1RC9A

Crystal structure of stecrisp, a member of crisp family from trimeresurus stejnegeri refined at 1.6 angstroms resolution: structual relationship of the two domains
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
221
structure length
221
Chain Sequence
NVDFDSESPRKPEIQNEIVDLHNSLRRSVNPTASNMLRMEWYPEAADNAERWAYRCIESHSSYESRVIEGIKCGENIYMSPYPMKWTDIIHAWHDEYKDFKYGVGADPPNAVTGHYTQIVWYKSYRIGCAAAYCPSSPYSYFFVCQYCPAGNFIGKTATPYTSGTPCGDCPSDCDNGLCTNPCTRENKFTNCNTMVQQSSCQDNYMKTNCPASCFCQNKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cysteine-rich secretory protein
publication title Crystal structure of cysteine-rich secretory protein stecrisp reveals the cysteine-rich domain has a K+-channel inhibitor-like fold.
pubmed doi rcsb
molecule tags Toxin
total genus 70
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 1rc9A02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 1rc9A01
1XX5A 4TPVA 3S6UA 2GIZA 1WVRA 2A05A 1SMBA 1U53A 3NT8A 3U3LC 3Q2RA 4NUIA 4NUOA 3U3NC 2DDBA 4LY5A 4AIWA 3Q2UA 4G2UA 3S6SA 5JYSA 4D53A 2VZNA 2EPFA 4NUNA 1CFEA 3MZ8A 4NUKA 5ETEA 3U3UC 4IFAA 1RC9A 2CQ7A 4H0AA 1XTAA 4P27A 3S6VA 2DDAA 1QNXA
chains in the Genus database with same CATH superfamily
2MYSA 1RZ4A 1U6GA 3K0LA 4E4HA 2JTVA 4FTHA 2QM3A 5IOZA 3A02A 2C6YA 4E7HA 1JTYA 4YFNF 4RLQA 1I50J 1SFKA 4DYRA 3ZP5A 4GDFA 1GXQA 3Q5FA 1JGGA 2CQXA 1S3JA 3PO2J 3RKQA 5DV5A 2QGUA 1UELB 2XGCA 3VB2A 1UCRA 2DODA 2QUFA 1XGNA 5F0HA 2WBMA 4RM2A 2Z3YA 3S1MJ 2P6TA 2ZNZA 3HIFA 2DQRA 2JJ7A 3BP8A 3IH2A 1HCRA 1XMXA 2AS5F 1LE8B 4EATA 1SD6A 5HLHA 1JKQC 2E36A 4LLLA 3MWMA 1REPC 3NARA 1ZG5A 3E5UA 2R0QC 1WJDA 4B09A 2VBXA 1T2KA 1KYZA 1O57A 2BY2A 3HB9A 2CW7A 1AU7A 1MBKA 3W6JB 1ZLKA 1Y8RB 2NVYJ 1OCPA 2WB1N 2LKXA 2ME0A 1Y0NA 1FOXA 2XSJC 1YOVB 5FD5A 4J00A 2CJJA 4D1QA 3K6GA 1IXSB 2COMA 5B1BH 3GF2A 1JKPC 3MZ8A 5KAFC 4C9YA 1ETWA 2CQ7A 2BXZA 5L3FA 3UR3C 4ITVA 3PIOF 3CCLI 2JZYA 3JRCA 2VUMJ 3S2DJ 3G2BA 3GTLJ 2GXAA 5E8GA 4A5NA 4AUXA 2W7NA 2BXYA 3HC7A 2LKPA 1SD7A 2O61A 3FZVA 2K9LA 4MLOA 4XIDA 5KAIC 2LG4A 4DZJA 5HDKA 2HQAA 3VSLA 5H6RA 3P5JA 1JE8A 4ENMA 3HSRA 4UUTA 3OYLA 1I6XA 2V4JC 4CXFA 5JLXA 2CUJA 3LSKA 1T6SA 3I64A 1YW9A 2K4JA 5E1XA 1QHHD 2NYXA 1SEUA 3CZ6A 4EMSA 2HQRA 4E7JA 1GVDA 3OIQA 4CZCA 1LUJB 2TRTA 4MFDA 5F1JA 2HFHA 1Y39A 1RRJA 3C3WA 1YYVA 3ZRGA 3WTTC 3W6VA 2OQGA 2XHKA 3S6UA 2QSGX 5AONA 1WSUA 3K4LA 3R0AA 2LYCA 1SFEA 2W4SA 1S7EA 1LFUP 1T38A 2DN0A 5FKNA 2JUGA 3EQLF 3KFWX 1KU7A 3DEEA 3JRIA 1FEXA 4XRMA 4F52A 4Y52J 9ANTA 4U0YA 1D1CA 4NQWB 2V1UA 2QQ9A 5DM7F 3GZ6A 3GBGA 2JA6J 1F36A 3S8PA 2VJJA 5DDGA 2LY2A 2DK5A 3SEZA 1L3LA 3RI4A 1X1AA 5E79C 3E97A 1S6LA 2L2OA 1HXDA 1E3PA 3KETA 3KYLA 1ZQ3P 3BPVA 3I59B 5D6FA 3LA3A 4P96A 2JRMA 2PEXA 2E34A 4HAMA 1ETVA 2XPVA 3BR2A 3DQVC 5EEGA 3OSFA 4EJWA 4WXCA 4ASNA 1APLC 5F04A 4M6XA 3L2VA 1T8IA 2LF7A 3LQRA 1U5TB 2CQNA 2R7SA 1IAWA 1IN8A 3H1CA 1YW7A 2M3AA 3S3OA 3LSRA 1BOBA 4YIFA 4BJTA 1CF7A 4KFCA 3IWZA 3OYAA 4IHSA 3GZ5A 5CVUA 2YPRA 2XKOA 4PJJA 1VQ6I 1YJWI 1MZBA 3NWSA 4ZYDA 2HOEA 4L18B 3HRTA 3U1DA 2DJIA 3QPTA 2W24A 1M1EB 3E6CC 4OIQF 3KP4A 1RUOA 2HGCA 1AWCA 4W1UA 3FHZA 3WHCA 2HKOA 1I3AA 3E1SA 2JMWA 1U8BA 2ZJRF 1BN5A 1MBHA 1XCBA 1JXSA 1WJ5A 1OQYA 1GVJA 3KLOA 5E20A 5KNLA 4LLNA 4BJ6C 3FM5A 1UMQA 3CJNA 4C2MJ 3ROUA 3KCCA 4X6AJ 1FPQA 1R9TJ 3G1LA 1TWFJ 4JYKA 3P9CA 3HBLA 2KZVA 1BW5A 3WTZA 2FA5A 1XDSA 3ULQB 4O3MA 5FO5A 2YU3A 2P8TA 2XAHA 2L0KA 5GADJ 2HVRA 2VKDA 2VLAA 3HDDA 2VOPA 5JLWA 3ASOH 4Y7NJ 1YHQI 2L7ZA 5F64A 2E2HJ 4EEFG 1FLIA 3CUQA 3WG9A 3BOQA 3C18A 3M1EA 2CFXA 3L2UA 5KCMA 1OCTC 2ELHA 1TT5B 2FXAA 4V2FA 4IHVA 5LHHA 1X3ZB 1YX3A 4J19A 3K69A 5ED4A 1W36C 3L7WA 1HKTA 4BEHA 3WTYC 1XMAA 2IA0A 1XCVA 3K7AJ 2EZHA 5CLSA 3S1QJ 2DOAA 2FOKA 5FLXK 1WJAA 2K40A 4LB6B 1S7OA 2NOGA 2RN7A 3I9V2 3TMOA 3E5XA 4G6DA 4G7HF 2X1CA 1OJLA 3H9QA 1IN6A 1TWAJ 3FXJA 5F0CA 3DEWA 5IT9K 3BR6A 2F4IA 1O3RA 1VQKI 3HPGA 1A31A 3PIPF 1YS7A 2XRNA 1VQOI 3OYNA 1Z67A 1DPUA 2Q2EB 1OR7C 3HOXJ 4L9VA 1LPQA 2E7XA 3W2VA 1D0XA 4B43A 2RV8A 1X1DA 4A3DJ 2PMZA 2Q0OA 4PSXA 2NXNB 3U9GA 4A3BJ 1BOAA 3REOA 4XBFA 4E7IA 5F08A 4OU0A 1IO2A 5ILVA 1V5FA 4RGXA 5JR3A 4DZPA 3K1MA 2NNNA 3D5SC 3DKWA 1HQCA 2ME6A 2DMPA 1BI1A 1FWZA 1WPKA 2O7OA 3PUBA 4NUIA 3BLYA 4HF2A 3LSJA 4RGRA 1KU2A 4G2UA 2DA3A 1MBFA 5JHFA 3JREA 4A3EJ 2VKEA 3R6SA 2DPDA 4QWQA 1B8IA 2CW8A 2KDOA 1I1GA 1W36D 5HLTA 3CDIA 1MMSA 4ZDPA 2CU7A 4HA8A 3E7LA 2WAEA 4UHTA 3JCUC 2MD0A 4Q47A 1NG7A 1HF0A 2HDWA 1OPCA 2IS2A 1HC8A 4UUVA 3CC2I 2DT7B 2DMTA 2DFIA 2EIJH 3TP0A 2DAOA 1HDDC 1MBJA 1LDDA 2BY1A 3QPSA 3D0SA 3I4MJ 2LC2A 1ZR4A 5FLMJ 4BDZA 4A12A 3A1YA 4E6KG 2YUSA 2UWMA 2VPLA 2ACJA 3ABLH 1MSFC 2EPFA 3T5XA 2W82A 2PMUA 2X4HA 1ZN2A 5LHIA 5J4YA 2ESNA 2QSFX 2IAIA 3JR9A 4KN7X 3Q0VA 5D5UB 1R71A 4M3GA 2PJPA 3I4NJ 1ZREA 3D5RC 4HF0A 3KEQA 2NS0A 1IW7F 1N77A 4M73A 3QOEA 1HOMA 2Y75A 1FIAA 2F2EA 2FNPA 4KT5C 3CJQB 4S05A 2K7LA 3GO5A 1TQMA 5C4JJ 3ASNH 5CVVA 3LAPA 4LG0B 3OYMA 3MFKA 1P4AA 1Z3YA 4Q4ZF 3BR1A 3CUOA 2XAJA 2ZNYA 4BE0A 2L54A 4UVAA 1U0JA 3BJ6A 2PLYA 3S6VA 4ZDOA 4A6EA 4II3A 2LY1A 2PMZN 4WF2A 2IW5A 2DI3A 1FMVA 3PQKA 1BJAA 4EJVA 4M72A 4MGRA 5CPRB 4IF4A 1MMGA 2WV1A 3OYDA 4PZJA 2L7MP 4UB8C 4EJUA 3ABUA 2QVOA 5GAHJ 3DBRB 4IOCF 2O0YA 3RQ4A 3CCSI 2JQ7A 2HVSA 2LREA 3J80Z 1YIOA 4EGYA 2VBWA 1F5TA 4BS9A 2M7AA 2KT0A 4L5JA 4KA4A 4OMYA 3BG3A 4L5EA 2L4MA 1NG6A 3ELKA 3ZQFA 2K3FA 2VBZA 4G94A 4RMNA 3T8TA 2STTA 1EJ9A 1ERDA 3TBIA 4CICA 1QVTA 4G7OF 3A01B 5B1AH 4UVCA 2B7EA 1GXPA 4BBSJ 2ICWG 1MBEA 1TQPA 2LLKA 3JTGA 3NQOA 1XGOA 2W84A 1P92A 3KEYA 2HOTA 3AAFA 3HUGA 3ZQLA 3U3UC 2QQBA 4LB5A 2P6SA 3F8CA 4O6JA 4XKWA 4F93B 3RSNA 3IL2A 4P27A 2IEKA 5FD6A 2M87A 3QYEA 1Z21A 2JPBA 5DTDA 4OOIA 4BKXA 4U7DA 2R5YA 4JX6A 2FD5A 4AWXB 4F3QA 4KT6A 3SZPA 3TQNA 3LA2A 1H89C 3BQYA 1Y0UA 3AG4H 4D9JA 2HPMA 2CSOA 2ZMEA 2VZNA 3GTPJ 4IHWA 2XAFA 1R22A 3F6VA 3K4NA 4IXAA 4H0EA 2CW0F 2NS7A 5GPCA 3IKVA 5EYRA 2Y0SN 2R7DA 3TW7A 2MABA 3PO3J 2FMYA 4UY8I 1IC8A 1WRJA 5IP6A 3WTVC 2DDAA 2E71A 3OYBA 1QNXA 2XPWA 2FMLA 3DCFA 4JBAA 2UZKA 4PGHA 3FXOA 1R1VA 3K9TA 3QU6A 4IEJA 3I5UA 2P5KA 3MAJA 3OMYA 4ZTJA 2FBHA 4IQ4A 2R4GA 1RKWA 3H5RA 4K2EA 2HDCA 3WGIA 2XSDC 5A2QK 3DTKA 4MIMA 4QPQA 1OCRH 3L00A 3QODA 5J40A 4Y33A 1RIOH 2EV5A 1XC5A 3BQZA 2RQQA 5GAGJ 2YX7A 3L2RA 2NNYA 4RAYA 1Y1WJ 1FYMA 2XF5A 1HSJA 4CYDA 2FQ3A 2P81A 2EFPA 4NNJA 5TISC 2PFBA 3LNQA 