4F3QA

Structure of a yebc family protein (cbu_1566) from coxiella burnetii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
234
Chain Sequence
KWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAIKRGADNLVEVRYEGYGPSGVAVMVDCLTDNKNRTVAEVRHAFSKCDGNLGTEGSVAYLFKQRGLITFPPNSDEEKIMEIALEVGAEDVTTNDDGSIDVTTLPEDFEKIRNAMKAADLNPSHAEVTVLASTEVGLDKDSAEQMLRLTEMLEDLDDVQNVYSNADYPEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulatory protein CBU_1566
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 73
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4f3qA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA03
1WJBA 3HPGA 1LFPA 1K6YA 1WJDA 1WJEA 1WJAA 4F3QA 3F9KA 1E0EA 1MW7A 1WJCA 3HPHA 1WJFA 1KONA
chains in the Genus database with same CATH superfamily
2M0CA 2LVWA 4CO3A 5L46A 2CWEA 1ZGWA 2JSCA 4DQSA 3GTMJ 2M70A 5L3EA 1RAHB 1FEXA 2RN7A 5D6EA 3OTOJ 1OPIA 1X4AA 1R0CB 2ZHOA 2CPYA 3LP1A 1HYSB 3J7Z5 2MLZA 2ZEJA 1T8IA 4L3NA 3PVXA 5CVIA 3EPGA 1D8KA 4H54A 2EQRA 3UDVA 4DZ6A 1BC6A 1VBYA 3WU0A 5KFMA 1NKBA 3DLEB 1HKTA 1ETOA 2FXAA 2ZWOA 2R3SA 5FKKA 4AC0A 3EUHC 4XAKA 4ZLJA 3ZQGA 2LRDA 4JV0A 5H6RA 3ILOA 4R5PB 1U26A 4UVAA 1HWIA 3V2UC 2A6TA 1PGZA 4YEAA 2M8EA 2FA5A 4MEXF 3TMOA 5DUKA 1UZHA 4X84A 3QJPA 4C8ZA 1XGOA 2O1PA 4PXCA 2HKEA 2XBPA 1QM9A 3BR3A 2IGOA 3HVAA 2QIFA 1V3ZA 4U8YA 3CTRA 3KLFA 1GEHA 2B7CB 1I94J 5FJ4A 2WOMB 2OC6A 4B17A 4YB1P 4I67A 4UTGA 2CQGA 2Q2EB 5K8MA 3BQ2A 4JI0F 4EATA 4LFBJ 3KPHA 5JUMA 3HHLC 4HQEA 1FDDA 2BABA 5ICCA 2L08A 1PCAA 3OIOA 3CDWA 1TL1B 2FJVA 5I4MA 3M2RB 3MM6A 2Z4PA 4YP3A 3QT5A 4NC7A 1ZRFA 3DI6B 4DS5A 2HK2A 4HLXA 2QL7B 4LRAA 3TVYA 3V81B 1MBKA 4DI6A 4K4ZA 1EAYC 1WEXA 2FPHX 3FMRA 4Y3OA 3U9GA 1R8HA 2P7VB 1U9OA 1RAGB 4O44A 2LD5A 3RAXA 1LPQA 2W85A 1FKAF 1WHUA 5ILUA 4S0MA 1WD6A 1UJ6A 1QD1A 3F9KA 4DV6J 4R8HA 4C0HA 4B9MA 1ACMB 2GZWA 3IWNC 3BQ0A 3L2CA 4KR0B 1VBZA 1O6XA 1SKUB 1WHYA 3I4NJ 4C8KA 2VL8A 4J9MA 4IOCQ 5KHDA 1SJRA 1IJEB 3FSYA 3IBFB 3ESWB 1DP3A 3NCRA 2BJ8A 3KK2B 3BR6A 2Q0OA 4MAKA 1JJHA 1SPBP 4LMYA 2JEGA 4F93B 3R5DA 1URNA 2J8SA 1K78B 3OSPA 4PUOB 1TELA 3NNHA 2GZOA 4B9LA 1LE8B 3BKUA 3MD1A 1WKKA 2P0WA 1XK8A 2JA2A 4I98B 4ENJA 1YIJI 4NCBA 5IYCJ 2KJVA 4UVBA 2LQ8A 5CQGA 2MLGA 3TOQA 2F5FA 3UQSA 4I7HA 2YKMB 3AL0C 3M8SA 1S6UA 4CT8A 3C66A 2OGUA 1RWPB 2YNFA 5E33A 1RGVA 2RU9A 1A6LA 3VGUA 3R5BA 1SAUA 1KVJA 2QC3A 4G7ZF 3HVTA 3SCJE 5A2QY 2CNKB 3W5ZA 5LFAA 3M8PA 4RW9A 2RF2A 2EFQA 4ILMA 1K83J 2JUGA 2KZMA 5C3EJ 3KCCA 3NGSA 2CJQA 2FJAB 3PYEA 2ACJA 1EP4A 3TOBA 4DL5A 3HD2A 1R36A 4QOTA 4FETA 3CP8A 3FCWA 4CYDA 3HRTA 3OPKA 4A8QA 4RBTA 4RW7B 2CQQA 2JTVA 5D0GA 2P9EA 4EBEA 1T03B 2XY5A 3VV2B 1F9NA 1PO6A 5ETVA 4TY9A 1FRHA 3OW2R 4B43A 4G12A 3QZ7A 2GVDB 4DR4J 1ZHFA 4IKFA 4OX6A 1NJZA 2OUGA 4BQQA 4YDXA 3OFHA 1FRKA 3PIPQ 1YX5A 1D1AA 4PWWA 2DH8A 4QSHA 2CJBA 4KH1B 1U47A 2IM0A 1HMVB 1O4XA 1IBKF 1T2KA 1O3SA 2LKZA 3K59A 2ZH3A 2W9CB 4ZPTR 3JAMY 4IX7A 3QRQA 4OAYA 4B9VA 3G8QA 3LANA 4DV3J 3RKXA 4IHWA 1YJVA 4LSLA 3BGRB 1TUGB 3R6LB 1X4HA 3TBIA 3KKFA 4O3QA 4I0AA 1J9IA 3UCUP 4QPOA 5F3ZA 2IC3A 1LFWA 4YHHF 1IKXA 2VG5B 5IT9Y 5HN0A 1TR0A 1KVIA 3TO7A 5IFMA 1BJZA 2W7OA 2D5VA 4JI7F 3JQMA 3NGDA 1OYEA 2E1NA 1P4XA 5AE3A 3KMQA 4LFAF 3EVMA 3H59A 1C1BA 2ZH6A 2HHTA 3M8ZA 3BKFA 3GYXB 5THWA 4A3IJ 1HNIB 5KT5A 3MPDA 3RGIA 1RTJB 3GJSB 1IM4A 4XL9A 1W1WE 1A0OB 3QWPA 2H3EB 1R00A 3K9TA 4WTOB 2CJAA 3LQRA 1YLXA 3M9NB 5GVQA 4H4OA 3ZZOA 2E19A 3PFYA 5SZTA 3DFEA 4XLAA 4AVZA 4NQWA 2QG9B 2J5PA 2L9RA 2YSRA 3KEQA 3W9HA 2WHOA 4WF2A 2F7VA 2VFTA 1U6GA 1PJ7A 3BTIA 2MYSA 3POTA 5FDLB 1JJ4A 1HHTP 3MEDB 2UUZA 2KZGA 2LR8A 2XGEA 1FRMA 2NXEA 4TKTA 1U2WA 3MTKA 2IYIA 1FJCA 1RWWB 2A2CA 4M6XA 2U1AA 2X1CA 2ELJA 4FNHA 1FIAA 1S9HA 3CMAI 2EEYA 5L3CA 1YITI 5EG0A 1MROB 2DHHA 4F3MA 4KKOB 4I2PA 3NGRA 4TY8B 1VI0A 2X3DA 5E1WA 1I39A 4K0KJ 4BNCA 1TMJA 1XBWA 1S1XA 4HOBA 2LA4A 1ZTRA 3GEZA 2DW4A 1VQPI 1ZM2A 3K7RA 3T9NA 2OTLI 2AV5A 4P9UA 5A8WB 4DQ2A 2HDDA 1S59A 1ZGJA 3N6LA 2YR2A 4M74A 2KI2A 6AT1B 1XDSA 3CC4S 5CYMA 3MN2A 2JEJA 1ITYA 3OYMA 1TKZA 4ECWA 2R7TA 3CD6S 3SYZA 2K3IA 5GPCA 1JJ8C 4U96A 2A05A 1YYVA 2R5YA 3CJTB 2IA0A 2HQAA 2C2ZB 4L6V3 2UU9F 4LD5A 4NMXA 1NHKL 3SV4A 3DLKA 4FS2A 2HS3A 1YBUA 4UZCA 1N56A 2MJUA 9ATCB 4A3EJ 1REVB 3DTIA 2DO4A 5E20A 4AXJA 1BIAA 3RJMB 2K02A 2XS7A 4LF9J 4GGGA 1HDPA 4UB8C 4USKA 2IA6A 4LF5J 2F4MB 2H54B 1IJWC 4Z2XA 4ZJLA 1U02A 1TQPA 1X8DA 3BH7B 1FTZA 2C3OA 1OWXA 3BREA 5C42B 4CZZA 3ZOBA 3WGGA 4CZCA 4OYAA 1JLCB 2FJWA 3GLJA 3UN2A 2W48A 1JTXA 5H9FJ 1ZYRF 2OTJI 3VQTA 1GV2A 3DRXA 4B9SA 1B72A 1GNKA 2CV1A 1R23A 1O3TA 4LF7F 1SVOA 2C28A 3OY9A 1P9QC 4K2EA 2ECCA 4CQ1A 3CD5A 2ABYA 3DMJB 3ILJA 1HBOB 2LBFA 1H3DA 3THVA 4CT9A 3ET6A 4AD9A 2HBYB 4RNOA 1J27A 3DLJA 1PG5B 4F4YA 2OJ3A 2CU7A 1S1UA 3K57A 3NL0A 4RWWA 3DF8A 3PQKA 4PFOA 2C6YA 1TTYA 3BJOA 2ELHA 4A93J 4EWTA 2V9PA 2HQ3A 1OR7C 5IPAA 4RLEA 4LITA 2MD5A 1XMQJ 1B0VA 2VQFJ 4C11B 1YRUA 1PUFA 1RCOB 5KG4A 3ILLA 2NVYJ 2WAQA 4BWMA 2R8IA 4ZPBA 2CQNA 2BHZA 1IUYA 4J9PA 5ETTA 1MNDA 4DN0A 2WY8Q 2RNJA 3LSPA 1QBJA 4V19X 3OHAA 2L9WA 4ED2A 2W7AA 3A4TA 1U1KA 2CPHA 4NLVA 2YWFA 3A3OB 3MECB 3OYAA 3PG9A 