1X2NA

Solution structure of the homeobox domain of human homeobox protein pknox1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
GSSGSSGKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the homeobox domain of human homeobox protein PKNOX1
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein PKNOX1
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x2nA01
4W1UA 1WCMJ 4Y52J 2Y9ZA 2EZIA 3LOCA 2L7FP 3IH3A 1TWCJ 2DJNA 5E3LA 3TP3A 1VNDA 2L7MP 2QCOA 4D5FA 2LKXA 3LSJA 2D5VA 4C3IJ 4DZPA 3I4MJ 3OIOA 2M0CA 2MSYA 3A02A 5E3OA 1ORKA 2CRGA 5EG0B 1QRYA 3OOUA 4V2GA 5K7FA 2GM4A 4IHXA 5EEAA 4L5EA 3BR5A 2O8KA 2LD5A 3HDDA 4BBSJ 1RETA 1GVDA 2YS9A 3PM1A 2HDDA 2DA7A 2HXIA 2EZHA 4XIDA 4I6ZA 1B8IB 5C4JJ 3FKIJ 5F0HA 3MVPA 1MH3A 4B1RA 2R93J 1CQTA 2ID3A 4IHVA 3GTGJ 3FK7A 3S1NJ 4XICA 1LE8A 5GP9A 2JK3A 1O4XA 5FJ8J 2DN0A 1BA5A 4M3DA 1ZK8A 2DTZA 4BBRJ 2ELKA 4A3MJ 3NARA 2XGCA 1R9TJ 1AKHA 1FIAA 2DA5A 3HKZN 1JTYA 1P7JA 2NS7A 5M5WJ 3M3YJ 4MFDA 3BQZA 4A3KJ 2M9HA 2M2EA 2GLOA 3A01A 2NOGA 5F27A 3UKGA 1H89C 1WPKA 1ENHA 1DU0A 5EDNA 3S1RJ 1BW6A 3BR6A 4MO7A 2NVQJ 1ETYA 5FKNA 1FIPA 2FQ4A 1MH4A 2NS8A 2YUSA 4MIMA 1H88C 2NVYJ 3G1OA 2K9NA 3BQYA 1U9OA 2VUMJ 1IDZA 5F1JA 1OJLA 2DA2A 1IDYA 3HOVJ 3I4NJ 3WHBA 2DA3A 3S1MJ 1JKPC 1IRZA 5J1UA 4RDUA 1RESA 1SFOJ 2EZLA 2ME6A 2WAQN 3WHCA 3C2BA 1B72B 1U8BA 2K9QA 1VF9A 2AHQA 3BG5A 1RKTA 2LVSA 4AC0A 3BR0A 3RZOJ 5EZGA 3GTJJ 2LP0A 1GV2A 3Q0VA 2Y31A 3GBGA 3BR1A 1GV5A 2LTPA 2JJ7A 4FISA 3VPRA 4A3BJ 3BTIA 4A3GJ 4FE7A 1A5JA 4FCYA 1ZTRA 3LSRA 3HGYA 3HOXJ 5HODA 3D1NI 1W0UA 3CMYA 1POGA 4NDLA 1RPWA 4I76A 5IOYA 3S17J 2DMQA 1QVUA 1JKQC 5EZHA 2CU7A 3F0CA 1QVTA 4AUXA 1Z77A 3DCFA 2KT0A 1TC3C 1Z0XA 1MBEA 3BT9A 1MSFC 4ABZA 2KDZA 5EG0A 4BXXJ 4A3JJ 2EH3A 2MW8A 2NVXJ 1ETWA 5M5XJ 3GTMJ 4IHWA 1TWAJ 1UMQA 1E3OC 4XK4A 3JRBA 3JRCA 1EF4A 4X1EA 1BW5A 4A3LJ 2DMTA 3BTCA 3JREA 1IJWC 4Y7NJ 5FLMJ 1T33A 1TWFJ 4JX6A 1VFCA 3TW7A 3O8GA 2XPVA 3JRGA 3HEFA 2O7OA 2X6OA 2HOSA 1XG1A 2Y0SN 4V2FA 5F0CA 2R7ZJ 1AU7A 2GBYA 2L7ZA 2XRLA 1IGNA 3S14J 1FEXA 5K7HA 3CQZJ 1NTCA 3NAUA 2LY9A 4AYBN 4MFEA 4J19A 1ETVA 5M5YJ 1XS9A 3S2DJ 2VI6A 4QSHA 1MBFA 3FK6A 2DMUA 1NK3P 2G0EA 2HYJA 2CUFA 2HOAA 5K7ZA 1IG7A 2FD5A 3HOYJ 4B3AA 2HQ5A 2CUEA 3JRHA 1YRNB 2E19A 1LFBA 1X2NA 3JRFA 2DA1A 1ETOA 1LE8B 5IYDJ 3CDLA 1FTZA 5FKKA 4D7MA 3JR9A 1JUSA 2R5ZB 3Q3SA 1PUFA 4JX5A 5J1RA 3PO2J 3GTPJ 2VKEA 1GUUA 2CJJA 2TRTA 1JJ8C 1AKHB 2MGQA 2JWTA 5F08A 2E1OA 5J1YA 3TP0A 2R5YA 4D5CA 5C3EJ 3S16J 1RR7A 4B4CA 1GDTA 3GTOJ 3GTLJ 1D5YA 9ANTA 1I6HJ 1ETKA 5EGOB 3GTQJ 3IH4A 5E3NA 3S2HJ 3ZQLA 2COBA 2DMPA 2DA6A 1HCRA 2IEKA 4C3HJ 2Y9YA 1OFCX 4BKXA 1IC8A 2LK2A 2VKVA 1JKRC 5IPAA 4S0HB 1LFUP 3IV5A 3RQIA 4DZJA 2FJ1A 5F04A 5J3LA 4HNVA 3QQAA 5C4XJ 4C3JJ 3BTJA 2XPWA 2TCTA 2LR8A 4CYCA 1ZKGA 4A3DJ 4M6VA 2JA8J 3MN2A 5FLVA 3OSFA 1ZGWA 5E3MA 2VPRA 5DS9A 1JJ6C 4DW6A 1XC5A 4A3EJ 3A01B 3HM5A 3Q0UA 5IP7J 1G2HA 4RBOA 3DEWA 5FKOA 3G1MA 2EZKA 1WI3A 4JP0A 1A6IA 4MLOA 4EEFG 1UG2A 2M34A 1BJZA 4C2MJ 2CQXA 3B6AA 2M8GX 2XGDA 1K61A 1JT6A 3BG9A 2ME0A 3JRIA 2AO9A 4UUSB 2JMWA 2X9DA 4JX4A 1WH5A 3BG3A 1ZQ3P 5M3MJ 5IOZA 1B8IA 3G1LA 1JUPA 1AHDP 2JA6J 4BY1J 1MBHA 1VI0A 3H0GJ 5BNGA 3HOUJ 3HBLA 3BR3A 3LNQA 2R92J 3HOWJ 4IEJA 1MBKA 2E2HJ 3A03A 1S7EA 1Y1VJ 4BY7J 5EF6A 5IP9J 1TWGJ 3QPLA 5C44J 3BR2A 1UHSA 5GPCA 3HGGA 5JLXA 1MNMC 2OF7A 1IUFA 1APLC 3IH2A 1OCTC 2CQQA 4JYKA 4A3IJ 3TEDA 3JRDA 4M3EA 3L1PA 4XRSG 2EBIA 1HF0A 2N8GA 1P7IA 1ETQA 2P81A 2PMZN 4QTRA 1W0TA 4GFBA 2K9SA 3S15J 3FISA 3Q0WA 2I10A 1Q1VA 3ZOBA 2DMNA 1H8AC 3ZQCA 1U9NA 1HDDC 2LFBA 2IAIA 1HDPA 4DYCA 1HOMA 1QPIA 2ZB9A 2L0KA 2H1KA 3ZQHA 4X6AJ 2L9RA 2NVTJ 5FKLA 2XB5A 3SFIA 5IYCJ 4XRSA 2FX0A 2X48A 3QPSA 3TW6A 5FKMA 1NK2P 1JKOC 2MG4A 4M3BA 4UUSA 3K7AJ 4M3FA 4M3GA 3W6VA 3FIWA 2ECCA 2DA4A 2ID6A 3JRAA 3CCYA 5DTDA 4A93J 1WH7A 2XPUA 4LOCA 1ITYA 2OPTA 4XRMA 3OSGA 1F43A 2R5ZA 1MBJA 3E7LA 1JTXA 3LSPA 3PO3J 3ZQFA 2WV1A 2EQRA 2E2IJ 3RZDJ 4CYCB 2RAEA 1BL0A 3GTKJ 1ETXA 1B72A 1JUMA 5M3FJ 3S1QJ 1FTTA 1MBGA 3ZQIA 5IP6A 2Y2ZA 1FJLA 2XGEA 1HLVA 2QF7A 2E2JJ 1F36A 3O8HA 1YRNA 2LLKA 2R0QC 2Y30A 3BTLA 2XB0X 4D7NA 2B63J 3RKQA 5JLWA 2K40A 4FTHA 1ZR4A 1DU6A 1TWHJ 1T56A 2XSDC 1PUFB 4DYQA 5GPAA 3HB9A 3MKLA 5IYBJ 3SJMA 4A3FJ 2JA5J 3LSGA 1I50J 3B6CA 1U78A 2ECBA 1RKWA 1Y1WJ 2YU9J 1WGXA 1ZR2A 4QIWN 2H8RA 2HI3A 2R5YB 1JGGA 1X2MA 4A3CJ 1JT0A 2HXOA 3SDGA 5F0FA 1SANA 3M4OJ 4A69C 5EGOA 1I3QJ 1K83J 3HOZJ 2W48A 1IV6A 3ZQGA 2O9LA 5EYRA 4IHYA 1OCPA 2WB1N 3K2AA 2JA7J 4W97A 4FE4A 1X58A 4UUTA 4DYRA 1MSEC 4G12A 2IBDA 2JN6A 3H3VK 2HOTA 1GT0C
chains in the Genus database with same CATH superfamily
3CMEI 2WAFA 3ASNH 2I5UA 2M4KA 2V1DA 1TWCJ 3OYBA 2ZBKA 2GQQA 2QCOA 4CO8A 3LSJA 3CCUI 1MMDA 5CVVA 1T98A 4L18B 2LDUA 3I59A 2E7WA 2E35A 4IQ4A 4FX0A 3SFZA 2MC3A 2M0MA 3CF2A 2LF8A 3HUGB 2BY1A 3FXOA 4M6XA 1R5GA 1QZZA 4L5EA 4MNUA 2PI0A 3BR5A 1HKTA 3LA7A 2O8KA 1KONA 2LD5A 4BBSJ 1YJWI 2YS9A 2STTA 2HDDA 1EJ9A 1O3RA 2DA7A 5DV5A 2EZHA 4XIDA 5F0HA 2IA2A 3CCLI 2ZXJA 3MVPA 2VQLA 3RIRA 4HDUA 2F4IA 3EUHA 3TO7A 3Q9SA 4HQMA 3OIPA 2KZGA 1B4AA 3RPUA 3S1NJ 2X6WA 2XDVA 1ACIA 3OYJA 2QZ8A 4TV7A 1ON2A 2P8TA 1BA5A 2ICWG 2CW7A 4M3DA 3RYRA 4P9UA 4CCLA 3Q9VA 1QQIA 2ELKA 3QPTA 1ZRFA 2NAZA 3FMSA 3GWZA 2AQFA 4MFDA 3BQZA 4MEYF 1GVJA 2DDAA 2M2EA 2FNAA 1SFEA 5F27A 1H89C 1IN8A 1ENHA 1DU0A 2OU2A 4QPOA 1BW6A 2NVQJ 4I98B 1FSHA 3DPTA 5CYVA 4RAYA 1MH4A 3ECOA 1Y6IA 3O6BB 4ESFA 5D6EA 1XCBA 1UAAA 2KHMA 1BR4A 4ZTJA 1NH3A 2ZXHA 4BYYA 2R3SA 1IDZA 4CXFA 4UHTA 2WV0A 3TDUC 2ZMEB 3I4NJ 2EV6A 2CV0A 3GZNB 5D6FA 1WJ5A 1SFOJ 3EQLF 2JVGA 2WAQN 2XV4S 2VT3A 1WI9A 3REOA 3RI4A 2HVRA 1BOAA 1PP8F 3BG5A 4Q47A 5E17F 2LVSA 3A2KA 2VXDA 5EZGA 2DDBA 5J4VA 1B9MA 1QNTA 3Q0VA 3I64A 3GCMA 3BR1A 1Y0NA 2D2WA 1ERDA 3ML6A 5A2QK 5LEJA 1MJAA 3L2VA 3BTIA 3ZMDA 4A3BJ 4FE7A 4A3GJ 4BGDA 1A5JA 4FCYA 1ZG5A 5HODA 2R7RA 3E6DA 1FYMA 3D1NI 1W0UA 3M8JA 2MLKA 4XN3A 4ZC3A 1FBQA 3NEUA 1ZREA 4UY8I 2LG4A 2QLZA 2JA2A 4NDLA 3BZKA 2HDCA 4I76A 5IOYA 3QP5A 2W4SA 4HOBA 4KJZA 2NRAC 1VQPI 4BDYA 2W00A 3ZR8X 1U6GA 1QGPA 4F91B 1MSFC 1QA6A 5EG0A 4BXXJ 1I6XA 1ZYRF 5CQEA 2PJRA 3OV8A 5DD4A 1KU2A 1E3OC 3JRBA 1OCRH 3VDXA 1EF4A 3E6MA 1QBJA 1BW5A 2P6TA 2Z1DA 3GZ5A 3BTCA 3JREA 4Y7NJ 3ZMUA 1T33A 1TWFJ 2GIZA 3R0AA 1MMGA 4Y4RA 2KFDA 2K3FA 1MJ9A 4ON0A 3WTXC 5DD8A 1R1TA 1PP7U 4NNJA 2Y0SN 5F0CA 4BHPA 3I54A 4EQQA 3I9V2 4ESBA 2R7ZJ 4EM2A 2BXYA 2ESHA 4YRVA 4BEHA 1TQPA 3G6EI 3AFHA 3P9KA 3KYLA 2DT5A 4M9SA 2RGVA 2BW3B 2EV0A 5GTHC 1FEXA 3F8MA 1K78A 3DKXA 3E1SA 3SQNA 5ICEA 2HPMA 5J47A 4XLNF 2EFNA 2VB6A 5M5YJ 3CMAI 1SVOA 2IGOA 4A5NA 2VI6A 2CG4A 2DMUA 1LJ9A 3V7SA 4KITB 1A36A 4JQFA 4AIJA 2F4MB 2X6YA 2DXIA 1TP4A 1Y8QB 2QSFX 1IG7A 3ONQA 2IS2A 4RLFA 2HQ5A 4NC8A 4LD5A 3JRHA 3HPGA 3O3KA 4RM3A 2Q1ZB 2YR2A 4EGZA 1YRNB 3U9GA 1X2NA 3RQ4A 3K70D 3JRFA 2P7CB 3CCEI 2XF5A 2FMLA 3QPHA 3CDLA 3W6KB 1Z3YA 5FKKA 2R5ZB 3F8FA 2IA1A 1FX7A 4JX5A 1ZLKA 2CFXA 3PO2J 5CVJA 3KZYA 2CYYA 4XKWA 3WTWC 2W84A 1JJ8C 1AKHB 4UNOA 4PFOA 1WVRA 4CCKA 2JWTA 5F08A 3OYGA 4XLCA 2DQLA 4XKCA 3V8JA 5LGUA 3ISPA 4R8HA 4B4CA 1QPMA 2CUJA 1OLTA 1DPRA 3OS2A 1S72I 9ANTA 4BDZA 1WJBA 2F48A 2XAUA 1ETKA 4HSTA 5E3NA 2D1HA 3ZMZA 2COBA 4KA4A 3HKZA 2DA6A 1G4DA 1HW1A 5FD6A 3DPUA 1HCRA 5J6XA 2CO5A 2ZJ2A 1LDDA 1JKRC 3IC7A 3OMYA 2XC7A 3IV5A 2DLLA 1KQ9A 3PNVA 4DZJA 5F04A 2H09A 1ODDA 3ABTA 3WTTC 2BOLA 4B8XA 4U0YA 5L3FA 4B47A 3AKZA 3AL0C 4LG0A 3QRFF 4NBQA 2CQ7A 2TCTA 3EUKL 3V42A 1JJ6C 2UUZA 3GFMA 3A01B 2VC1A 2CH0A 2LYCA 5LHIA 5FKOA 1P4AA 2ZNYA 3G1MA 1WI3A 3T0YA 1XGNA 2IP2A 2O61A 1UG2A 4UUVA 3HUGA 3KE2A 3DBHB 1STZA 2M8GX 3HHHA 5LHGA 2TDXA 3BG9A 4GDFA 2AO9A 1KU7A 1UHMA 3L2WA 2W85A 2JPCA 3WE3A 2KKOA 4PUSA 1SFKA 3WU0A 4HQEA 1LB2A 4RAGA 3RPUD 1AHDP 2AS5F 3J80Z 5BNGA 4G6QA 4Q5SF 3BR3A 1LEAA 1MW7A 2R92J 3GUDA 4C2TA 4EGYA 1MBKA 2CUZA 3OL3A 1Y1VJ 3E6BA 2VN2A 3ZXSA 1EH6A 2F6CA 2EB7A 5IP9J 5GADJ 1LNWA 1TWGJ 2VQGA 3KEOA 2K85A 3BR2A 4YIFA 5GPCA 4P5OA 2ZCWA 3HGGA 4MQ9F 3E0JB 2ZFWA 2RDPA 4LITA 4XONA 3BG6A 5F1RA 2W7NA 4JYKA 5D5XB 4CZCA 3HSRA 5B66C 2WAEA 1B9NA 3I59B 5DEQA 2X4HA 3O2PE 4GCVA 1UCRA 4G7OF 4XRSG 2EBIA 4F52A 1HF0A 1P7IA 4G6TB 2P81A 2ZO4A 2PMZN 2EFPA 2K9SA 2M4GA 1ZG3A 3FF5A 2DK8A 3IUOA 2Q0OA 3Q0WA 1Q1VA 5KK1A 1H8AC 2LFBA 4D0PA 5H6RA 3L09A 1HKQA 5ILSA 4C2UA 1HDPA 1D1CA 1HSJA 3BY6A 3DKYA 4DYCA 5K5OA 2RQPA 4KT5C 2CW0F 2NVTJ 4IOAF 3WTZA 2HU9A 3KLOA 1B59A 3SFIA 2X48A 2V9PA 1NK2P 2KPMA 1UG0A 2ZSHB 2KLOA 3ERMA 5DUKA 5HDGA 1JKOC 3DEUA 4L9TA 3ZN1A 3IRQA 4UUSA 2EILH 2WC2A 4M3FA 2BHZA 4YEJA 3CCYA 5DTDA 3BZ6A 4IVNA 3VYUB 2VBZA 2F5VA 1VTNC 2JSPA 4FETA 4XOTA 4JBAA 4XRMA 3DU6A 5FRMA 1N78A 1MBJA 4DJAA 3E7LA 3LSPA 4BQAA 3PO3J 2O0YA 5FLXZ 4IO9F 3BCAA 2EQRA 4A6EA 4EM1A 2E2IJ 3HL2A 