1X2NA

Solution structure of the homeobox domain of human homeobox protein pknox1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
GSSGSSGKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the homeobox domain of human homeobox protein PKNOX1
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein PKNOX1
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x2nA01
2VKVA 1JJ6C 5IP9J 3S1QJ 1I3QJ 2DA6A 2HQ5A 5JLXA 4MIMA 5IOZA 2ELKA 3LSGA 4BBSJ 3QPLA 4IHVA 2E2IJ 2CUFA 3JREA 1FTTA 5M5WJ 3ZOBA 5EEAA 5GPAA 2JN6A 2GLOA 4BXXJ 1GVDA 3K2AA 2WAQN 5DS9A 2DMUA 2HOAA 3BTIA 2M2EA 3UKGA 1HF0A 2HYJA 1IGNA 3S1RJ 4W97A 2FJ1A 2YU9J 3TP0A 2G0EA 1R9TJ 2I10A 5FKMA 1JT6A 3S16J 4JX4A 3IV5A 2DN0A 4V2GA 3HBLA 2JA7J 2R5ZB 4AUXA 2DMNA 3BT9A 2ME6A 3JRIA 5EZHA 1GT0C 4C3IJ 3BR2A 1W0UA 3BG9A 3CCYA 4DYQA 3GTMJ 3L1PA 4M6VA 1JTXA 3FK7A 3HOUJ 4D5FA 4S0HB 3NARA 2NVQJ 1SFOJ 1D5YA 1F36A 2XGCA 1A5JA 4RDUA 4D7MA 1AU7A 3WHCA 1IV6A 2EZLA 1BW6A 4JX5A 5EYRA 4NDLA 1QVUA 2CU7A 4B3AA 4MFDA 5HODA 1LE8B 2M0CA 1AKHB 2KDZA 4JP0A 3BTCA 3Q0UA 2D5VA 1JKOC 2LVSA 2IAIA 1FTZA 1X2NA 2ZB9A 5C4JJ 1XS9A 2VKEA 2ECBA 5K7FA 4LOCA 4UUSA 1SANA 1H88C 1LE8A 1NK3P 1MNMC 4FE7A 5IOYA 1XC5A 1Y1VJ 1UG2A 5E3LA 3BR3A 4I6ZA 1ETVA 1UHSA 2DA3A 3HGYA 2L9RA 3TW7A 1T56A 2H1KA 2NVYJ 1RR7A 1IUFA 3BG5A 3S1MJ 2XB0X 5M3MJ 4Y52J 2Y9YA 3FKIJ 4BKXA 2DA7A 2R7ZJ 5K7HA 4Y7NJ 3BTJA 3I4NJ 1I50J 1TWAJ 2DA4A 3F0CA 1X2MA 5IPAA 2DA1A 1BL0A 2JWTA 1IJWC 1TWHJ 3BTLA 3ZQHA 4M3EA 4DZJA 2JMWA 2E2JJ 2K40A 4M3DA 3HGGA 5J1UA 4HNVA 3ZQIA 1MH3A 3B6CA 3BG3A 1IDYA 1ZTRA 4MLOA 4JX6A 2WB1N 4A3JJ 2MGQA 2CUEA 1EF4A 3W6VA 4AC0A 2JJ7A 4QTRA 3TW6A 5K7ZA 1FIPA 2NS7A 1ZGWA 5EG0A 2IBDA 3QQAA 3ZQGA 5FKKA 2HXOA 2CJJA 1ETWA 4L5EA 3S1NJ 3VPRA 1FJLA 3O8HA 1JUPA 3LSPA 3S15J 3Q0WA 5M5YJ 3B6AA 3PO3J 3FISA 5F0HA 4A3KJ 1U78A 2AHQA 2XB5A 9ANTA 2TCTA 1QRYA 1JGGA 2WV1A 1ORKA 5F0CA 2QF7A 2OF7A 3TEDA 3Q3SA 1O4XA 1G2HA 5EG0B 3OIOA 2R5YA 2W48A 1IG7A 1JKPC 4MFEA 1HOMA 1WI3A 3BQZA 2L0KA 2VUMJ 2Y2ZA 2OPTA 1GDTA 1WPKA 2EZKA 2KT0A 2ECCA 1K83J 3S17J 4XRSA 2DTZA 4BBRJ 3S2HJ 1APLC 1I6HJ 1LFBA 1QPIA 1WH5A 3RKQA 4CYCA 2CQQA 4EEFG 4A3FJ 3PM1A 2EZIA 1AKHA 3GTOJ 1ETKA 3RZOJ 2X6OA 2HOSA 1GV5A 3JRHA 4FISA 2GM4A 2HDDA 5J1RA 1X58A 3JR9A 2EQRA 1Y1WJ 3GTQJ 2HOTA 2B63J 1PUFB 3HOWJ 4JYKA 1ETOA 1JJ8C 1HCRA 1GV2A 3QPSA 1U9NA 2DA2A 4V2FA 1ZQ3P 1T33A 4FTHA 2NOGA 3RZDJ 2DMPA 3OOUA 2M34A 4IHXA 3CMYA 1MH4A 2O8KA 2NS8A 4B4CA 3GTJJ 1U9OA 4A3BJ 3G1OA 1BW5A 1MBFA 3BR1A 1OJLA 3SJMA 1JKRC 5IYDJ 2QCOA 2X48A 1VFCA 1MBGA 4DZPA 5EGOB 2LKXA 1B8IA 4XRSG 3E7LA 2LLKA 2FD5A 2H8RA 3GTPJ 2E2HJ 5EGOA 1B8IB 4D5CA 2L7MP 1TC3C 2Y30A 2DMQA 5F08A 1RESA 4CYCB 1VF9A 3BR0A 4A3DJ 2L7ZA 3HKZN 3PO2J 1POGA 5IYCJ 1Q1VA 1JKQC 5FKNA 2JA5J 2M9HA 4D7NA 3RQIA 3ZQFA 1RETA 2VPRA 3HEFA 1TWFJ 5GP9A 1AHDP 1ZKGA 4G12A 3MVPA 1BA5A 5JLWA 3IH3A 2R0QC 1U8BA 2VI6A 4A3IJ 4A3LJ 2LTPA 2R5YB 2CQXA 1MBKA 4DYCA 1Z77A 2YS9A 3S2DJ 2PMZN 1MSEC 3HDDA 2K9NA 1WH7A 5EF6A 2N8GA 1B72A 5M3FJ 3JRFA 1CQTA 1YRNB 3GTLJ 4DW6A 1UMQA 2NVXJ 3MN2A 1ETXA 3JRCA 3BQYA 1RKTA 3C2BA 3G1MA 5IP6A 3HM5A 5E3NA 4UUSB 2DA5A 1HLVA 2TRTA 1E3OC 1JT0A 1NTCA 3G1LA 3HOXJ 4W1UA 1TWCJ 3GBGA 3SFIA 3WHBA 3HOZJ 1FIAA 2FX0A 1MBEA 3NAUA 3ZQCA 1IRZA 3LSJA 2E19A 1IDZA 5F27A 2DMTA 2XPVA 2XSDC 4DYRA 3JRAA 3JRDA 1BJZA 3A02A 1DU0A 4BY1J 3DCFA 2ME0A 2L7FP 2P81A 4GFBA 4M3FA 3HOVJ 4C3JJ 1YRNA 4FCYA 3A03A 1WCMJ 1MSFC 4M3BA 5FKLA 1B72B 3HB9A 2Y0SN 5EDNA 1HDDC 1RKWA 1DU6A 3A01A 2JK3A 1PUFA 2LD5A 3H3VK 1RPWA 4X6AJ 3FK6A 2ID3A 3D1NI 5E3OA 2K9QA 5FJ8J 2GBYA 3MKLA 2LY9A 5GPCA 3M4OJ 3HOYJ 4IHYA 1LFUP 2R92J 4AYBN 3TP3A 4J19A 5F0FA 2X9DA 3OSFA 5E3MA 3BR6A 5C44J 1ETYA 4ABZA 2XGDA 4QIWN 4A3CJ 2R5ZA 2LFBA 4A3MJ 4I76A 4RBOA 2R93J 2EH3A 1GUUA 1A6IA 5J1YA 2EZHA 2MW8A 4XICA 1ITYA 2NVTJ 1XG1A 2XGEA 5FLMJ 2E1OA 1P7IA 2XPUA 1H8AC 4QSHA 4UUTA 4A93J 2IEKA 5IP7J 2MG4A 4C3HJ 3S14J 1FEXA 1H89C 2Y9ZA 1ZK8A 1ETQA 2LR8A 3LOCA 2RAEA 3FIWA 2M8GX 2HXIA 2HI3A 4XK4A 3M3YJ 2LP0A 5F1JA 1ZR4A 4XIDA 3IH4A 4X1EA 1F43A 2K9SA 4A3GJ 1MBHA 3LSRA 3CQZJ 5J3LA 4XRMA 1NK2P 4IEJA 5DTDA 3JRBA 1K61A 3IH2A 4M3GA 5FKOA 1JUMA 3SDGA 3JRGA 4FE4A 3GTGJ 5M5XJ 1ENHA 1OCTC 2O7OA 3Q0VA 2DJNA 5F04A 3ZQLA 1W0TA 3K7AJ 2Y31A 5C4XJ 2CRGA 1WGXA 1IC8A 3OSGA 2MSYA 4MO7A 4IHWA 5IYBJ 1Z0XA 4B1RA 2EBIA 1S7EA 4C2MJ 1OCPA 2JA8J 4BY7J 2COBA 1VNDA 1JUSA 5FLVA 2O9LA 2AO9A 2XPWA 3LNQA 5BNGA 1OFCX 3BR5A 3O8GA 1JTYA 3DEWA 5C3EJ 5EZGA 1QVTA 2FQ4A 2YUSA 2JA6J 2XRLA 1MBJA 3H0GJ 3I4MJ 1HDPA 1TWGJ 3CDLA 2LK2A 1VI0A 3GTKJ 4A3EJ 1ZR2A 4A69C 2ID6A 1P7JA 3A01B
chains in the Genus database with same CATH superfamily
1OMIA 3J80Z 1N77A 1F5TA 2ZJ2A 1JJ6C 1EH7A 5CQGA 3FXUA 1ODDA 2J5OA 3HUGA 3UR3C 4A0YA 3VSLA 4BJ6C 3BJAA 1IXRC 2E2IJ 3DBRB 3W2AA 1TBXA 2QWWA 5H20A 3DP7A 2DDAA 3K1PA 3LQRA 1SAUA 1P6RA 1HF0A 3FXMA 1OISA 3HHHA 2FJ1A 3M1CA 4KNYA 3CMMA 4PFOA 1BR1A 5FKMA 4UXNA 3HL2A 3IV5A 3H0DA 2MD5A 4PUSA 4OIQF 2DN0A 5FRNA 3IWZA 4V2GA 2R5ZB 2ME6A 2NS0A 3JRIA 2H27A 1Y0UA 1G3WA 4UNOA 3WTVC 5EZHA 1IN7A 3CCQI 2WC2A 4C3IJ 3ZMDA 2ZC2A 1B1BA 3CCYA 2DLLA 4BJ5C 4HOBA 3L1PA 3GTMJ 4KUMA 2LBFB 3AAFA 1S3JA 1N78A 4GCVA 3KIOA 3TO6A 3F3XA 4MTDA 3HOUJ 1G3TA 4S0HB 1OCRH 4MQVA 1O7LA 5ICGA 1DP3A 4UB6C 1SD6A 2QYOA 4M9SA 4ZDLA 2CW8A 3G6EI 1KU7A 4NC6A 2LYCA 4A6EA 1T6SA 4MQ9F 4E7LA 2WAQA 3KZYA 3FXRA 3K70D 5LGNA 2FUG2 3DEEA 5KAIC 1IV6A 2EZLA 4RGSA 3AG3H 3M8EA 3GZ6A 2W24A 1QVUA 2DYRH 4ENKA 2XRNA 1X1PA 2V6CA 1Z9CA 1ZARA 3CTAA 3H9GA 4CH7A 3ZN1A 2VQCA 1W5SA 1V5EA 1AKHB 2JQ7A 1Q1HA 2LBFA 3GCMA 2R4GA 2HFHA 3R60A 1JKOC 4E7HA 2XGXA 4KT5C 4B09A 2XF7A 1S5LC 2VL8A 1LVAA 1X2NA 2L3DA 5C4JJ 5CVVA 3P9IA 4EJOA 2XVCA 2VKDA 2IS6A 4UUSA 4RAZA 5LEJA 4B8XA 4UVCA 2KJBA 1NK3P 5A2QK 4IX7A 1UG2A 4CHUA 5J6XA 1ETVA 3MWMA 4RMNA 1R71A 1KA8A 2DT7B 4A0XA 2DA3A 1XGSA 5ICFA 4DBRA 1T56A 3EETA 5GAEJ 2NVYJ 4BACA 3G2BA 4WXHA 1IUFA 4JK1X 4HX7A 2MA3A 4N0BA 5M3MJ 2K4BA 3LMMA 1ZELA 4PZJA 5GTIC 4HLYA 1XX5A 1IN8A 2V7FA 1R6RA 3FF5A 4KMFA 1QBJA 1W36C 2VODA 2UXNA 3RSNA 2HZDA 4HBLA 4O5VA 1T2KA 1X2MA 3HUGB 2VKHA 4P55A 1XMAA 1R58A 2EFQA 3HTUA 3SZPA 2R7VA 4YIIA 3N05A 3BTLA 4A5NA 4DJAA 4MEYF 2HEOA 4XKVA 4M3EA 4I99C 4DZJA 1BI1A 2K40A 1FOKA 3HGGA 2FQ3A 4XKWA 1SAXA 5DM6F 1IRXA 2EILH 5FFXA 3CF2A 4A5MA 3BG3A 4G7HF 2V1UA 3MAJA 2WB1N 4XLNF 3TMOA 3VYRB 3EYIA 3FMSA 1D0YA 2EPFA 5D5UB 3V42A 4CCKA 1UAAA 2XSJC 1FYKA 3QQAA 3ZQGA 4XONA 3COAC 1ZG5A 4YIFA 4U7DA 4DQ2A 1ETWA 1RI7A 4EM2A 4ENNA 3NWSA 1K7AA 2EIMH 4U87A 3CESA 2ADUA 2PMUA 4A3KJ 4EVIA 3I56I 2AHQA 1U78A 1YOVB 1LB2A 2V4JC 3KX2A 3SZGA 2VT3A 4ZZLA 5IT9K 4KYWA 2Q8KA 1FSEA 2OF7A 4ESJA 2QQ8A 3I64A 2IS2A 1IG7A 2W48A 2PJRB 3P9CA 1OYWA 1WI3A 2VJJA 4E7JA 2HQAA 2G7UA 2D1HA 3CC4I 3LA3A 4KA4A 4XL9A 3K1NA 2VQGA 2VT2A 2EZKA 2FF4A 2KFDA 4YG2F 1R7JA 1K83J 2VPLA 2RDPA 2DTZA 1APLC 1ACIA 1O3SA 3W6KB 4CYCA 2EV6A 3G4SI 3PM1A 2RN7A 3JSPA 4AIKA 1J59A 3RCOA 3FXOA 1E2XA 2HOSA 3ZMVA 1USSA 1KYZA 4BDZA 1H9TA 2IA1A 5J40A 2L4AA 4P5OA 1HW2A 1MD0A 2B63J 1PUFB 4DGWB 1ETOA 4JYKA 5HLHA 4U0VA 1WRJA 1ZHFA 1U9NA 4E7ZA 1BOBA 3H5AA 1XGMA 4WXCA 4BHPA 4AWXB 3WTZA 2E34A 4RGUA 1RNLA 1V54H 2M34A 3AFHA 4UVAA 2OCEA 5DEQA 3CLOA 1R23A 2ZJRF 3LA2A 2EA4A 1X1BA 2JVGA 3QPHA 2F6CA 1U9OA 3FBNB 4PJNA 5LRRA 3CCVI 1VQKI 2XAQA 3SYTA 3V8JA 2JVHA 3QAHA 2ACJA 2M30A 3T8TA 2HOEA 1WHUA 1MBFA 3U1DA 1TW3A 4HPQA 2RGVA 5D4RA 3L2CA 5E8GA 3W2WA 3BCAA 3E6DA 1EA3A 2H8WA 4OOIA 1JKRC 3DPLC 1VFCA 1MBGA 3L2RA 3F23A 3ZR8X 3ZQ7A 1AOYA 1R00A 4BEHB 3KEOA 1KONA 2FD5A 4BJTA 1IRGA 2OD5A 1FX7A 3OYCA 3RKXA 2HYGD 4HYEA 5JFRA 3F9KA 4CYCB 2V6EA 1ULYA 3J7ZI 1SVLA 2ZMEA 3T1BA 1OLTA 2DT5A 4A3DJ 2XF5A 5DCMA 5FO5A 1RRJA 1JKQC 1Z1DA 2P4WA 4HAMA 5FKNA 4Y13A 3R0JA 2JA5J 5D6FA 4D7NA 1EKEA 1LKXA 2M5WA 2VPRA 2NRAC 1BA5A 5GP9A 1ZKGA 3MVPA 2W82A 3IAM2 3RYRA 3GFJA 2UZKA 1Y8QB 1T0FA 4A3IJ 4A3LJ 4EATA 3ABTA 2CQXA 1MBKA 4DYCA 2NNNA 1X3ZB 2FXAA 2Z99A 2XROA 2N8GA 1MGTA 4MGRA 1FBSA 5BMZA 2Z5UA 3DWLE 2CO5A 5M3FJ 1MMGA 3FXLA 1WJCA 1SD5A 1Z6RA 1ZRDA 1BIBA 3TKYA 3HJEA 5ED4A 4J00A 4KISA 2D2WA 1HKQA 3BQYA 3C2BA 2K02A 3HM5A 2DA5A 4LFUA 3WTUC 2TRTA 1E3OC 1JT0A 2V79A 2EV5A 3F6OA 4W1UA 1TWCJ 3SFIA 3EPZA 2L4MA 1D1AA 2HU9A 1K79A 2LRDA 1FIAA 1OR7C 3JSOA 2FX0A 2R7UA 3L2VA 2DMTA 2IA2A 2XC7A 2XV4S 4Q48A 4RS8A 3JRAA 3JRDA 3OYFA 2LF7A 5JI6A 2GXAA 3A02A 5ICCA 5JR3A 4ZYEA 2KIMA 3IKVA 4BQOA 3FX3A 3A03A 4QWQA 1MSFC 2EIJH 4N4OB 1MMNA 4M71A 1OYIA 3PNTA 3HB9A 1V5GA 1CGPA 4LMYA 5EDNA 5ILSA 4YFKF 1DPUA 1RKWA 2OAZA 2X51A 2JK3A 3CD6I 2P0WA 4X6AJ 1HKSA 2CH0A 3LWFA 5E3OA 2K9QA 2O6GE 2NXNB 5FJ8J 3MKZA 2V1NA 3MKLA 1ZYRF 4WCGA 1STZA 1YQAA 4IHYA 2XAGA 4CGZA 4UV8A 4GRIA 2RC4A 5TGTA 1VQMI 5H6QA 5B1BH 1LUJB 1X4OA 4I01A 3RTRA 2RKHA 3R6SA 5LEKA 1GUUA 1A6IA 2RQQA 