1YLFA

X-ray crystal structure of bc1842 protein from bacillus cereus, a member of the rrf2 family of putative transcription regulators.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
117
Chain Sequence
b'KISSRFSIAVHILSILKNNPSSLCTSDYMAESVNTNPVVIRKIMSYLKQAGFVYVNGGAGLLKDLHEITLLDVYHAVNVIGANIQAVLEIILIQAQSAMEEVLRNITMGQLFETLQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRF2 family protein
publication title X-ray crystal structure of BC1842 protein from Bacillus cereus, a member of the Rrf2 family of putative transcription regulators.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transcription regulator
total genus 32
structure length 117
sequence length 138
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ylfA00
2TDXA 3QAHA 2A61A 1O7LA 2V9VA 3VOEA 3GXOA 2FEZA 1LJ9A 4LJZF 3LQQA 3E97A 4RGSA 2YX7A 3C18A 3GVAA 3I53A 3E6BA 2HTJA 4EGZA 3J81Z 2O6GE 5JFRA 1FBQA 4RS8A 5E20A 1Z9CA 4I01A 5LGTA 1BOAA 2DQLA 3F22A 4RB1A 5HS7A 3M9AA 1BI0A 2X0LA 5LGNA 4XLPF 3HRSA 1BC7C 2P7CB 1BBYA 2ZCWA 4UVAA 4M72A 4OIOF 3COAC 3ULQB 1K6OA 4M71A 2MLGA 5JHUA 1W5SA 3B02A 2UZKA 1B9MA 3QOPA 3JSPA 4ETSA 5DEQA 4ENKA 5LEJA 2DQRA 4M6XA 4ZH4F 2CWEA 4EJWA 1FLIA 2ZMEA 2ZFWA 5D5WB 1R36A 5ICEA 2IT0A 4HV6A 2EFPA 1S3JA 3ZMSA 3GZ5A 4M73A 4KIBA 1JHFA 3G73A 3WU0A 2KRFA 2VBWA 2KIUA 1JXSA 4UNOA 2CO5A 4OU0A 1KU7A 5BPDA 3SHFA 4AVPA 2K4BA 4EVIA 1JE8A 3TDZC 3WU1B 5FO5A 3KFWX 3QP5A 2EFWA 2Y75A 2OA4A 1USSA 3CLOA 1F9NA 3LA3A 1B59A 1U8RA 3U9GA 2BE5F 3TQNA 1TW3A 4CZZA 2PG4A 2F5EA 1BJAA 2XAFA 4R1HA 2W85A 1PP8F 4YIFA 4GGGA 2JRTA 3TO9A 3H92A 4N9IA 1FPQA 5AONA 3H3ZA 3F72A 3FXRA 2FE3A 4HX8A 2A3SA 5D8LB 4E70A 2M45A 2QZ8A 1J0RA 4ESJA 1Q1HA 2GQQA 3VEPA 3W6KB 1O57A 1MDMA 3DKWA 4MTDA 3O2PE 3CTAA 1JGSA 4S05A 1OYYA 2IA1A 3R6SA 2OU2A 3I5UA 2HEOA 2M1BA 1GXPA 3Q9VA 4G9YA 3FF5A 3WGGA 5ERIA 2H94A 4ZYGA 1BI3A 2IW5A 3I64A 2QQBA 3JTGA 4I0AA 3T8TA 5K5RA 1O3QA 3WTVC 5BOXA 4A5MA 3KP2A 3FMRA 1DDNA 2C6YA 4RB0A 3FZVA 1S7AA 3FXQA 3V7RA 3MAJA 3GFJA 5L3GA 2DAOA 2NS0A 2Z33A 5IT9K 5FFXA 1TBXA 2STTA 4GO1A 5HS8A 4EJTA 2XIGA 4KICA 2MH2A 1MJAA 4CHUA 3BJAA 1LEBA 4LB6B 3FXUA 1L0OC 1XCVA 3BWGA 3M7GA 1U3EM 5ICFA 4HQEA 3IKTA 4HQMA 1SFXA 1F4KA 1FT9A 3ZMZA 2ZNZA 1V3FA 4LFUA 2K27A 1Z6TA 3V7SA 3GWZA 3HSEA 2A6EF 1FYLA 4CXFA 4OIQF 4A12A 4MEYF 4BHPA 3DEUA 3D0SA 4EQQA 1R00A 2F5CA 3JTHA 4HA8A 4Q48A 1R22A 4HX7A 4Y13A 1K78A 1B4AA 4IVNA 2GA1A 3K0LA 2AS5F 3E6CC 3WE2A 4KA4A 4YFXF 2XAJA 5E8GA 2OD5A 2QLZA 3WTZA 4L5IA 2P5KA 3ZMDA 4P55A 2PI0A 2ESHA 4DNCA 2HZTA 2EV5A 1ZG5A 3KLNA 3AAFA 1IAWA 5LRSA 4IRGA 3GFMA 1XN7A 3EQLF 4ZZDA 5LHIA 3VB2A 3RYRA 1HBXG 3L9FA 1KU9A 5FB2A 6PAXA 3V8KA 2IRFG 1SD4A 1FOKA 2WTEA 1G3WA 1FY7A 4ASNA 2GAUA 1I1GA 4RB2C 3O6BB 3ERED 4HF1A 5HLHA 2YU3A 2VONA 4M9SA 3SQNA 2QQAA 2VBXA 3TOAA 3P7NA 2HQNA 4FHTA 2H27A 1U5TB 4A0XA 4LG0B 1G3TA 3VFZA 3RYPA 2W24A 1HKTA 5HOOA 1Z1DA 2WV0A 1XSDA 5D6EA 1J5YA 3WTYC 4PGGA 2DU9A 4GCVA 1TQPA 3BOQA 4UVBA 3L09A 2STWA 2J5OA 1ULYA 1FBUA 4BYYA 1R5HA 4PDKA 2RV8A 4IJAA 1G3YA 2HR3A 3SZPA 2EWNA 4BNCA 4M9XA 4G7HF 2FU4A 4CO8A 2K7LA 3IWZA 4KFCA 4MQVA 3W6JB 2PLYA 2P5LC 1ZN2A 5AIPA 3GW2A 2FF4A 2W84A 3HSRA 2O3FA 2RKHA 4TV7A 2MA3A 1GVJA 4RAZA 3DF8A 3EDPA 2FMYA 1DPRA 1U5TA 1FYKA 4XSZF 4LG0A 5D8KB 3P9CA 4WXHA 4BHBA 3F21A 1J75A 2CW0F 1O7FA 1XGSA 2V1DA 3WTUC 1YW8A 3GUDA 1HSTA 5HS9A 3ROUA 2L3DA 2FBIA 1IF1A 2ISYA 2HTSA 3CDHA 4EJOA 3FX3A 1FNNA 3TO7A 2RVCA 1XCBA 3CJNA 4EM1A 1LVAA 3E3VA 3R60A 3L7WA 3QU3A 2Q0OA 3I0TA 3V8JA 2A68F 5CVVA 2DI3A 2RQPA 3I4PA 4OINF 3E6MA 2V1XA 1Z91A 4EMSA 3K9TA 1WKMA 1J9IA 2VN2A 3V8LA 1UFMA 1P2FA 4LLNA 1ZG1A 4ZYEA 3SXYA 3CUQB 1ZGJA 1KA8A 5ILUA 2X4HA 3JSOA 2ZKZA 3REOA 4MEXF 5L3CA 3KEOA 2ESNA 4EM0B 2H6CA 4ENMA 5IT9Z 1G3SA 1R5GA 2OZUA 5ICGA 1TLHB 3TGNA 2F5DA 3DP7A 4Q47A 4ENNA 1CF7A 1FX7A 2HKOA 2ZMEB 3LSTA 2UXXA 1STZA 2ZBKA 3L00A 3HTUA 1ZAOA 3KP4A 1W7PA 3TKYA 3MCZA 2EB7A 2QENA 5BQTA 4WXCA 3OV8A 4GYGA 4HAMA 2IA0A 3SZTA 3HYIA 2Y0MA 1HW2A 1HKSA 2A6HF 1R1UA 3Q5FA 3CUQC 3ML6A 1BIBA 1BC8C 2RC4A 1XB4A 3CUQA 3ZMVA 1AWCA 1I6XA 1B9NA 2EV6A 4EJVA 4Z2YA 3ZN1A 5K1YA 2M5WA 3S2WA 2D1HA 2PN6A 1R7JA 1QZZA 4UV8A 1T6SA 1YFHA 2VXZA 2HYGD 1RI7A 2JPBA 2VE8A 2A5YB 1HQCA 4N0BA 3IHUA 3ZMUA 4KMUX 2DO7A 3WTWC 3J7AO 4UVCA 5ED4A 2RNJA 3ECOA 1D8KA 5FGMA 2COMA 1MDMB 4RGUA 5HDKA 4KNYA 1YLFA 4P5OA 2EFOA 4I2OA 3GX4X 3JW4A 2MC3A 2E1CA 1XD7A 3IL2A 3R4KA 3K1PA 4M9ZA 5LBQA 2JT1A 3HSFA 1ZLKA 3LAPA 2LF8A 3DPLC 3K1NA 2DBBA 1L3LA 4KUMA 4PGHA 2HYFA 1P6RA 1EV7A 1DUXC 3TO6A 1ONVA 1ZHFA 2YR2A 2PEXA 3DQVC 2Z3YA 2NNNA 2QQ9A 2XASA 1ZREA 4K2EA 1Z6RA 1OPCA 3WG9A 1UHWA 3HHGA 5TJJA 2KIMA 4A5NA 4UV9A 1KU2A 1PDNC 4MHGA 4Y17A 1MKMA 2BYVE 3R61A 2ZNYA 1J59A 2L4AA 1ZGAA 1D5VA 3GFIA 1ZRFA 1EH7A 2XAGA 2Y48A 3NQOA 1U6GA 4XBFA 2PFBA 2K4JA 4FX4A 1LQ1A 1QO0D 1LDKB 3NEUA 4JQFA 3T8RA 2PQ8A 2Q2EA 3MZYA 1HKQA 2ELHA 3SFZA 4LK1F 1TNTA 3FM3A 1KYWA 2XUBA 2V6CA 1FSHA 1QNTA 3IWFA 2XKPA 2VOOA 4LMYA 2VE9A 1NHAA 2XROA 3M1EA 5H6QA 2DPDA 4KN4X 5JR3A 5ICCA 1XSVA 3IRRA 5D5XB 1K78B 1U2WA 4RB3C 2MH9A 4NHJA 3J80K 3RTRA 5H6RA 5D4SA 3QPHA 3BDDA 2FNAA 3ECHA 5E1XA 4EJUA 5D5VB 2LDUA 1IN6A 1XGMA 2CG4A 1P92A 4A0YA 1IN5A 3GYHX 1P4AA 1H9TA 5KVRA 3N97A 2VC1A 1E17A 3E5XA 3KZZA 5CVJA 3WTSC 4XRFA 3HRUA 2KIFA 1QGPA 2NNYA 1LB2A 3WODF 2P4WA 1O3SA 3K69A 1A04A 3IC7A 3RJPA 1FSEA 5CJ9A 5FFZA 3BJ6A 2FNPA 1V4RA 2W25A 1OKRA 5FLXK 1F1ZA 1XGOA 4B09A 5D4RA 1Y0UA 2D2WA 1I27A 4A6EA 4I7HA 5ILVA 2E7XA 1XDSA 1DP7P 3DFGA 1YW9A 2G7HA 2H6BA 2GXGA 5LEKA 2Q8KA 4KIGA 2AXLA 4P9UA 3U2RA 2UXNA 3LA2A 2GWRA 2OQRA 4ZZLA 5TRDA 1TQMA 1X3UA 5F64A 4LD5A 3PQKA 2PMUA 5L3DA 3V7CA 4S04A 3HRMA 5LGUA 5CLSA 2FOKA 4HLYA 4U88A 2IPQX 3HIFA 4ESFA 2PMHA 4ZYDA 3ZPLA 2DW4A 2E7WA 3O3KA 1MZBA 4WWCA 2CYYA 4IXAA 3RPQA 2V1UA 1QZYA 3FWEA 5BPIA 1KQ8A 2ZO4A 4RGRA 3RKWA 3KP3A 5DUKA 4HX4A 4HYEA 2QUFA 1LDDA 1WI9A 4D0PA 1RNLA 5DUIA 4YFKF 3HUGA 1D8JA 1J7KA 5EEHA 3MZHA 4HF0A 4KYWA 1S6LA 1IXCA 1S7OA 2DK5A 1EH6A 2EA2A 2W57A 3ZQ7A 3KEQA 1SAXA 3E5UA 3BP8A 2QM3A 5K5OA 2OQGA 5CVIA 2OZ6A 3NRVA 1OYWA 1SFEA 4A2UA 3PFIA 1RUNA 3ZN0A 4U7DA 2D1VA 2UWMA 1LEAA 3HHHA 2HDCA 2EA4A 4LLGF 1R23A 2XAHA 4OMZA 2MBFA 4LLLA 3F8NA 2GXBA 3I59B 2J5PA 1H9GA 1TNSA 4FX0A 2M87A 4ON0A 5DV5A 1FP1D 4WX9A 3RPUA 5D5UB 1E2XA 3GF2A 5LRRA 3DV8A 2D45A 2NRAC 4G94A 4MQ9F 2G9WA 3I58A 5DCMA 4I98B 1S8NA 1K79A 2F2EA 1QQIA 4BH9A 5F6FA 3U1DA 3RKXA 2DFIA 5JI6A 1T39A 3ABTA 1CF7B 2O8XA 1IXSB 1LDJA 2ETHA 3IKVA 2FMLA 1AOYA 4HF2A 1C0WA 5LHGA 1YO5C 3WTTC 4P9FA 1IRGA 4KN7X 2XHKA 1W7PB 4ZYHA 2HOEA 4OOIA 5F1RA 2HKXA 3QPTA 4ENJA 5AIQA 4AD9A 3RIRA 1TW2A 1UHMA 3EYIA 3I59A 2GIVA 3KLOA 5KK1A 2EJRA 4Q4ZF 3F3XA 4CYDA 1SD5A 5DD8A 1QBJA 3F8CA 1WSUA 3F8BA 1QPMA 5L3EA 2QBYA 1I1SA 3WGIA 5DYMA 2PJPA 1F5TA 3F6VA 4BAYA 4YIIA 1ZG3A 2FBKA 1T0FA 3I71A 4M74A 3KETA 1ZLJA 2E1NA 3C1DA 4RAYA 1R1VA 3RI4A 2DT5A 1VTNC 1RZ4A 4R8HA 3J80Z 4LGWA 2JZYA 1XDUA 2OAZA 1O3TA 4L9JA 3M8EA 3R0JA 3MEXA 4NQWA 1YG2A 1SFUA 2VODA 2R3SA 3KP5A 1YW7A 5DDGA 1BN5A 1FWZA 2QVOA 2NYXA 4AWXB 4HOBA 4L0YB 1B6AA 1K7AA 3P9IA 4KT5C 3BPXA 2XGXA 4Y15A 2V79A 1IZ1A 2CGPA 4H0EA 1JHHA 4KIFA 2FQ3A 3F6OA 3KE2A 3LQRA 3GZ6A 5FD6A 2RDPA 2MD5A 1T98A 1OMIA 1U78A 3LWFA 1IN4A 3VODA 1Z7UA 1T38A 4IHTA 5FLXZ 5A2QK 2O03A 4WXDA 1HW1A 4P96A 1IRFA 4XLNF 4AIJA 3E5QA 1EH8A 3ZMTA 3E6DA 4R79A 3ABUA 3I54A 2L4MA 1YS7A 3TDUC 1FC3A 4GXOA 4JK1X 1GXQA 1W5TA 4BHCA 1REPC 3KP6A 4I02A 2LNBA 3CO6C 2VT3A 4IRIA 1FBSA 4U0YA 3KCCA 4G6DA 1FYMA 5DCFA 3T5XA 2G7UA 3C7JA 2M8EA 4HZFA 5JVTA 4G7OF 3L2CA 3MFKA 4YG2F 2L54A 2VBZA 1KQ0A 4EV0A 3ELKA 4O5VA 3GLXA 4WK8F 2HGCA 1TTYA 3RDIA 4UHTA 4FT8A 4AIKA 3QU6A 5BMZA 2B0LA 3G3ZA 1ZRDA 3K1MA 1IXRC 2XKOA 4GYIA 1MGTA 4MGRA 4LB5A 2ZJ2A 2FRHA 5H20A 5J8FA 3F8FA 5D6FA 1SMTA 3F23A 1MJBA 2VOPA 3JAMK 1H0MA 1B1BA 3DPTA 4M6YA 3GFLA 5HDNA 2FXAA 1IN8A 2DPUA 3QRFF 3LA7A 3FM5A 3LAJA 4L9NA 2BV6A 3ZP5A 5EEGA 2PBIA 5IT3A 4KMFA 2O61A 2BEOA 2R7DA 4B8XA 1OYIA 1UCRA 4IF4A 1R1TA 2L02A 2Z5UA 3BZ6A 2IA2A 2DLLA 5FD5A 1IUYA 2OBPA 2CFXA 5DD4A 2HQRA 1S29A 1Z05A 4EM2A 2P8TA 2VBYA 4L5JA 1ODDA 2WC2A 1KQ9A 2VC0A 3TOBA 1IW7F 1HXDA 2H09A 2EK5A 1PUEE 4JBAA 4MTEA 2FSWA 3CUOA 4IPAA 2YX4A 3WGHA 2KJBA 2BGCA 4F7ZA 2JTVA 2QYOA 2CQKA 2P7VB 4MNUA 5K5QA 1ON2A 1W4MA 1PP7U 3RKYA 3P9KA 4KDPA 3HRTA 2L01A 2XVCA 1XGNA 2LSOA 3T1BA 3BJOA 2M30A 4HBLA 2P5VA 3K2ZA 3KZYA 3EETA 3J81K 2IP2A 4IRHA 4BXUA 1IN7A 2P6SA 3N4MA 2A07F 2XV4S 5CYVA 1HSJA 3D5LA 1BI1A 4O6JA 5CVRA 4QLCU 2VT2A 1XSXA 4Q5SF 4HV5A 4WCGA 3C3WA 4G8XA 1MD0A 1WQ2A 1P4WA 4BQAA 2BBYA 1YQAA 4LK0F 2Z9OA 1R58A 5E1WA 4ESBA 1FZPB 2QWWA 4OIRF 5LHHA 1KU3A 1XMAA 2MLKA 4CICA 4OIPF 4HW0A 1ZH5A 1SD7A 2XRNA 3EYYA 1YTYA 4A0ZA 3WE3A 4O3MA 1LNWA 4I0BA 1MJ9A 1RIOH 2YPRA 2LF7A 2Z99A 5BS6A 3Q9SA 3HOSA 2IVMA 2KJCA 4N9HA 5L3BA 4G7ZF 2RGVA 5HDGA 2F5FA 2ISZA 1D3YA 2K02A 2GA2A 4U7BA 4UUVA 1J2XA 5A2QZ 2FA5A 2XAQA 2ADUA 5L3FA 2JSCA 1YIOA 4CDGA 2WWYA 4DQ2A 3H3UA 3DXJF 5LLQA 2DTRA 1BIAA 3R0AA 2GZWA 5HLIA 1UB9A 4U0VA 2P6TA 2DK8A 5DCMB 4UXNA 1DPUA 4G6QA 1SMYF 1GHCA 5HLGA 1KYZA 4L18B 5E1ZB 4AIHA 4L0ZB 1YS6A 1KGSA 5CVUA 3LFKA 5J6XA 4L9VA 1ZRCA 2O0YA 3MWMA 4A6DA 1ZYRF 1XMKA 3EUHA 5E18F 4WF2A 4HDUA 1W7PD 2ZXJA 1CGPA 1G6NA 1WRJA 2EFQA 2HFHA 4U0WA 2HWVA 1WWXA 1T2KA 2NAZA 2QBYB 1O3RA 3OOPA 1P4XA 5J8CA 4IHSA 2RN7A 3V4GA 2A69F 2YSRA 2HS5A 3PQJA 1G4DA 1RUOA 3M8FA 4HLXA 1I5ZA 4HDVA 4I09A 3KP7A 3JAMZ 1U5TC 1SD6A 4RGXA 1ZARA 2KKOA 3FMSA 4CGZA 4QWQA 3WTXC 3IRQA 1BM9A 5E8IA 2R7FA 2CSOA 2EFNA 3BROA 5HVQC 1FP2A 1BI2A 3HOTA 1ON1A 1OR7A 3ISPA 3B73A 4YFNF 4EGYA 3T0YA 3MQ0A 4OMYA 3FHZA 3F8MA 3CO7C 2FBHA 5E17F 4PCQA 4L9TA 1HW5A 4NB5A 5ILSA 3BPVA 2LKPA 2EV0A 3BY6A 3FMQA 2ACJA 3GO5A 4XSXF 1YYVA 2JPCA 3HTSB 2K86A 2IJLA 1USTA 1TQIA 3GEZA 3QP6A 4PZJA
chains in the Genus database with same CATH superfamily
1VQ4I 2TDXA 4NBQA 3QAHA 1XPXA 5HLTA 1E3OC 4E7IA 2E60A 3OYDA 2A61A 3CMYA 1O7LA 4C9YA 5F08A 1VQOI 2BVMA 2V9VA 4ANJA 3VOEA 2MW8A 3GXOA 2FEZA 2PJRA 1LJ9A 4KT6A 4LJZF 3LQQA 3E97A 1JKRC 4RGSA 2YX7A 4RLFA 4PJJA 1Y8RB 3C18A 2QKMB 3VWBA 2F48A 1D5YA 3PNVA 3GVAA 4DZJA 2R0QC 3A1YA 3I53A 4IOCF 3GTMJ 2TRTA 2VPRA 3HPHA 3E6BA 2A05A 2HTJA 4EGZA 3J81Z 2VQLA 3K4LA 2JK3A 4OAYA 2O6GE 2FQ4A 5JFRA 1FBQA 1LKXA 2DT7B 3IH4A 4RS8A 1VQNI 3ZOBA 3OIQA 5E20A 4XMYA 2DMPA 1K61A 2JN6A 1Z9CA 4I01A 2AQFA 1QRYA 4RLQA 1JUPA 1WH5A 4ABZA 5LGTA 1BOAA 2DQLA 3F22A 2MGQA 2BHZA 4RB1A 5HS7A 2B7EA 3HXLA 3M9AA 2WAQA 1BI0A 2X0LA 4PFPA 2QF7A 3DPUA 1SFKA 3C2HA 3U1KA 5LGNA 4XLPF 3HRSA 3G6EI 1BC7C 2P7CB 1BBYA 4JYKA 4C3JJ 2ZCWA 3K70C 4UVAA 4M72A 4OIOF 3COAC 1V5FA 2NVUB 3ULQB 3AG3H 1K6OA 2W48A 2L5QA 5F04A 4M71A 2MLGA 4V2FA 5JHUA 1W5SA 4XLAA 3B02A 3GCMA 2Y0SA 2UZKA 1TT5B 1B9MA 1E3PA 2AQEA 3QOPA 3JSPA 4ETSA 4HG2A 4YRVA 2DXIA 5DEQA 4DZPA 4ENKA 2DN0A 4MLOA 4F93B 1T56A 2Z2SB 5LEJA 3H9JA 2DQRA 4CCJA 5E3LA 1T08B 1Q1VA 4M6XA 4ZH4F 2CWEA 2ZMEC 1WJCA 4EJWA 1YJ9I 1FLIA 2ZMEA 2ZFWA 4F92B 5D5WB 1R36A 1WVRA 5ICEA 5K7ZA 1VQ7I 4HV6A 3CCUI 2EFPA 2IT0A 2WY8Q 2CUFA 1S3JA 3DLLF 3U21A 1ZQ3P 3ZMSA 3GZ5A 1QZEA 3CD6I 4M73A 4KIBA 1JHFA 3G73A 4I76A 3WU0A 5GAHJ 2EIMH 2KRFA 3K6GA 4IEJA 2LBFB 2VBWA 2VJIA 2KIUA 1JXSA 2YU9J 5J3LA 4UNOA 4E7HA 1ETVA 2CO5A 2HU9A 4PK4A 5DS9A 1MBKA 4OU0A 1EKEA 1KU7A 1TT0A 5BPDA 3DCFA 1IDZA 3K10A 2DA4A 3SHFA 4M3GA 4NNJA 4AVPA 2QSHX 2K4BA 4EVIA 1JE8A 2CV0A 3TDZC 4A3MJ 3WU1B 2LKSA 5FO5A 3KFWX 1S7EA 3E7LA 3O8HA 3QOEA 3BLYA 3QP5A 2EFWA 2Y75A 2OA4A 1USSA 3CLOA 3PL8A 1F9NA 1E0EA 1EF4A 3LA3A 1B59A 1U8RA 2ECCA 3U9GA 1LVKA 2BE5F 1MH3A 2E71A 3TQNA 2JVHA 1TW3A 3FXJA 1JUSA 3JRIA 4CZZA 2PG4A 2AO9A 2F5EA 3GTQJ 1BJAA 3PNYA 4AVZA 2XAFA 1OCTC 4R1HA 3DLAA 2W85A 4OAZA 1Y1VJ 1PP8F 1SFOJ 4YIFA 4GGGA 3CCEI 2VKHA 3IH3A 2PMZN 2JRTA 3LNQA 3TO9A 2DDBA 3H92A 4N9IA 1VI0A 1FPQA 5AONA 