYA 1J2XA 4NQWA 1SAXA 2MLKA 1ZRFA 3LAJA 2XIGA 2PI0A 3GW2A 1OYIA 2QQ9A 4ASNA 2YU3A 2R3SA 2ELHA 1W5TA 2DQLA 1JHHA 1OPCA 4MNUA 1S8NA 2VONA 1F4KA 2DQRA 2PMHA 4ESJA 2DT5A 1I1GA 4U0YA 3CTAA 1UB9A 1MJBA 2VT3A 4BYYA 2P5KA 1S7AA 1FP2A 1R1VA 1EH7A 3K0LA 3DF8A 3ELKA 1RI7A 4LK0F 3HRSA 3R4KA 1ZLJA 1XCBA 2O8XA 1I27A 1FYMA 5LHIA 4RGRA 1K78A 1ZRDA 3BJAA 4G8XA 3ISPA 4IRGA 2YX4A 1WRJA 1ZN2A 3IRQA 3E3VA 1R36A 1XGNA 4RGXA 2EFOA 4AIHA 3I58A 3KLNA 5LGUA 4EQQA 3HOTA 2FE3A 1O7LA 1Z1DA 2GQQA 3EUHA 1TTYA 5DD4A 1OKRA 2XVCA 4U0WA 5J6XA 4Y17A 2G9WA 3F23A 2O61A 4L9JA 4L9VA 3ABTA 1R00A 2NAZA 2W24A 1W7PD 4WF2A 1U5TC 3J81Z 2ZFWA 4UNOA 1SFEA 3RPQA 3L2CA 2E1NA 1MDMA 4KDPA 3CO6C 4KIFA 4OIRF 3H92A 1B9NA 3I4PA 2O6GE 2L54A 2JRTA 4HX8A 5CJ9A 3HRMA 1BI3A 2CW0F 1ZHFA 1QO0D 1H9GA 2A3SA 1W4MA 4MEYF 2NYXA 1Z6RA 2NNYA 4Q4ZF 4HZFA 4HV5A 3TKYA 4DNCA 2RGVA 2P7CB 1YYVA 3WGGA 3H3UA 2OQGA 4D0PA 5HS9A 3CJNA 5LLQA 4RB2C 1ZRCA 4XSZF 3KETA 1XMAA 2ZBKA 1RUOA 1EH6A 4A5NA 2JPCA 1KQ9A 5E1ZB 4A0XA 4BNCA 3RJPA 4PZJA 4HDUA 2M5WA 3RDIA 1UHWA 5D8LB 2HYGD 3Q9VA 1J7KA 2VXZA 3G3ZA 2QYOA 4IF4A 1FY7A 2VE8A 2EV0A 3CDHA 2QUFA 3ROUA 4HF2A 3KZZA 1UFMA 4EVIA 3KZYA 3U2RA 3E5XA 4ZZDA 1Z6TA 3DPLC 1KA8A 3U1DA 2PMUA 1S29A 1FC3A 1P4AA 1JHFA 3REOA 5HDNA 3FM5A 3E6CC 2CYYA 1T39A 3T1BA 2JPBA 2Y0MA 1XB4A 2Q2EA 1BJAA 2DTRA 5D5UB 1J9IA 5CLSA 1FWZA 2HFHA 2PN6A 5HS8A 2QBYA 3KFWX 1IF1A 3MFKA 2HKOA 2F5DA 3BJ6A 1X3UA 2M45A 3I0TA 4P5OA 1YLFA 1FZPB 4LG0A 4AIJA 5JI6A 4YFXF 1U78A 3PQKA 2RN7A 2VBYA 5CVIA 2QQAA 4L9NA 4KIGA 2P6SA 3VB2A 2FQ3A 2KRFA 2MBFA 2PEXA 2XAGA 5FLXK 1KQ8A 3GX4X 1W5SA 2GA2A 3SZPA 2FBKA 4JQFA 2VBZA 3LAPA 5DCMB 2LDUA 4ZYDA 4WXDA 4LG0B 2EFNA 2DLLA 5F1RA 2F2EA 1R22A 2VT2A 3TOBA 3CO7C 1RZ4A 3FHZA 3F8FA 1R5GA 3R6SA 4EM1A 1V3FA 2A6EF 1Z7UA 2G7UA 3LFKA 3M8FA 1LEAA 2HEOA 4S04A 2F5FA 5DV5A 3IC7A 1XGMA 3GFJA 3WTSC 4LK1F 3NEUA 4HYEA 4P9FA 2D1HA 2IPQX 3DEUA 1FPQA 1G3TA 3WTWC 5HS7A 3WU0A 1O7FA 3KP7A 3C3WA 2EV6A 1LEBA 1PDNC 2NNNA 2YX7A 3V8JA 4HF0A 2OU2A 2VODA 3E6DA 2PJPA 1YS7A 2ZNYA 3I5UA 4A5MA 3BWGA 4R79A 4LB5A 2K86A 3IKTA 2FMLA 3OV8A 4A12A 4HV6A 1YFHA 1OYYA 3ZMZA 3R0AA 1IXCA 5AIQA 5L3EA 5ERIA 2IW5A 4I7HA 5HLIA 2HKXA 1YQAA 4I98B 3HRTA 3SQNA 4Q5SF 5KK1A 1JE8A 3VODA 2NRAC 3PFIA 5LHHA 3TOAA 1DPUA 3FXUA 1TW2A 4O6JA 2A5YB 3HSRA 1W7PB 4EM0B 3JSPA 4O5VA 5BQTA 3WTYC 3DV8A 5CVVA 5BPIA 5FLXZ 1IN8A 4RAZA 3D5LA 1YS6A 3F8CA 2JT1A 1USSA 4L5IA 1G3YA 3IWZA 1RIOH 2JTVA 4RB3C 2Z33A 3V8LA 4L18B 4HX4A 3W6KB 1KU7A 1WWXA 5HLGA
chains in the Genus database with same CATH superfamily
1HA8A 1XDUA 4PJJA 1U0JA 5J8CA 1O3TA 2XASA 3M9AA 3DPTA 2F5EA 3ZN0A 2J5OA 2O9LA 3S1RJ 1UHMA 4Y33A 3JSOA 4BE1A 2GAUA 3CQZJ 4XRFA 4FTHA 3OIPA 2Q8KA 4HLYA 5IY5H 2KIQA 2A6TA 5FRNA 3EUAA 1F43A 3WGIA 2VQCA 1IGNA 2RKHA 4CCOA 4UUVA 4QIWN 1OYWA 4Y4RA 3ABMH 2XPWA 1YIJI 1V4RA 4XN0A 1TQIA 4IHVA 2FSWA 2FF4A 2OUMA 4Y13A 2K02A 4U88A 2FEZA 3IKVA 2OZUA 5EG0A 1T2KA 1ZGAA 1CF7A 2IVMA 1VI0A 5AIPA 4G9YA 3BCBA 3L2VA 2CFXA 3MCZA 3HYIA 4B47A 4DYRA 2W82A 3FWEA 1U9OA 3BQYA 4EEFG 4DZPA 5EEHA 3OYKA 1RETA 1KYZA 1OR7A 2CUZA 3F8BA 4Z6YA 2M9HA 4Y3OA 5CPRB 2R7ZJ 5K1YA 2E1CA 4MQVA 3A1YA 2OBPA 2ACJA 2LVSA 3N97A 1YIOA 2EFQA 4I02A 4BXUA 4ZYGA 2RDPA 2XB5A 4JOMA 5EZGA 3EDPA 4D5CA 3TEDA 3HUGA 3JRIA 3TDUC 1SD6A 4BQOA 1JKOC 1MJAA 2DYRH 4A3DJ 3BG5A 3O8GA 2BXYA 1XD7A 2O7OA 2WY7Q 3L9FA 3LSPA 2IJLA 1TNSA 3MKYB 4OIQF 2Y48A 2YSRA 2EQRA 5F6FA 2AQFA 2STWA 2DU9A 2L02A 4FQGA 2XC7A 2PG4A 4I0BA 2F5CA 1XG1A 2COBA 4W97A 1D5YA 2LKPA 3S16J 1LB2A 2P0WA 1R5HA 4KUMA 4D7NA 3VOEA 2JZYA 3FDYA 3ZMVA 1S72I 2N8GA 1KQ0A 2VE9A 3CJQB 3V7CA 2K7LA 3GZ5A 1TBXA 3ERED 2R7FA 2ZO4A 3JRFA 4A0YA 2XSJC 1IAWA 4CYDA 3ZPLA 3ZQHA 2H27A 2VLAA 3GTJJ 1YE9A 5ILSA 4I6ZA 5F04A 4A3LJ 1AA7A 1JTYA 3CLQA 1R4MB 1HCRA 2DK5A 2MD0A 4F7ZA 3MKWB 3K7AJ 3HUGB 3S3OA 3E5QA 1T8IA 2VQHA 3HC7A 2BYVE 5EEGA 4IOAF 1BM9A 5E3LA 4LLGF 2XB0X 2JA6J 1ZGJA 4BE0A 4D7MA 3WHCA 3C2GA 3J80K 3OYJA 1P6RA 2UXNA 1A04A 2M4KA 3BROA 5H6QA 2V6CA 2GBYA 3LWFA 2HXIA 1LPQA 3A4CA 4OMYA 3QP6A 4OIOF 3OS1A 1OR7C 3N05A 1MJ9A 2HQNA 3K1MA 4GCVA 3QYBA 5DYMA 4BHPA 3WU2C 2GOMA 4AIKA 2IEKA 3LSGA 3NAUA 2KJCA 3CC7I 1OMIA 3ZXSA 1R1UA 3P7NA 2KJBA 4GXOA 3SZGA 3ZRGA 5GPCA 2P5LC 3LSKA 2H09A 2P6TA 1XN7A 4PUSA 3VYSB 1IRFA 5J40A 4MFEA 1H8AC 2OQRA 3ZQQA 3WHBA 1B9MA 3LQRA 5D5WB 3BOQA 3DBLB 4IOCF 1Y6IA 1WJ5A 3QOPA 5E1WA 4A3MJ 2P81A 1OCCH 5E8IA 1BN5A 5D4SA 5KHDA 3PIOF 3CCUI 1FX7A 4A2UA 1I39A 1TNTA 1HXDA 3TO9A 4JBAA 3LSHA 1JJ8C 4L9TA 2QCOA 3MWMA 2GOXB 1Y0UA 3I55I 3SFZA 2ELJA 3EYYA 5K5OA 1HSTA 2V9VA 3CMYA 2GZWA 3ULQB 1IXRC 1U8RA 2K27A 2YUSA 4AM3A 2L9SA 1UCRA 3S3NA 1J09A 1MKMA 2KT0A 3F0CA 4ON0A 3IAS2 4EMSA 1TT0A 4EJVA 5LHGA 2RQQA 3OYDA 3GMEA 3S93A 4RBOA 5FKMA 3Q3SA 1MBHA 2R0QC 3C7JA 2RVCA 3B6AA 1YX5A 5EGOA 3S32A 2CQ7A 3O3KA 1XSXA 2CQKA 1RNLA 3PNYA 3R0JA 5FFXA 1R23A 3ZQGA 3KEYA 5TRDA 1TLHB 5CQGA 3BP8A 3CCSI 2EZIA 5J4YA 1MIJA 4WCGA 1GXQA 1FOYA 4CCJA 5FD6A 4IPAA 1ZK8A 2ID3A 1IC8A 2ZSIB 2ZSHB 3KYCB 1DP3A 2A6HF 4FHTA 1BA5A 1HSJA 1J75A 4MGRA 2KMUA 4ENJA 3VWBA 4U7BA 2QQBA 1Z9CA 4HEA2 1XGOA 2OA4A 3RIRA 1N75A 4A3BJ 2WAEA 3SFIA 1B8IA 4LLNA 3QPTA 3RKQA 1ZGWA 2KRCA 4PGGA 2DXIA 4BY1J 4C9YA 5LGTA 3Q0UA 5JHUA 1UJ8A 1NG7A 3I56I 4B3XA 4BGDA 2B7EA 3LA2A 1GV2A 4I2OA 4GFBA 1LDKB 1YO5C 2E7WA 2H94A 3RYPA 3H9GA 5DCFA 3S1QJ 5J1UA 1O4XA 1I6XA 2BHYA 3AKZA 1FBSA 4DZJA 3Q5FA 2ESNA 2FBHA 3BZ6A 2VJIA 2GM4A 2ISZA 2NVXJ 2BBYA 2DMTA 2UXXA 2W85A 3EUHC 1RR8C 1VQ4I 4KT6A 1KU2A 3J80Z 2K9LA 4II3A 3GTGJ 4JP0A 1D5VA 2VPLA 1J0RA 3ZP5A 2FOKA 1N77A 1W5CC 5FO5A 1RUNA 2BW3B 3JW4A 5ICGA 3HHHA 3KE2A 3BR3A 3S2HJ 1DU6A 2M87A 5TISC 1WI3A 4B48A 1OCRH 1VQ6I 3CUOA 2LF8A 1D8JA 5IPAA 4CZCA 2EA2A 3MD2A 3ZMSA 4CSWA 1DDNA 2AXLA 3HGYA 3MEXA 4LFUA 3K4BA 3LMMA 4FASD 3TQNA 4YRVA 2CWEA 3F8NA 1FTZA 3MQ0A 4EGYA 3E7LA 4XLPF 2TRTA 4EJWA 4HDVA 1JJ6C 2DA3A 2KIMA 1GUUA 4BU2A 4NNJA 1DUXC 1BC7C 5HDKA 2EJRA 1H9TA 5F27A 2MW8A 3JAMK 1P4WA 4ENNA 3I59B 2H1KA 3DKXA 1SFUA 3GF2A 1QZYA 2B0LA 4FCYA 3JRDA 4AVZA 3HEFA 4ZYHA 2LKXA 3IRRA 2DDAA 4AVPA 2NVYJ 5L3FA 4IHSA 2FU4A 2X6OA 3RPUA 3IH3A 3M1EA 1KYWA 1LJ9A 3I9V2 2VIXA 4ZH4F 3S15J 1WJCA 1GVJA 4RS8A 1W36D 1FBUA 5IP6A 2M1BA 3O6BB 2JVGA 2WY8Q 1L3LA 5DM7F 2WAQN 4EM2A 1ULYA 4M3BA 2XSDC 4BACA 2DI3A 2IGKA 4YIFA 2ESHA 1LVKA 4N9HA 4NHJA 5ED4A 2OF7A 4KJZA 5D6EA 1XC5A 3E5UA 4ZDLA 1JI8A 1T33A 4UVCA 2F4IA 2OCCH 4WK8F 1SVLA 3KP5A 1IN6A 1BIBA 4AIDA 5D5VB 1I5ZA 3J7YJ 4UB6C 4CA0A 3MN2A 5DCMA 1AU7A 3T0YA 2KKOA 2M8GX 3GXOA 4I99C 4GDFA 3LSIA 3HOWJ 1F9NA 4YELA 4RM3A 1Y1VJ 4N4OB 3GVAA 1O3QA 3JCUC 1X19A 4RA2A 3GTQJ 5FFZA 4CICA 3MKLA 3WG7H 1VF9A 1XX5A 2O03A 4BQAA 2GIZA 2FNPA 4G6DA 4RM2A 4EJTA 1YTYA 5H20A 5J8FA 3SDGA 1FOXA 3HOXJ 1IUYA 2QVOA 1X1PA 2LTPA 1E3PA 2W4SA 1R1TA 3HRUA 4IHYA 2P5VA 2ZXHA 4ESFA 3I4MJ 3FXQA 2ETHA 1QBJA 1IRGA 2R7DA 2VKEA 2LYCA 2VQGA 4HNTA 4FT8A 2VBXA 1A31A 4DGWB 1C0WA 4HLXA 2DJIA 2BHZA 3DXJF 3ML6A 4HQMA 4I09A 3TMOA 2M34A 3ESWB 1K79A 5JVTA 2Y0SN 3SZTA 5C4JJ 1TQMA 1PUEE 2WAQA 3H9JA 3OSGA 3TP0A 4U7DA 3M7GA 2CS3A 4E7LA 1G6NA 4BJ5C 2NS0A 4E7HA 4M6XA 4M9XA 4KA4A 4M73A 3CC4I 1FOWA 2L9RA 2E1OA 3Q0WA 2PX9A 1MBJA 3K69A 2ZXIA 3OR2C 1UELB 3KCCA 2ME0A 3LSTA 1BI2A 2R92J 1G8XA 3AFHA 1YW8A 1VTNC 1ETOA 2XRNA 2DBBA 4U87A 4ESBA 5K5RA 3S1MJ 2RNJA 1HDDC 3ONQA 1ERDA 3WTZA 2AHQA 2CO5A 3OR1C 4MTDA 3T8RA 1EJ9A 4UXNA 1VQ5I 3F6OA 5GAHJ 1IXSB 1S6LA 4NC6A 3D1NI 3FX3A 4KMUX 2X1EA 3PSIA 1I3AA 5KCMA 4BBSJ 4RGUA 1MW7A 1T98A 4CGZA 1MGTA 3DLAA 2EZHA 3M8JA 4HW0A 4KIBA 4KT5C 1GT0C 1PVEA 1WFXA 4LIUA 5DUKA 2IT0A 3QWLA 3K4JA 4Z2YA 3M4OJ 3RTRA 3JAMZ 2V1DA 2LR8A 1OLTA 1MNMC 3SHFA 1VQMI 3TDZC 5ICFA 1GHCA 2HTSA 2BY3A 3FK7A 4KITB 3N4MA 2ZMEB 1PP7U 2H6BA 4EJUA 4KYWA 3ABKH 5BS6A 4XRSG 4LGWA 2WB1N 3GLXA 4V2FA 3ZQCA 2Y0SA 4BHCA 2IBDA 1WH7A 3HHGA 1WGXA 2DYSH 2CUEA 4E7IA 4NBQA 3QPLA 4IX7A 3FISA 2HDWA 2HI3A 2JWTA 3FXLA 3DBHB 5DEQA 1ZQ3P 3BTLA 2HZTA 1QNTA 1W7PA 3I54A 3O8HA 5J47A 4XRSA 1TWHJ 2D45A 3QRFF 1E3OC 2GLOA 3OYEA 1A6IA 3BZKA 2ZJPF 2LBFA 1BC8C 1Z3YA 1P7IA 2MC3A 2VN2A 1TWCJ 4YFNF 3W2AA 3KZIC 3D5SC 2BY0A 1LUJB 3QYEA 2X6WA 1WI9A 2K4BA 5E1XA 5ICCA 2W84A 1NK3P 3MZHA 1IN7A 2LLKA 1K6OA 3PL8A 1FIPA 1KZHA 3CCVI 3CCQI 1TWFJ 3ECHA 3ZQ7A 4HX7A 2FD5A 2F4MB 4MQ9F 1O3RA 2VOOA 1JKQC 3BC8A 1K83J 2TDXA 4BS9A 3CMAI 3C2BA 3OYAA 2WADA 2K4JA 2XROA 2CUJA 3OL3A 4P1WA 1KU3A 4B44A 3T8TA 4YIIA 3KP4A 1FSEA 4LLLA 2P7VB 2K9SA 2CQQA 3CLOA 2DA5A 1P7JA 2R7RA 1VNDA 5CVUA 2QZ8A 1LVAA 1I50J 2V79A 3BT9A 2IRFG 1LNWA 1M1EB 1IG7A 2MC4A 3KP6A 3DEWA 1SFKA 2J5PA 2LMDA 4HQEA 4ENMA 3LSRA 2DT6A 3J7AY 5GP9A 2WB1A 4R8HA 4E7SA 2LSOA 3DEEA 1DGRM 2DAOA 1ZH5A 4G6TB 3OOUA 1E2XA 1BJZA 2WV1A 2MH2A 1OQYA 2PJRA 2VXDA 1L0OC 3HM5A 3PQJA 1EV7A 3OS0A 4ENKA 3KYDB 4WX9A 4H0EA 1VQNI 4UV8A 3DWLE 4XLNF 4RLQA 3FXJA 2Y9YA 1R5ID 3A03A 4HNVA 2DW4A 1J5YA 3DPUA 3FK6A 3VYRB 2KZGA 1MMNA 2IA1A 2PFBA 3FHNA 2MH9A 4S05A 4OINF 1EF4A 1E17A 3BZCA 1NHAA 2K9QA 2HYFA 3IWFA 2JA5J 1Z0XA 4MO7A 2DMQA 3RSNA 2NOJB 2G7HA 2DMNA 2D2WA 4OU0A 2VBWA 3P9KA 3CUQB 3ASOH 2HQRA 4C2MJ 1OISA 3IL2A 4M3FA 2EWNA 5LEKA 3JTGA 2PJRB 2QSGX 4JK1X 5DS9A 3OY9A 2F5VA 3HB9A 3ERMA 3FIWA 3CCYA 3AL0C 2VL8A 2PLYA 1HW1A 5JR3A 1RKWA 4M3DA 4Q47A 2DOEA 2D1VA 5E3MA 3IH4A 1VZ0A 1X1DA 1QQIA 1ZKGA 2DTZA 2L4MA 1S7EA 3LFUA 3QQAA 2E5NA 5ILUA 4E7ZA 2HVRA 3D0SA 2HVQA 3VSKA 2HDCA 1JXSA 1TWAJ 1FSHA 1V5GA 4BH9A 1EKEA 3BR2A 3L00A 4ZYAA 1TW3A 1S3JA 3FMRA 3KLOA 2NS8A 3IHUA 3HTSB 4QPQA 1YJWI 1T6SA 3GYHX 1UG0A 3AAFA 3QPSA 3WGHA 1BI1A 3OYFA 4XLEA 2LRDA 2M4GA 4Q48A 3SYTA 3EYIA 1FEXA 2X4HA 4OOIA 4DYQA 4P96A 5K7HA 4CYCA 1D3YA 3F3XA 4E6KG 3PUFA 1QHHD 3F72A 2XGDA 1TP4A 1SD4A 3PO2J 2A69F 3DFGA 2IA0A 1LFUP 1ODDA 2WC2A 1A36A 2LNBA 2HZDA 2C6YA 2DJNA 2EIKH 3G1MA 2FUG2 4IHTA 3JRAA 1WKMA 4RAGA 2DPDA 2XKOA 4RB0A 4J01A 5EDNA 1O57A 2MG4A 4XKVA 2QKMB 6PAXA 1E0EA 2ZB9A 1FBQA 3OYHA 5LD2C 3H5NA 2ME6A 1MBKA 2BEOA 3ZR8X 3ZCOA 5C4XJ 1YW9A 2ZJQF 2KL4A 1PP8F 3RKYA 1BR1A 5ICEA 3CMMA 3KEOA 4E70A 1FP1D 3BR6A 2L3DA 3DP7A 1YRNB 3EETA 4Y52J 3GUDA 2MSYA 3LOCA 1DQUA 2RNGA 2PQ8A 5E17F 3BQZA 4CYCB 5K5QA 3P9CA 2QLZA 4CH7A 2LK2A 2EB7A 4LMYA 4LITA 2IA2A 4G12A 3OYLA 4QPOA 5BMZA 1DGWY 3DLLF 3EPZA 1LDJA 1HQCA 4OIPF 3U21A 2IS1A 2QA4I 1QGPA 3JTHA 3RKWA 5D5XB 1DP7P 5TGTA 4F92B 3VPRA 4IJAA 2AS5F 4GYGA 2XAHA 4HAMA 4XOPA 1R58A 1HOMA 4RDUA 4PCQA 4HA8A 3FXRA 2CG4A 3GTKJ 4I0AA 2HOEA 3F8MA 1GDTA 5A2QK 3PJRA 1B1BA 2HR3A 3IAM2 3RKXA 1U5TA 1RRJA 1QPIA 4ETSA 2KIFA 4XSXF 2LY1A 4XRMA 3EQLF 3RQ4A 3BPXA 4UHTA 2XV4S 2QENA 5BPDA 4YFKF 4NQWB 1EH8A 2DK8A 5GAGJ 2QF7A 2WWYA 3E6BA 2E2HJ 2DFIA 4NUBA 1BR2A 3ZQLA 1Y8RB 1QRYA 4LG3A 4BHBA 3E6MA 2XAFA 3LA7A 2LP0A 4XR6A 3FMSA 2DA1A 1K4TA 5GADJ 1LDDA 3ZQFA 2WV0A 3KP2A 1G3WA 2Q0OA 2EK5A 4LB6B 1Y56A 4FX0A 1K7AA 3FXKA 1ON1A 1BW6A 3NARA 3QPHA 4OWRB 2JVHA 3FBIB 3QAHA 4IRHA 3W6JB 3ECOA 1T08B 5M3MJ 3QODA 2ZKZA 3L7WA 4X0GA 1FYLA 