3TDZC

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-stapled acetylated ubc12n complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
SNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DCN1-like protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 27
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tdzC00
2EV6A 2PQ8A 1Z05A 3IWZA 4LGWA 3J7AO 1FYLA 3E5UA 3F72A 5FD5A 1B9MA 2HKXA 2DTRA 5HS8A 1AOYA 3LQQA 4XBFA 1SAXA 3ZP5A 4XRFA 3F8CA 1GHCA 4OU0A 4H0EA 4AWXB 5E1XA 3MZYA 4M6XA 2HOEA 3W6JB 3EQLF 3F6OA 5D5XB 1EH8A 4U0YA 2GA1A 1W4MA 3ZMDA 1I1GA 2ZJ2A 3Q9VA 3CUQC 5FFXA 2QBYB 4EJOA 1PUEE 2WWYA 3P9KA 2BEOA 3AAFA 4I2OA 1IN8A 2CO5A 5ICCA 3TQNA 3F8MA 2EFOA 4PDKA 4JQFA 5DD8A 2O6GE 4L9TA 2P6TA 4EGYA 3KLOA 4OIQF 5IT3A 5L3GA 1P92A 2P7VB 2ZBKA 2XGXA 2VOOA 1ZRFA 1KYWA 2FRHA 2ZKZA 1B6AA 4LFUA 3BP8A 2V1UA 4ETSA 2X0LA 3CUQA 3ELKA 3ZMUA 1YQAA 1R1TA 1IF1A 1O3TA 4QLCU 4PZJA 1E2XA 4Z2YA 1P6RA 2V1DA 1BN5A 3I4PA 3E5QA 4P9UA 4I01A 3RJPA 4O6JA 5E20A 2FBKA 3KFWX 3JSPA 1EH6A 3BJOA 5DUIA 4HAMA 3DP7A 3HHHA 3ROUA 2MLGA 3KP6A 3ABUA 1K79A 3SFZA 3PQKA 3GFLA 1ZRCA 3FMQA 2EB7A 3H3UA 4UVAA 1WWXA 5CVIA 3IWFA 1TW2A 4G94A 2VXZA 5HS9A 4KNYA 4YIFA 4N9HA 2XROA 3FHZA 1XMKA 4RAYA 2L01A 2A69F 4ZYEA 2IRFG 2MH9A 5HDKA 2QUFA 1MKMA 5A2QK 1KU9A 3BJ6A 1XSXA 5L3DA 1O57A 3R0AA 2DK5A 4LD5A 1BM9A 2VE9A 3R61A 1ZG1A 4QWQA 3M7GA 2V1XA 2VN2A 3HRTA 3L7WA 1F9NA 1SFEA 3T1BA 5J6XA 2DU9A 5HS7A 1DPRA 4HBLA 1FBSA 1BC8C 1DUXC 3I0TA 3T8RA 5HLHA 1IN5A 2FE3A 3ABTA 4FX4A 1ZLKA 1BI0A 4GGGA 3SXYA 2CQKA 4HDUA 1IZ1A 1H9TA 1ZN2A 1P4WA 3K2ZA 3WGGA 1R36A 3I59B 3KEQA 3RTRA 4EGZA 5E8IA 2HEOA 4M9XA 2L4AA 2ZXJA 4ESFA 3TOBA 4IF4A 2V9VA 5DV5A 3MZHA 1K78B 3FM3A 2P5LC 4WWCA 2XKPA 1REPC 1U3EM 4RB2C 5E1WA 2OA4A 1T2KA 3GFJA 4RGRA 5JFRA 1W7PA 1FNNA 1QGPA 3WTZA 1IN4A 4P5OA 1ZREA 5FLXK 1USSA 1YW7A 4KMUX 5E8GA 4ZZDA 3VB2A 2RN7A 2W57A 3KP4A 2PN6A 5DCFA 1TQMA 2XHKA 1ZH5A 4LJZF 3CJNA 1MJBA 2XAQA 4OIRF 5DD4A 4PGHA 1Z6TA 1X3UA 3GZ5A 2WV0A 3BPVA 1XDSA 2XAJA 1J7KA 3P7NA 4IRHA 3ZMSA 5A2QZ 1MDMA 3EETA 4FT8A 2HKOA 3H3ZA 2XKOA 4A6EA 1FYKA 1UHWA 3GEZA 2VT3A 2Q0OA 2DO7A 4Q48A 4HW0A 1P4XA 2LF7A 4EQQA 1LQ1A 2IP2A 5E17F 3U1DA 1HSJA 1J5YA 2NAZA 3GFIA 4GO1A 5CVJA 1S3JA 4ZYDA 4JK1X 4YIIA 4M74A 3E5XA 4JBAA 2HWVA 1JHHA 4MQVA 2K86A 2IA2A 1HQCA 5DCMA 4EM2A 2J5OA 2A61A 3WGIA 4L0YB 3QRFF 5LGTA 1USTA 4A0XA 4Y17A 1S8NA 1U5TB 5HLIA 4RGXA 1FP2A 4U7BA 4I0BA 5CVVA 3DXJF 4EJUA 2H27A 1FWZA 1SMYF 3HUGA 5E18F 5F1RA 3TDZC 1FSHA 4G7OF 3VFZA 1PP7U 2ESHA 2H94A 3DPLC 4XSZF 1LNWA 4M6YA 4EM0B 5FLXZ 1FBQA 3K0LA 3E6MA 2VC0A 3D5LA 1LJ9A 1BJAA 2K02A 4HZFA 3F8NA 1UFMA 5CLSA 5L3BA 1OPCA 2PMHA 3HOTA 3WTUC 2KJCA 2D45A 1DPUA 3C7JA 4LB6B 4MTDA 3QOPA 4NB5A 4U7DA 3WGHA 3JW4A 2OZ6A 3KZYA 2OD5A 4OMYA 4AIJA 2GXGA 2PG4A 5CVUA 1XGNA 4N0BA 2MBFA 3GZ6A 1OYYA 1BOAA 1MD0A 3MAJA 1FX7A 2JT1A 1W7PD 1LDKB 4L5IA 1FP1D 3F8FA 1E17A 3DPTA 1I5ZA 1XMAA 3JTHA 3D0SA 2NS0A 4ON0A 1ZARA 3B02A 3RDIA 3V7RA 1UCRA 3K1PA 4PGGA 4WK8F 2K27A 2X4HA 2P6SA 2YU3A 3IL2A 1C0WA 3ZN1A 3O3KA 2OQRA 3KP5A 3K1MA 5LEJA 2B0LA 1TQPA 4ESJA 2E7WA 1SD5A 2MD5A 2M8EA 2L02A 5ED4A 2DBBA 4KYWA 2ELHA 4GCVA 3OV8A 1HKSA 2VC1A 3L9FA 1IAWA 3ZPLA 3HRUA 3GO5A 4KN4X 3MCZA 3KETA 4EV0A 2L4MA 5D5VB 3DKWA 3WTVC 3IRRA 2D1VA 4A12A 1Z1DA 5LLQA 3QAHA 3ZMVA 4KMFA 2K4JA 3RPUA 3HTSB 4NQWA 1J59A 2EFPA 1XCVA 3QPHA 2IPQX 2KIUA 4I98B 1HW1A 3TO9A 5BOXA 2HGCA 5JI6A 1WI9A 5H20A 3IRQA 2NNYA 1YTYA 3HSEA 1J0RA 1FT9A 1YS6A 2M5WA 4RAZA 3V8JA 2FBIA 3LA3A 4UV9A 4ASNA 2LNBA 2QENA 3F21A 1STZA 3SHFA 1KU3A 5EEGA 1I6XA 2A68F 2DQLA 4UXNA 3SZPA 2R3SA 3J81K 3DEUA 2OAZA 4HLYA 4Q47A 5D5UB 4R8HA 1O3RA 2STWA 4I0AA 2DI3A 4HYEA 2QQ9A 3GXOA 1FLIA 2QM3A 3K9TA 5CJ9A 1TNSA 3ML6A 4LG0B 1XSVA 1BI3A 3OOPA 4LMYA 2DPDA 2H09A 2G7HA 3E97A 1CF7B 2P7CB 2LKPA 2YR2A 3E3VA 1R1VA 2QLZA 2FMLA 5D6EA 2FQ3A 5TJJA 5FD6A 1GVJA 1QQIA 2FBHA 2EA4A 2XASA 2L3DA 4KDPA 2QBYA 2ESNA 4EJTA 1FC3A 3F8BA 1IXSB 1ZG5A 4IVNA 2G7UA 4UNOA 2Z99A 5HVQC 1RZ4A 4YG2F 1SFXA 2ISZA 4HDVA 1MJ9A 3NEUA 2BE5F 2HQRA 5ILUA 2KRFA 2Z33A 4ESBA 5FB2A 1XB4A 4A5NA 5DYMA 2P8TA 5L3FA 3T0YA 3G3ZA 1H0MA 2W24A 4HX7A 1HBXG 3HHGA 1D3YA 3BOQA 2O03A 2ZMEB 1HW5A 1ZAOA 2F5EA 2W85A 4ENKA 4CICA 1BBYA 3HYIA 4HX8A 5ILVA 4U0VA 2W84A 3VEPA 4K2EA 5E1ZB 5LRRA 1HSTA 2EA2A 4O3MA 1HW2A 1YO5C 1FBUA 1KU2A 2ADUA 1K6OA 3WTWC 2QVOA 3K69A 3J81Z 4LLNA 2O8XA 3LA2A 2VBXA 2P5VA 4P9FA 5LEKA 1XN7A 1JGSA 3C1DA 1JHFA 3MWMA 5IT9K 5K5RA 1OKRA 5D4RA 2ACJA 5F64A 3COAC 4I02A 2KKOA 4HX4A 1DP7P 5ICEA 3HOSA 2GA2A 2DPUA 2FOKA 4FHTA 2H6BA 4MEXF 3ZMTA 2JTVA 2FMYA 5LHGA 3IKTA 4KIBA 5BPDA 3KLNA 1R5GA 3CLOA 4P96A 3I5UA 4A0ZA 4IHTA 2YPRA 3LSTA 1IXCA 1U2WA 4WXCA 5FFZA 1KQ8A 3I53A 3K1NA 2PI0A 3E6DA 3F6VA 3QPTA 1MGTA 3ECOA 1S7AA 3V4GA 1O7FA 1Z6RA 2HQNA 2ZNZA 1XDUA 3RKYA 1B9NA 4HQEA 4RB3C 1MDMB 4MEYF 4KIFA 1Y0UA 1D8JA 4WXHA 2BGCA 4D0PA 3R60A 3BJAA 1Z7UA 4BNCA 2GQQA 2FXAA 3RYRA 2HYFA 2HTSA 1R22A 3GF2A 4LK1F 3KEOA 2KJBA 5ICFA 4L5JA 4Y15A 4IPAA 5JVTA 3MFKA 2L54A 3T8TA 4CZZA 2LDUA 4FX0A 4UV8A 2QQAA 1T98A 2JRTA 2EV0A 1ZG3A 4CDGA 4BQAA 3I59A 5HLGA 5DCMB 2IW5A 3WTXC 4L18B 3GX4X 4MQ9F 2BYVE 1IUYA 5L3EA 3REOA 1MJAA 1FSEA 1K78A 3BROA 3BDDA 4O5VA 1S7OA 3M9AA 4DQ2A 4WCGA 4A2UA 4AD9A 2XAHA 1YW9A 1OR7A 3R0JA 2MH2A 3I71A 5IT9Z 3LAJA 1SD6A 1BC7C 5K5OA 1GXPA 2PJPA 3V7CA 1AWCA 3PFIA 3N97A 4F7ZA 1KQ0A 3WE2A 3WTTC 1KU7A 1I1SA 1FPQA 2EJRA 1R5HA 3CTAA 1QO0D 4GXOA 1RIOH 1TTYA 2STTA 2XAFA 4BYYA 5HDGA 2CW0F 1O3SA 2ISYA 4WF2A 1U5TC 2OQGA 2DK8A 2Z3YA 4BH9A 3G73A 4LLLA 2NYXA 3RKWA 5D8LB 4L9JA 1W5SA 1XD7A 2M45A 1TW3A 4WX9A 5BPIA 3QP6A 3SZTA 1R58A 4CGZA 4ZZLA 4A6DA 4GYIA 2HTJA 2JSCA 2PLYA 4B09A 3TDUC 4EJWA 5J8CA 2FEZA 1XCBA 1SFUA 5JR3A 2CYYA 2G9WA 3I64A 2NNNA 2EV5A 4M72A 3HIFA 1O3QA 4L9VA 5AONA 4CO8A 1KA8A 3TOAA 1OMIA 2V79A 5KVRA 4UVCA 1Z9CA 2ZFWA 4EM1A 2O0YA 1ULYA 2XRNA 4HQMA 1EH7A 2M1BA 1RUNA 2RDPA 3HRSA 1YYVA 4YFXF 4M9SA 3QP5A 1R00A 2HR3A 3LA7A 1F5TA 1F1ZA 3FZVA 3HTUA 1J2XA 3JAMK 3CO7C 4KUMA 4ZYGA 2VBYA 2MA3A 2BV6A 3FMSA 3GYHX 2PMUA 1YIOA 2Q2EA 5ERIA 4I7HA 3ZMZA 2IJLA 5LHHA 2HDCA 3KE2A 1XGMA 4R1HA 4M9ZA 2VE8A 4N9IA 3SQNA 3RYPA 1WQ2A 3TO7A 1TLHB 3Q5FA 4OOIA 2F5FA 4LB5A 3WODF 2K7LA 1W5TA 3F23A 1QBJA 2F2EA 1BIBA 3VOEA 1IN6A 4G6DA 3O6BB 4HF1A 4CHUA 4RB1A 1U8RA 4UVBA 1LB2A 3ISPA 2RQPA 3P9IA 1IRGA 1ZRDA 3HSRA 4EMSA 2EFQA 3EYYA 2PEXA 1D5VA 1UB9A 5FGMA 1LEAA 3FX3A 3KP3A 3ERED 1TNTA 1OYIA 1YLFA 3H92A 5LHIA 2UWMA 1QPMA 1XGSA 2UXXA 4KT5C 3HRMA 4BHBA 3CUQB 2A3SA 1FOKA 1J9IA 2FNPA 1ZYRF 1KYZA 2XVCA 1P2FA 2UZKA 3FXRA 2ZNYA 4G7ZF 4HV6A 2JPBA 4GYGA 1SD4A 2P5KA 2RNJA 3I58A 1ONVA 4IJAA 1P4AA 2E7XA 4S05A 4LK0F 2D2WA 2A6EF 2GXBA 4WXDA 1QNTA 1BI2A 3JAMZ 3VODA 3V8LA 3GFMA 1RI7A 3LWFA 1ON2A 2CGPA 1IRFA 2EFNA 5D4SA 2CSOA 3U9GA 3M1EA 2OBPA 3RKXA 3GLXA 2QQBA 5H6RA 5JHUA 2PBIA 1G3TA 3KCCA 1DDNA 2IA0A 4U0WA 2RKHA 1YG2A 3O2PE 2DFIA 1B59A 5LBQA 2DW4A 4HF2A 3PQJA 1ON1A 5J8FA 3NQOA 1LDJA 2ZO4A 2P4WA 3GUDA 3IHUA 2JZYA 2E1NA 1TQIA 2FF4A 2V6CA 2YX7A 2COMA 2GZWA 3ZN0A 2EWNA 1J75A 5D6FA 4LG0A 4EVIA 4ENMA 3QU6A 5H6QA 2CG4A 3WE3A 1G6NA 2JPCA 2C6YA 1HKTA 2QZ8A 2TDXA 1CF7A 5CVRA 4BHPA 5D8KB 2BBYA 3RI4A 3LQRA 1A04A 4OMZA 3WTYC 5BMZA 2EFWA 1LDDA 4M71A 2IT0A 2LF8A 5TRDA 3N4MA 2DLLA 4RGSA 1LVAA 1G3YA 4L9NA 3M8EA 3CDHA 2WC2A 2GWRA 2HS5A 3P9CA 4G8XA 1VTNC 1ZGJA 4AVPA 4E70A 1BIAA 1B4AA 4A0YA 2FA5A 2FU4A 1YFHA 3FXUA 4AIKA 3S2WA 5ILSA 2AS5F 2A6HF 4YFKF 3BZ6A 2D1HA 2HZTA 1ZLJA 4CYDA 1KGSA 2MC3A 4KIGA 2PFBA 1B1BA 4HA8A 4LLGF 2Z9OA 2O61A 5CYVA 1W7PB 2NRAC 3TGNA 3BPXA 2F5CA 2ZMEA 3V8KA 6PAXA 4BHCA 1JE8A 4KA4A 1CGPA 3JSOA 1S29A 4IRIA 1GXQA 1TBXA 2GAUA 3R4KA 4KN7X 3GWZA 1RUOA 3CUOA 3MEXA 4DNCA 2YX4A 1R1UA 4HOBA 2MLKA 2VODA 1XSDA 2XUBA 3C18A 2F5DA 2Y48A 2RGVA 3BWGA 3WU0A 2O3FA 3WG9A 1XGOA 4CXFA 1G3SA 2RVCA 3RPQA 1K7AA 3KZZA 1FZPB 2Z5UA 3KP7A 5DUKA 1EV7A 2R7DA 4U88A 3HSFA 4YFNF 3E6BA 1R7JA 3C3WA 1MZBA 5LGNA 5LGUA 1NHAA 2XAGA 1G3WA 4G9YA 2KIFA 1ZHFA 1ODDA 4BAYA 2UXNA 4RS8A 2FNAA 4IRGA 1R23A 1G4DA 4OIOF 3IKVA 2QYOA 2VBZA 2QWWA 3L00A 4P55A 3FMRA 5KK1A 2K4BA 1PDNC 4TV7A 3WTSC 5L3CA 3EDPA 1ZGAA 4MGRA 2M87A 2LSOA 2DT5A 3FXQA 2XIGA 3ULQB 3MQ0A 1PP8F 2RC4A 4HV5A 2VT2A 3E6CC 4UHTA 1T38A 1LEBA 1YW8A 4IHSA 2AXLA 3DF8A 3I54A 5AIQA 4A5MA 4Q5SF 1Q1HA 2HYGD 3IC7A 3M8FA 3NRVA 2W25A 2Y75A 3DV8A 2IA1A 2ZCWA 1WSUA 5HDNA 4ENNA 5BQTA 3JTGA 2YSRA 5FO5A 1FYMA 4S04A 1O7LA 2GIVA 2R7FA 3KP2A 5LRSA 3TO6A 3F3XA 1V4RA 2Y0MA 2J5PA 5K5QA 2VBWA 4EJVA 3J80K 3B73A 2OZUA 2CWEA 4G7HF 4MNUA 3EUHA 1IN7A 1SMTA 3ECHA 1QZYA 1IW7F 2M30A 3T5XA 3EYIA 2VONA 2IVMA 4XSXF 3V7SA 3Q9SA 5DEQA 4KFCA 2FSWA 5EEHA 3FM5A 1T39A 1UHMA 5AIPA 1OYWA 1L0OC 5HOOA 2RV8A 2DQRA 1IXRC 1H9GA 1QZZA 3QU3A 1U5TA 2VOPA 2H6CA 2Q8KA 2EK5A 5ICGA 3GW2A 1FY7A 1WRJA 4Y13A 4MTEA 3U2RA 4B8XA 2ETHA 3TKYA 5DDGA 4AIHA 2HFHA 3L09A 2A07F 2A5YB 3W6KB 1BI1A 3LAPA 4HF0A 4KICA 4PCQA 3BY6A 3WU1B 4RB0A 4R79A 1L3LA 3FWEA 4I09A 4RGUA 1KQ9A 4NHJA 3DQVC 1SD7A 3F22A 4MHGA 2CFXA 4XLPF 1HXDA 1HKQA 4IXAA 5K1YA 1JXSA 4OIPF 4XLNF 3FF5A 1D8KA 2WTEA 2OU2A 4M73A 2KIMA 1F4KA 1Z91A 4G6QA 4HLXA 2DAOA 1WKMA 1U6GA 3LFKA 3CO6C 4ZH4F 3RIRA 3DFGA 3L2CA 4OINF 5D5WB 1U78A 1T6SA 4Q4ZF 5BS6A 4UUVA 1V3FA 3GVAA 1YS7A 1RNLA 2E1CA 4L0ZB 2XV4S 3J80Z 1S6LA 4ENJA 3ZQ7A 3R6SA 5F6FA 1T0FA 1I27A 4ZYHA 4BXUA
chains in the Genus database with same CATH superfamily
5K7FA 4C2TA 1FMVA 1HF0A 2EV6A 2PQ8A 1A35A 1Z05A 2DMNA 2LY9A 3CF5F 3IWZA 4LGWA 2X1CA 1UZCA 4JX4A 4CZCA 3J7AO 1XMXA 5KCMA 3IAS2 1FYLA 1OCOH 3E5UA 3I9V2 3VDXA 1U9NA 3F72A 5FD5A 2JUGA 2NS8A 1B9MA 1ZR4A 5FROA 3HOWJ 4DIQA 2HKXA 2DTRA 5HS8A 4XKCA 2R7OA 1AOYA 2V1NA 1B8IB 4QPOA 4F52A 3LQQA 4XBFA 1SAXA 3ZP5A 4XRFA 3LNQA 1DP3A 3F8CA 1VQMI 1GHCA 1ZELA 2HXIA 2WV1A 2L9VA 4CCJA 4OU0A 4G6TB 2Y0SA 1NK3P 4H0EA 4AWXB 2YU9J 4XLEA 5E1XA 3H36A 2VJ5A 3HM5A 1E3HA 1LFUP 3MZYA 4M6XA 2HOEA 3W6JB 5EG0B 2E34A 3EQLF 2RAEA 3F6OA 2VPLA 2E1MB 5D5XB 1EH8A 2L9RA 2Y69H 4M3DA 4U0YA 2GA1A 1W4MA 5E3MA 3ZMDA 1I1GA 2ZJ2A 3Q9VA 3CUQC 3EPZA 5FFXA 3J7YJ 2QBYB 4EJOA 1PUEE 2CMPA 2WWYA 3P9KA 3KEYA 2BEOA 3AAFA 3OYIA 4BBRJ 4I2OA 1IN8A 2CO5A 5ICCA 3TQNA 3F8MA 2EFOA 1ZTRA 4PDKA 4JQFA 3C2HA 3A03A 5DD8A 2O6GE 4L9TA 2DN0A 4YEJA 3OYCA 2P6TA 4EGYA 2E1MC 3KLOA 2XF5A 4OIQF 2E60A 5IT3A 5L3GA 1P92A 3K6GA 3OMYA 1AKHB 2P7VB 3ZR8X 2EH3A 3BLYA 2EZHA 2ZBKA 3L2RA 2HOAA 1KZHA 2XGXA 2VOOA 1ZRFA 1KYWA 2FRHA 2ZKZA 3HG9A 1B6AA 4M3FA 1P9QC 3BTCA 4LFUA 3BP8A 4B3XA 4UY8I 2V1UA 4ETSA 2X0LA 3CUQA 3ELKA 2XDVA 3ZMUA 2DOEA 1YQAA 3O8HA 2KPMA 2OPTA 2OTLI 4Y3OA 1JUPA 5KNLA 1R1TA 4W97A 2LYCA 1IF1A 1O3TA 4QLCU 1T8IA 4PZJA 1E2XA 4Z2YA 3KPHA 4HG2A 1P6RA 2V1DA 2ZSHB 1DQUA 1BN5A 1M1EB 3I4PA 3G1OA 2BVLA 3E5QA 1BR2A 5CQEA 4P9UA 4I01A 2E5NA 3RJPA 4O6JA 4QPQA 2L7ZA 5E20A 3LL7A 2FBKA 1FOXA 3GTOJ 1I6HJ 3CCMI 1VQNI 3KFWX 3JSPA 1EF4A 1EH6A 2LFBA 3BJOA 5DUIA 4HAMA 2FD5A 5E3NA 3DP7A 2JK3A 2H1LA 4ZJZA 3HHHA 3ZCOA 3ROUA 2MLGA 3BQZA 3KP6A 2K9LA 3ABUA 5M5YJ 1JJ6C 1K79A 4X6AJ 3PO2J 3SFZA 3MKYB 3L2UA 3BR1A 3PQKA 3GFLA 1APLC 1ZRCA 3FMQA 3K4LA 3OYEA 2HPMA 2KMUA 2EB7A 3H3UA 4UVAA 1WWXA 3S93A 3JRHA 5CVIA 3IWFA 2PMZA 1TW2A 4G94A 3GTGJ 4CA0A 2VXZA 5HS9A 2YUSA 4KNYA 5C3EJ 4YIFA 4N9HA 2XROA 3FHZA 3NWSA 1QPIA 1V5EA 3M3YJ 1XMKA 2AQEA 4ZC3A 3TBIA 2JA5J 2R7RA 2MG4A 2L01A 4RAYA 4HNTA 2A69F 4ZYEA 2NOGA 4XL9A 4W1UA 2IRFG 2MH9A 4HNVA 4CYCB 4B4CA 5HDKA 2QUFA 1S9HA 3PNTA 1MKMA 5A2QK 1KU9A 1OCPA 2X6OA 4PFOA 3S3MA 1G8XA 5J3LA 4D1QA 3BJ6A 1XSXA 2KQRA 5L3DA 1FIPA 2JSPA 4A69C 1O57A 1D1CA 1TT5B 2CS3A 3R0AA 1TP4A 4BJ5C 2DK5A 2CQXA 3QPLA 4LD5A 2L7MP 2KP6A 5EEAA 1BM9A 2VE9A 3FDYA 4A3DJ 3TP3A 3R61A 1IG7A 3TEDA 3TW6A 1ZG1A 4QWQA 3M7GA 3HJEA 3DKYA 3G2BA 2V1XA 2VN2A 3PSFA 2F4OB 3ZQFA 