3CCLI 1TWGJ 3GTJJ 3H3ZA 5F0HA 3F72A 2RAEA 3FXRA 2FE3A 2BW3B 4PJLA 4HX8A 2A3SA 5GTHC 5J1YA 3F0CA 5D8LB 2VLAA 2VKDA 4E70A 2M45A 2QZ8A 2M9HA 4ITVA 2L7MP 2CV1A 1J0RA 2IS2A 4XOPA 1ZGWA 4ESJA 1Q1HA 3HOXJ 1UMQA 2GQQA 3VEPA 3W6KB 2L9NA 1O57A 3OWTA 1MDMA 3EUKL 3DKWA 4MTDA 1U9NA 3RKQA 3HOVJ 3O2PE 3P5JA 3CTAA 2HXOA 1X1BA 3UR3C 4MFEA 1HDDC 2DJIA 2OCCH 1JGSA 3DBLB 3HDDA 4S05A 1OYYA 2IA1A 3R6SA 1B72B 2OU2A 3I5UA 5M5XJ 4RAGA 3CMAI 2E2HJ 2CUEA 2HEOA 4A3KJ 2M1BA 1GXPA 1Z3XA 1QU3A 3Q9VA 2ZSHB 4G9YA 1WJEA 3FF5A 3WGGA 5ERIA 1FMWA 1I3AA 2H94A 4C3HJ 4ZYGA 1BI3A 2MD0A 4PJMA 1Y0NA 2KMUA 1X1DA 2M7AA 2IW5A 4AUXA 3I64A 2QQBA 3B6CA 1TL8A 3JTGA 4I0AA 2KFDA 2VIXA 4Y52J 4NUBA 3T8TA 5K5RA 2I10A 9ANTA 1IV8A 1O3QA 5EEAA 3B6AA 3WTVC 3S3OA 5BOXA 1X4OA 4A5MA 2R7OA 3H0GJ 3L2QA 4NC7A 3KP2A 2JUCA 3IAS2 3FMRA 2LRDA 4C3IJ 5JHFA 1DDNA 5EZHA 2E1OA 2C6YA 4RB0A 2IS1A 1KZHA 1Z21A 1S7AA 3FXQA 3FZVA 3V7RA 2KLOA 3MAJA 2MABA 3GFJA 4XLEA 2V26A 5L3GA 4PJNA 2DAOA 2NS0A 4CCOA 1M1EB 2Z33A 5IT9K 2K9MA 5FFXA 1V5GA 1Y56A 1TBXA 2STTA 3BG5A 4GO1A 3WG7H 5HS8A 2JA5J 1XX5A 4EJTA 2XIGA 4KICA 2MH2A 4RAFA 1MJAA 3A01A 2R5ZB 1MSFC 2R7ZJ 4J19A 4CHUA 3BJAA 1LEBA 3K4JA 3LFUA 4LB6B 4LOCA 1BR2A 2XC7A 2FJ1A 3FXUA 3S93A 3CP8A 1B72A 2NXNB 2HQ5A 3FDYA 1L0OC 1X1PA 1XCVA 3BWGA 3M7GA 1U3EM 5ICFA 5IYBJ 4HQEA 3CC2I 5JVGF 5HNHA 3QPSA 1AHDP 2VJ4A 2BY2A 2L9SA 4B3AA 3IKTA 2X51A 4HQMA 1P7JA 1SFXA 3A0HC 4A3FJ 2CH0A 1H89C 2BZTA 2X1CA 2IGKA 1F4KA 1FT9A 4F55A 3ZMZA 2ZNZA 3CP2A 1V3FA 2LY2A 5H2FC 5FKOA 4LFUA 3S2HJ 2K27A 5CPRB 2HI3A 1Z6TA 1N75A 3V7SA 3GWZA 1LPQA 3HSEA 2W4SA 1VQLI 2A6EF 2H1LA 1RPWA 4E7SA 3CMMA 1FYLA 2XGCA 4CXFA 4XONA 3RPUD 4OIQF 4A12A 3OYBA 4MEYF 3L2RA 3S8PA 4BHPA 1I3QJ 2DA2A 3D0SA 2WAFA 3DEUA 3HOYJ 1S9HA 4EQQA 1R00A 2F5CA 3HM5A 3JTHA 4HA8A 4Q48A 1R22A 4HX7A 1HF0A 4Y13A 1K78A 1B4AA 4IVNA 3JCUC 2IS6A 2GA1A 2RREA 3K0LA 1UAAA 4AYBA 3TW7A 2AS5F 3E6CC 3WE2A 4KA4A 4YFXF 2XAJA 2H1KA 5E8GA 3LSRA 2ME0A 3JR9A 2OD5A 3AL0B 2QLZA 4UUTA 1DGWY 3WTZA 2R5ZA 4L5IA 2P5KA 2IGMA 3ZMDA 4P55A 1E3HA 2PI0A 1MMNA 3CJQB 2ESHA 2EZIA 2CJJA 4DNCA 2HZTA 1R4MB 2EV5A 1ZG5A 3KLNA 3AAFA 2XDVA 4UY8I 1IAWA 1Z3YA 5LRSA 2DMUA 4IRGA 2WA0A 1CQTA 3GFMA 5IOZA 4BXXJ 5EG0A 1XN7A 2DYRH 3EQLF 3OL4A 2IEKA 4ZZDA 5LHIA 1X1AA 2XRLA 2FX0A 3VB2A 1HOMA 3RYRA 1HBXG 3EPZA 3L9FA 1KU9A 5FB2A 3IAM2 2M0CA 3ZQLA 2D5VA 6PAXA 1MBFA 3V8KA 2IRFG 2A5WA 1SD4A 1FOKA 2WTEA 1FY7A 1G3WA 4ASNA 2GAUA 3BQZA 3H35A 2QQ8A 5M3FJ 1I1GA 1WJDA 4FTHA 4RB2C 3O6BB 1PJRA 2JMWA 1APLC 4C2UA 3ERED 1BA5A 2HOSA 4HF1A 4BQQA 5HLHA 2YU3A 2VONA 4M9SA 4XRSG 2DDAA 3SQNA 2QQAA 2VBXA 3X2QH 3TOAA 3P7NA 2HQNA 3BR0A 3OYAA 4FHTA 2JQ7A 2H27A 3CCSI 1P7IA 1JKOC 1U5TB 2L7FP 4A0XA 4LG0B 1G3TA 2CQXA 2W7NA 3VFZA 3BR2A 3RYPA 2W24A 1HKTA 1TC3C 5HOOA 1SAUA 2LVSA 1Z1DA 2WV0A 1XSDA 5D6EA 1J5YA 3FKIJ 5GADJ 3GBGA 1YI2I 1A6QA 4NC8A 3WTYC 2K9QA 2M2EA 4PGGA 2DU9A 4GCVA 2M34A 2VQHA 2WAEA 2TCTA 1TQPA 2IGNA 2CQQA 3QYEA 1VZ0A 3BOQA 4UVBA 3HZJA 5E3OA 2JVGA 3H1CA 2VJ5A 3JRBA 4ZDOA 3L09A 2STWA 2J5OA 1ULYA 2F5VA 1FBUA 2JUGA 4BYYA 1NK3P 1R5HA 4PDKA 2RV8A 4IJAA 3ABKH 1G3YA 1OCCH 2HR3A 3GTKJ 3SZPA 2EWNA 3O8GA 4BNCA 4M9XA 4G7HF 1X19A 2FU4A 4CSWA 4CO8A 1SEUA 1WJFA 1A35A 2DFFA 2K7LA 3IWZA 4KFCA 4MQVA 2KQRA 1JTXA 3W6JB 1OCRH 2PLYA 1OISA 3QWLA 2P5LC 1P9QC 1ZN2A 2B9SA 1QHGA 5AIPA 1X1CA 3GW2A 2LYCA 3SZGA 2FF4A 2W84A 3HSRA 2JJ7A 3QYBA 4E7ZA 5C3EJ 3S15J 2O3FA 2KZVA 2RKHA 4LG3A 4TV7A 2MA3A 5K7HA 1GVJA 4RAZA 2IGOA 3DF8A 2GM4A 1VNDA 3H0DA 3EDPA 2FMYA 2R7UA 3HOUJ 3VYTB 1DPRA 4AU7A 4BUPA 1U5TA 3HL2A 1FYKA 1TWAJ 5HNFA 4XSZF 4LG0A 3VSLA 5D8KB 3P9CA 1T95A 3OS2A 1U9OA 1BR4A 4WXHA 4BHBA 3F21A 2CW0F 2X85A 1O7FA 1J75A 4BBRJ 1XGSA 2V1DA 1ETWA 2WBMA 3WTUC 4D1QA 2PJRB 2NVQJ 1YW8A 3QODA 1DU6A 4V19K 5EZGA 3GUDA 1HSTA 4XLCA 5HS9A 3ROUA 2Y2ZA 2L3DA 3FBNB 4UUSA 2FBIA 1IF1A 2ISYA 4BACA 1TWCJ 2HTSA 4JX6A 1G2HA 1VQ8I 3CDHA 4EJOA 3FX3A 2CUJA 1FNNA 3TO7A 3V42A 2RVCA 1XCBA 2F6CA 1JKPC 3CJNA 1U8BA 2ID6A 4EM1A 3RSNA 3ZRGA 3W3CA 1LVAA 3KEYA 2ZXWH 3E3VA 1MW7A 1IGNA 3R60A 4XRMA 3L7WA 3J7ZI 1QHHD 1MBEA 3QU3A 4BE2A 2Q0OA 3I0TA 3V8JA 3HJEA 2A68F 5CVVA 2DI3A 2RQPA 3I4PA 4OINF 3E6MA 3GTGJ 2V1XA 1Z91A 1D0ZA 2XF6A 3K9TA 4EMSA 1GVDA 1WKMA 2IS4A 1D1CA 4OWRB 2PX9A 2VN2A 3H9GA 3V8LA 3JRAA 4A3GJ 1UFMA 1J9IA 1P2FA 4LLNA 3JRHA 4HEA2 4IL6C 1ZG1A 4ZYEA 3SXYA 3CUQB 2O7OA 2BY0A 1IRXA 1ZGJA 2FOWA 1KA8A 2VKEA 1ZTRA 5ILUA 2HNHA 2X4HA 3JSOA 2ZKZA 3REOA 2LTPA 3OIOA 1VQ9I 4MEXF 5L3CA 1U0JA 3MZ8A 3KEOA 3BQYA 2QEXI 2ESNA 2KZGA 3BR6A 4EM0B 1VQMI 2XGDA 2GBYA 2M4KA 2H6CA 1BR1A 4NDLA 3CCQI 4ENMA 2CQ7A 4XN3A 5IT9Z 2EILH 4BJ6C 1G3SA 1R5GA 2CRGA 2VI6A 2OZUA 2XB5A 5ICGA 1TLHB 2ZB9A 1DU0A 1RKTA 3TGNA 2F5DA 3DP7A 4Q47A 2AHQA 1W1WE 2EQRA 4ENNA 1CF7A 1FX7A 2HKOA 1F43A 2ZMEB 3LSTA 1K6YA 2UXXA 3CQZJ 1STZA 3IV5A 2M8GX 3K4NA 3HB9A 2ZBKA 1D0XA 3L00A 1YITI 3FIWA 1FTTA 3HTUA 1ZAOA 1W36D 3KP4A 1W7PA 3TKYA 5C4XJ 2DYSH 3MCZA 2EB7A 3CLQA 2QENA 3VYRB 5BQTA 4WXCA 3OV8A 4GYGA 2NVXJ 4HAMA 2LREA 2IA0A 3SZTA 3HYIA 4I6ZA 5E79C 2Y0MA 3OOUA 4CYCB 4YIRX 2Y30A 2Y31A 1HW2A 1HKSA 2LOOA 2A6HF 3PO2J 1QPIA 1MMGA 2K3PA 1R1UA 2CW8A 3Q5FA 5FJ8J 2W00A 3CUQC 2P81A 3LSIA 3ML6A 1BIBA 3RQIA 4C30A 4C2MJ 1BC8C 3S1RJ 2RC4A 4W1UA 1XB4A 4BDYA 3CUQA 3BR5A 3ZMVA 1AWCA 2XSDC 1I6XA 1I6HJ 1B9NA 1OLTA 2XPVA 2EV6A 4EJVA 4Z2YA 2V9PA 3ZN1A 4II2A 3ZGKA 5K1YA 2M5WA 1OCZH 3ASNH 3PFYA 3JRCA 3S2WA 3CF5F 4YELA 2D1HA 3FISA 4II3A 1UG0A 2PN6A 1FOYA 2WV1A 1R7JA 2K40A 1QZZA 2VUMJ 3BG3A 4UV8A 1R4NB 1T6SA 4XQFA 1YFHA 1Y8QB 2VXZA 2HYGD 1RI7A 1T33A 2JPBA 1POGA 2VE8A 4HRIA 2A5YB 1HQCA 1ZELA 2V9KA 4XKCA 4N0BA 2OF7A 3IHUA 1YX5A 2LY9A 3UKGA 4RMNA 3ZMUA 4KMUX 3VSKA 3CZ6A 2DO7A 4XKWA 1X4PA 3WTWC 4Y3OA 1WCMJ 3J7AO 1WZ2A 4UVCA 5ED4A 2RNJA 3ECOA 4NC6A 1ERDA 1D8KA 2M3AA 5FGMA 2COMA 4DGWB 1MDMB 4RGUA 4ZTJA 2Y9YA 5HDKA 3OIPA 3JREA 1YLFA 4KNYA 3FK7A 1DGRM 5CKTA 4HNUA 4CYCA 4CCKA 4P5OA 2EFOA 2EZHA 4I2OA 3GX4X 3JW4A 2MC3A 2E1CA 3I3LA 1XD7A 4BEHA 3IL2A 3R4KA 3K1PA 4M9ZA 2DCEA 5LBQA 3PNTA 2JT1A 3HSFA 1ZLKA 1MH4A 3LAPA 2LF8A 3DPLC 3K1NA 2BXZA 2DBBA 3KYCB 4N4NB 3SYTA 1L3LA 4KUMA 4PGHA 3KYDB 2HYFA 1RKWA 2YUSA 1P6RA 5E3NA 4E7JA 2KP6A 1EV7A 1HDPA 1DUXC 3KYLA 3TO6A 1ONVA 1ZHFA 2YR2A 2PEXA 4QPQA 3DQVC 2Z3YA 2DOAA 2NNNA 1YX3A 2EH3A 2XF7A 4V2GA 2QQ9A 2XASA 5B3SH 2OTJI 1ZREA 4K2EA 5M3MJ 2KIQA 5IY5H 5J40A 5B66C 1Z6RA 1OPCA 3WG9A 1UHWA 3HHGA 4A3LJ 5TJJA 2KIMA 4A5NA 4UV9A 5GPCA 1N78A 2E5NA 4AC0A 5KAIC 1KU2A 5IOYA 4Y33A 4FISA 1GT0C 2KRHA 1PDNC 1UZCA 4MHGA 4Y17A 1MKMA 2BYVE 1WJ5A 2R7RA 3R61A 1OJLA 2ZNYA 1J59A 2L4AA 1ZGAA 3ZQGA 2V4JC 4MIMA 2KHMA 2EZLA 2DA7A 3ZQQA 4BXFA 1D5VA 2LH9A 4H4KC 3GFIA 1ZRFA 3A03A 1EH7A 3A01B 2XAGA 2Y48A 3NQOA 1GLNA 1U6GA 4XLFA 4XBFA 2Z1DA 2PFBA 4FQGA 2K85A 3TEDA 1NK2P 3HEFA 2K4JA 3W6VA 4CA0A 4IZZA 3S2DJ 1PVEA 4FX4A 1LQ1A 1QO0D 1LDKB 3NEUA 4JQFA 3LSPA 3T8RA 2PQ8A 2Q2EA 1MMSA 3MZYA 1K83J 4BJ5C 3OYLA 4RM2A 1IO2A 3H5RA 1HKQA 1LUJB 2ELHA 4Y7NJ 2F4OB 3SFZA 4LK1F 1TNTA 3FM3A 1KYWA 5DM6F 1YJWI 2V6EA 2XUBA 3WHBA 2V6CA 1FSHA 1QNTA 4IHVA 3HKZN 3IWFA 2EZKA 2XKPA 2VOOA 4QPOA 5HODA 2BY3A 2LG4A 4LMYA 2VE9A 3BR1A 1NHAA 1TWHJ 3GMEA 2XROA 2R7XA 3NARA 2ZJRF 3M1EA 5H6QA 2BOLA 3DEEA 3IH2A 2DPDA 3SDGA 1EJ9A 4KN4X 5JR3A 4XK4A 5ICCA 3DTIA 1XSVA 1O4XA 3IRRA 2OC6A 5D5XB 2NOJB 1K78B 3GTLJ 1U2WA 2JSPA 3L1PA 4Y4RA 4RB3C 3BZCA 3I56I 2MH9A 4ZTFA 1UG2A 4NHJA 3J80K 5BNGA 2O5RA 4XKVA 3RTRA 2DA5A 5H6RA 5D4SA 3QPHA 3BDDA 3OYIA 3S1NJ 4FETA 2CW7A 2FNAA 3ECHA 5CQGA 5E1XA 3S3NA 4EJUA 5D5VB 4M3FA 2LDUA 1F36A 1ZK8A 1IN6A 1RC9A 2Z16A 1XGMA 4FE4A 4CZCA 1VFCA 2CG4A 1MNMC 1QVUA 4XKBA 1P92A 1I39A 3J7YJ 2M7BA 4A0YA 5E3MA 2WB1N 3DEWA 1IN5A 1OCPA 3GYHX 3A2KA 1P4AA 5EG0B 2CUZA 1S72I 3DKXA 4DYRA 1FIAA 1H9TA 5KVRA 4ZC3A 2OPTA 3N97A 1VQKI 2VC1A 1E17A 3E5XA 3KZZA 5CVJA 3WTSC 2HXIA 4XRFA 3HRUA 1LE8A 1H8AC 2KIFA 1QGPA 3KX2A 2NNYA 1MBHA 1LB2A 2AXTC 3WODF 2P4WA 2A6TA 2YS9A 1O3SA 5TGTA 5J47A 2Y69H 4UB8C 2O9LA 3K69A 3KPHA 1A04A 5IPAA 3OYJA 3PUBA 2OTLI 1FIPA 3IC7A 2DMTA 1FSEA 3RJPA 3OYKA 1HA8A 5CJ9A 4F52A 5F0CA 1WJBA 5KAFC 5FFZA 3QQAA 3BJ6A 1OQYA 1V5EA 1MNEA 3H5NA 4KJZA 4XM3A 2FNPA 2KDZA 1V4RA 2W25A 1OKRA 2PMZA 5FLXK 4FASD 3HUGB 1F1ZA 1XGOA 4B09A 4BQOA 2HDDA 5D4RA 2NOGA 1Y0UA 2D2WA 3HC7A 1I27A 1VQ5I 4A6EA 4I7HA 5ILVA 2E7XA 4XN0A 1XDSA 1MIJA 1DP7P 3CC7I 3DFGA 3D5RC 1XTAA 4M6VA 4X1EA 5FKLA 1YW9A 2G7HA 1LFUP 2NVYJ 2H6BA 2GXGA 5LEKA 2Q8KA 4KIGA 2AXLA 4P9UA 3U2RA 2UXNA 3DBHB 4GRIA 3LA2A 2GWRA 2OQRA 3HGYA 4ZZLA 5TRDA 1TQMA 1X3UA 2HPIA 3M8JA 1PUFB 4F91B 3OSGA 2V7FA 5F64A 5EGOB 4LD5A 2LKXA 3C2BA 3PQKA 4AIDA 2PMUA 2KRCA 5L3DA 3V7CA 4S04A 3HRMA 5LGUA 5CLSA 2FOKA 3TW6A 3BG7A 4HLYA 3K2AA 4U88A 2IPQX 3BG6A 2R7TA 3HIFA 4ESFA 2PMHA 4ZYDA 1XS9A 1BOBA 3ZPLA 2DW4A 3RCOA 2L7ZA 1A36A 2E7WA 4JP0A 3O3KA 1XG1A 2BXYA 1RR7A 1MZBA 3SDBA 4WWCA 2CYYA 3LSJA 4IXAA 5TISC 3RPQA 1W0UA 2E35A 2V1UA 1QZYA 3FWEA 4XORA 5BPIA 1IUFA 1GV5A 1KQ8A 4B1RA 2VL8A 2ZO4A 3AFHA 4RGRA 3CCYA 3RKWA 2ECBA 3HKZA 3KP3A 4QSHA 4HX4A 4HYEA 5DUKA 2QUFA 1LDDA 5GP9A 1WI9A 3I4NJ 2L2OA 4G12A 3AG4H 1FOXA 2ELKA 4D0PA 3G71I 1RNLA 5DUIA 4YFKF 3HUGA 3NWTA 1D8JA 1J7KA 5EEHA 3MZHA 3D5SC 4HF0A 4KYWA 4BU2A 1S6LA 3FXKA 2K9SA 1IXCA 1S7OA 3K7AJ 4UUSB 2DK5A 1EH6A 1Y6IA 2EA2A 2W57A 3ZQ7A 3KEQA 1SAXA 3MKZA 3E5UA 3BP8A 2QM3A 2VPLA 4RA2A 5K5OA 2OQGA 4PUSA 2OZ6A 3C2GA 1OYWA 1SFEA 3NRVA 5CVIA 4ZDPA 3PFIA 3H36A 4A2UA 4BJTA 1RUNA 3ZN0A 3S16J 3M3YJ 1ZR4A 4U7DA 4J00A 4KISA 3IUOA 1AKHB 1BW5A 1FEXA 4CCLA 1PUFA 2D1VA 2E5ZA 4QIWN 2UWMA 2QSGX 1LEAA 3HHHA 3NAUA 3EUHC 2HDCA 1TZLA 5EGOA 4FCYA 2EA4A 4KITB 2R7SA 1HC8A 4HNTA 3SFIA 4LLGF 5GTIC 1R23A 3VYUB 2XAHA 4OMZA 2MBFA 4LLLA 1EA3A 3LSGA 2ZJPF 3F8NA 2GXBA 2MC4A 3CCRI 3I59B 4A3DJ 2J5PA 3AG1H 3MKYB 2LC2A 2WAQN 1H9GA 5IYCJ 1TNSA 1D1AA 4FX0A 3AKZA 2M87A 4RDUA 4ON0A 5DV5A 3Q0VA 2VQGA 3E1SA 2DFEA 1FP1D 4WX9A 3F9KA 3RPUA 3OS0A 3M1CA 5FRMA 5D5UB 2P0WA 1E2XA 2QKLB 3GF2A 2IBDA 3DV8A 5LRRA 3ERMA 4BY1J 2D45A 1SVMA 2NRAC 2I8DA 3A02A 4G94A 2M4GA 4MQ9F 1H88C 1MBJA 3K70D 2G9WA 3TP0A 3I58A 5DCMA 4I98B 1S8NA 1K79A 3RQ4A 3M07A 2DJNA 4UB6C 2E1MC 2F2EA 5FKKA 1QQIA 4BH9A 3W2WA 5F6FA 3U1DA 3RKXA 2DFIA 5JI6A 1T39A 3ABTA 3ZXSA 1CF7B 2K3FA 2O8XA 4M3EA 4IOAF 1IXSB 1LDJA 1ETKA 2DOEA 2ETHA 2OUMA 2FMLA 1JT6A 3IKVA 1AOYA 4HF2A 2Q1ZB 1AKHA 1C0WA 5LHGA 1YO5C 3OYGA 2ZFUA 4P9FA 3WTTC 1IRGA 4KN7X 2XHKA 1W7PB 4ZYHA 2HOEA 3JRFA 5GAEJ 3BTCA 4OOIA 3NWSA 2HKXA 5F1RA 3PM1A 3QPTA 4JOMA 4B4CA 3G1LA 2G0EA 2VASA 4ENJA 1R6RA 1A31A 4X0GA 1RESA 2NS7A 5AIQA 4RBOA 2DODA 4AD9A 3HBLA 3RIRA 1YHQI 1TW2A 2GOMA 1DQUA 1UHMA 1YRNB 3EYIA 3I59A 2GIVA 3KLOA 4DYQA 3CCVI 5KK1A 2EJRA 2UV1A 3PJRA 1IRZA 4Q4ZF 2K9LA 3MVPA 3IP4B 5EF6A 3F3XA 4CYDA 2LY1A 5DD8A 1QBJA 3F8CA 1WSUA 3F8BA 1PYVA 1QPMA 4G6TB 2IXSA 5L3EA 2JRMA 2QBYA 1I1SA 4XLHA 1JJ8C 2NVTJ 3WGIA 3I9V2 5C44J 5DYMA 2PJPA 3JRGA 1T0FC 3PSIA 1F5TA 3F6VA 1JUMA 4BAYA 4YIIA 1ZG3A 1GDTA 2FBKA 5EYRA 4ZDLA 3OYHA 1T0FA 3I71A 2W1OA 1ZKGA 3FHNA 4M74A 3H5AA 3KETA 2KDOA 4LITA 2QCOA 1ZLJA 2E1NA 4W97A 3C1DA 2HDWA 4RAYA 4PSWA 1R1VA 3RI4A 3M4OJ 2DT5A 1VTNC 1RZ4A 4E7LA 4R8HA 3J80Z 4LGWA 2JZYA 4EEFG 1XDUA 1UELB 1JI8A 2OAZA 1O3TA 4L9JA 3E0JB 3M8EA 3R0JA 3MEXA 4NQWA 3MD2A 1ORKA 1XC5A 1YG2A 1SFUA 2VODA 4IQJA 2R3SA 3KP5A 1YW7A 5DDGA 3G2BA 3OYNA 2ZXIA 4BKXA 4PFOA 2CQNA 1BN5A 1FWZA 2QVOA 2NYXA 3QP6A 4AWXB 3L2VA 3S1MJ 2GXAA 4HOBA 4L0YB 4B44A 2EIJH 1B6AA 1K7AA 3P9IA 4KT5C 4HPQA 5J4VA 3BPXA 2XGXA 4E4HA 3ZQHA 1ETOA 4Y15A 5KHDA 2V79A 2LP0A 1IZ1A 1YRNA 2CGPA 1RRJA 4H0EA 1IV6A 1QVTA 1JHHA 4BEHB 3WU2C 4KIFA 4HNVA 5M5WJ 3FKJA 3BTIA 3MN2A 2DA6A 2FQ3A 3F6OA 3KE2A 2CMPA 3LQRA 4ZJZA 3GZ6A 5JLXA 5FD6A 2RDPA 3OR2C 3D1NI 2MD5A 2X6XA 1JGGA 1T98A 2UUZA 1OMIA 2DT6A 1U78A 3LWFA 2COBA 4D5FA 4BGDA 1IN4A 3TMOA 3VODA 1Z7UA 1T38A 