4F3QA

Structure of a yebc family protein (cbu_1566) from coxiella burnetii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
234
Chain Sequence
b'KWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAIKRGADNLVEVRYEGYGPSGVAVMVDCLTDNKNRTVAEVRHAFSKCDGNLGTEGSVAYLFKQRGLITFPPNSDEEKIMEIALEVGAEDVTTNDDGSIDVTTLPEDFEKIRNAMKAADLNPSHAEVTVLASTEVGLDKDSAEQMLRLTEMLEDLDDVQNVYSNADYPEEVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein CBU_1566
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transcription
total genus 73
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4f3qA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA03
1WJBA 1MW7A 1WJCA 4F3QA 1WJDA 1E0EA 3HPGA 3F9KA 1WJAA 1WJEA 3HPHA 1K6YA 1WJFA 1LFPA 1KONA
chains in the Genus database with same CATH superfamily
2W9CB 2HWIA 2OJ3A 4A6DA 1LWEB 3PL8A 4DUZF 5B0DA 1U6ZA 3BG5A 4J9PA 2M8HA 4DV1J 4K5SA 2OPQB 1LE8A 3PM9A 3DGPB 5AXLA 3KYDB 4JI0J 5GADJ 2JH3A 3OL9A 5FKNA 1N25A 3HCXA 1UPPA 3W5XA 1RC9A 1S57A 2DHXA 4X64J 3NCRA 2DNLA 3IRXA 3GZNB 5CCMA 2DGSA 3LA0A 2QA2A 3PFYA 2YKOA 3S93A 2KFNA 1L3LA 1BQNA 2B9EA 2VKZG 2ZEJA 3M8SA 3CT9A 1VQLS 3V6DB 5K9FA 4G6VB 3J7ZT 1TP4A 1NHUA 1HA1A 1YJNI 2V34A 2H1KA 4A47A 4TU8A 5DDOC 3OR1B 3ZFVA 3ZTOA 1R3NA 1VQNS 2A18A 1JLGA 4FX0A 1OQ6A 1LB2A 3H3UA 1YJUA 2OTLI 2DQRA 3TP3A 2ZVSA 1WOOA 1HBMA 1CC8A 5CKTA 4U7BA 4ZOSA 3M9OB 2I2YA 3T5JA 4ECUA 4B1RA 3G82A 2XSDC 2MSTA 3F8BA 1QNTA 3LA7A 4OHVA 3OUYA 3EZ5A 6FD1A 5H2FC 5CYJA 2N82B 1VBKA 3MEXA 3CCEI 5J2MA 4RBUA 1V54H 2KKOA 3KCCA 3PEJA 2K3KA 4RUBA 3C3WA 3QGHA 2K9SA 2W8KA 1R27B 1OR7A 1PILA 2BE2B 2R7ZJ 3ISND 1YJNS 3OOUA 4Q5VA 3QATA 4NQWB 4NL5A 4O23A 1SD5A 2NPFA 1I3QJ 3UPFA 2DA2A 2G2OA 5CPRB 3MR3A 2HQGA 2OTLS 3SEZA 2C2MB 4ELUA 5F3TA 2BJ7A 1W2IA 3ABKH 3GTKJ 4M5IA 2D5VA 4Y3CA 2ZBPA 2WY7Q 1HLWA 1LW0A 1B1BA 1J9IA 3MM5A 3CCES 4C8KA 3NNHA 1RNLA 3BR0A 3PYEA 5BYQA 2GA2A 1RUOA 1JUSA 5HLIA 2C3MA 2JT1A 3CMYA 4QIVA 2L7KA 2BYVE 4DR1J 3IG1B 2CJBA 3EUKL 2FUG9 1IR1A 3H2LA 2XMJA 3HHLA 3ILLA 2QSWA 2M9HA 2PQ8A 4MKVA 2ZH8A 4AT1B 1Z0XA 2EKNA 1VQYA 4L0ZB 3E6BA 5JFRA 4CM0A 1RAIB 1TV6A 4DUTA 2E19A 1SC6A 4NB5A 2YY3A 2OPTA 3JRGA 3P4UB 3RIRA 3GCXP 5KFYA 4ID5B 3VDXA 4C3JJ 3CCMI 4DEZA 3T5KA 4ZCMA 3CJKA 1U1OA 1Q8BA 2J9DA 5C4XJ 3SDBA 1LE8B 1S9EA 2M7BA 2PX9A 2HYFA 3KETA 1S49A 3DLJA 2QYCA 1R43A 1TAQA 4BJTA 5ADZA 2OF7A 4RNNA 2XO7A 5DM7Q 4NLOA 1UMQA 4RW4A 3HHHA 3IRXB 1JLBA 2BUNA 1R8AA 2E36A 2ZH6A 4QTRA 4G1QA 4FCYA 3GMGA 4ZP8A 2LY2A 1X5OA 1BQNB 4OHWA 1SJ1A 3C15A 2W7OA 2IS2A 1RETA 5GAEI 3I32A 2MLZA 4OLOA 3PHEA 3BT9A 4P2FA 4WFXA 3D1NI 1SQEA 3PG9A 4USIA 4EGYA 2JUGA 2JRTA 2W24A 4BHCA 2VXDA 1SANA 1JLGB 4MJKA 1XERA 3CCMS 1IBLF 3OY9A 2VG7A 3GTMJ 2ZJRF 1SFOJ 2JVRA 2F2EA 3CO7C 4QR2A 4B44A 1HBMB 2F9JA 3HX9A 5DDPC 3F8NA 4NUBA 2DJNA 4KMUX 1FKOA 3VGSA 3DOKA 5E8IA 2CRGA 3G82B 3EPZA 4LMYA 2CQGA 2KRBA 3FXQA 3OUYB 3GVAA 2VBYA 1B3TA 5J2MB 4MK9A 3DEWA 3HFVA 4GO1A 4C0OC 5KFNA 2XASA 3J7AN 5D4LA 1YG2A 4DJBA 4OAYA 5F04A 2V67A 1K6OA 5CYMA 2ZXWH 2VQCA 3QT6A 3HD1A 2QENA 2Z4PA 1NSKL 2V69A 3F6VA 3ZZYA 3ZP5A 1J27A 3NGKA 1H72C 3CC7S 3PZPA 2CV2A 3MEDA 1UVLA 2J8AA 2R2UA 1Z77A 2HVEA 3MMYB 4NLTA 1O5JA 2FC8A 3H4BA 2HDDA 1X19A 4JI4F 1SV5A 1Z05A 3AB4B 3H9JA 5HJXA 4YFKF 4NXMJ 3KK3A 1G4CA 3CCTA 2OELA 2MD5A 1LW0B 1MJAA 1RADB 3LNQA 3MM5B 3OJUA 2QBYA 2E7WA 2BANA 2B7CB 1H6KX 5IT9Y 5K14A 2CO5A 4RU2A 2F40A 3FIWA 4C2MJ 4I4BA 4ZCKA 4X0GA 1HCRA 2HOTA 1S7EA 2IEKA 1Z2ZA 3P7NA 3FK7A 4F0MA 1ZTRA 2WY8Q 2RRBA 3OS0A 2VT2A 1TV6B 1YYVA 3Q9SA 1I51B 1XNQJ 3BDPA 3HOTA 2XZTB 2NREA 2XB5A 5L1KA 1B0TA 4PZJA 1QTMA 5EDWA 2H1YA 3CDUA 1FA0A 3DYAA 3M8PA 5D0EA 4JI8J 4I2PA 3CJKB 2AJ0A 3BKTA 4ZVFA 2HTSA 2ZJQQ 1H9TA 2QF7A 2LVSA 2NSCA 1UVMA 3C14A 1S9EB 3QOPA 1GXUA 1VHIA 4WZMA 2KT2A 2V4JA 3VQTA 4JI5F 3IHUA 4YY3F 4R79A 1ZR4A 2CV1A 2PMZN 4RW4B 5KOWA 1JLBB 3RUBL 4USMA 1FTZA 2RKHA 4G1QB 4X4OA 1UFLA 3TR5A 2FUG2 4GGGA 2X51A 3C15B 5KFKA 2CPYA 2Q0OA 4OYXA 3MKZA 5L38A 3GTLJ 1MMDA 3UN3A 5CHCB 4UUXA 4WXDA 3HUGA 3MKWB 3CDEA 4HL9A 3GWCA 3EZUA 3OPKA 3OXGA 1CQNA 3I59A 2VG7B 3KG1A 3DRXA 2QG9B 4ZLNA 1U0JA 4LF7F 2GXGA 2J0WA 1FKOB 3IV5A 3DOKB 4NPOA 2CVIA 2ZD1A 2Q8KA 2P6SA 2FVSA 3TDZC 3KYCB 1RZMA 2DN0A 3L4BC 2OLWA 2DNPA 2BJDA 2QCOA 3H2UB 1FRHA 4BXFA 1NH8A 1S10A 3H5UA 3HLUA 3W64A 5FKMA 2YWEA 1MNDA 3LOUA 3JAMU 2ZHAA 3WTXC 3FWEA 1TQLA 3SFZA 2HLUA 5KFZA 2QKLB 5CYMB 2IS6A 2WCXA 3S14J 4CZCA 4KBIA 2JA7J 4Q48A 2RU9A 3R60A 4AL5A 2ACMA 2KVQE 3MEDB 1JTYA 1SXLA 1XBWA 3TUIC 2ZB9A 1SV5B 3RAXA 2IA6A 4CO8A 1ZH5A 4KPYA 3ABTA 4AIHA 3KK3B 4DV0F 3BF4A 1W25A 4LR8A 2HQRA 2OC6A 2QBYB 4O3MA 2CZ9A 2E5HA 4LFBF 2IBOA 2BANB 2CWKA 4RLFA 2DK8A 4CRJA 1KOOA 1HI1A 1ETOA 5C3EJ 5K14B 1ONVA 1N8RT 4X84A 2KYZA 1QHGA 2AGPA 3E6MA 4UOHA 3TW0A 5LRRA 5DLGA 2P7CB 2H6BA 4YIIA 2ZXIA 2HHUA 3GTPJ 2W2OP 4USJC 1QJHA 4RS8A 3LPYA 1K4TA 1GVJA 5DS9A 5D4OA 1LUJB 3HHDA 2ZZTA 2PFBA 4NBQA 2OIHA 1S9HA 5T41A 2KT5A 2DH8A 4NASA 1B4AA 4CLTA 5IOYA 5E3PA 3P49B 4I2PB 3M9AA 5IC6B 2K85A 4M3BA 3J80U 1JJCB 3C14B 3FCWA 3M30A 3EXCX 4FYXB 2V4JB 4KFBA 2IY5B 1KN6A 3OYHA 3C2PA 3MKYB 1UELB 5LT5A 4B3SJ 5J1UA 3OXFA 4WXHA 1QVFR 2KL8A 