1VQ4I 2RAEA 5CLSA 3MMYB 2PG4A 2QGUA 2CW8A 2GA2A 2X1CA 2FSWA 3SZGA 1R00A 2IGNA 4CUGA 4IRGA 1FJLA 2LRDA 2K86A 3V8KA 1HLVA 5DYMA 2QF7A 3JCUC 3AL0B 2RC4A 3CCJI 1HQCA 1YJ9I 2XHKA 2XKOA 2QQ8A 1G6NA 4CCNA 2XF6A 2K02A 2R0QC 4KMUX 5EJCA 2Y30A 2DOFA 3N4MA 5J8FA 3GLLA 2DQRA 3E5QA 4O5VA 1W7PA 3M07A 2XSDC 4DYQA 2K4BA 5DCFA 1PJRA 3MKYB 3ZN0A 3WU2C 1T6SA 4IXAA 1VQ8I 1XX5A 2NNNA 3NWSA 3T8RA 3GFLA 5D4RA 1YIJI 3COAC 2HI3A 3EUHC 2IVMA 2YSRA 1WWXA 5E1WA 1X2MA 1BIAA 4AIHA 3SDGA 5CPRB 3DTEA 5JVTA 2RV8A 3WODF 1P2FA 1VQ7I 3C1DA 5ERIA 4MQVA 2FUG2 5CVUA 3HOZJ 1ZARA 1IV6A 2BEOA 2O9LA 4XBFA 1FT9A 1SD5A 4HF1A 3K2AA 2Y0SA 3F8BA 2FE3A 2KMUA 2LREA 1MIJA 4DYRA 2GIVA 2KP6A 1BIBA 2YX7A 2JN6A 5B3SH 2HOTA 2W82A 2VBYA 5FO5A 2R7SA 4W1UA 1YG2A 4LG3A 1WSUA 5H2FC 1ONVA 2Z2SB 3LSMA 1SVLA 1W36C 5E3LA 4CSWA 1VNDA 2L7MP 3CJRB 4PJMA 2AQEA 3I4MJ 4UVBA 2OCCH 3GEZA 3OIOA 2FBKA 2MSYA 1I5ZA 2I8DA 5E3OA 1FLIA 2FU4A 1O3TA 1U5TC 2CRGA 1QRYA 2EV5A 5HLGA 4V2GA 5HVQC 5K7FA 1V55H 1R5HA 3WTYC 1Z6RA 3DF8A 3GX4X 2FEZA 2LMDA 3MZ8A 1E3PA 1TZLA 3HDDA 4NHJA 3PM1A 3GXOA 3TDZC 3FKIJ 4LLGF 2VOPA 4O3MA 3DBRB 1J5YA 2A05A 4HZFA 1ZRDA 3GTGJ 5KHDA 3TQNA 3LWFA 1S5LC 3IKVA 3VOEA 2CWEA 3OYMA 4ENMA 5IT9Z 1J7KA 2JK3A 3H9QA 4ASNA 1O4XA 5CKTA 5FJ8J 1Z7UA 1MNDA 1Z21A 3KP7A 1BR2A 3LSKA 4IRHA 3SZPA 4BBRJ 2IPQX 1AKHA 2LBFB 1FIAA 2DA5A 3HKZN 1JTYA 2EIMH 2NS7A 2VJ5A 4DBQA 2HGCA 3WGHA 1S7OA 3JSPA 1SEUA 2CV1A 3M3YJ 2P5KA 2M9HA 2GLOA 2R4GA 4PK4A 4MEXF 2M1BA 1OYWA 2E1CA 4HNUA 1LDKB 3GFIA 3BR6A 5LD2C 4P1WA 4CYDA 2VJJA 4F55A 3IHUA 1R36A 5HDKA 3DU5A 4MIMA 1H88C 1LDJA 2NVYJ 3G1OA 5FLXK 3BQYA 1G59A 4G7HF 1UHWA 4CZZA 5E1XA 3L2QA 4EM0B 1IDYA 2VOOA 2LY1A 3BOQA 1REPC 4JOMA 3WHBA 2DA3A 2O8XA 4CA0A 4L9NA 4RDUA 1RESA 2ME6A 3KEYA 1RC9A 1J0RA 3C2BA 4CCMA 3DFGA 5DCMA 3I53A 1U8BA 2K9QA 2L01A 2AHQA 4A12A 4AC0A 1YW9A 3RZOJ 3KZZA 2XASA 2WA0A 4EMSA 4FQGA 3GBGA 1R58A 2R7FA 3DLLF 3E5UA 4E7IA 1QZEA 3CLQA 1YLFA 3H1CA 2WY7Q 3RJPA 2Z5UA 4U7BA 2OAZA 3TGNA 1PYVA 3DTIA 4BQOA 2PJPA 3HGYA 1HA8A 2QKLB 2IRFG 1YI2I 2XSJC 2XGXA 1GXPA 1WJFA 4DIQA 2L2OA 4XLPF 2M5WA 1QVUA 1JKQC 1PUEE 2MH9A 1V5GA 2XKPA 5EZHA 2ELJA 3CCMI 3MCZA 4AUXA 2QBYB 1Z77A 3K69A 1TQIA 2OA4A 4OWRB 1TC3C 1B6AA 1R23A 3D5RC 3CDHA 1PVEA 3TMOA 1YYVA 2BY0A 2OQRA 2KDZA 4FX4A 2MW8A 2NVXJ 1ETWA 2YU3A 4J00A 1JI8A 1D1AA 2JZYA 1TWAJ 1OCCH 1UMQA 5KCMA 2L4MA 3JAMZ 3K2ZA 1HW5A 3TKYA 2EJRA 3HIFA 1IJWC 3TW7A 3BZCA 2XAHA 2VLAA 3JRGA 1P4WA 2RVCA 4L5IA 2X6XA 4RS8A 2X6OA 1XGMA 2VQHA 1W4MA 4PJLA 3KYCB 3ELKA 1AU7A 2XRLA 1IN7A 3AG3H 2DOEA 2Y0MA 3S3NA 3PJRA 4QWQA 5LFAA 1IGNA 3T1BA 3S14J 3HJEA 3H35A 4ZDPA 2VPLA 4KIFA 1NTCA 4LB5A 3FX3A 2DPUA 3KIOA 1ETVA 4LB6B 1XS9A 2L54A 2JT1A 3CUQB 4CICA 3WGGA 1G8XA 1VQ5I 3CESA 1NK3P 2XAQA 2CUFA 3OYHA 2HOAA 2HKXA 2DFIA 3LSHA 2RN7A 5K5QA 4OAZA 4EJTA 1IRFA 4Q4ZF 1H9TA 4UVCA 3I3LA 1S29A 3KETA 1JE8A 2ZMEA 5BQTA 1ETOA 2HNHA 2BY2A 2PQ8A 4E7LA 3CTAA 3GO5A 5ED4A 2KRFA 4D7MA 2IS1A 2FA5A 3EETA 1CF7B 3Q3SA 2OTJI 1P6RA 3I58A 1T38A 2BVLA 1EV7A 2B7EA 1GUUA 3V7CA 3OR1C 4ENKA 2E1OA 2Z3YA 1BI3A 5J1YA 2R5YA 3WU1B 3S16J 2ZMEC 1RR7A 3PSFA 3GTOJ 1X1AA 2KDOA 2CFOA 3S2WA 1D5YA 5BOXA 5EGOB 3GTQJ 1Z1DA 3IH4A 1R4NB 4M71A 3X2QH 1LQ1A 1R4MB 3BWGA 3H92A 4PGGA 1XDSA 4RGRA 4P9FA 3ZQ7A 2IEKA 2E1MB 3OS0A 2Y9YA 2W24A 1K4TA 3BCBA 1KU9A 1IC8A 2HDWA 4PJJA 3ECHA 2K9LA 4BEHB 2VKDA 5HLHA 4IHTA 1LFPA 1R71A 3F21A 2FRHA 4II2A 5D4SA 2H94A 4HNVA 3QQAA 2K5CA 4M74A 1T39A 4N9HA 2PMZA 1BI2A 4C3JJ 3BTJA 2XPWA 4GXOA 5TGTA 5IY5H 2EIKH 4A3DJ 2DK5A 1Y56A 3V8LA 1K7AA 3MN2A 2PFBA 4G8XA 2E60A 4DNCA 3J81K 1P9QC 3LAPA 2M8EA 1O3SA 1HW2A 1FPQA 4PGHA 3HM5A 5IP7J 1V5EA 3D5LA 2EZKA 3VYRB 4JP0A 2GXAA 1A6IA 1DP3A 1BJZA 1I1SA 2CQXA 2PLYA 4XLEA 3QAHA 4BE2A 2XGDA 4AIDA 2HZDA 2EIJH 3JRIA 2JMWA 1Z6TA 4YIIA 3F22A 4IQJA 3BG3A 4MGRA 2M30A 4PCQA 5D5VB 1TNSA 2IGKA 2Y69H 4QLCU 2UV1A 3WE2A 1JUPA 4BY1J 3K1MA 1WJDA 2PBIA 2D45A 4HG2A 3NQOA 1X3WB 3LNQA 3ERED 4IEJA 2P5VA 3A03A 4ZYHA 1O7LA 3SEQA 1MGTA 5EF6A 1DUXC 1FP1D 3PUBA 3JAMK 5H20A 4A2UA 5JLXA 4BHBA 1APLC 3A0HC 2OBPA 4A3IJ 3TEDA 1R5ID 5LLQA 3VODA 4DGWB 3SXYA 3S3MA 5HS8A 5ICFA 5ICGA 1U8RA 3QOPA 3ZCOA 2HPIA 4EEFG 4BS9A 3F3XA 4QTRA 1X1BA 5BPIA 3S15J 1CGPA 4KYWA 4A0XA 2EWNA 3DP7A 3FISA 5HOOA 4MTDA 1EH8A 1ZAOA 3C18A 3ABUA 2MD5A 1HDDC 1L0OC 1ULYA 4ZDLA 2QA4I 2V79A 3GLXA 1HOMA 3EDPA 1I3AA 1UFMA 2ZJQF 3K4MA 2VJ4A 2DOAA 4G9YA 1SD6A 2L9RA 3VYTB 3WGIA 3G3ZA 3RKWA 3MAJA 2FX0A 1FOWA 3FBNB 3QPSA 3RCOA 4GYGA 4WX9A 3HOTA 3GVAA 1TT5B 2DT7B 2IA0A 3JSOA 2VODA 3W6VA 2ZSIB 4IRIA 2NVUB 3FIWA 2ECCA 2LNBA 3OS1A 4B44A 1E17A 4A93J 4IOCF 2KQRA 4EJUA 3CZ6A 1JHHA 3P9CA 1V4RA 2HQNA 1FOKA 4XORA 1JTXA 3QODA 1IF1A 4KN4X 4HAMA 5EEGA 3RZDJ 2CQKA 1DGRM 1BL0A 2OCEA 5KAIC 1P4XA 4BXUA 3OYNA 3WTUC 4KFCA 1XD7A 4G6DA 4BH9A 3MZHA 2Y48A 1JUMA 2XIGA 1V5FA 4GO1A 5E8GA 2GZWA 3ZQIA 1C0WA 2M87A 1FTTA 1FSEA 2L3DA 1YX5A 2AXTC 2Q8KA 4YELA 3C3WA 2E2JJ 2KIMA 1N77A 2VBXA 4DOZA 1T08B 1F36A 4F7ZA 2LKPA 2MLGA 2ZC2A 5K1YA 3KCCA 4OINF 5KNLA 1SD4A 1YW8A 1I39A 2A69F 3C2GA 1XSDA 3H36A 2UXXA 4D7NA 1UELB 1WHUA 3RKQA 2K40A 1ZR4A 5JVGF 1PUFB 1T56A 5B1AH 4XKVA 5GPAA 3HB9A 3SJMA 4A3FJ 4E7JA 3LSGA 1I50J 2ECBA 4U87A 3IKTA 1D5VA 2YU9J 4HDVA 4QIWN 2H8RA 2ETHA 1K78B 1FOYA 5K5RA 1YTYA 1VQOI 1JGGA 1T0FA 4OIPF 1S8NA 1QU3A 3CD6I 2HVSA 1W5SA 5GAGJ 3AG1H 1E2XA 3E5XA 3HPHA 2MYSA 4XRFA 1YO5C 1VQLI 2V4JC 6PAXA 1IN5A 4LLNA 4HF0A 4DBRA 2DT6A 1X19A 4IF4A 3P7NA 5J8CA 2R7DA 1NG6A 1GXQA 1XGOA 3CLOA 5BS6A 4L0YB 2VE9A 4CH7A 4WK8F 4L9JA 1M1EB 2XF7A 3H3VK 3IP4B 4BQQA 2JPBA 4YFKF 4J01A 1MJBA 4RA2A 4Y52J 3LOCA 2L7FP 4IZZA 4HLXA 3TP3A 2BBYA 2P4WA 4MTEA 2LKXA 4LIVA 4C3IJ 2KRCA 1FYKA 2VC0A 4WF2A 5EEHA 3A02A 1VQKI 3ABKH 4HX8A 1ORKA 3GZ6A 1ZN2A 4IHXA 5EEAA 5GAEJ 4NB5A 3FWEA 2A5WA 3FXJA 4M9ZA 4YFNF 5TJJA 1RETA 2BE5F 3VB2A 5HDNA 1MH3A 1VQ9I 2R93J 2ID3A 2OZUA 4IHVA 1D0YA 2QSGX 1YQAA 4HX4A 2DU9A 5GP9A 2HWVA 2DI3A 1Z67A 1X1PA 3LL7A 1WJAA 2LOOA 3R60A 5E18F 4LG0B 2QQ9A 3K4JA 2Z33A 4A3MJ 1J2XA 4WXCA 4E70A 3HHGA 4G7ZF 3NARA 4ZYGA 5A2QZ 4KIBA 3V4GA 1KYZA 3KPHA 1EH7A 4OU0A 4BU2A 4CCOA 3A01A 3UKGA 3IL2A 1WPKA 4I2OA 2DFHA 3PFIA 3TO9A 3PSIA 1NHAA 2V6CA 2FQ4A 4R1HA 3K1NA 4B43A 4YFXF 3FHNA 1OJLA 3RSNA 3DTKA 4MHGA 2NS0A 2ESNA 3S1MJ 1IRZA 3L9FA 1J09A 3FXUA 2FBIA 1YFHA 2IGMA 2PMHA 2WBMA 4HRIA 1IAWA 1RKTA 3BJOA 2PEXA 3BR0A 4XM3A 2KZVA 3EUAA 4ETSA 4A6DA 2Y31A 2W1OA 4QPQA 1D8JA 3ABLH 2VT2A 1GV5A 2GXBA 2LTPA 4BJ5C 4XNFA 2GOMA 1L3LA 2V9VA 3LA3A 2RNJA 2M7BA 3VWBA 3QP6A 3LSRA 3HOXJ 1D0XA 1IN4A 5AONA 2JTVA 5HNFA 1B1BA 2A3SA 3BROA 1BBYA 1POGA 5B5EC 2RNGA 3D5SC 1D3YA 4RAFA 1SFUA 2A61A 1R1UA 3G4SI 2WY8Q 1S9HA 2RQQA 1OCZH 1OMIA 4B3XA 2CU7A 1QVTA 1OCOH 2DTRA 3BG7A 3G73A 3DCFA 3J7AY 3U1KA 1RI7A 2KT0A 2Z99A 1SMTA 4ZYDA 1Z0XA 3E6CC 2IW5A 4Z6YA 3J7AO 2V26A 3VSLA 5JFRA 4ABZA 1UJ8A 2E7XA 2OUMA 4A3JJ 1F1ZA 5LRRA 5M5XJ 4ESJA 4IHWA 1IW7F 1K79A 4HW0A 2CMPA 2WADA 4HV6A 4BL0B 3JRCA 3I55I 1OISA 1RR8C 3HXLA 2HYFA 3FXMA 4RGXA 5D8LB 3HTUA 5JR3A 5L3EA 5LHHA 2F5DA 5E8IA 4JX6A 1VFCA 2KJCA 3OWTA 2XPVA 1XGSA 4HSRA 3RDIA 3HEFA 1XG1A 5DDGA 3P5JA 3K0LA 4D1QA 5E20A 1KA8A 3DWLE 1SD7A 2GBYA 3KP3A 5LGNA 2L7ZA 4HLYA 3H9JA 1G3SA 1D1BA 1Y39A 2XAGA 3CJTB 4XLHA 3HTSB 2Y75A 2ZJRF 2LY9A 4M9XA 3U21A 4GGGA 1ZH5A 4J19A 4E7HA 3J7YJ 3CUQC 3S2DJ 3QU3A 2GXGA 3SDBA 4QSHA 1HC8A 3WTVC 4LMYA 2X1DA 2G0EA 4E7ZA 2E5ZA 4AIKA 1KU3A 4M72A 4PZJA 1V54H 4P96A 4RM2A 3CF5F 3HOYJ 2PN6A 1I1GA 3QU6A 2CUEA 3ZRGA 2LH9A 2EK5A 5CVIA 4HEA2 1Z05A 1LFBA 3RKXA 3PIOF 2HFHA 5F6FA 2D1VA 1G3WA 2DA1A 4BAYA 1UB9A 4U0WA 1LE8B 1FNNA 2QVOA 5IYDJ 2G7UA 4GRIA 1FTZA 4Q48A 3MKZA 3F9KA 2NOJB 3JR9A 1FP2A 1R7JA 5IT9K 5DM6F 1PUFA 3M7GA 1W7PB 4HF2A 5J1RA 1KZHA 3RYPA 3D0SA 3GTPJ 4XLAA 3EYYA 2PX9A 2TRTA 1LVKA 1TBXA 4M73A 2MGQA 2X1EA 2PJRB 2QM3A 4XLFA 4UB8C 4I01A 4XKBA 2OQGA 3ESWB 1TTYA 4D5CA 2DPDA 1TNTA 4YG2F 2DO7A 5L3DA 5IT3A 1LEBA 2G7HA 1O3QA 1U3EM 2L5QA 3S2HJ 2A6EF 2HKOA 4XMYA 4XQFA 2DMPA 4RAZA 3SEZA 3OYCA 4C3HJ 2RKHA 3FBIB 1PDNC 2NNYA 4OIRF 2Z9OA 5DUIA 2LK2A 1SFXA 2QYOA 5KVRA 2LKSA 2F2EA 5FFXA 4LLLA 3KP6A 1VZ0A 5IPAA 3VYSB 4RB0A 3RQIA 4DQ2A 4AYBA 3CCVI 1J75A 2QBYA 4X0GA 2VQCA 1HBXG 4OMYA 2YPRA 1TL8A 1D8KA 5C4XJ 4XL9A 2B9SA 3I71A 3L2RA 5D5UB 2LR8A 4CYCA 1ZKGA 3PIPF 4M6VA 2JA8J 1DDNA 2R7QA 3BJ6A 5FD5A 3RPQA 1ZGWA 2VPRA 5DS9A 4BE1A 3VFZA 1VQNI 2MABA 1G2HA 3Q0UA 1OYIA 2F5FA 2W25A 4L9VA 3CO7C 2CV2A 2EFOA 2MFZA 3K4CA 2M34A 4MLOA 5CQGA 4C2MJ 1TW2A 3B6AA 2HVQA 2VL8A 4I99C 1K61A 2ME0A 2OV7A 4B48A 1IXCA 2DFEA 2VBWA 2X9DA 3KP4A 2CGPA 2FXAA 3I4PA 3OYKA 2B0LA 2G9WA 3ZMVA 4G94A 5IOZA 3OY9A 3P9IA 2JA6J 1MBHA 2F5EA 1VI0A 2LSOA 5J4YA 3H0GJ 3HBLA 1A6QA 2KIUA 3HOWJ 5F64A 3M1CA 4PJ0C 1Z91A 2JQ7A 1S7EA 3QYEA 2YX4A 5L3BA 1YOVB 1RUOA 