3TDZC

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-stapled acetylated ubc12n complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
SNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
molecule keywords DCN1-like protein 1
total genus 27
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tdzC00
5FLXZ 4CYDA 4I0BA 5BPDA 4O3MA 2LNBA 3E6DA 2QBYA 2PI0A 3E6CC 1FYMA 3QPHA 1IRGA 5LGNA 5D5XB 4B09A 3TGNA 4L9NA 4L9TA 2LSOA 2CGPA 1S7AA 1SD5A 4RGSA 4A0ZA 4GCVA 3GZ6A 1R23A 1TQMA 4BAYA 4DNCA 4XLNF 3O3KA 4MTEA 4M6XA 3V7CA 1YS7A 1XDSA 3E6BA 3LQQA 1B4AA 2ZNZA 1SAXA 5L3EA 2XAQA 2XAHA 4CDGA 1V4RA 2ZNYA 3ZPLA 5JI6A 1FLIA 1IN4A 1OMIA 5CVUA 3ZMVA 2MLGA 3KEQA 2VC0A 3J80Z 1J59A 1LEAA 2GIVA 1OYYA 4WXDA 2A5YB 2JRTA 4PGGA 1JGSA 4BHCA 2PMHA 1XN7A 3V4GA 5ILSA 3CUQC 3RYPA 2ZMEA 4LK1F 2NAZA 3WTXC 3I71A 3FMQA 1MJ9A 2RN7A 1SMYF 2P7CB 1QQIA 1K79A 4WX9A 2YSRA 1ULYA 2E7WA 2NS0A 4YIFA 3GEZA 1IN5A 2P7VB 3WTVC 2D45A 4PGHA 3KP4A 1KU2A 3KEOA 4FX4A 3IWZA 4BXUA 3V8KA 3BY6A 2HS5A 1ZGAA 2VE9A 2FMYA 1Z91A 2RC4A 3LQRA 4M9SA 1HW2A 3GFJA 2XAFA 2ZFWA 2FEZA 5AIQA 2ISZA 3IWFA 2PN6A 1TW2A 3L00A 3WE3A 2HTSA 4A0XA 1W5SA 3DF8A 4HQEA 2KJBA 2W24A 4U0YA 3P9CA 3HHHA 1RNLA 4U7BA 3QPTA 5DV5A 4LLLA 1FNNA 4OIRF 2RVCA 3FF5A 3R4KA 2NRAC 2ELHA 2FA5A 2OAZA 1E2XA 2P5VA 2VONA 1WQ2A 2VBXA 2FOKA 2MA3A 1SFXA 3BDDA 3DEUA 5L3FA 1UB9A 2Z9OA 3MEXA 1FSHA 1XD7A 1W7PB 3QAHA 1QBJA 2HWVA 4RAYA 3I0TA 5HLIA 1YO5C 1HBXG 3R60A 1HQCA 4IHSA 2GXBA 2ZCWA 1P4XA 3MWMA 2EV6A 3K1MA 1FYLA 2KKOA 1HW1A 3DQVC 3JAMZ 2O03A 3N97A 1ZYRF 3M1EA 4HDVA 1ZREA 4N9HA 4IRGA 2XASA 4UUVA 3RI4A 2ZKZA 3P9IA 3RIRA 4IPAA 2RNJA 4RGRA 1RUNA 1W7PA 3KLOA 4L5JA 3FXUA 2VN2A 1FT9A 5HS7A 3TO6A 2A6EF 3EYIA 4EJVA 4EM2A 5FB2A 2EFWA 1WI9A 5D6FA 1IAWA 3R61A 2ESHA 3J81Z 2F2EA 4Q47A 1X3UA 1KU9A 1YW9A 3T8TA 4LK0F 2A61A 4ZYEA 1SFEA 2HQNA 3WODF 2Z33A 4HQMA 5F6FA 3GWZA 4KDPA 3I64A 3SZPA 5J8CA 4P96A 1KA8A 1I1GA 1K7AA 2ETHA 3J7AO 1O7LA 3LFKA 1TQIA 2L3DA 3WG9A 3I59A 4KNYA 3JW4A 2QM3A 4I0AA 5JHUA 2VT2A 4OU0A 4BYYA 2IA2A 4KT5C 5CLSA 4AIJA 3TKYA 3FMSA 1BIAA 6PAXA 2BGCA 4M73A 3FXRA 3M9AA 3ELKA 2OU2A 3JTGA 4KN7X 5BMZA 1ODDA 4JQFA 2BEOA 2IT0A 3NQOA 1HXDA 3F72A 3P7NA 3EQLF 1KQ0A 2H94A 1LEBA 4RGXA 3RKWA 1KQ9A 1FBUA 2JPBA 5ED4A 3U2RA 4EGZA 2BBYA 1XGOA 3R0AA 1B6AA 3T1BA 1G4DA 4EJUA 2A3SA 3CO7C 1R36A 3HUGA 3LA2A 2GQQA 1U3EM 4GO1A 4HDUA 1OKRA 3M8EA 1S29A 3T0YA 1GVJA 5DCMA 2XRNA 2KIFA 4MQVA 3WTWC 3FMRA 4A2UA 5CJ9A 3HIFA 4KIGA 4E70A 2O3FA 3DXJF 1FC3A 1ON2A 2G7HA 5DDGA 4HF1A 4U7DA 4HF0A 3TDZC 2MBFA 1FY7A 2MH9A 5CVIA 3EUHA 3Q5FA 3Q9VA 4U88A 3WGGA 1YW7A 2LF7A 4LG0B 2YU3A 2KIUA 2A69F 2CFXA 2K27A 3DPLC 2P6TA 3B73A 1XMAA 4YFNF 4IRIA 5E20A 1SMTA 3ZQ7A 1U5TC 2EV5A 2VE8A 4EQQA 4FX0A 1KGSA 1ZARA 1FP1D 2IA1A 1DPRA 4S04A 1R22A 1LVAA 4NHJA 3R0JA 4EGYA 1LDJA 2STWA 1T0FA 3QU3A 2DU9A 2JZYA 2QBYB 4YIIA 1R5HA 5JR3A 1TNTA 5E18F 3COAC 4PCQA 2L4AA 5HS9A 1MDMB 4ZYDA 4HA8A 3F8CA 3JSPA 3HSRA 2VC1A 4HX4A 1O3QA 2Z3YA 2A07F 4AIKA 1U5TA 2K02A 3BP8A 3W6KB 5LHIA 3SQNA 2ADUA 2O6GE 1IXCA 3KCCA 4LLGF 1TLHB 3E5XA 4JK1X 5LLQA 1QGPA 4EV0A 1MDMA 1W4MA 4ZYHA 1MGTA 2Y48A 2K4JA 3I4PA 1MZBA 2ESNA 5CVRA 3ECOA 2HZTA 5EEHA 2RQPA 3KLNA 2VODA 2IVMA 4S05A 3ULQB 3JSOA 5TRDA 5HLHA 2HYFA 3IRQA 4Y15A 2FSWA 4MQ9F 3RKXA 1KYZA 2DPDA 4B8XA 4Y13A 4XSXF 2K4BA 1CF7A 4MEYF 5JFRA 1ZRCA 1IUYA 3LA7A 4G6QA 3F8NA 2OBPA 4EM0B 4PZJA 4FHTA 2O8XA 1UHMA 2F5DA 1ZAOA 1Z1DA 5K5OA 2EA4A 3KP5A 5LGUA 4RB2C 4U0WA 1O3TA 3G3ZA 5DEQA 3HYIA 1YQAA 1PP7U 5IT3A 2V1DA 4MHGA 3KETA 2D1HA 4YG2F 3IL2A 3SZTA 2BV6A 1UHWA 5L3BA 1FBSA 2VOOA 4A6DA 1DPUA 1MJAA 3IHUA 4KN4X 2R7FA 5TJJA 2JTVA 1JXSA 1TTYA 2V1UA 5D4SA 2M8EA 4UNOA 1A04A 4RGUA 1EV7A 4HF2A 3V7RA 3IC7A 1Z6TA 3WU1B 5LRSA 1P6RA 3J80K 3EETA 2HGCA 3AAFA 1I27A 1FBQA 4UHTA 1G3YA 1T38A 4M74A 5L3DA 3MZHA 1B1BA 5ICCA 1BC8C 1DP7P 3E3VA 2HTJA 3KP7A 1R1UA 4O6JA 3TQNA 3I53A 4ETSA 2FRHA 3ZP5A 5K5QA 1QZZA 2CYYA 2EFNA 1BOAA 1XSDA 4HLYA 2XHKA 2W25A 5IT9Z 2KIMA 3F8BA 2RKHA 2DO7A 5E1XA 5AIPA 2IJLA 2Q8KA 4P9UA 4LFUA 1UCRA 1TBXA 4LG0A 2H09A 1J9IA 2CQKA 1B59A 4LJZF 5CYVA 3ABUA 2WWYA 4XSZF 4N0BA 2P8TA 3WGHA 2NNNA 1Q1HA 4MEXF 3ECHA 4EM1A 3HRMA 2O61A 1YLFA 2F5FA 2EK5A 2FE3A 4HV5A 3FX3A 3FHZA 1IRFA 5DUKA 1BIBA 2X0LA 3DPTA 3KZYA 3LWFA 2E7XA 5HS8A 3CDHA 3P9KA 1ZGJA 5J8FA 4MTDA 4OOIA 1FZPB 2VBWA 2E1CA 2CG4A 5KK1A 2P5KA 3R6SA 4BNCA 1S7OA 2HEOA 4LLNA 2MC3A 1RZ4A 1B9MA 5K1YA 4WXHA 5ILUA 2J5OA 1U5TB 1CGPA 2CW0F 5FGMA 1H9TA 1U2WA 3JAMK 1BBYA 3FM5A 4WXCA 3T5XA 2VXZA 4KMFA 3V8JA 2JT1A 4AD9A 4RB1A 5E1WA 3GFIA 2DK5A 2HR3A 3QU6A 4GGGA 5DCFA 4G7OF 3CUQA 2AXLA 5ICGA 3ZMDA 1H0MA 1G3SA 2DTRA 1JHHA 4M71A 3MZYA 2C6YA 3BPXA 1J2XA 3J81K 4Q48A 3H3UA 1BM9A 2FNPA 2A68F 2RGVA 1BC7C 1XDUA 1R1TA 3BROA 1P92A 5DUIA 4WK8F 2WV0A 1Z9CA 4F7ZA 1RUOA 1DDNA 1FSEA 1WRJA 2G7UA 4EJTA 2GXGA 3HTUA 5IT9K 1PUEE 4BQAA 2W57A 3FZVA 4WCGA 4RB0A 4N9IA 4L0YB 3WTSC 5HVQC 1OYIA 2W84A 2V1XA 5A2QK 1XMKA 3I5UA 2R7DA 1P4AA 4P5OA 2LKPA 4A0YA 2GZWA 3BJAA 2DQRA 1S3JA 2HQRA 2FNAA 3TOBA 1FP2A 1MKMA 3Q9SA 4G94A 2DAOA 3WE2A 2EB7A 2OD5A 4L18B 5D5WB 3MCZA 1HSTA 4AVPA 2H27A 4LB6B 3F23A 4OINF 2HOEA 5D5UB 3K1NA 3W6JB 4I01A 4HZFA 2VBYA 2K7LA 3HOTA 2GWRA 3REOA 2CWEA 3U1DA 1YFHA 5LHHA 2HDCA 3CTAA 3F6VA 1O3RA 3D0SA 4AWXB 2IA0A 2PG4A 2MH2A 3F8FA 2DW4A 2Z5UA 4A5MA 5BOXA 1IN6A 3OV8A 1H9GA 3C18A 4G6DA 5ICEA 3K0LA 4CGZA 1IZ1A 3L7WA 5JVTA 5DYMA 1KQ8A 3RJPA 1MJBA 4WWCA 5ERIA 1MD0A 1R58A 4M9ZA 4HYEA 3F21A 2YX4A 3RPUA 5E17F 4JBAA 2D1VA 5HDGA 4EJOA 1IN7A 4I09A 2LF8A 2DPUA 4QWQA 2V9VA 3PFIA 2DLLA 4FT8A 1EH7A 1QO0D 1R1VA 4PDKA 1F1ZA 4OIQF 1K78B 1WWXA 3EYYA 1SD4A 4G7HF 2UXNA 3PQJA 3N4MA 2PQ8A 1CF7B 2PLYA 2QQAA 3DP7A 5LHGA 2FQ3A 1P2FA 3LA3A 3OOPA 4OIOF 4KUMA 3FXQA 4Y17A 2L54A 2DFIA 5A2QZ 4RAZA 1K78A 2UXXA 4K2EA 3TOAA 3K2ZA 4IXAA 3KE2A 2STTA 4R79A 1R00A 1I5ZA 4ESFA 3O6BB 3F6OA 3HSFA 4OMZA 1HKQA 1ZG5A 3HRSA 4HLXA 3BOQA 5J6XA 1I6XA 1SD7A 2DBBA 2PMUA 2CO5A 4UVCA 4U0VA 4YFXF 4L9VA 5DCMB 4LGWA 4IJAA 3KFWX 2JPCA 2XROA 3B02A 3HTSB 1FWZA 5L3GA 1K6OA 2P5LC 4KIBA 2GAUA 1BI0A 1ZRFA 1ZRDA 3RKYA 2X4HA 1O7FA 4GYGA 5BQTA 2Y75A 4RB3C 1RIOH 2NNYA 2IP2A 3EDPA 1YW8A 3MQ0A 3ZN0A 1FOKA 3GFMA 1BN5A 1J5YA 1XCBA 3BJOA 3SHFA 1JE8A 4Q4ZF 2OA4A 2QVOA 2DT5A 1AOYA 2V79A 4IF4A 2OQGA 1S6LA 5ICFA 1XCVA 4GXOA 1TNSA 3U9GA 3F3XA 3HHGA 3LAPA 2EJRA 3V8LA 1I1SA 3SFZA 4KMUX 5F64A 1O3SA 5DD4A 3GUDA 3O2PE 1BI2A 4QLCU 4ENNA 4R8HA 4EJWA 2M5WA 3BZ6A 2XKOA 2R3SA 5ILVA 2P4WA 3LAJA 4H0EA 1IN8A 3RYRA 2BE5F 4XLPF 3ZMUA 3L9FA 2B0LA 5FD6A 2ZBKA 1TW3A 3NRVA 1JHFA 2ACJA 2PJPA 1HW5A 2A6HF 1ZLKA 4ENKA 4CO8A 2Q0OA 2M87A 2M1BA 3C1DA 4CZZA 4NB5A 2F5EA 1BJAA 3ZMSA 1LNWA 4G9YA 5EEGA 1QNTA 1ZH5A 3ML6A 4HAMA 3ZMZA 1ZHFA 4KA4A 3WU0A 3L2CA 1AWCA 1XSXA 4L5IA 3F8MA 2PBIA 3GFLA 4ENMA 3PQKA 2PEXA 1YTYA 3VODA 2Z99A 3BPVA 3QOPA 4HV6A 3M8FA 2QQ9A 2OZUA 1LDKB 5BPIA 3MAJA 3ZN1A 2UZKA 3CO6C 3JTHA 1W7PD 1ZLJA 5FFZA 3QP5A 2EFOA 1WSUA 1OPCA 1IF1A 2FF4A 3S2WA 4G8XA 1G3TA 5LEKA 1O57A 4HW0A 3SXYA 2L01A 1QZYA 2UWMA 2J5PA 3C7JA 2QLZA 2HYGD 3VFZA 4MGRA 2OQRA 2IW5A 1J0RA 2H6BA 1J7KA 5LEJA 3MFKA 3HRUA 2FXAA 4UVAA 1BI1A 2EFPA 4I2OA 3VB2A 2F5CA 2LDUA 4CHUA 2QENA 4LD5A 3ZMTA 1J75A 2KJCA 2GA1A 1T2KA 2ZXJA 1ON1A 3GYHX 1GHCA 1XGSA 1T98A 2YX7A 3H92A 1LJ9A 5FFXA 4A6EA 2W85A 5E1ZB 2XV4S 1XGMA 2FBKA 4IVNA 5HLGA 1XGNA 3I54A 2QYOA 5D6EA 4EVIA 5K5RA 2QZ8A 4MNUA 3WTYC 3RTRA 3BWGA 4DQ2A 3KP2A 3E5QA 2TDXA 3V7SA 2L4MA 1Z7UA 3RPQA 1KU7A 4ENJA 4ZZDA 3GF2A 1RI7A 2ZO4A 1D8KA 1WKMA 3K1PA 3WTTC 3GVAA 1FX7A 1LQ1A 1HSJA 3GO5A 3GZ5A 1PP8F 2E1NA 2FBIA 3M7GA 4RS8A 5F1RA 1SD6A 3K9TA 2XUBA 2KRFA 2DI3A 3TO9A 5H6RA 1KYWA 3T8RA 3DKWA 2AS5F 3ROUA 1NHAA 2EV0A 4GYIA 5LBQA 1G6NA 3HOSA 4UVBA 1B9NA 5FO5A 5H20A 4ASNA 1D5VA 3K69A 2EFQA 2G9WA 1U8RA 4UXNA 1Z05A 4KIFA 1U78A 3E5UA 2XKPA 5CVJA 1QPMA 2WTEA 2GA2A 4O5VA 5CVVA 1IXSB 4YFKF 2XAJA 5D4RA 4ESJA 1VTNC 1YG2A 3RDIA 2HKXA 1R5GA 5DD8A 1FPQA 2COMA 5FD5A 1G3WA 1KU3A 4L0ZB 1PDNC 2Q2EA 2PFBA 4P9FA 1S8NA 4KYWA 3FM3A 1F4KA 4EMSA 3QP6A 1D8JA 3HRTA 1EH6A 3QRFF 3H3ZA 3GW2A 5AONA 5BS6A 5LGTA 2ZJ2A 4I02A 4XBFA 2VOPA 2JSCA 4G7ZF 2V6CA 3CUOA 2ZMEB 4I7HA 4KICA 2L02A 1Y0UA 2RDPA 4BH9A 4A12A 1UFMA 4M72A 4ON0A 1STZA 2QWWA 3ABTA 3E6MA 2BYVE 2MLKA 1F5TA 2RV8A 3WTZA 2M30A 3G73A 1L0OC 1EH8A 2EWNA 5KVRA 1E17A 4ZZLA 1YYVA 2DQLA 1SFUA 1GXQA 1IW7F 3GLXA 5HDNA 3GXOA 5FLXK 2XGXA 2HKOA 3TDUC 3WGIA 4HBLA 4UV9A 4Q5SF 3I59B 4L9JA 3ISPA 4ESBA 2D2WA 1L3LA 3KP3A 2NYXA 4HOBA 1ZG3A 1USTA 4KFCA 1F9NA 5D8KB 2FMLA 1D3YA 1GXPA 1LDDA 4M9XA 3HSEA 3I58A 1R7JA 4WF2A 1U6GA 3DV8A 4M6YA 2FBHA 3IKTA 2VBZA 4Z2YA 1ZN2A 1OYWA 1Z6RA 3CUQB 2P6SA 5LRRA 4R1HA 2OZ6A 3LSTA 1YS6A 5L3CA 2QQBA 1DUXC 1ZG1A 4XRFA 1V3FA 3CJNA 4LB5A 1FYKA 2ISYA 2MD5A 3IKVA 2QUFA 4I98B 3ERED 5D8LB 1T6SA 3DFGA 2K86A 4HX8A 3GX4X 4HX7A 2IRFG 1REPC 2HFHA 3VOEA 3L09A 1ONVA 4OIPF 2M45A 4CXFA 5D5VB 1BI3A 3TO7A 3VEPA 1IXRC 1LB2A 3CLOA 4ZH4F 4IHTA 1TQPA 2DK8A 2VT3A 4CICA 2XVCA 2EA2A 3NEUA 2Y0MA 4AIHA 4IRHA 1XB4A 2CSOA 1YIOA 4NQWA 1C0WA 2YPRA 1P4WA 5H6QA 4P55A 1T39A 4OMYA 4BHBA 5E8IA 5E8GA 1OR7A 3BJ6A 1HKTA 1XSVA 2H6CA 3C3WA 1USSA 2FU4A 2YR2A 5HOOA 3IRRA 3WTUC 4BHPA 2IPQX 4A5NA 4D0PA 5HDKA 3D5LA 2WC2A 1HKSA 4ZYGA 4UV8A 3KZZA 1W5TA 2XAGA 3KP6A 2O0YA 3F22A 3E97A 4LMYA 2XIGA 3FWEA 4TV7A
chains in the Genus database with same CATH superfamily
5FLXZ 4CYDA 3JRGA 2KQRA 2V1NA 4I0BA 4RAGA 5BPDA 1UAAA 2LNBA 4O3MA 1RPWA 3E6DA 2E60A 2WY8Q 2QBYA 2OC6A 2PI0A 3Q0WA 3E6CC 1FYMA 3QPHA 1IRGA 1LUJB 2K3PA 5LGNA 1X1AA 3ZQCA 1JT6A 4HSRA 5D5XB 4B09A 1ACIA 2M8GX 3TGNA 4L9NA 4L9TA 2LSOA 2CGPA 1S7AA 3E0JB 3PM1A 2X1CA 2NOJB 2QGUA 1SD5A 3BR1A 4RGSA 2Y9YA 4GCVA 1FIPA 4OAZA 4A0ZA 5IP6A 3GZ6A 1A5JA 1B8IA 5J3LA 1VQ5I 3H3VK 1R23A 1SFKA 1TQMA 4BAYA 4XOTA 2TCTA 4DNCA 5HNHA 1SC7A 3FKIJ 4XLNF 3TEDA 1A6QA 4RM3A 2ZC2A 3LSHA 4D9JA 3O3KA 4MTEA 4M6XA 2G0EA 3V7CA 3JR9A 2BY1A 1YS7A 1XDSA 4UUTA 3E6BA 3LQQA 1B4AA 2ZNZA 1U9NA 2FUG2 5L3EA 1SAXA 3AG3H 2XAQA 2XAHA 4A3EJ 2DA7A 2H8WA 4CDGA 2HVRA 1V4RA 2ZNYA 3ZPLA 3HOYJ 4BBSJ 4UB6C 5JI6A 1FLIA 1IN4A 1OMIA 3HJEA 5CVUA 3ZMVA 1QA6A 2QSGX 2MLGA 3KEQA 2VC0A 5K7HA 3J80Z 3HUGB 2Q1ZB 1UG0A 2BHZA 1J59A 1LEAA 3I56I 2GIVA 3CC4I 2DOAA 3KEYA 2LKXA 1OYYA 4WXDA 4NC8A 4M3GA 2A5YB 3DLAA 1K4TA 1YJNI 2JRTA 4PGGA 1JGSA 2DMPA 4BHCA 2PMHA 2OF7A 1XN7A 3V4GA 3ZGKA 1Y39A 5ILSA 1QU3A 1X2NA 4FE4A 3CUQC 3RYPA 4C3JJ 2ZMEA 4LK1F 2NAZA 3WTXC 3JCUC 1KZHA 3H5AA 2M34A 3I71A 3FMQA 1MJ9A 2RN7A 3S15J 1SMYF 2P7CB 1QQIA 1K79A 4WX9A 3H36A 3C2BA 2YSRA 1ULYA 2E7WA 2NS0A 4YIFA 3GEZA 2ZSHB 4BE0A 4IOCF 1IN5A 2P7VB 3BTLA 3SZGA 4PGHA 3WTVC 3MKWB 2D45A 3KP4A 3K6GA 1R49A 1KU2A 2H1KA 3UR3C 3KEOA 2EIJH 4FX4A 3IWZA 4BXUA 2XB5A 3V8KA 2PX9A 1DP3A 3BY6A 2HS5A 3MD2A 1FTTA 1ZGAA 1SVMA 1VQLI 2X48A 4E7LA 2VE9A 2W48A 5BNGA 4UUSB 2FMYA 1WVRA 1Z91A 4XQFA 2RC4A 2R5YB 3A03A 3LQRA 3AL0B 4M9SA 1HW2A 3GFJA 2XAFA 3BTIA 2ZFWA 2FEZA 4RAFA 3EUAA 5AIQA 4CCMA 5H2FC 2ISZA 4E7SA 3IWFA 2PN6A 1TW2A 2M7AA 5GP9A 3L00A 2CJJA 3WE3A 2EINH 2HTSA 4A0XA 1W5SA 3DF8A 4HQEA 2IGKA 2KJBA 3IAM2 2W24A 4U0YA 3P9CA 3HHHA 1RNLA 3GTOJ 4U7BA 2Y2ZA 1HLVA 3OIOA 4B3AA 3CJTB 3QPTA 1XPXA 1S7EA 5DV5A 3I4MJ 4FCYA 1IRZA 4LLLA 1X4PA 4II3A 3LSJA 1MMGA 3S93A 1FNNA 4OIRF 2E36A 2RVCA 4XICA 3FF5A 3R4KA 1DGWY 2NRAC 2D5VA 2ELHA 2FA5A 3CCMI 2OAZA 1E2XA 2P5VA 1BR4A 2VONA 1WQ2A 2VBXA 2FOKA 1JTYA 1V55H 1BA5A 3H9GA 1ZTRA 4XLCA 1MMDA 2B63J 1WI3A 2MA3A 3HG9A 2KIQA 1SFXA 3BDDA 3DEUA 5L3FA 1X19A 3PJRA 2HOSA 4Z6YA 1UB9A 4HSTA 2XF6A 2QKMB 2Z9OA 5TISC 3MEXA 2MW8A 2JQ7A 4D7MA 1FSHA 4G12A 1MBFA 1ETVA 1XD7A 1W7PB 3QAHA 2A05A 2IAIA 3OYNA 1QBJA 2CUJA 2HWVA 5J4VA 4ZTFA 4RAYA 2VKDA 3I0TA 5HLIA 1YO5C 1B72B 5KNLA 1HBXG 4AYBA 3KIOA 