1YLFA

X-ray crystal structure of bc1842 protein from bacillus cereus, a member of the rrf2 family of putative transcription regulators.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
117
Chain Sequence
KISSRFSIAVHILSILKNNPSSLCTSDYMAESVNTNPVVIRKIMSYLKQAGFVYVNGGAGLLKDLHEITLLDVYHAVNVIGANIQAVLEIILIQAQSAMEEVLRNITMGQLFETLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of BC1842 protein from Bacillus cereus, a member of the Rrf2 family of putative transcription regulators.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transcription regulator
molecule keywords RRF2 family protein
total genus 32
structure length 117
sequence length 138
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ylfA00
1T0FA 3WTVC 3ZPLA 2IA2A 3GUDA 1F5TA 2V6CA 3IL2A 3BOQA 3P9KA 4MTDA 4R8HA 3I59A 3JSOA 5DUIA 1YW9A 2F5DA 2M1BA 2VBXA 1HW2A 4HZFA 1G3SA 2XV4S 3TOAA 5LEKA 1ZN2A 3Q9SA 3MQ0A 3O3KA 3RPUA 2RKHA 3F22A 5D4SA 1LDKB 2VXZA 2ZNYA 4NQWA 5CVVA 5FB2A 2VT2A 1B1BA 2EFQA 3J81Z 4WXCA 4MTEA 1XGOA 3ZMTA 2ZMEB 2YSRA 1KYZA 1ZLKA 5TRDA 2CWEA 2QYOA 1HSJA 3LAJA 3M8EA 4I0AA 1SD5A 2D45A 2F2EA 3I53A 1OR7A 1R1TA 1SFEA 2HQNA 1HSTA 2V1UA 5LLQA 4I0BA 4UV8A 1KQ8A 1TBXA 2YX4A 1W5TA 3M1EA 2E1CA 3F3XA 3CDHA 2QBYA 3LFKA 4OIRF 3DQVC 1FPQA 4HLYA 4L9NA 1HW5A 4U0VA 2VONA 1YW7A 3KP2A 1MDMA 3BPXA 2ELHA 4IRHA 4IPAA 2G9WA 3RJPA 2C6YA 4M6YA 4BHBA 4P9UA 3GFLA 5EEGA 3TGNA 2MLKA 5AIQA 2DBBA 3RI4A 1JHFA 4S05A 2A61A 1FLIA 2DFIA 3TQNA 1ZRFA 2OD5A 4ENKA 5LBQA 2CO5A 1YW8A 4FHTA 3KEQA 2X0LA 4BQAA 2FF4A 3V7SA 2GA1A 4G6QA 3R61A 3J80Z 1ZHFA 1K7AA 1PUEE 4ESBA 1OPCA 5E17F 1KU3A 5BPIA 1K78A 4G7HF 2HKOA 1JE8A 1DP7P 5FD5A 3NRVA 1QNTA 2Y0MA 5L3GA 4RB3C 3FF5A 1Z05A 5HDGA 2BEOA 3WTXC 2W84A 4IRGA 4EV0A 3OOPA 3D0SA 4Q48A 1P4AA 3JSPA 4HW0A 2F5CA 2DT5A 4KYWA 4UHTA 5D6EA 3LAPA 1YQAA 2JPCA 1IN5A 1EH6A 5CVJA 1BI3A 4HLXA 4L9TA 4M9SA 3FMSA 2PMUA 3GLXA 3ECHA 2OBPA 1Z7UA 4RGSA 2ESHA 1B9MA 2EV6A 3KLNA 3BP8A 2UWMA 3VEPA 1ZH5A 3VOEA 2L3DA 5EEHA 2GXBA 1WI9A 1PP8F 1BIBA 4ENMA 4CZZA 1LDDA 1MGTA 3E3VA 3QOPA 1U5TA 5DD8A 1C0WA 1R5HA 2MBFA 4L9VA 3F8FA 5D6FA 4M74A 1TTYA 1B9NA 1R7JA 2QENA 4ZZLA 3J7AO 3GWZA 1QO0D 4L0ZB 3RYPA 1OYIA 3M7GA 1X3UA 2HYGD 2KKOA 3KZZA 2Z9OA 2EV5A 4Q5SF 4A6DA 2ZFWA 5ERIA 2D2WA 4F7ZA 1WWXA 3C18A 2H27A 2V1XA 3NQOA 4UVBA 1S6LA 3JAMK 3FXRA 4P55A 5FO5A 5BS6A 2FOKA 2XKPA 2RDPA 4FT8A 1FSHA 2LF7A 2VBWA 2G7UA 2W57A 2D1HA 4M9XA 3CLOA 4I01A 1BI2A 1R5GA 2D1VA 4ENJA 3K1MA 4CGZA 5D5WB 4BYYA 4LK1F 3LSTA 3L9FA 3B73A 5L3FA 2NYXA 4Y13A 5E8IA 3T1BA 2DK5A 5A2QZ 2K4BA 4OMZA 1CF7B 4QLCU 1BI1A 4KFCA 3L00A 4M73A 3I5UA 1RNLA 3M8FA 5LHHA 5LGNA 2NAZA 1E17A 2EK5A 2QQAA 3R0AA 2VE8A 2P7CB 1U5TB 4UNOA 4IHSA 1IN8A 2O61A 1R23A 3FMQA 5HLHA 3R6SA 5IT9K 1G3TA 2O0YA 2JTVA 4I02A 1O7FA 2UXNA 2M30A 3JW4A 1SAXA 5F64A 2ADUA 2M5WA 3GZ6A 2VBZA 1K78B 4MQ9F 1WQ2A 1QGPA 2BGCA 4RS8A 1BC8C 2GAUA 4A0ZA 3RTRA 3IKVA 1P4WA 1OYWA 2YPRA 3W6JB 1O3TA 2EFOA 1YYVA 1S7OA 2JT1A 3ISPA 1T39A 3VFZA 4Z2YA 3S2WA 3EDPA 4P5OA 2OU2A 4HF2A 5E18F 1ZG5A 4P9FA 2HR3A 4I2OA 2ISYA 1KGSA 2TDXA 1KA8A 1XGMA 1FZPB 1XSXA 4HYEA 2BE5F 1U78A 1XB4A 3TOBA 4RAYA 2FNPA 1IZ1A 1J9IA 1GHCA 3DEUA 2M8EA 1LEBA 4LMYA 2ISZA 1I1GA 5L3EA 3BROA 1JGSA 4CO8A 1FWZA 1G4DA 3J80K 4KT5C 1YS6A 2A68F 1ZRCA 2ESNA 2VC1A 4KMFA 3TO9A 1RZ4A 3CO7C 5K1YA 2RQPA 2H6CA 3PFIA 5DD4A 1HKSA 2IJLA 5CYVA 5BPDA 5DCFA 4XRFA 2VN2A 3N97A 2GWRA 4YFXF 3HTSB 3KFWX 1U6GA 4XSXF 3SZPA 2P6TA 5HS9A 2QM3A 1J0RA 3RKXA 2Z33A 2JZYA 1TW2A 4AIHA 3KCCA 2XKOA 3F72A 1T6SA 4IXAA 4EJUA 1ON2A 1ZG1A 5D4RA 3SXYA 2ZCWA 2HQRA 3V7RA 1ZREA 2MA3A 4HA8A 1MJBA 1B6AA 5LEJA 2H94A 5L3DA 1JHHA 3WU1B 2B0LA 5F6FA 5JFRA 4A12A 4WF2A 1B4AA 1BJAA 2STTA 2P5VA 2DLLA 4RB1A 1J59A 4WX9A 2R7FA 3IWZA 2W24A 3ELKA 1MJAA 5BOXA 4BAYA 1R36A 3M9AA 3P9IA 2DK8A 4G6DA 4LG0A 1BOAA 1OMIA 5E8GA 4KIBA 2ZMEA 1LB2A 3U1DA 4WWCA 4Q47A 1IN4A 1WKMA 2VE9A 4ETSA 4HDVA 3T8TA 3WGHA 1I6XA 1U3EM 4HQEA 2HEOA 3T0YA 4N9IA 3I58A 2KIFA 3RYRA 1XCBA 2H09A 4CICA 1MD0A 3ULQB 1G3YA 4IF4A 3E6MA 2R3SA 3F23A 2VOOA 4O3MA 2EA4A 1FOKA 5ILVA 4AWXB 5AONA 2YU3A 2Z5UA 1B59A 1HXDA 4LG0B 4RGRA 1KU2A 1XMKA 4LFUA 3QAHA 2QZ8A 1Z9CA 1HBXG 3ERED 4IRIA 1ZGAA 5D8LB 1USTA 1I1SA 3IC7A 1P2FA 3SZTA 2QQBA 2EFNA 1XMAA 2EFPA 1BC7C 2FMYA 2PBIA 1GXPA 1BBYA 1W7PA 1OKRA 1ZYRF 2KJCA 2DO7A 2L4AA 3KLOA 1I5ZA 3I54A 4MHGA 1Y0UA 3MAJA 2L01A 5JHUA 3EQLF 2XAHA 4YG2F 4UVAA 4EJTA 4RAZA 4MGRA 5KVRA 2KIUA 2FA5A 3R60A 4I98B 2CGPA 4LB5A 2XRNA 2GZWA 2FBKA 3MCZA 3KE2A 3DP7A 2QBYB 5K5OA 4LLNA 2M45A 4WK8F 3HRSA 1L0OC 5DEQA 4A0XA 5J8CA 2IA0A 2ZBKA 3DPLC 3RKWA 2K27A 1SFXA 1W7PD 3BDDA 5LRRA 1FC3A 4A5MA 5TJJA 5F1RA 4OOIA 1ZRDA 3WE3A 5ICEA 3N4MA 4R1HA 1FT9A 2NRAC 1R58A 4WXHA 1FYLA 3I64A 3GO5A 2KRFA 4S04A 1PDNC 4EGZA 4DQ2A 5D5XB 2JPBA 2WV0A 5CVUA 3CTAA 5CJ9A 5E1XA 3FM3A 2MC3A 1XN7A 1L3LA 1RUOA 2HTSA 1TQMA 2XHKA 1SD4A 5K5QA 3HSRA 1YIOA 2J5OA 3P7NA 4EM1A 4K2EA 2EJRA 2PQ8A 1D5VA 4O6JA 4ON0A 4Y15A 4JK1X 4AD9A 3JAMZ 2Q2EA 4GGGA 4RGXA 1LQ1A 3G73A 4A0YA 4LB6B 1SFUA 4OMYA 4IVNA 3NEUA 4N0BA 4PGHA 1Z1DA 1XSVA 3SQNA 1TQIA 5LHGA 3ZN1A 2NNYA 3TDZC 1FYMA 3HSFA 1T38A 4GCVA 4JQFA 1HW1A 4I09A 2HZTA 1LEAA 2XASA 1YS7A 2WC2A 1J75A 3B02A 2IT0A 4G94A 2VODA 2RVCA 2WTEA 4UXNA 3AAFA 4M9ZA 5H6RA 3E6BA 4U0YA 3KZYA 3DF8A 3CUQC 4G7ZF 4KMUX 3ZMVA 1J7KA 2RV8A 1CGPA 1NHAA 3ECOA 3LWFA 2EA2A 4EM0B 4U7DA 2BYVE 1MDMB 5ED4A 4XSZF 2RGVA 3K1PA 3FHZA 1YFHA 4DNCA 4KUMA 4TV7A 2P6SA 1XSDA 3FXQA 4LLGF 2H6BA 4I7HA 3COAC 3HHHA 1QZYA 3R4KA 1BI0A 1ODDA 3LQRA 5LRSA 2DW4A 5ILUA 3DV8A 5DDGA 3WG9A 3FXUA 3TKYA 2Z3YA 5LHIA 3E6DA 3ABTA 2BV6A 2YR2A 2OA4A 2A07F 5HS7A 4EJOA 4AVPA 2LNBA 1ZGJA 3DFGA 5ICFA 4CHUA 2FXAA 3REOA 1H9TA 4YIFA 3GX4X 1UFMA 3BJOA 4N9HA 2YX7A 1YO5C 3WODF 3ZMSA 4A2UA 4PZJA 2FMLA 4CXFA 5LGTA 3HSEA 1YTYA 1EH7A 3MZHA 3TO7A 2COMA 3K2ZA 1O3RA 2P7VB 3KEOA 5JR3A 3BPVA 1ZG3A 4AIJA 2FSWA 1PP7U 5H20A 3DKWA 3HRUA 1RI7A 1BN5A 2FRHA 3GFIA 2IVMA 3KP3A 2GA2A 3DPTA 2F5FA 1J2XA 3VB2A 1RIOH 1V3FA 3F8MA 1WRJA 2FEZA 3CJNA 4EJWA 5CVIA 1HKTA 3WTTC 4EQQA 5D5VB 1REPC 3GXOA 1O57A 2CYYA 1DUXC 2MH2A 5J8FA 4IHTA 2HKXA 4PCQA 1Q1HA 4KIFA 2ZNZA 4B09A 2DI3A 3GEZA 3BJAA 3WTYC 3KP4A 4AIKA 3IWFA 1R1UA 2OAZA 3GW2A 1P92A 3P9CA 1Z6TA 1GXQA 3L09A 4ZYEA 3T5XA 3WGGA 3ZMDA 1P4XA 5KK1A 4KN4X 1IRGA 3E5XA 5E20A 4ASNA 2PLYA 3R0JA 4YFKF 2K7LA 4EMSA 2Y48A 5DCMA 2E7XA 2Q8KA 3H3UA 4OU0A 1QPMA 4KICA 4GXOA 4U88A 2O8XA 3E5QA 1EH8A 2OZ6A 1A04A 3VODA 3W6KB 5IT3A 3LA7A 2IW5A 1STZA 2VOPA 4RGUA 2FBHA 2QVOA 1MZBA 3F8CA 2EWNA 3CUQB 2V79A 4LGWA 2DAOA 1IN6A 4Y17A 3CUOA 1F9NA 3I59B 1T98A 4GO1A 1R1VA 3WGIA 4KDPA 3HUGA 4EGYA 3GFMA 2CSOA 5L3BA 4CYDA 3ZMZA 1YG2A 1TNTA 2CFXA 1E2XA 1D8JA 4MQVA 2HGCA 4MEXF 3L7WA 4GYGA 1CF7A 1MJ9A 1XGSA 1IRFA 3BWGA 1XD7A 5HDNA 4ENNA 2J5PA 1IXRC 3H92A 2EB7A 2XUBA 1I27A 2PMHA 4U0WA 5FGMA 3LA2A 3F6OA 2XAGA 2O6GE 1H9GA 2RNJA 4BH9A 5HLGA 3ZP5A 3U9GA 1G3WA 4ZZDA 2A6HF 2A5YB 3V8LA 1D3YA 4OIPF 1FY7A 1ZAOA 4Q4ZF 5HS8A 2VC0A 3CO6C 4ZYDA 1DDNA 4EVIA 4GYIA 3HOSA 4RB2C 3V8JA 1R00A 2MD5A 2XAQA 3Q9VA 2DPUA 4M72A 3DXJF 4HX4A 1ONVA 2UZKA 2L4MA 4MNUA 1FYKA 2JSCA 1FNNA 2PG4A 3GYHX 4QWQA 4U7BA 3V4GA 2PEXA 1O3QA 1QQIA 2JRTA 3CUQA 1S3JA 5CVRA 1ON1A 2AXLA 3LA3A 3FZVA 4L0YB 4KIGA 2A3SA 2XAJA 5HVQC 5DCMB 3ROUA 3PQJA 3K9TA 3RIRA 3ZN0A 4L5JA 2G7HA 4P96A 1O3SA 1Z91A 2HDCA 1TQPA 2ZXJA 4A5NA 5D8KB 4UUVA 1JXSA 2CG4A 1S29A 2V1DA 1KQ9A 1Z6RA 4HBLA 4OIQF 4WXDA 2HTJA 1USSA 4M71A 4ZYGA 2AS5F 3C7JA 2V9VA 1FBUA 5JVTA 4L5IA 5FFXA 2FNAA 1W5SA 2EV0A 5BQTA 2OQRA 2HOEA 1IUYA 2IPQX 1SMTA 4WCGA 2IP2A 3E97A 3SHFA 1FP1D 2OQGA 4KA4A 2LF8A 3JTGA 3PQKA 3HYIA 2XVCA 3MEXA 3K0LA 1VTNC 2IA1A 1QZZA 4YIIA 1U8RA 4LD5A 1LVAA 2XAFA 4E70A 5ICGA 3QPTA 4OINF 3GF2A 1UHMA 1UB9A 2NNNA 4HOBA 2STWA 3T8RA 1LDJA 2L54A 6PAXA 2LSOA 4NB5A 4A6EA 2P5LC 2Y75A 4YFNF 2P4WA 2RN7A 3QPHA 5A2QK 2MLGA 1TW3A 2PN6A 3WE2A 3QRFF 5FLXZ 2ACJA 1IF1A 5D5UB 1AOYA 1TLHB 4G9YA 2QWWA 3MWMA 1KYWA 2PFBA 2NS0A 3OV8A 3HIFA 5DYMA 2A69F 2Q0OA 4BHPA 3F8BA 3HHGA 3RPQA 4KNYA 3QP6A 3GFJA 2FBIA 5H6QA 3WU0A 3F21A 4JBAA 2KJBA 4CDGA 1K6OA 1SD7A 3Q5FA 1G6NA 2HS5A 2RC4A 2GXGA 1J5YA 4L9JA 4BNCA 2GQQA 1IN7A 2PI0A 4B8XA 2DQRA 4RB0A 1UHWA 3FM5A 4UVCA 1K79A 3I4PA 3WTSC 2K86A 1FBSA 2LDUA 1RUNA 1H0MA 1XDUA 2P5KA 4ESJA 2MH9A 1DPRA 2VT3A 3QU3A 2M87A 3TO6A 5FLXK 4XLNF 2ZO4A 1V4RA 5HLIA 4H0EA 1FBQA 3EETA 3O6BB 3SFZA 1ULYA 2X4HA 2ETHA 2W25A 2BBYA 3FX3A 3EUHA 3GVAA 1DPUA 3EYIA 3IRQA 4HF1A 3K1NA 4LJZF 5ICCA 4KN7X 3E5UA 2WWYA 3I0TA 2CQKA 5L3CA 3J81K 3G3ZA 1ZLJA 4HX8A 1W4MA 4HV6A 4XBFA 2O03A 2DTRA 2XGXA 1BIAA 1D8KA 2LKPA 1FP2A 3QU6A 2ZJ2A 3BJ6A 3F6VA 2E1NA 1YLFA 3H3ZA 2DPDA 1IAWA 5DUKA 1XGNA 1O7LA 3QP5A 2A6EF 5BMZA 1W7PB 3JTHA 4PDKA 4ZH4F 2F5EA 1QBJA 2DQLA 1F4KA 3TDUC 1BM9A 2DU9A 1IXSB 1OYYA 2Z99A 1XDSA 3HOTA 5LGUA 4HF0A 3V8KA 3RKYA 1SMYF 1FSEA 2XROA 1HQCA 1WSUA 3IHUA 5FFZA 4G7OF 2CW0F 4EJVA 2IRFG 3E6CC 4HX7A 4EM2A 2E7WA 4G8XA 1KQ0A 1HKQA 3ML6A 2QLZA 3KP7A 3WTWC 5AIPA 5DV5A 3KP5A 5E1ZB 1AWCA 2L02A 4O5VA 4NHJA 2HYFA 3BZ6A 1EV7A 5JI6A 3F8NA 3RDIA 3ABUA 3EYYA 4IJAA 1S7AA 3IRRA 1FX7A 2R7DA 3K69A 2KIMA 3LQQA 1UCRA 4HAMA 2K4JA 1U5TC 1LNWA 2O3FA 2QUFA 4BHCA 1F1ZA 4FX0A 3ZMUA 3WTUC 3HRMA 2ZKZA 3C3WA 3D5LA 2FU4A 1ZARA 5J6XA 4MEYF 4M6XA 1LJ9A 4HV5A 1KU7A 2VBYA 3HTUA 4LLLA 4XLPF 3C1DA 1T2KA 1IXCA 2UXXA 3FMRA 4LK0F 4D0PA 1U2WA 2QQ9A 1IW7F 4R79A 3IKTA 2W85A 1P6RA 5K5RA 3V7CA 3ZQ7A 5CLSA 4OIOF 3KETA 5HDKA 4L18B 3HRTA 1MKMA 2HWVA 3L2CA 2HFHA 3KP6A 4UV9A 3FWEA 3MZYA 5FD6A 3MFKA 3WTZA 2K02A 2PJPA 1SD6A 4ESFA 3BY6A 1KU9A 1S8NA 3O2PE 2P8TA 4HQMA 4BXUA 1GVJA 4ZYHA 2EFWA 3I71A 5HOOA 2GIVA 5ILSA 4FX4A 5E1WA 1XCVA 3GZ5A 2FE3A 2FQ3A 1TNSA 1R22A 4HDUA 3U2RA 5IT9Z 4PGGA 2OZUA 2XIGA
chains in the Genus database with same CATH superfamily
2MD0A 4Y33A 2GM4A 4ITVA 1P7JA 1T0FA 1IV8A 3WTVC 4HRIA 1IGNA 3ZPLA 3CCVI 2IA2A 1ETVA 4CCJA 3GUDA 2XSJC 1F5TA 2V6CA 5FROA 3LSMA 3IL2A 3BOQA 3RCOA 3CCJI 2HDWA 4BDYA 3P9KA 1SVLA 2E1MC 4MTDA 3FXJA 4R8HA 1YRNA 4QSHA 3I59A 2QSGX 2WY7Q 3JSOA 4XK4A 1I50J 3LSIA 1VQ8I 2VXDA 1MNEA 3BCBA 5DUIA 1YW9A 4E7SA 2M0CA 2F5DA 2M1BA 2OV7A 2VBXA 1HW2A 3K70D 4HZFA 4P1WA 4DGWB 1WI3A 1G3SA 2XV4S 3TOAA 3OWTA 5LEKA 1ZN2A 3Q9SA 4LOCA 3MQ0A 3O3KA 3RPUA 2RKHA 3F22A 5D4SA 3WHCA 3ESWB 2RNGA 1LDKB 3BQYA 4B43A 2VXZA 2ZNYA 4NQWA 5CVVA 5FB2A 2K85A 2VT2A 1B1BA 2EFQA 2NXNB 3J81Z 4WXCA 2OUMA 4MTEA 1XGOA 1IDZA 5GP9A 3ZMTA 4F55A 2ZMEB 5DM7F 5FKKA 1X2MA 2YSRA 2OC6A 1AKHA 1KYZA 1ZLKA 2BW3B 3RZOJ 2LKXA 2QGUA 3HZJA 4EATA 5TRDA 3UKGA 2BZTA 2IXSA 2LY1A 2Z2SB 2CWEA 1N78A 3AG1H 2QYOA 1HSJA 4B44A 3LAJA 4DJAA 3M8EA 4I0AA 2NOJB 4IHYA 1SD5A 5HNHA 2CMPA 3M4OJ 4ZJZA 2D45A 1T33A 4AYBN 1JKRC 2F2EA 3FIWA 3I53A 4XKWA 1OR7A 1R1TA 1SFEA 2HQNA 2GXAA 2JA2A 2F5VA 1HSTA 3BR6A 1B72B 1TWGJ 5LLQA 4I0BA 4UV8A 2V1UA 3OL4A 1KQ8A 1TBXA 4FISA 2YX4A 1W5TA 4ZYAA 2R7TA 3M1EA 2E1CA 3F3XA 1EJ9A 3CDHA 2QBYA 3LFKA 4OIRF 1E3OC 4AVZA 3DQVC 1FPQA 4HLYA 4L9NA 1HW5A 2L9SA 5EG0B 2R7QA 2JVGA 4U0VA 2VONA 3DLAA 3PNYA 3H9QA 1ETXA 1YW7A 1RKTA 1EKEA 3KP2A 3JRGA 1MDMA 3BPXA 4XRSG 3HB9A 4XORA 1GV2A 2ELHA 4IRHA 4IPAA 1TZLA 2G9WA 3RJPA 3HM5A 2C6YA 4BJTA 4M6YA 4BHBA 4P9UA 1EA3A 3GFLA 5EEGA 3GTQJ 3TGNA 3VYRB 2AXTC 1V5GA 1A6QA 2MLKA 5AIQA 2DBBA 3S15J 1OR7C 3RI4A 1JHFA 4S05A 1UZCA 4IQJA 2A61A 1FLIA 2DFIA 3TQNA 4XONA 1ZRFA 3MZ8A 1ZQ3P 1B8IA 2IGOA 2OD5A 4BEHA 4ENKA 1BL0A 3CJQB 5LBQA 2CO5A 4ZC3A 1YW8A 4FHTA 3KEQA 2X0LA 4BQAA 2FF4A 3SEQA 3V7SA 3UR3C 2GA1A 4G6QA 3R61A 3J80Z 3OIOA 2L9VA 2I5UA 1ZHFA 1K7AA 1PUEE 4ESBA 1OPCA 5E17F 1KU3A 2DOAA 5BPIA 1K78A 1VFCA 2XB5A 3H35A 4G7HF 2HKOA 3H5NA 4YEJA 5E3LA 1JE8A 2DMUA 3H5RA 1DP7P 4XNFA 5IOYA 4NC6A 3NRVA 5FD5A 2YS9A 2O7OA 4D7NA 4E7HA 1QNTA 2Y0MA 3CC2I 1JUSA 5L3GA 4RB3C 1JJ6C 3DEWA 4LIVA 