1YLFA

X-ray crystal structure of bc1842 protein from bacillus cereus, a member of the rrf2 family of putative transcription regulators.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
117
Chain Sequence
KISSRFSIAVHILSILKNNPSSLCTSDYMAESVNTNPVVIRKIMSYLKQAGFVYVNGGAGLLKDLHEITLLDVYHAVNVIGANIQAVLEIILIQAQSAMEEVLRNITMGQLFETLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords RRF2 family protein
publication title X-ray crystal structure of BC1842 protein from Bacillus cereus, a member of the Rrf2 family of putative transcription regulators.
rcsb
source organism Bacillus cereus atcc 14579
total genus 32
structure length 117
sequence length 138
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ylfA00
5FFXA 3K69A 5K1YA 3ISPA 1OYYA 1ON1A 3WTTC 1HKSA 2FNAA 3RI4A 4A6EA 2VODA 1QZZA 5AONA 2LKPA 5CLSA 1ZGAA 1YFHA 5F6FA 4UVCA 1XMAA 1LEAA 4U0VA 1R00A 1GXQA 2L4MA 3D0SA 3BPVA 2KIUA 4RS8A 1B4AA 3C3WA 1ONVA 3EDPA 1EH7A 4XSZF 3WU0A 4CO8A 4AIKA 3CTAA 1IAWA 3E5UA 1I1SA 1LNWA 2WV0A 1XMKA 4MGRA 3MEXA 1O57A 1XGSA 4L5JA 2R7FA 2VT2A 1IRFA 4IHTA 1LDJA 1BC7C 3F3XA 3F8BA 4GO1A 3WODF 4O3MA 2ZKZA 2KRFA 2XAJA 4HF0A 5LRSA 2EV6A 4LJZF 3FZVA 3WG9A 3CO6C 1TQPA 3J80Z 1H0MA 3DPTA 1PP7U 5K5OA 1XDSA 3I54A 3HUGA 1BOAA 3GUDA 3MAJA 1FPQA 1XDUA 1XGMA 4Y15A 2GA2A 4GGGA 4U0WA 1BBYA 1WKMA 1EH8A 2ZNYA 4KIGA 1FOKA 4RB1A 3V4GA 3BP8A 1K78B 2D1HA 4BXUA 3JAMZ 4HAMA 3RYRA 2PI0A 4DQ2A 3FXQA 3IL2A 2K4BA 4DNCA 3W6KB 4G8XA 2DQRA 1MGTA 1SFXA 3F8MA 3ABTA 4HLYA 3H3ZA 3GFMA 5BMZA 2M87A 3GZ5A 3ZMUA 2OAZA 1BI3A 4LG0B 4Q4ZF 2M8EA 5E1WA 1U3EM 3DEUA 2F5DA 2VBZA 3R61A 2VE9A 4UXNA 4A6DA 3BWGA 4CGZA 5DCMB 3DPLC 3H3UA 3JW4A 2MH9A 3E6MA 3E6BA 3QOPA 4HA8A 4I09A 2XKPA 1BC8C 4CYDA 2E7WA 4H0EA 2O3FA 4M72A 3GEZA 3MWMA 1HSJA 4HYEA 5DUKA 1FWZA 1W5SA 2GA1A 3I71A 3LSTA 1TQIA 4HX8A 2ZFWA 5CVJA 3KE2A 3R4KA 3GFIA 4RAYA 1J9IA 2NNNA 1R1TA 1DUXC 5KVRA 3BDDA 2RQPA 4KYWA 4L0YB 3L9FA 2TDXA 2FOKA 3KP6A 4NB5A 2EA4A 1ZH5A 1TNTA 4KNYA 2DI3A 4M6YA 5JI6A 3WTWC 3GVAA 3KEQA 3PQKA 1TNSA 2RNJA 2Z33A 2JT1A 4EJUA 4AWXB 1I5ZA 2DBBA 3JAMK 4KDPA 2R7DA 3WGIA 1O3TA 3SHFA 5D5VB 2ZJ2A 4UNOA 4IXAA 4LG0A 2Z3YA 5JR3A 3DQVC 1P6RA 4B8XA 2O0YA 4KUMA 2GWRA 2VOPA 1BIBA 2JPCA 4FHTA 4R8HA 5FD6A 3HSEA 4HOBA 2ISZA 4U7BA 4TV7A 2FQ3A 5CJ9A 2VONA 1DP7P 5DCMA 1G3WA 1I1GA 2V1UA 1WQ2A 2IJLA 1Z6TA 1IXSB 4KFCA 3N97A 2O6GE 1QO0D 4A5MA 4Y17A 3L7WA 2M45A 4U88A 1ZRFA 3ZMZA 4Q47A 4HQMA 4RGRA 2FE3A 2FBIA 3FX3A 4LB6B 3SQNA 2DFIA 4CDGA 4LK0F 1YS6A 3F22A 3HSRA 2V9VA 4L9JA 5J8FA 3AAFA 1HSTA 1G3SA 2BYVE 1EH6A 2PQ8A 1YIOA 2E7XA 5IT9Z 4AIJA 1Z91A 1XB4A 4YIFA 2PLYA 5K5QA 1LDDA 1R58A 5ICFA 1G6NA 4K2EA 2FBKA 1YW8A 2IP2A 1MKMA 4GCVA 1IXCA 4BHPA 4MNUA 4BNCA 1FZPB 5HDGA 1R5HA 3JSOA 1J0RA 4F7ZA 2VT3A 2V1DA 4EJTA 2Y0MA 4YFKF 1MJ9A 3Q5FA 2QQ9A 3LAPA 1DDNA 3OV8A 1USSA 3C7JA 4D0PA 2PN6A 4WXHA 1HW5A 1OMIA 1K7AA 1OYWA 2WTEA 5HLGA 4EMSA 2DO7A 1A04A 3NEUA 2VOOA 5ILSA 1RUNA 3HRSA 3V8KA 5HDNA 3RTRA 5CVUA 2HWVA 1W7PB 2X0LA 3ZN1A 2H6CA 2PBIA 2RV8A 3B73A 4RB0A 1YQAA 4MEXF 4EGZA 6PAXA 3I59B 3CDHA 2ZO4A 4RGUA 1ULYA 3KLOA 1S8NA 1BN5A 2OA4A 2ESHA 4RGXA 2VE8A 1AOYA 1T98A 3WTUC 1R36A 3R6SA 1FSHA 1Q1HA 5DD4A 4KN4X 4M9SA 1FLIA 4U0YA 1R5GA 4N9IA 3LA7A 4KA4A 4OIPF 2XAGA 4IF4A 1CGPA 1RIOH 2YX7A 5DEQA 1KA8A 1F4KA 1IUYA 1YLFA 5L3DA 2HFHA 3EYIA 2FA5A 2PMUA 1P92A 3JSPA 2GAUA 4MQVA 4CHUA 3JTGA 2FXAA 2P6TA 3F21A 3FM3A 2J5OA 2ESNA 4JQFA 4EJWA 4G94A 5BOXA 5HS7A 5D4RA 5KK1A 4I7HA 3U9GA 3F8FA 1SD6A 2IVMA 3F8CA 1WI9A 1S7OA 4M6XA 2GXGA 4HW0A 2ADUA 4MEYF 1W7PA 5E1ZB 4BH9A 3TQNA 4ASNA 2JRTA 2OBPA 4GYIA 5LGNA 3I59A 3IC7A 4IPAA 3CLOA 2FU4A 5ED4A 1U8RA 4KIBA 3E6CC 1IN7A 1R1VA 1T2KA 2IPQX 5D5XB 3RDIA 2LSOA 2BGCA 1L0OC 3QP5A 4QLCU 1KU3A 1QZYA 2PFBA 4HV5A 1ZG3A 5E8IA 1IN5A 2FBHA 3G3ZA 3K9TA 4WX9A 2G7HA 1FBUA 2KIFA 4Q48A 2CYYA 4ESBA 1OKRA 4I0AA 2EFPA 3GW2A 4I02A 2EFQA 4RGSA 2NNYA 4HDVA 1J75A 2LF7A 1KYWA 5LGTA 4OINF 3LAJA 3BJAA 1QPMA 1W5TA 3K0LA 2KIMA 1J5YA 1IN4A 3R60A 3HYIA 2JSCA 2RDPA 2XHKA 1ZREA 4FX4A 4WXDA 3IWFA 4L9VA 4ZH4F 4S04A 4ON0A 2A5YB 2IA2A 3WTSC 4OMYA 3M9AA 2YX4A 1FNNA 3VEPA 5FB2A 1TW2A 1J7KA 4EV0A 2NS0A 4MTEA 3ZQ7A 3VB2A 5A2QZ 1KU2A 2FEZA 2MLKA 1HKTA 2Z99A 1KQ9A 2KKOA 1J59A 3J7AO 3T8RA 2JZYA 5LHIA 4NHJA 4KT5C 2W84A 3V7SA 4Q5SF 2BV6A 1LB2A 2GXBA 5AIQA 3I5UA 1FX7A 1BIAA 2L02A 3KLNA 4M74A 3FMSA 1ZHFA 1OYIA 1OPCA 4L9NA 4RB2C 2BE5F 2PG4A 1XN7A 2IA0A 1MD0A 5K5RA 3U1DA 1H9TA 3IRQA 1Z7UA 1MZBA 3COAC 2UZKA 4KMFA 1FYLA 1B6AA 4LLNA 5FLXZ 1S3JA 3GX4X 1FP2A 4LD5A 3CJNA 3ROUA 3ZMTA 4PGGA 2V6CA 3FMQA 3CUQB 3ELKA 4XSXF 4CXFA 4P55A 2O8XA 1B1BA 2P5KA 4IRHA 3VFZA 4XLNF 3T0YA 5HS9A 2STWA 2XUBA 1ZARA 2XAHA 4GXOA 2L54A 4PGHA 2XIGA 4RB3C 5HDKA 1UHMA 1USTA 3KCCA 1UCRA 3WTXC 2HS5A 2P7VB 2A68F 3N4MA 3QPTA 1KQ8A 1O7LA 4OMZA 1IF1A 2RN7A 4WWCA 4G7HF 2K02A 3D5LA 3LA3A 1F5TA 4LLGF 2PMHA 2P5LC 5DUIA 4HZFA 2ACJA 2EV0A 4P9FA 3E6DA 5E20A 1KU9A 1MJBA 3KZYA 1ZLKA 4ZYGA 1E2XA 1PP8F 1S29A 2DQLA 2FRHA 1G3YA 4HF1A 5ICEA 4EJOA 1F1ZA 1O7FA 1QNTA 2H27A 3J80K 4KICA 3F8NA 3L00A 1AWCA 1H9GA 3ZMVA 2B0LA 1KGSA 4HLXA 2JPBA 4I98B 2O61A 1ZYRF 4HQEA 3KEOA 1ZG1A 4U7DA 3CUQA 5FLXK 2QM3A 2DK8A 3BJOA 2OZ6A 5FD5A 1K78A 2BEOA 2ETHA 1TW3A 2X4HA 2W85A 1B59A 2CSOA 1IXRC 1ZLJA 3ML6A 3SFZA 3EUHA 4ENKA 2VXZA 3RIRA 2D45A 2MLGA 1U5TB 4IRGA 5D8LB 4WK8F 2QVOA 2COMA 5H6RA 5BPDA 5L3BA 4G7ZF 3BOQA 2LDUA 3HSFA 1LDKB 2MC3A 2F5EA 3ABUA 2QZ8A 3VOEA 3IKVA 2QBYB 3IKTA 1VTNC 3KP5A 1JXSA 1U78A 1K6OA 3WTZA 2ZCWA 4ENJA 2HOEA 2MBFA 2HR3A 4Y13A 4NQWA 2GQQA 2YR2A 3RPUA 3DFGA 2G7UA 1IW7F 1PUEE 1CF7B 2MA3A 3GO5A 1XSDA 1D5VA 4JK1X 2FF4A 3WGGA 2AS5F 4EQQA 5D8KB 2EFNA 3KFWX 5AIPA 3BROA 5J6XA 4G6QA 2HQNA 3M7GA 1ZN2A 3V7CA 3GFJA 1SAXA 3HHGA 3CUQC 4BHBA 3QPHA 2V79A 2H09A 3BPXA 2A69F 2JTVA 1Z1DA 1BI1A 4HBLA 5DDGA 4ESJA 3L2CA 3KP4A 1GVJA 4YG2F 2RVCA 3P9CA 1XCBA 2QQAA 3C18A 1U5TA 2EK5A 3RPQA 3BZ6A 3JTHA 2QWWA 2P6SA 3T5XA 3TO7A 2CWEA 3TO9A 1STZA 1YW9A 1Z05A 4WF2A 3I0TA 4IVNA 1HW1A 4ZYEA 3O2PE 5H20A 1TTYA 1TQMA 5D4SA 5HLHA 2QBYA 1S7AA 2VBXA 2L01A 1RNLA 2YU3A 3V7RA 3M8FA 5HLIA 3G73A 3GLXA 4KN7X 3KP3A 4ZZLA 3BJ6A 1R22A 1JHHA 2DT5A 3KP2A 5BPIA 1FYKA 1CF7A 1ZGJA 1U6GA 1D8KA 4BQAA 5JFRA 3MFKA 5HVQC 2XROA 3HHHA 4A12A 2H94A 2YSRA 1B9NA 1IRGA 5D5WB 1SMYF 4EVIA 2A6EF 1SD7A 3WTVC 3FM5A 2EFOA 3ECHA 2Y48A 3RKYA 5IT9K 1LVAA 3HRMA 3O3KA 3C1DA 3CUOA 5HOOA 5LEJA 4FX0A 2MD5A 2CGPA 1XD7A 2HTJA 3TO6A 2OQGA 4B09A 1U5TC 3CO7C 5HS8A 4HV6A 1KU7A 3FHZA 2K7LA 3GF2A 1UFMA 5L3GA 1YYVA 2CW0F 2HYGD 1BI2A 2J5PA 3L09A 5IT3A 2CFXA 1T38A 1EV7A 3FXRA 1QQIA 3Q9SA 5DCFA 5D5UB 3B02A 1G3TA 3RKWA 3NRVA 5ILUA 4EM1A 1YS7A 4WCGA 2IT0A 3V8LA 3P9IA 3GYHX 4IJAA 2EWNA 3LQRA 2IRFG 3FF5A 5CVRA 5JVTA 1SFEA 3REOA 3MZHA 3M8EA 1UB9A 2Q8KA 1O3SA 4OIQF 4I2OA 2DW4A 1B9MA 2E1NA 3ZN0A 2KJCA 2Q0OA 2H6BA 3VODA 1LJ9A 3R0AA 1D3YA 1TBXA 2VBYA 2K4JA 2XV4S 2MH2A 3S2WA 2ZMEB 3O6BB 2WC2A 3GFLA 3HOTA 2ELHA 3ULQB 3TOAA 3OOPA 2F2EA 4S05A 3I4PA 1ZAOA 3I58A 4YFNF 5BS6A 3U2RA 2V1XA 1ZRDA 2M1BA 1IN8A 2UWMA 1FYMA 2HTSA 1P4WA 2W25A 3QAHA 5F1RA 5E17F 1XCVA 2VC1A 2XVCA 2UXNA 1HW2A 1MDMB 4MHGA 3HTUA 1JGSA 4N0BA 1FSEA 3RYPA 3EETA 1XGOA 2A07F 1E17A 3GXOA 3K2ZA 3Q9VA 4P9UA 2KJBA 1RUOA 1FBQA 2QUFA 3HIFA 3QU3A 2UXXA 2DPUA 3SZPA 4I01A 2OU2A 4M9XA 3EQLF 1G4DA 2EJRA 1SD5A 1T6SA 5D6FA 3F6OA 3ZMSA 2FMYA 4A0ZA 1D8JA 1ZRCA 1U2WA 4G6DA 2HYFA 2HGCA 1XSXA 4ENNA 1FY7A 2ZMEA 2A61A 4CICA 1P2FA 2F5FA 4FT8A 1YW7A 2EB7A 2DAOA 3FMRA 5LLQA 2RKHA 3QP6A 4LMYA 4LLLA 5DD8A 4HF2A 5LHGA 2A3SA 5D6EA 4LGWA 2NYXA 4CZZA 2XGXA 2FSWA 1F9NA 2F5CA 1V3FA 4G7OF 2NRAC 2DPDA 1IZ1A 2GZWA 2QYOA 2HQRA 5FFZA 1PDNC 1FP1D 4L18B 1NHAA 4UV8A 1MDMA 3KETA 2VN2A 2AXLA 1Z9CA 2DLLA 2HZTA 2W57A 4HX7A 4M9ZA 1ON2A 3ERED 5H6QA 1SFUA 1J2XA 3ZPLA 5A2QK 1KYZA 3FXUA 5ERIA 4MQ9F 3GWZA 5ICCA 3RJPA 1Y0UA 4YFXF 3WTYC 1S6LA 4ESFA 2CQKA 2ZXJA 5E1XA 4A0XA 4ZZDA 3DF8A 4R79A 3LWFA 2NAZA 1JE8A 2EV5A 3W6JB 4AD9A 1XGNA 4BHCA 4RAZA 3K1MA 1YG2A 4XBFA 5LGUA 4IRIA 2EFWA 4PZJA 5J8CA 3HRUA 2P8TA 2PJPA 2RC4A 2P4WA 1BM9A 2LF8A 1BJAA 1KQ0A 3J81Z 1R7JA 1O3RA 1I6XA 5ICGA 2XASA 2RGVA 4EGYA 1BI0A 4ENMA 4E70A 4Z2YA 1SMTA 2XKOA 2P5VA 4LFUA 4AVPA 3I53A 4EJVA 1T0FA 5L3CA 2HKOA 4KMUX 5LRRA 1UHWA 2HKXA 5JHUA 3HTSB 3F6VA 1HBXG 1MJAA 4M71A 3E5XA 5TRDA 1QGPA 4XLPF 4P96A 1T39A 4MTDA 1I27A 3P9KA 2Y75A 2DTRA 4EM2A 2HEOA 3SXYA 5L3EA 3MQ0A 4L0ZB 2QENA 4YIIA 2L4AA 2VBWA 2OD5A 5ILVA 4OOIA 1X3UA 4GYGA 2BBYA 4HX4A 4AIHA 1ZG5A 5L3FA 4ZYHA 4I0BA 2LNBA 4UVAA 4UVBA 4UUVA 3ZMDA 3P7NA 3IHUA 4M73A 4ZYDA 2W24A 5BQTA 3MZYA 1L3LA 4XRFA 2VC0A 1WRJA 2XAQA 2XAFA 3E97A 1HXDA 1LQ1A 5CYVA 3NQOA 3F23A 3IWZA 5FO5A 1RI7A 4A5NA 2HDCA 2Z9OA 3IRRA 3HOSA 3GZ6A 2E1CA 3J81K 1V4RA 4BAYA 2K27A 2IA1A 3QU6A 2C6YA 3LA2A 5E8GA 3BY6A 1GXPA 2STTA 3TGNA 4OIRF 4UV9A 2Q2EA 1IN6A 5LHHA 4JBAA 3TKYA 3V8JA 3LQQA 5LEKA 1P4AA 2IW5A 3ECOA 4R1HA 4UHTA 5FGMA 5LBQA 3PFIA 1O3QA 4LB5A 4L9TA 5TJJA 3T1BA 2D2WA 4O6JA 3K1PA 2M30A 2WWYA 4OIOF 1LEBA 1DPRA 2QLZA 1WWXA 3PQJA 4BYYA 4A2UA 4LK1F 3E5QA 4OU0A 3I64A 2ZBKA 3WE3A 5DYMA 3FWEA 2G9WA 2K86A 3EYYA 3TDUC 3RKXA 1HKQA 5CVVA 3DV8A 2FMLA 1W4MA 1GHCA 2YPRA 1DPUA 1Z6RA 1P4XA 1FT9A 5DV5A 2QQBA 3DKWA 3R0JA 3KP7A 1YO5C 3H92A 3QRFF 1YTYA 5EEGA 3WGHA 1OR7A 2OZUA 5F64A 1FC3A 3SZTA 2Z5UA 2CG4A 2A6HF 2O03A 4L5IA 1JHFA 1SD4A 3ZP5A 2L3DA 2DU9A 3KZZA 2XRNA 4WXCA 4PDKA 4PCQA 4KIFA 3WE2A 3WU1B 2CO5A 5EEHA 3LFKA 3MCZA 4N9HA 4P5OA 2FNPA 5CVIA 1W7PD 3TOBA 4ETSA 1QBJA 4O5VA 1FBSA 2R3SA 3K1NA 4HDUA 1WSUA 3HRTA 2P7CB 1C0WA 2ISYA 1R1UA 3M1EA 2D1VA 2ZNZA 1TLHB 3DP7A 4EM0B 3TDZC 2M5WA 1RZ4A 4A0YA 2GIVA 1K79A 2PEXA 3E3VA 2EA2A 4G9YA 3T8TA 4IHSA 1REPC 2OQRA 2DK5A 1R23A 4QWQA 1HQCA 1XSVA 5E18F 3F72A 3DXJF 1ODDA
chains in the Genus database with same CATH superfamily
5FFXA 1VQ4I 4HNTA 2BVLA 2E2JJ 2E34A 3K69A 1MIJA 5K1YA 3HUGB 3PNVA 3ISPA 3UNGC 4CA0A 2E1MC 2VKDA 1OYYA 1X1BA 2EIMH 1YJWI 4HEA2 4BACA 1ON1A 2V1NA 5B3SH 3WTTC 1HKSA 3DLAA 3GTMJ 2FNAA 5M3FJ 4A6EA 3RI4A 2QF7A 4QTRA 1Y8RB 1YX3A 2KZGA 4E7IA 2VODA 3D5SC 2X1DA 1QZZA 3S93A 5AONA 2HQAA 3OWTA 4E7ZA 2LKPA 1RC9A 5CLSA 4KJZA 1ZGAA 1YFHA 2X48A 5F6FA 4UVCA 1XMAA 1LKXA 2LBFB 1LEAA 4U0VA 1R00A 1GXQA 2BOLA 2L4MA 3FBNB 1ETWA 3D0SA 3BPVA 5FROA 2KIUA 4E4HA 4RS8A 1B4AA 3C3WA 1ONVA 3EDPA 2JA8J 3A03A 1EH7A 4XSZF 2LG4A 3WU0A 4CO8A 4AIKA 2EINH 3CTAA 3FHNA 1IAWA 2NOJB 3EPZA 2YU9J 4A3KJ 3G1MA 4JX5A 3H5AA 1Z3YA 1Z7LA 3E5UA 4FISA 3DU5A 1I1SA 4BS9A 1LNWA 2WV0A 1XMKA 1WJBA 3S3MA 4MGRA 2JN6A 3MEXA 3M1CA 3HG9A 2IGKA 1O57A 5GPAA 1UHSA 1XGSA 3JR9A 4L5JA 2OC6A 3H0GJ 4DGWB 2ZSHB 2R7FA 4BY7J 2VT2A 1IRFA 4IHTA 3D1NI 4OAYA 1LDJA 1BC7C 1XS9A 1ITYA 3F3XA 2DMNA 3F8BA 3IP4B 1QPIA 1ETXA 2CUFA 4GO1A 2IS6A 1IGNA 2X6YA 3WODF 4O3MA 2ZKZA 1OCPA 2KRFA 2XAJA 4HF0A 4C2MJ 1I6HJ 4XNFA 5F0CA 2EV6A 4XORA 4LJZF 5LRSA 3FZVA 3C2HA 2GM4A 3WG9A 4XK4A 3SFIA 5GTHC 1OQYA 3ZGKA 2WADA 3QYFA 4NUBA 3CO6C 1H89C 2OTJI 1TQPA 3J80Z 1H0MA 3DPTA 3BR5A 2W00A 1PP7U 2HQ5A 1XDSA 5K5OA 3I54A 1IG7A 4PK4A 3HUGA 5J3LA 1BOAA 4DYRA 5DS9A 3GUDA 3MAJA 2NVTJ 2L9SA 1FPQA 3PJRA 1XDUA 1XGMA 2XRLA 4Y15A 2GA2A 4GGGA 4U0WA 2VKHA 1BBYA 2OF7A 1WKMA 3A0HC 1EH8A 2M7AA 3J7YJ 2ZNYA 4M6VA 1HDDC 4KIGA 1FOKA 1OCTC 2XPWA 4BJ6C 3BT9A 2E1OA 4RB1A 3V4GA 3BP8A 2DFFA 1K78B 3IH4A 3RQIA 2D1HA 4BXUA 1X3ZB 1V55H 1SVOA 3JAMZ 2OCCH 2F48A 2XSDC 4HAMA 1TWGJ 2FJ1A 3VPRA 3RYRA 2PI0A 2MFZA 4RM3A 1WH7A 2ZXIA 3ABKH 2CRGA 4DQ2A 3FXQA 3IL2A 2K9QA 2K4BA 4DNCA 3W6KB 1BR1A 4G8XA 2DQRA 2N8GA 1MGTA 1SFXA 1CQTA 2YUSA 3FIWA 2BHYA 3F8MA 1S72I 3ABTA 4XOPA 1FOWA 4HLYA 4RLFA 3ZQHA 3H3ZA 3GFMA 2DTZA 3DEEA 2ZC2A 2Y9ZA 2M87A 5BMZA 2NVXJ 5EF6A 3GZ5A 3ZMUA 3VWBA 2OAZA 1BI3A 4LG0B 1ZR4A 4Q4ZF 2V6EA 1I50J 2M8EA 2EH3A 3KX2A 5E1WA 1U3EM 3DEUA 2F5DA 2DA2A 3OMYA 2VBZA 