4MFEA 2KZGA 1W4MA 3SFZA 1MBGA 1G3TA 1OYYA 4H4KC 2OU2A 2IJLA 2EA4A 2W85A 4U0VA 3HOSA 1J59A 1FY7A 2OPTA 4DYCA 4PSWA 3PL8A 5JYSA 4DBRA 2E1OA 3LFKA 4BBRJ 5KVRA 1XSVA 3CLQA 1FOWA 1S8NA 5J47A 4I09A 4EGZA 3RZOJ 2R7XA 5EJCA 2IS4A 1MIJA 5CVIA 4ESJA 2DOFA 4LIVA 3S93A 4ZYAA 1OCOH 2VN2A 3Q3SA 3OYHA 4UNOA 1P4WA 1H8AC 1KYWA 4JX5A 2P7VB 2DA6A 2W1OA 3GLLA 1HW1A 5LRSA 1T08B 2HKXA 3E3VA 2DXIA 3GYHX 2DT5A 3PSIA 3FBNB 2HZTA 2VXDA 4G8XA 3SHFA 3ECOA 1T39A 2KLOA 3GLXA 2BY3A 3F8MA 2EFNA 1J7KA 2YX4A 5JFRA 1OYWA 5IPAA 3KP6A 3FISA 2NVXJ 2GLOA 1B1BA 5IP7J 4BXFA 3GTOJ 1MMDA 2ISYA 2BBYA 1MH4A 4AIDA 3ZMDA 4AYBA 2ECCA 2V9VA 4A3FJ 2Q1ZB 1T0FA 3BTLA 2PJRA 2EZLA 5CJ9A 1OCCH 2L4AA 5EGOA 2DDBA 2M0CA 3IC7A 2L5QA 4BY7J 4IOAF 4M9XA 1EA3A 1SAUA 5CVRA 2L01A 2VQCA 1SFXA 5EG0B 3RPUA 1J9IA 2ELKA 2ZKZA 3H3ZA 3A03A 2K9SA 1I6HJ 4IHXA 1T95A 1HW2A 2Z33A 2NOJB 1ODDA 2M0MA 3OOPA 1CGPA 3DLLF 1NHAA 2W57A 3IH4A 3SDGA 2CS3A 3AL0C 1LKXA 1P7IA 1Z7LA 3AFHA 4XL9A 3ZQ7A 3RJPA 3WE3A 1F9NA 3MKYB 2H1LA 2IGOA 1FBUA 3EETA 4ENJA 1TC3C 1TTYA 2LRDA 2GXGA 1SFUA 4II2A 4FE4A 3WTUC 4AD9A 2MC4A 1QVUA 2BEOA 2BZTA 4KICA 3R0JA 1IUFA 4BXXJ 2HR3A 1WJBA 3OV8A 3SJMA 4LLGF 4HV5A 1T98A 2R5ZB 4BL0B 1ZTRA 1TWHJ 1SMTA 3VYRB 1N75A 2E1MC 1ACIA 3DEUA 4V2GA 1BM9A 1IXCA 2RNJA 1C0WA 1F4KA 1Z91A 4KN4X 5LGNA 4HF1A 2DA5A 2I5UA 1V5EA 4M71A 3PM1A 5KK1A 5BMZA 5FKLA 2A61A 2LOOA 1FYLA 4B47A 1R4MB 2R7FA 2WADA 2LD5A 3C2BA 1Q1HA 1YG2A 2R7QA 2HNHA 1JUMA 2VQGA 1PP7U 1TZLA 5DCMB 2IP2A 4CCJA 3EPZA 3JRDA 4L5IA 3GEZA 4XOPA 3F9KA 4Y4RA 2MG4A 3BC8A 2DW4A 3DTIA 4AYBN 2X9DA 4E70A 1MJ9A 2XKPA 3GFLA 1HDPA 2CH0A 3GW2A 1AKHA 1FTTA 1YE9A 1PVEA 3JSOA 1QHGA 4LOCA 4D7MA 1D1AA 2DT6A 1UB9A 1TP4A 1U9OA 2OJED 5J1YA 1R5HA 4BAYA 1T56A 1EV7A 2NVQJ 3WE2A 3KZZA 2WV0A 1BI3A 3CLOA 1LQ1A 4XRSA 2LK2A 2OQRA 3DP7A 2EZIA 3ISPA 3C2GA 4EJTA 1WH5A 3MMYB 1P6RA 5IP9J 3TEDA 3LSMA 2HYGD 1ETOA 4KMFA 3H3UA 4HX8A 1FIPA 1VZ0A 3N97A 3CCVI 1B72B 2HXOA 2R92J 1TWGJ 1R5ID 2HTSA 4B3AA 3M8EA 3EUHA 5DM6F 4E7SA 3CJTB 2V6EA 2BVLA 3HOUJ 4LMYA 3RYRA 5IT9Z 4ZDLA 4CH7A 1WKMA 3DPUA 3MEXA 1FP1D 1TW3A 4YRVA 2L7KA 4FQGA 3RKYA 1A6QA 2GA2A 3LMMA 3SYTA 4HBLA 1W0TA 2OV7A 4IX7A 1LB2A 3ERED 2K9MA 4L0YB 2YR2A 4RB0A 3FK6A 3CMAI 5FGMA 4QPOA 3BCBA 2I10A 1J2XA 5ETEA 4A93J 4MTEA 4BUPA 4R79A 2ZO4A 2O8XA 4RLFA 5D5VB 1E3HA 1IRZA 3BG9A 4C30A 4G7ZF 1ZLJA 4PJMA 4YIIA 1G2HA 3JRBA 4PJLA 3TP3A 3PNTA 3KZIC 1WZ2A 1ZG1A 2E1NA 1KONA 4ZYGA 2LY9A 2M45A 1BBYA 2EV6A 3HM5A 2HOSA 2OZ6A 2XPUA 4CCLA 1YLFA 3KE2A 2EK5A 1R00A 1X58A 2CFOA 5HS9A 3HPHA 4JK1X 1YJ9I 2I8DA 4U87A 4Z6YA 1B9NA 4A3LJ 3DFGA 4GFBA 4XLCA 3GVAA 2LDUA 2GA1A 1BR2A 3VPRA 1FTZA 4TPVA 1A35A 1DUXC 1OISA 1RR7A 2ESHA 2IGMA 3UKGA 3LSPA 5J1UA 5E18F 1ETQA 1BR1A 1EF4A 5LGUA 4EV0A 2COBA 3G4SI 3DU6A 2A68F 1R6RA 5BNGA 3HOVJ 2CRGA 3R60A 4U0WA 1UZCA 3GX4X 2CV0A 3OYGA 1LEBA 3HEFA 5H2FC 4NB5A 5M5YJ 4WX9A 2FOWA 3I53A 5ILSA 1GT0C 2HVQA 2AXLA 2R7WA 1ZH5A 1X4OA 4QLCU 4A5MA 2XB0X 1D1BA 2WA0A 3CDLA 2LBFA 2KL4A 2K5CA 4XK4A 1RI7A 2Q2EA 1ZRCA 4XONA 5B3SH 2M7BA 3VWBA 3HTUA 3IP4B 5IT3A 1VQ7I 3JAMZ 3CDHA 2B63J 1USSA 1IXRC 2DA7A 5DEQA 1MDMB 3EUKL 3VYUB 4JP0A 3FDYA 3O3KA 2Y30A 1FMWA 4P1WA 3ERMA 4A3GJ 1D3YA 4MEYF 3ZMZA 2Y9ZA 4M3DA 4Y15A 2B9SA 4N0BA 4Y17A 4M6VA 1QQIA 4GO1A 2LKSA 3U21A 5B5EC 3OS2A 2ID3A 5L3BA 2FJ1A 4OWRB 5BS6A 2XF6A 2K86A 2M30A 2WTEA 3HXLA 3SEQA 1EH6A 4GRIA 2H1KA 2O3FA 3B73A 2OCEA 3VSKA 1BW6A 3HHHA 4XLNF 5LD2C 3E6MA 1LFPA 2JN6A 3NT8A 1V54H 2EQRA 3A0HC 3B02A 4WCGA 3F72A 2QWWA 1ZARA 3CMMA 2VE8A 2ZBKA 3K70C 1BR4A 4AVZA 4D7NA 4RB1A 5LLQA 1H88C 1ULYA 3ZQCA 1BA5A 2DMQA 1YITI 1O3SA 2JSPA 3N05A 2ISZA 3P7NA 2X6OA 5FKMA 4S0HB 1F43A 4NC7A 4DW6A 1QGPA 3CF2A 3OYJA 5LEKA 1PP8F 4ANJA 2R7OA 3BR0A 3M3YJ 4I02A 4RS8A 4IZZA 1S5LC 1RNLA 3BT9A 3GMEA 1D8KA 2XUBA 2CQKA 2RVCA 2XGEA 4HQMA 5DUKA 3CMEI 1W7PD 2BGCA 2ZB9A 1UAAA 5J3LA 2O8KA 4BHBA 2QKMB 3TOAA 5HS8A 2MH2A 3KPHA 2D5VA 1UG0A 4D53A 1YO5C 3CCMI 4LG0A 1PJRA 4N9IA 3GFJA 1OFCX 5J8CA 5EEHA 3KLNA 3G1MA 1YW8A 2BE5F 2AHQA 2NAZA 5D6EA 2VODA 1IN7A 3S1RJ 3T0YA 1XX5A 1CF7B 1FSEA 1N25A 4CGZA 3QWLA 2CUFA 2MBFA 2DA2A 3QYFA 3H3VK 2CUEA 1V5GA 3H9JA 3PFIA 5CQEA 4DQ2A 3EYYA 4DGWB 1JKRC 4NDLA 1RETA 3SFIA 1A04A 3TGNA 1ZGJA 2Z2SB 1WJEA 3KYDB 5AIQA 3K70D 2LH9A 3CJRB 3L09A 1DDNA 2BHYA 5A2QZ 2Y2ZA 4HX7A 4UB6C 2L9NA 3ZQGA 5K5QA 2GQQA 1IDYA 3CP8A 5J8FA 2DO7A 4P9FA 2MA3A 4CA0A 4I01A 3ESWB 2IPQX 1OMIA 4A0YA 2JPCA 2EZKA 4CYCA 3J81K 1I3QJ 3HRMA 3U3LC 4BNCA 2P0WA 1A5JA 2L7FP 5L3DA 3HKZA 2F5FA 5ICEA 3R61A 3DU5A 1XDUA 2G0EA 2M4KA 2KPMA 2W48A 3H0GJ 3RCOA 1O3TA 4FETA 3GTKJ 3X2QH 2P5LC 3AL0B 1GV5A 2B0LA 3QAHA 4XM3A 2VKHA 1Y1VJ 2LSOA 5M5XJ 4A3KJ 5ICFA 1TNTA 2Y31A 4DJAA 2XAUA 2DLLA 2MFZA 2BW3B 1E2XA 4ZC3A 4HOBA 3WTXC 5C4XJ 1EH7A 1MD0A 1Y56A 1K78A 2WAFA 1Z1DA 2VI6A 2Y9YA 1FJLA 1MGTA 1D0YA 2ZFUA 3EYIA 2LFBA 3JRHA 3BDDA 2R93J 4LK0F 1P7JA 2M1BA 4H0AA 1R49A 3BJAA 1S29A 1O4XA 4M3BA 2E1MB 3OR2C 3SXYA 1I39A 1SFOJ 1JHFA 1UHMA 5FRNA 1BI0A 1XMKA 1MJBA 2A6HF 5FKOA 3EUAA 3MN2A 1U9NA 2V26A 3J7YJ 5M3FJ 4FT8A 3TDUC 3L2QA 3G3ZA 1TBXA 1POGA 4BE1A 1USTA 2ZJ2A 3ZMTA 5LBQA 4KIBA 2QZ8A 1L0OC 1NTCA 2KRCA 4M9ZA 4A2UA 4I2OA 4PGGA 2NVTJ 2M4GA 2CMPA 2OTLI 1WGXA 3WGHA 2OC6A 1G6NA 1ZAOA 1QRYA 2DFFA 2R7UA 2XC7A 1NK3P 5AIPA 1B4AA 3BJOA 1U8RA 1ON1A 2IVMA 3H9GA 3ZN0A 5IYDJ 3PNVA 1B8IB 2EILH 2CYYA 2KJCA 3H92A 4M6YA 2MGQA 3K4BA 5LFAA 5FJ8J 1WFXA 4C3IJ 4E7LA 2VB6A 5DD8A 1J5YA 2V79A 3HKZN 1KQ9A 3GTQJ 2DA4A 1G59A 3CMYA 3SQNA 1WHUA 4EJOA 1YRNB 4XRFA 3WU2C 2DCEA 3K2ZA 3L9FA 3SDBA 1E17A 4HEA2 4LJZF 1V4RA 2HQ5A 3H5AA 1IRXA 2ZC2A 3VYSB 3U3NC 1VQNI 5TRDA 2GM4A 2QYOA 4G6TB 4KJZA 3W2WA 3ZOBA 4XLHA 1X4PA 2X6XA 3BTIA 1ZHFA 5FKKA 3HGYA 2A6EF 3PFYA 1FSHA 1S72I 1MMAA 2HQNA 4NHJA 2F5VA 2IS1A 2UV1A 4LIUA 4YIRX 4QTRA 1MH3A 3IWFA 5LHGA 3F0CA 2GIZA 3E6BA 2FE3A 3I54A 2R3SA 3BTCA 1U53A 2EV0A 1IV8A 4HLXA 1JT0A 2R7VA 2PN6A 1SVMA 4DIQA 2ID6A 3LWFA 4JQFA 3TL4X 4BQQA 1JT6A 5LEJA 3H35A 4UXNA 1KU3A 4G6QA 3WG7H 2EIKH 3N4MA 5FB2A 2J5OA 4F92B 3AG3H 4B1RA 4AM3A 2CQQA 2F5DA 4ZTFA 4DBQA 2WC2A 4UV9A 1R5GA 4IFAA 1UHWA 4IRGA 1DP7P 1X2MA 4N9HA 2OAZA 2DMUA 2PG4A 3C7JA 4KNYA 4BH9A 1HW5A 4IJAA 4LITA 3BR3A 2M8GX 2NVUB 1R1UA 4BHPA 2JWTA 5HOOA 1Q1VA 2JSCA 2M5WA 5K1YA 1SAXA 1V55H 4LY5A 5EDNA 3ZGKA 5HDNA 2FQ4A 2L9SA 3A0BC 1IZ1A 1MNMC 1VNDA 5DCFA 3BCAA 3FXKA 2QCOA 2JA2A 1X1BA 1HA8A 2OF7A 3AG2H 1NK2P 1ONVA 3AG1H 1EH8A 