4F3QA

Structure of a yebc family protein (cbu_1566) from coxiella burnetii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
234
Chain Sequence
KWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAIKRGADNLVEVRYEGYGPSGVAVMVDCLTDNKNRTVAEVRHAFSKCDGNLGTEGSVAYLFKQRGLITFPPNSDEEKIMEIALEVGAEDVTTNDDGSIDVTTLPEDFEKIRNAMKAADLNPSHAEVTVLASTEVGLDKDSAEQMLRLTEMLEDLDDVQNVYSNADYPEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transcription
molecule keywords Transcriptional regulatory protein CBU_1566
total genus 73
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4f3qA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA03
1E0EA 1KONA 1LFPA 1WJDA 3F9KA 1MW7A 1WJCA 1WJAA 3HPGA 1WJBA 1WJFA 1WJEA 4F3QA 3HPHA 1K6YA
chains in the Genus database with same CATH superfamily
1M1HA 2F9JA 2EJRA 4EM0B 3GTKJ 3W64A 1NH3A 1WJDA 3JCUC 4EMSA 1MNMC 1DPRA 5D78A 4HDVA 3O5TB 4N7TA 1HBNA 2LDIA 3IC1A 1IAWA 1Y9OA 1TP7A 2KJVA 5K7HA 1UW4A 1LW0A 2MY8A 2J0XA 1Y39A 2PT0A 1TL1A 3JYTA 1Y11A 4DUTA 2DXEA 1S9GB 4NYZA 3QRQA 2YS9A 2DXIA 3THVA 1R5HA 4CM2A 4IRIA 3V6KA 4DL4A 1F6TA 1T3OA 2EFNA 3RW7A 4RNNA 1NH8A 2FPHX 1R0CB 4CM0A 1D9DA 4YRVA 2CUYA 2JL9A 3QO9B 3F8BA 3SJMA 1N78A 4CLYA 1SIWB 1KTVA 3ZQFA 3CCLI 2VPZB 3LOUA 1Z4UA 1G3YA 3MM9A 5M3FJ 4RAGA 4LFBF 1FC3A 3OSGA 1Z67A 1QZZA 3TRGA 3BC8A 2UUTA 1N56A 1I6XA 3FXJA 1RT5B 2HQCA 2H51B 2VQFJ 4F2RA 2W57A 5FD6A 2GNKA 1X19A 4WXHA 5GP9A 3CCUS 3QYFA 4L0ZB 4J9OA 4LF1A 4DXLA 3OTCA 2R7SA 2ZE2B 1LXNA 3VZHA 2MHNA 3RPUA 4NQWB 4TV7A 2HHUA 4IRCA 4M5GA 2BKPA 1W5TA 2IBKA 4ZVEA 1S97A 1S9HA 1O3TA 1TWCJ 3F22A 5FLXY 3LALA 1EH7A 3K0LA 2MQNA 4FX0A 5LGUA 1ZG1A 3EGNA 3JTOA 2ZJ2A 1KZHA 2BJ1A 2M30A 4DV0J 2GA2A 1QVFR 3CUQA 5CYQB 3TMOA 3V8LA 3TVZA 1A6QA 3OL9A 2YU9J 2RB7A 2E5GA 4AXIA 4MYTA 2UZAA 3CDEA 1VJQA 1U4BA 4PJMA 1J2XA 4C0HA 4I0BA 4CLZA 2IJFA 2EBGA 4OYOA 3AXKA 4DBRA 2QQBA 4WTYA 3BQZA 4EMDA 1KQFB 1VFCA 4RGSA 1J5YA 5J2MA 1RNLA 2LSOA 4LF7F 3I55I 2PLYA 1WORA 4DS5A 2HOAA 2H5IB 4LRCA 3KLFA 2E5LJ 4DV5J 2XSFA 5KFMA 2BM0A 1MROA 2HTJA 1F2GA 2LA6A 4BHPA 1WC4A 4ZP9A 4HTIA 3S01A 1YS6A 2XZDB 2CQ3A 5GAHU 2ZZNA 2LKZA 5BYQA 2E1CA 4RW9B 5DLGA 1WTFA 3FIWA 1H88C 2HHSA 1U24A 4ZDLA 2OV7A 2PIIA 1NK8A 4ZVRB 3DRPB 3PNYA 3R8YA 1ZELA 2CMPA 2ZH9A 3RB4A 2VJJA 1MMGA 1VQOI 4Z7YA 1HI8A 4HPQA 5EHHA 3D28A 4IZZA 1LWEA 2VB6A 4ANEA 4OX6A 5KVRA 1BD6A 3DDNA 4IVNA 1V6HA 3AT1B 1FMVA 5B08A 2HVSA 4NLXA 2E1OA 1L3VA 4M95A 4Y28C 3OFGA 1LK7A 2P9EA 1M5KC 1KVIA 2AV5A 4GMKA 1JLEA 1PIEA 4UF4A 5ETLA 3RZDJ 4ED5A 2XCAA 2CH0A 4JOMA 3HMJG 2C3MA 3R6LB 4BHCA 4PG5A 2XAGA 3R0JA 2QLFB 2BKOA 1N36F 1X5SA 3RDIA 5AE2A 5GAEJ 1OCPA 1W0UA 2VI6A 3EWGA 3PNIA 5AXMA 4FQGA 4EV0A 2D3UA 3KLGA 4B9UA 1X4BA 2QSWA 1TTHB 1YKWA 2M52A 3AHPA 3DWLE 3QP5A 3UR0A 1OISA 4AIHA 1TL7B 5EWGA 2FRHA 3DV8A 2MKKA 2ZH7A 3H92A 3DLJA 2ZUGA 1OQ6A 2RILA 3H4BA 4DJAA 4OZ5A 3F8MA 5D6FA 3AJ1A 3VZIA 5TGTA 3GLXA 2ZB9A 4ZJOA 2KU7A 3O3KA 3QYYA 2QG9B 2ZH2A 4V2GA 2CNNB 1NCLA 1P1TA 2C2MB 3HG9A 1R36A 2A2CA 4FXVA 3QP6A 3TQ1A 3QT8A 4ECQA 1RAIB 1YRXA 2VPRA 4RW6A 1OR7A 3NAHA 1UCRA 2PFFB 4V19K 3HOWJ 4PJLA 3KEYA 3KYLA 2P7CB 1FXLA 4OJ3A 2VJ5A 2GXAA 1IR0A 1MBFA 1VC5A 3MCOA 2JC1A 2BYCA 2WSFC 4DL2A 3QRPA 5LRSA 4GKKJ 3HUGA 2VIHA 3CTAA 3CCEI 1Y8RB 2PEHA 1ZREA 2LREA 2VF3A 1OMIA 2PA3A 2AJQA 3CD0A 1XC5A 1R4MB 4Q8EA 4ED2A 4IKFA 4NLGA 3RIRA 4RMNA 1FJCA 1FRIA 2NYHA 2X1CA 5EX0A 2JPCA 3M8QA 2OPTA 4O0IA 3GTGJ 4IKAA 1LVAA 4TVAB 2B56A 1KQ9A 2DY1A 1H7WA 4HA8A 2DNYA 2K4BA 1YVFA 2JUGA 4LITA 2LY9A 3C6TA 3K0JA 1X0PA 1J5OB 1HMVA 2MLXA 1M5PC 1NSKL 5B0GA 3BJ6A 1C0UB 3TP2A 1XR5A 4JI5J 2LBFB 3SMZA 1KR4A 1SB6A 5DUIA 1PP8F 4ECTA 4QPQA 5B0FA 2V8HA 4BE1A 4F67A 2HBZB 3DP7A 4FYDA 2AEJA 3D0GE 4ZVQB 3MR5A 2EFQA 3VQSA 3PW0A 3PJWA 2YQ3A 2W82A 2RT3A 3AFHA 1FHTA 3A01A 3W5XA 2PI5A 1NKEA 1GXUA 1MBGA 2L2OA 3HB9A 4PGHA 2QA4S 5DG8A 1HBMB 3W62A 4FVMA 2HDDA 2HR3A 1HDPA 1X2NA 2OAZA 1VRTA 3O1LA 2C2EA 4NCBA 4BY7J 2E34A 1IV8A 2HNYB 4RUBA 2RDPA 3NCQA 1HLVA 3MD2A 1PJ5A 4NZ6A 1D9FA 4JI0J 2H1LA 2XPWA 2FQ4A 3CCWA 1JWWA 2XULA 4BBYA 5LBQA 3GO5A 4RM2A 1KQKA 4L74A 1IQZA 1Y6IA 3OYLA 2E2HJ 4DS4A 4PRFA 2K40A 4Y3CA 2CPXA 1FKPB 1NJXA 5FD1A 2HLUA 1UWBA 3JB9k 1Y5NB 4FN5A 1NBEB 3ENVA 3MPUB 2DOEA 2POKA 2JRMA 5A8KA 5TISC 1YJ7A 4F52A 5J2PA 2HFNA 2GIZA 1SC1B 3OR1C 4B3SF 1XCVA 4D9JA 2VBXA 2B43A 3WGHA 4EATA 1FRLA 1G4CA 3VQTA 3SCIE 3AQPA 2QZ8A 2X1EA 4A6EA 4ZIWA 3MTJA 3K4BA 2F5EA 1XCBA 3RKYA 3SXYA 4CH1A 2VG6B 4BLGA 2R93J 1IUJA 2N4DA 2OUGA 4ZVGA 2RC4A 2FLLA 3ENAA 5HVGA 4KMFA 3KG0A 4ZYHA 1S5LC 1GTHA 3I58A 1JXVA 4DV1F 4USHA 4HDGA 2YQ0A 2XB5A 1R71A 3J80U 1F5CA 4OI0A 4I6AA 2BY0A 2AQ4A 3TANA 3BB5A 1HDDC 3NGDA 2Y9ZA 4D7MA 2XKPA 3JSMA 2L01A 1NJYA 4PKDB 1HW8A 1ON2A 1BR1A 3CGIA 3U7JA 1UVLA 2BE2A 4AYBD 2BJ8A 1RU2A 1N6QB 2QN6B 3NXZA 2DIVA 4XM3A 2XI3A 1UVMA 3DPTA 4RGXA 2OP5A 3R6GB 4NEYA 1SVOA 2DK8A 3M2UA 2GLOA 2DJNA 3NCPA 2RQMA 2MC3A 2QKLB 3RRHA 3SCLE 3K8WA 4W4MA 1RHJB 1HW2A 2Q3PA 3MUTP 1F3VA 5C25A 5D4PA 2XGQA 1YHQI 4XN3A 1MNDA 3M6UA 2VQGA 2F65A 2DPUA 1JLGA 1RAHB 1TZ0A 3PACA 3ZMDA 1Q5VA 4CLFA 1FX2A 3BQ1A 3S1NJ 4Y2CA 3DM2B 3OL3A 2GAHC 4NYPA 1S7AA 3VODA 4PQAA 