4F3QA

Structure of a yebc family protein (cbu_1566) from coxiella burnetii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
234
Chain Sequence
KWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAIKRGADNLVEVRYEGYGPSGVAVMVDCLTDNKNRTVAEVRHAFSKCDGNLGTEGSVAYLFKQRGLITFPPNSDEEKIMEIALEVGAEDVTTNDDGSIDVTTLPEDFEKIRNAMKAADLNPSHAEVTVLASTEVGLDKDSAEQMLRLTEMLEDLDDVQNVYSNADYPEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transcription
molecule keywords Transcriptional regulatory protein CBU_1566
total genus 73
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4f3qA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA03
1MW7A 1K6YA 1LFPA 1WJFA 3HPGA 3F9KA 1E0EA 1WJEA 4F3QA 1WJDA 1WJBA 3HPHA 1WJAA 1WJCA 1KONA
chains in the Genus database with same CATH superfamily
5CVRA 3Q8PB 4C8NA 3E6BA 2XGDA 2Y48A 3ZZOA 1NJYA 1S4EA 2JVHA 3BO2A 3Q2TC 2HEOA 2KFDA 2OZ6A 2J0SD 3SQGB 5DDQC 2XZDB 1GMWD 2QEXS 3ZR8X 4XR6A 1X9MA 2BVMA 4F4KA 2R7QA 2BX6A 1Q16B 3MMBB 4EEFG 2AS5F 2ZOMA 4BY7J 1R9TJ 4A3LJ 2C2OB 3S1RJ 4NXMJ 1VQKS 4G65A 4YFKF 2GA2A 3LALA 4DXLA 1T9WA 4C8LA 3U2RA 5E1XA 2XHCA 3TP0A 3DPLC 4I0BA 4NCAA 2LA4A 4KIFA 5J8FA 4X4TA 1PVEA 1MMDA 5CVVA 4CCLA 5KG5A 3V6JA 4A8SA 1J5YA 2BYCA 2IGNA 2QM3A 1CPZA 3WTTC 2HYGD 2RKHA 4CCHA 2UXNA 4HQEA 2B4PA 4JBCA 4HKQA 2HVEA 1XGOA 1SD4A 2XEXA 2B51A 2DGXA 3R6SA 5D3GA 4CZZA 4HF1A 4BHCA 1JLFA 2ZH1A 1Y3KA 4DLEA 2MZJA 1RUNA 4OU0A 1GAOA 3UKGA 1S6UA 1O3QA 2B5JB 4O44A 3W3CA 2W8LA 1ZKGA 3CESA 5LMUF 2CG4A 1SC6A 5K5RA 4YELA 3J80Y 2AU0A 2PMZA 4FXDA 3MEGB 3HBLA 3EDQB 4P73A 1X3WB 3QMQA 2Q1ZB 3TA1A 4F91B 2Z2ZA 1CQMA 3LAKA 1REVA 4FNIA 4YS2A 3SZ2A 1Q79A 1VNDA 3ITHA 1QZYA 4YEAA 5EWFA 1HR0F 3R0AA 1VQOI 1O6XA 1AFIA 3W5YA 3F8FA 2H3EB 2VG5B 2NVXJ 4ASNA 4DI6A 2OO4A 4LOCA 4LD5A 1SAXA 1NG7A 2MJNA 5BR8J 1JUPA 2VQHA 4OI4A 2F4IA 3BZCA 3K4JA 4YFNF 3CO6C 2QLWA 2XMAA 2CUEA 2MG4A 2DGUA 4RB2C 5HN0A 5DQHA 2EV6A 1R8PA 3N6LA 3SI8A 5DCFA 3RAQA 1TKZA 2HZVA 1FJEB 4L75A 4ZH4F 2E36A 1G7CB 2JPBA 5F0HA 1HHQA 1H2UX 1VC0A 2FLOA 2P0WA 4XLNF 4QJVA 1K0TA 2HGMA 4BE0A 4OFZA 1TL4A 2P5KA 1RAAB 2MGZB 3KP3A 3DV8A 3M07A 2ELJA 3ZQCA 3V5RA 1YE9A 4WCEQ 2EWNA 1JJ2R 4F2SA 4Y7NJ 4J5OA 2QSGX 5IP6A 4JI7J 5A8RB 4ES2A 3HHEA 3RSNA 1Q7YT 3PEHA 5KOWA 2Z8QA 3CW2C 2WSFC 3H0PA 3BPSP 2ATCB 2OUGA 4HSTA 4E4HA 1T2KA 4DSFA 4KJIA 1IRGA 1P6TA 2XBPA 4XOTA 3QGGA 2OPPA 2XQCA 4USJC 3T1HJ 4V19X 3CT9A 3A01B 3CCRS 1X8DA 3J81K 1U24A 1TWGJ 1FSHA 3AG2H 1VK8A 4FPIA 2LY9A 2WVBA 2PJRB 3HOSA 3UE2A 4NA2A 3S01A 4DFPA 5E2QA 1WSUA 5I42A 3KLEB 2DTJA 4TN2A 3K10A 1LUJB 3NBPA 2XF5A 4U8YA 3GVAA 4RAYA 4BHBA 3MMAB 2GO9A 4KY3A 4USMA 5T7LA 2PT0A 5HLIA 4NLYA 1I94F 1MDMB 1YQHA 2B4VA 4JX6A 4F7VA 3QSIA 4B17A 1YI2S 4AWXB 2RDIA 3CCTA 2BVLA 1ETXA 3K9TA 3SIPB 1WH7A 3GTLJ 2PBIA 4MFBB 5KFRA 4YHHJ 4L3KA 5H9FK 1YS6A 1PC5A 2M4KA 2XVCA 3U21A 4P2MA 4RLFA 3K5NA 3DTIA 5D8KB 3ET6A 3T1YF 3MM6B 5BNGA 5C5JA 1NMEB 1HBNA 2KPMA 3OOPA 3TW0A 5BYSA 2OHDA 3M32B 4NASA 1G4DA 1X4CA 2HHUA 5DLFA 3HM9A 2GA7A 2RRAA 2WV0A 4B47A 3CUOA 3MFHA 4NRTA 2UZKA 4DU8A 1TK8A 5ETKA 3DPTA 5K9FA 4OYBA 1HQ2A 2DGQA 3NS6A 2X51A 1RT4A 2OTLS 2BABA 1JJCB 2BXJA 3CCQI 1QU3A 4YQWA 9ATCB 3UVJB 2VL8A 1X0PA 4A12A 2BJ1A 3AD9C 1AFJA 1RK8A 4XKBA 4LSNA 2KL4A 2ADBA 4NYOA 2ELKA 2Y0SN 2GV1A 4LSLB 1K1SA 3AXMA 1SXLA 1O3TA 4L6V3 2Z9OA 4L18B 2H6BA 3U1DA 4TXSA 2FQ4A 2LSOA 1EZZB 3PFIA 3E1SA 1EARA 3DN9A 1QAJA 4OI0A 3JYTA 3UN3A 3LAMA 3FX3A 1HI1A 3C8YA 4DCPB 1CJVA 1BJZA 4Y3CA 2B9SA 2R2RA 3QAHA 2YKQA 2HLUA 2FA5A 3MKWB 5GAEJ 1ZETA 4M5HA 4YDDB 3S32A 2O0YA 4I68A 1YJWS 2OQGA 1RI7A 1X4HA 1LVKA 1OIAA 3LW5C 2JLFA 3PO2J 1L3LA 3TA2A 5F0CA 3FGVA 1BA5A 4Q2LA 3KNAA 2N4CA 4U7UD 5E3LA 4ZDOA 8ATCB 2JWTA 5ICGA 4USKA 4LVOP 5KFKA 4GRSA 3L2VA 1TV6A 1PKUA 4IH5A 3TQEA 4PFOA 2MQLA 2YPZA 3O8HA 4G1IA 2V1NA 4XLEA 2Q43A 1Q86T 1VQ7S 2I38A 3G1MA 2FPHX 3BP8A 1EF4A 3DPUA 4A0XA 3TYTA 5BR8F 2C2ZB 1XTZA 1XDSA 1DBDA 2H5JB 4XONA 2I2YA 4B1RA 2H09A 1HARA 3LPEA 1S1XB 2F4MB 6FD1A 3ABUA 4DX7A 4Q48A 1Z7LA 1F9FA 2FLPA 3Q0AA 1HIYA 1U8BA 4HV6A 1XWLA 3MEXA 2JSXA 5J1EA 1WG5A 3GXOA 2HKOA 1CEZA 1X9SA 3OL3A 1ZZFA 1BBYA 3ZTQA 1JLGA 2MZQA 5KFXA 4DFMA 1TK0A 2HURA 4RB1A 4BGDA 4L72B 2VPWB 2HQRA 3BR8A 5T7LB 4CLPA 1NKEA 1LB2A 1CGPA 2MYSA 1YVFA 1NSQA 3EUHC 2K9QA 2Z3YA 3M3YJ 1BI0A 4DIQA 3L2CA 2L54A 1ZYRF 3TO9A 4B44A 3DP7A 2IM3A 3LP0A 2BY2A 1O7LA 1B1BA 3BOQA 3PR4A 3EXCX 3VZHA 5LGUA 3CJRB 3GLXA 3GV8B 4XTTA 2XULA 2ZB9A 2XSJA 4LR8A 1GMUA 3MM7A 1G59A 1ZGAA 3EM1A 3HGYA 3NEKA 2V79A 4X1EA 4AE5A 2PI5A 4B9TA 5DYMA 4KFCA 5KFOA 3HIFA 2YKMB 5I42B 1WEZA 5HDKA 3TAPA 4RW8A 2E5GA 3JTNA 2OEKA 3TUZC 2WA0A 4F0KA 2WZ1A 3ZXWA 1URRA 5F8LA 3SZTA 3HL2A 4BH9A 3GP9A 3RRGA 5B0GA 5LXRA 3BR2A 3NMRA 5IT0A 5K7HA 2FEZA 1U1PA 3DNCA 2RQCA 1WQ2A 3HUGA 2JA5J 5HLGA 4AC0A 2CPHA 3BG5A 1HNXF 2JSPA 1JLQA 2IA2A 2Q3PA 3GCXP 1B72A 1T9VA 5AXLA 2GZWA 3VGVA 3MCMA 2UP1A 3M05A 3QBCA 4G1PA 2VHGA 3ZMVA 1DQ8A 4TQSA 1T0TV 2WBRA 1V55H 3MD1A 1S6LA 1F5AA 4IH7A 1RT2B 1SAUA 4H4KA 3DRYA 3FUYA 2NVQJ 1S6PA 3MR3A 5AE3A 4WFAQ 5C25A 1U1QA 3HP6A 2VLAA 2DJWA 1DQUA 4PCQA 4JI4F 2R5YA 2VUGA 2CUYA 4JI8J 2ISYA 4RNFA 2KJCA 4O3OA 2DT7B 