3R60A 1HQCA 4JP0A 2DA2A 4IHSA 2MG4A 5J40A 2GXBA 2ZCWA 1P4XA 3MWMA 2EV6A 3K1MA 1FYLA 1YE9A 3K4BA 3HZJA 2KKOA 4XL9A 1D1AA 1HW1A 4B3XA 2X6YA 3DQVC 3JAMZ 2R7RA 2EZKA 2O03A 3N97A 1QHHD 1ZYRF 1OCRH 4DGWB 3DU6A 3M1EA 4DYRA 4HDVA 1TP4A 1F43A 4BY1J 2X6XA 1ZREA 4N9HA 1DQUA 3HOVJ 4M3EA 4IRGA 1MIJA 2BY0A 2CH0A 2XASA 3OR1C 4UUVA 3A4CA 3FK7A 3RI4A 1T8IA 2ZKZA 1D5YA 3P9IA 4IL6C 3RIRA 4IPAA 2RNJA 4RGRA 1RUNA 1W7PA 5CKTA 4XKVA 1VNDA 3KLOA 4L5JA 3MN2A 3FXUA 2VN2A 2MFZA 1B72A 4DYQA 4QPOA 1FT9A 5HS7A 3TO6A 4RMNA 2A6EF 1ZELA 5HLTA 4OAYA 3FXMA 1F36A 3SFIA 2KMUA 2R4GA 4EJVA 3EYIA 4EM2A 2XGEA 5FB2A 1X4OA 2EFWA 1XG1A 1WI9A 5D6FA 1IAWA 1EKEA 4BQNA 3ABMH 3OYKA 4BDZA 3R61A 2CFOA 2ESHA 3J81Z 2XC7A 4KISA 2F2EA 4Q47A 1X3UA 3BTCA 2DFHA 2L9NA 2E35A 3S8PA 1KU9A 1YW9A 1NK2P 1P7IA 3OSFA 1JUMA 3T8TA 4PJ0C 4HRIA 4LK0F 3ERMA 4YIRX 2A61A 1ITYA 1JI8A 4ZYEA 1SFEA 2HQNA 3DBRB 3WODF 3CMAI 2JWTA 2Z33A 3OMYA 1LFBA 1ZK8A 4HQMA 3TP3A 5F6FA 2EIKH 4I99C 2E2JJ 3GWZA 1J09A 4KDPA 1BJZA 3I64A 1UG2A 3SZPA 4BQQA 1GT0C 3HDDA 4LOCA 5J8CA 1QPIA 3G2BA 3U21A 4P96A 1KA8A 1I1GA 2LC2A 2HXOA 2WADA 3GCMA 1K7AA 2IGOA 2ETHA 1P7JA 1AKHA 2MD0A 2GLOA 3J7AO 2TRTA 2I5UA 2WV1A 2HYJA 1O7LA 3LFKA 1TQIA 1YITI 3ABLH 2L3DA 2L5QA 3WG9A 2KL4A 3I59A 3JW4A 1RESA 4KNYA 2FX0A 2QM3A 1P9QC 2YU9J 2XAUA 2KRHA 2ZMEC 2GM4A 2DOFA 4I0AA 2R7ZJ 5JHUA 2VT2A 4OU0A 4BYYA 4A3IJ 2IA2A 4KT5C 5CLSA 4CCNA 4AIJA 2AQEA 3TKYA 4BEHB 3HOZJ 3EPZA 1U8BA 2LMDA 2XB0X 3FMSA 1BIAA 6PAXA 2BGCA 3HPHA 4M73A 2XF7A 2HI3A 1S72I 3K10A 3FXRA 5M5XJ 3BC8A 3M9AA 3ELKA 4BE2A 1B8IB 2KP6A 2QKLB 2OU2A 5EEAA 1Q1VA 3SJMA 3JTGA 4L5EA 3ZQHA 2NS7A 3HGYA 4KN7X 5BMZA 1ODDA 1TWAJ 2BHYA 2K9QA 4JQFA 2BEOA 3O8HA 2IT0A 3NQOA 1HXDA 3F72A 3P7NA 3VSKA 4QPQA 3EQLF 1KQ0A 2H94A 4A3GJ 3OS0A 1LEBA 4HG2A 4RGXA 4RDUA 3CC7I 2VQHA 3AL0C 3RQ4A 1LKXA 4V2FA 1VQ9I 1LE8A 5GTIC 3RKWA 1KQ9A 1FBUA 2JPBA 1GLNA 2CW7A 5ED4A 3U2RA 4EGZA 2BBYA 1XGOA 3HB9A 3R0AA 1B6AA 3T1BA 1G4DA 1V54H 2X51A 2A3SA 4BXFA 4EJUA 1R36A 3HUGA 3LA2A 3CO7C 3ZQLA 2GQQA 1U3EM 4GO1A 4C30A 4HDUA 1OKRA 1G59A 3S1NJ 3M8EA 1S29A 3T0YA 1Y8RB 2JA8J 1GVJA 3J7AY 5DCMA 3HXLA 2R7TA 3A0HC 3OYMA 4HNUA 1WJFA 5CQEA 3QQAA 2XRNA 2KIFA 3OYCA 4MQVA 1RKWA 2VPLA 1FTZA 3ZOBA 3FMRA 4A2UA 5CJ9A 3WTWC 2Z16A 3HIFA 3BR3A 4KIGA 4E70A 1X3ZB 2O3FA 3DXJF 1FC3A 2E5NA 2OCCH 5M5WJ 1ON2A 2G7HA 4UB8C 5DDGA 1H8AC 4F92B 1IV8A 1S9HA 4HF1A 4U7DA 5EGOB 3A01B 4HF0A 3D1NI 1TL8A 2VJIA 3TDZC 2MBFA 1FY7A 2DT7B 2MH9A 5CVIA 2GBYA 3EUHA 3S1MJ 4II2A 3Q5FA 2UV1A 2IS6A 5GPAA 1JJ6C 3Q9VA 4U88A 3WGGA 1TWFJ 1YW7A 1E3HA 2LF7A 4LG0B 3U1KA 2YU3A 2KIUA 1M1EB 2A69F 3CP2A 5IYDJ 2WAEA 1YJ9I 3K4JA 3CCVI 2VL8A 2CFXA 2R0QC 2K27A 2CRGA 2XGDA 3GLLA 2CS3A 3F9KA 4HEA2 2HNHA 4BU2A 3DPLC 1Z3YA 1IDYA 3JRFA 3RKQA 2P6TA 2E2IJ 4FETA 3B73A 1XMAA 4YFNF 5JVGF 1MH4A 1IG7A 4IRIA 4Y33A 5E20A 1POGA 1SMTA 2DODA 2WB1N 3ZQ7A 2BY3A 1U5TC 1RKTA 3CCSI 2EV5A 2L7MP 2VE8A 2LG4A 4EQQA 3S17J 1IJWC 4FX0A 5C3EJ 1Y6IA 3KPHA 1KGSA 1ZARA 1FP1D 1VQKI 2IA1A 1DPRA 1BL0A 1ETQA 4OWRB 3CJRB 4S04A 5E3NA 1R22A 4AVZA 1LVAA 1T56A 4NHJA 3R0JA 4EGYA 1TZLA 4D5FA 1LDJA 1SAUA 2STWA 1T0FA 3QU3A 3H0DA 2DU9A 2JZYA 2QBYB 4YIIA 1DGRM 1R5HA 5JR3A 1OCZH 1TNTA 1S5LC 2FOWA 2XGCA 5E18F 3COAC 4PCQA 2L4AA 3DU5A 2MABA 1MBEA 5HS9A 1NH3A 1MDMB 5IYBJ 3HC7A 4ZYDA 2DMNA 2VJ4A 9ANTA 3HOXJ 1R71A 4HA8A 4AUXA 3S14J 1ERDA 1K61A 2Y31A 4RM2A 3CCUI 2ICWG 3F8CA 3JSPA 3HSRA 2VC1A 3OIPA 4M3FA 3LNQA 5FLVA 1FOWA 3CCYA 4HX4A 2L7ZA 4F55A 3H9QA 1O3QA 3H0GJ 3TW7A 2Z3YA 3KYLA 3AG1H 2A07F 4AIKA 1HCRA 1U5TA 4A93J 2K02A 4YRVA 4A3DJ 3BP8A 3W6KB 2MC4A 2E1OA 5LHIA 2LH9A 3FIWA 3SQNA 2ADUA 2O6GE 1IXCA 1I3QJ 3KCCA 3PNYA 2CUZA 4LLGF 4DOZA 2I10A 1OJLA 2X1EA 3LSRA 1TLHB 4IHVA 1OQYA 4AM3A 3PIPF 3E5XA 4JK1X 5LLQA 1QGPA 4EV0A 4HPQA 1MDMA 4IOAF 2JJ7A 4I6ZA 1EA3A 1W4MA 4XONA 3C2GA 2ID3A 3H5RA 1MGTA 2ME0A 2ME6A 2Y48A 4ZYHA 3K4NA 1YIJI 2K4JA 3I4PA 3CC2I 3HKZN 1MZBA 3E7LA 2ESNA 5CVRA 3ECOA 2HZTA 5EEHA 2RQPA 1PUFB 3KLNA 2VODA 2IVMA 4S05A 1BR1A 3ULQB 5C44J 2R92J 4C2UA 1V5FA 1WH7A 3DTIA 3JSOA 5TRDA 5HLHA 2HYFA 3BCAA 3IRQA 4BUPA 3OYGA 4DJAA 2IS4A 1T33A 4Y15A 3N05A 3BR5A 4D7NA 1D1BA 2FSWA 5KAIC 4MQ9F 2DDAA 2B7EA 3RKXA 2DXIA 3M07A 4QSHA 1KYZA 4M3DA 4CYCA 2QF7A 2EH3A 2DPDA 4B8XA 3GTKJ 3ZQQA 3FXJA 3KX2A 4Y13A 4Y4RA 4XSXF 4BL0B 5E3OA 5F0CA 2BXZA 2K4BA 3BZCA 1CF7A 4XKWA 4MEYF 4B43A 2H8RA 4QTRA 3W3CA 3S3MA 5JFRA 1ZRCA 1IUYA 3LA7A 4G6QA 1KONA 5FROA 1MBGA 1IDZA 3F8NA 2OBPA 4EM0B 4PZJA 4FHTA 2GOXB 2O8XA 1UHMA 2F5DA 3HOUJ 1ZAOA 2LY2A 4BJ5C 2V6EA 4IHWA 1APLC 1RR8C 5B1BH 4BACA 5IOZA 3S2HJ 1UELB 1ETYA 2Y30A 2W82A 1Z1DA 5K5OA 3G71I 2EA4A 3GTLJ 3KP5A 1FMWA 5LGUA 5EJCA 2IEKA 4RB2C 4U0WA 1O3TA 3G3ZA 5DEQA 3HYIA 4H4KC 1YQAA 2AO9A 1PP7U 4ZDPA 2M2EA 2LBFA 4PFPA 3VSLA 5IT3A 3DTEA 4YEJA 2V1DA 4MHGA 3KETA 4LIVA 2D1HA 4YG2F 1E3PA 3IL2A 3SZTA 5IP9J 2BV6A 1UHWA 5L3BA 1FBSA 2VOOA 3I4NJ 3FDYA 4A6DA 1VQ8I 1DPUA 1MJAA 3IHUA 1YX3A 3A2KA 1VI0A 2Y0SN 4MIMA 4KN4X 2R7FA 1WZ2A 2WAQN 2WAQA 2P81A 4KJZA 5DTDA 3IAS2 3ZQGA 3DLLF 3CZ6A 5TJJA 3IP4B 1K83J 4XM3A 1WFXA 3GMEA 2JTVA 1JXSA 1TTYA 2RQQA 5D4SA 2V1UA 1XC5A 2M8EA 2R5ZA 4UNOA 3RQIA 5F08A 2ZJPF 2F5VA 1A04A 4RGUA 3OOUA 1ENHA 2R7VA 4CCJA 1EV7A 3BG3A 4A3LJ 4CCOA 1ETKA 4HF2A 3V7RA 3VYRB 3CCQI 1D0ZA 3BQZA 3F0CA 3IC7A 1Z6TA 1N25A 1D0XA 1YJWI 3WU1B 1G2HA 5LRSA 1P6RA 3J80K 2HDDA 3EETA 2LRDA 2HGCA 3AAFA 1I27A 2HPMA 1FBQA 2W1OA 3BT9A 4UHTA 3MKZA 1G3YA 3HM5A 1T38A 4M74A 3D5RC 4BBRJ 1D1CA 4A3BJ 5L3DA 3Q0VA 3MZHA 1B1BA 5ICCA 4C3IJ 1BC8C 1GV5A 4BGDA 2LR8A 1LFUP 1DP7P 1Z0XA 4U87A 3PUFA 3E3VA 3S3NA 3LSGA 1ETXA 2HTJA 3KP7A 1R1UA 2O9LA 4O6JA 1NTCA 3TQNA 5JLXA 3I53A 2CUEA 4F3QA 4ETSA 1N75A 2FRHA 1RC9A 1HDDC 3ZP5A 3QPSA 5K5QA 4ZTJA 1QZZA 2CYYA 2EFNA 3AFHA 3KZIC 3VYUB 1E0EA 1BOAA 4GRIA 3AG4H 1XSDA 2JRMA 4HLYA 2XHKA 5JHFA 5EGOA 2NVYJ 3A01A 2W25A 3LSMA 5IT9Z 2KIMA 3F8BA 3NARA 3DCFA 2RKHA 1IO2A 2VASA 5DS9A 2DO7A 2CQXA 3FISA 2EILH 5E1XA 2WA0A 5AIPA 2IJLA 2Q8KA 2M4GA 3I3LA 4P9UA 1K6YA 1XX5A 2E34A 3CDLA 4LFUA 1UCRA 1TBXA 4LIUA 4B48A 2VQLA 4LG0A 2H09A 1O4XA 1IC8A 2CV1A 1J9IA 2CQKA 1B59A 4BJTA 4IX7A 2Q2EB 4LJZF 1ETWA 2W4SA 5CYVA 3ABUA 2WWYA 4XSZF 3QWLA 4N0BA 4CA0A 3V42A 3LL7A 1WH5A 2L9RA 2P8TA 3WGHA 2NNNA 3AKZA 3HL2A 1Q1HA 4MEXF 3ECHA 4EM1A 5J47A 3HRMA 5B66C 2O61A 5F0FA 4IEJA 1YLFA 4B44A 2F5FA 4E7JA 2EK5A 1A6IA 2Z2SB 2FE3A 3RSNA 4HV5A 2E5ZA 3FX3A 3FHZA 1IUFA 2RNGA 4CZCA 1WJDA 4C2MJ 1IRFA 3K4MA 3GBGA 5DUKA 1GVDA 4XLFA 3PIOF 1BIBA 4PJNA 2X0LA 3DPTA 3KZYA 3EUKL 4Y52J 3LWFA 2E7XA 1TWCJ 5HS8A 2X1DA 3Q3SA 1I3AA 5EZHA 2OTLI 2CU7A 3CDHA 3P9KA 2KDZA 1ZGJA 1OCCH 4F91B 5J8FA 1X1CA 1SVLA 2VLAA 4MTDA 5C4JJ 1VQOI 2BZTA 2V7FA 4OOIA 1FZPB 2VBWA 2E1CA 2ELJA 2CG4A 5JLWA 2R7SA 5KK1A 2VPRA 3CCRI 2JUGA 2OUMA 2P5KA 3R6SA 4BNCA 4CCKA 1S7OA 2VQCA 4PJLA 2HEOA 1DU0A 4LLNA 2HZDA 2MC3A 5GAHJ 1RZ4A 3FXLA 4Y3OA 1W1WE 2WAFA 1B9MA 5K1YA 4I76A 1SFOJ 1X3WB 4WXHA 5ILUA 5KAFC 2NXNB 2EZLA 2K9SA 2J5OA 3O8GA 4DBRA 2ELKA 1U5TB 4D1QA 2JSPA 1CGPA 3G4SI 2CW0F 5FGMA 5HNFA 1H9TA 1R6RA 1U2WA 1JT0A 3JAMK 4E7HA 1BBYA 1FIAA 3FM5A 3E1SA 3D5SC 4WXCA 3T5XA 4EATA 4HNVA 3M1CA 2VXZA 4MFEA 4MO7A 1VQNI 4KMFA 3V8JA 2JT1A 4AD9A 4RB1A 4RA2A 4IKFA 5E1WA 1HOMA 2I8DA 3GFIA 2DK5A 3NWTA 2HR3A 3BQYA 3QU6A 3CLQA 4GGGA 4XN3A 2KHMA 5DCFA 3KYDB 4G7OF 3CUQA 2AXLA 5ICGA 3ZMDA 3BG9A 1H0MA 3FXKA 2DTRA 1G3SA 1JHHA 1PVEA 4M71A 3J7YJ 3MZYA 3S1QJ 2CQ7A 2C6YA 3BPXA 1J2XA 3CCEI 1R4MB 1MBKA 3J81K 1I6HJ 1JTXA 3RZOJ 2KPMA 4IHYA 2EIMH 5EG0A 3ZQFA 4Q48A 4XRSG 5F27A 3H3UA 1BM9A 2EBIA 2FNPA 2A68F 2RGVA 3WHCA 1BC7C 1XDUA 2L0KA 3M3YJ 1R1TA 3BROA 1P92A 5DUIA 5IPAA 4WK8F 4J00A 2WV0A 1VF9A 1Z9CA 4F7ZA 1RUOA 1DDNA 1FMVA 1UHSA 3OYIA 2K40A 1WPKA 2N8GA 1V5EA 1FSEA 1WRJA 4BS9A 2QSHX 2R7OA 2G7UA 3S2DJ 4BKXA 4EJTA 2GXGA 3HTUA 1OISA 5IT9K 3OYFA 1PUEE 4BQAA 1EJ9A 2W57A 3FZVA 1WJAA 4WCGA 4RB0A 3WHBA 4N9IA 4L0YB 3WTSC 2HDWA 5HVQC 1MMNA 1OYIA 2W84A 3GTJJ 2V1XA 2LY9A 5A2QK 1XMKA 3I5UA 3OYLA 2R7DA 2EZHA 1P4AA 4P5OA 3X2QH 4ZYAA 3WU2C 3QODA 2LKPA 5IOYA 3W2AA 4A0YA 2GZWA 3BJAA 2DQRA 1S3JA 2HPIA 2HQRA 4NC7A 1QRYA 2FNAA 4YELA 5J1UA 3TOBA 1JUSA 5GAEJ 2VIXA 1FP2A 2XPVA 1MKMA 1G8XA 3Q9SA 4BDYA 3LSPA 1TWHJ 1I50J 4G94A 2DAOA 1AU7A 3WE2A 2KRCA 2JA6J 3A0BC 2XSDC 4PJMA 2EB7A 2M7BA 2OD5A 2JA5J 4L18B 2R7QA 5D5WB 2DMTA 3LSIA 3MCZA 1HSTA 4AVPA 2ZB9A 5DM7F 2H27A 1MBJA 5J1RA 2CMPA 4LB6B 4FASD 3F23A 4BE1A 4OINF 2HOEA 4XLAA 4DBQA 1YI2I 5D5UB 3K1NA 1TC3C 3W6JB 3QPLA 2CQNA 1WJEA 4I01A 4LITA 4HZFA 3HGGA 1NG6A 4P1WA 2VBYA 2K7LA 3BG6A 4B1RA 4X0GA 1VZ0A 3HOTA 3HPGA 1VQ7I 4DZPA 4AYBN 4B47A 2GWRA 3M8JA 3REOA 2CWEA 3U1DA 1WJBA 1YFHA 5LHHA 1ZGWA 4ZC3A 2HDCA 2R5ZB 5FKKA 3CTAA 3F6VA 1ZR4A 3D0SA 4BY7J 4AWXB 1O3RA 2IA0A 2PG4A 2MH2A 2AQFA 3F8FA 4XN0A 1VFCA 3PO2J 3L2VA 5LFAA 2DW4A 3SYTA 2PJRB 2Z5UA 3K70D 4A5MA 2RREA 3PO3J 2DMQA 1QVUA 3I9V2 1IN6A 1Y8QB 5BOXA 3OV8A 1H9GA 3C18A 4XNFA 3UKGA 4G6DA 5ICEA 1GDTA 2O8KA 2EQRA 3K0LA 4RBOA 4V19K 4CGZA 2ECCA 2OPTA 2Y69H 3AG2H 1IZ1A 5EF6A 1IV6A 3L7WA 5JVTA 1UMQA 3DKYA 3GTPJ 3BLYA 3C2HA 5DYMA 1KQ8A 3RJPA 1MJBA 1TT5B 4WWCA 5ERIA 2JUCA 1MD0A 2FD5A 1R58A 2M0CA 4M9ZA 2OTJI 4HYEA 3S32A 4A3JJ 3F21A 2ZXIA 2YX4A 3RPUA 3S3OA 5FLMJ 5E17F 4JBAA 2VXDA 3RPUD 3IH3A 2D1VA 5HDGA 4CCLA 4EJOA 2BW3A 1WHUA 4RLQA 2PJRA 3FK6A 1IN7A 4I09A 4IHXA 2LF8A 2DPUA 4QWQA 2PMZA 2V9VA 3H5NA 3CF5F 3DWLE 3PFIA 5HODA 1Z21A 2DLLA 4FT8A 1EH7A 4FE7A 3S16J 1QO0D 1R1VA 5FJ8J 4PDKA 2M4KA 2DA5A 3GZNB 4X6AJ 4G6TB 1F1ZA 2M3AA 1K78B 1WWXA 2H1LA 4OIQF 3EYYA 2IBDA 1SD4A 4G7HF 4XLHA 4CYCB 2ZXWH 2L9VA 3DEWA 3NWSA 2OCEA 2UXNA 1FJLA 3PQJA 3N4MA 2PQ8A 2CW8A 1CF7B 1SEUA 1I39A 5CPRB 3OYDA 2LD5A 1TWGJ 4E6KG 2EPFA 2KDOA 2V9PA 2PLYA 2QQAA 3DP7A 1WJCA 2KISA 1QZEA 5LHGA 4HNTA 2K9LA 2FQ3A 1P2FA 3LA3A 3OOPA 2E2HJ 4OIOF 2F6CA 4KUMA 2B9SA 1K4SA 3SEQA 3FXQA 4Y17A 2L54A 1MBHA 2R7XA 2DFIA 5A2QZ 4RAZA 3HBLA 1K78A 2BY2A 2UXXA 4XRSA 4K2EA 3TOAA 3HKZA 3K2ZA 4IXAA 3KE2A 3PL8A 2LK2A 3CJQB 2STTA 4R79A 1R00A 1I5ZA 1UZCA 4ESFA 3O6BB 4XOPA 1W36C 3F6OA 2DT6A 2QA4I 2BVLA 2DCEA 3HSFA 1Z3XA 4OMZA 2ECBA 3MKLA 1HKQA 4E7IA 4FQGA 4E4HA 3HRSA 4HLXA 1ZG5A 4NUBA 3HOWJ 3BOQA 5J6XA 1I6XA 1SD7A 2DBBA 3G1OA 2PMUA 3W2WA 3FBNB 2CO5A 4PK4A 5K7FA 2R5YA 3GTGJ 4JX5A 4UVCA 2LOOA 1R5ID 4U0VA 4L9VA 4YFXF 5DCMB 4LGWA 1YRNB 2KFDA 3NAUA 4IJAA 2HQAA 3KFWX 2JPCA 2XROA 3B02A 3BG7A 3HTSB 1FWZA 3L2QA 1WJ5A 3CESA 2BVMA 5L3GA 1CQTA 1DU6A 2ZXHA 2XDVA 5FKMA 2DDBA 1K6OA 3OYBA 1U9OA 3SDGA 2P5LC 4KIBA 2GAUA 5B5EC 2LTPA 5FRNA 4GDFA 1BI0A 1ZRFA 1ZRDA 3RKYA 2X4HA 1O7FA 5GADJ 4GYGA 3W2VA 5BQTA 4XKCA 2Y75A 4RB3C 2V26A 3L2RA 1PJRA 3WG7H 2GOMA 1RIOH 4N4NB 3BR2A 2NNYA 2IP2A 3H35A 4ANJA 3EDPA 3J7ZI 3A1YA 1X1PA 1YW8A 3MQ0A 3VPRA 3ZN0A 2W00A 1FOKA 3GFMA 1BN5A 1J5YA 3CDIA 1XCBA 2RAEA 2V4JC 3BJOA 3SHFA 1A36A 2M9HA 4KT6A 5EG0B 4XRMA 1JE8A 4Q4ZF 2OA4A 3QYFA 5KHDA 2QVOA 2O5RA 2DT5A 2LVSA 1AOYA 2V79A 1MSEC 2QCOA 4JOMA 4IF4A 2OQGA 2QSFX 3TMOA 4IO9F 1S6LA 2GXAA 5ICFA 1XCVA 5IYCJ 4GXOA 1TNSA 4MFDA 3U9GA 3F3XA 3HHGA 5F1JA 3LAPA 2EJRA 1XS9A 3DPUA 1ETOA 3V8LA 1I1SA 3SFZA 4KMUX 5F64A 1O3SA 4NQWB 4FTHA 5DD4A 1V5GA 2WB1A 3IH4A 1T08B 3GUDA 1H88C 3O2PE 5EDNA 1BI2A 2P0WA 3DEEA 4LG3A 3LSKA 1MNMC 2L7FP 4QLCU 1R4NB 4IZZA 1FOXA 2KLOA 5FKNA 4F52A 1RETA 4ENNA 3L2UA 3HEFA 3JRIA 4R8HA 4EJWA 2M5WA 3OYJA 3BZ6A 2X6WA 2XKOA 2NVUB 2R3SA 4AIDA 5ILVA 2P4WA 3LAJA 2VB6A 4M3BA 4H0EA 1IN8A 1X2MA 1Z77A 5K7ZA 3RYRA 2BE5F 2HOAA 2OJED 2XPUA 4XLPF 3OYHA 3ZMUA 2OV7A 3L9FA 1IGNA 5M5YJ 1A35A 2B0LA 2UUZA 5FD6A 5LD2C 5GAGJ 2ZBKA 1TW3A 1UJ8A 2DYRH 3NRVA 3MKYB 1JHFA 5M3FJ 2ACJA 3OWTA 3Q0UA 5J4YA 2PJPA 1D0YA 1HW5A 2ID6A 4V2GA 2A6HF 1ZLKA 2E71A 4ENKA 2HOTA 2CQQA 4GFBA 4CO8A 2LYCA 5IY5H 2Q0OA 2M87A 2M1BA 2HU9A 5J1YA 