1FJLA

Homeodomain from the drosophila paired protein bound to a dna oligonucleotide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
KQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRKQHTSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAIRED PROTEIN
publication title High resolution crystal structure of a paired (Pax) class cooperative homeodomain dimer on DNA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 25
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1995-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fjlA00
1JTXA 1MBKA 1NK2P 4QTRA 3FK7A 2R92J 1U9OA 2XGDA 1WCMJ 3BG9A 1SFOJ 2DA2A 2DMPA 5EG0B 5EG0A 4AUXA 2JJ7A 1YRNB 1YRNA 1Y1VJ 1MBJA 2JA8J 1Y1WJ 1FTTA 3BTCA 2M34A 3LSJA 4MIMA 1MBGA 2M8GX 1T33A 3ZOBA 1IJWC 1ETXA 5J1YA 3IH3A 4A3FJ 4XRSG 4C2MJ 3LNQA 2XSDC 2LP0A 3IH4A 5FJ8J 4CYCB 1ORKA 4CYCA 2X48A 5F04A 3BR2A 3NARA 3GTOJ 3D1NI 3IH2A 4I76A 2DMQA 1JT0A 3JRHA 5DS9A 1RKWA 2O7OA 1F43A 1OCPA 2I10A 2K40A 1JJ8C 3I4NJ 4V2GA 1TWFJ 2XB0X 2DJNA 2L7MP 2XPWA 1HCRA 3BR1A 1FEXA 4D7MA 2NOGA 3ZQIA 3RQIA 5FKKA 2R7ZJ 3PM1A 1XG1A 2GM4A 2VKVA 1ENHA 1SANA 1GV5A 3JRAA 1U78A 4A3GJ 2WAQN 4DZJA 1X2NA 1EF4A 1S7EA 4B4CA 3BR6A 1ZQ3P 3ZQGA 3CQZJ 4RBOA 5FKMA 5K7HA 2GBYA 2DMUA 5IYCJ 1WH5A 3JRDA 1XS9A 2EZLA 2NS7A 3PO3J 4M3FA 3S2HJ 5IP7J 3BG3A 4M3DA 2WV1A 2JK3A 1GDTA 3CDLA 4XICA 2LD5A 2O9LA 2E19A 4BBSJ 3BTLA 1HDPA 3G1MA 4B1RA 3BTJA 3S17J 2VPRA 4A3IJ 3HBLA 2CRGA 2XPUA 3B6CA 2ID6A 2DA1A 5F1JA 3OSGA 2GLOA 3JRCA 3ZQHA 3JREA 2K9NA 1H8AC 3S14J 1IRZA 2OPTA 4M3GA 3PO2J 3K2AA 4RDUA 2N8GA 4M6VA 2R5ZB 5F0CA 2R5ZA 1BL0A 3GTLJ 1P7IA 4JX4A 4L5EA 2JN6A 4M3EA 1NTCA 1FJLA 4C3HJ 2L7FP 2X9DA 5IYDJ 5C4JJ 3GTGJ 1I3QJ 5K7FA 1MSFC 2HOTA 4W97A 2R5YB 5J1RA 4A93J 1GVDA 3S1NJ 1RPWA 2K9QA 1XC5A 2CUFA 1HOMA 2DA4A 1JTYA 4DW6A 1R9TJ 2DA6A 2LY9A 4JX6A 5F0FA 5IYBJ 5J1UA 3S1RJ 1WI3A 3HOXJ 1JGGA 2DA3A 3BG5A 3FISA 2HYJA 1UHSA 4XIDA 2R0QC 3HDDA 2NVXJ 1BA5A 1ZR2A 2B63J 3TEDA 1PUFB 2VKEA 5FKLA 1PUFA 4I6ZA 1ETYA 2XGCA 4X6AJ 1FTZA 1LFUP 3H3VK 2YS9A 4D5FA 2M2EA 2D5VA 5EYRA 2E2HJ 3LSGA 1ETKA 1JJ6C 3HB9A 2K9SA 3HGGA 4DYQA 1JUPA 1MBEA 3NAUA 3H0GJ 3LSRA 5EZHA 2HI3A 1ZGWA 4ABZA 1JKRC 3ZQFA 4FTHA 4A3LJ 5EF6A 4A3CJ 1TC3C 2HDDA 1ZK8A 1WPKA 1D5YA 1MBFA 3BTIA 4BY1J 3S16J 1QRYA 3TP3A 3IV5A 2HXOA 1G2HA 2DA5A 4FISA 4GFBA 2MGQA 3L1PA 3HM5A 3LOCA 1RKTA 3RZOJ 3FK6A 1WH7A 3HOZJ 5JLXA 2FD5A 1VNDA 2ID3A 4NDLA 4FE7A 5HODA 2ECBA 5E3MA 2VI6A 4A3KJ 1BW6A 2WB1N 3S1MJ 1H89C 2H8RA 2LKXA 1AHDP 1MH4A 1HF0A 5M5XJ 2IEKA 3GTMJ 2LVSA 1AU7A 4IHWA 4C3JJ 3WHCA 3LSPA 1ETWA 2H1KA 4B3AA 5EZGA 1CQTA 2CU7A 3GTQJ 2FJ1A 3SJMA 2EZHA 1H88C 1GUUA 5IOZA 1JT6A 1U8BA 5BNGA 4A3EJ 3QQAA 3M4OJ 1T56A 2JA7J 3BR0A 5IP6A 1IC8A 5IOYA 3Q0WA 3WHBA 4MO7A 5M3MJ 4J19A 1UMQA 1JKOC 1OCTC 3GTKJ 2L7ZA 3CCYA 2ELKA 2EZKA 4JX5A 5F08A 1IDYA 3O8GA 2ECCA 1W0TA 5FLVA 5E3NA 5FKOA 4BBRJ 2IBDA 3HEFA 2MG4A 4W1UA 5K7ZA 5EGOB 5EGOA 5EEAA 3Q0VA 2IAIA 3DEWA 2FQ4A 