2W4DA 2QEXS 2Y8WA 1QTNB 3BR9A 2KG1A 3VWBA 4BWJA 2Z2SB 1SC4B 2CPDA 2GOXB 3DFGA 3PW0A 1Z3YA 3FKJA 3HGGA 5HODA 4OZ2A 1HW1A 2AJ2A 5ETKA 3S93A 1Z4UA 5H20A 2KT3A 4B1RA 2PIIA 3I5UA 4BHPA 5B5EC 1Q8IA 2XAJA 1T38A 1U1LA 2NYXA 3IL2A 1TAQA 5D4SA 1RC9A 5IY5H 4ZYDA 1Y3KA 4JOMA 1HQEA 1OLTA 3DV8A 2L41A 2Z2ZA 3QBCA 2DMTA 4K50A 2E5GA 1N36F 2GHVC 4DPUA 1TVRA 4CM0A 4X4SA 1C0TB 3FVYA 3US5A 2Y30A 4CICA 3H4DA 2VPLA 5T14A 2Z56B 2JVOA 1OCPA 2HDWA 1OCOH 2V63A 1B4SA 4NE9C 2QZ8A 3IAS9 1SFUA 2FSWA 2EBEA 4K4WA 4ALZA 1VK3A 5JVGQ 1U45A 1SUQA 2HOEA 1N5YB 2D45A 1PJ6A 2F5CA 3RZDJ 3PX4A 2QA4S 2YNIB 2DB1A 2W8LA 1YW9A 2VJ4A 5D0RA 4RBOA 1HW5A 2VFVA 4AYBD 5J8FA 2J9EA 5D6GA 5BJRA 2NNYA 1HHSA 2RILA 3FSXA 2D1HA 5J1EB 4IHYA 2IPOB 3MEGB 3I0RA 3CMES 4DPXA 2HVDA 3NBPB 4G1PA 3NXZA 4CCLA 2DTZA 3A8EA 4MIWA 4QYZJ 4AXIA 4DUZJ 4Q45A 2K4BA 3JRAA 3OVAA 1XQIA 1MW7A 3BYRA 3K1PA 3PEJA 1P92A 2LXIA 2DTRA 2VKVA 3U2RA 4ER8A 2WY7Q 3VZIA 5DGAA 3C2PA 3ZTOA 2V1NA 4EQQA 2R7DA 2IMWP 3GXOA 2ECBA 3SXYA 4RPFA 2RGVA 1N78A 3TP3A 3OIQA 1VQ6S 4GYIA 2V79A 2DT7B 3KP7A 4MTEA 2JL9A 2P2CB 4YOEA 2L0KA 3H9GA 3F44A 1WC3A 2FDNA 2O3DA 1U0JA 1IR0A 4DL6A 2IVYA 3MM5A 3ZZ0A 4HTIA 3BQZA 5D5UB 2LEAA 4CO8A 4BL0B 3DYAB 1U2CA 1U7LA 2BW3A 3R7NB 4AVPA 3AJ2A 4Y00A 5EGOB 1V5IB 3PNYA 3FK7A 4F91B 4XLFA 1RA6A 3TVKA 1JXSA 5E79C 2HQNA 3PJRA 4YG2F 1X0FA 3NCPA 3AG4H 5H1SV 3A01B 2LKXA 4BXXJ 4BBSJ 5F0WA 2DMUA 5IOZA 4UY8I 4J37A 4LG0A 4F0HA 4NL5A 2V8DA 3JR9A 1B70B 3QIPB 4M3BA 4RNMA 5LLQA 5J2PA 4KT0C 3SMZA 3DLGB 4UY8T 4XKBA 4MTPA 2J0WA 3D54A 3C2HA 1FOWA 1RWVB 2HOSA 2KXFA 4P9SA 4DSEA 5KFSA 4A8MP 4IR9A 5K8OA 4BS9A 5F9NA 2ICWG 3OFGA 3BO4A 3BH6B 1X2MA 4BC9A 3VAIA 3ABUA 4U0VA 2XPUA 5HVQC 3KYCB 3DHXA 3SXLA 4CXFA 1RHQB 1QLNA 2RV8A 4L9VA 3GIIA 2KXHA 5J2NA 1MBJA 3FMSA 3I9V2 2NVQJ 2XSJB 3PTWA 2HMIB 1G1XA 1K0TA 2HRYA 3ZMDA 2K06A 5K8NA 4S04A 5D4OA 2K9NA 4ZJOA 5J2QA 1ZR4A 1B7FA 4NMLA 2ZD1A 3C6UB 1E3OC 2AYMA 4OAZA 4DMZA 1TFYA 1JNZB 1NSQA 3LALA 2WTFA 2G1HA 4BBRJ 3NAIA 3GZ6A 1IGNA 4LF6J 3DKYA 4C2UA 3SDEB 2R5ZB 3GR0A 1TMMA 1YS6A 4L5EA 2MH2A 1ORKA 1NRKA 3NRVA 1WPKA 2FOKA 2D1VA 1RP5A 3M30A 3TDZC 4DPTA 2FHKA 1DGRM 3JCUC 5JJBA 4ED3A 4ZPDA 1LFUP 2R7XA 4OYZA 3LA7A 3CDHA 1KOOA 4J5OA 1X3WB 3CJ4A 5K7HA 3S3NA 2STWA 3HXLA 4ZLLA 1YJRA 2E7WA 2O7OA 2R0QC 3FZ2A 4IH6A 3VTIA 1AUDA 3THTA 2KISA 4D7NA 3R3TA 4IQMA 1YJ9S 5ILSA 1RAIB 2X6YA 2NXNB 3GX4X 4DFPA 3T1YJ 3PJ9A 1OKRA 2R7OA 4JYKA 4NLDA 3S7RA 2HQGA 4UZBA 4NC6A 1VQYA 2IYGA 4HEA9 3SCLE 3WGIA 2V68A 3ROUA 1E6YA 1ZAOA 1FTRA 1BW5A 3IH4A 2KO1A 2Y3YA 4LF1A 3MUVP 4QWDA 3HFZB 2H1LA 4G65A 1IR1A 2OPQB 4KISA 3AG3H 5DV5A 4OYWA 2W25A 3C8YA 1FK9A 4WCEQ 2KRHA 2CUZA 4F50A 3L2WA 3P96A 4G8XA 1FA0A 4MK9A 2C2EA 2XWXA 3Q23A 1KD1T 2OBPA 1MLAA 5EF6A 4QYZK 2QQ9A 2TCTA 2BE2B 3PJXA 3K4JA 1LVAA 2ZH1A 4NLSA 4CDIA 1HNVA 4EJWA 4L9JA 4Y2MA 1SANA 1FXRA 2WVCA 3T1AA 1Y10A 3M4XA 5F1RA 1DARA 2KH9A 4RBUA 4II2A 1TKXA 4BXUA 3N5FA 3KEOA 2P7CB 3I96A 2NPFA 4G9YA 4I09A 4IHSA 5EUHA 5E8IA 2CDQA 1X9MA 2W1OA 4CO4A 4ZCLA 4O6JA 3DGPA 2L7ZA 4B3OA 3BCAA 1XSVA 2KFZA 4A5NA 1MU2A 4P2MA 2LKPA 1RWXB 3GFYA 2EILH 3U02A 4DR7J 3A1YG 4P6QA 4HF0A 1CVJA 5AJ3F 1GTEA 2HNDA 3CESA 3JRGA 5E5NA 2Y9YA 2QE5A 3KLGA 1KC8T 4OYIA 1FSEA 3Q0AA 4CH7A 4L5JA 4U67Q 2DOEA 1PC4A 1REPC 1SC1B 2MQOA 3OHBA 4ID5B 1JKRC 1E6VA 2HWHA 4FE7A 1VJWA 1O7LA 2WONA 4HI2A 1SVMA 2C3UA 3CCRI 1R0AB 4DYQA 2B9SA 4GMKA 4M5MA 4BHCA 4XNFA 2HBQB 2E71A 1OQ6A 1GDTA 5DDOC 3H5YA 2PG4A 4YR3A 3VAMA 1S9GB 1FJGF 4CYUB 4IFVA 2AYGA 2EK5A 2KL8A 3ITHB 1Q7LB 2HKXA 3JSBA 4D5CA 1R4NB 1OQYA 4BKXA 2JX2A 2V1DA 2RNEA 2EC0A 3BR8A 3CZ6A 1JE8A 1BC8C 1T9UA 2V6AA 2VUMJ 2Y1LB 5F3TA 3M2VA 2B6AB 1UVJA 4HYEA 1K73T 5HMZA 4AYBN 5AT1B 2BVMA 4DNCA 1OPZA 3MKYB 4FBTA 4H4MA 3PFEA 3OSNA 4J9RA 3UVJB 1N32F 3K70C 4LF2A 1XGSA 4Q8EA 5J1UA 1MKMA 1LEAA 4UUSA 1H8AC 5M3MJ 2WBRA 4B9TA 2LQBA 3QPIA 5B0AA 2CWXA 3H36A 3CJ0A 5DQIA 3TANA 1X0PA 1MNEA 3LQVA 3EUNA 3HLUA 1UELB 3GWZA 2R4FA 1SKWA 4NXNF 1IBCB 1FYMA 2P6TA 4M5GA 2V9WA 2VF3A 3P5JA 2BOPA 2AMCB 3LQQA 1LW2B 4ZVPB 4LFCJ 3TNVA 1FDBA 4UV8A 2Z16A 1FD8A 4RB0A 1KTQA 4II3A 1JT6A 2FTRA 1X5TA 3B6CA 3GUDA 5GAEJ 5E3RA 2BOLA 1J5OB 4A5MA 4F4AA 3UNGC 1DLOB 3QT7A 4JI8F 2IEKA 1NK6A 2NS0A 1P6RA 4KT6A 3AQOA 5HJXA 1VQ9I 2MY8A 4WK3A 5F41A 5CVRA 2VHGA 3RPUA 2XYPB 2NOJB 3K4CA 2DXIA 1NK0A 1EETB 1TNTA 4UUTA 3BDEA 2MZTA 2BJ7A 2RDPA 3Q0WA 3DPTA 3E6MA 3CO9A 3P6YC 2PJPA 4WF9Q 1RJJA 5KFRA 4J01A 3HVWA 3CCYA 5HJYA 4OI2A 5GAGU 3ETOA 2ZUGA 2XAUA 5CCLA 2NCKL 5F1JA 3ENAA 3OLBA 2B5JA 1EJ7L 1HF0A 5DCMB 4IZZA 5A0YA 2PX9A 3F73A 2OEKA 4K4YA 3KG1A 3OTEA 4A3FJ 2R4GA 2Y0SA 3Q9VA 2ADCA 4A69C 4FYDA 4HDGA 1RE1B 2QMWA 3QP5A 5KNLA 4JI4J 3CC4I 2DIVA 2ZE2B 3SZGA 1C0UB 5DDPC 4O4GA 1FMVA 2V4JB 4ON0A 3BQ1A 4A8SA 3PXGa 2MMYA 1I5ZA 4Y52J 1UVIA 1FXLA 4XQFA 2M2BA 1G3SA 1J75A 4XORA 4ZVEA 4DU7A 2KM8C 3KUEA 4M72A 4NLYA 5FKNA 1DBDA 2MGZA 3TZZA 4NZ0A 1W4MA 1CGPA 4HDHA 2M5YA 4OV6A 5E3PA 1S1WA 1QAXA 2XM3A 5FFXA 3L09A 1USTA 1HSTA 5J8CA 5A2QK 4FBUA 2HW3A 5HDKA 1W0UA 2MKCA 1IWAA 4WYLA 2DR7A 2EV6A 1LK7A 2CW7A 1B64A 1KVKA 1IDYA 3E01B 2NPIA 3LPYA 3VPRA 2CQXA 3ABTA 1KEKA 4HF1A 2WW8A 2JVRA 1JKOC 2LKSA 