3R61A 3DBRB 3BR6A 1XC5A 3K4BA 4D5CA 1ETYA 2VE9A 4UXNA 4A6DA 3BWGA 1JKOC 4BQQA 3BG6A 3MKYB 3IUOA 4CGZA 2CQNA 4CCJA 5DCMB 1VQ5I 3LSHA 3DPLC 4B4CA 1SEUA 5FKLA 3H3UA 3JW4A 1UELB 2MH9A 3PSIA 4FE4A 3E6MA 3E6BA 3QOPA 4HA8A 4I09A 3HOWJ 2XKPA 2V7FA 1BC8C 4CYDA 3BG5A 2E7WA 4H0EA 4FTHA 1F36A 2O3FA 4M72A 3GEZA 3MWMA 1HSJA 2F6CA 4HYEA 2A6TA 5DUKA 3GTLJ 1E3HA 4DBRA 2XGDA 1FWZA 1W5SA 2GA1A 3I71A 3BTIA 3LSTA 3N05A 1TQIA 2GIZA 3OL4A 4HX8A 4B3AA 1U8BA 2ZFWA 2KHMA 5CVJA 3JRIA 3KE2A 1DQUA 3R4KA 3GFIA 4RAYA 1J9IA 2NNNA 5J1UA 1R1TA 1DUXC 5KVRA 3BDDA 3VYUB 2K9LA 4E6KG 2RQPA 4KYWA 4L0YB 1UAAA 4CYCA 3ZOBA 3CCEI 3L9FA 1RETA 2TDXA 5KHDA 1ETOA 2XPUA 2FOKA 3KP6A 3B6CA 2L7ZA 3H9JA 4NB5A 3L2WA 2EA4A 2O8KA 4KISA 1ZH5A 2Y0SN 1TNTA 4KNYA 2DI3A 4M6YA 3RQ4A 5JI6A 3GVAA 5DTDA 3WTWC 1TWFJ 3KEQA 3A4CA 3PQKA 1TNSA 2RNJA 3PL8A 2DA1A 4DJAA 5J47A 3G6EI 2Z33A 2CV1A 2JT1A 3JRAA 4EJUA 1QHHD 3MMYB 4AWXB 1P9QC 1I5ZA 4A93J 2DBBA 2ELJA 3BCBA 3JAMK 3ERMA 3GBGA 4KDPA 3K6GA 3BZCA 3RSNA 2R7DA 3WGIA 3OYBA 1LFUP 2AQEA 1O3TA 3H9GA 3SHFA 2W82A 1AHDP 3G73A 2R7QA 4F3QA 3BCAA 5D5VB 2ZJ2A 4UNOA 4IXAA 4BE2A 4LG0A 2Z3YA 5JR3A 1FOYA 2P0WA 1LFPA 3DQVC 3L2VA 1P6RA 2I8DA 2L7MP 3HB9A 2O0YA 4B8XA 5F0HA 4KUMA 2GWRA 4XRMA 2VOPA 3RPUD 1BIBA 1ENHA 4XMYA 2JPCA 2WAEA 4FHTA 4R8HA 5FD6A 3HSEA 4HOBA 1NTCA 4CH7A 3S3NA 2ISZA 4U7BA 3L2QA 4IZZA 4TV7A 2FQ3A 1V5GA 3M07A 1JUPA 4XOTA 5CJ9A 2VONA 1DP7P 1JJ8C 5DCMA 1G3WA 1I1GA 2V1UA 1WQ2A 5KNLA 4PJMA 2IJLA 2X85A 1ERDA 1Z6TA 1TZLA 3GTQJ 3OR1C 1IXSB 4KFCA 2XC7A 4NC7A 3N97A 4M3DA 5GP9A 4BKXA 2E36A 4UUSB 2O6GE 1QO0D 4A5MA 4Y17A 3L7WA 2LKSA 4NDLA 3HM5A 3RZDJ 2LTPA 3OOUA 2M45A 3VYSB 1MH4A 4U88A 1ZRFA 5H2FC 3ZMZA 4N4OB 1YIJI 4Q47A 1WJDA 1Z0XA 4HQMA 4RGRA 1Y1VJ 3HGGA 2FE3A 2VQLA 3CDLA 2FBIA 3FX3A 1IC8A 1X2NA 2KP6A 4LB6B 2R92J 3SQNA 2DFIA 4CDGA 2DA5A 4LK0F 1YS6A 2BHZA 5EEAA 3F22A 4Z6YA 3CP8A 3HSRA 2V9VA 4L9JA 3LSIA 4X1EA 4B3XA 5J8FA 3AAFA 1HSTA 3QYBA 2A05A 1G3SA 2IGNA 2BYVE 1RKTA 3GTOJ 1EH6A 4XLCA 2PQ8A 1YIOA 2E7XA 2H8WA 4HNUA 5IT9Z 2X6XA 2HPIA 4AIJA 1Z91A 4A3GJ 2DOFA 2R7UA 1XB4A 4YIFA 2PLYA 2BVMA 2L7KA 5K5QA 1LDDA 3QWLA 1R58A 1WPKA 5ICFA 5IP7J 1G6NA 4K2EA 2ZXHA 2FBKA 3CCLI 1YW8A 2IP2A 3UKGA 1MKMA 3EUHC 3LL7A 4BUPA 2CU7A 4GCVA 2VI6A 1IXCA 4BHPA 4MNUA 4BNCA 1FZPB 5HDGA 1YJ9I 1R5HA 3JSOA 5E3LA 1J0RA 3AG4H 2JA5J 1YE9A 2LY9A 4F7ZA 3OIOA 1VQ6I 2VT3A 2V1DA 1I3AA 4EJTA 2M0CA 2Y0MA 4Y4RA 4YFKF 1MJ9A 2DDAA 2L2OA 5FKNA 5HNHA 3Q5FA 2QQ9A 3LAPA 1DDNA 3OV8A 3M3YJ 1USSA 2K9NA 3C7JA 4D0PA 2PN6A 4WXHA 3HL2A 1HW5A 1OMIA 2NOGA 1K7AA 1MMNA 1OYWA 2WTEA 3SYTA 5HLGA 4EMSA 4HSTA 2DO7A 1A04A 1XPXA 3NEUA 1GVDA 2VOOA 1HOMA 5ILSA 1JTXA 3FXMA 1RUNA 3HRSA 3V8KA 4UUSA 1E0EA 5HDNA 3RTRA 5CVUA 2HWVA 1W7PB 2LOOA 1B8IB 2X0LA 3ZN1A 2H6CA 1JT6A 5E3OA 2PBIA 4AIDA 2RV8A 1NG6A 3B73A 2OPTA 4RB0A 3HOUJ 1YQAA 4AUXA 4MEXF 4EGZA 6PAXA 3K70C 2WAQN 3I59B 3SDGA 2QSFX 5EYRA 3VYRB 5JHFA 3CDHA 3S1MJ 2ZO4A 4RGUA 1ULYA 4J19A 3KLOA 4W97A 3NAUA 4ZJZA 1S8NA 2E19A 1BN5A 2OA4A 2ESHA 4FE7A 4BQOA 4RGXA 4IOCF 2VE8A 1AOYA 4C2UA 1T98A 3WTUC 2O7OA 3ZRGA 1VQLI 1R36A 3O8HA 3R6SA 1FSHA 4HG2A 1IUFA 1DGWY 1Q1HA 5DD4A 4XONA 1YHQI 4XRSG 4KN4X 5EGOA 4LG3A 2EIKH 4M9SA 5F08A 1FLIA 4U0YA 4M3BA 1R5GA 2ZXWH 4N9IA 5K7HA 3LA7A 4KA4A 4OIPF 4KT6A 3CJRB 2XAGA 4IF4A 4A69C 4JOMA 2Y31A 1CGPA 1IV8A 3CDIA 1RIOH 2R7OA 4UB6C 1Z67A 2LP0A 4JP0A 2YX7A 2H1LA 1NH3A 4PFOA 2R7RA 5DEQA 1SFOJ 1KA8A 1F4KA 2WY8Q 1A35A 1IUYA 2ID3A 1YLFA 1PYVA 5L3DA 1Y6IA 5FRNA 2HFHA 3EYIA 2FA5A 2PMUA 1P92A 3JSPA 2GAUA 2V26A 3L2UA 3S32A 4MQVA 4I6ZA 2P81A 5IP9J 3JTGA 2IAIA 4CHUA 3DKXA 2FXAA 2LK2A 2P6TA 2D5VA 1VFCA 3F21A 3FM3A 4HNVA 2J5OA 4AVZA 2XGCA 2ESNA 2BXZA 4JQFA 4EJWA 5IYDJ 4G94A 2DYSH 5BOXA 1ZGWA 1GUUA 2WB1A 3BQZA 5F0FA 4UB8C 1JTYA 4HSRA 5HS7A 5D4RA 4IEJA 5KK1A 4I7HA 3U9GA 3F8FA 2ELKA 3BTCA 2ZFUA 2KISA 1SD6A 4CZCA 2IVMA 2V9KA 2EZKA 3VDXA 4X6AJ 3FKIJ 1HF0A 1VQ9I 3OYEA 1V5EA 4A3JJ 3F8CA 1N75A 1WI9A 1S7OA 4M6XA 3CF5F 2GXGA 2JRMA 1IRZA 2VL8A 3H9QA 3MVPA 4HW0A 2ADUA 4MEYF 1W7PA 5E1ZB 1B8IA 4BH9A 3TQNA 4ASNA 3GTPJ 2JRTA 2OBPA 4GYIA 4FASD 3FXJA 5LGNA 4P1WA 1BR2A 3I59A 1MBHA 3IC7A 3AG2H 3AFHA 4IPAA 2E35A 3CQZJ 3CLOA 3H35A 2FU4A 4MO7A 5LD2C 4DZJA 1TP4A 5ED4A 1HLVA 1U8RA 4KIBA 2XF6A 3E6CC 1IN7A 1R1VA 1T2KA 2IPQX 2O9LA 1WZ2A 3AL0B 2JJ7A 3RDIA 5D5XB 1H88C 2LSOA 2BGCA 3TBIA 1L0OC 3QP5A 4QLCU 1OLTA 1KU3A 1QZYA 3I55I 2PFBA 3K4CA 2KQRA 4HV5A 1ZG3A 2COBA 3Q0WA 5E8IA 1IN5A 2E2HJ 1WJ5A 2FBHA 3G3ZA 3K9TA 4WX9A 1MMSA 2E5NA 2G7HA 2HI3A 3SEQA 1FBUA 2KIFA 4Q48A 2CYYA 4ESBA 5J1RA 1KZHA 1OKRA 4I0AA 1HDPA 3S16J 4H4KC 2RREA 3DCFA 3H3VK 2EFPA 2WBMA 3GW2A 4I02A 1JKRC 4RLQA 4LIVA 2EFQA 4RGSA 1JGGA 2NNYA 1BW6A 1QZEA 2OTLI 3S17J 4HDVA 3FXOA 2LF7A 1KYWA 1J75A 5LGTA 5C3EJ 4IX7A 4OINF 3LSKA 3PO3J 1OJLA 3LAJA 5K7FA 3BJAA 4II2A 1VQOI 5CQEA 1JUMA 3OYFA 1QPMA 1W5TA 3TW6A 4D7NA 3K0LA 4MFEA 2W7NA 3A0BC 2HOAA 2KIMA 3OYIA 3S1NJ 2K40A 1J5YA 1IN4A 3R60A 3HYIA 4XKWA 2EZHA 1ZR2A 2JSCA 2EZLA 2RDPA 3PSFA 2XHKA 3W2VA 1ZREA 4FX4A 4WXDA 1GDTA 3IWFA 4L9VA 4ZH4F 4S04A 4ON0A 5IOYA 2Z1DA 3MKZA 2A5YB 2IA2A 3KYLA 3WTSC 2CUEA 3S2DJ 5CKTA 4OMYA 3M9AA 2YX4A 1FNNA 1UJ8A 2IXSA 2KIQA 3VEPA 5FB2A 1TW2A 1J7KA 2NS0A 3OIPA 4MTEA 3ZQ7A 4EV0A 4YRVA 3VB2A 1G8XA 3G4SI 1N78A 4XN0A 5A2QZ 1AU7A 1KU2A 1FEXA 1QRYA 1GV5A 2FEZA 2MLKA 3KPHA 2DMPA 1R49A 1HKTA 4IHVA 2Z99A 1KQ9A 3I4NJ 2KKOA 2L9RA 1T08B 2JQ7A 1U0JA 1J59A 2VPRA 4BE0A 2KRCA 3AKZA 3J7AO 4DW6A 4CCNA 5FLMJ 3T8RA 2JZYA 5LHIA 4NHJA 4XM3A 1UG0A 4KT5C 3CC4I 2W84A 3V7SA 4Q5SF 1NG7A 3E1SA 2BV6A 1LB2A 2GXBA 2MGQA 5AIQA 3I5UA 1FX7A 4IHXA 3JRBA 4OAZA 3BZKA 1BIAA 2L02A 2XB0X 3KLNA 4M74A 5B66C 1FTZA 3FMSA 1ZHFA 5FKKA 1OYIA 1OPCA 4L9NA 2CQXA 4RB2C 2BE5F 2PG4A 4XKCA 2CH0A 1XN7A 3BQYA 2IA0A 1MD0A 1P7JA 3BLYA 2HOTA 3CMYA 5K5RA 3U1DA 3F0CA 1H9TA 3IRQA 1AKHB 3OYNA 3OY9A 1Z7UA 1Q1VA 1MZBA 2HZDA 4PSWA 3COAC 2UZKA 4KMFA 2LREA 2QEXI 1FYLA 1B6AA 4XKVA 4OWRB 4LLNA 1HCRA 5JVGF 5FLXZ 2LLKA 3V42A 1S3JA 3GX4X 2HXIA 4E7LA 3FXLA 1Y39A 1FP2A 1JKPC 4LD5A 3CJNA 3ROUA 3ZMTA 4PGGA 2V6CA 1VQ7I 2R7XA 3FMQA 3CUQB 3ZQFA 3ELKA 2F5VA 3CESA 3DEWA 4XSXF 4A3BJ 3QOEA 4A3FJ 5EZGA 4CXFA 4P55A 1JUSA 2O8XA 1B1BA 2P5KA 2LBFA 4IRHA 3VFZA 3FK6A 1R6RA 4F55A 4XLNF 4FQGA 3T0YA 5HS9A 2CFOA 1WVRA 2STWA 2XUBA 2BY0A 1ZARA 2M8GX 2XAHA 4GXOA 3MZ8A 2L54A 4PGHA 2XIGA 4RB3C 1QA6A 5HDKA 1UHMA 1J09A 1USTA 4CUGA 3KCCA 1UCRA 3WTXC 2HS5A 2P7VB 5GAHJ 2A68F 5FKOA 3N4MA 3QPTA 5IP6A 1KQ8A 3OR2C 1X4OA 1O7LA 1PVEA 4OMZA 4DZPA 2OCEA 4N4NB 4RM2A 3PUFA 1IF1A 2ECBA 2RN7A 4WWCA 4G7HF 4DIQA 2K02A 3D5LA 2FOWA 1TL8A 3LA3A 1F5TA 2XSJC 2GOMA 2XGEA 4LLGF 2VIXA 2AXTC 2PMHA 2K3FA 1MSEC 2LY2A 2P5LC 5DUIA 4HZFA 2NS7A 5J1YA 1TWHJ 1JT0A 2ACJA 1BR4A 2EV0A 2DT7B 4P9FA 3E6DA 5E20A 1KU9A 1MJBA 3KZYA 1ZLKA 4ZYGA 1E2XA 1D5YA 2IEKA 1PP8F 1S29A 2DQLA 2DA7A 4NQWB 2FRHA 1G3YA 2LYCA 2Y0SA 4HF1A 2I5UA 5ICEA 3AL0C 4GDFA 2E71A 3TMOA 2XB5A 3A02A 4JYKA 4EJOA 1TT0A 2M2EA 1F1ZA 1O7FA 1QNTA 2H27A 1AKHA 3J80K 4KICA 2I10A 5DM6F 1VQKI 3F8NA 3L00A 1JKQC 1APLC 1AWCA 1H9GA 3ZMVA 2B0LA 1KGSA 4HLXA 2ZMEC 1UG2A 3HBLA 2JPBA 1KONA 3CZ6A 4I98B 2O61A 1ZYRF 2R7WA 4HQEA 3DPUA 3EUAA 3KEOA 1ZG1A 3HJEA 4U7DA 3CUQA 5FLXK 2DFEA 1VF9A 2QM3A 4BEHB 2DK8A 3S14J 3BJOA 2OZ6A 5FD5A 1K78A 1ZKGA 3L2RA 4MIMA 2BEOA 2ETHA 1ETQA 1OCZH 1TW3A 4PJJA 2R4GA 2W85A 2X4HA 2EIJH 1B59A 1O4XA 2CSOA 1IXRC 1ZLJA 3OYMA 2M9HA 1VNDA 3ML6A 4QIWN 1LUJB 3SFZA 5GAGJ 3EUHA 4ENKA 2VXZA 1MBGA 2GOXB 4BE1A 3IAS2 1AA7A 3QPLA 1U9OA 3IAM2 3RIRA 2D45A 2MLGA 1U5TB 4IRGA 5D8LB 4WK8F 2QVOA 2W1OA 1SAUA 4BJ5C 4ZTFA 1MMGA 1R4NB 2COMA 3ZR8X 5H6RA 5BPDA 5L3BA 4G7ZF 4M3FA 1D0XA 2NVUB 1ZELA 3BOQA 2LDUA 3HSFA 1LDKB 2F4MB 1BA5A 2MC3A 5FKMA 1DU6A 1Z77A 4IHYA 5B1BH 1WH5A 1K4TA 2F5EA 3ABUA 2QZ8A 3VOEA 4AYBN 3IKVA 2DOAA 2QBYB 3IKTA 1VTNC 3KP5A 2DJNA 1JXSA 5IYCJ 1U78A 1K6OA 2KZVA 1TWCJ 3WTZA 2ZCWA 4CCKA 2HOEA 2MBFA 4ENJA 1YITI 4AM3A 3LSMA 2HR3A 4Y13A 4ZDLA 4NQWA 5J40A 3K4MA 2K85A 2GQQA 2JSPA 2YR2A 1YX5A 2BZTA 3RPUA 3HEFA 2KL4A 3DFGA 2G7UA 1IW7F 3G2BA 3KIOA 5GTIC 2MA3A 3ASOH 3GO5A 1XSDA 1CF7B 1PUEE 1D5VA 4JK1X 2FF4A 3SZGA 3WGGA 2AS5F 3DLLF 2X1EA 4EQQA 2GBYA 5D8KB 2HU9A 2EFNA 1X3WB 1WGXA 3KFWX 1JJ6C 5AIPA 2HDWA 3F9KA 3I3LA 3BROA 2ME6A 5J6XA 4G6QA 3IH3A 2HQNA 2QSHX 3HKZN 4BEHA 3M7GA 1ZN2A 2UUZA 3V7CA 3S3OA 3GFJA 2M4GA 1SAXA 3HHGA 1E3PA 3CUQC 3TP3A 4BHBA 3QPHA 3KEYA 3OYAA 4A3DJ 2V79A 1A6QA 2H09A 4EATA 3BPXA 1POGA 3E0JB 1E3OC 2A69F 2JTVA 1Z1DA 2ZB9A 2KPMA 1BI1A 4HBLA 2OUMA 5DDGA 2X6WA 4ESJA 3L2CA 4ITVA 2QA4I 3KP4A 2X9DA 1GVJA 4V2FA 4YG2F 1NK3P 2RVCA 3P9CA 3K4LA 4BDZA 1XCBA 2RAEA 2QQAA 3C18A 1U5TA 2EK5A 3RPQA 3BR3A 3BZ6A 1UZCA 4A3IJ 2RQQA 3JTHA 2QWWA 5F04A 2JA2A 4NBQA 3BC8A 4A3LJ 2P6SA 3T5XA 3TO7A 2EBIA 2CWEA 2ME0A 1ZQ3P 1N25A 1BL0A 3TO9A 1STZA 1YW9A 1Z05A 4WF2A 1X19A 1IJWC 3I0TA 4IVNA 1HW1A 4ZYEA 3O2PE 1IO2A 2WAQA 1TTYA 1TQMA 4LOCA 5H20A 2MW8A 4BQNA 4F91B 3LSPA 5D4SA 1PUFB 5HLHA 2QBYA 1S7AA 3PUBA 1IDYA 3ZQQA 2VBXA 4V2GA 2L01A 1RNLA 2MABA 2PX9A 4RA2A 1WJFA 2ICWG 1WI3A 2YU3A 3V7RA 4IL6C 1D1BA 4PUSA 3OYHA 2R5YB 3M8FA 5HLIA 3OL3A 3GLXA 4KN7X 1QVTA 2LVSA 3KP3A 2QKLB 4ZZLA 3OS1A 3BJ6A 1R22A 5IY5H 1JHHA 3DTIA 2DT5A 4Y7NJ 3KP2A 2M4KA 2VQCA 1WCMJ 5BPIA 1FYKA 1CF7A 1ZGJA 2DMTA 3OIQA 1U6GA 5B5EC 1D8KA 3OYDA 3H5NA 4BQAA 5JFRA 2Z16A 1I3QJ 2PMZN 3MFKA 5HVQC 1Y1WJ 2B9SA 1RR7A 4Y33A 2K9SA 4CCLA 4KITB 1S7EA 2XROA 2DODA 3HHHA 1VQNI 3LSJA 4A12A 2H94A 2DJIA 2XDVA 2YSRA 3OSGA 4XL9A 3G71I 2DA6A 2H1KA 2BY2A 1B9NA 3B6AA 3W2AA 3Q0VA 2LD5A 1R4MB 2W4SA 3MKWB 1IRGA 2QGUA 1U9NA 5D5WB 1SMYF 4EVIA 3Q3SA 5IPAA 2A6EF 1SD7A 3WTVC 3FM5A 4JX4A 4C30A 2EFOA 4NC6A 3ECHA 1MNMC 4PJ0C 2Y48A 2LFBA 3RZOJ 1Y56A 3PIPF 2OV7A 3RKYA 5IT9K 3OYKA 1LVAA 3HRMA 3O3KA 2FQ4A 3C1DA 5CPRB 2HPMA 3CUOA 2MD0A 5LEJA 4XQFA 5HOOA 4FX0A 2MD5A 2CGPA 1XD7A 2HTJA 2M3AA 1SANA 3TO6A 3OSFA 2OQGA 3CP2A 4B09A 2Y30A 4V19K 3GCMA 5M5WJ 5CQGA 1EKEA 5JLXA 1U5TC 3CMEI 3CO7C 5HS8A 3GMEA 5M5XJ 3HZJA 4HV6A 3H5RA 5TGTA 3ZQLA 1KU7A 3DTEA 1RPWA 5HLTA 4MFDA 1MW7A 5EG0B 3FHZA 1ZTRA 2K7LA 1R5ID 1MNDA 2IGMA 3GF2A 1UFMA 2DYRH 5L3GA 3I4MJ 1YYVA 2CW0F 2HYGD 3WHCA 1S5LC 1BI2A 2J5PA 3DTKA 1PUFA 3L09A 4E7SA 5IT3A 3D5RC 2JK3A 2CFXA 2CQQA 2E60A 1T38A 2QQ8A 1MMDA 1EV7A 3FXRA 1QQIA 3Q9SA 1LPQA 2L0KA 5DCFA 5D5UB 3K10A 2R5YA 3HOXJ 1ETKA 1V54H 3B02A 1G3TA 1X2MA 2B63J 2BY3A 2BXYA 3RKWA 3FDYA 3NRVA 2NVYJ 5ILUA 4EM1A 1FMVA 4L5EA 1YS7A 3JCUC 3AG3H 4WCGA 5C44J 2K3PA 2IT0A 3V8LA 3P9IA 1WFXA 2EILH 3GYHX 4IJAA 2CW7A 1SC7A 1RKWA 3S15J 1F43A 2DN0A 4ZTJA 2EWNA 4F93B 2R7TA 1W36D 1T56A 3H0DA 4FETA 1D0YA 3LQRA 4J00A 2IRFG 3HOYJ 3FF5A 2Y9YA 5CVRA 5JVTA 5EDNA 1SFEA 3REOA 3MZHA 3K4NA 4DYCA 3HPGA 3M8EA 2VXDA 1UB9A 2Q8KA 1O3SA 4OIQF 4YIRX 5IYBJ 4D5FA 4I2OA 3BG9A 1K6YA 4BBRJ 2DW4A 1B9MA 2E1NA 1MBFA 3ZN0A 1RR8C 1YRNB 2KJCA 2Q0OA 1S9HA 2H6BA 2MSYA 3G1OA 4LITA 3VODA 1LJ9A 1WJCA 3R0AA 1D3YA 1TBXA 2VBYA 2K4JA 2XV4S 2DA4A 2MH2A 3S2WA 2V9PA 2ZMEB 3O6BB 4B1RA 3CCVI 2VJJA 5FJ8J 4IKFA 2KDZA 4Y3OA 4IOAF 2WC2A 3GFLA 4I76A 2JA6J 3HOTA 2ELHA 3CD6I 4M3GA 1HC8A 2Q1ZB 3PFYA 2HYJA 3CCMI 5KCMA 1HA8A 3U21A 3U1KA 4D7MA 3W2WA 4B47A 1MNEA 4BJTA 2M0MA 2HXOA 3ULQB 2ZJPF 3TOAA 3OOPA 2F2EA 4S05A 3I4PA 1VQ8I 2LKXA 4UUTA 1ZAOA 2IS1A 1EF4A 3I58A 1MH3A 4YFNF 3BTLA 3W3CA 4X0GA 1OCOH 5BS6A 3OYJA 3U2RA 2V4JC 2V1XA 1ZRDA 2M1BA 2X6OA 1OR7C 2DA3A 1IN8A 3CC7I 5EG0A 2UWMA 1FYMA 2HTSA 4HRIA 1P4WA 1RRJA 3GTGJ 2W25A 2EQRA 3QAHA 3ABLH 2DMQA 5F1RA 2XF5A 3ABMH 3H36A 5E17F 4II3A 1XCVA 2VC1A 5GAEJ 5HODA 1H8AC 5C4XJ 3HC7A 4BXXJ 2XVCA 2ID6A 2UXNA 1MDMB 1HW2A 2DFHA 4MHGA 4RDUA 3OYCA 2L9NA 3HTUA 1JGSA 4N0BA 1FSEA 1EJ9A 3RYPA 2Y2ZA 2XAUA 3EETA 4HPQA 3Q0UA 1XGOA 4BGDA 2A07F 1E17A 4J01A 2EZIA 4IO9F 3GXOA 2VUMJ 3K2ZA 3Q9VA 2OJED 4P9UA 1YOVB 2KJBA 