2DTZA 2HOSA 5M3FJ 1JKPC 1ETQA 4JP0A 3TP0A 2O8KA 1Z77A 5JLWA 1LFBA 4MFEA 1Q1VA 4FE4A 2HOAA 4XRMA 3C2BA 4BKXA 3S15J 2ME0A 2YU9J 3RZDJ 2L0KA 2R5YA 2EZIA 2DMNA 3MN2A 3DCFA 2E1OA 2RAEA 1RESA 2XGEA 2LK2A 1P7JA 1A6IA 3TW7A 3O8HA 2JMWA 4Y7NJ 2NS8A 5E3OA 2E2IJ 2XB5A 4X1EA 1DU0A 3SFIA 5GP9A 2CQQA 4BY7J 3ZQCA 1O4XA 1I6HJ 2LR8A 1BJZA 2PMZN 1Z0XA 3MVPA 4IHYA 5C3EJ 1MSEC 1E3OC 4A3JJ 2P81A 1WGXA 1I50J 3BQYA 2EH3A 1IDZA 3M3YJ 3Q0UA 2X6OA 3HKZN 3OOUA 5F27A 1TWHJ 5M5WJ 4A3BJ 2MW8A 2DN0A 4FCYA 3S1QJ 3HOYJ 4S0HB 5F0HA 1ZTRA 3BR5A 3F0CA 1MBHA 3BR3A 2M9HA 2CJJA 1F36A 2Y31A 4UUTA 3JRIA 3JR9A 1ZR4A 2Y9ZA 4DZPA 2QCOA 4IHVA 1OJLA 4AYBN 1AKHB 1MH3A 1HDDC 1AKHA 4QIWN 3W6VA 5FLMJ 3HOWJ 2JA5J 1APLC 2CUEA 2MSYA 4MFDA 1JUSA 3JRBA 3GTPJ 2COBA 4M3BA 1POGA 3S2DJ 1IV6A 2NVYJ 2Y30A 2EBIA 3A03A 1RETA 2YUSA 3Q3SA 1IUFA 3GBGA 3HOUJ 1ITYA 5FKNA 1JKQC 1FIAA 1B8IB 1B8IA 2AHQA 4XK4A 4DYCA 3A02A 4D5CA 5IPAA 3FIWA 2HXIA 3G1OA 3QPSA 3HOVJ 4UUSB 2R93J 2JWTA 4UUSA 1ETVA 5E3LA 2Y0SN 3SDGA 3BT9A 3K7AJ 2LFBA 5EDNA 2ZB9A 1VF9A 1A5JA 1X58A 4HNVA 3A01B 3A01A 2XRLA 1VI0A 4A69C 9ANTA 2LTPA 3E7LA 5J3LA 1TWCJ 4G12A 5IP9J 5DTDA 3TW6A 3JRFA 1K61A 4MLOA 4DYRA 1HLVA 2TRTA 5GPCA 5C4XJ 2Y2ZA 1FIPA 1UG2A 3CMYA 1K83J 1RR7A 2AO9A 4Y52J 3QPLA 2HQ5A 2JA6J 1IGNA 2KT0A 3OIOA 2M0CA 1QVUA 2KDZA 4JYKA 3I4MJ 1ZKGA 1GT0C 2E2JJ 3HGYA 1TWGJ 1NK3P 4QSHA 4XRSA 1MNMC 3MKLA 4A3DJ 2Y9YA 2TCTA 1VFCA 2CQXA 1QVTA 3G1LA 1ETOA 4AC0A 2L9RA 4C3IJ 2QF7A 3ZQLA 1IG7A 1BW5A 3GTJJ 2DMTA 1OFCX 1U9NA 2G0EA 1JUMA 3BQZA 1LE8B 1LE8A 4A3MJ 5GPAA 2DA7A 1QPIA 2OF7A 4LOCA 4V2FA 2XPVA 4IHXA 2LLKA 2ME6A 3UKGA 2W48A 3RKQA 3OSFA 4BXXJ 5C44J 3B6AA 1GV2A 1X2MA 3JRGA 2NVTJ 4IEJA 2FX0A 1W0UA 2EQRA 2NVQJ 3FKIJ 1B72B 2VUMJ 1DU6A 1B72A 4EEFG 4D7NA 5M5YJ 1TWAJ 3VPRA
chains in the Genus database with same CATH superfamily
1XX5A 3KP4A 4EJOA 1MBKA 1NK2P 2L2OA 4HF1A 2VJ5A 4BJTA 4XSXF 4RGRA 4Q5SF 1X4OA 1YITI 4HLXA 5EG0B 3FXLA 2XKOA 3FXMA 4ITVA 4PGGA 4ZYDA 1FMWA 2LOOA 1FTTA 3BTCA 2Z3YA 3M7GA 2M34A 3LSJA 4IO9F 1FBSA 5DCMB 2TDXA 1W5TA 1T33A 3WTSC 4PSWA 2R7OA 5IT9K 4BEHA 3R61A 2X1CA 2VONA 2BVMA 3I4PA 2R7RA 2CWEA 2LP0A 3GCMA 1ZHFA 2BHZA 2KZGA 3IH4A 5FJ8J 3EUHA 3KPHA 3OS1A 4XBFA 5F1RA 4CYCA 2BXYA 3HHGA 4P96A 3NARA 1SD5A 3KYCB 5KAIC 4PFPA 1ZELA 1RC9A 4B3XA 4LFUA 2FNPA 1VQOI 1JT0A 1WJAA 1HC8A 1OCPA 1OYIA 1T38A 4V2GA 5FRNA 4YFNF 2DJNA 1HCRA 3DEUA 5D5WB 1FEXA 5HDNA 2DCEA 4AD9A 1W5SA 2OJED 1XG1A 2GM4A 3CJQB 2ZXHA 1OR7C 3FXOA 5E8IA 4X0GA 4G9YA 3K70C 2JA2A 2KIUA 3ISPA 3F23A 3O2PE 4N0BA 1A35A 5D6EA 3ABTA 1X2NA 2HVRA 1YIOA 3ASOH 1F1ZA 2X6WA 3PUBA 1S8NA 3G2BA 4DGWB 3KE2A 5FKMA 2GBYA 2DMUA 2JVHA 5FGMA 3K4LA 3JRDA 2F5EA 3QU3A 2RKHA 2NS7A 3GZ5A 4RB1A 5TRDA 5HDGA 2V6EA 1UG0A 2XVCA 3FMQA 4KIFA 2XF7A 3W6KB 3BG6A 2L7KA 3LFKA 1GDTA 4XICA 1C0WA 4PJJA 1E3HA 1SVMA 4NHJA 3H35A 3VWBA 5HVQC 3CD6I 3BTLA 1HDPA 3ABMH 2STTA 3G1MA 3BTJA 2O8XA 1I1SA 4A3IJ 2GWRA 3B6CA 3K6GA 5F1JA 3ZQ7A 1VQPI 1MMSA 5H6RA 