4RAFA 3FF5A 5KAIC 1Z05A 5HDGA 2LFBA 3S3OA 3GTOJ 2E1OA 4MLOA 1WJCA 2BEOA 3WTXC 2W84A 3CCQI 1V55H 4IRGA 4EV0A 3OOPA 3D0SA 4HPQA 2HQ5A 5IP9J 4Q48A 2X48A 5CQGA 5GAEJ 1P4AA 3JSPA 4HW0A 1YIJI 2F5CA 2Z1DA 2DT5A 5M5YJ 4KYWA 4CSWA 1PVEA 2K9NA 4UHTA 5D6EA 5B3SH 3LAPA 5K7HA 1YQAA 1YJWI 2JPCA 3S14J 1IN5A 3IUOA 1EH6A 5CVJA 2WV1A 1BI3A 4HLXA 4HSRA 4L9TA 3M1CA 4BJ6C 5FLVA 4M9SA 3L2WA 2LBFB 3FMSA 2PMUA 3GLXA 5JVGF 3ECHA 3L1PA 1N75A 2OBPA 1Z7UA 4IL6C 4RGSA 1IRXA 1Y8QB 2WAQA 3I55I 2ESHA 1B9MA 2EV6A 2W1OA 3KLNA 1VI0A 3HPGA 2MC4A 3BP8A 5B1AH 2UWMA 3VEPA 1ZH5A 1D5YA 1HOMA 3VOEA 4NQWB 2L3DA 2ZSIB 1H8AC 4C30A 5EEHA 2GXBA 2HPIA 1WI9A 2A05A 3VYTB 1I6HJ 1PP8F 1U9NA 1BIBA 2VB6A 1W36C 4IQ4A 3O8GA 3JRDA 3GCMA 2ELJA 4XR6A 4ENMA 4CZZA 1LDDA 1X1PA 1MGTA 1OCCH 1UHSA 1LPQA 4BY1J 2H1LA 2M3AA 2Z16A 1VZ0A 3E3VA 1MBKA 1G59A 1UELB 3QOPA 1U5TA 5DD8A 2DA6A 1C0WA 5LD2C 2MW8A 2F48A 1OLTA 1POGA 2XF6A 3S1MJ 1R5HA 2MBFA 2OCCH 3F8FA 4L9VA 1Y56A 3LSKA 5D6FA 2D5VA 2WAFA 4M74A 1TTYA 3K7AJ 1B9NA 1R7JA 2QENA 4BBSJ 5K7FA 4ZZLA 3HOWJ 5GTHC 3TEDA 2AQFA 3J7AO 3BTJA 1B8IB 3GWZA 1QO0D 3D1NI 1FEXA 4L0ZB 3HGGA 3RYPA 4N4NB 1OYIA 2LY2A 3M7GA 5BNGA 2EPFA 4GFBA 2ECBA 1X3UA 2HYGD 2KKOA 4AIDA 2HVRA 3KZZA 2Z9OA 2EV5A 4ZDLA 5M5WJ 4Q5SF 2ME6A 4A6DA 2ZFWA 5ERIA 1D0YA 2D2WA 3OY9A 4F7ZA 3VYSB 1WWXA 3C18A 2H27A 2V1XA 4OWRB 1XC5A 3NQOA 4UVBA 1S6LA 3JAMK 3FXRA 4P55A 4A3CJ 5FO5A 5BS6A 3GZNB 2V7FA 1P7IA 3VPRA 2FOKA 2XKPA 1NG6A 2RDPA 4FT8A 3K4LA 2WADA 3A01B 1FSHA 2LF7A 2VKHA 3FXMA 5CKTA 1VQPI 2BOLA 2VBWA 2G7UA 1VQOI 4DYCA 3I4NJ 3DBRB 5LFAA 2W57A 2D1HA 4M9XA 3D5RC 3CLOA 2XGDA 2JA5J 4I01A 2JWTA 3S32A 1BI2A 1R5GA 2LREA 2V26A 2D1VA 3CCYA 2VJIA 4ENJA 4FETA 1OQYA 2VQGA 1MBFA 2GOMA 3K1MA 1F36A 4CGZA 5DS9A 3FXOA 5D5WB 5CPRB 3HUGB 2PMZN 2M2EA 4BYYA 4LK1F 2JSPA 3LSTA 3CLQA 5EEAA 2R5YA 3L9FA 3B73A 3OYKA 1X1CA 4XM3A 1WJAA 5C4XJ 2VKVA 3TP0A 1X19A 1ZELA 3K6GA 5L3FA 4RA2A 2NYXA 3SDBA 4Y13A 4BACA 2NS7A 2XAUA 3LSJA 3T1BA 5E8IA 2DK5A 5A2QZ 3S2HJ 1QZEA 2K4BA 3ZRGA 4OMZA 4B3XA 1CF7B 2M34A 1H88C 2KLOA 4QLCU 2DN0A 4G6TB 1BI1A 4KFCA 3L00A 2CQNA 1KZHA 4M73A 3I5UA 1RNLA 1RESA 2QCOA 3M8FA 5LHHA 5LGNA 2NAZA 2X1CA 1XS9A 1E17A 1GLNA 2BXYA 3OYAA 1ZR4A 1Z3XA 4C2UA 1G2HA 2QQAA 2EK5A 3R0AA 4C3HJ 2VE8A 3CMYA 1RR8C 2P7CB 3K4JA 1U5TB 2ZSHB 4HEA2 1BR4A 4IHSA 4UNOA 1IN8A 2O61A 2GIZA 1X1BA 4A3KJ 2LVSA 1R23A 3FMQA 5HLHA 3R6SA 3ZGKA 3OYCA 2QSFX 5IT9K 3I4MJ 2JUCA 1G3TA 3QPLA 2TRTA 4UUSA 3CCEI 2O0YA 2X9DA 2JTVA 2E5NA 4I02A 4NDLA 3NWTA 4IX7A 3K4KA 1O7FA 1T8IA 1ACIA 1BR2A 2UXNA 4MO7A 5TISC 1JGGA 1NG7A 2M30A 3JW4A 1SAXA 5F64A 2ADUA 2M5WA 2EZHA 3GZ6A 3OIQA 3FHNA 2VBZA 1K78B 1LFPA 3KZIC 4MQ9F 1A36A 1WQ2A 1QGPA 2BGCA 3JRHA 4RS8A 2BY1A 3M8JA 3HGYA 1BC8C 3GTPJ 2OPTA 2GAUA 4A0ZA 1E3PA 3RTRA 2K3FA 1P4WA 3IKVA 1OYWA 2YPRA 4BUPA 4BKXA 3G6EI 4ABZA 3W6JB 2R7WA 4IOAF 1O3TA 2EFOA 5IPAA 1YYVA 1S7OA 5FJ8J 2JT1A 3D5SC 3ISPA 3K70C 3OSFA 1T39A 1Z3YA 4M3DA 3VFZA 2IS4A 1U0JA 4Z2YA 3S2WA 3EDPA 2TCTA 1QPIA 2VQHA 2O9LA 2QF7A 1JKOC 4P5OA 5EGOA 3S1NJ 2OU2A 1ZKGA 2JMWA 4XN3A 1XPXA 4MFEA 1Z7LA 4HF2A 2VKDA 5E18F 3GLLA 5J1RA 1ZG5A 1WH7A 4P9FA 2HR3A 4I2OA 2ISYA 1KGSA 2TDXA 1KA8A 1XGMA 5F0FA 1FZPB 1XSXA 1JUMA 4J01A 2LBFA 1RC9A 3S3MA 1PUFB 2K9QA 4HYEA 5F08A 2FUG2 2CW8A 1O4XA 2BE5F 1F43A 1U78A 1XB4A 3TOBA 1HF0A 3CP8A 4PJJA 4RAYA 2FNPA 1IZ1A 1J9IA 1GHCA 4L5EA 4M3GA 3DEUA 4BE0A 2R5YB 2M8EA 1LEBA 4LMYA 3OS1A 4DZPA 2P0WA 5JLWA 2ISZA 1I1GA 3CCRI 3RPUD 5L3EA 2XPUA 3BROA 4RMNA 1JGSA 3A01A 4CO8A 3OR2C 3BR1A 1FWZA 2HVQA 1G4DA 3QYEA 3J80K 3DEEA 4KT5C 2Y2ZA 2LTPA 1SFOJ 1YS6A 2A68F 2V4JC 1W36D 1ZRCA 1FTZA 4XLFA 2ESNA 3DKYA 2VC1A 4KMFA 3RKQA 3TO9A 1RZ4A 1MBHA 3CO7C 1I3AA 3GTKJ 3TW6A 5K1YA 2GBYA 1RR7A 2H6CA 2RQPA 4W97A 2LY9A 1TWFJ 2QEXI 1K4SA 4BQOA 3PFIA 3LSRA 5DD4A 1HKSA 3ASOH 2DJNA 2IJLA 2WAQN 4M6VA 5CYVA 2Y0SN 5BPDA 3OR1C 5DCFA 4XRFA 2VN2A 3N97A 4E7LA 2XGEA 2LD5A 3AG4H 2MABA 2GWRA 4YFXF 2R5ZA 3HTSB 4A3BJ 3KFWX 1JKQC 3AFHA 1U6GA 4XSXF 2LK2A 3CD6I 5HLTA 1SFKA 1QVUA 4NC7A 3AG2H 3TW7A 3SZPA 1ETQA 2P6TA 5HS9A 2QM3A 4BXFA 1J0RA 3RKXA 4OAYA 5F27A 4IOCF 3CMAI 4M3EA 1IC8A 2Z33A 3DU5A 1H89C 2QKLB 2JZYA 3WHBA 2XGCA 1TW2A 4AIHA 3MN2A 3ZR8X 3AL0C 3KCCA 3QOEA 4IEJA 1XG1A 1A35A 1W5CC 3MVPA 2XKOA 1YE9A 5FKOA 3F72A 1T6SA 1DGWY 4IXAA 3TBIA 3OYDA 4EJUA 1SEUA 3IH3A 1ON2A 1ZG1A 5D4RA 1YHQI 3SXYA 4DIQA 4PK4A 4D9JA 3BR3A 4XKBA 2ZCWA 2ZMEC 2HQRA 2W7NA 3V7RA 2L7KA 3HDDA 1IV6A 1ZREA 2BVMA 2X51A 1JJ8C 3PM1A 2MA3A 4X1EA 4HA8A 1MJBA 2E35A 3LFUA 1B6AA 2VUMJ 2F4MB 1RPWA 2ZC2A 4II2A 3ZQQA 5LEJA 2H94A 5L3DA 3CCMI 1Y1WJ 4DYRA 1ERDA 1JHHA 3WU1B 2B0LA 5EZHA 5F6FA 5JFRA 2RQQA 2M7BA 3DBLB 4A12A 4WF2A 1B4AA 1BJAA 2STTA 4J00A 2P5VA 2DLLA 4RB1A 3DCFA 4Z6YA 1J59A 4A3LJ 1VQ6I 4WX9A 2R7FA 3CDIA 4NNJA 3IWZA 4XOPA 2CV1A 2W24A 4PSWA 3BG6A 3ELKA 2ZJQF 5EZGA 4PSXA 1AA7A 1MJAA 2XF7A 3BZKA 1R4NB 5BOXA 3HOZJ 4BAYA 1R36A 3M9AA 3BG9A 2DK8A 3P9IA 3BR0A 3K4MA 4G6DA 4LG0A 1BOAA 3RQIA 1OMIA 1S7EA 5E8GA 3MKWB 2E34A 1J09A 3CC4I 1VNDA 4KIBA 2DXIA 2ZMEA 3FXKA 1LB2A 3U1DA 3E0JB 2A5WA 4WWCA 3HOYJ 1AKHB 1VQ9I 1WHUA 4Q47A 2LLKA 1IN4A 1WKMA 3LNQA 3NWSA 4ETSA 2VE9A 4HDVA 3T8TA 3WGHA 5GPCA 1DU0A 1DU6A 1I6XA 1U3EM 2KMUA 5IOZA 4HQEA 2HEOA 4BXXJ 2N8GA 3T0YA 4N9IA 3I58A 1A5JA 1R4MB 2KIFA 2XF5A 1QHGA 3ZQFA 1X4PA 1NH3A 1D0ZA 3RYRA 1BA5A 1XCBA 3VDXA 3TMOA 3Q0VA 2W82A 4LITA 1S5LC 4JX6A 1V54H 2H09A 3U1KA 4CICA 1MD0A 3ULQB 3S16J 1G3YA 4CZCA 1MBEA 4IF4A 3E6MA 2R3SA 3F23A 2VOOA 1MIJA 5M5XJ 4GRIA 1SVOA 2R5ZB 3FXLA 4O3MA 2EA4A 1FOKA 5ILVA 4AWXB 3L2VA 5AONA 2YU3A 2Z5UA 4E7IA 1B59A 1HXDA 4LG0B 4RGRA 1KU2A 1PJRA 1XMKA 3LSHA 1GVDA 4LFUA 3QAHA 2QSHX 2QZ8A 1Z9CA 1HBXG 2DFEA 3ERED 4IRIA 3S17J 1ZGAA 5D8LB 2JA7J 1USTA 1I1SA 1NTCA 2H1KA 3IC7A 5KHDA 1GDTA 3H0GJ 4A3DJ 1P2FA 3SZTA 2QQBA 2EFNA 4CH7A 1XMAA 2EFPA 1BC7C 3VYUB 3MKYB 3IAM2 1GUUA 1N25A 2R7XA 2FMYA 4PUSA 1BJZA 2PBIA 1GXPA 1VQ5I 2CFOA 3OYEA 1BBYA 1W7PA 1X1DA 3QWLA 1OKRA 1ZYRF 2KJCA 2DO7A 1ETWA 5C4JJ 3CC7I 2L4AA 3KLOA 5FRNA 1I5ZA 5E3MA 3I54A 4MHGA 2X1DA 1Y0UA 3MAJA 3SFIA 2L01A 5JHUA 4JOMA 3CQZJ 3EQLF 2XAHA 4YG2F 4UVAA 4BE2A 2E2JJ 4EJTA 2V9PA 4RAZA 1OCOH 2WA0A 2KDZA 4MGRA 1ZR2A 5KVRA 2KIUA 1RRJA 2FA5A 3R60A 4I98B 2BHYA 1YX3A 2CGPA 4LB5A 2XRNA 2GZWA 2FBKA 1ENHA 1B72A 4PJ0C 3MCZA 3KE2A 3DP7A 3DWLE 2QBYB 4JYKA 3HC7A 4DBQA 4N4OB 5K5OA 3PIPF 4LLNA 3DLLF 3B6CA 2M45A 4WK8F 3HRSA 3ONQA 4IZZA 1L0OC 5DEQA 4A0XA 4F92B 2F6CA 5J8CA 2HOTA 1PYVA 2IA0A 3SYTA 4I6ZA 2DMPA 2OTLI 2ZBKA 3DPLC 2LKSA 1JTYA 2XSDC 3JRBA 3S2DJ 3RKWA 2HPMA 2FOWA 2I8DA 2K27A 2M4KA 4ZTJA 1SFXA 1W7PD 3BDDA 3BCAA 5LRRA 1FC3A 4A5MA 1YI2I 1MW7A 5TJJA 5F1RA 4OOIA 1ZRDA 2DA1A 3WE3A 5ICEA 3N4MA 4R1HA 1FT9A 2NRAC 1QRYA 1R58A 4WXHA 1FYLA 2DFFA 3I64A 1MMSA 3GO5A 2EH3A 3OYHA 2DFHA 3IH2A 2KRFA 2EZKA 4C2MJ 5F0HA 2E36A 4S04A 1PDNC 4EGZA 1VF9A 1WJEA 3OMYA 1R49A 1ETYA 2O5RA 2W4SA 3IP4B 3PNTA 4DQ2A 4CCKA 1U9OA 5D5XB 5KAFC 3BTCA 3H3VK 2JPBA 2AO9A 4YRVA 2MSYA 2VPLA 2WV0A 3BTLA 3MKLA 1K83J 5CVUA 3AL0B 3IAS2 3FBNB 3L2QA 2W48A 2EZLA 2K9SA 3CTAA 2ID6A 3NAUA 5CJ9A 1FJLA 5E1XA 2FD5A 3K4CA 3W6VA 3MD2A 1VQ4I 3FM3A 2CJJA 1I39A 2MC3A 1XN7A 4MIMA 1D1AA 3CCSI 4BJ5C 1L3LA 1RUOA 3W2AA 2HTSA 2VJ4A 2R7SA 1TQMA 2XHKA 1SD4A 5K5QA 3HSRA 1YIOA 2J5OA 1OJLA 4BBRJ 3OSGA 3P7NA 4EM1A 4KJZA 2WBMA 4K2EA 2EJRA 3G4SI 2PQ8A 1D5VA 1WH5A 2IGKA 4A3IJ 3ZCOA 3G1MA 4O6JA 4ON0A 3DKXA 1MNMC 4Y15A 2R7OA 4JK1X 4AD9A 3JAMZ 5C44J 4QTRA 2VQCA 1I3QJ 2Q2EA 4GGGA 4RGXA 1LQ1A 2JA8J 3G73A 5IYBJ 2CQ7A 2DDAA 3HXLA 3BG7A 4A0YA 3PUFA 3FDYA 4LB6B 1SFUA 4JP0A 4OMYA 3PIOF 4IVNA 3NEUA 4N0BA 4PGHA 1Z1DA 3A4CA 1XSVA 2ECCA 5E79C 3SQNA 1TQIA 2BW3A 5LHGA 3ZN1A 4J19A 1Z0XA 1YOVB 3H9GA 2NNYA 2CU7A 3TDZC 2B63J 1FYMA 1IDYA 3HSFA 4GCVA 1T38A 2GLOA 9ANTA 3C2BA 4BU2A 4JQFA 1HW1A 4I09A 2HZTA 1LEAA 2Y30A 2ZFUA 3E1SA 2XASA 1YS7A 2FQ4A 2WC2A 2DA3A 1LFBA 3B02A 1J75A 4X0GA 2IT0A 4G94A 2VODA 2RVCA 2WTEA 1QU3A 4UXNA 1IUFA 3BR5A 3AAFA 2VI6A 4M9ZA 1ZTRA 5H6RA 3E6BA 3S93A 4U0YA 3ZQCA 2DA7A 1VQLI 3KZYA 3HPHA 3G1LA 3DF8A 3CUQC 3PSIA 3WU2C 4G7ZF 1WPKA 4KMUX 3ZMVA 1J7KA 1Y0NA 2EIJH 2RV8A 2ZB9A 5CQEA 1CGPA 1NHAA 2LP0A 3J7ZI 3ECOA 3CZ6A 2FJ1A 3LWFA 4G12A 1WFXA 2EA2A 4EM0B 2DT6A 4U7DA 3SDGA 3GTGJ 2BYVE 5GPAA 3S3NA 1MDMB 5ED4A 4XSZF 2RGVA 3K1PA 4DOZA 1OCRH 2CV2A 3FHZA 1YFHA 4DNCA 2DOEA 3FKIJ 4KUMA 1W1WE 4TV7A 3ZOBA 4H4KC 1ZK8A 4IO9F 2P6SA 2H8RA 1OCPA 1XSDA 2JJ7A 2KZVA 3FXQA 3ZQHA 3HEFA 4LLGF 1HDPA 3EUKL 4AU7A 2H6BA 4I7HA 4CUGA 3SJMA 2JRMA 3K4NA 2XDVA 2CUFA 3HOXJ 3COAC 4CCLA 3HHHA 1QZYA 3R4KA 3KYDB 1P9QC 1BI0A 5B5EC 1ODDA 3LQRA 4D5CA 2KZGA 3H5AA 2DW4A 5H2FC 2WB1N 3DV8A 5ILUA 5LRSA 2R7UA 2LC2A 5DDGA 3WG9A 1FTTA 3FXUA 3TKYA 2Z3YA 3E6DA 5LHIA 3A03A 2R4GA 3ABTA 3CF2A 3TP3A 5K7ZA 4DYQA 2BV6A 2YR2A 2OA4A 2A07F 3OS0A 4XN0A 5HS7A 1Z67A 4BL0B 1LVKA 4EJOA 4AVPA 2LNBA 2HZDA 5KNLA 1ZGJA 3DFGA 5ICFA 3EUAA 4CHUA 2FXAA 1TWAJ 3REOA 1H9TA 4FE4A 4YIFA 1UFMA 3GX4X 3BJOA 3CJRB 5EJCA 4N9HA 2YX7A 3BZCA 1YO5C 5J4YA 3WODF 1X3WB 1SVMA 3OYBA 4XKVA 3ZMSA 4A2UA 2JA6J 4PZJA 2FMLA 2Q2EB 5LGTA 4CXFA 3VSLA 2K40A 2L7FP 2KPMA 3HSEA 1YTYA 1EH7A 4B4CA 3MZHA 3TO7A 2NVQJ 3ZXSA 2COMA 3K2ZA 3FISA 1O3RA 2P7VB 5E3NA 3KEOA 4M3BA 2HDDA 4XLCA 1VQ7I 3NARA 2KRHA 5JR3A 3BPVA 1ZG3A 2VPRA 3TL4X 2Q1ZB 2LMDA 2KRCA 2JQ7A 2DDBA 4AIJA 2E71A 2JN6A 2FSWA 3ABKH 1PP7U 1LKXA 2UV1A 5FRMA 4CA0A 3CMEI 1DQUA 4RLQA 5H20A 4A3GJ 2Y31A 5GADJ 1QA6A 3DKWA 3HRUA 1D0XA 1RI7A 1BN5A 2RREA 2FRHA 5EG0A 1M1EB 3GFIA 2IVMA 3KP3A 2Y9YA 2GA2A 1WGXA 2BY0A 4RM3A 3DPTA 1WJDA 2F5FA 3B6AA 3QYFA 1J2XA 5GAGJ 3VWBA 4HNVA 3VB2A 1RIOH 1V3FA 5B66C 3F8MA 1WRJA 5J1UA 2NS8A 2FEZA 3CJNA 3I3LA 2GOXB 4EJWA 5CVIA 4UB8C 4BE1A 1TC3C 1HKTA 3WTTC 4EQQA 5D5VB 1REPC 3GXOA 1O57A 2CYYA 2WY8Q 1DUXC 4FCYA 5IP6A 3PNVA 4I99C 5IP7J 3KIOA 2MH2A 5J8FA 1NK3P 4IHTA 3CP2A 2LG4A 2HKXA 4PCQA 3OYLA 1Q1HA 2ZJPF 2ZXIA 4KIFA 2ZNZA 5FKLA 4B09A 3OYGA 4E7JA 2DI3A 3GEZA 3BJAA 4YELA 2XB0X 1XMXA 3WTYC 3DU6A 3GTLJ 4AUXA 2EIMH 1K4TA 3KP4A 1YRNB 3DTKA 4AIKA 3HBLA 4NC8A 3IWFA 1WJBA 1R1UA 2OAZA 2EQRA 5EF6A 5EDNA 3GW2A 4KT6A 1PUFA 1P92A 3O8HA 3P9CA 1Z6TA 1GXQA 3L09A 3JRIA 1RETA 4ZYEA 3T5XA 3WGGA 2F4OB 3ZMDA 1P4XA 5KK1A 2VKEA 3E7LA 4UUSB 3QPSA 2DYSH 4KN4X 1R71A 2CW7A 5DTDA 1IRGA 3E5XA 5E20A 4ASNA 2PLYA 3R0JA 4YFKF 2R92J 1KONA 2K7LA 4C2TA 1WCMJ 4EMSA 1HC8A 4ZDOA 2Y48A 5DCMA 2E7XA 2CQXA 4JX4A 3G71I 2K3PA 2Q8KA 3H3UA 4OU0A 1QPMA 4KICA 4GXOA 4U88A 1MMGA 3EUHC 4D5FA 1IJWC 2O8XA 3JR9A 2LRDA 1FMWA 3E5QA 4E4HA 1EH8A 2OZ6A 2E1MB 1A04A 3VODA 3W6KB 4DBRA 5IT3A 3LA7A 4XMYA 2IW5A 1STZA 3OYNA 2VOPA 2PX9A 4JX5A 4RGUA 2FBHA 4D1QA 2QVOA 3H36A 5TGTA 2JK3A 2HVSA 3DPUA 1MZBA 1MBGA 5J40A 3F8CA 1Z77A 2R7VA 2EWNA 3CUQB 2V79A 4LGWA 4A3EJ 2IGMA 2DAOA 1Y8RB 4FTHA 1IN6A 2M4GA 4FASD 1LE8B 4Y17A 1FIPA 3CUOA 4BQNA 1F9NA 3K10A 3I59B 1T98A 3ZQGA 1HA8A 4GO1A 1R1VA 3ERMA 4FE7A 2KL4A 2HNHA 3KPHA 4M3FA 2G0EA 3WGIA 3JRAA 4KDPA 3AG3H 3HUGA 4RM2A 4EGYA 3GFMA 2CSOA 3A02A 3IH4A 5L3BA 5E3OA 2XPWA 2BXZA 1S72I 1TP4A 4CYDA 3ZMZA 1YG2A 4XICA 1TNTA 4A3MJ 2M9HA 4CYCB 5B1BH 1Y6IA 2NVUB 2CFXA 1E2XA 1D8JA 4MQVA 1CQTA 3FK7A 2HGCA 3OIPA 3KYCB 4Y7NJ 4MEXF 3L7WA 4GYGA 1CF7A 1MJ9A 1XGSA 3A2KA 1IRFA 3HJEA 3BWGA 3CCLI 4RAGA 1XD7A 2X6YA 4A3JJ 1X2NA 2QQ8A 5HDNA 3W2WA 4ENNA 2DMTA 2OCEA 2J5PA 1IXRC 2OJED 3ABMH 2R0QC 3H92A 2EB7A 1WJFA 2XUBA 4BEHB 1I27A 1LFUP 2PMHA 4U0WA 5F0CA 5FGMA 3LA2A 3PJRA 3LOCA 4QPOA 3I9V2 3ZQIA 4CCMA 3F6OA 3FKJA 1A6IA 2XAGA 2O6GE 4NUBA 2V1NA 1SANA 1H9GA 2RNJA 2EINH 3LMMA 3CMMA 4BH9A 3OL3A 5HLGA 5DM6F 3ZP5A 3X2QH 3U9GA 2HXOA 1G3WA 3RQ4A 4ZZDA 3K4BA 2B9SA 2A6HF 2A5YB 3QYBA 3WG7H 4CYCA 2VLAA 5HNFA 4B48A 1OCZH 5GTIC 3V8LA 1D3YA 4NBQA 4OIPF 2P81A 1BW5A 1FY7A 1TT5B 1ZAOA 4Q4ZF 5HS8A 2L7MP 2VC0A 4IHXA 3CO6C 4ZYDA 4MFDA 4Y3OA 1DDNA 4EVIA 