4F3QA

Structure of a yebc family protein (cbu_1566) from coxiella burnetii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
234
Chain Sequence
KWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAIKRGADNLVEVRYEGYGPSGVAVMVDCLTDNKNRTVAEVRHAFSKCDGNLGTEGSVAYLFKQRGLITFPPNSDEEKIMEIALEVGAEDVTTNDDGSIDVTTLPEDFEKIRNAMKAADLNPSHAEVTVLASTEVGLDKDSAEQMLRLTEMLEDLDDVQNVYSNADYPEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transcription
molecule keywords Transcriptional regulatory protein CBU_1566
total genus 73
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4f3qA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA03
3HPHA 1WJCA 1WJEA 1MW7A 4F3QA 1WJDA 3HPGA 1KONA 1WJBA 1WJFA 1K6YA 1LFPA 1WJAA 3F9KA 1E0EA
chains in the Genus database with same CATH superfamily
1TKDA 1RWWB 5ETVA 2X9DA 3O8WA 3WTTC 1ZETA 2UU9F 2B7BB 4BHPA 1GNKA 3PX6A 1FSEA 3OXLA 3RZOJ 1U49A 2GBYA 1RK8A 4IHYA 1P1LA 4ITSA 5J2PB 3GV5B 1H89C 2YKPA 1KP6A 2RUGA 5F8HA 2MMYA 3DRYA 1EJ7L 2QSWA 4D5CA 2NUHA 2M7SA 2VXZA 1UZDA 2GJFA 3GFMA 3CVKA 4YG2F 4KH1B 2OV7A 1FX4A 3V81B 1NSAA 4O3OA 1OLTA 3SSRA 4YDDB 4LFAF 2OZUA 4PXBA 3GJSB 4S0HB 1TZLA 4LBIA 2P8TA 1UFWA 2HQDA 4M94A 2ZD1A 2DK8A 2ZJPQ 3CF2A 4IEJA 1OWXA 2JUCA 2EWNA 1EHWA 5IS2A 4O3QA 2X1BA 4LQ3A 1BC6A 4X62J 1S9GB 3H92A 4CYUA 2YNHA 2W7PA 3RBEA 5IZHA 4L5EA 4CLKA 5D8KB 3OYAA 4NZ7A 4ZPAA 4K4VA 4L9TA 2OTJI 3NWSA 1XTZA 4DPTA 2WAFA 2RNJA 2QYGA 2GJIA 2R7TA 4TLRA 1UZCA 3TZWA 3A01A 1JKHB 4PGHA 2KZGA 2OO4A 2DFEA 2Q2EA 4ECQA 2BQ3A 2UWMA 2YX4A 1RT7A 1YGYA 2BVZA 2I2YA 4CGZA 1X4EA 3CDAA 1RKWA 3ZTPA 1FA0A 3D28A 4NLDA 1DQUA 3H98A 4C9YA 1X58A 2HNDA 2MDAA 3GONA 3CUQC 1AYEA 2I8EA 2X4HA 1U2CA 3DEUA 1RETA 1T8EA 4BC7A 5KFWA 4XLHA 3PW5A 1TK0A 2DYAA 4RO0A 3N9UC 1BGXT 2HW3A 2ECCA 2AGPA 1SFOJ 3CC4I 1D9AA 3I5CA 3CLOA 4ILMA 3MKZA 1ORKA 1GX6A 2EG1A 4HHHA 4P6QA 2IYGA 2IVMA 4PUOB 1DDNA 3C2BA 2ISYA 3MTJA 3CCJS 4YR3A 1WHUA 5CZXA 3NQOA 4F04B 4XLAA 5CKTA 4M72A 5CHCB 4DV1J 3R6GB 2JK3A 2DHHA 5KFLA 2BW3B 4ZJOA 2AZ3A 2EIMH 5E3CA 2XGQA 3G4SS 2G1HA 2KT3A 2JLEA 5HLIA 1GXQA 5EG0B 2HEOA 2C1EB 1RABB 4LIUA 2XROA 1RT1B 3AODA 3V7CA 3T5HA 3HVRA 3R2DJ 2B4VA 2WOMA 3AD7C 1UJ5A 3A1YG 3JAMK 3T9ZA 2R8IA 5BR8J 3ZTRA 5ILUA 3ABUA 3BF4A 4XK8C 1BHNA 2PFBA 4EGZA 4B1RA 2YNHB 4ANDA 4B9SA 2YQ3A 1LW2B 1S0MA 3DBRB 1Q5YA 3CC7I 2KHDA 2MTLA 1VGYA 5CA5A 3B4DA 3TW6A 5E1WA 3FXRA 2HK3A 3KLVA 3BGFA 3F22A 2JFDA 5FRNA 3KLEA 4E0DA 2RRAA 1M5VC 2EXUA 3R3TA 4LRCA 1PCAA 1T6SA 4BDPA 2DOFA 4G7HF 2DR6A 3I4NJ 4JI0J 3KHRA 4DCJB 5EDWA 3S2DJ 4UY8T 3ZR8X 3H5YA 5IT9U 4X65F 3PEHA 4CP5A 1I3AA 1TP7A 3MCZA 1TW3A 3A13A 5TISC 2MZRA 1UFKA 5DZ6A 3G2BA 4IJAA 1TKTB 3WGHA 3KK3A 3OL9A 2EZKA 3GU0A 4P72A 3OYIA 1TQPA 5EUHA 2IPOB 2P5VA 1XMQJ 5E5NA 4FF2A 3BKUA 3DGPA 4DQ2A 3I3LA 4OAYA 4R8UA 2NLWA 3RPUD 2V34A 3K5NA 4RU9A 4PUSA 1JHFA 4A8WA 4USWA 4IPAA 4Y4RA 2XO6A 3N4WA 5E7OB 3EICA 4DUYF 2LLKA 1OYDA 2JTVA 2J76E 1R0AB 1EQMA 3RB6A 1REGX 2M4GA 4BJ6C 4BBSJ 3KP7A 3F8CA 3PYFA 4IDKA 3B02A 2KZVA 1YS7A 4I2QA 2EFPA 2H8RA 1EETA 4DSJA 1MBHA 2CKWA 3DDKA 3KLIA 4AWXB 3BYRA 2I0XA 5FDLB 4A47A 3CJRA 3TNVA 2FGOA 1MN9A 3KX2A 2DNQA 3HRMA 4KISA 1XR7A 4FE7A 4ZJLA 2R7VA 3ML6A 1JLCB 2F8HA 4Q45A 3DOMB 4I69A 2A6TA 1T98A 3OYDA 4CH7A 2UVRA 2DMPA 2ZH7A 4A3JJ 3SCJE 2CNOB 2O61A 3DBLB 2F63A 2OHDA 4DV5F 1RU1A 1JK9B 1T94A 3AKZA 2OLWA 2ROGA 4CLFA 1SKUB 2E34A 3TARA 1NHKL 2ME0A 5IQQA 1FYMA 3QYYA 4OIPF 4KTQA 5KG7A 3M1CA 4RWWA 3I5AA 4M5HA 2EWHA 2Z8QA 4G65A 5D3GA 2PFDA 2DK5A 4EVIA 5IOYA 2OP5A 1VLOA 5AXKA 2O6GE 2ALZA 2ZM6J 4FZVA 2BM0A 1FFSB 3KZZA 1TW2A 4ZLJA 3FC9A 2CZ9A 2JUGA 2CDRB 2UUAJ 1YBUA 4M6YA 3ADAC 5IV3A 1X3ZB 3ZN1A 2LEAA 4JI7F 3BJOA 1H8AC 2RREA 4KPYA 3LFUA 1A35A 3B82A 2VQLA 4B3RJ 3KNAA 5ERIA 3OTEA 4A3CJ 1HPZB 3KKFA 3HB9A 2XKPA 1I5ZA 1ZZNA 1GXLA 4OX7A 2W2PP 3MPVA 3MR5A 3BCAA 3PFYA 4MO7A 1SVOA 1RHJB 2UV1A 2LEBA 2KG1A 4M6XA 3W61A 3N6NA 2WVEA 2XTJP 4WYLA 2JVOA 1UPPA 2WONA 3W6VA 4CXFA 3CCMI 1SFXA 4NB5A 4XPEA 4A69C 1FRXA 1WACA 3AD8C 3L7UA 1NAQA 1ZTTA 1QAJA 4FISA 1D9DA 3PW0A 4DR6F 2DOEA 1GXPA 3AQOA 4C98A 3F8FA 1O7FA 4U7DA 1O4XA 1DFDA 3HSGA 4F7VA 5EZHA 2C3PA 1BE4A 1Z1DA 2IVFB 1MWQA 3H3ZA 3MCSA 4CICA 4MIMA 2M7AA 4D0PA 4BEHA 1U8BA 4RB0A 1RT3A 4ZYHA 1SFEA 3QOEA 2IXSA 3OHBA 2DBBA 4F0HA 4N5SA 1WI8A 3GJQB 3OS1A 4MFEA 3GJTB 2VICA 1N5QA 1J9IA 2WVFA 4D9JA 3H5XA 4M1KA 2DGQA 3BCBA 4IR1A 2W24A 3LW5C 4V19J 1NPKA 3LSTA 3OR2C 1T8IA 4BQOA 5F1RA 1FY7A 2MH2A 2IEKA 3GBGA 1SKSA 3IGVA 1N77A 4KHRA 1GQEA 1OKRA 3E2EA 3HBLA 3MECA 4YB7A 3J7AO 3MPUB 1JGGA 1RUNA 1FDNA 5LMUJ 3SI8A 3PHEA 3TO8A 1FKAF 2R7ZJ 2LH9A 4E6KG 1A0OB 4KBIA 2ZH8A 4ZVEA 4RUHA 4IX7A 2X1EA 3B54A 2IC3A 2K3IA 3N01A 4LK1F 2M70A 2W1BA 1IBMJ 4HLYA 2FJAB 3V6KA 2UXBF 2FQQB 3ENWA 3BQ0A 1GMWD 4J9NA 5F0WA 4KIFA 3BBFA 1U9NA 3EWGA 1B70B 3N6MA 4DFPA 2LXUA 3MKLA 5L46A 1HPZA 1HA8A 1E0EA 2ASLA 4CCMA 4B02A 3BGUA 2V79A 4OU0A 3CUQB 1NSKL 1YJRA 2DA7A 4IHSA 5KFSA 1LKXA 1GDTA 4USVA 4ZPVR 5G4DA 3M8QB 2GVZA 1AZSA 5K5MA 1TWFJ 3PIPQ 1RHMB 3BEGB 1IKVB 4OAZA 3W1YC 4WJBA 4IFYB 1IJWC 3KEYA 1RRJA 2M7BA 2HS4A 1ON2A 3QO9B 1AA1B 2PMZD 3HRUA 3H0PA 2BEOA 4QPOA 1VRQC 1APLC 2ZHBA 