3CD6I 3ASOH 5B3SH 3C1DA 3CMMA 3VYSB 4CZZA 3I55I 4XMYA 4NB5A 2F5EA 2PMZN 2L2OA 1BJAA 1LPQA 3ZMSA 2FJ1A 1TT0A 1LNWA 4G9YA 5EEGA 4X1EA 4DIQA 1QNTA 2NVQJ 1ZH5A 3ML6A 4HAMA 3ZMZA 5F0HA 1ZHFA 4KA4A 1LFPA 2E1MC 2E19A 4W1UA 3WU0A 3ZCOA 3ZQIA 3L2CA 1AWCA 2VUMJ 1XSXA 1YOVB 4L5IA 3F8MA 2PBIA 3GFLA 4ENMA 3PQKA 2LP0A 2PEXA 1YTYA 2EZIA 3VODA 2Z99A 3BPVA 3QOPA 1XMXA 4HV6A 3M8FA 4PUSA 3K70C 2JVHA 2QQ9A 3IH2A 2OZUA 2VJJA 1LDKB 5BPIA 3MAJA 3TW6A 3ZN1A 3CP8A 3KYCB 2UZKA 2JVGA 2KT0A 1ZQ3P 1Y1WJ 3CO6C 3JRHA 1OR7C 3JTHA 3BCBA 1W7PD 1ZLJA 5FFZA 1PYVA 3VDXA 4Y7NJ 3QP5A 2EFOA 1WSUA 1OPCA 1IF1A 2Y0SA 2FF4A 4PSWA 3BR0A 3S2WA 2X6OA 1X58A 3DBLB 3ZRGA 4ABZA 3B6CA 4G8XA 1G3TA 5LEKA 2DA1A 1O57A 4HW0A 4BEHA 1VQ4I 1MW7A 3SXYA 1OCPA 1W5CC 2L01A 1QZYA 1X1BA 2X85A 2UWMA 2J5PA 3C7JA 1JKQC 1ZR2A 2QLZA 1MNDA 5E3LA 1NK3P 2HYGD 4J01A 3VFZA 2BW3B 3FBIB 4NC6A 2QEXI 4MGRA 2OQRA 3DBHB 2IW5A 1J0RA 3ONQA 2H6BA 1J7KA 5LEJA 3MFKA 3MZ8A 2COBA 3HRUA 4C3HJ 2FXAA 2VI6A 5GPCA 4UVAA 1BI1A 2DN0A 5GTHC 3UNGC 2EFPA 2CV0A 2CUFA 4I2OA 3VB2A 2F5CA 2LDUA 4CHUA 2FQ4A 2QENA 4JYKA 4LD5A 5F04A 3ZMTA 5E3MA 1J75A 2MSYA 2KJCA 5EYRA 2GA1A 4J19A 1T2KA 1H89C 2ZXJA 2IS1A 1ON1A 3GYHX 2LY1A 1GHCA 1XGSA 1T98A 4BXXJ 2XRLA 2YX7A 3H92A 2LKSA 1LJ9A 2LBFB 5FFXA 4A6EA 2W85A 1JKPC 5E1ZB 4UY8I 2XV4S 4AC0A 1XGMA 2FBKA 3B6AA 4IVNA 3G1MA 5HLGA 2L9SA 2MGQA 1XGNA 3I54A 3ZR8X 2QYOA 4MLOA 5D6EA 4EVIA 4BQOA 5K5RA 2QZ8A 5DM6F 4MNUA 3WTYC 1N78A 1N77A 1U0JA 2AXTC 4RLFA 3RTRA 3BWGA 4DQ2A 3KP2A 2X9DA 3E5QA 2TDXA 3V7SA 2L4MA 3VWBA 2NS8A 3JREA 3CMYA 1Z7UA 3LMMA 4JX6A 3RPQA 1KU7A 4ENJA 2LFBA 2YUSA 4BJ6C 1NG7A 1OCOH 4ZZDA 3GF2A 4ZDLA 3TL4X 1RI7A 2ZO4A 1D8KA 4NBQA 3OS2A 1WKMA 5FRMA 3K1PA 3WTTC 4W97A 3GVAA 1FX7A 1LQ1A 1HSJA 3GO5A 3GZ5A 3RCOA 1PP8F 2E1NA 2BXYA 2FBIA 3M7GA 3OL4A 4RS8A 5F1RA 1SD6A 2XF5A 2WBMA 1MNEA 1QHGA 3K9TA 2XUBA 3PNTA 1Z7LA 2K85A 2KRFA 3L2WA 2DI3A 2VQGA 4XLEA 2IGMA 4A3FJ 3TO9A 5H6RA 1BW5A 1KYWA 3T8RA 3DKWA 2AS5F 3ROUA 3OS1A 4DZJA 1NHAA 2EV0A 4GYIA 5LBQA 1AA7A 1HA8A 1G6NA 3HOSA 4UVBA 3OYAA 1B9NA 2ZSIB 5E79C 1MMSA 1JUPA 3BZKA 5FO5A 5H20A 2M0MA 4ASNA 3W6VA 1D5VA 3K69A 2EFQA 2G9WA 1U8RA 1GUUA 1JGGA 5C4XJ 4UXNA 2BOLA 2HVQA 4N4OB 2WY7Q 1Z05A 3QOEA 4KIFA 3H1CA 1U78A 3E5UA 3M4OJ 2XKPA 1BR2A 2A5WA 5B1AH 5CVJA 4XKBA 1QPMA 2IGNA 2WTEA 1BW6A 4E7KA 2XSJC 2MYSA 1AHDP 2IXSA 1VQ6I 2R7UA 2GA2A 3H9JA 4O5VA 2V9KA 3BG5A 5CVVA 3CF2A 3EUHC 1IXSB 2A6TA 4YFKF 3S1RJ 2F48A 2XAJA 5D4RA 4ESJA 2ZFUA 1VTNC 1RRJA 1YG2A 2ZJRF 3RDIA 2HKXA 3PSIA 1R5GA 5DD8A 4EEFG 5IP7J 2DFFA 2R93J 1FPQA 2COMA 1HDPA 5FD5A 1G3WA 1KU3A 2O7OA 4L0ZB 1PDNC 3PUBA 2Q2EA 2PFBA 4P9FA 4C2TA 1S8NA 4KYWA 1OLTA 1SANA 3FM3A 3ZXSA 1F4KA 1YX5A 4EMSA 3QP6A 4DYCA 1D8JA 3HRTA 1EH6A 4ZDOA 2DOEA 3P5JA 3OY9A 3QRFF 3H3ZA 3GW2A 2NVXJ 5AONA 2F4MB 5BS6A 4A69C 5LGTA 2DTZA 2L7KA 2HQ5A 2ZJ2A 4I02A 4XBFA 3IV5A 1W0UA 4PJJA 2VOPA 4XIDA 3OYEA 1RR7A 2JSCA 4G7ZF 2V6CA 5CQGA 3CUOA 2ZMEB 4I7HA 4KICA 3G1LA 2L02A 1Y0UA 2RDPA 4BH9A 5FKLA 3CMEI 4A12A 2VKEA 3A02A 4NNJA 4C9YA 3K7AJ 5M3MJ 1UFMA 4M72A 4ON0A 1STZA 1MSFC 1ORKA 3MMYB 3FXOA 3L1PA 4A3KJ 2QWWA 2JK3A 1YHQI 3ABTA 3E6MA 2BYVE 5KCMA 2MLKA 2DMUA 1QVTA 1F5TA 3SEZA 3SDBA 1PUFA 2RV8A 3WTZA 4IQ4A 2M30A 4F93B 3G73A 1L0OC 3G6EI 1EH8A 2EWNA 2Z1DA 5KVRA 1E17A 4ZZLA 1YYVA 2DQLA 1X1DA 1BOBA 4ZJZA 1SFUA 1GXQA 1IW7F 3GLXA 4UUSA 2LREA 5HDNA 3GXOA 4CSWA 3CCJI 5FLXK 2VKHA 2XGXA 2ZJQF 3FHNA 2HKOA 3TDUC 4IQJA 2VJ5A 1WGXA 3WGIA 1JJ8C 2YS9A 4HBLA 4UV9A 4A3MJ 4Q5SF 3I59B 4CH7A 2W7NA 1Y56A 4L9JA 3ISPA 4ESBA 2D2WA 4QIWN 3KP3A 1Y1VJ 1L3LA 2NYXA 4HOBA 1FOYA 1A31A 3K4CA 1ZG3A 3DTKA 1USTA 4KFCA 1F9NA 5D8KB 2FMLA 4XORA 1D3YA 1GXPA 1LDDA 3QYEA 4M9XA 3HSEA 4D5CA 1HC8A 3I58A 1R7JA 4XK4A 4WF2A 1U6GA 3DV8A 2KZGA 1OCTC 4M6YA 2FBHA 3IKTA 2VBZA 3VYTB 1OFCX 3IUOA 4Z2YA 1WCMJ 1ZN2A 1OYWA 1T95A 1Z6RA 3TP0A 3CUQB 3K4LA 2P6SA 5LRRA 4R1HA 2OZ6A 2K3FA 4PFOA 1YRNA 2HXIA 3LSTA 1YS6A 5L3CA 1JKRC 2QQBA 1DUXC 1ZG1A 2DYSH 4XRFA 2KZVA 1V3FA 4KITB 1MH3A 3CJNA 3PSFA 1LE8B 2JA7J 1ZKGA 1T0FC 4LB5A 5TGTA 1FYKA 4A3CJ 3OIQA 2ISYA 2MD5A 3IKVA 1R9TJ 2QUFA 3QYBA 4I98B 3DKXA 2DA4A 2E1MB 4DW6A 3PNVA 3ERED 2K9MA 4JX4A 5D8LB 3JRDA 1T6SA 3DFGA 4AU7A 2K86A 4HX8A 3GX4X 4HX7A 2IRFG 1REPC 2HFHA 3VOEA 3L09A 3CCLI 1ONVA 3GTQJ 2K5CA 4OIPF 2M45A 3ABKH 4CXFA 5D5VB 1E3OC 1BI3A 2DJNA 1Y0NA 2GIZA 3CQZJ 3RZDJ 3TBIA 3TO7A 2JA2A 3VEPA 2QQ8A 3PFYA 1IXRC 1LB2A 3CLOA 4ZH4F 1MMAA 4IHTA 1TQPA 2DK8A 3BR6A 2VT3A 5FKOA 3OSGA 3K2AA 3FKJA 2DA6A 2XVCA 2DA3A 2EA2A 4CICA 1HF0A 3GTMJ 3LFUA 2Y9ZA 3NEUA 2JMWA 2Y0MA 1SVOA 4AIHA 4IRHA 1FEXA 1XB4A 2CSOA 1YIOA 1VQPI 1IRXA 2F4OB 1Z67A 1JKOC 2LLKA 4NQWA 1C0WA 2DFEA 2YPRA 4E7ZA 2CV2A 1P4WA 2K9NA 5H6QA 4P55A 4S0HB 1T39A 4OMYA 3ASNH 4BHBA 4PSXA 5E8IA 2F4IA 2NOGA 3MVPA 5E8GA 1OR7A 2VKVA 3BJ6A 4CUGA 1HKTA 1XSVA 1EF4A 2H6CA 3JRCA 3C3WA 2AHQA 1USSA 2FU4A 2YR2A 5HOOA 3IRRA 1XTAA 1W0TA 4ITVA 2R7WA 3WTUC 1W36D 4BHPA 5EZGA 1VQMI 2IPQX 3OR2C 4A5NA 4D0PA 5HDKA 2IS2A 2HVSA 3D5LA 2WC2A 1HKSA 4ZYGA 3OL3A 3LOCA 4FISA 1LVKA 4UV8A 1GV2A 4XR6A 2DJIA 4B4CA 3KZZA 4NDLA 2NVTJ 1W5TA 2XPWA 2XAGA 3BTJA 3KP6A 2O0YA 3F22A 1AKHB 3E97A 3K4KA 4LMYA 3JRAA 2JN6A 2XIGA 3FWEA 4M6VA 3ESWB 3JRBA 4TV7A
chains in the Genus database with same CATH topology
5FLXZ 4CYDA 4I0BA 5BPDA 4O3MA 2LNBA 3E6DA 2QBYA 2PI0A 3E6CC 1FYMA 3QPHA 1IRGA 5LGNA 5D5XB 4B09A 3TGNA 4L9NA 4L9TA 2LSOA 2CGPA 1S7AA 1SD5A 4RGSA 4A0ZA 4GCVA 3GZ6A 1R23A 1TQMA 4BAYA 4DNCA 4XLNF 3O3KA 4MTEA 4M6XA 3V7CA 1YS7A 1XDSA 3E6BA 3LQQA 1B4AA 2ZNZA 1SAXA 5L3EA 2XAQA 2XAHA 4CDGA 1V4RA 2ZNYA 3ZPLA 5JI6A 1FLIA 1IN4A 1OMIA 5CVUA 3ZMVA 2MLGA 3KEQA 2VC0A 3J80Z 1J59A 1LEAA 2GIVA 1OYYA 4WXDA 2A5YB 2JRTA 4PGGA 1JGSA 4BHCA 2PMHA 1XN7A 3V4GA 5ILSA 3CUQC 3RYPA 2ZMEA 4LK1F 2NAZA 3WTXC 3I71A 3FMQA 1MJ9A 2RN7A 1SMYF 2P7CB 1QQIA 1K79A 4WX9A 2YSRA 1ULYA 2E7WA 2NS0A 4YIFA 3GEZA 1IN5A 2P7VB 3WTVC 2D45A 4PGHA 3KP4A 1KU2A 3KEOA 4FX4A 3IWZA 4BXUA 3V8KA 3BY6A 2HS5A 1ZGAA 2VE9A 2FMYA 1Z91A 2RC4A 3LQRA 4M9SA 1HW2A 3GFJA 2XAFA 2ZFWA 2FEZA 5AIQA 2ISZA 3IWFA 2PN6A 1TW2A 3L00A 3WE3A 2HTSA 4A0XA 1W5SA 3DF8A 4HQEA 2KJBA 2W24A 4U0YA 3P9CA 3HHHA 1RNLA 4U7BA 3QPTA 5DV5A 4LLLA 1FNNA 4OIRF 2RVCA 3FF5A 3R4KA 2NRAC 2ELHA 2FA5A 2OAZA 1E2XA 2P5VA 2VONA 1WQ2A 2VBXA 2FOKA 2MA3A 1SFXA 3BDDA 3DEUA 5L3FA 1UB9A 2Z9OA 3MEXA 1FSHA 1XD7A 1W7PB 3QAHA 1QBJA 2HWVA 4RAYA 3I0TA 5HLIA 1YO5C 1HBXG 3R60A 1HQCA 4IHSA 2GXBA 2ZCWA 1P4XA 3MWMA 2EV6A 3K1MA 1FYLA 2KKOA 1HW1A 3DQVC 3JAMZ 2O03A 3N97A 1ZYRF 3M1EA 4HDVA 1ZREA 4N9HA 4IRGA 2XASA 4UUVA 3RI4A 2ZKZA 3P9IA 3RIRA 4IPAA 2RNJA 4RGRA 1RUNA 1W7PA 3KLOA 4L5JA 3FXUA 2VN2A 1FT9A 5HS7A 3TO6A 2A6EF 3EYIA 4EJVA 4EM2A 5FB2A 2EFWA 1WI9A 5D6FA 1IAWA 3R61A 2ESHA 3J81Z 2F2EA 4Q47A 1X3UA 1KU9A 1YW9A 3T8TA 4LK0F 2A61A 4ZYEA 1SFEA 2HQNA 3WODF 2Z33A 4HQMA 5F6FA 3GWZA 4KDPA 3I64A 3SZPA 5J8CA 4P96A 1KA8A 1I1GA 1K7AA 2ETHA 3J7AO 1O7LA 3LFKA 1TQIA 2L3DA 3WG9A 3I59A 4KNYA 3JW4A 2QM3A 4I0AA 5JHUA 2VT2A 4OU0A 4BYYA 2IA2A 4KT5C 5CLSA 4AIJA 3TKYA 3FMSA 1BIAA 6PAXA 2BGCA 4M73A 3FXRA 3M9AA 3ELKA 2OU2A 3JTGA 4KN7X 5BMZA 1ODDA 4JQFA 2BEOA 2IT0A 3NQOA 1HXDA 3F72A 3P7NA 3EQLF 1KQ0A 2H94A 1LEBA 4RGXA 3RKWA 1KQ9A 1FBUA 2JPBA 5ED4A 3U2RA 4EGZA 2BBYA 1XGOA 3R0AA 1B6AA 3T1BA 1G4DA 4EJUA 2A3SA 3CO7C 1R36A 3HUGA 3LA2A 2GQQA 1U3EM 4GO1A 4HDUA 1OKRA 3M8EA 1S29A 3T0YA 1GVJA 5DCMA 2XRNA 2KIFA 4MQVA 3WTWC 3FMRA 4A2UA 5CJ9A 3HIFA 4KIGA 4E70A 2O3FA 3DXJF 1FC3A 1ON2A 2G7HA 5DDGA 4HF1A 4U7DA 4HF0A 3TDZC 2MBFA 1FY7A 2MH9A 5CVIA 3EUHA 3Q5FA 3Q9VA 4U88A 3WGGA 1YW7A 2LF7A 4LG0B 2YU3A 2KIUA 2A69F 2CFXA 2K27A 3DPLC 2P6TA 3B73A 1XMAA 4YFNF 4IRIA 5E20A 1SMTA 3ZQ7A 1U5TC 2EV5A 2VE8A 4EQQA 4FX0A 1KGSA 1ZARA 1FP1D 2IA1A 1DPRA 4S04A 1R22A 1LVAA 4NHJA 3R0JA 4EGYA 1LDJA 2STWA 1T0FA 3QU3A 2DU9A 2JZYA 2QBYB 4YIIA 1R5HA 5JR3A 1TNTA 5E18F 3COAC 4PCQA 2L4AA 5HS9A 1MDMB 4ZYDA 4HA8A 3F8CA 3JSPA 3HSRA 2VC1A 4HX4A 1O3QA 2Z3YA 2A07F 4AIKA 1U5TA 2K02A 3BP8A 3W6KB 5LHIA 3SQNA 2ADUA 2O6GE 1IXCA 3KCCA 4LLGF 1TLHB 3E5XA 4JK1X 5LLQA 1QGPA 4EV0A 1MDMA 1W4MA 4ZYHA 1MGTA 2Y48A 2K4JA 3I4PA 1MZBA 2ESNA 5CVRA 3ECOA 2HZTA 5EEHA 2RQPA 3KLNA 2VODA 2IVMA 4S05A 3ULQB 3JSOA 5TRDA 5HLHA 2HYFA 3IRQA 4Y15A 2FSWA 4MQ9F 3RKXA 1KYZA 2DPDA 4B8XA 4Y13A 4XSXF 2K4BA 1CF7A 4MEYF 5JFRA 1ZRCA 1IUYA 3LA7A 4G6QA 3F8NA 2OBPA 4EM0B 4PZJA 4FHTA 2O8XA 1UHMA 2F5DA 1ZAOA 1Z1DA 5K5OA 2EA4A 3KP5A 5LGUA 4RB2C 4U0WA 1O3TA 3G3ZA 5DEQA 3HYIA 1YQAA 1PP7U 5IT3A 2V1DA 4MHGA 3KETA 2D1HA 4YG2F 3IL2A 3SZTA 2BV6A 1UHWA 5L3BA 1FBSA 2VOOA 4A6DA 1DPUA 1MJAA 3IHUA 4KN4X 2R7FA 5TJJA 2JTVA 1JXSA 1TTYA 2V1UA 5D4SA 2M8EA 4UNOA 1A04A 4RGUA 1EV7A 4HF2A 3V7RA 3IC7A 1Z6TA 3WU1B 5LRSA 1P6RA 3J80K 3EETA 2HGCA 3AAFA 1I27A 1FBQA 4UHTA 1G3YA 1T38A 4M74A 5L3DA 3MZHA 1B1BA 5ICCA 1BC8C 1DP7P 3E3VA 2HTJA 3KP7A 1R1UA 4O6JA 3TQNA 3I53A 4ETSA 2FRHA 3ZP5A 5K5QA 1QZZA 2CYYA 2EFNA 1BOAA 1XSDA 4HLYA 2XHKA 2W25A 5IT9Z 2KIMA 3F8BA 2RKHA 2DO7A 5E1XA 5AIPA 2IJLA 2Q8KA 4P9UA 4LFUA 1UCRA 1TBXA 4LG0A 2H09A 1J9IA 2CQKA 1B59A 4LJZF 5CYVA 3ABUA 2WWYA 4XSZF 4N0BA 2P8TA 3WGHA 2NNNA 1Q1HA 4MEXF 3ECHA 4EM1A 3HRMA 2O61A 1YLFA 2F5FA 2EK5A 2FE3A 4HV5A 3FX3A 3FHZA 1IRFA 5DUKA 1BIBA 2X0LA 3DPTA 3KZYA 3LWFA 2E7XA 5HS8A 3CDHA 3P9KA 1ZGJA 5J8FA 4MTDA 4OOIA 1FZPB 2VBWA 2E1CA 2CG4A 5KK1A 2P5KA 3R6SA 4BNCA 1S7OA 2HEOA 4LLNA 2MC3A 1RZ4A 1B9MA 5K1YA 4WXHA 5ILUA 2J5OA 1U5TB 1CGPA 2CW0F 5FGMA 1H9TA 1U2WA 3JAMK 1BBYA 3FM5A 4WXCA 3T5XA 2VXZA 4KMFA 3V8JA 2JT1A 4AD9A 4RB1A 5E1WA 3GFIA 2DK5A 2HR3A 3QU6A 4GGGA 5DCFA 4G7OF 3CUQA 2AXLA 5ICGA 3ZMDA 1H0MA 1G3SA 2DTRA 1JHHA 4M71A 3MZYA 2C6YA 3BPXA 1J2XA 3J81K 4Q48A 3H3UA 1BM9A 2FNPA 2A68F 2RGVA 1BC7C 1XDUA 1R1TA 3BROA 1P92A 5DUIA 4WK8F 2WV0A 1Z9CA 4F7ZA 1RUOA 1DDNA 1FSEA 1WRJA 2G7UA 4EJTA 2GXGA 3HTUA 5IT9K 1PUEE 4BQAA 2W57A 3FZVA 4WCGA 4RB0A 4N9IA 4L0YB 3WTSC 5HVQC 1OYIA 2W84A 2V1XA 5A2QK 1XMKA 3I5UA 2R7DA 1P4AA 4P5OA 2LKPA 4A0YA 2GZWA 3BJAA 2DQRA 1S3JA 2HQRA 2FNAA 3TOBA 1FP2A 1MKMA 3Q9SA 4G94A 2DAOA 3WE2A 2EB7A 2OD5A 4L18B 5D5WB 3MCZA 1HSTA 4AVPA 2H27A 4LB6B 3F23A 4OINF 2HOEA 5D5UB 3K1NA 3W6JB 4I01A 4HZFA 2VBYA 2K7LA 3HOTA 2GWRA 3REOA 2CWEA 3U1DA 1YFHA 5LHHA 2HDCA 3CTAA 3F6VA 1O3RA 3D0SA 4AWXB 2IA0A 2PG4A 2MH2A 3F8FA 2DW4A 2Z5UA 4A5MA 5BOXA 1IN6A 3OV8A 1H9GA 3C18A 4G6DA 5ICEA 3K0LA 4CGZA 1IZ1A 3L7WA 5JVTA 5DYMA 1KQ8A 3RJPA 1MJBA 4WWCA 5ERIA 1MD0A 1R58A 4M9ZA 4HYEA 3F21A 2YX4A 3RPUA 5E17F 4JBAA 2D1VA 5HDGA 4EJOA 1IN7A 4I09A 2LF8A 2DPUA 4QWQA 2V9VA 3PFIA 2DLLA 4FT8A 1EH7A 1QO0D 1R1VA 4PDKA 1F1ZA 4OIQF 1K78B 1WWXA 3EYYA 1SD4A 4G7HF 2UXNA 3PQJA 3N4MA 2PQ8A 1CF7B 2PLYA 2QQAA 3DP7A 5LHGA 2FQ3A 1P2FA 3LA3A 3OOPA 4OIOF 4KUMA 3FXQA 4Y17A 2L54A 2DFIA 5A2QZ 4RAZA 1K78A 2UXXA 4K2EA 3TOAA 3K2ZA 4IXAA 3KE2A 2STTA 4R79A 1R00A 1I5ZA 4ESFA 3O6BB 3F6OA 3HSFA 4OMZA 1HKQA 1ZG5A 3HRSA 4HLXA 3BOQA 5J6XA 1I6XA 1SD7A 2DBBA 2PMUA 2CO5A 4UVCA 4U0VA 4YFXF 4L9VA 5DCMB 4LGWA 4IJAA 3KFWX 2JPCA 2XROA 3B02A 3HTSB 1FWZA 5L3GA 1K6OA 2P5LC 4KIBA 2GAUA 1BI0A 1ZRFA 1ZRDA 3RKYA 2X4HA 1O7FA 4GYGA 5BQTA 2Y75A 4RB3C 1RIOH 2NNYA 2IP2A 3EDPA 1YW8A 3MQ0A 3ZN0A 1FOKA 3GFMA 1BN5A 1J5YA 1XCBA 3BJOA 3SHFA 1JE8A 4Q4ZF 2OA4A 2QVOA 2DT5A 1AOYA 2V79A 4IF4A 2OQGA 1S6LA 5ICFA 1XCVA 4GXOA 1TNSA 3U9GA 3F3XA 3HHGA 3LAPA 2EJRA 3V8LA 1I1SA 3SFZA 4KMUX 5F64A 1O3SA 5DD4A 3GUDA 3O2PE 1BI2A 4QLCU 4ENNA 4R8HA 4EJWA 2M5WA 3BZ6A 2XKOA 2R3SA 5ILVA 2P4WA 3LAJA 4H0EA 1IN8A 3RYRA 2BE5F 4XLPF 3ZMUA 3L9FA 2B0LA 5FD6A 2ZBKA 1TW3A 3NRVA 1JHFA 2ACJA 2PJPA 1HW5A 2A6HF 1ZLKA 4ENKA 4CO8A 2Q0OA 2M87A 2M1BA 3C1DA 4CZZA 4NB5A 2F5EA 1BJAA 3ZMSA 1LNWA 4G9YA 5EEGA 1QNTA 1ZH5A 3ML6A 4HAMA 3ZMZA 1ZHFA 4KA4A 3WU0A 3L2CA 1AWCA 1XSXA 4L5IA 3F8MA 