4I2OA 2XGEA 2XDVA 2E1OA 4U0WA 2D45A 2EB7A 2OTJI 5A2QZ 5IP7J 2W4SA 1FEXA 1H89C 1E0EA 2Y9ZA 5LGUA 1UHMA 2M8GX 2HXIA 2HI3A 3K4KA 4DBQA 2ZNYA 1VZ0A 2LOOA 1FWZA 3GVAA 5BQTA 2YU3A 1F43A 3E5QA 3JTHA 5GAGJ 4M9XA 4BU2A 4NBQA 2YX7A 2O03A 1VQ7I 4IEJA 4EM0B 4ZZDA 3SDGA 1EH8A 2XAUA 3GTGJ 3S3OA 2K9LA 2O7OA 3N4MA 5CYVA 2DJNA 3IRRA 1ON1A 5E1XA 1W0TA 1PYVA 2VLAA 5HS9A 3TQNA 2IGOA 1X3WB 5IYBJ 4B1RA 2KJCA 3IP4B 2XIGA 2A6TA 1Y8RB 1S7EA 4L18B 4BUPA 3DKYA 4FHTA 3C7JA 1TTYA 4CCJA 1JUSA 1LDDA 3K9TA 1IXCA 3K70C 5BNGA 3FWEA 3PIPF 2HPIA 2BEOA 3ERED 5C3EJ 5EZGA 1QVTA 2D1VA 2FQ4A 2MC3A 2XRLA 2JUGA 2BGCA 3H0GJ 1C0WA 1X1CA 4I7HA 2OCCH 3OYHA 1JI8A 3IRQA 2GIVA 2LNBA 3FKJA 3U1KA 2DXIA 1ZR2A 1SD4A 2VB6A 1EH6A 1JHFA 4LIVA 2VKVA 2FA5A 3PUBA 4NQWB 3FM5A 5IP9J 1HSTA 3V7CA 2DA6A 4UV9A 3KZIC 4F3QA 4IJAA 1J0RA 2F4OB 2M4KA 2P6SA 3K0LA 5IT9Z 1RUNA 2CUFA 1FTTA 1BR4A 3E6BA 2HDCA 1YHQI 3V7RA 5AONA 3OYMA 4BXXJ 3FMQA 1K4TA 3K2AA 2Q1ZB 3MKWB 3F8BA 2E60A 1NHAA 2E5NA 2VBWA 5HDKA 3BTIA 2P5KA 4ANJA 3DBHB 2EIKH 1X4PA 2YU9J 5LBQA 2IGNA 3LA7A 4Y3OA 4KITB 1R9TJ 3H1CA 2I10A 1JT6A 3KYDB 4JX4A 4RLFA 1W7PB 2CG4A 1XSVA 2Y69H 1W36D 4D0PA 4HX8A 4BE1A 1L3LA 2HDWA 2DMNA 3K4CA 2XHKA 1O3TA 2NOJB 4HZFA 1ZG3A 3BR2A 1W0UA 2A6EF 2V9VA 2HR3A 4G6DA 1QPMA 4RB3C 4XBFA 2F4MB 2AXTC 3W3CA 4D5FA 5FGMA 4J01A 3OYGA 4ENMA 4KMUX 2E36A 2V1DA 3MKYB 1SFOJ 2PJRA 2GXGA 2V26A 2XGCA 2K86A 1A5JA 1WJ5A 5LFAA 1VQ5I 3VODA 2CYYA 1AU7A 2A07F 2B7EA 2KZVA 1GLNA 2KDOA 1BW6A 3HKZA 3RDIA 5EYRA 5HS8A 1B4AA 2IRFG 2CU7A 2L54A 1LE8B 5CJ9A 2M0CA 4IRGA 1UG0A 2FBHA 1V5FA 1UB9A 3BTCA 2AQEA 1Z7LA 3CZ6A 3Q0UA 2D5VA 4O6JA 2CV2A 1GVJA 1T08B 4CUGA 3BLYA 2MABA 2R7OA 3BG7A 4GGGA 4N9HA 3E0JB 3V8LA 3ZGKA 1IZ1A 5K7FA 1LE8A 1XN7A 3DKWA 2JPBA 3WU0A 4FE7A 2E1CA 3FXKA 5IOYA 1Z67A 4E6KG 1YW7A 4FX4A 3WU1B 4IRHA 5E3LA 3BR3A 2KZGA 3BDDA 3MQ0A 3CDHA 3EUKL 3OYEA 1LDKB 1UJ8A 5L3DA 3L7WA 1BI2A 1RR7A 2LDUA 2DJIA 3BG5A 1T95A 2OZUA 4Y52J 2Y9YA 2R7ZJ 1X1AA 5K7HA 3F8CA 2X6XA 1F9NA 2ZXWH 3I4NJ 4C9YA 2CQNA 3F0CA 1XSXA 2F48A 2H6BA 1S6LA 2BZTA 2DA1A 3BZCA 1TWHJ 2Q2EA 1J09A 5IT3A 4M3DA 4TV7A 5J1UA 4HNVA 1TQPA 1Z3XA 1MH3A 3B6CA 1ZTRA 1D8JA 2MGQA 3ZPLA 3W6VA 4K2EA 4U7BA 3TW6A 4RM3A 1JHHA 5K7ZA 3PL8A 2NS7A 4IF4A 1ZGWA 2VONA 3ZMUA 2H1LA 1EJ9A 1HKTA 3KYCB 4YRVA 1ZRCA 2CJJA 1IF1A 2BW3A 1TNSA 1WJAA 4ITVA 4F55A 3VPRA 1FJLA 2UUZA 5HS7A 4IL6C 3QU6A 3B6AA 3PO3J 2X1CA 2EK5A 2M1BA 3FISA 1SC7A 2KL4A 2E71A 3GXOA 4I98B 5J4VA 2TCTA 9ANTA 3K4JA 2KIQA 3LSIA 1A36A 2OZ6A 3KP3A 1JGGA 5F0CA 3REOA 2QF7A 3GFIA 3SFZA 4KIFA 1G2HA 1S8NA 3RKWA 4EGZA 2DT6A 2DU9A 1SFXA 3OS0A 1CF7A 5D8LB 3H5NA 1RC9A 4EV0A 2X1DA 4ZH4F 3LSMA 1HOMA 2A61A 2P6TA 3PSFA 4KICA 5E1ZB 3WGHA 1QU3A 2L0KA 2Y2ZA 2OPTA 1Z6TA 2QGUA 1GDTA 1DP7P 4EQQA 3BY6A 1MMAA 3HPGA 1B9NA 4XNFA 3S17J 4XRSA 5DYMA 4HQMA 1Y39A 2ZXIA 1LFBA 3PQJA 5HDGA 3M07A 4A3FJ 5DD4A 3I5UA 3GTOJ 1ETKA 2WADA 1GV5A 1REPC 3J81Z 2HDDA 4LGWA 5J1RA 2EQRA 1TP4A 4L9NA 5D4SA 5IY5H 2Z33A 3GEZA 3HOWJ 3DPTA 1YX3A 1CF7B 1GV2A 3QPSA 4HW0A 4V2FA 1YFHA 3DBLB 4FTHA 1I1SA 1IO2A 3RZDJ 4AU7A 1Z7UA 2DMPA 4IHXA 3CMYA 1MH4A 2O8KA 2NS8A 3WODF 2DCEA 4B4CA 4XLHA 3GTJJ 1BOAA 4L5IA 3F21A 3HZJA 4L5JA 4R1HA 4JQFA 2PMZA 2CFOA 4U88A 4CCLA 3D0SA 1I1GA 4QLCU 2BHZA 2L02A 3OIPA 1NG6A 5E79C 3VB2A 3BR1A 2LC2A 3JCUC 1USTA 1ZLJA 2Y0SA 5D6EA 3SJMA 1I39A 1LQ1A 2X48A 5D8KB 3OV8A 2K3PA 4DZPA 5EGOB 2KRFA 5DM7F 2LKXA 1B8IA 4CICA 4XRSG 4BNCA 4RAGA 1F4KA 1G59A 3GTPJ 5EGOA 1B8IB 5HLGA 1TC3C 3OYJA 2M45A 3CCEI 2QENA 3OYKA 3QPTA 4C30A 5LGTA 1VF9A 3E6CC 1KU2A 1POGA 3VWBA 1RUOA 1Q1VA 4EJUA 3CMAI 2DK5A 3DKXA 2ZSHB 3L00A 4WF2A 1UELB 3CUOA 1R5ID 2MLGA 5J8CA 3ROUA 1AHDP 2HVRA 3C18A 1QGPA 4G12A 5JHUA 3IH3A 2OV7A 3O2PE 3GW2A 3WE3A 3HPHA 2I8DA 3VOEA 1U6GA 1ZAOA 1A6QA 4HX4A 3EYYA 3LAJA 1GHCA 3S2DJ 4D9JA 4KIGA 2L2OA 5H6RA 1WH7A 3SQNA 3GFMA 3HRUA 4CCOA 3GYHX 4XM3A 1YRNB 4DW6A 2NVXJ 1YW8A 2WBMA 3MN2A 2ELHA 2VC1A 1J7KA 3JRCA 4ETSA 3G1MA 5IP6A 1N25A 4UUSB 1ZN2A 5CVUA 4KFCA 1ON2A 1FC3A 3GBGA 3WHBA 2WAFA 2O61A 1PUEE 1MBEA 1IRZA 1D0ZA 1W5TA 2BV6A 1KZHA 1IDZA 2XPVA 5F27A 3S32A 4P9UA 2QZ8A 2P8TA 3WTTC 2ZNZA 2XSDC 2PI0A 1TL8A 3RKYA 2IGKA 1OR7A 1UHWA 1E17A 1W1WE 1DU0A 5FLXZ 3DCFA 5FD5A 2EFOA 3HG9A 4IOCF 2ME0A 2L7FP 3TOAA 2BVLA 4M3FA 1YJ9I 1YRNA 3ISPA 5HNHA 4M3BA 4LK0F 1YW9A 3K10A 2A3SA 1D5VA 1HDDC 1LEBA 1V4RA 4PJMA 1O7FA 2W7NA 2JSPA 1HXDA 4G6QA 4KN4X 2ID3A 2DAOA 4HLXA 1XCBA 1W7PD 5GPCA 5BS6A 1LFUP 2R92J 3DLLF 3TOBA 4BQAA 4J19A 5E8IA 5F0FA 3OYIA 1YO5C 4HV5A 1YYVA 1T39A 1R22A 4QIWN 4LB5A 4A3MJ 4I76A 4MEXF 1KQ9A 4RB1A 1SMTA 4XICA 5J1YA 2EZHA 5LHGA 2DFEA 3I53A 2HS5A 1ITYA 2XUBA 1XG1A 1K6OA 1QQIA 5KHDA 2F4IA 2VJ5A 2ZFWA 4HEA2 3FXQA 2W84A 1SVMA 3NRVA 4QSHA 2KIUA 5TISC 2IEKA 3S14J 2GOMA 1ETQA 2LR8A 2RAEA 3FIWA 2WB1A 1IXSB 3P9KA 3OYDA 1G3YA 2RNJA 2MFZA 2Z1DA 5F1JA 1ZR4A 3HSEA 1B6AA 1D0XA 4X1EA 1BIAA 2K9SA 3S93A 5CVRA 5K5OA 1MBHA 1TLHB 3OYAA 5J3LA 3M7GA 1AWCA 1NK2P 3ASOH 2R7RA 3VYTB 1D1CA 3LSHA 3MZ8A 1OCTC 2M7BA 4UUVA 3Q0VA 4FQGA 2Z2SB 2OQRA 3IKTA 3ZQLA 1ZH5A 3M8JA 5D5XB 1E3PA 3GZNB 2LMDA 2KHMA 2MSYA 4IHWA 4CZCA 3OS1A 2EBIA 3CP8A 3K4MA 4C2MJ 1OCPA 4CCMA 4RGXA 2IJLA 3QODA 3T5XA 2COMA 2O9LA 3O8GA 1GXQA 1V55H 2L9NA 4EMSA 2X6YA 2QKLB 3ONQA 1VQ4I 2ETHA 2LKSA 1TWGJ 1K4SA 3OL4A 2LK2A 1XMKA 3FDYA 4AIDA 1I3AA 2JT1A 1YIJI 3I58A 5J8FA 4JBAA 3H5RA 4GO1A 3F22A 1T0FC 1P7JA 3HSRA 3CCSI 3A1YA 3DPUA 1FY7A 1P92A 3LSKA 4R79A 3S1QJ 3DF8A 1I27A 2VJ4A 2HQ5A 3CO6C 5JLXA 4HF1A 5IOZA 2ELKA 2ZFUA 4LB6B 4YFXF 4BBSJ 5EEAA 4EM1A 5GPAA 2GLOA 3CF5F 3ZCOA 3AG2H 2QM3A 3I0TA 3FMRA 3K2ZA 4NHJA 1KU3A 1YITI 2PLYA 2WAQN 1FLIA 2HTJA 5DS9A 1BN5A 2HOAA 4HSRA 2HYJA 4ESBA 1IGNA 1VQLI 4HG2A 2Q0OA 3TP0A 2G0EA 2Y75A 1NG7A 2FMLA 3BPXA 3S16J 4HDVA 1A04A 2BY1A 3EDPA 2X4HA 4L9VA 5E18F 2W85A 1YS7A 3A2KA 3HBLA 1D3YA 4AUXA 2KKOA 1Z21A 4LIUA 3J81K 2FOKA 1GT0C 2RQPA 1RZ4A 2CGPA 1VQ6I 2HVSA 3MFKA 3BG9A 1O3RA 4M6VA 3HTSB 1ZG1A 3OOPA 3NEUA 1G8XA 2O5RA 2XAFA 3EUHA 2FU4A 4OMYA 3IUOA 3KP4A 4RB2C 1D5YA 2IT0A 3ECOA 2QQ9A 2W1OA 2ESNA 2QSHX 5KVRA 2K4JA 3NWTA 3RQ4A 3CJTB 1FZPB 2VQLA 4PK4A 1RR8C 2L9VA 4NDLA 2R7FA 2DFIA 3WU2C 4UB8C 1F1ZA 1OQYA 4MFDA 5HODA 3BROA 2KDZA 5JVTA 3DFGA 2IS1A 2DODA 2K85A 2LVSA 1U8RA 3WGGA 4I02A 2IAIA 5CQEA 1FTZA 5TRDA 3BJOA 3DTEA 4B43A 2H6CA 2LSOA 1SANA 2BY3A 3S3MA 1R4MB 2PQ8A 2EV0A 4IVNA 2JUCA 2IXSA 2DDBA 2K5CA 1MNMC 1S7OA 1XC5A 4MHGA 3FZVA 1TW2A 4AVZA 1Y1VJ 2RREA 2M0MA 3OMYA 4I6ZA 2JTVA 4NC7A 3RPQA 3AKZA 1UHSA 3AG1H 3HGYA 4G6TB 3TDUC 5BOXA 1K78A 5L3BA 1HC8A 4XMYA 2H1KA 4E7SA 2FNPA 2AXLA 5CLSA 5E20A 3MZHA 3A4CA 4PJ0C 2B9SA 1LPQA 1J75A 3S1MJ 1P4XA 1YG2A 2XB0X 1U3EM 2VQHA 1FMVA 1PJRA 1HSJA 3PSIA 5HLTA 4FETA 2DOEA 3BTJA 3ABKH 1FOWA 1I50J 2K9MA 3CUQC 2GIZA 3ABLH 4LITA 2DA4A 3P5JA 4OU0A 5J47A 5IPAA 3LFUA 4LG0A 4F93B 4IRIA 1BL0A 1IJWC 2FNAA 2Y0MA 2JMWA 3GZ5A 4PGGA 4GDFA 2W00A 4Z6YA 2GQQA 3C2GA 5DDGA 2R7WA 3ZMZA 1XDUA 1ZLKA 5HNFA 4MNUA 4LG3A 3ZQIA 1IDYA 4JX6A 2CUZA 5ICEA 4A3JJ 3U21A 2BOLA 2CUEA 1EF4A 2WY8Q 1W7PA 3K1MA 3W2VA 4QTRA 2DK8A 3PNVA 4LD5A 2HZTA 4B48A 2GAUA 4G94A 2E7WA 1VQNI 2CUJA 3QP6A 2FRHA 5LRSA 3GLXA 2LF8A 2HXOA 1YTYA 4Z2YA 2IS4A 5BPIA 3S1NJ 4M72A 2A6HF 4F52A 3KEQA 3LSPA 3CCLI 4BE2A 4WX9A 4XKCA 1Z05A 5M5YJ 4CCNA 1K6YA 2WY7Q 4XLFA 3V7SA 3LQQA 3K4NA 3ECHA 1VQPI 2P5LC 2VXDA 2MD0A 4XLAA 1ORKA 3WG7H 2ZXHA 3TEDA 2E1NA 3CJNA 3FBIB 2BVMA 5EG0B 2MLKA 3OIOA 4JOMA 4Y33A 1UZCA 2MC4A 3I3LA 4MTEA 2QA4I 1JKPC 4MFEA 4LK1F 5FD6A 1DDNA 2VE8A 5CVIA 5ERIA 3C2HA 3CO7C 1HW1A 3I9V2 1ZRFA 2VUMJ 4PSXA 1KYWA 1WPKA 3TGNA 2ECCA 1YIOA 4PGHA 1WVRA 2X6WA 2H94A 3S2HJ 2ZJQF 2CQKA 4DOZA 1QPIA 4GYGA 1WH5A 1SVOA 2NYXA 5GADJ 2HKOA 2CQQA 4EEFG 2A05A 3RZOJ 2X6OA 3OIQA 1MJBA 1S29A 3JRHA 2HWVA 4FISA 2YX4A 4LLGF 2L01A 3GFLA 3L2QA 3DU5A 2E1MB 3CJQB 4BEHA 4ZYHA 1Y1WJ 2CW0F 4Y17A 3DQVC 4EJWA 5J4YA 2HOTA 3WE2A 1HCRA 4HRIA 5B5EC 3Q5FA 2ZSIB 3PJRA 3BCBA 5EJCA 4CXFA 1T33A 4YIRX 2R7SA 2NOGA 1XD7A 1IRFA 3OOUA 3HC7A 1SMYF 3F72A 2K7LA 3OWTA 4HQEA 4M73A 4IQJA 1TZLA 2P5VA 2DQRA 2UV1A 3FXJA 4IO9F 3K6GA 2NAZA 4XKBA 4A3BJ 3WG9A 2M8EA 2QQAA 3G1OA 4E7IA 3CCUI 1BW5A 1FP1D 2F5DA 4B3XA 1TQIA 1Y56A 2V1XA 3B73A 4NB5A 3WTYC 2QSFX 2X1EA 1Z91A 3J7YJ 4L9TA 2LKPA 1OKRA 2MYSA 1S7AA 4PJLA 1DQUA 2EFWA 2H8RA 3T0YA 2E2HJ 4D5CA 1QZEA 2HTSA 4H0EA 2DMQA 2JPCA 2VBXA 5F08A 2VC0A 1FT9A 2UXXA 4L0YB 3E1SA 4OAYA 4OWRB 5F1RA 2GZWA 5IYCJ 2HNHA 4P9FA 5FROA 1YE9A 2OA4A 2M9HA 3H36A 3I54A 3RQIA 3BP8A 4KIBA 4X0GA 1RETA 2M87A 4F7ZA 1SEUA 1DGWY 3ZRGA 4B47A 3HEFA 4CZZA 5JLWA 1FSHA 3D5LA 1HA8A 1V3FA 2BBYA 2LTPA 1J2XA 4P1WA 2W25A 4IHSA 3CUQA 2Y48A 1Z77A 3CJRB 2G9WA 5E17F 3HDDA 2QBYA 1U5TB 2K9NA 2GOXB 3L2WA 2A69F 2L7KA 3T8RA 1YJWI 1IN4A 3JRFA 1B59A 1CQTA 3LAPA 2JSCA 5ILUA 