1FJLA

Homeodomain from the drosophila paired protein bound to a dna oligonucleotide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
KQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRKQHTSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of a paired (Pax) class cooperative homeodomain dimer on DNA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords PAIRED PROTEIN
total genus 25
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1995-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fjlA00
3O8GA 4X6AJ 1MNMC 3CQZJ 4XRSA 5GPCA 2JA8J 3W6VA 3L1PA 1LFUP 4A3EJ 5F27A 4C2MJ 1SANA 2DMUA 2Y9YA 3TP3A 1ETXA 3CDLA 1B72A 1ZQ3P 5IP6A 3Q0VA 1X2MA 1GUUA 3BR5A 3A01B 2Y0SN 3FK6A 1HDDC 2MW8A 1TWGJ 1HLVA 1MBKA 3WHBA 1MBHA 3QPSA 3TP0A 2LP0A 2QF7A 3GTLJ 4I76A 2LY9A 1TWFJ 2KDZA 2Y31A 1IG7A 5FJ8J 2AHQA 3S14J 3JREA 2HOTA 3CMYA 2NVQJ 2W48A 5DS9A 3LSRA 2JJ7A 2G0EA 1AKHA 4ABZA 4DYCA 3BTLA 2WV1A 3JRAA 1IDYA 2OF7A 3BTCA 1JJ8C 2RAEA 3LNQA 1JTYA 2K9QA 3IH3A 2XRLA 4L5EA 5J3LA 1APLC 2O7OA 1A6IA 5J1UA 5EZHA 5F0FA 1Z77A 2LTPA 5FKOA 4A69C 1I3QJ 2HI3A 2IAIA 2VI6A 4C3JJ 3JRBA 1B8IB 4Y7NJ 1JGGA 1AKHB 2H8RA 2FJ1A 3BR0A 5E3LA 4CYCB 2E1OA 2XPWA 2O9LA 2LD5A 4JP0A 1GV5A 2HXOA 3TEDA 3Q0UA 1W0UA 4LOCA 2M2EA 1TC3C 1NK3P 2VPRA 3S1QJ 3BQYA 2MSYA 2YUSA 2DMPA 4HNVA 2Y2ZA 3HOWJ 1JJ6C 1FTTA 1MBGA 9ANTA 3GTOJ 1ZKGA 3BR1A 3OOUA 3I4MJ 3MKLA 1NK2P 3S1NJ 1H88C 2H1KA 4J19A 1IC8A 5F1JA 2NS7A 2GBYA 5FKLA 2ME6A 1RKTA 3BG3A 3LSJA 4CYCA 4C3IJ 4A93J 1HOMA 3RZOJ 2Y9ZA 2X48A 2L7ZA 4MFDA 3FIWA 1IGNA 4FCYA 3BT9A 3RZDJ 2JWTA 5K7ZA 3HKZN 3GTJJ 2NS8A 1MH3A 2K9SA 4BY1J 5EDNA 4XRMA 2EZLA 3ZQLA 3VPRA 2JN6A 2DA2A 3CCYA 3TW6A 4AYBN 2IEKA 1JUPA 4G12A 3BG9A 5FKNA 1IJWC 1JKOC 1ZTRA 5K7HA 2DA5A 4B4CA 3M3YJ 2DA3A 1ZK8A 4M3DA 3MVPA 5M5XJ 3RKQA 3ZQCA 1JKQC 1FIPA 3BR2A 1X58A 3JRHA 4EEFG 4M3GA 3BQZA 3SJMA 1Y1WJ 3GTKJ 3HOZJ 2DJNA 3I4NJ 4QSHA 5IYDJ 1EF4A 3UKGA 1NTCA 2L7MP 4I6ZA 2EH3A 2YS9A 1AHDP 4MLOA 3S15J 2HXIA 1VFCA 3JRFA 4B1RA 2HDDA 1YRNA 1BJZA 1OJLA 3C2BA 5E3MA 2OPTA 4DZJA 2JA5J 4A3KJ 2VUMJ 2NVXJ 3BTIA 4MFEA 1ZR4A 1T56A 1Q1VA 1IDZA 3OSGA 3IH4A 1MH4A 2DTZA 4IHXA 2IBDA 3HB9A 2R92J 5IYCJ 1XC5A 5IP7J 2HOAA 3ZOBA 5C3EJ 3LOCA 2LKXA 2EZHA 2FD5A 3LSPA 1IUFA 5GP9A 1FIAA 2XB5A 5F04A 1RETA 1BW6A 4DW6A 3NARA 5M5YJ 5M5WJ 5EYRA 1Z0XA 3WHCA 1WI3A 2YU9J 3HOYJ 2X6OA 2R5YA 1POGA 2XPUA 5M3FJ 3TW7A 1HCRA 4RBOA 4JX6A 2LFBA 3FKIJ 1OFCX 4JYKA 1QVUA 1B8IA 4XRSG 5JLXA 4JX4A 1GVDA 2ELKA 3OSFA 3HGGA 5EGOB 2NOGA 4QTRA 3H3VK 3H0GJ 2E2IJ 2EBIA 2ECCA 2L9RA 3A02A 3HOXJ 4A3LJ 4MIMA 3M4OJ 1CQTA 2R7ZJ 2GLOA 2XB0X 1GT0C 4XIDA 2QCOA 1RR7A 4V2GA 4Y52J 4IHVA 4MO7A 5J1YA 3S1RJ 3S17J 3S16J 3IV5A 5EGOA 2D5VA 3HOVJ 5M3MJ 2ECBA 3GBGA 3PO2J 2LVSA 4BKXA 2MG4A 2VKEA 3HGYA 5C4JJ 5FLVA 3A03A 4BY7J 5FKMA 2E19A 2HYJA 1U9OA 1X2NA 4FE7A 5IPAA 1JKRC 1WPKA 4RDUA 1WGXA 3G1OA 3B6AA 1UHSA 3DEWA 3NAUA 3FISA 2M34A 3B6CA 5IP9J 5C4XJ 3Q0WA 4A3CJ 2WB1N 4XICA 2HOSA 1G2HA 1XG1A 1QRYA 4GFBA 1HF0A 2HQ5A 2DA7A 3JRCA 2CUFA 2I10A 5EZGA 4AUXA 2TCTA 1MSEC 1B72B 1JKPC 2JK3A 1MBFA 3D1NI 2DA6A 2MGQA 3HOUJ 1OCPA 3QPLA 2Y30A 4XK4A 2CUEA 4A3MJ 1UG2A 1WH7A 1JTXA 2DA1A 1FTZA 1ETVA 1JT6A 1YRNB 5BNGA 1I50J 3S2HJ 2WAQN 3JRDA 2EZIA 2CQXA 1XS9A 4DZPA 1H8AC 1RESA 1ORKA 1LE8B 2E2JJ 2L7FP 4UUTA 4BBRJ 5IYBJ 4W1UA 3HBLA 4X1EA 2L0KA 1F36A 1H89C 1ENHA 4UUSA 1HDPA 2R5ZB 3ZQHA 1SFOJ 1D5YA 1ETQA 2NVTJ 1VI0A 1BW5A 1ETKA 1DU6A 2M9HA 1K61A 3FK7A 1TWCJ 1TWHJ 5GPAA 2PMZN 1WH5A 2VKVA 1O4XA 2X9DA 1PUFB 2B63J 3GTGJ 4M6VA 2R93J 4W97A 1R9TJ 4IHYA 5F08A 5E3NA 4QIWN 4IEJA 2FQ4A 1P7IA 2JMWA 3HM5A 2ZB9A 3K7AJ 5DTDA 3BR6A 2R5ZA 2EZKA 2DN0A 3G1MA 1FEXA 1E3OC 3LSGA 2CQQA 1VF9A 4NDLA 5JLWA 1LE8A 1JUSA 2N8GA 5C44J 4JX5A 3GTMJ 3RQIA 4AC0A 2DMNA 3SDGA 2ID6A 4D5FA 2XSDC 4S0HB 2DMTA 2KT0A 1VNDA 5K7FA 3S2DJ 1WCMJ 3A01A 4DYRA 3Q3SA 3ZQIA 1ZR2A 2LLKA 2E2HJ 2ID3A 2NVYJ 3S1MJ 1LFBA 2XGDA 2TRTA 1P7JA 4M3BA 2R5YB 3E7LA 1MSFC 1TWAJ 4D5CA 5FLMJ 4FTHA 4A3GJ 5E3OA 5EG0A 2K9NA 1U8BA 2FX0A 4D7NA 2LR8A 2LK2A 2AO9A 2COBA 3F0CA 5F0CA 2ME0A 1T33A 5FKKA 2DA4A 1IRZA 1S7EA 3PO3J 1ITYA 3JRIA 2XGEA 2O8KA 2P81A 3GTQJ 1U78A 2DMQA 3HDDA 2JA7J 4BBSJ 1ETWA 2M0CA 4FISA 4B3AA 1QPIA 4V2FA 3ZQFA 1ETYA 1RPWA 3SFIA 3MN2A 3ZQGA 5F0HA 3GTPJ 1QVTA 2EQRA 5IOYA 1DU0A 4M3EA 4A3JJ 5J1RA 1MBJA 5EEAA 1W0TA 3O8HA 3BG5A 1OCTC 3G1LA 4M3FA 2CRGA 1JT0A 3K2AA 3PM1A 1RKWA 1F43A 1JUMA 2R0QC 4D7MA 2CJJA 5IOZA 1IV6A 3OIOA 3BR3A 1PUFA 5EF6A 1BA5A 1UMQA 3IH2A 2JA6J 1A5JA 1ZGWA 2XPVA 1AU7A 3HEFA 1I6HJ 4C3HJ 2CU7A 3DCFA 4A3FJ 1FJLA 2XGCA 4IHWA 1ETOA 4A3IJ 4UUSB 2M8GX 1GDTA 5HODA 3BTJA 4A3BJ 4BXXJ 1U9NA 2K40A 1MBEA 1Y1VJ 3JRGA 1K83J 5EG0B 4A3DJ 1BL0A 4DYQA 2GM4A 4FE4A 1GV2A 3JR9A 3QQAA
chains in the Genus database with same CATH superfamily
2IT0A 2HPMA 1MNMC 3KP4A 4XRSA 4L0ZB 3WGGA 4CZZA 4RGXA 1HQCA 1L0OC 4RS8A 3ZN0A 5J40A 3VYTB 2ISZA 4PJ0C 4GGGA 4UUVA 2M3AA 2QKLB 2DMUA 2Y9YA 3R4KA 4XBFA 2ZJQF 1Z7UA 5IP6A 3Q0VA 1X2MA 3K1PA 2DT6A 2QA4I 1UAAA 3OYJA 2KJBA 2Y0SN 3A01B 1XSVA 3HC7A 2XAFA 2EILH 1HXDA 2BZTA 2L7KA 5B1BH 3OYAA 4CCNA 1U3EM 4U7BA 2RGVA 2L01A 3OV8A 1IRFA 5B5EC 1MBHA 3QPSA 4QPOA 4ENMA 3DU5A 4GYIA 4KN7X 3H35A 4Y33A 2KDZA 1VQPI 1SMTA 2QM3A 1IG7A 2AHQA 4MGRA 3H5RA 2O3FA 3JREA 4B48A 2FNAA 2NVQJ 1WVRA 4TV7A 4CCMA 2X6YA 4YIFA 2G9WA 3ISPA 2IGNA 3VOEA 3NWTA 1YJNI 4EGYA 2LG4A 4AVPA 3J80Z 3DTIA 2CV1A 2WV1A 2R3SA 2A69F 2EFQA 2DK8A 1IDYA 1GHCA 3GWZA 3CLOA 3BTCA 1JJ8C 4CCKA 2H94A 1D5VA 1QZYA 3GMEA 1IRXA 1JTYA 1OLTA 3IH3A 4BJ6C 2KIQA 1F9NA 4I02A 1U8RA 4UHTA 5FD5A 4BE0A 1Y0UA 1Z67A 2XGXA 2AXTC 2YX4A 1Z77A 2VBWA 2LTPA 3O6BB 2LBFB 1XD7A 4V19K 2LY1A 4HLXA 1XDSA 4IL6C 4CYCB 4N9IA 1FOWA 3U2RA 4P96A 5F64A 2HXOA 3TO9A 3Q0UA 2YSRA 5LRSA 4OAZA 1IAWA 1FY7A 4LOCA 3HTUA 1TC3C 1X3WB 2VPRA 3S1QJ 3ZPLA 2YUSA 3W6JB 2Y2ZA 1LVAA 5DD8A 2ZCWA 4C30A 2RVCA 2BOLA 4A6EA 9ANTA 2P5KA 2PJRB 1QZEA 2FMLA 2KQRA 2FEZA 3WGIA 3DEEA 1T98A 4L0YB 3OYFA 2NS7A 5EEHA 4YFXF 2Z99A 3JSPA 2VQHA 2BVMA 2GA2A 4Y3OA 2RV8A 5KAFC 1T8IA 1HOMA 3W6KB 3HJEA 2Y9ZA 2UXXA 2L7ZA 2YPRA 1DGRM 2HPIA 2OJED 3BT9A 2M4GA 3QPTA 4HOBA 3GTJJ 4XRFA 5JVTA 1K4TA 4OMYA 1WZ2A 2VQLA 1MH3A 4XORA 3KE2A 4PJNA 4BGDA 5EDNA 4XRMA 3FKJA 1SVLA 3HIFA 3ZQ7A 3VPRA 3FXQA 3ZQLA 5CQEA 3QPHA 2QBYA 5HLIA 2ICWG 1BI3A 3OMYA 2WC2A 2IXSA 4BHBA 1UB9A 4ZZLA 2QQ8A 4B4CA 4HG2A 4BQNA 3KZIC 3K0LA 2F5CA 4UVCA 4BS9A 1HC8A 4AIKA 2KZGA 5H20A 1YJ9I 3KLOA 5LHGA 1OPCA 1WJDA 1FIPA 1T38A 4L9NA 2QENA 3VODA 4ZTFA 4KMUX 3GW2A 3R61A 3SJMA 4QWQA 4I7HA 2BY3A 3ABTA 3I4NJ 3SHFA 2FQ3A 3RDIA 1IV8A 3QWLA 3F22A 2FOWA 2I8DA 1ZREA 4HV5A 4MLOA 3S15J 1Z05A 1VFCA 3I0TA 3CLQA 3KIOA 4A0YA 1BOAA 4IRHA 2EIJH 2G7HA 5E1XA 4UXNA 3G73A 1J59A 1YRNA 4A0XA 1S72I 2Z5UA 4IQ4A 2OPTA 3FXRA 1S5LC 4PSWA 3HHHA 2LSOA 4MFEA 3WTSC 1ZR4A 1T56A 1G59A 4CCOA 5A2QK 2P7CB 4LLNA 4EQQA 1WWXA 1RUOA 1MH4A 2V9KA 2XV4S 3CJQB 4KT5C 5AIQA 3HB9A 2R92J 1R5ID 3LQQA 3SZTA 3P9IA 5C3EJ 3GFMA 1IUFA 2XKPA 2JSCA 4NC6A 4UV8A 3OYMA 4P1WA 1YW8A 5M5YJ 2BGCA 1S7OA 3E0JB 3TOBA 3MZYA 1UCRA 1WI3A 1W7PB 3A1YA 1EJ9A 1Y8RB 2E1CA 3CC4I 2L54A 3T8TA 4WF2A 4AIJA 3IKVA 2COMA 5E8IA 4EJOA 2XPUA 5M3FJ 4RBOA 2BW3B 4IZZA 1OFCX 3RKYA 2X51A 2XRNA 1R36A 3OYKA 2K7LA 2ELKA 4HDUA 3H0GJ 5L3GA 1OR7C 1KQ9A 4XL9A 5J8FA 3OR1C 3H5AA 4MIMA 4BEHB 4HX4A 4YIRX 3M4OJ 1ULYA 1GT0C 2CW7A 2CS3A 3V8JA 4NC7A 4XIDA 2V6CA 2P6SA 3CCQI 4E7SA 1JGSA 5J1YA 3FXMA 1P9QC 3S17J 3S16J 1QNTA 4DBRA 3IRRA 1IN4A 2FE3A 1L3LA 5K1YA 1LEAA 3TOAA 3CCRI 5CVUA 1PP7U 2OD5A 2MG4A 3TGNA 2VT3A 2RNGA 4RB2C 1ERDA 3M1CA 2JTVA 1MNEA 3DKWA 3X2QH 3PNVA 1GXPA 1RNLA 3RCOA 4L5IA 3DEWA 3FISA 4NUBA 1C0WA 2X85A 4DIQA 4EJWA 3Q0WA 4A3CJ 3PQKA 2E71A 4XICA 2QKMB 3K4MA 5B1AH 5D5VB 2VXZA 4GFBA 2E7XA 5HDNA 2L3DA 5J6XA 2R7SA 4AUXA 2TCTA 1H9TA 5FLXK 1Z7LA 2NYXA 2JK3A 1AOYA 4G6QA 4DQ2A 1MBFA 3BPVA 1CF7B 3WGHA 2MGQA 2X6XA 5D6FA 2VXDA 1J09A 2O03A 1XSXA 4LIUA 1FTZA 1ETVA 1JT6A 3P9KA 4U87A 1YRNB 1IUYA 3QP6A 1I5ZA 1MMAA 4N4NB 3ABLH 2IGOA 3GFJA 2A05A 3JRDA 2EZIA 2RQQA 4C9YA 1H8AC 2DQRA 1SFXA 4UUTA 3CC7I 1W36D 2R7XA 3GLXA 4P9UA 1A35A 2RREA 1F36A 4YFNF 1A31A 1V4RA 4HF2A 1ETQA 1DU6A 1ETKA 2HZDA 2M9HA 3TO7A 2R7WA 1WJ5A 2PMZN 1WH5A 2FUG2 4FASD 4LK1F 3GTGJ 3JSOA 5FFXA 2VT2A 2RQPA 5LLQA 4QIWN 4IEJA 1J7KA 2PQ8A 4F55A 4OMZA 3OYLA 1E17A 4UVBA 4EM2A 5B66C 2R5ZA 1BR1A 2XUBA 3G1MA 2IGMA 3OWTA 1UHMA 5FLXZ 2NNYA 1FEXA 4PJMA 3KZZA 4YEJA 3MFKA 2ESNA 1XGNA 4JX5A 3SDGA 1R22A 2ID6A 4D5FA 2XSDC 3CESA 2DMTA 1VNDA 3A01A 4DYRA 2EWNA 2HGCA 2W84A 3F6VA 2DDAA 5FO5A 3T0YA 4LIVA 3S1MJ 2V1UA 2XAHA 3CCEI 3N05A 2Y48A 1LFBA 3BOQA 5DEQA 1IN7A 5DD4A 4CH7A 1ODDA 2STWA 1YQAA 1SFUA 1YG2A 1SD7A 4S04A 1TWAJ 2NRAC 1FNNA 4E7HA 1EH7A 5D8LB 2KISA 3DXJF 2ZC2A 3SQNA 3GFIA 1U8BA 2F2EA 3DU6A 