2F5EA 2YSRA 2L3DA 1ZRFA 1WI9A 1XGMA 4YEJA 5ICGA 3B6AA 1H9GA 3ZQQA 2R5ZA 2VJ4A 2A6TA 4M3FA 3VOEA 3TOBA 3IRRA 3RKXA 1K61A 5JVTA 2QBYB 3ZMUA 3FMRA 1KA8A 2O5RA 1IGNA 2Z9OA 1WJCA 2DPUA 2FSWA 3HUGB 2HS5A 1FOKA 1CFEA 2KRHA 2VASA 2DTRA 1VQ5I 3NEUA 1S7AA 3FMSA 4KMUX 2STWA 2IA1A 4RDUA 1TLHB 4IRIA 1R4NB 4MQ9F 1ZG3A 1W5CC 2ZXJA 2ECBA 3S16J 4Q5SF 3I4PA 1WWXA 2R5YB 2GOXB 1XPXA 1OR7A 3OIPA 2HOAA 1Z3XA 2AQFA 3UNGC 1STZA 4C2TA 3C2HA 2X48A 4GCVA 4XLPF 2E7WA 2DTZA 2F6CA 4XR6A 1P4XA 1PUEE 4AIHA 3RPQA 2RAEA 1LE8A 5IOYA 3RTRA 2AO9A 2DFEA 1W7PB 2FEZA 3OL3A 3BWGA 4HLYA 1XG1A 1TL8A 1FYKA 5KHDA 3I3LA 2FF4A 4KIFA 1VQ4I 3DBHB 1TNSA 2KRFA 1A36A 1Y6IA 2D2WA 3J7AY 5IYCJ 1YTYA 3CUQC 4XICA 4P55A 2O6GE 2P7CB 3HL2A 5L3GA 5EF6A 3Q2UA 3DF8A 3M7GA 4E7KA 1JJ6C 1IV6A 4IQJA 5ERIA 5JI6A 3QRFF 5BPIA 1AA7A 3MQ0A 5J4VA 2BHZA 3HGGA 4LG3A 1GHCA 3BTJA 2FRHA 2WB1A 4GXOA 2G7HA 3QU3A 3M9AA 3SZGA 2JT1A 1LDKB 3I56I 5K5OA 1H9TA 1K83J 2ZSIB 1OKRA 2KKOA 2HYJA 1LFBA 3OOUA 5FROA 1QO0D 4M9SA 2IS6A 3I58A 1ZGWA 1NH3A 3ZN1A 2QF7A 3ZPLA 2FUG2 4HG2A 3V7SA 3CC7I 2XIGA 3FKIJ 5FFXA 3TO6A 1J0RA 1JUSA 2FNAA 4G9YA 2E60A 3F8NA 3H0DA 4WXHA 4UUSB 3DXJF 1JGSA 2OZUA 2XASA 3HRUA 2OUMA 3FBIB 4HSTA 3Q0UA 2K4BA 2QQAA 2WAQA 2XVCA 1P9QC 5HS7A 2AQEA 1X3UA 2RKHA 3BZKA 2DU9A 4XSXF 4RBOA 3CO6C 2WY8Q 3F8FA 3Q9SA 5LRRA 3WU1B 4MHGA 4JOMA 4D5FA 1BIAA 1BL0A 3HSEA 4CCOA 2EIMH 4XORA 4RGUA 1P2FA 5DYMA 4FHTA 1Y8QB 1D0ZA 5IYBJ 2VXZA 3OY9A 4PCQA 4FASD 2XV4S 2VONA 3BY6A 4B4CA 3P9KA 1YJNI 2ZJQF 4NQWA 1VQLI 2M8EA 3NAUA 4OIOF 1XB4A 1Z05A 3WTSC 1OLTA 4KDPA 2E19A 5H6QA 2XGDA 2PJRB 1XGSA 1J75A 1B9MA 5EGOB 3TO7A 5HNHA 2V7FA 4A0XA 4BJ5C 4A3MJ 1LEAA 3O6BB 1R58A 1JTXA 3K1NA 2KIUA 3KP2A 1YX5A 1EKEA 3I59A 1IDZA 1SVLA 2Y0MA 3S14J 1BI2A 5LGTA 3IAM2 3OS0A 2F48A 1VQ9I 3O8GA 4XKBA 4IHTA 5FLXZ 3CO7C 2MH9A 4Y13A 4IRHA 2VC1A 4XSZF 1SMYF 3PJRA 5E3OA 3NRVA 2KISA 2GOMA 1R23A 3LSGA 4N4OB 2W25A 3LQQA 4BDYA 1U5TA 2EFWA 3LSIA 2KIFA 3Q2RA 4HW0A 4HNUA 4RM3A 2X1DA 2HPIA 3O2PE 4HZFA 2KIMA 4XMYA 1O7LA 2E5NA 4U88A 3QYBA 4IVNA 2O9LA 1S9HA 4BU2A 1QZYA 3A4CA 1SC7A 2W00A 1VFCA 3PQJA 1MNEA 4BHCA 4Q48A 4E7ZA 3WU0A 1MDMA 2LP0A 1R7JA 4BQNA 3GWZA 4AIKA 1LJ9A 3RKWA 1RKTA 4EM2A 4ESBA 1PUFB 1KQ0A 3ABKH 4KITB 3FXMA 2EBIA 1IRGA 2BOLA 2F5CA 2HDDA 4NUOA 3ZXSA 1O7FA 1VI0A 3MD2A 2WAQN 3WODF 5GTHC 3M1CA 4NUBA 5F6FA 4AU7A 3L2CA 1FBQA 1T33A 4AIJA 4XN0A 3SZTA 1QNTA 2E2JJ 2FX0A 4NUNA 4CCKA 3GXOA 2GXBA 2EFOA 2X85A 4MEXF 4IKFA 4O5VA 2OBPA 3F22A 5E3MA 1XN7A 4A69C 2A07F 1ZYRF 1PYVA 2KMUA 6PAXA 2VC0A 3IKTA 1HBXG 1KU9A 2Z99A 1FZPB 3FX3A 1YI2I 2CV1A 1IF1A 2XB5A 3OL4A 5D4RA 2JRTA 4I76A 4FE7A 3E6DA 3JW4A 1GUUA 1W0UA 3J81Z 2ZJPF 5F0FA 4OINF 2V1XA 4BQOA 1TQIA 1DP3A 2HU9A 1DGRM 3HZJA 4QSHA 5GP9A 1A6IA 1GLNA 3MKLA 3VEPA 1AKHB 3FXLA 1SVOA 2CG4A 4XKVA 3HOYJ 4HSRA 3B6CA 1LVKA 2IBDA 3FXUA 5D8LB 1U78A 2KIQA 2R7RA 1MJAA 4TV7A 3QPHA 2V9PA 4KISA 5EZGA 3P9IA 4RGSA 1FT9A 2H09A 4RB2C 5L3EA 2XRLA 2Z1DA 2CWEA 3LSTA 4XNFA 4AC0A 4CO8A 2K85A 1XS9A 1G3YA 1CQTA 3K4MA 1U3EM 3G6EI 3QPLA 3TKYA 1JJ8C 3E5QA 2X1EA 2KQRA 1K7AA 2HYFA 5IY5H 5E8IA 1IJWC 2X6YA 1Z6TA 4L9JA 1MMNA 3DTEA 2ZMEC 2ZFWA 3ECHA 1QA6A 1HLVA 3RQIA 4IO9F 3A2KA 2NRAC 4G12A 1G8XA 1UG2A 2E5ZA 4GYGA 2GZWA 3QOPA 1R36A 3DBLB 5F27A 2G7UA 2JVHA 4DYQA 2RC4A 3TW6A 1JUPA 3F3XA 2JA5J 3WHBA 1VTNC 2EA2A 5K5RA 4I7HA 3COAC 2K9QA 2DYRH 4R8HA 3WGGA 3I71A 1WI3A 4HDVA 1O3QA 2A69F 3DLAA 5HVQC 3DKYA 4I99C 1ETYA 5FRMA 2H8WA 1RC9A 2TDXA 3HSFA 3FIWA 2K3PA 2UXXA 2M9HA 3BG6A 5HNFA 4ZZDA 3OR1C 1VQMI 2DYSH 3FKJA 4KYWA 2XDVA 1WVRA 3QQAA 4M3EA 2ZXIA 5GPAA 4X1EA 3V8LA 4ESFA 3CF5F 1BC8C 2H6BA 3CP2A 2IGNA 4EVIA 2JVGA 1QBJA 4LK1F 2KDZA 4ZJZA 2IGKA 4X0GA 5H20A 1UHSA 2F4MB 4RAGA 1KGSA 2ELJA 2MC3A 1DGWY 4HV6A 3H36A 1IG7A 2HZDA 3DV8A 3S17J 1QPMA 5DUIA 5E1ZB 1X1PA 3FF5A 1ZR2A 5JVGF 1ZGAA 3DWLE 3CCJI 5GTIC 2JUCA 2P4WA 3CCUI 2BW3A 1I1SA 2QLZA 3MZYA 2UUZA 1QZZA 3VFZA 4DOZA 1ZK8A 3KEOA 3W6KB 4PJNA 3HHGA 4AIWA 1QZEA 4MTDA 1K4TA 5BPDA 4OAZA 4RAFA 3S6SA 2OD5A 2DQLA 3QP5A 4U7BA 2L9RA 4ENKA 3M4OJ 5TJJA 4L0ZB 3K4KA 1DQUA 4L9NA 2VPRA 3IH3A 1KZHA 1XTAA 2LTPA 2R7ZJ 3LAJA 3HG9A 4GYIA 2RREA 2L02A 1BJZA 4BGDA 2UXNA 2LBFB 4PJ0C 4IPAA 2MW8A 2MLGA 3ML6A 3HJEA 4IL6C 4P9UA 2FBIA 3MVPA 2H27A 3KP3A 4CDGA 2A3SA 3ABMH 3GFMA 1T0FC 2GIVA 1OYIA 3JRGA 5EEAA 1FNNA 1OCZH 4B44A 2JA8J 3LOCA 2RGVA 4OAYA 3ONQA 2VIXA 3V8KA 3PUFA 3ZMSA 4ZH4F 2D45A 4OIPF 5ICCA 2HI3A 1GDTA 1AHDP 4AVPA 4LGWA 3MZHA 1LVAA 3HTSB 3ZMVA 2KHMA 2M2EA 4JX4A 1YFHA 1W5TA 3LL7A 3BG7A 4I6ZA 2VJ5A 1B59A 3JTHA 4WWCA 3L1PA 3OSGA 4B8XA 3F6OA 1FBSA 3FHNA 3A01A 3HRSA 3BG5A 2TCTA 4CCNA 2DA1A 5BQTA 1GV2A 3JRFA 2FU4A 2VOOA 2AXTC 2VL8A 4ABZA 3HYIA 1PDNC 3CUQB 1VF9A 5J1RA 2GBYA 2OCCH 1YRNA 3MKWB 5BOXA 5D8KB 3JRAA 1TWCJ 4MO7A 4A3IJ 4NC6A 1UFMA 1Z0XA 4BEHB 1ITYA 2E2IJ 2R7TA 2DMNA 3VYTB 4FX4A 3HOTA 4LFUA 3BPXA 4GGGA 3IV5A 2H8RA 2QKLB 2EWNA 3W2AA 5E1WA 3DPLC 4P5OA 4BACA 1F1ZA 1N78A 2E35A 4ZYHA 4I98B 4A3JJ 1JHHA 3BR5A 3FK7A 3S3MA 3G73A 3EDPA 1XSXA 5J6XA 2ZXWH 4FCYA 1K4SA 1YIJI 2F4OB 2WWYA 2QA4I 2ZXHA 3RPUD 1ENHA 4B48A 4ZZLA 3GUDA 2Y0SA 2VQLA 4HNVA 2PBIA 1SD4A 4NBQA 5HDGA 5E3NA 2M34A 2QEXI 1D8JA 3RZDJ 3D1NI 1X2NA 3Q0WA 3JAMK 4Z2YA 3R4KA 4HPQA 3G71I 4EQQA 2E1CA 5FFZA 4XN3A 2PI0A 2HWVA 2X51A 4CZZA 1H0MA 1Z7UA 1ON2A 4A0ZA 1XD7A 3FMQA 3K1PA 3CCYA 4WXDA 3RDIA 5M5WJ 2X6WA 2P5VA 2H94A 4Y3OA 2BVMA 3V42A 1FX7A 3E0JB 2A05A 4EM1A 2CV2A 4HQEA 3M07A 3KP7A 5D5XB 1Z6RA 1RR8C 4ETSA 3V4GA 2XAQA 5D4SA 1ZELA 5JHUA 3WTWC 2OTJI 2VE9A 5GAEJ 5B66C 3V8JA 1DPRA 1W5SA 2LF8A 2PX9A 4WK8F 2VQHA 1E0EA 3CTAA 3RIRA 1ZRDA 4C3JJ 5D5WB 3FWEA 4MQVA 4W97A 5M3MJ 3FXRA 1W1WE 4HDUA 1MKMA 2JK3A 3T1BA 2BYVE 3OWTA 2CGPA 2D1VA 1YQAA 3K2AA 1X1CA 2V1DA 3GCMA 4PFPA 3W3CA 4A6DA 5DS9A 2LVSA 4CYCB 1WH7A 3MCZA 5K7ZA 1JKOC 1UJ8A 3EUHC 4UV8A 4I0BA 1U5TC 4F91B 2VBYA 3M8JA 4BY1J 1MSEC 1YS6A 2OA4A 2L9VA 4LD5A 3KIOA 2VKVA 2V6CA 2QBYA 3DPTA 1Z9CA 4CCMA 2CO5A 2NS8A 3O8HA 1HSTA 3GTMJ 1I5ZA 1HKSA 3KZYA 4XKCA 3PSFA 4XLAA 3ZR8X 4B3XA 1DU0A 3OYEA 4XRSG 3L2WA 1X19A 1QU3A 4CSWA 3F8BA 4F7ZA 3ZQIA 1Z77A 2QENA 1U2WA 1WJFA 1MW7A 4ON0A 2O03A 3DKXA 4PDKA 1WQ2A 3PNYA 5K7FA 1K78B 3KP5A 1XSDA 4C2UA 2V1NA 3HOZJ 1SANA 2Z5UA 1MNDA 2A5WA 3H5NA 2XROA 3S2WA 2DFHA 3FXQA 3T8RA 3F23A 3IUOA 4BQAA 2HXIA 3ZCOA 5EG0A 2RNGA 2LMDA 2XF7A 3J7AO 1W7PA 1D5VA 2VT2A 1FOYA 4FISA 4OMZA 2X0LA 3S1NJ 3J7ZI 4XLEA 1G4DA 2JA7J 