2ELJA 3G1OA 3HOZJ 1YOVB 3VPRA 5KNLA 4XNFA 4XICA 5LD2C 4IHTA 5FLXZ 5A2QK 2O03A 1IC8A 3FXOA 4I99C 4WXDA 2HOTA 1OFCX 1HW1A 4P96A 3GTOJ 1IRFA 1WH7A 5CQEA 4XLNF 1MSEC 4AIJA 3E5QA 1EH8A 2KPMA 3ZMTA 4IX7A 3E6DA 4BQNA 4R79A 3ABUA 3I54A 2L4MA 1D0YA 1IG7A 5EJCA 1YS7A 3TDUC 1FC3A 4GXOA 4D9JA 4ZYAA 4JK1X 1GXQA 1W5TA 4BHCA 1REPC 3KP6A 4I02A 2LNBA 4XL9A 3CO6C 2VT3A 3TP3A 1SC7A 4DJAA 2QGUA 2H8WA 1FBSA 4U0YA 4IRIA 3KCCA 4G6DA 1FYMA 2DMNA 5DCFA 3T5XA 2G7UA 3LSHA 1R5ID 2ZC2A 3AG2H 3C7JA 2M8EA 2OJED 4E7KA 4GFBA 4HZFA 3EUAA 5JVTA 2LLKA 2BY1A 4G7OF 3L2CA 3MFKA 4YG2F 3CDIA 2L54A 2VBZA 1KQ0A 4EV0A 1N25A 1WJAA 3ELKA 4O5VA 3N05A 3GLXA 3LOCA 4DBRA 4WK8F 4IHYA 1QA6A 2Q2EB 2WY7Q 3K4KA 3SEQA 2GIZA 2HGCA 3FXLA 1TTYA 2JA2A 1FTZA 1BJZA 3CJTB 2DA3A 4UHTA 3RDIA 4FT8A 2XAUA 4AIKA 1IJWC 3QU6A 4M3DA 3H9QA 5BMZA 3FBIB 1N77A 1K4TA 3ZR8X 1RR8C 1A5JA 2B0LA 3CJRB 4A3EJ 2OV7A 3G3ZA 4D7NA 5FLVA 3QYFA 1ZRDA 3K1MA 2XPWA 2R5YB 1IXRC 2XKOA 1J09A 3ASOH 4A93J 4GYIA 1OCOH 5F0FA 1MGTA 4MGRA 2O8KA 4LB5A 2ZJ2A 4B43A 2FRHA 3BCAA 5H20A 2V1NA 4XOTA 3S14J 5J8FA 2QSFX 3F8FA 2R7VA 2X48A 5D6FA 4PJ0C 1SMTA 3CESA 2CFOA 3BG9A 3F23A 1MJBA 2VOPA 1VF9A 4EATA 1W36C 1FOWA 2LFBA 3JAMK 1H0MA 3ZQCA 1B1BA 3DPTA 4M6YA 3S32A 4AYBN 5B1AH 3GFLA 5HDNA 2GOXB 2BHYA 2FXAA 2XGEA 2HOAA 1T8IA 1IN8A 2K9NA 3OS1A 2OCEA 2FD5A 1X58A 3PIOF 3QRFF 2DPUA 5C4JJ 3LA7A 1MMAA 3FM5A 3GZNB 3LAJA 3A0BC 1ITYA 4L9NA 1IDYA 2BV6A 3ZP5A 5EEGA 2PBIA 2VXDA 3BT9A 5IT3A 2ZXHA 4KMFA 2O61A 1WI3A 2BEOA 2R7DA 3RZOJ 4B8XA 1SVLA 3DBRB 2E2JJ 3LMMA 1OYIA 2LBFA 1Z77A 1UCRA 4IF4A 3KZIC 2H8RA 2VQCA 2EINH 1R1TA 2L02A 2Z5UA 2JA7J 3BZ6A 1TWFJ 2IA2A 2XSJC 3LSMA 5FRNA 2R92J 2DLLA 5FD5A 4HSTA 3OYCA 1JT0A 1LE8B 1IUYA 1YIJI 5FKNA 3HG9A 1AU7A 2X6WA 2OBPA 3OL3A 3CCMI 2CFXA 2R5YA 5DD4A 1WFXA 1BW6A 2HQRA 1S29A 1YE9A 1Z05A 3JRDA 4EM2A 2P8TA 2VBYA 1VQPI 3VDXA 4XRSA 4L5JA 4HSRA 1ODDA 2IAIA 3Q3SA 4XR6A 5DM7F 1WGXA 2WC2A 1KQ9A 2VC0A 3TOBA 4B3XA 1IW7F 3LL7A 1KONA 2R7WA 1HXDA 2H09A 2EK5A 1PUEE 3DTKA 4JBAA 5DTDA 1HCRA 1NG7A 2HVRA 4MTEA 2MYSA 4M3BA 5IP6A 1JJ6C 2FSWA 3CUOA 4IPAA 2YX4A 3WGHA 2KJBA 3QPLA 2BGCA 3PO3J 3ZCOA 3HOWJ 3CF2A 3S3MA 4F7ZA 2JTVA 2QYOA 5B1BH 1AA7A 3BR3A 4S0HB 1R9TJ 2BW3A 2CQKA 3H3VK 2P7VB 2K5CA 4P1WA 1Z0XA 3PIPF 4MNUA 3OYEA 5K5QA 2VB6A 5GPAA 2MFZA 1ON2A 4B48A 1W4MA 5J1UA 3S1QJ 3K4MA 2M0MA 1PP7U 4J01A 3RKYA 3P9KA 4KDPA 3HRTA 3VYSB 2E2IJ 2L01A 2B63J 2XVCA 1XGNA 2LSOA 3T1BA 1ZR2A 3BJOA 3G1MA 4A3BJ 2M30A 4HBLA 2P5VA 2QA4I 3BC8A 3K2ZA 3KZYA 3EETA 3K4CA 2VJJA 3J81K 2IP2A 4IRHA 2ICWG 4BXUA 1IN7A 2P6SA 3BTJA 3LSKA 5IP7J 3N4MA 2A07F 2XV4S 1S5LC 5CYVA 4QTRA 2F4IA 3MMYB 5EDNA 2ME6A 1HSJA 3OMYA 1G8XA 3D5LA 1BI1A 4O6JA 3CDLA 3ZQIA 5CVRA 4QLCU 2VT2A 1XSXA 4Q5SF 4HV5A 1ETXA 3BZKA 4WCGA 1DP3A 3C3WA 4G8XA 1MD0A 1WQ2A 1FMVA 2E36A 1I50J 1X2NA 1P4WA 1WPKA 1FJLA 3PUFA 4BQAA 2BBYA 3TL4X 3FK6A 1YQAA 4LK0F 2Z9OA 1R58A 2XB0X 3OR1C 4BDZA 4CUGA 2X6OA 3MKWB 5E1WA 1SANA 3RZDJ 4ESBA 1FZPB 2QWWA 4B47A 4OIRF 5LHHA 1KU3A 1XMAA 2MLKA 3MKLA 1G59A 4CICA 4OIPF 4HW0A 2XF5A 1ZH5A 1SD7A 2XRNA 3EYYA 1YTYA 4IQ4A 4A0ZA 3WE3A 4O3MA 1LNWA 4I0BA 4L5EA 1MJ9A 1SVOA 1RIOH 2YPRA 4CCMA 2LF7A 2Z99A 5BS6A 2LMDA 3Q9SA 2VKVA 3HOSA 3CC4I 2IVMA 2HQAA 2KJCA 4N9HA 2WADA 4C2TA 5L3BA 1XMXA 4G7ZF 3DTEA 2RGVA 5HDGA 4LIVA 3DU6A 4JX4A 4GDFA 3ZQFA 2DTZA 3L2WA 1VQ6I 2F5FA 5FKMA 2ISZA 4IHWA 1D3YA 2HYJA 2K02A 1ETYA 2GA2A 4U7BA 5FROA 4BBSJ 2LK2A 4UUVA 4BE1A 3DU5A 1J2XA 3PSFA 3UNGC 5A2QZ 3W2VA 1W0TA 2FA5A 2XAQA 2ADUA 4MFDA 5FLMJ 1YJNI 5L3FA 4RM3A 2NS8A 3I4MJ 2RQQA 3G4SI 5J1RA 2JSCA 1YIOA 4CH7A 4CDGA 2CS3A 2X1DA 3ABMH 2F4MB 2WWYA 1RETA 4DQ2A 3H3UA 3DXJF 2DOFA 5LLQA 1TP4A 1R71A 1R49A 3OYFA 4BL0B 2DTRA 1BIAA 1X3WB 3BTLA 4F3QA 2CV2A 3R0AA 2GZWA 2HVSA 2KISA 5HLIA 1UB9A 4U0VA 2P6TA 2DK8A 1BL0A 5DCMB 4DW6A 3CCJI 2ZJQF 4UXNA 2L0KA 1DPUA 4G6QA 4IO9F 1SMYF 1GHCA 3SEZA 1Z67A 2ZSIB 5HLGA 2E1MB 1KYZA 4L18B 4D7MA 3SJMA 5E1ZB 2Y9ZA 3AL0C 4BY7J 4AIHA 4L0ZB 2MG4A 1YS6A 1KGSA 5CVUA 4A69C 2BVLA 3LFKA 5J6XA 4Z6YA 1MNDA 2CU7A 4L9VA 3A4CA 3CMEI 1ZRCA 2N8GA 2O0YA 3MWMA 4A6DA 2R93J 1ZYRF 1W5CC 1XMKA 5IP9J 3EUHA 2JA6J 1HLVA 3TBIA 2X1EA 3I55I 1GUUA 5E18F 4WF2A 4HDUA 1W7PD 3K4BA 2ZXJA 1CGPA 2DFHA 3BCBA 2WB1A 1ETQA 1B8IB 1G6NA 2DMQA 1WRJA 2HPMA 1LFPA 2EFQA 2HFHA 4U0WA 4BE0A 1GV2A 2HWVA 1WWXA 3GLLA 2KT0A 1T2KA 5GAGJ 3HPGA 4CCNA 2EPFA 2NAZA 3OSFA 1MMDA 4A3IJ 2QBYB 1K4SA 4LIUA 1O3RA 3OOPA 1P4XA 4E6KG 4A3CJ 3OYMA 5J8CA 4IHSA 2RN7A 4U87A 3V4GA 4FE7A 3ESWB 1X3ZB 2A69F 2I5UA 3Q0UA 2YSRA 5F27A 2Y0SN 2HS5A 4MO7A 2KL4A 3PQJA 1G4DA 1RUOA 3Q0WA 3M8FA 3WHCA 4HLXA 1I5ZA 4D5CA 3DWLE 4HDVA 4I09A 3KP7A 3L2UA 4DBQA 3JAMZ 1U5TC 1UHSA 3DKYA 1SD6A 1V55H 4RGXA 1ZARA 2XPUA 2KKOA 3FMSA 4XIDA 2X9DA 2RNGA 2X6YA 5M5YJ 4QWQA 4CGZA 2JWTA 1NG6A 3WTXC 3IRQA 4JX5A 1BM9A 4BS9A 4NQWB 5E8IA 2R7FA 2CSOA 2EFNA 3BROA 5HVQC 1OR7C 2HZDA 1FP2A 1NTCA 1BI2A 3OY9A 3HOTA 1ON1A 2ID3A 1OR7A 1NH3A 2MSYA 3ISPA 3B73A 5KCMA 3HGGA 1LFBA 4YFNF 1Y39A 4EGYA 4A3JJ 3T0YA 3MQ0A 2LR8A 4OMYA 3FHZA 3F8MA 3S17J 4IKFA 1UJ8A 2L7KA 1ACIA 1D1BA 3FXMA 2W82A 2FBHA 3ABLH 3CO7C 1Y1WJ 5E17F 4PCQA 1B8IA 4PSXA 5F1JA 4L9TA 3KIOA 1HW5A 1WHUA 2EIKH 1ENHA 1JKQC 2EBIA 4NB5A 3W2AA 4X6AJ 4DOZA 5IYDJ 5ILSA 2GLOA 3ONQA 1V54H 3BPVA 2LKPA 5JLWA 2LD5A 4AM3A 2EV0A 3GTPJ 1Z7LA 5J4YA 1MBGA 3BY6A 4IHXA 2E34A 2R7QA 2DA1A 3FMQA 4YEJA 4N4OB 2ACJA 3GO5A 4DIQA 4XSXF 2FUG2 1JTYA 2HVQA 5K7FA 1YYVA 2E19A 2JPCA 2JA8J 2L9RA 2L9VA 3HTSB 2R4GA 2K86A 1A6IA 2IJLA 5LFAA 1USTA 4DYCA 5B5EC 3J7AY 1TQIA 3GEZA 1X2MA 1SD5A 4PZJA
chains in the Genus database with same CATH topology
2TDXA 3QAHA 2A61A 1O7LA 2V9VA 3VOEA 3GXOA 2FEZA 1LJ9A 4LJZF 3LQQA 3E97A 4RGSA 2YX7A 3C18A 3GVAA 3I53A 3E6BA 2HTJA 4EGZA 3J81Z 2O6GE 5JFRA 1FBQA 4RS8A 5E20A 1Z9CA 4I01A 5LGTA 1BOAA 2DQLA 3F22A 4RB1A 5HS7A 3M9AA 1BI0A 2X0LA 5LGNA 4XLPF 3HRSA 1BC7C 2P7CB 1BBYA 2ZCWA 4UVAA 4M72A 4OIOF 3COAC 3ULQB 1K6OA 4M71A 2MLGA 5JHUA 1W5SA 3B02A 2UZKA 1B9MA 3QOPA 3JSPA 4ETSA 5DEQA 4ENKA 5LEJA 2DQRA 4M6XA 4ZH4F 2CWEA 4EJWA 1FLIA 2ZMEA 2ZFWA 5D5WB 1R36A 5ICEA 2IT0A 4HV6A 2EFPA 1S3JA 3ZMSA 3GZ5A 4M73A 4KIBA 1JHFA 3G73A 3WU0A 2KRFA 2VBWA 2KIUA 1JXSA 4UNOA 2CO5A 4OU0A 1KU7A 5BPDA 3SHFA 4AVPA 2K4BA 4EVIA 1JE8A 3TDZC 3WU1B 5FO5A 3KFWX 3QP5A 2EFWA 2Y75A 2OA4A 1USSA 3CLOA 1F9NA 3LA3A 1B59A 1U8RA 3U9GA 2BE5F 3TQNA 1TW3A 4CZZA 2PG4A 2F5EA 1BJAA 2XAFA 4R1HA 2W85A 1PP8F 4YIFA 4GGGA 2JRTA 3TO9A 3H92A 4N9IA 1FPQA 5AONA 3H3ZA 3F72A 3FXRA 2FE3A 4HX8A 2A3SA 5D8LB 4E70A 2M45A 2QZ8A 1J0RA 4ESJA 1Q1HA 2GQQA 3VEPA 3W6KB 1O57A 1MDMA 3DKWA 4MTDA 3O2PE 3CTAA 1JGSA 4S05A 1OYYA 2IA1A 3R6SA 2OU2A 3I5UA 2HEOA 2M1BA 1GXPA 3Q9VA 4G9YA 3FF5A 3WGGA 5ERIA 2H94A 4ZYGA 1BI3A 2IW5A 3I64A 2QQBA 3JTGA 4I0AA 3T8TA 5K5RA 1O3QA 3WTVC 5BOXA 4A5MA 3KP2A 3FMRA 1DDNA 2C6YA 4RB0A 3FZVA 1S7AA 3FXQA 3V7RA 3MAJA 3GFJA 5L3GA 2DAOA 2NS0A 2Z33A 5IT9K 5FFXA 1TBXA 2STTA 4GO1A 5HS8A 4EJTA 2XIGA 4KICA 2MH2A 1MJAA 4CHUA 3BJAA 1LEBA 4LB6B 3FXUA 1L0OC 1XCVA 3BWGA 3M7GA 1U3EM 5ICFA 4HQEA 3IKTA 4HQMA 1SFXA 1F4KA 1FT9A 3ZMZA 2ZNZA 1V3FA 4LFUA 2K27A 1Z6TA 3V7SA 3GWZA 3HSEA 2A6EF 1FYLA 4CXFA 4OIQF 4A12A 4MEYF 4BHPA 3DEUA 3D0SA 4EQQA 1R00A 2F5CA 3JTHA 4HA8A 4Q48A 1R22A 4HX7A 4Y13A 1K78A 1B4AA 4IVNA 2GA1A 3K0LA 2AS5F 3E6CC 3WE2A 4KA4A 4YFXF 2XAJA 5E8GA 2OD5A 2QLZA 3WTZA 4L5IA 2P5KA 3ZMDA 4P55A 2PI0A 2ESHA 4DNCA 2HZTA 2EV5A 1ZG5A 3KLNA 3AAFA 1IAWA 5LRSA 4IRGA 3GFMA 1XN7A 3EQLF 4ZZDA 5LHIA 3VB2A 3RYRA 1HBXG 3L9FA 1KU9A 5FB2A 6PAXA 3V8KA 2IRFG 1SD4A 1FOKA 2WTEA 1G3WA 1FY7A 4ASNA 2GAUA 1I1GA 4RB2C 3O6BB 3ERED 4HF1A 5HLHA 2YU3A 2VONA 4M9SA 3SQNA 2QQAA 2VBXA 3TOAA 3P7NA 2HQNA 4FHTA 2H27A 1U5TB 4A0XA 4LG0B 1G3TA 3VFZA 3RYPA 2W24A 1HKTA 5HOOA 1Z1DA 2WV0A 1XSDA 5D6EA 1J5YA 3WTYC 4PGGA 2DU9A 4GCVA 1TQPA 3BOQA 4UVBA 3L09A 2STWA 2J5OA 1ULYA 1FBUA 4BYYA 1R5HA 4PDKA 2RV8A 4IJAA 1G3YA 2HR3A 3SZPA 2EWNA 4BNCA 4M9XA 4G7HF 2FU4A 4CO8A 2K7LA 3IWZA 4KFCA 4MQVA 3W6JB 2PLYA 2P5LC 1ZN2A 5AIPA 3GW2A 2FF4A 2W84A 3HSRA 2O3FA 2RKHA 4TV7A 2MA3A 1GVJA 4RAZA 3DF8A 3EDPA 2FMYA 1DPRA 1U5TA 1FYKA 4XSZF 4LG0A 5D8KB 3P9CA 4WXHA 4BHBA 3F21A 1J75A 2CW0F 1O7FA 1XGSA 2V1DA 3WTUC 1YW8A 3GUDA 1HSTA 5HS9A 3ROUA 2L3DA 2FBIA 1IF1A 2ISYA 2HTSA 3CDHA 4EJOA 3FX3A 1FNNA 3TO7A 2RVCA 1XCBA 3CJNA 4EM1A 1LVAA 3E3VA 3R60A 3L7WA 3QU3A 2Q0OA 3I0TA 3V8JA 2A68F 5CVVA 2DI3A 2RQPA 3I4PA 4OINF 3E6MA 2V1XA 1Z91A 4EMSA 3K9TA 1WKMA 1J9IA 2VN2A 3V8LA 1UFMA 1P2FA 4LLNA 1ZG1A 4ZYEA 3SXYA 3CUQB 1ZGJA 1KA8A 5ILUA 2X4HA 3JSOA 2ZKZA 3REOA 4MEXF 5L3CA 3KEOA 2ESNA 4EM0B 2H6CA 4ENMA 5IT9Z 1G3SA 1R5GA 2OZUA 5ICGA 1TLHB 3TGNA 2F5DA 3DP7A 4Q47A 4ENNA 1CF7A 1FX7A 2HKOA 2ZMEB 3LSTA 2UXXA 1STZA 2ZBKA 3L00A 3HTUA 1ZAOA 3KP4A 1W7PA 3TKYA 3MCZA 2EB7A 2QENA 5BQTA 4WXCA 3OV8A 4GYGA 4HAMA 2IA0A 3SZTA 3HYIA 2Y0MA 1HW2A 1HKSA 2A6HF 1R1UA 3Q5FA 3CUQC 3ML6A 1BIBA 1BC8C 2RC4A 1XB4A 3CUQA 3ZMVA 1AWCA 1I6XA 1B9NA 2EV6A 4EJVA 4Z2YA 3ZN1A 5K1YA 2M5WA 3S2WA 2D1HA 2PN6A 1R7JA 1QZZA 4UV8A 1T6SA 1YFHA 2VXZA 2HYGD 1RI7A 2JPBA 2VE8A 2A5YB 1HQCA 4N0BA 3IHUA 3ZMUA 4KMUX 2DO7A 3WTWC 3J7AO 4UVCA 5ED4A 2RNJA 3ECOA 1D8KA 5FGMA 2COMA 1MDMB 4RGUA 5HDKA 4KNYA 1YLFA 4P5OA 2EFOA 4I2OA 3GX4X 3JW4A 2MC3A 2E1CA 1XD7A 3IL2A 3R4KA 3K1PA 4M9ZA 5LBQA 2JT1A 3HSFA 1ZLKA 3LAPA 2LF8A 3DPLC 3K1NA 2DBBA 1L3LA 4KUMA 4PGHA 2HYFA 1P6RA 1EV7A 1DUXC 3TO6A 1ONVA 1ZHFA 2YR2A 2PEXA 3DQVC 2Z3YA 2NNNA 2QQ9A 2XASA 1ZREA 4K2EA 1Z6RA 1OPCA 3WG9A 1UHWA 3HHGA 5TJJA 2KIMA 4A5NA 4UV9A 1KU2A 1PDNC 4MHGA 4Y17A 1MKMA 2BYVE 3R61A 2ZNYA 1J59A 2L4AA 1ZGAA 1D5VA 3GFIA 1ZRFA 1EH7A 2XAGA 2Y48A 3NQOA 1U6GA 4XBFA 2PFBA 2K4JA 4FX4A 1LQ1A 1QO0D 1LDKB 3NEUA 4JQFA 3T8RA 2PQ8A 2Q2EA 3MZYA 1HKQA 2ELHA 3SFZA 4LK1F 1TNTA 3FM3A 1KYWA 2XUBA 2V6CA 1FSHA 1QNTA 3IWFA 2XKPA 2VOOA 4LMYA 2VE9A 1NHAA 2XROA 3M1EA 5H6QA 2DPDA 4KN4X 5JR3A 5ICCA 1XSVA 3IRRA 5D5XB 1K78B 1U2WA 4RB3C 2MH9A 4NHJA 3J80K 3RTRA 5H6RA 5D4SA 3QPHA 3BDDA 2FNAA 3ECHA 5E1XA 4EJUA 5D5VB 2LDUA 1IN6A 1XGMA 2CG4A 1P92A 4A0YA 1IN5A 3GYHX 1P4AA 1H9TA 5KVRA 3N97A 2VC1A 1E17A 3E5XA 3KZZA 5CVJA 3WTSC 4XRFA 3HRUA 2KIFA 1QGPA 2NNYA 1LB2A 3WODF 2P4WA 1O3SA 3K69A 1A04A 3IC7A 3RJPA 1FSEA 5CJ9A 5FFZA 3BJ6A 2FNPA 1V4RA 2W25A 1OKRA 5FLXK 1F1ZA 1XGOA 4B09A 5D4RA 1Y0UA 2D2WA 1I27A 4A6EA 4I7HA 5ILVA 2E7XA 1XDSA 1DP7P 3DFGA 1YW9A 2G7HA 2H6BA 2GXGA 5LEKA 2Q8KA 4KIGA 2AXLA 4P9UA 3U2RA 2UXNA 3LA2A 2GWRA 2OQRA 4ZZLA 5TRDA 1TQMA 1X3UA 5F64A 4LD5A 3PQKA 2PMUA 5L3DA 3V7CA 4S04A 3HRMA 5LGUA 5CLSA 2FOKA 4HLYA 4U88A 2IPQX 3HIFA 4ESFA 2PMHA 4ZYDA 3ZPLA 2DW4A 2E7WA 3O3KA 1MZBA 4WWCA 2CYYA 4IXAA 3RPQA 2V1UA 1QZYA 3FWEA 5BPIA 1KQ8A 2ZO4A 4RGRA 3RKWA 3KP3A 5DUKA 4HX4A 4HYEA 2QUFA 1LDDA 1WI9A 4D0PA 1RNLA 5DUIA 4YFKF 3HUGA 1D8JA 1J7KA 5EEHA 3MZHA 4HF0A 4KYWA 1S6LA 1IXCA 1S7OA 2DK5A 1EH6A 2EA2A 2W57A 3ZQ7A 3KEQA 1SAXA 3E5UA 3BP8A 2QM3A 5K5OA 2OQGA 5CVIA 2OZ6A 3NRVA 1OYWA 1SFEA 4A2UA 3PFIA 1RUNA 3ZN0A 4U7DA 2D1VA 2UWMA 1LEAA 3HHHA 2HDCA 2EA4A 4LLGF 1R23A 2XAHA 4OMZA 2MBFA 4LLLA 3F8NA 2GXBA 3I59B 2J5PA 1H9GA 1TNSA 4FX0A 2M87A 4ON0A 5DV5A 1FP1D 4WX9A 3RPUA 5D5UB 1E2XA 3GF2A 5LRRA 3DV8A 2D45A 2NRAC 4G94A 4MQ9F 2G9WA 3I58A 5DCMA 4I98B 1S8NA 1K79A 2F2EA 1QQIA 4BH9A 5F6FA 3U1DA 3RKXA 2DFIA 5JI6A 1T39A 3ABTA 1CF7B 2O8XA 1IXSB 1LDJA 2ETHA 3IKVA 2FMLA 1AOYA 4HF2A 1C0WA 5LHGA 1YO5C 3WTTC 4P9FA 1IRGA 4KN7X 2XHKA 1W7PB 4ZYHA 2HOEA 4OOIA 5F1RA 2HKXA 3QPTA 4ENJA 5AIQA 4AD9A 3RIRA 1TW2A 1UHMA 3EYIA 3I59A 2GIVA 3KLOA 5KK1A 2EJRA 4Q4ZF 3F3XA 4CYDA 1SD5A 5DD8A 1QBJA 3F8CA 1WSUA 3F8BA 1QPMA 5L3EA 2QBYA 1I1SA 3WGIA 5DYMA 2PJPA 1F5TA 3F6VA 4BAYA 4YIIA 1ZG3A 2FBKA 1T0FA 3I71A 4M74A 3KETA 1ZLJA 2E1NA 3C1DA 4RAYA 1R1VA 3RI4A 2DT5A 1VTNC 1RZ4A 4R8HA 3J80Z 4LGWA 2JZYA 1XDUA 2OAZA 1O3TA 4L9JA 3M8EA 3R0JA 