4DSLA 4HX7A 4IXAA 1S9EB 3WG7H 3E5UA 5A76A 3QGGA 2E9RX 4DJAA 1NG7A 4NPOA 4N76A 1WH7A 4RLFA 3V7RA 3C16B 1W7PB 4BHBA 3LMMA 2GXGA 3H25A 1UKUA 3GBGA 4DL3A 2BANB 5A2QZ 1O3QA 2CYYA 3RBXA 4DV2J 3ZZPA 3BSAA 2XF6A 4BC7A 4HDVA 3D3CJ 2KRRA 2W82A 4IHTA 5A6WA 3CCZA 3PHTA 1UWBB 3C1DA 3PO5A 4Y2IA 5E7OB 1P2FA 5KCMA 2EFPA 1VBKA 1E17A 4I2QB 3HBLA 4ZVQB 3JS9A 1UVMA 1UZDA 4KYZA 4KITB 5IT9K 1A04A 2KJBA 4I69A 4IJAA 5EX3A 5M2RA 2PFBA 4A8YA 2MQNA 2W4SA 3QFWA 4IQJA 4GO5X 5DTDA 2DY1A 5DYMA 1UL3A 1T9VA 3NEKA 1M5OC 4P71A 3LO3A 2DR5A 4IO9F 4NHJA 2QL5B 2DGSA 1VHIA 3I4PA 3S1TA 1UHWA 2QBYB 1I6HJ 7FD1A 2LQ9A 2QLWA 4EGLA 1IXCA 2M8HA 2YX4A 5EWEA 4ZC3A 4JBAA 4AUXA 2AJ4A 2FUG2 2P8IA 1RT7B 1NAQA 2EW9A 2CJKA 1MN7A 3M8QA 3NRBA 4FISA 5HSPA 4XK4A 3OS1A 1HW8A 3AAWB 2DOAA 1WJEA 2HZAA 1J0RA 1U8BA 1CJVA 5ETPA 4OJGA 5KFDA 1KKHA 3CSKA 3NP5A 3ZN0A 4JI1J 4L76A 4KRWA 1H7WA 3W7BA 4I0BA 4A3CJ 2F5GA 2HIQA 1PSDA 5IT9Z 1U09A 2IM1A 2FGCA 3DOKB 4ZIWA 2H09A 2YH1A 1EQ0A 1W7PD 3CJNA 3U7JA 4LG3A 1XGMA 4B3XA 2DPUA 2W9BA 3JRIA 3BG7A 3KNAA 4ECXA 1NJWA 3ML6A 5KK1A 3BS9A 4IG0B 2GO8A 4O5VA 3H4BA 2GX8A 1RTZA 3ENQA 2GJ2A 2Y1RI 2UUBF 2GV1A 2UXNA 3BO2A 4JV1A 3QIDA 3G73A 3C18A 4JI5J 2RDIA 4X62F 4O3PA 3H3ZA 2J0QD 4JYAF 2PJRB 1PAUB 3OR2A 1MJ9A 3D0IE 3RR8A 1NM2A 2I38A 3GCMA 3D0GE 2V8GA 1Z9CA 2K3PA 3D0SA 3OFFA 4F26A 5ICFA 1FNOA 2RQMA 4Z7YA 3W9JA 4OOIA 4M5NA 1UFMA 4KIBA 1GQEA 4HH0A 3CMEI 1SV5A 3AOCA 2FYXA 1Z21A 3CMYA 5IZHA 5HOOA 1HBNB 2X1FA 1RTHA 2H1YA 2EFNA 3PW4A 1T95A 2GM4A 1UJ4A 2JLEA 4EGZA 1SL0A 1Z77A 4DR6J 5E3QA 4UNOA 4M6YA 3DRRA 5A2QU 3GJTB 3GTKJ 2KQRA 3VAHA 5CXTA 3DU6A 1NSPA 5E3LA 1R43A 2V2ZA 2DO0A 1PBUA 3LAMA 3JXOA 1OIAA 2X48A 3HYIA 1WFXA 5J4VA 1VQ6I 3HPOA 4ITSA 2RS8A 1W5CC 1P8GA 3TAMA 3CD7A 3TVZA 2VU5A 2UXDJ 4WFZA 2E1MB 1SEUA 1VQMS 1IXKA 3HPHA 5GAGI 4IVNA 3DLLF 4EMDA 3BBFA 2EBGA 2Q79A 3GG1A 3FEZA 4RU2A 4U87A 3WU1B 2JQ7A 1CG2A 4XLPF 4ZVOB 3CCQS 3PNIA 2RIJA 4NCGB 2XO7A 4YY3J 2ID6A 5BOXA 3DN9A 3F23A 2IRUA 3FMBA 1IKWA 4BDPA 5ETMA 2E9TA 1M0SA 4C8LA 3JAMU 2CH0A 2I5JB 4ZP9A 1YW7A 1GX6A 4N4NB 3IRWP 4PWDB 4M63A 2LU1A 4LB6B 5LRSA 3EGZA 2IAJB 5HLHA 2R7UA 3QQAA 3IKTA 1YO5C 1D8JA 1MMNA 3LAPA 3AJDA 3CE8A 3W5XA 5C7PA 2ALZA 1HYSA 3CW2C 4KGKA 4DLEA 2YWKA 3SQGB 3KHLA 1ICEB 1OJ4A 1UETA 5EX0A 4ANEA 5IT9U 2VH7A 3PACA 2I0XA 4HI1A 1RUSA 4B4CA 4HNUA 1GMWD 2Z2LA 2J8AA 4W92B 3FDYA 3IWZA 1NSKL 5M3FJ 3ENVA 2ZBIA 2JPBA 2O67A 4Y2KA 4D3HA 5LHHA 4CO2A 4YMEA 2VFSA 4ATNA 2L3DA 1UFWA 3BC8A 1RABB 5GP9A 3G3ZA 4F2SA 2EC2A 1QZZA 3HOYJ 2DQRA 5GADJ 3K8VA 1VQ4I 1NH3A 1XIQA 1VC5A 3KK1B 3AY0A 4XRFA 4N9IA 4DBRA 4DL4A 2N7YA 3MZYA 2MB0B 3ICLA 1PDNC 5GAEU 3M9MB 4DF8A 4HHHA 4ZLPA 3MF5A 2Y1IA 1T33A 1EH8A 4NA1A 3A3PB 2Q2EA 1FEEA 2HTSA 2VBYA 2PLYA 1Y9OA 3R1LA 3LWMA 4WZMA 3X3UA 2QSWA 3RW7A 1WJDA 4R0JA 3R9LA 1KQFB 1VQ8S 2RQQA 3N28A 2XPWA 4JI0J 3V81A 1IBMJ 2BE7D 4MIMA 1OMIA 4E7JA 1KU7A 1YJ9I 2LY1A 2M4MA 2IIHA 5ETNA 2IS6A 2WAFA 1GXLA 4D0PA 3D28A 5FKLA 2ZNZA 3AXMA 2G0IA 4PQUB 1WOPA 5KFOA 3HHGA 4P7TA 2HZCA 3ZQLA 4BUPA 1WOOA 5B66C 3H5NA 4IF4A 2F4FA 1BY9A 2ZFHA 1RR8C 1RHJB 3IWFA 5GMDA 2VG7A 3KLEA 3I31A 2YWWA 2CSOA 2F3JA 3MOZA 1ZM4A 4ZVRB 1F9EB 1SD7A 3RKQA 1IBLJ 4I6YA 3ERED 1BMQB 1H2UX 2C3MA 1QE1A 4ZITA 1RT4B 5L1JA 1BQNB 4ETXA 1RU2A 2HLUA 1ZZNA 1O7FA 2ESHA 5KFGA 2Y1JA 4HV6A 1DP7P 3AXKA 2J5AA 3GW2A 3IGNA 1LE8A 4ZHRA 2DA4A 2R92J 4V2GA 3Q3SA 3O3KA 2DITA 1I1SA 3UR0A 3QATA 2Z1DA 1RLCL 2ZMEC 4ZPCA 1DHMA 3PEHA 2EK1A 5D78A 2H51B 2MLYA 2Y69H 3ABMH 2FQQB 2P4WA 4EM2A 5C25A 3PO4A 2XAGA 3CCVI 5E2QA 2V26A 4BLGA 1JX4A 4U7UD 4F4XA 2UXBF 4N41A 2AIRB 3FKIJ 4RS8A 1RWKB 5F64A 2H8WA 1RWNB 4GKKJ 1WSVA 4JX5A 3M7VA 4MYUA 1YBTA 2HFSA 3HSDA 2GNKA 3EGWB 1WWHA 2DHAA 2E66A 2IHR1 1D09B 2KIUA 4XPEA 3M1VB 5F27A 3E6CC 2O61A 4WXWA 1NO8A 4LK1F 1S7EA 3EJMA 1CJKA 2RAEA 5KG1A 4C3IJ 1T03A 1UEKA 4XIUA 5JI6A 5T41A 1RCXB 2ZVIA 1KQ8A 2QLXA 2G0JA 3TEHB 1TP4A 2B4VA 4NRTA 5D4LA 2YU3A 1S77D 2G2YA 3RG6A 3TO8A 3U21A 4ENOA 1U0HB 2OHDA 1I3QJ 1X9SA 5KOXA 3PR4A 1YRTA 5IWAF 1YHQS 2XSDC 4XRMA 2WSFC 2LCWA 3DBLB 4HYKA 2C2DA 2CPIA 5HROA 4QW9A 3W6JB 5HNFA 1WJ5A 1V3FA 3ENWA 2W9CA 2X0LA 1U48A 4C8NA 2LLZA 4X65F 4OI1A 1M5PC 2STTA 1D1BA 1TL4A 4A6DA 1N5SA 4ZIVA 3DTKA 4A4JA 2VG5A 3O1LA 2IS2A 2R8HA 3WGHA 4M3DA 4UOFA 3D1NI 1IAWA 5FRMA 2KRBA 1YQHA 4ZKAA 2A6OA 3W3SA 4B44A 4Q5VA 1YRNA 3QMQA 3VAFA 2DLLA 1S7AA 4C2MA 3F8NA 2V4QA 1Y6IA 1HQUB 3G2BA 3T0YA 2M45A 1S7IA 1FY7A 4E0DA 2M2EA 4QW8A 1NJIT 2OU2A 4DV4J 5L3GA 2MKJA 4JI7J 4YRVA 2D69A 2RC4A 4MTDA 2CNOB 3K5PA 1TT0A 1QU3A 5LHIA 1TK5A 2E44A 2N7CA 1QAJA 3ADAC 3IR6B 1IN4A 4BY1J 1CULA 2QUFA 4KMUX 2LF7A 2VC1A 4F2RA 2NS8A 3CMQA 1YWXA 3PJWA 3E5QA 4ENNA 3HHLB 1VISA 3S01A 2OPRA 3VWSA 5KG7A 3GE9A 1IDZA 3FFIA 3EMTA 3PHEA 3K5LA 3HFKA 2GVZB 2YWHA 4ELUA 2YKNB 3AA9A 3RR7A 2G13A 3E3VA 1Q1KA 3R0AA 1FKPB 1W25A 4CCOA 1YJNI 2PO4A 2XI2A 4MFBB 4KHPF 3MEXA 4KJZA 2UV8G 3EYZA 4DYCA 2HQFA 1QPMA 4B47A 3JSPA 3IBCB 5J1YA 4B9NA 5L8RC 2MQ8A 3PDNA 4J90A 4DX8H 1HWKA 2PQ8A 2KIFA 1JLBB 3CULA 1L0OC 5CYJA 1M5VC 2DGTA 4HH1A 5C4XJ 5HVFA 1G7CB 6PAXA 2ZOMA 5GAEI 5KFHA 4BQOA 4W1UA 3MR2A 4DL2A 3RYRA 3H90A 4LFUA 4M5DB 4GFBA 4LBIA 