1RC9A

Crystal structure of stecrisp, a member of crisp family from trimeresurus stejnegeri refined at 1.6 angstroms resolution: structual relationship of the two domains
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
221
structure length
221
Chain Sequence
b'NVDFDSESPRKPEIQNEIVDLHNSLRRSVNPTASNMLRMEWYPEAADNAERWAYRCIESHSSYESRVIEGIKCGENIYMSPYPMKWTDIIHAWHDEYKDFKYGVGADPPNAVTGHYTQIVWYKSYRIGCAAAYCPSSPYSYFFVCQYCPAGNFIGKTATPYTSGTPCGDCPSDCDNGLCTNPCTRENKFTNCNTMVQQSSCQDNYMKTNCPASCFCQNKII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cysteine-rich secretory protein
publication title Crystal structure of cysteine-rich secretory protein stecrisp reveals the cysteine-rich domain has a K+-channel inhibitor-like fold.
pubmed doi rcsb
molecule tags Toxin
total genus 70
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 1rc9A02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 1rc9A01
3S6SA 3S6UA 2DDBA 2A05A 1QNXA 2DDAA 1XX5A 3Q2UA 4P27A 1XTAA 2GIZA 4NUNA 1SMBA 3U3NC 4IFAA 2EPFA 3NT8A 3S6VA 4H0AA 1CFEA 2CQ7A 5ETEA 1U53A 4G2UA 4TPVA 3Q2RA 4D53A 4AIWA 2VZNA 4NUOA 3MZ8A 3U3LC 1RC9A 3U3UC 1WVRA 5JYSA 4NUIA 4NUKA 4LY5A
chains in the Genus database with same CATH superfamily
4BE1A 5E3OA 4XQFA 4M6XA 1JTXA 3UR3C 1UAAA 4IKFA 2ZXIA 1X3ZB 2R5ZB 3HOZJ 3I4NJ 1WJAA 2KMUA 5B1AH 3KEOA 4KICA 4B48A 2CV1A 2MLKA 4LMYA 3B6AA 1Z05A 4UVCA 1P7JA 3LSTA 3T8TA 3QYBA 3HSRA 5JLWA 2O7OA 3DXJF 2W24A 3T1BA 2VL8A 3MD2A 4XN3A 1KA8A 2F5EA 3RCOA 1X58A 1GV2A 2K02A 3CCMI 2HDDA 3MWMA 1MNDA 1QNXA 3CD6I 3GUDA 4RB3C 2ECBA 4QWQA 3ABMH 4M72A 3CUQA 5D8LB 1FTTA 3JRHA 5EJCA 1U9OA 5ICCA 3H9GA 1ZG5A 4QPQA 4BDZA 2LVSA 2XUBA 2JRTA 1MH4A 4BHCA 1B1BA 5LHGA 3GXOA 2ELKA 4KT5C 4QSHA 2WAQN 5M5XJ 4PJMA 3H9JA 2F6CA 5ED4A 4AUXA 3BG9A 2VT3A 3PM1A 1QHGA 3OMYA 1WH7A 2ZO4A 3CZ6A 4L9JA 1GXQA 4F92B 2VODA 2X9DA 2ECCA 1LVKA 1SVMA 2V26A 2X6YA 5DV5A 3KPHA 1KU3A 2W57A 2WTEA 3ZCOA 5BQTA 2GXBA 3H36A 4N9HA 4Q48A 4G9YA 4KN7X 2E36A 1QBJA 1ZGWA 5IOYA 3DQVC 4P9FA 4EMSA 3KEQA 2QYOA 2XVCA 2VKEA 4MQVA 2CH0A 2FJ1A 4D7MA 5HDGA 3W6VA 3MAJA 1SFXA 2OBPA 3W2WA 4AD9A 5L3CA 2VASA 1WFXA 5E18F 3SDBA 4MO7A 4IOCF 1Y0UA 1TT5B 2ZKZA 1JT6A 2L3DA 3KP2A 1K7AA 1BW5A 2EFNA 1OCOH 5C44J 3RPUA 3CJRB 2NNYA 1MSFC 1IN8A 2JA2A 3R0AA 2OJED 4OIRF 2OCEA 1ZAOA 2BGCA 2JPBA 3TBIA 3ABTA 2P7VB 3IRQA 3K4JA 4RM3A 3SHFA 4M3EA 1SAXA 2DK8A 3CUQB 2DT5A 4FX0A 3K4CA 3Q0UA 4BJTA 1OR7C 3K1NA 4MNUA 1LQ1A 1IG7A 1YJNI 4OMYA 4DYQA 5LRRA 1JUMA 3HRMA 3F0CA 2EIJH 3SZTA 2OV7A 2QF7A 1UG2A 1EV7A 3I54A 3OYGA 2XROA 1HBXG 3W2VA 2LKPA 2IBDA 2HS5A 2W4SA 1RR8C 4PZJA 3ELKA 1TT0A 4QPOA 4ZTJA 1WPKA 4HYEA 3KP5A 4M6VA 2RNGA 3PQKA 3GO5A 4CYCA 4C30A 2BW3B 2P81A 1KYWA 2BXYA 2E5ZA 3B6CA 2LSOA 2HR3A 4U87A 5C3EJ 2O5RA 1XPXA 3TP0A 1R22A 4B8XA 2GZWA 3ECOA 3J7YJ 1CF7A 1LNWA 1Q1HA 1XC5A 1A36A 1ZRDA 3VSKA 3I59B 1X3WB 1P92A 4HV6A 1T0FA 3K4MA 4XLCA 2B63J 5HODA 3IWFA 1MBEA 5LHIA 2KT0A 2QLZA 1SEUA 4DBQA 1SANA 2R5YB 5IY5H 3F8FA 4ON0A 2LR8A 3FXKA 4HSRA 4YG2F 2DPDA 5L3DA 3WTWC 1TW3A 2HKOA 5GAGJ 3U3LC 2WBMA 1UMQA 4FE4A 3GBGA 1IXCA 4BXFA 2OZUA 1X1AA 2NS7A 1VQ5I 3IHUA 1G4DA 2NVUB 1BJAA 4JQFA 3IH4A 2QSHX 1JTYA 4CICA 1IUYA 4BBSJ 2DA1A 1R9TJ 1Y1VJ 4R1HA 1ZLJA 2E1MC 2V1NA 3KP4A 1VQMI 4D5CA 5ILSA 1TQMA 4LIUA 4EJOA 1I6XA 1UFMA 4FHTA 5E1WA 4ZTFA 1D0ZA 1K6YA 2O03A 2DFIA 3TL4X 3E5XA 2IPQX 1ULYA 3E6BA 1WWXA 4L9TA 4A3EJ 1LDKB 4XORA 2GLOA 1DGWY 3LFUA 1PUEE 4HA8A 4CSWA 2X1EA 2VBZA 2TDXA 5IT9Z 3GCMA 3VFZA 4KITB 4RA2A 1U8RA 1R1TA 5EZHA 2HQNA 2PQ8A 2F5VA 3WTSC 4UNOA 4RMNA 4KMFA 2VBXA 2ID3A 4HF2A 5AONA 2H1LA 1D0XA 1ZR2A 1O3TA 3S17J 1ETVA 5IP9J 1SC7A 1LDJA 1T8IA 2ISYA 3O2PE 4B47A 4XRFA 1FY7A 2XSDC 3TW7A 1NTCA 1O7LA 3U1DA 1FP2A 2EWNA 5KAFC 4AYBA 2H94A 4Y17A 1WVRA 2L9RA 3A03A 3GFIA 4G7OF 2J5OA 3IC7A 4TV7A 4IHYA 5IOZA 3KE2A 2DT7B 1HDPA 1R4NB 1MIJA 1HW5A 2EFOA 1PUFB 4Q47A 5F6FA 2A6TA 5L3EA 3WTTC 1FBUA 2EA4A 3OSGA 3BROA 2LYCA 4LK0F 3J7AY 3S2HJ 1QU3A 3OIOA 3OWTA 2F4MB 1TWHJ 2K3FA 4I7HA 2X4HA 3QOPA 5HS7A 4BBRJ 2ZSIB 4A3FJ 4KNYA 1FZPB 2Q0OA 1OYYA 5GAEJ 1XGOA 2LKSA 4J19A 4E6KG 2CW0F 3H1CA 1PDNC 2A61A 3WG7H 1RR7A 3QU3A 3HOXJ 3SJMA 2LDUA 4CZZA 3GTJJ 4ESFA 2EV5A 4GYIA 3CO6C 2ICWG 2KP6A 2LMDA 5CVRA 4L9VA 3E0JB 3HL2A 2MA3A 2FE3A 3F9KA 3CQZJ 2ETHA 4XSZF 1SFUA 1QNTA 3U2RA 2KL4A 4F55A 2UV1A 2I5UA 1JHFA 1Z1DA 2R92J 3GTKJ 5L3BA 3BTCA 4ITVA 3BR3A 2I10A 2XPUA 1U5TA 1HF0A 1UCRA 4A3LJ 2RDPA 3H3VK 4YELA 5J1UA 4M73A 4HW0A 3V7RA 3LNQA 2IVMA 1KQ9A 3DPTA 1ZYRF 5H6RA 2HTSA 4CXFA 4RS8A 4EGYA 5F1JA 2CQKA 3BLYA 1IZ1A 5GAHJ 2X85A 4NUKA 4UB6C 3FM3A 2A6EF 4PSXA 2A05A 4NNJA 3A01B 2Y0MA 4ESBA 4BGDA 2PI0A 3S2DJ 1JUSA 3Q0VA 1IXRC 3DTIA 2JPCA 1VTNC 4FASD 1VQ6I 1XCBA 3U3NC 2DXIA 3WU0A 2R7ZJ 4EM0B 3RKYA 1GLNA 2VPRA 3RDIA 4E7LA 4IQJA 1CGPA 2R7TA 3ZQCA 1MMDA 4Y4RA 3V8LA 2KDZA 1MD0A 1ZRFA 3I55I 4AYBN 2VUMJ 3BG5A 5FFXA 2BVLA 5JLXA 3FHZA 4HRIA 1FLIA 5DTDA 4GXOA 4IF4A 3S32A 1VQNI 2ZFUA 1XX5A 5ICGA 3DBLB 5FKKA 4O3MA 2WY8Q 2PX9A 2OQGA 3LFKA 2ESHA 3V8JA 1WSUA 3S1NJ 1OJLA 4IHXA 4I2OA 4WF2A 3WGGA 5J3LA 3G1LA 4CCLA 2DAOA 2UXXA 2V1UA 3K70D 2VJ5A 3MVPA 1IW7F 1U5TB 3OR1C 3OY9A 1TNTA 3WTVC 2ZJPF 2MD5A 2BHZA 3O6BB 1F1ZA 3HB9A 3SFZA 3QODA 1JI8A 1H88C 3RZDJ 2CJJA 1HQCA 4B3XA 2UZKA 5LGNA 1FX7A 3L9FA 4FISA 3KYDB 1IN4A 1FYMA 1EH6A 3QYFA 1HOMA 3CMYA 2J5PA 2GIVA 4M6YA 3BR5A 5D6EA 3HTSB 4NBQA 5EDNA 3JAMZ 3GTQJ 2K4BA 2NS8A 1R4MB 1TBXA 1B8IA 4XK4A 5FLXK 5EYRA 3J81K 4ZC3A 4IO9F 4LB5A 5LLQA 4L0ZB 3BTIA 1BI0A 3FDYA 3BC8A 1A5JA 3ZN0A 4MQ9F 1BI2A 1YRNA 1H9GA 1QZZA 3VDXA 3D1NI 3HGGA 1QRYA 3DEWA 3FBIB 4Y52J 3CC7I 4XN0A 5F64A 5J1YA 3WGHA 4BEHB 1GXPA 4A3DJ 2DMQA 1YO5C 3P9CA 2DTZA 4E7HA 3QPTA 3QRFF 5BS6A 1ZG1A 3NQOA 1LB2A 3GTPJ 4HOBA 1U53A 2PMZN 4P96A 4HQMA 4UUSA 1Z9CA 1WHUA 3DKYA 3OIPA 1WI9A 1FOKA 2M8GX 2P6SA 1W5TA 1ZG3A 2HNHA 2R7WA 1ZQ3P 3HRUA 2JA6J 3ZMDA 2M5WA 1T33A 2STTA 3PIOF 1R1VA 2L4AA 3BT9A 4IRHA 5CVUA 3FK7A 3S3OA 3BPXA 5DD4A 3GFJA 1XTAA 4HLYA 1NH3A 1RESA 5DUIA 3HRSA 2K4JA 3CUQC 4LITA 4FT8A 4PGGA 2CRGA 4L5JA 4OAYA 3FWEA 2K5CA 2BBYA 1X2NA 3E3VA 3V42A 4HF0A 4BQNA 3H92A 4PUSA 3AG3H 2QM3A 2EIMH 2E7XA 4JX4A 2QQ9A 2M4GA 5D6FA 2VJIA 3D5LA 1ZR4A 2IAIA 3F22A 2PJPA 3CMAI 2K7LA 2EJRA 3ECHA 4XLPF 2QUFA 3D5SC 1SD6A 2Z2SB 4I01A 3OYEA 3ZMZA 2JA5J 5K7FA 1V4RA 4Y33A 2NS0A 3P9KA 3KZYA 2DMTA 1IN5A 2JSCA 2G9WA 4WXCA 1XDUA 4XR6A 4DBRA 2IS1A 4ZJZA 2HYFA 