3GTLJ 3CCJI 4G7OF 1ETXA 3SEZA 4CA0A 3DXJF 1B9MA 5K5QA 5E3NA 4BE0A 4ZYAA 1HLVA 3QYEA 1NTCA 2Z16A 3G1LA 3HOXJ 3MMYB 2PBIA 4G7ZF 2DPDA 1WZ2A 5JHFA 1I5ZA 4CYDA 3MEXA 3ZQCA 3LSJA 2E19A 3Q9SA 5K5RA 4AM3A 1LNWA 4DYRA 1FOYA 3W6JB 3HRTA 4L0ZB 3ABMH 1TT0A 1BJZA 1FNNA 2BHYA 2P7VB 1E3HA 1BI3A 4BY1J 3KYLA 2PFBA 1P2FA 1Y6IA 2R3SA 3B02A 4GFBA 2JZYA 3KE2A 2F5EA 4FCYA 1IV8A 1WCMJ 2IW5A 2KPMA 4AIHA 4ZJZA 3EUHC 2Y0SN 1DU6A 3A01A 4ZYDA 2LD5A 3H3VK 5KK1A 3CUQB 1R49A 1UCRA 2Z9OA 3HOSA 3D1NI 1BI0A 5LHIA 1TQMA 2GBYA 1O57A 4M9ZA 2LY9A 3VEPA 5GAHJ 5DUIA 3M4OJ 5K1YA 3HOYJ 1P4AA 4BHBA 3TP3A 2X9DA 3M1EA 3H3UA 3OSFA 2K27A 3BR6A 1ETYA 2FMYA 4ABZA 4A3CJ 2EFNA 2FSWA 2FE3A 1IN6A 2LFBA 3L09A 5DCMB 3K4BA 4RBOA 4XN0A 1LJ9A 2EH3A 3D5RC 2NVTJ 5FLMJ 4P96A 3N97A 1P7IA 3DTIA 1MMSA 3IHUA 2XPUA 1ERDA 1HW5A 4L9JA 5AIQA 2LH9A 4HF0A 4UUTA 3ESWB 4A93J 4IXAA 2MG4A 2M7AA 1XPXA 1ZK8A 2KISA 1PVEA 2VOOA 3ZMTA 4RAYA 3S8PA 1P9QC 2ISYA 3KLNA 4FASD 5TJJA 3JTGA 2YSRA 1LDJA 1MKMA 1T98A 4C2UA 4XIDA 5B3SH 3IH4A 5EEHA 3RPUD 3BPVA 1IN5A 3FHNA 4I09A 4EJTA 2YR2A 3V4GA 3LSRA 4XRMA 1ZGAA 2DBBA 1K61A 3IH2A 3OR1C 4KN7X 1JUMA 3F8MA 5FKOA 4FE4A 2R7XA 2FBIA 4NNJA 5M5XJ 1J5YA 4ZDOA 5L3EA 3GO5A 1OCZH 3CCRI 5FRMA 3K7AJ 2Y31A 4IHTA 2WA0A 2G7HA 5C4XJ 2CRGA 1WGXA 1IC8A 1VQ8I 4IOAF 1WWXA 1Z0XA 4PJJA 3S2WA 3MZYA 3I71A 1XDSA 2O0YA 3A0HC 2DOAA 2VBYA 4BY7J 2COBA 1PDNC 1UFMA 1VNDA 1MNDA 3SXYA 2AO9A 2CQ7A 3QOPA 5B66C 1OFCX 3BR5A 2EJRA 1S9HA 1JTYA 2Z3YA 5HDNA 2YUSA 2LY1A 2ELJA 1MBJA 3I4MJ 3K69A 3TO9A 3JW4A 1QA6A 3WTXC 1BC8C 1VI0A 2IA0A 1EV7A 2VBZA 3HSFA 4CO8A 3GTKJ 4A3EJ 1D1BA 3QYFA 1LFPA 2JRTA 4G8XA 1WQ2A 3ZN0A 2ID6A 4A69C 4V19K 1FPQA 3AL0B 2RV8A 3A01B 2NNYA 1M1EB 5AIPA 1I3QJ 1U0JA 1PP7U 2ESHA 3ZP5A 3CCMI 4MIMA 3Q9VA 3LSGA 3QPLA 1SFUA 1XMXA 4IHVA 3JREA 5M5WJ 2HKXA 3RIRA 3ZOBA 4ZYGA 2JN6A 4XN3A 1GVDA 5H2FC 2AS5F 4FT8A 1NH3A 1ONVA 3QRFF 2DMUA 3RI4A 2M2EA 3UKGA 4B44A 2BXYA 1YI2I 4ESFA 4XLEA 2KRCA 3S1RJ 4W97A 4EGYA 3RYPA 3OYBA 3KZZA 1GXPA 4YELA 4OIRF 1HQCA 2OQGA 5LD2C 5BPDA 4BHCA 4I0BA 2PJPA 1P4WA 2F5FA 2JA7J 1PP8F 3BT9A 1MZBA 2KIFA 3HHGA 3WTWC 4IKFA 3AG4H 4Q5SF 5FLXK 4DNCA 4DYQA 2EINH 3G73A 2DO7A 4KDPA 2BY2A 3ZQQA 1JTXA 3E3VA 3U9GA 3PQKA 2YPRA 3FK7A 4LG0B 4LJZF 3H3ZA 3NARA 4RGRA 4HSTA 2NVQJ 3GX4X 2L5QA 1MMDA 4NUBA 1F36A 2LY2A 3R0AA 3BZ6A 1MJAA 3ASNH 4RDUA 4D7MA 4WK8F 4IZZA 1T38A 4BXFA 3HYIA 2CW7A 3M8FA 3WHCA 1G3SA 4E4HA 1R5HA 2VASA 3DV8A 4BDYA 5DUKA 5F64A 4JX5A 3SDBA 4M6XA 4BS9A 3FHZA 1K78B 1SFEA 2X85A 3A0BC 3G71I 2HGCA 4B3AA 1N75A 4ENJA 5L3GA 4A12A 2QVOA 4II2A 2O8XA 4JP0A 2WWYA 2OBPA 5CVJA 2DI3A 4A0ZA 4IPAA 3PFIA 1KQ0A 4OIOF 1X3UA 2ZB9A 2A5WA 1XS9A 4N4NB 4E70A 1IAWA 2Q2EB 4F91B 2VKEA 2ECBA 4LOCA 4OMZA 3VDXA 2CS3A 1H88C 5FFZA 3BWGA 1BM9A 4PCQA 1X19A 3VSKA 2UWMA 1L0OC 4UVBA 4HV6A 2BYVE 2OTLI 2L9SA 2L9RA 3SEQA 3TW7A 2QSGX 3BC8A 5HLIA 2IPQX 3DTKA 4PSWA 3SZTA 5CKTA 1YLFA 2XKOA 2ZJPF 4NQWA 4RAFA 3FKIJ 4BKXA 2DA7A 2CSOA 3ELKA 3H9QA 3QU3A 1WJFA 4Y7NJ 3IAS2 1QO0D 3CLQA 2BY0A 3FM3A 1TWAJ 1IUYA 1QZZA 3E6MA 3CC7I 3ABUA 1R36A 1TT5B 1AA7A 1MJ9A 1FMWA 2GA1A 3KCCA 2CWEA 2JWTA 2V9PA 4XQFA 4M6YA 3ZQHA 4XSXF 4EJVA 2O3FA 2E2JJ 3G3ZA 1VQOI 3F6VA 1R1TA 3LFKA 3V8KA 2FEZA 3QWLA 1Y0NA 4Y4RA 2DTRA 4NC8A 4H4KC 4RB0A 4MLOA 3KLOA 3QP5A 2XAHA 1XCVA 2XF6A 3X2QH 4AC0A 2JJ7A 3KP7A 4UHTA 1FIPA 1X1DA 1R4NB 5EG0A 2IBDA 4HDUA 5FKKA 3VFZA 4L5EA 2GWRA 3KETA 5CPRB 1YX5A 3O8HA 1JUPA 1WJEA 4RM2A 3J7AY 3S15J 3Q0WA 2A68F 1QNTA 5DCFA 3EUAA 6PAXA 5F0HA 2DW4A 3O3KA 3ERMA 2EA2A 2XB5A 3D5SC 3J80K 1WSUA 2CV1A 4XOPA 1QRYA 2WV1A 5LHHA 1JE8A 2DQLA 2F5VA 2JA2A 2DFHA 3Q3SA 1O4XA 3DEUA 5HVQC 3CDIA 1LEAA 2ISZA 2DPUA 2QKMB 2R5YA 1R5GA 4F92B 4M74A 3WTSC 3BQZA 1WFXA 4HA8A 2DOFA 4DIQA 2X0LA 3E5UA 3I4PA 4YEJA 2KT0A 2FOWA 1BBYA 2VE9A 1JXSA 4BBRJ 1YJNI 1I6HJ 1WKMA 2HPMA 3PFYA 2OC6A 3DU6A 4FX0A 3JAMZ 3RKQA 1KQ8A 1W4MA 1QHGA 2EZIA 1AKHA 2LG4A 4C2TA 2E5ZA 2KRHA 1MW7A 4QPOA 5DD8A 2GM4A 3TL4X 1X58A 3JR9A 5D5WB 3K4LA 5E1WA 1A31A 3KFWX 3GTQJ 1VQ9I 3J7AO 2ZBKA 1JJ8C 1W5CC 2KMUA 1XGOA 2A5YB 1FBQA 2DA2A 1MIJA 2ZO4A 3GF2A 1YS6A 1ZQ3P 2M4GA 3H92A 2BE5F 2J5PA 2TDXA 4UY8I 4PDKA 1FBUA 4RA2A 1G6NA 5F6FA 2KP6A 3C3WA 1I6XA 3L9FA 4N9IA 4BH9A 2B0LA 1XGNA 3GMEA 1U2WA 2JRMA 3VYSB 1OJLA 3QOEA 1OCCH 3L2UA 3TO7A 3BZKA 4BYYA 3I55I 5IYDJ 3OYNA 2QCOA 1TNTA 1DUXC 3AL0C 4KT6A 5D5VB 3HRSA 4QPQA 3EQLF 3E7LA 2P7CB 2LLKA 3O6BB 1RIOH 2XASA 4OIPF 3KEYA 3NQOA 2ZCWA 1KU9A 3P7NA 2L7MP 2Y30A 4G9YA 2HYFA 4CSWA 1RESA 2E35A 4GXOA 2XKPA 3BR0A 2L7ZA 3HKZN 3PO2J 3JAMK 4Q47A 3S3NA 3WGIA 4S04A 3UNGC 3HOTA 1ZGJA 2VIXA 3VYUB 4BL0B 3GLLA 2QEXI 3ZQFA 2OJED 2HQNA 1TWFJ 1VTNC 3BJ6A 2R0QC 2RNGA 2VI6A 4GYIA 1U8BA 1S72I 2PEXA 2PN6A 2HQRA 1U5TC 1SD7A 2M3AA 1H9GA 1BC7C 2OUMA 2R5YB 2KLOA 2OU2A 3R4KA 2ZMEC 2C6YA 2LREA 2YS9A 4AVPA 1ZREA 2PMZN 1MSEC 1R1UA 2E7XA 2QBYB 5KCMA 1R1VA 5EF6A 4ZTFA 1Z3YA 1B72A 3MCZA 3QYBA 5FB2A 2BXZA 5GTHC 5L3CA 5KNLA 1UMQA 2CMPA 2R7DA 3LL7A 3GWZA 4XORA 3OS2A 1RKTA 4WWCA 2BW3B 4BXUA 3KPHA 4HNTA 3C1DA 3PUFA 3CMEI 3KP2A 2W57A 4BGDA 1O3QA 2K3FA 1WJBA 3HOZJ 3HRMA 3R61A 1H0MA 4O3MA 4D1QA 1SFKA 3NAUA 2F2EA 4LLLA 1J9IA 2H09A 2STTA 3HIFA 1T8IA 3OL3A 3H35A 4OINF 2ZXJA 2CV0A 3SHFA 1XTAA 1QHHD 3HXLA 2P81A 2STWA 3LSTA 4ZC3A 3E5XA 2GXBA 3HOVJ 1DGRM 1U5TA 3ZMSA 4C3JJ 1G4DA 1LVKA 5FKLA 1B72B 3PNYA 4BQNA 5HOOA 4LLNA 5EEGA 4CDGA 1MDMB 1PUFA 1RPWA 4ON0A 3FK6A 4XSZF 3TDZC 3KP5A 4XLPF 2NVUB 1MDMA 4RLQA 5B1AH 2R7TA 4S05A 5KAFC 4AYBN 3MD2A 4XLCA 5E3MA 5C44J 3F8NA 2XGDA 2EWNA 2R5ZA 3RPUA 3I59A 2VXZA 2R93J 1FYMA 2VOPA 5L3FA 1BJAA 2MW8A 3ULQB 4WXDA 5JVGF 2VJIA 2RVCA 3BOQA 2PMHA 5LLQA 2KQRA 2IVMA 2QQBA 4IQ4A 3E97A 2FBKA 2WTEA 1H8AC 3U2RA 4BQQA 2WV0A 3OY9A 3H9JA 3BG6A 1FYLA 2MBFA 1OCOH 4C3HJ 4XOTA 3TBIA 2QUFA 3LOCA 3I59B 2PG4A 3IWFA 2F5CA 5DV5A 4XK4A 3M3YJ 2LP0A 1WI9A 1FP2A 2IGMA 4KJZA 1BR2A 2GA2A 1HBXG 4AIJA 1DPRA 4PFPA 4BAYA 2WAEA 4ZDPA 2ZKZA 4YFNF 3DLAA 5ILVA 4A3GJ 2MH2A 2IP2A 3ML6A 3ZXSA 3IC7A 3CQZJ 1FOXA 1QZYA 1KGSA 5DTDA 2AQFA 1D8KA 2E1MC 4Y15A 3JRBA 4M3GA 1IW7F 3JRGA 1WJDA 2DYSH 4OAZA 2HVQA 1ENHA 2PX9A 2QLZA 5F04A 2ZMEB 3KP6A 3CC2I 1MNEA 2DFFA 3OYLA 4AD9A 3OSGA 2R7QA 4MO7A 2EFPA 3OR2C 4II3A 4HNUA 2VN2A 4HF2A 2MH9A 4R8HA 4A2UA 4XRFA 2JA8J 3IL2A 2ICWG 5FLVA 1JGSA 2XPWA 4Q4ZF 3LNQA 1OPCA 4ASNA 4XR6A 1XB4A 4ZTJA 2I5UA 3CP2A 3DEWA 4I0AA 2JA6J 4AYBA 2CFXA 3M9AA 1HDPA 2XAJA 3CDLA 1XSDA 4A6DA 3PIOF 1A35A 4U0YA 4E7KA 3RJPA 3F8FA 2V9KA 3GUDA 1OYYA
chains in the Genus database with same CATH topology
2VKVA 1JJ6C 5IP9J 3S1QJ 1I3QJ 2DA6A 2HQ5A 5JLXA 4MIMA 5IOZA 2ELKA 3LSGA 4BBSJ 3QPLA 4IHVA 2E2IJ 2CUFA 3JREA 1FTTA 5M5WJ 3ZOBA 5EEAA 5GPAA 2JN6A 2GLOA 4BXXJ 1GVDA 3K2AA 2WAQN 5DS9A 2DMUA 2HOAA 3BTIA 2M2EA 3UKGA 1HF0A 2HYJA 1IGNA 3S1RJ 4W97A 2FJ1A 2YU9J 3TP0A 2G0EA 1R9TJ 2I10A 5FKMA 1JT6A 3S16J 4JX4A 3IV5A 2DN0A 4V2GA 3HBLA 2JA7J 2R5ZB 4AUXA 2DMNA 3BT9A 2ME6A 3JRIA 5EZHA 1GT0C 4C3IJ 3BR2A 1W0UA 3BG9A 3CCYA 4DYQA 3GTMJ 3L1PA 4M6VA 1JTXA 3FK7A 3HOUJ 4D5FA 4S0HB 3NARA 2NVQJ 1SFOJ 1D5YA 1F36A 2XGCA 1A5JA 4RDUA 4D7MA 1AU7A 3WHCA 1IV6A 2EZLA 1BW6A 4JX5A 5EYRA 4NDLA 1QVUA 2CU7A 4B3AA 4MFDA 5HODA 1LE8B 2M0CA 1AKHB 2KDZA 4JP0A 3BTCA 3Q0UA 2D5VA 1JKOC 2LVSA 2IAIA 1FTZA 1X2NA 2ZB9A 5C4JJ 1XS9A 2VKEA 2ECBA 5K7FA 4LOCA 4UUSA 1SANA 1H88C 1LE8A 1NK3P 1MNMC 4FE7A 5IOYA 1XC5A 1Y1VJ 1UG2A 5E3LA 3BR3A 4I6ZA 1ETVA 1UHSA 2DA3A 3HGYA 2L9RA 3TW7A 1T56A 2H1KA 2NVYJ 1RR7A 1IUFA 3BG5A 3S1MJ 2XB0X 5M3MJ 4Y52J 2Y9YA 3FKIJ 4BKXA 2DA7A 2R7ZJ 5K7HA 4Y7NJ 3BTJA 3I4NJ 1I50J 1TWAJ 2DA4A 3F0CA 1X2MA 5IPAA 2DA1A 1BL0A 2JWTA 1IJWC 1TWHJ 3BTLA 3ZQHA 4M3EA 4DZJA 2JMWA 2E2JJ 2K40A 4M3DA 3HGGA 5J1UA 4HNVA 3ZQIA 1MH3A 3B6CA 3BG3A 1IDYA 1ZTRA 4MLOA 4JX6A 2WB1N 4A3JJ 2MGQA 2CUEA 1EF4A 3W6VA 4AC0A 2JJ7A 4QTRA 3TW6A 5K7ZA 1FIPA 2NS7A 1ZGWA 5EG0A 2IBDA 3QQAA 3ZQGA 5FKKA 2HXOA 2CJJA 1ETWA 4L5EA 3S1NJ 3VPRA 1FJLA 3O8HA 1JUPA 3LSPA 3S15J 3Q0WA 5M5YJ 3B6AA 3PO3J 3FISA 5F0HA 4A3KJ 1U78A 2AHQA 2XB5A 9ANTA 2TCTA 1QRYA 1JGGA 2WV1A 1ORKA 5F0CA 2QF7A 2OF7A 3TEDA 3Q3SA 1O4XA 1G2HA 5EG0B 3OIOA 2R5YA 2W48A 1IG7A 1JKPC 4MFEA 1HOMA 1WI3A 3BQZA 2L0KA 2VUMJ 2Y2ZA 2OPTA 1GDTA 1WPKA 2EZKA 2KT0A 2ECCA 1K83J 3S17J 4XRSA 2DTZA 4BBRJ 3S2HJ 1APLC 1I6HJ 1LFBA 1QPIA 1WH5A 3RKQA 4CYCA 2CQQA 4EEFG 4A3FJ 3PM1A 2EZIA 1AKHA 3GTOJ 1ETKA 3RZOJ 2X6OA 2HOSA 1GV5A 3JRHA 4FISA 2GM4A 2HDDA 5J1RA 1X58A 3JR9A 2EQRA 1Y1WJ 3GTQJ 2HOTA 2B63J 1PUFB 3HOWJ 4JYKA 1ETOA 1JJ8C 1HCRA 1GV2A 3QPSA 1U9NA 2DA2A 4V2FA 1ZQ3P 1T33A 4FTHA 2NOGA 3RZDJ 2DMPA 3OOUA 2M34A 4IHXA 3CMYA 1MH4A 2O8KA 2NS8A 4B4CA 3GTJJ 1U9OA 4A3BJ 3G1OA 1BW5A 1MBFA 3BR1A 1OJLA 3SJMA 1JKRC 5IYDJ 2QCOA 2X48A 1VFCA 1MBGA 4DZPA 5EGOB 2LKXA 1B8IA 4XRSG 3E7LA 2LLKA 2FD5A 2H8RA 