4CCMA 1RUOA 2NVQJ 1FBQA 2QUFA 3E7LA 3HIFA 3QU3A 5BNGA 2UXXA 4C9YA 3IV5A 2DPUA 4QPOA 3SZPA 4I01A 2OU2A 3LOCA 4M9XA 3EQLF 4XR6A 1IV6A 4XLAA 1G4DA 2EJRA 3HXLA 3JRCA 1SD5A 4ABZA 1ZK8A 1T6SA 5D6FA 3F6OA 2VB6A 3ZMSA 2FMYA 1YRNA 2VASA 2AO9A 4A0ZA 1D8JA 3HOZJ 4B44A 1ZRCA 1GLNA 1U2WA 3BR0A 4G6DA 2HYFA 2HGCA 1XSXA 4ENNA 4XLFA 1ACIA 1FY7A 2ZMEA 3CJTB 1Z21A 4C3IJ 1FTTA 2A61A 4CICA 4U87A 1P2FA 1W36C 4G6TB 2F5FA 3WG7H 3X2QH 3KYCB 5E3NA 4FT8A 1YW7A 3H1CA 2DXIA 2EB7A 3MKLA 1RESA 1A31A 2DAOA 3FMRA 5LLQA 2RKHA 4XRSA 1QVUA 3QP6A 4LMYA 1V5FA 1BJZA 1X1DA 4LLLA 4XICA 1ORKA 4A3EJ 1DP3A 3TL4X 1MBEA 5DD8A 1DU0A 5LHGA 4HF2A 1VQPI 5DM7F 2JMWA 2A3SA 3PM1A 5D6EA 4CYCB 4LGWA 2NYXA 4EEFG 4CZZA 2HVRA 2XGXA 4I99C 3LNQA 2FSWA 2XPVA 2WA0A 2VKVA 2CQ7A 1F9NA 5FLVA 2F5CA 2O5RA 4MLOA 1V3FA 4G7OF 2NRAC 3J7AY 2DPDA 1VZ0A 1T95A 1IZ1A 2GZWA 2QYOA 2HQRA 5FFZA 1PDNC 4DOZA 1FP1D 4L18B 3HDDA 1NHAA 4UV8A 1MDMA 3KETA 4IQ4A 2VN2A 2AXLA 1FMWA 5IOZA 1Z9CA 2DLLA 2HZTA 2DMUA 4G12A 4E7JA 1YJNI 2W57A 3ONQA 5F27A 4HX7A 1K83J 4M9ZA 2L9VA 2Y69H 4NC8A 1ON2A 3ERED 2CV0A 2EPFA 5H6QA 1SFUA 1J2XA 3ZPLA 2JUGA 2AHQA 2DDBA 5A2QK 3ZCOA 1KYZA 3FXUA 5ERIA 3FISA 2JVHA 1W1WE 3RKQA 3MD2A 4MQ9F 2CW8A 4W1UA 3JRDA 3VSLA 1A5JA 3GWZA 4RBOA 5ICCA 3RJPA 3P5JA 3ASNH 3KYDB 3FXKA 4FCYA 4XKBA 1Y0UA 5TISC 4YFXF 3WTYC 1S6LA 4B48A 4ESFA 2B7EA 2CQKA 2ZXJA 5E1XA 2VKEA 4A0XA 4ZZDA 3GTJJ 2RNGA 3DF8A 4R79A 2VJIA 3LSGA 3LWFA 5EZHA 2NAZA 1JE8A 2EV5A 3W6JB 4AD9A 4CSWA 4D1QA 1XGNA 2E2IJ 1OCCH 3AG1H 2MYSA 3S1RJ 4BHCA 4RAZA 3K1MA 3CCUI 1LE8B 1YG2A 3CMMA 4XBFA 3QPSA 5LGUA 4IRIA 2JA7J 2TRTA 2EFWA 4PZJA 3BG7A 3K2AA 5J8CA 2VQGA 2QCOA 1Z3XA 2K9MA 3HRUA 4A3CJ 1X4PA 4XLEA 1A6IA 2P8TA 2PJPA 2RC4A 2P4WA 1BM9A 2ZJRF 2LF8A 3S2HJ 2BW3B 1MSFC 1SVMA 1BJAA 1KQ0A 3J81Z 4DYQA 5J4YA 1R7JA 1O3RA 1W5CC 1I6XA 1G2HA 5GPCA 1R71A 5ICGA 2GLOA 2XASA 1BOBA 2RGVA 1BI0A 4EGYA 4ENMA 1P7IA 2K5CA 1DGRM 1SMTA 4Z2YA 2XKOA 2P5VA 4LFUA 4E70A 2HVSA 4AVPA 1G59A 4BXFA 2LR8A 3PIOF 3I53A 4EJVA 1T0FA 2FUG2 5L3CA 4AYBA 2W48A 2HKOA 3GZNB 3K4KA 4KMUX 5LRRA 4QSHA 5KAFC 5M5YJ 2IS2A 2Q2EB 1UHWA 2HKXA 3BR1A 5JHUA 4ZYAA 2HVQA 3HTSB 3F6VA 1X1AA 1HBXG 1MJAA 2A5WA 3ZQGA 1SVLA 4M71A 3NWSA 3E5XA 5K7ZA 1QGPA 4XLPF 5TRDA 4P96A 3KZIC 2CMPA 1T39A 4MTDA 1I27A 3P9KA 2Y75A 3DBHB 2DTRA 4EM2A 1TWAJ 2UV1A 2HEOA 2R7VA 3SXYA 5L3EA 1BW5A 3MQ0A 3OS0A 4L0ZB 2QENA 4YIIA 3DBLB 1VQMI 4CCOA 3M4OJ 2IS4A 2L4AA 2VBWA 2MG4A 1WHUA 2OD5A 3LSRA 4BU2A 5ILVA 4OOIA 1X3UA 2VQHA 3EUKL 3CJQB 1T33A 4GYGA 1PJRA 2BBYA 4HX4A 4AIHA 4B43A 3OS2A 3K70D 1ZG5A 2KLOA 3HKZA 5L3FA 4ZYHA 4I0BA 2R5ZB 2LNBA 3G1LA 3S8PA 4UVAA 4UVBA 3VSKA 3FKJA 4XIDA 4UUVA 3ZMDA 4E7HA 2LMDA 3VYTB 3P7NA 3QYEA 3IHUA 3OYGA 1TC3C 4M73A 3ZQCA 1OCRH 1LE8A 2ZJQF 4ZYDA 2W24A 3M8JA 5C4JJ 3NARA 1UMQA 4PFPA 5BQTA 3MZYA 1L3LA 4XRFA 2VC0A 3WU2C 1WRJA 2XAQA 3C2GA 2XAFA 3E97A 1HXDA 1W0UA 3RCOA 1LQ1A 5E3MA 3K7AJ 4PJLA 2R0QC 2CUJA 1WJEA 5CYVA 3S1QJ 3CCRI 2LRDA 3NQOA 3F23A 2KDOA 2BW3A 3MN2A 2H8RA 3IWZA 1XMXA 4Y52J 4BL0B 5FO5A 2VJ4A 1RI7A 4A5NA 2HDCA 2Z9OA 2DCEA 1X1CA 3IRRA 3HOSA 3GZ6A 2E1CA 3J81K 1V4RA 4BAYA 2IBDA 2ECCA 2K27A 2E5ZA 1TT5B 2IA1A 5EGOB 1I39A 3QU6A 3ZQIA 4AU7A 2C6YA 2WV1A 3LA2A 3A1YA 5E8GA 2DOEA 3BY6A 1GXPA 1T0FC 3GTKJ 1FIPA 2E1MB 3TGNA 4OIRF 4UV9A 2Q2EA 3QQAA 2STTA 3J7ZI 4ANJA 1IN6A 1N77A 2BY1A 3FBIB 1FIAA 4F52A 2JUCA 3BG3A 2PJRB 5LHHA 2LC2A 4JBAA 3TKYA 3V8JA 4M3EA 3TW7A 2KFDA 4XN3A 2CUZA 4JX6A 2PMZA 3LQQA 2CJJA 4PSXA 3CF2A 5LEKA 3LFUA 1P4AA 1K4SA 3CCSI 1EA3A 2IW5A 3ECOA 2CV2A 4R1HA 1D1CA 1XX5A 3C2BA 4UHTA 5FGMA 4AC0A 1FOXA 5LBQA 3QODA 3PFIA 3OYLA 1B72B 4BDYA 1O3QA 4LB5A 4L9TA 2FX0A 5TJJA 1Y0NA 3T1BA 2D2WA 4O6JA 3K1PA 2M30A 2WWYA 2R5ZA 3PO2J 2VLAA 1D0ZA 3A01B 4OIOF 3W6VA 2QSGX 5HNFA 5B1AH 1WJAA 4ZC3A 2LY1A 2DT6A 2WAFA 1LEBA 1DPRA 3SDBA 5J4VA 2QLZA 1WWXA 3CCJI 1FJLA 2TCTA 3PQJA 3I9V2 2LH9A 4RAGA 3O8GA 2MC4A 1K61A 4BYYA 4A2UA 4RMNA 4LK1F 3PNYA 5KAIC 3E5QA 1A36A 4BY1J 2AQFA 4OU0A 2NS8A 3I64A 2X51A 2ZBKA 4A3MJ 3WE3A 5DYMA 4F92B 3FWEA 2KT0A 1MBKA 2G9WA 2K86A 3EYYA 3TDUC 4NNJA 4C3HJ 2JVGA 2G0EA 3RKXA 4S0HB 4C3JJ 4XLHA 1HKQA 5CVVA 3DV8A 2FMLA 1W4MA 1X1PA 1GHCA 1X58A 4C2TA 1XG1A 1NK2P 2YPRA 1DPUA 2HNHA 1Z6RA 1P4XA 1FT9A 5DV5A 1VI0A 2QQBA 3DKWA 5GADJ 3R0JA 1IRXA 1GT0C 2F4OB 3KP7A 1YO5C 1D1AA 1W0TA 3H92A 2L5QA 3QRFF 1YTYA 5EEGA 4IHWA 3TEDA 3WGHA 2XF7A 3BR2A 3HPHA 1OR7A 4QPQA 2OZUA 5F64A 1FC3A 3SZTA 3JRGA 2ZSIB 2Z5UA 3SJMA 2CG4A 2PJRA 2A6HF 2O03A 2NXNB 4L5IA 3I56I 1JHFA 1SD4A 3ZP5A 3UR3C 1ETVA 2L3DA 2DU9A 2F4IA 2R7ZJ 4YEJA 3KZZA 2XRNA 4WXCA 4RAFA 4ZDOA 4PDKA 1MBJA 3ZXSA 4PCQA 1GV2A 2VPLA 3HGYA 3L1PA 4KIFA 3WE2A 2X1CA 1Y8QB 3WU1B 2KMUA 4IQJA 2CO5A 3PNTA 3HOVJ 3JREA 1OFCX 5EEHA 3LFKA 3MCZA 1M1EB 4N9HA 2GXAA 2CS3A 2QKMB 4P5OA 1B72A 2FNPA 3K4JA 5CVIA 1W7PD 1T8IA 3TOBA 1SFKA 3ESWB 2M7BA 3GLLA 4UY8I 3IH2A 4ETSA 1QBJA 4O5VA 5JLWA 1FBSA 2R3SA 2HOSA 4ZDPA 3DU6A 3JRHA 3K1NA 3A01A 1QU3A 1YI2I 5F1JA 4HDUA 4YELA 2VJ5A 1MMAA 1WSUA 1OISA 3HRTA 2P7CB 2HDDA 3DKYA 1C0WA 1LVKA 3TP0A 5E79C 3BTJA 3WHBA 3A2KA 1JI8A 3SEZA 3CMAI 2M34A 1XTAA 2ISYA 3DWLE 2IGOA 4E7KA 4GFBA 4LIUA 5EJCA 1R1UA 3M1EA 1QHGA 2D1VA 5FRMA 2ZNZA 3FK7A 1TLHB 3DP7A 4EM0B 2WB1N 2Z2SB 3LMMA 3TDZC 2KRHA 2M5WA 4PJNA 1RZ4A 3JRFA 4BBSJ 1IDZA 3NWTA 3CC2I 2JWTA 4GRIA 4A0YA 3CLQA 1LFBA 2GIVA 4D9JA 2FD5A 1K79A 2PEXA 3E3VA 2EA2A 4G9YA 1R9TJ 2R7SA 5LFAA 3T8TA 4IHSA 1REPC 2OQRA 2DK5A 1R23A 4QWQA 4DBQA 5M3MJ 1HQCA 1XSVA 5E18F 3CCYA 3DXJF 1ODDA 3F72A 3CCQI 9ANTA 2R93J 2WY7Q 2L7FP 2YS9A
chains in the Genus database with same CATH topology
5FFXA 3K69A 5K1YA 3ISPA 1OYYA 1ON1A 3WTTC 1HKSA 2FNAA 3RI4A 4A6EA 2VODA 1QZZA 5AONA 2LKPA 5CLSA 1ZGAA 1YFHA 5F6FA 4UVCA 1XMAA 1LEAA 4U0VA 1R00A 1GXQA 2L4MA 3D0SA 3BPVA 2KIUA 4RS8A 1B4AA 3C3WA 1ONVA 3EDPA 1EH7A 4XSZF 3WU0A 4CO8A 4AIKA 3CTAA 1IAWA 3E5UA 1I1SA 1LNWA 2WV0A 1XMKA 4MGRA 3MEXA 1O57A 1XGSA 4L5JA 2R7FA 2VT2A 1IRFA 4IHTA 1LDJA 1BC7C 3F3XA 3F8BA 4GO1A 3WODF 4O3MA 2ZKZA 2KRFA 2XAJA 4HF0A 5LRSA 2EV6A 4LJZF 3FZVA 3WG9A 3CO6C 1TQPA 3J80Z 1H0MA 3DPTA 1PP7U 5K5OA 1XDSA 3I54A 3HUGA 1BOAA 3GUDA 3MAJA 1FPQA 1XDUA 1XGMA 4Y15A 2GA2A 4GGGA 4U0WA 1BBYA 1WKMA 1EH8A 2ZNYA 4KIGA 1FOKA 4RB1A 3V4GA 3BP8A 1K78B 2D1HA 4BXUA 3JAMZ 4HAMA 3RYRA 2PI0A 4DQ2A 3FXQA 3IL2A 2K4BA 4DNCA 3W6KB 4G8XA 2DQRA 1MGTA 1SFXA 3F8MA 3ABTA 4HLYA 3H3ZA 3GFMA 5BMZA 2M87A 3GZ5A 3ZMUA 2OAZA 1BI3A 4LG0B 4Q4ZF 2M8EA 5E1WA 1U3EM 3DEUA 2F5DA 2VBZA 3R61A 2VE9A 4UXNA 4A6DA 3BWGA 4CGZA 5DCMB 3DPLC 3H3UA 3JW4A 2MH9A 3E6MA 3E6BA 3QOPA 4HA8A 4I09A 2XKPA 1BC8C 4CYDA 2E7WA 4H0EA 2O3FA 4M72A 3GEZA 3MWMA 1HSJA 4HYEA 5DUKA 1FWZA 1W5SA 2GA1A 3I71A 3LSTA 1TQIA 4HX8A 2ZFWA 5CVJA 3KE2A 3R4KA 3GFIA 4RAYA 1J9IA 2NNNA 1R1TA 1DUXC 5KVRA 3BDDA 2RQPA 4KYWA 4L0YB 3L9FA 2TDXA 2FOKA 3KP6A 4NB5A 2EA4A 1ZH5A 1TNTA 4KNYA 2DI3A 4M6YA 5JI6A 3WTWC 3GVAA 3KEQA 3PQKA 1TNSA 2RNJA 2Z33A 2JT1A 4EJUA 4AWXB 1I5ZA 2DBBA 3JAMK 4KDPA 2R7DA 3WGIA 1O3TA 3SHFA 5D5VB 2ZJ2A 4UNOA 4IXAA 4LG0A 2Z3YA 5JR3A 3DQVC 1P6RA 4B8XA 2O0YA 4KUMA 2GWRA 2VOPA 1BIBA 2JPCA 4FHTA 4R8HA 5FD6A 3HSEA 4HOBA 2ISZA 4U7BA 4TV7A 2FQ3A 5CJ9A 2VONA 1DP7P 5DCMA 1G3WA 1I1GA 2V1UA 1WQ2A 2IJLA 1Z6TA 1IXSB 4KFCA 3N97A 2O6GE 1QO0D 4A5MA 4Y17A 3L7WA 2M45A 4U88A 1ZRFA 3ZMZA 4Q47A 4HQMA 4RGRA 2FE3A 2FBIA 3FX3A 4LB6B 3SQNA 2DFIA 4CDGA 4LK0F 1YS6A 3F22A 3HSRA 2V9VA 4L9JA 5J8FA 3AAFA 1HSTA 1G3SA 2BYVE 1EH6A 2PQ8A 1YIOA 2E7XA 5IT9Z 4AIJA 1Z91A 1XB4A 4YIFA 2PLYA 5K5QA 1LDDA 1R58A 5ICFA 1G6NA 4K2EA 2FBKA 1YW8A 2IP2A 1MKMA 4GCVA 1IXCA 4BHPA 4MNUA 4BNCA 1FZPB 5HDGA 1R5HA 3JSOA 1J0RA 4F7ZA 2VT3A 2V1DA 4EJTA 2Y0MA 4YFKF 1MJ9A 3Q5FA 2QQ9A 3LAPA 1DDNA 3OV8A 1USSA 3C7JA 4D0PA 2PN6A 4WXHA 1HW5A 1OMIA 1K7AA 1OYWA 2WTEA 5HLGA 4EMSA 2DO7A 1A04A 3NEUA 2VOOA 5ILSA 1RUNA 3HRSA 3V8KA 5HDNA 3RTRA 5CVUA 2HWVA 1W7PB 2X0LA 3ZN1A 2H6CA 2PBIA 2RV8A 3B73A 4RB0A 1YQAA 4MEXF 4EGZA 6PAXA 3I59B 3CDHA 2ZO4A 4RGUA 1ULYA 3KLOA 1S8NA 1BN5A 2OA4A 2ESHA 4RGXA 2VE8A 1AOYA 1T98A 3WTUC 1R36A 3R6SA 1FSHA 1Q1HA 5DD4A 4KN4X 4M9SA 1FLIA 4U0YA 1R5GA 4N9IA 3LA7A 4KA4A 4OIPF 2XAGA 4IF4A 1CGPA 1RIOH 2YX7A 5DEQA 1KA8A 1F4KA 1IUYA 1YLFA 5L3DA 2HFHA 3EYIA 2FA5A 2PMUA 1P92A 3JSPA 2GAUA 4MQVA 4CHUA 3JTGA 2FXAA 2P6TA 3F21A 3FM3A 2J5OA 2ESNA 4JQFA 4EJWA 4G94A 5BOXA 5HS7A 5D4RA 5KK1A 4I7HA 3U9GA 3F8FA 1SD6A 2IVMA 3F8CA 1WI9A 1S7OA 4M6XA 2GXGA 4HW0A 2ADUA 4MEYF 1W7PA 5E1ZB 4BH9A 3TQNA 4ASNA 2JRTA 2OBPA 4GYIA 5LGNA 3I59A 3IC7A 4IPAA 3CLOA 2FU4A 5ED4A 1U8RA 4KIBA 3E6CC 1IN7A 1R1VA 1T2KA 2IPQX 5D5XB 3RDIA 2LSOA 2BGCA 1L0OC 3QP5A 4QLCU 1KU3A 1QZYA 2PFBA 4HV5A 1ZG3A 5E8IA 1IN5A 2FBHA 3G3ZA 3K9TA 4WX9A 2G7HA 1FBUA 2KIFA 4Q48A 2CYYA 4ESBA 1OKRA 4I0AA 2EFPA 3GW2A 4I02A 2EFQA 4RGSA 2NNYA 4HDVA 1J75A 2LF7A 1KYWA 5LGTA 4OINF 3LAJA 3BJAA 1QPMA 1W5TA 3K0LA 2KIMA 1J5YA 1IN4A 3R60A 3HYIA 2JSCA 2RDPA 2XHKA 1ZREA 4FX4A 4WXDA 3IWFA 4L9VA 4ZH4F 4S04A 4ON0A 2A5YB 2IA2A 3WTSC 4OMYA 3M9AA 2YX4A 1FNNA 3VEPA 5FB2A 1TW2A 1J7KA 4EV0A 2NS0A 4MTEA 3ZQ7A 3VB2A 5A2QZ 1KU2A 2FEZA 2MLKA 1HKTA 2Z99A 1KQ9A 2KKOA 1J59A 3J7AO 3T8RA 2JZYA 5LHIA 4NHJA 4KT5C 2W84A 3V7SA 4Q5SF 2BV6A 1LB2A 2GXBA 5AIQA 3I5UA 1FX7A 1BIAA 2L02A 3KLNA 4M74A 3FMSA 1ZHFA 1OYIA 1OPCA 4L9NA 4RB2C 2BE5F 2PG4A 1XN7A 2IA0A 1MD0A 5K5RA 3U1DA 1H9TA 3IRQA 1Z7UA 1MZBA 3COAC 2UZKA 4KMFA 1FYLA 1B6AA 4LLNA 5FLXZ 1S3JA 3GX4X 1FP2A 4LD5A 3CJNA 3ROUA 3ZMTA 4PGGA 2V6CA 3FMQA 3CUQB 3ELKA 4XSXF 4CXFA 4P55A 2O8XA 1B1BA 2P5KA 4IRHA 3VFZA 4XLNF 3T0YA 5HS9A 2STWA 2XUBA 1ZARA 2XAHA 4GXOA 2L54A 4PGHA 2XIGA 4RB3C 5HDKA 1UHMA 1USTA 3KCCA 1UCRA 3WTXC 2HS5A 2P7VB 2A68F 3N4MA 3QPTA 1KQ8A 1O7LA 4OMZA 1IF1A 2RN7A 4WWCA 4G7HF 2K02A 3D5LA 3LA3A 1F5TA 4LLGF 2PMHA 2P5LC 5DUIA 4HZFA 2ACJA 2EV0A 4P9FA 3E6DA 5E20A 1KU9A 1MJBA 3KZYA 1ZLKA 4ZYGA 1E2XA 1PP8F 1S29A 2DQLA 2FRHA 1G3YA 4HF1A 5ICEA 4EJOA 1F1ZA 1O7FA 1QNTA 2H27A 3J80K 4KICA 3F8NA 3L00A 1AWCA 1H9GA 3ZMVA 2B0LA 1KGSA 4HLXA 2JPBA 4I98B 2O61A 1ZYRF 4HQEA 3KEOA 1ZG1A 4U7DA 3CUQA 5FLXK 2QM3A 2DK8A 3BJOA 2OZ6A 5FD5A 1K78A 2BEOA 2ETHA 1TW3A 2X4HA 2W85A 1B59A 2CSOA 1IXRC 1ZLJA 3ML6A 3SFZA 3EUHA 4ENKA 2VXZA 3RIRA 2D45A 2MLGA 1U5TB 4IRGA 5D8LB 4WK8F 2QVOA 2COMA 5H6RA 5BPDA 5L3BA 4G7ZF 3BOQA 2LDUA 3HSFA 1LDKB 2MC3A 2F5EA 3ABUA 2QZ8A 3VOEA 3IKVA 2QBYB 3IKTA 1VTNC 3KP5A 1JXSA 1U78A 1K6OA 3WTZA 2ZCWA 4ENJA 2HOEA 2MBFA 2HR3A 4Y13A 4NQWA 2GQQA 2YR2A 3RPUA 3DFGA 2G7UA 1IW7F 1PUEE 1CF7B 2MA3A 3GO5A 1XSDA 1D5VA 4JK1X 2FF4A 3WGGA 2AS5F 4EQQA 5D8KB 2EFNA 3KFWX 5AIPA 3BROA 5J6XA 4G6QA 2HQNA 3M7GA 1ZN2A 3V7CA 3GFJA 1SAXA 3HHGA 3CUQC 4BHBA 3QPHA 2V79A 2H09A 3BPXA 2A69F 2JTVA 1Z1DA 1BI1A 4HBLA 5DDGA 4ESJA 3L2CA 3KP4A 1GVJA 4YG2F 2RVCA 3P9CA 1XCBA 2QQAA 3C18A 1U5TA 2EK5A 3RPQA 3BZ6A 3JTHA 2QWWA 2P6SA 3T5XA 3TO7A 2CWEA 3TO9A 1STZA 1YW9A 1Z05A 4WF2A 3I0TA 4IVNA 1HW1A 4ZYEA 3O2PE 5H20A 1TTYA 1TQMA 5D4SA 5HLHA 2QBYA 1S7AA 2VBXA 2L01A 1RNLA 2YU3A 3V7RA 3M8FA 5HLIA 3G73A 3GLXA 4KN7X 3KP3A 4ZZLA 3BJ6A 1R22A 1JHHA 2DT5A 3KP2A 5BPIA 1FYKA 1CF7A 1ZGJA 1U6GA 1D8KA 4BQAA 5JFRA 3MFKA 5HVQC 2XROA 3HHHA 4A12A 2H94A 2YSRA 1B9NA 1IRGA 5D5WB 1SMYF 4EVIA 2A6EF 1SD7A 3WTVC 3FM5A 2EFOA 3ECHA 2Y48A 3RKYA 5IT9K 1LVAA 3HRMA 3O3KA 3C1DA 3CUOA 5HOOA 5LEJA 4FX0A 2MD5A 2CGPA 1XD7A 2HTJA 3TO6A 2OQGA 4B09A 1U5TC 3CO7C 5HS8A 4HV6A 1KU7A 3FHZA 2K7LA 3GF2A 1UFMA 5L3GA 1YYVA 2CW0F 2HYGD 1BI2A 2J5PA 3L09A 5IT3A 2CFXA 1T38A 1EV7A 3FXRA 1QQIA 3Q9SA 5DCFA 5D5UB 3B02A 1G3TA 3RKWA 3NRVA 5ILUA 4EM1A 1YS7A 4WCGA 2IT0A 3V8LA 3P9IA 3GYHX 4IJAA 2EWNA 3LQRA 2IRFG 3FF5A 5CVRA 5JVTA 1SFEA 3REOA 3MZHA 3M8EA 1UB9A 2Q8KA 1O3SA 4OIQF 4I2OA 2DW4A 1B9MA 2E1NA 3ZN0A 2KJCA 2Q0OA 2H6BA 3VODA 1LJ9A 3R0AA 1D3YA 1TBXA 2VBYA 2K4JA 2XV4S 2MH2A 3S2WA 2ZMEB 3O6BB 2WC2A 3GFLA 3HOTA 