2PBIA 3GFLA 4ENMA 3PQKA 2PEXA 1YTYA 3VODA 2Z99A 3BPVA 3QOPA 4HV6A 3M8FA 2QQ9A 2OZUA 1LDKB 5BPIA 3MAJA 3ZN1A 2UZKA 3CO6C 3JTHA 1W7PD 1ZLJA 5FFZA 3QP5A 2EFOA 1WSUA 1OPCA 1IF1A 2FF4A 3S2WA 4G8XA 1G3TA 5LEKA 1O57A 4HW0A 3SXYA 2L01A 1QZYA 2UWMA 2J5PA 3C7JA 2QLZA 2HYGD 3VFZA 4MGRA 2OQRA 2IW5A 1J0RA 2H6BA 1J7KA 5LEJA 3MFKA 3HRUA 2FXAA 4UVAA 1BI1A 2EFPA 4I2OA 3VB2A 2F5CA 2LDUA 4CHUA 2QENA 4LD5A 3ZMTA 1J75A 2KJCA 2GA1A 1T2KA 2ZXJA 1ON1A 3GYHX 1GHCA 1XGSA 1T98A 2YX7A 3H92A 1LJ9A 5FFXA 4A6EA 2W85A 5E1ZB 2XV4S 1XGMA 2FBKA 4IVNA 5HLGA 1XGNA 3I54A 2QYOA 5D6EA 4EVIA 5K5RA 2QZ8A 4MNUA 3WTYC 3RTRA 3BWGA 4DQ2A 3KP2A 3E5QA 2TDXA 3V7SA 2L4MA 1Z7UA 3RPQA 1KU7A 4ENJA 4ZZDA 3GF2A 1RI7A 2ZO4A 1D8KA 1WKMA 3K1PA 3WTTC 3GVAA 1FX7A 1LQ1A 1HSJA 3GO5A 3GZ5A 1PP8F 2E1NA 2FBIA 3M7GA 4RS8A 5F1RA 1SD6A 3K9TA 2XUBA 2KRFA 2DI3A 3TO9A 5H6RA 1KYWA 3T8RA 3DKWA 2AS5F 3ROUA 1NHAA 2EV0A 4GYIA 5LBQA 1G6NA 3HOSA 4UVBA 1B9NA 5FO5A 5H20A 4ASNA 1D5VA 3K69A 2EFQA 2G9WA 1U8RA 4UXNA 1Z05A 4KIFA 1U78A 3E5UA 2XKPA 5CVJA 1QPMA 2WTEA 2GA2A 4O5VA 5CVVA 1IXSB 4YFKF 2XAJA 5D4RA 4ESJA 1VTNC 1YG2A 3RDIA 2HKXA 1R5GA 5DD8A 1FPQA 2COMA 5FD5A 1G3WA 1KU3A 4L0ZB 1PDNC 2Q2EA 2PFBA 4P9FA 1S8NA 4KYWA 3FM3A 1F4KA 4EMSA 3QP6A 1D8JA 3HRTA 1EH6A 3QRFF 3H3ZA 3GW2A 5AONA 5BS6A 5LGTA 2ZJ2A 4I02A 4XBFA 2VOPA 2JSCA 4G7ZF 2V6CA 3CUOA 2ZMEB 4I7HA 4KICA 2L02A 1Y0UA 2RDPA 4BH9A 4A12A 1UFMA 4M72A 4ON0A 1STZA 2QWWA 3ABTA 3E6MA 2BYVE 2MLKA 1F5TA 2RV8A 3WTZA 2M30A 3G73A 1L0OC 1EH8A 2EWNA 5KVRA 1E17A 4ZZLA 1YYVA 2DQLA 1SFUA 1GXQA 1IW7F 3GLXA 5HDNA 3GXOA 5FLXK 2XGXA 2HKOA 3TDUC 3WGIA 4HBLA 4UV9A 4Q5SF 3I59B 4L9JA 3ISPA 4ESBA 2D2WA 1L3LA 3KP3A 2NYXA 4HOBA 1ZG3A 1USTA 4KFCA 1F9NA 5D8KB 2FMLA 1D3YA 1GXPA 1LDDA 4M9XA 3HSEA 3I58A 1R7JA 4WF2A 1U6GA 3DV8A 4M6YA 2FBHA 3IKTA 2VBZA 4Z2YA 1ZN2A 1OYWA 1Z6RA 3CUQB 2P6SA 5LRRA 4R1HA 2OZ6A 3LSTA 1YS6A 5L3CA 2QQBA 1DUXC 1ZG1A 4XRFA 1V3FA 3CJNA 4LB5A 1FYKA 2ISYA 2MD5A 3IKVA 2QUFA 4I98B 3ERED 5D8LB 1T6SA 3DFGA 2K86A 4HX8A 3GX4X 4HX7A 2IRFG 1REPC 2HFHA 3VOEA 3L09A 1ONVA 4OIPF 2M45A 4CXFA 5D5VB 1BI3A 3TO7A 3VEPA 1IXRC 1LB2A 3CLOA 4ZH4F 4IHTA 1TQPA 2DK8A 2VT3A 4CICA 2XVCA 2EA2A 3NEUA 2Y0MA 4AIHA 4IRHA 1XB4A 2CSOA 1YIOA 4NQWA 1C0WA 2YPRA 1P4WA 5H6QA 4P55A 1T39A 4OMYA 4BHBA 5E8IA 5E8GA 1OR7A 3BJ6A 1HKTA 1XSVA 2H6CA 3C3WA 1USSA 2FU4A 2YR2A 5HOOA 3IRRA 3WTUC 4BHPA 2IPQX 4A5NA 4D0PA 5HDKA 3D5LA 2WC2A 1HKSA 4ZYGA 4UV8A 3KZZA 1W5TA 2XAGA 3KP6A 2O0YA 3F22A 3E97A 4LMYA 2XIGA 3FWEA 4TV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX Z;  4CYD A;  4I0B A;  5BPD A;  4O3M A;  2LNB A;  3E6D A;  2QBY A;  2PI0 A;  3E6C C;  1FYM A;  3QPH A;  1IRG A;  5LGN A;  5D5X B;  4B09 A;  3TGN A;  4L9N A;  4L9T A;  2LSO A;  2CGP A;  1S7A A;  1SD5 A;  4RGS A;  4A0Z A;  4GCV A;  3GZ6 A;  1R23 A;  1TQM A;  4BAY A;  4DNC A;  4XLN F;  3O3K A;  4MTE A;  4M6X A;  3V7C A;  1YS7 A;  1XDS A;  3E6B A;  3LQQ A;  1B4A A;  2ZNZ A;  1SAX A;  5L3E A;  2XAQ A;  2XAH A;  4CDG A;  1V4R A;  2ZNY A;  3ZPL A;  5JI6 A;  1FLI A;  1IN4 A;  1OMI A;  5CVU A;  3ZMV A;  2MLG A;  3KEQ A;  2VC0 A;  3J80 Z;  1J59 A;  1LEA A;  2GIV A;  1OYY A;  4WXD A;  2A5Y B;  2JRT A;  4PGG A;  1JGS A;  4BHC A;  2PMH A;  1XN7 A;  3V4G A;  5ILS A;  3CUQ C;  3RYP A;  2ZME A;  4LK1 F;  2NAZ A;  3WTX C;  3I71 A;  3FMQ A;  1MJ9 A;  2RN7 A;  1SMY F;  2P7C B;  1QQI A;  1K79 A;  4WX9 A;  2YSR A;  1ULY A;  2E7W A;  2NS0 A;  4YIF A;  3GEZ A;  1IN5 A;  2P7V B;  3WTV C;  2D45 A;  4PGH A;  3KP4 A;  1KU2 A;  3KEO A;  4FX4 A;  3IWZ A;  4BXU A;  3V8K A;  3BY6 A;  2HS5 A;  1ZGA A;  2VE9 A;  2FMY A;  1Z91 A;  2RC4 A;  3LQR A;  4M9S A;  1HW2 A;  3GFJ A;  2XAF A;  2ZFW A;  2FEZ A;  5AIQ A;  2ISZ A;  3IWF A;  2PN6 A;  1TW2 A;  3L00 A;  3WE3 A;  2HTS A;  4A0X A;  1W5S A;  3DF8 A;  4HQE A;  2KJB A;  2W24 A;  4U0Y A;  3P9C A;  3HHH A;  1RNL A;  4U7B A;  3QPT A;  5DV5 A;  4LLL A;  1FNN A;  4OIR F;  2RVC A;  3FF5 A;  3R4K A;  2NRA C;  2ELH A;  2FA5 A;  2OAZ A;  1E2X A;  2P5V A;  2VON A;  1WQ2 A;  2VBX A;  2FOK A;  2MA3 A;  1SFX A;  3BDD A;  3DEU A;  5L3F A;  1UB9 A;  2Z9O A;  3MEX A;  1FSH A;  1XD7 A;  1W7P B;  3QAH A;  1QBJ A;  2HWV A;  4RAY A;  3I0T A;  5HLI A;  1YO5 C;  1HBX G;  3R60 A;  1HQC A;  4IHS A;  2GXB A;  2ZCW A;  1P4X A;  3MWM A;  2EV6 A;  3K1M A;  1FYL A;  2KKO A;  1HW1 A;  3DQV C;  3JAM Z;  2O03 A;  3N97 A;  1ZYR F;  3M1E A;  4HDV A;  1ZRE A;  4N9H A;  4IRG A;  2XAS A;  4UUV A;  3RI4 A;  2ZKZ A;  3P9I A;  3RIR A;  4IPA A;  2RNJ A;  4RGR A;  1RUN A;  1W7P A;  3KLO A;  4L5J A;  3FXU A;  2VN2 A;  1FT9 A;  5HS7 A;  3TO6 A;  2A6E F;  3EYI A;  4EJV A;  4EM2 A;  5FB2 A;  2EFW A;  1WI9 A;  5D6F A;  1IAW A;  3R61 A;  2ESH A;  3J81 Z;  2F2E A;  4Q47 A;  1X3U A;  1KU9 A;  1YW9 A;  3T8T A;  4LK0 F;  2A61 A;  4ZYE A;  1SFE A;  2HQN A;  3WOD F;  2Z33 A;  4HQM A;  5F6F A;  3GWZ A;  4KDP A;  3I64 A;  3SZP A;  5J8C A;  4P96 A;  1KA8 A;  1I1G A;  1K7A A;  2ETH A;  3J7A O;  1O7L A;  3LFK A;  1TQI A;  2L3D A;  3WG9 A;  3I59 A;  4KNY A;  3JW4 A;  2QM3 A;  4I0A A;  5JHU A;  2VT2 A;  4OU0 A;  4BYY A;  2IA2 A;  4KT5 C;  5CLS A;  4AIJ A;  3TKY A;  3FMS A;  1BIA A;  6PAX A;  2BGC A;  4M73 A;  3FXR A;  3M9A A;  3ELK A;  2OU2 A;  3JTG A;  4KN7 X;  5BMZ A;  1ODD A;  4JQF A;  2BEO A;  2IT0 A;  3NQO A;  1HXD A;  3F72 A;  3P7N A;  3EQL F;  1KQ0 A;  2H94 A;  1LEB A;  4RGX A;  3RKW A;  1KQ9 A;  1FBU A;  2JPB A;  5ED4 A;  3U2R A;  4EGZ A;  2BBY A;  1XGO A;  3R0A A;  1B6A A;  3T1B A;  1G4D A;  4EJU A;  2A3S A;  3CO7 C;  1R36 A;  3HUG A;  3LA2 A;  2GQQ A;  1U3E M;  4GO1 A;  4HDU A;  1OKR A;  3M8E A;  1S29 A;  3T0Y A;  1GVJ A;  5DCM A;  2XRN A;  2KIF A;  4MQV A;  3WTW C;  3FMR A;  4A2U A;  5CJ9 A;  3HIF A;  4KIG A;  4E70 A;  2O3F A;  3DXJ F;  1FC3 A;  1ON2 A;  2G7H A;  5DDG A;  4HF1 A;  4U7D A;  4HF0 A;  3TDZ C;  2MBF A;  1FY7 A;  2MH9 A;  5CVI A;  3EUH A;  3Q5F A;  3Q9V A;  4U88 A;  3WGG A;  1YW7 A;  2LF7 A;  4LG0 B;  2YU3 A;  2KIU A;  2A69 F;  2CFX A;  2K27 A;  3DPL C;  2P6T A;  3B73 A;  1XMA A;  4YFN F;  4IRI A;  5E20 A;  1SMT A;  3ZQ7 A;  1U5T C;  2EV5 A;  2VE8 A;  4EQQ A;  4FX0 A;  1KGS A;  1ZAR A;  1FP1 D;  2IA1 A;  1DPR A;  4S04 A;  1R22 A;  1LVA A;  4NHJ A;  3R0J A;  4EGY A;  1LDJ A;  2STW A;  1T0F A;  3QU3 A;  2DU9 A;  2JZY A;  2QBY B;  4YII A;  1R5H A;  5JR3 A;  1TNT A;  5E18 F;  3COA C;  4PCQ A;  2L4A A;  5HS9 A;  1MDM B;  4ZYD A;  4HA8 A;  3F8C A;  3JSP A;  3HSR A;  2VC1 A;  4HX4 A;  1O3Q A;  2Z3Y A;  2A07 F;  4AIK A;  1U5T A;  2K02 A;  3BP8 A;  3W6K B;  5LHI A;  3SQN A;  2ADU A;  2O6G E;  1IXC A;  3KCC A;  4LLG F;  1TLH B;  3E5X A;  4JK1 X;  5LLQ A;  1QGP A;  4EV0 A;  1MDM A;  1W4M A;  4ZYH A;  1MGT A;  2Y48 A;  2K4J A;  3I4P A;  1MZB A;  2ESN A;  5CVR A;  3ECO A;  2HZT A;  5EEH A;  2RQP A;  3KLN A;  2VOD A;  2IVM A;  4S05 A;  3ULQ B;  3JSO A;  5TRD A;  5HLH A;  2HYF A;  3IRQ A;  4Y15 A;  2FSW A;  4MQ9 F;  3RKX A;  1KYZ A;  2DPD A;  4B8X A;  4Y13 A;  4XSX F;  2K4B A;  1CF7 A;  4MEY F;  5JFR A;  1ZRC A;  1IUY A;  3LA7 A;  4G6Q A;  3F8N A;  2OBP A;  4EM0 B;  4PZJ A;  4FHT A;  2O8X A;  1UHM A;  2F5D A;  1ZAO A;  1Z1D A;  5K5O A;  2EA4 A;  3KP5 A;  5LGU A;  4RB2 C;  4U0W A;  1O3T A;  3G3Z A;  5DEQ A;  3HYI A;  1YQA A;  1PP7 U;  5IT3 A;  2V1D A;  4MHG A;  3KET A;  2D1H A;  4YG2 F;  3IL2 A;  3SZT A;  2BV6 A;  1UHW A;  5L3B A;  1FBS A;  2VOO A;  4A6D A;  1DPU A;  1MJA A;  3IHU A;  4KN4 X;  2R7F A;  5TJJ A;  2JTV A;  1JXS A;  1TTY A;  2V1U A;  5D4S A;  2M8E A;  4UNO A;  1A04 A;  4RGU A;  1EV7 A;  4HF2 A;  3V7R A;  3IC7 A;  1Z6T A;  3WU1 B;  5LRS A;  1P6R A;  3J80 K;  3EET A;  2HGC A;  3AAF A;  1I27 A;  1FBQ A;  4UHT A;  1G3Y A;  1T38 A;  4M74 A;  5L3D A;  3MZH A;  1B1B A;  5ICC A;  1BC8 C;  1DP7 P;  3E3V A;  2HTJ A;  3KP7 A;  1R1U A;  4O6J A;  3TQN A;  3I53 A;  4ETS A;  2FRH A;  3ZP5 A;  5K5Q A;  1QZZ A;  2CYY A;  2EFN A;  1BOA A;  1XSD A;  4HLY A;  2XHK A;  2W25 A;  5IT9 Z;  2KIM A;  3F8B A;  2RKH A;  2DO7 A;  5E1X A;  5AIP A;  2IJL A;  2Q8K A;  4P9U A;  4LFU A;  1UCR A;  1TBX A;  4LG0 A;  2H09 A;  1J9I A;  2CQK A;  1B59 A;  4LJZ F;  5CYV A;  3ABU A;  2WWY A;  4XSZ F;  4N0B A;  2P8T A;  3WGH A;  2NNN A;  1Q1H A;  4MEX F;  3ECH A;  4EM1 A;  3HRM A;  2O61 A;  1YLF A;  2F5F A;  2EK5 A;  2FE3 A;  4HV5 A;  3FX3 A;  3FHZ A;  1IRF A;  5DUK A;  1BIB A;  2X0L A;  3DPT A;  3KZY A;  3LWF A;  2E7X A;  5HS8 A;  3CDH A;  3P9K A;  1ZGJ A;  5J8F A;  4MTD A;  4OOI A;  1FZP B;  2VBW A;  2E1C A;  2CG4 A;  5KK1 A;  2P5K A;  3R6S A;  4BNC A;  1S7O A;  2HEO A;  4LLN A;  2MC3 A;  1RZ4 A;  1B9M A;  5K1Y A;  4WXH A;  5ILU A;  2J5O A;  1U5T B;  1CGP A;  2CW0 F;  5FGM A;  1H9T A;  1U2W A;  3JAM K;  1BBY A;  3FM5 A;  4WXC A;  3T5X A;  2VXZ A;  4KMF A;  3V8J A;  2JT1 A;  4AD9 A;  4RB1 A;  5E1W A;  3GFI A;  2DK5 A;  2HR3 A;  3QU6 A;  4GGG A;  5DCF A;  4G7O F;  3CUQ A;  2AXL A;  5ICG A;  3ZMD A;  1H0M A;  1G3S A;  2DTR A;  1JHH A;  4M71 A;  3MZY A;  2C6Y A;  3BPX A;  1J2X A;  3J81 K;  4Q48 A;  3H3U A;  1BM9 A;  2FNP A;  2A68 F;  2RGV A;  1BC7 C;  1XDU A;  1R1T A;  3BRO A;  1P92 A;  5DUI A;  4WK8 F;  2WV0 A;  1Z9C A;  4F7Z A;  1RUO A;  1DDN A;  1FSE A;  1WRJ A;  2G7U A;  4EJT A;  2GXG A;  3HTU A;  5IT9 K;  1PUE E;  4BQA A;  2W57 A;  3FZV A;  4WCG A;  4RB0 A;  4N9I A;  4L0Y B;  3WTS C;  5HVQ C;  1OYI A;  2W84 A;  2V1X A;  5A2Q K;  1XMK A;  3I5U A;  2R7D A;  1P4A A;  4P5O A;  2LKP A;  4A0Y A;  2GZW A;  3BJA A;  2DQR A;  1S3J A;  2HQR A;  2FNA A;  3TOB A;  1FP2 A;  1MKM A;  3Q9S A;  4G94 A;  2DAO A;  3WE2 A;  2EB7 A;  2OD5 A;  4L18 B;  5D5W B;  3MCZ A;  1HST A;  4AVP A;  2H27 A;  4LB6 B;  3F23 A;  4OIN F;  2HOE A;  5D5U B;  3K1N A;  3W6J B;  4I01 A;  4HZF A;  2VBY A;  2K7L A;  3HOT A;  2GWR A;  3REO A;  2CWE A;  3U1D A;  1YFH A;  5LHH A;  2HDC A;  3CTA A;  3F6V A;  1O3R A;  3D0S A;  4AWX B;  2IA0 A;  2PG4 A;  2MH2 A;  3F8F A;  2DW4 A;  2Z5U A;  4A5M A;  5BOX A;  1IN6 A;  3OV8 A;  1H9G A;  3C18 A;  4G6D A;  5ICE A;  3K0L A;  4CGZ A;  1IZ1 A;  3L7W A;  5JVT A;  5DYM A;  1KQ8 A;  3RJP A;  1MJB A;  4WWC A;  5ERI A;  1MD0 A;  1R58 A;  4M9Z A;  4HYE A;  3F21 A;  2YX4 A;  3RPU A;  5E17 F;  4JBA A;  2D1V A;  5HDG A;  4EJO A;  1IN7 A;  4I09 A;  2LF8 A;  2DPU A;  4QWQ A;  2V9V A;  3PFI A;  2DLL A;  4FT8 A;  1EH7 A;  1QO0 D;  1R1V A;  4PDK A;  1F1Z A;  4OIQ F;  1K78 B;  1WWX A;  3EYY A;  1SD4 A;  4G7H F;  2UXN A;  3PQJ A;  3N4M A;  2PQ8 A;  1CF7 B;  2PLY A;  2QQA A;  3DP7 A;  5LHG A;  2FQ3 A;  1P2F A;  3LA3 A;  3OOP A;  4OIO F;  4KUM A;  3FXQ A;  4Y17 A;  2L54 A;  2DFI A;  5A2Q Z;  4RAZ A;  1K78 A;  2UXX A;  4K2E A;  3TOA A;  3K2Z A;  4IXA A;  3KE2 A;  2STT A;  4R79 A;  1R00 A;  1I5Z A;  4ESF A;  3O6B B;  3F6O A;  3HSF A;  4OMZ A;  1HKQ A;  1ZG5 A;  3HRS A;  4HLX A;  3BOQ A;  5J6X A;  1I6X A;  1SD7 A;  2DBB A;  2PMU A;  2CO5 A;  4UVC A;  4U0V A;  4YFX F;  4L9V A;  5DCM B;  4LGW A;  4IJA A;  3KFW X;  2JPC A;  2XRO A;  3B02 A;  3HTS B;  1FWZ A;  5L3G A;  1K6O A;  2P5L C;  4KIB A;  2GAU A;  1BI0 A;  1ZRF A;  1ZRD A;  3RKY A;  2X4H A;  1O7F A;  4GYG A;  5BQT A;  2Y75 A;  4RB3 C;  1RIO H;  2NNY A;  2IP2 A;  3EDP A;  1YW8 A;  3MQ0 A;  3ZN0 A;  1FOK A;  3GFM A;  1BN5 A;  1J5Y A;  1XCB A;  3BJO A;  3SHF A;  1JE8 A;  4Q4Z F;  2OA4 A;  2QVO A;  2DT5 A;  1AOY A;  2V79 A;  4IF4 A;  2OQG A;  1S6L A;  5ICF A;  1XCV A;  4GXO A;  1TNS A;  3U9G A;  3F3X A;  3HHG A;  3LAP A;  2EJR A;  3V8L A;  1I1S A;  3SFZ A;  4KMU X;  5F64 A;  1O3S A;  5DD4 A;  3GUD A;  3O2P E;  1BI2 A;  4QLC U;  4ENN