5HLGA 3AG2H 3QP5A 2XROA 2Y69H 3G71I 4M74A 2LR8A 1LJ9A 3F6OA 3HPHA 2COBA 1BR2A 1QU3A 2ME0A 3O3KA 2J5OA 3H9QA 1JHFA 2DA4A 1IRZA 2MABA 2XGEA 2K9LA 3LL7A 2CV0A 3GTQJ 1U78A 4E7IA 1WJEA 2UV1A 4XKWA 2AS5F 3HDDA 1FBSA 4D1QA 2VOPA 1RC9A 4FISA 3LMMA 4R8HA 1U5TB 4MTEA 1YI2I 3T1BA 4V2FA 3ZQFA 1OCRH 2IJLA 3H3UA 3ZQGA 3PIOF 5ERIA 3WTVC 2XSJC 4UVAA 1LPQA 4HAMA 5TISC 5IOYA 3DFGA 1STZA 3HYIA 1DQUA 5KHDA 1MW7A 4MQVA 1VQ9I 2R7UA 4FQGA 3MCZA 3G1LA 4N0BA 1JT0A 1TL8A 3AFHA 3PFIA 1P92A 4KYWA 5LHHA 4BDZA 4Q4ZF 2RNJA 3BZ6A 1W1WE 2DO7A 3I56I 1W7PD 1PUFA 2M7AA 1YX3A 1O3SA 2GOXB 4XKVA 2JA6J 2XPVA 2KLOA 4ZYDA 3HEFA 3M1EA 4UNOA 1ETOA 4NNJA 1O57A 2WAFA 3FHZA 1N25A 1Z3XA 2LY2A 3BTJA 1GDTA 4A3BJ 1E0EA 2JPCA 1U9NA 3WTZA 4BDYA 1Y1VJ 1QGPA 2DU9A 5EG0B 4CZCA 2GM4A 4FE4A 4ESFA 4PUSA 4G6DA 5GPCA 3HPGA 4HZFA 3W6VA 2JA8J 2R4GA 3L1PA 1WRJA 3HZJA 5F27A 2BV6A 4KT6A 4G7OF 5JI6A 2DFEA 1Z6RA 1MMSA 1ETXA 4EJTA 3CDLA 1B72A 1ZQ3P 1MD0A 2Y0SA 2UWMA 2DDBA 1YE9A 3J7AO 2KPMA 3CMEI 1OCZH 2QGUA 2GA1A 1HDDC 2MW8A 1TWGJ 3R6SA 3N97A 3IAS2 1KU3A 4GDFA 3WG7H 4CCJA 3CF2A 3WHBA 1K6YA 5JHUA 2QF7A 4Z2YA 1TWFJ 2HFHA 2Y31A 4HNUA 2WTEA 4OIPF 3E5XA 1S6LA 1ON2A 1P4WA 5BQTA 5GTHC 3CP8A 4Z6YA 3LSRA 2Z33A 3ASOH 4IPAA 4BJTA 1YLFA 4ZYGA 2ELHA 5DYMA 2BHYA 4ENNA 1P4AA 1LDJA 1O7LA 2FRHA 3K4NA 1S7AA 1SC7A 3KZYA 3FDYA 1MJBA 2E7WA 1OMIA 4A5NA 1PUEE 3EUHA 4NBQA 2QQBA 2VJJA 3A4CA 1XMXA 4ZC3A 4BHCA 4OAYA 3L2RA 2QBYB 3E6BA 1R5HA 4XONA 1D8JA 2A5WA 2LRDA 5J1UA 2A5YB 4HPQA 1X3UA 4HYEA 2IAIA 2E36A 1ON1A 1AKHB 1O3QA 2MLKA 4YIIA 4WXCA 3Q5FA 4KISA 2YU3A 3VDXA 4FETA 4UV9A 5HNHA 2XPWA 2W00A 2O9LA 4M71A 3PNYA 2BBYA 4CDGA 3G2BA 2M2EA 1NK3P 4OINF 4KUMA 3T8RA 3GLLA 1RR8C 4U88A 1CGPA 2IRFG 3M8EA 2V9VA 1MBGA 3GTOJ 1ZKGA 3EETA 3BR1A 3OOUA 3JTGA 1YW9A 2EFPA 1H88C 3ZCOA 1SFKA 3C1DA 4BUPA 4U7DA 5F1JA 1R49A 1FYLA 5D6EA 1FYMA 2LKPA 2CV2A 2R7VA 5FKLA 1RKTA 3BG3A 2P5LC 1LUJB 4CYCA 3KEQA 3FWEA 4C3IJ 2RDPA 4A93J 1WJFA 1ZAOA 3K4KA 2OBPA 3J80K 1HA8A 1EH8A 4FCYA 1AA7A 4XR6A 2NS8A 3CF5F 2K9SA 3G6EI 4BE2A 1QZZA 2OV7A 4BY1J 3CCYA 3TW6A 2BY0A 4RA2A 1YIJI 3GO5A 1I1GA 3NWSA 5CYVA 2IEKA 4AYBN 3LAJA 1V5GA 3JTHA 2HDCA 3H36A 2IS1A 3BG9A 2WADA 1RIOH 1KQ0A 2BY1A 1QA6A 5GAHJ 1RZ4A 3KP2A 3LA7A 2IP2A 4Q47A 2DA3A 1DUXC 4D9JA 1ZK8A 1HKTA 4M3DA 3H0DA 2H27A 4KICA 3BLYA 2W25A 3I58A 3I59A 1R5GA 5D8KB 3JRHA 3AG4H 4EEFG 4Y4RA 1YOVB 5J47A 1KGSA 1Y1WJ 2H09A 2Q1ZB 5FGMA 5IYDJ 1Z21A 4A2UA 2QLZA 3ZMSA 2L7MP 3LAPA 4I6ZA 2YS9A 2V1DA 3S32A 1LNWA 3VB2A 1B1BA 1KQ8A 3SEQA 4HQEA 1UJ8A 4DGWB 4M6YA 1E2XA 2F4IA 3PNTA 4P55A 4HF1A 3PUBA 3C2BA 3QYEA 4KITB 4DZJA 4A3KJ 2HTJA 4IOCF 2VUMJ 3BTIA 2P5VA 2PJPA 1IXCA 1SEUA 2QSHX 3CDHA 1X3ZB 4IKFA 4AVZA 5E79C 1DDNA 4Y17A 1MMGA 5IYCJ 1MJAA 3MKWB 1XC5A 2VC0A 2KRHA 3LOCA 4QLCU 2EZHA 2FD5A 3LSPA 3CCVI 3FMRA 5F04A 2MLGA 3VSKA 3WTTC 4NHJA 4DW6A 4XLPF 2GQQA 4PGHA 2LF7A 4ZDOA 3AG1H 5M5WJ 1R71A 2CUJA 5EYRA 1Z0XA 4DNCA 4L18B 1D3YA 2DYRH 1R6RA 5F6FA 3BJOA 3HOYJ 2R5YA 2IVMA 1POGA 5E20A 1IXRC 1K4SA 2LDUA 2JVGA 3TW7A 3AL0B 3FKIJ 3EQLF 4JX6A 1UZCA 3GZNB 3NQOA 1KYZA 1T08B 1YX5A 4JYKA 4XRSG 2B7EA 5D5WB 1VQ6I 3KX2A 3OSFA 5TGTA 3L2UA 5E1WA 3HGGA 4A6DA 4R79A 1P2FA 4QTRA 3H3VK 3ZMZA 2E2IJ 1X1PA 2VE8A 4MTDA 3IAM2 4BXUA 3R0JA 1B59A 4HNTA 1CQTA 4ZTJA 2XB0X 2ZXIA 1RR7A 1X1BA 2CW0F 2XF7A 3HUGB 4V2GA 3TBIA 4Y52J 4IHVA 1BC8C 2Z16A 1TW3A 3IV5A 4M73A 2ADUA 3SEZA 2IS6A 3K9TA 2DFHA 3GBGA 4BHPA 1YTYA 2LVSA 3HGYA 2VKEA 2F5VA 3VYUB 4B09A 5FLVA 1XGMA 4HX8A 2HOEA 3F23A 1X2NA 5KAIC 4XN0A 2FOKA 1WPKA 2MH9A 1MMDA 3G1OA 1S3JA 3B6AA 3IWZA 3L2QA 4JQFA 2X6WA 4CUGA 2X1CA 5GAGJ 2K5CA 3KLNA 1XGOA 3B6CA 4N9HA 5IP9J 1IF1A 4CICA 4G7HF 4O3MA 5EJCA 1V5FA 1I1SA 1HF0A 2KJCA 2HQ5A 2O8XA 4A0ZA 1Z6TA 2RN7A 2ZSIB 3JRCA 3OY9A 3HRMA 3BCAA 2M45A 4RAFA 2VKHA 3MEXA 3F8NA 1JKPC 1X1AA 4LK0F 4IX7A 1BI0A 2HVQA 1OCPA 1P4XA 4I0AA 4XK4A 1WH7A 1JTXA 2XIGA 3GCMA 1VQKI 4M9XA 2X1EA 3CO7C 3HL2A 1I50J 5DDGA 3OS0A 4RMNA 2QSFX 2OAZA 2HVSA 2DOAA 2OTLI 1SVOA 2F4OB 2V9PA 1XS9A 4DZPA 2PI0A 1ORKA 1LE8B 3PIPF 5ICEA 4E6KG 3DV8A 5AIPA 4X1EA 1UHWA 2BYVE 5DCMA 4HEA2 1KYWA 2DODA 4UUSA 3Q9SA 1DGWY 3ZMDA 1SFOJ 3PL8A 5H6QA 3OYEA 1TWCJ 1ZYRF 4IO9F 3PQJA 2ISYA 1PUFB 1QQIA 1TBXA 1G6NA 4IRIA 4L9JA 2LC2A 4DBQA 5HLTA 4RB0A 2FQ4A 4I0BA 1QHGA 4PJJA 3K10A 1X1CA 1B6AA 3LSGA 2PN6A 2CQQA 5HDKA 3CUQA 1PDNC 2VJ4A 4XSXF 4EV0A 4OWRB 3U1KA 4IF4A 2XHKA 3ECOA 2BY2A 4LB5A 1BJAA 2IA0A 1S8NA 4GO1A 3RQIA 2Q2EA 4AC0A 3TDZC 3QYFA 2KT0A 4S0HB 5K7FA 5FB2A 3HRTA 3OIPA 3I53A 1ZR2A 2XDVA 2LLKA 4Q48A 3BZKA 2FNPA 4S05A 3V4GA 4BAYA 1TP4A 1VQLI 3H9JA 1I39A 2XGDA 2TRTA 3M8JA 1SD5A 3FM5A 3CD6I 2CYYA 3E7LA 2XASA 4ZYHA 5HLHA 5FLMJ 2X1DA 2CW8A 4ESJA 4ENJA 1TLHB 3R0AA 1ZRFA 1KONA 5L3BA 2K9NA 3GYHX 4R1HA 2V1XA 1A04A 2FX0A 4D7NA 2LK2A 2L4AA 3ROUA 4XLAA 1ZRDA 3F0CA 3CMAI 4OOIA 2IS4A 1T33A 4O5VA 2M7BA 2LH9A 2Z2SB 3OYCA 3KEYA 2Y75A 2L2OA 4PGGA 2YR2A 4U0YA 4HV6A 3RPQA 4GCVA 2JA7J 1WSUA 2M0CA 3NRVA 5E18F 4B43A 4AIDA 4BNCA 2CQ7A 5DM7F 1QPIA 3HOTA 1DPUA 3JW4A 2L9SA 3SFIA 4BACA 2VBXA 2GIVA 5F0HA 3GTPJ 3I9V2 3LFUA 4LLGF 1QVTA 3OR2C 1DU0A 4FHTA 3DBLB 3FXLA 4A3JJ 1V5EA 5J1RA 5EEAA 1G3YA 3PFYA 2VC1A 5FROA 3BG5A 2EFOA 4M3FA 3EUHC 4IOAF 2R7TA 3E3VA 3K2AA 3IP4B 3SZGA 5BOXA 1ZGJA 3CUQC 3GVAA 4D7MA 1QBJA 1IXSB 4L9TA 3SZPA 3KYDB 1WKMA 2L9VA 4B3XA 4PZJA 2D45A 2W4SA 1VQ4I 1BA5A 5CJ9A 4ZYEA 1U0JA 2R7OA 4IVNA 3MZHA 1AU7A 1I6HJ 3A0BC 1QPMA 3DCFA 4XOTA 4IHWA 4HBLA 3E6DA 3E1SA 4NQWB 4UUSB 2M8GX 2JUGA 2CSOA 5HODA 4BXXJ 3RYPA 2KIMA 2R7QA 1J5YA 2K40A 4EM1A 1ZLJA 1BM9A 1F1ZA 1K83J 4KN4X 1TTYA 4A3DJ 1BL0A 2JT1A 1N78A 4ZYAA 1GXQA 3DKXA 1WJBA 4ZH4F 4LG0A 5LEJA 4OIQF 3L7WA 3CQZJ 2ZNYA 4EMSA 2V4JC 3J7AY 1J9IA 3P7NA 4F7ZA 1LFUP 4A3EJ 1VQOI 3R60A 3IL2A 3FM3A 4C2MJ 2FU4A 3D5LA 1SANA 1TNSA 2WBMA 3I54A 1MZBA 1TZLA 1GUUA 1U5TC 1FOKA 3BR5A 1VZ0A 2ZO4A 3KPHA 4EJVA 1MGTA 3MKYB 2EV5A 3HRSA 4FX0A 4L9VA 1XCVA 4M72A 2UZKA 3W2VA 1R1UA 5ICGA 4WXHA 1MBKA 2E34A 2BVLA 4HW0A 2LP0A 3DPUA 4KIGA 3GTLJ 1W5TA 2DPUA 1D0XA 2LY9A 4PCQA 1W4MA 3E97A 4J00A 2E5NA 4II3A 3S14J 2HOTA 4HA8A 2W48A 2ZMEB 1MJ9A 2JJ7A 2G0EA 2E35A 4ABZA 2DT7B 3L2VA 5DUIA 2LOOA 4DYCA 3AKZA 3BTLA 4XOPA 3FXUA 1HW5A 2NS0A 3JRAA 1NG7A 3U1DA 2DTRA 2HQNA 2RAEA 3ELKA 1NH3A 3LNQA 2K9QA 4HSRA 4RAGA 4HDVA 4AM3A 4L5EA 2IA2A 3JAMK 3BG7A 5HDGA 5J3LA 2EIKH 2MFZA 1O3RA 5FRNA 1RRJA 2O7OA 3BPXA 1ZG1A 4IRGA 4KMFA 2JZYA 5E17F 3Q9VA 5F0FA 1SFEA 2V7FA 1VQNI 4A69C 3K4CA 1FC3A 1I3QJ 2A68F 2M30A 3QOPA 2VI6A 2WV0A 3JRBA 1JGGA 3QOEA 3J81Z 2ESHA 2EFNA 4WK8F 2RKHA 3K69A 1GV5A 3D5RC 3VYRB 3A2KA 3TEDA 1W7PA 1W0UA 4L5JA 3ZP5A 4HQMA 2OTJI 1WJCA 1Z1DA 3TKYA 3J81K 3OIQA 1OISA 3BQYA 3IKTA 2FSWA 1D1AA 3HOWJ 1FTTA 1BI1A 3WU2C 3S2WA 2VQGA 3I4MJ 1FBUA 3MKLA 5LFAA 2FF4A 1MKMA 5JHFA 4EGZA 2H1KA 3QYBA 1IC8A 3RKWA 2ETHA 4C2TA 2H6BA 5TJJA 2A61A 5ILUA 3FHNA 3OOPA 2O5RA 2MYSA 2ZXWH 4U0WA 3RZOJ 3DLLF 4MFDA 1IGNA 3RZDJ 2P8TA 2K3PA 5K7ZA 2STTA 2GIZA 4EJUA 2CFOA 2GAUA 3HKZA 4GXOA 2EZLA 4AYBA 2JN6A 2DA2A 1K78B 3H1CA 1E3HA 3TMOA 1Y6IA 1U6GA 1H0MA 4G12A 1TT0A 1Y0NA 5FKNA 1JKOC 4BQOA 1ZTRA 4LFUA 1ZARA 1X1DA 1PVEA 3VWBA 1K7AA 2CUZA 5M5XJ 3ZQCA 5GAEJ 2DT5A 4CCLA 3L9FA 4RLQA 1NG6A 4Y13A 5DM6F 3FZVA 2Z9OA 2H8WA 1JKQC 4ESBA 3BR2A 3WTWC 2PLYA 1VTNC 2GOMA 4M3GA 1ZHFA 2VJ5A 5CVIA 5K5QA 2FBIA 3BP8A 3S8PA 5J4VA 4LMYA 1V3FA 4NC8A 1EF4A 2KL4A 1NTCA 2L02A 3E5QA 4NB5A 2DOFA 1AWCA 2M4KA 2LREA 5AONA 3LA3A 2HXIA 1IZ1A 4ASNA 4WCGA 4B1RA 3CCLI 2O0YA 1X19A 1BJZA 1OJLA 2KHMA 4RM2A 5E3MA 4LLLA 1MDMB 2JA5J 3DBHB 1D1BA 2NVXJ 3BCBA 1Q1VA 3OSGA 1KA8A 5D5XB 3U9GA 2IBDA 4BXFA 5ED4A 4GYGA 3LSMA 5K5OA 1V55H 5IP7J 1Y39A 3FMSA 4LGWA 3KYLA 4LITA 1FYKA 3CMMA 2VN2A 3L2CA 3OS2A 1SAUA 2HU9A 5GP9A 1FIAA 1KU7A 2XB5A 2ZNZA 2PJRA 1RETA 2IA1A 1BW6A 2OCEA 3V8LA 2KIUA 4F3QA 3C18A 3B73A 4G6TB 4H4KC 3DTKA 1G3WA 2EJRA 2VODA 2YU9J 2KRCA 4E7KA 1RI7A 2X6OA 2TDXA 3PUFA 2F4MB 4IXAA 4AWXB 2VKDA 2UXNA 2ZKZA 3FF5A 1VQ7I 5F1RA 3M7GA 2LBFA 5HS7A 4BJ5C 3JCUC 1GVJA 2CGPA 4JX4A 4BYYA 3HRUA 5EGOB 4ITVA 2NOGA 4LG0B 3A0HC 3QODA 3W2WA 2ECCA 1IW7F 3QAHA 3M8FA 2HTSA 3EPZA 3HOXJ 3L09A 1OKRA 2R7ZJ 2GLOA 1MMNA 4MO7A 3GZ6A 5IT9Z 4BH9A 5LRRA 3HOVJ 2V1NA 5M3MJ 2ECBA 2QYOA 1EH6A 3RPUD 3PO2J 4BKXA 3M9AA 5C4JJ 1DPRA 2E1MB 1HSJA 4BY7J 1QHHD 3DTEA 5FKMA 1VQMI 2DAOA 2E19A 1LQ1A 2EPFA 2PBIA 1U9OA 5BMZA 4FE7A 4E7LA 3CUOA 4RDUA 1ZG5A 3OYGA 1WGXA 3HTSB 5DUKA 5FFZA 4B44A 2VL8A 1UHSA 4G9YA 3NAUA 2LYCA 3SYTA 3LQRA 2XF6A 4MEXF 2JVHA 5C4XJ 1A6QA 3K1MA 4KJZA 2HOSA 1K78A 1XG1A 5CVJA 3I3LA 1SD4A 2MA3A 2WB1A 1Y56A 3BDDA 4IHSA 1FP2A 2DA7A 3S3OA 1FLIA 2ZFWA 2CUFA 2I10A 5DCFA 5EZGA 2CO5A 3UR3C 1B72B 5CPRB 3KCCA 5CKTA 1BR4A 3GEZA 3LWFA 2DW4A 2DA6A 1ZGAA 3H9GA 5LHIA 2BXYA 4ANJA 3ONQA 2L5QA 2MH2A 3QPLA 3C2GA 1OQYA 2PMHA 