5CZVA 4O3RA 3M8PA 1WI6A 1LW0B 3X1LB 2WAEA 2XKOA 1SXLA 2VG6B 3OD2A 2UUTA 2V7FA 3WDOA 3CCUS 2D3ZA 1IWAA 4X4QA 1WG1A 5FJ8J 3OYNA 3DEWA 2GM4A 2W48A 1WI9A 4FN5A 2MXYA 4ABZA 5JI6A 2KI2A 2DPIA 1OYEA 2YPZA 4NZ6A 3OPKA 4HDUA 3TUIC 2ASJA 3PSFA 5HDNA 3OFHA 2ISZA 4OYXA 1KNZA 2MKKA 4MQ9F 5B0GA 2BANB 1N33J 5GTHC 2HVDA 3VWSA 2B6AA 2ASYA 2RKIA 3OWTA 2RQKA 3JTPA 4CNYA 4HVZA 1RYSA 4MFBA 4DV6J 1QZEA 2M88A 5IOZA 4BHQA 2CPEA 3DRRA 2VPYB 5T7LA 1YITS 1V5IB 4USTA 1S6UA 4L3NA 5GADU 2AV5A 2NOGA 3MECB 1HWKA 3IG1A 5KOXA 1FOXA 2VFTA 5KAKA 3GB0A 2EFQA 2R9LA 3DXJF 1RCXB 2OTLS 1QY7A 1FD8A 2E5ZA 2VD3A 4JI4J 4ICLA 4AYBA 3LAJA 4PZJA 3A3NB 4J9UE 3SBMA 2LDIA 5AIPA 4PQUA 2KVQE 3UCZP 1S79A 1YOVB 4JBCA 2CS3A 2Y1LB 2WWYA 3VPRA 1R43A 5I3UA 2LY2A 1CJTB 5KG3A 3H5NA 4FF4A 4ETZA 4W97A 3KE2A 1TKZB 4DF4A 1RT6A 4YHHF 2FD2A 3FXQA 2CJJA 2LBFB 5IP6A 2HYGD 1H0HB 2BJDA 1FNMA 1VQKI 3BQ1A 1HSTA 1HDPA 1D3WA 1M5HA 2BOAA 2HNYA 2QG9B 1J5YA 2MQQA 4FS1A 1FBSA 2MPUA 4KRWA 1RR8C 1GXTA 1VK8A 2Z30B 4ZPBA 2PG4A 4N0BA 3CUNA 4NLPA 1QNTA 1RNLA 4OJGA 4UUXA 4Q0BA 2M52A 3EGWB 2FC8A 2MZ1A 1N5YA 1HL6A 4EFAC 1E6VB 4PK4A 2JZ5A 3PCOB 1FX7A 3E5XA 4KA4A 1MU2B 3CMYA 5HMWA 1EQ0A 3OUYB 1QVGR 2X3DA 2HPIA 3D2WA 2XQCA 4IFVB 4XORA 5E1ZB 1YKWA 4O44A 2DU9A 4ENNA 2HHXA 3V42A 3W9IA 2Z5UA 1VJWA 1YVFA 2F4MB 1ZYQA 1KR4A 4A8MP 2E9ZA 4DSEA 3CT9A 1IVZA 4BLGA 4DSLA 3QNWB 5J1YA 3A8IA 2Y0BB 3QMQA 5D0GA 4DR3J 3JCUC 1MSFC 2RDDA 2XC9A 3TW0A 2HZDA 3S14J 3HJVA 3IAM2 1XD7A 1RT4A 1X0PA 2KRRA 1K79A 3N6LA 3I31A 1Z9CA 1B64A 4JOUA 4RW9A 3CC2S 3I9V2 2PMHA 3W2AA 1KA8A 4X1EA 4L18B 1UJ6A 3LSKA 4E7IA 2DN0A 4G6DA 4C2MJ 3N79A 3SFIA 2QTWA 3R60A 2GIVA 5KFZA 3W63A 3ZMVA 2CWXA 4LF9F 3GFXA 4CLTA 2N3OA 1WJ5A 3OT9A 1P6RA 2ZB9A 4ELVA 2R8GA 2IW5A 1CJKB 2GIRA 1MNEA 4HF0A 5A8RB 1MROB 3NBPA 1HI1A 1WF0A 2VJ4A 3C19A 2QX0A 2A6EF 2M30A 2KXHA 4ID5A 1KZHA 3Q83A 4QYZJ 1WSUA 4IL6C 3HKZD 1R27B 3RBXA 4I09A 1R5GA 2DXDA 4DV7J 1HQEB 1EV7A 4ZN1A 2XASA 2YU3A 5ETQA 3OTDA 2HWHA 2A5WA 3KJVB 1NK4A 2I38A 1U45A 3DLGA 4M5GA 5KT2A 2C2RA 1DBDA 4R79A 1YIJS 4CIOA 5IM0B 3PX0A 3TGNA 3PQJA 3KZYA 3HJFA 4JUZA 3KMQA 3FXKA 4ETSA 2NCKL 2JVRA 2XYHB 4YDXA 3SXYA 3OXGA 2ZJPF 4HF1A 1LV5A 1S0VA 5BQTA 1KEKA 3HKZA 3CCLS 2FJXA 4NXNJ 3PUBA 3QT5A 4UQTA 3K4CA 3TJ9A 2VA3A 2DOAA 3EPIA 2C6YA 1MU2A 3ZQGA 2HQAA 3PL8A 3R7SB 4LF8F 2JA7J 1RHKB 3J7ZI 3V6DB 4K4ZA 1MMGA 1RR7A 3GTGJ 4V2FA 2Z57B 1R6YA 3FCHA 3T8RA 2DKOB 1WOSA 1AXQA 5HJYA 1BR2A 3GYHX 1PG5B 2BZ2A 5K7FA 1NZAA 3CEDA 1VQNI 3VFZA 3EGZA 1S0NA 1VQPI 1WC4A 1ICEB 2D45A 2JA2A 5FD5A 1WI3A 2VN2A 1BOBA 1Y8RB 1Y3KA 1HR0F 3E51A 3M8RA 1D0EA 1CJVA 4DSIA 3HZJA 2MJUA 1WJEA 2J9DA 3R2CJ 3PW7A 5J1EB 2DB1A 1HF0A 1M90T 3FX3A 4E70A 4OZ1A 5THWA 1MSWD 1XEZA 1MSEC 1VC6A 4BQQA 4WXHA 2KL4A 3ABMH 3PIPF 3QZ8A 4DBRA 2ZNYA 2YNGB 4Y34A 1APSA 3QATA 2Y1RI 1L3SA 3A01B 2Z99A 1KKHA 3K59A 1YI2I 5A6WA 1FIAA 2OCEA 3JTNA 4QWQA 1MNMC 2HBRB 4DUZF 1YLFA 4KKOB 3WTYC 1Y8QB 3ISNC 4OIOF 3S2HJ 4RW6A 1BC8C 3OSPA 1SVMA 4LF7J 1Z77A 1W36D 2VXDA 2YX1A 1EJ9A 3BJ6A 2Z2SB 2F5DA 2AJFE 2K4BA 2C3MA 3JYTA 3V8LA 4YIRX 3CD7A 4M3DA 5G0RB 5ICGA 4ZOSA 3N0VA 1S12A 2ZC4A 5HSPA 2XO7A 3CLQA 1LEOA 2MY7A 5IC4B 5HROB 1SD6A 2ZHAA 5KFQA 4LIWA 2L01A 3B73A 4NHJA 3A0BC 1RAJA 2NVXJ 3JSBA 2A5YB 2HDCA 3TA0A 2BJ9A 1TQLA 4YB6A 1L0OC 1Z6TA 3W6KB 4DLGA 4NDLA 1NB2A 3CO6C 3UR3C 4IRGA 2XY5A 4F3OA 2BW3A 4CA0A 3FMBA 3ZC4A 2K1RB 3US5A 4UVBA 5B0DA 5KFTA 2WB1A 3A8JA 4KQZA 4MMOA 2JZYA 4C3HJ 3CJ2A 4CO3A 3V4IB 1U6ZA 2K4JA 1S1WA 2R8JA 2YQ1A 1K8AT 1RT1A 1O7LA 4RR5A 1X2NA 1NPPA 5J47A 3CMES 3D1HA 4QIWN 3CJSA 5D6FA 3EZ5A 5EG0A 4TQRA 4ILRA 1VQLS 2WOMB 6AT1B 2DA5A 1D9FA 2CQGA 5ETPA 4FPRA 3W9HA 4U95A 3ISPA 2IRFG 5DQGA 3KLNA 5HI7A 2K85A 3UN5A 2V2QA 3RR8A 3H2UB 5GPAA 3IWFA 1HW5A 1X5SA 2LLZA 2A3SA 2NZ4A 2RQPA 3GTMJ 3OSGA 4ETXA 1X4CA 2HBQB 2RDPA 1M1EB 2C2OB 3P49B 2XF5A 3EM1A 3DI6B 2GZWA 1URRA 2DA3A 3HSDA 3GIMA 3FBEA 1TL3B 4K0KF 2FZGB 3MPYA 1JGSA 2Q6BA 1FKOB 4LSNB 4GKKJ 2K9NA 3B6AA 1SD4A 4FYVB 4CDIA 1YJNS 2FMLA 2G4BA 1HOMA 2WVBA 1X8DA 1FJ7A 2FXAA 1S5ZA 1KYZA 3KHGA 3LP0B 2F8EX 4MIAA 5C24B 2NZCA 3RKYA 3JRFA 5CCMA 5JUMA 1HXDA 1NH7A 1VFJA 4E98A 1SUQA 3GEZA 2NS1B 7FD1A 4A5MA 3HT3A 1Q8LA 1K0VA 2VZ9A 4PYAA 8RUCA 2WBMA 2DNPA 3QT7A 4NLSA 2CFOA 4ZVHA 1GT0C 2NSBA 2YH1A 1Y1WJ 3TOAA 2WZ1A 2MQLA 2V8PA 1FRKA 2R5YA 3GZ5A 4TXSA 2A18A 3SZTA 4IDKB 1YRXA 3JSPA 3RTRA 3CCRS 3PNVA 4DGWB 2H5EA 2N8GA 4XKCA 1TFWA 4DYRA 2VL1A 2Y8WA 4L0ZB 2PSZA 4A6DA 2OAUA 2OPTA 1IV8A 3A1YA 4RAFA 3GX4X 2OFGX 3K89A 3IR7B 2GX8A 2CDQA 4IG3B 4P9UA 2K5CA 1RI7A 3L2RA 2R93J 1HW8A 4CLPA 1RKTA 7FDRA 3V2UC 3MMJA 3TQ1A 1U09A 2UUZA 2RHSB 3GJRB 2FTRA 4HYKA 2AJ4A 1WKKA 2XNQA 2LKPA 3OS0A 1T02A 3BR0A 1RAIB 4I0BA 2XZTB 1ITPA 4M5DB 2GAGC 4IOCQ 1RWXB 1H2UX 4BHCA 4J9KA 1NCLA 5ETSA 3G96A 4OV1A 5C2CA 1A31A 3EXCX 2CG4A 1M5PC 2NR0A 3M4OJ 1U78A 1YW9A 2CJXB 1NBEB 2P81A 2HHUA 3RB4A 2ZMEC 3H0DA 2ZBIA 3BDPA 1FT8A 3UW1A 2IJFA 3MEGA 8ATCB 2BKNA 1NHUA 1BR4A 2JMWA 2J0WA 5I42B 1AB8A 3QYBA 2I10A 1VRTA 3DPTA 2ZEJA 5HP1B 1RWOB 1UWBA 3LA3A 2DJIA 2D69A 3U27A 1KHVA 2VDHA 4RX6A 4ZVQB 3H40A 1HI0P 9RUBA 2XI2A 2JSXA 4K4YA 3NNCA 1OCTC 2AXTC 4O0NA 4Q7AA 