A;  4R8H A;  4EJW A;  2M5W A;  3BZ6 A;  2XKO A;  2R3S A;  5ILV A;  2P4W A;  3LAJ A;  4H0E A;  1IN8 A;  3RYR A;  2BE5 F;  4XLP F;  3ZMU A;  3L9F A;  2B0L A;  5FD6 A;  2ZBK A;  1TW3 A;  3NRV A;  1JHF A;  2ACJ A;  2PJP A;  1HW5 A;  2A6H F;  1ZLK A;  4ENK A;  4CO8 A;  2Q0O A;  2M87 A;  2M1B A;  3C1D A;  4CZZ A;  4NB5 A;  2F5E A;  1BJA A;  3ZMS A;  1LNW A;  4G9Y A;  5EEG A;  1QNT A;  1ZH5 A;  3ML6 A;  4HAM A;  3ZMZ A;  1ZHF A;  4KA4 A;  3WU0 A;  3L2C A;  1AWC A;  1XSX A;  4L5I A;  3F8M A;  2PBI A;  3GFL A;  4ENM A;  3PQK A;  2PEX A;  1YTY A;  3VOD A;  2Z99 A;  3BPV A;  3QOP A;  4HV6 A;  3M8F A;  2QQ9 A;  2OZU A;  1LDK B;  5BPI A;  3MAJ A;  3ZN1 A;  2UZK A;  3CO6 C;  3JTH A;  1W7P D;  1ZLJ A;  5FFZ A;  3QP5 A;  2EFO A;  1WSU A;  1OPC A;  1IF1 A;  2FF4 A;  3S2W A;  4G8X A;  1G3T A;  5LEK A;  1O57 A;  4HW0 A;  3SXY A;  2L01 A;  1QZY A;  2UWM A;  2J5P A;  3C7J A;  2QLZ A;  2HYG D;  3VFZ A;  4MGR A;  2OQR A;  2IW5 A;  1J0R A;  2H6B A;  1J7K A;  5LEJ A;  3MFK A;  3HRU A;  2FXA A;  4UVA A;  1BI1 A;  2EFP A;  4I2O A;  3VB2 A;  2F5C A;  2LDU A;  4CHU A;  2QEN A;  4LD5 A;  3ZMT A;  1J75 A;  2KJC A;  2GA1 A;  1T2K A;  2ZXJ A;  1ON1 A;  3GYH X;  1GHC A;  1XGS A;  1T98 A;  2YX7 A;  3H92 A;  1LJ9 A;  5FFX A;  4A6E A;  2W85 A;  5E1Z B;  2XV4 S;  1XGM A;  2FBK A;  4IVN A;  5HLG A;  1XGN A;  3I54 A;  2QYO A;  5D6E A;  4EVI A;  5K5R A;  2QZ8 A;  4MNU A;  3WTY C;  3RTR A;  3BWG A;  4DQ2 A;  3KP2 A;  3E5Q A;  2TDX A;  3V7S A;  2L4M A;  1Z7U A;  3RPQ A;  1KU7 A;  4ENJ A;  4ZZD A;  3GF2 A;  1RI7 A;  2ZO4 A;  1D8K A;  1WKM A;  3K1P A;  3WTT C;  3GVA A;  1FX7 A;  1LQ1 A;  1HSJ A;  3GO5 A;  3GZ5 A;  1PP8 F;  2E1N A;  2FBI A;  3M7G A;  4RS8 A;  5F1R A;  1SD6 A;  3K9T A;  2XUB A;  2KRF A;  2DI3 A;  3TO9 A;  5H6R A;  1KYW A;  3T8R A;  3DKW A;  2AS5 F;  3ROU A;  1NHA A;  2EV0 A;  4GYI A;  5LBQ A;  1G6N A;  3HOS A;  4UVB A;  1B9N A;  5FO5 A;  5H20 A;  4ASN A;  1D5V A;  3K69 A;  2EFQ A;  2G9W A;  1U8R A;  4UXN A;  1Z05 A;  4KIF A;  1U78 A;  3E5U A;  2XKP A;  5CVJ A;  1QPM A;  2WTE A;  2GA2 A;  4O5V A;  5CVV A;  1IXS B;  4YFK F;  2XAJ A;  5D4R A;  4ESJ A;  1VTN C;  1YG2 A;  3RDI A;  2HKX A;  1R5G A;  5DD8 A;  1FPQ A;  2COM A;  5FD5 A;  1G3W A;  1KU3 A;  4L0Z B;  1PDN C;  2Q2E A;  2PFB A;  4P9F A;  1S8N A;  4KYW A;  3FM3 A;  1F4K A;  4EMS A;  3QP6 A;  1D8J A;  3HRT A;  1EH6 A;  3QRF F;  3H3Z A;  3GW2 A;  5AON A;  5BS6 A;  5LGT A;  2ZJ2 A;  4I02 A;  4XBF A;  2VOP A;  2JSC A;  4G7Z F;  2V6C A;  3CUO A;  2ZME B;  4I7H A;  4KIC A;  2L02 A;  1Y0U A;  2RDP A;  4BH9 A;  4A12 A;  1UFM A;  4M72 A;  4ON0 A;  1STZ A;  2QWW A;  3ABT A;  3E6M A;  2BYV E;  2MLK A;  1F5T A;  2RV8 A;  3WTZ A;  2M30 A;  3G73 A;  1L0O C;  1EH8 A;  2EWN A;  5KVR A;  1E17 A;  4ZZL A;  1YYV A;  2DQL A;  1SFU A;  1GXQ A;  1IW7 F;  3GLX A;  5HDN A;  3GXO A;  5FLX K;  2XGX A;  2HKO A;  3TDU C;  3WGI A;  4HBL A;  4UV9 A;  4Q5S F;  3I59 B;  4L9J A;  3ISP A;  4ESB A;  2D2W A;  1L3L A;  3KP3 A;  2NYX A;  4HOB A;  1ZG3 A;  1UST A;  4KFC A;  1F9N A;  5D8K B;  2FML A;  1D3Y A;  1GXP A;  1LDD A;  4M9X A;  3HSE A;  3I58 A;  1R7J A;  4WF2 A;  1U6G A;  3DV8 A;  4M6Y A;  2FBH A;  3IKT A;  2VBZ A;  4Z2Y A;  1ZN2 A;  1OYW A;  1Z6R A;  3CUQ B;  2P6S A;  5LRR A;  4R1H A;  2OZ6 A;  3LST A;  1YS6 A;  5L3C A;  2QQB A;  1DUX C;  1ZG1 A;  4XRF A;  1V3F A;  3CJN A;  4LB5 A;  1FYK A;  2ISY A;  2MD5 A;  3IKV A;  2QUF A;  4I98 B;  3ERE D;  5D8L B;  1T6S A;  3DFG A;  2K86 A;  4HX8 A;  3GX4 X;  4HX7 A;  2IRF G;  1REP C;  2HFH A;  3VOE A;  3L09 A;  1ONV A;  4OIP F;  2M45 A;  4CXF A;  5D5V B;  1BI3 A;  3TO7 A;  3VEP A;  1IXR C;  1LB2 A;  3CLO A;  4ZH4 F;  4IHT A;  1TQP A;  2DK8 A;  2VT3 A;  4CIC A;  2XVC A;  2EA2 A;  3NEU A;  2Y0M A;  4AIH A;  4IRH A;  1XB4 A;  2CSO A;  1YIO A;  4NQW A;  1C0W A;  2YPR A;  1P4W A;  5H6Q A;  4P55 A;  1T39 A;  4OMY A;  4BHB A;  5E8I A;  5E8G A;  1OR7 A;  3BJ6 A;  1HKT A;  1XSV A;  2H6C A;  3C3W A;  1USS A;  2FU4 A;  2YR2 A;  5HOO A;  3IRR A;  3WTU C;  4BHP A;  2IPQ X;  4A5N A;  4D0P A;  5HDK A;  3D5L A;  2WC2 A;  1HKS A;  4ZYG A;  4UV8 A;  3KZZ A;  1W5T A;  2XAG A;  3KP6 A;  2O0Y A;  3F22 A;  3E97 A;  4LMY A;  2XIG A;  3FWE A;  4TV7 A; 
#chains in the Genus database with same CATH topology
 5FLX Z;  4CYD A;  3JRG A;  2KQR A;  2V1N A;  4I0B A;  4RAG A;  5BPD A;  1UAA A;  2LNB A;  4O3M A;  1RPW A;  3E6D A;  2E60 A;  2WY8 Q;  2QBY A;  2OC6 A;  2PI0 A;  3Q0W A;  3E6C C;  1FYM A;  3QPH A;  1IRG A;  1LUJ B;  2K3P A;  5LGN A;  1X1A A;  3ZQC A;  1JT6 A;  4HSR A;  5D5X B;  4B09 A;  1ACI A;  2M8G X;  3TGN A;  4L9N A;  4L9T A;  2LSO A;  2CGP A;  1S7A A;  3E0J B;  3PM1 A;  2X1C A;  2NOJ B;  2QGU A;  1SD5 A;  3BR1 A;  4RGS A;  2Y9Y A;  4GCV A;  1FIP A;  4OAZ A;  4A0Z A;  5IP6 A;  3GZ6 A;  1A5J A;  1B8I A;  5J3L A;  1VQ5 I;  3H3V K;  1R23 A;  1SFK A;  1TQM A;  4BAY A;  4XOT A;  2TCT A;  4DNC A;  5HNH A;  1SC7 A;  3FKI J;  4XLN F;  3TED A;  1A6Q A;  4RM3 A;  2ZC2 A;  3LSH A;  4D9J A;  3O3K A;  4MTE A;  4M6X A;  2G0E A;  3V7C A;  3JR9 A;  2BY1 A;  1YS7 A;  1XDS A;  4UUT A;  3E6B A;  3LQQ A;  1B4A A;  2ZNZ A;  1U9N A;  2FUG 2;  5L3E A;  1SAX A;  3AG3 H;  2XAQ A;  2XAH A;  4A3E J;  2DA7 A;  2H8W A;  4CDG A;  2HVR A;  1V4R A;  2ZNY A;  3ZPL A;  3HOY J;  4BBS J;  4UB6 C;  5JI6 A;  1FLI A;  1IN4 A;  1OMI A;  3HJE A;  5CVU A;  3ZMV A;  1QA6 A;  2QSG X;  2MLG A;  3KEQ A;  2VC0 A;  5K7H A;  3J80 Z;  3HUG B;  2Q1Z B;  1UG0 A;  2BHZ A;  1J59 A;  1LEA A;  3I56 I;  2GIV A;  3CC4 I;  2DOA A;  3KEY A;  2LKX A;  1OYY A;  4WXD A;  4NC8 A;  4M3G A;  2A5Y B;  3DLA A;  1K4T A;  1YJN I;  2JRT A;  4PGG A;  1JGS A;  2DMP A;  4BHC A;  2PMH A;  2OF7 A;  1XN7 A;  3V4G A;  3ZGK A;  1Y39 A;  5ILS A;  1QU3 A;  1X2N A;  4FE4 A;  3CUQ C;  3RYP A;  4C3J J;  2ZME A;  4LK1 F;  2NAZ A;  3WTX C;  3JCU C;  1KZH A;  3H5A A;  2M34 A;  3I71 A;  3FMQ A;  1MJ9 A;  2RN7 A;  3S15 J;  1SMY F;  2P7C B;  1QQI A;  1K79 A;  4WX9 A;  3H36 A;  3C2B A;  2YSR A;  1ULY A;  2E7W A;  2NS0 A;  4YIF A;  3GEZ A;  2ZSH B;  4BE0 A;  4IOC F;  1IN5 A;  2P7V B;  3BTL A;  3SZG A;  4PGH A;  3WTV C;  3MKW B;  2D45 A;  3KP4 A;  3K6G A;  1R49 A;  1KU2 A;  2H1K A;  3UR3 C;  3KEO A;  2EIJ H;  4FX4 A;  3IWZ A;  4BXU A;  2XB5 A;  3V8K A;  2PX9 A;  1DP3 A;  3BY6 A;  2HS5 A;  3MD2 A;  1FTT A;  1ZGA A;  1SVM A;  1VQL I;  2X48 A;  4E7L A;  2VE9 A;  2W48 A;  5BNG A;  4UUS B;  2FMY A;  1WVR A;  1Z91 A;  4XQF A;  2RC4 A;  2R5Y B;  3A03 A;  3LQR A;  3AL0 B;  4M9S A;  1HW2 A;  3GFJ A;  2XAF A;  3BTI A;  2ZFW A;  2FEZ A;  4RAF A;  3EUA A;  5AIQ A;  4CCM A;  5H2F C;  2ISZ A;  4E7S A;  3IWF A;  2PN6 A;  1TW2 A;  2M7A A;  5GP9 A;  3L00 A;  2CJJ A;  3WE3 A;  2EIN H;  2HTS A;  4A0X A;  1W5S A;  3DF8 A;  4HQE A;  2IGK A;  2KJB A;  3IAM 2;  2W24 A;  4U0Y A;  3P9C A;  3HHH A;  1RNL A;  3GTO J;  4U7B A;  2Y2Z A;  1HLV A;  3OIO A;  4B3A A;  3CJT B;  3QPT A;  1XPX A;  1S7E A;  5DV5 A;  3I4M J;  4FCY A;  1IRZ A;  4LLL A;  1X4P A;  4II3 A;  3LSJ A;  1MMG A;  3S93 A;  1FNN A;  4OIR F;  2E36 A;  2RVC A;  4XIC A;  3FF5 A;  3R4K A;  1DGW Y;  2NRA C;  2D5V A;  2ELH A;  2FA5 A;  3CCM I;  2OAZ A;  1E2X A;  2P5V A;  1BR4 A;  2VON A;  1WQ2 A;  2VBX A;  2FOK A;  1JTY A;  1V55 H;  1BA5 A;  3H9G A;  1ZTR A;  4XLC A;  1MMD A;  2B63 J;  1WI3 A;  2MA3 A;  3HG9 A;  2KIQ A;  1SFX A;  3BDD A;  3DEU A;  5L3F A;  1X19 A;  3PJR A;  2HOS A;  4Z6Y A;  1UB9 A;  4HST A;  2XF6 A;  2QKM B;  2Z9O A;  5TIS C;  3MEX A;  2MW8 A;  2JQ7 A;  4D7M A;  1FSH A;  4G12 A;  1MBF A;  1ETV A;  1XD7 A;  1W7P B;  3QAH A;  2A05 A;  2IAI A;  3OYN A;  1QBJ A;  2CUJ A;  2HWV A;  5J4V A;  4ZTF A;  4RAY A;  2VKD A;  3I0T A;  5HLI A;  1YO5 C;  1B72 B;  5KNL A;  1HBX G;  4AYB A;  3KIO A;  3R60 A;  1HQC A;  4JP0 A;  2DA2 A;  4IHS A;  2MG4 A;  5J40 A;  2GXB A;  2ZCW A;  1P4X A;  3MWM A;  2EV6 A;  3K1M A;  1FYL A;  1YE9 A;  3K4B A;  3HZJ A;  2KKO A;  4XL9 A;  1D1A A;  1HW1 A;  4B3X A;  2X6Y A;  3DQV C;  3JAM Z;  2R7R A;  2EZK A;  2O03 A;  3N97 A;  1QHH D;  1ZYR F;  1OCR H;  4DGW B;  3DU6 A;  3M1E A;  4DYR A;  4HDV A;  1TP4 A;  1F43 A;  4BY1 J;  2X6X A;  1ZRE A;  4N9H A;  1DQU A;  3HOV J;  4M3E A;  4IRG A;  1MIJ A;  2BY0 A;  2CH0 A;  2XAS A;  3OR1 C;  4UUV A;  3A4C A;  3FK7 A;  3RI4 A;  1T8I A;  2ZKZ A;  1D5Y A;  3P9I A;  4IL6 C;  3RIR A;  4IPA A;  2RNJ A;  4RGR A;  1RUN A;  1W7P A;  5CKT A;  4XKV A;  1VND A;  3KLO A;  4L5J A;  3MN2 A;  3FXU A;  2VN2 A;  2MFZ A;  1B72 A;  4DYQ A;  4QPO A;  1FT9 A;  5HS7 A;  3TO6 A;  4RMN A;  2A6E F;  1ZEL A;  5HLT A;  4OAY A;  3FXM A;  1F36 A;  3SFI A;  2KMU A;  2R4G A;  4EJV A;  3EYI A;  4EM2 A;  2XGE A;  5FB2 A;  1X4O A;  2EFW A;  1XG1 A;  1WI9 A;  5D6F A;  1IAW A;  1EKE A;  4BQN A;  3ABM H;  3OYK A;  4BDZ A;  3R61 A;  2CFO A;  2ESH A;  3J81 Z;  2XC7 A;  4KIS A;  2F2E A;  4Q47 A;  1X3U A;  3BTC A;  2DFH A;  2L9N A;  2E35 A;  3S8P A;  1KU9 A;  1YW9 A;  1NK2 P;  1P7I A;  3OSF A;  1JUM A;  3T8T A;  4PJ0 C;  4HRI A;  4LK0 F;  3ERM A;  4YIR X;  2A61 A;  1ITY A;  1JI8 A;  4ZYE A;  1SFE A;  2HQN A;  3DBR B;  3WOD F;  3CMA I;  2JWT A;  2Z33 A;  3OMY A;  1LFB A;  1ZK8 A;  4HQM A;  3TP3 A;  5F6F A;  2EIK H;  4I99 C;  2E2J J;  3GWZ A;  1J09 A;  4KDP A;  1BJZ A;  3I64 A;  1UG2 A;  3SZP A;  4BQQ A;  1GT0 C;  3HDD A;  4LOC A;  5J8C A;  1QPI A;  3G2B A;  3U21 A;  4P96 A;  1KA8 A;  1I1G A;  2LC2 A;  2HXO A;  2WAD A;  3GCM A;  1K7A A;  2IGO A;  2ETH A;  1P7J A;  1AKH A;  2MD0 A;  2GLO A;  3J7A O;  2TRT A;  2I5U A;  2WV1 A;  2HYJ A;  1O7L A;  3LFK A;  1TQI A;  1YIT I;  3ABL H;  2L3D A;  2L5Q A;  3WG9 A;  2KL4 A;  3I59 A;  3JW4 A;  1RES A;  4KNY A;  2FX0 A;  2QM3 A;  1P9Q C;  2YU9 J;  2XAU A;  2KRH A;  2ZME C;  2GM4 A;  2DOF A;  4I0A A;  2R7Z J;  5JHU A;  2VT2 A;  4OU0 A;  4BYY A;  4A3I J;  2IA2 A;  4KT5 C;  5CLS A;  4CCN A;  4AIJ A;  2AQE A;  3TKY A;  4BEH B;  3HOZ J;  3EPZ A;  1U8B A;  2LMD A;  2XB0 X;  3FMS A;  1BIA A;  6PAX A;  2BGC A;  3HPH A;  4M73 A;  2XF7 A;  2HI3 A;  1S72 I;  3K10 A;  3FXR A;  5M5X J;  3BC8 A;  3M9A A;  3ELK A;  4BE2 A;  1B8I B;  2KP6 A;  2QKL B;  2OU2 A;  5EEA A;  1Q1V A;  3SJM A;  3JTG A;  4L5E A;  3ZQH A;  2NS7 A;  3HGY A;  4KN7 X;  5BMZ A;  1ODD A;  1TWA J;  2BHY A;  2K9Q A;  4JQF A;  2BEO A;  3O8H A;  2IT0 A;  3NQO A;  1HXD A;  3F72 A;  3P7N A;  3VSK A;  4QPQ A;  3EQL F;  1KQ0 A;  2H94 A;  4A3G J;  3OS0 A;  1LEB A;  4HG2 A;  4RGX A;  4RDU A;  3CC7 I;  2VQH A;  3AL0 C;  3RQ4 A;  1LKX A;  4V2F A;  1VQ9 I;  1LE8 A;  5GTI C;  3RKW A;  1KQ9 A;  1FBU A;  2JPB A;  1GLN A;  2CW7 A;  5ED4 A;  3U2R A;  4EGZ A;  2BBY A;  1XGO A;  3HB9 A;  3R0A A;  1B6A A;  3T1B A;  1G4D A;  1V54 H;  2X51 A;  2A3S A;  4BXF A;  4EJU A;  1R36 A;  3HUG A;  3LA2 A;  3CO7 C;  3ZQL A;  2GQQ A;  1U3E M;  4GO1 A;  4C30 A;  4HDU A;  1OKR A;  1G59 A;  3S1N J;  3M8E A;  1S29 A;  3T0Y A;  1Y8R B;  2JA8 J;  1GVJ A;  3J7A Y;  5DCM A;  3HXL A;  2R7T A;  3A0H C;  3OYM A;  4HNU A;  1WJF A;  5CQE A;  3QQA A;  2XRN A;  2KIF A;  3OYC A;  4MQV A;  1RKW A;  2VPL A;  1FTZ A;  3ZOB A;  3FMR A;  4A2U A;  5CJ9 A;  3WTW C;  2Z16 A;  3HIF A;  3BR3 A;  4KIG A;  4E70 A;  1X3Z B;  2O3F A;  3DXJ F;  1FC3 A;  2E5N A;  2OCC H;  5M5W J;  1ON2 A;  2G7H A;  4UB8 C;  5DDG A;  1H8A C;  4F92 B;  1IV8 A;  1S9H A;  4HF1 A;  4U7D A;  5EGO B;  3A01 B;  4HF0 A;  3D1N I;  1TL8 A;  2VJI A;  3TDZ C;  2MBF A;  1FY7 A;  2DT7 B;  2MH9 A;  5CVI A;  2GBY A;  3EUH A;  3S1M J;  4II2 A;  3Q5F A;  2UV1 A;  2IS6 A;  5GPA A;  1JJ6 C;  