2ELHA 3ULQB 3TOAA 3OOPA 2F2EA 4S05A 3I4PA 1ZAOA 3I58A 4YFNF 5BS6A 3U2RA 2V1XA 1ZRDA 2M1BA 1IN8A 2UWMA 1FYMA 2HTSA 1P4WA 2W25A 3QAHA 5F1RA 5E17F 1XCVA 2VC1A 2XVCA 2UXNA 1HW2A 1MDMB 4MHGA 3HTUA 1JGSA 4N0BA 1FSEA 3RYPA 3EETA 1XGOA 2A07F 1E17A 3GXOA 3K2ZA 3Q9VA 4P9UA 2KJBA 1RUOA 1FBQA 2QUFA 3HIFA 3QU3A 2UXXA 2DPUA 3SZPA 4I01A 2OU2A 4M9XA 3EQLF 1G4DA 2EJRA 1SD5A 1T6SA 5D6FA 3F6OA 3ZMSA 2FMYA 4A0ZA 1D8JA 1ZRCA 1U2WA 4G6DA 2HYFA 2HGCA 1XSXA 4ENNA 1FY7A 2ZMEA 2A61A 4CICA 1P2FA 2F5FA 4FT8A 1YW7A 2EB7A 2DAOA 3FMRA 5LLQA 2RKHA 3QP6A 4LMYA 4LLLA 5DD8A 4HF2A 5LHGA 2A3SA 5D6EA 4LGWA 2NYXA 4CZZA 2XGXA 2FSWA 1F9NA 2F5CA 1V3FA 4G7OF 2NRAC 2DPDA 1IZ1A 2GZWA 2QYOA 2HQRA 5FFZA 1PDNC 1FP1D 4L18B 1NHAA 4UV8A 1MDMA 3KETA 2VN2A 2AXLA 1Z9CA 2DLLA 2HZTA 2W57A 4HX7A 4M9ZA 1ON2A 3ERED 5H6QA 1SFUA 1J2XA 3ZPLA 5A2QK 1KYZA 3FXUA 5ERIA 4MQ9F 3GWZA 5ICCA 3RJPA 1Y0UA 4YFXF 3WTYC 1S6LA 4ESFA 2CQKA 2ZXJA 5E1XA 4A0XA 4ZZDA 3DF8A 4R79A 3LWFA 2NAZA 1JE8A 2EV5A 3W6JB 4AD9A 1XGNA 4BHCA 4RAZA 3K1MA 1YG2A 4XBFA 5LGUA 4IRIA 2EFWA 4PZJA 5J8CA 3HRUA 2P8TA 2PJPA 2RC4A 2P4WA 1BM9A 2LF8A 1BJAA 1KQ0A 3J81Z 1R7JA 1O3RA 1I6XA 5ICGA 2XASA 2RGVA 4EGYA 1BI0A 4ENMA 4E70A 4Z2YA 1SMTA 2XKOA 2P5VA 4LFUA 4AVPA 3I53A 4EJVA 1T0FA 5L3CA 2HKOA 4KMUX 5LRRA 1UHWA 2HKXA 5JHUA 3HTSB 3F6VA 1HBXG 1MJAA 4M71A 3E5XA 5TRDA 1QGPA 4XLPF 4P96A 1T39A 4MTDA 1I27A 3P9KA 2Y75A 2DTRA 4EM2A 2HEOA 3SXYA 5L3EA 3MQ0A 4L0ZB 2QENA 4YIIA 2L4AA 2VBWA 2OD5A 5ILVA 4OOIA 1X3UA 4GYGA 2BBYA 4HX4A 4AIHA 1ZG5A 5L3FA 4ZYHA 4I0BA 2LNBA 4UVAA 4UVBA 4UUVA 3ZMDA 3P7NA 3IHUA 4M73A 4ZYDA 2W24A 5BQTA 3MZYA 1L3LA 4XRFA 2VC0A 1WRJA 2XAQA 2XAFA 3E97A 1HXDA 1LQ1A 5CYVA 3NQOA 3F23A 3IWZA 5FO5A 1RI7A 4A5NA 2HDCA 2Z9OA 3IRRA 3HOSA 3GZ6A 2E1CA 3J81K 1V4RA 4BAYA 2K27A 2IA1A 3QU6A 2C6YA 3LA2A 5E8GA 3BY6A 1GXPA 2STTA 3TGNA 4OIRF 4UV9A 2Q2EA 1IN6A 5LHHA 4JBAA 3TKYA 3V8JA 3LQQA 5LEKA 1P4AA 2IW5A 3ECOA 4R1HA 4UHTA 5FGMA 5LBQA 3PFIA 1O3QA 4LB5A 4L9TA 5TJJA 3T1BA 2D2WA 4O6JA 3K1PA 2M30A 2WWYA 4OIOF 1LEBA 1DPRA 2QLZA 1WWXA 3PQJA 4BYYA 4A2UA 4LK1F 3E5QA 4OU0A 3I64A 2ZBKA 3WE3A 5DYMA 3FWEA 2G9WA 2K86A 3EYYA 3TDUC 3RKXA 1HKQA 5CVVA 3DV8A 2FMLA 1W4MA 1GHCA 2YPRA 1DPUA 1Z6RA 1P4XA 1FT9A 5DV5A 2QQBA 3DKWA 3R0JA 3KP7A 1YO5C 3H92A 3QRFF 1YTYA 5EEGA 3WGHA 1OR7A 2OZUA 5F64A 1FC3A 3SZTA 2Z5UA 2CG4A 2A6HF 2O03A 4L5IA 1JHFA 1SD4A 3ZP5A 2L3DA 2DU9A 3KZZA 2XRNA 4WXCA 4PDKA 4PCQA 4KIFA 3WE2A 3WU1B 2CO5A 5EEHA 3LFKA 3MCZA 4N9HA 4P5OA 2FNPA 5CVIA 1W7PD 3TOBA 4ETSA 1QBJA 4O5VA 1FBSA 2R3SA 3K1NA 4HDUA 1WSUA 3HRTA 2P7CB 1C0WA 2ISYA 1R1UA 3M1EA 2D1VA 2ZNZA 1TLHB 3DP7A 4EM0B 3TDZC 2M5WA 1RZ4A 4A0YA 2GIVA 1K79A 2PEXA 3E3VA 2EA2A 4G9YA 3T8TA 4IHSA 1REPC 2OQRA 2DK5A 1R23A 4QWQA 1HQCA 1XSVA 5E18F 3F72A 3DXJF 1ODDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFX A;  3K69 A;  5K1Y A;  3ISP A;  1OYY A;  1ON1 A;  3WTT C;  1HKS A;  2FNA A;  3RI4 A;  4A6E A;  2VOD A;  1QZZ A;  5AON A;  2LKP A;  5CLS A;  1ZGA A;  1YFH A;  5F6F A;  4UVC A;  1XMA A;  1LEA A;  4U0V A;  1R00 A;  1GXQ A;  2L4M A;  3D0S A;  3BPV A;  2KIU A;  4RS8 A;  1B4A A;  3C3W A;  1ONV A;  3EDP A;  1EH7 A;  4XSZ F;  3WU0 A;  4CO8 A;  4AIK A;  3CTA A;  1IAW A;  3E5U A;  1I1S A;  1LNW A;  2WV0 A;  1XMK A;  4MGR A;  3MEX A;  1O57 A;  1XGS A;  4L5J A;  2R7F A;  2VT2 A;  1IRF A;  4IHT A;  1LDJ A;  1BC7 C;  3F3X A;  3F8B A;  4GO1 A;  3WOD F;  4O3M A;  2ZKZ A;  2KRF A;  2XAJ A;  4HF0 A;  5LRS A;  2EV6 A;  4LJZ F;  3FZV A;  3WG9 A;  3CO6 C;  1TQP A;  3J80 Z;  1H0M A;  3DPT A;  1PP7 U;  5K5O A;  1XDS A;  3I54 A;  3HUG A;  1BOA A;  3GUD A;  3MAJ A;  1FPQ A;  1XDU A;  1XGM A;  4Y15 A;  2GA2 A;  4GGG A;  4U0W A;  1BBY A;  1WKM A;  1EH8 A;  2ZNY A;  4KIG A;  1FOK A;  4RB1 A;  3V4G A;  3BP8 A;  1K78 B;  2D1H A;  4BXU A;  3JAM Z;  4HAM A;  3RYR A;  2PI0 A;  4DQ2 A;  3FXQ A;  3IL2 A;  2K4B A;  4DNC A;  3W6K B;  4G8X A;  2DQR A;  1MGT A;  1SFX A;  3F8M A;  3ABT A;  4HLY A;  3H3Z A;  3GFM A;  5BMZ A;  2M87 A;  3GZ5 A;  3ZMU A;  2OAZ A;  1BI3 A;  4LG0 B;  4Q4Z F;  2M8E A;  5E1W A;  1U3E M;  3DEU A;  2F5D A;  2VBZ A;  3R61 A;  2VE9 A;  4UXN A;  4A6D A;  3BWG A;  4CGZ A;  5DCM B;  3DPL C;  3H3U A;  3JW4 A;  2MH9 A;  3E6M A;  3E6B A;  3QOP A;  4HA8 A;  4I09 A;  2XKP A;  1BC8 C;  4CYD A;  2E7W A;  4H0E A;  2O3F A;  4M72 A;  3GEZ A;  3MWM A;  1HSJ A;  4HYE A;  5DUK A;  1FWZ A;  1W5S A;  2GA1 A;  3I71 A;  3LST A;  1TQI A;  4HX8 A;  2ZFW A;  5CVJ A;  3KE2 A;  3R4K A;  3GFI A;  4RAY A;  1J9I A;  2NNN A;  1R1T A;  1DUX C;  5KVR A;  3BDD A;  2RQP A;  4KYW A;  4L0Y B;  3L9F A;  2TDX A;  2FOK A;  3KP6 A;  4NB5 A;  2EA4 A;  1ZH5 A;  1TNT A;  4KNY A;  2DI3 A;  4M6Y A;  5JI6 A;  3WTW C;  3GVA A;  3KEQ A;  3PQK A;  1TNS A;  2RNJ A;  2Z33 A;  2JT1 A;  4EJU A;  4AWX B;  1I5Z A;  2DBB A;  3JAM K;  4KDP A;  2R7D A;  3WGI A;  1O3T A;  3SHF A;  5D5V B;  2ZJ2 A;  4UNO A;  4IXA A;  4LG0 A;  2Z3Y A;  5JR3 A;  3DQV C;  1P6R A;  4B8X A;  2O0Y A;  4KUM A;  2GWR A;  2VOP A;  1BIB A;  2JPC A;  4FHT A;  4R8H A;  5FD6 A;  3HSE A;  4HOB A;  2ISZ A;  4U7B A;  4TV7 A;  2FQ3 A;  5CJ9 A;  2VON A;  1DP7 P;  5DCM A;  1G3W A;  1I1G A;  2V1U A;  1WQ2 A;  2IJL A;  1Z6T A;  1IXS B;  4KFC A;  3N97 A;  2O6G E;  1QO0 D;  4A5M A;  4Y17 A;  3L7W A;  2M45 A;  4U88 A;  1ZRF A;  3ZMZ A;  4Q47 A;  4HQM A;  4RGR A;  2FE3 A;  2FBI A;  3FX3 A;  4LB6 B;  3SQN A;  2DFI A;  4CDG A;  4LK0 F;  1YS6 A;  3F22 A;  3HSR A;  2V9V A;  4L9J A;  5J8F A;  3AAF A;  1HST A;  1G3S A;  2BYV E;  1EH6 A;  2PQ8 A;  1YIO A;  2E7X A;  5IT9 Z;  4AIJ A;  1Z91 A;  1XB4 A;  4YIF A;  2PLY A;  5K5Q A;  1LDD A;  1R58 A;  5ICF A;  1G6N A;  4K2E A;  2FBK A;  1YW8 A;  2IP2 A;  1MKM A;  4GCV A;  1IXC A;  4BHP A;  4MNU A;  4BNC A;  1FZP B;  5HDG A;  1R5H A;  3JSO A;  1J0R A;  4F7Z A;  2VT3 A;  2V1D A;  4EJT A;  2Y0M A;  4YFK F;  1MJ9 A;  3Q5F A;  2QQ9 A;  3LAP A;  1DDN A;  3OV8 A;  1USS A;  3C7J A;  4D0P A;  2PN6 A;  4WXH A;  1HW5 A;  1OMI A;  1K7A A;  1OYW A;  2WTE A;  5HLG A;  4EMS A;  2DO7 A;  1A04 A;  3NEU A;  2VOO A;  5ILS A;  1RUN A;  3HRS A;  3V8K A;  5HDN A;  3RTR A;  5CVU A;  2HWV A;  1W7P B;  2X0L A;  3ZN1 A;  2H6C A;  2PBI A;  2RV8 A;  3B73 A;  4RB0 A;  1YQA A;  4MEX F;  4EGZ A;  6PAX A;  3I59 B;  3CDH A;  2ZO4 A;  4RGU A;  1ULY A;  3KLO A;  1S8N A;  1BN5 A;  2OA4 A;  2ESH A;  4RGX A;  2VE8 A;  1AOY A;  1T98 A;  3WTU C;  1R36 A;  3R6S A;  1FSH A;  1Q1H A;  5DD4 A;  4KN4 X;  4M9S A;  1FLI A;  4U0Y A;  1R5G A;  4N9I A;  3LA7 A;  4KA4 A;  4OIP F;  2XAG A;  4IF4 A;  1CGP A;  1RIO H;  2YX7 A;  5DEQ A;  1KA8 A;  1F4K A;  1IUY A;  1YLF A;  5L3D A;  2HFH A;  3EYI A;  2FA5 A;  2PMU A;  1P92 A;  3JSP A;  2GAU A;  4MQV A;  4CHU A;  3JTG A;  2FXA A;  2P6T A;  3F21 A;  3FM3 A;  2J5O A;  2ESN A;  4JQF A;  4EJW A;  4G94 A;  5BOX A;  5HS7 A;  5D4R A;  5KK1 A;  4I7H A;  3U9G A;  3F8F A;  1SD6 A;  2IVM A;  3F8C A;  1WI9 A;  1S7O A;  4M6X A;  2GXG A;  4HW0 A;  2ADU A;  4MEY F;  1W7P A;  5E1Z B;  4BH9 A;  3TQN A;  4ASN A;  2JRT A;  2OBP A;  4GYI A;  5LGN A;  3I59 A;  3IC7 A;  4IPA A;  3CLO A;  2FU4 A;  5ED4 A;  1U8R A;  4KIB A;  3E6C C;  1IN7 A;  1R1V A;  1T2K A;  2IPQ X;  5D5X B;  3RDI A;  2LSO A;  2BGC A;  1L0O C;  3QP5 A;  4QLC U;  1KU3 A;  1QZY A;  2PFB A;  4HV5 A;  1ZG3 A;  5E8I A;  1IN5 A;  2FBH A;  3G3Z A;  3K9T A;  4WX9 A;  2G7H A;  1FBU A;  2KIF A;  4Q48 A;  2CYY A;  4ESB A;  1OKR A;  4I0A A;  2EFP A;  3GW2 A;  4I02 A;  2EFQ A;  4RGS A;  2NNY A;  4HDV A;  1J75 A;  2LF7 A;  1KYW A;  5LGT A;  4OIN F;  3LAJ A;  3BJA A;  1QPM A;  1W5T A;  3K0L A;  2KIM A;  1J5Y A;  1IN4 A;  3R60 A;  3HYI A;  2JSC A;  2RDP A;  2XHK A;  1ZRE A;  4FX4 A;  4WXD A;  3IWF A;  4L9V A;  4ZH4 F;  4S04 A;  4ON0 A;  2A5Y B;  2IA2 A;  3WTS C;  4OMY A;  3M9A A;  2YX4 A;  1FNN A;  3VEP A;  5FB2 A;  1TW2 A;  1J7K A;  4EV0 A;  2NS0 A;  4MTE A;  3ZQ7 A;  3VB2 A;  5A2Q Z;  1KU2 A;  2FEZ A;  2MLK A;  1HKT A;  2Z99 A;  1KQ9 A;  2KKO A;  1J59 A;  3J7A O;  3T8R A;  2JZY A;  5LHI A;  4NHJ A;  4KT5 C;  2W84 A;  3V7S A;  4Q5S F;  2BV6 A;  1LB2 A;  2GXB A;  5AIQ A;  3I5U A;  1FX7 A;  1BIA A;  2L02 A;  3KLN A;  4M74 A;  3FMS A;  1ZHF A;  1OYI A;  1OPC A;  4L9N A;  4RB2 C;  2BE5 F;  2PG4 A;  1XN7 A;  2IA0 A;  1MD0 A;  5K5R A;  3U1D A;  1H9T A;  3IRQ A;  1Z7U A;  1MZB A;  3COA C;  2UZK A;  4KMF A;  1FYL A;  1B6A A;  4LLN A;  5FLX Z;  1S3J A;  3GX4 X;  1FP2 A;  4LD5 A;  3CJN A;  3ROU A;  3ZMT A;  4PGG A;  2V6C A;  3FMQ A;  3CUQ B;  3ELK A;  4XSX F;  4CXF A;  4P55 A;  2O8X A;  1B1B A;  2P5K A;  4IRH A;  3VFZ A;  4XLN F;  3T0Y A;  5HS9 A;  2STW A;  2XUB A;  1ZAR A;  2XAH A;  4GXO A;  2L54 A;  4PGH A;  2XIG A;  4RB3 C;  5HDK A;  1UHM A;  1UST A;  3KCC A;  1UCR A;  3WTX C;  2HS5 A;  2P7V B;  2A68 F;  3N4M A;  3QPT A;  1KQ8 A;  1O7L A;  4OMZ A;  1IF1 A;  2RN7 A;  4WWC A;  4G7H F;  2K02 A;  3D5L A;  3LA3 A;  1F5T A;  4LLG F;  2PMH A;  2P5L C;  5DUI A;  4HZF A;  2ACJ A;  2EV0 A;  4P9F A;  3E6D A;  5E20 A;  1KU9 A;  1MJB A;  3KZY A;  1ZLK A;  4ZYG A;  1E2X A;  1PP8 F;  1S29 A;  2DQL A;  2FRH A;  1G3Y A;  4HF1 A;  5ICE A;  4EJO A;  1F1Z A;  1O7F A;  1QNT A;  2H27 A;  3J80 K;  4KIC A;  3F8N A;  3L00 A;  1AWC A;  1H9G A;  3ZMV A;  2B0L A;  1KGS A;  4HLX A;  2JPB A;  4I98 B;  2O61 A;  1ZYR F;  4HQE A;  3KEO A;  1ZG1 A;  4U7D A;  3CUQ A;  5FLX K;  2QM3 A;  2DK8 A;  3BJO A;  2OZ6 A;  5FD5 A;  1K78 A;  2BEO A;  2ETH A;  1TW3 A;  2X4H A;  2W85 A;  1B59 A;  2CSO A;  1IXR C;  1ZLJ A;  3ML6 A;  3SFZ A;  3EUH A;  4ENK A;  2VXZ A;  3RIR A;  2D45 A;  2MLG A;  1U5T B;  4IRG A;  5D8L B;  4WK8 F;  2QVO A;  2COM A;  5H6R A;  5BPD A;  5L3B A;  4G7Z F;  3BOQ A;  2LDU A;  3HSF A;  1LDK B;  2MC3 A;  2F5E A;  3ABU A;  2QZ8 A;  3VOE A;  3IKV A;  2QBY B;  3IKT A;  1VTN C;  3KP5 A;  1JXS A;  1U78 A;  1K6O A;  3WTZ A;  2ZCW A;  4ENJ A;  2HOE A;  2MBF A;  2HR3 A;  4Y13 A;  4NQW A;  2GQQ A;  2YR2 A;  3RPU A;  3DFG A;  2G7U A;  1IW7 F;  1PUE E;  1CF7 B;  2MA3 A;  3GO5 A;  1XSD A;  1D5V A;  4JK1 X;  2FF4 A;  3WGG A;  2AS5 F;  4EQQ A;  5D8K B;  2EFN A;  3KFW X;  5AIP A;  3BRO A;  5J6X A;  4G6Q A;  2HQN A;  3M7G A;  1ZN2 A;  3V7C A;  3GFJ A;  1SAX A;  3HHG A;  3CUQ C;  4BHB A;  3QPH A;  2V79 A;  2H09 A;  3BPX A;  2A69 F;  2JTV A;  1Z1D A;  1BI1 A;  4HBL A;  5DDG A;  4ESJ A;  3L2C A;  3KP4 A;  1GVJ A;  4YG2 F;  2RVC A;  3P9C A;  1XCB A;  2QQA A;  3C18 A;  1U5T A;  2EK5 A;  3RPQ A;  3BZ6 A;  3JTH A;  2QWW A;  2P6S A;  3T5X A;  3TO7 A;  2CWE A;  3TO9 A;  1STZ A;  1YW9 A;  1Z05 A;  4WF2 A;  3I0T A;  4IVN A;  1HW1 A;  4ZYE A;  3O2P E;  5H20 A;  1TTY A;  1TQM A;  5D4S A;  5HLH A;  2QBY A;  1S7A A;  2VBX A;  2L01 A;  1RNL A;  2YU3 A;  3V7R A;  3M8F A;  5HLI A;  3G73 A;  3GLX A;  4KN7 X;  3KP3 A;  4ZZL A;  3BJ6 A;  1R22 A;  1JHH A;  2DT5 A;  3KP2 A;  5BPI A;  1FYK A;  1CF7 A;  1ZGJ A;  1U6G A;  1D8K A;  4BQA A;  5JFR A;  3MFK A;  5HVQ C;  2XRO A;  3HHH A;  4A12 A;  2H94 A;  2YSR A;  1B9N A;  1IRG A;  5D5W B;  1SMY F;  4EVI A;  2A6E F;  1SD7 A;  3WTV C;  3FM5 A;  2EFO A;  3ECH A;  2Y48 A;  3RKY A;  5IT9 K;  1LVA A;  3HRM A;  3O3K A;  3C1D A;  3CUO A;  5HOO A;  5LEJ A;  4FX0 A;  2MD5 A;  2CGP A;  1XD7 A;  2HTJ A;  3TO6 A;  2OQG A;  4B09 A;  1U5T C;  3CO7 C;  5HS8 A;  4HV6 A;  1KU7 A;  3FHZ A;  2K7L A;  3GF2 A;  1UFM A;  5L3G A;  1YYV A;  2CW0 F;  2HYG D;  1BI2 A;  2J5P A;  3L09 A;  5IT3 A;  2CFX A;  1T38 A;  1EV7 A;  3FXR A;  1QQI A;  3Q9S A;  5DCF A;  5D5U B;  3B02 A;  1G3T A;  3RKW A;  3NRV A;  5ILU A;  4EM1 A;  1YS7 A;  4WCG A;  2IT0 A;  3V8L A;  3P9I A;  3GYH X;  4IJA A;  2EWN A;  3LQR A;  2IRF