4RB3C 3LA7A 2K02A 1VQPI 2FBKA 1R1TA 4D0PA 3CD6I 4OIRF 3I0TA 4HNTA 3CQZJ 3I55I 4XQFA 2EH3A 4N4NB 2GAUA 1WCMJ 3U2RA 4L9TA 4YFXF 1HKQA 2DOEA 2VJIA 3IAS2 2H6CA 1BIBA 2XAGA 3BZ6A 3OYIA 2MLKA 3GTGJ 5CVJA 1TW2A 4PFOA 4J01A 2EINH 2K27A 2MD5A 4BE2A 2Y48A 4YFKF 3F21A 1JI8A 2EB7A 2G9WA 3JSPA 3TDZC 1RESA 2J5PA 4HX4A 4MNUA 3S15J 1FC3A 2Q8KA 3KYCB 5E17F 4A3CJ 2YS9A 4UUSA 2KJBA 4YG2F 5DD4A 4HYEA 1DU6A 2CUZA 2QSHX 1K6OA 3K4JA 2IRFG 4KIGA 2HTJA 3C1DA 2QQ8A 4RAZA 2ADUA 3CESA 2GWRA 3U1KA 3TO9A 3IHUA 3G1OA 4DNCA 5L3CA 1IRFA 3Q9VA 4ENNA 2RQPA 5HLGA 5F1RA 5HLIA 2PQ8A 1D5YA 1B6AA 3OYFA 1BC7C 2D1HA 3K10A 3MKZA 3K4CA 4M74A 4HRIA 5E3LA 1J09A 5DCMA 5EZHA 2ZMEB 2LR8A 3OIOA 3CC4I 3BZCA 4KUMA 2IT0A 3VODA 3RYPA 5CQGA 3CCQI 2ETHA 2BV6A 5TGTA 4D5CA 1V3FA 2WY7Q 3D5LA 1LNWA 1ORKA 1RUNA 4ZYEA 2KP6A 2N8GA 2HEOA 4QIWN 4PUSA 4BXUA 2VT3A 2Y69H 3GZNB 1LDJA 3OYCA 2DBBA 2BY0A 4S04A 4CUGA 4V19K 1G3SA 4UVBA 2PMHA 3VDXA 5CYVA 3CCEI 2IXSA 1AOYA 2V9KA 4F55A 1G3WA 1X3WB 2YU9J 1ETKA 2MSYA 1K79A 3LFUA 1TT0A 3J80K 3KX2A 1VQ8I 2DJNA 4PK4A 4I0AA 3OYKA 2ZCWA 1IN5A 1B72A 1KQ8A 3S2HJ 1K6YA 2XGXA 3FM3A 1IUYA 2A5YB 3M8FA 4NC8A 2RDPA 5C3EJ 3GTJJ 1SD5A 4YELA 2K9NA 2LNBA 3ABTA 1FP2A 4RA2A 5C44J 3LSHA 4XOTA 3AKZA 3GFIA 3S3NA 1SMBA 3OS1A 3S32A 3NWTA 3V7RA 2EFQA 4BYYA 3HOWJ 1I27A 4R1HA 2ZSHB 1QPIA 2DK8A 3ZQHA 4IHYA 1RPWA 5K7HA 4CHUA 5CKTA 3BROA 5HODA 2KFDA 2EJRA 4FX0A 2Z16A 4C3HJ 1IN4A 3V7CA 2IA2A 4XLFA 3IRQA 3CCRI 4EM0B 1E3OC 5FLVA 1ETXA 1ZKGA 4NUKA 1PUFA 5ILUA 3QP6A
chains in the Genus database with same CATH topology
1XX5A 4TPVA 3S6UA 2GIZA 1WVRA 2A05A 1SMBA 1U53A 3NT8A 3U3LC 3Q2RA 4NUIA 4NUOA 3U3NC 2DDBA 4LY5A 4AIWA 3Q2UA 4G2UA 3S6SA 5JYSA 4D53A 2VZNA 2EPFA 4NUNA 1CFEA 3MZ8A 4NUKA 5ETEA 3U3UC 4IFAA 1RC9A 2CQ7A 4H0AA 1XTAA 4P27A 3S6VA 2DDAA 1QNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XX5 A;  4TPV A;  3S6U A;  2GIZ A;  1WVR A;  2A05 A;  1SMB A;  1U53 A;  3NT8 A;  3U3L C;  3Q2R A;  4NUI A;  4NUO A;  3U3N C;  2DDB A;  4LY5 A;  4AIW A;  3Q2U A;  4G2U A;  3S6S A;  5JYS A;  4D53 A;  2VZN A;  2EPF A;  4NUN A;  1CFE A;  3MZ8 A;  4NUK A;  5ETE A;  3U3U C;  4IFA A;  1RC9 A;  2CQ7 A;  4H0A A;  1XTA A;  4P27 A;  3S6V A;  2DDA A;  1QNX A; 
#chains in the Genus database with same CATH topology
 2MYS A;  1RZ4 A;  1U6G A;  3K0L A;  4E4H A;  2JTV A;  4FTH A;  2QM3 A;  5IOZ A;  3A02 A;  2C6Y A;  4E7H A;  1JTY A;  4YFN F;  4RLQ A;  1I50 J;  1SFK A;  4DYR A;  3ZP5 A;  4GDF A;  1GXQ A;  3Q5F A;  1JGG A;  2CQX A;  1S3J A;  3PO2 J;  3RKQ A;  5DV5 A;  2QGU A;  1UEL B;  2XGC A;  3VB2 A;  1UCR A;  2DOD A;  2QUF A;  1XGN A;  5F0H A;  2WBM A;  4RM2 A;  2Z3Y A;  3S1M J;  2P6T A;  2ZNZ A;  3HIF A;  2DQR A;  2JJ7 A;  3BP8 A;  3IH2 A;  1HCR A;  1XMX A;  2AS5 F;  1LE8 B;  4EAT A;  1SD6 A;  5HLH A;  1JKQ C;  2E36 A;  4LLL A;  3MWM A;  1REP C;  3NAR A;  1ZG5 A;  3E5U A;  2R0Q C;  1WJD A;  4B09 A;  2VBX A;  1T2K A;  1KYZ A;  1O57 A;  2BY2 A;  3HB9 A;  2CW7 A;  1AU7 A;  1MBK A;  3W6J B;  1ZLK A;  1Y8R B;  2NVY J;  1OCP A;  2WB1 N;  2LKX A;  2ME0 A;  1Y0N A;  1FOX A;  2XSJ C;  1YOV B;  5FD5 A;  4J00 A;  2CJJ A;  4D1Q A;  3K6G A;  1IXS B;  2COM A;  5B1B H;  3GF2 A;  1JKP C;  3MZ8 A;  5KAF C;  4C9Y A;  1ETW A;  2CQ7 A;  2BXZ A;  5L3F A;  3UR3 C;  4ITV A;  3PIO F;  3CCL I;  2JZY A;  3JRC A;  2VUM J;  3S2D J;  3G2B A;  3GTL J;  2GXA A;  5E8G A;  4A5N A;  4AUX A;  2W7N A;  2BXY A;  3HC7 A;  2LKP A;  1SD7 A;  2O61 A;  3FZV A;  2K9L A;  4MLO A;  4XID A;  5KAI C;  2LG4 A;  4DZJ A;  5HDK A;  2HQA A;  3VSL A;  5H6R A;  3P5J A;  1JE8 A;  4ENM A;  3HSR A;  4UUT A;  3OYL A;  1I6X A;  2V4J C;  4CXF A;  5JLX A;  2CUJ A;  3LSK A;  1T6S A;  3I64 A;  1YW9 A;  2K4J A;  5E1X A;  1QHH D;  2NYX A;  1SEU A;  3CZ6 A;  4EMS A;  2HQR A;  4E7J A;  1GVD A;  3OIQ A;  4CZC A;  1LUJ B;  2TRT A;  4MFD A;  5F1J A;  2HFH A;  1Y39 A;  1RRJ A;  3C3W A;  1YYV A;  3ZRG A;  3WTT C;  3W6V A;  2OQG A;  2XHK A;  3S6U A;  2QSG X;  5AON A;  1WSU A;  3K4L A;  3R0A A;  2LYC A;  1SFE A;  2W4S A;  1S7E A;  1LFU P;  1T38 A;  2DN0 A;  5FKN A;  2JUG A;  3EQL F;  3KFW X;  1KU7 A;  3DEE A;  3JRI A;  1FEX A;  4XRM A;  4F52 A;  4Y52 J;  9ANT A;  4U0Y A;  1D1C A;  4NQW B;  2V1U A;  2QQ9 A;  5DM7 F;  3GZ6 A;  3GBG A;  2JA6 J;  1F36 A;  3S8P A;  2VJJ A;  5DDG A;  2LY2 A;  2DK5 A;  3SEZ A;  1L3L A;  3RI4 A;  1X1A A;  5E79 C;  3E97 A;  1S6L A;  2L2O A;  1HXD A;  1E3P A;  3KET A;  3KYL A;  1ZQ3 P;  3BPV A;  3I59 B;  5D6F A;  3LA3 A;  4P96 A;  2JRM A;  2PEX A;  2E34 A;  4HAM A;  1ETV A;  2XPV A;  3BR2 A;  3DQV C;  5EEG A;  3OSF A;  4EJW A;  4WXC A;  4ASN A;  1APL C;  5F04 A;  4M6X A;  3L2V A;  1T8I A;  2LF7 A;  3LQR A;  1U5T B;  2CQN A;  2R7S A;  1IAW A;  1IN8 A;  3H1C A;  1YW7 A;  2M3A A;  3S3O A;  3LSR A;  1BOB A;  4YIF A;  4BJT A;  1CF7 A;  4KFC A;  3IWZ A;  3OYA A;  4IHS A;  3GZ5 A;  5CVU A;  2YPR A;  2XKO A;  4PJJ A;  1VQ6 I;  1YJW I;  1MZB A;  3NWS A;  4ZYD A;  2HOE A;  4L18 B;  3HRT A;  3U1D A;  2DJI A;  3QPT A;  2W24 A;  1M1E B;  3E6C C;  4OIQ F;  3KP4 A;  1RUO A;  2HGC A;  1AWC A;  4W1U A;  3FHZ A;  3WHC A;  2HKO A;  1I3A A;  3E1S A;  2JMW A;  1U8B A;  2ZJR F;  1BN5 A;  1MBH A;  1XCB A;  1JXS A;  1WJ5 A;  1OQY A;  1GVJ A;  3KLO A;  5E20 A;  5KNL A;  4LLN A;  4BJ6 C;  3FM5 A;  1UMQ A;  3CJN A;  4C2M J;  3ROU A;  3KCC A;  4X6A J;  1FPQ A;  1R9T J;  3G1L A;  1TWF J;  4JYK A;  3P9C A;  3HBL A;  2KZV A;  1BW5 A;  3WTZ A;  2FA5 A;  1XDS A;  3ULQ B;  4O3M A;  5FO5 A;  2YU3 A;  2P8T A;  2XAH A;  2L0K A;  5GAD J;  2HVR A;  2VKD A;  2VLA A;  3HDD A;  2VOP A;  5JLW A;  3ASO H;  4Y7N J;  1YHQ I;  2L7Z A;  5F64 A;  2E2H J;  4EEF G;  1FLI A;  3CUQ A;  3WG9 A;  3BOQ A;  3C18 A;  3M1E A;  2CFX A;  3L2U A;  5KCM A;  1OCT C;  2ELH A;  1TT5 B;  2FXA A;  4V2F A;  4IHV A;  5LHH A;  1X3Z B;  1YX3 A;  4J19 A;  3K69 A;  5ED4 A;  1W36 C;  3L7W A;  1HKT A;  4BEH A;  3WTY C;  1XMA A;  2IA0 A;  1XCV A;  3K7A J;  2EZH A;  5CLS A;  3S1Q J;  2DOA A;  2FOK A;  5FLX K;  1WJA A;  2K40 A;  4LB6 B;  1S7O A;  2NOG A;  2RN7 A;  3I9V 2;  3TMO A;  3E5X A;  4G6D A;  4G7H F;  2X1C A;  1OJL A;  3H9Q A;  1IN6 A;  1TWA J;  3FXJ A;  5F0C A;  3DEW A;  5IT9 K;  3BR6 A;  2F4I A;  1O3R A;  1VQK I;  3HPG A;  1A31 A;  3PIP F;  1YS7 A;  2XRN A;  1VQO I;  3OYN A;  1Z67 