5HLIA 2HQRA 1GHCA 2BYVE 1RRJA 3SZTA 1VQ6I 1UHSA 1G3TA 3M9AA 3BDDA 1WQ2A 3A4CA 1W1WE 1OCTC 1XMXA 3BPXA 3U2RA 2JVHA 3F72A 4I0BA 2WTEA 4M3EA 3Q5FA 3SYTA 1YJNI 4I09A 5FRNA 1ETQA 2A07F 2MA3A 1W0TA 4JK1X 2E1MC 4KN7X 2EFWA 3NWTA 2I10A 1HKSA 3ZOBA 2DMNA 4OIOF 4ZZLA 4UV9A 3ZQCA 2WWYA 4Y3OA 2GAUA 4UV8A 2BHYA 2V1NA 2R7XA 2X85A 3BPVA 1ZGJA 4CCJA 4ZYEA 1P92A 4PSXA 1TT0A 3GYHX 1ZHFA 5FKLA 2MC4A 3HOSA 4HYEA 3TW6A 4LJZF 2MG4A 2L4AA 3TBIA 4M3BA 4Z2YA 3C2HA 2DBBA 2PMUA 2C6YA 3K7AJ 3I56I 2DA4A 2QENA 3F6OA 2ID6A 1WH7A 2MD0A 2XPUA 3ZPLA 2FNPA 1T0FC 1ITYA 1BI1A 5JHUA 3OSGA 2MH2A 1F43A 3GF2A 2UZKA 1FOXA 4O6JA 5HS9A 1QO0D 3ZMTA 2BV6A 1U0JA 3N05A 3UNGC 2FBHA 3MEXA 3ZQFA 4KICA 4N4OB 1XDUA 3I5UA 2EPFA 1S7AA 3KLNA 2H1LA 2JUCA 2DCEA 4L0ZB 4BXFA 5LEKA 2DFFA 3DQVC 3HG9A 3KEQA 4ANJA 4IJAA 2ZNZA 1ON1A 4EJWA 2P6SA 2P0WA 4WXDA 1LPQA 2VASA 1T2KA 3HRTA 4UXNA 3ZQQA 3CJQB 2XGEA 3R61A 1X4OA 4H4KC 2O5RA 3S3OA 2V7FA 4II3A 3F6VA 1BC8C 2ADUA 3LFKA 4C9YA 2LLKA 3M8FA 1U2WA 3BTLA 3FMRA 2V6EA 4WCGA 2BY3A 3GMEA 2KL4A 3B02A 2FMYA 3SHFA 4IHSA 3W3CA 2M45A 1U78A 1MKMA 1RKWA 3S93A 1Y1WJ 2P7VB 3BLYA 3FMQA 4XR6A 1W5CC 2K3PA 3F8CA 1SAUA 3HRMA 3J81Z 2COMA 3CCRI 4A3CJ 3ASOH 3PQKA 1JT0A 2HXOA 1WKMA 3R0JA 1SANA 3M4OJ 4A69C 1I3QJ 3MQ0A 1USTA 2W57A 4IKFA 2VJIA 2DW4A 1XTAA 3ZQGA 1WZ2A 5EYRA 1OCPA 5BPDA 3MWMA 4FE4A 4KISA 3S8PA 1O7FA 3A1YA 4I0AA 4B09A 3H3ZA 4G12A 2NXNB 2XVCA 3C7JA 2V1XA 1FBUA 1T95A 1WCMJ 3KP2A 1IRGA 2Y9ZA 2EZIA 1MMNA 3ABMH 3IH3A 2DJNA 5CVRA 4A0ZA 2E36A 2FQ3A 1AA7A 4D5FA 5L3GA 2H8WA 4L5JA 3R6SA 3HC7A 2D5VA 4DZPA 1LVAA 3CP8A 2DODA 2QKMB 2M0CA 3WTSC 3LMMA 3OYLA 1IXRC 2JRMA 5LRSA 5EG0B 1BN5A 3OOUA 3G71I 2GM4A 4WWCA 2A68F 3OR2C 2BGCA 1Z7LA 3HSEA 4HV5A 2EFQA 3MZYA 1GVDA 1HXDA 4Y15A 1LKXA 3HYIA 2XROA 4CHUA 2R7TA 2R7VA 2HXIA 1X1CA 4I6ZA 1BM9A 5C4JJ 1B8IB 5HLTA 5E79C 4B1RA 1X3UA 2EINH 2QUFA 3F8NA 5BMZA 1MMAA 1CQTA 2VIXA 3FK7A 4RB1A 4XICA 1LE8A 1E0EA 2ZJPF 5DM7F 3MFKA 2Q2EB 5JHFA 4PSWA 2DN0A 1O57A 1ZK8A 2DTZA 3HRSA 4LIUA 3J80K 4UB6C 4KDPA 2JSCA 2XGCA 1R9TJ 1IN6A 5M5WJ 3K4KA 1F4KA 1P7JA 2HEOA 3LSTA 4BNCA 2V9KA 3FM3A 4A3KJ 2O3FA 2OZ6A 1KQ8A 2M3AA 1FMWA 2VONA 2K4JA 2K9MA 2NOGA 2VE8A 2HZTA 2F5CA 5EDNA 2CS3A 3S1RJ 4MO7A 1Z9CA 1ETYA 5FKNA 1FIPA 1R6RA 2QSHX 1TQMA 2NS8A 1XMKA 2YUSA 1FYLA 5ILUA 1YX3A 3OL4A 2K9NA 3H3UA 4AM3A 1D0ZA 3W2VA 2EA2A 1U9OA 3K9TA 2VUMJ 5F1JA 2DA2A 1JGSA 4HNTA 1HSTA 5JI6A 3HOVJ 2L02A 2IJLA 1JKPC 5J1UA 4Y13A 1OPCA 2EZLA 3LSIA 3QYBA 2A6TA 3WHCA 4BHCA 1B72B 1ZGAA 3QOEA 1H9GA 1VF9A 3HRUA 2ISZA 5B1BH 2A6HF 1QHHD 2HR3A 3GTJJ 2LP0A 1I27A 1GV2A 1A04A 3K70C 2EA4A 4XSZF 2OTLI 1H0MA 1OR7A 3PL8A 3KX2A 2JJ7A 3CUQA 4FISA 3VPRA 1USSA 1FWZA 2K7LA 3U1DA 2GA1A 4RGUA 1FMVA 1ZTRA 3T5XA 3KYDB 3FKJA 1KYWA 3ULQB 1MDMA 2MBFA 3CMYA 5H6QA 1RPWA 2X0LA 4LFUA 1BC7C 3S17J 3S32A 4U7DA 2DMQA 2ZKZA 4ZDOA 3F0CA 4ZZDA 3KP5A 1E3HA 2M7AA 2R7UA 4EV0A 1RUNA 2FF4A 5L3CA 1TW3A 1CF7A 3M1EA 1MBEA 1FC3A 3BT9A 2VXZA 1U5TA 1TLHB 4D9JA 3OYAA 1XSXA 3GW2A 2EH3A 1WFXA 5E1ZB 5AIPA 3GTMJ 4ENJA 3TL4X 4XK4A 2XRNA 2OC6A 2E5NA 4YIRX 5AIQA 1MD0A 2KJBA 2LY2A 3BJAA 3LQQA 4X1EA 4A3LJ 2DMTA 4CGZA 1Y0UA 5FLMJ 2ISYA 3IRRA 4BE0A 1K6OA 3O8GA 2WAQA 2NYXA 4N9IA 2QQBA 3HSFA 3DBLB 1YW7A 3I0TA 2ACJA 2O7OA 2V1UA 2HOSA 2L9SA 2KIFA 5HNHA 3OYDA 4V2FA 4N0BA 4BJTA 4ZJZA 4BACA 2Q2EA 5HS7A 3CC4I 3LAJA 5DCMB 4LGWA 3V7RA 1QZYA 4BJ6C 2ELHA 1YS6A 2QQAA 3CQZJ 5K7HA 4AWXB 4OIQF 3NAUA 3IWZA 1WRJA 4UVAA 4AYBN 4HBLA 4MFEA 1IO2A 2HYGD 3PFYA 2GOXB 2KISA 4HX7A 3T8TA 1MBFA 3FK6A 3CO6C 3H0DA 2Z16A 2HYJA 5FB2A 2RREA 1SC7A 2IS6A 5K7ZA 1K4SA 3K4BA 2CQNA 1ZLJA 2OJED 2FD5A 2R7OA 1ZRCA 2FOWA 3EPZA 1YS7A 4RGSA 4B3AA 2J5PA 3E3VA 3VSKA 3K4LA 2E19A 2JRTA 2H27A 4NQWB 4F93B 3N97A 3ZMSA 4BUPA 2QEXI 2KRHA 4P55A 1JUSA 2K27A 2HQAA 1OKRA 2BXZA 1YIOA 2E34A 3CDIA 5GTIC 4F92B 2VKEA 2CJJA 1OR7C 4E4HA 1DQUA 1LUJB 2O6GE 4I02A 3TP0A 2OD5A 5C3EJ 4A5MA 4XOPA 1EA3A 3QYFA 3AG4H 1GDTA 3GTLJ 1I6HJ 2QWWA 4ZYAA 3DV8A 3PNTA 3ZQLA 2HTSA 3LA2A 5ILVA 4KT6A 4I7HA 4ENNA 3TOBA 1OFCX 4BKXA 2O03A 4S05A 3FXQA 3E97A 3L00A 2VKVA 1XB4A 2E71A 3DEEA 4S0HB 1LFUP 2DYSH 4KNYA 4FHTA 3IAM2 4V19K 1MMSA 2ZXIA 3LFUA 2FJ1A 4NUBA 4OOIA 3DLAA 5J3LA 3W6JB 4E7KA 1YHQI 1W7PD 3CP2A 3L2CA 4ZTFA 4LK0F 3H5AA 2CSOA 2AXLA 3RKYA 2LBFA 1R49A 1NG7A 4S04A 5FLVA 3OSFA 3WG7H 5E3MA 1IUYA 3A0BC 3H9GA 4DW6A 3IAS2 1XC5A 1A35A 4A3EJ 2X51A 5ICCA 4FT8A 3K10A 1R22A 3DEWA 4RBOA 2HTJA 3NRVA 4HA8A 1SVMA 4EJOA 1UZCA 1DGWY 1JT6A 3CCSI 4CDGA 3KFWX 4UUSB 4AVPA 4EJVA 4JX4A 3PUFA 1WH5A 3EYIA 1ZQ3P 1GT0C 5M3MJ 2ZFUA 3RTRA 2HS5A 3G1LA 3OIQA 4IPAA 1B8IA 1IRXA 1G3YA 3CCQI 3JTHA 3FM5A 3HOUJ 1ZG1A 1XMAA 2L9VA 3L7WA 2E2HJ 3BP8A 2IT0A 4KMFA 2FOKA 2A5YB 1W36D 4BY7J 1SMYF 3QPLA 5C44J 1W5TA 2WB1A 2F4OB 1MNMC 1F9NA 2OF7A 1IUFA 4NC6A 4AVZA 3DPLC 1T8IA 1XSVA 3IH2A 1RIOH 2CQQA 3H5NA 4C30A 1X1DA 5D5WB 3JRDA 4AU7A 2STWA 3L1PA 3R4KA 1RZ4A 2N8GA 5TISC 1OQYA 4AD9A 1JXSA 3DXJF 2L9NA 1Z3XA 4GFBA 4RB3C 2IXSA 4PFPA 1IXSB 4BQNA 5CJ9A 1FBSA 1U9NA 3W2WA 5LGTA 2DAOA 4WXHA 3JW4A 3MKWB 2H6CA 1YITI 2J5OA 3GFJA 2IAIA 1EKEA 4RB2C 3OYEA 5LBQA 3CJNA 3MD2A 3F23A 3FXKA 1ZELA 1QPIA 3J7ZI 3UR3C 1WJEA 2ZB9A 2L0KA 2H1KA 3ZQHA 4ITVA 3OOPA 4KIGA 4X6AJ 1BOBA 2UXNA 4LK1F 4R79A 3HZJA 4OMZA 3AG2H 1BI0A 2XB5A 2BVMA 2XAFA 5IYCJ 4XRSA 4M6YA 4N4NB 1SAXA 5FKMA 3VEPA 3K6GA 4RMNA 1DPUA 4FASD 2ZXWH 4NC7A 1S3JA 3W2AA 4M3GA 2E1NA 1AOYA 1XN7A 3JRAA 3G2BA 2KIQA 5FGMA 2XUBA 5FFZA 4KUMA 4LOCA 1GLNA 1AWCA 1FZPB 3FXRA 1QHGA 3CMMA 4E6KG 2OPTA 3JTGA 2R5ZA 3ZP5A 4K2EA 2DYRH 1A31A 2R7WA 1KGSA 3OYIA 2WV1A 2BW3A 2BZTA 3B73A 4CYCB 3GTKJ 1XPXA 1IV8A 2LF7A 4IL6C 4HPQA 2P5LC 1XCVA 2XAJA 1ETXA 1B72A 4H0EA 1Q1HA 3CC7I 3M8EA 5M3FJ 3S1QJ 1MBGA 2LC2A 1U5TB 1OYYA 5GAHJ 3ROUA 3CC2I 3L2UA 3TO6A 5IP6A 2Y2ZA 4XSXF 3ZGKA 4A0YA 4XN0A 2JUGA 1S6LA 1BR1A 3O8HA 2IS4A 4EATA 1YRNA 3TOAA 3PQJA 2HOEA 4RLQA 3CUOA 1MZBA 1V3FA 2XB0X 3FHZA 3K4NA 1MDMB 1WJCA 2B63J 3IWFA 5JLWA 1DP7P 4FTHA 1DU6A 1TWHJ 4PJNA 5IYBJ 3MKLA 3AAFA 1VQMI 2JA5J 3WG9A 1F5TA 1N25A 3B6CA 1YE9A 1Y8RB 3LQRA 5D8KB 3BC8A 2DJIA 2VKHA 1WGXA 1ZR2A 4Y33A 3FZVA 2R5YB 4ZH4F 1J59A 5KAFC 3DKWA 3KZIC 3QWLA 3PNYA 3FDYA 2GWRA 4PDKA 1MNEA 5F0FA 4Y17A 5EGOA 5J40A 4E7SA 1K83J 1K6YA 5FROA 4F3QA 1N75A 4U88A 2W48A 3OYFA 4IHYA 2WB1N 1R1VA 3FXLA 2JA7J 2H6BA 1X58A 4W97A 5TRDA 4EVIA 4UUTA 4OAYA 4IX7A 1X3ZB 2UWMA 1RNLA 3K1PA 1JHFA 1FY7A 4U0VA 1MSEC 1J9IA 3H5RA 2IBDA 1X4PA 4GYIA 1BJAA 1KQ0A 4NQWA 2L7KA 1IZ1A
chains in the Genus database with same CATH topology
4W1UA 1WCMJ 4Y52J 2Y9ZA 2EZIA 3LOCA 2L7FP 3IH3A 1TWCJ 2DJNA 5E3LA 3TP3A 1VNDA 2L7MP 2QCOA 4D5FA 2LKXA 3LSJA 2D5VA 4C3IJ 4DZPA 3I4MJ 3OIOA 2M0CA 2MSYA 3A02A 5E3OA 1ORKA 2CRGA 5EG0B 1QRYA 3OOUA 4V2GA 5K7FA 2GM4A 4IHXA 5EEAA 4L5EA 3BR5A 2O8KA 2LD5A 3HDDA 4BBSJ 1RETA 1GVDA 2YS9A 3PM1A 2HDDA 2DA7A 2HXIA 2EZHA 4XIDA 4I6ZA 1B8IB 5C4JJ 3FKIJ 5F0HA 3MVPA 1MH3A 4B1RA 2R93J 1CQTA 2ID3A 4IHVA 3GTGJ 3FK7A 3S1NJ 4XICA 1LE8A 5GP9A 2JK3A 1O4XA 5FJ8J 2DN0A 1BA5A 4M3DA 1ZK8A 2DTZA 4BBRJ 2ELKA 4A3MJ 3NARA 2XGCA 1R9TJ 1AKHA 1FIAA 2DA5A 3HKZN 1JTYA 1P7JA 2NS7A 5M5WJ 3M3YJ 4MFDA 3BQZA 4A3KJ 2M9HA 2M2EA 2GLOA 3A01A 2NOGA 5F27A 3UKGA 1H89C 1WPKA 1ENHA 1DU0A 5EDNA 3S1RJ 1BW6A 3BR6A 4MO7A 2NVQJ 1ETYA 5FKNA 1FIPA 2FQ4A 1MH4A 2NS8A 2YUSA 4MIMA 1H88C 2NVYJ 3G1OA 2K9NA 3BQYA 1U9OA 2VUMJ 1IDZA 5F1JA 1OJLA 2DA2A 1IDYA 3HOVJ 3I4NJ 3WHBA 2DA3A 3S1MJ 1JKPC 1IRZA 5J1UA 4RDUA 1RESA 1SFOJ 2EZLA 2ME6A 2WAQN 3WHCA 3C2BA 1B72B 1U8BA 2K9QA 1VF9A 2AHQA 3BG5A 1RKTA 2LVSA 4AC0A 3BR0A 3RZOJ 5EZGA 3GTJJ 2LP0A 1GV2A 3Q0VA 2Y31A 3GBGA 3BR1A 1GV5A 2LTPA 2JJ7A 4FISA 3VPRA 4A3BJ 3BTIA 4A3GJ 4FE7A 1A5JA 4FCYA 1ZTRA 3LSRA 3HGYA 3HOXJ 5HODA 3D1NI 1W0UA 3CMYA 1POGA 4NDLA 1RPWA 4I76A 5IOYA 3S17J 2DMQA 1QVUA 1JKQC 5EZHA 2CU7A 3F0CA 1QVTA 4AUXA 1Z77A 3DCFA 2KT0A 1TC3C 1Z0XA 1MBEA 3BT9A 1MSFC 4ABZA 2KDZA 5EG0A 4BXXJ 4A3JJ 2EH3A 2MW8A 2NVXJ 1ETWA 5M5XJ 3GTMJ 4IHWA 1TWAJ 1UMQA 1E3OC 4XK4A 3JRBA 3JRCA 1EF4A 4X1EA 1BW5A 4A3LJ 2DMTA 3BTCA 3JREA 1IJWC 4Y7NJ 5FLMJ 1T33A 1TWFJ 4JX6A 1VFCA 3TW7A 3O8GA 2XPVA 3JRGA 3HEFA 2O7OA 2X6OA 2HOSA 1XG1A 2Y0SN 4V2FA 5F0CA 2R7ZJ 1AU7A 2GBYA 2L7ZA 2XRLA 1IGNA 3S14J 1FEXA 5K7HA 3CQZJ 1NTCA 3NAUA 2LY9A 4AYBN 4MFEA 4J19A 1ETVA 5M5YJ 1XS9A 3S2DJ 2VI6A 4QSHA 1MBFA 3FK6A 2DMUA 1NK3P 2G0EA 2HYJA 2CUFA 2HOAA 5K7ZA 1IG7A 2FD5A 3HOYJ 4B3AA 2HQ5A 2CUEA 3JRHA 1YRNB 2E19A 1LFBA 1X2NA 3JRFA 2DA1A 1ETOA 1LE8B 5IYDJ 3CDLA 1FTZA 5FKKA 4D7MA 3JR9A 1JUSA 2R5ZB 3Q3SA 1PUFA 4JX5A 5J1RA 3PO2J 3GTPJ 2VKEA 1GUUA 2CJJA 2TRTA 1JJ8C 1AKHB 2MGQA 2JWTA 5F08A 2E1OA 5J1YA 3TP0A 2R5YA 4D5CA 5C3EJ 3S16J 1RR7A 4B4CA 1GDTA 3GTOJ 3GTLJ 1D5YA 9ANTA 1I6HJ 1ETKA 5EGOB 3GTQJ 3IH4A 5E3NA 3S2HJ 3ZQLA 2COBA 2DMPA 