5JXSA 4LSZB 2L5QA 3CCQI 3S3NA 1DAXA 4PQAA 3ESWB 3D5SC 5F27A 2NXJA 3LP0A 1JJ6C 2XMJA 1IN4A 2P7CB 5IQ6A 5KT7A 4CLZA 1U1PA 1F9EB 4WE1B 5EGYA 3FSXA 5J2PA 5GADI 4RBTA 3G3ZA 1IRXA 3K57A 2XLIA 2XS5A 4M5LA 2F5EA 2ICWG 2IBOA 2VUGA 3UI3A 1VRUA 4KY3A 2ZBKA 3MMCB 2QA1A 3QSIA 4F02A 3M1VB 1N36F 3G6ES 1WD6A 1Q86T 1SJQA 4XSZF 4JI0F 3R61A 3V7RA 4EJWA 4HQEA 1XS9A 4AE5A 5F9LA 4IH6A 1I94F 3TO9A 3OXFA 1HWIA 1YQHA 1X9SA 2WONB 4F36A 5JMNA 4KHPF 4A3LJ 1U8SA 4FKYA 2R42A 1J2XA 3MOZA 3H9JA 2HWVA 4LJMA 1QD1A 1Z6RA 3LP2A 1SI9A 4KV8B 1SH3A 1X1BA 2CMPA 1FLIA 2N4DA 4NCBA 3MHYA 5ETTA 4DSFA 1HWUA 1JLEA 4XPCA 3WE2A 3C3LA 3QIPA 3HHGA 1C0WA 1OFCX 3ITHB 2UUWA 4ILLA 2WB1N 4K7QA 4HSTA 3Q8RB 5IOLA 3ZTQA 2YKMA 4MTDA 1TWCJ 2FUG9 5BYSA 4O3PA 4UZBA 1DJ0A 2H5IB 2RC4A 3FEXB 2R4GA 3M7GA 4ED0A 4ZJZA 2HFNA 3D6TB 5HVFA 4C97A 1KQ9A 5DCMB 4EGLA 2JEJA 1WWXA 1DARA 1MBEA 1BD6A 3ZMTA 1U8WA 3TBIA 3CCYA 1RISA 2HIQA 5B1BH 2K7JA 3BTIA 1UA0A 3C14A 1TWGJ 4HI2A 4PG8A 5B0CA 4I2OA 1FESA 2DR9A 3RB3A 3ULQB 2XUBA 1WG4A 4ZCKA 3WU2C 3FHZA 5HMXA 1D09B 5DGBA 4JYAF 1RU2A 4ZYDA 4H4KA 4QBUA 3CIZA 3J81j 2G9OA 3HHLC 1DTQA 3I9ZA 1QPMA 4UB6C 3ILOA 2XPUA 1S9EB 2OCCH 3VALA 1TK5A 1FBQA 2HOAA 5B08A 3DFEA 2M87A 4QYRA 2DH9A 2LC2A 1PIEA 5CVUA 3TOBA 3KLOA 1UJ4A 3UVJA 3EPGA 3PY8A 2GVZB 3P6YC 2ZOMA 1TL1A 1OQ6A 2ZJRF 2FVQA 1WJBA 1JHHA 4L5JA 2HBZB 5JLXA 3OLAA 5C3EJ 3NGRA 1DQ9A 2OAZA 4RAYA 4AUXA 3CO9A 3G82B 1PYSB 4XBFA 1RSCA 2WW8A 4Z7CA 1TWAJ 4X4VA 2OTLI 5D6GA 2CH0A 4CO1A 2YTCA 3UE2A 1YSJA 4CCKA 1OY9A 3TL4X 4DW6A 3M8ZA 2OUGA 2GFFA 1TC3C 5TJJA 2RRNA 1VTNC 4ED4A 2ZH5A 1MJ9A 3GTQJ 4DF8A 4DOZA 2N7CA 2DPUA 3QRRA 1X60A 5KFGA 1G2HA 3V4GA 2KRCA 2HVHA 2HOSA 2FVRA 1FFGB 1FF2A 4LMYA 3P5BP 3I5UA 3ELHA 5DETA 4J5OA 3S16J 4CTAB 1SFUA 2HHSA 3KLEB 3H0GJ 4OI3A 2J5PA 4ZIWA 2PEBA 3TQEA 4U87A 3U7JA 3MEEA 2LFVA 1UCNA 2GA7A 1NH8A 4Q4ZF 3EPZA 5L3DA 3HVTB 3OBIA 1NDLA 2QLJB 1U2WA 5L9NA 2QQ8A 1ZAOA 1T9VA 3TUPA 5JVGF 1PGZA 3PW4A 2ID3A 5DDQC 4AIJA 1FJEB 2ZE2A 1BQMA 3TX0A 1B99A 2JPCA 2K9SA 3CCWA 4HLBA 3DGVA 4JV1A 4P2XA 1WOPA 2ZDOA 2W8KA 2CQ1A 2V50A 3FEZA 3DGPB 1M1GA 2DPDA 4ZPCA 4DPYA 3GIKA 2RMLA 1WSRA 1AUDA 5HLTA 2XEXA 4DN0A 4KFBB 1S9HA 4L9VA 4M5NA 5HLHA 3EMTA 1CJTA 1SJ4P 3NXZA 1SMYF 4OL8A 2AHOB 3OLBA 1U3EM 4DJBA 1NM2A 1O5JA 1G1XA 4L9JA 2OJ3A 2EEYA 5LEKA 2F5VA 1B4SA 3OTCA 4NCAA 2EI5A 3ET6A 4R1HA 3TMOA 3MM9B 2FC9A 3RKXA 3CB4A 1A36A 3V7SA 3HLUA 5D77A 2CPYA 4EMDA 3G82A 2K7KA 1QUPA 5IPAA 4W98A 2LBFA 4OJ1A 4IOCF 1DRZA 4NBQA 4RBOA 2YH0A 5CD4H 3KJNB 2QE5A 5D15A 2HZTA 3E7LA 4AT1B 1N5YB 1CPZA 1VYAA 1KQGB 4HT7A 3ZN0A 4DUTA 3LH2S 1D8KA 2COMA 4C3KA 4IVNA 3OUYA 4Y33A 5FLXY 4BDZA 2NYXA 2HZVA 4KN7X 3T3FA 1VNDA 1FRHA 3RQIA 1MBFA 1JKPC 2XPWA 1URNA 5A0YB 1HD1A 2B5JA 4W90B 4RUBA 5IFMA 4PJ0C 4O44B 2CJQA 4L76A 2BMBA 4P7VA 2J7UA 1SC6A 2CQQA 2Z16A 4UV8A 3M6WA 2P9EA 2NPIA 1FIPA 2V9KA 1T2KA 4MQVA 5L9XA 1SC1B 5LT5A 1RT4B 3KG1A 4J90A 3WC2A 4GVBB 2WADA 2MLZA 1LFWA 1TQMA 4LBHA 1B8IB 1CS4A 4LSLA 2E7VA 4HSRA 1QUVA 2V1NA 2N3LA 2A07F 2ZXWH 5E3QA 4DI6A 2VQFF 2KT2A 2ZKZA 2X48A 3F21A 3R7NB 4JI3F 3VAHA 4P5OA 3QWUA 4M9XA 3Q0AA 2EC2A 3JRHA 2QLFB 4X66J 1V5FA 3HHHA 2LQ5A 5MLCV 1DURA 2UUAF 5A8WA 3CO0P 2VKDA 2WCXA 5F6FA 1FXLA 4QIWD 2IM1A 4CM0A 3QPHA 1FWKA 4O4RA 4CNZA 3FMSA 3VWBA 1TU0B 4DQIA 4BS2A 3FXUA 1QE1A 2H27A 1Q7YT 5E3MA 4ZCIA 2UZAA 2DNMA 1QDUB 2KU7A 1YK9A 1GVJA 2UUCF 2VFSA 2VG7B 2LECA 3ZGKA 1E6YA 1UZHA 1IR0A 4PSWA 4GO1A 1QRYA 1FBUA 2EK1A 3DOKA 3CGIA 1I51B 1T7PA 1UL3A 4EWTA 2H48B 2NXNA 5M2PA 3K7RA 1AOYA 3QT8A 3VYUB 4C8OA 3ENVA 2VFVA 1AT1B 2L2OA 5KG4A 1Y4ZB 3FMRA 1R1TA 2KIMA 4J19A 2HURA 3OV7A 1X5OA 1K1SA 4IQXA 1ETXA 3GVAA 3IFEA 4HG2A 1TL7A 1R36A 4ZN3A 3FNNA 2CQCA 1T0TV 1RT3B 3NGTA 4FS2A 5FLXZ 5LEJA 3MVPA 3V6DA 4IH7A 4IQMA 2JEGA 1D1BA 3R97A 1HBMB 4OYZA 2PQ8A 5HNFA 2ZVIA 4CLWA 3ZZPA 2CQ3A 3VAMA 5FD6A 4UUVA 3VAGA 4A4JA 3F41A 2LF7A 2CA9A 4ZYAA 3O3LA 2RRBA 1S59A 2HHVA 4D7MA 2C2NA 2QUFA 4ZDNA 3A8KA 2SXLA 1YIOA 5DD8A 3DKXA 2HOEA 2HQNA 1X3WB 2GQ2A 2XG8A 4FCYA 3PYGA 1M1HA 3CJQA 2UZKA 5C2GA 3VDXA 3JW4A 1F43A 4B08A 4YB1P 3HDSA 4YMEA 4OV6A 3OOUA 2GAUA 1HBXG 1ONVA 1YJTA 4FDFA 5CQEA 3A4TA 2L9VA 3S2WA 2FJ1A 2KKHA 5H9FJ 4IKFA 2Z58B 4GCVA 3MFHA 1JJ4A 2XHKA 4WPAA 4RGUA 3IKVA 4Q2LA 1XNQJ 4IRHA 5K1YA 3GFYA 2XV4S 2PI4A 3IM9A 2XMVA 3LSPA 2QSFX 5BPDA 2VKHA 4RUCA 1CF7B 3I0TA 5T41A 1RTDB 1PJ7A 4UV9A 3QRFF 3PXGa 2YS9A 3SV3A 5ILVA 3HHLA 4KKOA 1G3YA 2GW8A 4UUTA 3Q2SC 2JA6J 2D1HA 1MJAA 2CQIA 1FNXH 3PDNA 5D4RA 5E8GA 2HS0A 1FCAA 4LF4F 1REVB 1UVKA 4C48A 4GKJJ 4QCLA 2VG7A 2M4KA 4YFUA 4P74A 1X19A 4DX7A 1EIYB 5KFJA 1X1CA 4FHTA 3HHDA 2WAQN 3UDLA 5KFPA 5ETKA 1IBMF 3HG9A 3GP9A 2KFDA 1GX5A 3BKTA 1XX5A 3UDCA 2ESNA 3D5RC 4DL3A 3SZGA 2VT2A 1TL7B 1HQUB 3HPOA 3OFGA 3LANA 4D3GA 4QPXA 4QTRA 1HW9A 3BQZA 2DA1A 2L9WA 2LA6A 4LF8J 2FLOA 3IBFB 4DR4F 4AVPA 3UNGC 3ZZYA 4HNVA 4ZPTR 4PRFA 3G87A 3OYLA 4RNMA 2EG2A 2QEXS 4U0YA 3CWJA 3BROA 2DYSH 1LKZA 4ZVRB 2MC3A 4A3FJ 3LF0A 1HHQA 5JJBA 1J2VA 4DNCA 3OTBA 4PEOA 2RT3A 1T9XA 2OD6A 4FNHA 2EA4A 1VQYA 3I32A 2HPUA 4QJVA 1TK8A 3M30A 1R3NA 2QSHX 1Y7PA 1JTYA 2LMIA 4G12A 1GK8A 1Y0NA 4Z2YA 2XGEA 1S9FA 4HEA9 2I6WA 