4F3QA

Structure of a yebc family protein (cbu_1566) from coxiella burnetii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
234
Chain Sequence
KWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAIKRGADNLVEVRYEGYGPSGVAVMVDCLTDNKNRTVAEVRHAFSKCDGNLGTEGSVAYLFKQRGLITFPPNSDEEKIMEIALEVGAEDVTTNDDGSIDVTTLPEDFEKIRNAMKAADLNPSHAEVTVLASTEVGLDKDSAEQMLRLTEMLEDLDDVQNVYSNADYPEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein CBU_1566
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transcription
total genus 73
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4f3qA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3qA03
1WJBA 1WJAA 1WJDA 3F9KA 1E0EA 1LFPA 1MW7A 1K6YA 1WJFA 1KONA 3HPHA 1WJEA 4F3QA 3HPGA 1WJCA
chains in the Genus database with same CATH superfamily
2C2NA 2R7WA 4ZVHA 2H1KA 2ZH6A 4KGXB 2Y9HA 1HMVA 2ROGA 5KFGA 3M9MB 3DLEB 2JJ7A 4A0YA 2A68F 2R2SA 3PQJA 3TZZA 3E01B 2Y9ZA 2OJED 2ZE2B 2RD5C 2GHPA 5FKMA 3D0HE 2DTRA 4DUZF 1I94J 3QAHA 4ILMA 5EF6A 5HSPA 4ZPVR 4I64A 2Z8QA 3OR1B 3LA0A 3NMRA 1FF2A 4MQVA 1S5ZA 4N9IA 3GZ6A 3DRSB 5ILSA 2L7MP 3AOAA 2C2RA 2R2UA 1V3SA 4LITA 5KAIC 3Q24A 2HG4A 3Q3SA 2IPQX 1D1BA 2H9ZA 1YQAA 5D4RA 3DWLE 5B0BA 1WORA 2IS6A 4ZYDA 3FDSA 2ZXJA 4WK3A 2AQFA 4AT1B 5LRRA 1HBOA 1KVKA 3FCWA 2IM2A 3AHPA 5L3CA 1UW9A 3IBFB 4C97A 2VD3A 4AL6A 1VS3A 1SJ4P 3H7HB 2XB5A 1RBAA 1PJRA 1M5SA 2V9WA 3FHNA 3OYDA 2FF4A 4LMYA 3HX9A 4JI4J 3QWUA 2F5CA 5KAFC 3BO2A 5KG1A 2KZGA 1WJBA 1RNLA 1C1BB 4EMDA 4EEYA 1RCOB 1I50J 3GIRA 5KFVA 2E36A 4ZVTB 3OR2B 4Q4ZF 4FX4A 2OCCH 1SCJB 4ETXA 3LPYA 2E5JA 2DH8A 5HODA 5KFTA 3H1CA 2ATCB 4HH0A 2OEJA 2ZFHA 1UVLA 1QTNB 4IHYA 4C11B 4DLGA 5HNHA 3ZZUA 1HNIB 2BY3A 1B72A 2W9CA 2YNHA 2W25A 3GZNB 3QLHB 4LFUA 4H54A 2MZ1A 4IOCQ 4PKDB 1UMQA 1YBUA 5KFZA 2HEOA 1UTAA 2LMIA 1WG4A 2MH2A 1N33F 4A8QA 1GMWD 1JT0A 4EYIB 3TUZC 1OKRA 4QYRA 2HZAA 5EEAA 2HAIA 4LLNA 4O3SA 1D0EA 4KV8B 1RT3A 3N01A 3PW5A 5EHHA 3VVTA 3BQ2A 5FD5A 4HT5A 1H73A 3ENAA 1V3FA 4F0KA 2JMWA 1HI1A 3CMAS 4NMLA 1YK9A 1T08B 2QLZA 2J0SD 1H9GA 2HMIB 4PUOB 1YG0A 3WTWC 5KNLA 2DVIA 5B66C 7FD1A 2VJJA 3LFUA 3G3ZA 3GXOA 2MY7A 4LSLA 2DGSA 2YNGB 3DM2A 1IXSB 3FBFA 2OPQA 2JC1A 1POGA 3GW2A 3GTGJ 3CCUS 4UT4A 3J7YI 4ERDA 4F26A 2AT1B 1W0UA 2Q2EB 1XWLA 4NA3A 2YY3A 3RSNA 5GAEU 5HROB 1VFJA 2HQCA 4Y17A 4CLWA 1Q7YT 1TT5B 2HFZA 2EC0A 2K40A 1HR0F 2F3JA 1MU2B 4A8KA 3IAM2 1VRTB 2VPRA 5IYDJ 1BIAA 1F0XA 2X6WA 2DIUA 2RQMA 2W7OA 1DP7P 3FCHA 3PIPQ 3WIUA 3AD8C 3K5MA 4IVNA 3S8SA 1KQKA 1CSJA 1NKEA 3IO1A 1ZAVA 3NNAA 2H1LA 3BDPA 3D6MB 3QYFA 4TYAA 2L2OA 4WE1B 1X31C 3GILA 4I98B 1DQ9A 2E9TA 3G8SA 2EFWA 2X1BA 2V4JC 2WAEA 4AXIA 2E19A 3PKYA 5FD1A 2QEXS 3TAMB 1LXNA 1UHMA 3D3BJ 4BC7A 1T2KA 2A07F 2XUBA 4ZDOA 1MDMB 1UVJA 4LGWA 1HF0A 4G3IA 2R7FA 4FKYA 2XAJA 4PDKA 3EE3A 3HPHA 4P2SA 2ASYA 1LKZA 3HOUJ 1X7VA 3AT1B 5LLQA 3AG1H 1BQMB 4LF4F 2DK8A 1D5VA 1ZHFA 3S6EA 3DKDA 1KSPA 2HOSA 2M9HA 3NMAA 3D6TB 2LF8A 1NK9A 2OTLS 2HBRB 1B9MA 3EZUA 1VOMA 2V6EA 4IO9Q 2QJ3A 1FA0A 3JRDA 1N34J 1S97A 2XAHA 2EV0A 3K69A 3KP3A 3T1BA 2VG6B 2HRTA 3MEEB 4WIIA 1WF2A 4OHVA 3DKYA 3MURP 2DT7B 2PSZA 5IP6A 1JQGA 4DXLA 3CCMS 2CZ4A 2V2VA 3FM5A 4M5GA 3V8KA 4ANCA 2BVLA 3KETA 4M8LA 4JI3F 3IM9A 2KZVA 2Y0SN 2AD9A 1MBHA 4FBTA 5LL6d 4ECTA 1RAAB 4DN9A 1WI3A 4O44B 4OZ2A 2XYGB 2HQDA 3QODA 4CLFA 3DEEA 3E2EA 2LXIA 1QSSA 2WB1N 3Q86A 4CLTA 3DP7A 1IN5A 2UP1A 1HYSA 1D09B 5KTQA 2X1EA 2V1UA 2GAGC 2W4SA 5H6RA 1ZBTA 3NKYA 2EFVA 3FXOA 1RHJB 3ZFVA 2IAJB 2IA1A 4B17A 4RL1A 4ZP9A 5F41A 4B3TJ 1HBNB 5ITHA 1V54H 4F0MA 1DQ8A 2Z9OA 4J9KA 2ZH8A 2MABA 4DFPA 2HS3A 2IS4A 3BJYA 4I56A 1GXUA 1WF0A 3IM8A 3KK3B 1LE8A 1NXIA 4F92B 1NH3A 1QUVA 4ZP8A 2JLFA 3H90A 4TVAB 1YITI 3CF5Q 1T05B 1OFCX 4C8YA 1IR1A 5KVRA 3HI9A 3AL0B 1MIJA 5KT4A 4DV4F 3ZOBA 2L4MA 2JVOA 4CNYA 1SVDA 4CDIA 1USSA 1BW6A 4B3OA 2RREA 2F5FA 2I0XA 4DPTA 4DBQA 3M7GA 1PCAA 3B4DA 1NK6A 3VOEA 2IA6A 3LA2A 3TANA 1EETA 4Q48A 4NDLA 5KFXA 1GMWA 3OR1C 3KLIA 4WTYA 3BJOA 3BZKA 3SFUA 2ZH3A 3OHBA 4PCQA 3X2QH 3OTEA 1IKVA 3GZ7A 1XCVA 1T6SA 4EYHB 1Q5VA 4OV6A 2X9DA 5FLXK 4ON0A 3K6GA 1RKTA 1R22A 1RT7A 3MM5A 2MKHA 1GUUA 4J91A 3CJKA 2VFUA 3PX0A 1ZZFA 1R7IA 2VFTA 4Q5SF 3O3LA 4EFAC 3QAUA 5J47A 1REVB 3B73A 1D0YA 2HYGD 2DNYA 2CQ4A 3AJ2A 4HTIA 3R27A 4I09A 4XLEA 4C30A 3PM9A 1P1TA 5HP1B 3OL3A 4U7UD 2QBYB 2EEYA 3HO1A 2RC4A 4C3IJ 2W9BB 5ETOA 1E6VA 5LGNA 1FKPA 4DV3F 3N4MA 4IPAA 2QIFA 4RUAA 2CQKA 3M8QB 3C2HA 3EVWA 2WSEC 1JLQB 3JAMZ 4P52A 2FVQA 1HFEL 5A0YB 2EPIA 2QSGX 4XRMA 1S59A 4IOCF 2KYXA 2KXFA 4EUVA 2BBYA 5LEJA 4RBVA 1NHVA 6AT1B 3TO9A 2J9DA 1FTCA 2ZMEC 2DMNA 3OR2C 4I68A 4HRIA 3MWBA 2R8IA 2BW3A 3WGGA 2IBDA 4L6V3 3V42A 1RHUB 4IG3A 4PJNA 5ADZA 4USIA 3R8YA 5J3LA 1S1XB 4Y34A 3JSPA 2CQ0A 1QAXA 4OV1A 4P2FA 3PNYA 5K20B 3GTKJ 4C48A 3GWCA 4MKAA 3TW6A 3KJNB 2C1EB 4KMUX 1QM9A 2ZH5A 2BYCA 2N4DA 4OI6A 2X7IA 1GXQA 4DSFA 1I6HJ 1U0HA 4QPQA 4BQQA 2W2PP 4I6ZA 3ZQCA 1ZYRF 1U2FA 2KU7A 2HGMA 3QT5A 1NB2A 2MQNA 1Y5LB 4R1HA 3LP2B 2DBBA 1H9TA 2UUCJ 2HXOA 3M2UB 2BACA 3HKWA 2CMPA 4DV2F 3NOCA 5EUHA 5BYSA 3T6JA 3N79A 4W1UA 2NSCA 1W4MA 3W1YC 5E20A 3O3KA 3FDYA 3OFHA 2PO4A 4G7HF 5D0HA 2FBHA 