2A61A 1G2HA 1U5TB 2E34A 4HNUA 4KISA 1HDPA 4BJ6C 4KICA 5HVQC 2H6CA 2EINH 4FE4A 2CUFA 4ZJZA 4ITVA 1YJNI 2OAZA 5L3CA 2KIUA 2IP2A 4XONA 2AXTC 2CU7A 1F5TA 3CZ6A 2CGPA 5FJ8J 2JJ7A 4BDZA 4MLOA 3NRVA 1MD0A 3KP3A 4OMZA 1SD7A 3F21A 2BE5F 1Z7LA 2DA6A 2XAQA 4CZZA 1JTXA 3NWTA 2Z99A 2M0CA 2RQPA 2OV7A 1K78B 3B73A 2MLGA 3GFLA 3V7RA 2HXOA 1SEUA 1P92A 5IT9K 1XDSA 5FRMA 3ABUA 2X1DA 4P9UA 4UVBA 1ITYA 3PO3J 4IEJA 2JSCA 4D5FA 4IKFA 1EA3A 2V9KA 3QOEA 3MZYA 5FB2A 5E3NA 1B59A 3ZMUA 3HTUA 3BG3A 2KDOA 1ZARA 3UKGA 2FMYA 4FX4A 1G4DA 2A07F 4CCLA 2QKLB 3QU3A 3BG6A 4W1UA 1IZ1A 3G4SI 1F1ZA 2BW3A 1ZYRF 1USTA 2X9DA 3K1NA 2VJ5A 4DBQA 1MBFA 3V4GA 3TO7A 2GWRA 4P55A 5F64A 4D1QA 1XGSA 2K85A 3JR9A 1P4XA 4XN3A 4WWCA 2EPFA 3PIPF 2R5ZB 1FOKA 2MD5A 2GXBA 2X0LA 5DUIA 4Y15A 3K4CA 1YG2A 4GO1A 4KFCA 1WPKA 3F6VA 3S14J 1Z3XA 5DD8A 4WXHA 3Q9SA 2IGNA 5JLWA 1R9TJ 3I59A 5E18F 1WZ2A 2DPUA 1RKTA 1A6QA 5HDGA 1MDMB 5D4RA 3SJMA 3CF5F 1MMDA 2DA2A 3P9IA 4YG2F 2VUMJ 2V1NA 4PFPA 1U6GA 2FXAA 5EEAA 5B1AH 1RC9A 4UY8I 2NXNB 2F6CA 1Q1HA 2E1MB 2HWVA 5A2QZ 1IN5A 1WHUA 4G7HF 3PUBA 1R4NB 4IRIA 1Z67A 5FLVA 2M8EA 2WAFA 3BJOA 3D5RC 4XLFA 3F9KA 5F1JA 4L0ZB 1X3WB 2WBMA 3J7AO 3R60A 2LH9A 3K4KA 2EFPA 2E7XA 2GXGA 2GIVA 2V26A 4XK4A 4KN4X 1Y8QB 1IN4A 3K6GA 2KDZA 4AYBN 1SD5A 3HDDA 4PJNA 1STZA 1FJLA 3BTIA 4TV7A 1BOAA 4IVNA 5GAEJ 2HYJA 1ZREA 3VEPA 5K7FA 3WTVC 2V1UA 1BW5A 4CXFA 1OFCX 2VI6A 4F3QA 1T95A 3GO5A 2L9VA 2VKDA 3O2PE 1VQ9I 2B9SA 1Z05A 4CHUA 4CCMA 2ID6A 3PNVA 1X3ZB 2Y75A 3WTXC 1VQPI 2R7XA 2ZNZA 3M1CA 4A6DA 3OOPA 1R7JA 2JA2A 2FBIA 2MA3A 4NC7A 2DODA 2H1LA 3K9TA 1A5JA 2X1CA 4PJ0C 5CVJA 3HGGA 2IS6A 4ZTFA 1O3SA 2YS9A 1I1SA 4AUXA 2RV8A 4LD5A 5CVRA 4IXAA 3H5AA 2COMA 4RGSA 1JKPC 4PFOA 3CESA 2YPRA 5ILVA 2CW8A 1ZR2A 3GTMJ 2JA8J 1IUFA 2BY2A 3BTCA 4F93B 5IYDJ 3DQVC 5GPAA 4XORA 5BOXA 2CV1A 1WJEA 3L2WA 5F0CA 2R5YA 3WTUC 4M6YA 4C2TA 2UZKA 3GBGA 1ZR4A 4XLCA 3V7SA 4CO8A 2RAEA 2MFZA 1MZBA 4BDYA 4DIQA 1SFXA 3HKZN 3OS2A 5IT9Z 4XL9A 2O0YA 4XKWA 4AYBA 1JGSA 1ZAOA 2LG4A 4PJMA 2H8WA 1AOYA 4IL6C 2W25A 5BNGA 3OYMA 4FE7A 5D8KB 3CJTB 4XLHA 4BUPA 2L4AA 3E0JB 3NQOA 2HPMA 1XSDA 3BR1A 3V8KA 3GZ6A 3FF5A 3FKIJ 2L7MP 2ISYA 5IYCJ 1IO2A 1BI0A 1ETXA 5FKNA 3BY6A 4J19A 2L7FP 5B66C 4KMFA 1CGPA 1FTTA 4NB5A 1KGSA 3JRCA 2QM3A 5F0FA 4LOCA 3K4NA 4I01A 3VSLA 3L09A 2Q2EB 1XPXA 3G73A 2VB6A 3LSJA 2EH3A 3UR3C 2R5YB 1Z91A 3RYRA 3C1DA 2BZTA 3QU6A 3RZDJ 2DDBA 2O3FA 4ZDPA 5HOOA 3WODF 2D5VA 3GEZA 2EZLA 2QBYB 2EBIA 2FNAA 4ANJA 3SXYA 5DTDA 4RAYA 1W0UA 1XMKA 1HW2A 3IH2A 3CMEI 1JUPA 2EIJH 2ZMEA 2V6EA 3JRGA 3LSMA 1DU0A 5LRRA 1IDZA 1LE8B 2HOAA 5CYVA 3H36A 1VQOI 1R49A 2HDDA 4DOZA 3FMQA 1HKQA 1QVUA 4B8XA 2Y30A 1FYKA 4H4KC 5D6FA 3HKZA 1NG6A 4EGZA 2G0EA 2XHKA 3C18A 2KFDA 3SDBA 2H8RA 4A0ZA 1UAAA 2W57A 2UWMA 3DTEA 3GFMA 3CD6I 2R7SA 2V1XA 3DKWA 2ZXJA 5E3OA 4LJZF 4QWQA 2BOLA 1ZG3A 3RZOJ 4A69C 3HBLA 3MMYB 1X4PA 4V2GA 2XUBA 1KONA 3MKZA 2Z2SB 3OYCA 3OWTA 1XSVA 4RMNA 3VFZA 1JGGA 1B72B 1WQ2A 4MEXF 1DPRA 2R7OA 2CQXA 3CCRI 1HW5A 3U9GA 2E19A 3HIFA 1SMTA 2M30A 1T38A 3VYUB 1BR4A 1SFOJ 1HBXG 2HPIA 3MAJA 2EA4A 2K40A 2XRLA 5EJCA 3VDXA 4G94A 4B09A 3S1NJ 2JA7J 1ETYA 1D1AA 2PBIA 2YR2A 3ZMTA 4RB1A 4CUGA 4PGHA 3P5JA 2MABA 5C3EJ 2XGXA 1XCVA 1SVOA 2CV0A 4M71A 3KEQA 1MBEA 2LOOA 3MZ8A 4V19K 1G3SA 2QWWA 2QEXI 5DDGA 2RREA 3CCJI 2I5UA 2M3AA 4IZZA 5FGMA 2OTJI 1V5FA 4GGGA 2VC1A 4S0HB 5J1YA 3COAC 3TL4X 1ONVA 2A68F 1X58A 2V4JC 3A02A 3WU1B 4PSXA 3CC2I 4M9ZA 4HSTA 3HOSA 3HSFA 3K2ZA 1ZG5A 4AC0A 5HNFA 5GTHC 2ZMEC 4D9JA 5E79C 1HKTA 1IW7F 2CSOA 4BQNA 4O3MA 4BEHB 2E2IJ 3M8EA 4UV9A 1SMYF 3WTTC 3WE3A 3B02A 4DQ2A 1S7OA 2XKPA 5L3DA 3UNGC 5LGNA 3S3MA 2R7TA 1MSEC 1HKSA 1ZLKA 2HGCA 1WH5A 4MHGA 2OTLI 2M0MA 2HTJA 1I6HJ 2TCTA 2Y9ZA 1MMGA 1WCMJ 2ZJ2A 3TO6A 2XAJA 4HBLA 2Z3YA 4ZYEA 2LC2A 1MH3A 5E8GA 2VOPA 5J1RA 4G7ZF 4RAFA 4A3CJ 3CUQA 1B6AA 2KLOA 2Z5UA 1Y0NA 3G1LA 3X2QH 4RLFA 2STTA 2Y2ZA 3DU6A 3H0GJ 4EV0A 1MMAA 4C3JJ 3FZVA 3LA3A 3BG7A 1B4AA 1A35A 1BBYA 1QPMA 2VPRA 4L5JA 5E20A 4UVAA 3CCLI 2OD5A 2XF6A 3I64A 1BOBA 5EZHA 1FT9A 1U2WA 4L5EA 3HOZJ 3G2BA 2DO7A 5HLTA 1ETQA 5KVRA 3GFIA 3TW7A 4XM3A 1AHDP 1LFPA 3S2WA 5LBQA 3FXMA 1ZG1A 2KQRA 3G6EI 1VQ7I 1KU9A 1IRZA 3QP5A 2GA1A 4XBFA 2RC4A 3ZQIA 2R7QA 3BR5A 1REPC 3ZMDA 4G7OF 4AWXB 3ZN1A 4KN7X 4XKCA 4E7JA 4MTEA 5H6RA 2I8DA 2XGEA 4WXCA 5AONA 1WSUA 1HC8A 2DFHA 1H0MA 3TGNA 2KP6A 2FOWA 3GWZA 1AWCA 1PUFB 2HS5A 4U0VA 5JFRA 3F22A 2HOTA 4CDGA 3OIOA 5HNHA 4N0BA 3IP4B 4BE2A 5HLHA 1LKXA 1FNNA 3AG3H 4QLCU 4G6QA 5IP9J 3FKJA 3RI4A 1V55H 3DU5A 2CJJA 2DT7B 3E97A 1YW7A 2OC6A 4M3EA 2Z9OA 2ZCWA 3K4LA 4HPQA 1LQ1A 2R4GA 1TQPA 4IQ4A 4NDLA 1HLVA 2FA5A 3H3ZA 3I53A 2HOSA 1QZZA 2IGMA 1J59A 1BIAA 2L01A 5L3BA 2NVQJ 3BR0A 4L0YB 3CUQC 2P8TA 1IV6A 2E36A 1T0FA 1IV8A 4OAZA 3ZGKA 1IRXA 3IV5A 2LF7A 4M9SA 4I76A 1YRNA 1GV5A 1TC3C 4HF1A 3LNQA 4R1HA 4XQFA 2BGCA 3HSEA 2R93J 4A93J 2DOAA 4CCNA 1P9QC 5IT3A 3OYGA 3K70D 1N78A 3WG9A 1YX3A 4HSRA 4PJLA 1MNDA 2K9MA 2WTEA 4DW6A 2BY1A 2FQ4A 5L3GA 2ADUA 5LRSA 2R7VA 3QYFA 2VC0A 3RPUD 1U3EM 2X85A 1RPWA 2EV5A 4QSHA 4ZZLA 1FLIA 1XTAA 1OJLA 3J81K 2X48A 1ETVA 4HOBA 2BV6A 1QVTA 1P2FA 2EFWA 5JHFA 1ON2A 3I71A 2FRHA 4II2A 4N9IA 3GLLA 1X4OA 4EJOA 4JX5A 4A6EA 2OZ6A 1D8KA 4QTRA 3DTKA 3FM3A 4AD9A 5LEJA 3HOUJ 9ANTA 3R61A 4GYIA 3RQIA 2V9PA 4K2EA 3WE2A 4M74A 4PDKA 1OCPA 3TP3A 5EG0B 3BTJA 1CF7B 3T5XA 3BPVA 3LQQA 1GXPA 2EIMH 4M72A 2M7BA 5TJJA 2P4WA 4KNYA 1X1AA 2XPVA 2VKVA 3BDDA 3K1PA 5FD5A 4BAYA 1J2XA 3J7ZI 4NQWA 5FKOA 3CP2A 1SAXA 4MFDA 2QQ8A 1QA6A 2MLKA 1ZRFA 2W48A 2BVLA 3LAJA 2HNHA 2XIGA 2PI0A 3GW2A 1VFCA 1OYIA 2LD5A 1YHQI 2QQ9A 3OYBA 1UZCA 4ASNA 1W36C 2ECCA 2YU3A 2OPTA 3IUOA 1VQLI 2R3SA 2ELHA 1GLNA 1W5TA 2DQLA 1JHHA 1OPCA 1T0FC 4MNUA 1S8NA 1WJFA 2VONA 2OCEA 2IGOA 4B3AA 1F4KA 3W2WA 2DQRA 5J3LA 2PMHA 3EUKL 4ESJA 1YI2I 1D0XA 3CP8A 5FLMJ 2DT5A 5KNLA 3M3YJ 1I1GA 3Q0VA 4U0YA 3CTAA 2DFEA 1UB9A 1MJBA 2VT3A 1VQ8I 4BYYA 2P5KA 1IJWC 1S7AA 1FP2A 1R1VA 3L2RA 2WA0A 3W6VA 3PNTA 1EH7A 3LL7A 3K0LA 3DBRB 3CDLA 1OCZH 3DF8A 1WVRA 3ELKA 1RI7A 1GVDA 2L7ZA 4LK0F 5IYBJ 3HRSA 4C3IJ 1ETKA 3R4KA 1ZLJA 1XCBA 2O8XA 3PSFA 2DCEA 1I27A 4J00A 4MIMA 1FYMA 1X2MA 5LHIA 1R71A 3V42A 4RGRA 3I4NJ 1K78A 5H2FC 2CH0A 3L2UA 1ZRDA 3BJAA 2XF7A 1JT6A 3PM1A 5DM6F 4G8XA 2DN0A 2NS7A 1Z77A 3ISPA 3W2VA 3AG4H 3OMYA 1X1CA 5IOYA 1MH4A 4IRGA 3KYLA 1BL0A 3A2KA 3JRHA 2YX4A 5M5YJ 1WRJA 1ZN2A 3IRQA 3ABLH 3E3VA 1RESA 2K3PA 4OAYA 2IXSA 1R36A 2L7KA 1XGNA 4RGXA 2EFOA 3H35A 1WJBA 4BBRJ 4AIHA 3I58A 3KLNA 4XOTA 5LGUA 1POGA 4EQQA 3HOTA 2VASA 3K4MA 2FE3A 3FXOA 2X51A 4GRIA 1O7LA 1Z1DA 2FX0A 2GQQA 3EUHA 1TTYA 2R7WA 5DD4A 4AU7A 2DMUA 3HL2A 1MSFC 2JMWA 4DJAA 1OKRA 2XVCA 4U0WA 1U9NA 4Y17A 5J6XA 5C44J 2G9WA 3F23A 2R5ZA 1K6YA 1N25A 2DMPA 2Z16A 2O61A 4L9JA 1JUSA 4L9VA 4BY7J 4YIRX 3BCAA 3ABTA 2L0KA 1R00A 3DKYA 2NAZA 2W24A 1W7PD 4WF2A 1U5TC 4XIDA 3J81Z 2ZFWA 4UNOA 1SFEA 3RPQA 2HQAA 3OYNA 2IAIA 3L2CA 1K61A 2E1NA 1MDMA 4KDPA 3CO6C 4KIFA 4OIRF 3KX2A 2W00A 2QSHX 1I3QJ 5F0HA 1X2NA 3H92A 2F48A 1B9NA 3I4PA 3U1KA 1F36A 2O6GE 3CF2A 2L54A 2JRTA 5KAIC 4HX8A 1T56A 3JRBA 4LIVA 5CJ9A 1H89C 3HRMA 1BI3A 3HXLA 4F91B 1Z21A 2CW0F 1ORKA 1QHGA 1ZHFA 3H5RA 1IDYA 1QO0D 2HU9A 3CJRB 1H9GA 1K4SA 2A3SA 2KPMA 1W4MA 4MEYF 1NK2P 2AQEA 2NYXA 2OJED 5CKTA 1Z6RA 2NNYA 1X1BA 3NWSA 2JN6A 4Q4ZF 4X6AJ 4HZFA 4N4NB 4HV5A 4IQJA 2CMPA 3TKYA 4DNCA 2XPUA 1TT5B 5KAFC 2RGVA 1MBGA 1NTCA 2P7CB 3GTOJ 4IHXA 5EGOB 1YYVA 1R6RA 1ZELA 3WGGA 2GXAA 3H3UA 2JUGA 2OQGA 4D0PA 2BVMA 2ELKA 5HS9A 3CJNA 5LLQA 3CCEI 2VQLA 4M6VA 5CQEA 1SANA 4RB2C 2M2EA 1OCOH 4A3GJ 1ZRCA 2E2JJ 4XSZF 3KETA 5M5WJ 1XMAA 2ZBKA 4XMYA 1D0ZA 2UV1A 3K2AA 1RUOA 3L2QA 1EH6A 2JSPA 4A5NA 2JPCA 1KQ9A 5E1ZB 4A0XA 5EF6A 2HVSA 3G71I 3RJPA 4BNCA 4PZJA 4HDUA 2M5WA 2Z1DA 2DA4A 1YITI 3RDIA 2LY2A 1B8IB 3OYIA 1HF0A 1UHWA 5D8LB 2HYGD 4JYKA 3Q9VA 1J7KA 2VXZA 3G3ZA 2QYOA 3DCFA 4IF4A 1FY7A 3BG9A 2VE8A 1LFBA 2EV0A 3CDHA 5HODA 1U8BA 2O5RA 3A01A 3ASNH 2QUFA 2ICWG 3ROUA 4HF2A 3KZZA 3HG9A 4F52A 2ZXWH 5J4VA 3S8PA 1H88C 1UFMA 2E1MC 4EVIA 2W7NA 4DYCA 3KZYA 3E1SA 3GCMA 3U2RA 3CCMI 2L5QA 3AG2H 3E5XA 4ZZDA 1V5EA 3AG1H 1Z6TA 3DPLC 4ZDOA 1KA8A 3U1DA 2XAUA 2PMUA 1S29A 2ZC2A 1FC3A 1S5LC 1P4AA 2B63J 1JHFA 3REOA 3B6CA 5HDNA 4A3FJ 4PK4A 2EZKA 3FM5A 3E6CC 2CYYA 2F4OB 3T1BA 1T39A 1UG2A 2JPBA 1XB4A 2Q2EA 2Y0MA 2QSFX 3A01B 1BJAA 2DTRA 1UHSA 2K5CA 5D5UB 3MVPA 5CLSA 1J9IA 1FWZA 2HFHA 2PN6A 5HS8A 2DOFA 3OSFA 2FJ1A 2QBYA 3KFWX 1IF1A 3MFKA 1WJAA 2HKOA 4A3KJ 4B4CA 4BJTA 3VYTB 2E35A 2F5DA 3BJ6A 1YJ9I 1X3UA 2M45A 5JVGF 4XKBA 1FMVA 2E71A 3I0TA 4P5OA 1YLFA 1FZPB 4BL0B 4LG0A 1LE8A 2UUZA 4NC8A 4AIJA 5JI6A 1CQTA 2MGQA 3OL4A 1SAUA 4YFXF 4Y7NJ 3PQKA 1U78A 4ZC3A 2RN7A 2VBYA 4BXXJ 2JK3A 5CVIA 2QQAA 4L9NA 2EILH 4F55A 3H0DA 3C2HA 4KIGA 2P6SA 3VB2A 4B1RA 2FQ3A 2KRFA 2MBFA 3H1CA 4UUSA 2PEXA 2XAGA 3KPHA 1TWGJ 2M7AA 1PJRA 5FLXK 1KQ8A 3GX4X 1W5SA 2LREA 2VJJA 1G59A 1MNEA 2DA7A 2ECBA 2GA2A 2KISA 2W1OA 4ZTJA 3SZPA 2FBKA 1B72A 2JUCA 1APLC 1W0TA 2YU9J 1D1CA 2L9NA 2VBZA 4JQFA 3LAPA 1RR7A 2LDUA 5DCMB 4ZYDA 4WXDA 4BXFA 2PMZN 3K70C 4LG0B 2EFNA 2NVTJ 2DLLA 5F1RA 3GTPJ 2F2EA 4HRIA 1R22A 2VT2A 5M5XJ 4BKXA 3TOBA 1D1BA 3CO7C 1RZ4A 1WJDA 1MMSA 3FHZA 3F8FA 2E60A 1R5GA 3R6SA 2A05A 2CQNA 3TBIA 5IOZA 1XS9A 2IS2A 4EM1A 1V3FA 2A6EF 3JREA 2QGUA 1Z7UA 4DBRA 2O8KA 2G7UA 3LFKA 3M8FA 4UUSB 1FMWA 1LEAA 5K7ZA 2HEOA 1XMXA 2Q1ZB 4S04A 4BQQA 2F5FA 5DV5A 3HJEA 3IC7A 2LFBA 1XGMA 1W1WE 5FKKA 2HQ5A 3GFJA 3WTSC 3S2DJ 1SC7A 4LK1F 3NEUA 4HYEA 4P9FA 2D1HA 2IPQX 3DEUA 5FKLA 4A3EJ 2VKHA 1FPQA 1G3TA 2XDVA 3WTWC 1OCTC 5HS7A 2CW7A 3WU0A 4E7KA 1O7FA 5FROA 2VJ4A 3C3WA 3KP7A 2EV6A 2BXZA 2X6YA 3BLYA 4YEJA 1LEBA 4BEHA 2X6XA 4XLAA 2K3FA 1PDNC 4IHWA 2NNNA 3SEZA 2DFFA 2YX7A 2CV2A 3V8JA 4HF0A 4IO9F 2OU2A 2VODA 2IS4A 4FETA 4ABZA 3E6DA 2PJPA 2KRHA 4X1EA 2R7UA 1YS7A 2ZNYA 1YOVB 3I5UA 4PSWA 3BWGA 4A5MA 4R79A 4LB5A 2PMZA 2LY9A 2K86A 3IKTA 1VQKI 3HOYJ 1AKHA 1Y39A 2FMLA 3OV8A 5M3FJ 5LFAA 4A12A 2Y69H 2V7FA 3H3VK 3L1PA 4HV6A 1YFHA 1OYYA 4A3JJ 1JKRC 3ZMZA 4B43A 3GZNB 3R0AA 2XF5A 1IXCA 5AIQA 5L3EA 5ERIA 2IW5A 3S17J 4I7HA 2A5WA 4C2UA 3HPGA 1ENHA 2E5ZA 3CDIA 5HLIA 2HKXA 1YQAA 5EYRA 4I98B 1S9HA 3HRTA 1E3HA 3SQNA 1ETWA 4Q5SF 5KK1A 3HPHA 3FBNB 1JE8A 2K9NA 2ZFUA 4C3HJ 4JX6A 3SEQA 3VODA 2LKSA 3A0BC 2AO9A 2NRAC 3G1OA 2JQ7A 3PFIA 5LHHA 1AKHB 1D0YA 2KZVA 3TOAA 4CCKA 1DPUA 3FXUA 4HG2A 3DTIA 1TW2A 4FISA 4O6JA 1QZEA 2A5YB 3HSRA 1W7PB 2NVUB 4EM0B 1Y1WJ 3JSPA 1V54H 1PUFA 1SVMA 3A0HC 5IP7J 2LBFB 4UUTA 3I3LA 1ZTRA 3TW6A 4O5VA 5BQTA 2L2OA 3WTYC 3DV8A 3HZJA 5CVVA 4JX4A 2I10A 5BPIA 4XNFA 5FLXZ 1IN8A 4M3GA 3PFYA 1QU3A 5GTIC 3OIQA 4RAZA 3M07A 4XICA 3AL0B 3D5LA 1YS6A 1ACIA 3F8CA 2CFOA 1PYVA 3K10A 4A3IJ 1TL8A 5F08A 2JRMA 3W3CA 1JUMA 5JLXA 2KHMA 2JT1A 4EATA 3H9QA 5B1BH 1USSA 4C30A 4L5IA 2Y31A 3ZOBA 1G3YA 3KIOA 1UMQA 2MYSA 4E4HA 2XGCA 3RCOA 2ZJRF 3HOVJ 3IWZA 1RIOH 1Q1VA 2JTVA 1NH3A 4RB3C 1TZLA 5B5EC 3V8LA 2Z33A 4L18B 4HX4A 3W6KB 4UB8C 1KU7A 1WWXA 5B3SH 3GTLJ 1JT0A 1FIAA 2CRGA 5HLGA 2NOGA