4C0OC 1VQOS 2LREA 2JNJA 2E1PA 4ZP9A 3PO4A 4OYPA 1Z2LA 4CYDA 3UD5A 2BQUA 1V4RA 1RPWA 3F8BA 3IRXA 2UV8G 3CTRA 1D8YA 2B9EA 1RWVB 1VQ4I 1PP8F 1B9MA 2XS7A 1TL8A 2BX6A 3EDQB 1XTAA 3OYCA 2MKYA 1CULB 1EH6A 4QIFA 1FKOA 1HCRA 3MEXA 4RW7B 2EQRA 1G3TA 3VZHA 3S01A 2FMYA 4LLLA 1J0RA 1PO6A 3I6PA 1TMMA 4YR0A 2RF2A 1B72A 3HX9A 2E1MB 1ZELA 1LWFB 4OZNA 4DEZA 4LF5J 2YKOA 3K4NA 1XMXA 4ZPDA 2BE9B 4ZLPA 2XM3A 2V2ZA 3WX8A 1ELOA 5LSLA 4DG1B 5LXRA 4HNTA 3AOAA 5KFYA 2MKCA 2R7FA 1RACB 1RHRB 4K4WA 4BXUA 4C0HA 3G8SA 3GG0A 5E17F 5DJBA 1NUEA 3TW7A 1SFKA 2A68F 4PUOA 2B9SA 1NK8A 2QJ3A 4J9PA 3ASOH 3D66A 2V26A 5CYMA 1VJQA 5LM7E 3W8PA 5EZGA 4EUVA 1N48A 3R1LA 2A1BA 2Z9OA 3TWZA 3QRQA 3M32B 3VAJA 2KT0A 3FMQA 1KTQA 3BO3A 2CU7A 1O51A 3RKQA 2B8PA 1RT5B 2L48A 2H51B 2CVIA 2JEFA 1S0OA 2K3FA 3RR7A 3V8KA 1FMVA 3CDHA 2W9BB 5KG6A 3RPUA 2HVEA 2J9CA 1GT8A 4ED2A 2V8VA 1VS3A 3DRPA 1EH7A 1WJDA 2POKA 5LHIA 3FQKA 2J0QD 3QAUA 2FRHA 1HQ2A 4C3JJ 1FSHA 2FJWA 2R3VA 2DRAA 4QW8A 5D5VB 2D7SA 3CXCR 1WJAA 4QPTA 2UXDJ 3MF5A 4IO9F 4FF1A 3CCTA 2DI3A 2FVSA 4XIDA 1Q7LB 1XBWA 5AE2A 2EK5A 3KP6A 3BSCA 1WHWA 4CCOA 2D41A 1FEEA 5F8NA 1HQEA 1HKQA 4DV7F 5HP1A 2DHGA 3QGGA 1Z3XA 5LSOA 3K8VA 1KS2A 2CGPA 3DDIA 3L7WA 1WJ9A 2ZDPA 1B3TA 3BLYA 2NVYJ 3DTKA 3LSGA 2HBYB 2W84A 5J4YA 1NDCA 2DNNA 3D0HE 3H5RA 3L95X 1EF4A 4GMKA 4N8NA 2UP1A 3FSYA 5F1JA 1B72B 4QQBA 2G13A 3A02A 5KFBA 2DJNA 1JLQB 4IKAA 5BOXA 3JAMY 3TOQA 4HTIA 3J80K 2FNPA 4TLQA 3C7JA 2IM0A 1QPIA 2JLFA 5DTDA 2KIUA 3CO7C 1H2VZ 1JT6A 5F3ZA 2E5JA 2EK6A 4I01A 1N5SA 1WHYA 3EZUA 5ICEA 4OMFG 4DFKA 3K10A 3KYDB 3NCQA 3M3YJ 2VPZB 1IM4A 4LF2A 1DU0A 2V1UA 3MMCA 1U7LA 1R4NB 3ZMUA 4B3MF 1LK5A 4Z7YA 2WTEA 1REPC 2BYCA 1ENHA 4ZVPB 1W5CC 2LYVA 1HSJA 2BE5F 2QENA 3AL0C 4Y2KA 3FK6A 3GFHA 1YX5A 2DH7A 4Q47A 1Y0UA 4BUPA 2ZNZA 4WCGA 3K0LA 1N78A 1HBNA 4MIWA 2M8DB 3MMBA 1NSQA 4NX9A 3T5XA 4PFPA 4I1TA 2VONA 4B3AA 4QWCA 4OYAA 1MZBA 5J1EA 3BR9A 4MKBA 3CD5A 4N7TA 1VIOA 2Z0GA 4RGSA 4GFBA 5I3PA 4QWAA 3KG4A 5EHHA 4MKYA 3FXMA 5IT4A 1CLFA 2PMWA 2ZH6A 3JSOA 3D1QA 2IGKA 3BPVA 2STWA 2LU1A 4UZCA 1BIAA 3QSYB 1FP2A 1NNDA 3KYLA 4M6VA 1R58A 5AIQA 3KLHB 4CT8A 3KP3A 1LXNA 4A5NA 3K2AA 2K40A 1N34F 5DD4A 9ANTA 2VL8A 3JYTB 4OIXA 3CDLA 3Q9SA 3DC2A 3HOUJ 4B48A 3GZ6A 2LQBA 3C2HA 1YHQI 1S5LC 3AB2B 2E36A 4DBQA 5LL6d 2MGZB 1N4LA 4OYMA 3I4HX 5E2QA 3VOEA 3W60A 4DZJA 3G6VA 4FBUA 3K1PA 3DYAB 2ROEA 3T9NA 4DJAA 2AT1B 4TNOA 4I56A 2E5IA 5KFEA 3BBBA 3I71A 1DP3A 4AIDA 3SV4A 4DUZJ 3AAFA 2V4JA 1VQLI 4Y00A 1JMTA 2BVMA 3JRCA 2EJRA 1GXUA 2DO0A 3D9BA 2X1GA 1CJUA 3FKBA 2VJIA 2ZKTA 4NYPA 4KNYA 3JR9A 4OYOA 2GO9A 2P2CB 3B6CA 3IP0A 1RTJB 1NEEA 4LGWA 4DV4J 1FTTA 4L5IA 4DR7F 4QWDA 3H42A 1ACIA 2IDEA 4ED8A 1DPUA 3IS9B 2UUBF 5F9NA 1NKCA 5HANA 2RIJA 2HNZB 5FLMJ 2G1DA 3GUDA 2QA4I 3W5XA 2V0NA 4CTAA 2KL8A 4B47A 1V3RA 4L0YB 4A8KA 3PKYA 1Q82T 5L38A 3BG6A 4XRSA 3KOAA 1HBUB 1IN8A 1B0TA 2QA4S 1V9OA 2Z4PA 4X64J 1V55H 4F4KA 2QL9B 2CSOA 4BL0B 2DGOA 3BG9A 4G1PA 2I5UA 3CDEA 3S3MA 2RS2A 1A9NB 3SQOP 4HTJA 4PWUA 1M5OC 1WEYA 3MUMP 3K5LA 4K59A 4C0BA 3E0JB 2PMZA 4HR2A 1WFXA 2OSRA 3G86A 1BQMB 3D1NI 1P92A 4LFAJ 1KOOA 2CUJA 1SH2A 2CPIA 2F9DA 3EGVA 2R7UA 3MEKA 3PRDA 3SCKE 2DDBA 4Y65A 3IRQA 1OJ4A 2RUSA 4JYKA 1UAAA 3AFGA 2IA6A 3H90A 4DU7A 3M2RA 1U48A 3S93A 3T1HF 4NLYA 1FC3A 3FFIA 2J9EA 1ZM4A 3ET6B 4OHWA 2P5KA 4IQJA 2PLYA 5KFXA 3JRBA 2L3DA 2CZVC 3PJXA 1JUSA 3RZDJ 2RSQA 1VQNS 1FJGF 2HLUA 2ZSIB 2H09A 3E6DA 5DDOC 1XGOA 3BP8A 4AU7A 2W4SA 3KUGA 3U1LA 1TR0A 1YLXA 2KFZA 1TL4A 5JVTA 4FYXB 4A3IJ 5I4MA 1T03B 3RBZA 1X1AA 1JJCB 5D8HB 1QSLA 1VF9A 2HZAA 1RZMA 2EFOA 2Y9HA 3H4BA 4ECZA 1D0XA 5M3FJ 2DA4A 1I6HJ 4HW0A 4ESFA 3PRVA 2HRUA 2CIMA 3I0RA 1GHCA 5AE3A 4MTEA 3GTJJ 3SCIE 4KE5A 4C6AA 2G7HA 4ZVFA 3LOCA 3VAKA 5LD2C 4LSLB 2B7CB 4EMSA 1S7EA 2BKOA 2GGPB 3CJTA 5F0HA 2EBGA 2GXAA 4GVBA 1YJNI 1QAIA 2ZZMA 3I59B 2KT5A 3BR3A 3BQ2A 3HOZJ 5IV4A 1CS4B 3S15J 2E5HA 4DU8A 2DFIA 2W7OA 1LNWA 2D9PA 4B3SF 2DXEA 2DD8S 1FWZA 3BPXA 3HTSB 1RHUB 3TVYA 5AXNA 4C2TA 4U88A 2DFFA 2LYCA 4Z37A 1G3WA 4GO7X 1R0BG 2MY8A 3EUHC 4DV0J 4F92B 2ZJ2A 4R0EA 3I5BA 1CQNA 1HNXJ 4FASD 3HSJA 1XJWB 4HZFA 3OYBA 1KDNA 1NU4A 2C42A 1O3RA 2DNKA 4XTTA 1OPCA 4B3OB 2XB0X 1AW0A 2XZDB 4WTOB 3L1PA 1S77D 1P2FA 2EFNA 4N56A 3GTKJ 1EZZB 2UVWA 3D7SB 2E29A 4WFAQ 4BS9A 1N36J 1L5UA 3VEPA 2PBIA 1JLCA 1MD0A 1YQAA 4F2RA 4K4UA 1T9UA 1S72I 2DTJA 1YG2A 1SCJB 2KYXA 3RZAA 3CNQP 3R1HA 1H6KX 3OL4A 2MH9A 2OPPB 1NG6A 3TQNA 3BPSP 1RZ4A 3GW2A 3DF8A 2YWGA 1HBMA 2MKJA 2Y9ZA 1DHMA 3EVWA 1TP4A 4LMZA 3HO1A 3LGHA 1FWPA 2R7XA 1S1VA 1YI2S 1VQ7I 3CUOA 3H3UA 4FKXA 1I3OB 3I82A 2Z1DA 2D3UA 4H4OB 2QM3A 2BEFA 3WBZA 3W2WB 3MAHA 3K58A 4X2BA 2DODA 3GF2A 2L7MP 3CJNA 4F91B 1ZRFA 4DS5A 5BYQA 4DPWA 3CIMA 2X6XA 2QQAA 2E60A 1BR1A 3ZZ0A 3KEOA 4WU2A 4KITB 1UPMB 4XLNF 4KGZB 3I59A 4NCGB 3AJDA 2OSQA 5KFHA 5HVHA 3PO5A 3BGLA 3G71S 1BWEA 3ERMA 2JX2A 1IWGA 2O0YA 1KLNA 2EPIA 3BTLA 3DRXA 2XVCA 2IGNA 3HHLB 3U21A 4L74A 3Q86A 2M34A 5LSRA 3RW7A 3R5GA 4DN9A 5L39A 4LFBJ 3I0SB 2YR2A 5IWAJ 4XL9A 3F73A 3MDFA 3HFKA 3KJVA 4CO0A 2DHAA 3M2UB 3GYNA 2XY6A 1LWXA 1UW4A 4O5VA 5IM0A 2MKSA 4OQJA 2KQRA 4WWCA 1VI7A 2QKLB 4GDFA 5EGOB 