1YLFA

X-ray crystal structure of bc1842 protein from bacillus cereus, a member of the rrf2 family of putative transcription regulators.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
117
Chain Sequence
KISSRFSIAVHILSILKNNPSSLCTSDYMAESVNTNPVVIRKIMSYLKQAGFVYVNGGAGLLKDLHEITLLDVYHAVNVIGANIQAVLEIILIQAQSAMEEVLRNITMGQLFETLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRF2 family protein
publication title X-ray crystal structure of BC1842 protein from Bacillus cereus, a member of the Rrf2 family of putative transcription regulators.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transcription regulator
total genus 32
structure length 117
sequence length 138
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ylfA00
2XASA 3C7JA 1YFHA 2MA3A 1R7JA 5D8KB 3V8JA 2BE5F 5D5XB 4BH9A 2DK5A 5CVJA 3DPTA 1TQPA 4OIOF 1S7AA 1A04A 1OYWA 3WODF 1ZRFA 3PQKA 1OMIA 4UNOA 2EJRA 3I53A 2DU9A 1QZYA 1G3WA 4HLYA 2XKOA 3JSPA 2P5LC 2KJCA 1VTNC 4G6DA 4BHPA 1Q1HA 2W24A 3FMSA 3IKTA 3FXUA 3RKWA 4KUMA 4OMZA 2K27A 1OPCA 2O61A 4WX9A 1L3LA 1I1GA 3IRRA 4E70A 1RZ4A 1E17A 4MEYF 3BY6A 1IXCA 1EV7A 4O5VA 3QRFF 3ECHA 3F8BA 2P5KA 3SHFA 1HKTA 3ZN1A 5E18F 3VB2A 2OU2A 1BI0A 1XDSA 2O03A 5FB2A 1WRJA 3HOTA 3VODA 3I58A 1WQ2A 4HOBA 1RUOA 2A6HF 5F6FA 4RB3C 2M45A 1EH6A 4GYIA 5ICGA 3GX4X 4LLNA 6PAXA 3V8LA 3ZMVA 2LF7A 2ZMEB 4I0AA 3D5LA 3FHZA 4G9YA 2PQ8A 5LGUA 4EJOA 2VT2A 4HV5A 3E5QA 4G7ZF 1Z91A 4BXUA 2Z3YA 4G6QA 2ZJ2A 2HQRA 3F72A 4P5OA 4ZYEA 2VBZA 3QU3A 2F2EA 3J81K 3BJ6A 4ASNA 2D45A 3ZMDA 2MD5A 1TTYA 4G7HF 5FLXK 4A6EA 3WTYC 1RUNA 3BPXA 4KMUX 5BPIA 1ZG5A 4UVAA 2UXNA 4IVNA 3QP6A 4MGRA 4Q47A 1YS7A 2IA0A 4NB5A 3K69A 4EM2A 1KU2A 1UHMA 2W25A 3HHGA 5DUKA 3T0YA 3WU0A 5IT9Z 4UUVA 3CUQA 2QBYA 2P8TA 1RIOH 2D2WA 2K4JA 2H09A 5CVRA 3HUGA 1J5YA 1T38A 2A5YB 3CLOA 4N9HA 4O3MA 5E1ZB 3L2CA 5BMZA 3IC7A 4GXOA 5L3FA 2M8EA 5HOOA 1SFXA 4I09A 3WGGA 4XBFA 2QZ8A 3T8TA 5FFXA 2P6TA 4AWXB 2WTEA 4HYEA 4L9TA 5D4RA 2ZO4A 2PMUA 1YG2A 3IKVA 3N97A 3GFIA 1S3JA 2WC2A 2C6YA 4LB6B 2WV0A 4M6XA 4LG0B 1FYMA 2OBPA 3QU6A 2GZWA 2FMYA 4L5IA 2H6CA 1D8KA 3KP4A 2VOOA 2PN6A 2L02A 2FBHA 5TRDA 5EEHA 1FBSA 1G3TA 1IN8A 4HW0A 1SFUA 4OMYA 3SQNA 2E1NA 1DUXC 3CO6C 3HRTA 3O3KA 1ZG1A 2YSRA 1XGSA 3TOAA 3T8RA 3ISPA 1ZAOA 5AIPA 4CHUA 1IW7F 3GXOA 2R3SA 1KU7A 4U7DA 2QYOA 3F22A 3B02A 5LHIA 1TNTA 2QWWA 3BPVA 1JGSA 3HSEA 4LLGF 3HOSA 2ESHA 1YW8A 2XAQA 3I71A 2ZKZA 3K0LA 3RI4A 5AONA 2JPCA 3HRMA 2ZMEA 1YS6A 4BHCA 4L9JA 2RVCA 3DP7A 5D8LB 2NS0A 2DBBA 2DT5A 3JSOA 5H6RA 1SAXA 4CICA 1W5TA 3FWEA 4B8XA 1QNTA 2L4AA 4D0PA 3U1DA 4HDUA 5DD8A 4NHJA 2D1HA 3GW2A 1PP7U 3GEZA 3L9FA 4JBAA 4BHBA 2IA1A 3GO5A 4KN4X 2QLZA 2FQ3A 3C3WA 3U2RA 4UV8A 4WXHA 2FU4A 2HKOA 1P4XA 4OIRF 2STTA 2M1BA 4YG2F 1F4KA 1I1SA 4LJZF 2COMA 2R7FA 4LGWA 2CGPA 1RI7A 3R61A 1U8RA 4N9IA 3ULQB 1QO0D 4M9SA 2VBXA 4FX4A 3KZYA 5ED4A 5FD5A 5KVRA 5HVQC 1IAWA 4U0VA 2GA2A 2EFPA 4HA8A 3CUOA 2FSWA 3F3XA 4JQFA 1BM9A 4TV7A 3QOPA 3KLOA 1J75A 3W6KB 1P6RA 2FBKA 3KLNA 4ZYGA 1ZHFA 2LF8A 1DPUA 5H20A 1R23A 1F1ZA 2OD5A 2RGVA 4M6YA 2EV5A 4BQAA 2RN7A 4EJWA 5DV5A 3OV8A 4EGYA 1R1VA 2EFNA 1FSEA 2GIVA 4M73A 3EDPA 2QQAA 5J6XA 5FD6A 4LG0A 2XAJA 3WG9A 2MC3A 4R1HA 2ISYA 1MKMA 2MLGA 3RDIA 3T1BA 4ZH4F 4M9XA 2YR2A 3TDUC 4BAYA 4RGXA 2D1VA 4ZYDA 4P9UA 4A12A 5HDNA 1XMAA 4P9FA 4KIBA 3HRSA 1U2WA 3MEXA 1T2KA 3I64A 1XN7A 1V3FA 2Z9OA 1FPQA 3F23A 5BPDA 1TW3A 2EFWA 3RKXA 4HQMA 3ERED 1FYKA 2FXAA 3DEUA 3CUQB 4Q48A 1MJAA 3F8NA 4WXCA 3LWFA 3E6MA 4KA4A 2MLKA 4PGGA 4YFXF 1OYIA 5L3GA 3J80K 4WXDA 4DQ2A 1SD7A 4CDGA 1Z1DA 4UHTA 1BC7C 1Z6TA 3E3VA 5D4SA 5JFRA 4YIFA 1FZPB 3CUQC 4XLNF 1YYVA 4P55A 1ODDA 3N4MA 2PLYA 3I59B 4Q4ZF 4KIFA 1ZGJA 4L9VA 4QWQA 4U88A 4DNCA 2ZXJA 1TQIA 5E8IA 1IZ1A 2VBWA 3U9GA 2PEXA 3SFZA 3ECOA 4OU0A 2F5FA 2HEOA 4L0ZB 3GWZA 1YO5C 3E5UA 3EQLF 1FLIA 3F6OA 1OYYA 3WGIA 3L09A 5IT9K 1O3QA 5CJ9A 1WKMA 3WTXC 3IHUA 2PI0A 1YQAA 1ON1A 5K1YA 2V1UA 2JSCA 4I98B 2IVMA 2ADUA 2V1DA 5TJJA 2A3SA 3CTAA 5LRRA 1USSA 4EM1A 3FX3A 2QENA 1J0RA 1ZGAA 4BYYA 1MJBA 4MQ9F 1AWCA 2VONA 5LEKA 1S6LA 2HKXA 2KJBA 3GFMA 2XRNA 3J7AO 4CZZA 2MH2A 3LA3A 2Y0MA 4HX8A 5LGTA 3RJPA 5BQTA 2HYGD 4QLCU 3MFKA 4R79A 1IUYA 4AIJA 4YIIA 2DQRA 2O8XA 1ZRDA 5JVTA 3E6DA 4IRIA 1BJAA 2Z33A 1W7PB 5DDGA 2G9WA 1BBYA 3OOPA 2FF4A 4G8XA 3LQRA 1PP8F 3FXRA 2J5OA 3L00A 5HLGA 1P4AA 1O3RA 3KE2A 3Q9SA 3K9TA 3F8MA 1UHWA 1D8JA 2BYVE 4XSZF 1FP2A 4U0YA 4LK1F 5E1WA 1IXSB 4UVCA 1SMYF 2M87A 2HQNA 3COAC 3IWZA 1STZA 3ABTA 2VN2A 3T5XA 2A61A 2JPBA 3P9KA 2FEZA 3K1NA 1ULYA 1GXQA 2XAFA 1O3SA 5LHHA 2V79A 3GUDA 1R5HA 2NYXA 2G7UA 5CYVA 3TO7A 3C18A 2F5EA 4I7HA 5L3BA 4RGUA 3ZQ7A 5LHGA 4H0EA 3BZ6A 1KQ9A 5K5QA 3WTTC 4MTDA 4I2OA 1QBJA 2FNAA 1TNSA 1SD6A 3B73A 3RPUA 4AD9A 4Y17A 2A07F 5HS8A 2MBFA 4S05A 1B1BA 1YW9A 1FP1D 3SZTA 5BS6A 4RGSA 3I59A 1KA8A 2GAUA 3EUHA 3RYPA 2OA4A 3NQOA 2JZYA 2GWRA 1LDKB 3BJAA 1DDNA 1EH8A 4U7BA 1S7OA 4GYGA 3ZN0A 2GA1A 4IRGA 1IN6A 2IRFG 1FWZA 2XROA 3EETA 2TDXA 3JAMK 1PUEE 3F21A 5ICCA 2JRTA 2Y48A 1FY7A 4HF2A 2BV6A 3CO7C 2QVOA 1O57A 1GVJA 1LDJA 2NRAC 3GLXA 1I5ZA 2DFIA 2H94A 4PDKA 4L18B 5BOXA 4L0YB 3DFGA 1YW7A 1MZBA 2K4BA 1RNLA 4IPAA 4MQVA 4CGZA 1GXPA 1EH7A 2PG4A 4CYDA 2L4MA 5J8CA 3TO6A 2KIMA 5F64A 2O3FA 3DKWA 5KK1A 3LSTA 3LFKA 5E17F 1SD4A 3BROA 3J81Z 1K6OA 3ZPLA 4P96A 1W5SA 4GGGA 4LFUA 5FLXZ 2AXLA 4I02A 5D5WB 1R36A 3M8EA 2IJLA 1P92A 2HWVA 1UCRA 3BP8A 3GVAA 1JHFA 4A6DA 4ENNA 1LQ1A 1B4AA 1B9MA 3H3ZA 4WWCA 2CSOA 1TW2A 1W7PA 2YPRA 4RB1A 1F9NA 3VOEA 2K86A 1KU9A 4HDVA 5HS7A 2A69F 2LNBA 4G7OF 4LK0F 2HR3A 1T98A 3GF2A 1R5GA 2DPUA 1U5TB 5D5UB 1V4RA 2ZCWA 1W4MA 1X3UA 2CG4A 1MDMB 4OIPF 1FYLA 1SMTA 3Q9VA 1HW5A 4XRFA 3H3UA 1KGSA 5ERIA 4ENJA 1P2FA 2F5DA 3IL2A 4ENMA 3TQNA 1U5TC 5L3EA 2O6GE 5ILSA 5D5VB 1PDNC 2P7CB 3WTVC 3FF5A 4EM0B 2PJPA 4OOIA 2QQ9A 1JXSA 1BI3A 3GZ6A 3P9CA 2E7WA 3ZMSA 4Q5SF 3VEPA 2H27A 2VODA 4JK1X 1W7PD 3RKYA 3V7RA 5H6QA 1XSVA 4KNYA 2X4HA 2ZFWA 3KEOA 4FHTA 1FBQA 2CYYA 2O0YA 3MZHA 5DEQA 4IRHA 4IF4A 2XAGA 2HOEA 1UB9A 3EYIA 1UFMA 3CDHA 2RDPA 4M74A 4HF1A 3KEQA 1Z6RA 3ROUA 3WTWC 1NHAA 1BN5A 3O2PE 1LEBA 3I54A 3IRQA 4ESFA 3P7NA 3LAPA 2VC0A 2A6EF 3LAJA 2QQBA 1ZG3A 2FE3A 4O6JA 1HW2A 1H0MA 4OIQF 3DV8A 1ZARA 5LRSA 1BI1A 2W84A 5A2QZ 3KP5A 4I0BA 3GFJA 3E5XA 3QAHA 2VXZA 2CQKA 1USTA 3VFZA 1XGMA 2ZNZA 3ELKA 3HTSB 1KU3A 4M72A 1XD7A 2M5WA 3HHHA 3E6BA 1BI2A 5K5RA 5ICFA 5D6EA 3TO9A 2STWA 3JTGA 4HV6A 3DQVC 2VBYA 2G7HA 2IT0A 3KFWX 3WU1B 3S2WA 4AIKA 4LLLA 4ON0A 1IF1A 1MJ9A 3V7SA 5JR3A 2JT1A 1Z9CA 2W85A 1TLHB 2ZNYA 3KP6A 1LB2A 3RTRA 1KQ8A 3LA7A 1MGTA 3M7GA 1HXDA 1E2XA 2QM3A 4EJUA 2A68F 3HYIA 1XSDA 3HTUA 2RC4A 2HGCA 4LB5A 4RS8A 3Q5FA 5DUIA 3PFIA 3HSFA 1R00A 4M9ZA 1R58A 3ZMUA 1LVAA 2XGXA 3FM3A 1JE8A 1CF7B 2F5CA 5E8GA 3TGNA 4KMFA 1KQ0A 2L54A 3G73A 4KT5C 4U0WA 2ZBKA 1U5TA 1DPRA 4K2EA 1QPMA 2P5VA 3ZP5A 5JI6A 1MDMA 3FMQA 5E20A 5L3DA 2VOPA 5HLIA 1HQCA 2LKPA 3WE3A 1D5VA 3E6CC 3JTHA 4YFKF 4A5MA 2GXBA 1J7KA 2B0LA 3ZMZA 2Z5UA 4ETSA 3RYRA 2XHKA 2E7XA 2L01A 2HYFA 3LQQA 2PFBA 5FGMA 3L7WA 3MZYA 2M30A 3KP3A 1YLFA 1F5TA 4ESBA 1IN5A 4IJAA 1IRFA 4YFNF 4RAZA 3QP5A 4HZFA 3KP2A 1H9TA 2DK8A 4L9NA 1T6SA 2FBIA 4RGRA 1B9NA 3HIFA 1XMKA 4EJTA 1WSUA 3BJOA 1P4WA 4A2UA 2WWYA 1I27A 3WGHA 4HF0A 1ZN2A 4WF2A 2FRHA 3MAJA 3NRVA 3V8KA 2K02A 3F8CA 3R0AA 2CWEA 2EWNA 3LA2A 2DO7A 1OKRA 2FNPA 2ELHA 4NQWA 1H9GA 1XCVA 1B6AA 1KYWA 3TOBA 1LNWA 2IW5A 2CFXA 3J80Z 3HSRA 2FOKA 2KRFA 1YTYA 4GCVA 2KIUA 2YX4A 1ZRCA 5DCMB 2RV8A 4ZYHA 1K78B 1U78A 1FT9A 4UVBA 2OQRA 1O7LA 5HS9A 4KN7X 3R60A 3SZPA 4HAMA 4B09A 1IN7A 3FM5A 2PBIA 4EV0A 2DI3A 4A0ZA 4OINF 3BOQA 3KZZA 1C0WA 4KDPA 4IHSA 2MH9A 2LSOA 1BIAA 5J8FA 1BIBA 2P6SA 3R4KA 1I6XA 1FOKA 3WE2A 2UWMA 4RB2C 2IA2A 4MHGA 5LLQA 1IXRC 2GQQA 2HZTA 1Y0UA 2Y75A 2EFQA 1BOAA 3O6BB 1WI9A 2V1XA 2V9VA 1HSJA 4UV9A 2RKHA 3REOA 5CLSA 2HS5A 3I4PA 1XB4A 1G6NA 1ZYRF 4PCQA 5IT3A 2BBYA 3GYHX 2NAZA 4MEXF 3W6JB 5ILUA 5FFZA 2OZUA 2BEOA 5FO5A 5DD4A 2HDCA 2EA4A 1HBXG 2GXGA 2XVCA 1CF7A 4KYWA 1LEAA 1HKSA 4RB0A 4A0XA 4ESJA 2W57A 2RNJA 3GFLA 1HKQA 2UXXA 2HFHA 4HLXA 4LD5A 3MCZA 3RIRA 2ISZA 2ESNA 2EFOA 4WCGA 1MD0A 4N0BA 2XUBA 2DW4A 2DTRA 2OQGA 2FMLA 5HLHA 3AAFA 2OZ6A 2EA2A 3F8FA 3MWMA 4KICA 4PGHA 2P4WA 1O3TA 3FXQA 2EK5A 1XGOA 3MQ0A 5E1XA 1SFEA 2FA5A 4EGZA 4R8HA 1XDUA 2XV4S 3M9AA 2XAHA 4UXNA 5CVUA 1B59A 2BGCA 1FX7A 3IWFA 3V7CA 4FT8A 1XCBA 2EB7A 3F6VA 2X0LA 4M71A 5A2QK 4HQEA 3DPLC 1WWXA 4AVPA 2JTVA 3PQJA 1REPC 3TKYA 5ILVA 2Q0OA 4G94A 1R1UA 3SXYA 1ZH5A 4CXFA 4Z2YA 1Z05A 2VT3A 3ABUA 3KP7A 1S8NA 4WK8F 5LEJA 3ZMTA 1S29A 5HDGA 3QPTA 1G4DA 4ZZDA 2XIGA 1SD5A 5DCMA 3R0JA 2L3DA 1T39A 5LGNA 4EQQA 1BC8C 1K78A 1YIOA 5AIQA 2LDUA 3K1PA 4HX4A 1LDDA 3BWGA 2QUFA 3WTUC 3R6SA 2UZKA 3M1EA 3RPQA 2OAZA 3E97A 4AIHA 2CW0F 5L3CA 4IXAA 2Z99A 2XKPA 3DXJF 3HRUA 5DYMA 3QPHA 4XSXF 3KETA 1G3SA 2RQPA 3JAMZ 2KIFA 4ZZLA 3I5UA 3BDDA 1J2XA 2VC1A 2YU3A 5K5OA 2DQLA 5LBQA 3G3ZA 1FC3A 1ZREA 1L0OC 1ZLKA 1TQMA 5HDKA 2YX7A 1T0FA 1K79A 1FBUA 4HBLA 2AS5F 1QQIA 3D0SA 1IRGA 3H92A 1DP7P 4PZJA 3GZ5A 5JHUA 4GO1A 2V6CA 2IP2A 3I0TA 1G3YA 1FNNA 1QZZA 4EMSA 1J59A 1K7AA 3NEUA 2DLLA 2EV6A 1ZLJA 2J5PA 1U6GA 2VE9A 3CJNA 2NNYA 1ON2A 4S04A 1R22A 4Y13A 2VE8A 1D3YA 1XGNA 1FSHA 2KKOA 4I01A 4CO8A 1O7FA 4F7ZA 3FMRA 1ONVA 1GHCA 3C1DA 2IPQX 3K1MA 4A0YA 4MNUA 1LJ9A 4FX0A 4IHTA 2R7DA 2DPDA 2DAOA 3EYYA 2HTSA 3FZVA 4HX7A 2HTJA 2H6BA 5ICEA 1IN4A 4KIGA 2E1CA 4Y15A 4A5NA 4ENKA 3K2ZA 5CVIA 2EV0A 1R1TA 3ML6A 4BNCA 4MTEA 2QBYB 2Q8KA 4EVIA 1AOYA 4EJVA 5D6FA 4LMYA 2K7LA 1U3EM 2P7VB 2CO5A 1Z7UA 3TDZC 1OR7A 5EEGA 4KFCA 1J9IA 5F1RA 3KCCA 1CGPA 1HW1A 2PMHA 2NNNA 4XLPF 1JHHA 3DF8A 3P9IA 3JW4A 5CVVA 2ACJA 1QGPA 3WTSC 5DCFA 4L5JA 1TBXA 1HSTA 1XSXA 1KYZA 2Q2EA 3V4GA 3M8FA 4RAYA 3WTZA 2ETHA
chains in the Genus database with same CATH superfamily
2XASA 5LD2C 3C7JA 1YFHA 2MA3A 1R7JA 4AC0A 3Q3SA 5D8KB 2DA6A 3V8JA 2BE5F 5D5XB 1Y1WJ 4BH9A 2DK5A 5CVJA 2R0QC 3DPTA 1TQPA 4OIOF 1S7AA 5IYBJ 1A04A 1OYWA 3FK6A 3WODF 1LE8B 1ZRFA 3PQKA 1OMIA 4RA2A 4UNOA 4BE2A 2EJRA 3I53A 3A1YA 2VQHA 2DU9A 1QZYA 1G3WA 4BY7J 4HLYA 2IGOA 4XKCA 2R7UA 2XKOA 3JSPA 2P5LC 4XRSG 2YS9A 2KJCA 1Q1VA 1VTNC 4G6DA 3FISA 5FKLA 4BHPA 1OCCH 1Q1HA 2VJJA 2W24A 2WB1A 3FMSA 2IGNA 3IKTA 2O5RA 3FXUA 2WV1A 3RKWA 4KUMA 1I3AA 4OMZA 2K27A 1OPCA 3I3LA 3CF2A 2O61A 4WX9A 1L3LA 1I1GA 1K61A 3HEFA 1OJLA 3DU6A 3IRRA 1TWGJ 1JJ8C 1ENHA 4E70A 3AL0B 2MYSA 1RZ4A 1E17A 2CUFA 4MEYF 1LFPA 3BY6A 1IXCA 3S14J 2KDOA 3U21A 1ETKA 3ZOBA 1X19A 4OAZA 1EV7A 4O5VA 3E0JB 5IOYA 3QRFF 3ECHA 4Y33A 2TCTA 2W48A 1UELB 2VQCA 3DEWA 3F8BA 2P5KA 3SHFA 1HKTA 3ZN1A 5E18F 3SYTA 3AG3H 3VB2A 4D7NA 2OU2A 3A01B 3DTEA 2E19A 1BI0A 2LMDA 1VFCA 3MKWB 1XDSA 2ZB9A 2O03A 1D5YA 3LSIA 5FB2A 1WRJA 3HOTA 3AL0C 3VODA 3I58A 2NS8A 3L2WA 1WQ2A 2BY2A 3OSGA 5J1RA 2Y69H 4HOBA 3BQZA 1MSEC 1RUOA 5K7ZA 2A6HF 5F6FA 4RB3C 1ZR2A 2M45A 1EH6A 3EPZA 4GYIA 1BR4A 5ICGA 3GX4X 4FCYA 4LLNA 6PAXA 2VQGA 2R7ZJ 3K4LA 5HODA 2VKEA 3V8LA 1P9QC 2H1KA 3IV5A 2X9DA 4YIRX 1GVDA 3ZMVA 2LF7A 2Y9YA 3LOCA 3I55I 4H4KC 2ZMEB 4I0AA 3ABLH 3D5LA 4G9YA 3FHZA 2E2JJ 2PQ8A 5LGUA 4EJOA 2VT2A 4HV5A 3E5QA 4G7ZF 2WAFA 1Z91A 5B5EC 2W1OA 3M8JA 4BXUA 2JUGA 2Z3YA 1WJEA 2ZJ2A 4G6QA 2K9SA 4UUSA 4HNUA 2HQRA 4IOCF 3F72A 3A4CA 4IL6C 5KAFC 1IGNA 4P5OA 4ZYEA 2VBZA 3QU3A 2FOWA 5B3SH 3NAUA 1V5GA 2F2EA 4KISA 1Z7LA 4C9YA 3J81K 3BJ6A 1S5LC 4ASNA 4CYCA 2QEXI 2ZJRF 4PJ0C 2D45A 3ZMDA 3M3YJ 2MD5A 1V54H 1TTYA 4G7HF 2JRMA 4CCJA 5FLXK 1Y39A 4A6EA 1JKPC 3WTYC 3PNYA 5C4XJ 2V6EA 1RUNA 2BVLA 3BPXA 4KMUX 5BPIA 1ZG5A 2AHQA 4QSHA 3KPHA 4UVAA 2UXNA 3OWTA 4IVNA 3OYJA 1BOBA 3QP6A 4MGRA 3OYLA 2H8RA 4Q47A 1YS7A 3BTLA 2IA0A 4NB5A 3K69A 3QPSA 2DODA 3VDXA 3W2AA 2Y2ZA 2XGCA 2OPTA 2E34A 3VYRB 4EM2A 1QHGA 1KU2A 1UHMA 2W25A 3IAM2 5GAHJ 2XSDC 3MD2A 