2CUEA 2DI3A 2B0LA 2DA1A 2O6GE 3KFWX 5BNGA 3E6CC 2WAQN 1XMAA 2DYSH 1XSDA 5H6RA 4HLYA 1MIJA 3COAC 4FX4A 5IYBJ 1YJWI 2FXAA 2NXNB 3HBLA 4W1UA 1PYVA 3HSRA 3V7SA 2L0KA 3GX4X 1H89C 3I71A 3S3MA 1ENHA 2KKOA 3LA2A 1HDPA 3ERED 3EDPA 2NVTJ 1OYYA 1VI0A 2FMYA 3RYRA 1BW5A 3WODF 4C2UA 3DPLC 1K61A 3VYSB 3TDUC 3FK7A 1TWHJ 5GPAA 4M9ZA 3REOA 1O4XA 4I2OA 4MNUA 2X9DA 3F8BA 1G4DA 4M6VA 2R93J 4W97A 2HYGD 1FT9A 2MBFA 3KP5A 4IHTA 5F08A 4RGSA 5E3NA 2JMWA 5LGUA 2DK5A 1D0YA 3SFZA 3CDIA 3HM5A 3K7AJ 3BR6A 2EZKA 2DN0A 1EV7A 3CCMI 1E3OC 3ZR8X 1VF9A 3GXOA 4NDLA 5GTIC 4UB6C 3RKXA 5JLWA 5LD2C 1LE8A 1JUSA 4BEHA 2ZMEC 3BC8A 3GTMJ 2M0MA 3K4LA 3AAFA 2H1LA 2DPDA 1FBQA 1YIOA 3CC2I 1O7FA 3U21A 4EM0B 4X0GA 2JQ7A 3ZQIA 5KK1A 2G7UA 3C3WA 4P5OA 1FZPB 1WQ2A 2QSGX 1TW2A 3DWLE 2ZMEA 4RGRA 2KRFA 1FX7A 2EIMH 2M87A 4QPQA 2E60A 2WY8Q 4CYDA 1P7JA 3F3XA 2R5YB 2CH0A 2DLLA 2HKOA 1MSFC 4D5CA 3WTUC 4Y15A 3LSTA 2KP6A 2V26A 2OZUA 5HVQC 4FTHA 4J01A 4A3GJ 1TT5B 2WAQA 5E3OA 2I5UA 1WI9A 4B8XA 1LEBA 5FD6A 2MC4A 3RTRA 3CZ6A 2ZJRF 2PMUA 5L3CA 3F72A 1XGSA 2WA0A 2ZXHA 3HXLA 5FKKA 2OQRA 3PSFA 4XLFA 1G3TA 1ACIA 4EVIA 2VE9A 1ITYA 5J8CA 1HW1A 3JRIA 2IPQX 1ZRCA 2O8KA 2EB7A 5KNLA 1S9HA 1B4AA 2F5EA 3MD2A 4B3AA 1LKXA 4XLCA 4JK1X 4BE1A 1ETYA 1RPWA 1YYVA 3WTXC 3MN2A 2ZBKA 1BOBA 3FX3A 2CWEA 2EQRA 2HKXA 2Z1DA 2HEOA 1XCBA 2IW5A 1W0TA 1YHQI 3HSFA 3KP3A 1T6SA 3O8HA 5IT9K 1OCTC 2VIXA 1UELB 2CRGA 2FBHA 5JR3A 2OQGA 2H6CA 1TQIA 4KA4A 1SVMA 2HNHA 2HWVA 1F43A 1JUMA 3L00A 2K27A 2PEXA 1FSHA 5BS6A 3BY6A 2EINH 3EYYA 3CJTB 1IV6A 3MMYB 3OIOA 5BPDA 2DFFA 3C2HA 3I59B 5ICCA 1Z91A 1F4KA 1A5JA 3HHGA 3HG9A 2FBKA 2HYFA 2Q0OA 1B9MA 1LDKB 1P6RA 2CU7A 3OL3A 2L9NA 2OCCH 1TQMA 5FRMA 3QU6A 5IT3A 5A2QZ 2CQNA 4A3IJ 2M5WA 2XAQA 1ZELA 5ILVA 3GFLA 3JRGA 2HZTA 1HW2A 3CTAA 2NNNA 1KU2A 4AIHA 4ZZDA 3ZRGA 1LB2A 4HX7A 2A6TA 1GV2A 3JR9A 3O8GA 2B9SA 4X6AJ 2P7VB 1JI8A 4YFKF 1FP1D 3F8CA 3DLAA 4HF0A 1Q1HA 1U5TA 1YW7A 2QZ8A 1RUNA 1XTAA 1IO2A 3K2ZA 3IRQA 3TP3A 3NEUA 4RAYA 3J7ZI 2ZXJA 2RC4A 3G4SI 4F93B 2M1BA 4KNYA 3WG9A 3ML6A 3FK6A 3W3CA 2E1MC 2KFDA 2CMPA 2Q2EB 2K86A 1HLVA 4M9SA 2OUMA 4FT8A 5D4RA 4LD5A 3LSHA 3F21A 3RIRA 2Y0MA 4NQWA 3TP0A 4A5MA 4D0PA 5LBQA 4ZDLA 1V54H 4I76A 3DPTA 5FJ8J 2KZVA 1FWZA 1R1TA 1T95A 2QQAA 2ZJ2A 3CJNA 3CMYA 3ZMUA 2A07F 2GXAA 3BZCA 3DQVC 1KZHA 5DS9A 1JE8A 3TQNA 4Q5SF 1FSEA 2UUZA 1DP7P 1AKHA 4DOZA 3OYHA 1JHHA 2L4MA 4XKBA 1W36C 1IN6A 2J5PA 1YITI 2OF7A 5H2FC 3H92A 3FXKA 4G7ZF 1WJAA 3PSIA 3C7JA 5E8GA 2XRLA 1J0RA 3GUDA 3V8KA 2DCEA 4F91B 1APLC 3V7RA 1A6IA 5L3EA 1U2WA 5EZHA 2MD5A 2D1VA 3HSEA 4MQ9F 2X0LA 5FKOA 1Y8QB 2HI3A 1Z9CA 1YFHA 2P6TA 4C3JJ 2CG4A 2E5ZA 4Y7NJ 1B8IB 2H8RA 2FJ1A 3BR0A 5E3LA 1H9GA 2LNBA 2QUFA 2BW3A 3I55I 1IN8A 2E1OA 2LD5A 4JP0A 1J75A 3K4JA 3OYBA 1R58A 2EFWA 1D1CA 5IY5H 2WAEA 3BROA 4K2EA 1QO0D 2MSYA 1VQ5I 3QU3A 2DMPA 4HNVA 3ASNH 1JJ6C 5CQGA 4JBAA 3ABKH 2E1NA 1G3SA 1YS7A 2GXGA 1XPXA 2EV0A 2QQ9A 2CQKA 2HQRA 5CLSA 4JOMA 1OCOH 1NK2P 3S1NJ 2XVCA 4F92B 2VLAA 4J19A 2GBYA 2ME6A 1OYIA 3WU0A 5DV5A 5LEKA 1HKSA 3SXYA 4I99C 3I5UA 3LSJA 4G94A 1NHAA 2JSPA 2F48A 1D8KA 2X48A 2JRTA 3FIWA 1VQ8I 3RI4A 2JWTA 4YG2F 2P0WA 3HKZN 4IJAA 3D5SC 2HDWA 3V42A 4ENKA 3OL4A 1HKQA 2VPLA 1OCCH 3HUGA 1BIAA 3MWMA 2BE5F 2Z3YA 4XQFA 3M07A 1T39A 1JUPA 2XKOA 1IJWC 4WXDA 3E6MA 2LMDA 5K7HA 3IUOA 2DA5A 3M3YJ 4PDKA 3JAMZ 1YS6A 2KMUA 3IC7A 3H3ZA 3MVPA 4E7JA 3RKQA 3HOSA 4PJLA 1R4NB 4CXFA 5LGNA 3LSKA 4O6JA 2A6EF 3BJAA 3BG6A 1X58A 1X4PA 1J2XA 1I27A 3OYNA 2F6CA 1USTA 3BQZA 4OIRF 3GTKJ 3LSIA 3HOZJ 2DJNA 3MQ0A 2R7RA 3BWGA 3P5JA 4QSHA 4BL0B 5KVRA 3OYDA 1T2KA 3UKGA 2A6HF 2EH3A 1SD6A 4CHUA 1AHDP 4BQQA 3I4PA 2VBYA 2YX7A 2HVRA 3JRFA 6PAXA 2VJIA 3VEPA 2HDDA 2A3SA 2XC7A 4ETSA 3V7CA 4BU2A 2K9MA 3KEOA 1I6XA 5TRDA 2F5DA 3FXJA 2EA2A 3N4MA 2EV6A 2EK5A 3D0SA 3IHUA 3K4BA 3DF8A 4P9FA 1IDZA 4XN3A 3FMQA 3IH4A 4CA0A 2DTZA 4EATA 4IHXA 3EYIA 1G8XA 2C6YA 1XB4A 2HOAA 1DP3A 3ZOBA 2K02A 2LKXA 4MEYF 4B47A 4LB6B 1OYWA 1LVKA 1UG0A 4RAZA 3NARA 2GXBA 2EA4A 4XKCA 2R7DA 4RM3A 3TL4X 2X4HA 3IWFA 2ZFUA 3WHCA 1XX5A 5ILSA 2W1OA 3KYCB 1W5SA 3ECHA 2W7NA 3DBRB 3FBIB 2HR3A 1B9NA 4PFPA 5J4YA 4KDPA 4F52A 4XM3A 1D0ZA 3ZGKA 4H0EA 1LDDA 4N4OB 1HCRA 1R1VA 4ON0A 2LFBA 1WFXA 2MD0A 1B8IA 1QVUA 5GADJ 4HSTA 5JLXA 4I01A 1GVDA 3ZMTA 1ZG3A 1LFPA 2PG4A 1KU9A 1O3TA 2EBIA 2IS2A 1F5TA 2L9RA 3A02A 4A3LJ 1FOYA 1ZH5A 1IRGA 4A12A 2VOOA 2QCOA 2DBBA 1N75A 3S1RJ 1OR7A 1GLNA 4AU7A 4CSWA 5EGOA 2D5VA 4RB1A 2BHZA 5B3SH 2P4WA 3S3NA 5D4SA 3A03A 2W57A 4I09A 1MNDA 2OC6A 3AG3H 3DEUA 2HYJA 2NAZA 1WHUA 5IPAA 1JKRC 1S29A 3KP6A 3ABUA 1PJRA 3F9KA 2M34A 1BI2A 5HS9A 3CJRB 1EA3A 2R7FA 3KP7A 4WWCA 2K3FA 2FA5A 2VASA 4XLEA 3W2AA 2WB1N 1BIBA 2XAGA 3OS1A 1G2HA 1XMKA 4LJZF 2IGKA 1QRYA 2XAUA 3CCUI 2K4BA 4UY8I 3FXOA 2AXLA 3H5NA 4ZDPA 2AQEA 1K79A 2JRMA 3WTYC 2QVOA 3WE2A 1MSEC 2DXIA 4DJAA 3UNGC 3GF2A 3K70D 3DP7A 3D1NI 5BPIA 3PJRA 2AQFA 3F8FA 2VBZA 1HBXG 3HOUJ 4U0VA 2Y30A 4M6XA 5L3FA 1MDMA 4A3MJ 1UG2A 2DQLA 4XNFA 2D2WA 3S2HJ 2LKSA 2PFBA 1TNTA 4ZJZA 1HSTA 2DFIA 1R7JA 1M1EB 2BXZA 2CQXA 2E2JJ 1RESA 3K1NA 2L7FP 1TQPA 3CUQB 4BBRJ 2D1HA 3E5UA 3ZXSA 2ACJA 1ZLKA 1PP8F 3CCSI 5JVGF 1Z3YA 2R5ZB 3ZQHA 4OU0A 1D5YA 1E3PA 3TO6A 4RLFA 4BQAA 1X4OA 2PMZA 4E7ZA 3QRFF 4PFOA 3T5XA 1N77A 3EUKL 2DOEA 3P9CA 2JPBA 2VKVA 5LGTA 1REPC 2BEOA 2B63J 3BJ6A 2O61A 4GRIA 1R9TJ 4IHYA 3S93A 1FMVA 4UB8C 1IN5A 1R4MB 1P7IA 2ZSHB 2ZB9A 3EUAA 5DTDA 3MKZA 3L2WA 2VQCA 2HQAA 5DCMB 5D5UB 5HOOA 3RJPA 4XMYA 2CFXA 4LG3A 4RB3C 2W24A 4CGZA 1R23A 2N8GA 2LF8A 1BN5A 5C44J 1R00A 5E1ZB 2DMNA 3ZMVA 1FMWA 1A36A 2OA4A 2W85A 2NVUB 2OU2A 2PX9A 2WY7Q 4OIOF 3S2DJ 1WCMJ 2F5FA 3VFZA 3GZ5A 1K6OA 3Q3SA 4I98B 3LFKA 3ZN1A 2E2HJ 2ID3A 2NVYJ 3J7YJ 1YO5C 2WWYA 1CF7A 3G3ZA 2MC3A 4E4HA 3VSLA 1USSA 3RPUA 2QEXI 4M3BA 5HNFA 1T0FC 1XDUA 2V79A 2JA2A 2OZ6A 4G8XA 3F8MA 4XLNF 3RSNA 4KFCA 1XN7A 1SMYF 4KIBA 4YELA 4MHGA 5EG0A 1SAXA 4XLHA 1BC7C 3FBNB 3B02A 4IQJA 2VONA 3CO6C 1T0FA 2ZJPF 2AO9A 2HS5A 3I64A 5F0CA 2K4JA 3KETA 1FOXA 1S7EA 2GZWA 3CP2A 3PO3J 4HRIA 3SDBA 2P81A 1EKEA 3MZ8A 4PSXA 2DMQA 4XSZF 5HS8A 4BBSJ 1JXSA 1ETWA 3ZQQA 2K85A 2NOJB 2Q8KA 4RGUA 2KIFA 3ERMA 5EEGA 2VB6A 5JFRA 3OYIA 4M3EA 1MBJA 2V6EA 4YRVA 4PK4A 3RQ4A 3O2PE 2ELJA 3ABMH 4KIFA 4CO8A 3PM1A 3K6GA 1RKWA 3DKYA 2R0QC 2GWRA 4AD9A 2CJJA 1UFMA 2M8EA 5KCMA 3ESWB 5IOZA 4E70A 3BR3A 5ICFA 2XAJA 5CVVA 2DJIA 5EF6A 1ONVA 4WX9A 3CCJI 1I3AA 1UMQA 3IH2A 1ZGWA 4II2A 5CVRA 4C3HJ 3WU1B 4A3FJ 1FJLA 2XGCA 3ULQB 5L3DA 1ZN2A 5K5RA 3AL0C 1BBYA 3K70C 2QWWA 2KDOA 1MBEA 1FPQA 1W5CC 2XF5A 3WE3A 3MAJA 2W82A 2JUCA 4DYQA 3QQAA
chains in the Genus database with same CATH topology
3O8GA 4X6AJ 1MNMC 3CQZJ 4XRSA 5GPCA 2JA8J 3W6VA 3L1PA 1LFUP 4A3EJ 5F27A 4C2MJ 1SANA 2DMUA 2Y9YA 3TP3A 1ETXA 3CDLA 1B72A 1ZQ3P 5IP6A 3Q0VA 1X2MA 1GUUA 3BR5A 3A01B 2Y0SN 3FK6A 1HDDC 2MW8A 1TWGJ 1HLVA 1MBKA 3WHBA 1MBHA 3QPSA 3TP0A 2LP0A 2QF7A 3GTLJ 4I76A 2LY9A 1TWFJ 2KDZA 2Y31A 1IG7A 5FJ8J 2AHQA 3S14J 3JREA 2HOTA 3CMYA 2NVQJ 2W48A 5DS9A 3LSRA 2JJ7A 2G0EA 1AKHA 4ABZA 4DYCA 3BTLA 2WV1A 3JRAA 1IDYA 2OF7A 3BTCA 1JJ8C 2RAEA 3LNQA 1JTYA 2K9QA 3IH3A 2XRLA 4L5EA 5J3LA 1APLC 2O7OA 1A6IA 5J1UA 5EZHA 5F0FA 1Z77A 2LTPA 5FKOA 4A69C 1I3QJ 2HI3A 2IAIA 2VI6A 4C3JJ 3JRBA 1B8IB 4Y7NJ 1JGGA 1AKHB 2H8RA 2FJ1A 3BR0A 5E3LA 4CYCB 2E1OA 2XPWA 2O9LA 2LD5A 4JP0A 1GV5A 2HXOA 3TEDA 3Q0UA 1W0UA 4LOCA 2M2EA 1TC3C 1NK3P 2VPRA 3S1QJ 3BQYA 2MSYA 2YUSA 2DMPA 4HNVA 2Y2ZA 3HOWJ 1JJ6C 1FTTA 1MBGA 9ANTA 3GTOJ 1ZKGA 3BR1A 3OOUA 3I4MJ 3MKLA 1NK2P 3S1NJ 1H88C 2H1KA 4J19A 1IC8A 5F1JA 2NS7A 2GBYA 5FKLA 2ME6A 1RKTA 3BG3A 3LSJA 4CYCA 4C3IJ 4A93J 1HOMA 3RZOJ 2Y9ZA 2X48A 2L7ZA 4MFDA 3FIWA 1IGNA 4FCYA 3BT9A 3RZDJ 2JWTA 5K7ZA 3HKZN 3GTJJ 2NS8A 1MH3A 2K9SA 4BY1J 5EDNA 4XRMA 2EZLA 3ZQLA 3VPRA 2JN6A 2DA2A 3CCYA 3TW6A 4AYBN 2IEKA 1JUPA 4G12A 3BG9A 5FKNA 1IJWC 1JKOC 1ZTRA 5K7HA 2DA5A 4B4CA 3M3YJ 2DA3A 1ZK8A 4M3DA 3MVPA 5M5XJ 3RKQA 3ZQCA 1JKQC 1FIPA 3BR2A 1X58A 3JRHA 4EEFG 4M3GA 3BQZA 3SJMA 1Y1WJ 3GTKJ 3HOZJ 2DJNA 3I4NJ 4QSHA 5IYDJ 1EF4A 3UKGA 1NTCA 2L7MP 4I6ZA 2EH3A 2YS9A 1AHDP 4MLOA 3S15J 2HXIA 1VFCA 3JRFA 4B1RA 2HDDA 1YRNA 1BJZA 1OJLA 3C2BA 5E3MA 2OPTA 4DZJA 2JA5J 4A3KJ 2VUMJ 2NVXJ 3BTIA 4MFEA 1ZR4A 1T56A 1Q1VA 1IDZA 3OSGA 3IH4A 1MH4A 2DTZA 4IHXA 2IBDA 3HB9A 2R92J 5IYCJ 1XC5A 5IP7J 2HOAA 3ZOBA 5C3EJ 3LOCA 2LKXA 2EZHA 2FD5A 3LSPA 1IUFA 5GP9A 1FIAA 2XB5A 5F04A 1RETA 1BW6A 4DW6A 3NARA 5M5YJ 5M5WJ 5EYRA 1Z0XA 3WHCA 1WI3A 2YU9J 3HOYJ 2X6OA 2R5YA 1POGA 2XPUA 5M3FJ 3TW7A 1HCRA 4RBOA 4JX6A 2LFBA 3FKIJ 1OFCX 4JYKA 1QVUA 1B8IA 4XRSG 5JLXA 4JX4A 1GVDA 2ELKA 3OSFA 3HGGA 5EGOB 2NOGA 4QTRA 3H3VK 3H0GJ 2E2IJ 2EBIA 2ECCA 2L9RA 3A02A 3HOXJ 4A3LJ 4MIMA 3M4OJ 1CQTA 2R7ZJ 2GLOA 2XB0X 1GT0C 4XIDA 2QCOA 1RR7A 4V2GA 4Y52J 4IHVA 