4XKCA 4GYIA 3HOSA 4ANJA 4RB2C 4V19K 1BW6A 3V8JA 5J1YA 1R00A 2MD5A 2XAQA 2VJ5A 2X6XA 1IO2A 2W00A 1JI8A 3Q9VA 2IS2A 1SC7A 2DPUA 4M72A 3DXJF 1G8XA 4HX4A 3AKZA 2L0KA 1ONVA 2UZKA 2L4MA 4MNUA 1FYKA 2R7ZJ 3DTIA 2JSCA 1FNNA 2CUEA 2PG4A 3S1RJ 3GMEA 3GYHX 1X1AA 4QWQA 4U7BA 3V4GA 2IEKA 3V42A 2PEXA 2IS6A 1O3QA 1QQIA 1X58A 2JRTA 3BLYA 5EGOB 3CUQA 1S3JA 2CUJA 1TWHJ 3Q0WA 1MH3A 5CVRA 4YIRX 3OYMA 1LE8A 2VIXA 1ON1A 1FMVA 1TT0A 2AXLA 3K2AA 4RBOA 3LA3A 3FZVA 4B47A 4L0YB 4KIGA 2ID3A 2A3SA 2RAEA 1T08B 2XAJA 1JT6A 4PFPA 5HVQC 5EYRA 4RDUA 5DCMB 4C9YA 1AU7A 2V6EA 3ROUA 3PQJA 4HNTA 3K9TA 4LIUA 1X4OA 5IYCJ 2PMZA 3RIRA 3ZN0A 4L5JA 2G7HA 4P96A 4F93B 1O3SA 5GAHJ 1Z91A 2XPVA 2HDCA 1TQPA 1BR1A 1YJNI 4AM3A 4I76A 5JLXA 1FOWA 2ZXJA 4A5NA 5D8KB 3S1QJ 4UUVA 5J47A 3CCUI 1JXSA 2EZIA 2CG4A 1S29A 2V1DA 1KQ9A 2K5CA 1Z6RA 4HBLA 4OIQF 3PL8A 2HU9A 2NVXJ 3J7AY 3PSFA 2MGQA 3PFYA 2MG4A 4WXDA 2HTJA 1USSA 4M71A 4DZJA 4ZYGA 2AS5F 3M3YJ 3C7JA 3BQZA 2XC7A 2V9VA 1FBUA 5JVTA 1APLC 4L5IA 2OF7A 1D1CA 5FFXA 5HODA 2FNAA 1W5SA 2EV0A 5BQTA 3GBGA 4KITB 2M8GX 2OQRA 2HOEA 3UNGC 1IUYA 2IPQX 1SMTA 2V9KA 1HCRA 1YITI 3MKZA 4WCGA 2IP2A 3E97A 4CCNA 2O8KA 2L9RA 1IG7A 3H9JA 3LL7A 3SHFA 2K9LA 1MBJA 3A1YA 3Q0UA 1FP1D 2OQGA 4KA4A 1JKPC 2LF8A 3JTGA 4GDFA 2HOAA 3PQKA 1FIAA 3W3CA 3OYJA 1MSEC 2IAIA 1S9HA 3HYIA 2XVCA 1HLVA 1ETOA 3MEXA 3K0LA 1VTNC 2IA1A 1Y39A 1QZZA 3SEZA 3M07A 4YIIA 4HNUA 2DCEA 5FKMA 2DOFA 1U8RA 4A93J 2VASA 4LD5A 1UAAA 2DJIA 2ZJRF 2IS1A 3ZQLA 1LVAA 2XAFA 4E70A 1DGRM 5ICGA 3QODA 3QPTA 4OINF 2MFZA 3GF2A 3KX2A 1UHMA 3HKZN 1UB9A 2NNNA 4HOBA 2STWA 2ZXWH 4A3FJ 3T8RA 1LDJA 2L54A 6PAXA 2CS3A 1Z21A 2LSOA 3PUBA 4NB5A 4A6EA 4BS9A 2P5LC 3DBHB 1K6YA 2Y75A 4YFNF 2P4WA 2RN7A 3QPHA 5A2QK 2MLGA 1TW3A 2PN6A 3BG3A 4ZDPA 3WE2A 5FLXZ 3W2VA 2BY3A 3QRFF 2ACJA 2DMQA 1IF1A 5C3EJ 5D5UB 1AOYA 1TLHB 1WJ5A 4G9YA 4D7MA 2QWWA 1VQKI 1Y1VJ 3MWMA 1T56A 1QVTA 1KYWA 4PJNA 1MNDA 3I56I 2PFBA 2L9NA 2NS0A 3OV8A 3HIFA 3H1CA 5DYMA 3RSNA 3HL2A 2A69F 2Q0OA 3P5JA 1JUPA 3F8BA 3HHGA 3RPQA 4BHPA 4E7KA 4KNYA 2OTJI 3QP6A 3GFJA 4F3QA 5J4VA 2FBIA 4PJLA 5H6QA 2QKMB 2PJRA 3Q3SA 1N77A 3LSGA 3GTJJ 3WU0A 1IRZA 3F21A 1OISA 4JBAA 2KJBA 4CDGA 1K6OA 1SD7A 3Q5FA 1G6NA 2HS5A 2RC4A 2AQEA 2JVHA 4IHWA 2GXGA 3PO3J 4OAZA 1J5YA 3OOUA 4L9JA 2E2HJ 2GQQA 3BR2A 3C2HA 1IN7A 2PI0A 4BNCA 4B8XA 2DA2A 2DQRA 2EILH 4RB0A 1UHWA 3J7YJ 4XLEA 1EF4A 3FM5A 5FLMJ 4UVCA 1K79A 1RKWA 3I4PA 3WTSC 3BC8A 4IKFA 2K9MA 2IBDA 2K86A 2DODA 2M0MA 1MMAA 1FBSA 3OYFA 2LDUA 1RUNA 4PJMA 1H0MA 1XDUA 2P5KA 3S8PA 4ESJA 1NK2P 2VL8A 2MH9A 2COBA 1W0UA 1DPRA 2BVLA 2VT3A 3U21A 3QU3A 2XRLA 4F52A 2M87A 4II3A 3TO6A 1OCTC 4XLNF 5FLXK 2ZO4A 3SZGA 1V4RA 5HLIA 4EEFG 4H0EA 1TL8A 1FBQA 3EETA 3N05A 3O6BB 4PFOA 2HXIA 3SFZA 1LUJB 2KDOA 4RLFA 1ULYA 1YJ9I 1XTAA 2ETHA 1ETKA 2X4HA 4XRSA 1WVRA 2W25A 2BBYA 2EBIA 3FX3A 4UY8I 2HOSA 3EUHA 3GVAA 1DPUA 4Y52J 4FQGA 3EYIA 2L7ZA 2M7AA 3IRQA 2CUZA 5IY5H 4HF1A 2JUGA 3K1NA 4LJZF 5M3MJ 1U8BA 2NVYJ 5ICCA 2EIKH 1W0TA 1WZ2A 4KN7X 3E5UA 4V2FA 2WWYA 3LSPA 3I0TA 2CQKA 2DMNA 5L3CA 3J81K 3G3ZA 4DW6A 1ZLJA 4HX8A 1W4MA 4HV6A 4XBFA 2X6OA 2O03A 2ICWG 2X6WA 2R7RA 2VJJA 2DTRA 2XGXA 3EPZA 1BIAA 1R6RA 1D8KA 3G1OA 5F04A 2LKPA 2DYRH 1FP2A 3QU6A 1JT0A 2B7EA 2ZJ2A 3BJ6A 2CH0A 3OS2A 3F6VA 2E1NA 1YLFA 3H3ZA 2DPDA 5M3FJ 4XLAA 2A6TA 1IAWA 5DUKA 1XGNA 1O7LA 5J3LA 1UG2A 1VQMI 3QP5A 2A6EF 5BMZA 4XLHA 1W7PB 1A31A 3JCUC 3CF5F 4KISA 3CJTB 1MMDA 1UJ8A 3JTHA 4PDKA 4UUTA 3CDLA 3BT9A 4ZH4F 3JRCA 2Y9ZA 2F5EA 1QBJA 2DQLA 1F4KA 2KFDA 3TDUC 1BM9A 1E0EA 4HG2A 2DU9A 1IXSB 1OYYA 2Z99A 1XDSA 1Q1VA 3L2RA 3HOTA 5LGUA 4HF0A 3V8KA 3RKYA 3C2GA 1SMYF 2E60A 2CRGA 5F1JA 2LYCA 3A0HC 1FSEA 2XROA 5JHFA 1MSFC 1HQCA 1WSUA 3IHUA 5FFZA 4W1UA 4G7OF 4BDZA 4U87A 2CW0F 3JRFA 4E6KG 4EJVA 3F9KA 2IRFG 4BGDA 3E6CC 4LG3A 4HX7A 4EM2A 2CQQA 2E7WA 2Y69H 3G2BA 4G8XA 4XQFA 4X6AJ 2BHZA 1KQ0A 4XOTA 4XRMA 1QHHD 1HKQA 3ML6A 2NOGA 2QLZA 3KP7A 1AHDP 1BOBA 2R93J 2LR8A 4E7ZA 2UUZA 5AIPA 3WTWC 5DV5A 2WAEA 3KP5A 2ZXHA 4AYBA 5E1ZB 4XL9A 1AWCA 3KYLA 2L02A 2H8WA 4O5VA 4NHJA 4Y4RA 2HYFA 2CV0A 3ABLH 1EV7A 3BZ6A 5JI6A 3F8NA 1MH4A 1E3HA 3FBIB 2NVTJ 2FX0A 3RDIA 2DA5A 3ABUA 2WB1A 3EYYA 4IJAA 1MMNA 2DT7B 1S7AA 2VQLA 3IRRA 1FX7A 2R7DA 2YUSA 3K69A 2KIMA 3LQQA 1R5ID 1UCRA 2K4JA 4HAMA 2E19A 1TWCJ 1U5TC 3F0CA 1LNWA 2O3FA 2QUFA 4BHCA 3PO2J 1F1ZA 2Y0SA 4FX0A 3ZMUA 1HDDC 2ELKA 3WTUC 3GTMJ 3HRMA 2F4IA 2ZKZA 4S0HB 2MYSA 3C3WA 3HOUJ 3H0DA 1GT0C 2KISA 3D5LA 4C3IJ 5FKNA 2L5QA 2FU4A 4QIWN 3IV5A 3ASNH 1ZARA 3KEYA 4B3AA 5J6XA 4HSTA 3BG5A 2LH9A 4MEYF 4M6XA 1LJ9A 4XIDA 1XX5A 4HV5A 1KU7A 1V5EA 1JTXA 1UG0A 2VBYA 3HTUA 4LLLA 4XLPF 3C1DA 1T2KA 2YU9J 4CCOA 4ZTFA 2L2OA 1IXCA 2UXXA 3CESA 4C3JJ 3FMRA 2I10A 2ME0A 3HOVJ 4LK0F 4D0PA 1U2WA 2QQ9A 1IW7F 1DP3A 4R79A 3IKTA 2W85A 1P6RA 5K5RA 1D1BA 3V7CA 5IYDJ 4BQQA 3ZQ7A 2DTZA 5CLSA 4OIOF 4A69C 4B1RA 3FK6A 1K61A 2KT0A 3KETA 5HDKA 1ZGWA 1T0FC 4IHVA 1V5FA 1VQNI 2HI3A 4L18B 4QPQA 2KQRA 1MKMA 3HRTA 3QQAA 2QA4I 2HWVA 1FOXA 2KP6A 4V2GA 1FOYA 3L2CA 2E5ZA 4AC0A 2HFHA 2KIQA 3KP6A 4UV9A 3L2UA 3FWEA 3MZYA 5FD6A 3MFKA 2DA4A 3OYIA 2HQAA 3WTZA 2K02A 3RZDJ 2PJPA 1SD6A 2AHQA 1UMQA 1SAUA 4ESFA 3BY6A 1KU9A 1R9TJ 1S8NA 1ORKA 1ITYA 3O2PE 3BTIA 3MMYB 1T95A 2P8TA 4HQMA 4BXUA 1GVJA 4ZYHA 2BY2A 4F91B 3DTEA 2EFWA 3I71A 5HOOA 2X85A 2GIVA 5ILSA 3VSKA 3JREA 4FX4A 1OFCX 2IGNA 4BY7J 5E1WA 1XCVA 1X3ZB 2HYJA 2LOOA 3GZ5A 2FE3A 2FQ3A 2X1EA 2E2IJ 3HG9A 1TNSA 5KCMA 2KHMA 1R22A 3HKZA 4HDUA 3U2RA 1YX5A 5IT9Z 4PGGA 1GV5A 2OZUA 2XIGA 2PJRB 3A0BC 4UB6C
chains in the Genus database with same CATH topology
1T0FA 3WTVC 3ZPLA 2IA2A 3GUDA 1F5TA 2V6CA 3IL2A 3BOQA 3P9KA 4MTDA 4R8HA 3I59A 3JSOA 5DUIA 1YW9A 2F5DA 2M1BA 2VBXA 1HW2A 4HZFA 1G3SA 2XV4S 3TOAA 5LEKA 1ZN2A 3Q9SA 3MQ0A 3O3KA 3RPUA 2RKHA 3F22A 5D4SA 1LDKB 2VXZA 2ZNYA 4NQWA 5CVVA 5FB2A 2VT2A 1B1BA 2EFQA 3J81Z 4WXCA 4MTEA 1XGOA 3ZMTA 2ZMEB 2YSRA 1KYZA 1ZLKA 5TRDA 2CWEA 2QYOA 1HSJA 3LAJA 3M8EA 4I0AA 1SD5A 2D45A 2F2EA 3I53A 1OR7A 1R1TA 1SFEA 2HQNA 1HSTA 2V1UA 5LLQA 4I0BA 4UV8A 1KQ8A 1TBXA 2YX4A 1W5TA 3M1EA 2E1CA 3F3XA 3CDHA 2QBYA 3LFKA 4OIRF 3DQVC 1FPQA 4HLYA 4L9NA 1HW5A 4U0VA 2VONA 1YW7A 3KP2A 1MDMA 3BPXA 2ELHA 4IRHA 4IPAA 2G9WA 3RJPA 2C6YA 4M6YA 4BHBA 4P9UA 3GFLA 5EEGA 3TGNA 2MLKA 5AIQA 2DBBA 3RI4A 1JHFA 4S05A 2A61A 1FLIA 2DFIA 3TQNA 1ZRFA 2OD5A 4ENKA 5LBQA 2CO5A 1YW8A 4FHTA 3KEQA 2X0LA 4BQAA 2FF4A 3V7SA 2GA1A 4G6QA 3R61A 3J80Z 1ZHFA 1K7AA 1PUEE 4ESBA 1OPCA 5E17F 1KU3A 5BPIA 1K78A 4G7HF 2HKOA 1JE8A 1DP7P 5FD5A 3NRVA 1QNTA 2Y0MA 5L3GA 4RB3C 3FF5A 1Z05A 5HDGA 2BEOA 3WTXC 2W84A 4IRGA 4EV0A 3OOPA 3D0SA 4Q48A 1P4AA 3JSPA 4HW0A 2F5CA 2DT5A 4KYWA 4UHTA 5D6EA 3LAPA 1YQAA 2JPCA 1IN5A 1EH6A 5CVJA 1BI3A 4HLXA 4L9TA 4M9SA 3FMSA 2PMUA 3GLXA 3ECHA 2OBPA 1Z7UA 4RGSA 2ESHA 1B9MA 2EV6A 3KLNA 3BP8A 2UWMA 3VEPA 1ZH5A 3VOEA 2L3DA 5EEHA 2GXBA 1WI9A 1PP8F 1BIBA 4ENMA 4CZZA 1LDDA 1MGTA 3E3VA 3QOPA 1U5TA 5DD8A 1C0WA 1R5HA 2MBFA 4L9VA 3F8FA 5D6FA 4M74A 1TTYA 1B9NA 1R7JA 2QENA 4ZZLA 3J7AO 3GWZA 1QO0D 4L0ZB 3RYPA 1OYIA 3M7GA 1X3UA 2HYGD 2KKOA 3KZZA 2Z9OA 2EV5A 4Q5SF 4A6DA 2ZFWA 5ERIA 2D2WA 4F7ZA 1WWXA 3C18A 2H27A 2V1XA 3NQOA 4UVBA 1S6LA 3JAMK 3FXRA 4P55A 5FO5A 5BS6A 2FOKA 2XKPA 2RDPA 4FT8A 1FSHA 2LF7A 2VBWA 2G7UA 2W57A 2D1HA 4M9XA 3CLOA 4I01A 1BI2A 1R5GA 2D1VA 4ENJA 3K1MA 4CGZA 5D5WB 4BYYA 4LK1F 3LSTA 3L9FA 3B73A 5L3FA 2NYXA 4Y13A 5E8IA 3T1BA 2DK5A 5A2QZ 2K4BA 4OMZA 1CF7B 4QLCU 1BI1A 4KFCA 3L00A 4M73A 3I5UA 1RNLA 3M8FA 5LHHA 5LGNA 2NAZA 1E17A 2EK5A 2QQAA 3R0AA 2VE8A 2P7CB 1U5TB 4UNOA 4IHSA 1IN8A 2O61A 1R23A 3FMQA 5HLHA 3R6SA 5IT9K 1G3TA 2O0YA 2JTVA 4I02A 1O7FA 2UXNA 2M30A 3JW4A 1SAXA 5F64A 2ADUA 2M5WA 3GZ6A 2VBZA 1K78B 4MQ9F 1WQ2A 1QGPA 2BGCA 4RS8A 1BC8C 2GAUA 4A0ZA 3RTRA 3IKVA 1P4WA 1OYWA 2YPRA 3W6JB 1O3TA 2EFOA 1YYVA 1S7OA 2JT1A 3ISPA 1T39A 3VFZA 4Z2YA 3S2WA 3EDPA 4P5OA 2OU2A 4HF2A 5E18F 1ZG5A 4P9FA 2HR3A 4I2OA 2ISYA 1KGSA 2TDXA 1KA8A 1XGMA 1FZPB 1XSXA 4HYEA 2BE5F 1U78A 1XB4A 3TOBA 4RAYA 2FNPA 1IZ1A 1J9IA 1GHCA 3DEUA 2M8EA 1LEBA 4LMYA 2ISZA 1I1GA 5L3EA 3BROA 1JGSA 4CO8A 1FWZA 1G4DA 3J80K 4KT5C 1YS6A 2A68F 1ZRCA 2ESNA 2VC1A 4KMFA 3TO9A 1RZ4A 3CO7C 5K1YA 2RQPA 2H6CA 3PFIA 5DD4A 1HKSA 2IJLA 5CYVA 5BPDA 5DCFA 4XRFA 2VN2A 3N97A 2GWRA 4YFXF 3HTSB 3KFWX 1U6GA 4XSXF 3SZPA 2P6TA 5HS9A 2QM3A 1J0RA 3RKXA 2Z33A 2JZYA 1TW2A 4AIHA 3KCCA 2XKOA 3F72A 1T6SA 4IXAA 4EJUA 1ON2A 1ZG1A 5D4RA 3SXYA 2ZCWA 2HQRA 3V7RA 1ZREA 2MA3A 4HA8A 1MJBA 1B6AA 5LEJA 2H94A 5L3DA 1JHHA 3WU1B 2B0LA 5F6FA 5JFRA 4A12A 4WF2A 1B4AA 1BJAA 2STTA 2P5VA 2DLLA 4RB1A 1J59A 4WX9A 2R7FA 3IWZA 2W24A 3ELKA 1MJAA 5BOXA 4BAYA 1R36A 3M9AA 3P9IA 2DK8A 4G6DA 4LG0A 1BOAA 1OMIA 5E8GA 4KIBA 2ZMEA 1LB2A 3U1DA 4WWCA 4Q47A 1IN4A 1WKMA 2VE9A 4ETSA 4HDVA 3T8TA 3WGHA 1I6XA 1U3EM 4HQEA 2HEOA 3T0YA 4N9IA 3I58A 2KIFA 3RYRA 1XCBA 2H09A 4CICA 1MD0A 3ULQB 1G3YA 4IF4A 3E6MA 2R3SA 3F23A 2VOOA 4O3MA 2EA4A 1FOKA 5ILVA 4AWXB 5AONA 2YU3A 2Z5UA 1B59A 1HXDA 4LG0B 4RGRA 1KU2A 1XMKA 4LFUA 3QAHA 2QZ8A 1Z9CA 1HBXG 3ERED 4IRIA 1ZGAA 5D8LB 1USTA 1I1SA 3IC7A 1P2FA 3SZTA 2QQBA 2EFNA 1XMAA 2EFPA 1BC7C 2FMYA 2PBIA 1GXPA 1BBYA 1W7PA 1OKRA 1ZYRF 2KJCA 2DO7A 2L4AA 3KLOA 1I5ZA 3I54A 4MHGA 1Y0UA 3MAJA 2L01A 5JHUA 3EQLF 2XAHA 4YG2F 4UVAA 4EJTA 4RAZA 4MGRA 5KVRA 2KIUA 2FA5A 3R60A 4I98B 2CGPA 4LB5A 2XRNA 2GZWA 2FBKA 3MCZA 3KE2A 3DP7A 2QBYB 5K5OA 4LLNA 2M45A 4WK8F 3HRSA 1L0OC 5DEQA 4A0XA 5J8CA 2IA0A 2ZBKA 3DPLC 3RKWA 2K27A 1SFXA 1W7PD 3BDDA 5LRRA 1FC3A 4A5MA 5TJJA 5F1RA 4OOIA 1ZRDA 3WE3A 5ICEA 3N4MA 4R1HA 1FT9A 2NRAC 1R58A 4WXHA 1FYLA 3I64A 3GO5A 2KRFA 4S04A 1PDNC 4EGZA 4DQ2A 5D5XB 2JPBA 2WV0A 5CVUA 3CTAA 5CJ9A 5E1XA 3FM3A 2MC3A 1XN7A 1L3LA 1RUOA 2HTSA 1TQMA 2XHKA 1SD4A 5K5QA 3HSRA 1YIOA 2J5OA 3P7NA 4EM1A 4K2EA 2EJRA 2PQ8A 1D5VA 4O6JA 4ON0A 4Y15A 4JK1X 4AD9A 3JAMZ 2Q2EA 4GGGA 4RGXA 1LQ1A 3G73A 4A0YA 4LB6B 1SFUA 4OMYA 4IVNA 3NEUA 4N0BA 4PGHA 1Z1DA 1XSVA 3SQNA 1TQIA 5LHGA 3ZN1A 2NNYA 3TDZC 1FYMA 3HSFA 1T38A 4GCVA 4JQFA 1HW1A 4I09A 2HZTA 1LEAA 2XASA 1YS7A 2WC2A 1J75A 3B02A 2IT0A 4G94A 2VODA 2RVCA 2WTEA 4UXNA 3AAFA 4M9ZA 5H6RA 3E6BA 4U0YA 3KZYA 3DF8A 3CUQC 4G7ZF 4KMUX 3ZMVA 1J7KA 2RV8A 1CGPA 1NHAA 3ECOA 3LWFA 2EA2A 4EM0B 4U7DA 2BYVE 1MDMB 5ED4A 4XSZF 2RGVA 3K1PA 3FHZA 1YFHA 4DNCA 4KUMA 4TV7A 2P6SA 1XSDA 3FXQA 4LLGF 2H6BA 4I7HA 3COAC 3HHHA 1QZYA 3R4KA 1BI0A 1ODDA 3LQRA 5LRSA 2DW4A 5ILUA 3DV8A 5DDGA 3WG9A 3FXUA 3TKYA 2Z3YA 5LHIA 3E6DA 3ABTA 2BV6A 2YR2A 2OA4A 2A07F 5HS7A 4EJOA 4AVPA 2LNBA 1ZGJA 3DFGA 5ICFA 4CHUA 2FXAA 3REOA 1H9TA 4YIFA 3GX4X 1UFMA 3BJOA 4N9HA 2YX7A 1YO5C 3WODF 3ZMSA 4A2UA 4PZJA 2FMLA 4CXFA 5LGTA 3HSEA 1YTYA 1EH7A 3MZHA 3TO7A 2COMA 3K2ZA 1O3RA 2P7VB 3KEOA 5JR3A 3BPVA 1ZG3A 4AIJA 2FSWA 1PP7U 5H20A 3DKWA 3HRUA 1RI7A 1BN5A 2FRHA 3GFIA 2IVMA 3KP3A 2GA2A 3DPTA 2F5FA 1J2XA 3VB2A 1RIOH 1V3FA 3F8MA 1WRJA 2FEZA 3CJNA 4EJWA 5CVIA 1HKTA 3WTTC 4EQQA 5D5VB 1REPC 3GXOA 1O57A 2CYYA 1DUXC 2MH2A 5J8FA 4IHTA 2HKXA 4PCQA 1Q1HA 4KIFA 2ZNZA 4B09A 2DI3A 3GEZA 3BJAA 3WTYC 3KP4A 4AIKA 3IWFA 1R1UA 2OAZA 3GW2A 1P92A 3P9CA 1Z6TA 1GXQA 3L09A 4ZYEA 3T5XA 3WGGA 3ZMDA 1P4XA 5KK1A 4KN4X 1IRGA 3E5XA 5E20A 4ASNA 2PLYA 3R0JA 4YFKF 2K7LA 4EMSA 2Y48A 5DCMA 2E7XA 2Q8KA 3H3UA 4OU0A 1QPMA 4KICA 4GXOA 4U88A 2O8XA 3E5QA 1EH8A 2OZ6A 1A04A 3VODA 3W6KB 5IT3A 3LA7A 2IW5A 1STZA 2VOPA 4RGUA 2FBHA 2QVOA 1MZBA 3F8CA 2EWNA 3CUQB 2V79A 4LGWA 2DAOA 1IN6A 4Y17A 3CUOA 1F9NA 3I59B 1T98A 4GO1A 1R1VA 3WGIA 4KDPA 3HUGA 4EGYA 3GFMA 2CSOA 5L3BA 4CYDA 3ZMZA 1YG2A 1TNTA 2CFXA 1E2XA 1D8JA 4MQVA 2HGCA 4MEXF 3L7WA 4GYGA 1CF7A 1MJ9A 1XGSA 1IRFA 3BWGA 1XD7A 5HDNA 4ENNA 2J5PA 1IXRC 3H92A 2EB7A 2XUBA 1I27A 2PMHA 4U0WA 5FGMA 3LA2A 3F6OA 2XAGA 2O6GE 1H9GA 2RNJA 4BH9A 5HLGA 3ZP5A 3U9GA 1G3WA 4ZZDA 2A6HF 2A5YB 