chains in the Genus database with same CATH topology
1XDUA 1O3TA 5J8CA 2XASA 3M9AA 3DPTA 2F5EA 3ZN0A 2J5OA 1UHMA 3JSOA 2GAUA 4XRFA 4HLYA 2Q8KA 3WGIA 2RKHA 4UUVA 1OYWA 1V4RA 1TQIA 2FSWA 2FF4A 4Y13A 2K02A 4U88A 2FEZA 3IKVA 2OZUA 1T2KA 1ZGAA 1CF7A 2IVMA 5AIPA 4G9YA 2CFXA 3MCZA 3HYIA 3FWEA 5EEHA 1KYZA 1OR7A 3F8BA 5K1YA 2E1CA 4MQVA 2OBPA 2ACJA 3N97A 1YIOA 2EFQA 4I02A 4BXUA 4ZYGA 2RDPA 3EDPA 3HUGA 3TDUC 1SD6A 1MJAA 1XD7A 3L9FA 2IJLA 1TNSA 4OIQF 2Y48A 2YSRA 5F6FA 2STWA 2DU9A 2L02A 2PG4A 4I0BA 2F5CA 2LKPA 1LB2A 1R5HA 4KUMA 3VOEA 2JZYA 3ZMVA 1KQ0A 2VE9A 3V7CA 2K7LA 3GZ5A 1TBXA 3ERED 2R7FA 2ZO4A 4A0YA 1IAWA 4CYDA 3ZPLA 2H27A 5ILSA 2DK5A 4F7ZA 3E5QA 2BYVE 5EEGA 1BM9A 4LLGF 1ZGJA 3J80K 1P6RA 2UXNA 1A04A 3BROA 5H6QA 2V6CA 3LWFA 4OMYA 3QP6A 4OIOF 1MJ9A 2HQNA 3K1MA 4GCVA 5DYMA 4BHPA 4AIKA 2KJCA 1OMIA 1R1UA 3P7NA 2KJBA 4GXOA 2P5LC 2H09A 2P6TA 1XN7A 1IRFA 2OQRA 1B9MA 3LQRA 5D5WB 3BOQA 3QOPA 5E1WA 5E8IA 1BN5A 5D4SA 1FX7A 4A2UA 1TNTA 3TO9A 1HXDA 4JBAA 4L9TA 3MWMA 1Y0UA 3SFZA 3EYYA 5K5OA 1HSTA 2V9VA 2GZWA 3ULQB 1IXRC 1U8RA 2K27A 1UCRA 1MKMA 4ON0A 4EMSA 4EJVA 5LHGA 3C7JA 2RVCA 3O3KA 1XSXA 2CQKA 1RNLA 3R0JA 5FFXA 1R23A 5TRDA 1TLHB 3BP8A 4WCGA 1GXQA 5FD6A 4IPAA 2A6HF 4FHTA 1HSJA 1J75A 4MGRA 4ENJA 4U7BA 2QQBA 1Z9CA 1XGOA 2OA4A 3RIRA 4LLNA 3QPTA 4PGGA 5LGTA 5JHUA 3LA2A 4I2OA 1LDKB 1YO5C 2E7WA 2H94A 3RYPA 5DCFA 1I6XA 1FBSA 2ISZA 3Q5FA 2ESNA 2FBHA 3BZ6A 2BBYA 2UXXA 2W85A 1KU2A 3J80Z 1D5VA 1J0RA 3ZP5A 2FOKA 5FO5A 1RUNA 3JW4A 5ICGA 3HHHA 3KE2A 2M87A 3CUOA 2LF8A 1D8JA 2EA2A 3ZMSA 1DDNA 2AXLA 3MEXA 4LFUA 3TQNA 2CWEA 3F8NA 3MQ0A 4EGYA 4XLPF 4EJWA 4HDVA 2KIMA 1DUXC 1BC7C 5HDKA 2EJRA 1H9TA 3JAMK 1P4WA 4ENNA 3I59B 1SFUA 3GF2A 1QZYA 2B0LA 4ZYHA 3IRRA 4AVPA 5L3FA 4IHSA 2FU4A 3RPUA 3M1EA 1KYWA 1LJ9A 4ZH4F 1GVJA 4RS8A 1FBUA 2M1BA 3O6BB 1L3LA 4EM2A 1ULYA 2DI3A 4YIFA 2ESHA 4N9HA 4NHJA 5ED4A 5D6EA 3E5UA 4UVCA 4WK8F 3KP5A 1IN6A 1BIBA 5D5VB 1I5ZA 5DCMA 3T0YA 2KKOA 3GXOA 1F9NA 3GVAA 1O3QA 5FFZA 4CICA 2O03A 4BQAA 2FNPA 4G6DA 4EJTA 1YTYA 5H20A 5J8FA 1IUYA 2QVOA 3HRUA 1R1TA 2P5VA 4ESFA 3FXQA 2ETHA 1QBJA 1IRGA 2R7DA 4FT8A 2VBXA 1C0WA 4HLXA 3DXJF 3ML6A 4HQMA 4I09A 1K79A 5JVTA 3SZTA 1TQMA 1PUEE 4U7DA 3M7GA 1G6NA 2NS0A 4M6XA 4M9XA 4KA4A 4M73A 3K69A 3KCCA 3LSTA 1BI2A 1YW8A 1VTNC 2XRNA 2DBBA 5K5RA 4ESBA 2RNJA 3WTZA 2CO5A 4MTDA 3T8RA 4UXNA 3F6OA 1IXSB 1S6LA 3FX3A 4KMUX 4RGUA 1T98A 4CGZA 1MGTA 4KIBA 4KT5C 4HW0A 5DUKA 2IT0A 4Z2YA 3RTRA 3JAMZ 2V1DA 3SHFA 3TDZC 5ICFA 1GHCA 2HTSA 3N4MA 2ZMEB 1PP7U 2H6BA 4EJUA 4KYWA 5BS6A 4LGWA 3GLXA 4BHCA 3HHGA 5DEQA 2HZTA 1QNTA 1W7PA 3I54A 2D45A 3QRFF 1BC8C 2VN2A 2MC3A 4YFNF 1WI9A 2K4BA 5E1XA 5ICCA 2W84A 3MZHA 1IN7A 1K6OA 3ECHA 3ZQ7A 4HX7A 4MQ9F 2VOOA 1O3RA 2TDXA 2K4JA 2XROA 1KU3A 3T8TA 4YIIA 3KP4A 1FSEA 4LLLA 2P7VB 3CLOA 5CVUA 2QZ8A 1LVAA 2V79A 2IRFG 1LNWA 3KP6A 4HQEA 2J5PA 4ENMA 4R8HA 2LSOA 2DAOA 1ZH5A 1E2XA 2MH2A 1L0OC 3PQJA 1EV7A 4ENKA 4WX9A 4H0EA 4UV8A 4XLNF 2DW4A 1J5YA 4S05A 2PFBA 2IA1A 2MH9A 4OINF 1E17A 1NHAA 2HYFA 3IWFA 2G7HA 2D2WA 4OU0A 2VBWA 3P9KA 3CUQB 2HQRA 3IL2A 2EWNA 5LEKA 3JTGA 4JK1X 2PLYA 1HW1A 5JR3A 4Q47A 2D1VA 1QQIA 5ILUA 2L4MA 3D0SA 2HDCA 1JXSA 1FSHA 4BH9A 3L00A 1TW3A 1S3JA 3FMRA 3KLOA 3IHUA 3HTSB 1T6SA 3GYHX 3AAFA 3WGHA 1BI1A 4Q48A 3EYIA 2X4HA 4OOIA 4P96A 1D3YA 3F3XA 3F72A 1SD4A 2A69F 3DFGA 2IA0A 1ODDA 2WC2A 2LNBA 2C6YA 4IHTA 1WKMA 2DPDA 2XKOA 4RB0A 1O57A 6PAXA 1FBQA 2BEOA 1YW9A 1PP8F 3RKYA 5ICEA 3KEOA 4E70A 1FP1D 2L3DA 3DP7A 3EETA 3GUDA 2PQ8A 5E17F 5K5QA 3P9CA 2QLZA 2EB7A 4LMYA 2IA2A 5BMZA 1LDJA 1HQCA 4OIPF 1QGPA 3JTHA 5D5XB 3RKWA 1DP7P 4IJAA 2AS5F 4GYGA 2XAHA 4HAMA 1R58A 4PCQA 4HA8A 3FXRA 2CG4A 4I0AA 2HOEA 3F8MA 5A2QK 1B1BA 2HR3A 3RKXA 1U5TA 4ETSA 2KIFA 4XSXF 3EQLF 3BPXA 4UHTA 2XV4S 2QENA 5BPDA 4YFKF 1EH8A 2DK8A 2WWYA 3E6BA 2DFIA 4BHBA 3E6MA 2XAFA 3LA7A 3FMSA 1LDDA 2WV0A 3KP2A 1G3WA 2Q0OA 2EK5A 4LB6B 4FX0A 1K7AA 1ON1A 3QPHA 3QAHA 4IRHA 3W6JB 3ECOA 2ZKZA 3L7WA 1FYLA 2A61A 1U5TB 4KICA 5HVQC 2H6CA 2OAZA 5L3CA 2KIUA 2IP2A 1F5TA 2CGPA 3NRVA 1MD0A 3KP3A 4OMZA 1SD7A 3F21A 2BE5F 2XAQA 4CZZA 2Z99A 2RQPA 1K78B 3B73A 2MLGA 3GFLA 3V7RA 1P92A 5IT9K 1XDSA 3ABUA 4P9UA 4UVBA 2JSCA 3MZYA 5FB2A 1B59A 3ZMUA 3HTUA 1ZARA 2FMYA 4FX4A 1G4DA 2A07F 3QU3A 1IZ1A 1F1ZA 1ZYRF 1USTA 3K1NA 3V4GA 3TO7A 2GWRA 4P55A 5F64A 1XGSA 1P4XA 4WWCA 1FOKA 2MD5A 2GXBA 2X0LA 5DUIA 4Y15A 1YG2A 4GO1A 4KFCA 3F6VA 5DD8A 4WXHA 3Q9SA 3I59A 5E18F 2DPUA 1MDMB 5HDGA 5D4RA 3P9IA 4YG2F 1U6GA 2FXAA 1Q1HA 2HWVA 5A2QZ 1IN5A 4G7HF 4IRIA 2M8EA 3BJOA 4L0ZB 3J7AO 3R60A 2EFPA 2E7XA 2GXGA 2GIVA 4KN4X 1IN4A 1SD5A 1STZA 4TV7A 1BOAA 4IVNA 1ZREA 3VEPA 3WTVC 2V1UA 4CXFA 3GO5A 3O2PE 4CHUA 1Z05A 2Y75A 3WTXC 2ZNZA 4A6DA 3OOPA 1R7JA 2FBIA 2MA3A 3K9TA 5CVJA 1O3SA 1I1SA 2RV8A 4LD5A 5CVRA 4IXAA 2COMA 4RGSA 2YPRA 5ILVA 3DQVC 5BOXA 3WTUC 4M6YA 2UZKA 3V7SA 4CO8A 1MZBA 1SFXA 5IT9Z 2O0YA 1JGSA 1ZAOA 1AOYA 2W25A 5D8KB 2L4AA 3NQOA 1XSDA 3V8KA 3GZ6A 3FF5A 2ISYA 1BI0A 3BY6A 4KMFA 1CGPA 4NB5A 1KGSA 2QM3A 4I01A 3L09A 3G73A 1Z91A 3RYRA 3C1DA 3QU6A 2O3FA 5HOOA 3WODF 3GEZA 2QBYB 2FNAA 3SXYA 4RAYA 1XMKA 1HW2A 2ZMEA 5LRRA 5CYVA 3FMQA 1HKQA 4B8XA 1FYKA 5D6FA 4EGZA 2XHKA 3C18A 4A0ZA 2W57A 2UWMA 3GFMA 2V1XA 3DKWA 2ZXJA 4LJZF 4QWQA 1ZG3A 2XUBA 1XSVA 3VFZA 1WQ2A 4MEXF 1DPRA 1HW5A 3U9GA 3HIFA 1SMTA 2M30A 1T38A 1HBXG 3MAJA 2EA4A 4B09A 4G94A 2PBIA 3ZMTA 2YR2A 4RB1A 4PGHA 2XGXA 1XCVA 4M71A 3KEQA 1G3SA 2QWWA 5DDGA 5FGMA 4GGGA 2VC1A 3COAC 1ONVA 2A68F 3WU1B 4M9ZA 3HOSA 3HSFA 3K2ZA 1ZG5A 1HKTA 1IW7F 2CSOA 4O3MA 3M8EA 4UV9A 1SMYF 3WTTC 3WE3A 3B02A 4DQ2A 1S7OA 2XKPA 5L3DA 5LGNA 1HKSA 1ZLKA 2HGCA 4MHGA 2HTJA 2ZJ2A 3TO6A 2XAJA 4HBLA 2Z3YA 4ZYEA 2VOPA 5E8GA 4G7ZF 3CUQA 1B6AA 2Z5UA 2STTA 4EV0A 3FZVA 3LA3A 1B4AA 1BBYA 1QPMA 5E20A 4L5JA 4UVAA 2OD5A 3I64A 1FT9A 1U2WA 2DO7A 5KVRA 3GFIA 3S2WA 5LBQA 1ZG1A 1KU9A 3QP5A 2GA1A 4XBFA 2RC4A 1REPC 3ZMDA 4G7OF 4AWXB 3ZN1A 4KN7X 4MTEA 5H6RA 4WXCA 5AONA 1WSUA 1H0MA 3TGNA 3GWZA 1AWCA 2HS5A 4U0VA 5JFRA 3F22A 4CDGA 4N0BA 5HLHA 1FNNA 4QLCU 4G6QA 3RI4A 3E97A 1YW7A 2Z9OA 2ZCWA 1LQ1A 1TQPA 2FA5A 3H3ZA 3I53A 1QZZA 1J59A 1BIAA 2L01A 5L3BA 4L0YB 3CUQC 2P8TA 1T0FA 2LF7A 4M9SA 4HF1A 4R1HA 2BGCA 3HSEA 5IT3A 3WG9A 2WTEA 5L3GA 2ADUA 5LRSA 2VC0A 1U3EM 4ZZLA 1FLIA 2EV5A 3J81K 4HOBA 2BV6A 1P2FA 2EFWA 1ON2A 3I71A 2FRHA 4N9IA 4EJOA 4A6EA 2OZ6A 1D8KA 3FM3A 4AD9A 5LEJA 3R61A 4GYIA 4K2EA 3WE2A 4M74A 4PDKA 1CF7B 3T5XA 3BPVA 3LQQA 1GXPA 4M72A 5TJJA 2P4WA 4KNYA 3BDDA 3K1PA 5FD5A 4BAYA 1J2XA 4NQWA 1SAXA 2MLKA 1ZRFA 3LAJA 2XIGA 2PI0A 3GW2A 1OYIA 2QQ9A 4ASNA 2YU3A 2R3SA 2ELHA 1W5TA 2DQLA 1JHHA 1OPCA 4MNUA 1S8NA 2VONA 1F4KA 2DQRA 2PMHA 4ESJA 2DT5A 1I1GA 4U0YA 3CTAA 1UB9A 1MJBA 2VT3A 4BYYA 2P5KA 1S7AA 1FP2A 1R1VA 1EH7A 3K0LA 3DF8A 3ELKA 1RI7A 4LK0F 3HRSA 3R4KA 1ZLJA 1XCBA 2O8XA 1I27A 1FYMA 5LHIA 4RGRA 1K78A 1ZRDA 3BJAA 4G8XA 3ISPA 4IRGA 2YX4A 1WRJA 1ZN2A 3IRQA 3E3VA 1R36A 1XGNA 4RGXA 2EFOA 4AIHA 3I58A 3KLNA 5LGUA 4EQQA 3HOTA 2FE3A 1O7LA 1Z1DA 2GQQA 3EUHA 1TTYA 5DD4A 1OKRA 2XVCA 4U0WA 5J6XA 4Y17A 2G9WA 3F23A 2O61A 4L9JA 4L9VA 3ABTA 1R00A 2NAZA 2W24A 1W7PD 4WF2A 1U5TC 3J81Z 2ZFWA 4UNOA 1SFEA 3RPQA 3L2CA 2E1NA 1MDMA 4KDPA 3CO6C 4KIFA 4OIRF 3H92A 1B9NA 3I4PA 2O6GE 2L54A 2JRTA 4HX8A 5CJ9A 3HRMA 1BI3A 2CW0F 1ZHFA 1QO0D 1H9GA 2A3SA 1W4MA 4MEYF 2NYXA 1Z6RA 2NNYA 4Q4ZF 4HZFA 4HV5A 3TKYA 4DNCA 2RGVA 2P7CB 1YYVA 3WGGA 3H3UA 2OQGA 4D0PA 5HS9A 3CJNA 5LLQA 4RB2C 1ZRCA 4XSZF 3KETA 1XMAA 2ZBKA 1RUOA 1EH6A 4A5NA 2JPCA 1KQ9A 5E1ZB 4A0XA 4BNCA 3RJPA 4PZJA 4HDUA 2M5WA 3RDIA 1UHWA 5D8LB 2HYGD 3Q9VA 1J7KA 2VXZA 3G3ZA 2QYOA 4IF4A 1FY7A 2VE8A 2EV0A 3CDHA 2QUFA 3ROUA 4HF2A 3KZZA 1UFMA 4EVIA 3KZYA 3U2RA 3E5XA 4ZZDA 1Z6TA 3DPLC 1KA8A 3U1DA 2PMUA 1S29A 1FC3A 1P4AA 1JHFA 3REOA 5HDNA 3FM5A 3E6CC 2CYYA 1T39A 3T1BA 2JPBA 2Y0MA 1XB4A 2Q2EA 1BJAA 2DTRA 5D5UB 1J9IA 5CLSA 1FWZA 2HFHA 2PN6A 5HS8A 2QBYA 3KFWX 1IF1A 3MFKA 2HKOA 2F5DA 3BJ6A 1X3UA 2M45A 3I0TA 4P5OA 1YLFA 1FZPB 4LG0A 4AIJA 5JI6A 4YFXF 1U78A 3PQKA 2RN7A 2VBYA 5CVIA 2QQAA 4L9NA 4KIGA 2P6SA 3VB2A 2FQ3A 2KRFA 2MBFA 2PEXA 2XAGA 5FLXK 1KQ8A 3GX4X 1W5SA 2GA2A 3SZPA 2FBKA 4JQFA 2VBZA 3LAPA 5DCMB 2LDUA 4ZYDA 4WXDA 4LG0B 2EFNA 2DLLA 5F1RA 2F2EA 1R22A 2VT2A 3TOBA 3CO7C 1RZ4A 3FHZA 3F8FA 1R5GA 3R6SA 4EM1A 1V3FA 2A6EF 1Z7UA 2G7UA 3LFKA 3M8FA 1LEAA 2HEOA 4S04A 2F5FA 5DV5A 3IC7A 1XGMA 3GFJA 3WTSC 4LK1F 3NEUA 4HYEA 4P9FA 2D1HA 2IPQX 3DEUA 1FPQA 1G3TA 3WTWC 5HS7A 3WU0A 1O7FA 3KP7A 3C3WA 2EV6A 1LEBA 1PDNC 2NNNA 2YX7A 3V8JA 4HF0A 2OU2A 2VODA 3E6DA 2PJPA 1YS7A 2ZNYA 3I5UA 4A5MA 3BWGA 4R79A 4LB5A 2K86A 3IKTA 2FMLA 3OV8A 4A12A 4HV6A 1YFHA 1OYYA 3ZMZA 3R0AA 1IXCA 5AIQA 5L3EA 5ERIA 2IW5A 4I7HA 5HLIA 2HKXA 1YQAA 4I98B 3HRTA 3SQNA 4Q5SF 5KK1A 1JE8A 3VODA 2NRAC 3PFIA 5LHHA 3TOAA 1DPUA 3FXUA 1TW2A 4O6JA 2A5YB 3HSRA 1W7PB 4EM0B 3JSPA 4O5VA 5BQTA 3WTYC 3DV8A 5CVVA 5BPIA 5FLXZ 1IN8A 4RAZA 3D5LA 1YS6A 3F8CA 2JT1A 1USSA 4L5IA 1G3YA 3IWZA 1RIOH 2JTVA 4RB3C 2Z33A 3V8LA 4L18B 4HX4A 3W6KB 1KU7A 1WWXA 5HLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDU A;  1O3T A;  5J8C A;  2XAS A;  3M9A A;  3DPT A;  2F5E A;  3ZN0 A;  2J5O A;  1UHM A;  3JSO A;  2GAU A;  4XRF A;  4HLY A;  2Q8K A;  3WGI A;  2RKH A;  4UUV A;  1OYW A;  1V4R A;  1TQI A;  2FSW A;  2FF4 A;  4Y13 A;  2K02 A;  4U88 A;  2FEZ A;  3IKV A;  2OZU A;  1T2K A;  1ZGA A;  1CF7 A;  2IVM A;  5AIP A;  4G9Y A;  2CFX A;  3MCZ A;  3HYI A;  3FWE A;  5EEH A;  1KYZ A;  1OR7 A;  3F8B A;  5K1Y A;  2E1C A;  4MQV A;  2OBP A;  2ACJ A;  3N97 A;  1YIO A;  2EFQ A;  4I02 A;  4BXU A;  4ZYG A;  2RDP A;  3EDP A;  3HUG A;  3TDU C;  1SD6 A;  1MJA A;  1XD7 A;  3L9F A;  2IJL A;  1TNS A;  4OIQ F;  2Y48 A;  2YSR A;  5F6F A;  2STW A;  2DU9 A;  2L02 A;  2PG4 A;  4I0B A;  2F5C A;  2LKP A;  1LB2 A;  1R5H A;  4KUM A;  3VOE A;  2JZY A;  3ZMV A;  1KQ0 A;  2VE9 A;  3V7C A;  2K7L A;  3GZ5 A;  1TBX A;  3ERE D;  2R7F A;  2ZO4 A;  4A0Y A;  1IAW A;  4CYD A;  3ZPL A;  2H27 A;  5ILS A;  2DK5 A;  4F7Z A;  3E5Q A;  2BYV E;  5EEG A;  1BM9 A;  4LLG F;  1ZGJ A;  3J80 K;  1P6R A;  2UXN A;  1A04 A;  3BRO A;  5H6Q A;  2V6C A;  3LWF A;  4OMY A;  3QP6 A;  4OIO F;  1MJ9 A;  2HQN A;  3K1M A;  4GCV A;  5DYM A;  4BHP A;  4AIK A;  2KJC A;  1OMI A;  1R1U A;  3P7N A;  2KJB A;  4GXO A;  2P5L C;  2H09 A;  2P6T A;  1XN7 A;  1IRF A;  2OQR A;  1B9M A;  3LQR A;  5D5W B;  3BOQ A;  3QOP A;  5E1W A;  5E8I A;  1BN5 A;  5D4S A;  1FX7 A;  4A2U A;  1TNT A;  3TO9 A;  1HXD A;  4JBA A;  4L9T A;  3MWM A;  1Y0U A;  3SFZ A;  3EYY A;  5K5O A;  1HST A;  2V9V A;  2GZW A;  3ULQ B;  1IXR C;  1U8R A;  2K27 A;  1UCR A;  1MKM A;  4ON0 A;  4EMS A;  4EJV A;  5LHG A;  3C7J A;  2RVC A;  3O3K A;  1XSX A;  2CQK A;  