1POGA 5HOOA 1TTYA 1RIOH 4LK1F 1U6GA 4RGXA 3HOSA 3TW6A 1H89C 1R36A 2HZDA 4GDFA 1W7PA 2FEZA 3TMOA 2X1DA 3GMEA 3ZR8X 1S29A 2ZMEB 4BKXA 1XD7A 1IN7A 1DDNA 4C3HJ 3KCCA 5FLVA 2JTVA 2IRFG 3GWZA 4BJ5C 1MBKA 4UUSB 4ZYEA 4PJLA 2CYYA 2Y30A 1ZTRA 1ODDA 1QPIA 4XKWA 4G6TB 5HLTA 2YSRA 1U9NA 5DCFA 3UNGC 5BPDA 4ZYAA 2LC2A 1RRJA 3CCJI 5HLIA 1X2MA 1YW9A 3WTYC 2JMWA 2DPUA 2M7BA 5KK1A 1D3YA 4ZH4F 3ERED 1R5ID 2FOWA 2XGXA 2MFZA 3S93A 2STWA 2F5FA 3BG7A 3LA7A 4HG2A 4IRIA 3I4PA 1W4MA 3QPLA 3JRIA 3M7GA 4MEYF 3LMMA 4RAGA 3ROUA 1NHAA 3F6OA 4BY7J 3G1MA 1TW2A 2IA2A 1R5HA 4A0YA 3JSPA 1L0OC 2EH3A 4EQQA 1O3RA 1W0UA 1UHSA 2XIGA 3LA3A 1FNNA 4EM2A 5FLXZ 2HQRA 1VQPI 5EEHA 3DLLF 3I71A 5CKTA 5DM7F 3BJ6A 3KYCB 2YPRA 5IYBJ 1JGSA 5E3NA 1I1GA 5BNGA 4L5EA 2D45A 3HIFA 3BCAA 2DK5A 3ZP5A 2VC0A 1BW6A 3DTEA 2R5ZA 5J8CA 2V1XA 5LEKA 4A3JJ 4AVZA 2V9PA 1QVTA 3DFGA 4DJAA 4XNFA 2LTPA 2X0LA 2BY0A 3F8CA 4ETSA 1EA3A 2WAFA 2K9NA 2XGEA 3RQIA 2JRMA 4CCOA 2PFBA 4AIJA 3OL4A 4YIRX 2QWWA 3N05A 4KT6A 5BOXA 1ZGAA 3AG2H 1GUUA 2EILH 2FRHA 3S8PA 3IUOA 4CCKA 2KIUA 2IGKA 2HXOA 4XIDA 1H9TA 3CC2I 2P5VA 5M3MJ 4EJUA 1E3PA 4OIOF 4KMUX 4M71A 5EEAA 1TNSA 2JN6A 4KIFA 3IAM2 2CUFA 3ZMVA 4PFPA 2XDVA 3HPGA 1TL8A 2UXNA 4ZDOA 2QKLB 1V5GA 2MW8A 3MN2A 4RGUA 2BYVE 1XG1A 4EJTA 1W0TA 1TWAJ 2R7DA 4IZZA 2EPFA 1IO2A 2A6HF 3RYPA 4JK1X 3ULQB 3GZNB 2EFPA 2N8GA 1YQAA 3BQYA 4WX9A 3I4MJ 1VQ9I 2XB0X 3BZKA 3K7AJ 2K3PA 2RAEA 5TISC 4UV8A 4IHTA 3CCQI 4RDUA 2V7FA 3W6KB 3JTGA 1T95A 2WY7Q 2PBIA 4J00A 2LF7A 2MH2A 1SD5A 4XMYA 2HPMA 3FKJA 5F1RA 2EB7A 2AXTC 2FOKA 1EH8A 2MC3A 1J59A 2YS9A 4B44A 1LE8B 2O0YA 3KZIC 2DMPA 4MHGA 3GTLJ 1C0WA 1HDDC 3LSHA 4I09A 3SEZA 2GAUA 3TOBA 1BM9A 3CCYA 4ENJA 2CFXA 1F5TA 3A0HC 3ABLH 4PJNA 4CCNA 5D5VB 2VLAA 1EKEA 4RGRA 3ZQIA 2XAJA 1HW1A 2DU9A 1MNEA 3K2ZA 1WJDA 1R49A 1FEXA 3CLOA 1Y8QB 1ETOA 1ZGJA 5J1RA 1SMYF 4EEFG 2M45A 3H9QA 4DZPA 5J8FA 1S7OA 2E34A 2H8WA 4K2EA 2GBYA 1SFKA 4XRMA 1WJBA 1LFBA 4S05A 1UB9A 1TC3C 4XICA 4LGWA 3S1QJ 4A5MA 1EH7A 1BC7C 4G2UA 2A5YB 4L5IA 1U8BA 5E20A 1IRXA 3ZQGA 2HOAA 3MZ8A 3IL2A 3WGIA 2I8DA 4AU7A 3TEDA 4A6DA 1HCRA 3KP3A 2VKHA 3BG6A 4Q4ZF 2PLYA 1YOVB 2IJLA 2F5CA 1J09A 3ZQQA 3RPQA 3LOCA 5E8IA 3KLNA 2BW3A 3LQQA 3KFWX 4NUNA 3HOTA 4XLFA 4U7DA 1Z6TA 5B66C 2WADA 5IT9K 5CJ9A 2XC7A 3VEPA 4D0PA 4HDVA 2BVMA 3I59A 1JT0A 2HVRA 5GP9A 1MSEC 2P7CB 2DA3A 2L5QA 2QCOA 2CUZA 3P9IA 2Z1DA 1XGMA 2R5YA 2XPVA 1FJLA 4CGZA 1HSJA 3L2CA 2LY2A 3QYEA 1XN7A 5M5WJ 1TZLA 5EZGA 2DBBA 3EDPA 4XKBA 4BY1J 1T56A 5JFRA 1G2HA 1G3TA 1KQ0A 1VQ7I 4QTRA 3FXQA 2JWTA 1U5TC 2FNAA 2LLKA 2HYJA 1G59A 2DT6A 2E2JJ 4HX8A 2O61A 4IOAF 1B9MA 2FSWA 3ZMUA 4F7ZA 2QBYB 2NOJB 3OS1A 2M87A 1GHCA 5GTIC 3LSRA 3BG3A 1MMAA 2FXAA 3CDHA 4LLLA 3F3XA 1YHQI 1S72I 2JJ7A 4YEJA 3HOWJ 2DYSH 2EFWA 2W82A 1ZREA 2Z9OA 5GADJ 1U0JA 3QP5A 4I6ZA 1YX3A 1TQIA 5F0HA 4DYCA 4A93J 3CCSI 5GPAA 1WJEA 3KP6A 4E7JA 1IDZA 3TO6A 3H35A 3PO2J 2KRFA 1S6LA 5HNHA 1ERDA 2ZXJA 1R71A 1IRZA 1UJ8A 2PMUA 2RQQA 4WCGA 5JVGF 1MZBA 1WH5A 1ZK8A 3B73A 3HBLA 3ESWB 1PJRA 5EF6A 1J2XA 2QKMB 1YIJI 2QENA 3DKXA 1FMWA 1IV8A 4YRVA 1P4WA 2DOFA 2HZTA 2IA1A 3NAUA 2HDCA 2HXIA 1JHHA 2ZBKA 1F36A 2DFHA 3EUAA 2ZXHA 2JUCA 4C2TA 4HX7A 1PUFA 2DQLA 3HRTA 1FTZA 3DU5A 5CPRB 3GTMJ 2KIFA 3EUHC 2ISZA 4ZYHA 2RREA 3FXJA 2FQ4A 1OCPA 1LDDA 4MFDA 2VBYA 2WB1A 1WJ5A 3JRCA 4U0WA 2IS2A 3EYIA 4A69C 1MMGA 4Z2YA 2EZIA 4BYYA 1SFOJ 3BCBA 3CF2A 5J6XA 5FRNA 3ZOBA 1EJ9A 1OQYA 1SD7A 2JSPA 3BR6A 5E1XA 1IGNA 4M9SA 3EQLF 3ZMTA 5JHUA 1N25A 2E1NA 2XAQA 2GIZA 1KONA 1IAWA 2XV4S 3J80K 1Y6IA 3OS2A 2X51A 4ZZLA 2QGUA 1WZ2A 2ZMEC 3GX4X 3TDZC 1MJBA 3RKWA 1W36D 1AKHB 3S3MA 1OCRH 2KRHA 1YW7A 5FD6A 1IF1A 1WCMJ 3K6GA 2V6EA 1MBHA 1FOWA 1REPC 5JR3A 1AOYA 4JP0A 2LBFB 1VQ8I 3CDLA 5BMZA 2KHMA 4RB0A 4OOIA 3Q9SA 4C2UA 2VQCA 2CU7A 2M1BA 3TO9A 1QZYA 1OYWA 1D1BA 1WKMA 3IWZA 4LD5A 3I58A 4A5NA 3CJTB 3PO3J 3ZRGA 3J7AO 4X1EA 3C7JA 2O8KA 3OR2C 3LSKA 2RNJA 2Y75A 1VQKI 4LG0B 5LHHA 3A01A 3S14J 3HUGB 1K6OA 2B0LA 3U3UC 3CESA 1K78A 2V1DA 3E5UA 1WI3A 3IP4B 1DP7P 3G6EI 1I1SA 5K5QA 1W5CC 3JAMK 3QOEA 2VC1A 1S8NA 1Y39A 2GM4A 2JQ7A 4OWRB 2HOTA 2ZXWH 3BTJA 3CMEI 3CCLI 4I76A 2NAZA 2CS3A 5AIPA 4BH9A 2Q2EA 3F8NA 1O3SA 1MDMB 4ANJA 2KPMA 3DEEA 2ESNA 2DJIA 4UB8C 1YLFA 5IP6A 4S0HB 1YS7A 2VIXA 3O8GA 4D53A 2K9QA 3J7ZI 3WTZA 2DDBA 3SZPA 2OPTA 1GV5A 1W5SA 4MTEA 1OLTA 3CP2A 4B09A 2R0QC 3L2QA 4AC0A 1OCCH 3FXLA 5HDNA 3M4OJ 1HXDA 2VQGA 1FIPA 3DU6A 3R60A 2WB1N 4A0ZA 2YU3A 2TCTA 3TDUC 3T0YA 3GF2A 2HWVA 5ILUA 5GPCA 5J40A 1E17A 4BNCA 1R00A 2VQHA 1KYZA 3QWLA 3WHBA 1ETYA 4BJ6C 4M9ZA 1GT0C 2GOXB 4BE0A 1T6SA 5CVVA 1QPMA 1RKWA 3PL8A 2HDWA 2XKOA 4M3DA 3HZJA 3L7WA 4OAZA 2XRLA 2K86A 3BQZA 5J4VA 1XDSA 2BY2A 1HW2A 2H6CA 2K9MA 3WG9A 1K78B 5DEQA 1O4XA 2OTJI 4H0AA 1P4AA 3M1EA 5FROA 1XCVA 4XLNF 1H8AC 3BOQA 4D7NA 2MG4A 5D5UB 1ZRCA 2WV1A 1FMVA 4EV0A 1L3LA 4BEHA 2OZ6A 3DPUA 1LVAA 1HC8A 2Q2EB 3J80Z 2Q1ZB 1SAUA 1RKTA 5FD5A 3MEXA 1N77A 2DFEA 1S5LC 1HKQA 2OCCH 4DGWB 3IKTA 2CMPA 4WXDA 2IT0A 4YFNF 2ELHA 2LD5A 3F6VA 2AS5F 3BR0A 2FUG2 1TP4A 1IN6A 2COMA 2JA7J 3A2KA 3G2BA 4BUPA 2H1KA 2W1OA 4XKVA 2F48A 1JJ8C 4G6DA 2IS4A 3K70C 5C4JJ 2VB6A 3EUHA 4BS9A 1G3YA 2B9SA 3M07A 2L02A 1F4KA 3NRVA 1X3UA 4P9UA 3HSFA 2NVYJ 1PP8F 5FLMJ 5FFZA 3E6MA 3X2QH 2NVTJ 2EQRA 3ABKH 4EGZA 1HKTA 3I3LA 2XPWA 3I64A 3GZ6A 3BDDA 1B59A 3SQNA 5JVTA 4ZDPA 4XL9A 3HEFA 4GGGA 3PFIA 5B3SH 1VQLI 4NQWB 3BPVA 3OYFA 1LEBA 4ZDLA 2Z33A 1BR2A 3DCFA 3FKIJ 1MNMC 2QQAA 2M4KA 3SZGA 1Z6RA 1NK3P 2HGCA 1IRFA 2G0EA 2W85A 4E4HA 1J0RA 4KYWA 3CDIA 4X0GA 2PEXA 2ZMEA 3IAS2 2VXZA 2OA4A 3JREA 3RKQA 2DMUA 4JYKA 4PSWA 4CUGA 2R3SA 3G1OA 4CHUA 2KKOA 1I50J 2VZNA 2GXAA 2E19A 1B9NA 2Y31A 3FZVA 4WXHA 4HLXA 4BXUA 4KISA 5ICEA 3G71I 1XMAA 4CCMA 4DOZA 3GTGJ 2P5LC 2O6GE 1QO0D 2MSYA 1STZA 2MBFA 1WRJA 5LGTA 4ENKA 2VI6A 1A6QA 1X1DA 2ADUA 4AIKA 2EINH 3K2AA 1D8JA 3E5QA 3CJQB 1AA7A 1FYKA 2QA4I 1B4AA 1ZELA 2CQ7A 4D1QA 4Y15A 4XLAA 1OPCA 2KIMA 4HV5A 2OUMA 2UWMA 2R7RA 4V2FA 1A6IA 1X1BA 3QQAA 2ID6A 2H09A 1YX5A 2L4MA 1BI1A 3OYMA 2GA1A 3K4LA 2DOEA 1JXSA 1LFPA 1X1PA 3M8FA 1G8XA 2DMNA 2VT2A 4KUMA 4G12A 1KGSA 3AFHA 1ETXA 1FBSA 3VPRA 4A3CJ 4IFAA 5CLSA 2JVHA 5D8KB 4PCQA 4M3FA 2D1HA 1BIAA 3DBHB 2LOOA 3LQRA 3OYLA 3M8EA 2E1MB 1RUOA 2CV2A 2BEOA 4CCJA 4G7HF 4ENNA 4XBFA 3ASOH 4H4KC 3F21A 1HLVA 2EZKA 3GYHX 1MBFA 1YYVA 3K4BA 3M8JA 3I0TA 5DM6F 4FTHA 4BHPA 1FYLA 5LGUA 2BZTA 3FXOA 5HDKA 