3Q9V A;  4U88 A;  3WGG A;  1TWF J;  1YW7 A;  1E3H A;  2LF7 A;  4LG0 B;  3U1K A;  2YU3 A;  2KIU A;  1M1E B;  2A69 F;  3CP2 A;  5IYD J;  2WAE A;  1YJ9 I;  3K4J A;  3CCV I;  2VL8 A;  2CFX A;  2R0Q C;  2K27 A;  2CRG A;  2XGD A;  3GLL A;  2CS3 A;  3F9K A;  4HEA 2;  2HNH A;  4BU2 A;  3DPL C;  1Z3Y A;  1IDY A;  3JRF A;  3RKQ A;  2P6T A;  2E2I J;  4FET A;  3B73 A;  1XMA A;  4YFN F;  5JVG F;  1MH4 A;  1IG7 A;  4IRI A;  4Y33 A;  5E20 A;  1POG A;  1SMT A;  2DOD A;  2WB1 N;  3ZQ7 A;  2BY3 A;  1U5T C;  1RKT A;  3CCS I;  2EV5 A;  2L7M P;  2VE8 A;  2LG4 A;  4EQQ A;  3S17 J;  1IJW C;  4FX0 A;  5C3E J;  1Y6I A;  3KPH A;  1KGS A;  1ZAR A;  1FP1 D;  1VQK I;  2IA1 A;  1DPR A;  1BL0 A;  1ETQ A;  4OWR B;  3CJR B;  4S04 A;  5E3N A;  1R22 A;  4AVZ A;  1LVA A;  1T56 A;  4NHJ A;  3R0J A;  4EGY A;  1TZL A;  4D5F A;  1LDJ A;  1SAU A;  2STW A;  1T0F A;  3QU3 A;  3H0D A;  2DU9 A;  2JZY A;  2QBY B;  4YII A;  1DGR M;  1R5H A;  5JR3 A;  1OCZ H;  1TNT A;  1S5L C;  2FOW A;  2XGC A;  5E18 F;  3COA C;  4PCQ A;  2L4A A;  3DU5 A;  2MAB A;  1MBE A;  5HS9 A;  1NH3 A;  1MDM B;  5IYB J;  3HC7 A;  4ZYD A;  2DMN A;  2VJ4 A;  9ANT A;  3HOX J;  1R71 A;  4HA8 A;  4AUX A;  3S14 J;  1ERD A;  1K61 A;  2Y31 A;  4RM2 A;  3CCU I;  2ICW G;  3F8C A;  3JSP A;  3HSR A;  2VC1 A;  3OIP A;  4M3F A;  3LNQ A;  5FLV A;  1FOW A;  3CCY A;  4HX4 A;  2L7Z A;  4F55 A;  3H9Q A;  1O3Q A;  3H0G J;  3TW7 A;  2Z3Y A;  3KYL A;  3AG1 H;  2A07 F;  4AIK A;  1HCR A;  1U5T A;  4A93 J;  2K02 A;  4YRV A;  4A3D J;  3BP8 A;  3W6K B;  2MC4 A;  2E1O A;  5LHI A;  2LH9 A;  3FIW A;  3SQN A;  2ADU A;  2O6G E;  1IXC A;  1I3Q J;  3KCC A;  3PNY A;  2CUZ A;  4LLG F;  4DOZ A;  2I10 A;  1OJL A;  2X1E A;  3LSR A;  1TLH B;  4IHV A;  1OQY A;  4AM3 A;  3PIP F;  3E5X A;  4JK1 X;  5LLQ A;  1QGP A;  4EV0 A;  4HPQ A;  1MDM A;  4IOA F;  2JJ7 A;  4I6Z A;  1EA3 A;  1W4M A;  4XON A;  3C2G A;  2ID3 A;  3H5R A;  1MGT A;  2ME0 A;  2ME6 A;  2Y48 A;  4ZYH A;  3K4N A;  1YIJ I;  2K4J A;  3I4P A;  3CC2 I;  3HKZ N;  1MZB A;  3E7L A;  2ESN A;  5CVR A;  3ECO A;  2HZT A;  5EEH A;  2RQP A;  1PUF B;  3KLN A;  2VOD A;  2IVM A;  4S05 A;  1BR1 A;  3ULQ B;  5C44 J;  2R92 J;  4C2U A;  1V5F A;  1WH7 A;  3DTI A;  3JSO A;  5TRD A;  5HLH A;  2HYF A;  3BCA A;  3IRQ A;  4BUP A;  3OYG A;  4DJA A;  2IS4 A;  1T33 A;  4Y15 A;  3N05 A;  3BR5 A;  4D7N A;  1D1B A;  2FSW A;  5KAI C;  4MQ9 F;  2DDA A;  2B7E A;  3RKX A;  2DXI A;  3M07 A;  4QSH A;  1KYZ A;  4M3D A;  4CYC A;  2QF7 A;  2EH3 A;  2DPD A;  4B8X A;  3GTK J;  3ZQQ A;  3FXJ A;  3KX2 A;  4Y13 A;  4Y4R A;  4XSX F;  4BL0 B;  5E3O A;  5F0C A;  2BXZ A;  2K4B A;  3BZC A;  1CF7 A;  4XKW A;  4MEY F;  4B43 A;  2H8R A;  4QTR A;  3W3C A;  3S3M A;  5JFR A;  1ZRC A;  1IUY A;  3LA7 A;  4G6Q A;  1KON A;  5FRO A;  1MBG A;  1IDZ A;  3F8N A;  2OBP A;  4EM0 B;  4PZJ A;  4FHT A;  2GOX B;  2O8X A;  1UHM A;  2F5D A;  3HOU J;  1ZAO A;  2LY2 A;  4BJ5 C;  2V6E A;  4IHW A;  1APL C;  1RR8 C;  5B1B H;  4BAC A;  5IOZ A;  3S2H J;  1UEL B;  1ETY A;  2Y30 A;  2W82 A;  1Z1D A;  5K5O A;  3G71 I;  2EA4 A;  3GTL J;  3KP5 A;  1FMW A;  5LGU A;  5EJC A;  2IEK A;  4RB2 C;  4U0W A;  1O3T A;  3G3Z A;  5DEQ A;  3HYI A;  4H4K C;  1YQA A;  2AO9 A;  1PP7 U;  4ZDP A;  2M2E A;  2LBF A;  4PFP A;  3VSL A;  5IT3 A;  3DTE A;  4YEJ A;  2V1D A;  4MHG A;  3KET A;  4LIV A;  2D1H A;  4YG2 F;  1E3P A;  3IL2 A;  3SZT A;  5IP9 J;  2BV6 A;  1UHW A;  5L3B A;  1FBS A;  2VOO A;  3I4N J;  3FDY A;  4A6D A;  1VQ8 I;  1DPU A;  1MJA A;  3IHU A;  1YX3 A;  3A2K A;  1VI0 A;  2Y0S N;  4MIM A;  4KN4 X;  2R7F A;  1WZ2 A;  2WAQ N;  2WAQ A;  2P81 A;  4KJZ A;  5DTD A;  3IAS 2;  3ZQG A;  3DLL F;  3CZ6 A;  5TJJ A;  3IP4 B;  1K83 J;  4XM3 A;  1WFX A;  3GME A;  2JTV A;  1JXS A;  1TTY A;  2RQQ A;  5D4S A;  2V1U A;  1XC5 A;  2M8E A;  2R5Z A;  4UNO A;  3RQI A;  5F08 A;  2ZJP F;  2F5V A;  1A04 A;  4RGU A;  3OOU A;  1ENH A;  2R7V A;  4CCJ A;  1EV7 A;  3BG3 A;  4A3L J;  4CCO A;  1ETK A;  4HF2 A;  3V7R A;  3VYR B;  3CCQ I;  1D0Z A;  3BQZ A;  3F0C A;  3IC7 A;  1Z6T A;  1N25 A;  1D0X A;  1YJW I;  3WU1 B;  1G2H A;  5LRS A;  1P6R A;  3J80 K;  2HDD A;  3EET A;  2LRD A;  2HGC A;  3AAF A;  1I27 A;  2HPM A;  1FBQ A;  2W1O A;  3BT9 A;  4UHT A;  3MKZ A;  1G3Y A;  3HM5 A;  1T38 A;  4M74 A;  3D5R C;  4BBR J;  1D1C A;  4A3B J;  5L3D A;  3Q0V A;  3MZH A;  1B1B A;  5ICC A;  4C3I J;  1BC8 C;  1GV5 A;  4BGD A;  2LR8 A;  1LFU P;  1DP7 P;  1Z0X A;  4U87 A;  3PUF A;  3E3V A;  3S3N A;  3LSG A;  1ETX A;  2HTJ A;  3KP7 A;  1R1U A;  2O9L A;  4O6J A;  1NTC A;  3TQN A;  5JLX A;  3I53 A;  2CUE A;  4F3Q A;  4ETS A;  1N75 A;  2FRH A;  1RC9 A;  1HDD C;  3ZP5 A;  3QPS A;  5K5Q A;  4ZTJ A;  1QZZ A;  2CYY A;  2EFN A;  3AFH A;  3KZI C;  3VYU B;  1E0E A;  1BOA A;  4GRI A;  3AG4 H;  1XSD A;  2JRM A;  4HLY A;  2XHK A;  5JHF A;  5EGO A;  2NVY J;  3A01 A;  2W25 A;  3LSM A;  5IT9 Z;  2KIM A;  3F8B A;  3NAR A;  3DCF A;  2RKH A;  1IO2 A;  2VAS A;  5DS9 A;  2DO7 A;  2CQX A;  3FIS A;  2EIL H;  5E1X A;  2WA0 A;  5AIP A;  2IJL A;  2Q8K A;  2M4G A;  3I3L A;  4P9U A;  1K6Y A;  1XX5 A;  2E34 A;  3CDL A;  4LFU A;  1UCR A;  1TBX A;  4LIU A;  4B48 A;  2VQL A;  4LG0 A;  2H09 A;  1O4X A;  1IC8 A;  2CV1 A;  1J9I A;  2CQK A;  1B59 A;  4BJT A;  4IX7 A;  2Q2E B;  4LJZ F;  1ETW A;  2W4S A;  5CYV A;  3ABU A;  2WWY A;  4XSZ F;  3QWL A;  4N0B A;  4CA0 A;  3V42 A;  3LL7 A;  1WH5 A;  2L9R A;  2P8T A;  3WGH A;  2NNN A;  3AKZ A;  3HL2 A;  1Q1H A;  4MEX F;  3ECH A;  4EM1 A;  5J47 A;  3HRM A;  5B66 C;  2O61 A;  5F0F A;  4IEJ A;  1YLF A;  4B44 A;  2F5F A;  4E7J A;  2EK5 A;  1A6I A;  2Z2S B;  2FE3 A;  3RSN A;  4HV5 A;  2E5Z A;  3FX3 A;  3FHZ A;  1IUF A;  2RNG A;  4CZC A;  1WJD A;  4C2M J;  1IRF A;  3K4M A;  3GBG A;  5DUK A;  1GVD A;  4XLF A;  3PIO F;  1BIB A;  4PJN A;  2X0L A;  3DPT A;  3KZY A;  3EUK L;  4Y52 J;  3LWF A;  2E7X A;  1TWC J;  5HS8 A;  2X1D A;  3Q3S A;  1I3A A;  5EZH A;  2OTL I;  2CU7 A;  3CDH A;  3P9K A;  2KDZ A;  1ZGJ A;  1OCC H;  4F91 B;  5J8F A;  1X1C A;  1SVL A;  2VLA A;  4MTD A;  5C4J J;  1VQO I;  2BZT A;  2V7F A;  4OOI A;  1FZP B;  2VBW A;  2E1C A;  2ELJ A;  2CG4 A;  5JLW A;  2R7S A;  5KK1 A;  2VPR A;  3CCR I;  2JUG A;  2OUM A;  2P5K A;  3R6S A;  4BNC A;  4CCK A;  1S7O A;  2VQC A;  4PJL A;  2HEO A;  1DU0 A;  4LLN A;  2HZD A;  2MC3 A;  5GAH J;  1RZ4 A;  3FXL A;  4Y3O A;  1W1W E;  2WAF A;  1B9M A;  5K1Y A;  4I76 A;  1SFO J;  1X3W B;  4WXH A;  5ILU A;  5KAF C;  2NXN B;  2EZL A;  2K9S A;  2J5O A;  3O8G A;  4DBR A;  2ELK A;  1U5T B;  4D1Q A;  2JSP A;  1CGP A;  3G4S I;  2CW0 F;  5FGM A;  5HNF A;  1H9T A;  1R6R A;  1U2W A;  1JT0 A;  3JAM K;  4E7H A;  1BBY A;  1FIA A;  3FM5 A;  3E1S A;  3D5S C;  4WXC A;  3T5X A;  4EAT A;  4HNV A;  3M1C A;  2VXZ A;  4MFE A;  4MO7 A;  1VQN I;  4KMF A;  3V8J A;  2JT1 A;  4AD9 A;  4RB1 A;  4RA2 A;  4IKF A;  5E1W A;  1HOM A;  2I8D A;  3GFI A;  2DK5 A;  3NWT A;  2HR3 A;  3BQY A;  3QU6 A;  3CLQ A;  4GGG A;  4XN3 A;  2KHM A;  5DCF A;  3KYD B;  4G7O F;  3CUQ A;  2AXL A;  5ICG A;  3ZMD A;  3BG9 A;  1H0M A;  3FXK A;  2DTR A;  1G3S A;  1JHH A;  1PVE A;  4M71 A;  3J7Y J;  3MZY A;  3S1Q J;  2CQ7 A;  2C6Y A;  3BPX A;  1J2X A;  3CCE I;  1R4M B;  1MBK A;  3J81 K;  1I6H J;  1JTX A;  3RZO J;  2KPM A;  4IHY A;  2EIM H;  5EG0 A;  3ZQF A;  4Q48 A;  4XRS G;  5F27 A;  3H3U A;  1BM9 A;  2EBI A;  2FNP A;  2A68 F;  2RGV A;  3WHC A;  1BC7 C;  1XDU A;  2L0K A;  3M3Y J;  1R1T A;  3BRO A;  1P92 A;  5DUI A;  5IPA A;  4WK8 F;  4J00 A;  2WV0 A;  1VF9 A;  1Z9C A;  4F7Z A;  1RUO A;  1DDN A;  1FMV A;  1UHS A;  3OYI A;  2K40 A;  1WPK A;  2N8G A;  1V5E A;  1FSE A;  1WRJ A;  4BS9 A;  2QSH X;  2R7O A;  2G7U A;  3S2D J;  4BKX A;  4EJT A;  2GXG A;  3HTU A;  1OIS A;  5IT9 K;  3OYF A;  1PUE E;  4BQA A;  1EJ9 A;  2W57 A;  3FZV A;  1WJA A;  4WCG A;  4RB0 A;  3WHB A;  4N9I A;  4L0Y B;  3WTS C;  2HDW A;  5HVQ C;  1MMN A;  1OYI A;  2W84 A;  3GTJ J;  2V1X A;  2LY9 A;  5A2Q K;  1XMK A;  3I5U A;  3OYL A;  2R7D A;  2EZH A;  1P4A A;  4P5O A;  3X2Q H;  4ZYA A;  3WU2 C;  3QOD A;  2LKP A;  5IOY A;  3W2A A;  4A0Y A;  2GZW A;  3BJA A;  2DQR A;  1S3J A;  2HPI A;  2HQR A;  4NC7 A;  1QRY A;  2FNA A;  4YEL A;  5J1U A;  3TOB A;  1JUS A;  5GAE J;  2VIX A;  1FP2 A;  2XPV A;  1MKM A;  1G8X A;  3Q9S A;  4BDY A;  3LSP A;  1TWH J;  1I50 J;  4G94 A;  2DAO A;  1AU7 A;  3WE2 A;  2KRC A;  2JA6 J;  3A0B C;  2XSD C;  4PJM A;  2EB7 A;  2M7B A;  2OD5 A;  2JA5 J;  4L18 B;  2R7Q A;  5D5W B;  2DMT A;  3LSI A;  3MCZ A;  1HST A;  4AVP A;  2ZB9 A;  5DM7 F;  2H27 A;  1MBJ A;  5J1R A;  2CMP A;  4LB6 B;  4FAS D;  3F23 A;  4BE1 A;  4OIN F;  2HOE A;  4XLA A;  4DBQ A;  1YI2 I;  5D5U B;  3K1N A;  1TC3 C;  3W6J B;  3QPL A;  2CQN A;  1WJE A;  4I01 A;  4LIT A;  4HZF A;  3HGG A;  1NG6 A;  4P1W A;  2VBY A;  2K7L A;  3BG6 A;  4B1R A;  4X0G A;  1VZ0 A;  3HOT A;  3HPG A;  1VQ7 I;  4DZP A;  4AYB N;  4B47 A;  2GWR A;  3M8J A;  3REO A;  2CWE A;  3U1D A;  1WJB A;  1YFH A;  5LHH A;  1ZGW A;  4ZC3 A;  2HDC A;  2R5Z B;  5FKK A;  3CTA A;  3F6V A;  1ZR4 A;  3D0S A;  4BY7 J;  4AWX B;  1O3R A;  2IA0 A;  2PG4 A;  2MH2 A;  2AQF A;  3F8F A;  4XN0 A;  1VFC A;  3PO2 J;  3L2V A;  5LFA A;  2DW4 A;  3SYT A;  2PJR B;  2Z5U A;  3K70 D;  4A5M A;  2RRE A;  3PO3 J;  2DMQ A;  1QVU A;  3I9V 2;  1IN6 A;  1Y8Q B;  5BOX A;  3OV8 A;  1H9G A;  3C18 A;  4XNF A;  3UKG A;  4G6D A;  5ICE A;  1GDT A;  2O8K A;  2EQR A;  3K0L A;  4RBO A;  4V19 K;  4CGZ A;  2ECC A;  2OPT A;  2Y69 H;  3AG2 H;  1IZ1 A;  5EF6 A;  1IV6 A;  3L7W A;  5JVT A;  1UMQ A;  3DKY A;  3GTP J;  3BLY A;  3C2H A;  5DYM A;  1KQ8 A;  3RJP A;  1MJB A;  1TT5 B;  4WWC A;  5ERI A;  2JUC A;  1MD0 A;  2FD5 A;  1R58 A;  2M0C A;  4M9Z A;  2OTJ I;  4HYE A;  3S32 A;  4A3J J;  3F21 A;  2ZXI A;  2YX4 A;  3RPU A;  3S3O A;  5FLM J;  5E17 F;  4JBA A;  2VXD A;  3RPU D;  3IH3 A;  2D1V A;  5HDG A;  4CCL A;  4EJO A;  2BW3 A;  1WHU A;  4RLQ A;  2PJR A;  3FK6 A;  1IN7 A;  4I09 A;  4IHX A;  2LF8 A;  2DPU A;  4QWQ A;  2PMZ A;  2V9V A;  3H5N A;  3CF5 F;  3DWL E;  3PFI A;  5HOD A;  1Z21 A;  2DLL A;  4FT8 A;  1EH7 A;  4FE7 A;  3S16 J;  1QO0 D;  1R1V A;  5FJ8 J;  4PDK A;  2M4K A;  2DA5 A;  3GZN B;  4X6A J;  4G6T B;  1F1Z A;  2M3A A;  1K78 B;  1WWX A;  2H1L A;  4OIQ F;  3EYY A;  2IBD A;  1SD4 A;  4G7H F;  4XLH A;  4CYC B;  2ZXW H;  2L9V A;  3DEW A;  3NWS A;  2OCE A;  2UXN A;  1FJL A;  3PQJ A;  3N4M A;  2PQ8 A;  2CW8 A;  1CF7 B;  1SEU A;  1I39 A;  5CPR B;  3OYD A;  2LD5 A;  1TWG J;  4E6K G;  2EPF A;  2KDO A;  2V9P A;  2PLY A;  2QQA A;  3DP7 A;  1WJC A;  2KIS A;  1QZE A;  5LHG A;  4HNT A;  2K9L A;  2FQ3 A;  1P2F A;  3LA3 A;  3OOP A;  2E2H J;  4OIO F;  2F6C A;  4KUM A;  2B9S A;  1K4S A;  3SEQ A;  3FXQ A;  4Y17 A;  2L54 A;  1MBH A;  2R7X A;  2DFI A;  5A2Q Z;  4RAZ A;  3HBL A;  1K78 A;  2BY2 A;  2UXX A;  4XRS A;  4K2E A;  3TOA A;  3HKZ A;  3K2Z A;  4IXA A;  3KE2 A;  3PL8 A;  2LK2 A;  3CJQ B;  2STT A;  4R79 A;  1R00 A;  1I5Z A;  1UZC A;  4ESF A;  3O6B B;  4XOP A;  1W36 C;  3F6O A;  2DT6 A;  2QA4 I;  2BVL A;  2DCE A;  3HSF A;  1Z3X A;  4OMZ A;  2ECB A;  3MKL A;  1HKQ A;  4E7I A;  4FQG A;  4E4H A;  3HRS A;  4HLX A;  1ZG5 A;  4NUB A;  3HOW J;  3BOQ A;  5J6X A;  1I6X A;  1SD7 A;  2DBB A;  3G1O A;  2PMU A;  3W2W A;  3FBN B;  2CO5 A;  4PK4 A;  5K7F A;  2R5Y A;  3GTG J;  4JX5 A;  4UVC A;  2LOO A;  1R5I D;  4U0V A;  4L9V A;  4YFX F;  5DCM B;  4LGW A;  1YRN B;  2KFD A;  3NAU A;  4IJA A;  2HQA A;  3KFW X;  2JPC A;  2XRO A;  3B02 A;  3BG7 A;  3HTS B;  1FWZ A;  3L2Q