3HHGA 2CRGA 5DUKA 3EUKL 4XLCA 3T0YA 3TEDA 4BJ5C 2YUSA 3BG3A 3WU0A 4UUVA 5IT9Z 3CUQA 4XOPA 2F4IA 3OR2C 3C2GA 3TP0A 4CUGA 2QBYA 2P8TA 1RIOH 2D2WA 1GV2A 1I3QJ 3W2WA 2K4JA 4C2MJ 3CF5F 2H09A 3AG1H 5CVRA 3HUGA 2L7MP 1J5YA 1OCOH 1T38A 9ANTA 2A5YB 2CFOA 3K70D 3CLOA 3M4OJ 1MBEA 3DEEA 4N9HA 4O3MA 2CQNA 5E1ZB 1R4NB 4D5FA 3L2CA 5BMZA 3IC7A 1Y0NA 3H5AA 3RQ4A 4LOCA 4GXOA 4CCKA 5L3FA 4V2GA 4PJLA 2M8EA 5HOOA 1SFXA 4I09A 2ZSIB 3WGGA 4XBFA 2QZ8A 3T8TA 2VJ5A 3CJQB 4MO7A 2F4OB 5FFXA 2OC6A 2P6TA 2KDZA 2FX0A 4AWXB 2WTEA 1RKTA 1OCZH 4HYEA 2ZC2A 4M3FA 4DBQA 2EZHA 4L9TA 3ESWB 5D4RA 2ZO4A 2PMUA 1YG2A 3IKVA 3KIOA 3N97A 1VQ5I 2GOXB 3GFIA 4XLEA 1S3JA 2WC2A 2C6YA 4LB6B 2WV0A 4XLHA 3SEZA 1OFCX 4M6XA 4LG0B 1X4OA 4W97A 3PUFA 1FYMA 2L2OA 2OBPA 3QU6A 2GZWA 2FMYA 3Q0VA 1QRYA 4L5IA 2H6CA 3HZJA 2L7FP 1D8KA 1RKWA 1WHUA 5CPRB 3KP4A 4ZC3A 4FE4A 3HOYJ 4YEJA 2CUEA 2HI3A 4XORA 2VOOA 2PN6A 2L02A 3LMMA 2FBHA 5TRDA 2JA6J 2BY0A 1XMXA 4B44A 1LE8A 3OYAA 5EEHA 3VYTB 2R93J 1FBSA 3OS1A 1G3TA 1TL8A 1IN8A 2KPMA 3PUBA 1OCPA 3ABMH 1MIJA 4C30A 2LG4A 4BJ6C 1T56A 1SVLA 1T33A 4B3AA 4HW0A 2JA5J 2IEKA 3LSPA 1SFUA 3UNGC 1ZK8A 4UB6C 4BXFA 1H88C 4OMYA 5F08A 2DT7B 1YI2I 3SQNA 2E1NA 2VASA 3BR5A 5EJCA 3CO6C 1DUXC 4A3GJ 1N77A 1HOMA 3HOUJ 3HRTA 3AG2H 2M8GX 2LY1A 3GCMA 4D1QA 3OOUA 3O3KA 1ZG1A 2YSRA 1AU7A 3ZR8X 5F0HA 1APLC 1XGSA 2X51A 1G2HA 3TOAA 1W0TA 3O8HA 3T8RA 3QQAA 2DN0A 3ISPA 1ZAOA 4JP0A 1MBJA 1MH3A 2CQQA 5AIPA 2LLKA 4CHUA 4UB8C 4DW6A 4B4CA 2IS4A 4FETA 3ZCOA 1FOWA 1IW7F 2IS1A 3GXOA 2R3SA 2HYJA 2M9HA 1VQKI 3A01A 2EH3A 1KU7A 4U7DA 4A3CJ 2QYOA 2HQ5A 3FK7A 4KT6A 4RMNA 3F22A 2HVQA 3V42A 4RBOA 3HPHA 1NG7A 3B02A 5LHIA 3BTCA 3HKZN 1TNTA 4IHWA 2QWWA 2VB6A 3BPVA 1JGSA 5CQGA 3CD6I 3DBLB 1HLVA 3HSEA 4LLGF 1S7EA 3HOSA 2ESHA 1YW8A 2M34A 2XAQA 3I71A 2ZKZA 2CQ7A 3K0LA 3RI4A 5AONA 1TWAJ 2JPCA 1WJFA 2XB5A 3HRMA 3IH2A 2ZMEA 1YS6A 4BHCA 1WJAA 2DOAA 2RVCA 3DP7A 4L9JA 2NS0A 5D8LB 1HF0A 3PO2J 4DIQA 2BZTA 4DOZA 1UAAA 2DBBA 2DT5A 3JSOA 4M3DA 2LBFB 5BNGA 5H6RA 1SAXA 2BY1A 4A93J 4CICA 1W5TA 3FWEA 4B8XA 2K40A 1QNTA 2AO9A 2L4AA 2V9KA 5M5XJ 4IHXA 4IKFA 4D0PA 4BBSJ 3U1DA 4HDUA 5DD8A 4NHJA 2D1HA 3ZQGA 3GW2A 1PP7U 1HA8A 1POGA 3GEZA 4NC8A 1E0EA 3L9FA 3VPRA 4JBAA 3OL4A 2CH0A 4BHBA 2IA1A 3GO5A 4KN4X 2QLZA 3CLQA 4IQ4A 3FDYA 3H3VK 2R7SA 2FQ3A 1QA6A 4KJZA 4PUSA 3C3WA 1VQ7I 3U2RA 1VQ8I 1ETQA 1PVEA 2M0MA 4BQNA 3QODA 4UV8A 1RRJA 3HPGA 4WXHA 2FU4A 2HKOA 1P4XA 2VQLA 3BC8A 3M1CA 4OIRF 2STTA 1WI3A 1P7JA 2V26A 3OYGA 2M1BA 4YG2F 4LIVA 4M6VA 1F4KA 2JA8J 3SDGA 4D5CA 1I1SA 2BY3A 1TZLA 4IOAF 2V7FA 4LJZF 2COMA 2R7FA 2DJNA 3GTKJ 5E79C 4LGWA 2QQ8A 2CV0A 4BGDA 1LVKA 2CGPA 3L2UA 1SVMA 1RI7A 1KZHA 2QKMB 3ZGKA 3BR6A 3R61A 3CESA 1AA7A 4N9IA 1U8RA 2BHZA 3ULQB 3AKZA 4ZTFA 5FLMJ 1E3PA 1QO0D 5KHDA 4M9SA 3CCJI 2VBXA 4FX4A 1BW5A 3KZYA 5ED4A 4IQJA 5FD5A 1GV5A 5KVRA 5HVQC 2VLAA 3RCOA 1IAWA 3KYCB 4U0VA 1Y8RB 2E60A 2GA2A 2ZFUA 2EFPA 4HA8A 2B7EA 3CUOA 2FSWA 3F3XA 1LFBA 2JVGA 3RZOJ 2H1LA 4JQFA 1BM9A 4TV7A 3QOPA 3KLOA 2EPFA 5F27A 1J75A 3W6KB 3H0DA 1P6RA 1X58A 2FBKA 3KLNA 1GLNA 4ZYGA 1ZHFA 2LF8A 3OIOA 4Y4RA 2RQQA 5EZGA 1DPUA 1IRZA 2K3PA 2NVUB 5H20A 1K83J 2DMNA 1R5ID 3LSRA 1R23A 3FIWA 2O7OA 2WA0A 1F1ZA 2Y0SA 2OD5A 2RGVA 4M6YA 2EV5A 4A69C 4BQAA 1X1BA 2RN7A 4ZDPA 3EUAA 4EJWA 1VF9A 5DV5A 5K7FA 3CJRB 3FKJA 1FTTA 3OV8A 4EGYA 1R1VA 3ZQQA 4BL0B 2DA7A 2W7NA 2EFNA 1WFXA 2G0EA 3ZQIA 1FSEA 1G59A 2K9QA 2GIVA 4M73A 3KZIC 1B8IB 3EDPA 2XF6A 2QQAA 2WAEA 5FD6A 5J6XA 2XDVA 4JOMA 3RKQA 4LG0A 3FXJA 1JKQC 3S2HJ 1A6IA 2UUZA 2XAJA 4DYQA 3WG9A 2YU9J 5LFAA 2MC3A 4R1HA 2ISYA 1MKMA 1IO2A 2MLGA 1QVTA 3RDIA 4PFPA 3T1BA 4ZH4F 3S32A 4M9XA 2YR2A 3TDUC 4BAYA 2DA5A 5GADJ 4RGXA 2E71A 4E6KG 4E7ZA 3S16J 4XKVA 2D1VA 4ZYDA 3C2BA 1RETA 2EIMH 4P9UA 5HDNA 3OYHA 4A12A 1XMAA 3FXLA 2VXDA 3A03A 4P9FA 4KIBA 3HRSA 1U2WA 3MEXA 1H89C 4C3HJ 4DZJA 1T2KA 3S1RJ 5J4VA 3S1MJ 2R7XA 2AXTC 3SEQA 2B63J 3I64A 1SEUA 2NVYJ 1XN7A 1V3FA 3W2VA 2Z9OA 3HOVJ 1FPQA 2L9NA 3F23A 2MGQA 2CW8A 2FD5A 1Z21A 5BPDA 1TW3A 4LG3A 1MW7A 4B48A 4EEFG 3CC2I 2EFWA 1NG6A 1JT6A 3RKXA 4HQMA 3ERED 1FYKA 2FXAA 1Z0XA 2M2EA 2PMZN 3DEUA 3CUQB 4A3BJ 3DBHB 4Q48A 1MJAA 2VKHA 3F8NA 5J1YA 2HOSA 4WXCA 3LWFA 2DDAA 2ME0A 2MLKA 3E6MA 4PGGA 4KA4A 4A3FJ 1T8IA 4YFXF 2CV1A 1OYIA 5L3GA 3LSMA 2OJED 3OYMA 1FIAA 3J80K 4WXDA 4DQ2A 3OYIA 4ZDOA 1SD7A 5GPAA 4CDGA 1Z1DA 4UHTA 1TC3C 1BC7C 1Z6TA 3E3VA 5D4SA 1Y8QB 2XF7A 4Y3OA 5JFRA 4YIFA 5JHFA 1FZPB 4RAFA 1MNDA 3FXOA 4AM3A 4D9JA 3CUQC 4XLNF 1YYVA 1K6YA 4N4OB 5IYDJ 4P55A 1ODDA 3N4MA 2PLYA 3PO3J 3I59B 2Y30A 2E1MB 1OQYA 2LTPA 3OYDA 2O9LA 1Y6IA 3VYUB 4Q4ZF 4KIFA 1ZGJA 4L9VA 1DGRM 3X2QH 1HC8A 4QWQA 4U88A 4DNCA 5EF6A 1FIPA 2ZXJA 1TQIA 5E8IA 2R7TA 5IP9J 2E35A 3CMMA 5FKOA 1IZ1A 2VBWA 3HGGA 3U9GA 3CCYA 2LBFA 2PEXA 3SFZA 3ECOA 4OU0A 1TWHJ 4OWRB 3FHNA 1R49A 2VUMJ 2F5FA 2HEOA 2E1MC 3S3NA 2QSGX 2EBIA 4L0ZB 3GWZA 1YO5C 3E5UA 3EQLF 1UHSA 2MW8A 1FLIA 3F6OA 1ZKGA 1OYYA 3WGIA 2TRTA 4W1UA 1ETOA 3L09A 5IT9K 3AG4H 5CJ9A 1O3QA 4AIDA 4AYBN 1WKMA 3WTXC 2XPUA 3IHUA 3S3MA 2PI0A 3KYLA 1YQAA 2WBMA 3OR1C 1HCRA 1ON1A 5K1YA 2V1UA 2JSCA 3GTGJ 4I98B 2IVMA 3SFIA 2ADUA 1VQ4I 2V1DA 1VQNI 5TJJA 5HNFA 2DDBA 2A3SA 3CTAA 5LRRA 2QGUA 3ASOH 5DM7F 1USSA 5J4YA 4FISA 3OS0A 5F0CA 1YX5A 1NK3P 3S1QJ 4BXXJ 4EM1A 3LSJA 3FX3A 2QENA 1J0RA 1ZGAA 4BYYA 1X4PA 3MKZA 1MJBA 4MQ9F 4F91B 1AWCA 1MNMC 2VONA 1FEXA 3OMYA 4ZYAA 5LEKA 1SC7A 1LFUP 2IBDA 1S6LA 2M4GA 3A2KA 2HKXA 2KJBA 3GFMA 3E7LA 2XRNA 2EQRA 3RSNA 4BY1J 3J7AO 4XL9A 2IS2A 4CZZA 3S1NJ 2MH2A 1DU0A 3LA3A 3JCUC 2Y0MA 4HX8A 2DA1A 5LGTA 3RJPA 5FKMA 5BQTA 3GTQJ 2HYGD 4QLCU 2KHMA 2DT6A 2ID6A 3MFKA 4RAGA 3QPLA 4R79A 3GMEA 3LFUA 1FMVA 1IUYA 4AIJA 4YIIA 3PNTA 2DQRA 2WAQN 3J7ZI 1RPWA 2O8XA 5M3MJ 1Z3XA 2PJRB 4CSWA 1N75A 1ZRDA 5JVTA 3E6DA 2BVMA 1SANA 3JRDA 1QPIA 1ZQ3P 4IRIA 1BJAA 3RQIA 2Z33A 1W7PB 5DDGA 3HOWJ 2G9WA 1BBYA 3B6CA 1X3ZB 3OOPA 2FF4A 5F0FA 2R7WA 4E7SA 4G8XA 4PK4A 3LQRA 3S8PA 1PP8F 3FXRA 2E2HJ 2J5OA 4XIDA 2HNHA 4L5EA 1SFOJ 1B8IA 3L00A 2I8DA 5HLGA 1K4TA 4E7JA 3D5SC 5C3EJ 1P4AA 1O3RA 3KE2A 4E4HA 1BA5A 3Q9SA 3K9TA 3F8MA 2ZMEC 3QOEA 1UHWA 3ZQFA 4A3EJ 4J00A 1D8JA 1WJDA 2BYVE 4XSZF 1FP2A 4U0YA 4X0GA 3ZQLA 3FXMA 4LK1F 2LY2A 1VQPI 5E1WA 4HG2A 1IXSB 4UVCA 1SMYF 2M87A 5K7HA 5J3LA 2HQNA 1FOXA 5CQEA 4M3GA 4MFEA 5EDNA 3IWZA 3OS2A 2JK3A 2VKDA 3COAC 4C2UA 1STZA 3ABTA 2VN2A 3DPUA 3T5XA 4A3LJ 2A61A 3M07A 2JPBA 3HOZJ 3P9KA 2FEZA 3K1NA 1ULYA 1A31A 1QU3A 1GXQA 2XAFA 1SAUA 3E1SA 1O3SA 1DU6A 5LHHA 2V79A 3GUDA 1R5HA 2NYXA 1R4MB 3PNVA 2G7UA 2R5ZB 1ZTRA 5CYVA 3TO7A 3C18A 2JQ7A 2F5EA 1QZEA 3GBGA 4I7HA 4B1RA 2CQXA 4RGUA 5L3BA 3G6EI 4NC7A 3CCUI 3ZQ7A 5LHGA 4CA0A 2DFHA 2JVHA 4H0EA 4G12A 1FJLA 1W5CC 4V2FA 3BZ6A 2JWTA 3CP2A 1KQ9A 2DOEA 5K5QA 3WTTC 1JUPA 2R4GA 4MIMA 3UKGA 4MTDA 1AHDP 1ITYA 2X6YA 4I2OA 1QBJA 1JTXA 3LSGA 2CMPA 3GTJJ 1TT5B 2FNAA 1TNSA 4P1WA 1SD6A 3B73A 3RPUA 4AD9A 3CMAI 2LREA 4Y17A 1W36C 2MBFA 5HS8A 2A07F 1YJNI 2DYRH 4S05A 1LKXA 1B1BA 1YW9A 2COBA 4NDLA 1FP1D 5IPAA 1VQOI 3PL8A 3SZTA 5BS6A 4RGSA 4Z6YA 2IGKA 4QPOA 3I59A 5TISC 1KA8A 3NWTA 2GAUA 3EUHA 5F1JA 3RYPA 2CUJA 2OA4A 3NQOA 2JZYA 2GWRA 1EJ9A 1LDKB 4XMYA 1D0YA 3BJAA 4ZDLA 1F36A 1EH8A 3H36A 4BQOA 1DDNA 2KRHA 4U7BA 1ZELA 3JRBA 2O8KA 2NOJB 3G4SI 1S7OA 4GYGA 3JRHA 1MBHA 2JJ7A 2GA1A 5DTDA 3ZN0A 4IRGA 2V1NA 3A0BC 1IN6A 2B9SA 2IRFG 3F9KA 3FBNB 1FWZA 3ZQCA 4DYCA 2XROA 5J47A 4XK4A 3EETA 4XKBA 2TDXA 3JAMK 3JRIA 1U8BA 3IAS2 1PUEE 2L9RA 3F21A 5ICCA 2JRTA 2Y48A 1FY7A 2LFBA 1A36A 4HF2A 4X1EA 2BV6A 2KZGA 3BTJA 2OCEA 3HOXJ 3CO7C 4F55A 2QVOA 1O57A 1GVJA 3H5RA 4Y7NJ 5DS9A 1LDJA 2NRAC 3GLXA 1I5ZA 3DU5A 2DFIA 2H94A 4PDKA 3H5NA 1I50J 4L18B 5BOXA 2JA7J 4L0YB 2ICWG 2W4SA 3DFGA 2MG4A 1MZBA 2K4BA 1RNLA 1YW7A 2EINH 4IPAA 4MQVA 4CH7A 4CGZA 2XF5A 4A3JJ 3JRCA 1GXPA 1EH7A 2PG4A 3RPUD 2LRDA 2K9NA 2Z16A 3DTKA 4CYDA 2L4MA 5J8CA 4M3BA 3TO6A 1EF4A 1XC5A 2K9MA 5GTIC 2KIMA 5F64A 2O3FA 3DKWA 5KK1A 3LSTA 3LFKA 1LPQA 5E17F 1SD4A 5H2FC 2LC2A 3BROA 4ABZA 3J81Z 2M4KA 1K6OA 3G1MA 3BG6A 2OF7A 3ZPLA 4P96A 1W5SA 2KISA 4GGGA 3OYBA 4LFUA 3H9GA 4J01A 3K10A 5FLXZ 2AXLA 4I02A 5D5WB 4RM2A 1R36A 1Y56A 3M8EA 2IJLA 2F6CA 5M5WJ 2KT0A 3HG9A 2L9VA 1P92A 2HWVA 2F4MB 3OYKA 1UCRA 3BP8A 3GVAA 1JHFA 2CW7A 4A6DA 4ENNA 2R5YB 1LQ1A 4A3IJ 2PJRA 3GTLJ 5GPCA 2DA4A 4AU7A 1JI8A 1B4AA 1B9MA 3H3ZA 2MFZA 5EG0B 4WWCA 4MFDA 2CSOA 1TW2A 3BCAA 3PFYA 1W7PA 4B43A 2HOTA 2YPRA 3GLLA 1I39A 4IO9F 3G1OA 4QTRA 4RB1A 2KP6A 1JKRC 1DP3A 2PX9A 1F9NA 3VOEA 2K86A 1KU9A 2VPRA 3H35A 3JR9A 4I6ZA 4HDVA 5HS7A 2A69F 1FMWA 2LNBA 3BG5A 4G7OF 4LK0F 2HR3A 1T98A 1AKHB 3GF2A 1X3WB 1R5GA 2IAIA 3HM5A 2DPUA 2ZXHA 1U5TB 5D5UB 4A3KJ 1V4RA 5GP9A 2ZCWA 4LITA 1W4MA 1S72I 1X3UA 2CG4A 2BW3B 5FRMA 1WJCA 2A05A 2DA3A 1MDMB 1FYLA 4OIPF 1ETWA 1R6RA 1SMTA 3Q9VA 3WU2C 1HW5A 4XRFA 1YE9A 2M7AA 3FXKA 3H3UA 4F52A 4D7MA 2LD5A 4XRSA 4XNFA 1KGSA 2BOLA 3HJEA 5ERIA 1D1AA 4ENJA 1P2FA 2F5DA 3IL2A 4ENMA 3DKXA 4BU2A 3TQNA 2GLOA 1U5TC 2X48A 3OY9A 5L3EA 2O6GE 2R5ZA 5ILSA 5D5VB 1PDNC 2P7CB 1WH7A 3WTVC 3FF5A 2R7VA 4EM0B 3K4JA 2PJPA 4OOIA 4ITVA 2QQ9A 1DQUA 1JXSA 1BI3A 4RLFA 3GZ6A 1BJZA 3P9CA 2E7WA 2NVTJ 5KNLA 2MC4A 3ZMSA 4Q5SF 4AVZA 3VEPA 4JX5A 3BTIA 2HVRA 2H27A 1TWFJ 2VODA 4RM3A 4JK1X 1W7PD 5FKNA 2F5VA 2R7OA 3RKYA 3V7RA 5H6QA 1XSVA 2XGEA 3DCFA 2X4HA 2ZFWA 4KNYA 3KEOA 4FHTA 1FBQA 1UG2A 1GUUA 2CYYA 3HKZA 3SZGA 2O0YA 3MZHA 1MMSA 5DEQA 3P5JA 4IRHA 3KX2A 2LR8A 4IF4A 2XAGA 1RR7A 2D5VA 2HOEA 4GDFA 1UB9A 3EYIA 1UFMA 3CDHA 2RDPA 1X1DA 4M74A 1X1CA 3KEQA 1Z6RA 4HF1A 2BXZA 3ROUA 1MMAA 2X85A 2HU9A 1NHAA 1BR1A 1BN5A 2BHYA 4NQWB 1VZ0A 4F92B 3WTWC 3O2PE 3HL2A 1LEBA 1ERDA 3CC4I 3LL7A 3I54A 3IRQA 4ESFA 2RAEA 3HC7A 3P7NA 3LAPA 2VC0A 2R92J 1D1BA 2A6EF 3LAJA 3B6AA 2QQBA 1ZG3A 2FE3A 4O6JA 1HW2A 1H0MA 4OIQF 3DV8A 1ZARA 2Z2SB 1YRNB 5LRSA 3QYFA 2R7QA 1BI1A 1WPKA 2Z1DA 1Z67A 2CJJA 2W84A 5A2QZ 3KP5A 4I0BA 3GFJA 2E5NA 1V55H 2R7RA 3E5XA 3QAHA 2AQFA 3ONQA 1W36D 2VXZA 4BEHB 2CQKA 2ME6A 4RDUA 1FOYA 1USTA 3IP4B 3VFZA 4EATA 2X1DA 1SFKA 5EZHA 1XGMA 4M3EA 2GIZA 2ZNZA 3ZXSA 2VPLA 3K7AJ 3ELKA 3S15J 1YJ9I 3HTSB 1UZCA 4QIWN 1KU3A 4IZZA 1HDDC 1MBFA 4M72A 1DGWY 1TT0A 1Y1VJ 2WB1N 1XD7A 2M5WA 5TGTA 3D5RC 3ZQHA 3HHHA 2VJ4A 3E6BA 1BI2A 4II2A 1A35A 5K5RA 5ICFA 1WVRA 5D6EA 2P0WA 1JUSA 4E7HA 3TO9A 1XG1A 2E5ZA 1ORKA 2STWA 3JTGA 4HV6A 2NVQJ 3DQVC 2VBYA 5FROA 2G7HA 2IT0A 2NVXJ 4I76A 3SJMA 3KFWX 3WU1B 3S2WA 4AIKA 4LLLA 4ON0A 1IF1A 1MJ9A 5FRNA 3BR1A 1J09A 3V7SA 5JR3A 2MD0A 1D0ZA 2JT1A 1Z9CA 3BG9A 3G1LA 1UG0A 2W85A 1TLHB 1IV6A 2ZNYA 4XN0A 3KP6A 2DFEA 3BR2A 1LB2A 4BKXA 4E7IA 4NUBA 3RTRA 5JVGF 1KQ8A 2VIXA 1R71A 1EKEA 2V4JC 3LA7A 3GZNB 4XQFA 1XPXA 1MGTA 3M7GA 2CV2A 1HXDA 1E2XA 3DBRB 4DYRA 2L5QA 2QM3A 2R5YA 4EJUA 2A68F 5M5YJ 3MKLA 3HYIA 1PUFB 1XSDA 3HTUA 2RC4A 3I9V2 5EG0A 3K4MA 2HGCA 2DMQA 4RS8A 4LB5A 2GOMA 2JA2A 1XX5A 1VQLI 2DMTA 3Q5FA 5DUIA 2LYCA 3PFIA 3HSFA 2VI6A 2ZSHB 3JRFA 1R00A 4M9ZA 1JTYA 1F43A 1R58A 4PJJA 3EUHC 2LKXA 3ZMUA 1LVAA 2I10A 2XGXA 3FM3A 1JE8A 1NTCA 4RLQA 2F5CA 1CF7B 2K5CA 5E8GA 3TGNA 3UR3C 1MBGA 4KMFA 1KQ0A 2L54A 2QF7A 3QYBA 3G73A 4HEA2 1AKHA 4KT5C 3DTIA 4U0WA 2ZBKA 4N4NB 1U5TA 1DPRA 4K2EA 1QPMA 2P5VA 3ZP5A 2E36A 3G71I 3H9JA 2BW3A 5JI6A 1MDMA 3FMQA 5E20A 4HPQA 2DA2A 3PSIA 5L3DA 1KONA 5HLIA 2VOPA 1HQCA 2LKPA 3WE3A 1IUFA 1WZ2A 1IRXA 2HPIA 1D5VA 4AUXA 3F0CA 3E6CC 3JTHA 4YFKF 4FTHA 3ABKH 3LSHA 3LSKA 2LY9A 4A5MA 3PJRA 2GXBA 1J7KA 2B0LA 2PMZA 3H0GJ 4U87A 3ZMZA 3KEYA 2Z5UA 4ETSA 2DTZA 3RYRA 2XHKA 3K4CA 2E7XA 2L01A 2NS7A 2HYFA 3LQQA 2PFBA 5FGMA 3L7WA 3MZYA 2M30A 1N78A 3KP3A 5EYRA 1YLFA 4PSWA 4ESBA 1F5TA 2XC7A 1IN5A 4IJAA 2HDDA 1IRFA 4YFNF 4RAZA 1CQTA 3QP5A 4GFBA 2LVSA 4HZFA 4E7KA 2LKSA 3KP2A 2CU7A 1H9TA 4HRIA 5IYCJ 2DK8A 3J7YJ 4L9NA 1T6SA 3I4NJ 2FBIA 1IDYA 2OUMA 4RGRA 