3KEOA 4LB5A 1QO0D 1IRZA 2CV1A 2NXNB 3WU1B 3D0SA 5ICCA 4N4NB 4RDUA 4HQMA 2QKLB 3DF8A 3H3ZA 3VYSB 3ZMTA 1Y0UA 1P7IA 2OBPA 3RCOA 3S32A 3JTGA 1VZ0A 4ZYGA 1XD7A 4OIPF 4PJ0C 3CUOA 1YHQI 3S8PA 3SEZA 2VODA 4RB2C 2L7FP 1TT5B 3MFKA 4DNCA 5C4JJ 1J09A 5DM7F 1VQ8I 2HS5A 2R5YB 4EGYA 3J7ZI 4ZTJA 1ZRFA 2OA4A 2K9QA 5LFAA 1HOMA 2DA4A 3L2WA 3AG3H 3M1CA 2QBYB 3CUQC 2JRMA 2DA3A 2VOOA 2L9NA 4PJMA 5D6FA 2DT7B 1K78A 3CP8A 1P2FA 1UHSA 2HYJA 2JPBA 3CO6C 3HDDA 4GXOA 1PUFB 3D5RC 5DYMA 1MDMB 1BI0A 3MKZA 3HG9A 4ENMA 2XGCA 1FOKA 4X6AJ 2JPCA 1WSUA 2DYRH 3TQNA 2NNNA 1LFUP 1FTZA 2QQ8A 1LFPA 2OZ6A 3I0TA 3LSGA 1JJ6C 2IXSA 3HB9A 4KIGA 3F6OA 2K86A 4XLCA 2P4WA 1WFXA 5EZHA 4A3LJ 1JKRC 1U5TC 4FTHA 4A3CJ 1TC3C 2HDDA 2K4JA 4MHGA 2IPQX 3W6JB 4G7HF 1R4NB 3G71I 2P5VA 3TO9A 1K79A 2HXOA 2UV1A 4FISA 4RAYA 2MGQA 2CO5A 1MMDA 4CZCA 2CMPA 2BHYA 4G8XA 3LOCA 4L9VA 4RB3C 2BV6A 2STWA 4XSZF 2XROA 3RZOJ 2K3FA 1D8JA 3LA2A 1LVAA 1KU2A 1VNDA 2ID3A 4NDLA 3IKTA 4FE7A 2V6CA 1T0FA 5D8LB 2ECBA 3E1SA 5HODA 3VFZA 1GHCA 3F8NA 4HEA2 4RM3A 2WB1N 4IXAA 3U21A 3S1MJ 5HLGA 1T98A 3GZ6A 1H89C 2H8RA 4BNCA 2K5CA 1HF0A 3F72A 5M5XJ 1RUNA 4S04A 1X1PA 4UVCA 2LVSA 1V5FA 1AU7A 5HLHA 4IHWA 1BJAA 1PVEA 1ETWA 1BOAA 1TZLA 3FZVA 3ZMUA 2H1KA 3L09A 4CGZA 2CU7A 3GTQJ 3CJTB 3IWFA 1D1CA 3SXYA 3WTYC 2QUFA 1Z3YA 2HQNA 1O3SA 1EH7A 3QQAA 3M4OJ 1T56A 4I0AA 1XSVA 3BR0A 5IP6A 3GMEA 5IOYA 2CYYA 2KRHA 4MO7A 4XKVA 2GIZA 3KP5A 1BC7C 2YX7A 1P6RA 2A3SA 3LSKA 2IS6A 3CUQA 3GTKJ 2WBMA 3FM5A 2PJRA 1Z9CA 2EZKA 4JX5A 1K7AA 5GTHC 2KKOA 4PJNA 4LK0F 3OL4A 3E6CC 3O8GA 1CGPA 4B43A 1EV7A 3RQ4A 1QU3A 5FLVA 1QZYA 3LQRA 4BBRJ 3QU6A 1SFUA 5EGOA 3Q0VA 2EFPA 3RKWA 2JVGA 2VKHA 2HOSA 4R1HA 1YJWI 1ETQA 4JP0A 1PDNC 1R5GA 1ZYRF 2E34A 1UHWA 1Q1VA 4KJZA 5KAFC 3WODF 2CFXA 1D5VA 2YU9J 2XV4S 1HXDA 4EMSA 2ZC2A 5LHGA 3AL0B 2DMNA 4YIRX 3D5LA 3MN2A 3MQ0A 2E5NA 3WE3A 2OCEA 2XF6A 1H9TA 3CCQI 2RAEA 1RESA 1ULYA 2LK2A 4XLPF 3I3LA 2RQPA 3ZP5A 3QYBA 3L2RA 2V9KA 3DU6A 3TW7A 4WWCA 2JMWA 2OU2A 1BR2A 4G7ZF 1IW7F 3AG2H 3W3CA 4I0BA 2DBBA 4B47A 4I09A 5B3SH 4JOMA 4MEYF 2ISZA 2LR8A 3GZNB 1ZARA 3UR3C 5KVRA 1X3UA 1WGXA 2EB7A 2LF8A 4XR6A 1T8IA 2PLYA 4XNFA 2FEZA 3OYLA 2W25A 2X6OA 3Q0UA 4LB6B 5M5WJ 2B9SA 1AA7A 2D1HA 4OAZA 1OQYA 2KL4A 1W4MA 3LSMA 3WG9A 4FCYA 2L4AA 2Y0SA 5BMZA 5F0HA 4YIIA 1D0YA 3F0CA 3ECOA 2A68F 2QGUA 4KFCA 5LHHA 1F36A 3HSEA 3IKVA 2EV6A 3BJ6A 3JRIA 2VASA 2FOWA 3DXJF 3ECHA 3LFUA 4KT5C 4IHVA 1KA8A 1VQNI 1AKHB 4GYIA 2YR2A 1HDDC 2COMA 3A2KA 1MZBA 2KZVA 3V7RA 1KQ8A 2VE8A 2RNJA 2DFEA 1OPCA 4L18B 2W00A 2M1BA 4NBQA 4CCNA 1YJ9I 5JHUA 1B59A 5LGUA 2KFDA 2W84A 3CC7I 1Z1DA 4EGZA 4C9YA 1ZRCA 3HOUJ 5FKNA 1JKQC 3CLQA 2KLOA 3HRMA 2AHQA 3GFJA 1B8IA 5IPAA 1BM9A 3OYEA 2HKXA 2HZTA 4HNUA 4LGWA 1SFEA 3DFGA 5ERIA 2R93J 2F6CA 3I59B 4Y15A 5TJJA 1XMAA 4ENJA 1GVJA 1BI3A 1X1CA 3K7AJ 4ZZDA 4MGRA 2QENA 5EDNA 3KX2A 2BVLA 4XMYA 1FZPB 1X58A 3LQQA 1W7PA 3DPTA 3A01A 5BQTA 2CFOA 9ANTA 2KRFA 4DQ2A 1TWCJ 4G12A 3W2WA 5IP9J 