2DA6A 1HCRA 2IEKA 4C3HJ 2Y9YA 1OFCX 4BKXA 1IC8A 2LK2A 2VKVA 1JKRC 5IPAA 4S0HB 1LFUP 3IV5A 3RQIA 4DZJA 2FJ1A 5F04A 5J3LA 4HNVA 3QQAA 5C4XJ 4C3JJ 3BTJA 2XPWA 2TCTA 2LR8A 4CYCA 1ZKGA 4A3DJ 4M6VA 2JA8J 3MN2A 5FLVA 3OSFA 1ZGWA 5E3MA 2VPRA 5DS9A 1JJ6C 4DW6A 1XC5A 4A3EJ 3A01B 3HM5A 3Q0UA 5IP7J 1G2HA 4RBOA 3DEWA 5FKOA 3G1MA 2EZKA 1WI3A 4JP0A 1A6IA 4MLOA 4EEFG 1UG2A 2M34A 1BJZA 4C2MJ 2CQXA 3B6AA 2M8GX 2XGDA 1K61A 1JT6A 3BG9A 2ME0A 3JRIA 2AO9A 4UUSB 2JMWA 2X9DA 4JX4A 1WH5A 3BG3A 1ZQ3P 5M3MJ 5IOZA 1B8IA 3G1LA 1JUPA 1AHDP 2JA6J 4BY1J 1MBHA 1VI0A 3H0GJ 5BNGA 3HOUJ 3HBLA 3BR3A 3LNQA 2R92J 3HOWJ 4IEJA 1MBKA 2E2HJ 3A03A 1S7EA 1Y1VJ 4BY7J 5EF6A 5IP9J 1TWGJ 3QPLA 5C44J 3BR2A 1UHSA 5GPCA 3HGGA 5JLXA 1MNMC 2OF7A 1IUFA 1APLC 3IH2A 1OCTC 2CQQA 4JYKA 4A3IJ 3TEDA 3JRDA 4M3EA 3L1PA 4XRSG 2EBIA 1HF0A 2N8GA 1P7IA 1ETQA 2P81A 2PMZN 4QTRA 1W0TA 4GFBA 2K9SA 3S15J 3FISA 3Q0WA 2I10A 1Q1VA 3ZOBA 2DMNA 1H8AC 3ZQCA 1U9NA 1HDDC 2LFBA 2IAIA 1HDPA 4DYCA 1HOMA 1QPIA 2ZB9A 2L0KA 2H1KA 3ZQHA 4X6AJ 2L9RA 2NVTJ 5FKLA 2XB5A 3SFIA 5IYCJ 4XRSA 2FX0A 2X48A 3QPSA 3TW6A 5FKMA 1NK2P 1JKOC 2MG4A 4M3BA 4UUSA 3K7AJ 4M3FA 4M3GA 3W6VA 3FIWA 2ECCA 2DA4A 2ID6A 3JRAA 3CCYA 5DTDA 4A93J 1WH7A 2XPUA 4LOCA 1ITYA 2OPTA 4XRMA 3OSGA 1F43A 2R5ZA 1MBJA 3E7LA 1JTXA 3LSPA 3PO3J 3ZQFA 2WV1A 2EQRA 2E2IJ 3RZDJ 4CYCB 2RAEA 1BL0A 3GTKJ 1ETXA 1B72A 1JUMA 5M3FJ 3S1QJ 1FTTA 1MBGA 3ZQIA 5IP6A 2Y2ZA 1FJLA 2XGEA 1HLVA 2QF7A 2E2JJ 1F36A 3O8HA 1YRNA 2LLKA 2R0QC 2Y30A 3BTLA 2XB0X 4D7NA 2B63J 3RKQA 5JLWA 2K40A 4FTHA 1ZR4A 1DU6A 1TWHJ 1T56A 2XSDC 1PUFB 4DYQA 5GPAA 3HB9A 3MKLA 5IYBJ 3SJMA 4A3FJ 2JA5J 3LSGA 1I50J 3B6CA 1U78A 2ECBA 1RKWA 1Y1WJ 2YU9J 1WGXA 1ZR2A 4QIWN 2H8RA 2HI3A 2R5YB 1JGGA 1X2MA 4A3CJ 1JT0A 2HXOA 3SDGA 5F0FA 1SANA 3M4OJ 4A69C 5EGOA 1I3QJ 1K83J 3HOZJ 2W48A 1IV6A 3ZQGA 2O9LA 5EYRA 4IHYA 1OCPA 2WB1N 3K2AA 2JA7J 4W97A 4FE4A 1X58A 4UUTA 4DYRA 1MSEC 4G12A 2IBDA 2JN6A 3H3VK 2HOTA 1GT0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W1U A;  1WCM J;  4Y52 J;  2Y9Z A;  2EZI A;  3LOC A;  2L7F P;  3IH3 A;  1TWC J;  2DJN A;  5E3L A;  3TP3 A;  1VND A;  2L7M P;  2QCO A;  4D5F A;  2LKX A;  3LSJ A;  2D5V A;  4C3I J;  4DZP A;  3I4M J;  3OIO A;  2M0C A;  2MSY A;  3A02 A;  5E3O A;  1ORK A;  2CRG A;  5EG0 B;  1QRY A;  3OOU A;  4V2G A;  5K7F A;  2GM4 A;  4IHX A;  5EEA A;  4L5E A;  3BR5 A;  2O8K A;  2LD5 A;  3HDD A;  4BBS J;  1RET A;  1GVD A;  2YS9 A;  3PM1 A;  2HDD A;  2DA7 A;  2HXI A;  2EZH A;  4XID A;  4I6Z A;  1B8I B;  5C4J J;  3FKI J;  5F0H A;  3MVP A;  1MH3 A;  4B1R A;  2R93 J;  1CQT A;  2ID3 A;  4IHV A;  3GTG J;  3FK7 A;  3S1N J;  4XIC A;  1LE8 A;  5GP9 A;  2JK3 A;  1O4X A;  5FJ8 J;  2DN0 A;  1BA5 A;  4M3D A;  1ZK8 A;  2DTZ A;  4BBR J;  2ELK A;  4A3M J;  3NAR A;  2XGC A;  1R9T J;  1AKH A;  1FIA A;  2DA5 A;  3HKZ N;  1JTY A;  1P7J A;  2NS7 A;  5M5W J;  3M3Y J;  4MFD A;  3BQZ A;  4A3K J;  2M9H A;  2M2E A;  2GLO A;  3A01 A;  2NOG A;  5F27 A;  3UKG A;  1H89 C;  1WPK A;  1ENH A;  1DU0 A;  5EDN A;  3S1R J;  1BW6 A;  3BR6 A;  4MO7 A;  2NVQ J;  1ETY A;  5FKN A;  1FIP A;  2FQ4 A;  1MH4 A;  2NS8 A;  2YUS A;  4MIM A;  1H88 C;  2NVY J;  3G1O A;  2K9N A;  3BQY A;  1U9O A;  2VUM J;  1IDZ A;  5F1J A;  1OJL A;  2DA2 A;  1IDY A;  3HOV J;  3I4N J;  3WHB A;  2DA3 A;  3S1M J;  1JKP C;  1IRZ A;  5J1U A;  4RDU A;  1RES A;  1SFO J;  2EZL A;  2ME6 A;  2WAQ N;  3WHC A;  3C2B A;  1B72 B;  1U8B A;  2K9Q A;  1VF9 A;  2AHQ A;  3BG5 A;  1RKT A;  2LVS A;  4AC0 A;  3BR0 A;  3RZO J;  5EZG A;  3GTJ J;  2LP0 A;  1GV2 A;  3Q0V A;  2Y31 A;  3GBG A;  3BR1 A;  1GV5 A;  2LTP A;  2JJ7 A;  4FIS A;  3VPR A;  4A3B J;  3BTI A;  4A3G J;  4FE7 A;  1A5J A;  4FCY A;  1ZTR A;  3LSR A;  3HGY A;  3HOX J;  5HOD A;  3D1N I;  1W0U A;  3CMY A;  1POG A;  4NDL A;  1RPW A;  4I76 A;  5IOY A;  3S17 J;  2DMQ A;  1QVU A;  1JKQ C;  5EZH A;  2CU7 A;  3F0C A;  1QVT A;  4AUX A;  1Z77 A;  3DCF A;  2KT0 A;  1TC3 C;  1Z0X A;  1MBE A;  3BT9 A;  1MSF C;  4ABZ A;  2KDZ A;  5EG0 A;  4BXX J;  4A3J J;  2EH3 A;  2MW8 A;  2NVX J;  1ETW A;  5M5X J;  3GTM J;  4IHW A;  1TWA J;  1UMQ A;  1E3O C;  4XK4 A;  3JRB A;  3JRC A;  1EF4 A;  4X1E A;  1BW5 A;  4A3L J;  2DMT A;  3BTC A;  3JRE A;  1IJW C;  4Y7N J;  5FLM J;  1T33 A;  1TWF J;  4JX6 A;  1VFC A;  3TW7 A;  3O8G A;  2XPV A;  3JRG A;  3HEF A;  2O7O A;  2X6O A;  2HOS A;  1XG1 A;  2Y0S N;  4V2F A;  5F0C A;  2R7Z J;  1AU7 A;  2GBY A;  2L7Z A;  2XRL A;  1IGN A;  3S14 J;  1FEX A;  5K7H A;  3CQZ J;  1NTC A;  3NAU A;  2LY9 A;  4AYB N;  4MFE A;  4J19 A;  1ETV A;  5M5Y J;  1XS9 A;  3S2D J;  2VI6 A;  4QSH A;  1MBF A;  3FK6 A;  2DMU A;  1NK3 P;  2G0E A;  2HYJ A;  2CUF A;  2HOA A;  5K7Z A;  1IG7 A;  2FD5 A;  3HOY J;  4B3A A;  2HQ5 A;  2CUE A;  3JRH A;  1YRN B;  2E19 A;  1LFB A;  1X2N A;  3JRF A;  2DA1 A;  1ETO A;  1LE8 B;  5IYD J;  3CDL A;  1FTZ A;  5FKK A;  4D7M A;  3JR9 A;  1JUS A;  2R5Z B;  3Q3S A;  1PUF A;  4JX5 A;  5J1R A;  3PO2 J;  3GTP J;  2VKE A;  1GUU A;  2CJJ A;  2TRT A;  1JJ8 C;  1AKH B;  2MGQ A;  2JWT A;  5F08 A;  2E1O A;  5J1Y A;  3TP0 A;  2R5Y A;  4D5C A;  5C3E J;  3S16 J;  1RR7 A;  4B4C A;  1GDT A;  3GTO J;  3GTL J;  1D5Y A;  9ANT A;  1I6H J;  1ETK A;  5EGO B;  3GTQ J;  3IH4 A;  5E3N A;  3S2H J;  3ZQL A;  2COB A;  2DMP A;  2DA6 A;  1HCR A;  2IEK A;  4C3H J;  2Y9Y A;  1OFC X;  4BKX A;  1IC8 A;  2LK2 A;  2VKV A;  1JKR C;  5IPA A;  4S0H B;  1LFU P;  3IV5 A;  3RQI A;  4DZJ A;  2FJ1 A;  5F04 A;  5J3L A;  4HNV A;  3QQA A;  5C4X J;  4C3J J;  3BTJ A;  2XPW A;  2TCT A;  2LR8 A;  4CYC A;  1ZKG A;  4A3D J;  4M6V A;  2JA8 J;  3MN2 A;  5FLV A;  3OSF A;  1ZGW A;  5E3M A;  2VPR A;  5DS9 A;  1JJ6 C;  4DW6 A;  1XC5 A;  4A3E J;  3A01 B;  3HM5 A;  3Q0U A;  5IP7 J;  1G2H A;  4RBO A;  3DEW A;  5FKO A;  3G1M A;  2EZK A;  1WI3 A;  4JP0 A;  1A6I A;  4MLO A;  4EEF G;  1UG2 A;  2M34 A;  1BJZ A;  4C2M J;  2CQX A;  3B6A A;  2M8G X;  2XGD A;  1K61 A;  1JT6 A;  3BG9 A;  2ME0 A;  3JRI A;  2AO9 A;  4UUS B;  2JMW A;  2X9D A;  4JX4 A;  1WH5 A;  3BG3 A;  1ZQ3 P;  5M3M J;  5IOZ A;  1B8I A;  3G1L A;  1JUP A;  1AHD P;  2JA6 J;  4BY1 J;  1MBH A;  1VI0 A;  3H0G J;  5BNG A;  3HOU J;  3HBL A;  3BR3 A;  3LNQ A;  2R92 J;  3HOW J;  4IEJ A;  1MBK A;  2E2H J;  3A03 A;  1S7E A;  1Y1V J;  4BY7 J;  5EF6 A;  5IP9 J;  1TWG J;  3QPL A;  5C44 J;  3BR2 A;  1UHS A;  5GPC A;  3HGG A;  5JLX A;  1MNM C;  2OF7 A;  1IUF A;  1APL C;  3IH2 A;  1OCT C;  2CQQ A;  4JYK A;  4A3I J;  3TED A;  3JRD A;  4M3E A;  3L1P A;  4XRS G;  2EBI A;  1HF0 A;  2N8G A;  1P7I A;  1ETQ A;  2P81 A;  2PMZ N;  4QTR A;  1W0T A;  4GFB A;  2K9S A;  3S15 J;  3FIS A;  3Q0W A;  2I10 A;  1Q1V A;  3ZOB A;  2DMN A;  1H8A C;  3ZQC A;  1U9N A;  1HDD C;  2LFB A;  2IAI A;  1HDP A;  4DYC A;  1HOM A;  1QPI A;  2ZB9 A;  2L0K A;  2H1K A;  3ZQH A;  4X6A J;  2L9R A;  2NVT J;  5FKL A;  2XB5 A;  3SFI A;  5IYC J;  4XRS A;  2FX0 A;  2X48 A;  3QPS A;  3TW6 A;  5FKM A;  1NK2 P;  1JKO C;  2MG4 A;  4M3B A;  4UUS A;  3K7A J;  4M3F A;  4M3G A;  3W6V A;  3FIW A;  2ECC A;  2DA4 A;  2ID6 A;  3JRA A;  3CCY A;  5DTD A;  4A93 J;  1WH7 A;  2XPU A;  4LOC A;  1ITY A;  2OPT A;  4XRM A;  3OSG A;  1F43 A;  2R5Z A;  1MBJ A;  3E7L A;  1JTX A;  3LSP A;  3PO3 J;  3ZQF A;  2WV1 A;  2EQR A;  2E2I J;  3RZD J;  4CYC B;  2RAE A;  1BL0 A;  3GTK J;  1ETX A;  1B72 A;  1JUM A;  5M3F J;  3S1Q J;  1FTT A;  1MBG A;  3ZQI A;  5IP6 A;  2Y2Z A;  1FJL A;  2XGE A;  1HLV A;  2QF7 A;  2E2J J;  1F36 A;  3O8H A;  1YRN A;  2LLK A;  2R0Q C;  2Y30 A;  3BTL A;  2XB0 X;  4D7N A;  2B63 J;  3RKQ A;  5JLW A;  2K40 A;  4FTH A;  1ZR4 A;  1DU6 A;  1TWH J;  1T56 A;  2XSD C;  1PUF B;  4DYQ A;  5GPA A;  3HB9 A;  3MKL A;  5IYB J;  3SJM A;  4A3F J;  2JA5 J;  3LSG A;  1I50 J;  3B6C A;  1U78 A;  2ECB A;  1RKW A;  1Y1W J;  2YU9 J;  1WGX A;  1ZR2 A;  4QIW N;  2H8R A;  2HI3 A;  2R5Y B;  1JGG A;  1X2M A;  4A3C J;  1JT0 A;  2HXO A;  3SDG A;  5F0F A;  1SAN A;  3M4O J;  4A69 C;  5EGO A;  1I3Q J;  1K83 J;  3HOZ J;  2W48 A;  1IV6 A;  3ZQG A;  2O9L A;  5EYR A;  4IHY A;  1OCP A;  2WB1 N;  3K2A A;  2JA7 J;  4W97 A;  4FE4 A;  1X58 A;  4UUT A;  4DYR A;  1MSE C;  4G12 A;  2IBD A;  2JN6 A;  3H3V K;  2HOT A;  1GT0 C; 
#chains in the Genus database with same CATH topology