A;  1DPU A;  2Q2E B;  1OR7 C;  3HOX J;  4L9V A;  1LPQ A;  2E7X A;  3W2V A;  1D0X A;  4B43 A;  2RV8 A;  1X1D A;  4A3D J;  2PMZ A;  2Q0O A;  4PSX A;  2NXN B;  3U9G A;  4A3B J;  1BOA A;  3REO A;  4XBF A;  4E7I A;  5F08 A;  4OU0 A;  1IO2 A;  5ILV A;  1V5F A;  4RGX A;  5JR3 A;  4DZP A;  3K1M A;  2NNN A;  3D5S C;  3DKW A;  1HQC A;  2ME6 A;  2DMP A;  1BI1 A;  1FWZ A;  1WPK A;  2O7O A;  3PUB A;  4NUI A;  3BLY A;  4HF2 A;  3LSJ A;  4RGR A;  1KU2 A;  4G2U A;  2DA3 A;  1MBF A;  5JHF A;  3JRE A;  4A3E J;  2VKE A;  3R6S A;  2DPD A;  4QWQ A;  1B8I A;  2CW8 A;  2KDO A;  1I1G A;  1W36 D;  5HLT A;  3CDI A;  1MMS A;  4ZDP A;  2CU7 A;  4HA8 A;  3E7L A;  2WAE A;  4UHT A;  3JCU C;  2MD0 A;  4Q47 A;  1NG7 A;  1HF0 A;  2HDW A;  1OPC A;  2IS2 A;  1HC8 A;  4UUV A;  3CC2 I;  2DT7 B;  2DMT A;  2DFI A;  2EIJ H;  3TP0 A;  2DAO A;  1HDD C;  1MBJ A;  1LDD A;  2BY1 A;  3QPS A;  3D0S A;  3I4M J;  2LC2 A;  1ZR4 A;  5FLM J;  4BDZ A;  4A12 A;  3A1Y A;  4E6K G;  2YUS A;  2UWM A;  2VPL A;  2ACJ A;  3ABL H;  1MSF C;  2EPF A;  3T5X A;  2W82 A;  2PMU A;  2X4H A;  1ZN2 A;  5LHI A;  5J4Y A;  2ESN A;  2QSF X;  2IAI A;  3JR9 A;  4KN7 X;  3Q0V A;  5D5U B;  1R71 A;  4M3G A;  2PJP A;  3I4N J;  1ZRE A;  3D5R C;  4HF0 A;  3KEQ A;  2NS0 A;  1IW7 F;  1N77 A;  4M73 A;  3QOE A;  1HOM A;  2Y75 A;  1FIA A;  2F2E A;  2FNP A;  4KT5 C;  3CJQ B;  4S05 A;  2K7L A;  3GO5 A;  1TQM A;  5C4J J;  3ASN H;  5CVV A;  3LAP A;  4LG0 B;  3OYM A;  3MFK A;  1P4A A;  1Z3Y A;  4Q4Z F;  3BR1 A;  3CUO A;  2XAJ A;  2ZNY A;  4BE0 A;  2L54 A;  4UVA A;  1U0J A;  3BJ6 A;  2PLY A;  3S6V A;  4ZDO A;  4A6E A;  4II3 A;  2LY1 A;  2PMZ N;  4WF2 A;  2IW5 A;  2DI3 A;  1FMV A;  3PQK A;  1BJA A;  4EJV A;  4M72 A;  4MGR A;  5CPR B;  4IF4 A;  1MMG A;  2WV1 A;  3OYD A;  4PZJ A;  2L7M P;  4UB8 C;  4EJU A;  3ABU A;  2QVO A;  5GAH J;  3DBR B;  4IOC F;  2O0Y A;  3RQ4 A;  3CCS I;  2JQ7 A;  2HVS A;  2LRE A;  3J80 Z;  1YIO A;  4EGY A;  2VBW A;  1F5T A;  4BS9 A;  2M7A A;  2KT0 A;  4L5J A;  4KA4 A;  4OMY A;  3BG3 A;  4L5E A;  2L4M A;  1NG6 A;  3ELK A;  3ZQF A;  2K3F A;  2VBZ A;  4G94 A;  4RMN A;  3T8T A;  2STT A;  1EJ9 A;  1ERD A;  3TBI A;  4CIC A;  1QVT A;  4G7O F;  3A01 B;  5B1A H;  4UVC A;  2B7E A;  1GXP A;  4BBS J;  2ICW G;  1MBE A;  1TQP A;  2LLK A;  3JTG A;  3NQO A;  1XGO A;  2W84 A;  1P92 A;  3KEY A;  2HOT A;  3AAF A;  3HUG A;  3ZQL A;  3U3U C;  2QQB A;  4LB5 A;  2P6S A;  3F8C A;  4O6J A;  4XKW A;  4F93 B;  3RSN A;  3IL2 A;  4P27 A;  2IEK A;  5FD6 A;  2M87 A;  3QYE A;  1Z21 A;  2JPB A;  5DTD A;  4OOI A;  4BKX A;  4U7D A;  2R5Y A;  4JX6 A;  2FD5 A;  4AWX B;  4F3Q A;  4KT6 A;  3SZP A;  3TQN A;  3LA2 A;  1H89 C;  3BQY A;  1Y0U A;  3AG4 H;  4D9J A;  2HPM A;  2CSO A;  2ZME A;  2VZN A;  3GTP J;  4IHW A;  2XAF A;  1R22 A;  3F6V A;  3K4N A;  4IXA A;  4H0E A;  2CW0 F;  2NS7 A;  5GPC A;  3IKV A;  5EYR A;  2Y0S N;  2R7D A;  3TW7 A;  2MAB A;  3PO3 J;  2FMY A;  4UY8 I;  1IC8 A;  1WRJ A;  5IP6 A;  3WTV C;  2DDA A;  2E71 A;  3OYB A;  1QNX A;  2XPW A;  2FML A;  3DCF A;  4JBA A;  2UZK A;  4PGH A;  3FXO A;  1R1V A;  3K9T A;  3QU6 A;  4IEJ A;  3I5U A;  2P5K A;  3MAJ A;  3OMY A;  4ZTJ A;  2FBH A;  4IQ4 A;  2R4G A;  1RKW A;  3H5R A;  4K2E A;  2HDC A;  3WGI A;  2XSD C;  5A2Q K;  3DTK A;  4MIM A;  4QPQ A;  1OCR H;  3L00 A;  3QOD A;  5J40 A;  4Y33 A;  1RIO H;  2EV5 A;  1XC5 A;  3BQZ A;  2RQQ A;  5GAG J;  2YX7 A;  3L2R A;  2NNY A;  4RAY A;  1Y1W J;  1FYM A;  2XF5 A;  1HSJ A;  4CYD A;  2FQ3 A;  2P81 A;  2EFP A;  4NNJ A;  5TIS C;  2PFB A;  3LNQ A;  4MFE A;  2KZG A;  1W4M A;  3SFZ A;  1MBG A;  1G3T A;  1OYY A;  4H4K C;  2OU2 A;  2IJL A;  2EA4 A;  2W85 A;  4U0V A;  3HOS A;  1J59 A;  1FY7 A;  2OPT A;  4DYC A;  4PSW A;  3PL8 A;  5JYS A;  4DBR A;  2E1O A;  3LFK A;  4BBR J;  5KVR A;  1XSV A;  3CLQ A;  1FOW A;  1S8N A;  5J47 A;  4I09 A;  4EGZ A;  3RZO J;  2R7X A;  5EJC A;  2IS4 A;  1MIJ A;  5CVI A;  4ESJ A;  2DOF A;  4LIV A;  3S93 A;  4ZYA A;  1OCO H;  2VN2 A;  3Q3S A;  3OYH A;  4UNO A;  1P4W A;  1H8A C;  1KYW A;  4JX5 A;  2P7V B;  2DA6 A;  2W1O A;  3GLL A;  1HW1 A;  5LRS A;  1T08 B;  2HKX A;  3E3V A;  2DXI A;  3GYH X;  2DT5 A;  3PSI A;  3FBN B;  2HZT A;  2VXD A;  4G8X A;  3SHF A;  3ECO A;  1T39 A;  2KLO A;  3GLX A;  2BY3 A;  3F8M A;  2EFN A;  1J7K A;  2YX4 A;  5JFR A;  1OYW A;  5IPA A;  3KP6 A;  3FIS A;  2NVX J;  2GLO A;  1B1B A;  5IP7 J;  4BXF A;  3GTO J;  1MMD A;  2ISY A;  2BBY A;  1MH4 A;  4AID A;  3ZMD A;  4AYB A;  2ECC A;  2V9V A;  4A3F J;  2Q1Z B;  1T0F A;  3BTL A;  2PJR A;  2EZL A;  5CJ9 A;  1OCC H;  2L4A A;  5EGO A;  2DDB A;  2M0C A;  3IC7 A;  2L5Q A;  4BY7 J;  4IOA F;  4M9X A;  1EA3 A;  1SAU A;  5CVR A;  2L01 A;  2VQC A;  1SFX A;  5EG0 B;  3RPU A;  1J9I A;  2ELK A;  2ZKZ A;  3H3Z A;  3A03 A;  2K9S A;  1I6H J;  4IHX A;  1T95 A;  1HW2 A;  2Z33 A;  2NOJ B;  1ODD A;  2M0M A;  3OOP A;  1CGP A;  3DLL F;  1NHA A;  2W57 A;  3IH4 A;  3SDG A;  2CS3 A;  3AL0 C;  1LKX A;  1P7I A;  1Z7L A;  3AFH A;  4XL9 A;  3ZQ7 A;  3RJP A;  3WE3 A;  1F9N A;  3MKY B;  2H1L A;  2IGO A;  1FBU A;  3EET A;  4ENJ A;  1TC3 C;  1TTY A;  2LRD A;  2GXG A;  1SFU A;  4II2 A;  4FE4 A;  3WTU C;  4AD9 A;  2MC4 A;  1QVU A;  2BEO A;  2BZT A;  4KIC A;  3R0J A;  1IUF A;  4BXX J;  2HR3 A;  1WJB A;  3OV8 A;  3SJM A;  4LLG F;  4HV5 A;  1T98 A;  2R5Z B;  4BL0 B;  1ZTR A;  1TWH J;  1SMT A;  3VYR B;  1N75 A;  2E1M C;  1ACI A;  3DEU A;  4V2G A;  1BM9 A;  1IXC A;  2RNJ A;  1C0W A;  1F4K A;  1Z91 A;  4KN4 X;  5LGN A;  4HF1 A;  2DA5 A;  2I5U A;  1V5E A;  4M71 A;  3PM1 A;  5KK1 A;  5BMZ A;  5FKL A;  2A61 A;  2LOO A;  1FYL A;  4B47 A;  1R4M B;  2R7F A;  2WAD A;  2LD5 A;  3C2B A;  1Q1H A;  1YG2 A;  2R7Q A;  2HNH A;  1JUM A;  2VQG A;  1PP7 U;  1TZL A;  5DCM B;  2IP2 A;  4CCJ A;  3EPZ A;  3JRD A;  4L5I A;  3GEZ A;  4XOP A;  3F9K A;  4Y4R A;  2MG4 A;  3BC8 A;  2DW4 A;  3DTI A;  4AYB N;  2X9D A;  4E70 A;  1MJ9 A;  2XKP A;  3GFL A;  1HDP A;  2CH0 A;  3GW2 A;  1AKH A;  1FTT A;  1YE9 A;  1PVE A;  3JSO A;  1QHG A;  4LOC A;  4D7M A;  1D1A A;  2DT6 A;  1UB9 A;  1TP4 A;  1U9O A;  2OJE D;  5J1Y A;  1R5H A;  4BAY A;  1T56 A;  1EV7 A;  2NVQ J;  3WE2 A;  3KZZ A;  2WV0 A;  1BI3 A;  3CLO A;  1LQ1 A;  4XRS A;  2LK2 A;  2OQR A;  3DP7 A;  2EZI A;  3ISP A;  3C2G A;  4EJT A;  1WH5 