1X2NA

Solution structure of the homeobox domain of human homeobox protein pknox1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
GSSGSSGKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the homeobox domain of human homeobox protein PKNOX1
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein PKNOX1
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x2nA01
3HEFA 5IPAA 2OPTA 5C3EJ 1QVUA 1MH3A 2R5YB 1BL0A 2EZHA 4RDUA 3LOCA 5K7ZA 4DYQA 3B6CA 3GTPJ 4MIMA 5GPCA 4A3DJ 3BTIA 1Y1WJ 3S16J 3BQYA 1JUPA 4B1RA 4UUTA 2NS7A 1RESA 1RETA 5EZHA 4C3HJ 5FLVA 4V2GA 3E7LA 5E3LA 1WI3A 5EZGA 1VI0A 1ZGWA 4V2FA 3MN2A 1IDYA 2M9HA 4FISA 1ENHA 2L9RA 2R7ZJ 2Y9ZA 1A5JA 1JKRC 5IYDJ 1IUFA 1GUUA 1B72A 2YUSA 3OSFA 2DA7A 5FLMJ 3S1QJ 3GTQJ 4XK4A 4BY1J 4A3CJ 1JUMA 4M3EA 1HDPA 4IHWA 2ME0A 2CU7A 3FKIJ 2YU9J 2XGCA 1O4XA 3K2AA 3L1PA 2K9NA 3S1RJ 1U78A 2CQQA 2NVQJ 3S14J 3BG3A 5EYRA 4A3GJ 3CMYA 1MBKA 1IRZA 1MBGA 3HOUJ 2HQ5A 2Y9YA 2X9DA 4MLOA 3A03A 3HGGA 3HOVJ 4M3FA 1HLVA 2MGQA 1ETOA 2NS8A 3RQIA 4DW6A 5M3MJ 3JREA 1JTXA 2VKEA 2MG4A 1Y1VJ 1AKHB 1NK2P 2ECCA 5F08A 2IEKA 2YS9A 4M6VA 2L0KA 1POGA 1VFCA 5F27A 3G1MA 3CCYA 3NAUA 2VUMJ 3SJMA 4C3IJ 2ID3A 5JLWA 4BBRJ 1Z0XA 5E3OA 1FIAA 2DMQA 5J1YA 1TWGJ 2DTZA 1ZR2A 1OCTC 2HOTA 1B72B 1ETWA 1FEXA 1R9TJ 1OCPA 1WH5A 1TC3C 3I4NJ 2LP0A 1RPWA 4XRMA 2XB5A 1LE8B 1JT6A 3ZQGA 4ABZA 2GLOA 3HB9A 1MBEA 4FE4A 1MH4A 1U9NA 2NVXJ 3BTJA 4JX6A 3MKLA 4EEFG 4MFEA 4QSHA 3G1LA 2R5ZB 2Y0SN 3CDLA 4L5EA 1HDDC 5C44J 5J3LA 3GTGJ 4UUSA 1MBFA 1UHSA 3HOXJ 1HCRA 3F0CA 2R5ZA 3I4MJ 1HF0A 5K7HA 3SDGA 1S7EA 1ZR4A 4MFDA 3NARA 3CQZJ 2EH3A 4M3DA 4A3BJ 1BW5A 5HODA 4FCYA 1ZTRA 4DYCA 1WGXA 1AKHA 2JK3A 2JMWA 4A3LJ 4A3IJ 1TWFJ 3PO3J 3FIWA 3IH3A 3JRGA 2ZB9A 1VF9A 4A69C 3JRBA 1D5YA 1JJ6C 3DEWA 3WHCA 5F0CA 4Y52J 2Y30A 1ETKA 4IEJA 4JX5A 1FJLA 3S17J 1P7IA 4BBSJ 2FD5A 2HYJA 2MSYA 1EF4A 4A93J 2L7FP 4CYCB 2E19A 5FKOA 3DCFA 3RZDJ 5GP9A 1LE8A 3B6AA 4X1EA 2H1KA 1XC5A 2TCTA 1MSEC 3ZQIA 3S2DJ 4RBOA 1QVTA 2DJNA 2HOAA 3HKZN 5IP7J 2LVSA 3HOZJ 3FISA 1DU6A 1JKOC 1IJWC 4XRSG 1TWCJ 2P81A 2O9LA 3S2HJ 1ETQA 1DU0A 1LFUP 5M5YJ 2O8KA 3A02A 1GDTA 4DZJA 4B4CA 2E1OA 5IP9J 3VPRA 2H8RA 2FQ4A 3GBGA 2AO9A 5GPAA 5M3FJ 1JJ8C 3GTLJ 1TWAJ 1OJLA 3JRHA 2HXIA 4B3AA 1RR7A 5F0HA 1ORKA 4W1UA 5EF6A 1H88C 4M3GA 1F43A 2DMTA 1X2NA 3K7AJ 3M4OJ 5FJ8J 2Y2ZA 4XRSA 4X6AJ 4J19A 5JLXA 5EGOB 1VNDA 2EQRA 1NTCA 5BNGA 1XG1A 2ME6A 3BR6A 2G0EA 3GTKJ 3S1MJ 1GVDA 4XIDA 3IH4A 5IOYA 5EGOA 3HOYJ 2O7OA 3Q0VA 3QPLA 1A6IA 2DMUA 4JP0A 5IP6A 1JKPC 2EZKA 4D7NA 2JWTA 1WCMJ 1U9OA 2K9QA 2XGEA 2LD5A 1JGGA 2JA8J 1YRNA 2VI6A 2EBIA 2FJ1A 2VKVA 2N8GA 5K7FA 5J1RA 1W0UA 1T33A 3BR5A 1WPKA 4IHYA 5FKLA 1W0TA 5EEAA 3S1NJ 3ZOBA 2LY9A 2KT0A 2LKXA 2QF7A 4D5FA 1H8AC 1ITYA 2DMPA 3Q0WA 4Y7NJ 1LFBA 3H0GJ 3O8HA 4MO7A 4DZPA 3D1NI 4IHVA 1GV2A 1IV6A 2XPVA 2CJJA 3UKGA 5C4JJ 4HNVA 1FTZA 1Z77A 2E2HJ 3S15J 3JRDA 2R93J 3RZOJ 2X48A 4A3EJ 5FKNA 1Q1VA 5J1UA 1NK3P 4C2MJ 2M8GX 1U8BA 2EZIA 1I6HJ 2XSDC 2HDDA 3BR0A 1WH7A 4I76A 2LLKA 3LSPA 4G12A 3TP0A 3IV5A 1FIPA 2E2IJ 2Y31A 4C3JJ 1GV5A 2XPWA 4W97A 5FKKA 1K61A 2HOSA 1HOMA 3QPSA 2NOGA 2LTPA 2OF7A 2HI3A 3LSRA 4QIWN 1APLC 2R5YA 1JT0A 1H89C 3RKQA 2K40A 1JUSA 2DN0A 5DTDA 2CRGA 1CQTA 2DA6A 4BXXJ 1QRYA 2FX0A 3ZQLA 3FK7A 3IH2A 2DA1A 2K9SA 1RKTA 2D5VA 3M3YJ 3OSGA 1E3OC 1TWHJ 3HOWJ 5E3MA 3JRAA 2IBDA 2I10A 5FKMA 1F36A 1JTYA 2L7ZA 1JKQC 2ID6A 1AU7A 1K83J 2MW8A 4A3JJ 4CYCA 3Q3SA 4I6ZA 4NDLA 4A3KJ 3BR1A 2M0CA 5M5XJ 3ZQCA 3PO2J 1IC8A 1I3QJ 3QQAA 5F0FA 3HM5A 5DS9A 4XICA 3LNQA 2GBYA 4FE7A 3BTCA 3HBLA 1AHDP 3PM1A 3GTMJ 2W48A 1P7JA 3Q0UA 5EG0A 2DA3A 2TRTA 2PMZN 1IG7A 1SANA 2JN6A 2E2JJ 2EZLA 2M2EA 5EDNA 3LSJA 2XPUA 5EG0B 2WB1N 4UUSB 1ETYA 3GTJJ 3JR9A 2LFBA 2XRLA 4A3MJ 2DMNA 3TP3A 3SFIA 2LR8A 5IYBJ 2JA5J 3G1OA 1QPIA 3BR3A 2VPRA 5F1JA 2WV1A 2NVTJ 4FTHA 3C2BA 1X58A 1I50J 3BT9A 3OIOA 2L7MP 2JA6J 2B63J 9ANTA 3TW6A 3O8GA 3A01B 4AYBN 2AHQA 1T56A 2JJ7A 3W6VA 1IGNA 4JYKA 1X2MA 2M34A 1BW6A 1MNMC 1FTTA 2XGDA 1B8IB 1ZK8A 2CQXA 4LOCA 3OOUA 3A01A 3HDDA 2CUEA 1GT0C 1MBJA 1G2HA 3BG9A 4BY7J 4GFBA 1ZKGA 2X6OA 1YRNB 3BG5A 2WAQN 1RKWA 1OFCX 4JX4A 1MBHA 2R92J 4QTRA 4AUXA 3LSGA 3H3VK 2QCOA 3JRCA 1ETXA 3BQZA 2GM4A 3JRFA 5M5WJ 1BA5A 3WHBA 5F04A 5IYCJ 1ZQ3P 4S0HB 4D5CA 5E3NA 3BTLA 2RAEA 1UMQA 2DA2A 2KDZA 1BJZA 1MSFC 3TW7A 2R0QC 3FK6A 3MVPA 4A3FJ 5C4XJ 1IDZA 2NVYJ 1SFOJ 3GTOJ 2DA4A 1ETVA 3TEDA 2JA7J 4BKXA 1PUFA 2HXOA 3HGYA 1UG2A 2XB0X 3ZQHA 5IOZA 2COBA 2IAIA 2ELKA 4DYRA 3JRIA 1B8IA 3ZQFA 2DA5A 4D7MA 4AC0A 2LK2A 1PUFB 2ECBA 1XS9A 4IHXA 2CUFA 4M3BA 3BR2A
chains in the Genus database with same CATH superfamily
1L3LA 3ZQQA 1HW2A 3HEFA 2JA2A 3KZIC 1QVUA 4D1QA 4CH7A 1R36A 5K7ZA 3LFUA 3GVAA 4MIMA 3ZRGA 2WY7Q 3VDXA 2L4AA 3A2KA 1KU2A 3SZPA 3T8TA 3QU6A 1Y1WJ 2DCEA 3S16J 3W6KB 1YJNI 2ZC2A 3BQYA 2XRNA 4XKWA 3ZR8X 2UZKA 5IY5H 5FLVA 4UY8I 1B59A 3D5SC 3K6GA 1GHCA 4LB5A 4B43A 4FISA 1JKRC 5GAGJ 1I3AA 1K78B 1XGNA 3TO9A 1Z21A 2YUSA 4LB6B 3K4LA 4KIFA 4M74A 2X1EA 2QQ8A 1SAXA 1REPC 4A3CJ 2L3DA 1JUMA 2ZMEC 1HDPA 1KZHA 1I6XA 4IHWA 4IPAA 3HG9A 4B3XA 2R3SA 1D1BA 1RUOA 4XORA 3HHHA 1XDUA 2JQ7A 1KYWA 2K9NA 3ONQA 5J47A 1VQMI 1HXDA 4Q4ZF 4IVNA 1U78A 4G7HF 3S14J 2OD5A 2VJ5A 4ZDOA 2DQLA 3CMYA 1RI7A 1LFPA 1MBGA 3HSRA 4RM3A 1Z7UA 2ETHA 2HQ5A 4CCLA 2Y9YA 3CDIA 4F55A 4BE1A 1LJ9A 5BPIA 1HLVA 2HYGD 1ZREA 5M3MJ 2MG4A 1X19A 1Y1VJ 1AKHB 1NK2P 1MMNA 2RNJA 3Q9SA 2WAQA 4GGGA 3MD2A 4L9VA 3TKYA 2DT6A 3CC7I 1IN5A 1ZELA 1VFCA 2RKHA 3RQ4A 2ZJ2A 2E5NA 3CZ6A 1J9IA 2F5VA 4BBRJ 1S6LA 1FIAA 2HU9A 4LIUA 4UB8C 1OMIA 4C2UA 1FEXA 4I0BA 3PFYA 1TC3C 3I4NJ 2LP0A 4OAZA 2FSWA 4HV6A 2XB5A 4N4NB 1VQKI 4AYBA 2HVRA 1USSA 1O3SA 2IS2A 1EA3A 2H94A 4FE4A 3VEPA 1U9NA 2ICWG 1QGPA 2VBZA 4L9NA 1FYMA 2MFZA 3JCUC 4MFEA 1S3JA 2R7XA 3CCSI 4HF2A 3BOQA 4WF2A 3VYRB 2Y0SN 3C3WA 3FMRA 4CCOA 4LJZF 3CC2I 1ZG5A 3C2HA 1MBFA 4UUSA 1F4KA 3JAMZ 2P7VB 3HOXJ 1HCRA 4PFOA 3F0CA 4ON0A 3I56I 2BY2A 2L9VA 2VN2A 1IO2A 2CUJA 3F22A 4L0ZB 4XN0A 3IL2A 3HSFA 3BG6A 4MFDA 3V4GA 3CQZJ 3MKZA 2DXIA 3DBHB 1HW1A 2JSCA 1BW5A 5HNHA 1ZN2A 4DYCA 2HQAA 2A05A 2WAFA 3EUHA 2IA0A 4BE0A 2HDCA 3PO3J 1BIBA 1FBUA 2BE5F 1JJ6C 3DEWA 5F0CA 2Y30A 4IEJA 5HS7A 1XD7A 3PSFA 4M73A 5D8KB 4K2EA 3G71I 2FD5A 2HZTA 3TDZC 2E71A 4A5MA 1FT9A 3DU6A 5LHGA 3V42A 2F5FA 1LUJB 3F8MA 3OYHA 3BY6A 4DJAA 3M07A 3I55I 3DV8A 5GP9A 1CF7A 6PAXA 3M8JA 3S2DJ 2GQQA 2DJNA 2HOAA 3HKZN 5IP7J 3PNTA 1E3PA 3AL0B 2ZKZA 2XAGA 3HOZJ 5E1XA 2ZSIB 1BM9A 2QQAA 3OYJA 1V55H 1WQ2A 2DYSH 3HZJA 4PGGA 1IJWC 1ERDA 1TWCJ 1X1CA 1DDNA 2H27A 1ETQA 1O7FA 1OCOH 1ZYRF 2O9LA 3ZMUA 2DT7B 2ZNYA 4E6KG 1ULYA 3CLQA 1ZG1A 5M5YJ 5D5VB 3CCMI 2L7KA 3LAPA 1VQ7I 2BHYA 2IA1A 3LA2A 1XSDA 1H9TA 1GLNA 2ZNZA 2RNGA 1BC7C 5IP9J 2Y48A 4NQWB 5ICGA 2H8RA 2BY3A 2E36A 3GBGA 3S3OA 4P96A 1JJ8C 4RAFA 3GTLJ 4Q47A 3JRHA 2HXIA 4B3AA 5E79C 1WI9A 5F0HA 1R6RA 2E5ZA 2VLAA 5EF6A 2DMTA 2V26A 5K5QA 4BQQA 1ZH5A 3H5NA 3WU2C 4XRSA 4X6AJ 3ZGKA 4BQAA 5FLXK 3WGIA 3M8FA 5FD6A 4MGRA 3J7YJ 4HAMA 1U5TA 4XM3A 2P5LC 1ON2A 4A0ZA 4RAZA 3S1MJ 1W4MA 1T8IA 3H36A 4TV7A 5IOYA 2ZJRF 1Z6RA 4XN3A 4M9XA 4RB3C 2CFOA 2DMUA 1KYZA 2VJIA 1P92A 3F9KA 4HNUA 2F4MB 3SZGA 1EH6A 2RDPA 4I01A 1U9OA 1W36C 1JGGA 1D0ZA 2JA8J 3RCOA 2VKVA 2R7OA 3T5XA 2FBIA 3K4KA 3ERED 2KRHA 4E7JA 5K7FA 3W2AA 2JTVA 3BR5A 3NEUA 3V8KA 5FROA 1SFEA 3ZOBA 2JVGA 2EILH 4LMYA 1U6GA 2NYXA 2GXBA 3FBNB 2QF7A 1R49A 1X1BA 4IX7A 3DTKA 3Q0WA 3AG4H 4LLNA 2XAHA 4BHBA 4C2TA 3D1NI 1QZEA 4DBRA 4LG0A 2XPVA 1UB9A 2CJJA 3RTRA 3BLYA 3U9GA 3K69A 1BOAA 1FTZA 3I0TA 3X2QH 1NG7A 3FF5A 1ZHFA 1FOKA 3S15J 1G3WA 2R7QA 2LG4A 5D6EA 2DOAA 5KAFC 3LFKA 5FKNA 1H0MA 3FM3A 3T0YA 2KPMA 2UXXA 3E3VA 5J1UA 4EM2A 5BS6A 2A07F 5HVQC 1U8BA 2HVQA 3EQLF 2ZMEB 2HR3A 3E6MA 3OYNA 2KP6A 1BI3A 4HEA2 2Y0MA 2HDDA 3PIPF 3K1NA 4I76A 2IA2A 4FX4A 3SZTA 4G12A 2J5PA 1UAAA 2MH9A 4YIRX 5TJJA 1YHQI 1GV5A 2EJRA 2XPWA 1J0RA 3OYFA 1A04A 2NOGA 3RYPA 1MJ9A 1HA8A 4MNUA 2JPCA 2XF5A 2YSRA 2IGKA 5CVJA 2DN0A 2CRGA 1WKMA 2VJ4A 3P7NA 4BGDA 4RLFA 3S93A 2FOWA 2VQHA 2DA1A 4FETA 2D5VA 3LWFA 4EJWA 1E3OC 2R7VA 3BJ6A 2W1OA 1VQNI 3HRSA 2L54A 4G6QA 4QLCU 3JSOA 1F36A 2IXSA 3NWTA 4OMZA 1OISA 4ENNA 3H35A 4HA8A 2ZCWA 4RB0A 4XLCA 4II3A 4RGUA 4ZYAA 4XKVA 5K5OA 4EV0A 4A3JJ 2R7TA 4CYCA 4A3KJ 4NDLA 1YW9A 3RKXA 2R7RA 1FMWA 1S5LC 5M5XJ 4Y4RA 2XF7A 1I3QJ 3QQAA 1TW2A 1GXQA 2LC2A 3BDDA 1KQ9A 3DBRB 1G6NA 3KCCA 5DS9A 1X1PA 4XSZF 5CJ9A 1YS7A 2D45A 3DPLC 1BBYA 3BTCA 2K5CA 3QYFA 3GLLA 3GTMJ 2O8XA 4S05A 4XQFA 4V19K 1BC8C 5LGUA 1XCVA 1SANA 1VQ4I 2JN6A 2FA5A 1QBJA 3MWMA 2J5OA 2IGNA 2WB1N 4N4OB 2GWRA 2NNNA 3HL2A 1FX7A 1WJCA 5AONA 4A12A 4IQJA 4RMNA 5FO5A 2KZVA 4U0YA 3DPUA 3OYDA 3OS1A 1QPIA 2Y0SA 3LL7A 5LD2C 3HIFA 2WWYA 1Z91A 4KMFA 2VPRA 4KICA 1D1CA 