3MEXA 4NQWA 1YG2A 1SFUA 2VODA 2R3SA 3KP5A 1YW7A 5DDGA 1BN5A 1FWZA 2QVOA 2NYXA 4AWXB 4HOBA 4L0YB 1B6AA 1K7AA 3P9IA 4KT5C 3BPXA 2XGXA 4Y15A 2V79A 1IZ1A 2CGPA 4H0EA 1JHHA 4KIFA 2FQ3A 3F6OA 3KE2A 3LQRA 3GZ6A 5FD6A 2RDPA 2MD5A 1T98A 1OMIA 1U78A 3LWFA 1IN4A 3VODA 1Z7UA 1T38A 4IHTA 5FLXZ 5A2QK 2O03A 4WXDA 1HW1A 4P96A 1IRFA 4XLNF 4AIJA 3E5QA 1EH8A 3ZMTA 3E6DA 4R79A 3ABUA 3I54A 2L4MA 1YS7A 3TDUC 1FC3A 4GXOA 4JK1X 1GXQA 1W5TA 4BHCA 1REPC 3KP6A 4I02A 2LNBA 3CO6C 2VT3A 4IRIA 1FBSA 4U0YA 3KCCA 4G6DA 1FYMA 5DCFA 3T5XA 2G7UA 3C7JA 2M8EA 4HZFA 5JVTA 4G7OF 3L2CA 3MFKA 4YG2F 2L54A 2VBZA 1KQ0A 4EV0A 3ELKA 4O5VA 3GLXA 4WK8F 2HGCA 1TTYA 3RDIA 4UHTA 4FT8A 4AIKA 3QU6A 5BMZA 2B0LA 3G3ZA 1ZRDA 3K1MA 1IXRC 2XKOA 4GYIA 1MGTA 4MGRA 4LB5A 2ZJ2A 2FRHA 5H20A 5J8FA 3F8FA 5D6FA 1SMTA 3F23A 1MJBA 2VOPA 3JAMK 1H0MA 1B1BA 3DPTA 4M6YA 3GFLA 5HDNA 2FXAA 1IN8A 2DPUA 3QRFF 3LA7A 3FM5A 3LAJA 4L9NA 2BV6A 3ZP5A 5EEGA 2PBIA 5IT3A 4KMFA 2O61A 2BEOA 2R7DA 4B8XA 1OYIA 1UCRA 4IF4A 1R1TA 2L02A 2Z5UA 3BZ6A 2IA2A 2DLLA 5FD5A 1IUYA 2OBPA 2CFXA 5DD4A 2HQRA 1S29A 1Z05A 4EM2A 2P8TA 2VBYA 4L5JA 1ODDA 2WC2A 1KQ9A 2VC0A 3TOBA 1IW7F 1HXDA 2H09A 2EK5A 1PUEE 4JBAA 4MTEA 2FSWA 3CUOA 4IPAA 2YX4A 3WGHA 2KJBA 2BGCA 4F7ZA 2JTVA 2QYOA 2CQKA 2P7VB 4MNUA 5K5QA 1ON2A 1W4MA 1PP7U 3RKYA 3P9KA 4KDPA 3HRTA 2L01A 2XVCA 1XGNA 2LSOA 3T1BA 3BJOA 2M30A 4HBLA 2P5VA 3K2ZA 3KZYA 3EETA 3J81K 2IP2A 4IRHA 4BXUA 1IN7A 2P6SA 3N4MA 2A07F 2XV4S 5CYVA 1HSJA 3D5LA 1BI1A 4O6JA 5CVRA 4QLCU 2VT2A 1XSXA 4Q5SF 4HV5A 4WCGA 3C3WA 4G8XA 1MD0A 1WQ2A 1P4WA 4BQAA 2BBYA 1YQAA 4LK0F 2Z9OA 1R58A 5E1WA 4ESBA 1FZPB 2QWWA 4OIRF 5LHHA 1KU3A 1XMAA 2MLKA 4CICA 4OIPF 4HW0A 1ZH5A 1SD7A 2XRNA 3EYYA 1YTYA 4A0ZA 3WE3A 4O3MA 1LNWA 4I0BA 1MJ9A 1RIOH 2YPRA 2LF7A 2Z99A 5BS6A 3Q9SA 3HOSA 2IVMA 2KJCA 4N9HA 5L3BA 4G7ZF 2RGVA 5HDGA 2F5FA 2ISZA 1D3YA 2K02A 2GA2A 4U7BA 4UUVA 1J2XA 5A2QZ 2FA5A 2XAQA 2ADUA 5L3FA 2JSCA 1YIOA 4CDGA 2WWYA 4DQ2A 3H3UA 3DXJF 5LLQA 2DTRA 1BIAA 3R0AA 2GZWA 5HLIA 1UB9A 4U0VA 2P6TA 2DK8A 5DCMB 4UXNA 1DPUA 4G6QA 1SMYF 1GHCA 5HLGA 1KYZA 4L18B 5E1ZB 4AIHA 4L0ZB 1YS6A 1KGSA 5CVUA 3LFKA 5J6XA 4L9VA 1ZRCA 2O0YA 3MWMA 4A6DA 1ZYRF 1XMKA 3EUHA 5E18F 4WF2A 4HDUA 1W7PD 2ZXJA 1CGPA 1G6NA 1WRJA 2EFQA 2HFHA 4U0WA 2HWVA 1WWXA 1T2KA 2NAZA 2QBYB 1O3RA 3OOPA 1P4XA 5J8CA 4IHSA 2RN7A 3V4GA 2A69F 2YSRA 2HS5A 3PQJA 1G4DA 1RUOA 3M8FA 4HLXA 1I5ZA 4HDVA 4I09A 3KP7A 3JAMZ 1U5TC 1SD6A 4RGXA 1ZARA 2KKOA 3FMSA 4CGZA 4QWQA 3WTXC 3IRQA 1BM9A 5E8IA 2R7FA 2CSOA 2EFNA 3BROA 5HVQC 1FP2A 1BI2A 3HOTA 1ON1A 1OR7A 3ISPA 3B73A 4YFNF 4EGYA 3T0YA 3MQ0A 4OMYA 3FHZA 3F8MA 3CO7C 2FBHA 5E17F 4PCQA 4L9TA 1HW5A 4NB5A 5ILSA 3BPVA 2LKPA 2EV0A 3BY6A 3FMQA 2ACJA 3GO5A 4XSXF 1YYVA 2JPCA 3HTSB 2K86A 2IJLA 1USTA 1TQIA 3GEZA 3QP6A 4PZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TDX A;  3QAH A;  2A61 A;  1O7L A;  2V9V A;  3VOE A;  3GXO A;  2FEZ A;  1LJ9 A;  4LJZ F;  3LQQ A;  3E97 A;  4RGS A;  2YX7 A;  3C18 A;  3GVA A;  3I53 A;  3E6B A;  2HTJ A;  4EGZ A;  3J81 Z;  2O6G E;  5JFR A;  1FBQ A;  4RS8 A;  5E20 A;  1Z9C A;  4I01 A;  5LGT A;  1BOA A;  2DQL A;  3F22 A;  4RB1 A;  5HS7 A;  3M9A A;  1BI0 A;  2X0L A;  5LGN A;  4XLP F;  3HRS A;  1BC7 C;  2P7C B;  1BBY A;  2ZCW A;  4UVA A;  4M72 A;  4OIO F;  3COA C;  3ULQ B;  1K6O A;  4M71 A;  2MLG A;  5JHU A;  1W5S A;  3B02 A;  2UZK A;  1B9M A;  3QOP A;  3JSP A;  4ETS A;  5DEQ A;  4ENK A;  5LEJ A;  2DQR A;  4M6X A;  4ZH4 F;  2CWE A;  4EJW A;  1FLI A;  2ZME A;  2ZFW A;  5D5W B;  1R36 A;  5ICE A;  2IT0 A;  4HV6 A;  2EFP A;  1S3J A;  3ZMS A;  3GZ5 A;  4M73 A;  4KIB A;  1JHF A;  3G73 A;  3WU0 A;  2KRF A;  2VBW A;  2KIU A;  1JXS A;  4UNO A;  2CO5 A;  4OU0 A;  1KU7 A;  5BPD A;  3SHF A;  4AVP A;  2K4B A;  4EVI A;  1JE8 A;  3TDZ C;  3WU1 B;  5FO5 A;  3KFW X;  3QP5 A;  2EFW A;  2Y75 A;  2OA4 A;  1USS A;  3CLO A;  1F9N A;  3LA3 A;  1B59 A;  1U8R A;  3U9G A;  2BE5 F;  3TQN A;  1TW3 A;  4CZZ A;  2PG4 A;  2F5E A;  1BJA A;  2XAF A;  4R1H A;  2W85 A;  1PP8 F;  4YIF A;  4GGG A;  2JRT A;  3TO9 A;  3H92 A;  4N9I A;  1FPQ A;  5AON A;  3H3Z A;  3F72 A;  3FXR A;  2FE3 A;  4HX8 A;  2A3S A;  5D8L B;  4E70 A;  2M45 A;  2QZ8 A;  1J0R A;  4ESJ A;  1Q1H A;  2GQQ A;  3VEP A;  3W6K B;  1O57 A;  1MDM A;  3DKW A;  4MTD A;  3O2P E;  3CTA A;  1JGS A;  4S05 A;  1OYY A;  2IA1 A;  3R6S A;  2OU2 A;  3I5U A;  2HEO A;  2M1B A;  1GXP A;  3Q9V A;  4G9Y A;  3FF5 A;  3WGG A;  5ERI A;  2H94 A;  4ZYG A;  1BI3 A;  2IW5 A;  3I64 A;  2QQB A;  3JTG A;  4I0A A;  3T8T A;  5K5R A;  1O3Q A;  3WTV C;  5BOX A;  4A5M A;  3KP2 A;  3FMR A;  1DDN A;  2C6Y A;  4RB0 A;  3FZV A;  1S7A A;  3FXQ A;  3V7R A;  3MAJ A;  3GFJ A;  5L3G A;  2DAO A;  2NS0 A;  2Z33 A;  5IT9 K;  5FFX A;  1TBX A;  2STT A;  4GO1 A;  5HS8 A;  4EJT A;  2XIG A;  4KIC A;  2MH2 A;  1MJA A;  4CHU A;  3BJA A;  1LEB A;  4LB6 B;  3FXU A;  1L0O C;  1XCV A;  3BWG A;  3M7G A;  1U3E M;  5ICF A;  4HQE A;  3IKT A;  4HQM A;  1SFX A;  1F4K A;  1FT9 A;  3ZMZ A;  2ZNZ A;  1V3F A;  4LFU A;  2K27 A;  1Z6T A;  3V7S A;  3GWZ A;  3HSE A;  2A6E F;  1FYL A;  4CXF A;  4OIQ F;  4A12 A;  4MEY F;  4BHP A;  3DEU A;  3D0S A;  4EQQ A;  1R00 A;  2F5C A;  3JTH A;  4HA8 A;  4Q48 A;  1R22 A;  4HX7 A;  4Y13 A;  1K78 A;  1B4A A;  4IVN A;  2GA1 A;  3K0L A;  2AS5 F;  3E6C C;  3WE2 A;  4KA4 A;  4YFX F;  2XAJ A;  5E8G A;  2OD5 A;  2QLZ A;  3WTZ A;  4L5I A;  2P5K A;  3ZMD A;  4P55 A;  2PI0 A;  2ESH A;  4DNC A;  2HZT A;  2EV5 A;  1ZG5 A;  3KLN A;  3AAF A;  1IAW A;  5LRS A;  4IRG A;  3GFM A;  1XN7 A;  3EQL F;  4ZZD A;  5LHI A;  3VB2 A;  3RYR A;  1HBX G;  3L9F A;  1KU9 A;  5FB2 A;  6PAX A;  3V8K A;  2IRF G;  1SD4 A;  1FOK A;  2WTE A;  1G3W A;  1FY7 A;  4ASN A;  2GAU A;  1I1G A;  4RB2 C;  3O6B B;  3ERE D;  4HF1 A;  5HLH A;  2YU3 A;  2VON A;  4M9S A;  3SQN A;  2QQA A;  2VBX A;  3TOA A;  3P7N A;  2HQN A;  4FHT A;  2H27 A;  1U5T B;  4A0X A;  4LG0 B;  1G3T A;  3VFZ A;  3RYP A;  2W24 A;  1HKT A;  5HOO A;  1Z1D A;  2WV0 A;  1XSD A;  5D6E A;  1J5Y A;  3WTY C;  4PGG A;  2DU9 A;  4GCV A;  1TQP A;  3BOQ A;  4UVB A;  3L09 A;  2STW A;  2J5O A;  1ULY A;  1FBU A;  4BYY A;  1R5H A;  4PDK A;  2RV8 A;  4IJA A;  1G3Y A;  2HR3 A;  3SZP A;  2EWN A;  4BNC A;  4M9X A;  4G7H F;  2FU4 A;  4CO8 A;  2K7L A;  3IWZ A;  4KFC A;  4MQV A;  3W6J B;  2PLY A;  2P5L C;  1ZN2 A;  5AIP A;  3GW2 A;  2FF4 A;  2W84 A;  3HSR A;  2O3F A;  2RKH A;  4TV7 A;  2MA3 A;  1GVJ A;  4RAZ A;  3DF8 A;  3EDP A;  2FMY A;  1DPR A;  1U5T A;  1FYK A;  4XSZ F;  4LG0 A;  5D8K B;  3P9C A;  4WXH A;  4BHB A;  3F21 A;  1J75 A;  2CW0 F;  1O7F A;  1XGS A;  2V1D A;  3WTU C;  1YW8 A;  3GUD A;  1HST A;  5HS9 A;  3ROU A;  2L3D A;  2FBI A;  1IF1 A;  2ISY A;  2HTS A;  3CDH A;  4EJO A;  3FX3 A;  1FNN A;  3TO7 A;  2RVC A;  1XCB A;  3CJN A;  4EM1 A;  1LVA A;  3E3V A;  3R60 A;  3L7W A;  3QU3 A;  2Q0O A;  3I0T A;  3V8J A;  2A68 F;  5CVV A;  2DI3 A;  2RQP A;  3I4P A;  4OIN F;  3E6M A;  2V1X A;  1Z91 A;  4EMS A;  3K9T A;  1WKM A;  1J9I A;  2VN2 A;  3V8L A;  1UFM A;  1P2F A;  4LLN A;  1ZG1 A;  4ZYE A;  3SXY A;  3CUQ B;  1ZGJ A;  1KA8 A;  5ILU A;  2X4H A;  3JSO A;  2ZKZ A;  3REO A;  4MEX F;  5L3C A;  3KEO A;  2ESN A;  4EM0 B;  2H6C A;  4ENM A;  5IT9 Z;  1G3S A;  1R5G A;  2OZU A;  5ICG A;  1TLH B;  3TGN A;  2F5D A;  3DP7 A;  4Q47 A;  4ENN A;  1CF7 A;  1FX7 A;  2HKO A;  2ZME B;  3LST A;  2UXX A;  1STZ A;  2ZBK A;  3L00 A;  3HTU A;  1ZAO A;  3KP4 A;  1W7P A;  3TKY A;  3MCZ A;  2EB7 A;  2QEN A;  5BQT A;  4WXC A;  3OV8 A;  4GYG A;  4HAM A;  2IA0 A;  3SZT A;  3HYI A;  2Y0M A;  1HW2 A;  1HKS A;  2A6H F;  1R1U A;  3Q5F A;  3CUQ C;  3ML6 A;  1BIB A;  1BC8 C;  2RC4 A;  1XB4 A;  3CUQ A;  3ZMV A;  1AWC A;  1I6X A;  1B9N A;  2EV6 A;  4EJV A;  4Z2Y A;  3ZN1 A;  5K1Y A;  2M5W A;  3S2W A;  2D1H A;  2PN6 A;  1R7J A;  1QZZ A;  4UV8 A;  1T6S A;  1YFH A;  2VXZ A;  2HYG D;  1RI7 A;  2JPB A;  2VE8 A;  2A5Y B;  1HQC A;  4N0B A;  3IHU A;  3ZMU A;  4KMU X;  2DO7 A;  3WTW C;  3J7A O;  4UVC A;  5ED4 A;  2RNJ A;  3ECO A;  1D8K A;  5FGM A;  2COM A;  1MDM B;  4RGU A;  5HDK A;  4KNY A;  1YLF A;  4P5O A;  2EFO A;  4I2O A;  3GX4 X;  3JW4 A;  2MC3 A;  2E1C A;  1XD7 A;  3IL2 A;  3R4K A;  3K1P A;  4M9Z A;  5LBQ A;  2JT1 A;  3HSF A;  1ZLK A;  3LAP A;  2LF8 A;  3DPL C;  3K1N A;  2DBB A;  1L3L A;  4KUM A;  4PGH A;  2HYF A;  1P6R A;  1EV7 A;  1DUX C;  3TO6 A;  1ONV A;  1ZHF A;  2YR2 A;  2PEX A;  3DQV C;  2Z3Y A;  2NNN A;  2QQ9 A;  2XAS A;  1ZRE A;  4K2E A;  1Z6R A;  1OPC A;  3WG9 A;  1UHW A;  3HHG A;  5TJJ A;  2KIM A;  4A5N A;  4UV9 A;  1KU2 A;  1PDN C;  4MHG A;  4Y17 A;  1MKM A;  2BYV E;  3R61 A;  2ZNY A;  1J59 A;  2L4A A;  1ZGA A;  1D5V A;  3GFI A;  1ZRF A;  1EH7 A;  2XAG A;  2Y48 A;  3NQO A;  1U6G A;  4XBF A;  2PFB A;  2K4J A;  4FX4 A;  1LQ1 A;  1QO0 D;  1LDK B;  3NEU A;  4JQF A;  3T8R A;  2PQ8 A;  2Q2E A;  3MZY A;  1HKQ A;  2ELH A;  3SFZ A;  4LK1 F;  1TNT A;  3FM3 A;  1KYW A;  2XUB A;  2V6C A;  1FSH A;  1QNT A;  3IWF A;  2XKP A;  2VOO A;  4LMY A;  2VE9 A;  1NHA A;  2XRO A;  3M1E A;  5H6Q A;  2DPD A;  4KN4 X;  5JR3 A;  5ICC A;  1XSV A;  3IRR A;  5D5X B;  1K78 B;  1U2W A;  4RB3 C;  2MH9 A;  4NHJ A;  3J80 K;  3RTR A;  5H6R A;  5D4S A;  3QPH A;  3BDD A;  2FNA A;  3ECH A;  5E1X A;  4EJU A;  5D5V B;  2LDU A;  1IN6 A;  1XGM A;  2CG4 A;  1P92 A;  4A0Y A;  1IN5 A;  3GYH X;  1P4A A;  1H9T A;  5KVR A;  3N97 A;  2VC1 A;  1E17 A;  3E5X A;  3KZZ A;  5CVJ A;  3WTS C;  4XRF A;  3HRU A;  2KIF A;  1QGP A;  2NNY A;  1LB2 A;  3WOD F;  2P4W A;  1O3S A;  3K69 A;  1A04 A;  3IC7 A;  3RJP A;  1FSE A;  5CJ9 A;  5FFZ A;  3BJ6 A;  2FNP A;  1V4R A;  2W25 A;  1OKR A;  5FLX K;  1F1Z A;  1XGO A;  4B09 A;  5D4R A;  1Y0U A;  2D2W A;  1I27 A;  4A6E A;  4I7H A;  5ILV A;  2E7X A;  1XDS A;  1DP7 P;  3DFG A;  1YW9 A;  2G7H A;  2H6B A;  2GXG A;  5LEK A;  2Q8K A;  4KIG A;  2AXL A;  4P9U A;  3U2R A;  2UXN A;  3LA2 A;  2GWR A;  2OQR A;  4ZZL A;  5TRD A;  1TQM A;  1X3U A;  5F64 A;  4LD5 A;  3PQK A;  2PMU A;  5L3D A;  3V7C A;  4S04 A;  3HRM A;  5LGU A;  5CLS A;  2FOK A;  4HLY A;  4U88 A;  2IPQ X;  3HIF A;  4ESF A;  2PMH A;  4ZYD A;  3ZPL A;  2DW4 A;  2E7W A;  3O3K A;  1MZB A;  4WWC A;  2CYY A;  4IXA A;  3RPQ A;  2V1U A;  1QZY A;  3FWE A;  5BPI A;  1KQ8 A;  2ZO4 A;  4RGR A;  3RKW A;  3KP3 A;  5DUK A;  4HX4 A;  4HYE A;  2QUF A;  1LDD A;  1WI9 A;  4D0P A;  1RNL A;  5DUI A;  4YFK F;  3HUG A;  1D8J A;  1J7K A;  5EEH A;  3MZH A;  4HF0 A;  4KYW A;  1S6L A;  1IXC A;  1S7O A;  2DK5 A;  1EH6 A;  2EA2 A;  2W57 A;  3ZQ7 A;  3KEQ A;  1SAX A;  3E5U A;  3BP8 A;  2QM3 A;  5K5O A;  2OQG A;  5CVI A;  2OZ6 A;  3NRV A;  1OYW A;  1SFE A;  4A2U A;  3PFI A;  1RUN A;  3ZN0 A;  4U7D A;  2D1V A;  2UWM A;  1LEA A;  3HHH A;  2HDC A;  2EA4 A;  4LLG F;  1R23 A;  2XAH A;  4OMZ A;  2MBF A;  4LLL A;  3F8N A;  2GXB A;  3I59 B;  2J5P A;  1H9G A;  1TNS A;  4FX0 A;  2M87 A;  4ON0 A;  5DV5 A;  1FP1 D;  4WX9 A;  3RPU A;  5D5U B;  1E2X A;  3GF2 A;  5LRR A;  3DV8 A;  2D45 A;  2NRA C;  4G94 A;  4MQ9 F;  2G9W A;  3I58 A;  5DCM A;  4I98 B;  1S8N A;  1K79 A;  2F2E A;  1QQI A;  4BH9 A;  5F6F A;  3U1D A;  3RKX A;  2DFI A;  5JI6 A;  1T39 A;  3ABT A;  1CF7 B;  2O8X A;  1IXS B;  1LDJ A;  2ETH A;  3IKV A;  2FML A;  1AOY A;  4HF2 A;  1C0W A;  5LHG A;  1YO5 C;  3WTT C;  4P9F A;  1IRG A;  4KN7 X;  2XHK A;  1W7P B;  4ZYH A;  2HOE A;  4OOI A;  5F1R A;  2HKX A;  3QPT A;  4ENJ A;  5AIQ A;  4AD9 A;  3RIR A;  1TW2 A;  1UHM A;  3EYI A;  3I59 A;  2GIV A;  3KLO A;  5KK1 A;  2EJR A;  4Q4Z F;  3F3X A;  4CYD A;  1SD5 A;  5DD8 A;  1QBJ A;  3F8C A;  1WSU A;  3F8B A;  1QPM A;  5L3E A;  