3HRTA 1EJ9A 1HDPA 3L7WA 5JLXA 2NVXJ 1F9NA 2BZTA 2MC4A 1SFEA 3T1BA 4BJTA 5J6XA 5EYRA 4XLHA 1Q1VA 1VF9A 2DU9A 5HS7A 1DPRA 1MH3A 1UMQA 4HBLA 4FE4A 1FBSA 1BC8C 1DUXC 3I0TA 2E19A 3T8RA 3PO3J 1LVKA 5HLHA 2O8KA 2E35A 1IN5A 5IOZA 2W7NA 4XICA 2FE3A 3ABTA 3MMYB 4FX4A 1ZLKA 1BI0A 4GGGA 2H1KA 5GAEJ 3SXYA 4DYRA 4CCKA 1QRYA 5F0CA 2CQKA 3SZGA 4HDUA 2QA4I 1OLTA 1IZ1A 1H9TA 1ZN2A 1P4WA 2ELJA 3K2ZA 3WGGA 4PSWA 4M3GA 1R36A 1I39A 3I59B 3KEQA 3IH2A 3RTRA 4EGZA 4PJMA 1Y1VJ 4XN3A 4DW6A 5E8IA 2CW7A 2TCTA 4NC8A 2HEOA 2ZB9A 4M9XA 2BVMA 2L4AA 2MFZA 2ZXJA 4ESFA 3TOBA 4IF4A 3DEEA 2V9VA 5DV5A 3M4OJ 1QU3A 5EDNA 3MZHA 1K78B 3FM3A 2P5LC 2Z2SB 3CCEI 4GRIA 4V2FA 4WWCA 2XKPA 4LOCA 1REPC 1O4XA 4ZDOA 2IS1A 1Y8QB 2IGOA 1U3EM 1HOMA 1D0XA 4RB2C 5E1WA 4BEHB 4C3JJ 2OA4A 2B9SA 3LSRA 1T2KA 3GFJA 3OYJA 4RGRA 5JFRA 2LR8A 4A3FJ 3OS0A 1IUFA 1W7PA 2HDWA 3OYFA 1FNNA 2KL4A 1QGPA 2LVSA 3FK6A 3WTZA 2GOXB 4XORA 2HDDA 1IN4A 4P5OA 1ZREA 1I3QJ 1BOBA 2VKHA 5FLXK 1USSA 1YW7A 2PJRA 3IAM2 4KMUX 1Y39A 5E8GA 4ZZDA 3VB2A 4AYBN 2RN7A 2V4JC 2W57A 2M0MA 3KP4A 4NDLA 2PN6A 5DCFA 1TQMA 2XHKA 4AIDA 1ZH5A 3QYBA 4LJZF 3CJNA 4II2A 1MJBA 2XAQA 4OIRF 5DD4A 1V5GA 3DLAA 1MH4A 4PGHA 3BTJA 4CCLA 1Z6TA 4YIRX 1XTAA 2MW8A 1UG2A 3DTIA 3Q0VA 1X3UA 3GZ5A 2CQQA 2WV0A 1Z3XA 3BPVA 1XDSA 2XAJA 3BT9A 4UUTA 1J7KA 5HODA 3P7NA 2QCOA 4IRHA 3ZMSA 1YI2I 3H5RA 2GBYA 4RLFA 2WB1N 5A2QZ 1MDMA 3F9KA 4X0GA 3H5NA 4QIWN 3NAUA 3F0CA 3EETA 2VQHA 4FT8A 2CRGA 2HKOA 3H3ZA 2XKOA 4NNJA 2Y0SN 4A6EA 1FYKA 1UHWA 2DYRH 4E7HA 3GEZA 2VT3A 2QSGX 2LKSA 2Q0OA 2DO7A 1TWGJ 3LOCA 4Q48A 1WJFA 2LMDA 5DTDA 2FUG2 4HW0A 1P4XA 2LF7A 3JRBA 3H0DA 3CP2A 4EQQA 1PUFB 1LQ1A 1E0EA 2IP2A 2WAQN 5E17F 3U1DA 1HSJA 1J5YA 1XG1A 1BR4A 3M1CA 3OSFA 2NAZA 3GFIA 3HL2A 1OCZH 4GO1A 5CVJA 5E3OA 5M5WJ 1S3JA 2XAUA 4PJ0C 4ZYDA 2Y2ZA 4JK1X 4YIIA 5EZGA 4A93J 3LSMA 4M74A 1F43A 3E5XA 4JBAA 2HWVA 1JHHA 3A01A 5J1YA 4MQVA 2K86A 2IA2A 1HQCA 1VQ8I 3I4NJ 5DCMA 4EM2A 4PSXA 4E4HA 4XR6A 5F0FA 1YJNI 2DTZA 2J5OA 1MSEC 2A61A 3WGIA 5M3MJ 4L0YB 1R4MB 5FLVA 3QRFF 5LGTA 3ABLH 1USTA 1A5JA 1UHSA 2DMPA 1QHHD 1HC8A 3CJTB 4A0XA 3DCFA 2M9HA 4Y17A 1S8NA 1U5TB 2GM4A 1LKXA 5HLIA 5B66C 4ZDPA 4RGXA 3HDDA 2EZLA 2XC7A 1FP2A 2M7AA 4BXXJ 4U7BA 2K9MA 3CCVI 4JYKA 2I5UA 4I0BA 5CVVA 4FQGA 2KRCA 3DXJF 4EJUA 2DA4A 2H27A 1YX3A 1PJRA 2VI6A 1FWZA 1SMYF 1QVTA 3HUGA 5E18F 5F1RA 2OF7A 1IRXA 3TDZC 1LE8B 1FSHA 4IKFA 4XKWA 4G7OF 3VFZA 1IGNA 1V55H 1PP7U 2ESHA 3HBLA 2H94A 3DPLC 4J19A 4IHXA 2VPRA 2LRDA 4XSZF 4XLAA 2JA6J 1LNWA 4M6YA 4EM0B 3G4SI 1X1CA 5FLXZ 2WA0A 3RSNA 1FBQA 3EUAA 3K0LA 2KIQA 3E6MA 2R7TA 2VC0A 2QGUA 1G2HA 1CQTA 3D5LA 2ELKA 4D5CA 1ERDA 2X48A 3A0HC 2X1EA 1LJ9A 3L2QA 5KAFC 1BJAA 2K02A 2CV1A 1WGXA 2Q2EB 4HZFA 1MBFA 1X3WB 3F8NA 1UFMA 5CLSA 3PNYA 5L3BA 1RESA 3GBGA 1OPCA 3AL0B 2PMHA 3OYGA 1WCMJ 1X2MA 5J4YA 3HOTA 3WTUC 2KJCA 2D45A 1DPUA 2ZFUA 3C7JA 4LIVA 3FKIJ 3E1SA 3OSGA 4LB6B 4MTDA 3QOPA 4NB5A 4U7DA 3WGHA 3K70D 4FISA 1FTZA 3JW4A 1TWCJ 2OZ6A 3KZYA 2OD5A 5C44J 3OIPA 1QHGA 2ZJRF 5M3FJ 4OMYA 4C9YA 4AIJA 2GXGA 2PG4A 5CVUA 3KYDB 1XGNA 4N0BA 3MKWB 2MBFA 3GZ6A 2NVQJ 1DU6A 3S1RJ 3PJRA 1OYYA 1BOAA 4V2GA 2M3AA 1MD0A 3MAJA 1FX7A 2JT1A 1W7PD 2BY3A 5FKNA 1LDKB 3JRCA 1W0TA 4L5IA 1FP1D 4XOPA 3F8FA 1E17A 1YHQI 3DPTA 5JLWA 2V7FA 1YJWI 1I5ZA 4F91B 1XMAA 1N25A 3JTHA 2AHQA 3D0SA 2ECBA 2LOOA 2NS0A 3E0JB 4ON0A 5F0HA 4BQQA 1ZARA 3B02A 1VQLI 5GADJ 3RDIA 2ZJQF 2BW3A 3V7RA 4KITB 1UCRA 3K1PA 1FEXA 4QTRA 4PGGA 4BJ6C 4WK8F 2EZKA 2K27A 2X4HA 3BTIA 1OCCH 2P6SA 2VQCA 3D5SC 4RMNA 2K85A 3IP4B 2YU3A 3IL2A 1C0WA 3ZN1A 2BHYA 3BG6A 2LP0A 3O3KA 2OQRA 3HZJA 4MFDA 3KP5A 3CMMA 4XRSA 3K1MA 2I10A 5LEJA 2B0LA 4HSRA 5IYBJ 1TQPA 4ESJA 2E7WA 1SD5A 1DU0A 2MD5A 2M8EA 2L02A 5ED4A 1R9TJ 2DBBA 2L7FP 2HU9A 2DT6A 4OWRB 5E3LA 4KYWA 2ELHA 4GCVA 3H1CA 3OV8A 2DA3A 1HKSA 2VC1A 3ZQQA 3L9FA 4X1EA 1IAWA 3ZPLA 1ORKA 3HRUA 2L2OA 3ZQGA 3GO5A 4KN4X 3MCZA 3KETA 1YJ9I 5F27A 4AYBA 4PJNA 2Y9ZA 4EV0A 3A0BC 3S1QJ 9ANTA 3L1PA 2L4MA 4ABZA 5FRNA 5D5VB 3DKWA 1RC9A 3WTVC 2R7UA 3IRRA 1S5LC 1ZGWA 2D1VA 4A12A 2MSYA 1LFPA 2BY1A 1KONA 1Z1DA 3G1MA 5LLQA 3QAHA 3ZMVA 2B7EA 3GCMA 4KMFA 2K4JA 2M4GA 2HPIA 3QQAA 1FMWA 3DPUA 3RPUA 2DA1A 3UNGC 4NQWA 2EPFA 3HTSB 2HOSA 2UV1A 2EFPA 1XCVA 1J59A 2HZDA 2WB1A 3QPHA 3LMMA 2IPQX 2DOFA 2EIKH 2KIUA 3E7LA 4PK4A 5GTHC 3C2GA 3CC2I 4I98B 4NBQA 1HW1A 3TO9A 4GDFA 5BOXA 2HGCA 5JI6A 3OS2A 4XK4A 1WI9A 5H20A 4MO7A 2LD5A 1BJZA 3IRQA 3BR2A 2D5VA 1VNDA 3CJQB 1X58A 5J4VA 2NNYA 1YTYA 2XB5A 3HSEA 4A3GJ 1J0RA 1FT9A 1MBGA 5EGOB 1YS6A 2M5WA 4RAZA 3V8JA 4Z6YA 2WAQA 2FBIA 3LA3A 4UV9A 2FJ1A 4IOCF 1R49A 4ASNA 2LNBA 2QENA 1XX5A 3F21A 1STZA 3WHCA 3SHFA 1KU3A 1YOVB 5EEGA 2DA5A 1Z3YA 1I6XA 4I99C 2A68F 4XMYA 4S0HB 4E7JA 2NOJB 2VB6A 3NARA 2DQLA 2F6CA 2VKDA 5TISC 4UXNA 3SZPA 2DODA 2R3SA 3J81K 3S32A 3DEUA 2OAZA 4HLYA 1K4TA 2H8WA 4Q47A 5D5UB 4R8HA 2DFHA 4F93B 1O3RA 2STWA 4I0AA 1OISA 2DI3A 4HYEA 2QQ9A 3GXOA 2XB0X 1FLIA 2QM3A 3K9TA 5CJ9A 2IAIA 1TNSA 3ML6A 1B8IA 4LG0B 2DOAA 1XSVA 1BI3A 3OOPA 4LMYA 2DPDA 1N78A 1WVRA 4II3A 4IHWA 1Z67A 2H09A 2G7HA 1D1BA 3E97A 1CF7B 2P7CB 1NH3A 1ZK8A 2XGCA 2LKPA 3GTLJ 4B47A 1IV6A 3HOXJ 2YR2A 3E3VA 1R1VA 2QLZA 3MKZA 2FMLA 3HXLA 5D6EA 4MIMA 3WHBA 5EG0A 1K6YA 2FQ3A 3OIQA 5TJJA 4DOZA 5FD6A 5EZHA 1GVJA 1QQIA 3JRDA 2E1OA 2FBHA 1BW5A 2EA4A 2XASA 2HOTA 2L3DA 1SVLA 4KDPA 2QBYA 2ESNA 2NVTJ 4EJTA 1FC3A 3F8BA 5HNHA 1UELB 2DJNA 1IXSB 3K7AJ 1ZG5A 4IVNA 2XPWA 4QSHA 2G7UA 4UNOA 1A31A 4XNFA 4CCOA 2Z99A 5HVQC 1RZ4A 3HKZN 4YG2F 2IXSA 1U9OA 4DBQA 1SFXA 2ISZA 1YX5A 4HDVA 1MJ9A 2VJ4A 5GPCA 2WY8Q 4BDZA 3NEUA 2R7VA 1PYVA 2BE5F 2DFEA 1UAAA 3I4MJ 1AKHA 4LG3A 2HQRA 5ILUA 2KRFA 5DM6F 3KZIC 2Z33A 4ESBA 2DA2A 5FB2A 1XB4A 4A5NA 1A6IA 2P8TA 5DYMA 4FCYA 3Q0WA 5L3FA 4M3EA 3VSLA 1RRJA 1IJWC 1G59A 2XRLA 3LSHA 2LLKA 1WPKA 1MNEA 3T0YA 3G3ZA 3ASOH 1I50J 2O9LA 1H0MA 1Z21A 2W24A 4HX7A 3SDGA 1HBXG 2JVHA 3ABKH 1LPQA 3HHGA 4ZTFA 1TC3C 4IQ4A 5FLMJ 1TWHJ 1D3YA 3BG7A 2LKXA 3BOQA 2O03A 2ZMEB 1HW5A 2L5QA 1ZAOA 3CF2A 3FBIB 2F5EA 2W85A 4AUXA 3GTKJ 1HDDC 4ENKA 4A3CJ 4ZTJA 4CICA 4CSWA 1BBYA 1ETQA 1N77A 3HYIA 1AU7A 2R7ZJ 4HX8A 2CUFA 5ILVA 2LY1A 4U0VA 3KYLA 2W84A 3FXKA 3K4MA 4DYQA 3VEPA 2E2JJ 4C2UA 4K2EA 5M5XJ 1Y56A 3S17J 5E1ZB 3D1NI 5LRRA 3CCLI 1HSTA 2EA2A 1GT0C 1HW2A 1YO5C 4O3MA 1FBUA 1KU2A 2ADUA 1K6OA 1Z7LA 4F3QA 4N4NB 3WTWC 3DWLE 4M6VA 2QVOA 3AG1H 5DM7F 3FIWA 3K69A 3J81Z 4LLNA 2HI3A 4J01A 2L9SA 2IS4A 2O8XA 3LA2A 2VBXA 2P5VA 4P9FA 5LEKA 2X51A 1XN7A 4C3HJ 1JGSA 3C1DA 2ICWG 1JHFA 2LTPA 3MWMA 3SFIA 4J00A 4AU7A 5IT9K 2R4GA 5K5RA 2LBFB 1OKRA 2K5CA 3DBLB 5D4RA 3CCRI 4A3KJ 2ACJA 2OCCH 5F64A 3COAC 3SYTA 4I02A 4B43A 2KKOA 4HX4A 3CDLA 1X2NA 2PX9A 1DP7P 2NVYJ 5ICEA 2A6TA 3HOSA 1GV2A 4IHYA 3PSIA 2GA2A 2DPUA 2FOKA 3CD6I 4FHTA 2L9NA 2H6BA 4MEXF 4E7LA 2VQLA 3ZMTA 2JTVA 3LSPA 2FMYA 4BDYA 4FTHA 1EA3A 5LHGA 3IKTA 5B1AH 4KIBA 5BPDA 3IH4A 3KLNA 5GAHJ 5KAIC 4CYCA 1R5GA 3CLOA 2DYSH 1SVOA 2QKLB 2VQGA 2RREA 1WJ5A 2VJJA 2BOLA 3HOZJ 4P96A 3I5UA 1SEUA 4A0ZA 4IHTA 1RKWA 2YPRA 3LSTA 1IXCA 1U2WA 4I6ZA 4WXCA 5FFZA 1KQ8A 3I53A 2OV7A 3K1NA 2PI0A 3E6DA 1Z0XA 2Y9YA 3F6VA 3QPTA 1MGTA 3ECOA 1S7AA 1F36A 3FK7A 3V4GA 1YRNB 1U8BA 1O7FA 5BNGA 1Z6RA 4E6KG 2HQNA 2ZNZA 1XDUA 2DMTA 2LREA 3RKYA 1B9NA 4HQEA 4RAGA 3BR5A 2H8RA 4RB3C 1MDMB 4ITVA 4MEYF 4BS9A 4CUGA 1X1PA 4KIFA 1Y0UA 2M4KA 1D8JA 1AA7A 1I3AA 4D7NA 4WXHA 2BGCA 4D0PA 3R60A 5J40A 3CQZJ 2QSFX 2DCEA 4UUSB 4CCMA 2JA7J 3BJAA 1JT6A 4I76A 1Z7UA 4BNCA 2GQQA 2FXAA 3SJMA 1DGWY 3RYRA 2R93J 2HYFA 2HTSA 2HXOA 2K40A 1R22A 3GF2A 4LK1F 1HCRA 3KEOA 2KJBA 5ICFA 3ZRGA 2XGDA 2HVRA 4L5JA 5B5EC 1ENHA 3H5AA 4Y15A 4IPAA 5JVTA 3MFKA 3C2BA 1MNMC 2L54A 3ZGKA 3T8TA 2I8DA 3BZKA 4CZZA 2W1OA 4AC0A 2LDUA 4FX0A 4UV8A 2QQAA 2XGEA 3FXLA 1MSFC 1T98A 3DEWA 4EEFG 2JRTA 2EV0A 1ZG3A 4CDGA 4BQAA 2A5WA 1BW6A 4HNUA 1OR7C 3I59A 5HLGA 5DCMB 2IW5A 3WTXC 3QYFA 3GX4X 4L18B 2OUMA 4MQ9F 3CCSI 4P1WA 4BL0B 2BYVE 4B44A 2R92J 1MBJA 1IUYA 5DS9A 5L3EA 3REOA 2BXYA 1SFKA 1MJAA 1FSEA 3OY9A 1K78A 3BROA 4BY1J 3BDDA 4O5VA 3HGYA 2K3FA 4BE1A 1ZKGA 1S7OA 3M9AA 1XS9A 3H3VK 3IV5A 4BEHA 4UB6C 4DQ2A 3BR3A 4WCGA 4A2UA 3TL4X 4AD9A 1R71A 1E3PA 2KT0A 2XAHA 1YW9A 2JVGA 3OYDA 2ZXHA 4IL6C 1MMAA 2ECCA 4BQOA 4XQFA 4YELA 1OR7A 3R0JA 2MH2A 3I71A 5IT9Z 3LAJA 1SD6A 1BC7C 1VQOI 2DMUA 2E36A 2DDAA 5K5OA 1GXPA 2WBMA 3RQ4A 2PJPA 3V7CA 4DYCA 1MNDA 1AWCA 3PFIA 1X1BA 3RCOA 2Q1ZB 2X6YA 1IC8A 1VI0A 4E7ZA 3CMYA 2BY0A 3N97A 2CV2A 1K83J 1KQ0A 3WE2A 4F7ZA 3WTTC 3KX2A 1KU7A 1I1SA 1FPQA 2DA7A 3OIOA 1WHUA 3ESWB 3HKZA 2EJRA 1R5HA 3CTAA 5GAGJ 1QO0D 4GXOA 2AXTC 2UUZA 2ZJPF 3NWTA 4CH7A 3TW7A 1RIOH 1TTYA 2VXDA 1DGRM 3KIOA 2STTA 3UR3C 2CUZA 3BCBA 2XAFA 2M0CA 2W4SA 4BYYA 4NC7A 5HDGA 2CW0F 1JKPC 2JJ7A 2R5YB 2V9KA 3BC8A 1ETYA 3K10A 4FE7A 3KYCB 1O3SA 1WZ2A 2XSDC 2XF6A 2JUCA 2ISYA 2HQAA 1JKRC 4WF2A 1U5TC 3AG2H 1PUFA 3IUOA 3FBNB 3L2VA 2OQGA 2OTJI 3OYMA 1WJDA 2DK8A 2Z3YA 2F5VA 3TP0A 1JTXA 4BH9A 3G73A 3GTPJ 4LLLA 2NYXA 3RKWA 5D8LB 4L9JA 1W5SA 1OCTC 1IDZA 1XD7A 2M45A 2IEKA 4BGDA 1TW3A 3U1KA 4WX9A 5BPIA 3PIOF 1RPWA 3A02A 3QP6A 3SZTA 1R58A 4CGZA 4ZZLA 1GLNA 4A6DA 4XKVA 2CV0A 4DGWB 2DMQA 5IP7J 4GYIA 2HTJA 2X6XA 2JSCA 1QA6A 2PLYA 5H2FC 3BG5A 4B09A 1TL8A 3TDUC 2KZGA 2R5ZB 3CC4I 4IHVA 5FKLA 5J1RA 4XRSG 4EJWA 5K7ZA 5J8CA 2FEZA 1XCBA 1SFUA 2LG4A 3CCQI 5JR3A 2CYYA 2G9WA 3I64A 2NNNA 3BCAA 2EV5A 4M72A 3HIFA 1B72B 1O3QA 4L9VA 5AONA 4CO8A 4C2MJ 1KA8A 3JRFA 3TOAA 1XPXA 1OMIA 3CZ6A 3OYKA 3CCJI 2V79A 5KVRA 4UVCA 1Z9CA 2ZFWA 4EM1A 2O0YA 3AL0C 1ULYA 4F55A 2XRNA 4HQMA 1EH7A 3G6EI 2M1BA 1LE8A 2TRTA 3PFYA 1RUNA 5B3SH 2RDPA 3BG3A 2FOWA 2JRMA 2AO9A 3HRSA 3MD2A 4V19K 1YYVA 4YFXF 3K4KA 3CC7I 3ZQCA 4UB8C 2FX0A 4M9SA 1RETA 1R00A 2HR3A 3LA7A 3QP5A 3AKZA 1F1ZA 3FZVA 1F5TA 3HTUA 3VYSB 1J2XA 3JAMK 3CO7C 1NG7A 4XIDA 3CMEI 4E7IA 4KUMA 3DTKA 3MKLA 4ZYGA 2VBYA 4BACA 2MA3A 2BV6A 3FMSA 3OR2C 3GYHX 2PMUA 1ETWA 1VQKI 1YIOA 2Q2EA 5ERIA 4I7HA 3ZMZA 2IJLA 5LHHA 2HDCA 2ZXIA 1TT0A 3CJRB 3KE2A 1XGMA 1BR1A 1QZEA 2ID6A 4R1HA 4M9ZA 2VE8A 3S1NJ 2JN6A 4N9IA 3SQNA 3RYPA 1WQ2A 3TO7A 3RQIA 1W1WE 4U87A 1TLHB 3Q5FA 4OOIA 3J7ZI 2F5FA 4LB5A 3WODF 1HA8A 3PIPF 3ONQA 1YITI 2K7LA 5CPRB 4G12A 4XM3A 3DBRB 1MBHA 1W5TA 3F23A 1QBJA 1YE9A 2F2EA 5IYDJ 1BIBA 1BA5A 3FXJA 3VOEA 3PM1A 2HNHA 5E79C 4Y52J 1IN6A 3OR1C 1XC5A 4G6DA 3O6BB 5F1JA 4HF1A 2NS7A 1JI8A 4CHUA 4RB1A 2VKVA 1U8RA 1S72I 3EUKL 1TWFJ 4UVBA 1PVEA 1LB2A 1TWAJ 1D0YA 3ISPA 2RQPA 2QSHX 3P9IA 2Z16A 3VYRB 2QKMB 1IRGA 3LSIA 2VASA 1ZRDA 2JA8J 2K9NA 4N4OB 3HSRA 4EMSA 2EFQA 3EYYA 2PEXA 3VYUB 1D5VA 1EKEA 1UB9A 5FGMA 1ETOA 1LEAA 2KFDA 3W3CA 2IS6A 3FX3A 3KP3A 3ERED 1TNTA 1ETXA 1OYIA 4PJLA 3D5RC 2MD0A 4GFBA 1YLFA 3H92A 5LHIA 4KISA 2UWMA 1QPMA 1XGSA 2UXXA 2M2EA 4KT5C 3HRMA 2CUJA 4BHBA 3GTJJ 3CUQB 4FASD 3K2AA 2A3SA 3LSGA 1FOKA 1J9IA 2FNPA 1ZYRF 2G0EA 5J47A 4RBOA 4OAZA 4AM3A 3MVPA 1VZ0A 3CP8A 2CW8A 3LFUA 1KYZA 3QOEA 3S16J 2XVCA 2KISA 1P2FA 2UZKA 3CESA 3ZQHA 1WH7A 3HOVJ 3QYEA 4B3AA 3FXRA 2M7BA 2ZNYA 3S14J 5IY5H 4G7ZF 4B1RA 4HV6A 2JPBA 4GYGA 1SD4A 2P5KA 3ASNH 2RNJA 3I58A 5K7HA 5JVGF 5FJ8J 1ONVA 1MBKA 1P4AA 2E7XA 4IJAA 4S05A 5F04A 4LK0F 1T95A 2D2WA 2A6EF 3S3OA 2GXBA 4WXDA 4A3MJ 1QNTA 5GTIC 3W6VA 1BI2A 1NTCA 3JAMZ 3QPSA 4HSTA 3VODA 2B63J 2XPVA 3V8LA 2IBDA 3GFMA 1RI7A 3CDIA 2DFFA 3LWFA 1ON2A 3OYBA 2CGPA 1IRFA 2EFNA 5D4SA 2CJJA 2CSOA 3K4CA 3U9GA 2IS2A 3M1EA 4IZZA 2OBPA 3RKXA 3GLXA 2QQBA 5H6RA 1SFOJ 2CUEA 2ME6A 4A3LJ 2F48A 5JHUA 1H8AC 3W2AA 2PBIA 1G3TA 3ERMA 3KCCA 4BUPA 1H88C 3DU6A 1DDNA 5EGOA 2IA0A 1VQ4I 1WJCA 5FKMA 2EILH 4RLQA 4DZJA 4U0WA 1ITYA 2RKHA 1YG2A 3HPHA 4RM3A 1X19A 3O2PE 5HNFA 4LIUA 2DFIA 1B59A 5LBQA 1JKQC 1MMDA 2DW4A 1JGGA 3H35A 4HF2A 3PQJA 1OCRH 1NK2P 4JX6A 3B6AA 1ON1A 3H9JA 5J8FA 