4F3QA

Structure of a yebc family protein (cbu_1566) from coxiella burnetii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
234
Chain Sequence
KWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAIKRGADNLVEVRYEGYGPSGVAVMVDCLTDNKNRTVAEVRHAFSKCDGNLGTEGSVAYLFKQRGLITFPPNSDEEKIMEIALEVGAEDVTTNDDGSIDVTTLPEDFEKIRNAMKAADLNPSHAEVTVLASTEVGLDKDSAEQMLRLTEMLEDLDDVQNVYSNADYPEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein CBU_1566
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transcription
total genus 73
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4f3qA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA03
1KONA 1WJDA 1WJAA 1K6YA 3HPHA 4F3QA 1E0EA 1WJEA 3HPGA 1LFPA 1WJCA 1MW7A 3F9KA 1WJFA 1WJBA
chains in the Genus database with same CATH superfamily
1ETYA 2HHHF 1FY7A 2UXCF 1UPMB 5HVHA 4Q47A 3MQ0A 2C42A 2LR8A 1BQXA 4XLPF 3AY0A 1ZR4A 5GTIC 4X4QA 3I54A 4FYWB 5KT7A 4P9UA 4DPXA 1JJ8C 1TQMA 4M5JA 1LVKA 3CPWR 3SCKE 2X51A 3V6KA 4I6YA 1U26A 3LSKA 3MM8B 1BI1A 4DR4J 3KK3A 1ZK8A 1YBUA 4FYYB 4P2FA 2FQ4A 3T3FA 1Z4UA 4TQRA 4RKUC 3FXRA 3DU6A 2SXLA 5CABA 4IR9A 3MUMP 1S0OA 4LLGF 1H7WA 3CZ6A 1YS7A 2GBYA 4KHPF 2AZ1A 2A61A 3GZ6A 3GJQB 4ZPWR 1XTAA 2QFIA 3Q2TC 1C0UB 2KKOA 1YWXA 1KQSR 4LF5J 3GILA 3T41A 2UUTA 1SVOA 3CDEA 3LALA 3HOVJ 4E2FB 1MDMB 4BY7J 4A8MP 2QT7A 3JSBA 2QQBA 2NUHA 2DA5A 4EWTA 1S97A 4OJGA 2QL7B 1NZ8A 2RRAA 1MNEA 3A02A 2V4JA 5B0AA 2Z16A 4CLKA 2PMUA 3VAKA 2OTJI 3A1YA 1XGSA 3L7WA 1GDTA 2L7KA 5K20B 4C0BA 1RT6A 4HDUA 2H5JB 3SFGA 3IWZA 2RT3A 1YO5C 4ZCMA 5EUHA 4LG0B 4Q2LA 3ELHA 5H20A 3L7UA 1X5PA 1YJNI 4JV5F 2UWMA 5KFKA 2JA6J 5EEHA 1H3DA 2RVCA 3BR2A 1Z1ZA 1ZH5A 2RUGA 2GJIA 3C3LA 4BEHA 2F8MA 5B5EC 1F4KA 2CA9A 4YRVA 2W8LA 2QEXI 2HWVA 4XQFA 2IA6A 2MGZB 1FBSA 2OV7A 3H92A 5DZ7A 1IRXA 1FXLA 2DI3A 2NXEA 1RWVB 1NB7A 1F0XA 3QP6A 4X4OA 3A1YG 2IY5B 5THWA 2P9GA 3PQKA 2ZH8A 5GAGJ 3H4BA 1B59A 2R5ZA 1LDJA 3KLFB 4CM2A 4A8XA 1HQUA 5JLXA 1CEZA 3KLGB 3MFHA 1KU7A 2LBFB 2HK2A 1QZEA 2CPXA 4AXIA 2CJQA 3K4CA 4CO0A 5HK4A 1NHUA 3KMSA 4YMEA 2H09A 3H2UB 4FXVA 3P4UB 3PW5A 3A12A 2G4BA 2IA1A 2UV8A 3SMZA 4IQJA 3K2YA 4UZBA 3SDBA 1S5ZA 1E6YA 5J1NA 3M8JA 3KPHA 4FKYA 3BR8A 4G3IA 4AC0A 2CNKB 1RDRA 3GFHA 5DGBA 2VOOA 2GHVC 5K14A 4W98A 3H20A 3MURP 1QNTA 3C2HA 2W9CA 1TKXA 2MQNA 2FZKB 1GMVA 1BJZA 1FTCA 5K5RA 5F8LA 3CC4S 2BRLA 3KDNA 1QDUB 3TQEA 5HMXA 3IC1A 3PVXA 2OPPB 2CKWA 1S3JA 4HYKA 1GX5A 1WJDA 5DYMA 1IBMF 3HO1A 2VV5A 2WHOA 5J1EA 1MW7A 1AYEA 3PX0A 4WK8F 2UV8G 3AB4B 4Q45A 3CD7A 3A01B 4HW0A 3FFIA 4I2PB 1VR6A 1CF7A 1S1WB 4C3LA 4AD6A 5KG4A 4R79A 2RB7A 3KLHA 2DMUA 1FFGB 1HHSA 1SD5A 1NDCA 4DR3F 2MLZA 3ITHA 4NXNJ 3F21A 4UV8A 1B8IA 2V68A 1REGX 1W0UA 4P7TA 1QAYA 2CWKA 3I9V9 4KGMA 2CDRB 2MQ8A 5B0CA 3KK2B 4A3CJ 1EP4B 1NM2A 3OV7A 3OT9A 2IT0A 2BYCA 1FP2A 2X6XA 2ZVIA 1FX7A 1T3OA 4PRFA 1RWNB 1HOMA 2DA3A 4NBQA 3BJ6A 1EKEA 3THTA 1KGSA 2KMUA 4M3EA 3CC7S 3HVTA 2KQRA 5T7LB 1Z05A 5F3ZA 2K9NA 4UZCA 1HW9A 1MMDA 1TZLA 4FISA 3I55S 3HJFA 1KYZA 1Y39A 5ETSA 2M2EA 2OU2A 1P7IA 2BE5F 2OQRA 1C0UA 4Y17A 1S0NA 4CYCB 1Y5LB 2KT5A 3KP6A 3CCES 2Z1DA 4IHVA 4PYAA 3MR3A 4DSJA 1MDMA 1P9YA 4Z7CA 2R8JA 4KH0B 1LWEB 3QQAA 2QZ8A 3PG9A 5HLIA 3IH3A 1QY7A 2BY2A 1X4PA 2GXBA 1UEUA 1LWCB 1UAWA 1WQ2A 1VK3A 2CH0A 1FEEA 3LGMA 3CIMA 4X62F 4PCQA 3ZMVA 2HPUA 1V3ZA 3UCZP 5ED4A 3KJFB 1WG5A 1PVEA 5LMUJ 4ZITA 5K8NA 4LG0A 3K4BA 4F02A 2VC1A 2QLJB 4EM1A 4BC9A 3IKVA 1IUYA 1EQMA 3J7Z5 2VXDA 1W5SA 3TUJC 2CJXB 1NK0A 3VWBA 3DU5A 3M4OJ 2NAZA 1NK8A 1IN5A 1RTHB 3EPZA 3QQCD 2UXBJ 1KEKA 1VQKS 1H2UX 2MGZA 3JTOA 3I5CA 3EDQB 5J1YA 4PAAA 1L3TA 4L0YB 2JQ7A 1EJ9A 5J3LA 5GAHJ 3NGKA 3TVYA 1HSTA 2MHEA 4RNMA 4NEYA 3CW2C 5DM7F 1YYVA 5EWGA 1RHQB 3KLFA 2A5YB 4Y2CA 4RA2A 2ZOGA 1KOOA 1WFXA 4IFVB 2LBFA 2CW7A 2QWWA 4XORA 1OY6A 1P9QC 4P9SA 2FE3A 4U6PA 4IHSA 1O8BA 3J7YJ 3NGUA 4GMKA 2QMWA 2IAIA 3HJVA 3KNGA 4ECRA 4N0BA 3RQIA 1JIHA 2C2ZB 1R8PA 3P5TL 1POGA 3BT9A 2HOTA 3FZBA 3H40A 2DXDA 2FJ1A 4NQWB 2A6EF 4N9IA 4CXFA 3CJSA 2XBPA 4CLWA 4K0KJ 2GMHA 4DX7A 3L2CA 3UDCA 2EA4A 1PBAA 4UUVA 2IDLA 3QGHA 5L38A 4UTGA 4ED6A 1JLBB 2K7KA 4OJ3A 2DA7A 1CVJA 1M1HA 1WJCA 4ED4A 4UF4A 4TQSA 3N6NA 4A0XA 1OYYA 1M1GA 3MPYA 3DDKA 5DLFA 1FVQA 2V94A 5BXIA 4UUSB 4IH6A 2OPPA 2Q6CA 2AJ1A 3BJAA 2EKYA 2XMJA 3C7JA 3T6BA 4CM0A 2F5EA 3JSYA 1RAIB 2Q2EB 2FVQA 3ENVA 1HW5A 1T3NA 3HIFA 3QWUA 2VDIA 2FVSA 4CLTA 4PZVA 1IQTA 3CC7I 2HWHA 3GMGA 3A01A 3M32B 1T8EA 2VQHA 3FBIB 5TJJA 3QSIA 1S1WA 3OXFA 3I55I 2E7XA 2E66A 1S77D 2LFVA 4FZVA 2QQ9A 2FGCA 5L1LA 1VFJA 5JLWA 4WPAA 2HWTA 3NWTA 1H98A 6FD1A 4Q43A 1OCCH 1W1WE 1Q1KA 2EC2A 1KA8A 1ELOA 1W7WA 2RF2B 4K2JA 4X4SA 2VFVA 2FOKA 2LYCA 5B0DA 4V19K 3KK2A 3TEHB 1EP4A 5B0GA 3HHGA 4B8XA 3LPEA 4M5MA 4O6JA 5L3CA 3SFIA 3T8RA 1ITPA 1R22A 1RTIB 2HQ3A 2PMZA 4IOAF 2EFGA 2KZVA 2IRXA 2PLYA 2DMTA 5GVQA 1NAQA 2XSJC 4F04B 3HD2A 2E5JA 1MMAA 3HGGA 1S59A 1T9XA 3QWPA 2VKVA 5F04A 5F8IA 3Q9SA 4C2MA 5IT9Z 3SIPB 1TKDA 4DS4A 2KJCA 2D3ZA 1ZBTA 2A2DA 3MI7X 3BO3A 1SKRA 1S99A 3D0GE 3EGWB 4HACB 1K1QA 3AOCA 4DCOB 4IO9Q 1N75A 4DN9A 4CYCA 2CXEA 4KO0A 4P9FA 4C8ZA 4ZVGA 1VQKI 3CJ4A 2MXYA 4XKWA 2CIMA 3BQ0A 4JBCA 