1SUQB 1VI0A 1GTHA 2YX4A 1EJ7L 1EQMA 2EK5A 1FBSA 3G6VA 1J5OA 3G71S 1RDRA 4GRSA 4NCGA 5EGYA 5F0CA 1LWFB 1XERA 1TNTA 4M1KA 3PIPF 3KLFB 5IM0A 4MTDA 2BV6A 4EM1A 3SQGA 3PEHA 3ZZPA 2B3TB 4XAKA 1RYSA 2HHXA 3WQPA 3DOKA 2CV0A 5BOXA 5IT9Z 1HQUA 2W85A 2FEZA 1W2BR 3DHWC 3J80Z 2CWKA 3GTJJ 1H2TZ 1GT0C 2XB2D 4TQRA 2Y8YA 1ZH5A 5LJ5Y 1P4WA 2X3DA 3O44A 1VK3A 1SIZA 4ZP6A 2KO1A 4BE0A 2QMUB 4IQJA 1SD4A 2CWEA 1Z1ZA 3MR6A 3S15J 1NH7A 3TX0A 3KLHA 4HBLA 1IJWC 2UUAJ 2CNKB 2XAFA 5GPAA 3DPUA 1G59A 3K1NA 4FN5A 4WX9A 2O9LA 5KFUA 1IR0A 2RE1A 2L3MA 2E5HA 1VGYA 3BQZA 2K85A 1AZSA 2M4KA 2QLFB 4XIDA 2P5LC 2BKNA 2YQ0A 3NS6A 2P7CB 1TL3B 4C98A 3WG9A 2HYFA 3MI7X 3TA2A 4GXOA 4HLYA 2D74B 1UVIA 4WFXA 2WV0A 2PMHA 3EZ5A 3PX6A 4WPAA 3CMES 1S9GA 4DQSA 2QZ8A 1FFWB 1R49A 4AUXA 4L0YB 2BDPA 1BOAA 3PV8A 3NGTA 2CJ9A 1EP4B 1RKJA 2FQ3A 2E1OA 4USWA 4DX8H 3VALA 4IO9F 1WEXA 1HKTA 2ZZMA 2XSFA 5JR3A 4RDUA 3IBWA 4B9NA 3THVA 5DGAA 1D1UA 1QE1B 3R1LA 4BJ6C 1RWVB 2OPSB 1CS4A 2FOKA 1ZETA 2B7CB 2JRMA 4BJTA 3VTIA 4W92B 4BBRJ 4C0BA 3EYIA 4F0HA 5IOZA 2HS4A 3BKTA 4LF1A 1SFOJ 3VHQA 2QLXA 4RLFA 1JX4A 1NG6A 4UOCA 2O61A 1Q8IA 1JLGA 3OHAA 2DT5A 3QPLA 1LW2A 3P5TL 3IS9A 5SUHA 2RH3A 1TVRA 4A8YA 2LC2A 2R7QA 3LSJA 3KEYA 2B5JB 3GONA 4MTEA 1K0TA 1BJAA 2FNPA 3VDXA 4ZMMA 4JV2A 1OYWA 4HV5A 2DNLA 3G9CA 2QLWA 1XCBA 1WTFA 2L9SA 4X0GA 1Y8QB 4G7ZF 4UOFA 1T02A 5KG2A 4Y28C 2APOA 2DTZA 2VKEA 1X4CA 4IKAA 3SDBA 2R5YB 1D8ZA 1OYEA 3QQCD 4WU2A 4B47A 5JVHQ 3D1OA 4CO8A 5M5YJ 1TKXA 3EDRB 3ZMSA 2LVWA 4ZVPB 8ATCB 4ZOSA 3GTPJ 4ZP7A 5AIPA 3NRBA 2OQRA 1FJ7A 4MK7A 4E4HA 3QT8A 3ZQHA 1ZGJA 1O5JA 2F48A 2I6WA 2HHUA 2K02A 3NBPB 5KFOA 3ASOH 1IBCB 3L2UA 1ZREA 1X5SA 3CF5F 5E3QA 3BH7B 4CYUA 3SZGA 5C25A 3AAFA 4OI2A 3V7RA 3OYJA 2MLYA 4K2XA 5TISC 4KJZA 1Q8LA 4UV9A 3NWGA 3S2DJ 1S57A 2JA5J 2XCPA 3EPGA 4DR4F 3GLXA 1OO0B 1ZN2A 3GTYX 2KJWA 1WC4A 2YX1A 4IR1A 5LMNF 2DR7A 3KLNA 4URSA 5J40A 2XMJA 3GYNA 5I42B 1H72C 3DRYA 5GAHU 4OYAA 1P9QC 2NS8A 4E70A 1FJGJ 4NYZA 3IR6B 2NVUB 2B4VA 3AL0C 3AB4B 4M63A 3D9BA 4E7ZA 4RPFA 4ECZA 5KOWA 1BGXT 3M8EA 3K4MA 5FRNA 1K44A 4JI7F 4EMSA 3TAQA 2EIJH 1RWKB 3D6HB 4ZYAA 3AKZA 3RZDJ 5LSLA 1W5TA 3DFEA 2M7AA 4A3LJ 5EWEA 2OSQA 4DUTA 1F5AA 5EYRA 4NLTA 1XMXA 1GK8A 4LRDA 3VAKA 5FJ4A 2HNYA 2UV8G 2WBRA 1S1TB 2Q79A 3MKZA 2AYMA 5EX3A 2X6OA 4A8WA 3F23A 4RW8A 2CQXA 1XTZA 3SIPB 2AGQA 4CYCB 1FT9A 4HLBA 4BCAA 4IJAA 4U95A 1GHCA 4F02A 1B0PA 3M6WA 1O7FA 5T41A 1WJEA 3G2XA 3US5A 4KKOA 1CULB 4B9UA 5KFDA 2KM8B 3DLGB 2LXFA 1A9NB 2A0FB 1BC8C 1IM6A 2RNJA 5KFKA 1OQ6A 2Y75A 3CD7A 3B54A 4LF7F 3M8ZA 4X4PA 4IFVB 2DXFA 2E5LF 4P7TA 1QPMA 2HLUA 2ABYA 1Q79A 4NQWA 5K5MA 4Y65A 4I0BA 2EV5A 1FERA 1YX3A 1J75A 4F93B 5F3ZA 3M8PA 4M5JA 2PT0A 1DFDA 2NXNA 3E6BA 1LOUA 5JJBA 1KONA 3M8RA 4MKYA 3A4TA 4XK4A 2HSEB 4E0DA 3I5AA 1FRKA 2D1HA 4CT9A 3ROUA 2Z2LA 5KG7A 4QR0A 3P9KA 2ESNA 2RHSB 4DV1J 4F4AA 4I6YA 1W25A 5EGOA 4I6AA 2VJ5A 4EBEA 3R61A 3H20A 2HHHF 4FHTA 3PRDA 4RW9A 5FLXU 1XD7A 4HOBA 3EUKL 3Q8QB 3MECB 2JEGA 4DR2J 1IBMJ 1KQGB 2MZRA 5D5XB 3KK1B 3OS1A 4Z6YA 4WFAQ 1DTTA 1K73T 5K8PA 2DFFA 3G6YA 1ZPWX 4IH6A 1SJFA 4CCMA 5L46A 2XRNA 4X4SA 1JLBA 4NXNJ 5IP9J 3GP9A 5DM6Q 3L00A 3WHIA 3JRHA 4IOAQ 2DCLA 2QRRA 2BX6A 3HM5A 1VQ4S 4XSZF 2ME0A 5B3SH 3T1HJ 3K70D 2JFKA 2BVMA 1NPRA 2OD4A 2BXZA 3LAJA 4A6EA 5EEGA 1GT8A 2J9CA 2CPIA 1JE8A 3TP0A 3OSPA 3ECOA 2J0XA 1G6NA 3RRHA 4FCYA 2ADUA 1IG7A 2XI2A 4KHMA 1SJ3P 1T0TV 1TAUA 5EZGA 4Z7YA 2PLYA 3GR0A 1FC3A 1AKHB 1FFGB 2E35A 1IUJA 2COLA 2XC7A 4I01A 1UWAA 3HHEA 1BOBA 4OZJA 1S9EB 5A2QZ 4II3A 3CCJI 1C4CA 3HYIA 5ILUA 1J27A 5CYJA 3W65A 1LB2A 5ETPA 2MA3A 2YU9J 3OYCA 1F5BA 1UJ8A 3JQKA 2H54B 1TZLA 1BR4A 1WHWA 2I1RA 4GO7X 4LK0F 3TEHB 2PJPA 2NVYJ 1ETQA 3BSNA 5KFBA 3BG7A 4NHJA 3DTKA 4II2A 4HW0A 2ZZTA 3B02A 2M87A 1LWCA 2ZDPA 4A8OA 4ZJZA 1LWXA 3T9ZA 1D8KA 5F0HA 3J81j 2IGMA 2WAQD 2CJQA 5DDOC 3NL0A 1Q8KA 1MBKA 4UB8C 3NNCA 1LFPA 1C0WA 4WWCA 1FDBA 5KT7A 4WIQA 3EGVA 2H65B 4PUSA 3W5ZA 3CJ0A 3F8NA 4EZ6A 2P6SA 2GGPB 1R0AB 5T7LA 1XDSA 1SJRA 2M0MA 2VBYA 2YWEA 5CD4H 4I2OA 1U09A 4C8NA 4DS5A 3JREA 3EVOA 5F9LA 3HP6A 4BWJA 4RW7A 1A35A 3EPZA 4I69A 3QO9B 4CLPA 5JUMA 1NK8A 2AIRB 1I27A 2FVPA 2CUYA 1PBUA 3Q83A 1SC6A 3BB5A 2LOOA 1XMOJ 1R27B 2DH9A 3OJSA 1BBYA 4B3SJ 1NEEA 2K2PA 2B7BB 3BR8A 2YVSA 3Q2TC 2YXLA 4IRKA 3CCWA 1HHSA 4CO2A 3ZRGA 3C2GA 3Q9SA 5KT5A 5L38A 1DPUA 5F64A 4WF9Q 2YKNB 1C0UA 1SAXA 1U45A 2BHZA 2IDEA 2BE9B 2IT0A 3THPA 2AJQA 3JR9A 1WI6A 1LFBA 1RTIB 3GCXP 1H7XA 2LDYA 4X66J 1LFWA 5IC6B 3HOZJ 4QZVB 2NYHA 3CMMA 1P27B 4OFZA 3MAJA 2BRKA 3P45B 1RTDB 1Y39A 2YS9A 2XAUA 3FBIB 4FS2A 1NJXA 4LFCJ 1NHKL 2RN7A 2M4MA 1LNWA 3LGMA 4KMFA 1JLAB 4LK1F 3MQ0A 3W8PA 2GC8A 4A0ZA 3HD1A 4USKA 2X4HA 2AGPA 4DZJA 2LQ8A 2P8TA 4LIVA 3HK2A 2E71A 3BTCA 3OT9A 2KN4A 4C7QA 4PQUB 4HF1A 1YZ6A 3BPXA 3OSGA 4K50A 3UI3A 3K1PA 2K9NA 3M07A 5DEQA 4RO0A 1M1EB 2BQRA 4M73A 3DRRB 2MGZB 6PAXA 5AJ3F 1I3OB 1TELA 2WK4A 3AJDA 3GYGA 2HRUA 4OIQF 4OIRF 2V2QA 5B1AH 1BUXA 2W84A 2F5DA 1RA7A 3D28A 1QZZA 3V81B 1TWHJ 2V67A 3WIVA 1OYIA 4H4KA 3IGNA 2NS1B 3EWGA 4N4OB 1S72I 3HM9A 4WZQA 1S9FA 1VQ9S 2O0YA 2RRNA 2I10A 2LECA 4OYMA 4AL5A 2CQDA 4DPUA 2W01A 4N5SA 