3NQOA 3WU2C 4D9JA 3I3LA 3VPRA 1LDJA 2ZO4A 3JRAA 4A3JJ 2P4WA 3GUDA 3IHUA 3P5JA 2JZYA 1YIJI 2E1NA 3H9QA 2O7OA 4LITA 1TQIA 1E3OC 2FF4A 2EIMH 2KZVA 2HVSA 2V6CA 2YX7A 5CKTA 1WH5A 1SANA 2WAFA 2ME0A 1RR7A 2COMA 2GZWA 3ZN0A 2EWNA 1U0JA 3AFHA 1J75A 5D6FA 4A3EJ 4LG0A 4EVIA 4PUSA 4ENMA 3PL8A 1IO2A 1LUJB 1HLVA 3QU6A 2CQNA 3W2VA 2E2IJ 2MGQA 5H6QA 2CG4A 3WE3A 1G6NA 1MMNA 2JPCA 1JJ8C 1MBEA 1V54H 2C6YA 3BZCA 1HKTA 2QZ8A 2TDXA 1CF7A 1W36C 5CVRA 4BHPA 3ZOBA 5D8KB 2X85A 4HPQA 2BBYA 4JX5A 3I56I 3LQRA 3RI4A 1A04A 2R7SA 4OMZA 3WTYC 5BMZA 3PUBA 2EFWA 1LDDA 4M71A 2IT0A 2LF8A 5TRDA 3N4MA 2DLLA 4RGSA 5TGTA 1LVAA 2WY7Q 1G3YA 2L7KA 3OYNA 4L9NA 3M8EA 2GOMA 2BY2A 2XPUA 1WFXA 3CDHA 3OL4A 1JKOC 4M3BA 1SC7A 3RZOJ 1UJ8A 3OYLA 4F92B 1Z77A 2WC2A 2CU7A 5LFAA 3RKQA 2GWRA 2HS5A 2DT7B 3P9CA 4G8XA 1MIJA 2ZMEC 1VTNC 5C4XJ 3AG4H 4HRIA 1ZGJA 4AVPA 4E70A 1BIAA 5IYCJ 1B4AA 4NUBA 4A0YA 3ABMH 2FA5A 2FU4A 2GLOA 4AVZA 2Z1DA 1YFHA 5FRMA 3FXUA 5EJCA 4B48A 1T33A 4MLOA 1R6RA 4RDUA 4AIKA 4D7MA 3S2WA 3VSKA 3IH3A 5ILSA 4RM2A 3RPUD 2AS5F 2A6HF 1VQPI 2M34A 2JWTA 1MW7A 4YFKF 4XN0A 3BZ6A 2D1HA 1LFBA 2HZTA 1ZLJA 2HYJA 4CYDA 1V5FA 1KGSA 2MC3A 5IP9J 4KIGA 1ACIA 2PFBA 1B1BA 1IV8A 4HA8A 4LLGF 3AG3H 5GP9A 3VYTB 2Z9OA 1OFCX 2O61A 5CYVA 4L5EA 1W7PB 5KHDA 2NRAC 2IGNA 3TGNA 3BPXA 2F5CA 2KLOA 1BL0A 2ZMEA 3V8KA 2E2HJ 2XF7A 3M8JA 6PAXA 4BHCA 4C30A 3K70C 4KA4A 1JE8A 1CGPA 2V9PA 3TMOA 3JSOA 3HEFA 3G71I 3G1LA 1S29A 2PJRB 4IRIA 2P0WA 3DLLF 1K61A 4ZDLA 1GXQA 2BXZA 2JQ7A 4JOMA 1A36A 1TBXA 3CMAI 2GAUA 3R4KA 4KN7X 3GWZA 1RUOA 3CUOA 3MEXA 4DNCA 3FXMA 3ZQIA 2YX4A 1R1UA 4HOBA 2MLKA 3A2KA 4CCNA 2VODA 3X2QH 2XUBA 3C18A 2W00A 1XSDA 2F5DA 2Y48A 2RGVA 3BWGA 3OL3A 1R4NB 3OS1A 2VLAA 1VFCA 3WU0A 2O3FA 2ZXWH 4XKBA 3WG9A 1QVUA 1XGOA 3JREA 3FISA 3QODA 4CXFA 1G3SA 2RVCA 2HVQA 3RPQA 2LH9A 4Y33A 1K7AA 1P7IA 2R7WA 3KZZA 4RA2A 3A4CA 2VL8A 1Y1WJ 2RQQA 1T08B 3FXOA 1FZPB 2Z5UA 2LBFA 3KP7A 4IEJA 2IGMA 2KDZA 5DUKA 1EV7A 2EBIA 3K4BA 2R7DA 3SEZA 4Y4RA 4U88A 1GV5A 3HSFA 4IQJA 1SVMA 4YFNF 3Q0UA 2RNGA 3E6BA 4IO9F 5J1UA 1D0ZA 1R7JA 1X3ZB 3C3WA 1MZBA 5LGNA 1AHDP 5LGUA 3O8GA 1R5ID 3JRGA 3OWTA 3A01B 2NXNB 3HPGA 1NHAA 2XAGA 1S7EA 1G3WA 2EINH 2QQ8A 1K4SA 2W48A 5IPAA 1OJLA 3BG9A 4G9YA 3OYAA 5JHFA 4BKXA 2KIFA 2VKEA 1ZHFA 1ODDA 2O5RA 3DBHB 4BAYA 2EQRA 4A3BJ 2UXNA 4RS8A 2FNAA 4IRGA 1R23A 1G4DA 1W0UA 4OIOF 1ZR2A 1YRNA 3IKVA 2FQ4A 4A3IJ 2QYOA 2VBZA 3LSJA 4BY7J 2QWWA 3L00A 4P55A 2WAEA 3FMRA 5KK1A 2DDBA 2K4BA 3K4JA 4KJZA 1PDNC 4TV7A 1H89C 3WTSC 1NG6A 5L3CA 3EDPA 1WI3A 1ZGAA 4MGRA 2M87A 3ZQLA 3BQYA 2LSOA 2DT5A 3FXQA 2XIGA 3ULQB 3MQ0A 1W5CC 1PP8F 4ZYAA 2RC4A 4HV5A 2VT2A 3N05A 4UUSA 3E6CC 4HEA2 4UHTA 1T38A 1T56A 1VQ7I 3H0GJ 1D5YA 3HOYJ 1LEBA 1YW8A 1ETVA 4IHSA 2AXLA 3DF8A 2P81A 3HUGB 2WADA 3GZNB 2LK2A 3I54A 5AIQA 1POGA 4A5MA 4Q5SF 2E71A 3OYHA 1Q1HA 3BR0A 1FIAA 3U21A 2K9QA 1A6QA 2CFOA 1GUUA 2HYGD 2X1DA 4JP0A 3IC7A 1JUSA 2L0KA 3M8FA 2CQ7A 3EUHC 4IOAF 3I55I 3NRVA 2W25A 1VQ5I 3S3NA 2VJIA 2YS9A 3WG7H 2Y75A 3K4NA 2VUMJ 3DV8A 2IA1A 2ZCWA 3MZ8A 1IDYA 5FKKA 5HDNA 4ENNA 5HLTA 5BQTA 1WSUA 3GTMJ 1FOYA 3S1MJ 4C3IJ 3JTGA 2YSRA 3PUFA 5FO5A 4E7KA 4XOTA 1FYMA 4DJAA 4S04A 4MFEA 4OAYA 4DBRA 1O7LA 2GIVA 2R7FA 3KP2A 5LRSA 3TO6A 3VWBA 3F3XA 3H9GA 3GTQJ 1V4RA 2Y0MA 2J5PA 5K5QA 3RZDJ 4NC6A 4ANJA 4KT6A 2VBWA 4EJVA 3J80K 2ZSIB 1W36D 3B73A 2OZUA 4BE0A 3S8PA 3BTLA 3CCYA 4IX7A 3DU5A 2CWEA 2HQ5A 2OJED 2R0QC 4G7HF 3CLQA 1MMGA 4MNUA 3UKGA 3EUHA 2IGKA 1IN7A 1SMTA 1FOWA 3ECHA 4PFPA 1QZYA 2MABA 2ZC2A 2V26A 1IW7F 4BXFA 1X1AA 2M30A 3T5XA 3EYIA 1OQYA 3LSKA 1VQ9I 2KDOA 2VONA 2IVMA 3PNVA 3JRIA 5LD2C 4XSXF 3V7SA 3B6CA 3S2HJ 3JCUC 3DTEA 4EATA 2K3PA 3Q9SA 5DEQA 3JR9A 4KFCA 1X4PA 2FSWA 5EEHA 3FM5A 5IOYA 1JTYA 1T39A 1UHMA 5AIPA 2E5ZA 2DA6A 1OYWA 1L0OC 5HOOA 2RV8A 2JMWA 2DXIA 3GLLA 5CQGA 2GIZA 2DQRA 2R7XA 1IXRC 2K9SA 4BQNA 1H9GA 1QZZA 5C4JJ 2X6WA 3QU3A 1U5TA 4Y7NJ 1RKTA 2VOPA 2H6CA 1WJAA 3BR6A 2Q8KA 3V42A 1X1DA 2EK5A 4BBSJ 1Y8RB 2BW3B 5ICGA 3GW2A 1UG0A 5EF6A 2F4IA 1FY7A 1WRJA 4Y13A 2X9DA 5B1BH 1FTTA 4MTEA 3HGGA 4XLCA 3Q3SA 4FETA 3U2RA 3A1YA 4B8XA 2R5YA 2ETHA 3TKYA 1GDTA 3FHNA 1VQ6I 1SAUA 2CH0A 2XSJC 4AIHA 5DDGA 1TZLA 2HFHA 1J09A 2F4MB 3S2DJ 2PMZN 2QF7A 3L09A 2A07F 5F08A 2A5YB 3W6KB 1BI1A 2MYSA 4E7SA 3LAPA 4HF0A 4KICA 2M8GX 3BY6A 1ETKA 4PCQA 4RB0A 4R79A 2EZIA 3WU1B 1L3LA 3FWEA 4D5FA 1JUMA 4I09A 2OCEA 4RGUA 1KQ9A 4NHJA 3DQVC 1JT0A 2AQFA 2LC2A 2OC6A 3J7AY 4DZPA 2BHZA 1P7JA 1SD7A 3FKJA 1WJEA 2ID3A 3HB9A 2KHMA 1Y6IA 2JA2A 3F22A 4RAFA 2COBA 2DJIA 3SEQA 3MN2A 3L2WA 1GVDA 2W82A 2N8GA 4MHGA 2CFXA 4XLPF 3GMEA 1HXDA 1HKQA 2LY2A 4IXAA 5K1YA 1X4OA 4OIPF 1JXSA 4XLNF 3FF5A 4XLFA 2R5ZA 3HOUJ 1D8KA 2KRHA 2WTEA 2OU2A 1T0FC 3DKXA 4NQWB 1MMSA 4M73A 5FKOA 3SDBA 5IP6A 2KIMA 1F4KA 2GXAA 3QWLA 4XONA 1Z91A 4G6QA 3M07A 3OOUA 4HLXA 1FJLA 2DAOA 1WKMA 1U6GA 2EIJH 3LFKA 3CO6C 3ZXSA 4ZH4F 2Y31A 1B72A 1D1AA 4PJJA 4H4KC 3S15J 3RIRA 3DFGA 3L2CA 4OINF 5D5WB 5GPAA 3CCUI 1T6SA 1U78A 4BU2A 4Q4ZF 5BS6A 2A05A 2V6EA 2QEXI 4UUVA 1V3FA 2VIXA 1YS7A 1RNLA 3GVAA 2E1CA 3HC7A 4L0ZB 1Y0NA 4XRMA 4YRVA 2XV4S 3J80Z 1IRZA 1S6LA 1ZQ3P 3W2WA 2NVUB 1RR8C 2Y30A 4ENJA 3ZQ7A 3R6SA 5F6FA 1WJBA 1T0FA 2R7QA 1I27A 4ZYHA 4BE2A 4BXUA 1N75A
chains in the Genus database with same CATH topology
2EV6A 2PQ8A 1Z05A 3IWZA 4LGWA 3J7AO 1FYLA 3E5UA 3F72A 5FD5A 1B9MA 2HKXA 2DTRA 5HS8A 1AOYA 3LQQA 4XBFA 1SAXA 3ZP5A 4XRFA 3F8CA 1GHCA 4OU0A 4H0EA 4AWXB 5E1XA 3MZYA 4M6XA 2HOEA 3W6JB 3EQLF 3F6OA 5D5XB 1EH8A 4U0YA 2GA1A 1W4MA 3ZMDA 1I1GA 2ZJ2A 3Q9VA 3CUQC 5FFXA 2QBYB 4EJOA 1PUEE 2WWYA 3P9KA 2BEOA 3AAFA 4I2OA 1IN8A 2CO5A 5ICCA 3TQNA 3F8MA 2EFOA 4PDKA 4JQFA 5DD8A 2O6GE 4L9TA 2P6TA 4EGYA 3KLOA 4OIQF 5IT3A 5L3GA 1P92A 2P7VB 2ZBKA 2XGXA 2VOOA 1ZRFA 1KYWA 2FRHA 2ZKZA 1B6AA 4LFUA 3BP8A 2V1UA 4ETSA 2X0LA 3CUQA 3ELKA 3ZMUA 1YQAA 1R1TA 1IF1A 1O3TA 4QLCU 4PZJA 1E2XA 4Z2YA 1P6RA 2V1DA 1BN5A 3I4PA 3E5QA 4P9UA 4I01A 3RJPA 4O6JA 5E20A 2FBKA 3KFWX 3JSPA 1EH6A 3BJOA 5DUIA 4HAMA 3DP7A 3HHHA 3ROUA 2MLGA 3KP6A 3ABUA 1K79A 3SFZA 3PQKA 3GFLA 1ZRCA 3FMQA 2EB7A 3H3UA 4UVAA 1WWXA 5CVIA 3IWFA 1TW2A 4G94A 2VXZA 5HS9A 4KNYA 4YIFA 4N9HA 2XROA 3FHZA 1XMKA 4RAYA 2L01A 2A69F 4ZYEA 2IRFG 2MH9A 5HDKA 2QUFA 1MKMA 5A2QK 1KU9A 3BJ6A 1XSXA 5L3DA 1O57A 3R0AA 2DK5A 4LD5A 1BM9A 2VE9A 3R61A 1ZG1A 4QWQA 3M7GA 2V1XA 2VN2A 3HRTA 3L7WA 1F9NA 1SFEA 3T1BA 5J6XA 2DU9A 5HS7A 1DPRA 4HBLA 1FBSA 1BC8C 1DUXC 3I0TA 3T8RA 5HLHA 1IN5A 2FE3A 3ABTA 4FX4A 1ZLKA 1BI0A 4GGGA 3SXYA 2CQKA 4HDUA 1IZ1A 1H9TA 1ZN2A 1P4WA 3K2ZA 3WGGA 1R36A 3I59B 3KEQA 3RTRA 4EGZA 5E8IA 2HEOA 4M9XA 2L4AA 2ZXJA 4ESFA 3TOBA 4IF4A 2V9VA 5DV5A 3MZHA 1K78B 3FM3A 2P5LC 4WWCA 2XKPA 1REPC 1U3EM 4RB2C 5E1WA 2OA4A 1T2KA 3GFJA 4RGRA 5JFRA 1W7PA 1FNNA 1QGPA 3WTZA 1IN4A 4P5OA 1ZREA 5FLXK 1USSA 1YW7A 4KMUX 5E8GA 4ZZDA 3VB2A 2RN7A 2W57A 3KP4A 2PN6A 5DCFA 1TQMA 2XHKA 1ZH5A 4LJZF 3CJNA 1MJBA 2XAQA 4OIRF 5DD4A 4PGHA 1Z6TA 1X3UA 3GZ5A 2WV0A 3BPVA 1XDSA 2XAJA 1J7KA 3P7NA 4IRHA 3ZMSA 5A2QZ 1MDMA 3EETA 4FT8A 2HKOA 3H3ZA 2XKOA 4A6EA 1FYKA 1UHWA 3GEZA 2VT3A 2Q0OA 2DO7A 4Q48A 4HW0A 1P4XA 2LF7A 4EQQA 1LQ1A 2IP2A 5E17F 3U1DA 1HSJA 1J5YA 2NAZA 3GFIA 4GO1A 5CVJA 1S3JA 4ZYDA 4JK1X 4YIIA 4M74A 3E5XA 4JBAA 2HWVA 1JHHA 4MQVA 2K86A 2IA2A 1HQCA 5DCMA 4EM2A 2J5OA 2A61A 3WGIA 4L0YB 3QRFF 5LGTA 1USTA 4A0XA 4Y17A 1S8NA 1U5TB 5HLIA 4RGXA 1FP2A 4U7BA 4I0BA 5CVVA 3DXJF 4EJUA 2H27A 1FWZA 1SMYF 3HUGA 5E18F 5F1RA 3TDZC 1FSHA 4G7OF 3VFZA 1PP7U 2ESHA 2H94A 3DPLC 4XSZF 1LNWA 4M6YA 4EM0B 5FLXZ 1FBQA 3K0LA 3E6MA 2VC0A 3D5LA 1LJ9A 1BJAA 2K02A 4HZFA 3F8NA 1UFMA 5CLSA 5L3BA 1OPCA 2PMHA 3HOTA 3WTUC 2KJCA 2D45A 1DPUA 3C7JA 4LB6B 4MTDA 3QOPA 4NB5A 4U7DA 3WGHA 3JW4A 2OZ6A 3KZYA 2OD5A 4OMYA 4AIJA 2GXGA 2PG4A 5CVUA 1XGNA 4N0BA 2MBFA 3GZ6A 1OYYA 1BOAA 1MD0A 3MAJA 1FX7A 2JT1A 1W7PD 1LDKB 4L5IA 1FP1D 3F8FA 1E17A 3DPTA 1I5ZA 1XMAA 3JTHA 3D0SA 2NS0A 4ON0A 1ZARA 3B02A 3RDIA 3V7RA 1UCRA 3K1PA 4PGGA 4WK8F 2K27A 2X4HA 2P6SA 2YU3A 3IL2A 1C0WA 3ZN1A 3O3KA 2OQRA 3KP5A 3K1MA 5LEJA 2B0LA 1TQPA 4ESJA 2E7WA 1SD5A 2MD5A 2M8EA 2L02A 5ED4A 2DBBA 4KYWA 2ELHA 4GCVA 3OV8A 1HKSA 2VC1A 3L9FA 1IAWA 3ZPLA 3HRUA 3GO5A 4KN4X 3MCZA 3KETA 4EV0A 2L4MA 5D5VB 3DKWA 3WTVC 3IRRA 2D1VA 4A12A 1Z1DA 5LLQA 3QAHA 3ZMVA 4KMFA 2K4JA 3RPUA 3HTSB 4NQWA 1J59A 2EFPA 1XCVA 3QPHA 2IPQX 2KIUA 4I98B 1HW1A 3TO9A 5BOXA 2HGCA 5JI6A 1WI9A 5H20A 3IRQA 2NNYA 1YTYA 3HSEA 1J0RA 1FT9A 1YS6A 2M5WA 4RAZA 3V8JA 2FBIA 3LA3A 4UV9A 4ASNA 2LNBA 2QENA 3F21A 1STZA 3SHFA 1KU3A 5EEGA 1I6XA 2A68F 2DQLA 4UXNA 3SZPA 2R3SA 3J81K 3DEUA 2OAZA 4HLYA 4Q47A 5D5UB 4R8HA 1O3RA 2STWA 4I0AA 2DI3A 4HYEA 2QQ9A 3GXOA 1FLIA 2QM3A 3K9TA 5CJ9A 1TNSA 3ML6A 4LG0B 1XSVA 1BI3A 3OOPA 4LMYA 2DPDA 2H09A 2G7HA 3E97A 1CF7B 2P7CB 2LKPA 2YR2A 3E3VA 1R1VA 2QLZA 2FMLA 5D6EA 2FQ3A 5TJJA 5FD6A 1GVJA 1QQIA 2FBHA 2EA4A 2XASA 2L3DA 4KDPA 2QBYA 2ESNA 4EJTA 1FC3A 3F8BA 1IXSB 1ZG5A 4IVNA 2G7UA 4UNOA 2Z99A 5HVQC 1RZ4A 4YG2F 1SFXA 2ISZA 4HDVA 1MJ9A 3NEUA 2BE5F 2HQRA 5ILUA 2KRFA 2Z33A 4ESBA 5FB2A 1XB4A 4A5NA 5DYMA 2P8TA 5L3FA 3T0YA 3G3ZA 1H0MA 2W24A 4HX7A 1HBXG 3HHGA 1D3YA 3BOQA 2O03A 2ZMEB 1HW5A 1ZAOA 2F5EA 2W85A 4ENKA 4CICA 1BBYA 3HYIA 4HX8A 5ILVA 4U0VA 2W84A 3VEPA 4K2EA 5E1ZB 5LRRA 1HSTA 2EA2A 4O3MA 1HW2A 1YO5C 1FBUA 1KU2A 2ADUA 1K6OA 3WTWC 2QVOA 3K69A 3J81Z 4LLNA 2O8XA 3LA2A 2VBXA 2P5VA 4P9FA 5LEKA 1XN7A 1JGSA 3C1DA 1JHFA 3MWMA 5IT9K 5K5RA 1OKRA 5D4RA 2ACJA 5F64A 3COAC 4I02A 2KKOA 4HX4A 1DP7P 5ICEA 3HOSA 2GA2A 2DPUA 2FOKA 4FHTA 2H6BA 4MEXF 3ZMTA 2JTVA 2FMYA 5LHGA 3IKTA 4KIBA 5BPDA 3KLNA 1R5GA 3CLOA 4P96A 3I5UA 4A0ZA 4IHTA 2YPRA 3LSTA 1IXCA 1U2WA 4WXCA 5FFZA 1KQ8A 3I53A 3K1NA 2PI0A 3E6DA 3F6VA 3QPTA 1MGTA 3ECOA 1S7AA 3V4GA 1O7FA 1Z6RA 2HQNA 2ZNZA 1XDUA 3RKYA 1B9NA 4HQEA 4RB3C 1MDMB 4MEYF 4KIFA 1Y0UA 1D8JA 4WXHA 2BGCA 4D0PA 3R60A 3BJAA 1Z7UA 4BNCA 2GQQA 2FXAA 3RYRA 2HYFA 2HTSA 1R22A 3GF2A 4LK1F 3KEOA 2KJBA 5ICFA 4L5JA 4Y15A 4IPAA 5JVTA 3MFKA 2L54A 3T8TA 4CZZA 2LDUA 4FX0A 4UV8A 2QQAA 1T98A 2JRTA 2EV0A 1ZG3A 4CDGA 4BQAA 3I59A 5HLGA 5DCMB 2IW5A 3WTXC 4L18B 3GX4X 4MQ9F 2BYVE 1IUYA 5L3EA 3REOA 1MJAA 1FSEA 1K78A 3BROA 3BDDA 4O5VA 1S7OA 3M9AA 4DQ2A 4WCGA 4A2UA 4AD9A 2XAHA 1YW9A 1OR7A 3R0JA 2MH2A 3I71A 5IT9Z 3LAJA 1SD6A 1BC7C 5K5OA 1GXPA 2PJPA 3V7CA 1AWCA 3PFIA 3N97A 4F7ZA 1KQ0A 3WE2A 3WTTC 1KU7A 1I1SA 1FPQA 2EJRA 1R5HA 3CTAA 1QO0D 4GXOA 1RIOH 1TTYA 2STTA 2XAFA 4BYYA 5HDGA 2CW0F 1O3SA 2ISYA 4WF2A 1U5TC 2OQGA 2DK8A 2Z3YA 4BH9A 3G73A 4LLLA 2NYXA 3RKWA 5D8LB 4L9JA 1W5SA 1XD7A 2M45A 1TW3A 4WX9A 5BPIA 3QP6A 3SZTA 1R58A 4CGZA 4ZZLA 4A6DA 4GYIA 2HTJA 2JSCA 2PLYA 4B09A 3TDUC 4EJWA 5J8CA 2FEZA 1XCBA 1SFUA 5JR3A 2CYYA 2G9WA 3I64A 2NNNA 2EV5A 4M72A 3HIFA 1O3QA 4L9VA 5AONA 4CO8A 1KA8A 3TOAA 1OMIA 2V79A 5KVRA 4UVCA 1Z9CA 2ZFWA 4EM1A 2O0YA 1ULYA 2XRNA 4HQMA 1EH7A 2M1BA 1RUNA 2RDPA 3HRSA 1YYVA 4YFXF 4M9SA 3QP5A 1R00A 2HR3A 3LA7A 1F5TA 1F1ZA 3FZVA 3HTUA 1J2XA 3JAMK 3CO7C 4KUMA 4ZYGA 2VBYA 2MA3A 2BV6A 3FMSA 3GYHX 2PMUA 1YIOA 2Q2EA 5ERIA 4I7HA 3ZMZA 2IJLA 5LHHA 2HDCA 3KE2A 1XGMA 4R1HA 4M9ZA 2VE8A 4N9IA 3SQNA 3RYPA 1WQ2A 3TO7A 1TLHB 3Q5FA 4OOIA 2F5FA 4LB5A 3WODF 2K7LA 1W5TA 3F23A 1QBJA 2F2EA 1BIBA 3VOEA 1IN6A 4G6DA 3O6BB 4HF1A 4CHUA 4RB1A 1U8RA 4UVBA 1LB2A 3ISPA 2RQPA 3P9IA 1IRGA 1ZRDA 3HSRA 4EMSA 2EFQA 3EYYA 2PEXA 1D5VA 1UB9A 5FGMA 1LEAA 3FX3A 3KP3A 3ERED 1TNTA 1OYIA 1YLFA 3H92A 5LHIA 2UWMA 1QPMA 1XGSA 2UXXA 4KT5C 3HRMA 4BHBA 3CUQB 2A3SA 1FOKA 1J9IA 2FNPA 1ZYRF 1KYZA 2XVCA 1P2FA 2UZKA 3FXRA 2ZNYA 4G7ZF 4HV6A 2JPBA 4GYGA 1SD4A 2P5KA 2RNJA 3I58A 1ONVA 4IJAA 1P4AA 2E7XA 4S05A 4LK0F 2D2WA 2A6EF 2GXBA 4WXDA 1QNTA 1BI2A 3JAMZ 3VODA 3V8LA 3GFMA 1RI7A 3LWFA 1ON2A 2CGPA 1IRFA 2EFNA 5D4SA 2CSOA 