3QJJA 1WGXA 3CCLS 2VI6A 2DQRA 4RBUA 3GBGA 1UA1A 1X4FA 2G1DA 1LWEA 2DNYA 4XSZF 3KEQA 1O3RA 4N5SA 2G9WA 4U7UD 1IQZA 2MG4A 1LWCA 3JSMB 2X0LA 3OSGA 1NK7A 2X85A 4JI6J 3TL4X 2I2YA 3ZTSA 5LHGA 3EYYA 1QUVA 2V0NA 4MFBB 1NK9A 3I4NJ 1R4NB 5D6EA 4JI7J 3ZMZA 3BSOA 5CVIA 2W48A 1L3LA 3FC9A 3U1KA 4LMZA 2AXTC 2DOFA 3TDUC 1K47A 4EYIB 2XASA 1RTHA 1ONVA 1WTBA 4XSXF 4QOTA 1IGNA 2HNZB 2H94A 2DPDA 2QSFX 1LXNA 1X0PA 1TW2A 1A7GE 5FGMA 3QYYA 5DG9A 5HO4A 2RNJA 2F8HA 3ZQQA 3CC2S 4WP9A 1WEZA 2DT5A 5C3EJ 3PXGa 2VPYB 4I2QB 4K5SA 3CDBA 2LEAA 3SFZA 2XO7A 1NHAA 3J7AO 2DHAA 1BL0A 4ED7A 4CO8A 3MR2A 1V3RA 1R1VA 4LF9J 4MYTA 2H8RA 2VPWB 3NARA 2RDDA 4IFVA 3AOAA 2BHYA 1EA3A 1GMWD 2ZC2A 1P6TA 2BEFA 2GIFA 3NKYA 2Z8QA 4IHXA 1HKSA 1F60B 3IR7B 3P96A 4O4GB 3TAMB 1TK0A 1W0TA 3AG2H 1RADB 1RQ0A 3BZQA 4CLSA 2H48B 4USHA 2V79A 4JOMA 4NQWA 1SV5B 1F5TA 3LUYA 3S6EA 3KJQB 5DM7Q 2X1AA 5J2QB 4YDXA 1NG7A 3SQOP 1JLBA 1TWGJ 4F2RA 3Q0VA 3Q89A 1F9EB 4DR2F 2CRGA 3CUQB 3LMMA 2ID3A 4RGSA 2LNBA 5F8GA 1E0EA 4UUSA 3EGVA 1ZLKA 1NK2P 1VLYA 2FLPA 1SJFA 1DQ8A 2J9CA 5K5QA 3HGYA 1RTDB 2VA3A 1U8RA 3MPDA 1BQMA 2Q2EA 4CLUA 5H9EK 4K59A 2HGLA 5C4JJ 1UHSA 3D0SA 5J4VA 1HD0A 1N56A 1QGPA 1B4SA 1J5YA 1XIQA 4GKJF 4TY9A 3M32A 1NLKL 3ABUA 3HZEA 4GC6A 2AHQA 3BGRB 2KRFA 2P8TA 2O03A 2IYIA 4DUYJ 1VMBA 2HPIA 3D1OA 1WKJA 1CQNA 3U9GA 2CPJA 1S10A 2EPIA 2R7XA 5IV3A 4NL5A 2RF2A 5LHHA 2D45A 2Z33A 3QAUA 1YW8A 3KETA 5FJ4A 3CCLI 1P8GA 5IWAF 4DX5A 1YHQS 1NK4A 2KIFA 5IM0B 3TW6A 2E44A 3I0SB 3VALA 1TNTA 2Q0OA 3ZMUA 3J80U 4KAIA 3H2LA 3N0VA 1RTIA 3I82A 4DW6A 4P6QA 4PKDB 3GTQJ 1LFUP 3ZCOA 4DZ6A 3S17J 2KVQE 1IN0A 4KV8B 5CCMA 3S8PA 2HQ5A 3KCCA 4C0OC 3OUYB 3TI0A 1H72C 1RPWA 3R6GB 2XKOA 3L09A 3WODF 2OCCH 3LSGA 4OLPA 3JB9k 1BI3A 1SH3A 2WBRA 1GV5A 1SXLA 2VPXB 2XLJA 5C5JA 2W84A 3IP4B 1TUWA 4B9VA 3TANA 4OZ0A 4HACA 3UD4P 2H1YA 4WXHA 3FMQA 3OIPA 3LTOA 4FS1A 2VQCA 1QPIA 3QZ7A 2HFOA 4IOAQ 3WHIA 1TWAJ 4ED5A 4YR2A 2YX7A 3GLJA 5LLQA 2D1HA 3HJEA 3HOWJ 3CC2I 4LOCA 1O3SA 3NNHA 1U2CA 5KT6A 4U0WA 4EO8A 3LAJA 3U21A 3JSMA 4P52A 2JK3A 2K02A 2R2TA 3M8WA 1FJGF 1UFKA 4ZLLA 4KISA 1RZ4A 4JI0F 2X1FA 2CWXA 3N4MA 4MFBA 3RPUD 1ROFA 3EGNA 1U49A 2NS7A 2AYGA 4EZ9A 2OEKA 3VAIA 2OUMA 1KQ9A 4BQAA 2J5PA 2XQCA 4A8YA 1T6SA 1REVB 2ZKZA 3JYTB 2V8HA 1EIYB 3MKZA 5HLFB 3BN4A 2DEJA 3ISZA 1M5OC 3UN3A 1XBWA 2YPYA 2HNZA 1WF2A 2X9DA 2DHHA 2HKEA 2HOEA 4DR1F 2KG1A 1L0OC 3WG9A 2KRCA 3ENAA 2GVZA 5CHCB 2Y2ZA 5KFGA 2ZITA 3LAKA 2CZ4A 3JR9A 1ULYA 2DK8A 1NPPA 2F7VA 4XONA 4DX6A 1X9SA 1SJ3P 5CVVA 3LSHA 3N6MA 1HSJA 4CLZA 2DHXA 3MVPA 4DCJB 2QUFA 4URQU 4QR1A 4I6WA 3EICA 4O4GA 3TAMA 1S5LC 2UU9J 2R4GA 3BPXA 3H90A 4DSLA 4WIIA 4YR3A 4OYMA 5D8LB 4W97A 3HTSB 5EEAA 1U1RA 1ZLJA 4ES3A 2PN6A 1SV5A 3CCRS 2DT6A 3MKWB 4RNNA 5J2QA 4P72A 4ILRA 5KTQA 1Y3KA 1FOXA 3OY9A 4LFAF 1D1UA 1L3KA 3D3BJ 4QR2A 4CCKA 3PEJA 1YHQI 2A3SA 2IGNA 3CUQA 1XERA 3DRSB 2FD2A 5CYQB 4QPXA 3V8LA 4GYGA 3EUNA 2D3OR 2R3VA 3NEKA 3H59A 2RDPA 4NLRA 1RTDA 4BNCA 1HWIA 4D7MA 3S2HJ 1N5VA 1Q8LA 2FOWA 3P8BB 1U2WA 3O6QA 4ZIVA 1MJBA 2L2OA 2DTJA 3OYDA 5FDLB 3E6CC 2CAJA 5HATA 5ETKA 4JV2A 2PC6A 3GFIA 3C6UB 3KUEA 1T9WA 3GWCA 3C2GA 5HS7A 4BXFA 2HDCA 4OYBA 4GKKF 1H0MA 3VCDA 1OJ4A 3VSKA 1X5OA 3UQSA 4YQWA 1FYKA 1WJ5A 2OPSB 3T19A 1NDKA 2RHSB 4QWQA 3ZMTA 1S6PB 3QPHA 4EJVA 2PBIA 4WU3A 2R5YB 2BJEA 1TWHJ 1YQAA 2HFUA 5KG0A 1MJAA 3M05A 4M3FA 4HH0A 2JLGA 2XMWA 4TU9A 1YLXA 3VGUA 2YNGA 4ZVSB 3MTJA 5KG2A 5IM0A 1H0HB 4ANCA 3I0SA 5BR8F 1DHMA 1I6XA 5ETPA 2HNYA 2YPRA 1R5ID 1SAXA 4L9JA 5FKNA 1LNQA 2MDAA 4PEOA 2ZC4A 3KHHA 5M5YJ 1EARA 2XLIA 3KX2A 4KV8A 4ELUA 3CD5A 3KE2A 3OUYA 2AT1B 2OSRA 4ENKA 1D5VA 3TVKA 1NJWA 3THVA 4X1EA 2WB4A 3D5MA 4NASA 1DP3A 2KFYA 2WB1N 1S29A 5IT9K 3HKZD 5CD4H 1X4OA 2DN0A 1B7YB 3BG6A 4X66F 4UB6C 5DCMB 1VTNC 4EJOA 2HVIA 1U47A 2UXDJ 2XPVA 3GF2A 2H51B 2DCEA 2AQ4A 3ZQGA 4ANDA 3TO6A 3EUAA 5LMNJ 3JAMZ 3DCFA 4F4WA 2IA0A 1Q8KA 5F0WA 2ZBCA 1IRZA 1OMSA 1T03A 2LXIA 4A0ZA 1HHTP 2DISA 1K73T 2ZO4A 4E7JA 4XKVA 5DEQA 4KJZA 2W4SA 2IBKA 5A6WA 1TR0A 4XLAA 3NWSA 4RUAA 3R1HA 4KYWA 5H9FJ 2UVWA 1V5FA 2DU9A 3Q8UA 3M6VA 4EBCA 1REVA 5D4SA 3ZMSA 2F3JA 2KRRA 2F4IA 2IDEA 1RU1A 4B3SJ 2C3OA 2EIKH 5HLFA 2LY1A 1HC8A 3IRXA 2H6CA 2AQFA 4N47A 3HL2A 3DI6B 4A3KJ 3SQGB 4Z7YA 3RB0A 2V9WA 4G1IA 3JTHA 4JUZA 4AQYF 2BW7A 2HVSA 2KRHA 2HS5A 2O67A 1K78A 3CJ8A 1S1UB 1ZETA 3T6JA 3BGOP 3KYCB 5JVGF 1WH5A 4PWUA 4ERDA 5CD4A 3KUHA 2KPMA 3EZUA 1TBXA 1FFSB 1YJWS 4EEFG 2EA2A 2B9SA 2MYSA 3FKJA 2DYRH 2MZQA 4HA8A 2F48A 1Q16B 1YTYA 1LE8B 2XZWA 2FHOB 2YWEA 3F8MA 4CO2A 3N79A 1ON2A 3AAWB 4LG3A 2YXLA 4DQSA 1FSHA 2QA2A 1T9YA 1IBLF 3NMRA 4RNHA 3MPVA 1FVSA 2AQEA 1AT1B 4M94A 2P7VB 1TFYA 2MFZA 3AL0C 1TP7A 3OJUA 4BAYA 2HFSA 4TKTA 1VQ8S 1TKZB 2MQOA 4ATNA 4CSWA 4OQJA 2VICA 2R7WA 1KZHA 5LXRA 1RYRA 3ILJA 2ZWPA 2HVRA 4FN5A 3DRSA 1FOWA 2FB0A 1V54H 1KVKA 2CPFA 4EM0B 5CYQA 3V6JA 2FJWA 2FUG2 2VUMJ 4DL2A 1RUSA 4OX6A 1ZG3A 4DV1J 4EUVA 4KFCA 1MMSA 1RA7A 2WAQN 2DMNA 5F1JA 1YQHA 2LLZA 2UVVA 1TL5A 2JRMA 3L2WA 2FNAA 4JV0A 5FDLA 4LBPA 4YUDA 2LVWA 3C6UA 3DEWA 2ZVSA 1HFEL 1V3SA 3P9CA 1TQIA 2AXLA 2O8XA 4I1TA 3DWLE 4DV4J 1JJHA 2OPSA 2P9CA 1S6PA 2F1FA 1OYWA 1M90T 