3GTPJ 2E2HJ 5EGOA 1B8IB 4D5CA 2L7MP 1TC3C 2Y30A 2DMQA 5F08A 1RESA 4CYCB 1VF9A 3BR0A 4A3DJ 2L7ZA 3HKZN 3PO2J 1POGA 5IYCJ 1Q1VA 1JKQC 5FKNA 2JA5J 2M9HA 4D7NA 3RQIA 3ZQFA 1RETA 2VPRA 3HEFA 1TWFJ 5GP9A 1AHDP 1ZKGA 4G12A 3MVPA 1BA5A 5JLWA 3IH3A 2R0QC 1U8BA 2VI6A 4A3IJ 4A3LJ 2LTPA 2R5YB 2CQXA 1MBKA 4DYCA 1Z77A 2YS9A 3S2DJ 2PMZN 1MSEC 3HDDA 2K9NA 1WH7A 5EF6A 2N8GA 1B72A 5M3FJ 3JRFA 1CQTA 1YRNB 3GTLJ 4DW6A 1UMQA 2NVXJ 3MN2A 1ETXA 3JRCA 3BQYA 1RKTA 3C2BA 3G1MA 5IP6A 3HM5A 5E3NA 4UUSB 2DA5A 1HLVA 2TRTA 1E3OC 1JT0A 1NTCA 3G1LA 3HOXJ 4W1UA 1TWCJ 3GBGA 3SFIA 3WHBA 3HOZJ 1FIAA 2FX0A 1MBEA 3NAUA 3ZQCA 1IRZA 3LSJA 2E19A 1IDZA 5F27A 2DMTA 2XPVA 2XSDC 4DYRA 3JRAA 3JRDA 1BJZA 3A02A 1DU0A 4BY1J 3DCFA 2ME0A 2L7FP 2P81A 4GFBA 4M3FA 3HOVJ 4C3JJ 1YRNA 4FCYA 3A03A 1WCMJ 1MSFC 4M3BA 5FKLA 1B72B 3HB9A 2Y0SN 5EDNA 1HDDC 1RKWA 1DU6A 3A01A 2JK3A 1PUFA 2LD5A 3H3VK 1RPWA 4X6AJ 3FK6A 2ID3A 3D1NI 5E3OA 2K9QA 5FJ8J 2GBYA 3MKLA 2LY9A 5GPCA 3M4OJ 3HOYJ 4IHYA 1LFUP 2R92J 4AYBN 3TP3A 4J19A 5F0FA 2X9DA 3OSFA 5E3MA 3BR6A 5C44J 1ETYA 4ABZA 2XGDA 4QIWN 4A3CJ 2R5ZA 2LFBA 4A3MJ 4I76A 4RBOA 2R93J 2EH3A 1GUUA 1A6IA 5J1YA 2EZHA 2MW8A 4XICA 1ITYA 2NVTJ 1XG1A 2XGEA 5FLMJ 2E1OA 1P7IA 2XPUA 1H8AC 4QSHA 4UUTA 4A93J 2IEKA 5IP7J 2MG4A 4C3HJ 3S14J 1FEXA 1H89C 2Y9ZA 1ZK8A 1ETQA 2LR8A 3LOCA 2RAEA 3FIWA 2M8GX 2HXIA 2HI3A 4XK4A 3M3YJ 2LP0A 5F1JA 1ZR4A 4XIDA 3IH4A 4X1EA 1F43A 2K9SA 4A3GJ 1MBHA 3LSRA 3CQZJ 5J3LA 4XRMA 1NK2P 4IEJA 5DTDA 3JRBA 1K61A 3IH2A 4M3GA 5FKOA 1JUMA 3SDGA 3JRGA 4FE4A 3GTGJ 5M5XJ 1ENHA 1OCTC 2O7OA 3Q0VA 2DJNA 5F04A 3ZQLA 1W0TA 3K7AJ 2Y31A 5C4XJ 2CRGA 1WGXA 1IC8A 3OSGA 2MSYA 4MO7A 4IHWA 5IYBJ 1Z0XA 4B1RA 2EBIA 1S7EA 4C2MJ 1OCPA 2JA8J 4BY7J 2COBA 1VNDA 1JUSA 5FLVA 2O9LA 2AO9A 2XPWA 3LNQA 5BNGA 1OFCX 3BR5A 3O8GA 1JTYA 3DEWA 5C3EJ 5EZGA 1QVTA 2FQ4A 2YUSA 2JA6J 2XRLA 1MBJA 3H0GJ 3I4MJ 1HDPA 1TWGJ 3CDLA 2LK2A 1VI0A 3GTKJ 4A3EJ 1ZR2A 4A69C 2ID6A 1P7JA 3A01B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKV A;  1JJ6 C;  5IP9 J;  3S1Q J;  1I3Q J;  2DA6 A;  2HQ5 A;  5JLX A;  4MIM A;  5IOZ A;  2ELK A;  3LSG A;  4BBS J;  3QPL A;  4IHV A;  2E2I J;  2CUF A;  3JRE A;  1FTT A;  5M5W J;  3ZOB A;  5EEA A;  5GPA A;  2JN6 A;  2GLO A;  4BXX J;  1GVD A;  3K2A A;  2WAQ N;  5DS9 A;  2DMU A;  2HOA A;  3BTI A;  2M2E A;  3UKG A;  1HF0 A;  2HYJ A;  1IGN A;  3S1R J;  4W97 A;  2FJ1 A;  2YU9 J;  3TP0 A;  2G0E A;  1R9T J;  2I10 A;  5FKM A;  1JT6 A;  3S16 J;  4JX4 A;  3IV5 A;  2DN0 A;  4V2G A;  3HBL A;  2JA7 J;  2R5Z B;  4AUX A;  2DMN A;  3BT9 A;  2ME6 A;  3JRI A;  5EZH A;  1GT0 C;  4C3I J;  3BR2 A;  1W0U A;  3BG9 A;  3CCY A;  4DYQ A;  3GTM J;  3L1P A;  4M6V A;  1JTX A;  3FK7 A;  3HOU J;  4D5F A;  4S0H B;  3NAR A;  2NVQ J;  1SFO J;  1D5Y A;  1F36 A;  2XGC A;  1A5J A;  4RDU A;  4D7M A;  1AU7 A;  3WHC A;  1IV6 A;  2EZL A;  1BW6 A;  4JX5 A;  5EYR A;  4NDL A;  1QVU A;  2CU7 A;  4B3A A;  4MFD A;  5HOD A;  1LE8 B;  2M0C A;  1AKH B;  2KDZ A;  4JP0 A;  3BTC A;  3Q0U A;  2D5V A;  1JKO C;  2LVS A;  2IAI A;  1FTZ A;  1X2N A;  2ZB9 A;  5C4J J;  1XS9 A;  2VKE A;  2ECB A;  5K7F A;  4LOC A;  4UUS A;  1SAN A;  1H88 C;  1LE8 A;  1NK3 P;  1MNM C;  4FE7 A;  5IOY A;  1XC5 A;  1Y1V J;  1UG2 A;  5E3L A;  3BR3 A;  4I6Z A;  1ETV A;  1UHS A;  2DA3 A;  3HGY A;  2L9R A;  3TW7 A;  1T56 A;  2H1K A;  2NVY J;  1RR7 A;  1IUF A;  3BG5 A;  3S1M J;  2XB0 X;  5M3M J;  4Y52 J;  2Y9Y A;  3FKI J;  4BKX A;  2DA7 A;  2R7Z J;  5K7H A;  4Y7N J;  3BTJ A;  3I4N J;  1I50 J;  1TWA J;  2DA4 A;  3F0C A;  1X2M A;  5IPA A;  2DA1 A;  1BL0 A;  2JWT A;  1IJW C;  1TWH J;  3BTL A;  3ZQH A;  4M3E A;  4DZJ A;  2JMW A;  2E2J J;  2K40 A;  4M3D A;  3HGG A;  5J1U A;  4HNV A;  3ZQI A;  1MH3 A;  3B6C A;  3BG3 A;  1IDY A;  1ZTR A;  4MLO A;  4JX6 A;  2WB1 N;  4A3J J;  2MGQ A;  2CUE A;  1EF4 A;  3W6V A;  4AC0 A;  2JJ7 A;  4QTR A;  3TW6 A;  5K7Z A;  1FIP A;  2NS7 A;  1ZGW A;  5EG0 A;  2IBD A;  3QQA A;  3ZQG A;  5FKK A;  2HXO A;  2CJJ A;  1ETW A;  4L5E A;  3S1N J;  3VPR A;  1FJL A;  3O8H A;  1JUP A;  3LSP A;  3S15 J;  3Q0W A;  5M5Y J;  3B6A A;  3PO3 J;  3FIS A;  5F0H A;  4A3K J;  1U78 A;  2AHQ A;  2XB5 A;  9ANT A;  2TCT A;  1QRY A;  1JGG A;  2WV1 A;  1ORK A;  5F0C A;  2QF7 A;  2OF7 A;  3TED A;  3Q3S A;  1O4X A;  1G2H A;  5EG0 B;  3OIO A;  2R5Y A;  2W48 A;  1IG7 A;  1JKP C;  4MFE A;  1HOM A;  1WI3 A;  3BQZ A;  2L0K A;  2VUM J;  2Y2Z A;  2OPT A;  1GDT A;  1WPK A;  2EZK A;  2KT0 A;  2ECC A;  1K83 J;  3S17 J;  4XRS A;  2DTZ A;  4BBR J;  3S2H J;  1APL C;  1I6H J;  1LFB A;  1QPI A;  1WH5 A;  3RKQ A;  4CYC A;  2CQQ A;  4EEF G;  4A3F J;  3PM1 A;  2EZI A;  1AKH A;  3GTO J;  1ETK A;  3RZO J;  2X6O A;  2HOS A;  1GV5 A;  3JRH A;  4FIS A;  2GM4 A;  2HDD A;  5J1R A;  1X58 A;  3JR9 A;  2EQR A;  1Y1W J;  3GTQ J;  2HOT A;  2B63 J;  1PUF B;  3HOW J;  4JYK A;  1ETO A;  1JJ8 C;  1HCR A;  1GV2 A;  3QPS A;  1U9N A;  2DA2 A;  4V2F A;  1ZQ3 P;  1T33 A;  4FTH A;  2NOG A;  3RZD J;  2DMP A;  3OOU A;  2M34 A;  4IHX A;  3CMY A;  1MH4 A;  2O8K A;  2NS8 A;  4B4C A;  3GTJ J;  1U9O A;  4A3B J;  3G1O A;  1BW5 A;  1MBF A;  3BR1 A;  1OJL A;  3SJM A;  1JKR C;  5IYD J;  2QCO A;  2X48 A;  1VFC A;  1MBG A;  4DZP A;  5EGO B;  2LKX A;  1B8I A;  4XRS G;  3E7L A;  2LLK A;  2FD5 A;  2H8R A;  3GTP J;  2E2H J;  5EGO A;  1B8I B;  4D5C A;  2L7M P;  1TC3 C;  2Y30 A;  2DMQ A;  5F08 A;  1RES A;  4CYC B;  1VF9 A;  3BR0 A;  4A3D J;  2L7Z A;  3HKZ N;  3PO2 J;  1POG A;  5IYC J;  1Q1V A;  1JKQ C;  5FKN A;  2JA5 J;  2M9H A;  4D7N A;  3RQI A;  3ZQF A;  1RET A;  2VPR A;  3HEF A;  1TWF J;  5GP9 A;  1AHD P;  1ZKG A;  4G12 A;  3MVP A;  1BA5 A;  5JLW A;  3IH3 A;  2R0Q C;  1U8B A;  2VI6 A;  4A3I J;  4A3L J;  2LTP A;  2R5Y B;  2CQX A;  1MBK A;  4DYC A;  1Z77 A;  2YS9 A;  3S2D J;  2PMZ N;  1MSE C;  3HDD A;  2K9N A;  1WH7 A;  5EF6 A;  2N8G A;  1B72 A;  5M3F J;  3JRF A;  1CQT A;  1YRN B;  3GTL J;  4DW6 A;  1UMQ A;  2NVX J;  3MN2 A;  1ETX A;  3JRC A;  3BQY A;  1RKT A;  3C2B A;  3G1M A;  5IP6 A;  3HM5 A;  5E3N A;  4UUS B;  2DA5 A;  1HLV A;  2TRT A;  1E3O C;  1JT0 A;  1NTC A;  3G1L A;  3HOX J;  4W1U A;  1TWC J;  3GBG A;  3SFI A;  3WHB A;  3HOZ J;  1FIA A;  2FX0 A;  1MBE A;  3NAU A;  3ZQC A;  1IRZ A;  3LSJ A;  2E19 A;  1IDZ A;  5F27 A;  2DMT A;  2XPV A;  2XSD C;  4DYR A;  3JRA A;  3JRD A;  1BJZ A;  3A02 A;  1DU0 A;  4BY1 J;  3DCF A;  2ME0 A;  2L7F P;  2P81 A;  4GFB A;  4M3F A;  3HOV J;  4C3J J;  1YRN A;  4FCY A;  3A03 A;  1WCM J;  1MSF C;  4M3B A;  5FKL A;  1B72 B;  3HB9 A;  2Y0S N;  5EDN A;  1HDD C;  1RKW A;  1DU6 A;  3A01 A;  2JK3 A;  1PUF A;  2LD5 A;  3H3V K;  1RPW A;  4X6A J;  3FK6 A;  2ID3 A;  3D1N I;  5E3O A;  2K9Q A;  5FJ8 J;  2GBY A;  3MKL A;  2LY9 A;  5GPC A;  3M4O J;  3HOY J;  4IHY A;  1LFU P;  2R92 J;  4AYB N;  3TP3 A;  4J19 A;  5F0F A;  2X9D A;  3OSF A;  5E3M A;  3BR6 A;  5C44 J;  1ETY A;  4ABZ A;  2XGD A;  4QIW N;  4A3C J;  2R5Z A;  2LFB A;  4A3M J;  4I76 A;  4RBO A;  2R93 J;  2EH3 A;  1GUU A;  1A6I A;  5J1Y A;  2EZH A;  2MW8 A;  4XIC A;  1ITY A;  2NVT J;  1XG1 A;  2XGE A;  5FLM J;  2E1O A;  1P7I A;  2XPU A;  1H8A C;  4QSH A;  4UUT A;  4A93 J;  2IEK A;  5IP7 J;  2MG4 A;  4C3H J;  3S14 J;  1FEX A;  1H89 C;  2Y9Z A;  1ZK8 A;  1ETQ A;  2LR8 A;  3LOC A;  2RAE A;  3FIW A;  2M8G X;  2HXI A;  2HI3 A;  4XK4 A;  3M3Y J;  2LP0 A;  5F1J A;  1ZR4 A;  4XID A;  3IH4 A;  4X1E A;  1F43 A;  2K9S A;  4A3G J;  1MBH A;  3LSR A;  3CQZ J;  5J3L A;  4XRM A;  1NK2 P;  4IEJ A;  5DTD A;  3JRB A;  1K61 A;  3IH2 A;  4M3G A;  5FKO A;  1JUM A;  3SDG A;  3JRG A;  4FE4 A;  3GTG J;  5M5X J;  1ENH A;  1OCT C;  2O7O A;  3Q0V A;  2DJN A;  5F04 A;  3ZQL A;  1W0T A;  3K7A J;  2Y31 A;  5C4X J;  2CRG A;  1WGX A;  1IC8 A;  3OSG A;  2MSY A;  4MO7 A;  4IHW A;  5IYB J;  1Z0X A;  4B1R A;  2EBI A;  1S7E A;  4C2M J;  1OCP A;  2JA8 J;  4BY7 J;  2COB A;  1VND A;  1JUS A;  5FLV A;  2O9L A;  2AO9 A;  2XPW A;  3LNQ A;  5BNG A;  1OFC X;  3BR5 A;  3O8G A;  1JTY A;  3DEW A;  5C3E J;  5EZG A;  1QVT A;  2FQ4 A;  2YUS A;  2JA6 J;  2XRL A;  1MBJ A;  3H0G J;  3I4M J;  1HDP A;  1TWG J;  3CDL A;  2LK2 A;  1VI0 A;  3GTK J;  4A3E J;  1ZR2 A;  4A69 C;  2ID6 A;  1P7J A;  3A01 B; 
#chains in the Genus database with same CATH topology
