1X2NA

Solution structure of the homeobox domain of human homeobox protein pknox1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
b'GSSGSSGKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein PKNOX1
publication title Solution structure of the homeobox domain of human homeobox protein PKNOX1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x2nA01
2IAIA 5GPAA 1MNMC 2EZHA 4A3MJ 1HDDC 4AC0A 2EBIA 3E7LA 3B6AA 3CCYA 3LOCA 3IH3A 2L7ZA 1NK3P 3ZQHA 2NVYJ 3FKIJ 4RBOA 5M5XJ 1B72A 3GTLJ 1FIAA 2K9QA 5IP7J 1TWCJ 3GTGJ 1B72B 1DU6A 1Q1VA 5C44J 4FCYA 3NAUA 2ZB9A 4B4CA 1GDTA 5J1YA 5JLWA 3OIOA 2JMWA 3TW7A 4IHXA 3SDGA 5K7HA 2YUSA 4DZPA 5F1JA 4C3IJ 2DA6A 3DCFA 3H3VK 1JKPC 3S15J 2HOSA 2Y9YA 4C3HJ 4M6VA 2ELKA 2IBDA 1FIPA 2JA6J 2CRGA 3CDLA 5E3NA 1SANA 4XRMA 1MBHA 3PO3J 1F43A 3RKQA 1MH3A 3K7AJ 5E3OA 3SFIA 4A3GJ 1JKQC 5C4XJ 3HDDA 1MBGA 5F0CA 1MBKA 1TWFJ 3BR0A 4XIDA 2K9NA 1RETA 5M5WJ 2LVSA 1NTCA 3HKZN 2DA1A 5E3MA 3S1MJ 2M9HA 1WPKA 3ZQIA 1VF9A 3S2DJ 3M4OJ 3JRDA 4BBRJ 3BG5A 1JJ8C 1ETVA 1QVUA 2O7OA 1JUSA 1B8IA 1TWGJ 5F27A 3S16J 1GUUA 1MH4A 2TRTA 4A3IJ 1B8IB 1BL0A 3O8GA 1WH7A 2NVQJ 3CQZJ 1Y1VJ 4JX4A 2G0EA 2FX0A 3A02A 4MFEA 1PUFB 3BTIA 2DN0A 1WCMJ 5GPCA 5EDNA 1BJZA 4XRSA 2FD5A 1ZR4A 2FQ4A 3D1NI 3HGYA 1IV6A 2COBA 2XPUA 4V2GA 2DMQA 3JRHA 2DA2A 3BTLA 4A3EJ 5E3LA 4NDLA 3S1RJ 1LFUP 2EZKA 2WV1A 2LK2A 4MFDA 3ZQGA 1ETYA 2VKEA 1JUPA 2HOAA 3GBGA 5F0HA 2JA7J 3BG9A 1ZKGA 2HYJA 3DEWA 4FTHA 1UG2A 3BTCA 5DTDA 3K2AA 1P7JA 1BW6A 3WHBA 5EEAA 2XRLA 4UUSA 4UUSB 3OSFA 1ITYA 5BNGA 1BW5A 2HXOA 4UUTA 3ZOBA 1HF0A 3MVPA 2ID6A 4M3BA 2X9DA 3LSPA 1GV2A 3RQIA 3PO2J 3FIWA 3TP0A 4QTRA 2JWTA 2EH3A 5EZGA 1HLVA 3PM1A 4M3FA 3GTJJ 2DTZA 3SJMA 2HOTA 1FEXA 2Y2ZA 1IJWC 2EZIA 1ENHA 1GT0C 2MGQA 2Y9ZA 4J19A 1UMQA 4BY1J 3HEFA 2JK3A 3HOUJ 3FISA 3G1MA 4XK4A 4JX6A 2JJ7A 1R9TJ 1GV5A 2QCOA 2L9RA 2WAQN 3OOUA 3QPSA 3JRGA 4JYKA 4S0HB 1IC8A 3JRFA 2D5VA 2HXIA 4IEJA 3HB9A 1HOMA 1U8BA 4LOCA 2TCTA 4W1UA 3TEDA 2KT0A 3G1LA 3LSRA 4A3CJ 2Y31A 4AYBN 1JT0A 4A3BJ 4BXXJ 1RKWA 2AO9A 1S7EA 4EEFG 2R92J 1FJLA 3LNQA 3C2BA 3I4MJ 1WGXA 2B63J 1OJLA 2P81A 4JX5A 4V2FA 3B6CA 1APLC 2N8GA 4DYQA 2O9LA 1XS9A 2NVXJ 3Q3SA 3S1NJ 2Y30A 1OFCX 2L7MP 2X48A 2XGCA 3ZQFA 1H88C 1I3QJ 2WB1N 4FE7A 4A3FJ 4JP0A 2NS7A 1JKRC 3HGGA 2E19A 5FLMJ 3VPRA 1T33A 4QSHA 3BR6A 3TW6A 1OCPA 3LSJA 1JUMA 2IEKA 4BY7J 1AKHA 5C4JJ 1AKHB 3BQZA 2XPWA 4FISA 3ZQLA 3HOYJ 2R7ZJ 1ETOA 3S2HJ 2DJNA 5EYRA 3BR3A 1GVDA 1XC5A 4XRSG 5EF6A 2VI6A 3MN2A 1IDZA 3JRAA 2LTPA 1RKTA 2X6OA 1Y1WJ 2YS9A 3Q0VA 3HOWJ 2E1OA 2XB5A 3A01A 1W0TA 1IGNA 1JGGA 5F08A 4D5FA 1IDYA 2M0CA 3HM5A 2DA7A 2QF7A 2GBYA 1QPIA 1FTZA 1WH5A 2H8RA 2DMTA 4AUXA 1ZQ3P 3H0GJ 2CU7A 5IYCJ 1MBJA 4A3JJ 4A3KJ 3LSGA 1EF4A 3G1OA 2H1KA 2OF7A 3QPLA 2LR8A 4D7MA 4BKXA 1D5YA 2K9SA 4M3DA 1A6IA 5IPAA 5FLVA 1X2NA 3GTQJ 5C3EJ 3HOXJ 1LE8A 1ORKA 3Q0UA 2ECBA 2VKVA 5FKNA 1YRNA 2R93J 4D7NA 1ETQA 3BT9A 4GFBA 3IV5A 3IH2A 1YRNB 5FKMA 2CUEA 4FE4A 3HBLA 5EZHA 1ETWA 2JA5J 1VI0A 2VPRA 3M3YJ 2JA8J 2HDDA 5FKOA 4MIMA 1FTTA 2I10A 1IG7A 3TP3A 1ZTRA 2M34A 5K7ZA 3GTPJ 1ETXA 1VFCA 1QRYA 1NK2P 4M3GA 3BTJA 2KDZA 5EGOA 2R5ZA 4MO7A 3JRBA 1UHSA 1AHDP 3I4NJ 5EGOB 4DYCA 2R5ZB 2NS8A 5M5YJ 1JJ6C 4DZJA 1MBFA 9ANTA 5IYDJ 2CQQA 1ZGWA 1JTXA 1W0UA 1TWAJ 4A3DJ 2ID3A 3A03A 4Y7NJ 1MBEA 2XSDC 2LP0A 3GTKJ 3UKGA 2ECCA 2JN6A 1H89C 1O4XA 2HI3A 2LFBA 1BA5A 5J3LA 3ZQCA 3GTMJ 1AU7A 1MSFC 3CMYA 5IOYA 3JRCA 3BR5A 1Z77A 2L0KA 2L7FP 3OSGA 4G12A 2EZLA 4IHWA 1WI3A 2CUFA 2ME0A 3JREA 5FKLA 4C3JJ 5DS9A 4X1EA 2M8GX 4HNVA 2M2EA 1HDPA 1QVTA 3NARA 2FJ1A 2AHQA 3QQAA 3S14J 1RESA 3WHCA 3S1QJ 2YU9J 1I6HJ 3GTOJ 2DA3A 4DW6A 1G2HA 2XPVA 1U9OA 2DA4A 5JLXA 2NOGA 4IHVA 1JTYA 2K40A 2GM4A 4MLOA 2W48A 3L1PA 2R0QC 4M3EA 4A69C 3RZOJ 2GLOA 2E2HJ 2RAEA 1IUFA 4W97A 5GP9A 5IP6A 4BBSJ 2DA5A 2XGEA 1HCRA 2MSYA 1TC3C 4DYRA 5J1RA 2DMNA 2DMPA 1CQTA 5F04A 5IP9J 2LD5A 2R5YA 1P7IA 1TWHJ 3FK6A 3A01B 5IYBJ 1Z0XA 4RDUA 2HQ5A 2R5YB 1U78A 1JKOC 1ZK8A 1T56A 2LKXA 5EG0A 3RZDJ 2CJJA 2DMUA 1PUFA 3S17J 4QIWN 2LLKA 5EG0B 2CQXA 1E3OC 2LY9A 5J1UA 4B3AA 4B1RA 2NVTJ 2EQRA 3F0CA 5M3FJ 1MSEC 1XG1A 1JT6A 1RPWA 2ME6A 5FKKA 2XB0X 1X2MA 1VNDA 3HOVJ 1K83J 5HODA 4C2MJ 1IRZA 1LE8B 3JRIA 5IOZA 5F0FA 1RR7A 1POGA 3O8HA 4L5EA 2O8KA 1OCTC 1U9NA 4D5CA 3W6VA 1SFOJ 4A3LJ 2PMZN 2MW8A 3MKLA 2OPTA 1DU0A 4I6ZA 1ETKA 3BG3A 2E2JJ 3BQYA 4CYCA 5FJ8J 4ABZA 4X6AJ 1I50J 1ZR2A 3FK7A 1H8AC 4CYCB 2XGDA 1A5JA 4A93J 1K61A 4XICA 1F36A 4IHYA 2VUMJ 1LFBA 3BR2A 5K7FA 4Y52J 2Y0SN 2MG4A 1X58A 3BR1A 2E2IJ 4I76A 5M3MJ 3Q0WA 3JR9A 3IH4A 3HOZJ
chains in the Genus database with same CATH superfamily
1DPUA 1P92A 2EK5A 2KFDA 2HEOA 4A6DA 2M1BA 3LOCA 2DT7B 3FXQA 3DU5A 4DNCA 1XGOA 2JSPA 2NVYJ 3LQQA 2DTRA 4U7DA 1LEBA 2VC0A 4NC7A 5M5XJ 3LAPA 4EM0B 2BY2A 2VBWA 1R5ID 5HS9A 3L2QA 1TWCJ 1YS7A 5CQEA 2R7DA 3J80K 5HVQC 2NRAC 3HSEA 1B59A 2ZB9A 2H8WA 3NAUA 4CZZA 2GWRA 2QM3A 2FXAA 1WQ2A 3I5UA 5K7HA 2CS3A 4EJTA 3IRQA 4CUGA 3DCFA 3H3VK 3EDPA 3S15J 5TRDA 4C3HJ 3GXOA 5A2QZ 2O6GE 2IBDA 3GVAA 3HRMA 2K86A 3KYCB 2HYFA 4RLFA 3MFKA 4Q47A 5HLIA 3H9GA 2DOAA 1F1ZA 5E3OA 4A3GJ 5C4XJ 3HDDA 4I98B 4PJNA 1RETA 1P6RA 5HNFA 1LUJB 4XLPF 5E3MA 3GFIA 4I0BA 2M9HA 3M4OJ 1MMAA 1W36D 1SAXA 1CF7B 3S2DJ 4C9YA 1S3JA 4BBRJ 3SFZA 1QVUA 1TWGJ 3S16J 5EEGA 3FHNA 2BV6A 1B8IB 4E7KA 1BL0A 1VZ0A 3CQZJ 2K4BA 4I02A 3CD6I 4B8XA 3FHZA 4HF1A 4E7ZA 5L3CA 3W6JB 2ZXWH 3LSMA 1A36A 4L9VA 4JK1X 3IRRA 4LGWA 3CCMI 3BTIA 4JOMA 1IV8A 3DBLB 3FXJA 3R0AA 1MD0A 2LMDA 5EJCA 4WF2A 2FD5A 1VQ9I 1VTNC 1O3QA 5ERIA 2WWYA 3V42A 3PSFA 3R61A 2XDVA 1XGSA 3VEPA 3UR3C 2DMQA 3JRHA 1ZELA 5B1AH 3K2ZA 3BTLA 2BVLA 2XAFA 1KYZA 1XDSA 1IRXA 1M1EB 4I99C 3ZMTA 3SEQA 1ZLJA 4P9FA 1E3HA 4RGXA 1Z21A 1TP4A 1KZHA 2VKEA 2HOAA 2A6HF 2K02A 2OTJI 4I7HA 3BC8A 1UG2A 4BQQA 3BTCA 5FD5A 3K2AA 5CVUA 2NNYA 2E35A 3CC4I 4PGHA 2M7BA 1UCRA 1EH8A 2HZDA 3FXUA 1HXDA 4UUSB 1G6NA 3OSFA 5GAEJ 2X0LA 2OQRA 3PQJA 4HG2A 5BNGA 4CA0A 2HXOA 3ZOBA 3AKZA 2DODA 1HF0A 2BW3B 5CKTA 2E5ZA 4CZCA 1Y0NA 5GAGJ 3E5UA 3ZMUA 3RQIA 3PO2J 5FROA 4LJZF 3HHHA 4XR6A 2WTEA 5EZGA 1SFXA 1XGNA 4IO9F 2RNGA 3CP2A 2DTZA 1NHAA 4QPQA 1SFKA 3C18A 1Y8RB 3KX2A 2WAFA 3OOPA 3TO7A 2HOTA 1FEXA 2O5RA 1ENHA 4UV9A 2VONA 2MGQA 2HYGD 3TDUC 1FX7A 1NG7A 1UMQA 4J19A 3HOUJ 1KONA 3FISA 1VQOI 5HDKA 2ZKZA 5FFZA 1OYYA 2L9RA 1UELB 3JRGA 5DM6F 1X3UA 1U8BA 1HOMA 4CCJA 2NNNA 4XKCA 4LOCA 5CPRB 1LNWA 2TCTA 4W1UA 1QO0D 2JPBA 1WJCA 1KU9A 5J8CA 5GAHJ 1X3WB 4A3CJ 1ZGJA 2D1VA 4LB5A 5D5VB 1JT0A 2JVGA 1BI2A 2ESHA 3DF8A 1ODDA 1G59A 4BHCA 3K10A 3QP6A 3CZ6A 3BZCA 1FJLA 3V4GA 4EJWA 1DQUA 2RC4A 2B63J 3BPXA 5FGMA 1YJNI 2M87A 3I64A 3DEUA 3B6CA 1X4PA 3Q3SA 4ESBA 3G6EI 2WV0A 4ZJZA 4DBQA 2CGPA 1OFCX 4HX4A 2ESNA 2L7MP 4EM2A 4N0BA 4F91B 2XGCA 3ZQFA 1KU3A 2LOOA 1ZRDA 4FE7A 4A3FJ 2L2OA 2H6CA 3TOBA 2DFHA 2A6TA 1JKRC 1TNTA 1OKRA 3LA3A 1YTYA 4RLQA 5FLMJ 3HSFA 5CQGA 4XM3A 3TDZC 1T6SA 4PFPA 2PMZA 4L9JA 1RUNA 1JUMA 4Y17A 3CCLI 2PQ8A 4KITB 3CCEI 2GXGA 1WRJA 3K1MA 3MWMA 3RQ4A 3AG3H 2NVUB 2QSFX 5ICGA 3AL0C 2DJNA 3HG9A 1GVDA 1LKXA 2BY3A 4EQQA 5JFRA 4XRSG 2IS2A 4RGSA 2IA0A 1H9GA 4XSZF 3JRAA 2LTPA 3ZRGA 1RKTA 2X6OA 4HPQA 2W82A 4R1HA 3VDXA 1P9QC 2E1OA 2XB5A 3UNGC 1XSVA 2ZFUA 3ZMVA 3RYPA 2JZYA 2V6CA 2DMTA 2PMUA 2KIQA 3H0GJ 2CU7A 1PJRA 5IYCJ 1SFUA 3FMSA 3LSGA 3PIPF 3G73A 2QSGX 2IVMA 3J7AY 3CUQA 3QPLA 1I1SA 4LG0B 2COMA 4BKXA 2L9SA 3KIOA 3G3ZA 1U2WA 4J00A 3QOEA 2VIXA 5IPAA 1X2NA 2OU2A 1Q1HA 2X6WA 5DCMA 2Z2SB 3Q0UA 2GA2A 2VKVA 2BHYA 4M9XA 5JHFA 1YRNA 2R93J 3BT9A 1YHQI 2P5VA 3IV5A 4ZZDA 2VBXA 2JRMA 4FE4A 4D9JA 1ETWA 4E70A 1V5GA 1VI0A 2QQ9A 1ZRCA 3VWBA 3M3YJ 4U0VA 4KFCA 4XNFA 2FA5A 5FKOA 5CLSA 4MIMA 5HLHA 1PP7U 3W2VA 2A07F 2JQ7A 4ZYDA 1FBUA 1ZTRA 1Y6IA 2YX4A 4Y3OA 4AIHA 2F5CA 3TGNA 4M3GA 3BTJA 3HKZA 2IA1A 2IS6A 3PL8A 2F5VA 3OR2C 4F55A 5DM7F 2ZJPF 1AHDP 4IZZA 1OYWA 3JCUC 1WJAA 1FOWA 3GLLA 4M74A 2D2WA 5IYDJ 5E8GA 2QQBA 1W0UA 4A3DJ 2ID3A 3OYKA 4Y7NJ 4HDUA 1MBEA 3I9V2 3QYBA 5DUIA 4FX4A 2XSDC 2LP0A 5DV5A 2GXBA 3FXMA 3GW2A 4A2UA 3GMEA 4HSTA 4B48A 1Y56A 1O4XA 2XAQA 2HI3A 3H9JA 2E71A 3CP8A 2HOEA 2XASA 2P5LC 1AU7A 3OYLA 2PLYA 3CO6C 2GOMA 2A5YB 3DXJF 1YFHA 4CYDA 1DGRM 3ZGKA 1Z77A 2L0KA 2L7FP 1FBSA 1L0OC 2YR2A 3CLQA 4RAFA 4IHWA 4ZDLA 2CFXA 4NB5A 2DT5A 5DS9A 3MEXA 2QENA 1XCBA 4EJUA 4G7HF 5JR3A 2HDCA 1V55H 1ZHFA 2AHQA 1R22A 3OYBA 3S1QJ 1RI7A 4XOPA 4L9TA 2KRCA 1UG0A 2DA4A 2C6YA 2K3FA 4IHVA 1RC9A 1SD5A 3IKTA 2XRNA 5ICCA 3L1PA 3G71I 3N05A 3DTEA 3RZOJ 2E2HJ 2HNHA 4ZYGA 4W97A 3VYTB 1HKQA 4ESJA 1U3EM 4G7ZF 3OYIA 1HCRA 2DI3A 4YIIA 3ZCOA 1YIOA 1TC3C 2RREA 1K4SA 3DP7A 3W3CA 1O3TA 3RPQA 2X4HA 4BAYA 3NWSA 3FBIB 3COAC 1LDDA 5IYBJ 4H4KC 1LVAA 1T39A 1Z0XA 3HOSA 1FZPB 4M9ZA 5K5OA 3LFKA 2LKXA 2K9LA 5EG0A 4ZZLA 1PUFA 