A;  3MMY B;  1P6R A;  5IP9 J;  3TED A;  3LSM A;  2HYG D;  1ETO A;  4KMF A;  3H3U A;  4HX8 A;  1FIP A;  1VZ0 A;  3N97 A;  3CCV I;  1B72 B;  2HXO A;  2R92 J;  1TWG J;  1R5I D;  2HTS A;  4B3A A;  3M8E A;  3EUH A;  5DM6 F;  4E7S A;  3CJT B;  2V6E A;  2BVL A;  3HOU J;  4LMY A;  3RYR A;  5IT9 Z;  4ZDL A;  4CH7 A;  1WKM A;  3DPU A;  3MEX A;  1FP1 D;  1TW3 A;  4YRV A;  2L7K A;  4FQG A;  3RKY A;  1A6Q A;  2GA2 A;  3LMM A;  3SYT A;  4HBL A;  1W0T A;  2OV7 A;  4IX7 A;  1LB2 A;  3ERE D;  2K9M A;  4L0Y B;  2YR2 A;  4RB0 A;  3FK6 A;  3CMA I;  5FGM A;  4QPO A;  3BCB A;  2I10 A;  1J2X A;  5ETE A;  4A93 J;  4MTE A;  4BUP A;  4R79 A;  2ZO4 A;  2O8X A;  4RLF A;  5D5V B;  1E3H A;  1IRZ A;  3BG9 A;  4C30 A;  4G7Z F;  1ZLJ A;  4PJM A;  4YII A;  1G2H A;  3JRB A;  4PJL A;  3TP3 A;  3PNT A;  3KZI C;  1WZ2 A;  1ZG1 A;  2E1N A;  1KON A;  4ZYG A;  2LY9 A;  2M45 A;  1BBY A;  2EV6 A;  3HM5 A;  2HOS A;  2OZ6 A;  2XPU A;  4CCL A;  1YLF A;  3KE2 A;  2EK5 A;  1R00 A;  1X58 A;  2CFO A;  5HS9 A;  3HPH A;  4JK1 X;  1YJ9 I;  2I8D A;  4U87 A;  4Z6Y A;  1B9N A;  4A3L J;  3DFG A;  4GFB A;  4XLC A;  3GVA A;  2LDU A;  2GA1 A;  1BR2 A;  3VPR A;  1FTZ A;  4TPV A;  1A35 A;  1DUX C;  1OIS A;  1RR7 A;  2ESH A;  2IGM A;  3UKG A;  3LSP A;  5J1U A;  5E18 F;  1ETQ A;  1BR1 A;  1EF4 A;  5LGU A;  4EV0 A;  2COB A;  3G4S I;  3DU6 A;  2A68 F;  1R6R A;  5BNG A;  3HOV J;  2CRG A;  3R60 A;  4U0W A;  1UZC A;  3GX4 X;  2CV0 A;  3OYG A;  1LEB A;  3HEF A;  5H2F C;  4NB5 A;  5M5Y J;  4WX9 A;  2FOW A;  3I53 A;  5ILS A;  1GT0 C;  2HVQ A;  2AXL A;  2R7W A;  1ZH5 A;  1X4O A;  4QLC U;  4A5M A;  2XB0 X;  1D1B A;  2WA0 A;  3CDL A;  2LBF A;  2KL4 A;  2K5C A;  4XK4 A;  1RI7 A;  2Q2E A;  1ZRC A;  4XON A;  5B3S H;  2M7B A;  3VWB A;  3HTU A;  3IP4 B;  5IT3 A;  1VQ7 I;  3JAM Z;  3CDH A;  2B63 J;  1USS A;  1IXR C;  2DA7 A;  5DEQ A;  1MDM B;  3EUK L;  3VYU B;  4JP0 A;  3FDY A;  3O3K A;  2Y30 A;  1FMW A;  4P1W A;  3ERM A;  4A3G J;  1D3Y A;  4MEY F;  3ZMZ A;  2Y9Z A;  4M3D A;  4Y15 A;  2B9S A;  4N0B A;  4Y17 A;  4M6V A;  1QQI A;  4GO1 A;  2LKS A;  3U21 A;  5B5E C;  3OS2 A;  2ID3 A;  5L3B A;  2FJ1 A;  4OWR B;  5BS6 A;  2XF6 A;  2K86 A;  2M30 A;  2WTE A;  3HXL A;  3SEQ A;  1EH6 A;  4GRI A;  2H1K A;  2O3F A;  3B73 A;  2OCE A;  3VSK A;  1BW6 A;  3HHH A;  4XLN F;  5LD2 C;  3E6M A;  1LFP A;  2JN6 A;  3NT8 A;  1V54 H;  2EQR A;  3A0H C;  3B02 A;  4WCG A;  3F72 A;  2QWW A;  1ZAR A;  3CMM A;  2VE8 A;  2ZBK A;  3K70 C;  1BR4 A;  4AVZ A;  4D7N A;  4RB1 A;  5LLQ A;  1H88 C;  1ULY A;  3ZQC A;  1BA5 A;  2DMQ A;  1YIT I;  1O3S A;  2JSP A;  3N05 A;  2ISZ A;  3P7N A;  2X6O A;  5FKM A;  4S0H B;  1F43 A;  4NC7 A;  4DW6 A;  1QGP A;  3CF2 A;  3OYJ A;  5LEK A;  1PP8 F;  4ANJ A;  2R7O A;  3BR0 A;  3M3Y J;  4I02 A;  4RS8 A;  4IZZ A;  1S5L C;  1RNL A;  3BT9 A;  3GME A;  1D8K A;  2XUB A;  2CQK A;  2RVC A;  2XGE A;  4HQM A;  5DUK A;  3CME I;  1W7P D;  2BGC A;  2ZB9 A;  1UAA A;  5J3L A;  2O8K A;  4BHB A;  2QKM B;  3TOA A;  5HS8 A;  2MH2 A;  3KPH A;  2D5V A;  1UG0 A;  4D53 A;  1YO5 C;  3CCM I;  4LG0 A;  1PJR A;  4N9I A;  3GFJ A;  1OFC X;  5J8C A;  5EEH A;  3KLN A;  3G1M A;  1YW8 A;  2BE5 F;  2AHQ A;  2NAZ A;  5D6E A;  2VOD A;  1IN7 A;  3S1R J;  3T0Y A;  1XX5 A;  1CF7 B;  1FSE A;  1N25 A;  4CGZ A;  3QWL A;  2CUF A;  2MBF A;  2DA2 A;  3QYF A;  3H3V K;  2CUE A;  1V5G A;  3H9J A;  3PFI A;  5CQE A;  4DQ2 A;  3EYY A;  4DGW B;  1JKR C;  4NDL A;  1RET A;  3SFI A;  1A04 A;  3TGN A;  1ZGJ A;  2Z2S B;  1WJE A;  3KYD B;  5AIQ A;  3K70 D;  2LH9 A;  3CJR B;  3L09 A;  1DDN A;  2BHY A;  5A2Q Z;  2Y2Z A;  4HX7 A;  4UB6 C;  2L9N A;  3ZQG A;  5K5Q A;  2GQQ A;  1IDY A;  3CP8 A;  5J8F A;  2DO7 A;  4P9F A;  2MA3 A;  4CA0 A;  4I01 A;  3ESW B;  2IPQ X;  1OMI A;  4A0Y A;  2JPC A;  2EZK A;  4CYC A;  3J81 K;  1I3Q J;  3HRM A;  3U3L C;  4BNC A;  2P0W A;  1A5J A;  2L7F P;  5L3D A;  3HKZ A;  2F5F A;  5ICE A;  3R61 A;  3DU5 A;  1XDU A;  2G0E A;  2M4K A;  2KPM A;  2W48 A;  3H0G J;  3RCO A;  1O3T A;  4FET A;  3GTK J;  3X2Q H;  2P5L C;  3AL0 B;  1GV5 A;  2B0L A;  3QAH A;  4XM3 A;  2VKH A;  1Y1V J;  2LSO A;  5M5X J;  4A3K J;  5ICF A;  1TNT A;  2Y31 A;  4DJA A;  2XAU A;  2DLL A;  2MFZ A;  2BW3 B;  1E2X A;  4ZC3 A;  4HOB A;  3WTX C;  5C4X J;  1EH7 A;  1MD0 A;  1Y56 A;  1K78 A;  2WAF A;  1Z1D A;  2VI6 A;  2Y9Y A;  1FJL A;  1MGT A;  1D0Y A;  2ZFU A;  3EYI A;  2LFB A;  3JRH A;  3BDD A;  2R93 J;  4LK0 F;  1P7J A;  2M1B A;  4H0A A;  1R49 A;  3BJA A;  1S29 A;  1O4X A;  4M3B A;  2E1M B;  3OR2 C;  3SXY A;  1I39 A;  1SFO J;  1JHF A;  1UHM A;  5FRN A;  1BI0 A;  1XMK A;  1MJB A;  2A6H F;  5FKO A;  3EUA A;  3MN2 A;  1U9N A;  2V26 A;  3J7Y J;  5M3F J;  4FT8 A;  3TDU C;  3L2Q A;  3G3Z A;  1TBX A;  1POG A;  4BE1 A;  1UST A;  2ZJ2 A;  3ZMT A;  5LBQ A;  4KIB A;  2QZ8 A;  1L0O C;  1NTC A;  2KRC A;  4M9Z A;  4A2U A;  4I2O A;  4PGG A;  2NVT J;  2M4G A;  2CMP A;  2OTL I;  1WGX A;  3WGH A;  2OC6 A;  1G6N A;  1ZAO A;  1QRY A;  2DFF A;  2R7U A;  2XC7 A;  1NK3 P;  5AIP A;  1B4A A;  3BJO A;  1U8R A;  1ON1 A;  2IVM A;  3H9G A;  3ZN0 A;  5IYD J;  3PNV A;  1B8I B;  2EIL H;  2CYY A;  2KJC A;  3H92 A;  4M6Y A;  2MGQ A;  3K4B A;  5LFA A;  5FJ8 J;  1WFX A;  4C3I J;  4E7L A;  2VB6 A;  5DD8 A;  1J5Y A;  2V79 A;  3HKZ N;  1KQ9 A;  3GTQ J;  2DA4 A;  1G59 A;  3CMY A;  3SQN A;  1WHU A;  4EJO A;  1YRN B;  4XRF A;  3WU2 C;  2DCE A;  3K2Z A;  3L9F A;  3SDB A;  1E17 A;  4HEA 2;  4LJZ F;  1V4R A;  2HQ5 A;  3H5A A;  1IRX A;  2ZC2 A;  3VYS B;  3U3N C;  1VQN I;  5TRD A;  2GM4 A;  2QYO A;  4G6T B;  4KJZ A;  3W2W A;  3ZOB A;  4XLH A;  1X4P A;  2X6X A;  3BTI A;  1ZHF A;  5FKK A;  3HGY A;  2A6E F;  3PFY A;  1FSH A;  1S72 I;  1MMA A;  2HQN A;  4NHJ A;  2F5V A;  2IS1 A;  2UV1 A;  4LIU A;  4YIR X;  4QTR A;  1MH3 A;  3IWF A;  5LHG A;  3F0C A;  2GIZ A;  3E6B A;  2FE3 A;  3I54 A;  2R3S A;  3BTC A;  1U53 A;  2EV0 A;  1IV8 A;  4HLX A;  1JT0 A;  2R7V A;  2PN6 A;  1SVM A;  4DIQ A;  2ID6 A;  3LWF A;  4JQF A;  3TL4 X;  4BQQ A;  1JT6 A;  5LEJ A;  3H35 A;  4UXN A;  1KU3 A;  4G6Q A;  3WG7 H;  2EIK H;  3N4M A;  5FB2 A;  2J5O A;  4F92 B;  3AG3 H;  4B1R A;  4AM3 A;  2CQQ A;  2F5D A;  4ZTF A;  4DBQ A;  2WC2 A;  4UV9 A;  1R5G A;  4IFA A;  1UHW A;  4IRG A;  1DP7 P;  1X2M A;  4N9H A;  2OAZ A;  