4F3QA 3EPIA 2L4MA 1IC8A 1BM9A 2DD8S 3F21A 3FM3A 1EARA 4P52A 4EUVA 1N4LA 1ZRFA 2P9EA 4JB8B 5F8IA 4ENOA 5LMUJ 2ELHA 1I5OB 4ZP6A 2ALZA 2YX7A 4HZFA 3S1TA 5CXTA 3VYRB 2DHSA 4UY85 3CJRA 3HUGB 4IFVA 4RW9A 1T94A 4I01A 2KP6A 1MNEA 5IT4A 2DK2A 3BSOA 3L7UA 3RBXA 4AUKA 1IWGA 3I59B 1URNA 3IAS9 1R8PA 1B64A 1VLOA 2PI0A 4M8LA 2KIQA 4KIGA 4NCGA 4KSEB 1Q1HA 2OTJI 3K2AA 3BGOP 4YOEA 3KJQB 2ZD1B 4K4XA 5ED4A 1P6RA 2V6CA 1T98A 4WYLA 5EWGA 2WONA 4TV7A 4Q0BA 3HD2A 1RTZA 1VK8A 2R7RA 1YIOA 3BS9A 2QJ3A 5FLXY 1K1SA 5EWFA 4N41A 3BGLA 3PCOB 3R6SA 3GIRA 5HATA 3V7RA 1MZBA 2UXBF 1CEZA 1P6TA 3SEQA 2FLOA 1VTNC 2DO0A 2M0GB 1RDRA 4ZPTR 2HS4A 1KFSA 4XQFA 3KUEA 3EDQB 1Z4UA 3PYGA 4H4KC 1MSEC 2ZITA 3A13A 2EA2A 3E51A 3B02A 3K5LA 1MBKA 4GKKF 2I38A 4LD5A 1RLDA 1S1XA 2OTJS 3OS1A 2HQCA 3BPDA 4CQ1A 2Q6BA 2F4VJ 1WVRA 2DNOA 2L9SA 2V1NA 3H3ZA 1BBYA 2Y9ZA 4B3TJ 2XMWA 2QLZA 3VAKA 4KJIA 2JLGA 2VFUA 4BJ6C 2CW0F 4HTJA 2MYSA 2YKPA 4RGXA 4DBRA 4JI7J 3GR1A 3RQIA 1BIBA 4B48A 3FEYB 2B56A 3J7AO 3BB5A 5E1ZB 3FRZA 4Y4RA 1WPKA 4BWMA 1S0OA 3VQSA 2YTCA 2WTEA 1BMQB 2MQMA 3U21A 2FJDB 4NLYA 2BDPA 3IM8A 4A0YA 3WU2C 2LQJA 5RUBA 4E4HA 1HKQA 1FX4A 1T9TA 1YRXA 2ZXJA 5TRDA 4ESJA 3V6KA 1UAWA 4M9SA 4EJUA 4DR1F 4KNYA 2LDYA 4DX7A 3QSYB 1X3WB 2XYGB 1BUXA 1X2NA 4YB1P 5J2NA 1RKIA 2IVFB 2EWNA 3OYLA 2IFXA 4ENKA 5L9XA 4G6DA 1SQGA 3M30B 4OINF 2UU9J 3BCBA 3UNGC 4F7VA 4GXOA 2FLLA 5GAEU 4KFBB 1IXRC 2NPIA 1IKYA 2ZUGA 4U0WA 5CH7B 1C2PA 4LF4J 4P71A 3RGIA 3TUPA 2RH3A 1S4EA 3O1LA 1Y7PA 1RAGB 2H09A 1GLNA 2HEKA 4AL6A 2Z1DA 4D5FA 1Z3YA 2RD5C 4K4YA 3PXGa 5J4VA 1UPMB 3Q5FA 1TFWA 4KKOA 3ERMA 3JRDA 3VODA 2GJFA 3CJRB 4BE0A 4IFVB 4RW9B 5DDGA 3DPLC 3MEGA 1K4SA 1FD8A 1VDHA 1RWUA 3RKWA 4FBUA 1FXDA 3J81U 2G4BA 1WHVA 4JBCA 4NCGB 1F9NA 3Q0AA 2FGCA 4E2FB 1UZCA 2DA7A 2HZTA 3JW4A 2I9SA 3OFHA 4KV8A 3D0HE 1B99A 5KFBA 5EWEA 4AQYF 2WONB 4NYZA 4OYAA 3DFGA 4NCAA 1WF0A 2E71A 1VGYA 1EHWA 3F6OA 1U24A 2JHEA 2XHWA 4NA1A 3LGHA 4LLGF 5F3ZA 3HOZJ 2HXOA 2NNNA 2AU0A 4DL6A 1XJWB 1RUSA 5D6EA 3K58A 4AC0A 2CZVC 1FIAA 2MZRA 4DJAA 3BC8A 1DBDA 3R0AA 1YKWA 3VGTA 4CM2A 3RAMA 1HW9A 1BW5A 5DYMA 4I2OA 1JXSA 3E97A 4C2TA 1QO0D 1S1XB 3G9CA 5IQQA 3IAS2 1G2HA 5GTIC 2AEJA 2M5YA 4DYCA 3POTA 3LSPA 1IO2A 4CDIA 5EDNA 3G6EI 3KIOA 5K5RA 4J9SA 2DNHA 3NOCA 5F27A 5GTHC 4P55A 4LF8J 2LCWA 1NAQA 2LVWA 1VQKI 2BM0A 1SL1A 2EPIA 1X4EA 1GXLA 3Q8UA 3K4NA 1S76D 3PR4A 2XUBA 4TYBA 3IBFB 1DP7P 3MMCA 4F0HA 3KLHA 3W5YA 4HNVA 2XLKA 2GIVA 1O8BA 4B17A 1HBOA 1T9XA 4LF6F 4IG0A 1IBCB 2X85A 1B7FA 4FF4A 4AXIA 3W5ZA 3R5CA 2JSCA 4CYCA 3MCSA 3DLHA 1WSRA 4O4RA 2P2CB 2XS2A 2I0XA 3KLFA 1PYVA 3ZMDA 2W4PA 4WBFA 8ATCB 3L09A 2MY7A 2XAJA 3PRBA 2V79A 4E7LA 5KFLA 2LYCA 1PP8F 3IR6B 4WK8F 3T19A 2FE3A 1Y10A 2UZAA 4NLQA 2VG5A 2QT7A 3G6ES 1VQ4I 2F5CA 3OIOA 3GFMA 2Y3YA 3Q8YA 3JAMZ 4K0KF 2DT5A 2BKNA 4IXAA 2YWFA 3ZNUA 2H65B 1VQKS 2PA3A 3C2BA 1B72A 1IKYB 4DF4A 3I0RA 3FKBA 4DV7F 4FISA 4P10A 2MKHA 3MQ0A 4OL8A 2R7FA 1U49A 4QZVB 3BG3A 4ELTA 2OPSA 4QU6A 1UETA 2FBHA 1ZG1A 2FZKB 2WHOA 2I8EA 4ZJOA 2K3FA 3H5XA 3DRPA 2VC1A 1SJQA 1OSDA 4KKOB 1IRZA 4ZVSB 2IHR1 1L3TA 2CVEA 1V5IB 5CD4A 3CO9A 1D09B 2M4GA 5CVUA 1ON1A 1HSJA 1OYDA 3NAHA 1F5TA 3NWSA 1TUVA 1XMKA 3MEGB 4ZMMA 1D0ZA 3W7BA 4FXVA 1K73T 5FLXK 1VQ4S 1D1CA 4MLOA 2V1DA 2BJEA 5F0CA 4QWDA 1JE8A 4JI2J 1XS9A 4NYOA 3NLCA 1SJ4P 2ZC2A 5BR8J 2U2FA 2XY6A 2Z8QA 4KV8B 3W6KB 4GKJJ 2DVIA 1O3RA 5A8RA 2CPJA 3V7SA 3S16J 1RT4A 1JMTA 1T0FA 2E60A 2ZH4A 2ZJPF 2JA6J 3EX7B 5FRMA 4NHJA 2MLGA 1HW2A 1C1CA 1LEOA 2YKNA 1DPUA 3F8MA 4XLEA 4NOHA 4RLEA 3KEOA 1OCZH 3J80Z 2BOLA 1AT1B 1U6GA 2KG1A 2IDLA 1FERA 1S9GA 2DNRA 4LLLA 1MDMA 2VFVA 1NJZA 1UJ8A 2LTPA 1FVSA 3POTB 1FFSB 1RWXB 2I1RA 1P27B 2AX1A 2BA9A 2FJ1A 3IAM9 1R0AA 2WB1N 5D4NA 3RPQA 2VJJA 2RDPA 5F0FA 2O1PA 2XNQA 2AHOB 4BBRJ 1W36D 2EFGA 1Q81T 4B9SA 3K7AJ 2D69A 3LA2A 3VSKA 3GXOA 1NJWA 4KH0B 2RAEA 1K0VA 7AT1B 1S29A 4GRIA 3L2WA 1U8WA 4YFUA 3MAHA 3KLHB 4DYRA 4DU7A 1T9UA 5IS2A 1HBOB 1AROP 2OKQA 3U1LA 1OCRH 1XGMA 1YSJA 2WTFA 1KQGB 4NLGA 4CYCB 2HRTA 4PZVA 4JI1F 4MMOA 3GYXB 5HNHA 5KT2A 3FMWA 3NWRA 1T33A 6AT1B 1IZ1A 2CNOB 3ULQB 5BJRA 3KLFB 1LFWA 2DA6A 4OYZA 1S72I 3ITHA 4M3EA 4QPTA 3OYNA 5HLTA 2EZKA 4DPUA 4KN7X 5IP6A 3HRSA 2NOJB 3HSDA 1FJCA 1OQYA 2VG5B 2DCUB 4TY9A 3OL8A 2HU9A 1FD2A 2ASDA 2V8HA 2O6GE 1QY7A 2OPRA 4C7QA 3QYEA 2VA2A 3MCOA 1FEEA 2JMWA 2WAEA 3GF2A 4OZ2A 5KOXA 1B72B 3I0RB 2DDAA 3HFKA 4BQQA 1QAYA 1O7FA 5HNFA 2KHMA 4LK0F 2XPUA 2V2ZA 5BYRA 1QSYA 4L9VA 1RYSA 2C28A 4K4VA 2ECCA 3UE2A 2VG6A 2MHNA 2HK2A 1MBFA 2OZUA 2V94A 4EZ6A 5EGOB 2F8EX 3GV7B 3DRPB 4KGMA 2D7SA 4KPCA 1X4BA 2OFGX 2A5WA 3SZGA 4N56A 2E7VA 1S72S 5FJ8J 3TA2A 2GOMA 3A8JA 2PG4A 2XMUA 1BW6A 3HJEA 2NOGA 3KP2A 1IRXA 3HYIA 3OYMA 2MHEA 2ZOFA 3D6FB 3WDOA 2RHQB 2M7SA 2LMDA 1SVLA 1SC7A 4CLWA 4PXDA 4P74A 2VPZB 4JI3F 3CTAA 1LQ9A 1T95A 4HLYA 2A07F 1V5FA 3ASOH 2A05A 4LLNA 3CCVI 2MKKA 2FVCA 1APSA 1HQ2A 2VHGA 2CQXA 5A8RB 2DK5A 1RT4B 1ZZNA 2MSYA 3G1OA 3OFGA 4DV2F 2PFFB 3ET6A 3OYIA 3HDDA 4P2XA 1WH5A 5DG8A 3M32A 3R0JA 3QQAA 4JX6A 3SZPA 2DHHA 3BG7A 1C1CB 2H5JB 3NARA 2YKNB 2FQ3A 4CSWA 3ZZRA 2M2BA 4HF0A 1MWYA 5H9EK 1NTCA 1QAIA 1UCNA 1MMGA 