1FT9A 1UHWA 1X1AA 1Z9CA 2HGCA 2LY9A 3I3LA 2WAQA 1N77A 3OR1C 2DFEA 3CUQB 2NVTJ 2Z99A 4DJAA 4XKVA 4G8XA 4O6JA 2ME6A 2MLGA 3RPUA 2XB0X 4OMZA 2KZVA 4PSXA 3GFLA 5BOXA 4C2MJ 3W6KB 3JAMZ 1IRZA 4B09A 2L4MA 2P7VB 2XV4S 1POGA 1D1AA 2IGKA 2ZXHA 4KISA 4IL6C 5L3EA 1U9NA 1W1WE 2FNAA 3ASNH 5GTIC 1T38A 2UXNA 4A3LJ 3CCUI 1SVOA 1GVJA 1WJEA 3SQNA 5LFAA 4I6ZA 1ETKA 5KAIC 3L2VA 4YFXF 3BG3A 2BYVE 4HLYA 5H2FC 2E2JJ 3BQYA 4CYCA 2HPMA 2V9PA 4ABZA 1TQIA 2EFPA 2WB1A 3J81K 4BNCA 2J5PA 2M5WA 2QQAA 4HW0A 3VB2A 4IHYA 3TQNA 2VUMJ 1KQ9A 3RTRA 1NG6A 3HXLA 1K6YA 3OYDA 1VQPI 2DW4A 4I76A 1FY7A 4EM1A 3HOZJ 2IAIA 5GPAA 3LSHA 2EZHA 3DKWA 1HDDC 2EBIA 3E7LA 5D4RA 3B6AA 2VXDA 5D4SA 2JT1A 3U21A 3IH3A 3ZPLA 1FMWA 1GXPA 1NK3P 3E6DA 4UUVA 3S2WA 1QPMA 5ED4A 2VE9A 1JXSA 1BC7C 2ZJQF 5HS7A 1DU6A 4OIQF 1Q1VA 5C44J 4FCYA 3QRFF 2XHKA 4B4CA 1Y0UA 2M4GA 1GDTA 2HQRA 2EPFA 4KT6A 3V8KA 3OY9A 1MNDA 3GLXA 2E34A 1QZZA 2V1XA 4IHXA 2YUSA 1J5YA 2EA2A 4NC6A 4C3IJ 1D1BA 3E5XA 4A5MA 1O3SA 4DIQA 1FYMA 4HF0A 4M6VA 4HSRA 1T08B 2CRGA 3P9CA 1WFXA 2EV5A 3K69A 1MBHA 2M45A 3WE2A 4XRMA 4WXCA 4WK8F 1YW9A 1F43A 1W5TA 2QLZA 4V19K 1E0EA 1MBKA 1TWFJ 3BR0A 4I2OA 4XIDA 4OIOF 2HQNA 1CF7A 3S1MJ 4F3QA 1BI0A 1VF9A 4M72A 4ENJA 1YX5A 3BG5A 3KP7A 3C2GA 2VPLA 3HRSA 2O7OA 4I0AA 2QA4I 3R6SA 1JUSA 1B8IA 3CF2A 1EJ9A 1MH4A 3K1PA 4A3IJ 2KJCA 2XKOA 3ISPA 4RAZA 3I59B 1ZGAA 5KHDA 2EINH 1OPCA 3T5XA 4JX4A 2G0EA 2CUZA 4R8HA 2P6SA 4B47A 2QGUA 4ASNA 5BPDA 3D5LA 2YPRA 1F5TA 1VQ8I 3A02A 4PZJA 1PUFB 3F9KA 1IRFA 2YX7A 1LQ1A 2XF6A 2H27A 2FBKA 1QU3A 2BEOA 4ENMA 2MC3A 1Z1DA 2Q2EB 3H9QA 2DAOA 3HL2A 5J40A 1ZR4A 3HGYA 1MKMA 4EATA 3FXRA 3ABMH 2XPUA 4FETA 2BOLA 2F4OB 4A0ZA 3Q9VA 5E3LA 5KAFC 3S1RJ 5HLGA 1W5CC 1IO2A 3WU2C 2HKXA 2WV1A 3EQLF 1S9HA 4E6KG 1E3PA 1CGPA 3O6BB 3QPTA 3R0JA 5F0HA 2IXSA 2CV2A 5JVTA 3LSKA 3BG9A 4L0ZB 4OIRF 2HYJA 2K85A 3K6GA 2V79A 2F5FA 1MJAA 3HZJA 5ILUA 1SEUA 4LITA 4XLFA 5LRSA 5LHGA 2XRLA 4UUSA 1XMXA 3RKWA 1SC7A 1TT5B 4S05A 5E1ZB 2BW3A 2HTSA 3CTAA 1P4AA 2IPQX 2FUG2 2OBPA 1GV2A 2VQCA 3CLOA 2H6BA 3TP0A 1H0MA 3OS0A 3FXOA 3PM1A 4Y4RA 1MIJA 1IJWC 1QZEA 2EZIA 4HDVA 1GT0C 4BL0B 2P0WA 3NEUA 1LJ9A 2Y9ZA 3HEFA 3OYFA 4XK4A 2MFZA 4PK4A 2R7OA 4WX9A 1GV5A 2TDXA 1MW7A 3OOUA 3ABLH 4OAYA 4XN0A 4JYKA 1IC8A 1W7PD 2EFQA 4IEJA 5HDNA 4P96A 3TEDA 4IQ4A 2E5NA 3AFHA 4F52A 3E3VA 5CYVA 4A3BJ 4KN4X 5H20A 1WWXA 1U8RA 2G7UA 2FNPA 1S7EA 5B66C 1SMYF 3DTIA 4HA8A 2R92J 3DPUA 3LNQA 2BBYA 2VASA 2DDBA 3ROUA 2R7WA 2B9SA 1FNNA 2JRTA 1OJLA 3BCAA 2M4KA 1D1CA 1D5VA 2X1CA 2N8GA 2O9LA 3F8NA 4II2A 1EKEA 2QKLB 4BJ5C 2CW7A 2V7FA 2Z16A 3K4NA 2HZTA 4EJVA 2ICWG 1I3QJ 1YW7A 1AWCA 4U87A 1W7PB 4AM3A 4FT8A 5AIPA 2LF8A 3RJPA 1PDNC 1BIBA 3B73A 3OMYA 3VFZA 3EYIA 3VPRA 1T33A 3LSTA 4MQVA 4E7HA 4HF2A 3BZKA 2RQPA 1OCPA 1OMIA 4BY7J 1IXSB 3H1CA 2CYYA 5H6RA 1BM9A 2F6CA 1UZCA 2XKPA 3I58A 3J81Z 4B43A 2L02A 1EV7A 2R7ZJ 3BZ6A 1ETOA 4XRFA 2FBIA 1ACIA 4IOCF 1XC5A 2RQQA 2LRDA 1BR2A 3MN2A 2Y0SA 1IN8A 2ZXIA 5LRRA 3V8JA 2CW0F 3WG7H 3EYYA 3WU0A 1KU2A 3K70D 1ERDA 1J2XA 2IGMA 3GZ5A 2KIFA 1JGGA 2UWMA 2QUFA 2CQKA 2DFFA 4JQFA 3DLAA 2DA7A 2QF7A 1QPIA 1XD7A 3QYEA 2H8RA 2VXZA 2HDWA 4MNUA 4AUXA 1ZQ3P 2A69F 5CVJA 3CC2I 4UVAA 3FM5A 4ZYHA 3MKYB 4A3JJ 2MLKA 4A3KJ 3KP4A 3B02A 1YJWI 4GGGA 4Q5SF 1EF4A 1MNEA 4MEXF 3CUQC 4LG0A 4FX0A 1BJAA 2XF5A 1D5YA 5FLVA 2X1EA 3D5RC 2IP2A 4HNUA 5C3EJ 3GTQJ 3GX4X 4IJAA 1TLHB 2IS1A 3FBNB 3CDHA 4KIGA 2HKOA 3U1KA 5FKNA 4D7NA 4HQMA 4L9NA 4UNOA 3L2RA 5FKMA 3VYSB 1R7JA 2W84A 5B3SH 3R4KA 2P8TA 3L2CA 2R7RA 2X6YA 3MAJA 1G3WA 3FWEA 2FEZA 2DK5A 3GTPJ 5K7ZA 3S3OA 4WCGA 3D0SA 3DV8A 3MD2A 2KMUA 2P7CB 4KNYA 3LWFA 2UZKA 2PEXA 3KP3A 5E1XA 1HW2A 2G7HA 3RDIA 2LBFA 3J7YJ 1U5TB 1VQLI 1XMAA 5EGOB 4DYCA 2R5ZB 2FBHA 2PN6A 5IT3A 1LDKB 2VL8A 3TMOA 2WAEA 3L7WA 1MBFA 4ITVA 1R1TA 3F8MA 3MKWB 5D8KB 1JTXA 3C1DA 1YITI 4NUBA 2RGVA 4II3A 3ZMZA 2OCEA 1SD4A 3GTKJ 1ZG3A 4ZH4F 5LLQA 1QQIA 3DTKA 2ECCA 4P1WA 4AVZA 2ZMEB 1H89C 3JAMK 3ECOA 3O2PE 1QHGA 1P2FA 2EFNA 3MZYA 4OWRB 3CMYA 2CUJA 3VYRB 1T2KA 5GADJ 4HBLA 4BHBA 3OSGA 4G12A 4ZTFA 1YG2A 2ME0A 4XLNF 1Z91A 2DOFA 3M07A 3JREA 5FKLA 2M8GX 3ZMSA 1SFEA 3TKYA 2M2EA 4HV5A 1HDPA 3WE3A 2FE3A 4ON0A 2W00A 5AIQA 1RESA 3V8LA 5LBQA 3EUHA 1ZRFA 1R49A 2MABA 3RIRA 1G2HA 3I0TA 5JLXA 3RKYA 4DBRA 4AU7A 2ELJA 2JSCA 3M7GA 2GLOA 4DOZA 2RDPA 4BJTA 2ZC2A 1FYLA 2MA3A 4Y15A 5GP9A 4QLCU 1UFMA 2ELHA 3TOAA 4BBSJ 5DEQA 1MGTA 3E6MA 3PIOF 3M8JA 3ZQQA 3OIQA 1MDMB 1CQTA 5IP9J 5F64A 4A12A 2IS4A 1P7IA 4RB0A 1K6OA 4LG3A 3FK6A 4LMYA 2PBIA 3KFWX 4RDUA 2HQ5A 2R5YB 1QA6A 4AIJA 3HPHA 1ZK8A 1VQ5I 4G94A 3IWZA 5H6QA 3EUAA 2GXAA 2E1MC 5DDGA 3RZDJ 2CJJA 2DMUA 2H09A 1O57A 4GRIA 1JHFA 3KP5A 2CQXA 3BLYA 5DUKA 1E3OC 2V26A 5LHIA 2JUCA 2ISYA 2KKOA 2XUBA 1J0RA 4XBFA 4GCVA 5J1UA 4B3AA 2DYRH 2OUMA 4GXOA 5E18F 4B1RA 1FOKA 5ILVA 5LEJA 1IXRC 3IWFA 3HRTA 3HYIA 1R58A 4KICA 3HJEA 5FKKA 5K1YA 1X2MA 3F72A 5FLXZ 1P4XA 3HOVJ 4KUMA 1K83J 4AYBA 2F2EA 1E2XA 3CCSI 5IOZA 1RR7A 4B3XA 1HW5A 2XC7A 2DJIA 1XB4A 3O8HA 4KT5C 3T0YA 5HLTA 5KNLA 3QU3A 3OS2A 3W6VA 1SFOJ 2PMZN 2M0MA 2OPTA 1S7OA 1STZA 3MKLA 4PUSA 4R79A 4CXFA 3FXLA 3L2UA 1ONVA 1DDNA 4ETSA 2VQGA 2JVHA 3WTWC 2EIKH 4X6AJ 3Q5FA 1ZR2A 3FK7A 4WWCA 2HTJA 4XICA 1F36A 4XLHA 4KN7X 2CO5A 1D8JA 1W4MA 2LBFB 4MEYF 2KPMA 1X1PA 3BR2A 3CJRB 1LEAA 2Z5UA 2HR3A 5EEHA 4Y52J 4RGUA 1J59A 2E2IJ 4BS9A 4GO1A 1HQCA 3Q0WA 3IH4A 3OS1A 1UJ8A 3PNYA 1MMGA 1MNMC 1AA7A 4K2EA 3QWLA 3MMYB 4A3MJ 2QZ8A 4FHTA 4AC0A 3C7JA 4HLXA 4F7ZA 3DEEA 1K4TA 2L7ZA 3KETA 3ZQHA 2XAJA 3FKIJ 4ZYAA 4CICA 1HSJA 2DO7A 4RBOA 1RZ4A 3GTLJ 2OQGA 2VQHA 3I55I 3GTGJ 1ZG5A 5HDGA 1B72B 2KJBA 2CQNA 1USSA 2W4SA 4Y13A 2LG4A 4A6EA 5J1YA 4O3MA 5JLWA 3H3ZA 4RM3A 1HA8A 3TW7A 4BE2A 2VE8A 3ECHA 5E17F 5F1JA 3ELKA 4HAMA 2DA6A 2A3SA 1YJ9I 2F48A 3HSRA 5FRNA 1JKPC 1D0YA 4IPAA 1R23A 5K5RA 2PJPA 3PUFA 2HOSA 2Y9YA 2ELKA 2QSHX 1FIPA 2JA6J 1HKSA 3CDLA 1QZYA 1SANA 4U7BA 4P5OA 4E4HA 3A4CA 1YIJI 3E0JB 3DBHB 3JTGA 3DLLF 3PO3J 1HC8A 2Q0OA 2LSOA 1R1VA 3RKQA 2F4IA 2CH0A 2P4WA 2PI0A 1ZN2A 1O7LA 5F0CA 2A05A 3BP8A 4FQGA 3KP6A 2K9NA 5M5WJ 3JTHA 5D5WB 3C3WA 2X1DA 3HKZN 2DA1A 4U0WA 3ZR8X 2L4AA 2GA1A 5FB2A 1ZREA 3L9FA 2XIGA 3JRDA 1JJ8C 4Z6YA 3F8FA 1JHHA 2VB6A 3LSIA 5F27A 3OV8A 3PQKA 3I59A 2HVQA 4RB2C 2TRTA 1TTYA 2YU3A 3SEZA 2NVQJ 1Y1VJ 3S93A 3DBRB 3X2QH 3HTUA 3LA2A 1UHMA 2FX0A 4MFEA 2Q2EA 3H0DA 2DN0A 4PJLA 1WCMJ 5GPCA 3ZQ7A 1BJZA 1ZH5A 5TGTA 4L18B 3LQRA 1YYVA 2K27A 1W36C 2OA4A 3BPVA 3K4KA 2DBBA 2W7NA 2QWWA 2COBA 2Y69H 3EETA 5LGNA 3ZN0A 4V2GA 2BHZA 2VOOA 1WSUA 2OC6A 3CJNA 4A3EJ 3GZ6A 2ZCWA 1IN4A 2EV0A 1LFUP 4M71A 2E36A 3REOA 4KIBA 2LK2A 2QQ8A 4MFDA 5TISC 1ETYA 1WVRA 3GBGA 2ZBKA 4CO8A 1DGWY 3GCMA 2KRFA 2D1HA 4E7IA 5KCMA 5DTDA 2M7AA 4ENKA 1JI8A 3M1CA 3K70C 5JHUA 2FQ3A 3WHBA 5GTHC 5DD4A 4FASD 3BCBA 3CUOA 3S32A 3ERED 2O03A 1LVKA 4A0XA 2W24A 2ZJ2A 1F9NA 1ITYA 2XVCA 3CCVI 4UUTA 3WG9A 2ID6A 1FBQA 2ZNZA 4N4NB 1XX5A 2KISA 4F93B 2X9DA 1BOBA 2OZ6A 2EFWA 1T95A 2JWTA 3VYUB 2EH3A 2FRHA 2QBYB 3GTJJ 2K7LA 4QWQA 4YFKF 4OINF 3MZHA 3FX3A 4AIDA 1XMKA 4P9UA 2STWA 3CDIA 1I1GA 3K4JA 1R9TJ 1RNLA 2E7WA 2VBYA 2Z9OA 3E97A 2WAQN 5D8LB 3FF5A 3GUDA 3QPSA 1TQMA 3KLNA 4S0HB 4HQEA 2D5VA 4BQAA 2HXIA 3HB9A 4PGGA 2NOJB 2VT3A 4CCMA 1TBXA 1J09A 2JA2A 1Z3YA 2KT0A 3G1LA 2L7KA 3E6CC 2F5DA 2DFIA 3ML6A 4HOBA 3ESWB 2ETHA 3F6VA 2AO9A 1R1UA 1TZLA 2DCEA 1OR7A 1SVMA 4EEFG 2DYSH 2EJRA 2E7XA 3C2BA 3I4MJ 1WGXA 2P81A 4I01A 1APLC 3H5NA 3GEZA 4CHUA 3VOEA 3CF5F 5IT9Z 2NVXJ 4IHTA 4U0YA 3K1NA 2R7UA 3QPHA 1REPC 3V7SA 3S1NJ 2Y30A 1LB2A 2DLLA 5L3BA 1W7PA 2X48A 1H88C 2WB1N 2A6EF 2MH2A 2NS7A 2CV1A 3N4MA 4OIPF 3IL2A 4IKFA 2E19A 2IT0A 1YW8A 4QSHA 3TBIA 3BR6A 4LLGF 2KQRA 3TW6A 2IEKA 3DKXA 1G3YA 3P9KA 1K79A 1S7AA 1TQPA 3IUOA 1X4OA 1AKHB 3BQZA 1IN7A 2XPWA 2EA4A 2F4MB 1WHUA 3IAM2 3D5SC 3CC7I 3M9AA 1A31A 2KIMA 5EF6A 2VI6A 3AL0B 3QU6A 3IC7A 5KVRA 1K78B 4XLEA 1YLFA 1U0JA 1YE9A 3A1YA 2YS9A 1BI1A 1W0TA 2L3DA 1IGNA 1VQ6I 3NWTA 4XL9A 5F08A 1D0ZA 1IDYA 3HM5A 4NQWB 1FTZA 4G6DA 3Q9SA 4DQ2A 3S3NA 1BN5A 3M1EA 3F8BA 1OCOH 4Q48A 1MBJA 1MMDA 3HTSB 4XSXF 3G1OA 2H1KA 2MC4A 3WGGA 4LK1F 3DKYA 4L5JA 3BWGA 4M3DA 1C0WA 4BACA 2WA0A 2HVRA 4QPOA 2K3PA 4RB1A 1Z67A 3VODA 4ANJA 2LH9A 2R7VA 2EB7A 5J6XA 1V4RA 1N75A 3HOXJ 2Q8KA 1LE8A 4NNJA 3A2KA 2ECBA 4KMUX 2PJRB 4GFBA 1ETQA 4M9SA 1FP2A 1EA3A 1IZ1A 4RB3C 2PG4A 4RS8A 3HBLA 3G2BA 3L00A 4LFUA 1MJBA 2JA5J 2KRHA 2EILH 1YO5C 1WKMA 2G9WA 2HDDA 5J47A 2Y48A 2I10A 4N9HA 5D5XB 1FTTA 4GYGA 1IG7A 3TP3A 2VBZA 1IRGA 2M34A 4BHPA 4CDGA 1S72I 4PSWA 1VFCA 3OYJA 1QRYA 1NK2P 1FOXA 1U5TA 1OCCH 2VKHA 5EGOA 1J75A 2R5ZA 1OQYA 2PMHA 3JRBA 1UHSA 3I4NJ 2IGNA 5D6FA 1QGPA 1UAAA 1G3TA 5AONA 5M5YJ 4AIKA 2LF7A 2LKSA 3ZP5A 1PUEE 1T0FA 4BE1A 1JJ6C 9ANTA 1OISA 3I71A 