2QM3A 1C4CA 1BUXA 5TJJA 1FWPA 3ZNJ1 4HDUA 1WJCA 2NS1B 1ETYA 5A8KA 4URQU 4M3EA 2CMPA 3HB9A 2R9LA 2ESNA 2D3OR 1HNZF 1LQ1A 1D0YA 2DO7A 1YZ7A 5HLFB 4NZ7A 2I2YA 2V69A 1F9HA 4OIOF 5F0FA 2WSCC 3EXYA 1REVA 3V8KA 3K1NA 4J9UE 3HM5A 3HHLD 1AW0A 3OV7A 5L3DA 1F1ZA 2ZO4A 4OLPA 1N4LA 3GILA 3AD7C 1BE4A 4ECZA 2BE9B 2BGCA 4X64J 4OJ1A 1TWCJ 3F8CA 2PMZA 3BG3A 3JSYA 2XMKA 1XCBA 3I56S 3H40A 2J6UA 3RTVA 5HP1B 2EI5A 1NK5A 2BACA 5LOQA 1BN5A 4ECTA 4JI2J 5D4NA 4R8UB 5KFZA 2F65A 3UN5A 1KRPA 3H5UA 3WE2A 2QLFB 2EXUA 4BH9A 3S15J 1HPZB 3DWLE 4MKBA 3D1OA 4DV7J 1YJ7A 3TARA 3BR0A 2HGMA 4QIEA 3EGVA 3OR2C 4OZNA 2L7FP 2EG2A 3NS5A 2H65B 1YIOA 2KXNB 3K58A 2OPSA 2QF7A 3PUFA 1O51A 2YU9J 2Z99A 1BI3A 2JDJA 3ZQIA 3R7BB 4F36A 1AOYA 3VF0B 1RT2B 5GADU 1OPCA 3OBIA 3QYYA 3QWLA 3FXJA 3E8OA 5IT0A 4Q0BB 1Z05A 4BDZA 2P6SA 3BJYA 2UVWA 3MM7A 2JOQA 5BMZA 3CQZJ 5FROA 1YGYA 4X4VA 2CS3A 2GS8A 3KHHA 1XCVA 5KFAA 2DHXA 2LDUA 1BA5A 3NAUA 4DV0J 4EJUA 4CCJA 1NHAA 4RA2A 3W64A 4RX6A 3MECA 1TP7A 3NOCA 1AKHA 2DXDA 3MR3A 4ELVA 3L2RA 3QYEA 1AZSB 4UV9A 3IHUA 1SJQA 2LXFA 2QENA 1KLMB 2GA7A 4DR5F 3N5BA 1S9FA 2D1CA 2MPUA 3L1PA 1MBGA 1NBEB 3BB5A 4R79A 3ZPLA 4YEJA 2XHKA 3MZIA 2VQGA 4XSZF 2NQPA 1YW8A 4K8RA 4C97A 4PYDA 2GFFA 1MMGA 4ESJA 3IS9A 2MABA 5DD4A 3ULQB 2Y9ZA 3QT8A 1RT3A 2XNQA 1SAXA 4IUFA 1Q8LA 4YR0A 3V4IA 2H4YB 3LPEA 1DDNA 4ZMMA 3ZMZA 4W4MA 4ZCIA 1MJAA 1TWFJ 3L2QA 2VOOA 2E1RA 4QU7A 4PG8A 1XNRJ 2Z58B 4TQSA 2MQPA 2FRHA 2LXUA 2ZC3A 1X4BA 4AIJA 5G4DA 4CHUA 3I9V9 3BLYA 1DRZA 1HNWF 5L9NA 4HHUA 4C9DA 4RW6A 3B6BA 4E8UA 1QO0D 2B56A 4IO1A 3H0GJ 3CCLI 3QFHA 3OOUA 1UAAA 1N36J 2NOGA 2YKPA 3HSFA 3J7AO 3A8IA 5AXKA 4BJ6C 3M9AA 4EMSA 1Z7LA 2UUAJ 2FMLA 4LBPA 1QUPA 2VXDA 4C2MJ 2NVUB 3QJJA 2DH9A 2DNLA 1OCTC 1X5OA 3ZCOA 2IDEA 4FTHA 3IG1A 3E6DA 4ZA1A 5JVHQ 2VBWA 3J81j 3QJLA 2Z33A 3L7PA 4Y4RA 2ZKUA 1T05B 1TV6B 4K59A 3LA3A 2FOWA 1UEVA 1Y1VJ 3VYSB 2E34A 3EVWA 3D67A 2MKIA 5DO2A 5LRRA 3RDIA 1MMLA 2XC9A 4MO7A 1WC6A 1HA8A 1MSWD 3QO9A 3KFWX 2OPTA 4I6AA 3IC1A 3KWMA 2YWGA 4NI2A 2HPIA 1ZA1B 3ISPA 3TUZC 1SJFA 4JV5F 3DCFA 3MAJA 3V7CA 1N33J 2JUCA 1XD7A 3FWEA 3GTGJ 2VD3A 2Q1LA 1N8RT 3HD1A 3CJRA 3MMAA 5IM0A 3EUHA 5KG5A 3BR5A 1OY8A 2VQLA 1ZPVA 3QSYB 1G3OA 2DI3A 3BZQA 2BKOA 1LWEA 3S8PA 2KFYA 2F9JA 5HQLA 2G7HA 2L9DA 2ADBA 4ZH4F 1OQ3A 1RACB 3CCES 2FJDB 4IO9Q 4N7TA 1C2PA 1IN5A 2CNLB 2MSYA 1SD6A 2VPXB 2B9XA 5EGOA 4X1EA 1WG4A 3IO1A 4CLSA 1FOXA 1U2RA 3U1MA 4XLHA 2AYEA 2ZBKA 2KRCA 1RT5A 3QAEA 4PQAA 5J1NA 1NH8A 1MSFC 1XC9A 3SFUA 1U8RA 2CPEA 1EARA 2HK3A 3A01A 3DKDA 2MDAA 1FZPB 1S4EA 4NA3A 4QU6A 4KV8B 3TO6A 2EG1A 1DPRA 3T8TA 3CVKA 3FUYA 2O8XA 4YIIA 3MR7A 3QIPA 1QQIA 1WJAA 4RO0A 3CUNA 3TA1A 2XF5A 2GQCA 3DLGA 2J7UA 2X1AA 4RR5A 3B82A 2HNZA 3CCJS 3PRDA 2F2EA 1VRUB 3M05A 3TW0A 1SI9A 5IP6A 1HKAA 4X4OA 1OMSA 3F8MA 5B0CA 3RKWA 1Y4ZB 2HVQA 4CDGA 4P75A 1HBUB 2DT5A 1YS7A 3S2DJ 1MG7A 1P7JA 4M3FA 3P45B 3MWMA 2K9MA 4I76A 1QAYA 1BM9A 2QGFB 4DW6A 2B7EA 4JV2A 3H2VE 2CJYB 1RT1A 1RAEB 3SZTA 3RAQA 1BGXT 2L3MA 1UJ5A 4OYXA 2XV4S 5EDNA 1O8BA 1IWGA 4OZLA 4RAYA 2Q1ZB 1FYKA 1B8IB 1X1DA 3R97A 4X66F 1X4GA 4WYWA 2OFHX 4ED1A 4C2TA 1T56A 1W0TA 4R0EA 5HO4A 1FOKA 3JRHA 3K5NA 3DRSB 4ZPVR 2NXJA 4PPZA 1EF4A 5CD4H 4AQYJ 2HHHJ 2VZ9A 4WX9A 3HPGA 1NPKA 2FLLA 3BPSP 2W7PA 1FNXH 3LH2S 5FGMA 4EEFG 2HVRA 4LJMA 5C24B 1Q78A 1D0XA 3RI4A 3HOXJ 1GT0C 2IY5B 4CYCB 1U6ZA 3BGFA 3SDEA 5KT6A 3WTUC 4OYBA 1T08B 1IN0A 2KKOA 1JJ6C 1WELA 4XDCA 1Q0NA 2W4PA 2JFKA 2FY8A 2HS0A 2H1KA 1OYYA 4LIWA 4S0HB 5DG9A 2MSSA 3OTOF 4XR6A 3QLHA 1HI1A 5F6FA 4ED6A 4HHJA 4Z2YA 4U6PA 2GQ2A 2NSCA 1IRZA 5GADI 4J9NA 2IGNA 3N05A 4M1KA 3A2KA 2XPVA 2HNYA 2FVQA 4KYWA 4EO6A 2J7WA 5HS9A 4G94A 4BCAA 1G2EA 1Q5YA 5KFQA 3CDBA 1DTQA 3KP5A 3FRYA 4XLCA 2DNMA 2WBMA 1OYWA 3LP1B 1B9NA 4HNTA 3G71I 3SSRA 2DFIA 4A3JJ 3Q83A 4IRIA 4OZ1A 2BA9A 2FGOA 3CEDA 1ZM9A 1YSJA 3DLLQ 1KS2A 4FNIA 1P1LA 1ZS6A 5AIPA 1LDDA 1G8XA 2OPQA 1J5EF 3HOVJ 2OSRA 4ZDNA 2GXBA 3VGTA 2BW2A 3I5CA 2RUSA 1XSXA 4EZ6A 3W62A 4MKAA 1HD0A 2YQ3A 1BLUA 1WHWA 1NJXA 3O2IA 2QFIA 1YX2A 1LOUA 1BQXA 3HIFA 2MKYA 2Y9HA 1ACIA 3R5GA 1K79A 5FJ8J 4N47A 1I94F 1S6LA 4A12A 2VA2A 2B9EA 2VJVA 4BEHA 1RQ0A 1TL7A 2E5LJ 3HKZD 1K1QA 3FMQA 3PO3J 1S1VA 2OP5A 2CQ1A 3P9KA 5D77A 3DDKA 3FCVA 4MH8A 1H2VZ 1S72S 3QRFF 3S3OA 1P27B 4WXCA 4K4XA 2BJ9A 4OQJA 1H9TA 2WVEA 3QPHA 1OISA 2CKWA 4MYTA 3KMSA 1RNLA 5FLMJ 1R7JA 4QTRA 5B3SH 3WTVC 4E7IA 2RQ4A 5M2PA 1WC0A 4DUYJ 4DV6F 4DQQA 3CO0P 1UG2A 1N54B 4RBVA 2JWTA 2V8VA 2DA3A 4O44B 5BYQA 3WHIA 5AJ3J 2PEXA 3Q8VA 3W5YA 4O0IA 3GFZA 2BEFA 4I68A 2XCAA 3MFIA 1G3WA 2P5KA 2X7IA 3GTQJ 3AT1B 3G1LA 4YFXF 4OIRF 1X5PA 2GJIA 3GMGA 3BTJA 4FF2A 2A18A 1MMAA 2EPFA 5HDNA 2ZC4A 4CO0A 3G6VA 3HG9A 4KIGA 5AXMA 1BXNA 4TYBA 3MZHA 2FHMA 1GHCA 2ROGA 4TQRA 4IH5A 2NNNA 3OMYA 1ULRA 3TI0A 4ID8A 3M6VA 4N5SA 3N4MA 3R6GB 1YE9A 2DBBA 3CCMI 5EEAA 1X4OA 2O01C 1KNZA 1FJGJ 1QGPA 1TWGJ 3NMAA 1IV6A 2PA8D 2HHQA 3D5RC 3HX9A 3FK4A 2FQ4A 1JLQA 3LOUA 2UXXA 2DCEA 4EU0A 2KT0A 1H38A 2RT3A 3FIWA 3N6NA 2D3UA 4PXEA 4RGUA 1HC8A 2ZBQA 2L02A 5FB2A 2XY6A 4Y13A 1QVFR 3UDCA 1SVLA 1BQMB 3OL3A 4M95A 2VJJA 3COAC 2LMIA 3HVTB 3OXLA 4U7UK 3M8PB 4RW9B 1N32J 