1W0UA 1W1WE 2QKLB 1B9NA 3HIFA 3A0HC 1XMKA 1YITI 2UV1A 2KMUA 4EJTA 1WSUA 3BJOA 1P4WA 4A2UA 5DM6F 2WWYA 1I27A 4C3JJ 3ERMA 3WGHA 5C44J 4HF0A 1ZN2A 2CUZA 1XTAA 5GAGJ 4WF2A 2FRHA 2ELKA 3MAJA 1M1EB 3ZRGA 4BE0A 3NRVA 1MNEA 3V8KA 2K02A 4BBRJ 2M3AA 3F8CA 3R0AA 3HB9A 2CWEA 1D0XA 3S17J 2EWNA 2BXYA 2X6WA 3W3CA 3LA2A 1MMGA 4S0HB 5EGOB 2DO7A 1NK2P 2WY7Q 1OKRA 2FNPA 2ELHA 4NQWA 1H9GA 1XCVA 1B6AA 1KYWA 1JT0A 3TOBA 1QVUA 1LNWA 2IW5A 2CFXA 3TMOA 4OAYA 3J80Z 3HSRA 2QSHX 2FOKA 4NC6A 2KRFA 1YTYA 1U9NA 2WY8Q 4GCVA 2Y31A 4IHVA 2KIUA 3DWLE 2YX4A 3QYEA 1ZGWA 3GTOJ 4NNJA 3BZKA 1YRNA 1ZRCA 2IXSA 5DCMB 4JYKA 2EZKA 3AFHA 2RV8A 4AYBA 4F93B 4ZYHA 1K78B 2GXAA 3TP3A 1U78A 1FT9A 2X1EA 2ZXIA 4UVBA 2OQRA 3I4MJ 1O7LA 5HS9A 2FUG2 3TW7A 4KN7X 1D1CA 3L2RA 3CCLI 3R60A 4KITB 3OYCA 2FJ1A 3HGYA 4XKWA 4BEHA 4FASD 2HPMA 2DXIA 1A6QA 2DOFA 2P81A 3SZPA 4HAMA 3I56I 4B09A 4HNVA 1IN7A 3O8GA 2ECCA 2ELJA 2GBYA 3BCBA 4ANJA 4PFOA 3FM5A 2PBIA 1X1AA 4EV0A 4X6AJ 4IX7A 2DI3A 4A0ZA 4OINF 1WGXA 3BOQA 4BE1A 2XGDA 2KIQA 4ZTJA 4C3IJ 2N8GA 3KZZA 2XAUA 1C0WA 4KDPA 4IHSA 1H8AC 3JRGA 2MH9A 2KFDA 2LSOA 3OYFA 3CMYA 2L9SA 1BIAA 5J8FA 1Z77A 1BIBA 2P6SA 3R4KA 1I6XA 1FOKA 3WE2A 1RESA 3VSKA 2UWMA 2VL8A 2OCCH 2IA2A 3N05A 4RB2C 4MHGA 1MH4A 3PSFA 4CCLA 5LLQA 1IXRC 4CZCA 2E1OA 2GQQA 2HZTA 4G6TB 1Y0UA 4MLOA 2EILH 3CMEI 4BS9A 2Y75A 1IV8A 1G8XA 2EFQA 2WAQA 3S93A 1BOAA 3O6BB 1WI9A 2L7ZA 2V1XA 2V9VA 1HSJA 4UV9A 3JRAA 2A5WA 2VKVA 3OSFA 3K4BA 4DZPA 2W00A 2RKHA 3REOA 1MMDA 3CC7I 1PUFA 3S2DJ 5CLSA 4BDYA 1ACIA 1ETXA 1ZR4A 2HS5A 2ZXWH 3I4PA 1XB4A 1G6NA 1ZYRF 3CCSI 4PCQA 5IT3A 2BBYA 3IUOA 3GYHX 3MVPA 4B47A 2NAZA 2HQAA 3TL4X 4MEXF 3W6JB 5ILUA 1MSFC 2E2IJ 5FFZA 2OZUA 3HDDA 2BEOA 4XLAA 5FO5A 1BW6A 3BT9A 5DD4A 2K85A 3CQZJ 3MMYB 3LNQA 2HDCA 1T0FC 1YHQI 2EA4A 1HBXG 3SDBA 1X2MA 2GXGA 2XVCA 1CF7A 2ID3A 1LEAA 1HKSA 5HNHA 4RB0A 4A0XA 4KYWA 3DLAA 2DYSH 4LIUA 1RC9A 3MN2A 4ESJA 2W57A 3BG7A 2RNJA 5KCMA 3TW6A 2H8WA 2JMWA 3GFLA 1HKQA 2UXXA 3Q0WA 2HFHA 1U0JA 2IS6A 3L1PA 4HLXA 3C2HA 2JN6A 5JLXA 1T08B 3OL3A 1GDTA 1IJWC 4LD5A 3MCZA 1TWCJ 2Q1ZB 3RIRA 3CJTB 4BQQA 2ISZA 2ESNA 1WJBA 2EFOA 5CKTA 4PSXA 3H9QA 5J40A 4WCGA 1N25A 1MD0A 4N0BA 4QPQA 2XUBA 2DW4A 2DTRA 1YIJI 2X6OA 2OQGA 2FMLA 4XONA 1B72B 5HLHA 3AAFA 2Y9ZA 3BQYA 1JGGA 2X6XA 2OZ6A 4XOTA 5J1UA 2EA2A 1IDZA 3TBIA 2LOOA 5E3MA 3F8FA 3MWMA 4PJNA 4KICA 4PGHA 2P4WA 1O3TA 3DKYA 1LUJB 4JX4A 3FXQA 2GM4A 2EK5A 1XGOA 3MQ0A 5E1XA 1SFEA 2FA5A 4EGZA 1IC8A 4R8HA 2OTJI 5EEAA 1XDUA 2XV4S 3J7AY 3PIOF 2AQEA 3M9AA 3PIPF 2XAHA 4UXNA 5B1BH 1VQ9I 3CDLA 5CVUA 1B59A 2BGCA 2ZJPF 1FX7A 2HZDA 3D1NI 3IWFA 1VNDA 1OCTC 3V7CA 4FT8A 5FJ8J 4E7LA 1YOVB 1YX3A 1XCBA 3U1KA 2EB7A 5B1AH 3F6VA 1A5JA 2X0LA 3NWSA 2KQRA 4M71A 4NBQA 5A2QK 4HQEA 3DPLC 1YJWI 1V5EA 1WWXA 4AVPA 2JTVA 3PQJA 3IH4A 5KAIC 2W82A 1REPC 4CCMA 1S9HA 1SVOA 2DMPA 3TKYA 5ILVA 2Q0OA 2XSJC 5EGOA 3BLYA 2Q2EB 1FTZA 2Y0SN 4G94A 1JKOC 1R1UA 1VI0A 3SXYA 3CCEI 1ZH5A 4CXFA 2XRLA 4Z2YA 1Z05A 2KZVA 2VT3A 3H1CA 3ABUA 1OR7C 3KP7A 1S8NA 5GAEJ 4WK8F 5LEJA 3S3OA 4IEJA 3ZMTA 5GTHC 1S29A 3CZ6A 5IOZA 5HDGA 2RNGA 3QPTA 5C4JJ 1G4DA 4ZZDA 4V19K 2XIGA 2MSYA 1SD5A 4PJMA 2M0CA 5DCMA 3R0JA 4C2TA 2L3DA 1T39A 5LGNA 4EQQA 1BC8C 3DLLF 1K78A 2EIJH 4FE7A 2QSFX 1YIOA 5AIQA 2EZLA 4JX6A 2LP0A 2LDUA 2CS3A 3K1PA 4HX4A 3L2VA 1LDDA 1QHHD 3BWGA 5HLTA 2QUFA 1MMNA 3R6SA 3WTUC 3CCVI 2F48A 2UZKA 3M1EA 3RPQA 3GTMJ 2OAZA 3QWLA 3E97A 2XB0X 3FBIB 4AIHA 2CW0F 1OISA 1UJ8A 5L3CA 4IXAA 2Z99A 2QA4I 3W6VA 2QCOA 2XKPA 2L0KA 3DXJF 5F04A 1T95A 4ZJZA 2OTLI 3HRUA 5DYMA 3QPHA 5JLWA 2DFFA 4XSXF 3KETA 1VQ6I 3PM1A 1G3SA 2RQPA 2KRCA 3JAMZ 3JREA 1I6HJ 1HDPA 2KIFA 1U9OA 2VJIA 1ETVA 1GT0C 4ZZLA 2WADA 3I5UA 3BDDA 3BR3A 1J2XA 3VWBA 3WHCA 3FKIJ 3Q0UA 3CCQI 5E3OA 2ECBA 1WCMJ 2VC1A 3ASNH 3VYSB 1NH3A 2HXIA 2YU3A 5K5OA 4IHYA 3CCRI 2DQLA 5LBQA 3MZ8A 4XM3A 3G3ZA 2NOGA 2NXNB 5E3LA 4Y52J 1FC3A 3CDIA 4BACA 1ZREA 1L0OC 1ZLKA 1TQMA 2KLOA 5HDKA 4F3QA 2YX7A 1T0FA 4BDZA 1K79A 1FBUA 4HBLA 3K2AA 4I99C 3L2QA 2AS5F 1QQIA 3D0SA 1IRGA 3H92A 1XS9A 4PZJA 1O4XA 1DP7P 1IG7A 3GZ5A 1UMQA 2LH9A 3NARA 5JHUA 2A6TA 4XLFA 2V6CA 4GO1A 2IP2A 5FKKA 4BJTA 3I0TA 3CP8A 1G3YA 4HSTA 1FNNA 3K6GA 3K4KA 1QZZA 4EMSA 3K4NA 1J59A 4GRIA 4BUPA 2ZJQF 1K7AA 4UUSB 2DMUA 2DLLA 3NEUA 2EV6A 1ETYA 1Z3YA 1X1PA 4II3A 1ZLJA 2J5PA 2HVSA 4YRVA 1U6GA 4A3MJ 4J19A 2VE9A 3CJNA 2NNYA 1ON2A 4S04A 2JSPA 2K3FA 2HOAA 2JUCA 1R22A 4CYCB 4Y13A 2LK2A 2VE8A 1D3YA 2EZIA 1TP4A 3K70C 1XGNA 2RREA 1FSHA 1BR2A 2KKOA 3IH3A 4I01A 4XR6A 4CO8A 4HNTA 5FLVA 1O7FA 4XRMA 2V9PA 4HSRA 4F7ZA 3FMRA 1X2NA 1ONVA 2OV7A 3VSLA 4DBRA 1GHCA 3C1DA 3OYNA 2IPQX 3K1MA 4A0YA 4MNUA 1JUMA 1LJ9A 4FX0A 4IHTA 5M3FJ 2R7DA 4XICA 2DPDA 1E3OC 1PJRA 1VQMI 2DAOA 4YELA 3EYYA 2HTSA 3WG7H 2X1CA 1OCRH 5E3NA 2HDWA 3FZVA 2DJIA 4HX7A 1K4SA 4DJAA 2HTJA 2H6BA 5ICEA 1B72A 1IN4A 1WH5A 4KIGA 2E1CA 5IP6A 4Y15A 4A5NA 4ENKA 3K2ZA 5CVIA 3A02A 2FQ4A 3OYEA 2I5UA 2EV0A 1RR8C 2XPWA 1R1TA 3GTPJ 1WJ5A 3ML6A 3RZDJ 2M7BA 3KYDB 4BNCA 1V5FA 4MTEA 2QBYB 2Q8KA 4EVIA 1AOYA 3CCMI 4EJVA 3MKYB 2HXOA 4FQGA 3HUGB 5D6FA 3OIQA 4LMYA 2K7LA 4CCOA 1U3EM 2P7VB 2CO5A 1PYVA 1Z7UA 3BZCA 3TDZC 2XPVA 1OR7A 5EEGA 3G2BA 4KFCA 3HXLA 1J9IA 4UUTA 2IGMA 5F1RA 3KCCA 1CGPA 4B3XA 1OLTA 4UY8I 1BL0A 3WHBA 1HW1A 2PMHA 2KL4A 1P7IA 5IP7J 2NNNA 1R9TJ 4XLPF 1JHHA 3DF8A 2MABA 3OIPA 3P9IA 4CCNA 1JJ6C 3JW4A 5CVVA 2ACJA 1QGPA 4A3DJ 3HBLA 3WTSC 5DCFA 1E3HA 1MBKA 1EA3A 4L5JA 4DGWB 2K9LA 1TBXA 1HSTA 1XSXA 1KYZA 2DCEA 2Q2EA 5IY5H 3BR0A 2L7KA 3V4GA 2EIKH 3M8FA 4RAYA 3WTZA 5B66C 2ETHA 4XN3A
chains in the Genus database with same CATH topology
2XASA 3C7JA 1YFHA 2MA3A 1R7JA 5D8KB 3V8JA 2BE5F 5D5XB 4BH9A 2DK5A 5CVJA 3DPTA 1TQPA 4OIOF 1S7AA 1A04A 1OYWA 3WODF 1ZRFA 3PQKA 1OMIA 4UNOA 2EJRA 3I53A 2DU9A 1QZYA 1G3WA 4HLYA 2XKOA 3JSPA 2P5LC 2KJCA 1VTNC 4G6DA 4BHPA 1Q1HA 2W24A 3FMSA 3IKTA 3FXUA 3RKWA 4KUMA 4OMZA 2K27A 1OPCA 2O61A 4WX9A 1L3LA 1I1GA 3IRRA 4E70A 1RZ4A 1E17A 4MEYF 3BY6A 1IXCA 1EV7A 4O5VA 3QRFF 3ECHA 3F8BA 2P5KA 3SHFA 1HKTA 3ZN1A 5E18F 3VB2A 2OU2A 1BI0A 1XDSA 2O03A 5FB2A 1WRJA 3HOTA 3VODA 3I58A 1WQ2A 4HOBA 1RUOA 2A6HF 5F6FA 4RB3C 2M45A 1EH6A 4GYIA 5ICGA 3GX4X 4LLNA 6PAXA 3V8LA 3ZMVA 2LF7A 2ZMEB 4I0AA 3D5LA 3FHZA 4G9YA 2PQ8A 5LGUA 4EJOA 2VT2A 4HV5A 3E5QA 4G7ZF 1Z91A 4BXUA 2Z3YA 4G6QA 2ZJ2A 2HQRA 3F72A 4P5OA 4ZYEA 2VBZA 3QU3A 2F2EA 3J81K 3BJ6A 4ASNA 2D45A 3ZMDA 2MD5A 1TTYA 4G7HF 5FLXK 4A6EA 3WTYC 1RUNA 3BPXA 4KMUX 5BPIA 1ZG5A 4UVAA 2UXNA 4IVNA 3QP6A 4MGRA 4Q47A 1YS7A 2IA0A 4NB5A 3K69A 4EM2A 1KU2A 1UHMA 2W25A 3HHGA 5DUKA 3T0YA 3WU0A 5IT9Z 4UUVA 3CUQA 2QBYA 2P8TA 1RIOH 2D2WA 2K4JA 2H09A 5CVRA 3HUGA 1J5YA 1T38A 2A5YB 3CLOA 4N9HA 4O3MA 5E1ZB 3L2CA 5BMZA 3IC7A 4GXOA 5L3FA 2M8EA 5HOOA 1SFXA 4I09A 3WGGA 4XBFA 2QZ8A 3T8TA 5FFXA 2P6TA 4AWXB 2WTEA 4HYEA 4L9TA 5D4RA 2ZO4A 2PMUA 1YG2A 3IKVA 3N97A 3GFIA 1S3JA 2WC2A 2C6YA 4LB6B 2WV0A 4M6XA 4LG0B 1FYMA 2OBPA 3QU6A 2GZWA 2FMYA 4L5IA 2H6CA 1D8KA 3KP4A 2VOOA 2PN6A 2L02A 2FBHA 5TRDA 5EEHA 1FBSA 1G3TA 1IN8A 4HW0A 1SFUA 4OMYA 3SQNA 2E1NA 1DUXC 3CO6C 3HRTA 3O3KA 1ZG1A 2YSRA 1XGSA 3TOAA 3T8RA 3ISPA 1ZAOA 5AIPA 4CHUA 1IW7F 3GXOA 2R3SA 1KU7A 4U7DA 2QYOA 3F22A 3B02A 5LHIA 1TNTA 2QWWA 3BPVA 1JGSA 3HSEA 4LLGF 3HOSA 2ESHA 1YW8A 2XAQA 3I71A 2ZKZA 3K0LA 3RI4A 5AONA 2JPCA 3HRMA 2ZMEA 1YS6A 4BHCA 4L9JA 2RVCA 3DP7A 5D8LB 2NS0A 2DBBA 2DT5A 3JSOA 5H6RA 1SAXA 4CICA 1W5TA 3FWEA 4B8XA 1QNTA 2L4AA 4D0PA 3U1DA 4HDUA 5DD8A 4NHJA 2D1HA 3GW2A 1PP7U 3GEZA 3L9FA 4JBAA 4BHBA 2IA1A 3GO5A 4KN4X 2QLZA 2FQ3A 3C3WA 3U2RA 4UV8A 4WXHA 2FU4A 2HKOA 1P4XA 4OIRF 2STTA 2M1BA 4YG2F 1F4KA 1I1SA 4LJZF 2COMA 2R7FA 4LGWA 2CGPA 1RI7A 3R61A 1U8RA 4N9IA 3ULQB 1QO0D 4M9SA 2VBXA 4FX4A 3KZYA 5ED4A 5FD5A 5KVRA 5HVQC 1IAWA 4U0VA 2GA2A 2EFPA 4HA8A 3CUOA 2FSWA 3F3XA 4JQFA 1BM9A 4TV7A 3QOPA 3KLOA 1J75A 3W6KB 1P6RA 2FBKA 3KLNA 4ZYGA 1ZHFA 2LF8A 1DPUA 5H20A 1R23A 1F1ZA 2OD5A 2RGVA 4M6YA 2EV5A 4BQAA 2RN7A 4EJWA 5DV5A 3OV8A 4EGYA 1R1VA 2EFNA 1FSEA 2GIVA 4M73A 3EDPA 2QQAA 5J6XA 5FD6A 4LG0A 2XAJA 3WG9A 2MC3A 4R1HA 2ISYA 1MKMA 2MLGA 3RDIA 3T1BA 4ZH4F 4M9XA 2YR2A 3TDUC 4BAYA 4RGXA 2D1VA 4ZYDA 4P9UA 4A12A 5HDNA 1XMAA 4P9FA 4KIBA 3HRSA 1U2WA 3MEXA 1T2KA 3I64A 1XN7A 1V3FA 2Z9OA 1FPQA 3F23A 5BPDA 1TW3A 2EFWA 3RKXA 4HQMA 3ERED 1FYKA 2FXAA 3DEUA 3CUQB 4Q48A 1MJAA 3F8NA 4WXCA 3LWFA 3E6MA 4KA4A 2MLKA 4PGGA 4YFXF 1OYIA 5L3GA 3J80K 4WXDA 4DQ2A 1SD7A 4CDGA 1Z1DA 4UHTA 1BC7C 1Z6TA 3E3VA 5D4SA 5JFRA 4YIFA 1FZPB 3CUQC 4XLNF 1YYVA 4P55A 1ODDA 3N4MA 2PLYA 3I59B 4Q4ZF 4KIFA 1ZGJA 4L9VA 4QWQA 4U88A 4DNCA 2ZXJA 1TQIA 5E8IA 1IZ1A 2VBWA 3U9GA 2PEXA 3SFZA 3ECOA 4OU0A 2F5FA 2HEOA 4L0ZB 3GWZA 1YO5C 3E5UA 3EQLF 1FLIA 3F6OA 1OYYA 3WGIA 3L09A 5IT9K 1O3QA 5CJ9A 1WKMA 3WTXC 3IHUA 2PI0A 1YQAA 1ON1A 5K1YA 2V1UA 2JSCA 4I98B 2IVMA 2ADUA 2V1DA 5TJJA 2A3SA 3CTAA 5LRRA 1USSA 4EM1A 3FX3A 2QENA 1J0RA 1ZGAA 4BYYA 1MJBA 4MQ9F 1AWCA 2VONA 5LEKA 1S6LA 2HKXA 2KJBA 3GFMA 2XRNA 3J7AO 4CZZA 2MH2A 3LA3A 2Y0MA 4HX8A 5LGTA 3RJPA 5BQTA 2HYGD 4QLCU 3MFKA 4R79A 1IUYA 4AIJA 4YIIA 2DQRA 2O8XA 1ZRDA 5JVTA 3E6DA 4IRIA 1BJAA 2Z33A 1W7PB 5DDGA 2G9WA 1BBYA 3OOPA 2FF4A 4G8XA 3LQRA 1PP8F 3FXRA 2J5OA 3L00A 5HLGA 1P4AA 1O3RA 3KE2A 3Q9SA 3K9TA 3F8MA 1UHWA 1D8JA 2BYVE 4XSZF 1FP2A 4U0YA 4LK1F 5E1WA 1IXSB 4UVCA 1SMYF 2M87A 2HQNA 3COAC 3IWZA 1STZA 3ABTA 2VN2A 3T5XA 2A61A 2JPBA 3P9KA 2FEZA 3K1NA 1ULYA 1GXQA 2XAFA 1O3SA 5LHHA 2V79A 3GUDA 1R5HA 2NYXA 2G7UA 5CYVA 3TO7A 3C18A 2F5EA 4I7HA 5L3BA 4RGUA 3ZQ7A 5LHGA 4H0EA 3BZ6A 1KQ9A 5K5QA 3WTTC 4MTDA 4I2OA 1QBJA 2FNAA 1TNSA 1SD6A 3B73A 3RPUA 4AD9A 4Y17A 2A07F 5HS8A 2MBFA 4S05A 1B1BA 1YW9A 1FP1D 3SZTA 5BS6A 4RGSA 3I59A 1KA8A 2GAUA 3EUHA 3RYPA 2OA4A 3NQOA 2JZYA 2GWRA 1LDKB 3BJAA 1DDNA 1EH8A 4U7BA 1S7OA 4GYGA 3ZN0A 2GA1A 4IRGA 1IN6A 2IRFG 1FWZA 2XROA 3EETA 2TDXA 3JAMK 1PUEE 3F21A 5ICCA 2JRTA 2Y48A 1FY7A 4HF2A 2BV6A 3CO7C 2QVOA 1O57A 1GVJA 1LDJA 2NRAC 3GLXA 1I5ZA 2DFIA 2H94A 4PDKA 4L18B 5BOXA 4L0YB 3DFGA 1YW7A 1MZBA 2K4BA 1RNLA 4IPAA 4MQVA 4CGZA 1GXPA 1EH7A 2PG4A 4CYDA 2L4MA 5J8CA 3TO6A 2KIMA 5F64A 2O3FA 3DKWA 5KK1A 3LSTA 3LFKA 5E17F 1SD4A 3BROA 3J81Z 1K6OA 3ZPLA 4P96A 1W5SA 4GGGA 4LFUA 5FLXZ 2AXLA 4I02A 5D5WB 1R36A 3M8EA 2IJLA 1P92A 2HWVA 1UCRA 3BP8A 3GVAA 1JHFA 4A6DA 4ENNA 1LQ1A 1B4AA 1B9MA 3H3ZA 4WWCA 2CSOA 1TW2A 1W7PA 2YPRA 4RB1A 1F9NA 3VOEA 2K86A 1KU9A 4HDVA 5HS7A 2A69F 2LNBA 4G7OF 4LK0F 2HR3A 1T98A 3GF2A 1R5GA 2DPUA 1U5TB 5D5UB 1V4RA 2ZCWA 1W4MA 1X3UA 2CG4A 1MDMB 4OIPF 1FYLA 1SMTA 3Q9VA 1HW5A 4XRFA 3H3UA 1KGSA 5ERIA 4ENJA 1P2FA 2F5DA 3IL2A 4ENMA 3TQNA 1U5TC 5L3EA 2O6GE 5ILSA 5D5VB 1PDNC 2P7CB 3WTVC 3FF5A 4EM0B 2PJPA 4OOIA 2QQ9A 1JXSA 1BI3A 3GZ6A 3P9CA 2E7WA 3ZMSA 4Q5SF 3VEPA 2H27A 2VODA 4JK1X 1W7PD 3RKYA 3V7RA 5H6QA 1XSVA 4KNYA 2X4HA 2ZFWA 3KEOA 4FHTA 1FBQA 2CYYA 2O0YA 3MZHA 5DEQA 4IRHA 4IF4A 2XAGA 2HOEA 1UB9A 3EYIA 1UFMA 3CDHA 2RDPA 4M74A 4HF1A 3KEQA 1Z6RA 3ROUA 3WTWC 1NHAA 1BN5A 3O2PE 1LEBA 3I54A 3IRQA 4ESFA 3P7NA 3LAPA 2VC0A 2A6EF 3LAJA 2QQBA 1ZG3A 2FE3A 4O6JA 1HW2A 1H0MA 4OIQF 3DV8A 1ZARA 5LRSA 1BI1A 2W84A 5A2QZ 3KP5A 4I0BA 3GFJA 3E5XA 3QAHA 2VXZA 2CQKA 1USTA 3VFZA 1XGMA 2ZNZA 3ELKA 3HTSB 1KU3A 4M72A 1XD7A 2M5WA 3HHHA 3E6BA 1BI2A 5K5RA 5ICFA 5D6EA 3TO9A 2STWA 3JTGA 4HV6A 3DQVC 2VBYA 2G7HA 2IT0A 3KFWX 3WU1B 3S2WA 4AIKA 4LLLA 4ON0A 1IF1A 1MJ9A 3V7SA 5JR3A 2JT1A 1Z9CA 2W85A 1TLHB 2ZNYA 3KP6A 1LB2A 3RTRA 1KQ8A 3LA7A 1MGTA 3M7GA 1HXDA 1E2XA 2QM3A 4EJUA 2A68F 3HYIA 1XSDA 3HTUA 2RC4A 2HGCA 4LB5A 4RS8A 3Q5FA 5DUIA 3PFIA 3HSFA 1R00A 4M9ZA 1R58A 3ZMUA 1LVAA 2XGXA 3FM3A 1JE8A 1CF7B 2F5CA 5E8GA 3TGNA 4KMFA 1KQ0A 2L54A 3G73A 4KT5C 4U0WA 2ZBKA 1U5TA 1DPRA 4K2EA 1QPMA 2P5VA 3ZP5A 5JI6A 1MDMA 3FMQA 5E20A 5L3DA 2VOPA 5HLIA 1HQCA 2LKPA 3WE3A 1D5VA 3E6CC 3JTHA 4YFKF 