4OAZA 2CQQA 1G4DA 2V4JC 4MQ9F 1TT0A 5FO5A 3A0HC 3I54A 3M8FA 4IVNA 4BGDA 1FP1D 4OMYA 3ZXSA 4BQNA 5FLXK 3BDDA 2ZMEA 4XLAA 4A5NA 5B1BH 3V7RA 3CCRI 3UKGA 2STTA 1WI9A 2JN6A 5BQTA 5HNHA 4ZYEA 3CJTB 1HKTA 3ZQCA 3GTMJ 4U88A 1I6XA 2X51A 1MMNA 4E7SA 4XLCA 2EV6A 1VQMI 2L9VA 5J4YA 3JRCA 3BR5A 4GDFA 2MBFA 2OCCH 4Y33A 1A35A 2EZLA 4O5VA 5L3GA 4IHSA 4TV7A 4ZDPA 1Z05A 4MHGA 3NRVA 3H5AA 3VSLA 1XN7A 3LAJA 1U6GA 3QP5A 1QVTA 3NARA 4NBQA 2FJ1A 3U1DA 3EUHC 3HUGA 3QQAA 3S14J 2A68F 3AG2H 1I6HJ 3SZGA 4CSWA 4DW6A 3HOTA 3OYGA 3PNTA 3DFGA 3P5JA 3R60A 5CJ9A 2ISZA 2UXXA 3GYHX 1IN6A 2NOGA 2CW8A 4BXUA 2KDOA 1HBXG 2K40A 2AQEA 4PCQA 2GM4A 2Z33A 2CWEA 3PUBA 2R0QC 4M3EA 2W85A 2KL4A 2ZSIB 3IAS2 2F5EA 1O7FA 2X85A 2RAEA 3T8RA 1DP7P 1IUFA 4HZFA 3N97A 3CCQI 3ABUA 3CMEI 4KDPA 4E7JA 5IP6A 1J7KA 3HIFA 2DA5A 1BBYA 2MSYA 1RRJA 1TW2A 2AXTC 4IRIA 3K4MA 5BS6A 4DYRA 1MDMA 1Z6RA 4D1QA 1HW1A 2RN7A 2DMNA 3E6BA 2DMPA 3KEOA 2IRFG 1N25A 2FOKA 2K4JA 3LL7A 4PDKA 1X1BA 2R5YA 5LHHA 1PYVA 1S5LC 1DP3A 1BIAA 1JE8A 5E79C 1TNSA 4HNTA 3GFMA 4AWXB 3OYCA 1I5ZA 4IX7A 3FMQA 3OL3A 3S17J 2LLKA 4EMSA 1ULYA 3QOPA 3G4SI 2L54A 2L9NA 4HYEA 3FXKA 3F23A 1Y39A 2EQRA 2M3AA 1MSEC 4M6YA 1JT6A 1YS6A 1W5SA 2GQQA 5K5QA 2QEXI 1MMSA 1VNDA 1XTAA 3OYAA 6PAXA 4ZC3A 1UB9A 1KA8A 5HODA 1LE8B 3VSKA 3F8CA 3PFYA 5F0FA 2Z3YA 3ULQB 2M30A 4RMNA 1Z7UA 4L5EA 2LY1A 2RVCA 2O8KA 1OCTC 2R7TA 5DYMA 4N9IA 1B9NA 2JPCA 3P9IA 1R4MB 2MW8A 3KYLA 1YI2I 4ESFA 2B0LA 3BROA 4D0PA 2FU4A 2EIMH 3DU6A 3WGIA 2RNJA 3ZMDA 2X6XA 4XORA 3FM3A 1I50J 2NXNB 2ZO4A 2XGDA 2HFHA 1A5JA 1SD7A 1JGSA 4DGWB 1FMVA 1LFBA 4J01A 1L3LA 4CCKA 3LFUA 2Y0SN 1VQ4I 2R4GA 2L01A 5DD8A 2PFBA 3JR9A 4UB6C 1R6RA 3WTSC 3KEYA 2HVSA 1I39A 2E1NA 2JTVA 2BZTA 4PJJA 5L3FA 3I56I 4UB8C 4C2TA 3WTZA 2OZUA 3CCYA 1BI3A 3U9GA 1K7AA 5E1WA 1I3AA 5F1RA 3GO5A 3V7CA 2DOEA 1WJDA 1VQKI 2VJ4A 1V5FA 1B72A 1X19A 1OCZH 1FIAA 2K9QA 2MD0A 3H36A 5IP7J 2DPUA 2V6EA 2Z1DA 2I8DA 5JVGF 4RAGA 3JSPA 2ADUA 3OIOA 4WXDA 2JMWA 1IXCA 1OLTA 2EIJH 3SDGA 3KZYA 4DZPA 5D6EA 1KQ0A 2LC2A 5L3DA 3L2WA 4IOAF 4XN3A 5JI6A 5F6FA 2GOXB 2R7FA 2R3SA 1IN5A 3CO7C 1TW3A 1B1BA 3HUGB 5E3NA 1NH3A 2DQLA 3EPZA 3SHFA 3TL4X 3AG1H 3EUKL 2ZNYA 3FZVA 1MH3A 3K7AJ 4BUPA 3SFIA 5TJJA 4CCLA 1JKQC 2KHMA 1MBGA 1WJ5A 2LVSA 2IW5A 3CMMA 4LLNA 1NTCA 2MD5A 3WGHA 3WODF 1WPKA 3ZQIA 1A6QA 1IW7F 1KQ8A 2JUGA 1ETVA 4PJMA 1ZAOA 5LD2C 5B5EC 3J7ZI 1FPQA 2UV1A 1X1DA 2ZFWA 3DWLE 1V3FA 1GUUA 2DK8A 2QVOA 4XQFA 3O8GA 1BOAA 1IUYA 1WH7A 3ONQA 4BH9A 4KYWA 2VOPA 1TL8A 4B44A 1T8IA 3PFIA 2J5OA 3T1BA 3SXYA 4S04A 3JSOA 1OCRH 3W2WA 2CSOA 4A0YA 3GF2A 3QODA 5EDNA 4RM2A 2XGXA 4XRSA 1R5HA 3HHGA 2FQ4A 1KYWA 3ABKH 3D1NI 1R71A 2V1NA 2DXIA 1IV6A 4G7OF 2DT6A 5BPIA 5ILSA 2YSRA 4H0EA 2DQRA 2WADA 4YRVA 2NAZA 2DA2A 5IT9K 3BG7A 4Z2YA 3AAFA 4IF4A 4NDLA 3W2AA 4UVCA 4YELA 2IA2A 2EZKA 3J80Z 2Y0MA 1LPQA 2O0YA 3H3UA 3K4BA 4CCOA 3ZQGA 4NHJA 1JUPA 4YG2F 2JA7J 1YOVB 3BJOA 4PJ0C 1PVEA 1ZKGA 5HS8A 3DEWA 2WY8Q 4I09A 4FTHA 4ZDOA 2CV0A 1I27A 4CCNA 1XSDA 1P7JA 1BW6A 1FSEA 2BY1A 4C30A 3F22A 1BC8C 2LNBA 4BYYA 3BOQA 3F3XA 5EEAA 4LIVA 3KEQA 1FYKA 2VLAA 2VJ5A 2M8EA 3OYHA 1QNTA 4LLLA 1LDJA 1BW5A 3GFJA 3MVPA 2VJIA 3TO6A 2BE5F 4M3BA 2XAUA 1ZARA 3IHUA 3A0BC 3LSPA 2QBYA 3FIWA 4QTRA 1SVLA 4BQOA 5ICFA 3S8PA 1HLVA 4M3FA 1XSXA 3OWTA 3IP4B 3SJMA 2OJED 1QBJA 2V1UA 2Y2ZA 4HX8A 4LK0F 1XCVA 1R4NB 1XDUA 3K0LA 4BXFA 4BY1J 2JK3A 4BJ6C 1ZLKA 4JBAA 3G1MA 2VT2A 3HRUA 4JX6A 2JJ7A 4YIRX 1KU7A 2QCOA 1IF1A 4X0GA 3S3MA 3JRFA 4M6XA 1Z7LA 1Z6TA 1FC3A 2QYOA 2BXZA 2KLOA 2W1OA 2FMYA 5CVVA 5ICEA 5J4VA 2BGCA 1WZ2A 1GHCA 4UV8A 3LSRA 2Y31A 4AYBN 2P6TA 4BXXJ 1RKWA 1OR7C 2BVMA 4L0YB 4UHTA 4UY8I 3RI4A 5IY5H 3RYRA 3FMRA 4JX5A 4LD5A 4V2FA 1B4AA 1D0XA 2Q1ZB 4DYQA 1XS9A 2O3FA 2O8XA 4NC8A 1ZYRF 2VC1A 2DPDA 4HV6A 3TO9A 5BMZA 3RSNA 1XGMA 1EH6A 3OL4A 4JP0A 1O3RA 2HPIA 1B9MA 3HGGA 1H9TA 2WC2A 2VJJA 1ZG1A 4KJZA 4EV0A 1SD6A 3U2RA 1R36A 4BDZA 3LSJA 1GXQA 1AKHA 1G3SA 3CCJI 3F21A 5C4JJ 1G8XA 4FISA 3ZQLA 1OYIA 3HOYJ 2OAZA 3E5QA 3S2HJ 3RCOA 2VKDA 3BR3A 5EYRA 5FD6A 2FF4A 5J8FA 3OYEA 4MGRA 1EH7A 3OYNA 1K78A 1ON1A 1P4WA 1IDZA 3K9TA 3J7AO 5CVIA 1WJFA 1Y1WJ 3Q0VA 2R7XA 4NQWA 3HOWJ 2RKHA 3DQVC 4RAYA 3A01A 2H1LA 5DCFA 3L09A 4LB6B 4D5FA 2M0CA 1X3ZB 2GBYA 3KE2A 2CFOA 1WH5A 4KIFA 2IGOA 1SAUA 2LY2A 4HX7A 3WTXC 3MQ0A 2NS0A 2CQ7A 2V9KA 3HC7A 2OF7A 3BY6A 3OYMA 3KLOA 2LR8A 3WU1B 4RA2A 4D7MA 1FSHA 1S6LA 5A2QK 3RKXA 2K9SA 4KA4A 3SYTA 1A6IA 2ZSHB 3O3KA 4IRHA 1T98A 3WTYC 2LKPA 2DU9A 4HEA2 3CESA 1ORKA 2PJRA 1V54H 5DCMB 3PSIA 1VQNI 3BJAA 2L5QA 4XOTA 3M8EA 3IH2A 1YRNB 1RR8C 2ZJRF 2CUEA 5EZHA 3I53A 2D45A 4N4OB 2VPRA 3FDYA 3LA7A 2JA8J 2H94A 2XROA 2LDUA 1BR1A 2P5KA 1R00A 1ETXA 2E60A 1U5TC 3KZZA 2A5WA 1KGSA 2GZWA 4LIUA 2OD5A 2KDZA 1N78A 2AS5F 4BEHA 1QHHD 4MO7A 5CVRA 3H35A 3C2HA 1YX3A 3PNVA 2NS8A 1T0FC 4G6QA 1F4KA 4DZJA 1A04A 2ZXJA 1HSTA 2DDAA 3F6OA 2FOWA 1S8NA 2W57A 2W25A 1ZGWA 2FSWA 1TWAJ 3A03A 5LEKA 4RGRA 2HU9A 1DUXC 4HRIA 2GIVA 2ZMEC 4GYIA 1Y8QB 4CH7A 2IJLA 3QYFA 2R7QA 4L5IA 1R5GA 2XAGA 4MTDA 4UVBA 1BA5A 2LFBA 3BG6A 1YQAA 4CGZA 2MH9A 4ZTJA 5J3LA 3SDBA 3P7NA 3WTTC 1PP8F 1MSFC 5IOYA 2BY0A 1BR4A 2HQAA 2AXLA 2EFOA 2VN2A 1S29A 2UUZA 2VODA 3E1SA 4UXNA 4XONA 1WI3A 4M73A 2CUFA 4P55A 4G9YA 3SZPA 4C3JJ 4X1EA 2A61A 4AD9A 4HNVA 4MTEA 3ZN1A 3IKVA 2OV7A 2E1CA 3KCCA 3WHCA 2CG4A 2YU9J 2R7SA 2RV8A 2Y75A 2DA3A 3BJ6A 3GTOJ 4BU2A 2XPVA 3K4CA 1U9OA 2LYCA 2OTLI 4EGYA 1JTYA 3FKJA 1J9IA 3AG4H 4MLOA 1FLIA 2W48A 4KMFA 4IQJA 1XPXA 4A69C 1MJ9A 3KYDB 4YEJA 2WY7Q 2MYSA 3NQOA 4IRGA 3CJQB 1GLNA 4BDYA 3MZ8A 2XGEA 2V9VA 4C2UA 1B6AA 5LGUA 1RUOA 1VQ7I 3RPUD 2KZGA 5J1RA 3H92A 4ENNA 3PJRA 4YFNF 5F04A 2HS5A 4F92B 4BE0A 3DPTA 4OU0A 2LD5A 1WJBA 3WTUC 4IXAA 1TWHJ 3A01B 2XAHA 1V5EA 3GWZA 3WTVC 1U78A 1JKOC 4E7LA 3DPLC 2KP6A 2KIUA 1T56A 2GAUA 5FRMA 3CMAI 3ERMA 3T8TA 4QIWN 2E1MB 1DPRA 3HPGA 5EG0B 3KP2A 1IAWA 5LGTA 4EGZA 2FMLA 2ACJA 4EVIA 1FWZA 3F0CA 5M3FJ 3MKZA 1XG1A 2O61A 1RPWA 2K5CA 2PX9A 2HWVA 3ASOH 1FOYA 2XF7A 2QKMB 2I5UA 2LREA 3K4LA 3JW4A 1E17A 1USTA 3JRIA 1ON2A 5KK1A 1D3YA 3ABTA 3GZNB 4EJOA 1AOYA 4G6TB 2B7EA 2WBMA 3I4PA 1D8KA 3KPHA 4D5CA 4XMYA 4XKWA 2EWNA 3QAHA 1RIOH 5HOOA 4PFOA 2GIZA 2K9MA 1X1CA 2NYXA 1DU0A 1Z3XA 5FFXA 3OIPA 1MZBA 5FJ8J 3H5RA 4Q4ZF 1H8AC 2XSJC 3KZIC 3LMMA 4CYCB 2CMPA 2VQLA 1K61A 4AVPA 4A93J 2AQFA 5K7FA 4BEHB 4XKBA 5D5UB 5E20A 2V1DA 4OOIA 3SZTA 1SMTA 2MG4A 3MCZA 1X58A 3BR1A 4WXHA 5E8IA 5M3MJ 4YIFA 1LFPA 2BXYA
chains in the Genus database with same CATH topology
2IAIA 5GPAA 1MNMC 2EZHA 4A3MJ 1HDDC 4AC0A 2EBIA 3E7LA 3B6AA 3CCYA 3LOCA 3IH3A 2L7ZA 1NK3P 3ZQHA 2NVYJ 3FKIJ 4RBOA 5M5XJ 1B72A 3GTLJ 1FIAA 2K9QA 5IP7J 1TWCJ 3GTGJ 1B72B 1DU6A 1Q1VA 5C44J 4FCYA 3NAUA 2ZB9A 4B4CA 1GDTA 5J1YA 5JLWA 3OIOA 2JMWA 3TW7A 4IHXA 3SDGA 5K7HA 2YUSA 4DZPA 5F1JA 4C3IJ 2DA6A 3DCFA 3H3VK 1JKPC 3S15J 2HOSA 2Y9YA 4C3HJ 4M6VA 2ELKA 2IBDA 1FIPA 2JA6J 2CRGA 3CDLA 5E3NA 1SANA 4XRMA 1MBHA 3PO3J 1F43A 3RKQA 1MH3A 3K7AJ 5E3OA 3SFIA 4A3GJ 1JKQC 5C4XJ 3HDDA 1MBGA 5F0CA 1MBKA 1TWFJ 3BR0A 4XIDA 2K9NA 1RETA 5M5WJ 2LVSA 1NTCA 3HKZN 2DA1A 5E3MA 3S1MJ 2M9HA 1WPKA 3ZQIA 1VF9A 3S2DJ 3M4OJ 3JRDA 4BBRJ 3BG5A 1JJ8C 1ETVA 1QVUA 2O7OA 1JUSA 1B8IA 1TWGJ 5F27A 3S16J 1GUUA 1MH4A 2TRTA 4A3IJ 1B8IB 1BL0A 3O8GA 1WH7A 2NVQJ 3CQZJ 1Y1VJ 4JX4A 2G0EA 2FX0A 3A02A 4MFEA 1PUFB 3BTIA 2DN0A 1WCMJ 5GPCA 5EDNA 1BJZA 4XRSA 2FD5A 1ZR4A 2FQ4A 3D1NI 3HGYA 1IV6A 2COBA 2XPUA 4V2GA 2DMQA 3JRHA 2DA2A 3BTLA 4A3EJ 5E3LA 4NDLA 3S1RJ 1LFUP 2EZKA 2WV1A 2LK2A 4MFDA 3ZQGA 1ETYA 2VKEA 1JUPA 2HOAA 3GBGA 5F0HA 2JA7J 3BG9A 1ZKGA 2HYJA 3DEWA 4FTHA 1UG2A 3BTCA 5DTDA 3K2AA 1P7JA 1BW6A 3WHBA 5EEAA 2XRLA 4UUSA 4UUSB 3OSFA 1ITYA 5BNGA 1BW5A 2HXOA 4UUTA 3ZOBA 1HF0A 3MVPA 2ID6A 4M3BA 2X9DA 3LSPA 1GV2A 3RQIA 3PO2J 3FIWA 3TP0A 4QTRA 2JWTA 2EH3A 5EZGA 1HLVA 3PM1A 4M3FA 3GTJJ 2DTZA 3SJMA 2HOTA 1FEXA 2Y2ZA 1IJWC 2EZIA 1ENHA 1GT0C 2MGQA 2Y9ZA 4J19A 1UMQA 4BY1J 3HEFA 2JK3A 3HOUJ 3FISA 3G1MA 4XK4A 4JX6A 2JJ7A 1R9TJ 1GV5A 2QCOA 2L9RA 2WAQN 3OOUA 3QPSA 3JRGA 4JYKA 4S0HB 1IC8A 3JRFA 2D5VA 2HXIA 4IEJA 3HB9A 1HOMA 1U8BA 4LOCA 2TCTA 4W1UA 3TEDA 2KT0A 3G1LA 3LSRA 4A3CJ 2Y31A 4AYBN 1JT0A 4A3BJ 4BXXJ 1RKWA 2AO9A 1S7EA 4EEFG 2R92J 1FJLA 3LNQA 3C2BA 3I4MJ 1WGXA 2B63J 1OJLA 2P81A 4JX5A 4V2FA 3B6CA 1APLC 2N8GA 4DYQA 2O9LA 1XS9A 2NVXJ 3Q3SA 3S1NJ 2Y30A 1OFCX 2L7MP 2X48A 2XGCA 3ZQFA 1H88C 1I3QJ 2WB1N 4FE7A 4A3FJ 4JP0A 2NS7A 1JKRC 3HGGA 2E19A 5FLMJ 3VPRA 1T33A 4QSHA 3BR6A 3TW6A 1OCPA 3LSJA 1JUMA 2IEKA 4BY7J 1AKHA 5C4JJ 1AKHB 3BQZA 2XPWA 4FISA 3ZQLA 3HOYJ 2R7ZJ 1ETOA 3S2HJ 2DJNA 5EYRA 3BR3A 1GVDA 1XC5A 4XRSG 5EF6A 2VI6A 3MN2A 1IDZA 3JRAA 2LTPA 1RKTA 2X6OA 1Y1WJ 2YS9A 3Q0VA 3HOWJ 2E1OA 2XB5A 3A01A 1W0TA 1IGNA 1JGGA 5F08A 