3MEEB 3HKZA 1A36A 1JLAB 4Y34A 5AT1B 4ANEA 2YKAA 1F1BB 2FD5A 3M2RB 5BPDA 4LJZF 1DY3A 2V7FA 5GMEA 4A47A 1WOPA 1HSJA 3LGHA 3OYCA 2E2HJ 3K69A 4UOFA 3LNQA 2XC7A 2LMIA 3A8KA 1R0AB 1U8WA 1YJRA 1KU2A 5J3LA 1EH6A 4UUXA 2N82B 2M70A 2RS2A 4A46A 7FD1A 1F43A 3Q8UA 4L3NA 4CLFA 5D8LB 2VKZG 2OU2A 3G82A 1FK9B 1HKAA 3CCZA 3G96A 4NBQA 3G71I 2V67A 3MM8A 3L2RA 4DNCA 5L1KA 4QPTA 5E33A 3BG7A 2ZJQF 3HOUJ 5F0WA 1LDKB 2NVTJ 5LRRA 4GYGA 3SV4A 2HHXA 2C1EB 4EZ6A 4KGVB 5HNHA 2RQKA 4FNHA 3VODA 4UUWA 3GB0A 4TU9A 1KVIA 1FRJA 1EP4A 2V68A 3H25A 4MTEA 3BJ6A 4ZTFA 5EWGA 2QL9B 4EGZA 4QWQA 2B7BB 2R7SA 1NTCA 3J7YJ 1PAUB 2XKOA 1AOYA 2MD5A 2PI0A 3ZGKA 2DNRA 3BY6A 5KG4A 1HI0P 3M8RA 1RU2A 3FC9A 2KJBA 3FXJA 3EZUA 4ZLNA 1ZS6A 3FM5A 1RTHB 4JI5F 3CD5A 2IJLA 2E35A 2RJZA 3W8GA 4UOHA 1W36C 4TV7A 4LB6B 2VV5A 4KB7A 2QJ3A 3HFKA 4NLRA 1RAIB 1NM2A 2DMUA 2VOOA 2EBIA 2VFRA 2FVRA 1WDDA 1N32F 3GO5A 2L5QA 1HNIB 4Q44A 1V5EA 4ENJA 2C6YA 2MHNA 2UUBF 3N6MA 2JFDA 4XKWA 2P5LC 3F6OA 5HDNA 3E3XA 3CC4I 4DEZA 4IRCA 2QMXA 3GFXA 1EH8A 1X1DA 2QLXA 1LE8A 2AX0A 2PC6A 2HRTA 3WQPA 3OOUA 4P75A 2HSEB 3I0TA 1HF0A 1IN6A 5AONA 2E1NA 4F4YA 3BDDA 4NLVA 1RP5A 1UWBB 4N5SA 2A6TA 5J2PB 2HQCA 5DM7F 2B4OA 2A3JA 3M30A 2ZJ2A 3QU6A 5GTHC 5J4VA 4XKCA 2ROEA 4LITA 3U9GA 3J7AN 1MBKA 4L9NA 1NK6A 3CCSS 8RUCA 2BE7D 3UD4P 1S9HA 3K5PA 4BXUA 4OLOA 2KRHA 2Q1LA 2Z1DA 1ETKA 4DV0F 3MM9A 3F72A 2PLYA 1DTQB 4DUTA 3HTUA 1ZRFA 2AJ4A 3I87A 4Q5VA 1H9GA 4WK1A 1AA7A 2D1VA 2AEJA 3GIJA 3OMYA 3G2BA 5CZVA 1XMOF 4ZYHA 2PG4A 4AU7A 3B02A 3M8EA 4U0YA 3H5AA 2FHJA 3GLLA 2Y0SD 3BN4A 4BWMA 3NWSA 2QFIA 3V4MA 3W2VB 2W9BA 4ZVOB 2VJ4A 1LWCA 4WKRA 3CJ4A 2DPJA 2R0QC 2JC0A 4ESFA 3RR7A 1VQMS 5AXMA 4KYWA 4UVAA 3WHCA 4J9NA 3ETOA 4I1TA 1VRTA 1JXSA 2ZWPA 3W2AA 2M3AA 5GAGI 1RYSA 1J5OA 4F3OA 3TZZA 4YEJA 3DKWA 1V3RA 4X4OA 3W64A 4CO0A 1D5YA 1HWUA 2MW8A 3M6VA 5DQIA 2XG8A 3OYMA 1WJEA 2DNKA 1KVJA 2OF7A 4IO9F 3LWLA 3PFOA 3AL0B 2RDDA 1NK3P 4EUVA 5J1PA 3IAM2 2V6EA 1NG6A 2L7FP 4KHRA 3HC7A 2VBZA 2GQCA 2BXZA 3K6GA 4DX6A 2GXAA 2IDEA 2JLGA 2KQRA 2DRAA 1SC3B 3OR1A 3IAS2 3DXJF 4W98A 3M8YA 1WZ2A 1R8CA 5HQLA 3Q0WA 2A69F 4LRAA 2Y0MA 1PILA 3GYXB 4RKUC 2I0XA 3W2VA 2W9BB 1JXVA 3MUTP 2W00A 1C0TA 4UY85 3BS9A 5DUIA 2Z99A 1J9IA 4RW6A 4M73A 3PW4A 1MMAA 1DHMA 1GV2A 2X9DA 2ASDA 3QJLA 5IQ6A 5FFXA 2EBEA 3M2VA 2HR3A 3HG9A 1HNZJ 2Z30B 2ZC4A 2CVEA 1QZEA 4PR6A 2V1UA 2G1DA 3CD7A 3QQCD 1PUFA 2KHCA 1AXQA 1UVKA 2YXLA 3WE2A 5B08A 5HMZA 3GX4X 1M90T 4ICLA 4FT8A 4IR9A 1OR7A 3FXQA 3WTSC 5KT5A 2BVZA 3G9CA 4PQAA 4XSXF 2RQMA 1XMOJ 2ZH2A 4BEHA 4DBRA 3T0YA 4RW9B 4JV5J 2J0XA 3G87A 1FIAA 2CNNB 3HD1A 5DG7A 2ELHA 1QSYA 3MR2A 1JT6A 2DO4A 3DOLA 4RO0A 2KG1A 2YPYA 2A3SA 1N56A 1GHCA 2D3O1 1WHWA 3SHFA 4UV8A 1M5SA 3OR2B 2EFPA 5GMDA 1NEEA 4CO1A 3MCZA 4YY3F 4J9PA 2J7UA 1I50J 2M8GX 1Y0UA 2A07F 4C4WA 1FI4A 2DK5A 1GDTA 4FDFA 2ESHA 1YX2A 2K7KA 4IFVB 4HH0A 5CYMA 1U6ZA 5K8PA 1ACIA 3TOQA 1O51A 1NJZA 4USHA 1ZARA 4DN9A 4I7FA 1B3TA 4DV1F 5GAHI 4MIWA 1QE1A 4IZZA 4OYZA 2XY5A 5LSLA 1S76D 3TARA 2LBFB 3E01A 4LRCA 3TP2A 2FB0A 2HGNA 1Y5LB 3JR9A 1VQ8I 3SBMA 1AUSL 2A2DA 3IMQJ 1ZBTA 4F3QA 2FC8A 4JYKA 3ZQHA 2HRYA 1YO5C 4N0BA 5F9NA 1SJ3P 3CDEA 1BE4A 3R1LA 3ZFVA 2MTLA 2POKA 4ELTA 1MMSA 4F3MA 2KH9A 3VB2A 1TZ0A 2DFFA 1Z2LA 1TKXA 3R2CJ 4HTJA 3IUOA 1VBKA 1JJ6C 3RB3A 2YS9A 3PSIA 2QF7A 1RGVA 2GW8A 2FYXA 3MM9B 3GUDA 4LF7J 2EK6A 4CO5A 4A3IJ 2GX8A 3OTOF 2R2UA 5FLVA 1G6NA 2HVRA 1EIYB 5DD4A 1JHFA 2HOTA 2J8SA 3DYAA 2MY7A 4DPOA 4G6DA 3SXYA 4ETSA 4AIJA 4I6AA 2HVQA 3O3LA 3H4BA 4UQTA 3PJRA 3FM3A 2RHQB 1IWGA 4DZ6A 1SKRA 3WC0A 2VKHA 2J9CA 4CCNA 5KFTA 4NXMF 4AT1B 3LSIA 3W61A 4RAFA 2AP6A 3JSPA 1S9GB 1PJRA 3HYIA 5KVRA 2AEMA 4IHTA 1CG2A 1FKOB 1MNMC 3TGNA 2P81A 4HV5A 1FFWB 1FYMA 1S9GA 3MURP 1XN7A 2VKRA 2P2CB 3KK1A 3QYEA 3VOEA 3M1VB 5DDGA 2HIQA 1IBMJ 1SC7A 1WSRA 3CMES 4EM1A 2C2KB 2AJFE 3AFHA 3LMMA 1BLUA 4IQMA 1O4XA 3HJEA 3FRYA 3KCCA 1FEHA 1NBEB 2DFHA 1F1ZA 3CMAS 4OZJA 2DU9A 1URNA 3ET6B 3CVKA 1Z3XA 1LEOA 2V50A 1MN9A 5BQTA 1HCRA 3JXOA 4FTHA 1D1CA 2LQ9A 4UXNA 2OSQA 3DKDA 1WJAA 1TVRB 4ECZA 3K2ZA 2DTRA 5DV5A 2K4JA 1RAEB 4F36A 1S10A 3K5LA 1T33A 3KIOA 3IKVA 2ZNYA 4ZYGA 2R7UA 1S1VA 1U8SA 5HNFA 3ZMUA 2CQNA 2K7LA 3OL7A 3L7WA 4QWEA 1XGMA 2F5VA 1VQ7I 3NP5A 1X1CA 5LHIA 5H6RA 4R25A 4E6KG 1STZA 2PFDA 2X1DA 1UAAA 3CQZJ 3ECOA 2HFHA 1T0FA 2HHPA 1WELA 2DHGA 1RCOB 1Q1KA 1FDDA 4MK8A 4IL6C 2G0EA 3QZ8A 1DDNA 3RKQA 2HI3A 4GFBA 3FFIA 1HLVA 4NLWA 4XKVA 2HNDA 1HNZF 5JHUA 1HNVB 5GAHU 3ESWB 4RWXA 2LYVA 1D0XA 3SFIA 1JUMA 2JX2A 1ZQ3P 3VWSA 3VGUA 4C8ZA 1SMYF 2OBPA 3GIIA 2DA5A 1TZLA 4KSEB 3VPRA 3RB6A 3ZMZA 3RPUA 4A5NA 4ZVTB 1IZ1A 3QFHA 4HNTA 2XHKA 1TP4A 4OYAA 1RC9A 1WACA 2QA1A 4A48A 1OSDA 2YH0A 3CB4A 4M5KA 2PN6A 5IT9K 1BWVA 4J9MA 2XZTB 2FJDB 3IN5A 1ZA2B 2XAJA 3CCWA 4ZVFA 3IAS9 1KDNA 3ZMTA 3ULHA 1TL3A 1SQGA 2WSEC 4XRSA 1FZPB 3GPAA 3KUEA 2DISA 2O8KA 3D7SB 1X5SA 4KV8A 1PJ5A 1E3OC 2UXBF 4KNYA 2YY3A 1R6RA 1RBOB 1IKYB 4ZVUB 3EVWA 1KQSR 2AKWB 2O01C 2ZBKA 4M9XA 1FT9A 5AXNA 4I76A 4M5IA 4CM2A 4XMYA 1U45A 4MYTA 2PMWA 1H89C 3JRCA 1R49A 1DU0A 3PTWA 4DR2J 1JLQB 3JRAA 1WJCA 2CRGA 2IM0A 3OYHA 1BGXT 4CH1A 3IO1A 5ETRA 1ITYA 4DQSA 