G;  3FF5 A;  5CVR A;  5JVT A;  1SFE A;  3REO A;  3MZH A;  3M8E A;  1UB9 A;  2Q8K A;  1O3S A;  4OIQ F;  4I2O A;  2DW4 A;  1B9M A;  2E1N A;  3ZN0 A;  2KJC A;  2Q0O A;  2H6B A;  3VOD A;  1LJ9 A;  3R0A A;  1D3Y A;  1TBX A;  2VBY A;  2K4J A;  2XV4 S;  2MH2 A;  3S2W A;  2ZME B;  3O6B B;  2WC2 A;  3GFL A;  3HOT A;  2ELH A;  3ULQ B;  3TOA A;  3OOP A;  2F2E A;  4S05 A;  3I4P A;  1ZAO A;  3I58 A;  4YFN F;  5BS6 A;  3U2R A;  2V1X A;  1ZRD A;  2M1B A;  1IN8 A;  2UWM A;  1FYM A;  2HTS A;  1P4W A;  2W25 A;  3QAH A;  5F1R A;  5E17 F;  1XCV A;  2VC1 A;  2XVC A;  2UXN A;  1HW2 A;  1MDM B;  4MHG A;  3HTU A;  1JGS A;  4N0B A;  1FSE A;  3RYP A;  3EET A;  1XGO A;  2A07 F;  1E17 A;  3GXO A;  3K2Z A;  3Q9V A;  4P9U A;  2KJB A;  1RUO A;  1FBQ A;  2QUF A;  3HIF A;  3QU3 A;  2UXX A;  2DPU A;  3SZP A;  4I01 A;  2OU2 A;  4M9X A;  3EQL F;  1G4D A;  2EJR A;  1SD5 A;  1T6S A;  5D6F A;  3F6O A;  3ZMS A;  2FMY A;  4A0Z A;  1D8J A;  1ZRC A;  1U2W A;  4G6D A;  2HYF A;  2HGC A;  1XSX A;  4ENN A;  1FY7 A;  2ZME A;  2A61 A;  4CIC A;  1P2F A;  2F5F A;  4FT8 A;  1YW7 A;  2EB7 A;  2DAO A;  3FMR A;  5LLQ A;  2RKH A;  3QP6 A;  4LMY A;  4LLL A;  5DD8 A;  4HF2 A;  5LHG A;  2A3S A;  5D6E A;  4LGW A;  2NYX A;  4CZZ A;  2XGX A;  2FSW A;  1F9N A;  2F5C A;  1V3F A;  4G7O F;  2NRA C;  2DPD A;  1IZ1 A;  2GZW A;  2QYO A;  2HQR A;  5FFZ A;  1PDN C;  1FP1 D;  4L18 B;  1NHA A;  4UV8 A;  1MDM A;  3KET A;  2VN2 A;  2AXL A;  1Z9C A;  2DLL A;  2HZT A;  2W57 A;  4HX7 A;  4M9Z A;  1ON2 A;  3ERE D;  5H6Q A;  1SFU A;  1J2X A;  3ZPL A;  5A2Q K;  1KYZ A;  3FXU A;  5ERI A;  4MQ9 F;  3GWZ A;  5ICC A;  3RJP A;  1Y0U A;  4YFX F;  3WTY C;  1S6L A;  4ESF A;  2CQK A;  2ZXJ A;  5E1X A;  4A0X A;  4ZZD A;  3DF8 A;  4R79 A;  3LWF A;  2NAZ A;  1JE8 A;  2EV5 A;  3W6J B;  4AD9 A;  1XGN A;  4BHC A;  4RAZ A;  3K1M A;  1YG2 A;  4XBF A;  5LGU A;  4IRI A;  2EFW A;  4PZJ A;  5J8C A;  3HRU A;  2P8T A;  2PJP A;  2RC4 A;  2P4W A;  1BM9 A;  2LF8 A;  1BJA A;  1KQ0 A;  3J81 Z;  1R7J A;  1O3R A;  1I6X A;  5ICG A;  2XAS A;  2RGV A;  4EGY A;  1BI0 A;  4ENM A;  4E70 A;  4Z2Y A;  1SMT A;  2XKO A;  2P5V A;  4LFU A;  4AVP A;  3I53 A;  4EJV A;  1T0F A;  5L3C A;  2HKO A;  4KMU X;  5LRR A;  1UHW A;  2HKX A;  5JHU A;  3HTS B;  3F6V A;  1HBX G;  1MJA A;  4M71 A;  3E5X A;  5TRD A;  1QGP A;  4XLP F;  4P96 A;  1T39 A;  4MTD A;  1I27 A;  3P9K A;  2Y75 A;  2DTR A;  4EM2 A;  2HEO A;  3SXY A;  5L3E A;  3MQ0 A;  4L0Z B;  2QEN A;  4YII A;  2L4A A;  2VBW A;  2OD5 A;  5ILV A;  4OOI A;  1X3U A;  4GYG A;  2BBY A;  4HX4 A;  4AIH A;  1ZG5 A;  5L3F A;  4ZYH A;  4I0B A;  2LNB A;  4UVA A;  4UVB A;  4UUV A;  3ZMD A;  3P7N A;  3IHU A;  4M73 A;  4ZYD A;  2W24 A;  5BQT A;  3MZY A;  1L3L A;  4XRF A;  2VC0 A;  1WRJ A;  2XAQ A;  2XAF A;  3E97 A;  1HXD A;  1LQ1 A;  5CYV A;  3NQO A;  3F23 A;  3IWZ A;  5FO5 A;  1RI7 A;  4A5N A;  2HDC A;  2Z9O A;  3IRR A;  3HOS A;  3GZ6 A;  2E1C A;  3J81 K;  1V4R A;  4BAY A;  2K27 A;  2IA1 A;  3QU6 A;  2C6Y A;  3LA2 A;  5E8G A;  3BY6 A;  1GXP A;  2STT A;  3TGN A;  4OIR F;  4UV9 A;  2Q2E A;  1IN6 A;  5LHH A;  4JBA A;  3TKY A;  3V8J A;  3LQQ A;  5LEK A;  1P4A A;  2IW5 A;  3ECO A;  4R1H A;  4UHT A;  5FGM A;  5LBQ A;  3PFI A;  1O3Q A;  4LB5 A;  4L9T A;  5TJJ A;  3T1B A;  2D2W A;  4O6J A;  3K1P A;  2M30 A;  2WWY A;  4OIO F;  1LEB A;  1DPR A;  2QLZ A;  1WWX A;  3PQJ A;  4BYY A;  4A2U A;  4LK1 F;  3E5Q A;  4OU0 A;  3I64 A;  2ZBK A;  3WE3 A;  5DYM A;  3FWE A;  2G9W A;  2K86 A;  3EYY A;  3TDU C;  3RKX A;  1HKQ A;  5CVV A;  3DV8 A;  2FML A;  1W4M A;  1GHC A;  2YPR A;  1DPU A;  1Z6R A;  1P4X A;  1FT9 A;  5DV5 A;  2QQB A;  3DKW A;  3R0J A;  3KP7 A;  1YO5 C;  3H92 A;  3QRF F;  1YTY A;  5EEG A;  3WGH A;  1OR7 A;  2OZU A;  5F64 A;  1FC3 A;  3SZT A;  2Z5U A;  2CG4 A;  2A6H F;  2O03 A;  4L5I A;  1JHF A;  1SD4 A;  3ZP5 A;  2L3D A;  2DU9 A;  3KZZ A;  2XRN A;  4WXC A;  4PDK A;  4PCQ A;  4KIF A;  3WE2 A;  3WU1 B;  2CO5 A;  5EEH A;  3LFK A;  3MCZ A;  4N9H A;  4P5O A;  2FNP A;  5CVI A;  1W7P D;  3TOB A;  4ETS A;  1QBJ A;  4O5V A;  1FBS A;  2R3S A;  3K1N A;  4HDU A;  1WSU A;  3HRT A;  2P7C B;  1C0W A;  2ISY A;  1R1U A;  3M1E A;  2D1V A;  2ZNZ A;  1TLH B;  3DP7 A;  4EM0 B;  3TDZ C;  2M5W A;  1RZ4 A;  4A0Y A;  2GIV A;  1K79 A;  2PEX A;  3E3V A;  2EA2 A;  4G9Y A;  3T8T A;  4IHS A;  1REP C;  2OQR A;  2DK5 A;  1R23 A;  4QWQ A;  1HQC A;  1XSV A;  5E18 F;  3F72 A;  3DXJ F;  1ODD A; 
#chains in the Genus database with same CATH topology
 5FFX A;  1VQ4 I;  4HNT A;  2BVL A;  2E2J J;  2E34 A;  3K69 A;  1MIJ A;  5K1Y A;  3HUG B;  3PNV A;  3ISP A;  3UNG C;  4CA0 A;  2E1M C;  2VKD A;  1OYY A;  1X1B A;  2EIM H;  1YJW I;  4HEA 2;  4BAC A;  1ON1 A;  2V1N A;  5B3S H;  3WTT C;  1HKS A;  3DLA A;  3GTM J;  2FNA A;  5M3F J;  4A6E A;  3RI4 A;  2QF7 A;  4QTR A;  1Y8R B;  1YX3 A;  2KZG A;  4E7I A;  2VOD A;  3D5S C;  2X1D A;  1QZZ A;  3S93 A;  5AON A;  2HQA A;  3OWT A;  4E7Z A;  2LKP A;  1RC9 A;  5CLS A;  4KJZ A;  1ZGA A;  1YFH A;  2X48 A;  5F6F A;  4UVC A;  1XMA A;  1LKX A;  2LBF B;  1LEA A;  4U0V A;  1R00 A;  1GXQ A;  2BOL A;  2L4M A;  3FBN B;  1ETW A;  3D0S A;  3BPV A;  5FRO A;  2KIU A;  4E4H A;  4RS8 A;  1B4A A;  3C3W A;  1ONV A;  3EDP A;  2JA8 J;  3A03 A;  1EH7 A;  4XSZ F;  2LG4 A;  3WU0 A;  4CO8 A;  4AIK A;  2EIN H;  3CTA A;  3FHN A;  1IAW A;  2NOJ B;  3EPZ A;  2YU9 J;  4A3K J;  3G1M A;  4JX5 A;  3H5A A;  1Z3Y A;  1Z7L A;  3E5U A;  4FIS A;  3DU5 A;  1I1S A;  4BS9 A;  1LNW A;  2WV0 A;  1XMK A;  1WJB A;  3S3M A;  4MGR A;  2JN6 A;  3MEX A;  3M1C A;  3HG9 A;  2IGK A;  1O57 A;  5GPA A;  1UHS A;  1XGS A;  3JR9 A;  4L5J A;  2OC6 A;  3H0G J;  4DGW B;  2ZSH B;  2R7F A;  4BY7 J;  2VT2 A;  1IRF A;  4IHT A;  3D1N I;  4OAY A;  1LDJ A;  1BC7 C;  1XS9 A;  1ITY A;  3F3X A;  2DMN A;  3F8B A;  3IP4 B;  1QPI A;  1ETX A;  2CUF A;  4GO1 A;  2IS6 A;  1IGN A;  2X6Y A;  3WOD F;  4O3M A;  2ZKZ A;  1OCP A;  2KRF A;  2XAJ A;  4HF0 A;  4C2M J;  1I6H J;  4XNF A;  5F0C A;  2EV6 A;  4XOR A;  4LJZ F;  5LRS A;  3FZV A;  3C2H A;  2GM4 A;  3WG9 A;  4XK4 A;  3SFI A;  5GTH C;  1OQY A;  3ZGK A;  2WAD A;  3QYF A;  4NUB A;  3CO6 C;  1H89 C;  2OTJ I;  1TQP A;  3J80 Z;  1H0M A;  3DPT A;  3BR5 A;  2W00 A;  1PP7 U;  2HQ5 A;  1XDS A;  5K5O A;  3I54 A;  1IG7 A;  4PK4 A;  3HUG A;  5J3L A;  1BOA A;  4DYR A;  5DS9 A;  3GUD A;  3MAJ A;  2NVT J;  2L9S A;  1FPQ A;  3PJR A;  1XDU A;  1XGM A;  2XRL A;  4Y15 A;  2GA2 A;  4GGG A;  4U0W A;  2VKH A;  1BBY A;  2OF7 A;  1WKM A;  3A0H C;  1EH8 A;  2M7A A;  3J7Y J;  2ZNY A;  4M6V A;  1HDD C;  4KIG A;  1FOK A;  1OCT C;  2XPW A;  4BJ6 C;  3BT9 A;  2E1O A;  4RB1 A;  3V4G A;  3BP8 A;  2DFF A;  1K78 B;  3IH4 A;  3RQI A;  2D1H A;  4BXU A;  1X3Z B;  1V55 H;  1SVO A;  3JAM Z;  2OCC H;  2F48 A;  2XSD C;  4HAM A;  1TWG J;  2FJ1 A;  3VPR A;  3RYR A;  2PI0 A;  2MFZ A;  4RM3 A;  1WH7 A;  2ZXI A;  3ABK H;  2CRG A;  4DQ2 A;  3FXQ A;  3IL2 A;  2K9Q A;  2K4B A;  4DNC A;  3W6K B;  1BR1 A;  4G8X A;  2DQR A;  2N8G A;  1MGT A;  1SFX A;  1CQT A;  2YUS A;  3FIW A;  2BHY A;  3F8M A;  1S72 I;  3ABT A;  4XOP A;  1FOW A;  4HLY A;  4RLF A;  3ZQH A;  3H3Z A;  3GFM A;  2DTZ A;  3DEE A;  2ZC2 A;  2Y9Z A;  2M87 A;  5BMZ A;  2NVX J;  5EF6 A;  3GZ5 A;  3ZMU A;  3VWB A;  2OAZ A;  1BI3 A;  4LG0 B;  1ZR4 A;  4Q4Z F;  2V6E A;  1I50 J;  2M8E A;  2EH3 A;  3KX2 A;  5E1W A;  1U3E M;  3DEU A;  2F5D A;  2DA2 A;  3OMY A;  2VBZ A;  3R61 A;  3DBR B;  3BR6 A;  1XC5 A;  3K4B A;  4D5C A;  1ETY A;  2VE9 A;  4UXN A;  4A6D A;  3BWG A;  1JKO C;  4BQQ A;  3BG6 A;  3MKY B;  3IUO A;  4CGZ A;  2CQN A;  4CCJ A;  5DCM B;  1VQ5 I;  3LSH A;  3DPL C;  4B4C A;  1SEU A;  5FKL A;  3H3U A;  3JW4 A;  1UEL B;  2MH9 A;  3PSI A;  4FE4 A;  3E6M A;  3E6B A;  3QOP A;  4HA8 A;  4I09 A;  3HOW J;  2XKP A;  2V7F A;  1BC8 C;  4CYD A;  3BG5 A;  2E7W A;  4H0E A;  4FTH A;  1F36 A;  2O3F A;  4M72 A;  3GEZ A;  3MWM A;  1HSJ A;  2F6C A;  4HYE A;  2A6T A;  5DUK A;  3GTL J;  1E3H A;  4DBR A;  2XGD A;  1FWZ A;  1W5S A;  2GA1 A;  3I71 A;  3BTI A;  3LST A;  3N05 A;  1TQI A;  2GIZ A;  3OL4 A;  4HX8 A;  4B3A A;  1U8B A;  2ZFW A;  2KHM A;  5CVJ A;  3JRI A;  3KE2 A;  1DQU A;  3R4K A;  3GFI A;  4RAY A;  1J9I A;  2NNN A;  5J1U A;  1R1T A;  1DUX C;  5KVR A;  3BDD A;  3VYU B;  2K9L A;  4E6K G;  2RQP A;  4KYW A;  4L0Y B;  1UAA A;  4CYC A;  3ZOB A;  3CCE I;  3L9F A;  1RET A;  2TDX A;  5KHD A;  1ETO A;  2XPU A;  2FOK A;  3KP6 A;  3B6C A;  2L7Z A;  3H9J A;  4NB5 A;  3L2W A;  2EA4 A;  2O8K A;  4KIS A;  1ZH5 A;  2Y0S N;  1TNT A;  4KNY A;  2DI3 A;  4M6Y A;  3RQ4 A;  5JI6 A;  3GVA A;  5DTD A;  3WTW C;  1TWF J;  3KEQ A;  3A4C A;  3PQK A;  1TNS A;  2RNJ A;  3PL8 A;  2DA1 A;  4DJA A;  5J47 A;  3G6E I;  2Z33 A;  2CV1 A;  2JT1 A;  3JRA A;  4EJU A;  1QHH D;  3MMY B;  4AWX B;  1P9Q C;  1I5Z A;  4A93 J;  2DBB A;  2ELJ A;  3BCB A;  3JAM K;  3ERM A;  3GBG A;  4KDP A;  3K6G A;  3BZC A;  3RSN A;  2R7D A;  3WGI A;  3OYB A;  1LFU P;  2AQE A;  1O3T A;  3H9G A;  3SHF A;  2W82 A;  1AHD P;  3G73 A;  2R7Q A;  4F3Q A;  3BCA A;  5D5V B;  2ZJ2 A;  4UNO A;  4IXA A;  4BE2 A;  4LG0 A;  2Z3Y A;  5JR3 A;  1FOY A;  2P0W A;  1LFP A;  3DQV C;  3L2V A;  1P6R A;  2I8D A;  2L7M P;  3HB9 A;  2O0Y A;  4B8X A;  5F0H A;  4KUM A;  2GWR A;  4XRM A;  2VOP A;  3RPU D;  1BIB A;  1ENH A;  4XMY A;  2JPC A;  2WAE A;  4FHT A;  4R8H A;  5FD6 A;  3HSE A;  4HOB A;  1NTC A;  4CH7 A;  3S3N A;  2ISZ A;  4U7B A;  3L2Q A;  4IZZ A;  4TV7 A;  2FQ3 A;  1V5G A;  3M07 A;  1JUP A;  4XOT A;  5CJ9 A;  2VON A;  1DP7 P;  1JJ8 C;  5DCM A;  1G3W A;  1I1G A;  2V1U A;  1WQ2 A;  5KNL A;  4PJM A;  2IJL A;  2X85 A;  1ERD A;  1Z6T A;  1TZL A;  3GTQ J;  3OR1 C;  1IXS B;  4KFC A;  2XC7 A;  4NC7 A;  3N97 A;  4M3D A;  5GP9 A;  4BKX A;  2E36 A;  4UUS B;  2O6G E;  1QO0 D;  4A5M A;  4Y17 A;  3L7W A;  2LKS A;  4NDL A;  3HM5 A;  3RZD J;  2LTP A;  3OOU A;  2M45 A;  3VYS B;  1MH4 A;  4U88 A;  1ZRF A;  5H2F C;  3ZMZ A;  4N4O B;  1YIJ I;  4Q47 A;  1WJD A;  1Z0X A;  4HQM A;  4RGR A;  1Y1V J;  3HGG A;  2FE3 A;  2VQL A;  3CDL A;  2FBI A;  3FX3 A;  1IC8 A;  1X2N A;  2KP6 A;  4LB6 B;  2R92 J;  3SQN A;  2DFI A;  4CDG A;  2DA5 A;  4LK0 F;  1YS6 A;  2BHZ A;  5EEA A;  3F22 A;  4Z6Y A;  3CP8 A;  3HSR A;  2V9V A;  4L9J A;  3LSI A;  4X1E A;  4B3X A;  5J8F A;  3AAF A;  1HST A;  3QYB A;  2A05 A;  1G3S A;  2IGN A;  2BYV E;  1RKT A;  3GTO J;  1EH6 A;  4XLC A;  2PQ8 A;  1YIO A;  2E7X A;  2H8W A;  4HNU A;  5IT9 Z;  2X6X A;  2HPI A;  4AIJ A;  1Z91 A;  4A3G J;  2DOF A;  2R7U A;  1XB4 A;  4YIF A;  2PLY A;  2BVM A;  2L7K A;  5K5Q A;  1LDD A;  3QWL A;  1R58 A;  1WPK A;  5ICF A;  5IP7 J;  1G6N A;  4K2E A;  2ZXH A;  2FBK A;  3CCL I;  1YW8 A;  2IP2 A;  3UKG A;  1MKM A;  3EUH C;  3LL7 A;  4BUP A;  2CU7 A;  4GCV A;  2VI6 A;  1IXC A;  4BHP A;  4MNU A;  4BNC A;  1FZP B;  5HDG A;  1YJ9 I;  1R5H A;  3JSO A;  5E3L A;  1J0R A;  3AG4 H;  2JA5 J;  1YE9 A;  2LY9 A;  4F7Z A;  3OIO A;  1VQ6 I;  2VT3 A;  2V1D A;  1I3A A;  4EJT A;  2M0C A;  2Y0M A;  4Y4R A;  4YFK F;  1MJ9 A;  2DDA A;  2L2O A;  5FKN A;  5HNH A;  3Q5F A;  2QQ9 A;  3LAP A;  1DDN A;  3OV8 A;  3M3Y J;  1USS A;  2K9N A;  3C7J A;  4D0P A;  2PN6 A;  4WXH A;  3HL2 A;  1HW5 A;  1OMI A;  2NOG A;  1K7A A;  1MMN A;  1OYW A;  2WTE A;  3SYT A;  5HLG A;  4EMS A;  4HST A;  2DO7 A;  1A04 A;  1XPX A;  3NEU A;  1GVD A;  2VOO A;  1HOM A;  5ILS A;  1JTX A;  3FXM A;  1RUN A;  3HRS A;  3V8K A;  4UUS A;  1E0E A;  5HDN A;  3RTR A;  5CVU A;  2HWV A;  1W7P B;  2LOO A;  1B8I B;  2X0L A;  3ZN1 A;  2H6C A;  1JT6 A;  5E3O A;  2PBI A;  4AID A;  2RV8 