2DDBA 2NYXA 3E6DA 4MLOA 1FNNA 1AOYA 4OMZA 1KYWA 5C4XJ 4PSXA 2OV7A 1Z91A 3CMYA 4Y52J 3ZPLA 3QPLA 1FT9A 2A6HF 1VTNC 2MC4A 3QP5A 3OIOA 1JHFA 5KHDA 5KK1A 1Q1HA 1QVUA 3ZMZA 2KDZA 3IHUA 2B0LA 2K3PA 2E2JJ 3PJRA 3HPGA 3J7AO 2VBWA 3EETA 4QSHA 2W1OA 3LSHA 4A3DJ 3VODA 1B9NA 2PX9A 2H6CA 3GO5A 2A61A 3OIQA 4XQFA 5H6QA 2QF7A 4NUBA 2IS1A 2M87A 3ZQLA 3K2ZA 4PUSA 2E5ZA 4FT8A 3RJPA 4BHCA 3GTJJ 1MGTA 4QPOA 1U9NA 2XASA 4BE1A 1LE8A 2EIMH 5GPAA 2HFHA 3T0YA 4FX4A 2OF7A 2DTRA 3BLYA 2BGCA 4M74A 5ED4A 3Q9SA 4IHXA 2VXDA 4BE0A 4ESJA 2F4MB 4QPQA 2ME6A 3TBIA 3WU0A 1MKMA 1RI7A 2HGCA 3G73A 2M30A 3K69A 2R7UA 4HDVA 1P4WA 4IEJA 2FX0A 2VUMJ 4EQQA 2CQNA 4EEFG 2Y75A 2LKSA 5LBQA 4M9SA 5M5YJ 1HKQA 1JTXA 2PG4A 5DUIA 4A0ZA 1FSEA 4QTRA 2R7SA 3DTKA 5E1ZB 4E7KA 2XGDA 1D0XA 3GLLA 3DU5A 1R00A 1WCMJ 4LD5A 2GXAA 1SAXA 1UAAA 1TQIA 5KNLA 3IUOA 4AUXA 5HS8A 2ZSIB 1QA6A 1YRNA 1Y1VJ 1MBJA 3BZKA 1AWCA 4MEXF 5BPIA 4HF0A 1LNWA 4H0EA 3QP6A 1MBGA 5E20A 2WAQA 3ZOBA 3IH3A 5F64A 1SC7A 4XRSG 1I27A 3CZ6A 3A0HC 4II2A 4E7JA 2Y0MA 4YFXF 2E36A 2K9LA 2RGVA 3SFZA 1V5GA 4C30A 3W2VA 3CCMI 4C2TA 3DEEA 2VBYA 4Q47A 1H9GA 1ORKA 4F52A 3KYLA 3QPHA 4II3A 3GTOJ 3PSFA 4I76A 1WJ5A 2CH0A 4HF2A 2ZMEC 1F43A 1UJ8A 2I10A 2V4JC 4Y4RA 2K40A 4GYGA 1JJ8C 4KN7X 1FOXA 1LB2A 1HW5A 2XB0X 4UV9A 2MABA 4D7MA 1CF7A 3ZQIA 3CDIA 5B1AH 5FKKA 1OMIA 3PM1A 4PCQA 3UNGC 4HBLA 2VKVA 3S93A 2LBFB 5FLXZ 2A05A 2LMDA 4XN0A 5H20A 5L3BA 1GV5A 3JRAA 4ZDOA 2DQLA 1SD4A 4DZJA 2LY2A 4D1QA 1XB4A 4B4CA 3BR6A 3HL2A 2W57A 4N9HA 3VYUB 2Q2EB 4UHTA 4HDUA 1VQ5I 1QGPA 4Y17A 2FF4A 5JFRA 1FBQA 4CDGA 5BOXA 1T95A 3CF2A 4ENNA 4YG2F 3PIOF 1NHAA 3Q9VA 3BG3A 3OYDA 3ULQB 2LD5A 2O9LA 3ZR8X 4EJWA 2E19A 2EA4A 2PJRB 4NQWB 3P9IA 2IA1A 4B1RA 3TO7A 3VB2A 3S17J 3HBLA 2CRGA 4HSTA 5GAEJ 1HSTA 3BY6A 3QODA 3EUKL 3OSGA 1E2XA 4XL9A 2GLOA 3BG7A 3MZYA 1YYVA 3S14J 4P1WA 3EYIA 4I2OA 3H5NA 5GTIC 3HUGA 3K2AA 1BOBA 3X2QH 4M6VA 2R5ZA 1U5TB 1B1BA 1R23A 3I64A 5A2QZ 4M3EA 1NTCA 1LVKA 2V26A 1R6RA 2M5WA 3DKYA 2WA0A 3K0LA 4YFKF 5IYDJ 1L0OC 1I3QJ 3IRRA 5K7FA 2G9WA 4W97A 1RPWA 2ZMEA 3DTIA 5LEKA 3KLNA 2XAJA 2CUFA 1JTYA 2OAZA 4G94A 5CVRA 4DW6A 1F4KA 4LITA 3F3XA 3OYKA 3F8MA 3GVAA 3M8JA 1GXPA 3BG5A 2A6EF 3FISA 1W7PD 1WJCA 3HZJA 1KONA 2ZBKA 4XIDA 3PQJA 4CH7A 3VYTB 5CKTA 1QHGA 2E1MC 2XIGA 1IAWA 2B63J 2EWNA 4KA4A 3CMAI 2Y48A 1DUXC 3BZCA 3LA3A 2QWWA 1EJ9A 1S29A 4WF2A 2BY1A 2E1CA 5AIPA 3BOQA 3R4KA 1U3EM 4D5FA 1MW7A 2M2EA 1S7AA 5HNFA 5EYRA 5FFZA 2D5VA 2E2HJ 1XGMA 2EIKH 4XOTA 2A07F 2PMUA 2K9SA 2L4MA 3HGGA 3OR1C 3T8TA 1ZGWA 3MEXA 2EV5A 4OAYA 4ABZA 3E97A 3SYTA 1W5CC 2H94A 1R71A 4KNYA 1ZK8A 3CCSI 4AIJA 3J7YJ 1WPKA 4BY1J 4LG0B 1QRYA 3A4CA 2XF5A 2EFOA 3IV5A 2BW3B 2JUGA 4OINF 2DA5A 5AONA 3TL4X 2L02A 2QQAA 2QZ8A 5JHFA 3HSFA 4JQFA 2XAQA 1SAUA 1TW2A 4A0XA 1UFMA 2M4GA 4LIVA 1WH7A 3HOZJ 1RZ4A 4BS9A 4EM1A 5E79C 4N9IA 3QOEA 1SFXA 3K4NA 4Y33A 2IA0A 3NQOA 3L9FA 2DW4A 1AHDP 3WTZA 1MH4A 3LSTA 2BZTA 3GTMJ 3GUDA 2R7VA 4B09A 2PEXA 1Z21A 1Z7UA 