4A5MA 2GXBA 1J7KA 2B0LA 3ZMZA 2Z5UA 4ETSA 3RYRA 2XHKA 2E7XA 2L01A 2HYFA 3LQQA 2PFBA 5FGMA 3L7WA 3MZYA 2M30A 3KP3A 1YLFA 1F5TA 4ESBA 1IN5A 4IJAA 1IRFA 4YFNF 4RAZA 3QP5A 4HZFA 3KP2A 1H9TA 2DK8A 4L9NA 1T6SA 2FBIA 4RGRA 1B9NA 3HIFA 1XMKA 4EJTA 1WSUA 3BJOA 1P4WA 4A2UA 2WWYA 1I27A 3WGHA 4HF0A 1ZN2A 4WF2A 2FRHA 3MAJA 3NRVA 3V8KA 2K02A 3F8CA 3R0AA 2CWEA 2EWNA 3LA2A 2DO7A 1OKRA 2FNPA 2ELHA 4NQWA 1H9GA 1XCVA 1B6AA 1KYWA 3TOBA 1LNWA 2IW5A 2CFXA 3J80Z 3HSRA 2FOKA 2KRFA 1YTYA 4GCVA 2KIUA 2YX4A 1ZRCA 5DCMB 2RV8A 4ZYHA 1K78B 1U78A 1FT9A 4UVBA 2OQRA 1O7LA 5HS9A 4KN7X 3R60A 3SZPA 4HAMA 4B09A 1IN7A 3FM5A 2PBIA 4EV0A 2DI3A 4A0ZA 4OINF 3BOQA 3KZZA 1C0WA 4KDPA 4IHSA 2MH9A 2LSOA 1BIAA 5J8FA 1BIBA 2P6SA 3R4KA 1I6XA 1FOKA 3WE2A 2UWMA 4RB2C 2IA2A 4MHGA 5LLQA 1IXRC 2GQQA 2HZTA 1Y0UA 2Y75A 2EFQA 1BOAA 3O6BB 1WI9A 2V1XA 2V9VA 1HSJA 4UV9A 2RKHA 3REOA 5CLSA 2HS5A 3I4PA 1XB4A 1G6NA 1ZYRF 4PCQA 5IT3A 2BBYA 3GYHX 2NAZA 4MEXF 3W6JB 5ILUA 5FFZA 2OZUA 2BEOA 5FO5A 5DD4A 2HDCA 2EA4A 1HBXG 2GXGA 2XVCA 1CF7A 4KYWA 1LEAA 1HKSA 4RB0A 4A0XA 4ESJA 2W57A 2RNJA 3GFLA 1HKQA 2UXXA 2HFHA 4HLXA 4LD5A 3MCZA 3RIRA 2ISZA 2ESNA 2EFOA 4WCGA 1MD0A 4N0BA 2XUBA 2DW4A 2DTRA 2OQGA 2FMLA 5HLHA 3AAFA 2OZ6A 2EA2A 3F8FA 3MWMA 4KICA 4PGHA 2P4WA 1O3TA 3FXQA 2EK5A 1XGOA 3MQ0A 5E1XA 1SFEA 2FA5A 4EGZA 4R8HA 1XDUA 2XV4S 3M9AA 2XAHA 4UXNA 5CVUA 1B59A 2BGCA 1FX7A 3IWFA 3V7CA 4FT8A 1XCBA 2EB7A 3F6VA 2X0LA 4M71A 5A2QK 4HQEA 3DPLC 1WWXA 4AVPA 2JTVA 3PQJA 1REPC 3TKYA 5ILVA 2Q0OA 4G94A 1R1UA 3SXYA 1ZH5A 4CXFA 4Z2YA 1Z05A 2VT3A 3ABUA 3KP7A 1S8NA 4WK8F 5LEJA 3ZMTA 1S29A 5HDGA 3QPTA 1G4DA 4ZZDA 2XIGA 1SD5A 5DCMA 3R0JA 2L3DA 1T39A 5LGNA 4EQQA 1BC8C 1K78A 1YIOA 5AIQA 2LDUA 3K1PA 4HX4A 1LDDA 3BWGA 2QUFA 3WTUC 3R6SA 2UZKA 3M1EA 3RPQA 2OAZA 3E97A 4AIHA 2CW0F 5L3CA 4IXAA 2Z99A 2XKPA 3DXJF 3HRUA 5DYMA 3QPHA 4XSXF 3KETA 1G3SA 2RQPA 3JAMZ 2KIFA 4ZZLA 3I5UA 3BDDA 1J2XA 2VC1A 2YU3A 5K5OA 2DQLA 5LBQA 3G3ZA 1FC3A 1ZREA 1L0OC 1ZLKA 1TQMA 5HDKA 2YX7A 1T0FA 1K79A 1FBUA 4HBLA 2AS5F 1QQIA 3D0SA 1IRGA 3H92A 1DP7P 4PZJA 3GZ5A 5JHUA 4GO1A 2V6CA 2IP2A 3I0TA 1G3YA 1FNNA 1QZZA 4EMSA 1J59A 1K7AA 3NEUA 2DLLA 2EV6A 1ZLJA 2J5PA 1U6GA 2VE9A 3CJNA 2NNYA 1ON2A 4S04A 1R22A 4Y13A 2VE8A 1D3YA 1XGNA 1FSHA 2KKOA 4I01A 4CO8A 1O7FA 4F7ZA 3FMRA 1ONVA 1GHCA 3C1DA 2IPQX 3K1MA 4A0YA 4MNUA 1LJ9A 4FX0A 4IHTA 2R7DA 2DPDA 2DAOA 3EYYA 2HTSA 3FZVA 4HX7A 2HTJA 2H6BA 5ICEA 1IN4A 4KIGA 2E1CA 4Y15A 4A5NA 4ENKA 3K2ZA 5CVIA 2EV0A 1R1TA 3ML6A 4BNCA 4MTEA 2QBYB 2Q8KA 4EVIA 1AOYA 4EJVA 5D6FA 4LMYA 2K7LA 1U3EM 2P7VB 2CO5A 1Z7UA 3TDZC 1OR7A 5EEGA 4KFCA 1J9IA 5F1RA 3KCCA 1CGPA 1HW1A 2PMHA 2NNNA 4XLPF 1JHHA 3DF8A 3P9IA 3JW4A 5CVVA 2ACJA 1QGPA 3WTSC 5DCFA 4L5JA 1TBXA 1HSTA 1XSXA 1KYZA 2Q2EA 3V4GA 3M8FA 4RAYA 3WTZA 2ETHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAS A;  3C7J A;  1YFH A;  2MA3 A;  1R7J A;  5D8K B;  3V8J A;  2BE5 F;  5D5X B;  4BH9 A;  2DK5 A;  5CVJ A;  3DPT A;  1TQP A;  4OIO F;  1S7A A;  1A04 A;  1OYW A;  3WOD F;  1ZRF A;  3PQK A;  1OMI A;  4UNO A;  2EJR A;  3I53 A;  2DU9 A;  1QZY A;  1G3W A;  4HLY A;  2XKO A;  3JSP A;  2P5L C;  2KJC A;  1VTN C;  4G6D A;  4BHP A;  1Q1H A;  2W24 A;  3FMS A;  3IKT A;  3FXU A;  3RKW A;  4KUM A;  4OMZ A;  2K27 A;  1OPC A;  2O61 A;  4WX9 A;  1L3L A;  1I1G A;  3IRR A;  4E70 A;  1RZ4 A;  1E17 A;  4MEY F;  3BY6 A;  1IXC A;  1EV7 A;  4O5V A;  3QRF F;  3ECH A;  3F8B A;  2P5K A;  3SHF A;  1HKT A;  3ZN1 A;  5E18 F;  3VB2 A;  2OU2 A;  1BI0 A;  1XDS A;  2O03 A;  5FB2 A;  1WRJ A;  3HOT A;  3VOD A;  3I58 A;  1WQ2 A;  4HOB A;  1RUO A;  2A6H F;  5F6F A;  4RB3 C;  2M45 A;  1EH6 A;  4GYI A;  5ICG A;  3GX4 X;  4LLN A;  6PAX A;  3V8L A;  3ZMV A;  2LF7 A;  2ZME B;  4I0A A;  3D5L A;  3FHZ A;  4G9Y A;  2PQ8 A;  5LGU A;  4EJO A;  2VT2 A;  4HV5 A;  3E5Q A;  4G7Z F;  1Z91 A;  4BXU A;  2Z3Y A;  4G6Q A;  2ZJ2 A;  2HQR A;  3F72 A;  4P5O A;  4ZYE A;  2VBZ A;  3QU3 A;  2F2E A;  3J81 K;  3BJ6 A;  4ASN A;  2D45 A;  3ZMD A;  2MD5 A;  1TTY A;  4G7H F;  5FLX K;  4A6E A;  3WTY C;  1RUN A;  3BPX A;  4KMU X;  5BPI A;  1ZG5 A;  4UVA A;  2UXN A;  4IVN A;  3QP6 A;  4MGR A;  4Q47 A;  1YS7 A;  2IA0 A;  4NB5 A;  3K69 A;  4EM2 A;  1KU2 A;  1UHM A;  2W25 A;  3HHG A;  5DUK A;  3T0Y A;  3WU0 A;  5IT9 Z;  4UUV A;  3CUQ A;  2QBY A;  2P8T A;  1RIO H;  2D2W A;  2K4J A;  2H09 A;  5CVR A;  3HUG A;  1J5Y A;  1T38 A;  2A5Y B;  3CLO A;  4N9H A;  4O3M A;  5E1Z B;  3L2C A;  5BMZ A;  3IC7 A;  4GXO A;  5L3F A;  2M8E A;  5HOO A;  1SFX A;  4I09 A;  3WGG A;  4XBF A;  2QZ8 A;  3T8T A;  5FFX A;  2P6T A;  4AWX B;  2WTE A;  4HYE A;  4L9T A;  5D4R A;  2ZO4 A;  2PMU A;  1YG2 A;  3IKV A;  3N97 A;  3GFI A;  1S3J A;  2WC2 A;  2C6Y A;  4LB6 B;  2WV0 A;  4M6X A;  4LG0 B;  1FYM A;  2OBP A;  3QU6 A;  2GZW A;  2FMY A;  4L5I A;  2H6C A;  1D8K A;  3KP4 A;  2VOO A;  2PN6 A;  2L02 A;  2FBH A;  5TRD A;  5EEH A;  1FBS A;  1G3T A;  1IN8 A;  4HW0 A;  1SFU A;  4OMY A;  3SQN A;  2E1N A;  1DUX C;  3CO6 C;  3HRT A;  3O3K A;  1ZG1 A;  2YSR A;  1XGS A;  3TOA A;  3T8R A;  3ISP A;  1ZAO A;  5AIP A;  4CHU A;  1IW7 F;  3GXO A;  2R3S A;  1KU7 A;  4U7D A;  2QYO A;  3F22 A;  3B02 A;  5LHI A;  1TNT A;  2QWW A;  3BPV A;  1JGS A;  3HSE A;  4LLG F;  3HOS A;  2ESH A;  1YW8 A;  2XAQ A;  3I71 A;  2ZKZ A;  3K0L A;  3RI4 A;  5AON A;  2JPC A;  3HRM A;  2ZME A;  1YS6 A;  4BHC A;  4L9J A;  2RVC A;  3DP7 A;  5D8L B;  2NS0 A;  2DBB A;  2DT5 A;  3JSO A;  5H6R A;  1SAX A;  4CIC A;  1W5T A;  3FWE A;  4B8X A;  1QNT A;  2L4A A;  4D0P A;  3U1D A;  4HDU A;  5DD8 A;  4NHJ A;  2D1H A;  3GW2 A;  1PP7 U;  3GEZ A;  3L9F A;  4JBA A;  4BHB A;  2IA1 A;  3GO5 A;  4KN4 X;  2QLZ A;  2FQ3 A;  3C3W A;  3U2R A;  4UV8 A;  4WXH A;  2FU4 A;  2HKO A;  1P4X A;  4OIR F;  2STT A;  2M1B A;  4YG2 F;  1F4K A;  1I1S A;  4LJZ F;  2COM A;  2R7F A;  4LGW A;  2CGP A;  1RI7 A;  3R61 A;  1U8R A;  4N9I A;  3ULQ B;  1QO0 D;  4M9S A;  2VBX A;  4FX4 A;  3KZY A;  5ED4 A;  5FD5 A;  5KVR A;  5HVQ C;  1IAW A;  4U0V A;  2GA2 A;  2EFP A;  4HA8 A;  3CUO A;  2FSW A;  3F3X A;  4JQF A;  1BM9 A;  4TV7 A;  3QOP A;  3KLO A;  1J75 A;  3W6K B;  1P6R A;  2FBK A;  3KLN A;  4ZYG A;  1ZHF A;  2LF8 A;  1DPU A;  5H20 A;  1R23 A;  1F1Z A;  2OD5 A;  2RGV A;  4M6Y A;  2EV5 A;  4BQA A;  2RN7 A;  4EJW A;  5DV5 A;  3OV8 A;  4EGY A;  1R1V A;  2EFN A;  1FSE A;  2GIV A;  4M73 A;  3EDP A;  2QQA A;  5J6X A;  5FD6 A;  4LG0 A;  2XAJ A;  3WG9 A;  2MC3 A;  4R1H A;  2ISY A;  1MKM A;  2MLG A;  3RDI A;  3T1B A;  4ZH4 F;  4M9X A;  2YR2 A;  3TDU C;  4BAY A;  4RGX A;  2D1V A;  4ZYD A;  4P9U A;  4A12 A;  5HDN A;  1XMA A;  4P9F A;  4KIB A;  3HRS A;  1U2W A;  3MEX A;  1T2K A;  3I64 A;  1XN7 A;  1V3F A;  2Z9O A;  1FPQ A;  3F23 A;  5BPD A;  1TW3 A;  2EFW A;  3RKX A;  4HQM A;  3ERE D;  1FYK A;  2FXA A;  3DEU A;  3CUQ B;  4Q48 A;  1MJA A;  3F8N A;  4WXC A;  3LWF A;  3E6M A;  4KA4 A;  2MLK A;  4PGG A;  4YFX F;  1OYI A;  5L3G A;  3J80 K;  4WXD A;  4DQ2 A;  1SD7 A;  4CDG A;  1Z1D A;  4UHT A;  1BC7 C;  1Z6T A;  3E3V A;  5D4S A;  5JFR A;  4YIF A;  1FZP B;  3CUQ C;  4XLN F;  1YYV A;  4P55 A;  1ODD A;  3N4M A;  2PLY A;  3I59 B;  4Q4Z F;  4KIF A;  1ZGJ A;  4L9V A;  4QWQ A;  4U88 A;  4DNC A;  2ZXJ A;  1TQI A;  5E8I A;  1IZ1 A;  2VBW A;  3U9G A;  2PEX A;  3SFZ A;  3ECO A;  4OU0 A;  2F5F A;  2HEO A;  4L0Z B;  3GWZ A;  1YO5 C;  3E5U A;  3EQL F;  1FLI A;  3F6O A;  1OYY A;  3WGI A;  3L09 A;  5IT9 K;  1O3Q A;  5CJ9 A;  1WKM A;  3WTX C;  3IHU A;  2PI0 A;  1YQA A;  1ON1 A;  5K1Y A;  2V1U A;  2JSC A;  4I98 B;  2IVM A;  2ADU A;  2V1D A;  5TJJ A;  2A3S A;  3CTA A;  5LRR A;  1USS A;  4EM1 A;  3FX3 A;  2QEN A;  1J0R A;  1ZGA A;  4BYY A;  1MJB A;  4MQ9 F;  1AWC A;  2VON A;  5LEK A;  1S6L A;  2HKX A;  2KJB A;  3GFM A;  2XRN A;  3J7A O;  4CZZ A;  2MH2 A;  3LA3 A;  2Y0M A;  4HX8 A;  5LGT A;  3RJP A;  5BQT A;  2HYG D;  4QLC U;  3MFK A;  4R79 A;  1IUY A;  4AIJ A;  4YII A;  2DQR A;  2O8X A;  1ZRD A;  5JVT A;  3E6D A;  4IRI A;  1BJA A;  2Z33 A;  1W7P B;  5DDG A;  2G9W A;  1BBY A;  3OOP A;  2FF4 A;  4G8X A;  3LQR A;  1PP8 F;  3FXR A;  2J5O A;  3L00 A;  5HLG A;  1P4A A;  1O3R A;  3KE2 A;  3Q9S A;  3K9T A;  3F8M A;  1UHW A;  1D8J A;  2BYV E;  4XSZ F;  1FP2 A;  4U0Y A;  4LK1 F;  5E1W A;  1IXS B;  4UVC A;  1SMY F;  2M87 A;  2HQN A;  3COA C;  3IWZ A;  1STZ A;  3ABT A;  2VN2 A;  3T5X A;  2A61 A;  2JPB A;  3P9K A;  2FEZ A;  3K1N A;  1ULY A;  1GXQ A;  2XAF A;  1O3S A;  5LHH A;  2V79 A;  3GUD A;  1R5H A;  2NYX A;  2G7U A;  5CYV A;  3TO7 A;  3C18 A;  2F5E A;  4I7H A;  5L3B A;  4RGU A;  3ZQ7 A;  5LHG A;  4H0E A;  3BZ6 A;  1KQ9 A;  5K5Q A;  3WTT C;  4MTD A;  4I2O A;  1QBJ A;  2FNA A;  1TNS A;  1SD6 A;  3B73 A;  3RPU A;  4AD9 A;  4Y17 A;  2A07 F;  5HS8 A;  2MBF A;  4S05 A;  1B1B A;  1YW9 A;  1FP1 D;  3SZT A;  5BS6 A;  4RGS A;  3I59 A;  1KA8 A;  2GAU A;  3EUH A;  3RYP A;  2OA4 A;  3NQO A;  2JZY A;  2GWR A;  1LDK B;  3BJA A;  1DDN A;  1EH8 A;  4U7B A;  1S7O A;  4GYG A;  3ZN0 A;  2GA1 A;  4IRG A;  1IN6 A;  2IRF G;  1FWZ A;  2XRO A;  3EET A;  2TDX A;  3JAM K;  1PUE E;  3F21 A;  5ICC A;  2JRT A;  2Y48 A;  1FY7 A;  4HF2 A;  2BV6 A;  3CO7 C;  2QVO A;  1O57 A;  1GVJ A;  1LDJ A;  2NRA C;  3GLX A;  1I5Z A;  2DFI A;  2H94 A;  4PDK A;  4L18 B;  5BOX A;  4L0Y B;  3DFG A;  1YW7 A;  1MZB A;  2K4B A;  1RNL A;  4IPA A;  4MQV A;  4CGZ A;  1GXP A;  1EH7 A;  2PG4 A;  4CYD A;  2L4M A;  5J8C A;  3TO6 A;  2KIM A;  5F64 A;  2O3F A;  3DKW A;  5KK1 A;  3LST A;  3LFK A;  5E17 F;  1SD4 A;  3BRO A;  3J81 Z;  1K6O A;  3ZPL A;  4P96 A;  1W5S A;  4GGG A;  4LFU A;  5FLX Z;  2AXL A;  4I02 A;  5D5W B;  1R36 A;  3M8E A;  2IJL A;  1P92 A;  2HWV A;  1UCR A;  3BP8 A;  3GVA A;  1JHF A;  4A6D A;  4ENN A;  1LQ1 A;  1B4A A;  1B9M A;  3H3Z A;  4WWC A;  2CSO A;  1TW2 A;  1W7P A;  2YPR A;  4RB1 A;  1F9N A;  3VOE A;  2K86 A;  1KU9 A;  4HDV A;  5HS7 A;  2A69 F;  2LNB A;  4G7O F;  4LK0 F;  2HR3 A;  1T98 A;  3GF2 A;  1R5G A;  2DPU A;  1U5T B;  5D5U B;  1V4R A;  2ZCW A;  1W4M A;  1X3U A;  2CG4 A;  1MDM B;  4OIP F;  1FYL A;  1SMT A;  3Q9V A;  1HW5 A;  4XRF A;  3H3U A;  1KGS A;  5ERI A;  4ENJ A;  1P2F A;  2F5D A;  3IL2 A;  4ENM A;  3TQN A;  1U5T C;  5L3E A;  2O6G E;  5ILS A;  5D5V B;  1PDN C;  2P7C B;  3WTV C;  3FF5 A;  4EM0 B;  2PJP A;  4OOI A;  2QQ9 A;  1JXS A;  1BI3 A;  3GZ6 A;  3P9C A;  2E7W A;  3ZMS A;  4Q5S F;  3VEP A;  2H27 A;  2VOD A;  4JK1 X;  1W7P D;  3RKY A;  3V7R A;  5H6Q A;  1XSV A;  4KNY A;  2X4H A;  2ZFW A;  3KEO A;  4FHT A;  1FBQ A;  2CYY A;  2O0Y A;  3MZH A;  5DEQ A;  4IRH A;  4IF4 A;  2XAG A;  2HOE A;  1UB9 A;  3EYI A;  1UFM A;  3CDH A;  2RDP A;  4M74 A;  4HF1 A;  3KEQ A;  1Z6R A;  3ROU A;  3WTW C;  1NHA A;  1BN5 A;  3O2P E;  1LEB A;  3I54 A;  3IRQ A;  4ESF A;  3P7N A;  3LAP A;  2VC0 A;  2A6E F;  3LAJ A;  2QQB A;  1ZG3 A;  2FE3 A;  4O6J A;  1HW2 A;  1H0M A;  4OIQ F;  3DV8 A;  1ZAR A;  5LRS A;  1BI1 A;  2W84 A;  5A2Q Z;  3KP5 A;  4I0B A;  3GFJ A;  3E5X A;  3QAH A;  2VXZ A;  2CQK A;  1UST A;  3VFZ A;  1XGM A;  2ZNZ A;  3ELK A;  3HTS B;  1KU3 A;  4M72 A;  1XD7 A;  2M5W A;  3HHH A;  3E6B A;  1BI2 A;  5K5R A;  5ICF A;  5D6E A;  3TO9 A;  2STW A;  3JTG A;  4HV6 A;  3DQV C;  2VBY A;  2G7H A;  2IT0 A;  3KFW X;  3WU1 B;  3S2W A;  4AIK A;  4LLL A;  4ON0 A;  1IF1 A;  1MJ9 A;  3V7S A;  5JR3 A;  2JT1 A;  1Z9C A;  2W85 A;  1TLH B;  2ZNY A;  3KP6 A;  1LB2 A;  3RTR A;  1KQ8 A;  3LA7 A;  1MGT A;  3M7G A;  1HXD A;  1E2X A;  2QM3 A;  4EJU A;  2A68 F;  3HYI A;  1XSD A;  3HTU A;  2RC4 A;  2HGC A;  4LB5 A;  4RS8 A;  3Q5F A;  5DUI A;  3PFI A;  3HSF A;  1R00 A;  4M9Z A;  1R58 A;  3ZMU A;  1LVA A;  