2NVTJ 3C2BA 1I50J 2EV0A 3OIOA 5IT9Z 3CTAA 2JPBA 3ZQ7A 2EINH 1ZLJA 4AYBN 2NS0A 3H3ZA 3GZ5A 2VBWA 3CJRB 2JJ7A 3W6VA 3LMMA 2M34A 1W7PD 3IC7A 2EIKH 2PJRB 3A01A 3HDDA 2JT1A 3MZHA 1G2HA 2X1DA 4CCJA 3QWLA 3LA7A 3ZMVA 1RIOH 3DKWA 1J75A 1O3RA 4KFCA 4F52A 2Y69H 3W3CA 4EQQA 4I7HA 2XDVA 4PJNA 3ABLH 3FXRA 4BEHA 2ISZA 1G4DA 4I09A 3WE3A 3S3MA 2ZXJA 3G4SI 1X1AA 2GM4A 3JRFA 2B9SA 3CUQA 2DLLA 3PQKA 3GFJA 4HSTA 3RI4A 3CMAI 5ICFA 2STWA 1CGPA 4G94A 1ZAOA 1EH7A 4KJZA 4KN4X 2IT0A 3VFZA 3F6VA 4S0HB 2ZFWA 1TP4A 3MEXA 3H5AA 4DQ2A 5ICCA 2OQRA 1MSFC 1BJZA 3ABMH 3IKTA 3RYRA 3DLAA 2R0QC 2HYFA 3FK6A 3GLXA 4H4KC 5C4XJ 4UVCA 3E6BA 2C6YA 2VB6A 2NVYJ 2DOEA 1SFOJ 1O57A 4BH9A 1UG2A 1HKSA 3KP6A 1IN7A 3E5QA 3ZQHA 5IOZA 4YIIA 2ELKA 3TL4X 4LG3A 2ECBA 2YX4A 3AAFA 1DGWY 3CLOA 4AIDA 1PUEE 1LQ1A 3DLLF 4UHTA 2OPTA 2K27A 5C3EJ 1MH3A 4EM1A 2R5YB 3BZKA 3OYMA 3C1DA 3B6CA 3GTPJ 3QU3A 3MZ8A 3JTGA 4A3DJ 1OQYA 2EB7A 4IXAA 3K70D 3ZPLA 3TBIA 4OINF 3I9V2 3A0BC 3OR1C 5FLXZ 3D5LA 4UUTA 1RESA 4B44A 3U2RA 5J8FA 1WI3A 2CH0A 5EZGA 2DPUA 3F23A 3VYUB 1ZGWA 3CMEI 2L9RA 2OZUA 4KN7X 2KHMA 2Y9ZA 4PK4A 2LY1A 3KETA 1FOYA 3SEZA 1NHAA 4XK4A 1ACIA 2P7CB 4EJUA 2E35A 3EYYA 3FDYA 3EUAA 3MQ0A 4HZFA 4FHTA 3FKIJ 4OWRB 2XGCA 5D4RA 1Z1DA 3AG3H 1ZLKA 2DT5A 1WZ2A 1YQAA 2CQQA 1BJAA 2DYRH 4NUBA 5EYRA 4A3GJ 1IUYA 1MBKA 2BY1A 2L2OA 2DI3A 4ENJA 3K2ZA 3OV8A 4MLOA 3FKJA 4M3FA 2LBFA 2MGQA 1R5HA 4DW6A 3JREA 5JR3A 4OIQF 1FSHA 2P8TA 3O3KA 4CO8A 2PMHA 2ECCA 1J59A 1Y6IA 2YS9A 3BPVA 2M4GA 1RC9A 2ELHA 2XIGA 2HTJA 4LIVA 5F27A 2VUMJ 1I27A 1XGOA 5L3GA 4E7ZA 2EA4A 5JLWA 2V1UA 5E3OA 3GFMA 3T8RA 1VQ9I 4IRGA 5KAIC 3GX4X 4Q5SF 1W7PA 5J1YA 1K78A 1ETWA 1R22A 4WXDA 1R9TJ 1OCPA 3HRUA 1U3EM 2X6WA 2XV4S 2K9LA 2LYCA 3K4JA 2GLOA 3HB9A 3KZZA 5LHHA 2KL4A 3EPZA 2YPRA 2X6XA 2Q8KA 1A36A 2NVXJ 3JTHA 4EEFG 4M72A 2XAJA 5BOXA 3AFHA 2E1MC 2E7WA 4RGSA 1IRFA 4LGWA 3ASNH 4KT6A 2KIUA 3CDLA 4L5EA 1HDDC 1R7JA 5J40A 1XCBA 3A0HC 1A6QA 5E18F 2V6CA 3I4MJ 1MKMA 1T0FC 4ESJA 2ZJQF 1S7OA 1S7EA 3SDGA 4YFKF 2GA1A 1YX3A 2DBBA 2QA4I 5DM7F 1XPXA 4M3DA 2O61A 4I99C 1R71A 1ZTRA 5H2FC 1FBQA 3GMEA 4UV9A 1TWFJ 1TQMA 4G6TB 2CWEA 3IH3A 3JRGA 4A69C 3JRBA 5DCMA 3WHCA 4Y52J 1IN4A 4LD5A 1ETKA 2W84A 1S9HA 3EDPA 4BS9A 2VC0A 5ED4A 3J7AY 1UHWA 1P7IA 5LLQA 3HUGA 2FE3A 2MSYA 4IHSA 4A93J 3DXJF 3OYAA 5BQTA 3E6CC 1QQIA 1JE8A 3M8EA 5FKOA 3DCFA 3RZDJ 1LE8A 3KIOA 1RZ4A 3M1EA 4GXOA 4X1EA 2WA0A 3L2QA 2ZBKA 3ZMTA 4E7HA 4RBOA 1QVTA 4EMSA 2IS1A 3CCLI 1YIJI 1YG2A 1ODDA 4IZZA 2LVSA 4HX4A 2CG4A 2DDBA 1SEUA 1DU6A 2DO7A 1MJBA 5E1ZB 4XRSG 3SFZA 5EJCA 4XLHA 1X3WB 2ZXIA 1T08B 1LFUP 4F93B 1ZRFA 2M87A 3K9TA 1WFXA 2O8KA 5E1WA 3A02A 1GDTA 2E1OA 3K4MA 1QU3A 4RM2A 1LDJA 1ZARA 4RB1A 1ZGJA 4ZTFA 1LKXA 3OIQA 3QOPA 2P6SA 2QWWA 3QODA 2I8DA 1ON1A 1YE9A 3ZCOA 4LG0B 3KP5A 2O3FA 1D8JA 5ERIA 1XX5A 3DTIA 3IAM2 4BHPA 1LB2A 2K02A 4M3GA 1W36D 5HS9A 2XROA 3LSTA 2HGCA 2Y2ZA 1X3ZB 4FT8A 2H09A 3CCVI 5JLXA 5F6FA 2ZMEA 2FXAA 1J09A 3WTYC 4IO9F 1WSUA 1LVKA 1NTCA 3C2GA 3ABTA 5BNGA 1IAWA 2PLYA 3S2WA 4JBAA 1R00A 2B0LA 3GTKJ 4XIDA 3IH4A 5DV5A 4RLQA 1OYWA 4MQ9F 2DW4A 3QPLA 3G73A 4KYWA 1A6IA 3NWSA 1DP3A 4JP0A 1PDNC 4QWQA 1JKPC 2JWTA 2K9MA 4E7LA 2XGEA 2LD5A 4PSWA 2FJ1A 3AG2H 2N8GA 2CV1A 1K7AA 1N78A 4IHYA 3VYSB 5EEAA 3WG9A 1LDKB 1VQLI 3CESA 3ISPA 1WRJA 1TT0A 4E4HA 2LKXA 4LK1F 2VQLA 3I3LA 2IGOA 1H8AC 2DMPA 3H9GA 1BR4A 5HLTA 1HC8A 3PNVA 1SVOA 3I58A 4HV5A 4BDYA 5BPDA 1KONA 4IOAF 4HDVA 1IV6A 3KYCB 1W5SA 4O3MA 2AXTC 2OV7A 3IRQA 1BI1A 3VB2A 4HNVA 4IRIA 1Z77A 1VQOI 1LDDA 4II2A 1QPMA 3MZYA 3JRDA 2K86A 2LKSA 3HPHA 2R93J 1B9MA 2E1NA 3O2PE 4B09A 4H0EA 3PL8A 2KFDA 5D6FA 3FXJA 1SFKA 5L3EA 5JHUA 3BR0A 1WH7A 3RPUD 5CKTA 5IT9K 1TQIA 1QZYA 1FIPA 2E2IJ 1QZZA 3OR2C 1TTYA 4W97A 5FKKA 1STZA 4YRVA 1R1UA 1D8KA 2G9WA 1SFXA 2OF7A 1TLHB 1SVLA 2H8WA 3MCZA 3RPQA 2HQRA 4ZZLA 1B6AA 1H89C 3CP2A 2HVSA 3WG7H 1JUSA 3DEUA 2MH2A 3K1MA 2DA6A 1WJDA 1CQTA 4BXXJ 5HLGA 4FASD 1QRYA 1UELB 2UWMA 3IH2A 2X4HA 2FEZA 2ESHA 2QEXI 4RA2A 3KFWX 2IW5A 3JRAA 2A6TA 3L2UA 1TL8A 3EETA 2IBDA 2I10A 4PSXA 5FKMA 1E0EA 3PSIA 5F64A 5DD8A 1XMAA 5HS8A 2L7ZA 2ID6A 2E7XA 4IQ4A 4XMYA 4HBLA 4AD9A 1MMSA 3Q3SA 4I6ZA 3BR1A 5GADJ 5HOOA 1P4XA 4BE2A 4Y33A 2CYYA 1EH8A 3KEQA 3HHGA 5DUKA 3CCRI 3HM5A 2ZXWH 3LNQA 1W1WE 2PQ8A 1YYVA 2FNPA 3QAHA 5B66C 1Z7LA 1WJBA 5JVTA 4GCVA 3H9JA 3Q5FA 1S72I 3PM1A 3FHZA 5FB2A 2W48A 4HDUA 2OTJI 2DA3A 4CZCA 2PMZN 2RGVA 3I64A 2AQEA 1XN7A 2E2JJ 3H1CA 5JVGF 4ZH4F 2QBYA 2M2EA 5EDNA 3LSJA 3QP5A 1TZLA 3N97A 4XBFA 1ETYA 4PUSA 3JR9A 2KRCA 4XSXF 2LBFB 2BEOA 4AIJA 2LFBA 2OZ6A 3TP3A 2LR8A 5IYBJ 3QPTA 2P6TA 4PZJA 3G1OA 4XKCA 3UR3C 4ZTJA 2HS5A 2HNHA 2HKXA 3F8FA 3BR3A 1SD5A 4RGRA 3M9AA 5K5RA 2WV1A 3VWBA 2PX9A 3W2VA 1ONVA 2VPLA 3BT9A 3F8BA 2X6YA 2L7MP 1K4SA 1QA6A 4L5IA 4OIRF 2KIMA 9ANTA 3OS0A 4XLPF 1W7PB 4BHCA 2L02A 4S04A 4IOCF 2VIXA 2VQGA 3E6DA 1X2MA 2HZDA 2XAFA 2XAUA 1ZK8A 2OCCH 3OOUA 4XL9A 5TISC 2R7WA 3AL0C 3OOPA 3BG9A 1BR2A 2XASA 1YFHA 3L2RA 3KP2A 3HXLA 3KP7A 5FFXA 1AWCA 3CF5F 1ZRCA 1OFCX 4JX4A 4HNTA 2R92J 4QTRA 3H3VK 3TOBA 1VQ5I 4XNFA 4GYGA 1ETXA 5HDNA 1DGRM 1BA5A 4DBQA 1ZRDA 2HKOA 2L5QA 2DK8A 2DQRA 2W7NA 1R1TA 3IRRA 1ZQ3P 2BV6A 3IWZA 3KP3A 4UVBA 5D5XB 4J00A 1MMDA 1W5CC 1LEBA 3MKWB 4M9ZA 2QKMB 3CCUI 3FXUA 3D5RC 4A0XA 1PP8F 4A3FJ 1JXSA 3PNYA 4WX9A 3ZMSA 4Z6YA 1IDZA 3W6JB 4CZZA 4DNCA 1FP2A 2NNYA 4PCQA 1T38A 3TEDA 2KRFA 2JA7J 1PUFA 3HGYA 3GZ6A 2NRAC 4UUVA 5FRNA 1BN5A 4R8HA 2IAIA 3JRIA 2VL8A 5ILSA 2M1BA 4L9JA 1B8IA 3ZQFA 2VXZA 5IT3A 4AC0A 2AXLA 2LK2A 3IHUA 3M1CA 4HW0A 4CA0A 4KISA 1J2XA 2CUFA 1TWHJ 4M3BA 4LK0F 1FY7A 2LDUA 4ZYGA 5IPAA 2E34A 3BC8A 1R5ID 1YOVB 3LOCA 3L09A 1FNNA 4WCGA 1PJRA 3S3NA 2K4JA 3HSEA 1LNWA 4XLNF 4KUMA 3OYBA 1OKRA 3GEZA 4Y3OA 3BJAA 4B1RA 4P9UA 3J7AO 4BDZA 1RETA 3TO6A 1KU7A 2L4MA 3E7LA 3CO6C 4OIPF 1I1SA 3MN2A 3K1PA 2R7ZJ 4LITA 1A5JA 5GAHJ 3BZ6A 2BHZA 5KNLA 1IUFA 1GUUA 2OAZA 3BZCA 2LY2A 3K4BA 3OSFA 2KIQA 2VT3A 3KPHA 3GTQJ 3U1DA 4AIHA 4AVZA 1X1DA 2BBYA 4XONA 4BY1J 1UJ8A 2F2EA 4M3EA 2VKHA 1OCZH 4UB6C 2DAOA 2F5CA 4BQOA 1X4OA 1I5ZA 2MABA 2YU9J 2K85A 1E2XA 1O4XA 3S1RJ 2QSGX 5EEHA 3I71A 2NVQJ 3BG3A 1MGTA 1JHFA 5ILUA 1XSVA 1XGMA 1IRZA 3HOUJ 1Y8RB 3R0AA 2OQGA 2GIZA 2NOJB 1SD7A 3DU5A 3CDHA 2R7SA 2X9DA 3TQNA 2O6GE 3Q9VA 1AOYA 2VODA 2BXZA 1HBXG 2NS8A 3DKYA 1P4AA 5A2QK 1JTXA 2EFOA 4EM0B 3OYEA 5LHIA 2IEKA 4XOPA 1AA7A 2VE9A 4M6VA 4BAYA 5KK1A 1U0JA 1BR1A 3V8LA 4GRIA 4NC7A 2LH9A 3BCBA 3G1MA 3NAUA 3HKZA 4DOZA 1YX5A 2ID3A 3QYBA 1Y8QB 1Z0XA 2VXDA 2Q1ZB 2R4GA 4N9HA 5J8CA 1Z67A 3KEOA 4MHGA 1TWGJ 2BVLA 2DTZA 1ZR2A 1SD4A 1S8NA 4BYYA 1B72B 1WH5A 1YIOA 1RPWA 4XRMA 4E7SA 2X85A 3OL4A 2ELJA 3P9KA 1LE8B 4HYEA 3KYDB 3ZQGA 4ABZA 2F4OB 1IF1A 1JHHA 3HYIA 1D5VA 4CUGA 1MBEA 3BTJA 2DK5A 3MKLA 2MBFA 4NC8A 1WJEA 2R5ZB 5CQEA 5J3LA 3F6OA 4U7DA 1TT5B 2R5ZA 5K7HA 4EGZA 3KP4A 1ZR4A 3V8JA 1HW5A 3NARA 1YS6A 3G6EI 4FCYA 1T95A 2Z2SB 1JI8A 4EVIA 1WGXA 4L18B 2JK3A 2JMWA 1XMXA 4A3LJ 4A3IJ 5J4VA 4CSWA 2ZB9A 1D5YA 4L0YB 1XB4A 3GFIA 5L3DA 2A6HF 4JX5A 4ENKA 1FJLA 1E17A 4BACA 2BVMA 3S17J 4BBSJ 4GYIA 2HYJA 2L7FP 2M7BA 1TNTA 3TMOA 2E19A 2ZJPF 5TGTA 3BPXA 3V7CA 2Z1DA 1MW7A 1T6SA 3LQRA 3HTSB 4UVAA 2A68F 4F7ZA 2JRMA 1JKOC 1OCCH 3K4CA 3BCAA 3S2HJ 1WVRA 1DU0A 1SD6A 3J80Z 3EUKL 3KZYA 1FOXA 1J7KA 1XSXA 3V7RA 3R6SA 4N9IA 3OS2A 2QBYB 1IXRC 1GXPA 1MMGA 5LEKA 5DCFA 1V3FA 4B4CA 1UG0A 2CV0A 1KU9A 3F8CA 2XVCA 3BROA 3VPRA 2FQ4A 3AKZA 1D0XA 2AO9A 2XKPA 4GDFA 5GPAA 3R4KA 1TWAJ 1OJLA 4KT5C 2GAUA 2UXNA 1RR7A 4ENMA 1ORKA 5CVRA 3KLNA 5FRMA 2UV1A 4EGYA 3DBLB 1B4AA 3ABKH 3H9QA 1F43A 1X2NA 5ILVA 3K7AJ 5CPRB 1LPQA 3E1SA 5FJ8J 3DKXA 1P6RA 2Y75A 3P9IA 4J19A 2GXAA 5EGOB 1VNDA 3M7GA 1SVMA 2EQRA 3WTSC 1BIAA 3KX2A 2ME6A 3BR6A 2V9KA 4HQMA 1C0WA 1GVDA 2EK5A 5EGOA 2CO5A 2EV6A 2O7OA 2P0WA 2MD5A 2OCEA 3S32A 3QYEA 3DF8A 2EZKA 5LBQA 1D0YA 4PJMA 1FBSA 5KHDA 1WCMJ 1R5GA 3VSKA 1V5FA 2EBIA 1I39A 2KMUA 2UUZA 4U0VA 4I2OA 5E8GA 1TNSA 4DGWB 4RS8A 5B1AH 5J1RA 1T33A 2BY0A 3CJTB 4WXHA 1E3HA 3WTTC 1W0UA 4AVPA 2QVOA 4IHTA 2BGCA 3S1NJ 3RKWA 2FRHA 1DQUA 2ESNA 4NHJA 3RDIA 2KT0A 4D5FA 2GXGA 2EFWA 2CUZA 4Y7NJ 4U87A 2GIVA 3H0GJ 2LSOA 2KISA 4YFXF 4DZPA 2PN6A 5LEJA 4L5JA 2KZGA 3L2VA 3MFKA 5AIQA 3K4NA 4BQNA 2VOOA 3G3ZA 5AIPA 3RZOJ 4A3EJ 4PJLA 3J81K 1SFUA 1PP7U 1Q1VA 2KKOA 1FSEA 2W00A 4C2MJ 2QLZA 2WAEA 1WJ5A 3H0DA 4PJ0C 1G59A 1K6YA 3FXLA 3I5UA 2IGMA 1WJAA 3ML6A 3ECOA 4JQFA 3LSPA 3SXYA 3FZVA 5D5UB 5LFAA 2VASA 2Y31A 1XMKA 2HOSA 2VT2A 5K1YA 2FF4A 2LTPA 3LSRA 5H6RA 1VZ0A 4QIWN 1UZCA 1APLC 2E1CA 3OL3A 5DTDA 2M30A 3WGHA 2RQPA 2PEXA 2CW8A 4M9SA 1G8XA 2HDWA 4KITB 3GCMA 3GXOA 3VOEA 2A5YB 3MKYB 1RKTA 2RC4A 3IP4B 3M3YJ 1OYYA 1Z3XA 2X1CA 3L9FA 4XLAA 3OSGA 2K3FA 1OCRH 3PUFA 5H6QA 2IVMA 4OU0A 5DCMB 3U21A 2XAQA 