1QE1B 2BZTA 1VQ8S 2QL5B 3HHLD 1U6FA 3TANA 4DHVA 1N33F 5JFRA 4PG8A 2DDBA 4A8QA 4OZ1A 1R5HA 5ETMA 2QN6B 1HMVA 1BR2A 5E41A 1HXDA 5CD4H 2WBMA 4LF4F 4FETA 2XMJA 4PG6A 1S1WB 3RW6A 5ICCA 2GJ2A 4X6AJ 1MBFA 5GAGJ 2FVCA 3S14J 2FBIA 2ZFHA 1FKOA 3TW7A 3HXLA 4NLGA 2IJFA 2HFOA 1VQSA 1BIAA 1WG4A 1RETA 4PWDA 2DITA 4Y2IA 1O7FA 5LLQA 3AAFA 2E66A 1D0EA 4H4OB 4PJLA 3HHDA 5SUHA 3QYFA 4C98A 2F63A 2TDXA 1RPWA 1U25A 4WF2A 5D5WB 4MO7A 5IZHA 5IT9Z 4QPOA 3AA9A 1J7KA 2WRMA 2QSFX 4DR3J 4A0ZA 4XRFA 3JAMY 1XG1A 1A0OB 4PGHA 4IX7A 1X5OA 5ETLA 2EILH 3LA0A 4U87A 4CLSA 3NNHA 2NYHA 1B59A 2E5JA 1VOMA 3CCJS 4ZJZA 3R7SB 1S1WA 5J47A 4G1QA 2M8EA 4DG1A 1LK7A 2C2MB 3CCUI 2XB5A 2O3DA 4C3HJ 2XO7A 4A3JJ 4G7OF 4XIDA 2XTJP 3KK1B 2QLBB 5FRMA 3SQOP 2JL9A 4HX4A 1QM9A 4L5JA 1YBAA 3J81j 4ESBA 4NXNJ 4PPZA 2KMUA 3MR5A 4IYQA 4IH6A 4RGRA 3FNNA 2PMHA 5F8JA 3QRFF 4X4SA 2BANA 3G6ES 5C44J 4TLQA 5KG3A 1VK3A 2YNHB 2F4VJ 2R7FA 4W92B 4ZPVR 1LKZA 1AU7A 4UVCA 2B8PA 1K7AA 2LREA 4OJGA 3P3DA 1P8GA 3FDYA 2BJEA 5D6GA 4URQU 2M5WA 3VAGA 3MUMP 3DLGB 2R2TA 2Y0BB 5KG1A 5D4OA 2MABA 4RPFA 4IR1A 4LF8F 2LQ8A 2ZCWA 2ACMA 3OT9A 2FHOB 3CLOA 3RTVA 1L3UA 1Y11A 1RT7A 5HMYA 2DAOA 1TKZB 1B9NA 4LJMA 4BJ6C 2EFVA 1EH7A 4YIRX 2PD1A 4DFJA 5E3MA 1FJLA 1IM6A 2G1HA 5L3FA 2STTA 4OI6A 3U02A 3FEYB 4IHVA 1XCBA 2JJ4D 3FEZA 1ETWA 9RUBA 2ZC2A 1FDAA 2DI3A 5LGNA 3T19A 1N54B 1SANA 5A2QZ 1DU6A 2WAQD 4J9OA 4RLEA 4WIIA 1R1UA 1KHVA 2K4BA 1KSPA 5J40A 3HVRA 3BGOP 5HLTA 3RDIA 1U6GA 2VJVA 3OYGA 2ZFWA 4XK4A 4F4ZA 3NARA 3HDSA 3FCHA 3WDOA 4X66F 1I6JA 1N5VA 2O9LA 3SXLA 1WRJA 4OX7A 1N32J 1USSA 3KEYA 4PXDA 3JAMU 2Q2EA 3S1QJ 4W97A 2LC2A 1RLDA 4G12A 1W7PB 1W2BR 1C4AA 4MTDA 4A69C 1VQNI 3S2WA 3K4MA 4ERDA 1HW8A 3KLGB 1HD1A 4HAMA 4MKBA 4NLUA 2B8QA 4P96A 1DLOA 4XLFA 4K5SA 5ICFA 5EUHA 4KT0C 3QAUA 4OL8A 3M7VA 2DPIA 1BW5A 4X4UA 3TQ1A 1U2RA 2XNQA 2VG7B 1DGWY 1H0HB 2EZKA 1O0PA 2EW9A 3Q3SA 5D4SA 4AYBA 3R7BB 1X4OA 3KJNB 5ETTA 1UVMA 4B9SA 2DRDA 4J9VA 4JI2F 3VAMA 3PIPQ 1MH3A 3N05A 1WTBA 2R8KA 3PIPF 5LGTA 4OJHA 4IO1A 4WWSA 5D5VB 2W7AA 1S5ZA 4KKOA 2FLNA 4V19K 4Q43A 2APOA 4USVA 3BYPA 1NJIT 3FMRA 3M8QB 5LHHA 3R1HA 2A5YB 4CP5A 2J7KA 5HMWA 4FYDA 3IL2A 3O2PE 3BZQA 3IRXA 3C66A 3HSDA 4JI0J 1ACMB 2P6SA 2CJQA 4TY9A 1HWJA 4J91A 3OS2A 3M8QA 2VQFF 2ZXWH 3R27A 2CGPA 1TKTB 4DZPA 4WF9Q 1TNSA 2ZD1A 5F41A 2XGQA 2ZE2B 1RU1A 3Q5FA 2UV8G 3OLBA 2OA4A 4BQOA 3WTXC 1NK8A 4PK4A 6AT1B 3QLHB 4XRMA 2NSBA 2PA8D 3ZTPA 1J5OB 3BF4A 2K06A 1KFSA 1VRUA 2R4GA 5IOLA 1SIZA 4FQGA 3N4MA 2JC1A 4RX6A 2NS0A 1JTYA 1Q95G 4OJ1A 4B9LA 5HK4A 4C6AA 5FJ8J 3A3PB 1H0MA 1QY7A 3J7Z5 3R4KA 3OS1A 4E8UA 4XIUA 3CO7C 4PDKA 4ECYA 5BJRA 2LMDA 2KT5A 1K9MT 5DS7A 2G2YA 2RV8A 5EDNA 2Y1JA 3QO9B 4FF1A 2IRFG 5DQGA 2XWXA 2K02A 3NS7B 4RBOA 2OI2A 3P49B 2OGUA 4ABZA 1FESA 3QT6A 2LR8A 3S15J 4D3HA 3UWTA 3C18A 2MKHA 2KO1A 2GJIA 4RDUA 2DXFA 7FDRA 2K3FA 4WFZA 2R8HA 1NK5A 1YG0A 2BJ7A 1R5GA 2HOAA 2JZ5A 2G0JA 2ACJA 3HSZA 1FBSA 4Q8FA 3KP4A 3QPIA 3D6HB 2A6MA 4OMYA 3HF5A 3E2EA 3JQJA 2DHSA 4NCBA 1RADB 3MAQA 2FMLA 2XAQA 3EUKL 1VRUB 4LFCF 5HP1B 3F21A 1JLAA 3CD6I 1QD1A 5B3SH 1PYOB 2DNMA 4NCGB 5B5EC 2BQ3A 2FUG9 2E1CA 3GTYX 1KTQA 1R6VA 3SYZA 2HVIA 2YBVA 1E3HA 4GMKA 4XN0A 1WC3A 4B3OA 3R9LA 2YQ1A 1YJWI 5I4MA 4B08A 1S3JA 1X1AA 2V69A 3RZDJ 1U5TA 3ZQ7A 2NNNA 2I8EA 5F8IA 4B48A 3MAAA 2LP4A 3BKUA 4M94A 1C1CB 2MC4A 4I02A 2L9SA 2QMUB 4ZJLA 1RESA 3E5QA 1JGSA 3LP0B 4IFYA 3LA2A 4ZYAA 1NU4A 3K59A 3T1YJ 4OHVA 5KOXA 3PFYA 2W1BA 1L3SA 4A3EJ 3H92A 1P4AA 1M1GA 3HVTA 2K2PA 1IRXA 1B8IA 3DOMA 3A13A 2J0WA 3OBIA 1J5EF 3PNIA 2K3PA 4NA1A 1FRMA 4M5MA 2WTEA 4URGA 4K4XA 3PW0A 5E1WA 2HHHJ 3MQ0A 1XSXA 4O3PA 5J1EB 4D7NA 5FD5A 1OYWA 4DPWA 4RUAA 3F0CA 1FJCA 1S1TA 1T39A 5IV3A 5IC4B 4YY3J 1R58A 3HOYJ 3JQMA 4R8UA 2LDYA 2WB4A 2RQ4A 4DWIA 2Y8YA 3H3VK 1L3TA 4OX9J 1YX3A 2K9SA 2Y9YA 4KE5A 3DXBA 4QR0A 2BV3A 2PEBA 4G7ZF 4QIWN 5IY5H 4I7FB 1TELA 4IUFA 2NZ4A 3IH3A 3FCVA 3C2GA 3HJVA 2Y1RI 3MHYA 1AZSB 2J5PA 1LWXA 2ZXJA 3AODA 2Q2EB 3I9ZA 5IT3A 3K4BA 2KHMA 2CFOA 1IDZA 1SL2A 3H5YA 1KOHA 1D9FA 3CMMA 3QRQA 1LW0A 3WIUA 3OTDA 1RWWB 2HK3A 1R8AA 4RGSA 2IMOA 4AXJA 2BHZA 3HRMA 3VSLA 1YITI 3QJPA 4M5JA 1CC7A 2HHVA 2G0CA 3LSRA 4GCVA 2GO8A 1VI7A 5B66C 3G2XA 5AE2A 1EP4B 3DRSA 2JA6J 2V4JB 3H90A 4K4VA 3W7BA 3AOAA 2BOLA 2KRBA 3C15B 4Z6YA 1Y9OA 2FXAA 1WF0A 1CVJA 3PZPA 2RD5C 4YP3A 2CQQA 3K2YA 4NYPA 1P9YA 1SMTA 4WXCA 2VZ9A 4FVMA 5D5XB 3IG1A 1G6BA 2BJ8A 3ZC4A 3H2UB 1W1WE 1D5VA 1LXJA 2GBYA 3MGJA 3J81U 4LF6F 2DPUA 4KMUX 2CS3A 3LAJA 2X1BA 2WB1A 2VONA 3K70D 1N88A 2ADCA 4ENKA 2R7WA 3K8WA 5HQ8A 1K79A 1P92A 3RZOJ 3TO6A 3BGRB 4N8NA 2E1OA 2HS3A 4HTIA 2DNNA 5KFWA 4LLLA 1HBMA 4DZDA 4A3CJ 3KFWX 4TY8A 3IC1A 2XS2A 1T02A 3QFWA 2JRMA 4PQUA 1SJ4P 2OPSB 4KC5A 3SCKE 1PJ7A 4F4XA 4LQ3A 4QIWD 5F1JA 4CH0S 1XMAA 2AQFA 1S79A 4A6EA 4NL5A 2M7BA 4L5IA 3PQKA 2XHWA 1S7EA 2MFZA 5GTIC 2ALZA 1TKDA 1JQGA 3ML6A 1L5UA 1MD0A 3LFUA 1Y56A 2QKMB 4IPAA 2ZH8A 2CJXB 1X2NA 2HRUA 3FSXA 5T14A 5B1AH 5KFLA 1I1SA 3F23A 2DXEA 5EWEA 2CJBA 1B0PA 2Y9HA 1SUQA 4TU7A 3QNWB 2FE3A 2FNPA 3MMCA 4Q4ZF 4MMOA 2MMYA 5FFZA 4F4WA 4DSLA 1RAFB 2H1YA 2V26A 3ABLH 5LBQA 3V7CA 4J37A 1CJVB 4P6QA 1SKSA 