2XGX A;  3FM3 A;  1JE8 A;  1CF7 B;  2F5C A;  5E8G A;  3TGN A;  4KMF A;  1KQ0 A;  2L54 A;  3G73 A;  4KT5 C;  4U0W A;  2ZBK A;  1U5T A;  1DPR A;  4K2E A;  1QPM A;  2P5V A;  3ZP5 A;  5JI6 A;  1MDM A;  3FMQ A;  5E20 A;  5L3D A;  2VOP A;  5HLI A;  1HQC A;  2LKP A;  3WE3 A;  1D5V A;  3E6C C;  3JTH A;  4YFK F;  4A5M A;  2GXB A;  1J7K A;  2B0L A;  3ZMZ A;  2Z5U A;  4ETS A;  3RYR A;  2XHK A;  2E7X A;  2L01 A;  2HYF A;  3LQQ A;  2PFB A;  5FGM A;  3L7W A;  3MZY A;  2M30 A;  3KP3 A;  1YLF A;  1F5T A;  4ESB A;  1IN5 A;  4IJA A;  1IRF A;  4YFN F;  4RAZ A;  3QP5 A;  4HZF A;  3KP2 A;  1H9T A;  2DK8 A;  4L9N A;  1T6S A;  2FBI A;  4RGR A;  1B9N A;  3HIF A;  1XMK A;  4EJT A;  1WSU A;  3BJO A;  1P4W A;  4A2U A;  2WWY A;  1I27 A;  3WGH A;  4HF0 A;  1ZN2 A;  4WF2 A;  2FRH A;  3MAJ A;  3NRV A;  3V8K A;  2K02 A;  3F8C A;  3R0A A;  2CWE A;  2EWN A;  3LA2 A;  2DO7 A;  1OKR A;  2FNP A;  2ELH A;  4NQW A;  1H9G A;  1XCV A;  1B6A A;  1KYW A;  3TOB A;  1LNW A;  2IW5 A;  2CFX A;  3J80 Z;  3HSR A;  2FOK A;  2KRF A;  1YTY A;  4GCV A;  2KIU A;  2YX4 A;  1ZRC A;  5DCM B;  2RV8 A;  4ZYH A;  1K78 B;  1U78 A;  1FT9 A;  4UVB A;  2OQR A;  1O7L A;  5HS9 A;  4KN7 X;  3R60 A;  3SZP A;  4HAM A;  4B09 A;  1IN7 A;  3FM5 A;  2PBI A;  4EV0 A;  2DI3 A;  4A0Z A;  4OIN F;  3BOQ A;  3KZZ A;  1C0W A;  4KDP A;  4IHS A;  2MH9 A;  2LSO A;  1BIA A;  5J8F A;  1BIB A;  2P6S A;  3R4K A;  1I6X A;  1FOK A;  3WE2 A;  2UWM A;  4RB2 C;  2IA2 A;  4MHG A;  5LLQ A;  1IXR C;  2GQQ A;  2HZT A;  1Y0U A;  2Y75 A;  2EFQ A;  1BOA A;  3O6B B;  1WI9 A;  2V1X A;  2V9V A;  1HSJ A;  4UV9 A;  2RKH A;  3REO A;  5CLS A;  2HS5 A;  3I4P A;  1XB4 A;  1G6N A;  1ZYR F;  4PCQ A;  5IT3 A;  2BBY A;  3GYH X;  2NAZ A;  4MEX F;  3W6J B;  5ILU A;  5FFZ A;  2OZU A;  2BEO A;  5FO5 A;  5DD4 A;  2HDC A;  2EA4 A;  1HBX G;  2GXG A;  2XVC A;  1CF7 A;  4KYW A;  1LEA A;  1HKS A;  4RB0 A;  4A0X A;  4ESJ A;  2W57 A;  2RNJ A;  3GFL A;  1HKQ A;  2UXX A;  2HFH A;  4HLX A;  4LD5 A;  3MCZ A;  3RIR A;  2ISZ A;  2ESN A;  2EFO A;  4WCG A;  1MD0 A;  4N0B A;  2XUB A;  2DW4 A;  2DTR A;  2OQG A;  2FML A;  5HLH A;  3AAF A;  2OZ6 A;  2EA2 A;  3F8F A;  3MWM A;  4KIC A;  4PGH A;  2P4W A;  1O3T A;  3FXQ A;  2EK5 A;  1XGO A;  3MQ0 A;  5E1X A;  1SFE A;  2FA5 A;  4EGZ A;  4R8H A;  1XDU A;  2XV4 S;  3M9A A;  2XAH A;  4UXN A;  5CVU A;  1B59 A;  2BGC A;  1FX7 A;  3IWF A;  3V7C A;  4FT8 A;  1XCB A;  2EB7 A;  3F6V A;  2X0L A;  4M71 A;  5A2Q K;  4HQE A;  3DPL C;  1WWX A;  4AVP A;  2JTV A;  3PQJ A;  1REP C;  3TKY A;  5ILV A;  2Q0O A;  4G94 A;  1R1U A;  3SXY A;  1ZH5 A;  4CXF A;  4Z2Y A;  1Z05 A;  2VT3 A;  3ABU A;  3KP7 A;  1S8N A;  4WK8 F;  5LEJ A;  3ZMT A;  1S29 A;  5HDG A;  3QPT A;  1G4D A;  4ZZD A;  2XIG A;  1SD5 A;  5DCM A;  3R0J A;  2L3D A;  1T39 A;  5LGN A;  4EQQ A;  1BC8 C;  1K78 A;  1YIO A;  5AIQ A;  2LDU A;  3K1P A;  4HX4 A;  1LDD A;  3BWG A;  2QUF A;  3WTU C;  3R6S A;  2UZK A;  3M1E A;  3RPQ A;  2OAZ A;  3E97 A;  4AIH A;  2CW0 F;  5L3C A;  4IXA A;  2Z99 A;  2XKP A;  3DXJ F;  3HRU A;  5DYM A;  3QPH A;  4XSX F;  3KET A;  1G3S A;  2RQP A;  3JAM Z;  2KIF A;  4ZZL A;  3I5U A;  3BDD A;  1J2X A;  2VC1 A;  2YU3 A;  5K5O A;  2DQL A;  5LBQ A;  3G3Z A;  1FC3 A;  1ZRE A;  1L0O C;  1ZLK A;  1TQM A;  5HDK A;  2YX7 A;  1T0F A;  1K79 A;  1FBU A;  4HBL A;  2AS5 F;  1QQI A;  3D0S A;  1IRG A;  3H92 A;  1DP7 P;  4PZJ A;  3GZ5 A;  5JHU A;  4GO1 A;  2V6C A;  2IP2 A;  3I0T A;  1G3Y A;  1FNN A;  1QZZ A;  4EMS A;  1J59 A;  1K7A A;  3NEU A;  2DLL A;  2EV6 A;  1ZLJ A;  2J5P A;  1U6G A;  2VE9 A;  3CJN A;  2NNY A;  1ON2 A;  4S04 A;  1R22 A;  4Y13 A;  2VE8 A;  1D3Y A;  1XGN A;  1FSH A;  2KKO A;  4I01 A;  4CO8 A;  1O7F A;  4F7Z A;  3FMR A;  1ONV A;  1GHC A;  3C1D A;  2IPQ X;  3K1M A;  4A0Y A;  4MNU A;  1LJ9 A;  4FX0 A;  4IHT A;  2R7D A;  2DPD A;  2DAO A;  3EYY A;  2HTS A;  3FZV A;  4HX7 A;  2HTJ A;  2H6B A;  5ICE A;  1IN4 A;  4KIG A;  2E1C A;  4Y15 A;  4A5N A;  4ENK A;  3K2Z A;  5CVI A;  2EV0 A;  1R1T A;  3ML6 A;  4BNC A;  4MTE A;  2QBY B;  2Q8K A;  4EVI A;  1AOY A;  4EJV A;  5D6F A;  4LMY A;  2K7L A;  1U3E M;  2P7V B;  2CO5 A;  1Z7U A;  3TDZ C;  1OR7 A;  5EEG A;  4KFC A;  1J9I A;  5F1R A;  3KCC A;  1CGP A;  1HW1 A;  2PMH A;  2NNN A;  4XLP F;  1JHH A;  3DF8 A;  3P9I A;  3JW4 A;  5CVV A;  2ACJ A;  1QGP A;  3WTS C;  5DCF A;  4L5J A;  1TBX A;  1HST A;  1XSX A;  1KYZ A;  2Q2E A;  3V4G A;  3M8F A;  4RAY A;  3WTZ A;  2ETH A; 
#chains in the Genus database with same CATH topology
 2XAS A;  5LD2 C;  3C7J A;  1YFH A;  2MA3 A;  1R7J A;  4AC0 A;  3Q3S A;  5D8K B;  2DA6 A;  3V8J A;  2BE5 F;  5D5X B;  1Y1W J;  4BH9 A;  2DK5 A;  5CVJ A;  2R0Q C;  3DPT A;  1TQP A;  4OIO F;  1S7A A;  5IYB J;  1A04 A;  1OYW A;  3FK6 A;  3WOD F;  1LE8 B;  1ZRF A;  3PQK A;  1OMI A;  4RA2 A;  4UNO A;  4BE2 A;  2EJR A;  3I53 A;  3A1Y A;  2VQH A;  2DU9 A;  1QZY A;  1G3W A;  4BY7 J;  4HLY A;  2IGO A;  4XKC A;  2R7U A;  2XKO A;  3JSP A;  2P5L C;  4XRS G;  2YS9 A;  2KJC A;  1Q1V A;  1VTN C;  4G6D A;  3FIS A;  5FKL A;  4BHP A;  1OCC H;  1Q1H A;  2VJJ A;  2W24 A;  2WB1 A;  3FMS A;  2IGN A;  3IKT A;  2O5R A;  3FXU A;  2WV1 A;  3RKW A;  4KUM A;  1I3A A;  4OMZ A;  2K27 A;  1OPC A;  3I3L A;  3CF2 A;  2O61 A;  4WX9 A;  1L3L A;  1I1G A;  1K61 A;  3HEF A;  1OJL A;  3DU6 A;  3IRR A;  1TWG J;  1JJ8 C;  1ENH A;  4E70 A;  3AL0 B;  2MYS A;  1RZ4 A;  1E17 A;  2CUF A;  4MEY F;  1LFP A;  3BY6 A;  1IXC A;  3S14 J;  2KDO A;  3U21 A;  1ETK A;  3ZOB A;  1X19 A;  4OAZ A;  1EV7 A;  4O5V A;  3E0J B;  5IOY A;  3QRF F;  3ECH A;  4Y33 A;  2TCT A;  2W48 A;  1UEL B;  2VQC A;  3DEW A;  3F8B A;  2P5K A;  3SHF A;  1HKT A;  3ZN1 A;  5E18 F;  3SYT A;  3AG3 H;  3VB2 A;  4D7N A;  2OU2 A;  3A01 B;  3DTE A;  2E19 A;  1BI0 A;  2LMD A;  1VFC A;  3MKW B;  1XDS A;  2ZB9 A;  2O03 A;  1D5Y A;  3LSI A;  5FB2 A;  1WRJ A;  3HOT A;  3AL0 C;  3VOD A;  3I58 A;  2NS8 A;  3L2W A;  1WQ2 A;  2BY2 A;  3OSG A;  5J1R A;  2Y69 H;  4HOB A;  3BQZ A;  1MSE C;  1RUO A;  5K7Z A;  2A6H F;  5F6F A;  4RB3 C;  1ZR2 A;  2M45 A;  1EH6 A;  3EPZ A;  4GYI A;  1BR4 A;  5ICG A;  3GX4 X;  4FCY A;  4LLN A;  6PAX A;  2VQG A;  2R7Z J;  3K4L A;  5HOD A;  2VKE A;  3V8L A;  1P9Q C;  2H1K A;  3IV5 A;  2X9D A;  4YIR X;  1GVD A;  3ZMV A;  2LF7 A;  2Y9Y A;  3LOC A;  3I55 I;  4H4K C;  2ZME B;  4I0A A;  3ABL H;  3D5L A;  4G9Y A;  3FHZ A;  2E2J J;  2PQ8 A;  5LGU A;  4EJO A;  2VT2 A;  4HV5 A;  3E5Q A;  4G7Z F;  2WAF A;  1Z91 A;  5B5E C;  2W1O A;  3M8J A;  4BXU A;  2JUG A;  2Z3Y A;  1WJE A;  2ZJ2 A;  4G6Q A;  2K9S A;  4UUS A;  4HNU A;  2HQR A;  4IOC F;  3F72 A;  3A4C A;  4IL6 C;  5KAF C;  1IGN A;  4P5O A;  4ZYE A;  2VBZ A;  3QU3 A;  2FOW A;  5B3S H;  3NAU A;  1V5G A;  2F2E A;  4KIS A;  1Z7L A;  4C9Y A;  3J81 K;  3BJ6 A;  1S5L C;  4ASN A;  4CYC A;  2QEX I;  2ZJR F;  4PJ0 C;  2D45 A;  3ZMD A;  3M3Y J;  2MD5 A;  1V54 H;  1TTY A;  4G7H F;  2JRM A;  4CCJ A;  5FLX K;  1Y39 A;  4A6E A;  1JKP C;  3WTY C;  3PNY A;  5C4X J;  2V6E A;  1RUN A;  2BVL A;  3BPX A;  4KMU X;  5BPI A;  1ZG5 A;  2AHQ A;  4QSH A;  3KPH A;  4UVA A;  2UXN A;  3OWT A;  4IVN A;  3OYJ A;  1BOB A;  3QP6 A;  4MGR A;  3OYL A;  2H8R A;  4Q47 A;  1YS7 A;  3BTL A;  2IA0 A;  4NB5 A;  3K69 A;  3QPS A;  2DOD A;  3VDX A;  3W2A A;  2Y2Z A;  2XGC A;  2OPT A;  2E34 A;  3VYR B;  4EM2 A;  1QHG A;  1KU2 A;  1UHM A;  2W25 A;  3IAM 2;  5GAH J;  2XSD C;  3MD2 A;  3HHG A;  2CRG A;  5DUK A;  3EUK L;  4XLC A;  3T0Y A;  3TED A;  4BJ5 C;  2YUS A;  3BG3 A;  3WU0 A;  4UUV A;  5IT9 Z;  3CUQ A;  4XOP A;  2F4I A;  3OR2 C;  3C2G A;  3TP0 A;  4CUG A;  2QBY A;  2P8T A;  1RIO H;  2D2W A;  1GV2 A;  1I3Q J;  3W2W A;  2K4J A;  4C2M J;  3CF5 F;  2H09 A;  3AG1 H;  5CVR A;  3HUG A;  2L7M P;  1J5Y A;  1OCO H;  1T38 A;  9ANT A;  2A5Y B;  2CFO A;  3K70 D;  3CLO A;  3M4O J;  1MBE A;  3DEE A;  4N9H A;  4O3M A;  2CQN A;  5E1Z B;  1R4N B;  4D5F A;  3L2C A;  5BMZ A;  3IC7 A;  1Y0N A;  3H5A A;  3RQ4 A;  4LOC A;  4GXO A;  4CCK A;  5L3F A;  4V2G A;  4PJL A;  2M8E A;  5HOO A;  1SFX A;  4I09 A;  2ZSI B;  3WGG A;  4XBF A;  2QZ8 A;  3T8T A;  2VJ5 A;  3CJQ B;  4MO7 A;  2F4O B;  5FFX A;  2OC6 A;  2P6T A;  2KDZ A;  2FX0 A;  4AWX B;  2WTE A;  1RKT A;  1OCZ H;  4HYE A;  2ZC2 A;  4M3F A;  4DBQ A;  2EZH A;  4L9T A;  3ESW B;  5D4R A;  2ZO4 A;  2PMU A;  1YG2 A;  3IKV A;  3KIO A;  3N97 A;  1VQ5 I;  2GOX B;  3GFI A;  4XLE A;  1S3J A;  2WC2 A;  2C6Y A;  4LB6 B;  2WV0 A;  4XLH A;  3SEZ A;  1OFC X;  4M6X A;  4LG0 B;  1X4O A;  4W97 A;  3PUF A;  1FYM A;  2L2O A;  2OBP A;  3QU6 A;  2GZW A;  2FMY A;  3Q0V A;  1QRY A;  4L5I A;  2H6C A;  3HZJ A;  2L7F P;  1D8K A;  1RKW A;  1WHU A;  5CPR B;  3KP4 A;  4ZC3 A;  4FE4 A;  3HOY J;  4YEJ A;  2CUE A;  2HI3 A;  4XOR A;  2VOO A;  2PN6 A;  2L02 A;  3LMM A;  2FBH A;  5TRD A;  2JA6 J;  2BY0 A;  1XMX A;  4B44 A;  1LE8 A;  3OYA A;  5EEH A;  3VYT B;  2R93 J;  1FBS A;  3OS1 A;  1G3T A;  1TL8 A;  1IN8 A;  2KPM A;  3PUB A;  1OCP A;  3ABM H;  1MIJ A;  4C30 A;  2LG4 A;  4BJ6 C;  1T56 A;  1SVL A;  1T33 A;  4B3A A;  4HW0 A;  2JA5 J;  2IEK A;  3LSP A;  1SFU A;  3UNG C;  1ZK8 A;  4UB6 C;  4BXF A;  1H88 C;  4OMY A;  5F08 A;  2DT7 B;  1YI2 I;  3SQN A;  2E1N A;  2VAS A;  3BR5 A;  5EJC A;  3CO6 C;  1DUX C;  4A3G J;  1N77 A;  1HOM A;  3HOU J;  3HRT A;  3AG2 H;  2M8G X;  2LY1 A;  3GCM A;  4D1Q A;  3OOU A;  3O3K A;  1ZG1 A;  2YSR A;  1AU7 A;  3ZR8 X;  5F0H A;  1APL C;  1XGS A;  2X51 A;  1G2H A;  3TOA A;  1W0T A;  3O8H A;  3T8R A;  3QQA A;  2DN0 A;  3ISP A;  1ZAO A;  4JP0 A;  1MBJ A;  1MH3 A;  2CQQ A;  5AIP A;  2LLK A;  4CHU A;  4UB8 C;  4DW6 A;  4B4C A;  2IS4 A;  4FET A;  3ZCO A;  1FOW A;  1IW7 F;  2IS1 A;  3GXO A;  2R3S A;  2HYJ A;  2M9H A;  1VQK I;  3A01 A;  2EH3 A;  1KU7 A;  4U7D A;  4A3C J;  2QYO A;  2HQ5 A;  3FK7 A;  4KT6 A;  4RMN A;  3F22 A;  2HVQ A;  3V42 A;  4RBO A;  3HPH A;  1NG7 A;  3B02 A;  5LHI A;  3BTC A;  3HKZ N;  1TNT A;  4IHW A;  2QWW A;  2VB6 A;  3BPV A;  1JGS A;  5CQG A;  3CD6 I;  3DBL B;  1HLV A;  3HSE A;  4LLG F;  1S7E A;  3HOS A;  2ESH A;  1YW8 A;  2M34 A;  2XAQ A;  3I71 A;  2ZKZ A;  2CQ7 A;  3K0L A;  3RI4 A;  5AON A;  1TWA J;  2JPC A;  1WJF A;  2XB5 A;  3HRM A;  3IH2 A;  2ZME A;  1YS6 A;  4BHC A;  1WJA A;  2DOA A;  2RVC A;  3DP7 A;  4L9J A;  2NS0 A;  5D8L B;  1HF0 A;  3PO2 J;  4DIQ A;  2BZT A;  4DOZ A;  1UAA A;  2DBB A;  2DT5 A;  3JSO A;  4M3D A;  2LBF B;  5BNG A;  5H6R A;  1SAX A;  2BY1 A;  4A93 J;  4CIC A;  1W5T A;  3FWE A;  4B8X A;  2K40 A;  1QNT A;  2AO9 A;  2L4A A;  2V9K A;  5M5X J;  4IHX A;  4IKF A;  4D0P A;  4BBS J;  3U1D A;  4HDU A;  5DD8 A;  4NHJ A;  2D1H A;  3ZQG A;  3GW2 A;  1PP7 U;  1HA8 A;  1POG A;  3GEZ A;  4NC8 A;  1E0E A;  3L9F A;  3VPR A;  4JBA A;  3OL4 A;  2CH0 A;  4BHB A;  2IA1 A;  3GO5 A;  4KN4 X;  2QLZ A;  3CLQ A;  4IQ4 A;  3FDY A;  3H3V K;  2R7S A;  2FQ3 A;  1QA6 A;  4KJZ A;  4PUS A;  3C3W A;  1VQ7 I;  3U2R A;  1VQ8 I;  1ETQ A;  1PVE A;  2M0M A;  4BQN A;  3QOD A;  4UV8 A;  1RRJ A;  3HPG A;  4WXH A;  2FU4 A;  2HKO A;  1P4X A;  2VQL A;  3BC8 A;  3M1C A;  4OIR F;  2STT A;  1WI3 A;  1P7J A;  2V26 A;  3OYG A;  2M1B A;  4YG2 F;  4LIV A;  4M6V A;  1F4K A;  2JA8 J;  3SDG A;  4D5C A;  1I1S A;  2BY3 A;  1TZL A;  4IOA F;  2V7F A;  4LJZ F;  2COM A;  2R7F A;  2DJN A;  3GTK J;  5E79 C;  4LGW A;  2QQ8 A;  2CV0 A;  4BGD A;  1LVK A;  2CGP A;  3L2U A;  1SVM A;  1RI7 A;  1KZH A;  2QKM B;  3ZGK A;  3BR6 A;  3R61 A;  3CES A;  1AA7 A;  4N9I A;  1U8R A;  2BHZ A;  3ULQ B;  3AKZ A;  4ZTF A;  5FLM J;  1E3P A;  1QO0 D;  5KHD A;  4M9S A;  3CCJ I;  2VBX A;  4FX4 A;  1BW5 