3U9GA 3M1EA 2OBPA 3RKXA 3GLXA 2QQBA 5H6RA 5JHUA 2PBIA 1G3TA 3KCCA 1DDNA 2IA0A 4U0WA 2RKHA 1YG2A 3O2PE 2DFIA 1B59A 5LBQA 2DW4A 4HF2A 3PQJA 1ON1A 5J8FA 3NQOA 1LDJA 2ZO4A 2P4WA 3GUDA 3IHUA 2JZYA 2E1NA 1TQIA 2FF4A 2V6CA 2YX7A 2COMA 2GZWA 3ZN0A 2EWNA 1J75A 5D6FA 4LG0A 4EVIA 4ENMA 3QU6A 5H6QA 2CG4A 3WE3A 1G6NA 2JPCA 2C6YA 1HKTA 2QZ8A 2TDXA 1CF7A 5CVRA 4BHPA 5D8KB 2BBYA 3RI4A 3LQRA 1A04A 4OMZA 3WTYC 5BMZA 2EFWA 1LDDA 4M71A 2IT0A 2LF8A 5TRDA 3N4MA 2DLLA 4RGSA 1LVAA 1G3YA 4L9NA 3M8EA 3CDHA 2WC2A 2GWRA 2HS5A 3P9CA 4G8XA 1VTNC 1ZGJA 4AVPA 4E70A 1BIAA 1B4AA 4A0YA 2FA5A 2FU4A 1YFHA 3FXUA 4AIKA 3S2WA 5ILSA 2AS5F 2A6HF 4YFKF 3BZ6A 2D1HA 2HZTA 1ZLJA 4CYDA 1KGSA 2MC3A 4KIGA 2PFBA 1B1BA 4HA8A 4LLGF 2Z9OA 2O61A 5CYVA 1W7PB 2NRAC 3TGNA 3BPXA 2F5CA 2ZMEA 3V8KA 6PAXA 4BHCA 1JE8A 4KA4A 1CGPA 3JSOA 1S29A 4IRIA 1GXQA 1TBXA 2GAUA 3R4KA 4KN7X 3GWZA 1RUOA 3CUOA 3MEXA 4DNCA 2YX4A 1R1UA 4HOBA 2MLKA 2VODA 1XSDA 2XUBA 3C18A 2F5DA 2Y48A 2RGVA 3BWGA 3WU0A 2O3FA 3WG9A 1XGOA 4CXFA 1G3SA 2RVCA 3RPQA 1K7AA 3KZZA 1FZPB 2Z5UA 3KP7A 5DUKA 1EV7A 2R7DA 4U88A 3HSFA 4YFNF 3E6BA 1R7JA 3C3WA 1MZBA 5LGNA 5LGUA 1NHAA 2XAGA 1G3WA 4G9YA 2KIFA 1ZHFA 1ODDA 4BAYA 2UXNA 4RS8A 2FNAA 4IRGA 1R23A 1G4DA 4OIOF 3IKVA 2QYOA 2VBZA 2QWWA 3L00A 4P55A 3FMRA 5KK1A 2K4BA 1PDNC 4TV7A 3WTSC 5L3CA 3EDPA 1ZGAA 4MGRA 2M87A 2LSOA 2DT5A 3FXQA 2XIGA 3ULQB 3MQ0A 1PP8F 2RC4A 4HV5A 2VT2A 3E6CC 4UHTA 1T38A 1LEBA 1YW8A 4IHSA 2AXLA 3DF8A 3I54A 5AIQA 4A5MA 4Q5SF 1Q1HA 2HYGD 3IC7A 3M8FA 3NRVA 2W25A 2Y75A 3DV8A 2IA1A 2ZCWA 1WSUA 5HDNA 4ENNA 5BQTA 3JTGA 2YSRA 5FO5A 1FYMA 4S04A 1O7LA 2GIVA 2R7FA 3KP2A 5LRSA 3TO6A 3F3XA 1V4RA 2Y0MA 2J5PA 5K5QA 2VBWA 4EJVA 3J80K 3B73A 2OZUA 2CWEA 4G7HF 4MNUA 3EUHA 1IN7A 1SMTA 3ECHA 1QZYA 1IW7F 2M30A 3T5XA 3EYIA 2VONA 2IVMA 4XSXF 3V7SA 3Q9SA 5DEQA 4KFCA 2FSWA 5EEHA 3FM5A 1T39A 1UHMA 5AIPA 1OYWA 1L0OC 5HOOA 2RV8A 2DQRA 1IXRC 1H9GA 1QZZA 3QU3A 1U5TA 2VOPA 2H6CA 2Q8KA 2EK5A 5ICGA 3GW2A 1FY7A 1WRJA 4Y13A 4MTEA 3U2RA 4B8XA 2ETHA 3TKYA 5DDGA 4AIHA 2HFHA 3L09A 2A07F 2A5YB 3W6KB 1BI1A 3LAPA 4HF0A 4KICA 4PCQA 3BY6A 3WU1B 4RB0A 4R79A 1L3LA 3FWEA 4I09A 4RGUA 1KQ9A 4NHJA 3DQVC 1SD7A 3F22A 4MHGA 2CFXA 4XLPF 1HXDA 1HKQA 4IXAA 5K1YA 1JXSA 4OIPF 4XLNF 3FF5A 1D8KA 2WTEA 2OU2A 4M73A 2KIMA 1F4KA 1Z91A 4G6QA 4HLXA 2DAOA 1WKMA 1U6GA 3LFKA 3CO6C 4ZH4F 3RIRA 3DFGA 3L2CA 4OINF 5D5WB 1U78A 1T6SA 4Q4ZF 5BS6A 4UUVA 1V3FA 3GVAA 1YS7A 1RNLA 2E1CA 4L0ZB 2XV4S 3J80Z 1S6LA 4ENJA 3ZQ7A 3R6SA 5F6FA 1T0FA 1I27A 4ZYHA 4BXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EV6 A;  2PQ8 A;  1Z05 A;  3IWZ A;  4LGW A;  3J7A O;  1FYL A;  3E5U A;  3F72 A;  5FD5 A;  1B9M A;  2HKX A;  2DTR A;  5HS8 A;  1AOY A;  3LQQ A;  4XBF A;  1SAX A;  3ZP5 A;  4XRF A;  3F8C A;  1GHC A;  4OU0 A;  4H0E A;  4AWX B;  5E1X A;  3MZY A;  4M6X A;  2HOE A;  3W6J B;  3EQL F;  3F6O A;  5D5X B;  1EH8 A;  4U0Y A;  2GA1 A;  1W4M A;  3ZMD A;  1I1G A;  2ZJ2 A;  3Q9V A;  3CUQ C;  5FFX A;  2QBY B;  4EJO A;  1PUE E;  2WWY A;  3P9K A;  2BEO A;  3AAF A;  4I2O A;  1IN8 A;  2CO5 A;  5ICC A;  3TQN A;  3F8M A;  2EFO A;  4PDK A;  4JQF A;  5DD8 A;  2O6G E;  4L9T A;  2P6T A;  4EGY A;  3KLO A;  4OIQ F;  5IT3 A;  5L3G A;  1P92 A;  2P7V B;  2ZBK A;  2XGX A;  2VOO A;  1ZRF A;  1KYW A;  2FRH A;  2ZKZ A;  1B6A A;  4LFU A;  3BP8 A;  2V1U A;  4ETS A;  2X0L A;  3CUQ A;  3ELK A;  3ZMU A;  1YQA A;  1R1T A;  1IF1 A;  1O3T A;  4QLC U;  4PZJ A;  1E2X A;  4Z2Y A;  1P6R A;  2V1D A;  1BN5 A;  3I4P A;  3E5Q A;  4P9U A;  4I01 A;  3RJP A;  4O6J A;  5E20 A;  2FBK A;  3KFW X;  3JSP A;  1EH6 A;  3BJO A;  5DUI A;  4HAM A;  3DP7 A;  3HHH A;  3ROU A;  2MLG A;  3KP6 A;  3ABU A;  1K79 A;  3SFZ A;  3PQK A;  3GFL A;  1ZRC A;  3FMQ A;  2EB7 A;  3H3U A;  4UVA A;  1WWX A;  5CVI A;  3IWF A;  1TW2 A;  4G94 A;  2VXZ A;  5HS9 A;  4KNY A;  4YIF A;  4N9H A;  2XRO A;  3FHZ A;  1XMK A;  4RAY A;  2L01 A;  2A69 F;  4ZYE A;  2IRF G;  2MH9 A;  5HDK A;  2QUF A;  1MKM A;  5A2Q K;  1KU9 A;  3BJ6 A;  1XSX A;  5L3D A;  1O57 A;  3R0A A;  2DK5 A;  4LD5 A;  1BM9 A;  2VE9 A;  3R61 A;  1ZG1 A;  4QWQ A;  3M7G A;  2V1X A;  2VN2 A;  3HRT A;  3L7W A;  1F9N A;  1SFE A;  3T1B A;  5J6X A;  2DU9 A;  5HS7 A;  1DPR A;  4HBL A;  1FBS A;  1BC8 C;  1DUX C;  3I0T A;  3T8R A;  5HLH A;  1IN5 A;  2FE3 A;  3ABT A;  4FX4 A;  1ZLK A;  1BI0 A;  4GGG A;  3SXY A;  2CQK A;  4HDU A;  1IZ1 A;  1H9T A;  1ZN2 A;  1P4W A;  3K2Z A;  3WGG A;  1R36 A;  3I59 B;  3KEQ A;  3RTR A;  4EGZ A;  5E8I A;  2HEO A;  4M9X A;  2L4A A;  2ZXJ A;  4ESF A;  3TOB A;  4IF4 A;  2V9V A;  5DV5 A;  3MZH A;  1K78 B;  3FM3 A;  2P5L C;  4WWC A;  2XKP A;  1REP C;  1U3E M;  4RB2 C;  5E1W A;  2OA4 A;  1T2K A;  3GFJ A;  4RGR A;  5JFR A;  1W7P A;  1FNN A;  1QGP A;  3WTZ A;  1IN4 A;  4P5O A;  1ZRE A;  5FLX K;  1USS A;  1YW7 A;  4KMU X;  5E8G A;  4ZZD A;  3VB2 A;  2RN7 A;  2W57 A;  3KP4 A;  2PN6 A;  5DCF A;  1TQM A;  2XHK A;  1ZH5 A;  4LJZ F;  3CJN A;  1MJB A;  2XAQ A;  4OIR F;  5DD4 A;  4PGH A;  1Z6T A;  1X3U A;  3GZ5 A;  2WV0 A;  3BPV A;  1XDS A;  2XAJ A;  1J7K A;  3P7N A;  4IRH A;  3ZMS A;  5A2Q Z;  1MDM A;  3EET A;  4FT8 A;  2HKO A;  3H3Z A;  2XKO A;  4A6E A;  1FYK A;  1UHW A;  3GEZ A;  2VT3 A;  2Q0O A;  2DO7 A;  4Q48 A;  4HW0 A;  1P4X A;  2LF7 A;  4EQQ A;  1LQ1 A;  2IP2 A;  5E17 F;  3U1D A;  1HSJ A;  1J5Y A;  2NAZ A;  3GFI A;  4GO1 A;  5CVJ A;  1S3J A;  4ZYD A;  4JK1 X;  4YII A;  4M74 A;  3E5X A;  4JBA A;  2HWV A;  1JHH A;  4MQV A;  2K86 A;  2IA2 A;  1HQC A;  5DCM A;  4EM2 A;  2J5O A;  2A61 A;  3WGI A;  4L0Y B;  3QRF F;  5LGT A;  1UST A;  4A0X A;  4Y17 A;  1S8N A;  1U5T B;  5HLI A;  4RGX A;  1FP2 A;  4U7B A;  4I0B A;  5CVV A;  3DXJ F;  4EJU A;  2H27 A;  1FWZ A;  1SMY F;  3HUG A;  5E18 F;  5F1R A;  3TDZ C;  1FSH A;  4G7O F;  3VFZ A;  1PP7 U;  2ESH A;  2H94 A;  3DPL C;  4XSZ F;  1LNW A;  4M6Y A;  4EM0 B;  5FLX Z;  1FBQ A;  3K0L A;  3E6M A;  2VC0 A;  3D5L A;  1LJ9 A;  1BJA A;  2K02 A;  4HZF A;  3F8N A;  1UFM A;  5CLS A;  5L3B A;  1OPC A;  2PMH A;  3HOT A;  3WTU C;  2KJC A;  2D45 A;  1DPU A;  3C7J A;  4LB6 B;  4MTD A;  3QOP A;  4NB5 A;  4U7D A;  3WGH A;  3JW4 A;  2OZ6 A;  3KZY A;  2OD5 A;  4OMY A;  4AIJ A;  2GXG A;  2PG4 A;  5CVU A;  1XGN A;  4N0B A;  2MBF A;  3GZ6 A;  1OYY A;  1BOA A;  1MD0 A;  3MAJ A;  1FX7 A;  2JT1 A;  1W7P D;  1LDK B;  4L5I A;  1FP1 D;  3F8F A;  1E17 A;  3DPT A;  1I5Z A;  1XMA A;  3JTH A;  3D0S A;  2NS0 A;  4ON0 A;  1ZAR A;  3B02 A;  3RDI A;  3V7R A;  1UCR A;  3K1P A;  4PGG A;  4WK8 F;  2K27 A;  2X4H A;  2P6S A;  2YU3 A;  3IL2 A;  1C0W A;  3ZN1 A;  3O3K A;  2OQR A;  3KP5 A;  3K1M A;  5LEJ A;  2B0L A;  1TQP A;  4ESJ A;  2E7W A;  1SD5 A;  2MD5 A;  2M8E A;  2L02 A;  5ED4 A;  2DBB A;  4KYW A;  2ELH A;  4GCV A;  3OV8 A;  1HKS A;  2VC1 A;  3L9F A;  1IAW A;  3ZPL A;  3HRU A;  3GO5 A;  4KN4 X;  3MCZ A;  3KET A;  4EV0 A;  2L4M A;  5D5V B;  3DKW A;  3WTV C;  3IRR A;  2D1V A;  4A12 A;  1Z1D A;  5LLQ A;  3QAH A;  3ZMV A;  4KMF A;  2K4J A;  3RPU A;  3HTS B;  4NQW A;  1J59 A;  2EFP A;  1XCV A;  3QPH A;  2IPQ X;  2KIU A;  4I98 B;  1HW1 A;  3TO9 A;  5BOX A;  2HGC A;  5JI6 A;  1WI9 A;  5H20 A;  3IRQ A;  2NNY A;  1YTY A;  3HSE A;  1J0R A;  1FT9 A;  1YS6 A;  2M5W A;  4RAZ A;  3V8J A;  2FBI A;  3LA3 A;  4UV9 A;  4ASN A;  2LNB A;  2QEN A;  3F21 A;  1STZ A;  3SHF A;  1KU3 A;  5EEG A;  1I6X A;  2A68 F;  2DQL A;  4UXN A;  3SZP A;  2R3S A;  3J81 K;  3DEU A;  2OAZ A;  4HLY A;  4Q47 A;  5D5U B;  4R8H A;  1O3R A;  2STW A;  4I0A A;  2DI3 A;  4HYE A;  2QQ9 A;  3GXO A;  1FLI A;  2QM3 A;  3K9T A;  5CJ9 A;  1TNS A;  3ML6 A;  4LG0 B;  1XSV A;  1BI3 A;  3OOP A;  4LMY A;  2DPD A;  2H09 A;  2G7H A;  3E97 A;  1CF7 B;  2P7C B;  2LKP A;  2YR2 A;  3E3V A;  1R1V A;  2QLZ A;  2FML A;  5D6E A;  2FQ3 A;  5TJJ A;  5FD6 A;  1GVJ A;  1QQI A;  2FBH A;  2EA4 A;  2XAS A;  2L3D A;  4KDP A;  2QBY A;  2ESN A;  4EJT A;  1FC3 A;  3F8B A;  1IXS B;  1ZG5 A;  4IVN A;  2G7U A;  4UNO A;  2Z99 A;  5HVQ C;  1RZ4 A;  4YG2 F;  1SFX A;  2ISZ A;  4HDV A;  1MJ9 A;  3NEU A;  2BE5 F;  2HQR A;  5ILU A;  2KRF A;  2Z33 A;  4ESB A;  5FB2 A;  1XB4 A;  4A5N A;  5DYM A;  2P8T A;  5L3F A;  3T0Y A;  3G3Z A;  1H0M A;  2W24 A;  4HX7 A;  1HBX G;  3HHG A;  1D3Y A;  3BOQ A;  2O03 A;  2ZME B;  1HW5 A;  1ZAO A;  2F5E A;  2W85 A;  4ENK A;  4CIC A;  1BBY A;  3HYI A;  4HX8 A;  5ILV A;  4U0V A;  2W84 A;  3VEP A;  4K2E A;  5E1Z B;  5LRR A;  1HST A;  2EA2 A;  4O3M A;  1HW2 A;  1YO5 C;  1FBU A;  1KU2 A;  2ADU A;  1K6O A;  3WTW C;  2QVO A;  3K69 A;  3J81 Z;  4LLN A;  2O8X A;  3LA2 A;  2VBX A;  2P5V A;  4P9F A;  5LEK A;  1XN7 A;  1JGS A;  3C1D A;  1JHF A;  3MWM A;  5IT9 K;  5K5R A;  1OKR A;  5D4R A;  2ACJ A;  5F64 A;  3COA C;  4I02 A;  2KKO A;  4HX4 A;  1DP7 P;  5ICE A;  3HOS A;  2GA2 A;  2DPU A;  2FOK A;  4FHT A;  2H6B A;  4MEX F;  3ZMT A;  2JTV A;  2FMY A;  5LHG A;  3IKT A;  4KIB A;  5BPD A;  3KLN A;  1R5G A;  3CLO A;  4P96 A;  3I5U A;  4A0Z A;  4IHT A;  2YPR A;  3LST A;  1IXC A;  1U2W A;  4WXC A;  5FFZ A;  1KQ8 A;  3I53 A;  3K1N A;  2PI0 A;  3E6D A;  3F6V A;  3QPT A;  1MGT A;  3ECO A;  1S7A A;  3V4G A;  1O7F A;  1Z6R A;  2HQN A;  2ZNZ A;  1XDU A;  3RKY A;  1B9N A;  4HQE A;  4RB3 C;  1MDM B;  4MEY F;  4KIF A;  1Y0U A;  1D8J A;  4WXH A;  2BGC A;  4D0P A;  3R60 A;  3BJA A;  1Z7U A;  4BNC A;  2GQQ A;  2FXA A;  3RYR A;  2HYF A;  2HTS A;  1R22 A;  3GF2 A;  4LK1 F;  3KEO A;  2KJB A;  5ICF A;  4L5J A;  4Y15 A;  4IPA A;  5JVT A;  3MFK A;  2L54 A;  3T8T A;  4CZZ A;  2LDU A;  4FX0 A;  4UV8 A;  2QQA A;  1T98 A;  2JRT A;  2EV0 A;  1ZG3 A;  4CDG A;  4BQA A;  3I59 A;  5HLG A;  5DCM B;  2IW5 A;  3WTX C;  4L18 B;  3GX4 X;  4MQ9 F;  2BYV E;  1IUY A;  5L3E A;  3REO A;  1MJA A;  1FSE A;  1K78 A;  3BRO A;  3BDD A;  4O5V A;  1S7O A;  3M9A A;  4DQ2 A;  4WCG A;  4A2U A;  4AD9 A;  2XAH A;  1YW9 A;  1OR7 A;  3R0J A;  2MH2 A;  3I71 A;  5IT9 Z;  3LAJ A;  1SD6 A;  1BC7 C;  5K5O A;  1GXP A;  2PJP A;  3V7C A;  1AWC A;  3PFI A;  3N97 A;  4F7Z A;  1KQ0 A;  3WE2 A;  3WTT C;  1KU7 A;  1I1S A;  1FPQ A;  2EJR A;  1R5H A;  3CTA A;  1QO0 D;  4GXO A;  1RIO H;  1TTY A;  2STT A;  2XAF A;  4BYY A;  5HDG A;  2CW0 F;  1O3S A;  2ISY A;  4WF2 A;  1U5T C;  2OQG A;  2DK8 A;  2Z3Y A;  4BH9 A;  3G73 A;  4LLL A;  2NYX A;  3RKW A;  5D8L B;  4L9J A;  1W5S A;  1XD7 A;  2M45 A;  1TW3 A;  4WX9 A;  5BPI A;  3QP6 A;  3SZT A;  1R58 A;  4CGZ A;  4ZZL A;  4A6D A;  4GYI A;  2HTJ A;  2JSC A;  2PLY A;  4B09 A;  3TDU C;  4EJW A;  5J8C A;  2FEZ A;  1XCB A;  1SFU A;  5JR3 A;  2CYY A;  2G9W A;  3I64 A;  2NNN A;  2EV5 A;  4M72 A;  3HIF A;  1O3Q A;  4L9V A;  5AON A;  4CO8 A;  1KA8 A;  3TOA A;  1OMI A;  2V79 A;  5KVR A;  4UVC A;  1Z9C A;  2ZFW A;  4EM1 A;  2O0Y A;  1ULY A;  2XRN A;  4HQM A;  1EH7 A;  2M1B A;  1RUN A;  2RDP A;  3HRS A;  1YYV A;  4YFX F;  4M9S A;  3QP5 A;  1R00 A;  2HR3 A;  3LA7 A;  1F5T A;  1F1Z A;  3FZV A;  3HTU A;  1J2X A;  3JAM K;  3CO7 C;  4KUM A;  4ZYG A;  2VBY A;  2MA3 A;  2BV6 A;  3FMS A;  3GYH X;  2PMU A;  1YIO A;  2Q2E A;  5ERI A;  4I7H A;  3ZMZ A;  2IJL A;  5LHH A;  2HDC A;  3KE2 A;  1XGM A;  4R1H A;  4M9Z A;  2VE8 A;  4N9I A;  3SQN A;  3RYP A;  1WQ2 A;  3TO7 A;  1TLH B;  3Q5F A;  4OOI A;  2F5F A;  4LB5 A;  3WOD F;  2K7L A;  1W5T A;  3F23 A;  1QBJ A;  2F2E A;  1BIB A;  3VOE A;  1IN6 A;  4G6D A;  3O6B B;  4HF1 A;  4CHU A;  4RB1 A;  1U8R A;  4UVB A;  1LB2 A;  3ISP A;  2RQP A;  3P9I A;  1IRG A;  1ZRD A;  3HSR A;  4EMS A;  2EFQ A;  3EYY A;  2PEX A;  1D5V A;  1UB9 A;  5FGM A;  1LEA A;  3FX3 A;  3KP3 A;  3ERE D;  1TNT A;  1OYI A;  1YLF