2J7KA 2R5YA 5LL6d 1G2EA 4FVMA 1D1AA 4ZCLA 2QYCA 1U78A 4DV0F 1YRNA 3T5LA 2DJNA 2NPIA 4WTOB 3J81Z 1JT6A 2IPQX 3M9NB 3PJRA 1ZTWA 4NLQA 1QJHA 2XC7A 4RLFA 3TBIA 2JA8J 3EVOA 2QA4I 2O9LA 1QVTA 4NUBA 1KWMA 3E8OA 1NKBA 3JRAA 4AYBN 5JJBA 4O44B 4I02A 3WBZA 4M5IA 1WCMJ 1Y9OA 2C2MB 4F4YA 2DGSA 4IHTA 1U6FA 2FBHA 3SJMA 2RRBA 1ODDA 3E5XA 2IS6A 2B7CB 2POKA 4IRGA 3M8QB 4M1KA 2ZUAA 2IEKA 4IQXA 1ICEB 2ZEJA 4O0IA 1K7AA 3DHWC 5DCMA 4JX5A 2MLGA 3GTOJ 2MLXA 3S32A 4RUBA 1ZS6A 1MMGA 2GFFA 2ZFHA 4HOBA 1NJIT 3S2DJ 2HYJA 5DJBA 2X3DA 2XY6A 4BACA 2F63A 3LSJA 2Z9OA 4RGXA 1O7LA 2X6YA 3OIOA 3B4MA 1FRIA 2ZDOA 4FETA 1F2GA 1LK7A 3TVZA 3CUQC 1J0RA 5DTDA 1S49A 4DJBA 2ZOFA 4XOTA 3BR6A 1T0TV 3DFGA 2M8DB 4IZZA 2CQ4A 2XM3A 2IC3B 4XLHA 3IWNC 1XB4A 3CDUA 1OR7A 2OELA 2YWWA 2C2KB 3R1LA 1FYLA 1W36C 4GO5X 4CLPA 2KT3A 3OXLA 1RCOB 3I59B 3IXQA 2OJED 2FPHX 3FSIA 3M2VB 2ZXHA 5CH7B 1IKXB 2DA1A 1NXIA 1SCJB 1IRFA 3QIDA 2GHPA 3W9JA 3DI6A 2ZJQF 2CVEA 3SQGA 2AS5F 2CV2A 2H4YB 3ZGKA 2WW4A 1GFWB 1SQFA 2ZKUA 2I5JB 1EAYC 2NNYA 1XS9A 1WC3A 1TL4A 3KHLA 4KE5A 3PM1A 2OCEA 1SB6A 3MR7A 4LK1F 4RMNA 4NRUA 1JQGA 3GLLA 4A8SA 4ZPCA 4I0AA 1LE8A 3F22A 3GFXA 3CJQB 3ZZYA 3S1RJ 1S7IA 2P7CB 4EFAC 4NA2A 3GIRA 3HHKA 4C4WA 2VQEF 4AUXA 1WHVA 1R1TA 4JI1F 3AHPA 3ISNC 4QW9A 4Q7AA 5JVGQ 2HHQA 1FRJA 3A3OB 1S12A 1AUSL 1TZ0A 3QBCA 1H6KX 2VONA 1TKZA 4URGA 4QPTA 3QOPA 3UW1A 1VJWA 1DGWY 2V6EA 1QU3A 1I1SA 4OMYA 1OYDA 5KFYA 2AIRB 1AOYA 1T8IA 5LEJA 2IVFB 3KOAA 1RZMA 5LSOA 1MWZA 3HSZA 1RHKB 4L9VA 2MD5A 2EC0A 1Y11A 1IBCB 3G8SA 2RQCA 3H9JA 2ZB9A 3OL7A 2HGMA 2OTLS 2CW8A 1K4SA 1ZN2A 4B48A 3AA9A 4M9ZA 4DUTA 4E98A 4G94A 2RS8A 2NXUA 3W8PA 5EN1A 1Z9CA 3GTLJ 5GAEU 1MWQA 3BCAA 4I99C 2QGUA 3K7RA 3KLOA 4J9OA 1HA1A 2E2IJ 3QP5A 2TCTA 1NSKL 3F41A 2J6UA 4K4VA 5JUMA 4MNUA 4UNOA 3PW0A 4KH1B 5L3FA 2GLOA 3C46A 2V1UA 3RBXA 5AXMA 4USWA 2HYGD 1FWZA 4XPEA 3Q0AA 2L5QA 5E3PA 4DL6A 1RT5B 4DZDA 2WY7Q 5JR3A 1IW7F 2CV0A 3SZGA 1VFCA 5A0YB 4KN7X 2QLZA 2O61A 3BF4A 1FERA 2KIUA 1SH0A 4M6XA 5A6PA 3FISA 5K8PA 4O44A 2CUJA 1F9HA 1QSYA 4HX8A 2BX6A 4UVAA 2DNNA 2K86A 2PD1A 5CYJA 4IEJA 4PG4A 2ZBRA 4TXSA 4F3OA 1K83J 1JGGA 4M3GA 4D0PA 3IWXA 1YI2S 3UWTA 3M8QA 2DITA 4X65J 3M6WA 4RBOA 4DFPA 1VC5A 3H2VE 2L02A 4NNJA 4ZVQB 2HRYA 4C2TA 3R5AA 3BQYA 1HXDA 2E5IA 1Q0NA 4H0EA 3GB0A 4QBUA 3V8JA 5JVTA 3MWBA 2KM8B 2RRNA 5ICFA 3EUKL 1RISA 3JAMK 1KP6A 4HHJA 4AVZA 1Z6RA 1RT4B 3HHEA 4A3MJ 1FKOB 1KBRA 3W2WB 1R89A 1X9MA 4FBUA 1YG0A 4UW2A 3H5NA 4GVLA 1Z91A 1SFOJ 3O3LA 1R5HA 4E4HA 4KNYA 3J7A1 2ZJRF 2ROPA 2Y1LB 4Y2KA 2E1PA 2BXJA 5KFSA 2ALZA 3K10A 3M2VA 2WWYA 3AODA 1IKXA 5AJ3F 2W2NP 2XYPB 3ZRGA 1RUNA 2XUBA 3TP0A 5D8KB 2CQXA 3TMOA 2DO0A 3ZZOA 1AUDA 1CQMA 2UP1A 2I1RA 2IGOA 2I5JA 2DCUB 3LA2A 4WXWA 4ABZA 4LITA 3US5A 1GT0C 3KP4A 1ZRDA 4RBTA 1WDTA 5EEGA 5FLXU 2BW3B 1FIPA 2MLKA 1VQSA 3RBDA 1Q7YT 2DA6A 5F9NA 1RJJA 2OTLI 3CJQA 1I1GA 1VRTB 2N7CA 2ZJQQ 2DFIA 3RQ4A 2YX4A 4HTJA 2CPHA 4USTA 1SMYF 2LA6A 4FXDA 4ECWA 1PUFB 4DPOA 1DBDA 4LR9A 3MZHA 2L7MP 2IMOA 5KFDA 4Z6YA 1S0VA 1YKWA 1PJ5A 4HKQA 4ZYHA 1VIOA 2FZCB 3WX4A 1FXRA 3I87A 4CIOA 3HSEA 2BABA 3QPLA 1FT9A 2WVFA 5LSLA 3KHRA 4AE5A 1M5HA 1MSEC 1S48A 2HGCA 3HI9A 2PMZD 3RR8A 1Q53A 2L0KA 1HYSB 4QIGA 1SC1B 3CJTA 1FDNA 1Y8QB 5DG7A 1M5PC 3FZ2A 4WTYA 2V1DA 2MGQA 2ADUA 2VJJA 4CGZA 1KFDA 1RT2B 1ZZFA 3FUYA 2F4VJ 4C3HJ 1HNWF 3U1MA 2WV0A 2XSFA 3QGPA 2C2EA 4TLQA 3DNCA 4KHMA 4WX9A 4HEA2 4ED2A 2AX1A 4QU7A 2YWKA 1JGSA 3R6SA 1P27B 4TU7A 2A2CA 2UVUA 1NO8A 4ITSA 3HOXJ 3WC0A 1Q1VA 3GG1A 2R8KA 1ETKA 1O6XA 2DFEA 2FF4A 2Z2YB 4I67A 4ZJQA 4F7ZA 5EX0A 2PIIA 5JVHQ 3DF8A 3WU2C 4YDDB 1NJZA 3H0DA 3CJNA 2W2QP 4UHTA 4LBHA 2L9RA 4N9HA 1PYOB 1RT5A 2I5UA 4NE9C 3HHDA 1RTJB 1RT1A 2D1VA 3J81K 4P7VA 2XO6A 1S7HA 5A0YA 1YG2A 4P96A 3I6PA 1Y6IA 1D0YA 4IRHA 1FI4A 4B09A 3DXSX 3V4IB 1RNLA 2VHGA 3KJVB 5C24B 4N41A 1T56A 2FVCA 3Q8QB 1V6HA 2D41A 2FA5A 3D6HB 3CLOA 1EF4A 2OF7A 1Y5IB 3OQ2A 1QO0D 1N6QA 2ADBA 4PWWA 2UXXA 1NHKL 1R27B 1FOKA 2HOSA 4MIWA 4M5LA 5J1RA 1SC7A 3R2DJ 1TV6B 1JXEA 2LU1A 4AL5A 2BM1A 2M4KA 3A3NB 1B64A 2RILA 4FKXA 1LK5A 2VD3A 4UOFA 4LRDA 1R3NA 4MIAA 2KL4A 2QQ8A 4BQNA 3D0IE 4LBIA 3LW5C 3DRRB 1TLHB 2XMTA 2KYZA 1RT4A 3W2WA 1FKOA 2IRUA 2VG7A 2DBBA 2MQLA 2XGXA 2WA0A 4P5OA 2E5NA 4DS5A 1ZM4A 3HFVA 3ML6A 3K89A 4PG5A 2AGOA 1N32J 1YIOA 1LWXA 4DV2F 1U6GA 5DDGA 2XS7A 3CQZJ 3PNIA 5HVQC 3ZZRA 4ZLPA 1S1VB 3K8WA 3R5BA 4IQ4A 2LECA 5GAEI 3ILOA 3QJPA 3DC2A 2HNDB 5KT3A 3CDWA 4RNFA 3UD3P 5E33A 1IJEB 4Y52J 4ETSA 3CCMS 4ECVA 2KO1A 1QAXA 1XMOJ 2ZZNA 3ASOH 3D5RC 2L7FP 3DBHB 3AFGA 3A0HC 1KOHA 2JL9A 5A2QK 2IHR1 2B56A 1OPCA 3F9KA 4XR6A 2JZ5A 4WWCA 1ACIA 3QRFF 3SBMA 2BYVE 4NA3A 2FHJA 3PYDA 1FDAA 1K8AT 4NZ6A 1WI6A 3VEPA 2OPQA 3JQMA 4R0EA 1T38A 2DGOA 4KC5A 4BGDA 2NVXJ 1VQ6I 2HVEA 2W01A 1SKSA 4NDLA 3CCYA 1VRTA 4J90A 2LEBA 3HG9A 5KFLA 4B3TF 1ZGJA 1RWPB 3KLNA 4J01A 2E7VA 5TGTA 1R58A 2YWHA 1KRPA 1PUFA 1KQ8A 2LDUA 1RACB 2IM1A 5IT3A 2DNGA 4QJVA 3AD7C 5BNGA 3R5DA 1UL3A 3OSFA 3JTNA 2VQFJ 3GZ7A 5CYVA 1R7JA 1D9AA 3IC7A 3DBRB 1JJ6C 3CD0A 1R6RA 2DNMA 3AH6A 2CRLA 1BOAA 5L3BA 1VOMA 1SJQA 3Q2SC 3CDHA 1VRUB 4USMA 4RJVA 4K4XA 2ZBPA 1TWFJ 4FF4A 1G8XA 