 1OMI A;  3J80 Z;  1N77 A;  1F5T A;  2ZJ2 A;  1JJ6 C;  1EH7 A;  5CQG A;  3FXU A;  1ODD A;  2J5O A;  3HUG A;  3UR3 C;  4A0Y A;  3VSL A;  4BJ6 C;  3BJA A;  1IXR C;  2E2I J;  3DBR B;  3W2A A;  1TBX A;  2QWW A;  5H20 A;  3DP7 A;  2DDA A;  3K1P A;  3LQR A;  1SAU A;  1P6R A;  1HF0 A;  3FXM A;  1OIS A;  3HHH A;  2FJ1 A;  3M1C A;  4KNY A;  3CMM A;  4PFO A;  1BR1 A;  5FKM A;  4UXN A;  3HL2 A;  3IV5 A;  3H0D A;  2MD5 A;  4PUS A;  4OIQ F;  2DN0 A;  5FRN A;  3IWZ A;  4V2G A;  2R5Z B;  2ME6 A;  2NS0 A;  3JRI A;  2H27 A;  1Y0U A;  1G3W A;  4UNO A;  3WTV C;  5EZH A;  1IN7 A;  3CCQ I;  2WC2 A;  4C3I J;  3ZMD A;  2ZC2 A;  1B1B A;  3CCY A;  2DLL A;  4BJ5 C;  4HOB A;  3L1P A;  3GTM J;  4KUM A;  2LBF B;  3AAF A;  1S3J A;  1N78 A;  4GCV A;  3KIO A;  3TO6 A;  3F3X A;  4MTD A;  3HOU J;  1G3T A;  4S0H B;  1OCR H;  4MQV A;  1O7L A;  5ICG A;  1DP3 A;  4UB6 C;  1SD6 A;  2QYO A;  4M9S A;  4ZDL A;  2CW8 A;  3G6E I;  1KU7 A;  4NC6 A;  2LYC A;  4A6E A;  1T6S A;  4MQ9 F;  4E7L A;  2WAQ A;  3KZY A;  3FXR A;  3K70 D;  5LGN A;  2FUG 2;  3DEE A;  5KAI C;  1IV6 A;  2EZL A;  4RGS A;  3AG3 H;  3M8E A;  3GZ6 A;  2W24 A;  1QVU A;  2DYR H;  4ENK A;  2XRN A;  1X1P A;  2V6C A;  1Z9C A;  1ZAR A;  3CTA A;  3H9G A;  4CH7 A;  3ZN1 A;  2VQC A;  1W5S A;  1V5E A;  1AKH B;  2JQ7 A;  1Q1H A;  2LBF A;  3GCM A;  2R4G A;  2HFH A;  3R60 A;  1JKO C;  4E7H A;  2XGX A;  4KT5 C;  4B09 A;  2XF7 A;  1S5L C;  2VL8 A;  1LVA A;  1X2N A;  2L3D A;  5C4J J;  5CVV A;  3P9I A;  4EJO A;  2XVC A;  2VKD A;  2IS6 A;  4UUS A;  4RAZ A;  5LEJ A;  4B8X A;  4UVC A;  2KJB A;  1NK3 P;  5A2Q K;  4IX7 A;  1UG2 A;  4CHU A;  5J6X A;  1ETV A;  3MWM A;  4RMN A;  1R71 A;  1KA8 A;  2DT7 B;  4A0X A;  2DA3 A;  1XGS A;  5ICF A;  4DBR A;  1T56 A;  3EET A;  5GAE J;  2NVY J;  4BAC A;  3G2B A;  4WXH A;  1IUF A;  4JK1 X;  4HX7 A;  2MA3 A;  4N0B A;  5M3M J;  2K4B A;  3LMM A;  1ZEL A;  4PZJ A;  5GTI C;  4HLY A;  1XX5 A;  1IN8 A;  2V7F A;  1R6R A;  3FF5 A;  4KMF A;  1QBJ A;  1W36 C;  2VOD A;  2UXN A;  3RSN A;  2HZD A;  4HBL A;  4O5V A;  1T2K A;  1X2M A;  3HUG B;  2VKH A;  4P55 A;  1XMA A;  1R58 A;  2EFQ A;  3HTU A;  3SZP A;  2R7V A;  4YII A;  3N05 A;  3BTL A;  4A5N A;  4DJA A;  4MEY F;  2HEO A;  4XKV A;  4M3E A;  4I99 C;  4DZJ A;  1BI1 A;  2K40 A;  1FOK A;  3HGG A;  2FQ3 A;  4XKW A;  1SAX A;  5DM6 F;  1IRX A;  2EIL H;  5FFX A;  3CF2 A;  4A5M A;  3BG3 A;  4G7H F;  2V1U A;  3MAJ A;  2WB1 N;  4XLN F;  3TMO A;  3VYR B;  3EYI A;  3FMS A;  1D0Y A;  2EPF A;  5D5U B;  3V42 A;  4CCK A;  1UAA A;  2XSJ C;  1FYK A;  3QQA A;  3ZQG A;  4XON A;  3COA C;  1ZG5 A;  4YIF A;  4U7D A;  4DQ2 A;  1ETW A;  1RI7 A;  4EM2 A;  4ENN A;  3NWS A;  1K7A A;  2EIM H;  4U87 A;  3CES A;  2ADU A;  2PMU A;  4A3K J;  4EVI A;  3I56 I;  2AHQ A;  1U78 A;  1YOV B;  1LB2 A;  2V4J C;  3KX2 A;  3SZG A;  2VT3 A;  4ZZL A;  5IT9 K;  4KYW A;  2Q8K A;  1FSE A;  2OF7 A;  4ESJ A;  2QQ8 A;  3I64 A;  2IS2 A;  1IG7 A;  2W48 A;  2PJR B;  3P9C A;  1OYW A;  1WI3 A;  2VJJ A;  4E7J A;  2HQA A;  2G7U A;  2D1H A;  3CC4 I;  3LA3 A;  4KA4 A;  4XL9 A;  3K1N A;  2VQG A;  2VT2 A;  2EZK A;  2FF4 A;  2KFD A;  4YG2 F;  1R7J A;  1K83 J;  2VPL A;  2RDP A;  2DTZ A;  1APL C;  1ACI A;  1O3S A;  3W6K B;  4CYC A;  2EV6 A;  3G4S I;  3PM1 A;  2RN7 A;  3JSP A;  4AIK A;  1J59 A;  3RCO A;  3FXO A;  1E2X A;  2HOS A;  3ZMV A;  1USS A;  1KYZ A;  4BDZ A;  1H9T A;  2IA1 A;  5J40 A;  2L4A A;  4P5O A;  1HW2 A;  1MD0 A;  2B63 J;  1PUF B;  4DGW B;  1ETO A;  4JYK A;  5HLH A;  4U0V A;  1WRJ A;  1ZHF A;  1U9N A;  4E7Z A;  1BOB A;  3H5A A;  1XGM A;  4WXC A;  4BHP A;  4AWX B;  3WTZ A;  2E34 A;  4RGU A;  1RNL A;  1V54 H;  2M34 A;  3AFH A;  4UVA A;  2OCE A;  5DEQ A;  3CLO A;  1R23 A;  2ZJR F;  3LA2 A;  2EA4 A;  1X1B A;  2JVG A;  3QPH A;  2F6C A;  1U9O A;  3FBN B;  4PJN A;  5LRR A;  3CCV I;  1VQK I;  2XAQ A;  3SYT A;  3V8J A;  2JVH A;  3QAH A;  2ACJ A;  2M30 A;  3T8T A;  2HOE A;  1WHU A;  1MBF A;  3U1D A;  1TW3 A;  4HPQ A;  2RGV A;  5D4R A;  3L2C A;  5E8G A;  3W2W A;  3BCA A;  3E6D A;  1EA3 A;  2H8W A;  4OOI A;  1JKR C;  3DPL C;  1VFC A;  1MBG A;  3L2R A;  3F23 A;  3ZR8 X;  3ZQ7 A;  1AOY A;  1R00 A;  4BEH B;  3KEO A;  1KON A;  2FD5 A;  4BJT A;  1IRG A;  2OD5 A;  1FX7 A;  3OYC A;  3RKX A;  2HYG D;  4HYE A;  5JFR A;  3F9K A;  4CYC B;  2V6E A;  1ULY A;  3J7Z I;  1SVL A;  2ZME A;  3T1B A;  1OLT A;  2DT5 A;  4A3D J;  2XF5 A;  5DCM A;  5FO5 A;  1RRJ A;  1JKQ C;  1Z1D A;  2P4W A;  4HAM A;  5FKN A;  4Y13 A;  3R0J A;  2JA5 J;  5D6F A;  4D7N A;  1EKE A;  1LKX A;  2M5W A;  2VPR A;  2NRA C;  1BA5 A;  5GP9 A;  1ZKG A;  3MVP A;  2W82 A;  3IAM 2;  3RYR A;  3GFJ A;  2UZK A;  1Y8Q B;  1T0F A;  4A3I J;  4A3L J;  4EAT A;  3ABT A;  2CQX A;  1MBK A;  4DYC A;  2NNN A;  1X3Z B;  2FXA A;  2Z99 A;  2XRO A;  2N8G A;  1MGT A;  4MGR A;  1FBS A;  5BMZ A;  2Z5U A;  3DWL E;  2CO5 A;  5M3F J;  1MMG A;  3FXL A;  1WJC A;  1SD5 A;  1Z6R A;  1ZRD A;  1BIB A;  3TKY A;  3HJE A;  5ED4 A;  4J00 A;  4KIS A;  2D2W A;  1HKQ A;  3BQY A;  3C2B A;  2K02 A;  3HM5 A;  2DA5 A;  4LFU A;  3WTU C;  2TRT A;  1E3O C;  1JT0 A;  2V79 A;  2EV5 A;  3F6O A;  4W1U A;  1TWC J;  3SFI A;  3EPZ A;  2L4M A;  1D1A A;  2HU9 A;  1K79 A;  2LRD A;  1FIA A;  1OR7 C;  3JSO A;  2FX0 A;  2R7U A;  3L2V A;  2DMT A;  2IA2 A;  2XC7 A;  2XV4 S;  4Q48 A;  4RS8 A;  3JRA A;  3JRD A;  3OYF A;  2LF7 A;  5JI6 A;  2GXA A;  3A02 A;  5ICC A;  5JR3 A;  4ZYE A;  2KIM A;  3IKV A;  4BQO A;  3FX3 A;  3A03 A;  4QWQ A;  1MSF C;  2EIJ H;  4N4O B;  1MMN A;  4M71 A;  1OYI A;  3PNT A;  3HB9 A;  1V5G A;  1CGP A;  4LMY A;  5EDN A;  5ILS A;  4YFK F;  1DPU A;  1RKW A;  2OAZ A;  2X51 A;  2JK3 A;  3CD6 I;  2P0W A;  4X6A J;  1HKS A;  2CH0 A;  3LWF A;  5E3O A;  2K9Q A;  2O6G E;  2NXN B;  5FJ8 J;  3MKZ A;  2V1N A;  3MKL A;  1ZYR F;  4WCG A;  1STZ A;  1YQA A;  4IHY A;  2XAG A;  4CGZ A;  4UV8 A;  4GRI A;  2RC4 A;  5TGT A;  1VQM I;  5H6Q A;  5B1B H;  1LUJ B;  1X4O A;  4I01 A;  3RTR A;  2RKH A;  3R6S A;  5LEK A;  1GUU A;  1A6I A;  2RQQ A;  4I2O A;  2XGE A;  2XDV A;  2E1O A;  4U0W A;  2D45 A;  2EB7 A;  2OTJ I;  5A2Q Z;  5IP7 J;  2W4S A;  1FEX A;  1H89 C;  1E0E A;  2Y9Z A;  5LGU A;  1UHM A;  2M8G X;  2HXI A;  2HI3 A;  3K4K A;  4DBQ A;  2ZNY A;  1VZ0 A;  2LOO A;  1FWZ A;  3GVA A;  5BQT A;  2YU3 A;  1F43 A;  3E5Q A;  3JTH A;  5GAG J;  4M9X A;  4BU2 A;  4NBQ A;  2YX7 A;  2O03 A;  1VQ7 I;  4IEJ A;  4EM0 B;  4ZZD A;  3SDG A;  1EH8 A;  2XAU A;  3GTG J;  3S3O A;  2K9L A;  2O7O A;  3N4M A;  5CYV A;  2DJN A;  3IRR A;  1ON1 A;  5E1X A;  1W0T A;  1PYV A;  2VLA A;  5HS9 A;  3TQN A;  2IGO A;  1X3W B;  5IYB J;  4B1R A;  2KJC A;  3IP4 B;  2XIG A;  2A6T A;  1Y8R B;  1S7E A;  4L18 B;  4BUP A;  3DKY A;  4FHT A;  3C7J A;  1TTY A;  4CCJ A;  1JUS A;  1LDD A;  3K9T A;  1IXC A;  3K70 C;  5BNG A;  3FWE A;  3PIP F;  2HPI A;  2BEO A;  3ERE D;  5C3E J;  5EZG A;  1QVT A;  2D1V A;  2FQ4 A;  2MC3 A;  2XRL A;  2JUG A;  2BGC A;  3H0G J;  1C0W A;  1X1C A;  4I7H A;  2OCC H;  3OYH A;  1JI8 A;  3IRQ A;  2GIV A;  2LNB A;  3FKJ A;  3U1K A;  2DXI A;  1ZR2 A;  1SD4 A;  2VB6 A;  1EH6 A;  1JHF A;  4LIV A;  2VKV A;  2FA5 A;  3PUB A;  4NQW B;  3FM5 A;  5IP9 J;  1HST A;  3V7C A;  2DA6 A;  4UV9 A;  3KZI C;  4F3Q A;  4IJA A;  1J0R A;  2F4O B;  2M4K A;  2P6S A;  3K0L A;  5IT9 Z;  1RUN A;  2CUF A;  1FTT A;  1BR4 A;  3E6B A;  2HDC A;  1YHQ I;  3V7R A;  5AON A;  3OYM A;  4BXX J;  3FMQ A;  1K4T A;  3K2A A;  2Q1Z B;  3MKW B;  3F8B A;  2E60 A;  1NHA A;  2E5N A;  2VBW A;  5HDK A;  3BTI A;  2P5K A;  4ANJ A;  3DBH B;  2EIK H;  1X4P A;  2YU9 J;  5LBQ A;  2IGN A;  3LA7 A;  4Y3O A;  4KIT B;  1R9T J;  3H1C A;  2I10 A;  1JT6 A;  3KYD B;  4JX4 A;  4RLF A;  1W7P B;  2CG4 A;  1XSV A;  2Y69 H;  1W36 D;  4D0P A;  4HX8 A;  4BE1 A;  1L3L A;  2HDW A;  2DMN A;  3K4C A;  2XHK A;  1O3T A;  2NOJ B;  4HZF A;  1ZG3 A;  3BR2 A;  1W0U A;  2A6E F;  2V9V A;  2HR3 A;  4G6D A;  1QPM A;  4RB3 C;  4XBF A;  2F4M B;  2AXT C;  3W3C A;  4D5F A;  5FGM A;  4J01 A;  3OYG A;  4ENM A;  4KMU X;  2E36 A;  2V1D A;  3MKY B;  1SFO J;  2PJR A;  2GXG A;  2V26 A;  2XGC A;  2K86 A;  1A5J A;  1WJ5 A;  5LFA A;  1VQ5 I;  3VOD A;  2CYY A;  1AU7 A;  2A07 F;  2B7E A;  2KZV A;  1GLN A;  2KDO A;  1BW6 A;  3HKZ A;  3RDI A;  5EYR A;  5HS8 A;  1B4A A;  2IRF G;  2CU7 A;  2L54 A;  1LE8 B;  5CJ9 A;  2M0C A;  4IRG A;  1UG0 A;  2FBH A;  1V5F A;  1UB9 A;  3BTC A;  2AQE A;  1Z7L A;  3CZ6 A;  3Q0U A;  2D5V A;  4O6J A;  2CV2 A;  1GVJ A;  1T08 B;  4CUG A;  3BLY A;  2MAB A;  2R7O A;  3BG7 A;  4GGG A;  4N9H A;  3E0J B;  3V8L A;  3ZGK A;  1IZ1 A;  5K7F A;  1LE8 A;  1XN7 A;  3DKW A;  2JPB A;  3WU0 A;  4FE7 A;  2E1C A;  3FXK A;  5IOY A;  1Z67 A;  4E6K G;  1YW7 A;  4FX4 A;  3WU1 B;  4IRH A;  5E3L A;  3BR3 A;  2KZG A;  3BDD A;  3MQ0 A;  3CDH A;  3EUK L;  3OYE A;  1LDK B;  1UJ8 A;  5L3D A;  3L7W A;  1BI2 A;  1RR7 A;  2LDU A;  2DJI A;  3BG5 A;  1T95 A;  2OZU A;  4Y52 J;  2Y9Y A;  2R7Z J;  1X1A A;  5K7H A;  