A;  3H92 A;  5LHI A;  2UWM A;  1QPM A;  1XGS A;  2UXX A;  4KT5 C;  3HRM A;  4BHB A;  3CUQ B;  2A3S A;  1FOK A;  1J9I A;  2FNP A;  1ZYR F;  1KYZ A;  2XVC A;  1P2F A;  2UZK A;  3FXR A;  2ZNY A;  4G7Z F;  4HV6 A;  2JPB A;  4GYG A;  1SD4 A;  2P5K A;  2RNJ A;  3I58 A;  1ONV A;  4IJA A;  1P4A A;  2E7X A;  4S05 A;  4LK0 F;  2D2W A;  2A6E F;  2GXB A;  4WXD A;  1QNT A;  1BI2 A;  3JAM Z;  3VOD A;  3V8L A;  3GFM A;  1RI7 A;  3LWF A;  1ON2 A;  2CGP A;  1IRF A;  2EFN A;  5D4S A;  2CSO A;  3U9G A;  3M1E A;  2OBP A;  3RKX A;  3GLX A;  2QQB A;  5H6R A;  5JHU A;  2PBI A;  1G3T A;  3KCC A;  1DDN A;  2IA0 A;  4U0W A;  2RKH A;  1YG2 A;  3O2P E;  2DFI A;  1B59 A;  5LBQ A;  2DW4 A;  4HF2 A;  3PQJ A;  1ON1 A;  5J8F A;  3NQO A;  1LDJ A;  2ZO4 A;  2P4W A;  3GUD A;  3IHU A;  2JZY A;  2E1N A;  1TQI A;  2FF4 A;  2V6C A;  2YX7 A;  2COM A;  2GZW A;  3ZN0 A;  2EWN A;  1J75 A;  5D6F A;  4LG0 A;  4EVI A;  4ENM A;  3QU6 A;  5H6Q A;  2CG4 A;  3WE3 A;  1G6N A;  2JPC A;  2C6Y A;  1HKT A;  2QZ8 A;  2TDX A;  1CF7 A;  5CVR A;  4BHP A;  5D8K B;  2BBY A;  3RI4 A;  3LQR A;  1A04 A;  4OMZ A;  3WTY C;  5BMZ A;  2EFW A;  1LDD A;  4M71 A;  2IT0 A;  2LF8 A;  5TRD A;  3N4M A;  2DLL A;  4RGS A;  1LVA A;  1G3Y A;  4L9N A;  3M8E A;  3CDH A;  2WC2 A;  2GWR A;  2HS5 A;  3P9C A;  4G8X A;  1VTN C;  1ZGJ A;  4AVP A;  4E70 A;  1BIA A;  1B4A A;  4A0Y A;  2FA5 A;  2FU4 A;  1YFH A;  3FXU A;  4AIK A;  3S2W A;  5ILS A;  2AS5 F;  2A6H F;  4YFK F;  3BZ6 A;  2D1H A;  2HZT A;  1ZLJ A;  4CYD A;  1KGS A;  2MC3 A;  4KIG A;  2PFB A;  1B1B A;  4HA8 A;  4LLG F;  2Z9O A;  2O61 A;  5CYV A;  1W7P B;  2NRA C;  3TGN A;  3BPX A;  2F5C A;  2ZME A;  3V8K A;  6PAX A;  4BHC A;  1JE8 A;  4KA4 A;  1CGP A;  3JSO A;  1S29 A;  4IRI A;  1GXQ A;  1TBX A;  2GAU A;  3R4K A;  4KN7 X;  3GWZ A;  1RUO A;  3CUO A;  3MEX A;  4DNC A;  2YX4 A;  1R1U A;  4HOB A;  2MLK A;  2VOD A;  1XSD A;  2XUB A;  3C18 A;  2F5D A;  2Y48 A;  2RGV A;  3BWG A;  3WU0 A;  2O3F A;  3WG9 A;  1XGO A;  4CXF A;  1G3S A;  2RVC A;  3RPQ A;  1K7A A;  3KZZ A;  1FZP B;  2Z5U A;  3KP7 A;  5DUK A;  1EV7 A;  2R7D A;  4U88 A;  3HSF A;  4YFN F;  3E6B A;  1R7J A;  3C3W A;  1MZB A;  5LGN A;  5LGU A;  1NHA A;  2XAG A;  1G3W A;  4G9Y A;  2KIF A;  1ZHF A;  1ODD A;  4BAY A;  2UXN A;  4RS8 A;  2FNA A;  4IRG A;  1R23 A;  1G4D A;  4OIO F;  3IKV A;  2QYO A;  2VBZ A;  2QWW A;  3L00 A;  4P55 A;  3FMR A;  5KK1 A;  2K4B A;  1PDN C;  4TV7 A;  3WTS C;  5L3C A;  3EDP A;  1ZGA A;  4MGR A;  2M87 A;  2LSO A;  2DT5 A;  3FXQ A;  2XIG A;  3ULQ B;  3MQ0 A;  1PP8 F;  2RC4 A;  4HV5 A;  2VT2 A;  3E6C C;  4UHT A;  1T38 A;  1LEB A;  1YW8 A;  4IHS A;  2AXL A;  3DF8 A;  3I54 A;  5AIQ A;  4A5M A;  4Q5S F;  1Q1H A;  2HYG D;  3IC7 A;  3M8F A;  3NRV A;  2W25 A;  2Y75 A;  3DV8 A;  2IA1 A;  2ZCW A;  1WSU A;  5HDN A;  4ENN A;  5BQT A;  3JTG A;  2YSR A;  5FO5 A;  1FYM A;  4S04 A;  1O7L A;  2GIV A;  2R7F A;  3KP2 A;  5LRS A;  3TO6 A;  3F3X A;  1V4R A;  2Y0M A;  2J5P A;  5K5Q A;  2VBW A;  4EJV A;  3J80 K;  3B73 A;  2OZU A;  2CWE A;  4G7H F;  4MNU A;  3EUH A;  1IN7 A;  1SMT A;  3ECH A;  1QZY A;  1IW7 F;  2M30 A;  3T5X A;  3EYI A;  2VON A;  2IVM A;  4XSX F;  3V7S A;  3Q9S A;  5DEQ A;  4KFC A;  2FSW A;  5EEH A;  3FM5 A;  1T39 A;  1UHM A;  5AIP A;  1OYW A;  1L0O C;  5HOO A;  2RV8 A;  2DQR A;  1IXR C;  1H9G A;  1QZZ A;  3QU3 A;  1U5T A;  2VOP A;  2H6C A;  2Q8K A;  2EK5 A;  5ICG A;  3GW2 A;  1FY7 A;  1WRJ A;  4Y13 A;  4MTE A;  3U2R A;  4B8X A;  2ETH A;  3TKY A;  5DDG A;  4AIH A;  2HFH A;  3L09 A;  2A07 F;  2A5Y B;  3W6K B;  1BI1 A;  3LAP A;  4HF0 A;  4KIC A;  4PCQ A;  3BY6 A;  3WU1 B;  4RB0 A;  4R79 A;  1L3L A;  3FWE A;  4I09 A;  4RGU A;  1KQ9 A;  4NHJ A;  3DQV C;  1SD7 A;  3F22 A;  4MHG A;  2CFX A;  4XLP F;  1HXD A;  1HKQ A;  4IXA A;  5K1Y A;  1JXS A;  4OIP F;  4XLN F;  3FF5 A;  1D8K A;  2WTE A;  2OU2 A;  4M73 A;  2KIM A;  1F4K A;  1Z91 A;  4G6Q A;  4HLX A;  2DAO A;  1WKM A;  1U6G A;  3LFK A;  3CO6 C;  4ZH4 F;  3RIR A;  3DFG A;  3L2C A;  4OIN F;  5D5W B;  1U78 A;  1T6S A;  4Q4Z F;  5BS6 A;  4UUV A;  1V3F A;  3GVA A;  1YS7 A;  1RNL A;  2E1C A;  4L0Z B;  2XV4 S;  3J80 Z;  1S6L A;  4ENJ A;  3ZQ7 A;  3R6S A;  5F6F A;  1T0F A;  1I27 A;  4ZYH A;  4BXU A; 
#chains in the Genus database with same CATH topology
 5K7F A;  4C2T A;  1FMV A;  1HF0 A;  2EV6 A;  2PQ8 A;  1A35 A;  1Z05 A;  2DMN A;  2LY9 A;  3CF5 F;  3IWZ A;  4LGW A;  2X1C A;  1UZC A;  4JX4 A;  4CZC A;  3J7A O;  1XMX A;  5KCM A;  3IAS 2;  1FYL A;  1OCO H;  3E5U A;  3I9V 2;  3VDX A;  1U9N A;  3F72 A;  5FD5 A;  2JUG A;  2NS8 A;  1B9M A;  1ZR4 A;  5FRO A;  3HOW J;  4DIQ A;  2HKX A;  2DTR A;  5HS8 A;  4XKC A;  2R7O A;  1AOY A;  2V1N A;  1B8I B;  4QPO A;  4F52 A;  3LQQ A;  4XBF A;  1SAX A;  3ZP5 A;  4XRF A;  3LNQ A;  1DP3 A;  3F8C A;  1VQM I;  1GHC A;  1ZEL A;  2HXI A;  2WV1 A;  2L9V A;  4CCJ A;  4OU0 A;  4G6T B;  2Y0S A;  1NK3 P;  4H0E A;  4AWX B;  2YU9 J;  4XLE A;  5E1X A;  3H36 A;  2VJ5 A;  3HM5 A;  1E3H A;  1LFU P;  3MZY A;  4M6X A;  2HOE A;  3W6J B;  5EG0 B;  2E34 A;  3EQL F;  2RAE A;  3F6O A;  2VPL A;  2E1M B;  5D5X B;  1EH8 A;  2L9R A;  2Y69 H;  4M3D A;  4U0Y A;  2GA1 A;  1W4M A;  5E3M A;  3ZMD A;  1I1G A;  2ZJ2 A;  3Q9V A;  3CUQ C;  3EPZ A;  5FFX A;  3J7Y J;  2QBY B;  4EJO A;  1PUE E;  2CMP A;  2WWY A;  3P9K A;  3KEY A;  2BEO A;  3AAF A;  3OYI A;  4BBR J;  4I2O A;  1IN8 A;  2CO5 A;  5ICC A;  3TQN A;  3F8M A;  2EFO A;  1ZTR A;  4PDK A;  4JQF A;  3C2H A;  3A03 A;  5DD8 A;  2O6G E;  4L9T A;  2DN0 A;  4YEJ A;  3OYC A;  2P6T A;  4EGY A;  2E1M C;  3KLO A;  2XF5 A;  4OIQ F;  2E60 A;  5IT3 A;  5L3G A;  1P92 A;  3K6G A;  3OMY A;  1AKH B;  2P7V B;  3ZR8 X;  2EH3 A;  3BLY A;  2EZH A;  2ZBK A;  3L2R A;  2HOA A;  1KZH A;  2XGX A;  2VOO A;  1ZRF A;  1KYW A;  2FRH A;  2ZKZ A;  3HG9 A;  1B6A A;  4M3F A;  1P9Q C;  3BTC A;  4LFU A;  3BP8 A;  4B3X A;  4UY8 I;  2V1U A;  4ETS A;  2X0L A;  3CUQ A;  3ELK A;  2XDV A;  3ZMU A;  2DOE A;  1YQA A;  3O8H A;  2KPM A;  2OPT A;  2OTL I;  4Y3O A;  1JUP A;  5KNL A;  1R1T A;  4W97 A;  2LYC A;  1IF1 A;  1O3T A;  4QLC U;  1T8I A;  4PZJ A;  1E2X A;  4Z2Y A;  3KPH A;  4HG2 A;  1P6R A;  2V1D A;  2ZSH B;  1DQU A;  1BN5 A;  1M1E B;  3I4P A;  3G1O A;  2BVL A;  3E5Q A;  1BR2 A;  5CQE A;  4P9U A;  4I01 A;  2E5N A;  3RJP A;  4O6J A;  4QPQ A;  2L7Z A;  5E20 A;  3LL7 A;  2FBK A;  1FOX A;  3GTO J;  1I6H J;  3CCM I;  1VQN I;  3KFW X;  3JSP A;  1EF4 A;  1EH6 A;  2LFB A;  3BJO A;  5DUI A;  4HAM A;  2FD5 A;  5E3N A;  3DP7 A;  2JK3 A;  2H1L A;  4ZJZ A;  3HHH A;  3ZCO A;  3ROU A;  2MLG A;  3BQZ A;  3KP6 A;  2K9L A;  3ABU A;  5M5Y J;  1JJ6 C;  1K79 A;  4X6A J;  3PO2 J;  3SFZ A;  3MKY B;  3L2U A;  3BR1 A;  3PQK A;  3GFL A;  1APL C;  1ZRC A;  3FMQ A;  3K4L A;  3OYE A;  2HPM A;  2KMU A;  2EB7 A;  3H3U A;  4UVA A;  1WWX A;  3S93 A;  3JRH A;  5CVI A;  3IWF A;  2PMZ A;  1TW2 A;  4G94 A;  3GTG J;  4CA0 A;  2VXZ A;  5HS9 A;  2YUS A;  4KNY A;  5C3E J;  4YIF A;  4N9H A;  2XRO A;  3FHZ A;  3NWS A;  1QPI A;  1V5E A;  3M3Y J;  1XMK A;  2AQE A;  4ZC3 A;  3TBI A;  2JA5 J;  2R7R A;  2MG4 A;  2L01 A;  4RAY A;  4HNT A;  2A69 F;  4ZYE A;  2NOG A;  4XL9 A;  4W1U A;  2IRF G;  2MH9 A;  4HNV A;  4CYC B;  4B4C A;  5HDK A;  2QUF A;  1S9H A;  3PNT A;  1MKM A;  5A2Q K;  1KU9 A;  1OCP A;  2X6O A;  4PFO A;  3S3M A;  1G8X A;  5J3L A;  4D1Q A;  3BJ6 A;  1XSX A;  2KQR A;  5L3D A;  1FIP A;  2JSP A;  4A69 C;  1O57 A;  1D1C A;  1TT5 B;  2CS3 A;  3R0A A;  1TP4 A;  4BJ5 C;  2DK5 A;  2CQX A;  3QPL A;  4LD5 A;  2L7M P;  2KP6 A;  5EEA A;  1BM9 A;  2VE9 A;  3FDY A;  4A3D J;  3TP3 A;  3R61 A;  1IG7 A;  3TED A;  3TW6 A;  1ZG1 A;  4QWQ A;  3M7G A;  3HJE A;  3DKY A;  3G2B A;  2V1X A;  2VN2 A;  3PSF A;  2F4O B;  3ZQF A;  3HRT A;  1EJ9 A;  1HDP A;  3L7W A;  5JLX A;  2NVX J;  1F9N A;  2BZT A;  2MC4 A;  1SFE A;  3T1B A;  4BJT A;  5J6X A;  5EYR A;  4XLH A;  1Q1V A;  1VF9 A;  2DU9 A;  5HS7 A;  1DPR A;  1MH3 A;  1UMQ A;  4HBL A;  4FE4 A;  1FBS A;  1BC8 C;  1DUX C;  3I0T A;  2E19 A;  3T8R A;  3PO3 J;  1LVK A;  5HLH A;  2O8K A;  2E35 A;  1IN5 A;  5IOZ A;  2W7N A;  4XIC A;  2FE3 A;  3ABT A;  3MMY B;  4FX4 A;  1ZLK A;  1BI0 A;  4GGG A;  2H1K A;  5GAE J;  3SXY A;  4DYR A;  4CCK A;  1QRY A;  5F0C A;  2CQK A;  3SZG A;  4HDU A;  2QA4 I;  1OLT A;  1IZ1 A;  1H9T A;  1ZN2 A;  1P4W A;  2ELJ A;  3K2Z A;  3WGG A;  4PSW A;  4M3G A;  1R36 A;  1I39 A;  3I59 B;  3KEQ A;  3IH2 A;  3RTR A;  4EGZ A;  4PJM A;  1Y1V J;  4XN3 A;  4DW6 A;  5E8I A;  2CW7 A;  2TCT A;  4NC8 A;  2HEO A;  2ZB9 A;  4M9X A;  2BVM A;  2L4A A;  2MFZ A;  2ZXJ A;  4ESF A;  3TOB A;  4IF4 A;  3DEE A;  2V9V A;  5DV5 A;  3M4O J;  1QU3 A;  5EDN A;  3MZH A;  1K78 B;  3FM3 A;  2P5L C;  2Z2S B;  3CCE I;  4GRI A;  4V2F A;  4WWC A;  2XKP A;  4LOC A;  1REP C;  1O4X A;  4ZDO A;  2IS1 A;  1Y8Q B;  2IGO A;  1U3E M;  1HOM A;  1D0X A;  4RB2 C;  5E1W A;  4BEH B;  4C3J J;  2OA4 A;  2B9S A;  3LSR A;  1T2K A;  3GFJ A;  3OYJ A;  4RGR A;  5JFR A;  2LR8 A;  4A3F J;  3OS0 A;  1IUF A;  1W7P A;  2HDW A;  3OYF A;  1FNN A;  2KL4 A;  1QGP A;  2LVS A;  3FK6 A;  3WTZ A;  2GOX B;  4XOR A;  2HDD A;  1IN4 A;  4P5O A;  1ZRE A;  1I3Q J;  1BOB A;  2VKH A;  5FLX K;  1USS A;  1YW7 A;  2PJR A;  3IAM 2;  4KMU X;  1Y39 A;  5E8G A;  4ZZD A;  3VB2 A;  4AYB N;  2RN7 A;  2V4J C;  2W57 A;  2M0M A;  3KP4 A;  4NDL A;  2PN6 A;  5DCF A;  1TQM A;  2XHK A;  4AID A;  1ZH5 A;  3QYB A;  4LJZ F;  3CJN A;  4II2 A;  1MJB A;  2XAQ A;  4OIR F;  5DD4 A;  1V5G A;  3DLA A;  1MH4 A;  4PGH A;  3BTJ A;  4CCL A;  1Z6T A;  4YIR X;  1XTA A;  2MW8 A;  1UG2 A;  3DTI A;  3Q0V A;  1X3U A;  3GZ5 A;  2CQQ A;  2WV0 A;  1Z3X A;  3BPV A;  1XDS A;  2XAJ A;  3BT9 A;  4UUT A;  1J7K A;  5HOD A;  3P7N A;  2QCO A;  4IRH A;  3ZMS A;  1YI2 I;  3H5R A;  2GBY A;  4RLF A;  2WB1 N;  5A2Q Z;  1MDM A;  3F9K A;  4X0G A;  3H5N A;  4QIW N;  3NAU A;  3F0C A;  3EET A;  2VQH A;  4FT8 A;  2CRG A;  2HKO A;  3H3Z A;  2XKO A;  4NNJ A;  2Y0S N;  4A6E A;  1FYK A;  1UHW A;  2DYR H;  4E7H A;  3GEZ A;  2VT3 A;  2QSG X;  2LKS A;  2Q0O A;  2DO7 A;  1TWG J;  3LOC A;  4Q48 A;  1WJF A;  2LMD A;  5DTD A;  2FUG 2;  4HW0 A;  1P4X A;  2LF7 A;  3JRB A;  3H0D A;  3CP2 A;  4EQQ A;  1PUF B;  1LQ1 A;  1E0E A;  2IP2 A;  2WAQ N;  5E17 F;  3U1D A;  1HSJ A;  1J5Y A;  1XG1 A;  1BR4 A;  3M1C A;  3OSF A;  2NAZ A;  3GFI A;  3HL2 A;  1OCZ H;  4GO1 A;  5CVJ A;  5E3O A;  5M5W J;  1S3J A;  2XAU A;  4PJ0 C;  4ZYD A;  2Y2Z A;  4JK1 X;  4YII A;  5EZG A;  4A93 J;  3LSM A;  4M74 A;  1F43 A;  3E5X A;  4JBA A;  2HWV A;  1JHH A;  3A01 A;  5J1Y A;  4MQV A;  2K86 A;  2IA2 A;  1HQC A;  1VQ8 I;  3I4N J;  5DCM A;  4EM2 A;  4PSX A;  4E4H A;  4XR6 A;  5F0F A;  1YJN I;  2DTZ A;  2J5O A;  1MSE C;  2A61 A;  3WGI A;  5M3M J;  4L0Y B;  1R4M B;  5FLV A;  3QRF F;  5LGT A;  3ABL H;  1UST A;  1A5J A;  1UHS A;  2DMP A;  1QHH D;  1HC8 A;  3CJT B;  4A0X A;  3DCF A;  2M9H A;  4Y17 A;  1S8N A;  1U5T B;  2GM4 A;  1LKX A;  5HLI A;  5B66 C;  4ZDP A;  4RGX A;  3HDD A;  2EZL A;  2XC7 A;  1FP2 A;  2M7A A;  4BXX J;  4U7B A;  2K9M A;  3CCV I;  4JYK A;  2I5U A;  4I0B A;  5CVV A;  4FQG A;  2KRC A;  3DXJ F;  4EJU A;  2DA4 A;  2H27 A;  1YX3 A;  1PJR A;  2VI6 A;  1FWZ A;  1SMY F;  1QVT A;  3HUG A;  5E18 F;  5F1R A;  2OF7 A;  1IRX A;  3TDZ C;  1LE8 B;  1FSH A;  4IKF A;  4XKW A;  4G7O F;  3VFZ A;  1IGN A;  1V55 H;  1PP7 U;  2ESH A;  3HBL A;  2H94 A;  3DPL C;  4J19 A;  4IHX A;  2VPR A;  2LRD A;  4XSZ F;  4XLA A;  2JA6 J;  1LNW A;  4M6Y A;  4EM0 B;  3G4S I;  1X1C A;  