1O4XA 1FE4A 2DRDA 3IS9B 3K5OA 2XAGA 3DOMA 1UWAA 4FYVB 3G1OA 1YW7A 2LVSA 1ZGWA 1HYSA 4BL0B 3G4SS 1X4BA 1JWWA 1RT2A 3J7AY 4JI5J 4B4CA 1F6TA 3LP1B 1ZARA 3BREA 3DGPB 2F4MB 2V9KA 2E5LF 3GCXP 2OP5A 4IF4A 3RYPA 2CPYA 2X6OA 4F8RA 1N4LA 4J19A 3PRVA 3T1YJ 4K8RA 3V6HA 5BPIA 2YKNB 1ZR2A 3EMTA 2GAGC 3MZIA 4O3OA 2EIMH 3M6UA 4U0VA 5DQGA 3CCUS 4LLLA 2ID6A 3L2RA 1YZ7A 4KGKA 4HDHA 4ETZA 4FBTA 3TX0A 2C2DA 2ACMA 5J1PA 4LB5A 1RTJA 1WUUA 1P4XA 1Y3JA 1OCTC 2WONB 4L74A 5IT9Y 4XIUA 1Y7PA 4JI8J 1R0AB 1WOOA 2XI3A 2P5LC 3C3WA 4HHHA 3V4IA 4B3RF 3KJVA 5C24A 4M6YA 1IN6A 2ZXIA 1LXJA 1W25A 4UV9A 4LMYA 4IRDA 4DSKA 5K1YA 1XN9A 2Z30B 3MDFA 3TEDA 1N5QA 3OW2R 1VF9A 1SPBP 3JQKA 4DQ2A 1UVLA 5HDGA 5IPAA 1TV6A 3Q0UA 3WIVA 1LVAA 3HSJA 1C1CB 3OFGA 1QQIA 3CCMI 3K0LA 3HMJG 2ALYB 4PXEA 2DXEA 7FD1A 3R0AA 2ZSHB 1WJAA 2NS1B 4XPCA 4AUKA 4JI3F 4NXMF 3DRRA 4ZKAA 1RB0A 2BXYA 3M07A 1R31A 2LA4A 3GVAA 1BY9A 3SFUA 2CGPA 4LFBJ 2K3IA 5D0GA 2KT0A 1VQOS 4O3QA 2GA2A 2NXCA 1BW6A 5IC6B 4NC8A 4J9UE 2DDAA 3BJYA 4OYOA 2GA7A 2K85A 3HC7A 3EE3A 4QU6A 2WVEA 2QA1A 5IOYA 3FXLA 1XMBA 2KG0A 4X6AJ 1S1VA 2RU9A 3MMAB 4MGRA 3OTOF 3W9IA 1BR1A 3I53A 3OYKA 4A69C 3G2XA 2HNDA 3N97A 1KDNA 3RRHA 1N34J 4HYEA 3FMRA 3RI4A 2RNEA 4LF7F 3CCTA 2A5WA 5EGOB 4TVAB 4B3MJ 1TL3B 1F2HA 2LDYA 3MCZA 1XQIA 3BDEA 3FDYA 3OL9A 5KFVA 1FEXA 4YHHJ 2NXNB 2M4GA 3V7RA 4JI4J 3CP2A 3GYXB 3QLHB 1BR2A 4ZPBA 4D3GA 3HCXA 3HVRA 3I32A 1YFHA 2HXIA 4S0MA 2PFFB 3K4LA 5L9NA 3SI8A 1GV2A 1JKQC 1IM6A 4QYRA 3I5UA 5KFOA 1F1ZA 3T8TA 1JHFA 1MIJA 3U27A 2I6WA 1SFUA 3SCIE 2YNIB 5EGYA 3G4SI 3N4WA 1HW8A 3QIPB 4W1UA 2CG4A 3G82B 1HQEB 1TMMA 5IYBJ 2V1NA 3RBZA 2C3UA 2DNOA 3QT6A 5C2GA 2YQ3A 5MLCV 2M8HA 2NVQJ 3DLHA 1MZBA 4CNYA 3B4DA 2VB6A 2EZIA 2CJKA 4M3DA 1HNZF 1VGYA 2DO4A 3AJDA 1K79A 4YEJA 3BB5A 3VOEA 5TISC 2GHWA 3PIOF 4FS2A 3DGVA 4EGZA 1RKTA 1UMQA 3H98A 2GS8A 3C6TB 2HYIB 3CCUI 3DLGB 4RB3C 2BGCA 1H9GA 3PO4A 1JT0A 2I8DA 1VRUA 2X3GA 4DLEA 5KFAA 4D9JA 1Q79A 5K8MA 1SKUB 3IS9A 1GXTA 4M73A 1LW2B 2FMLA 1O5JA 2HK3A 2NZCA 2W82A 2E2HJ 4NLTA 5J8FA 3DGPA 3LP1A 5KFEA 1U8WA 1IBKF 1FSEA 4BE0A 1WG4A 2H27A 2VIHA 5FJ8J 4LRAA 4MFDA 5F41A 4RGUA 4B43A 4LF6J 2JFKA 1H73A 1Q95G 4B1RA 2HQCA 2F8EX 4DR7F 2YKNA 2UUCF 3ZN0A 3CCJS 3G86A 4ZC3A 2QYOA 2OC6A 1NH7A 2B5JB 3F0NA 1CQTA 2HRTA 3G1MA 4CO3A 1UG0A 1R43A 1N36F 4PQUB 3TUZC 3MR6A 3ELKA 1WJFA 2QVOA 1P1LA 2MQQA 4F93B 1S72I 3SXLA 3HKWA 1R0AA 1VQOI 3F8FA 2VFSA 4OU0A 1JKPC 1QE1A 3I56S 1DU0A 4DPWA 1FK9B 3O2PE 2VJVA 1WD6A 3HRUA 4M8LA 5CQEA 2RAQA 4LSZB 4LF1A 3T9ZA 1AWCA 3WU0A 3QT5A 2XIGA 1WTFA 3AXMA 2JN6A 4NB5A 4MHGA 3OYNA 2JFDA 4CNZA 5HSPA 4L3KA 3DRYA 2WW8A 3V7CA 3NRBA 1C1CA 3TR5A 3M8EA 2Q43A 4W90B 1R5GA 3CCZA 3IAM9 2UUBF 2W24A 5JHFA 3L3CA 3CO9A 4CRJA 5A76A 1UW9A 2R7OA 2B9EA 1A6LA 4FXWA 3HULA 1WNEA 5EYRA 5F8MA 5HLHA 3O2IA 3MEKA 5FRNA 4BE2A 2DODA 3CCSS 1SI9A 4ELVA 5BS6A 3ZTPA 2CQ1A 4YFKF 4HDVA 2CQQA 3HPHA 3R97A 4XIDA 1HKAA 3ZTQA 1QAIA 1FJCA 1SIZA 3H4DA 5CZVA 4KPCA 1S1XB 1MD0A 1ZAWA 4A3DJ 1HBXG 4AU7A 4XKCA 3MMAA 3LA3A 2CPDA 1XNQF 4BWMA 2W9AA 2RU3A 3H35A 2EK1A 4M72A 5KAFC 3MKYB 2A07F 1Z0XA 1VC0A 3G6EI 2YNFB 3PX4A 2QF7A 5EGOA 1CJTB 4RNOA 1TL3A 1DY3A 1KD1T 5U47A 3MD1A 2QC3A 3BG5A 2QL5B 4WKYA 2KT2A 1VQNS 2QRRA 4L75A 1WZ2A 2AV5A 1VQLS 3QLHA 2X1BA 2P4WA 4A3JJ 5E5NA 4OINF 2D7SA 2GW8A 6AT1B 3MMYB 4XLCA 4PJNA 3CMYA 3U1NA 2HEOA 3GCWP 2F5FA 3W7BA 2G7HA 3OTEA 1IXKA 5KFCA 4RPFA 4QCLA 3C66A 1W4MA 2R7RA 2G2ZA 1YJUA 3BR5A 1HQEA 1REPC 2XMKA 1XSXA 3RZDJ 3MCNA 2EZKA 2M1BA 2N3OA 1MMNA 2AP6A 2G0IA 2JVGA 3LSPA 5LD2C 4PJLA 2NVTJ 2IP2A 5E17F 2E1NA 1N33F 3WGGA 3W5XA 3CCJI 3PUFA 1T11A 2ZH1A 3C6TA 3DLGA 3U2RA 3DEUA 3VQTA 3SZ2A 1ZKGA 1HA8A 3D6MB 4GVBB 4XAKA 1UVNA 3G2BA 3T0YA 3RTRA 5CVJA 2CQ3A 3PHTA 2YVSA 4XL9A 3ETMA 4Y33A 3J80Z 1DJ0A 1LW2A 1LNWA 2Z2ZA 3E3XA 2BVLA 2N3LA 2D9OA 3MEDB 5IQ6A 1WKLA 3W6JB 2XROA 3AQOA 1M1EB 5H6RA 4WK1A 4M3BA 3V42A 4QIWD 5KG5A 2HVDA 2BBYA 3KXDA 3PIOQ 1YLFA 2D74B 2E9TA 3MMBB 1Z6TA 1U8BA 2HHHJ 1J2VA 2UXCJ 3F3XA 4H54A 4R8UB 2FYXA 4F0HA 2COBA 2UUWA 1UZDA 2H65B 2WB1A 2Q8KA 3HSDA 2R3SA 1HQ2A 4BY1J 3M9OB 1UW4A 1IV6A 2P6SA 2MZSA 4HI1A 4XLFA 1ZAVA 4A47A 5A2QU 4TY8B 3QYBA 1U0HB 1XX5A 3ENQA 2MSYA 4OAYA 1UFMA 5M2PA 4DN0A 5DQHA 2B5JA 1D1BA 3QYFA 3H5RA 3RG6A 1L3VA 3F0CA 4PQUA 3AJ1A 2OA4A 4G1QA 2ECBA 4DL4A 4DV3F 1NMEB 1TTYA 3A2KA 3V4GA 5F8HA 1X58A 4WYWA 2PEHA 3EUHC 1WJ9A 2Q1ZB 1BIAA 1KLMA 2Y1IA 4F67A 2OMLA 1FK9A 4ZK7M 4G7ZF 4V1Ak 4KHPJ 3KDOA 3M2RA 3GYHX 4LUBA 2P9EA 4QWAA 1QRYA 3SV3A 2R8IA 3GZ5A 1GQEA 4C3MA 3W66A 4JI2F 3NOGA 3L00A 4HX4A 2MZRA 4M5DB 5KFMA 3JAMY 3FDSA 4WFZA 1B72B 1SL0A 4OIRF 1K6OA 1XG1A 5JI6A 3TYTA 3OLBA 1Z2LA 4I4BA 1IDYA 2JRSA 2AJ0A 2VFUA 3NGRA 2JWNA 2WTFA 4ESJA 3S3MA 1A31A 3LSMA 4PFOA 4BC7A 2FJAB 3A3PB 5E1XA 2HS3A 4BDYA 1VQNI 1QBJA 2HBYB 3TP2A 1K44A 1VQLI 1OY8A 5GAEJ 1BQNB 3B78A 5CKTA 1CC7A 3L2QA 2PO4A 3TJ8A 1WHYA 2EIJH 1KU2A 3HT3A 1RBLA 4JV5J 3R60A 4DUZF 4C7QA 2BJ8A 2CSOA 2UZKA 4F91B 5KG3A 3ZFVA 2QA4G 4L5EA 1VBZA 2GIZA 4RBVA 1HBMB 1S1XA 2Q79A 4MIBA 4DF8A 4DZPA 1FF2A 4G12A 3I64A 3BP8A 3OOPA 5JHUA 2YTCA 3D66A 2HDWA 1IR0A 3BQ2A 2VXZA 4C8NA 1T08B 4ZVOB 1QPMA 4WBFA 