4D5FA 1IDYA 2M0CA 3HM5A 2DA7A 2QF7A 2GBYA 1QPIA 1FTZA 1WH5A 2H8RA 2DMTA 4AUXA 1ZQ3P 3H0GJ 2CU7A 5IYCJ 1MBJA 4A3JJ 4A3KJ 3LSGA 1EF4A 3G1OA 2H1KA 2OF7A 3QPLA 2LR8A 4D7MA 4BKXA 1D5YA 2K9SA 4M3DA 1A6IA 5IPAA 5FLVA 1X2NA 3GTQJ 5C3EJ 3HOXJ 1LE8A 1ORKA 3Q0UA 2ECBA 2VKVA 5FKNA 1YRNA 2R93J 4D7NA 1ETQA 3BT9A 4GFBA 3IV5A 3IH2A 1YRNB 5FKMA 2CUEA 4FE4A 3HBLA 5EZHA 1ETWA 2JA5J 1VI0A 2VPRA 3M3YJ 2JA8J 2HDDA 5FKOA 4MIMA 1FTTA 2I10A 1IG7A 3TP3A 1ZTRA 2M34A 5K7ZA 3GTPJ 1ETXA 1VFCA 1QRYA 1NK2P 4M3GA 3BTJA 2KDZA 5EGOA 2R5ZA 4MO7A 3JRBA 1UHSA 1AHDP 3I4NJ 5EGOB 4DYCA 2R5ZB 2NS8A 5M5YJ 1JJ6C 4DZJA 1MBFA 9ANTA 5IYDJ 2CQQA 1ZGWA 1JTXA 1W0UA 1TWAJ 4A3DJ 2ID3A 3A03A 4Y7NJ 1MBEA 2XSDC 2LP0A 3GTKJ 3UKGA 2ECCA 2JN6A 1H89C 1O4XA 2HI3A 2LFBA 1BA5A 5J3LA 3ZQCA 3GTMJ 1AU7A 1MSFC 3CMYA 5IOYA 3JRCA 3BR5A 1Z77A 2L0KA 2L7FP 3OSGA 4G12A 2EZLA 4IHWA 1WI3A 2CUFA 2ME0A 3JREA 5FKLA 4C3JJ 5DS9A 4X1EA 2M8GX 4HNVA 2M2EA 1HDPA 1QVTA 3NARA 2FJ1A 2AHQA 3QQAA 3S14J 1RESA 3WHCA 3S1QJ 2YU9J 1I6HJ 3GTOJ 2DA3A 4DW6A 1G2HA 2XPVA 1U9OA 2DA4A 5JLXA 2NOGA 4IHVA 1JTYA 2K40A 2GM4A 4MLOA 2W48A 3L1PA 2R0QC 4M3EA 4A69C 3RZOJ 2GLOA 2E2HJ 2RAEA 1IUFA 4W97A 5GP9A 5IP6A 4BBSJ 2DA5A 2XGEA 1HCRA 2MSYA 1TC3C 4DYRA 5J1RA 2DMNA 2DMPA 1CQTA 5F04A 5IP9J 2LD5A 2R5YA 1P7IA 1TWHJ 3FK6A 3A01B 5IYBJ 1Z0XA 4RDUA 2HQ5A 2R5YB 1U78A 1JKOC 1ZK8A 1T56A 2LKXA 5EG0A 3RZDJ 2CJJA 2DMUA 1PUFA 3S17J 4QIWN 2LLKA 5EG0B 2CQXA 1E3OC 2LY9A 5J1UA 4B3AA 4B1RA 2NVTJ 2EQRA 3F0CA 5M3FJ 1MSEC 1XG1A 1JT6A 1RPWA 2ME6A 5FKKA 2XB0X 1X2MA 1VNDA 3HOVJ 1K83J 5HODA 4C2MJ 1IRZA 1LE8B 3JRIA 5IOZA 5F0FA 1RR7A 1POGA 3O8HA 4L5EA 2O8KA 1OCTC 1U9NA 4D5CA 3W6VA 1SFOJ 4A3LJ 2PMZN 2MW8A 3MKLA 2OPTA 1DU0A 4I6ZA 1ETKA 3BG3A 2E2JJ 3BQYA 4CYCA 5FJ8J 4ABZA 4X6AJ 1I50J 1ZR2A 3FK7A 1H8AC 4CYCB 2XGDA 1A5JA 4A93J 1K61A 4XICA 1F36A 4IHYA 2VUMJ 1LFBA 3BR2A 5K7FA 4Y52J 2Y0SN 2MG4A 1X58A 3BR1A 2E2IJ 4I76A 5M3MJ 3Q0WA 3JR9A 3IH4A 3HOZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAI A;  5GPA A;  1MNM C;  2EZH A;  4A3M J;  1HDD C;  4AC0 A;  2EBI A;  3E7L A;  3B6A A;  3CCY A;  3LOC A;  3IH3 A;  2L7Z A;  1NK3 P;  3ZQH A;  2NVY J;  3FKI J;  4RBO A;  5M5X J;  1B72 A;  3GTL J;  1FIA A;  2K9Q A;  5IP7 J;  1TWC J;  3GTG J;  1B72 B;  1DU6 A;  1Q1V A;  5C44 J;  4FCY A;  3NAU A;  2ZB9 A;  4B4C A;  1GDT A;  5J1Y A;  5JLW A;  3OIO A;  2JMW A;  3TW7 A;  4IHX A;  3SDG A;  5K7H A;  2YUS A;  4DZP A;  5F1J A;  4C3I J;  2DA6 A;  3DCF A;  3H3V K;  1JKP C;  3S15 J;  2HOS A;  2Y9Y A;  4C3H J;  4M6V A;  2ELK A;  2IBD A;  1FIP A;  2JA6 J;  2CRG A;  3CDL A;  5E3N A;  1SAN A;  4XRM A;  1MBH A;  3PO3 J;  1F43 A;  3RKQ A;  1MH3 A;  3K7A J;  5E3O A;  3SFI A;  4A3G J;  1JKQ C;  5C4X J;  3HDD A;  1MBG A;  5F0C A;  1MBK A;  1TWF J;  3BR0 A;  4XID A;  2K9N A;  1RET A;  5M5W J;  2LVS A;  1NTC A;  3HKZ N;  2DA1 A;  5E3M A;  3S1M J;  2M9H A;  1WPK A;  3ZQI A;  1VF9 A;  3S2D J;  3M4O J;  3JRD A;  4BBR J;  3BG5 A;  1JJ8 C;  1ETV A;  1QVU A;  2O7O A;  1JUS A;  1B8I A;  1TWG J;  5F27 A;  3S16 J;  1GUU A;  1MH4 A;  2TRT A;  4A3I J;  1B8I B;  1BL0 A;  3O8G A;  1WH7 A;  2NVQ J;  3CQZ J;  1Y1V J;  4JX4 A;  2G0E A;  2FX0 A;  3A02 A;  4MFE A;  1PUF B;  3BTI A;  2DN0 A;  1WCM J;  5GPC A;  5EDN A;  1BJZ A;  4XRS A;  2FD5 A;  1ZR4 A;  2FQ4 A;  3D1N I;  3HGY A;  1IV6 A;  2COB A;  2XPU A;  4V2G A;  2DMQ A;  3JRH A;  2DA2 A;  3BTL A;  4A3E J;  5E3L A;  4NDL A;  3S1R J;  1LFU P;  2EZK A;  2WV1 A;  2LK2 A;  4MFD A;  3ZQG A;  1ETY A;  2VKE A;  1JUP A;  2HOA A;  3GBG A;  5F0H A;  2JA7 J;  3BG9 A;  1ZKG A;  2HYJ A;  3DEW A;  4FTH A;  1UG2 A;  3BTC A;  5DTD A;  3K2A A;  1P7J A;  1BW6 A;  3WHB A;  5EEA A;  2XRL A;  4UUS A;  4UUS B;  3OSF A;  1ITY A;  5BNG A;  1BW5 A;  2HXO A;  4UUT A;  3ZOB A;  1HF0 A;  3MVP A;  2ID6 A;  4M3B A;  2X9D A;  3LSP A;  1GV2 A;  3RQI A;  3PO2 J;  3FIW A;  3TP0 A;  4QTR A;  2JWT A;  2EH3 A;  5EZG A;  1HLV A;  3PM1 A;  4M3F A;  3GTJ J;  2DTZ A;  3SJM A;  2HOT A;  1FEX A;  2Y2Z A;  1IJW C;  2EZI A;  1ENH A;  1GT0 C;  2MGQ A;  2Y9Z A;  4J19 A;  1UMQ A;  4BY1 J;  3HEF A;  2JK3 A;  3HOU J;  3FIS A;  3G1M A;  4XK4 A;  4JX6 A;  2JJ7 A;  1R9T J;  1GV5 A;  2QCO A;  2L9R A;  2WAQ N;  3OOU A;  3QPS A;  3JRG A;  4JYK A;  4S0H B;  1IC8 A;  3JRF A;  2D5V A;  2HXI A;  4IEJ A;  3HB9 A;  1HOM A;  1U8B A;  4LOC A;  2TCT A;  4W1U A;  3TED A;  2KT0 A;  3G1L A;  3LSR A;  4A3C J;  2Y31 A;  4AYB N;  1JT0 A;  4A3B J;  4BXX J;  1RKW A;  2AO9 A;  1S7E A;  4EEF G;  2R92 J;  1FJL A;  3LNQ A;  3C2B A;  3I4M J;  1WGX A;  2B63 J;  1OJL A;  2P81 A;  4JX5 A;  4V2F A;  3B6C A;  1APL C;  2N8G A;  4DYQ A;  2O9L A;  1XS9 A;  2NVX J;  3Q3S A;  3S1N J;  2Y30 A;  1OFC X;  2L7M P;  2X48 A;  2XGC A;  3ZQF A;  1H88 C;  1I3Q J;  2WB1 N;  4FE7 A;  4A3F J;  4JP0 A;  2NS7 A;  1JKR C;  3HGG A;  2E19 A;  5FLM J;  3VPR A;  1T33 A;  4QSH A;  3BR6 A;  3TW6 A;  1OCP A;  3LSJ A;  1JUM A;  2IEK A;  4BY7 J;  1AKH A;  5C4J J;  1AKH B;  3BQZ A;  2XPW A;  4FIS A;  3ZQL A;  3HOY J;  2R7Z J;  1ETO A;  3S2H J;  2DJN A;  5EYR A;  3BR3 A;  1GVD A;  1XC5 A;  4XRS G;  5EF6 A;  2VI6 A;  3MN2 A;  1IDZ A;  3JRA A;  2LTP A;  1RKT A;  2X6O A;  1Y1W J;  2YS9 A;  3Q0V A;  3HOW J;  2E1O A;  2XB5 A;  3A01 A;  1W0T A;  1IGN A;  1JGG A;  5F08 A;  4D5F A;  1IDY A;  2M0C A;  3HM5 A;  2DA7 A;  2QF7 A;  2GBY A;  1QPI A;  1FTZ A;  1WH5 A;  2H8R A;  2DMT A;  4AUX A;  1ZQ3 P;  3H0G J;  2CU7 A;  5IYC J;  1MBJ A;  4A3J J;  4A3K J;  3LSG A;  1EF4 A;  3G1O A;  2H1K A;  2OF7 A;  3QPL A;  2LR8 A;  4D7M A;  4BKX A;  1D5Y A;  2K9S A;  4M3D A;  1A6I A;  5IPA A;  5FLV A;  1X2N A;  3GTQ J;  5C3E J;  3HOX J;  1LE8 A;  1ORK A;  3Q0U A;  2ECB A;  2VKV A;  5FKN A;  1YRN A;  2R93 J;  4D7N A;  1ETQ A;  3BT9 A;  4GFB A;  3IV5 A;  3IH2 A;  1YRN B;  5FKM A;  2CUE A;  4FE4 A;  3HBL A;  5EZH A;  1ETW A;  2JA5 J;  1VI0 A;  2VPR A;  3M3Y J;  2JA8 J;  2HDD A;  5FKO A;  4MIM A;  1FTT A;  2I10 A;  1IG7 A;  3TP3 A;  1ZTR A;  2M34 A;  5K7Z A;  3GTP J;  1ETX A;  1VFC A;  1QRY A;  1NK2 P;  4M3G A;  3BTJ A;  2KDZ A;  5EGO A;  2R5Z A;  4MO7 A;  3JRB A;  1UHS A;  1AHD P;  3I4N J;  5EGO B;  4DYC A;  2R5Z B;  2NS8 A;  5M5Y J;  1JJ6 C;  4DZJ A;  1MBF A;  9ANT A;  5IYD J;  2CQQ A;  1ZGW A;  1JTX A;  1W0U A;  1TWA J;  4A3D J;  2ID3 A;  3A03 A;  4Y7N J;  1MBE A;  2XSD C;  2LP0 A;  3GTK J;  3UKG A;  2ECC A;  2JN6 A;  1H89 C;  1O4X A;  2HI3 A;  2LFB A;  1BA5 A;  5J3L A;  3ZQC A;  3GTM J;  1AU7 A;  1MSF C;  3CMY A;  5IOY A;  3JRC A;  3BR5 A;  1Z77 A;  2L0K A;  2L7F P;  3OSG A;  4G12 A;  2EZL A;  4IHW A;  1WI3 A;  2CUF A;  2ME0 A;  3JRE A;  5FKL A;  4C3J J;  5DS9 A;  4X1E A;  2M8G X;  4HNV A;  2M2E A;  1HDP A;  1QVT A;  3NAR A;  2FJ1 A;  2AHQ A;  3QQA A;  3S14 J;  1RES A;  3WHC A;  3S1Q J;  2YU9 J;  1I6H J;  3GTO J;  2DA3 A;  4DW6 A;  1G2H A;  2XPV A;  1U9O A;  2DA4 A;  5JLX A;  2NOG A;  4IHV A;  1JTY A;  2K40 A;  2GM4 A;  4MLO A;  2W48 A;  3L1P A;  2R0Q C;  4M3E A;  4A69 C;  3RZO J;  2GLO A;  2E2H J;  2RAE A;  1IUF A;  4W97 A;  5GP9 A;  5IP6 A;  4BBS J;  2DA5 A;  2XGE A;  1HCR A;  2MSY A;  1TC3 C;  4DYR A;  5J1R A;  2DMN A;  2DMP A;  1CQT A;  5F04 A;  5IP9 J;  2LD5 A;  2R5Y A;  1P7I A;  1TWH J;  3FK6 A;  3A01 B;  5IYB J;  1Z0X A;  4RDU A;  2HQ5 A;  2R5Y B;  1U78 A;  1JKO C;  1ZK8 A;  1T56 A;  2LKX A;  5EG0 A;  3RZD J;  2CJJ A;  2DMU A;  1PUF A;  3S17 J;  4QIW N;  2LLK A;  5EG0 B;  2CQX A;  1E3O C;  2LY9 A;  5J1U A;  4B3A A;  4B1R A;  2NVT J;  2EQR A;  3F0C A;  5M3F J;  1MSE C;  1XG1 A;  1JT6 A;  1RPW A;  2ME6 A;  5FKK A;  2XB0 X;  1X2M A;  1VND A;  3HOV J;  1K83 J;  5HOD A;  4C2M J;  1IRZ A;  1LE8 B;  3JRI A;  5IOZ A;  5F0F A;  1RR7 A;  1POG A;  3O8H A;  4L5E A;  2O8K A;  1OCT C;  1U9N A;  4D5C A;  3W6V A;  1SFO J;  4A3L J;  2PMZ N;  2MW8 A;  3MKL A;  2OPT A;  1DU0 A;  4I6Z A;  1ETK A;  3BG3 A;  2E2J J;  3BQY A;  4CYC A;  5FJ8 J;  4ABZ A;  4X6A J;  1I50 J;  1ZR2 A;  3FK7 A;  1H8A C;  4CYC B;  2XGD A;  1A5J A;  4A93 J;  1K61 A;  4XIC A;  1F36 A;  4IHY A;  2VUM J;  1LFB A;  3BR2 A;  5K7F A;  4Y52 J;  2Y0S N;  2MG4 A;  1X58 A;  3BR1 A;  2E2I J;  4I76 A;  5M3M J;  3Q0W A;  3JR9 A;  3IH4 A;  3HOZ J; 
#chains in the Genus database with same CATH topology