4MO7A 5J1YA 3S1RJ 3S17J 3S16J 3IV5A 5EGOA 2D5VA 3HOVJ 5M3MJ 2ECBA 3GBGA 3PO2J 2LVSA 4BKXA 2MG4A 2VKEA 3HGYA 5C4JJ 5FLVA 3A03A 4BY7J 5FKMA 2E19A 2HYJA 1U9OA 1X2NA 4FE7A 5IPAA 1JKRC 1WPKA 4RDUA 1WGXA 3G1OA 3B6AA 1UHSA 3DEWA 3NAUA 3FISA 2M34A 3B6CA 5IP9J 5C4XJ 3Q0WA 4A3CJ 2WB1N 4XICA 2HOSA 1G2HA 1XG1A 1QRYA 4GFBA 1HF0A 2HQ5A 2DA7A 3JRCA 2CUFA 2I10A 5EZGA 4AUXA 2TCTA 1MSEC 1B72B 1JKPC 2JK3A 1MBFA 3D1NI 2DA6A 2MGQA 3HOUJ 1OCPA 3QPLA 2Y30A 4XK4A 2CUEA 4A3MJ 1UG2A 1WH7A 1JTXA 2DA1A 1FTZA 1ETVA 1JT6A 1YRNB 5BNGA 1I50J 3S2HJ 2WAQN 3JRDA 2EZIA 2CQXA 1XS9A 4DZPA 1H8AC 1RESA 1ORKA 1LE8B 2E2JJ 2L7FP 4UUTA 4BBRJ 5IYBJ 4W1UA 3HBLA 4X1EA 2L0KA 1F36A 1H89C 1ENHA 4UUSA 1HDPA 2R5ZB 3ZQHA 1SFOJ 1D5YA 1ETQA 2NVTJ 1VI0A 1BW5A 1ETKA 1DU6A 2M9HA 1K61A 3FK7A 1TWCJ 1TWHJ 5GPAA 2PMZN 1WH5A 2VKVA 1O4XA 2X9DA 1PUFB 2B63J 3GTGJ 4M6VA 2R93J 4W97A 1R9TJ 4IHYA 5F08A 5E3NA 4QIWN 4IEJA 2FQ4A 1P7IA 2JMWA 3HM5A 2ZB9A 3K7AJ 5DTDA 3BR6A 2R5ZA 2EZKA 2DN0A 3G1MA 1FEXA 1E3OC 3LSGA 2CQQA 1VF9A 4NDLA 5JLWA 1LE8A 1JUSA 2N8GA 5C44J 4JX5A 3GTMJ 3RQIA 4AC0A 2DMNA 3SDGA 2ID6A 4D5FA 2XSDC 4S0HB 2DMTA 2KT0A 1VNDA 5K7FA 3S2DJ 1WCMJ 3A01A 4DYRA 3Q3SA 3ZQIA 1ZR2A 2LLKA 2E2HJ 2ID3A 2NVYJ 3S1MJ 1LFBA 2XGDA 2TRTA 1P7JA 4M3BA 2R5YB 3E7LA 1MSFC 1TWAJ 4D5CA 5FLMJ 4FTHA 4A3GJ 5E3OA 5EG0A 2K9NA 1U8BA 2FX0A 4D7NA 2LR8A 2LK2A 2AO9A 2COBA 3F0CA 5F0CA 2ME0A 1T33A 5FKKA 2DA4A 1IRZA 1S7EA 3PO3J 1ITYA 3JRIA 2XGEA 2O8KA 2P81A 3GTQJ 1U78A 2DMQA 3HDDA 2JA7J 4BBSJ 1ETWA 2M0CA 4FISA 4B3AA 1QPIA 4V2FA 3ZQFA 1ETYA 1RPWA 3SFIA 3MN2A 3ZQGA 5F0HA 3GTPJ 1QVTA 2EQRA 5IOYA 1DU0A 4M3EA 4A3JJ 5J1RA 1MBJA 5EEAA 1W0TA 3O8HA 3BG5A 1OCTC 3G1LA 4M3FA 2CRGA 1JT0A 3K2AA 3PM1A 1RKWA 1F43A 1JUMA 2R0QC 4D7MA 2CJJA 5IOZA 1IV6A 3OIOA 3BR3A 1PUFA 5EF6A 1BA5A 1UMQA 3IH2A 2JA6J 1A5JA 1ZGWA 2XPVA 1AU7A 3HEFA 1I6HJ 4C3HJ 2CU7A 3DCFA 4A3FJ 1FJLA 2XGCA 4IHWA 1ETOA 4A3IJ 4UUSB 2M8GX 1GDTA 5HODA 3BTJA 4A3BJ 4BXXJ 1U9NA 2K40A 1MBEA 1Y1VJ 3JRGA 1K83J 5EG0B 4A3DJ 1BL0A 4DYQA 2GM4A 4FE4A 1GV2A 3JR9A 3QQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8G A;  4X6A J;  1MNM C;  3CQZ J;  4XRS A;  5GPC A;  2JA8 J;  3W6V A;  3L1P A;  1LFU P;  4A3E J;  5F27 A;  4C2M J;  1SAN A;  2DMU A;  2Y9Y A;  3TP3 A;  1ETX A;  3CDL A;  1B72 A;  1ZQ3 P;  5IP6 A;  3Q0V A;  1X2M A;  1GUU A;  3BR5 A;  3A01 B;  2Y0S N;  3FK6 A;  1HDD C;  2MW8 A;  1TWG J;  1HLV A;  1MBK A;  3WHB A;  1MBH A;  3QPS A;  3TP0 A;  2LP0 A;  2QF7 A;  3GTL J;  4I76 A;  2LY9 A;  1TWF J;  2KDZ A;  2Y31 A;  1IG7 A;  5FJ8 J;  2AHQ A;  3S14 J;  3JRE A;  2HOT A;  3CMY A;  2NVQ J;  2W48 A;  5DS9 A;  3LSR A;  2JJ7 A;  2G0E A;  1AKH A;  4ABZ A;  4DYC A;  3BTL A;  2WV1 A;  3JRA A;  1IDY A;  2OF7 A;  3BTC A;  1JJ8 C;  2RAE A;  3LNQ A;  1JTY A;  2K9Q A;  3IH3 A;  2XRL A;  4L5E A;  5J3L A;  1APL C;  2O7O A;  1A6I A;  5J1U A;  5EZH A;  5F0F A;  1Z77 A;  2LTP A;  5FKO A;  4A69 C;  1I3Q J;  2HI3 A;  2IAI A;  2VI6 A;  4C3J J;  3JRB A;  1B8I B;  4Y7N J;  1JGG A;  1AKH B;  2H8R A;  2FJ1 A;  3BR0 A;  5E3L A;  4CYC B;  2E1O A;  2XPW A;  2O9L A;  2LD5 A;  4JP0 A;  1GV5 A;  2HXO A;  3TED A;  3Q0U A;  1W0U A;  4LOC A;  2M2E A;  1TC3 C;  1NK3 P;  2VPR A;  3S1Q J;  3BQY A;  2MSY A;  2YUS A;  2DMP A;  4HNV A;  2Y2Z A;  3HOW J;  1JJ6 C;  1FTT A;  1MBG A;  9ANT A;  3GTO J;  1ZKG A;  3BR1 A;  3OOU A;  3I4M J;  3MKL A;  1NK2 P;  3S1N J;  1H88 C;  2H1K A;  4J19 A;  1IC8 A;  5F1J A;  2NS7 A;  2GBY A;  5FKL A;  2ME6 A;  1RKT A;  3BG3 A;  3LSJ A;  4CYC A;  4C3I J;  4A93 J;  1HOM A;  3RZO J;  2Y9Z A;  2X48 A;  2L7Z A;  4MFD A;  3FIW A;  1IGN A;  4FCY A;  3BT9 A;  3RZD J;  2JWT A;  5K7Z A;  3HKZ N;  3GTJ J;  2NS8 A;  1MH3 A;  2K9S A;  4BY1 J;  5EDN A;  4XRM A;  2EZL A;  3ZQL A;  3VPR A;  2JN6 A;  2DA2 A;  3CCY A;  3TW6 A;  4AYB N;  2IEK A;  1JUP A;  4G12 A;  3BG9 A;  5FKN A;  1IJW C;  1JKO C;  1ZTR A;  5K7H A;  2DA5 A;  4B4C A;  3M3Y J;  2DA3 A;  1ZK8 A;  4M3D A;  3MVP A;  5M5X J;  3RKQ A;  3ZQC A;  1JKQ C;  1FIP A;  3BR2 A;  1X58 A;  3JRH A;  4EEF G;  4M3G A;  3BQZ A;  3SJM A;  1Y1W J;  3GTK J;  3HOZ J;  2DJN A;  3I4N J;  4QSH A;  5IYD J;  1EF4 A;  3UKG A;  1NTC A;  2L7M P;  4I6Z A;  2EH3 A;  2YS9 A;  1AHD P;  4MLO A;  3S15 J;  2HXI A;  1VFC A;  3JRF A;  4B1R A;  2HDD A;  1YRN A;  1BJZ A;  1OJL A;  3C2B A;  5E3M A;  2OPT A;  4DZJ A;  2JA5 J;  4A3K J;  2VUM J;  2NVX J;  3BTI A;  4MFE A;  1ZR4 A;  1T56 A;  1Q1V A;  1IDZ A;  3OSG A;  3IH4 A;  1MH4 A;  2DTZ A;  4IHX A;  2IBD A;  3HB9 A;  2R92 J;  5IYC J;  1XC5 A;  5IP7 J;  2HOA A;  3ZOB A;  5C3E J;  3LOC A;  2LKX A;  2EZH A;  2FD5 A;  3LSP A;  1IUF A;  5GP9 A;  1FIA A;  2XB5 A;  5F04 A;  1RET A;  1BW6 A;  4DW6 A;  3NAR A;  5M5Y J;  5M5W J;  5EYR A;  1Z0X A;  3WHC A;  1WI3 A;  2YU9 J;  3HOY J;  2X6O A;  2R5Y A;  1POG A;  2XPU A;  5M3F J;  3TW7 A;  1HCR A;  4RBO A;  4JX6 A;  2LFB A;  3FKI J;  1OFC X;  4JYK A;  1QVU A;  1B8I A;  4XRS G;  5JLX A;  4JX4 A;  1GVD A;  2ELK A;  3OSF A;  3HGG A;  5EGO B;  2NOG A;  4QTR A;  3H3V K;  3H0G J;  2E2I J;  2EBI A;  2ECC A;  2L9R A;  3A02 A;  3HOX J;  4A3L J;  4MIM A;  3M4O J;  1CQT A;  2R7Z J;  2GLO A;  2XB0 X;  1GT0 C;  4XID A;  2QCO A;  1RR7 A;  4V2G A;  4Y52 J;  4IHV A;  4MO7 A;  5J1Y A;  3S1R J;  3S17 J;  3S16 J;  3IV5 A;  5EGO A;  2D5V A;  3HOV J;  5M3M J;  2ECB A;  3GBG A;  3PO2 J;  2LVS A;  4BKX A;  2MG4 A;  2VKE A;  3HGY A;  5C4J J;  5FLV A;  3A03 A;  4BY7 J;  5FKM A;  2E19 A;  2HYJ A;  1U9O A;  1X2N A;  4FE7 A;  5IPA A;  1JKR C;  1WPK A;  4RDU A;  1WGX A;  3G1O A;  3B6A A;  1UHS A;  3DEW A;  3NAU A;  3FIS A;  2M34 A;  3B6C A;  5IP9 J;  5C4X J;  3Q0W A;  4A3C J;  2WB1 N;  4XIC A;  2HOS A;  1G2H A;  1XG1 A;  1QRY A;  4GFB A;  1HF0 A;  2HQ5 A;  2DA7 A;  3JRC A;  2CUF A;  2I10 A;  5EZG A;  4AUX A;  2TCT A;  1MSE C;  1B72 B;  1JKP C;  2JK3 A;  1MBF A;  3D1N I;  2DA6 A;  2MGQ A;  3HOU J;  1OCP A;  3QPL A;  2Y30 A;  4XK4 A;  2CUE A;  4A3M J;  1UG2 A;  1WH7 A;  1JTX A;  2DA1 A;  1FTZ A;  1ETV A;  1JT6 A;  1YRN B;  5BNG A;  1I50 J;  3S2H J;  2WAQ N;  3JRD A;  2EZI A;  2CQX A;  1XS9 A;  4DZP A;  1H8A C;  1RES A;  1ORK A;  1LE8 B;  2E2J J;  2L7F P;  4UUT A;  4BBR J;  5IYB J;  4W1U A;  3HBL A;  4X1E A;  2L0K A;  1F36 A;  1H89 C;  1ENH A;  4UUS A;  1HDP A;  2R5Z B;  3ZQH A;  1SFO J;  1D5Y A;  1ETQ A;  2NVT J;  1VI0 A;  1BW5 A;  1ETK A;  1DU6 A;  2M9H A;  1K61 A;  3FK7 A;  1TWC J;  1TWH J;  5GPA A;  2PMZ N;  1WH5 A;  2VKV A;  1O4X A;  2X9D A;  1PUF B;  2B63 J;  3GTG J;  4M6V A;  2R93 J;  4W97 A;  1R9T J;  4IHY A;  5F08 A;  5E3N A;  4QIW N;  4IEJ A;  2FQ4 A;  1P7I A;  2JMW A;  3HM5 A;  2ZB9 A;  3K7A J;  5DTD A;  3BR6 A;  2R5Z A;  2EZK A;  2DN0 A;  3G1M A;  1FEX A;  1E3O C;  3LSG A;  2CQQ A;  1VF9 A;  4NDL A;  5JLW A;  1LE8 A;  1JUS A;  2N8G A;  5C44 J;  4JX5 A;  3GTM J;  3RQI A;  4AC0 A;  2DMN A;  3SDG A;  2ID6 A;  4D5F A;  2XSD C;  4S0H B;  2DMT A;  2KT0 A;  1VND A;  5K7F A;  3S2D J;  1WCM J;  3A01 A;  4DYR A;  3Q3S A;  3ZQI A;  1ZR2 A;  2LLK A;  2E2H J;  2ID3 A;  2NVY J;  3S1M J;  1LFB A;  2XGD A;  2TRT A;  1P7J A;  4M3B A;  2R5Y B;  3E7L A;  1MSF C;  1TWA J;  4D5C A;  5FLM J;  4FTH A;  4A3G J;  5E3O A;  5EG0 A;  2K9N A;  1U8B A;  2FX0 A;  4D7N A;  2LR8 A;  2LK2 A;  2AO9 A;  2COB A;  3F0C A;  5F0C A;  2ME0 A;  1T33 A;  5FKK A;  2DA4 A;  1IRZ A;  1S7E A;  3PO3 J;  1ITY A;  3JRI A;  2XGE A;  2O8K A;  2P81 A;  3GTQ J;  1U78 A;  2DMQ A;  3HDD A;  2JA7 J;  4BBS J;  1ETW A;  2M0C A;  4FIS A;  4B3A A;  1QPI A;  4V2F A;  3ZQF A;  1ETY A;  1RPW A;  3SFI A;  3MN2 A;  3ZQG A;  5F0H A;  3GTP J;  1QVT A;  2EQR A;  5IOY A;  1DU0 A;  4M3E A;  4A3J J;  5J1R A;  1MBJ A;  5EEA A;  1W0T A;  3O8H A;  3BG5 A;  1OCT C;  3G1L A;  4M3F A;  2CRG A;  1JT0 A;  3K2A A;  3PM1 A;  1RKW A;  1F43 A;  1JUM A;  2R0Q C;  4D7M A;  2CJJ A;  5IOZ A;  1IV6 A;  3OIO A;  3BR3 A;  1PUF A;  5EF6 A;  1BA5 A;  1UMQ A;  3IH2 A;  2JA6 J;  1A5J A;  1ZGW A;  2XPV A;  1AU7 A;  3HEF A;  1I6H J;  4C3H J;  2CU7 A;  3DCF A;  4A3F J;  1FJL A;  2XGC A;  4IHW A;  1ETO A;  4A3I J;  4UUS B;  2M8G X;  1GDT A;  5HOD A;  3BTJ A;  4A3B J;  4BXX J;  1U9N A;  2K40 A;  1MBE A;  1Y1V J;  3JRG A;  1K83 J;  5EG0 B;  4A3D J;  1BL0 A;  4DYQ A;  2GM4 A;  4FE4 A;  1GV2 A;  3JR9 A;  3QQA A; 
#chains in the Genus database with same CATH topology