A;  1NG6 A;  3B73 A;  2OPT A;  4RB0 A;  3HOU J;  1YQA A;  4AUX A;  4MEX F;  4EGZ A;  6PAX A;  3K70 C;  2WAQ N;  3I59 B;  3SDG A;  2QSF X;  5EYR A;  3VYR B;  5JHF A;  3CDH A;  3S1M J;  2ZO4 A;  4RGU A;  1ULY A;  4J19 A;  3KLO A;  4W97 A;  3NAU A;  4ZJZ A;  1S8N A;  2E19 A;  1BN5 A;  2OA4 A;  2ESH A;  4FE7 A;  4BQO A;  4RGX A;  4IOC F;  2VE8 A;  1AOY A;  4C2U A;  1T98 A;  3WTU C;  2O7O A;  3ZRG A;  1VQL I;  1R36 A;  3O8H A;  3R6S A;  1FSH A;  4HG2 A;  1IUF A;  1DGW Y;  1Q1H A;  5DD4 A;  4XON A;  1YHQ I;  4XRS G;  4KN4 X;  5EGO A;  4LG3 A;  2EIK H;  4M9S A;  5F08 A;  1FLI A;  4U0Y A;  4M3B A;  1R5G A;  2ZXW H;  4N9I A;  5K7H A;  3LA7 A;  4KA4 A;  4OIP F;  4KT6 A;  3CJR B;  2XAG A;  4IF4 A;  4A69 C;  4JOM A;  2Y31 A;  1CGP A;  1IV8 A;  3CDI A;  1RIO H;  2R7O A;  4UB6 C;  1Z67 A;  2LP0 A;  4JP0 A;  2YX7 A;  2H1L A;  1NH3 A;  4PFO A;  2R7R A;  5DEQ A;  1SFO J;  1KA8 A;  1F4K A;  2WY8 Q;  1A35 A;  1IUY A;  2ID3 A;  1YLF A;  1PYV A;  5L3D A;  1Y6I A;  5FRN A;  2HFH A;  3EYI A;  2FA5 A;  2PMU A;  1P92 A;  3JSP A;  2GAU A;  2V26 A;  3L2U A;  3S32 A;  4MQV A;  4I6Z A;  2P81 A;  5IP9 J;  3JTG A;  2IAI A;  4CHU A;  3DKX A;  2FXA A;  2LK2 A;  2P6T A;  2D5V A;  1VFC A;  3F21 A;  3FM3 A;  4HNV A;  2J5O A;  4AVZ A;  2XGC A;  2ESN A;  2BXZ A;  4JQF A;  4EJW A;  5IYD J;  4G94 A;  2DYS H;  5BOX A;  1ZGW A;  1GUU A;  2WB1 A;  3BQZ A;  5F0F A;  4UB8 C;  1JTY A;  4HSR A;  5HS7 A;  5D4R A;  4IEJ A;  5KK1 A;  4I7H A;  3U9G A;  3F8F A;  2ELK A;  3BTC A;  2ZFU A;  2KIS A;  1SD6 A;  4CZC A;  2IVM A;  2V9K A;  2EZK A;  3VDX A;  4X6A J;  3FKI J;  1HF0 A;  1VQ9 I;  3OYE A;  1V5E A;  4A3J J;  3F8C A;  1N75 A;  1WI9 A;  1S7O A;  4M6X A;  3CF5 F;  2GXG A;  2JRM A;  1IRZ A;  2VL8 A;  3H9Q A;  3MVP A;  4HW0 A;  2ADU A;  4MEY F;  1W7P A;  5E1Z B;  1B8I A;  4BH9 A;  3TQN A;  4ASN A;  3GTP J;  2JRT A;  2OBP A;  4GYI A;  4FAS D;  3FXJ A;  5LGN A;  4P1W A;  1BR2 A;  3I59 A;  1MBH A;  3IC7 A;  3AG2 H;  3AFH A;  4IPA A;  2E35 A;  3CQZ J;  3CLO A;  3H35 A;  2FU4 A;  4MO7 A;  5LD2 C;  4DZJ A;  1TP4 A;  5ED4 A;  1HLV A;  1U8R A;  4KIB A;  2XF6 A;  3E6C C;  1IN7 A;  1R1V A;  1T2K A;  2IPQ X;  2O9L A;  1WZ2 A;  3AL0 B;  2JJ7 A;  3RDI A;  5D5X B;  1H88 C;  2LSO A;  2BGC A;  3TBI A;  1L0O C;  3QP5 A;  4QLC U;  1OLT A;  1KU3 A;  1QZY A;  3I55 I;  2PFB A;  3K4C A;  2KQR A;  4HV5 A;  1ZG3 A;  2COB A;  3Q0W A;  5E8I A;  1IN5 A;  2E2H J;  1WJ5 A;  2FBH A;  3G3Z A;  3K9T A;  4WX9 A;  1MMS A;  2E5N A;  2G7H A;  2HI3 A;  3SEQ A;  1FBU A;  2KIF A;  4Q48 A;  2CYY A;  4ESB A;  5J1R A;  1KZH A;  1OKR A;  4I0A A;  1HDP A;  3S16 J;  4H4K C;  2RRE A;  3DCF A;  3H3V K;  2EFP A;  2WBM A;  3GW2 A;  4I02 A;  1JKR C;  4RLQ A;  4LIV A;  2EFQ A;  4RGS A;  1JGG A;  2NNY A;  1BW6 A;  1QZE A;  2OTL I;  3S17 J;  4HDV A;  3FXO A;  2LF7 A;  1KYW A;  1J75 A;  5LGT A;  5C3E J;  4IX7 A;  4OIN F;  3LSK A;  3PO3 J;  1OJL A;  3LAJ A;  5K7F A;  3BJA A;  4II2 A;  1VQO I;  5CQE A;  1JUM A;  3OYF A;  1QPM A;  1W5T A;  3TW6 A;  4D7N A;  3K0L A;  4MFE A;  2W7N A;  3A0B C;  2HOA A;  2KIM A;  3OYI A;  3S1N J;  2K40 A;  1J5Y A;  1IN4 A;  3R60 A;  3HYI A;  4XKW A;  2EZH A;  1ZR2 A;  2JSC A;  2EZL A;  2RDP A;  3PSF A;  2XHK A;  3W2V A;  1ZRE A;  4FX4 A;  4WXD A;  1GDT A;  3IWF A;  4L9V A;  4ZH4 F;  4S04 A;  4ON0 A;  5IOY A;  2Z1D A;  3MKZ A;  2A5Y B;  2IA2 A;  3KYL A;  3WTS C;  2CUE A;  3S2D J;  5CKT A;  4OMY A;  3M9A A;  2YX4 A;  1FNN A;  1UJ8 A;  2IXS A;  2KIQ A;  3VEP A;  5FB2 A;  1TW2 A;  1J7K A;  2NS0 A;  3OIP A;  4MTE A;  3ZQ7 A;  4EV0 A;  4YRV A;  3VB2 A;  1G8X A;  3G4S I;  1N78 A;  4XN0 A;  5A2Q Z;  1AU7 A;  1KU2 A;  1FEX A;  1QRY A;  1GV5 A;  2FEZ A;  2MLK A;  3KPH A;  2DMP A;  1R49 A;  1HKT A;  4IHV A;  2Z99 A;  1KQ9 A;  3I4N J;  2KKO A;  2L9R A;  1T08 B;  2JQ7 A;  1U0J A;  1J59 A;  2VPR A;  4BE0 A;  2KRC A;  3AKZ A;  3J7A O;  4DW6 A;  4CCN A;  5FLM J;  3T8R A;  2JZY A;  5LHI A;  4NHJ A;  4XM3 A;  1UG0 A;  4KT5 C;  3CC4 I;  2W84 A;  3V7S A;  4Q5S F;  1NG7 A;  3E1S A;  2BV6 A;  1LB2 A;  2GXB A;  2MGQ A;  5AIQ A;  3I5U A;  1FX7 A;  4IHX A;  3JRB A;  4OAZ A;  3BZK A;  1BIA A;  2L02 A;  2XB0 X;  3KLN A;  4M74 A;  5B66 C;  1FTZ A;  3FMS A;  1ZHF A;  5FKK A;  1OYI A;  1OPC A;  4L9N A;  2CQX A;  4RB2 C;  2BE5 F;  2PG4 A;  4XKC A;  2CH0 A;  1XN7 A;  3BQY A;  2IA0 A;  1MD0 A;  1P7J A;  3BLY A;  2HOT A;  3CMY A;  5K5R A;  3U1D A;  3F0C A;  1H9T A;  3IRQ A;  1AKH B;  3OYN A;  3OY9 A;  1Z7U A;  1Q1V A;  1MZB A;  2HZD A;  4PSW A;  3COA C;  2UZK A;  4KMF A;  2LRE A;  2QEX I;  1FYL A;  1B6A A;  4XKV A;  4OWR B;  4LLN A;  1HCR A;  5JVG F;  5FLX Z;  2LLK A;  3V42 A;  1S3J A;  3GX4 X;  2HXI A;  4E7L A;  3FXL A;  1Y39 A;  1FP2 A;  1JKP C;  4LD5 A;  3CJN A;  3ROU A;  3ZMT A;  4PGG A;  2V6C A;  1VQ7 I;  2R7X A;  3FMQ A;  3CUQ B;  3ZQF A;  3ELK A;  2F5V A;  3CES A;  3DEW A;  4XSX F;  4A3B J;  3QOE A;  4A3F J;  5EZG A;  4CXF A;  4P55 A;  1JUS A;  2O8X A;  1B1B A;  2P5K A;  2LBF A;  4IRH A;  3VFZ A;  3FK6 A;  1R6R A;  4F55 A;  4XLN F;  4FQG A;  3T0Y A;  5HS9 A;  2CFO A;  1WVR A;  2STW A;  2XUB A;  2BY0 A;  1ZAR A;  2M8G X;  2XAH A;  4GXO A;  3MZ8 A;  2L54 A;  4PGH A;  2XIG A;  4RB3 C;  1QA6 A;  5HDK A;  1UHM A;  1J09 A;  1UST A;  4CUG A;  3KCC A;  1UCR A;  3WTX C;  2HS5 A;  2P7V B;  5GAH J;  2A68 F;  5FKO A;  3N4M A;  3QPT A;  5IP6 A;  1KQ8 A;  3OR2 C;  1X4O A;  1O7L A;  1PVE A;  4OMZ A;  4DZP A;  2OCE A;  4N4N B;  4RM2 A;  3PUF A;  1IF1 A;  2ECB A;  2RN7 A;  4WWC A;  4G7H F;  4DIQ A;  2K02 A;  3D5L A;  2FOW A;  1TL8 A;  3LA3 A;  1F5T A;  2XSJ C;  2GOM A;  2XGE A;  4LLG F;  2VIX A;  2AXT C;  2PMH A;  2K3F A;  1MSE C;  2LY2 A;  2P5L C;  5DUI A;  4HZF A;  2NS7 A;  5J1Y A;  1TWH J;  1JT0 A;  2ACJ A;  1BR4 A;  2EV0 A;  2DT7 B;  4P9F A;  3E6D A;  5E20 A;  1KU9 A;  1MJB A;  3KZY A;  1ZLK A;  4ZYG A;  1E2X A;  1D5Y A;  2IEK A;  1PP8 F;  1S29 A;  2DQL A;  2DA7 A;  4NQW B;  2FRH A;  1G3Y A;  2LYC A;  2Y0S A;  4HF1 A;  2I5U A;  5ICE A;  3AL0 C;  4GDF A;  2E71 A;  3TMO A;  2XB5 A;  3A02 A;  4JYK A;  4EJO A;  1TT0 A;  2M2E A;  1F1Z A;  1O7F A;  1QNT A;  2H27 A;  1AKH A;  3J80 K;  4KIC A;  2I10 A;  5DM6 F;  1VQK I;  3F8N A;  3L00 A;  1JKQ C;  1APL C;  1AWC A;  1H9G A;  3ZMV A;  2B0L A;  1KGS A;  4HLX A;  2ZME C;  1UG2 A;  3HBL A;  2JPB A;  1KON A;  3CZ6 A;  4I98 B;  2O61 A;  1ZYR F;  2R7W A;  4HQE A;  3DPU A;  3EUA A;  3KEO A;  1ZG1 A;  3HJE A;  4U7D A;  3CUQ A;  5FLX K;  2DFE A;  1VF9 A;  2QM3 A;  4BEH B;  2DK8 A;  3S14 J;  3BJO A;  2OZ6 A;  5FD5 A;  1K78 A;  1ZKG A;  3L2R A;  4MIM A;  2BEO A;  2ETH A;  1ETQ A;  1OCZ H;  1TW3 A;  4PJJ A;  2R4G A;  2W85 A;  2X4H A;  2EIJ H;  1B59 A;  1O4X A;  2CSO A;  1IXR C;  1ZLJ A;  3OYM A;  2M9H A;  1VND A;  3ML6 A;  4QIW N;  1LUJ B;  3SFZ A;  5GAG J;  3EUH A;  4ENK A;  2VXZ A;  1MBG A;  2GOX B;  4BE1 A;  3IAS 2;  1AA7 A;  3QPL A;  1U9O A;  3IAM 2;  3RIR A;  2D45 A;  2MLG A;  1U5T B;  4IRG A;  5D8L B;  4WK8 F;  2QVO A;  2W1O A;  1SAU A;  4BJ5 C;  4ZTF A;  1MMG A;  1R4N B;  2COM A;  3ZR8 X;  5H6R A;  5BPD A;  5L3B A;  4G7Z F;  4M3F A;  1D0X A;  2NVU B;  1ZEL A;  3BOQ A;  2LDU A;  3HSF A;  1LDK B;  2F4M B;  1BA5 A;  2MC3 A;  5FKM A;  1DU6 A;  1Z77 A;  4IHY A;  5B1B H;  1WH5 A;  1K4T A;  2F5E A;  3ABU A;  2QZ8 A;  3VOE A;  4AYB N;  3IKV A;  2DOA A;  2QBY B;  3IKT A;  1VTN C;  3KP5 A;  2DJN A;  1JXS A;  5IYC J;  1U78 A;  1K6O A;  2KZV A;  1TWC J;  3WTZ A;  2ZCW A;  4CCK A;  2HOE A;  2MBF A;  4ENJ A;  1YIT I;  4AM3 A;  3LSM A;  2HR3 A;  4Y13 A;  4ZDL A;  4NQW A;  5J40 A;  3K4M A;  2K85 A;  2GQQ A;  2JSP A;  2YR2 A;  1YX5 A;  2BZT A;  3RPU A;  3HEF A;  2KL4 A;  3DFG A;  2G7U A;  1IW7 F;  3G2B A;  3KIO A;  5GTI C;  2MA3 A;  3ASO H;  3GO5 A;  1XSD A;  1CF7 B;  1PUE E;  1D5V A;  4JK1 X;  2FF4 A;  3SZG A;  3WGG A;  2AS5 F;  3DLL F;  2X1E A;  4EQQ A;  2GBY A;  5D8K B;  2HU9 A;  2EFN A;  1X3W B;  1WGX A;  3KFW X;  1JJ6 C;  5AIP A;  2HDW A;  3F9K A;  3I3L A;  3BRO A;  2ME6 A;  5J6X A;  4G6Q A;  3IH3 A;  2HQN A;  2QSH X;  3HKZ N;  4BEH A;  3M7G A;  1ZN2 A;  2UUZ A;  3V7C A;  3S3O A;  3GFJ A;  2M4G A;  1SAX A;  3HHG A;  1E3P A;  3CUQ C;  3TP3 A;  4BHB A;  3QPH A;  3KEY A;  3OYA A;  4A3D J;  2V79 A;  1A6Q A;  2H09 A;  4EAT A;  3BPX A;  1POG A;  3E0J B;  1E3O C;  2A69 F;  2JTV A;  1Z1D A;  2ZB9 A;  2KPM A;  1BI1 A;  4HBL A;  2OUM A;  5DDG A;  2X6W A;  4ESJ A;  3L2C A;  4ITV A;  2QA4 I;  3KP4 A;  2X9D A;  1GVJ A;  4V2F A;  4YG2 F;  1NK3 P;  2RVC A;  3P9C A;  3K4L A;  4BDZ A;  1XCB A;  2RAE A;  2QQA A;  3C18 A;  1U5T A;  2EK5 A;  3RPQ A;  3BR3 A;  3BZ6 A;  1UZC A;  4A3I J;  2RQQ A;  3JTH A;  2QWW A;  5F04 A;  2JA2 A;  4NBQ A;  3BC8 A;  4A3L J;  2P6S A;  3T5X A;  3TO7 A;  2EBI A;  2CWE A;  2ME0 A;  1ZQ3 P;  1N25 A;  1BL0 A;  3TO9 A;  1STZ A;  1YW9 A;  1Z05 A;  4WF2 A;  1X19 A;  1IJW C;  3I0T A;  4IVN A;  1HW1 A;  4ZYE A;  3O2P E;  1IO2 A;  2WAQ A;  1TTY A;  1TQM A;  4LOC A;  5H20 A;  2MW8 A;  4BQN A;  4F91 B;  3LSP A;  5D4S A;  1PUF B;  5HLH A;  2QBY A;  1S7A A;  3PUB A;  1IDY A;  3ZQQ A;  2VBX A;  4V2G A;  2L01 A;  1RNL A;  2MAB A;  2PX9 A;  4RA2 A;  1WJF A;  2ICW G;  1WI3 A;  2YU3 A;  3V7R A;  4IL6 C;  1D1B A;  4PUS A;  3OYH A;  2R5Y B;  3M8F A;  5HLI A;  3OL3 A;  3GLX A;  4KN7 X;  1QVT A;  2LVS A;  3KP3 A;  2QKL B;  4ZZL A;  3OS1 A;  3BJ6 A;  1R22 A;  5IY5 H;  1JHH A;  3DTI A;  2DT5 A;  4Y7N J;  3KP2 A;  2M4K A;  2VQC A;  1WCM J;  5BPI A;  1FYK A;  1CF7 A;  1ZGJ A;  2DMT A;  3OIQ A;  1U6G A;  5B5E C;  1D8K A;  3OYD A;  3H5N A;  4BQA A;  5JFR A;  2Z16 A;  1I3Q J;  2PMZ N;  3MFK A;  5HVQ C;  1Y1W J;  2B9S A;  1RR7 A;  4Y33 A;  2K9S A;  4CCL A;  4KIT B;  1S7E A;  2XRO A;  2DOD A;  3HHH A;  1VQN I;  3LSJ A;  4A12 A;  2H94 A;  2DJI A;  2XDV A;  2YSR A;  3OSG A;  4XL9 A;  3G71 I;  2DA6 A;  2H1K A;  2BY2 A;  1B9N A;  3B6A A;  3W2A A;  3Q0V A;  2LD5 A;  1R4M B;  2W4S A;  3MKW B;  1IRG A;  2QGU A;  1U9N A;  5D5W B;  1SMY F;  4EVI A;  3Q3S A;  5IPA A;  2A6E F;  1SD7 A;  3WTV C;  3FM5 A;  4JX4 A;  4C30 A;  2EFO A;  4NC6 A;  3ECH A;  1MNM C;  4PJ0 C;  2Y48 A;  2LFB A;  3RZO J;  1Y56 A;  3PIP F;  2OV7 A;  3RKY A;  5IT9 K;  3OYK A;  1LVA A;  3HRM A;  3O3K A;  2FQ4 A;  3C1D A;  5CPR B;  2HPM A;  3CUO A;  2MD0 A;  5LEJ A;  4XQF A;  5HOO A;  4FX0 A;  2MD5 A;  2CGP A;  1XD7 A;  2HTJ A;  2M3A A;  1SAN A;  3TO6 A;  3OSF A;  2OQG A;  3CP2 A;  4B09 A;  2Y30 A;  4V19 K;  3GCM A;  5M5W J;  5CQG A;  1EKE A;  5JLX A;  1U5T C;  3CME I;  3CO7 C;  5HS8 A;  3GME A;  5M5X J;  3HZJ A;  4HV6 A;  3H5R A;  5TGT A;  3ZQL A;  1KU7 A;  3DTE A;  1RPW A;  5HLT A;  4MFD A;  1MW7 A;  5EG0 B;  3FHZ A;  1ZTR A;  2K7L A;  1R5I D;  1MND A;  2IGM A;  3GF2 A;  1UFM A;  2DYR H;  5L3G A;  3I4M J;  1YYV A;  2CW0 F;  2HYG D;  3WHC A;  1S5L C;  1BI2 A;  2J5P A;  3DTK A;  1PUF A;  3L09 A;  4E7S A;  5IT3 A;  3D5R C;  2JK3 A;  2CFX A;  2CQQ A;  2E60 A;  1T38 A;  2QQ8 A;  1MMD A;  1EV7 A;  3FXR A;  1QQI A;  3Q9S A;  1LPQ A;  2L0K A;  5DCF A;  5D5U B;  3K10 A;  2R5Y A;  3HOX J;  1ETK A;  1V54 H;  3B02 A;  1G3T A;  1X2M A;  2B63 J;  2BY3 A;  2BXY A;  3RKW A;  3FDY A;  3NRV A;  2NVY J;  5ILU A;  4EM1 A;  1FMV A;  4L5E A;  1YS7 A;  3JCU C;  3AG3 H;  4WCG A;  5C44 J;  2K3P A;  2IT0 A;  3V8L A;  3P9I A;  1WFX A;  2EIL H;  3GYH X;  4IJA A;  2CW7 A;  1SC7 A;  1RKW A;  3S15 J;  1F43 A;  2DN0 A;  4ZTJ A;  2EWN A;  4F93 B;  2R7T A;  1W36 D;  1T56 A;  3H0D A;  4FET A;  1D0Y A;  3LQR A;  4J00 A;  2IRF G;  3HOY J;  3FF5 A;  2Y9Y A;  5CVR A;  5JVT A;  5EDN A;  1SFE A;  3REO