A;  3KZY A;  5ED4 A;  4IQJ A;  5FD5 A;  1GV5 A;  5KVR A;  5HVQ C;  2VLA A;  3RCO A;  1IAW A;  3KYC B;  4U0V A;  1Y8R B;  2E60 A;  2GA2 A;  2ZFU A;  2EFP A;  4HA8 A;  2B7E A;  3CUO A;  2FSW A;  3F3X A;  1LFB A;  2JVG A;  3RZO J;  2H1L A;  4JQF A;  1BM9 A;  4TV7 A;  3QOP A;  3KLO A;  2EPF A;  5F27 A;  1J75 A;  3W6K B;  3H0D A;  1P6R A;  1X58 A;  2FBK A;  3KLN A;  1GLN A;  4ZYG A;  1ZHF A;  2LF8 A;  3OIO A;  4Y4R A;  2RQQ A;  5EZG A;  1DPU A;  1IRZ A;  2K3P A;  2NVU B;  5H20 A;  1K83 J;  2DMN A;  1R5I D;  3LSR A;  1R23 A;  3FIW A;  2O7O A;  2WA0 A;  1F1Z A;  2Y0S A;  2OD5 A;  2RGV A;  4M6Y A;  2EV5 A;  4A69 C;  4BQA A;  1X1B A;  2RN7 A;  4ZDP A;  3EUA A;  4EJW A;  1VF9 A;  5DV5 A;  5K7F A;  3CJR B;  3FKJ A;  1FTT A;  3OV8 A;  4EGY A;  1R1V A;  3ZQQ A;  4BL0 B;  2DA7 A;  2W7N A;  2EFN A;  1WFX A;  2G0E A;  3ZQI A;  1FSE A;  1G59 A;  2K9Q A;  2GIV A;  4M73 A;  3KZI C;  1B8I B;  3EDP A;  2XF6 A;  2QQA A;  2WAE A;  5FD6 A;  5J6X A;  2XDV A;  4JOM A;  3RKQ A;  4LG0 A;  3FXJ A;  1JKQ C;  3S2H J;  1A6I A;  2UUZ A;  2XAJ A;  4DYQ A;  3WG9 A;  2YU9 J;  5LFA A;  2MC3 A;  4R1H A;  2ISY A;  1MKM A;  1IO2 A;  2MLG A;  1QVT A;  3RDI A;  4PFP A;  3T1B A;  4ZH4 F;  3S32 A;  4M9X A;  2YR2 A;  3TDU C;  4BAY A;  2DA5 A;  5GAD J;  4RGX A;  2E71 A;  4E6K G;  4E7Z A;  3S16 J;  4XKV A;  2D1V A;  4ZYD A;  3C2B A;  1RET A;  2EIM H;  4P9U A;  5HDN A;  3OYH A;  4A12 A;  1XMA A;  3FXL A;  2VXD A;  3A03 A;  4P9F A;  4KIB A;  3HRS A;  1U2W A;  3MEX A;  1H89 C;  4C3H J;  4DZJ A;  1T2K A;  3S1R J;  5J4V A;  3S1M J;  2R7X A;  2AXT C;  3SEQ A;  2B63 J;  3I64 A;  1SEU A;  2NVY J;  1XN7 A;  1V3F A;  3W2V A;  2Z9O A;  3HOV J;  1FPQ A;  2L9N A;  3F23 A;  2MGQ A;  2CW8 A;  2FD5 A;  1Z21 A;  5BPD A;  1TW3 A;  4LG3 A;  1MW7 A;  4B48 A;  4EEF G;  3CC2 I;  2EFW A;  1NG6 A;  1JT6 A;  3RKX A;  4HQM A;  3ERE D;  1FYK A;  2FXA A;  1Z0X A;  2M2E A;  2PMZ N;  3DEU A;  3CUQ B;  4A3B J;  3DBH B;  4Q48 A;  1MJA A;  2VKH A;  3F8N A;  5J1Y A;  2HOS A;  4WXC A;  3LWF A;  2DDA A;  2ME0 A;  2MLK A;  3E6M A;  4PGG A;  4KA4 A;  4A3F J;  1T8I A;  4YFX F;  2CV1 A;  1OYI A;  5L3G A;  3LSM A;  2OJE D;  3OYM A;  1FIA A;  3J80 K;  4WXD A;  4DQ2 A;  3OYI A;  4ZDO A;  1SD7 A;  5GPA A;  4CDG A;  1Z1D A;  4UHT A;  1TC3 C;  1BC7 C;  1Z6T A;  3E3V A;  5D4S A;  1Y8Q B;  2XF7 A;  4Y3O A;  5JFR A;  4YIF A;  5JHF A;  1FZP B;  4RAF A;  1MND A;  3FXO A;  4AM3 A;  4D9J A;  3CUQ C;  4XLN F;  1YYV A;  1K6Y A;  4N4O B;  5IYD J;  4P55 A;  1ODD A;  3N4M A;  2PLY A;  3PO3 J;  3I59 B;  2Y30 A;  2E1M B;  1OQY A;  2LTP A;  3OYD A;  2O9L A;  1Y6I A;  3VYU B;  4Q4Z F;  4KIF A;  1ZGJ A;  4L9V A;  1DGR M;  3X2Q H;  1HC8 A;  4QWQ A;  4U88 A;  4DNC A;  5EF6 A;  1FIP A;  2ZXJ A;  1TQI A;  5E8I A;  2R7T A;  5IP9 J;  2E35 A;  3CMM A;  5FKO A;  1IZ1 A;  2VBW A;  3HGG A;  3U9G A;  3CCY A;  2LBF A;  2PEX A;  3SFZ A;  3ECO A;  4OU0 A;  1TWH J;  4OWR B;  3FHN A;  1R49 A;  2VUM J;  2F5F A;  2HEO A;  2E1M C;  3S3N A;  2QSG X;  2EBI A;  4L0Z B;  3GWZ A;  1YO5 C;  3E5U A;  3EQL F;  1UHS A;  2MW8 A;  1FLI A;  3F6O A;  1ZKG A;  1OYY A;  3WGI A;  2TRT A;  4W1U A;  1ETO A;  3L09 A;  5IT9 K;  3AG4 H;  5CJ9 A;  1O3Q A;  4AID A;  4AYB N;  1WKM A;  3WTX C;  2XPU A;  3IHU A;  3S3M A;  2PI0 A;  3KYL A;  1YQA A;  2WBM A;  3OR1 C;  1HCR A;  1ON1 A;  5K1Y A;  2V1U A;  2JSC A;  3GTG J;  4I98 B;  2IVM A;  3SFI A;  2ADU A;  1VQ4 I;  2V1D A;  1VQN I;  5TJJ A;  5HNF A;  2DDB A;  2A3S A;  3CTA A;  5LRR A;  2QGU A;  3ASO H;  5DM7 F;  1USS A;  5J4Y A;  4FIS A;  3OS0 A;  5F0C A;  1YX5 A;  1NK3 P;  3S1Q J;  4BXX J;  4EM1 A;  3LSJ A;  3FX3 A;  2QEN A;  1J0R A;  1ZGA A;  4BYY A;  1X4P A;  3MKZ A;  1MJB A;  4MQ9 F;  4F91 B;  1AWC A;  1MNM C;  2VON A;  1FEX A;  3OMY A;  4ZYA A;  5LEK A;  1SC7 A;  1LFU P;  2IBD A;  1S6L A;  2M4G A;  3A2K A;  2HKX A;  2KJB A;  3GFM A;  3E7L A;  2XRN A;  2EQR A;  3RSN A;  4BY1 J;  3J7A O;  4XL9 A;  2IS2 A;  4CZZ A;  3S1N J;  2MH2 A;  1DU0 A;  3LA3 A;  3JCU C;  2Y0M A;  4HX8 A;  2DA1 A;  5LGT A;  3RJP A;  5FKM A;  5BQT A;  3GTQ J;  2HYG D;  4QLC U;  2KHM A;  2DT6 A;  2ID6 A;  3MFK A;  4RAG A;  3QPL A;  4R79 A;  3GME A;  3LFU A;  1FMV A;  1IUY A;  4AIJ A;  4YII A;  3PNT A;  2DQR A;  2WAQ N;  3J7Z I;  1RPW A;  2O8X A;  5M3M J;  1Z3X A;  2PJR B;  4CSW A;  1N75 A;  1ZRD A;  5JVT A;  3E6D A;  2BVM A;  1SAN A;  3JRD A;  1QPI A;  1ZQ3 P;  4IRI A;  1BJA A;  3RQI A;  2Z33 A;  1W7P B;  5DDG A;  3HOW J;  2G9W A;  1BBY A;  3B6C A;  1X3Z B;  3OOP A;  2FF4 A;  5F0F A;  2R7W A;  4E7S A;  4G8X A;  4PK4 A;  3LQR A;  3S8P A;  1PP8 F;  3FXR A;  2E2H J;  2J5O A;  4XID A;  2HNH A;  4L5E A;  1SFO J;  1B8I A;  3L00 A;  2I8D A;  5HLG A;  1K4T A;  4E7J A;  3D5S C;  5C3E J;  1P4A A;  1O3R A;  3KE2 A;  4E4H A;  1BA5 A;  3Q9S A;  3K9T A;  3F8M A;  2ZME C;  3QOE A;  1UHW A;  3ZQF A;  4A3E J;  4J00 A;  1D8J A;  1WJD A;  2BYV E;  4XSZ F;  1FP2 A;  4U0Y A;  4X0G A;  3ZQL A;  3FXM A;  4LK1 F;  2LY2 A;  1VQP I;  5E1W A;  4HG2 A;  1IXS B;  4UVC A;  1SMY F;  2M87 A;  5K7H A;  5J3L A;  2HQN A;  1FOX A;  5CQE A;  4M3G A;  4MFE A;  5EDN A;  3IWZ A;  3OS2 A;  2JK3 A;  2VKD A;  3COA C;  4C2U A;  1STZ A;  3ABT A;  2VN2 A;  3DPU A;  3T5X A;  4A3L J;  2A61 A;  3M07 A;  2JPB A;  3HOZ J;  3P9K A;  2FEZ A;  3K1N A;  1ULY A;  1A31 A;  1QU3 A;  1GXQ A;  2XAF A;  1SAU A;  3E1S A;  1O3S A;  1DU6 A;  5LHH A;  2V79 A;  3GUD A;  1R5H A;  2NYX A;  1R4M B;  3PNV A;  2G7U A;  2R5Z B;  1ZTR A;  5CYV A;  3TO7 A;  3C18 A;  2JQ7 A;  2F5E A;  1QZE A;  3GBG A;  4I7H A;  4B1R A;  2CQX A;  4RGU A;  5L3B A;  3G6E I;  4NC7 A;  3CCU I;  3ZQ7 A;  5LHG A;  4CA0 A;  2DFH A;  2JVH A;  4H0E A;  4G12 A;  1FJL A;  1W5C C;  4V2F A;  3BZ6 A;  2JWT A;  3CP2 A;  1KQ9 A;  2DOE A;  5K5Q A;  3WTT C;  1JUP A;  2R4G A;  4MIM A;  3UKG A;  4MTD A;  1AHD P;  1ITY A;  2X6Y A;  4I2O A;  1QBJ A;  1JTX A;  3LSG A;  2CMP A;  3GTJ J;  1TT5 B;  2FNA A;  1TNS A;  4P1W A;  1SD6 A;  3B73 A;  3RPU A;  4AD9 A;  3CMA I;  2LRE A;  4Y17 A;  1W36 C;  2MBF A;  5HS8 A;  2A07 F;  1YJN I;  2DYR H;  4S05 A;  1LKX A;  1B1B A;  1YW9 A;  2COB A;  4NDL A;  1FP1 D;  5IPA A;  1VQO I;  3PL8 A;  3SZT A;  5BS6 A;  4RGS A;  4Z6Y A;  2IGK A;  4QPO A;  3I59 A;  5TIS C;  1KA8 A;  3NWT A;  2GAU A;  3EUH A;  5F1J A;  3RYP A;  2CUJ A;  2OA4 A;  3NQO A;  2JZY A;  2GWR A;  1EJ9 A;  1LDK B;  4XMY A;  1D0Y A;  3BJA A;  4ZDL A;  1F36 A;  1EH8 A;  3H36 A;  4BQO A;  1DDN A;  2KRH A;  4U7B A;  1ZEL A;  3JRB A;  2O8K A;  2NOJ B;  3G4S I;  1S7O A;  4GYG A;  3JRH A;  1MBH A;  2JJ7 A;  2GA1 A;  5DTD A;  3ZN0 A;  4IRG A;  2V1N A;  3A0B C;  1IN6 A;  2B9S A;  2IRF G;  3F9K A;  3FBN B;  1FWZ A;  3ZQC A;  4DYC A;  2XRO A;  5J47 A;  4XK4 A;  3EET A;  4XKB A;  2TDX A;  3JAM K;  3JRI A;  1U8B A;  3IAS 2;  1PUE E;  2L9R A;  3F21 A;  5ICC A;  2JRT A;  2Y48 A;  1FY7 A;  2LFB A;  1A36 A;  4HF2 A;  4X1E A;  2BV6 A;  2KZG A;  3BTJ A;  2OCE A;  3HOX J;  3CO7 C;  4F55 A;  2QVO A;  1O57 A;  1GVJ A;  3H5R A;  4Y7N J;  5DS9 A;  1LDJ A;  2NRA C;  3GLX A;  1I5Z A;  3DU5 A;  2DFI A;  2H94 A;  4PDK A;  3H5N A;  1I50 J;  4L18 B;  5BOX A;  2JA7 J;  4L0Y B;  2ICW G;  2W4S A;  3DFG A;  2MG4 A;  1MZB A;  2K4B A;  1RNL A;  1YW7 A;  2EIN H;  4IPA A;  4MQV A;  4CH7 A;  4CGZ A;  2XF5 A;  4A3J J;  3JRC A;  1GXP A;  1EH7 A;  2PG4 A;  3RPU D;  2LRD A;  2K9N A;  2Z16 A;  3DTK A;  4CYD A;  2L4M A;  5J8C A;  4M3B A;  3TO6 A;  1EF4 A;  1XC5 A;  2K9M A;  5GTI C;  2KIM A;  5F64 A;  2O3F A;  3DKW A;  5KK1 A;  3LST A;  3LFK A;  1LPQ A;  5E17 F;  1SD4 A;  5H2F C;  2LC2 A;  3BRO A;  4ABZ A;  3J81 Z;  2M4K A;  1K6O A;  3G1M A;  3BG6 A;  2OF7 A;  3ZPL A;  4P96 A;  1W5S A;  2KIS A;  4GGG A;  3OYB A;  4LFU A;  3H9G A;  4J01 A;  3K10 A;  5FLX Z;  2AXL A;  4I02 A;  5D5W B;  4RM2 A;  1R36 A;  1Y56 A;  3M8E A;  2IJL A;  2F6C A;  5M5W J;  2KT0 A;  3HG9 A;  2L9V A;  1P92 A;  2HWV A;  2F4M B;  3OYK A;  1UCR A;  3BP8 A;  3GVA A;  1JHF A;  2CW7 A;  4A6D A;  4ENN A;  2R5Y B;  1LQ1 A;  4A3I J;  2PJR A;  3GTL J;  5GPC A;  2DA4 A;  4AU7 A;  1JI8 A;  1B4A A;  1B9M A;  3H3Z A;  2MFZ A;  5EG0 B;  4WWC A;  4MFD A;  2CSO A;  1TW2 A;  3BCA A;  3PFY A;  1W7P A;  4B43 A;  2HOT A;  2YPR A;  3GLL A;  1I39 A;  4IO9 F;  3G1O A;  4QTR A;  4RB1 A;  2KP6 A;  1JKR C;  1DP3 A;  2PX9 A;  1F9N A;  3VOE A;  2K86 A;  1KU9 A;  2VPR A;  3H35 A;  3JR9 A;  4I6Z A;  4HDV A;  5HS7 A;  2A69 F;  1FMW A;  2LNB A;  3BG5 A;  4G7O F;  4LK0 F;  2HR3 A;  1T98 A;  1AKH B;  3GF2 A;  1X3W B;  1R5G A;  2IAI A;  3HM5 A;  2DPU A;  2ZXH A;  1U5T B;  5D5U B;  4A3K J;  1V4R A;  5GP9 A;  2ZCW A;  4LIT A;  1W4M A;  1S72 I;  1X3U A;  2CG4 A;  2BW3 B;  5FRM A;  1WJC A;  2A05 A;  2DA3 A;  1MDM B;  1FYL A;  4OIP F;  1ETW A;  1R6R A;  1SMT A;  3Q9V A;  3WU2 C;  1HW5 A;  4XRF A;  1YE9 A;  2M7A A;  3FXK A;  3H3U A;  4F52 A;  4D7M A;  2LD5 A;  4XRS A;  4XNF A;  1KGS A;  2BOL A;  3HJE A;  5ERI A;  1D1A A;  4ENJ A;  1P2F A;  2F5D A;  3IL2 A;  4ENM A;  3DKX A;  4BU2 A;  3TQN A;  2GLO A;  1U5T C;  2X48 A;  3OY9 A;  5L3E A;  2O6G E;  2R5Z A;  5ILS A;  5D5V B;  1PDN C;  2P7C B;  1WH7 A;  3WTV C;  3FF5 A;  2R7V A;  4EM0 B;  3K4J A;  2PJP A;  4OOI A;  4ITV A;  2QQ9 A;  1DQU A;  1JXS A;  1BI3 A;  4RLF A;  3GZ6 A;  1BJZ A;  3P9C A;  2E7W A;  2NVT J;  5KNL A;  2MC4 A;  3ZMS A;  4Q5S F;  4AVZ A;  3VEP A;  4JX5 A;  3BTI A;  2HVR A;  2H27 A;  1TWF J;  2VOD A;  4RM3 A;  4JK1 X;  1W7P D;  5FKN A;  2F5V A;  2R7O A;  3RKY A;  3V7R A;  5H6Q A;  1XSV A;  2XGE A;  3DCF A;  2X4H A;  2ZFW A;  4KNY A;  3KEO A;  4FHT A;  1FBQ A;  1UG2 A;  1GUU A;  2CYY A;  3HKZ A;  3SZG A;  2O0Y A;  3MZH A;  1MMS A;  5DEQ A;  3P5J A;  4IRH A;  3KX2 A;  2LR8 A;  4IF4 A;  2XAG A;  1RR7 A;  2D5V A;  2HOE A;  4GDF A;  1UB9 A;  3EYI A;  1UFM A;  3CDH A;  2RDP A;  1X1D A;  4M74 A;  1X1C A;  3KEQ A;  1Z6R A;  4HF1 A;  2BXZ A;  3ROU A;  1MMA A;  2X85 A;  2HU9 A;  1NHA A;  1BR1 A;  1BN5 A;  2BHY A;  4NQW B;  1VZ0 A;  4F92 B;  3WTW C;  3O2P E;  3HL2 A;  1LEB A;  1ERD A;  3CC4 I;  3LL7 A;  3I54 A;  3IRQ A;  4ESF A;  2RAE A;  3HC7 A;  3P7N A;  3LAP A;  2VC0 A;  2R92 J;  1D1B A;  2A6E F;  3LAJ A;  3B6A A;  2QQB A;  1ZG3 A;  2FE3 A;  4O6J A;  1HW2 A;  1H0M A;  4OIQ F;  3DV8 A;  1ZAR A;  2Z2S B;  1YRN B;  5LRS A;  3QYF A;  2R7Q A;  1BI1 A;  1WPK A;  2Z1D A;  1Z67 A;  2CJJ A;  2W84 A;  5A2Q Z;  3KP5 A;  4I0B A;  3GFJ A;  2E5N A;  1V55 H;  2R7R A;  3E5X A;  3QAH A;  2AQF A;  3ONQ A;  1W36 D;  2VXZ A;  4BEH B;  2CQK A;  2ME6 A;  4RDU A;  1FOY A;  1UST A;  3IP4 B;  3VFZ A;  4EAT A;  2X1D A;  1SFK A;  5EZH A;  1XGM A;  4M3E A;  2GIZ A;  2ZNZ A;  3ZXS A;  2VPL A;  3K7A J;  3ELK A;  3S15 J;  1YJ9 I;  3HTS B;  1UZC A;  4QIW N;  1KU3 A;  4IZZ A;  1HDD C;  1MBF A;  4M72 A;  1DGW Y;  1TT0 A;  1Y1V J;  2WB1 N;  1XD7 A;  2M5W A;  5TGT A;  3D5R C;  3ZQH A;  3HHH A;  2VJ4 A;  3E6B A;  1BI2 A;  4II2 A;  1A35 A;  5K5R A;  5ICF A;  1WVR A;  5D6E A;  2P0W A;  1JUS A;  4E7H A;  3TO9 A;  1XG1 A;  2E5Z A;  1ORK A;  2STW A;  3JTG A;  4HV6 A;  2NVQ J;  3DQV C;  2VBY A;  5FRO A;  2G7H A;  2IT0 A;  2NVX J;  4I76 A;  3SJM A;  3KFW X;  3WU1 B;  3S2W A;  4AIK A;  4LLL A;  4ON0 A;  1IF1 A;  1MJ9 A;  5FRN A;  3BR1 A;  1J09 A;  3V7S A;  5JR3 A;  2MD0 A;  1D0Z A;  2JT1 A;  1Z9C A;  3BG9 A;  3G1L A;  1UG0 A;  2W85 A;  1TLH B;  1IV6 A;  2ZNY A;  4XN0 A;  3KP6 A;  2DFE A;  3BR2 A;  1LB2 A;  4BKX A;  4E7I A;  4NUB A;  3RTR A;  5JVG F;  1KQ8 A;  2VIX A;  1R71 A;  1EKE A;  2V4J C;  3LA7 A;  3GZN B;  4XQF A;  1XPX A;  1MGT A;  3M7G A;  2CV2 A;  1HXD A;  