1NUEA 3I5CA 1N75A 4XPCA 4DR1F 2HURA 1MMDA 2L4AA 4CRJA 1QVUA 2R7TA 3GSDA 1JGGA 3FIWA 1CJVB 1OQ3A 5J1EB 5KFAA 5CCMA 3J7Z5 4G9YA 3BSAA 1TQIA 1I3AA 3ESWB 3I0RB 2O1PA 4CZCA 2J9EA 4UUTA 1I6XA 5DD8A 2KKOA 2Y69H 2DA3A 2VQGA 2FNAA 1F5CA 2KT5A 4AIDA 3BR0A 1GXTA 1HNVA 1GX5A 3WTVC 3RRKA 3GTMJ 4CYDA 3ZZYA 4E2FB 1W2IA 2JNJA 3BF4A 5HLFB 4C2TA 2VDHA 3CMYA 4DUYJ 3CDWA 3AOBA 2KM8C 4OI3A 2CQGA 5D78A 5HANA 1Z67A 2DA1A 1E17A 1V3RA 1LVAA 3U21A 4CHUA 2B4PA 1KU3A 3F44A 2D9PA 2E66A 1VIOA 2DO4A 2Q6BA 2OD6A 2A3JA 4HDUA 1ZM4A 1GMVA 4ENKA 4DDFA 3K1MA 1T95A 2H4WB 3OYFA 3QAEA 2UXBJ 5IOLA 3RBZA 4TYBA 4GC7A 4B9LA 3JTPA 1ROFA 1DGRM 4JK1X 3HJFA 2EQRA 4DV6J 1Q4RA 4OYOA 1R4NB 3P5BP 3BYPA 5LT5A 2XO7A 3GCMA 3WG7H 4KGMA 4B9VA 1HQ2A 4OYIA 3LH2S 2GMHA 3DEUA 1OYYA 1S99A 2VBXA 3TP3A 4NLOA 4P9SA 5C5JA 1ETXA 1T8EA 3ENWA 3DI6B 3L7UA 3RB4A 1T03B 1W26A 3U1LA 1S8NA 3CC7S 1TKZB 2QYGA 2AQ4A 3R7NB 5HNFA 5DM6F 2KVIA 3HVTA 1BLUA 4KICA 4IOAF 3CUNA 1RR7A 1X8DA 4PK4A 4PYDA 4DBRA 3TX8A 3CCQI 1HL6A 3PW4A 3K9TA 4PFPA 4TU8A 4RAFA 2XBPA 2FZKB 3S7RA 4Q45A 2VJIA 3CUQB 4ZVRB 4V19J 5J4YA 2LQBA 1IKWB 3PX4A 1VQMS 2LK2A 5IWAJ 3C18A 2DISA 3AOCA 3ISPA 3FXQA 2DITA 2DOFA 3I55I 1D1CA 3ZNJ1 1FMWA 1MMGA 1VC0A 4RAZA 1Q95G 1EA3A 4A4JA 4R5PA 2NS7A 1HW8A 4LD5A 4OMZA 1IVZA 1UELB 2KFNA 1MNMC 3GYXB 3K4KA 2O01C 3UVJA 5A6WA 1JJHA 3NS5A 2MKYA 5AT1B 4MK8A 1TU0B 3BPVA 2FOWA 1ZTTA 4GYIA 3KNGA 3N97A 4C3MA 3M32B 2QYCA 4DQPA 4AD6A 3U1DA 4D7NA 2DCUB 3SMZA 3OL4A 1YRUA 2Z3YA 4JI4F 1AFIA 1PGZA 1APLC 3CXCR 3MMCA 1DZ5A 4NX9A 4RB2C 4JX4A 4EU0A 3A1YG 5HK4A 1RUSA 1YJ9S 3BOQA 3VQTA 1IN8A 3PYGA 2IRUA 2YPRA 5FKLA 1FXDA 4KIFA 2XHKA 2KMUA 3I56S 2CFXA 2RQCA 3EGZA 4E6KG 2H6CA 3U02A 3OXLA 4YP3A 5M2PA 2FQ4A 4ENNA 4X84A 1FT8A 4CUGA 2PJRB 3F9KA 4P2MA 2XAQA 2BJ3A 2F4MB 1A36A 3TP2A 3VAJA 1PVEA 3HEFA 2UVRA 2K9MA 3WGHA 5JI6A 2QE5A 1CVJA 1G3OA 4PXDA 3QT7A 1NU4A 1BI1A 2DQLA 2QN6B 3AFGA 1NK4A 1R89A 4ZA1A 1N32F 2R7VA 4HH1A 5GTIC 2Q3PA 2K4JA 4CI0B 3RG6A 2LG4A 5CABA 2XASA 1FBUA 3HSFA 2HXIA 3MDFA 3ZQLA 2M9KA 2QUFA 2PGCA 3PJRA 2Z56B 3CW2C 1RTHB 2XQCA 1TAQA 3HOWJ 1ZG5A 1R8BA 4WXWA 3PW7A 5KG3A 4FYYB 5DRKA 2WA0A 1W5SA 2CXEA 3DU6A 1TL1A 2MQOA 2ZC4A 1SQFA 3EGWB 1EKSA 3EX7B 1S12A 1VJWA 2V2KA 3PVXA 3PNIA 3IA0A 1SMTA 3P96A 4F2RA 1LVKA 5DG7A 2W4DA 1S7EA 2B6AB 2NR0A 1T11A 1ZG1A 3CC4I 3L7WA 1JGSA 4JV1A 4IYQA 3MXHP 3HOYJ 1NAQA 3SSSA 4M3DA 2ROPA 3R0JA 4P2XA 3E5QA 1HD1A 4ZPTR 3Q8UA 2B9WA 2KHCA 4XRSG 4TY8A 1RT4A 2FQQB 3TOQA 1G7CB 2M8HA 4L74A 1U6GA 4JBCA 1D9FA 3CZ6A 2FBIA 4A3FJ 5D4NA 1EIYB 2DT9A 3HUGA 3BQ1A 3FBEA 1NPPA 2CQ1A 4WXHA 1R9TJ 3JYTA 4A3GJ 1VDHA 1S6QB 1OISA 2OZUA 5BPDA 2JQ7A 2G4BA 4O6JA 1BN5A 3NG8A 1JNZB 3DXBA 1X4EA 2NUHA 1K47A 3KHRA 2OPTA 2R7DA 4Z37A 1KS2A 2WWYA 2R7ZJ 3MZYA 4DJAA 1ZK8A 1R1VA 2DNKA 4MFDA 2L3DA 1FNNA 4DL7A 1T39A 1GDTA 1MNDA 1BY9A 1MROA 3A01A 1HR0J 4ENJA 2HVDA 2VL8A 2LXUA 3AJ1A 1KVIA 3E6DA 3O6QA 2LSOA 1WC1A 2V9PA 3MKWB 1E2XA 4MLOA 4KTQA 3PSIA 3C15B 2EFGA 3K5PA 3CCVS 1T9VA 3BDEA 3BYRA 3P3DA 1SKRA 3ZXSA 2F9DA 2OP5A 1JKHA 1M5HA 4DF4A 2LKZA 5IT0A 3U1MA 1PYTA 2K86A 5HQLA 2R4GA 2IBOA 5BXIA 1YRNB 2M30A 4ID5A 2C2ZB 2MKSA 1MJBA 5KFWA 1C0TA 2DR6A 2ZD1B 3KJVA 4FF2A 2Y0BB 5DGBA 2ZKZA 4P71A 3HTSB 4J7CA 5AE2A 3CO7C 1VISA 1XJWB 2AEJA 3DMJA 1K83J 1JMTA 4I2PA 4NOHA 3EUAA 3L9ZA 3DTEA 3VSKA 2BOAA 3EJMA 2E5NA 2IFXA 4KFCA 1DHMA 5CLSA 4LF4J 1X4OA 5LFAA 1VC5A 1NDPA 5KFRA 3JAMK 3RB6A 5J2NA 1VIXA 2F8HA 4YG2F 1K4TA 1IV8A 1VBKA 1O3QA 4KGKA 5FDLA 1GVDA 1I5OB 4O3RA 3IWNC 2IVYA 3T5XA 2YR2A 2UV8A 4DI6A 4EBDA 2W24A 5E3NA 2FVSA 5HVQC 2D3OR 4R8HA 2BHYA 5GAEJ 3W2VB 3N6NA 5LXYA 5DCMA 1UEVA 2OPPB 1X2MA 5J1NA 4ZVFA 2WOMA 2EK6A 2DN0A 3MMYB 2IY5B 5CAAA 4PQAA 2MJNA 2QSWA 4B3TF 2ZITA 2MKCA 1KNZA 1S48A 1U5TB 4JI3J 3S17J 1NCLA 2FTRA 2ID6A 4CH7A 1KOHA 3AB2B 2XO6A 3H5RA 4M5HA 3A3PB 5KFLA 1A0OB 4RUCA 1TTYA 2R0QC 4X4TA 5F0UA 1L3KA 2L08A 2Z2YB 3R5JB 1QHGA 1V3ZA 1FPQA 5IP7J 3OSFA 3M2RB 1Q1HA 2M70A 4UUSA 3Q5FA 1QTMA 3SYTA 4DFMA 2E34A 4UF4A 2L0KA 4RW4B 2F5GA 2FJDB 2UVUA 1T98A 3M4OJ 1T9UA 2YNFB 5ICGA 5DLFA 2MQ8A 3BP8A 3DCFA 1FRIA 2RS8A 4XO0A 3ISNC 2RGVA 2JEFA 2ZVSA 2YKOA 4ZPWR 3CUQC 3F41A 4YFNF 2G1HA 2CPZA 2ZBQA 5HQMA 2HZDA 4HACA 4LBHA 1UG0A 3HHLB 5A8KB 2CA9A 1O57A 1Y56A 1YFHA 1FNXH 3R60A 3TDZC 3UD4P 1RHMB 2YH1A 5K1YA 1ZQ3P 1UEKA 3B8HA 4QLCU 5ICEA 2QFIA 4DV4J 1TUVA 3UE2A 5HAOA 3BM7A 3BKUA 5L3BA 5L3EA 3OYGA 1VI7A 5HVGA 1HKAA 4RAYA 2OHDA 2ZJPQ 2RKHA 4L9NA 4FT8A 5IT9K 4M5MA 1B8IA 1HI0P 3OYMA 2XSJB 5FB2A 1KYWA 3KP7A 2NXJA 3CDHA 2HFVA 1NJIT 1X4FA 2D45A 1XMKA 1U25A 5DZ6A 3LA3A 1N5SA 1AU7A 5H6QA 4QIVA 3CJ2A 1VBYA 3EICA 2OIHA 4C2UA 5I3UB 2V0NA 1LV5A 2MJUA 1HBOB 1SBRA 4NLRA 3F6VA 4FKXA 2W8KA 4D5CA 1R58A 1PC5A 4K2JA 4G12A 2VT3A 4KITB 2LP0A 2FRHA 4BXUA 4NA1A 4D3HA 5HOOA 3ZZ0A 2OTJI 2ZNZA 2ZBPA 2WRMA 1TW2A 2CPFA 4KHRA 5KFYA 5J2QA 2JK3A 1U3EM 2OI2A 1WG5A 3PJWA 2O3FA 2FY1A 1KD1T 3J7AY 3LQRA 3IWXA 3JCUC 4HYKA 4DF8A 5DDGA 2V4JA 1FRJA 5H20A 2CRLA 1KLNA 2HVZA 1B72B 1TK0A 3C3WA 4M5DB 3SJMA 3B6BA 3E0JB 1B7FA 4GVBB 1ULRA 2R8HA 2FBKA 1BIBA 2UUCF 4LR7A 3PUFA 5CYMA 3M4XA 2EW9A 1XGOA 2Y8WA 4IRGA 3B78A 1IJFB 5LMUJ 2C6YA 3IMQJ 4F4KA 