 3CME I;  2WAF A;  3ASN H;  2I5U A;  2M4K A;  2V1D A;  1TWC J;  3OYB A;  2ZBK A;  2GQQ A;  2QCO A;  4CO8 A;  3LSJ A;  3CCU I;  1MMD A;  5CVV A;  1T98 A;  4L18 B;  2LDU A;  3I59 A;  2E7W A;  2E35 A;  4IQ4 A;  4FX0 A;  3SFZ A;  2MC3 A;  2M0M A;  3CF2 A;  2LF8 A;  3HUG B;  2BY1 A;  3FXO A;  4M6X A;  1R5G A;  1QZZ A;  4L5E A;  4MNU A;  2PI0 A;  3BR5 A;  1HKT A;  3LA7 A;  2O8K A;  1KON A;  2LD5 A;  4BBS J;  1YJW I;  2YS9 A;  2STT A;  2HDD A;  1EJ9 A;  1O3R A;  2DA7 A;  5DV5 A;  2EZH A;  4XID A;  5F0H A;  2IA2 A;  3CCL I;  2ZXJ A;  3MVP A;  2VQL A;  3RIR A;  4HDU A;  2F4I A;  3EUH A;  3TO7 A;  3Q9S A;  4HQM A;  3OIP A;  2KZG A;  1B4A A;  3RPU A;  3S1N J;  2X6W A;  2XDV A;  1ACI A;  3OYJ A;  2QZ8 A;  4TV7 A;  1ON2 A;  2P8T A;  1BA5 A;  2ICW G;  2CW7 A;  4M3D A;  3RYR A;  4P9U A;  4CCL A;  3Q9V A;  1QQI A;  2ELK A;  3QPT A;  1ZRF A;  2NAZ A;  3FMS A;  3GWZ A;  2AQF A;  4MFD A;  3BQZ A;  4MEY F;  1GVJ A;  2DDA A;  2M2E A;  2FNA A;  1SFE A;  5F27 A;  1H89 C;  1IN8 A;  1ENH A;  1DU0 A;  2OU2 A;  4QPO A;  1BW6 A;  2NVQ J;  4I98 B;  1FSH A;  3DPT A;  5CYV A;  4RAY A;  1MH4 A;  3ECO A;  1Y6I A;  3O6B B;  4ESF A;  5D6E A;  1XCB A;  1UAA A;  2KHM A;  1BR4 A;  4ZTJ A;  1NH3 A;  2ZXH A;  4BYY A;  2R3S A;  1IDZ A;  4CXF A;  4UHT A;  2WV0 A;  3TDU C;  2ZME B;  3I4N J;  2EV6 A;  2CV0 A;  3GZN B;  5D6F A;  1WJ5 A;  1SFO J;  3EQL F;  2JVG A;  2WAQ N;  2XV4 S;  2VT3 A;  1WI9 A;  3REO A;  3RI4 A;  2HVR A;  1BOA A;  1PP8 F;  3BG5 A;  4Q47 A;  5E17 F;  2LVS A;  3A2K A;  2VXD A;  5EZG A;  2DDB A;  5J4V A;  1B9M A;  1QNT A;  3Q0V A;  3I64 A;  3GCM A;  3BR1 A;  1Y0N A;  2D2W A;  1ERD A;  3ML6 A;  5A2Q K;  5LEJ A;  1MJA A;  3L2V A;  3BTI A;  3ZMD A;  4A3B J;  4FE7 A;  4A3G J;  4BGD A;  1A5J A;  4FCY A;  1ZG5 A;  5HOD A;  2R7R A;  3E6D A;  1FYM A;  3D1N I;  1W0U A;  3M8J A;  2MLK A;  4XN3 A;  4ZC3 A;  1FBQ A;  3NEU A;  1ZRE A;  4UY8 I;  2LG4 A;  2QLZ A;  2JA2 A;  4NDL A;  3BZK A;  2HDC A;  4I76 A;  5IOY A;  3QP5 A;  2W4S A;  4HOB A;  4KJZ A;  2NRA C;  1VQP I;  4BDY A;  2W00 A;  3ZR8 X;  1U6G A;  1QGP A;  4F91 B;  1MSF C;  1QA6 A;  5EG0 A;  4BXX J;  1I6X A;  1ZYR F;  5CQE A;  2PJR A;  3OV8 A;  5DD4 A;  1KU2 A;  1E3O C;  3JRB A;  1OCR H;  3VDX A;  1EF4 A;  3E6M A;  1QBJ A;  1BW5 A;  2P6T A;  2Z1D A;  3GZ5 A;  3BTC A;  3JRE A;  4Y7N J;  3ZMU A;  1T33 A;  1TWF J;  2GIZ A;  3R0A A;  1MMG A;  4Y4R A;  2KFD A;  2K3F A;  1MJ9 A;  4ON0 A;  3WTX C;  5DD8 A;  1R1T A;  1PP7 U;  4NNJ A;  2Y0S N;  5F0C A;  4BHP A;  3I54 A;  4EQQ A;  3I9V 2;  4ESB A;  2R7Z J;  4EM2 A;  2BXY A;  2ESH A;  4YRV A;  4BEH A;  1TQP A;  3G6E I;  3AFH A;  3P9K A;  3KYL A;  2DT5 A;  4M9S A;  2RGV A;  2BW3 B;  2EV0 A;  5GTH C;  1FEX A;  3F8M A;  1K78 A;  3DKX A;  3E1S A;  3SQN A;  5ICE A;  2HPM A;  5J47 A;  4XLN F;  2EFN A;  2VB6 A;  5M5Y J;  3CMA I;  1SVO A;  2IGO A;  4A5N A;  2VI6 A;  2CG4 A;  2DMU A;  1LJ9 A;  3V7S A;  4KIT B;  1A36 A;  4JQF A;  4AIJ A;  2F4M B;  2X6Y A;  2DXI A;  1TP4 A;  1Y8Q B;  2QSF X;  1IG7 A;  3ONQ A;  2IS2 A;  4RLF A;  2HQ5 A;  4NC8 A;  4LD5 A;  3JRH A;  3HPG A;  3O3K A;  4RM3 A;  2Q1Z B;  2YR2 A;  4EGZ A;  1YRN B;  3U9G A;  1X2N A;  3RQ4 A;  3K70 D;  3JRF A;  2P7C B;  3CCE I;  2XF5 A;  2FML A;  3QPH A;  3CDL A;  3W6K B;  1Z3Y A;  5FKK A;  2R5Z B;  3F8F A;  2IA1 A;  1FX7 A;  4JX5 A;  1ZLK A;  2CFX A;  3PO2 J;  5CVJ A;  3KZY A;  2CYY A;  4XKW A;  3WTW C;  2W84 A;  1JJ8 C;  1AKH B;  4UNO A;  4PFO A;  1WVR A;  4CCK A;  2JWT A;  5F08 A;  3OYG A;  4XLC A;  2DQL A;  4XKC A;  3V8J A;  5LGU A;  3ISP A;  4R8H A;  4B4C A;  1QPM A;  2CUJ A;  1OLT A;  1DPR A;  3OS2 A;  1S72 I;  9ANT A;  4BDZ A;  1WJB A;  2F48 A;  2XAU A;  1ETK A;  4HST A;  5E3N A;  2D1H A;  3ZMZ A;  2COB A;  4KA4 A;  3HKZ A;  2DA6 A;  1G4D A;  1HW1 A;  5FD6 A;  3DPU A;  1HCR A;  5J6X A;  2CO5 A;  2ZJ2 A;  1LDD A;  1JKR C;  3IC7 A;  3OMY A;  2XC7 A;  3IV5 A;  2DLL A;  1KQ9 A;  3PNV A;  4DZJ A;  5F04 A;  2H09 A;  1ODD A;  3ABT A;  3WTT C;  2BOL A;  4B8X A;  4U0Y A;  5L3F A;  4B47 A;  3AKZ A;  3AL0 C;  4LG0 A;  3QRF F;  4NBQ A;  2CQ7 A;  2TCT A;  3EUK L;  3V42 A;  1JJ6 C;  2UUZ A;  3GFM A;  3A01 B;  2VC1 A;  2CH0 A;  2LYC A;  5LHI A;  5FKO A;  1P4A A;  2ZNY A;  3G1M A;  1WI3 A;  3T0Y A;  1XGN A;  2IP2 A;  2O61 A;  1UG2 A;  4UUV A;  3HUG A;  3KE2 A;  3DBH B;  1STZ A;  2M8G X;  3HHH A;  5LHG A;  2TDX A;  3BG9 A;  4GDF A;  2AO9 A;  1KU7 A;  1UHM A;  3L2W A;  2W85 A;  2JPC A;  3WE3 A;  2KKO A;  4PUS A;  1SFK A;  3WU0 A;  4HQE A;  1LB2 A;  4RAG A;  3RPU D;  1AHD P;  2AS5 F;  3J80 Z;  5BNG A;  4G6Q A;  4Q5S F;  3BR3 A;  1LEA A;  1MW7 A;  2R92 J;  3GUD A;  4C2T A;  4EGY A;  1MBK A;  2CUZ A;  3OL3 A;  1Y1V J;  3E6B A;  2VN2 A;  3ZXS A;  1EH6 A;  2F6C A;  2EB7 A;  5IP9 J;  5GAD J;  1LNW A;  1TWG J;  2VQG A;  3KEO A;  2K85 A;  3BR2 A;  4YIF A;  5GPC A;  4P5O A;  2ZCW A;  3HGG A;  4MQ9 F;  3E0J B;  2ZFW A;  2RDP A;  4LIT A;  4XON A;  3BG6 A;  5F1R A;  2W7N A;  4JYK A;  5D5X B;  4CZC A;  3HSR A;  5B66 C;  2WAE A;  1B9N A;  3I59 B;  5DEQ A;  2X4H A;  3O2P E;  4GCV A;  1UCR A;  4G7O F;  4XRS G;  2EBI A;  4F52 A;  1HF0 A;  1P7I A;  4G6T B;  2P81 A;  2ZO4 A;  2PMZ N;  2EFP A;  2K9S A;  2M4G A;  1ZG3 A;  3FF5 A;  2DK8 A;  3IUO A;  2Q0O A;  3Q0W A;  1Q1V A;  5KK1 A;  1H8A C;  2LFB A;  4D0P A;  5H6R A;  3L09 A;  1HKQ A;  5ILS A;  4C2U A;  1HDP A;  1D1C A;  1HSJ A;  3BY6 A;  3DKY A;  4DYC A;  5K5O A;  2RQP A;  4KT5 C;  2CW0 F;  2NVT J;  4IOA F;  3WTZ A;  2HU9 A;  3KLO A;  1B59 A;  3SFI A;  2X48 A;  2V9P A;  1NK2 P;  2KPM A;  1UG0 A;  2ZSH B;  2KLO A;  3ERM A;  5DUK A;  5HDG A;  1JKO C;  3DEU A;  4L9T A;  3ZN1 A;  3IRQ A;  4UUS A;  2EIL H;  2WC2 A;  4M3F A;  2BHZ A;  4YEJ A;  3CCY A;  5DTD A;  3BZ6 A;  4IVN A;  3VYU B;  2VBZ A;  2F5V A;  1VTN C;  2JSP A;  4FET A;  4XOT A;  4JBA A;  4XRM A;  3DU6 A;  5FRM A;  1N78 A;  1MBJ A;  4DJA A;  3E7L A;  3LSP A;  4BQA A;  3PO3 J;  2O0Y A;  5FLX Z;  4IO9 F;  3BCA A;  2EQR A;  4A6E A;  4EM1 A;  2E2I J;  3HL2 A;  1VQ4 I;  2RAE A;  5CLS A;  3MMY B;  2PG4 A;  2QGU A;  2CW8 A;  2GA2 A;  2X1C A;  2FSW A;  3SZG A;  1R00 A;  2IGN A;  4CUG A;  4IRG A;  1FJL A;  2LRD A;  2K86 A;  3V8K A;  1HLV A;  5DYM A;  2QF7 A;  3JCU C;  3AL0 B;  2RC4 A;  3CCJ I;  1HQC A;  1YJ9 I;  2XHK A;  2XKO A;  2QQ8 A;  1G6N A;  4CCN A;  2XF6 A;  2K02 A;  2R0Q C;  4KMU X;  5EJC A;  2Y30 A;  2DOF A;  3N4M A;  5J8F A;  3GLL A;  2DQR A;  3E5Q A;  4O5V A;  1W7P A;  3M07 A;  2XSD C;  4DYQ A;  2K4B A;  5DCF A;  1PJR A;  3MKY B;  3ZN0 A;  3WU2 C;  1T6S A;  4IXA A;  1VQ8 I;  1XX5 A;  2NNN A;  3NWS A;  3T8R A;  3GFL A;  5D4R A;  1YIJ I;  3COA C;  2HI3 A;  3EUH C;  2IVM A;  2YSR A;  1WWX A;  5E1W A;  1X2M A;  1BIA A;  4AIH A;  3SDG A;  5CPR B;  3DTE A;  5JVT A;  2RV8 A;  3WOD F;  1P2F A;  1VQ7 I;  3C1D A;  5ERI A;  4MQV A;  2FUG 2;  5CVU A;  3HOZ J;  1ZAR A;  1IV6 A;  2BEO A;  2O9L A;  4XBF A;  1FT9 A;  1SD5 A;  4HF1 A;  3K2A A;  2Y0S A;  3F8B A;  2FE3 A;  2KMU A;  2LRE A;  1MIJ A;  4DYR A;  2GIV A;  2KP6 A;  1BIB A;  2YX7 A;  2JN6 A;  5B3S H;  2HOT A;  2W82 A;  2VBY A;  5FO5 A;  2R7S A;  4W1U A;  1YG2 A;  4LG3 A;  1WSU A;  5H2F C;  1ONV A;  2Z2S B;  3LSM A;  1SVL A;  1W36 C;  5E3L A;  4CSW A;  1VND A;  2L7M P;  3CJR B;  4PJM A;  2AQE A;  3I4M J;  4UVB A;  2OCC H;  3GEZ A;  3OIO A;  2FBK A;  2MSY A;  1I5Z A;  2I8D A;  5E3O A;  1FLI A;  2FU4 A;  1O3T A;  1U5T C;  2CRG A;  1QRY A;  2EV5 A;  5HLG A;  4V2G A;  5HVQ C;  5K7F A;  1V55 H;  1R5H A;  3WTY C;  1Z6R A;  3DF8 A;  3GX4 X;  2FEZ A;  2LMD A;  3MZ8 A;  1E3P A;  1TZL A;  3HDD A;  4NHJ A;  3PM1 A;  3GXO A;  3TDZ C;  3FKI J;  4LLG F;  2VOP A;  4O3M A;  3DBR B;  1J5Y A;  2A05 A;  4HZF A;  1ZRD A;  3GTG J;  5KHD A;  3TQN A;  3LWF A;  1S5L C;  3IKV A;  3VOE A;  2CWE A;  3OYM A;  4ENM A;  5IT9 Z;  1J7K A;  2JK3 A;  3H9Q A;  4ASN A;  1O4X A;  5CKT A;  5FJ8 J;  1Z7U A;  1MND A;  1Z21 A;  3KP7 A;  1BR2 A;  3LSK A;  4IRH A;  3SZP A;  4BBR J;  2IPQ X;  1AKH A;  2LBF B;  1FIA A;  2DA5 A;  3HKZ N;  1JTY A;  2EIM H;  2NS7 A;  2VJ5 A;  4DBQ A;  2HGC A;  3WGH A;  1S7O A;  3JSP A;  1SEU A;  2CV1 A;  3M3Y J;  2P5K A;  2M9H A;  2GLO A;  2R4G A;  4PK4 A;  4MEX F;  2M1B A;  1OYW A;  2E1C A;  4HNU A;  1LDK B;  3GFI A;  3BR6 A;  5LD2 C;  4P1W A;  4CYD A;  2VJJ A;  4F55 A;  3IHU A;  1R36 A;  5HDK A;  3DU5 A;  4MIM A;  1H88 C;  1LDJ A;  2NVY J;  3G1O A;  5FLX K;  3BQY A;  1G59 A;  4G7H F;  1UHW A;  4CZZ A;  5E1X A;  3L2Q A;  4EM0 B;  1IDY A;  2VOO A;  2LY1 A;  3BOQ A;  1REP C;  4JOM A;  3WHB A;  2DA3 A;  2O8X A;  4CA0 A;  4L9N A;  4RDU A;  1RES A;  2ME6 A;  3KEY A;  1RC9 A;  1J0R A;  3C2B A;  4CCM A;  3DFG A;  5DCM A;  3I53 A;  1U8B A;  2K9Q A;  2L01 A;  2AHQ A;  4A12 A;  4AC0 A;  1YW9 A;  3RZO J;  3KZZ A;  2XAS A;  2WA0 A;  4EMS A;  4FQG A;  3GBG A;  1R58 A;  2R7F A;  3DLL F;  3E5U A;  4E7I A;  1QZE A;  3CLQ A;  1YLF A;  3H1C A;  2WY7 Q;  3RJP A;  2Z5U A;  4U7B A;  