4I02A 4E7IA 1PP8F 4LG3A 3K10A 3GYHX 1E3PA 2FJ1A 4BXUA 5JR3A 4P55A 3RI4A 1NH3A 1H88C 1GUUA 5IOZA 1JT6A 2LH9A 2XAFA 1Y6IA 2BY3A 1U8BA 5HNHA 4KN4X 2F5CA 2QSHX 2JA7J 5DUKA 2M8EA 1OYWA 2GQQA 3HPHA 3WHBA 5CLSA 2LNBA 2X0LA 2NOJB 3OMYA 2D2WA 1O3RA 1OCTC 4OIQF 1WQ2A 2L7ZA 3B73A 4LIUA 2EIJH 3PIPF 3HXLA 2ETHA 3FWEA 1A6QA 2GAUA 1FOWA 1X1AA 2HTSA 1IN8A 4CCMA 2ICWG 1IDYA 3JW4A 5J8CA 1Z7LA 2LKPA 4MTDA 4XLHA 4I01A 3SQNA 4BH9A 1S9HA 1T0FC 4GDFA 5E3NA 2H09A 5EEAA 2FQ4A 4MTEA 1H0MA 4Y3OA 5M3FJ 3L2CA 4L0ZB 1Z77A 2EFQA 1Y0NA 4MFEA 3TDZC 2PQ8A 5J47A 3C2BA 3FMRA 4BKXA 2DOAA 3VSLA 2AXLA 1VQ7I 3ASNH 4HPQA 2DT5A 4NC8A 2CW0F 2ZKZA 3NEUA 1UELB 3L2UA 1ZN2A 3ABLH 3QRFF 5JVTA 1WJFA 1YFHA 2GIVA 3S3MA 1S6LA 1L3LA 2HOEA 1IRFA 2VQLA 1LDKB 3QWLA 2HYFA 2Q8KA 1WJDA 2C6YA 3ERMA 5E3OA 3E5QA 5E17F 2E2IJ 3R6SA 1DU0A 1FY7A 3SFIA 5ICEA 1JHHA 5B5EC 4BY7J 1I6HJ 1STZA 2O0YA 1IN6A 1D8KA 4U88A 4UB6C 1LPQA 1Z0XA 3MVPA 2LREA 3ML6A 2CW7A 4JK1X 2BOLA 3WG7H 1I50J 2BY0A 1IDZA 3D5SC 1TWHJ 1N25A 1B4AA 4A3BJ 3S1QJ 3BZ6A 1LQ1A 3BP8A 1EKEA 1MJ9A 4RLQA 1ZTRA 2HDWA 2F4IA 4G6DA 1MJBA 2BY2A 3F8BA 3NWTA 2CJJA 3CCVI 2EA2A 4UUTA 4XN3A 1ZG1A 4CXFA 3DTEA 1IZ1A 2OZUA 2Y9ZA 4DZPA 2HDCA 1OJLA 2EFWA 2V1UA 5GADJ 2R7XA 3CMMA 1TNSA 2DJIA 3A0BC 4YIFA 1VQLI 2CUEA 4MFDA 1FWZA 2HTJA 2P0WA 4NC7A 5DD4A 1MJAA 3GTPJ 2COBA 2DFHA 4AM3A 4BU2A 1ON2A 5CPRB 2PBIA 2IS2A 3A03A 3Q3SA 5IY5H 1P4XA 3GEZA 4WK8F 2VE9A 3MKYB 1JXSA 1FOYA 3ZGKA 1YQAA 3AAFA 2F5DA 3FIWA 3HOVJ 3KP7A 4UUSB 5D4SA 5IT3A 3L2VA 5E1XA 3JAMZ 1MIJA 2Y0SN 4RGXA 3BT9A 4MQ9F 1QZZA 2BXZA 4DOZA 2LFBA 2M0MA 3VEPA 2JZYA 3RKYA 1IXSB 2R7FA 1D3YA 1KGSA 1VI0A 1XPXA 3N4MA 2LTPA 1J7KA 1WJEA 4BYYA 3KEYA 4M72A 5DTDA 2F4OB 4PFOA 1K61A 1U8RA 2MC3A 2H6BA 3PFIA 5FB2A 4KISA 1SMTA 2TRTA 5GPCA 1T6SA 2RV8A 2DK5A 1UG2A 3O3KA 2ZJQF 4IQJA 1K83J 2AO9A 2KIMA 2HQ5A 4CCOA 1N75A 1FP2A 3I4MJ 1ZKGA 2CUZA 3QYFA 2VBZA 3HGYA 4XONA 1O3TA 1QNTA 2GXBA 2ZCWA 3RPUA 1SVOA 3JSPA 2FSWA 4BQQA 1VFCA 2L9SA 1LDJA 5EEHA 1ETOA 1YOVB 2HQAA 2GXGA 4NB5A 3HRSA 4PJLA 4N4OB 2FE3A 4E7ZA 3GF2A 3V42A 4F7ZA 1KQ9A 5LHIA 4ETSA 2XSJC 1R5ID 2QQ9A 2G7HA 2HNHA 1FC3A 1OFCX 2DLLA 1P92A 3VOEA 3GLXA 1FSHA 3OS0A 5D5XB 1QHHD 2IP2A 2O3FA 2YSRA 1XDUA 1YG2A 2DA7A 2EV0A 1QPIA 1E0EA 2P5KA 4LOCA 2K7LA 2LLKA 4HW0A 1OCZH 3OYCA 1BIBA 3CC2I 3RKQA 1OCOH 1K4TA 1Z6RA 4BXXJ 5C44J 2ISYA 1KU9A 3OYAA 3BJOA 4KUMA 3HRTA 5DDGA 2DFFA 1N78A 4A5NA 2EQRA 3LA7A 3VSKA 1B72A 3ZMVA 3F6VA 1ERDA 4LMYA 3ABUA 4AIKA 2J5PA 3FK7A 1WHUA 2DK8A 2R92J 3H92A 4E4HA 3BG9A 4ZYHA 4BAYA 1SFOJ 4M6XA 2DMPA 5JVGF 3M07A 5EG0A 1VQ4I 4AVZA 2JJ7A 1W1WE 3DV8A 4FASD 2JA8J 4F3QA 1DP3A 2P6TA 3COAC 1Y1WJ 2WAFA 3OIPA 4G6TB 4MIMA 4RLFA 4M9XA 1MNDA 2DQRA 3C2HA 5DCMA 4M71A 3KZYA 1IJWC 1ETXA 1NG7A 1FYKA 4BEHB 5E8GA 2PJPA 2GA1A 1F5TA 3SHFA 2Z16A 3KFWX 5FD5A 2ZXJA 2B7EA 4M6YA 2XSDC 1V55H 2ESNA 3OYGA 2FU4A 1JI8A 3QYEA 3J80K 2AQEA 4CYCB 1ZG5A 1TQPA 4IHTA 2X48A 5F04A 3BR2A 4ESFA 2IGOA 3IH2A 4G7OF 3FKJA 2LG4A 