3V8LA 1D3YA 4OIPF 1FY7A 1ZAOA 4Q4ZF 5HS8A 2VC0A 3CO6C 4ZYDA 1DDNA 4EVIA 4GYIA 3HOSA 4RB2C 3V8JA 1R00A 2MD5A 2XAQA 3Q9VA 2DPUA 4M72A 3DXJF 4HX4A 1ONVA 2UZKA 2L4MA 4MNUA 1FYKA 2JSCA 1FNNA 2PG4A 3GYHX 4QWQA 4U7BA 3V4GA 2PEXA 1O3QA 1QQIA 2JRTA 3CUQA 1S3JA 5CVRA 1ON1A 2AXLA 3LA3A 3FZVA 4L0YB 4KIGA 2A3SA 2XAJA 5HVQC 5DCMB 3ROUA 3PQJA 3K9TA 3RIRA 3ZN0A 4L5JA 2G7HA 4P96A 1O3SA 1Z91A 2HDCA 1TQPA 2ZXJA 4A5NA 5D8KB 4UUVA 1JXSA 2CG4A 1S29A 2V1DA 1KQ9A 1Z6RA 4HBLA 4OIQF 4WXDA 2HTJA 1USSA 4M71A 4ZYGA 2AS5F 3C7JA 2V9VA 1FBUA 5JVTA 4L5IA 5FFXA 2FNAA 1W5SA 2EV0A 5BQTA 2OQRA 2HOEA 1IUYA 2IPQX 1SMTA 4WCGA 2IP2A 3E97A 3SHFA 1FP1D 2OQGA 4KA4A 2LF8A 3JTGA 3PQKA 3HYIA 2XVCA 3MEXA 3K0LA 1VTNC 2IA1A 1QZZA 4YIIA 1U8RA 4LD5A 1LVAA 2XAFA 4E70A 5ICGA 3QPTA 4OINF 3GF2A 1UHMA 1UB9A 2NNNA 4HOBA 2STWA 3T8RA 1LDJA 2L54A 6PAXA 2LSOA 4NB5A 4A6EA 2P5LC 2Y75A 4YFNF 2P4WA 2RN7A 3QPHA 5A2QK 2MLGA 1TW3A 2PN6A 3WE2A 3QRFF 5FLXZ 2ACJA 1IF1A 5D5UB 1AOYA 1TLHB 4G9YA 2QWWA 3MWMA 1KYWA 2PFBA 2NS0A 3OV8A 3HIFA 5DYMA 2A69F 2Q0OA 4BHPA 3F8BA 3HHGA 3RPQA 4KNYA 3QP6A 3GFJA 2FBIA 5H6QA 3WU0A 3F21A 4JBAA 2KJBA 4CDGA 1K6OA 1SD7A 3Q5FA 1G6NA 2HS5A 2RC4A 2GXGA 1J5YA 4L9JA 4BNCA 2GQQA 1IN7A 2PI0A 4B8XA 2DQRA 4RB0A 1UHWA 3FM5A 4UVCA 1K79A 3I4PA 3WTSC 2K86A 1FBSA 2LDUA 1RUNA 1H0MA 1XDUA 2P5KA 4ESJA 2MH9A 1DPRA 2VT3A 3QU3A 2M87A 3TO6A 5FLXK 4XLNF 2ZO4A 1V4RA 5HLIA 4H0EA 1FBQA 3EETA 3O6BB 3SFZA 1ULYA 2X4HA 2ETHA 2W25A 2BBYA 3FX3A 3EUHA 3GVAA 1DPUA 3EYIA 3IRQA 4HF1A 3K1NA 4LJZF 5ICCA 4KN7X 3E5UA 2WWYA 3I0TA 2CQKA 5L3CA 3J81K 3G3ZA 1ZLJA 4HX8A 1W4MA 4HV6A 4XBFA 2O03A 2DTRA 2XGXA 1BIAA 1D8KA 2LKPA 1FP2A 3QU6A 2ZJ2A 3BJ6A 3F6VA 2E1NA 1YLFA 3H3ZA 2DPDA 1IAWA 5DUKA 1XGNA 1O7LA 3QP5A 2A6EF 5BMZA 1W7PB 3JTHA 4PDKA 4ZH4F 2F5EA 1QBJA 2DQLA 1F4KA 3TDUC 1BM9A 2DU9A 1IXSB 1OYYA 2Z99A 1XDSA 3HOTA 5LGUA 4HF0A 3V8KA 3RKYA 1SMYF 1FSEA 2XROA 1HQCA 1WSUA 3IHUA 5FFZA 4G7OF 2CW0F 4EJVA 2IRFG 3E6CC 4HX7A 4EM2A 2E7WA 4G8XA 1KQ0A 1HKQA 3ML6A 2QLZA 3KP7A 3WTWC 5AIPA 5DV5A 3KP5A 5E1ZB 1AWCA 2L02A 4O5VA 4NHJA 2HYFA 3BZ6A 1EV7A 5JI6A 3F8NA 3RDIA 3ABUA 3EYYA 4IJAA 1S7AA 3IRRA 1FX7A 2R7DA 3K69A 2KIMA 3LQQA 1UCRA 4HAMA 2K4JA 1U5TC 1LNWA 2O3FA 2QUFA 4BHCA 1F1ZA 4FX0A 3ZMUA 3WTUC 3HRMA 2ZKZA 3C3WA 3D5LA 2FU4A 1ZARA 5J6XA 4MEYF 4M6XA 1LJ9A 4HV5A 1KU7A 2VBYA 3HTUA 4LLLA 4XLPF 3C1DA 1T2KA 1IXCA 2UXXA 3FMRA 4LK0F 4D0PA 1U2WA 2QQ9A 1IW7F 4R79A 3IKTA 2W85A 1P6RA 5K5RA 3V7CA 3ZQ7A 5CLSA 4OIOF 3KETA 5HDKA 4L18B 3HRTA 1MKMA 2HWVA 3L2CA 2HFHA 3KP6A 4UV9A 3FWEA 3MZYA 5FD6A 3MFKA 3WTZA 2K02A 2PJPA 1SD6A 4ESFA 3BY6A 1KU9A 1S8NA 3O2PE 2P8TA 4HQMA 4BXUA 1GVJA 4ZYHA 2EFWA 3I71A 5HOOA 2GIVA 5ILSA 4FX4A 5E1WA 1XCVA 3GZ5A 2FE3A 2FQ3A 1TNSA 1R22A 4HDUA 3U2RA 5IT9Z 4PGGA 2OZUA 2XIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0F A;  3WTV C;  3ZPL A;  2IA2 A;  3GUD A;  1F5T A;  2V6C A;  3IL2 A;  3BOQ A;  3P9K A;  4MTD A;  4R8H A;  3I59 A;  3JSO A;  5DUI A;  1YW9 A;  2F5D A;  2M1B A;  2VBX A;  1HW2 A;  4HZF A;  1G3S A;  2XV4 S;  3TOA A;  5LEK A;  1ZN2 A;  3Q9S A;  3MQ0 A;  3O3K A;  3RPU A;  2RKH A;  3F22 A;  5D4S A;  1LDK B;  2VXZ A;  2ZNY A;  4NQW A;  5CVV A;  5FB2 A;  2VT2 A;  1B1B A;  2EFQ A;  3J81 Z;  4WXC A;  4MTE A;  1XGO A;  3ZMT A;  2ZME B;  2YSR A;  1KYZ A;  1ZLK A;  5TRD A;  2CWE A;  2QYO A;  1HSJ A;  3LAJ A;  3M8E A;  4I0A A;  1SD5 A;  2D45 A;  2F2E A;  3I53 A;  1OR7 A;  1R1T A;  1SFE A;  2HQN A;  1HST A;  2V1U A;  5LLQ A;  4I0B A;  4UV8 A;  1KQ8 A;  1TBX A;  2YX4 A;  1W5T A;  3M1E A;  2E1C A;  3F3X A;  3CDH A;  2QBY A;  3LFK A;  4OIR F;  3DQV C;  1FPQ A;  4HLY A;  4L9N A;  1HW5 A;  4U0V A;  2VON A;  1YW7 A;  3KP2 A;  1MDM A;  3BPX A;  2ELH A;  4IRH A;  4IPA A;  2G9W A;  3RJP A;  2C6Y A;  4M6Y A;  4BHB A;  4P9U A;  3GFL A;  5EEG A;  3TGN A;  2MLK A;  5AIQ A;  2DBB A;  3RI4 A;  1JHF A;  4S05 A;  2A61 A;  1FLI A;  2DFI A;  3TQN A;  1ZRF A;  2OD5 A;  4ENK A;  5LBQ A;  2CO5 A;  1YW8 A;  4FHT A;  3KEQ A;  2X0L A;  4BQA A;  2FF4 A;  3V7S A;  2GA1 A;  4G6Q A;  3R61 A;  3J80 Z;  1ZHF A;  1K7A A;  1PUE E;  4ESB A;  1OPC A;  5E17 F;  1KU3 A;  5BPI A;  1K78 A;  4G7H F;  2HKO A;  1JE8 A;  1DP7 P;  5FD5 A;  3NRV A;  1QNT A;  2Y0M A;  5L3G A;  4RB3 C;  3FF5 A;  1Z05 A;  5HDG A;  2BEO A;  3WTX C;  2W84 A;  4IRG A;  4EV0 A;  3OOP A;  3D0S A;  4Q48 A;  1P4A A;  3JSP A;  4HW0 A;  2F5C A;  2DT5 A;  4KYW A;  4UHT A;  5D6E A;  3LAP A;  1YQA A;  2JPC A;  1IN5 A;  1EH6 A;  5CVJ A;  1BI3 A;  4HLX A;  4L9T A;  4M9S A;  3FMS A;  2PMU A;  3GLX A;  3ECH A;  2OBP A;  1Z7U A;  4RGS A;  2ESH A;  1B9M A;  2EV6 A;  3KLN A;  3BP8 A;  2UWM A;  3VEP A;  1ZH5 A;  3VOE A;  2L3D A;  5EEH A;  2GXB A;  1WI9 A;  1PP8 F;  1BIB A;  4ENM A;  4CZZ A;  1LDD A;  1MGT A;  3E3V A;  3QOP A;  1U5T A;  5DD8 A;  1C0W A;  1R5H A;  2MBF A;  4L9V A;  3F8F A;  5D6F A;  4M74 A;  1TTY A;  1B9N A;  1R7J A;  2QEN A;  4ZZL A;  3J7A O;  3GWZ A;  1QO0 D;  4L0Z B;  3RYP A;  1OYI A;  3M7G A;  1X3U A;  2HYG D;  2KKO A;  3KZZ A;  2Z9O A;  2EV5 A;  4Q5S F;  4A6D A;  2ZFW A;  5ERI A;  2D2W A;  4F7Z A;  1WWX A;  3C18 A;  2H27 A;  2V1X A;  3NQO A;  4UVB A;  1S6L A;  3JAM K;  3FXR A;  4P55 A;  5FO5 A;  5BS6 A;  2FOK A;  2XKP A;  2RDP A;  4FT8 A;  1FSH A;  2LF7 A;  2VBW A;  2G7U A;  2W57 A;  2D1H A;  4M9X A;  3CLO A;  4I01 A;  1BI2 A;  1R5G A;  2D1V A;  4ENJ A;  3K1M A;  4CGZ A;  5D5W B;  4BYY A;  4LK1 F;  3LST A;  3L9F A;  3B73 A;  5L3F A;  2NYX A;  4Y13 A;  5E8I A;  3T1B A;  2DK5 A;  5A2Q Z;  2K4B A;  4OMZ A;  1CF7 B;  4QLC U;  1BI1 A;  4KFC A;  3L00 A;  4M73 A;  3I5U A;  1RNL A;  3M8F A;  5LHH A;  5LGN A;  2NAZ A;  1E17 A;  2EK5 A;  2QQA A;  3R0A A;  2VE8 A;  2P7C B;  1U5T B;  4UNO A;  4IHS A;  1IN8 A;  2O61 A;  1R23 A;  3FMQ A;  5HLH A;  3R6S A;  5IT9 K;  1G3T A;  2O0Y A;  2JTV A;  4I02 A;  1O7F A;  2UXN A;  2M30 A;  3JW4 A;  1SAX A;  5F64 A;  2ADU A;  2M5W A;  3GZ6 A;  2VBZ A;  1K78 B;  4MQ9 F;  1WQ2 A;  1QGP A;  2BGC A;  4RS8 A;  1BC8 C;  2GAU A;  4A0Z A;  3RTR A;  3IKV A;  1P4W A;  1OYW A;  2YPR A;  3W6J B;  1O3T A;  2EFO A;  1YYV A;  1S7O A;  2JT1 A;  3ISP A;  1T39 A;  3VFZ A;  4Z2Y A;  3S2W A;  3EDP A;  4P5O A;  2OU2 A;  4HF2 A;  5E18 F;  1ZG5 A;  4P9F A;  2HR3 A;  4I2O A;  2ISY A;  1KGS A;  2TDX A;  1KA8 A;  1XGM A;  1FZP B;  1XSX A;  4HYE A;  2BE5 F;  1U78 A;  1XB4 A;  3TOB A;  4RAY A;  2FNP A;  1IZ1 A;  1J9I A;  1GHC A;  3DEU A;  2M8E A;  1LEB A;  4LMY A;  2ISZ A;  1I1G A;  5L3E A;  3BRO A;  1JGS A;  4CO8 A;  1FWZ A;  1G4D A;  3J80 K;  4KT5 C;  1YS6 A;  2A68 F;  1ZRC A;  2ESN A;  2VC1 A;  4KMF A;  3TO9 A;  1RZ4 A;  3CO7 C;  5K1Y A;  2RQP A;  2H6C A;  3PFI A;  5DD4 A;  1HKS A;  2IJL A;  5CYV A;  5BPD A;  5DCF A;  4XRF A;  2VN2 A;  3N97 A;  2GWR A;  4YFX F;  3HTS B;  3KFW X;  1U6G A;  4XSX F;  3SZP A;  2P6T A;  5HS9 A;  2QM3 A;  1J0R A;  3RKX A;  2Z33 A;  2JZY A;  1TW2 A;  4AIH A;  3KCC A;  2XKO A;  3F72 A;  1T6S A;  4IXA A;  4EJU A;  1ON2 A;  1ZG1 A;  5D4R A;  3SXY A;  2ZCW A;  2HQR A;  3V7R A;  1ZRE A;  2MA3 A;  4HA8 A;  1MJB A;  1B6A A;  5LEJ A;  2H94 A;  5L3D A;  1JHH A;  3WU1 B;  2B0L A;  5F6F A;  5JFR A;  4A12 A;  4WF2 A;  1B4A A;  1BJA A;  2STT A;  2P5V A;  2DLL A;  4RB1 A;  1J59 A;  4WX9 A;  2R7F A;  3IWZ A;  2W24 A;  3ELK A;  1MJA A;  5BOX A;  4BAY A;  1R36 A;  3M9A A;  3P9I A;  2DK8 A;  4G6D A;  4LG0 A;  1BOA A;  1OMI A;  5E8G A;  4KIB A;  2ZME A;  1LB2 A;  3U1D A;  4WWC A;  4Q47 A;  1IN4 A;  1WKM A;  2VE9 A;  4ETS A;  4HDV A;  3T8T A;  3WGH A;  1I6X A;  1U3E M;  4HQE A;  2HEO A;  3T0Y A;  4N9I A;  3I58 A;  2KIF A;  3RYR A;  1XCB A;  2H09 A;  4CIC A;  1MD0 A;  3ULQ B;  1G3Y A;  4IF4 A;  3E6M A;  2R3S A;  3F23 A;  2VOO A;  4O3M A;  2EA4 A;  1FOK A;  5ILV A;  4AWX B;  5AON A;  2YU3 A;  2Z5U A;  1B59 A;  1HXD A;  4LG0 B;  4RGR A;  1KU2 A;  1XMK A;  4LFU A;  3QAH A;  2QZ8 A;  1Z9C A;  1HBX G;  3ERE D;  4IRI A;  1ZGA A;  5D8L B;  1UST A;  1I1S A;  3IC7 A;  1P2F A;  3SZT A;  2QQB A;  2EFN A;  1XMA A;  2EFP A;  1BC7 C;  2FMY A;  2PBI A;  1GXP A;  1BBY A;  1W7P A;  1OKR A;  1ZYR F;  2KJC A;  2DO7 A;  2L4A A;  3KLO A;  1I5Z A;  3I54 A;  4MHG A;  1Y0U A;  3MAJ A;  2L01 A;  5JHU A;  3EQL F;  2XAH A;  4YG2 F;  4UVA A;  4EJT A;  4RAZ A;  4MGR A;  5KVR A;  2KIU A;  2FA5 A;  3R60 A;  4I98 B;  2CGP A;  4LB5 A;  2XRN A;  2GZW A;  2FBK A;  3MCZ A;  3KE2 A;  3DP7 A;  2QBY B;  5K5O A;  4LLN A;  2M45 A;  4WK8 F;  3HRS A;  1L0O C;  5DEQ A;  4A0X A;  5J8C A;  2IA0 A;  2ZBK A;  3DPL C;  3RKW A;  2K27 A;  1SFX A;  1W7P D;  3BDD A;  5LRR A;  1FC3 A;  4A5M A;  5TJJ A;  5F1R A;  4OOI A;  1ZRD A;  3WE3 A;  5ICE A;  3N4M A;  4R1H A;  1FT9 A;  2NRA C;  1R58 A;  4WXH A;  1FYL A;  3I64 A;  3GO5 A;  2KRF A;  4S04 A;  1PDN C;  4EGZ A;  4DQ2 A;  5D5X B;  2JPB A;  2WV0 A;  5CVU A;  3CTA A;  5CJ9 A;  5E1X A;  3FM3 A;  2MC3 A;  1XN7 A;  1L3L A;  1RUO A;  2HTS A;  1TQM A;  2XHK A;  1SD4 A;  5K5Q A;  3HSR A;  1YIO A;  2J5O A;  3P7N A;  4EM1 A;  4K2E A;  2EJR A;  2PQ8 A;  1D5V A;  4O6J A;  4ON0 A;  4Y15 A;  4JK1 X;  4AD9 A;  3JAM Z;  2Q2E A;  4GGG A;  4RGX A;  1LQ1 A;  3G73 A;  4A0Y A;  4LB6 B;  1SFU A;  4OMY A;  4IVN A;  3NEU A;  4N0B A;  4PGH A;  1Z1D A;  1XSV A;  3SQN A;  1TQI A;  5LHG A;  3ZN1 A;  2NNY A;  3TDZ C;  1FYM A;  3HSF A;  1T38 A;  4GCV A;  4JQF A;  1HW1 A;  4I09 A;  2HZT A;  1LEA A;  2XAS A;  1YS7 A;  2WC2 A;  1J75 A;  3B02 A;  2IT0 A;  4G94 A;  2VOD A;  2RVC A;  2WTE A;  4UXN A;  3AAF A;  4M9Z A;  5H6R A;  3E6B A;  4U0Y A;  3KZY A;  3DF8 A;  3CUQ C;  4G7Z F;  4KMU X;  3ZMV A;  1J7K A;  2RV8 A;  1CGP A;  1NHA A;  3ECO A;  3LWF A;  2EA2 A;  4EM0 B;  4U7D A;  2BYV E;  1MDM B;  5ED4 A;  4XSZ F;  2RGV A;  3K1P A;  3FHZ A;  1YFH A;  4DNC A;  4KUM A;  4TV7 A;  2P6S A;  1XSD A;  3FXQ A;  4LLG F;  2H6B A;  4I7H A;  3COA C;  3HHH A;  1QZY A;  3R4K A;  1BI0 A;  1ODD A;  3LQR A;  5LRS A;  2DW4 A;  5ILU A;  3DV8 A;  5DDG A;  3WG9 A;  3FXU A;  3TKY A;  2Z3Y A;  5LHI A;  3E6D A;  3ABT A;  2BV6 A;  2YR2 A;  2OA4 A;  2A07 F;  5HS7 A;  4EJO A;  4AVP A;  2LNB A;  1ZGJ A;  3DFG A;  5ICF A;  4CHU A;  2FXA A;  3REO A;  1H9T A;  4YIF A;  3GX4 X;  1UFM A;  3BJO A;  4N9H A;  2YX7 A;  1YO5 C;  3WOD F;  3ZMS A;  4A2U A;  4PZJ A;  2FML A;  4CXF A;  5LGT A;  3HSE A;  1YTY A;  1EH7 A;  3MZH A;  3TO7 A;  2COM A;  3K2Z A;  1O3R A;  2P7V B;  3KEO A;  5JR3 A;  3BPV A;  1ZG3 A;  4AIJ A;  2FSW A;  1PP7 U;  5H20 A;  3DKW A;  3HRU A;  1RI7 A;  1BN5 A;  2FRH A;  3GFI A;  2IVM A;  3KP3 A;  2GA2 A;  3DPT A;  2F5F A;  1J2X A;  3VB2 A;  1RIO H;  1V3F A;  3F8M A;  1WRJ A;  2FEZ A;  3CJN A;  4EJW A;  5CVI A;  1HKT A;  3WTT C;  4EQQ A;  5D5V B;  1REP C;  3GXO A;  1O57 A;  2CYY A;  1DUX C;  2MH2 A;  5J8F A;  4IHT A;  2HKX A;  4PCQ A;  1Q1H A;  4KIF A;  2ZNZ A;  4B09 A;  2DI3 A;  3GEZ A;  3BJA A;  3WTY C;  3KP4 A;  4AIK A;  3IWF A;  1R1U A;  2OAZ A;  3GW2 A;  1P92 A;  3P9C A;  1Z6T A;  1GXQ A;  3L09 A;  4ZYE A;  3T5X A;  3WGG A;  3ZMD A;  1P4X A;  5KK1 A;  4KN4 X;  1IRG A;  3E5X A;  5E20 A;  4ASN A;  2PLY A;  3R0J A;  4YFK F;  2K7L A;  4EMS A;  2Y48 A;  5DCM A;  2E7X A;  2Q8K A;  3H3U A;  4OU0 A;  1QPM A;  4KIC A;  4GXO A;  4U88 A;  2O8X A;  3E5Q A;  1EH8 A;  2OZ6 A;  1A04 A;  3VOD A;  3W6K B;  5IT3 A;  3LA7 A;  2IW5 A;  1STZ A;  2VOP A;  4RGU A;  2FBH A;  2QVO A;  1MZB A;  3F8C A;  2EWN A;  3CUQ B;  2V79 A;  4LGW A;  2DAO A;  1IN6 A;  4Y17 A;  3CUO A;  1F9N A;  3I59 B;  1T98 A;  4GO1 A;  1R1V A;  3WGI A;  4KDP A;  3HUG A;  4EGY A;  3GFM A;  2CSO A;  5L3B A;  4CYD A;  3ZMZ A;  1YG2 A;  1TNT A;  2CFX A;  1E2X A;  1D8J A;  4MQV A;  2HGC