1JTYA 2MLKA 1QHHD 1MDMB 1JKQC 3OYCA 4PFPA 1K83J 3VYTB 2MW8A 1HSTA 3HUGB 4D9JA 1BOBA 3CF2A 4WK8F 4EJVA 4IRHA 3J7ZI 4HLXA 1ZG3A 1OR7A 2M0CA 3I59A 3ZQCA 4YELA 3ZMDA 4LFUA 1IC8A 2LF7A 3DWLE 3ERMA 1JGSA 1KQ0A 1G3SA 1MNEA 3E5UA 2W57A 4ZYEA 3K70C 4HF0A 2IJLA 1R4NB 2E1MB 2GBYA 4FE7A 2HTSA 4EJOA 4ZYHA 2FBKA 2GOMA 1AHDP 5JFRA 4M71A 2MD0A 2M8EA 5EG0A 3FMSA 2VJJA 1P4WA 1IN8A 3ABUA 3PFIA 4ZDLA 5CVIA 2JUCA 3ZXSA 3LSMA 2EZLA 1GVJA 2LNBA 2DOFA 4F3QA 2XPUA 5EG0B 3I54A 4B48A 2QGUA 4L9TA 4UUSB 3WTVC 2QYOA 4KNYA 4CCKA 1TW3A 4MEXF 3WODF 2A5WA 1RNLA 2XRLA 4JK1X 4A3MJ 2DMNA 2DJIA 4XOTA 2HOEA 5JI6A 2EFPA 3DFGA 4ZDPA 3ZP5A 2JA5J 1TQPA 5F1JA 2FNAA 4FTHA 1X58A 2PMZA 1D1AA 5CQGA 4QPOA 2B63J 3TW6A 2MYSA 1IXCA 1UFMA 3A01B 4IKFA 1S7AA 1MMAA 1T56A 4MQVA 1FC3A 2K7LA 1MD0A 3E0JB 4U0WA 2OJED 1IGNA 1G3YA 3GUDA 2DFHA 1A31A 1FTTA 2XGDA 1B8IB 4HPQA 3G2BA 2CQXA 3ELKA 3OIPA 4BNCA 2CUEA 4BUPA 1MBJA 3DQVC 4BEHB 2FU4A 3HOTA 4GFBA 1ZKGA 2L01A 2X6OA 1YRNB 2PJRA 3BG5A 1FZPB 2GA2A 4G9YA 1RKWA 5LGNA 1X3UA 2M4KA 2KIFA 2LKPA 4X0GA 1MBHA 5L3BA 4AUXA 4GO1A 1V5GA 2Q2EA 2BW3B 3EUHC 3BQZA 5M5WJ 1VQ8I 1MNDA 2FMYA 3I4PA 4A6EA 4B47A 1N75A 2P4WA 2K4BA 3EYIA 5IYCJ 2BW3A 3HC7A 3HOSA 5FD5A 1O3QA 2KJBA 1V4RA 4ITVA 2RN7A 4FX0A 2IP2A 3TDUC 2RAEA 2DA2A 5HDKA 1SAUA 3T1BA 4WWCA 2H6CA 3C18A 2KDZA 4CCMA 1IW7F 4G8XA 3TW7A 2DFIA 4O6JA 4I0AA 3MVPA 3C7JA 3BJOA 2W25A 4R1HA 3WTWC 5FFZA 3GTOJ 2HQNA 3N05A 5DYMA 2VQCA 1FOWA 5CYVA 4BKXA 4J01A 1ZGAA 4M6YA 2COBA 2P5VA 4DYRA 2EA2A 2RV8A 2PFBA 3LQQA 1O3TA 1KQ8A 4PJJA 1L0OC 2HPIA 5LGTA 5HNFA 1U5TB 4IHXA 4ETSA 1OCTC 2IRFG 3BR2A 4NBQA 1YO5C 2G7UA 1HQCA 5FGMA 2X0LA 1WWXA 1BL0A 2EZHA 1EJ9A 4RDUA 3ESWB 3FX3A 3B73A 4DYQA 3SEQA 3SQNA 4KA4A 3HRMA 5GPCA 4OIOF 2F4IA 2WY8Q 3BTIA 4MTDA 2OBPA 1WJFA 2CW0F 1YJ9I 5J4YA 1JUPA 2CSOA 5KVRA 1YTYA 2NS7A 4P9FA 4NQWA 5EZHA 3TO7A 4C3HJ 3H92A 4V2GA 5DUIA 5D5WB 3LAJA 3P9CA 5E3LA 1Y0UA 3FMQA 3OYLA 1VI0A 4V2FA 1IDYA 2M9HA 1ENHA 2D1VA 5IYDJ 1B72A 2EWNA 2DA7A 5FLMJ 2PBIA 1J5YA 2O0YA 3S1QJ 2NXNB 1USTA 3MMYB 2L9NA 3QP6A 4DIQA 1Z6TA 2ME0A 1U5TC 4UV8A 3QRFF 3CC4I 2K3PA 2CU7A 3KLOA 1K6OA 2XGXA 4N0BA 1O7LA 4EJTA 4KDPA 3F21A 5E17F 3K2AA 3L1PA 4AM3A 4CHUA 4E7KA 1PYVA 3W2WA 4CGZA 3HJEA 3AG1H 4P5OA 3SHFA 3CCQI 2HPMA 2V9PA 3ASOH 2H1LA 3K0LA 2R7FA 1IXSB 4XLEA 2NVUB 5HLHA 4I02A 2XSJC 4CDGA 3A03A 3HGGA 3HOVJ 3P5JA 5DDGA 2IS6A 3CJNA 3IAS2 1ETOA 4CXFA 3RQIA 2Z5UA 1KA8A 2VKEA 4QPQA 3BG7A 2HFHA 3NQOA 5F08A 3N4MA 2WC2A 2IS4A 2L0KA 3QPHA 2YX7A 2OU2A 1K4TA 1RUNA 3V7SA 2BYVE 2XF6A 4HSRA 4HF1A 1POGA 2I5UA 1D3YA 4M6XA 2XHKA 3CCYA 3O6BB 4BXUA 5A2QZ 2ZSHB 5H20A 4C3IJ 4KIGA 3SJMA 2H6BA 2ZFUA 3CP8A 1VQ6I 1HSJA 2DMQA 1IZ1A 3R61A 5GAEJ 1FMVA 2HOTA 2ISYA 3LSHA 1IRGA 3LSKA 2COMA 2W4SA 4OAYA 1JT6A 1S29A 1MH4A 4JX6A 1FYLA 4F92B 4QSHA 3G1LA 3VSLA 2R7UA 2W24A 4Z2YA 4LLGF 1DPUA 1FP1D 3BWGA 1YLFA 5C44J 3GTGJ 1UHSA 5E20A 3FXQA 3L2WA 3FBIB 5D8LB 3KEYA 1HF0A 3CD6I 4IF4A 4O5VA 5BMZA 2EH3A 4A3BJ 5HODA 2Z16A 1DUXC 4YEJA 4YG2F 1UHMA 2VC1A 1AKHA 2AQFA 1FPQA 1P9QC 4FQGA 1XDSA 3OYIA 2ACJA 1FLIA 1QHGA 3FIWA 2L9SA 3CO7C 1VF9A 1NH3A 4OMYA 3RJPA 1U8RA 1F5TA 2A61A 2VKDA 5KCMA 3CMMA 2KJCA 3ULQB 4Y13A 1EF4A 3I53A 4CYCB 3U1KA 3UNGC 4UXNA 3J80K 1B9NA 3CCEI 2NAZA 3B6AA 2H1KA 2VOPA 1XC5A 1TBXA 4ZJZA 2TCTA 1MSEC 4U88A 2LRDA 3REOA 3ZQIA 5D4SA 3IKVA 1YI2I 4ASNA 3FISA 5HLIA 2IPQX 2FQ3A 1XTAA 2M5WA 2JUGA 2P81A 1Y56A 3CCJI 2F6CA 3FXOA 4D0PA 1H9GA 2VE8A 3OMYA 4HQEA 4I98B 4CYDA 4MTEA 5B1BH 4HG2A 1Z9CA 4Q48A 3WU0A 2B7EA 2FBHA 2XUBA 4DZJA 3TGNA 1PVEA 3JSPA 2Q2EB 3L00A 1R58A 4AWXB 2V9VA 3E97A 4ESFA 5M3FJ 4XKBA 4NNJA 3FHNA 2OC6A 1MJAA 3RKYA 1WHUA 4WXCA 4W1UA 1QO0D 1H88C 2ZXHA 2F5DA 1T39A 2F48A 3M4OJ 3FXMA 3GZNB 2FUG2 1XGSA 3ZN1A 3L7WA 4C9YA 2VBXA 2P5KA 1XG1A 2TDXA 2WB1A 1Z05A 3ECHA 4F91B 2G0EA 3HOYJ 1CF7B 1W5TA 4E70A 2Z33A 3Q0VA 1K79A 1EKEA 2JSPA 3BP8A 5IP6A 4A0YA 2OA4A 3KYLA 4C30A 4D7NA 4ZC3A 4U7BA 1V5EA 2GZWA 3NRVA 4AU7A 5JHFA 1NG6A 2K9QA 3PQJA 3H5RA 1X4PA 3TOAA 2VI6A 1YRNA 2EFQA 3GYHX 3CUOA 3DTEA 3RPUA 1FYKA 2V1DA 1I1GA 1WPKA 2YR2A 5FKLA 1W0TA 2BOLA 2DTRA 2V1XA 2CW7A 2Z99A 2CS3A 3CUQB 2LY9A 2O03A 5B5EC 2YU3A 1ITYA 2RREA 1LFBA 3DPTA 1BI0A 3O8HA 1RR8C 5J6XA 2V6EA 4MO7A 4IHVA 1YW7A 1GV2A 3OYGA 4LLLA 3E5XA 3UKGA 2JRTA 2PG4A 3JAMK 5C4JJ 2E2HJ 4ANJA 2MC3A 2V4JC 4YIFA 2OTLI 4G7OF 2X48A 4BL0B 5CVUA 1QNTA 3IWFA 4BJ5C 2BZTA 3I59B 2LREA 1NK3P 2CQNA 2M8GX 5TRDA 2DFFA 2EZIA 3CJQB 2M7AA 1I6HJ 1HKTA 2XSDC 4XLFA 2O5RA 2R7DA 2VONA 3WE2A 2QSHX 5ICEA 1KGSA 2LLKA 5L3CA 3TP0A 3IV5A 5DD4A 2QQ9A 4P1WA 4C3JJ 5GTIC 2QKLB 5LRRA 2QM3A 1K61A 1HOMA 2LMDA 3QPSA 2V7FA 2HI3A 1R4MB 1Q1HA 5DEQA 3QOEA 2R5YA 1JT0A 2DDAA 2VBYA 3RKQA 2K40A 2W82A 1Y39A 2LOOA 4HOBA 5EEGA 2CMPA 4A5NA 2M3AA 4CCNA 3PIOF 2FX0A 5GTHC 3ZQLA 1HKQA 2E60A 3FK7A 1VTNC 3JW4A 3H3UA 2EIJH 1IV8A 2CFXA 2K9SA 4XRFA 3DEEA 5CLSA 3HOWJ 5E3MA 4BJ6C 2GOXB 3GO5A 1Y0NA 2MLGA 1IRXA 2QQBA 2CQ7A 1A35A 3R60A 4NB5A 3DP7A 1AU7A 1LVAA 2G7HA 3VODA 4A6DA 3HRTA 2EFNA 5DM6F 3S8PA 4A2UA 1V54H 2BXYA 3SDBA 3A4CA 4RGXA 3PO2J 4G6DA 5B3SH 2A69F 5F0FA 3OY9A 1LEAA 3WGGA 4XICA 4B8XA 3WU1B 4HX8A 3PJRA 2FMLA 2EIMH 2ADUA 2LF8A 4HX7A 3HBLA 2MC4A 2CV2A 3SYTA 2DPDA 4P55A 1P7JA 3Q0UA 2WBMA 3PUBA 3D0SA 2TRTA 2CGPA 1IG7A 2QENA 2V79A 1BI2A 3LA3A 4R79A 1YITI 1SMYF 1G3TA 2FOKA 5L3FA 2V1NA 2JZYA 2EPFA 2CQKA 4UNOA 1DPRA 3GTJJ 4YFNF 1N77A 4IJAA 4JOMA 2QZ8A 1T0FA 3RIRA 3SFIA 4G7ZF 2QSFX 3CUQC 2KDOA 3ROUA 3LSIA 1T2KA 1EV7A 2RQQA 1OPCA 1OR7C 1KU3A 3GW2A 4ZYDA 1MDMA 2JA6J 5CVVA 1R23A 3O8GA 3OWTA 2AHQA 1SC7A 2DODA 4JYKA 4BXFA 1BW6A 1MNMC 1P2FA 5HDGA 3F8NA 4LOCA 4HRIA 1F9NA 1IN6A 5E8IA 1FWZA 2WTEA 2XKOA 1GT0C 3HTUA 4KIBA 2F5EA 2KQRA 4BY7J 3COAC 3WTXC 4RAGA 2MA3A 2A3SA 2W85A 3IUOA 4ZZDA 3ZN0A 4AIKA 2WAQN 2PJPA 3F72A 4E7IA 2OUMA 3FXKA 3LSGA 3WTZA 2QCOA 3MAJA 5F1RA 3JRCA 2D2WA 3R0JA 4BJTA 1B1BA 1T98A 2DU9A 2D1HA 3WHBA 5F04A 3B02A 2M45A 4PGHA 4XR6A 1MZBA 3WTUC 3J81Z 2A6EF 4OOIA 4HLYA 2Z9OA 3ZMZA 4D5CA 2Q0OA 1U2WA 5E3NA 2HWVA 3BTLA 5LRSA 1SMTA 1UMQA 1M1EB 4RB2C 3K10A 1F1ZA 2PMUA 4CICA 1Z3YA 2X51A 3GFLA 3OYKA 3L2CA 2WADA 4IL6C 4NC6A 4ESBA 1DP7P 3A1YA 1UCRA 1R1VA 3GF2A 1YJWI 1N25A 2ZO4A 2KLOA 4EATA 3FWEA 2DA4A 2DFEA 3F3XA 2AS5F 2RVCA 2Z3YA 1ETVA 4BU2A 2PI0A 1OLTA 1YW8A 2HXOA 2EV5A 3GWZA 2WV0A 4PDKA 3KE2A 4RAYA 2XB0X 4Y17A 1VQPI 1MIJA 1OYIA 2HEOA 2QUFA 3FM5A 4Y15A 2DA5A 4D7MA 2XC7A 4MEYF 4KMUX 1PUFB 1XS9A 1RRJA 3HPGA 2STTA 3RSNA 2M0MA 2JVHA
chains in the Genus database with same CATH topology
3HEFA 5IPAA 2OPTA 5C3EJ 1QVUA 1MH3A 2R5YB 1BL0A 2EZHA 4RDUA 3LOCA 5K7ZA 4DYQA 3B6CA 3GTPJ 4MIMA 5GPCA 4A3DJ 3BTIA 1Y1WJ 3S16J 3BQYA 1JUPA 4B1RA 4UUTA 2NS7A 1RESA 1RETA 5EZHA 4C3HJ 5FLVA 4V2GA 3E7LA 5E3LA 1WI3A 5EZGA 1VI0A 1ZGWA 4V2FA 3MN2A 1IDYA 2M9HA 4FISA 1ENHA 2L9RA 2R7ZJ 2Y9ZA 1A5JA 1JKRC 5IYDJ 1IUFA 1GUUA 1B72A 2YUSA 3OSFA 2DA7A 5FLMJ 3S1QJ 3GTQJ 4XK4A 4BY1J 4A3CJ 1JUMA 4M3EA 1HDPA 4IHWA 2ME0A 2CU7A 3FKIJ 2YU9J 2XGCA 1O4XA 3K2AA 3L1PA 2K9NA 3S1RJ 1U78A 2CQQA 2NVQJ 3S14J 3BG3A 5EYRA 4A3GJ 3CMYA 1MBKA 1IRZA 1MBGA 3HOUJ 2HQ5A 2Y9YA 2X9DA 4MLOA 3A03A 3HGGA 3HOVJ 4M3FA 1HLVA 2MGQA 1ETOA 2NS8A 3RQIA 4DW6A 5M3MJ 3JREA 1JTXA 2VKEA 2MG4A 1Y1VJ 1AKHB 1NK2P 2ECCA 5F08A 2IEKA 2YS9A 4M6VA 2L0KA 1POGA 1VFCA 5F27A 3G1MA 3CCYA 3NAUA 2VUMJ 3SJMA 4C3IJ 2ID3A 5JLWA 4BBRJ 1Z0XA 5E3OA 1FIAA 2DMQA 5J1YA 1TWGJ 2DTZA 1ZR2A 1OCTC 2HOTA 1B72B 1ETWA 1FEXA 1R9TJ 1OCPA 1WH5A 1TC3C 3I4NJ 2LP0A 1RPWA 4XRMA 2XB5A 1LE8B 1JT6A 3ZQGA 4ABZA 2GLOA 3HB9A 1MBEA 4FE4A 1MH4A 1U9NA 2NVXJ 3BTJA 4JX6A 3MKLA 4EEFG 4MFEA 4QSHA 3G1LA 2R5ZB 2Y0SN 3CDLA 4L5EA 1HDDC 5C44J 5J3LA 3GTGJ 4UUSA 1MBFA 1UHSA 3HOXJ 1HCRA 3F0CA 2R5ZA 3I4MJ 1HF0A 5K7HA 3SDGA 1S7EA 1ZR4A 4MFDA 3NARA 3CQZJ 2EH3A 4M3DA 4A3BJ 1BW5A 5HODA 4FCYA 1ZTRA 4DYCA 1WGXA 1AKHA 2JK3A 2JMWA 4A3LJ 4A3IJ 1TWFJ 3PO3J 3FIWA 3IH3A 3JRGA 2ZB9A 1VF9A 4A69C 3JRBA 1D5YA 1JJ6C 3DEWA 3WHCA 5F0CA 4Y52J 2Y30A 1ETKA 4IEJA 4JX5A 1FJLA 3S17J 1P7IA 4BBSJ 2FD5A 2HYJA 2MSYA 1EF4A 4A93J 2L7FP 4CYCB 2E19A 5FKOA 3DCFA 3RZDJ 5GP9A 1LE8A 3B6AA 4X1EA 2H1KA 1XC5A 2TCTA 1MSEC 3ZQIA 3S2DJ 4RBOA 1QVTA 2DJNA 2HOAA 3HKZN 5IP7J 2LVSA 3HOZJ 3FISA 1DU6A 1JKOC 1IJWC 4XRSG 1TWCJ 2P81A 2O9LA 3S2HJ 1ETQA 1DU0A 1LFUP 5M5YJ 2O8KA 3A02A 1GDTA 4DZJA 4B4CA 2E1OA 5IP9J 3VPRA 2H8RA 2FQ4A 3GBGA 2AO9A 5GPAA 5M3FJ 1JJ8C 3GTLJ 1TWAJ 1OJLA 3JRHA 2HXIA 4B3AA 1RR7A 5F0HA 1ORKA 4W1UA 5EF6A 1H88C 4M3GA 1F43A 2DMTA 1X2NA 3K7AJ 3M4OJ 5FJ8J 2Y2ZA 4XRSA 4X6AJ 4J19A 5JLXA 5EGOB 1VNDA 2EQRA 1NTCA 5BNGA 1XG1A 2ME6A 3BR6A 2G0EA 3GTKJ 3S1MJ 1GVDA 4XIDA 3IH4A 5IOYA 5EGOA 3HOYJ 2O7OA 3Q0VA 3QPLA 1A6IA 2DMUA 4JP0A 5IP6A 1JKPC 2EZKA 4D7NA 2JWTA 1WCMJ 1U9OA 2K9QA 2XGEA 2LD5A 1JGGA 2JA8J 1YRNA 