1K61A 1BBYA 2PJRB 3PNTA 3TO7A 4LFUA 4FQGA 2CUEA 1Y0NA 2CSOA 2VKDA 3EPZA 1JKQC 5FKLA 1N78A 4UUTA 1S9HA 1Z0XA 2EFQA 3NWSA 4J01A 2X6WA 5K7ZA 5K1YA 2L7KA 5HNFA 4D5FA 5LFAA 4LIVA 3A1YA 3MMYB 1A35A 4F3QA 4KN4X 3CCEI 3ZQFA 1APLC 1AWCA 4LB6B 1JKRC 1S7EA 1VF9A 5E8GA 1LPQA 2VONA 2XAUA 2Z5UA 3FHNA 4DNCA 2JUGA 3PSFA 1X4OA 1LJ9A 3R0JA 1TWFJ 4IRGA 3NT8A 2HKXA 1R1UA 2WA0A 1UHWA 3GLXA 4N0BA 4A2UA 4YFKF 3CO7C 3H3UA 1MJAA 4HX4A 1ACIA 2IGNA 2W25A 2ZSHB 2X1CA 4KIBA 1R6RA 2KJBA 4JOMA 4E7ZA 3IKVA 3UKGA 3OL3A 3S3NA 3GTOJ 2H27A 2L7MP 3HC7A 2VQLA 2C6YA 4MLOA 3E6CC 5M3FJ 2LK2A 5DUKA 1LEAA 2OD5A 1BI3A 1LE8A 4AWXB 4PFOA 5H20A 2M30A 5K5OA 4M3BA 2CFOA 4A6EA 5FJ8J 1DU6A 2DA2A 1Z7LA 3TP3A 1DQUA 3HOUJ 3ZQ7A 1Z77A 3JR9A 5DCMB 4LJZF 5HS8A 2EZHA 1USTA 1QHHD 2BHYA 1ENHA 3BTLA 3FISA 4NDLA 3OYIA 1JE8A 2F2EA 3FIWA 2XGDA 3JSOA 3S1RJ 4LY5A 3HOYJ 1E3HA 2P0WA 3FXMA 3O3KA 3LL7A 2RGVA 1G3SA 1RETA 2DOAA 4DW6A 3MKLA 1BIBA 3KZZA 4CO8A 2R7SA 3HHGA 4IL6C 4N9IA 2KJCA 5TRDA 3ZN1A 3K1PA 3HGYA 1AU7A 3VSLA 5M5YJ 3GLLA 2OTLI 1G6NA 2DTRA 3EUKL 3LWFA 3RYRA 4U0YA 4UHTA 2XKPA 1QVUA 4CZCA 5J47A 5KVRA 1S3JA 1DPRA 2A3SA 3RKXA 2GOMA 5K5RA 2V9VA 1VQ4I 2B7EA 2DODA 3CJNA 3TQNA 1JGGA 2GXGA 2KZVA 3E7LA 4KJZA 2MD0A 2NYXA 1I27A 1YIOA 1XB4A 2XAHA 3KLOA 3N97A 3T8RA 3AG4H 2KRCA 1FSEA 2ME6A 3HDDA 2QSFX 2VJJA 2JA8J 2BE5F 4O5VA 3H0GJ 1DU0A 4JX6A 1R5GA 3S15J 3HSEA 4OIQF 2TRTA 2GA2A 1HA8A 3FXUA 2HVSA 2L9SA 1EF4A 1LFUP 2H8RA 1XGNA 4BQOA 1YW8A 2M0CA 2O3FA 1I3QJ 3CLQA 2HEOA 3I56I 4YIFA 3BR1A 3GVAA 2QBYA 1FP1D 3U21A 1FPQA 3HHHA 3GW2A 4HNTA 1E0EA 3Q2RA 4A3GJ 5IT3A 2R4GA 3RSNA 1T98A 5JYSA 3CF5F 2ZNYA 1ETQA 2R7FA 4XRSA 4HAMA 5E79C 2DQRA 2G7HA 3NEUA 3EYYA 1MMSA 1FC3A 4NC8A 1CQTA 3PUFA 4MGRA 4EJVA 4X6AJ 1X4PA 2VOPA 3K10A 2RQPA 4YIIA 3OYHA 2HOSA 4RAFA 2IP2A 4R79A 2WV0A 1ON1A 5LD2C 4E7IA 3BY6A 2R7OA 3HYIA 1OKRA 3DP7A 3FXRA 1ON2A 4I98B 3WE2A 1ZH5A 2XHKA 4OU0A 2NVXJ 2K9LA 4UV9A 2Q8KA 1USSA 4UVBA 1YJWI 2DDAA 3K69A 2ME0A 3QPHA 3LSGA 3LSJA 3M9AA 3SYTA 4KDPA 4V19K 1SMBA 4KFCA 1O3QA 1R7JA 5FKOA 3OYAA 3P7NA 5BPIA 3E1SA 4UUVA 4IEJA 1UELB 4WWCA 4P1WA 5KCMA 5F0FA 3PFYA 4B4CA 1XS9A 5FRMA 2EZLA 4G94A 5TGTA 3OYDA 3ONQA 2V9KA 1V55H 2OC6A 1I39A 2EBIA 2VXDA 2ZCWA 4B43A 1D5YA 1MKMA 3VYSB 2GWRA 4MEXF 5HLGA 1YI2I 4BACA 2P4WA 3R4KA 4I0AA 4YFXF 3MFKA 1YFHA 1SFEA 2V4JC 4DZJA 2L2OA 1FOXA 2CG4A 3PIPF 2YU9J 2Y2ZA 1XGSA 3ERMA 4FETA 3C2BA 4M9XA 3S6VA 4QLCU 1SVOA 3PSIA 3KETA 2E35A 4W1UA 3MZHA 2L9VA 1D1AA 3FMQA 2BOLA 5TJJA 4C3IJ 2E7WA 1T2KA 2KDOA 3EETA 1DGRM 2FA5A 2UUZA 1JKOC 5LRSA 1LUJB 2NNNA 3DKWA 3DPLC 3SDGA 3L2WA 2KLOA 2RKHA 3F8BA 4NUOA 1X1CA 3F23A 4RB1A 3S6SA 3ABUA 1I6HJ 2H6BA 4IQ4A 4XLEA 3HOVJ 1WGXA 1RZ4A 3VYUB 4XM3A 1N75A 2D1VA 3LSPA 1AKHA 2IGMA 1BL0A 2F5DA 2CWEA 4O6JA 4EATA 4GO1A 4C3JJ 1OISA 2LBFA 3G4SI 2ZJQF 1Z3YA 3OS0A 2K40A 3MZYA 2FD5A 4NC7A 2M7AA 2L9NA 4BQQA 1P4XA 3P5JA 1DPUA 4ZZDA 1Z3XA 3WE3A 3OYKA 5F27A 2FBKA 2DLLA 1P2FA 4R8HA 2DJNA 3NWTA 3JTHA 1T08B 3L09A 3C3WA 4UXNA 5DD8A 1RI7A 4ENMA 4LLNA 2R7UA 1YS6A 2WWYA 4LG0A 4C9YA 4B3AA 5HLHA 3HUGA 2R7VA 4MIMA 1BJZA 1YG2A 1BC8C 1MW7A 2IXSA 2OU2A 3WU2C 4EVIA 2CQXA 1K4TA 5L3GA 3RQ4A 4L18B 1Z91A 2VOOA 1QQIA 2QEXI 3L2UA 1W1WE 5EEGA 2AQFA 4FX4A 2DI3A 3JRBA 3HKZA 4A0XA 2A07F 3ZXSA 5F08A 1PVEA 3C2GA 4HBLA 2MYSA 1D5VA 4RLQA 4BQAA 4UVAA 3L1PA 3ISPA 1TWCJ 4RB2C 1OCTC 2Y0SA 4BE2A 3FMSA 4HNUA 4ZYGA 5A2QK 4U7BA 1QA6A 1VQOI 1MDMA 3JRAA 1YJ9I 1RNLA 2P6TA 2AHQA 2VKVA 5GTHC 4QIWN 2X6OA 4Y7NJ 2FBIA 1ZHFA 2V6CA 1RUNA 1V3FA 5ETEA 2DO7A 2XB5A 1QZEA 1DP3A 1UG0A 5FGMA 4TPVA 1B6AA 2FBHA 2ZFWA 3I53A 1W36C 2YX4A 1J5YA 3U9GA 2ZC2A 5DYMA 1YITI 4A3BJ 2LKXA 2CW8A 4CYCB 1OFCX 2HVQA 3FX3A 4P55A 2X6XA 4II3A 3K1MA 1KU2A 3PQJA 5J4YA 5EGOA 1IV6A 4Y3OA 1CF7B 3W3CA 5FO5A 4XRSG 2HQAA 1LKXA 4RAZA 1VFCA 3JRGA 2NVQJ 1VZ0A 1GVJA 2F4IA 2LREA 3BZ6A 1U2WA 3IV5A 3LSMA 3Q9VA 5E1ZB 3ZPLA 3DTKA 4CH7A 3AAFA 2DN0A 4IJAA 3S16J 2EA2A 4F93B 2RV8A 1Y56A 4CYDA 2WAEA 3QPSA 5K7HA 3M3YJ 4NB5A 4RLFA 2ZJ2A 1T38A 1MBGA 2XSJC 4FCYA 2DA7A 4FE7A 2W7NA 2M34A 3BP8A 3VYTB 3CTAA 5CQGA 2CV0A 1Z67A 3C2HA 2COBA 2MH9A 3VYRB 3OYJA 2Y48A 4N4NB 4PK4A 5B1BH 3AL0B 2E1CA 2AQEA 1QGPA 4NUBA 4JX5A 3OV8A 3WTUC 1FIAA 2GQQA 1GVDA 3MCZA 5ERIA 3CCUI 4OIPF 2R7XA 2ZNZA 5B5EC 2M3AA 5IYCJ 4KA4A 4ESJA 2CQNA 2PG4A 3VODA 2A5WA 1OMIA 2VE8A 1BR4A 1V5FA 2W84A 3BR2A 3CUOA 3V4GA 1IUFA 1TLHB 1ZKGA 2JT1A 4E70A 1ETKA 3DBRB 1TQPA 5LBQA 2ZJRF 1W7PD 3HKZN 3OIQA 4GRIA 5D5XB 3AKZA 4ABZA 5EGOB 3COAC 2NOGA 4F52A 2HFHA 1XMKA 1MBJA 3V7CA 1BR1A 2Y0SN 1JUPA 1UZCA 3Q5FA 4XSXF 2LY1A 2QSGX 1IDYA 4AIDA 2FX0A 3TGNA 3H0DA 1E2XA 2HOEA 3Q3SA 2IS6A 3JRDA 3DF8A 1MJ9A 3LA2A 1WQ2A 2PN6A 3KX2A 1R23A 2DA6A 2FMYA 2LG4A 3M1CA 4LLGF 4WK8F 1B72A 4RAYA 2Z99A 3REOA 3HJEA 1NG6A 1OR7A 1Z7UA 2DFFA 2PMZA 4NQWA 5DDGA 3KEYA 1FOYA 4I99C 3O8HA 4L9NA 2BV6A 5A2QZ 4G6QA 5ICFA 2E1OA 4NUIA 2XAGA 4G7ZF 1NG7A 2BY3A 3MKYB 1MMNA 2X48A 1O57A 2MGQA 1Y8RB 3K0LA 3A02A 2AXLA 3HM5A 1IRGA 1OYIA 4OMZA 4BAYA 2QZ8A 3WTXC 3GFLA 1P9QC 2MABA 2RN7A 4IHVA 4IXAA 1XSDA 3JCUC 4OINF 2KQRA 1DUXC 2VJ4A 4U88A 1VNDA 4LG3A 4PDKA 2XASA 2FU4A 4Q5SF 4AM3A 5EG0A 2CGPA 1J9IA 3RZOJ 1FSHA 2L0KA 2LRDA 1U3EM 2F4OB 1D1CA 3B02A 3DWLE 4A3IJ 4XONA 2NRAC 2VN2A 2MC4A 3T5XA 4HPQA 1MGTA 5D4RA 3KIOA 1HSTA 1I3AA 4HDUA 2DCEA 4G8XA 2K85A 2W48A 2DW4A 2YUSA 3QAHA 4S04A 3IH2A 3LAPA 2KIQA 4E7KA 4ASNA 3CMMA 3VB2A 3I9V2 1FBQA 2BY1A 2CQQA 1BA5A 4AIHA 5CVIA 4HNVA 2R93J 2FF4A 3H3ZA 4PJ0C 3E6DA 4I02A 4PGHA 3WU1B 2Z16A 5FKNA 1ZLKA 2CW7A 3FF5A 2LNBA 5H6QA 1B72B 5C4XJ 2YR2A 1SD4A 3L2RA 6PAXA 2Z3YA 1JJ6C 1F9NA 1VI0A 3PNVA 5LEJA 3C18A 2KZGA 1GDTA 3FK6A 3RI4A 3LSIA 2XF5A 2RVCA 3HTUA 1XSXA 1ZARA 4HSTA 2G7UA 4M3GA 1JKPC 5KNLA 3BZCA 1K4SA 2PJRA 1RC9A 4I0BA 4BL0B 2P5KA 1FWZA 2FMLA 1WJCA 1WJFA 2E5NA 3BWGA 4A3KJ 4NHJA 1K83J 5FB2A 1IJWC 3ASNH 3CCVI 2A68F 4XOTA 2P8TA 1MH3A 4RM2A 4W97A 2WC2A 2HPIA 4DQ2A 5EG0B 1H0MA 3PUBA 3ZQHA 4Z6YA 3H5RA 5CQEA 1Q1VA 3IRRA 2VE9A 3ZMSA 2D5VA 2QQBA 1SVLA 1YE9A 2FNPA 3W6JB 2LF8A 3IH3A 3WODF 2MLGA 4DYRA 3OSFA 2LY9A 5CVJA 4XKCA 3BJOA 3DEUA 3U1KA 4M74A 3RJPA 2LFBA 3DLAA 1Z21A 3K9TA 5JHFA 3V7SA 3MKZA 4U0VA 2O9LA 3H5AA 1U78A 3MKWB 1Y1WJ 1E3OC 3JRFA 2HI3A 3FM5A 2EV6A 4A12A 5E3LA 4CA0A 3F8MA 4AVPA 4AIWA 3G3ZA 3AG1H 3R61A 4IHWA 3S2WA 2KFDA 4D9JA 4KIGA 9ANTA 4HF1A 1K79A 3L2VA 2RC4A 2IA0A 3TKYA 5DCMA 4P27A 4IX7A 1B8IB 3K4KA 4EJWA 3JW4A 2CUJA 