A;  4MEX F;  3L7W A;  4GYG A;  1CF7 A;  1MJ9 A;  1XGS A;  1IRF A;  3BWG A;  1XD7 A;  5HDN A;  4ENN A;  2J5P A;  1IXR C;  3H92 A;  2EB7 A;  2XUB A;  1I27 A;  2PMH A;  4U0W A;  5FGM A;  3LA2 A;  3F6O A;  2XAG A;  2O6G E;  1H9G A;  2RNJ A;  4BH9 A;  5HLG A;  3ZP5 A;  3U9G A;  1G3W A;  4ZZD A;  2A6H F;  2A5Y B;  3V8L A;  1D3Y A;  4OIP F;  1FY7 A;  1ZAO A;  4Q4Z F;  5HS8 A;  2VC0 A;  3CO6 C;  4ZYD A;  1DDN A;  4EVI A;  4GYI A;  3HOS A;  4RB2 C;  3V8J A;  1R00 A;  2MD5 A;  2XAQ A;  3Q9V A;  2DPU A;  4M72 A;  3DXJ F;  4HX4 A;  1ONV A;  2UZK A;  2L4M A;  4MNU A;  1FYK A;  2JSC A;  1FNN A;  2PG4 A;  3GYH X;  4QWQ A;  4U7B A;  3V4G A;  2PEX A;  1O3Q A;  1QQI A;  2JRT A;  3CUQ A;  1S3J A;  5CVR A;  1ON1 A;  2AXL A;  3LA3 A;  3FZV A;  4L0Y B;  4KIG A;  2A3S A;  2XAJ A;  5HVQ C;  5DCM B;  3ROU A;  3PQJ A;  3K9T A;  3RIR A;  3ZN0 A;  4L5J A;  2G7H A;  4P96 A;  1O3S A;  1Z91 A;  2HDC A;  1TQP A;  2ZXJ A;  4A5N A;  5D8K B;  4UUV A;  1JXS A;  2CG4 A;  1S29 A;  2V1D A;  1KQ9 A;  1Z6R A;  4HBL A;  4OIQ F;  4WXD A;  2HTJ A;  1USS A;  4M71 A;  4ZYG A;  2AS5 F;  3C7J A;  2V9V A;  1FBU A;  5JVT A;  4L5I A;  5FFX A;  2FNA A;  1W5S A;  2EV0 A;  5BQT A;  2OQR A;  2HOE A;  1IUY A;  2IPQ X;  1SMT A;  4WCG A;  2IP2 A;  3E97 A;  3SHF A;  1FP1 D;  2OQG A;  4KA4 A;  2LF8 A;  3JTG A;  3PQK A;  3HYI A;  2XVC A;  3MEX A;  3K0L A;  1VTN C;  2IA1 A;  1QZZ A;  4YII A;  1U8R A;  4LD5 A;  1LVA A;  2XAF A;  4E70 A;  5ICG A;  3QPT A;  4OIN F;  3GF2 A;  1UHM A;  1UB9 A;  2NNN A;  4HOB A;  2STW A;  3T8R A;  1LDJ A;  2L54 A;  6PAX A;  2LSO A;  4NB5 A;  4A6E A;  2P5L C;  2Y75 A;  4YFN F;  2P4W A;  2RN7 A;  3QPH A;  5A2Q K;  2MLG A;  1TW3 A;  2PN6 A;  3WE2 A;  3QRF F;  5FLX Z;  2ACJ A;  1IF1 A;  5D5U B;  1AOY A;  1TLH B;  4G9Y A;  2QWW A;  3MWM A;  1KYW A;  2PFB A;  2NS0 A;  3OV8 A;  3HIF A;  5DYM A;  2A69 F;  2Q0O A;  4BHP A;  3F8B A;  3HHG A;  3RPQ A;  4KNY A;  3QP6 A;  3GFJ A;  2FBI A;  5H6Q A;  3WU0 A;  3F21 A;  4JBA A;  2KJB A;  4CDG A;  1K6O A;  1SD7 A;  3Q5F A;  1G6N A;  2HS5 A;  2RC4 A;  2GXG A;  1J5Y A;  4L9J A;  4BNC A;  2GQQ A;  1IN7 A;  2PI0 A;  4B8X A;  2DQR A;  4RB0 A;  1UHW A;  3FM5 A;  4UVC A;  1K79 A;  3I4P A;  3WTS C;  2K86 A;  1FBS A;  2LDU A;  1RUN A;  1H0M A;  1XDU A;  2P5K A;  4ESJ A;  2MH9 A;  1DPR A;  2VT3 A;  3QU3 A;  2M87 A;  3TO6 A;  5FLX K;  4XLN F;  2ZO4 A;  1V4R A;  5HLI A;  4H0E A;  1FBQ A;  3EET A;  3O6B B;  3SFZ A;  1ULY A;  2X4H A;  2ETH A;  2W25 A;  2BBY A;  3FX3 A;  3EUH A;  3GVA A;  1DPU A;  3EYI A;  3IRQ A;  4HF1 A;  3K1N A;  4LJZ F;  5ICC A;  4KN7 X;  3E5U A;  2WWY A;  3I0T A;  2CQK A;  5L3C A;  3J81 K;  3G3Z A;  1ZLJ A;  4HX8 A;  1W4M A;  4HV6 A;  4XBF A;  2O03 A;  2DTR A;  2XGX A;  1BIA A;  1D8K A;  2LKP A;  1FP2 A;  3QU6 A;  2ZJ2 A;  3BJ6 A;  3F6V A;  2E1N A;  1YLF A;  3H3Z A;  2DPD A;  1IAW A;  5DUK A;  1XGN A;  1O7L A;  3QP5 A;  2A6E F;  5BMZ A;  1W7P B;  3JTH A;  4PDK A;  4ZH4 F;  2F5E A;  1QBJ A;  2DQL A;  1F4K A;  3TDU C;  1BM9 A;  2DU9 A;  1IXS B;  1OYY A;  2Z99 A;  1XDS A;  3HOT A;  5LGU A;  4HF0 A;  3V8K A;  3RKY A;  1SMY F;  1FSE A;  2XRO A;  1HQC A;  1WSU A;  3IHU A;  5FFZ A;  4G7O F;  2CW0 F;  4EJV A;  2IRF G;  3E6C C;  4HX7 A;  4EM2 A;  2E7W A;  4G8X A;  1KQ0 A;  1HKQ A;  3ML6 A;  2QLZ A;  3KP7 A;  3WTW C;  5AIP A;  5DV5 A;  3KP5 A;  5E1Z B;  1AWC A;  2L02 A;  4O5V A;  4NHJ A;  2HYF A;  3BZ6 A;  1EV7 A;  5JI6 A;  3F8N A;  3RDI A;  3ABU A;  3EYY A;  4IJA A;  1S7A A;  3IRR A;  1FX7 A;  2R7D A;  3K69 A;  2KIM A;  3LQQ A;  1UCR A;  4HAM A;  2K4J A;  1U5T C;  1LNW A;  2O3F A;  2QUF A;  4BHC A;  1F1Z A;  4FX0 A;  3ZMU A;  3WTU C;  3HRM A;  2ZKZ A;  3C3W A;  3D5L A;  2FU4 A;  1ZAR A;  5J6X A;  4MEY F;  4M6X A;  1LJ9 A;  4HV5 A;  1KU7 A;  2VBY A;  3HTU A;  4LLL A;  4XLP F;  3C1D A;  1T2K A;  1IXC A;  2UXX A;  3FMR A;  4LK0 F;  4D0P A;  1U2W A;  2QQ9 A;  1IW7 F;  4R79 A;  3IKT A;  2W85 A;  1P6R A;  5K5R A;  3V7C A;  3ZQ7 A;  5CLS A;  4OIO F;  3KET A;  5HDK A;  4L18 B;  3HRT A;  1MKM A;  2HWV A;  3L2C A;  2HFH A;  3KP6 A;  4UV9 A;  3FWE A;  3MZY A;  5FD6 A;  3MFK A;  3WTZ A;  2K02 A;  2PJP A;  1SD6 A;  4ESF A;  3BY6 A;  1KU9 A;  1S8N A;  3O2P E;  2P8T A;  4HQM A;  4BXU A;  1GVJ A;  4ZYH A;  2EFW A;  3I71 A;  5HOO A;  2GIV A;  5ILS A;  4FX4 A;  5E1W A;  1XCV A;  3GZ5 A;  2FE3 A;  2FQ3 A;  1TNS A;  1R22 A;  4HDU A;  3U2R A;  5IT9 Z;  4PGG A;  2OZU A;  2XIG A; 
#chains in the Genus database with same CATH topology
 2MD0 A;  4Y33 A;  2GM4 A;  4ITV A;  1P7J A;  1T0F A;  1IV8 A;  3WTV C;  4HRI A;  1IGN A;  3ZPL A;  3CCV I;  2IA2 A;  1ETV A;  4CCJ A;  3GUD A;  2XSJ C;  1F5T A;  2V6C A;  5FRO A;  3LSM A;  3IL2 A;  3BOQ A;  3RCO A;  3CCJ I;  2HDW A;  4BDY A;  3P9K A;  1SVL A;  2E1M C;  4MTD A;  3FXJ A;  4R8H A;  1YRN A;  4QSH A;  3I59 A;  2QSG X;  2WY7 Q;  3JSO A;  4XK4 A;  1I50 J;  3LSI A;  1VQ8 I;  2VXD A;  1MNE A;  3BCB A;  5DUI A;  1YW9 A;  4E7S A;  2M0C A;  2F5D A;  2M1B A;  2OV7 A;  2VBX A;  1HW2 A;  3K70 D;  4HZF A;  4P1W A;  4DGW B;  1WI3 A;  1G3S A;  2XV4 S;  3TOA A;  3OWT A;  5LEK A;  1ZN2 A;  3Q9S A;  4LOC A;  3MQ0 A;  3O3K A;  3RPU A;  2RKH A;  3F22 A;  5D4S A;  3WHC A;  3ESW B;  2RNG A;  1LDK B;  3BQY A;  4B43 A;  2VXZ A;  2ZNY A;  4NQW A;  5CVV A;  5FB2 A;  2K85 A;  2VT2 A;  1B1B A;  2EFQ A;  2NXN B;  3J81 Z;  4WXC A;  2OUM A;  4MTE A;  1XGO A;  1IDZ A;  5GP9 A;  3ZMT A;  4F55 A;  2ZME B;  5DM7 F;  5FKK A;  1X2M A;  2YSR A;  2OC6 A;  1AKH A;  1KYZ A;  1ZLK A;  2BW3 B;  3RZO J;  2LKX A;  2QGU A;  3HZJ A;  4EAT A;  5TRD A;  3UKG A;  2BZT A;  2IXS A;  2LY1 A;  2Z2S B;  2CWE A;  1N78 A;  3AG1 H;  2QYO A;  1HSJ A;  4B44 A;  3LAJ A;  4DJA A;  3M8E A;  4I0A A;  2NOJ B;  4IHY A;  1SD5 A;  5HNH A;  2CMP A;  3M4O J;  4ZJZ A;  2D45 A;  1T33 A;  4AYB N;  1JKR C;  2F2E A;  3FIW A;  3I53 A;  4XKW A;  1OR7 A;  1R1T A;  1SFE A;  2HQN A;  2GXA A;  2JA2 A;  2F5V A;  1HST A;  3BR6 A;  1B72 B;  1TWG J;  5LLQ A;  4I0B A;  4UV8 A;  2V1U A;  3OL4 A;  1KQ8 A;  1TBX A;  4FIS A;  2YX4 A;  1W5T A;  4ZYA A;  2R7T A;  3M1E A;  2E1C A;  3F3X A;  1EJ9 A;  3CDH A;  2QBY A;  3LFK A;  4OIR F;  1E3O C;  4AVZ A;  3DQV C;  1FPQ A;  4HLY A;  4L9N A;  1HW5 A;  2L9S A;  5EG0 B;  2R7Q A;  2JVG A;  4U0V A;  2VON A;  3DLA A;  3PNY A;  3H9Q A;  1ETX A;  1YW7 A;  1RKT A;  1EKE A;  3KP2 A;  3JRG A;  1MDM A;  3BPX A;  4XRS G;  3HB9 A;  4XOR A;  1GV2 A;  2ELH A;  4IRH A;  4IPA A;  1TZL A;  2G9W A;  3RJP A;  3HM5 A;  2C6Y A;  4BJT A;  4M6Y A;  4BHB A;  4P9U A;  1EA3 A;  3GFL A;  5EEG A;  3GTQ J;  3TGN A;  3VYR B;  2AXT C;  1V5G A;  1A6Q A;  2MLK A;  5AIQ A;  2DBB A;  3S15 J;  1OR7 C;  3RI4 A;  1JHF A;  4S05 A;  1UZC A;  4IQJ A;  2A61 A;  1FLI A;  2DFI A;  3TQN A;  4XON A;  1ZRF A;  3MZ8 A;  1ZQ3 P;  1B8I A;  2IGO A;  2OD5 A;  4BEH A;  4ENK A;  1BL0 A;  3CJQ B;  5LBQ A;  2CO5 A;  4ZC3 A;  1YW8 A;  4FHT A;  3KEQ A;  2X0L A;  4BQA A;  2FF4 A;  3SEQ A;  3V7S A;  3UR3 C;  2GA1 A;  4G6Q A;  3R61 A;  3J80 Z;  3OIO A;  2L9V A;  2I5U A;  1ZHF A;  1K7A A;  1PUE E;  4ESB A;  1OPC A;  5E17 F;  1KU3 A;  2DOA A;  5BPI A;  1K78 A;  1VFC A;  2XB5 A;  3H35 A;  4G7H F;  2HKO A;  3H5N A;  4YEJ A;  5E3L A;  1JE8 A;  2DMU A;  3H5R A;  1DP7 P;  4XNF A;  5IOY A;  4NC6 A;  3NRV A;  5FD5 A;  2YS9 A;  2O7O A;  4D7N A;  4E7H A;  1QNT A;  2Y0M A;  3CC2 I;  1JUS A;  5L3G A;  4RB3 C;  1JJ6 C;  3DEW A;  4LIV A;  4RAF A;  3FF5 A;  5KAI C;  1Z05 A;  5HDG A;  2LFB A;  3S3O A;  3GTO J;  2E1O A;  4MLO A;  1WJC A;  2BEO A;  3WTX C;  2W84 A;  3CCQ I;  1V55 H;  4IRG A;  4EV0 A;  3OOP A;  3D0S A;  4HPQ A;  2HQ5 A;  5IP9 J;  4Q48 A;  2X48 A;  5CQG A;  5GAE J;  1P4A A;  3JSP A;  4HW0 A;  1YIJ I;  2F5C A;  2Z1D A;  2DT5 A;  5M5Y J;  4KYW A;  4CSW A;  1PVE A;  2K9N A;  4UHT A;  5D6E A;  5B3S H;  3LAP A;  5K7H A;  1YQA A;  1YJW I;  2JPC A;  3S14 J;  1IN5 A;  3IUO A;  1EH6 A;  5CVJ A;  2WV1 A;  1BI3 A;  4HLX A;  4HSR A;  4L9T A;  3M1C A;  4BJ6 C;  5FLV A;  4M9S A;  3L2W A;  2LBF B;  3FMS A;  2PMU A;  3GLX A;  5JVG F;  3ECH A;  3L1P A;  1N75 A;  2OBP A;  1Z7U A;  4IL6 C;  4RGS A;  1IRX A;  1Y8Q B;  2WAQ A;  3I55 I;  2ESH A;  1B9M A;  2EV6 A;  2W1O A;  3KLN A;  1VI0 A;  3HPG A;  2MC4 A;  3BP8 A;  5B1A H;  2UWM A;  3VEP A;  1ZH5 A;  1D5Y A;  1HOM A;  3VOE A;  4NQW B;  2L3D A;  2ZSI B;  1H8A C;  4C30 A;  5EEH A;  2GXB A;  2HPI A;  1WI9 A;  2A05 A;  3VYT B;  1I6H J;  1PP8 F;  1U9N A;  1BIB A;  2VB6 A;  1W36 C;  4IQ4 A;  3O8G A;  3JRD A;  3GCM A;  2ELJ A;  4XR6 A;  4ENM A;  4CZZ A;  1LDD A;  1X1P A;  1MGT A;  1OCC H;  1UHS A;  1LPQ A;  4BY1 J;  2H1L A;  2M3A A;  2Z16 A;  1VZ0 A;  3E3V A;  1MBK A;  1G59 A;  1UEL B;  3QOP A;  1U5T A;  5DD8 A;  2DA6 A;  1C0W A;  5LD2 C;  2MW8 A;  2F48 A;  1OLT A;  1POG A;  2XF6 A;  3S1M J;  1R5H A;  2MBF A;  2OCC H;  3F8F A;  4L9V A;  1Y56 A;  3LSK A;  5D6F A;  2D5V A;  2WAF A;  4M74 A;  1TTY A;  3K7A J;  1B9N A;  1R7J A;  2QEN A;  4BBS J;  5K7F A;  4ZZL A;  3HOW J;  5GTH C;  3TED A;  2AQF A;  3J7A O;  3BTJ A;  1B8I B;  3GWZ A;  1QO0 D;  3D1N I;  1FEX A;  4L0Z B;  3HGG A;  3RYP A;  4N4N B;  1OYI A;  2LY2 A;  3M7G A;  5BNG A;  2EPF A;  4GFB A;  2ECB A;  1X3U A;  2HYG D;  2KKO A;  4AID A;  2HVR A;  3KZZ A;  2Z9O A;  2EV5 A;  4ZDL A;  5M5W J;  4Q5S F;  2ME6 A;  4A6D A;  2ZFW A;  5ERI A;  1D0Y A;  2D2W A;  3OY9 A;  4F7Z A;  3VYS B;  1WWX A;  3C18 A;  2H27 A;  2V1X A;  4OWR B;  1XC5 A;  3NQO A;  4UVB A;  1S6L A;  3JAM K;  3FXR A;  4P55 A;  4A3C J;  5FO5 A;  5BS6 A;  3GZN B;  2V7F A;  1P7I A;  3VPR A;  2FOK A;  2XKP A;  1NG6 A;  2RDP A;  4FT8 A;  3K4L A;  2WAD A;  3A01 B;  1FSH A;  2LF7 A;  2VKH A;  3FXM A;  5CKT A;  1VQP I;  2BOL A;  2VBW A;  2G7U A;  1VQO I;  4DYC A;  3I4N J;  3DBR B;  5LFA A;  2W57 A;  2D1H A;  4M9X A;  3D5R C;  3CLO A;  2XGD A;  2JA5 J;  4I01 A;  2JWT A;  3S32 A;  1BI2 A;  1R5G A;  2LRE A;  2V26 A;  2D1V A;  3CCY A;  2VJI A;  4ENJ A;  4FET A;  1OQY A;  2VQG A;  1MBF A;  2GOM A;  3K1M A;  1F36 A;  4CGZ A;  5DS9 A;  3FXO A;  5D5W B;  5CPR B;  3HUG B;  2PMZ N;  2M2E A;  4BYY A;  4LK1 F;  2JSP A;  3LST A;  3CLQ A;  5EEA A;  2R5Y A;  3L9F A;  3B73 A;  3OYK A;  1X1C A;  4XM3 A;  1WJA A;  5C4X J;  2VKV A;  3TP0 A;  1X19 A;  1ZEL A;  3K6G A;  5L3F A;  4RA2 A;  2NYX A;  3SDB A;  4Y13 A;  4BAC A;  2NS7 A;  2XAU A;  3LSJ A;  3T1B A;  5E8I A;  2DK5 A;  5A2Q Z;  3S2H J;  1QZE A;  2K4B A;  3ZRG A;  4OMZ A;  4B3X A;  1CF7 B;  2M34 A;  1H88 C;  2KLO A;  4QLC U;  2DN0 A;  4G6T B;  1BI1 A;  4KFC A;  3L00 A;  2CQN A;  1KZH A;  4M73 A;  3I5U A;  1RNL A;  1RES A;  2QCO A;  3M8F A;  5LHH A;  5LGN A;  2NAZ A;  2X1C A;  1XS9 A;  1E17 A;  1GLN A;  2BXY A;  3OYA A;  1ZR4 A;  1Z3X A;  4C2U A;  1G2H A;  2QQA A;  2EK5 A;  3R0A A;  4C3H J;  2VE8 A;  3CMY A;  1RR8 C;  2P7C B;  3K4J A;  1U5T B;  2ZSH B;  4HEA 2;  1BR4 A;  4IHS A;  4UNO A;  1IN8 A;  2O61 A;  2GIZ A;  1X1B A;  4A3K J;  2LVS A;  1R23 A;  3FMQ A;  5HLH A;  3R6S A;  3ZGK A;  3OYC A;  2QSF X;  5IT9 K;  3I4M J;  2JUC A;  1G3T A;  3QPL A;  2TRT A;  4UUS A;  3CCE I;  2O0Y A;  2X9D A;  2JTV A;  2E5N A;  4I02 A;  4NDL A;  3NWT A;  4IX7 A;  3K4K A;  1O7F A;  1T8I A;  1ACI A;  1BR2 A;  2UXN A;  4MO7 A;  5TIS C;  1JGG A;  1NG7 A;  2M30 A;  3JW4 A;  1SAX A;  5F64 A;  2ADU A;  2M5W A;  2EZH A;  3GZ6 A;  3OIQ A;  3FHN A;  2VBZ A;  1K78 B;  1LFP A;  3KZI C;  4MQ9 F;  1A36 A;  1WQ2 A;  1QGP A;  2BGC A;  3JRH A;  4RS8 A;  2BY1 A;  3M8J A;  3HGY A;  1BC8 C;  3GTP J;  2OPT A;  2GAU A;  4A0Z A;  1E3P A;  3RTR A;  2K3F A;  1P4W A;  3IKV A;  1OYW