1TELA 1IG7A 1HQUA 3CP8A 1ZN2A 4M3EA 5GAGU 3WTXC 4AFFA 2CJBA 2HRTA 4N9IA 4KR0B 2AZ1A 2RQCA 3RYRA 3OYEA 3RU0A 4NUBA 5K7ZA 1E17A 4G1IA 4PDKA 5B0AA 4O6JA 4BKXA 4QU6A 1PUFB 5CQGA 1USSA 1U1KA 1KHWA 4ECSA 1BMQB 1IDYA 2KM8B 4ECVA 3H59A 2VOPA 4G6QA 4E7HA 1IDZA 3SZ2A 3OYHA 2CPXA 4YHHJ 2LDYA 1X4FA 4ZHRA 3WHBA 3ECHA 1OSCA 2ZH2A 4RM2A 1YRNA 4U8YA 3MWMA 1LWCB 1SMTA 3HVTA 2BY1A 1ETWA 4NLRA 3HHLD 2H4WB 1OJLA 5F3TA 1MKMA 3TUZC 2AYBA 3CC7S 4CZZA 2W2MP 1YW7A 3EDPA 3P96A 3DLLF 4I4BA 1O57A 3RRGA 4NI2A 3L2UA 2ZSHB 3VTIA 2ACMA 3L9ZA 3SHFA 2MKHA 2LQ8A 2JA5J 3DPLC 2JSPA 1YFHA 1F2GA 1A6IA 3QWLA 1SC3B 4BYYA 4Q5SF 2DIUA 3CUQA 1Y9OA 1IUJA 5FLXU 3VV2B 2OF7A 2AW0A 4KGMA 2KG0A 1B4AA 4EU0A 4G7ZF 4ZS6A 1TT0A 4EYIB 4Y15A 2YNGA 3A03A 1OR7C 4WKYA 4M9ZA 1FXDA 5KG5A 3F72A 5K20B 4ED7A 2R2SA 1KBRA 1R8CA 3CCVS 3R6LB 4XNFA 1RHQB 1U26A 2E44A 3M8PB 1HNWF 3P8BB 4DQQA 2OFHX 1AA7A 5IT9Z 4L73A 3O3KA 3DDNA 3G8QA 3OHAA 1KQ0A 5A2QU 2JRSA 3NGUA 4I02A 4BY1J 1U1OA 1JUPA 3OFEA 1XSXA 2FBIA 4LOCA 4P55A 3OVSA 1LDDA 4CDGA 2AP6A 5F0UA 1RA6A 4ELTA 1DLOB 2MHEA 1T9TA 1XWLA 4A3KJ 3WX4A 3NS5A 1U8RA 2GHWA 2MBFA 1FD2A 3VHQA 3TJ8A 1SV5A 4AD9A 4BBRJ 2PC6A 3G1LA 1SQFA 4HX8A 4NRTA 1BI2A 3ZFVA 4UOFA 4CH1A 3TZYA 1JTXA 1XDUA 4A0ZA 5C4XJ 1S6PB 2EBEA 1MGTA 2P7VB 4R8HA 3JREA 4HACA 3HSRA 2CYYA 2MLKA 2OQRA 4YOEA 1IQTA 4D3HA 4A12A 5IYCJ 4RAZA 3IG1B 1QAYA 5GAEJ 1ITYA 3SXLA 4P73A 3K4LA 2CW8A 1DUXC 1C0TA 2AO9A 3GG1A 3GYXB 4WWSA 3VB2A 3AG2H 2RQQA 1Z05A 4N77A 3F8MA 4XAKA 1GLNA 3HFZB 4UUWA 2ZZTA 4PKDB 4MEYF 4NPOA 3EX7B 2I5JB 2PMZN 3K5OA 5HJXA 4LFBF 4KAIA 3GFZA 4HDHA 3DLKB 3LQVA 2VPRA 3EQLF 5H9EJ 4KYZA 1BI1A 2AYMA 3HHKA 1B6AA 5KT6A 2WAQD 4FTHA 2L9RA 1M0SA 4D7NA 3DBHB 2VQFJ 1WH7A 1TKZA 4DWIA 2YNIB 3CCMS 1D5VA 3FKIJ 1FKPB 1W25A 3DLJA 1L3UA 2ZD1B 1UG0A 4O3NA 2J7KA 2L54A 4LSNA 2FQ4A 3CJ0A 2HNYB 3TEHB 3QPIA 3NWTA 1H72C 4K8RA 5F8LA 3ZCOA 3X2QH 1U9OA 1S1XA 3SDEB 2NS0A 4CO4A 2IRYA 3MFKA 3UN3A 1TVRB 5M5XJ 2VFUA 2ZBPA 2DCUB 2R7OA 4RB2C 2IP2A 2XB5A 4ECWA 4Y52J 2LU2A 1JLQA 3C15B 4RLQA 1DY3A 4S05A 5DG8A 4J9RA 2VJVA 3EUNA 2F48A 2ABYA 4I7HA 1P7JA 2JC1A 3Q23A 2GMLA 4JI7J 1YJ9I 2BKPA 2K7LA 5KFDA 1WJFA 4HX7A 1AKHA 3D3CJ 1RT7B 3DLAA 2VQEF 1K78B 3GV7B 3TAQA 5KT4A 2W4DA 1G2EA 2AYGA 3K4MA 4J37A 2G0IA 2DGTA 2NS7A 2PDAA 3DQVC 2PEHA 4RNHA 2HNDB 3E6BA 5DZ7A 4X4NA 1RAAB 2Q43A 4HRIA 4OI0A 4XDCA 1X2MA 3CJQB 5J2NA 3CTAA 4ESBA 3L2CA 2QEXI 4W92B 4DDFA 2VFRA 1P7IA 2W8LA 4CYUB 3LA0A 2Y3YA 1HMVA 5GAHI 3C16A 4YEJA 3I96A 2VKZG 3THTA 2MZQA 1GV5A 4RW4A 2HZCA 3LQRA 4DV2F 3AG3H 1R7IA 1K0TA 1KYWA 5E3OA 4ENJA 1LFUP 3BZCA 2E1MC 5M2UA 3MD2A 4A8SA 2XS2A 1STZA 4HDGA 1MROA 3NBPB 5C25A 4JP8A 3CF5Q 5CCLA 2IRXA 1RQ0A 2MD0A 4WFXA 2MZSA 1F1ZA 5ILSA 4PZVA 3TA1A 1N56A 2D5VA 4B3TF 4B3TJ 1LE8B 4ZZDA 2HS3A 1ZLJA 2EKYA 4K0KJ 1VQSA 4ZDOA 3DLGB 3TAMA 4XSXF 3DTEA 1REVA 2CQHA 4XICA 2GMJA 2ZOGA 3DTIA 2VJ5A 2MSTA 4NC6A 1K6OA 5K14A 2NXEA 4AXJA 3ZQFA 4OHVA 1Q5VA 5MAOA 1HNWJ 3SEZA 1RTIB 5D4LA 2RAQA 2OGUA 1T3NA 3F9KA 1KN6A 3PFEA 2CAJA 4LVNP 1IXKA 4OHXA 1IBLF 4F93B 1IBLJ 1ZREA 2XYPB 2B4PA 2WK4A 5FKOA 3BSAA 3FCWA 5DV5A 5KAFC 4J00A 4TY8B 2LMDA 3T1YF 4G6TB 1FTZA 2DHXA 3ABKH 1AFIA 1D5YA 2GZOA 1R5ID 2EFVA 2V68A 4HLXA 4DV1F 2LCWA 3DYAA 5GAGI 1JNZB 5ICCA 1Y3JA 1ON1A 3QWPA 4J91A 3JAMZ 1AU7A 3W2VA 4H54A 1F2HA 1K78A 2CQ4A 5KVRA 4JX6A 1FJCA 3VODA 3L09A 2JH3A 1X5PA 4K5SA 1FOWA 1WG5A 3KUHA 1P1TA 2HQ5A 2OMOA 4DR4J 4ZC3A 1WELA 4F67A 1Y56A 3IL2A 4ZVSB 1Y0HA 3GFLA 2J9DE 3RRKA 2W4PA 1CJVB 3KK3B 2XRLA 2Z3YA 3IS9A 3TP3A 4L6V3 2LXIA 1V5GA 2PMUA 3W64A 3OIOA 3L00A 5IYDJ 3JB9k 3GTPJ 4KSEB 5L3EA 4B9MA 1HKAA 2CWEA 2GXGA 3LWMA 3IRXB 1MH3A 2D3O1 4EEFG 2BY0A 3MR3A 2CVEA 2CW7A 5D5XB 2CZ4A 1JXSA 1PKUA 5B3SH 4ZP6A 1WUUA 3OR1C 1R71A 4MYUA 2ELKA 2JC0A 1ZAVA 1R00A 1CG2A 1XERA 3KIOA 1UEVA 4OOIA 1WC1A 2BXYA 1CULA 2WW4A 1K83J 2X1CA 4G1QB 4GC7A 3HI9A 4I2QB 1F3FA 1CBKA 4DL5A 4OZ0A 2K86A 1ZKGA 3GZNB 4J9LA 1O3QA 1ZHFA 5B5EC 2PO4A 4WTYA 5FDLA 5BJRA 5J40A 4XLCA 4AIKA 2RF2B 4A46A 2ZH3A 5E8IA 1YS6A 2MJNA 1FNOA 1IXSB 3ILJA 1FWLA 2IA1A 2B9YA 1FDAA 4U8VA 1F5BA 4EM2A 2CFXA 2W25A 4ZP8A 4MFDA 2RU3A 4K2XA 3LQQA 2MKIA 2B9WA 2O8KA 2YKAA 3KTQA 4PCQA 3PHTA 1J5OB 3NWRA 2V63A 2HKXA 4QWBA 1FVQA 1DGWY 5KNLA 2DMUA 3TVZA 2UXBJ 3TO6A 5KFMA 4B4CA 3RKWA 1YG0A 4CWBA 3T6BA 3Q0VA 4V19K 3CCSI 1WCMJ 1N52B 3M2RB 1VQ9S 2IBKA 1R22A 2D9OA 1Q81T 1WRJA 2K02A 1WEZA 2R0QC 3KK2A 1WKJA 2BJ7A 2VPXB 5ETNA 5JFRA 2QO3A 1SQEA 1T0FC 3AT1B 2MW8A 2R8HA 3QBCA 1S49A 1S76D 1P6TA 1TZ0A 1FI4A 4YQWA 4LB6B 3MMAB 5BPIA 3DU6A 3E6MA 4HAMA 3UPFA 2IGMA 4X4OA 1PSDA 4LF7F 2HK2A 4WF9Q 1NSPA 4I2PB 2W2NP 3NS6A 4V19X 3RAQA 2XBPA 2Z56B 1NG7A 5FLVA 5J1PA 3A8EA 3SFGA 3CJ5A 3Q9VA 4CSWA 1FEXA 3IH3A 3BYPA 4RM3A 1WPKA 2IRUA 4LR8A 1N25A 3MN2A 3WG7H 1X4BA 2XMTA 2NYHA 3UCUP 2KMUA 1QQIA 4AVZA 3NLCA 3ZQCA 4JX5A 4KMFA 3D6FB 4H4MA 2DT9A 1YITI 3U1MA 2E1OA 1IN0A 1E3OC 3EE3A 3NY0A 3ZP5A 1ZG3A 3M6XA 2JWNA 2GHVC 2FVCA 1YO5C 4DCPB 1D0ZA 1W7PD 4DZ6A 2Y0SA 1RWPB 4J7CA 2BY2A 4C11A 3PX4A 3WGIA 4FXDA 5FFZA 5C24A 4RLFA 1K73T 2ZE2B 1IGNA 2X1FA 2DNGA 2J6SA 3K5MA 4II3A 2YWKA 1FYLA 1EKRA 1KLMA 3OL8A 3P9KA 3QQAA 2DTRA 4XRMA 