3K5NA 1SJ1A 2ZD1B 3QRPA 4LFCF 1LJ9A 2YNFA 3K4JA 4JBAA 1CJTA 5ETTA 4ZVFA 4RAGA 3HRTA 2H4WB 2KFZA 2FMYA 1TVRB 3LQQA 2O1PA 2VFRA 5C4XJ 4LSNB 4OHZA 2VT2A 1CPZA 4RLEA 2CUZA 5EZGA 4GYIA 2RAEA 3VYSB 3FXKA 4OYWA 1LDKB 5IC4B 2I10A 1RK8A 3GXOA 1RT6B 1U4BA 2V8PA 4I7HA 3WE2A 2JUCA 1H2VZ 1HHQA 5G0RA 1HLVA 1UAAA 2N4DA 2XCAA 3LWLA 1RHRB 2W4DA 5EJCA 2MZTA 3RPQA 2RKHA 4ZS6A 3BTIA 4DL7A 3VR1A 1FWPA 5HLGA 5C42B 2ADCA 2CNOB 2DOAA 1ZGAA 1OWXA 4NLYA 4NZ0A 2DGTA 3FKIJ 3A8EA 3E51A 1G59A 3JW4A 3T9NA 3I31A 3AA8A 4EZ6A 4O23A 4MKVA 3E6DA 4GVBA 1IBMJ 2A6HF 2WTEA 3I9ZA 1S6LA 3DHXA 1ZTRA 3GO5A 3I71A 4LR8A 3E6MA 2XSJB 4HV6A 3VAHA 1XR5A 5IV4A 4DEZA 3MEDA 1O57A 1OPZA 2H1LA 3NP5A 5LRSA 4ZHRA 5EWEA 1Y0UA 5SZTA 1HBUB 2JEJA 3S16J 3S3OA 4DNCA 3MMBA 4DR3J 1F36A 5E3AA 1FJ7A 3ET6A 1GXQA 2ZUGA 3J81Y 2X7IA 4R8UA 4PPZA 4IFYB 2QCOA 2XY5A 3QU3A 2QSHX 2ZCWA 2CFOA 1U6BA 4TY8A 2PT0A 2ZNYA 2ZNZA 3H0GJ 3OSNA 3Q24A 5L3GA 1SJRA 2VL1A 1J2XA 2LOOA 4KB7A 2W1BA 4UUXA 2AD9A 4KIGA 2W00A 2J0XA 2MZJA 2Y9YA 1T0FC 4KIAA 4X4NA 3WC2A 2Z2MA 1Q8BA 2QLBB 4ALZA 2HIYA 5BMZA 4F92B 1EETB 3X3UA 5HL7Q 1E6VB 3EXCX 4DG1B 4ZMMA 3LPYA 3HOSA 2G1HA 1H9TA 3FXJA 1M0SA 4CCMA 3F6OA 1YX2A 5C2CA 2LP0A 2GXGA 3WGHA 4FDFA 4Q5VA 3K4MA 2M3AA 5LFAA 3I4HX 1EH8A 1QA6A 4M5DA 2K1RB 1QZYA 1LW0B 1KQGB 1B72A 2BR0A 4C2MJ 1NK5A 4ECUA 1STZA 4BHBA 1DPUA 4IHWA 4OI6A 5LXYA 2HFVA 3VTIA 1W2BR 3PKYA 2XAJA 3ZPLA 4WJBA 4DHVA 3DLAA 3CEDA 1HIYA 3T5XA 4A93J 4YS2A 2FD5A 1U02A 4X62J 3W5ZA 2B9YA 1L3UA 1BQNA 1HW1A 4HQEA 1A5JA 3PRDA 3K0JA 5K8OA 1I27A 2AJ2A 3BPVA 3GV8B 2FVRA 4DQQA 3M6XA 1ZPWX 2ZFUA 1DGRM 2CS3A 3HVTB 4QZVB 4OV6A 2DIVA 5HLTA 1HBMA 4EBEA 3OYLA 4XDCA 5A2QY 3GV5B 1NHVA 4FQGA 5HANA 5BJRA 5KAKA 2LMIA 1WRJA 1TU0B 3RUBL 1TKTB 3ABKH 2E9ZA 3CJRB 4LVOP 3FEXB 2ZD1A 3H3VK 3IR5B 2OJ3A 2QKLB 4C48A 2HAFA 1TNSA 3D0HE 1FBUA 1TVRA 1I94F 2MEWA 4CYDA 3L7PA 3SSSA 3Q8PB 5GPCA 2ZHOA 4P2SA 4C8YA 2XDVA 2VJ4A 2UUAF 1UJ5A 3ZZ0A 4LSNA 3W60A 1CJKB 5E0OA 4G7HF 4DV5F 4DR6F 2QN6B 1UVJA 1N8RT 2L9NA 3CT9A 3BEGB 2DY9A 3R27A 2DMPA 5IP6A 3CESA 2ZBKA 3DEEA 3D7SB 2K7LA 2RUSA 2K9LA 5EDNA 2ZE2B 2VODA 5H1SV 3CULA 3DDNA 5ICCA 2D3O1 3HUGB 2XGPA 1RC9A 3TAPA 3UDVA 4J9RA 1QD1A 5C42A 2XB2D 2STWA 2OH2A 4L18B 1YGYA 3IM9A 1FDDA 2MKHA 1RAJA 5B3SH 2OD5A 4CH1A 2DAOA 2IPOB 3W65A 4ZP9A 4DBQA 3V2UC 3EM1A 4OHWA 3BR9A 4PYDA 1I51B 3ASNH 1UG2A 4QSHA 1VISA 2M0CA 3HHLC 1WH7A 3PFOA 4IG3B 4AFFA 5D3GA 4A5NA 2AEJA 1U5TC 3W1YC 2OKQA 3MFIA 1IJWC 4FNIA 2XSJA 4G1PA 1ZELA 3HSFA 3RJPA 3MECB 4KRWA 3X1LB 1LFPA 3FZVA 4G6TB 4XKBA 1DTQB 2L41A 4KYZA 4RL1A 3J80K 2KIMA 3IGVA 2JVOA 4OYXA 2DA2A 4M9XA 3BN7A 1FO1A 2P8IA 2E71A 2Z5UA 4GDFA 1HBUA 1GTHA 3BZCA 2BRKA 1EQ0A 1BC7C 1V5VA 3ZTOA 1VBYA 2Z57B 1GNKA 2H9ZA 4IFYA 3KIOA 2JLFA 4P73A 3FJ2A 5FD5A 5CJ9A 5HROB 1GXLA 2QM3A 2FC8A 1T94A 3R7SB 1TP4A 3BDPA 2WAFA 4M71A 1UMJA 4P1WA 3ERED 4K4ZA 2F40A 4FYXB 3IGNA 3I96A 3OL6A 5KFXA 1SUQB 3RU0A 2VE9A 2K9SA 4EV0A 5H2FC 4PJJA 1EETA 2ZOMA 1E6VA 3A4CA 4DG1A 2NQPA 2JTVA 1XCBA 2C2OB 3UO0A 3TW0A 2Z0GA 2L9VA 5FD1A 1F9FA 2LFBA 2K1RA 4NC6A 3Q8SB 2VPZB 2JVRA 1LW0A 1JUSA 2JC0A 4OLOA 2DGVA 2FC9A 1CJVB 3W63A 2VA2A 5HBMB 2IBDA 4I2OA 3K57A 3C18A 1JHHA 5KG6A 4UB8C 2FJBB 2A68F 3JRCA 4J9VA 2NSCA 3S93A 3PZPA 3GIKA 3OMYA 1VIXA 3A4TA 3NGSA 3SDEB 4Z2XA 3M8RA 5KFBA 2ZZTA 2M7SA 2NR0A 3AQPA 4DPYA 3S1TA 2DK5A 2HFHA 3FGVA 2F65A 1IN8A 1DFDA 4OZ3A 1HI1A 1N52B 2BA9A 3H8YA 3RKQA 4U96A 4DSIA 3IMQJ 3O44A 3K6GA 1Z7UA 1S6UA 4UXNA 5LM7E 4OZ5A 2Q1LA 1ERDA 5M2UA 5KFFA 2LQJA 2B8PA 3MM5B 1IUFA 2F9DA 3AB2B 3S3NA 1NNDA 1X4AA 1M1KT 5FD6A 2DXIA 3AAFA 1TKTA 2L9WA 1L5UA 1Z3YA 3CJRA 1IXSB 4X64F 1P1TA 3K4KA 5F9LA 2KHCA 3SEZA 2GCFA 1BWEA 4KO0B 4Y4RA 3AJ2A 1GXUA 4C0HA 2HOAA 4ZVUB 4IOBA 3E3VA 3T1HF 2EWNA 1YZ6A 4LD5A 4EJUA 3HT0A 3JRGA 4UUTA 4I6ZA 1CJKA 4YIIA 1U1MA 2Y8WA 1AROP 3GUDA 2FLOA 2M88A 3K8VA 2VLAA 1L3SA 2V5HG 4E7IA 1BE4A 3ERMA 2PMWA 1VLOA 3G96A 5LGNA 2XMUA 1PC5A 2KIQA 3OR2A 5L9XA 2HW3A 2AEFA 3PW2A 5DDPC 3CP8A 3UCGA 2ZE2A 3G71S 4O5VA 4RW7A 4B3AA 4M5NA 3BJOA 3HUGA 3H5YA 3N6LA 5KK1A 2M3DA 4CTAB 3LSTA 1ZA2B 3M8YA 4HF0A 3IA0A 1PUEE 3G9CA 2WOMB 3JS9A 4K4WA 4DR2J 4A8FA 3FKBA 1FYMA 1NG6A 1NSAA 1IWAA 2GMJA 4J9SA 1U09A 3K9TA 4BQQA 3NOCA 2Y31A 3C14B 5HMYA 2N4CA 4B47A 2DIUA 2RH3A 4GO7X 4J9LA 1J75A 8AT1B 4IG3A 2J5OA 1QVGR 4B3OB 3IAS2 1U2RA 1AU7A 1M5KC 4DF4A 1X31C 2PJRB 3MECA 3LFKA 5ILSA 2V2ZA 4K4TA 4Y2IA 4GKJJ 1Y00A 1WSRA 1T33A 3NGTA 1FE0A 5D5VB 1FZPB 1DTQA 1GHCA 3ILLA 2LQ8A 1KTQA 3KLIB 4RR5A 4H4KC 3ZZTA 2LKPA 2K9QA 2MKKA 1J9IA 3BR0A 3IL2A 1LFBA 3E7LA 5ETNA 3CMAS 4LF8F 5GMEA 3CD6I 1TL7B 1XMXA 1WC5A 2ILZA 5IWAJ 2HHSA 3GCMA 2G0JA 2J7WA 2RIJA 1NH3A 5HROA 1GAOA 2EZHA 2ASLA 1OLTA 3VPRA 3FXQA 3P5JA 2ZMEC 1N5YB 4ZP8A 3W5YA 3VYRB 2DQLA 2Y3YA 2DR9A 4MJKA 2XG8A 1SUQA 4X4TA 1MH3A 1X3ZB 2FQQB 4MK7A 2LCWA 1BQMB 3PYGA 4L9TA 4EQQA 1F3VA 3AG4H 3DTKA 4HLBA 4CCHA 2DNZA 3GEZA 2DT9A 1X9WA 3MPWA 2ZSIB 5HQLA 2IRFG 2XWYA 2W25A 1TAUA 5DD4A 3HVWA 1CJVA 1G2HA 1T2KA 4CZZA 2DEIA 2ZH2A 1XNRF 5HBMA 2A6OA 1SFEA 3W61A 1W2IA 3GJRB 4GRSA 3N05A 3PW7A 2DR5A 2L01A 3UN2A 2K4BA 4EJWA 3QODA 4ZTFA 2V34A 4F4ZA 1FJGJ 3ENWA 3SDEA 3VSLA 2Y0SN 