2QBY A;  1I1S A;  3WGI A;  5DYM A;  2PJP A;  1F5T A;  3F6V A;  4BAY A;  4YII A;  1ZG3 A;  2FBK A;  1T0F A;  3I71 A;  4M74 A;  3KET A;  1ZLJ A;  2E1N A;  3C1D A;  4RAY A;  1R1V A;  3RI4 A;  2DT5 A;  1VTN C;  1RZ4 A;  4R8H A;  3J80 Z;  4LGW A;  2JZY A;  1XDU A;  2OAZ A;  1O3T A;  4L9J A;  3M8E A;  3R0J A;  3MEX A;  4NQW A;  1YG2 A;  1SFU A;  2VOD A;  2R3S A;  3KP5 A;  1YW7 A;  5DDG A;  1BN5 A;  1FWZ A;  2QVO A;  2NYX A;  4AWX B;  4HOB A;  4L0Y B;  1B6A A;  1K7A A;  3P9I A;  4KT5 C;  3BPX A;  2XGX A;  4Y15 A;  2V79 A;  1IZ1 A;  2CGP A;  4H0E A;  1JHH A;  4KIF A;  2FQ3 A;  3F6O A;  3KE2 A;  3LQR A;  3GZ6 A;  5FD6 A;  2RDP A;  2MD5 A;  1T98 A;  1OMI A;  1U78 A;  3LWF A;  1IN4 A;  3VOD A;  1Z7U A;  1T38 A;  4IHT A;  5FLX Z;  5A2Q K;  2O03 A;  4WXD A;  1HW1 A;  4P96 A;  1IRF A;  4XLN F;  4AIJ A;  3E5Q A;  1EH8 A;  3ZMT A;  3E6D A;  4R79 A;  3ABU A;  3I54 A;  2L4M A;  1YS7 A;  3TDU C;  1FC3 A;  4GXO A;  4JK1 X;  1GXQ A;  1W5T A;  4BHC A;  1REP C;  3KP6 A;  4I02 A;  2LNB A;  3CO6 C;  2VT3 A;  4IRI A;  1FBS A;  4U0Y A;  3KCC A;  4G6D A;  1FYM A;  5DCF A;  3T5X A;  2G7U A;  3C7J A;  2M8E A;  4HZF A;  5JVT A;  4G7O F;  3L2C A;  3MFK A;  4YG2 F;  2L54 A;  2VBZ A;  1KQ0 A;  4EV0 A;  3ELK A;  4O5V A;  3GLX A;  4WK8 F;  2HGC A;  1TTY A;  3RDI A;  4UHT A;  4FT8 A;  4AIK A;  3QU6 A;  5BMZ A;  2B0L A;  3G3Z A;  1ZRD A;  3K1M A;  1IXR C;  2XKO A;  4GYI A;  1MGT A;  4MGR A;  4LB5 A;  2ZJ2 A;  2FRH A;  5H20 A;  5J8F A;  3F8F A;  5D6F A;  1SMT A;  3F23 A;  1MJB A;  2VOP A;  3JAM K;  1H0M A;  1B1B A;  3DPT A;  4M6Y A;  3GFL A;  5HDN A;  2FXA A;  1IN8 A;  2DPU A;  3QRF F;  3LA7 A;  3FM5 A;  3LAJ A;  4L9N A;  2BV6 A;  3ZP5 A;  5EEG A;  2PBI A;  5IT3 A;  4KMF A;  2O61 A;  2BEO A;  2R7D A;  4B8X A;  1OYI A;  1UCR A;  4IF4 A;  1R1T A;  2L02 A;  2Z5U A;  3BZ6 A;  2IA2 A;  2DLL A;  5FD5 A;  1IUY A;  2OBP A;  2CFX A;  5DD4 A;  2HQR A;  1S29 A;  1Z05 A;  4EM2 A;  2P8T A;  2VBY A;  4L5J A;  1ODD A;  2WC2 A;  1KQ9 A;  2VC0 A;  3TOB A;  1IW7 F;  1HXD A;  2H09 A;  2EK5 A;  1PUE E;  4JBA A;  4MTE A;  2FSW A;  3CUO A;  4IPA A;  2YX4 A;  3WGH A;  2KJB A;  2BGC A;  4F7Z A;  2JTV A;  2QYO A;  2CQK A;  2P7V B;  4MNU A;  5K5Q A;  1ON2 A;  1W4M A;  1PP7 U;  3RKY A;  3P9K A;  4KDP A;  3HRT A;  2L01 A;  2XVC A;  1XGN A;  2LSO A;  3T1B A;  3BJO A;  2M30 A;  4HBL A;  2P5V A;  3K2Z A;  3KZY A;  3EET A;  3J81 K;  2IP2 A;  4IRH A;  4BXU A;  1IN7 A;  2P6S A;  3N4M A;  2A07 F;  2XV4 S;  5CYV A;  1HSJ A;  3D5L A;  1BI1 A;  4O6J A;  5CVR A;  4QLC U;  2VT2 A;  1XSX A;  4Q5S F;  4HV5 A;  4WCG A;  3C3W A;  4G8X A;  1MD0 A;  1WQ2 A;  1P4W A;  4BQA A;  2BBY A;  1YQA A;  4LK0 F;  2Z9O A;  1R58 A;  5E1W A;  4ESB A;  1FZP B;  2QWW A;  4OIR F;  5LHH A;  1KU3 A;  1XMA A;  2MLK A;  4CIC A;  4OIP F;  4HW0 A;  1ZH5 A;  1SD7 A;  2XRN A;  3EYY A;  1YTY A;  4A0Z A;  3WE3 A;  4O3M A;  1LNW A;  4I0B A;  1MJ9 A;  1RIO H;  2YPR A;  2LF7 A;  2Z99 A;  5BS6 A;  3Q9S A;  3HOS A;  2IVM A;  2KJC A;  4N9H A;  5L3B A;  4G7Z F;  2RGV A;  5HDG A;  2F5F A;  2ISZ A;  1D3Y A;  2K02 A;  2GA2 A;  4U7B A;  4UUV A;  1J2X A;  5A2Q Z;  2FA5 A;  2XAQ A;  2ADU A;  5L3F A;  2JSC A;  1YIO A;  4CDG A;  2WWY A;  4DQ2 A;  3H3U A;  3DXJ F;  5LLQ A;  2DTR A;  1BIA A;  3R0A A;  2GZW A;  5HLI A;  1UB9 A;  4U0V A;  2P6T A;  2DK8 A;  5DCM B;  4UXN A;  1DPU A;  4G6Q A;  1SMY F;  1GHC A;  5HLG A;  1KYZ A;  4L18 B;  5E1Z B;  4AIH A;  4L0Z B;  1YS6 A;  1KGS A;  5CVU A;  3LFK A;  5J6X A;  4L9V A;  1ZRC A;  2O0Y A;  3MWM A;  4A6D A;  1ZYR F;  1XMK A;  3EUH A;  5E18 F;  4WF2 A;  4HDU A;  1W7P D;  2ZXJ A;  1CGP A;  1G6N A;  1WRJ A;  2EFQ A;  2HFH A;  4U0W A;  2HWV A;  1WWX A;  1T2K A;  2NAZ A;  2QBY B;  1O3R A;  3OOP A;  1P4X A;  5J8C A;  4IHS A;  2RN7 A;  3V4G A;  2A69 F;  2YSR A;  2HS5 A;  3PQJ A;  1G4D A;  1RUO A;  3M8F A;  4HLX A;  1I5Z A;  4HDV A;  4I09 A;  3KP7 A;  3JAM Z;  1U5T C;  1SD6 A;  4RGX A;  1ZAR A;  2KKO A;  3FMS A;  4CGZ A;  4QWQ A;  3WTX C;  3IRQ A;  1BM9 A;  5E8I A;  2R7F A;  2CSO A;  2EFN A;  3BRO A;  5HVQ C;  1FP2 A;  1BI2 A;  3HOT A;  1ON1 A;  1OR7 A;  3ISP A;  3B73 A;  4YFN F;  4EGY A;  3T0Y A;  3MQ0 A;  4OMY A;  3FHZ A;  3F8M A;  3CO7 C;  2FBH A;  5E17 F;  4PCQ A;  4L9T A;  1HW5 A;  4NB5 A;  5ILS A;  3BPV A;  2LKP A;  2EV0 A;  3BY6 A;  3FMQ A;  2ACJ A;  3GO5 A;  4XSX F;  1YYV A;  2JPC A;  3HTS B;  2K86 A;  2IJL A;  1UST A;  1TQI A;  3GEZ A;  3QP6 A;  4PZJ A; 
#chains in the Genus database with same CATH topology
 1VQ4 I;  2TDX A;  4NBQ A;  3QAH A;  1XPX A;  5HLT A;  1E3O C;  4E7I A;  2E60 A;  3OYD A;  2A61 A;  3CMY A;  1O7L A;  4C9Y A;  5F08 A;  1VQO I;  2BVM A;  2V9V A;  4ANJ A;  3VOE A;  2MW8 A;  3GXO A;  2FEZ A;  2PJR A;  1LJ9 A;  4KT6 A;  4LJZ F;  3LQQ A;  3E97 A;  1JKR C;  4RGS A;  2YX7 A;  4RLF A;  4PJJ A;  1Y8R B;  3C18 A;  2QKM B;  3VWB A;  2F48 A;  1D5Y A;  3PNV A;  3GVA A;  4DZJ A;  2R0Q C;  3A1Y A;  3I53 A;  4IOC F;  3GTM J;  2TRT A;  2VPR A;  3HPH A;  3E6B A;  2A05 A;  2HTJ A;  4EGZ A;  3J81 Z;  2VQL A;  3K4L A;  2JK3 A;  4OAY A;  2O6G E;  2FQ4 A;  5JFR A;  1FBQ A;  1LKX A;  2DT7 B;  3IH4 A;  4RS8 A;  1VQN I;  3ZOB A;  3OIQ A;  5E20 A;  4XMY A;  2DMP A;  1K61 A;  2JN6 A;  1Z9C A;  4I01 A;  2AQF A;  1QRY A;  4RLQ A;  1JUP A;  1WH5 A;  4ABZ A;  5LGT A;  1BOA A;  2DQL A;  3F22 A;  2MGQ A;  2BHZ A;  4RB1 A;  5HS7 A;  2B7E A;  3HXL A;  3M9A A;  2WAQ A;  1BI0 A;  2X0L A;  4PFP A;  2QF7 A;  3DPU A;  1SFK A;  3C2H A;  3U1K A;  5LGN A;  4XLP F;  3HRS A;  3G6E I;  1BC7 C;  2P7C B;  1BBY A;  4JYK A;  4C3J J;  2ZCW A;  3K70 C;  4UVA A;  4M72 A;  4OIO F;  3COA C;  1V5F A;  2NVU B;  3ULQ B;  3AG3 H;  1K6O A;  2W48 A;  2L5Q A;  5F04 A;  4M71 A;  2MLG A;  4V2F A;  5JHU A;  1W5S A;  4XLA A;  3B02 A;  3GCM A;  2Y0S A;  2UZK A;  1TT5 B;  1B9M A;  1E3P A;  2AQE A;  3QOP A;  3JSP A;  4ETS A;  4HG2 A;  4YRV A;  2DXI A;  5DEQ A;  4DZP A;  4ENK A;  2DN0 A;  4MLO A;  4F93 B;  1T56 A;  2Z2S B;  5LEJ A;  3H9J A;  2DQR A;  4CCJ A;  5E3L A;  1T08 B;  1Q1V A;  4M6X A;  4ZH4 F;  2CWE A;  2ZME C;  1WJC A;  4EJW A;  1YJ9 I;  1FLI A;  2ZME A;  2ZFW A;  4F92 B;  5D5W B;  1R36 A;  1WVR A;  5ICE A;  5K7Z A;  1VQ7 I;  4HV6 A;  3CCU I;  2EFP A;  2IT0 A;  2WY8 Q;  2CUF A;  1S3J A;  3DLL F;  3U21 A;  1ZQ3 P;  3ZMS A;  3GZ5 A;  1QZE A;  3CD6 I;  4M73 A;  4KIB A;  1JHF A;  3G73 A;  4I76 A;  3WU0 A;  5GAH J;  2EIM H;  2KRF A;  3K6G A;  4IEJ A;  2LBF B;  2VBW A;  2VJI A;  2KIU A;  1JXS A;  2YU9 J;  5J3L A;  4UNO A;  4E7H A;  1ETV A;  2CO5 A;  2HU9 A;  4PK4 A;  5DS9 A;  1MBK A;  4OU0 A;  1EKE A;  1KU7 A;  1TT0 A;  5BPD A;  3DCF A;  1IDZ A;  3K10 A;  2DA4 A;  3SHF A;  4M3G A;  4NNJ A;  4AVP A;  2QSH X;  2K4B A;  4EVI A;  1JE8 A;  2CV0 A;  3TDZ C;  4A3M J;  3WU1 B;  2LKS A;  5FO5 A;  3KFW X;  1S7E A;  3E7L A;  3O8H A;  3QOE A;  3BLY A;  3QP5 A;  2EFW A;  2Y75 A;  2OA4 A;  1USS A;  3CLO A;  3PL8 A;  1F9N A;  1E0E A;  1EF4 A;  3LA3 A;  1B59 A;  1U8R A;  2ECC A;  3U9G A;  1LVK A;  2BE5 F;  1MH3 A;  2E71 A;  3TQN A;  2JVH A;  1TW3 A;  3FXJ A;  1JUS A;  3JRI A;  4CZZ A;  2PG4 A;  2AO9 A;  2F5E A;  3GTQ J;  1BJA A;  3PNY A;  4AVZ A;  2XAF A;  1OCT C;  4R1H A;  3DLA A;  2W85 A;  4OAZ A;  1Y1V J;  1PP8 F;  1SFO J;  4YIF A;  4GGG A;  3CCE I;  2VKH A;  3IH3 A;  2PMZ N;  2JRT A;  3LNQ A;  3TO9 A;  2DDB A;  3H92 A;  4N9I A;  1VI0 A;  1FPQ A;  5AON A;  3CCL I;  1TWG J;  3GTJ J;  3H3Z A;  5F0H A;  3F72 A;  2RAE A;  3FXR A;  2FE3 A;  2BW3 B;  4PJL A;  4HX8 A;  2A3S A;  5GTH C;  5J1Y A;  3F0C A;  5D8L B;  2VLA A;  2VKD A;  4E70 A;  2M45 A;  2QZ8 A;  2M9H A;  4ITV A;  2L7M P;  2CV1 A;  1J0R A;  2IS2 A;  4XOP A;  1ZGW A;  4ESJ A;  1Q1H A;  3HOX J;  1UMQ A;  2GQQ A;  3VEP A;  3W6K B;  2L9N A;  1O57 A;  3OWT A;  1MDM A;  3EUK L;  3DKW A;  4MTD A;  1U9N A;  3RKQ A;  3HOV J;  3O2P E;  3P5J A;  3CTA A;  2HXO A;  1X1B A;  3UR3 C;  4MFE A;  1HDD C;  2DJI A;  2OCC H;  1JGS A;  3DBL B;  3HDD A;  4S05 A;  1OYY A;  2IA1 A;  3R6S A;  1B72 B;  2OU2 A;  3I5U A;  5M5X J;  4RAG A;  3CMA I;  2E2H J;  2CUE A;  2HEO A;  4A3K J;  2M1B A;  1GXP A;  1Z3X A;  1QU3 A;  3Q9V A;  2ZSH B;  4G9Y A;  1WJE A;  3FF5 A;  3WGG A;  5ERI A;  1FMW A;  1I3A A;  2H94 A;  4C3H J;  4ZYG A;  1BI3 A;  2MD0 A;  4PJM A;  1Y0N A;  2KMU A;  1X1D A;  2M7A A;  2IW5 A;  4AUX A;  3I64 A;  2QQB A;  3B6C A;  1TL8 A;  3JTG A;  4I0A A;  2KFD A;  2VIX A;  4Y52 J;  4NUB A;  3T8T A;  5K5R A;  2I10 A;  9ANT A;  1IV8 A;  1O3Q A;  5EEA A;  3B6A A;  3WTV C;  3S3O A;  5BOX A;  1X4O A;  4A5M A;  2R7O A;  3H0G J;  3L2Q A;  4NC7 A;  3KP2 A;  2JUC A;  3IAS 2;  3FMR A;  2LRD A;  4C3I J;  5JHF A;  1DDN A;  5EZH A;  2E1O A;  2C6Y A;  4RB0 A;  2IS1 A;  1KZH A;  1Z21 A;  1S7A A;  3FXQ A;  3FZV A;  3V7R A;  2KLO A;  3MAJ A;  2MAB A;  3GFJ A;  4XLE A;  2V26 A;  5L3G A;  4PJN A;  2DAO A;  2NS0 A;  4CCO A;  1M1E B;  2Z33 A;  5IT9 K;  2K9M A;  5FFX A;  1V5G A;  1Y56 A;  1TBX A;  2STT A;  3BG5 A;  4GO1 A;  3WG7 H;  5HS8 A;  2JA5 J;  1XX5 A;  4EJT A;  2XIG A;  4KIC A;  2MH2 A;  4RAF A;  1MJA A;  3A01 A;  2R5Z B;  1MSF C;  2R7Z J;  4J19 A;  4CHU A;  3BJA A;  1LEB A;  3K4J A;  3LFU A;  4LB6 B;  4LOC A;  1BR2 A;  2XC7 A;  2FJ1 A;  3FXU A;  3S93 A;  3CP8 A;  1B72 A;  2NXN B;  2HQ5 A;  3FDY A;  1L0O C;  1X1P A;  1XCV A;  3BWG A;  3M7G A;  1U3E M;  5ICF A;  5IYB J;  4HQE A;  3CC2 I;  5JVG F;  5HNH A;  3QPS A;  1AHD P;  2VJ4 A;  2BY2 A;  2L9S A;  4B3A A;  3IKT A;  2X51 A;  4HQM A;  1P7J A;  1SFX A;  3A0H C;  4A3F J;  2CH0 A;  1H89 C;  2BZT A;  2X1C A;  2IGK A;  1F4K A;  1FT9 A;  4F55 A;  3ZMZ A;  2ZNZ A;  3CP2 A;  1V3F A;  2LY2 A;  5H2F C;  5FKO A;  4LFU A;  3S2H J;  2K27 A;  5CPR B;  2HI3 A;  1Z6T A;  1N75 A;  3V7S A;  3GWZ A;  1LPQ A;  3HSE A;  2W4S A;  1VQL I;  2A6E F;  2H1L A;  1RPW A;  4E7S A;  3CMM A;  1FYL A;  2XGC A;  4CXF A;  4XON A;  3RPU D;  4OIQ F;  4A12 A;  3OYB A;  4MEY F;  3L2R A;  3S8P A;  4BHP A;  1I3Q J;  2DA2 A;  3D0S A;  2WAF A;  3DEU A;  3HOY J;  1S9H A;  4EQQ A;  1R00 A;  2F5C A;  3HM5 A;  3JTH A;  4HA8 A;  4Q48 A;  1R22 A;  4HX7 A;  1HF0 A;  4Y13 A;  1K78 A;  1B4A A;  4IVN A;  3JCU C;  2IS6 A;  2GA1 A;  2RRE A;  3K0L A;  1UAA A;  4AYB A;  3TW7 A;  2AS5 F;  3E6C C;  3WE2 A;  4KA4 A;  4YFX F;  2XAJ A;  2H1K A;  5E8G A;  3LSR A;  2ME0 A;  3JR9 A;  2OD5 A;  3AL0 B;  2QLZ A;  4UUT A;  1DGW Y;  3WTZ A;  2R5Z A;  4L5I A;  2P5K A;  2IGM A;  3ZMD A;  4P55 A;  1E3H A;  2PI0 A;  1MMN A;  3CJQ B;  2ESH A;  2EZI A;  2CJJ A;  4DNC A;  2HZT A;  1R4M B;  2EV5 A;  1ZG5 A;  3KLN A;  3AAF A;  2XDV A;  4UY8 I;  1IAW A;  1Z3Y A;  5LRS A;  2DMU A;  4IRG A;  2WA0 A;  1CQT A;  3GFM A;  5IOZ A;  4BXX J;  5EG0 A;  1XN7 A;  2DYR H;  3EQL F;  3OL4 A;  2IEK A;  4ZZD A;  5LHI A;  1X1A A;  2XRL A;  2FX0 A;  3VB2 A;  1HOM A;  3RYR A;  1HBX G;  3EPZ A;  3L9F A;  1KU9 A;  5FB2 A;  3IAM 2;  2M0C A;  3ZQL A;  2D5V A;  6PAX A;  1MBF A;  3V8K A;  2IRF G;  2A5W A;  1SD4 A;  1FOK A;  2WTE A;  1FY7 A;  1G3W A;  4ASN A;  2GAU A;  3BQZ A;  3H35 A;  2QQ8 A;  5M3F J;  1I1G A;  1WJD A;  4FTH A;  4RB2 C;  3O6B B;  1PJR A;  2JMW A;  1APL C;  4C2U A;  3ERE D;  1BA5 A;  2HOS A;  4HF1 A;  4BQQ A;  5HLH A;  2YU3 A;  2VON A;  4M9S A;  4XRS G;  2DDA A;  3SQN A;  2QQA A;  2VBX A;  3X2Q H;  3TOA A;  3P7N A;  2HQN A;  3BR0 A;  3OYA A;  4FHT A;  2JQ7 A;  2H27 A;  3CCS I;  1P7I A;  1JKO C;  1U5T B;  2L7F P;  4A0X A;  4LG0 B;  1G3T A;  2CQX A;  2W7N A;  3VFZ A;  3BR2 A;  3RYP A;  2W24 A;  1HKT A;  1TC3 C;  5HOO A;  1SAU A;  2LVS A;  1Z1D A;  2WV0 A;  1XSD A;  5D6E A;  