4ZP8A 2DMPA 4DR2F 3N01A 4MJKA 3ISZA 2ZM6F 5TISC 1LW2A 3KZIC 2GIFA 1Q4RA 2EWHA 2G1DA 2MXYA 4AL6A 3DKXA 1T98A 1VQ5S 4ECUA 1ZG3A 3BTLA 1SFOJ 3M07A 2E35A 1Y3JA 4NXNJ 2CQ2A 4DR4F 1MSEC 3G4SI 1P6TA 1H98A 1NK7A 3TP0A 1FKOA 3HF5A 1G3YA 2PC6A 3CF5Q 5BYRA 3JRBA 4JB8B 3JYTA 1D5VA 3RBDA 4FPRA 4RLQA 1JHFA 2AKWB 3W6VA 1UP1A 2X51A 1CF7A 2CQBA 2OF7A 5LGNA 2B8QA 4WFYA 1G4CA 2WW4A 2V94A 4WFXA 1SD4A 1U1NA 4JI8J 4KJIA 2A68F 2ERRA 2Z3YA 2AJQA 1L3SA 1YTYA 2HWVA 2OO4A 5BR8J 2YKQA 4IG3A 3SSSA 2A69F 2FUG9 3PKMA 1Y8RB 2YQ1A 4JX6A 2AGQA 4IHXA 5LMNF 4RUCA 1TUWA 5EDWA 3OYEA 2CJ9A 3CP2A 4QQBA 4FN5A 3QP6A 2GIQA 5FRNA 3D4JA 1GK8A 3QU6A 3FM3A 5LBQA 3WC0A 2ZZTA 4J19A 2IC3B 1RADB 3SIPB 1IKXB 3LSMA 2FLOA 1J2XA 1XS9A 4CO5A 2WCXA 3P5TL 2XF7A 1C0UA 3BJAA 4H4KC 4A3MJ 1GXPA 5IQ6A 1ONVA 3IR5B 3K4BA 3SQOP 3K8WA 4F0KA 5BNGA 4W97A 3Q8PB 3R0JA 2N82B 2VA3A 1C1BB 1Q53A 2XS5A 2LMDA 1IR2A 2DK5A 4HW0A 4F3OA 2KIQA 3GFMA 3ZZRA 1NHUA 4Y17A 3BF4A 4G7OF 4B3MJ 4Q47A 1GH8A 1W36D 4F02A 3K89A 3KTQA 1RYRA 1RBLA 3LSKA 4F55A 1XERA 3HFVA 1BJAA 4RB1A 4NLGA 3HO1A 3X1LB 4LRBA 2GAUA 3GZNB 2E1AA 4ANJA 3FRZA 2BYVE 4NQWB 1Y7PA 2ZXIA 3Q8QB 2CG8A 4FE4A 1QSSA 4N0BA 5C2CA 2EKNA 2ZXWH 2EJRA 3QAUA 2GGPA 3OYHA 1QRYA 3D5SC 2BM1A 3BEGB 4Y6IA 1FI4A 2JA7J 3JTOA 3CCUI 4OX7A 3CPWR 1VQNS 2PSZA 2L2OA 2BDPA 4K0KF 1ZPWX 3KYLA 2HHPA 2ZDPA 4GRSA 4BQNA 4V1Ak 4QWCA 3C16A 3H5XA 1X4FA 2E1PA 1G4DA 2K9QA 4PGHA 4C30A 5EG0B 3FDSA 1S12A 2BANA 5F9LA 4PWUA 1FESA 4I2PB 1D8YA 5C5JA 4ENMA 3D1QA 4ICLA 1JQGA 3WX4A 2QA2A 4CM2A 1S1XB 2BE5F 2ZKTA 3MAAA 2VFRA 2ALYB 3A1YA 3GG0A 3WIVA 2DNGA 3FGVA 4C7QA 5IC6B 3LFKA 5K9FA 5CYMB 2MEWA 4FXWA 3L00A 2OV7A 3WU2C 1F6TA 3DM2A 1HBMB 3VFZA 1TKZB 1B3TA 2P5LC 3N0VA 3TUPA 3W2VB 1VC0A 2JJ7A 5J2MA 4XPCA 2DPDA 4LF9F 4FXVA 3PRVA 3R4KA 2R5YB 1L5UA 3MCNA 1Q8BA 4LF5F 3CDUA 4RL1A 1YI2S 5HMYA 3DLKB 4HQMA 3TOAA 3AJ1A 3OD2A 3J7ZI 1YJTA 1S6OA 3H2LA 1DU6A 3R2CJ 4Y2CA 4NUBA 1UHMA 3TEDA 3NGUA 3HKZN 3T6JA 5EGYA 3J7ZT 2KP6A 3NQOA 1FO1A 4NCAA 4C3JJ 4M9ZA 2FY1A 3F3XA 2ASLA 2WSEC 5B0BA 5M5YJ 4CLZA 2IM3A 2XCPA 2R2SA 1WGXA 1SJ1A 3EUKL 3KJVA 3BR1A 4DCPB 4N8NA 4OX9J 2ASYA 2DCLA 1YG0A 3VSKA 2COLA 2DRBA 4IDKA 2CG4A 2O5DA 2LQ5A 4ZN3A 1B72B 2VE8A 2ZFWA 4WBFA 4Q4ZF 4NEZA 2LEBA 4EJVA 3WHCA 3QGHA 2X6OA 4ZLNA 4NNJA 2LBFB 1RRJA 2VQFF 1YG2A 3TQ1A 3MCOA 1UVNA 5TRDA 1R1UA 3SEZA 3ET6B 3GWCA 3HEFA 3IFEA 2LK2A 1IUFA 3MGJA 1S1UB 4OZ0A 2W9AA 1IW7F 2B4OA 4B3RJ 1H6KX 3CJSA 1UG0A 3PR5B 4YDDB 2ZJQF 1AFJA 2XRNA 5M2UA 3NNCA 1ZAVA 2PJRA 3TW7A 3MMBA 4RZRA 4ED0A 3MM9A 1FP1D 3C14A 4FHTA 1ZQ3P 1OJLA 4WTYA 5IC4B 2EV5A 1VK8A 4ZN1A 2QT7A 4MNUA 2OELA 1U25A 3BBCA 3ZTRA 4QPXA 1XNQF 5LXYA 2LVSA 3K70D 4ZZLA 1R8PA 4BE0A 1RWMB 1DQUA 2EZHA 1RAFB 4AL7A 3GYNA 1HNXJ 4B3TF 3X2QH 4KHRA 3VHQA 2O9LA 2ZZMA 3OYIA 4Z7CA 1LKXA 2BZ2A 4LF8F 4USIA 3FZBA 5K20B 4PG6A 1G3TA 2BJEA 3FMWA 4EM1A 1R6YA 2RRAA 2FVSA 5AIQA 1T6SA 3VYRB 5CYQB 3ZZUA 2BUNA 5ADZA 4RW4A 4FXDA 4EV0A 2VXZA 3N97A 2XTJP 3FK6A 5I3QA 3NNAA 4A8FA 1HQCA 3BROA 2XMVA 2GCFA 1U3EM 5T7LA 4FVMA 2VKHA 1PYOB 2I10A 3OYBA 1M5KC 3ZP5A 3CCEI 1TKTA 5I3UA 4LLNA 2MZQA 1TVRB 5HBMA 3JRCA 3GV5B 1HKQA 2H5EA 4JOUA 2VT3A 1D0EA 4NCGA 2TDXA 2OI2A 1IVZA 4L72B 5D5WB 4BGDA 1HOMA 3G6ES 5KFNA 2AXTC 2DEIA 5EHHA 4M5KA 2C1EB 2WVBA 4G1IA 3H5AA 4XTTA 2KHCA 3ZZZA 1XC5A 1K6OA 1KP6A 4URSA 3DDNA 1AA7A 5DG8A 3I5AA 3NS7B 3A0BC 2WAQD 1WZ2A 1SUQB 2Y2ZA 1T3OA 5KFUA 4MQVA 3CCJI 3JQJA 2JRMA 4QZVB 3UWTA 4PEOA 4LQ3A 2JVGA 2MKHA 4DUZF 3I55I 1PKUA 4OHXA 5LGTA 3KK3A 1TW3A 2XS2A 1XN9A 2HQDA 1DTTA 2G9OA 5ETLA 1BD6A 1V5GA 2IPQX 3I0RB 2YQ0A 2YTCA 2K9LA 2QX0A 3AG1H 4S05A 3KJFB 1F2GA 2PE8A 3MEEB 4KGMA 1APSA 1JMTA 2DH7A 1N52B 1SBRA 3V6JA 4LRDA 1SFKA 2QLZA 2F9DA 1QVTA 3HSZA 5DZ7A 1JB0C 3JSRA 2L9SA 3ZXSA 4QIGA 4RMNA 1Z6RA 1ELOA 5K5MA 2AQ4A 2HEOA 2F4OB 1HCRA 3DLHA 2G4BA 2D7SA 3IRXA 4P52A 4OJ3A 2MHEA 1JWWA 1NPRA 3TYTA 1T9TA 3BSCA 2ZFUA 1XX5A 1WF0A 2IBDA 4C3HJ 4OYMA 3W61A 4UQGA 1V5EA 2A5WA 4ZTFA 2KJWA 4P9FA 2ASDA 2HRTA 1F0XA 2BW3B 3HSJA 4BYYA 4F8RA 1V9OA 4DPWA 1ERDA 2RKIA 1SCJB 1UWAA 3CC2S 1Z91A 1HXDA 1CPZA 2ELKA 2QQ8A 1BIBA 3IR7B 1LXJA 5IYDJ 5KFVA 4A8KA 1UTAA 2BV6A 5LL6d 1GV5A 3GSDA 2XHCA 1Y8QB 4FPIA 5J2PB 5F8IA 3PM1A 4I56A 1ZTWA 4PJNA 2IS1A 2I6WA 2WVFA 1VQKS 1WWXA 1MMDA 1VQOI 1V5FA 2KMUA 1X9WA 3DBHB 1SKRA 4RDUA 4LR7A 3HHEA 2NVTJ 1SC6A 4F25A 5F8LA 2O8KA 3NAHA 2HWIA 3FEXB 2EPIA 1RDRA 3B02A 3O8HA 3TJ9A 2DA6A 4DDFA 2VJIA 4YN3B 2EA2A 5J2NB 3HKWA 3K0LA 2HVEA 2FF4A 2BY0A 2KYZA 2FX0A 2PBIA 4TNOA 5FKMA 1RT4A 1B59A 4LF6F 5J2QB 2K8GA 3Q5FA 1W2IA 3CDLA 3IAS2 4L0YB 2ZD1B 3BWGA 1ETVA 1TU0B 4ZYEA 2X6XA 1S7HA 3AFGA 1NH7A 4X4NA 3MMJA 3FBIB 3SJMA 3AOAA 4HNVA 3K69A 1J09A 1CQMA 3PM9A 4WU3A 3HSEA 2BVLA 2CQ4A 4N9HA 4U9RA 3K6GA 2OKQA 1ZGAA 3TJAA 3M30B 9ANTA 1N0VC 1N77A 1QY7A 3HOZJ 4Y34A 3RUBL 2DJNA 4DN9A 4Q5SF 5F0UA 1X31C 1OFCX 2DYSH 4PSXA 2DY9A 3BPXA 5GTIC 3EICA 2H48B 3KLVA 4RAZA 1FWZA 2VC0A 1IXRC 5KT2A 4NYOA 3TA2A 1G59A 2CO5A 1KQ0A 1R27B 2IM2A 4NWBA 1IM6A 5D15A 2FBHA 2GOMA 4XONA 3ELHA 3OUYA 1E6YB 3ZQQA 1CQNA 2VFUA 1S6QA 1RI7A 3LTOA 4HLBA 3IBWA 3Q22A 1ITPA 4FF4A 4WIIA 3L7OA 3RRHA 5JHFA 5E18F 4YELA 3VOEA 4K2JA 