4PXCA 3MKWB 2Q43A 4PAAA 3S3MA 2ISYA 2COMA 3C2BA 1R58A 2KZVA 2VJ4A 1P2FA 3FXMA 1WJBA 3CLOA 4PXBA 2HFSA 2DY9A 1RRJA 4H54A 1X4CA 1CQNA 3OLAA 3M8EA 2R7DA 2H48B 3A3PB 1WC6A 3LSPA 2EKNA 4B3SJ 4LRBA 4FDFA 3K59A 2K06A 3F41A 1GX5A 4WFAQ 3DPLC 3LFUA 1WCMJ 2ASDA 3WGGA 2DA7A 2NS1B 4ES1A 2XROA 4R0EA 1VJWA 4DV4J 2CKWA 3TNVA 4WE1B 4DSLA 2CPZA 4ZTFA 5KT5A 2ZKUA 5A8KB 4DG1B 4JP0A 2BY1A 3FBCA 2FSWA 1SIZA 2PO4A 5HLGA 2ACJA 2JEGA 3HL2A 2OBPA 3QAHA 4XIDA 2NUHA 4EM2A 3H0GJ 3JRGA 3DLGA 3GLJA 5ETRA 3H3UA 4LQ9A 2D7SA 5C4XJ 1IW7F 4HLXA 1ZG3A 1XSDA 1FWKA 4NYOA 3K5MA 3CC7S 4F0MA 3GFJA 3H2UB 3CCQS 1TP4A 1GLNA 4ED3A 6AT1B 2ZM6J 2JOQA 2DGXA 1N48A 3M2UB 3KETA 4J01A 4EWTA 4RWWA 1GUUA 4P52A 4PSXA 5EZHA 3DLBA 2WVDA 2HKOA 5A8WA 4JBAA 1G8XA 1W36C 4F4KA 5CQEA 3I54A 1KQ8A 3JAMU 3G71I 2KRRA 1OKRA 1IGNA 4FX4A 4LT6A 4M6XA 5L3DA 1YRTA 4DR7F 1NMEB 4ZDPA 2QMUB 3NKYA 2VXZA 4MJKA 4LSNA 4Z6YA 2XZWA 1NPKA 1FRJA 4ZP6A 1IN4A 3CMEI 1JLFB 1XMQF 3E6BA 3UCUP 4MNUA 1ERDA 1IM4A 1FNNA 1BL0A 2D2WA 4AQYJ 4K2EA 5THWA 4AL7A 2R7XA 5SUHA 2RRAA 1H2VZ 1LNQA 1BOBA 5F8IA 3GILA 1OS5A 3FFIA 3TVKA 4NLUA 4UUSB 2YBVA 3AFGA 4CZCA 1I94F 2XHKA 3DTKA 4W98A 1XMOJ 2EINH 2K3PA 4ELVA 1F9HA 3VGSA 3I5UA 1X4FA 5HVQC 3PJ9A 2ADUA 3R0AA 4H4OA 4BL0B 5J2PB 5C42A 1ZGWA 1C0TB 1VQ4S 4WXDA 2Q1ZB 2ZD1A 1BQNB 4LIWA 5L38A 2VZ9A 4KB7A 4JV5F 3AG2H 4J19A 2FMYA 5LHIA 3HUGB 4DI6A 1U8BA 2J7KA 1JLCA 2BZTA 1FLIA 4KISA 3EGZA 1XMXA 5TRDA 3JQJA 3GZ5A 3GV8B 3T9ZA 4C2UA 1T39A 3KEOA 3VR1A 5LJ5Y 4AT1B 1UELB 5J8FA 3BM7A 2KHCA 1X4PA 2HYFA 3TR5A 4JP8A 1RT4B 3R5BA 3A3NB 2ELKA 1JK9B 4DSKA 1TLHB 4DZPA 1YJRA 3THPA 4OOIA 3GYNA 2JVGA 2Z33A 4IFYB 1QJHA 2L9VA 2QCOA 3WU1B 2M0GB 3HIFA 2PA8D 3R2CJ 3BG5A 3HCXA 1KWMA 1Q8KA 1WQ2A 4TLRA 1X1PA 2MLKA 3P9IA 4K2JA 4LMZA 2C2KB 4CGZA 1FRKA 1H38A 4Y2KA 4L5JA 1JXLA 3FEXB 1MBHA 2DJWA 2EKYA 1EP4B 2CPJA 2ZMEC 3CCJS 2OSRA 3PW2A 2WHOA 3IP0A 4BHQA 5HBMB 3PFIA 4JI8F 4YP3A 1RWPB 2H8WA 1RWKB 1JLEB 2BQUA 4XICA 4O6JA 3OVAA 3KPHA 2XWYA 4JX4A 1BW5A 3A8KA 2LR8A 2LNBA 4TYBA 3M8QB 3NRBA 1Y7PA 3RG6A 2HBRB 5KFIA 6FD1A 1IC8A 3KHHA 2F8MA 2ZBCA 4KGKA 2PI4A 5KTQA 2DAOA 3QT7A 3AXMA 1NK0A 2KT0A 1LWEB 4RL1A 1YX3A 3K6GA 3BF4A 2LRDA 3SEQA 5G0RB 3JRDA 5KT7A 1VQNS 4I7FA 1UMQA 4KO0A 3FDSA 5KFDA 3EZ5A 2QKMB 5K5MA 1S49A 4C97A 2GO8A 3DLLF 4RW9A 3D66A 5B0EA 5B0DA 4JV5J 3E6MA 1T11A 1UJ5A 1I50J 4RW6B 3PX6A 3FMSA 2R92J 2DA1A 2HQGA 1FJLA 5LSOA 2KXNB 2E66A 2OEJA 2ZUAA 4AUKA 3GIJA 2Z4PA 5I3UB 1YITS 3OV7A 1MROB 1A35A 1PILA 3LA7A 4DYCA 2W9BB 2X1BA 4U8YA 1PUFA 3R5JB 4UOHA 1DY3A 4LRAA 4X4UA 3HI9A 4DQQA 2FVPA 1XDUA 4CZZA 1LOUA 3CJ5A 3UKGA 1EH6A 5J3LA 4OZ2A 2B9XA 3REOA 2IM3A 1SXLA 2HK3A 2H6BA 5KFOA 3MMCA 3FBBA 2KM8C 2ZBQA 5IQQA 3S1QJ 1G3TA 4L6V3 4ANJA 1YW9A 2LXFA 1RWOB 4M5DA 1X60A 3CMQA 2ZBPA 3RAQA 2PJRB 3JSOA 1U47A 4DR4J 2LXIA 3N9UC 1PKUA 1MLAA 2DHGA 3OQ2A 2DCEA 3M30B 4PYAA 1HW1A 3KJFB 2KYZA 1U8RA 5FRMA 1PC4A 3EETA 1Y8QB 4K8RA 4U67Q 2ZO4A 3B4DA 5F1JA 4KGMA 3W5ZA 1XR6A 3S2WA 2GS8A 2V69A 2NXNA 2P2CB 1APSA 4P72A 4DV2F 1KQSR 1S1TA 1P7IA 1ZH5A 3FJ2A 1BA5A 4WFNQ 4EI2A 1FNXH 3QNWB 3CT9A 1B7FA 3CCUI 1G6BA 2CG8A 1RAAB 3MWBA 4OAZA 4DSFA 2ZC3A 4HI2A 1U6ZA 3HHDA 4F4WA 3AD8C 1YO5C 4FXWA 3QOPA 2C1EB 3PFEA 3MFIA 2XMTA 4FE4A 3RZOJ 2E5NA 2WOMB 2XBPA 3T9NA 2XGEA 1IJEB 3PL8A 4O3PA 1BE4A 3GFZA 3IBWA 4BDYA 2YXLA 4B43A 4EYIB 2Y1JA 1ETQA 4CCKA 3TKYA 5C4JJ 3PJRA 1IBMF 2I0XA 2V67A 4A3CJ 1UAAA 3FCVA 1YX2A 2IJNA 3TZZA 4PFPA 1RACB 1ZPWX 4LK0F 1PCAA 2H65B 4E7JA 1S1XA 3HF5A 1T7PA 3KLFB 2F4VF 4FS2A 3JTPA 3PG9A 2CZ4A 5HP1B 2IA6A 3K2ZA 3LQRA 2UV8A 1HBNB 2XPVA 2LLKA 5IP9J 4TNOA 3FCWA 3NNHA 2P4WA 1MU2A 2M0CA 3MCNA 3PR4A 2RGVA 3KDNA 1ONVA 4TY8A 4TU9A 1I51B 4KT0C 3W63A 2PGCA 2GAUA 2FVCA 3MGJA 1YK9A 1KA8A 2XO6A 5F0HA 2PG4A 1AKHA 5FFXA 4KPCA 2DBBA 2XLIA 4JV2A 2WTFA 4X66F 3OOPA 1YX5A 1K83J 2ZOFA 1MJ9A 2EIKH 3CUQC 1VRUB 1SAUA 2G7HA 3CUQB 1VK8A 3OBIA 1QTMA 1EJ7L 4RW7A 2Z2LA 4MFEA 1XK8A 1A0OB 1C4AA 1S6LA 1PYSB 1N75A 3R7BB 2M3AA 2K9MA 2G2YA 2XF6A 3FK7A 1HNZF 3FDYA 5J40A 5FROA 1ZAWA 1JTXA 2L9DA 3MFKA 5DETA 4DU7A 4IQJA 2A6TA 3H9QA 5E1WA 4P73A 3SDEB 1BLUA 2VL1A 2WADA 3DRXA 5F0UA 4BXXJ 3GZ7A 4ZJQA 3MCSA 4C3MA 2DMUA 2J9CA 2AKWB 1RT5A 4O3OA 2VQFF 1HQ2A 3K2AA 1L3TA 3DMJB 5GVQA 2RUSA 4F8RA 2Z58B 2AYGA 2KJWA 1B4SA 3CJ8A 5CHCB 3M6XA 1U8WA 1CC8A 5E20A 2IRUA 1FOWA 2MHEA 5GTIC 4CLWA 2Y69H 1MIJA 1SMTA 5EEGA 1RHRB 3V81B 2YNIB 1Y5IB 3VF0B 2F5FA 1IN7A 3CJNA 3N28A 3U9GA 2LC2A 3SZPA 2RNEA 2WVBA 3H9JA 5ETVA 3E1SA 3SEOA 2BR0A 1TL1B 3JYTB 2DMTA 3ABUA 4MFBA 1V3SA 1LW2A 5KCMA 2V26A 7AT1B 3S3OA 3QT5A 1SQFA 2VXDA 4A5MA 4GKJF 4B3MJ 1TQLA 4PWDA 2A6OA 4PG8A 2B4VA 1DTQB 4HTJA 3IWNC 1P4XA 4OMFG 2JWNA 1Z6TA 3UO0A 3GVAA 1S6QA 2IRYA 3C2PA 2UUAF 4B3MF 4FF1A 1V55H 2VFSA 5ED4A 3CCVI 5CXTA 1O8BA 1ETVA 1XG1A 1UJ4A 4FCYA 4FYWB 3N5FA 3QZ8A 4WZMA 1ZS6A 3Q3SA 2IGMA 3D0SA 4PQUB 1ZBTA 2I5JB 2HVIA 2M4MA 3W2VA 5KFZA 4ITSA 3T1HF 2DDAA 2HMIA 3T1BA 3KZZA 4EO6A 3HRUA 1FWPA 3KNGA 1OQYA 1YG0A 1XERA 3HVTA 2NOGA 3BR3A 3KG1A 4MGRA 3D0IE 3PW5A 4JV0A 4RW4B 4X64J 4QWQA 3HM9A 2R8JA 5HNHA 2AMCB 1ZARA 3MWMA 4HHJA 1DTTA 3HSRA 2HNZA 2R7ZJ 2KL4A 1HNXF 1T05A 4ILMA 3BG6A 