2B4OA 1U1NA 1JHFA 2VV5A 3MEGB 2CKWA 3NLCA 3NWTA 2RRBA 2X3GA 2AYBA 2VKRA 3QPIA 4CCJA 4XN3A 2GXAA 2J5PA 4BQNA 4A5MA 3RJPA 3HVAA 4HAMA 1UL3A 1MSEC 2OAZA 3CE8A 3MMAA 3PNTA 5J8CA 4EO6A 1RT3B 1OLTA 3KMSA 2WSCC 4O0NA 3UDEA 1FXRA 4EVIA 3MFKA 3V4MA 2CV2A 2DJWA 5E41A 3HXMA 4YRVA 1U02A 3RYRA 3N5BA 2G0IA 3W8GA 3D2WA 4M72A 4WU3A 4LIUA 3CESA 4CH0S 3N05A 3E3XA 1DJ0A 5A8WB 2X48A 4LSLB 1OCCH 1EQ0A 3DM2B 1BE4A 2ZOFA 2MZJA 3G1OA 1FTTA 3ILIA 3IRXA 1Y9OA 2BE2A 3W61A 4YN3B 2OPQB 5E2QA 5IYBJ 1JHHA 1Y3JA 1KA8A 5DQIA 1S4FA 3LSGA 4QCLA 4ED4A 3MCNA 1OCTC 3UO0A 1L0OC 3WTUC 3DRXA 4KBIA 2V6CA 5GAHI 3D0IE 1S0NA 2XEXA 1KU9A 4J9NA 3FMSA 3AA8A 1T3OA 1F60B 2I2YA 2UVVA 1RADB 1GEHA 1X4HA 3QMQA 5IQQA 2WVCA 1S1UB 3MAHA 3SDEB 2E9RX 4ETZA 2ZSIB 5EEHA 1VQKS 1VQLI 3VZIA 4UQTA 2KIMA 1J7KA 1SKWA 3PNVA 4YFXF 4M3FA 2EBIA 4E98A 3CD5A 3GR1A 4LREA 3MD2A 5ETNA 1RT1A 3A3OB 3DLKA 2STWA 3CCEI 3MM8B 1VQ7S 2VIHA 1MLAA 3ZGKA 2IGKA 3D5LA 1U1KA 3FXJA 2HIYA 5B08A 5MLCV 3DBRB 3L09A 1P8GA 3SCJE 4BNCA 4A0XA 2QQBA 3ZC4A 5F8MA 2QL9B 4HEA9 1N0VC 2YPZA 1NHUA 2WY7Q 3DLEA 3ZZTA 5KK1A 2D5VA 1X1PA 1JB0C 3W60A 1Q53A 2ILZA 1J2XA 2L7ZA 1FNOA 2B4UA 3WDOA 2C3MA 2Y30A 3OR1A 2DY1A 2XCAA 3H5AA 4DS4A 3FZVA 1WJAA 4ZC3A 3C19A 4QIEA 5HLHA 3R5AA 3QOPA 3ZQ7A 2GIZA 2HVHA 4JQFA 3DRSA 2W2MP 1C4AA 4ED5A 3DNCA 1X19A 2CQIA 1VQNI 2MDAA 3PCOB 3BDDA 1CJUA 2X1FA 3UN5A 3MFIA 4PWWA 2A6TA 3JW4A 4HA8A 3NARA 4D7MA 3GIMA 2AW0A 4GKJF 2VJVA 1VQ8S 3HULA 1QBJA 3BH6B 2CJKA 4ECUA 2VKVA 4HL9A 1I5ZA 6FD1A 2R2RA 4CCOA 4CO4A 4NLSA 2VG7A 3K5NA 3DLAA 2QM3A 2RQQA 4BHCA 4NA2A 1QPIA 4RGSA 4X4NA 3KCCA 3ZN0A 3MM6B 4USHA 1SC4B 3FEZA 2ZMEA 2GVZB 1X9WA 3OR2A 1OR7C 2P2CB 1ELOA 2UUZA 3L2QA 4OI4A 1GFWB 5B0GA 4XNFA 4MAKA 4MYUA 3SEQA 3GFXA 3U1KA 3RKQA 1MWQA 1RUOA 1HLVA 4C11A 2VF3A 1WGXA 2J9DE 1U5TC 3KP2A 1LNQA 3L4BC 2JLGA 3O5TB 1RAGB 4A3BJ 1FK9A 4Y2IA 4Y3OA 3W7BA 1KBRA 1FO1A 1T56A 3BJ6A 2L9VA 4ZYEA 1NDLA 1WH7A 2L54A 1WHXA 5FRMA 3CMQA 1G2EA 2CQ3A 3CCLS 1D9DA 5LXRA 1FJGF 4CTAB 3R1HA 2P9GA 2V1DA 4LSNA 3K2YA 2EILH 1RKIA 2EV6A 2FHJD 2F8EX 4ANJA 5KAKA 3CC4S 4HHHA 4ELTA 3A0HC 5D6EA 2IHR1 2LYCA 4QIFA 5K14B 3JAMU 2R5ZB 4H0EA 3ELKA 3MPYA 1PAUB 3SBMA 4FNIA 4WFZA 3PR4A 5CVJA 4KV8A 1YHQS 1O3SA 2ZJPF 5BJRA 1N6QA 5DDQC 5GMKa 4DR4J 4IHVA 2JSPA 4HX7A 2VQLA 2VT2A 1F9FA 2B8PA 2VLAA 3HHLC 5HDGA 4NNJA 2DA2A 2ESHA 2LNBA 2LEBA 1B3TA 1J9IA 1XPXA 4PUOA 4B3OB 4F36A 3G6ES 1ORKA 5EDNA 1N5YB 1EETB 3S93A 2FJVA 1RE1B 5DG9A 2GHWA 3KLIB 3ZTRA 4U7UK 5FLXY 1B70B 3VV2B 2FZGB 5ILVA 1LXJA 3BR5A 1X9MA 2XSJC 3PYDA 3V4GA 4O5VA 3VGVA 4MIBA 5A2QK 2ZOGA 1RT7B 3MM5B 3CJKB 5H9FJ 1J09A 3BQ0A 2KRCA 3W64A 4X6AJ 1LWEA 4O3QA 2RU9A 1YIJS 2GVDA 2FZCB 1WELA 1EKEA 4WK1A 3GG1A 3MM7A 3AXMA 4PABA 4C0HA 4N8OA 2IM3A 1BI3A 1MMAA 4F91B 1IN0A 2P8IA 1IRGA 1MG7A 1E6VB 1FKPB 1MMLA 4OYPA 3OXFA 2AXTC 1KLMB 1RI7A 4DV1F 3KLEA 2HFHA 1F3FA 3NCRA 3QT6A 1U4BA 3DBLB 3AA9A 1ZAWA 3R6LB 3GTQJ 3A03A 4LLLA 3FMRA 1XR7A 1D3WA 4BLGA 4WE1A 5F6FA 3PO5A 5G4DA 3LO3A 4DL0C 3A1YA 4GFBA 2PEBA 5KFEA 2EFPA 2BW3B 4DCJB 4LF7J 2L02A 2KXNB 2XS7A 3TNVA 4QWEA 4ZTJA 1WQ2A 3SSRA 2VZ9A 3TAMA 3CP8A 1FX4A 3IRWP 1NB7A 2XDVA 2P4WA 1P2FA 1FFSB 5IT9U 3TQNA 2G13A 4FP9A 1MDMA 5GAGU 2MB0B 3KDOA 1VQOI 3W62A 1GVJA 4A8SA 4G8XA 3EXCX 2HWVA 3DLLQ 1Y6IA 4M9ZA 2M8DB 5DJBA 4MIAA 4DR5F 3POTB 2DNRA 5C2CA 1DTQB 5CYVA 5F9NA 2HHHJ 1U0HB 1Z3XA 2KDZA 3WC2A 3GYHX 4Q43A 4BYYA 1XNQJ 1WDTA 1YBTA 3BROA 1C2PA 2FMYA 4FE7A 1R0CB 4PFOA 4C9DA 3H5SA 1IN6A 4F25A 4NXMF 2QG9B 3OLBA 2HRYA 2DNPA 1RSCA 2NS0A 3MTJA 2FVRA 5JVTA 2G2ZA 3NRVA 4YMEA 5EJCA 5IFMA 4NWBA 3L7OA 1CGPA 4Y33A 1UZHA 1WEYA 3CC2I 1J5OB 3VGTA 1U2CA 2V8PA 1E0EA 4J9UE 5D6FA 2IBKA 5F0FA 3BR2A 4G94A 3K4LA 4O44A 1N48A 2AJ1A 2LTPA 2DPIA 1H7WA 4ZZDA 2HTSA 2ID3A 1DLOB 2A18A 3FSYA 1U1PA 4PSWA 2PA3A 2W48A 3P5JA 2LF7A 3V8JA 1HQUB 2ZJRQ 4RM2A 5E3AA 2RDDA 2AHOB 2FPHX 5FKNA 1LDJA 4J9QA 1H88C 1LDDA 1NK3P 4XRSA 5BMZA 3GB0A 4I7FA 2HR3A 2P7VB 4P55A 1MZBA 1OPCA 2O7OA 2X1DA 3PQKA 5F8HA 2NCKL 3BBCA 3C16B 3MUTP 2FC8A 3DBHB 2MEWA 4TKTA 3KLHB 4XL9A 2IYIA 4P74A 4DEZA 3N4WA 1WF1A 1JNRB 3WODF 2E1CA 2AJFE 2AJ4A 1TC3C 2VASA 1PJ6A 2I38A 2QGFB 3JQJA 3VAGA 1XDUA 1FEHA 2PA8D 3FKIJ 3LWMA 4Y4RA 3CNQP 4PG6A 1OJ4A 3D5RC 1H0HB 1FWLA 1S9GB 1XMOF 4L5EA 3RB3A 4DPWA 3M2VA 2CJBA 4UQGA 4UUWA 3JSRA 1G3SA 4XKCA 1YJUA 4USMA 1VQSA 2YTCA 4AD9A 3TL4X 1VNDA 4OI1A 4FE4A 2HYJA 2OAUA 1H3DA 1LQ9A 2FHJA 3PR5B 3U1NA 4K4SA 2JFDA 1UA0A 2MC3A 1CS4B 1NG7A 3CO9A 3TBIA 5D5VB 2GMJA 2RQPA 1AA7A 2X6XA 3PUBA 2GV1A 2XY6A 4EO8A 2OTJS 3KPHA 1YI2S 2RUSA 4BS9A 1WH5A 2CUJA 3PHEA 4X66F 4IQ4A 2OEMA 1VBZA 4YFKF 2AMCB 4QYZJ 1LW2B 3IS9B 5HP1A 1TVRB 2IDLA 1WSUA 4WZMA 4RZRA 3DC2A 2A5WA 1N88A 3ERED 2VPZB 3PYFA 4LFCF 2W9BA 2QA2A 2JA7J 4Y2CA 3CD6I 3MEKA 2KVQE 3M8QA 3PG9A 2N3LA 3FK7A 1JLQA 4OJGA 4WKRA 4Z2YA 3Q89A 4M6YA 2DO0A 1S0MA 2C2MB 1F4KA 1JKPC 3BJAA 1HI8A 5C4JJ 3I6PA 3LSTA 3RBXA 1TKXB 3KYCB 4D0PA 3TUPA 4FBUA 1K61A 1IAWA 4NLGA 2CSOA 1FRLA 2LFVA 2R8JA 1V55H 2DB1A 2ISYA 2VBZA 3GFIA 2L9NA 4GGGA 3CO0P 5LSOA 1JIHA 1GH8A 2XS5A 1J5EJ 2ILYA 4LF5J 2K27A 2DEJA 3LMMA 2LEPA 4K5RA 3IG1A 3N0VA 5H1SV 4CYUB 5C25B 3BGRA 4LVNP 