1RNL A;  3R0J A;  5FFX A;  1R23 A;  5TRD A;  1TLH B;  3BP8 A;  4WCG A;  1GXQ A;  5FD6 A;  4IPA A;  2A6H F;  4FHT A;  1HSJ A;  1J75 A;  4MGR A;  4ENJ A;  4U7B A;  2QQB A;  1Z9C A;  1XGO A;  2OA4 A;  3RIR A;  4LLN A;  3QPT A;  4PGG A;  5LGT A;  5JHU A;  3LA2 A;  4I2O A;  1LDK B;  1YO5 C;  2E7W A;  2H94 A;  3RYP A;  5DCF A;  1I6X A;  1FBS A;  2ISZ A;  3Q5F A;  2ESN A;  2FBH A;  3BZ6 A;  2BBY A;  2UXX A;  2W85 A;  1KU2 A;  3J80 Z;  1D5V A;  1J0R A;  3ZP5 A;  2FOK A;  5FO5 A;  1RUN A;  3JW4 A;  5ICG A;  3HHH A;  3KE2 A;  2M87 A;  3CUO A;  2LF8 A;  1D8J A;  2EA2 A;  3ZMS A;  1DDN A;  2AXL A;  3MEX A;  4LFU A;  3TQN A;  2CWE A;  3F8N A;  3MQ0 A;  4EGY A;  4XLP F;  4EJW A;  4HDV A;  2KIM A;  1DUX C;  1BC7 C;  5HDK A;  2EJR A;  1H9T A;  3JAM K;  1P4W A;  4ENN A;  3I59 B;  1SFU A;  3GF2 A;  1QZY A;  2B0L A;  4ZYH A;  3IRR A;  4AVP A;  5L3F A;  4IHS A;  2FU4 A;  3RPU A;  3M1E A;  1KYW A;  1LJ9 A;  4ZH4 F;  1GVJ A;  4RS8 A;  1FBU A;  2M1B A;  3O6B B;  1L3L A;  4EM2 A;  1ULY A;  2DI3 A;  4YIF A;  2ESH A;  4N9H A;  4NHJ A;  5ED4 A;  5D6E A;  3E5U A;  4UVC A;  4WK8 F;  3KP5 A;  1IN6 A;  1BIB A;  5D5V B;  1I5Z A;  5DCM A;  3T0Y A;  2KKO A;  3GXO A;  1F9N A;  3GVA A;  1O3Q A;  5FFZ A;  4CIC A;  2O03 A;  4BQA A;  2FNP A;  4G6D A;  4EJT A;  1YTY A;  5H20 A;  5J8F A;  1IUY A;  2QVO A;  3HRU A;  1R1T A;  2P5V A;  4ESF A;  3FXQ A;  2ETH A;  1QBJ A;  1IRG A;  2R7D A;  4FT8 A;  2VBX A;  1C0W A;  4HLX A;  3DXJ F;  3ML6 A;  4HQM A;  4I09 A;  1K79 A;  5JVT A;  3SZT A;  1TQM A;  1PUE E;  4U7D A;  3M7G A;  1G6N A;  2NS0 A;  4M6X A;  4M9X A;  4KA4 A;  4M73 A;  3K69 A;  3KCC A;  3LST A;  1BI2 A;  1YW8 A;  1VTN C;  2XRN A;  2DBB A;  5K5R A;  4ESB A;  2RNJ A;  3WTZ A;  2CO5 A;  4MTD A;  3T8R A;  4UXN A;  3F6O A;  1IXS B;  1S6L A;  3FX3 A;  4KMU X;  4RGU A;  1T98 A;  4CGZ A;  1MGT A;  4KIB A;  4KT5 C;  4HW0 A;  5DUK A;  2IT0 A;  4Z2Y A;  3RTR A;  3JAM Z;  2V1D A;  3SHF A;  3TDZ C;  5ICF A;  1GHC A;  2HTS A;  3N4M A;  2ZME B;  1PP7 U;  2H6B A;  4EJU A;  4KYW A;  5BS6 A;  4LGW A;  3GLX A;  4BHC A;  3HHG A;  5DEQ A;  2HZT A;  1QNT A;  1W7P A;  3I54 A;  2D45 A;  3QRF F;  1BC8 C;  2VN2 A;  2MC3 A;  4YFN F;  1WI9 A;  2K4B A;  5E1X A;  5ICC A;  2W84 A;  3MZH A;  1IN7 A;  1K6O A;  3ECH A;  3ZQ7 A;  4HX7 A;  4MQ9 F;  2VOO A;  1O3R A;  2TDX A;  2K4J A;  2XRO A;  1KU3 A;  3T8T A;  4YII A;  3KP4 A;  1FSE A;  4LLL A;  2P7V B;  3CLO A;  5CVU A;  2QZ8 A;  1LVA A;  2V79 A;  2IRF G;  1LNW A;  3KP6 A;  4HQE A;  2J5P A;  4ENM A;  4R8H A;  2LSO A;  2DAO A;  1ZH5 A;  1E2X A;  2MH2 A;  1L0O C;  3PQJ A;  1EV7 A;  4ENK A;  4WX9 A;  4H0E A;  4UV8 A;  4XLN F;  2DW4 A;  1J5Y A;  4S05 A;  2PFB A;  2IA1 A;  2MH9 A;  4OIN F;  1E17 A;  1NHA A;  2HYF A;  3IWF A;  2G7H A;  2D2W A;  4OU0 A;  2VBW A;  3P9K A;  3CUQ B;  2HQR A;  3IL2 A;  2EWN A;  5LEK A;  3JTG A;  4JK1 X;  2PLY A;  1HW1 A;  5JR3 A;  4Q47 A;  2D1V A;  1QQI A;  5ILU A;  2L4M A;  3D0S A;  2HDC A;  1JXS A;  1FSH A;  4BH9 A;  3L00 A;  1TW3 A;  1S3J A;  3FMR A;  3KLO A;  3IHU A;  3HTS B;  1T6S A;  3GYH X;  3AAF A;  3WGH A;  1BI1 A;  4Q48 A;  3EYI A;  2X4H A;  4OOI A;  4P96 A;  1D3Y A;  3F3X A;  3F72 A;  1SD4 A;  2A69 F;  3DFG A;  2IA0 A;  1ODD A;  2WC2 A;  2LNB A;  2C6Y A;  4IHT A;  1WKM A;  2DPD A;  2XKO A;  4RB0 A;  1O57 A;  6PAX A;  1FBQ A;  2BEO A;  1YW9 A;  1PP8 F;  3RKY A;  5ICE A;  3KEO A;  4E70 A;  1FP1 D;  2L3D A;  3DP7 A;  3EET A;  3GUD A;  2PQ8 A;  5E17 F;  5K5Q A;  3P9C A;  2QLZ A;  2EB7 A;  4LMY A;  2IA2 A;  5BMZ A;  1LDJ A;  1HQC A;  4OIP F;  1QGP A;  3JTH A;  5D5X B;  3RKW A;  1DP7 P;  4IJA A;  2AS5 F;  4GYG A;  2XAH A;  4HAM A;  1R58 A;  4PCQ A;  4HA8 A;  3FXR A;  2CG4 A;  4I0A A;  2HOE A;  3F8M A;  5A2Q K;  1B1B A;  2HR3 A;  3RKX A;  1U5T A;  4ETS A;  2KIF A;  4XSX F;  3EQL F;  3BPX A;  4UHT A;  2XV4 S;  2QEN A;  5BPD A;  4YFK F;  1EH8 A;  2DK8 A;  2WWY A;  3E6B A;  2DFI A;  4BHB A;  3E6M A;  2XAF A;  3LA7 A;  3FMS A;  1LDD A;  2WV0 A;  3KP2 A;  1G3W A;  2Q0O A;  2EK5 A;  4LB6 B;  4FX0 A;  1K7A A;  1ON1 A;  3QPH A;  3QAH A;  4IRH A;  3W6J B;  3ECO A;  2ZKZ A;  3L7W A;  1FYL A;  2A61 A;  1U5T B;  4KIC A;  5HVQ C;  2H6C A;  2OAZ A;  5L3C A;  2KIU A;  2IP2 A;  1F5T A;  2CGP A;  3NRV A;  1MD0 A;  3KP3 A;  4OMZ A;  1SD7 A;  3F21 A;  2BE5 F;  2XAQ A;  4CZZ A;  2Z99 A;  2RQP A;  1K78 B;  3B73 A;  2MLG A;  3GFL A;  3V7R A;  1P92 A;  5IT9 K;  1XDS A;  3ABU A;  4P9U A;  4UVB A;  2JSC A;  3MZY A;  5FB2 A;  1B59 A;  3ZMU A;  3HTU A;  1ZAR A;  2FMY A;  4FX4 A;  1G4D A;  2A07 F;  3QU3 A;  1IZ1 A;  1F1Z A;  1ZYR F;  1UST A;  3K1N A;  3V4G A;  3TO7 A;  2GWR A;  4P55 A;  5F64 A;  1XGS A;  1P4X A;  4WWC A;  1FOK A;  2MD5 A;  2GXB A;  2X0L A;  5DUI A;  4Y15 A;  1YG2 A;  4GO1 A;  4KFC A;  3F6V A;  5DD8 A;  4WXH A;  3Q9S A;  3I59 A;  5E18 F;  2DPU A;  1MDM B;  5HDG A;  5D4R A;  3P9I A;  4YG2 F;  1U6G A;  2FXA A;  1Q1H A;  2HWV A;  5A2Q Z;  1IN5 A;  4G7H F;  4IRI A;  2M8E A;  3BJO A;  4L0Z B;  3J7A O;  3R60 A;  2EFP A;  2E7X A;  2GXG A;  2GIV A;  4KN4 X;  1IN4 A;  1SD5 A;  1STZ A;  4TV7 A;  1BOA A;  4IVN A;  1ZRE A;  3VEP A;  3WTV C;  2V1U A;  4CXF A;  3GO5 A;  3O2P E;  4CHU A;  1Z05 A;  2Y75 A;  3WTX C;  2ZNZ A;  4A6D A;  3OOP A;  1R7J A;  2FBI A;  2MA3 A;  3K9T A;  5CVJ A;  1O3S A;  1I1S A;  2RV8 A;  4LD5 A;  5CVR A;  4IXA A;  2COM A;  4RGS A;  2YPR A;  5ILV A;  3DQV C;  5BOX A;  3WTU C;  4M6Y A;  2UZK A;  3V7S A;  4CO8 A;  1MZB A;  1SFX A;  5IT9 Z;  2O0Y A;  1JGS A;  1ZAO A;  1AOY A;  2W25 A;  5D8K B;  2L4A A;  3NQO A;  1XSD A;  3V8K A;  3GZ6 A;  3FF5 A;  2ISY A;  1BI0 A;  3BY6 A;  4KMF A;  1CGP A;  4NB5 A;  1KGS A;  2QM3 A;  4I01 A;  3L09 A;  3G73 A;  1Z91 A;  3RYR A;  3C1D A;  3QU6 A;  2O3F A;  5HOO A;  3WOD F;  3GEZ A;  2QBY B;  2FNA A;  3SXY A;  4RAY A;  1XMK A;  1HW2 A;  2ZME A;  5LRR A;  5CYV A;  3FMQ A;  1HKQ A;  4B8X A;  1FYK A;  5D6F A;  4EGZ A;  2XHK A;  3C18 A;  4A0Z A;  2W57 A;  2UWM A;  3GFM A;  2V1X A;  3DKW A;  2ZXJ A;  4LJZ F;  4QWQ A;  1ZG3 A;  2XUB A;  1XSV A;  3VFZ A;  1WQ2 A;  4MEX F;  1DPR A;  1HW5 A;  3U9G A;  3HIF A;  1SMT A;  2M30 A;  1T38 A;  1HBX G;  3MAJ A;  2EA4 A;  4B09 A;  4G94 A;  2PBI A;  3ZMT A;  2YR2 A;  4RB1 A;  4PGH A;  2XGX A;  1XCV A;  4M71 A;  3KEQ A;  1G3S A;  2QWW A;  5DDG A;  5FGM A;  4GGG A;  2VC1 A;  3COA C;  1ONV A;  2A68 F;  3WU1 B;  4M9Z A;  3HOS A;  3HSF A;  3K2Z A;  1ZG5 A;  1HKT A;  1IW7 F;  2CSO A;  4O3M A;  3M8E A;  4UV9 A;  1SMY F;  3WTT C;  3WE3 A;  3B02 A;  4DQ2 A;  1S7O A;  2XKP A;  5L3D A;  5LGN A;  1HKS A;  1ZLK A;  2HGC A;  4MHG A;  2HTJ A;  2ZJ2 A;  3TO6 A;  2XAJ A;  4HBL A;  2Z3Y A;  4ZYE A;  2VOP A;  5E8G A;  4G7Z F;  3CUQ A;  1B6A A;  2Z5U A;  2STT A;  4EV0 A;  3FZV A;  3LA3 A;  1B4A A;  1BBY A;  1QPM A;  5E20 A;  4L5J A;  4UVA A;  2OD5 A;  3I64 A;  1FT9 A;  1U2W A;  2DO7 A;  5KVR A;  3GFI A;  3S2W A;  5LBQ A;  1ZG1 A;  1KU9 A;  3QP5 A;  2GA1 A;  4XBF A;  2RC4 A;  1REP C;  3ZMD A;  4G7O F;  4AWX B;  3ZN1 A;  4KN7 X;  4MTE A;  5H6R A;  4WXC A;  5AON A;  1WSU A;  1H0M A;  3TGN A;  3GWZ A;  1AWC A;  2HS5 A;  4U0V A;  5JFR A;  3F22 A;  4CDG A;  4N0B A;  5HLH A;  1FNN A;  4QLC U;  4G6Q A;  3RI4 A;  3E97 A;  1YW7 A;  2Z9O A;  2ZCW A;  1LQ1 A;  1TQP A;  2FA5 A;  3H3Z A;  3I53 A;  1QZZ A;  1J59 A;  1BIA A;  2L01 A;  5L3B A;  4L0Y B;  3CUQ C;  2P8T A;  1T0F A;  2LF7 A;  4M9S A;  4HF1 A;  4R1H A;  2BGC A;  3HSE A;  5IT3 A;  3WG9 A;  2WTE A;  5L3G A;  2ADU A;  5LRS A;  2VC0 A;  1U3E M;  4ZZL A;  1FLI A;  2EV5 A;  3J81 K;  4HOB A;  2BV6 A;  1P2F A;  2EFW A;  1ON2 A;  3I71 A;  2FRH A;  4N9I A;  4EJO A;  4A6E A;  2OZ6 A;  1D8K A;  3FM3 A;  4AD9 A;  5LEJ A;  3R61 A;  4GYI A;  4K2E A;  3WE2 A;  4M74 A;  4PDK A;  1CF7 B;  3T5X A;  3BPV A;  3LQQ A;  1GXP A;  4M72 A;  5TJJ A;  2P4W A;  4KNY A;  3BDD A;  3K1P A;  5FD5 A;  4BAY A;  1J2X A;  4NQW A;  1SAX A;  2MLK A;  1ZRF A;  3LAJ A;  2XIG A;  2PI0 A;  3GW2 A;  1OYI A;  2QQ9 A;  4ASN A;  2YU3 A;  2R3S A;  2ELH A;  1W5T A;  2DQL A;  1JHH A;  1OPC A;  4MNU A;  1S8N A;  2VON A;  1F4K A;  2DQR A;  2PMH A;  4ESJ A;  2DT5 A;  1I1G A;  4U0Y A;  3CTA A;  1UB9 A;  1MJB A;  2VT3 A;  4BYY A;  2P5K A;  1S7A A;  1FP2 A;  1R1V A;  1EH7 A;  3K0L A;  3DF8 A;  3ELK A;  1RI7 A;  4LK0 F;  3HRS A;  3R4K A;  1ZLJ A;  1XCB A;  2O8X A;  1I27 A;  1FYM A;  5LHI A;  4RGR A;  1K78 A;  1ZRD A;  3BJA A;  4G8X A;  3ISP A;  4IRG A;  2YX4 A;  1WRJ A;  1ZN2 A;  3IRQ A;  3E3V A;  1R36 A;  1XGN A;  4RGX A;  2EFO A;  4AIH A;  3I58 A;  3KLN A;  5LGU A;  4EQQ A;  3HOT A;  2FE3 A;  1O7L A;  1Z1D A;  2GQQ A;  3EUH A;  1TTY A;  5DD4 A;  1OKR A;  2XVC A;  4U0W A;  5J6X A;  4Y17 A;  2G9W A;  3F23 A;  2O61 A;  4L9J A;  4L9V A;  3ABT A;  1R00 A;  2NAZ A;  2W24 A;  1W7P D;  4WF2 A;  1U5T C;  3J81 Z;  2ZFW A;  4UNO A;  1SFE A;  3RPQ A;  3L2C A;  2E1N A;  1MDM A;  4KDP A;  3CO6 C;  4KIF A;  4OIR F;  3H92 A;  1B9N A;  3I4P A;  2O6G E;  2L54 A;  2JRT A;  4HX8 A;  5CJ9 A;  3HRM A;  1BI3 A;  2CW0 F;  1ZHF A;  1QO0 D;  1H9G A;  2A3S A;  1W4M A;  4MEY F;  2NYX A;  1Z6R A;  2NNY A;  4Q4Z F;  4HZF A;  4HV5 A;  3TKY A;  4DNC A;  2RGV A;  2P7C B;  1YYV A;  3WGG A;  3H3U A;  2OQG A;  4D0P A;  5HS9 A;  3CJN A;  5LLQ A;  4RB2 C;  1ZRC A;  4XSZ F;  3KET A;  1XMA A;  2ZBK A;  1RUO A;  1EH6 A;  4A5N A;  2JPC A;  1KQ9 A;  5E1Z B;  4A0X A;  4BNC A;  3RJP A;  4PZJ A;  4HDU A;  2M5W A;  3RDI A;  1UHW A;  5D8L B;  2HYG D;  3Q9V A;  1J7K A;  2VXZ A;  3G3Z A;  2QYO A;  4IF4 A;  1FY7 A;  2VE8 A;  2EV0 A;  3CDH A;  2QUF A;  3ROU A;  4HF2 A;  3KZZ A;  1UFM A;  4EVI A;  3KZY A;  3U2R A;  3E5X A;  4ZZD A;  1Z6T A;  3DPL C;  1KA8 A;  3U1D A;  2PMU A;  1S29 A;  1FC3 A;  1P4A A;  1JHF A;  3REO A;  5HDN A;  3FM5 A;  3E6C C;  2CYY A;  1T39 A;  3T1B A;  2JPB A;  2Y0M A;  1XB4 A;  2Q2E A;  1BJA A;  2DTR A;  5D5U B;  1J9I A;  5CLS A;  1FWZ A;  2HFH A;  2PN6 A;  5HS8 A;  2QBY A;  3KFW X;  1IF1 A;  3MFK A;  2HKO A;  2F5D A;  3BJ6 A;  1X3U A;  2M45 A;  3I0T A;  4P5O A;  1YLF A;  1FZP B;  4LG0 A;  4AIJ A;  5JI6 A;  4YFX F;  1U78 A;  3PQK A;  2RN7 A;  2VBY A;  5CVI A;  2QQA A;  4L9N A;  4KIG A;  2P6S A;  3VB2 A;  2FQ3 A;  2KRF A;  2MBF A;  2PEX A;  2XAG A;  5FLX K;  1KQ8 A;  3GX4 X;  1W5S A;  2GA2 A;  3SZP A;  2FBK A;  4JQF A;  2VBZ A;  3LAP A;  5DCM B;  2LDU A;  4ZYD A;  4WXD A;  4LG0 B;  2EFN A;  2DLL A;  5F1R A;  2F2E A;  1R22 A;  2VT2 A;  3TOB A;  3CO7 C;  1RZ4 A;  3FHZ A;  3F8F A;  1R5G A;  3R6S A;  4EM1 A;  1V3F A;  2A6E F;  1Z7U A;  2G7U A;  3LFK A;  3M8F A;  1LEA A;  2HEO A;  4S04 A;  2F5F A;  5DV5 A;  3IC7 A;  1XGM A;  3GFJ A;  3WTS C;  4LK1 F;  3NEU A;  4HYE A;  4P9F A;  2D1H A;  2IPQ X;  3DEU A;  1FPQ A;  1G3T A;  3WTW C;  5HS7 A;  3WU0 A;  1O7F A;  3KP7 A;  3C3W A;  2EV6 A;  1LEB A;  1PDN C;  2NNN A;  2YX7 A;  3V8J A;  4HF0 A;  2OU2 A;  2VOD A;  3E6D A;  2PJP A;  1YS7 A;  2ZNY A;  3I5U A;  4A5M A;  3BWG A;  4R79 A;  4LB5 A;  2K86 A;  3IKT A;  2FML A;  3OV8 A;  4A12 A;  4HV6 A;  1YFH A;  1OYY A;  3ZMZ A;  3R0A A;  1IXC A;  5AIQ A;  5L3E A;  5ERI A;  2IW5 A;  4I7H A;  5HLI A;  2HKX A;  1YQA A;  4I98 B;  3HRT A;  3SQN A;  4Q5S F;  5KK1 A;  1JE8 A;  3VOD A;  2NRA C;  3PFI A;  5LHH A;  3TOA A;  1DPU A;  3FXU A;  1TW2 A;  4O6J A;  2A5Y B;  3HSR A;  1W7P B;  4EM0 B;  3JSP A;  4O5V A;  5BQT A;  3WTY C;  3DV8 A;  5CVV A;  5BPI A;  5FLX Z;  1IN8 A;  4RAZ A;  3D5L A;  1YS6 A;  3F8C A;  2JT1 A;  1USS A;  4L5I A;  1G3Y A;  3IWZ A;  1RIO H;  2JTV A;  4RB3 C;  2Z33 A;  3V8L A;  4L18 B;  4HX4 A;  3W6K B;  1KU7 A;  1WWX A;  5HLG A; 