2E44A 4ZHRA 4KA4A 3AOAA 1T9VA 2M5WA 1S1UA 3UCGA 3HHLB 1GXQA 1R6VA 5LGNA 3UNYA 1Y00A 3U02A 2H6CA 2WB1N 3J7AO 4J7CA 3T3FA 2Z1DA 3NLCA 2V8DA 4WCEQ 1LEAA 2MSTA 3JXOA 1F3FA 1H7XA 2DB1A 4Y65A 2HURA 4YIRX 1KLMB 1T05B 5FD5A 3A8EA 4DPUA 2HIQA 5IWAF 2UVUA 3H0DA 1BOAA 4IR9A 1XQIA 4I56A 1R7IA 3ILIA 3BDDA 1A04A 4WWCA 3W9HA 4DHVA 3KK3B 1WELA 2OC6A 3HVTB 1IKVB 4RLEA 3A0HC 2CZVC 3HHGA 2XS5A 2V9VA 4QPTA 3ZC4A 3DHXA 1YJVA 2OFGX 3TA1A 4PCQA 5KFYA 2HHTA 3BV8A 4FS1A 1M0SA 5IT3A 2HGCA 2CADA 3V7RA 4GKJJ 2CQ4A 3RB6A 4GRSA 2C3PA 2QO3A 1S6QB 4XQFA 5EGOA 3O2PE 4ZDOA 5JFRA 3D6TB 1SKUB 5IYDJ 1RU1A 4MQ9F 2ZBRA 3H36A 2ISZA 1NSPA 3SCKE 2CG4A 4DR7J 4A8MP 2DGQA 4XKWA 4R5PA 2WBRA 5FKKA 3NP5A 3QFWA 2ZJQF 2V79A 4HQMA 2IT0A 2I1RA 4XLPF 4LFCF 1C1BA 1QHHD 4C98A 4RNMA 3HSFA 1ZAOA 3DOMA 4OLOA 2E7WA 4Y34A 1POGA 4AUXA 3TAMA 1NHAA 3BWGA 4ID5B 3D54A 5DZ6A 4U0WA 1FX4A 3AKZA 4DR2F 2I38A 5DD4A 1UTAA 2CPDA 4K50A 4CH7A 2B3TB 2HS3A 2DQRA 4CLLA 3ZZYA 1BJZA 3GZ6A 2BW2A 1SCJB 3BJOA 2VKRA 2I8DA 4L76A 3HVWA 2DA3A 3HM5A 3BR1A 3SDGA 2JSXA 3HKZD 4OX8A 5KFWA 4J9QA 2G0IA 1CPZA 5DD8A 4B08A 3W2AA 2VC0A 3EPZA 2A18A 2XF7A 5KFNA 2OH2A 2NVYJ 4MK9A 1IN6A 1YZ6A 5LL6d 3OIQA 3HJFA 2E19A 1Y0HA 3QGPA 4OYMA 1RDRA 1EF4A 1V3ZA 5HI7A 2G4BA 4GGGA 1YI2I 2XMMA 4UXNA 2VH7A 2E1NA 3JSYA 1FTZA 1UA1A 4QWDA 1VRUA 2A10A 4ILRA 3BS9A 2HQNA 3OJUA 3CSKA 3UI3A 4BS2A 4MMOA 3CCZA 1EAYC 1J2VA 2MGQA 1T6SA 3ZCOA 3BQ0A 2FB0A 3S1TA 5KFHA 1BQMB 2R7VA 4R1HA 4LFAJ 1HNVA 5ERIA 1NLKL 2ROGA 3ERMA 4I7HA 3DTEA 1SC3B 3R1HA 2ZH4A 1FDNA 4NMLA 1S1XB 2Z0GA 2JLFA 2MQPA 2JH3A 3TX8A 1WVRA 2FYXA 1X4OA 1XGNA 2DGVA 3P49B 4E98A 1X1CA 1FDBA 2NR0A 3PQKA 3ZFVA 1VR6A 3I31A 2CUEA 4DCJB 4UW2A 1QGPA 3QPTA 3GJRB 2KFZA 3K5PA 1SH2A 4ELUA 3ET6B 3A3OB 2CPFA 3BGRA 2WAQD 2Z2ZA 4Y17A 2OCEA 2OO4A 2NXCA 5HROB 2X6WA 4XKBA 2RKIA 3DC2A 3ISNC 1P9YA 4KICA 4Q2LA 3BSNA 1WG5A 3G86A 4XORA 2H5EA 3VAJA 4WXCA 1HI0P 4LREA 3I4HX 1TQIA 4JI4J 3C2HA 4DZDA 1J7KA 1NK3P 4RBVA 4P7VA 3BJAA 3DRSB 3G87A 3FHZA 1WJ9A 2WCXA 2YPRA 4RKUC 4I2QA 5DV5A 2ZH8A 3M30A 1OPCA 2CIMA 3FSXA 4XONA 2NAZA 1X8DA 2QVOA 1UFLA 2ZXIA 2AXLA 2DNQA 5IWAJ 1FJEB 2EFWA 2L4AA 3J80K 1IKWB 3CJKA 4ZKAA 2W7PA 3S1RJ 2V50A 1QE1B 4P2XA 3ZTQA 3MMCB 3MEKA 1ITPA 3MM6A 2XMWA 1B9MA 1Q79A 3BROA 5EGYA 2M8EA 4HAMA 4OL8A 4J9VA 1S0OA 1TZLA 3OLBA 2EA4A 1VCTA 1T94A 3BKTA 5IS2A 2W9BA 4BBRJ 5HS8A 2OA4A 4K59A 3BYRA 1PBAA 3IV5A 5I3UA 2XO7A 5GAEI 4XTTA 2NQPA 1DLOB 5D8KB 2QFIA 3GTLJ 3DYAB 4ZPAA 4ILLA 3CCSS 4LUBA 5M5XJ 1BR2A 2HFVA 2MYSA 3QJJA 1JJCB 2R7UA 3EYIA 3PNVA 4X65J 2M70A 1W4MA 3A0BC 2EZLA 2ACMA 3NRVA 4DSJA 4C8OA 4ENJA 1K4TA 5K5QA 3A4TA 1F5AA 4EBDA 3W9IA 2ZH1A 4NRUA 5CKTA 1RAEB 3EX7B 1FYMA 4B3RF 4LG3A 5HJYA 5J1EA 1FRMA 5DDQC 1GMWD 4M3GA 4LJMA 1FJ7A 1FVSA 3SZGA 4FF4A 4AL5A 2QLWA 2NPFA 3WX4A 1FKOA 2Y0SA 3IP4B 4EJVA 3IRQA 1QPMA 3PFYA 2RQQA 2N8GA 1JHHA 1UB9A 2LU2A 2VT3A 2NYXA 4L9NA 2ETHA 4WJBA 3GYGA 1Z91A 5EUHA 4DR5F 4GCVA 3PYEA 4KPYA 1WGXA 2IRFG 2XCPA 3VYUB 1BMQB 3RBEA 3HKWA 4LD5A 1S0MA 4ZN1A 4CWBA 2R8IA 5LRRA 2MLYA 1HHSA 4DU8A 3ZZPA 3BEGB 2AZ3A 2B4PA 2LKXA 3GMEA 1B3TA 1UETA 3H2LA 1HNVB 1HI1A 4I64A 2XSJA 4P7TA 4L9VA 2XNRA 4OZJA 2QA4I 2CNOB 5LSLA 2HLTA 2AX1A 3ESWB 3HHEA 2ZKZA 3TUPA 1HW9A 3D5SC 3R4KA 1RC9A 5HMXA 3VAGA 2MJNA 1W7WA 4IG0B 4WPAA 2W2PP 1RHUB 3KK2A 2RRBA 3FBIB 3BZCA 2ZH6A 5E8GA 4JI0F 2E1PA 4O3SA 2FQQB 1HNZJ 3FX3A 2UXXA 3ZGKA 1SJRA 2Z5UA 1PP7U 2AGOA 1Q95G 5K8OA 1DFDA 2YTCA 2D74B 3M6WA 1XC9A 1D1CA 1X5TA 3AL0B 1WHYA 3KFWX 4JX6A 5ETKA 2ZD1B 4ES2A 3HJEA 4F3QA 4IQ4A 5C42B 3DDIA 2VFUA 4H4OB 3DLKB 2DR9A 3H5AA 4I98B 4NPOA 4OX7A 2ILYA 2CW8A 1U2RA 4XDCA 1KP6A 4O3QA 1T08B 4AQYF 2JEIA 3ZQIA 4F26A 4ESBA 3TP0A 1N52B 2ZH5A 4X2BA 1K0VA 5CH7B 5AE3A 1KLNA 1N5SA 4DL3A 4JOUA 1CF7A 3SI8A 2BY2A 2HXIA 5FLXZ 4CHUA 3M3YJ 4FASD 5DDRC 4CO5A 2V1NA 1PYTA 3CJ3A 2OF7A 3TAMB 1VQOS 2RVCA 2XPUA 3EUHA 3EDRB 4LF6F 3HYIA 4M5MA 4FYXB 5LOQA 5T41A 4LSNB 1F5BA 4Z2YA 2KJCA 4LF4J 1LDDA 1P1LA 4GFBA 3I71A 2NRAC 4OYIA 4R5PB 1ORKA 4LB5A 4IOCF 3I0SA 3E8OA 1U0HA 2K2PA 1DARA 3MFHA 2UUAJ 3C3WA 2LY2A 3B8HA 1A9NB 5EGOB 3U21A 3SQNA 2YX4A 2P8IA 3FM3A 3FKBA 1DU0A 4LR9A 2HRUA 3FK4A 4RDUA 2CW7A 3ZMTA 2FZCB 1OY6A 2XUBA 1TL4A 5H9FK 4CDIA 3HPGA 1XPXA 1QVTA 1BC8C 2QQ9A 4ON0A 3MEDB 4JI2F 1NDKA 4C8ZA 3G6EI 2F4MB 2PMWA 2ZHAA 2L02A 2XF5A 3FM5A 1ACMB 4Q7AA 4ECZA 3QSYB 1R8CA 4DG1A 2HQDA 3EZOA 3WHIA 2J5OA 2VUGA 3LA0A 3EGWB 1IBCB 5DQIA 2IAIA 3UD5A 2VQHA 3CDWA 2DMPA 1RWXB 2YH0A 4ZPCA 2KXFA 3WU0A 4M5JA 3LA3A 4E7LA 2L9RA 1YJUA 4Y2IA 1N36J 1SQEA 3CJQB 2H4WB 2X3DA 3ZTOA 1U0SA 1AW0A 3BPVA 2BQ3A 4W92B 4X1EA 4QWCA 3CP2A 4AYBN 4HRIA 4X6AJ 5M2UA 1S5ZA 1RHQB 3I9V9 2EIJH 2TRTA 3ZQQA 4C9YA 1NU4A 3ZO7A 2CPIA 1BC6A 3O8HA 4F7VA 3K4JA 4Y3OA 5KT2A 4Q8FA 3CE8A 1WHUA 4WK3A 2YKAA 3KHRA 1GX6A 5CLSA 4EVIA 2IDLA 4PQUA 3DN9A 2IMOA 3BOQA 5DS9A 3MZ8A 3G96A 2GHVC 3RCOA 4H4MA 5C25B 3W1YC 4ED1A 1HFEL 1S3JA 1VIXA 5F64A 2K86A 2DNMA 2UUCJ 4ZITA 1LDJA 3T6BA 3PZPA 4JI3J 2CJ9A 1YWXA 4ASNA 4B4CA 1IBLJ 2UXCF 1U1PA 3RKXA 2DYSH 3CVKA 3IBCB 1UKUA 2DRDA 1MMSA 2ZCWA 4F36A 3F56A 1ETWA 3Q2SC 1S0NA 2J9DE 4BXUA 1P8GA 2MMYA 3UVJA 3EUNA 3M8ZA 2D1CA 2KZMA 