3KLOA 4U7DA 2JL9A 2W57A 3R3TA 3GJRB 5G0RA 4ECSA 2NVTJ 4J9MA 4PG5A 1A6IA 1ZM2A 3UCUP 3LP2A 2P0WA 2I5JA 2RDIA 2V69A 3M2UA 4UOGA 2MD0A 1VCTA 1QAYA 1KWMA 1X3UA 2F6CA 2LCWA 2QENA 1TL5A 4OYXA 1R00A 5AJ3J 1Q86T 2GOXB 3M8FA 3HPOA 1HWJA 3WE2A 3AG2H 2IVMA 2FHOB 5RUBA 5B0EA 1OMSA 4OIPF 3KEOA 2FJBB 2H27A 1YYVA 3E5XA 2XY7A 3F3XA 3UWTA 2R4FA 1O4XA 1DDNA 1Z0XA 1X1CA 5J1UA 2XRLA 1YJWS 2GNKA 3CJ4A 1LWFA 3QGIA 4DR1J 2VH7A 4PG4A 3KLFA 2JEJA 3OYNA 2HNYB 4ZVSB 3IP4B 3TR5A 4NCAA 3GFZA 2L9WA 2CH0A 2CQHA 4CZZA 2H4YB 1XC5A 2F65A 2Y48A 4N9HA 3IWLA 4RNFA 4CO0A 3CCES 1EB0A 3LAKA 2UXBF 4KKOB 4U67Q 3T1AA 4YIIA 3CCYA 2K3FA 1MBFA 2HWTA 3TVKA 1SH3A 4BBYA 1B64A 3QRFF 3FXRA 1DRZA 2DAOA 5DTDA 3SCLE 3RB0A 5L39A 1PAEX 3TUIC 4NQWB 2KKHA 4LF2A 5HVHA 1ZRCA 1X0PA 4USUA 4HX8A 4IG0B 3GWZA 4RWXA 2AGOA 1SJ1A 2M88A 2NXNB 3DLLF 2HZVA 1TL3A 4UXNA 4A6DA 3MZHA 1KHWA 2X1CA 1NRKA 3H98A 4S04A 1KYZA 4YR0A 2CG8A 3D1QA 2X85A 1JJ4A 4BEHA 5LM7E 1R6YA 2LVSA 5EGOB 1ZTRA 2DNZA 5IY5H 4QQBA 1BA5A 1EP4A 1LW0A 2IJRA 2DXDA 4RW9B 3M6VA 1X1AA 5IWAF 5A2QU 3HVWA 2HQAA 5T14A 3W9HA 1JKRC 2P5VA 5KFMA 1HNZJ 3K4JA 2JWTA 3DPTA 4RNMA 2G2OA 4U0YA 4QOTA 3T8TA 4OOIA 2DQRA 1RU2A 4DR6J 2CQ7A 2YH0A 3T0YA 1EV7A 3ABTA 1DTTB 4JYKA 5HMWA 1YWXA 4DPYA 2LFBA 2P6TA 4IRDA 2UZAA 1ZM9A 1RT6B 3IR7B 5FLMJ 3C6UA 1JLBB 2EC2A 1BWVA 3K7RA 3DN9A 3KUGA 3HJEA 2L01A 4ED1A 4C3HJ 4KB7A 4J5OA 2B5JA 3LOUA 4LVOP 3SEOA 4KIAA 2DFHA 4YEAA 2GLOA 1BWEA 2YSRA 5HS7A 4YIFA 2FJXA 2HOAA 3DQVC 3HDSA 2FD2A 4XQFA 2R5YA 2E1RA 4YELA 2ZJRF 3FMBA 4F2SA 3TZYA 4UY85 4EM2A 5FLVA 5B1BH 5EWFA 2V8VA 4R0JA 4RGXA 4UVBA 4K0KF 2EK1A 4DQRA 2H6BA 3GSIA 1CLFA 3M7VA 3ET6B 2R8GA 4LF6F 4G6DA 1WC3A 2HK2A 3HSJA 2DU9A 3VQSA 3LGHA 1TL4A 5J2PA 3DTIA 5K5OA 3UKGA 2VQCA 3NBPA 2HIQA 4X65J 2CQBA 3SEZA 4IH5A 2NSBA 1YW9A 4C8KA 2KB2A 3ZMUA 1WKJA 4LRAA 1FJLA 2FHMA 3J81Z 4ED6A 1FXLA 3OUYB 1FX7A 2DGVA 3W6KB 3M8SA 1WKKA 4QWDA 1Z7UA 1ZRDA 3AFHA 4EM0B 3J7YU 2WW8A 2E7WA 3SXYA 4NEYA 1RWWB 2ZKUA 1KZHA 2JX2A 1LWCB 3IXQA 4E7LA 3QJLA 1K0VA 1FDNA 2N7CA 2GIVA 1FOKA 1M0SA 5F8NA 2Z57B 1TP7A 4N7TA 3KLGB 1Y00A 2HAFA 2PMWA 9RUBA 4HDVA 3S14J 1A5JA 5F8IA 4DFKA 4NRUA 3ZXWA 2MPUA 2KPMA 3HRMA 2XF7A 3K57A 3HD2A 2IP2A 3K2AA 5GMDA 2HS0A 1WJDA 3QQAA 4EJTA 1WOOA 1WC0A 4HT7A 1N32J 2MQMA 2W2OP 7FDRA 2R7XA 2EBEA 1BJZA 4QIWN 3MPVA 3CCSS 2W4PA 2KLOA 4M5NA 4B3RJ 3K17A 2HNZA 2CWXA 1N5TA 1Y0NA 3E7LA 4CYCA 3LP0B 3QYEA 1QRYA 2GQCA 3G6XA 1L3VA 3F56A 3H9GA 3RUBL 1C0UB 3H36A 3GLJA 3DLGA 1RKWA 1PYSB 2KJBA 1TWFJ 4M3BA 2YNIA 3LGNA 4XLAA 4ZKAA 4ZDNA 4ALZA 3H9JA 2IJNA 4F8RA 4ETSA 1FVQA 2ZH7A 1Z77A 2XGPA 1YJTA 3HG9A 2EPFA 2R7SA 2HPUA 3I5UA 1UHWA 4PXBA 3I0SA 4ZN3A 2R93J 1SH0A 4LOCA 3WTXC 1B1BA 5C44J 3CCRS 1RTZA 3OQ2A 1MMSA 1ZR4A 4CLKA 5MAOA 2FY8A 2IC3A 1ACMB 2B43A 1OSDA 3PFOA 4KNYA 2QMWA 5LBQA 4IHXA 5IZHA 4X2BA 2CQPA 3QRQA 4MYTA 1SVLA 2GBYA 5I4MA 3I31A 1KP6A 3FRZA 4WJBA 1YTYA 5H9FK 3K59A 4LSZB 1F2HA 1RTJA 2HBZB 3QWPA 3Q8PB 2YWGA 3KK1A 2XV4S 2DPDA 3FBCA 3KTQA 3I53A 1JI8A 1O6XA 4K4XA 5E8GA 2WTEA 4ZPBA 2LH9A 1NDKA 1LK5A 2NPFA 1EAYC 3FXLA 1UWBB 4G1QA 2DXIA 1HCRA 4RBTA 1G1XA 2NVXJ 4EI2A 2UXNA 4CM2A 5KFCA 4K2EA 1M90T 3O6BB 4FF1A 2QT7A 3ULHA 4K8RA 5KG5A 2RB7A 4KE5A 1WNEA 2JA2A 3W9IA 1EH7A 3MPDA 1RA6A 4RUHA 3OL8A 1XG1A 5FO5A 4OMFG 4P72A 3E97A 1QDUB 4ZLLA 3E6CC 1SAUA 3CP2A 3N5FA 2GOMA 2BZTA 2BM1A 1JKOC 3OYKA 4FDFA 2ZM6J 4DZ6A 1IDYA 5FFZA 4F4WA 2KRRA 4GRIA 4XIUA 4XKWA 1D8JA 2RKIA 3RI4A 1SH2A 5HATA 2XC9A 3A0BC 4DG1A 3ICLA 4X64J 2MKJA 1XGNA 2BW7A 2MSSA 3OVBA 4ZVEA 1VFCA 2VKHA 3F73A 4DR7F 1MSWD 4ECWA 2HKEA 3ZTQA 4CO5A 3RPQA 4FTHA 1XBWA 3KKFA 2OD5A 3L95X 3P4UB 4ECVA 2FUG2 2YUSA 5B0FA 1BD6A 1PYOB 1ZOTA 2FGOA 3VWBA 2DEIA 4OYBA 2LY2A 4OZ3A 5KT6A 1E6YB 2IJLA 1CJKB 3JRCA 1RCXB 3D6FB 2CADA 3Q8SB 1PO6A 2H8RA 4DX6A 2LMDA 4IX7A 4PR6A 2WCXA 1Z1DA 3BR3A 2OJ3A 2M5YA 1F9EB 4LJZF 3LWLA 3MMBA 4OX7A 2CG4A 3ADAC 5BNGA 3FXMA 5DS9A 1G4DA 2WC2A 3MUMP 4HNUA 2OPRB 3B4MA 1G3TA 4YS2A 1ETWA 1IWAA 4B09A 4EQQA 3LSMA 3LP1A 2VN2A 2GGPA 3M6UA 1H8AC 2KRFA 3MFHA 1GLNA 3QGHA 3DOMB 4X4VA 2BMBA 4DL3A 3RU0A 3OTDA 1X60A 1K1QA 4JI5J 4A3MJ 3GO5A 2CNOB 3HPGA 5LJ3Y 4URGA 3QO9A 3R5DA 4OHXA 4O3PA 4ZPDA 2KISA 5BPIA 1KQ8A 4DL5A 1TK8A 1NBEB 1U8BA 3FBBA 3OYAA 4Y52J 2LRDA 3CD6S 2BXJA 3VEPA 1FE4A 1DQAA 4DL4A 3PY8A 4ICLA 2MSYA 3HCXA 2GA2A 2IPOB 3BSCA 2AS5F 2VONA 5M2UA 2PDAA 3QIPA 4DX7A 3D5MA 5HS8A 1M1GA 1HOMA 4QWQA 1MD0A 1PBAA 1NJYA 4R5PB 2V9KA 5E5NA 4WWSA 4CO3A 4N77A 2BJEA 4LF8J 1RTIA 3UVJB 2ZZNA 2GWRA 3RBDA 2XGDA 4K7QA 2E44A 1DAXA 4P96A 2VA2A 2OH2A 1JJ2R 2YWWA 5EN1A 2G9OA 3QFWA 1GXPA 4MEXF 2BANB 3SQOP 1TV6B 3EYYA 2QL5B 1QSYA 4P6QA 1KQFB 4JBAA 2VICA 4MIWA 4P75A 3MR3A 2Y31A 7AT1B 2R7RA 3BLYA 2ZJQQ 2VU5A 2XIGA 4A69C 4KQZA 1W7PD 3SZPA 5DDRC 3OW2R 2I8DA 4AIHA 4RBOA 3GX4X 4B44A 3NEKA 1RZ4A 4J00A 4OYZA 3UQSA 3W2WA 2MZQA 5D0GA 4K4UA 3JTHA 1FTRA 2LLKA 1IKYA 1KDNA 5D0EA 3H3VK 4OZ5A 4MHGA 1HBXG 5D6GA 2NYIA 5IC4B 1YX5A 3SFIA 2MKIA 2QQ8A 1I39A 1YS6A 1AHDP 4QYZK 1Q7LB 3HBLA 2J5AA 1AROP 1WCMJ 4PJMA 1QNTA 2DRAA 3TW0A 3OOPA 4IFYB 1JK9B 2ZKTA 2ELJA 2NOGA 5LMUF 3DF8A 2PD1A 2HFSA 1OYDA 2XG8A 3MKLA 4F3MA 4FXVA 2KHDA 3J7AN 