2VI6A 2EBIA 2FJ1A 2VKVA 2N8GA 5K7FA 5J1RA 1W0UA 1T33A 3BR5A 1WPKA 4IHYA 5FKLA 1W0TA 5EEAA 3S1NJ 3ZOBA 2LY9A 2KT0A 2LKXA 2QF7A 4D5FA 1H8AC 1ITYA 2DMPA 3Q0WA 4Y7NJ 1LFBA 3H0GJ 3O8HA 4MO7A 4DZPA 3D1NI 4IHVA 1GV2A 1IV6A 2XPVA 2CJJA 3UKGA 5C4JJ 4HNVA 1FTZA 1Z77A 2E2HJ 3S15J 3JRDA 2R93J 3RZOJ 2X48A 4A3EJ 5FKNA 1Q1VA 5J1UA 1NK3P 4C2MJ 2M8GX 1U8BA 2EZIA 1I6HJ 2XSDC 2HDDA 3BR0A 1WH7A 4I76A 2LLKA 3LSPA 4G12A 3TP0A 3IV5A 1FIPA 2E2IJ 2Y31A 4C3JJ 1GV5A 2XPWA 4W97A 5FKKA 1K61A 2HOSA 1HOMA 3QPSA 2NOGA 2LTPA 2OF7A 2HI3A 3LSRA 4QIWN 1APLC 2R5YA 1JT0A 1H89C 3RKQA 2K40A 1JUSA 2DN0A 5DTDA 2CRGA 1CQTA 2DA6A 4BXXJ 1QRYA 2FX0A 3ZQLA 3FK7A 3IH2A 2DA1A 2K9SA 1RKTA 2D5VA 3M3YJ 3OSGA 1E3OC 1TWHJ 3HOWJ 5E3MA 3JRAA 2IBDA 2I10A 5FKMA 1F36A 1JTYA 2L7ZA 1JKQC 2ID6A 1AU7A 1K83J 2MW8A 4A3JJ 4CYCA 3Q3SA 4I6ZA 4NDLA 4A3KJ 3BR1A 2M0CA 5M5XJ 3ZQCA 3PO2J 1IC8A 1I3QJ 3QQAA 5F0FA 3HM5A 5DS9A 4XICA 3LNQA 2GBYA 4FE7A 3BTCA 3HBLA 1AHDP 3PM1A 3GTMJ 2W48A 1P7JA 3Q0UA 5EG0A 2DA3A 2TRTA 2PMZN 1IG7A 1SANA 2JN6A 2E2JJ 2EZLA 2M2EA 5EDNA 3LSJA 2XPUA 5EG0B 2WB1N 4UUSB 1ETYA 3GTJJ 3JR9A 2LFBA 2XRLA 4A3MJ 2DMNA 3TP3A 3SFIA 2LR8A 5IYBJ 2JA5J 3G1OA 1QPIA 3BR3A 2VPRA 5F1JA 2WV1A 2NVTJ 4FTHA 3C2BA 1X58A 1I50J 3BT9A 3OIOA 2L7MP 2JA6J 2B63J 9ANTA 3TW6A 3O8GA 3A01B 4AYBN 2AHQA 1T56A 2JJ7A 3W6VA 1IGNA 4JYKA 1X2MA 2M34A 1BW6A 1MNMC 1FTTA 2XGDA 1B8IB 1ZK8A 2CQXA 4LOCA 3OOUA 3A01A 3HDDA 2CUEA 1GT0C 1MBJA 1G2HA 3BG9A 4BY7J 4GFBA 1ZKGA 2X6OA 1YRNB 3BG5A 2WAQN 1RKWA 1OFCX 4JX4A 1MBHA 2R92J 4QTRA 4AUXA 3LSGA 3H3VK 2QCOA 3JRCA 1ETXA 3BQZA 2GM4A 3JRFA 5M5WJ 1BA5A 3WHBA 5F04A 5IYCJ 1ZQ3P 4S0HB 4D5CA 5E3NA 3BTLA 2RAEA 1UMQA 2DA2A 2KDZA 1BJZA 1MSFC 3TW7A 2R0QC 3FK6A 3MVPA 4A3FJ 5C4XJ 1IDZA 2NVYJ 1SFOJ 3GTOJ 2DA4A 1ETVA 3TEDA 2JA7J 4BKXA 1PUFA 2HXOA 3HGYA 1UG2A 2XB0X 3ZQHA 5IOZA 2COBA 2IAIA 2ELKA 4DYRA 3JRIA 1B8IA 3ZQFA 2DA5A 4D7MA 4AC0A 2LK2A 1PUFB 2ECBA 1XS9A 4IHXA 2CUFA 4M3BA 3BR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEF A;  5IPA A;  2OPT A;  5C3E J;  1QVU A;  1MH3 A;  2R5Y B;  1BL0 A;  2EZH A;  4RDU A;  3LOC A;  5K7Z A;  4DYQ A;  3B6C A;  3GTP J;  4MIM A;  5GPC A;  4A3D J;  3BTI A;  1Y1W J;  3S16 J;  3BQY A;  1JUP A;  4B1R A;  4UUT A;  2NS7 A;  1RES A;  1RET A;  5EZH A;  4C3H J;  5FLV A;  4V2G A;  3E7L A;  5E3L A;  1WI3 A;  5EZG A;  1VI0 A;  1ZGW A;  4V2F A;  3MN2 A;  1IDY A;  2M9H A;  4FIS A;  1ENH A;  2L9R A;  2R7Z J;  2Y9Z A;  1A5J A;  1JKR C;  5IYD J;  1IUF A;  1GUU A;  1B72 A;  2YUS A;  3OSF A;  2DA7 A;  5FLM J;  3S1Q J;  3GTQ J;  4XK4 A;  4BY1 J;  4A3C J;  1JUM A;  4M3E A;  1HDP A;  4IHW A;  2ME0 A;  2CU7 A;  3FKI J;  2YU9 J;  2XGC A;  1O4X A;  3K2A A;  3L1P A;  2K9N A;  3S1R J;  1U78 A;  2CQQ A;  2NVQ J;  3S14 J;  3BG3 A;  5EYR A;  4A3G J;  3CMY A;  1MBK A;  1IRZ A;  1MBG A;  3HOU J;  2HQ5 A;  2Y9Y A;  2X9D A;  4MLO A;  3A03 A;  3HGG A;  3HOV J;  4M3F A;  1HLV A;  2MGQ A;  1ETO A;  2NS8 A;  3RQI A;  4DW6 A;  5M3M J;  3JRE A;  1JTX A;  2VKE A;  2MG4 A;  1Y1V J;  1AKH B;  1NK2 P;  2ECC A;  5F08 A;  2IEK A;  2YS9 A;  4M6V A;  2L0K A;  1POG A;  1VFC A;  5F27 A;  3G1M A;  3CCY A;  3NAU A;  2VUM J;  3SJM A;  4C3I J;  2ID3 A;  5JLW A;  4BBR J;  1Z0X A;  5E3O A;  1FIA A;  2DMQ A;  5J1Y A;  1TWG J;  2DTZ A;  1ZR2 A;  1OCT C;  2HOT A;  1B72 B;  1ETW A;  1FEX A;  1R9T J;  1OCP A;  1WH5 A;  1TC3 C;  3I4N J;  2LP0 A;  1RPW A;  4XRM A;  2XB5 A;  1LE8 B;  1JT6 A;  3ZQG A;  4ABZ A;  2GLO A;  3HB9 A;  1MBE A;  4FE4 A;  1MH4 A;  1U9N A;  2NVX J;  3BTJ A;  4JX6 A;  3MKL A;  4EEF G;  4MFE A;  4QSH A;  3G1L A;  2R5Z B;  2Y0S N;  3CDL A;  4L5E A;  1HDD C;  5C44 J;  5J3L A;  3GTG J;  4UUS A;  1MBF A;  1UHS A;  3HOX J;  1HCR A;  3F0C A;  2R5Z A;  3I4M J;  1HF0 A;  5K7H A;  3SDG A;  1S7E A;  1ZR4 A;  4MFD A;  3NAR A;  3CQZ J;  2EH3 A;  4M3D A;  4A3B J;  1BW5 A;  5HOD A;  4FCY A;  1ZTR A;  4DYC A;  1WGX A;  1AKH A;  2JK3 A;  2JMW A;  4A3L J;  4A3I J;  1TWF J;  3PO3 J;  3FIW A;  3IH3 A;  3JRG A;  2ZB9 A;  1VF9 A;  4A69 C;  3JRB A;  1D5Y A;  1JJ6 C;  3DEW A;  3WHC A;  5F0C A;  4Y52 J;  2Y30 A;  1ETK A;  4IEJ A;  4JX5 A;  1FJL A;  3S17 J;  1P7I A;  4BBS J;  2FD5 A;  2HYJ A;  2MSY A;  1EF4 A;  4A93 J;  2L7F P;  4CYC B;  2E19 A;  5FKO A;  3DCF A;  3RZD J;  5GP9 A;  1LE8 A;  3B6A A;  4X1E A;  2H1K A;  1XC5 A;  2TCT A;  1MSE C;  3ZQI A;  3S2D J;  4RBO A;  1QVT A;  2DJN A;  2HOA A;  3HKZ N;  5IP7 J;  2LVS A;  3HOZ J;  3FIS A;  1DU6 A;  1JKO C;  1IJW C;  4XRS G;  1TWC J;  2P81 A;  2O9L A;  3S2H J;  1ETQ A;  1DU0 A;  1LFU P;  5M5Y J;  2O8K A;  3A02 A;  1GDT A;  4DZJ A;  4B4C A;  2E1O A;  5IP9 J;  3VPR A;  2H8R A;  2FQ4 A;  3GBG A;  2AO9 A;  5GPA A;  5M3F J;  1JJ8 C;  3GTL J;  1TWA J;  1OJL A;  3JRH A;  2HXI A;  4B3A A;  1RR7 A;  5F0H A;  1ORK A;  4W1U A;  5EF6 A;  1H88 C;  4M3G A;  1F43 A;  2DMT A;  1X2N A;  3K7A J;  3M4O J;  5FJ8 J;  2Y2Z A;  4XRS A;  4X6A J;  4J19 A;  5JLX A;  5EGO B;  1VND A;  2EQR A;  1NTC A;  5BNG A;  1XG1 A;  2ME6 A;  3BR6 A;  2G0E A;  3GTK J;  3S1M J;  1GVD A;  4XID A;  3IH4 A;  5IOY A;  5EGO A;  3HOY J;  2O7O A;  3Q0V A;  3QPL A;  1A6I A;  2DMU A;  4JP0 A;  5IP6 A;  1JKP C;  2EZK A;  4D7N A;  2JWT A;  1WCM J;  1U9O A;  2K9Q A;  2XGE A;  2LD5 A;  1JGG A;  2JA8 J;  1YRN A;  2VI6 A;  2EBI A;  2FJ1 A;  2VKV A;  2N8G A;  5K7F A;  5J1R A;  1W0U A;  1T33 A;  3BR5 A;  1WPK A;  4IHY A;  5FKL A;  1W0T A;  5EEA A;  3S1N J;  3ZOB A;  2LY9 A;  2KT0 A;  2LKX A;  2QF7 A;  4D5F A;  1H8A C;  1ITY A;  2DMP A;  3Q0W A;  4Y7N J;  1LFB A;  3H0G J;  3O8H A;  4MO7 A;  4DZP A;  3D1N I;  4IHV A;  1GV2 A;  1IV6 A;  2XPV A;  2CJJ A;  3UKG A;  5C4J J;  4HNV A;  1FTZ A;  1Z77 A;  2E2H J;  3S15 J;  3JRD A;  2R93 J;  3RZO J;  2X48 A;  4A3E J;  5FKN A;  1Q1V A;  5J1U A;  1NK3 P;  4C2M J;  2M8G X;  1U8B A;  2EZI A;  1I6H J;  2XSD C;  2HDD A;  3BR0 A;  1WH7 A;  4I76 A;  2LLK A;  3LSP A;  4G12 A;  3TP0 A;  3IV5 A;  1FIP A;  2E2I J;  2Y31 A;  4C3J J;  1GV5 A;  2XPW A;  4W97 A;  5FKK A;  1K61 A;  2HOS A;  1HOM A;  3QPS A;  2NOG A;  2LTP A;  2OF7 A;  2HI3 A;  3LSR A;  4QIW N;  1APL C;  2R5Y A;  1JT0 A;  1H89 C;  3RKQ A;  2K40 A;  1JUS A;  2DN0 A;  5DTD A;  2CRG A;  1CQT A;  2DA6 A;  4BXX J;  1QRY A;  2FX0 A;  3ZQL A;  3FK7 A;  3IH2 A;  2DA1 A;  2K9S A;  1RKT A;  2D5V A;  3M3Y J;  3OSG A;  1E3O C;  1TWH J;  3HOW J;  5E3M A;  3JRA A;  2IBD A;  2I10 A;  5FKM A;  1F36 A;  1JTY A;  2L7Z A;  1JKQ C;  2ID6 A;  1AU7 A;  1K83 J;  2MW8 A;  4A3J J;  4CYC A;  3Q3S A;  4I6Z A;  4NDL A;  4A3K J;  3BR1 A;  2M0C A;  5M5X J;  3ZQC A;  3PO2 J;  1IC8 A;  1I3Q J;  3QQA A;  5F0F A;  3HM5 A;  5DS9 A;  4XIC A;  3LNQ A;  2GBY A;  4FE7 A;  3BTC A;  3HBL A;  1AHD P;  3PM1 A;  3GTM J;  2W48 A;  1P7J A;  3Q0U A;  5EG0 A;  2DA3 A;  2TRT A;  2PMZ N;  1IG7 A;  1SAN A;  2JN6 A;  2E2J J;  2EZL A;  2M2E A;  5EDN A;  3LSJ A;  2XPU A;  5EG0 B;  2WB1 N;  4UUS B;  1ETY A;  3GTJ J;  3JR9 A;  2LFB A;  2XRL A;  4A3M J;  2DMN A;  3TP3 A;  3SFI A;  2LR8 A;  5IYB J;  2JA5 J;  3G1O A;  1QPI A;  3BR3 A;  2VPR A;  5F1J A;  2WV1 A;  2NVT J;  4FTH A;  3C2B A;  1X58 A;  1I50 J;  3BT9 A;  3OIO A;  2L7M P;  2JA6 J;  2B63 J;  9ANT A;  3TW6 A;  3O8G A;  3A01 B;  4AYB N;  2AHQ A;  1T56 A;  2JJ7 A;  3W6V A;  1IGN A;  4JYK A;  1X2M A;  2M34 A;  1BW6 A;  1MNM C;  1FTT A;  2XGD A;  1B8I B;  1ZK8 A;  2CQX A;  4LOC A;  3OOU A;  3A01 A;  3HDD A;  2CUE A;  1GT0 C;  1MBJ A;  1G2H A;  3BG9 A;  4BY7 J;  4GFB A;  1ZKG A;  2X6O A;  1YRN B;  3BG5 A;  2WAQ N;  1RKW A;  1OFC X;  4JX4 A;  1MBH A;  2R92 J;  4QTR A;  4AUX A;  3LSG A;  3H3V K;  2QCO A;  3JRC A;  1ETX A;  3BQZ A;  2GM4 A;  3JRF A;  5M5W J;  1BA5 A;  3WHB A;  5F04 A;  5IYC J;  1ZQ3 P;  4S0H B;  4D5C A;  5E3N A;  3BTL A;  2RAE A;  1UMQ A;  2DA2 A;  2KDZ A;  1BJZ A;  1MSF C;  3TW7 A;  2R0Q C;  3FK6 A;  3MVP A;  4A3F J;  5C4X J;  1IDZ A;  2NVY J;  1SFO J;  3GTO J;  2DA4 A;  1ETV A;  3TED A;  2JA7 J;  4BKX A;  1PUF A;  2HXO A;  3HGY A;  1UG2 A;  2XB0 X;  3ZQH A;  5IOZ A;  2COB A;  2IAI A;  2ELK A;  4DYR A;  3JRI A;  1B8I A;  3ZQF A;  2DA5 A;  4D7M A;  4AC0 A;  2LK2 A;  1PUF B;  2ECB A;  1XS9 A;  4IHX A;  2CUF A;  4M3B A;  3BR2 A; 
#chains in the Genus database with same CATH topology