4DQIA 2G0JA 4WXWA 4ZK7M 5K7FA 1H8AC 1E6VB 3DLHA 2OHDA 5DZ7A 5ETNA 3WTYC 5GAGU 3K1NA 1T03B 2W2OP 1TFWA 3UDVA 3EMTA 1MKMA 4KT5C 3QIDA 2QL9B 3OYIA 3K5LA 2Y31A 2VOPA 1UHSA 5FJ4A 1RZ4A 3QWUA 2H1KA 3NAIA 3FSYA 3LW5C 2PMUA 2X1AA 4A93J 2VG6A 1FPQA 1XNRF 3PIPQ 3B78A 1UW9A 4NLSA 2QSGX 2EV5A 3V4GA 2DNHA 2KB2A 4AL6A 1RAJA 3R60A 2UXBF 2DO7A 1SD5A 2B0GA 5CYMB 3BBCA 1ZKGA 2Y1RI 2MQQA 3D6MB 3CC7I 2XWXA 3DI6B 1R8BA 3WTVC 1RWNB 3AH6A 4F04B 4C3HJ 4ZLNA 3I3LA 2HEKA 2HVQA 5A76A 3QJLA 1V4RA 3J81U 4DOZA 5EEAA 4GO7X 3UPFA 2H09A 4CH0S 3MZIA 4LRDA 1AUSL 3G4SS 2QL5B 1VBYA 5LEKA 3GXOA 1VHIA 2QLZA 2L41A 1M5SA 1AKHB 3PIOF 3S16J 1S48A 4NLVA 2GQCA 4E0DA 1IBMJ 4Q5SF 4CO8A 3E6CC 2DPIA 2RAQA 4MK8A 1U09A 1SEUA 5ILUA 4QR0A 5A2QK 1V5FA 4KYWA 4JYAF 4QU7A 1PSDA 5JVHQ 5ETSA 4RW8A 5HODA 1XX5A 1GT0C 3LP0B 5HP1A 2HYIB 5E17F 2F4VJ 2WW4A 1D8YA 4UY8I 1S7HA 3ITHB 4C0OC 4YY3F 2JQ7A 3T1HJ 3QPIA 5JHFA 4F55A 3M4OJ 5DYMA 1YQHA 4XN0A 1EKEA 1ZR4A 4ZCLA 3IA0A 4C8LA 5D77A 2QQ8A 1RSCA 3RYLA 5I4MA 2C2NA 2KXHA 1GXLA 4UVCA 2MSYA 3JRFA 2M87A 4RS8A 2FJAB 4UOFA 4RBTA 3ZMUA 1XD7A 4RNOA 3HRTA 1DP3A 2IVFB 4K4UA 5AIQA 1NKBA 2F4OB 4GYIA 1S9EA 3CDHA 4CO2A 5K8NA 2UUBJ 4KHPF 1X9MA 2XMJA 2LBFA 3OYJA 1Y1VJ 2GVZB 1CG2A 1VQNI 1C0UA 4URGA 1Z2ZA 4QIGA 3WX8A 1TKZB 1A6LA 5E7OB 5HANA 1YHQS 1OSCA 3CCRS 3DFEA 2VG7B 4RJVA 2CQNA 2J76E 2NXNB 1QDUB 3QMQA 1AB8A 4M94A 2MG4A 2KI2A 4FBUA 2XAJA 4OIOF 4DR1F 3O44A 1H9TA 2OSQA 3NGUA 5H9EK 3H90A 1JLQA 3GFHA 3Q8YA 3N0VA 2L7FP 1CULB 4ICLB 2V63A 4M5DB 3Q24A 4TU8A 2OMOA 5DCMA 1RXOB 3GFLA 5A0YB 1TNSA 2VJIA 4DQRA 5D0GA 4EGLA 3P8BB 1MH4A 4UY8T 2BXJA 2M7SA 3A03A 2RDJA 1KKHA 2CUJA 3MOJB 1VC0A 3JQKA 1S59A 3MAQA 2LVSA 3OTEA 1PUFB 2FVQA 3D67A 2XY6A 2ALZA 5IV3A 1U1RA 2UV1A 3K4KA 3QJPA 1OCOH 3C1DA 3OYHA 3CUNA 4NLOA 4DPTA 2CJKA 5DLFA 1TL7A 4JI1J 3UN5A 2FJ1A 1ZM4A 2BACA 1HYSA 3GW2A 3PUBA 2ZH3A 1GMUA 5HLFB 2FZKB 1VTNC 2L7KA 4DSEA 3M7VA 5CA5A 1Q1VA 2RF2B 3F0CA 2GBYA 1MWQA 3PUFA 1Z1DA 1SD7A 4I7FB 3MPYA 2W4PA 3DKDA 4HKQA 2VBZA 5G0RA 4ICLA 3P3DA 2GWRA 3V42A 4QW9A 3DEWA 4WCGA 2QA4G 4DF4A 4USTA 1N5QA 3W3CA 3OYFA 4ZMMA 3HOSA 2BANB 4I2PA 1D1BA 3HJVA 4HF1A 2AYBA 1GMWA 2UUBF 2VL8A 4A3JJ 1XS9A 4CDGA 3FHNA 2COLA 1OJLA 1S79A 2I5UA 1LWFA 2ZBKA 2IVYA 3ABTA 4UOCA 4NI2A 5IYBJ 3LH2S 2V8GA 4HSRA 1CC7A 1N5TA 2ZVSA 2Y0SD 1RA7A 4KFBB 2G13A 1SL1A 1JJ6C 5F0WA 5M2PA 4C8MA 4PUOA 5HVFA 3VALA 4QU6A 3L09A 4R79A 1R22A 1AUDA 3L3CA 1FOXA 3NEUA 4J9NA 2LKPA 4V2FA 3JS9A 2HQRA 4MYUA 2Q66A 3FNNA 5KG4A 1SFKA 5HK4A 1OCTC 4S0HB 2Y30A 2RF2A 3F9KA 4I67A 3TX0A 2CZ9A 3I56I 4WF9Q 3SZ2A 3FZ2A 5HLFA 3DBHB 3AOCA 1BWVA 4ZPDA 3TAQA 3CD5A 2HQIA 4XO0A 1HYSB 2HAIA 4IPAA 3KCCA 3R5CA 2VFRA 1QO0D 2DNLA 4K5RA 3MM8B 3HFVA 3KZIC 2XIGA 1LE8B 2DOFA 3D3CJ 2F8EX 3LP0A 4HACB 2XSJC 1OLTA 2KT2A 4U9RA 4BCAA 2Q2EB 3L2RA 1JB0C 1LFUP 1RT4A 4FHTA 1O0PA 1RISA 2VHGA 3K7RA 1WI8A 2X1DA 2ZXHA 3NMRA 4B48A 3RI4A 4B1RA 5BPDA 1TQMA 4DWIA 3MEXA 2ELHA 2IYIA 3VOEA 3PO5A 5A0YA 5C24B 1S6PA 2VBYA 4UZCA 2FD5A 3DRYA 4O0NA 2YU3A 1VIOA 3J7AN 1JE8A 5J1UA 3OY9A 2DIUA 4NL5A 4A0YA 3FMQA 4IJAA 4HNVA 1HBUB 5D8LB 2OGUA 4KSEB 3BZQA 4ED8A 2R8KA 1FSHA 2WV0A 2V2QA 4YDXA 8AT1B 3HBLA 2FQ3A 1DAXA 1KU3A 1EX8A 1XMOF 3NL0A 1B0TA 1JKPC 3L00A 1FYLA 4USIA 2AF6A 4HHHA 4NC7A 4LRFA 2YNGB 2VG7A 4DX8H 4ZJLA 4LF8J 3JAMK 3COAC 1ETOA 3FISA 1KGSA 2LOOA 2M8GX 4LIVA 3MF5A 2FZGB 4LVOP 4U7CA 3E7LA 1T9WA 1TELA 2LVWA 3ILOA 3CDIA 2ZJQQ 4JV1A 3OL7A 1JLFA 1B4AA 3BZ6A 5BQTA 1H72C 4I09A 4ZA1A 3AJ2A 4B3OA 4A8QA 3ISZA 1TUVA 1FIPA 1WJAA 5GPAA 3AAWB 2A5YB 3Q9VA 3JRCA 1S9EB 4YN3B 4F4XA 1VOMA 5HMZA 1KSPA 4HSTA 3MTKA 4WKYA 1FOYA 4CSWA 4EGYA 5LMNF 2WRMA 3I96A 3ULHA 3BCBA 5B66C 4QR2A 3ZNUA 1NG6A 3MD1A 4HR2A 2R4GA 1U8SA 1VQ5I 4RPFA 4ZPTR 3HT0A 2LQBA 2VICA 2J6TA 1U5TC 3V6JA 4CXFA 3Q89A 4I68A 2DLLA 2YX1A 3N4MA 4X0GA 4KNYA 3C2GA 1VQSA 5LLQA 1J27A 5DRKA 1WOOA 3SHFA 3K70D 3SYZA 2WC2A 4OI2A 2MLGA 2CXEA 2KDOA 1NHKL 3KUGA 2ZHOA 2K5CA 1ZM2A 3N01A 4IHVA 3W6VA 1S6UA 3VVTA 3UQSA 1GTEA 3LANA 4H4MB 2AGPA 1RUSA 2LP4A 4Y52J 5L1JA 1CJKB 2ATLA 3BGLA 3FXOA 2MZRA 2XB0X 2DMNA 3DLGB 3L2VA 1RTHB 4NCGB 3CC4S 2I2YA 2E1MB 3X3UA 3IWXA 3P5TL 3V5RA 4TY9A 2K27A 4C3JJ 5ILVA 2XMVA 2QF7A 1S9FA 1R43A 2W1BA 4YR0A 1FI4A 1GXPA 4V1Ak 5DM6Q 2BY3A 2LCWA 2BGCA 3BR6A 3MKZA 1V5EA 2E9ZA 1ZRFA 2XY5A 1YRNB 3ZZ0A 3M8RA 3FEYB 2EZHA 4RAYA 1K8AT 2ZMEB 4YFNF 3TEHB 1IRGA 3Q2TC 1MMDA 4J9RA 1S6OA 2VPWB 2LTPA 3QQCD 1OR7C 1TKXB 2PBIA 1R23A 2B0LA 2Y75A 1E17A 1B99A 4YR2A 5FLVA 2Q6CA 2BRLA 2YQ1A 4RWXA 3ELHA 1G59A 2AEFA 4R25A 2D45A 1FEXA 1UZDA 1HSTA 2CQXA 1MWYA 4CYCB 3DTIA 2V5HG 1T3NA 2NSCA 4Y33A 3NGTA 2M1BA 3OYDA 2QSFX 1W5SA 1XR7A 2NVXJ 3ABKH 4KJZA 2Y1IA 3H5NA 4CNZA 3HGYA 3BSAA 1SANA 4HH0A 4OHVA 5E3RA 1VS3A 2QYGA 4XPCA 5L3CA 1IDYA 4OJGA 4KHRA 2YNFB 2W9CB 2RRNA 3CQZJ 4N4OB 2HRYA 3BN7A 1A5JA 2RHQB 1F1ZA 2L3MA 5KOWA 3R5GA 1P27B 3PM1A 4BY1J 2QSHX 3O8WA 2EW9A 3FSIA 1DQAA 4EGZA 1VC6A 1IBLF 2KTQA 2DFEA 1G3WA 4MHGA 4KFCA 5BPIA 4P1WA 3WC2A 1W5CC 4E7ZA 3PJXA 3T5LA 5CYJA 3LSRA 2M4KA 4DLEA 3F3XA 4NASA 1XTAA 4XRMA 1TL5A 2Z57B 3S2HJ 4L72B 1GAOA 2V34A 5AT1B 1XNQJ 3LP2A 4NLPA 1EA3A 3HT3A 2O5DA 1RAFB 2ZJRQ 2NOJB 