1JMTA 4JI0J 5E8IA 3ZP5A 1XPXA 4B9NA 3CJ5A 1RAEB 5K5MA 3BH7B 4OHXA 4MKBA 3NS7B 3OFEA 2WVCA 2GAUA 1OFCX 3BR1A 5FLXZ 1VI7A 4CO4A 4Y2MA 1HD1A 5E20A 3SSRA 2PG4A 2Y1RI 3ADAC 2K8GA 3JSPA 3G71I 2XAUA 4ZDNA 3MM5A 4ED3A 1F1BB 2EB7A 1EB0A 5F3TA 4DR1J 1Z21A 3AL0B 2GGPB 4LIVA 2I38A 3N28A 4QPOA 4P55A 1O3QA 3RB3A 3Q8VA 1T02A 3LO3A 2FZGB 3KTQA 2BZTA 4BYYA 3ZTRA 1I3QJ 2WADA 3K5LA 1NPRA 2Z3YA 3UPFA 1PP8F 5D5XB 3VWSA 5I3PA 1YDLA 2AMCB 3GTJJ 2ME6A 1RESA 1H8AC 3PKMA 3QMQA 3W9HA 1RETA 2E36A 5I3QA 3OTBA 2EV5A 3R3TA 1BOBA 5ILUA 1JLEB 4ZP6A 1VI0A 3TX8A 2VJ5A 2QENA 1ZG1A 3IHUA 2LKZA 5BYRA 2MQMA 1U1QA 1R4MB 4CTAA 4OX9F 3BG3A 3A8JA 3CMAI 3MAQA 2WOMA 1Y8RB 4LFAJ 2L4MA 1R6YA 3CWJA 5AXLA 5IYDJ 3VB2A 3C14A 5GADJ 3P5BP 2GVZB 5AXNA 4ECTA 3NLCA 2MY7A 2JEGA 1UPPA 2OMOA 5KT4A 4HV5A 3M30B 5EG0B 2LD5A 4B3OA 5CVUA 3GG0A 3P9KA 3BO4A 2XNQA 2PJRA 3D5SC 1FT8A 1E3PA 3MN2A 1S57A 2VJIA 5M5WJ 2M9KA 4GKKJ 4ECXA 1WEXA 1XGOA 1K61A 2XRLA 3MEEB 4RAYA 1O51A 1G3SA 2FRHA 3PYFA 4DWIA 1V5IB 1GVDA 3ZNJ1 3KLIA 5K9FA 3EVMA 3LP2B 5AONA 3M4XA 2U1AA 4DPTA 2MD0A 2FXAA 3ZC4A 1TL7A 4IPAA 2BJ3A 3UDLA 4NLPA 4P2XA 1RT3B 1FTTA 2XAHA 4ZVTB 3ULHA 4I69A 5BR8J 4RW4A 2TDXA 5IOLA 5KFRA 2FDNA 1N5YA 3KP5A 3VDXA 2KHDA 1FLIA 4WFAQ 2ZFWA 4KITB 1IJFB 2M5YA 4ECSA 3R7NB 3FBNB 5C25B 4NYPA 4D5FA 4AL7A 4FASD 3WTTC 4Y34A 3CO7C 4CA0A 4YIFA 3F73A 4ETXA 3V6DB 1IO2A 2KH9A 4FF1A 3CO0P 1XDSA 4X66J 1UA0A 2J9DA 3OR2C 2EBIA 5HJXA 4DV7F 3MM7B 3R5CA 4EMSA 3SEOA 4TYBA 5ICEA 3HRSA 2VKDA 1RA6A 3NRVA 3OWTA 1FFWB 2ZKTA 5FFZA 3P45B 4I56A 2ROEA 1F9NA 3PO5A 4TU8A 1B9MA 5HMZA 5AT1B 2YKQA 2ZHBA 4L5JA 2R9LA 3LAPA 1ZREA 2CVIA 4XRSA 4MQ9F 5DM6F 3UDEA 2YNGB 1ORKA 1YJ7A 1P2FA 3EXYA 5J6XA 1ZAOA 3E2EA 1RAFB 4CLYA 4ZYAA 1J27A 2ZH9A 4DZJA 3CO6C 1LFWA 2HNYB 2RHQB 3KWMA 1P4AA 2AYMA 2ETHA 4IVNA 5IOZA 4HAMA 5GAHI 3MCOA 1ON1A 2DW4A 3P7NA 1G3WA 2VBYA 2F9JA 9ANTA 2MLYA 5E1ZB 2EI5A 2PA8D 2TRTA 1YX5A 1CG2A 2EV6A 4YFUA 1FTRA 2HTJA 1X7VA 3HSRA 1J09A 3VAFA 2ASJA 1WC0A 3IP0A 4KDPA 2V26A 4XNFA 2GGPA 3BSAA 2ZM6F 1NK6A 1RBOB 2XHWA 4AQYJ 1IKWB 2ICWG 1XK8A 3FNNA 3ECHA 1DUXC 2LRDA 2M8GX 4XRSG 4CH0S 4DI6A 1C4CA 3CNQP 1SL1A 1BLUA 3GR1A 2JNJA 4CDIA 4IYQA 4PG6A 3ULQB 1HMVB 2O5RA 3WTZA 2KU7A 2F5DA 1T03B 2AYBA 3JXOA 5IXUA 4HVZA 1SFKA 8ATCB 2JPBA 1PJ7A 1ZRFA 3JCUC 5E1WA 2HHXA 1JLEA 3MMCA 5I42B 1IBLJ 2HSEB 1U3EM 4NWBA 3DYAB 3K69A 1RHJB 3DRXA 3W3SA 4M6VA 5E3QA 2R2SA 3ZQ7A 5JMNA 2MY8A 4I0BA 2Y75A 2NNNA 1BI2A 2WB1D 5J40A 2W2MP 3PCOB 1XR7A 4Q48A 2W8KA 3IRXB 3IBWA 4FX4A 2JA2A 3VVUA 4IKFA 4UOGA 1GT8A 3WTSC 2QLWA 2VDHA 2HG4A 2E9RX 3BQZA 1K78B 1WWHA 3R5GA 2BBEA 1EKSA 2J9EA 4OFZA 3A03A 3M30A 5EG0A 2YBVA 1Q78A 5E8GA 4U88A 3FX3A 4F25A 1G4CA 2X1EA 4LB6B 5F0UA 1WI8A 2W7OA 3CLQA 2DGWA 1LV5A 3MEEA 2W7PA 3OD2A 1FA0A 3LP2A 3GIIA 3DKYA 4N76A 1XMQF 4KT5C 4PR6A 5F08A 4DV0J 1OCZH 1XSVA 1YBAA 3HP6A 4NLUA 1WSVA 3RAQA 1A36A 3MXHP 4O3NA 1T98A 3QU6A 4FT8A 1RT3A 2DR6A 4U87A 2BJ1A 3LA0A 1UELB 2XB5A 5HOOA 2HWIA 5K7FA 3DQVC 1JE8A 1TW3A 1CGPA 4ID5B 1WEYA 1FJEB 2J0WA 3CCVS 5HDKA 3OFFA 5C25A 1N77A 1QVUA 3EWGA 2A1BA 1E3HA 3WDOA 3F8CA 3CUNA 4DU8A 4DYQA 3IKTA 3V6DA 2J5AA 2BOLA 1NJYA 2V67A 4E7KA 5LJ3Y 1S0MA 3HKZA 4F7VA 4YY3F 1PCAA 1U9OA 5ETMA 3UN5A 1J59A 5LEKA 4UY8T 4PSXA 3HBLA 3MM7A 5HDNA 1S8NA 1ZYRF 3OIQA 2GWRA 1DQAA 2DNHA 3C15B 1B0PA 1RIOH 1QAJA 2ZZMA 3D28A 2YU3A 4A3GJ 2QSGX 1JLFB 4PXDA 2F6CA 3SYZA 2LP4A 3MCSA 2BY1A 4B9UA 1AA7A 1C1BB 2VBXA 1ZPVA 1YRNB 3BKFA 2DH7A 4R0JA 2QX0A 3VHQA 1HNVB 3AXKA 4I01A 4C3KA 3L95X 4LR7A 4NI2B 1HQCA 1A35A 4LF4F 1N48A 1ETXA 1Q82T 1JB0C 1YW9A 5JXSA 2LMDA 2WAQD 1QTNB 3K17A 2ATLA 2JMWA 3OS0A 1AKHB 4NLVA 5FLXK 5F0CA 5EZHA 2QFJA 5L1IA 1AFJA 4HLXA 3M9AA 1Q81T 1FP1D 4X4RA 1HKQA 4BBRJ 5E3NA 3B6CA 2R7DA 1HCRA 1JK9B 4H4MB 3RKYA 1JTYA 1IKWA 2CQPA 2EILH 3LANA 2MPUA 1F5BA 1RABB 2R7SA 2IA2A 3RRKA 3RB6A 4JB8B 4XDDA 2JX2A 4MMOA 4X4VA 4B9MA 3RW6A 4KJIA 3BG7A 1HMVA 2AJ4A 3H9QA 1B0TA 1PILA 2MSTA 3UVJB 1S7OA 3B6BA 1XGMA 5KAIC 3F23A 1IN4A 1IDZA 4J9NA 1WDDA 2QA4S 1N54B 2L7ZA 4ENJA 4C8MA 1LKXA 2KYXA 2W2OP 2VQEJ 3RRGA 3NGDA 3TAQA 2G2OA 5I42A 1B99A 4AYBD 3DYAA 2J0QD 3E01B 4JI1J 4OI2A 1DU6A 2IM3A 2WSEC 5ETLA 4C8KA 3MM9B 4UVBA 4F4XA 1X19A 3CJ3A 5BQTA 2X1DA 2NSBA 2WVDA 4OYAA 3PYEA 4LT6A 2MH9A 3A8IA 2AGPA 2XF6A 4JP8A 4OX8A 2E34A 4CH7A 3H5XA 2CZ9A 3GTPJ 2EG2A 3MHYA 2DT7B 1LB2A 3J80Y 3FBEA 4DR5F 3U1LA 1B7FA 2EK5A 4X84A 1JKHB 4G7OF 3S1NJ 4CCNA 2CV1A 3CCVI 2B4OA 4BXUA 2IJFA 3QJLA 2L3DA 4ZYEA 3MOZA 1HW2A 3PO3J 3N9UC 3HB9A 3FBCA 2RVJA 4LREA 2NYHA 3K7AJ 1ENHA 5B1BH 4F0KA 4ZYDA 4J91A 3CIZA 2YWGA 5D4RA 3K70C 1J5EF 4F4KA 3CCWA 3RZAA 4JYAF 1TQLA 4WFNQ 3SYTA 2KDZA 1KHWA 3QFWA 3BZKA 2L9DA 1Z3XA 4BKXA 1HBNB 2D2WA 2KLOA 2MTLA 3D4JA 3TJ9A 3QPIA 1DP7P 3BBCA 4CHUA 4IRCA 3FMBA 1DPRA 5BYQA 2VPLA 2V4RA 1G6BA 1GUUA 4NCAA 4YELA 1EZZB 4F26A 2WSFC 4EK2A 4YB7A 4EU0A 2E29A 4XN3A 1SVMA 2EFQA 2CMPA 1R0CB 4ID5A 3NCPA 1PJRA 3LSRA 1HLWA 5FLVA 2H5EA 3FWEA 2HQAA 2IBOA 1MROB 3GSIA 3E5UA 5A8WA 2GXAA 3S7RA 3ZZZA 4LSLB 1BIBA 1DQ9A 1HNXF 1RRJA 4HSTA 3GE9A 1TAQA 1U0SA 3FMSA 5KG7A 5AIPA 2CUFA 1P7JA 4ENNA 3HTUA 1O7FA 3FXOA 4CT9A 2FUG9 1KKHA 1CSJA 1I3OB 