2B9YA 4EFAC 2QA2A 5H9FJ 4D3GA 4OZNA 2Q6BA 1IUFA 2FQQB 4KIGA 3IGNA 1YQAA 3ZQFA 3KEOA 5C3EJ 4EBDA 1NHAA 4QSHA 5KFZA 4KISA 4W1UA 3CE8A 2I5JB 1FBQA 4G1QB 1YBTA 1OY8A 3UR3C 3BDPA 5LJ3Y 3LTOA 4C0BA 3CDLA 3LOUA 1G8XA 4LVNP 2PE8A 2ZMEB 4RNNA 2H48B 3GILA 1RHRB 2EIJH 3Q23A 2Z16A 1FTTA 4Z2YA 1BUXA 2Q66A 5ETPA 5G0RB 1OQYA 1S49A 3L9ZA 1FF2A 2COLA 4QCLA 5E20A 3F8MA 4DV5J 3UNYA 5M3MJ 2XMWA 1S1VB 4RGUA 4I2PB 4LR7A 3E3VA 2DBBA 3W9IA 3DLEB 2VT2A 1HW1A 1IM4A 3S2HJ 2VICA 1VISA 4M9ZA 5BS6A 2IT0A 3M4OJ 2J0QD 2RB7A 1KQ0A 3QP6A 4I2PA 2IS6A 4B3RJ 4GVBA 4ILLA 1EQ0A 1FO1A 1SD7A 2RU9A 3M1EA 4M3BA 3R5GA 5KG6A 4JI1J 3KLIA 2Z58B 5EG0B 3VGSA 1VQNS 1TUVA 4MFEA 1S1XA 1T95A 2OAUA 2GAGC 1D1BA 2QEXI 4KQZA 1ICEB 3BR3A 3EICA 4F67A 2OCCH 1VIXA 1WCMJ 1IUJA 2CZ9A 1D8YA 1XDUA 3MPWA 4JYAF 1OPZA 3MKYB 3Q0VA 3Q22A 3T5JA 2O03A 1Y1VJ 4ITVA 2FQ3A 2I8DA 5M5YJ 3QPLA 2WB1N 3H5NA 1YYVA 3AG3H 1LWFA 4ZVRB 2VA2A 3IWLA 3DU6A 1FTRA 4IG3B 3C6UB 4JI4J 4RZRA 1RAGB 1X3UA 2E2IJ 3CD6S 3FXLA 1P1LA 1B9MA 1CJUA 4JX4A 3LP1B 2EINH 3SFUA 3UCGA 2KHDA 4AVZA 1RWVB 3BG3A 1JJHA 3MMYB 4U0WA 2HS4A 1JLBB 3DRPB 5TRDA 3P5TL 1ZGWA 4PUOB 2Z57B 1J0RA 3OXFA 2ZH6A 4DMZA 1WJ9A 2K5CA 4NEZA 3BJAA 3QRRA 4LB5A 2ZJQQ 1RHMB 4Y2KA 4M5DA 4OYWA 1PAEX 2KXHA 4HLXA 3JRDA 3QYYA 1TL3B 3P96A 5I3QA 4TU8A 1T98A 2F9DA 3IH4A 1YW7A 1OCZH 1RAJA 4OX9F 3UDVA 4DV3J 3I96A 1IQZA 3OYIA 2AJ0A 5LT5A 1Q1HA 2ZUGA 1ZG1A 2OCEA 2M9HA 1RKWA 4OHYA 4O3MA 2WVCA 4CI0B 2W7OA 1XSVA 2DA1A 3MD3A 1Q78A 2XAGA 3CCJI 4ZLLA 2D9OA 5B0EA 1FEEA 2YKMA 2NR0A 2CJYB 2M8HA 4EU0A 2DEIA 1YIJS 4I01A 5HS7A 2G7HA 3SQGA 3NL0A 1W36D 5A0YB 2MGQA 1JKHB 1NH8A 3PXGa 5A2QY 2MEWA 2HNDB 5D15A 1PYVA 4XK8C 4K50A 4IRIA 2ZDPA 1QVGR 5K7ZA 1W5TA 2PA3A 4ZVSB 2EJRA 3ZMSA 1DP3A 2KFZA 2LY1A 4WX9A 4ALZA 1RWMB 1OY9A 2XF7A 2D41A 2CV1A 4X62F 1WKKA 4QQBA 2CQHA 2B7CB 3EPGA 2U2FA 2BZ2A 3JSBA 5HO4A 2UV8A 4IQXA 3PV8A 2H94A 2IJRA 1HNWF 3RI4A 5KFPA 4DQIA 4MNUA 2RGVA 1MSFC 2GIRA 1KQKA 4WE1A 4A93J 1T38A 1G3OA 1IN4A 1N75A 3TAQA 4CYCB 1ZM3A 1YIJI 2KFYA 3QYBA 3S3NA 2W48A 4RW4A 3RB0A 3W1YC 3EDPA 2HXIA 2VIXA 1F0XA 2M4GA 4DR6F 3DGPB 4QIVA 3S1TA 2PMZN 3W8PA 5A0YA 3TEDA 3HHLB 4RNOA 2BR0A 1IJEB 3VYUB 4BDYA 4XPEA 3IRWP 3GFZA 4OYXA 1RKTA 2NXUA 3EVMA 3LPYA 5L46A 1H72C 2ZZTA 3JCUC 1F5CA 2ABYA 4G8XA 3DLHA 2CU7A 1BL0A 3X1LB 2GVZB 2AGPA 4BWJA 1S0MA 3M8ZA 4LFBJ 4RJVA 2MC3A 2LDUA 3HFVA 1PCAA 3HDDA 2YU3A 1I5OB 3CGIA 3ENAA 4A8MP 4MQVA 5CAAA 5D8HB 1S9EA 3VWBA 4CQ1A 1FCAA 2AEFA 3NXZA 3BBFA 1JKQC 3OV8A 3PEJA 2CV0A 5B1BH 2MYFA 4WK3A 3AD8C 1V5VA 3D0GE 2JN6A 5IP9J 4LIRA 1R89A 4KO0A 2MDAA 1NPKA 4M1KA 3KDNA 2IAJB 3SYTA 1H8AC 4DSKA 3DRPA 4AL7A 1ZLKA 2E9ZA 3PHTA 3BGUA 3CDAA 1GUUA 4FYYB 3UR0A 4F93B 2EZLA 3B6CA 1JGGA 4MH8A 3GTKJ 4ECQA 2P9EA 2CKWA 5B0DA 2YNIA 3LAPA 3E5UA 1VQLS 1FXDA 2WWYA 4A3FJ 4KR0B 1OJLA 4F4AA 3HHKA 3PKYA 3CSKA 2LBFA 2BE9B 1HNIA 1MMLA 4Y2AA 4DL4A 3S1NJ 1SC1B 2IYGA 2CVIA 1OS5A 4QIFA 3TW6A 3MFIA 1IDYA 1ZR4A 3P9IA 4II2A 3ZN1A 5IYBJ 2A2CA 4X4QA 3NGSA 3DOLB 5GPAA 1KGSA 3M2UB 2E5HA 4LMYA 4RW7A 3R7NB 2ZXIA 2ZJRF 4ZYEA 2EC2A 2LNBA 2LTPA 1RZ4A 3CJ2A 1I39A 2X1GA 3RR8A 4KFBA 3KP5A 2MLXA 2CRLA 2R5ZA 2IEKA 3GFJA 1GXTA 1QLNA 2LH9A 4Y13A 4TYBA 4RU9A 3H5UA 3K2AA 2OPQB 5CPRB 5DCMB 3J7YU 2XMMA 2JRTA 1DPUA 1WJBA 5C2CA 1CQTA 1WSVA 2VG5A 3BBBA 1VBXA 4ZCKA 5L39A 3X2QH 4NWBA 5C42A 3RQIA 1IRZA 4HHUA 4Q45A 1NDLA 3V6HA 3OSFA 2QQBA 3IG1B 2EFOA 4BS9A 4M3EA 4QOTA 2QYOA 2VQEF 5KFEA 2FLLA 1TAUA 2ZMEA 4EO8A 2C3UA 4G3IA 4CDIA 1N77A 2DOAA 5JLXA 3Q8VA 3CCMS 2DLLA 2I5JA 3OTCA 4HYKA 3CCVS 2RKIA 2MSYA 3C2BA 2HFZA 5EGOB 1K61A 1ZLJA 3A8EA 4RW6B 1ON2A 4A3GJ 2QTWA 5IC6B 2QQAA 1N6QB 1HR0J 4F2RA 1O8BA 1TWCJ 5J1RA 4K0KJ 2AJQA 1Q7LB 1HBUA 2LP0A 5DZ7A 2X6WA 4QPQA 4NZ6A 4MFBA 1JE8A 2IBDA 4HOBA 2CG8A 4WTYA 1CF7B 3HT3A 4XICA 1UPPA 2NCKL 2E1MC 4KT5C 2M0CA 3OYNA 4IRGA 4QR1A 5IS2A 1RTZA 4ZP8A 5H2FC 3SFGA 2XAFA 1UA1A 4O3QA 4Y65A 2OPRB 1VBZA 4Y6IA 1XGNA 2VOPA 3V42A 5LMNJ 1IW7F 4MT1A 4MHGA 1G1XA 2F4FA 2VG6B 3DEWA 2YX1A 1MNEA 1W0UA 1KTVA 1S6OA 4C0OC 2X7IA 2XM3A 2ESNA 4RWWA 2N8GA 4ATNA 1SD6A 1YI2I 4NHJA 1AKHA 3KHHA 4IOCF 5H6QA 2VKVA 2PFBA 4WYWA 1WKJA 2XLKA 3FJ2A 3DKXA 2M1BA 2HZAA 2ZM6F 4R0JA 4NQWB 2B0LA 1IBMF 1PP7U 2FJEB 2ZOGA 5HROB 1L3KA 4FX0A 2V8VA 3GW2A 1ROFA 1BOAA 3I59B 4UB8C 2Y3YA 1ODDA 1WF1A 4BNCA 2LVSA 1OYEA 4KAIA 4A8YA 1I94J 1SKUB 1JK9B 3OQ2A 3K89A 3GJRB 1TU0B 3UD5A 2K3KA 3CJQB 3OIPA 3DHXA 3ECHA 3ULQB 3D2WA 4EZ9A 2P7VB 3CUQA 3QGHA 2JK3A 3LSPA 3PO4A 5BYRA 4F02A 4GXOA 2ECBA 2L9DA 2EI5A 5JVHQ 1NKBA 4BJTA 2HVZA 4KPCA 5B0BA 1T7PA 5GP9A 5IQQA 3NGUA 2ROPA 4OAZA 3EUAA 3MZIA 4Z2XA 1HW2A 1DURA 2IVFB 3Q8YA 3THPA 4YR3A 3TOAA 1SFXA 1K4TA 3EVOA 1HDDC 4TYAA 2V9WA 2ZBPA 2HFSA 2CQGA 2OEJA 3AT1B 2PDAA 3GFLA 1LFPA 5KFDA 4B3RF 3I53A 4U7CA 1CS4B 1MWYA 4WK8F 4E7LA 2GAUA 3VV2B 3S1MJ 3V4IA 1MSWD 2F3JA 3GIKA 4DL7A 2KRRA 1KHWA 2QYCA 2ZHOA 4WZQA 4KPYA 1T3OA 3U27A 2Y0SA 4NLDA 2EA2A 1YK9A 1YZ7A 3PUFA 3WG7H 3P8BB 1JLCB 4E7SA 2NSCA 1FFGB 4IEJA 2CAJA 1UEVA 2UXXA 3O3KA 1ZAOA 3OYLA 1VQYA 3PDNA 4ZKAA 3KK2A 2BE5F 4DV7F 1ZYQA 4C8OA 2IFXA 5DCMA 1EAYC 2F2EA 1YJTA 2HQIA 2VG7A 3C19A 4I69A 3CJTB 4C3MA 1UW4A 2EPFA 3OL9A 