 1L3L A;  3ZQQ A;  1HW2 A;  3HEF A;  2JA2 A;  3KZI C;  1QVU A;  4D1Q A;  4CH7 A;  1R36 A;  5K7Z A;  3LFU A;  3GVA A;  4MIM A;  3ZRG A;  2WY7 Q;  3VDX A;  2L4A A;  3A2K A;  1KU2 A;  3SZP A;  3T8T A;  3QU6 A;  1Y1W J;  2DCE A;  3S16 J;  3W6K B;  1YJN I;  2ZC2 A;  3BQY A;  2XRN A;  4XKW A;  3ZR8 X;  2UZK A;  5IY5 H;  5FLV A;  4UY8 I;  1B59 A;  3D5S C;  3K6G A;  1GHC A;  4LB5 A;  4B43 A;  4FIS A;  1JKR C;  5GAG J;  1I3A A;  1K78 B;  1XGN A;  3TO9 A;  1Z21 A;  2YUS A;  4LB6 B;  3K4L A;  4KIF A;  4M74 A;  2X1E A;  2QQ8 A;  1SAX A;  1REP C;  4A3C J;  2L3D A;  1JUM A;  2ZME C;  1HDP A;  1KZH A;  1I6X A;  4IHW A;  4IPA A;  3HG9 A;  4B3X A;  2R3S A;  1D1B A;  1RUO A;  4XOR A;  3HHH A;  1XDU A;  2JQ7 A;  1KYW A;  2K9N A;  3ONQ A;  5J47 A;  1VQM I;  1HXD A;  4Q4Z F;  4IVN A;  1U78 A;  4G7H F;  3S14 J;  2OD5 A;  2VJ5 A;  4ZDO A;  2DQL A;  3CMY A;  1RI7 A;  1LFP A;  1MBG A;  3HSR A;  4RM3 A;  1Z7U A;  2ETH A;  2HQ5 A;  4CCL A;  2Y9Y A;  3CDI A;  4F55 A;  4BE1 A;  1LJ9 A;  5BPI A;  1HLV A;  2HYG D;  1ZRE A;  5M3M J;  2MG4 A;  1X19 A;  1Y1V J;  1AKH B;  1NK2 P;  1MMN A;  2RNJ A;  3Q9S A;  2WAQ A;  4GGG A;  3MD2 A;  4L9V A;  3TKY A;  2DT6 A;  3CC7 I;  1IN5 A;  1ZEL A;  1VFC A;  2RKH A;  3RQ4 A;  2ZJ2 A;  2E5N A;  3CZ6 A;  1J9I A;  2F5V A;  4BBR J;  1S6L A;  1FIA A;  2HU9 A;  4LIU A;  4UB8 C;  1OMI A;  4C2U A;  1FEX A;  4I0B A;  3PFY A;  1TC3 C;  3I4N J;  2LP0 A;  4OAZ A;  2FSW A;  4HV6 A;  2XB5 A;  4N4N B;  1VQK I;  4AYB A;  2HVR A;  1USS A;  1O3S A;  2IS2 A;  1EA3 A;  2H94 A;  4FE4 A;  3VEP A;  1U9N A;  2ICW G;  1QGP A;  2VBZ A;  4L9N A;  1FYM A;  2MFZ A;  3JCU C;  4MFE A;  1S3J A;  2R7X A;  3CCS I;  4HF2 A;  3BOQ A;  4WF2 A;  3VYR B;  2Y0S N;  3C3W A;  3FMR A;  4CCO A;  4LJZ F;  3CC2 I;  1ZG5 A;  3C2H A;  1MBF A;  4UUS A;  1F4K A;  3JAM Z;  2P7V B;  3HOX J;  1HCR A;  4PFO A;  3F0C A;  4ON0 A;  3I56 I;  2BY2 A;  2L9V A;  2VN2 A;  1IO2 A;  2CUJ A;  3F22 A;  4L0Z B;  4XN0 A;  3IL2 A;  3HSF A;  3BG6 A;  4MFD A;  3V4G A;  3CQZ J;  3MKZ A;  2DXI A;  3DBH B;  1HW1 A;  2JSC A;  1BW5 A;  5HNH A;  1ZN2 A;  4DYC A;  2HQA A;  2A05 A;  2WAF A;  3EUH A;  2IA0 A;  4BE0 A;  2HDC A;  3PO3 J;  1BIB A;  1FBU A;  2BE5 F;  1JJ6 C;  3DEW A;  5F0C A;  2Y30 A;  4IEJ A;  5HS7 A;  1XD7 A;  3PSF A;  4M73 A;  5D8K B;  4K2E A;  3G71 I;  2FD5 A;  2HZT A;  3TDZ C;  2E71 A;  4A5M A;  1FT9 A;  3DU6 A;  5LHG A;  3V42 A;  2F5F A;  1LUJ B;  3F8M A;  3OYH A;  3BY6 A;  4DJA A;  3M07 A;  3I55 I;  3DV8 A;  5GP9 A;  1CF7 A;  6PAX A;  3M8J A;  3S2D J;  2GQQ A;  2DJN A;  2HOA A;  3HKZ N;  5IP7 J;  3PNT A;  1E3P A;  3AL0 B;  2ZKZ A;  2XAG A;  3HOZ J;  5E1X A;  2ZSI B;  1BM9 A;  2QQA A;  3OYJ A;  1V55 H;  1WQ2 A;  2DYS H;  3HZJ A;  4PGG A;  1IJW C;  1ERD A;  1TWC J;  1X1C A;  1DDN A;  2H27 A;  1ETQ A;  1O7F A;  1OCO H;  1ZYR F;  2O9L A;  3ZMU A;  2DT7 B;  2ZNY A;  4E6K G;  1ULY A;  3CLQ A;  1ZG1 A;  5M5Y J;  5D5V B;  3CCM I;  2L7K A;  3LAP A;  1VQ7 I;  2BHY A;  2IA1 A;  3LA2 A;  1XSD A;  1H9T A;  1GLN A;  2ZNZ A;  2RNG A;  1BC7 C;  5IP9 J;  2Y48 A;  4NQW B;  5ICG A;  2H8R A;  2BY3 A;  2E36 A;  3GBG A;  3S3O A;  4P96 A;  1JJ8 C;  4RAF A;  3GTL J;  4Q47 A;  3JRH A;  2HXI A;  4B3A A;  5E79 C;  1WI9 A;  5F0H A;  1R6R A;  2E5Z A;  2VLA A;  5EF6 A;  2DMT A;  2V26 A;  5K5Q A;  4BQQ A;  1ZH5 A;  3H5N A;  3WU2 C;  4XRS A;  4X6A J;  3ZGK A;  4BQA A;  5FLX K;  3WGI A;  3M8F A;  5FD6 A;  4MGR A;  3J7Y J;  4HAM A;  1U5T A;  4XM3 A;  2P5L C;  1ON2 A;  4A0Z A;  4RAZ A;  3S1M J;  1W4M A;  1T8I A;  3H36 A;  4TV7 A;  5IOY A;  2ZJR F;  1Z6R A;  4XN3 A;  4M9X A;  4RB3 C;  2CFO A;  2DMU A;  1KYZ A;  2VJI A;  1P92 A;  3F9K A;  4HNU A;  2F4M B;  3SZG A;  1EH6 A;  2RDP A;  4I01 A;  1U9O A;  1W36 C;  1JGG A;  1D0Z A;  2JA8 J;  3RCO A;  2VKV A;  2R7O A;  3T5X A;  2FBI A;  3K4K A;  3ERE D;  2KRH A;  4E7J A;  5K7F A;  3W2A A;  2JTV A;  3BR5 A;  3NEU A;  3V8K A;  5FRO A;  1SFE A;  3ZOB A;  2JVG A;  2EIL H;  4LMY A;  1U6G A;  2NYX A;  2GXB A;  3FBN B;  2QF7 A;  1R49 A;  1X1B A;  4IX7 A;  3DTK A;  3Q0W A;  3AG4 H;  4LLN A;  2XAH A;  4BHB A;  4C2T A;  3D1N I;  1QZE A;  4DBR A;  4LG0 A;  2XPV A;  1UB9 A;  2CJJ A;  3RTR A;  3BLY A;  3U9G A;  3K69 A;  1BOA A;  1FTZ A;  3I0T A;  3X2Q H;  1NG7 A;  3FF5 A;  1ZHF A;  1FOK A;  3S15 J;  1G3W A;  2R7Q A;  2LG4 A;  5D6E A;  2DOA A;  5KAF C;  3LFK A;  5FKN A;  1H0M A;  3FM3 A;  3T0Y A;  2KPM A;  2UXX A;  3E3V A;  5J1U A;  4EM2 A;  5BS6 A;  2A07 F;  5HVQ C;  1U8B A;  2HVQ A;  3EQL F;  2ZME B;  2HR3 A;  3E6M A;  3OYN A;  2KP6 A;  1BI3 A;  4HEA 2;  2Y0M A;  2HDD A;  3PIP F;  3K1N A;  4I76 A;  2IA2 A;  4FX4 A;  3SZT A;  4G12 A;  2J5P A;  1UAA A;  2MH9 A;  4YIR X;  5TJJ A;  1YHQ I;  1GV5 A;  2EJR A;  2XPW A;  1J0R A;  3OYF A;  1A04 A;  2NOG A;  3RYP A;  1MJ9 A;  1HA8 A;  4MNU A;  2JPC A;  2XF5 A;  2YSR A;  2IGK A;  5CVJ A;  2DN0 A;  2CRG A;  1WKM A;  2VJ4 A;  3P7N A;  4BGD A;  4RLF A;  3S93 A;  2FOW A;  2VQH A;  2DA1 A;  4FET A;  2D5V A;  3LWF A;  4EJW A;  1E3O C;  2R7V A;  3BJ6 A;  2W1O A;  1VQN I;  3HRS A;  2L54 A;  4G6Q A;  4QLC U;  3JSO A;  1F36 A;  2IXS A;  3NWT A;  4OMZ A;  1OIS A;  4ENN A;  3H35 A;  4HA8 A;  2ZCW A;  4RB0 A;  4XLC A;  4II3 A;  4RGU A;  4ZYA A;  4XKV A;  5K5O A;  4EV0 A;  4A3J J;  2R7T A;  4CYC A;  4A3K J;  4NDL A;  1YW9 A;  3RKX A;  2R7R A;  1FMW A;  1S5L C;  5M5X J;  4Y4R A;  2XF7 A;  1I3Q J;  3QQA A;  1TW2 A;  1GXQ A;  2LC2 A;  3BDD A;  1KQ9 A;  3DBR B;  1G6N A;  3KCC A;  5DS9 A;  1X1P A;  4XSZ F;  5CJ9 A;  1YS7 A;  2D45 A;  3DPL C;  1BBY A;  3BTC A;  2K5C A;  3QYF A;  3GLL A;  3GTM J;  2O8X A;  4S05 A;  4XQF A;  4V19 K;  1BC8 C;  5LGU A;  1XCV A;  1SAN A;  1VQ4 I;  2JN6 A;  2FA5 A;  1QBJ A;  3MWM A;  2J5O A;  2IGN A;  2WB1 N;  4N4O B;  2GWR A;  2NNN A;  3HL2 A;  1FX7 A;  1WJC A;  5AON A;  4A12 A;  4IQJ A;  4RMN A;  5FO5 A;  2KZV A;  4U0Y A;  3DPU A;  3OYD A;  3OS1 A;  1QPI A;  2Y0S A;  3LL7 A;  5LD2 C;  3HIF A;  2WWY A;  1Z91 A;  4KMF A;  2VPR A;  4KIC A;  1D1C A;  2NVT J;  3C2B A;  1I50 J;  2EV0 A;  3OIO A;  5IT9 Z;  3CTA A;  2JPB A;  3ZQ7 A;  2EIN H;  1ZLJ A;  4AYB N;  2NS0 A;  3H3Z A;  3GZ5 A;  2VBW A;  3CJR B;  2JJ7 A;  3W6V A;  3LMM A;  2M34 A;  1W7P D;  3IC7 A;  2EIK H;  2PJR B;  3A01 A;  3HDD A;  2JT1 A;  3MZH A;  1G2H A;  2X1D A;  4CCJ A;  3QWL A;  3LA7 A;  3ZMV A;  1RIO H;  3DKW A;  1J75 A;  1O3R A;  4KFC A;  4F52 A;  2Y69 H;  3W3C A;  4EQQ A;  4I7H A;  2XDV A;  4PJN A;  3ABL H;  3FXR A;  4BEH A;  2ISZ A;  1G4D A;  4I09 A;  3WE3 A;  3S3M A;  2ZXJ A;  3G4S I;  1X1A A;  2GM4 A;  3JRF A;  2B9S A;  3CUQ A;  2DLL A;  3PQK A;  3GFJ A;  4HST A;  3RI4 A;  3CMA I;  5ICF A;  2STW A;  1CGP A;  4G94 A;  1ZAO A;  1EH7 A;  4KJZ A;  4KN4 X;  2IT0 A;  3VFZ A;  3F6V A;  4S0H B;  2ZFW A;  1TP4 A;  3MEX A;  3H5A A;  4DQ2 A;  5ICC A;  2OQR A;  1MSF C;  1BJZ A;  3ABM H;  3IKT A;  3RYR A;  3DLA A;  2R0Q C;  2HYF A;  3FK6 A;  3GLX A;  4H4K C;  5C4X J;  4UVC A;  3E6B A;  2C6Y A;  2VB6 A;  2NVY J;  2DOE A;  1SFO J;  1O57 A;  4BH9 A;  1UG2 A;  1HKS A;  3KP6 A;  1IN7 A;  3E5Q A;  3ZQH A;  5IOZ A;  4YII A;  2ELK A;  3TL4 X;  4LG3 A;  2ECB A;  2YX4 A;  3AAF A;  1DGW Y;  3CLO A;  4AID A;  1PUE E;  1LQ1 A;  3DLL F;  4UHT A;  2OPT A;  2K27 A;  5C3E J;  1MH3 A;  4EM1 A;  2R5Y B;  3BZK A;  3OYM A;  3C1D A;  3B6C A;  3GTP J;  3QU3 A;  3MZ8 A;  3JTG A;  4A3D J;  1OQY A;  2EB7 A;  4IXA A;  3K70 D;  3ZPL A;  3TBI A;  4OIN F;  3I9V 2;  3A0B C;  3OR1 C;  5FLX Z;  3D5L A;  4UUT A;  1RES A;  4B44 A;  3U2R A;  5J8F A;  1WI3 A;  2CH0 A;  5EZG A;  2DPU A;  3F23 A;  3VYU B;  1ZGW A;  3CME I;  2L9R A;  2OZU A;  4KN7 X;  2KHM A;  2Y9Z A;  4PK4 A;  2LY1 A;  3KET A;  1FOY A;  3SEZ A;  1NHA A;  4XK4 A;  1ACI A;  2P7C B;  4EJU A;  2E35 A;  3EYY A;  3FDY A;  3EUA A;  3MQ0 A;  4HZF A;  4FHT A;  3FKI J;  4OWR B;  2XGC A;  5D4R A;  1Z1D A;  3AG3 H;  1ZLK A;  2DT5 A;  1WZ2 A;  1YQA A;  2CQQ A;  1BJA A;  2DYR H;  4NUB A;  5EYR A;  4A3G J;  1IUY A;  1MBK A;  2BY1 A;  2L2O A;  2DI3 A;  4ENJ A;  3K2Z A;  3OV8 A;  4MLO A;  3FKJ A;  4M3F A;  2LBF A;  2MGQ A;  1R5H A;  4DW6 A;  3JRE A;  5JR3 A;  4OIQ F;  1FSH A;  2P8T A;  3O3K A;  4CO8 A;  2PMH A;  2ECC A;  1J59 A;  1Y6I A;  2YS9 A;  3BPV A;  2M4G A;  1RC9 A;  2ELH A;  2XIG A;  2HTJ A;  4LIV A;  5F27 A;  2VUM J;  1I27 A;  1XGO A;  5L3G A;  4E7Z A;  2EA4 A;  5JLW A;  2V1U A;  5E3O A;  3GFM A;  3T8R A;  1VQ9 I;  4IRG A;  5KAI C;  3GX4 X;  4Q5S F;  1W7P A;  5J1Y A;  1K78 A;  1ETW A;  1R22 A;  4WXD A;  1R9T J;  1OCP A;  3HRU A;  1U3E M;  2X6W A;  2XV4 S;  2K9L A;  2LYC A;  3K4J A;  2GLO A;  3HB9 A;  3KZZ A;  5LHH A;  2KL4 A;  3EPZ A;  2YPR A;  2X6X A;  2Q8K A;  1A36 A;  2NVX J;  3JTH A;  4EEF G;  4M72 A;  2XAJ A;  5BOX A;  3AFH A;  2E1M C;  2E7W A;  4RGS A;  1IRF A;  4LGW A;  3ASN H;  4KT6 A;  2KIU A;  3CDL A;  4L5E A;  1HDD C;  1R7J A;  5J40 A;  1XCB A;  3A0H C;  1A6Q A;  5E18 F;  2V6C A;  3I4M J;  1MKM A;  