3U9GA 3FXJA 4ON0A 2O7OA 3K1PA 5FD6A 1WKMA 3T5XA 3I4NJ 1EH6A 4HAMA 1YO5C 3BR1A 2M7AA 2RC4A 1XTAA 3RQIA 2QYOA 2R7ZJ 3KYDB 4ZH4F 3OYBA 1I5ZA 4ZZLA 3CCJI 4DJAA 2H1LA 2VJ4A 3RYRA 1U78A 2XUBA 3FHZA 4A3GJ 2WAQN 2R3SA 2VL8A 2DYSH 1EF4A 3RYPA 3I58A 2D1VA 3ZCOA 1IN4A 1R7JA 1R1VA 4BHPA 3P9KA 5BPDA 1ZQ3P 2IT0A 4OMYA 4XLFA 4F92B 3CDHA 2RREA 4R8HA 2CV0A 1R5HA 4HRIA 4I98B 3ZMSA 3FXRA 5IYCJ 1XS9A 3PO3J 4GRIA 5IP7J 3FM3A 5ILSA 3E5XA 2HKOA 3H9QA 1TL8A 2AXTC 3CJRB 1YX5A 3CDLA 3IAM2 2R7QA 2A69F 5FFXA 3V7SA 4UV8A 1I3AA 2VPRA 4UVAA 5K5OA 2E1MB 5FLXK 2KP6A 2M3AA 5CVUA 5L3GA 2Y69H 2ID6A 1XGSA 1T2KA 3JRCA 3H9JA 2DDAA 1K4SA 2DO7A 4A6EA 1H8AC 3H5RA 3HC7A 1BIAA 2OPTA 4M3GA 1RIOH 4K2EA 3CCLI 5L3DA 4IQ4A 2PFBA 3K4JA 4BHBA 1TW3A 3DLLF 2N8GA 2RN7A 2VKDA 4A0YA 5F0CA 5K1YA 2CQ7A 3RPQA 3GTLJ 5CQGA 3N05A 2JN6A 4EM0B 2HZDA 1QPMA 4E7LA 1XGOA 1IO2A 3A1YA 2X9DA 3TDUC 3GTGJ 1TBXA 3BCAA 4ZTFA 2FMYA 1XCVA 3LAPA 1IV8A 1MSFC 2VLAA 4A93J 2L9VA 2MA3A 3QAHA 1GVDA 3OYFA 3S1NJ 4HYEA 1J5YA 3J80Z 4KYWA 2BE5F 5CVJA 2L3DA 3PUFA 2DA6A 2LY9A 5IYBJ 1TQMA 5J1UA 1WI3A 2E1NA 3VDXA 3FDYA 2QBYA 1FBUA 2IW5A 2VT3A 2XAHA 1K78B 2L5QA 3DBHB 1LEAA 2XGXA 2R0QC 2NVXJ 1I39A 2QLZA 2OTJI 1USTA 5CYVA 3IP4B 1PUFA 4I6ZA 4CCJA 3KZZA 3CC4I 1MDMA 3ABKH 4XLNF 2RVCA 2VQGA 4AIHA 5A2QK 5LD2C 4D0PA 5DD8A 3H3VK 3E0JB 3K4CA 4XKBA 5K5RA 2ZJRF 3GX4X 3K9TA 1ETKA 2ZXIA 4DIQA 3H1CA 4YEJA 2BYVE 3KP2A 3M1EA 1X3WB 4DYQA 5B66C 1JUPA 3WTUC 1MBEA 3LSRA 2HI3A 1TLHB 4E70A 5EF6A 3BWGA 3ELKA 4Q4ZF 3I53A 1X1DA 5LGTA 1K6YA 1MBFA 1HA8A 4IRGA 3S16J 5J6XA 1WVRA 4EJTA 1G2HA 3RPUD 1G3SA 5J4VA 1KYZA 4IJAA 3HM5A 4JBAA 4HZFA 2MBFA 1FPQA 3G6EI 4B8XA 1KU3A 5LRRA 3GFLA 2FBIA 3DQVC 3I55I 2ZNYA 2FD5A 1J2XA 1TTYA 4EVIA 5AIQA 2V9PA 3K1MA 5E3MA 4Z2YA 2VI6A 5EJCA 4A3KJ 4WXCA 3TO6A 2GA2A 3ZN1A 3T8RA 3MZ8A 3RDIA 1LDDA 1ZRDA 3WHCA 3EUAA 1IN7A 4BQOA 3LSPA 4P5OA 4XLAA 4BQAA 4B3AA 5L3FA 4PDKA 2O61A 2YU3A 3E6BA 3BC8A 2KQRA 3DPUA 5HLIA 3IC7A 4U7BA 2KPMA 4BDZA 2DPDA 4RM2A 1O3QA 3FXUA 5BNGA 1YE9A 4A3EJ 4M9ZA 4XORA 5HOOA 2AQFA 1IC8A 2A6TA 1V5EA 3H9GA 4U7DA 1YS6A 4A5MA 3PFYA 4J19A 1UMQA 1JKOC 2KJCA 1NG6A 3CUQB 3TOAA 1XGNA 3J7AY 4RAFA 3CCYA 2ELKA 5F08A 3FF5A 4RGUA 1EH8A 3C3WA 3JTHA 3NWSA 3PSIA 2I5UA 1Y8QB 2ZSHB 2Z99A 2QSFX 4OU0A 4Y13A 4CO8A 3U1DA 2WV0A 2P8TA 2F48A 1FP1D 5FKOA 2IBDA 2LYCA 3OR2C 5K7ZA 5EGOB 3N97A 2PMZA 1MNEA 2IAIA 3BDDA 4S05A 2DTZA 4IOAF 2NRAC 4I7HA 4CCKA 4LLNA 3R0JA 4HG2A 2O8KA 3HKZA 5JLWA 2VBXA 4HV5A 1LFBA 3H0DA 4TV7A 2HOAA 1T39A 3S15J 1FYMA 1ZH5A 4GCVA 1MMNA 4OIRF 3RZDJ 2EZIA 3OV8A 4EJVA 1YS7A 2LC2A 3U1KA 1WWXA 4HX8A 5ILVA 2XGEA 5DCFA 6PAXA 1XMXA 3ERED 1P7JA 5FRMA 4F55A 2J5OA 1JE8A 4H4KC 2FOKA 5HS9A 4EM2A 2W82A 1S5LC 2CQQA 3F21A 1O4XA 3WTTC 4HNTA 3W2AA 3BCBA 2Z1DA 3MKWB 3ZRGA 3K1NA 4IHYA 3HTSB 1MSEC 4A3JJ 3BQYA 3MD2A 1FMVA 4M73A 3OOUA 5F27A 1O7FA 5LEJA 2CSOA 4IRHA 3ZXSA 4IKFA 2MYSA 3O6BB 3HOYJ 4S0HB 1G6NA 4HOBA 1MBHA 3BR3A 4WXHA 2DOEA 2XC7A 2R7WA 2Y31A 