 2IT0 A;  2HPM A;  1MNM C;  3KP4 A;  4XRS A;  4L0Z B;  3WGG A;  4CZZ A;  4RGX A;  1HQC A;  1L0O C;  4RS8 A;  3ZN0 A;  5J40 A;  3VYT B;  2ISZ A;  4PJ0 C;  4GGG A;  4UUV A;  2M3A A;  2QKL B;  2DMU A;  2Y9Y A;  3R4K A;  4XBF A;  2ZJQ F;  1Z7U A;  5IP6 A;  3Q0V A;  1X2M A;  3K1P A;  2DT6 A;  2QA4 I;  1UAA A;  3OYJ A;  2KJB A;  2Y0S N;  3A01 B;  1XSV A;  3HC7 A;  2XAF A;  2EIL H;  1HXD A;  2BZT A;  2L7K A;  5B1B H;  3OYA A;  4CCN A;  1U3E M;  4U7B A;  2RGV A;  2L01 A;  3OV8 A;  1IRF A;  5B5E C;  1MBH A;  3QPS A;  4QPO A;  4ENM A;  3DU5 A;  4GYI A;  4KN7 X;  3H35 A;  4Y33 A;  2KDZ A;  1VQP I;  1SMT A;  2QM3 A;  1IG7 A;  2AHQ A;  4MGR A;  3H5R A;  2O3F A;  3JRE A;  4B48 A;  2FNA A;  2NVQ J;  1WVR A;  4TV7 A;  4CCM A;  2X6Y A;  4YIF A;  2G9W A;  3ISP A;  2IGN A;  3VOE A;  3NWT A;  1YJN I;  4EGY A;  2LG4 A;  4AVP A;  3J80 Z;  3DTI A;  2CV1 A;  2WV1 A;  2R3S A;  2A69 F;  2EFQ A;  2DK8 A;  1IDY A;  1GHC A;  3GWZ A;  3CLO A;  3BTC A;  1JJ8 C;  4CCK A;  2H94 A;  1D5V A;  1QZY A;  3GME A;  1IRX A;  1JTY A;  1OLT A;  3IH3 A;  4BJ6 C;  2KIQ A;  1F9N A;  4I02 A;  1U8R A;  4UHT A;  5FD5 A;  4BE0 A;  1Y0U A;  1Z67 A;  2XGX A;  2AXT C;  2YX4 A;  1Z77 A;  2VBW A;  2LTP A;  3O6B B;  2LBF B;  1XD7 A;  4V19 K;  2LY1 A;  4HLX A;  1XDS A;  4IL6 C;  4CYC B;  4N9I A;  1FOW A;  3U2R A;  4P96 A;  5F64 A;  2HXO A;  3TO9 A;  3Q0U A;  2YSR A;  5LRS A;  4OAZ A;  1IAW A;  1FY7 A;  4LOC A;  3HTU A;  1TC3 C;  1X3W B;  2VPR A;  3S1Q J;  3ZPL A;  2YUS A;  3W6J B;  2Y2Z A;  1LVA A;  5DD8 A;  2ZCW A;  4C30 A;  2RVC A;  2BOL A;  4A6E A;  9ANT A;  2P5K A;  2PJR B;  1QZE A;  2FML A;  2KQR A;  2FEZ A;  3WGI A;  3DEE A;  1T98 A;  4L0Y B;  3OYF A;  2NS7 A;  5EEH A;  4YFX F;  2Z99 A;  3JSP A;  2VQH A;  2BVM A;  2GA2 A;  4Y3O A;  2RV8 A;  5KAF C;  1T8I A;  1HOM A;  3W6K B;  3HJE A;  2Y9Z A;  2UXX A;  2L7Z A;  2YPR A;  1DGR M;  2HPI A;  2OJE D;  3BT9 A;  2M4G A;  3QPT A;  4HOB A;  3GTJ J;  4XRF A;  5JVT A;  1K4T A;  4OMY A;  1WZ2 A;  2VQL A;  1MH3 A;  4XOR A;  3KE2 A;  4PJN A;  4BGD A;  5EDN A;  4XRM A;  3FKJ A;  1SVL A;  3HIF A;  3ZQ7 A;  3VPR A;  3FXQ A;  3ZQL A;  5CQE A;  3QPH A;  2QBY A;  5HLI A;  2ICW G;  1BI3 A;  3OMY A;  2WC2 A;  2IXS A;  4BHB A;  1UB9 A;  4ZZL A;  2QQ8 A;  4B4C A;  4HG2 A;  4BQN A;  3KZI C;  3K0L A;  2F5C A;  4UVC A;  4BS9 A;  1HC8 A;  4AIK A;  2KZG A;  5H20 A;  1YJ9 I;  3KLO A;  5LHG A;  1OPC A;  1WJD A;  1FIP A;  1T38 A;  4L9N A;  2QEN A;  3VOD A;  4ZTF A;  4KMU X;  3GW2 A;  3R61 A;  3SJM A;  4QWQ A;  4I7H A;  2BY3 A;  3ABT A;  3I4N J;  3SHF A;  2FQ3 A;  3RDI A;  1IV8 A;  3QWL A;  3F22 A;  2FOW A;  2I8D A;  1ZRE A;  4HV5 A;  4MLO A;  3S15 J;  1Z05 A;  1VFC A;  3I0T A;  3CLQ A;  3KIO A;  4A0Y A;  1BOA A;  4IRH A;  2EIJ H;  2G7H A;  5E1X A;  4UXN A;  3G73 A;  1J59 A;  1YRN A;  4A0X A;  1S72 I;  2Z5U A;  4IQ4 A;  2OPT A;  3FXR A;  1S5L C;  4PSW A;  3HHH A;  2LSO A;  4MFE A;  3WTS C;  1ZR4 A;  1T56 A;  1G59 A;  4CCO A;  5A2Q K;  2P7C B;  4LLN A;  4EQQ A;  1WWX A;  1RUO A;  1MH4 A;  2V9K A;  2XV4 S;  3CJQ B;  4KT5 C;  5AIQ A;  3HB9 A;  2R92 J;  1R5I D;  3LQQ A;  3SZT A;  3P9I A;  5C3E J;  3GFM A;  1IUF A;  2XKP A;  2JSC A;  4NC6 A;  4UV8 A;  3OYM A;  4P1W A;  1YW8 A;  5M5Y J;  2BGC A;  1S7O A;  3E0J B;  3TOB A;  3MZY A;  1UCR A;  1WI3 A;  1W7P B;  3A1Y A;  1EJ9 A;  1Y8R B;  2E1C A;  3CC4 I;  2L54 A;  3T8T A;  4WF2 A;  4AIJ A;  3IKV A;  2COM A;  5E8I A;  4EJO A;  2XPU A;  5M3F J;  4RBO A;  2BW3 B;  4IZZ A;  1OFC X;  3RKY A;  2X51 A;  2XRN A;  1R36 A;  3OYK A;  2K7L A;  2ELK A;  4HDU A;  3H0G J;  5L3G A;  1OR7 C;  1KQ9 A;  4XL9 A;  5J8F A;  3OR1 C;  3H5A A;  4MIM A;  4BEH B;  4HX4 A;  4YIR X;  3M4O J;  1ULY A;  1GT0 C;  2CW7 A;  2CS3 A;  3V8J A;  4NC7 A;  4XID A;  2V6C A;  2P6S A;  3CCQ I;  4E7S A;  1JGS A;  5J1Y A;  3FXM A;  1P9Q C;  3S17 J;  3S16 J;  1QNT A;  4DBR A;  3IRR A;  1IN4 A;  2FE3 A;  1L3L A;  5K1Y A;  1LEA A;  3TOA A;  3CCR I;  5CVU A;  1PP7 U;  2OD5 A;  2MG4 A;  3TGN A;  2VT3 A;  2RNG A;  4RB2 C;  1ERD A;  3M1C A;  2JTV A;  1MNE A;  3DKW A;  3X2Q H;  3PNV A;  1GXP A;  1RNL A;  3RCO A;  4L5I A;  3DEW A;  3FIS A;  4NUB A;  1C0W A;  2X85 A;  4DIQ A;  4EJW A;  3Q0W A;  4A3C J;  3PQK A;  2E71 A;  4XIC A;  2QKM B;  3K4M A;  5B1A H;  5D5V B;  2VXZ A;  4GFB A;  2E7X A;  5HDN A;  2L3D A;  5J6X A;  2R7S A;  4AUX A;  2TCT A;  1H9T A;  5FLX K;  1Z7L A;  2NYX A;  2JK3 A;  1AOY A;  4G6Q A;  4DQ2 A;  1MBF A;  3BPV A;  1CF7 B;  3WGH A;  2MGQ A;  2X6X A;  5D6F A;  2VXD A;  1J09 A;  2O03 A;  1XSX A;  4LIU A;  1FTZ A;  1ETV A;  1JT6 A;  3P9K A;  4U87 A;  1YRN B;  1IUY A;  3QP6 A;  1I5Z A;  1MMA A;  4N4N B;  3ABL H;  2IGO A;  3GFJ A;  2A05 A;  3JRD A;  2EZI A;  2RQQ A;  4C9Y A;  1H8A C;  2DQR A;  1SFX A;  4UUT A;  3CC7 I;  1W36 D;  2R7X A;  3GLX A;  4P9U A;  1A35 A;  2RRE A;  1F36 A;  4YFN F;  1A31 A;  1V4R A;  4HF2 A;  1ETQ A;  1DU6 A;  1ETK A;  2HZD A;  2M9H A;  3TO7 A;  2R7W A;  1WJ5 A;  2PMZ N;  1WH5 A;  2FUG 2;  4FAS D;  4LK1 F;  3GTG J;  3JSO A;  5FFX A;  2VT2 A;  2RQP A;  5LLQ A;  4QIW N;  4IEJ A;  1J7K A;  2PQ8 A;  4F55 A;  4OMZ A;  3OYL A;  1E17 A;  4UVB A;  4EM2 A;  5B66 C;  2R5Z A;  1BR1 A;  2XUB A;  3G1M A;  2IGM A;  3OWT A;  1UHM A;  5FLX Z;  2NNY A;  1FEX A;  4PJM A;  3KZZ A;  4YEJ A;  3MFK A;  2ESN A;  1XGN A;  4JX5 A;  3SDG A;  1R22 A;  2ID6 A;  4D5F A;  2XSD C;  3CES A;  2DMT A;  1VND A;  3A01 A;  4DYR A;  2EWN A;  2HGC A;  2W84 A;  3F6V A;  2DDA A;  5FO5 A;  3T0Y A;  4LIV A;  3S1M J;  2V1U A;  2XAH A;  3CCE I;  3N05 A;  2Y48 A;  1LFB A;  3BOQ A;  5DEQ A;  1IN7 A;  5DD4 A;  4CH7 A;  1ODD A;  2STW A;  1YQA A;  1SFU A;  1YG2 A;  1SD7 A;  4S04 A;  1TWA J;  2NRA C;  1FNN A;  4E7H A;  1EH7 A;  5D8L B;  2KIS A;  3DXJ F;  2ZC2 A;  3SQN A;  3GFI A;  1U8B A;  2F2E A;  3DU6 A;  5HLG A;  3AG2 H;  3QP5 A;  2XRO A;  2Y69 H;  3G71 I;  4M74 A;  2LR8 A;  1LJ9 A;  3F6O A;  3HPH A;  2COB A;  1BR2 A;  1QU3 A;  2ME0 A;  3O3K A;  2J5O A;  3H9Q A;  1JHF A;  2DA4 A;  1IRZ A;  2MAB A;  2XGE A;  2K9L A;  3LL7 A;  2CV0 A;  3GTQ J;  1U78 A;  4E7I A;  1WJE A;  2UV1 A;  4XKW A;  2AS5 F;  3HDD A;  1FBS A;  4D1Q A;  2VOP A;  1RC9 A;  4FIS A;  3LMM A;  4R8H A;  1U5T B;  4MTE A;  1YI2 I;  3T1B A;  4V2F A;  3ZQF A;  1OCR H;  2IJL A;  3H3U A;  3ZQG A;  3PIO F;  5ERI A;  3WTV C;  2XSJ C;  4UVA A;  1LPQ A;  4HAM A;  5TIS C;  5IOY A;  3DFG A;  1STZ A;  3HYI A;  1DQU A;  5KHD A;  1MW7 A;  4MQV A;  1VQ9 I;  2R7U A;  4FQG A;  3MCZ A;  3G1L A;  4N0B A;  1JT0 A;  1TL8 A;  3AFH A;  3PFI A;  1P92 A;  4KYW A;  5LHH A;  4BDZ A;  4Q4Z F;  2RNJ A;  3BZ6 A;  1W1W E;  2DO7 A;  3I56 I;  1W7P D;  1PUF A;  2M7A A;  1YX3 A;  1O3S A;  2GOX B;  4XKV A;  2JA6 J;  2XPV A;  2KLO A;  4ZYD A;  3HEF A;  3M1E A;  4UNO A;  1ETO A;  4NNJ A;  1O57 A;  2WAF A;  3FHZ A;  1N25 A;  1Z3X A;  2LY2 A;  3BTJ A;  1GDT A;  4A3B J;  1E0E A;  2JPC A;  1U9N A;  3WTZ A;  4BDY A;  1Y1V J;  1QGP A;  2DU9 A;  5EG0 B;  4CZC A;  2GM4 A;  4FE4 A;  4ESF A;  4PUS A;  4G6D A;  5GPC A;  3HPG A;  4HZF A;  3W6V A;  2JA8 J;  2R4G A;  3L1P A;  1WRJ A;  3HZJ A;  5F27 A;  2BV6 A;  4KT6 A;  4G7O F;  5JI6 A;  2DFE A;  1Z6R A;  1MMS A;  1ETX A;  4EJT A;  3CDL A;  1B72 A;  1ZQ3 P;  1MD0 A;  2Y0S A;  2UWM A;  2DDB A;  1YE9 A;  3J7A O;  2KPM A;  3CME I;  1OCZ H;  2QGU A;  2GA1 A;  1HDD C;  2MW8 A;  1TWG J;  3R6S A;  3N97 A;  3IAS 2;  1KU3 A;  4GDF A;  3WG7 H;  4CCJ A;  3CF2 A;  3WHB A;  1K6Y A;  5JHU A;  2QF7 A;  4Z2Y A;  1TWF J;  2HFH A;  2Y31 A;  4HNU A;  2WTE A;  4OIP F;  3E5X A;  1S6L A;  1ON2 A;  1P4W A;  5BQT A;  5GTH C;  3CP8 A;  4Z6Y A;  3LSR A;  2Z33 A;  3ASO H;  4IPA A;  4BJT A;  1YLF A;  4ZYG A;  2ELH A;  5DYM A;  2BHY A;  4ENN A;  1P4A A;  1LDJ A;  1O7L A;  2FRH A;  3K4N A;  1S7A A;  1SC7 A;  3KZY A;  3FDY A;  1MJB A;  2E7W A;  1OMI A;  4A5N A;  1PUE E;  3EUH A;  4NBQ A;  2QQB A;  2VJJ A;  3A4C A;  1XMX A;  4ZC3 A;  4BHC A;  4OAY A;  3L2R A;  2QBY B;  3E6B A;  1R5H A;  4XON A;  1D8J A;  2A5W A;  2LRD A;  5J1U A;  2A5Y B;  4HPQ A;  1X3U A;  4HYE A;  2IAI A;  2E36 A;  1ON1 A;  1AKH B;  1O3Q A;  2MLK A;  4YII A;  4WXC A;  3Q5F A;  4KIS A;  2YU3 A;  3VDX A;  4FET A;  4UV9 A;  5HNH A;  2XPW A;  2W00 A;  2O9L A;  4M71 A;  3PNY A;  2BBY A;  4CDG A;  3G2B A;  2M2E A;  1NK3 P;  4OIN F;  4KUM A;  3T8R A;  3GLL A;  1RR8 C;  4U88 A;  1CGP A;  2IRF G;  3M8E A;  2V9V A;  1MBG A;  3GTO J;  1ZKG A;  3EET A;  3BR1 A;  3OOU A;  3JTG A;  1YW9 A;  2EFP A;  1H88 C;  3ZCO A;  1SFK A;  3C1D A;  4BUP A;  4U7D A;  5F1J A;  1R49 A;  1FYL A;  5D6E A;  1FYM A;  2LKP A;  2CV2 A;  2R7V A;  5FKL A;  1RKT A;  3BG3 A;  2P5L C;  1LUJ B;  4CYC A;  3KEQ A;  3FWE A;  4C3I J;  2RDP A;  4A93 J;  1WJF A;  1ZAO A;  3K4K A;  2OBP A;  3J80 K;  1HA8 A;  1EH8 A;  4FCY A;  1AA7 A;  4XR6 A;  2NS8 A;  3CF5 F;  2K9S A;  3G6E I;  4BE2 A;  1QZZ A;  2OV7 A;  4BY1 J;  3CCY A;  