2ZBCA 1YRTA 1GAOA 3BN7A 1FDDA 1E3HA 2MBFA 2CYYA 2HLTA 3RZAA 4LRFA 1HDDC 1D5YA 4A8XA 2BKOA 2VG5A 3Q22A 3PACA 2C42A 5C24A 2IMOA 1S6UA 2XZTB 5J1EA 5FFXA 1VLOA 3I59B 2VB6A 3UNYA 1RBOB 4P73A 2KDOA 4BJ5C 4B3MJ 4FPRA 1AB8A 1BHNA 2GXBA 3RQIA 3NAIA 4MJKA 1HPZB 3JS9A 4JX5A 1G6BA 1EF4A 3NAUA 2R92J 1X1BA 3PRBA 3MWMA 4CXFA 4I4BA 5HLFA 1HBMA 4F7VA 3KJFB 1S1WA 3HRTA 2QA4S 2R3VA 2DNOA 2G9WA 4ABZA 1D0ZA 4L5IA 3QU6A 3CJTA 2V2ZA 5B7WA 2FSWA 1ZPVA 2RIJA 2A6HF 1K9MT 3I96A 5L9XA 1FIPA 4I6WA 3WC0A 1VHIA 3CMAI 3IP0A 2D69A 2LD5A 3HUGB 5IYCJ 1T9XA 3FKBA 1RAJA 3JYTB 3AG4H 2H5IB 3D54A 4ZJQA 4E7HA 1JUMA 1SJQA 2CDRB 3BO3A 2XKOA 3OBIA 3G96A 1Z4UA 2E7XA 2JJ4D 4CT8A 4O3MA 3N28A 1UAAA 3R9LA 1BR1A 1WKMA 1N36J 3HT3A 4AWXB 5CVRA 2XS2A 1W36D 4NYPA 1XSXA 3K0JA 1H2VZ 1DU0A 4BY1J 1H6KX 4RNNA 4M9SA 3LF0A 1PP8F 5HMZA 2DGUA 1V9OA 3DYAA 2W7AA 4K4ZA 5F8GA 5DQHA 1NK2P 3J7AO 3C2PA 2J8AA 3V6DA 3K58A 1YSJA 2FIUA 1PG5B 4B02A 1WRJA 2XLKA 3AQPA 5K7ZA 1IKWA 2BJ1A 2KT3A 1NSPA 2ZVIA 2FJAB 2OMOA 1PUFA 4H4KC 3IBCB 2PMZD 2Y1JA 3I4NJ 4UUXA 1JKHB 2DHGA 1WJCA 2DRBA 1S29A 4HQMA 2RV8A 3AY0A 3C6TB 1AUDA 3K89A 4HZFA 2DK5A 4NEZA 1S49A 1H74A 2UXCJ 3JB9k 1IGNA 1K1SA 3KJVB 3F21A 1C0TB 1OWXA 3H25A 2KP6A 4XICA 5I3PA 1Q1VA 3FBNB 2H51B 3T6BA 2DO7A 4U0VA 3CPWR 1ODDA 3KDNA 4Q0BA 3EQLF 2F1FA 2YKMA 2HKOA 1YLXA 5D5UB 3DMJB 2CW8A 1I1SA 3RW7A 4I2PB 5C42A 2EFNA 2D41A 1O7LA 4NCBA 5L3GA 5D5WB 1M5VC 1HA1A 1IQZA 4HI1A 2IA0A 3KZZA 4ENMA 2F9JA 3JAMY 4OAZA 1WSVA 2R3SA 5ETMA 2ALZA 4DV5J 2RNEA 3FCVA 4JI8F 3K70C 2O67A 3FQKA 3OL6A 1TKDA 5FDLB 3P9IA 4EV0A 2NVQJ 4GDFA 1ON2A 1X1DA 3L9FA 1D1AA 1F1BB 1RYRA 3Q8YA 2HFNA 4GKJJ 3CJ3A 4J9SA 1RAIB 3M1EA 4ESBA 2PJRA 2DGOA 1L3SA 3K4CA 1VYAA 5THWA 5HS9A 1ENHA 2J6UA 2IXSA 4NUBA 1WWXA 3KHHA 1XS9A 2B56A 1N52B 2AX0A 2FVCA 2QTWA 3H4BA 1OMIA 4IRIA 1W7PA 1Z6TA 4AC0A 3S2HJ 2J7WA 3WGIA 3HZGA 3BTLA 1R5HA 2O6GE 2MHNA 2WADA 3W2AA 3C66A 3WX8A 2XVCA 1X3WB 2VUGA 1JLCB 3IKVA 1MJ9A 5JLWA 1X0FA 2A2CA 3LL7A 1KU7A 2EG2A 2STTA 4V2GA 1TTHB 1T0FA 3LAMA 2UXXA 2H5JB 5F1RA 1HWLA 2QSHX 2XLJA 3GFLA 1KQ0A 1UFMA 3LSIA 1IXCA 4MH8A 4F55A 4LLGF 2W00A 3G1LA 1VF9A 3BC8A 3RIRA 2OA4A 5C4XJ 3NGUA 3A4CA 2ADCA 1X3ZB 4DL2A 1U26A 1KC8T 5H9EK 1L3UA 1AOYA 1O3RA 4FYWB 1Y10A 5D4LA 1R5GA 3PRVA 3WU0A 2ZJQF 3MM9A 4DL6A 3VAFA 1U7LA 3I4HX 3WX4A 1XB4A 2MZTA 2EZIA 1JJ8C 1U1QA 1Y0UA 5IT9Y 3O8GA 1ETVA 2LKXA 3RRGA 2EG1A 2RAEA 2DFEA 3J80Y 1B8IB 3DHXA 1NPKA 4F52A 3TOBA 4KT0C 2LU1A 3IAS9 4OX8A 4QWCA 2K1RB 2QL7B 1U0JA 2UZKA 1JXSA 4K4VA 3SCIE 2ZBIA 1CF7A 5A76A 2LYVA 5GADJ 1HKQA 1UEUA 1P4XA 4O4GA 1XMBA 4F4YA 3F8BA 2IMWP 3TZXA 1B0TA 2JN6A 3HF5A 2HNDA 1DURA 1TL7B 3HIFA 3LSRA 3HFZB 2V34A 1FY7A 5L1JA 5AXNA 5CXTA 4IDKA 4PZJA 2J76E 3GCWP 4M6XA 3UN3A 1R1UA 4MIMA 1M1HA 2G1DA 5J2QB 5FKKA 4RNOA 4QWAA 3QPHA 5DS7A 2E5GA 5HMYA 2CDQA 3ZP5A 5CYQA 2J0QD 4YR3A 2O5DA 1IXKA 4ZIVA 4DCPB 3TO8A 1BQNA 3ZQQA 2BA9A 2QQ9A 2XYHB 1U1MA 2VHGA 2ECCA 5KCMA 1HW2A 2XGQA 1IJEB 3U2RA 2MLGA 3C8YA 2P9EA 1YRNA 3HFKA 2DOEA 2HHTA 5CYMB 1XNQF 3H2LA 2Q43A 1FYLA 5CA5A 1IDZA 3BSOA 1YG2A 1N77A 1WHYA 2OLWA 1PUEE 2HU9A 3EUNA 2A69F 5KFNA 3PJ9A 4WFNQ 1MW7A 3ZPLA 4H4MA 1C1CA 4ZCIA 2XULA 4CH1A 3L7PA 2CVIA 1U8SA 2ACMA 4C0OC 1NKBA 3OVAA 3MMAB 3KP5A 2PMZA 2N4CA 1Z21A 2XMKA 4DR5J 3THTA 1SD7A 2GX8A 2M52A 4TLQA 2G7UA 1U8WA 4ED0A 5A8RA 3CCZA 3Q0WA 2YQ3A 4NLVA 2IGOA 5DUKA 1IRZA 4OYWA 2ZCWA 5LEKA 4FYXB 3CTAA 1SFUA 1SC1B 2W4CA 1NDCA 3G8TA 1RT5B 4RAGA 2DHXA 3W2VA 3KEQA 1IKXA 1WDDA 3R5GA 2FC9A 2HDWA 3UDLA 1OR7A 5AXMA 3DU5A 1UVMA 3SCKE 2XF6A 1RT2A 4NXMJ 4FQGA 2E2HJ 5HVFA 2HVEA 3MVPA 3FMQA 3FSXA 1WOPA 3KHLA 4KPYA 3BPSP 1PSDA 4HV6A 3BWGA 3GIIA 3GE9A 1G8XA 1I51B 2B51A 4NI2A 5KG6A 1TK5A 2HW3A 2ZB9A 3SZ2A 3VYTB 3HOXJ 2ZEJA 2VJ4A 1YITS 3WZ0A 4KRWA 3G71I 4HTJA 4HKQA 1FNMA 4B48A 1HWIA 1WI8A 2M8GX 3EVMA 2Z5UA 1FOWA 3RAXA 4R8UB 1MJAA 3M2RA 1HNXJ 1BR2A 4ZYGA 2BZ2A 2MTLA 3M30A 1Q1KA 2Q66A 2F4OB 1FYMA 4DV0F 4ES1A 1OJLA 2L48A 1VR6A 1T8IA 4CLYA 2K9SA 1RT1B 3DLKB 5FIIA 2IW5A 4LFBJ 5JHUA 4LB6B 2K06A 1SXLA 3I5BA 2DCEA 2HWHA 3PW2A 2ZH4A 3KK2B 5GAGJ 1TKTA 5D77A 3FZ2A 3HHLA 3M1VA 5A8KA 1YS7A 2HOEA 4EJVA 4BU2A 3T5KA 4LG0A 1VMBA 3CDEA 4OZ1A 4KFBA 2VPXB 4KISA 1QVGR 2GA1A 5TJJA 4FASD 1R0BG 3IV5A 2GJIA 5JVGQ 1FRXA 1YJVA 3GFMA 2XSJA 3ELHA 3OJUA 4JX6A 3FKJA 2VQEF 3CMEI 2HVRA 3RZOJ 3B6AA 1ZA1B 4KA4A 2VE8A 2XMUA 2VC1A 4P5OA 2Q6CA 2HYIB 4F4ZA 1TFYA 1TL8A 3ZQIA 4IRHA 3V5RA 2HHQA 1CJUB 2YX7A 5D15A 3G86A 2EZKA 3IRRA 3W66A 5I3UA 3ZQGA 4WCEQ 3TJ9A 2XM3A 4JOMA 5HJYA 2C3OA 2TRTA 2SXLA 2BOLA 2N7YA 3K7AJ 3HHGA 3OY9A 2MD5A 2MG4A 2K9QA 4PYAA 2D7SA 4H4OA 2VQHA 1BL0A 2Y3YA 1XK8A 1WEZA 2VG7B 4L5JA 1DARA 2BVZA 3DLJA 1OIAA 3B6CA 3VR1A 1N78A 1J5EF 4LF5F 2HEKA 3S3MA 2GO9A 4ENOA 2W8LA 4LQ9A 3HB9A 2HQRA 1R3NA 1GV2A 4XORA 2V50A 1SFXA 2ZMEB 2LKSA 1SIWB 3OYHA 2VBWA 2J6SA 4ESJA 1GMUA 2OO4A 3GV7B 2PEXA 8AT1B 3BCAA 3S1RJ 4F7ZA 2HHPA 2JZYA 3UNGC 1WJFA 2HDCA 4M5DA 2HHVA 1FK9B 1VTNC 4GVBA 5L3FA 4IQXA 5D8KB 4ZZLA 1S6OA 3FFIB 1LEOA 4CM0A 4KGZB 1OPIA 1HNWJ 4OLOA 1SI9A 5HQ8A 2AP6A 4OLPA 3BR6A 3UR0A 4LSNB 4PZVA 3W63A 2R7OA 1ZAXA 3OYBA 2MYSA 5C2GA 3MEGA 3NY0A 2JEIA 3QZ7A 4R0EA 