A;  2YPR A;  4BUP A;  4BKX A;  3G6E I;  4ABZ A;  3W6J B;  2R7W A;  4IOA F;  1O3T A;  2EFO A;  5IPA A;  1YYV A;  1S7O A;  5FJ8 J;  2JT1 A;  3D5S C;  3ISP A;  3K70 C;  3OSF A;  1T39 A;  1Z3Y A;  4M3D A;  3VFZ A;  2IS4 A;  1U0J A;  4Z2Y A;  3S2W A;  3EDP A;  2TCT A;  1QPI A;  2VQH A;  2O9L A;  2QF7 A;  1JKO C;  4P5O A;  5EGO A;  3S1N J;  2OU2 A;  1ZKG A;  2JMW A;  4XN3 A;  1XPX A;  4MFE A;  1Z7L A;  4HF2 A;  2VKD A;  5E18 F;  3GLL A;  5J1R A;  1ZG5 A;  1WH7 A;  4P9F A;  2HR3 A;  4I2O A;  2ISY A;  1KGS A;  2TDX A;  1KA8 A;  1XGM A;  5F0F A;  1FZP B;  1XSX A;  1JUM A;  4J01 A;  2LBF A;  1RC9 A;  3S3M A;  1PUF B;  2K9Q A;  4HYE A;  5F08 A;  2FUG 2;  2CW8 A;  1O4X A;  2BE5 F;  1F43 A;  1U78 A;  1XB4 A;  3TOB A;  1HF0 A;  3CP8 A;  4PJJ A;  4RAY A;  2FNP A;  1IZ1 A;  1J9I A;  1GHC A;  4L5E A;  4M3G A;  3DEU A;  4BE0 A;  2R5Y B;  2M8E A;  1LEB A;  4LMY A;  3OS1 A;  4DZP A;  2P0W A;  5JLW A;  2ISZ A;  1I1G A;  3CCR I;  3RPU D;  5L3E A;  2XPU A;  3BRO A;  4RMN A;  1JGS A;  3A01 A;  4CO8 A;  3OR2 C;  3BR1 A;  1FWZ A;  2HVQ A;  1G4D A;  3QYE A;  3J80 K;  3DEE A;  4KT5 C;  2Y2Z A;  2LTP A;  1SFO J;  1YS6 A;  2A68 F;  2V4J C;  1W36 D;  1ZRC A;  1FTZ A;  4XLF A;  2ESN A;  3DKY A;  2VC1 A;  4KMF A;  3RKQ A;  3TO9 A;  1RZ4 A;  1MBH A;  3CO7 C;  1I3A A;  3GTK J;  3TW6 A;  5K1Y A;  2GBY A;  1RR7 A;  2H6C A;  2RQP A;  4W97 A;  2LY9 A;  1TWF J;  2QEX I;  1K4S A;  4BQO A;  3PFI A;  3LSR A;  5DD4 A;  1HKS A;  3ASO H;  2DJN A;  2IJL A;  2WAQ N;  4M6V A;  5CYV A;  2Y0S N;  5BPD A;  3OR1 C;  5DCF A;  4XRF A;  2VN2 A;  3N97 A;  4E7L A;  2XGE A;  2LD5 A;  3AG4 H;  2MAB A;  2GWR A;  4YFX F;  2R5Z A;  3HTS B;  4A3B J;  3KFW X;  1JKQ C;  3AFH A;  1U6G A;  4XSX F;  2LK2 A;  3CD6 I;  5HLT A;  1SFK A;  1QVU A;  4NC7 A;  3AG2 H;  3TW7 A;  3SZP A;  1ETQ A;  2P6T A;  5HS9 A;  2QM3 A;  4BXF A;  1J0R A;  3RKX A;  4OAY A;  5F27 A;  4IOC F;  3CMA I;  4M3E A;  1IC8 A;  2Z33 A;  3DU5 A;  1H89 C;  2QKL B;  2JZY A;  3WHB A;  2XGC A;  1TW2 A;  4AIH A;  3MN2 A;  3ZR8 X;  3AL0 C;  3KCC A;  3QOE A;  4IEJ A;  1XG1 A;  1A35 A;  1W5C C;  3MVP A;  2XKO A;  1YE9 A;  5FKO A;  3F72 A;  1T6S A;  1DGW Y;  4IXA A;  3TBI A;  3OYD A;  4EJU A;  1SEU A;  3IH3 A;  1ON2 A;  1ZG1 A;  5D4R A;  1YHQ I;  3SXY A;  4DIQ A;  4PK4 A;  4D9J A;  3BR3 A;  4XKB A;  2ZCW A;  2ZME C;  2HQR A;  2W7N A;  3V7R A;  2L7K A;  3HDD A;  1IV6 A;  1ZRE A;  2BVM A;  2X51 A;  1JJ8 C;  3PM1 A;  2MA3 A;  4X1E A;  4HA8 A;  1MJB A;  2E35 A;  3LFU A;  1B6A A;  2VUM J;  2F4M B;  1RPW A;  2ZC2 A;  4II2 A;  3ZQQ A;  5LEJ A;  2H94 A;  5L3D A;  3CCM I;  1Y1W J;  4DYR A;  1ERD A;  1JHH A;  3WU1 B;  2B0L A;  5EZH A;  5F6F A;  5JFR A;  2RQQ A;  2M7B A;  3DBL B;  4A12 A;  4WF2 A;  1B4A A;  1BJA A;  2STT A;  4J00 A;  2P5V A;  2DLL A;  4RB1 A;  3DCF A;  4Z6Y A;  1J59 A;  4A3L J;  1VQ6 I;  4WX9 A;  2R7F A;  3CDI A;  4NNJ A;  3IWZ A;  4XOP A;  2CV1 A;  2W24 A;  4PSW A;  3BG6 A;  3ELK A;  2ZJQ F;  5EZG A;  4PSX A;  1AA7 A;  1MJA A;  2XF7 A;  3BZK A;  1R4N B;  5BOX A;  3HOZ J;  4BAY A;  1R36 A;  3M9A A;  3BG9 A;  2DK8 A;  3P9I A;  3BR0 A;  3K4M A;  4G6D A;  4LG0 A;  1BOA A;  3RQI A;  1OMI A;  1S7E A;  5E8G A;  3MKW B;  2E34 A;  1J09 A;  3CC4 I;  1VND A;  4KIB A;  2DXI A;  2ZME A;  3FXK A;  1LB2 A;  3U1D A;  3E0J B;  2A5W A;  4WWC A;  3HOY J;  1AKH B;  1VQ9 I;  1WHU A;  4Q47 A;  2LLK A;  1IN4 A;  1WKM A;  3LNQ A;  3NWS A;  4ETS A;  2VE9 A;  4HDV A;  3T8T A;  3WGH A;  5GPC A;  1DU0 A;  1DU6 A;  1I6X A;  1U3E M;  2KMU A;  5IOZ A;  4HQE A;  2HEO A;  4BXX J;  2N8G A;  3T0Y A;  4N9I A;  3I58 A;  1A5J A;  1R4M B;  2KIF A;  2XF5 A;  1QHG A;  3ZQF A;  1X4P A;  1NH3 A;  1D0Z A;  3RYR A;  1BA5 A;  1XCB A;  3VDX A;  3TMO A;  3Q0V A;  2W82 A;  4LIT A;  1S5L C;  4JX6 A;  1V54 H;  2H09 A;  3U1K A;  4CIC A;  1MD0 A;  3ULQ B;  3S16 J;  1G3Y A;  4CZC A;  1MBE A;  4IF4 A;  3E6M A;  2R3S A;  3F23 A;  2VOO A;  1MIJ A;  5M5X J;  4GRI A;  1SVO A;  2R5Z B;  3FXL A;  4O3M A;  2EA4 A;  1FOK A;  5ILV A;  4AWX B;  3L2V A;  5AON A;  2YU3 A;  2Z5U A;  4E7I A;  1B59 A;  1HXD A;  4LG0 B;  4RGR A;  1KU2 A;  1PJR A;  1XMK A;  3LSH A;  1GVD A;  4LFU A;  3QAH A;  2QSH X;  2QZ8 A;  1Z9C A;  1HBX G;  2DFE A;  3ERE D;  4IRI A;  3S17 J;  1ZGA A;  5D8L B;  2JA7 J;  1UST A;  1I1S A;  1NTC A;  2H1K A;  3IC7 A;  5KHD A;  1GDT A;  3H0G J;  4A3D J;  1P2F A;  3SZT A;  2QQB A;  2EFN A;  4CH7 A;  1XMA A;  2EFP A;  1BC7 C;  3VYU B;  3MKY B;  3IAM 2;  1GUU A;  1N25 A;  2R7X A;  2FMY A;  4PUS A;  1BJZ A;  2PBI A;  1GXP A;  1VQ5 I;  2CFO A;  3OYE A;  1BBY A;  1W7P A;  1X1D A;  3QWL A;  1OKR A;  1ZYR F;  2KJC A;  2DO7 A;  1ETW A;  5C4J J;  3CC7 I;  2L4A A;  3KLO A;  5FRN A;  1I5Z A;  5E3M A;  3I54 A;  4MHG A;  2X1D A;  1Y0U A;  3MAJ A;  3SFI A;  2L01 A;  5JHU A;  4JOM A;  3CQZ J;  3EQL F;  2XAH A;  4YG2 F;  4UVA A;  4BE2 A;  2E2J J;  4EJT A;  2V9P A;  4RAZ A;  1OCO H;  2WA0 A;  2KDZ A;  4MGR A;  1ZR2 A;  5KVR A;  2KIU A;  1RRJ A;  2FA5 A;  3R60 A;  4I98 B;  2BHY A;  1YX3 A;  2CGP A;  4LB5 A;  2XRN A;  2GZW A;  2FBK A;  1ENH A;  1B72 A;  4PJ0 C;  3MCZ A;  3KE2 A;  3DP7 A;  3DWL E;  2QBY B;  4JYK A;  3HC7 A;  4DBQ A;  4N4O B;  5K5O A;  3PIP F;  4LLN A;  3DLL F;  3B6C A;  2M45 A;  4WK8 F;  3HRS A;  3ONQ A;  4IZZ A;  1L0O C;  5DEQ A;  4A0X A;  4F92 B;  2F6C A;  5J8C A;  2HOT A;  1PYV A;  2IA0 A;  3SYT A;  4I6Z A;  2DMP A;  2OTL I;  2ZBK A;  3DPL C;  2LKS A;  1JTY A;  2XSD C;  3JRB A;  3S2D J;  3RKW A;  2HPM A;  2FOW A;  2I8D A;  2K27 A;  2M4K A;  4ZTJ A;  1SFX A;  1W7P D;  3BDD A;  3BCA A;  5LRR A;  1FC3 A;  4A5M A;  1YI2 I;  1MW7 A;  5TJJ A;  5F1R A;  4OOI A;  1ZRD A;  2DA1 A;  3WE3 A;  5ICE A;  3N4M A;  4R1H A;  1FT9 A;  2NRA C;  1QRY A;  1R58 A;  4WXH A;  1FYL A;  2DFF A;  3I64 A;  1MMS A;  3GO5 A;  2EH3 A;  3OYH A;  2DFH A;  3IH2 A;  2KRF A;  2EZK A;  4C2M J;  5F0H A;  2E36 A;  4S04 A;  1PDN C;  4EGZ A;  1VF9 A;  1WJE A;  3OMY A;  1R49 A;  1ETY A;  2O5R A;  2W4S A;  3IP4 B;  3PNT A;  4DQ2 A;  4CCK A;  1U9O A;  5D5X B;  5KAF C;  3BTC A;  3H3V K;  2JPB A;  2AO9 A;  4YRV A;  2MSY A;  2VPL A;  2WV0 A;  3BTL A;  3MKL A;  1K83 J;  5CVU A;  3AL0 B;  3IAS 2;  3FBN B;  3L2Q A;  2W48 A;  2EZL A;  2K9S A;  3CTA A;  2ID6 A;  3NAU A;  5CJ9 A;  1FJL A;  5E1X A;  2FD5 A;  3K4C A;  3W6V A;  3MD2 A;  1VQ4 I;  3FM3 A;  2CJJ A;  1I39 A;  2MC3 A;  1XN7 A;  4MIM A;  1D1A A;  3CCS I;  4BJ5 C;  1L3L A;  1RUO A;  3W2A A;  2HTS A;  2VJ4 A;  2R7S A;  1TQM A;  2XHK A;  1SD4 A;  5K5Q A;  3HSR A;  1YIO A;  2J5O A;  1OJL A;  4BBR J;  3OSG A;  3P7N A;  4EM1 A;  4KJZ A;  2WBM A;  4K2E A;  2EJR A;  3G4S I;  2PQ8 A;  1D5V A;  1WH5 A;  2IGK A;  4A3I J;  3ZCO A;  3G1M A;  4O6J A;  4ON0 A;  3DKX A;  1MNM C;  4Y15 A;  2R7O A;  4JK1 X;  4AD9 A;  3JAM Z;  5C44 J;  4QTR A;  2VQC A;  1I3Q J;  2Q2E A;  4GGG A;  4RGX A;  1LQ1 A;  2JA8 J;  3G73 A;  5IYB J;  2CQ7 A;  2DDA A;  3HXL A;  3BG7 A;  4A0Y A;  3PUF A;  3FDY A;  4LB6 B;  1SFU A;  4JP0 A;  4OMY A;  3PIO F;  4IVN A;  3NEU A;  4N0B A;  4PGH A;  1Z1D A;  3A4C A;  1XSV A;  2ECC A;  5E79 C;  3SQN A;  1TQI A;  2BW3 A;  5LHG A;  3ZN1 A;  4J19 A;  1Z0X A;  1YOV B;  3H9G A;  2NNY A;  2CU7 A;  3TDZ C;  2B63 J;  1FYM A;  1IDY A;  3HSF A;  4GCV A;  1T38 A;  2GLO A;  9ANT A;  3C2B A;  4BU2 A;  4JQF A;  1HW1 A;  4I09 A;  2HZT A;  1LEA A;  2Y30 A;  2ZFU A;  3E1S A;  2XAS A;  1YS7 A;  2FQ4 A;  2WC2 A;  2DA3 A;  1LFB A;  3B02 A;  1J75 A;  4X0G A;  2IT0 A;  4G94 A;  2VOD A;  2RVC A;  2WTE A;  1QU3 A;  4UXN A;  1IUF A;  3BR5 A;  3AAF A;  2VI6 A;  4M9Z A;  1ZTR A;  5H6R A;  3E6B A;  3S93 A;  4U0Y A;  3ZQC A;  2DA7 A;  1VQL I;  3KZY A;  3HPH A;  3G1L A;  3DF8 A;  3CUQ C;  3PSI A;  3WU2 C;  4G7Z F;  1WPK A;  4KMU X;  3ZMV A;  1J7K A;  1Y0N A;  2EIJ H;  2RV8 A;  2ZB9 A;  5CQE A;  1CGP A;  1NHA A;  2LP0 A;  3J7Z I;  3ECO A;  3CZ6 A;  2FJ1 A;  3LWF A;  4G12 A;  1WFX A;  2EA2 A;  4EM0 B;  2DT6 A;  4U7D A;  3SDG A;  3GTG J;  2BYV E;  5GPA A;  3S3N A;  1MDM B;  5ED4 A;  4XSZ F;  2RGV A;  3K1P A;  4DOZ A;  1OCR H;  2CV2 A;  3FHZ A;  1YFH A;  4DNC A;  2DOE A;  3FKI J;  4KUM A;  1W1W E;  4TV7 A;  3ZOB A;  4H4K C;  1ZK8 A;  4IO9 F;  2P6S A;  2H8R A;  1OCP A;  1XSD A;  2JJ7 A;  2KZV A;  3FXQ A;  3ZQH A;  3HEF A;  4LLG F;  1HDP A;  3EUK L;  4AU7 A;  2H6B A;  4I7H A;  4CUG A;  3SJM A;  2JRM A;  3K4N A;  2XDV A;  2CUF A;  3HOX J;  3COA C;  4CCL A;  3HHH A;  1QZY A;  3R4K A;  3KYD B;  1P9Q C;  1BI0 A;  5B5E C;  1ODD A;  3LQR A;  4D5C A;  2KZG A;  3H5A A;  2DW4 A;  5H2F C;  2WB1 N;  3DV8 A;  5ILU A;  5LRS A;  2R7U A;  2LC2 A;  5DDG A;  3WG9 A;  1FTT A;  3FXU A;  3TKY A;  2Z3Y A;  3E6D A;  5LHI A;  3A03 A;  2R4G A;  3ABT A;  3CF2 A;  3TP3 A;  5K7Z A;  4DYQ A;  2BV6 A;  2YR2 A;  2OA4 A;  2A07 F;  3OS0 A;  4XN0 A;  5HS7 A;  1Z67 A;  4BL0 B;  1LVK A;  4EJO A;  4AVP A;  2LNB A;  2HZD A;  5KNL A;  1ZGJ A;  3DFG A;  5ICF A;  3EUA A;  4CHU A;  2FXA A;  1TWA J;  3REO A;  1H9T A;  4FE4 A;  4YIF A;  1UFM A;  3GX4 X;  3BJO A;  3CJR B;  5EJC A;  4N9H A;  2YX7 A;  3BZC A;  1YO5 C;  5J4Y A;  3WOD F;  1X3W B;  1SVM A;  3OYB A;  4XKV A;  3ZMS A;  4A2U A;  2JA6 J;  4PZJ A;  2FML A;  2Q2E B;  5LGT A;  4CXF A;  3VSL A;  2K40 A;  2L7F P;  2KPM A;  3HSE A;  1YTY A;  1EH7 A;  4B4C A;  3MZH A;  3TO7 A;  2NVQ J;  3ZXS A;  2COM A;  3K2Z A;  3FIS A;  1O3R A;  2P7V B;  5E3N A;  3KEO A;  4M3B A;  2HDD A;  4XLC A;  1VQ7 I;  3NAR A;  2KRH A;  5JR3 A;  3BPV A;  1ZG3 A;  2VPR A;  3TL4 X;  2Q1Z B;  2LMD A;  2KRC A;  2JQ7 A;  2DDB A;  4AIJ A;  2E71 A;  2JN6 A;  2FSW A;  3ABK H;  1PP7 U;  1LKX A;  2UV1 A;  5FRM A;  4CA0 A;  3CME I;  1DQU A;  4RLQ A;  5H20 A;  4A3G J;  2Y31 A;  5GAD J;  1QA6 A;  3DKW A;  3HRU A;  1D0X A;  1RI7 A;  1BN5 A;  2RRE A;  2FRH A;  5EG0 A;  1M1E B;  3GFI A;  2IVM A;  3KP3 A;  2Y9Y A;  2GA2 A;  1WGX A;  2BY0 A;  4RM3 A;  3DPT A;  1WJD A;  2F5F A;  3B6A A;  3QYF A;  1J2X A;  5GAG J;  3VWB A;  4HNV A;  3VB2 A;  1RIO H;  1V3F A;  5B66 C;  3F8M A;  1WRJ A;  5J1U A;  2NS8 A;  2FEZ A;  3CJN A;  3I3L A;  2GOX B;  4EJW A;  5CVI A;  4UB8 C;  4BE1 A;  1TC3 C;  1HKT A;  3WTT C;  4EQQ A;  5D5V B;  1REP C;  3GXO A;  1O57 A;  2CYY A;  2WY8 Q;  1DUX C;  4FCY A;  5IP6 A;  3PNV A;  4I99 C;  5IP7 J;  3KIO A;  2MH2 A;  5J8F A;  1NK3 P;  4IHT A;  3CP2 A;  2LG4 A;  2HKX A;  4PCQ A;  3OYL A;  1Q1H A;  2ZJP F;  2ZXI A;  4KIF A;  2ZNZ A;  5FKL A;  4B09 A;  3OYG A;  4E7J A;  2DI3 A;  3GEZ A;  3BJA A;  4YEL A;  2XB0 X;  1XMX A;  3WTY C;  3DU6 A;  3GTL J;  4AUX A;  2EIM H;  1K4T A;  3KP4 A;  1YRN B;  3DTK A;  4AIK A;  3HBL A;  4NC8 A;  3IWF A;  1WJB A;  1R1U A;  2OAZ A;  2EQR A;  5EF6 A;  5EDN A;  3GW2 A;  4KT6 A;  1PUF A;  1P92 A;  3O8H A;  3P9C A;  1Z6T A;  1GXQ A;  3L09 A;  3JRI A;  1RET A;  4ZYE A;  3T5X A;  3WGG A;  2F4O B;  3ZMD A;  1P4X A;  5KK1 A;  2VKE A;  3E7L A;  4UUS B;  3QPS A;  2DYS H;  4KN4 X;  1R71 A;  2CW7 A;  5DTD A;  1IRG A;  3E5X A;  5E20 A;  4ASN A;  2PLY A;  3R0J A;  4YFK F;  2R92 J;  1KON A;  2K7L A;  4C2T A;  1WCM J;  4EMS A;  1HC8 A;  4ZDO A;  2Y48 A;  5DCM A;  2E7X A;  2CQX A;  4JX4 A;  3G71 I;  2K3P A;  2Q8K A;  3H3U A;  4OU0 A;  1QPM A;  4KIC A;  4GXO A;  4U88 A;  1MMG A;  3EUH C;  4D5F A;  1IJW C;  2O8X A;  3JR9 A;  2LRD A;  1FMW A;  3E5Q A;  4E4H A;  1EH8 A;  2OZ6 A;  2E1M B;  1A04 A;  3VOD A;  3W6K B;  4DBR A;  5IT3 A;  3LA7 A;  4XMY A;  2IW5 A;  1STZ A;  3OYN A;  2VOP A;  2PX9 A;  4JX5 A;  4RGU A;  2FBH A;  4D1Q A;  2QVO A;  3H36 A;  5TGT A;  2JK3 A;  2HVS A;  3DPU A;  1MZB A;  1MBG A;  5J40 A;  3F8C