2YPRA 4QWQA 3KETA 2E35A 3JR9A 3OYJA 2QCOA 3RTRA 4D9JA 1USSA 4AYBN 2EJRA 3CP2A 1MH3A 3IAS2 1AKHA 3WTWC 4QIWN 3W6VA 3ESWB 3HOWJ 2JA5J 1IXCA 3CCRI 1OCCH 4CICA 2P6SA 4RAZA 1JUSA 1DDNA 2KHMA 1IN5A 5BS6A 4M3BA 4PK4A 1ZG3A 2NVYJ 2Y30A 3U2RA 2EBIA 1RETA 1IUFA 1T08B 1UCRA 2R7DA 3GBGA 4CUGA 1B8IB 2HQRA 2P7CB 5KCMA 1ZGAA 3GWZA 4DYCA 2HU9A 4OOIA 1BR1A 5FROA 4O6JA 2HXIA 3PNTA 2VJJA 3G1OA 1W36D 3QPSA 5ICFA 3I59A 3ZN0A 2K9MA 4BL0B 2VPLA 5CJ9A 3KCCA 1XSDA 1S3JA 1LJ9A 2QVOA 1X4PA 3B02A 2ZB9A 4L9JA 1A5JA 3OYHA 2LSOA 2OC6A 3CESA 2O5RA 1W7PB 3K4KA 2IJLA 3MCZA 3A01B 3DBLB 2LF7A 1S7OA 4A69C 2E71A 2A5WA 1S72I 3E7LA 2I8DA 3TKYA 4BGDA 3CCUI 2E60A 3CO7C 4KITB 1G4DA 3KLOA 2ZJ2A 4AWXB 2FXAA 1FIPA 5K5QA 1RR7A 2D45A 2DAOA 1QQIA 2JA6J 1IGNA 5L3EA 2WY7Q 4P9UA 2M0CA 3TMOA 2DODA 4JYKA 2V9VA 4B44A 1Z67A 3JAMK 2OD5A 2H8WA 1TWGJ 2UXNA 2NS0A 3DKWA 4P9FA 4U0YA 1LEBA 4XLEA 3GXOA 4L5JA 2L01A 4UXNA 1VQKI 3E5UA 5DM6F 1KQ0A 1N77A 2KJBA 1ONVA 4CSWA 1DGWY 4R79A 1IG7A 4DBQA 2X85A 1DQUA 1LUJB 4OWRB 1QZEA 2DMTA 1LE8B 1I6XA 3BQZA 1JUMA 1I1GA 1OLTA 2O6GE 4A6DA 2ZXWH 1P9QC 5LGNA 3PL8A 4RMNA 2K85A 3MWMA 4V2FA 4OIOF 3GW2A 4AYBA 3CF5F 3ZQQA 3I9V2 3UKGA 4PZJA 1YJNI 2GOXB 2PN6A 2CGPA 5IT9Z 4FX0A 2AS5F 2CQKA 4ZJZA 4J01A 3JRGA 4IOCF 4XRFA 2NVQJ 1W0UA 3FKIJ 4RAGA 2FNAA 4D7NA 2Z5UA 4UNOA 3FX3A 3VPRA 2ACJA 4LLGF 2FMLA 2XHKA 2NNYA 3IWZA 1U9OA 1V3FA 3LMMA 4HX4A 3WTXC 1OR7A 2DA2A 1DP7P 4A12A 2XAUA 2LDUA 2VT2A 1YRNB 2CG4A 1YX3A 3L2QA 3KP6A 4HV6A 3G4SI 2KIFA 3P9CA 2M8GX 2ADUA 3HHHA 4A3FJ 5J1YA 3V8KA 5D8KB 4MQVA 1FYLA 2VOPA 3J81K 4C2MJ 1KU7A 1VQ6I 2X51A 3QPTA 2IRFG 4RA2A 5LLQA 3LNQA 3I54A 2IS4A 2NVUB 3SZTA 5CQEA 4QLCU 2QEXI 1HSJA 3WGHA 3LSIA 3VYRB 3DPLC 3F9KA 3D1NI 5LRSA 2DMQA 2LY1A 2Q1ZB 4GGGA 3T1BA 3OWTA 1ZLJA 1G3YA 3V8LA 3WU2C 5DS9A 1RKWA 3JRHA 3JSOA 3CMEI 2X4HA 3FBIB 5L3CA 4EV0A 5E18F 1TWFJ 2L7MP 2XPWA 1CF7B 3OYIA 2NOGA 1Z05A 3H3UA 1IXRC 1X3ZB 2ELHA 1E17A 3GFIA 4UUVA 2ZJPF 1ENHA 1V4RA 2LBFA 1SANA 3P5JA 4O3MA 1D1AA 1O57A 1OKRA 2V1NA 1REPC 4ENKA 4FHTA 2RNGA 1S7EA 1ACIA 3DP7A 3OYMA 3ZQGA 1UHMA 1J9IA 3CQZJ 4RBOA 2WC2A 4XKCA 2Q2EA 5K7HA 2XRNA 1WH5A 3PQKA 4WX9A 2KRCA 2EZLA 2M45A 4M3FA 3S2HJ 4M3DA 2WV1A 2JK3A 5D5UB 1XCBA 1U2WA 4DBRA 4L9TA 1WI9A 3BJAA 3KIOA 2VQCA 2Z2SB 4BBSJ 4NQWA 2V79A 2VC0A 3HJEA 3HOTA 4HLYA 2KMUA 4KDPA 2BEOA 2FRHA 2ZO4A 1JGSA 3AG4H 2XPUA 4BUPA 4ANJA 3KZIC 5TGTA 3OOPA 2DA1A 2DXIA 3PNYA 4CA0A 4I99C 3ZQHA 2K9NA 3JREA 1SD6A 3OS2A 4HX7A 3DWLE 3HUGB 4ZYEA 3PO2J 5DEQA 2RDPA 1OISA 2UWMA 3OL3A 2R5ZB 1BL0A 4JX4A 3MMYB 2MH9A 4L5EA 1U5TA 4YRVA 1FJLA 2VB6A 4C3HJ 3IRQA 3EDPA 2IGKA 3S2WA 3WGIA 2GZWA 4IRIA 3G3ZA 3J81Z 3FXQA 4E7HA 2WTEA 4U87A 2W7NA 1Z6TA 2G7UA 1HKSA 3E3VA 2HWVA 2HOTA 5J1RA 3RSNA 2ZMEB 3REOA 1TT0A 5DV5A 3S3NA 3FHNA 1XC5A 4AU7A 4RS8A 1R9TJ 2X6YA 2E7WA 4JX6A 5F0FA 3WE2A 3CCEI 4ZC3A 4BJ6C 3S1RJ 3HOXJ 1JGGA 3EQLF 2JUCA 3EPZA 4ZYAA 5EEGA 1OCRH 3WTVC 1DPUA 2UZKA 2OCCH 1BA5A 1SVLA 1DPRA 3GFMA 1ZR2A 3KEQA 