 1DPU A;  1P92 A;  2EK5 A;  2KFD A;  2HEO A;  4A6D A;  2M1B A;  3LOC A;  2DT7 B;  3FXQ A;  3DU5 A;  4DNC A;  1XGO A;  2JSP A;  2NVY J;  3LQQ A;  2DTR A;  4U7D A;  1LEB A;  2VC0 A;  4NC7 A;  5M5X J;  3LAP A;  4EM0 B;  2BY2 A;  2VBW A;  1R5I D;  5HS9 A;  3L2Q A;  1TWC J;  1YS7 A;  5CQE A;  2R7D A;  3J80 K;  5HVQ C;  2NRA C;  3HSE A;  1B59 A;  2ZB9 A;  2H8W A;  3NAU A;  4CZZ A;  2GWR A;  2QM3 A;  2FXA A;  1WQ2 A;  3I5U A;  5K7H A;  2CS3 A;  4EJT A;  3IRQ A;  4CUG A;  3DCF A;  3H3V K;  3EDP A;  3S15 J;  5TRD A;  4C3H J;  3GXO A;  5A2Q Z;  2O6G E;  2IBD A;  3GVA A;  3HRM A;  2K86 A;  3KYC B;  2HYF A;  4RLF A;  3MFK A;  4Q47 A;  5HLI A;  3H9G A;  2DOA A;  1F1Z A;  5E3O A;  4A3G J;  5C4X J;  3HDD A;  4I98 B;  4PJN A;  1RET A;  1P6R A;  5HNF A;  1LUJ B;  4XLP F;  5E3M A;  3GFI A;  4I0B A;  2M9H A;  3M4O J;  1MMA A;  1W36 D;  1SAX A;  1CF7 B;  3S2D J;  4C9Y A;  1S3J A;  4BBR J;  3SFZ A;  1QVU A;  1TWG J;  3S16 J;  5EEG A;  3FHN A;  2BV6 A;  1B8I B;  4E7K A;  1BL0 A;  1VZ0 A;  3CQZ J;  2K4B A;  4I02 A;  3CD6 I;  4B8X A;  3FHZ A;  4HF1 A;  4E7Z A;  5L3C A;  3W6J B;  2ZXW H;  3LSM A;  1A36 A;  4L9V A;  4JK1 X;  3IRR A;  4LGW A;  3CCM I;  3BTI A;  4JOM A;  1IV8 A;  3DBL B;  3FXJ A;  3R0A A;  1MD0 A;  2LMD A;  5EJC A;  4WF2 A;  2FD5 A;  1VQ9 I;  1VTN C;  1O3Q A;  5ERI A;  2WWY A;  3V42 A;  3PSF A;  3R61 A;  2XDV A;  1XGS A;  3VEP A;  3UR3 C;  2DMQ A;  3JRH A;  1ZEL A;  5B1A H;  3K2Z A;  3BTL A;  2BVL A;  2XAF A;  1KYZ A;  1XDS A;  1IRX A;  1M1E B;  4I99 C;  3ZMT A;  3SEQ A;  1ZLJ A;  4P9F A;  1E3H A;  4RGX A;  1Z21 A;  1TP4 A;  1KZH A;  2VKE A;  2HOA A;  2A6H F;  2K02 A;  2OTJ I;  4I7H A;  3BC8 A;  1UG2 A;  4BQQ A;  3BTC A;  5FD5 A;  3K2A A;  5CVU A;  2NNY A;  2E35 A;  3CC4 I;  4PGH A;  2M7B A;  1UCR A;  1EH8 A;  2HZD A;  3FXU A;  1HXD A;  4UUS B;  1G6N A;  3OSF A;  5GAE J;  2X0L A;  2OQR A;  3PQJ A;  4HG2 A;  5BNG A;  4CA0 A;  2HXO A;  3ZOB A;  3AKZ A;  2DOD A;  1HF0 A;  2BW3 B;  5CKT A;  2E5Z A;  4CZC A;  1Y0N A;  5GAG J;  3E5U A;  3ZMU A;  3RQI A;  3PO2 J;  5FRO A;  4LJZ F;  3HHH A;  4XR6 A;  2WTE A;  5EZG A;  1SFX A;  1XGN A;  4IO9 F;  2RNG A;  3CP2 A;  2DTZ A;  1NHA A;  4QPQ A;  1SFK A;  3C18 A;  1Y8R B;  3KX2 A;  2WAF A;  3OOP A;  3TO7 A;  2HOT A;  1FEX A;  2O5R A;  1ENH A;  4UV9 A;  2VON A;  2MGQ A;  2HYG D;  3TDU C;  1FX7 A;  1NG7 A;  1UMQ A;  4J19 A;  3HOU J;  1KON A;  3FIS A;  1VQO I;  5HDK A;  2ZKZ A;  5FFZ A;  1OYY A;  2L9R A;  1UEL B;  3JRG A;  5DM6 F;  1X3U A;  1U8B A;  1HOM A;  4CCJ A;  2NNN A;  4XKC A;  4LOC A;  5CPR B;  1LNW A;  2TCT A;  4W1U A;  1QO0 D;  2JPB A;  1WJC A;  1KU9 A;  5J8C A;  5GAH J;  1X3W B;  4A3C J;  1ZGJ A;  2D1V A;  4LB5 A;  5D5V B;  1JT0 A;  2JVG A;  1BI2 A;  2ESH A;  3DF8 A;  1ODD A;  1G59 A;  4BHC A;  3K10 A;  3QP6 A;  3CZ6 A;  3BZC A;  1FJL A;  3V4G A;  4EJW A;  1DQU A;  2RC4 A;  2B63 J;  3BPX A;  5FGM A;  1YJN I;  2M87 A;  3I64 A;  3DEU A;  3B6C A;  1X4P A;  3Q3S A;  4ESB A;  3G6E I;  2WV0 A;  4ZJZ A;  4DBQ A;  2CGP A;  1OFC X;  4HX4 A;  2ESN A;  2L7M P;  4EM2 A;  4N0B A;  4F91 B;  2XGC A;  3ZQF A;  1KU3 A;  2LOO A;  1ZRD A;  4FE7 A;  4A3F J;  2L2O A;  2H6C A;  3TOB A;  2DFH A;  2A6T A;  1JKR C;  1TNT A;  1OKR A;  3LA3 A;  1YTY A;  4RLQ A;  5FLM J;  3HSF A;  5CQG A;  4XM3 A;  3TDZ C;  1T6S A;  4PFP A;  2PMZ A;  4L9J A;  1RUN A;  1JUM A;  4Y17 A;  3CCL I;  2PQ8 A;  4KIT B;  3CCE I;  2GXG A;  1WRJ A;  3K1M A;  3MWM A;  3RQ4 A;  3AG3 H;  2NVU B;  2QSF X;  5ICG A;  3AL0 C;  2DJN A;  3HG9 A;  1GVD A;  1LKX A;  2BY3 A;  4EQQ A;  5JFR A;  4XRS G;  2IS2 A;  4RGS A;  2IA0 A;  1H9G A;  4XSZ F;  3JRA A;  2LTP A;  3ZRG A;  1RKT A;  2X6O A;  4HPQ A;  2W82 A;  4R1H A;  3VDX A;  1P9Q C;  2E1O A;  2XB5 A;  3UNG C;  1XSV A;  2ZFU A;  3ZMV A;  3RYP A;  2JZY A;  2V6C A;  2DMT A;  2PMU A;  2KIQ A;  3H0G J;  2CU7 A;  1PJR A;  5IYC J;  1SFU A;  3FMS A;  3LSG A;  3PIP F;  3G73 A;  2QSG X;  2IVM A;  3J7A Y;  3CUQ A;  3QPL A;  1I1S A;  4LG0 B;  2COM A;  4BKX A;  2L9S A;  3KIO A;  3G3Z A;  1U2W A;  4J00 A;  3QOE A;  2VIX A;  5IPA A;  1X2N A;  2OU2 A;  1Q1H A;  2X6W A;  5DCM A;  2Z2S B;  3Q0U A;  2GA2 A;  2VKV A;  2BHY A;  4M9X A;  5JHF A;  1YRN A;  2R93 J;  3BT9 A;  1YHQ I;  2P5V A;  3IV5 A;  4ZZD A;  2VBX A;  2JRM A;  4FE4 A;  4D9J A;  1ETW A;  4E70 A;  1V5G A;  1VI0 A;  2QQ9 A;  1ZRC A;  3VWB A;  3M3Y J;  4U0V A;  4KFC A;  4XNF A;  2FA5 A;  5FKO A;  5CLS A;  4MIM A;  5HLH A;  1PP7 U;  3W2V A;  2A07 F;  2JQ7 A;  4ZYD A;  1FBU A;  1ZTR A;  1Y6I A;  2YX4 A;  4Y3O A;  4AIH A;  2F5C A;  3TGN A;  4M3G A;  3BTJ A;  3HKZ A;  2IA1 A;  2IS6 A;  3PL8 A;  2F5V A;  3OR2 C;  4F55 A;  5DM7 F;  2ZJP F;  1AHD P;  4IZZ A;  1OYW A;  3JCU C;  1WJA A;  1FOW A;  3GLL A;  4M74 A;  2D2W A;  5IYD J;  5E8G A;  2QQB A;  1W0U A;  4A3D J;  2ID3 A;  3OYK A;  4Y7N J;  4HDU A;  1MBE A;  3I9V 2;  3QYB A;  5DUI A;  4FX4 A;  2XSD C;  2LP0 A;  5DV5 A;  2GXB A;  3FXM A;  3GW2 A;  4A2U A;  3GME A;  4HST A;  4B48 A;  1Y56 A;  1O4X A;  2XAQ A;  2HI3 A;  3H9J A;  2E71 A;  3CP8 A;  2HOE A;  2XAS A;  2P5L C;  1AU7 A;  3OYL A;  2PLY A;  3CO6 C;  2GOM A;  2A5Y B;  3DXJ F;  1YFH A;  4CYD A;  1DGR M;  3ZGK A;  1Z77 A;  2L0K A;  2L7F P;  1FBS A;  1L0O C;  2YR2 A;  3CLQ A;  4RAF A;  4IHW A;  4ZDL A;  2CFX A;  4NB5 A;  2DT5 A;  5DS9 A;  3MEX A;  2QEN A;  1XCB A;  4EJU A;  4G7H F;  5JR3 A;  2HDC A;  1V55 H;  1ZHF A;  2AHQ A;  1R22 A;  3OYB A;  3S1Q J;  1RI7 A;  4XOP A;  4L9T A;  2KRC A;  1UG0 A;  2DA4 A;  2C6Y A;  2K3F A;  4IHV A;  1RC9 A;  1SD5 A;  3IKT A;  2XRN A;  5ICC A;  3L1P A;  3G71 I;  3N05 A;  3DTE A;  3RZO J;  2E2H J;  2HNH A;  4ZYG A;  4W97 A;  3VYT B;  1HKQ A;  4ESJ A;  1U3E M;  4G7Z F;  3OYI A;  1HCR A;  2DI3 A;  4YII A;  3ZCO A;  1YIO A;  1TC3 C;  2RRE A;  1K4S A;  3DP7 A;  3W3C A;  1O3T A;  3RPQ A;  2X4H A;  4BAY A;  3NWS A;  3FBI B;  3COA C;  1LDD A;  5IYB J;  4H4K C;  1LVA A;  1T39 A;  1Z0X A;  3HOS A;  1FZP B;  4M9Z A;  5K5O A;  3LFK A;  2LKX A;  2K9L A;  5EG0 A;  4ZZL A;  1PUF A;  1FT9 A;  1UHW A;  1X1A A;  1Z9C A;  2HGC A;  2LY9 A;  3I3L A;  2WAQ A;  1N77 A;  3OR1 C;  2DFE A;  3CUQ B;  2NVT J;  2Z99 A;  4DJA A;  4XKV A;  4G8X A;  4O6J A;  2ME6 A;  2MLG A;  3RPU A;  2XB0 X;  4OMZ A;  2KZV A;  4PSX A;  3GFL A;  5BOX A;  4C2M J;  3W6K B;  3JAM Z;  1IRZ A;  4B09 A;  2L4M A;  2P7V B;  2XV4 S;  1POG A;  1D1A A;  2IGK A;  2ZXH A;  4KIS A;  4IL6 C;  5L3E A;  1U9N A;  1W1W E;  2FNA A;  3ASN H;  5GTI C;  1T38 A;  2UXN A;  4A3L J;  3CCU I;  1SVO A;  1GVJ A;  1WJE A;  3SQN A;  5LFA A;  4I6Z A;  1ETK A;  5KAI C;  3L2V A;  4YFX F;  3BG3 A;  2BYV E;  4HLY A;  5H2F C;  2E2J J;  3BQY A;  4CYC A;  2HPM A;  2V9P A;  4ABZ A;  1TQI A;  2EFP A;  2WB1 A;  3J81 K;  4BNC A;  2J5P A;  2M5W A;  2QQA A;  4HW0 A;  3VB2 A;  4IHY A;  3TQN A;  2VUM J;  1KQ9 A;  3RTR A;  1NG6 A;  3HXL A;  1K6Y A;  3OYD A;  1VQP I;  2DW4 A;  4I76 A;  1FY7 A;  4EM1 A;  3HOZ J;  2IAI A;  5GPA A;  3LSH A;  2EZH A;  3DKW A;  1HDD C;  2EBI A;  3E7L A;  5D4R A;  3B6A A;  2VXD A;  5D4S A;  2JT1 A;  3U21 A;  3IH3 A;  3ZPL A;  1FMW A;  1GXP A;  1NK3 P;  3E6D A;  4UUV A;  3S2W A;  1QPM A;  5ED4 A;  2VE9 A;  1JXS A;  1BC7 C;  2ZJQ F;  5HS7 A;  1DU6 A;  4OIQ F;  1Q1V A;  5C44 J;  4FCY A;  3QRF F;  2XHK A;  4B4C A;  1Y0U A;  2M4G A;  1GDT A;  2HQR A;  2EPF A;  4KT6 A;  3V8K A;  3OY9 A;  1MND A;  3GLX A;  2E34 A;  1QZZ A;  2V1X A;  4IHX A;  2YUS A;  1J5Y A;  2EA2 A;  4NC6 A;  4C3I J;  1D1B A;  3E5X A;  4A5M A;  1O3S A;  4DIQ A;  1FYM A;  4HF0 A;  4M6V A;  4HSR A;  1T08 B;  2CRG A;  3P9C A;  1WFX A;  2EV5 A;  3K69 A;  1MBH A;  2M45 A;  3WE2 A;  4XRM A;  4WXC A;  4WK8 F;  1YW9 A;  1F43 A;  1W5T A;  2QLZ A;  4V19 K;  1E0E A;  1MBK A;  1TWF J;  3BR0 A;  4I2O A;  4XID A;  4OIO F;  2HQN A;  1CF7 A;  3S1M J;  4F3Q A;  1BI0 A;  1VF9 A;  4M72 A;  4ENJ A;  1YX5 A;  3BG5 A;  3KP7 A;  3C2G A;  2VPL A;  3HRS A;  2O7O A;  4I0A A;  2QA4 I;  3R6S A;  1JUS A;  1B8I A;  3CF2 A;  1EJ9 A;  1MH4 A;  3K1P A;  4A3I J;  2KJC A;  2XKO A;  3ISP A;  4RAZ A;  3I59 B;  1ZGA A;  5KHD A;  2EIN H;  1OPC A;  3T5X A;  4JX4 A;  2G0E A;  2CUZ A;  4R8H A;  2P6S A;  4B47 A;  2QGU A;  4ASN A;  5BPD A;  3D5L A;  2YPR A;  1F5T A;  1VQ8 I;  3A02 A;  4PZJ A;  1PUF B;  3F9K A;  1IRF A;  2YX7 A;  1LQ1 A;  2XF6 A;  2H27 A;  2FBK A;  1QU3 A;  2BEO A;  4ENM A;  2MC3 A;  1Z1D A;  2Q2E B;  3H9Q A;  2DAO A;  3HL2 A;  5J40 A;  1ZR4 A;  3HGY A;  1MKM A;  4EAT A;  3FXR A;  3ABM H;  2XPU A;  4FET A;  2BOL A;  2F4O B;  4A0Z A;  3Q9V A;  5E3L A;  5KAF C;  3S1R J;  5HLG A;  1W5C C;  1IO2 A;  3WU2 C;  2HKX A;  2WV1 A;  3EQL F;  1S9H A;  4E6K G;  1E3P A;  1CGP A;  3O6B B;  3QPT A;  3R0J A;  5F0H A;  2IXS A;  2CV2 A;  5JVT A;  3LSK A;  3BG9 A;  4L0Z B;  4OIR F;  2HYJ A;  2K85 A;  3K6G A;  2V79 A;  2F5F A;  1MJA A;  3HZJ A;  5ILU A;  1SEU A;  4LIT A;  4XLF A;  5LRS A;  5LHG A;  2XRL A;  4UUS A;  1XMX A;  3RKW A;  1SC7 A;  1TT5 