3WIUA 4C9DA 2XSJC 2ACYA 2ZJQQ 4DR5J 1IKYA 3LSRA 4GGGA 4BDYA 3SQNA 1S6QB 1Q1HA 1NK0A 1J5OA 2LFBA 3DM2B 1XC9A 1FVSA 2VASA 3HOTA 5IP7J 1X3UA 2KKOA 2KP6A 1H74A 2FF4A 2GCFA 2OEJA 3O44A 2H8WA 1I5OB 1P9QC 2Y1IA 3IAS2 4DV3J 1C0UB 2EZHA 3R5DA 3NNHA 1BLUA 4XRSG 4B3OA 1YJWS 3PEJA 4X66F 3GIRA 4B9VA 1NDKA 3J7AY 3EYYA 3FEYB 1LQ9A 4L75A 3M9NB 3ZO7A 3POTA 2COLA 4C7QA 3VYSB 2MQOA 3WG9A 4ENOA 5D4SA 1LFPA 4LITA 4C2UA 1FNNA 2DO4A 3K4BA 2FOKA 1F36A 1UVIA 2HYFA 2HTSA 1U2RA 4ESJA 2IS1A 3AXMA 2WAQA 3D6HB 4PYDA 1MN7A 4TYBA 3ZZUA 4DR1F 2PA8D 1VBXA 4P96A 2ZZNA 5E20A 2DRBA 3MAAA 4HV5A 5L8RC 2XMWA 2PIIA 4I6AA 1TUVA 4HX4A 1JLFB 2EV6A 2EVZA 2AGQA 1T56A 3GSIA 4QOTA 1G59A 4WKRA 1UWBB 4IO1A 2FJVA 5DS9A 1H38A 4A0XA 4RU2A 1U0HB 5FKNA 5EN1A 3RB0A 2YWWA 2L9NA 3TP2A 1ZBTA 2AIRB 3LO3A 3ZTSA 3MM5B 3TP0A 4LVOP 1H7WA 2ROPA 3KK1A 2V9VA 1LPQA 1Q8BA 1WKMA 3GYGA 1JXEA 4F4YA 1H7XA 4USHA 4OJ3A 4P9SA 2IM3A 1ZTRA 3EETA 2JJ4D 3S1TA 3M9MB 1XR5A 1WC3A 3PNTA 2AQ4A 3COAC 4ZYGA 3BG3A 1OPZA 4DFJA 2I8DA 5D4PA 3NWGA 2Q6CA 4B8XA 4XOPA 1KRPA 3GWZA 2F7VA 3SQGB 3LGMA 3I58A 1ZM3A 4U9RA 1OCZH 1Z91A 2HXOA 2BANA 2W2QP 1W7PB 3DP7A 2IIHA 1NK2P 4NQWB 1MH4A 1UW9A 3N97A 2DYRH 3TA2A 4UTGA 1U0JA 1E2XA 1BL0A 1A7GE 2V4JB 3DRRB 2FDNA 3MM7B 3BR1A 4A48A 4USMA 3BH7B 2AJQA 3FK7A 3TZXA 3FHNA 4HPQA 3MCNA 4DR2F 1FE4A 2QVOA 1GV2A 2DY1A 4RL1A 1LW0A 3DOKB 2DR8A 2PJRA 2QMUB 3M8SA 4XMYA 1XMKA 4GXOA 2XMAA 1JLEB 5CVIA 4BE2A 1UEUA 4DHVA 2V6EA 4NNJA 4CH0S 1IW7F 2VIXA 1GTEA 2QZ8A 1UVLA 2CXEA 2IJNA 2M9KA 1KC8T 2YKMB 2HNZA 1J7KA 3JSMB 4B3SJ 1PUFA 1XMAA 2GQCA 2OPRB 3H8YA 4KIAA 3F23A 3K4JA 3WQPA 1MMLA 3M1EA 3BZQA 2X7IA 1W26A 4ANCA 2EV5A 4DQPA 3BY6A 2EZLA 3MAAB 1IJFB 5T7LB 4X4TA 5E79C 1SIWB 2UUBJ 1PUEE 4UHTA 1FRLA 4KJIA 1OYYA 3GTYX 4JI1J 4ZCLA 1X1DA 2ZXIA 1VQ4S 5D0RA 1X9WA 3OJUA 4YS2A 3BOQA 1F60B 2UU9J 2YKQA 2XGXA 4NI2B 4F8RA 1DP7P 5E3AA 2BHYA 3NRVA 2DA6A 1Q78A 2VV5A 1TWHJ 1WC0A 2ZFHA 3KXDA 2XY7A 5LGNA 4G7OF 4BXFA 2IYIA 1SD7A 4WK8F 4EV0A 2YBVA 2BOPA 2MSYA 3MZHA 4EZ9A 3GIJA 3MM6B 5D5UB 2CRGA 2CPZA 2KRHA 3ONQA 2L02A 1W0UA 3S3OA 3K1MA 5J4VA 1IUFA 3L9FA 3I55I 2HAIA 2QGFB 4C4WA 4AL7A 4YFNF 4U7UD 4AYBN 5LMNJ 3JRDA 4D1QA 4Y2IA 4BCAA 4CYCA 5LJ5Y 5HATA 3H5UA 4JI2J 1IZ1A 3DLEA 1UELB 4FYDA 3U1NA 2PJPA 3LTOA 4EK2A 4OZ2A 3SYZA 2HS5A 2W82A 2IS2A 4GRSA 4TY9A 3OSFA 1PYVA 3REOA 2KDOA 3D4JA 2QRRA 4IRDA 3DRSB 1BQNA 3P45B 4ZA1A 3HPGA 3IHUA 2O66A 5B7WA 4PGGA 1ZS6A 3G8TA 3VAIA 2X1DA 2QKMB 2BXJA 2HHHF 1PVEA 1X9MA 4L72B 4OI6A 4JK1X 5F0CA 2VLAA 3ASNH 3FZBA 4I64A 4E4HA 4ELUA 2QYCA 2RNEA 5TGTA 3MWBA 4WZQA 5KT3A 1X1PA 1ZH5A 1TUWA 2QF7A 4I0AA 2J6UA 3A4CA 4IHWA 2MABA 1F6TA 4Y13A 3DHXA 4UNOA 1SV5B 4OMYA 1S1UA 2VG5A 4AXIA 4ZVTB 2HHWA 3QU6A 1R0CB 5DLFA 3MZ8A 3B6BA 1VZ0A 2Y48A 2A61A 1HD0A 3VAFA 1BOAA 4G3IA 3HVWA 3ILIA 1Y5NB 1GFWB 1RADB 3CCLI 4RW9B 3JQKA 4NC7A 1TKXA 5IC6B 2AD9A 1IUYA 2R7WA 1C0TB 2H94A 3NRBA 5DDRC 3UNYA 2BXZA 3EUHA 4TN2A 4PG6A 1G4CA 2MQ8A 1NH3A 2I5JA 3EUAA 5HMYA 5DUKA 1NHAA 2DT5A 1PJ6A 1OIAA 3U1DA 4ZVGA 3M8EA 5LOQA 4ED6A 3DMJA 1GH8A 1HHSA 5GAEU 2MLGA 3QQCD 2W9CA 2XGCA 1N5VA 1F5TA 3WHCA 3TJAA 5B0BA 2AS5F 2FJDB 3MURP 1PJ5A 5A8RA 1WTBA 2DHSA 2F8MA 3QP5A 2XC7A 2AQFA 1D8JA 3KCCA 1NPRA 2YNIA 5J2QA 4KC5A 1Y11A 3K0JA 4DL4A 2BW7A 3DCAA 3W5YA 1X5TA 1F5AA 1GEHA 1S99A 4QR2A 4DV0F 4RUAA 2AEFA 2HEKA 3OR2B 1VHIA 2G0CA 4FXVA 3VR1A 1BWVA 2XRNA 1TVRA 2DY9A 3LNQA 2Z2LA 4UT4A 4M5JA 1SAXA 3R7BB 2VIHA 4CT9A 2MYSA 1IKWA 1S1XB 4BGDA 4ZZLA 4AQYJ 2KRBA 3BTJA 3OTOJ 1UEKA 1PBAA 2BOLA 3EDRB 3HULA 3RCOA 4UY8I 2PN6A 1FFWB 1JLGA 2ZVSA 3OIPA 4IRKA 1HBOB 1ZR2A 4WCEQ 5F8MA 2O3FA 3R0AA 4USUA 3LUYA 4I6YA 4X65J 2LP0A 1HNXF 2ME6A 3HOXJ 3AB4B 1OCRH 5ETLA 3KLGB 1KGSA 2F2EA 1BBYA 4X84A 3G73A 3RAMA 3E5QA 1OISA 2CV2A 3RBDA 3IP4B 3W2WA 2DGSA 1HMVB 4GO5X 2VI6A 1VISA 3FRYA 2ETHA 1HA1A 4X4RA 3HHNB 2Z2YB 1B8IA 3S32A 2Y9YA 2IT0A 3O2IA 2YSRA 4FBTA 4KGVB 2IHR1 2R7SA 4G9YA 1Y5IB 3FXJA 4EJTA 3J81K 4HH0A 4LUBA 1LFBA 4KB7A 5C25B 4OZLA 3MMYB 2GS8A 3PRBA 2HQ3A 2XAJA 2WV1A 1NJZA 2IMWP 3FXLA 3Q0WA 5LRRA 3GMEA 2ID6A 2L3MA 1QE1B 2HAFA 4OFZA 4ZLLA 3WTVC 2K27A 1O8BA 1HNVB 2MA3A 3V4MA 2C2DA 5DM6F 3ILLA 5J2QB 2LTPA 4LF6J 3UD4P 3L4BC 5HLFB 4O0IA 3I0SA 3HFVA 4BBYA 2BQRA 4PJLA 2RHQB 4LRFA 4NYOA 3UN2A 2VBZA 5DYMA 5F8JA 3PG9A 4IHTA 2V8DA 2M2BA 1U24A 3FCVA 5B66C 3Q8VA 3UWTA 4I6ZA 2DXFA 3G9CA 1IKWB 1I3QJ 3JS9A 2HHHJ 4GYIA 5K8PA 2IJRA 3H2LA 2BV6A 4GRIA 4A8XA 4ECRA 2HFVA 3OYJA 3RI4A 4MAKA 1MBKA 4WFYA 2ZXHA 1XG1A 3H7HB 5K7HA 4BH9A 5K8OA 2YXLA 3V81A 2H6CA 3WZ0A 3PJRA 3PR5B 3KFWX 1K44A 1U6FA 4BJTA 1JNRB 5D6EA 2W57A 3R5JB 2RNGA 5J2MB 4OHZA 2GQQA 3BB5A 3IWLA 5DLGA 1OQ3A 4EBDA 2KM8C 1VQ5I 3KEQA 2LY9A 1GMUA 3H36A 5KFOA 4IR9A 4MGRA 1QSYA 2ZBQA 2DITA 3NEKA 3R8YA 5BXIA 1F5CA 5D4OA 4Q8FA 3GR1A 5HBMA 3UFCX 1EB0A 3MZYA 1FT9A 4R0JA 2PEXA 3LPEA 1R49A 1I1SA 3TANA 1OCPA 3BT9A 4IG0A 3F6OA 4AIHA 4U96A 3E5UA 4BJ5C 5GADJ 4PG4A 2CNLB 3HM5A 2K06A 2D74B 2KISA 1WH5A 1D1CA 3QAHA 1YIJI 2BZTA 3ZMZA 4CQ1A 2KJWA 4H4KC 5AT1B 1S7AA 4IG3A 4LFCF 3KLHA 2A69F 2X3GA 1WWHA 3PM9A 4N47A 1NJYA 3H2VE 1XSDA 2XHWA 2MQPA 6PAXA 2CQPA 1GVDA 4BQNA 1IN5A 2LG4A 4DL6A 2CQ0A 