2VJ5A 2PX9A 3NQOA 2W2MP 4P10A 2BEOA 4DV1J 4QLCU 1LKXA 5CZXA 2CQ7A 3ZXSA 3JS9A 1FXLA 4CCJA 3N97A 2YKNA 3KKFA 2B9WA 2W4PA 1RT2A 3EE3A 1V3ZA 2MKSA 1Q8IA 4O4RA 2KTQA 4OI2A 1N5SA 3KLHA 2DCLA 1SJFA 1KLMA 5IT9Y 3NY0A 4ZCMA 4DR1F 3PYEA 4RU2A 3IKTA 4OV1A 5KT4A 2BDPA 2R5YB 1FJGF 4C8MA 2FNAA 3VYTB 3VAFA 1VYAA 3J7YI 2UXCJ 4RBTA 3WGHA 3HOVJ 3MZHA 5DLGA 2R7TA 2FOWA 5KG0A 2IS4A 2CJ9A 1BC7C 1UWAA 2VG6A 1VTNC 5LMUJ 1KYWA 1WJDA 1U6BA 2TCTA 1WOOA 4MKYA 1X19A 1RJJA 2NUUG 1UHSA 2R7XA 2NVUB 1H98A 2K40A 1H88C 4ID8A 4I2QA 1FK9A 2ZNZA 1E0EA 1R7JA 4I09A 2BY1A 1U09A 3HKWA 2KN4A 2FJBB 1QZZA 2K86A 2LFVA 3HHGA 1XERA 2IAJA 1C1CA 4K4SA 2HGCA 5KT6A 1BI3A 2L4MA 1CSJA 2IM2A 3MPVA 4O4GB 4LK1F 4DV4J 2X6YA 3SCJE 3U1KA 4GC7A 2JJ7A 1N5YB 2JH3A 3EPZA 2CPZA 1S7HA 4WFNQ 3L2WA 2LKXA 1VDHA 4EEYA 4IJAA 1WC0A 1W25A 4NQWA 3HHLA 2YQ3A 3CO9A 2QSWA 1MJBA 5IP7J 3DGPA 3TX0A 2XAHA 3K4NA 4AQYF 4LRDA 3KUGA 4XNFA 3T6BA 4BQQA 4DUZJ 3NRVA 3W2WB 2AMCB 3CJSA 2GLOA 3BJYA 4DV6F 1V3SA 2FJVA 3M8PB 1P9QC 4PZVA 3KLVA 3DBHB 2AJ1A 3PYDA 2TRTA 1YJ9I 2D3OR 1NK2P 2LFBA 4F50A 1TR0A 1Y0NA 2XLJA 2ZVSA 2WW4A 1VMBA 3E97A 3D3CJ 3MM7B 2EV0A 2QSHX 1S9EB 3T5LA 3C1DA 4NUBA 4J90A 3A2KA 5KAKA 3OXGA 2AHQA 3IM8A 1IBCB 4PEOA 1RTJB 4C7QA 3SSQA 1VQPS 3AQOA 1FX7A 4PZJA 2H1LA 4PXEA 4D7MA 2F9JA 3IR6B 4OI1A 3VFZA 5LD2C 4YIIA 1Q53A 2OMOA 1UWBA 4RUCA 3H42A 2DGOA 2GMHA 1TKXB 1X2MA 5F8HA 6FDRA 1YJUA 2HAFA 3QOPA 2JWNA 2B7EA 1RHQB 2RAQA 4EVIA 3R8YA 3H5SA 3Q0UA 5HANA 2MKYA 1GXPA 2DGSA 1NZAA 1XN9A 3ENVA 2BE2B 3J80U 4OZLA 3KNGA 3BQ1A 1LK5A 4I0AA 1O57A 2DCEA 3LOCA 1TMMA 4QW8A 5L3CA 2GWRA 2AIRB 5LSOA 2DOEA 3BG6A 4NRUA 4NLXA 2J9EA 1QSLA 3TR5A 2L9RA 1BIBA 3ZTOA 3QJJA 1KR4A 3WZ0A 4KYZA 4O3NA 3MAHA 2JEIA 1ENHA 1QSSA 3I0RA 3DOKA 1SH3A 2XZWA 1Y39A 1UMJA 5M3FJ 3HSRA 2DYSH 3AY0A 4B3SJ 3C2PA 2CW7A 4ED4A 5CYQB 5D77A 2W01A 1FMWA 4ZIVA 2RMLA 3AH6A 3HPOA 2VU5A 4RNHA 5KFHA 3BT9A 1XMXA 3WU0A 3LSTA 4C2UA 2FX0A 1UETA 3AG1H 1RA7A 2XROA 5HL7Q 1XPXA 2DQLA 2ZBCA 4F0MA 1I6XA 2D1HA 3P5JA 5KFCA 3RGIA 2CNOB 2QENA 1U2WA 3B82A 4UUTA 1HDPA 1X7VA 3HSJA 2CA9A 4EV0A 2DPDA 1EJ9A 2RN7A 2IGKA 4U88A 2WADA 5LMNF 1WWHA 1PUFB 3DMJA 1BM9A 3CCUS 2R8JA 3DRRB 2GHWA 1T11A 5TISC 3ZZZA 2DT6A 3HO1A 1ZGJA 2FGOA 2GXBA 4I56A 1TQIA 2KYXA 5E5NA 2QC3A 4H54A 3JSMA 2FJXA 4I6WA 1ZTWA 5ETVA 1N34J 1Q4RA 1Q81T 3PACA 1BWEA 3FVYA 2XYGB 3M8SA 2A6OA 4WYLA 3OS0A 2BBEA 1H38A 1IBKF 4FE7A 2MLGA 3C6TB 1T8EA 3OY9A 3BPXA 3RB4A 1HNXJ 2RIJA 3HK2A 3CC2I 2BJ3A 3JYTB 2UVRA 2VKEA 2Q6CA 4AXIA 1G2HA 4CLUA 1N78A 1FEXA 2ZUAA 4J01A 3D1HA 1WI3A 2HDDA 4ANCA 2L3MA 3PW5A 1WC5A 4X0GA 3U1LA 2HG4A 4IHWA 3PG9A 2DA4A 1Z67A 2EFWA 2XSJC 4TKTA 2VBXA 4HACA 1ETQA 5D0GA 4WP3A 3V6DB 3CCEI 4UNOA 2LQJA 3AL0C 5ED4A 3BTIA 1RR7A 2J9DA 3JSOA 3PW7A 3ICLA 4NXNF 1HKTA 3OYAA 1XIQA 3BTCA 5IV4A 1KC8T 5K1YA 4LREA 4OYPA 4I2QB 3GJQB 3W66A 1IXKA 2V0NA 3DU5A 2E34A 3BR0A 1TLHB 1FD8A 2HZDA 2AYMA 1C2PA 3OW2R 4ZITA 3OFFA 3C3WA 3M8PA 4R79A 1VIOA 1OY6A 3OL6A 4H4MB 3H4DA 2HAIA 2HYFA 5K14A 1DZ5A 5GMKa 2CJKA 1MGTA 4L76A 2GJFA 1K6OA 5DG9A 3K4CA 3GTMJ 1XJWB 4KGXB 3IR7B 1ULYA 5GADJ 4LRBA 4RM3A 4ZCLA 3DLKA 4N4OB 2P6TA 2HBRB 3AB2B 2DMPA 3R6LB 1MBGA 3PL8A 4CYDA 1XMBA 2K9NA 3MEDB 3BSNA 4USIA 1FTCA 4YUDA 4C48A 3KEQA 1U1LA 2HDCA 4EBCA 2M4MA 2EA4A 4HDHA 2I9SA 3D3BJ 1FX4A 3T9ZA 3LA7A 4B02A 2G9WA 2VQCA 2QFJA 5J2NA 2K9MA 2IXSA 1TTYA 2LKZA 2VPXB 4ECVA 2GM4A 3FXKA 4DL3A 2L02A 3I58A 2LEAA 1Y10A 3RKXA 4UVBA 2M8DB 3GZNB 4Q0BB 3HI9A 3R3TA 2JUGA 1BOBA 4MK7A 4EGYA 2EEYA 4LF9J 2VUMJ 5DGAA 1YS7A 4WFXA 1C0UB 1SQEA 3MOZA 1UG0A 4DX5A 2RUSA 1QAIA 1FT8A 2DGTA 1MU2B 3I4PA 4IG3A 4J9QA 1G3WA 4PQUB 3DGVA 4KT6A 1MWZA 3U7JA 3F0NA 2KIFA 2L41A 2ID3A 4L9TA 2BUNA 2H9ZA 3RRHA 3N5FA 2F65A 3AD7C 2LA6A 3FXMA 4JI3F 1S4FA 2BW3B 2KZMA 4OINF 1SVLA 1C0WA 4OYIA 3I9V2 4JI5J 4G6QA 2OPTA 3MR7A 3M6UA 3LSGA 1WI6A 5AJ3J 4GDFA 1F4KA 5ETOA 1USTA 3T6JA 2HTJA 1LEAA 4EJVA 2RNJA 2KXFA 2K27A 2GHVC 3WGGA 2QIFA 1HNWJ 1BJAA 2OD5A 1Q5VA 3F8CA 1FHTA 4PUOA 2OPQA 2KZVA 1S0OA 3FMWA 5DEQA 1D8JA 3CXCR 1MROB 4M63A 2XKPA 4B3AA 2P7CB 1RISA 3ABMH 2M3DA 4ZTJA 4BBSJ 1H7WA 3BGFA 2QGUA 2UUAJ 1N0UA 4U7BA 3AJ1A 4PABA 2KIMA 2PI4A 1GH8A 3RBDA 2U1AA 1X1PA 3N4WA 2DRBA 3FMQA 2IPOB 4C9DA 3TEGA 4LT6A 2UVVA 1MJAA 1OLTA 2BGCA 4X65F 2YPRA 4IVNA 5F04A 3FQKA 1Z77A 1RTDA 2IP2A 2DTZA 2F5DA 2KLOA 1D3YA 1YWXA 3K1PA 2CPEA 2M0GB 4LFAJ 2MQMA 2OJ3A 4R8UB 1RBLA 1F5TA 3CCRI 2AO9A 4NZ0A 3N0VA 2IYIA 5TGTA 1T94A 2FHJD 1UZHA 3CPWR 3SFZA 5A6PA 2UXCF 1HHTP 2V8HA 1H2VZ 4CTAB 4RLQA 2BKNA 2CDQA 4B43A 3M7GA 4NCGA 4TVAB 4DV0J 4ECRA 2QKLB 5HROA 2LLZA 4BXFA 2D1CA 3BR9A 4C2TA 3DFGA 4YG2F 2JRSA 3WHIA 3W3SA 3F6VA 1E6YA 2HYIB 1W2IA 3LQRA 1B0TA 2DGVA 2WONB 4J9RA 4HLYA 3A4CA 1TTHB 1RWOB 2VIHA 4GVLA 1P7JA 3GWCA 2DXIA 4X4PA 2RDPA 3ENWA 2ECCA 4BS2A 4FYVB 1WF2A 4JV0A 3GSIA 2Z33A 4OHXA 1ZM9A 1IV8A 1KNZA 2J6UA 1OQ3A 1UFKA 1T6SA 3NAIA 3LUYA 2KXNB 3I0SA 1B8IB 4X84A 3OYJA 2IRUA 2ALYB 2GAHC 1Z91A 2E29A 4J9KA 1FYLA 1XR6A 2L7ZA 3F9KA 3BQ2A 3G6VA 3V6KA 3WTWC 5L1IA 2CQCA 3HHNB 2MZRA 1KQ8A 2XI3A 1E6VB 3H35A 4ZPWR 5L1LA 2DD8S 3QGIA 2CPFA 4UB6C 3D6MB 3UN5A 2B0GA 3TZWA 4HZFA 1A6QA 3GZ5A 1R6YA 