B;  4S05 A;  5E1Z B;  2BW3 A;  2HTS A;  3CTA A;  1P4A A;  2IPQ X;  2FUG 2;  2OBP A;  1GV2 A;  2VQC A;  3CLO A;  2H6B A;  3TP0 A;  1H0M A;  3OS0 A;  3FXO A;  3PM1 A;  4Y4R A;  1MIJ A;  1IJW C;  1QZE A;  2EZI A;  4HDV A;  1GT0 C;  4BL0 B;  2P0W A;  3NEU A;  1LJ9 A;  2Y9Z A;  3HEF A;  3OYF A;  4XK4 A;  2MFZ A;  4PK4 A;  2R7O A;  4WX9 A;  1GV5 A;  2TDX A;  1MW7 A;  3OOU A;  3ABL H;  4OAY A;  4XN0 A;  4JYK A;  1IC8 A;  1W7P D;  2EFQ A;  4IEJ A;  5HDN A;  4P96 A;  3TED A;  4IQ4 A;  2E5N A;  3AFH A;  4F52 A;  3E3V A;  5CYV A;  4A3B J;  4KN4 X;  5H20 A;  1WWX A;  1U8R A;  2G7U A;  2FNP A;  1S7E A;  5B66 C;  1SMY F;  3DTI A;  4HA8 A;  2R92 J;  3DPU A;  3LNQ A;  2BBY A;  2VAS A;  2DDB A;  3ROU A;  2R7W A;  2B9S A;  1FNN A;  2JRT A;  1OJL A;  3BCA A;  2M4K A;  1D1C A;  1D5V A;  2X1C A;  2N8G A;  2O9L A;  3F8N A;  4II2 A;  1EKE A;  2QKL B;  4BJ5 C;  2CW7 A;  2V7F A;  2Z16 A;  3K4N A;  2HZT A;  4EJV A;  2ICW G;  1I3Q J;  1YW7 A;  1AWC A;  4U87 A;  1W7P B;  4AM3 A;  4FT8 A;  5AIP A;  2LF8 A;  3RJP A;  1PDN C;  1BIB A;  3B73 A;  3OMY A;  3VFZ A;  3EYI A;  3VPR A;  1T33 A;  3LST A;  4MQV A;  4E7H A;  4HF2 A;  3BZK A;  2RQP A;  1OCP A;  1OMI A;  4BY7 J;  1IXS B;  3H1C A;  2CYY A;  5H6R A;  1BM9 A;  2F6C A;  1UZC A;  2XKP A;  3I58 A;  3J81 Z;  4B43 A;  2L02 A;  1EV7 A;  2R7Z J;  3BZ6 A;  1ETO A;  4XRF A;  2FBI A;  1ACI A;  4IOC F;  1XC5 A;  2RQQ A;  2LRD A;  1BR2 A;  3MN2 A;  2Y0S A;  1IN8 A;  2ZXI A;  5LRR A;  3V8J A;  2CW0 F;  3WG7 H;  3EYY A;  3WU0 A;  1KU2 A;  3K70 D;  1ERD A;  1J2X A;  2IGM A;  3GZ5 A;  2KIF A;  1JGG A;  2UWM A;  2QUF A;  2CQK A;  2DFF A;  4JQF A;  3DLA A;  2DA7 A;  2QF7 A;  1QPI A;  1XD7 A;  3QYE A;  2H8R A;  2VXZ A;  2HDW A;  4MNU A;  4AUX A;  1ZQ3 P;  2A69 F;  5CVJ A;  3CC2 I;  4UVA A;  3FM5 A;  4ZYH A;  3MKY B;  4A3J J;  2MLK A;  4A3K J;  3KP4 A;  3B02 A;  1YJW I;  4GGG A;  4Q5S F;  1EF4 A;  1MNE A;  4MEX F;  3CUQ C;  4LG0 A;  4FX0 A;  1BJA A;  2XF5 A;  1D5Y A;  5FLV A;  2X1E A;  3D5R C;  2IP2 A;  4HNU A;  5C3E J;  3GTQ J;  3GX4 X;  4IJA A;  1TLH B;  2IS1 A;  3FBN B;  3CDH A;  4KIG A;  2HKO A;  3U1K A;  5FKN A;  4D7N A;  4HQM A;  4L9N A;  4UNO A;  3L2R A;  5FKM A;  3VYS B;  1R7J A;  2W84 A;  5B3S H;  3R4K A;  2P8T A;  3L2C A;  2R7R A;  2X6Y A;  3MAJ A;  1G3W A;  3FWE A;  2FEZ A;  2DK5 A;  3GTP J;  5K7Z A;  3S3O A;  4WCG A;  3D0S A;  3DV8 A;  3MD2 A;  2KMU A;  2P7C B;  4KNY A;  3LWF A;  2UZK A;  2PEX A;  3KP3 A;  5E1X A;  1HW2 A;  2G7H A;  3RDI A;  2LBF A;  3J7Y J;  1U5T B;  1VQL I;  1XMA A;  5EGO B;  4DYC A;  2R5Z B;  2FBH A;  2PN6 A;  5IT3 A;  1LDK B;  2VL8 A;  3TMO A;  2WAE A;  3L7W A;  1MBF A;  4ITV A;  1R1T A;  3F8M A;  3MKW B;  5D8K B;  1JTX A;  3C1D A;  1YIT I;  4NUB A;  2RGV A;  4II3 A;  3ZMZ A;  2OCE A;  1SD4 A;  3GTK J;  1ZG3 A;  4ZH4 F;  5LLQ A;  1QQI A;  3DTK A;  2ECC A;  4P1W A;  4AVZ A;  2ZME B;  1H89 C;  3JAM K;  3ECO A;  3O2P E;  1QHG A;  1P2F A;  2EFN A;  3MZY A;  4OWR B;  3CMY A;  2CUJ A;  3VYR B;  1T2K A;  5GAD J;  4HBL A;  4BHB A;  3OSG A;  4G12 A;  4ZTF A;  1YG2 A;  2ME0 A;  4XLN F;  1Z91 A;  2DOF A;  3M07 A;  3JRE A;  5FKL A;  2M8G X;  3ZMS A;  1SFE A;  3TKY A;  2M2E A;  4HV5 A;  1HDP A;  3WE3 A;  2FE3 A;  4ON0 A;  2W00 A;  5AIQ A;  1RES A;  3V8L A;  5LBQ A;  3EUH A;  1ZRF A;  1R49 A;  2MAB A;  3RIR A;  1G2H A;  3I0T A;  5JLX A;  3RKY A;  4DBR A;  4AU7 A;  2ELJ A;  2JSC A;  3M7G A;  2GLO A;  4DOZ A;  2RDP A;  4BJT A;  2ZC2 A;  1FYL A;  2MA3 A;  4Y15 A;  5GP9 A;  4QLC U;  1UFM A;  2ELH A;  3TOA A;  4BBS J;  5DEQ A;  1MGT A;  3E6M A;  3PIO F;  3M8J A;  3ZQQ A;  3OIQ A;  1MDM B;  1CQT A;  5IP9 J;  5F64 A;  4A12 A;  2IS4 A;  1P7I A;  4RB0 A;  1K6O A;  4LG3 A;  3FK6 A;  4LMY A;  2PBI A;  3KFW X;  4RDU A;  2HQ5 A;  2R5Y B;  1QA6 A;  4AIJ A;  3HPH A;  1ZK8 A;  1VQ5 I;  4G94 A;  3IWZ A;  5H6Q A;  3EUA A;  2GXA A;  2E1M C;  5DDG A;  3RZD J;  2CJJ A;  2DMU A;  2H09 A;  1O57 A;  4GRI A;  1JHF A;  3KP5 A;  2CQX A;  3BLY A;  5DUK A;  1E3O C;  2V26 A;  5LHI A;  2JUC A;  2ISY A;  2KKO A;  2XUB A;  1J0R A;  4XBF A;  4GCV A;  5J1U A;  4B3A A;  2DYR H;  2OUM A;  4GXO A;  5E18 F;  4B1R A;  1FOK A;  5ILV A;  5LEJ A;  1IXR C;  3IWF A;  3HRT A;  3HYI A;  1R58 A;  4KIC A;  3HJE A;  5FKK A;  5K1Y A;  1X2M A;  3F72 A;  5FLX Z;  1P4X A;  3HOV J;  4KUM A;  1K83 J;  4AYB A;  2F2E A;  1E2X A;  3CCS I;  5IOZ A;  1RR7 A;  4B3X A;  1HW5 A;  2XC7 A;  2DJI A;  1XB4 A;  3O8H A;  4KT5 C;  3T0Y A;  5HLT A;  5KNL A;  3QU3 A;  3OS2 A;  3W6V A;  1SFO J;  2PMZ N;  2M0M A;  2OPT A;  1S7O A;  1STZ A;  3MKL A;  4PUS A;  4R79 A;  4CXF A;  3FXL A;  3L2U A;  1ONV A;  1DDN A;  4ETS A;  2VQG A;  2JVH A;  3WTW C;  2EIK H;  4X6A J;  3Q5F A;  1ZR2 A;  3FK7 A;  4WWC A;  2HTJ A;  4XIC A;  1F36 A;  4XLH A;  4KN7 X;  2CO5 A;  1D8J A;  1W4M A;  2LBF B;  4MEY F;  2KPM A;  1X1P A;  3BR2 A;  3CJR B;  1LEA A;  2Z5U A;  2HR3 A;  5EEH A;  4Y52 J;  4RGU A;  1J59 A;  2E2I J;  4BS9 A;  4GO1 A;  1HQC A;  3Q0W A;  3IH4 A;  3OS1 A;  1UJ8 A;  3PNY A;  1MMG A;  1MNM C;  1AA7 A;  4K2E A;  3QWL A;  3MMY B;  4A3M J;  2QZ8 A;  4FHT A;  4AC0 A;  3C7J A;  4HLX A;  4F7Z A;  3DEE A;  1K4T A;  2L7Z A;  3KET A;  3ZQH A;  2XAJ A;  3FKI J;  4ZYA A;  4CIC A;  1HSJ A;  2DO7 A;  4RBO A;  1RZ4 A;  3GTL J;  2OQG A;  2VQH A;  3I55 I;  3GTG J;  1ZG5 A;  5HDG A;  1B72 B;  2KJB A;  2CQN A;  1USS A;  2W4S A;  4Y13 A;  2LG4 A;  4A6E A;  5J1Y A;  4O3M A;  5JLW A;  3H3Z A;  4RM3 A;  1HA8 A;  3TW7 A;  4BE2 A;  2VE8 A;  3ECH A;  5E17 F;  5F1J A;  3ELK A;  4HAM A;  2DA6 A;  2A3S A;  1YJ9 I;  2F48 A;  3HSR A;  5FRN A;  1JKP C;  1D0Y A;  4IPA A;  1R23 A;  5K5R A;  2PJP A;  3PUF A;  2HOS A;  2Y9Y A;  2ELK A;  2QSH X;  1FIP A;  2JA6 J;  1HKS A;  3CDL A;  1QZY A;  1SAN A;  4U7B A;  4P5O A;  4E4H A;  3A4C A;  1YIJ I;  3E0J B;  3DBH B;  3JTG A;  3DLL F;  3PO3 J;  1HC8 A;  2Q0O A;  2LSO A;  1R1V A;  3RKQ A;  2F4I A;  2CH0 A;  2P4W A;  2PI0 A;  1ZN2 A;  1O7L A;  5F0C A;  2A05 A;  3BP8 A;  4FQG A;  3KP6 A;  2K9N A;  5M5W J;  3JTH A;  5D5W B;  3C3W A;  2X1D A;  3HKZ N;  2DA1 A;  4U0W A;  3ZR8 X;  2L4A A;  2GA1 A;  5FB2 A;  1ZRE A;  3L9F A;  2XIG A;  3JRD A;  1JJ8 C;  4Z6Y A;  3F8F A;  1JHH A;  2VB6 A;  3LSI A;  5F27 A;  3OV8 A;  3PQK A;  3I59 A;  2HVQ A;  4RB2 C;  2TRT A;  1TTY A;  2YU3 A;  3SEZ A;  2NVQ J;  1Y1V J;  3S93 A;  3DBR B;  3X2Q H;  3HTU A;  3LA2 A;  1UHM A;  2FX0 A;  4MFE A;  2Q2E A;  3H0D A;  2DN0 A;  4PJL A;  1WCM J;  5GPC A;  3ZQ7 A;  1BJZ A;  1ZH5 A;  5TGT A;  4L18 B;  3LQR A;  1YYV A;  2K27 A;  1W36 C;  2OA4 A;  3BPV A;  3K4K A;  2DBB A;  2W7N A;  2QWW A;  2COB A;  2Y69 H;  3EET A;  5LGN A;  3ZN0 A;  4V2G A;  2BHZ A;  2VOO A;  1WSU A;  2OC6 A;  3CJN A;  4A3E J;  3GZ6 A;  2ZCW A;  1IN4 A;  2EV0 A;  1LFU P;  4M71 A;  2E36 A;  3REO A;  4KIB A;  2LK2 A;  2QQ8 A;  4MFD A;  5TIS C;  1ETY A;  1WVR A;  3GBG A;  2ZBK A;  4CO8 A;  1DGW Y;  3GCM A;  2KRF A;  2D1H A;  4E7I A;  5KCM A;  5DTD A;  2M7A A;  4ENK A;  1JI8 A;  3M1C A;  3K70 C;  5JHU A;  2FQ3 A;  3WHB A;  5GTH C;  5DD4 A;  4FAS D;  3BCB A;  3CUO A;  3S32 A;  3ERE D;  2O03 A;  1LVK A;  4A0X A;  2W24 A;  2ZJ2 A;  1F9N A;  1ITY A;  2XVC A;  3CCV I;  4UUT A;  3WG9 A;  2ID6 A;  1FBQ A;  2ZNZ A;  4N4N B;  1XX5 A;  2KIS A;  4F93 B;  2X9D A;  1BOB A;  2OZ6 A;  2EFW A;  1T95 A;  2JWT A;  3VYU B;  2EH3 A;  2FRH A;  2QBY B;  3GTJ J;  2K7L A;  4QWQ A;  4YFK F;  4OIN F;  3MZH A;  3FX3 A;  4AID A;  1XMK A;  4P9U A;  2STW A;  3CDI A;  1I1G A;  3K4J A;  1R9T J;  1RNL A;  2E7W A;  2VBY A;  2Z9O A;  3E97 A;  2WAQ N;  5D8L B;  3FF5 A;  3GUD A;  3QPS A;  1TQM A;  3KLN A;  4S0H B;  4HQE A;  2D5V A;  4BQA A;  2HXI A;  3HB9 A;  4PGG A;  2NOJ B;  2VT3 A;  4CCM A;  1TBX A;  1J09 A;  2JA2 A;  1Z3Y A;  2KT0 A;  3G1L A;  2L7K A;  3E6C C;  2F5D A;  2DFI A;  3ML6 A;  4HOB A;  3ESW B;  2ETH A;  3F6V A;  2AO9 A;  1R1U A;  1TZL A;  2DCE A;  1OR7 A;  1SVM A;  4EEF G;  2DYS H;  2EJR A;  2E7X A;  3C2B A;  3I4M J;  1WGX A;  2P81 A;  4I01 A;  1APL C;  3H5N A;  3GEZ A;  4CHU A;  3VOE A;  3CF5 F;  5IT9 Z;  2NVX J;  4IHT A;  4U0Y A;  3K1N A;  2R7U A;  3QPH A;  1REP C;  3V7S A;  3S1N J;  2Y30 A;  1LB2 A;  2DLL A;  5L3B A;  1W7P A;  2X48 A;  1H88 C;  2WB1 N;  2A6E F;  2MH2 A;  2NS7 A;  2CV1 A;  3N4M A;  4OIP F;  3IL2 A;  4IKF A;  2E19 A;  2IT0 A;  1YW8 A;  4QSH A;  3TBI A;  3BR6 A;  4LLG F;  2KQR A;  3TW6 A;  2IEK A;  3DKX A;  1G3Y A;  3P9K A;  1K79 A;  1S7A A;  1TQP A;  3IUO A;  1X4O A;  1AKH B;  3BQZ A;  1IN7 A;  2XPW A;  2EA4 A;  2F4M B;  1WHU A;  3IAM 2;  3D5S C;  3CC7 I;  