4PG8A 2CVEA 2GHVC 1P4AA 4E7SA 2RNGA 2PE8A 3H5NA 1Z6RA 4V2FA 2WB4A 5DYMA 2DMUA 5IPAA 4FVMA 2V63A 4RS8A 2OGUA 1L3TA 2XROA 1XSDA 1KFSA 2V5HG 4MO7A 2IJFA 3MCOA 2DIVA 2BGCA 3IC1A 3TOAA 3RR7A 3GBGA 1N6QB 3KZYA 3CWJA 3JSMA 2H8WA 3S3NA 1FP1D 3FJ2A 4P7VA 2PI0A 4XMYA 2A3SA 4PEOA 3RAMA 2NOJB 2MLXA 2NZ4A 2V8GA 1FWPA 4YIRX 4YB6A 1XQIA 2V9VA 2RUGA 3ZMZA 2DLLA 3GQCA 3BGFA 5A8WA 2WVDA 2G0JA 1IQTA 3ZQFA 4C8OA 2UXDF 5HMXA 2HVSA 3Q23A 1Y7PA 3E8OA 5A2QY 3VF0B 2LY9A 5DD4A 4G1IA 1WHUA 3MEDA 1RRJA 1R23A 2NQPA 3F6OA 5IOYA 1G3WA 1KEKA 2DT6A 2CPYA 1DU6A 3I9ZA 3R6SA 2BXYA 4JI2J 4J9RA 2NNNA 2OKQA 1LWEB 3DXJF 2HFOA 4OJ3A 5DDPC 4RW6A 2LA6A 2AEFA 3J81K 2NAZA 2GVDB 1MSFC 2L7KA 2CZ9A 1WVRA 3MM7B 5LGUA 3GG0A 1S1UA 3S1MJ 3SDEA 3M9AA 2RJZA 4YB5A 4JYAF 1FJCA 4V1Ak 3TA0A 2ELKA 3K2ZA 3QJJA 1JXEA 3I4MJ 4ZITA 3BKFA 2W1BA 3HHNB 1O0PA 2XWXA 3EYZA 3A3NB 1S9HA 2EXUA 2CFOA 3KLEB 1CG2A 3MM8A 1S1VA 1TP4A 3R4KA 3O8HA 3H3UA 4TV7A 1LQ1A 3PW0A 2DW4A 4QU7A 1HNZF 3R97A 3IHUA 4DZPA 1ETKA 3OTBA 1HIYA 1SV5A 4DR6F 3ZO7A 4FX0A 2NYXA 5B0DA 4UVCA 4NC6A 3LTOA 1Q5YA 4U0WA 5HBMA 1VZ0A 1JXLA 2RRAA 2ZUAA 1QHHD 3AQOA 4O23A 1TNSA 2PBIA 1B99A 2K7JA 5BYRA 1EHWA 4U8YA 1JLFA 1ZA2B 2AHQA 1YJRA 5GPCA 4ZHRA 3VB2A 5L1KA 4MMOA 3DOLA 3F0NA 1NM2A 1ZZNA 4USJC 1R8CA 3KFWX 4HG2A 4RGRA 2UU9F 2DRDA 4I2QA 5EX0A 4L18B 2TCTA 2CJAA 3CIMA 1LEAA 1I1GA 4MFBB 2F2EA 4JV5J 1TMJA 5GAEI 4N76A 2ROEA 2FLLA 4LF9J 3OWTA 2VL1A 1TUGB 1BI2A 4WP3A 2DTJA 2BJDA 4NLQA 3M6XA 1HHQA 3MKYB 3NXZA 2OFHX 4DFJA 2QWWA 4XRFA 3ZTSA 3O1LA 3FXUA 4KYWA 4CA0A 1MN7A 4BY7J 3KOAA 1CQTA 3RW6A 2QA1A 2F4VJ 2JA8J 1NZ8A 3NWRA 2LBFA 3RPUD 2WHOA 4RKUC 1QVFR 1X4GA 4B9MA 2VE9A 2WAFA 4QPXA 4X65F 3MM6A 2GVZA 2KHMA 3KLVA 1AW0A 1VQ4I 4KT5C 4YY3J 2JZ5A 2R8KA 3JTGA 1A04A 3SHFA 2B9EA 2L41A 3TW7A 3H5XA 2AJ2A 1QLNA 4RM3A 1XMQF 3R5BA 1FYKA 2F7VA 3L2WA 2J7KA 4K0KJ 1ULYA 4DOZA 4CLUA 1OCOH 3KP6A 2HS5A 1FEEA 2A05A 3C2BA 2XY5A 4LF6J 2GO8A 2B9SA 1K78A 5F8JA 4ECYA 4CTAA 2ZFWA 4I7FB 4J37A 1ZLJA 2WONA 2L7FP 1BW5A 1OSCA 3C14A 5B0AA 3VSLA 2CNNB 1D9AA 5AONA 4Z7CA 2F63A 1P7JA 1PJ7A 1FWKA 5GVQA 2IGNA 5AIQA 4DJBA 3MAAA 3WHCA 2DDBA 1W1WE 4A3DJ 1QO0D 3ONQA 5K14A 1WHVA 2R5ZA 1EJ9A 3H2VE 3I9V9 5JVGF 3H40A 4QW8A 3EUHC 4TU7A 2GQ2A 4DZDA 4EZ9A 1EARA 1SVOA 1APSA 2Q0OA 2K4BA 5CQGA 2O66A 3HFVA 3KXDA 3J7ZI 4U7CA 3JRBA 4NBQA 4IR9A 2O8XA 5CZVA 2QVOA 5LD2C 4ELUA 2H09A 4I02A 3GFJA 1UA1A 3OFEA 4B3RF 3ZTOA 4FETA 3M2VB 4QWBA 4NC7A 3BO4A 1N5YA 5F8LA 4DV7F 2UUBJ 2A5YB 4WTOB 5DQGA 2VPLA 2ERRA 3WTYC 1Z3YA 2RF2B 2NUUG 2JRTA 1U6BA 1NH8A 5J2MA 1NHAA 1N5VA 2KJCA 3Q0VA 2VUMJ 3ISZA 3WHBA 1N8RT 5IT3A 3VGUA 3TEDA 3G8QA 1S6LA 1Y5NB 1YE9A 3ILLA 2V1NA 3NS7B 3ERMA 2DNNA 3DXSX 3BZQA 2M5WA 4RX6A 4WXCA 4UZCA 4UTGA 1DPRA 2G7HA 1UP1A 3V4IA 2Q1LA 1IV6A 1FLIA 4EJUA 4LBPA 4U87A 1WACA 3X1LB 1NKCA 3IL2A 2ZH9A 3DGPA 4QR2A 2AWZA 3D1HA 1RK8A 4LFAJ 3MCZA 1S79A 2ZO4A 5E0OA 3S8PA 2BOPA 1KLMA 3KP4A 1KR4A 2OZ6A 4C3KA 1VJQA 2R9LA 3D66A 4LR8A 5CVVA 4K4WA 4J9LA 3QSYB 2MXYA 3ULQB 2O8KA 2XPUA 4R79A 5KHDA 4RBUA 2O3DA 1W5CC 3RTRA 2LEAA 5F3TA 4AQYF 2CQNA 2EWNA 1VRUB 4KIBA 3NAHA 3BGLA 1LDKB 4OIOF 2XHWA 4Q8EA 5LGTA 2DI3A 3EDPA 4MGRA 4UVAA 1S6PA 5AXLA 2WVEA 2ASDA 3J7YJ 2CIMA 1SD5A 3IG1B 1AYEA 1STZA 3OS0A 4ZVOB 5HL7Q 1RWXB 4ZDLA 1Y0HA 3L2VA 3BGRB 2JRSA 5HLTA 1O51A 3UD5A 2EIMH 5KOXA 3POTA 2DYRH 1DTQA 5ICCA 5CKTA 1NJWA 1FEXA 5G0RB 1WFXA 3W9JA 3LAPA 2I5JB 4C2MA 4XM3A 2XSDC 3HOVJ 8RUCA 2YPYA 3L3CA 3ECHA 2ZM6F 5L1LA 2HFUA 2V7FA 3W3SA 3PO2J 2DH7A 3GV8B 3MCMA 4PSXA 3HZJA 5GTHC 4OAYA 1XMAA 4X64F 4A47A 3O8WA 2H5EA 3IRQA 2ZH2A 1U47A 3OSNA 2FX0A 4IHSA 3KMQA 3WU2C 4CICA 3CCJS 3DDNA 3FQLA 5IS2A 3BS9A 2CUEA 2EVZA 1ZELA 5HDKA 3WU1B 3I32A 2ZC2A 3W3CA 1JLEB 2HQ3A 2L9DA 1VQ9I 2CJJA 5AE1A 4DPXA 4M95A 1DLOA 5D3GA 1UVNA 4KHPJ 2MC4A 3CJRA 1USTA 2FMLA 3ML6A 4LUBA 4JI1F 1BC7C 4JB8B 3CULA 1BI0A 3BTJA 3D0GE 1SQGA 3H42A 3KIOA 4FF4A 2O03A 2Z2ZA 1WTBA 4DR7J 2DKOB 4AIJA 2KT2A 3RPUA 3QYYA 4XONA 4DSJA 1WC6A 4NASA 2M4GA 4A12A 3BEGB 1WZ2A 5D0RA 1NLKL 2PFBA 5C3EJ 3C16A 3MAQA 1FSHA 4ZK7M 4ZDPA 3SV4A 3CLOA 1IC8A 3ILJA 4Q44A 1VQYA 4F04B 3HT0A 1KQ9A 3BGOP 5FGMA 4M71A 3BR1A 4KO0A 5J1RA 1U2WA 1CJTB 3EDQB 1U8RA 2FGCA 2C22A 3K8WA 4JI5F 2KTQA 3N9UC 3I64A 5GP9A 3HOSA 1RIOH 1O3TA 1HQEA 1N0UA 2E5ZA 1BXNA 1WJ9A 2IYGA 3VPRA 4DYRA 4OINF 4L3KA 4BEHB 3PEJA 3ABUA 4LJMA 1LW0B 4CSWA 1V5EA 4U7BA 4U6PA 1TBXA 1U6FA 2WY8Q 1HARA 5ETSA 2PMZN 2VPYB 1HW1A 3PTWA 3FK4A 3NWSA 2M3DA 2A6OA 2VXZA 3G4SI 3J81U 1UCRA 2GZOA 4RA2A 1IR2A 2LP4A 1F5TA 4X62F 1UCNA 4LF8F 3CC7I 3WTSC 3VAMA 1U1LA 1HMVB 1K6OA 4O0IA 3BREA 3C6UB 1TUWA 3QGGA 3QIDA 4KPCA 1X9SA 3MZ8A 4QIWD 3V2UC 2XYPB 3LNQA 1HBUA 3ABKH 3CSKA 3FX3A 3FGVA 2HNHA 1REGX 2HBYB 1U1RA 4JI6J 3NGSA 2QMXA 1U1OA 3AXKA 3R5CA 1VQMI 3PFYA 4EGYA 5D4SA 3R7BB 4E7IA 2G0CA 4GO5X 2MH9A 3OMYA 3UDCA 1KVJA 4A93J 3BV8A 2CPJA 2IEKA 3GV5B 4YHHJ 2GW8A 2CPXA 4U88A 4TQSA 1SEUA 4AL7A 4CCHA 1ZRFA 2GAUA 1G3YA 4DHVA 1YQHA 2DNMA 1Q81T 3HSDA 3PM1A 3DDIA 5J2PB 2F4FA 1Q8BA 1RHRB 4CO1A 2W9AA 1V5IB 2M34A 4KY3A 2JVHA 2Z4PA 2PX9A 5KFJA 5EG0A 2ZUGA 1S72S 2ACJA 4Z2XA 2Z33A 2CNLB 1AWCA 3NP5A 2VFSA 2Y1IA 1UHSA 1P92A 