1KQ8A 3D5RC 3HXLA 2ELJA 2M0MA 1F43A 1YRNB 4GYGA 5D5WB 2LP0A 2EIKH 2EK5A 3KP7A 1D8KA 3HG9A 3PNYA 2HU9A 2FQ3A 2VPLA 1FT9A 2NXNB 4HZFA 3KYLA 2E2HJ 2XF6A 4IPAA 2M9HA 4IHSA 1KZHA 3D0SA 2DYRH 2DA4A 2XGCA 4CDGA 1ITYA 2PMHA 3W2AA 4BXXJ 4MTDA 2M2EA 1XSVA 4IVNA 2BXZA 3RPUD 3C1DA 1M1EB 2Y9YA 1ONVA 1V5EA 3GEZA 3GFMA 2LH9A 1T39A 4L0YB 1P7IA 3H5NA 4F91B 2L01A 5JI6A 4ZYDA 1IXSB 2E2IJ 5KAIC 1CFEA 3LAJA 2L7ZA 4E7SA 5F0CA 1RPWA 2AO9A 3SFIA 1V54H 1KU9A 2JVGA 2E60A 1YTYA 1BOBA 3WHCA 3OYCA 5KHDA 3RTRA 1ORKA 3FBNB 3DV8A 3FMRA 5F04A 4RBOA 3SEQA 3SXYA 4LOCA 4GFBA 2L54A 1NK2P 1A04A 4RGSA 3ZQLA 1KU7A 5E17F 2D2WA 1HKSA 2JK3A 2HYGD 3TOAA 4XOPA 2O8XA 5IP7J 4P5OA 2OQRA 5D4SA 1TWGJ 2KISA 3J81Z 3RIRA 2OF7A 4UY8I 2DA5A 3ML6A 1A31A 3CC4I 1J75A 2QVOA 1D0YA 2Y69H 3OOUA 2HTJA 3NARA 3S1MJ 2A69F 2WAQA 3Q0WA 4BHBA 5H2FC 1AHDP 3A4CA 2XF7A 1PP7U 5AIQA 3A0BC 3N4MA 1IC8A 2E71A 4XLHA 1PYVA 1J7KA 5ILVA 3S6UA 3V8KA 4Y13A 3QU6A 1W7PB 3GZ5A 2OAZA 3ZGKA 1P6RA 5IYDJ 3I5UA 1R58A 4MFEA 3K4NA 3VWBA 2V79A 3OYNA 1T0FC 2CO5A 2HQ5A 5L3FA 1BN5A 2IW5A 1BOAA 3CCRI 5E3MA 2R7QA 3HPHA 2IEKA 1XMXA 2XRNA 4N4OB 1SMTA 1ZN2A 3CP8A 4H0EA 2Y9ZA 3L00A 3F72A 4V2GA 2W00A 2XAFA 3BJAA 1I5ZA 5HVQC 1G3WA 3G73A 3QP6A 2IGOA 2ACJA 4JBAA 4EM1A 4NC6A 4C2MJ 3Q2UA 3OYBA 2K27A 5DS9A 3MQ0A 4BDYA 3E97A 4DIQA 4HQEA 1UHMA 4PJJA 3AL0C 2VBWA 5CYVA 4B1RA 3PJRA 2EV0A 2L7FP 2ZB9A 2M8EA 4GCVA 1ETWA 2K9SA 4BU2A 1X19A 4II2A 1OCZH 4HEA2 3OOPA 2QQ8A 3VOEA 2YX7A 2JZYA 3R6SA 5IPAA 4A3MJ 1O7FA 1S7AA 5HS9A 5FKMA
chains in the Genus database with same CATH topology
3S6SA 3S6UA 2DDBA 2A05A 1QNXA 2DDAA 1XX5A 3Q2UA 4P27A 1XTAA 2GIZA 4NUNA 1SMBA 3U3NC 4IFAA 2EPFA 3NT8A 3S6VA 4H0AA 1CFEA 2CQ7A 5ETEA 1U53A 4G2UA 4TPVA 3Q2RA 4D53A 4AIWA 2VZNA 4NUOA 3MZ8A 3U3LC 1RC9A 3U3UC 1WVRA 5JYSA 4NUIA 4NUKA 4LY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6S A;  3S6U A;  2DDB A;  2A05 A;  1QNX A;  2DDA A;  1XX5 A;  3Q2U A;  4P27 A;  1XTA A;  2GIZ A;  4NUN A;  1SMB A;  3U3N C;  4IFA A;  2EPF A;  3NT8 A;  3S6V A;  4H0A A;  1CFE A;  2CQ7 A;  5ETE A;  1U53 A;  4G2U A;  4TPV A;  3Q2R A;  4D53 A;  4AIW A;  2VZN A;  4NUO A;  3MZ8 A;  3U3L C;  1RC9 A;  3U3U C;  1WVR A;  5JYS A;  4NUI A;  4NUK A;  4LY5 A; 
#chains in the Genus database with same CATH topology
 4BE1 A;  5E3O A;  4XQF A;  4M6X A;  1JTX A;  3UR3 C;  1UAA A;  4IKF A;  2ZXI A;  1X3Z B;  2R5Z B;  3HOZ J;  3I4N J;  1WJA A;  2KMU A;  5B1A H;  3KEO A;  4KIC A;  4B48 A;  2CV1 A;  2MLK A;  4LMY A;  3B6A A;  1Z05 A;  4UVC A;  1P7J A;  3LST A;  3T8T A;  3QYB A;  3HSR A;  5JLW A;  2O7O A;  3DXJ F;  2W24 A;  3T1B A;  2VL8 A;  3MD2 A;  4XN3 A;  1KA8 A;  2F5E A;  3RCO A;  1X58 A;  1GV2 A;  2K02 A;  3CCM I;  2HDD A;  3MWM A;  1MND A;  1QNX A;  3CD6 I;  3GUD A;  4RB3 C;  2ECB A;  4QWQ A;  3ABM H;  4M72 A;  3CUQ A;  5D8L B;  1FTT A;  3JRH A;  5EJC A;  1U9O A;  5ICC A;  3H9G A;  1ZG5 A;  4QPQ A;  4BDZ A;  2LVS A;  2XUB A;  2JRT A;  1MH4 A;  4BHC A;  1B1B A;  5LHG A;  3GXO A;  2ELK A;  4KT5 C;  4QSH A;  2WAQ N;  5M5X J;  4PJM A;  3H9J A;  2F6C A;  5ED4 A;  4AUX A;  3BG9 A;  2VT3 A;  3PM1 A;  1QHG A;  3OMY A;  1WH7 A;  2ZO4 A;  3CZ6 A;  4L9J A;  1GXQ A;  4F92 B;  2VOD A;  2X9D A;  2ECC A;  1LVK A;  1SVM A;  2V26 A;  2X6Y A;  5DV5 A;  3KPH A;  1KU3 A;  2W57 A;  2WTE A;  3ZCO A;  5BQT A;  2GXB A;  3H36 A;  4N9H A;  4Q48 A;  4G9Y A;  4KN7 X;  2E36 A;  1QBJ A;  1ZGW A;  5IOY A;  3DQV C;  4P9F A;  4EMS A;  3KEQ A;  2QYO A;  2XVC A;  2VKE A;  4MQV A;  2CH0 A;  2FJ1 A;  4D7M A;  5HDG A;  3W6V A;  3MAJ A;  1SFX A;  2OBP A;  3W2W A;  4AD9 A;  5L3C A;  2VAS A;  1WFX A;  5E18 F;  3SDB A;  4MO7 A;  4IOC F;  1Y0U A;  1TT5 B;  2ZKZ A;  1JT6 A;  2L3D A;  3KP2 A;  1K7A A;  1BW5 A;  2EFN A;  1OCO H;  5C44 J;  3RPU A;  3CJR B;  2NNY A;  1MSF C;  1IN8 A;  2JA2 A;  3R0A A;  2OJE D;  4OIR F;  2OCE A;  1ZAO A;  2BGC A;  2JPB A;  3TBI A;  3ABT A;  2P7V B;  3IRQ A;  3K4J A;  4RM3 A;  3SHF A;  4M3E A;  1SAX A;  2DK8 A;  3CUQ B;  2DT5 A;  4FX0 A;  3K4C A;  3Q0U A;  4BJT A;  1OR7 C;  3K1N A;  4MNU A;  1LQ1 A;  1IG7 A;  1YJN I;  4OMY A;  4DYQ A;  5LRR A;  1JUM A;  3HRM A;  3F0C A;  2EIJ H;  3SZT A;  2OV7 A;  2QF7 A;  1UG2 A;  1EV7 A;  3I54 A;  3OYG A;  2XRO A;  1HBX G;  3W2V A;  2LKP A;  2IBD A;  2HS5 A;  2W4S A;  1RR8 C;  4PZJ A;  3ELK A;  1TT0 A;  4QPO A;  4ZTJ A;  1WPK A;  4HYE A;  3KP5 A;  4M6V A;  2RNG A;  3PQK A;  3GO5 A;  4CYC A;  4C30 A;  2BW3 B;  2P81 A;  1KYW A;  2BXY A;  2E5Z A;  3B6C A;  2LSO A;  2HR3 A;  4U87 A;  5C3E J;  2O5R A;  1XPX A;  3TP0 A;  1R22 A;  4B8X A;  2GZW A;  3ECO A;  3J7Y J;  1CF7 A;  1LNW A;  1Q1H A;  1XC5 A;  1A36 A;  1ZRD A;  3VSK A;  3I59 B;  1X3W B;  1P92 A;  4HV6 A;  1T0F A;  3K4M A;  4XLC A;  2B63 J;  5HOD A;  3IWF A;  1MBE A;  5LHI A;  2KT0 A;  2QLZ A;  1SEU A;  4DBQ A;  1SAN A;  2R5Y B;  5IY5 H;  3F8F A;  4ON0 A;  2LR8 A;  3FXK A;  4HSR A;  4YG2 F;  2DPD A;  5L3D A;  3WTW C;  1TW3 A;  2HKO A;  5GAG J;  3U3L C;  2WBM A;  1UMQ A;  4FE4 A;  3GBG A;  1IXC A;  4BXF A;  2OZU A;  1X1A A;  2NS7 A;  1VQ5 I;  3IHU A;  1G4D A;  2NVU B;  1BJA A;  4JQF A;  3IH4 A;  2QSH X;  1JTY A;  4CIC A;  1IUY A;  4BBS J;  2DA1 A;  1R9T J;  1Y1V J;  4R1H A;  1ZLJ A;  2E1M C;  2V1N A;  3KP4 A;  1VQM I;  4D5C A;  5ILS A;  1TQM A;  4LIU A;  4EJO A;  1I6X A;  1UFM A;  4FHT A;  5E1W A;  4ZTF A;  1D0Z A;  1K6Y A;  2O03 A;  2DFI A;  3TL4 X;  3E5X A;  2IPQ X;  1ULY A;  3E6B A;  1WWX A;  4L9T A;  4A3E J;  1LDK B;  4XOR A;  2GLO A;  1DGW Y;  3LFU A;  1PUE E;  4HA8 A;  4CSW A;  2X1E A;  2VBZ A;  2TDX A;  5IT9 Z;  3GCM A;  3VFZ A;  4KIT B;  4RA2 A;  1U8R A;  1R1T A;  5EZH A;  2HQN A;  2PQ8 A;  2F5V A;  3WTS C;  4UNO A;  4RMN A;  4KMF A;  2VBX A;  2ID3 A;  4HF2 A;  5AON A;  2H1L A;  1D0X A;  1ZR2 A;  1O3T A;  3S17 J;  1ETV A;  5IP9 J;  1SC7 A;  1LDJ A;  1T8I A;  2ISY A;  3O2P E;  4B47 A;  4XRF A;  1FY7 A;  2XSD C;  3TW7 A;  1NTC A;  1O7L A;  3U1D A;  1FP2 A;  2EWN A;  5KAF C;  4AYB A;  2H94 A;  4Y17 A;  1WVR A;  2L9R A;  3A03 A;  3GFI A;  4G7O F;  2J5O A;  3IC7 A;  4TV7 A;  4IHY A;  5IOZ A;  3KE2 A;  2DT7 B;  1HDP A;  1R4N B;  1MIJ A;  1HW5 A;  2EFO A;  1PUF B;  4Q47 A;  5F6F A;  2A6T A;  5L3E A;  3WTT C;  1FBU A;  2EA4 A;  3OSG A;  3BRO A;  2LYC A;  4LK0 F;  3J7A Y;  3S2H J;  1QU3 A;  3OIO