3K2AA 3C15A 1SQEA 1ZOTA 4LF2A 3X2QH 2A69F 4BUPA 2ZJPF 2VASA 1JLFA 3H3ZA 1JKOC 2G9OA 1Q8IA 4LFUA 3CTAA 1UEKA 1C1BA 2CADA 2MKIA 4A3EJ 2OZUA 2RJZA 1HWLA 3F8NA 1VS3A 2DNRA 1HNVA 2V8GA 1BR4A 2EXUA 5LJ5Y 4NI2A 2CQ2A 4HF2A 4PFPA 4A6DA 2COLA 2GOMA 3KKFA 4ZJZA 3OTDA 5E7OB 1RLCL 4TLRA 2CQKA 1AKHA 1PDNC 4OHVA 1NB2A 2EJRA 4IR1A 1XWLA 4YN3B 4OX7A 3V8KA 5AJ3J 2B6AB 1JLQB 4ITVA 3WTXC 2QLXA 5J4YA 1ZAXA 1JLCB 2RS2A 1CJUB 1FMWA 4H4MA 3DXJF 2NPFA 4EJTA 3GX4X 2DCLA 5HVGA 2FX0A 2HLUA 3BH6B 2XHCA 3RB4A 3BGFA 4ILMA 2R7VA 1YITS 1IC8A 5KFQA 4IHYA 4PG8A 1LWFB 2E1OA 2OAZA 5E3RA 5D0RA 3LL7A 2OAUA 4OJ1A 1Y56A 1IF1A 1UP1A 2GIRA 1FJLA 1PSDA 4AD9A 3TEGA 3TO8A 4A3IJ 3UVJA 2CPIA 5LRRA 1HR0F 1FIAA 2LKXA 4IX7A 3I9V2 4WP3A 3GWZA 1MG7A 4FE4A 2NS0A 2YY3A 4MEXF 3LQVA 2A6MA 1Q7LB 2VKHA 5CXTA 5KFPA 1R1UA 2IMWP 3H25A 2ESHA 3E01A 3CB4A 2Q6BA 3FVYA 4HI2A 2GZOA 3MM9A 4WXOA 4YR0A 3BYRA 3Q22A 4QLCU 2DRBA 1FESA 1NDLA 5CZXA 3DM2B 2AEMA 2E1MC 2AZ3A 5DUKA 2HZCA 1XTZA 2HU9A 4N4OB 2QGFB 4WWSA 2OEJA 1UFLA 2NOGA 4DL0C 2DO7A 3MWMA 4IO9F 4DFKA 2JRTA 5A2QZ 1MBEA 5BOXA 1S4FA 2FLNA 5EX3A 1S79A 2HZVA 1JKHA 4C8OA 2MBFA 4E70A 3BSNA 3OR1C 3CDIA 3MM8A 2M2BA 3E5QA 5HNHA 2DD8S 3PACA 4G65A 2Q3PA 3FK4A 3L4BC 2PI4A 2E1CA 2LC2A 1NDPA 4IQMA 1XR6A 3SZTA 2M9HA 4DV6F 3W6KB 1HNWJ 5KNLA 4LJMA 4FTHA 2JLEA 4YIRX 2CQNA 3D1QA 3BQ1A 2K7JA 3W2VB 1OIAA 2R8HA 1N5TA 1HBNA 3GJSB 2ZH5A 4MTDA 3QO9B 2GIQA 3DP7A 2NYIA 4NLXA 3TO7A 3OJSA 1K0VA 1G6NA 1LQ9A 3AD8C 4J9MA 5LT5A 1N88A 3BBFA 3RAMA 2R4FA 2L08A 2H1KA 4Q0BB 3H42A 1H38A 3NY0A 1K6YA 3KNAA 4YFXF 3O1LA 4GC7A 4LRCA 1MROA 1BI0A 4WFXA 2HHTA 3FIWA 3FCHA 3D1HA 2DOEA 4MQVA 2QE5A 1TELA 2ACJA 2XI2A 1JNRB 4LSLA 3TARA 3V5RA 4J9QA 4DR4F 1RHMB 2HHPA 4ANJA 4X2BA 4BJ5C 3CJTB 2ZXJA 1H2TZ 4P2MA 2KDOA 3SV4A 3PFIA 4UT4A 1ITYA 2RMLA 4QW8A 4FPRA 1HPZB 1DZ5A 1BC6A 1IVZA 1S9HA 4GXOA 3PJ9A 1FKPB 3VV2B 2XMVA 4JP0A 4QIFA 3CMMA 2RREA 2FGOA 3GTGJ 2H54B 1LDDA 1Q1HA 3ZQIA 1YITI 4LF5F 1IKYB 3IV5A 2CQ7A 1GMUA 3CC4I 2DYAA 3EVWA 2GM4A 1E17A 2PX9A 4DFJA 3TJAA 4KT6A 3M7VA 3O8GA 3KLGA 2QMXA 4ZIWA 4DOZA 2YQ1A 1RT1B 1U1LA 2KTQA 1QLNA 4Q44A 4DV2J 4C3IJ 5E3CA 2EZLA 4DMZA 5HP1B 5F6FA 3I0RB 2ZJPQ 5D78A 2Y0MA 2B6AA 1JLQA 1MNMC 3BWGA 1S6OA 4LJZF 2OGUA 2O3DA 1N6QB 1JLCA 1CJUA 3GZNB 4NYOA 3CJKB 6FDRA 5T41A 2QG9B 4XICA 1LWFA 1JX4A 5DO2A 1SC4B 1FXDA 3WTVC 1X4HA 3MPUB 4PQAA 2OFHX 3GSDA 3M8PB 2M87A 4K4SA 4M5HA 1D3YA 4ESFA 4YEAA 3QNWB 2OLWA 2V4JC 3UKGA 1IKVB 1AZSB 4K2XA 4HT5A 1RBAA 3H5SA 3BOQA 1MBKA 3PJWA 2VG7B 4Y15A 5KOXA 3R6LB 4I2PA 4B3TJ 4N7TA 3IH4A 4DL5A 3OVAA 1XC9A 2OPRB 3HFKA 3U7JA 1YRTA 4YFNF 2MKSA 2X6WA 1AA1B 3CCEI 3DM2A 2XGQA 5FKLA 1D5YA 4ENOA 4C97A 3BC8A 3Q5FA 1D09B 1FMVA 3SCLE 3O5TB 1VYAA 1X1DA 2BZ2A 4KY3A 2PEXA 1JLAB 1KYWA 2XSDC 1PBUA 2BMBA 4P75A 3TZXA 2MC3A 2GNKA 2RQPA 1U1PA 4X4PA 1FNNA 3B82A 1WC6A 1R0BG 3AOBA 3FQLA 1HWKA 4OIPF 4C9YA 3TQNA 2M34A 4IH5A 1ZRCA 1USSA 5CA5A 1TUGB 3S01A 3UD5A 5T7LA 2AX0A 3O8WA 4L5IA 3PQJA 4B9SA 3CCQS 2UV1A 2RD5C 4A8WA 1PIEA 2OPQB 2E5LJ 1KQ0A 3FSXA 4KMFA 3W2VA 1FRXA 2WSCC 2HQGA 2DPJA 5I3UB 4FCYA 1EHWA 3QO9A 4L76A 5B7WA 5DV5A 1C0TB 2R92J 3C2PA 1VK8A 3K2ZA 3LGNA 2BVZA 1FNMA 2C3PA 2CQHA 1WC4A 2XB0X 3CMQA 1M5SA 3M8SA 2XF5A 4NXNF 1HL6A 2XS2A 2JSPA 2V2VA 2RQQA 4S0HB 5KOWA 4Q0BA 3BKUA 4OI0A 4EATA 1X5TA 2D5VA 1D0ZA 1NH8A 2DJWA 2JUGA 2C3YA 1IXCA 1NCLA 3RSNA 3PIPF 4B3RJ 2WK4A 1YJVA 3J7ZI 1H7XA 5AE2A 3DBLB 2O8KA 2EFPA 1R36A 1TQPA 4ON0A 3DOMB 2G13A 1FTZA 2HHUA 3CDAA 1UVMA 3JQJA 1TC3C 2RNGA 3IR6B 5FO5A 4K7QA 5DRKA 1VQ6S 2BV6A 4PK4A 3T5HA 4TYAA 5C7PA 3ECOA 4DQIA 3PHEA 3PNVA 4F3QA 1HPZA 2BE2B 3MKLA 4V2FA 1AB8A 4U8VA 1R23A 2D9PA 5KHDA 2F5VA 4NZ7A 1FKPA 3M9MB 1LEBA 5D15A 1FRKA 4OWRB 3MOJB 4JI3J 3MR5A 4NXMJ 4P10A 5FKOA 1EH7A 5FRMA 5L39A 2EQRA 1SD7A 3JTPA 1IKYA 4RU2A 3PTWA 4NEZA 4WXDA 2QO3A 3HZGA 2LU2A 1N0VC 4OI4A 2BQUA 3CGIA 5JFRA 2N8GA 4PGGA 1SVDA 3H0PA 2XTJP 4UOHA 4HEA9 2LREA 5CQGA 1AXQA 4RU9A 1TL1B 2PQ8A 4U0YA 2XKPA 4W92B 4PUOB 5KFUA 4OZ1A 4KT0C 1CC8A 5TRDA 1K0TA 5HP1A 1HNIB 1YE9A 4ZA1A 3OTOJ 1DURA 2YH1A 3K1NA 2O6GE 3I0RA 9ATCB 3HSGA 1KS2A 5LMUF 3LH2S 4Y3OA 2K27A 2KKHA 4ZPAA 4I6AA 1UEVA 2CPEA 3OL4A 4LF7J 2NXJA 2AJQA 3NS6A 3KJNB 5KFJA 2VBWA 3HRMA 2BKOA 4HH1A 3CJKA 4MT1A 3HZJA 3B73A 2UXBF 2KN4A 4E8UA 1O3TA 3NQOA 3CF2A 2FU4A 3PRBA 2LTPA 2DY1A 2XGDA 4AWXB 2IGKA 3MFKA 4U7DA 3HM5A 3M8PA 3FRYA 1PKUA 1N25A 5AE1A 4PJMA 4P74A 4PUSA 2DRAA 3SSQA 3TRGA 4WZMA 1IKVA 1AZSA 4ED8A 2LH9A 3TOAA 4C8LA 4A12A 1OCPA 1SJ4P 4XRMA 1ULRA 1NK3P 5DG8A 2OI2A 3CCQI 4KFBB 1VQPS 1WPKA 3EPGA 4QYZJ 4AIDA 2MKCA 3ROUA 2E5ZA 4ZPTR 5ERIA 3GU0A 2OPRA 2OD6A 3D67A 4K2EA 4Y7NJ 3O8HA 4XBFA 1HNZJ 4F0MA 4DGWB 3OHAA 1VBKA 3GTYX 1RKJA 1PC4A 4PWDB 5HI7A 3IO1A 4K0KF 2BY3A 1WHUA 1JLAA 1UZHA 3LAMA 2CQBA 2IFXA 1IXRC 2U2FA 2EKNA 4WFYA 3Q86A 2DTZA 3UFCX 3RJMB 3PUBA 2C6YA 3D1NI 3PJXA 4BHCA 3EYIA 1WJBA 4NLGA 3GJTB 4I98B 2XRNA 1X1CA 2ZJRQ 1H88C 2GQ2A 3BG9A 2LXFA 1U1OA 3RR7A 2R2UA 1B1BA 1IBKJ 4PXCA 4A3BJ 3WQPA 2YKOA 1MN7A 3CMES 3DXBA 3W6VA 5I3UA 1HI8A 1VQ4S 2I9SA 4BJTA 4E0DA 4DR7J 1C0TA 2UUCJ 3IM8A 2PE8A 1CBKA 4XK4A 2VOPA 4XM3A 2FIUA 4Q8EA 3D54A 2NREA 5ICGA 