2DMU A;  2PG4 A;  3C7J A;  4KNY A;  4BH9 A;  1HW5 A;  4IJA A;  4LIT A;  3BR3 A;  2M8G X;  2NVU B;  1R1U A;  4BHP A;  2JWT A;  5HOO A;  1Q1V A;  2JSC A;  2M5W A;  5K1Y A;  1SAX A;  1V55 H;  4LY5 A;  5EDN A;  3ZGK A;  5HDN A;  2FQ4 A;  2L9S A;  3A0B C;  1IZ1 A;  1MNM C;  1VND A;  5DCF A;  3BCA A;  3FXK A;  2QCO A;  2JA2 A;  1X1B A;  1HA8 A;  2OF7 A;  3AG2 H;  1NK2 P;  1ONV A;  3AG1 H;  1EH8 A;  2F5E A;  2YSR A;  2L3D A;  1ZRF A;  1WI9 A;  1XGM A;  4YEJ A;  5ICG A;  3B6A A;  1H9G A;  3ZQQ A;  2R5Z A;  2VJ4 A;  2A6T A;  4M3F A;  3VOE A;  3TOB A;  3IRR A;  3RKX A;  1K61 A;  5JVT A;  2QBY B;  3ZMU A;  3FMR A;  1KA8 A;  2O5R A;  1IGN A;  2Z9O A;  1WJC A;  2DPU A;  2FSW A;  3HUG B;  2HS5 A;  1FOK A;  1CFE A;  2KRH A;  2VAS A;  2DTR A;  1VQ5 I;  3NEU A;  1S7A A;  3FMS A;  4KMU X;  2STW A;  2IA1 A;  4RDU A;  1TLH B;  4IRI A;  1R4N B;  4MQ9 F;  1ZG3 A;  1W5C C;  2ZXJ A;  2ECB A;  3S16 J;  4Q5S F;  3I4P A;  1WWX A;  2R5Y B;  2GOX B;  1XPX A;  1OR7 A;  3OIP A;  2HOA A;  1Z3X A;  2AQF A;  3UNG C;  1STZ A;  4C2T A;  3C2H A;  2X48 A;  4GCV A;  4XLP F;  2E7W A;  2DTZ A;  2F6C A;  4XR6 A;  1P4X A;  1PUE E;  4AIH A;  3RPQ A;  2RAE A;  1LE8 A;  5IOY A;  3RTR A;  2AO9 A;  2DFE A;  1W7P B;  2FEZ A;  3OL3 A;  3BWG A;  4HLY A;  1XG1 A;  1TL8 A;  1FYK A;  5KHD A;  3I3L A;  2FF4 A;  4KIF A;  1VQ4 I;  3DBH B;  1TNS A;  2KRF A;  1A36 A;  1Y6I A;  2D2W A;  3J7A Y;  5IYC J;  1YTY A;  3CUQ C;  4XIC A;  4P55 A;  2O6G E;  2P7C B;  3HL2 A;  5L3G A;  5EF6 A;  3Q2U A;  3DF8 A;  3M7G A;  4E7K A;  1JJ6 C;  1IV6 A;  4IQJ A;  5ERI A;  5JI6 A;  3QRF F;  5BPI A;  1AA7 A;  3MQ0 A;  5J4V A;  2BHZ A;  3HGG A;  4LG3 A;  1GHC A;  3BTJ A;  2FRH A;  2WB1 A;  4GXO A;  2G7H A;  3QU3 A;  3M9A A;  3SZG A;  2JT1 A;  1LDK B;  3I56 I;  5K5O A;  1H9T A;  1K83 J;  2ZSI B;  1OKR A;  2KKO A;  2HYJ A;  1LFB A;  3OOU A;  5FRO A;  1QO0 D;  4M9S A;  2IS6 A;  3I58 A;  1ZGW A;  1NH3 A;  3ZN1 A;  2QF7 A;  3ZPL A;  2FUG 2;  4HG2 A;  3V7S A;  3CC7 I;  2XIG A;  3FKI J;  5FFX A;  3TO6 A;  1J0R A;  1JUS A;  2FNA A;  4G9Y A;  2E60 A;  3F8N A;  3H0D A;  4WXH A;  4UUS B;  3DXJ F;  1JGS A;  2OZU A;  2XAS A;  3HRU A;  2OUM A;  3FBI B;  4HST A;  3Q0U A;  2K4B A;  2QQA A;  2WAQ A;  2XVC A;  1P9Q C;  5HS7 A;  2AQE A;  1X3U A;  2RKH A;  3BZK A;  2DU9 A;  4XSX F;  4RBO A;  3CO6 C;  2WY8 Q;  3F8F A;  3Q9S A;  5LRR A;  3WU1 B;  4MHG A;  4JOM A;  4D5F A;  1BIA A;  1BL0 A;  3HSE A;  4CCO A;  2EIM H;  4XOR A;  4RGU A;  1P2F A;  5DYM A;  4FHT A;  1Y8Q B;  1D0Z A;  5IYB J;  2VXZ A;  3OY9 A;  4PCQ A;  4FAS D;  2XV4 S;  2VON A;  3BY6 A;  4B4C A;  3P9K A;  1YJN I;  2ZJQ F;  4NQW A;  1VQL I;  2M8E A;  3NAU A;  4OIO F;  1XB4 A;  1Z05 A;  3WTS C;  1OLT A;  4KDP A;  2E19 A;  5H6Q A;  2XGD A;  2PJR B;  1XGS A;  1J75 A;  1B9M A;  5EGO B;  3TO7 A;  5HNH A;  2V7F A;  4A0X A;  4BJ5 C;  4A3M J;  1LEA A;  3O6B B;  1R58 A;  1JTX A;  3K1N A;  2KIU A;  3KP2 A;  1YX5 A;  1EKE A;  3I59 A;  1IDZ A;  1SVL A;  2Y0M A;  3S14 J;  1BI2 A;  5LGT A;  3IAM 2;  3OS0 A;  2F48 A;  1VQ9 I;  3O8G A;  4XKB A;  4IHT A;  5FLX Z;  3CO7 C;  2MH9 A;  4Y13 A;  4IRH A;  2VC1 A;  4XSZ F;  1SMY F;  3PJR A;  5E3O A;  3NRV A;  2KIS A;  2GOM A;  1R23 A;  3LSG A;  4N4O B;  2W25 A;  3LQQ A;  4BDY A;  1U5T A;  2EFW A;  3LSI A;  2KIF A;  3Q2R A;  4HW0 A;  4HNU A;  4RM3 A;  2X1D A;  2HPI A;  3O2P E;  4HZF A;  2KIM A;  4XMY A;  1O7L A;  2E5N A;  4U88 A;  3QYB A;  4IVN A;  2O9L A;  1S9H A;  4BU2 A;  1QZY A;  3A4C A;  1SC7 A;  2W00 A;  1VFC A;  3PQJ A;  1MNE A;  4BHC A;  4Q48 A;  4E7Z A;  3WU0 A;  1MDM A;  2LP0 A;  1R7J A;  4BQN A;  3GWZ A;  4AIK A;  1LJ9 A;  3RKW A;  1RKT A;  4EM2 A;  4ESB A;  1PUF B;  1KQ0 A;  3ABK H;  4KIT B;  3FXM A;  2EBI A;  1IRG A;  2BOL A;  2F5C A;  2HDD A;  4NUO A;  3ZXS A;  1O7F A;  1VI0 A;  3MD2 A;  2WAQ N;  3WOD F;  5GTH C;  3M1C A;  4NUB A;  5F6F A;  4AU7 A;  3L2C A;  1FBQ A;  1T33 A;  4AIJ A;  4XN0 A;  3SZT A;  1QNT A;  2E2J J;  2FX0 A;  4NUN A;  4CCK A;  3GXO A;  2GXB A;  2EFO A;  2X85 A;  4MEX F;  4IKF A;  4O5V A;  2OBP A;  3F22 A;  5E3M A;  1XN7 A;  4A69 C;  2A07 F;  1ZYR F;  1PYV A;  2KMU A;  6PAX A;  2VC0 A;  3IKT A;  1HBX G;  1KU9 A;  2Z99 A;  1FZP B;  3FX3 A;  1YI2 I;  2CV1 A;  1IF1 A;  2XB5 A;  3OL4 A;  5D4R A;  2JRT A;  4I76 A;  4FE7 A;  3E6D A;  3JW4 A;  1GUU A;  1W0U A;  3J81 Z;  2ZJP F;  5F0F A;  4OIN F;  2V1X A;  4BQO A;  1TQI A;  1DP3 A;  2HU9 A;  1DGR M;  3HZJ A;  4QSH A;  5GP9 A;  1A6I A;  1GLN A;  3MKL A;  3VEP A;  1AKH B;  3FXL A;  1SVO A;  2CG4 A;  4XKV A;  3HOY J;  4HSR A;  3B6C A;  1LVK A;  2IBD A;  3FXU A;  5D8L B;  1U78 A;  2KIQ A;  2R7R A;  1MJA A;  4TV7 A;  3QPH A;  2V9P A;  4KIS A;  5EZG A;  3P9I A;  4RGS A;  1FT9 A;  2H09 A;  4RB2 C;  5L3E A;  2XRL A;  2Z1D A;  2CWE A;  3LST A;  4XNF A;  4AC0 A;  4CO8 A;  2K85 A;  1XS9 A;  1G3Y A;  1CQT A;  3K4M A;  1U3E M;  3G6E I;  3QPL A;  3TKY A;  1JJ8 C;  3E5Q A;  2X1E A;  2KQR A;  1K7A A;  2HYF A;  5IY5 H;  5E8I A;  1IJW C;  2X6Y A;  1Z6T A;  4L9J A;  1MMN A;  3DTE A;  2ZME C;  2ZFW A;  3ECH A;  1QA6 A;  1HLV A;  3RQI A;  4IO9 F;  3A2K A;  2NRA C;  4G12 A;  1G8X A;  1UG2 A;  2E5Z A;  4GYG A;  2GZW A;  3QOP A;  1R36 A;  3DBL B;  5F27 A;  2G7U A;  2JVH A;  4DYQ A;  2RC4 A;  3TW6 A;  1JUP A;  3F3X A;  2JA5 J;  3WHB A;  1VTN C;  2EA2 A;  5K5R A;  4I7H A;  3COA C;  2K9Q A;  2DYR H;  4R8H A;  3WGG A;  3I71 A;  1WI3 A;  4HDV A;  1O3Q A;  2A69 F;  3DLA A;  5HVQ C;  3DKY A;  4I99 C;  1ETY A;  5FRM A;  2H8W A;  1RC9 A;  2TDX A;  3HSF A;  3FIW A;  2K3P A;  2UXX A;  2M9H A;  3BG6 A;  5HNF A;  4ZZD A;  3OR1 C;  1VQM I;  2DYS H;  3FKJ A;  4KYW A;  2XDV A;  1WVR A;  3QQA A;  4M3E A;  2ZXI A;  5GPA A;  4X1E A;  3V8L A;  4ESF A;  3CF5 F;  1BC8 C;  2H6B A;  3CP2 A;  2IGN A;  4EVI A;  2JVG A;  1QBJ A;  4LK1 F;  2KDZ A;  4ZJZ A;  2IGK A;  4X0G A;  5H20 A;  1UHS A;  2F4M B;  4RAG A;  1KGS A;  2ELJ A;  2MC3 A;  1DGW Y;  4HV6 A;  3H36 A;  1IG7 A;  2HZD A;  3DV8 A;  3S17 J;  1QPM A;  5DUI A;  5E1Z B;  1X1P A;  3FF5 A;  1ZR2 A;  5JVG F;  1ZGA A;  3DWL E;  3CCJ I;  5GTI C;  2JUC A;  2P4W A;  3CCU I;  2BW3 A;  1I1S A;  2QLZ A;  3MZY A;  2UUZ A;  1QZZ A;  3VFZ A;  4DOZ A;  1ZK8 A;  3KEO A;  3W6K B;  4PJN A;  3HHG A;  4AIW A;  1QZE A;  4MTD A;  1K4T A;  