A;  3OWT A;  2F4M B;  1TWH J;  2K3F A;  4I7H A;  2X4H A;  3QOP A;  5HS7 A;  4BBR J;  2ZSI B;  4A3F J;  4KNY A;  1FZP B;  2Q0O A;  1OYY A;  5GAE J;  1XGO A;  2LKS A;  4J19 A;  4E6K G;  2CW0 F;  3H1C A;  1PDN C;  2A61 A;  3WG7 H;  1RR7 A;  3QU3 A;  3HOX J;  3SJM A;  2LDU A;  4CZZ A;  3GTJ J;  4ESF A;  2EV5 A;  4GYI A;  3CO6 C;  2ICW G;  2KP6 A;  2LMD A;  5CVR A;  4L9V A;  3E0J B;  3HL2 A;  2MA3 A;  2FE3 A;  3F9K A;  3CQZ J;  2ETH A;  4XSZ F;  1SFU A;  1QNT A;  3U2R A;  2KL4 A;  4F55 A;  2UV1 A;  2I5U A;  1JHF A;  1Z1D A;  2R92 J;  3GTK J;  5L3B A;  3BTC A;  4ITV A;  3BR3 A;  2I10 A;  2XPU A;  1U5T A;  1HF0 A;  1UCR A;  4A3L J;  2RDP A;  3H3V K;  4YEL A;  5J1U A;  4M73 A;  4HW0 A;  3V7R A;  3LNQ A;  2IVM A;  1KQ9 A;  3DPT A;  1ZYR F;  5H6R A;  2HTS A;  4CXF A;  4RS8 A;  4EGY A;  5F1J A;  2CQK A;  3BLY A;  1IZ1 A;  5GAH J;  2X85 A;  4NUK A;  4UB6 C;  3FM3 A;  2A6E F;  4PSX A;  2A05 A;  4NNJ A;  3A01 B;  2Y0M A;  4ESB A;  4BGD A;  2PI0 A;  3S2D J;  1JUS A;  3Q0V A;  1IXR C;  3DTI A;  2JPC A;  1VTN C;  4FAS D;  1VQ6 I;  1XCB A;  3U3N C;  2DXI A;  3WU0 A;  2R7Z J;  4EM0 B;  3RKY A;  1GLN A;  2VPR A;  3RDI A;  4E7L A;  4IQJ A;  1CGP A;  2R7T A;  3ZQC A;  1MMD A;  4Y4R A;  3V8L A;  2KDZ A;  1MD0 A;  1ZRF A;  3I55 I;  4AYB N;  2VUM J;  3BG5 A;  5FFX A;  2BVL A;  5JLX A;  3FHZ A;  4HRI A;  1FLI A;  5DTD A;  4GXO A;  4IF4 A;  3S32 A;  1VQN I;  2ZFU A;  1XX5 A;  5ICG A;  3DBL B;  5FKK A;  4O3M A;  2WY8 Q;  2PX9 A;  2OQG A;  3LFK A;  2ESH A;  3V8J A;  1WSU A;  3S1N J;  1OJL A;  4IHX A;  4I2O A;  4WF2 A;  3WGG A;  5J3L A;  3G1L A;  4CCL A;  2DAO A;  2UXX A;  2V1U A;  3K70 D;  2VJ5 A;  3MVP A;  1IW7 F;  1U5T B;  3OR1 C;  3OY9 A;  1TNT A;  3WTV C;  2ZJP F;  2MD5 A;  2BHZ A;  3O6B B;  1F1Z A;  3HB9 A;  3SFZ A;  3QOD A;  1JI8 A;  1H88 C;  3RZD J;  2CJJ A;  1HQC A;  4B3X A;  2UZK A;  5LGN A;  1FX7 A;  3L9F A;  4FIS A;  3KYD B;  1IN4 A;  1FYM A;  1EH6 A;  3QYF A;  1HOM A;  3CMY A;  2J5P A;  2GIV A;  4M6Y A;  3BR5 A;  5D6E A;  3HTS B;  4NBQ A;  5EDN A;  3JAM Z;  3GTQ J;  2K4B A;  2NS8 A;  1R4M B;  1TBX A;  1B8I A;  4XK4 A;  5FLX K;  5EYR A;  3J81 K;  4ZC3 A;  4IO9 F;  4LB5 A;  5LLQ A;  4L0Z B;  3BTI A;  1BI0 A;  3FDY A;  3BC8 A;  1A5J A;  3ZN0 A;  4MQ9 F;  1BI2 A;  1YRN A;  1H9G A;  1QZZ A;  3VDX A;  3D1N I;  3HGG A;  1QRY A;  3DEW A;  3FBI B;  4Y52 J;  3CC7 I;  4XN0 A;  5F64 A;  5J1Y A;  3WGH A;  4BEH B;  1GXP A;  4A3D J;  2DMQ A;  1YO5 C;  3P9C A;  2DTZ A;  4E7H A;  3QPT A;  3QRF F;  5BS6 A;  1ZG1 A;  3NQO A;  1LB2 A;  3GTP J;  4HOB A;  1U53 A;  2PMZ N;  4P96 A;  4HQM A;  4UUS A;  1Z9C A;  1WHU A;  3DKY A;  3OIP A;  1WI9 A;  1FOK A;  2M8G X;  2P6S A;  1W5T A;  1ZG3 A;  2HNH A;  2R7W A;  1ZQ3 P;  3HRU A;  2JA6 J;  3ZMD A;  2M5W A;  1T33 A;  2STT A;  3PIO F;  1R1V A;  2L4A A;  3BT9 A;  4IRH A;  5CVU A;  3FK7 A;  3S3O A;  3BPX A;  5DD4 A;  3GFJ A;  1XTA A;  4HLY A;  1NH3 A;  1RES A;  5DUI A;  3HRS A;  2K4J A;  3CUQ C;  4LIT A;  4FT8 A;  4PGG A;  2CRG A;  4L5J A;  4OAY A;  3FWE A;  2K5C A;  2BBY A;  1X2N A;  3E3V A;  3V42 A;  4HF0 A;  4BQN A;  3H92 A;  4PUS A;  3AG3 H;  2QM3 A;  2EIM H;  2E7X A;  4JX4 A;  2QQ9 A;  2M4G A;  5D6F A;  2VJI A;  3D5L A;  1ZR4 A;  2IAI A;  3F22 A;  2PJP A;  3CMA I;  2K7L A;  2EJR A;  3ECH A;  4XLP F;  2QUF A;  3D5S C;  1SD6 A;  2Z2S B;  4I01 A;  3OYE A;  3ZMZ A;  2JA5 J;  5K7F A;  1V4R A;  4Y33 A;  2NS0 A;  3P9K A;  3KZY A;  2DMT A;  1IN5 A;  2JSC A;  2G9W A;  4WXC A;  1XDU A;  4XR6 A;  4DBR A;  2IS1 A;  4ZJZ A;  2HYF A;  1POG A;  5HOO A;  1TTY A;  1RIO H;  4LK1 F;  1U6G A;  4RGX A;  3HOS A;  3TW6 A;  1H89 C;  1R36 A;  2HZD A;  4GDF A;  1W7P A;  2FEZ A;  3TMO A;  2X1D A;  3GME A;  3ZR8 X;  1S29 A;  2ZME B;  4BKX A;  1XD7 A;  1IN7 A;  1DDN A;  4C3H J;  3KCC A;  5FLV A;  2JTV A;  2IRF G;  3GWZ A;  4BJ5 C;  1MBK A;  4UUS B;  4ZYE A;  4PJL A;  2CYY A;  2Y30 A;  1ZTR A;  1ODD A;  1QPI A;  4XKW A;  4G6T B;  5HLT A;  2YSR A;  1U9N A;  5DCF A;  3UNG C;  5BPD A;  4ZYA A;  2LC2 A;  1RRJ A;  3CCJ I;  5HLI A;  1X2M A;  1YW9 A;  3WTY C;  2JMW A;  2DPU A;  2M7B A;  5KK1 A;  1D3Y A;  4ZH4 F;  3ERE D;  1R5I D;  2FOW A;  2XGX A;  2MFZ A;  3S93 A;  2STW A;  2F5F A;  3BG7 A;  3LA7 A;  4HG2 A;  4IRI A;  3I4P A;  1W4M A;  3QPL A;  3JRI A;  3M7G A;  4MEY F;  3LMM A;  4RAG A;  3ROU A;  1NHA A;  3F6O A;  4BY7 J;  3G1M A;  1TW2 A;  2IA2 A;  1R5H A;  4A0Y A;  3JSP A;  1L0O C;  2EH3 A;  4EQQ A;  1O3R A;  1W0U A;  1UHS A;  2XIG A;  3LA3 A;  1FNN A;  4EM2 A;  5FLX Z;  2HQR A;  1VQP I;  5EEH A;  3DLL F;  3I71 A;  5CKT A;  5DM7 F;  3BJ6 A;  3KYC B;  2YPR A;  5IYB J;  1JGS A;  5E3N A;  1I1G A;  5BNG A;  4L5E A;  2D45 A;  3HIF A;  3BCA A;  2DK5 A;  3ZP5 A;  2VC0 A;  1BW6 A;  3DTE A;  2R5Z A;  5J8C A;  2V1X A;  5LEK A;  4A3J J;  4AVZ A;  2V9P A;  1QVT A;  3DFG A;  4DJA A;  4XNF A;  2LTP A;  2X0L A;  2BY0 A;  3F8C A;  4ETS A;  1EA3 A;  2WAF A;  2K9N A;  2XGE A;  3RQI A;  2JRM A;  4CCO A;  2PFB A;  4AIJ A;  3OL4 A;  4YIR X;  2QWW A;  3N05 A;  4KT6 A;  5BOX A;  1ZGA A;  3AG2 H;  1GUU A;  2EIL H;  2FRH A;  3S8P A;  3IUO A;  4CCK A;  2KIU A;  2IGK A;  2HXO A;  4XID A;  1H9T A;  3CC2 I;  2P5V A;  5M3M J;  4EJU A;  1E3P A;  4OIO F;  4KMU X;  4M71 A;  5EEA A;  1TNS A;  2JN6 A;  4KIF A;  3IAM 2;  2CUF A;  3ZMV A;  4PFP A;  2XDV A;  3HPG A;  1TL8 A;  2UXN A;  4ZDO A;  2QKL B;  1V5G A;  2MW8 A;  3MN2 A;  4RGU A;  2BYV E;  1XG1 A;  4EJT A;  1W0T A;  1TWA J;  2R7D A;  4IZZ A;  2EPF A;  1IO2 A;  2A6H F;  3RYP A;  4JK1 X;  3ULQ B;  3GZN B;  2EFP A;  2N8G A;  1YQA A;  3BQY A;  4WX9 A;  3I4M J;  1VQ9 I;  2XB0 X;  3BZK A;  3K7A J;  2K3P A;  2RAE A;  5TIS C;  4UV8 A;  4IHT A;  3CCQ I;  4RDU A;  2V7F A;  3W6K B;  3JTG A;  1T95 A;  2WY7 Q;  2PBI A;  4J00 A;  2LF7 A;  2MH2 A;  1SD5 A;  4XMY A;  2HPM A;  3FKJ A;  5F1R A;  2EB7 A;  2AXT C;  2FOK A;  1EH8 A;  2MC3 A;  1J59 A;  2YS9 A;  4B44 A;  1LE8 B;  2O0Y A;  3KZI C;  2DMP A;  4MHG A;  3GTL J;  1C0W A;  1HDD C;  3LSH A;  4I09 A;  3SEZ A;  2GAU A;  3TOB A;  1BM9 A;  3CCY A;  4ENJ A;  2CFX A;  1F5T A;  3A0H C;  3ABL H;  4PJN A;  4CCN A;  5D5V B;  2VLA A;  1EKE A;  4RGR A;  3ZQI A;  2XAJ A;  1HW1 A;  2DU9 A;  1MNE A;  3K2Z A;  1WJD A;  1R49 A;  1FEX A;  3CLO A;  1Y8Q B;  1ETO A;  