5FLX Z;  2WA0 A;  3RSN A;  1FBQ A;  3EUA A;  3K0L A;  2KIQ A;  3E6M A;  2R7T A;  2VC0 A;  2QGU A;  1G2H A;  1CQT A;  3D5L A;  2ELK A;  4D5C A;  1ERD A;  2X48 A;  3A0H C;  2X1E A;  1LJ9 A;  3L2Q A;  5KAF C;  1BJA A;  2K02 A;  2CV1 A;  1WGX A;  2Q2E B;  4HZF A;  1MBF A;  1X3W B;  3F8N A;  1UFM A;  5CLS A;  3PNY A;  5L3B A;  1RES A;  3GBG A;  1OPC A;  3AL0 B;  2PMH A;  3OYG A;  1WCM J;  1X2M A;  5J4Y A;  3HOT A;  3WTU C;  2KJC A;  2D45 A;  1DPU A;  2ZFU A;  3C7J A;  4LIV A;  3FKI J;  3E1S A;  3OSG A;  4LB6 B;  4MTD A;  3QOP A;  4NB5 A;  4U7D A;  3WGH A;  3K70 D;  4FIS A;  1FTZ A;  3JW4 A;  1TWC J;  2OZ6 A;  3KZY A;  2OD5 A;  5C44 J;  3OIP A;  1QHG A;  2ZJR F;  5M3F J;  4OMY A;  4C9Y A;  4AIJ A;  2GXG A;  2PG4 A;  5CVU A;  3KYD B;  1XGN A;  4N0B A;  3MKW B;  2MBF A;  3GZ6 A;  2NVQ J;  1DU6 A;  3S1R J;  3PJR A;  1OYY A;  1BOA A;  4V2G A;  2M3A A;  1MD0 A;  3MAJ A;  1FX7 A;  2JT1 A;  1W7P D;  2BY3 A;  5FKN A;  1LDK B;  3JRC A;  1W0T A;  4L5I A;  1FP1 D;  4XOP A;  3F8F A;  1E17 A;  1YHQ I;  3DPT A;  5JLW A;  2V7F A;  1YJW I;  1I5Z A;  4F91 B;  1XMA A;  1N25 A;  3JTH A;  2AHQ A;  3D0S A;  2ECB A;  2LOO A;  2NS0 A;  3E0J B;  4ON0 A;  5F0H A;  4BQQ A;  1ZAR A;  3B02 A;  1VQL I;  5GAD J;  3RDI A;  2ZJQ F;  2BW3 A;  3V7R A;  4KIT B;  1UCR A;  3K1P A;  1FEX A;  4QTR A;  4PGG A;  4BJ6 C;  4WK8 F;  2EZK A;  2K27 A;  2X4H A;  3BTI A;  1OCC H;  2P6S A;  2VQC A;  3D5S C;  4RMN A;  2K85 A;  3IP4 B;  2YU3 A;  3IL2 A;  1C0W A;  3ZN1 A;  2BHY A;  3BG6 A;  2LP0 A;  3O3K A;  2OQR A;  3HZJ A;  4MFD A;  3KP5 A;  3CMM A;  4XRS A;  3K1M A;  2I10 A;  5LEJ A;  2B0L A;  4HSR A;  5IYB J;  1TQP A;  4ESJ A;  2E7W A;  1SD5 A;  1DU0 A;  2MD5 A;  2M8E A;  2L02 A;  5ED4 A;  1R9T J;  2DBB A;  2L7F P;  2HU9 A;  2DT6 A;  4OWR B;  5E3L A;  4KYW A;  2ELH A;  4GCV A;  3H1C A;  3OV8 A;  2DA3 A;  1HKS A;  2VC1 A;  3ZQQ A;  3L9F A;  4X1E A;  1IAW A;  3ZPL A;  1ORK A;  3HRU A;  2L2O A;  3ZQG A;  3GO5 A;  4KN4 X;  3MCZ A;  3KET A;  1YJ9 I;  5F27 A;  4AYB A;  4PJN A;  2Y9Z A;  4EV0 A;  3A0B C;  3S1Q J;  9ANT A;  3L1P A;  2L4M A;  4ABZ A;  5FRN A;  5D5V B;  3DKW A;  1RC9 A;  3WTV C;  2R7U A;  3IRR A;  1S5L C;  1ZGW A;  2D1V A;  4A12 A;  2MSY A;  1LFP A;  2BY1 A;  1KON A;  1Z1D A;  3G1M A;  5LLQ A;  3QAH A;  3ZMV A;  2B7E A;  3GCM A;  4KMF A;  2K4J A;  2M4G A;  2HPI A;  3QQA A;  1FMW A;  3DPU A;  3RPU A;  2DA1 A;  3UNG C;  4NQW A;  2EPF A;  3HTS B;  2HOS A;  2UV1 A;  2EFP A;  1XCV A;  1J59 A;  2HZD A;  2WB1 A;  3QPH A;  3LMM A;  2IPQ X;  2DOF A;  2EIK H;  2KIU A;  3E7L A;  4PK4 A;  5GTH C;  3C2G A;  3CC2 I;  4I98 B;  4NBQ A;  1HW1 A;  3TO9 A;  4GDF A;  5BOX A;  2HGC A;  5JI6 A;  3OS2 A;  4XK4 A;  1WI9 A;  5H20 A;  4MO7 A;  2LD5 A;  1BJZ A;  3IRQ A;  3BR2 A;  2D5V A;  1VND A;  3CJQ B;  1X58 A;  5J4V A;  2NNY A;  1YTY A;  2XB5 A;  3HSE A;  4A3G J;  1J0R A;  1FT9 A;  1MBG A;  5EGO B;  1YS6 A;  2M5W A;  4RAZ A;  3V8J A;  4Z6Y A;  2WAQ A;  2FBI A;  3LA3 A;  4UV9 A;  2FJ1 A;  4IOC F;  1R49 A;  4ASN A;  2LNB A;  2QEN A;  1XX5 A;  3F21 A;  1STZ A;  3WHC A;  3SHF A;  1KU3 A;  1YOV B;  5EEG A;  2DA5 A;  1Z3Y A;  1I6X A;  4I99 C;  2A68 F;  4XMY A;  4S0H B;  4E7J A;  2NOJ B;  2VB6 A;  3NAR A;  2DQL A;  2F6C A;  2VKD A;  5TIS C;  4UXN A;  3SZP A;  2DOD A;  2R3S A;  3J81 K;  3S32 A;  3DEU A;  2OAZ A;  4HLY A;  1K4T A;  2H8W A;  4Q47 A;  5D5U B;  4R8H A;  2DFH A;  4F93 B;  1O3R A;  2STW A;  4I0A A;  1OIS A;  2DI3 A;  4HYE A;  2QQ9 A;  3GXO A;  2XB0 X;  1FLI A;  2QM3 A;  3K9T A;  5CJ9 A;  2IAI A;  1TNS A;  3ML6 A;  1B8I A;  4LG0 B;  2DOA A;  1XSV A;  1BI3 A;  3OOP A;  4LMY A;  2DPD A;  1N78 A;  1WVR A;  4II3 A;  4IHW A;  1Z67 A;  2H09 A;  2G7H A;  1D1B A;  3E97 A;  1CF7 B;  2P7C B;  1NH3 A;  1ZK8 A;  2XGC A;  2LKP A;  3GTL J;  4B47 A;  1IV6 A;  3HOX J;  2YR2 A;  3E3V A;  1R1V A;  2QLZ A;  3MKZ A;  2FML A;  3HXL A;  5D6E A;  4MIM A;  3WHB A;  5EG0 A;  1K6Y A;  2FQ3 A;  3OIQ A;  5TJJ A;  4DOZ A;  5FD6 A;  5EZH A;  1GVJ A;  1QQI A;  3JRD A;  2E1O A;  2FBH A;  1BW5 A;  2EA4 A;  2XAS A;  2HOT A;  2L3D A;  1SVL A;  4KDP A;  2QBY A;  2ESN A;  2NVT J;  4EJT A;  1FC3 A;  3F8B A;  5HNH A;  1UEL B;  2DJN A;  1IXS B;  3K7A J;  1ZG5 A;  4IVN A;  2XPW A;  4QSH A;  2G7U A;  4UNO A;  1A31 A;  4XNF A;  4CCO A;  2Z99 A;  5HVQ C;  1RZ4 A;  3HKZ N;  4YG2 F;  2IXS A;  1U9O A;  4DBQ A;  1SFX A;  2ISZ A;  1YX5 A;  4HDV A;  1MJ9 A;  2VJ4 A;  5GPC A;  2WY8 Q;  4BDZ A;  3NEU A;  2R7V A;  1PYV A;  2BE5 F;  2DFE A;  1UAA A;  3I4M J;  1AKH A;  4LG3 A;  2HQR A;  5ILU A;  2KRF A;  5DM6 F;  3KZI C;  2Z33 A;  4ESB A;  2DA2 A;  5FB2 A;  1XB4 A;  4A5N A;  1A6I A;  2P8T A;  5DYM A;  4FCY A;  3Q0W A;  5L3F A;  4M3E A;  3VSL A;  1RRJ A;  1IJW C;  1G59 A;  2XRL A;  3LSH A;  2LLK A;  1WPK A;  1MNE A;  3T0Y A;  3G3Z A;  3ASO H;  1I50 J;  2O9L A;  1H0M A;  1Z21 A;  2W24 A;  4HX7 A;  3SDG A;  1HBX G;  2JVH A;  3ABK H;  1LPQ A;  3HHG A;  4ZTF A;  1TC3 C;  4IQ4 A;  5FLM J;  1TWH J;  1D3Y A;  3BG7 A;  2LKX A;  3BOQ A;  2O03 A;  2ZME B;  1HW5 A;  2L5Q A;  1ZAO A;  3CF2 A;  3FBI B;  2F5E A;  2W85 A;  4AUX A;  3GTK J;  1HDD C;  4ENK A;  4A3C J;  4ZTJ A;  4CIC A;  4CSW A;  1BBY A;  1ETQ A;  1N77 A;  3HYI A;  1AU7 A;  2R7Z J;  4HX8 A;  2CUF A;  5ILV A;  2LY1 A;  4U0V A;  3KYL A;  2W84 A;  3FXK A;  3K4M A;  4DYQ A;  3VEP A;  2E2J J;  4C2U A;  4K2E A;  5M5X J;  1Y56 A;  3S17 J;  5E1Z B;  3D1N I;  5LRR A;  3CCL I;  1HST A;  2EA2 A;  1GT0 C;  1HW2 A;  1YO5 C;  4O3M A;  1FBU A;  1KU2 A;  2ADU A;  1K6O A;  1Z7L A;  4F3Q A;  4N4N B;  3WTW C;  3DWL E;  4M6V A;  2QVO A;  3AG1 H;  5DM7 F;  3FIW A;  3K69 A;  3J81 Z;  4LLN A;  2HI3 A;  4J01 A;  2L9S A;  2IS4 A;  2O8X A;  3LA2 A;  2VBX A;  2P5V A;  4P9F A;  5LEK A;  2X51 A;  1XN7 A;  4C3H J;  1JGS A;  3C1D A;  2ICW G;  1JHF A;  2LTP A;  3MWM A;  3SFI A;  4J00 A;  4AU7 A;  5IT9 K;  2R4G A;  5K5R A;  2LBF B;  1OKR A;  2K5C A;  3DBL B;  5D4R A;  3CCR I;  4A3K J;  2ACJ A;  2OCC H;  5F64 A;  3COA C;  3SYT A;  4I02 A;  4B43 A;  2KKO A;  4HX4 A;  3CDL A;  1X2N A;  2PX9 A;  1DP7 P;  2NVY J;  5ICE A;  2A6T A;  3HOS A;  1GV2 A;  4IHY A;  3PSI A;  2GA2 A;  2DPU A;  2FOK A;  3CD6 I;  4FHT A;  2L9N A;  2H6B A;  4MEX F;  4E7L A;  2VQL A;  3ZMT A;  2JTV A;  3LSP A;  2FMY A;  4BDY A;  4FTH A;  1EA3 A;  5LHG A;  3IKT A;  5B1A H;  4KIB A;  5BPD A;  3IH4 A;  3KLN A;  5GAH J;  5KAI C;  4CYC A;  1R5G A;  3CLO A;  2DYS H;  1SVO A;  2QKL B;  2VQG A;  2RRE A;  1WJ5 A;  2VJJ A;  2BOL A;  3HOZ J;  4P96 A;  3I5U A;  1SEU A;  4A0Z A;  4IHT A;  1RKW A;  2YPR A;  3LST A;  1IXC A;  1U2W A;  4I6Z A;  4WXC A;  5FFZ A;  1KQ8 A;  3I53 A;  2OV7 A;  3K1N A;  2PI0 A;  3E6D A;  1Z0X A;  2Y9Y A;  3F6V A;  3QPT A;  1MGT A;  3ECO A;  1S7A A;  1F36 A;  3FK7 A;  3V4G A;  1YRN B;  1U8B A;  1O7F A;  5BNG A;  1Z6R A;  4E6K G;  2HQN A;  2ZNZ A;  1XDU A;  2DMT A;  2LRE A;  3RKY A;  1B9N A;  4HQE A;  4RAG A;  3BR5 A;  2H8R A;  4RB3 C;  1MDM B;  4ITV A;  4MEY F;  4BS9 A;  4CUG A;  1X1P A;  4KIF A;  1Y0U A;  2M4K A;  1D8J A;  1AA7 A;  1I3A A;  4D7N A;  4WXH A;  2BGC A;  4D0P A;  3R60 A;  5J40 A;  3CQZ J;  2QSF X;  2DCE A;  4UUS B;  4CCM A;  2JA7 J;  3BJA A;  1JT6 A;  4I76 A;  1Z7U A;  4BNC A;  2GQQ A;  2FXA A;  3SJM A;  1DGW Y;  3RYR A;  2R93 J;  2HYF A;  2HTS A;  2HXO A;  2K40 A;  1R22 A;  3GF2 A;  4LK1 F;  1HCR A;  3KEO A;  2KJB A;  5ICF A;  3ZRG A;  2XGD A;  2HVR A;  4L5J A;  5B5E C;  1ENH A;  3H5A A;  4Y15 A;  4IPA A;  5JVT A;  3MFK A;  3C2B A;  1MNM C;  2L54 A;  3ZGK A;  3T8T A;  2I8D A;  3BZK A;  4CZZ A;  2W1O A;  4AC0 A;  2LDU A;  4FX0 A;  4UV8 A;  2QQA A;  2XGE A;  3FXL A;  1MSF C;  1T98 A;  3DEW A;  4EEF G;  2JRT A;  2EV0 A;  1ZG3 A;  4CDG A;  4BQA A;  2A5W A;  1BW6 A;  4HNU A;  1OR7 C;  3I59 A;  5HLG A;  5DCM B;  2IW5 A;  3WTX C;  3QYF A;  3GX4 X;  4L18 B;  2OUM A;  4MQ9 F;  3CCS I;  4P1W A;  4BL0 B;  2BYV E;  4B44 A;  2R92 J;  1MBJ A;  1IUY A;  5DS9 A;  5L3E A;  3REO A;  2BXY A;  1SFK A;  1MJA A;  1FSE A;  3OY9 A;  1K78 A;  3BRO A;  4BY1 J;  3BDD A;  4O5V A;  3HGY A;  2K3F A;  4BE1 A;  1ZKG A;  1S7O A;  3M9A A;  1XS9 A;  3H3V K;  3IV5 A;  4BEH A;  4UB6 C;  4DQ2 A;  3BR3 A;  4WCG A;  4A2U A;  3TL4 X;  4AD9 A;  1R71 A;  1E3P A;  2KT0 A;  2XAH A;  1YW9 A;  2JVG A;  3OYD A;  2ZXH A;  4IL6 C;  1MMA A;  2ECC A;  4BQO A;  4XQF A;  4YEL A;  1OR7 A;  3R0J A;  2MH2 A;  3I71 A;  5IT9 Z;  3LAJ A;  1SD6 A;  1BC7 C;  1VQO I;  2DMU A;  2E36 A;  2DDA A;  5K5O A;  1GXP A;  2WBM A;  3RQ4 A;  2PJP A;  3V7C A;  4DYC A;  1MND A;  1AWC A;  3PFI A;  1X1B A;  3RCO A;  2Q1Z B;  2X6Y A;  1IC8 A;  1VI0 A;  4E7Z A;  3CMY A;  2BY0 A;  3N97 A;  2CV2 A;  1K83 J;  1KQ0 A;  3WE2 A;  4F7Z A;  3WTT C;  3KX2 A;  1KU7 A;  1I1S A;  1FPQ A;  2DA7 A;  3OIO A;  1WHU A;  3ESW B;  3HKZ A;  2EJR A;  1R5H A;  3CTA A;  5GAG J;  1QO0 D;  4GXO A;  2AXT C;  2UUZ A;  2ZJP F;  3NWT A;  4CH7 A;  3TW7 A;  1RIO H;  1TTY A;  2VXD A;  1DGR M;  3KIO A;  2STT A;  3UR3 C;  2CUZ A;  3BCB A;  2XAF A;  2M0C A;  2W4S A;  4BYY A;  4NC7 A;  5HDG A;  2CW0 F;  1JKP C;  2JJ7 A;  2R5Y B;  2V9K A;  3BC8 A;  1ETY A;  3K10 A;  4FE7 A;  3KYC B;  1O3S A;  1WZ2 A;  2XSD C;  2XF6 A;  2JUC A;  2ISY A;  2HQA A;  1JKR C;  4WF2 A;  1U5T C;  3AG2 H;  1PUF A;  3IUO A;  3FBN B;  3L2V A;  2OQG A;  2OTJ I;  3OYM A;  1WJD A;  2DK8 A;  2Z3Y A;  2F5V A;  3TP0 A;  1JTX A;  4BH9 A;  3G73 A;  3GTP J;  4LLL A;  2NYX A;  3RKW A;  5D8L B;  4L9J A;  1W5S A;  1OCT C;  1IDZ A;  1XD7 A;  2M45 A;  2IEK A;  4BGD A;  1TW3 A;  3U1K A;  4WX9 A;  5BPI A;  3PIO F;  1RPW A;  3A02 A;  3QP6 A;  3SZT A;  1R58 A;  4CGZ A;  4ZZL A;  1GLN A;  4A6D A;  4XKV A;  2CV0 A;  4DGW B;  2DMQ A;  5IP7 J;  4GYI A;  2HTJ A;  2X6X A;  2JSC A;  1QA6 A;  2PLY A;  5H2F C;  3BG5 A;  4B09 A;  1TL8 A;  3TDU C;  2KZG A;  2R5Z B;  3CC4 I;  4IHV A;  5FKL A;  5J1R A;  4XRS G;  4EJW A;  5K7Z A;  5J8C A;  2FEZ A;  1XCB A;  1SFU A;  2LG4 A;  3CCQ I;  5JR3 A;  2CYY A;  2G9W A;  3I64 A;  2NNN A;  3BCA A;  2EV5 A;  4M72 A;  3HIF A;  1B72 B;  1O3Q A;  4L9V A;  5AON A;  4CO8 A;  4C2M J;  1KA8 A;  3JRF A;  3TOA A;  1XPX A;  1OMI A;  3CZ6 A;  3OYK A;  3CCJ I;  2V79 A;  5KVR A;  4UVC A;  1Z9C A;  2ZFW A;  4EM1 A;  2O0Y A;  3AL0 C;  1ULY A;  4F55 A;  2XRN A;  4HQM A;  1EH7 A;  3G6E I;  2M1B A;  1LE8 A;  2TRT A;  3PFY A;  1RUN A;  5B3S H;  2RDP A;  3BG3 A;  2FOW A;  2JRM A;  2AO9 A;  3HRS A;  3MD2 A;  4V19 K;  1YYV A;  4YFX F;  3K4K A;  3CC7 I;  3ZQC A;  4UB8 C;  2FX0 A;  4M9S A;  1RET A;  1R00 A;  2HR3 A;  3LA7 A;  3QP5 A;  3AKZ A;  1F1Z A;  3FZV A;  1F5T A;  3HTU A;  3VYS B;  1J2X A;  3JAM K;  3CO7 C;  1NG7 A;  4XID A;  3CME I;  4E7I A;  4KUM A;  3DTK A;  3MKL A;  4ZYG A;  2VBY A;  4BAC A;  2MA3 A;  2BV6 A;  3FMS A;  3OR2 C;  3GYH X;  2PMU A;  1ETW A;  1VQK I;  1YIO A;  2Q2E A;  5ERI A;  4I7H A;  3ZMZ A;  2IJL A;  5LHH A;  2HDC A;  2ZXI A;  1TT0 A;  3CJR B;  3KE2 A;  1XGM A;  1BR1 A;  1QZE A;  2ID6 A;  4R1H A;  4M9Z A;  2VE8 A;  3S1N J;  2JN6 A;  4N9I A;  3SQN A;  3RYP A;  1WQ2 A;  3TO7 A;  3RQI A;  1W1W E;  4U87 A;  1TLH B;  3Q5F A;  4OOI A;  3J7Z I;  2F5F A;  4LB5 A;  3WOD F;  1HA8 A;  3PIP F;  3ONQ A;  1YIT I;  2K7L A;  5CPR B;  4G12 A;  4XM3 A;  3DBR B;  1MBH A;  1W5T A;  3F23 A;  1QBJ A;  1YE9 A;  2F2E A;  5IYD J;  1BIB A;  1BA5 A;  3FXJ A;  3VOE A;  3PM1 A;  2HNH A;  5E79 C;  4Y52 J;  1IN6 A;  3OR1 C;  1XC5 A;  4G6D A;  3O6B B;  5F1J A;  4HF1 A;  2NS7 A;  1JI8 A;  4CHU A;  4RB1 A;  2VKV A;  1U8R A;  1S72 I;  3EUK L;  