A;  1WJ5 A;  3CES A;  2BVM A;  5L3G A;  1CQT A;  1DU6 A;  2ZXH A;  2XDV A;  5FKM A;  2DDB A;  1K6O A;  3OYB A;  1U9O A;  3SDG A;  2P5L C;  4KIB A;  2GAU A;  5B5E C;  2LTP A;  5FRN A;  4GDF A;  1BI0 A;  1ZRF A;  1ZRD A;  3RKY A;  2X4H A;  1O7F A;  5GAD J;  4GYG A;  3W2V A;  5BQT A;  4XKC A;  2Y75 A;  4RB3 C;  2V26 A;  3L2R A;  1PJR A;  3WG7 H;  2GOM A;  1RIO H;  4N4N B;  3BR2 A;  2NNY A;  2IP2 A;  3H35 A;  4ANJ A;  3EDP A;  3J7Z I;  3A1Y A;  1X1P A;  1YW8 A;  3MQ0 A;  3VPR A;  3ZN0 A;  2W00 A;  1FOK A;  3GFM A;  1BN5 A;  1J5Y A;  3CDI A;  1XCB A;  2RAE A;  2V4J C;  3BJO A;  3SHF A;  1A36 A;  2M9H A;  4KT6 A;  5EG0 B;  4XRM A;  1JE8 A;  4Q4Z F;  2OA4 A;  3QYF A;  5KHD A;  2QVO A;  2O5R A;  2DT5 A;  2LVS A;  1AOY A;  2V79 A;  1MSE C;  2QCO A;  4JOM A;  4IF4 A;  2OQG A;  2QSF X;  3TMO A;  4IO9 F;  1S6L A;  2GXA A;  5ICF A;  1XCV A;  5IYC J;  4GXO A;  1TNS A;  4MFD A;  3U9G A;  3F3X A;  3HHG A;  5F1J A;  3LAP A;  2EJR A;  1XS9 A;  3DPU A;  1ETO A;  3V8L A;  1I1S A;  3SFZ A;  4KMU X;  5F64 A;  1O3S A;  4NQW B;  4FTH A;  5DD4 A;  1V5G A;  2WB1 A;  3IH4 A;  1T08 B;  3GUD A;  1H88 C;  3O2P E;  5EDN A;  1BI2 A;  2P0W A;  3DEE A;  4LG3 A;  3LSK A;  1MNM C;  2L7F P;  4QLC U;  1R4N B;  4IZZ A;  1FOX A;  2KLO A;  5FKN A;  4F52 A;  1RET A;  4ENN A;  3L2U A;  3HEF A;  3JRI A;  4R8H A;  4EJW A;  2M5W A;  3OYJ A;  3BZ6 A;  2X6W A;  2XKO A;  2NVU B;  2R3S A;  4AID A;  5ILV A;  2P4W A;  3LAJ A;  2VB6 A;  4M3B A;  4H0E A;  1IN8 A;  1X2M A;  1Z77 A;  5K7Z A;  3RYR A;  2BE5 F;  2HOA A;  2OJE D;  2XPU A;  4XLP F;  3OYH A;  3ZMU A;  2OV7 A;  3L9F A;  1IGN A;  5M5Y J;  1A35 A;  2B0L A;  2UUZ A;  5FD6 A;  5LD2 C;  5GAG J;  2ZBK A;  1TW3 A;  1UJ8 A;  2DYR H;  3NRV A;  3MKY B;  1JHF A;  5M3F J;  2ACJ A;  3OWT A;  3Q0U A;  5J4Y A;  2PJP A;  1D0Y A;  1HW5 A;  2ID6 A;  4V2G A;  2A6H F;  1ZLK A;  2E71 A;  4ENK A;  2HOT A;  2CQQ A;  4GFB A;  4CO8 A;  2LYC A;  5IY5 H;  2Q0O A;  2M87 A;  2M1B A;  2HU9 A;  5J1Y A;  3CD6 I;  3ASO H;  5B3S H;  3C1D A;  3CMM A;  3VYS B;  4CZZ A;  3I55 I;  4XMY A;  4NB5 A;  2F5E A;  2PMZ N;  2L2O A;  1BJA A;  1LPQ A;  3ZMS A;  2FJ1 A;  1TT0 A;  1LNW A;  4G9Y A;  5EEG A;  4X1E A;  4DIQ A;  1QNT A;  2NVQ J;  1ZH5 A;  3ML6 A;  4HAM A;  3ZMZ A;  5F0H A;  1ZHF A;  4KA4 A;  1LFP A;  2E1M C;  2E19 A;  4W1U A;  3WU0 A;  3ZCO A;  3ZQI A;  3L2C A;  1AWC A;  2VUM J;  1XSX A;  1YOV B;  4L5I A;  3F8M A;  2PBI A;  3GFL A;  4ENM A;  3PQK A;  2LP0 A;  2PEX A;  1YTY A;  2EZI A;  3VOD A;  2Z99 A;  3BPV A;  3QOP A;  1XMX A;  4HV6 A;  3M8F A;  4PUS A;  3K70 C;  2JVH A;  2QQ9 A;  3IH2 A;  2OZU A;  2VJJ A;  1LDK B;  5BPI A;  3MAJ A;  3TW6 A;  3ZN1 A;  3CP8 A;  3KYC B;  2UZK A;  2JVG A;  2KT0 A;  1ZQ3 P;  1Y1W J;  3CO6 C;  3JRH A;  1OR7 C;  3JTH A;  3BCB A;  1W7P D;  1ZLJ A;  5FFZ A;  1PYV A;  3VDX A;  4Y7N J;  3QP5 A;  2EFO A;  1WSU A;  1OPC A;  1IF1 A;  2Y0S A;  2FF4 A;  4PSW A;  3BR0 A;  3S2W A;  2X6O A;  1X58 A;  3DBL B;  3ZRG A;  4ABZ A;  3B6C A;  4G8X A;  1G3T A;  5LEK A;  2DA1 A;  1O57 A;  4HW0 A;  4BEH A;  1VQ4 I;  1MW7 A;  3SXY A;  1OCP A;  1W5C C;  2L01 A;  1QZY A;  1X1B A;  2X85 A;  2UWM A;  2J5P A;  3C7J A;  1JKQ C;  1ZR2 A;  2QLZ A;  1MND A;  5E3L A;  1NK3 P;  2HYG D;  4J01 A;  3VFZ A;  2BW3 B;  3FBI B;  4NC6 A;  2QEX I;  4MGR A;  2OQR A;  3DBH B;  2IW5 A;  1J0R A;  3ONQ A;  2H6B A;  1J7K A;  5LEJ A;  3MFK A;  3MZ8 A;  2COB A;  3HRU A;  4C3H J;  2FXA A;  2VI6 A;  5GPC A;  4UVA A;  1BI1 A;  2DN0 A;  5GTH C;  3UNG C;  2EFP A;  2CV0 A;  2CUF A;  4I2O A;  3VB2 A;  2F5C A;  2LDU A;  4CHU A;  2FQ4 A;  2QEN A;  4JYK A;  4LD5 A;  5F04 A;  3ZMT A;  5E3M A;  1J75 A;  2MSY A;  2KJC A;  5EYR A;  2GA1 A;  4J19 A;  1T2K A;  1H89 C;  2ZXJ A;  2IS1 A;  1ON1 A;  3GYH X;  2LY1 A;  1GHC A;  1XGS A;  1T98 A;  4BXX J;  2XRL A;  2YX7 A;  3H92 A;  2LKS A;  1LJ9 A;  2LBF B;  5FFX A;  4A6E A;  2W85 A;  1JKP C;  5E1Z B;  4UY8 I;  2XV4 S;  4AC0 A;  1XGM A;  2FBK A;  3B6A A;  4IVN A;  3G1M A;  5HLG A;  2L9S A;  2MGQ A;  1XGN A;  3I54 A;  3ZR8 X;  2QYO A;  4MLO A;  5D6E A;  4EVI A;  4BQO A;  5K5R A;  2QZ8 A;  5DM6 F;  4MNU A;  3WTY C;  1N78 A;  1N77 A;  1U0J A;  2AXT C;  4RLF A;  3RTR A;  3BWG A;  4DQ2 A;  3KP2 A;  2X9D A;  3E5Q A;  2TDX A;  3V7S A;  2L4M A;  3VWB A;  2NS8 A;  3JRE A;  3CMY A;  1Z7U A;  3LMM A;  4JX6 A;  3RPQ A;  1KU7 A;  4ENJ A;  2LFB A;  2YUS A;  4BJ6 C;  1NG7 A;  1OCO H;  4ZZD A;  3GF2 A;  4ZDL A;  3TL4 X;  1RI7 A;  2ZO4 A;  1D8K A;  4NBQ A;  3OS2 A;  1WKM A;  5FRM A;  3K1P A;  3WTT C;  4W97 A;  3GVA A;  1FX7 A;  1LQ1 A;  1HSJ A;  3GO5 A;  3GZ5 A;  3RCO A;  1PP8 F;  2E1N A;  2BXY A;  2FBI A;  3M7G A;  3OL4 A;  4RS8 A;  5F1R A;  1SD6 A;  2XF5 A;  2WBM A;  1MNE A;  1QHG A;  3K9T A;  2XUB A;  3PNT A;  1Z7L A;  2K85 A;  2KRF A;  3L2W A;  2DI3 A;  2VQG A;  4XLE A;  2IGM A;  4A3F J;  3TO9 A;  5H6R A;  1BW5 A;  1KYW A;  3T8R A;  3DKW A;  2AS5 F;  3ROU A;  3OS1 A;  4DZJ A;  1NHA A;  2EV0 A;  4GYI A;  5LBQ A;  1AA7 A;  1HA8 A;  1G6N A;  3HOS A;  4UVB A;  3OYA A;  1B9N A;  2ZSI B;  5E79 C;  1MMS A;  1JUP A;  3BZK A;  5FO5 A;  5H20 A;  2M0M A;  4ASN A;  3W6V A;  1D5V A;  3K69 A;  2EFQ A;  2G9W A;  1U8R A;  1GUU A;  1JGG A;  5C4X J;  4UXN A;  2BOL A;  2HVQ A;  4N4O B;  2WY7 Q;  1Z05 A;  3QOE A;  4KIF A;  3H1C A;  1U78 A;  3E5U A;  3M4O J;  2XKP A;  1BR2 A;  2A5W A;  5B1A H;  5CVJ A;  4XKB A;  1QPM A;  2IGN A;  2WTE A;  1BW6 A;  4E7K A;  2XSJ C;  2MYS A;  1AHD P;  2IXS A;  1VQ6 I;  2R7U A;  2GA2 A;  3H9J A;  4O5V A;  2V9K A;  3BG5 A;  5CVV A;  3CF2 A;  3EUH C;  1IXS B;  2A6T A;  4YFK F;  3S1R J;  2F48 A;  2XAJ A;  5D4R A;  4ESJ A;  2ZFU A;  1VTN C;  1RRJ A;  1YG2 A;  2ZJR F;  3RDI A;  2HKX A;  3PSI A;  1R5G A;  5DD8 A;  4EEF G;  5IP7 J;  2DFF A;  2R93 J;  1FPQ A;  2COM A;  1HDP A;  5FD5 A;  1G3W A;  1KU3 A;  2O7O A;  4L0Z B;  1PDN C;  3PUB A;  2Q2E A;  2PFB A;  4P9F A;  4C2T A;  1S8N A;  4KYW A;  1OLT A;  1SAN A;  3FM3 A;  3ZXS A;  1F4K A;  1YX5 A;  4EMS A;  3QP6 A;  4DYC A;  1D8J A;  3HRT A;  1EH6 A;  4ZDO A;  2DOE A;  3P5J A;  3OY9 A;  3QRF F;  3H3Z A;  3GW2 A;  2NVX J;  5AON A;  2F4M B;  5BS6 A;  4A69 C;  5LGT A;  2DTZ A;  2L7K A;  2HQ5 A;  2ZJ2 A;  4I02 A;  4XBF A;  3IV5 A;  1W0U A;  4PJJ A;  2VOP A;  4XID A;  3OYE A;  1RR7 A;  2JSC A;  4G7Z F;  2V6C A;  5CQG A;  3CUO A;  2ZME B;  4I7H A;  4KIC A;  3G1L A;  2L02 A;  1Y0U A;  2RDP A;  4BH9 A;  5FKL A;  3CME I;  4A12 A;  2VKE A;  3A02 A;  4NNJ A;  4C9Y A;  3K7A J;  5M3M J;  1UFM A;  4M72 A;  4ON0 A;  1STZ A;  1MSF C;  1ORK A;  3MMY B;  3FXO A;  3L1P A;  4A3K J;  2QWW A;  2JK3 A;  1YHQ I;  3ABT A;  3E6M A;  2BYV E;  5KCM A;  2MLK A;  2DMU A;  1QVT A;  1F5T A;  3SEZ A;  3SDB A;  1PUF A;  2RV8 A;  3WTZ A;  4IQ4 A;  2M30 A;  4F93 B;  3G73 A;  1L0O C;  3G6E I;  1EH8 A;  2EWN A;  2Z1D A;  5KVR A;  1E17 A;  4ZZL A;  1YYV A;  2DQL A;  1X1D A;  1BOB A;  4ZJZ A;  1SFU A;  1GXQ A;  1IW7 F;  3GLX A;  4UUS A;  2LRE A;  5HDN A;  3GXO A;  4CSW A;  3CCJ I;  5FLX K;  2VKH A;  2XGX A;  2ZJQ F;  3FHN A;  2HKO A;  3TDU C;  4IQJ A;  2VJ5 A;  1WGX A;  3WGI A;  1JJ8 C;  2YS9 A;  4HBL A;  4UV9 A;  4A3M J;  4Q5S F;  3I59 B;  4CH7 A;  2W7N A;  1Y56 A;  4L9J A;  3ISP A;  4ESB A;  2D2W A;  4QIW N;  3KP3 A;  1Y1V J;  1L3L A;  2NYX A;  4HOB A;  1FOY A;  1A31 A;  3K4C A;  1ZG3 A;  3DTK A;  1UST A;  4KFC A;  1F9N A;  5D8K B;  2FML A;  4XOR A;  1D3Y A;  1GXP A;  1LDD A;  3QYE A;  4M9X A;  3HSE A;  4D5C A;  1HC8 A;  3I58 A;  1R7J A;  4XK4 A;  4WF2 A;  1U6G A;  3DV8 A;  2KZG A;  1OCT C;  4M6Y A;  2FBH A;  3IKT A;  2VBZ A;  3VYT B;  1OFC X;  3IUO A;  4Z2Y A;  1WCM J;  1ZN2 A;  1OYW A;  1T95 A;  1Z6R A;  3TP0 A;  3CUQ B;  3K4L A;  2P6S A;  5LRR A;  4R1H A;  2OZ6 A;  2K3F A;  4PFO A;  1YRN A;  2HXI A;  3LST A;  1YS6 A;  5L3C A;  1JKR C;  2QQB A;  1DUX C;  1ZG1 A;  2DYS H;  4XRF A;  2KZV A;  1V3F A;  4KIT B;  1MH3 A;  3CJN A;  3PSF A;  1LE8 B;  2JA7 J;  1ZKG A;  1T0F C;  4LB5 A;  5TGT A;  1FYK A;  4A3C J;  3OIQ A;  2ISY A;  2MD5 A;  3IKV A;  1R9T J;  2QUF A;  3QYB A;  4I98 B;  3DKX A;  2DA4 A;  2E1M B;  4DW6 A;  3PNV A;  3ERE D;  2K9M A;  4JX4 A;  5D8L B;  3JRD A;  1T6S A;  3DFG A;  4AU7 A;  2K86 A;  4HX8 A;  3GX4 X;  4HX7 A;  2IRF G;  1REP C;  2HFH A;  3VOE A;  3L09 A;  3CCL I;  1ONV A;  3GTQ J;  2K5C A;  4OIP F;  2M45 A;  3ABK H;  4CXF A;  5D5V B;  1E3O C;  1BI3 A;  2DJN A;  1Y0N A;  2GIZ A;  3CQZ J;  3RZD J;  3TBI A;  3TO7 A;  2JA2 A;  3VEP A;  2QQ8 A;  3PFY A;  1IXR C;  1LB2 A;  3CLO A;  4ZH4 F;  1MMA A;  4IHT A;  1TQP A;  2DK8 A;  3BR6 A;  2VT3 A;  5FKO A;  3OSG A;  3K2A A;  3FKJ A;  2DA6 A;  2XVC A;  2DA3 A;  2EA2 A;  4CIC A;  1HF0 A;  3GTM J;  3LFU A;  2Y9Z A;  3NEU A;  2JMW A;  2Y0M A;  1SVO A;  4AIH A;  4IRH A;  1FEX A;  1XB4 A;  2CSO A;  1YIO A;  1VQP I;  1IRX A;  2F4O B;  1Z67 A;  1JKO C;  2LLK A;  4NQW A;  1C0W A;  2DFE A;  2YPR A;  4E7Z A;  2CV2 A;  1P4W A;  2K9N A;  5H6Q A;  4P55 A;  4S0H B;  1T39 A;  4OMY A;  3ASN H;  4BHB A;  4PSX A;  5E8I A;  2F4I A;  2NOG A;  3MVP A;  5E8G A;  1OR7 A;  2VKV A;  3BJ6 A;  4CUG A;  1HKT A;  1XSV A;  1EF4 A;  2H6C A;  3JRC A;  3C3W A;  2AHQ A;  1USS A;  2FU4 A;  2YR2 A;  5HOO A;  3IRR A;  1XTA A;  1W0T A;  4ITV A;  2R7W A;  3WTU C;  1W36 D;  4BHP A;  5EZG A;  1VQM I;  2IPQ X;  3OR2 C;  4A5N A;  4D0P A;  5HDK A;  2IS2 A;  2HVS A;  3D5L A;  2WC2 A;  1HKS A;  4ZYG A;  3OL3 A;  3LOC A;  4FIS A;  1LVK A;  4UV8 A;  1GV2 A;  4XR6 A;  2DJI A;  4B4C A;  3KZZ A;  4NDL A;  2NVT J;  1W5T A;  2XPW A;  2XAG A;  3BTJ A;  3KP6 A;  2O0Y A;  3F22 A;  1AKH B;  3E97 A;  3K4K A;  4LMY A;  3JRA A;  2JN6 A;  2XIG A;  3FWE A;  4M6V A;  3ESW B;  3JRB A;  4TV7 A; 
#chains in the Genus database with same CATH homology
 5FLX Z;  4CYD A;  4I0B A;  5BPD A;  4O3M A;  2LNB A;  3E6D A;  2QBY A;  2PI0 A;  3E6C C;  1FYM A;  3QPH A;  1IRG A;  5LGN A;  5D5X B;  4B09 A;  3TGN A;  4L9N A;  4L9T A;  2LSO A;  2CGP A;  1S7A A;  1SD5 A;  4RGS A;  4A0Z A;  4GCV A;  3GZ6 A;  1R23 A;  1TQM A;  4BAY A;  4DNC A;  4XLN F;  3O3K A;  4MTE A;  4M6X A;  3V7C A;  1YS7 A;  1XDS A;  3E6B A;  3LQQ A;  1B4A A;  2ZNZ A;  1SAX A;  5L3E A;  2XAQ A;  2XAH A;  4CDG A;  1V4R A;  2ZNY A;  3ZPL A;  5JI6 A;  1FLI A;  1IN4 A;  1OMI A;  5CVU A;  3ZMV A;  2MLG A;  3KEQ A;  2VC0 A;  3J80 Z;  1J59 A;  1LEA A;  2GIV A;  1OYY A;  4WXD A;  2A5Y B;  2JRT A;  4PGG A;  1JGS A;  4BHC A;  2PMH A;  1XN7 A;  3V4G A;  5ILS A;  3CUQ C;  3RYP A;  2ZME A;  4LK1 F;  2NAZ A;  3WTX C;  3I71 A;  3FMQ A;  1MJ9 A;  2RN7 A;  1SMY F;  2P7C B;  1QQI A;  1K79 A;  4WX9 A;  2YSR A;  1ULY A;  2E7W A;  2NS0 A;  4YIF A;  3GEZ A;  1IN5 A;  2P7V B;  3WTV C;  2D45 A;  4PGH A;  3KP4 A;  1KU2 A;  3KEO A;  4FX4 A;  3IWZ A;  4BXU A;  3V8K A;  3BY6 A;  2HS5 A;  1ZGA A;  2VE9 A;  2FMY A;  1Z91 A;  2RC4 A;  3LQR A;  4M9S A;  1HW2 A;  3GFJ A;  2XAF A;  2ZFW A;  2FEZ A;  5AIQ A;  2ISZ A;  3IWF A;  2PN6 A;  1TW2 A;  3L00 A;  3WE3 A;  2HTS A;  4A0X A;  1W5S A;  3DF8 A;  4HQE A;  2KJB A;  2W24 A;  4U0Y A;  3P9C A;  3HHH A;  1RNL A;  4U7B A;  3QPT A;  5DV5 A;  4LLL A;  1FNN A;  4OIR F;  2RVC A;  3FF5 A;  3R4K A;  2NRA C;  2ELH A;  2FA5 A;  2OAZ A;  1E2X A;  2P5V A;  2VON A;  1WQ2 A;  2VBX A;  2FOK A;  2MA3 A;  1SFX A;  3BDD A;  3DEU A;  5L3F A;  1UB9 A;  2Z9O A;  3MEX A;  1FSH A;  1XD7 A;  1W7P B;  3QAH A;  1QBJ A;  2HWV A;  4RAY A;  3I0T A;  5HLI A;  1YO5 C;  1HBX G;  3R60 A;  1HQC A;  4IHS A;  2GXB A;  2ZCW A;  1P4X A;  3MWM A;  2EV6 A;  3K1M A;  