3F8C A;  2X6X A;  1F9N A;  2ZXW H;  3I4N J;  4C9Y A;  2CQN A;  3F0C A;  1XSX A;  2F48 A;  2H6B A;  1S6L A;  2BZT A;  2DA1 A;  3BZC A;  1TWH J;  2Q2E A;  1J09 A;  5IT3 A;  4M3D A;  4TV7 A;  5J1U A;  4HNV A;  1TQP A;  1Z3X A;  1MH3 A;  3B6C A;  1ZTR A;  1D8J A;  2MGQ A;  3ZPL A;  3W6V A;  4K2E A;  4U7B A;  3TW6 A;  4RM3 A;  1JHH A;  5K7Z A;  3PL8 A;  2NS7 A;  4IF4 A;  1ZGW A;  2VON A;  3ZMU A;  2H1L A;  1EJ9 A;  1HKT A;  3KYC B;  4YRV A;  1ZRC A;  2CJJ A;  1IF1 A;  2BW3 A;  1TNS A;  1WJA A;  4ITV A;  4F55 A;  3VPR A;  1FJL A;  2UUZ A;  5HS7 A;  4IL6 C;  3QU6 A;  3B6A A;  3PO3 J;  2X1C A;  2EK5 A;  2M1B A;  3FIS A;  1SC7 A;  2KL4 A;  2E71 A;  3GXO A;  4I98 B;  5J4V A;  2TCT A;  9ANT A;  3K4J A;  2KIQ A;  3LSI A;  1A36 A;  2OZ6 A;  3KP3 A;  1JGG A;  5F0C A;  3REO A;  2QF7 A;  3GFI A;  3SFZ A;  4KIF A;  1G2H A;  1S8N A;  3RKW A;  4EGZ A;  2DT6 A;  2DU9 A;  1SFX A;  3OS0 A;  1CF7 A;  5D8L B;  3H5N A;  1RC9 A;  4EV0 A;  2X1D A;  4ZH4 F;  3LSM A;  1HOM A;  2A61 A;  2P6T A;  3PSF A;  4KIC A;  5E1Z B;  3WGH A;  1QU3 A;  2L0K A;  2Y2Z A;  2OPT A;  1Z6T A;  2QGU A;  1GDT A;  1DP7 P;  4EQQ A;  3BY6 A;  1MMA A;  3HPG A;  1B9N A;  4XNF A;  3S17 J;  4XRS A;  5DYM A;  4HQM A;  1Y39 A;  2ZXI A;  1LFB A;  3PQJ A;  5HDG A;  3M07 A;  4A3F J;  5DD4 A;  3I5U A;  3GTO J;  1ETK A;  2WAD A;  1GV5 A;  1REP C;  3J81 Z;  2HDD A;  4LGW A;  5J1R A;  2EQR A;  1TP4 A;  4L9N A;  5D4S A;  5IY5 H;  2Z33 A;  3GEZ A;  3HOW J;  3DPT A;  1YX3 A;  1CF7 B;  1GV2 A;  3QPS A;  4HW0 A;  4V2F A;  1YFH A;  3DBL B;  4FTH A;  1I1S A;  1IO2 A;  3RZD J;  4AU7 A;  1Z7U A;  2DMP A;  4IHX A;  3CMY A;  1MH4 A;  2O8K A;  2NS8 A;  3WOD F;  2DCE A;  4B4C A;  4XLH A;  3GTJ J;  1BOA A;  4L5I A;  3F21 A;  3HZJ A;  4L5J A;  4R1H A;  4JQF A;  2PMZ A;  2CFO A;  4U88 A;  4CCL A;  3D0S A;  1I1G A;  4QLC U;  2BHZ A;  2L02 A;  3OIP A;  1NG6 A;  5E79 C;  3VB2 A;  3BR1 A;  2LC2 A;  3JCU C;  1UST A;  1ZLJ A;  2Y0S A;  5D6E A;  3SJM A;  1I39 A;  1LQ1 A;  2X48 A;  5D8K B;  3OV8 A;  2K3P A;  4DZP A;  5EGO B;  2KRF A;  5DM7 F;  2LKX A;  1B8I A;  4CIC A;  4XRS G;  4BNC A;  4RAG A;  1F4K A;  1G59 A;  3GTP J;  5EGO A;  1B8I B;  5HLG A;  1TC3 C;  3OYJ A;  2M45 A;  3CCE I;  2QEN A;  3OYK A;  3QPT A;  4C30 A;  5LGT A;  1VF9 A;  3E6C C;  1KU2 A;  1POG A;  3VWB A;  1RUO A;  1Q1V A;  4EJU A;  3CMA I;  2DK5 A;  3DKX A;  2ZSH B;  3L00 A;  4WF2 A;  1UEL B;  3CUO A;  1R5I D;  2MLG A;  5J8C A;  3ROU A;  1AHD P;  2HVR A;  3C18 A;  1QGP A;  4G12 A;  5JHU A;  3IH3 A;  2OV7 A;  3O2P E;  3GW2 A;  3WE3 A;  3HPH A;  2I8D A;  3VOE A;  1U6G A;  1ZAO A;  1A6Q A;  4HX4 A;  3EYY A;  3LAJ A;  1GHC A;  3S2D J;  4D9J A;  4KIG A;  2L2O A;  5H6R A;  1WH7 A;  3SQN A;  3GFM A;  3HRU A;  4CCO A;  3GYH X;  4XM3 A;  1YRN B;  4DW6 A;  2NVX J;  1YW8 A;  2WBM A;  3MN2 A;  2ELH A;  2VC1 A;  1J7K A;  3JRC A;  4ETS A;  3G1M A;  5IP6 A;  1N25 A;  4UUS B;  1ZN2 A;  5CVU A;  4KFC A;  1ON2 A;  1FC3 A;  3GBG A;  3WHB A;  2WAF A;  2O61 A;  1PUE E;  1MBE A;  1IRZ A;  1D0Z A;  1W5T A;  2BV6 A;  1KZH A;  1IDZ A;  2XPV A;  5F27 A;  3S32 A;  4P9U A;  2QZ8 A;  2P8T A;  3WTT C;  2ZNZ A;  2XSD C;  2PI0 A;  1TL8 A;  3RKY A;  2IGK A;  1OR7 A;  1UHW A;  1E17 A;  1W1W E;  1DU0 A;  5FLX Z;  3DCF A;  5FD5 A;  2EFO A;  3HG9 A;  4IOC F;  2ME0 A;  2L7F P;  3TOA A;  2BVL A;  4M3F A;  1YJ9 I;  1YRN A;  3ISP A;  5HNH A;  4M3B A;  4LK0 F;  1YW9 A;  3K10 A;  2A3S A;  1D5V A;  1HDD C;  1LEB A;  1V4R A;  4PJM A;  1O7F A;  2W7N A;  2JSP A;  1HXD A;  4G6Q A;  4KN4 X;  2ID3 A;  2DAO A;  4HLX A;  1XCB A;  1W7P D;  5GPC A;  5BS6 A;  1LFU P;  2R92 J;  3DLL F;  3TOB A;  4BQA A;  4J19 A;  5E8I A;  5F0F A;  3OYI A;  1YO5 C;  4HV5 A;  1YYV A;  1T39 A;  1R22 A;  4QIW N;  4LB5 A;  4A3M J;  4I76 A;  4MEX F;  1KQ9 A;  4RB1 A;  1SMT A;  4XIC A;  5J1Y A;  2EZH A;  5LHG A;  2DFE A;  3I53 A;  2HS5 A;  1ITY A;  2XUB A;  1XG1 A;  1K6O A;  1QQI A;  5KHD A;  2F4I A;  2VJ5 A;  2ZFW A;  4HEA 2;  3FXQ A;  2W84 A;  1SVM A;  3NRV A;  4QSH A;  2KIU A;  5TIS C;  2IEK A;  3S14 J;  2GOM A;  1ETQ A;  2LR8 A;  2RAE A;  3FIW A;  2WB1 A;  1IXS B;  3P9K A;  3OYD A;  1G3Y A;  2RNJ A;  2MFZ A;  2Z1D A;  5F1J A;  1ZR4 A;  3HSE A;  1B6A A;  1D0X A;  4X1E A;  1BIA A;  2K9S A;  3S93 A;  5CVR A;  5K5O A;  1MBH A;  1TLH B;  3OYA A;  5J3L A;  3M7G A;  1AWC A;  1NK2 P;  3ASO H;  2R7R A;  3VYT B;  1D1C A;  3LSH A;  3MZ8 A;  1OCT C;  2M7B A;  4UUV A;  3Q0V A;  4FQG A;  2Z2S B;  2OQR A;  3IKT A;  3ZQL A;  1ZH5 A;  3M8J A;  5D5X B;  1E3P A;  3GZN B;  2LMD A;  2KHM A;  2MSY A;  4IHW A;  4CZC A;  3OS1 A;  2EBI A;  3CP8 A;  3K4M A;  4C2M J;  1OCP A;  4CCM A;  4RGX A;  2IJL A;  3QOD A;  3T5X A;  2COM A;  2O9L A;  3O8G A;  1GXQ A;  1V55 H;  2L9N A;  4EMS A;  2X6Y A;  2QKL B;  3ONQ A;  1VQ4 I;  2ETH A;  2LKS A;  1TWG J;  1K4S A;  3OL4 A;  2LK2 A;  1XMK A;  3FDY A;  4AID A;  1I3A A;  2JT1 A;  1YIJ I;  3I58 A;  5J8F A;  4JBA A;  3H5R A;  4GO1 A;  3F22 A;  1T0F C;  1P7J A;  3HSR A;  3CCS I;  3A1Y A;  3DPU A;  1FY7 A;  1P92 A;  3LSK A;  4R79 A;  3S1Q J;  3DF8 A;  1I27 A;  2VJ4 A;  2HQ5 A;  3CO6 C;  5JLX A;  4HF1 A;  5IOZ A;  2ELK A;  2ZFU A;  4LB6 B;  4YFX F;  4BBS J;  5EEA A;  4EM1 A;  5GPA A;  2GLO A;  3CF5 F;  3ZCO A;  3AG2 H;  2QM3 A;  3I0T A;  3FMR A;  3K2Z A;  4NHJ A;  1KU3 A;  1YIT I;  2PLY A;  2WAQ N;  1FLI A;  2HTJ A;  5DS9 A;  1BN5 A;  2HOA A;  4HSR A;  2HYJ A;  4ESB A;  1IGN A;  1VQL I;  4HG2 A;  2Q0O A;  3TP0 A;  2G0E A;  2Y75 A;  1NG7 A;  2FML A;  3BPX A;  3S16 J;  4HDV A;  1A04 A;  2BY1 A;  3EDP A;  2X4H A;  4L9V A;  5E18 F;  2W85 A;  1YS7 A;  3A2K A;  3HBL A;  1D3Y A;  4AUX A;  2KKO A;  1Z21 A;  4LIU A;  3J81 K;  2FOK A;  1GT0 C;  2RQP A;  1RZ4 A;  2CGP A;  1VQ6 I;  2HVS A;  3MFK A;  3BG9 A;  1O3R A;  4M6V A;  3HTS B;  1ZG1 A;  3OOP A;  3NEU A;  1G8X A;  2O5R A;  2XAF A;  3EUH A;  2FU4 A;  4OMY A;  3IUO A;  3KP4 A;  4RB2 C;  1D5Y A;  2IT0 A;  3ECO A;  2QQ9 A;  2W1O A;  2ESN A;  2QSH X;  5KVR A;  2K4J A;  3NWT A;  3RQ4 A;  3CJT B;  1FZP B;  2VQL A;  4PK4 A;  1RR8 C;  2L9V A;  4NDL A;  2R7F A;  2DFI A;  3WU2 C;  4UB8 C;  1F1Z A;  1OQY A;  4MFD A;  5HOD A;  3BRO A;  2KDZ A;  5JVT A;  3DFG A;  2IS1 A;  2DOD A;  2K85 A;  2LVS A;  1U8R A;  3WGG A;  4I02 A;  2IAI A;  5CQE A;  1FTZ A;  5TRD A;  3BJO A;  3DTE A;  4B43 A;  2H6C A;  2LSO A;  1SAN A;  2BY3 A;  3S3M A;  1R4M B;  2PQ8 A;  2EV0 A;  4IVN A;  2JUC A;  2IXS A;  2DDB A;  2K5C A;  1MNM C;  1S7O A;  1XC5 A;  4MHG A;  3FZV A;  1TW2 A;  4AVZ A;  1Y1V J;  2RRE A;  2M0M A;  3OMY A;  4I6Z A;  2JTV A;  4NC7 A;  3RPQ A;  3AKZ A;  1UHS A;  3AG1 H;  3HGY A;  4G6T B;  3TDU C;  5BOX A;  1K78 A;  5L3B A;  1HC8 A;  4XMY A;  2H1K A;  4E7S A;  2FNP A;  2AXL A;  5CLS A;  5E20 A;  3MZH A;  3A4C A;  4PJ0 C;  2B9S A;  1LPQ A;  1J75 A;  3S1M J;  1P4X A;  1YG2 A;  2XB0 X;  1U3E M;  2VQH A;  1FMV A;  1PJR A;  1HSJ A;  3PSI A;  5HLT A;  4FET A;  2DOE A;  3BTJ A;  3ABK H;  1FOW A;  1I50 J;  2K9M A;  3CUQ C;  2GIZ A;  3ABL H;  4LIT A;  2DA4 A;  3P5J A;  4OU0 A;  5J47 A;  5IPA A;  3LFU A;  4LG0 A;  4F93 B;  4IRI A;  1BL0 A;  1IJW C;  2FNA A;  2Y0M A;  2JMW A;  3GZ5 A;  4PGG A;  4GDF A;  2W00 A;  4Z6Y A;  2GQQ A;  3C2G A;  5DDG A;  2R7W A;  3ZMZ A;  1XDU A;  1ZLK A;  5HNF A;  4MNU A;  4LG3 A;  3ZQI A;  1IDY A;  4JX6 A;  2CUZ A;  5ICE A;  4A3J J;  3U21 A;  2BOL A;  2CUE A;  1EF4 A;  2WY8 Q;  1W7P A;  3K1M A;  3W2V A;  4QTR A;  2DK8 A;  3PNV A;  4LD5 A;  2HZT A;  4B48 A;  2GAU A;  4G94 A;  2E7W A;  1VQN I;  2CUJ A;  3QP6 A;  2FRH A;  5LRS A;  3GLX A;  2LF8 A;  2HXO A;  1YTY A;  4Z2Y A;  2IS4 A;  5BPI A;  3S1N J;  4M72 A;  2A6H F;  4F52 A;  3KEQ A;  3LSP A;  3CCL I;  4BE2 A;  4WX9 A;  4XKC A;  1Z05 A;  5M5Y J;  4CCN A;  1K6Y A;  2WY7 Q;  4XLF A;  3V7S A;  3LQQ A;  3K4N A;  3ECH A;  1VQP I;  2P5L C;  2VXD A;  2MD0 A;  4XLA A;  1ORK A;  3WG7 H;  2ZXH A;  3TED A;  2E1N A;  3CJN A;  3FBI B;  2BVM A;  5EG0 B;  2MLK A;  3OIO A;  4JOM A;  4Y33 A;  1UZC A;  2MC4 A;  3I3L A;  4MTE A;  2QA4 I;  1JKP C;  4MFE A;  4LK1 F;  5FD6 A;  1DDN A;  2VE8 A;  5CVI A;  5ERI A;  3C2H A;  3CO7 C;  1HW1 A;  3I9V 2;  1ZRF A;  2VUM J;  4PSX A;  1KYW A;  1WPK A;  3TGN A;  2ECC A;  1YIO A;  4PGH A;  1WVR A;  2X6W A;  2H94 A;  3S2H J;  2ZJQ F;  2CQK A;  4DOZ A;  1QPI A;  4GYG A;  1WH5 A;  1SVO A;  2NYX A;  5GAD J;  2HKO A;  2CQQ A;  4EEF G;  2A05 A;  3RZO J;  2X6O A;  3OIQ A;  1MJB A;  1S29 A;  3JRH A;  2HWV A;  4FIS A;  2YX4 A;  4LLG F;  2L01 A;  3GFL A;  3L2Q A;  3DU5 A;  2E1M B;  3CJQ B;  4BEH A;  4ZYH A;  1Y1W J;  2CW0 