1J5Y A;  3FKI J;  5GAD J;  3GBG A;  1YI2 I;  1A6Q A;  4NC8 A;  3WTY C;  2K9Q A;  2M2E A;  4PGG A;  2DU9 A;  4GCV A;  2M34 A;  2VQH A;  2WAE A;  2TCT A;  1TQP A;  2IGN A;  2CQQ A;  3QYE A;  1VZ0 A;  3BOQ A;  4UVB A;  3HZJ A;  5E3O A;  2JVG A;  3H1C A;  2VJ5 A;  3JRB A;  4ZDO A;  3L09 A;  2STW A;  2J5O A;  1ULY A;  2F5V A;  1FBU A;  2JUG A;  4BYY A;  1NK3 P;  1R5H A;  4PDK A;  2RV8 A;  4IJA A;  3ABK H;  1G3Y A;  1OCC H;  2HR3 A;  3GTK J;  3SZP A;  2EWN A;  3O8G A;  4BNC A;  4M9X A;  4G7H F;  1X19 A;  2FU4 A;  4CSW A;  4CO8 A;  1SEU A;  1WJF A;  1A35 A;  2DFF A;  2K7L A;  3IWZ A;  4KFC A;  4MQV A;  2KQR A;  1JTX A;  3W6J B;  1OCR H;  2PLY A;  1OIS A;  3QWL A;  2P5L C;  1P9Q C;  1ZN2 A;  2B9S A;  1QHG A;  5AIP A;  1X1C A;  3GW2 A;  2LYC A;  3SZG A;  2FF4 A;  2W84 A;  3HSR A;  2JJ7 A;  3QYB A;  4E7Z A;  5C3E J;  3S15 J;  2O3F A;  2KZV A;  2RKH A;  4LG3 A;  4TV7 A;  2MA3 A;  5K7H A;  1GVJ A;  4RAZ A;  2IGO A;  3DF8 A;  2GM4 A;  1VND A;  3H0D A;  3EDP A;  2FMY A;  2R7U A;  3HOU J;  3VYT B;  1DPR A;  4AU7 A;  4BUP A;  1U5T A;  3HL2 A;  1FYK A;  1TWA J;  5HNF A;  4XSZ F;  4LG0 A;  3VSL A;  5D8K B;  3P9C A;  1T95 A;  3OS2 A;  1U9O A;  1BR4 A;  4WXH A;  4BHB A;  3F21 A;  2CW0 F;  2X85 A;  1O7F A;  1J75 A;  4BBR J;  1XGS A;  2V1D A;  1ETW A;  2WBM A;  3WTU C;  4D1Q A;  2PJR B;  2NVQ J;  1YW8 A;  3QOD A;  1DU6 A;  4V19 K;  5EZG A;  3GUD A;  1HST A;  4XLC A;  5HS9 A;  3ROU A;  2Y2Z A;  2L3D A;  3FBN B;  4UUS A;  2FBI A;  1IF1 A;  2ISY A;  4BAC A;  1TWC J;  2HTS A;  4JX6 A;  1G2H A;  1VQ8 I;  3CDH A;  4EJO A;  3FX3 A;  2CUJ A;  1FNN A;  3TO7 A;  3V42 A;  2RVC A;  1XCB A;  2F6C A;  1JKP C;  3CJN A;  1U8B A;  2ID6 A;  4EM1 A;  3RSN A;  3ZRG A;  3W3C A;  1LVA A;  3KEY A;  2ZXW H;  3E3V A;  1MW7 A;  1IGN A;  3R60 A;  4XRM A;  3L7W A;  3J7Z I;  1QHH D;  1MBE A;  3QU3 A;  4BE2 A;  2Q0O A;  3I0T A;  3V8J A;  3HJE A;  2A68 F;  5CVV A;  2DI3 A;  2RQP A;  3I4P A;  4OIN F;  3E6M A;  3GTG J;  2V1X A;  1Z91 A;  1D0Z A;  2XF6 A;  3K9T A;  4EMS A;  1GVD A;  1WKM A;  2IS4 A;  1D1C A;  4OWR B;  2PX9 A;  2VN2 A;  3H9G A;  3V8L A;  3JRA A;  4A3G J;  1UFM A;  1J9I A;  1P2F A;  4LLN A;  3JRH A;  4HEA 2;  4IL6 C;  1ZG1 A;  4ZYE A;  3SXY A;  3CUQ B;  2O7O A;  2BY0 A;  1IRX A;  1ZGJ A;  2FOW A;  1KA8 A;  2VKE A;  1ZTR A;  5ILU A;  2HNH A;  2X4H A;  3JSO A;  2ZKZ A;  3REO A;  2LTP A;  3OIO A;  1VQ9 I;  4MEX F;  5L3C A;  1U0J A;  3MZ8 A;  3KEO A;  3BQY A;  2QEX I;  2ESN A;  2KZG A;  3BR6 A;  4EM0 B;  1VQM I;  2XGD A;  2GBY A;  2M4K A;  2H6C A;  1BR1 A;  4NDL A;  3CCQ I;  4ENM A;  2CQ7 A;  4XN3 A;  5IT9 Z;  2EIL H;  4BJ6 C;  1G3S A;  1R5G A;  2CRG A;  2VI6 A;  2OZU A;  2XB5 A;  5ICG A;  1TLH B;  2ZB9 A;  1DU0 A;  1RKT A;  3TGN A;  2F5D A;  3DP7 A;  4Q47 A;  2AHQ A;  1W1W E;  2EQR A;  4ENN A;  1CF7 A;  1FX7 A;  2HKO A;  1F43 A;  2ZME B;  3LST A;  1K6Y A;  2UXX A;  3CQZ J;  1STZ A;  3IV5 A;  2M8G X;  3K4N A;  3HB9 A;  2ZBK A;  1D0X A;  3L00 A;  1YIT I;  3FIW A;  1FTT A;  3HTU A;  1ZAO A;  1W36 D;  3KP4 A;  1W7P A;  3TKY A;  5C4X J;  2DYS H;  3MCZ A;  2EB7 A;  3CLQ A;  2QEN A;  3VYR B;  5BQT A;  4WXC A;  3OV8 A;  4GYG A;  2NVX J;  4HAM A;  2LRE A;  2IA0 A;  3SZT A;  3HYI A;  4I6Z A;  5E79 C;  2Y0M A;  3OOU A;  4CYC B;  4YIR X;  2Y30 A;  2Y31 A;  1HW2 A;  1HKS A;  2LOO A;  2A6H F;  3PO2 J;  1QPI A;  1MMG A;  2K3P A;  1R1U A;  2CW8 A;  3Q5F A;  5FJ8 J;  2W00 A;  3CUQ C;  2P81 A;  3LSI A;  3ML6 A;  1BIB A;  3RQI A;  4C30 A;  4C2M J;  1BC8 C;  3S1R J;  2RC4 A;  4W1U A;  1XB4 A;  4BDY A;  3CUQ A;  3BR5 A;  3ZMV A;  1AWC A;  2XSD C;  1I6X A;  1I6H J;  1B9N A;  1OLT A;  2XPV A;  2EV6 A;  4EJV A;  4Z2Y A;  2V9P A;  3ZN1 A;  4II2 A;  3ZGK A;  5K1Y A;  2M5W A;  1OCZ H;  3ASN H;  3PFY A;  3JRC A;  3S2W A;  3CF5 F;  4YEL A;  2D1H A;  3FIS A;  4II3 A;  1UG0 A;  2PN6 A;  1FOY A;  2WV1 A;  1R7J A;  2K40 A;  1QZZ A;  2VUM J;  3BG3 A;  4UV8 A;  1R4N B;  1T6S A;  4XQF A;  1YFH A;  1Y8Q B;  2VXZ A;  2HYG D;  1RI7 A;  1T33 A;  2JPB A;  1POG A;  2VE8 A;  4HRI A;  2A5Y B;  1HQC A;  1ZEL A;  2V9K A;  4XKC A;  4N0B A;  2OF7 A;  3IHU A;  1YX5 A;  2LY9 A;  3UKG A;  4RMN A;  3ZMU A;  4KMU X;  3VSK A;  3CZ6 A;  2DO7 A;  4XKW A;  1X4P A;  3WTW C;  4Y3O A;  1WCM J;  3J7A O;  1WZ2 A;  4UVC A;  5ED4 A;  2RNJ A;  3ECO A;  4NC6 A;  1ERD A;  1D8K A;  2M3A A;  5FGM A;  2COM A;  4DGW B;  1MDM B;  4RGU A;  4ZTJ A;  2Y9Y A;  5HDK A;  3OIP A;  3JRE A;  1YLF A;  4KNY A;  3FK7 A;  1DGR M;  5CKT A;  4HNU A;  4CYC A;  4CCK A;  4P5O A;  2EFO A;  2EZH A;  4I2O A;  3GX4 X;  3JW4 A;  2MC3 A;  2E1C A;  3I3L A;  1XD7 A;  4BEH A;  3IL2 A;  3R4K A;  3K1P A;  4M9Z A;  2DCE A;  5LBQ A;  3PNT A;  2JT1 A;  3HSF A;  1ZLK A;  1MH4 A;  3LAP A;  2LF8 A;  3DPL C;  3K1N A;  2BXZ A;  2DBB A;  3KYC B;  4N4N B;  3SYT A;  1L3L A;  4KUM A;  4PGH A;  3KYD B;  2HYF A;  1RKW A;  2YUS A;  1P6R A;  5E3N A;  4E7J A;  2KP6 A;  1EV7 A;  1HDP A;  1DUX C;  3KYL A;  3TO6 A;  1ONV A;  1ZHF A;  2YR2 A;  2PEX A;  4QPQ A;  3DQV C;  2Z3Y A;  2DOA A;  2NNN A;  1YX3 A;  2EH3 A;  2XF7 A;  4V2G A;  2QQ9 A;  2XAS A;  5B3S H;  2OTJ I;  1ZRE A;  4K2E A;  5M3M J;  2KIQ A;  5IY5 H;  5J40 A;  5B66 C;  1Z6R A;  1OPC A;  3WG9 A;  1UHW A;  3HHG A;  4A3L J;  5TJJ A;  2KIM A;  4A5N A;  4UV9 A;  5GPC A;  1N78 A;  2E5N A;  4AC0 A;  5KAI C;  1KU2 A;  5IOY A;  4Y33 A;  4FIS A;  1GT0 C;  2KRH A;  1PDN C;  1UZC A;  4MHG A;  4Y17 A;  1MKM A;  2BYV E;  1WJ5 A;  2R7R A;  3R61 A;  1OJL A;  2ZNY A;  1J59 A;  2L4A A;  1ZGA A;  3ZQG A;  2V4J C;  4MIM A;  2KHM A;  2EZL A;  2DA7 A;  3ZQQ A;  4BXF A;  1D5V A;  2LH9 A;  4H4K C;  3GFI A;  1ZRF A;  3A03 A;  1EH7 A;  3A01 B;  2XAG A;  2Y48 A;  3NQO A;  1GLN A;  1U6G A;  4XLF A;  4XBF A;  2Z1D A;  2PFB A;  4FQG A;  2K85 A;  3TED A;  1NK2 P;  3HEF A;  2K4J A;  3W6V A;  4CA0 A;  4IZZ A;  3S2D J;  1PVE A;  4FX4 A;  1LQ1 A;  1QO0 D;  1LDK B;  3NEU A;  4JQF A;  3LSP A;  3T8R A;  2PQ8 A;  2Q2E A;  1MMS A;  3MZY A;  1K83 J;  4BJ5 C;  3OYL A;  4RM2 A;  1IO2 A;  3H5R A;  1HKQ A;  1LUJ B;  2ELH A;  4Y7N J;  2F4O B;  3SFZ A;  4LK1 F;  1TNT A;  3FM3 A;  1KYW A;  5DM6 F;  1YJW I;  2V6E A;  2XUB A;  3WHB A;  2V6C A;  1FSH A;  1QNT A;  4IHV A;  3HKZ N;  3IWF A;  2EZK A;  2XKP A;  2VOO A;  4QPO A;  5HOD A;  2BY3 A;  2LG4 A;  4LMY A;  2VE9 A;  3BR1 A;  1NHA A;  1TWH J;  3GME A;  2XRO A;  2R7X A;  3NAR A;  2ZJR F;  3M1E A;  5H6Q A;  2BOL A;  3DEE A;  3IH2 A;  2DPD A;  3SDG A;  1EJ9 A;  4KN4 X;  5JR3 A;  4XK4 A;  5ICC A;  3DTI A;  1XSV A;  1O4X A;  3IRR A;  2OC6 A;  5D5X B;  2NOJ B;  1K78 B;  3GTL J;  1U2W A;  2JSP A;  3L1P A;  4Y4R A;  4RB3 C;  3BZC A;  3I56 I;  2MH9 A;  4ZTF A;  1UG2 A;  4NHJ A;  3J80 K;  5BNG A;  2O5R A;  4XKV A;  3RTR A;  2DA5 A;  5H6R A;  5D4S A;  3QPH A;  3BDD A;  3OYI A;  3S1N J;  4FET A;  2CW7 A;  2FNA A;  3ECH A;  5CQG A;  5E1X A;  3S3N A;  4EJU A;  5D5V B;  4M3F A;  2LDU A;  1F36 A;  1ZK8 A;  1IN6 A;  1RC9 A;  2Z16 A;  1XGM A;  4FE4 A;  4CZC A;  1VFC A;  2CG4 A;  1MNM C;  1QVU A;  4XKB A;  1P92 A;  1I39 A;  3J7Y J;  2M7B A;  4A0Y A;  5E3M A;  2WB1 N;  3DEW A;  1IN5 A;  1OCP A;  3GYH X;  3A2K A;  1P4A A;  5EG0 B;  2CUZ A;  1S72 I;  3DKX A;  4DYR A;  1FIA A;  1H9T A;  5KVR A;  4ZC3 A;  2OPT A;  3N97 A;  1VQK I;  2VC1 A;  1E17 A;  3E5X A;  3KZZ A;  5CVJ A;  3WTS C;  2HXI A;  4XRF A;  3HRU A;  1LE8 A;  1H8A C;  2KIF A;  1QGP A;  3KX2 A;  2NNY A;  1MBH A;  1LB2 A;  2AXT C;  3WOD F;  2P4W A;  2A6T A;  2YS9 A;  1O3S A;  5TGT A;  5J47 A;  2Y69 H;  4UB8 C;  2O9L A;  3K69 A;  3KPH A;  1A04 A;  5IPA A;  3OYJ A;  3PUB A;  2OTL I;  1FIP A;  3IC7 A;  2DMT A;  1FSE A;  3RJP A;  3OYK A;  1HA8 A;  5CJ9 A;  4F52 A;  5F0C A;  1WJB A;  5KAF C;  5FFZ A;  3QQA A;  3BJ6 A;  1OQY A;  1V5E A;  1MNE A;  3H5N A;  4KJZ A;  4XM3 A;  2FNP A;  2KDZ A;  1V4R A;  2W25 A;  1OKR A;  2PMZ A;  5FLX K;  4FAS D;  3HUG B;  1F1Z A;  1XGO A;  4B09 A;  4BQO A;  2HDD A;  5D4R A;  2NOG A;  1Y0U A;  2D2W A;  3HC7 A;  1I27 A;  1VQ5 I;  4A6E A;  4I7H A;  5ILV A;  2E7X A;  4XN0 A;  1XDS A;  1MIJ A;  1DP7 P;  3CC7 I;  3DFG A;  3D5R C;  1XTA A;  4M6V A;  4X1E A;  5FKL A;  1YW9 A;  2G7H A;  1LFU P;  2NVY J;  2H6B A;  2GXG A;  5LEK A;  2Q8K A;  4KIG A;  2AXL A;  4P9U A;  3U2R A;  2UXN A;  3DBH B;  4GRI A;  3LA2 A;  2GWR A;  2OQR A;  3HGY A;  4ZZL A;  5TRD A;  1TQM A;  1X3U A;  2HPI A;  3M8J A;  1PUF B;  4F91 B;  3OSG A;  2V7F A;  5F64 A;  5EGO B;  4LD5 A;  2LKX A;  3C2B A;  3PQK A;  4AID A;  2PMU A;  2KRC A;  5L3D A;  3V7C A;  4S04 A;  3HRM A;  5LGU A;  5CLS A;  2FOK A;  3TW6 A;  3BG7 A;  4HLY A;  3K2A A;  4U88 A;  2IPQ X;  3BG6 A;  2R7T A;  3HIF A;  4ESF A;  2PMH A;  4ZYD A;  1XS9 A;  1BOB A;  3ZPL A;  2DW4 A;  3RCO A;  2L7Z A;  1A36 A;  2E7W A;  4JP0 A;  3O3K A;  1XG1 A;  2BXY A;  1RR7 A;  1MZB A;  3SDB A;  4WWC A;  2CYY A;  3LSJ A;  4IXA A;  5TIS C;  3RPQ A;  1W0U A;  2E35 A;  2V1U A;  1QZY A;  3FWE A;  4XOR A;  5BPI A;  1IUF A;  1GV5 A;  1KQ8 A;  4B1R A;  2VL8 A;  2ZO4 A;  3AFH A;  4RGR A;  3CCY A;  3RKW A;  2ECB A;  3HKZ A;  3KP3 A;  4QSH A;  4HX4 A;  4HYE A;  5DUK A;  2QUF A;  1LDD A;  5GP9 A;  1WI9 A;  3I4N J;  2L2O A;  4G12 A;  3AG4 H;  1FOX A;  2ELK A;  4D0P A;  3G71 I;  1RNL A;  5DUI A;  4YFK F;  3HUG A;  3NWT A;  1D8J A;  1J7K A;  5EEH A;  3MZH A;  3D5S C;  4HF0 A;  4KYW A;  4BU2 A;  1S6L A;  3FXK A;  2K9S A;  1IXC A;  1S7O A;  3K7A J;  4UUS B;  2DK5 A;  1EH6 A;  1Y6I A;  2EA2 A;  2W57 A;  3ZQ7 A;  3KEQ A;  1SAX A;  3MKZ A;  3E5U A;  3BP8 A;  2QM3 A;  2VPL A;  4RA2 A;  5K5O A;  2OQG A;  4PUS A;  2OZ6 A;  3C2G A;  1OYW A;  1SFE A;  3NRV A;  5CVI A;  4ZDP A;  3PFI A;  3H36 A;  4A2U A;  4BJT A;  1RUN A;  3ZN0 A;  3S16 J;  3M3Y J;  1ZR4 A;  4U7D A;  4J00 A;  4KIS A;  3IUO A;  1AKH B;  1BW5 A;  1FEX A;  4CCL A;  1PUF A;  2D1V A;  2E5Z A;  4QIW N;  2UWM A;  2QSG X;  1LEA A;  3HHH A;  3NAU A;  3EUH C;  2HDC A;  1TZL A;  5EGO A;  4FCY A;  2EA4 A;  4KIT B;  2R7S A;  1HC8 A;  4HNT A;  3SFI A;  4LLG F;  5GTI C;  1R23 A;  3VYU B;  2XAH A;  4OMZ A;  2MBF A;  4LLL A;  1EA3 A;  3LSG A;  2ZJP F;  3F8N A;  2GXB A;  2MC4 A;  3CCR I;  3I59 B;  4A3D J;  2J5P A;  3AG1 H;  3MKY B;  2LC2 A;  2WAQ N;  1H9G A;  5IYC J;  1TNS A;  1D1A A;  4FX0 A;  3AKZ A;  2M87 A;  4RDU A;  4ON0 A;  5DV5 A;  3Q0V A;  2VQG A;  3E1S A;  2DFE A;  1FP1 D;  4WX9 A;  3F9K A;  3RPU A;  3OS0 A;  3M1C A;  5FRM A;  5D5U B;  2P0W A;  1E2X A;  2QKL B;  3GF2 A;  2IBD A;  3DV8 A;  5LRR A;  3ERM A;  4BY1 J;  2D45 A;  1SVM A;  2NRA C;  2I8D A;  3A02 A;  4G94 A;  2M4G A;  4MQ9 F;  1H88 C;  1MBJ A;  3K70 D;  2G9W A;  3TP0 A;  3I58 A;  5DCM A;  4I98 B;  1S8N A;  1K79 A;  3RQ4 A;  3M07 A;  2DJN A;  4UB6 C;  2E1M C;  2F2E A;  5FKK A;  1QQI A;  4BH9 A;  3W2W A;  5F6F A;  3U1D A;  3RKX A;  2DFI A;  5JI6 A;  1T39 A;  3ABT A;  3ZXS A;  1CF7 B;  2K3F A;  2O8X A;  4M3E A;  4IOA F;  1IXS B;  1LDJ A;  1ETK A;  2DOE A;  2ETH A;  2OUM A;  2FML A;  1JT6 A;  3IKV A;  1AOY A;  4HF2 A;  2Q1Z B;  1AKH A;  1C0W A;  5LHG A;  1YO5 C;  3OYG A;  2ZFU A;  4P9F A;  3WTT C;  1IRG A;  4KN7 X;  2XHK A;  1W7P B;  4ZYH A;  2HOE A;  3JRF A;  5GAE J;  3BTC A;  4OOI A;  3NWS A;  2HKX A;  5F1R A;  3PM1 A;  3QPT A;  4JOM A;  4B4C A;  3G1L A;  2G0E A;  2VAS A;  4ENJ A;  1R6R A;  1A31 A;  4X0G A;  1RES A;  2NS7 A;  5AIQ A;  4RBO A;  2DOD A;  4AD9 A;  3HBL A;  3RIR A;  1YHQ I;  1TW2 A;  2GOM A;  1DQU A;  1UHM A;  1YRN B;  3EYI A;  3I59 A;  2GIV A;  3KLO A;  4DYQ A;  3CCV I;  5KK1 A;  2EJR A;  2UV1 A;  3PJR A;  1IRZ A;  4Q4Z F;  2K9L A;  3MVP A;  3IP4 