3TW6 A;  2BY0 A;  4RA2 A;  1YIJ I;  3GO5 A;  1I1G A;  3NWS A;  5CYV A;  2IEK A;  4AYB N;  3LAJ A;  1V5G A;  3JTH A;  2HDC A;  3H36 A;  2IS1 A;  3BG9 A;  2WAD A;  1RIO H;  1KQ0 A;  2BY1 A;  1QA6 A;  5GAH J;  1RZ4 A;  3KP2 A;  3LA7 A;  2IP2 A;  4Q47 A;  2DA3 A;  1DUX C;  4D9J A;  1ZK8 A;  1HKT A;  4M3D A;  3H0D A;  2H27 A;  4KIC A;  3BLY A;  2W25 A;  3I58 A;  3I59 A;  1R5G A;  5D8K B;  3JRH A;  3AG4 H;  4EEF G;  4Y4R A;  1YOV B;  5J47 A;  1KGS A;  1Y1W J;  2H09 A;  2Q1Z B;  5FGM A;  5IYD J;  1Z21 A;  4A2U A;  2QLZ A;  3ZMS A;  2L7M P;  3LAP A;  4I6Z A;  2YS9 A;  2V1D A;  3S32 A;  1LNW A;  3VB2 A;  1B1B A;  1KQ8 A;  3SEQ A;  4HQE A;  1UJ8 A;  4DGW B;  4M6Y A;  1E2X A;  2F4I A;  3PNT A;  4P55 A;  4HF1 A;  3PUB A;  3C2B A;  3QYE A;  4KIT B;  4DZJ A;  4A3K J;  2HTJ A;  4IOC F;  2VUM J;  3BTI A;  2P5V A;  2PJP A;  1IXC A;  1SEU A;  2QSH X;  3CDH A;  1X3Z B;  4IKF A;  4AVZ A;  5E79 C;  1DDN A;  4Y17 A;  1MMG A;  5IYC J;  1MJA A;  3MKW B;  1XC5 A;  2VC0 A;  2KRH A;  3LOC A;  4QLC U;  2EZH A;  2FD5 A;  3LSP A;  3CCV I;  3FMR A;  5F04 A;  2MLG A;  3VSK A;  3WTT C;  4NHJ A;  4DW6 A;  4XLP F;  2GQQ A;  4PGH A;  2LF7 A;  4ZDO A;  3AG1 H;  5M5W J;  1R71 A;  2CUJ A;  5EYR A;  1Z0X A;  4DNC A;  4L18 B;  1D3Y A;  2DYR H;  1R6R A;  5F6F A;  3BJO A;  3HOY J;  2R5Y A;  2IVM A;  1POG A;  5E20 A;  1IXR C;  1K4S A;  2LDU A;  2JVG A;  3TW7 A;  3AL0 B;  3FKI J;  3EQL F;  4JX6 A;  1UZC A;  3GZN B;  3NQO A;  1KYZ A;  1T08 B;  1YX5 A;  4JYK A;  4XRS G;  2B7E A;  5D5W B;  1VQ6 I;  3KX2 A;  3OSF A;  5TGT A;  3L2U A;  5E1W A;  3HGG A;  4A6D A;  4R79 A;  1P2F A;  4QTR A;  3H3V K;  3ZMZ A;  2E2I J;  1X1P A;  2VE8 A;  4MTD A;  3IAM 2;  4BXU A;  3R0J A;  1B59 A;  4HNT A;  1CQT A;  4ZTJ A;  2XB0 X;  2ZXI A;  1RR7 A;  1X1B A;  2CW0 F;  2XF7 A;  3HUG B;  4V2G A;  3TBI A;  4Y52 J;  4IHV A;  1BC8 C;  2Z16 A;  1TW3 A;  3IV5 A;  4M73 A;  2ADU A;  3SEZ A;  2IS6 A;  3K9T A;  2DFH A;  3GBG A;  4BHP A;  1YTY A;  2LVS A;  3HGY A;  2VKE A;  2F5V A;  3VYU B;  4B09 A;  5FLV A;  1XGM A;  4HX8 A;  2HOE A;  3F23 A;  1X2N A;  5KAI C;  4XN0 A;  2FOK A;  1WPK A;  2MH9 A;  1MMD A;  3G1O A;  1S3J A;  3B6A A;  3IWZ A;  3L2Q A;  4JQF A;  2X6W A;  4CUG A;  2X1C A;  5GAG J;  2K5C A;  3KLN A;  1XGO A;  3B6C A;  4N9H A;  5IP9 J;  1IF1 A;  4CIC A;  4G7H F;  4O3M A;  5EJC A;  1V5F A;  1I1S A;  1HF0 A;  2KJC A;  2HQ5 A;  2O8X A;  4A0Z A;  1Z6T A;  2RN7 A;  2ZSI B;  3JRC A;  3OY9 A;  3HRM A;  3BCA A;  2M45 A;  4RAF A;  2VKH A;  3MEX A;  3F8N A;  1JKP C;  1X1A A;  4LK0 F;  4IX7 A;  1BI0 A;  2HVQ A;  1OCP A;  1P4X A;  4I0A A;  4XK4 A;  1WH7 A;  1JTX A;  2XIG A;  3GCM A;  1VQK I;  4M9X A;  2X1E A;  3CO7 C;  3HL2 A;  1I50 J;  5DDG A;  3OS0 A;  4RMN A;  2QSF X;  2OAZ A;  2HVS A;  2DOA A;  2OTL I;  1SVO A;  2F4O B;  2V9P A;  1XS9 A;  4DZP A;  2PI0 A;  1ORK A;  1LE8 B;  3PIP F;  5ICE A;  4E6K G;  3DV8 A;  5AIP A;  4X1E A;  1UHW A;  2BYV E;  5DCM A;  4HEA 2;  1KYW A;  2DOD A;  4UUS A;  3Q9S A;  1DGW Y;  3ZMD A;  1SFO J;  3PL8 A;  5H6Q A;  3OYE A;  1TWC J;  1ZYR F;  4IO9 F;  3PQJ A;  2ISY A;  1PUF B;  1QQI A;  1TBX A;  1G6N A;  4IRI A;  4L9J A;  2LC2 A;  4DBQ A;  5HLT A;  4RB0 A;  2FQ4 A;  4I0B A;  1QHG A;  4PJJ A;  3K10 A;  1X1C A;  1B6A A;  3LSG A;  2PN6 A;  2CQQ A;  5HDK A;  3CUQ A;  1PDN C;  2VJ4 A;  4XSX F;  4EV0 A;  4OWR B;  3U1K A;  4IF4 A;  2XHK A;  3ECO A;  2BY2 A;  4LB5 A;  1BJA A;  2IA0 A;  1S8N A;  4GO1 A;  3RQI A;  2Q2E A;  4AC0 A;  3TDZ C;  3QYF A;  2KT0 A;  4S0H B;  5K7F A;  5FB2 A;  3HRT A;  3OIP A;  3I53 A;  1ZR2 A;  2XDV A;  2LLK A;  4Q48 A;  3BZK A;  2FNP A;  4S05 A;  3V4G A;  4BAY A;  1TP4 A;  1VQL I;  3H9J A;  1I39 A;  2XGD A;  2TRT A;  3M8J A;  1SD5 A;  3FM5 A;  3CD6 I;  2CYY A;  3E7L A;  2XAS A;  4ZYH A;  5HLH A;  5FLM J;  2X1D A;  2CW8 A;  4ESJ A;  4ENJ A;  1TLH B;  3R0A A;  1ZRF A;  1KON A;  5L3B A;  2K9N A;  3GYH X;  4R1H A;  2V1X A;  1A04 A;  2FX0 A;  4D7N A;  2LK2 A;  2L4A A;  3ROU A;  4XLA A;  1ZRD A;  3F0C A;  3CMA I;  4OOI A;  2IS4 A;  1T33 A;  4O5V A;  2M7B A;  2LH9 A;  2Z2S B;  3OYC A;  3KEY A;  2Y75 A;  2L2O A;  4PGG A;  2YR2 A;  4U0Y A;  4HV6 A;  3RPQ A;  4GCV A;  2JA7 J;  1WSU A;  2M0C A;  3NRV A;  5E18 F;  4B43 A;  4AID A;  4BNC A;  2CQ7 A;  5DM7 F;  1QPI A;  3HOT A;  1DPU A;  3JW4 A;  2L9S A;  3SFI A;  4BAC A;  2VBX A;  2GIV A;  5F0H A;  3GTP J;  3I9V 2;  3LFU A;  4LLG F;  1QVT A;  3OR2 C;  1DU0 A;  4FHT A;  3DBL B;  3FXL A;  4A3J J;  1V5E A;  5J1R A;  5EEA A;  1G3Y A;  3PFY A;  2VC1 A;  5FRO A;  3BG5 A;  2EFO A;  4M3F A;  3EUH C;  4IOA F;  2R7T A;  3E3V A;  3K2A A;  3IP4 B;  3SZG A;  5BOX A;  1ZGJ A;  3CUQ C;  3GVA A;  4D7M A;  1QBJ A;  1IXS B;  4L9T A;  3SZP A;  3KYD B;  1WKM A;  2L9V A;  4B3X A;  4PZJ A;  2D45 A;  2W4S A;  1VQ4 I;  1BA5 A;  5CJ9 A;  4ZYE A;  1U0J A;  2R7O A;  4IVN A;  3MZH A;  1AU7 A;  1I6H J;  3A0B C;  1QPM A;  3DCF A;  4XOT A;  4IHW A;  4HBL A;  3E6D A;  3E1S A;  4NQW B;  4UUS B;  2M8G X;  2JUG A;  2CSO A;  5HOD A;  4BXX J;  3RYP A;  2KIM A;  2R7Q A;  1J5Y A;  2K40 A;  4EM1 A;  1ZLJ A;  1BM9 A;  1F1Z A;  1K83 J;  4KN4 X;  1TTY A;  4A3D J;  1BL0 A;  2JT1 A;  1N78 A;  4ZYA A;  1GXQ A;  3DKX A;  1WJB A;  4ZH4 F;  4LG0 A;  5LEJ A;  4OIQ F;  3L7W A;  3CQZ J;  2ZNY A;  4EMS A;  2V4J C;  3J7A Y;  1J9I A;  3P7N A;  4F7Z A;  1LFU P;  4A3E J;  1VQO I;  3R60 A;  3IL2 A;  3FM3 A;  4C2M J;  2FU4 A;  3D5L A;  1SAN A;  1TNS A;  2WBM A;  3I54 A;  1MZB A;  1TZL A;  1GUU A;  1U5T C;  1FOK A;  3BR5 A;  1VZ0 A;  2ZO4 A;  3KPH A;  4EJV A;  1MGT A;  3MKY B;  2EV5 A;  3HRS A;  4FX0 A;  4L9V A;  1XCV A;  4M72 A;  2UZK A;  3W2V A;  1R1U A;  5ICG A;  4WXH A;  1MBK A;  2E34 A;  2BVL A;  4HW0 A;  2LP0 A;  3DPU A;  4KIG A;  3GTL J;  1W5T A;  2DPU A;  1D0X A;  2LY9 A;  4PCQ A;  1W4M A;  3E97 A;  4J00 A;  2E5N A;  4II3 A;  3S14 J;  2HOT A;  4HA8 A;  2W48 A;  2ZME B;  1MJ9 A;  2JJ7 A;  2G0E A;  2E35 A;  4ABZ A;  2DT7 B;  3L2V A;  5DUI A;  2LOO A;  4DYC A;  3AKZ A;  3BTL A;  4XOP A;  3FXU A;  1HW5 A;  2NS0 A;  3JRA A;  1NG7 A;  3U1D A;  2DTR A;  2HQN A;  2RAE A;  3ELK A;  1NH3 A;  3LNQ A;  2K9Q A;  4HSR A;  4RAG A;  4HDV A;  4AM3 A;  4L5E A;  2IA2 A;  3JAM K;  3BG7 A;  5HDG A;  5J3L A;  2EIK H;  2MFZ A;  1O3R A;  5FRN A;  1RRJ A;  2O7O A;  3BPX A;  1ZG1 A;  4IRG A;  4KMF A;  2JZY A;  5E17 F;  3Q9V A;  5F0F A;  1SFE A;  2V7F A;  1VQN I;  4A69 C;  3K4C A;  1FC3 A;  1I3Q J;  2A68 F;  2M30 A;  3QOP A;  2VI6 A;  2WV0 A;  3JRB A;  1JGG A;  3QOE A;  3J81 Z;  2ESH A;  2EFN A;  4WK8 F;  2RKH A;  3K69 A;  1GV5 A;  3D5R C;  3VYR B;  3A2K A;  3TED A;  1W7P A;  1W0U A;  4L5J A;  3ZP5 A;  4HQM A;  2OTJ I;  1WJC A;  1Z1D A;  3TKY A;  3J81 K;  3OIQ A;  1OIS A;  3BQY A;  3IKT A;  2FSW A;  1D1A A;  3HOW J;  1FTT A;  1BI1 A;  3WU2 C;  3S2W A;  2VQG A;  3I4M J;  1FBU A;  3MKL A;  5LFA A;  2FF4 A;  1MKM A;  5JHF A;  4EGZ A;  2H1K A;  3QYB A;  1IC8 A;  3RKW A;  2ETH A;  4C2T A;  2H6B A;  5TJJ A;  2A61 A;  5ILU A;  3FHN A;  3OOP A;  2O5R A;  2MYS A;  2ZXW H;  4U0W A;  3RZO J;  3DLL F;  4MFD A;  1IGN A;  3RZD J;  2P8T A;  2K3P A;  5K7Z A;  2STT A;  2GIZ A;  4EJU A;  2CFO A;  2GAU A;  3HKZ A;  4GXO A;  2EZL A;  4AYB A;  2JN6 A;  2DA2 A;  1K78 B;  3H1C A;  1E3H A;  3TMO A;  1Y6I A;  1U6G A;  1H0M A;  4G12 A;  1TT0 A;  1Y0N A;  5FKN A;  1JKO C;  4BQO A;  1ZTR A;  4LFU A;  1ZAR A;  1X1D A;  1PVE A;  3VWB A;  1K7A A;  2CUZ A;  5M5X J;  3ZQC A;  5GAE J;  2DT5 A;  4CCL A;  3L9F A;  4RLQ A;  1NG6 A;  4Y13 A;  5DM6 F;  3FZV A;  2Z9O A;  2H8W A;  1JKQ C;  4ESB A;  3BR2 A;  3WTW C;  2PLY A;  1VTN C;  2GOM A;  4M3G A;  1ZHF A;  2VJ5 A;  5CVI A;  5K5Q A;  2FBI A;  3BP8 A;  3S8P A;  5J4V A;  4LMY A;  1V3F A;  4NC8 A;  1EF4 A;  2KL4 A;  1NTC A;  2L02 A;  3E5Q A;  4NB5 A;  2DOF A;  1AWC A;  2M4K A;  2LRE A;  5AON A;  3LA3 A;  2HXI A;  1IZ1 A;  4ASN A;  4WCG A;  4B1R A;  3CCL I;  2O0Y A;  1X19 A;  1BJZ A;  1OJL A;  2KHM A;  4RM2 A;  5E3M A;  4LLL A;  1MDM B;  2JA5 J;  3DBH B;  1D1B A;  2NVX J;  3BCB A;  1Q1V A;  3OSG A;  1KA8 A;  5D5X B;  3U9G A;  2IBD A;  4BXF A;  5ED4 A;  4GYG A;  3LSM A;  5K5O A;  1V55 H;  5IP7 J;  1Y39 A;  3FMS A;  4LGW A;  3KYL A;  4LIT A;  1FYK A;  3CMM A;  2VN2 A;  3L2C A;  3OS2 A;  1SAU A;  2HU9 A;  5GP9 A;  1FIA A;  1KU7 A;  2XB5 A;  2ZNZ A;  2PJR A;  1RET A;  2IA1 A;  1BW6 A;  2OCE A;  3V8L A;  2KIU A;  4F3Q A;  3C18 A;  3B73 A;  4G6T B;  4H4K C;  3DTK A;  1G3W A;  2EJR A;  2VOD A;  2YU9 J;  2KRC A;  4E7K A;  1RI7 A;  2X6O A;  2TDX A;  3PUF A;  2F4M B;  4IXA A;  4AWX B;  2VKD A;  2UXN A;  2ZKZ A;  3FF5 