3C16B 3T6JA 3PKMA 1VZ0A 1GVDA 3QIPB 5H9EJ 3EXYA 1B9NA 1K0TA 4A0ZA 3E5QA 3C66A 3E5UA 1T9UA 1IVZA 3JSMB 4EEYA 3C8YA 3ICLA 1YLFA 4M6VA 1NDCA 1RPWA 2LLZA 1OMSA 1JUSA 1OYDA 4F0HA 1ZM9A 3W9JA 1MMAA 4M5IA 4Z7CA 2IGKA 2CJJA 1B6AA 2OD6A 5CVVA 1WPKA 3H4DA 1TW2A 1VLYA 5IT9Z 5IYCJ 3BTIA 2XAFA 2CAJA 4U87A 4N8NA 1BW6A 4Q47A 2HQFA 2CQ1A 3JTGA 2RHSB 4IRDA 1NDLA 4HVZA 2XGDA 3NMAA 4ZLLA 4EK2A 1Z7UA 5HMWA 3HZJA 1PJ7A 2HVRA 3U1LA 3GIRA 2DKOB 4C8YA 2VQLA 1O6XA 1TVRA 3I0RA 2R2RA 3LWFA 3G6YA 4ZCMA 1SVLA 2WB4A 4ENOA 2GC8A 2R42A 2JJ7A 1FKPA 2KIUA 3GYXB 2K7JA 3QGHA 2IRXA 2DTRA 1DJ0A 1LKZA 1D5VA 3OS2A 4IHSA 2AJ1A 5L3EA 5K7ZA 3IAM2 2UP1A 3OSPA 3I32A 2DCLA 4P9SA 2DNOA 2RDIA 3W7BA 4RO0A 2EXUA 3PX4A 2QGUA 1UFWA 1VRTB 2DPJA 3P96A 5F8JA 1H0MA 1TTYA 3QATA 1NB7A 1C4CA 2RH3A 5FFZA 5B7WA 4B09A 1ZPVA 2VOOA 2DI3A 1SUQB 3TW0A 3CMAI 1JKRC 1RWWB 1U0HB 5KG6A 4JI2J 3M8PB 4OZLA 3KLEB 4KQZA 2YWGA 3G73A 1P4WA 3GCMA 4A3IJ 5ICEA 3SZTA 5FJ8J 3CCMS 3FXRA 3K4NA 1RP5A 2K9NA 2HPIA 2MGZB 3NY0A 1P6TA 2ID6A 1JLAA 3BJYA 3CMYA 1X5OA 3LNQA 3OSFA 1WUUA 2L9WA 3DOKA 4QWBA 5FB2A 1BI3A 2NVTJ 3THTA 1N4LA 2GVDA 2E1RA 3PSIA 1HMVB 1VHFA 1FSEA 3POTB 1A31A 3R7SB 3RJPA 2CSOA 2RMLA 1GV5A 1FKOB 5BNGA 1R7JA 5BR8J 2XC9A 3LAJA 2RN7A 2IM2A 1TK0A 1W7PA 4A4JA 3GJQB 3KP5A 2IS6A 4K0KJ 3TQEA 4IEJA 1CGPA 2HG4A 4D0PA 2ZNYA 1U25A 1W26A 3BGFA 1CS4A 4OZ3A 5J1EB 2F5GA 3BR0A 1PUEE 3DOLA 5AXKA 4ED4A 5HDNA 5F3ZA 2V68A 2R7OA 2DRBA 1N34F 2CQKA 2DODA 2ZKTA 4A3GJ 1UZHA 1EZZB 2MXYA 2V4JB 2VKHA 3OTOJ 3HXMA 2XGCA 1RBAA 3BT9A 1R5GA 1FT9A 2A61A 2FF4A 5J1YA 1XGSA 4XNFA 5EN1A 1TWAJ 5SZTA 4TN2A 4KIBA 3OTOF 1HQUA 2UVWA 2B9YA 4AFFA 4F92B 2P0WA 1S12A 1YJNS 5LFAA 2P5KA 1RGVA 1LWCB 4IG3A 2AO9A 2AEMA 3QU6A 1YJWI 1TV6A 4DX7A 2QLJB 5LMUF 4J91A 2CU7A 2IAJB 5KG2A 2DDBA 5DDOC 2C2RA 3DLEA 2L5QA 5E8IA 2N7CA 2J8SA 3GBGA 2QL7B 2DD8S 2JA7J 4NNJA 2HFHA 5JVGQ 2WONA 2OPRB 1J0RA 1X9SA 1U1KA 1DURA 4QBUA 4XKVA 3CCLS 2MW8A 5D4NA 1ZTWA 4C2MA 2D1HA 2R7TA 3MEEA 1Q7YT 2IC3B 4B9VA 1JI8A 4USKA 2OEMA 4JUZA 4A3LJ 4IHWA 4R8UA 1QHGA 2GM4A 2C3YA 2VD3A 4QW8A 3BO2A 4I2QB 1WI3A 4GDFA 4C48A 4X62F 3KEQA 3JRAA 3N97A 3G71S 4G7HF 2MA3A 4FBTA 3HGGA 3CO9A 5ADZA 3AG4H 1UJ6A 2OTJI 4NCAA 1S4EA 2WVCA 3LL7A 3RPUD 2LFVA 2HPMA 3HHLD 1R1VA 3E5XA 1CJTA 3PIPF 2MDAA 1HPZB 1SC6A 2QA1A 2LEBA 4LF9J 3HOZJ 4BKXA 1SD6A 1I3AA 4QZVB 2RKIB 2MFZA 5HROA 2DGUA 2M4GA 3M9OB 1UFMA 3G1OA 1X4EA 3KOAA 1HIYA 4ZJZA 3EVMA 3ET6A 4UUXA 5GADU 1FIAA 3M8JA 3DRPA 3TDZC 1DZ5A 1NB2A 3RB0A 4UQGA 3EPIA 1MWZA 4CCMA 3A8IA 3CO0P 5KFTA 1RUNA 1VQ8I 2W24A 3M9MB 4QIWD 3ELKA 3F8NA 3OR2A 2H54B 3B6BA 2JN6A 3C6UB 4Y4RA 4B9LA 2FC9A 4MKBA 3GV7B 3K7AJ 1MNEA 4DV6J 3QYBA 5HO4A 4K4ZA 2WK4A 4XK8C 3SV3A 5KT3A 2ZSHB 1OYIA 2X4HA 3KZYA 2AJ0A 2OPRA 1X3WB 3FMWA 3L7OA 3G8QA 2KKOA 1BQMA 4UY85 2JVOA 2DQLA 5B1BH 1H73A 3DLEB 4TYAA 2LECA 5J2QB 1VQ9S 3KYDB 5CJ9A 5JXSA 1S77D 1HNWJ 3R7NB 5B3SH 1QTNB 1G4DA 2OMLA 1SJFA 2XG8A 1JT0A 3IL2A 4HBLA 4HEA2 3KJVB 1TR0A 1FEHA 1R6YA 2IA1A 1AA7A 5KFLA 4BQNA 3S15J 6PAXA 1UCNA 3K9TA 2J6UA 1QAXA 1WSRA 1D0EA 4O5VA 2DNPA 4OINF 4JQFA 2STWA 2J6SA 1RJJA 3FRYA 3TVYA 1Z0XA 3DRSA 4IO1A 2KHDA 3LSGA 2W48A 3TBIA 3BKUA 4NLWA 2R0QC 3E51A 3M2VA 1IR1A 1U02A 3BTCA 1R49A 4UUVA 2ZE2A 2M8DB 1SI9A 3BPDA 1FNMA 2P6SA 1RHMB 3KNAA 3OJSA 5BMZA 1JXSA 1CS4B 3V7CA 3QOEA 1QAJA 3MKYB 5GAHI 2FC8A 2HBQB 3BGRB 4IH7A 2DHHA 3LUYA 3JQMA 2DH7A 5HLIA 4M5LA 5BR8F 3G8TA 3RBDA 1RR7A 1NJZA 2XV4S 1UVKA 1D3YA 3POTA 1V9OA 2EFOA 2HOEA 1IR2A 4YELA 4HYEA 3I56S 4U6PA 5ICFA 3PFOA 2G0CA 3DOKB 3MR2A 4WFZA 3QRRA 2MGZA 5J4YA 4G7OF 3W65A 4KH1B 3PO3J 4IOAF 3M1VA 2JX2A 1LW0B 1AHDP 2QYCA 1VBZA 4Q45A 2OFHX 1VQLI 3KLEA 3RR7A 4ZPWR 4DFMA 3FEZA 2A3SA 2Y2ZA 4PXDA 3IAS2 1OY9A 3J81Z 4YB5A 2Y3YA 3CC2S 1BXNA 3G82B 2HXOA 1BGXT 4JYAJ 5J2NA 4RU2A 2ATCB 3G6VA 2VC1A 1RE1B 4JI6F 3DKWA 2FVSA 5E3AA 1XEZA 3TW6A 2RAEA 4X65F 2E5LF 1HNWF 3D3BJ 2ZOGA 3AL0C 3QRFF 1HKQA 2O7OA 4ZTJA 3IG1B 5B0AA 1U3EM 4YB1P 3MURP 3FRZA 4NXNF 3KK3A 4HV6A 4M9XA 4DQSA 1SPBP 3MAAB 5CVUA 2BMBA 1QQIA 2YWFA 4ZP7A 1RTDB 1V3FA 5AE1A 2AIRB 4PFOA 4O23A 1JJ4A 1R9TJ 4E4HA 1KLMA 3I0RB 3NGRA 4X64F 2B7CB 5KFRA 5E3PA 3IGVA 3KP2A 5F8GA 3TAPA 1MJBA 3PHEA 5IOLA 3HPOA 2DTZA 5KAFC 1UWAA 3RW6A 1RT2B 2WSCC 3RBXA 5D0EA 4KGZB 1OWXA 3NS6A 3KXDA 2G9OA 1GDTA 2BQRA 1K4SA 4ID5A 3FZVA 2RKHA 4CLPA 3V7SA 1RWMB 2DA5A 2FHJD 1KVKA 1ZA1B 4DV7F 1SJ4P 2YKNA 3CULA 2L9SA 2K8GA 3FXLA 2KHMA 1YIJI 1HWKA 1TQPA 4CLTA 3AQOA 2HMIB 3HTUA 2W85A 1H2UX 4A8WA 2V0NA 4OX9J 1B1BA 2H5JB 3LP2B 2ZWOA 4MIBA 3L2UA 3SQGA 1NHUA 5JLWA 2CS3A 4QOTA 1R8HA 3GPAA 1ETYA 2EC0A 2VV5A 2L54A 1IDZA 1FCAA 2RU3A 3MQ0A 4YUDA 3GIIA 3D0HE 4ECSA 3L7PA 2ESHA 3O8GA 1U49A 4Y7NJ 1UEVA 4KV8A 3HSEA 4ZPVR 3ZPLA 1WJFA 1RT3B 1TC3C 4ZVUB 1X9WA 1R8AA 1T0FC 1YOVB 3CCVS 3P5JA 1AROP 2BJDA 3E3XA 2Y0BB 4BQQA 3H2VE 3Q0VA 1HHQA 1VQKI 5DJBA 3PSFA 2B4OA 2YNHA 3PX0A 2MZSA 4XSXF 1YBAA 3PR5B 5M5WJ 3IC7A 2R7QA 1RBOB 1CJUB 1SBRA 5KFJA 5F41A 5IFMA 2HHHJ 2PEXA 1WEXA 2IEKA 2CWXA 4LF5F 4HF0A 4WFXA 5HJXA 3K1PA 2O01C 4D3GA 1T98A 1B72B 3U27A 2W84A 3LSJA 4U0YA 4GC6A 2XRNA 1JUMA 1S72I 3T5KA 2P9CA 1RETA 1GQEA 2HS0A 3DBLB 2PE8A 3HHLA 