1ZGJ A;  5J1R A;  1SMY F;  4EEF G;  2M45 A;  3H9Q A;  4DZP A;  5J8F A;  1S7O A;  2E34 A;  2H8W A;  4K2E A;  2GBY A;  1SFK A;  4XRM A;  1WJB A;  1LFB A;  4S05 A;  1UB9 A;  1TC3 C;  4XIC A;  4LGW A;  3S1Q J;  4A5M A;  1EH7 A;  1BC7 C;  4G2U A;  2A5Y B;  4L5I A;  1U8B A;  5E20 A;  1IRX A;  3ZQG A;  2HOA A;  3MZ8 A;  3IL2 A;  3WGI A;  2I8D A;  4AU7 A;  3TED A;  4A6D A;  1HCR A;  3KP3 A;  2VKH A;  3BG6 A;  4Q4Z F;  2PLY A;  1YOV B;  2IJL A;  2F5C A;  1J09 A;  3ZQQ A;  3RPQ A;  3LOC A;  5E8I A;  3KLN A;  2BW3 A;  3LQQ A;  3KFW X;  4NUN A;  3HOT A;  4XLF A;  4U7D A;  1Z6T A;  5B66 C;  2WAD A;  5IT9 K;  5CJ9 A;  2XC7 A;  3VEP A;  4D0P A;  4HDV A;  2BVM A;  3I59 A;  1JT0 A;  2HVR A;  5GP9 A;  1MSE C;  2P7C B;  2DA3 A;  2L5Q A;  2QCO A;  2CUZ A;  3P9I A;  2Z1D A;  1XGM A;  2R5Y A;  2XPV A;  1FJL A;  4CGZ A;  1HSJ A;  3L2C A;  2LY2 A;  3QYE A;  1XN7 A;  5M5W J;  1TZL A;  5EZG A;  2DBB A;  3EDP A;  4XKB A;  4BY1 J;  1T56 A;  5JFR A;  1G2H A;  1G3T A;  1KQ0 A;  1VQ7 I;  4QTR A;  3FXQ A;  2JWT A;  1U5T C;  2FNA A;  2LLK A;  2HYJ A;  1G59 A;  2DT6 A;  2E2J J;  4HX8 A;  2O61 A;  4IOA F;  1B9M A;  2FSW A;  3ZMU A;  4F7Z A;  2QBY B;  2NOJ B;  3OS1 A;  2M87 A;  1GHC A;  5GTI C;  3LSR A;  3BG3 A;  1MMA A;  2FXA A;  3CDH A;  4LLL A;  3F3X A;  1YHQ I;  1S72 I;  2JJ7 A;  4YEJ A;  3HOW J;  2DYS H;  2EFW A;  2W82 A;  1ZRE A;  2Z9O A;  5GAD J;  1U0J A;  3QP5 A;  4I6Z A;  1YX3 A;  1TQI A;  5F0H A;  4DYC A;  4A93 J;  3CCS I;  5GPA A;  1WJE A;  3KP6 A;  4E7J A;  1IDZ A;  3TO6 A;  3H35 A;  3PO2 J;  2KRF A;  1S6L A;  5HNH A;  1ERD A;  2ZXJ A;  1R71 A;  1IRZ A;  1UJ8 A;  2PMU A;  2RQQ A;  4WCG A;  5JVG F;  1MZB A;  1WH5 A;  1ZK8 A;  3B73 A;  3HBL A;  3ESW B;  1PJR A;  5EF6 A;  1J2X A;  2QKM B;  1YIJ I;  2QEN A;  3DKX A;  1FMW A;  1IV8 A;  4YRV A;  1P4W A;  2DOF A;  2HZT A;  2IA1 A;  3NAU A;  2HDC A;  2HXI A;  1JHH A;  2ZBK A;  1F36 A;  2DFH A;  3EUA A;  2ZXH A;  2JUC A;  4C2T A;  4HX7 A;  1PUF A;  2DQL A;  3HRT A;  1FTZ A;  3DU5 A;  5CPR B;  3GTM J;  2KIF A;  3EUH C;  2ISZ A;  4ZYH A;  2RRE A;  3FXJ A;  2FQ4 A;  1OCP A;  1LDD A;  4MFD A;  2VBY A;  2WB1 A;  1WJ5 A;  3JRC A;  4U0W A;  2IS2 A;  3EYI A;  4A69 C;  1MMG A;  4Z2Y A;  2EZI A;  4BYY A;  1SFO J;  3BCB A;  3CF2 A;  5J6X A;  5FRN A;  3ZOB A;  1EJ9 A;  1OQY A;  1SD7 A;  2JSP A;  3BR6 A;  5E1X A;  1IGN A;  4M9S A;  3EQL F;  3ZMT A;  5JHU A;  1N25 A;  2E1N A;  2XAQ A;  2GIZ A;  1KON A;  1IAW A;  2XV4 S;  3J80 K;  1Y6I A;  3OS2 A;  2X51 A;  4ZZL A;  2QGU A;  1WZ2 A;  2ZME C;  3GX4 X;  3TDZ C;  1MJB A;  3RKW A;  1W36 D;  1AKH B;  3S3M A;  1OCR H;  2KRH A;  1YW7 A;  5FD6 A;  1IF1 A;  1WCM J;  3K6G A;  2V6E A;  1MBH A;  1FOW A;  1REP C;  5JR3 A;  1AOY A;  4JP0 A;  2LBF B;  1VQ8 I;  3CDL A;  5BMZ A;  2KHM A;  4RB0 A;  4OOI A;  3Q9S A;  4C2U A;  2VQC A;  2CU7 A;  2M1B A;  3TO9 A;  1QZY A;  1OYW A;  1D1B A;  1WKM A;  3IWZ A;  4LD5 A;  3I58 A;  4A5N A;  3CJT B;  3PO3 J;  3ZRG A;  3J7A O;  4X1E A;  3C7J A;  2O8K A;  3OR2 C;  3LSK A;  2RNJ A;  2Y75 A;  1VQK I;  4LG0 B;  5LHH A;  3A01 A;  3S14 J;  3HUG B;  1K6O A;  2B0L A;  3U3U C;  3CES A;  1K78 A;  2V1D A;  3E5U A;  1WI3 A;  3IP4 B;  1DP7 P;  3G6E I;  1I1S A;  5K5Q A;  1W5C C;  3JAM K;  3QOE A;  2VC1 A;  1S8N A;  1Y39 A;  2GM4 A;  2JQ7 A;  4OWR B;  2HOT A;  2ZXW H;  3BTJ A;  3CME I;  3CCL I;  4I76 A;  2NAZ A;  2CS3 A;  5AIP A;  4BH9 A;  2Q2E A;  3F8N A;  1O3S A;  1MDM B;  4ANJ A;  2KPM A;  3DEE A;  2ESN A;  2DJI A;  4UB8 C;  1YLF A;  5IP6 A;  4S0H B;  1YS7 A;  2VIX A;  3O8G A;  4D53 A;  2K9Q A;  3J7Z I;  3WTZ A;  2DDB A;  3SZP A;  2OPT A;  1GV5 A;  1W5S A;  4MTE A;  1OLT A;  3CP2 A;  4B09 A;  2R0Q C;  3L2Q A;  4AC0 A;  1OCC H;  3FXL A;  5HDN A;  3M4O J;  1HXD A;  2VQG A;  1FIP A;  3DU6 A;  3R60 A;  2WB1 N;  4A0Z A;  2YU3 A;  2TCT A;  3TDU C;  3T0Y A;  3GF2 A;  2HWV A;  5ILU A;  5GPC A;  5J40 A;  1E17 A;  4BNC A;  1R00 A;  2VQH A;  1KYZ A;  3QWL A;  3WHB A;  1ETY A;  4BJ6 C;  4M9Z A;  1GT0 C;  2GOX B;  4BE0 A;  1T6S A;  5CVV A;  1QPM A;  1RKW A;  3PL8 A;  2HDW A;  2XKO A;  4M3D A;  3HZJ A;  3L7W A;  4OAZ A;  2XRL A;  2K86 A;  3BQZ A;  5J4V A;  1XDS A;  2BY2 A;  1HW2 A;  2H6C A;  2K9M A;  3WG9 A;  1K78 B;  5DEQ A;  1O4X A;  2OTJ I;  4H0A A;  1P4A A;  3M1E A;  5FRO A;  1XCV A;  4XLN F;  1H8A C;  3BOQ A;  4D7N A;  2MG4 A;  5D5U B;  1ZRC A;  2WV1 A;  1FMV A;  4EV0 A;  1L3L A;  4BEH A;  2OZ6 A;  3DPU A;  1LVA A;  1HC8 A;  2Q2E B;  3J80 Z;  2Q1Z B;  1SAU A;  1RKT A;  5FD5 A;  3MEX A;  1N77 A;  2DFE A;  1S5L C;  1HKQ A;  2OCC H;  4DGW B;  3IKT A;  2CMP A;  4WXD A;  2IT0 A;  4YFN F;  2ELH A;  2LD5 A;  3F6V A;  2AS5 F;  3BR0 A;  2FUG 2;  1TP4 A;  1IN6 A;  2COM A;  2JA7 J;  3A2K A;  3G2B A;  4BUP A;  2H1K A;  2W1O A;  4XKV A;  2F48 A;  1JJ8 C;  4G6D A;  2IS4 A;  3K70 C;  5C4J J;  2VB6 A;  3EUH A;  4BS9 A;  1G3Y A;  2B9S A;  3M07 A;  2L02 A;  1F4K A;  3NRV A;  1X3U A;  4P9U A;  3HSF A;  2NVY J;  1PP8 F;  5FLM J;  5FFZ A;  3E6M A;  3X2Q H;  2NVT J;  2EQR A;  3ABK H;  4EGZ A;  1HKT A;  3I3L A;  2XPW A;  3I64 A;  3GZ6 A;  3BDD A;  1B59 A;  3SQN A;  5JVT A;  4ZDP A;  4XL9 A;  3HEF A;  4GGG A;  3PFI A;  5B3S H;  1VQL I;  4NQW B;  3BPV A;  3OYF A;  1LEB A;  4ZDL A;  2Z33 A;  1BR2 A;  3DCF A;  3FKI J;  1MNM C;  2QQA A;  2M4K A;  3SZG A;  1Z6R A;  1NK3 P;  2HGC A;  1IRF A;  2G0E A;  2W85 A;  4E4H A;  1J0R A;  4KYW A;  3CDI A;  4X0G A;  2PEX A;  2ZME A;  3IAS 2;  2VXZ A;  2OA4 A;  3JRE A;  3RKQ A;  2DMU A;  4JYK A;  4PSW A;  4CUG A;  2R3S A;  3G1O A;  4CHU A;  2KKO A;  1I50 J;  2VZN A;  2GXA A;  2E19 A;  1B9N A;  2Y31 A;  3FZV A;  4WXH A;  4HLX A;  4BXU A;  4KIS A;  5ICE A;  3G71 I;  1XMA A;  4CCM A;  4DOZ A;  3GTG J;  2P5L C;  2O6G E;  1QO0 D;  2MSY A;  1STZ A;  2MBF A;  1WRJ A;  5LGT A;  4ENK A;  2VI6 A;  1A6Q A;  1X1D A;  2ADU A;  4AIK A;  2EIN H;  3K2A A;  1D8J A;  3E5Q A;  3CJQ B;  1AA7 A;  1FYK A;  2QA4 I;  1B4A A;  1ZEL A;  2CQ7 A;  4D1Q A;  4Y15 A;  4XLA A;  1OPC A;  2KIM A;  4HV5 A;  2OUM A;  2UWM A;  2R7R A;  4V2F A;  1A6I A;  1X1B A;  3QQA A;  2ID6 A;  2H09 A;  1YX5 A;  2L4M A;  1BI1 A;  3OYM A;  2GA1 A;  3K4L A;  2DOE A;  1JXS A;  1LFP A;  1X1P A;  3M8F A;  1G8X A;  2DMN A;  2VT2 A;  4KUM A;  4G12 A;  1KGS A;  3AFH A;  1ETX A;  