3SZTA 1UVJA 4KHMA 3HVTA 3CJ3A 1MDMB 1HWIA 4QBUA 1MWZA 4RUHA 1X1BA 4KITB 3MD2A 3CCVS 2VA3A 2K9NA 2DNGA 2VPYB 1R0AB 2UVVA 4FBTA 2KMUA 1OLTA 1HD1A 3M7GA 2XGDA 4A8KA 2KFDA 3BP8A 2ISYA 2DIVA 3IGNA 3LF0A 4X62F 1NK8A 3ENQA 3TVKA 4DX8H 1WTBA 3DN9A 2CUJA 1WG4A 3GCMA 1USTA 3IL2A 4B3TF 4PABA 2ZFHA 2R7WA 5FKLA 5F9LA 3SCLE 4DPTA 2ISZA 3I87A 1QZYA 1FBSA 2YU9J 3ITHB 4NLXA 4TXSA 1LW2A 2YU3A 1IR2A 4NLDA 2GCFA 4DUYF 3WQPA 3GFJA 1C1BA 2XGXA 4GYGA 2C3YA 1ZYRF 3K2ZA 2HNDA 4H54A 1MH3A 3WTZA 1YS7A 2Y8YA 4HYEA 4XPEA 3WG9A 4BQOA 1YW8A 2OPRB 1TK8A 3OTOJ 3IAM2 5KFFA 1UZHA 1GT0C 4RGRA 4F55A 4R0EA 4ER8A 1FP2A 4UVCA 1FJ7A 3HVRA 1S5LC 1YLFA 2NXNA 3BOQA 2EBEA 1JUMA 4ANJA 2F5GA 4DR7J 2VG6B 4OU0A 3GFZA 3D9BA 1U45A 3QJLA 1FDBA 3DEUA 3PFEA 2K3IA 4HNUA 2Y1JA 3BO2A 1U47A 1PC5A 2ZBIA 1MIJA 1NDPA 4QWEA 2FJVA 1RZ4A 2UU9F 3ELHA 2Y9HA 4FP9A 1W7WA 5ETQA 2XLIA 1YQHA 4LOCA 3IH3A 1QTNB 1F1BB 3DOLA 1W0TA 4HRIA 3DMJA 4F91B 3IA0A 3MM7A 3N5BA 5IYCJ 3CJ8A 2UVRA 2EPFA 3T3FA 2R7XA 2MLXA 4ZP7A 1P7IA 1HBUA 2WWYA 4HBLA 3BM7A 1FOWA 2XKPA 2F8MA 1Z2LA 4X4PA 3R1LA 2MEWA 4HLXA 4CLUA 1B9NA 4FE4A 2HHHJ 1BI0A 1H8AC 2JNJA 2QZ8A 2VL8A 1LK5A 3M32B 5DM7F 5KFXA 2YKMA 3IS9B 5HLFA 4P2SA 5IT3A 2QL7B 3ZXSA 1KYWA 3KUHA 4WIQA 5HJYA 3GFXA 3FDYA 2CQCA 3KZIC 1DJ0A 5EZGA 3TA0A 5K5OA 2WAQA 4JI6J 1LWXA 2YNHA 1H0MA 5EN1A 3HVTB 5ETTA 1SAUA 2Q66A 3RBZA 1WWHA 4LF5F 3QPSA 2HKEA 3IM9A 3MMBA 5FO5A 1FYLA 1HQEB 1EETA 3G8QA 3QWLA 5FD5A 1ROFA 2OQGA 3LUYA 4X4VA 3MM9A 4DGWB 1U09A 5DGAA 4DPYA 1HQCA 1TP7A 3AJ1A 3WZ0A 2EV6A 4D5CA 3JQJA 1HNXJ 2RV8A 2EBGA 4OQJA 4BC7A 4L9NA 1YTYA 1UFWA 1HWUA 1DQ8A 3BZCA 3G71I 1OKRA 3GSDA 4MGRA 2IJNA 1ZGAA 2HHTA 2XDVA 4G7ZF 4WE1A 4ESBA 1EV7A 2C2NA 5JVGQ 1S1UB 3DWLE 2HAIA 2XYHB 1XMXA 5THWA 5HDKA 1LW2B 1S12A 4TVAB 3ZCOA 2XAGA 4EVIA 2CNNB 1P4AA 3DFEA 3JRAA 1REVA 1C1BB 5ICFA 2RGVA 2HNDB 1H73A 2DRDA 3P9KA 1ZG5A 2DR6A 5A2QU 3RB3A 2EA4A 3CESA 1O3TA 1P92A 1RAJA 1I1GA 1TWFJ 4CNZA 3QLHA 3I55I 4MTPA 1C4AA 4PWUA 2NS7A 4XONA 1NK7A 1JTXA 2NXNB 4FF1A 9ANTA 3G71S 3JTHA 3K8VA 3SV3A 3FRYA 2X3DA 2BJ1A 2J6SA 1JUPA 2GNKA 2R7SA 1JJ8C 1FNXH 5HS9A 2L7MP 4ETZA 4RNHA 4U9RA 2UUWA 4V1Ak 4D3HA 3A3NB 3B6AA 4G65A 1UHWA 3LAPA 5HLHA 1Q7YT 1GX6A 1VK3A 3KHGA 3RJPA 3SV4A 3DOLB 3DPUA 2HFNA 2K9LA 1LFPA 3DMJB 3MM7B 3I55S 4B9MA 3WE3A 2Z2ZA 3I4MJ 1TZLA 3OD2A 1HBUB 2F9DA 2WBRA 2D3OR 3FSYA 3PQKA 2ZJQF 4I0WA 1FYMA 5J1PA 1GQEA 2KFZA 2DA3A 1BI3A 3Q8VA 4J37A 3DLKB 3FHNA 3CCRS 1P7JA 5F9NA 1WTFA 2VF3A 2YKMB 3H7HB 3PQJA 4FVMA 5HLFB 3D1HA 3SSRA 4ZDPA 4JI2F 4ZPVR 3A02A 3GIIA 3G1LA 1ZETA 4ZDNA 2KQRA 2DMQA 2QSGX 2RQQA 4M6YA 1RQ0A 5EX0A 1OQ3A 3MFIA 2R8IA 2YNHB 4C2MA 2CA9A 2E2HJ 2E1NA 1I94F 3KPHA 2BQUA 4M5NA 3OYDA 3DKYA 1Q8IA 3MMBB 5HQ8A 2HYJA 1S1TB 1EETB 1W5CC 3NMAA 2RNEA 4QSHA 2ZC3A 3HHLD 1IGNA 1SH3A 3MM9B 3L2VA 5KFVA 3FXOA 4Z6YA 3AH6A 4NMXA 4C0BA 1CPZA 2EB7A 1IKWA 3BSCA 2GM4A 1E3OC 3QRPA 3VAJA 2PMUA 2FQQB 2MZJA 4Y0FA 1TK0A 3N05A 3EUAA 5JHFA 4WFBQ 4BBYA 2CGPA 2LP0A 2M30A 1BC6A 3OVBA 5LOQA 4WIIA 5E8GA 4XNFA 2IDEA 5F08A 3PV8A 1TMJA 1REVB 3ULHA 5J2PA 1OS5A 4F4KA 2Z16A 3JAMY 3HM9A 1VMBA 2HBRB 4YR0A 1NRKA 3TVYA 1OCPA 2XROA 1EQMA 3E5UA 2VFTA 1Z67A 4PJJA 1NEEA 2XKOA 5HSPA 1U1QA 3SIPB 4DL0C 4C3LA 4JV2A 4H4KA 1FK9A 3LAJA 2DYAA 5L3DA 4KIFA 3GB0A 3N6MA 2J9CA 1VQMI 3H4DA 2DEJA 2JSXA 1PG5B 3IR7B 3L7PA 1XNRJ 1GVDA 2FOKA 3O3KA 3IH2A 1XB4A 2ROPA 4J9QA 4XRMA 2M34A 2LRDA 3PSIA 5HMYA 3MD3A 3LSKA 1W5SA 1FIPA 4F50A 2B63J 5B08A 4Y7NJ 1EB0A 5AONA 3AG1H 1XGOA 2F4MB 4B9NA 4M94A 1NJXA 3MXHP 2HKXA 2PI4A 1TR0A 1X60A 4EM0B 3D6HB 4XLCA 3PX6A 3CD6S 1K1QA 1D1UA 2W4SA 4PYAA 2JX2A 1HMVA 4MKYA 3FBNB 1RE1B 3ABUA 3GFYA 2L7FP 5HP1A 4DV3F 1A7GE 1SAXA 1JXVA 1VQMS 4U6PA 4A8WA 2CNKB 2DFFA 1G59A 2VUMJ 1BQXA 2BY1A 4J9LA 5JHUA 2FEZA 4WP8A 4L0YB 4UHTA 3J7AY 4M5HA 1RKTA 2CIMA 3OIQA 2MQNA 4Q44A 1Y8QB 1VISA 1KQ9A 2LFVA 2OAUA 2XAUA 3S1RJ 1APLC 4R0JA 1Z21A 3RTVA 4JOMA 3I0SA 3CJ2A 3LOCA 1M5KC 1ZA1B 3RBEA 3D5LA 2JWNA 2GGPA 3H20A 1Q79A 3K0JA 3L9ZA 1UA1A 4N8OA 5LXRA 4U0YA 1IAWA 3D2WA 1SC3B 5H6QA 4HACA 2BVZA 1Y1WJ 1WG5A 4M1KA 2XTJP 4OI0A 1EA3A 5GAHI 3DHXA 2GIFA 2JLEA 3WGIA 3T1BA 4MO7A 3R5JB 1UWAA 1YIJI 1IKWB 4HQEA 2KYXA 2H27A 3HTSB 1F2GA 2E5GA 2KXFA 4LR7A 3X1LB 3BPSP 3E1SA 1R1TA 1NH3A 1WELA 3OL7A 1T0TV 2KXHA 4GO5X 5HROA 3R2DJ 1YW7A 2R7QA 2BBEA 3U27A 3MFKA 4USKA 2RQPA 3TAQA 4IHWA 3QYFA 2FD2A 4OX9F 1CJKA 2UXCJ 3TBIA 2V7FA 1JXEA 3I5CA 4F7ZA 4LRFA 4WTOB 1KD1T 2C6YA 5J2PB 4DR3J 2QQBA 1S6QB 5IT9U 1ZRCA 1KVJA 1KBRA 2JEIA 2JC1A 2OHDA 2V9VA 2PO4A 3M1VA 4IG3A 3CF5Q 1VQ8I 3DPTA 4YDXA 4HPQA 2FRHA 2DKOB 1YIJS 2R8HA 2JRMA 4F4XA 3EICA 3ABLH 2NUHA 1MBHA 2DFEA 1MN9A 1P4XA 1NJYA 1FK9B 5AJ3F 3F0CA 1ZBTA 2DITA 4ON0A 1RESA 2JJ7A 3V6JA 4M74A 1RAHB 4WCGA 2DH9A 4WKYA 4RBTA 4ZVEA 5B0AA 2E5LF 1KQSR 2L7ZA 2MC3A 4P72A 4WTYA 1P8GA 4I6WA 2XM3A 1HR0F 1TC3C 3Q24A 1U02A 1RTHA 1XCVA 2DO4A 4WWCA 4NXNJ 5F6FA 2O8KA 4OHXA 1S7HA 1ELOA 4OZ5A 1D5YA 2G0CA 3R2CJ 2CMPA 2Y69H 3ILJA 2F7VA 4C8MA 1ITPA 2NUUG 2PEHA 1RYRA 3NL0A 2DA1A 2ZH2A 4WFAQ 3FQKA 1R8BA 5KFPA 3BO4A 1VQ8S 1IDYA 1HMVB 5CZVA 5ICGA 1MBEA 4OYBA 2UUTA 4F26A 4B3AA 3BR2A 2FX0A 2L5QA 1WUUA 4K4SA 4A8XA 