#chains in the Genus database with same CATH topology
 1HA8 A;  1XDU A;  4PJJ A;  1U0J A;  5J8C A;  1O3T A;  2XAS A;  3M9A A;  3DPT A;  2F5E A;  3ZN0 A;  2J5O A;  2O9L A;  3S1R J;  1UHM A;  4Y33 A;  3JSO A;  4BE1 A;  2GAU A;  3CQZ J;  4XRF A;  4FTH A;  3OIP A;  2Q8K A;  4HLY A;  5IY5 H;  2KIQ A;  2A6T A;  5FRN A;  3EUA A;  1F43 A;  3WGI A;  2VQC A;  1IGN A;  2RKH A;  4CCO A;  4UUV A;  4QIW N;  1OYW A;  4Y4R A;  3ABM H;  2XPW A;  1YIJ I;  1V4R A;  4XN0 A;  1TQI A;  4IHV A;  2FSW A;  2FF4 A;  2OUM A;  4Y13 A;  2K02 A;  4U88 A;  2FEZ A;  3IKV A;  2OZU A;  5EG0 A;  1T2K A;  1ZGA A;  1CF7 A;  2IVM A;  1VI0 A;  5AIP A;  4G9Y A;  3BCB A;  3L2V A;  2CFX A;  3MCZ A;  3HYI A;  4B47 A;  4DYR A;  2W82 A;  3FWE A;  1U9O A;  3BQY A;  4EEF G;  4DZP A;  5EEH A;  3OYK A;  1RET A;  1KYZ A;  1OR7 A;  2CUZ A;  3F8B A;  4Z6Y A;  2M9H A;  4Y3O A;  5CPR B;  2R7Z J;  5K1Y A;  2E1C A;  4MQV A;  3A1Y A;  2OBP A;  2ACJ A;  2LVS A;  3N97 A;  1YIO A;  2EFQ A;  4I02 A;  4BXU A;  4ZYG A;  2RDP A;  2XB5 A;  4JOM A;  5EZG A;  3EDP A;  4D5C A;  3TED A;  3HUG A;  3JRI A;  3TDU C;  1SD6 A;  4BQO A;  1JKO C;  1MJA A;  2DYR H;  4A3D J;  3BG5 A;  3O8G A;  2BXY A;  1XD7 A;  2O7O A;  2WY7 Q;  3L9F A;  3LSP A;  2IJL A;  1TNS A;  3MKY B;  4OIQ F;  2Y48 A;  2YSR A;  2EQR A;  5F6F A;  2AQF A;  2STW A;  2DU9 A;  2L02 A;  4FQG A;  2XC7 A;  2PG4 A;  4I0B A;  2F5C A;  1XG1 A;  2COB A;  4W97 A;  1D5Y A;  2LKP A;  3S16 J;  1LB2 A;  2P0W A;  1R5H A;  4KUM A;  4D7N A;  3VOE A;  2JZY A;  3FDY A;  3ZMV A;  1S72 I;  2N8G A;  1KQ0 A;  2VE9 A;  3CJQ B;  3V7C A;  2K7L A;  3GZ5 A;  1TBX A;  3ERE D;  2R7F A;  2ZO4 A;  3JRF A;  4A0Y A;  2XSJ C;  1IAW A;  4CYD A;  3ZPL A;  3ZQH A;  2H27 A;  2VLA A;  3GTJ J;  1YE9 A;  5ILS A;  4I6Z A;  5F04 A;  4A3L J;  1AA7 A;  1JTY A;  3CLQ A;  1R4M B;  1HCR A;  2DK5 A;  2MD0 A;  4F7Z A;  3MKW B;  3K7A J;  3HUG B;  3S3O A;  3E5Q A;  1T8I A;  2VQH A;  3HC7 A;  2BYV E;  5EEG A;  4IOA F;  1BM9 A;  5E3L A;  4LLG F;  2XB0 X;  2JA6 J;  1ZGJ A;  4BE0 A;  4D7M A;  3WHC A;  3C2G A;  3J80 K;  3OYJ A;  1P6R A;  2UXN A;  1A04 A;  2M4K A;  3BRO A;  5H6Q A;  2V6C A;  2GBY A;  3LWF A;  2HXI A;  1LPQ A;  3A4C A;  4OMY A;  3QP6 A;  4OIO F;  3OS1 A;  1OR7 C;  3N05 A;  1MJ9 A;  2HQN A;  3K1M A;  4GCV A;  3QYB A;  5DYM A;  4BHP A;  3WU2 C;  2GOM A;  4AIK A;  2IEK A;  3LSG A;  3NAU A;  2KJC A;  3CC7 I;  1OMI A;  3ZXS A;  1R1U A;  3P7N A;  2KJB A;  4GXO A;  3SZG A;  3ZRG A;  5GPC A;  2P5L C;  3LSK A;  2H09 A;  2P6T A;  1XN7 A;  4PUS A;  3VYS B;  1IRF A;  5J40 A;  4MFE A;  1H8A C;  2OQR A;  3ZQQ A;  3WHB A;  1B9M A;  3LQR A;  5D5W B;  3BOQ A;  3DBL B;  4IOC F;  1Y6I A;  1WJ5 A;  3QOP A;  5E1W A;  4A3M J;  2P81 A;  1OCC H;  5E8I A;  1BN5 A;  5D4S A;  5KHD A;  3PIO F;  3CCU I;  1FX7 A;  4A2U A;  1I39 A;  1TNT A;  1HXD A;  3TO9 A;  4JBA A;  3LSH A;  1JJ8 C;  4L9T A;  2QCO A;  3MWM A;  2GOX B;  1Y0U A;  3I55 I;  3SFZ A;  2ELJ A;  3EYY A;  5K5O A;  1HST A;  2V9V A;  3CMY A;  2GZW A;  3ULQ B;  1IXR C;  1U8R A;  2K27 A;  2YUS A;  4AM3 A;  2L9S A;  1UCR A;  3S3N A;  1J09 A;  1MKM A;  2KT0 A;  3F0C A;  4ON0 A;  3IAS 2;  4EMS A;  1TT0 A;  4EJV A;  5LHG A;  2RQQ A;  3OYD A;  3GME A;  3S93 A;  4RBO A;  5FKM A;  3Q3S A;  1MBH A;  2R0Q C;  3C7J A;  2RVC A;  3B6A A;  1YX5 A;  5EGO A;  3S32 A;  2CQ7 A;  3O3K A;  1XSX A;  2CQK A;  1RNL A;  3PNY A;  3R0J A;  5FFX A;  1R23 A;  3ZQG A;  3KEY A;  5TRD A;  1TLH B;  5CQG A;  3BP8 A;  3CCS I;  2EZI A;  5J4Y A;  1MIJ A;  4WCG A;  1GXQ A;  1FOY A;  4CCJ A;  5FD6 A;  4IPA A;  1ZK8 A;  2ID3 A;  1IC8 A;  2ZSI B;  2ZSH B;  3KYC B;  1DP3 A;  2A6H F;  4FHT A;  1BA5 A;  1HSJ A;  1J75 A;  4MGR A;  2KMU A;  4ENJ A;  3VWB A;  4U7B A;  2QQB A;  1Z9C A;  4HEA 2;  1XGO A;  2OA4 A;  3RIR A;  1N75 A;  4A3B J;  2WAE A;  3SFI A;  1B8I A;  4LLN A;  3QPT A;  3RKQ A;  1ZGW A;  2KRC A;  4PGG A;  2DXI A;  4BY1 J;  4C9Y A;  5LGT A;  3Q0U A;  5JHU A;  1UJ8 A;  1NG7 A;  3I56 I;  4B3X A;  4BGD A;  2B7E A;  3LA2 A;  1GV2 A;  4I2O A;  4GFB A;  1LDK B;  1YO5 C;  2E7W A;  2H94 A;  3RYP A;  3H9G A;  5DCF A;  3S1Q J;  5J1U A;  1O4X A;  1I6X A;  2BHY A;  3AKZ A;  1FBS A;  4DZJ A;  3Q5F A;  2ESN A;  2FBH A;  3BZ6 A;  2VJI A;  2GM4 A;  2ISZ A;  2NVX J;  2BBY A;  2DMT A;  2UXX A;  2W85 A;  3EUH C;  1RR8 C;  1VQ4 I;  4KT6 A;  1KU2 A;  3J80 Z;  2K9L A;  4II3 A;  3GTG J;  4JP0 A;  1D5V A;  2VPL A;  1J0R A;  3ZP5 A;  2FOK A;  1N77 A;  1W5C C;  5FO5 A;  1RUN A;  2BW3 B;  3JW4 A;  5ICG A;  3HHH A;  3KE2 A;  3BR3 A;  3S2H J;  1DU6 A;  2M87 A;  5TIS C;  1WI3 A;  4B48 A;  1OCR H;  1VQ6 I;  3CUO A;  2LF8 A;  1D8J A;  5IPA A;  4CZC A;  2EA2 A;  3MD2 A;  3ZMS A;  4CSW A;  1DDN A;  2AXL A;  3HGY A;  3MEX A;  4LFU A;  3K4B A;  3LMM A;  4FAS D;  3TQN A;  4YRV A;  2CWE A;  3F8N A;  1FTZ A;  3MQ0 A;  4EGY A;  3E7L A;  4XLP F;  2TRT A;  4EJW A;  4HDV A;  1JJ6 C;  2DA3 A;  2KIM A;  1GUU A;  4BU2 A;  4NNJ A;  1DUX C;  1BC7 C;  5HDK A;  2EJR A;  1H9T A;  5F27 A;  2MW8 A;  3JAM K;  1P4W A;  4ENN A;  3I59 B;  2H1K A;  3DKX A;  1SFU A;  3GF2 A;  1QZY A;  2B0L A;  4FCY A;  3JRD A;  4AVZ A;  3HEF A;  4ZYH A;  2LKX A;  3IRR A;  2DDA A;  4AVP A;  2NVY J;  5L3F A;  4IHS A;  2FU4 A;  2X6O A;  3RPU A;  3IH3 A;  3M1E A;  1KYW A;  1LJ9 A;  3I9V 2;  2VIX A;  4ZH4 F;  3S15 J;  1WJC A;  1GVJ A;  4RS8 A;  1W36 D;  1FBU A;  5IP6 A;  2M1B A;  3O6B B;  2JVG A;  2WY8 Q;  1L3L A;  5DM7 F;  2WAQ N;  4EM2 A;  1ULY A;  4M3B A;  2XSD C;  4BAC A;  2DI3 A;  2IGK A;  4YIF A;  2ESH A;  1LVK A;  4N9H A;  4NHJ A;  5ED4 A;  2OF7 A;  4KJZ A;  5D6E A;  1XC5 A;  3E5U A;  4ZDL A;  1JI8 A;  1T33 A;  4UVC A;  2F4I A;  2OCC H;  4WK8 F;  1SVL A;  3KP5 A;  1IN6 A;  1BIB A;  4AID A;  5D5V B;  1I5Z A;  3J7Y J;  4UB6 C;  4CA0 A;  3MN2 A;  5DCM A;  1AU7 A;  3T0Y A;  2KKO A;  2M8G X;  3GXO A;  4I99 C;  4GDF A;  3LSI A;  3HOW J;  1F9N A;  4YEL A;  4RM3 A;  1Y1V J;  4N4O B;  3GVA A;  1O3Q A;  3JCU C;  1X19 A;  4RA2 A;  3GTQ J;  5FFZ A;  4CIC A;  3MKL A;  3WG7 H;  1VF9 A;  1XX5 A;  2O03 A;  4BQA A;  2GIZ A;  2FNP A;  4G6D A;  4RM2 A;  4EJT A;  1YTY A;  5H20 A;  5J8F A;  3SDG A;  1FOX A;  3HOX J;  1IUY A;  2QVO A;  1X1P A;  2LTP A;  1E3P A;  2W4S A;  1R1T A;  3HRU A;  4IHY A;  2P5V A;  2ZXH A;  4ESF A;  3I4M J;  3FXQ A;  2ETH A;  1QBJ A;  1IRG A;  2R7D A;  2VKE A;  2LYC A;  2VQG A;  4HNT A;  4FT8 A;  2VBX A;  1A31 A;  4DGW B;  1C0W A;  4HLX A;  2DJI A;  2BHZ A;  3DXJ F;  3ML6 A;  4HQM A;  4I09 A;  3TMO A;  2M34 A;  3ESW B;  1K79 A;  5JVT A;  2Y0S N;  3SZT A;  5C4J J;  1TQM A;  1PUE E;  2WAQ A;  3H9J A;  3OSG A;  3TP0 A;  4U7D A;  3M7G A;  2CS3 A;  4E7L A;  1G6N A;  4BJ5 C;  2NS0 A;  4E7H A;  4M6X A;  4M9X A;  4KA4 A;  4M73 A;  3CC4 I;  1FOW A;  2L9R A;  2E1O A;  3Q0W A;  2PX9 A;  1MBJ A;  3K69 A;  2ZXI A;  3OR2 C;  1UEL B;  3KCC A;  2ME0 A;  3LST A;  1BI2 A;  2R92 J;  1G8X A;  3AFH A;  1YW8 A;  1VTN C;  1ETO A;  2XRN A;  2DBB A;  4U87 A;  4ESB A;  5K5R A;  3S1M J;  2RNJ A;  1HDD C;  3ONQ A;  1ERD A;  3WTZ A;  2AHQ A;  2CO5 A;  3OR1 C;  4MTD A;  3T8R A;  1EJ9 A;  4UXN A;  1VQ5 I;  3F6O A;  5GAH J;  1IXS B;  1S6L A;  4NC6 A;  3D1N I;  3FX3 A;  4KMU X;  2X1E A;  3PSI A;  1I3A A;  5KCM A;  4BBS J;  4RGU A;  1MW7 A;  1T98 A;  4CGZ A;  1MGT A;  3DLA A;  2EZH A;  3M8J A;  4HW0 A;  4KIB A;  4KT5 C;  1GT0 C;  1PVE A;  1WFX A;  4LIU A;  5DUK A;  2IT0 A;  3QWL A;  3K4J A;  4Z2Y A;  3M4O J;  3RTR A;  3JAM Z;  2V1D A;  2LR8 A;  1OLT A;  1MNM C;  3SHF A;  1VQM I;  3TDZ C;  5ICF A;  1GHC A;  2HTS A;  2BY3 A;  3FK7 A;  4KIT B;  3N4M A;  2ZME B;  1PP7 U;  2H6B A;  4EJU A;  4KYW A;  3ABK H;  5BS6 A;  4XRS G;  4LGW A;  2WB1 N;  3GLX A;  4V2F A;  3ZQC A;  2Y0S A;  4BHC A;  2IBD A;  1WH7 A;  3HHG A;  1WGX A;  2DYS H;  2CUE A;  4E7I A;  4NBQ A;  3QPL A;  4IX7 A;  3FIS A;  2HDW A;  2HI3 A;  2JWT A;  3FXL A;  3DBH B;  5DEQ A;  1ZQ3 P;  3BTL A;  2HZT A;  1QNT A;  1W7P A;  3I54 A;  3O8H A;  5J47 A;  4XRS A;  1TWH J;  2D45 A;  3QRF F;  1E3O C;  2GLO A;  3OYE A;  1A6I A;  3BZK A;  2ZJP F;  2LBF A;  1BC8 C;  1Z3Y A;  1P7I A;  2MC3 A;  2VN2 A;  1TWC J;  4YFN F;  3W2A A;  3KZI C;  3D5S C;  2BY0 A;  1LUJ B;  3QYE A;  2X6W A;  1WI9 A;  2K4B A;  5E1X A;  5ICC A;  2W84 A;  1NK3 P;  3MZH A;  1IN7 A;  2LLK A;  1K6O A;  3PL8 A;  1FIP A;  1KZH A;  3CCV I;  3CCQ I;  1TWF J;  3ECH A;  3ZQ7 A;  4HX7 A;  2FD5 A;  2F4M B;  4MQ9 F;  1O3R A;  2VOO A;  1JKQ C;  3BC8 A;  1K83 J;  2TDX A;  4BS9 A;  3CMA I;  3C2B A;  3OYA A;  2WAD A;  2K4J A;  2XRO A;  2CUJ A;  3OL3 A;  4P1W A;  1KU3 A;  4B44 A;  3T8T A;  4YII A;  3KP4 A;  1FSE A;  4LLL A;  2P7V B;  2K9S A;  2CQQ A;  3CLO A;  2DA5 A;  1P7J A;  2R7R A;  1VND A;  5CVU A;  2QZ8 A;  1LVA A;  1I50 J;  2V79 A;  3BT9 A;  2IRF G;  1LNW A;  1M1E B;  1IG7 A;  2MC4 A;  3KP6 A;  3DEW A;  1SFK A;  2J5P A;  2LMD A;  4HQE A;  4ENM A;  3LSR A;  2DT6 A;  3J7A Y;  5GP9 A;  2WB1 A;  4R8H A;  4E7S A;  2LSO A;  3DEE A;  1DGR M;  2DAO A;  1ZH5 A;  4G6T B;  3OOU A;  1E2X A;  1BJZ A;  2WV1 A;  2MH2 A;  1OQY A;  2PJR A;  2VXD A;  1L0O C;  3HM5 A;  3PQJ A;  1EV7 A;  3OS0 A;  4ENK A;  3KYD B;  4WX9 A;  4H0E A;  1VQN I;  4UV8 A;  3DWL E;  4XLN F;  4RLQ A;  3FXJ A;  2Y9Y A;  1R5I D;  3A03 A;  4HNV A;  2DW4 A;  1J5Y A;  3DPU A;  3FK6 A;  3VYR B;  2KZG A;  1MMN A;  2IA1 A;  2PFB A;  3FHN A;  2MH9 A;  4S05 A;  4OIN F;  1EF4 A;  1E17 A;  3BZC A;  1NHA A;  2K9Q A;  2HYF A;  3IWF A;  2JA5 J;  1Z0X A;  4MO7 A;  2DMQ A;  3RSN A;  2NOJ B;  2G7H A;  2DMN A;  2D2W A;  4OU0 A;  2VBW A;  3P9K A;  3CUQ B;  3ASO H;  2HQR A;  4C2M J;  1OIS A;  3IL2 A;  4M3F A;  2EWN A;  5LEK A;  3JTG A;  2PJR B;  2QSG X;  4JK1 X;  5DS9 A;  3OY9 A;  2F5V A;  3HB9 A;  3ERM A;  3FIW A;  3CCY A;  3AL0 C;  2VL8 A;  2PLY A;  1HW1 