F;  4Y17 A;  3DQV C;  4EJW A;  5J4Y A;  2HOT A;  3WE2 A;  1HCR A;  4HRI A;  5B5E C;  3Q5F A;  2ZSI B;  3PJR A;  3BCB A;  5EJC A;  4CXF A;  1T33 A;  4YIR X;  2R7S A;  2NOG A;  1XD7 A;  1IRF A;  3OOU A;  3HC7 A;  1SMY F;  3F72 A;  2K7L A;  3OWT A;  4HQE A;  4M73 A;  4IQJ A;  1TZL A;  2P5V A;  2DQR A;  2UV1 A;  3FXJ A;  4IO9 F;  3K6G A;  2NAZ A;  4XKB A;  4A3B J;  3WG9 A;  2M8E A;  2QQA A;  3G1O A;  4E7I A;  3CCU I;  1BW5 A;  1FP1 D;  2F5D A;  4B3X A;  1TQI A;  1Y56 A;  2V1X A;  3B73 A;  4NB5 A;  3WTY C;  2QSF X;  2X1E A;  1Z91 A;  3J7Y J;  4L9T A;  2LKP A;  1OKR A;  2MYS A;  1S7A A;  4PJL A;  1DQU A;  2EFW A;  2H8R A;  3T0Y A;  2E2H J;  4D5C A;  1QZE A;  2HTS A;  4H0E A;  2DMQ A;  2JPC A;  2VBX A;  5F08 A;  2VC0 A;  1FT9 A;  2UXX A;  4L0Y B;  3E1S A;  4OAY A;  4OWR B;  5F1R A;  2GZW A;  5IYC J;  2HNH A;  4P9F A;  5FRO A;  1YE9 A;  2OA4 A;  2M9H A;  3H36 A;  3I54 A;  3RQI A;  3BP8 A;  4KIB A;  4X0G A;  1RET A;  2M87 A;  4F7Z A;  1SEU A;  1DGW Y;  3ZRG A;  4B47 A;  3HEF A;  4CZZ A;  5JLW A;  1FSH A;  3D5L A;  1HA8 A;  1V3F A;  2BBY A;  2LTP A;  1J2X A;  4P1W A;  2W25 A;  4IHS A;  3CUQ A;  2Y48 A;  1Z77 A;  3CJR B;  2G9W A;  5E17 F;  3HDD A;  2QBY A;  1U5T B;  2K9N A;  2GOX B;  3L2W A;  2A69 F;  2L7K A;  3T8R A;  1YJW I;  1IN4 A;  3JRF A;  1B59 A;  1CQT A;  3LAP A;  2JSC A;  5ILU A;  3GTL J;  3CCJ I;  4G7O F;  1ETX A;  3SEZ A;  4CA0 A;  3DXJ F;  1B9M A;  5K5Q A;  5E3N A;  4BE0 A;  4ZYA A;  1HLV A;  3QYE A;  1NTC A;  2Z16 A;  3G1L A;  3HOX J;  3MMY B;  2PBI A;  4G7Z F;  2DPD A;  1WZ2 A;  5JHF A;  1I5Z A;  4CYD A;  3MEX A;  3ZQC A;  3LSJ A;  2E19 A;  3Q9S A;  5K5R A;  4AM3 A;  1LNW A;  4DYR A;  1FOY A;  3W6J B;  3HRT A;  4L0Z B;  3ABM H;  1TT0 A;  1BJZ A;  1FNN A;  2BHY A;  2P7V B;  1E3H A;  1BI3 A;  4BY1 J;  3KYL A;  2PFB A;  1P2F A;  1Y6I A;  2R3S A;  3B02 A;  4GFB A;  2JZY A;  3KE2 A;  2F5E A;  4FCY A;  1IV8 A;  1WCM J;  2IW5 A;  2KPM A;  4AIH A;  4ZJZ A;  3EUH C;  2Y0S N;  1DU6 A;  3A01 A;  4ZYD A;  2LD5 A;  3H3V K;  5KK1 A;  3CUQ B;  1R49 A;  1UCR A;  2Z9O A;  3HOS A;  3D1N I;  1BI0 A;  5LHI A;  1TQM A;  2GBY A;  1O57 A;  4M9Z A;  2LY9 A;  3VEP A;  5GAH J;  5DUI A;  3M4O J;  5K1Y A;  3HOY J;  1P4A A;  4BHB A;  3TP3 A;  2X9D A;  3M1E A;  3H3U A;  3OSF A;  2K27 A;  3BR6 A;  1ETY A;  2FMY A;  4ABZ A;  4A3C J;  2EFN A;  2FSW A;  2FE3 A;  1IN6 A;  2LFB A;  3L09 A;  5DCM B;  3K4B A;  4RBO A;  4XN0 A;  1LJ9 A;  2EH3 A;  3D5R C;  2NVT J;  5FLM J;  4P96 A;  3N97 A;  1P7I A;  3DTI A;  1MMS A;  3IHU A;  2XPU A;  1ERD A;  1HW5 A;  4L9J A;  5AIQ A;  2LH9 A;  4HF0 A;  4UUT A;  3ESW B;  4A93 J;  4IXA A;  2MG4 A;  2M7A A;  1XPX A;  1ZK8 A;  2KIS A;  1PVE A;  2VOO A;  3ZMT A;  4RAY A;  3S8P A;  1P9Q C;  2ISY A;  3KLN A;  4FAS D;  5TJJ A;  3JTG A;  2YSR A;  1LDJ A;  1MKM A;  1T98 A;  4C2U A;  4XID A;  5B3S H;  3IH4 A;  5EEH A;  3RPU D;  3BPV A;  1IN5 A;  3FHN A;  4I09 A;  4EJT A;  2YR2 A;  3V4G A;  3LSR A;  4XRM A;  1ZGA A;  2DBB A;  1K61 A;  3IH2 A;  3OR1 C;  4KN7 X;  1JUM A;  3F8M A;  5FKO A;  4FE4 A;  2R7X A;  2FBI A;  4NNJ A;  5M5X J;  1J5Y A;  4ZDO A;  5L3E A;  3GO5 A;  1OCZ H;  3CCR I;  5FRM A;  3K7A J;  2Y31 A;  4IHT A;  2WA0 A;  2G7H A;  5C4X J;  2CRG A;  1WGX A;  1IC8 A;  1VQ8 I;  4IOA F;  1WWX A;  1Z0X A;  4PJJ A;  3S2W A;  3MZY A;  3I71 A;  1XDS A;  2O0Y A;  3A0H C;  2DOA A;  2VBY A;  4BY7 J;  2COB A;  1PDN C;  1UFM A;  1VND A;  1MND A;  3SXY A;  2AO9 A;  2CQ7 A;  3QOP A;  5B66 C;  1OFC X;  3BR5 A;  2EJR A;  1S9H A;  1JTY A;  2Z3Y A;  5HDN A;  2YUS A;  2LY1 A;  2ELJ A;  1MBJ A;  3I4M J;  3K69 A;  3TO9 A;  3JW4 A;  1QA6 A;  3WTX C;  1BC8 C;  1VI0 A;  2IA0 A;  1EV7 A;  2VBZ A;  3HSF A;  4CO8 A;  3GTK J;  4A3E J;  1D1B A;  3QYF A;  1LFP A;  2JRT A;  4G8X A;  1WQ2 A;  3ZN0 A;  2ID6 A;  4A69 C;  4V19 K;  1FPQ A;  3AL0 B;  2RV8 A;  3A01 B;  2NNY A;  1M1E B;  5AIP A;  1I3Q J;  1U0J A;  1PP7 U;  2ESH A;  3ZP5 A;  3CCM I;  4MIM A;  3Q9V A;  3LSG A;  3QPL A;  1SFU A;  1XMX A;  4IHV A;  3JRE A;  5M5W J;  2HKX A;  3RIR A;  3ZOB A;  4ZYG A;  2JN6 A;  4XN3 A;  1GVD A;  5H2F C;  2AS5 F;  4FT8 A;  1NH3 A;  1ONV A;  3QRF F;  2DMU A;  3RI4 A;  2M2E A;  3UKG A;  4B44 A;  2BXY A;  1YI2 I;  4ESF A;  4XLE A;  2KRC A;  3S1R J;  4W97 A;  4EGY A;  3RYP A;  3OYB A;  3KZZ A;  1GXP A;  4YEL A;  4OIR F;  1HQC A;  2OQG A;  5LD2 C;  5BPD A;  4BHC A;  4I0B A;  2PJP A;  1P4W A;  2F5F A;  2JA7 J;  1PP8 F;  3BT9 A;  1MZB A;  2KIF A;  3HHG A;  3WTW C;  4IKF A;  3AG4 H;  4Q5S F;  5FLX K;  4DNC A;  4DYQ A;  2EIN H;  3G73 A;  2DO7 A;  4KDP A;  2BY2 A;  3ZQQ A;  1JTX A;  3E3V A;  3U9G A;  3PQK A;  2YPR A;  3FK7 A;  4LG0 B;  4LJZ F;  3H3Z A;  3NAR A;  4RGR A;  4HST A;  2NVQ J;  3GX4 X;  2L5Q A;  1MMD A;  4NUB A;  1F36 A;  2LY2 A;  3R0A A;  3BZ6 A;  1MJA A;  3ASN H;  4RDU A;  4D7M A;  4WK8 F;  4IZZ A;  1T38 A;  4BXF A;  3HYI A;  2CW7 A;  3M8F A;  3WHC A;  1G3S A;  4E4H A;  1R5H A;  2VAS A;  3DV8 A;  4BDY A;  5DUK A;  5F64 A;  4JX5 A;  3SDB A;  4M6X A;  4BS9 A;  3FHZ A;  1K78 B;  1SFE A;  2X85 A;  3A0B C;  3G71 I;  2HGC A;  4B3A A;  1N75 A;  4ENJ A;  5L3G A;  4A12 A;  2QVO A;  4II2 A;  2O8X A;  4JP0 A;  2WWY A;  2OBP A;  5CVJ A;  2DI3 A;  4A0Z A;  4IPA A;  3PFI A;  1KQ0 A;  4OIO F;  1X3U A;  2ZB9 A;  2A5W A;  1XS9 A;  4N4N B;  4E70 A;  1IAW A;  2Q2E B;  4F91 B;  2VKE A;  2ECB A;  4LOC A;  4OMZ A;  3VDX A;  2CS3 A;  1H88 C;  5FFZ A;  3BWG A;  1BM9 A;  4PCQ A;  1X19 A;  3VSK A;  2UWM A;  1L0O C;  4UVB A;  4HV6 A;  2BYV E;  2OTL I;  2L9S A;  2L9R A;  3SEQ A;  3TW7 A;  2QSG X;  3BC8 A;  5HLI A;  2IPQ X;  3DTK A;  4PSW A;  3SZT A;  5CKT A;  1YLF A;  2XKO A;  2ZJP F;  4NQW A;  4RAF A;  3FKI J;  4BKX A;  2DA7 A;  2CSO A;  3ELK A;  3H9Q A;  3QU3 A;  1WJF A;  4Y7N J;  3IAS 2;  1QO0 D;  3CLQ A;  2BY0 A;  3FM3 A;  1TWA J;  1IUY A;  1QZZ A;  3E6M A;  3CC7 I;  3ABU A;  1R36 A;  1TT5 B;  1AA7 A;  1MJ9 A;  1FMW A;  2GA1 A;  3KCC A;  2CWE A;  2JWT A;  2V9P A;  4XQF A;  4M6Y A;  3ZQH A;  4XSX F;  4EJV A;  2O3F A;  2E2J J;  3G3Z A;  1VQO I;  3F6V A;  1R1T A;  3LFK A;  3V8K A;  2FEZ A;  3QWL A;  1Y0N A;  4Y4R A;  2DTR A;  4NC8 A;  4H4K C;  4RB0 A;  4MLO A;  3KLO A;  3QP5 A;  2XAH A;  1XCV A;  2XF6 A;  3X2Q H;  4AC0 A;  2JJ7 A;  3KP7 A;  4UHT A;  1FIP A;  1X1D A;  1R4N B;  5EG0 A;  2IBD A;  4HDU A;  5FKK A;  3VFZ A;  4L5E A;  2GWR A;  3KET A;  5CPR B;  1YX5 A;  3O8H A;  1JUP A;  1WJE A;  4RM2 A;  3J7A Y;  3S15 J;  3Q0W A;  2A68 F;  1QNT A;  5DCF A;  3EUA A;  6PAX A;  5F0H A;  2DW4 A;  3O3K A;  3ERM A;  2EA2 A;  2XB5 A;  3D5S C;  3J80 K;  1WSU A;  2CV1 A;  4XOP A;  1QRY A;  2WV1 A;  5LHH A;  1JE8 A;  2DQL A;  2F5V A;  2JA2 A;  2DFH A;  3Q3S A;  1O4X A;  3DEU A;  5HVQ C;  3CDI A;  1LEA A;  2ISZ A;  2DPU A;  2QKM B;  2R5Y A;  1R5G A;  4F92 B;  4M74 A;  3WTS C;  3BQZ A;  1WFX A;  4HA8 A;  2DOF A;  4DIQ A;  2X0L A;  3E5U A;  3I4P A;  4YEJ A;  2KT0 A;  2FOW A;  1BBY A;  2VE9 A;  1JXS A;  4BBR J;  1YJN I;  1I6H J;  1WKM A;  2HPM A;  3PFY A;  2OC6 A;  3DU6 A;  4FX0 A;  3JAM Z;  3RKQ A;  1KQ8 A;  1W4M A;  1QHG A;  2EZI A;  1AKH A;  2LG4 A;  4C2T A;  2E5Z A;  2KRH A;  1MW7 A;  4QPO A;  5DD8 A;  2GM4 A;  3TL4 X;  1X58 A;  3JR9 A;  5D5W B;  3K4L A;  5E1W A;  1A31 A;  3KFW X;  3GTQ J;  1VQ9 I;  3J7A O;  2ZBK A;  1JJ8 C;  1W5C C;  2KMU A;  1XGO A;  2A5Y B;  1FBQ A;  2DA2 A;  1MIJ A;  2ZO4 A;  3GF2 A;  1YS6 A;  1ZQ3 P;  2M4G A;  3H92 A;  2BE5 F;  2J5P A;  2TDX A;  4UY8 I;  4PDK A;  1FBU A;  4RA2 A;  1G6N A;  5F6F A;  2KP6 A;  3C3W A;  1I6X A;  3L9F A;  4N9I A;  4BH9 A;  2B0L A;  1XGN A;  3GME A;  1U2W A;  2JRM A;  3VYS B;  1OJL A;  3QOE A;  1OCC H;  3L2U A;  3TO7 A;  3BZK A;  4BYY A;  3I55 I;  5IYD J;  3OYN A;  2QCO A;  1TNT A;  1DUX C;  3AL0 C;  4KT6 A;  5D5V B;  3HRS A;  4QPQ A;  3EQL F;  3E7L A;  2P7C B;  2LLK A;  3O6B B;  1RIO H;  2XAS A;  4OIP F;  3KEY A;  3NQO A;  2ZCW A;  1KU9 A;  3P7N A;  2L7M P;  2Y30 A;  4G9Y A;  2HYF A;  4CSW A;  1RES A;  2E35 A;  4GXO A;  2XKP A;  3BR0 A;  2L7Z A;  3HKZ N;  3PO2 J;  3JAM K;  4Q47 A;  3S3N A;  3WGI A;  4S04 A;  3UNG C;  3HOT A;  1ZGJ A;  2VIX A;  3VYU B;  4BL0 B;  3GLL A;  2QEX I;  3ZQF A;  2OJE D;  2HQN A;  1TWF J;  1VTN C;  3BJ6 A;  2R0Q C;  2RNG A;  2VI6 A;  4GYI A;  1U8B A;  1S72 I;  2PEX A;  2PN6 A;  2HQR A;  1U5T C;  1SD7 A;  2M3A A;  1H9G A;  1BC7 C;  2OUM A;  2R5Y B;  2KLO A;  2OU2 A;  3R4K A;  2ZME C;  2C6Y A;  2LRE A;  2YS9 A;  4AVP A;  1ZRE A;  2PMZ N;  1MSE C;  1R1U A;  2E7X A;  2QBY B;  5KCM A;  1R1V A;  5EF6 A;  4ZTF A;  1Z3Y A;  1B72 A;  3MCZ A;  3QYB