3JREA 2MZTA 5HMWA 5HP1B 5F8GA 1LFUP 4DR6F 4GC6A 1U26A 4CT8A 3NKYA 3B54A 5K7ZA 4URGA 2F5EA 2XF6A 3MR6A 1X4DA 3RRHA 5HDGA 5M2RA 2W85A 5K8NA 5KFCA 3J7Z5 4LG0A 3UW1A 4YRVA 4HTIA 1RT7A 5D4SA 1FHTA 4YHHF 3F3XA 1N5SA 1UCRA 3M07A 2B8QA 2RQCA 2AEMA 3I0SB 4EMSA 2XBPA 4ZZLA 3RI4A 3OHBA 5A2QZ 2HOAA 1LEAA 1KRPA 3ICLA 2RQ4A 2GGPB 5CAAA 3S32A 3V42A 1Y4ZB 3CDHA 4LGWA 2HQ3A 2DY9A 3WIUA 3ECOA 2MC4A 4ZIVA 5KTQA 2H9ZA 4HACB 2CYYA 3F9KA 4MKBA 2KG0A 4DU8A 4DQPA 2K1RA 4FYDA 1VBXA 1X9MA 2OAZA 3IKTA 4C3IJ 1XX5A 4BWJA 2RDIA 4K4TA 2RF2A 4IEJA 3HOUJ 3PKMA 4NA3A 3J7YJ 3JAMK 3R7SB 1Y3JA 3L9FA 5K8MA 3KFWX 1RWVB 3BQ2A 3G2BA 2CQIA 2CSOA 1IG7A 3ZXWA 3HHKA 4KR0B 2HS3A 1LDKB 3WC2A 5IOZA 3D5SC 2HMIA 2LDUA 3H9GA 1OJLA 1HWJA 1MMNA 3RYRA 4LFAJ 2OD5A 2Y0MA 1F6TA 4ECZA 1KSPA 1CJKB 3DDNA 2HFSA 2ESNA 4EBDA 2EC2A 4HT5A 1J5EJ 2LK2A 3K70D 3JQKA 3P96A 3AL0C 2LY1A 1IM4A 1VR6A 4PK4A 1Q16B 4N0BA 4QIWD 4K4UA 2LLZA 4IG3B 1KKHA 4IDKB 1FXLA 4ECSA 2YVSA 4ENNA 2KZVA 3Q0VA 3SDGA 1Q1KA 3IRWP 4OIPF 2J7KA 1VS3A 4DYQA 1VC5A 2YQ3A 1ETYA 4WU2A 4DR4J 2VPRA 3MI7X 3PRVA 1YJ7A 3D67A 3LSGA 2DW4A 1S99A 2DB1A 1N5VA 2A6MA 2YWHA 1RHJB 3C7JA 3M3YJ 3AQOA 3SSQA 3KLVA 1IN5A 4A5MA 2D74B 3N6NA 3PJWA 3UDLA 4A0ZA 2UXNA 2DISA 1RTHB 4ZLLA 1U5TC 1BE4A 4ZN1A 2N8GA 4CLYA 1R71A 4NZ6A 2BM1A 2L3MA 3GV8B 3OT9A 1NG6A 1NUEA 2KH9A 3CMEI 3L2RA 3V81A 1TVRA 2DMPA 3DLEA 1DGRM 3Q0UA 5FROA 1CF7A 4IOBA 2IPQX 3MCMA 3RYLA 2RDJA 3CCLI 3CMAS 4I98B 4Y6IA 3J80K 1OYWA 2Y0SN 2ZBCA 3ZQ7A 1T38A 2PC6A 3KDOA 4DHVA 1OYYA 4ZN3A 1FKPA 4PR6A 1IV8A 1S6LA 1PYTA 1JKPC 3UDEA 2E7XA 1I6HJ 4LG0B 4C98A 3RAQA 4Y2CA 5GADI 1N34F 1RT7B 2HG4A 3EDRB 1HI0P 2CQQA 1JHFA 3CD7A 4O5VA 4J91A 4I1TA 1R5ID 4XDDA 4U8VA 4QR1A 2V2VA 3IFEA 3QT7A 2M9KA 5C42A 4RWWA 3OTBA 1DU6A 1F3FA 1NK2P 3QIDA 4IO1A 3AG4H 4HF1A 2BX6A 4DR5F 4E0DA 1LNQA 3TW7A 5BYSA 3VV2B 1WORA 3QT8A 4OIQF 1DZ5A 1KFDA 4RGSA 2NVXJ 4CI0B 2XQCA 5KG7A 2MYFA 2K1RB 1FDDA 5J2QA 3B78A 4O3NA 3DV8A 1EIYB 4A3DJ 2IJFA 4FKXA 5FLXU 2RF2B 4AE5A 1X7VA 1MN7A 5L1JA 4J90A 2K27A 2W1OA 3G87A 5IT0A 2BEOA 1CSJA 3UVJA 1V6HA 2EG1A 4IO9Q 4F4YA 3KNGA 2VKHA 1FTTA 2RHSB 3V5RA 2JWTA 5FKOA 2K06A 2IBKA 1FLIA 4EJVA 2VJ5A 3G2XA 3U2RA 4CDGA 1FKAF 2L0KA 3HSEA 4DCJB 3VVTA 4ED4A 1MJ9A 2HMIB 3H5SA 4JV5F 2GMHA 4LSLB 1WOSA 2HRUA 3ZQQA 4NEYA 1UHSA 5IY5H 4Z37A 2AHQA 2MG4A 2GX8A 5CLSA 2XZDB 1IN6A 1NDCA 3H42A 1WJEA 4DIQA 4FYYB 1T39A 3QGGA 2KM8C 2XRLA 2BOPA 1MMAA 5A0YA 2H5EA 3LMMA 2IM0A 4OMYA 2HLTA 1AYEA 4UT4A 2BE5F 4LFUA 5HI7A 5K7FA 2XF5A 1H0HB 4USUA 1YHQI 3RW7A 5ETMA 1RGVA 4N9IA 3VGUA 3C2GA 1F5BA 4MEXF 2K7LA 1UMJA 2YKQA 3V4GA 4QWBA 3TKYA 2LEBA 3HPOA 3CQZJ 1FT8A 5LMNJ 4EEYA 3M6UA 3VB2A 1MW7A 2DQLA 1NLKL 1VJQA 3C3LA 2BBYA 2FLPA 2PJRA 2XF7A 4QLCU 1NHAA 4R25A 2EFQA 1ULYA 5I4MA 5F8MA 1CULA 3Q89A 4KMFA 3FBIB 2LYVA 1JGSA 1XGSA 3LANA 1OMIA 4CO4A 5IPAA 2W7AA 4BDPA 1TQMA 1XDSA 1XNRF 3V81B 2ZH1A 1TVRB 3KNAA 3DLEB 3IO1A 2WC2A 4ILRA 1P2FA 2O66A 1OY6A 3MM6B 2DNQA 1K8AT 2YXLA 4C3HJ 1PUEE 3DBLB 4HVZA 3WODF 2E44A 3P3DA 3EPGA 4J9RA 2ESHA 2BEFA 4DCPB 1YG0A 2BGCA 1OO0B 3NRVA 1JWWA 1AUDA 1IXSB 1FKPB 5B0BA 3ZQFA 3RDIA 2KFYA 2UUBJ 4A3IJ 1FX2A 5FLVA 3CCSI 2DT9A 1FVQA 3L2UA 2CPDA 1HA8A 2UXDF 5B3SH 4BDZA 4FXDA 2DR9A 4X4NA 4Q7AA 1S5ZA 5C42B 3TO9A 5IT9Z 2FZGB 3E2EA 2A68F 2R4FA 1VCTA 2KRHA 4RU9A 4USVA 1JLCA 2VV5A 2Z30B 1TAUA 2OA4A 3IWFA 2VKRA 2GA1A 4DV5J 1YQAA 1NO8A 3TJAA 1O7LA 1IBKF 3J7A1 3ZZTA 1XR5A 1SD7A 1YI2I 2EIKH 5JLWA 2MY8A 1P1TA 4CUGA 3AODA 1M1KT 3THPA 3G8TA 2D3ZA 2NVYJ 5KNLA 5J8FA 1R00A 2UUZA 1TL3A 3MFHA 3GFLA 1TL5A 2DRAA 1U2RA 3UVJB 2WA0A 1FF2A 1PGZA 2IVMA 1I27A 3PW5A 2U1AA 1JNZB 2XHKA 2LF8A 2D3O1 2ZOGA 2QN6B 1ETKA 3PUFA 4J19A 4ZZDA 4N77A 4UW2A 2JZYA 3N6LA 3DU5A 4A3LJ 1L3KA 7FD1A 3O8WA 5M5YJ 3R5GA 2O0YA 1YJ9I 2LKPA 1NPPA 1WC0A 3KZYA 3PEHA 2F5FA 2P4WA 3R8YA 5A0YB 2P9CA 1WD6A 2H51B 1B8IA 1IKXA 2OGUA 1LPQA 5FJ4A 4OIOF 4Y28C 4DW6A 1I6XA 2TCTA 2QWWA 4CYUA 1VQOI 3MWBA 4M5LA 1POGA 2AX0A 1TL7B 1XTZA 2LQ9A 4F2SA 3KDNA 2LC2A 1J5OA 1YRUA 4QIEA 2FPHX 4ZC3A 2C42A 2CS3A 2D1CA 2Z33A 4FETA 1ZAWA 5BPDA 1S1WA 4U96A 2PJRB 4HEA9 4G7HF 4BY1J 1JHHA 1FSHA 2VIHA 1TTYA 3N79A 1AHDP 3T1YF 3LSMA 1D3WA 1NKCA 2MFZA 3QPTA 3T8RA 1MNMC 1CULB 2Q1LA 4WFYA 4CTAA 3MM8A 2STWA 5EEAA 1HSTA 5D8LB 2OV7A 1NKBA 4B3MF 1WC3A 1I6JA 4LR9A 2ZNZA 3WX4A 2HAFA 3M1EA 4EV0A 2G0JA 4WXWA 1TQPA 1U8RA 5ETNA 5GAGJ 3E5QA 3ZZOA 2MPUA 2NCKL 3N9UC 3BR5A 3IMQJ 1NH7A 3R9LA 1VQOS 3GQCA 2VQEJ 2DDBA 4QR0A 1RHKB 2Y1IA 2LMIA 4NXNF 3TYTA 1M5PC 2MQPA 2CU7A 1IXCA 3NBPA 3F8CA 1DUXC 3MGJA 2G7HA 3US5A 1FE0A 5LSOA 4I69A 4WF9Q 3OSGA 1VC6A 2XB2D 3T8TA 3ZC4A 4K5RA 4M3FA 2DHAA 4RAFA 3GTOJ 1YITS 1VOMA 3KHLA 2AJ2A 4LBPA 3PO5A 1WH7A 2XAFA 3GMEA 1EKRA 3EGWB 1Q53A 4K7QA 3MMJA 3AXKA 3TAPA 2B0GA 4KICA 1VI7A 3OSFA 4KTQA 4QOTA 4HX8A 2WBMA 2EJRA 4XO0A 2KPMA 4B9LA 2LG4A 2V9WA 2JVHA 4IH5A 1JLCB 1WJ9A 3GFHA 1Q5YA 2RUGA 1IN4A 4CH0S 3FBBA 4I56A 2PMWA 2VQFJ 1RABB 2AYEA 5EZHA 1VQ6I 2LREA 5KFUA 1TBXA 4HH0A 2BXZA 4DX5A 2VODA 4PPZA 4OI3A 2EZLA 3RB0A 1F43A 4Y2AA 3P9CA 2QL9B 1TL3B 2ZUAA 2KL4A 2AZ1A 3W3CA 4HLBA 4PXEA 2VOOA 3OV8A 4F02A 3IH4A 1H74A 1MSFC 1SJ3P 4ZP9A 2GAGC 4XIDA 