3M9A A;  1A31 A;  2KIM A;  5EF6 A;  2VI6 A;  3AL0 B;  3QU6 A;  3IC7 A;  5KVR A;  1K78 B;  4XLE A;  1YLF A;  1U0J A;  1YE9 A;  3A1Y A;  2YS9 A;  1BI1 A;  1W0T A;  2L3D A;  1IGN A;  1VQ6 I;  3NWT A;  4XL9 A;  5F08 A;  1D0Z A;  1IDY A;  3HM5 A;  4NQW B;  1FTZ A;  4G6D A;  3Q9S A;  4DQ2 A;  3S3N A;  1BN5 A;  3M1E A;  3F8B A;  1OCO H;  4Q48 A;  1MBJ A;  1MMD A;  3HTS B;  4XSX F;  3G1O A;  2H1K A;  2MC4 A;  3WGG A;  4LK1 F;  3DKY A;  4L5J A;  3BWG A;  4M3D A;  1C0W A;  4BAC A;  2WA0 A;  2HVR A;  4QPO A;  2K3P A;  4RB1 A;  1Z67 A;  3VOD A;  4ANJ A;  2LH9 A;  2R7V A;  2EB7 A;  5J6X A;  1V4R A;  1N75 A;  3HOX J;  2Q8K A;  1LE8 A;  4NNJ A;  3A2K A;  2ECB A;  4KMU X;  2PJR B;  4GFB A;  1ETQ A;  4M9S A;  1FP2 A;  1EA3 A;  1IZ1 A;  4RB3 C;  2PG4 A;  4RS8 A;  3HBL A;  3G2B A;  3L00 A;  4LFU A;  1MJB A;  2JA5 J;  2KRH A;  2EIL H;  1YO5 C;  1WKM A;  2G9W A;  2HDD A;  5J47 A;  2Y48 A;  2I10 A;  4N9H A;  5D5X B;  1FTT A;  4GYG A;  1IG7 A;  3TP3 A;  2VBZ A;  1IRG A;  2M34 A;  4BHP A;  4CDG A;  1S72 I;  4PSW A;  1VFC A;  3OYJ A;  1QRY A;  1NK2 P;  1FOX A;  1U5T A;  1OCC H;  2VKH A;  5EGO A;  1J75 A;  2R5Z A;  1OQY A;  2PMH A;  3JRB A;  1UHS A;  3I4N J;  2IGN A;  5D6F A;  1QGP A;  1UAA A;  1G3T A;  5AON A;  5M5Y J;  4AIK A;  2LF7 A;  2LKS A;  3ZP5 A;  1PUE E;  1T0F A;  4BE1 A;  1JJ6 C;  9ANT A;  1OIS A;  3I71 A;  4OAZ A;  2CQQ A;  1G4D A;  2V4J C;  4MQ9 F;  1TT0 A;  5FO5 A;  3A0H C;  3I54 A;  3M8F A;  4IVN A;  4BGD A;  1FP1 D;  4OMY A;  3ZXS A;  4BQN A;  5FLX K;  3BDD A;  2ZME A;  4XLA A;  4A5N A;  5B1B H;  3V7R A;  3CCR I;  3UKG A;  2STT A;  1WI9 A;  2JN6 A;  5BQT A;  5HNH A;  4ZYE A;  3CJT B;  1HKT A;  3ZQC A;  3GTM J;  4U88 A;  1I6X A;  2X51 A;  1MMN A;  4E7S A;  4XLC A;  2EV6 A;  1VQM I;  2L9V A;  5J4Y A;  3JRC A;  3BR5 A;  4GDF A;  2MBF A;  2OCC H;  4Y33 A;  1A35 A;  2EZL A;  4O5V A;  5L3G A;  4IHS A;  4TV7 A;  4ZDP A;  1Z05 A;  4MHG A;  3NRV A;  3H5A A;  3VSL A;  1XN7 A;  3LAJ A;  1U6G A;  3QP5 A;  1QVT A;  3NAR A;  4NBQ A;  2FJ1 A;  3U1D A;  3EUH C;  3HUG A;  3QQA A;  3S14 J;  2A68 F;  3AG2 H;  1I6H J;  3SZG A;  4CSW A;  4DW6 A;  3HOT A;  3OYG A;  3PNT A;  3DFG A;  3P5J A;  3R60 A;  5CJ9 A;  2ISZ A;  2UXX A;  3GYH X;  1IN6 A;  2NOG A;  2CW8 A;  4BXU A;  2KDO A;  1HBX G;  2K40 A;  2AQE A;  4PCQ A;  2GM4 A;  2Z33 A;  2CWE A;  3PUB A;  2R0Q C;  4M3E A;  2W85 A;  2KL4 A;  2ZSI B;  3IAS 2;  2F5E A;  1O7F A;  2X85 A;  2RAE A;  3T8R A;  1DP7 P;  1IUF A;  4HZF A;  3N97 A;  3CCQ I;  3ABU A;  3CME I;  4KDP A;  4E7J A;  5IP6 A;  1J7K A;  3HIF A;  2DA5 A;  1BBY A;  2MSY A;  1RRJ A;  1TW2 A;  2AXT C;  4IRI A;  3K4M A;  5BS6 A;  4DYR A;  1MDM A;  1Z6R A;  4D1Q A;  1HW1 A;  2RN7 A;  2DMN A;  3E6B A;  2DMP A;  3KEO A;  2IRF G;  1N25 A;  2FOK A;  2K4J A;  3LL7 A;  4PDK A;  1X1B A;  2R5Y A;  5LHH A;  1PYV A;  1S5L C;  1DP3 A;  1BIA A;  1JE8 A;  5E79 C;  1TNS A;  4HNT A;  3GFM A;  4AWX B;  3OYC A;  1I5Z A;  4IX7 A;  3FMQ A;  3OL3 A;  3S17 J;  2LLK A;  4EMS A;  1ULY A;  3QOP A;  3G4S I;  2L54 A;  2L9N A;  4HYE A;  3FXK A;  3F23 A;  1Y39 A;  2EQR A;  2M3A A;  1MSE C;  4M6Y A;  1JT6 A;  1YS6 A;  1W5S A;  2GQQ A;  5K5Q A;  2QEX I;  1MMS A;  1VND A;  1XTA A;  3OYA A;  6PAX A;  4ZC3 A;  1UB9 A;  1KA8 A;  5HOD A;  1LE8 B;  3VSK A;  3F8C A;  3PFY A;  5F0F A;  2Z3Y A;  3ULQ B;  2M30 A;  4RMN A;  1Z7U A;  4L5E A;  2LY1 A;  2RVC A;  2O8K A;  1OCT C;  2R7T A;  5DYM A;  4N9I A;  1B9N A;  2JPC A;  3P9I A;  1R4M B;  2MW8 A;  3KYL A;  1YI2 I;  4ESF A;  2B0L A;  3BRO A;  4D0P A;  2FU4 A;  2EIM H;  3DU6 A;  3WGI A;  2RNJ A;  3ZMD A;  2X6X A;  4XOR A;  3FM3 A;  1I50 J;  2NXN B;  2ZO4 A;  2XGD A;  2HFH A;  1A5J A;  1SD7 A;  1JGS A;  4DGW B;  1FMV A;  1LFB A;  4J01 A;  1L3L A;  4CCK A;  3LFU A;  2Y0S N;  1VQ4 I;  2R4G A;  2L01 A;  5DD8 A;  2PFB A;  3JR9 A;  4UB6 C;  1R6R A;  3WTS C;  3KEY A;  2HVS A;  1I39 A;  2E1N A;  2JTV A;  2BZT A;  4PJJ A;  5L3F A;  3I56 I;  4UB8 C;  4C2T A;  3WTZ A;  2OZU A;  3CCY A;  1BI3 A;  3U9G A;  1K7A A;  5E1W A;  1I3A A;  5F1R A;  3GO5 A;  3V7C A;  2DOE A;  1WJD A;  1VQK I;  2VJ4 A;  1V5F A;  1B72 A;  1X19 A;  1OCZ H;  1FIA A;  2K9Q A;  2MD0 A;  3H36 A;  5IP7 J;  2DPU A;  2V6E A;  2Z1D A;  2I8D A;  5JVG F;  4RAG A;  3JSP A;  2ADU A;  3OIO A;  4WXD A;  2JMW A;  1IXC A;  1OLT A;  2EIJ H;  3SDG A;  3KZY A;  4DZP A;  5D6E A;  1KQ0 A;  2LC2 A;  5L3D A;  3L2W A;  4IOA F;  4XN3 A;  5JI6 A;  5F6F A;  2GOX B;  2R7F A;  2R3S A;  1IN5 A;  3CO7 C;  1TW3 A;  1B1B A;  3HUG B;  5E3N A;  1NH3 A;  2DQL A;  3EPZ A;  3SHF A;  3TL4 X;  3AG1 H;  3EUK L;  2ZNY A;  3FZV A;  1MH3 A;  3K7A J;  4BUP A;  3SFI A;  5TJJ A;  4CCL A;  1JKQ C;  2KHM A;  1MBG A;  1WJ5 A;  2LVS A;  2IW5 A;  3CMM A;  4LLN A;  1NTC A;  2MD5 A;  3WGH A;  3WOD F;  1WPK A;  3ZQI A;  1A6Q A;  1IW7 F;  1KQ8 A;  2JUG A;  1ETV A;  4PJM A;  1ZAO A;  5LD2 C;  5B5E C;  3J7Z I;  1FPQ A;  2UV1 A;  1X1D A;  2ZFW A;  3DWL E;  1V3F A;  1GUU A;  2DK8 A;  2QVO A;  4XQF A;  3O8G A;  1BOA A;  1IUY A;  1WH7 A;  3ONQ A;  4BH9 A;  4KYW A;  2VOP A;  1TL8 A;  4B44 A;  1T8I A;  3PFI A;  2J5O A;  3T1B A;  3SXY A;  4S04 A;  3JSO A;  1OCR H;  3W2W A;  2CSO A;  4A0Y A;  3GF2 A;  3QOD A;  5EDN A;  4RM2 A;  2XGX A;  4XRS A;  1R5H A;  3HHG A;  2FQ4 A;  1KYW A;  3ABK H;  3D1N I;  1R71 A;  2V1N A;  2DXI A;  1IV6 A;  4G7O F;  2DT6 A;  5BPI A;  5ILS A;  2YSR A;  4H0E A;  2DQR A;  2WAD A;  4YRV A;  2NAZ A;  2DA2 A;  5IT9 K;  3BG7 A;  4Z2Y A;  3AAF A;  4IF4 A;  4NDL A;  3W2A A;  4UVC A;  4YEL A;  2IA2 A;  2EZK A;  3J80 Z;  2Y0M A;  1LPQ A;  2O0Y A;  3H3U A;  3K4B A;  4CCO A;  3ZQG A;  4NHJ A;  1JUP A;  4YG2 F;  2JA7 J;  1YOV B;  3BJO A;  4PJ0 C;  1PVE A;  1ZKG A;  5HS8 A;  3DEW A;  2WY8 Q;  4I09 A;  4FTH A;  4ZDO A;  2CV0 A;  1I27 A;  4CCN A;  1XSD A;  1P7J A;  1BW6 A;  1FSE A;  2BY1 A;  4C30 A;  3F22 A;  1BC8 C;  2LNB A;  4BYY A;  3BOQ A;  3F3X A;  5EEA A;  4LIV A;  3KEQ A;  1FYK A;  2VLA A;  2VJ5 A;  2M8E A;  3OYH A;  1QNT A;  4LLL A;  1LDJ A;  1BW5 A;  3GFJ A;  3MVP A;  2VJI A;  3TO6 A;  2BE5 F;  4M3B A;  2XAU A;  1ZAR A;  3IHU A;  3A0B C;  3LSP A;  2QBY A;  3FIW A;  4QTR A;  1SVL A;  4BQO A;  5ICF A;  3S8P A;  1HLV A;  4M3F A;  1XSX A;  3OWT A;  3IP4 B;  3SJM A;  2OJE D;  1QBJ A;  2V1U A;  2Y2Z A;  4HX8 A;  4LK0 F;  1XCV A;  1R4N B;  1XDU A;  3K0L A;  4BXF A;  4BY1 J;  2JK3 A;  4BJ6 C;  1ZLK A;  4JBA A;  3G1M A;  2VT2 A;  3HRU A;  4JX6 A;  2JJ7 A;  4YIR X;  1KU7 A;  2QCO A;  1IF1 A;  4X0G A;  3S3M A;  3JRF A;  4M6X A;  1Z7L A;  1Z6T A;  1FC3 A;  2QYO A;  2BXZ A;  2KLO A;  2W1O A;  2FMY A;  5CVV A;  5ICE A;  5J4V A;  2BGC A;  1WZ2 A;  1GHC A;  4UV8 A;  3LSR A;  2Y31 A;  4AYB N;  2P6T A;  4BXX J;  1RKW A;  1OR7 C;  2BVM A;  4L0Y B;  4UHT A;  4UY8 I;  3RI4 A;  5IY5 H;  3RYR A;  3FMR A;  4JX5 A;  4LD5 A;  4V2F A;  1B4A A;  1D0X A;  2Q1Z B;  4DYQ A;  1XS9 A;  2O3F A;  2O8X A;  4NC8 A;  1ZYR F;  2VC1 A;  2DPD A;  4HV6 A;  3TO9 A;  5BMZ A;  3RSN A;  1XGM A;  1EH6 A;  3OL4 A;  4JP0 A;  1O3R A;  2HPI A;  1B9M A;  3HGG A;  1H9T A;  2WC2 A;  2VJJ A;  1ZG1 A;  4KJZ A;  4EV0 A;  1SD6 A;  3U2R A;  1R36 A;  4BDZ A;  3LSJ A;  1GXQ A;  1AKH A;  1G3S A;  3CCJ I;  3F21 A;  5C4J J;  1G8X A;  4FIS A;  3ZQL A;  1OYI A;  3HOY J;  2OAZ A;  3E5Q A;  3S2H J;  3RCO A;  2VKD A;  3BR3 A;  5EYR A;  5FD6 A;  2FF4 A;  5J8F A;  3OYE A;  4MGR A;  1EH7 A;  3OYN A;  1K78 A;  1ON1 A;  1P4W A;  1IDZ A;  3K9T A;  3J7A O;  5CVI A;  1WJF A;  1Y1W J;  3Q0V A;  2R7X A;  4NQW A;  3HOW J;  2RKH A;  3DQV C;  4RAY A;  3A01 A;  2H1L A;  5DCF A;  3L09 A;  4LB6 B;  4D5F A;  2M0C A;  1X3Z B;  2GBY A;  3KE2 A;  2CFO A;  1WH5 A;  4KIF A;  2IGO A;  1SAU A;  2LY2 A;  4HX7 A;  3WTX C;  3MQ0 A;  2NS0 A;  2CQ7 A;  2V9K A;  3HC7 A;  2OF7 A;  3BY6 A;  3OYM A;  3KLO A;  2LR8 A;  3WU1 B;  4RA2 A;  4D7M A;  1FSH A;  1S6L A;  5A2Q K;  3RKX A;  2K9S A;  4KA4 A;  3SYT A;  1A6I A;  2ZSH B;  3O3K A;  4IRH A;  1T98 A;  3WTY C;  2LKP A;  2DU9 A;  4HEA 2;  3CES A;  1ORK A;  2PJR A;  1V54 H;  5DCM B;  3PSI A;  1VQN I;  3BJA A;  2L5Q A;  4XOT A;  3M8E A;  3IH2 A;  1YRN B;  1RR8 C;  2ZJR F;  2CUE A;  5EZH A;  3I53 A;  2D45 A;  4N4O B;  2VPR A;  3FDY A;  3LA7 A;  2JA8 J;  2H94 A;  2XRO A;  2LDU A;  1BR1 A;  2P5K A;  1R00 A;  1ETX A;  2E60 A;  1U5T C;  3KZZ A;  2A5W A;  1KGS A;  2GZW A;  4LIU A;  2OD5 A;  2KDZ A;  1N78 A;  2AS5 F;  4BEH A;  1QHH D;  4MO7 A;  5CVR A;  3H35 A;  3C2H A;  1YX3 A;  3PNV A;  2NS8 A;  1T0F C;  4G6Q A;  1F4K A;  4DZJ A;  1A04 A;  2ZXJ A;  1HST A;  2DDA A;  3F6O A;  2FOW A;  1S8N