1SL0A 4EYHB 1QBJA 1OQ3A 2Z2YB 3SDEA 2X85A 4XLEA 2GCFA 3LAKA 1I1GA 2BJ9A 4ER8A 3VAFA 1WI6A 2EK6A 3J80Y 1WEYA 1SV5B 3OR1A 4RW4A 4DR3F 3PEJA 1OCCH 2UXBJ 5DGAA 1BI0A 4KN4X 1B0VA 1X58A 2CA9A 5KFUA 3DGPB 4RW7B 3CJ0A 1LVKA 5FRNA 1LEBA 2C3UA 3HOYJ 3TJ9A 3KJQB 3KK1B 1XGOA 3C14A 1RADB 2I5JA 1S99A 4HLBA 4ZYGA 1XSXA 2GJFA 5IXUA 3MDFA 2HQ5A 4OZ0A 3DFGA 2DFIA 2MZ1A 1WKKA 3UN2A 2CV0A 5BYSA 3C18A 4HHUA 4C0BA 2AHQA 3HTSB 4NZ7A 4ED7A 3JSPA 3RB3A 1W2IA 1SFUA 1FMWA 1IWAA 3M1VB 4KUMA 5DG9A 3E01B 2GJ2A 1IN8A 1EKSA 4UVBA 4I6YA 2EV6A 1HQEB 2O61A 4IFVA 4QYRA 1B8IA 2OI2A 4KN7X 2OIHA 2EFPA 2MTLA 2KFYA 3JAMZ 1HHTP 1Q8LA 2E7XA 4O3NA 1O3RA 2MB0B 4Y0FA 4AD6A 4OYZA 1WKMA 5EYRA 4G1QA 4X4SA 4XOTA 1SFXA 5IT9K 4HW0A 5E3MA 1N0VC 1LV5A 1R1TA 1ACIA 2CV2A 2BJ7A 4Z2XA 2PQ8A 4EEFG 2YKOA 1K47A 3DNCA 2D41A 3MZYA 3V8JA 1WOPA 3VWSA 3BTLA 4MLOA 1ZR2A 4EO8A 3H42A 2XB2D 2OEKA 1RQ0A 4G6DA 4OYBA 2O6GE 1W0TA 2K9QA 4P9UA 2YNGA 2V94A 3C3LA 3OUYB 3NARA 3HHNB 4O4GB 1RYRA 3M2VB 4P71A 2V2ZA 3VGTA 2HHWA 4Q44A 1TWFJ 2HPUA 3L2QA 3J7ZT 1JKQC 2V6EA 2F40A 2L3DA 4I6ZA 5F9NA 1RTIA 2A3JA 3IAM9 3ABLH 4LOCA 2BBYA 2E35A 4M3BA 3K1MA 2FJBB 1HBUA 5FLMJ 3RSNA 3CZ6A 2YSRA 2V4RA 4WKRA 3H35A 2QX0A 1BBYA 3M1EA 5DDGA 4RUAA 2MQLA 1P92A 3MMBB 5C24A 1UPPA 4TY8B 2FLPA 1E3PA 3OVBA 4OHZA 4LFUA 2DW4A 4QWAA 3RYPA 3J7Z5 1RT6B 4ZYDA 1MU2B 4G94A 2F63A 1FDAA 1URRA 4FTHA 3DU6A 1VI7A 1DDNA 1EKRA 2AYMA 4FT8A 4HI1A 2O5RA 2YWKA 1EJ9A 1OIAA 5IV4A 2BW7A 2C2DA 3DKXA 1ZRCA 2OPSA 3WTUC 2EILH 3MM8A 5F8LA 3UNGC 1XBWA 4DIQA 4H0EA 2EWHA 3OSNA 2XQCA 3OR2B 1T95A 2FY8A 4NZ0A 5IZHA 1XN9A 2QBYA 3WTZA 1VQ6S 3VGVA 2HHPA 1WC5A 1PAEX 3J81K 3HFZB 3JW4A 4NMXA 3FKIJ 2H8RA 2WOMA 2XY7A 3QAEA 2RQKA 2U2FA 1HQCA 1HWUA 1FWZA 3CMAS 2QM3A 2EB7A 2B7EA 4O44B 4CCNA 2E9TA 1H9GA 3G2XA 2H9ZA 2EIMH 1U48A 3OYGA 5M3MJ 3HFKA 3ZTPA 3GF2A 3JAMY 5D4SA 1HPZA 2C3OA 3N6NA 1AA1B 5AJ3J 2DXFA 4NI2B 4BGDA 2CW0F 3D5LA 3MCMA 2QC3A 2XM3A 4F02A 3RBZA 3N4WA 2MH2A 5HBMA 2BANA 3CF5F 1Y3KA 1YSJA 3BN4A 4DV4F 3PRBA 2BVZA 2MKYA 1UHMA 1MSWD 2K02A 3MM5B 1Q8BA 4I69A 5KAKA 1Y5LB 2NREA 1BI1A 3LPYA 4WFBQ 3OS0A 2O67A 2CWEA 5LEJA 4JI7J 2LG4A 5D0HA 3CIMA 1ENHA 2IVMA 3Q83A 3K10A 2Z2MA 3IKTA 2AU0A 1XMKA 5JI6A 3D68A 3C46A 2DCUB 1ZN2A 1RWUA 4FKXA 1RBLA 3KUEA 3Q23A 1YW8A 2V1DA 3W66A 1IO2A 4IG3B 1HR0J 2CVEA 2HI3A 3EXCX 2VODA 2A69F 1TK5A 1FD8A 2OUMA 2HOTA 4ZYEA 5HSPA 3NOGA 2YPZA 1FEEA 3KP4A 1GEHA 3KUHA 1TUGB 3QPHA 3VHQA 2HFOA 3KKFA 3K69A 2HEOA 1ZTTA 2DHSA 1FDDA 1BC7C 2V4JA 3M8SA 1TBXA 5IM0B 2Z2SB 2VKEA 5HOOA 3TARA 4PABA 3FMRA 3BO3A 1O4XA 2QJ3A 2M7BA 1WOSA 1BQNA 2B6AA 2F4FA 2QT7A 4A2UA 1T0FA 4MTEA 3VWBA 3H5XA 3GJTB 4OFZA 4USMA 5H6RA 2DEJA 1XMQJ 1L3LA 2P6TA 1HARA 3MPDA 3VTIA 1KVJA 5A6WA 2CQPA 3QT6A 3JSBA 4C7QA 1D09B 2FJDB 3IN5A 5C7PA 4BACA 2KL8A 1N5YA 2C2OB 2JHEA 2BE9B 4G3IA 2BRKA 1EQ0A 4KGVB 1ZM3A 5AJ3F 2KKHA 4ECUA 2V2VA 1T9XA 3S17J 2HNHA 1EP4A 1LPQA 2GVZA 2JFDA 2H94A 4MAKA 2L0KA 2MD0A 4L18B 1U2FA 3AD7C 3MMYB 4AVZA 1HLWA 3HPHA 2EZKA 2LFBA 5E3CA 2HZCA 2OPQA 3LGHA 2EBIA 4IQXA 5CABA 2YVSA 4AIDA 4LF4F 3U1KA 1PJRA 4CUGA 1UL3A 4XMYA 5F8NA 3IR5B 2R4FA 5JR3A 4XOPA 1D3WA 1R00A 4PXEA 1VFJA 3SBMA 4UHTA 3GFXA 5K1YA 1FT8A 2TCTA 4DCPB 3MMJA 2FGOA 2VPLA 4IFYA 3FQLA 1R1UA 4B3AA 3HC7A 2HKEA 3SFZA 3QLHB 4RW8B 4RAZA 3GUDA 1NNDA 2XNQA 3D6FB 2ME0A 5LXYA 4USWA 3AB4B 2W00A 2ZITA 4CCHA 5FKOA 1KYWA 3F8CA 1IRZA 1FERA 3ZOBA 2NS8A 1SVDA 2Z99A 3TGNA 1D0ZA 1FTTA 2G7UA 3UR3C 4EJOA 3ZR8X 2STTA 1RHKB 4DNCA 5GTHC 3V8KA 1SH0A 3M7GA 4NLRA 1DBDA 4CCLA 1VMBA 2E36A 5DM7Q 3OYEA 1F9EB 4W90B 2H4YB 5A8RB 1TT0A 3AAFA 2JDJA 3DF8A 3IFEA 3HZEA 2W7OA 4CTAA 4QYZK 4MKAA 5I42B 2PI0A 1P4AA 4BQAA 4FISA 3BR8A 3BSOA 4O3MA 4WIIA 3FCHA 4CT8A 2GJIA 1DUXC 2CPHA 2D1VA 3KMSA 1XJWB 1YYVA 2W7NA 2B8QA 2EG1A 1USSA 4FYVB 2GZOA 3CXCR 3FFIB 1R0BG 3PM9A 5H6QA 2NCKL 1EARA 2QYOA 2FJWA 2JRTA 4JI5F 3GWZA 1YI2S 1X31C 2ZZTA 5H20A 2G2ZA 2ASLA 2HHXA 1WWHA 3BBBA 2IS2A 3WG7H 3EYYA 4EJTA 3DEUA 5CCLA 1T03A 3WE3A 1BIBA 2EEYA 2HWHA 3QODA 4B3TJ 1YJ9I 3MR6A 3CDLA 2KM8B 5KFAA 1FOKA 4RB1A 4HH1A 3VAHA 2IS4A 3HZGA 1BY9A 3Q8PB 4UTGA 1URNA 2DR5A 2LP0A 2XYGB 2RQCA 2JC0A 2MZTA 5KG1A 4A3BJ 3KTQA 1NZ8A 4ZVHA 4Y13A 1K79A 3FMBA 2HVDA 3LSIA 2CJYB 2IS1A 1NH7A 2QGFB 3IO1A 1Z2LA 4PG4A 2XZTB 2BOAA 1KYZA 4G12A 1JQGA 4UOGA 3N79A 5IC6B 5E1ZB 1G3OA 3T0YA 5L3GA 1Z77A 2J9EA 1AT1B 1HD1A 3BTJA 1S76D 3UN3A 2MQOA 2DU9A 4IR1A 1RT1B 1WC1A 5D5VB 4ZYAA 2QQAA 3W6JB 4M63A 2JFKA 1PC5A 3HHLC 2GHWA 2FBIA 2OAUA 4NXMF 2HZAA 1PBUA 4C8NA 5H9FJ 1N6QA 3EJMA 2BHYA 1Q5YA 3R5AA 5KFFA 2BE2B 2HVHA 1REVA 4BXFA 3OW2R 2WVFA 1X3UA 5LT5A 4G9YA 2MKHA 3US5A 4A69C 3R5DA 4U7BA 3LAPA 1HA1A 3IRXA 2FGCA 3TDUC 4OYXA 2P5VA 3NQOA 1VRQC 3BGUA 4EBEA 1AFJA 2FX0A 4C11A 1ZGJA 1LWXA 3GR1A 1DU6A 1FZPB 4Y2MA 2HNDB 4KIFA 1TKXA 5GAEU 5M2RA 3K5NA 5A2QY 1VQ6I 2V9WA 1F4KA 2R5ZA 4PR6A 9RUBA 2ZMEA 2GO9A 2HZVA 4C3KA 4G6TB 1JNRB 4N47A 3EDQB 2MKJA 2I9SA 4RX6A 1ZK8A 3OFFA 5I42A 2HS5A 1MMLA 1VNDA 3RTRA 2KRFA 2FXAA 1QM9A 4U8VA 1AZSB 3OR2C 3HVAA 4F4AA 4L73A 3OFHA 5A8RA 3VYTB 1UWBB 3H9GA 3EQLF 3O6BB 1Q53A 3OYMA 2ZOMA 1RTZA 3L95X 1RTHA 1IRFA 2M7AA 3T8RA 3B73A 1CVJA 1UAWA 