5J1EA 1E3HA 3NGDA 3QAEA 4U7UD 4BL0B 4OX8A 1A0OB 3FCHA 1QAJA 5EEHA 1URRA 3BV8A 2BY2A 1TNSA 2MQOA 5D8KB 3PSFA 4UV8A 1HBXG 4M5MA 3MVPA 3HEFA 5MAOA 3BZKA 5U47A 1ZTTA 4OJGA 4DQRA 2PEBA 5KG2A 1B8IB 4RUAA 2FSWA 3L1PA 3IWXA 2G0EA 2XMKA 1VQ6S 2JFKA 4PG6A 3HM5A 2GIQA 4X4QA 4A46A 2LXFA 2ICWG 3TUJC 4CYUB 4IRIA 5C4JJ 4B3RJ 3DHWC 1WDDA 2RC4A 4IRGA 4CYDA 3B4DA 2ME0A 4LFAF 1D0XA 4J9NA 3E0JB 5JVTA 5MLCV 1J5OB 3CVKA 1CQTA 4HSTA 1UZDA 2LU1A 1UW4A 4IJAA 1RPWA 1S1WB 4LFCJ 3BCAA 3MZHA 4PXBA 3I4PA 1JI8A 2AQEA 3A3OB 3HJFA 2CQKA 2JDJA 2O8XA 3RBDA 3S2HJ 2DNYA 2Z2SB 4ZPCA 3BWGA 2YQ1A 4CTAB 2QVOA 3MM8B 2J8SA 1JXLA 5AXNA 2L48A 2ROEA 2VPXB 2BY3A 2VOPA 1CC7A 1BR4A 4LG3A 3KHRA 3H92A 4QPOA 1H7XA 2R42A 2PN6A 5M3FJ 1UA0A 4LQ3A 2EEYA 3DKXA 3W2WA 3E3VA 2Y9YA 3KK2A 1G3TA 1SD4A 3OR1C 1YK9A 4GMKA 2VH7A 4I6ZA 4ED5A 1I39A 3ENAA 1VNDA 4L5JA 3AOCA 3N0VA 3NBPB 4EJOA 2XMMA 3PY8A 3JSPA 3SMZA 1FRKA 1G4DA 3BEGB 3H5RA 3ZNJ1 2AYGA 2WVCA 3EYZA 1FFWB 4BJ5C 3IUOA 1KHVA 1SIZA 2WB1A 2EWHA 2FB0A 2HURA 2EV0A 5HAOA 4HEA2 2AT1B 3Q3SA 1Y0NA 1FJGF 3PFIA 5M2UA 2IA0A 1TL1A 4WP9A 2YNGA 4XSZF 2P81A 4O3RA 2DXEA 4A3GJ 2VBZA 2P8IA 2D45A 2CUYA 3W66A 1STZA 4K4WA 2B7BB 4TN2A 5AE2A 4F67A 4YEAA 4EBCA 5HLGA 1S6OA 2CW8A 2C2EA 4FHTA 2KLOA 1JGGA 5F0WA 4NYPA 3T1HJ 3HGGA 2GMJA 3SFGA 1N52B 2ELJA 1QSLA 1JB0C 3P5BP 1M1HA 2GXAA 2J0XA 3ETMA 4DMZA 2XZWA 2DNZA 3AT1B 4KGZB 4BYYA 1N5TA 3AHPA 4V2FA 3I82A 1Q4RA 3DQVC 3K2YA 2EW9A 4IHXA 2IA2A 3CJ4A 3CWJA 5J1EB 1ETWA 2ALYB 3ISZA 3THTA 5E7OB 3AD8C 1FYKA 3ZO7A 1RAEB 4LF9F 3BH7B 2IJLA 1WC6A 4V19X 4DSKA 4UZCA 3UR3C 5KAKA 3L95X 5KT6A 2F8HA 4KJZA 4N4NB 4HHHA 4W92B 4OX7A 2E66A 4L9JA 1FP1D 1HW8A 4QIWN 3M8JA 2O67A 1U6FA 1KONA 3H90A 1E3PA 1IBMJ 1DTQA 2IRXA 3QYYA 5I3UA 4K59A 2AMCB 4A8FA 3KWMA 4L9TA 2BKOA 4DV4F 5CYVA 2QGFB 1ZARA 1KQKA 3LO3A 2Y31A 2CNLB 2ZZMA 4DFKA 3HGYA 4PYDA 4KHPJ 3FZBA 1U4BA 1C4CA 1BI2A 2E1PA 1N33J 3VYTB 4PJMA 5DD4A 1OPIA 4C6AA 1YGYA 3D1QA 2H54B 2E35A 4FTHA 3W9HA 2LP4A 1X5PA 4X66F 2AP6A 3K59A 1U1KA 1FI4A 5IWAF 2ZDOA 2DT6A 2LKSA 3LL7A 4CT9A 3IC1A 4RB3C 1HNWF 1UTAA 2B4VA 3OLBA 3TQNA 2RMLA 1Z1ZA 2CV0A 1R8HA 2OUMA 4LF2A 2F6CA 5LMNF 2VQLA 4GCVA 3OS2A 2X7IA 2QGUA 1NB2A 5HDNA 4O3QA 2JEGA 2FA5A 5HMZA 1RK8A 1B9MA 1VQ7I 1VIOA 1XMOF 3PX4A 3M2VA 2DCLA 2ZBQA 5DCFA 4EJWA 2EILH 3W2WB 3LAKA 3KK2B 5LRSA 3NOGA 4CLZA 2Q1ZB 4I0AA 1F0XA 2UUCF 1RA6A 2R3VA 2X1CA 3LGMA 1S48A 1F4KA 5ETVA 1QM9A 2YX1A 1N88A 4ECTA 1KR4A 4LRBA 3WIVA 2XEXA 3QOEA 1FWKA 2EG2A 3M8QA 3UNYA 2WAQD 2VASA 4IL6C 4K2JA 2M87A 1JKRC 2HYGD 3G6XA 4DV6J 2HDWA 3HOWJ 2VL1A 3B8HA 1JKQC 4WFZA 3NCQA 1TL1B 5B0CA 1SVMA 5AE1A 4MT1A 2YNGB 4RJVA 1XR6A 3GV5B 1GDTA 5GMEA 1FBQA 3BGUA 4BS9A 1SKSA 1VQ7S 3OYEA 4B08A 2EFOA 4MK8A 1TL4A 3BJOA 2UVWA 3FMSA 2R92J 2HFZA 5HVQC 3S15J 2KRRA 1S9FA 3AA8A 4TLRA 3MF5A 2EH3A 3NS5A 4KT0C 3GUDA 1X1CA 5F1RA 3RZDJ 1AXQA 1S1VA 4ES2A 2MBFA 3WTSC 3MCZA 3VEPA 3OYCA 2JZ5A 2B8PA 4G12A 3HULA 1LOUA 1FRIA 3GR0A 2RJZA 4DDFA 2B9WA 1BR2A 5ETOA 3K1NA 1RKWA 3WTYC 2OEMA 3N28A 3C6UA 2CPHA 4MIAA 3W3SA 3ZPLA 1B4SA 1MBJA 1VQ5I 4CO3A 3FMBA 2CQ2A 4K8RA 1S77D 2IT0A 2AXLA 3H40A 4FYVB 1L3UA 4IPAA 3D7SB 3E6CC 4ZCLA 1X4CA 4OFZA 3HKZA 2FDNA 1KQ0A 1FT9A 1SFXA 1BQMA 1BWEA 2WV1A 1DTQB 4D3GA 1YS6A 5I3UB 4I0BA 4X4SA 2F48A 2V4RA 3ILIA 4NC7A 2F4FA 4DR2J 5DO2A 1XG1A 1DP3A 5TJJA 4DL2A 1R7JA 2WADA 3GTJJ 3IBCB 1D8YA 2VPLA 3E7LA 2KT3A 3A8IA 2CUZA 1PBUA 5F1JA 2IGOA 3FISA 3O2IA 2ZH7A 2ZM6J 2VU5A 4BHPA 5A8KA 3NGUA 4BXXJ 3JRHA 3K89A 1VQ5S 2AZ3A 1FBUA 3DEEA 4XKBA 2J76E 4OOIA 1BOBA 3GTYX 5L1LA 1FCAA 1ETVA 4HH1A 1W26A 4KAIA 3CCZA 3WTWC 4C48A 1LXNA 4DS4A 2AGOA 1F60B 4UB6C 1VFJA 3ZQGA 1EF4A 4QYZK 1MLAA 2KKHA 1WC5A 1U8SA 3M2VB 1TUGB 4I09A 3FC9A 3I9V9 4EO8A 5A2QK 2DCEA 1XCBA 5FIIA 4WPAA 3HP6A 3OJSA 5DZ6A 5A6WA 2EV5A 3C16A 3HPHA 1BA5A 3CF5F 2HVHA 4YN3B 4V2GA 3U1MA 4BH9A 3BH6B 2DY1A 1NK5A 4TU9A 4LSZB 3UD3P 3BKFA 2ZNYA 2F5VA 4CCNA 4A69C 4BGDA 4NE9C 2LLKA 5HQMA 4RAZA 2PBIA 1GNKA 4QW9A 1U1RA 2DTZA 2V6EA 3LSJA 5F64A 2E5NA 1WJDA 2HZVA 3DXSX 4F04B 2DPIA 2HFHA 2VPWB 3A4CA 2OMLA 4RB2C 2Z9OA 1NHKL 3DGVA 2CQPA 3ZN1A 3CF2A 4ZKAA 4ZS6A 1KEKA 4LT6A 2KISA 3ZRGA 1D9AA 1KZHA 3HHLB 2E5ZA 3E3XA 1WF1A 5DGBA 3K5MA 3CJSA 5JXSA 3HTUA 2GV1A 3RJMB 3KMQA 2AGQA 4Y15A 3GILA 2BQ3A 1K61A 2A3JA 1S1VB 3BBFA 3QRRA 3BR9A 2A5YB 1RISA 1TWAJ 4XKWA 3HXLA 1YBTA 5E18F 5SUHA 4AIKA 3DU6A 4XRSG 3W2VA 3ZQHA 4PRFA 3UCGA 1GMVA 3DTIA 3OL6A 5D5UB 1RU2A 1O6XA 5LXYA 1Q7LB 2HPMA 3PW7A 4MAKA 3C6UB 2WVEA 2GLOA 3M2RA 1ZZFA 2ME6A 1FX7A 2MMYA 5KT4A 3PW4A 3W9JA 3FZ2A 3B4MA 1MBGA 5KFQA 2RQKA 1L3SA 4NLRA 1D3YA 2PLYA 2UV1A 2HQNA 2MABA 3AA9A 1I50J 2AJFE 2E5IA 4XTTA 4ICLA 2FJWA 5G4DA 4J9MA 1QZEA 3KZZA 2L08A 3G8SA 5DLFA 2ZMEA 4WJBA 2JFDA 3GONA 1RWMB 2M8GX 3OMYA 2DPUA 1F9FA 4O0IA 3OSPA 4OV1A 3H25A 4EGZA 1HIYA 4LVOP 3JB9k 3GX4X 1GAOA 1PJ7A 3DCAA 1L3VA 5C2CA 1W1WE 3KP6A 2LSOA 1QVGR 5D5XB 2JL9A 1O57A 3AAFA 3MDFA 4ECRA 1T9VA 2CRLA 1WJ5A 5K5MA 4D9JA 3R1HA 1V9OA 4K2EA 2CQ1A 2M2EA 3L7WA 2FJBB 1Y56A 5A8KB 3H36A 1Y5IB 5ETSA 3KK1A 4OV6A 3ZMTA 4M6VA 1WI8A 1YX2A 4BQAA 2V4JC 2YUSA 5E0OA 1AKHA 2K8GA 4DF8A 1S79A 4ETSA 2XULA 4IHTA 1XN7A 3T41A 3I54A 