1AFIA 2O66A 2C2RA 2GIVA 1N36J 2RN7A 3F56A 4OL8A 4OAZA 2W85A 4LRFA 3HOZJ 2WCXA 2KZZA 3V7SA 2P0WA 1VZ0A 4IXAA 1FDBA 3K70D 4BBSJ 3A8KA 1WHWA 1BW5A 2KXHA 2Y0SA 3G1LA 3R0JA 1T39A 4KKOB 3DPUA 3DDIA 4A6EA 1XD7A 1S6QB 2N82B 3FCVA 1GVJA 5KFWA 2RDJA 4MTPA 1YS6A 4WCEQ 2V6AA 4ZJOA 4PGHA 1UZCA 3BTLA 3V81B 3OL3A 3NXZA 4F4AA 1RSCA 2BE2A 1IM4A 1IR2A 3CJ2A 1SBRA 5ETVA 2UUBJ 1VC6A 4WF9Q 1QZZA 1WELA 1OJLA 4XMYA 4TV7A 3PIPQ 4S05A 2Z58B 4XN0A 1D1CA 2R7FA 4I2QA 2UZAA 2IS2A 4A3LJ 4OJHA 3GIJA 3FEYB 2L9SA 1VHIA 5FLXY 2YPZA 4L9NA 5ILVA 2QMUB 1B3TA 1SH2A 2IYGA 3PM9A 3OTCA 1TL1A 3QAEA 4BQOA 1WF0A 1LKZA 4JI6F 4PUOA 1BUXA 1SEUA 4I09A 1H74A 3BTCA 1HNIA 2HIQA 5I4MA 1QE1B 4ES2A 1VBXA 1LQ1A 2XS5A 4J9PA 1VQPI 1XNQJ 1UJ8A 4CCJA 2IW5A 4JI7F 5FKMA 1P92A 1A6QA 3QRRA 1BN5A 2ZXWH 2NUUG 2XLKA 1MU2B 1OSCA 2R42A 1RE1B 1UVKA 5IT4A 1UKUA 5IZHA 1OQYA 2MH2A 3SCJE 2YKMB 3S14J 2DR7A 2DHGA 4G8XA 2LQ5A 1SD4A 1R6VA 2JEFA 2ZHAA 2OZ6A 3LGHA 2OEMA 4WFBQ 4C6AA 3KG4A 4NA1A 1OCOH 3G6YA 4C30A 4HTIA 4LQ3A 2KXFA 5F8JA 3TWZA 3KK1B 2BXZA 1SIWB 3PO2J 1D0XA 1I5ZA 3RAXA 1S72S 2JH3A 2LKSA 2CNLB 3I4MJ 4LF9F 2NZ4A 3K4NA 3BGRA 4ZZDA 3JTGA 2CJAA 3NNAA 2K3PA 4KFBA 3PNYA 1RUOA 3BPDA 1WWXA 2V2KA 1Y0HA 2MKJA 1G3YA 3CMEI 1VQ4I 3IWFA 2N7YA 1N33J 2AF6A 3VODA 1OISA 4PWDA 3OYJA 2KL8A 2QYGA 2VE8A 1YBTA 3FHZA 3KG1A 2JJ4D 2EK6A 1AHDP 2AKWB 3JRDA 4MEYF 1RR7A 3AD9C 1I3AA 3IUOA 4RUCA 4FF3A 1SC3B 1R8BA 1OQ3A 4DYRA 4X0GA 3LP0B 3NCQA 2ASYA 4ZLJA 2V2QA 5J2NB 2GZWA 2VFTA 4DL3A 2XMAA 3IRRA 2P81A 4OOIA 2DPIA 2M7AA 5HVFA 4CUGA 4YB1P 5M3FJ 3QOEA 3QT8A 3UNYA 2HBRB 5ETOA 3EUHA 3RW7A 1ZG5A 2M8EA 4OMZA 1SD6A 2O7OA 3BV8A 1WORA 3GTKJ 1C4AA 5HS9A 1W36D 1WG1A 2W1OA 3TQ1A 5BYSA 1UHWA 1G7CB 5KFIA 4RWXA 1DTTB 2PI5A 5F1RA 2JVHA 1NSQA 5DCFA 3I5BA 1BMQB 4M63A 3FRZA 4RB1A 4L6V3 4YB5A 4N8OA 4OZLA 4DUYF 4F36A 2KHMA 1G3TA 3U02A 3LOCA 1XSDA 3L1PA 1W7PB 3G6ES 2DYSH 4OI3A 1D8JA 2XEXA 4B3XA 5HODA 5F27A 2XAFA 2VPRA 2JSCA 2G7UA 4R8HA 4DV3J 2EFOA 1TTHB 1QSLA 3THPA 4H4OB 3I3LA 5C44J 1I5OB 4KKOA 3NMAA 3PFEA 1JJ4A 4G6QA 1MH4A 2OUGA 1S6QA 1WC1A 3JYTA 4FHTA 4JI2J 3DLEB 3FEZA 3FK6A 2C28A 1RWXB 2DXFA 2V8DA 2CFXA 4DDFA 3V81A 2DFFA 3CCRI 4ICLB 3ISND 1U24A 4DPUA 1EJ7L 3HD1A 2B4UA 3GV7B 2AYEA 2IS4A 2X4HA 1X3UA 1U2FA 2KJVA 5DDQC 2OBPA 3GFJA 4QTRA 4BCAA 4F52A 3IBCB 4G6VB 5HQ8A 1LPQA 4ZVRB 5HJYA 2ZH4A 5D4OA 1BJAA 2HFNA 2L54A 2XCPA 4DYCA 4LVNP 4DUZJ 2NLWA 3HEFA 4Q2MA 3PFYA 4HQMA 2FSWA 2VQGA 1FD2A 1T9TA 2K06A 4NLDA 4ESBA 3EDRB 1AW0A 1UTAA 4MLOA 4N8NA 1IV8A 4G1QB 2Y9ZA 1T05B 3DKDA 1KN6A 1QSSA 2DA4A 5A8KB 2QJ3A 1FNOA 3K59A 2XGEA 1KLMB 2EINH 1TFWA 3D68A 2CJBA 2DNPA 3M2RB 5DZ6A 3PX6A 2VIXA 2D1CA 1Z67A 2W57A 2HZDA 2IS1A 3DN9A 2FY1A 4LFCJ 1MU2A 3OVBA 2HFZA 3BBBA 2HKXA 2BY0A 4BE1A 2YKMA 3UNGC 2W2PP 4II3A 3QGGA 3SQNA 4RW8B 3VYTB 1DAXA 3N01A 5KT2A 3ETOA 1YIJS 3VZIA 4B44A 1TT5B 2BOAA 4B08A 1ACMB 3HHLB 2GO9A 4L72B 2YSRA 3L9FA 2A0FB 3BSCA 4XO0A 1U5TB 4DSEA 1NEEA 3KK1A 3JREA 5ITHA 3D3CJ 1IZ1A 1Y1VJ 2E1RA 5B1AH 2DKOB 2Y0BB 3VGSA 2F5CA 2NYXA 5E3LA 1SVLA 3SEQA 3SZPA 1CLFA 1N0UA 4A8KA 9RUBA 4GFBA 3GFMA 3PR4A 1FPQA 5GPAA 5HMWA 4CDGA 4WXCA 1N5SA 3HKZN 2R7UA 1X60A 4YB6A 2VN2A 5E79C 5IT0A 2UU9F 4O0NA 4FYDA 4DSFA 1TL8A 4L73A 4AIKA 3B8HA 3PV8A 1J7KA 3Q8YA 1RAHB 1R71A 2NOJB 2H3EB 1KHVA 5CPRB 2D69A 2YX1A 2NVYJ 2ZDPA 2GOXB 5FROA 4K5RA 4A2UA 5K5OA 2JJ7A 3LP0A 5J2NA 2IAJB 3E6BA 1T0FA 1NTCA 3IWLA 3FBFA 4WE1B 2ZWOA 3DLJA 4AVPA 2EV0A 3HPGA 4WF2A 1R00A 2GQQA 3TOQA 2BJ9A 3CF5F 2O5DA 1Z7LA 4GRIA 4HRIA 4CCLA 2JEIA 2CZVC 3DLKB 3QPSA 1KSPA 2OO4A 2JZYA 2K9MA 1UB9A 1DTTA 5G0RB 4AT1B 1OMIA 2EFNA 1P4WA 2LG4A 3ZQFA 2DGXA 5DETA 5D0HA 3KHGA 4NMLA 2KFDA 5KFZA 2HQFA 1W7PA 2B3TB 2XC9A 1LEOA 2C3MA 4UQGA 1TK5A 1FHTA 3CTRA 1O0PA 1RWUA 2ABYA 2LQ9A 4J00A 2YR2A 3GW2A 1YJWI 5K7HA 4Y28C 3TNVA 1A6IA 4Q8FA 4H4OA 4HPQA 2VG6B 4CWBA 5EDWA 4O3MA 2G0CA 2KFNA 2KP6A 1CULB 5DDRC 1IN7A 2BV3A 3R5JB 5IY5H 3BPSP 2IRYA 1RLDA 3NEUA 1NKCA 2BQ3A 2CG8A 2L4AA 3DLEA 5DQIA 4ZHRB 2UUZA 2HURA 4ICLA 3DRPB 2BKPA 2VT3A 3OXGA 2YWFA 1VDHA 5LSRA 3WG7H 1PYTA 5GMDA 3J7ZT 3OYAA 2NCKL 1VQ8I 4QWEA 1PO6A 3ET6B 4ZPDA 3EYZA 4FF2A 2DB1A 3QATA 2H8WA 4QIEA 1S1UA 3D9BA 1YJRA 4IH7A 1YIJI 4HSRA 2UXDF 5D5WB 3MZ8A 4ZN3A 4JYKA 3BS9A 1E3OC 3KMQA 3QWLA 2CQCA 2B43A 5LMNF 4M95A 3OYFA 2IIHA 3GP9A 2OQGA 3FXUA 1BC8C 3B54A 3IBFB 3DCAA 2AU0A 1HBOB 4K4UA 2ASDA 2A6TA 1T05A 5D6GA 2J8AA 4XLEA 2CUEA 5A8KA 4EO6A 2CYYA 2PA3A 4Q5SF 4ZDOA 4BS2A 2O3FA 2E5GA 4BHPA 4N56A 1TT0A 3ZQHA 5E18F 2XHKA 3HOTA 3DOKB 4QPQA 4K4YA 4C2UA 4B3SF 3I4PA 2B4VA 2IVMA 4Z37A 4OZJA 2E2JJ 1NJXA 4IRIA 3NL0A 2HPMA 2XZTB 4Y65A 1I94J 3S15J 4RW8A 2L3MA 1APLC 3IRWP 2UUAJ 1HWJA 5IQQA 1R9TJ 4O4RA 4DCPB 3HHLA 3SDGA 1KQFB 4DV5J 3HYIA 4DR6J 2ELJA 3WTWC 1U5TA 3ZN1A 1NSPA 2APOA 4U8YA 3PR5B 1Y5NB 1XN7A 1MGTA 1OYIA 2KB2A 4E7HA 4CP5A 4I0WA 2LF8A 1YSJA 4USKA 3I58A 3CDLA 4DXLA 3D5LA 5LGUA 1TK8A 4JX4A 3KEYA 1JJCB 5G4DA 2PMHA 4ENMA 2VG5B 4CYUB 1FEHA 4R25A 3PEHA 2WC2A 4BBYA 4USIA 4HR2A 3HFZB 3TOBA 3KZZA 3H36A 5B66C 2BANB 3K5MA 2FJDB 4C11B 2ZMEB 4KGVB 3WZ0A 3HLUA 2K2PA 1G3OA 3KUGA 2B0LA 2IAJA 4GGGA 1B0VA 4RAZA 1VRQC 3MAAB 1OKRA 1S7AA 4WE1A