A;  1Z77 A;  2R7V A;  2EWN A;  3CUQ B;  2V79 A;  4LGW A;  4A3E J;  2IGM A;  2DAO A;  1Y8R B;  4FTH A;  1IN6 A;  2M4G A;  4FAS D;  1LE8 B;  4Y17 A;  1FIP A;  3CUO A;  4BQN A;  1F9N A;  3K10 A;  3I59 B;  1T98 A;  3ZQG A;  1HA8 A;  4GO1 A;  1R1V A;  3ERM A;  4FE7 A;  2KL4 A;  2HNH A;  3KPH A;  4M3F A;  2G0E A;  3WGI A;  3JRA A;  4KDP A;  3AG3 H;  3HUG A;  4RM2 A;  4EGY A;  3GFM A;  2CSO A;  3A02 A;  3IH4 A;  5L3B A;  5E3O A;  2XPW A;  2BXZ A;  1S72 I;  1TP4 A;  4CYD A;  3ZMZ A;  1YG2 A;  4XIC A;  1TNT A;  4A3M J;  2M9H A;  4CYC B;  5B1B H;  1Y6I A;  2NVU B;  2CFX A;  1E2X A;  1D8J A;  4MQV A;  1CQT A;  3FK7 A;  2HGC A;  3OIP A;  3KYC B;  4Y7N J;  4MEX F;  3L7W A;  4GYG A;  1CF7 A;  1MJ9 A;  1XGS A;  3A2K A;  1IRF A;  3HJE A;  3BWG A;  3CCL I;  4RAG A;  1XD7 A;  2X6Y A;  4A3J J;  1X2N A;  2QQ8 A;  5HDN A;  3W2W A;  4ENN A;  2DMT A;  2OCE A;  2J5P A;  1IXR C;  2OJE D;  3ABM H;  2R0Q C;  3H92 A;  2EB7 A;  1WJF A;  2XUB A;  4BEH B;  1I27 A;  1LFU P;  2PMH A;  4U0W A;  5F0C A;  5FGM A;  3LA2 A;  3PJR A;  3LOC A;  4QPO A;  3I9V 2;  3ZQI A;  4CCM A;  3F6O A;  3FKJ A;  1A6I A;  2XAG A;  2O6G E;  4NUB A;  2V1N A;  1SAN A;  1H9G A;  2RNJ A;  2EIN H;  3LMM A;  3CMM A;  4BH9 A;  3OL3 A;  5HLG A;  5DM6 F;  3ZP5 A;  3X2Q H;  3U9G A;  2HXO A;  1G3W A;  3RQ4 A;  4ZZD A;  3K4B A;  2B9S A;  2A6H F;  2A5Y B;  3QYB A;  3WG7 H;  4CYC A;  2VLA A;  5HNF A;  4B48 A;  1OCZ H;  5GTI C;  3V8L A;  1D3Y A;  4NBQ A;  4OIP F;  2P81 A;  1BW5 A;  1FY7 A;  1TT5 B;  1ZAO A;  4Q4Z F;  5HS8 A;  2L7M P;  2VC0 A;  4IHX A;  3CO6 C;  4ZYD A;  4MFD A;  4Y3O A;  1DDN A;  4EVI A;  4XKC A;  4GYI A;  3HOS A;  4ANJ A;  4RB2 C;  4V19 K;  1BW6 A;  3V8J A;  5J1Y A;  1R00 A;  2MD5 A;  2XAQ A;  2VJ5 A;  2X6X A;  1IO2 A;  2W00 A;  1JI8 A;  3Q9V A;  2IS2 A;  1SC7 A;  2DPU A;  4M72 A;  3DXJ F;  1G8X A;  4HX4 A;  3AKZ A;  2L0K A;  1ONV A;  2UZK A;  2L4M A;  4MNU A;  1FYK A;  2R7Z J;  3DTI A;  2JSC A;  1FNN A;  2CUE A;  2PG4 A;  3S1R J;  3GME A;  3GYH X;  1X1A A;  4QWQ A;  4U7B A;  3V4G A;  2IEK A;  3V42 A;  2PEX A;  2IS6 A;  1O3Q A;  1QQI A;  1X58 A;  2JRT A;  3BLY A;  5EGO B;  3CUQ A;  1S3J A;  2CUJ A;  1TWH J;  3Q0W A;  1MH3 A;  5CVR A;  4YIR X;  3OYM A;  1LE8 A;  2VIX A;  1ON1 A;  1FMV A;  1TT0 A;  2AXL A;  3K2A A;  4RBO A;  3LA3 A;  3FZV A;  4B47 A;  4L0Y B;  4KIG A;  2ID3 A;  2A3S A;  2RAE A;  1T08 B;  2XAJ A;  1JT6 A;  4PFP A;  5HVQ C;  5EYR A;  4RDU A;  5DCM B;  4C9Y A;  1AU7 A;  2V6E A;  3ROU A;  3PQJ A;  4HNT A;  3K9T A;  4LIU A;  1X4O A;  5IYC J;  2PMZ A;  3RIR A;  3ZN0 A;  4L5J A;  2G7H A;  4P96 A;  4F93 B;  1O3S A;  5GAH J;  1Z91 A;  2XPV A;  2HDC A;  1TQP A;  1BR1 A;  1YJN I;  4AM3 A;  4I76 A;  5JLX A;  1FOW A;  2ZXJ A;  4A5N A;  5D8K B;  3S1Q J;  4UUV A;  5J47 A;  3CCU I;  1JXS A;  2EZI A;  2CG4 A;  1S29 A;  2V1D A;  1KQ9 A;  2K5C A;  1Z6R A;  4HBL A;  4OIQ F;  3PL8 A;  2HU9 A;  2NVX J;  3J7A Y;  3PSF A;  2MGQ A;  3PFY A;  2MG4 A;  4WXD A;  2HTJ A;  1USS A;  4M71 A;  4DZJ A;  4ZYG A;  2AS5 F;  3M3Y J;  3C7J A;  3BQZ A;  2XC7 A;  2V9V A;  1FBU A;  5JVT A;  1APL C;  4L5I A;  2OF7 A;  1D1C A;  5FFX A;  5HOD A;  2FNA A;  1W5S A;  2EV0 A;  5BQT A;  3GBG A;  4KIT B;  2M8G X;  2OQR A;  2HOE A;  3UNG C;  1IUY A;  2IPQ X;  1SMT A;  2V9K A;  1HCR A;  1YIT I;  3MKZ A;  4WCG A;  2IP2 A;  3E97 A;  4CCN A;  2O8K A;  2L9R A;  1IG7 A;  3H9J A;  3LL7 A;  3SHF A;  2K9L A;  1MBJ A;  3A1Y A;  3Q0U A;  1FP1 D;  2OQG A;  4KA4 A;  1JKP C;  2LF8 A;  3JTG A;  4GDF A;  2HOA A;  3PQK A;  1FIA A;  3W3C A;  3OYJ A;  1MSE C;  2IAI A;  1S9H A;  3HYI A;  2XVC A;  1HLV A;  1ETO A;  3MEX A;  3K0L A;  1VTN C;  2IA1 A;  1Y39 A;  1QZZ A;  3SEZ A;  3M07 A;  4YII A;  4HNU A;  2DCE A;  5FKM A;  2DOF A;  1U8R A;  4A93 J;  2VAS A;  4LD5 A;  1UAA A;  2DJI A;  2ZJR F;  2IS1 A;  3ZQL A;  1LVA A;  2XAF A;  4E70 A;  1DGR M;  5ICG A;  3QOD A;  3QPT A;  4OIN F;  2MFZ A;  3GF2 A;  3KX2 A;  1UHM A;  3HKZ N;  1UB9 A;  2NNN A;  4HOB A;  2STW A;  2ZXW H;  4A3F J;  3T8R A;  1LDJ A;  2L54 A;  6PAX A;  2CS3 A;  1Z21 A;  2LSO A;  3PUB A;  4NB5 A;  4A6E A;  4BS9 A;  2P5L C;  3DBH B;  1K6Y A;  2Y75 A;  4YFN F;  2P4W A;  2RN7 A;  3QPH A;  5A2Q K;  2MLG A;  1TW3 A;  2PN6 A;  3BG3 A;  4ZDP A;  3WE2 A;  5FLX Z;  3W2V A;  2BY3 A;  3QRF F;  2ACJ A;  2DMQ A;  1IF1 A;  5C3E J;  5D5U B;  1AOY A;  1TLH B;  1WJ5 A;  4G9Y A;  4D7M A;  2QWW A;  1VQK I;  1Y1V J;  3MWM A;  1T56 A;  1QVT A;  1KYW A;  4PJN A;  1MND A;  3I56 I;  2PFB A;  2L9N A;  2NS0 A;  3OV8 A;  3HIF A;  3H1C A;  5DYM A;  3RSN A;  3HL2 A;  2A69 F;  2Q0O A;  3P5J A;  1JUP A;  3F8B A;  3HHG A;  3RPQ A;  4BHP A;  4E7K A;  4KNY A;  2OTJ I;  3QP6 A;  3GFJ A;  4F3Q A;  5J4V A;  2FBI A;  4PJL A;  5H6Q A;  2QKM B;  2PJR A;  3Q3S A;  1N77 A;  3LSG A;  3GTJ J;  3WU0 A;  1IRZ A;  3F21 A;  1OIS A;  4JBA A;  2KJB A;  4CDG A;  1K6O A;  1SD7 A;  3Q5F A;  1G6N A;  2HS5 A;  2RC4 A;  2AQE A;  2JVH A;  4IHW A;  2GXG A;  3PO3 J;  4OAZ A;  1J5Y A;  3OOU A;  4L9J A;  2E2H J;  2GQQ A;  3BR2 A;  3C2H A;  1IN7 A;  2PI0 A;  4BNC A;  4B8X A;  2DA2 A;  2DQR A;  2EIL H;  4RB0 A;  1UHW A;  3J7Y J;  4XLE A;  1EF4 A;  3FM5 A;  5FLM J;  4UVC A;  1K79 A;  1RKW A;  3I4P A;  3WTS C;  3BC8 A;  4IKF A;  2K9M A;  2IBD A;  2K86 A;  2DOD A;  2M0M A;  1MMA A;  1FBS A;  3OYF A;  2LDU A;  1RUN A;  4PJM A;  1H0M A;  1XDU A;  2P5K A;  3S8P A;  4ESJ A;  1NK2 P;  2VL8 A;  2MH9 A;  2COB A;  1W0U A;  1DPR A;  2BVL A;  2VT3 A;  3U21 A;  3QU3 A;  2XRL A;  4F52 A;  2M87 A;  4II3 A;  3TO6 A;  1OCT C;  4XLN F;  5FLX K;  2ZO4 A;  3SZG A;  1V4R A;  5HLI A;  4EEF G;  4H0E A;  1TL8 A;  1FBQ A;  3EET A;  3N05 A;  3O6B B;  4PFO A;  2HXI A;  3SFZ A;  1LUJ B;  2KDO A;  4RLF A;  1ULY A;  1YJ9 I;  1XTA A;  2ETH A;  1ETK A;  2X4H A;  4XRS A;  1WVR A;  2W25 A;  2BBY A;  2EBI A;  3FX3 A;  4UY8 I;  2HOS A;  3EUH A;  3GVA A;  1DPU A;  4Y52 J;  4FQG A;  3EYI A;  2L7Z A;  2M7A A;  3IRQ A;  2CUZ A;  5IY5 H;  4HF1 A;  2JUG A;  3K1N A;  4LJZ F;  5M3M J;  1U8B A;  2NVY J;  5ICC A;  2EIK H;  1W0T A;  1WZ2 A;  4KN7 X;  3E5U A;  4V2F A;  2WWY A;  3LSP A;  3I0T A;  2CQK A;  2DMN A;  5L3C A;  3J81 K;  3G3Z A;  4DW6 A;  1ZLJ A;  4HX8 A;  1W4M A;  4HV6 A;  4XBF A;  2X6O A;  2O03 A;  2ICW G;  2X6W A;  2R7R A;  2VJJ A;  2DTR A;  2XGX A;  3EPZ A;  1BIA A;  1R6R A;  1D8K A;  3G1O A;  5F04 A;  2LKP A;  2DYR H;  1FP2 A;  3QU6 A;  1JT0 A;  2B7E A;  2ZJ2 A;  3BJ6 A;  2CH0 A;  3OS2 A;  3F6V A;  2E1N A;  1YLF A;  3H3Z A;  2DPD A;  5M3F J;  4XLA A;  2A6T A;  1IAW A;  5DUK A;  1XGN A;  1O7L A;  5J3L A;  1UG2 A;  1VQM I;  3QP5 A;  2A6E F;  5BMZ A;  4XLH A;  1W7P B;  1A31 A;  3JCU C;  3CF5 F;  4KIS A;  3CJT B;  1MMD A;  1UJ8 A;  3JTH A;  4PDK A;  4UUT A;  3CDL A;  3BT9 A;  4ZH4 F;  3JRC A;  2Y9Z A;  2F5E A;  1QBJ A;  2DQL A;  1F4K A;  2KFD A;  3TDU C;  1BM9 A;  1E0E A;  4HG2 A;  2DU9 A;  1IXS B;  1OYY A;  2Z99 A;  1XDS A;  1Q1V A;  3L2R A;  3HOT A;  5LGU A;  4HF0 A;  3V8K A;  3RKY A;  3C2G A;  1SMY F;  2E60 A;  2CRG A;  5F1J A;  2LYC A;  3A0H C;  1FSE A;  2XRO A;  5JHF A;  1MSF C;  1HQC A;  1WSU A;  3IHU A;  5FFZ A;  4W1U A;  4G7O F;  4BDZ A;  4U87 A;  2CW0 F;  3JRF A;  4E6K G;  4EJV A;  3F9K A;  2IRF G;  4BGD A;  3E6C C;  4LG3 A;  4HX7 A;  4EM2 A;  2CQQ A;  2E7W A;  2Y69 H;  3G2B A;  4G8X A;  4XQF A;  4X6A J;  2BHZ A;  1KQ0 A;  4XOT A;  4XRM A;  1QHH D;  1HKQ A;  3ML6 A;  2NOG A;  2QLZ A;  3KP7 A;  1AHD P;  1BOB A;  2R93 J;  2LR8 A;  4E7Z A;  2UUZ A;  5AIP A;  3WTW C;  5DV5 A;  2WAE A;  3KP5 A;  2ZXH A;  4AYB A;  5E1Z B;  4XL9 A;  1AWC A;  3KYL A;  2L02 A;  2H8W A;  4O5V A;  4NHJ A;  4Y4R A;  2HYF A;  2CV0 A;  3ABL H;  1EV7 A;  3BZ6 A;  5JI6 A;  3F8N A;  1MH4 A;  1E3H A;  3FBI B;  2NVT J;  2FX0 A;  3RDI A;  2DA5 A;  3ABU A;  2WB1 A;  3EYY A;  4IJA A;  1MMN A;  2DT7 B;  1S7A A;  2VQL A;  3IRR A;  1FX7 A;  2R7D A;  2YUS A;  3K69 A;  2KIM A;  3LQQ A;  1R5I D;  1UCR A;  2K4J A;  4HAM A;  2E19 A;  1TWC J;  1U5T C;  3F0C A;  1LNW A;  2O3F A;  2QUF A;  4BHC A;  3PO2 J;  1F1Z A;  2Y0S A;  4FX0 A;  3ZMU A;  1HDD C;  2ELK A;  3WTU C;  3GTM J;  3HRM A;  2F4I A;  2ZKZ A;  4S0H B;  2MYS A;  3C3W A;  3HOU J;  3H0D A;  1GT0 C;  2KIS A;  3D5L A;  4C3I J;  5FKN A;  2L5Q A;  2FU4 A;  4QIW N;  3IV5 A;  3ASN H;  1ZAR A;  3KEY A;  4B3A A;  5J6X A;  4HST A;  3BG5 A;  2LH9 A;  4MEY F;  4M6X A;  1LJ9 A;  4XID A;  1XX5 A;  4HV5 A;  1KU7 A;  1V5E A;  1JTX A;  1UG0 A;  2VBY A;  3HTU A;  4LLL A;  4XLP F;  3C1D A;  1T2K A;  2YU9 J;  4CCO A;  4ZTF A;  2L2O A;  1IXC A;  2UXX A;  3CES A;  4C3J J;  3FMR A;  2I10 A;  2ME0 A;  3HOV J;  4LK0 F;  4D0P A;  1U2W A;  2QQ9 A;  1IW7 F;  1DP3 A;  4R79 A;  3IKT A;  2W85 A;  1P6R A;  5K5R A;  1D1B A;  3V7C A;  5IYD J;  4BQQ A;  3ZQ7 A;  2DTZ A;  5CLS A;  4OIO F;  4A69 C;  4B1R A;  3FK6 A;  1K61 A;  2KT0 A;  3KET A;  5HDK A;  1ZGW A;  1T0F C;  4IHV A;  1V5F A;  1VQN I;  2HI3 A;  4L18 B;  4QPQ A;  2KQR A;  1MKM A;  3HRT A;  3QQA A;  2QA4 I;  2HWV A;  1FOX A;  2KP6 A;  4V2G A;  1FOY A;  3L2C A;  2E5Z A;  4AC0 A;  2HFH A;  2KIQ A;  3KP6 A;  4UV9 A;  3L2U A;  3FWE A;  3MZY A;  5FD6 A;  3MFK A;  2DA4 A;  3OYI A;  2HQA A;  3WTZ A;  2K02 A;  3RZD J;  2PJP A;  1SD6 A;  2AHQ A;  1UMQ A;  1SAU A;  4ESF A;  3BY6 A;  1KU9 A;  1R9T J;  1S8N A;  1ORK A;  1ITY A;  3O2P E;  3BTI A;  3MMY B;  1T95 A;  2P8T A;  4HQM A;  4BXU A;  1GVJ A;  4ZYH A;  2BY2 A;  4F91 B;  3DTE A;  2EFW A;  3I71 A;  5HOO A;  2X85 A;  2GIV A;  5ILS A;  3VSK A;  3JRE A;  4FX4 A;  1OFC X;  2IGN A;  4BY7 J;  5E1W A;  1XCV A;  1X3Z B;  2HYJ A;  2LOO A;  3GZ5 A;  2FE3 A;  2FQ3 A;  2X1E A;  2E2I J;  3HG9 A;  1TNS A;  5KCM A;  2KHM A;  1R22 A;  3HKZ A;  4HDU A;  3U2R A;  1YX5 A;  5IT9 Z;  4PGG A;  1GV5 A;  2OZU A;  2XIG A;  2PJR B;  3A0B C;  4UB6 C; 
#chains in the Genus database with same CATH homology