1T0F C;  4ESJ A;  2ZJQ F;  1S7O A;  1S7E A;  3SDG A;  4YFK F;  2GA1 A;  1YX3 A;  2DBB A;  2QA4 I;  5DM7 F;  1XPX A;  4M3D A;  2O61 A;  4I99 C;  1R71 A;  1ZTR A;  5H2F C;  1FBQ A;  3GME A;  4UV9 A;  1TWF J;  1TQM A;  4G6T B;  2CWE A;  3IH3 A;  3JRG A;  4A69 C;  3JRB A;  5DCM A;  3WHC A;  4Y52 J;  1IN4 A;  4LD5 A;  1ETK A;  2W84 A;  1S9H A;  3EDP A;  4BS9 A;  2VC0 A;  5ED4 A;  3J7A Y;  1UHW A;  1P7I A;  5LLQ A;  3HUG A;  2FE3 A;  2MSY A;  4IHS A;  4A93 J;  3DXJ F;  3OYA A;  5BQT A;  3E6C C;  1QQI A;  1JE8 A;  3M8E A;  5FKO A;  3DCF A;  3RZD J;  1LE8 A;  3KIO A;  1RZ4 A;  3M1E A;  4GXO A;  4X1E A;  2WA0 A;  3L2Q A;  2ZBK A;  3ZMT A;  4E7H A;  4RBO A;  1QVT A;  4EMS A;  2IS1 A;  3CCL I;  1YIJ I;  1YG2 A;  1ODD A;  4IZZ A;  2LVS A;  4HX4 A;  2CG4 A;  2DDB A;  1SEU A;  1DU6 A;  2DO7 A;  1MJB A;  5E1Z B;  4XRS G;  3SFZ A;  5EJC A;  4XLH A;  1X3W B;  2ZXI A;  1T08 B;  1LFU P;  4F93 B;  1ZRF A;  2M87 A;  3K9T A;  1WFX A;  2O8K A;  5E1W A;  3A02 A;  1GDT A;  2E1O A;  3K4M A;  1QU3 A;  4RM2 A;  1LDJ A;  1ZAR A;  4RB1 A;  1ZGJ A;  4ZTF A;  1LKX A;  3OIQ A;  3QOP A;  2P6S A;  2QWW A;  3QOD A;  2I8D A;  1ON1 A;  1YE9 A;  3ZCO A;  4LG0 B;  3KP5 A;  2O3F A;  1D8J A;  5ERI A;  1XX5 A;  3DTI A;  3IAM 2;  4BHP A;  1LB2 A;  2K02 A;  4M3G A;  1W36 D;  5HS9 A;  2XRO A;  3LST A;  2HGC A;  2Y2Z A;  1X3Z B;  4FT8 A;  2H09 A;  3CCV I;  5JLX A;  5F6F A;  2ZME A;  2FXA A;  1J09 A;  3WTY C;  4IO9 F;  1WSU A;  1LVK A;  1NTC A;  3C2G A;  3ABT A;  5BNG A;  1IAW A;  2PLY A;  3S2W A;  4JBA A;  1R00 A;  2B0L A;  3GTK J;  4XID A;  3IH4 A;  5DV5 A;  4RLQ A;  1OYW A;  4MQ9 F;  2DW4 A;  3QPL A;  3G73 A;  4KYW A;  1A6I A;  3NWS A;  1DP3 A;  4JP0 A;  1PDN C;  4QWQ A;  1JKP C;  2JWT A;  2K9M A;  4E7L A;  2XGE A;  2LD5 A;  4PSW A;  2FJ1 A;  3AG2 H;  2N8G A;  2CV1 A;  1K7A A;  1N78 A;  4IHY A;  3VYS B;  5EEA A;  3WG9 A;  1LDK B;  1VQL I;  3CES A;  3ISP A;  1WRJ A;  1TT0 A;  4E4H A;  2LKX A;  4LK1 F;  2VQL A;  3I3L A;  2IGO A;  1H8A C;  2DMP A;  3H9G A;  1BR4 A;  5HLT A;  1HC8 A;  3PNV A;  1SVO A;  3I58 A;  4HV5 A;  4BDY A;  5BPD A;  1KON A;  4IOA F;  4HDV A;  1IV6 A;  3KYC B;  1W5S A;  4O3M A;  2AXT C;  2OV7 A;  3IRQ A;  1BI1 A;  3VB2 A;  4HNV A;  4IRI A;  1Z77 A;  1VQO I;  1LDD A;  4II2 A;  1QPM A;  3MZY A;  3JRD A;  2K86 A;  2LKS A;  3HPH A;  2R93 J;  1B9M A;  2E1N A;  3O2P E;  4B09 A;  4H0E A;  3PL8 A;  2KFD A;  5D6F A;  3FXJ A;  1SFK A;  5L3E A;  5JHU A;  3BR0 A;  1WH7 A;  3RPU D;  5CKT A;  5IT9 K;  1TQI A;  1QZY A;  1FIP A;  2E2I J;  1QZZ A;  3OR2 C;  1TTY A;  4W97 A;  5FKK A;  1STZ A;  4YRV A;  1R1U A;  1D8K A;  2G9W A;  1SFX A;  2OF7 A;  1TLH B;  1SVL A;  2H8W A;  3MCZ A;  3RPQ A;  2HQR A;  4ZZL A;  1B6A A;  1H89 C;  3CP2 A;  2HVS A;  3WG7 H;  1JUS A;  3DEU A;  2MH2 A;  3K1M A;  2DA6 A;  1WJD A;  1CQT A;  4BXX J;  5HLG A;  4FAS D;  1QRY A;  1UEL B;  2UWM A;  3IH2 A;  2X4H A;  2FEZ A;  2ESH A;  2QEX I;  4RA2 A;  3KFW X;  2IW5 A;  3JRA A;  2A6T A;  3L2U A;  1TL8 A;  3EET A;  2IBD A;  2I10 A;  4PSX A;  5FKM A;  1E0E A;  3PSI A;  5F64 A;  5DD8 A;  1XMA A;  5HS8 A;  2L7Z A;  2ID6 A;  2E7X A;  4IQ4 A;  4XMY A;  4HBL A;  4AD9 A;  1MMS A;  3Q3S A;  4I6Z A;  3BR1 A;  5GAD J;  5HOO A;  1P4X A;  4BE2 A;  4Y33 A;  2CYY A;  1EH8 A;  3KEQ A;  3HHG A;  5DUK A;  3CCR I;  3HM5 A;  2ZXW H;  3LNQ A;  1W1W E;  2PQ8 A;  1YYV A;  2FNP A;  3QAH A;  5B66 C;  1Z7L A;  1WJB A;  5JVT A;  4GCV A;  3H9J A;  3Q5F A;  1S72 I;  3PM1 A;  3FHZ A;  5FB2 A;  2W48 A;  4HDU A;  2OTJ I;  2DA3 A;  4CZC A;  2PMZ N;  2RGV A;  3I64 A;  2AQE A;  1XN7 A;  2E2J J;  3H1C A;  5JVG F;  4ZH4 F;  2QBY A;  2M2E A;  5EDN A;  3LSJ A;  3QP5 A;  1TZL A;  3N97 A;  4XBF A;  1ETY A;  4PUS A;  3JR9 A;  2KRC A;  4XSX F;  2LBF B;  2BEO A;  4AIJ A;  2LFB A;  2OZ6 A;  3TP3 A;  2LR8 A;  5IYB J;  3QPT A;  2P6T A;  4PZJ A;  3G1O A;  4XKC A;  3UR3 C;  4ZTJ A;  2HS5 A;  2HNH A;  2HKX A;  3F8F A;  3BR3 A;  1SD5 A;  4RGR A;  3M9A A;  5K5R A;  2WV1 A;  3VWB A;  2PX9 A;  3W2V A;  1ONV A;  2VPL A;  3BT9 A;  3F8B A;  2X6Y A;  2L7M P;  1K4S A;  1QA6 A;  4L5I A;  4OIR F;  2KIM A;  9ANT A;  3OS0 A;  4XLP F;  1W7P B;  4BHC A;  2L02 A;  4S04 A;  4IOC F;  2VIX A;  2VQG A;  3E6D A;  1X2M A;  2HZD A;  2XAF A;  2XAU A;  1ZK8 A;  2OCC H;  3OOU A;  4XL9 A;  5TIS C;  2R7W A;  3AL0 C;  3OOP A;  3BG9 A;  1BR2 A;  2XAS A;  1YFH A;  3L2R A;  3KP2 A;  3HXL A;  3KP7 A;  5FFX A;  1AWC A;  3CF5 F;  1ZRC A;  1OFC X;  4JX4 A;  4HNT A;  2R92 J;  4QTR A;  3H3V K;  3TOB A;  1VQ5 I;  4XNF A;  4GYG A;  1ETX A;  5HDN A;  1DGR M;  1BA5 A;  4DBQ A;  1ZRD A;  2HKO A;  2L5Q A;  2DK8 A;  2DQR A;  2W7N A;  1R1T A;  3IRR A;  1ZQ3 P;  2BV6 A;  3IWZ A;  3KP3 A;  4UVB A;  5D5X B;  4J00 A;  1MMD A;  1W5C C;  1LEB A;  3MKW B;  4M9Z A;  2QKM B;  3CCU I;  3FXU A;  3D5R C;  4A0X A;  1PP8 F;  4A3F J;  1JXS A;  3PNY A;  4WX9 A;  3ZMS A;  4Z6Y A;  1IDZ A;  3W6J B;  4CZZ A;  4DNC A;  1FP2 A;  2NNY A;  4PCQ A;  1T38 A;  3TED A;  2KRF A;  2JA7 J;  1PUF A;  3HGY A;  3GZ6 A;  2NRA C;  4UUV A;  5FRN A;  1BN5 A;  4R8H A;  2IAI A;  3JRI A;  2VL8 A;  5ILS A;  2M1B A;  4L9J A;  1B8I A;  3ZQF A;  2VXZ A;  5IT3 A;  4AC0 A;  2AXL A;  2LK2 A;  3IHU A;  3M1C A;  4HW0 A;  4CA0 A;  4KIS A;  1J2X A;  2CUF A;  1TWH J;  4M3B A;  4LK0 F;  1FY7 A;  2LDU A;  4ZYG A;  5IPA A;  2E34 A;  3BC8 A;  1R5I D;  1YOV B;  3LOC A;  3L09 A;  1FNN A;  4WCG A;  1PJR A;  3S3N A;  2K4J A;  3HSE A;  1LNW A;  4XLN F;  4KUM A;  3OYB A;  1OKR A;  3GEZ A;  4Y3O A;  3BJA A;  4B1R A;  4P9U A;  3J7A O;  4BDZ A;  1RET A;  3TO6 A;  1KU7 A;  2L4M A;  3E7L A;  3CO6 C;  4OIP F;  1I1S A;  3MN2 A;  3K1P A;  2R7Z J;  4LIT A;  1A5J A;  5GAH J;  3BZ6 A;  2BHZ A;  5KNL A;  1IUF A;  1GUU A;  2OAZ A;  3BZC A;  2LY2 A;  3K4B A;  3OSF A;  2KIQ A;  2VT3 A;  3KPH A;  3GTQ J;  3U1D A;  4AIH A;  4AVZ A;  1X1D A;  2BBY A;  4XON A;  4BY1 J;  1UJ8 A;  2F2E A;  4M3E A;  2VKH A;  1OCZ H;  4UB6 C;  2DAO A;  2F5C A;  4BQO A;  1X4O A;  1I5Z A;  2MAB A;  2YU9 J;  2K85 A;  1E2X A;  1O4X A;  3S1R J;  2QSG X;  5EEH A;  3I71 A;  2NVQ J;  3BG3 A;  1MGT A;  1JHF A;  5ILU A;  1XSV A;  1XGM A;  1IRZ A;  3HOU J;  1Y8R B;  3R0A A;  2OQG A;  2GIZ A;  2NOJ B;  1SD7 A;  3DU5 A;  3CDH A;  2R7S A;  2X9D A;  3TQN A;  2O6G E;  3Q9V A;  1AOY A;  2VOD A;  2BXZ A;  1HBX G;  2NS8 A;  3DKY A;  1P4A A;  5A2Q K;  1JTX A;  2EFO A;  4EM0 B;  3OYE A;  5LHI A;  2IEK A;  4XOP A;  1AA7 A;  2VE9 A;  4M6V A;  4BAY A;  5KK1 A;  1U0J A;  1BR1 A;  3V8L A;  4GRI A;  4NC7 A;  2LH9 A;  3BCB A;  3G1M A;  3NAU A;  3HKZ A;  4DOZ A;  1YX5 A;  2ID3 A;  3QYB A;  1Y8Q B;  1Z0X A;  2VXD A;  2Q1Z B;  2R4G A;  4N9H A;  5J8C A;  1Z67 A;  3KEO A;  4MHG A;  1TWG J;  2BVL A;  2DTZ A;  1ZR2 A;  1SD4 A;  1S8N A;  4BYY A;  1B72 B;  1WH5 A;  1YIO A;  1RPW A;  4XRM A;  4E7S A;  2X85 A;  3OL4 A;  2ELJ A;  3P9K A;  1LE8 B;  4HYE A;  3KYD B;  3ZQG A;  4ABZ A;  2F4O B;  1IF1 A;  1JHH A;  3HYI A;  1D5V A;  4CUG A;  1MBE A;  3BTJ A;  2DK5 A;  3MKL A;  2MBF A;  4NC8 A;  1WJE A;  2R5Z B;  5CQE A;  5J3L A;  3F6O A;  4U7D A;  1TT5 B;  2R5Z A;  5K7H A;  4EGZ A;  3KP4 A;  1ZR4 A;  3V8J A;  1HW5 A;  3NAR A;  1YS6 A;  3G6E I;  4FCY A;  1T95 A;  2Z2S B;  1JI8 A;  4EVI A;  1WGX A;  4L18 B;  2JK3 A;  2JMW A;  1XMX A;  4A3L J;  4A3I J;  5J4V A;  4CSW A;  2ZB9 A;  1D5Y A;  4L0Y B;  1XB4 A;  3GFI A;  5L3D A;  2A6H F;  4JX5 A;  4ENK A;  1FJL A;  1E17 A;  4BAC A;  2BVM A;  3S17 J;  4BBS J;  4GYI A;  2HYJ A;  2L7F P;  2M7B A;  1TNT A;  3TMO A;  2E19 A;  2ZJP F;  5TGT A;  3BPX A;  3V7C A;  2Z1D A;  1MW7 A;  1T6S A;  3LQR A;  3HTS B;  4UVA A;  2A68 F;  4F7Z A;  2JRM A;  1JKO C;  1OCC H;  3K4C A;  3BCA A;  3S2H J;  1WVR A;  1DU0 A;  1SD6 A;  3J80 Z;  3EUK L;  3KZY A;  1FOX A;  1J7K A;  1XSX A;  3V7R A;  3R6S A;  4N9I A;  3OS2 A;  2QBY B;  1IXR C;  1GXP A;  1MMG A;  5LEK A;  5DCF A;  1V3F A;  4B4C A;  1UG0 A;  2CV0 A;  1KU9 A;  3F8C A;  2XVC A;  3BRO A;  3VPR A;  2FQ4 A;  3AKZ A;  1D0X A;  2AO9 A;  2XKP A;  4GDF A;  5GPA A;  3R4K A;  1TWA J;  1OJL A;  4KT5 C;  2GAU A;  2UXN A;  1RR7 A;  4ENM A;  1ORK A;  5CVR A;  3KLN A;  5FRM A;  2UV1 A;  4EGY A;  3DBL B;  1B4A A;  3ABK H;  3H9Q A;  1F43 A;  1X2N A;  5ILV A;  3K7A J;  5CPR B;  1LPQ A;  3E1S A;  5FJ8 J;  3DKX A;  1P6R A;  2Y75 A;  3P9I A;  4J19 A;  2GXA A;  5EGO B;  1VND A;  3M7G A;  1SVM A;  2EQR A;  3WTS C;  1BIA A;  3KX2 A;  2ME6 A;  3BR6 A;  2V9K A;  4HQM A;  1C0W A;  1GVD A;  2EK5 A;  5EGO A;  2CO5 A;  2EV6 A;  2O7O A;  2P0W A;  2MD5 A;  2OCE A;  3S32 A;  3QYE A;  3DF8 A;  2EZK