1FBS A;  3VPR A;  4A3C J;  4IFA A;  5CLS A;  2JVH A;  5D8K B;  4PCQ A;  4M3F A;  2D1H A;  1BIA A;  3DBH B;  2LOO A;  3LQR A;  3OYL A;  3M8E A;  2E1M B;  1RUO A;  2CV2 A;  2BEO A;  4CCJ A;  4G7H F;  4ENN A;  4XBF A;  3ASO H;  4H4K C;  3F21 A;  1HLV A;  2EZK A;  3GYH X;  1MBF A;  1YYV A;  3K4B A;  3M8J A;  3I0T A;  5DM6 F;  4FTH A;  4BHP A;  1FYL A;  5LGU A;  2BZT A;  3FXO A;  5HDK A;  1K61 A;  1BBY A;  2PJR B;  3PNT A;  3TO7 A;  4LFU A;  4FQG A;  2CUE A;  1Y0N A;  2CSO A;  2VKD A;  3EPZ A;  1JKQ C;  5FKL A;  1N78 A;  4UUT A;  1S9H A;  1Z0X A;  2EFQ A;  3NWS A;  4J01 A;  2X6W A;  5K7Z A;  5K1Y A;  2L7K A;  5HNF A;  4D5F A;  5LFA A;  4LIV A;  3A1Y A;  3MMY B;  1A35 A;  4F3Q A;  4KN4 X;  3CCE I;  3ZQF A;  1APL C;  1AWC A;  4LB6 B;  1JKR C;  1S7E A;  1VF9 A;  5E8G A;  1LPQ A;  2VON A;  2XAU A;  2Z5U A;  3FHN A;  4DNC A;  2JUG A;  3PSF A;  1X4O A;  1LJ9 A;  3R0J A;  1TWF J;  4IRG A;  3NT8 A;  2HKX A;  1R1U A;  2WA0 A;  1UHW A;  3GLX A;  4N0B A;  4A2U A;  4YFK F;  3CO7 C;  3H3U A;  1MJA A;  4HX4 A;  1ACI A;  2IGN A;  2W25 A;  2ZSH B;  2X1C A;  4KIB A;  1R6R A;  2KJB A;  4JOM A;  4E7Z A;  3IKV A;  3UKG A;  3OL3 A;  3S3N A;  3GTO J;  2H27 A;  2L7M P;  3HC7 A;  2VQL A;  2C6Y A;  4MLO A;  3E6C C;  5M3F J;  2LK2 A;  5DUK A;  1LEA A;  2OD5 A;  1BI3 A;  1LE8 A;  4AWX B;  4PFO A;  5H20 A;  2M30 A;  5K5O A;  4M3B A;  2CFO A;  4A6E A;  5FJ8 J;  1DU6 A;  2DA2 A;  1Z7L A;  3TP3 A;  1DQU A;  3HOU J;  3ZQ7 A;  1Z77 A;  3JR9 A;  5DCM B;  4LJZ F;  5HS8 A;  2EZH A;  1UST A;  1QHH D;  2BHY A;  1ENH A;  3BTL A;  3FIS A;  4NDL A;  3OYI A;  1JE8 A;  2F2E A;  3FIW A;  2XGD A;  3JSO A;  3S1R J;  4LY5 A;  3HOY J;  1E3H A;  2P0W A;  3FXM A;  3O3K A;  3LL7 A;  2RGV A;  1G3S A;  1RET A;  2DOA A;  4DW6 A;  3MKL A;  1BIB A;  3KZZ A;  4CO8 A;  2R7S A;  3HHG A;  4IL6 C;  4N9I A;  2KJC A;  5TRD A;  3ZN1 A;  3K1P A;  3HGY A;  1AU7 A;  3VSL A;  5M5Y J;  3GLL A;  2OTL I;  1G6N A;  2DTR A;  3EUK L;  3LWF A;  3RYR A;  4U0Y A;  4UHT A;  2XKP A;  1QVU A;  4CZC A;  5J47 A;  5KVR A;  1S3J A;  1DPR A;  2A3S A;  3RKX A;  2GOM A;  5K5R A;  2V9V A;  1VQ4 I;  2B7E A;  2DOD A;  3CJN A;  3TQN A;  1JGG A;  2GXG A;  2KZV A;  3E7L A;  4KJZ A;  2MD0 A;  2NYX A;  1I27 A;  1YIO A;  1XB4 A;  2XAH A;  3KLO A;  3N97 A;  3T8R A;  3AG4 H;  2KRC A;  1FSE A;  2ME6 A;  3HDD A;  2QSF X;  2VJJ A;  2JA8 J;  2BE5 F;  4O5V A;  3H0G J;  1DU0 A;  4JX6 A;  1R5G A;  3S15 J;  3HSE A;  4OIQ F;  2TRT A;  2GA2 A;  1HA8 A;  3FXU A;  2HVS A;  2L9S A;  1EF4 A;  1LFU P;  2H8R A;  1XGN A;  4BQO A;  1YW8 A;  2M0C A;  2O3F A;  1I3Q J;  3CLQ A;  2HEO A;  3I56 I;  4YIF A;  3BR1 A;  3GVA A;  2QBY A;  1FP1 D;  3U21 A;  1FPQ A;  3HHH A;  3GW2 A;  4HNT A;  1E0E A;  3Q2R A;  4A3G J;  5IT3 A;  2R4G A;  3RSN A;  1T98 A;  5JYS A;  3CF5 F;  2ZNY A;  1ETQ A;  2R7F A;  4XRS A;  4HAM A;  5E79 C;  2DQR A;  2G7H A;  3NEU A;  3EYY A;  1MMS A;  1FC3 A;  4NC8 A;  1CQT A;  3PUF A;  4MGR A;  4EJV A;  4X6A J;  1X4P A;  2VOP A;  3K10 A;  2RQP A;  4YII A;  3OYH A;  2HOS A;  4RAF A;  2IP2 A;  4R79 A;  2WV0 A;  1ON1 A;  5LD2 C;  4E7I A;  3BY6 A;  2R7O A;  3HYI A;  1OKR A;  3DP7 A;  3FXR A;  1ON2 A;  4I98 B;  3WE2 A;  1ZH5 A;  2XHK A;  4OU0 A;  2NVX J;  2K9L A;  4UV9 A;  2Q8K A;  1USS A;  4UVB A;  1YJW I;  2DDA A;  3K69 A;  2ME0 A;  3QPH A;  3LSG A;  3LSJ A;  3M9A A;  3SYT A;  4KDP A;  4V19 K;  1SMB A;  4KFC A;  1O3Q A;  1R7J A;  5FKO A;  3OYA A;  3P7N A;  5BPI A;  3E1S A;  4UUV A;  4IEJ A;  1UEL B;  4WWC A;  4P1W A;  5KCM A;  5F0F A;  3PFY A;  4B4C A;  1XS9 A;  5FRM A;  2EZL A;  4G94 A;  5TGT A;  3OYD A;  3ONQ A;  2V9K A;  1V55 H;  2OC6 A;  1I39 A;  2EBI A;  2VXD A;  2ZCW A;  4B43 A;  1D5Y A;  1MKM A;  3VYS B;  2GWR A;  4MEX F;  5HLG A;  1YI2 I;  4BAC A;  2P4W A;  3R4K A;  4I0A A;  4YFX F;  3MFK A;  1YFH A;  1SFE A;  2V4J C;  4DZJ A;  2L2O A;  1FOX A;  2CG4 A;  3PIP F;  2YU9 J;  2Y2Z A;  1XGS A;  3ERM A;  4FET A;  3C2B A;  4M9X A;  3S6V A;  4QLC U;  1SVO A;  3PSI A;  3KET A;  2E35 A;  4W1U A;  3MZH A;  2L9V A;  1D1A A;  3FMQ A;  2BOL A;  5TJJ A;  4C3I J;  2E7W A;  1T2K A;  2KDO A;  3EET A;  1DGR M;  2FA5 A;  2UUZ A;  1JKO C;  5LRS A;  1LUJ B;  2NNN A;  3DKW A;  3DPL C;  3SDG A;  3L2W A;  2KLO A;  2RKH A;  3F8B A;  4NUO A;  1X1C A;  3F23 A;  4RB1 A;  3S6S A;  3ABU A;  1I6H J;  2H6B A;  4IQ4 A;  4XLE A;  3HOV J;  1WGX A;  1RZ4 A;  3VYU B;  4XM3 A;  1N75 A;  2D1V A;  3LSP A;  1AKH A;  2IGM A;  1BL0 A;  2F5D A;  2CWE A;  4O6J A;  4EAT A;  4GO1 A;  4C3J J;  1OIS A;  2LBF A;  3G4S I;  2ZJQ F;  1Z3Y A;  3OS0 A;  2K40 A;  3MZY A;  2FD5 A;  4NC7 A;  2M7A A;  2L9N A;  4BQQ A;  1P4X A;  3P5J A;  1DPU A;  4ZZD A;  1Z3X A;  3WE3 A;  3OYK A;  5F27 A;  2FBK A;  2DLL A;  1P2F A;  4R8H A;  2DJN A;  3NWT A;  3JTH A;  1T08 B;  3L09 A;  3C3W A;  4UXN A;  5DD8 A;  1RI7 A;  4ENM A;  4LLN A;  2R7U A;  1YS6 A;  2WWY A;  4LG0 A;  4C9Y A;  4B3A A;  5HLH A;  3HUG A;  2R7V A;  4MIM A;  1BJZ A;  1YG2 A;  1BC8 C;  1MW7 A;  2IXS A;  2OU2 A;  3WU2 C;  4EVI A;  2CQX A;  1K4T A;  5L3G A;  3RQ4 A;  4L18 B;  1Z91 A;  2VOO A;  1QQI A;  2QEX I;  3L2U A;  1W1W E;  5EEG A;  2AQF A;  4FX4 A;  2DI3 A;  3JRB A;  3HKZ A;  4A0X A;  2A07 F;  3ZXS A;  5F08 A;  1PVE A;  3C2G A;  4HBL A;  2MYS A;  1D5V A;  4RLQ A;  4BQA A;  4UVA A;  3L1P A;  3ISP A;  1TWC J;  4RB2 C;  1OCT C;  2Y0S A;  4BE2 A;  3FMS A;  4HNU A;  4ZYG A;  5A2Q K;  4U7B A;  1QA6 A;  1VQO I;  1MDM A;  3JRA A;  1YJ9 I;  1RNL A;  2P6T A;  2AHQ A;  2VKV A;  5GTH C;  4QIW N;  2X6O A;  4Y7N J;  2FBI A;  1ZHF A;  2V6C A;  1RUN A;  1V3F A;  5ETE A;  2DO7 A;  2XB5 A;  1QZE A;  1DP3 A;  1UG0 A;  5FGM A;  4TPV A;  1B6A A;  2FBH A;  2ZFW A;  3I53 A;  1W36 C;  2YX4 A;  1J5Y A;  3U9G A;  2ZC2 A;  5DYM A;  1YIT I;  4A3B J;  2LKX A;  2CW8 A;  4CYC B;  1OFC X;  2HVQ A;  3FX3 A;  4P55 A;  2X6X A;  4II3 A;  3K1M A;  1KU2 A;  3PQJ A;  5J4Y A;  5EGO A;  1IV6 A;  4Y3O A;  1CF7 B;  3W3C A;  5FO5 A;  4XRS G;  2HQA A;  1LKX A;  4RAZ A;  1VFC A;  3JRG A;  2NVQ J;  1VZ0 A;  1GVJ A;  2F4I A;  2LRE A;  3BZ6 A;  1U2W A;  3IV5 A;  3LSM A;  3Q9V A;  5E1Z B;  3ZPL A;  3DTK A;  4CH7 A;  3AAF A;  2DN0 A;  4IJA A;  3S16 J;  2EA2 A;  4F93 B;  2RV8 A;  1Y56 A;  4CYD A;  2WAE A;  3QPS A;  5K7H A;  3M3Y J;  4NB5 A;  