2FYXA 4HHUA 3PSIA 2ZC3A 4CLUA 2QWWA 4YELA 3WTZA 5ITHA 1ZQ3P 1TAQA 3MM8A 1T39A 1KTVA 1W7WA 3FGVA 1U5TA 3X3UA 2KZMA 1SB6A 1KU2A 2O7OA 3TO7A 1WGXA 3MAJA 2KYZA 1EP4A 4PJNA 2PE8A 1N5TA 3MR2A 4R5PA 3CC2I 5LGUA 3MKWB 3KK2B 4ZTJA 2DAOA 5EF6A 2RD5C 1W0TA 3Q22A 5EWGA 1R8PA 3D0SA 4DQSA 4MLOA 4YUDA 3Q8UA 2XGPA 3M07A 3OJSA 4AD6A 2NOJB 3PQKA 2B7EA 2XIGA 2QBYA 1WZ2A 2AJ2A 1RAFB 4HT5A 1YRTA 1EKSA 1T08B 3N05A 1FE0A 5J2MA 2FZKB 4IRIA 3IH2A 3GSDA 1SC7A 3N28A 3TUJC 4DZDA 2QFIA 4M5DA 3CCRI 2RQMA 4R8UB 2Y75A 4KIBA 4NZ0A 2QGUA 2UXXA 2OI2A 3ICLA 4RB3C 3M8WA 5CAAA 2JWTA 1FJGJ 1CSJA 3NGDA 3TYTA 2XMKA 4HEA2 3BG7A 3BC8A 2ADUA 1ZM9A 1VC0A 5EDNA 3HT0A 3QT6A 3C6UA 4MH8A 1WDTA 1HWLA 5H20A 1CC8A 1F1BB 3GMGA 2IAIA 3WTSC 2D3OR 3B4MA 2N82B 1FKPA 4OZJA 3LAMA 2NS8A 3FZVA 1ETQA 1FRMA 4UQGA 1ULYA 2X6WA 2DNOA 2F40A 1PJRA 3RIRA 1V6HA 4RLEA 1B0VA 1QLNA 2OBPA 1Q53A 2JVGA 4USKA 5K9FA 2Y2ZA 3K2YA 1XSVA 1LJ9A 2L4AA 1IKYB 4KYWA 1XN9A 2VH7A 3PNIA 4C3MA 2HU9A 4AL6A 1K9MT 2CNNB 2JL9A 1KLMB 1L3KA 1DU6A 2YNFB 2KXNB 1SQGA 1SVDA 1ZK8A 2QT7A 3ELKA 1NKEA 4Y28C 2CQBA 5A2QY 2DK2A 1GAOA 2CV0A 5H6QA 1AFJA 1LWEA 1D1AA 2BGCA 2DJWA 1UWAA 1IM6A 4LFUA 5LGTA 5AJ3F 3POTB 4M5MA 2JRTA 2C28A 2DMNA 5LBQA 3KLIB 5CYVA 4ZVUB 3NNAA 3LSHA 1RT5A 3LP2B 1C1CB 1KD1T 2KB2A 2LQJA 4KPCA 1TV6A 1GMVA 2W9BA 1QVFR 4LB5A 1K1QA 1YWXA 4DFMA 5CVVA 3IAM9 3FF5A 1NK3P 2Q1LA 5KFUA 3C16B 3CCEI 1V3FA 1QTMA 3RPQA 2LNBA 2XF6A 3JRIA 3E3XA 2DR5A 2ZKUA 3RYPA 1ZYRF 4BQAA 5T14A 1SH0A 1RIOH 4WZMA 2XWXA 1JQGA 3OQ2A 4F7ZA 1I50J 4RS8A 4CLLA 3D0GE 3LAKA 1HC8A 4YR2A 1X4DA 4CI0B 2F1FA 5DS7A 3M7VA 1U0HA 2YPRA 1BC7C 3HXLA 1K7AA 2OUMA 2HXIA 4HBLA 5F64A 4DS4A 2ATCB 2RDIA 3R5CA 2MGQA 2FPHX 3TAMB 5FKLA 4NLXA 4DZPA 2A0FB 1B7YB 2L7FP 3C14B 2K3PA 2KJCA 2MQNA 2V1XA 2Y0SN 4EM0B 1LDKB 3OY9A 2AYEA 5C4JJ 5M3MJ 2KTQA 3J7AN 4P2MA 1MDMA 1XPXA 2XZWA 3T41A 2QMXA 1I39A 1Z21A 4ZH4F 2G2YA 3E01A 2ZHOA 1Z1ZA 2W85A 4QZVB 4A0YA 3H9QA 5SUHA 4MNUA 3NAUA 4F25A 3O2PE 2EV0A 2CUYA 3G2XA 4WXWA 1Z0XA 3SQGA 2M4MA 2HRYA 4OI2A 3UCGA 3OL6A 3D1OA 4NC8A 4NQWA 2HG4A 3HPHA 2RN7A 3S1MJ 2V4QA 2MG4A 1Y00A 2H6BA 3FBBA 4DSKA 1IXCA 3DU5A 2CQ2A 1JWWA 1QTNB 3HL2A 4BU2A 2F65A 3Q2TC 1NO8A 2X1AA 2ZM6F 3FISA 2RVCA 4EATA 1XK8A 3ABLH 3N5BA 4NMLA 5GAEI 4TU8A 4RNFA 2ZBRA 3MM7A 2O9LA 1J27A 2F5GA 2OU2A 3BR5A 1JKOC 5A2QK 4DX8H 1FYKA 3TAPA 2YWFA 2BM1A 4C30A 1HBNB 1VFCA 3MMBB 2MFZA 5J1UA 3SZPA 1BUXA 2IAJB 2EBIA 2L7KA 1QA6A 1AHDP 2OPRA 4ENKA 2CW0F 1ROFA 2U2FA 3AXKA 4JX4A 2YX7A 2I9SA 1X4AA 4CCLA 2PX9A 2HQCA 4EBEA 2KDZA 3JQMA 1JLAA 1ETYA 2APOA 5FFXA 1IJEB 1YJWI 2OPPA 3W62A 3OL7A 3WU1B 2HHQA 1AZSB 1D3YA 4FP9A 3IBCB 4MJKA 2BJ1A 2HDWA 4OZ3A 3MEEB 3MI7X 4YY3F 1RC9A 4XKBA 4KO0B 4UY85 3KP2A 3GLJA 5JVHQ 4A3BJ 1WHVA 3HZEA 2LQ9A 1XB4A 2IBDA 1NRKA 2FEZA 5LJ3Y 2VG6A 1RTHA 1NJXA 1WVRA 2DNHA 3FMWA 2LK2A 3IRWP 3RYLA 4WF2A 1BM9A 3GFIA 3ZQIA 5LHHA 4IHVA 4F3MA 4BAYA 2B43A 2NREA 2H65B 3MM6A 2EIJH 1JKQC 3E01B 2GA2A 2M8GX 5F04A 2UVUA 1ZGWA 3TRGA 1OYIA 1K61A 2X0LA 4UUSB 2OPQA 3PJ9A 4NCGA 3NGSA 4P10A 4XQFA 1XDSA 2V6CA 4C8YA 4KHMA 5L1JA 4QPQA 2IS6A 3S17J 4DIQA 1U5TC 5DDPC 1ZARA 2L7ZA 1ZR4A 3VSLA 2IGOA 4CYCB 1RLCL 3MR7A 4RB1A 4IFYA 1MIJA 4J9SA 2V69A 2DNRA 1V54H 4IHXA 4O4GB 3GO5A 2W1OA 1W36C 2WB4A 1SKWA 5IT9K 2O5DA 1RJJA 4P52A 4WP9A 2BJ8A 3H4DA 2C3YA 2ZUAA 1JB0C 4NASA 1LNQA 3MUVP 3Q24A 3PUFA 1XGNA 2DTZA 1R8HA 1ZPVA 2RU9A 3FBCA 3FDSA 1NK6A 3FQLA 2OIHA 2L9SA 2F4IA 5KFVA 2HTJA 3D5LA 3ZZTA 1NTCA 1I94J 2O01C 3C18A 3QODA 5KAIC 3J80Y 5FROA 3ZQHA 1CGPA 1P4AA 4EJVA 3LP1B 1OMIA 2JJ7A 4OX8A 2JVHA 1XNRF 5F0FA 3P4UB 1TLHB 1UB9A 2B5JB 4KUMA 4M9SA 5JLWA 1UVMA 2PD1A 2XGDA 4ZCMA 1J59A 4KJZA 3CCSS 3WU0A 3CJ3A 5DGAA 3DWLE 4JI6F 2JT1A 3J81Y 4JB8B 5D78A 3I4MJ 3W6JB 4ZHRB 3FBIB 2CQKA 4KO0A 4DLEA 3HHEA 3K2ZA 1K4TA 2M0CA 3GLXA 3HGGA 2V4JC 2VQGA 3KHLA 2MEWA 3WC0A 4KT6A 2DA2A 1VLYA 5F8IA 4DR7J 4IRCA 5B0FA 2H3EB 3AY0A 2EILH 3U9GA 2QL7B 5ICFA 3S6EA 1G3SA 4RGXA 5KFNA 2B51A 3PYEA 1M1KT 3HOVJ 5J8CA 1QSSA 3IWZA 2EZIA 3PACA 1S6QA 4FPIA 3T5KA 2GNKA 1TAUA 2W9CB 2E1RA 2DEIA 4S04A 4M3GA 1RBAA 2W9AA 3DM2A 1XIQA 4WP3A 3MOJB 1F9FA 1NHVA 4X62F 3CQZJ 5HODA 3NGKA 3RJPA 1C0UA 2O5RA 2UUCJ 2HYJA 4M71A 3SFUA 4RAGA 2Q0OA 4F26A 3OOPA 1QZYA 2R8KA 4WK3A 3OYFA 4USIA 1N8RT 2BHZA 2FUG2 2OJED 3O8HA 5DO2A 2CV1A 5K5OA 3MZIA 3BJAA 5EEHA 5FGMA 3DOLB 2QLXA 4KFCA 2WHOA 3VYTB 1HLVA 2FHOB 3MGJA 4E7SA 3BGRB 4IO9Q 1T05B 5GP9A 4IFVA 2KHCA 4CHUA 4MHGA 2PT0A 4QIEA 1NB7A 4LF9J 3HSFA 1X4GA 2LVWA 4UB8C 4Q43A 2N4CA 1UG2A 4KDPA 3LP1A 3IV5A 4FE4A 1OYWA 3RQ4A 2VODA 1MMSA 1LEAA 9ATCB 5FRMA 1O3SA 4M3FA 3S7RA 4EYHB 1JLFA 2QCOA 3S1RJ 2GHPA 3BO4A 1VBYA 3AH6A 2J0SD 5IT0A 3CCUI 1KOHA 2NNYA 2IVYA 4RW8A 1S7HA 4A8FA 3EJMA 2E5NA 3GWCA 1IC8A 4BXXJ 2AMCB 3IXQA 4PXDA 2AX0A 1UFLA 4HI1A 3LALA 2Y31A 3MM5A 2ZFWA 3DKYA 4ZDPA 3U2RA 5L3CA 3D0IE 4H0EA 2CPJA 3FSIA 3NMAA 2LDUA 4U7BA 2F4VF 2FB0A 2P6SA 4NLGA 2FHJA 1PYOB 3MEDA 1G3OA 4NE9C 4DPXA 1VCTA 3AJ2A 4LRBA 5LHGA 1RKIA 3BG5A 1A6LA 1LQ1A 4YP3A 2QFJA 4A3MJ 2QN6B 2QSFA 3DKDA 3OVBA 5D0HA 4NXNF 2V1DA 2TDXA 2ADCA 2DXIA 1UETA 3LFKA 2P0WA 4CLSA 5RUBA 4RNNA 6FDRA 2H9ZA 1TBXA 1RTDA 1ZA1B 3M9AA 