A;  3MZH A;  3K4N A;  4DYC A;  3HPG A;  3M8E A;  2VXD A;  1UB9 A;  2Q8K A;  1O3S A;  4OIQ F;  4YIR X;  5IYB J;  4D5F A;  4I2O A;  3BG9 A;  1K6Y A;  4BBR J;  2DW4 A;  1B9M A;  2E1N A;  1MBF A;  3ZN0 A;  1RR8 C;  1YRN B;  2KJC A;  2Q0O A;  1S9H A;  2H6B A;  2MSY A;  3G1O A;  4LIT A;  3VOD A;  1LJ9 A;  1WJC A;  3R0A A;  1D3Y A;  1TBX A;  2VBY A;  2K4J A;  2XV4 S;  2DA4 A;  2MH2 A;  3S2W A;  2V9P A;  2ZME B;  3O6B B;  4B1R A;  3CCV I;  2VJJ A;  5FJ8 J;  4IKF A;  2KDZ A;  4Y3O A;  4IOA F;  2WC2 A;  3GFL A;  4I76 A;  2JA6 J;  3HOT A;  2ELH A;  3CD6 I;  4M3G A;  1HC8 A;  2Q1Z B;  3PFY A;  2HYJ A;  3CCM I;  5KCM A;  1HA8 A;  3U21 A;  3U1K A;  4D7M A;  3W2W A;  4B47 A;  1MNE A;  4BJT A;  2M0M A;  2HXO A;  3ULQ B;  2ZJP F;  3TOA A;  3OOP A;  2F2E A;  4S05 A;  3I4P A;  1VQ8 I;  2LKX A;  4UUT A;  1ZAO A;  2IS1 A;  1EF4 A;  3I58 A;  1MH3 A;  4YFN F;  3BTL A;  3W3C A;  4X0G A;  1OCO H;  5BS6 A;  3OYJ A;  3U2R A;  2V4J C;  2V1X A;  1ZRD A;  2M1B A;  2X6O A;  1OR7 C;  2DA3 A;  1IN8 A;  3CC7 I;  5EG0 A;  2UWM A;  1FYM A;  2HTS A;  4HRI A;  1P4W A;  1RRJ A;  3GTG J;  2W25 A;  2EQR A;  3QAH A;  3ABL H;  2DMQ A;  5F1R A;  2XF5 A;  3ABM H;  3H36 A;  5E17 F;  4II3 A;  1XCV A;  2VC1 A;  5GAE J;  5HOD A;  1H8A C;  5C4X J;  3HC7 A;  4BXX J;  2XVC A;  2ID6 A;  2UXN A;  1MDM B;  1HW2 A;  2DFH A;  4MHG A;  4RDU A;  3OYC A;  2L9N A;  3HTU A;  1JGS A;  4N0B A;  1FSE A;  1EJ9 A;  3RYP A;  2Y2Z A;  2XAU A;  3EET A;  4HPQ A;  3Q0U A;  1XGO A;  4BGD A;  2A07 F;  1E17 A;  4J01 A;  2EZI A;  4IO9 F;  3GXO A;  2VUM J;  3K2Z A;  3Q9V A;  2OJE D;  4P9U A;  1YOV B;  2KJB A;  4CCM A;  1RUO A;  2NVQ J;  1FBQ A;  2QUF A;  3E7L A;  3HIF A;  3QU3 A;  5BNG A;  2UXX A;  4C9Y A;  3IV5 A;  2DPU A;  4QPO A;  3SZP A;  4I01 A;  2OU2 A;  3LOC A;  4M9X A;  3EQL F;  4XR6 A;  1IV6 A;  4XLA A;  1G4D A;  2EJR A;  3HXL A;  3JRC A;  1SD5 A;  4ABZ A;  1ZK8 A;  1T6S A;  5D6F A;  3F6O A;  2VB6 A;  3ZMS A;  2FMY A;  1YRN A;  2VAS A;  2AO9 A;  4A0Z A;  1D8J A;  3HOZ J;  4B44 A;  1ZRC A;  1GLN A;  1U2W A;  3BR0 A;  4G6D A;  2HYF A;  2HGC A;  1XSX A;  4ENN A;  4XLF A;  1ACI A;  1FY7 A;  2ZME A;  3CJT B;  1Z21 A;  4C3I J;  1FTT A;  2A61 A;  4CIC A;  4U87 A;  1P2F A;  1W36 C;  4G6T B;  2F5F A;  3WG7 H;  3X2Q H;  3KYC B;  5E3N A;  4FT8 A;  1YW7 A;  3H1C A;  2DXI A;  2EB7 A;  3MKL A;  1RES A;  1A31 A;  2DAO A;  3FMR A;  5LLQ A;  2RKH A;  4XRS A;  1QVU A;  3QP6 A;  4LMY A;  1V5F A;  1BJZ A;  1X1D A;  4LLL A;  4XIC A;  1ORK A;  4A3E J;  1DP3 A;  3TL4 X;  1MBE A;  5DD8 A;  1DU0 A;  5LHG A;  4HF2 A;  1VQP I;  5DM7 F;  2JMW A;  2A3S A;  3PM1 A;  5D6E A;  4CYC B;  4LGW A;  2NYX A;  4EEF G;  4CZZ A;  2HVR A;  2XGX A;  4I99 C;  3LNQ A;  2FSW A;  2XPV A;  2WA0 A;  2VKV A;  2CQ7 A;  1F9N A;  5FLV A;  2F5C A;  2O5R A;  4MLO A;  1V3F A;  4G7O F;  2NRA C;  3J7A Y;  2DPD A;  1VZ0 A;  1T95 A;  1IZ1 A;  2GZW A;  2QYO A;  2HQR A;  5FFZ A;  1PDN C;  4DOZ A;  1FP1 D;  4L18 B;  3HDD A;  1NHA A;  4UV8 A;  1MDM A;  3KET A;  4IQ4 A;  2VN2 A;  2AXL A;  1FMW A;  5IOZ A;  1Z9C A;  2DLL A;  2HZT A;  2DMU A;  4G12 A;  4E7J A;  1YJN I;  2W57 A;  3ONQ A;  5F27 A;  4HX7 A;  1K83 J;  4M9Z A;  2L9V A;  2Y69 H;  4NC8 A;  1ON2 A;  3ERE D;  2CV0 A;  2EPF A;  5H6Q A;  1SFU A;  1J2X A;  3ZPL A;  2JUG A;  2AHQ A;  2DDB A;  5A2Q K;  3ZCO A;  1KYZ A;  3FXU A;  5ERI A;  3FIS A;  2JVH A;  1W1W E;  3RKQ A;  3MD2 A;  4MQ9 F;  2CW8 A;  4W1U A;  3JRD A;  3VSL A;  1A5J A;  3GWZ A;  4RBO A;  5ICC A;  3RJP A;  3P5J A;  3ASN H;  3KYD B;  3FXK A;  4FCY A;  4XKB A;  1Y0U A;  5TIS C;  4YFX F;  3WTY C;  1S6L A;  4B48 A;  4ESF A;  2B7E A;  2CQK A;  2ZXJ A;  5E1X A;  2VKE A;  4A0X A;  4ZZD A;  3GTJ J;  2RNG A;  3DF8 A;  4R79 A;  2VJI A;  3LSG A;  3LWF A;  5EZH A;  2NAZ A;  1JE8 A;  2EV5 A;  3W6J B;  4AD9 A;  4CSW A;  4D1Q A;  1XGN A;  2E2I J;  1OCC H;  3AG1 H;  2MYS A;  3S1R J;  4BHC A;  4RAZ A;  3K1M A;  3CCU I;  1LE8 B;  1YG2 A;  3CMM A;  4XBF A;  3QPS A;  5LGU A;  4IRI A;  2JA7 J;  2TRT A;  2EFW A;  4PZJ A;  3BG7 A;  3K2A A;  5J8C A;  2VQG A;  2QCO A;  1Z3X A;  2K9M A;  3HRU A;  4A3C J;  1X4P A;  4XLE A;  1A6I A;  2P8T A;  2PJP A;  2RC4 A;  2P4W A;  1BM9 A;  2ZJR F;  2LF8 A;  3S2H J;  2BW3 B;  1MSF C;  1SVM A;  1BJA A;  1KQ0 A;  3J81 Z;  4DYQ A;  5J4Y A;  1R7J A;  1O3R A;  1W5C C;  1I6X A;  1G2H A;  5GPC A;  1R71 A;  5ICG A;  2GLO A;  2XAS A;  1BOB A;  2RGV A;  1BI0 A;  4EGY A;  4ENM A;  1P7I A;  2K5C A;  1DGR M;  1SMT A;  4Z2Y A;  2XKO A;  2P5V A;  4LFU A;  4E70 A;  2HVS A;  4AVP A;  1G59 A;  4BXF A;  2LR8 A;  3PIO F;  3I53 A;  4EJV A;  1T0F A;  2FUG 2;  5L3C A;  4AYB A;  2W48 A;  2HKO A;  3GZN B;  3K4K A;  4KMU X;  5LRR A;  4QSH A;  5KAF C;  5M5Y J;  2IS2 A;  2Q2E B;  1UHW A;  2HKX A;  3BR1 A;  5JHU A;  4ZYA A;  2HVQ A;  3HTS B;  3F6V A;  1X1A A;  1HBX G;  1MJA A;  2A5W A;  3ZQG A;  1SVL A;  4M71 A;  3NWS A;  3E5X A;  5K7Z A;  1QGP A;  4XLP F;  5TRD A;  4P96 A;  3KZI C;  2CMP A;  1T39 A;  4MTD A;  1I27 A;  3P9K A;  2Y75 A;  3DBH B;  2DTR A;  4EM2 A;  1TWA J;  2UV1 A;  2HEO A;  2R7V A;  3SXY A;  5L3E A;  1BW5 A;  3MQ0 A;  3OS0 A;  4L0Z B;  2QEN A;  4YII A;  3DBL B;  1VQM I;  4CCO A;  3M4O J;  2IS4 A;  2L4A A;  2VBW A;  2MG4 A;  1WHU A;  2OD5 A;  3LSR A;  4BU2 A;  5ILV A;  4OOI A;  1X3U A;  2VQH A;  3EUK L;  3CJQ B;  1T33 A;  4GYG A;  1PJR A;  2BBY A;  4HX4 A;  4AIH A;  4B43 A;  3OS2 A;  3K70 D;  1ZG5 A;  2KLO A;  3HKZ A;  5L3F A;  4ZYH A;  4I0B A;  2R5Z B;  2LNB A;  3G1L A;  3S8P A;  4UVA A;  4UVB A;  3VSK A;  3FKJ A;  4XID A;  4UUV A;  3ZMD A;  4E7H A;  2LMD A;  3VYT B;  3P7N A;  3QYE A;  3IHU A;  3OYG A;  1TC3 C;  4M73 A;  3ZQC A;  1OCR H;  1LE8 A;  2ZJQ F;  4ZYD A;  2W24 A;  3M8J A;  5C4J J;  3NAR A;  1UMQ A;  4PFP A;  5BQT A;  3MZY A;  1L3L A;  4XRF A;  2VC0 A;  3WU2 C;  1WRJ A;  2XAQ A;  3C2G A;  2XAF A;  3E97 A;  1HXD A;  1W0U A;  3RCO A;  1LQ1 A;  5E3M A;  3K7A J;  4PJL A;  2R0Q C;  2CUJ A;  1WJE A;  5CYV A;  3S1Q J;  3CCR I;  2LRD A;  3NQO A;  3F23 A;  2KDO A;  2BW3 A;  3MN2 A;  2H8R A;  3IWZ A;  1XMX A;  4Y52 J;  4BL0 B;  5FO5 A;  2VJ4 A;  1RI7 A;  4A5N A;  2HDC A;  2Z9O A;  2DCE A;  1X1C A;  3IRR A;  3HOS A;  3GZ6 A;  2E1C A;  3J81 K;  1V4R A;  4BAY A;  2IBD A;  2ECC A;  2K27 A;  2E5Z A;  1TT5 B;  2IA1 A;  5EGO B;  1I39 A;  3QU6 A;  3ZQI A;  4AU7 A;  2C6Y A;  2WV1 A;  3LA2 A;  3A1Y A;  5E8G A;  2DOE A;  3BY6 A;  1GXP A;  1T0F C;  3GTK J;  1FIP A;  2E1M B;  3TGN A;  4OIR F;  4UV9 A;  2Q2E A;  3QQA A;  2STT A;  3J7Z I;  4ANJ A;  1IN6 A;  1N77 A;  2BY1 A;  3FBI B;  1FIA A;  4F52 A;  2JUC A;  3BG3 A;  2PJR B;  5LHH A;  2LC2 A;  4JBA A;  3TKY A;  3V8J A;  4M3E A;  3TW7 A;  2KFD A;  4XN3 A;  2CUZ A;  4JX6 A;  2PMZ A;  3LQQ A;  2CJJ A;  4PSX A;  3CF2 A;  5LEK A;  3LFU A;  1P4A A;  1K4S A;  3CCS I;  1EA3 A;  2IW5 A;  3ECO A;  2CV2 A;  4R1H A;  1D1C A;  1XX5 A;  3C2B A;  4UHT A;  5FGM A;  4AC0 A;  1FOX A;  5LBQ A;  3QOD A;  3PFI A;  3OYL A;  1B72 B;  4BDY A;  1O3Q A;  4LB5 A;  4L9T A;  2FX0 A;  5TJJ A;  1Y0N A;  3T1B A;  2D2W A;  4O6J A;  3K1P A;  2M30 A;  2WWY A;  2R5Z A;  3PO2 J;  2VLA A;  1D0Z A;  3A01 B;  4OIO F;  3W6V A;  2QSG X;  5HNF A;  5B1A H;  1WJA A;  4ZC3 A;  2LY1 A;  2DT6 A;  2WAF A;  1LEB A;  1DPR A;  3SDB A;  5J4V A;  2QLZ A;  1WWX A;  3CCJ I;  1FJL A;  2TCT A;  3PQJ A;  3I9V 2;  2LH9 A;  4RAG A;  3O8G A;  2MC4 A;  1K61 A;  4BYY A;  4A2U A;  4RMN A;  4LK1 F;  3PNY A;  5KAI C;  3E5Q A;  1A36 A;  4BY1 J;  2AQF A;  4OU0 A;  2NS8 A;  3I64 A;  2X51 A;  2ZBK A;  4A3M J;  3WE3 A;  5DYM A;  4F92 B;  3FWE A;  2KT0 A;  1MBK A;  2G9W A;  2K86 A;  3EYY A;  3TDU C;  4NNJ A;  4C3H J;  2JVG A;  2G0E A;  3RKX A;  4S0H B;  4C3J J;  4XLH A;  1HKQ A;  5CVV A;  3DV8 A;  2FML A;  1W4M A;  1X1P A;  1GHC A;  1X58 A;  4C2T A;  1XG1 A;  1NK2 P;  2YPR A;  1DPU A;  2HNH A;  1Z6R A;  1P4X A;  1FT9 A;  5DV5 A;  1VI0 A;  2QQB A;  3DKW A;  5GAD J;  3R0J A;  1IRX A;  1GT0 C;  2F4O B;  3KP7 A;  1YO5 C;  1D1A A;  1W0T A;  3H92 A;  2L5Q A;  3QRF F;  1YTY A;  5EEG A;  4IHW A;  3TED A;  3WGH A;  2XF7 A;  3BR2 A;  3HPH A;  1OR7 A;  4QPQ A;  2OZU A;  5F64 A;  1FC3 A;  3SZT A;  3JRG A;  2ZSI B;  2Z5U A;  3SJM A;  2CG4 A;  2PJR A;  2A6H F;  2O03 A;  2NXN B;  4L5I A;  3I56 I;  1JHF A;  1SD4 A;  3ZP5 A;  3UR3 C;  1ETV A;  2L3D A;  2DU9 A;  2F4I A;  2R7Z J;  4YEJ A;  3KZZ A;  2XRN A;  4WXC A;  4RAF A;  4ZDO A;  4PDK A;  1MBJ A;  3ZXS A;  4PCQ A;  1GV2 A;  2VPL A;  3HGY A;  3L1P A;  4KIF A;  3WE2 A;  2X1C A;  1Y8Q B;  3WU1 B;  2KMU A;  4IQJ A;  2CO5 A;  3PNT A;  3HOV J;  3JRE A;  1OFC X;  5EEH A;  3LFK A;  3MCZ A;  1M1E B;  4N9H A;  2GXA A;  2CS3 A;  2QKM B;  4P5O A;  1B72 A;  2FNP A;  3K4J A;  5CVI A;  1W7P D;  1T8I A;  3TOB A;  1SFK A;  3ESW B;  2M7B A;  3GLL A;  4UY8 I;  3IH2 A;  4ETS A;  1QBJ A;  4O5V A;  5JLW A;  1FBS A;  2R3S A;  2HOS A;  4ZDP A;  3DU6 A;  3JRH A;  3K1N A;  3A01 A;  1QU3 A;  1YI2 I;  5F1J A;  4HDU A;  4YEL A;  2VJ5 A;  1MMA A;  1WSU A;  1OIS A;  3HRT A;  2P7C B;  2HDD A;  3DKY A;  1C0W A;  1LVK A;  3TP0 A;  5E79 C;  3BTJ A;  3WHB A;  3A2K A;  1JI8 A;  3SEZ A;  3CMA I;  2M34 A;  1XTA A;  2ISY A;  3DWL E;  2IGO A;  4E7K A;  4GFB A;  4LIU A;  5EJC A;  1R1U A;  3M1E A;  1QHG A;  2D1V A;  5FRM A;  2ZNZ A;  3FK7 A;  1TLH B;  3DP7 A;  4EM0 B;  2WB1 N;  2Z2S B;  3LMM A;  3TDZ C;  2KRH A;  2M5W A;  4PJN A;  1RZ4 A;  3JRF A;  4BBS J;  1IDZ A;  3NWT A;  3CC2 I;  2JWT A;  4GRI A;  4A0Y A;  3CLQ A;  1LFB A;  2GIV A;  4D9J A;  2FD5 A;  1K79 A;  2PEX A;  3E3V A;  2EA2 A;  4G9Y A;  1R9T J;  2R7S A;  5LFA A;  3T8T A;  4IHS A;  1REP C;  2OQR A;  2DK5 A;  1R23 A;  4QWQ A;  4DBQ A;  5M3M J;  1HQC A;  1XSV A;  5E18 F;  3CCY A;  3DXJ F;  1ODD A;  3F72 A;  3CCQ I;  9ANT A;  2R93 J;  2WY7 Q;  2L7F P;  2YS9 A; 
#chains in the Genus database with same CATH homology