1FRIA 4QR0A 3LP0A 1JKHA 3G86A 3QT6A 4QLCU 3FKBA 4IFYA 4MFDA 1BHNA 2QA1A 5EZHA 4XO0A 4HACB 5EZGA 1HNVB 2XB0X 3VVUA 9RUBA 3CTAA 2ZHBA 1FX4A 1K44A 2V4JC 5IOLA 4CIOA 2K7JA 2WWYA 1TZ0A 2JZYA 4I4BA 2E1OA 1FPQA 4EJOA 2J6SA 2ME0A 3BT9A 3E5XA 2OH2A 3FXRA 4ZTJA 1E3PA 2HVHA 2PN6A 4XKWA 3T19A 1TKXB 4BE1A 3CC7S 5LEKA 1D1CA 3DGPB 5D4PA 2HQRA 3K7AJ 4B3OB 4M94A 1QSLA 1MU2B 3TA0A 1B0TA 4DR1J 4F4ZA 3OL4A 2V67A 4UW2A 2XB5A 3SV3A 5HVGA 2IW5A 2HNDB 3GYGA 1VQ5I 1DJ0A 4XLEA 2FZKB 3I0TA 1GTHA 2ACMA 4USJC 3KLGB 2C2NA 2HHUA 2OZ6A 3D7SB 1CJTA 2KT5A 2A5YB 2HVSA 4ZPAA 2ZH9A 4E7ZA 1LQ9A 1JLEA 1OO0B 2HG4A 5E3NA 2WONB 3NGTA 2YNGB 3PFIA 1IQTA 2ILZA 2J76E 4FVCA 2YXLA 2VJUA 3FZVA 1F4KA 2L48A 4RNNA 1HARA 1RAAB 2UP1A 3MKWB 4IFVB 1RYSA 1A6QA 3KP3A 1KU3A 5G0RA 3K4LA 2K1RA 1FRJA 2V8HA 1X4DA 2PFFB 2F5EA 1JLGA 2Y31A 2FNAA 2CJXB 1U1RA 2WAQN 1T7PA 5M5XJ 2CQ3A 4ZOSA 1FTTA 1F9FA 1UMJA 3H20A 2QL9B 2VKDA 3DEEA 2ISYA 4M5DA 3HM9A 4HPQA 4ZZDA 4H4MB 3MAHA 2AXLA 1DQ9A 2EFVA 3QGPA 1K61A 5KOWA 2IS4A 1PP8F 3ECOA 2CXEA 4HEA2 2BM0A 2F8MA 2UVVA 4G6VB 4GYGA 3W2WA 3FCHA 2JRSA 3MKZA 2K9SA 1K4SA 4UUSB 4KGXB 5CA5A 3CGIA 2FHJA 1WC1A 4AWXB 5D3GA 4XOTA 3DOMA 2YWEA 3EYIA 2KHDA 4CP5A 2K3KA 1KBRA 4D9JA 2M1BA 1N5QA 4GO1A 5C4JJ 4X6AJ 2VOPA 1LDJA 1K7AA 4XLNF 2DK8A 3LL7A 1HNZJ 5DZ6A 1LWXA 4H0EA 4CLTA 4ANCA 2FD2A 4LSNA 2ME6A 1JUMA 3W1YC 2QRRA 4GC6A 4PSWA 2HRUA 3RB3A 5DD8A 1OCRH 1LWFA 4FKYA 4WE1A 1SC7A 3J7AY 3J80Y 3KG0A 2DNOA 4OIPF 4P2FA 3N79A 1TAUA 1GAOA 4DR3F 1YBAA 1FBSA 3JB9k 3AH6A 2P8TA 4QWAA 1HW2A 4MK8A 4DWIA 3A02A 1R3NA 1UAWA 4USUA 2ZKZA 4PG4A 2NXUA 1FJEB 5H9FK 3TGNA 3GFJA 1YITS 3DLBA 5K14B 3HJVA 2XSFA 2X6WA 3I59B 5DS7A 2QYGA 1L3KA 2H5IB 2YNHA 2WB1A 3H98A 1T11A 1FNMA 4MK7A 5E3CA 3VB2A 1DURA 4OINF 2EZLA 2KLOA 4UOCA 1B9MA 2B5JB 3CWJA 4IEJA 3T8RA 1Z2ZA 3KDOA 2B4UA 4FX0A 3BGLA 5J40A 5K5QA 2L9NA 4RWXA 2Q6BA 3F41A 4RW8B 4OV1A 1T02A 2OAUA 1RT2A 2D2WA 3CJQA 3GTOJ 5CKTA 3SI8A 3IWXA 4J7CA 4OIXA 4O4GB 1M1HA 1FERA 4HV5A 2CW0F 3AODA 1O0PA 5JHUA 1I3AA 3L4BC 2B9WA 3WG9A 2JNJA 4OZ5A 3IGVA 1T94A 3TZWA 4ELTA 5HS7A 3HJFA 5ETQA 1BR2A 3MFKA 2MGZB 3VZHA 2LFBA 2IGKA 1S1WB 2EFGA 4YFUA 3VODA 1TZLA 2V1XA 1YVFA 5LJ3Y 3L7WA 3T1HF 3FXUA 1JI8A 3CUQA 4Y2AA 1XTAA 4A3KJ 3A13A 4P2SA 3C19A 4CWBA 1LWCB 2UZAA 2E1MC 1JXEA 1A31A 5LD2C 1ZARA 1NU4A 2HAFA 1T9XA 5F8MA 2MHNA 3LWLA 4E7HA 2C2MB 2W57A 4DR5J 3RPUD 4NLUA 3Q24A 2QMXA 3M2UA 2R7WA 4F3QA 2BW7A 4LRCA 1YJUA 3KHGA 3ZMTA 2F5DA 3TR5A 2PD1A 2OTJS 1ZM3A 4DV2F 2G0EA 1FEHA 1WUUA 3F0CA 2VQEJ 1JXLA 3G1MA 1I5OB 4D7MA 4BE2A 5L39A 3IRRA 2RE1A 4QBUA 2YKAA 3GFLA 2GIVA 3M6UA 2BRLA 3D2WA 2O66A 1NMEB 2ZHAA 2UXCJ 2KRFA 2UUCF 1JJ2R 2N3LA 3ABKH 2JH3A 3H1CA 3M8JA 1SIZA 2OEMA 2Y0SD 1LV5A 5DJBA 5JLXA 4CLKA 2HBRB 3PV8A 2VPZB 7FDRA 3HOWJ 2ZH2A 3H5RA 4A8WA 4ECSA 1GXUA 2R93J 5CVJA 1LEOA 3LSJA 1T05A 3CDIA 1TV6A 3VCDA 1TUVA 2G2OA 4R1HA 2XUBA 1HIYA 1EV7A 4R25A 1ODDA 3MM8A 3FC9A 3TEGA 1CQTA 5ED4A 3MMCB 3S32A 3D5MA 2CFXA 2MC3A 1I51B 4YQWA 3M1CA 4USTA 4LR9A 4JI1F 3RRKA 2ZOGA 4O0NA 5H2FC 4TV7A 3AB2B 2UV8A 4GC7A 3HRSA 4ZVSB 1YRXA 4BHQA 2M4KA 3M8QB 3H0PA 1RPWA 4DJBA 4E7LA 1GXTA 1BOAA 4OMZA 1CJVB 3RQ4A 2JN6A 3UN3A 2LEPA 4URGA 3NLCA 1JTYA 1VDHA 4DFMA 2OMLA 2VDIA 3PYGA 2V6EA 5LT5A 3G9CA 5J47A 3H42A 2LDIA 3MFHA 1YJWS 4CUGA 5K8PA 1EJ9A 4EJTA 3KX2A 4HT7A 2QV6A 4JV5J 3NY0A 2I1RA 2HYGD 1U8WA 3PYFA 5A6PA 2W9BB 4KN7X 3I4MJ 1ETQA 1TW2A 4I6ZA 1W5TA 1QNTA 5B7WA 2CRGA 5KAIC 1SH0A 3G6EI 2H27A 5HLTA 2N4CA 4LF4F 4LMZA 3FQKA 3S16J 2F4VJ 2YX7A 3K10A 4BACA 2IJFA 4EFAC 1FDNA 2DFFA 3GP9A 4I7FA 3RIRA 3C15A 2K5CA 1H2TZ 3KLOA 2Y48A 3R2DJ 5IS2A 2HHSA 3CNQP 3OR2B 3G82B 5SUHA 3PX6A 2K86A 1VHFA 3IAM9 4KIAA 1FX7A 4CCKA 4CNYA 1S5ZA 2PI0A 2YPYA 3FJ2A 1GFWB 5J1RA 2RB7A 1HBUA 3KEYA 2HFHA 1UEUA 3C2BA 3R7SB 1JLFA 1SV5B 2Q3PA 1JHHA 1IN8A 1TL3A 3C3LA 3HOTA 4PG7A 1EB0A 2V9KA 5KVRA 4OMYA 4YR2A 3SSQA 1S3JA 3ZQFA 1MWQA 3MI7X 1LFPA 5A8RB 1IZ1A 3DRRB 1VRTB 1XMAA 3Q0VA 2HGNA 4OFZA 1B8IA 4WXHA 1KGSA 4MHGA 3BDPA 2ZJQQ 4YIRX 3WE3A 2DGQA 3KLIA 3Q9SA 4QWEA 2UXDF 4DFKA 3AD9C 3DU5A 3DRSA 2GMLA 4BAYA 3HT0A 2ISZA 1TLHB 4P7VA 1ZN2A 3MCSA 3OYLA 3LP2B 5C24A 4CLWA 2HXIA 4X66J 4UQTA 4L74A 4IRHA 3GONA 4YY3F 3OR1B 3IC7A 1VNDA 1LDKB 4DX5A 4KH0B 4TU7A 4K5RA 4P55A 2RNGA 2B4PA 2MQQA 2AEJA 3EZUA 3GFHA 3H9JA 3OYDA 4RNHA 2FLNA 5RUBA 2P9GA 3ZNUA 4ZJZA 3BGUA 2DVIA 3RBZA 4U88A 3C6TA 4DG1A 3CC2I 1FJLA 2Z30B 5BYSA 2ZMEA 2BQRA 3ASNH 2AJFE 2COMA 3P3DA 2XAQA 1IKWB 3T6BA 2FE3A 1IQZA 1OYDA 3K5OA 4KY3A 2DMQA 2F8EX 4LIUA 3NKYA 2YUSA 1S6PA 1XMOF 1O5JA 4Y3CA 2ZZNA 5E17F 1VQKI 1U2FA 5CVUA 2B8PA 1V4RA 1D1UA 2E5IA 2K27A 3KOAA 3S1NJ 1VOMA 2KVIA 1JNRB 2ZJPF 2OPPA 2YH0A 4C3KA 4ZCMA 5B0FA 3BO3A 4E2FB 3ZQCA 2F4IA 4CCMA 2BR0A 2OQGA 1WOSA 4OZJA 2IAIA 2DMNA 1Z1ZA 3VQSA 4RGSA 3ZMUA 3UR3C 2FC9A 4K4UA 3AHPA 3WTTC 3I32A 3DHWC 5LMUF 4C8MA 5LGUA 1J5EJ 3LA2A 3CO7C 2Y0BB 1LB2A 3DRPB 1NK4A 2E5JA 3PW2A 2VIXA 4WPAA 3ZR8X 3S2WA 1RT6A 3GTLJ 4FQGA 4ZVTB 3EVOA 3IKVA 2HKOA 5I42A 3UNYA 4U8VA 3EGNA 3I9ZA 4PXDA 2RQPA 1FCAA 3EX7B 3HCXA 3R1HA 1R9TJ 1FP2A 4M9XA 2ZNYA 4DUTA 2RRBA 4W90B 4XK8C 2HNHA 4OIQF 1FYLA 3H3VK 1PIEA 2NUUG 1AU7A 3CD6I 