5F1RA 3PKYA 1HKTA 5K9FA 3Q0AA 4A8OA 1WF0A 4PJNA 2RU9A 3U2RA 4DGWB 2O66A 5T14A 3SIPB 4YHHJ 4D3HA 4WZQA 4RB2C 3CF2A 3NGKA 1E0EA 4Z37A 4JI6J 1TW3A 5LM7E 3QLHA 2IIHA 3M9AA 4JYKA 4A48A 4BS9A 2FHKA 4F25A 2GQ2A 3CF5Q 2CGPA 5KFGA 1OPZA 3N5BA 1LNWA 1O7LA 3QU3A 5CQGA 3D6HB 4BE2A 1FK9B 4WF2A 3TZYA 2V6AA 3BR5A 2W25A 3L2CA 1WC0A 4RGUA 2BM1A 3P45B 3W60A 4A3FJ 2BA9A 1C2PA 2A05A 4EZ6A 4LB6B 1QAYA 4LMYA 4C3IJ 3EGVA 1WF1A 7FDRA 4B3OB 1SH3A 3K4CA 2DFHA 1H98A 2AJ4A 5EEHA 2F48A 2A07F 2CDQA 3WDOA 2XRLA 4PDKA 1J5OA 4YFXF 3OWTA 4I2OA 3Q0UA 1NK9A 1S7EA 3IH3A 2FUG9 3VYRB 1D1AA 2HFUA 2PMZD 5IPAA 3DLKA 5HL7Q 4M9ZA 4TQSA 2I10A 3GP9A 3S2DJ 4YIFA 1I3QJ 4IUFA 3OYBA 1WACA 2GV1A 3G2BA 3MOZA 1WH7A 4AWXB 3BR2A 1WSVA 1HC8A 5IM0A 1QA6A 4M1KA 3WHCA 3TO8A 1KQ0A 3L1PA 2OKQA 1TKDA 3R97A 1WDTA 2NYIA 5KFBA 4D5CA 1GFWB 3I9V2 3VGUA 3X2QH 4HEA9 2DJIA 3SFGA 1YJ9S 1Q7LB 1CEZA 1WC3A 3KG4A 1TAUA 3DGVA 4MT1A 4DX5A 2L7ZA 2HNYA 2Q2EA 4KH0B 5D3GB 2ZM6F 5F0FA 1ZG5A 1X0FA 4HG2A 5L46A 4WBFA 3H3ZA 4ZVOB 8ATCB 5CVRA 1ZZFA 2VT2A 2R8HA 4IOBA 3IKVA 3DXBA 3QGIA 3OIOA 2B51A 2OELA 5CZXA 2Y48A 2ZNZA 1WKLA 2RNGA 4XLNF 4I1TA 3MM7B 2V2KA 1OY8A 4DR6F 1M5OC 3EUKL 1FFSB 2CUFA 3EUHC 4LFCJ 3RRGA 4KJIA 2EK5A 3WTSC 2HVZA 3K4MA 4LJZF 2L9NA 4B44A 1T0TV 3GCXP 2B9WA 3CCSI 4S0MA 3LFKA 3G3ZA 2IYGA 1C1CB 2VDIA 1HSJA 3BQ2A 2OPQB 5E3QA 1IQTA 1T56A 1OO0B 1QZEA 4FF3A 2ABYA 1J5EF 4BJTA 4KDPA 4IL6C 1NKCA 3FK6A 3BGOP 2CQCA 5KFPA 4P10A 3B6AA 2MZJA 1N5VA 1PDNC 3NG8A 1RKIA 2G2OA 4U7UD 2HWVA 3LPEA 3OVSA 3QYEA 3M2RB 4V19J 2JK3A 2DT9A 1MGTA 4KY3A 1M5VC 2OJED 4QLCU 1B64A 4UT4A 2JLGA 4CT9A 5IOYA 4KMUX 4M8LA 4OZ1A 4DR3J 1QSYA 3ZQHA 2Q8KA 1D5YA 2B6AB 3UD4P 3S6EA 4I2PB 1U6FA 2VKDA 2XAUA 1LUJB 5ETPA 1EIYB 2F1FA 2VPYB 3D5MA 2HHQA 4B8XA 1JGGA 1BR4A 2DOAA 1SKWA 4Q0BA 1FFWB 3ENWA 2YPYA 1HD0A 4OMZA 4LSZB 3HHKA 2HZDA 3A1YG 1VQMI 1FYKA 1MBEA 5C2GA 2X51A 2PX9A 4L9JA 4HNUA 1U7LA 1PJ6A 3DYAA 3TP3A 4DV0F 4KITB 2HDWA 1DLOA 5F6FA 4E70A 2FE3A 4U95A 3IUOA 2W9AA 5E3NA 3DQVC 1X5PA 3EPGA 3ISPA 3BQYA 2R2UA 1JXEA 2XC7A 3H8YA 2AXTC 2PFBA 2B4UA 3HULA 2JSCA 3TUIC 1YDLA 3BO4A 5CAAA 3CEDA 1F9FA 4RNFA 4FXDA 3WU2C 2UVRA 2L48A 4CO1A 2E9RX 5I3QA 2N3OA 2HGNA 4NB5A 2JA2A 3UW1A 1S29A 3KIOA 2B9SA 1L0OC 4G6VB 5E3LA 3A02A 3MN2A 3A4CA 3BH6B 4MH8A 4QIVA 4KYZA 5M5YJ 2P8TA 1QE1A 3K70C 2JZ5A 1FO1A 1QNTA 4P75A 3BG9A 2CQBA 2WBMA 2FHMA 4IHXA 1NHVA 2RQPA 2KH9A 2U1AA 1ODDA 4KIAA 2K1RB 5F08A 3C15B 3MCZA 3WC0A 1CULA 3GSDA 4FNHA 3RQIA 1FBQA 4ITVA 3TW7A 9ATCB 1QLNA 5KNLA 3B82A 3TO7A 3D9BA 4XLAA 2HQAA 2QEXI 5KG5A 1R89A 2ZJPQ 3H5RA 2HDCA 2CQDA 2VG5B 5IT9Y 1AYEA 3OPKA 4NQWA 4O4GA 4AXJA 1TUWA 4BBSJ 4Y6IA 2EI5A 3ZQCA 1EQMA 4F7ZA 3SV4A 2B9EA 1N33F 3MPWA 1UVIA 3GIKA 2XYPB 1VK3A 3CESA 1TT5B 3Q8UA 2L7MP 5J1NA 3HOTA 1JNZB 4LF6J 1A7GE 2O9LA 4MIWA 4ECRA 3BPXA 1D8ZA 3CJRA 2D5VA 1Z05A 3MM9B 4K5SA 1RT7B 3NEKA 3GMGA 1ULRA 1SFEA 5GMDA 2HS4A 1EHWA 5KHDA 1WDDA 1MDMA 1IJWC 1ZRDA 3QO9A 2LQ5A 1U9NA 1W2BR 3PVXA 2VFTA 5F9LA 2FJXA 4GO1A 1RUOA 4OLPA 4OWRB 4GXOA 1IKYA 3SSQA 1B0PA 1Y4ZB 1UVJA 3PO4A 2JPBA 3ITHA 4ELTA 3SCJE 2F5CA 1HF0A 3TO6A 1EH8A 3BCAA 3KLOA 4KBIA 4DPOA 1ZQ3P 5K8PA 4EBCA 5J4VA 2BXYA 4F4ZA 2RV8A 3ABMH 2CPEA 4TLQA 2CQHA 2X1GA 4HL9A 4LR8A 3L7UA 4ZVPB 1WI9A 2J5PA 1VQPS 3NAUA 3CC2I 3HSDA 2IXSA 1X7VA 4OU0A 4BJ5C 3CD6S 1WJEA 4BYYA 2CRLA 4I0WA 2NUUG 2QE5A 3V6HA 4RNHA 3MMBA 1KTQA 1QVUA 2XEXA 2MEWA 1T38A 5C2CA 4AYBA 4WTOB 1F43A 3G6ES 1R0AA 3WHBA 3C14B 4DR4F 4ENNA 3HRMA 4PK4A 1QSSA 2W1OA 2HZTA 5E1XA 4FETA 1S8NA 1QVGR 1N77A 2AGQA 2NXJA 1PAUB 2G1HA 1R6RA 4WX9A 1Y0UA 1SV5A 3F8FA 2XHCA 3HP6A 3H40A 3LWMA 3IM8A 1A36A 1GHCA 1VBKA 4N9HA 3OUYA 2WA0A 3CB4A 4GKKF 5B5EC 2DGSA 1Q82T 4G65A 1R4NB 3PDNA 3C19A 3ZZOA 1N34J 2ASYA 4ZVSB 3HO1A 2IA2A 2LKSA 2CRGA 5IP6A 3BDEA 2WAQA 4ZS6A 3S8PA 1RYSA 4YB6A 1QSLA 2RNJA 4AC0A 5CYVA 1MN7A 1D1UA 1W1WE 4RM3A 2KT5A 2MQ8A 3ZP5A 2JEFA 4RBUA 3CCTA 3TOBA 5FLXK 3KLHB 2OPPB 4PWUA 2IBDA 4UNOA 1XB4A 4PPDA 1YFHA 1UA0A 3GR0A 2YNHB 4ZZLA 2EFGA 5DO2A 2WW8A 3V4MA 2ME6A 5EF6A 1E3OC 4FNIA 4WP3A 1HQEA 2FJVA 2R9LA 1RLCL 2BW3B 1VF9A 2NS7A 4DV7J 2W4SA 2LYVA 3OXLA 2GIQA 4E6KG 1VBXA 1MZBA 4P74A 2HSEB 3J80Z 3TOAA 5KG0A 4UB8C 2F4IA 4JI3F 3GTQJ 4XKCA 2AT1B 3T5HA 4ERDA 3Q86A 2VLAA 2MJUA 4M9SA 4PYDA 5EDWA 5D4RA 2NXUA 1FD2A 2HVEA 2FOWA 1STZA 4X4RA 3QPSA 3ONQA 2K9SA 3HSGA 4YEAA 4RAFA 2C28A 1SFOJ 5JVTA 3SQGB 3OYNA 4WIQA 5L8RC 1VI0A 4IDKA 5A2QU 1SJ1A 4E2FB 1UVNA 1IZ1A 4DN9A 5GAGJ 1NM2A 3SSSA 1P7JA 1YJTA 2N82B 3P4UB 2R7FA 4G1PA 1EB0A 2DA4A 4X62J 3DGPA 2R2TA 2VQCA 1IKXA 2BE7D 1ZAXA 4KR0B 2DR8A 3TJ8A 3PW7A 1U5TA 2DH9A 3ZN1A 1K7AA 4A47A 3A2KA 1FF2A 4LGWA 2MH9A 4BDPA 1T33A 2LEPA 4A3KJ 4USVA 3QGGA 3O2IA 3MVPA 1FKAF 1HBOB 1KD1T 1R31A 1WZ2A 4MQVA 3CTRA 2O3DA 2EC2A 2XASA 2GX8A 5CCMA 3VAKA 2RQ4A 1RT2A 4GVBB 2V4QA 3UDEA 3ISND 2JSPA 3HSZA 1R8PA 2W4DA 3PYDA 3QZ7A 1S72S 2FMLA 3MD3A 4ETSA 4GVBA 2ROEA 4NA1A 2EA2A 5D5UB 5KOXA 1WEZA 5DCFA 4LR7A 1NK4A 2HNZB 4MK7A 1K78A 3I6PA 2HBYB 1OYYA 4OI4A 4O3RA 3JRBA 5KG7A 4M72A 4DV6F 1NXIA 3MAAA 4MEXF 3JRHA 4N0BA 3MEDA 1MW7A 3DDKA 3W61A 2MKIA 4ZVFA 1G3SA 3P6YC 3GTYX 4X4OA 2D9OA 3MUMP 3BR9A 1RT3A 1Q8IA 