4J9LA 1M5KC 2M52A 3FKBA 3HSFA 3GYNA 3ZZUA 1B6AA 2VKDA 3D0IE 3D1QA 1HYSA 1YJNI 2UZAA 2HNZB 2KRCA 2L7MP 4M5NA 4CCOA 3BC8A 1Z1DA 1REPC 2QSFA 1TQPA 2VQLA 4P52A 1WHYA 4DJAA 2RNEA 5F8NA 3HZEA 3KP7A 1WKMA 4QTRA 1IGNA 2CQ2A 3IBFB 3OUYB 1YX5A 4EM2A 1SFEA 2Y75A 1SV5A 2R8GA 4P72A 1WH5A 3PRVA 1A6IA 3M8FA 2YKNB 3IH2A 3ABKH 1QVFR 3AAWB 1O3SA 2GIQA 3H40A 4JI2J 2AWZA 2RHSB 3WE3A 3GG0A 2MKKA 2E44A 2VPZB 3HHLC 4I0WA 3KMSA 1K0VA 3H98A 2P8TA 3FZ2A 2LY2A 4YRVA 4QWBA 2AQ4A 3KK2B 1WNEA 3G4SI 2DN0A 1EETB 4ETZA 1VQ6I 3C7JA 1PGZA 3C3LA 4PGGA 1ELOA 2CQDA 4PWDB 3FHZA 4DR5J 1IJFB 4ZPDA 1J09A 1NPPA 4CO3A 4OV6A 3IAM9 2I10A 5C24B 4UW2A 3HOWJ 4MJKA 2W82A 3CCYA 1QO0D 3CIZA 1A5JA 3LGNA 4AL6A 4HH1A 3OVSA 3S93A 3S6EA 4IHYA 2AW0A 4ZVPB 1VFJA 2XPUA 1X5TA 4K4YA 3A0HC 5L3EA 3A0BC 2EFQA 1FRXA 2BOAA 3A4TA 3FEXB 2ZKTA 3I56I 3REOA 4BC9A 1MG7A 2ZITA 3M2UA 4DLGA 3LWFA 3GEZA 3GV5B 3LFKA 2GMLA 4MIBA 3CDUA 4F26A 4XLAA 2ICWG 1KA8A 4DR1J 2ROGA 4QYRA 5EX0A 1APSA 4PSXA 3MECA 4QR2A 2R5ZB 3L3CA 1V4RA 3DRSB 3IBWA 4OOIA 3OFEA 2JLEA 2OMLA 3DTEA 1HSTA 3ADAC 1WI9A 1PDNC 3W65A 3FHNA 3DWLE 4LIUA 2A61A 3E7LA 2HXOA 2RUGA 1C4CA 2DA2A 4LF1A 2UUAF 1HOMA 1LOUA 2Z2MA 3UDEA 5KFUA 2ZJPF 2QT7A 1R43A 3DEEA 3BEGB 3G82B 1KU9A 3ZQQA 4WU3A 2CMPA 4UTGA 4KIAA 2RQPA 2BQRA 4ICLB 3CJQA 1U47A 4CLYA 2UUCJ 4HT5A 5DM6F 5F0FA 3T1AA 4Q47A 2DH7A 1GMVA 4USUA 3BROA 3H2VE 4QU6A 4U67Q 4K5RA 1OCPA 2QQ9A 3MEDA 1LFWA 4ANDA 4A2UA 1CJKB 3HZGA 2DW4A 3I31A 4ANJA 3CJ5A 2DNGA 1NRKA 1VC5A 3OTEA 1XR7A 3KZZA 1A7GE 2W84A 2UUCF 5CVJA 1APLC 2QX0A 3JQKA 3GE9A 4P1WA 1VQ9I 2QO3A 1GTEA 3UVJA 3CIMA 2HHTA 4DPXA 1IO2A 2VC0A 3G71S 4Y52J 5J6XA 2LXFA 3DI6B 1C0TB 2HWIA 2IM1A 1NKCA 1SL1A 2E7VA 5L1JA 3LQVA 4JUZA 1NJWA 3CP8A 2ISZA 4OIOF 5L38A 2L4AA 1YIOA 3O6BB 1U0HB 2CQKA 2HOSA 3QT8A 2J5AA 2LYCA 5LHGA 2W2QP 2KFNA 1VQ5S 1EETA 3DM2B 1IR0A 1MN7A 2YNGB 5FLXU 2XMVA 5DG8A 2WAQA 3OYKA 2GVDA 2O6GE 3HZJA 1JNRB 1UPMB 2RC4A 2KJVA 3QWUA 1IQTA 5E3OA 4JV2A 1IKXB 1IXCA 3Q86A 2CQ1A 1VRQC 5B0CA 3K1MA 4GKJJ 1FSEA 1F6TA 2HQ3A 4M5GA 3U1MA 4KGMA 2Z5UA 3ZZRA 2LRDA 2KDZA 4DUZF 1R4NB 1Z6TA 2C3MA 4C0HA 4N56A 1S1UB 5ILUA 4NNJA 3NLCA 1WC6A 1M5HA 2HWTA 4UY8T 3D1NI 2HBYB 3MMAA 1UFMA 2JZYA 1PO6A 2IDLA 2HBZB 3LWMA 2EXUA 3GFYA 4OIXA 1VZ0A 1IN0A 3MPUB 3CF5Q 3Q89A 2IJNA 2YWHA 2V2QA 4R0EA 1SI9A 4DPYA 4YHHF 5EYRA 2BE2A 2L7KA 4ZC3A 1Q5YA 4BDPA 5FLXK 1NK9A 1FY7A 4F52A 2H4YB 4KO0B 3NS5A 2IC3A 4UOGA 3FXOA 3J80K 3FK7A 2I1RA 5ETNA 2IA1A 4A8XA 4Q2MA 2BRKA 2W4SA 1SB6A 4WXWA 2ZFUA 3RJPA 1R8BA 1RHKB 2XSFA 2V8PA 3PNTA 3TL4X 2F8MA 1OMIA 1TT5B 3H3UA 3GR1A 3RZAA 1FKAF 3RCOA 3CTAA 4CO2A 5HBMB 1UJ4A 1LW2A 3DHWC 2M7SA 1S0VA 2H1KA 1HQCA 3ABTA 1UZDA 1TC3C 4ZN1A 3M9NB 3M30B 2CQBA 4K7QA 2E1RA 5J8CA 1T05A 3GV7B 4DU7A 3LGMA 4A8OA 5F3TA 1G3YA 3PYGA 3IP0A 2DMNA 3PO3J 3Q2SC 4FF2A 2VBYA 4WXDA 4ECUA 3F22A 2CNLB 3K8VA 4HT7A 1BI1A 3TP3A 2KISA 1BMQB 3FSIA 4BE2A 2DYAA 1KU3A 4QBUA 2Y9ZA 4C2MJ 2JNJA 4Y15A 1U9OA 2Z2YB 2C2RA 4JP0A 1SJRA 4LLNA 4L9VA 3CCVI 3G3ZA 3BKTA 4XSZF 2FTRA 4S0HB 1YG2A 2ZBRA 5KNLA 2HPUA 3KLHB 1RKIA 1IXSB 1CJKA 2ATLA 4O4GA 1UCRA 1J2XA 3GTGJ 5EEHA 2AYEA 4D5CA 4ZCIA 3R6GB 1KD1T 1CLFA 3NMAA 2M5YA 1QNTA 5CYVA 5A2QK 4BU2A 4DV4F 5EEAA 1TL8A 1T9UA 5JXSA 2VI6A 3OJUA 4M8LA 2XCPA 1BW6A 1S99A 4FKYA 4HA8A 1N33J 3CF2A 1TQLA 2ILYA 1OYIA 2FSWA 4I6ZA 4S0MA 2V1DA 2B9XA 3VAHA 1JXEA 2LXIA 3RBXA 4L73A 5F64A 2ID6A 2NXEA 1NK4A 2VQGA 5FGMA 4EMDA 4XM3A 1TNTA 5AIQA 3F8NA 1XTAA 2J6TA 4XDDA 3RIRA 4RS8A 2R7OA 1YKWA 3A03A 3MUVP 5F08A 4ZLJA 4WBFA 2VQFJ 3BSCA 1PBUA 3T8RA 2XMKA 4FP9A 1NB7A 3TO8A 2HMIB 2EC0A 2F5EA 3JRIA 1QTMA 4CIOA 2JEJA 2YU9J 3QT5A 1FDNA 1Q8LA 1LFBA 2FOKA 4IFVA 2RAEA 2W1OA 2DB1A 3FISA 2PO4A 4FVCA 4RR5A 4C11B 1G2EA 2J9DE 2BACA 4HF0A 5J2NB 4ILRA 4DN0A 5KFVA 1SVOA 3NWRA 4WFYA 2F5CA 1ZAWA 2E1AA 4DX8H 1FMVA 2XGCA 2FHMA 4UZBA 5THWA 1A6LA 3IBCB 3TJAA 4BEHB 4JB8B 2DJNA 2M7AA 3B54A 2R2SA 3J7A1 5TJJA 3TOBA 3W63A 3HVTB 5RUBA 4ECWA 2D5VA 4ED1A 3QSYB 3UNGC 1S1UA 1RT6A 2VDIA 4ED7A 1N36J 1LW2B 1RTJA 2K1RA 2NPFA 3VHQA 1IR2A 3FRZA 2KDOA 4A4JA 3KMQA 3GMGA 3KWMA 5CCLA 1ZELA 1DFDA 3B4DA 2BOPA 2O67A 3GBGA 2MJUA 3T1HF 3R97A 4WU2A 3QT7A 3R0JA 1ZH5A 3KUHA 3PSFA 1HL6A 2QL7B 1NDCA 1JWWA 1V5FA 1IJWC 3V81A 5AXKA 1S77D 5FKOA 3PRBA 4DQ2A 5LJ5Y 1DTTA 3BCAA 3MCOA 1Y5IB 3QQAA 3JSYA 1PIEA 2OZUA 2ASYA 2JOQA 1GQEA 3A3OB 2X3GA 3E8OA 3TVYA 1RAHB 3TO7A 5CCMA 2MKCA 3TX8A 4QWCA 5DZ6A 1HQEA 4FCYA 2FDNA 2ZC3A 4KHMA 3VAJA 2H4WB 4DV3F 5E3PA 2DHAA 5K5QA 4IRHA 3QPSA 2HVSA 2NQPA 2UUTA 2YNFB 2M30A 4DL6A 3EYIA 3R61A 1M5OC 1PBAA 2R3SA 2ZHAA 2Y2ZA 1JLBA 1Y4ZB 2B5JA 4O44B 3VEPA 4IOBA 5DUKA 4IQJA 2C22A 2O61A 3TWZA 4GO5X 2XO6A 5ILSA 2OP5A 1JLEA 3SDBA 1EB0A 1KZHA 1SH2A 1R7IA 1ZOTA 4MGRA 1NHVA 3M8JA 3FBNB 2NYXA 2HNYA 3KE2A 3IM9A 1T9XA 2WOMA 2V63A 3QIDA 1ZPWX 4ES1A 5HVQC 1T0FC 3UDCA 2QLZA 2B4UA 3KXDA 1K47A 3VZIA 1U0JA 3EETA 4KN7X 4CT8A 3KJFB 2HPIA 4LLGF 4EO6A 1NZ8A 2MSTA 4TY8B 3J80Z 2GOMA 3DTKA 1FBUA 1HWIA 1XC9A 1T56A 4P9FA 4CUGA 4C2MA 3GIMA 1QRYA 1YLXA 1L3VA 5E8IA 4PG4A 2AZ1A 5K8OA 7AT1B 2WCXA 1QVTA 2M34A 1REGX 1TWHJ 5D3GB 1Z3YA 1GT8A 2YNGA 1C1BB 2NS8A 5EJCA 2DOFA 1RTIB 1IN8A 