3CJKA 1X60A 3N9UC 1IBMF 2NAZA 3QPSA 1NUEA 2XB2D 1PP7U 1UCRA 5DLGA 1ETXA 3REOA 4MMOA 2IDLA 2GA1A 4G6QA 2DGWA 3M3YJ 4QPTA 1UW9A 3Q2SC 4ETSA 1L3UA 3L7UA 1IKYA 2LTPA 2DYAA 2XKOA 2MGQA 3IP4B 2CQCA 3K17A 2EK6A 4PZJA 4GDFA 5CPRB 2JZ5A 3GU0A 2RS2A 3TKYA 4O3RA 3J7AN 2WV1A 1Y5IB 4XRSG 1D5YA 1FT8A 2KTQA 2W2PP 2FVCA 4DQIA 4KGZB 1SQFA 4UUWA 4NOHA 5KG0A 1VF9A 5IYBJ 1IBLF 4YB6A 2V8PA 2BJDA 4G1QA 4RGRA 4PFPA 3A3NB 2EZKA 2FVRA 2MQLA 3U1LA 3JTHA 1CEZA 1MDMA 1D9FA 2VG7B 3KLEB 4JK1X 3KJNB 3MPYA 2L4AA 4XKCA 4LLLA 2IXSA 2DGVA 2Y0SN 4EGYA 3IV5A 1C1CA 1QE1B 2MTLA 2RQKA 1KWMA 1H9GA 3QZ8A 4FF1A 1FT9A 4X4PA 4Q43A 5L38A 5DQHA 2DFEA 1LW0A 2EKYA 3HZEA 3ONQA 5AE2A 5C44J 4ZHRB 5J6XA 4DLGA 3Q86A 1Y39A 4WP3A 4C8OA 4GKKF 4MGRA 1XJWB 2VQCA 3DDIA 2CQIA 3LUYA 1ON1A 4RU9A 3CC7I 5K7ZA 4OU0A 1VZ0A 2W00A 1IF1A 2ZXHA 5C25B 1L3VA 1S57A 5FIIA 5EEHA 1BQMA 3WTXC 3L95X 1CLFA 1QJHA 4Z37A 3HRMA 4LSZB 3LSRA 1EZZB 4X2BA 1CBKA 1REGX 3ECHA 5KFYA 3FXOA 3V4GA 1W26A 2QEXI 2Z0GA 4B9UA 3V5RA 3K4NA 2A0FB 4BBYA 2BXZA 2RMLA 3ABLH 1QVGR 2XGPA 3RU0A 4A6EA 1U1PA 3HT3A 1SJ4P 2RU3A 5DEQA 3V8JA 4GRIA 4DV1J 3BP8A 4DR2J 3FXLA 3NWRA 1CJKB 1RHRB 1A35A 2ZM6J 4GVBA 4B09A 3AB4B 5AXNA 2L7MP 5ICGA 1SQEA 1Y0HA 2R7VA 2Y0MA 2R42A 3CCRS 2OJED 3FBFA 2GMJA 1N88A 1I6JA 1RZMA 1Y11A 1ETWA 1R49A 3A0HC 3LA0A 5J3LA 3MPWA 3DOLA 2XDVA 4J9KA 5JVTA 1DUXC 5B0DA 3NMRA 2KIMA 4EZ9A 2RRNA 5HROB 4A0ZA 4CH1A 1LNWA 2BXYA 4QIVA 1FE4A 4Q2LA 3BV8A 3ISNC 5E41A 2F6CA 1SQGA 4U7CA 2OCCH 5D0EA 4KPYA 1CC8A 4E7SA 3HZJA 2P9CA 1VBXA 1VRQC 1EKRA 4AIDA 1XPXA 3KDNA 3EDRB 2GQQA 3J7YJ 2JK3A 2XMUA 4F4KA 3HTSB 4HZFA 2U2FA 3FQLA 2QA4I 3QU3A 1CS4A 2Z2YB 4MKYA 5LMNJ 2VN2A 1CJUA 4DV4F 2GWRA 3T5JA 2DRAA 5KFPA 4LB5A 5F0HA 3GMEA 4NASA 2VB6A 2CQDA 3CUQC 2GO9A 1YRNB 3MTJA 2JJ4D 2L4MA 4WU2A 2W8KA 3JRDA 2DD8S 1ZYQA 3V7SA 1HR0J 2C2OB 5L1LA 1UW4A 3KUGA 4NLTA 2B3TB 2CZ4A 4K4SA 4IOBA 3ZMSA 4DL0C 4A2UA 1TC3C 3D3BJ 2GC8A 3GIRA 1Y0NA 3RAMA 1CULB 3I71A 1K8AT 5H6QA 1F5BA 2KL4A 3FF5A 1NB7A 4F7VA 3KP4A 1BI2A 1U8SA 4D5FA 2MG4A 1K9MT 2OPRB 2COBA 3KZZA 1HHQA 3PYDA 2AS5F 1YKWA 2HFOA 3WTWC 2DJWA 1W2BR 4A3GJ 3EYYA 3FFIB 5KTQA 1UPMB 2JHEA 1VQ9S 1R0BG 2AZ3A 3I0SB 2MA3A 1J59A 2LYCA 1X1AA 1ZLJA 3DC2A 3GQCA 4CTAB 2JWNA 3WTZA 3S1RJ 2LC2A 1RTIA 2IP2A 2Z57B 3VAGA 4CA0A 4QIWD 2B9YA 5JXSA 5HVHA 2KDZA 1F36A 2BY3A 4M71A 2VKZG 3WX8A 1N6QA 4ZYAA 2CVIA 1QZYA 1RIOH 2IFXA 3M7GA 5CZXA 4LREA 2AJ0A 2VBZA 1M90T 1WKJA 1HL6A 4A3BJ 1R6RA 2VG6A 3V6DA 1JXVA 3T5XA 3OXGA 5BS6A 1BWEA 1PJRA 1WI3A 1FNNA 1NDCA 4PG5A 1LKZA 3W2AA 3S2HJ 5HQ8A 4TU8A 3W9IA 3GIJA 4WXDA 2QQBA 1GMUA 3QOEA 1D3YA 3E1SA 4DEZA 2CA9A 2MZRA 3V6HA 2XGQA 3E7LA 5A8KB 4FKXA 3DGVA 1HBMA 4LIVA 2DODA 1TKDA 1V54H 3W2VA 2LFVA 2NZCA 2BRKA 1D9AA 4J9QA 4HT5A 1JUSA 3NOGA 4X64F 8RUCA 5B1BH 1SVDA 5LSLA 3DLEA 5K1YA 1M1EB 2GHPA 3WBZA 1X4PA 3TX8A 1KDNA 4X4QA 2M87A 4DQRA 3QWUA 1HFEL 2RHQB 1WDDA 5TGTA 2CRLA 2L7KA 3KZYA 3IWLA 4CCNA 2C2KB 1UVLA 4R5PA 1F5CA 4JI2F 2DNKA 3TL4X 3IP0A 3OT9A 3DP7A 2CNNB 1DPUA 3L3CA 4I0WA 4TVAB 2MZSA 5E3MA 4RB3C 4F67A 5HLGA 2DXFA 1QSYA 3VDXA 4KNYA 4DV7F 3OYCA 5F08A 2X9DA 2BYCA 3HOSA 2KZZA 3FHNA 1Q86T 2HYJA 2WOMA 2ASJA 1S0NA 2XMMA 3I6PA 2K40A 3M6XA 1UCNA 2FB0A 2CAJA 2XY7A 5KFFA 3B73A 1LVKA 1YQAA 3EE3A 1T9WA 2DA5A 4PABA 3DTEA 1TL1A 5BPDA 2RHSB 3M2RA 4NX9A 3QGIA 1KA8A 3AOBA 1JKPC 2OPSB 2XHWA 3DI6A 1NTCA 5FD6A 1XMXA 3PQJA 2DRDA 3VR1A 3M32B 1WDTA 4DX7A 4DV0F 2FIUA 1S10A 4JP0A 1IRXA 2HZVA 2PT0A 2MBFA 4P2XA 3MM7B 2CQKA 1WEYA 1NCLA 4KFBB 1M1GA 4J9LA 1STZA 1SKSA 3BDDA 4M3GA 3D0HE 5IP9J 1AKHB 3JTGA 3F56A 1MBHA 3TRGA 2V0NA 2QYOA 4ZVFA 3LSGA 3SFGA 1HLWA 4OLOA 2R2TA 1XR5A 3OFEA 2WC2A 3KK2A 1RKJA 1KU2A 4LIRA 4I64A 1AB8A 4IRCA 1PC5A 1XNQJ 3RCOA 4D3GA 4B3SF 2PMZD 1TNSA 1S99A 5DM7F 2W24A 5CYQA 1SIWB 1X1BA 4B3TJ 1K78A 1XNRF 1LFBA 1X3UA 1VFCA 3IS9B 3AG2H 4F52A 4PUOA 3HUGB 4LF8J 1S49A 1RT3B 2ACYA 3ZN1A 5D4RA 2XLJA 5GPAA 4XSXF 1AROP 3KHRA 1IO2A 1MBEA 3L9ZA 3V4IB 2AT1B 3HL2A 4FT8A 1NEEA 3J80K 4K4VA 3GYHX 2GIRA 3G8SA 4U7DA 1YJWI 3C46A 1KONA 2YKMA 1GX5A 3OVBA 3O2PE 1WEZA 1MN9A 4O3OA 4IRKA 4AM3A 3LGMA 2UUAF 2O5RA 3NS6A 5I3PA 4MQ9F 3B8HA 3CF2A 4RW6B 1MWZA 3ZTSA 3JSMB 1D8ZA 3QSIA 2M0MA 3KP6A 3G96A 3MOJB 2KU7A 2QSHX 1HQ2A 3HP6A 1B4AA 5DDQC 4OYPA 1SD5A 1I50J 4ECRA 4RW7A 1XB4A 3GJQB 5KT7A 4MEYF 3IG1B 1Z3XA 4E7KA 2UUWA 4TLQA 1ZA2B 2HGLA 3WODF 3J81Y 1U5TB 3J80Z 4JI6F 3UW1A 1RWOB 3OLAA 4UB6C 2CGPA 3T3FA 1RTDB 2GVDA 1UMQA 3K4MA 1ZKGA 4USVA 5BXIA 4GXOA 3D6TB 5GAGJ 1F1BB 1TQMA 1SH3A 3MEEA 2WRMA 1S97A 1ETKA 2M52A 5LSRA 1N33F 2O3FA 4ES3A 3CJ8A 2VV5A 3BYPA 3QO9B 8AT1B 1HMVA 4XDDA 1N34F 1BI0A 4PJ0C 1RLDA 3P8BB 4AE5A 1XWLA 4AFFA 5FLXY 3GTPJ 4NI2B 3HHHA 3EXCX 1CC7A 4CGZA 4ANDA 3UCZP 4GKJF 3W8PA 3BGRA 2ZH4A 2RQCA 1RUNA 1K4TA 2GJFA 3CUOA 3CDAA 4NA2A 4PXBA 1IBKJ 2R8GA 3CJRB 3MMAB 4B08A 5IM0B 5IV3A 1GMVA 3AAFA 3M8RA 3D68A 5KFLA 3CMMA 1LWEB 1XTZA 4M5JA 2UVRA 4NBQA 3U1KA 1YDLA 2Z9OA 1V55H 4YB5A 3A8KA 2TRTA 3MUTP 2VI6A 4UY85 1IXSB 4YHHJ 2M30A 4IKAA 1HNIA 1TK0A 1G2HA 1RTJA 3ZXWA 3NARA 1RT5B 4OI6A 1NDLA 5E1XA 3BSNA 5L3BA 2Q43A 1S8NA 4QCLA 3PW7A 2JSXA 3ZQHA 3P7NA 5LJ5Y 4LFAJ 3TWZA 4JI3F 