A;  5JR3 A;  1RKW A;  4M3D A;  4Q47 A;  2DOE A;  2D1V A;  5E3M A;  3IH4 A;  1VZ0 A;  1X1D A;  1QQI A;  1ZKG A;  2DTZ A;  2L4M A;  1S7E A;  3LFU A;  3QQA A;  2E5N A;  5ILU A;  4E7Z A;  2HVR A;  3D0S A;  2HVQ A;  3VSK A;  2HDC A;  1JXS A;  1TWA J;  1FSH A;  1V5G A;  4BH9 A;  1EKE A;  3BR2 A;  3L00 A;  4ZYA A;  1TW3 A;  1S3J A;  3FMR A;  3KLO A;  2NS8 A;  3IHU A;  3HTS B;  4QPQ A;  1YJW I;  1T6S A;  3GYH X;  1UG0 A;  3AAF A;  3QPS A;  3WGH A;  1BI1 A;  3OYF A;  4XLE A;  2LRD A;  2M4G A;  4Q48 A;  3SYT A;  3EYI A;  1FEX A;  2X4H A;  4OOI A;  4DYQ A;  4P96 A;  5K7H A;  4CYC A;  1D3Y A;  3F3X A;  4E6K G;  3PUF A;  1QHH D;  3F72 A;  2XGD A;  1TP4 A;  1SD4 A;  3PO2 J;  2A69 F;  3DFG A;  2IA0 A;  1LFU P;  1ODD A;  2WC2 A;  1A36 A;  2LNB A;  2HZD A;  2C6Y A;  2DJN A;  2EIK H;  3G1M A;  2FUG 2;  4IHT A;  3JRA A;  1WKM A;  4RAG A;  2DPD A;  2XKO A;  4RB0 A;  4J01 A;  5EDN A;  1O57 A;  2MG4 A;  4XKV A;  2QKM B;  6PAX A;  1E0E A;  2ZB9 A;  1FBQ A;  3OYH A;  5LD2 C;  3H5N A;  2ME6 A;  1MBK A;  2BEO A;  3ZR8 X;  3ZCO A;  5C4X J;  1YW9 A;  2ZJQ F;  2KL4 A;  1PP8 F;  3RKY A;  1BR1 A;  5ICE A;  3CMM A;  3KEO A;  4E70 A;  1FP1 D;  3BR6 A;  2L3D A;  3DP7 A;  1YRN B;  3EET A;  4Y52 J;  3GUD A;  2MSY A;  3LOC A;  1DQU A;  2RNG A;  2PQ8 A;  5E17 F;  3BQZ A;  4CYC B;  5K5Q A;  3P9C A;  2QLZ A;  4CH7 A;  2LK2 A;  2EB7 A;  4LMY A;  4LIT A;  2IA2 A;  4G12 A;  3OYL A;  4QPO A;  5BMZ A;  1DGW Y;  3DLL F;  3EPZ A;  1LDJ A;  1HQC A;  4OIP F;  3U21 A;  2IS1 A;  2QA4 I;  1QGP A;  3JTH A;  3RKW A;  5D5X B;  1DP7 P;  5TGT A;  4F92 B;  3VPR A;  4IJA A;  2AS5 F;  4GYG A;  2XAH A;  4HAM A;  4XOP A;  1R58 A;  1HOM A;  4RDU A;  4PCQ A;  4HA8 A;  3FXR A;  2CG4 A;  3GTK J;  4I0A A;  2HOE A;  3F8M A;  1GDT A;  5A2Q K;  3PJR A;  1B1B A;  2HR3 A;  3IAM 2;  3RKX A;  1U5T A;  1RRJ A;  1QPI A;  4ETS A;  2KIF A;  4XSX F;  2LY1 A;  4XRM A;  3EQL F;  3RQ4 A;  3BPX A;  4UHT A;  2XV4 S;  2QEN A;  5BPD A;  4YFK F;  4NQW B;  1EH8 A;  2DK8 A;  5GAG J;  2QF7 A;  2WWY A;  3E6B A;  2E2H J;  2DFI A;  4NUB A;  1BR2 A;  3ZQL A;  1Y8R B;  1QRY A;  4LG3 A;  4BHB A;  3E6M A;  2XAF A;  3LA7 A;  2LP0 A;  4XR6 A;  3FMS A;  2DA1 A;  1K4T A;  5GAD J;  1LDD A;  3ZQF A;  2WV0 A;  3KP2 A;  1G3W A;  2Q0O A;  2EK5 A;  4LB6 B;  1Y56 A;  4FX0 A;  1K7A A;  3FXK A;  1ON1 A;  1BW6 A;  3NAR A;  3QPH A;  4OWR B;  2JVH A;  3FBI B;  3QAH A;  4IRH A;  3W6J B;  3ECO A;  1T08 B;  5M3M J;  3QOD A;  2ZKZ A;  3L7W A;  4X0G A;  1FYL A;  2A61 A;  1G2H A;  1U5T B;  2E34 A;  4HNU A;  4KIS A;  1HDP A;  4BJ6 C;  4KIC A;  5HVQ C;  2H6C A;  2EIN H;  4FE4 A;  2CUF A;  4ZJZ A;  4ITV A;  1YJN I;  2OAZ A;  5L3C A;  2KIU A;  2IP2 A;  4XON A;  2AXT C;  2CU7 A;  1F5T A;  3CZ6 A;  2CGP A;  5FJ8 J;  2JJ7 A;  4BDZ A;  4MLO A;  3NRV A;  1MD0 A;  3KP3 A;  4OMZ A;  1SD7 A;  3F21 A;  2BE5 F;  1Z7L A;  2DA6 A;  2XAQ A;  4CZZ A;  1JTX A;  3NWT A;  2Z99 A;  2M0C A;  2RQP A;  2OV7 A;  1K78 B;  3B73 A;  2MLG A;  3GFL A;  3V7R A;  2HXO A;  1SEU A;  1P92 A;  5IT9 K;  1XDS A;  5FRM A;  3ABU A;  2X1D A;  4P9U A;  4UVB A;  1ITY A;  3PO3 J;  4IEJ A;  2JSC A;  4D5F A;  4IKF A;  1EA3 A;  2V9K A;  3QOE A;  3MZY A;  5FB2 A;  5E3N A;  1B59 A;  3ZMU A;  3HTU A;  3BG3 A;  2KDO A;  1ZAR A;  3UKG A;  2FMY A;  4FX4 A;  1G4D A;  2A07 F;  4CCL A;  2QKL B;  3QU3 A;  3BG6 A;  4W1U A;  1IZ1 A;  3G4S I;  1F1Z A;  2BW3 A;  1ZYR F;  1UST A;  2X9D A;  3K1N A;  2VJ5 A;  4DBQ A;  1MBF A;  3V4G A;  3TO7 A;  2GWR A;  4P55 A;  5F64 A;  4D1Q A;  1XGS A;  2K85 A;  3JR9 A;  1P4X A;  4XN3 A;  4WWC A;  2EPF A;  3PIP F;  2R5Z B;  1FOK A;  2MD5 A;  2GXB A;  2X0L A;  5DUI A;  4Y15 A;  3K4C A;  1YG2 A;  4GO1 A;  4KFC A;  1WPK A;  3F6V A;  3S14 J;  1Z3X A;  5DD8 A;  4WXH A;  3Q9S A;  2IGN A;  5JLW A;  1R9T J;  3I59 A;  5E18 F;  1WZ2 A;  2DPU A;  1RKT A;  1A6Q A;  5HDG A;  1MDM B;  5D4R A;  3SJM A;  3CF5 F;  1MMD A;  2DA2 A;  3P9I A;  4YG2 F;  2VUM J;  2V1N A;  4PFP A;  1U6G A;  2FXA A;  5EEA A;  5B1A H;  1RC9 A;  4UY8 I;  2NXN B;  2F6C A;  1Q1H A;  2E1M B;  2HWV A;  5A2Q Z;  1IN5 A;  1WHU A;  4G7H F;  3PUB A;  1R4N B;  4IRI A;  1Z67 A;  5FLV A;  2M8E A;  2WAF A;  3BJO A;  3D5R C;  4XLF A;  3F9K A;  5F1J A;  4L0Z B;  1X3W B;  2WBM A;  3J7A O;  3R60 A;  2LH9 A;  3K4K A;  2EFP A;  2E7X A;  2GXG A;  2GIV A;  2V26 A;  4XK4 A;  4KN4 X;  1Y8Q B;  1IN4 A;  3K6G A;  2KDZ A;  4AYB N;  1SD5 A;  3HDD A;  4PJN A;  1STZ A;  1FJL A;  3BTI A;  4TV7 A;  1BOA A;  4IVN A;  5GAE J;  2HYJ A;  1ZRE A;  3VEP A;  5K7F A;  3WTV C;  2V1U A;  1BW5 A;  4CXF A;  1OFC X;  2VI6 A;  4F3Q A;  1T95 A;  3GO5 A;  2L9V A;  2VKD A;  3O2P E;  1VQ9 I;  2B9S A;  1Z05 A;  4CHU A;  4CCM A;  2ID6 A;  3PNV A;  1X3Z B;  2Y75 A;  3WTX C;  1VQP I;  2R7X A;  2ZNZ A;  3M1C A;  4A6D A;  3OOP A;  1R7J A;  2JA2 A;  2FBI A;  2MA3 A;  4NC7 A;  2DOD A;  2H1L A;  3K9T A;  1A5J A;  2X1C A;  4PJ0 C;  5CVJ A;  3HGG A;  2IS6 A;  4ZTF A;  1O3S A;  2YS9 A;  1I1S A;  4AUX A;  2RV8 A;  4LD5 A;  5CVR A;  4IXA A;  3H5A A;  2COM A;  4RGS A;  1JKP C;  4PFO A;  3CES A;  2YPR A;  5ILV A;  2CW8 A;  1ZR2 A;  3GTM J;  2JA8 J;  1IUF A;  2BY2 A;  3BTC A;  4F93 B;  5IYD J;  3DQV C;  5GPA A;  4XOR A;  5BOX A;  2CV1 A;  1WJE A;  3L2W A;  5F0C A;  2R5Y A;  3WTU C;  4M6Y A;  4C2T A;  2UZK A;  3GBG A;  1ZR4 A;  4XLC A;  3V7S A;  4CO8 A;  2RAE A;  2MFZ A;  1MZB A;  4BDY A;  4DIQ A;  1SFX A;  3HKZ N;  3OS2 A;  5IT9 Z;  4XL9 A;  2O0Y A;  4XKW A;  4AYB A;  1JGS A;  1ZAO A;  2LG4 A;  4PJM A;  2H8W A;  1AOY A;  4IL6 C;  2W25 A;  5BNG A;  3OYM A;  4FE7 A;  5D8K B;  3CJT B;  4XLH A;  4BUP A;  2L4A A;  3E0J B;  3NQO A;  2HPM A;  1XSD A;  3BR1 A;  3V8K A;  3GZ6 A;  3FF5 A;  3FKI J;  2L7M P;  2ISY A;  5IYC J;  1IO2 A;  1BI0 A;  1ETX A;  5FKN A;  3BY6 A;  4J19 A;  2L7F P;  5B66 C;  4KMF A;  1CGP A;  1FTT A;  4NB5 A;  1KGS A;  3JRC A;  2QM3 A;  5F0F A;  4LOC A;  3K4N A;  4I01 A;  3VSL A;  3L09 A;  2Q2E B;  1XPX A;  3G73 A;  2VB6 A;  3LSJ A;  2EH3 A;  3UR3 C;  2R5Y B;  1Z91 A;  3RYR A;  3C1D A;  2BZT A;  3QU6 A;  3RZD J;  2DDB A;  2O3F A;  4ZDP A;  5HOO A;  3WOD F;  2D5V A;  3GEZ A;  2EZL A;  2QBY B;  2EBI A;  2FNA A;  4ANJ A;  3SXY A;  5DTD A;  4RAY A;  1W0U A;  1XMK A;  1HW2 A;  3IH2 A;  3CME I;  1JUP A;  2EIJ H;  2ZME A;  2V6E A;  3JRG A;  3LSM A;  1DU0 A;  5LRR A;  1IDZ A;  1LE8 B;  2HOA A;  5CYV A;  3H36 A;  1VQO I;  1R49 A;  2HDD A;  4DOZ A;  3FMQ A;  1HKQ A;  1QVU A;  4B8X A;  2Y30 A;  1FYK A;  4H4K C;  5D6F A;  3HKZ A;  1NG6 A;  4EGZ A;  2G0E A;  2XHK A;  3C18 A;  2KFD A;  3SDB A;  2H8R A;  4A0Z A;  1UAA A;  2W57 A;  2UWM A;  3DTE A;  3GFM A;  3CD6 I;  2R7S A;  2V1X A;  3DKW A;  2ZXJ A;  5E3O A;  4LJZ F;  4QWQ A;  2BOL A;  1ZG3 A;  3RZO J;  4A69 C;  3HBL A;  3MMY B;  1X4P A;  4V2G A;  2XUB A;  1KON A;  3MKZ A;  2Z2S B;  3OYC A;  3OWT A;  1XSV A;  4RMN A;  3VFZ A;  1JGG A;  1B72 B;  1WQ2 A;  4MEX F;  1DPR A;  2R7O A;  2CQX A;  3CCR I;  1HW5 A;  3U9G A;  2E19 A;  3HIF A;  1SMT A;  2M30 A;  1T38 A;  3VYU B;  1BR4 A;  1SFO J;  1HBX G;  2HPI A;  3MAJ A;  2EA4 A;  2K40 A;  2XRL A;  5EJC A;  3VDX A;  4G94 A;  4B09 A;  3S1N J;  2JA7 J;  1ETY A;  1D1A A;  2PBI A;  2YR2 A;  3ZMT A;  4RB1 A;  4CUG A;  4PGH A;  3P5J A;  2MAB A;  5C3E J;  2XGX A;  1XCV A;  1SVO A;  2CV0 A;  4M71 A;  3KEQ A;  1MBE A;  2LOO A;  3MZ8 A;  4V19 K;  1G3S A;  2QWW A;  2QEX I;  5DDG A;  2RRE A;  3CCJ I;  2I5U A;  2M3A A;  4IZZ A;  5FGM A;  2OTJ I;  1V5F A;  4GGG A;  2VC1 A;  4S0H B;  5J1Y A;  3COA C;  3TL4 X;  1ONV A;  2A68 F;  1X58 A;  2V4J C;  3A02 A;  3WU1 B;  4PSX A;  3CC2 I;  4M9Z A;  4HST A;  3HOS A;  3HSF A;  3K2Z A;  1ZG5 A;  4AC0 A;  5HNF A;  5GTH C;  2ZME C;  4D9J A;  5E79 C;  1HKT A;  1IW7 F;  2CSO A;  4BQN A;  4O3M A;  4BEH B;  2E2I J;  3M8E A;  4UV9 A;  1SMY F;  3WTT C;  3WE3 A;  3B02 A;  4DQ2 A;  1S7O A;  2XKP A;  5L3D A;  3UNG C;  5LGN A;  3S3M A;  2R7T A;  1MSE C;  1HKS A;  1ZLK A;  2HGC A;  1WH5 A;  4MHG A;  2OTL I;  2M0M A;  2HTJ A;  1I6H J;  2TCT A;  2Y9Z A;  1MMG A;  1WCM J;  2ZJ2 A;  3TO6 A;  2XAJ A;  4HBL A;  2Z3Y A;  4ZYE A;  2LC2 A;  1MH3 A;  5E8G A;  2VOP A;  5J1R A;  4G7Z F;  4RAF A;  4A3C J;  3CUQ A;  1B6A A;  2KLO A;  2Z5U A;  1Y0N A;  3G1L A;  3X2Q H;  4RLF A;  2STT A;  2Y2Z A;  3DU6 A;  3H0G J;  4EV0 A;  1MMA A;  4C3J J;  3FZV A;  3LA3 A;  3BG7 A;  1B4A A;  1A35 A;  1BBY A;  1QPM A;  2VPR A;  4L5J A;  5E20 A;  4UVA A;  3CCL I;  2OD5 A;  2XF6 A;  3I64 A;  1BOB A;  5EZH A;  1FT9 A;  1U2W A;  4L5E A;  3HOZ J;  3G2B A;  2DO7 A;  5HLT A;  1ETQ A;  5KVR A;  3GFI A;  3TW7 A;  4XM3 A;  1AHD P;  1LFP A;  3S2W A;  5LBQ A;  3FXM A;  1ZG1 A;  2KQR A;  3G6E I;  1VQ7 I;  1KU9 A;  1IRZ A;  3QP5 A;  2GA1 A;  4XBF A;  2RC4 A;  3ZQI A;  2R7Q A;  3BR5 A;  1REP C;  3ZMD A;  4G7O F;  4AWX B;  3ZN1 A;  4KN7 X;  4XKC A;  4E7J A;  4MTE A;  5H6R A;  2I8D A;  2XGE A;  4WXC A;  5AON A;  1WSU A;  1HC8 A;  2DFH A;  1H0M A;  3TGN A;  2KP6 A;  2FOW A;  3GWZ A;  1AWC A;  1PUF B;  2HS5 A;  4U0V A;  5JFR A;  3F22 A;  2HOT A;  4CDG A;  3OIO A;  5HNH A;  4N0B A;  3IP4 B;  4BE2 A;  5HLH A;  1LKX A;  1FNN A;  3AG3 H;  4QLC U;  4G6Q A;  5IP9 J;  3FKJ A;  3RI4 A;  1V55 H;  3DU5 A;  2CJJ A;  2DT7 B;  3E97 A;  1YW7 A;  2OC6 A;  4M3E A;  2Z9O A;  2ZCW A;  3K4L A;  4HPQ A;  1LQ1 A;  2R4G A;  1TQP A;  4IQ4 A;  4NDL A;  1HLV A;  2FA5 A;  3H3Z A;  3I53 A;  2HOS A;  1QZZ A;  2IGM A;  1J59 A;  1BIA A;  2L01 A;  5L3B A;  2NVQ J;  3BR0 A;  4L0Y B;  3CUQ C;  2P8T A;  1IV6 A;  2E36 A;  1T0F A;  1IV8 A;  4OAZ A;  3ZGK A;  1IRX A;  3IV5 A;  2LF7 A;  4M9S A;  4I76 A;  1YRN A;  1GV5 A;  1TC3 C;  4HF1 A;  3LNQ A;  4R1H A;  4XQF A;  2BGC A;  3HSE A;  2R93 J;  4A93 J;  2DOA A;  4CCN A;  1P9Q C;  5IT3 A;  3OYG A;  3K70 D;  1N78 A;  3WG9 A;  1YX3 A;  4HSR A;  4PJL A;  1MND A;  2K9M A;  2WTE A;  4DW6 A;  2BY1 A;  2FQ4 A;  5L3G A;  2ADU A;  5LRS A;  2R7V A;  3QYF A;  2VC0 A;  3RPU D;  1U3E M;  2X85 A;  1RPW A;  2EV5 A;  4QSH A;  4ZZL A;  1FLI A;  1XTA A;  1OJL A;  3J81 K;  2X48 A;  1ETV A;  4HOB A;  2BV6 A;  1QVT A;  1P2F A;  2EFW A;  5JHF A;  1ON2 A;  3I71 A;  2FRH A;  4II2 A;  4N9I A;  3GLL A;  1X4O A;  4EJO A;  4JX5 A;  4A6E A;  2OZ6 A;  1D8K A;  4QTR A;  3DTK A;  3FM3 A;  4AD9 A;  5LEJ A;  3HOU J;  9ANT A;  3R61 A;  4GYI A;  3RQI A;  2V9P A;  4K2E A;  3WE2 A;  4M74 A;  4PDK A;  1OCP A;  3TP3 A;  5EG0 B;  3BTJ A;  1CF7 B;  3T5X A;  3BPV A;  3LQQ A;  1GXP A;  2EIM H;  4M72 A;  2M7B A;  5TJJ A;  2P4W A;  4KNY A;  1X1A A;  2XPV A;  2VKV A;  3BDD A;  3K1P A;  5FD5 A;  4BAY A;  1J2X A;  3J7Z I;  4NQW A;  5FKO A;  3CP2 A;  1SAX A;  4MFD A;  2QQ8 A;  1QA6 A;  2MLK A;  1ZRF A;  2W48 A;  2BVL A;  