A;  1VQ7 I;  5F1R A;  3M7G A;  2LBF A;  5HS7 A;  4BJ5 C;  3JCU C;  1GVJ A;  2CGP A;  4JX4 A;  4BYY A;  3HRU A;  5EGO B;  4ITV A;  2NOG A;  4LG0 B;  3A0H C;  3QOD A;  3W2W A;  2ECC A;  1IW7 F;  3QAH A;  3M8F A;  2HTS A;  3EPZ A;  3HOX J;  3L09 A;  1OKR A;  2R7Z J;  2GLO A;  1MMN A;  4MO7 A;  3GZ6 A;  5IT9 Z;  4BH9 A;  5LRR A;  3HOV J;  2V1N A;  5M3M J;  2ECB A;  2QYO A;  1EH6 A;  3RPU D;  3PO2 J;  4BKX A;  3M9A A;  5C4J J;  1DPR A;  2E1M B;  1HSJ A;  4BY7 J;  1QHH D;  3DTE A;  5FKM A;  1VQM I;  2DAO A;  2E19 A;  1LQ1 A;  2EPF A;  2PBI A;  1U9O A;  5BMZ A;  4FE7 A;  4E7L A;  3CUO A;  4RDU A;  1ZG5 A;  3OYG A;  1WGX A;  3HTS B;  5DUK A;  5FFZ A;  4B44 A;  2VL8 A;  1UHS A;  4G9Y A;  3NAU A;  2LYC A;  3SYT A;  3LQR A;  2XF6 A;  4MEX F;  2JVH A;  5C4X J;  1A6Q A;  3K1M A;  4KJZ A;  2HOS A;  1K78 A;  1XG1 A;  5CVJ A;  3I3L A;  1SD4 A;  2MA3 A;  2WB1 A;  1Y56 A;  3BDD A;  4IHS A;  1FP2 A;  2DA7 A;  3S3O A;  1FLI A;  2ZFW A;  2CUF A;  2I10 A;  5DCF A;  5EZG A;  2CO5 A;  3UR3 C;  1B72 B;  5CPR B;  3KCC A;  5CKT A;  1BR4 A;  3GEZ A;  3LWF A;  2DW4 A;  2DA6 A;  1ZGA A;  3H9G A;  5LHI A;  2BXY A;  4ANJ A;  3ONQ A;  2L5Q A;  2MH2 A;  3QPL A;  3C2G A;  1OQY A;  2PMH A;  2CUE A;  2DI3 A;  2B0L A;  2DA1 A;  2O6G E;  3KFW X;  5BNG A;  3E6C C;  2WAQ N;  1XMA A;  2DYS H;  1XSD A;  5H6R A;  4HLY A;  1MIJ A;  3COA C;  4FX4 A;  5IYB J;  1YJW I;  2FXA A;  2NXN B;  3HBL A;  4W1U A;  1PYV A;  3HSR A;  3V7S A;  2L0K A;  3GX4 X;  1H89 C;  3I71 A;  3S3M A;  1ENH A;  2KKO A;  3LA2 A;  1HDP A;  3ERE D;  3EDP A;  2NVT J;  1OYY A;  1VI0 A;  2FMY A;  3RYR A;  1BW5 A;  3WOD F;  4C2U A;  3DPL C;  1K61 A;  3VYS B;  3TDU C;  3FK7 A;  1TWH J;  5GPA A;  4M9Z A;  3REO A;  1O4X A;  4I2O A;  4MNU A;  2X9D A;  3F8B A;  1G4D A;  4M6V A;  2R93 J;  4W97 A;  2HYG D;  1FT9 A;  2MBF A;  3KP5 A;  4IHT A;  5F08 A;  4RGS A;  5E3N A;  2JMW A;  5LGU A;  2DK5 A;  1D0Y A;  3SFZ A;  3CDI A;  3HM5 A;  3K7A J;  3BR6 A;  2EZK A;  2DN0 A;  1EV7 A;  3CCM I;  1E3O C;  3ZR8 X;  1VF9 A;  3GXO A;  4NDL A;  5GTI C;  4UB6 C;  3RKX A;  5JLW A;  5LD2 C;  1LE8 A;  1JUS A;  4BEH A;  2ZME C;  3BC8 A;  3GTM J;  2M0M A;  3K4L A;  3AAF A;  2H1L A;  2DPD A;  1FBQ A;  1YIO A;  3CC2 I;  1O7F A;  3U21 A;  4EM0 B;  4X0G A;  2JQ7 A;  3ZQI A;  5KK1 A;  2G7U A;  3C3W A;  4P5O A;  1FZP B;  1WQ2 A;  2QSG X;  1TW2 A;  3DWL E;  2ZME A;  4RGR A;  2KRF A;  1FX7 A;  2EIM H;  2M87 A;  4QPQ A;  2E60 A;  2WY8 Q;  4CYD A;  1P7J A;  3F3X A;  2R5Y B;  2CH0 A;  2DLL A;  2HKO A;  1MSF C;  4D5C A;  3WTU C;  4Y15 A;  3LST A;  2KP6 A;  2V26 A;  2OZU A;  5HVQ C;  4FTH A;  4J01 A;  4A3G J;  1TT5 B;  2WAQ A;  5E3O A;  2I5U A;  1WI9 A;  4B8X A;  1LEB A;  5FD6 A;  2MC4 A;  3RTR A;  3CZ6 A;  2ZJR F;  2PMU A;  5L3C A;  3F72 A;  1XGS A;  2WA0 A;  2ZXH A;  3HXL A;  5FKK A;  2OQR A;  3PSF A;  4XLF A;  1G3T A;  1ACI A;  4EVI A;  2VE9 A;  1ITY A;  5J8C A;  1HW1 A;  3JRI A;  2IPQ X;  1ZRC A;  2O8K A;  2EB7 A;  5KNL A;  1S9H A;  1B4A A;  2F5E A;  3MD2 A;  4B3A A;  1LKX A;  4XLC A;  4JK1 X;  4BE1 A;  1ETY A;  1RPW A;  1YYV A;  3WTX C;  3MN2 A;  2ZBK A;  1BOB A;  3FX3 A;  2CWE A;  2EQR A;  2HKX A;  2Z1D A;  2HEO A;  1XCB A;  2IW5 A;  1W0T A;  1YHQ I;  3HSF A;  3KP3 A;  1T6S A;  3O8H A;  5IT9 K;  1OCT C;  2VIX A;  1UEL B;  2CRG A;  2FBH A;  5JR3 A;  2OQG A;  2H6C A;  1TQI A;  4KA4 A;  1SVM A;  2HNH A;  2HWV A;  1F43 A;  1JUM A;  3L00 A;  2K27 A;  2PEX A;  1FSH A;  5BS6 A;  3BY6 A;  2EIN H;  3EYY A;  3CJT B;  1IV6 A;  3MMY B;  3OIO A;  5BPD A;  2DFF A;  3C2H A;  3I59 B;  5ICC A;  1Z91 A;  1F4K A;  1A5J A;  3HHG A;  3HG9 A;  2FBK A;  2HYF A;  2Q0O A;  1B9M A;  1LDK B;  1P6R A;  2CU7 A;  3OL3 A;  2L9N A;  2OCC H;  1TQM A;  5FRM A;  3QU6 A;  5IT3 A;  5A2Q Z;  2CQN A;  4A3I J;  2M5W A;  2XAQ A;  1ZEL A;  5ILV A;  3GFL A;  3JRG A;  2HZT A;  1HW2 A;  3CTA A;  2NNN A;  1KU2 A;  4AIH A;  4ZZD A;  3ZRG A;  1LB2 A;  4HX7 A;  2A6T A;  1GV2 A;  3JR9 A;  3O8G A;  2B9S A;  4X6A J;  2P7V B;  1JI8 A;  4YFK F;  1FP1 D;  3F8C A;  3DLA A;  4HF0 A;  1Q1H A;  1U5T A;  1YW7 A;  2QZ8 A;  1RUN A;  1XTA A;  1IO2 A;  3K2Z A;  3IRQ A;  3TP3 A;  3NEU A;  4RAY A;  3J7Z I;  2ZXJ A;  2RC4 A;  3G4S I;  4F93 B;  2M1B A;  4KNY A;  3WG9 A;  3ML6 A;  3FK6 A;  3W3C A;  2E1M C;  2KFD A;  2CMP A;  2Q2E B;  2K86 A;  1HLV A;  4M9S A;  2OUM A;  4FT8 A;  5D4R A;  4LD5 A;  3LSH A;  3F21 A;  3RIR A;  2Y0M A;  4NQW A;  3TP0 A;  4A5M A;  4D0P A;  5LBQ A;  4ZDL A;  1V54 H;  4I76 A;  3DPT A;  5FJ8 J;  2KZV A;  1FWZ A;  1R1T A;  1T95 A;  2QQA A;  2ZJ2 A;  3CJN A;  3CMY A;  3ZMU A;  2A07 F;  2GXA A;  3BZC A;  3DQV C;  1KZH A;  5DS9 A;  1JE8 A;  3TQN A;  4Q5S F;  1FSE A;  2UUZ A;  1DP7 P;  1AKH A;  4DOZ A;  3OYH A;  1JHH A;  2L4M A;  4XKB A;  1W36 C;  1IN6 A;  2J5P A;  1YIT I;  2OF7 A;  5H2F C;  3H92 A;  3FXK A;  4G7Z F;  1WJA A;  3PSI A;  3C7J A;  5E8G A;  2XRL A;  1J0R A;  3GUD A;  3V8K A;  2DCE A;  4F91 B;  1APL C;  3V7R A;  1A6I A;  5L3E A;  1U2W A;  5EZH A;  2MD5 A;  2D1V A;  3HSE A;  4MQ9 F;  2X0L A;  5FKO A;  1Y8Q B;  2HI3 A;  1Z9C A;  1YFH A;  2P6T A;  4C3J J;  2CG4 A;  2E5Z A;  4Y7N J;  1B8I B;  2H8R A;  2FJ1 A;  3BR0 A;  5E3L A;  1H9G A;  2LNB A;  2QUF A;  2BW3 A;  3I55 I;  1IN8 A;  2E1O A;  2LD5 A;  4JP0 A;  1J75 A;  3K4J A;  3OYB A;  1R58 A;  2EFW A;  1D1C A;  5IY5 H;  2WAE A;  3BRO A;  4K2E A;  1QO0 D;  2MSY A;  1VQ5 I;  3QU3 A;  2DMP A;  4HNV A;  3ASN H;  1JJ6 C;  5CQG A;  4JBA A;  3ABK H;  2E1N A;  1G3S A;  1YS7 A;  2GXG A;  1XPX A;  2EV0 A;  2QQ9 A;  2CQK A;  2HQR A;  5CLS A;  4JOM A;  1OCO H;  1NK2 P;  3S1N J;  2XVC A;  4F92 B;  2VLA A;  4J19 A;  2GBY A;  2ME6 A;  1OYI A;  3WU0 A;  5DV5 A;  5LEK A;  1HKS A;  3SXY A;  4I99 C;  3I5U A;  3LSJ A;  4G94 A;  1NHA A;  2JSP A;  2F48 A;  1D8K A;  2X48 A;  2JRT A;  3FIW A;  1VQ8 I;  3RI4 A;  2JWT A;  4YG2 F;  2P0W A;  3HKZ N;  4IJA A;  3D5S C;  2HDW A;  3V42 A;  4ENK A;  3OL4 A;  1HKQ A;  2VPL A;  1OCC H;  3HUG A;  1BIA A;  3MWM A;  2BE5 F;  2Z3Y A;  4XQF A;  3M07 A;  1T39 A;  1JUP A;  2XKO A;  1IJW C;  4WXD A;  3E6M A;  2LMD A;  5K7H A;  3IUO A;  2DA5 A;  3M3Y J;  4PDK A;  3JAM Z;  1YS6 A;  2KMU A;  3IC7 A;  3H3Z A;  3MVP A;  4E7J A;  3RKQ A;  3HOS A;  4PJL A;  1R4N B;  4CXF A;  5LGN A;  3LSK A;  4O6J A;  2A6E F;  3BJA A;  3BG6 A;  1X58 A;  1X4P A;  1J2X A;  1I27 A;  3OYN A;  2F6C A;  1UST A;  3BQZ A;  4OIR F;  3GTK J;  3LSI A;  3HOZ J;  2DJN A;  3MQ0 A;  2R7R A;  3BWG A;  3P5J A;  4QSH A;  4BL0 B;  5KVR A;  3OYD A;  1T2K A;  3UKG A;  2A6H F;  2EH3 A;  1SD6 A;  4CHU A;  1AHD P;  4BQQ A;  3I4P A;  2VBY A;  2YX7 A;  2HVR A;  3JRF A;  6PAX A;  2VJI A;  3VEP A;  2HDD A;  2A3S A;  2XC7 A;  4ETS A;  3V7C A;  4BU2 A;  2K9M A;  3KEO A;  1I6X A;  5TRD A;  2F5D A;  3FXJ A;  2EA2 A;  3N4M A;  2EV6 A;  2EK5 A;  3D0S A;  3IHU A;  3K4B A;  3DF8 A;  4P9F A;  1IDZ A;  4XN3 A;  3FMQ A;  3IH4 A;  4CA0 A;  2DTZ A;  4EAT A;  4IHX A;  3EYI A;  1G8X A;  2C6Y A;  1XB4 A;  2HOA A;  1DP3 A;  3ZOB A;  2K02 A;  2LKX A;  4MEY F;  4B47 A;  4LB6 B;  1OYW A;  1LVK A;  1UG0 A;  4RAZ A;  3NAR A;  2GXB A;  2EA4 A;  4XKC A;  2R7D A;  4RM3 A;  3TL4 X;  2X4H A;  3IWF A;  2ZFU A;  3WHC A;  1XX5 A;  5ILS A;  2W1O A;  3KYC B;  1W5S A;  3ECH A;  2W7N A;  3DBR B;  3FBI B;  2HR3 A;  1B9N A;  4PFP A;  5J4Y A;  4KDP A;  4F52 A;  4XM3 A;  1D0Z A;  3ZGK A;  4H0E A;  1LDD A;  4N4O B;  1HCR A;  1R1V A;  4ON0 A;  2LFB A;  1WFX A;  2MD0 A;  1B8I A;  1QVU A;  5GAD J;  4HST A;  5JLX A;  4I01 A;  1GVD A;  3ZMT A;  1ZG3 A;  1LFP A;  2PG4 A;  1KU9 A;  1O3T A;  2EBI A;  2IS2 A;  1F5T A;  2L9R A;  3A02 A;  4A3L J;  1FOY A;  1ZH5 A;  1IRG A;  4A12 A;  2VOO A;  2QCO A;  2DBB A;  1N75 A;  3S1R J;  1OR7 A;  1GLN A;  4AU7 A;  4CSW A;  5EGO A;  2D5V A;  4RB1 A;  2BHZ A;  5B3S H;  2P4W A;  3S3N A;  5D4S A;  3A03 A;  2W57 A;  4I09 A;  1MND A;  2OC6 A;  3AG3 H;  3DEU A;  2HYJ A;  2NAZ A;  1WHU A;  5IPA A;  1JKR C;  1S29 A;  3KP6 A;  3ABU A;  1PJR A;  3F9K A;  2M34 A;  1BI2 A;  5HS9 A;  3CJR B;  1EA3 A;  2R7F A;  3KP7 A;  4WWC A;  2K3F A;  2FA5 A;  2VAS A;  4XLE A;  3W2A A;  2WB1 N;  1BIB A;  2XAG A;  3OS1 A;  1G2H A;  1XMK A;  4LJZ F;  2IGK A;  1QRY A;  2XAU A;  3CCU I;  2K4B A;  4UY8 I;  3FXO A;  2AXL A;  3H5N A;  4ZDP A;  2AQE A;  1K79 A;  2JRM A;  3WTY C;  2QVO A;  3WE2 A;  1MSE C;  2DXI A;  4DJA A;  3UNG C;  3GF2 A;  3K70 D;  3DP7 A;  3D1N I;  5BPI A;  3PJR A;  2AQF A;  3F8F A;  2VBZ A;  1HBX G;  3HOU J;  4U0V A;  2Y30 A;  4M6X A;  5L3F A;  1MDM A;  4A3M J;  1UG2 A;  2DQL A;  4XNF A;  2D2W A;  3S2H J;  2LKS A;  