1SL1A 3DXBA 1KN6A 3I54A 5DGBA 3VYTB 4B3AA 4DOZA 1MNMC 1ZOTA 2HNZB 5K5OA 1H7XA 4RAFA 1S79A 2EA4A 2JA5J 5FDLA 5IT3A 3MEDA 3J7YU 2HQCA 3AKZA 4KAIA 2C3PA 3RB6A 3FBNB 1HWLA 4QIWN 2B51A 2W2NP 3KLHB 2YPZA 1GLNA 4OYOA 2K4JA 3SDGA 1EH6A 1LJ9A 2V5HG 2LYVA 5CD4A 4TLRA 1S7OA 2XYHB 1B7YB 1RT1B 1B99A 2XZWA 1QDUB 2HHHF 4AQYF 3MCZA 4L0ZB 3JW4A 1APLC 2QVOA 3QODA 4B02A 1MROA 4KKOA 4F0MA 4TY8A 1JJCB 4DV5F 4BS2A 2GAGC 2D74B 4BXFA 3MHYA 2DNQA 5BQTA 2CV2A 2X1BA 3Q0UA 2HFVA 5DRKA 3KUHA 1VQ4S 2HZTA 4DZPA 1ZRDA 2HI3A 4KDPA 3O6QA 1NXIA 4HTJA 3OYGA 2HQIA 2DOFA 2OAZA 5A8WA 3GTYX 2QKMB 3TX0A 3FISA 4QR2A 3K2YA 1FFGB 5HANA 1AA1B 1KYZA 3JQKA 4A8OA 4CSWA 1U0SA 2CFOA 1OY9A 3J80U 3OSFA 2MZJA 1FWKA 1W36C 2R8JA 3CJTA 1GVJA 1WACA 4M73A 3V8LA 4LJZF 3FM5A 4K7QA 3QLHB 3F21A 4JQFA 4WP9A 5CLSA 3SFIA 2M9KA 5KAFC 3AL0B 1E0EA 3SCKE 2JEFA 2W7NA 2A07F 1FRLA 2OIHA 1JLAB 2HNYB 2EFOA 4Y15A 1VYAA 2UU9J 1GUUA 2A1BA 1TQLA 2XG8A 1G6BA 2V34A 3U27A 1DTQB 2B7BB 3PZPA 3VGVA 5CZVA 5C42A 2HOTA 3U1DA 4ZCKA 5CYVA 1JLCA 3B78A 1VI7A 1HA1A 3R6SA 2HFNA 5GMEA 4EBCA 1VIOA 3SCIE 4WKRA 4XICA 1AFIA 2X4HA 3DCAA 4LK0F 1DQAA 2QJ3A 3DMJA 4ENKA 2MFZA 2GXAA 5K5RA 1HBOA 1EKEA 3KE2A 1AYEA 2DNRA 4CRJA 1Q1HA 1RETA 1VIXA 2E5LF 1FDAA 2AP6A 1T9YA 4HACA 2PI5A 3ZZTA 4LF7J 5BPIA 1Q95G 2IBOA 3G1OA 4YIFA 2ZDOA 2NVXJ 4WFAQ 3PUBA 4BEHB 1KQKA 5KFWA 1OY6A 2CW8A 1TL7B 4C11A 1S1TB 1J5YA 4KO0B 2MKKA 3TP2A 1S1VB 2DGXA 4HSRA 3PIOF 1HD1A 2E29A 4C4WA 1WF2A 3OIPA 3PL8A 3SDBA 4J91A 4IRGA 2ZJPQ 2I8EA 3OL9A 5DCFA 5IT4A 4DSFA 3CCVS 3KYDB 1U24A 2F40A 2YY3A 2VIHA 4ZP6A 1ON2A 5EN1A 1WRJA 5DETA 4AYBA 4LOCA 4EYIB 2M9HA 4DUYF 4MT1A 2XMAA 4U7BA 2E5NA 3JTNA 1FC3A 2CUJA 1H0MA 3FXMA 2PMZN 4YUDA 5CAAA 2EV0A 5HAOA 1HSJA 4H4KA 3RBEA 4HRIA 2J9DE 4P96A 4RB2C 4ZDOA 5KFTA 3S6EA 4Q44A 3HGYA 4KN4X 1S0OA 4MIBA 4Y0FA 4E98A 3DPLC 3OOPA 3FX3A 1ZZFA 5MAOA 3E97A 3UCGA 2DIUA 4U0WA 5LHGA 3MEKA 5MLCV 3GZ5A 1FFWB 2YNGA 4NLQA 1SJ3P 1K47A 1Q16B 3O44A 2YS9A 5CH7B 2GW8A 4IL6C 3UDLA 2G9WA 5LM7E 2IGMA 3CJ5A 2LH9A 5C2GA 1C0TA 1Z0XA 3S1QJ 1D0ZA 1URRA 3W60A 4CLUA 1C4AA 3DRYA 1HI8A 5F8HA 5IQQA 2FJEB 2JMWA 2B0GA 3BZKA 3EPIA 3M6WA 6FD1A 1BBYA 1IKVB 2AX1A 1DQ8A 4IQ4A 2NZ4A 2YBVA 4O23A 1TTHB 4CI0B 1S0MA 4NZ6A 1JLQB 2W2OP 1FLIA 3NWTA 3P9IA 2BXJA 1GXQA 1G6NA 2DGOA 2QTWA 1N5YA 5GMKa 2XIGA 2YNIA 1BR4A 1IUJA 3O6BB 2V7FA 5KT4A 1BWVA 5F0CA 1AXQA 3UDEA 4HBLA 2FBKA 3TO9A 1C0WA 3IH2A 3D6HB 2GAHC 1DGWY 2AJ1A 4FYYB 2DR8A 5J1EA 4O4RA 3RKYA 3MEGA 3BPDA 2G7UA 1ZG5A 3NBPA 1T0FA 3RPQA 1A5JA 2M3DA 4WWSA 5F04A 2CZ9A 2P81A 1NB2A 1Q8KA 2AQEA 2WAEA 4L3KA 2EFWA 2R7SA 4ZYHA 3MUMP 3DEUA 4IRDA 3WTYC 1M5HA 1LUJB 1R8BA 1FE0A 1H74A 4UHTA 1JIHA 3H9QA 3J7YI 1NKEA 3EDPA 2QGUA 3UFCX 1RAOA 2I9SA 1T3NA 3GCXP 2HZDA 1UJ8A 1FKOB 2HR3A 2HHXA 3HDDA 3RB4A 5KFJA 4HL9A 2XMWA 5BR8F 3FSIA 2RAQA 3JYTB 4UVCA 2HVIA 2FC8A 1ZRCA 1RISA 1CF7B 1YJNS 1KSPA 5D5XB 1VQMI 2OFGX 1R5GA 3HDSA 3UD4P 1WNEA 3DYAA 4PKDB 2N3OA 2KKHA 4IPAA 1F2HA 2C42A 3AFHA 3S14J 2IRFG 5K14A 3I59A 2DGUA 3SEQA 4IG3B 3H2UB 4DR3J 2A3JA 4CLLA 3CCQI 3RB0A 2EWNA 4KT5C 1EX8A 1PUEE 2J7KA 2F48A 4G6DA 5CCMA 1L3TA 4PJJA 2FU4A 5ICEA 5FLVA 4NB5A 2AZ1A 3WQPA 2QMUB 2FNPA 4RW8A 4QPQA 1P4AA 3LOCA 4ESFA 4DU8A 1FSHA 4ERDA 2AU0A 4KTQA 2Q6CA 4A3DJ 3ZMVA 4B3MF 1IRGA 3BGOP 1N75A 4C48A 1KQGB 2FZCB 2H8RA 1RWUA 4AIKA 3IM9A 5IXUA 2Z2MA 3VGSA 2OEJA 2YVSA 2OD4A 5K7FA 3V6KA 5FD1A 4EO8A 2ZBPA 2XSJA 2ZXJA 2JFDA 2HMIA 2AO9A 2VPWB 2QWWA 1LWCA 5HATA 1UPPA 2CUYA 1WJBA 2ZJRF 4KC5A 4F04B 1NG6A 4Q7AA 2JVHA 1NDPA 4LLGF 4E70A 3QQCD 4NXMF 3Q8UA 1RKIA 3C6UA 1YFHA 2NXCA 3T1HJ 2PEBA 3FNNA 2GGPB 4KHMA 4U0YA 3F6OA 1RBAA 3M8FA 2HPUA 2LU2A 2QA4G 1MWYA 2R5ZA 4C9YA 3B4MA 2WADA 4UOHA 3CLOA 2KVQE 5B09A 2IVMA 3A03A 3HOUJ 3W6KB 4FDFA 4AD6A 3H35A 2CVEA 2XI3A 4ITVA 4CNZA 4ICLB 1RSCA 4O3SA 2QCOA 4EM0B 2F63A 4A46A 3R60A 4ZYGA 1VQ8I 4ZS6A 2R7RA 3JAMK 4FZVA 4HSTA 4WK8F 1X3ZB 5DUIA 1QHHD 2MH9A 3LWFA 2GMHA 3MAAB 1Q7YT 5L9XA 4P5OA 2R8KA 3K1MA 1WH5A 1X4EA 2DAOA 3ELKA 4DIQA 4WZQA 4LRFA 2NXNA 5DS9A 1RB0A 2YPRA 2X1GA 1MZBA 1RESA 3OYNA 2UUCJ 3NCQA 3HULA 1JKQC 3LNQA 2D3O1 3DM2B 4L18B 3R61A 1K6YA 1U1OA 2ZH8A 4YFNF 3D66A 3F8FA 1O3RA 5EYRA 3W3CA 1TT5B 5J2MB 3M4OJ 3BN7A 1MIJA 1E3HA 5HK4A 2A6EF 1L3LA 2Q8KA 4LBHA 4WXOA 2IJRA 3MMCA 2QFJA 3PO2J 3R5AA 2XVCA 2XMTA 5HQMA 3HHDA 1WHXA 1LEBA 2BKPA 2IJNA 1KZHA 1VQ7S 1VJQA 3MURP 3GF2A 4OX9F 4Q8FA 2BE2A 1SB6A 2A6HF 5U47A 2C22A 2MJNA 1UFLA 1MBFA 3JAMZ 2V2VA 1FJ7A 1NNDA 2AW0A 1VS3A 5CABA 2GIZA 2NR0A 3FBCA 4N8OA 2ATCB 3BG5A 2E5HA 3KJVB 3OYFA 4DCOB 1OS5A 4HLYA 1PJ5A 1R5ID 4LFBF 1MH3A 4CH0S 4IDKB 2MQMA 2W2MP 3MD2A 3KLFB 1WVRA 1NSAA 3OS2A 2DT9A 2HTJA 4CO1A 5IOYA 5HL7Q 2POKA 3WDOA 4B3RF 3PRBA 4FS1A 1UB9A 4USMA 3VAJA 3EPZA 4HF2A 2QSFA 3MDFA 2B0LA 1S29A 3CCLS 5ETSA 2I8DA 1H88C 3BBBA 4K4TA 3W66A 3MD3A 4ECVA 3MM6B 4YFKF 4WK1A 5B0EA 2M7AA 1POGA 2Z8QA 5L3FA 3ZZYA 3MMBB 2H9ZA 1I27A 3MM9B 4IQXA 3G82A 3M8YA 4UT4A 3OL7A 2KYXA 2J6TA 3C14B 3MR5A 1XEZA 1B1BA 4ID5A 4LF4J 4J9SA 1HNXF 3HSRA 2JT1A 2FLPA 1MMSA 2APOA 1A6IA 3D6FB 1WF1A 2RH3A 1R0AA 1Y00A 1FX2A 3WIUA 3RQIA 1ZREA 2M5WA 1S9GA 1YHQI 2PEHA 4CYUA 2DPJA 4AL5A 1Q1VA