4RLF A;  2ZJ2 A;  1T38 A;  1MBG A;  2XSJ C;  4FCY A;  2DA7 A;  4FE7 A;  2W7N A;  2M34 A;  3BP8 A;  3VYT B;  3CTA A;  5CQG A;  2CV0 A;  1Z67 A;  3C2H A;  2COB A;  2MH9 A;  3VYR B;  3OYJ A;  2Y48 A;  4N4N B;  4PK4 A;  5B1B H;  3AL0 B;  2E1C A;  2AQE A;  1QGP A;  4NUB A;  4JX5 A;  3OV8 A;  3WTU C;  1FIA A;  2GQQ A;  1GVD A;  3MCZ A;  5ERI A;  3CCU I;  4OIP F;  2R7X A;  2ZNZ A;  5B5E C;  2M3A A;  5IYC J;  4KA4 A;  4ESJ A;  2CQN A;  2PG4 A;  3VOD A;  2A5W A;  1OMI A;  2VE8 A;  1BR4 A;  1V5F A;  2W84 A;  3BR2 A;  3CUO A;  3V4G A;  1IUF A;  1TLH B;  1ZKG A;  2JT1 A;  4E70 A;  1ETK A;  3DBR B;  1TQP A;  5LBQ A;  2ZJR F;  1W7P D;  3HKZ N;  3OIQ A;  4GRI A;  5D5X B;  3AKZ A;  4ABZ A;  5EGO B;  3COA C;  2NOG A;  4F52 A;  2HFH A;  1XMK A;  1MBJ A;  3V7C A;  1BR1 A;  2Y0S N;  1JUP A;  1UZC A;  3Q5F A;  4XSX F;  2LY1 A;  2QSG X;  1IDY A;  4AID A;  2FX0 A;  3TGN A;  3H0D A;  1E2X A;  2HOE A;  3Q3S A;  2IS6 A;  3JRD A;  3DF8 A;  1MJ9 A;  3LA2 A;  1WQ2 A;  2PN6 A;  3KX2 A;  1R23 A;  2DA6 A;  2FMY A;  2LG4 A;  3M1C A;  4LLG F;  4WK8 F;  1B72 A;  4RAY A;  2Z99 A;  3REO A;  3HJE A;  1NG6 A;  1OR7 A;  1Z7U A;  2DFF A;  2PMZ A;  4NQW A;  5DDG A;  3KEY A;  1FOY A;  4I99 C;  3O8H A;  4L9N A;  2BV6 A;  5A2Q Z;  4G6Q A;  5ICF A;  2E1O A;  4NUI A;  2XAG A;  4G7Z F;  1NG7 A;  2BY3 A;  3MKY B;  1MMN A;  2X48 A;  1O57 A;  2MGQ A;  1Y8R B;  3K0L A;  3A02 A;  2AXL A;  3HM5 A;  1IRG A;  1OYI A;  4OMZ A;  4BAY A;  2QZ8 A;  3WTX C;  3GFL A;  1P9Q C;  2MAB A;  2RN7 A;  4IHV A;  4IXA A;  1XSD A;  3JCU C;  4OIN F;  2KQR A;  1DUX C;  2VJ4 A;  4U88 A;  1VND A;  4LG3 A;  4PDK A;  2XAS A;  2FU4 A;  4Q5S F;  4AM3 A;  5EG0 A;  2CGP A;  1J9I A;  3RZO J;  1FSH A;  2L0K A;  2LRD A;  1U3E M;  2F4O B;  1D1C A;  3B02 A;  3DWL E;  4A3I J;  4XON A;  2NRA C;  2VN2 A;  2MC4 A;  3T5X A;  4HPQ A;  1MGT A;  5D4R A;  3KIO A;  1HST A;  1I3A A;  4HDU A;  2DCE A;  4G8X A;  2K85 A;  2W48 A;  2DW4 A;  2YUS A;  3QAH A;  4S04 A;  3IH2 A;  3LAP A;  2KIQ A;  4E7K A;  4ASN A;  3CMM A;  3VB2 A;  3I9V 2;  1FBQ A;  2BY1 A;  2CQQ A;  1BA5 A;  4AIH A;  5CVI A;  4HNV A;  2R93 J;  2FF4 A;  3H3Z A;  4PJ0 C;  3E6D A;  4I02 A;  4PGH A;  3WU1 B;  2Z16 A;  5FKN A;  1ZLK A;  2CW7 A;  3FF5 A;  2LNB A;  5H6Q A;  1B72 B;  5C4X J;  2YR2 A;  1SD4 A;  3L2R A;  6PAX A;  2Z3Y A;  1JJ6 C;  1F9N A;  1VI0 A;  3PNV A;  5LEJ A;  3C18 A;  2KZG A;  1GDT A;  3FK6 A;  3RI4 A;  3LSI A;  2XF5 A;  2RVC A;  3HTU A;  1XSX A;  1ZAR A;  4HST A;  2G7U A;  4M3G A;  1JKP C;  5KNL A;  3BZC A;  1K4S A;  2PJR A;  1RC9 A;  4I0B A;  4BL0 B;  2P5K A;  1FWZ A;  2FML A;  1WJC A;  1WJF A;  2E5N A;  3BWG A;  4A3K J;  4NHJ A;  1K83 J;  5FB2 A;  1IJW C;  3ASN H;  3CCV I;  2A68 F;  4XOT A;  2P8T A;  1MH3 A;  4RM2 A;  4W97 A;  2WC2 A;  2HPI A;  4DQ2 A;  5EG0 B;  1H0M A;  3PUB A;  3ZQH A;  4Z6Y A;  3H5R A;  5CQE A;  1Q1V A;  3IRR A;  2VE9 A;  3ZMS A;  2D5V A;  2QQB A;  1SVL A;  1YE9 A;  2FNP A;  3W6J B;  2LF8 A;  3IH3 A;  3WOD F;  2MLG A;  4DYR A;  3OSF A;  2LY9 A;  5CVJ A;  4XKC A;  3BJO A;  3DEU A;  3U1K A;  4M74 A;  3RJP A;  2LFB A;  3DLA A;  1Z21 A;  3K9T A;  5JHF A;  3V7S A;  3MKZ A;  4U0V A;  2O9L A;  3H5A A;  1U78 A;  3MKW B;  1Y1W J;  1E3O C;  3JRF A;  2HI3 A;  3FM5 A;  2EV6 A;  4A12 A;  5E3L A;  4CA0 A;  3F8M A;  4AVP A;  4AIW A;  3G3Z A;  3AG1 H;  3R61 A;  4IHW A;  3S2W A;  2KFD A;  4D9J A;  4KIG A;  9ANT A;  4HF1 A;  1K79 A;  3L2V A;  2RC4 A;  2IA0 A;  3TKY A;  5DCM A;  4P27 A;  4IX7 A;  1B8I B;  3K4K A;  4EJW A;  3JW4 A;  2CUJ A;  1KQ8 A;  3D5R C;  3HXL A;  2ELJ A;  2M0M A;  1F43 A;  1YRN B;  4GYG A;  5D5W B;  2LP0 A;  2EIK H;  2EK5 A;  3KP7 A;  1D8K A;  3HG9 A;  3PNY A;  2HU9 A;  2FQ3 A;  2VPL A;  1FT9 A;  2NXN B;  4HZF A;  3KYL A;  2E2H J;  2XF6 A;  4IPA A;  2M9H A;  4IHS A;  1KZH A;  3D0S A;  2DYR H;  2DA4 A;  2XGC A;  4CDG A;  1ITY A;  2PMH A;  3W2A A;  4BXX J;  4MTD A;  2M2E A;  1XSV A;  4IVN A;  2BXZ A;  3RPU D;  3C1D A;  1M1E B;  2Y9Y A;  1ONV A;  1V5E A;  3GEZ A;  3GFM A;  2LH9 A;  1T39 A;  4L0Y B;  1P7I A;  3H5N A;  4F91 B;  2L01 A;  5JI6 A;  4ZYD A;  1IXS B;  2E2I J;  5KAI C;  1CFE A;  3LAJ A;  2L7Z A;  4E7S A;  5F0C A;  1RPW A;  2AO9 A;  3SFI A;  1V54 H;  1KU9 A;  2JVG A;  2E60 A;  1YTY A;  1BOB A;  3WHC A;  3OYC A;  5KHD A;  3RTR A;  1ORK A;  3FBN B;  3DV8 A;  3FMR A;  5F04 A;  4RBO A;  3SEQ A;  3SXY A;  4LOC A;  4GFB A;  2L54 A;  1NK2 P;  1A04 A;  4RGS A;  3ZQL A;  1KU7 A;  5E17 F;  2D2W A;  1HKS A;  2JK3 A;  2HYG D;  3TOA A;  4XOP A;  2O8X A;  5IP7 J;  4P5O A;  2OQR A;  5D4S A;  1TWG J;  2KIS A;  3J81 Z;  3RIR A;  2OF7 A;  4UY8 I;  2DA5 A;  3ML6 A;  1A31 A;  3CC4 I;  1J75 A;  2QVO A;  1D0Y A;  2Y69 H;  3OOU A;  2HTJ A;  3NAR A;  3S1M J;  2A69 F;  2WAQ A;  3Q0W A;  4BHB A;  5H2F C;  1AHD P;  3A4C A;  2XF7 A;  1PP7 U;  5AIQ A;  3A0B C;  3N4M A;  1IC8 A;  2E71 A;  4XLH A;  1PYV A;  1J7K A;  5ILV A;  3S6U A;  3V8K A;  4Y13 A;  3QU6 A;  1W7P B;  3GZ5 A;  2OAZ A;  3ZGK A;  1P6R A;  5IYD J;  3I5U A;  1R58 A;  4MFE A;  3K4N A;  3VWB A;  2V79 A;  3OYN A;  1T0F C;  2CO5 A;  2HQ5 A;  5L3F A;  1BN5 A;  2IW5 A;  1BOA A;  3CCR I;  5E3M A;  2R7Q A;  3HPH A;  2IEK A;  1XMX A;  2XRN A;  4N4O B;  1SMT A;  1ZN2 A;  3CP8 A;  4H0E A;  2Y9Z A;  3L00 A;  3F72 A;  4V2G A;  2W00 A;  2XAF A;  3BJA A;  1I5Z A;  5HVQ C;  1G3W A;  3G73 A;  3QP6 A;  2IGO A;  2ACJ A;  4JBA A;  4EM1 A;  4NC6 A;  4C2M J;  3Q2U A;  3OYB A;  2K27 A;  5DS9 A;  3MQ0 A;  4BDY A;  3E97 A;  4DIQ A;  4HQE A;  1UHM A;  4PJJ A;  3AL0 C;  2VBW A;  5CYV A;  4B1R A;  3PJR A;  2EV0 A;  2L7F P;  2ZB9 A;  2M8E A;  4GCV A;  1ETW A;  2K9S A;  4BU2 A;  1X19 A;  4II2 A;  1OCZ H;  4HEA 2;  3OOP A;  2QQ8 A;  3VOE A;  2YX7 A;  2JZY A;  3R6S A;  5IPA A;  4A3M J;  1O7F A;  1S7A A;  5HS9 A;  5FKM A; 
#chains in the Genus database with same CATH homology
 3S6S A;  3S6U A;  2DDB A;  2A05 A;  1QNX A;  2DDA A;  1XX5 A;  3Q2U A;  4P27 A;  1XTA A;  2GIZ A;  4NUN A;  1SMB A;  3U3N C;  4IFA A;  2EPF A;  3NT8 A;  3S6V A;  4H0A A;  1CFE A;  2CQ7 A;  5ETE A;  1U53 A;  4G2U A;  4TPV A;  3Q2R A;  4D53 A;  4AIW A;  2VZN A;  4NUO A;  3MZ8 A;  3U3L C;  1RC9 A;  3U3U C;  1WVR A;  5JYS A;  4NUI A;  4NUK A;  4LY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...