B;  5EF6 A;  3F3X A;  4CYD A;  2LY1 A;  5DD8 A;  1QBJ A;  3F8C A;  1WSU A;  3F8B A;  1PYV A;  1QPM A;  4G6T B;  2IXS A;  5L3E A;  2JRM A;  2QBY A;  1I1S A;  4XLH A;  1JJ8 C;  2NVT J;  3WGI A;  3I9V 2;  5C44 J;  5DYM A;  2PJP A;  3JRG A;  1T0F C;  3PSI A;  1F5T A;  3F6V A;  1JUM A;  4BAY A;  4YII A;  1ZG3 A;  1GDT A;  2FBK A;  5EYR A;  4ZDL A;  3OYH A;  1T0F A;  3I71 A;  2W1O A;  1ZKG A;  3FHN A;  4M74 A;  3H5A A;  3KET A;  2KDO A;  4LIT A;  2QCO A;  1ZLJ A;  2E1N A;  4W97 A;  3C1D A;  2HDW A;  4RAY A;  4PSW A;  1R1V A;  3RI4 A;  3M4O J;  2DT5 A;  1VTN C;  1RZ4 A;  4E7L A;  4R8H A;  3J80 Z;  4LGW A;  2JZY A;  4EEF G;  1XDU A;  1UEL B;  1JI8 A;  2OAZ A;  1O3T A;  4L9J A;  3E0J B;  3M8E A;  3R0J A;  3MEX A;  4NQW A;  3MD2 A;  1ORK A;  1XC5 A;  1YG2 A;  1SFU A;  2VOD A;  4IQJ A;  2R3S A;  3KP5 A;  1YW7 A;  5DDG A;  3G2B A;  3OYN A;  2ZXI A;  4BKX A;  4PFO A;  2CQN A;  1BN5 A;  1FWZ A;  2QVO A;  2NYX A;  3QP6 A;  4AWX B;  3L2V A;  3S1M J;  2GXA A;  4HOB A;  4L0Y B;  4B44 A;  2EIJ H;  1B6A A;  1K7A A;  3P9I A;  4KT5 C;  4HPQ A;  5J4V A;  3BPX A;  2XGX A;  4E4H A;  3ZQH A;  1ETO A;  4Y15 A;  5KHD A;  2V79 A;  2LP0 A;  1IZ1 A;  1YRN A;  2CGP A;  1RRJ A;  4H0E A;  1IV6 A;  1QVT A;  1JHH A;  4BEH B;  3WU2 C;  4KIF A;  4HNV A;  5M5W J;  3FKJ A;  3BTI A;  3MN2 A;  2DA6 A;  2FQ3 A;  3F6O A;  3KE2 A;  2CMP A;  3LQR A;  4ZJZ A;  3GZ6 A;  5JLX A;  5FD6 A;  2RDP A;  3OR2 C;  3D1N I;  2MD5 A;  2X6X A;  1JGG A;  1T98 A;  2UUZ A;  1OMI A;  2DT6 A;  1U78 A;  3LWF A;  2COB A;  4D5F A;  4BGD A;  1IN4 A;  3TMO A;  3VOD A;  1Z7U A;  1T38 A;  2ELJ A;  3G1O A;  3HOZ J;  1YOV B;  3VPR A;  5KNL A;  4XNF A;  4XIC A;  5LD2 C;  4IHT A;  5FLX Z;  5A2Q K;  2O03 A;  1IC8 A;  3FXO A;  4I99 C;  4WXD A;  2HOT A;  1OFC X;  1HW1 A;  4P96 A;  3GTO J;  1IRF A;  1WH7 A;  5CQE A;  4XLN F;  1MSE C;  4AIJ A;  3E5Q A;  1EH8 A;  2KPM A;  3ZMT A;  4IX7 A;  3E6D A;  4BQN A;  4R79 A;  3ABU A;  3I54 A;  2L4M A;  1D0Y A;  1IG7 A;  5EJC A;  1YS7 A;  3TDU C;  1FC3 A;  4GXO A;  4D9J A;  4ZYA A;  4JK1 X;  1GXQ A;  1W5T A;  4BHC A;  1REP C;  3KP6 A;  4I02 A;  2LNB A;  4XL9 A;  3CO6 C;  2VT3 A;  3TP3 A;  1SC7 A;  4DJA A;  2QGU A;  2H8W A;  1FBS A;  4U0Y A;  4IRI A;  3KCC A;  4G6D A;  1FYM A;  2DMN A;  5DCF A;  3T5X A;  2G7U A;  3LSH A;  1R5I D;  2ZC2 A;  3AG2 H;  3C7J A;  2M8E A;  2OJE D;  4E7K A;  4GFB A;  4HZF A;  3EUA A;  5JVT A;  2LLK A;  2BY1 A;  4G7O F;  3L2C A;  3MFK A;  4YG2 F;  3CDI A;  2L54 A;  2VBZ A;  1KQ0 A;  4EV0 A;  1N25 A;  1WJA A;  3ELK A;  4O5V A;  3N05 A;  3GLX A;  3LOC A;  4DBR A;  4WK8 F;  4IHY A;  1QA6 A;  2Q2E B;  2WY7 Q;  3K4K A;  3SEQ A;  2GIZ A;  2HGC A;  3FXL A;  1TTY A;  2JA2 A;  1FTZ A;  1BJZ A;  3CJT B;  2DA3 A;  4UHT A;  3RDI A;  4FT8 A;  2XAU A;  4AIK A;  1IJW C;  3QU6 A;  4M3D A;  3H9Q A;  5BMZ A;  3FBI B;  1N77 A;  1K4T A;  3ZR8 X;  1RR8 C;  1A5J A;  2B0L A;  3CJR B;  4A3E J;  2OV7 A;  3G3Z A;  4D7N A;  5FLV A;  3QYF A;  1ZRD A;  3K1M A;  2XPW A;  2R5Y B;  1IXR C;  2XKO A;  1J09 A;  3ASO H;  4A93 J;  4GYI A;  1OCO H;  5F0F A;  1MGT A;  4MGR A;  2O8K A;  4LB5 A;  2ZJ2 A;  4B43 A;  2FRH A;  3BCA A;  5H20 A;  2V1N A;  4XOT A;  3S14 J;  5J8F A;  2QSF X;  3F8F A;  2R7V A;  2X48 A;  5D6F A;  4PJ0 C;  1SMT A;  3CES A;  2CFO A;  3BG9 A;  3F23 A;  1MJB A;  2VOP A;  1VF9 A;  4EAT A;  1W36 C;  1FOW A;  2LFB A;  3JAM K;  1H0M A;  3ZQC A;  1B1B A;  3DPT A;  4M6Y A;  3S32 A;  4AYB N;  5B1A H;  3GFL A;  5HDN A;  2GOX B;  2BHY A;  2FXA A;  2XGE A;  2HOA A;  1T8I A;  1IN8 A;  2K9N A;  3OS1 A;  2OCE A;  2FD5 A;  1X58 A;  3PIO F;  3QRF F;  2DPU A;  5C4J J;  3LA7 A;  1MMA A;  3FM5 A;  3GZN B;  3LAJ A;  3A0B C;  1ITY A;  4L9N A;  1IDY A;  2BV6 A;  3ZP5 A;  5EEG A;  2PBI A;  2VXD A;  3BT9 A;  5IT3 A;  2ZXH A;  4KMF A;  2O61 A;  1WI3 A;  2BEO A;  2R7D A;  3RZO J;  4B8X A;  1SVL A;  3DBR B;  2E2J J;  3LMM A;  1OYI A;  2LBF A;  1Z77 A;  1UCR A;  4IF4 A;  3KZI C;  2H8R A;  2VQC A;  2EIN H;  1R1T A;  2L02 A;  2Z5U A;  2JA7 J;  3BZ6 A;  1TWF J;  2IA2 A;  2XSJ C;  3LSM A;  5FRN A;  2R92 J;  2DLL A;  5FD5 A;  4HST A;  3OYC A;  1JT0 A;  1LE8 B;  1IUY A;  1YIJ I;  5FKN A;  3HG9 A;  1AU7 A;  2X6W A;  2OBP A;  3OL3 A;  3CCM I;  2CFX A;  2R5Y A;  5DD4 A;  1WFX A;  1BW6 A;  2HQR A;  1S29 A;  1YE9 A;  1Z05 A;  3JRD A;  4EM2 A;  2P8T A;  2VBY A;  1VQP I;  3VDX A;  4XRS A;  4L5J A;  4HSR A;  1ODD A;  2IAI A;  3Q3S A;  4XR6 A;  5DM7 F;  1WGX A;  2WC2 A;  1KQ9 A;  2VC0 A;  3TOB A;  4B3X A;  1IW7 F;  3LL7 A;  1KON A;  2R7W A;  1HXD A;  2H09 A;  2EK5 A;  1PUE E;  3DTK A;  4JBA A;  5DTD A;  1HCR A;  1NG7 A;  2HVR A;  4MTE A;  2MYS A;  4M3B A;  5IP6 A;  1JJ6 C;  2FSW A;  3CUO A;  4IPA A;  2YX4 A;  3WGH A;  2KJB A;  3QPL A;  2BGC A;  3PO3 J;  3ZCO A;  3HOW J;  3CF2 A;  3S3M A;  4F7Z A;  2JTV A;  2QYO A;  5B1B H;  1AA7 A;  3BR3 A;  4S0H B;  1R9T J;  2BW3 A;  2CQK A;  3H3V K;  2P7V B;  2K5C A;  4P1W A;  1Z0X A;  3PIP F;  4MNU A;  3OYE A;  5K5Q A;  2VB6 A;  5GPA A;  2MFZ A;  1ON2 A;  4B48 A;  1W4M A;  5J1U A;  3S1Q J;  3K4M A;  2M0M A;  1PP7 U;  4J01 A;  3RKY A;  3P9K A;  4KDP A;  3HRT A;  3VYS B;  2E2I J;  2L01 A;  2B63 J;  2XVC A;  1XGN A;  2LSO A;  3T1B A;  1ZR2 A;  3BJO A;  3G1M A;  4A3B J;  2M30 A;  4HBL A;  2P5V A;  2QA4 I;  3BC8 A;  3K2Z A;  3KZY A;  3EET A;  3K4C A;  2VJJ A;  3J81 K;  2IP2 A;  4IRH A;  2ICW G;  4BXU A;  1IN7 A;  2P6S A;  3BTJ A;  3LSK A;  5IP7 J;  3N4M A;  2A07 F;  2XV4 S;  1S5L C;  5CYV A;  4QTR A;  2F4I A;  3MMY B;  5EDN A;  2ME6 A;  1HSJ A;  3OMY A;  1G8X A;  3D5L A;  1BI1 A;  4O6J A;  3CDL A;  3ZQI A;  5CVR A;  4QLC U;  2VT2 A;  1XSX A;  4Q5S F;  4HV5 A;  1ETX A;  3BZK A;  4WCG A;  1DP3 A;  3C3W A;  4G8X A;  1MD0 A;  1WQ2 A;  1FMV A;  2E36 A;  1I50 J;  1X2N A;  1P4W A;  1WPK A;  1FJL A;  3PUF A;  4BQA A;  2BBY A;  3TL4 X;  3FK6 A;  1YQA A;  4LK0 F;  2Z9O A;  1R58 A;  2XB0 X;  3OR1 C;  4BDZ A;  4CUG A;  2X6O A;  3MKW B;  5E1W A;  1SAN A;  3RZD J;  4ESB A;  1FZP B;  2QWW A;  4B47 A;  4OIR F;  5LHH A;  1KU3 A;  1XMA A;  2MLK A;  3MKL A;  1G59 A;  4CIC A;  4OIP F;  4HW0 A;  2XF5 A;  1ZH5 A;  1SD7 A;  2XRN A;  3EYY A;  1YTY A;  4IQ4 A;  4A0Z A;  3WE3 A;  4O3M A;  1LNW A;  4I0B A;  4L5E A;  1MJ9 A;  1SVO A;  1RIO H;  2YPR A;  4CCM A;  2LF7 A;  2Z99 A;  5BS6 A;  2LMD A;  3Q9S A;  2VKV A;  3HOS A;  3CC4 I;  2IVM A;  2HQA A;  2KJC A;  4N9H A;  2WAD A;  4C2T A;  5L3B A;  1XMX A;  4G7Z F;  3DTE A;  2RGV A;  5HDG A;  4LIV A;  3DU6 A;  4JX4 A;  4GDF A;  3ZQF A;  2DTZ A;  3L2W A;  1VQ6 I;  2F5F A;  5FKM A;  2ISZ A;  4IHW A;  1D3Y A;  2HYJ A;  2K02 A;  1ETY A;  2GA2 A;  4U7B A;  5FRO A;  4BBS J;  2LK2 A;  4UUV A;  4BE1 A;  3DU5 A;  1J2X A;  3PSF A;  3UNG C;  5A2Q Z;  3W2V A;  1W0T A;  2FA5 A;  2XAQ A;  2ADU A;  4MFD A;  5FLM J;  1YJN I;  5L3F A;  4RM3 A;  2NS8 A;  3I4M J;  2RQQ A;  3G4S I;  5J1R A;  2JSC A;  1YIO A;  4CH7 A;  4CDG A;  2CS3 A;  2X1D A;  3ABM H;  2F4M B;  2WWY A;  1RET A;  4DQ2 A;  3H3U A;  3DXJ F;  2DOF A;  5LLQ A;  1TP4 A;  1R71 A;  1R49 A;  3OYF A;  4BL0 B;  2DTR A;  1BIA A;  1X3W B;  3BTL A;  4F3Q A;  2CV2 A;  3R0A A;  2GZW A;  2HVS A;  2KIS A;  5HLI A;  1UB9 A;  4U0V A;  2P6T A;  2DK8 A;  1BL0 A;  5DCM B;  4DW6 A;  3CCJ I;  2ZJQ F;  4UXN A;  2L0K A;  1DPU A;  4G6Q A;  4IO9 F;  1SMY F;  1GHC A;  3SEZ A;  1Z67 A;  2ZSI B;  5HLG A;  2E1M B;  1KYZ A;  4L18 B;  4D7M A;  3SJM A;  5E1Z B;  2Y9Z A;  3AL0 C;  4BY7 J;  4AIH A;  4L0Z B;  2MG4 A;  1YS6 A;  1KGS A;  5CVU A;  4A69 C;  2BVL A;  3LFK A;  5J6X A;  4Z6Y A;  1MND A;  2CU7 A;  4L9V A;  3A4C A;  3CME I;  1ZRC A;  2N8G A;  2O0Y A;  3MWM A;  4A6D A;  2R93 J;  1ZYR F;  1W5C C;  1XMK A;  5IP9 J;  3EUH A;  2JA6 J;  1HLV A;  3TBI A;  2X1E A;  3I55 I;  1GUU A;  5E18 F;  4WF2 A;  4HDU A;  1W7P D;  3K4B A;  2ZXJ A;  1CGP A;  2DFH A;  3BCB A;  2WB1 A;  1ETQ A;  1B8I B;  1G6N A;  2DMQ A;  1WRJ A;  2HPM A;  1LFP A;  2EFQ A;  2HFH A;  4U0W A;  4BE0 A;  1GV2 A;  2HWV A;  1WWX A;  3GLL A;  2KT0 A;  1T2K A;  5GAG J;  3HPG A;  4CCN A;  2EPF A;  2NAZ A;  3OSF A;  1MMD A;  4A3I J;  2QBY B;  1K4S A;  4LIU A;  1O3R A;  3OOP A;  1P4X A;  4E6K G;  4A3C J;  3OYM A;  5J8C A;  4IHS A;  2RN7 A;  4U87 A;  3V4G A;  4FE7 A;  3ESW B;  1X3Z B;  2A69 F;  2I5U A;  3Q0U A;  2YSR A;  5F27 A;  2Y0S N;  2HS5 A;  4MO7 A;  2KL4 A;  3PQJ A;  1G4D A;  1RUO A;  3Q0W A;  3M8F A;  3WHC A;  4HLX A;  1I5Z A;  4D5C A;  3DWL E;  4HDV A;  4I09 A;  3KP7 A;  3L2U A;  4DBQ A;  3JAM Z;  1U5T C;  1UHS A;  3DKY A;  1SD6 A;  1V55 H;  4RGX A;  1ZAR A;  2XPU A;  2KKO A;  3FMS A;  4XID A;  2X9D A;  2RNG A;  2X6Y A;  5M5Y J;  4QWQ A;  4CGZ A;  2JWT A;  1NG6 A;  3WTX C;  3IRQ A;  4JX5 A;  1BM9 A;  4BS9 A;  4NQW B;  5E8I A;  2R7F A;  2CSO A;  2EFN A;  3BRO A;  5HVQ C;  1OR7 C;  2HZD A;  1FP2 A;  1NTC A;  1BI2 A;  3OY9 A;  3HOT A;  1ON1 A;  2ID3 A;  1OR7 A;  1NH3 A;  2MSY A;  3ISP A;  3B73 A;  5KCM A;  3HGG A;  1LFB A;  4YFN F;  1Y39 A;  4EGY A;  4A3J J;  3T0Y A;  3MQ0 A;  2LR8 A;  4OMY A;  3FHZ A;  3F8M A;  3S17 J;  4IKF A;  1UJ8 A;  2L7K A;  1ACI A;  1D1B A;  3FXM A;  2W82 A;  2FBH A;  3ABL H;  3CO7 C;  1Y1W J;  5E17 F;  4PCQ A;  1B8I A;  4PSX A;  5F1J A;  4L9T A;  3KIO A;  1HW5 A;  1WHU A;  2EIK H;  1ENH A;  1JKQ C;  2EBI A;  4NB5 A;  3W2A A;  4X6A J;  4DOZ A;  5IYD J;  5ILS A;  2GLO A;  3ONQ A;  1V54 H;  3BPV A;  2LKP A;  5JLW A;  2LD5 A;  4AM3 A;  2EV0 A;  3GTP J;  1Z7L A;  5J4Y A;  1MBG A;  3BY6 A;  4IHX A;  2E34 A;  2R7Q A;  2DA1 A;  3FMQ A;  4YEJ A;  4N4O B;  2ACJ A;  3GO5 A;  4DIQ A;  4XSX F;  2FUG 2;  1JTY A;  2HVQ A;  5K7F A;  1YYV A;  2E19 A;  2JPC A;  2JA8 J;  2L9R A;  2L9V A;  3HTS B;  2R4G A;  2K86 A;  1A6I A;  2IJL A;  5LFA A;  1UST A;  4DYC A;  5B5E C;  3J7A Y;  1TQI A;  3GEZ A;  1X2M A;  1SD5 A;  4PZJ A; 
#chains in the Genus database with same CATH homology