2E7WA 2BBYA 4ZP9A 2PGCA 5D4NA 2HZCA 2NUHA 4NB5A 2YWKA 1VCTA 3OR2A 1Q82T 4O5VA 2KI2A 1T8IA 1QHHD 2R92J 3ILJA 4LFAF 4N77A 3IS9B 1W5CC 4DV2F 2EH3A 1M0SA 1YFHA 4FHTA 2Y30A 3I9V9 2Q0OA 2DH8A 2CADA 1KLMB 5KCMA 2HWVA 3DLEA 2MD0A 2X48A 3JRHA 2HU9A 4BDZA 2VQEJ 4ZK7M 2E9TA 2MA3A 5K20B 3DBLB 3C6UA 3UCZP 2EZHA 1GTHA 3S17J 1WJ5A 1BI2A 1BY9A 1WOSA 3J7AY 2XMTA 4QWAA 4LFBF 4LF6J 1OJ4A 2DCUB 2L08A 5FDLA 4GC6A 2XY6A 3CC7I 2RF2B 2FGCA 5JR3A 5HVFA 5F9LA 3CTRA 3W9JA 3W2WA 3A3NB 2PJRA 4NOHA 1RHJB 1B4AA 2X85A 1HC8A 3W5ZA 1UCNA 1ZPVA 4FASD 1F9HA 3QPTA 1NLKL 4M3DA 2HWHA 1R23A 2GIZA 1TUWA 4DYQA 2OPPB 4ZVEA 1SCJB 2V2VA 2BXYA 1DAXA 5DM7Q 3HRUA 4AYBN 3GFIA 4MEYF 2L9WA 5JI6A 3ZN0A 3TAMB 3DYAB 2ZSIB 1LWCB 4KRWA 1FJGJ 3I82A 5DRKA 1E6VA 3RU0A 2AQEA 1R3NA 4ED3A 4DR2F 3DDIA 3V4IB 2GOXB 2OSRA 3CUQB 3BCBA 3H0DA 2MY8A 1SD5A 2UXDJ 2XAUA 5KFGA 2MZSA 3LSHA 4U95A 3IP4B 4DR7F 3A1YG 2PEHA 3BO3A 1MMNA 3UI3A 4ES3A 1IKVB 3S7RA 2COBA 3KG4A 1WKLA 3TJ9A 1VHFA 5J2MA 1JJ4A 1POGA 1X4FA 4XOPA 1CC8A 3CCES 1QGPA 2V4JC 2VE9A 3OTOJ 5CD4A 3LP2A 4HL9A 2DKOB 1S9FA 5LEJA 3GYGA 2WOMB 4FXVA 4OX8A 1NSAA 4ZPCA 2O3FA 4KH1B 3DCFA 4Q5SF 1ITPA 2A6EF 2NXNA 4B09A 3IRRA 1V54H 2FVPA 3LP2B 5HJYA 1J5EJ 2Q8KA 3COAC 4A8FA 2XRNA 4K4TA 3RRKA 4A5MA 5G4DA 2ZD1B 5J4YA 4DV5F 5JVTA 3BYRA 4IO9Q 1VJWA 1FPQA 2AX1A 1TL1B 3GIRA 3D6FB 4DPTA 2LF8A 2HKEA 2JHEA 3FMSA 2YX7A 2M9KA 4HRIA 4IRKA 3V8LA 2B63J 2HHQA 3H5RA 3TRGA 2LEBA 5KG2A 1VRTB 3K70C 2BJDA 4NLPA 1KEKA 5CLSA 2QWWA 2IHR1 1Y0HA 4K4WA 1IRFA 5EDWA 2VFUA 5KT3A 2ASLA 3TI0A 2HGLA 3QGPA 1RLCL 1HBUB 1O5JA 5FD6A 1WEYA 3KHGA 5D4PA 1V3FA 2BYVE 2W2PP 2CQXA 4PYDA 2F48A 2UVUA 4Z7YA 5ADZA 5E8GA 2LVWA 4BQAA 3RAXA 1TWAJ 3L1PA 2BRLA 2OLWA 2HHSA 3P7NA 5E1ZB 1HWKA 3HX9A 1S72S 3MFKA 1WTFA 3OR1C 4XLCA 3L7OA 1T3NA 1BD6A 2AYBA 3QATA 2XY7A 3H9JA 4CYCA 4B3SF 1YJVA 5CABA 2IGMA 3CF5F 4ZJOA 2Z4PA 4PJJA 2FRHA 1F5BA 3G1OA 3BTLA 3L2UA 1T9YA 1N4LA 4MFDA 3OHBA 3I4MJ 4HG2A 3OR2C 1FTZA 2ZWOA 2WONA 3G4SS 3JRBA 1MROA 4E0DA 3CDWA 4OYMA 4NE9C 2HFVA 4J00A 2EFGA 3TUJC 4Z7CA 4RW9A 1IKYA 2FVQA 1FA0A 2W8KA 1O3RA 2CPJA 4DR7J 5DDPC 2W25A 4WP9A 3F73A 2NOJB 2FJ1A 3GU0A 1S6QA 4KMFA 4DCOB 1KYZA 1GMWA 2ZJPQ 3MM8B 4ID5A 3F3XA 4MLOA 2AGQA 1V5IB 3RBZA 4CNZA 4ZHRB 1KRPA 4LF9F 3HFZB 1UZCA 4TLRA 1SIWB 1LWEA 1Z9CA 2OTJI 1RT3B 3M9MB 3AXKA 2AD9A 4FS1A 1V6HA 4XLHA 2RS8A 2NS1B 5DS9A 1M1KT 2G13A 4P7VA 4YB5A 1SV5B 2VXZA 3BH7B 1A9NB 3ZQGA 4AD9A 4FX4A 3K17A 1P27B 2DFEA 4V19J 4EATA 2NAZA 3JTHA 5K7FA 5C2GA 4KHPF 4AIDA 3W6KB 2DNHA 4ZDNA 2QCOA 4ILMA 4PG5A 1XC5A 3CCLI 3ZNJ1 3DCAA 3HSGA 1FWPA 2W9CB 3J7AO 4PG7A 1HPZA 3VAKA 1AKHB 1TV6B 4IDKB 1NHKL 4KFBB 2GCFA 1X60A 4CRJA 2GC8A 2OKQA 3JTGA 2OH2A 3H36A 3NKYA 1HW9A 1PUEE 1GXLA 4HHJA 3NCPA 1ERDA 4M3GA 3W6JB 4CXFA 5KFMA 1TFYA 3CDBA 4O0IA 1HQEB 2D3UA 3GFMA 2E19A 2NVYJ 4IRDA 4CLZA 2D3ZA 3EX7B 4Y00A 2BW3A 3BGLA 2BHYA 1ZRDA 3KPHA 3K1NA 2GXGA 5E3AA 4LF5F 3ZQLA 4JOUA 1Z2ZA 1S0NA 1FWLA 4WXHA 1RT6B 4DDFA 4HBLA 1U1NA 1RYRA 3VAIA 3R5AA 1SL0A 2KZGA 1W5SA 1RT5A 4Y17A 4BBRJ 1MDMA 1SEUA 2MQ8A 3DLKB 1R5ID 2YNIB 3SDGA 4H4OA 4LGWA 1HBOB 2XASA 2A5WA 4LIVA 3SJMA 1ZA1B 1LV5A 3OYDA 1YGYA 4EJTA 4DUYF 3D6TB 2RSQA 3AJDA 3OPKA 5ITHA 4FS2A 4ZP7A 2XLIA 2LOOA 1UVJA 3Q9VA 1M1HA 4LIWA 1IKWA 4MQ9F 1XMKA 3CZ6A 2VF3A 1N48A 3G8SA 2FZKB 4C8KA 3QU3A 4P2FA 3POTA 4EWTA 3HKZD 1IKWB 4ED5A 2MH2A 3V81B 4K2EA 4MIMA 3EXYA 1SJ1A 4LBIA 2K9LA 4PJNA 4NPOA 2HQGA 3A1YA 3IA0A 1SBRA 3KK3A 2CPYA 1BN5A 3SEZA 2VFTA 1S5LC 3GYHX 5M5WJ 2QYGA 4CLTA 2W7PA 3TA0A 5HOOA 3I0SB 1XEZA 2IIHA 3EPIA 5D0EA 1LQ1A 3TKYA 2JFKA 3HVWA 2WK4A 3ILLA 1QDUB 1D1UA 1UJ8A 3G6XA 2L0KA 3MCNA 3B73A 2B6AA 2PFFB 3VTIA 5I3UA 1U2CA 5M2PA 2DVIA 2OD4A 3B6AA 3RAMA 2C3PA 2E71A 1ONVA 3P9CA 1QUPA 2MQNA 1AUDA 6PAXA 4BE1A 1FVSA 3BB5A 1D8ZA 1ZHFA 4C11A 4B9VA 1JKHA 2GVDB 1JLGB 3FK4A 4EJUA 1CBKA 2AT1B 1WI8A 1C1BA 3MTJA 3EYYA 1X4BA 3GR0A 1R27B 4F55A 4AVPA 3PRDA 2F40A 5HQMA 3GTJJ 3AJ2A 4DQQA 3ZTSA 1W7PA 5FO5A 3ZZ0A 4E70A 1FJ7A 2OTJS 3MM5B 2V6AA 3FBEA 2MKIA 3LH2S 4B3MF 4C97A 2GGPA 2A18A 4JP8A 3BQ0A 1X1BA 5HS9A 3GZ6A 1Y7PA 2EQRA 1H6KX 1VHIA 2OC6A 3EYZA 2CJJA 3NOCA 2MSSA 3E0JB 1VQ4S 4ETXA 3ZTRA 2QRRA 4I7HA 4ELVA 3G8TA 4NYZA 5DJBA 4G6TB 5GADI 1OYDA 3UO0A 3KZYA 5HI7A 4F04B 2CQ3A 4WXOA 4CM0A 4GYIA 2VB6A 2HTSA 2FU4A 1MBHA 2N7CA 1MJ9A 1RRJA 3BQZA 3PIOF 2HNHA 4YIFA 4ZHRA 3C14B 1ORKA 5A8KB 3KJVB 2G2ZA 1NJXA 2LK2A 2K3IA 2H5EA 4DUYJ 2ZBIA 1T03A 3H8YA 1TBXA 4JV1A 5A8KA 3OIQA 2ZHBA 1AB8A 3JAMZ 2WVDA 2XYPB 3D67A 4RB3C 2WY8Q 3QWPA 3DRRA 3TDZC 2MHEA 2F8EX 2OPSA 1NH3A 2NXCA 2RH3A 2GGPB 3K57A 4DJBA 4MTPA 1IBKJ 3MCSA 3DQVC 2AYGA 4ZP6A 3QWLA 3OL4A 9ANTA 4WKYA 3GLJA 4Z37A 1SFOJ 2ME6A 1RT1B 5KFNA 1OFCX 1B70B 4DQPA 2J7WA 4XAKA 3PM9A 5LFAA 2VFSA 1Y1WJ 1LXNA 1LWFB 1YRTA 3JRGA 3M1VA 4R5PB 4U7UK 1HNVA 3MF5A 1UJ6A 3K4LA 1U9NA 2LD5A 4KJZA 3CO0P 2E9RX 1N36F 1FOKA 5D4LA 4BXXJ 1MH4A 2L2OA 4B9MA 3KG0A 1ZM2A 3AHPA 1WWXA 4XQFA 3OD2A 2FBKA 1RWPB 3LP1A 1IF1A 4NA3A 2ZH9A 4NLQA 2DODA 2GFFA 4NC8A 1SFUA 2X3DA 2DNOA 2LU2A 2H51B 4CHUA 4LR9A 4ZVGA 2BKPA 1NB2A 3NGKA 3K5MA 3I5AA 3F41A 3CC4S 1LDJA 3DBRB 1EX8A 3BWGA 3KLEA 4HSRA 1ZG3A 3V7SA 1FNOA 2C2NA 