2OAZ A;  3TGN A;  1PYV A;  3DTI A;  4BQO A;  2PJP A;  3HGY A;  1HA8 A;  2QKL B;  2IRF G;  1YI2 I;  2XSJ C;  2XGX A;  1GXP A;  1WJF A;  4DIQ A;  2L2O A;  4XLP F;  2M5W A;  1QVU A;  1JKQ C;  1PUE E;  2MH9 A;  1V5G A;  2XKP A;  5EZH A;  2ELJ A;  3CCM I;  3MCZ A;  4AUX A;  2QBY B;  1Z77 A;  3K69 A;  1TQI A;  2OA4 A;  4OWR B;  1TC3 C;  1B6A A;  1R23 A;  3D5R C;  3CDH A;  1PVE A;  3TMO A;  1YYV A;  2BY0 A;  2OQR A;  2KDZ A;  4FX4 A;  2MW8 A;  2NVX J;  1ETW A;  2YU3 A;  4J00 A;  1JI8 A;  1D1A A;  2JZY A;  1TWA J;  1OCC H;  1UMQ A;  5KCM A;  2L4M A;  3JAM Z;  3K2Z A;  1HW5 A;  3TKY A;  2EJR A;  3HIF A;  1IJW C;  3TW7 A;  3BZC A;  2XAH A;  2VLA A;  3JRG A;  1P4W A;  2RVC A;  4L5I A;  2X6X A;  4RS8 A;  2X6O A;  1XGM A;  2VQH A;  1W4M A;  4PJL A;  3KYC B;  3ELK A;  1AU7 A;  2XRL A;  1IN7 A;  3AG3 H;  2DOE A;  2Y0M A;  3S3N A;  3PJR A;  4QWQ A;  5LFA A;  1IGN A;  3T1B A;  3S14 J;  3HJE A;  3H35 A;  4ZDP A;  2VPL A;  4KIF A;  1NTC A;  4LB5 A;  3FX3 A;  2DPU A;  3KIO A;  1ETV A;  4LB6 B;  1XS9 A;  2L54 A;  2JT1 A;  3CUQ B;  4CIC A;  3WGG A;  1G8X A;  1VQ5 I;  3CES A;  1NK3 P;  2XAQ A;  2CUF A;  3OYH A;  2HOA A;  2HKX A;  2DFI A;  3LSH A;  2RN7 A;  5K5Q A;  4OAZ A;  4EJT A;  1IRF A;  4Q4Z F;  1H9T A;  4UVC A;  3I3L A;  1S29 A;  3KET A;  1JE8 A;  2ZME A;  5BQT A;  1ETO A;  2HNH A;  2BY2 A;  2PQ8 A;  4E7L A;  3CTA A;  3GO5 A;  5ED4 A;  2KRF A;  4D7M A;  2IS1 A;  2FA5 A;  3EET A;  1CF7 B;  3Q3S A;  2OTJ I;  1P6R A;  3I58 A;  1T38 A;  2BVL A;  1EV7 A;  2B7E A;  1GUU A;  3V7C A;  3OR1 C;  4ENK A;  2E1O A;  2Z3Y A;  1BI3 A;  5J1Y A;  2R5Y A;  3WU1 B;  3S16 J;  2ZME C;  1RR7 A;  3PSF A;  3GTO J;  1X1A A;  2KDO A;  2CFO A;  3S2W A;  1D5Y A;  5BOX A;  5EGO B;  3GTQ J;  1Z1D A;  3IH4 A;  1R4N B;  4M71 A;  3X2Q H;  1LQ1 A;  1R4M B;  3BWG A;  3H92 A;  4PGG A;  1XDS A;  4RGR A;  4P9F A;  3ZQ7 A;  2IEK A;  2E1M B;  3OS0 A;  2Y9Y A;  2W24 A;  1K4T A;  3BCB A;  1KU9 A;  1IC8 A;  2HDW A;  4PJJ A;  3ECH A;  2K9L A;  4BEH B;  2VKD A;  5HLH A;  4IHT A;  1LFP A;  1R71 A;  3F21 A;  2FRH A;  4II2 A;  5D4S A;  2H94 A;  4HNV A;  3QQA A;  2K5C A;  4M74 A;  1T39 A;  4N9H A;  2PMZ A;  1BI2 A;  4C3J J;  3BTJ A;  2XPW A;  4GXO A;  5TGT A;  5IY5 H;  2EIK H;  4A3D J;  2DK5 A;  1Y56 A;  3V8L A;  1K7A A;  3MN2 A;  2PFB A;  4G8X A;  2E60 A;  4DNC A;  3J81 K;  1P9Q C;  3LAP A;  2M8E A;  1O3S A;  1HW2 A;  1FPQ A;  4PGH A;  3HM5 A;  5IP7 J;  1V5E A;  3D5L A;  2EZK A;  3VYR B;  4JP0 A;  2GXA A;  1A6I A;  1DP3 A;  1BJZ A;  1I1S A;  2CQX A;  2PLY A;  4XLE A;  3QAH A;  4BE2 A;  2XGD A;  4AID A;  2HZD A;  2EIJ H;  3JRI A;  2JMW A;  1Z6T A;  4YII A;  3F22 A;  4IQJ A;  3BG3 A;  4MGR A;  2M30 A;  4PCQ A;  5D5V B;  1TNS A;  2IGK A;  2Y69 H;  4QLC U;  2UV1 A;  3WE2 A;  1JUP A;  4BY1 J;  3K1M A;  1WJD A;  2PBI A;  2D45 A;  4HG2 A;  3NQO A;  1X3W B;  3LNQ A;  3ERE D;  4IEJ A;  2P5V A;  3A03 A;  4ZYH A;  1O7L A;  3SEQ A;  1MGT A;  5EF6 A;  1DUX C;  1FP1 D;  3PUB A;  3JAM K;  5H20 A;  4A2U A;  5JLX A;  4BHB A;  1APL C;  3A0H C;  2OBP A;  4A3I J;  3TED A;  1R5I D;  5LLQ A;  3VOD A;  4DGW B;  3SXY A;  3S3M A;  5HS8 A;  5ICF A;  5ICG A;  1U8R A;  3QOP A;  3ZCO A;  2HPI A;  4EEF G;  4BS9 A;  3F3X A;  4QTR A;  1X1B A;  5BPI A;  3S15 J;  1CGP A;  4KYW A;  4A0X A;  2EWN A;  3DP7 A;  3FIS A;  5HOO A;  4MTD A;  1EH8 A;  1ZAO A;  3C18 A;  3ABU A;  2MD5 A;  1HDD C;  1L0O C;  1ULY A;  4ZDL A;  2QA4 I;  2V79 A;  3GLX A;  1HOM A;  3EDP A;  1I3A A;  1UFM A;  2ZJQ F;  3K4M A;  2VJ4 A;  2DOA A;  4G9Y A;  1SD6 A;  2L9R A;  3VYT B;  3WGI A;  3G3Z A;  3RKW A;  3MAJ A;  2FX0 A;  1FOW A;  3FBN B;  3QPS A;  3RCO A;  4GYG A;  4WX9 A;  3HOT A;  3GVA A;  1TT5 B;  2DT7 B;  2IA0 A;  3JSO A;  2VOD A;  3W6V A;  2ZSI B;  4IRI A;  2NVU B;  3FIW A;  2ECC A;  2LNB A;  3OS1 A;  4B44 A;  1E17 A;  4A93 J;  4IOC F;  2KQR A;  4EJU A;  3CZ6 A;  1JHH A;  3P9C A;  1V4R A;  2HQN A;  1FOK A;  4XOR A;  1JTX A;  3QOD A;  1IF1 A;  4KN4 X;  4HAM A;  5EEG A;  3RZD J;  2CQK A;  1DGR M;  1BL0 A;  2OCE A;  5KAI C;  1P4X A;  4BXU A;  3OYN A;  3WTU C;  4KFC A;  1XD7 A;  4G6D A;  4BH9 A;  3MZH A;  2Y48 A;  1JUM A;  2XIG A;  1V5F A;  4GO1 A;  5E8G A;  2GZW A;  3ZQI A;  1C0W A;  2M87 A;  1FTT A;  1FSE A;  2L3D A;  1YX5 A;  2AXT C;  2Q8K A;  4YEL A;  3C3W A;  2E2J J;  2KIM A;  1N77 A;  2VBX A;  4DOZ A;  1T08 B;  1F36 A;  4F7Z A;  2LKP A;  2MLG A;  2ZC2 A;  5K1Y A;  3KCC A;  4OIN F;  5KNL A;  1SD4 A;  1YW8 A;  1I39 A;  2A69 F;  3C2G A;  1XSD A;  3H36 A;  2UXX A;  4D7N A;  1UEL B;  1WHU A;  3RKQ A;  2K40 A;  1ZR4 A;  5JVG F;  1PUF B;  1T56 A;  5B1A H;  4XKV A;  5GPA A;  3HB9 A;  3SJM A;  4A3F J;  4E7J A;  3LSG A;  1I50 J;  2ECB A;  4U87 A;  3IKT A;  1D5V A;  2YU9 J;  4HDV A;  4QIW N;  2H8R A;  2ETH A;  1K78 B;  1FOY A;  5K5R A;  1YTY A;  1VQO I;  1JGG A;  1T0F A;  4OIP F;  1S8N A;  1QU3 A;  3CD6 I;  2HVS A;  1W5S A;  5GAG J;  3AG1 H;  1E2X A;  3E5X A;  3HPH A;  2MYS A;  4XRF A;  1YO5 C;  1VQL I;  2V4J C;  6PAX A;  1IN5 A;  4LLN A;  4HF0 A;  4DBR A;  2DT6 A;  1X19 A;  4IF4 A;  3P7N A;  5J8C A;  2R7D A;  1NG6 A;  1GXQ A;  1XGO A;  3CLO A;  5BS6 A;  4L0Y B;  2VE9 A;  4CH7 A;  4WK8 F;  4L9J A;  1M1E B;  2XF7 A;  3H3V K;  3IP4 B;  4BQQ A;  2JPB A;  4YFK F;  4J01 A;  1MJB A;  4RA2 A;  4Y52 J;  3LOC A;  2L7F P;  4IZZ A;  4HLX A;  3TP3 A;  2BBY A;  2P4W A;  4MTE A;  2LKX A;  4LIV A;  4C3I J;  2KRC A;  1FYK A;  2VC0 A;  4WF2 A;  5EEH A;  3A02 A;  1VQK I;  3ABK H;  4HX8 A;  1ORK A;  3GZ6 A;  1ZN2 A;  4IHX A;  5EEA A;  5GAE J;  4NB5 A;  3FWE A;  2A5W A;  3FXJ A;  4M9Z A;  4YFN F;  5TJJ A;  1RET A;  2BE5 F;  3VB2 A;  5HDN A;  1MH3 A;  1VQ9 I;  2R93 J;  2ID3 A;  2OZU A;  4IHV A;  1D0Y A;  2QSG X;  1YQA A;  4HX4 A;  2DU9 A;  5GP9 A;  2HWV A;  2DI3 A;  1Z67 A;  1X1P A;  3LL7 A;  1WJA A;  2LOO A;  3R60 A;  5E18 F;  4LG0 B;  2QQ9 A;  3K4J A;  2Z33 A;  4A3M J;  1J2X A;  4WXC A;  4E70 A;  3HHG A;  4G7Z F;  3NAR A;  4ZYG A;  5A2Q Z;  4KIB A;  3V4G A;  1KYZ A;  3KPH A;  1EH7 A;  4OU0 A;  4BU2 A;  4CCO A;  3A01 A;  3UKG A;  3IL2 A;  1WPK A;  4I2O A;  2DFH A;  3PFI A;  3TO9 A;  3PSI A;  1NHA A;  2V6C A;  2FQ4 A;  4R1H A;  3K1N A;  4B43 A;  4YFX F;  3FHN A;  1OJL A;  3RSN A;  3DTK A;  4MHG A;  2NS0 A;  2ESN A;  3S1M J;  1IRZ A;  3L9F A;  1J09 A;  3FXU A;  2FBI A;  1YFH A;  2IGM A;  2PMH A;  2WBM A;  4HRI A;  1IAW A;  1RKT A;  3BJO A;  2PEX A;  3BR0 A;  4XM3 A;  2KZV A;  3EUA A;  4ETS A;  4A6D A;  2Y31 A;  2W1O A;  4QPQ A;  1D8J A;  3ABL H;  2VT2 A;  1GV5 A;  2GXB A;  2LTP A;  4BJ5 C;  4XNF A;  2GOM A;  1L3L A;  2V9V A;  3LA3 A;  2RNJ A;  2M7B A;  3VWB A;  3QP6 A;  3LSR A;  3HOX J;  1D0X A;  1IN4 A;  5AON A;  2JTV A;  5HNF A;  1B1B A;  2A3S A;  3BRO A;  1BBY A;  1POG A;  5B5E C;  2RNG A;  3D5S C;  1D3Y A;  4RAF A;  1SFU A;  2A61 A;  1R1U A;  3G4S I;  2WY8 Q;  1S9H A;  2RQQ A;  1OCZ H;  1OMI A;  4B3X A;  2CU7 A;  1QVT A;  1OCO H;  2DTR A;  3BG7 A;  3G73 A;  3DCF A;  3J7A Y;  3U1K A;  1RI7 A;  2KT0 A;  2Z99 A;  1SMT A;  4ZYD A;  1Z0X A;  3E6C C;  2IW5 A;  4Z6Y A;  3J7A O;  2V26 A;  3VSL A;  5JFR A;  4ABZ A;  1UJ8 A;  2E7X A;  2OUM A;  4A3J J;  1F1Z A;  5LRR A;  5M5X J;  4ESJ A;  4IHW A;  1IW7 F;  1K79 A;  4HW0 A;  2CMP A;  2WAD A;  4HV6 A;  4BL0 B;  3JRC A;  3I55 I;  1OIS A;  1RR8 C;  3HXL A;  2HYF A;  3FXM A;  4RGX A;  5D8L B;  3HTU A;  5JR3 A;  5L3E A;  5LHH A;  2F5D A;  5E8I A;  4JX6 A;  1VFC A;  2KJC A;  3OWT A;  2XPV A;  1XGS A;  4HSR A;  3RDI A;  3HEF A;  1XG1 A;  5DDG A;  3P5J A;  3K0L A;  4D1Q A;  5E20 A;  1KA8 A;  3DWL E;  1SD7 A;  2GBY A;  3KP3 A;  5LGN A;  2L7Z A;  4HLY A;  3H9J A;  1G3S A;  1D1B A;  1Y39 A;  2XAG A;  3CJT B;  4XLH A;  3HTS B;  2Y75 A;  2ZJR F;  2LY9 A;  4M9X A;  3U21 A;  4GGG A;  1ZH5 A;  4J19 A;  4E7H A;  3J7Y J;  3CUQ C;  3S2D J;  3QU3 A;  2GXG A;  3SDB A;  4QSH A;  1HC8 A;  3WTV C;  4LMY A;  2X1D A;  2G0E A;  4E7Z A;  2E5Z A;  4AIK A;  1KU3 A;  4M72 A;  4PZJ A;  1V54 H;  4P96 A;  4RM2 A;  3CF5 F;  3HOY J;  2PN6 A;  1I1G A;  3QU6 A;  2CUE A;  3ZRG A;  2LH9 A;  2EK5 A;  5CVI A;  4HEA 2;  1Z05 A;  1LFB A;  3RKX A;  3PIO F;  2HFH A;  5F6F A;  2D1V A;  1G3W A;  2DA1 A;  4BAY A;  1UB9 A;  4U0W A;  1LE8 B;  1FNN A;  2QVO A;  5IYD J;  2G7U A;  4GRI A;  1FTZ A;  4Q48 A;  3MKZ A;  3F9K A;  2NOJ B;  3JR9 A;  1FP2 A;  1R7J A;  5IT9 K;  5DM6 F;  1PUF A;  3M7G A;  1W7P B;  4HF2 A;  5J1R A;  1KZH A;  3RYP A;  3D0S A;  3GTP J;  4XLA A;  3EYY A;  2PX9 A;  2TRT A;  1LVK A;  1TBX A;  4M73 A;  2MGQ A;  2X1E A;  2PJR B;  2QM3 A;  4XLF A;  4UB8 C;  4I01 A;  4XKB