 2TDX A;  3QAH A;  2A61 A;  1O7L A;  2V9V A;  3VOE A;  3GXO A;  2FEZ A;  1LJ9 A;  4LJZ F;  3LQQ A;  3E97 A;  4RGS A;  2YX7 A;  3C18 A;  3GVA A;  3I53 A;  3E6B A;  2HTJ A;  4EGZ A;  3J81 Z;  2O6G E;  5JFR A;  1FBQ A;  4RS8 A;  5E20 A;  1Z9C A;  4I01 A;  5LGT A;  1BOA A;  2DQL A;  3F22 A;  4RB1 A;  5HS7 A;  3M9A A;  1BI0 A;  2X0L A;  5LGN A;  4XLP F;  3HRS A;  1BC7 C;  2P7C B;  1BBY A;  2ZCW A;  4UVA A;  4M72 A;  4OIO F;  3COA C;  3ULQ B;  1K6O A;  4M71 A;  2MLG A;  5JHU A;  1W5S A;  3B02 A;  2UZK A;  1B9M A;  3QOP A;  3JSP A;  4ETS A;  5DEQ A;  4ENK A;  5LEJ A;  2DQR A;  4M6X A;  4ZH4 F;  2CWE A;  4EJW A;  1FLI A;  2ZME A;  2ZFW A;  5D5W B;  1R36 A;  5ICE A;  2IT0 A;  4HV6 A;  2EFP A;  1S3J A;  3ZMS A;  3GZ5 A;  4M73 A;  4KIB A;  1JHF A;  3G73 A;  3WU0 A;  2KRF A;  2VBW A;  2KIU A;  1JXS A;  4UNO A;  2CO5 A;  4OU0 A;  1KU7 A;  5BPD A;  3SHF A;  4AVP A;  2K4B A;  4EVI A;  1JE8 A;  3TDZ C;  3WU1 B;  5FO5 A;  3KFW X;  3QP5 A;  2EFW A;  2Y75 A;  2OA4 A;  1USS A;  3CLO A;  1F9N A;  3LA3 A;  1B59 A;  1U8R A;  3U9G A;  2BE5 F;  3TQN A;  1TW3 A;  4CZZ A;  2PG4 A;  2F5E A;  1BJA A;  2XAF A;  4R1H A;  2W85 A;  1PP8 F;  4YIF A;  4GGG A;  2JRT A;  3TO9 A;  3H92 A;  4N9I A;  1FPQ A;  5AON A;  3H3Z A;  3F72 A;  3FXR A;  2FE3 A;  4HX8 A;  2A3S A;  5D8L B;  4E70 A;  2M45 A;  2QZ8 A;  1J0R A;  4ESJ A;  1Q1H A;  2GQQ A;  3VEP A;  3W6K B;  1O57 A;  1MDM A;  3DKW A;  4MTD A;  3O2P E;  3CTA A;  1JGS A;  4S05 A;  1OYY A;  2IA1 A;  3R6S A;  2OU2 A;  3I5U A;  2HEO A;  2M1B A;  1GXP A;  3Q9V A;  4G9Y A;  3FF5 A;  3WGG A;  5ERI A;  2H94 A;  4ZYG A;  1BI3 A;  2IW5 A;  3I64 A;  2QQB A;  3JTG A;  4I0A A;  3T8T A;  5K5R A;  1O3Q A;  3WTV C;  5BOX A;  4A5M A;  3KP2 A;  3FMR A;  1DDN A;  2C6Y A;  4RB0 A;  3FZV A;  1S7A A;  3FXQ A;  3V7R A;  3MAJ A;  3GFJ A;  5L3G A;  2DAO A;  2NS0 A;  2Z33 A;  5IT9 K;  5FFX A;  1TBX A;  2STT A;  4GO1 A;  5HS8 A;  4EJT A;  2XIG A;  4KIC A;  2MH2 A;  1MJA A;  4CHU A;  3BJA A;  1LEB A;  4LB6 B;  3FXU A;  1L0O C;  1XCV A;  3BWG A;  3M7G A;  1U3E M;  5ICF A;  4HQE A;  3IKT A;  4HQM A;  1SFX A;  1F4K A;  1FT9 A;  3ZMZ A;  2ZNZ A;  1V3F A;  4LFU A;  2K27 A;  1Z6T A;  3V7S A;  3GWZ A;  3HSE A;  2A6E F;  1FYL A;  4CXF A;  4OIQ F;  4A12 A;  4MEY F;  4BHP A;  3DEU A;  3D0S A;  4EQQ A;  1R00 A;  2F5C A;  3JTH A;  4HA8 A;  4Q48 A;  1R22 A;  4HX7 A;  4Y13 A;  1K78 A;  1B4A A;  4IVN A;  2GA1 A;  3K0L A;  2AS5 F;  3E6C C;  3WE2 A;  4KA4 A;  4YFX F;  2XAJ A;  5E8G A;  2OD5 A;  2QLZ A;  3WTZ A;  4L5I A;  2P5K A;  3ZMD A;  4P55 A;  2PI0 A;  2ESH A;  4DNC A;  2HZT A;  2EV5 A;  1ZG5 A;  3KLN A;  3AAF A;  1IAW A;  5LRS A;  4IRG A;  3GFM A;  1XN7 A;  3EQL F;  4ZZD A;  5LHI A;  3VB2 A;  3RYR A;  1HBX G;  3L9F A;  1KU9 A;  5FB2 A;  6PAX A;  3V8K A;  2IRF G;  1SD4 A;  1FOK A;  2WTE A;  1G3W A;  1FY7 A;  4ASN A;  2GAU A;  1I1G A;  4RB2 C;  3O6B B;  3ERE D;  4HF1 A;  5HLH A;  2YU3 A;  2VON A;  4M9S A;  3SQN A;  2QQA A;  2VBX A;  3TOA A;  3P7N A;  2HQN A;  4FHT A;  2H27 A;  1U5T B;  4A0X A;  4LG0 B;  1G3T A;  3VFZ A;  3RYP A;  2W24 A;  1HKT A;  5HOO A;  1Z1D A;  2WV0 A;  1XSD A;  5D6E A;  1J5Y A;  3WTY C;  4PGG A;  2DU9 A;  4GCV A;  1TQP A;  3BOQ A;  4UVB A;  3L09 A;  2STW A;  2J5O A;  1ULY A;  1FBU A;  4BYY A;  1R5H A;  4PDK A;  2RV8 A;  4IJA A;  1G3Y A;  2HR3 A;  3SZP A;  2EWN A;  4BNC A;  4M9X A;  4G7H F;  2FU4 A;  4CO8 A;  2K7L A;  3IWZ A;  4KFC A;  4MQV A;  3W6J B;  2PLY A;  2P5L C;  1ZN2 A;  5AIP A;  3GW2 A;  2FF4 A;  2W84 A;  3HSR A;  2O3F A;  2RKH A;  4TV7 A;  2MA3 A;  1GVJ A;  4RAZ A;  3DF8 A;  3EDP A;  2FMY A;  1DPR A;  1U5T A;  1FYK A;  4XSZ F;  4LG0 A;  5D8K B;  3P9C A;  4WXH A;  4BHB A;  3F21 A;  1J75 A;  2CW0 F;  1O7F A;  1XGS A;  2V1D A;  3WTU C;  1YW8 A;  3GUD A;  1HST A;  5HS9 A;  3ROU A;  2L3D A;  2FBI A;  1IF1 A;  2ISY A;  2HTS A;  3CDH A;  4EJO A;  3FX3 A;  1FNN A;  3TO7 A;  2RVC A;  1XCB A;  3CJN A;  4EM1 A;  1LVA A;  3E3V A;  3R60 A;  3L7W A;  3QU3 A;  2Q0O A;  3I0T A;  3V8J A;  2A68 F;  5CVV A;  2DI3 A;  2RQP A;  3I4P A;  4OIN F;  3E6M A;  2V1X A;  1Z91 A;  4EMS A;  3K9T A;  1WKM A;  1J9I A;  2VN2 A;  3V8L A;  1UFM A;  1P2F A;  4LLN A;  1ZG1 A;  4ZYE A;  3SXY A;  3CUQ B;  1ZGJ A;  1KA8 A;  5ILU A;  2X4H A;  3JSO A;  2ZKZ A;  3REO A;  4MEX F;  5L3C A;  3KEO A;  2ESN A;  4EM0 B;  2H6C A;  4ENM A;  5IT9 Z;  1G3S A;  1R5G A;  2OZU A;  5ICG A;  1TLH B;  3TGN A;  2F5D A;  3DP7 A;  4Q47 A;  4ENN A;  1CF7 A;  1FX7 A;  2HKO A;  2ZME B;  3LST A;  2UXX A;  1STZ A;  2ZBK A;  3L00 A;  3HTU A;  1ZAO A;  3KP4 A;  1W7P A;  3TKY A;  3MCZ A;  2EB7 A;  2QEN A;  5BQT A;  4WXC A;  3OV8 A;  4GYG A;  4HAM A;  2IA0 A;  3SZT A;  3HYI A;  2Y0M A;  1HW2 A;  1HKS A;  2A6H F;  1R1U A;  3Q5F A;  3CUQ C;  3ML6 A;  1BIB A;  1BC8 C;  2RC4 A;  1XB4 A;  3CUQ A;  3ZMV A;  1AWC A;  1I6X A;  1B9N A;  2EV6 A;  4EJV A;  4Z2Y A;  3ZN1 A;  5K1Y A;  2M5W A;  3S2W A;  2D1H A;  2PN6 A;  1R7J A;  1QZZ A;  4UV8 A;  1T6S A;  1YFH A;  2VXZ A;  2HYG D;  1RI7 A;  2JPB A;  2VE8 A;  2A5Y B;  1HQC A;  4N0B A;  3IHU A;  3ZMU A;  4KMU X;  2DO7 A;  3WTW C;  3J7A O;  4UVC A;  5ED4 A;  2RNJ A;  3ECO A;  1D8K A;  5FGM A;  2COM A;  1MDM B;  4RGU A;  5HDK A;  4KNY A;  1YLF A;  4P5O A;  2EFO A;  4I2O A;  3GX4 X;  3JW4 A;  2MC3 A;  2E1C A;  1XD7 A;  3IL2 A;  3R4K A;  3K1P A;  4M9Z A;  5LBQ A;  2JT1 A;  3HSF A;  1ZLK A;  3LAP A;  2LF8 A;  3DPL C;  3K1N A;  2DBB A;  1L3L A;  4KUM A;  4PGH A;  2HYF A;  1P6R A;  1EV7 A;  1DUX C;  3TO6 A;  1ONV A;  1ZHF A;  2YR2 A;  2PEX A;  3DQV C;  2Z3Y A;  2NNN A;  2QQ9 A;  2XAS A;  1ZRE A;  4K2E A;  1Z6R A;  1OPC A;  3WG9 A;  1UHW A;  3HHG A;  5TJJ A;  2KIM A;  4A5N A;  4UV9 A;  1KU2 A;  1PDN C;  4MHG A;  4Y17 A;  1MKM A;  2BYV E;  3R61 A;  2ZNY A;  1J59 A;  2L4A A;  1ZGA A;  1D5V A;  3GFI A;  1ZRF A;  1EH7 A;  2XAG A;  2Y48 A;  3NQO A;  1U6G A;  4XBF A;  2PFB A;  2K4J A;  4FX4 A;  1LQ1 A;  1QO0 D;  1LDK B;  3NEU A;  4JQF A;  3T8R A;  2PQ8 A;  2Q2E A;  3MZY A;  1HKQ A;  2ELH A;  3SFZ A;  4LK1 F;  1TNT A;  3FM3 A;  1KYW A;  2XUB A;  2V6C A;  1FSH A;  1QNT A;  3IWF A;  2XKP A;  2VOO A;  4LMY A;  2VE9 A;  1NHA A;  2XRO A;  3M1E A;  5H6Q A;  2DPD A;  4KN4 X;  5JR3 A;  5ICC A;  1XSV A;  3IRR A;  5D5X B;  1K78 B;  1U2W A;  4RB3 C;  2MH9 A;  4NHJ A;  3J80 K;  3RTR A;  5H6R A;  5D4S A;  3QPH A;  3BDD A;  2FNA A;  3ECH A;  5E1X A;  4EJU A;  5D5V B;  2LDU A;  1IN6 A;  1XGM A;  2CG4 A;  1P92 A;  4A0Y A;  1IN5 A;  3GYH X;  1P4A A;  1H9T A;  5KVR A;  3N97 A;  2VC1 A;  1E17 A;  3E5X A;  3KZZ A;  5CVJ A;  3WTS C;  4XRF A;  3HRU A;  2KIF A;  1QGP A;  2NNY A;  1LB2 A;  3WOD F;  2P4W A;  1O3S A;  3K69 A;  1A04 A;  3IC7 A;  3RJP A;  1FSE A;  5CJ9 A;  5FFZ A;  3BJ6 A;  2FNP A;  1V4R A;  2W25 A;  1OKR A;  5FLX K;  1F1Z A;  1XGO A;  4B09 A;  5D4R A;  1Y0U A;  2D2W A;  1I27 A;  4A6E A;  4I7H A;  5ILV A;  2E7X A;  1XDS A;  1DP7 P;  3DFG A;  1YW9 A;  2G7H A;  2H6B A;  2GXG A;  5LEK A;  2Q8K A;  4KIG A;  2AXL A;  4P9U A;  3U2R A;  2UXN A;  3LA2 A;  2GWR A;  2OQR A;  4ZZL A;  5TRD A;  1TQM A;  1X3U A;  5F64 A;  4LD5 A;  3PQK A;  2PMU A;  5L3D A;  3V7C A;  4S04 A;  3HRM A;  5LGU A;  5CLS A;  2FOK A;  4HLY A;  4U88 A;  2IPQ X;  3HIF A;  4ESF A;  2PMH A;  4ZYD A;  3ZPL A;  2DW4 A;  2E7W A;  3O3K A;  1MZB A;  4WWC A;  2CYY A;  4IXA A;  3RPQ A;  2V1U A;  1QZY A;  3FWE A;  5BPI A;  1KQ8 A;  2ZO4 A;  4RGR A;  3RKW A;  3KP3 A;  5DUK A;  4HX4 A;  4HYE A;  2QUF A;  1LDD A;  1WI9 A;  4D0P A;  1RNL A;  5DUI A;  4YFK F;  3HUG A;  1D8J A;  1J7K A;  5EEH A;  3MZH A;  4HF0 A;  4KYW A;  1S6L A;  1IXC A;  1S7O A;  2DK5 A;  1EH6 A;  2EA2 A;  2W57 A;  3ZQ7 A;  3KEQ A;  1SAX A;  3E5U A;  3BP8 A;  2QM3 A;  5K5O A;  2OQG A;  5CVI A;  2OZ6 A;  3NRV A;  1OYW A;  1SFE A;  4A2U A;  3PFI A;  1RUN A;  3ZN0 A;  4U7D A;  2D1V A;  2UWM A;  1LEA A;  3HHH A;  2HDC A;  2EA4 A;  4LLG F;  1R23 A;  2XAH A;  4OMZ A;  2MBF A;  4LLL A;  3F8N A;  2GXB A;  3I59 B;  2J5P A;  1H9G A;  1TNS A;  4FX0 A;  2M87 A;  4ON0 A;  5DV5 A;  1FP1 D;  4WX9 A;  3RPU A;  5D5U B;  1E2X A;  3GF2 A;  5LRR A;  3DV8 A;  2D45 A;  2NRA C;  4G94 A;  4MQ9 F;  2G9W A;  3I58 A;  5DCM A;  4I98 B;  1S8N A;  1K79 A;  2F2E A;  1QQI A;  4BH9 A;  5F6F A;  3U1D A;  3RKX A;  2DFI A;  5JI6 A;  1T39 A;  3ABT A;  1CF7 B;  2O8X A;  1IXS B;  1LDJ A;  2ETH A;  3IKV A;  2FML A;  1AOY A;  4HF2 A;  1C0W A;  5LHG A;  1YO5 C;  3WTT C;  4P9F A;  1IRG A;  4KN7 X;  2XHK A;  1W7P B;  4ZYH A;  2HOE A;  4OOI A;  5F1R A;  2HKX A;  3QPT A;  4ENJ A;  5AIQ A;  4AD9 A;  3RIR A;  1TW2 A;  1UHM A;  3EYI A;  3I59 A;  2GIV A;  3KLO A;  5KK1 A;  2EJR A;  4Q4Z F;  3F3X A;  4CYD A;  1SD5 A;  5DD8 A;  1QBJ A;  3F8C A;  1WSU A;  3F8B A;  1QPM A;  5L3E A;  2QBY A;  1I1S A;  3WGI A;  5DYM A;  2PJP A;  1F5T A;  3F6V A;  4BAY A;  4YII A;  1ZG3 A;  2FBK A;  1T0F A;  3I71 A;  4M74 A;  3KET A;  1ZLJ A;  2E1N A;  3C1D A;  4RAY A;  1R1V A;  3RI4 A;  2DT5 A;  1VTN C;  1RZ4 A;  4R8H A;  3J80 Z;  4LGW A;  2JZY A;  1XDU A;  2OAZ A;  1O3T A;  4L9J A;  3M8E A;  3R0J A;  3MEX A;  4NQW A;  1YG2 A;  1SFU A;  2VOD A;  2R3S A;  3KP5 A;  1YW7 A;  5DDG A;  1BN5 A;  1FWZ A;  2QVO A;  2NYX A;  4AWX B;  4HOB A;  4L0Y B;  1B6A A;  1K7A A;  3P9I A;  4KT5 C;  3BPX A;  2XGX A;  4Y15 A;  2V79 A;  1IZ1 A;  2CGP A;  4H0E A;  1JHH A;  4KIF A;  2FQ3 A;  3F6O A;  3KE2 A;  3LQR A;  3GZ6 A;  5FD6 A;  2RDP A;  2MD5 A;  1T98 A;  1OMI A;  1U78 A;  3LWF A;  1IN4 A;  3VOD A;  1Z7U A;  1T38 A;  4IHT A;  5FLX Z;  5A2Q K;  2O03 A;  4WXD A;  1HW1 A;  4P96 A;  1IRF A;  4XLN F;  4AIJ A;  3E5Q A;  1EH8 A;  3ZMT A;  3E6D A;  4R79 A;  3ABU A;  3I54 A;  2L4M A;  1YS7 A;  3TDU C;  1FC3 A;  4GXO A;  4JK1 X;  1GXQ A;  1W5T A;  4BHC A;  1REP C;  3KP6 A;  4I02 A;  2LNB A;  3CO6 C;  2VT3 A;  4IRI A;  1FBS A;  4U0Y A;  3KCC A;  4G6D A;  1FYM A;  5DCF A;  3T5X A;  2G7U A;  3C7J A;  2M8E A;  4HZF A;  5JVT A;  4G7O F;  3L2C A;  3MFK A;  4YG2 F;  2L54 A;  2VBZ A;  1KQ0 A;  4EV0 A;  3ELK A;  4O5V A;  3GLX A;  4WK8 F;  2HGC A;  1TTY A;  3RDI A;  4UHT A;  4FT8 A;  4AIK A;  3QU6 A;  5BMZ A;  2B0L A;  3G3Z A;  1ZRD A;  3K1M A;  1IXR C;  2XKO A;  4GYI A;  1MGT A;  4MGR A;  4LB5 A;  2ZJ2 A;  2FRH A;  5H20 A;  5J8F A;  3F8F A;  5D6F A;  1SMT A;  3F23 A;  1MJB A;  2VOP A;  3JAM K;  1H0M A;  1B1B A;  3DPT A;  4M6Y A;  3GFL A;  5HDN A;  2FXA A;  1IN8 A;  2DPU A;  3QRF F;  3LA7 A;  3FM5 A;  3LAJ A;  4L9N A;  2BV6 A;  3ZP5 A;  5EEG A;  2PBI A;  5IT3 A;  4KMF A;  2O61 A;  2BEO A;  2R7D A;  4B8X A;  1OYI A;  1UCR A;  4IF4 A;  1R1T A;  2L02 A;  2Z5U A;  3BZ6 A;  2IA2 A;  2DLL A;  5FD5 A;  1IUY A;  2OBP A;  2CFX A;  5DD4 A;  2HQR A;  1S29 A;  1Z05 A;  4EM2 A;  2P8T A;  2VBY A;  4L5J A;  1ODD A;  2WC2 A;  1KQ9 A;  2VC0 A;  3TOB A;  1IW7 F;  1HXD A;  2H09 A;  2EK5 A;  1PUE E;  4JBA A;  4MTE A;  2FSW A;  3CUO A;  4IPA A;  2YX4 A;  3WGH A;  2KJB A;  2BGC A;  4F7Z A;  2JTV A;  2QYO A;  2CQK A;  2P7V B;  4MNU A;  5K5Q A;  1ON2 A;  1W4M A;  1PP7 U;  3RKY A;  3P9K A;  4KDP A;  3HRT A;  2L01 A;  2XVC A;  1XGN A;  2LSO A;  3T1B A;  3BJO A;  2M30 A;  4HBL A;  2P5V A;  3K2Z A;  3KZY A;  3EET A;  3J81 K;  2IP2 A;  4IRH A;  4BXU A;  1IN7 A;  2P6S A;  3N4M A;  2A07 F;  2XV4 S;  5CYV A;  1HSJ A;  3D5L A;  1BI1 A;  4O6J A;  5CVR A;  4QLC U;  2VT2 A;  1XSX A;  4Q5S F;  4HV5 A;  4WCG A;  3C3W A;  4G8X A;  1MD0 A;  1WQ2 A;  1P4W A;  4BQA A;  2BBY A;  1YQA A;  4LK0 F;  2Z9O A;  1R58 A;  5E1W A;  4ESB A;  1FZP B;  2QWW A;  4OIR F;  5LHH A;  1KU3 A;  1XMA A;  2MLK A;  4CIC A;  4OIP F;  4HW0 A;  1ZH5 A;  1SD7 A;  2XRN A;  3EYY A;  1YTY A;  4A0Z A;  3WE3 A;  4O3M A;  1LNW A;  4I0B A;  1MJ9 A;  1RIO H;  2YPR A;  2LF7 A;  2Z99 A;  5BS6 A;  3Q9S A;  3HOS A;  2IVM A;  2KJC A;  4N9H A;  5L3B A;  4G7Z F;  2RGV A;  5HDG A;  2F5F A;  2ISZ A;  1D3Y A;  2K02 A;  2GA2 A;  4U7B A;  4UUV A;  1J2X A;  5A2Q Z;  2FA5 A;  2XAQ A;  2ADU A;  5L3F A;  2JSC A;  1YIO A;  4CDG A;  2WWY A;  4DQ2 A;  3H3U A;  3DXJ F;  5LLQ A;  2DTR A;  1BIA A;  3R0A A;  2GZW A;  5HLI A;  1UB9 A;  4U0V A;  2P6T A;  2DK8 A;  5DCM B;  4UXN A;  1DPU A;  4G6Q A;  1SMY F;  1GHC A;  5HLG A;  1KYZ A;  4L18 B;  5E1Z B;  4AIH A;  4L0Z B;  1YS6 A;  1KGS A;  5CVU A;  3LFK A;  5J6X A;  4L9V A;  1ZRC A;  2O0Y A;  3MWM A;  4A6D A;  1ZYR F;  1XMK A;  3EUH A;  5E18 F;  4WF2 A;  4HDU A;  1W7P D;  2ZXJ A;  1CGP A;  1G6N A;  1WRJ A;  2EFQ A;  2HFH A;  4U0W A;  2HWV A;  1WWX A;  1T2K A;  2NAZ A;  2QBY B;  1O3R A;  3OOP A;  1P4X A;  5J8C A;  4IHS A;  2RN7 A;  3V4G A;  2A69 F;  2YSR A;  2HS5 A;  3PQJ A;  1G4D A;  1RUO A;  3M8F A;  4HLX A;  1I5Z A;  4HDV A;  4I09 A;  3KP7 A;  3JAM Z;  1U5T C;  1SD6 A;  4RGX A;  1ZAR A;  2KKO A;  3FMS A;  4CGZ A;  4QWQ A;  3WTX C;  3IRQ A;  1BM9 A;  5E8I A;  2R7F A;  2CSO A;  2EFN A;  3BRO A;  5HVQ C;  1FP2 A;  1BI2 A;  3HOT A;  1ON1 A;  1OR7 A;  3ISP A;  3B73 A;  4YFN F;  4EGY A;  3T0Y A;  3MQ0 A;  4OMY A;  3FHZ A;  3F8M A;  3CO7 C;  2FBH A;  5E17 F;  4PCQ A;  4L9T A;  1HW5 A;  4NB5 A;  5ILS A;  3BPV A;  2LKP A;  2EV0 A;  3BY6 A;  3FMQ A;  2ACJ A;  3GO5 A;  4XSX F;  1YYV A;  2JPC A;  3HTS B;  2K86 A;  2IJL A;  1UST A;  1TQI A;  3GEZ A;  3QP6 A;  4PZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...