1TWF J;  4UVB A;  1PVE A;  1LB2 A;  1TWA J;  1D0Y A;  3ISP A;  2RQP A;  2QSH X;  3P9I A;  2Z16 A;  3VYR B;  2QKM B;  1IRG A;  3LSI A;  2VAS A;  1ZRD A;  2JA8 J;  2K9N A;  4N4O B;  3HSR A;  4EMS A;  2EFQ A;  3EYY A;  2PEX A;  3VYU B;  1D5V A;  1EKE A;  1UB9 A;  5FGM A;  1ETO A;  1LEA A;  2KFD A;  3W3C A;  2IS6 A;  3FX3 A;  3KP3 A;  3ERE D;  1TNT A;  1ETX A;  1OYI A;  4PJL A;  3D5R C;  2MD0 A;  4GFB A;  1YLF A;  3H92 A;  5LHI A;  4KIS A;  2UWM A;  1QPM A;  1XGS A;  2UXX A;  2M2E A;  4KT5 C;  3HRM A;  2CUJ A;  4BHB A;  3GTJ J;  3CUQ B;  4FAS D;  3K2A A;  2A3S A;  3LSG A;  1FOK A;  1J9I A;  2FNP A;  1ZYR F;  2G0E A;  5J47 A;  4RBO A;  4OAZ A;  4AM3 A;  3MVP A;  1VZ0 A;  3CP8 A;  2CW8 A;  3LFU A;  1KYZ A;  3QOE A;  3S16 J;  2XVC A;  2KIS A;  1P2F A;  2UZK A;  3CES A;  3ZQH A;  1WH7 A;  3HOV J;  3QYE A;  4B3A A;  3FXR A;  2M7B A;  2ZNY A;  3S14 J;  5IY5 H;  4G7Z F;  4B1R A;  4HV6 A;  2JPB A;  4GYG A;  1SD4 A;  2P5K A;  3ASN H;  2RNJ A;  3I58 A;  5K7H A;  5JVG F;  5FJ8 J;  1ONV A;  1MBK A;  1P4A A;  2E7X A;  4IJA A;  4S05 A;  5F04 A;  4LK0 F;  1T95 A;  2D2W A;  2A6E F;  3S3O A;  2GXB A;  4WXD A;  4A3M J;  1QNT A;  5GTI C;  3W6V A;  1BI2 A;  1NTC A;  3JAM Z;  3QPS A;  4HST A;  3VOD A;  2B63 J;  2XPV A;  3V8L A;  2IBD A;  3GFM A;  1RI7 A;  3CDI A;  2DFF A;  3LWF A;  1ON2 A;  3OYB A;  2CGP A;  1IRF A;  2EFN A;  5D4S A;  2CJJ A;  2CSO A;  3K4C A;  3U9G A;  2IS2 A;  3M1E A;  4IZZ A;  2OBP A;  3RKX A;  3GLX A;  2QQB A;  5H6R A;  1SFO J;  2CUE A;  2ME6 A;  4A3L J;  2F48 A;  5JHU A;  1H8A C;  3W2A A;  2PBI A;  1G3T A;  3ERM A;  3KCC A;  4BUP A;  1H88 C;  3DU6 A;  1DDN A;  5EGO A;  2IA0 A;  1VQ4 I;  1WJC A;  5FKM A;  2EIL H;  4RLQ A;  4DZJ A;  4U0W A;  1ITY A;  2RKH A;  1YG2 A;  3HPH A;  4RM3 A;  1X19 A;  3O2P E;  5HNF A;  4LIU A;  2DFI A;  1B59 A;  5LBQ A;  1JKQ C;  1MMD A;  2DW4 A;  1JGG A;  3H35 A;  4HF2 A;  3PQJ A;  1OCR H;  1NK2 P;  4JX6 A;  3B6A A;  1ON1 A;  3H9J A;  5J8F A;  3NQO A;  3WU2 C;  4D9J A;  3I3L A;  3VPR A;  1LDJ A;  2ZO4 A;  3JRA A;  4A3J J;  2P4W A;  3GUD A;  3IHU A;  3P5J A;  2JZY A;  1YIJ I;  2E1N A;  3H9Q A;  2O7O A;  4LIT A;  1TQI A;  1E3O C;  2FF4 A;  2EIM H;  2KZV A;  2HVS A;  2V6C A;  2YX7 A;  5CKT A;  1WH5 A;  1SAN A;  2WAF A;  2ME0 A;  1RR7 A;  2COM A;  2GZW A;  3ZN0 A;  2EWN A;  1U0J A;  3AFH A;  1J75 A;  5D6F A;  4A3E J;  4LG0 A;  4EVI A;  4PUS A;  4ENM A;  3PL8 A;  1IO2 A;  1LUJ B;  1HLV A;  3QU6 A;  2CQN A;  3W2V A;  2E2I J;  2MGQ A;  5H6Q A;  2CG4 A;  3WE3 A;  1G6N A;  1MMN A;  2JPC A;  1JJ8 C;  1MBE A;  1V54 H;  2C6Y A;  3BZC A;  1HKT A;  2QZ8 A;  2TDX A;  1CF7 A;  1W36 C;  5CVR A;  4BHP A;  3ZOB A;  5D8K B;  2X85 A;  4HPQ A;  2BBY A;  4JX5 A;  3I56 I;  3LQR A;  3RI4 A;  1A04 A;  2R7S A;  4OMZ A;  3WTY C;  5BMZ A;  3PUB A;  2EFW A;  1LDD A;  4M71 A;  2IT0 A;  2LF8 A;  5TRD A;  3N4M A;  2DLL A;  4RGS A;  5TGT A;  1LVA A;  2WY7 Q;  1G3Y A;  2L7K A;  3OYN A;  4L9N A;  3M8E A;  2GOM A;  2BY2 A;  2XPU A;  1WFX A;  3CDH A;  3OL4 A;  1JKO C;  4M3B A;  1SC7 A;  3RZO J;  1UJ8 A;  3OYL A;  4F92 B;  1Z77 A;  2WC2 A;  2CU7 A;  5LFA A;  3RKQ A;  2GWR A;  2HS5 A;  2DT7 B;  3P9C A;  4G8X A;  1MIJ A;  2ZME C;  1VTN C;  5C4X J;  3AG4 H;  4HRI A;  1ZGJ A;  4AVP A;  4E70 A;  1BIA A;  5IYC J;  1B4A A;  4NUB A;  4A0Y A;  3ABM H;  2FA5 A;  2FU4 A;  2GLO A;  4AVZ A;  2Z1D A;  1YFH A;  5FRM A;  3FXU A;  5EJC A;  4B48 A;  1T33 A;  4MLO A;  1R6R A;  4RDU A;  4AIK A;  4D7M A;  3S2W A;  3VSK A;  3IH3 A;  5ILS A;  4RM2 A;  3RPU D;  2AS5 F;  2A6H F;  1VQP I;  2M34 A;  2JWT A;  1MW7 A;  4YFK F;  4XN0 A;  3BZ6 A;  2D1H A;  1LFB A;  2HZT A;  1ZLJ A;  2HYJ A;  4CYD A;  1V5F A;  1KGS A;  2MC3 A;  5IP9 J;  4KIG A;  1ACI A;  2PFB A;  1B1B A;  1IV8 A;  4HA8 A;  4LLG F;  3AG3 H;  5GP9 A;  3VYT B;  2Z9O A;  1OFC X;  2O61 A;  5CYV A;  4L5E A;  1W7P B;  5KHD A;  2NRA C;  2IGN A;  3TGN A;  3BPX A;  2F5C A;  2KLO A;  1BL0 A;  2ZME A;  3V8K A;  2E2H J;  2XF7 A;  3M8J A;  6PAX A;  4BHC A;  4C30 A;  3K70 C;  4KA4 A;  1JE8 A;  1CGP A;  2V9P A;  3TMO A;  3JSO A;  3HEF A;  3G71 I;  3G1L A;  1S29 A;  2PJR B;  4IRI A;  2P0W A;  3DLL F;  1K61 A;  4ZDL A;  1GXQ A;  2BXZ A;  2JQ7 A;  4JOM A;  1A36 A;  1TBX A;  3CMA I;  2GAU A;  3R4K A;  4KN7 X;  3GWZ A;  1RUO A;  3CUO A;  3MEX A;  4DNC A;  3FXM A;  3ZQI A;  2YX4 A;  1R1U A;  4HOB A;  2MLK A;  3A2K A;  4CCN A;  2VOD A;  3X2Q H;  2XUB A;  3C18 A;  2W00 A;  1XSD A;  2F5D A;  2Y48 A;  2RGV A;  3BWG A;  3OL3 A;  1R4N B;  3OS1 A;  2VLA A;  1VFC A;  3WU0 A;  2O3F A;  2ZXW H;  4XKB A;  3WG9 A;  1QVU A;  1XGO A;  3JRE A;  3FIS A;  3QOD A;  4CXF A;  1G3S A;  2RVC A;  2HVQ A;  3RPQ A;  2LH9 A;  4Y33 A;  1K7A A;  1P7I A;  2R7W A;  3KZZ A;  4RA2 A;  3A4C A;  2VL8 A;  1Y1W J;  2RQQ A;  1T08 B;  3FXO A;  1FZP B;  2Z5U A;  2LBF A;  3KP7 A;  4IEJ A;  2IGM A;  2KDZ A;  5DUK A;  1EV7 A;  2EBI A;  3K4B A;  2R7D A;  3SEZ A;  4Y4R A;  4U88 A;  1GV5 A;  3HSF A;  4IQJ A;  1SVM A;  4YFN F;  3Q0U A;  2RNG A;  3E6B A;  4IO9 F;  5J1U A;  1D0Z A;  1R7J A;  1X3Z B;  3C3W A;  1MZB A;  5LGN A;  1AHD P;  5LGU A;  3O8G A;  1R5I D;  3JRG A;  3OWT A;  3A01 B;  2NXN B;  3HPG A;  1NHA A;  2XAG A;  1S7E A;  1G3W A;  2EIN H;  2QQ8 A;  1K4S A;  2W48 A;  5IPA A;  1OJL A;  3BG9 A;  4G9Y A;  3OYA A;  5JHF A;  4BKX A;  2KIF A;  2VKE A;  1ZHF A;  1ODD A;  2O5R A;  3DBH B;  4BAY A;  2EQR A;  4A3B J;  2UXN A;  4RS8 A;  2FNA A;  4IRG A;  1R23 A;  1G4D A;  1W0U A;  4OIO F;  1ZR2 A;  1YRN A;  3IKV A;  2FQ4 A;  4A3I J;  2QYO A;  2VBZ A;  3LSJ A;  4BY7 J;  2QWW A;  3L00 A;  4P55 A;  2WAE A;  3FMR A;  5KK1 A;  2DDB A;  2K4B A;  3K4J A;  4KJZ A;  1PDN C;  4TV7 A;  1H89 C;  3WTS C;  1NG6 A;  5L3C A;  3EDP A;  1WI3 A;  1ZGA A;  4MGR A;  2M87 A;  3ZQL A;  3BQY A;  2LSO A;  2DT5 A;  3FXQ A;  2XIG A;  3ULQ B;  3MQ0 A;  1W5C C;  1PP8 F;  4ZYA A;  2RC4 A;  4HV5 A;  2VT2 A;  3N05 A;  4UUS A;  3E6C C;  4HEA 2;  4UHT A;  1T38 A;  1T56 A;  1VQ7 I;  3H0G J;  1D5Y A;  3HOY J;  1LEB A;  1YW8 A;  1ETV A;  4IHS A;  2AXL A;  3DF8 A;  2P81 A;  3HUG B;  2WAD A;  3GZN B;  2LK2 A;  3I54 A;  5AIQ A;  1POG A;  4A5M A;  4Q5S F;  2E71 A;  3OYH A;  1Q1H A;  3BR0 A;  1FIA A;  3U21 A;  2K9Q A;  1A6Q A;  2CFO A;  1GUU A;  2HYG D;  2X1D A;  4JP0 A;  3IC7 A;  1JUS A;  2L0K A;  3M8F A;  2CQ7 A;  3EUH C;  4IOA F;  3I55 I;  3NRV A;  2W25 A;  1VQ5 I;  3S3N A;  2VJI A;  2YS9 A;  3WG7 H;  2Y75 A;  3K4N A;  2VUM J;  3DV8 A;  2IA1 A;  2ZCW A;  3MZ8 A;  1IDY A;  5FKK A;  5HDN A;  4ENN A;  5HLT A;  5BQT A;  1WSU A;  3GTM J;  1FOY A;  3S1M J;  4C3I J;  3JTG A;  2YSR A;  3PUF A;  5FO5 A;  4E7K A;  4XOT A;  1FYM A;  4DJA A;  4S04 A;  4MFE A;  4OAY A;  4DBR A;  1O7L A;  2GIV A;  2R7F A;  3KP2 A;  5LRS A;  3TO6 A;  3VWB A;  3F3X A;  3H9G A;  3GTQ J;  1V4R A;  2Y0M A;  2J5P A;  5K5Q A;  3RZD J;  4NC6 A;  4ANJ A;  4KT6 A;  2VBW A;  4EJV A;  3J80 K;  2ZSI B;  1W36 D;  3B73 A;  2OZU A;  4BE0 A;  3S8P A;  3BTL A;  3CCY A;  4IX7 A;  3DU5 A;  2CWE A;  2HQ5 A;  2OJE D;  2R0Q C;  4G7H F;  3CLQ A;  1MMG A;  4MNU A;  3UKG A;  3EUH A;  2IGK A;  1IN7 A;  1SMT A;  1FOW A;  3ECH A;  4PFP A;  1QZY A;  2MAB A;  2ZC2 A;  2V26 A;  1IW7 F;  4BXF A;  1X1A A;  2M30 A;  3T5X A;  3EYI A;  1OQY A;  3LSK A;  1VQ9 I;  2KDO A;  2VON A;  2IVM A;  3PNV A;  3JRI A;  5LD2 C;  4XSX F;  3V7S A;  3B6C A;  3S2H J;  3JCU C;  3DTE A;  4EAT A;  2K3P A;  3Q9S A;  5DEQ A;  3JR9 A;  4KFC A;  1X4P A;  2FSW A;  5EEH A;  3FM5 A;  5IOY A;  1JTY A;  1T39 A;  1UHM A;  5AIP A;  2E5Z A;  2DA6 A;  1OYW A;  1L0O C;  5HOO A;  2RV8 A;  2JMW A;  2DXI A;  3GLL A;  5CQG A;  2GIZ A;  2DQR A;  2R7X A;  1IXR C;  2K9S A;  4BQN A;  1H9G A;  1QZZ A;  5C4J J;  2X6W A;  3QU3 A;  1U5T A;  4Y7N J;  1RKT A;  2VOP A;  2H6C A;  1WJA A;  3BR6 A;  2Q8K A;  3V42 A;  1X1D A;  2EK5 A;  4BBS J;  1Y8R B;  2BW3 B;  5ICG A;  3GW2 A;  1UG0 A;  5EF6 A;  2F4I A;  1FY7 A;  1WRJ A;  4Y13 A;  2X9D A;  5B1B H;  1FTT A;  4MTE A;  3HGG A;  4XLC A;  3Q3S A;  4FET A;  3U2R A;  3A1Y A;  4B8X A;  2R5Y A;  2ETH A;  3TKY A;  1GDT A;  3FHN A;  1VQ6 I;  1SAU A;  2CH0 A;  2XSJ C;  4AIH A;  5DDG A;  1TZL A;  2HFH A;  1J09 A;  2F4M B;  3S2D J;  2PMZ N;  2QF7 A;  3L09 A;  2A07 F;  5F08 A;  2A5Y B;  3W6K B;  1BI1 A;  2MYS A;  4E7S A;  3LAP A;  4HF0 A;  4KIC A;  2M8G X;  3BY6 A;  1ETK A;  4PCQ A;  4RB0 A;  4R79 A;  2EZI A;  3WU1 B;  1L3L A;  3FWE A;  4D5F A;  1JUM A;  4I09 A;  2OCE A;  4RGU A;  1KQ9 A;  4NHJ A;  3DQV C;  1JT0 A;  2AQF A;  2LC2 A;  2OC6 A;  3J7A Y;  4DZP A;  2BHZ A;  1P7J A;  1SD7 A;  3FKJ A;  1WJE A;  2ID3 A;  3HB9 A;  2KHM A;  1Y6I A;  2JA2 A;  3F22 A;  4RAF A;  2COB A;  2DJI A;  3SEQ A;  3MN2 A;  3L2W A;  1GVD A;  2W82 A;  2N8G A;  4MHG A;  2CFX A;  4XLP F;  3GME A;  1HXD A;  1HKQ A;  2LY2 A;  4IXA A;  5K1Y A;  1X4O A;  4OIP F;  1JXS A;  4XLN F;  3FF5 A;  4XLF A;  2R5Z A;  3HOU J;  1D8K A;  2KRH A;  2WTE A;  2OU2 A;  1T0F C;  3DKX A;  4NQW B;  1MMS A;  4M73 A;  5FKO A;  3SDB A;  5IP6 A;  2KIM A;  1F4K A;  2GXA A;  3QWL A;  4XON A;  1Z91 A;  4G6Q A;  3M07 A;  3OOU A;  4HLX A;  1FJL A;  2DAO A;  1WKM A;  1U6G A;  2EIJ H;  3LFK A;  3CO6 C;  3ZXS A;  4ZH4 F;  2Y31 A;  1B72 A;  1D1A A;  4PJJ A;  4H4K C;  3S15 J;  3RIR A;  3DFG A;  3L2C A;  4OIN F;  5D5W B;  5GPA A;  3CCU I;  1T6S A;  1U78 A;  4BU2 A;  4Q4Z F;  5BS6 A;  2A05 A;  2V6E A;  2QEX I;  4UUV A;  1V3F A;  2VIX A;  1YS7 A;  1RNL A;  3GVA A;  2E1C A;  3HC7 A;  4L0Z B;  1Y0N A;  4XRM A;  4YRV A;  2XV4 S;  3J80 Z;  1IRZ A;  1S6L A;  1ZQ3 P;  3W2W A;  2NVU B;  1RR8 C;  2Y30 A;  4ENJ A;  3ZQ7 A;  3R6S A;  5F6F A;  1WJB A;  1T0F A;  2R7Q A;  1I27 A;  4ZYH A;  4BE2 A;  4BXU A;  1N75 A; 
#chains in the Genus database with same CATH homology
 2EV6 A;  2PQ8 A;  1Z05 A;  3IWZ A;  4LGW A;  3J7A O;  1FYL A;  3E5U A;  3F72 A;  5FD5 A;  1B9M A;  2HKX A;  2DTR A;  5HS8 A;  1AOY A;  3LQQ A;  4XBF A;  1SAX A;  3ZP5 A;  4XRF A;  3F8C A;  1GHC A;  4OU0 A;  4H0E A;  4AWX B;  5E1X A;  3MZY A;  4M6X A;  2HOE A;  3W6J B;  3EQL F;  3F6O A;  5D5X B;  1EH8 A;  4U0Y A;  2GA1 A;  1W4M A;  3ZMD A;  1I1G A;  2ZJ2 A;  3Q9V A;  3CUQ C;  5FFX A;  2QBY B;  4EJO A;  1PUE E;  2WWY A;  3P9K A;  2BEO A;  3AAF A;  4I2O A;  1IN8 A;  2CO5 A;  5ICC A;  3TQN A;  3F8M A;  2EFO A;  4PDK A;  4JQF A;  5DD8 A;  2O6G E;  4L9T A;  2P6T A;  4EGY A;  3KLO A;  4OIQ F;  5IT3 A;  5L3G A;  1P92 A;  2P7V B;  2ZBK A;  2XGX A;  2VOO A;  1ZRF A;  1KYW A;  2FRH A;  2ZKZ A;  1B6A A;  4LFU A;  3BP8 A;  2V1U A;  4ETS A;  2X0L A;  3CUQ A;  3ELK A;  3ZMU A;  1YQA A;  1R1T A;  1IF1 A;  1O3T A;  4QLC U;  4PZJ A;  1E2X A;  4Z2Y A;  1P6R A;  2V1D A;  1BN5 A;  3I4P A;  3E5Q A;  4P9U A;  4I01 A;  3RJP A;  4O6J A;  5E20 A;  2FBK A;  3KFW X;  3JSP A;  1EH6 A;  3BJO A;  5DUI A;  4HAM A;  3DP7 A;  3HHH A;  3ROU A;  2MLG A;  3KP6 A;  3ABU A;  1K79 A;  3SFZ A;  3PQK A;  3GFL A;  1ZRC A;  3FMQ A;  2EB7 A;  3H3U A;  4UVA A;  1WWX A;  5CVI A;  3IWF A;  1TW2 A;  4G94 A;  2VXZ A;  5HS9 A;  4KNY A;  4YIF A;  4N9H A;  2XRO A;  3FHZ A;  1XMK A;  4RAY A;  2L01 A;  2A69 F;  4ZYE A;  2IRF G;  2MH9 A;  5HDK A;  2QUF A;  1MKM A;  5A2Q K;  1KU9 A;  3BJ6 A;  1XSX A;  5L3D A;  1O57 A;  3R0A A;  2DK5 A;  4LD5 A;  1BM9 A;  2VE9 A;  3R61 A;  1ZG1 A;  4QWQ A;  3M7G A;  2V1X A;  2VN2 A;  3HRT A;  3L7W A;  1F9N A;  1SFE A;  3T1B A;  5J6X A;  2DU9 A;  5HS7 A;  1DPR A;  4HBL A;  1FBS A;  1BC8 C;  1DUX C;  3I0T A;  3T8R A;  5HLH A;  1IN5 A;  2FE3 A;  3ABT A;  4FX4 A;  1ZLK