1E2X A;  3DBR B;  4DYR A;  2L5Q A;  2QM3 A;  2R5Y A;  4EJU A;  2A68 F;  5M5Y J;  3MKL A;  3HYI A;  1PUF B;  1XSD A;  3HTU A;  2RC4 A;  3I9V 2;  5EG0 A;  3K4M A;  2HGC A;  2DMQ A;  4RS8 A;  4LB5 A;  2GOM A;  2JA2 A;  1XX5 A;  1VQL I;  2DMT A;  3Q5F A;  5DUI A;  2LYC A;  3PFI A;  3HSF A;  2VI6 A;  2ZSH B;  3JRF A;  1R00 A;  4M9Z A;  1JTY A;  1F43 A;  1R58 A;  4PJJ A;  3EUH C;  2LKX A;  3ZMU A;  1LVA A;  2I10 A;  2XGX A;  3FM3 A;  1JE8 A;  1NTC A;  4RLQ A;  2F5C A;  1CF7 B;  2K5C A;  5E8G A;  3TGN A;  3UR3 C;  1MBG A;  4KMF A;  1KQ0 A;  2L54 A;  2QF7 A;  3QYB A;  3G73 A;  4HEA 2;  1AKH A;  4KT5 C;  3DTI A;  4U0W A;  2ZBK A;  4N4N B;  1U5T A;  1DPR A;  4K2E A;  1QPM A;  2P5V A;  3ZP5 A;  2E36 A;  3G71 I;  3H9J A;  2BW3 A;  5JI6 A;  1MDM A;  3FMQ A;  5E20 A;  4HPQ A;  2DA2 A;  3PSI A;  5L3D A;  1KON A;  5HLI A;  2VOP A;  1HQC A;  2LKP A;  3WE3 A;  1IUF A;  1WZ2 A;  1IRX A;  2HPI A;  1D5V A;  4AUX A;  3F0C A;  3E6C C;  3JTH A;  4YFK F;  4FTH A;  3ABK H;  3LSH A;  3LSK A;  2LY9 A;  4A5M A;  3PJR A;  2GXB A;  1J7K A;  2B0L A;  2PMZ A;  3H0G J;  4U87 A;  3ZMZ A;  3KEY A;  2Z5U A;  4ETS A;  2DTZ A;  3RYR A;  2XHK A;  3K4C A;  2E7X A;  2L01 A;  2NS7 A;  2HYF A;  3LQQ A;  2PFB A;  5FGM A;  3L7W A;  3MZY A;  2M30 A;  1N78 A;  3KP3 A;  5EYR A;  1YLF A;  4PSW A;  4ESB A;  1F5T A;  2XC7 A;  1IN5 A;  4IJA A;  2HDD A;  1IRF A;  4YFN F;  4RAZ A;  1CQT A;  3QP5 A;  4GFB A;  2LVS A;  4HZF A;  4E7K A;  2LKS A;  3KP2 A;  2CU7 A;  1H9T A;  4HRI A;  5IYC J;  2DK8 A;  3J7Y J;  4L9N A;  1T6S A;  3I4N J;  2FBI A;  1IDY A;  2OUM A;  4RGR A;  1W0U A;  1W1W E;  2QKL B;  1B9N A;  3HIF A;  3A0H C;  1XMK A;  1YIT I;  2UV1 A;  2KMU A;  4EJT A;  1WSU A;  3BJO A;  1P4W A;  4A2U A;  5DM6 F;  2WWY A;  1I27 A;  4C3J J;  3ERM A;  3WGH A;  5C44 J;  4HF0 A;  1ZN2 A;  2CUZ A;  1XTA A;  5GAG J;  4WF2 A;  2FRH A;  2ELK A;  3MAJ A;  1M1E B;  3ZRG A;  4BE0 A;  3NRV A;  1MNE A;  3V8K A;  2K02 A;  4BBR J;  2M3A A;  3F8C A;  3R0A A;  3HB9 A;  2CWE A;  1D0X A;  3S17 J;  2EWN A;  2BXY A;  2X6W A;  3W3C A;  3LA2 A;  1MMG A;  4S0H B;  5EGO B;  2DO7 A;  1NK2 P;  2WY7 Q;  1OKR A;  2FNP A;  2ELH A;  4NQW A;  1H9G A;  1XCV A;  1B6A A;  1KYW A;  1JT0 A;  3TOB A;  1QVU A;  1LNW A;  2IW5 A;  2CFX A;  3TMO A;  4OAY A;  3J80 Z;  3HSR A;  2QSH X;  2FOK A;  4NC6 A;  2KRF A;  1YTY A;  1U9N A;  2WY8 Q;  4GCV A;  2Y31 A;  4IHV A;  2KIU A;  3DWL E;  2YX4 A;  3QYE A;  1ZGW A;  3GTO J;  4NNJ A;  3BZK A;  1YRN A;  1ZRC A;  2IXS A;  5DCM B;  4JYK A;  2EZK A;  3AFH A;  2RV8 A;  4AYB A;  4F93 B;  4ZYH A;  1K78 B;  2GXA A;  3TP3 A;  1U78 A;  1FT9 A;  2X1E A;  2ZXI A;  4UVB A;  2OQR A;  3I4M J;  1O7L A;  5HS9 A;  2FUG 2;  3TW7 A;  4KN7 X;  1D1C A;  3L2R A;  3CCL I;  3R60 A;  4KIT B;  3OYC A;  2FJ1 A;  3HGY A;  4XKW A;  4BEH A;  4FAS D;  2HPM A;  2DXI A;  1A6Q A;  2DOF A;  2P81 A;  3SZP A;  4HAM A;  3I56 I;  4B09 A;  4HNV A;  1IN7 A;  3O8G A;  2ECC A;  2ELJ A;  2GBY A;  3BCB A;  4ANJ A;  4PFO A;  3FM5 A;  2PBI A;  1X1A A;  4EV0 A;  4X6A J;  4IX7 A;  2DI3 A;  4A0Z A;  4OIN F;  1WGX A;  3BOQ A;  4BE1 A;  2XGD A;  2KIQ A;  4ZTJ A;  4C3I J;  2N8G A;  3KZZ A;  2XAU A;  1C0W A;  4KDP A;  4IHS A;  1H8A C;  3JRG A;  2MH9 A;  2KFD A;  2LSO A;  3OYF A;  3CMY A;  2L9S A;  1BIA A;  5J8F A;  1Z77 A;  1BIB A;  2P6S A;  3R4K A;  1I6X A;  1FOK A;  3WE2 A;  1RES A;  3VSK A;  2UWM A;  2VL8 A;  2OCC H;  2IA2 A;  3N05 A;  4RB2 C;  4MHG A;  1MH4 A;  3PSF A;  4CCL A;  5LLQ A;  1IXR C;  4CZC A;  2E1O A;  2GQQ A;  2HZT A;  4G6T B;  1Y0U A;  4MLO A;  2EIL H;  3CME I;  4BS9 A;  2Y75 A;  1IV8 A;  1G8X A;  2EFQ A;  2WAQ A;  3S93 A;  1BOA A;  3O6B B;  1WI9 A;  2L7Z A;  2V1X A;  2V9V A;  1HSJ A;  4UV9 A;  3JRA A;  2A5W A;  2VKV A;  3OSF A;  3K4B A;  4DZP A;  2W00 A;  2RKH A;  3REO A;  1MMD A;  3CC7 I;  1PUF A;  3S2D J;  5CLS A;  4BDY A;  1ACI A;  1ETX A;  1ZR4 A;  2HS5 A;  2ZXW H;  3I4P A;  1XB4 A;  1G6N A;  1ZYR F;  3CCS I;  4PCQ A;  5IT3 A;  2BBY A;  3IUO A;  3GYH X;  3MVP A;  4B47 A;  2NAZ A;  2HQA A;  3TL4 X;  4MEX F;  3W6J B;  5ILU A;  1MSF C;  2E2I J;  5FFZ A;  2OZU A;  3HDD A;  2BEO A;  4XLA A;  5FO5 A;  1BW6 A;  3BT9 A;  5DD4 A;  2K85 A;  3CQZ J;  3MMY B;  3LNQ A;  2HDC A;  1T0F C;  1YHQ I;  2EA4 A;  1HBX G;  3SDB A;  1X2M A;  2GXG A;  2XVC A;  1CF7 A;  2ID3 A;  1LEA A;  1HKS A;  5HNH A;  4RB0 A;  4A0X A;  4KYW A;  3DLA A;  2DYS H;  4LIU A;  1RC9 A;  3MN2 A;  4ESJ A;  2W57 A;  3BG7 A;  2RNJ A;  5KCM A;  3TW6 A;  2H8W A;  2JMW A;  3GFL A;  1HKQ A;  2UXX A;  3Q0W A;  2HFH A;  1U0J A;  2IS6 A;  3L1P A;  4HLX A;  3C2H A;  2JN6 A;  5JLX A;  1T08 B;  3OL3 A;  1GDT A;  1IJW C;  4LD5 A;  3MCZ A;  1TWC J;  2Q1Z B;  3RIR A;  3CJT B;  4BQQ A;  2ISZ A;  2ESN A;  1WJB A;  2EFO A;  5CKT A;  4PSX A;  3H9Q A;  5J40 A;  4WCG A;  1N25 A;  1MD0 A;  4N0B A;  4QPQ A;  2XUB A;  2DW4 A;  2DTR A;  1YIJ I;  2X6O A;  2OQG A;  2FML A;  4XON A;  1B72 B;  5HLH A;  3AAF A;  2Y9Z A;  3BQY A;  1JGG A;  2X6X A;  2OZ6 A;  4XOT A;  5J1U A;  2EA2 A;  1IDZ A;  3TBI A;  2LOO A;  5E3M A;  3F8F A;  3MWM A;  4PJN A;  4KIC A;  4PGH A;  2P4W A;  1O3T A;  3DKY A;  1LUJ B;  4JX4 A;  3FXQ A;  2GM4 A;  2EK5 A;  1XGO A;  3MQ0 A;  5E1X A;  1SFE A;  2FA5 A;  4EGZ A;  1IC8 A;  4R8H A;  2OTJ I;  5EEA A;  1XDU A;  2XV4 S;  3J7A Y;  3PIO F;  2AQE A;  3M9A A;  3PIP F;  2XAH A;  4UXN A;  5B1B H;  1VQ9 I;  3CDL A;  5CVU A;  1B59 A;  2BGC A;  2ZJP F;  1FX7 A;  2HZD A;  3D1N I;  3IWF A;  1VND A;  1OCT C;  3V7C A;  4FT8 A;  5FJ8 J;  4E7L A;  1YOV B;  1YX3 A;  1XCB A;  3U1K A;  2EB7 A;  5B1A H;  3F6V A;  1A5J A;  2X0L A;  3NWS A;  2KQR A;  4M71 A;  4NBQ A;  5A2Q K;  4HQE A;  3DPL C;  1YJW I;  1V5E A;  1WWX A;  4AVP A;  2JTV A;  3PQJ A;  3IH4 A;  5KAI C;  2W82 A;  1REP C;  4CCM A;  1S9H A;  1SVO A;  2DMP A;  3TKY A;  5ILV A;  2Q0O A;  2XSJ C;  5EGO A;  3BLY A;  2Q2E B;  1FTZ A;  2Y0S N;  4G94 A;  1JKO C;  1R1U A;  1VI0 A;  3SXY A;  3CCE I;  1ZH5 A;  4CXF A;  2XRL A;  4Z2Y A;  1Z05 A;  2KZV A;  2VT3 A;  3H1C A;  3ABU A;  1OR7 C;  3KP7 A;  1S8N A;  5GAE J;  4WK8 F;  5LEJ A;  3S3O A;  4IEJ A;  3ZMT A;  5GTH C;  1S29 A;  3CZ6 A;  5IOZ A;  5HDG A;  2RNG A;  3QPT A;  5C4J J;  1G4D A;  4ZZD A;  4V19 K;  2XIG A;  2MSY A;  1SD5 A;  4PJM A;  2M0C A;  5DCM A;  3R0J A;  4C2T A;  2L3D A;  1T39 A;  5LGN A;  4EQQ A;  1BC8 C;  3DLL F;  1K78 A;  2EIJ H;  4FE7 A;  2QSF X;  1YIO A;  5AIQ A;  2EZL A;  4JX6 A;  2LP0 A;  2LDU A;  2CS3 A;  3K1P A;  4HX4 A;  3L2V A;  1LDD A;  1QHH D;  3BWG A;  5HLT A;  2QUF A;  1MMN A;  3R6S A;  3WTU C;  3CCV I;  2F48 A;  2UZK A;  3M1E A;  3RPQ A;  3GTM J;  2OAZ A;  3QWL A;  3E97 A;  2XB0 X;  3FBI B;  4AIH A;  2CW0 F;  1OIS A;  1UJ8 A;  5L3C A;  4IXA A;  2Z99 A;  2QA4 I;  3W6V A;  2QCO A;  2XKP A;  2L0K A;  3DXJ F;  5F04 A;  1T95 A;  4ZJZ A;  2OTL I;  3HRU A;  5DYM A;  3QPH A;  5JLW A;  2DFF A;  4XSX F;  3KET A;  1VQ6 I;  3PM1 A;  1G3S A;  2RQP A;  2KRC A;  3JAM Z;  3JRE A;  1I6H J;  1HDP A;  2KIF A;  1U9O A;  2VJI A;  1ETV A;  1GT0 C;  4ZZL A;  2WAD A;  3I5U A;  3BDD A;  3BR3 A;  1J2X A;  3VWB A;  3WHC A;  3FKI J;  3Q0U A;  3CCQ I;  5E3O A;  2ECB A;  1WCM J;  2VC1 A;  3ASN H;  3VYS B;  1NH3 A;  2HXI A;  2YU3 A;  5K5O A;  4IHY A;  3CCR I;  2DQL A;  5LBQ A;  3MZ8 A;  4XM3 A;  3G3Z A;  2NOG A;  2NXN B;  5E3L A;  4Y52 J;  1FC3 A;  3CDI A;  4BAC A;  1ZRE A;  1L0O C;  1ZLK A;  1TQM A;  2KLO A;  5HDK A;  4F3Q A;  2YX7 A;  1T0F A;  4BDZ A;  1K79 A;  1FBU A;  4HBL A;  3K2A A;  4I99 C;  3L2Q A;  2AS5 F;  1QQI A;  3D0S A;  1IRG A;  3H92 A;  1XS9 A;  4PZJ A;  1O4X A;  1DP7 P;  1IG7 A;  3GZ5 A;  1UMQ A;  2LH9 A;  3NAR A;  5JHU A;  2A6T A;  4XLF A;  2V6C A;  4GO1 A;  2IP2 A;  5FKK A;  4BJT A;  3I0T A;  3CP8 A;  1G3Y A;  4HST A;  1FNN A;  3K6G A;  3K4K A;  1QZZ A;  4EMS A;  3K4N A;  1J59 A;  4GRI A;  4BUP A;  2ZJQ F;  1K7A A;  4UUS B;  2DMU A;  2DLL A;  3NEU A;  2EV6 A;  1ETY A;  1Z3Y A;  1X1P A;  4II3 A;  1ZLJ A;  2J5P A;  2HVS A;  4YRV A;  1U6G A;  4A3M J;  4J19 A;  2VE9 A;  3CJN A;  2NNY A;  1ON2 A;  4S04 A;  2JSP A;  2K3F A;  2HOA A;  2JUC A;  1R22 A;  4CYC B;  4Y13 A;  2LK2 A;  2VE8 A;  1D3Y A;  2EZI A;  1TP4 A;  3K70 C;  1XGN A;  2RRE A;  1FSH A;  1BR2 A;  2KKO A;  3IH3 A;  4I01 A;  4XR6 A;  4CO8 A;  4HNT A;  5FLV A;  1O7F A;  4XRM A;  2V9P A;  4HSR A;  4F7Z A;  3FMR A;  1X2N A;  1ONV A;  2OV7 A;  3VSL A;  4DBR A;  1GHC A;  3C1D A;  3OYN A;  2IPQ X;  3K1M A;  4A0Y A;  4MNU A;  1JUM A;  1LJ9 A;  4FX0 A;  4IHT A;  5M3F J;  2R7D A;  4XIC A;  2DPD A;  1E3O C;  1PJR A;  1VQM I;  2DAO A;  4YEL A;  3EYY A;  2HTS A;  3WG7 H;  2X1C A;  1OCR H;  5E3N A;  2HDW A;  3FZV A;  2DJI A;  4HX7 A;  1K4S A;  4DJA A;  2HTJ A;  2H6B A;  5ICE A;  1B72 A;  1IN4 A;  1WH5 A;  4KIG A;  2E1C A;  5IP6 A;  4Y15 A;  4A5N A;  4ENK A;  3K2Z A;  5CVI A;  3A02 A;  2FQ4 A;  3OYE A;  2I5U A;  2EV0 A;  1RR8 C;  2XPW A;  1R1T A;  3GTP J;  1WJ5 A;  3ML6 A;  3RZD J;  2M7B A;  3KYD B;  4BNC A;  1V5F A;  4MTE A;  2QBY B;  2Q8K A;  4EVI A;  1AOY A;  3CCM I;  4EJV A;  3MKY B;  2HXO A;  4FQG A;  3HUG B;  5D6F A;  3OIQ A;  4LMY A;  2K7L A;  4CCO A;  1U3E M;  2P7V B;  2CO5 A;  1PYV A;  1Z7U A;  3BZC A;  3TDZ C;  2XPV A;  1OR7 A;  5EEG A;  3G2B A;  4KFC A;  3HXL A;  1J9I A;  4UUT A;  2IGM A;  5F1R A;  3KCC A;  1CGP A;  4B3X A;  1OLT A;  4UY8 I;  1BL0 A;  3WHB A;  1HW1 A;  2PMH A;  2KL4 A;  1P7I A;  5IP7 J;  2NNN A;  1R9T J;  4XLP F;  1JHH A;  3DF8 A;  2MAB A;  3OIP A;  3P9I A;  4CCN A;  1JJ6 C;  3JW4 A;  5CVV A;  2ACJ A;  1QGP A;  4A3D J;  3HBL A;  3WTS C;  5DCF A;  1E3H A;  1MBK A;  1EA3 A;  4L5J A;  4DGW B;  2K9L A;  1TBX A;  1HST A;  1XSX A;  1KYZ A;  2DCE A;  2Q2E A;  5IY5 H;  3BR0 A;  2L7K A;  3V4G A;  2EIK H;  3M8F A;  4RAY A;  3WTZ A;  5B66 C;  2ETH A;  4XN3 A; 
#chains in the Genus database with same CATH homology