2PFB A;  1TNT A;  4ZJZ A;  1HST A;  2DFI A;  1R7J A;  1M1E B;  2BXZ A;  2CQX A;  2E2J J;  1RES A;  3K1N A;  2L7F P;  1TQP A;  3CUQ B;  4BBR J;  2D1H A;  3E5U A;  3ZXS A;  2ACJ A;  1ZLK A;  1PP8 F;  3CCS I;  5JVG F;  1Z3Y A;  2R5Z B;  3ZQH A;  4OU0 A;  1D5Y A;  1E3P A;  3TO6 A;  4RLF A;  4BQA A;  1X4O A;  2PMZ A;  4E7Z A;  3QRF F;  4PFO A;  3T5X A;  1N77 A;  3EUK L;  2DOE A;  3P9C A;  2JPB A;  2VKV A;  5LGT A;  1REP C;  2BEO A;  2B63 J;  3BJ6 A;  2O61 A;  4GRI A;  1R9T J;  4IHY A;  3S93 A;  1FMV A;  4UB8 C;  1IN5 A;  1R4M B;  1P7I A;  2ZSH B;  2ZB9 A;  3EUA A;  5DTD A;  3MKZ A;  3L2W A;  2VQC A;  2HQA A;  5DCM B;  5D5U B;  5HOO A;  3RJP A;  4XMY A;  2CFX A;  4LG3 A;  4RB3 C;  2W24 A;  4CGZ A;  1R23 A;  2N8G A;  2LF8 A;  1BN5 A;  5C44 J;  1R00 A;  5E1Z B;  2DMN A;  3ZMV A;  1FMW A;  1A36 A;  2OA4 A;  2W85 A;  2NVU B;  2OU2 A;  2PX9 A;  2WY7 Q;  4OIO F;  3S2D J;  1WCM J;  2F5F A;  3VFZ A;  3GZ5 A;  1K6O A;  3Q3S A;  4I98 B;  3LFK A;  3ZN1 A;  2E2H J;  2ID3 A;  2NVY J;  3J7Y J;  1YO5 C;  2WWY A;  1CF7 A;  3G3Z A;  2MC3 A;  4E4H A;  3VSL A;  1USS A;  3RPU A;  2QEX I;  4M3B A;  5HNF A;  1T0F C;  1XDU A;  2V79 A;  2JA2 A;  2OZ6 A;  4G8X A;  3F8M A;  4XLN F;  3RSN A;  4KFC A;  1XN7 A;  1SMY F;  4KIB A;  4YEL A;  4MHG A;  5EG0 A;  1SAX A;  4XLH A;  1BC7 C;  3FBN B;  3B02 A;  4IQJ A;  2VON A;  3CO6 C;  1T0F A;  2ZJP F;  2AO9 A;  2HS5 A;  3I64 A;  5F0C A;  2K4J A;  3KET A;  1FOX A;  1S7E A;  2GZW A;  3CP2 A;  3PO3 J;  4HRI A;  3SDB A;  2P81 A;  1EKE A;  3MZ8 A;  4PSX A;  2DMQ A;  4XSZ F;  5HS8 A;  4BBS J;  1JXS A;  1ETW A;  3ZQQ A;  2K85 A;  2NOJ B;  2Q8K A;  4RGU A;  2KIF A;  3ERM A;  5EEG A;  2VB6 A;  5JFR A;  3OYI A;  4M3E A;  1MBJ A;  2V6E A;  4YRV A;  4PK4 A;  3RQ4 A;  3O2P E;  2ELJ A;  3ABM H;  4KIF A;  4CO8 A;  3PM1 A;  3K6G A;  1RKW A;  3DKY A;  2R0Q C;  2GWR A;  4AD9 A;  2CJJ A;  1UFM A;  2M8E A;  5KCM A;  3ESW B;  5IOZ A;  4E70 A;  3BR3 A;  5ICF A;  2XAJ A;  5CVV A;  2DJI A;  5EF6 A;  1ONV A;  4WX9 A;  3CCJ I;  1I3A A;  1UMQ A;  3IH2 A;  1ZGW A;  4II2 A;  5CVR A;  4C3H J;  3WU1 B;  4A3F J;  1FJL A;  2XGC A;  3ULQ B;  5L3D A;  1ZN2 A;  5K5R A;  3AL0 C;  1BBY A;  3K70 C;  2QWW A;  2KDO A;  1MBE A;  1FPQ A;  1W5C C;  2XF5 A;  3WE3 A;  3MAJ A;  2W82 A;  2JUC A;  4DYQ A;  3QQA A; 
#chains in the Genus database with same CATH homology
 3O8G A;  4X6A J;  1MNM C;  3CQZ J;  4XRS A;  5GPC A;  2JA8 J;  3W6V A;  3L1P A;  1LFU P;  4A3E J;  5F27 A;  4C2M J;  1SAN A;  2DMU A;  2Y9Y A;  3TP3 A;  1ETX A;  3CDL A;  1B72 A;  1ZQ3 P;  5IP6 A;  3Q0V A;  1X2M A;  1GUU A;  3BR5 A;  3A01 B;  2Y0S N;  3FK6 A;  1HDD C;  2MW8 A;  1TWG J;  1HLV A;  1MBK A;  3WHB A;  1MBH A;  3QPS A;  3TP0 A;  2LP0 A;  2QF7 A;  3GTL J;  4I76 A;  2LY9 A;  1TWF J;  2KDZ A;  2Y31 A;  1IG7 A;  5FJ8 J;  2AHQ A;  3S14 J;  3JRE A;  2HOT A;  3CMY A;  2NVQ J;  2W48 A;  5DS9 A;  3LSR A;  2JJ7 A;  2G0E A;  1AKH A;  4ABZ A;  4DYC A;  3BTL A;  2WV1 A;  3JRA A;  1IDY A;  2OF7 A;  3BTC A;  1JJ8 C;  2RAE A;  3LNQ A;  1JTY A;  2K9Q A;  3IH3 A;  2XRL A;  4L5E A;  5J3L A;  1APL C;  2O7O A;  1A6I A;  5J1U A;  5EZH A;  5F0F A;  1Z77 A;  2LTP A;  5FKO A;  4A69 C;  1I3Q J;  2HI3 A;  2IAI A;  2VI6 A;  4C3J J;  3JRB A;  1B8I B;  4Y7N J;  1JGG A;  1AKH B;  2H8R A;  2FJ1 A;  3BR0 A;  5E3L A;  4CYC B;  2E1O A;  2XPW A;  2O9L A;  2LD5 A;  4JP0 A;  1GV5 A;  2HXO A;  3TED A;  3Q0U A;  1W0U A;  4LOC A;  2M2E A;  1TC3 C;  1NK3 P;  2VPR A;  3S1Q J;  3BQY A;  2MSY A;  2YUS A;  2DMP A;  4HNV A;  2Y2Z A;  3HOW J;  1JJ6 C;  1FTT A;  1MBG A;  9ANT A;  3GTO J;  1ZKG A;  3BR1 A;  3OOU A;  3I4M J;  3MKL A;  1NK2 P;  3S1N J;  1H88 C;  2H1K A;  4J19 A;  1IC8 A;  5F1J A;  2NS7 A;  2GBY A;  5FKL A;  2ME6 A;  1RKT A;  3BG3 A;  3LSJ A;  4CYC A;  4C3I J;  4A93 J;  1HOM A;  3RZO J;  2Y9Z A;  2X48 A;  2L7Z A;  4MFD A;  3FIW A;  1IGN A;  4FCY A;  3BT9 A;  3RZD J;  2JWT A;  5K7Z A;  3HKZ N;  3GTJ J;  2NS8 A;  1MH3 A;  2K9S A;  4BY1 J;  5EDN A;  4XRM A;  2EZL A;  3ZQL A;  3VPR A;  2JN6 A;  2DA2 A;  3CCY A;  3TW6 A;  4AYB N;  2IEK A;  1JUP A;  4G12 A;  3BG9 A;  5FKN A;  1IJW C;  1JKO C;  1ZTR A;  5K7H A;  2DA5 A;  4B4C A;  3M3Y J;  2DA3 A;  1ZK8 A;  4M3D A;  3MVP A;  5M5X J;  3RKQ A;  3ZQC A;  1JKQ C;  1FIP A;  3BR2 A;  1X58 A;  3JRH A;  4EEF G;  4M3G A;  3BQZ A;  3SJM A;  1Y1W J;  3GTK J;  3HOZ J;  2DJN A;  3I4N J;  4QSH A;  5IYD J;  1EF4 A;  3UKG A;  1NTC A;  2L7M P;  4I6Z A;  2EH3 A;  2YS9 A;  1AHD P;  4MLO A;  3S15 J;  2HXI A;  1VFC A;  3JRF A;  4B1R A;  2HDD A;  1YRN A;  1BJZ A;  1OJL A;  3C2B A;  5E3M A;  2OPT A;  4DZJ A;  2JA5 J;  4A3K J;  2VUM J;  2NVX J;  3BTI A;  4MFE A;  1ZR4 A;  1T56 A;  1Q1V A;  1IDZ A;  3OSG A;  3IH4 A;  1MH4 A;  2DTZ A;  4IHX A;  2IBD A;  3HB9 A;  2R92 J;  5IYC J;  1XC5 A;  5IP7 J;  2HOA A;  3ZOB A;  5C3E J;  3LOC A;  2LKX A;  2EZH A;  2FD5 A;  3LSP A;  1IUF A;  5GP9 A;  1FIA A;  2XB5 A;  5F04 A;  1RET A;  1BW6 A;  4DW6 A;  3NAR A;  5M5Y J;  5M5W J;  5EYR A;  1Z0X A;  3WHC A;  1WI3 A;  2YU9 J;  3HOY J;  2X6O A;  2R5Y A;  1POG A;  2XPU A;  5M3F J;  3TW7 A;  1HCR A;  4RBO A;  4JX6 A;  2LFB A;  3FKI J;  1OFC X;  4JYK A;  1QVU A;  1B8I A;  4XRS G;  5JLX A;  4JX4 A;  1GVD A;  2ELK A;  3OSF A;  3HGG A;  5EGO B;  2NOG A;  4QTR A;  3H3V K;  3H0G J;  2E2I J;  2EBI A;  2ECC A;  2L9R A;  3A02 A;  3HOX J;  4A3L J;  4MIM A;  3M4O J;  1CQT A;  2R7Z J;  2GLO A;  2XB0 X;  1GT0 C;  4XID A;  2QCO A;  1RR7 A;  4V2G A;  4Y52 J;  4IHV A;  4MO7 A;  5J1Y A;  3S1R J;  3S17 J;  3S16 J;  3IV5 A;  5EGO A;  2D5V A;  3HOV J;  5M3M J;  2ECB A;  3GBG A;  3PO2 J;  2LVS A;  4BKX A;  2MG4 A;  2VKE A;  3HGY A;  5C4J J;  5FLV A;  3A03 A;  4BY7 J;  5FKM A;  2E19 A;  2HYJ A;  1U9O A;  1X2N A;  4FE7 A;  5IPA A;  1JKR C;  1WPK A;  4RDU A;  1WGX A;  3G1O A;  3B6A A;  1UHS A;  3DEW A;  3NAU A;  3FIS A;  2M34 A;  3B6C A;  5IP9 J;  5C4X J;  3Q0W A;  4A3C J;  2WB1 N;  4XIC A;  2HOS A;  1G2H A;  1XG1 A;  1QRY A;  4GFB A;  1HF0 A;  2HQ5 A;  2DA7 A;  3JRC A;  2CUF A;  2I10 A;  5EZG A;  4AUX A;  2TCT A;  1MSE C;  1B72 B;  1JKP C;  2JK3 A;  1MBF A;  3D1N I;  2DA6 A;  2MGQ A;  3HOU J;  1OCP A;  3QPL A;  2Y30 A;  4XK4 A;  2CUE A;  4A3M J;  1UG2 A;  1WH7 A;  1JTX A;  2DA1 A;  1FTZ A;  1ETV A;  1JT6 A;  1YRN B;  5BNG A;  1I50 J;  3S2H J;  2WAQ N;  3JRD A;  2EZI A;  2CQX A;  1XS9 A;  4DZP A;  1H8A C;  1RES A;  1ORK A;  1LE8 B;  2E2J J;  2L7F P;  4UUT A;  4BBR J;  5IYB J;  4W1U A;  3HBL A;  4X1E A;  2L0K A;  1F36 A;  1H89 C;  1ENH A;  4UUS A;  1HDP A;  2R5Z B;  3ZQH A;  1SFO J;  1D5Y A;  1ETQ A;  2NVT J;  1VI0 A;  1BW5 A;  1ETK A;  1DU6 A;  2M9H A;  1K61 A;  3FK7 A;  1TWC J;  1TWH J;  5GPA A;  2PMZ N;  1WH5 A;  2VKV A;  1O4X A;  2X9D A;  1PUF B;  2B63 J;  3GTG J;  4M6V A;  2R93 J;  4W97 A;  1R9T J;  4IHY A;  5F08 A;  5E3N A;  4QIW N;  4IEJ A;  2FQ4 A;  1P7I A;  2JMW A;  3HM5 A;  2ZB9 A;  3K7A J;  5DTD A;  3BR6 A;  2R5Z A;  2EZK A;  2DN0 A;  3G1M A;  1FEX A;  1E3O C;  3LSG A;  2CQQ A;  1VF9 A;  4NDL A;  5JLW A;  1LE8 A;  1JUS A;  2N8G A;  5C44 J;  4JX5 A;  3GTM J;  3RQI A;  4AC0 A;  2DMN A;  3SDG A;  2ID6 A;  4D5F A;  2XSD C;  4S0H B;  2DMT A;  2KT0 A;  1VND A;  5K7F A;  3S2D J;  1WCM J;  3A01 A;  4DYR A;  3Q3S A;  3ZQI A;  1ZR2 A;  2LLK A;  2E2H J;  2ID3 A;  2NVY J;  3S1M J;  1LFB A;  2XGD A;  2TRT A;  1P7J A;  4M3B A;  2R5Y B;  3E7L A;  1MSF C;  1TWA J;  4D5C A;  5FLM J;  4FTH A;  4A3G J;  5E3O A;  5EG0 A;  2K9N A;  1U8B A;  2FX0 A;  4D7N A;  2LR8 A;  2LK2 A;  2AO9 A;  2COB A;  3F0C A;  5F0C A;  2ME0 A;  1T33 A;  5FKK A;  2DA4 A;  1IRZ A;  1S7E A;  3PO3 J;  1ITY A;  3JRI A;  2XGE A;  2O8K A;  2P81 A;  3GTQ J;  1U78 A;  2DMQ A;  3HDD A;  2JA7 J;  4BBS J;  1ETW A;  2M0C A;  4FIS A;  4B3A A;  1QPI A;  4V2F A;  3ZQF A;  1ETY A;  1RPW A;  3SFI A;  3MN2 A;  3ZQG A;  5F0H A;  3GTP J;  1QVT A;  2EQR A;  5IOY A;  1DU0 A;  4M3E A;  4A3J J;  5J1R A;  1MBJ A;  5EEA A;  1W0T A;  3O8H A;  3BG5 A;  1OCT C;  3G1L A;  4M3F A;  2CRG A;  1JT0 A;  3K2A A;  3PM1 A;  1RKW A;  1F43 A;  1JUM A;  2R0Q C;  4D7M A;  2CJJ A;  5IOZ A;  1IV6 A;  3OIO A;  3BR3 A;  1PUF A;  5EF6 A;  1BA5 A;  1UMQ A;  3IH2 A;  2JA6 J;  1A5J A;  1ZGW A;  2XPV A;  1AU7 A;  3HEF A;  1I6H J;  4C3H J;  2CU7 A;  3DCF A;  4A3F J;  1FJL A;  2XGC A;  4IHW A;  1ETO A;  4A3I J;  4UUS B;  2M8G X;  1GDT A;  5HOD A;  3BTJ A;  4A3B J;  4BXX J;  1U9N A;  2K40 A;  1MBE A;  1Y1V J;  3JRG A;  1K83 J;  5EG0 B;  4A3D J;  1BL0 A;  4DYQ A;  2GM4 A;  4FE4 A;  1GV2 A;  3JR9 A;  3QQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...