3LAJ A;  2HNH A;  2XIG A;  2PI0 A;  3GW2 A;  1VFC A;  1OYI A;  2LD5 A;  1YHQ I;  2QQ9 A;  3OYB A;  1UZC A;  4ASN A;  1W36 C;  2ECC A;  2YU3 A;  2OPT A;  3IUO A;  1VQL I;  2R3S A;  2ELH A;  1GLN A;  1W5T A;  2DQL A;  1JHH A;  1OPC A;  1T0F C;  4MNU A;  1S8N A;  1WJF A;  2VON A;  2OCE A;  2IGO A;  4B3A A;  1F4K A;  3W2W A;  2DQR A;  5J3L A;  2PMH A;  3EUK L;  4ESJ A;  1YI2 I;  1D0X A;  3CP8 A;  5FLM J;  2DT5 A;  5KNL A;  3M3Y J;  1I1G A;  3Q0V A;  4U0Y A;  3CTA A;  2DFE A;  1UB9 A;  1MJB A;  2VT3 A;  1VQ8 I;  4BYY A;  2P5K A;  1IJW C;  1S7A A;  1FP2 A;  1R1V A;  3L2R A;  2WA0 A;  3W6V A;  3PNT A;  1EH7 A;  3LL7 A;  3K0L A;  3DBR B;  3CDL A;  1OCZ H;  3DF8 A;  1WVR A;  3ELK A;  1RI7 A;  1GVD A;  2L7Z A;  4LK0 F;  5IYB J;  3HRS A;  4C3I J;  1ETK A;  3R4K A;  1ZLJ A;  1XCB A;  2O8X A;  3PSF A;  2DCE A;  1I27 A;  4J00 A;  4MIM A;  1FYM A;  1X2M A;  5LHI A;  1R71 A;  3V42 A;  4RGR A;  3I4N J;  1K78 A;  5H2F C;  2CH0 A;  3L2U A;  1ZRD A;  3BJA A;  2XF7 A;  1JT6 A;  3PM1 A;  5DM6 F;  4G8X A;  2DN0 A;  2NS7 A;  1Z77 A;  3ISP A;  3W2V A;  3AG4 H;  3OMY A;  1X1C A;  5IOY A;  1MH4 A;  4IRG A;  3KYL A;  1BL0 A;  3A2K A;  3JRH A;  2YX4 A;  5M5Y J;  1WRJ A;  1ZN2 A;  3IRQ A;  3ABL H;  3E3V A;  1RES A;  2K3P A;  4OAY A;  2IXS A;  1R36 A;  2L7K A;  1XGN A;  4RGX A;  2EFO A;  3H35 A;  1WJB A;  4BBR J;  4AIH A;  3I58 A;  3KLN A;  4XOT A;  5LGU A;  1POG A;  4EQQ A;  3HOT A;  2VAS A;  3K4M A;  2FE3 A;  3FXO A;  2X51 A;  4GRI A;  1O7L A;  1Z1D A;  2FX0 A;  2GQQ A;  3EUH A;  1TTY A;  2R7W A;  5DD4 A;  4AU7 A;  2DMU A;  3HL2 A;  1MSF C;  2JMW A;  4DJA A;  1OKR A;  2XVC A;  4U0W A;  1U9N A;  4Y17 A;  5J6X A;  5C44 J;  2G9W A;  3F23 A;  2R5Z A;  1K6Y A;  1N25 A;  2DMP A;  2Z16 A;  2O61 A;  4L9J A;  1JUS A;  4L9V A;  4BY7 J;  4YIR X;  3BCA A;  3ABT A;  2L0K A;  1R00 A;  3DKY A;  2NAZ A;  2W24 A;  1W7P D;  4WF2 A;  1U5T C;  4XID A;  3J81 Z;  2ZFW A;  4UNO A;  1SFE A;  3RPQ A;  2HQA A;  3OYN A;  2IAI A;  3L2C A;  1K61 A;  2E1N A;  1MDM A;  4KDP A;  3CO6 C;  4KIF A;  4OIR F;  3KX2 A;  2W00 A;  2QSH X;  1I3Q J;  5F0H A;  1X2N A;  3H92 A;  2F48 A;  1B9N A;  3I4P A;  3U1K A;  1F36 A;  2O6G E;  3CF2 A;  2L54 A;  2JRT A;  5KAI C;  4HX8 A;  1T56 A;  3JRB A;  4LIV A;  5CJ9 A;  1H89 C;  3HRM A;  1BI3 A;  3HXL A;  4F91 B;  1Z21 A;  2CW0 F;  1ORK A;  1QHG A;  1ZHF A;  3H5R A;  1IDY A;  1QO0 D;  2HU9 A;  3CJR B;  1H9G A;  1K4S A;  2A3S A;  2KPM A;  1W4M A;  4MEY F;  1NK2 P;  2AQE A;  2NYX A;  2OJE D;  5CKT A;  1Z6R A;  2NNY A;  1X1B A;  3NWS A;  2JN6 A;  4Q4Z F;  4X6A J;  4HZF A;  4N4N B;  4HV5 A;  4IQJ A;  2CMP A;  3TKY A;  4DNC A;  2XPU A;  1TT5 B;  5KAF C;  2RGV A;  1MBG A;  1NTC A;  2P7C B;  3GTO J;  4IHX A;  5EGO B;  1YYV A;  1R6R A;  1ZEL A;  3WGG A;  2GXA A;  3H3U A;  2JUG A;  2OQG A;  4D0P A;  2BVM A;  2ELK A;  5HS9 A;  3CJN A;  5LLQ A;  3CCE I;  2VQL A;  4M6V A;  5CQE A;  1SAN A;  4RB2 C;  2M2E A;  1OCO H;  4A3G J;  1ZRC A;  2E2J J;  4XSZ F;  3KET A;  5M5W J;  1XMA A;  2ZBK A;  4XMY A;  1D0Z A;  2UV1 A;  3K2A A;  1RUO A;  3L2Q A;  1EH6 A;  2JSP A;  4A5N A;  2JPC A;  1KQ9 A;  5E1Z B;  4A0X A;  5EF6 A;  2HVS A;  3G71 I;  3RJP A;  4BNC A;  4PZJ A;  4HDU A;  2M5W A;  2Z1D A;  2DA4 A;  1YIT I;  3RDI A;  2LY2 A;  1B8I B;  3OYI A;  1HF0 A;  1UHW A;  5D8L B;  2HYG D;  4JYK A;  3Q9V A;  1J7K A;  2VXZ A;  3G3Z A;  2QYO A;  3DCF A;  4IF4 A;  1FY7 A;  3BG9 A;  2VE8 A;  1LFB A;  2EV0 A;  3CDH A;  5HOD A;  1U8B A;  2O5R A;  3A01 A;  3ASN H;  2QUF A;  2ICW G;  3ROU A;  4HF2 A;  3KZZ A;  3HG9 A;  4F52 A;  2ZXW H;  5J4V A;  3S8P A;  1H88 C;  1UFM A;  2E1M C;  4EVI A;  2W7N A;  4DYC A;  3KZY A;  3E1S A;  3GCM A;  3U2R A;  3CCM I;  2L5Q A;  3AG2 H;  3E5X A;  4ZZD A;  1V5E A;  3AG1 H;  1Z6T A;  3DPL C;  4ZDO A;  1KA8 A;  3U1D A;  2XAU A;  2PMU A;  1S29 A;  2ZC2 A;  1FC3 A;  1S5L C;  1P4A A;  2B63 J;  1JHF A;  3REO A;  3B6C A;  5HDN A;  4A3F J;  4PK4 A;  2EZK A;  3FM5 A;  3E6C C;  2CYY A;  2F4O B;  3T1B A;  1T39 A;  1UG2 A;  2JPB A;  1XB4 A;  2Q2E A;  2Y0M A;  2QSF X;  3A01 B;  1BJA A;  2DTR A;  1UHS A;  2K5C A;  5D5U B;  3MVP A;  5CLS A;  1J9I A;  1FWZ A;  2HFH A;  2PN6 A;  5HS8 A;  2DOF A;  3OSF A;  2FJ1 A;  2QBY A;  3KFW X;  1IF1 A;  3MFK A;  1WJA A;  2HKO A;  4A3K J;  4B4C A;  4BJT A;  3VYT B;  2E35 A;  2F5D A;  3BJ6 A;  1YJ9 I;  1X3U A;  2M45 A;  5JVG F;  4XKB A;  1FMV A;  2E71 A;  3I0T A;  4P5O A;  1YLF A;  1FZP B;  4BL0 B;  4LG0 A;  1LE8 A;  2UUZ A;  4NC8 A;  4AIJ A;  5JI6 A;  1CQT A;  2MGQ A;  3OL4 A;  1SAU A;  4YFX F;  4Y7N J;  3PQK A;  1U78 A;  4ZC3 A;  2RN7 A;  2VBY A;  4BXX J;  2JK3 A;  5CVI A;  2QQA A;  4L9N A;  2EIL H;  4F55 A;  3H0D A;  3C2H A;  4KIG A;  2P6S A;  3VB2 A;  4B1R A;  2FQ3 A;  2KRF A;  2MBF A;  3H1C A;  4UUS A;  2PEX A;  2XAG A;  3KPH A;  1TWG J;  2M7A A;  1PJR A;  5FLX K;  1KQ8 A;  3GX4 X;  1W5S A;  2LRE A;  2VJJ A;  1G59 A;  1MNE A;  2DA7 A;  2ECB A;  2GA2 A;  2KIS A;  2W1O A;  4ZTJ A;  3SZP A;  2FBK A;  1B72 A;  2JUC A;  1APL C;  1W0T A;  2YU9 J;  1D1C A;  2L9N A;  2VBZ A;  4JQF A;  3LAP A;  1RR7 A;  2LDU A;  5DCM B;  4ZYD A;  4WXD A;  4BXF A;  2PMZ N;  3K70 C;  4LG0 B;  2EFN A;  2NVT J;  2DLL A;  5F1R A;  3GTP J;  2F2E A;  4HRI A;  1R22 A;  2VT2 A;  5M5X J;  4BKX A;  3TOB A;  1D1B A;  3CO7 C;  1RZ4 A;  1WJD A;  1MMS A;  3FHZ A;  3F8F A;  2E60 A;  1R5G A;  3R6S A;  2A05 A;  2CQN A;  3TBI A;  5IOZ A;  1XS9 A;  2IS2 A;  4EM1 A;  1V3F A;  2A6E F;  3JRE A;  2QGU A;  1Z7U A;  4DBR A;  2O8K A;  2G7U A;  3LFK A;  3M8F A;  4UUS B;  1FMW A;  1LEA A;  5K7Z A;  2HEO A;  1XMX A;  2Q1Z B;  4S04 A;  4BQQ A;  2F5F A;  5DV5 A;  3HJE A;  3IC7 A;  2LFB A;  1XGM A;  1W1W E;  5FKK A;  2HQ5 A;  3GFJ A;  3WTS C;  3S2D J;  1SC7 A;  4LK1 F;  3NEU A;  4HYE A;  4P9F A;  2D1H A;  2IPQ X;  3DEU A;  5FKL A;  4A3E J;  2VKH A;  1FPQ A;  1G3T A;  2XDV A;  3WTW C;  1OCT C;  5HS7 A;  2CW7 A;  3WU0 A;  4E7K A;  1O7F A;  5FRO A;  2VJ4 A;  3C3W A;  3KP7 A;  2EV6 A;  2BXZ A;  2X6Y A;  3BLY A;  4YEJ A;  1LEB A;  4BEH A;  2X6X A;  4XLA A;  2K3F A;  1PDN C;  4IHW A;  2NNN A;  3SEZ A;  2DFF A;  2YX7 A;  2CV2 A;  3V8J A;  4HF0 A;  4IO9 F;  2OU2 A;  2VOD A;  2IS4 A;  4FET A;  4ABZ A;  3E6D A;  2PJP A;  2KRH A;  4X1E A;  2R7U A;  1YS7 A;  2ZNY A;  1YOV B;  3I5U A;  4PSW A;  3BWG A;  4A5M A;  4R79 A;  4LB5 A;  2PMZ A;  2LY9 A;  2K86 A;  3IKT A;  1VQK I;  3HOY J;  1AKH A;  1Y39 A;  2FML A;  3OV8 A;  5M3F J;  5LFA A;  4A12 A;  2Y69 H;  2V7F A;  3H3V K;  3L1P A;  4HV6 A;  1YFH A;  1OYY A;  4A3J J;  1JKR C;  3ZMZ A;  4B43 A;  3GZN B;  3R0A A;  2XF5 A;  1IXC A;  5AIQ A;  5L3E A;  5ERI A;  2IW5 A;  3S17 J;  4I7H A;  2A5W A;  4C2U A;  3HPG A;  1ENH A;  2E5Z A;  3CDI A;  5HLI A;  2HKX A;  1YQA A;  5EYR A;  4I98 B;  1S9H A;  3HRT A;  1E3H A;  3SQN A;  1ETW A;  4Q5S F;  5KK1 A;  3HPH A;  3FBN B;  1JE8 A;  2K9N A;  2ZFU A;  4C3H J;  4JX6 A;  3SEQ A;  3VOD A;  2LKS A;  3A0B C;  2AO9 A;  2NRA C;  3G1O A;  2JQ7 A;  3PFI A;  5LHH A;  1AKH B;  1D0Y A;  2KZV A;  3TOA A;  4CCK A;  1DPU A;  3FXU A;  4HG2 A;  3DTI A;  1TW2 A;  4FIS A;  4O6J A;  1QZE A;  2A5Y B;  3HSR A;  1W7P B;  2NVU B;  4EM0 B;  1Y1W J;  3JSP A;  1V54 H;  1PUF A;  1SVM A;  3A0H C;  5IP7 J;  2LBF B;  4UUT A;  3I3L A;  1ZTR A;  3TW6 A;  4O5V A;  5BQT A;  2L2O A;  3WTY C;  3DV8 A;  3HZJ A;  5CVV A;  4JX4 A;  2I10 A;  5BPI A;  4XNF A;  5FLX Z;  1IN8 A;  4M3G A;  3PFY A;  1QU3 A;  5GTI C;  3OIQ A;  4RAZ A;  3M07 A;  4XIC A;  3AL0 B;  3D5L A;  1YS6 A;  1ACI A;  3F8C A;  2CFO A;  1PYV A;  3K10 A;  4A3I J;  1TL8 A;  5F08 A;  2JRM A;  3W3C A;  1JUM A;  5JLX A;  2KHM A;  2JT1 A;  4EAT A;  3H9Q A;  5B1B H;  1USS A;  4C30 A;  4L5I A;  2Y31 A;  3ZOB A;  1G3Y A;  3KIO A;  1UMQ A;  2MYS A;  4E4H A;  2XGC A;  3RCO A;  2ZJR F;  3HOV J;  3IWZ A;  1RIO H;  1Q1V A;  2JTV A;  1NH3 A;  4RB3 C;  1TZL A;  5B5E C;  3V8L A;  2Z33 A;  4L18 B;  4HX4 A;  3W6K B;  4UB8 C;  1KU7 A;  1WWX A;  5B3S H;  3GTL J;  1JT0 A;  1FIA A;  2CRG A;  5HLG A;  2NOG A; 
#chains in the Genus database with same CATH homology
 1XDU A;  1O3T A;  5J8C A;  2XAS A;  3M9A A;  3DPT A;  2F5E A;  3ZN0 A;  2J5O A;  1UHM A;  3JSO A;  2GAU A;  4XRF A;  4HLY A;  2Q8K A;  3WGI A;  2RKH A;  4UUV A;  1OYW A;  1V4R A;  1TQI A;  2FSW A;  2FF4 A;  4Y13 A;  2K02 A;  4U88 A;  2FEZ A;  3IKV A;  2OZU A;  1T2K A;  1ZGA A;  1CF7 A;  2IVM A;  5AIP A;  4G9Y A;  2CFX A;  3MCZ A;  3HYI A;  3FWE A;  5EEH A;  1KYZ A;  1OR7 A;  3F8B A;  5K1Y A;  2E1C A;  4MQV A;  2OBP A;  2ACJ A;  3N97 A;  1YIO A;  2EFQ A;  4I02 A;  4BXU A;  4ZYG A;  2RDP A;  3EDP A;  3HUG A;  3TDU C;  1SD6 A;  1MJA A;  1XD7 A;  3L9F A;  2IJL A;  1TNS A;  4OIQ F;  2Y48 A;  2YSR A;  5F6F A;  2STW A;  2DU9 A;  2L02 A;  2PG4 A;  4I0B A;  2F5C A;  2LKP A;  1LB2 A;  1R5H A;  4KUM A;  3VOE A;  2JZY A;  3ZMV A;  1KQ0 A;  2VE9 A;  3V7C A;  2K7L A;  3GZ5 A;  1TBX A;  3ERE D;  2R7F A;  2ZO4 A;  4A0Y A;  1IAW A;  4CYD A;  3ZPL A;  2H27 A;  5ILS A;  2DK5 A;  4F7Z A;  3E5Q A;  2BYV E;  5EEG A;  1BM9 A;  4LLG F;  1ZGJ A;  3J80 K;  1P6R A;  2UXN A;  1A04 A;  3BRO A;  5H6Q A;  2V6C A;  3LWF A;  4OMY A;  3QP6 A;  4OIO F;  1MJ9 A;  2HQN A;  3K1M A;  4GCV A;  5DYM A;  4BHP A;  4AIK A;  2KJC A;  1OMI A;  1R1U A;  3P7N A;  2KJB A;  4GXO A;  2P5L C;  2H09 A;  2P6T A;  1XN7 A;  1IRF A;  2OQR A;  1B9M A;  3LQR A;  5D5W B;  3BOQ A;  3QOP A;  5E1W A;  5E8I A;  1BN5 A;  5D4S A;  1FX7 A;  4A2U A;  1TNT A;  3TO9 A;  1HXD A;  4JBA A;  4L9T A;  3MWM A;  1Y0U A;  3SFZ A;  3EYY A;  5K5O A;  1HST A;  2V9V A;  2GZW A;  3ULQ B;  1IXR C;  1U8R A;  2K27 A;  1UCR A;  1MKM A;  4ON0 A;  4EMS A;  4EJV A;  5LHG A;  3C7J A;  2RVC A;  3O3K A;  1XSX A;  2CQK A;  1RNL A;  3R0J A;  5FFX A;  1R23 A;  5TRD A;  1TLH B;  3BP8 A;  4WCG A;  1GXQ A;  5FD6 A;  4IPA A;  2A6H F;  4FHT A;  1HSJ A;  1J75 A;  4MGR A;  4ENJ A;  4U7B A;  2QQB A;  1Z9C A;  1XGO A;  2OA4 A;  3RIR A;  4LLN A;  3QPT A;  4PGG A;  5LGT A;  5JHU A;  3LA2 A;  4I2O A;  1LDK B;  1YO5 C;  2E7W A;  2H94 A;  3RYP A;  5DCF A;  1I6X A;  1FBS A;  2ISZ A;  3Q5F A;  2ESN A;  2FBH A;  3BZ6 A;  2BBY A;  2UXX A;  2W85 A;  1KU2 A;  3J80 Z;  1D5V A;  1J0R A;  3ZP5 A;  2FOK A;  5FO5 A;  1RUN A;  3JW4 A;  5ICG A;  3HHH A;  3KE2 A;  2M87 A;  3CUO A;  2LF8 A;  1D8J A;  2EA2 A;  3ZMS A;  1DDN A;  2AXL A;  3MEX A;  4LFU A;  3TQN A;  2CWE A;  3F8N A;  3MQ0 A;  4EGY A;  4XLP F;  4EJW A;  4HDV A;  2KIM A;  1DUX C;  1BC7 C;  5HDK A;  2EJR A;  1H9T A;  3JAM K;  1P4W A;  4ENN A;  3I59 B;  1SFU A;  3GF2 A;  1QZY A;  2B0L A;  4ZYH A;  3IRR A;  4AVP A;  5L3F A;  4IHS A;  2FU4 A;  3RPU A;  3M1E A;  1KYW A;  1LJ9 A;  4ZH4 F;  