A;  5LBQ A;  1D0Y A;  4PJM A;  1FBS A;  5KHD A;  1WCM J;  1R5G A;  3VSK A;  1V5F A;  2EBI A;  1I39 A;  2KMU A;  2UUZ A;  4U0V A;  4I2O A;  5E8G A;  1TNS A;  4DGW B;  4RS8 A;  5B1A H;  5J1R A;  1T33 A;  2BY0 A;  3CJT B;  4WXH A;  1E3H A;  3WTT C;  1W0U A;  4AVP A;  2QVO A;  4IHT A;  2BGC A;  3S1N J;  3RKW A;  2FRH A;  1DQU A;  2ESN A;  4NHJ A;  3RDI A;  2KT0 A;  4D5F A;  2GXG A;  2EFW A;  2CUZ A;  4Y7N J;  4U87 A;  2GIV A;  3H0G J;  2LSO A;  2KIS A;  4YFX F;  4DZP A;  2PN6 A;  5LEJ A;  4L5J A;  2KZG A;  3L2V A;  3MFK A;  5AIQ A;  3K4N A;  4BQN A;  2VOO A;  3G3Z A;  5AIP A;  3RZO J;  4A3E J;  4PJL A;  3J81 K;  1SFU A;  1PP7 U;  1Q1V A;  2KKO A;  1FSE A;  2W00 A;  4C2M J;  2QLZ A;  2WAE A;  1WJ5 A;  3H0D A;  4PJ0 C;  1G59 A;  1K6Y A;  3FXL A;  3I5U A;  2IGM A;  1WJA A;  3ML6 A;  3ECO A;  4JQF A;  3LSP A;  3SXY A;  3FZV A;  5D5U B;  5LFA A;  2VAS A;  2Y31 A;  1XMK A;  2HOS A;  2VT2 A;  5K1Y A;  2FF4 A;  2LTP A;  3LSR A;  5H6R A;  1VZ0 A;  4QIW N;  1UZC A;  1APL C;  2E1C A;  3OL3 A;  5DTD A;  2M30 A;  3WGH A;  2RQP A;  2PEX A;  2CW8 A;  4M9S A;  1G8X A;  2HDW A;  4KIT B;  3GCM A;  3GXO A;  3VOE A;  2A5Y B;  3MKY B;  1RKT A;  2RC4 A;  3IP4 B;  3M3Y J;  1OYY A;  1Z3X A;  2X1C A;  3L9F A;  4XLA A;  3OSG A;  2K3F A;  1OCR H;  3PUF A;  5H6Q A;  2IVM A;  4OU0 A;  5DCM B;  3U21 A;  2XAQ A;  1JTY A;  2MLK A;  1QHH D;  1MDM B;  1JKQ C;  3OYC A;  4PFP A;  1K83 J;  3VYT B;  2MW8 A;  1HST A;  3HUG B;  4D9J A;  1BOB A;  3CF2 A;  4WK8 F;  4EJV A;  4IRH A;  3J7Z I;  4HLX A;  1ZG3 A;  1OR7 A;  2M0C A;  3I59 A;  3ZQC A;  4YEL A;  3ZMD A;  4LFU A;  1IC8 A;  2LF7 A;  3DWL E;  3ERM A;  1JGS A;  1KQ0 A;  1G3S A;  1MNE A;  3E5U A;  2W57 A;  4ZYE A;  3K70 C;  4HF0 A;  2IJL A;  1R4N B;  2E1M B;  2GBY A;  4FE7 A;  2HTS A;  4EJO A;  4ZYH A;  2FBK A;  2GOM A;  1AHD P;  5JFR A;  4M71 A;  2MD0 A;  2M8E A;  5EG0 A;  3FMS A;  2VJJ A;  1P4W A;  1IN8 A;  3ABU A;  3PFI A;  4ZDL A;  5CVI A;  2JUC A;  3ZXS A;  3LSM A;  2EZL A;  1GVJ A;  2LNB A;  2DOF A;  4F3Q A;  2XPU A;  5EG0 B;  3I54 A;  4B48 A;  2QGU A;  4L9T A;  4UUS B;  3WTV C;  2QYO A;  4KNY A;  4CCK A;  1TW3 A;  4MEX F;  3WOD F;  2A5W A;  1RNL A;  2XRL A;  4JK1 X;  4A3M J;  2DMN A;  2DJI A;  4XOT A;  2HOE A;  5JI6 A;  2EFP A;  3DFG A;  4ZDP A;  3ZP5 A;  2JA5 J;  1TQP A;  5F1J A;  2FNA A;  4FTH A;  1X58 A;  2PMZ A;  1D1A A;  5CQG A;  4QPO A;  2B63 J;  3TW6 A;  2MYS A;  1IXC A;  1UFM A;  3A01 B;  4IKF A;  1S7A A;  1MMA A;  1T56 A;  4MQV A;  1FC3 A;  2K7L A;  1MD0 A;  3E0J B;  4U0W A;  2OJE D;  1IGN A;  1G3Y A;  3GUD A;  2DFH A;  1A31 A;  1FTT A;  2XGD A;  1B8I B;  4HPQ A;  3G2B A;  2CQX A;  3ELK A;  3OIP A;  4BNC A;  2CUE A;  4BUP A;  1MBJ A;  3DQV C;  4BEH B;  2FU4 A;  3HOT A;  4GFB A;  1ZKG A;  2L01 A;  2X6O A;  1YRN B;  2PJR A;  3BG5 A;  1FZP B;  2GA2 A;  4G9Y A;  1RKW A;  5LGN A;  1X3U A;  2M4K A;  2KIF A;  2LKP A;  4X0G A;  1MBH A;  5L3B A;  4AUX A;  4GO1 A;  1V5G A;  2Q2E A;  2BW3 B;  3EUH C;  3BQZ A;  5M5W J;  1VQ8 I;  1MND A;  2FMY A;  3I4P A;  4A6E A;  4B47 A;  1N75 A;  2P4W A;  2K4B A;  3EYI A;  5IYC J;  2BW3 A;  3HC7 A;  3HOS A;  5FD5 A;  1O3Q A;  2KJB A;  1V4R A;  4ITV A;  2RN7 A;  4FX0 A;  2IP2 A;  3TDU C;  2RAE A;  2DA2 A;  5HDK A;  1SAU A;  3T1B A;  4WWC A;  2H6C A;  3C18 A;  2KDZ A;  4CCM A;  1IW7 F;  4G8X A;  3TW7 A;  2DFI A;  4O6J A;  4I0A A;  3MVP A;  3C7J A;  3BJO A;  2W25 A;  4R1H A;  3WTW C;  5FFZ A;  3GTO J;  2HQN A;  3N05 A;  5DYM A;  2VQC A;  1FOW A;  5CYV A;  4BKX A;  4J01 A;  1ZGA A;  4M6Y A;  2COB A;  2P5V A;  4DYR A;  2EA2 A;  2RV8 A;  2PFB A;  3LQQ A;  1O3T A;  1KQ8 A;  4PJJ A;  1L0O C;  2HPI A;  5LGT A;  5HNF A;  1U5T B;  4IHX A;  4ETS A;  1OCT C;  2IRF G;  3BR2 A;  4NBQ A;  1YO5 C;  2G7U A;  1HQC A;  5FGM A;  2X0L A;  1WWX A;  1BL0 A;  2EZH A;  1EJ9 A;  4RDU A;  3ESW B;  3FX3 A;  3B73 A;  4DYQ A;  3SEQ A;  3SQN A;  4KA4 A;  3HRM A;  5GPC A;  4OIO F;  2F4I A;  2WY8 Q;  3BTI A;  4MTD A;  2OBP A;  1WJF A;  2CW0 F;  1YJ9 I;  5J4Y A;  1JUP A;  2CSO A;  5KVR A;  1YTY A;  2NS7 A;  4P9F A;  4NQW A;  5EZH A;  3TO7 A;  4C3H J;  3H92 A;  4V2G A;  5DUI A;  5D5W B;  3LAJ A;  3P9C A;  5E3L A;  1Y0U A;  3FMQ A;  3OYL A;  1VI0 A;  4V2F A;  1IDY A;  2M9H A;  1ENH A;  2D1V A;  5IYD J;  1B72 A;  2EWN A;  2DA7 A;  5FLM J;  2PBI A;  1J5Y A;  2O0Y A;  3S1Q J;  2NXN B;  1UST A;  3MMY B;  2L9N A;  3QP6 A;  4DIQ A;  1Z6T A;  2ME0 A;  1U5T C;  4UV8 A;  3QRF F;  3CC4 I;  2K3P A;  2CU7 A;  3KLO A;  1K6O A;  2XGX A;  4N0B A;  1O7L A;  4EJT A;  4KDP A;  3F21 A;  5E17 F;  3K2A A;  3L1P A;  4AM3 A;  4CHU A;  4E7K A;  1PYV A;  3W2W A;  4CGZ A;  3HJE A;  3AG1 H;  4P5O A;  3SHF A;  3CCQ I;  2HPM A;  2V9P A;  3ASO H;  2H1L A;  3K0L A;  2R7F A;  1IXS B;  4XLE A;  2NVU B;  5HLH A;  4I02 A;  2XSJ C;  4CDG A;  3A03 A;  3HGG A;  3HOV J;  3P5J A;  5DDG A;  2IS6 A;  3CJN A;  3IAS 2;  1ETO A;  4CXF A;  3RQI A;  2Z5U A;  1KA8 A;  2VKE A;  4QPQ A;  3BG7 A;  2HFH A;  3NQO A;  5F08 A;  3N4M A;  2WC2 A;  2IS4 A;  2L0K A;  3QPH A;  2YX7 A;  2OU2 A;  1K4T A;  1RUN A;  3V7S A;  2BYV E;  2XF6 A;  4HSR A;  4HF1 A;  1POG A;  2I5U A;  1D3Y A;  4M6X A;  2XHK A;  3CCY A;  3O6B B;  4BXU A;  5A2Q Z;  2ZSH B;  5H20 A;  4C3I J;  4KIG A;  3SJM A;  2H6B A;  2ZFU A;  3CP8 A;  1VQ6 I;  1HSJ A;  2DMQ A;  1IZ1 A;  3R61 A;  5GAE J;  1FMV A;  2HOT A;  2ISY A;  3LSH A;  1IRG A;  3LSK A;  2COM A;  2W4S A;  4OAY A;  1JT6 A;  1S29 A;  1MH4 A;  4JX6 A;  1FYL A;  4F92 B;  4QSH A;  3G1L A;  3VSL A;  2R7U A;  2W24 A;  4Z2Y A;  4LLG F;  1DPU A;  1FP1 D;  3BWG A;  1YLF A;  5C44 J;  3GTG J;  1UHS A;  5E20 A;  3FXQ A;  3L2W A;  3FBI B;  5D8L B;  3KEY A;  1HF0 A;  3CD6 I;  4IF4 A;  4O5V A;  5BMZ A;  2EH3 A;  4A3B J;  5HOD A;  2Z16 A;  1DUX C;  4YEJ A;  4YG2 F;  1UHM A;  2VC1 A;  1AKH A;  2AQF A;  1FPQ A;  1P9Q C;  4FQG A;  1XDS A;  3OYI A;  2ACJ A;  1FLI A;  1QHG A;  3FIW A;  2L9S A;  3CO7 C;  1VF9 A;  1NH3 A;  4OMY A;  3RJP A;  1U8R A;  1F5T A;  2A61 A;  2VKD A;  5KCM A;  3CMM A;  2KJC A;  3ULQ B;  4Y13 A;  1EF4 A;  3I53 A;  4CYC B;  3U1K A;  3UNG C;  4UXN A;  3J80 K;  1B9N A;  3CCE I;  2NAZ A;  3B6A A;  2H1K A;  2VOP A;  1XC5 A;  1TBX A;  4ZJZ A;  2TCT A;  1MSE C;  4U88 A;  2LRD A;  3REO A;  3ZQI A;  5D4S A;  3IKV A;  1YI2 I;  4ASN A;  3FIS A;  5HLI A;  2IPQ X;  2FQ3 A;  1XTA A;  2M5W A;  2JUG A;  2P81 A;  1Y56 A;  3CCJ I;  2F6C A;  3FXO A;  4D0P A;  1H9G A;  2VE8 A;  3OMY A;  4HQE A;  4I98 B;  4CYD A;  4MTE A;  5B1B H;  4HG2 A;  1Z9C A;  4Q48 A;  3WU0 A;  2B7E A;  2FBH A;  2XUB A;  4DZJ A;  3TGN A;  1PVE A;  3JSP A;  2Q2E B;  3L00 A;  1R58 A;  4AWX B;  2V9V A;  3E97 A;  4ESF A;  5M3F J;  4XKB A;  4NNJ A;  3FHN A;  2OC6 A;  1MJA A;  3RKY A;  1WHU A;  4WXC A;  4W1U A;  1QO0 D;  1H88 C;  2ZXH A;  2F5D A;  1T39 A;  2F48 A;  3M4O J;  3FXM A;  3GZN B;  2FUG 2;  1XGS A;  3ZN1 A;  3L7W A;  4C9Y A;  2VBX A;  2P5K A;  1XG1 A;  2TDX A;  2WB1 A;  1Z05 A;  3ECH A;  4F91 B;  2G0E A;  3HOY J;  1CF7 B;  1W5T A;  4E70 A;  2Z33 A;  3Q0V A;  1K79 A;  1EKE A;  2JSP A;  3BP8 A;  5IP6 A;  4A0Y A;  2OA4 A;  3KYL A;  4C30 A;  4D7N A;  4ZC3 A;  4U7B A;  1V5E A;  2GZW A;  3NRV A;  4AU7 A;  5JHF A;  1NG6 A;  2K9Q A;  3PQJ A;  3H5R A;  1X4P A;  3TOA A;  2VI6 A;  1YRN A;  2EFQ A;  3GYH X;  3CUO A;  3DTE A;  3RPU A;  1FYK A;  2V1D A;  1I1G A;  1WPK A;  2YR2 A;  5FKL A;  1W0T A;  2BOL A;  2DTR A;  2V1X A;  2CW7 A;  2Z99 A;  2CS3 A;  3CUQ B;  2LY9 A;  2O03 A;  5B5E C;  2YU3 A;  1ITY A;  2RRE A;  1LFB A;  3DPT A;  1BI0 A;  3O8H A;  1RR8 C;  5J6X A;  2V6E A;  4MO7 A;  4IHV A;  1YW7 A;  1GV2 A;  3OYG A;  4LLL A;  3E5X A;  3UKG A;  2JRT A;  2PG4 A;  3JAM K;  5C4J J;  2E2H J;  4ANJ A;  2MC3 A;  2V4J C;  4YIF A;  2OTL I;  4G7O F;  2X48 A;  4BL0 B;  5CVU A;  1QNT A;  3IWF A;  4BJ5 C;  2BZT A;  3I59 B;  2LRE A;  1NK3 P;  2CQN A;  2M8G X;  5TRD A;  2DFF A;  2EZI A;  3CJQ B;  2M7A A;  1I6H J;  1HKT A;  2XSD C;  4XLF A;  2O5R A;  2R7D A;  2VON A;  3WE2 A;  2QSH X;  5ICE A;  1KGS A;  2LLK A;  5L3C A;  3TP0 A;  3IV5 A;  5DD4 A;  2QQ9 A;  4P1W A;  4C3J J;  5GTI C;  2QKL B;  5LRR A;  2QM3 A;  1K61 A;  1HOM A;  2LMD A;  3QPS A;  2V7F A;  2HI3 A;  1R4M B;  1Q1H A;  5DEQ A;  3QOE A;  2R5Y A;  1JT0 A;  2DDA A;  2VBY A;  3RKQ A;  2K40 A;  2W82 A;  1Y39 A;  2LOO A;  4HOB A;  5EEG A;  2CMP A;  4A5N A;  2M3A A;  4CCN A;  3PIO F;  2FX0 A;  5GTH C;  3ZQL A;  1HKQ A;  2E60 A;  3FK7 A;  1VTN C;  3JW4 A;  3H3U A;  2EIJ H;  1IV8 A;  2CFX A;  2K9S A;  4XRF A;  3DEE A;  5CLS A;  3HOW J;  5E3M A;  4BJ6 C;  2GOX B;  