5FKMA 1FK9A 1FX2A 2O3DA 1OCCH 2M0GB 2V4RA 2R7RA 4DL7A 1EKEA 4AM3A 3LGNA 2WVDA 1ZG1A 2EFGA 4PG7A 2GIQA 2UV8A 1NMEB 2AKWB 2XNRA 1IRGA 3FVYA 4B9UA 1HNIA 2YKNA 2AGOA 1ZOTA 3RJMB 1Q1KA 2X51A 2E19A 1QBJA 2B63J 3NG8A 1U1MA 2HVRA 2JQ7A 4Y2MA 2GWRA 2M9HA 2DISA 2YVSA 4LG3A 3ZXSA 3IAS9 2O67A 2R7QA 4E8UA 2FX0A 4U0VA 1SJ1A 2F4OB 1DTTA 4G6VB 3W65A 1XMQF 3QPSA 3HXMA 2X6OA 2DEJA 1UJ8A 1S3JA 2G9WA 3GLLA 4F4WA 3C3WA 2WY7Q 1T05A 1N34J 2MZJA 2QV6A 1N6QA 3C15A 4FVMA 5HS9A 3C8YA 1IN7A 4DQRA 1Q4RA 3J7YI 3P3DA 3BM7A 2UXCF 4FVCA 4OI4A 1D8ZA 2YY3A 4XRFA 2HWIA 3AHPA 3OL3A 2VDIA 1YJVA 3HTUA 5C5JA 2HI3A 5DDGA 2P5LC 3FWEA 1LXJA 5AE1A 1K47A 4PXCA 3B78A 3W8GA 1H2TZ 2BACA 5G0RA 2GV1A 5FD1A 1S6LA 3PW2A 1DQAA 3MCMA 5JR3A 3F0NA 1R8AA 2BW2A 2LSOA 4ZMMA 4F55A 5HROA 5HNHA 1TFYA 2KLOA 2EPFA 3I55S 4OX6A 3VYRB 3V5RA 3MEDB 4DR3F 3QAEA 2HYIB 5HQMA 4XKVA 3HSEA 2M0MA 4C2MA 4DX6A 4BHBA 4RW4B 5HBMB 3IGNA 1VQ8I 1HYSB 1N0VC 4JI5J 4KMUX 3E8OA 5FB2A 3E1SA 2RJZA 1W5SA 4IG0B 1VR6A 3QIDA 2NRAC 2HQGA 1SPBP 1R0AA 2QA2A 2M3AA 4IZZA 2EC0A 3T0YA 1JJ2R 1P4XA 2K8GA 3MD3A 3J7YU 1HNZF 2HWTA 3C46A 3BS9A 1P9YA 5CYQA 4RW7A 2A2DA 2VJUA 5IY5H 4FYYB 3AQPA 1Y39A 1Z67A 2MHNA 3GIIA 2OELA 4DR5F 4CLYA 3CJRB 1RAGB 5ETOA 4WIIA 2HGCA 2XULA 4OJHA 2HQRA 2W4CA 2BVLA 4W1UA 1RWMB 2CJYB 2LKXA 1ZG5A 1U6GA 3Q0UA 1KFDA 3FXOA 1ERDA 1M5SA 4J9OA 4YIIA 2FZCB 2MZTA 4O3MA 4OIRF 3BPDA 2C3OA 4Q48A 3FM3A 1NDPA 4FETA 3MM8B 3IUOA 2NUUG 2Y0SD 4GVLA 4ER8A 1T0FA 2BY3A 2XAFA 2XAHA 4TKTA 5LFAA 4E7JA 4YFKF 5CJ9A 4NA2A 1KQFB 2ILYA 2F4FA 4RJVA 4Y0FA 4QLCU 1Q79A 1EP4B 4MT1A 4Q2MA 3D54A 2D1VA 5L3GA 1T33A 3GCXP 2M2EA 4R5PB 2KXFA 3MPWA 3KDOA 1IBCB 4FX0A 3J7ZT 4J9QA 2MD5A 1PDNC 2QBYB 1S1WB 3TVKA 1SAUA 1PAUB 1T95A 1UHSA 2X85A 2HGMA 3H25A 1SL2A 4WU3A 5KTQA 3BZKA 1U6BA 2A6OA 1RGVA 1HW1A 4PXEA 3IN5A 3MKYB 2LP4A 3I64A 4NL5A 4WBFA 4IUFA 5BR8F 5FIIA 1MMNA 2FJEB 3QGHA 1B59A 3W9JA 5AJ3J 4URGA 2RILA 4DV2J 4LR7A 3UKGA 1BI0A 4GC6A 2QLZA 3BV8A 3M9OB 4UXNA 3ETOA 5J1NA 2R5YB 3QJJA 5LRSA 3CZ6A 1B0PA 3H1CA 3P9IA 1SD5A 2CQNA 3CMMA 4ID8A 1TT5B 1F0XA 1VQMI 1IRFA 3I56S 2DCEA 2ZJQF 2VHGA 4K4SA 4LD5A 3C6UB 4LLGF 1TL3A 5HO4A 3SYTA 1WNEA 2W01A 2FU4A 3N5FA 4JV5J 3BKFA 1WSVA 2ELHA 5BMZA 3I87A 1WF2A 2XSJA 4JV2A 1ETOA 3FK4A 1NXIA 4RWXA 5GAHJ 1RLDA 1SJFA 3KPHA 5DM7Q 3M8JA 1GTHA 1KU7A 3P7NA 1YE9A 4E7LA 2DNZA 2CPHA 3WIVA 1SUQB 3PIOF 1EAYC 4E7KA 2FGCA 2OD5A 1XN7A 4ES3A 3LL7A 4U6PA 3R5AA 3C1DA 5EEAA 2FSWA 2A05A 3HCXA 1DLOA 1JX4A 2KFYA 2GA1A 3MEGB 2BE2B 3H5SA 3HM9A 1LWEB 5DM6Q 2FOWA 1ETKA 1XQIA 1AUSL 2HHPA 2DGXA 2IM2A 2GIZA 3J81Z 3OYMA 3H5AA 1S6PA 1YJUA 4PAAA 3CMAS 4JI8F 4M3BA 2LKSA 2BABA 1JI8A 3J80U 2AXLA 3KLGA 2EA2A 3IR6B 4DX5A 1FERA 2CG8A 3J81U 3KYCB 1IXRC 3EUKL 2DIVA 3D6MB 4L3KA 2B4UA 3IBWA 4NA3A 2VKEA 3AG4H 3NOCA 2HFZA 2EINH 1D0YA 4WK1A 3MAQA 2ERRA 1WEXA 3M4XA 4B9LA 4MKVA 2KJVA 4EBCA 4WIQA 4JV0A 1BQXA 4I7FA 3CD6I 1S4FA 5M2RA 1RUSA 1Y10A 3R5BA 2ATLA 4F52A 1JLBB 5HS7A 5SZTA 2GC8A 2R2RA 1ZRDA 1KSPA 4X4PA 3K17A 3GR0A 4P9FA 3SEOA 3PO3J 3M1VA 3L3CA 3BDDA 2KPMA 4DPOA 2HLTA 1WC6A 3O5TB 5HQLA 1LOUA 4L9NA 3C2GA 1HNZJ 2AWZA 1NKBA 1SKRA 3IRRA 2YPYA 5KFAA 2FBHA 1ACMB 2NYIA 4XM3A 3C6TB 2E5LF 2E5LJ 4NOHA 4KHPJ 3HP6A 3T19A 1TTHB 3A0HC 4H4MB 3VQSA 1UVJA 3ZMDA 1RAEB 3LSIA 3JXOA 2CJKA 1G7CB 2XSJB 1QAXA 1L3VA 2VQHA 3DNCA 1BN5A 4ECTA 1OSDA 4I67A 4BWJA 4C11B 1U1QA 2WSEC 1IKXA 3QIPB 1VQ6S 4ED1A 2RAEA 4QWEA 1I27A 3V6HA 2XI3A 1MBJA 2C2ZB 2BR0A 3I4PA 3CDIA 3ZQQA 2HGLA 4U7CA 2R7DA 3JAMU 4U67Q 5E0OA 3EYZA 2X6YA 4EQQA 4MK8A 1C2PA 2RS8A 4RA2A 4ECXA 1J5EF 1JT0A 3PO2J 1HBUA 4KICA 1VBZA 4OYIA 4NLVA 3M05A 3L2WA 5D8LB 4NXMJ 1YBAA 4B9NA 1Z7UA 4IH5A 1SL0A 5M5WJ 1R31A 1YDLA 4OZ5A 4KN4X 1IN6A 1VQ6I 1S1TB 1RESA 2E9TA 4RNOA 1RTJA 4KIGA 2BJ3A 2Z2MA 4N76A 2IY5B 1S72S 2H54B 2COBA 1S29A 4EEYA 1RP5A 1IR1A 3ECOA 1H3DA 1EH8A 2RV8A 3QYEA 1G6NA 2DH8A 5DG9A 1FRIA 2VJJA 1C4CA 2IAJA 1U0SA 2ACJA 1HFEL 1W5TA 3SMZA 2EH3A 4G8XA 4I7FB 4JV5F 2CUEA 2VBYA 4TVAB 4EM1A 1XGMA 1T38A 4RBVA 3SDBA 5L3BA 1VK3A 4QIVA 1YJ7A 2B56A 5HK4A 2QIFA 4YB5A 4F0MA 1R7JA 4ALZA 2AX1A 1U2FA 2PA3A 5DG7A 4B9TA 1W2BR 3KZIC 3CMAI 3T6JA 3G6EI 2LXFA 5BS6A 4XN0A 2DMQA 2XAQA 2FE3A 3NMRA 1XNQF 3BBCA 1R6RA 1YZ7A 4RPFA 2VOOA 1NJWA 5K14B 1HARA 1FRJA 4RBUA 3IC7A 1USTA 1RTIA 3UQSA 2ZO4A 5ED4A 3E97A 2QSGX 4B44A 5LXYA 3AA9A 1U1RA 3HKZN 3VF0B 4MEXF 5A6PA 2GOXB 1S8NA 3TR5A 2AU0A 3VGTA 1B7FA 3IH4A 3RW6A 1YX3A 3E3VA 2OPQB 5KK1A 4KH0B 4JI1F 3DKWA 2WSFC 4M74A 4I68A 3ISND 1T03A 2WVCA 3M6UA 1K6YA 4QW9A 4GKJF 5IYBJ 4QIGA 2E9RX 1BY9A 5K5QA 4UUSA 3QFWA 1N0UA 2P9CA 1ZAWA 3QGIA 4Y2CA 5H1SV 1RWNB 2OC6A 4NYZA 2ESHA 3CCZA 3I54A 1KONA 3HKWA 1OO0B 2WB1D 4O23A 3ZZZA 1R8BA 4XOTA 2QQ9A 4CCHA 3CJ8A 1IV6A 1V3SA 4NLOA 3OTOF 4O4GA 3EGNA 4DL2A 2NQPA 2A6MA 4HOBA 3CPWR 2BBEA 4IYQA 5DEQA 3A3PB 3MTKA 2J5AA 1U4BA 5CABA 2XSDC 2BRLA 2L9DA 4PWDB 1BA5A 2EB7A 1PILA 2DO7A 2QLBB 3DLBA 4P2FA 4OX9F 1X7VA 4IOBA 4BWMA 2ZH1A 5E3PA 3K9TA 1NJIT 2O03A 3A2KA 1SJ3P 1ZGAA 4LF4J 2XB2D 3L2VA 2OZ6A 5A2QZ 4Y6IA 4CM2A 1R1VA 4P71A 5KCMA 3OYGA 4KFBA 2NSCA 3DXSX 2XF7A 3F44A 1HKTA 3NL0A 4DPUA 1IR2A 1XR6A 4ID5B 5B0EA 2FA5A 2J8SA