A;  2OQG A;  3ESW B;  1TTY A;  4D5C A;  2DPD A;  1TNT A;  4YG2 F;  2DO7 A;  5L3D A;  5IT3 A;  1LEB A;  2G7H A;  1O3Q A;  1U3E M;  2L5Q A;  3S2H J;  2A6E F;  2HKO A;  4XMY A;  4XQF A;  2DMP A;  4RAZ A;  3SEZ A;  3OYC A;  4C3H J;  2RKH A;  3FBI B;  1PDN C;  2NNY A;  4OIR F;  2Z9O A;  5DUI A;  2LK2 A;  1SFX A;  2QYO A;  5KVR A;  2LKS A;  2F2E A;  5FFX A;  4LLL A;  3KP6 A;  1VZ0 A;  5IPA A;  3VYS B;  4RB0 A;  3RQI A;  4DQ2 A;  4AYB A;  3CCV I;  1J75 A;  2QBY A;  4X0G A;  2VQC A;  1HBX G;  4OMY A;  2YPR A;  1TL8 A;  1D8K A;  5C4X J;  4XL9 A;  2B9S A;  3I71 A;  3L2R A;  5D5U B;  2LR8 A;  4CYC A;  1ZKG A;  3PIP F;  4M6V A;  2JA8 J;  1DDN A;  2R7Q A;  3BJ6 A;  5FD5 A;  3RPQ A;  1ZGW A;  2VPR A;  5DS9 A;  4BE1 A;  3VFZ A;  1VQN I;  2MAB A;  1G2H A;  3Q0U A;  1OYI A;  2F5F A;  2W25 A;  4L9V A;  3CO7 C;  2CV2 A;  2EFO A;  2MFZ A;  3K4C A;  2M34 A;  4MLO A;  5CQG A;  4C2M J;  1TW2 A;  3B6A A;  2HVQ A;  2VL8 A;  4I99 C;  1K61 A;  2ME0 A;  2OV7 A;  4B48 A;  1IXC A;  2DFE A;  2VBW A;  2X9D A;  3KP4 A;  2CGP A;  2FXA A;  3I4P A;  3OYK A;  2B0L A;  2G9W A;  3ZMV A;  4G94 A;  5IOZ A;  3OY9 A;  3P9I A;  2JA6 J;  1MBH A;  2F5E A;  1VI0 A;  2LSO A;  5J4Y A;  3H0G J;  3HBL A;  1A6Q A;  2KIU A;  3HOW J;  5F64 A;  3M1C A;  4PJ0 C;  1Z91 A;  2JQ7 A;  1S7E A;  3QYE A;  2YX4 A;  5L3B A;  1YOV B;  1RUO A;  5HLI A;  2HQR A;  1GHC A;  2BYV E;  1RRJ A;  3SZT A;  1VQ6 I;  1UHS A;  1G3T A;  3M9A A;  3BDD A;  1WQ2 A;  3A4C A;  1W1W E;  1OCT C;  1XMX A;  3BPX A;  3U2R A;  2JVH A;  3F72 A;  4I0B A;  2WTE A;  4M3E A;  3Q5F A;  3SYT A;  1YJN I;  4I09 A;  5FRN A;  1ETQ A;  2A07 F;  2MA3 A;  1W0T A;  4JK1 X;  2E1M C;  4KN7 X;  2EFW A;  3NWT A;  2I10 A;  1HKS A;  3ZOB A;  2DMN A;  4OIO F;  4ZZL A;  4UV9 A;  3ZQC A;  2WWY A;  4Y3O A;  2GAU A;  4UV8 A;  2BHY A;  2V1N A;  2R7X A;  2X85 A;  3BPV A;  1ZGJ A;  4CCJ A;  4ZYE A;  1P92 A;  4PSX A;  1TT0 A;  3GYH X;  1ZHF A;  5FKL A;  2MC4 A;  3HOS A;  4HYE A;  3TW6 A;  4LJZ F;  2MG4 A;  2L4A A;  3TBI A;  4M3B A;  4Z2Y A;  3C2H A;  2DBB A;  2PMU A;  2C6Y A;  3K7A J;  3I56 I;  2DA4 A;  2QEN A;  3F6O A;  2ID6 A;  1WH7 A;  2MD0 A;  2XPU A;  3ZPL A;  2FNP A;  1T0F C;  1ITY A;  1BI1 A;  5JHU A;  3OSG A;  2MH2 A;  1F43 A;  3GF2 A;  2UZK A;  1FOX A;  4O6J A;  5HS9 A;  1QO0 D;  3ZMT A;  2BV6 A;  1U0J A;  3N05 A;  3UNG C;  2FBH A;  3MEX A;  3ZQF A;  4KIC A;  4N4O B;  1XDU A;  3I5U A;  2EPF A;  1S7A A;  3KLN A;  2H1L A;  2JUC A;  2DCE A;  4L0Z B;  4BXF A;  5LEK A;  2DFF A;  3DQV C;  3HG9 A;  3KEQ A;  4ANJ A;  4IJA A;  2ZNZ A;  1ON1 A;  4EJW A;  2P6S A;  2P0W A;  4WXD A;  1LPQ A;  2VAS A;  1T2K A;  3HRT A;  4UXN A;  3ZQQ A;  3CJQ B;  2XGE A;  3R61 A;  1X4O A;  4H4K C;  2O5R A;  3S3O A;  2V7F A;  4II3 A;  3F6V A;  1BC8 C;  2ADU A;  3LFK A;  4C9Y A;  2LLK A;  3M8F A;  1U2W A;  3BTL A;  3FMR A;  2V6E A;  4WCG A;  2BY3 A;  3GME A;  2KL4 A;  3B02 A;  2FMY A;  3SHF A;  4IHS A;  3W3C A;  2M45 A;  1U78 A;  1MKM A;  1RKW A;  3S93 A;  1Y1W J;  2P7V B;  3BLY A;  3FMQ A;  4XR6 A;  1W5C C;  2K3P A;  3F8C A;  1SAU A;  3HRM A;  3J81 Z;  2COM A;  3CCR I;  4A3C J;  3ASO H;  3PQK A;  1JT0 A;  2HXO A;  1WKM A;  3R0J A;  1SAN A;  3M4O J;  4A69 C;  1I3Q J;  3MQ0 A;  1UST A;  2W57 A;  4IKF A;  2VJI A;  2DW4 A;  1XTA A;  3ZQG A;  1WZ2 A;  5EYR A;  1OCP A;  5BPD A;  3MWM A;  4FE4 A;  4KIS A;  3S8P A;  1O7F A;  3A1Y A;  4I0A A;  4B09 A;  3H3Z A;  4G12 A;  2NXN B;  2XVC A;  3C7J A;  2V1X A;  1FBU A;  1T95 A;  1WCM J;  3KP2 A;  1IRG A;  2Y9Z A;  2EZI A;  1MMN A;  3ABM H;  3IH3 A;  2DJN A;  5CVR A;  4A0Z A;  2E36 A;  2FQ3 A;  1AA7 A;  4D5F A;  5L3G A;  2H8W A;  4L5J A;  3R6S A;  3HC7 A;  2D5V A;  4DZP A;  1LVA A;  3CP8 A;  2DOD A;  2QKM B;  2M0C A;  3WTS C;  3LMM A;  3OYL A;  1IXR C;  2JRM A;  5LRS A;  5EG0 B;  1BN5 A;  3OOU A;  3G71 I;  2GM4 A;  4WWC A;  2A68 F;  3OR2 C;  2BGC A;  1Z7L A;  3HSE A;  4HV5 A;  2EFQ A;  3MZY A;  1GVD A;  1HXD A;  4Y15 A;  1LKX A;  3HYI A;  2XRO A;  4CHU A;  2R7T A;  2R7V A;  2HXI A;  1X1C A;  4I6Z A;  1BM9 A;  5C4J J;  1B8I B;  5HLT A;  5E79 C;  4B1R A;  1X3U A;  2EIN H;  2QUF A;  3F8N A;  5BMZ A;  1MMA A;  1CQT A;  2VIX A;  3FK7 A;  4RB1 A;  4XIC A;  1LE8 A;  1E0E A;  2ZJP F;  5DM7 F;  3MFK A;  2Q2E B;  5JHF A;  4PSW A;  2DN0 A;  1O57 A;  1ZK8 A;  2DTZ A;  3HRS A;  4LIU A;  3J80 K;  4UB6 C;  4KDP A;  2JSC A;  2XGC A;  1R9T J;  1IN6 A;  5M5W J;  3K4K A;  1F4K A;  1P7J A;  2HEO A;  3LST A;  4BNC A;  2V9K A;  3FM3 A;  4A3K J;  2O3F A;  2OZ6 A;  1KQ8 A;  2M3A A;  1FMW A;  2VON A;  2K4J A;  2K9M A;  2NOG A;  2VE8 A;  2HZT A;  2F5C A;  5EDN A;  2CS3 A;  3S1R J;  4MO7 A;  1Z9C A;  1ETY A;  5FKN A;  1FIP A;  1R6R A;  2QSH X;  1TQM A;  2NS8 A;  1XMK A;  2YUS A;  1FYL A;  5ILU A;  1YX3 A;  3OL4 A;  2K9N A;  3H3U A;  4AM3 A;  1D0Z A;  3W2V A;  2EA2 A;  1U9O A;  3K9T A;  2VUM J;  5F1J A;  2DA2 A;  1JGS A;  4HNT A;  1HST A;  5JI6 A;  3HOV J;  2L02 A;  2IJL A;  1JKP C;  5J1U A;  4Y13 A;  1OPC A;  2EZL A;  3LSI A;  3QYB A;  2A6T A;  3WHC A;  4BHC A;  1B72 B;  1ZGA A;  3QOE A;  1H9G A;  1VF9 A;  3HRU A;  2ISZ A;  5B1B H;  2A6H F;  1QHH D;  2HR3 A;  3GTJ J;  2LP0 A;  1I27 A;  1GV2 A;  1A04 A;  3K70 C;  2EA4 A;  4XSZ F;  2OTL I;  1H0M A;  1OR7 A;  3PL8 A;  3KX2 A;  2JJ7 A;  3CUQ A;  4FIS A;  3VPR A;  1USS A;  1FWZ A;  2K7L A;  3U1D A;  2GA1 A;  4RGU A;  1FMV A;  1ZTR A;  3T5X A;  3KYD B;  3FKJ A;  1KYW A;  3ULQ B;  1MDM A;  2MBF A;  3CMY A;  5H6Q A;  1RPW A;  2X0L A;  4LFU A;  1BC7 C;  3S17 J;  3S32 A;  4U7D A;  2DMQ A;  2ZKZ A;  4ZDO A;  3F0C A;  4ZZD A;  3KP5 A;  1E3H A;  2M7A A;  2R7U A;  4EV0 A;  1RUN A;  2FF4 A;  5L3C A;  1TW3 A;  1CF7 A;  3M1E A;  1MBE A;  1FC3 A;  3BT9 A;  2VXZ A;  1U5T A;  1TLH B;  4D9J A;  3OYA A;  1XSX A;  3GW2 A;  2EH3 A;  1WFX A;  5E1Z B;  5AIP A;  3GTM J;  4ENJ A;  3TL4 X;  4XK4 A;  2XRN A;  2OC6 A;  2E5N A;  4YIR X;  5AIQ A;  1MD0 A;  2KJB A;  2LY2 A;  3BJA A;  3LQQ A;  4X1E A;  4A3L J;  2DMT A;  4CGZ A;  1Y0U A;  5FLM J;  2ISY A;  3IRR A;  4BE0 A;  1K6O A;  3O8G A;  2WAQ A;  2NYX A;  4N9I A;  2QQB A;  3HSF A;  3DBL B;  1YW7 A;  3I0T A;  2ACJ A;  2O7O A;  2V1U A;  2HOS A;  2L9S A;  2KIF A;  5HNH A;  3OYD A;  4V2F A;  4N0B A;  4BJT A;  4ZJZ A;  4BAC A;  2Q2E A;  5HS7 A;  3CC4 I;  3LAJ A;  5DCM B;  4LGW A;  3V7R A;  1QZY A;  4BJ6 C;  2ELH A;  1YS6 A;  2QQA A;  3CQZ J;  5K7H A;  4AWX B;  4OIQ F;  3NAU A;  3IWZ A;  1WRJ A;  4UVA A;  4AYB N;  4HBL A;  4MFE A;  1IO2 A;  2HYG D;  3PFY A;  2GOX B;  2KIS A;  4HX7 A;  3T8T A;  1MBF A;  3FK6 A;  3CO6 C;  3H0D A;  2Z16 A;  2HYJ A;  5FB2 A;  2RRE A;  1SC7 A;  2IS6 A;  5K7Z A;  1K4S A;  3K4B A;  2CQN A;  1ZLJ A;  2OJE D;  2FD5 A;  2R7O A;  1ZRC A;  2FOW A;  3EPZ A;  1YS7 A;  4RGS A;  4B3A A;  2J5P A;  3E3V A;  3VSK A;  3K4L A;  2E19 A;  2JRT A;  2H27 A;  4NQW B;  4F93 B;  3N97 A;  3ZMS A;  4BUP A;  2QEX I;  2KRH A;  4P55 A;  1JUS A;  2K27 A;  2HQA A;  1OKR A;  2BXZ A;  1YIO A;  2E34 A;  3CDI A;  5GTI C;  4F92 B;  2VKE A;  2CJJ A;  1OR7 C;  4E4H A;  1DQU A;  1LUJ B;  2O6G E;  4I02 A;  3TP0 A;  2OD5 A;  5C3E J;  4A5M A;  4XOP A;  1EA3 A;  3QYF A;  3AG4 H;  1GDT A;  3GTL J;  1I6H J;  2QWW A;  4ZYA A;  3DV8 A;  3PNT A;  3ZQL A;  2HTS A;  3LA2 A;  5ILV A;  4KT6 A;  4I7H A;  4ENN A;  3TOB A;  1OFC X;  4BKX A;  2O03 A;  4S05 A;  3FXQ A;  3E97 A;  3L00 A;  2VKV A;  1XB4 A;  2E71 A;  3DEE A;  4S0H B;  1LFU P;  2DYS H;  4KNY A;  4FHT A;  3IAM 2;  4V19 K;  1MMS A;  2ZXI A;  3LFU A;  2FJ1 A;  4NUB A;  4OOI A;  3DLA A;  5J3L A;  3W6J B;  4E7K A;  1YHQ I;  1W7P D;  3CP2 A;  3L2C A;  4ZTF A;  4LK0 F;  3H5A A;  2CSO A;  2AXL A;  3RKY A;  2LBF A;  1R49 A;  1NG7 A;  4S04 A;  5FLV A;  3OSF A;  3WG7 H;  5E3M A;  1IUY A;  3A0B C;  3H9G A;  4DW6 A;  3IAS 2;  1XC5 A;  1A35 A;  4A3E J;  2X51 A;  5ICC A;  4FT8 A;  3K10 A;  1R22 A;  3DEW A;  4RBO A;  2HTJ A;  3NRV A;  4HA8 A;  1SVM A;  4EJO A;  1UZC A;  1DGW Y;  1JT6 A;  3CCS I;  4CDG A;  3KFW X;  4UUS B;  4AVP A;  4EJV A;  4JX4 A;  3PUF A;  1WH5 A;  3EYI A;  1ZQ3 P;  1GT0 C;  5M3M J;  2ZFU A;  3RTR A;  2HS5 A;  3G1L A;  3OIQ A;  4IPA A;  1B8I A;  1IRX A;  1G3Y A;  3CCQ I;  3JTH A;  3FM5 A;  3HOU J;  1ZG1 A;  1XMA A;  2L9V A;  3L7W A;  2E2H J;  3BP8 A;  2IT0 A;  4KMF A;  2FOK A;  2A5Y B;  1W36 D;  4BY7 J;  1SMY F;  3QPL A;  5C44 J;  1W5T A;  2WB1 A;  2F4O B;  1MNM C;  1F9N A;  2OF7 A;  1IUF A;  4NC6 A;  4AVZ A;  3DPL C;  1T8I A;  1XSV A;  3IH2 A;  1RIO H;  2CQQ A;  3H5N A;  4C30 A;  1X1D A;  5D5W B;  3JRD A;  4AU7 A;  2STW A;  3L1P A;  3R4K A;  1RZ4 A;  