5BPD A;  4OAZ A;  4RAF A;  3S6S A;  2OD5 A;  2DQL A;  3QP5 A;  4U7B A;  2L9R A;  4ENK A;  3M4O J;  5TJJ A;  4L0Z B;  3K4K A;  1DQU A;  4L9N A;  2VPR A;  3IH3 A;  1KZH A;  1XTA A;  2LTP A;  2R7Z J;  3LAJ A;  3HG9 A;  4GYI A;  2RRE A;  2L02 A;  1BJZ A;  4BGD A;  2UXN A;  2LBF B;  4PJ0 C;  4IPA A;  2MW8 A;  2MLG A;  3ML6 A;  3HJE A;  4IL6 C;  4P9U A;  2FBI A;  3MVP A;  2H27 A;  3KP3 A;  4CDG A;  2A3S A;  3ABM H;  3GFM A;  1T0F C;  2GIV A;  1OYI A;  3JRG A;  5EEA A;  1FNN A;  1OCZ H;  4B44 A;  2JA8 J;  3LOC A;  2RGV A;  4OAY A;  3ONQ A;  2VIX A;  3V8K A;  3PUF A;  3ZMS A;  4ZH4 F;  2D45 A;  4OIP F;  5ICC A;  2HI3 A;  1GDT A;  1AHD P;  4AVP A;  4LGW A;  3MZH A;  1LVA A;  3HTS B;  3ZMV A;  2KHM A;  2M2E A;  4JX4 A;  1YFH A;  1W5T A;  3LL7 A;  3BG7 A;  4I6Z A;  2VJ5 A;  1B59 A;  3JTH A;  4WWC A;  3L1P A;  3OSG A;  4B8X A;  3F6O A;  1FBS A;  3FHN A;  3A01 A;  3HRS A;  3BG5 A;  2TCT A;  4CCN A;  2DA1 A;  5BQT A;  1GV2 A;  3JRF A;  2FU4 A;  2VOO A;  2AXT C;  2VL8 A;  4ABZ A;  3HYI A;  1PDN C;  3CUQ B;  1VF9 A;  5J1R A;  2GBY A;  2OCC H;  1YRN A;  3MKW B;  5BOX A;  5D8K B;  3JRA A;  1TWC J;  4MO7 A;  4A3I J;  4NC6 A;  1UFM A;  1Z0X A;  4BEH B;  1ITY A;  2E2I J;  2R7T A;  2DMN A;  3VYT B;  4FX4 A;  3HOT A;  4LFU A;  3BPX A;  4GGG A;  3IV5 A;  2H8R A;  2QKL B;  2EWN A;  3W2A A;  5E1W A;  3DPL C;  4P5O A;  4BAC A;  1F1Z A;  1N78 A;  2E35 A;  4ZYH A;  4I98 B;  4A3J J;  1JHH A;  3BR5 A;  3FK7 A;  3S3M A;  3G73 A;  3EDP A;  1XSX A;  5J6X A;  2ZXW H;  4FCY A;  1K4S A;  1YIJ I;  2F4O B;  2WWY A;  2QA4 I;  2ZXH A;  3RPU D;  1ENH A;  4B48 A;  4ZZL A;  3GUD A;  2Y0S A;  2VQL A;  4HNV A;  2PBI A;  1SD4 A;  4NBQ A;  5HDG A;  5E3N A;  2M34 A;  2QEX I;  1D8J A;  3RZD J;  3D1N I;  1X2N A;  3Q0W A;  3JAM K;  4Z2Y A;  3R4K A;  4HPQ A;  3G71 I;  4EQQ A;  2E1C A;  5FFZ A;  4XN3 A;  2PI0 A;  2HWV A;  2X51 A;  4CZZ A;  1H0M A;  1Z7U A;  1ON2 A;  4A0Z A;  1XD7 A;  3FMQ A;  3K1P A;  3CCY A;  4WXD A;  3RDI A;  5M5W J;  2X6W A;  2P5V A;  2H94 A;  4Y3O A;  2BVM A;  3V42 A;  1FX7 A;  3E0J B;  2A05 A;  4EM1 A;  2CV2 A;  4HQE A;  3M07 A;  3KP7 A;  5D5X B;  1Z6R A;  1RR8 C;  4ETS A;  3V4G A;  2XAQ A;  5D4S A;  1ZEL A;  5JHU A;  3WTW C;  2OTJ I;  2VE9 A;  5GAE J;  5B66 C;  3V8J A;  1DPR A;  1W5S A;  2LF8 A;  2PX9 A;  4WK8 F;  2VQH A;  1E0E A;  3CTA A;  3RIR A;  1ZRD A;  4C3J J;  5D5W B;  3FWE A;  4MQV A;  4W97 A;  5M3M J;  3FXR A;  1W1W E;  4HDU A;  1MKM A;  2JK3 A;  3T1B A;  2BYV E;  3OWT A;  2CGP A;  2D1V A;  1YQA A;  3K2A A;  1X1C A;  2V1D A;  3GCM A;  4PFP A;  3W3C A;  4A6D A;  5DS9 A;  2LVS A;  4CYC B;  1WH7 A;  3MCZ A;  5K7Z A;  1JKO C;  1UJ8 A;  3EUH C;  4UV8 A;  4I0B A;  1U5T C;  4F91 B;  2VBY A;  3M8J A;  4BY1 J;  1MSE C;  1YS6 A;  2OA4 A;  2L9V A;  4LD5 A;  3KIO A;  2VKV A;  2V6C A;  2QBY A;  3DPT A;  1Z9C A;  4CCM A;  2CO5 A;  2NS8 A;  3O8H A;  1HST A;  3GTM J;  1I5Z A;  1HKS A;  3KZY A;  4XKC A;  3PSF A;  4XLA A;  3ZR8 X;  4B3X A;  1DU0 A;  3OYE A;  4XRS G;  3L2W A;  1X19 A;  1QU3 A;  4CSW A;  3F8B A;  4F7Z A;  3ZQI A;  1Z77 A;  2QEN A;  1U2W A;  1WJF A;  1MW7 A;  4ON0 A;  2O03 A;  3DKX A;  4PDK A;  1WQ2 A;  3PNY A;  5K7F A;  1K78 B;  3KP5 A;  1XSD A;  4C2U A;  2V1N A;  3HOZ J;  1SAN A;  2Z5U A;  1MND A;  2A5W A;  3H5N A;  2XRO A;  3S2W A;  2DFH A;  3FXQ A;  3T8R A;  3F23 A;  3IUO A;  4BQA A;  2HXI A;  3ZCO A;  5EG0 A;  2RNG A;  2LMD A;  2XF7 A;  3J7A O;  1W7P A;  1D5V A;  2VT2 A;  1FOY A;  4FIS A;  4OMZ A;  2X0L A;  3S1N J;  3J7Z I;  4XLE A;  1G4D A;  2JA7 J;  4RB3 C;  3LA7 A;  2K02 A;  1VQP I;  2FBK A;  1R1T A;  4D0P A;  3CD6 I;  4OIR F;  3I0T A;  4HNT A;  3CQZ J;  3I55 I;  4XQF A;  2EH3 A;  4N4N B;  2GAU A;  1WCM J;  3U2R A;  4L9T A;  4YFX F;  1HKQ A;  2DOE A;  2VJI A;  3IAS 2;  2H6C A;  1BIB A;  2XAG A;  3BZ6 A;  3OYI A;  2MLK A;  3GTG J;  5CVJ A;  1TW2 A;  4PFO A;  4J01 A;  2EIN H;  2K27 A;  2MD5 A;  4BE2 A;  2Y48 A;  4YFK F;  3F21 A;  1JI8 A;  2EB7 A;  2G9W A;  3JSP A;  3TDZ C;  1RES A;  2J5P A;  4HX4 A;  4MNU A;  3S15 J;  1FC3 A;  2Q8K A;  3KYC B;  5E17 F;  4A3C J;  2YS9 A;  4UUS A;  2KJB A;  4YG2 F;  5DD4 A;  4HYE A;  1DU6 A;  2CUZ A;  2QSH X;  1K6O A;  3K4J A;  2IRF G;  4KIG A;  2HTJ A;  3C1D A;  2QQ8 A;  4RAZ A;  2ADU A;  3CES A;  2GWR A;  3U1K A;  3TO9 A;  3IHU A;  3G1O A;  4DNC A;  5L3C A;  1IRF A;  3Q9V A;  4ENN A;  2RQP A;  5HLG A;  5F1R A;  5HLI A;  2PQ8 A;  1D5Y A;  1B6A A;  3OYF A;  1BC7 C;  2D1H A;  3K10 A;  3MKZ A;  3K4C A;  4M74 A;  4HRI A;  5E3L A;  1J09 A;  5DCM A;  5EZH A;  2ZME B;  2LR8 A;  3OIO A;  3CC4 I;  3BZC A;  4KUM A;  2IT0 A;  3VOD A;  3RYP A;  5CQG A;  3CCQ I;  2ETH A;  2BV6 A;  5TGT A;  4D5C A;  1V3F A;  2WY7 Q;  3D5L A;  1LNW A;  1ORK A;  1RUN A;  4ZYE A;  2KP6 A;  2N8G A;  2HEO A;  4QIW N;  4PUS A;  4BXU A;  2VT3 A;  2Y69 H;  3GZN B;  1LDJ A;  3OYC A;  2DBB A;  2BY0 A;  4S04 A;  4CUG A;  4V19 K;  1G3S A;  4UVB A;  2PMH A;  3VDX A;  5CYV A;  3CCE I;  2IXS A;  1AOY A;  2V9K A;  4F55 A;  1G3W A;  1X3W B;  2YU9 J;  1ETK A;  2MSY A;  1K79 A;  3LFU A;  1TT0 A;  3J80 K;  3KX2 A;  1VQ8 I;  2DJN A;  4PK4 A;  4I0A A;  3OYK A;  2ZCW A;  1IN5 A;  1B72 A;  1KQ8 A;  3S2H J;  1K6Y A;  2XGX A;  3FM3 A;  1IUY A;  2A5Y B;  3M8F A;  4NC8 A;  2RDP A;  5C3E J;  3GTJ J;  1SD5 A;  4YEL A;  2K9N A;  2LNB A;  3ABT A;  1FP2 A;  4RA2 A;  5C44 J;  3LSH A;  4XOT A;  3AKZ A;  3GFI A;  3S3N A;  1SMB A;  3OS1 A;  3S32 A;  3NWT A;  3V7R A;  2EFQ A;  4BYY A;  3HOW J;  1I27 A;  4R1H A;  2ZSH B;  1QPI A;  2DK8 A;  3ZQH A;  4IHY A;  1RPW A;  5K7H A;  4CHU A;  5CKT A;  3BRO A;  5HOD A;  2KFD A;  2EJR A;  4FX0 A;  2Z16 A;  4C3H J;  1IN4 A;  3V7C A;  2IA2 A;  4XLF A;  3IRQ A;  3CCR I;  4EM0 B;  1E3O C;  5FLV A;  1ETX A;  1ZKG A;  4NUK A;  1PUF A;  5ILU A;  3QP6 A; 
#chains in the Genus database with same CATH homology
 1XX5 A;  4TPV A;  3S6U A;  2GIZ A;  1WVR A;  2A05 A;  1SMB A;  1U53 A;  3NT8 A;  3U3L C;  3Q2R A;  4NUI A;  4NUO A;  3U3N C;  2DDB A;  4LY5 A;  4AIW A;  3Q2U A;  4G2U A;  3S6S A;  5JYS A;  4D53 A;  2VZN A;  2EPF A;  4NUN A;  1CFE A;  3MZ8 A;  4NUK A;  5ETE A;  3U3U C;  4IFA A;  1RC9 A;  2CQ7 A;  4H0A A;  1XTA A;  4P27 A;  3S6V A;  2DDA A;  1QNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...