 2XAS A;  3C7J A;  1YFH A;  2MA3 A;  1R7J A;  5D8K B;  3V8J A;  2BE5 F;  5D5X B;  4BH9 A;  2DK5 A;  5CVJ A;  3DPT A;  1TQP A;  4OIO F;  1S7A A;  1A04 A;  1OYW A;  3WOD F;  1ZRF A;  3PQK A;  1OMI A;  4UNO A;  2EJR A;  3I53 A;  2DU9 A;  1QZY A;  1G3W A;  4HLY A;  2XKO A;  3JSP A;  2P5L C;  2KJC A;  1VTN C;  4G6D A;  4BHP A;  1Q1H A;  2W24 A;  3FMS A;  3IKT A;  3FXU A;  3RKW A;  4KUM A;  4OMZ A;  2K27 A;  1OPC A;  2O61 A;  4WX9 A;  1L3L A;  1I1G A;  3IRR A;  4E70 A;  1RZ4 A;  1E17 A;  4MEY F;  3BY6 A;  1IXC A;  1EV7 A;  4O5V A;  3QRF F;  3ECH A;  3F8B A;  2P5K A;  3SHF A;  1HKT A;  3ZN1 A;  5E18 F;  3VB2 A;  2OU2 A;  1BI0 A;  1XDS A;  2O03 A;  5FB2 A;  1WRJ A;  3HOT A;  3VOD A;  3I58 A;  1WQ2 A;  4HOB A;  1RUO A;  2A6H F;  5F6F A;  4RB3 C;  2M45 A;  1EH6 A;  4GYI A;  5ICG A;  3GX4 X;  4LLN A;  6PAX A;  3V8L A;  3ZMV A;  2LF7 A;  2ZME B;  4I0A A;  3D5L A;  3FHZ A;  4G9Y A;  2PQ8 A;  5LGU A;  4EJO A;  2VT2 A;  4HV5 A;  3E5Q A;  4G7Z F;  1Z91 A;  4BXU A;  2Z3Y A;  4G6Q A;  2ZJ2 A;  2HQR A;  3F72 A;  4P5O A;  4ZYE A;  2VBZ A;  3QU3 A;  2F2E A;  3J81 K;  3BJ6 A;  4ASN A;  2D45 A;  3ZMD A;  2MD5 A;  1TTY A;  4G7H F;  5FLX K;  4A6E A;  3WTY C;  1RUN A;  3BPX A;  4KMU X;  5BPI A;  1ZG5 A;  4UVA A;  2UXN A;  4IVN A;  3QP6 A;  4MGR A;  4Q47 A;  1YS7 A;  2IA0 A;  4NB5 A;  3K69 A;  4EM2 A;  1KU2 A;  1UHM A;  2W25 A;  3HHG A;  5DUK A;  3T0Y A;  3WU0 A;  5IT9 Z;  4UUV A;  3CUQ A;  2QBY A;  2P8T A;  1RIO H;  2D2W A;  2K4J A;  2H09 A;  5CVR A;  3HUG A;  1J5Y A;  1T38 A;  2A5Y B;  3CLO A;  4N9H A;  4O3M A;  5E1Z B;  3L2C A;  5BMZ A;  3IC7 A;  4GXO A;  5L3F A;  2M8E A;  5HOO A;  1SFX A;  4I09 A;  3WGG A;  4XBF A;  2QZ8 A;  3T8T A;  5FFX A;  2P6T A;  4AWX B;  2WTE A;  4HYE A;  4L9T A;  5D4R A;  2ZO4 A;  2PMU A;  1YG2 A;  3IKV A;  3N97 A;  3GFI A;  1S3J A;  2WC2 A;  2C6Y A;  4LB6 B;  2WV0 A;  4M6X A;  4LG0 B;  1FYM A;  2OBP A;  3QU6 A;  2GZW A;  2FMY A;  4L5I A;  2H6C A;  1D8K A;  3KP4 A;  2VOO A;  2PN6 A;  2L02 A;  2FBH A;  5TRD A;  5EEH A;  1FBS A;  1G3T A;  1IN8 A;  4HW0 A;  1SFU A;  4OMY A;  3SQN A;  2E1N A;  1DUX C;  3CO6 C;  3HRT A;  3O3K A;  1ZG1 A;  2YSR A;  1XGS A;  3TOA A;  3T8R A;  3ISP A;  1ZAO A;  5AIP A;  4CHU A;  1IW7 F;  3GXO A;  2R3S A;  1KU7 A;  4U7D A;  2QYO A;  3F22 A;  3B02 A;  5LHI A;  1TNT A;  2QWW A;  3BPV A;  1JGS A;  3HSE A;  4LLG F;  3HOS A;  2ESH A;  1YW8 A;  2XAQ A;  3I71 A;  2ZKZ A;  3K0L A;  3RI4 A;  5AON A;  2JPC A;  3HRM A;  2ZME A;  1YS6 A;  4BHC A;  4L9J A;  2RVC A;  3DP7 A;  5D8L B;  2NS0 A;  2DBB A;  2DT5 A;  3JSO A;  5H6R A;  1SAX A;  4CIC A;  1W5T A;  3FWE A;  4B8X A;  1QNT A;  2L4A A;  4D0P A;  3U1D A;  4HDU A;  5DD8 A;  4NHJ A;  2D1H A;  3GW2 A;  1PP7 U;  3GEZ A;  3L9F A;  4JBA A;  4BHB A;  2IA1 A;  3GO5 A;  4KN4 X;  2QLZ A;  2FQ3 A;  3C3W A;  3U2R A;  4UV8 A;  4WXH A;  2FU4 A;  2HKO A;  1P4X A;  4OIR F;  2STT A;  2M1B A;  4YG2 F;  1F4K A;  1I1S A;  4LJZ F;  2COM A;  2R7F A;  4LGW A;  2CGP A;  1RI7 A;  3R61 A;  1U8R A;  4N9I A;  3ULQ B;  1QO0 D;  4M9S A;  2VBX A;  4FX4 A;  3KZY A;  5ED4 A;  5FD5 A;  5KVR A;  5HVQ C;  1IAW A;  4U0V A;  2GA2 A;  2EFP A;  4HA8 A;  3CUO A;  2FSW A;  3F3X A;  4JQF A;  1BM9 A;  4TV7 A;  3QOP A;  3KLO A;  1J75 A;  3W6K B;  1P6R A;  2FBK A;  3KLN A;  4ZYG A;  1ZHF A;  2LF8 A;  1DPU A;  5H20 A;  1R23 A;  1F1Z A;  2OD5 A;  2RGV A;  4M6Y A;  2EV5 A;  4BQA A;  2RN7 A;  4EJW A;  5DV5 A;  3OV8 A;  4EGY A;  1R1V A;  2EFN A;  1FSE A;  2GIV A;  4M73 A;  3EDP A;  2QQA A;  5J6X A;  5FD6 A;  4LG0 A;  2XAJ A;  3WG9 A;  2MC3 A;  4R1H A;  2ISY A;  1MKM A;  2MLG A;  3RDI A;  3T1B A;  4ZH4 F;  4M9X A;  2YR2 A;  3TDU C;  4BAY A;  4RGX A;  2D1V A;  4ZYD A;  4P9U A;  4A12 A;  5HDN A;  1XMA A;  4P9F A;  4KIB A;  3HRS A;  1U2W A;  3MEX A;  1T2K A;  3I64 A;  1XN7 A;  1V3F A;  2Z9O A;  1FPQ A;  3F23 A;  5BPD A;  1TW3 A;  2EFW A;  3RKX A;  4HQM A;  3ERE D;  1FYK A;  2FXA A;  3DEU A;  3CUQ B;  4Q48 A;  1MJA A;  3F8N A;  4WXC A;  3LWF A;  3E6M A;  4KA4 A;  2MLK A;  4PGG A;  4YFX F;  1OYI A;  5L3G A;  3J80 K;  4WXD A;  4DQ2 A;  1SD7 A;  4CDG A;  1Z1D A;  4UHT A;  1BC7 C;  1Z6T A;  3E3V A;  5D4S A;  5JFR A;  4YIF A;  1FZP B;  3CUQ C;  4XLN F;  1YYV A;  4P55 A;  1ODD A;  3N4M A;  2PLY A;  3I59 B;  4Q4Z F;  4KIF A;  1ZGJ A;  4L9V A;  4QWQ A;  4U88 A;  4DNC A;  2ZXJ A;  1TQI A;  5E8I A;  1IZ1 A;  2VBW A;  3U9G A;  2PEX A;  3SFZ A;  3ECO A;  4OU0 A;  2F5F A;  2HEO A;  4L0Z B;  3GWZ A;  1YO5 C;  3E5U A;  3EQL F;  1FLI A;  3F6O A;  1OYY A;  3WGI A;  3L09 A;  5IT9 K;  1O3Q A;  5CJ9 A;  1WKM A;  3WTX C;  3IHU A;  2PI0 A;  1YQA A;  1ON1 A;  5K1Y A;  2V1U A;  2JSC A;  4I98 B;  2IVM A;  2ADU A;  2V1D A;  5TJJ A;  2A3S A;  3CTA A;  5LRR A;  1USS A;  4EM1 A;  3FX3 A;  2QEN A;  1J0R A;  1ZGA A;  4BYY A;  1MJB A;  4MQ9 F;  1AWC A;  2VON A;  5LEK A;  1S6L A;  2HKX A;  2KJB A;  3GFM A;  2XRN A;  3J7A O;  4CZZ A;  2MH2 A;  3LA3 A;  2Y0M A;  4HX8 A;  5LGT A;  3RJP A;  5BQT A;  2HYG D;  4QLC U;  3MFK A;  4R79 A;  1IUY A;  4AIJ A;  4YII A;  2DQR A;  2O8X A;  1ZRD A;  5JVT A;  3E6D A;  4IRI A;  1BJA A;  2Z33 A;  1W7P B;  5DDG A;  2G9W A;  1BBY A;  3OOP A;  2FF4 A;  4G8X A;  3LQR A;  1PP8 F;  3FXR A;  2J5O A;  3L00 A;  5HLG A;  1P4A A;  1O3R A;  3KE2 A;  3Q9S A;  3K9T A;  3F8M A;  1UHW A;  1D8J A;  2BYV E;  4XSZ F;  1FP2 A;  4U0Y A;  4LK1 F;  5E1W A;  1IXS B;  4UVC A;  1SMY F;  2M87 A;  2HQN A;  3COA C;  3IWZ A;  1STZ A;  3ABT A;  2VN2 A;  3T5X A;  2A61 A;  2JPB A;  3P9K A;  2FEZ A;  3K1N A;  1ULY A;  1GXQ A;  2XAF A;  1O3S A;  5LHH A;  2V79 A;  3GUD A;  1R5H A;  2NYX A;  2G7U A;  5CYV A;  3TO7 A;  3C18 A;  2F5E A;  4I7H A;  5L3B A;  4RGU A;  3ZQ7 A;  5LHG A;  4H0E A;  3BZ6 A;  1KQ9 A;  5K5Q A;  3WTT C;  4MTD A;  4I2O A;  1QBJ A;  2FNA A;  1TNS A;  1SD6 A;  3B73 A;  3RPU A;  4AD9 A;  4Y17 A;  2A07 F;  5HS8 A;  2MBF A;  4S05 A;  1B1B A;  1YW9 A;  1FP1 D;  3SZT A;  5BS6 A;  4RGS A;  3I59 A;  1KA8 A;  2GAU A;  3EUH A;  3RYP A;  2OA4 A;  3NQO A;  2JZY A;  2GWR A;  1LDK B;  3BJA A;  1DDN A;  1EH8 A;  4U7B A;  1S7O A;  4GYG A;  3ZN0 A;  2GA1 A;  4IRG A;  1IN6 A;  2IRF G;  1FWZ A;  2XRO A;  3EET A;  2TDX A;  3JAM K;  1PUE E;  3F21 A;  5ICC A;  2JRT A;  2Y48 A;  1FY7 A;  4HF2 A;  2BV6 A;  3CO7 C;  2QVO A;  1O57 A;  1GVJ A;  1LDJ A;  2NRA C;  3GLX A;  1I5Z A;  2DFI A;  2H94 A;  4PDK A;  4L18 B;  5BOX A;  4L0Y B;  3DFG A;  1YW7 A;  1MZB A;  2K4B A;  1RNL A;  4IPA A;  4MQV A;  4CGZ A;  1GXP A;  1EH7 A;  2PG4 A;  4CYD A;  2L4M A;  5J8C A;  3TO6 A;  2KIM A;  5F64 A;  2O3F A;  3DKW A;  5KK1 A;  3LST A;  3LFK A;  5E17 F;  1SD4 A;  3BRO A;  3J81 Z;  1K6O A;  3ZPL A;  4P96 A;  1W5S A;  4GGG A;  4LFU A;  5FLX Z;  2AXL A;  4I02 A;  5D5W B;  1R36 A;  3M8E A;  2IJL A;  1P92 A;  2HWV A;  1UCR A;  3BP8 A;  3GVA A;  1JHF A;  4A6D A;  4ENN A;  1LQ1 A;  1B4A A;  1B9M A;  3H3Z A;  4WWC A;  2CSO A;  1TW2 A;  1W7P A;  2YPR A;  4RB1 A;  1F9N A;  3VOE A;  2K86 A;  1KU9 A;  4HDV A;  5HS7 A;  2A69 F;  2LNB A;  4G7O F;  4LK0 F;  2HR3 A;  1T98 A;  3GF2 A;  1R5G A;  2DPU A;  1U5T B;  5D5U B;  1V4R A;  2ZCW A;  1W4M A;  1X3U A;  2CG4 A;  1MDM B;  4OIP F;  1FYL A;  1SMT A;  3Q9V A;  1HW5 A;  4XRF A;  3H3U A;  1KGS A;  5ERI A;  4ENJ A;  1P2F A;  2F5D A;  3IL2 A;  4ENM A;  3TQN A;  1U5T C;  5L3E A;  2O6G E;  5ILS A;  5D5V B;  1PDN C;  2P7C B;  3WTV C;  3FF5 A;  4EM0 B;  2PJP A;  4OOI A;  2QQ9 A;  1JXS A;  1BI3 A;  3GZ6 A;  3P9C A;  2E7W A;  3ZMS A;  4Q5S F;  3VEP A;  2H27 A;  2VOD A;  4JK1 X;  1W7P D;  3RKY A;  3V7R A;  5H6Q A;  1XSV A;  4KNY A;  2X4H A;  2ZFW A;  3KEO A;  4FHT A;  1FBQ A;  2CYY A;  2O0Y A;  3MZH A;  5DEQ A;  4IRH A;  4IF4 A;  2XAG A;  2HOE A;  1UB9 A;  3EYI A;  1UFM A;  3CDH A;  2RDP A;  4M74 A;  4HF1 A;  3KEQ A;  1Z6R A;  3ROU A;  3WTW C;  1NHA A;  1BN5 A;  3O2P E;  1LEB A;  3I54 A;  3IRQ A;  4ESF A;  3P7N A;  3LAP A;  2VC0 A;  2A6E F;  3LAJ A;  2QQB A;  1ZG3 A;  2FE3 A;  4O6J A;  1HW2 A;  1H0M A;  4OIQ F;  3DV8 A;  1ZAR A;  5LRS A;  1BI1 A;  2W84 A;  5A2Q Z;  3KP5 A;  4I0B A;  3GFJ A;  3E5X A;  3QAH A;  2VXZ A;  2CQK A;  1UST A;  3VFZ A;  1XGM A;  2ZNZ A;  3ELK A;  3HTS B;  1KU3 A;  4M72 A;  1XD7 A;  2M5W A;  3HHH A;  3E6B A;  1BI2 A;  5K5R A;  5ICF A;  5D6E A;  3TO9 A;  2STW A;  3JTG A;  4HV6 A;  3DQV C;  2VBY A;  2G7H A;  2IT0 A;  3KFW X;  3WU1 B;  3S2W A;  4AIK A;  4LLL A;  4ON0 A;  1IF1 A;  1MJ9 A;  3V7S A;  5JR3 A;  2JT1 A;  1Z9C A;  2W85 A;  1TLH B;  2ZNY A;  3KP6 A;  1LB2 A;  3RTR A;  1KQ8 A;  3LA7 A;  1MGT A;  3M7G A;  1HXD A;  1E2X A;  2QM3 A;  4EJU A;  2A68 F;  3HYI A;  1XSD A;  3HTU A;  2RC4 A;  2HGC A;  4LB5 A;  4RS8 A;  3Q5F A;  5DUI A;  3PFI A;  3HSF A;  1R00 A;  4M9Z A;  1R58 A;  3ZMU A;  1LVA A;  2XGX A;  3FM3 A;  1JE8 A;  1CF7 B;  2F5C A;  5E8G A;  3TGN A;  4KMF A;  1KQ0 A;  2L54 A;  3G73 A;  4KT5 C;  4U0W A;  2ZBK A;  1U5T A;  1DPR A;  4K2E A;  1QPM A;  2P5V A;  3ZP5 A;  5JI6 A;  1MDM A;  3FMQ A;  5E20 A;  5L3D A;  2VOP A;  5HLI A;  1HQC A;  2LKP A;  3WE3 A;  1D5V A;  3E6C C;  3JTH A;  4YFK F;  4A5M A;  2GXB A;  1J7K A;  2B0L A;  3ZMZ A;  2Z5U A;  4ETS A;  3RYR A;  2XHK A;  2E7X A;  2L01 A;  2HYF A;  3LQQ A;  2PFB A;  5FGM A;  3L7W A;  3MZY A;  2M30 A;  3KP3 A;  1YLF A;  1F5T A;  4ESB A;  1IN5 A;  4IJA A;  1IRF A;  4YFN F;  4RAZ A;  3QP5 A;  4HZF A;  3KP2 A;  1H9T A;  2DK8 A;  4L9N A;  1T6S A;  2FBI A;  4RGR A;  1B9N A;  3HIF A;  1XMK A;  4EJT A;  1WSU A;  3BJO A;  1P4W A;  4A2U A;  2WWY A;  1I27 A;  3WGH A;  4HF0 A;  1ZN2 A;  4WF2 A;  2FRH A;  3MAJ A;  3NRV A;  3V8K A;  2K02 A;  3F8C A;  3R0A A;  2CWE A;  2EWN A;  3LA2 A;  2DO7 A;  1OKR A;  2FNP A;  2ELH A;  4NQW A;  1H9G A;  1XCV A;  1B6A A;  1KYW A;  3TOB A;  1LNW A;  2IW5 A;  2CFX A;  3J80 Z;  3HSR A;  2FOK A;  2KRF A;  1YTY A;  4GCV A;  2KIU A;  2YX4 A;  1ZRC A;  5DCM B;  2RV8 A;  4ZYH A;  1K78 B;  1U78 A;  1FT9 A;  4UVB A;  2OQR A;  1O7L A;  5HS9 A;  4KN7 X;  3R60 A;  3SZP A;  4HAM A;  4B09 A;  1IN7 A;  3FM5 A;  2PBI A;  4EV0 A;  2DI3 A;  4A0Z A;  4OIN F;  3BOQ A;  3KZZ A;  1C0W A;  4KDP A;  4IHS A;  2MH9 A;  2LSO A;  1BIA A;  5J8F A;  1BIB A;  2P6S A;  3R4K A;  1I6X A;  1FOK A;  3WE2 A;  2UWM A;  4RB2 C;  2IA2 A;  4MHG A;  5LLQ A;  1IXR C;  2GQQ A;  2HZT A;  1Y0U A;  2Y75 A;  2EFQ A;  1BOA A;  3O6B B;  1WI9 A;  2V1X A;  2V9V A;  1HSJ A;  4UV9 A;  2RKH A;  3REO A;  5CLS A;  2HS5 A;  3I4P A;  1XB4 A;  1G6N A;  1ZYR F;  4PCQ A;  5IT3 A;  2BBY A;  3GYH X;  2NAZ A;  4MEX F;  3W6J B;  5ILU A;  5FFZ A;  2OZU A;  2BEO A;  5FO5 A;  5DD4 A;  2HDC A;  2EA4 A;  1HBX G;  2GXG A;  2XVC A;  1CF7 A;  4KYW A;  1LEA A;  1HKS A;  4RB0 A;  4A0X A;  4ESJ A;  2W57 A;  2RNJ A;  3GFL A;  1HKQ A;  2UXX A;  2HFH A;  4HLX A;  4LD5 A;  3MCZ A;  3RIR A;  2ISZ A;  2ESN A;  2EFO A;  4WCG A;  1MD0 A;  4N0B A;  2XUB A;  2DW4 A;  2DTR A;  2OQG A;  2FML A;  5HLH A;  3AAF A;  2OZ6 A;  2EA2 A;  3F8F A;  3MWM A;  4KIC A;  4PGH A;  2P4W A;  1O3T A;  3FXQ A;  2EK5 A;  1XGO A;  3MQ0 A;  5E1X A;  1SFE A;  2FA5 A;  4EGZ A;  4R8H A;  1XDU A;  2XV4 S;  3M9A A;  2XAH A;  4UXN A;  5CVU A;  1B59 A;  2BGC A;  1FX7 A;  3IWF A;  3V7C A;  4FT8 A;  1XCB A;  2EB7 A;  3F6V A;  2X0L A;  4M71 A;  5A2Q K;  4HQE A;  3DPL C;  1WWX A;  4AVP A;  2JTV A;  3PQJ A;  1REP C;  3TKY A;  5ILV A;  2Q0O A;  4G94 A;  1R1U A;  3SXY A;  1ZH5 A;  4CXF A;  4Z2Y A;  1Z05 A;  2VT3 A;  3ABU A;  3KP7 A;  1S8N A;  4WK8 F;  5LEJ A;  3ZMT A;  1S29 A;  5HDG A;  3QPT A;  1G4D A;  4ZZD A;  2XIG A;  1SD5 A;  5DCM A;  3R0J A;  2L3D A;  1T39 A;  5LGN A;  4EQQ A;  1BC8 C;  1K78 A;  1YIO A;  5AIQ A;  2LDU A;  3K1P A;  4HX4 A;  1LDD A;  3BWG A;  2QUF A;  3WTU C;  3R6S A;  2UZK A;  3M1E A;  3RPQ A;  2OAZ A;  3E97 A;  4AIH A;  2CW0 F;  5L3C A;  4IXA A;  2Z99 A;  2XKP A;  3DXJ F;  3HRU A;  5DYM A;  3QPH A;  4XSX F;  3KET A;  1G3S A;  2RQP A;  3JAM Z;  2KIF A;  4ZZL A;  3I5U A;  3BDD A;  1J2X A;  2VC1 A;  2YU3 A;  5K5O A;  2DQL A;  5LBQ A;  3G3Z A;  1FC3 A;  1ZRE A;  1L0O C;  1ZLK A;  1TQM A;  5HDK A;  2YX7 A;  1T0F A;  1K79 A;  1FBU A;  4HBL A;  2AS5 F;  1QQI A;  3D0S A;  1IRG A;  3H92 A;  1DP7 P;  4PZJ A;  3GZ5 A;  5JHU A;  4GO1 A;  2V6C A;  2IP2 A;  3I0T A;  1G3Y A;  1FNN A;  1QZZ A;  4EMS A;  1J59 A;  1K7A A;  3NEU A;  2DLL A;  2EV6 A;  1ZLJ A;  2J5P A;  1U6G A;  2VE9 A;  3CJN A;  2NNY A;  1ON2 A;  4S04 A;  1R22 A;  4Y13 A;  2VE8 A;  1D3Y A;  1XGN A;  1FSH A;  2KKO A;  4I01 A;  4CO8 A;  1O7F A;  4F7Z A;  3FMR A;  1ONV A;  1GHC A;  3C1D A;  2IPQ X;  3K1M A;  4A0Y A;  4MNU A;  1LJ9 A;  4FX0 A;  4IHT A;  2R7D A;  2DPD A;  2DAO A;  3EYY A;  2HTS A;  3FZV A;  4HX7 A;  2HTJ A;  2H6B A;  5ICE A;  1IN4 A;  4KIG A;  2E1C A;  4Y15 A;  4A5N A;  4ENK A;  3K2Z A;  5CVI A;  2EV0 A;  1R1T A;  3ML6 A;  4BNC A;  4MTE A;  2QBY B;  2Q8K A;  4EVI A;  1AOY A;  4EJV A;  5D6F A;  4LMY A;  2K7L A;  1U3E M;  2P7V B;  2CO5 A;  1Z7U A;  3TDZ C;  1OR7 A;  5EEG A;  4KFC A;  1J9I A;  5F1R A;  3KCC A;  1CGP A;  1HW1 A;  2PMH A;  2NNN A;  4XLP F;  1JHH A;  3DF8 A;  3P9I A;  3JW4 A;  5CVV A;  2ACJ A;  1QGP A;  3WTS C;  5DCF A;  4L5J A;  1TBX A;  1HST A;  1XSX A;  1KYZ A;  2Q2E A;  3V4G A;  3M8F A;  4RAY A;  3WTZ A;  2ETH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...