2N8G A;  5TIS C;  1OQY A;  4AD9 A;  1JXS A;  3DXJ F;  2L9N A;  1Z3X A;  4GFB A;  4RB3 C;  2IXS A;  4PFP A;  1IXS B;  4BQN A;  5CJ9 A;  1FBS A;  1U9N A;  3W2W A;  5LGT A;  2DAO A;  4WXH A;  3JW4 A;  3MKW B;  2H6C A;  1YIT I;  2J5O A;  3GFJ A;  2IAI A;  1EKE A;  4RB2 C;  3OYE A;  5LBQ A;  3CJN A;  3MD2 A;  3F23 A;  3FXK A;  1ZEL A;  1QPI A;  3J7Z I;  3UR3 C;  1WJE A;  2ZB9 A;  2L0K A;  2H1K A;  3ZQH A;  4ITV A;  3OOP A;  4KIG A;  4X6A J;  1BOB A;  2UXN A;  4LK1 F;  4R79 A;  3HZJ A;  4OMZ A;  3AG2 H;  1BI0 A;  2XB5 A;  2BVM A;  2XAF A;  5IYC J;  4XRS A;  4M6Y A;  4N4N B;  1SAX A;  5FKM A;  3VEP A;  3K6G A;  4RMN A;  1DPU A;  4FAS D;  2ZXW H;  4NC7 A;  1S3J A;  3W2A A;  4M3G A;  2E1N A;  1AOY A;  1XN7 A;  3JRA A;  3G2B A;  2KIQ A;  5FGM A;  2XUB A;  5FFZ A;  4KUM A;  4LOC A;  1GLN A;  1AWC A;  1FZP B;  3FXR A;  1QHG A;  3CMM A;  4E6K G;  2OPT A;  3JTG A;  2R5Z A;  3ZP5 A;  4K2E A;  2DYR H;  1A31 A;  2R7W A;  1KGS A;  3OYI A;  2WV1 A;  2BW3 A;  2BZT A;  3B73 A;  4CYC B;  3GTK J;  1XPX A;  1IV8 A;  2LF7 A;  4IL6 C;  4HPQ A;  2P5L C;  1XCV A;  2XAJ A;  1ETX A;  1B72 A;  4H0E A;  1Q1H A;  3CC7 I;  3M8E A;  5M3F J;  3S1Q J;  1MBG A;  2LC2 A;  1U5T B;  1OYY A;  5GAH J;  3ROU A;  3CC2 I;  3L2U A;  3TO6 A;  5IP6 A;  2Y2Z A;  4XSX F;  3ZGK A;  4A0Y A;  4XN0 A;  2JUG A;  1S6L A;  1BR1 A;  3O8H A;  2IS4 A;  4EAT A;  1YRN A;  3TOA A;  3PQJ A;  2HOE A;  4RLQ A;  3CUO A;  1MZB A;  1V3F A;  2XB0 X;  3FHZ A;  3K4N A;  1MDM B;  1WJC A;  2B63 J;  3IWF A;  5JLW A;  1DP7 P;  4FTH A;  1DU6 A;  1TWH J;  4PJN A;  5IYB J;  3MKL A;  3AAF A;  1VQM I;  2JA5 J;  3WG9 A;  1F5T A;  1N25 A;  3B6C A;  1YE9 A;  1Y8R B;  3LQR A;  5D8K B;  3BC8 A;  2DJI A;  2VKH A;  1WGX A;  1ZR2 A;  4Y33 A;  3FZV A;  2R5Y B;  4ZH4 F;  1J59 A;  5KAF C;  3DKW A;  3KZI C;  3QWL A;  3PNY A;  3FDY A;  2GWR A;  4PDK A;  1MNE A;  5F0F A;  4Y17 A;  5EGO A;  5J40 A;  4E7S A;  1K83 J;  1K6Y A;  5FRO A;  4F3Q A;  1N75 A;  4U88 A;  2W48 A;  3OYF A;  4IHY A;  2WB1 N;  1R1V A;  3FXL A;  2JA7 J;  2H6B A;  1X58 A;  4W97 A;  5TRD A;  4EVI A;  4UUT A;  4OAY A;  4IX7 A;  1X3Z B;  2UWM A;  1RNL A;  3K1P A;  1JHF A;  1FY7 A;  4U0V A;  1MSE C;  1J9I A;  3H5R A;  2IBD A;  1X4P A;  4GYI A;  1BJA A;  1KQ0 A;  4NQW A;  2L7K A;  1IZ1 A; 
#chains in the Genus database with same CATH homology
 4W1U A;  1WCM J;  4Y52 J;  2Y9Z A;  2EZI A;  3LOC A;  2L7F P;  3IH3 A;  1TWC J;  2DJN A;  5E3L A;  3TP3 A;  1VND A;  2L7M P;  2QCO A;  4D5F A;  2LKX A;  3LSJ A;  2D5V A;  4C3I J;  4DZP A;  3I4M J;  3OIO A;  2M0C A;  2MSY A;  3A02 A;  5E3O A;  1ORK A;  2CRG A;  5EG0 B;  1QRY A;  3OOU A;  4V2G A;  5K7F A;  2GM4 A;  4IHX A;  5EEA A;  4L5E A;  3BR5 A;  2O8K A;  2LD5 A;  3HDD A;  4BBS J;  1RET A;  1GVD A;  2YS9 A;  3PM1 A;  2HDD A;  2DA7 A;  2HXI A;  2EZH A;  4XID A;  4I6Z A;  1B8I B;  5C4J J;  3FKI J;  5F0H A;  3MVP A;  1MH3 A;  4B1R A;  2R93 J;  1CQT A;  2ID3 A;  4IHV A;  3GTG J;  3FK7 A;  3S1N J;  4XIC A;  1LE8 A;  5GP9 A;  2JK3 A;  1O4X A;  5FJ8 J;  2DN0 A;  1BA5 A;  4M3D A;  1ZK8 A;  2DTZ A;  4BBR J;  2ELK A;  4A3M J;  3NAR A;  2XGC A;  1R9T J;  1AKH A;  1FIA A;  2DA5 A;  3HKZ N;  1JTY A;  1P7J A;  2NS7 A;  5M5W J;  3M3Y J;  4MFD A;  3BQZ A;  4A3K J;  2M9H A;  2M2E A;  2GLO A;  3A01 A;  2NOG A;  5F27 A;  3UKG A;  1H89 C;  1WPK A;  1ENH A;  1DU0 A;  5EDN A;  3S1R J;  1BW6 A;  3BR6 A;  4MO7 A;  2NVQ J;  1ETY A;  5FKN A;  1FIP A;  2FQ4 A;  1MH4 A;  2NS8 A;  2YUS A;  4MIM A;  1H88 C;  2NVY J;  3G1O A;  2K9N A;  3BQY A;  1U9O A;  2VUM J;  1IDZ A;  5F1J A;  1OJL A;  2DA2 A;  1IDY A;  3HOV J;  3I4N J;  3WHB A;  2DA3 A;  3S1M J;  1JKP C;  1IRZ A;  5J1U A;  4RDU A;  1RES A;  1SFO J;  2EZL A;  2ME6 A;  2WAQ N;  3WHC A;  3C2B A;  1B72 B;  1U8B A;  2K9Q A;  1VF9 A;  2AHQ A;  3BG5 A;  1RKT A;  2LVS A;  4AC0 A;  3BR0 A;  3RZO J;  5EZG A;  3GTJ J;  2LP0 A;  1GV2 A;  3Q0V A;  2Y31 A;  3GBG A;  3BR1 A;  1GV5 A;  2LTP A;  2JJ7 A;  4FIS A;  3VPR A;  4A3B J;  3BTI A;  4A3G J;  4FE7 A;  1A5J A;  4FCY A;  1ZTR A;  3LSR A;  3HGY A;  3HOX J;  5HOD A;  3D1N I;  1W0U A;  3CMY A;  1POG A;  4NDL A;  1RPW A;  4I76 A;  5IOY A;  3S17 J;  2DMQ A;  1QVU A;  1JKQ C;  5EZH A;  2CU7 A;  3F0C A;  1QVT A;  4AUX A;  1Z77 A;  3DCF A;  2KT0 A;  1TC3 C;  1Z0X A;  1MBE A;  3BT9 A;  1MSF C;  4ABZ A;  2KDZ A;  5EG0 A;  4BXX J;  4A3J J;  2EH3 A;  2MW8 A;  2NVX J;  1ETW A;  5M5X J;  3GTM J;  4IHW A;  1TWA J;  1UMQ A;  1E3O C;  4XK4 A;  3JRB A;  3JRC A;  1EF4 A;  4X1E A;  1BW5 A;  4A3L J;  2DMT A;  3BTC A;  3JRE A;  1IJW C;  4Y7N J;  5FLM J;  1T33 A;  1TWF J;  4JX6 A;  1VFC A;  3TW7 A;  3O8G A;  2XPV A;  3JRG A;  3HEF A;  2O7O A;  2X6O A;  2HOS A;  1XG1 A;  2Y0S N;  4V2F A;  5F0C A;  2R7Z J;  1AU7 A;  2GBY A;  2L7Z A;  2XRL A;  1IGN A;  3S14 J;  1FEX A;  5K7H A;  3CQZ J;  1NTC A;  3NAU A;  2LY9 A;  4AYB N;  4MFE A;  4J19 A;  1ETV A;  5M5Y J;  1XS9 A;  3S2D J;  2VI6 A;  4QSH A;  1MBF A;  3FK6 A;  2DMU A;  1NK3 P;  2G0E A;  2HYJ A;  2CUF A;  2HOA A;  5K7Z A;  1IG7 A;  2FD5 A;  3HOY J;  4B3A A;  2HQ5 A;  2CUE A;  3JRH A;  1YRN B;  2E19 A;  1LFB A;  1X2N A;  3JRF A;  2DA1 A;  1ETO A;  1LE8 B;  5IYD J;  3CDL A;  1FTZ A;  5FKK A;  4D7M A;  3JR9 A;  1JUS A;  2R5Z B;  3Q3S A;  1PUF A;  4JX5 A;  5J1R A;  3PO2 J;  3GTP J;  2VKE A;  1GUU A;  2CJJ A;  2TRT A;  1JJ8 C;  1AKH B;  2MGQ A;  2JWT A;  5F08 A;  2E1O A;  5J1Y A;  3TP0 A;  2R5Y A;  4D5C A;  5C3E J;  3S16 J;  1RR7 A;  4B4C A;  1GDT A;  3GTO J;  3GTL J;  1D5Y A;  9ANT A;  1I6H J;  1ETK A;  5EGO B;  3GTQ J;  3IH4 A;  5E3N A;  3S2H J;  3ZQL A;  2COB A;  2DMP A;  2DA6 A;  1HCR A;  2IEK A;  4C3H J;  2Y9Y A;  1OFC X;  4BKX A;  1IC8 A;  2LK2 A;  2VKV A;  1JKR C;  5IPA A;  4S0H B;  1LFU P;  3IV5 A;  3RQI A;  4DZJ A;  2FJ1 A;  5F04 A;  5J3L A;  4HNV A;  3QQA A;  5C4X J;  4C3J J;  3BTJ A;  2XPW A;  2TCT A;  2LR8 A;  4CYC A;  1ZKG A;  4A3D J;  4M6V A;  2JA8 J;  3MN2 A;  5FLV A;  3OSF A;  1ZGW A;  5E3M A;  2VPR A;  5DS9 A;  1JJ6 C;  4DW6 A;  1XC5 A;  4A3E J;  3A01 B;  3HM5 A;  3Q0U A;  5IP7 J;  1G2H A;  4RBO A;  3DEW A;  5FKO A;  3G1M A;  2EZK A;  1WI3 A;  4JP0 A;  1A6I A;  4MLO A;  4EEF G;  1UG2 A;  2M34 A;  1BJZ A;  4C2M J;  2CQX A;  3B6A A;  2M8G X;  2XGD A;  1K61 A;  1JT6 A;  3BG9 A;  2ME0 A;  3JRI A;  2AO9 A;  4UUS B;  2JMW A;  2X9D A;  4JX4 A;  1WH5 A;  3BG3 A;  1ZQ3 P;  5M3M J;  5IOZ A;  1B8I A;  3G1L A;  1JUP A;  1AHD P;  2JA6 J;  4BY1 J;  1MBH A;  1VI0 A;  3H0G J;  5BNG A;  3HOU J;  3HBL A;  3BR3 A;  3LNQ A;  2R92 J;  3HOW J;  4IEJ A;  1MBK A;  2E2H J;  3A03 A;  1S7E A;  1Y1V J;  4BY7 J;  5EF6 A;  5IP9 J;  1TWG J;  3QPL A;  5C44 J;  3BR2 A;  1UHS A;  5GPC A;  3HGG A;  5JLX A;  1MNM C;  2OF7 A;  1IUF A;  1APL C;  3IH2 A;  1OCT C;  2CQQ A;  4JYK A;  4A3I J;  3TED A;  3JRD A;  4M3E A;  3L1P A;  4XRS G;  2EBI A;  1HF0 A;  2N8G A;  1P7I A;  1ETQ A;  2P81 A;  2PMZ N;  4QTR A;  1W0T A;  4GFB A;  2K9S A;  3S15 J;  3FIS A;  3Q0W A;  2I10 A;  1Q1V A;  3ZOB A;  2DMN A;  1H8A C;  3ZQC A;  1U9N A;  1HDD C;  2LFB A;  2IAI A;  1HDP A;  4DYC A;  1HOM A;  1QPI A;  2ZB9 A;  2L0K A;  2H1K A;  3ZQH A;  4X6A J;  2L9R A;  2NVT J;  5FKL A;  2XB5 A;  3SFI A;  5IYC J;  4XRS A;  2FX0 A;  2X48 A;  3QPS A;  3TW6 A;  5FKM A;  1NK2 P;  1JKO C;  2MG4 A;  4M3B A;  4UUS A;  3K7A J;  4M3F A;  4M3G A;  3W6V A;  3FIW A;  2ECC A;  2DA4 A;  2ID6 A;  3JRA A;  3CCY A;  5DTD A;  4A93 J;  1WH7 A;  2XPU A;  4LOC A;  1ITY A;  2OPT A;  4XRM A;  3OSG A;  1F43 A;  2R5Z A;  1MBJ A;  3E7L A;  1JTX A;  3LSP A;  3PO3 J;  3ZQF A;  2WV1 A;  2EQR A;  2E2I J;  3RZD J;  4CYC B;  2RAE A;  1BL0 A;  3GTK J;  1ETX A;  1B72 A;  1JUM A;  5M3F J;  3S1Q J;  1FTT A;  1MBG A;  3ZQI A;  5IP6 A;  2Y2Z A;  1FJL A;  2XGE A;  1HLV A;  2QF7 A;  2E2J J;  1F36 A;  3O8H A;  1YRN A;  2LLK A;  2R0Q C;  2Y30 A;  3BTL A;  2XB0 X;  4D7N A;  2B63 J;  3RKQ A;  5JLW A;  2K40 A;  4FTH A;  1ZR4 A;  1DU6 A;  1TWH J;  1T56 A;  2XSD C;  1PUF B;  4DYQ A;  5GPA A;  3HB9 A;  3MKL A;  5IYB J;  3SJM A;  4A3F J;  2JA5 J;  3LSG A;  1I50 J;  3B6C A;  1U78 A;  2ECB A;  1RKW A;  1Y1W J;  2YU9 J;  1WGX A;  1ZR2 A;  4QIW N;  2H8R A;  2HI3 A;  2R5Y B;  1JGG A;  1X2M A;  4A3C J;  1JT0 A;  2HXO A;  3SDG A;  5F0F A;  1SAN A;  3M4O J;  4A69 C;  5EGO A;  1I3Q J;  1K83 J;  3HOZ J;  2W48 A;  1IV6 A;  3ZQG A;  2O9L A;  5EYR A;  4IHY A;  1OCP A;  2WB1 N;  3K2A A;  2JA7 J;  4W97 A;  4FE4 A;  1X58 A;  4UUT A;  4DYR A;  1MSE C;  4G12 A;  2IBD A;  2JN6 A;  3H3V K;  2HOT A;  1GT0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...