1GVJ A;  4RS8 A;  1FBU A;  2M1B A;  3O6B B;  1L3L A;  4EM2 A;  1ULY A;  2DI3 A;  4YIF A;  2ESH A;  4N9H A;  4NHJ A;  5ED4 A;  5D6E A;  3E5U A;  4UVC A;  4WK8 F;  3KP5 A;  1IN6 A;  1BIB A;  5D5V B;  1I5Z A;  5DCM A;  3T0Y A;  2KKO A;  3GXO A;  1F9N A;  3GVA A;  1O3Q A;  5FFZ A;  4CIC A;  2O03 A;  4BQA A;  2FNP A;  4G6D A;  4EJT A;  1YTY A;  5H20 A;  5J8F A;  1IUY A;  2QVO A;  3HRU A;  1R1T A;  2P5V A;  4ESF A;  3FXQ A;  2ETH A;  1QBJ A;  1IRG A;  2R7D A;  4FT8 A;  2VBX A;  1C0W A;  4HLX A;  3DXJ F;  3ML6 A;  4HQM A;  4I09 A;  1K79 A;  5JVT A;  3SZT A;  1TQM A;  1PUE E;  4U7D A;  3M7G A;  1G6N A;  2NS0 A;  4M6X A;  4M9X A;  4KA4 A;  4M73 A;  3K69 A;  3KCC A;  3LST A;  1BI2 A;  1YW8 A;  1VTN C;  2XRN A;  2DBB A;  5K5R A;  4ESB A;  2RNJ A;  3WTZ A;  2CO5 A;  4MTD A;  3T8R A;  4UXN A;  3F6O A;  1IXS B;  1S6L A;  3FX3 A;  4KMU X;  4RGU A;  1T98 A;  4CGZ A;  1MGT A;  4KIB A;  4KT5 C;  4HW0 A;  5DUK A;  2IT0 A;  4Z2Y A;  3RTR A;  3JAM Z;  2V1D A;  3SHF A;  3TDZ C;  5ICF A;  1GHC A;  2HTS A;  3N4M A;  2ZME B;  1PP7 U;  2H6B A;  4EJU A;  4KYW A;  5BS6 A;  4LGW A;  3GLX A;  4BHC A;  3HHG A;  5DEQ A;  2HZT A;  1QNT A;  1W7P A;  3I54 A;  2D45 A;  3QRF F;  1BC8 C;  2VN2 A;  2MC3 A;  4YFN F;  1WI9 A;  2K4B A;  5E1X A;  5ICC A;  2W84 A;  3MZH A;  1IN7 A;  1K6O A;  3ECH A;  3ZQ7 A;  4HX7 A;  4MQ9 F;  2VOO A;  1O3R A;  2TDX A;  2K4J A;  2XRO A;  1KU3 A;  3T8T A;  4YII A;  3KP4 A;  1FSE A;  4LLL A;  2P7V B;  3CLO A;  5CVU A;  2QZ8 A;  1LVA A;  2V79 A;  2IRF G;  1LNW A;  3KP6 A;  4HQE A;  2J5P A;  4ENM A;  4R8H A;  2LSO A;  2DAO A;  1ZH5 A;  1E2X A;  2MH2 A;  1L0O C;  3PQJ A;  1EV7 A;  4ENK A;  4WX9 A;  4H0E A;  4UV8 A;  4XLN F;  2DW4 A;  1J5Y A;  4S05 A;  2PFB A;  2IA1 A;  2MH9 A;  4OIN F;  1E17 A;  1NHA A;  2HYF A;  3IWF A;  2G7H A;  2D2W A;  4OU0 A;  2VBW A;  3P9K A;  3CUQ B;  2HQR A;  3IL2 A;  2EWN A;  5LEK A;  3JTG A;  4JK1 X;  2PLY A;  1HW1 A;  5JR3 A;  4Q47 A;  2D1V A;  1QQI A;  5ILU A;  2L4M A;  3D0S A;  2HDC A;  1JXS A;  1FSH A;  4BH9 A;  3L00 A;  1TW3 A;  1S3J A;  3FMR A;  3KLO A;  3IHU A;  3HTS B;  1T6S A;  3GYH X;  3AAF A;  3WGH A;  1BI1 A;  4Q48 A;  3EYI A;  2X4H A;  4OOI A;  4P96 A;  1D3Y A;  3F3X A;  3F72 A;  1SD4 A;  2A69 F;  3DFG A;  2IA0 A;  1ODD A;  2WC2 A;  2LNB A;  2C6Y A;  4IHT A;  1WKM A;  2DPD A;  2XKO A;  4RB0 A;  1O57 A;  6PAX A;  1FBQ A;  2BEO A;  1YW9 A;  1PP8 F;  3RKY A;  5ICE A;  3KEO A;  4E70 A;  1FP1 D;  2L3D A;  3DP7 A;  3EET A;  3GUD A;  2PQ8 A;  5E17 F;  5K5Q A;  3P9C A;  2QLZ A;  2EB7 A;  4LMY A;  2IA2 A;  5BMZ A;  1LDJ A;  1HQC A;  4OIP F;  1QGP A;  3JTH A;  5D5X B;  3RKW A;  1DP7 P;  4IJA A;  2AS5 F;  4GYG A;  2XAH A;  4HAM A;  1R58 A;  4PCQ A;  4HA8 A;  3FXR A;  2CG4 A;  4I0A A;  2HOE A;  3F8M A;  5A2Q K;  1B1B A;  2HR3 A;  3RKX A;  1U5T A;  4ETS A;  2KIF A;  4XSX F;  3EQL F;  3BPX A;  4UHT A;  2XV4 S;  2QEN A;  5BPD A;  4YFK F;  1EH8 A;  2DK8 A;  2WWY A;  3E6B A;  2DFI A;  4BHB A;  3E6M A;  2XAF A;  3LA7 A;  3FMS A;  1LDD A;  2WV0 A;  3KP2 A;  1G3W A;  2Q0O A;  2EK5 A;  4LB6 B;  4FX0 A;  1K7A A;  1ON1 A;  3QPH A;  3QAH A;  4IRH A;  3W6J B;  3ECO A;  2ZKZ A;  3L7W A;  1FYL A;  2A61 A;  1U5T B;  4KIC A;  5HVQ C;  2H6C A;  2OAZ A;  5L3C A;  2KIU A;  2IP2 A;  1F5T A;  2CGP A;  3NRV A;  1MD0 A;  3KP3 A;  4OMZ A;  1SD7 A;  3F21 A;  2BE5 F;  2XAQ A;  4CZZ A;  2Z99 A;  2RQP A;  1K78 B;  3B73 A;  2MLG A;  3GFL A;  3V7R A;  1P92 A;  5IT9 K;  1XDS A;  3ABU A;  4P9U A;  4UVB A;  2JSC A;  3MZY A;  5FB2 A;  1B59 A;  3ZMU A;  3HTU A;  1ZAR A;  2FMY A;  4FX4 A;  1G4D A;  2A07 F;  3QU3 A;  1IZ1 A;  1F1Z A;  1ZYR F;  1UST A;  3K1N A;  3V4G A;  3TO7 A;  2GWR A;  4P55 A;  5F64 A;  1XGS A;  1P4X A;  4WWC A;  1FOK A;  2MD5 A;  2GXB A;  2X0L A;  5DUI A;  4Y15 A;  1YG2 A;  4GO1 A;  4KFC A;  3F6V A;  5DD8 A;  4WXH A;  3Q9S A;  3I59 A;  5E18 F;  2DPU A;  1MDM B;  5HDG A;  5D4R A;  3P9I A;  4YG2 F;  1U6G A;  2FXA A;  1Q1H A;  2HWV A;  5A2Q Z;  1IN5 A;  4G7H F;  4IRI A;  2M8E A;  3BJO A;  4L0Z B;  3J7A O;  3R60 A;  2EFP A;  2E7X A;  2GXG A;  2GIV A;  4KN4 X;  1IN4 A;  1SD5 A;  1STZ A;  4TV7 A;  1BOA A;  4IVN A;  1ZRE A;  3VEP A;  3WTV C;  2V1U A;  4CXF A;  3GO5 A;  3O2P E;  4CHU A;  1Z05 A;  2Y75 A;  3WTX C;  2ZNZ A;  4A6D A;  3OOP A;  1R7J A;  2FBI A;  2MA3 A;  3K9T A;  5CVJ A;  1O3S A;  1I1S A;  2RV8 A;  4LD5 A;  5CVR A;  4IXA A;  2COM A;  4RGS A;  2YPR A;  5ILV A;  3DQV C;  5BOX A;  3WTU C;  4M6Y A;  2UZK A;  3V7S A;  4CO8 A;  1MZB A;  1SFX A;  5IT9 Z;  2O0Y A;  1JGS A;  1ZAO A;  1AOY A;  2W25 A;  5D8K B;  2L4A A;  3NQO A;  1XSD A;  3V8K A;  3GZ6 A;  3FF5 A;  2ISY A;  1BI0 A;  3BY6 A;  4KMF A;  1CGP A;  4NB5 A;  1KGS A;  2QM3 A;  4I01 A;  3L09 A;  3G73 A;  1Z91 A;  3RYR A;  3C1D A;  3QU6 A;  2O3F A;  5HOO A;  3WOD F;  3GEZ A;  2QBY B;  2FNA A;  3SXY A;  4RAY A;  1XMK A;  1HW2 A;  2ZME A;  5LRR A;  5CYV A;  3FMQ A;  1HKQ A;  4B8X A;  1FYK A;  5D6F A;  4EGZ A;  2XHK A;  3C18 A;  4A0Z A;  2W57 A;  2UWM A;  3GFM A;  2V1X A;  3DKW A;  2ZXJ A;  4LJZ F;  4QWQ A;  1ZG3 A;  2XUB A;  1XSV A;  3VFZ A;  1WQ2 A;  4MEX F;  1DPR A;  1HW5 A;  3U9G A;  3HIF A;  1SMT A;  2M30 A;  1T38 A;  1HBX G;  3MAJ A;  2EA4 A;  4B09 A;  4G94 A;  2PBI A;  3ZMT A;  2YR2 A;  4RB1 A;  4PGH A;  2XGX A;  1XCV A;  4M71 A;  3KEQ A;  1G3S A;  2QWW A;  5DDG A;  5FGM A;  4GGG A;  2VC1 A;  3COA C;  1ONV A;  2A68 F;  3WU1 B;  4M9Z A;  3HOS A;  3HSF A;  3K2Z A;  1ZG5 A;  1HKT A;  1IW7 F;  2CSO A;  4O3M A;  3M8E A;  4UV9 A;  1SMY F;  3WTT C;  3WE3 A;  3B02 A;  4DQ2 A;  1S7O A;  2XKP A;  5L3D A;  5LGN A;  1HKS A;  1ZLK A;  2HGC A;  4MHG A;  2HTJ A;  2ZJ2 A;  3TO6 A;  2XAJ A;  4HBL A;  2Z3Y A;  4ZYE A;  2VOP A;  5E8G A;  4G7Z F;  3CUQ A;  1B6A A;  2Z5U A;  2STT A;  4EV0 A;  3FZV A;  3LA3 A;  1B4A A;  1BBY A;  1QPM A;  5E20 A;  4L5J A;  4UVA A;  2OD5 A;  3I64 A;  1FT9 A;  1U2W A;  2DO7 A;  5KVR A;  3GFI A;  3S2W A;  5LBQ A;  1ZG1 A;  1KU9 A;  3QP5 A;  2GA1 A;  4XBF A;  2RC4 A;  1REP C;  3ZMD A;  4G7O F;  4AWX B;  3ZN1 A;  4KN7 X;  4MTE A;  5H6R A;  4WXC A;  5AON A;  1WSU A;  1H0M A;  3TGN A;  3GWZ A;  1AWC A;  2HS5 A;  4U0V A;  5JFR A;  3F22 A;  4CDG A;  4N0B A;  5HLH A;  1FNN A;  4QLC U;  4G6Q A;  3RI4 A;  3E97 A;  1YW7 A;  2Z9O A;  2ZCW A;  1LQ1 A;  1TQP A;  2FA5 A;  3H3Z A;  3I53 A;  1QZZ A;  1J59 A;  1BIA A;  2L01 A;  5L3B A;  4L0Y B;  3CUQ C;  2P8T A;  1T0F A;  2LF7 A;  4M9S A;  4HF1 A;  4R1H A;  2BGC A;  3HSE A;  5IT3 A;  3WG9 A;  2WTE A;  5L3G A;  2ADU A;  5LRS A;  2VC0 A;  1U3E M;  4ZZL A;  1FLI A;  2EV5 A;  3J81 K;  4HOB A;  2BV6 A;  1P2F A;  2EFW A;  1ON2 A;  3I71 A;  2FRH A;  4N9I A;  4EJO A;  4A6E A;  2OZ6 A;  1D8K A;  3FM3 A;  4AD9 A;  5LEJ A;  3R61 A;  4GYI A;  4K2E A;  3WE2 A;  4M74 A;  4PDK A;  1CF7 B;  3T5X A;  3BPV A;  3LQQ A;  1GXP A;  4M72 A;  5TJJ A;  2P4W A;  4KNY A;  3BDD A;  3K1P A;  5FD5 A;  4BAY A;  1J2X A;  4NQW A;  1SAX A;  2MLK A;  1ZRF A;  3LAJ A;  2XIG A;  2PI0 A;  3GW2 A;  1OYI A;  2QQ9 A;  4ASN A;  2YU3 A;  2R3S A;  2ELH A;  1W5T A;  2DQL A;  1JHH A;  1OPC A;  4MNU A;  1S8N A;  2VON A;  1F4K A;  2DQR A;  2PMH A;  4ESJ A;  2DT5 A;  1I1G A;  4U0Y A;  3CTA A;  1UB9 A;  1MJB A;  2VT3 A;  4BYY A;  2P5K A;  1S7A A;  1FP2 A;  1R1V A;  1EH7 A;  3K0L A;  3DF8 A;  3ELK A;  1RI7 A;  4LK0 F;  3HRS A;  3R4K A;  1ZLJ A;  1XCB A;  2O8X A;  1I27 A;  1FYM A;  5LHI A;  4RGR A;  1K78 A;  1ZRD A;  3BJA A;  4G8X A;  3ISP A;  4IRG A;  2YX4 A;  1WRJ A;  1ZN2 A;  3IRQ A;  3E3V A;  1R36 A;  1XGN A;  4RGX A;  2EFO A;  4AIH A;  3I58 A;  3KLN A;  5LGU A;  4EQQ A;  3HOT A;  2FE3 A;  1O7L A;  1Z1D A;  2GQQ A;  3EUH A;  1TTY A;  5DD4 A;  1OKR A;  2XVC A;  4U0W A;  5J6X A;  4Y17 A;  2G9W A;  3F23 A;  2O61 A;  4L9J A;  4L9V A;  3ABT A;  1R00 A;  2NAZ A;  2W24 A;  1W7P D;  4WF2 A;  1U5T C;  3J81 Z;  2ZFW A;  4UNO A;  1SFE A;  3RPQ A;  3L2C A;  2E1N A;  1MDM A;  4KDP A;  3CO6 C;  4KIF A;  4OIR F;  3H92 A;  1B9N A;  3I4P A;  2O6G E;  2L54 A;  2JRT A;  4HX8 A;  5CJ9 A;  3HRM A;  1BI3 A;  2CW0 F;  1ZHF A;  1QO0 D;  1H9G A;  2A3S A;  1W4M A;  4MEY F;  2NYX A;  1Z6R A;  2NNY A;  4Q4Z F;  4HZF A;  4HV5 A;  3TKY A;  4DNC A;  2RGV A;  2P7C B;  1YYV A;  3WGG A;  3H3U A;  2OQG A;  4D0P A;  5HS9 A;  3CJN A;  5LLQ A;  4RB2 C;  1ZRC A;  4XSZ F;  3KET A;  1XMA A;  2ZBK A;  1RUO A;  1EH6 A;  4A5N A;  2JPC A;  1KQ9 A;  5E1Z B;  4A0X A;  4BNC A;  3RJP A;  4PZJ A;  4HDU A;  2M5W A;  3RDI A;  1UHW A;  5D8L B;  2HYG D;  3Q9V A;  1J7K A;  2VXZ A;  3G3Z A;  2QYO A;  4IF4 A;  1FY7 A;  2VE8 A;  2EV0 A;  3CDH A;  2QUF A;  3ROU A;  4HF2 A;  3KZZ A;  1UFM A;  4EVI A;  3KZY A;  3U2R A;  3E5X A;  4ZZD A;  1Z6T A;  3DPL C;  1KA8 A;  3U1D A;  2PMU A;  1S29 A;  1FC3 A;  1P4A A;  1JHF A;  3REO A;  5HDN A;  3FM5 A;  3E6C C;  2CYY A;  1T39 A;  3T1B A;  2JPB A;  2Y0M A;  1XB4 A;  2Q2E A;  1BJA A;  2DTR A;  5D5U B;  1J9I A;  5CLS A;  1FWZ A;  2HFH A;  2PN6 A;  5HS8 A;  2QBY A;  3KFW X;  1IF1 A;  3MFK A;  2HKO A;  2F5D A;  3BJ6 A;  1X3U A;  2M45 A;  3I0T A;  4P5O A;  1YLF A;  1FZP B;  4LG0 A;  4AIJ A;  5JI6 A;  4YFX F;  1U78 A;  3PQK A;  2RN7 A;  2VBY A;  5CVI A;  2QQA A;  4L9N A;  4KIG A;  2P6S A;  3VB2 A;  2FQ3 A;  2KRF A;  2MBF A;  2PEX A;  2XAG A;  5FLX K;  1KQ8 A;  3GX4 X;  1W5S A;  2GA2 A;  3SZP A;  2FBK A;  4JQF A;  2VBZ A;  3LAP A;  5DCM B;  2LDU A;  4ZYD A;  4WXD A;  4LG0 B;  2EFN A;  2DLL A;  5F1R A;  2F2E A;  1R22 A;  2VT2 A;  3TOB A;  3CO7 C;  1RZ4 A;  3FHZ A;  3F8F A;  1R5G A;  3R6S A;  4EM1 A;  1V3F A;  2A6E F;  1Z7U A;  2G7U A;  3LFK A;  3M8F A;  1LEA A;  2HEO A;  4S04 A;  2F5F A;  5DV5 A;  3IC7 A;  1XGM A;  3GFJ A;  3WTS C;  4LK1 F;  3NEU A;  4HYE A;  4P9F A;  2D1H A;  2IPQ X;  3DEU A;  1FPQ A;  1G3T A;  3WTW C;  5HS7 A;  3WU0 A;  1O7F A;  3KP7 A;  3C3W A;  2EV6 A;  1LEB A;  1PDN C;  2NNN A;  2YX7 A;  3V8J A;  4HF0 A;  2OU2 A;  2VOD A;  3E6D A;  2PJP A;  1YS7 A;  2ZNY A;  3I5U A;  4A5M A;  3BWG A;  4R79 A;  4LB5 A;  2K86 A;  3IKT A;  2FML A;  3OV8 A;  4A12 A;  4HV6 A;  1YFH A;  1OYY A;  3ZMZ A;  3R0A A;  1IXC A;  5AIQ A;  5L3E A;  5ERI A;  2IW5 A;  4I7H A;  5HLI A;  2HKX A;  1YQA A;  4I98 B;  3HRT A;  3SQN A;  4Q5S F;  5KK1 A;  1JE8 A;  3VOD A;  2NRA C;  3PFI A;  5LHH A;  3TOA A;  1DPU A;  3FXU A;  1TW2 A;  4O6J A;  2A5Y B;  3HSR A;  1W7P B;  4EM0 B;  3JSP A;  4O5V A;  5BQT A;  3WTY C;  3DV8 A;  5CVV A;  5BPI A;  5FLX Z;  1IN8 A;  4RAZ A;  3D5L A;  1YS6 A;  3F8C A;  2JT1 A;  1USS A;  4L5I A;  1G3Y A;  3IWZ A;  1RIO H;  2JTV A;  4RB3 C;  2Z33 A;  3V8L A;  4L18 B;  4HX4 A;  3W6K B;  1KU7 A;  1WWX A;  5HLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...