3KNAA 5C7PA 4BXFA 1F6TA 4MNUA 1YJ9I 4GO1A 3CT9A 1OCRH 2GIRA 4ED3A 5M5XJ 4LG3A 2BM0A 2DNHA 2D3O1 4GYGA 1LPQA 2JUGA 4NLYA 3I56I 1RAFB 1ZYQA 2GS8A 1MBJA 4ELVA 4YQWA 2W9CB 2ZWPA 3QPSA 1NK7A 3P49B 3E1SA 2YNHB 2AQEA 1QJHA 1S7AA 4GKKF 1R31A 4N0BA 4KT6A 2QLBB 3NCQA 1T3NA 3DRPA 4B3MF 2M8EA 4K4TA 1V5GA 3IKTA 4TU9A 1FCAA 3S1QJ 4UHTA 2KRBA 2K3KA 3W6VA 1FMVA 3IH2A 4J01A 3BBFA 1TWAJ 1N4LA 1OQYA 2DXEA 3EXYA 3LQQA 3KYLA 4ECXA 3GZ5A 1Q82T 3EZOA 3SI8A 1SL1A 2B63J 5K8NA 6FDRA 3I3LA 1ZM3A 2BUNA 2V1XA 4DCOB 2H3EB 1Z2ZA 4V19X 2HNZB 1XR5A 1RLDA 4NLXA 4ASNA 2KL4A 4WKYA 3MEXA 2KT0A 1FKOA 4CIOA 5EDWA 3P9CA 2M7SA 2E9ZA 4XLHA 1UB9A 4JI0J 2C2OB 1KTQA 1FD8A 3OXGA 1ZG3A 1HW9A 1PJ5A 2K3IA 2LDIA 4HDHA 4Q47A 5I3QA 2PI4A 1S76D 1RLCL 4OZNA 2CW0F 3CJQA 3M1CA 1HSJA 2YNIB 1X5OA 3CD0A 3FEXB 2PEHA 4XN0A 4XBFA 1RAEB 3ITHA 3F8CA 5DM7Q 3LQVA 4FNHA 1N36F 3QNWB 1F9HA 2DGTA 3KG0A 3MCSA 5J1YA 1RAOA 3G82A 3X3UA 5AXKA 4PWDA 2M45A 4IG0A 2BQUA 2DA4A 3I0SB 1YOVB 3CCQS 2OF7A 4ID8A 1P7IA 4A2UA 3TUJC 4F4XA 4FF3A 1SMYF 2IC3B 4WYLA 3MMJA 3DDKA 2E1AA 2ME6A 1U6ZA 2IAIA 1U0SA 1U9OA 3W5XA 2RVJA 3CEDA 1W0TA 3ZMDA 3ILOA 4BQOA 1HA8A 1U24A 4KIGA 3I55S 4YB1P 1CC8A 3M8YA 2DJIA 3G73A 3CDAA 4AYBD 4PRFA 1RTJB 1SD6A 2RILA 3FK6A 5HI7A 2UUWA 2DA5A 2FA5A 4KN7X 3P7NA 3Q9VA 4I76A 2RVCA 4DYCA 2UXCF 1ACIA 3DEWA 1R8PA 4G1QB 4UOHA 2QSFA 1RT6A 2BJ8A 2BW2A 4PG7A 1CEZA 1G4CA 3E01A 2ZE2A 3V6KA 3LSPA 3N6MA 4DW6A 4FS1A 2N3OA 2HPIA 1RZMA 2NZCA 2A6EF 2D1CA 4DLEA 4PAAA 4S0HB 1TQLA 2RT3A 1SFEA 1F36A 4LMZA 2R42A 2WTFA 4C4WA 1IUFA 1MBEA 3QU3A 5CHCB 5JHFA 2HGLA 3CCVI 4RR5A 2YBVA 3EMTA 5M5WJ 1MH3A 3TMOA 2DGXA 4DV5F 3IWFA 2WSFC 3NGKA 1CC7A 4ZJLA 1DP3A 4QIGA 1N56A 4WP8A 4CCKA 3R2CJ 1I6JA 2RKIB 2VA3A 2YWFA 3HVRA 3OV8A 3ET6A 2MLZA 4CQ1A 4DG1B 2QGUA 4IOBA 2OUMA 3REOA 2MSTA 3DV8A 5D4PA 3VGSA 1OCPA 2X6YA 1SKSA 1XX5A 3DPLC 4NLUA 4DSIA 4IXAA 4HX4A 1GTEA 2WW4A 2J7UA 5A6PA 4CLZA 5GADU 3T1YJ 2BE7D 3TEGA 2W7NA 2F8MA 3IN5A 2JTVA 3CTRA 3OUYA 1C1BA 2VPWB 4MFEA 4CDGA 4L9JA 2XGCA 4WF2A 1TQPA 2DNGA 4IHWA 1NSKL 4JI8J 1HWUA 4ES2A 2VQFF 1IZ1A 4OZLA 4RLQA 4PWUA 1HNIA 4NE9C 3MMBB 3IFEA 2JWNA 3KLGA 3ZTPA 3SV3A 1HYSB 4LT6A 3A13A 3IAS2 4Y2AA 4ZN1A 1UKUA 3PDNA 1URRA 3QLHA 5K9FA 3FM3A 4KH0B 1RACB 3ZN1A 3UD3P 2KZZA 1RU1A 2AEMA 1P9YA 3LP1B 4NLDA 3CDUA 2K8GA 2EA4A 2CPHA 3V8LA 2YU3A 1UG2A 2P81A 3K5OA 1SANA 1RBLA 4PPZA 1WC5A 5ETLA 4ZLPA 4YEJA 2NRAC 2ZDOA 3OTOF 1BM9A 2WV1A 3I82A 3QP6A 2IS1A 2Y0MA 2XI3A 1GQEA 1QY7A 3FC9A 1SC3B 5BR8J 1LE8B 5DCFA 3HXLA 1ETYA 5EWGA 4WCGA 2BE5F 2AZ1A 5LOQA 2EINH 1WKLA 3KE2A 3GMEA 4XDDA 4WBFA 4S05A 3LP0A 5DETA 3E6MA 3NEUA 1R6RA 4XLNF 3UR3C 2HMIA 4ICLB 3FHZA 3OIOA 4M94A 3KUHA 3QIPB 3LALA 4Q8FA 2QCOA 2YNGA 2R2TA 3V7CA 5K5RA 3QRPA 1QSLA 2KIQA 3GTOJ 1CQNA 3IH3A 3BBBA 1MGTA 1T9WA 4XLFA 4FZVA 1IKVB 5LSRA 3MTKA 2Q2EA 3RCOA 5K8MA 5DUIA 4EBCA 2QSFX 3QBCA 3DLBA 1WUUA 5HROA 2KFYA 2G0EA 4USVA 2GZWA 2RMLA 2ZXWH 4QBUA 2D2WA 5D4OA 4DYQA 4HLXA 3BGUA 1MU2A 2BABA 1VRTA 4EEFG 3RQ4A 2EJRA 3NQOA 1ZLKA 1VLYA 2CAJA 4I0AA 4EK2A 2AV5A 2ZBKA 2FD5A 2GXGA 4KN4X 1JUPA 2MW8A 1IBLF 3PXGa 3MOJB 3D5SC 1NNDA 2HZCA 1IXRC 4G6TB 5F0WA 1DQUA 2DGQA 1A6QA 2BJ7A 4XLCA 2ISZA 3W2WB 4QSHA 3TQEA 3U27A 3GF2A 5E3MA 2DODA 4DR3J 1X2NA 2UV1A 1IKYB 1TWCJ 1VHFA 4AVPA 4B4CA 4IH7A 3CVKA 4DU8A 4FVCA 4IG3B 1UWBA 3H8YA 4Q2LA 1PDNC 2ZXIA 2KH9A 1AUSL 1J2VA 1D8YA 4IUFA 2B9XA 5KG4A 2BR0A 3GFHA 3V7SA 3VODA 2V8DA 3CUOA 1JXVA 3LANA 3IH4A 3HSGA 5F08A 1RB0A 4UNOA 3NCPA 2FU4A 4M3EA 4UB6C 1RHKB 3T5LA 1RHQB 3MPUB 1R7JA 3BG3A 3Q8RB 4EJWA 4AYBA 3ETMA 4BDZA 1BQMA 2VG5B 3WE3A 5C24B 4ECRA 4PJ0C 4P10A 4PXCA 4DQQA 4XK8C 3T8RA 2JT1A 4C2MJ 3GJQB 4KH1B 1RISA 2ZJ2A 4BKXA 1ZTWA 2EKYA 4WFYA 1H38A 1ZGAA 3H2UB 1TFWA 4QPTA 4ITVA 5DM7F 1EH6A 2MKKA 4J9OA 2V4RA 2VG6A 1XGMA 3C1DA 3MEEA 1XNRF 2CO5A 2DOAA 4L9VA 4ZVGA 1RR8C 3VZHA 4ANEA 1HBMB 1CBKA 1F3VA 3ZNUA 4I1TA 4WYWA 1S1WB 3F72A 2XTJP 5K7HA 2D1VA 1WOSA 2M0CA 2OBPA 2N82B 1E6YA 1CJKA 1K4SA 1H89C 2JVGA 4CCLA 4OX9J 5ETQA 4NCGB 3CJTB 4J90A 5E3RA 2KYZA 5JMNA 1Z7LA 5IM0B 2B7EA 2DA7A 3SQGB 3QSIA 4ER8A 1IBKF 3W6JB 4CWBA 3DOKB 1WPKA 1IW7F 1HNXF 2KFZA 4AUKA 5KT3A 2CW7A 2E5IA 1EZZB 2OPRA 5LHGA 3G4SS 2UWMA 3A8JA 3S01A 3EM1A 1F2GA 3CJSA 4LFBF 1K8AT 2IAJA 4ZJOA 3HSRA 1QA6A 1HBNA 4IEJA 2Z30B 1HC8A 3DOMA 2EI5A 2LQJA 3MN2A 2E1MB 3HGGA 2DHHA 2C2KB 4FYVB 4HHJA 3KK3A 3HC7A 3DYAB 3CB4A 3S2WA 5BYQA 3PO3J 2GJFA 2AJ0A 3K5LA 1RPWA 3PL8A 4AFFA 1T05A 1AZSB 4TY9A 4IL6C 1IWGA 2JH3A 2WAQA 2W2QP 2XGXA 1I94F 1M5OC 1RETA 1VQKI 3V6DB 1VC6A 4TXSA 3G2BA 1IN4A 4NZ7A 3B82A 1QAIA 3BZ6A 4NZ6A 4DV0J 3DCAA 4QW9A 2HZTA 1RWOB 1UZCA 4BAYA 1PUFB 3GJTB 1U78A 3K0LA 2ECBA 1T38A 2GA7A 3ENVA 3CIZA 1VQ7I 4GVLA 5E3PA 4L72B 1WG1A 2KI2A 4RLEA 4YDXA 1XIQA 3TA1A 5CVIA 2PFFB 2DHSA 3TWZA 4BC9A 2DYSH 1DBDA 1F1ZA 4J9PA 1IRFA 3D0SA 4U96A 3LOCA 4HSTA 4UUVA 4Q0BB 1G2HA 1R36A 2ZFUA 2HPMA 1UJ6A 2AXLA 1TV6A 2BANA 5KFFA 2YKMB 1S0VA 1REVA 4DUZJ 3CDLA 2GCFA 4M5KA 3D1NI 2XMVA 5KFIA 5C42B 2DMPA 1JLGB 2JLEA 2A6MA 1TT0A 4OZ0A 2J6TA 3F0CA 5IV3A 4IZZA 1YKWA 5ETKA 1UAWA 1QVTA 2VQEJ 2X1AA 1U2RA 2PQ8A 2QBYA 1PIEA 4NRTA 2ASJA 1FDAA 4UY8T 3F8MA 2FJWA 4Y2KA