2FEZA 4I0AA 3G1MA 4LF7J 2OU2A 2FHOB 4IH6A 5KFXA 2BEFA 4NHJA 1ELOA 2GMHA 3M8WA 3HOVJ 5JLXA 2XS2A 3OMYA 4PJ0C 2TDXA 5L1IA 5E0OA 3PO2J 3GLLA 1T9YA 3CDAA 2F5DA 4S05A 1ZOTA 4ATNA 1K1SA 3MI7X 3DEEA 4H4KC 1YIOA 5D8HB 2UU9F 4DPWA 4JB8B 1VQPI 1LW2B 3V2UC 4MFBB 1HKSA 1V5GA 1M5HA 3AJDA 2BW3A 2YKNB 3R3TA 4DUZJ 2XLJA 3B6CA 4E7SA 2XVCA 3GG1A 3S14J 5IT9U 3CCES 3HKZN 1Z6RA 2YWHA 4NLQA 3KLHA 2ECBA 1I3OB 4BEHA 4IH5A 2X6YA 3J7YJ 4P55A 3IWLA 3MR3A 2XKOA 3BLYA 5EWFA 4M5NA 5TJJA 3UDLA 2VA3A 4ABZA 5J47A 3NCRA 4NBQA 5IT4A 2UXDJ 5JVGF 2KT3A 1S1VB 2J7UA 1W7PD 4U0VA 4AIKA 2IDEA 2CQIA 2YWWA 1RA6A 3R27A 5D6EA 2ASJA 4DUYJ 4CO4A 2UUWA 2O1PA 2RIJA 2E2JJ 4AVPA 1F9NA 3VAIA 4K4WA 4M71A 4X84A 3LP1A 1IXCA 3G4SI 4FE7A 3L2WA 3IG1A 3J7YI 2BEOA 2DT6A 2E29A 1W25A 5KT6A 1LKXA 4P2SA 4ZP8A 2CPYA 4GVLA 3TZWA 2ZJPF 2FNPA 1PYOB 5BYRA 3G6XA 1R0AB 4I02A 1XMAA 4OYAA 3S8SA 1Y56A 2VKVA 4LIRA 2JA5J 5J2NB 3LAMA 2CO5A 4NUBA 5FLXU 4RUHA 1OFCX 2DH8A 2FOKA 3J81Y 4ENKA 4P5OA 1LQ1A 1U6BA 3JR9A 4I4BA 2XMAA 2M5YA 3F73A 4O4RA 5H2FC 3N6MA 5HQLA 1UG2A 1FP1D 4CP5A 2XI2A 2LMIA 2HWTA 2X3GA 2LH9A 5J1RA 1LFBA 1W36D 3RUBL 4RA2A 1IKYB 1VQKS 4QCLA 3DXJF 2UU9J 5KFCA 2ELJA 3EDPA 2C42A 4CNYA 2YKMA 1XNQF 3LSHA 4YDDB 3CP8A 3TEGA 1MDMB 2KFNA 2VQEF 4DL7A 5K5RA 2O03A 2WB1D 2WSEC 3IAS9 2F5VA 3DCAA 4EJUA 2I6WA 1YLXA 1JGSA 5D6GA 3CJRB 9ANTA 2OD5A 2M9KA 4RUCA 1L3KA 4HQEA 3G8SA 2AS5F 4FP9A 3H25A 2GXGA 5J1PA 4B3RJ 2W01A 2LF7A 1AWCA 3AA8A 1S1TB 1SVMA 1TKTA 5L9XA 3FXQA 4OJ1A 1YW7A 1ROFA 4WFYA 5AXNA 4DV2J 1KONA 1V3RA 3VV2B 3ZMSA 1USTA 2VA2A 4WU3A 8RUCA 2DNGA 3HXLA 1F5TA 4HLYA 4R8UB 2K1RA 2ZXWH 4B9TA 4KT6A 4RR5A 3IS9B 2JEJA 4RGRA 2LF8A 4BUPA 3PYGA 1IXRC 3IMQJ 4DEZA 4DX6A 5EG0A 3EYZA 4CYUB 4QWEA 4NLTA 3MEGA 2X6OA 1I1SA 2AX0A 1KFSA 1KNZA 3ASNH 2PC6A 4ZCKA 1P9QC 3R1LA 4YEJA 1GXTA 1WJ5A 3UDCA 2EQRA 3ZZTA 3M1CA 2LQ9A 2WONB 4K4XA 4J9PA 5KFQA 1BJAA 4ID8A 3E0JB 3LMMA 4NLYA 1WTBA 2B5JA 3KLIA 1GVJA 2B8PA 2WY7Q 1U26A 3GG0A 3F6OA 4MKVA 3MEGB 2QFJA 2WVEA 4X4NA 4CYUA 1LWCA 1Q4RA 3TQNA 1IKWA 3CJKB 2UXCJ 2X9DA 4CO3A 3ASOH 2VONA 4NXNJ 4IRHA 4HT5A 1HQUB 1OJ4A 2DEIA 2JVHA 4DV3F 2LU1A 3UFCX 1FXRA 2IPOB 1VISA 3DRRA 1UP1A 4Q0BB 4ETXA 1QZYA 4KO0B 2VN2A 3LQQA 4II2A 2FVRA 1NG7A 2CFOA 3PW4A 4OIRF 1YTYA 4QIFA 3MECB 4C4WA 2O8XA 1N54B 4UUWA 1TKTB 1YG2A 4XR6A 3DOLB 4DR1J 3GYHX 2PEBA 2QV6A 3OXFA 4WK1A 2RD5C 5ETOA 2ILZA 2JZYA 1KC8T 2ZJRF 2YX7A 2W2NP 3JSRA 3OD2A 3A1YA 2IP2A 1NDPA 2XAHA 1TMMA 3M2RA 1XNRJ 2ZEJA 4W97A 4TU7A 3HD1A 5IOZA 3GZNB 3OTDA 1ZA2B 2IM1A 4CO0A 4JBCA 4OZNA 5KFSA 4A3EJ 1RI7A 1JLAB 3VSLA 2LQJA 2IGNA 3K89A 2IC3A 4WP8A 3MEEB 1O3QA 2Z16A 1LFWA 3CDBA 4N56A 3S7RA 1C1CA 4ANDA 5D0RA 1O7FA 4ZC3A 2LMDA 1TU0B 3C7JA 1M1EB 3M8PA 1WHVA 3GFMA 4DDFA 1Z21A 4OYPA 4DR6J 2R3VA 3EM1A 3DBRB 3OL6A 1N8RT 1NSQA 1O3SA 1D8KA 4QQBA 4U7UK 1XGMA 4P9FA 2AQEA 2Q79A 2MBFA 1RCOB 1YZ7A 1LQ9A 3DLAA 1ZETA 3P7NA 2FJEB 5D3GA 2BKNA 4J90A 2M2BA 4KGXB 2CJQA 3BSCA 1CSJA 3IBFB 4NDLA 3JTNA 4DYRA 3HVRA 2AP6A 1S10A 2YWEA 4IO9Q 2IW5A 1PVEA 2GOXB 3NWGA 2F7VA 4QTRA 2QLXA 3ETMA 3WG9A 3FBNB 4C8KA 4QJVA 5DM6F 3FXKA 4LG0B 4KKOA 2FHJA 2CV1A 3CJ4A 5L3FA 1T8IA 3E6DA 1JLCB 5FDLB 2XSDC 2QMWA 3R61A 3GSIA 2XS7A 1OYWA 4OHYA 3OTBA 3OV8A 2ZDPA 1C0TA 2E5IA 4RB0A 2KZGA 3OXGA 4EJWA 4NA2A 3WTXC 1HA8A 3MMAB 2WAEA 2QWWA 4TKTA 1DQ8A 3N6LA 4Q43A 4M5HA 3QPLA 2HK2A 1M1GA 2NPIA 2AHOB 3B54A 4CICA 3ZZUA 5GMEA 2IY5B 4E7IA 1QUVA 2NXEA 3FKJA 3IXQA 4USUA 3W8PA 2BABA 2QSFA 2Z8QA 4DZ6A 2ALYB 2LDYA 1X1DA 4IRKA 4OV1A 4B9NA 4K4TA 1ZYQA 4XRSG 4YOEA 1HNIA 3BH7B 3M32A 3J7YU 3KHLA 4OIPF 2P5LC 1JKHB 4EUVA 2DO4A 4A8SA 2A5WA 1U6GA 2FY1A 2DMQA 3TA2A 3IWZA 3OL8A 1CLFA 1P6RA 2V8PA 3ZMVA 5A8WB 1SUQA 2GW8A 4G6QA 1HBXG 1MMNA 2JMWA 3CJTB 5JHUA 4OYWA 3ZQGA 5GPCA 5HN0A 3LSMA 5ICCA 3S1MJ 4E7KA 3F21A 1NAQA 2RDDA 4FPRA 4QR1A 4PG7A 1IN0A 4A8FA 3SEZA 4J9LA 4HV5A 4M74A 2W9CA 3S32A 2WV1A 2FTRA 3TWZA 3W8GA 1UMJA 1MSFC 4KIGA 5HQMA 1EV7A 1GMVA 3TJAA 4JI1F 4Q4ZF 1UEKA 4U7DA 1Q1HA 5FIIA 2CNKB 4Y15A 3CCJI 4R8HA 3EZUA 1TL3A 2UXNA 4CI0B 2RSQA 4MFDA 4B02A 1TVRB 4G1IA 1WRJA 1U2WA 4LF8F 2J7WA 4YS2A 1I94J 1L3SA 2CFXA 4FVCA 1IG7A 4CYCA 4WE1A 4BHBA 4XL9A 3T1AA 4DL0C 3EICA 4P6QA 1IRXA 1U78A 1FWLA 4HF2A 1NK6A 4LQ3A 5HLHA 1RAGB 3LTOA 4J9MA 4IF4A 4DPYA 4C11B 3RPQA 3Q8RB 2OLWA 4MTPA 5DEQA 3AD9C 5IP7J 1DTTB 3FGVA 1Y3JA 2CYYA 2DRAA 4ZN3A 3CIZA 5AXLA 3TI0A 2N4CA 3IRXB 4CCOA 2DA6A 5L3BA 3G1LA 1RCXB 2F8HA 3DPUA 1ITYA 2IA0A 2K7LA 3ULQB 1IKXB 2M34A 2DT7B 3OIPA 4DFPA 1JHFA 2MKSA 3FVYA 3QSIA 1M90T 4AD9A 1A6IA 1GNKA 5C3EJ 1LK5A 3DM2A 4OI1A 3QIPA 2AZ1A 2DITA 1REVB 4U96A 4GYGA 2KP6A 3C16A 3W2VB 4YR3A 4IDKB 2BOPA 4J9KA 1JJHA 2NSBA 1QAIA 3DU5A 3ZXSA 2WZ1A 2EG2A 2V1XA 2ZC4A 2W7AA 4ALZA 4QYZJ 4NEZA 4X4TA 1N88A 4NC8A 3PCOB 1ZAVA 2Q0OA 2HTSA 2OZUA 3ZTRA 1MH3A 3D1OA 3I55S 3LO3A 1KU9A 3GFIA 1PO6A 1XDSA 3OYCA 1U1LA 3AG3H 2YNFA 3J7A1 2FUG2 4DJBA 5CD4A 3KYCB 2F9DA 1E2XA 4BJ6C 3T41A 3P9KA 3U1MA 2EWNA 3V81A 2PDAA 4A8XA 1OCRH 1N0UA 4BE0A 5HDKA 2J0SD 3P5BP 1KOOA 2CQGA 2HU9A 1BM9A 4WXOA 3SDBA 3TL4X 2MY7A 2XMKA 4EFAC 1L5UA 2KQRA 3ZTSA 3KLNA 4K4SA 1U45A 2A1BA 1J75A 2O8KA 3ZZZA 1V54H 3NWSA 3BZKA