3GO5 A;  1Y0N A;  2MLG A;  1IRX A;  2QQB A;  2CQ7 A;  1A35 A;  3R60 A;  4NB5 A;  3DP7 A;  1AU7 A;  1LVA A;  2G7H A;  3VOD A;  4A6D A;  3HRT A;  2EFN A;  5DM6 F;  3S8P A;  4A2U A;  1V54 H;  2BXY A;  3SDB A;  3A4C A;  4RGX A;  3PO2 J;  4G6D A;  5B3S H;  2A69 F;  5F0F A;  3OY9 A;  1LEA A;  3WGG A;  4XIC A;  4B8X A;  3WU1 B;  4HX8 A;  3PJR A;  2FML A;  2EIM H;  2ADU A;  2LF8 A;  4HX7 A;  3HBL A;  2MC4 A;  2CV2 A;  3SYT A;  2DPD A;  4P55 A;  1P7J A;  3Q0U A;  2WBM A;  3PUB A;  3D0S A;  2TRT A;  2CGP A;  1IG7 A;  2QEN A;  2V79 A;  1BI2 A;  3LA3 A;  4R79 A;  1YIT I;  1SMY F;  1G3T A;  2FOK A;  5L3F A;  2V1N A;  2JZY A;  2EPF A;  2CQK A;  4UNO A;  1DPR A;  3GTJ J;  4YFN F;  1N77 A;  4IJA A;  4JOM A;  2QZ8 A;  1T0F A;  3RIR A;  3SFI A;  4G7Z F;  2QSF X;  3CUQ C;  2KDO A;  3ROU A;  3LSI A;  1T2K A;  1EV7 A;  2RQQ A;  1OPC A;  1OR7 C;  1KU3 A;  3GW2 A;  4ZYD A;  1MDM A;  2JA6 J;  5CVV A;  1R23 A;  3O8G A;  3OWT A;  2AHQ A;  1SC7 A;  2DOD A;  4JYK A;  4BXF A;  1BW6 A;  1MNM C;  1P2F A;  5HDG A;  3F8N A;  4LOC A;  4HRI A;  1F9N A;  1IN6 A;  5E8I A;  1FWZ A;  2WTE A;  2XKO A;  1GT0 C;  3HTU A;  4KIB A;  2F5E A;  2KQR A;  4BY7 J;  3COA C;  3WTX C;  4RAG A;  2MA3 A;  2A3S A;  2W85 A;  3IUO A;  4ZZD A;  3ZN0 A;  4AIK A;  2WAQ N;  2PJP A;  3F72 A;  4E7I A;  2OUM A;  3FXK A;  3LSG A;  3WTZ A;  2QCO A;  3MAJ A;  5F1R A;  3JRC A;  2D2W A;  3R0J A;  4BJT A;  1B1B A;  1T98 A;  2DU9 A;  2D1H A;  3WHB A;  5F04 A;  3B02 A;  2M45 A;  4PGH A;  4XR6 A;  1MZB A;  3WTU C;  3J81 Z;  2A6E F;  4OOI A;  4HLY A;  2Z9O A;  3ZMZ A;  4D5C A;  2Q0O A;  1U2W A;  5E3N A;  2HWV A;  3BTL A;  5LRS A;  1SMT A;  1UMQ A;  1M1E B;  4RB2 C;  3K10 A;  1F1Z A;  2PMU A;  4CIC A;  1Z3Y A;  2X51 A;  3GFL A;  3OYK A;  3L2C A;  2WAD A;  4IL6 C;  4NC6 A;  4ESB A;  1DP7 P;  3A1Y A;  1UCR A;  1R1V A;  3GF2 A;  1YJW I;  1N25 A;  2ZO4 A;  2KLO A;  4EAT A;  3FWE A;  2DA4 A;  2DFE A;  3F3X A;  2AS5 F;  2RVC A;  2Z3Y A;  1ETV A;  4BU2 A;  2PI0 A;  1OLT A;  1YW8 A;  2HXO A;  2EV5 A;  3GWZ A;  2WV0 A;  4PDK A;  3KE2 A;  4RAY A;  2XB0 X;  4Y17 A;  1VQP I;  1MIJ A;  1OYI A;  2HEO A;  2QUF A;  3FM5 A;  4Y15 A;  2DA5 A;  4D7M A;  2XC7 A;  4MEY F;  4KMU X;  1PUF B;  1XS9 A;  1RRJ A;  3HPG A;  2STT A;  3RSN A;  2M0M A;  2JVH A; 
#chains in the Genus database with same CATH homology
 3HEF A;  5IPA A;  2OPT A;  5C3E J;  1QVU A;  1MH3 A;  2R5Y B;  1BL0 A;  2EZH A;  4RDU A;  3LOC A;  5K7Z A;  4DYQ A;  3B6C A;  3GTP J;  4MIM A;  5GPC A;  4A3D J;  3BTI A;  1Y1W J;  3S16 J;  3BQY A;  1JUP A;  4B1R A;  4UUT A;  2NS7 A;  1RES A;  1RET A;  5EZH A;  4C3H J;  5FLV A;  4V2G A;  3E7L A;  5E3L A;  1WI3 A;  5EZG A;  1VI0 A;  1ZGW A;  4V2F A;  3MN2 A;  1IDY A;  2M9H A;  4FIS A;  1ENH A;  2L9R A;  2R7Z J;  2Y9Z A;  1A5J A;  1JKR C;  5IYD J;  1IUF A;  1GUU A;  1B72 A;  2YUS A;  3OSF A;  2DA7 A;  5FLM J;  3S1Q J;  3GTQ J;  4XK4 A;  4BY1 J;  4A3C J;  1JUM A;  4M3E A;  1HDP A;  4IHW A;  2ME0 A;  2CU7 A;  3FKI J;  2YU9 J;  2XGC A;  1O4X A;  3K2A A;  3L1P A;  2K9N A;  3S1R J;  1U78 A;  2CQQ A;  2NVQ J;  3S14 J;  3BG3 A;  5EYR A;  4A3G J;  3CMY A;  1MBK A;  1IRZ A;  1MBG A;  3HOU J;  2HQ5 A;  2Y9Y A;  2X9D A;  4MLO A;  3A03 A;  3HGG A;  3HOV J;  4M3F A;  1HLV A;  2MGQ A;  1ETO A;  2NS8 A;  3RQI A;  4DW6 A;  5M3M J;  3JRE A;  1JTX A;  2VKE A;  2MG4 A;  1Y1V J;  1AKH B;  1NK2 P;  2ECC A;  5F08 A;  2IEK A;  2YS9 A;  4M6V A;  2L0K A;  1POG A;  1VFC A;  5F27 A;  3G1M A;  3CCY A;  3NAU A;  2VUM J;  3SJM A;  4C3I J;  2ID3 A;  5JLW A;  4BBR J;  1Z0X A;  5E3O A;  1FIA A;  2DMQ A;  5J1Y A;  1TWG J;  2DTZ A;  1ZR2 A;  1OCT C;  2HOT A;  1B72 B;  1ETW A;  1FEX A;  1R9T J;  1OCP A;  1WH5 A;  1TC3 C;  3I4N J;  2LP0 A;  1RPW A;  4XRM A;  2XB5 A;  1LE8 B;  1JT6 A;  3ZQG A;  4ABZ A;  2GLO A;  3HB9 A;  1MBE A;  4FE4 A;  1MH4 A;  1U9N A;  2NVX J;  3BTJ A;  4JX6 A;  3MKL A;  4EEF G;  4MFE A;  4QSH A;  3G1L A;  2R5Z B;  2Y0S N;  3CDL A;  4L5E A;  1HDD C;  5C44 J;  5J3L A;  3GTG J;  4UUS A;  1MBF A;  1UHS A;  3HOX J;  1HCR A;  3F0C A;  2R5Z A;  3I4M J;  1HF0 A;  5K7H A;  3SDG A;  1S7E A;  1ZR4 A;  4MFD A;  3NAR A;  3CQZ J;  2EH3 A;  4M3D A;  4A3B J;  1BW5 A;  5HOD A;  4FCY A;  1ZTR A;  4DYC A;  1WGX A;  1AKH A;  2JK3 A;  2JMW A;  4A3L J;  4A3I J;  1TWF J;  3PO3 J;  3FIW A;  3IH3 A;  3JRG A;  2ZB9 A;  1VF9 A;  4A69 C;  3JRB A;  1D5Y A;  1JJ6 C;  3DEW A;  3WHC A;  5F0C A;  4Y52 J;  2Y30 A;  1ETK A;  4IEJ A;  4JX5 A;  1FJL A;  3S17 J;  1P7I A;  4BBS J;  2FD5 A;  2HYJ A;  2MSY A;  1EF4 A;  4A93 J;  2L7F P;  4CYC B;  2E19 A;  5FKO A;  3DCF A;  3RZD J;  5GP9 A;  1LE8 A;  3B6A A;  4X1E A;  2H1K A;  1XC5 A;  2TCT A;  1MSE C;  3ZQI A;  3S2D J;  4RBO A;  1QVT A;  2DJN A;  2HOA A;  3HKZ N;  5IP7 J;  2LVS A;  3HOZ J;  3FIS A;  1DU6 A;  1JKO C;  1IJW C;  4XRS G;  1TWC J;  2P81 A;  2O9L A;  3S2H J;  1ETQ A;  1DU0 A;  1LFU P;  5M5Y J;  2O8K A;  3A02 A;  1GDT A;  4DZJ A;  4B4C A;  2E1O A;  5IP9 J;  3VPR A;  2H8R A;  2FQ4 A;  3GBG A;  2AO9 A;  5GPA A;  5M3F J;  1JJ8 C;  3GTL J;  1TWA J;  1OJL A;  3JRH A;  2HXI A;  4B3A A;  1RR7 A;  5F0H A;  1ORK A;  4W1U A;  5EF6 A;  1H88 C;  4M3G A;  1F43 A;  2DMT A;  1X2N A;  3K7A J;  3M4O J;  5FJ8 J;  2Y2Z A;  4XRS A;  4X6A J;  4J19 A;  5JLX A;  5EGO B;  1VND A;  2EQR A;  1NTC A;  5BNG A;  1XG1 A;  2ME6 A;  3BR6 A;  2G0E A;  3GTK J;  3S1M J;  1GVD A;  4XID A;  3IH4 A;  5IOY A;  5EGO A;  3HOY J;  2O7O A;  3Q0V A;  3QPL A;  1A6I A;  2DMU A;  4JP0 A;  5IP6 A;  1JKP C;  2EZK A;  4D7N A;  2JWT A;  1WCM J;  1U9O A;  2K9Q A;  2XGE A;  2LD5 A;  1JGG A;  2JA8 J;  1YRN A;  2VI6 A;  2EBI A;  2FJ1 A;  2VKV A;  2N8G A;  5K7F A;  5J1R A;  1W0U A;  1T33 A;  3BR5 A;  1WPK A;  4IHY A;  5FKL A;  1W0T A;  5EEA A;  3S1N J;  3ZOB A;  2LY9 A;  2KT0 A;  2LKX A;  2QF7 A;  4D5F A;  1H8A C;  1ITY A;  2DMP A;  3Q0W A;  4Y7N J;  1LFB A;  3H0G J;  3O8H A;  4MO7 A;  4DZP A;  3D1N I;  4IHV A;  1GV2 A;  1IV6 A;  2XPV A;  2CJJ A;  3UKG A;  5C4J J;  4HNV A;  1FTZ A;  1Z77 A;  2E2H J;  3S15 J;  3JRD A;  2R93 J;  3RZO J;  2X48 A;  4A3E J;  5FKN A;  1Q1V A;  5J1U A;  1NK3 P;  4C2M J;  2M8G X;  1U8B A;  2EZI A;  1I6H J;  2XSD C;  2HDD A;  3BR0 A;  1WH7 A;  4I76 A;  2LLK A;  3LSP A;  4G12 A;  3TP0 A;  3IV5 A;  1FIP A;  2E2I J;  2Y31 A;  4C3J J;  1GV5 A;  2XPW A;  4W97 A;  5FKK A;  1K61 A;  2HOS A;  1HOM A;  3QPS A;  2NOG A;  2LTP A;  2OF7 A;  2HI3 A;  3LSR A;  4QIW N;  1APL C;  2R5Y A;  1JT0 A;  1H89 C;  3RKQ A;  2K40 A;  1JUS A;  2DN0 A;  5DTD A;  2CRG A;  1CQT A;  2DA6 A;  4BXX J;  1QRY A;  2FX0 A;  3ZQL A;  3FK7 A;  3IH2 A;  2DA1 A;  2K9S A;  1RKT A;  2D5V A;  3M3Y J;  3OSG A;  1E3O C;  1TWH J;  3HOW J;  5E3M A;  3JRA A;  2IBD A;  2I10 A;  5FKM A;  1F36 A;  1JTY A;  2L7Z A;  1JKQ C;  2ID6 A;  1AU7 A;  1K83 J;  2MW8 A;  4A3J J;  4CYC A;  3Q3S A;  4I6Z A;  4NDL A;  4A3K J;  3BR1 A;  2M0C A;  5M5X J;  3ZQC A;  3PO2 J;  1IC8 A;  1I3Q J;  3QQA A;  5F0F A;  3HM5 A;  5DS9 A;  4XIC A;  3LNQ A;  2GBY A;  4FE7 A;  3BTC A;  3HBL A;  1AHD P;  3PM1 A;  3GTM J;  2W48 A;  1P7J A;  3Q0U A;  5EG0 A;  2DA3 A;  2TRT A;  2PMZ N;  1IG7 A;  1SAN A;  2JN6 A;  2E2J J;  2EZL A;  2M2E A;  5EDN A;  3LSJ A;  2XPU A;  5EG0 B;  2WB1 N;  4UUS B;  1ETY A;  3GTJ J;  3JR9 A;  2LFB A;  2XRL A;  4A3M J;  2DMN A;  3TP3 A;  3SFI A;  2LR8 A;  5IYB J;  2JA5 J;  3G1O A;  1QPI A;  3BR3 A;  2VPR A;  5F1J A;  2WV1 A;  2NVT J;  4FTH A;  3C2B A;  1X58 A;  1I50 J;  3BT9 A;  3OIO A;  2L7M P;  2JA6 J;  2B63 J;  9ANT A;  3TW6 A;  3O8G A;  3A01 B;  4AYB N;  2AHQ A;  1T56 A;  2JJ7 A;  3W6V A;  1IGN A;  4JYK A;  1X2M A;  2M34 A;  1BW6 A;  1MNM C;  1FTT A;  2XGD A;  1B8I B;  1ZK8 A;  2CQX A;  4LOC A;  3OOU A;  3A01 A;  3HDD A;  2CUE A;  1GT0 C;  1MBJ A;  1G2H A;  3BG9 A;  4BY7 J;  4GFB A;  1ZKG A;  2X6O A;  1YRN B;  3BG5 A;  2WAQ N;  1RKW A;  1OFC X;  4JX4 A;  1MBH A;  2R92 J;  4QTR A;  4AUX A;  3LSG A;  3H3V K;  2QCO A;  3JRC A;  1ETX A;  3BQZ A;  2GM4 A;  3JRF A;  5M5W J;  1BA5 A;  3WHB A;  5F04 A;  5IYC J;  1ZQ3 P;  4S0H B;  4D5C A;  5E3N A;  3BTL A;  2RAE A;  1UMQ A;  2DA2 A;  2KDZ A;  1BJZ A;  1MSF C;  3TW7 A;  2R0Q C;  3FK6 A;  3MVP A;  4A3F J;  5C4X J;  1IDZ A;  2NVY J;  1SFO J;  3GTO J;  2DA4 A;  1ETV A;  3TED A;  2JA7 J;  4BKX A;  1PUF A;  2HXO A;  3HGY A;  1UG2 A;  2XB0 X;  3ZQH A;  5IOZ A;  2COB A;  2IAI A;  2ELK A;  4DYR A;  3JRI A;  1B8I A;  3ZQF A;  2DA5 A;  4D7M A;  4AC0 A;  2LK2 A;  1PUF B;  2ECB A;  1XS9 A;  4IHX A;  2CUF A;  4M3B A;  3BR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...