4N76A 3HKWA 1TW2A 5CD4H 4V19K 2X1GA 5ERIA 2MKIA 5B0EA 3ZZPA 1T3OA 1SBRA 4RW8A 4NDLA 3ROUA 5HS7A 4MQVA 5D0RA 5J6XA 2CADA 2XGCA 3SYTA 5D5WB 3C16B 3CCQI 1V55H 3FKJA 5H9FK 2DFHA 4LJZF 1VHFA 4YB5A 2MKJA 1DHMA 3OV7A 3AB2B 3JRBA 3GYNA 5JR3A 4DUZJ 2N3LA 3AL0B 3FXRA 1N36F 1SUQA 1TMMA 4KISA 3NNCA 5IV3A 2AIRB 1N32F 1HW1A 3T1AA 2M45A 4ESFA 2MH9A 5E33A 1WJFA 1KOHA 3D0SA 3BTLA 3EZOA 5A8WA 3TZYA 2C3PA 2FF4A 1LFBA 1KU3A 1UEKA 4IKAA 2GAHC 5I3QA 4R8UA 1SFEA 3ECHA 2HKOA 5FFZA 4EFAC 3I9V2 4NZ7A 2B9YA 5EGYA 2C2RA 3CCQS 3V6HA 3MAAA 3FEXB 4HKQA 2K5CA 2DAOA 4LSNA 5EYRA 2W00A 1D0EA 3QAHA 3TJ8A 3ZGKA 3W2VB 1R0CB 3DYAB 2ASLA 3C1DA 3M8PB 1B70B 4K4ZA 2BV6A 2Q79A 2M3DA 2GVZA 1T3NA 4E98A 1JLAA 5T7LA 1X0PA 2FJEB 3JRCA 3DKDA 3O6BB 4XKVA 4QYRA 3BBBA 5D5VB 1YLXA 4A3KJ 2NNYA 1OJ4A 5D77A 3T1HF 2QFIA 4RB1A 2LDIA 2UUAF 4UQTA 1JKOC 1F9EB 4ICLB 1HYSA 2J0QD 3EETA 1QUVA 2CJKA 2X0LA 1FY7A 2XI2A 2ZMEB 2MGZA 1D8JA 4KGXB 2MW8A 4DV1F 1KHWA 2P0WA 1X4FA 2Z5UA 2M1BA 2CQ3A 2XC7A 1HBNA 1SIWB 1AA1B 4JI0F 1M5SA 1M5VC 3TANA 5JUMA 3U1NA 1IJEB 4X64F 4RAYA 2JTVA 1ZLKA 1RT1A 1NB7A 2PFDA 1JJ6C 2ZXHA 1UW9A 5TGTA 2JUCA 4G1PA 2ADBA 1LK7A 1E6VA 2VUGA 4TLQA 2E2JJ 3EUHA 3OL3A 1NNDA 3KK1B 3T5HA 2M4KA 4IO9F 1AKHB 2GO8A 1TLHB 1BI1A 4UF4A 4AYBN 3T9ZA 3WGHA 4A48A 2ZHBA 3GG0A 1Y6IA 5J1RA 4HF2A 3THVA 1YJTA 4HT7A 2FVQA 1U2FA 1HQUA 3D6MB 3DM2A 3H5AA 3KX2A 1HDDC 2XGEA 2HSEB 1REPC 2QLFB 4RW8B 3NS7B 5CQGA 3LWLA 4U0VA 3L00A 1ZQ3P 3ZOBA 4EEFG 5IT9K 4ECQA 4YB6A 2W01A 4I2QA 5I42A 2AXTC 2AKWB 1PAEX 3I71A 2RN7A 3TGNA 1G3OA 3HVWA 3AJDA 1LKXA 4G3IA 4KT6A 2DRBA 2WW4A 1Q95G 1WFXA 3ENVA 4EM2A 2LFBA 2BQRA 4HW0A 5DG9A 2KM8B 1DLOA 1N78A 1CGPA 3DRYA 3T5XA 1SUQB 4CCKA 4EYIB 2KJBA 1V4RA 3BTIA 2GS8A 1A04A 1LJ9A 5HODA 1X4HA 3M8FA 2VN2A 1KQFB 2PI5A 3OSNA 4RX6A 2HGNA 4C8ZA 4UVBA 1ZLJA 5A8WB 4BS2A 2NRAC 4P9FA 1ZN2A 2CPZA 2KB2A 2K2PA 3OOPA 4IQ4A 2RIJA 3HK2A 4FT8A 3CCJI 4RAGA 2HQFA 4IRCA 1QE1A 4OI4A 3VYUB 1QLNA 1K6YA 3LQQA 2ZBKA 4CO2A 1AA7A 3ILOA 2G9WA 2C1EB 3MAAB 4PJ0C 1D8KA 2E1MB 1MSWD 2ASJA 1NG7A 1WGXA 3FK6A 1IBLJ 3LSRA 3TDUC 5EJCA 2EXUA 4GFBA 3KLIA 2RDDA 4CCOA 1EH7A 1SFKA 1HFEL 3CC4I 4HOBA 2L9NA 1O0PA 2VFRA 2NR0A 2GVZB 2V1XA 3SBMA 1BR1A 2A0FB 3O8HA 2ECBA 4YS2A 3FGVA 3RPUA 4KQZA 3D28A 4J5OA 3CJ0A 2IGKA 2QX0A 5GPCA 3CCJS 2MA3A 4Q43A 1HYSB 2GVDA 5D8HB 3ZTQA 2MGZB 4NMLA 3NGRA 1KWMA 2G1DA 1VBZA 3EVOA 2G13A 1UEUA 3M8EA 1JQGA 1HBNB 1UJ5A 5B7WA 5DM6Q 3JSBA 4RWXA 3IWZA 4A3EJ 1QVUA 3BG9A 1YWXA 3ELKA 1RT1B 4QWCA 4F52A 4N7TA 4NLSA 3CC4S 4JI4J 3S7RA 1MU2A 3K69A 3B82A 1JT0A 3E8OA 1R1UA 1E6VB 2YQ0A 3T5LA 5H20A 3UFCX 3SJMA 2EVZA 3CJQA 2G2ZA 4J01A 2GFFA 4YIRX 2O5RA 1KTQA 3H59A 1X1DA 1YZ6A 2DPDA 4JP8A 2HVDA 5FGMA 2M70A 4OX6A 3CMQA 3SFIA 4MIWA 1R8CA 4Q0BB 1NDKA 4QWQA 2QLWA 4IVNA 5KFMA 3VZHA 3ONQA 3UN5A 5K8PA 1IDZA 1HNZJ 1HQUB 1M1GA 4DQIA 3DM2B 2N3OA 1FRMA 1RU1A 2GQ2A 2TDXA 4J9UE 4E70A 2HVSA 2CJJA 3QBCA 3L7OA 2J7UA 4ZYHA 4EGLA 2RVCA 2NVQJ 3TEGA 4MH8A 2IIHA 2M0MA 1W4MA 5H9EJ 4X4TA 3ZMUA 4MEYF 2BE9B 3MHYA 2F63A 1EZZB 3QT5A 5EX3A 2WAQN 1XSVA 4XN3A 3H9QA 4OI1A 4WU3A 3HRUA 1RT3A 1DLOB 3TI0A 2R5YA 2FQ4A 1I3AA 3R7NB 2QSFX 2A2DA 5M5WJ 3BR6A 4ECXA 1FC3A 2HZCA 1YFHA 1OISA 2HS0A 3I4HX 1IKVA 2KI2A 1OY9A 4P6QA 1X9WA 3H98A 4YY3J 4LVNP 1FNOA 4B9TA 2HDCA 2SXLA 2W2PP 4OZ0A 4ES1A 1LKZA 2QA4I 4DPXA 2CG4A 2MLKA 5HQLA 3BJYA 1QE1B 4NXMF 1DQAA 4RNFA 3G73A 3MEEA 1RCOB 2L9RA 1K9MT 3J7ZI 5K7HA 1YJVA 3RU0A 4II3A 4IH6A 1SMTA 4NX9A 3REOA 1NZAA 4Y65A 2MGQA 1U6BA 3KLIB 2P5LC 4CZZA 3D6TB 2BE7D 8RUCA 1WKMA 4BC9A 5C5JA 1FNNA 1H7WA 1Y5LB 1WHWA 4HYKA 1IQZA 3M2UA 4DQSA 4L76A 5J2NB 3LSTA 1U2CA 2LXIA 4E7HA 4F2RA 3CDLA 2RAQA 2CJQA 1RB0A 4TY8A 2COLA 1NPRA 1R36A 3OR1A 4USHA 2VJ4A 4IRKA 2ID3A 3BPXA 1XNQF 4U95A 3K0LA 3M05A 2QA4S 2X1EA 5DUKA 4C8YA 1MGTA 2FHJA 3CJNA 3IXQA 2BXYA 1B0PA 2GVDB 3IR5B 4JI8F 2B4UA 1LXJA 3DI6A 1O3SA 3EVMA 1AZSA 2QLBB 3K4MA 3KLGA 1P4WA 5J1YA 4N9HA 2CH0A 1C0TA 5ILSA 5LEJA 4HV5A 1LVAA 3Q0WA 3A01A 4IZZA 4TQSA 4M72A 2CWEA 3FXLA 2GA7A 2FYXA 3RYPA 3FHZA 4WF2A 3T6JA 2BJ9A 3V8LA 1MU2B 3HT0A 1LDDA 5L46A 4M9ZA 2XMAA 4PXCA 4Q2LA 1N6QA 1H3DA 3CJQB 2Y0SA 2DA5A 1WZ2A 2IYIA 1G6BA 4UVAA 3SI8A 1PKUA 4LFBJ 3NAIA 3JCUC 5E1WA 3OTEA 1U0HA 2KZMA 3W8PA 2CJAA 3Q2TC 5J3LA 2BHZA 2EBIA 3MN2A 3P45B 3S3MA 2VFSA 3GU0A 4NA2A 1RI7A 4ED0A 3DDKA 3QFWA 3KOAA 4E7KA 4U67Q 2WOMA 3OYAA 4B4CA 3JTOA 1VRTA 4UNOA 1ETQA 3W8GA 5CVIA 1QD1A 4N47A 5D3GA 5DUIA 3FKIJ 2W2MP 2KDZA 2R7DA 1R6VA 2BRKA 2ASYA 4M95A 2O01C 3NCPA 2N7YA 3W2AA 3DLAA 2B43A 1YRNA 3BSNA 5IM0A 3PFOA 3K4JA 4XR6A 5HVFA 1RT3B 5DJBA 2PE8A 5FRNA 2YX4A 3MUMP 2R5YB 2P9GA 3MZ8A 4ZVRB 4NI2A 5KT7A 3Q8QB 5FB2A 3WG7H 1IKVB 4PWWA 4L74A 1FNMA 2VBXA 3RRKA 5D15A 3WU0A 3HHEA 2M8EA 4ATNA 4FZVA 4QIGA 1Y8RB 2MD0A 1G6NA 4ITVA 4LIVA 2DGWA 1T2KA 1ZGJA 1VLYA 1SC1B 3MR5A 3D4JA 3MMCB 3R27A 3O44A 1U3EM 5LLQA 1SB6A 4I7FA 1GV2A 4IG0B 4FF2A 2L9DA 3MEEB 3GLJA 2DOFA 2AS5F 2Y0BB 4O3PA 4TYAA 4RZRA 4CCJA 3F23A 1I1SA 1QRYA 4F4ZA 1QGPA 3HOSA 3U02A 4BY7J 2K4BA 2DXFA 2RSQA 3HI9A 3K4CA 1P9QC 2GZWA 4OIXA 2OEJA 4C8LA 3M2UB 5F8LA 2UVUA 2KRFA 3K5OA 3QGPA 4U88A 4L5EA 5CJ9A 4ZVTB 2QSFA 2Q3PA 4YFXF 