A;  2W57 A;  2W25 A;  1ZGW A;  2FSW A;  1TWA J;  3A03 A;  5LEK A;  4RGR A;  2HU9 A;  1DUX C;  4HRI A;  2GIV A;  2ZME C;  4GYI A;  1Y8Q B;  4CH7 A;  2IJL A;  3QYF A;  2R7Q A;  4L5I A;  1R5G A;  2XAG A;  4MTD A;  4UVB A;  1BA5 A;  2LFB A;  3BG6 A;  1YQA A;  4CGZ A;  2MH9 A;  4ZTJ A;  5J3L A;  3SDB A;  3P7N A;  3WTT C;  1PP8 F;  1MSF C;  5IOY A;  2BY0 A;  1BR4 A;  2HQA A;  2AXL A;  2EFO A;  2VN2 A;  1S29 A;  2UUZ A;  2VOD A;  3E1S A;  4UXN A;  4XON A;  1WI3 A;  4M73 A;  2CUF A;  4P55 A;  4G9Y A;  3SZP A;  4C3J J;  4X1E A;  2A61 A;  4AD9 A;  4HNV A;  4MTE A;  3ZN1 A;  3IKV A;  2OV7 A;  2E1C A;  3KCC A;  3WHC A;  2CG4 A;  2YU9 J;  2R7S A;  2RV8 A;  2Y75 A;  2DA3 A;  3BJ6 A;  3GTO J;  4BU2 A;  2XPV A;  3K4C A;  1U9O A;  2LYC A;  2OTL I;  4EGY A;  1JTY A;  3FKJ A;  1J9I A;  3AG4 H;  4MLO A;  1FLI A;  2W48 A;  4KMF A;  4IQJ A;  1XPX A;  4A69 C;  1MJ9 A;  3KYD B;  4YEJ A;  2WY7 Q;  2MYS A;  3NQO A;  4IRG A;  3CJQ B;  1GLN A;  4BDY A;  3MZ8 A;  2XGE A;  2V9V A;  4C2U A;  1B6A A;  5LGU A;  1RUO A;  1VQ7 I;  3RPU D;  2KZG A;  5J1R A;  3H92 A;  4ENN A;  3PJR A;  4YFN F;  5F04 A;  2HS5 A;  4F92 B;  4BE0 A;  3DPT A;  4OU0 A;  2LD5 A;  1WJB A;  3WTU C;  4IXA A;  1TWH J;  3A01 B;  2XAH A;  1V5E A;  3GWZ A;  3WTV C;  1U78 A;  1JKO C;  4E7L A;  3DPL C;  2KP6 A;  2KIU A;  1T56 A;  2GAU A;  5FRM A;  3CMA I;  3ERM A;  3T8T A;  4QIW N;  2E1M B;  1DPR A;  3HPG A;  5EG0 B;  3KP2 A;  1IAW A;  5LGT A;  4EGZ A;  2FML A;  2ACJ A;  4EVI A;  1FWZ A;  3F0C A;  5M3F J;  3MKZ A;  1XG1 A;  2O61 A;  1RPW A;  2K5C A;  2PX9 A;  2HWV A;  3ASO H;  1FOY A;  2XF7 A;  2QKM B;  2I5U A;  2LRE A;  3K4L A;  3JW4 A;  1E17 A;  1UST A;  3JRI A;  1ON2 A;  5KK1 A;  1D3Y A;  3ABT A;  3GZN B;  4EJO A;  1AOY A;  4G6T B;  2B7E A;  2WBM A;  3I4P A;  1D8K A;  3KPH A;  4D5C A;  4XMY A;  4XKW A;  2EWN A;  3QAH A;  1RIO H;  5HOO A;  4PFO A;  2GIZ A;  2K9M A;  1X1C A;  2NYX A;  1DU0 A;  1Z3X A;  5FFX A;  3OIP A;  1MZB A;  5FJ8 J;  3H5R A;  4Q4Z F;  1H8A C;  2XSJ C;  3KZI C;  3LMM A;  4CYC B;  2CMP A;  2VQL A;  1K61 A;  4AVP A;  4A93 J;  2AQF A;  5K7F A;  4BEH B;  4XKB A;  5D5U B;  5E20 A;  2V1D A;  4OOI A;  3SZT A;  1SMT A;  2MG4 A;  3MCZ A;  1X58 A;  3BR1 A;  4WXH A;  5E8I A;  5M3M J;  4YIF A;  1LFP A;  2BXY A; 
#chains in the Genus database with same CATH homology
 2IAI A;  5GPA A;  1MNM C;  2EZH A;  4A3M J;  1HDD C;  4AC0 A;  2EBI A;  3E7L A;  3B6A A;  3CCY A;  3LOC A;  3IH3 A;  2L7Z A;  1NK3 P;  3ZQH A;  2NVY J;  3FKI J;  4RBO A;  5M5X J;  1B72 A;  3GTL J;  1FIA A;  2K9Q A;  5IP7 J;  1TWC J;  3GTG J;  1B72 B;  1DU6 A;  1Q1V A;  5C44 J;  4FCY A;  3NAU A;  2ZB9 A;  4B4C A;  1GDT A;  5J1Y A;  5JLW A;  3OIO A;  2JMW A;  3TW7 A;  4IHX A;  3SDG A;  5K7H A;  2YUS A;  4DZP A;  5F1J A;  4C3I J;  2DA6 A;  3DCF A;  3H3V K;  1JKP C;  3S15 J;  2HOS A;  2Y9Y A;  4C3H J;  4M6V A;  2ELK A;  2IBD A;  1FIP A;  2JA6 J;  2CRG A;  3CDL A;  5E3N A;  1SAN A;  4XRM A;  1MBH A;  3PO3 J;  1F43 A;  3RKQ A;  1MH3 A;  3K7A J;  5E3O A;  3SFI A;  4A3G J;  1JKQ C;  5C4X J;  3HDD A;  1MBG A;  5F0C A;  1MBK A;  1TWF J;  3BR0 A;  4XID A;  2K9N A;  1RET A;  5M5W J;  2LVS A;  1NTC A;  3HKZ N;  2DA1 A;  5E3M A;  3S1M J;  2M9H A;  1WPK A;  3ZQI A;  1VF9 A;  3S2D J;  3M4O J;  3JRD A;  4BBR J;  3BG5 A;  1JJ8 C;  1ETV A;  1QVU A;  2O7O A;  1JUS A;  1B8I A;  1TWG J;  5F27 A;  3S16 J;  1GUU A;  1MH4 A;  2TRT A;  4A3I J;  1B8I B;  1BL0 A;  3O8G A;  1WH7 A;  2NVQ J;  3CQZ J;  1Y1V J;  4JX4 A;  2G0E A;  2FX0 A;  3A02 A;  4MFE A;  1PUF B;  3BTI A;  2DN0 A;  1WCM J;  5GPC A;  5EDN A;  1BJZ A;  4XRS A;  2FD5 A;  1ZR4 A;  2FQ4 A;  3D1N I;  3HGY A;  1IV6 A;  2COB A;  2XPU A;  4V2G A;  2DMQ A;  3JRH A;  2DA2 A;  3BTL A;  4A3E J;  5E3L A;  4NDL A;  3S1R J;  1LFU P;  2EZK A;  2WV1 A;  2LK2 A;  4MFD A;  3ZQG A;  1ETY A;  2VKE A;  1JUP A;  2HOA A;  3GBG A;  5F0H A;  2JA7 J;  3BG9 A;  1ZKG A;  2HYJ A;  3DEW A;  4FTH A;  1UG2 A;  3BTC A;  5DTD A;  3K2A A;  1P7J A;  1BW6 A;  3WHB A;  5EEA A;  2XRL A;  4UUS A;  4UUS B;  3OSF A;  1ITY A;  5BNG A;  1BW5 A;  2HXO A;  4UUT A;  3ZOB A;  1HF0 A;  3MVP A;  2ID6 A;  4M3B A;  2X9D A;  3LSP A;  1GV2 A;  3RQI A;  3PO2 J;  3FIW A;  3TP0 A;  4QTR A;  2JWT A;  2EH3 A;  5EZG A;  1HLV A;  3PM1 A;  4M3F A;  3GTJ J;  2DTZ A;  3SJM A;  2HOT A;  1FEX A;  2Y2Z A;  1IJW C;  2EZI A;  1ENH A;  1GT0 C;  2MGQ A;  2Y9Z A;  4J19 A;  1UMQ A;  4BY1 J;  3HEF A;  2JK3 A;  3HOU J;  3FIS A;  3G1M A;  4XK4 A;  4JX6 A;  2JJ7 A;  1R9T J;  1GV5 A;  2QCO A;  2L9R A;  2WAQ N;  3OOU A;  3QPS A;  3JRG A;  4JYK A;  4S0H B;  1IC8 A;  3JRF A;  2D5V A;  2HXI A;  4IEJ A;  3HB9 A;  1HOM A;  1U8B A;  4LOC A;  2TCT A;  4W1U A;  3TED A;  2KT0 A;  3G1L A;  3LSR A;  4A3C J;  2Y31 A;  4AYB N;  1JT0 A;  4A3B J;  4BXX J;  1RKW A;  2AO9 A;  1S7E A;  4EEF G;  2R92 J;  1FJL A;  3LNQ A;  3C2B A;  3I4M J;  1WGX A;  2B63 J;  1OJL A;  2P81 A;  4JX5 A;  4V2F A;  3B6C A;  1APL C;  2N8G A;  4DYQ A;  2O9L A;  1XS9 A;  2NVX J;  3Q3S A;  3S1N J;  2Y30 A;  1OFC X;  2L7M P;  2X48 A;  2XGC A;  3ZQF A;  1H88 C;  1I3Q J;  2WB1 N;  4FE7 A;  4A3F J;  4JP0 A;  2NS7 A;  1JKR C;  3HGG A;  2E19 A;  5FLM J;  3VPR A;  1T33 A;  4QSH A;  3BR6 A;  3TW6 A;  1OCP A;  3LSJ A;  1JUM A;  2IEK A;  4BY7 J;  1AKH A;  5C4J J;  1AKH B;  3BQZ A;  2XPW A;  4FIS A;  3ZQL A;  3HOY J;  2R7Z J;  1ETO A;  3S2H J;  2DJN A;  5EYR A;  3BR3 A;  1GVD A;  1XC5 A;  4XRS G;  5EF6 A;  2VI6 A;  3MN2 A;  1IDZ A;  3JRA A;  2LTP A;  1RKT A;  2X6O A;  1Y1W J;  2YS9 A;  3Q0V A;  3HOW J;  2E1O A;  2XB5 A;  3A01 A;  1W0T A;  1IGN A;  1JGG A;  5F08 A;  4D5F A;  1IDY A;  2M0C A;  3HM5 A;  2DA7 A;  2QF7 A;  2GBY A;  1QPI A;  1FTZ A;  1WH5 A;  2H8R A;  2DMT A;  4AUX A;  1ZQ3 P;  3H0G J;  2CU7 A;  5IYC J;  1MBJ A;  4A3J J;  4A3K J;  3LSG A;  1EF4 A;  3G1O A;  2H1K A;  2OF7 A;  3QPL A;  2LR8 A;  4D7M A;  4BKX A;  1D5Y A;  2K9S A;  4M3D A;  1A6I A;  5IPA A;  5FLV A;  1X2N A;  3GTQ J;  5C3E J;  3HOX J;  1LE8 A;  1ORK A;  3Q0U A;  2ECB A;  2VKV A;  5FKN A;  1YRN A;  2R93 J;  4D7N A;  1ETQ A;  3BT9 A;  4GFB A;  3IV5 A;  3IH2 A;  1YRN B;  5FKM A;  2CUE A;  4FE4 A;  3HBL A;  5EZH A;  1ETW A;  2JA5 J;  1VI0 A;  2VPR A;  3M3Y J;  2JA8 J;  2HDD A;  5FKO A;  4MIM A;  1FTT A;  2I10 A;  1IG7 A;  3TP3 A;  1ZTR A;  2M34 A;  5K7Z A;  3GTP J;  1ETX A;  1VFC A;  1QRY A;  1NK2 P;  4M3G A;  3BTJ A;  2KDZ A;  5EGO A;  2R5Z A;  4MO7 A;  3JRB A;  1UHS A;  1AHD P;  3I4N J;  5EGO B;  4DYC A;  2R5Z B;  2NS8 A;  5M5Y J;  1JJ6 C;  4DZJ A;  1MBF A;  9ANT A;  5IYD J;  2CQQ A;  1ZGW A;  1JTX A;  1W0U A;  1TWA J;  4A3D J;  2ID3 A;  3A03 A;  4Y7N J;  1MBE A;  2XSD C;  2LP0 A;  3GTK J;  3UKG A;  2ECC A;  2JN6 A;  1H89 C;  1O4X A;  2HI3 A;  2LFB A;  1BA5 A;  5J3L A;  3ZQC A;  3GTM J;  1AU7 A;  1MSF C;  3CMY A;  5IOY A;  3JRC A;  3BR5 A;  1Z77 A;  2L0K A;  2L7F P;  3OSG A;  4G12 A;  2EZL A;  4IHW A;  1WI3 A;  2CUF A;  2ME0 A;  3JRE A;  5FKL A;  4C3J J;  5DS9 A;  4X1E A;  2M8G X;  4HNV A;  2M2E A;  1HDP A;  1QVT A;  3NAR A;  2FJ1 A;  2AHQ A;  3QQA A;  3S14 J;  1RES A;  3WHC A;  3S1Q J;  2YU9 J;  1I6H J;  3GTO J;  2DA3 A;  4DW6 A;  1G2H A;  2XPV A;  1U9O A;  2DA4 A;  5JLX A;  2NOG A;  4IHV A;  1JTY A;  2K40 A;  2GM4 A;  4MLO A;  2W48 A;  3L1P A;  2R0Q C;  4M3E A;  4A69 C;  3RZO J;  2GLO A;  2E2H J;  2RAE A;  1IUF A;  4W97 A;  5GP9 A;  5IP6 A;  4BBS J;  2DA5 A;  2XGE A;  1HCR A;  2MSY A;  1TC3 C;  4DYR A;  5J1R A;  2DMN A;  2DMP A;  1CQT A;  5F04 A;  5IP9 J;  2LD5 A;  2R5Y A;  1P7I A;  1TWH J;  3FK6 A;  3A01 B;  5IYB J;  1Z0X A;  4RDU A;  2HQ5 A;  2R5Y B;  1U78 A;  1JKO C;  1ZK8 A;  1T56 A;  2LKX A;  5EG0 A;  3RZD J;  2CJJ A;  2DMU A;  1PUF A;  3S17 J;  4QIW N;  2LLK A;  5EG0 B;  2CQX A;  1E3O C;  2LY9 A;  5J1U A;  4B3A A;  4B1R A;  2NVT J;  2EQR A;  3F0C A;  5M3F J;  1MSE C;  1XG1 A;  1JT6 A;  1RPW A;  2ME6 A;  5FKK A;  2XB0 X;  1X2M A;  1VND A;  3HOV J;  1K83 J;  5HOD A;  4C2M J;  1IRZ A;  1LE8 B;  3JRI A;  5IOZ A;  5F0F A;  1RR7 A;  1POG A;  3O8H A;  4L5E A;  2O8K A;  1OCT C;  1U9N A;  4D5C A;  3W6V A;  1SFO J;  4A3L J;  2PMZ N;  2MW8 A;  3MKL A;  2OPT A;  1DU0 A;  4I6Z A;  1ETK A;  3BG3 A;  2E2J J;  3BQY A;  4CYC A;  5FJ8 J;  4ABZ A;  4X6A J;  1I50 J;  1ZR2 A;  3FK7 A;  1H8A C;  4CYC B;  2XGD A;  1A5J A;  4A93 J;  1K61 A;  4XIC A;  1F36 A;  4IHY A;  2VUM J;  1LFB A;  3BR2 A;  5K7F A;  4Y52 J;  2Y0S N;  2MG4 A;  1X58 A;  3BR1 A;  2E2I J;  4I76 A;  5M3M J;  3Q0W A;  3JR9 A;  3IH4 A;  3HOZ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...