1FYL A;  2KKO A;  1HW1 A;  3DQV C;  3JAM Z;  2O03 A;  3N97 A;  1ZYR F;  3M1E A;  4HDV A;  1ZRE A;  4N9H A;  4IRG A;  2XAS A;  4UUV A;  3RI4 A;  2ZKZ A;  3P9I A;  3RIR A;  4IPA A;  2RNJ A;  4RGR A;  1RUN A;  1W7P A;  3KLO A;  4L5J A;  3FXU A;  2VN2 A;  1FT9 A;  5HS7 A;  3TO6 A;  2A6E F;  3EYI A;  4EJV A;  4EM2 A;  5FB2 A;  2EFW A;  1WI9 A;  5D6F A;  1IAW A;  3R61 A;  2ESH A;  3J81 Z;  2F2E A;  4Q47 A;  1X3U A;  1KU9 A;  1YW9 A;  3T8T A;  4LK0 F;  2A61 A;  4ZYE A;  1SFE A;  2HQN A;  3WOD F;  2Z33 A;  4HQM A;  5F6F A;  3GWZ A;  4KDP A;  3I64 A;  3SZP A;  5J8C A;  4P96 A;  1KA8 A;  1I1G A;  1K7A A;  2ETH A;  3J7A O;  1O7L A;  3LFK A;  1TQI A;  2L3D A;  3WG9 A;  3I59 A;  4KNY A;  3JW4 A;  2QM3 A;  4I0A A;  5JHU A;  2VT2 A;  4OU0 A;  4BYY A;  2IA2 A;  4KT5 C;  5CLS A;  4AIJ A;  3TKY A;  3FMS A;  1BIA A;  6PAX A;  2BGC A;  4M73 A;  3FXR A;  3M9A A;  3ELK A;  2OU2 A;  3JTG A;  4KN7 X;  5BMZ A;  1ODD A;  4JQF A;  2BEO A;  2IT0 A;  3NQO A;  1HXD A;  3F72 A;  3P7N A;  3EQL F;  1KQ0 A;  2H94 A;  1LEB A;  4RGX A;  3RKW A;  1KQ9 A;  1FBU A;  2JPB A;  5ED4 A;  3U2R A;  4EGZ A;  2BBY A;  1XGO A;  3R0A A;  1B6A A;  3T1B A;  1G4D A;  4EJU A;  2A3S A;  3CO7 C;  1R36 A;  3HUG A;  3LA2 A;  2GQQ A;  1U3E M;  4GO1 A;  4HDU A;  1OKR A;  3M8E A;  1S29 A;  3T0Y A;  1GVJ A;  5DCM A;  2XRN A;  2KIF A;  4MQV A;  3WTW C;  3FMR A;  4A2U A;  5CJ9 A;  3HIF A;  4KIG A;  4E70 A;  2O3F A;  3DXJ F;  1FC3 A;  1ON2 A;  2G7H A;  5DDG A;  4HF1 A;  4U7D A;  4HF0 A;  3TDZ C;  2MBF A;  1FY7 A;  2MH9 A;  5CVI A;  3EUH A;  3Q5F A;  3Q9V A;  4U88 A;  3WGG A;  1YW7 A;  2LF7 A;  4LG0 B;  2YU3 A;  2KIU A;  2A69 F;  2CFX A;  2K27 A;  3DPL C;  2P6T A;  3B73 A;  1XMA A;  4YFN F;  4IRI A;  5E20 A;  1SMT A;  3ZQ7 A;  1U5T C;  2EV5 A;  2VE8 A;  4EQQ A;  4FX0 A;  1KGS A;  1ZAR A;  1FP1 D;  2IA1 A;  1DPR A;  4S04 A;  1R22 A;  1LVA A;  4NHJ A;  3R0J A;  4EGY A;  1LDJ A;  2STW A;  1T0F A;  3QU3 A;  2DU9 A;  2JZY A;  2QBY B;  4YII A;  1R5H A;  5JR3 A;  1TNT A;  5E18 F;  3COA C;  4PCQ A;  2L4A A;  5HS9 A;  1MDM B;  4ZYD A;  4HA8 A;  3F8C A;  3JSP A;  3HSR A;  2VC1 A;  4HX4 A;  1O3Q A;  2Z3Y A;  2A07 F;  4AIK A;  1U5T A;  2K02 A;  3BP8 A;  3W6K B;  5LHI A;  3SQN A;  2ADU A;  2O6G E;  1IXC A;  3KCC A;  4LLG F;  1TLH B;  3E5X A;  4JK1 X;  5LLQ A;  1QGP A;  4EV0 A;  1MDM A;  1W4M A;  4ZYH A;  1MGT A;  2Y48 A;  2K4J A;  3I4P A;  1MZB A;  2ESN A;  5CVR A;  3ECO A;  2HZT A;  5EEH A;  2RQP A;  3KLN A;  2VOD A;  2IVM A;  4S05 A;  3ULQ B;  3JSO A;  5TRD A;  5HLH A;  2HYF A;  3IRQ A;  4Y15 A;  2FSW A;  4MQ9 F;  3RKX A;  1KYZ A;  2DPD A;  4B8X A;  4Y13 A;  4XSX F;  2K4B A;  1CF7 A;  4MEY F;  5JFR A;  1ZRC A;  1IUY A;  3LA7 A;  4G6Q A;  3F8N A;  2OBP A;  4EM0 B;  4PZJ A;  4FHT A;  2O8X A;  1UHM A;  2F5D A;  1ZAO A;  1Z1D A;  5K5O A;  2EA4 A;  3KP5 A;  5LGU A;  4RB2 C;  4U0W A;  1O3T A;  3G3Z A;  5DEQ A;  3HYI A;  1YQA A;  1PP7 U;  5IT3 A;  2V1D A;  4MHG A;  3KET A;  2D1H A;  4YG2 F;  3IL2 A;  3SZT A;  2BV6 A;  1UHW A;  5L3B A;  1FBS A;  2VOO A;  4A6D A;  1DPU A;  1MJA A;  3IHU A;  4KN4 X;  2R7F A;  5TJJ A;  2JTV A;  1JXS A;  1TTY A;  2V1U A;  5D4S A;  2M8E A;  4UNO A;  1A04 A;  4RGU A;  1EV7 A;  4HF2 A;  3V7R A;  3IC7 A;  1Z6T A;  3WU1 B;  5LRS A;  1P6R A;  3J80 K;  3EET A;  2HGC A;  3AAF A;  1I27 A;  1FBQ A;  4UHT A;  1G3Y A;  1T38 A;  4M74 A;  5L3D A;  3MZH A;  1B1B A;  5ICC A;  1BC8 C;  1DP7 P;  3E3V A;  2HTJ A;  3KP7 A;  1R1U A;  4O6J A;  3TQN A;  3I53 A;  4ETS A;  2FRH A;  3ZP5 A;  5K5Q A;  1QZZ A;  2CYY A;  2EFN A;  1BOA A;  1XSD A;  4HLY A;  2XHK A;  2W25 A;  5IT9 Z;  2KIM A;  3F8B A;  2RKH A;  2DO7 A;  5E1X A;  5AIP A;  2IJL A;  2Q8K A;  4P9U A;  4LFU A;  1UCR A;  1TBX A;  4LG0 A;  2H09 A;  1J9I A;  2CQK A;  1B59 A;  4LJZ F;  5CYV A;  3ABU A;  2WWY A;  4XSZ F;  4N0B A;  2P8T A;  3WGH A;  2NNN A;  1Q1H A;  4MEX F;  3ECH A;  4EM1 A;  3HRM A;  2O61 A;  1YLF A;  2F5F A;  2EK5 A;  2FE3 A;  4HV5 A;  3FX3 A;  3FHZ A;  1IRF A;  5DUK A;  1BIB A;  2X0L A;  3DPT A;  3KZY A;  3LWF A;  2E7X A;  5HS8 A;  3CDH A;  3P9K A;  1ZGJ A;  5J8F A;  4MTD A;  4OOI A;  1FZP B;  2VBW A;  2E1C A;  2CG4 A;  5KK1 A;  2P5K A;  3R6S A;  4BNC A;  1S7O A;  2HEO A;  4LLN A;  2MC3 A;  1RZ4 A;  1B9M A;  5K1Y A;  4WXH A;  5ILU A;  2J5O A;  1U5T B;  1CGP A;  2CW0 F;  5FGM A;  1H9T A;  1U2W A;  3JAM K;  1BBY A;  3FM5 A;  4WXC A;  3T5X A;  2VXZ A;  4KMF A;  3V8J A;  2JT1 A;  4AD9 A;  4RB1 A;  5E1W A;  3GFI A;  2DK5 A;  2HR3 A;  3QU6 A;  4GGG A;  5DCF A;  4G7O F;  3CUQ A;  2AXL A;  5ICG A;  3ZMD A;  1H0M A;  1G3S A;  2DTR A;  1JHH A;  4M71 A;  3MZY A;  2C6Y A;  3BPX A;  1J2X A;  3J81 K;  4Q48 A;  3H3U A;  1BM9 A;  2FNP A;  2A68 F;  2RGV A;  1BC7 C;  1XDU A;  1R1T A;  3BRO A;  1P92 A;  5DUI A;  4WK8 F;  2WV0 A;  1Z9C A;  4F7Z A;  1RUO A;  1DDN A;  1FSE A;  1WRJ A;  2G7U A;  4EJT A;  2GXG A;  3HTU A;  5IT9 K;  1PUE E;  4BQA A;  2W57 A;  3FZV A;  4WCG A;  4RB0 A;  4N9I A;  4L0Y B;  3WTS C;  5HVQ C;  1OYI A;  2W84 A;  2V1X A;  5A2Q K;  1XMK A;  3I5U A;  2R7D A;  1P4A A;  4P5O A;  2LKP A;  4A0Y A;  2GZW A;  3BJA A;  2DQR A;  1S3J A;  2HQR A;  2FNA A;  3TOB A;  1FP2 A;  1MKM A;  3Q9S A;  4G94 A;  2DAO A;  3WE2 A;  2EB7 A;  2OD5 A;  4L18 B;  5D5W B;  3MCZ A;  1HST A;  4AVP A;  2H27 A;  4LB6 B;  3F23 A;  4OIN F;  2HOE A;  5D5U B;  3K1N A;  3W6J B;  4I01 A;  4HZF A;  2VBY A;  2K7L A;  3HOT A;  2GWR A;  3REO A;  2CWE A;  3U1D A;  1YFH A;  5LHH A;  2HDC A;  3CTA A;  3F6V A;  1O3R A;  3D0S A;  4AWX B;  2IA0 A;  2PG4 A;  2MH2 A;  3F8F A;  2DW4 A;  2Z5U A;  4A5M A;  5BOX A;  1IN6 A;  3OV8 A;  1H9G A;  3C18 A;  4G6D A;  5ICE A;  3K0L A;  4CGZ A;  1IZ1 A;  3L7W A;  5JVT A;  5DYM A;  1KQ8 A;  3RJP A;  1MJB A;  4WWC A;  5ERI A;  1MD0 A;  1R58 A;  4M9Z A;  4HYE A;  3F21 A;  2YX4 A;  3RPU A;  5E17 F;  4JBA A;  2D1V A;  5HDG A;  4EJO A;  1IN7 A;  4I09 A;  2LF8 A;  2DPU A;  4QWQ A;  2V9V A;  3PFI A;  2DLL A;  4FT8 A;  1EH7 A;  1QO0 D;  1R1V A;  4PDK A;  1F1Z A;  4OIQ F;  1K78 B;  1WWX A;  3EYY A;  1SD4 A;  4G7H F;  2UXN A;  3PQJ A;  3N4M A;  2PQ8 A;  1CF7 B;  2PLY A;  2QQA A;  3DP7 A;  5LHG A;  2FQ3 A;  1P2F A;  3LA3 A;  3OOP A;  4OIO F;  4KUM A;  3FXQ A;  4Y17 A;  2L54 A;  2DFI A;  5A2Q Z;  4RAZ A;  1K78 A;  2UXX A;  4K2E A;  3TOA A;  3K2Z A;  4IXA A;  3KE2 A;  2STT A;  4R79 A;  1R00 A;  1I5Z A;  4ESF A;  3O6B B;  3F6O A;  3HSF A;  4OMZ A;  1HKQ A;  1ZG5 A;  3HRS A;  4HLX A;  3BOQ A;  5J6X A;  1I6X A;  1SD7 A;  2DBB A;  2PMU A;  2CO5 A;  4UVC A;  4U0V A;  4YFX F;  4L9V A;  5DCM B;  4LGW A;  4IJA A;  3KFW X;  2JPC A;  2XRO A;  3B02 A;  3HTS B;  1FWZ A;  5L3G A;  1K6O A;  2P5L C;  4KIB A;  2GAU A;  1BI0 A;  1ZRF A;  1ZRD A;  3RKY A;  2X4H A;  1O7F A;  4GYG A;  5BQT A;  2Y75 A;  4RB3 C;  1RIO H;  2NNY A;  2IP2 A;  3EDP A;  1YW8 A;  3MQ0 A;  3ZN0 A;  1FOK A;  3GFM A;  1BN5 A;  1J5Y A;  1XCB A;  3BJO A;  3SHF A;  1JE8 A;  4Q4Z F;  2OA4 A;  2QVO A;  2DT5 A;  1AOY A;  2V79 A;  4IF4 A;  2OQG A;  1S6L A;  5ICF A;  1XCV A;  4GXO A;  1TNS A;  3U9G A;  3F3X A;  3HHG A;  3LAP A;  2EJR A;  3V8L A;  1I1S A;  3SFZ A;  4KMU X;  5F64 A;  1O3S A;  5DD4 A;  3GUD A;  3O2P E;  1BI2 A;  4QLC U;  4ENN A;  4R8H A;  4EJW A;  2M5W A;  3BZ6 A;  2XKO A;  2R3S A;  5ILV A;  2P4W A;  3LAJ A;  4H0E A;  1IN8 A;  3RYR A;  2BE5 F;  4XLP F;  3ZMU A;  3L9F A;  2B0L A;  5FD6 A;  2ZBK A;  1TW3 A;  3NRV A;  1JHF A;  2ACJ A;  2PJP A;  1HW5 A;  2A6H F;  1ZLK A;  4ENK A;  4CO8 A;  2Q0O A;  2M87 A;  2M1B A;  3C1D A;  4CZZ A;  4NB5 A;  2F5E A;  1BJA A;  3ZMS A;  1LNW A;  4G9Y A;  5EEG A;  1QNT A;  1ZH5 A;  3ML6 A;  4HAM A;  3ZMZ A;  1ZHF A;  4KA4 A;  3WU0 A;  3L2C A;  1AWC A;  1XSX A;  4L5I A;  3F8M A;  2PBI A;  3GFL A;  4ENM A;  3PQK A;  2PEX A;  1YTY A;  3VOD A;  2Z99 A;  3BPV A;  3QOP A;  4HV6 A;  3M8F A;  2QQ9 A;  2OZU A;  1LDK B;  5BPI A;  3MAJ A;  3ZN1 A;  2UZK A;  3CO6 C;  3JTH A;  1W7P D;  1ZLJ A;  5FFZ A;  3QP5 A;  2EFO A;  1WSU A;  1OPC A;  1IF1 A;  2FF4 A;  3S2W A;  4G8X A;  1G3T A;  5LEK A;  1O57 A;  4HW0 A;  3SXY A;  2L01 A;  1QZY A;  2UWM A;  2J5P A;  3C7J A;  2QLZ A;  2HYG D;  3VFZ A;  4MGR A;  2OQR A;  2IW5 A;  1J0R A;  2H6B A;  1J7K A;  5LEJ A;  3MFK A;  3HRU A;  2FXA A;  4UVA A;  1BI1 A;  2EFP A;  4I2O A;  3VB2 A;  2F5C A;  2LDU A;  4CHU A;  2QEN A;  4LD5 A;  3ZMT A;  1J75 A;  2KJC A;  2GA1 A;  1T2K A;  2ZXJ A;  1ON1 A;  3GYH X;  1GHC A;  1XGS A;  1T98 A;  2YX7 A;  3H92 A;  1LJ9 A;  5FFX A;  4A6E A;  2W85 A;  5E1Z B;  2XV4 S;  1XGM A;  2FBK A;  4IVN A;  5HLG A;  1XGN A;  3I54 A;  2QYO A;  5D6E A;  4EVI A;  5K5R A;  2QZ8 A;  4MNU A;  3WTY C;  3RTR A;  3BWG A;  4DQ2 A;  3KP2 A;  3E5Q A;  2TDX A;  3V7S A;  2L4M A;  1Z7U A;  3RPQ A;  1KU7 A;  4ENJ A;  4ZZD A;  3GF2 A;  1RI7 A;  2ZO4 A;  1D8K A;  1WKM A;  3K1P A;  3WTT C;  3GVA A;  1FX7 A;  1LQ1 A;  1HSJ A;  3GO5 A;  3GZ5 A;  1PP8 F;  2E1N A;  2FBI A;  3M7G A;  4RS8 A;  5F1R A;  1SD6 A;  3K9T A;  2XUB A;  2KRF A;  2DI3 A;  3TO9 A;  5H6R A;  1KYW A;  3T8R A;  3DKW A;  2AS5 F;  3ROU A;  1NHA A;  2EV0 A;  4GYI A;  5LBQ A;  1G6N A;  3HOS A;  4UVB A;  1B9N A;  5FO5 A;  5H20 A;  4ASN A;  1D5V A;  3K69 A;  2EFQ A;  2G9W A;  1U8R A;  4UXN A;  1Z05 A;  4KIF A;  1U78 A;  3E5U A;  2XKP A;  5CVJ A;  1QPM A;  2WTE A;  2GA2 A;  4O5V A;  5CVV A;  1IXS B;  4YFK F;  2XAJ A;  5D4R A;  4ESJ A;  1VTN C;  1YG2 A;  3RDI A;  2HKX A;  1R5G A;  5DD8 A;  1FPQ A;  2COM A;  5FD5 A;  1G3W A;  1KU3 A;  4L0Z B;  1PDN C;  2Q2E A;  2PFB A;  4P9F A;  1S8N A;  4KYW A;  3FM3 A;  1F4K A;  4EMS A;  3QP6 A;  1D8J A;  3HRT A;  1EH6 A;  3QRF F;  3H3Z A;  3GW2 A;  5AON A;  5BS6 A;  5LGT A;  2ZJ2 A;  4I02 A;  4XBF A;  2VOP A;  2JSC A;  4G7Z F;  2V6C A;  3CUO A;  2ZME B;  4I7H A;  4KIC A;  2L02 A;  1Y0U A;  2RDP A;  4BH9 A;  4A12 A;  1UFM A;  4M72 A;  4ON0 A;  1STZ A;  2QWW A;  3ABT A;  3E6M A;  2BYV E;  2MLK A;  1F5T A;  2RV8 A;  3WTZ A;  2M30 A;  3G73 A;  1L0O C;  1EH8 A;  2EWN A;  5KVR A;  1E17 A;  4ZZL A;  1YYV A;  2DQL A;  1SFU A;  1GXQ A;  1IW7 F;  3GLX A;  5HDN A;  3GXO A;  5FLX K;  2XGX A;  2HKO A;  3TDU C;  3WGI A;  4HBL A;  4UV9 A;  4Q5S F;  3I59 B;  4L9J A;  3ISP A;  4ESB A;  2D2W A;  1L3L A;  3KP3 A;  2NYX A;  4HOB A;  1ZG3 A;  1UST A;  4KFC A;  1F9N A;  5D8K B;  2FML A;  1D3Y A;  1GXP A;  1LDD A;  4M9X A;  3HSE A;  3I58 A;  1R7J A;  4WF2 A;  1U6G A;  3DV8 A;  4M6Y A;  2FBH A;  3IKT A;  2VBZ A;  4Z2Y A;  1ZN2 A;  1OYW A;  1Z6R A;  3CUQ B;  2P6S A;  5LRR A;  4R1H A;  2OZ6 A;  3LST A;  1YS6 A;  5L3C A;  2QQB A;  1DUX C;  1ZG1 A;  4XRF A;  1V3F A;  3CJN A;  4LB5 A;  1FYK A;  2ISY A;  2MD5 A;  3IKV A;  2QUF A;  4I98 B;  3ERE D;  5D8L B;  1T6S A;  3DFG A;  2K86 A;  4HX8 A;  3GX4 X;  4HX7 A;  2IRF G;  1REP C;  2HFH A;  3VOE A;  3L09 A;  1ONV A;  4OIP F;  2M45 A;  4CXF A;  5D5V B;  1BI3 A;  3TO7 A;  3VEP A;  1IXR C;  1LB2 A;  3CLO A;  4ZH4 F;  4IHT A;  1TQP A;  2DK8 A;  2VT3 A;  4CIC A;  2XVC A;  2EA2 A;  3NEU A;  2Y0M A;  4AIH A;  4IRH A;  1XB4 A;  2CSO A;  1YIO A;  4NQW A;  1C0W A;  2YPR A;  1P4W A;  5H6Q A;  4P55 A;  1T39 A;  4OMY A;  4BHB A;  5E8I A;  5E8G A;  1OR7 A;  3BJ6 A;  1HKT A;  1XSV A;  2H6C A;  3C3W A;  1USS A;  2FU4 A;  2YR2 A;  5HOO A;  3IRR A;  3WTU C;  4BHP A;  2IPQ X;  4A5N A;  4D0P A;  5HDK A;  3D5L A;  2WC2 A;  1HKS A;  4ZYG A;  4UV8 A;  3KZZ A;  1W5T A;  2XAG A;  3KP6 A;  2O0Y A;  3F22 A;  3E97 A;  4LMY A;  2XIG A;  3FWE A;  4TV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...