4TY8B 4Y00A 3MPVA 4O0NA 4LRAA 2CQ0A 3O6QA 4QQBA 3HRTA 4M3DA 2OPSB 3CUQC 4DPOA 3M8RA 4JYKA 3S1NJ 4UOFA 4ZYGA 3DI6B 3E6DA 2HPIA 1AZSB 4AUXA 1W2BR 3KLGB 3ZN0A 2EIJH 3TL4X 2H94A 2UXBJ 1PBAA 1XDUA 5EUHA 2K02A 1K79A 1C0TB 3TVZA 4AFFA 3A01B 3ML6A 2D9OA 2FVRA 2C3UA 2W7PA 3F72A 4B3SF 3KJNB 4GKKJ 2BR0A 2BVLA 2K4JA 1T7PA 2D1VA 2HGCA 5LGUA 1U7LA 2STTA 1FTRA 1N6QB 1FFGB 2FD5A 1VFCA 5J1NA 5LMUF 3T6BA 3CO6C 1A5JA 3HHNB 3M1CA 2L9VA 1K47A 3LP0A 4ANEA 1FJLA 1U0HB 2KO1A 3UD5A 2IVYA 4ZCIA 2AV5A 1FE4A 3VZIA 1BHNA 2DNKA 3HXMA 2C22A 3O8GA 1RCXB 2BZ2A 1MJBA 3HJVA 4JYAJ 1JNRB 3DP7A 2WOMB 3S3OA 4OIRF 3CDBA 4A93J 2WSCC 1VRTB 1NSQA 5FLMJ 5D3GB 4UUTA 2MKYA 4OYMA 3OR2C 3NP5A 3GEZA 2XCAA 5E3NA 9RUBA 1TTHB 5CVVA 2DOAA 2L9WA 1YRNB 2FMLA 5IM0B 4CGZA 1S9GB 4ZYEA 2QSHX 2NXCA 2XPWA 1U1PA 2P5VA 3VAHA 1P9YA 2HNHA 1HLVA 1W7PA 4NI2B 3HPGA 5E41A 2KHDA 1Z1DA 4KC5A 4ZJLA 3H5YA 1BC7C 4ID8A 3TOQA 4IFYA 2V0NA 3T0YA 2H48B 2W48A 1X58A 2K7KA 5F0HA 3LPEA 3UDVA 4EWTA 3GYHX 2X1BA 3K4KA 2JK3A 4BE1A 1X9SA 1ZM4A 2UP1A 3MZIA 4C3MA 2R3SA 4I7FB 4IRHA 3MR2A 4X4RA 3QGIA 4KB7A 1HL6A 1J2XA 2F4VF 4ED2A 3RCOA 5E3MA 3A8EA 5E3CA 4KFCA 2ZJ2A 2VJUA 2L54A 4ZDOA 1D9DA 2YR2A 4RBOA 2FU4A 1HNVA 3U9GA 3QWPA 2CFXA 2QYGA 3OIPA 2ERRA 4LIRA 5GVQA 4JI7F 2APOA 2J5OA 1FESA 2HHPA 2K9MA 3WE2A 2XWXA 1RKJA 2M0CA 4U7UK 2V9PA 2XMTA 2O3DA 1GMWA 2J9DE 1E0EA 2EK1A 2IAJA 4MIMA 2XMVA 2JSPA 2R93J 3E5XA 1R49A 4IHSA 3TZXA 1WKLA 3L2QA 2HFUA 2XG8A 4K50A 1SL0A 1U9NA 4BE2A 1LDJA 3PTWA 4A8MP 4AQYJ 2BABA 4HX4A 2MH2A 1S0VA 4ZYAA 4A3FJ 3CC7I 2FHKA 1QZZA 4AL7A 4O4GA 4PQAA 2MJUA 3VYSB 5D6GA 1AU7A 2H5IB 3M8WA 4II2A 3F73A 2R4GA 3TRGA 3MKLA 1H2TZ 1Q1VA 4RM3A 5HMXA 1GXQA 3PUBA 3KYLA 1U25A 2X9DA 4RUCA 1Z6TA 2Z56B 4LF4F 1TW3A 4ZJQA 2H1LA 1XGNA 2HBQB 1Z7LA 1UVNA 5E3AA 4I67A 1RHRB 2JA8J 5JJBA 3M6XA 1D0YA 4TKTA 3J7YI 3LP0B 2NQPA 3NGTA 5L3EA 2LKZA 4M63A 4ZIWA 3ET6B 2L2OA 2JEJA 1UAAA 4PKDB 4MTEA 2M4MA 2DA4A 3M7VA 4FDFA 1TKTA 4LF6J 2GHWA 1IF1A 4CNYA 3D1OA 1KQ8A 3KXDA 2OP5A 1EH8A 2WB1D 4A8OA 3SYZA 5KFRA 3K1MA 1Q5VA 3VR1A 4L75A 2WB4A 1WEXA 4OI2A 4Z7CA 2BW7A 2ZSHB 1MH4A 3HO1A 2RU3A 1HNZF 1KU7A 2DYSH 2X4HA 3HOYJ 2M52A 2CW7A 1NPKA 4K0KJ 1W7PB 3VPRA 3DOMA 4HQMA 2QA4G 1HOMA 4IFYB 3P8BB 1SEUA 4AU7A 4DV7J 5KT5A 4ZLJA 3S2WA 1PJ6A 1S3JA 4QWAA 2PT0A 3OFFA 2K40A 3HHGA 3H5NA 2CJ9A 3ISNC 2DIUA 1LQ1A 3I53A 3QPIA 2H3EB 3MPYA 5L3CA 1BXNA 2OCCH 3I64A 1CBKA 1TK5A 1HNIA 2W84A 4OYWA 2GXBA 3NWGA 1IR0A 1X3ZB 2NXJA 3I56I 1NU4A 2ROGA 2RT3A 3E01A 1Y00A 4LF8F 4DCOB 1LWCA 3IWLA 3W6VA 3NWTA 2OSQA 3KHHA 1SL2A 1HNVB 3JTNA 1WCMJ 3WGGA 3AKZA 3CLOA 2IM2A 1ENHA 1M90T 1FRXA 4GO7X 4PAAA 2A2CA 4OMZA 3VOEA 2RILA 2VI6A 2QQ8A 3PW0A 2EFWA 2BHYA 1U1MA 3GIKA 2IAJB 1V3RA 4KT5C 2XI3A 2MSSA 1S6PA 1QBJA 3WHIA 1FSEA 2HHWA 1YX5A 3ABMH 4MTDA 1J0RA 2OO4A 3DLGA 1IUJA 4PWDA 2B5JA 1N48A 4O4GB 4JUZA 2O5DA 3H2VE 3I56S 3EGZA 2FVPA 5E5NA 1OYIA 2ADCA 1WHXA 4OYOA 5LHGA 2FHOB 3D54A 4ZHRA 3H8YA 3B73A 4PJLA 3FZVA 4ZPDA 3BZQA 4JK1X 3I31A 3G86A 3R5DA 3MWMA 4HDVA 3PO4A 1SI9A 3UCZP 1F5AA 3CULA 4IR1A 4IYQA 1K44A 1R0BG 5E2QA 3PJXA 1A6IA 4KHRA 2YWGA 1XR7A 4LK1F 4NNJA 2V4QA 2OEKA 3K1PA 4BU2A 4OJ3A 1XC5A 2DNNA 3CIMA 3GPAA 5LGNA 5BMZA 2R7VA 2DGOA 1T8IA 4BUPA 2IMWP 1RA7A 3IN5A 1TKTB 2MTLA 3DF8A 1KLNA 3QNWB 3LTOA 4EJTA 3DLBA 2K7JA 4ZVQB 2KVIA 3QSIA 4JI1J 1R5GA 2GBYA 2UZKA 3HSZA 4ZPBA 2DHGA 5BR8F 1TKZA 4GKJF 4Z7YA 1D9FA 3N5FA 1SH2A 2MB0B 2L4AA 1TNTA 5J40A 1NXIA 4KN4X 4XRFA 1ZGWA 3BYPA 4ALZA 3BDEA 1DAXA 4DWIA 2R7TA 4RR5A 3CGIA 4F25A 1HC8A 2IGMA 1ODDA 3DOMB 3J81j 1NK0A 2EK5A 2KJCA 1R5HA 1TU0B 3K57A 3IKVA 3WBZA 2W4DA 4JX4A 1GTEA 3N97A 4S04A 4PPDA 1T8EA 1NSPA 2V63A 4XLHA 3R7BB 1WF2A 5D0GA 4IQJA 1TWGJ 4LITA 2KIMA 2FNPA 2ZVIA 5IC4B 2O7OA 1HNIB 2J7WA 4YIFA 2FNAA 4WE1B 2NVUB 3PYFA 1XMQJ 1OWXA 1RACB 4Y2IA 1T08B 3PNIA 3HSFA 2G2YA 3E01B 2R2RA 2QQ9A 1VRUA 3O3LA 1LWCB 1FDNA 1XTAA 4NLVA 4I76A 2B0LA 2GJ2A 4I02A 4M9XA 3TP0A 2W2QP 2EFPA 4Y2MA 4EK2A 4JP0A 3K17A 4C30A 1YX3A 1KU2A 3CJTA 3CO0P 1J75A 3SSSA 4JI3J 2Q43A 4RGUA 3QYBA 5CZXA 4JQFA 3M8ZA 3QLHB 4E6KG 2BW2A 3HKZD 3QMQA 1OPCA 5DDQC 4HX7A 1DGWY 1S6PB 3Q8SB 2X1DA 3SFUA 3S2DJ 1NDLA 2M88A 5BQTA 3D68A 1UVKA 3MEKA 4AXJA 5F41A 3C46A 4DV2J 4G6TB 4PDKA 4UUVA 2XSJC 2W7NA 4XK8C 4FVCA 3W60A 3DLGB 4R5PA 2VICA 4PWDB 2B5JB 4LB6B 3NEUA 3OFEA 2F1FA 5KFHA 1EQ0A 4CLPA 1SQFA 3V8KA 4ZHRB 1FOKA 4DSIA 3F0NA 4XSXF 4FKYA 4CO1A 3FFIA 3W1YC 1RT2A 3WTUC 4DL5A 4JBAA 5FD1A 1P1LA 2V9KA 4XRSA 5KFTA 3HC7A 4BHQA 2VDHA 2LA4A 1E6YA 2R8GA 4UOGA 2HVIA 1SFUA 1N5QA 1N0UA 2OMOA 4BKXA 3AFGA 2OCEA 4A12A 3X3UA 2DGTA 1VJWA 2VC0A 1IJFB 4DZPA 4HNTA 1DURA 3A1YG 2QTWA 2HHVA 3RZOJ 2COBA 2GHPA 3KEYA 9ATCB 5ETRA 1F2HA 4XLPF 4X62J 3OTCA 3BROA 5LBQA 3V4MA 1N5YA 2QQAA 4DL4A 4ERDA 3GZ5A 1ZKGA 3B6BA 1TELA 3MAJA 1ZM9A 1DRZA 1UEVA 1Q82T 2JQ7A 1R4NB 2DR8A 2E9RX 4A6EA 4GC7A 2I10A 4DS5A 3GP9A 2HK3A 3F44A 2E9TA 1WKKA 2DMTA 3G96A 1EP4A 2J6UA 1TKZB 6FDRA 4KY3A 4KYZA 2X6XA 3S8PA 1AW0A 2E29A 4XBFA 3M6WA 4DUYJ 1KP6A 4PUOA 2XS5A 2FLNA 1JT6A 2AW0A 4JYAF 2J5AA 3GIMA 3CPWR 3TJ9A 2RUSA 1C0UA 4EYHB 1IXKA 3JRFA 4W90B 5LD2C 3BDDA 1G3WA 1N75A 2DYRH 2O9LA 3ZMSA 1XPXA 