A;  5FB2 A;  2BXZ A;  5GTH C;  5L3C A;  5KNL A;  1UMQ A;  2CMP A;  2R7D A;  3LL7 A;  3GWZ A;  4XOR A;  3OS2 A;  1RKT A;  4WWC A;  2BW3 B;  4BXU A;  3KPH A;  4HNT A;  3C1D A;  3PUF A;  3CME I;  3KP2 A;  2W57 A;  4BGD A;  1O3Q A;  2K3F A;  1WJB A;  3HOZ J;  3HRM A;  3R61 A;  1H0M A;  4O3M A;  4D1Q A;  1SFK A;  3NAU A;  2F2E A;  4LLL A;  1J9I A;  2H09 A;  2STT A;  3HIF A;  1T8I A;  3OL3 A;  3H35 A;  4OIN F;  2ZXJ A;  2CV0 A;  3SHF A;  1XTA A;  1QHH D;  3HXL A;  2P81 A;  2STW A;  3LST A;  4ZC3 A;  3E5X A;  2GXB A;  3HOV J;  1DGR M;  1U5T A;  3ZMS A;  4C3J J;  1G4D A;  1LVK A;  5FKL A;  1B72 B;  3PNY A;  4BQN A;  5HOO A;  4LLN A;  5EEG A;  4CDG A;  1MDM B;  1PUF A;  1RPW A;  4ON0 A;  3FK6 A;  4XSZ F;  3TDZ C;  3KP5 A;  4XLP F;  2NVU B;  1MDM A;  4RLQ A;  5B1A H;  2R7T A;  4S05 A;  5KAF C;  4AYB N;  3MD2 A;  4XLC A;  5E3M A;  5C44 J;  3F8N A;  2XGD A;  2EWN A;  2R5Z A;  3RPU A;  3I59 A;  2VXZ A;  2R93 J;  1FYM A;  2VOP A;  5L3F A;  1BJA A;  2MW8 A;  3ULQ B;  4WXD A;  5JVG F;  2VJI A;  2RVC A;  3BOQ A;  2PMH A;  5LLQ A;  2KQR A;  2IVM A;  2QQB A;  4IQ4 A;  3E97 A;  2FBK A;  2WTE A;  1H8A C;  3U2R A;  4BQQ A;  2WV0 A;  3OY9 A;  3H9J A;  3BG6 A;  1FYL A;  2MBF A;  1OCO H;  4C3H J;  4XOT A;  3TBI A;  2QUF A;  3LOC A;  3I59 B;  2PG4 A;  3IWF A;  2F5C A;  5DV5 A;  4XK4 A;  3M3Y J;  2LP0 A;  1WI9 A;  1FP2 A;  2IGM A;  4KJZ A;  1BR2 A;  2GA2 A;  1HBX G;  4AIJ A;  1DPR A;  4PFP A;  4BAY A;  2WAE A;  4ZDP A;  2ZKZ A;  4YFN F;  3DLA A;  5ILV A;  4A3G J;  2MH2 A;  2IP2 A;  3ML6 A;  3ZXS A;  3IC7 A;  3CQZ J;  1FOX A;  1QZY A;  1KGS A;  5DTD A;  2AQF A;  1D8K A;  2E1M C;  4Y15 A;  3JRB A;  4M3G A;  1IW7 F;  3JRG A;  1WJD A;  2DYS H;  4OAZ A;  2HVQ A;  1ENH A;  2PX9 A;  2QLZ A;  5F04 A;  2ZME B;  3KP6 A;  3CC2 I;  1MNE A;  2DFF A;  3OYL A;  4AD9 A;  3OSG A;  2R7Q A;  4MO7 A;  2EFP A;  3OR2 C;  4II3 A;  4HNU A;  2VN2 A;  4HF2 A;  2MH9 A;  4R8H A;  4A2U A;  4XRF A;  2JA8 J;  3IL2 A;  2ICW G;  5FLV A;  1JGS A;  2XPW A;  4Q4Z F;  3LNQ A;  1OPC A;  4ASN A;  4XR6 A;  1XB4 A;  4ZTJ A;  2I5U A;  3CP2 A;  3DEW A;  4I0A A;  2JA6 J;  4AYB A;  2CFX A;  3M9A A;  1HDP A;  2XAJ A;  3CDL A;  1XSD A;  4A6D A;  3PIO F;  1A35 A;  4U0Y A;  4E7K A;  3RJP A;  3F8F A;  2V9K A;  3GUD A;  1OYY A; 
#chains in the Genus database with same CATH homology
 2VKV A;  1JJ6 C;  5IP9 J;  3S1Q J;  1I3Q J;  2DA6 A;  2HQ5 A;  5JLX A;  4MIM A;  5IOZ A;  2ELK A;  3LSG A;  4BBS J;  3QPL A;  4IHV A;  2E2I J;  2CUF A;  3JRE A;  1FTT A;  5M5W J;  3ZOB A;  5EEA A;  5GPA A;  2JN6 A;  2GLO A;  4BXX J;  1GVD A;  3K2A A;  2WAQ N;  5DS9 A;  2DMU A;  2HOA A;  3BTI A;  2M2E A;  3UKG A;  1HF0 A;  2HYJ A;  1IGN A;  3S1R J;  4W97 A;  2FJ1 A;  2YU9 J;  3TP0 A;  2G0E A;  1R9T J;  2I10 A;  5FKM A;  1JT6 A;  3S16 J;  4JX4 A;  3IV5 A;  2DN0 A;  4V2G A;  3HBL A;  2JA7 J;  2R5Z B;  4AUX A;  2DMN A;  3BT9 A;  2ME6 A;  3JRI A;  5EZH A;  1GT0 C;  4C3I J;  3BR2 A;  1W0U A;  3BG9 A;  3CCY A;  4DYQ A;  3GTM J;  3L1P A;  4M6V A;  1JTX A;  3FK7 A;  3HOU J;  4D5F A;  4S0H B;  3NAR A;  2NVQ J;  1SFO J;  1D5Y A;  1F36 A;  2XGC A;  1A5J A;  4RDU A;  4D7M A;  1AU7 A;  3WHC A;  1IV6 A;  2EZL A;  1BW6 A;  4JX5 A;  5EYR A;  4NDL A;  1QVU A;  2CU7 A;  4B3A A;  4MFD A;  5HOD A;  1LE8 B;  2M0C A;  1AKH B;  2KDZ A;  4JP0 A;  3BTC A;  3Q0U A;  2D5V A;  1JKO C;  2LVS A;  2IAI A;  1FTZ A;  1X2N A;  2ZB9 A;  5C4J J;  1XS9 A;  2VKE A;  2ECB A;  5K7F A;  4LOC A;  4UUS A;  1SAN A;  1H88 C;  1LE8 A;  1NK3 P;  1MNM C;  4FE7 A;  5IOY A;  1XC5 A;  1Y1V J;  1UG2 A;  5E3L A;  3BR3 A;  4I6Z A;  1ETV A;  1UHS A;  2DA3 A;  3HGY A;  2L9R A;  3TW7 A;  1T56 A;  2H1K A;  2NVY J;  1RR7 A;  1IUF A;  3BG5 A;  3S1M J;  2XB0 X;  5M3M J;  4Y52 J;  2Y9Y A;  3FKI J;  4BKX A;  2DA7 A;  2R7Z J;  5K7H A;  4Y7N J;  3BTJ A;  3I4N J;  1I50 J;  1TWA J;  2DA4 A;  3F0C A;  1X2M A;  5IPA A;  2DA1 A;  1BL0 A;  2JWT A;  1IJW C;  1TWH J;  3BTL A;  3ZQH A;  4M3E A;  4DZJ A;  2JMW A;  2E2J J;  2K40 A;  4M3D A;  3HGG A;  5J1U A;  4HNV A;  3ZQI A;  1MH3 A;  3B6C A;  3BG3 A;  1IDY A;  1ZTR A;  4MLO A;  4JX6 A;  2WB1 N;  4A3J J;  2MGQ A;  2CUE A;  1EF4 A;  3W6V A;  4AC0 A;  2JJ7 A;  4QTR A;  3TW6 A;  5K7Z A;  1FIP A;  2NS7 A;  1ZGW A;  5EG0 A;  2IBD A;  3QQA A;  3ZQG A;  5FKK A;  2HXO A;  2CJJ A;  1ETW A;  4L5E A;  3S1N J;  3VPR A;  1FJL A;  3O8H A;  1JUP A;  3LSP A;  3S15 J;  3Q0W A;  5M5Y J;  3B6A A;  3PO3 J;  3FIS A;  5F0H A;  4A3K J;  1U78 A;  2AHQ A;  2XB5 A;  9ANT A;  2TCT A;  1QRY A;  1JGG A;  2WV1 A;  1ORK A;  5F0C A;  2QF7 A;  2OF7 A;  3TED A;  3Q3S A;  1O4X A;  1G2H A;  5EG0 B;  3OIO A;  2R5Y A;  2W48 A;  1IG7 A;  1JKP C;  4MFE A;  1HOM A;  1WI3 A;  3BQZ A;  2L0K A;  2VUM J;  2Y2Z A;  2OPT A;  1GDT A;  1WPK A;  2EZK A;  2KT0 A;  2ECC A;  1K83 J;  3S17 J;  4XRS A;  2DTZ A;  4BBR J;  3S2H J;  1APL C;  1I6H J;  1LFB A;  1QPI A;  1WH5 A;  3RKQ A;  4CYC A;  2CQQ A;  4EEF G;  4A3F J;  3PM1 A;  2EZI A;  1AKH A;  3GTO J;  1ETK A;  3RZO J;  2X6O A;  2HOS A;  1GV5 A;  3JRH A;  4FIS A;  2GM4 A;  2HDD A;  5J1R A;  1X58 A;  3JR9 A;  2EQR A;  1Y1W J;  3GTQ J;  2HOT A;  2B63 J;  1PUF B;  3HOW J;  4JYK A;  1ETO A;  1JJ8 C;  1HCR A;  1GV2 A;  3QPS A;  1U9N A;  2DA2 A;  4V2F A;  1ZQ3 P;  1T33 A;  4FTH A;  2NOG A;  3RZD J;  2DMP A;  3OOU A;  2M34 A;  4IHX A;  3CMY A;  1MH4 A;  2O8K A;  2NS8 A;  4B4C A;  3GTJ J;  1U9O A;  4A3B J;  3G1O A;  1BW5 A;  1MBF A;  3BR1 A;  1OJL A;  3SJM A;  1JKR C;  5IYD J;  2QCO A;  2X48 A;  1VFC A;  1MBG A;  4DZP A;  5EGO B;  2LKX A;  1B8I A;  4XRS G;  3E7L A;  2LLK A;  2FD5 A;  2H8R A;  3GTP J;  2E2H J;  5EGO A;  1B8I B;  4D5C A;  2L7M P;  1TC3 C;  2Y30 A;  2DMQ A;  5F08 A;  1RES A;  4CYC B;  1VF9 A;  3BR0 A;  4A3D J;  2L7Z A;  3HKZ N;  3PO2 J;  1POG A;  5IYC J;  1Q1V A;  1JKQ C;  5FKN A;  2JA5 J;  2M9H A;  4D7N A;  3RQI A;  3ZQF A;  1RET A;  2VPR A;  3HEF A;  1TWF J;  5GP9 A;  1AHD P;  1ZKG A;  4G12 A;  3MVP A;  1BA5 A;  5JLW A;  3IH3 A;  2R0Q C;  1U8B A;  2VI6 A;  4A3I J;  4A3L J;  2LTP A;  2R5Y B;  2CQX A;  1MBK A;  4DYC A;  1Z77 A;  2YS9 A;  3S2D J;  2PMZ N;  1MSE C;  3HDD A;  2K9N A;  1WH7 A;  5EF6 A;  2N8G A;  1B72 A;  5M3F J;  3JRF A;  1CQT A;  1YRN B;  3GTL J;  4DW6 A;  1UMQ A;  2NVX J;  3MN2 A;  1ETX A;  3JRC A;  3BQY A;  1RKT A;  3C2B A;  3G1M A;  5IP6 A;  3HM5 A;  5E3N A;  4UUS B;  2DA5 A;  1HLV A;  2TRT A;  1E3O C;  1JT0 A;  1NTC A;  3G1L A;  3HOX J;  4W1U A;  1TWC J;  3GBG A;  3SFI A;  3WHB A;  3HOZ J;  1FIA A;  2FX0 A;  1MBE A;  3NAU A;  3ZQC A;  1IRZ A;  3LSJ A;  2E19 A;  1IDZ A;  5F27 A;  2DMT A;  2XPV A;  2XSD C;  4DYR A;  3JRA A;  3JRD A;  1BJZ A;  3A02 A;  1DU0 A;  4BY1 J;  3DCF A;  2ME0 A;  2L7F P;  2P81 A;  4GFB A;  4M3F A;  3HOV J;  4C3J J;  1YRN A;  4FCY A;  3A03 A;  1WCM J;  1MSF C;  4M3B A;  5FKL A;  1B72 B;  3HB9 A;  2Y0S N;  5EDN A;  1HDD C;  1RKW A;  1DU6 A;  3A01 A;  2JK3 A;  1PUF A;  2LD5 A;  3H3V K;  1RPW A;  4X6A J;  3FK6 A;  2ID3 A;  3D1N I;  5E3O A;  2K9Q A;  5FJ8 J;  2GBY A;  3MKL A;  2LY9 A;  5GPC A;  3M4O J;  3HOY J;  4IHY A;  1LFU P;  2R92 J;  4AYB N;  3TP3 A;  4J19 A;  5F0F A;  2X9D A;  3OSF A;  5E3M A;  3BR6 A;  5C44 J;  1ETY A;  4ABZ A;  2XGD A;  4QIW N;  4A3C J;  2R5Z A;  2LFB A;  4A3M J;  4I76 A;  4RBO A;  2R93 J;  2EH3 A;  1GUU A;  1A6I A;  5J1Y A;  2EZH A;  2MW8 A;  4XIC A;  1ITY A;  2NVT J;  1XG1 A;  2XGE A;  5FLM J;  2E1O A;  1P7I A;  2XPU A;  1H8A C;  4QSH A;  4UUT A;  4A93 J;  2IEK A;  5IP7 J;  2MG4 A;  4C3H J;  3S14 J;  1FEX A;  1H89 C;  2Y9Z A;  1ZK8 A;  1ETQ A;  2LR8 A;  3LOC A;  2RAE A;  3FIW A;  2M8G X;  2HXI A;  2HI3 A;  4XK4 A;  3M3Y J;  2LP0 A;  5F1J A;  1ZR4 A;  4XID A;  3IH4 A;  4X1E A;  1F43 A;  2K9S A;  4A3G J;  1MBH A;  3LSR A;  3CQZ J;  5J3L A;  4XRM A;  1NK2 P;  4IEJ A;  5DTD A;  3JRB A;  1K61 A;  3IH2 A;  4M3G A;  5FKO A;  1JUM A;  3SDG A;  3JRG A;  4FE4 A;  3GTG J;  5M5X J;  1ENH A;  1OCT C;  2O7O A;  3Q0V A;  2DJN A;  5F04 A;  3ZQL A;  1W0T A;  3K7A J;  2Y31 A;  5C4X J;  2CRG A;  1WGX A;  1IC8 A;  3OSG A;  2MSY A;  4MO7 A;  4IHW A;  5IYB J;  1Z0X A;  4B1R A;  2EBI A;  1S7E A;  4C2M J;  1OCP A;  2JA8 J;  4BY7 J;  2COB A;  1VND A;  1JUS A;  5FLV A;  2O9L A;  2AO9 A;  2XPW A;  3LNQ A;  5BNG A;  1OFC X;  3BR5 A;  3O8G A;  1JTY A;  3DEW A;  5C3E J;  5EZG A;  1QVT A;  2FQ4 A;  2YUS A;  2JA6 J;  2XRL A;  1MBJ A;  3H0G J;  3I4M J;  1HDP A;  1TWG J;  3CDL A;  2LK2 A;  1VI0 A;  3GTK J;  4A3E J;  1ZR2 A;  4A69 C;  2ID6 A;  1P7J A;  3A01 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...