 5FFX A;  3K69 A;  5K1Y A;  3ISP A;  1OYY A;  1ON1 A;  3WTT C;  1HKS A;  2FNA A;  3RI4 A;  4A6E A;  2VOD A;  1QZZ A;  5AON A;  2LKP A;  5CLS A;  1ZGA A;  1YFH A;  5F6F A;  4UVC A;  1XMA A;  1LEA A;  4U0V A;  1R00 A;  1GXQ A;  2L4M A;  3D0S A;  3BPV A;  2KIU A;  4RS8 A;  1B4A A;  3C3W A;  1ONV A;  3EDP A;  1EH7 A;  4XSZ F;  3WU0 A;  4CO8 A;  4AIK A;  3CTA A;  1IAW A;  3E5U A;  1I1S A;  1LNW A;  2WV0 A;  1XMK A;  4MGR A;  3MEX A;  1O57 A;  1XGS A;  4L5J A;  2R7F A;  2VT2 A;  1IRF A;  4IHT A;  1LDJ A;  1BC7 C;  3F3X A;  3F8B A;  4GO1 A;  3WOD F;  4O3M A;  2ZKZ A;  2KRF A;  2XAJ A;  4HF0 A;  5LRS A;  2EV6 A;  4LJZ F;  3FZV A;  3WG9 A;  3CO6 C;  1TQP A;  3J80 Z;  1H0M A;  3DPT A;  1PP7 U;  5K5O A;  1XDS A;  3I54 A;  3HUG A;  1BOA A;  3GUD A;  3MAJ A;  1FPQ A;  1XDU A;  1XGM A;  4Y15 A;  2GA2 A;  4GGG A;  4U0W A;  1BBY A;  1WKM A;  1EH8 A;  2ZNY A;  4KIG A;  1FOK A;  4RB1 A;  3V4G A;  3BP8 A;  1K78 B;  2D1H A;  4BXU A;  3JAM Z;  4HAM A;  3RYR A;  2PI0 A;  4DQ2 A;  3FXQ A;  3IL2 A;  2K4B A;  4DNC A;  3W6K B;  4G8X A;  2DQR A;  1MGT A;  1SFX A;  3F8M A;  3ABT A;  4HLY A;  3H3Z A;  3GFM A;  5BMZ A;  2M87 A;  3GZ5 A;  3ZMU A;  2OAZ A;  1BI3 A;  4LG0 B;  4Q4Z F;  2M8E A;  5E1W A;  1U3E M;  3DEU A;  2F5D A;  2VBZ A;  3R61 A;  2VE9 A;  4UXN A;  4A6D A;  3BWG A;  4CGZ A;  5DCM B;  3DPL C;  3H3U A;  3JW4 A;  2MH9 A;  3E6M A;  3E6B A;  3QOP A;  4HA8 A;  4I09 A;  2XKP A;  1BC8 C;  4CYD A;  2E7W A;  4H0E A;  2O3F A;  4M72 A;  3GEZ A;  3MWM A;  1HSJ A;  4HYE A;  5DUK A;  1FWZ A;  1W5S A;  2GA1 A;  3I71 A;  3LST A;  1TQI A;  4HX8 A;  2ZFW A;  5CVJ A;  3KE2 A;  3R4K A;  3GFI A;  4RAY A;  1J9I A;  2NNN A;  1R1T A;  1DUX C;  5KVR A;  3BDD A;  2RQP A;  4KYW A;  4L0Y B;  3L9F A;  2TDX A;  2FOK A;  3KP6 A;  4NB5 A;  2EA4 A;  1ZH5 A;  1TNT A;  4KNY A;  2DI3 A;  4M6Y A;  5JI6 A;  3WTW C;  3GVA A;  3KEQ A;  3PQK A;  1TNS A;  2RNJ A;  2Z33 A;  2JT1 A;  4EJU A;  4AWX B;  1I5Z A;  2DBB A;  3JAM K;  4KDP A;  2R7D A;  3WGI A;  1O3T A;  3SHF A;  5D5V B;  2ZJ2 A;  4UNO A;  4IXA A;  4LG0 A;  2Z3Y A;  5JR3 A;  3DQV C;  1P6R A;  4B8X A;  2O0Y A;  4KUM A;  2GWR A;  2VOP A;  1BIB A;  2JPC A;  4FHT A;  4R8H A;  5FD6 A;  3HSE A;  4HOB A;  2ISZ A;  4U7B A;  4TV7 A;  2FQ3 A;  5CJ9 A;  2VON A;  1DP7 P;  5DCM A;  1G3W A;  1I1G A;  2V1U A;  1WQ2 A;  2IJL A;  1Z6T A;  1IXS B;  4KFC A;  3N97 A;  2O6G E;  1QO0 D;  4A5M A;  4Y17 A;  3L7W A;  2M45 A;  4U88 A;  1ZRF A;  3ZMZ A;  4Q47 A;  4HQM A;  4RGR A;  2FE3 A;  2FBI A;  3FX3 A;  4LB6 B;  3SQN A;  2DFI A;  4CDG A;  4LK0 F;  1YS6 A;  3F22 A;  3HSR A;  2V9V A;  4L9J A;  5J8F A;  3AAF A;  1HST A;  1G3S A;  2BYV E;  1EH6 A;  2PQ8 A;  1YIO A;  2E7X A;  5IT9 Z;  4AIJ A;  1Z91 A;  1XB4 A;  4YIF A;  2PLY A;  5K5Q A;  1LDD A;  1R58 A;  5ICF A;  1G6N A;  4K2E A;  2FBK A;  1YW8 A;  2IP2 A;  1MKM A;  4GCV A;  1IXC A;  4BHP A;  4MNU A;  4BNC A;  1FZP B;  5HDG A;  1R5H A;  3JSO A;  1J0R A;  4F7Z A;  2VT3 A;  2V1D A;  4EJT A;  2Y0M A;  4YFK F;  1MJ9 A;  3Q5F A;  2QQ9 A;  3LAP A;  1DDN A;  3OV8 A;  1USS A;  3C7J A;  4D0P A;  2PN6 A;  4WXH A;  1HW5 A;  1OMI A;  1K7A A;  1OYW A;  2WTE A;  5HLG A;  4EMS A;  2DO7 A;  1A04 A;  3NEU A;  2VOO A;  5ILS A;  1RUN A;  3HRS A;  3V8K A;  5HDN A;  3RTR A;  5CVU A;  2HWV A;  1W7P B;  2X0L A;  3ZN1 A;  2H6C A;  2PBI A;  2RV8 A;  3B73 A;  4RB0 A;  1YQA A;  4MEX F;  4EGZ A;  6PAX A;  3I59 B;  3CDH A;  2ZO4 A;  4RGU A;  1ULY A;  3KLO A;  1S8N A;  1BN5 A;  2OA4 A;  2ESH A;  4RGX A;  2VE8 A;  1AOY A;  1T98 A;  3WTU C;  1R36 A;  3R6S A;  1FSH A;  1Q1H A;  5DD4 A;  4KN4 X;  4M9S A;  1FLI A;  4U0Y A;  1R5G A;  4N9I A;  3LA7 A;  4KA4 A;  4OIP F;  2XAG A;  4IF4 A;  1CGP A;  1RIO H;  2YX7 A;  5DEQ A;  1KA8 A;  1F4K A;  1IUY A;  1YLF A;  5L3D A;  2HFH A;  3EYI A;  2FA5 A;  2PMU A;  1P92 A;  3JSP A;  2GAU A;  4MQV A;  4CHU A;  3JTG A;  2FXA A;  2P6T A;  3F21 A;  3FM3 A;  2J5O A;  2ESN A;  4JQF A;  4EJW A;  4G94 A;  5BOX A;  5HS7 A;  5D4R A;  5KK1 A;  4I7H A;  3U9G A;  3F8F A;  1SD6 A;  2IVM A;  3F8C A;  1WI9 A;  1S7O A;  4M6X A;  2GXG A;  4HW0 A;  2ADU A;  4MEY F;  1W7P A;  5E1Z B;  4BH9 A;  3TQN A;  4ASN A;  2JRT A;  2OBP A;  4GYI A;  5LGN A;  3I59 A;  3IC7 A;  4IPA A;  3CLO A;  2FU4 A;  5ED4 A;  1U8R A;  4KIB A;  3E6C C;  1IN7 A;  1R1V A;  1T2K A;  2IPQ X;  5D5X B;  3RDI A;  2LSO A;  2BGC A;  1L0O C;  3QP5 A;  4QLC U;  1KU3 A;  1QZY A;  2PFB A;  4HV5 A;  1ZG3 A;  5E8I A;  1IN5 A;  2FBH A;  3G3Z A;  3K9T A;  4WX9 A;  2G7H A;  1FBU A;  2KIF A;  4Q48 A;  2CYY A;  4ESB A;  1OKR A;  4I0A A;  2EFP A;  3GW2 A;  4I02 A;  2EFQ A;  4RGS A;  2NNY A;  4HDV A;  1J75 A;  2LF7 A;  1KYW A;  5LGT A;  4OIN F;  3LAJ A;  3BJA A;  1QPM A;  1W5T A;  3K0L A;  2KIM A;  1J5Y A;  1IN4 A;  3R60 A;  3HYI A;  2JSC A;  2RDP A;  2XHK A;  1ZRE A;  4FX4 A;  4WXD A;  3IWF A;  4L9V A;  4ZH4 F;  4S04 A;  4ON0 A;  2A5Y B;  2IA2 A;  3WTS C;  4OMY A;  3M9A A;  2YX4 A;  1FNN A;  3VEP A;  5FB2 A;  1TW2 A;  1J7K A;  4EV0 A;  2NS0 A;  4MTE A;  3ZQ7 A;  3VB2 A;  5A2Q Z;  1KU2 A;  2FEZ A;  2MLK A;  1HKT A;  2Z99 A;  1KQ9 A;  2KKO A;  1J59 A;  3J7A O;  3T8R A;  2JZY A;  5LHI A;  4NHJ A;  4KT5 C;  2W84 A;  3V7S A;  4Q5S F;  2BV6 A;  1LB2 A;  2GXB A;  5AIQ A;  3I5U A;  1FX7 A;  1BIA A;  2L02 A;  3KLN A;  4M74 A;  3FMS A;  1ZHF A;  1OYI A;  1OPC A;  4L9N A;  4RB2 C;  2BE5 F;  2PG4 A;  1XN7 A;  2IA0 A;  1MD0 A;  5K5R A;  3U1D A;  1H9T A;  3IRQ A;  1Z7U A;  1MZB A;  3COA C;  2UZK A;  4KMF A;  1FYL A;  1B6A A;  4LLN A;  5FLX Z;  1S3J A;  3GX4 X;  1FP2 A;  4LD5 A;  3CJN A;  3ROU A;  3ZMT A;  4PGG A;  2V6C A;  3FMQ A;  3CUQ B;  3ELK A;  4XSX F;  4CXF A;  4P55 A;  2O8X A;  1B1B A;  2P5K A;  4IRH A;  3VFZ A;  4XLN F;  3T0Y A;  5HS9 A;  2STW A;  2XUB A;  1ZAR A;  2XAH A;  4GXO A;  2L54 A;  4PGH A;  2XIG A;  4RB3 C;  5HDK A;  1UHM A;  1UST A;  3KCC A;  1UCR A;  3WTX C;  2HS5 A;  2P7V B;  2A68 F;  3N4M A;  3QPT A;  1KQ8 A;  1O7L A;  4OMZ A;  1IF1 A;  2RN7 A;  4WWC A;  4G7H F;  2K02 A;  3D5L A;  3LA3 A;  1F5T A;  4LLG F;  2PMH A;  2P5L C;  5DUI A;  4HZF A;  2ACJ A;  2EV0 A;  4P9F A;  3E6D A;  5E20 A;  1KU9 A;  1MJB A;  3KZY A;  1ZLK A;  4ZYG A;  1E2X A;  1PP8 F;  1S29 A;  2DQL A;  2FRH A;  1G3Y A;  4HF1 A;  5ICE A;  4EJO A;  1F1Z A;  1O7F A;  1QNT A;  2H27 A;  3J80 K;  4KIC A;  3F8N A;  3L00 A;  1AWC A;  1H9G A;  3ZMV A;  2B0L A;  1KGS A;  4HLX A;  2JPB A;  4I98 B;  2O61 A;  1ZYR F;  4HQE A;  3KEO A;  1ZG1 A;  4U7D A;  3CUQ A;  5FLX K;  2QM3 A;  2DK8 A;  3BJO A;  2OZ6 A;  5FD5 A;  1K78 A;  2BEO A;  2ETH A;  1TW3 A;  2X4H A;  2W85 A;  1B59 A;  2CSO A;  1IXR C;  1ZLJ A;  3ML6 A;  3SFZ A;  3EUH A;  4ENK A;  2VXZ A;  3RIR A;  2D45 A;  2MLG A;  1U5T B;  4IRG A;  5D8L B;  4WK8 F;  2QVO A;  2COM A;  5H6R A;  5BPD A;  5L3B A;  4G7Z F;  3BOQ A;  2LDU A;  3HSF A;  1LDK B;  2MC3 A;  2F5E A;  3ABU A;  2QZ8 A;  3VOE A;  3IKV A;  2QBY B;  3IKT A;  1VTN C;  3KP5 A;  1JXS A;  1U78 A;  1K6O A;  3WTZ A;  2ZCW A;  4ENJ A;  2HOE A;  2MBF A;  2HR3 A;  4Y13 A;  4NQW A;  2GQQ A;  2YR2 A;  3RPU A;  3DFG A;  2G7U A;  1IW7 F;  1PUE E;  1CF7 B;  2MA3 A;  3GO5 A;  1XSD A;  1D5V A;  4JK1 X;  2FF4 A;  3WGG A;  2AS5 F;  4EQQ A;  5D8K B;  2EFN A;  3KFW X;  5AIP A;  3BRO A;  5J6X A;  4G6Q A;  2HQN A;  3M7G A;  1ZN2 A;  3V7C A;  3GFJ A;  1SAX A;  3HHG A;  3CUQ C;  4BHB A;  3QPH A;  2V79 A;  2H09 A;  3BPX A;  2A69 F;  2JTV A;  1Z1D A;  1BI1 A;  4HBL A;  5DDG A;  4ESJ A;  3L2C A;  3KP4 A;  1GVJ A;  4YG2 F;  2RVC A;  3P9C A;  1XCB A;  2QQA A;  3C18 A;  1U5T A;  2EK5 A;  3RPQ A;  3BZ6 A;  3JTH A;  2QWW A;  2P6S A;  3T5X A;  3TO7 A;  2CWE A;  3TO9 A;  1STZ A;  1YW9 A;  1Z05 A;  4WF2 A;  3I0T A;  4IVN A;  1HW1 A;  4ZYE A;  3O2P E;  5H20 A;  1TTY A;  1TQM A;  5D4S A;  5HLH A;  2QBY A;  1S7A A;  2VBX A;  2L01 A;  1RNL A;  2YU3 A;  3V7R A;  3M8F A;  5HLI A;  3G73 A;  3GLX A;  4KN7 X;  3KP3 A;  4ZZL A;  3BJ6 A;  1R22 A;  1JHH A;  2DT5 A;  3KP2 A;  5BPI A;  1FYK A;  1CF7 A;  1ZGJ A;  1U6G A;  1D8K A;  4BQA A;  5JFR A;  3MFK A;  5HVQ C;  2XRO A;  3HHH A;  4A12 A;  2H94 A;  2YSR A;  1B9N A;  1IRG A;  5D5W B;  1SMY F;  4EVI A;  2A6E F;  1SD7 A;  3WTV C;  3FM5 A;  2EFO A;  3ECH A;  2Y48 A;  3RKY A;  5IT9 K;  1LVA A;  3HRM A;  3O3K A;  3C1D A;  3CUO A;  5HOO A;  5LEJ A;  4FX0 A;  2MD5 A;  2CGP A;  1XD7 A;  2HTJ A;  3TO6 A;  2OQG A;  4B09 A;  1U5T C;  3CO7 C;  5HS8 A;  4HV6 A;  1KU7 A;  3FHZ A;  2K7L A;  3GF2 A;  1UFM A;  5L3G A;  1YYV A;  2CW0 F;  2HYG D;  1BI2 A;  2J5P A;  3L09 A;  5IT3 A;  2CFX A;  1T38 A;  1EV7 A;  3FXR A;  1QQI A;  3Q9S A;  5DCF A;  5D5U B;  3B02 A;  1G3T A;  3RKW A;  3NRV A;  5ILU A;  4EM1 A;  1YS7 A;  4WCG A;  2IT0 A;  3V8L A;  3P9I A;  3GYH X;  4IJA A;  2EWN A;  3LQR A;  2IRF G;  3FF5 A;  5CVR A;  5JVT A;  1SFE A;  3REO A;  3MZH A;  3M8E A;  1UB9 A;  2Q8K A;  1O3S A;  4OIQ F;  4I2O A;  2DW4 A;  1B9M A;  2E1N A;  3ZN0 A;  2KJC A;  2Q0O A;  2H6B A;  3VOD A;  1LJ9 A;  3R0A A;  1D3Y A;  1TBX A;  2VBY A;  2K4J A;  2XV4 S;  2MH2 A;  3S2W A;  2ZME B;  3O6B B;  2WC2 A;  3GFL A;  3HOT A;  2ELH A;  3ULQ B;  3TOA A;  3OOP A;  2F2E A;  4S05 A;  3I4P A;  1ZAO A;  3I58 A;  4YFN F;  5BS6 A;  3U2R A;  2V1X A;  1ZRD A;  2M1B A;  1IN8 A;  2UWM A;  1FYM A;  2HTS A;  1P4W A;  2W25 A;  3QAH A;  5F1R A;  5E17 F;  1XCV A;  2VC1 A;  2XVC A;  2UXN A;  1HW2 A;  1MDM B;  4MHG A;  3HTU A;  1JGS A;  4N0B A;  1FSE A;  3RYP A;  3EET A;  1XGO A;  2A07 F;  1E17 A;  3GXO A;  3K2Z A;  3Q9V A;  4P9U A;  2KJB A;  1RUO A;  1FBQ A;  2QUF A;  3HIF A;  3QU3 A;  2UXX A;  2DPU A;  3SZP A;  4I01 A;  2OU2 A;  4M9X A;  3EQL F;  1G4D A;  2EJR A;  1SD5 A;  1T6S A;  5D6F A;  3F6O A;  3ZMS A;  2FMY A;  4A0Z A;  1D8J A;  1ZRC A;  1U2W A;  4G6D A;  2HYF A;  2HGC A;  1XSX A;  4ENN A;  1FY7 A;  2ZME A;  2A61 A;  4CIC A;  1P2F A;  2F5F A;  4FT8 A;  1YW7 A;  2EB7 A;  2DAO A;  3FMR A;  5LLQ A;  2RKH A;  3QP6 A;  4LMY A;  4LLL A;  5DD8 A;  4HF2 A;  5LHG A;  2A3S A;  5D6E A;  4LGW A;  2NYX A;  4CZZ A;  2XGX A;  2FSW A;  1F9N A;  2F5C A;  1V3F A;  4G7O F;  2NRA C;  2DPD A;  1IZ1 A;  2GZW A;  2QYO A;  2HQR A;  5FFZ A;  1PDN C;  1FP1 D;  4L18 B;  1NHA A;  4UV8 A;  1MDM A;  3KET A;  2VN2 A;  2AXL A;  1Z9C A;  2DLL A;  2HZT A;  2W57 A;  4HX7 A;  4M9Z A;  1ON2 A;  3ERE D;  5H6Q A;  1SFU A;  1J2X A;  3ZPL A;  5A2Q K;  1KYZ A;  3FXU A;  5ERI A;  4MQ9 F;  3GWZ A;  5ICC A;  3RJP A;  1Y0U A;  4YFX F;  3WTY C;  1S6L A;  4ESF A;  2CQK A;  2ZXJ A;  5E1X A;  4A0X A;  4ZZD A;  3DF8 A;  4R79 A;  3LWF A;  2NAZ A;  1JE8 A;  2EV5 A;  3W6J B;  4AD9 A;  1XGN A;  4BHC A;  4RAZ A;  3K1M A;  1YG2 A;  4XBF A;  5LGU A;  4IRI A;  2EFW A;  4PZJ A;  5J8C A;  3HRU A;  2P8T A;  2PJP A;  2RC4 A;  2P4W A;  1BM9 A;  2LF8 A;  1BJA A;  1KQ0 A;  3J81 Z;  1R7J A;  1O3R A;  1I6X A;  5ICG A;  2XAS A;  2RGV A;  4EGY A;  1BI0 A;  4ENM A;  4E70 A;  4Z2Y A;  1SMT A;  2XKO A;  2P5V A;  4LFU A;  4AVP A;  3I53 A;  4EJV A;  1T0F A;  5L3C A;  2HKO A;  4KMU X;  5LRR A;  1UHW A;  2HKX A;  5JHU A;  3HTS B;  3F6V A;  1HBX G;  1MJA A;  4M71 A;  3E5X A;  5TRD A;  1QGP A;  4XLP F;  4P96 A;  1T39 A;  4MTD A;  1I27 A;  3P9K A;  2Y75 A;  2DTR A;  4EM2 A;  2HEO A;  3SXY A;  5L3E A;  3MQ0 A;  4L0Z B;  2QEN A;  4YII A;  2L4A A;  2VBW A;  2OD5 A;  5ILV A;  4OOI A;  1X3U A;  4GYG A;  2BBY A;  4HX4 A;  4AIH A;  1ZG5 A;  5L3F A;  4ZYH A;  4I0B A;  2LNB A;  4UVA A;  4UVB A;  4UUV A;  3ZMD A;  3P7N A;  3IHU A;  4M73 A;  4ZYD A;  2W24 A;  5BQT A;  3MZY A;  1L3L A;  4XRF A;  2VC0 A;  1WRJ A;  2XAQ A;  2XAF A;  3E97 A;  1HXD A;  1LQ1 A;  5CYV A;  3NQO A;  3F23 A;  3IWZ A;  5FO5 A;  1RI7 A;  4A5N A;  2HDC A;  2Z9O A;  3IRR A;  3HOS A;  3GZ6 A;  2E1C A;  3J81 K;  1V4R A;  4BAY A;  2K27 A;  2IA1 A;  3QU6 A;  2C6Y A;  3LA2 A;  5E8G A;  3BY6 A;  1GXP A;  2STT A;  3TGN A;  4OIR F;  4UV9 A;  2Q2E A;  1IN6 A;  5LHH A;  4JBA A;  3TKY A;  3V8J A;  3LQQ A;  5LEK A;  1P4A A;  2IW5 A;  3ECO A;  4R1H A;  4UHT A;  5FGM A;  5LBQ A;  3PFI A;  1O3Q A;  4LB5 A;  4L9T A;  5TJJ A;  3T1B A;  2D2W A;  4O6J A;  3K1P A;  2M30 A;  2WWY A;  4OIO F;  1LEB A;  1DPR A;  2QLZ A;  1WWX A;  3PQJ A;  4BYY A;  4A2U A;  4LK1 F;  3E5Q A;  4OU0 A;  3I64 A;  2ZBK A;  3WE3 A;  5DYM A;  3FWE A;  2G9W A;  2K86 A;  3EYY A;  3TDU C;  3RKX A;  1HKQ A;  5CVV A;  3DV8 A;  2FML A;  1W4M A;  1GHC A;  2YPR A;  1DPU A;  1Z6R A;  1P4X A;  1FT9 A;  5DV5 A;  2QQB A;  3DKW A;  3R0J A;  3KP7 A;  1YO5 C;  3H92 A;  3QRF F;  1YTY A;  5EEG A;  3WGH A;  1OR7 A;  2OZU A;  5F64 A;  1FC3 A;  3SZT A;  2Z5U A;  2CG4 A;  2A6H F;  2O03 A;  4L5I A;  1JHF A;  1SD4 A;  3ZP5 A;  2L3D A;  2DU9 A;  3KZZ A;  2XRN A;  4WXC A;  4PDK A;  4PCQ A;  4KIF A;  3WE2 A;  3WU1 B;  2CO5 A;  5EEH A;  3LFK A;  3MCZ A;  4N9H A;  4P5O A;  2FNP A;  5CVI A;  1W7P D;  3TOB A;  4ETS A;  1QBJ A;  4O5V A;  1FBS A;  2R3S A;  3K1N A;  4HDU A;  1WSU A;  3HRT A;  2P7C B;  1C0W A;  2ISY A;  1R1U A;  3M1E A;  2D1V A;  2ZNZ A;  1TLH B;  3DP7 A;  4EM0 B;  3TDZ C;  2M5W A;  1RZ4 A;  4A0Y A;  2GIV A;  1K79 A;  2PEX A;  3E3V A;  2EA2 A;  4G9Y A;  3T8T A;  4IHS A;  1REP C;  2OQR A;  2DK5 A;  1R23 A;  4QWQ A;  1HQC A;  1XSV A;  5E18 F;  3F72 A;  3DXJ F;  1ODD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...