3NAUA 2E1AA 5DS7A 4A3MJ 4OJHA 3VAGA 4KE5A 3SCKE 4N8NA 2KZGA 3OWTA 3D5RC 2RREA 4P75A 3EXYA 4BACA 2HQIA 4CICA 4IOCF 1TQIA 2A69F 2HGMA 1ZAOA 1VRUB 2NZ4A 3QIPA 3I9ZA 4D7MA 2W4CA 4BEHA 2Z99A 5GAGI 1ZTWA 3S3NA 4PEOA 2V8DA 3CJTB 2KJWA 4DN9A 2VXZA 2WVDA 1JJHA 5GP9A 1U8BA 5KG6A 4AIDA 3UO0A 5M3MJ 3BQ0A 2KT0A 4YQWA 2F3JA 4F36A 3VWBA 2H6CA 3GTGJ 2R8JA 3C8YA 4ETXA 3AAWB 4R5PB 3GW2A 3TAMA 3UWTA 1IV6A 4OMFG 2CQHA 4ZPWR 2ETHA 1UB9A 1VF9A 2A1BA 2TRTA 4ZH4F 1FWZA 5AXKA 3LFKA 4J7CA 3OTOF 3RB4A 1SC4B 1IW7F 2BZTA 5LHIA 1FEXA 1YVFA 4R8HA 3ETOA 3FFIB 4O3SA 4NC6A 1RT2B 1QUPA 3J7YU 5H6RA 5L8RC 2D2WA 3NGSA 1Z6RA 4DR7F 3BN7A 2GC8A 1MD0A 3TNVA 4LF5J 2ELKA 3SQGA 1E6YB 1NSAA 5ICCA 1F5CA 2ZHOA 1N56A 2P5KA 3AJ2A 1R89A 2MJNA 2WVFA 1XK8A 1RR8C 2JOQA 4A8SA 1RWOB 3CDAA 3HZGA 5GAEJ 1L5UA 1NZ8A 1X5SA 4UXNA 5DRKA 1N5YB 3HB9A 2XVCA 2BACA 2RQMA 1Y39A 2ACYA 4BXUA 3UI3A 2FC9A 4PQUA 2ADUA 2W2NP 2P8TA 1Q0NA 1TT5B 4FASD 3QU6A 4YP3A 4U7CA 2WRMA 2IAIA 3HSGA 1BJZA 1EP4B 4WX9A 1UL3A 1UKUA 2GIZA 4QU7A 5L3GA 1PO6A 2YNFA 2HHHF 4F3MA 2E1CA 2GW8A 5DM6F 4PUOB 3DTEA 4CCHA 4PJNA 4MHGA 3LSHA 2MDAA 1ZRDA 2ZKZA 1C0UB 1FWLA 4ZVGA 4L18B 5G0RA 4YG2F 1LEBA 2CQ7A 4MYUA 2QMXA 1GV5A 2K9QA 3CZ6A 1YDLA 4C3KA 3L3CA 1RTJA 4JI6F 3RR7A 2JJ4D 5A76A 2COMA 2OU2A 1D1AA 2Y30A 3EWGA 1SCJB 1UHMA 1U1LA 3SCIE 1U1NA 3GLXA 1ITYA 2Y8WA 2QV6A 1FPQA 3A03A 5IP9J 5HROB 5L1IA 4WYWA 3MURP 5EG0A 3W65A 3QIPB 2PMZA 1KTVA 4ZITA 1WSUA 2NXEA 4BEHB 1Y11A 1HNXF 4XLAA 3EGNA 3UKGA 2JRSA 2WK4A 1RAOA 1MROA 5EGOA 4MNUA 4TQRA 2QM3A 1J7KA 1U2WA 2CUFA 3M1VB 4OAZA 3HDSA 3K5PA 5HVGA 4WXOA 4IH7A 2EC0A 4HSRA 3TQ1A 2KRCA 2WSFC 2QC3A 4KA4A 1X5TA 3D3BJ 2BW3A 5HBMA 2ILYA 1JLQA 5F8NA 5KVRA 2Y1LB 4IOAQ 3TAMB 4DSJA 4EU0A 3CXCR 3OL4A 4DFJA 1TFYA 4EATA 4Q45A 4IKFA 3KKFA 4DZ6A 3S17J 2CDRB 2LQBA 1PJRA 3MTKA 5GMKa 1KVIA 2HOEA 4KIAA 4ZVUB 1OCOH 4OWRB 4WKRA 2JVOA 3FXMA 3BBCA 3CCWA 2B7EA 4IR9A 3TP2A 4ZJZA 4KGVB 1ZOTA 1D5VA 3RZAA 3KG4A 1I94J 3QQCD 1LVKA 3SQGB 2L02A 2AJ1A 2QL5B 1V3FA 1H38A 4YR3A 3GJSB 1VI0A 3QP5A 3VWSA 4GVLA 3AOBA 1FO1A 1JKHA 2GWRA 4NC8A 3L2CA 3ZZ0A 5EHHA 5DEQA 5FDLA 2UXXA 2LQ8A 2HZAA 1S6UA 4RW7A 5EEGA 2N4DA 2DEIA 3LQRA 1NHVA 4ZLPA 1IVZA 2XAQA 4USWA 4IQMA 1X4OA 2YSRA 4PQUB 2DH7A 1RBOB 3C2HA 4G7OF 1R6YA 4F4AA 2UV8G 1UG0A 1WJAA 3PM1A 2DMUA 2YPRA 2IMOA 2E34A 2YPZA 2P6TA 3TARA 2XC9A 1GTHA 2KTQA 5BOXA 4WP3A 1M1EB 2RKIA 2YNFB 3HRMA 3G4SI 1RT5A 3CMES 1VC0A 2FMYA 4ED8A 2FY1A 1ZR2A 1Y9OA 3CUQA 3OYGA 3QZ7A 3CCLS 1F3VA 5IYBJ 5IXUA 5DQHA 1TKXA 5EF6A 1O51A 3G6YA 3AG2H 2C2ZB 5BXIA 3O2PE 3BQ1A 4QIFA 5CABA 4P96A 4HI2A 3FMQA 3CSKA 1H9GA 3K9TA 3GZ6A 4ECYA 2CWXA 4QJVA 3R3TA 5G0RB 3ZTRA 4HR2A 1K7AA 1RTJB 1FRLA 2DU9A 4H4OA 3PIPQ 1QHHD 2LBFA 3LFUA 3M8YA 1ON2A 2ZO4A 2BXJA 3BG6A 3FEZA 3H3VK 2PGCA 4L3KA 4LUBA 2ZFWA 3TUZC 1MG7A 3CD5A 2OJED 2EZHA 1O3QA 3G4SS 5EG0B 3JS9A 4E8UA 4FPRA 1BD6A 3DKWA 4IHVA 3RPUD 1N0VC 4DI6A 4FPIA 4OI6A 4B3XA 1MROB 1SD6A 2ZWPA 4RA2A 4M6XA 4LRCA 3WTVC 3R97A 5KFIA 1B59A 4Y52J 3PNTA 1XMQF 5L3BA 4X4UA 2IBDA 4DV3J 2R8KA 2ZKUA 3OR2A 2HOSA 2PJPA 4ENMA 1BWVA 3QPLA 4W1UA 2BW3B 4PSWA 5HBMB 3O5TB 4RW6A 1JLQB 2WZ1A 1HWKA 5LL6d 2JN6A 1XMAA 1EH6A 4S0HB 3TZZA 1Q86T 5E79C 4ECVA 2IS1A 1HKSA 3GLLA 4YELA 3GTQJ 2MQ8A 4AYBA 1S8NA 4E7IA 4DNCA 4DL7A 3TX8A 3TO8A 2XV4S 1EJ9A 2Z2YB 1GMUA 3PRDA 3BO3A 5HL7Q 4YMEA 5HVHA 5KFOA 1PYSB 3IS9A 2R7UA 3U1KA 3G1MA 3JTGA 2ZH3A 1CF7B 1YHQS 4EM1A 2JPBA 2YH0A 2Y2ZA 3NEKA 1JKHB 2ZZNA 2QKMB 5GPAA 2HFVA 5SZTA 4RNMA 4XM3A 1Y5NB 5FDLB 2OFHX 5C7PA 2FXAA 3I5AA 4RW7B 1Z3XA 4RO0A 4BLGA 2I6WA 3GG1A 4ANDA 2QIFA 4KO0A 4OHZA 1YJWI 2EKYA 1Q78A 4UY8I 2VD3A 3CDWA 5DG7A 2PSZA 3SXYA 3NY0A 2D3UA 2R2TA 4QPQA 3T9NA 1HQEA 1HHSA 1OCTC 3W6JB 4Q2MA 3PHTA 4M5JA 4BNCA 3EUNA 3ZTPA 5J8CA 3WTTC 5GAHU 2RKIB 2VDIA 1RT5B 5E17F 1DTTA 4PFPA 4OX9J 4P9UA 1ZAXA 2KDOA 3DC2A 3CUQB 1IWAA 3N4WA 3Q86A 1TKXB 4U8YA 5AE3A 3VAMA 2V8VA 2AD9A 2B51A 1BY9A 3J81Z 4HDHA 1ETXA 1S1UA 4CO5A 5J2QB 5E1XA 3ZMVA 2HWVA 1H88C 3MOZA 5KG0A 1S7AA 4XICA 2HBZB 4H4OB 5AJ3J 2LBFB 1RRJA 3CCSS 1YJWS 1XN9A 1R23A 2ZDPA 5KAIC 3ZQCA 4FE7A 1IRFA 3VALA 2NS8A 3LQVA 5GAGU 3M4OJ 3EQLF 3CJ5A 3CLQA 2E5LJ 3JSYA 3TMOA 3CE8A 2NYXA 4LF1A 5J47A 1ZPWX 4H4MA 1PDNC 2FGOA 4USTA 2V6AA 2R0QC 1HR0J 3MZYA 2GIRA 4IHYA 2HVRA 3TX0A 4Q47A 2YBVA 3A0HC 4OZLA 2RRNA 4XLNF 4ZA1A 3KTQA 1VIXA 5LSRA 1GFWB 5C2GA 4CH7A 4N4OB 2HHSA 1X31C 1RWKB 1T05A 3IP0A 4R1HA 3HKZN 1W36C 2FHJD 1YI2S 3QRQA 2R2SA 5LFAA 1NM2A 4B9UA 1ZAVA 1K83J 1WC4A 4N5SA 1YBUA 2GMLA 3AFHA 2NYIA 3OR2B 4DR6J 3SDEA 1SVDA 2HWTA 2IYGA 3FK4A 3BQYA 3BN4A 2OZ6A 5C44J 2WW8A 1YBAA 4RW6B 4YEJA 4A8YA 2UXCF 1R9TJ 4RNOA 1BC8C 1UFKA 1U78A 5IQ6A 4YHHJ 1HW5A 4A3CJ 4DR3F 2UWMA 2BRLA 2DXDA 3FVYA 3PW2A 2V1UA 1QSSA 3IWNC 2CDQA 1WHYA 1RIOH 1YJ9S 1AFJA 2DJWA 2Y0SD 1CVJA 3DXJF 1SKWA 4IQXA 1KVKA 2JEFA 3QWUA 3G3ZA 1CJUA 3DLKA 2OUGA 3F41A 4U7DA 3H35A 4L5IA 4WCEQ 3A8KA 2FY8A 1WI3A 1I3OB 3MAQA 2DTJA 3JTPA 4WWSA 4D7NA 5IZHA 4C0HA 2Z57B 1M0SA 2QMWA 5CYQA 1T03A 4RM2A 4RL1A 2EK6A 3DRRA 1S7OA 2FBIA 2B6AA 4KO0B 2GO9A 5IFMA 1PSDA 3K5NA 2MKCA 1JLFA 5A6PA 2AO9A 1EKEA 2G1HA 2CQNA 4CIOA 1S1TA 1REGX 3QAUA 4IRDA 1HD0A 1LWFA