 1T0F A;  3WTV C;  3ZPL A;  2IA2 A;  3GUD A;  1F5T A;  2V6C A;  3IL2 A;  3BOQ A;  3P9K A;  4MTD A;  4R8H A;  3I59 A;  3JSO A;  5DUI A;  1YW9 A;  2F5D A;  2M1B A;  2VBX A;  1HW2 A;  4HZF A;  1G3S A;  2XV4 S;  3TOA A;  5LEK A;  1ZN2 A;  3Q9S A;  3MQ0 A;  3O3K A;  3RPU A;  2RKH A;  3F22 A;  5D4S A;  1LDK B;  2VXZ A;  2ZNY A;  4NQW A;  5CVV A;  5FB2 A;  2VT2 A;  1B1B A;  2EFQ A;  3J81 Z;  4WXC A;  4MTE A;  1XGO A;  3ZMT A;  2ZME B;  2YSR A;  1KYZ A;  1ZLK A;  5TRD A;  2CWE A;  2QYO A;  1HSJ A;  3LAJ A;  3M8E A;  4I0A A;  1SD5 A;  2D45 A;  2F2E A;  3I53 A;  1OR7 A;  1R1T A;  1SFE A;  2HQN A;  1HST A;  2V1U A;  5LLQ A;  4I0B A;  4UV8 A;  1KQ8 A;  1TBX A;  2YX4 A;  1W5T A;  3M1E A;  2E1C A;  3F3X A;  3CDH A;  2QBY A;  3LFK A;  4OIR F;  3DQV C;  1FPQ A;  4HLY A;  4L9N A;  1HW5 A;  4U0V A;  2VON A;  1YW7 A;  3KP2 A;  1MDM A;  3BPX A;  2ELH A;  4IRH A;  4IPA A;  2G9W A;  3RJP A;  2C6Y A;  4M6Y A;  4BHB A;  4P9U A;  3GFL A;  5EEG A;  3TGN A;  2MLK A;  5AIQ A;  2DBB A;  3RI4 A;  1JHF A;  4S05 A;  2A61 A;  1FLI A;  2DFI A;  3TQN A;  1ZRF A;  2OD5 A;  4ENK A;  5LBQ A;  2CO5 A;  1YW8 A;  4FHT A;  3KEQ A;  2X0L A;  4BQA A;  2FF4 A;  3V7S A;  2GA1 A;  4G6Q A;  3R61 A;  3J80 Z;  1ZHF A;  1K7A A;  1PUE E;  4ESB A;  1OPC A;  5E17 F;  1KU3 A;  5BPI A;  1K78 A;  4G7H F;  2HKO A;  1JE8 A;  1DP7 P;  5FD5 A;  3NRV A;  1QNT A;  2Y0M A;  5L3G A;  4RB3 C;  3FF5 A;  1Z05 A;  5HDG A;  2BEO A;  3WTX C;  2W84 A;  4IRG A;  4EV0 A;  3OOP A;  3D0S A;  4Q48 A;  1P4A A;  3JSP A;  4HW0 A;  2F5C A;  2DT5 A;  4KYW A;  4UHT A;  5D6E A;  3LAP A;  1YQA A;  2JPC A;  1IN5 A;  1EH6 A;  5CVJ A;  1BI3 A;  4HLX A;  4L9T A;  4M9S A;  3FMS A;  2PMU A;  3GLX A;  3ECH A;  2OBP A;  1Z7U A;  4RGS A;  2ESH A;  1B9M A;  2EV6 A;  3KLN A;  3BP8 A;  2UWM A;  3VEP A;  1ZH5 A;  3VOE A;  2L3D A;  5EEH A;  2GXB A;  1WI9 A;  1PP8 F;  1BIB A;  4ENM A;  4CZZ A;  1LDD A;  1MGT A;  3E3V A;  3QOP A;  1U5T A;  5DD8 A;  1C0W A;  1R5H A;  2MBF A;  4L9V A;  3F8F A;  5D6F A;  4M74 A;  1TTY A;  1B9N A;  1R7J A;  2QEN A;  4ZZL A;  3J7A O;  3GWZ A;  1QO0 D;  4L0Z B;  3RYP A;  1OYI A;  3M7G A;  1X3U A;  2HYG D;  2KKO A;  3KZZ A;  2Z9O A;  2EV5 A;  4Q5S F;  4A6D A;  2ZFW A;  5ERI A;  2D2W A;  4F7Z A;  1WWX A;  3C18 A;  2H27 A;  2V1X A;  3NQO A;  4UVB A;  1S6L A;  3JAM K;  3FXR A;  4P55 A;  5FO5 A;  5BS6 A;  2FOK A;  2XKP A;  2RDP A;  4FT8 A;  1FSH A;  2LF7 A;  2VBW A;  2G7U A;  2W57 A;  2D1H A;  4M9X A;  3CLO A;  4I01 A;  1BI2 A;  1R5G A;  2D1V A;  4ENJ A;  3K1M A;  4CGZ A;  5D5W B;  4BYY A;  4LK1 F;  3LST A;  3L9F A;  3B73 A;  5L3F A;  2NYX A;  4Y13 A;  5E8I A;  3T1B A;  2DK5 A;  5A2Q Z;  2K4B A;  4OMZ A;  1CF7 B;  4QLC U;  1BI1 A;  4KFC A;  3L00 A;  4M73 A;  3I5U A;  1RNL A;  3M8F A;  5LHH A;  5LGN A;  2NAZ A;  1E17 A;  2EK5 A;  2QQA A;  3R0A A;  2VE8 A;  2P7C B;  1U5T B;  4UNO A;  4IHS A;  1IN8 A;  2O61 A;  1R23 A;  3FMQ A;  5HLH A;  3R6S A;  5IT9 K;  1G3T A;  2O0Y A;  2JTV A;  4I02 A;  1O7F A;  2UXN A;  2M30 A;  3JW4 A;  1SAX A;  5F64 A;  2ADU A;  2M5W A;  3GZ6 A;  2VBZ A;  1K78 B;  4MQ9 F;  1WQ2 A;  1QGP A;  2BGC A;  4RS8 A;  1BC8 C;  2GAU A;  4A0Z A;  3RTR A;  3IKV A;  1P4W A;  1OYW A;  2YPR A;  3W6J B;  1O3T A;  2EFO A;  1YYV A;  1S7O A;  2JT1 A;  3ISP A;  1T39 A;  3VFZ A;  4Z2Y A;  3S2W A;  3EDP A;  4P5O A;  2OU2 A;  4HF2 A;  5E18 F;  1ZG5 A;  4P9F A;  2HR3 A;  4I2O A;  2ISY A;  1KGS A;  2TDX A;  1KA8 A;  1XGM A;  1FZP B;  1XSX A;  4HYE A;  2BE5 F;  1U78 A;  1XB4 A;  3TOB A;  4RAY A;  2FNP A;  1IZ1 A;  1J9I A;  1GHC A;  3DEU A;  2M8E A;  1LEB A;  4LMY A;  2ISZ A;  1I1G A;  5L3E A;  3BRO A;  1JGS A;  4CO8 A;  1FWZ A;  1G4D A;  3J80 K;  4KT5 C;  1YS6 A;  2A68 F;  1ZRC A;  2ESN A;  2VC1 A;  4KMF A;  3TO9 A;  1RZ4 A;  3CO7 C;  5K1Y A;  2RQP A;  2H6C A;  3PFI A;  5DD4 A;  1HKS A;  2IJL A;  5CYV A;  5BPD A;  5DCF A;  4XRF A;  2VN2 A;  3N97 A;  2GWR A;  4YFX F;  3HTS B;  3KFW X;  1U6G A;  4XSX F;  3SZP A;  2P6T A;  5HS9 A;  2QM3 A;  1J0R A;  3RKX A;  2Z33 A;  2JZY A;  1TW2 A;  4AIH A;  3KCC A;  2XKO A;  3F72 A;  1T6S A;  4IXA A;  4EJU A;  1ON2 A;  1ZG1 A;  5D4R A;  3SXY A;  2ZCW A;  2HQR A;  3V7R A;  1ZRE A;  2MA3 A;  4HA8 A;  1MJB A;  1B6A A;  5LEJ A;  2H94 A;  5L3D A;  1JHH A;  3WU1 B;  2B0L A;  5F6F A;  5JFR A;  4A12 A;  4WF2 A;  1B4A A;  1BJA A;  2STT A;  2P5V A;  2DLL A;  4RB1 A;  1J59 A;  4WX9 A;  2R7F A;  3IWZ A;  2W24 A;  3ELK A;  1MJA A;  5BOX A;  4BAY A;  1R36 A;  3M9A A;  3P9I A;  2DK8 A;  4G6D A;  4LG0 A;  1BOA A;  1OMI A;  5E8G A;  4KIB A;  2ZME A;  1LB2 A;  3U1D A;  4WWC A;  4Q47 A;  1IN4 A;  1WKM A;  2VE9 A;  4ETS A;  4HDV A;  3T8T A;  3WGH A;  1I6X A;  1U3E M;  4HQE A;  2HEO A;  3T0Y A;  4N9I A;  3I58 A;  2KIF A;  3RYR A;  1XCB A;  2H09 A;  4CIC A;  1MD0 A;  3ULQ B;  1G3Y A;  4IF4 A;  3E6M A;  2R3S A;  3F23 A;  2VOO A;  4O3M A;  2EA4 A;  1FOK A;  5ILV A;  4AWX B;  5AON A;  2YU3 A;  2Z5U A;  1B59 A;  1HXD A;  4LG0 B;  4RGR A;  1KU2 A;  1XMK A;  4LFU A;  3QAH A;  2QZ8 A;  1Z9C A;  1HBX G;  3ERE D;  4IRI A;  1ZGA A;  5D8L B;  1UST A;  1I1S A;  3IC7 A;  1P2F A;  3SZT A;  2QQB A;  2EFN A;  1XMA A;  2EFP A;  1BC7 C;  2FMY A;  2PBI A;  1GXP A;  1BBY A;  1W7P A;  1OKR A;  1ZYR F;  2KJC A;  2DO7 A;  2L4A A;  3KLO A;  1I5Z A;  3I54 A;  4MHG A;  1Y0U A;  3MAJ A;  2L01 A;  5JHU A;  3EQL F;  2XAH A;  4YG2 F;  4UVA A;  4EJT A;  4RAZ A;  4MGR A;  5KVR A;  2KIU A;  2FA5 A;  3R60 A;  4I98 B;  2CGP A;  4LB5 A;  2XRN A;  2GZW A;  2FBK A;  3MCZ A;  3KE2 A;  3DP7 A;  2QBY B;  5K5O A;  4LLN A;  2M45 A;  4WK8 F;  3HRS A;  1L0O C;  5DEQ A;  4A0X A;  5J8C A;  2IA0 A;  2ZBK A;  3DPL C;  3RKW A;  2K27 A;  1SFX A;  1W7P D;  3BDD A;  5LRR A;  1FC3 A;  4A5M A;  5TJJ A;  5F1R A;  4OOI A;  1ZRD A;  3WE3 A;  5ICE A;  3N4M A;  4R1H A;  1FT9 A;  2NRA C;  1R58 A;  4WXH A;  1FYL A;  3I64 A;  3GO5 A;  2KRF A;  4S04 A;  1PDN C;  4EGZ A;  4DQ2 A;  5D5X B;  2JPB A;  2WV0 A;  5CVU A;  3CTA A;  5CJ9 A;  5E1X A;  3FM3 A;  2MC3 A;  1XN7 A;  1L3L A;  1RUO A;  2HTS A;  1TQM A;  2XHK A;  1SD4 A;  5K5Q A;  3HSR A;  1YIO A;  2J5O A;  3P7N A;  4EM1 A;  4K2E A;  2EJR A;  2PQ8 A;  1D5V A;  4O6J A;  4ON0 A;  4Y15 A;  4JK1 X;  4AD9 A;  3JAM Z;  2Q2E A;  4GGG A;  4RGX A;  1LQ1 A;  3G73 A;  4A0Y A;  4LB6 B;  1SFU A;  4OMY A;  4IVN A;  3NEU A;  4N0B A;  4PGH A;  1Z1D A;  1XSV A;  3SQN A;  1TQI A;  5LHG A;  3ZN1 A;  2NNY A;  3TDZ C;  1FYM A;  3HSF A;  1T38 A;  4GCV A;  4JQF A;  1HW1 A;  4I09 A;  2HZT A;  1LEA A;  2XAS A;  1YS7 A;  2WC2 A;  1J75 A;  3B02 A;  2IT0 A;  4G94 A;  2VOD A;  2RVC A;  2WTE A;  4UXN A;  3AAF A;  4M9Z A;  5H6R A;  3E6B A;  4U0Y A;  3KZY A;  3DF8 A;  3CUQ C;  4G7Z F;  4KMU X;  3ZMV A;  1J7K A;  2RV8 A;  1CGP A;  1NHA A;  3ECO A;  3LWF A;  2EA2 A;  4EM0 B;  4U7D A;  2BYV E;  1MDM B;  5ED4 A;  4XSZ F;  2RGV A;  3K1P A;  3FHZ A;  1YFH A;  4DNC A;  4KUM A;  4TV7 A;  2P6S A;  1XSD A;  3FXQ A;  4LLG F;  2H6B A;  4I7H A;  3COA C;  3HHH A;  1QZY A;  3R4K A;  1BI0 A;  1ODD A;  3LQR A;  5LRS A;  2DW4 A;  5ILU A;  3DV8 A;  5DDG A;  3WG9 A;  3FXU A;  3TKY A;  2Z3Y A;  5LHI A;  3E6D A;  3ABT A;  2BV6 A;  2YR2 A;  2OA4 A;  2A07 F;  5HS7 A;  4EJO A;  4AVP A;  2LNB A;  1ZGJ A;  3DFG A;  5ICF A;  4CHU A;  2FXA A;  3REO A;  1H9T A;  4YIF A;  3GX4 X;  1UFM A;  3BJO A;  4N9H A;  2YX7 A;  1YO5 C;  3WOD F;  3ZMS A;  4A2U A;  4PZJ A;  2FML A;  4CXF A;  5LGT A;  3HSE A;  1YTY A;  1EH7 A;  3MZH A;  3TO7 A;  2COM A;  3K2Z A;  1O3R A;  2P7V B;  3KEO A;  5JR3 A;  3BPV A;  1ZG3 A;  4AIJ A;  2FSW A;  1PP7 U;  5H20 A;  3DKW A;  3HRU A;  1RI7 A;  1BN5 A;  2FRH A;  3GFI A;  2IVM A;  3KP3 A;  2GA2 A;  3DPT A;  2F5F A;  1J2X A;  3VB2 A;  1RIO H;  1V3F A;  3F8M A;  1WRJ A;  2FEZ A;  3CJN A;  4EJW A;  5CVI A;  1HKT A;  3WTT C;  4EQQ A;  5D5V B;  1REP C;  3GXO A;  1O57 A;  2CYY A;  1DUX C;  2MH2 A;  5J8F A;  4IHT A;  2HKX A;  4PCQ A;  1Q1H A;  4KIF A;  2ZNZ A;  4B09 A;  2DI3 A;  3GEZ A;  3BJA A;  3WTY C;  3KP4 A;  4AIK A;  3IWF A;  1R1U A;  2OAZ A;  3GW2 A;  1P92 A;  3P9C A;  1Z6T A;  1GXQ A;  3L09 A;  4ZYE A;  3T5X A;  3WGG A;  3ZMD A;  1P4X A;  5KK1 A;  4KN4 X;  1IRG A;  3E5X A;  5E20 A;  4ASN A;  2PLY A;  3R0J A;  4YFK F;  2K7L A;  4EMS A;  2Y48 A;  5DCM A;  2E7X A;  2Q8K A;  3H3U A;  4OU0 A;  1QPM A;  4KIC A;  4GXO A;  4U88 A;  2O8X A;  3E5Q A;  1EH8 A;  2OZ6 A;  1A04 A;  3VOD A;  3W6K B;  5IT3 A;  3LA7 A;  2IW5 A;  1STZ A;  2VOP A;  4RGU A;  2FBH A;  2QVO A;  1MZB A;  3F8C A;  2EWN A;  3CUQ B;  2V79 A;  4LGW A;  2DAO A;  1IN6 A;  4Y17 A;  3CUO A;  1F9N A;  3I59 B;  1T98 A;  4GO1 A;  1R1V A;  3WGI A;  4KDP A;  3HUG A;  4EGY A;  3GFM A;  2CSO A;  5L3B A;  4CYD A;  3ZMZ A;  1YG2 A;  1TNT A;  2CFX A;  1E2X A;  1D8J A;  4MQV A;  2HGC A;  4MEX F;  3L7W A;  4GYG A;  1CF7 A;  1MJ9 A;  1XGS A;  1IRF A;  3BWG A;  1XD7 A;  5HDN A;  4ENN A;  2J5P A;  1IXR C;  3H92 A;  2EB7 A;  2XUB A;  1I27 A;  2PMH A;  4U0W A;  5FGM A;  3LA2 A;  3F6O A;  2XAG A;  2O6G E;  1H9G A;  2RNJ A;  4BH9 A;  5HLG A;  3ZP5 A;  3U9G A;  1G3W A;  4ZZD A;  2A6H F;  2A5Y B;  3V8L A;  1D3Y A;  4OIP F;  1FY7 A;  1ZAO A;  4Q4Z F;  5HS8 A;  2VC0 A;  3CO6 C;  4ZYD A;  1DDN A;  4EVI A;  4GYI A;  3HOS A;  4RB2 C;  3V8J A;  1R00 A;  2MD5 A;  2XAQ A;  3Q9V A;  2DPU A;  4M72 A;  3DXJ F;  4HX4 A;  1ONV A;  2UZK A;  2L4M A;  4MNU A;  1FYK A;  2JSC A;  1FNN A;  2PG4 A;  3GYH X;  4QWQ A;  4U7B A;  3V4G A;  2PEX A;  1O3Q A;  1QQI A;  2JRT A;  3CUQ A;  1S3J A;  5CVR A;  1ON1 A;  2AXL A;  3LA3 A;  3FZV A;  4L0Y B;  4KIG A;  2A3S A;  2XAJ A;  5HVQ C;  5DCM B;  3ROU A;  3PQJ A;  3K9T A;  3RIR A;  3ZN0 A;  4L5J A;  2G7H A;  4P96 A;  1O3S A;  1Z91 A;  2HDC A;  1TQP A;  2ZXJ A;  4A5N A;  5D8K B;  4UUV A;  1JXS A;  2CG4 A;  1S29 A;  2V1D A;  1KQ9 A;  1Z6R A;  4HBL A;  4OIQ F;  4WXD A;  2HTJ A;  1USS A;  4M71 A;  4ZYG A;  2AS5 F;  3C7J A;  2V9V A;  1FBU A;  5JVT A;  4L5I A;  5FFX A;  2FNA A;  1W5S A;  2EV0 A;  5BQT A;  2OQR A;  2HOE A;  1IUY A;  2IPQ X;  1SMT A;  4WCG A;  2IP2 A;  3E97 A;  3SHF A;  1FP1 D;  2OQG A;  4KA4 A;  2LF8 A;  3JTG A;  3PQK A;  3HYI A;  2XVC A;  3MEX A;  3K0L A;  1VTN C;  2IA1 A;  1QZZ A;  4YII A;  1U8R A;  4LD5 A;  1LVA A;  2XAF A;  4E70 A;  5ICG A;  3QPT A;  4OIN F;  3GF2 A;  1UHM A;  1UB9 A;  2NNN A;  4HOB A;  2STW A;  3T8R A;  1LDJ A;  2L54 A;  6PAX A;  2LSO A;  4NB5 A;  4A6E A;  2P5L C;  2Y75 A;  4YFN F;  2P4W A;  2RN7 A;  3QPH A;  5A2Q K;  2MLG A;  1TW3 A;  2PN6 A;  3WE2 A;  3QRF F;  5FLX Z;  2ACJ A;  1IF1 A;  5D5U B;  1AOY A;  1TLH B;  4G9Y A;  2QWW A;  3MWM A;  1KYW A;  2PFB A;  2NS0 A;  3OV8 A;  3HIF A;  5DYM A;  2A69 F;  2Q0O A;  4BHP A;  3F8B A;  3HHG A;  3RPQ A;  4KNY A;  3QP6 A;  3GFJ A;  2FBI A;  5H6Q A;  3WU0 A;  3F21 A;  4JBA A;  2KJB A;  4CDG A;  1K6O A;  1SD7 A;  3Q5F A;  1G6N A;  2HS5 A;  2RC4 A;  2GXG A;  1J5Y A;  4L9J A;  4BNC A;  2GQQ A;  1IN7 A;  2PI0 A;  4B8X A;  2DQR A;  4RB0 A;  1UHW A;  3FM5 A;  4UVC A;  1K79 A;  3I4P A;  3WTS C;  2K86 A;  1FBS A;  2LDU A;  1RUN A;  1H0M A;  1XDU A;  2P5K A;  4ESJ A;  2MH9 A;  1DPR A;  2VT3 A;  3QU3 A;  2M87 A;  3TO6 A;  5FLX K;  4XLN F;  2ZO4 A;  1V4R A;  5HLI A;  4H0E A;  1FBQ A;  3EET A;  3O6B B;  3SFZ A;  1ULY A;  2X4H A;  2ETH A;  2W25 A;  2BBY A;  3FX3 A;  3EUH A;  3GVA A;  1DPU A;  3EYI A;  3IRQ A;  4HF1 A;  3K1N A;  4LJZ F;  5ICC A;  4KN7 X;  3E5U A;  2WWY A;  3I0T A;  2CQK A;  5L3C A;  3J81 K;  3G3Z A;  1ZLJ A;  4HX8 A;  1W4M A;  4HV6 A;  4XBF A;  2O03 A;  2DTR A;  2XGX A;  1BIA A;  1D8K A;  2LKP A;  1FP2 A;  3QU6 A;  2ZJ2 A;  3BJ6 A;  3F6V A;  2E1N A;  1YLF A;  3H3Z A;  2DPD A;  1IAW A;  5DUK A;  1XGN A;  1O7L A;  3QP5 A;  2A6E F;  5BMZ A;  1W7P B;  3JTH A;  4PDK A;  4ZH4 F;  2F5E A;  1QBJ A;  2DQL A;  1F4K A;  3TDU C;  1BM9 A;  2DU9 A;  1IXS B;  1OYY A;  2Z99 A;  1XDS A;  3HOT A;  5LGU A;  4HF0 A;  3V8K A;  3RKY A;  1SMY F;  1FSE A;  2XRO A;  1HQC A;  1WSU A;  3IHU A;  5FFZ A;  4G7O F;  2CW0 F;  4EJV A;  2IRF G;  3E6C C;  4HX7 A;  4EM2 A;  2E7W A;  4G8X A;  1KQ0 A;  1HKQ A;  3ML6 A;  2QLZ A;  3KP7 A;  3WTW C;  5AIP A;  5DV5 A;  3KP5 A;  5E1Z B;  1AWC A;  2L02 A;  4O5V A;  4NHJ A;  2HYF A;  3BZ6 A;  1EV7 A;  5JI6 A;  3F8N A;  3RDI A;  3ABU A;  3EYY A;  4IJA A;  1S7A A;  3IRR A;  1FX7 A;  2R7D A;  3K69 A;  2KIM A;  3LQQ A;  1UCR A;  4HAM A;  2K4J A;  1U5T C;  1LNW A;  2O3F A;  2QUF A;  4BHC A;  1F1Z A;  4FX0 A;  3ZMU A;  3WTU C;  3HRM A;  2ZKZ A;  3C3W A;  3D5L A;  2FU4 A;  1ZAR A;  5J6X A;  4MEY F;  4M6X A;  1LJ9 A;  4HV5 A;  1KU7 A;  2VBY A;  3HTU A;  4LLL A;  4XLP F;  3C1D A;  1T2K A;  1IXC A;  2UXX A;  3FMR A;  4LK0 F;  4D0P A;  1U2W A;  2QQ9 A;  1IW7 F;  4R79 A;  3IKT A;  2W85 A;  1P6R A;  5K5R A;  3V7C A;  3ZQ7 A;  5CLS A;  4OIO F;  3KET A;  5HDK A;  4L18 B;  3HRT A;  1MKM A;  2HWV A;  3L2C A;  2HFH A;  3KP6 A;  4UV9 A;  3FWE A;  3MZY A;  5FD6 A;  3MFK A;  3WTZ A;  2K02 A;  2PJP A;  1SD6 A;  4ESF A;  3BY6 A;  1KU9 A;  1S8N A;  3O2P E;  2P8T A;  4HQM A;  4BXU A;  1GVJ A;  4ZYH A;  2EFW A;  3I71 A;  5HOO A;  2GIV A;  5ILS A;  4FX4 A;  5E1W A;  1XCV A;  3GZ5 A;  2FE3 A;  2FQ3 A;  1TNS A;  1R22 A;  4HDU A;  3U2R A;  5IT9 Z;  4PGG A;  2OZU A;  2XIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...