A;  1BI0 A;  4GGG A;  3SXY A;  2CQK A;  4HDU A;  1IZ1 A;  1H9T A;  1ZN2 A;  1P4W A;  3K2Z A;  3WGG A;  1R36 A;  3I59 B;  3KEQ A;  3RTR A;  4EGZ A;  5E8I A;  2HEO A;  4M9X A;  2L4A A;  2ZXJ A;  4ESF A;  3TOB A;  4IF4 A;  2V9V A;  5DV5 A;  3MZH A;  1K78 B;  3FM3 A;  2P5L C;  4WWC A;  2XKP A;  1REP C;  1U3E M;  4RB2 C;  5E1W A;  2OA4 A;  1T2K A;  3GFJ A;  4RGR A;  5JFR A;  1W7P A;  1FNN A;  1QGP A;  3WTZ A;  1IN4 A;  4P5O A;  1ZRE A;  5FLX K;  1USS A;  1YW7 A;  4KMU X;  5E8G A;  4ZZD A;  3VB2 A;  2RN7 A;  2W57 A;  3KP4 A;  2PN6 A;  5DCF A;  1TQM A;  2XHK A;  1ZH5 A;  4LJZ F;  3CJN A;  1MJB A;  2XAQ A;  4OIR F;  5DD4 A;  4PGH A;  1Z6T A;  1X3U A;  3GZ5 A;  2WV0 A;  3BPV A;  1XDS A;  2XAJ A;  1J7K A;  3P7N A;  4IRH A;  3ZMS A;  5A2Q Z;  1MDM A;  3EET A;  4FT8 A;  2HKO A;  3H3Z A;  2XKO A;  4A6E A;  1FYK A;  1UHW A;  3GEZ A;  2VT3 A;  2Q0O A;  2DO7 A;  4Q48 A;  4HW0 A;  1P4X A;  2LF7 A;  4EQQ A;  1LQ1 A;  2IP2 A;  5E17 F;  3U1D A;  1HSJ A;  1J5Y A;  2NAZ A;  3GFI A;  4GO1 A;  5CVJ A;  1S3J A;  4ZYD A;  4JK1 X;  4YII A;  4M74 A;  3E5X A;  4JBA A;  2HWV A;  1JHH A;  4MQV A;  2K86 A;  2IA2 A;  1HQC A;  5DCM A;  4EM2 A;  2J5O A;  2A61 A;  3WGI A;  4L0Y B;  3QRF F;  5LGT A;  1UST A;  4A0X A;  4Y17 A;  1S8N A;  1U5T B;  5HLI A;  4RGX A;  1FP2 A;  4U7B A;  4I0B A;  5CVV A;  3DXJ F;  4EJU A;  2H27 A;  1FWZ A;  1SMY F;  3HUG A;  5E18 F;  5F1R A;  3TDZ C;  1FSH A;  4G7O F;  3VFZ A;  1PP7 U;  2ESH A;  2H94 A;  3DPL C;  4XSZ F;  1LNW A;  4M6Y A;  4EM0 B;  5FLX Z;  1FBQ A;  3K0L A;  3E6M A;  2VC0 A;  3D5L A;  1LJ9 A;  1BJA A;  2K02 A;  4HZF A;  3F8N A;  1UFM A;  5CLS A;  5L3B A;  1OPC A;  2PMH A;  3HOT A;  3WTU C;  2KJC A;  2D45 A;  1DPU A;  3C7J A;  4LB6 B;  4MTD A;  3QOP A;  4NB5 A;  4U7D A;  3WGH A;  3JW4 A;  2OZ6 A;  3KZY A;  2OD5 A;  4OMY A;  4AIJ A;  2GXG A;  2PG4 A;  5CVU A;  1XGN A;  4N0B A;  2MBF A;  3GZ6 A;  1OYY A;  1BOA A;  1MD0 A;  3MAJ A;  1FX7 A;  2JT1 A;  1W7P D;  1LDK B;  4L5I A;  1FP1 D;  3F8F A;  1E17 A;  3DPT A;  1I5Z A;  1XMA A;  3JTH A;  3D0S A;  2NS0 A;  4ON0 A;  1ZAR A;  3B02 A;  3RDI A;  3V7R A;  1UCR A;  3K1P A;  4PGG A;  4WK8 F;  2K27 A;  2X4H A;  2P6S A;  2YU3 A;  3IL2 A;  1C0W A;  3ZN1 A;  3O3K A;  2OQR A;  3KP5 A;  3K1M A;  5LEJ A;  2B0L A;  1TQP A;  4ESJ A;  2E7W A;  1SD5 A;  2MD5 A;  2M8E A;  2L02 A;  5ED4 A;  2DBB A;  4KYW A;  2ELH A;  4GCV A;  3OV8 A;  1HKS A;  2VC1 A;  3L9F A;  1IAW A;  3ZPL A;  3HRU A;  3GO5 A;  4KN4 X;  3MCZ A;  3KET A;  4EV0 A;  2L4M A;  5D5V B;  3DKW A;  3WTV C;  3IRR A;  2D1V A;  4A12 A;  1Z1D A;  5LLQ A;  3QAH A;  3ZMV A;  4KMF A;  2K4J A;  3RPU A;  3HTS B;  4NQW A;  1J59 A;  2EFP A;  1XCV A;  3QPH A;  2IPQ X;  2KIU A;  4I98 B;  1HW1 A;  3TO9 A;  5BOX A;  2HGC A;  5JI6 A;  1WI9 A;  5H20 A;  3IRQ A;  2NNY A;  1YTY A;  3HSE A;  1J0R A;  1FT9 A;  1YS6 A;  2M5W A;  4RAZ A;  3V8J A;  2FBI A;  3LA3 A;  4UV9 A;  4ASN A;  2LNB A;  2QEN A;  3F21 A;  1STZ A;  3SHF A;  1KU3 A;  5EEG A;  1I6X A;  2A68 F;  2DQL A;  4UXN A;  3SZP A;  2R3S A;  3J81 K;  3DEU A;  2OAZ A;  4HLY A;  4Q47 A;  5D5U B;  4R8H A;  1O3R A;  2STW A;  4I0A A;  2DI3 A;  4HYE A;  2QQ9 A;  3GXO A;  1FLI A;  2QM3 A;  3K9T A;  5CJ9 A;  1TNS A;  3ML6 A;  4LG0 B;  1XSV A;  1BI3 A;  3OOP A;  4LMY A;  2DPD A;  2H09 A;  2G7H A;  3E97 A;  1CF7 B;  2P7C B;  2LKP A;  2YR2 A;  3E3V A;  1R1V A;  2QLZ A;  2FML A;  5D6E A;  2FQ3 A;  5TJJ A;  5FD6 A;  1GVJ A;  1QQI A;  2FBH A;  2EA4 A;  2XAS A;  2L3D A;  4KDP A;  2QBY A;  2ESN A;  4EJT A;  1FC3 A;  3F8B A;  1IXS B;  1ZG5 A;  4IVN A;  2G7U A;  4UNO A;  2Z99 A;  5HVQ C;  1RZ4 A;  4YG2 F;  1SFX A;  2ISZ A;  4HDV A;  1MJ9 A;  3NEU A;  2BE5 F;  2HQR A;  5ILU A;  2KRF A;  2Z33 A;  4ESB A;  5FB2 A;  1XB4 A;  4A5N A;  5DYM A;  2P8T A;  5L3F A;  3T0Y A;  3G3Z A;  1H0M A;  2W24 A;  4HX7 A;  1HBX G;  3HHG A;  1D3Y A;  3BOQ A;  2O03 A;  2ZME B;  1HW5 A;  1ZAO A;  2F5E A;  2W85 A;  4ENK A;  4CIC A;  1BBY A;  3HYI A;  4HX8 A;  5ILV A;  4U0V A;  2W84 A;  3VEP A;  4K2E A;  5E1Z B;  5LRR A;  1HST A;  2EA2 A;  4O3M A;  1HW2 A;  1YO5 C;  1FBU A;  1KU2 A;  2ADU A;  1K6O A;  3WTW C;  2QVO A;  3K69 A;  3J81 Z;  4LLN A;  2O8X A;  3LA2 A;  2VBX A;  2P5V A;  4P9F A;  5LEK A;  1XN7 A;  1JGS A;  3C1D A;  1JHF A;  3MWM A;  5IT9 K;  5K5R A;  1OKR A;  5D4R A;  2ACJ A;  5F64 A;  3COA C;  4I02 A;  2KKO A;  4HX4 A;  1DP7 P;  5ICE A;  3HOS A;  2GA2 A;  2DPU A;  2FOK A;  4FHT A;  2H6B A;  4MEX F;  3ZMT A;  2JTV A;  2FMY A;  5LHG A;  3IKT A;  4KIB A;  5BPD A;  3KLN A;  1R5G A;  3CLO A;  4P96 A;  3I5U A;  4A0Z A;  4IHT A;  2YPR A;  3LST A;  1IXC A;  1U2W A;  4WXC A;  5FFZ A;  1KQ8 A;  3I53 A;  3K1N A;  2PI0 A;  3E6D A;  3F6V A;  3QPT A;  1MGT A;  3ECO A;  1S7A A;  3V4G A;  1O7F A;  1Z6R A;  2HQN A;  2ZNZ A;  1XDU A;  3RKY A;  1B9N A;  4HQE A;  4RB3 C;  1MDM B;  4MEY F;  4KIF A;  1Y0U A;  1D8J A;  4WXH A;  2BGC A;  4D0P A;  3R60 A;  3BJA A;  1Z7U A;  4BNC A;  2GQQ A;  2FXA A;  3RYR A;  2HYF A;  2HTS A;  1R22 A;  3GF2 A;  4LK1 F;  3KEO A;  2KJB A;  5ICF A;  4L5J A;  4Y15 A;  4IPA A;  5JVT A;  3MFK A;  2L54 A;  3T8T A;  4CZZ A;  2LDU A;  4FX0 A;  4UV8 A;  2QQA A;  1T98 A;  2JRT A;  2EV0 A;  1ZG3 A;  4CDG A;  4BQA A;  3I59 A;  5HLG A;  5DCM B;  2IW5 A;  3WTX C;  4L18 B;  3GX4 X;  4MQ9 F;  2BYV E;  1IUY A;  5L3E A;  3REO A;  1MJA A;  1FSE A;  1K78 A;  3BRO A;  3BDD A;  4O5V A;  1S7O A;  3M9A A;  4DQ2 A;  4WCG A;  4A2U A;  4AD9 A;  2XAH A;  1YW9 A;  1OR7 A;  3R0J A;  2MH2 A;  3I71 A;  5IT9 Z;  3LAJ A;  1SD6 A;  1BC7 C;  5K5O A;  1GXP A;  2PJP A;  3V7C A;  1AWC A;  3PFI A;  3N97 A;  4F7Z A;  1KQ0 A;  3WE2 A;  3WTT C;  1KU7 A;  1I1S A;  1FPQ A;  2EJR A;  1R5H A;  3CTA A;  1QO0 D;  4GXO A;  1RIO H;  1TTY A;  2STT A;  2XAF A;  4BYY A;  5HDG A;  2CW0 F;  1O3S A;  2ISY A;  4WF2 A;  1U5T C;  2OQG A;  2DK8 A;  2Z3Y A;  4BH9 A;  3G73 A;  4LLL A;  2NYX A;  3RKW A;  5D8L B;  4L9J A;  1W5S A;  1XD7 A;  2M45 A;  1TW3 A;  4WX9 A;  5BPI A;  3QP6 A;  3SZT A;  1R58 A;  4CGZ A;  4ZZL A;  4A6D A;  4GYI A;  2HTJ A;  2JSC A;  2PLY A;  4B09 A;  3TDU C;  4EJW A;  5J8C A;  2FEZ A;  1XCB A;  1SFU A;  5JR3 A;  2CYY A;  2G9W A;  3I64 A;  2NNN A;  2EV5 A;  4M72 A;  3HIF A;  1O3Q A;  4L9V A;  5AON A;  4CO8 A;  1KA8 A;  3TOA A;  1OMI A;  2V79 A;  5KVR A;  4UVC A;  1Z9C A;  2ZFW A;  4EM1 A;  2O0Y A;  1ULY A;  2XRN A;  4HQM A;  1EH7 A;  2M1B A;  1RUN A;  2RDP A;  3HRS A;  1YYV A;  4YFX F;  4M9S A;  3QP5 A;  1R00 A;  2HR3 A;  3LA7 A;  1F5T A;  1F1Z A;  3FZV A;  3HTU A;  1J2X A;  3JAM K;  3CO7 C;  4KUM A;  4ZYG A;  2VBY A;  2MA3 A;  2BV6 A;  3FMS A;  3GYH X;  2PMU A;  1YIO A;  2Q2E A;  5ERI A;  4I7H A;  3ZMZ A;  2IJL A;  5LHH A;  2HDC A;  3KE2 A;  1XGM A;  4R1H A;  4M9Z A;  2VE8 A;  4N9I A;  3SQN A;  3RYP A;  1WQ2 A;  3TO7 A;  1TLH B;  3Q5F A;  4OOI A;  2F5F A;  4LB5 A;  3WOD F;  2K7L A;  1W5T A;  3F23 A;  1QBJ A;  2F2E A;  1BIB A;  3VOE A;  1IN6 A;  4G6D A;  3O6B B;  4HF1 A;  4CHU A;  4RB1 A;  1U8R A;  4UVB A;  1LB2 A;  3ISP A;  2RQP A;  3P9I A;  1IRG A;  1ZRD A;  3HSR A;  4EMS A;  2EFQ A;  3EYY A;  2PEX A;  1D5V A;  1UB9 A;  5FGM A;  1LEA A;  3FX3 A;  3KP3 A;  3ERE D;  1TNT A;  1OYI A;  1YLF A;  3H92 A;  5LHI A;  2UWM A;  1QPM A;  1XGS A;  2UXX A;  4KT5 C;  3HRM A;  4BHB A;  3CUQ B;  2A3S A;  1FOK A;  1J9I A;  2FNP A;  1ZYR F;  1KYZ A;  2XVC A;  1P2F A;  2UZK A;  3FXR A;  2ZNY A;  4G7Z F;  4HV6 A;  2JPB A;  4GYG A;  1SD4 A;  2P5K A;  2RNJ A;  3I58 A;  1ONV A;  4IJA A;  1P4A A;  2E7X A;  4S05 A;  4LK0 F;  2D2W A;  2A6E F;  2GXB A;  4WXD A;  1QNT A;  1BI2 A;  3JAM Z;  3VOD A;  3V8L A;  3GFM A;  1RI7 A;  3LWF A;  1ON2 A;  2CGP A;  1IRF A;  2EFN A;  5D4S A;  2CSO A;  3U9G A;  3M1E A;  2OBP A;  3RKX A;  3GLX A;  2QQB A;  5H6R A;  5JHU A;  2PBI A;  1G3T A;  3KCC A;  1DDN A;  2IA0 A;  4U0W A;  2RKH A;  1YG2 A;  3O2P E;  2DFI A;  1B59 A;  5LBQ A;  2DW4 A;  4HF2 A;  3PQJ A;  1ON1 A;  5J8F A;  3NQO A;  1LDJ A;  2ZO4 A;  2P4W A;  3GUD A;  3IHU A;  2JZY A;  2E1N A;  1TQI A;  2FF4 A;  2V6C A;  2YX7 A;  2COM A;  2GZW A;  3ZN0 A;  2EWN A;  1J75 A;  5D6F A;  4LG0 A;  4EVI A;  4ENM A;  3QU6 A;  5H6Q A;  2CG4 A;  3WE3 A;  1G6N A;  2JPC A;  2C6Y A;  1HKT A;  2QZ8 A;  2TDX A;  1CF7 A;  5CVR A;  4BHP A;  5D8K B;  2BBY A;  3RI4 A;  3LQR A;  1A04 A;  4OMZ A;  3WTY C;  5BMZ A;  2EFW A;  1LDD A;  4M71 A;  2IT0 A;  2LF8 A;  5TRD A;  3N4M A;  2DLL A;  4RGS A;  1LVA A;  1G3Y A;  4L9N A;  3M8E A;  3CDH A;  2WC2 A;  2GWR A;  2HS5 A;  3P9C A;  4G8X A;  1VTN C;  1ZGJ A;  4AVP A;  4E70 A;  1BIA A;  1B4A A;  4A0Y A;  2FA5 A;  2FU4 A;  1YFH A;  3FXU A;  4AIK A;  3S2W A;  5ILS A;  2AS5 F;  2A6H F;  4YFK F;  3BZ6 A;  2D1H A;  2HZT A;  1ZLJ A;  4CYD A;  1KGS A;  2MC3 A;  4KIG A;  2PFB A;  1B1B A;  4HA8 A;  4LLG F;  2Z9O A;  2O61 A;  5CYV A;  1W7P B;  2NRA C;  3TGN A;  3BPX A;  2F5C A;  2ZME A;  3V8K A;  6PAX A;  4BHC A;  1JE8 A;  4KA4 A;  1CGP A;  3JSO A;  1S29 A;  4IRI A;  1GXQ A;  1TBX A;  2GAU A;  3R4K A;  4KN7 X;  3GWZ A;  1RUO A;  3CUO A;  3MEX A;  4DNC A;  2YX4 A;  1R1U A;  4HOB A;  2MLK A;  2VOD A;  1XSD A;  2XUB A;  3C18 A;  2F5D A;  2Y48 A;  2RGV A;  3BWG A;  3WU0 A;  2O3F A;  3WG9 A;  1XGO A;  4CXF A;  1G3S A;  2RVC A;  3RPQ A;  1K7A A;  3KZZ A;  1FZP B;  2Z5U A;  3KP7 A;  5DUK A;  1EV7 A;  2R7D A;  4U88 A;  3HSF A;  4YFN F;  3E6B A;  1R7J A;  3C3W A;  1MZB A;  5LGN A;  5LGU A;  1NHA A;  2XAG A;  1G3W A;  4G9Y A;  2KIF A;  1ZHF A;  1ODD A;  4BAY A;  2UXN A;  4RS8 A;  2FNA A;  4IRG A;  1R23 A;  1G4D A;  4OIO F;  3IKV A;  2QYO A;  2VBZ A;  2QWW A;  3L00 A;  4P55 A;  3FMR A;  5KK1 A;  2K4B A;  1PDN C;  4TV7 A;  3WTS C;  5L3C A;  3EDP A;  1ZGA A;  4MGR A;  2M87 A;  2LSO A;  2DT5 A;  3FXQ A;  2XIG A;  3ULQ B;  3MQ0 A;  1PP8 F;  2RC4 A;  4HV5 A;  2VT2 A;  3E6C C;  4UHT A;  1T38 A;  1LEB A;  1YW8 A;  4IHS A;  2AXL A;  3DF8 A;  3I54 A;  5AIQ A;  4A5M A;  4Q5S F;  1Q1H A;  2HYG D;  3IC7 A;  3M8F A;  3NRV A;  2W25 A;  2Y75 A;  3DV8 A;  2IA1 A;  2ZCW A;  1WSU A;  5HDN A;  4ENN A;  5BQT A;  3JTG A;  2YSR A;  5FO5 A;  1FYM A;  4S04 A;  1O7L A;  2GIV A;  2R7F A;  3KP2 A;  5LRS A;  3TO6 A;  3F3X A;  1V4R A;  2Y0M A;  2J5P A;  5K5Q A;  2VBW A;  4EJV A;  3J80 K;  3B73 A;  2OZU A;  2CWE A;  4G7H F;  4MNU A;  3EUH A;  1IN7 A;  1SMT A;  3ECH A;  1QZY A;  1IW7 F;  2M30 A;  3T5X A;  3EYI A;  2VON A;  2IVM A;  4XSX F;  3V7S A;  3Q9S A;  5DEQ A;  4KFC A;  2FSW A;  5EEH A;  3FM5 A;  1T39 A;  1UHM A;  5AIP A;  1OYW A;  1L0O C;  5HOO A;  2RV8 A;  2DQR A;  1IXR C;  1H9G A;  1QZZ A;  3QU3 A;  1U5T A;  2VOP A;  2H6C A;  2Q8K A;  2EK5 A;  5ICG A;  3GW2 A;  1FY7 A;  1WRJ A;  4Y13 A;  4MTE A;  3U2R A;  4B8X A;  2ETH A;  3TKY A;  5DDG A;  4AIH A;  2HFH A;  3L09 A;  2A07 F;  2A5Y B;  3W6K B;  1BI1 A;  3LAP A;  4HF0 A;  4KIC A;  4PCQ A;  3BY6 A;  3WU1 B;  4RB0 A;  4R79 A;  1L3L A;  3FWE A;  4I09 A;  4RGU A;  1KQ9 A;  4NHJ A;  3DQV C;  1SD7 A;  3F22 A;  4MHG A;  2CFX A;  4XLP F;  1HXD A;  1HKQ A;  4IXA A;  5K1Y A;  1JXS A;  4OIP F;  4XLN F;  3FF5 A;  1D8K A;  2WTE A;  2OU2 A;  4M73 A;  2KIM A;  1F4K A;  1Z91 A;  4G6Q A;  4HLX A;  2DAO A;  1WKM A;  1U6G A;  3LFK A;  3CO6 C;  4ZH4 F;  3RIR A;  3DFG A;  3L2C A;  4OIN F;  5D5W B;  1U78 A;  1T6S A;  4Q4Z F;  5BS6 A;  4UUV A;  1V3F A;  3GVA A;  1YS7 A;  1RNL A;  2E1C A;  4L0Z B;  2XV4 S;  3J80 Z;  1S6L A;  4ENJ A;  3ZQ7 A;  3R6S A;  5F6F A;  1T0F A;  1I27 A;  4ZYH A;  4BXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...