2NS7A 4GKKF 3ASOH 1TL1A 2OAZA 2NNYA 4FXWA 2R7ZJ 4U7DA 1N5QA 4YB1P 2VJJA 1SVDA 2F4OB 1DPRA 3MPDA 4KIBA 3OUYA 1FRLA 1BR4A 3H9GA 1NHUA 1I3OB 2K8GA 5JLWA 1GVDA 2DR7A 4UHTA 3M32A 3H1CA 4UT4A 2ZDOA 2V2KA 4PYAA 4NLOA 3MD2A 5DDRC 2JVGA 2PIIA 3HOZJ 1GT0C 3UD3P 1H3DA 4ZDLA 2YVSA 3HEFA 5IYDJ 3C2HA 5K8MA 4RMNA 4BQNA 4ESJA 3ZMDA 3PM1A 1OR7C 2OQRA 2LLKA 2QGFB 2BEFA 4OLPA 2HQFA 2E5LF 3EMTA 3ILIA 2ZMEC 4CZCA 3MTKA 4L5EA 2XRLA 3RW7A 1N5YA 3GTPJ 2V9VA 4ZLPA 4OHZA 2VH7A 1DRZA 1L0OC 2WV1A 1XX5A 4ZZDA 5CYMB 4ON0A 2OIHA 4N47A 3C6TA 3H0GJ 3PX6A 4YR0A 3R5BA 2CV2A 2CPIA 5HS8A 5DTDA 2NRAC 2KVIA 2FMYA 2EB7A 2WY7Q 3GCWP 1N6QA 4LF4J 1FIPA 4ZN3A 4BYYA 1SKWA 1WUUA 5E17F 2C42A 2V8DA 2BA9A 3VYRB 3I5CA 2BY0A 3CLQA 1DARA 3NGDA 5BYQA 1F2HA 3VGTA 4EJOA 4DBQA 1WHXA 3CULA 2R8IA 2HHHF 5KK1A 5C4XJ 5FDLB 2CPXA 4ZA1A 5D6EA 2CUJA 2XGEA 2X0LA 1IXRC 1JKRC 2DIVA 3NRBA 3W6VA 2HFUA 4MEXF 5JUMA 4K4UA 2A68F 5H9EJ 1KQFB 3HT0A 4ID5B 1Q8KA 3SSRA 1RWXB 4DS4A 4M5DB 3A8IA 2CWKA 8AT1B 1HQUB 2L3DA 1VQKI 2EG1A 4QU7A 3KJVA 3TUIC 4LFCJ 2IA0A 3DLAA 3C14A 1Q1VA 1IWAA 4DS5A 1CJTA 2OJED 3RYRA 4WPAA 2XIGA 2FVSA 4GVBB 3L95X 2XF6A 4O6JA 2PMZD 3Q9SA 4L0YB 4X65J 1FDBA 3EZOA 4HR2A 3FXUA 1JUSA 4EMSA 4Q8EA 3W60A 4C8YA 2DFIA 4LF5J 4TNOA 1QAYA 1H2TZ 1OKRA 3EQLF 1HKSA 4BJ5C 3D5LA 1IV6A 2VD3A 4AM3A 3M1CA 1QBJA 2Z56B 4HDUA 1PYTA 2HS0A 2XC9A 4F7ZA 1Z1ZA 3D0SA 2H8RA 5KFSA 1RCXB 4V2GA 2ZH3A 3CJTA 3IWFA 3KP6A 4P5OA 5E3CA 1TT0A 3EGVA 2JPCA 1S59A 3HRTA 4B3TF 5IT9U 2K85A 1BR1A 4XORA 1E3PA 4RAGA 4LF8J 2ZM6J 3E51A 4FF3A 1IR1A 2RE1A 2NXNB 2EVZA 1FNNA 2CZVC 1JHHA 1ETOA 2KZZA 3TJ8A 2H65B 4JQFA 1XBWA 1TW3A 2E5NA 1TL5A 1OISA 1XNRF 3BR1A 4LUBA 5FRNA 4E7IA 4M71A 2IVMA 2XPVA 4P2SA 2C28A 1YJNS 2ACYA 5HBMA 2PEXA 3CMAI 2PMUA 1K44A 2SXLA 4ED8A 4U96A 1F3FA 3I32A 5E3QA 4NLSA 1S29A 3PUBA 4JX5A 2N3LA 3RPQA 4PXCA 4QYZK 5IPAA 5GPCA 3G1LA 3FF5A 3BM7A 3FQLA 4Y28C 1X0FA 3N9UC 4HEA2 2UUWA 4AUXA 4KH0B 2Y1IA 4RUBA 5D4RA 1I51B 3WC2A 1FNXH 2ZZMA 4OAYA 2YNHA 2UU9J 4P2XA 2Y8WA 2BQUA 4J7CA 2BANB 4C3KA 2OD6A 1SQFA 3LSJA 2QVOA 2EK5A 5J2MB 3WX8A 3D0HE 4NZ7A 1B7FA 4XL9A 5H1SV 5M5XJ 3NAUA 3ONQA 3H5XA 2IS2A 5F3ZA 4DF8A 5KAFC 3N79A 4F92B 2CUFA 4PWUA 3CJ0A 3IR5B 2VXDA 2MZTA 3CUNA 1R1VA 2ADUA 2YNFA 3MEGA 4EI2A 2JMWA 4CO8A 1FP2A 5HATA 3GFHA 4B3OB 3JB9k 1BQNA 1Y8QB 3AKZA 2E5ZA 1GNKA 2WHOA 5IM0B 3QPHA 1H7XA 3JW4A 5EGOA 4DV6J 2WAEA 1RQ0A 1WFXA 2O66A 1S6QB 5HP1A 5JJBA 5KFYA 3OJSA 1UHMA 1OCCH 1WGXA 2COMA 5IYCJ 4NMXA 2DGWA 4J19A 3WG9A 1U26A 1DTTB 1IN7A 1WPKA 2ZH4A 1Y3JA 4J9SA 5J2PA 1OPCA 3IRXB 2A10A 3IGVA 4L74A 1WHVA 3MZ8A 3J81Y 1U48A 4KGZB 5A2QU 1VC6A 4K4ZA 1XK8A 5KG7A 3PNVA 1CS4A 3HPHA 3KLGA 3HXMA 5IWAF 3V7RA 4EBEA 1Z7UA 4DZJA 1GX5A 2ZE2A 2W4DA 1ZM4A 3K5OA 5HAOA 4C3LA 2N4DA 2X4HA 4K0KF 2H54B 2BMBA 4QWDA 2ZXHA 5KTQA 1I3AA 1R4MB 2LCWA 1S1TB 1ZR2A 3J7ZT 3O8WA 4MK9A 1RT3A 1FFSB 5ERIA 3MKZA 1KFDA 1EKSA 1CJTB 2A1BA 1RKJA 2J6SA 2Z2LA 3M4XA 3R5CA 4H4KC 4G6VB 2E1MB 5EHHA 2GMJA 2V9KA 2XV4S 2KT2A 4FYXB 3FK6A 1HI8A 3CMEI 2UUBJ 3BR6A 3G8QA 3I55I 2G2OA 5CA5A 4N4NB 3OTBA 4P7TA 2AV5A 1TKTA 4UOCA 3CJ8A 2X6OA 3C16A 3Q24A 1NXIA 1PJ6A 5F0UA 5BPIA 1DLOB 4GKKJ 2KT0A 3F56A 2D7SA 4BL0B 3MI7X 4DSIA 2JTVA 4LF2A 2V4RA 4CYUA 4N76A 5HMXA 3ROUA 1A35A 4B4CA 2Z0GA 2XS7A 2KL8A 3MMBA 4YMEA 2QA4G 4HDVA 1RAOA 2DEJA 3M2RA 2IW5A 3TQNA 4QIGA 5F27A 3SDEA 4A0YA 4DYCA 2YKPA 2UVWA 2HNZA 3MKLA 4DR3F 5GAGU 3H2LA 4MIAA 3Q83A 5LXYA 1B72B 1R22A 1VQPI 4I64A 4DL5A 1VQ4I 2GNKA 1UG2A 2D45A 1Q0NA 4Q0BA 5SZTA 3HD2A 1OMSA 1FD2A 1ON1A 2V1XA 4CH7A 3GMEA 4ECXA 2CIMA 3WX4A 5FD1A 2RVCA 5C25B 3KYCB 3I54A 1U3EM 2MZ1A 1S6PB 4LK0F 1RDRA 1U1RA 5EN1A 3WGIA 4DV2J 2CFXA 1Z6RA 4F25A 3EJMA 2GIVA 5J1UA 1G4CA 1TUGB 4AQYJ 3RUBL 1OWXA 2CPDA 5DD8A 3KLIB 4D0PA 2BM0A 5CQEA 3ZZYA 3PX0A 3K58A 1TAQA 4CLKA 5JVGQ 4URSA 3RPUD 1OYYA 3ZO7A 4EJWA 2QE5A 1G3SA 4AD6A 3FMBA 3SZGA 2ERRA 5ETSA 1RT7B 4OMZA 4BAYA 4BLGA 2IBKA 5DDOC 2Y69H 3ENQA 2OV7A 2BW2A 5KT2A 2EKNA 3RQ4A 4ZDPA 3UQSA 3CJ3A 4LSLA 1TWFJ 3ZZPA 1GEHA 2DYRH 2B3TB 2MPUA 3K0JA 4LF7F 2W2NP 2IC3B 4L0ZB 3KYDB 2VFVA 2X6XA 4P55A 3D66A 1QVUA 4BY1J 4DOZA 2BM1A 2NREA 3PVXA 5HVGA 2ZVIA 3CUQC 1B4SA 1XQIA 4FN5A 1Z4UA 1KP6A 4I98B 1RNLA 2Q79A 3BBCA 3SEQA 1J75A 3EZ5A 2R93J 1S97A 3WTUC 1BQMB 1QPIA 2HQNA 2GHPA 1YRNA 1UFWA 4B3MJ 4JI1F 3UFCX 5IT4A 1ZTRA 1U1KA 1YHQI 4OHWA 3KHLA 2QMWA 1RTDB 4DG1B 3T41A 4NEYA 3JSMB 2VPRA 4DR6J 2KKHA 4A3KJ 3N28A 1RABB 2VASA 3BPVA 1IBLJ 5FKMA 2DK2A 4KBIA 4CA0A 3DMJB 1RWKB 3W9HA 5CKTA 2OFHX 3FZVA 4HACB 3LQQA 1IUYA 2HLTA 2L9VA 4ED2A 4ER8A 3IS9A 2EG2A 1WDTA 4DGWB 2JDJA 5K14B 3OYFA 2B43A 3RKWA 4CWBA 3CEDA 3OSPA 1FWZA 1PYSB 3Q8RB 5L9XA 4S05A 1M5PC 5BMZA 2EV5A 3QOEA 2QBYB 4LRFA 1KVKA 1HMVB 4E98A 2RRBA 4OWRB 3D4JA 4A6DA 4YB6A 3OSNA 4ECSA 2ZH7A 3E6DA 3BO4A 1AW0A 1J2VA 2YTCA 3KDOA 2QV6A 2DNZA 1KN6A 1HBMB 3MN2A 2CJAA 2FZCB 4NC6A 2YH1A 1Q8BA 3DC2A 4A8KA 4I99C 3MMJA 1CJUB 1TL7B 3H9QA 1FC3A 1HBOA 2BY3A 3GSDA 3R2DJ 3RYLA 2HMIA 2MBFA 2ZKZA 4YN3B 4WZMA 1XNQJ 3T8TA 3PFEA 3UW1A 1WC1A 1YSJA 1VF9A 2O7OA 4GKJF 1T03B 3WIVA 1R31A 5CYJA 2AXTC 1XR5A 3CNQP 3MPYA 4JYAJ 5EF6A 2D2WA 1NO8A 2X1FA 1H9TA 3OXLA 3QZ7A