1G3TA 3TEDA 2VKEA 1PJRA 5FKLA 2XAGA 5D5VB 1ETYA 1PYVA 1HW1A 2WB1A 1BI1A 2YS9A 2OUMA 4ZDPA 2QM3A 1Y56A 1MMAA 4C2UA 5CVIA 4CCLA 3LL7A 4UY8I 2GOMA 1VQMI 4KMFA 3ZMDA 1ZREA 2ELJA 3FXKA 1IRGA 4LJZF 3H0GJ 3NAUA 2WWYA 1UZCA 3ZQFA 3S3OA 2MFZA 1RUOA 2FBKA 4IHSA 1D5YA 2JSPA 3BTIA 3BPVA 1W36C 4UVBA 1YTYA 4LG0A 2VQHA 4XM3A 3TP3A 3AKZA 3AG1H 2BW3A 2MLGA 2O03A 1G3WA 1SMYF 2DFIA 4GFBA 4FQGA 3C2GA 2X6XA 3TGNA 2EFNA 3L1PA 1VQ9I 3V8JA 1U0JA 4KICA 4HA8A 3BPXA 5ILUA 1QBJA 2UUZA 1RKTA 2VC1A 3K4BA 4G6QA 2VN2A 3FK6A 4HSRA 2V1XA 4GO1A 5JLXA 3HIFA 4CYDA 4LK1F 1BW6A 2MH2A 2IA2A 2LKXA 3M8EA 4EATA 3NRVA 2IEKA 3CJNA 3V7CA 1BR4A 4C3JJ 3PNVA 4AVPA 3LWFA 5EZGA 4A2UA 4WCGA 1IUYA 1CQTA 4F91B 1BBYA 1R36A 1ZGJA 3SJMA 5J40A 3SZPA 2EZHA 3AFHA 2BBYA 4XOPA 1YLFA 5B1BH 4NC6A 2HPMA 2HYGD 3H5AA 2CS3A 2JTVA 4J00A 4XKWA 3Q0WA 3ROUA 5M3MJ 5J8FA 4ESBA 1BC8C 5GAGJ 1RR8C 1YW8A 3ONQA 3KP3A 4B48A 2V7FA 3K70D 1OYYA 4YELA 4E7SA 3JCUC 1J0RA 2X1EA 1D1BA 1PUEE 2QSGX 2W85A 2A5YB 4L9NA 3CLOA 2ECCA 4RB0A 2XDVA 2K4BA 3I5UA 1R4MB 1W0TA 5CVVA 4L5IA 2FUG2 2M7BA 2FQ3A 3E6MA 3HEFA 2MG4A 4W1UA 3WGGA 4BE2A 1XMKA 4V19K 3M8FA 3DEWA 2CUJA 2L54A 5F6FA 4KMUX 2KISA 1JKPC 1X19A 2DT6A 2QKMB 3TP0A 3Q5FA 4FE4A 3HTUA 5HDKA 1BI2A 4XRMA 5ICGA 1XDSA 1HKTA 1XN7A 2HVSA 2ME0A 2OTLI 4BACA 1ZLKA 4U0VA 2H27A 2HR3A 2L0KA 4WXDA 2R5YA 2VJIA 3DCFA 1GXQA 1X1BA 4ZDLA 3BROA 2E1OA 1J59A 3RIRA 1G8XA 5H2FC 2Z9OA 2R7TA 3DLAA 3SEQA 3L00A 4IX7A 1A6IA 3QOPA 1M1EB 3O8HA 1Z3XA 3V4GA 1IF1A 4Y7NJ 2NS8A 4NNJA 2XB5A 2DI3A 4X1EA 2JRTA 2M4KA 5GP9A 3ZQCA 1SD7A 2DOFA 2OQGA 1RNLA 1BJZA 2CV2A 2PMZN 2W4SA 5C3EJ 1E3OC 1ODDA 1KZHA 2P81A 4BDYA 1D0ZA 1MD0A 2EH3A 2NAZA 2ZNZA 3M3YJ 1O7LA 1F9NA 3HKZN 4KT6A 5HS7A 1R1TA 2MW8A 5E1WA 2DPUA 4O5VA 2DN0A 4CHUA 2ESHA 4RGSA 1UB9A 2MD5A 4BQNA 1A31A 3BR5A 1G59A 4IL6C 2KIQA 4KIBA 2M9HA 1Y39A 1R22A 3FBNB 3K4MA 1XSXA 1ZR4A 3F8CA 1FLIA 2XKPA 3AL0C 2F5VA 1TP4A 5TISC 2QA4I 5J4YA 5FLMJ 1APLC 1ZAOA 2MSYA 1A36A 3JRBA 3SZGA 3S2DJ 1POGA 2E7XA 2X1DA 1IV6A 1J75A 2ZFWA 1FX7A 2YUSA 5D4RA 1ITYA 4IF4A 1R1UA 4IPAA 4U0WA 1FIAA 1LKXA 2W24A 3C1DA 4XK4A 4E6KG 2HEOA 2EILH 3A02A 4D5CA 3MZHA 2ZFUA 3CTAA 4UB8C 3HYIA 1Y8RB 2JWTA 4UUSA 3TOBA 1IRXA 1ETVA 2VIXA 5E3LA 4CZZA 3SDGA 5HLTA 4HQEA 2OQRA 2WADA 1SFKA 3DKXA 3RKXA 1VF9A 4PGHA 1YIJI 4HNVA 2K27A 2PI0A 3H36A 2XRLA 3M9AA 3LAJA 2K02A 4IZZA 3I56I 1WRJA 2F5FA 2JSCA 1TNTA 3MAJA 1GLNA 2F2EA 2EK5A 2HVQA 2PMHA 2CW8A 5J3LA 4ASNA 4EJUA 1U6GA 1WZ2A 3TW6A 3EYYA 1YI2I 2WAEA 3C7JA 3JRFA 1DGRM 3OY9A 1PP7U 4DYRA 1HLVA 2FA5A 2IVMA 2Y2ZA 4IVNA 4BJ5C 1HQCA 2RQQA 4FETA 3EUHC 4BXFA 4F93B 3I71A 2KT0A 5FO5A 2WY8Q 3C18A 2Q0OA 5GAHJ 1GT0C 1V54H 1K6OA 3IL2A 1NK3P 4XRSA 1MNMC 1P4AA 4AIDA 3MKLA 2MD0A 2MLKA 2Y9YA 2TCTA 2JT1A 1YW7A 2EPFA 2CQXA 1QVTA 2R4GA 3G1LA 2Z33A 1B9MA 1HBXG 4AC0A 3DBRB 2L9RA 2UXXA 3SDBA 4C3IJ 3F22A 3F8FA 2JQ7A 4Q48A 3P7NA 1BW5A 2V1DA 3HSRA 1ON1A 1WJBA 3HRUA 3OYNA 3FMSA 2G0EA 4LLLA 4A3MJ 2P7VB 2KDOA 3HOSA 2HPIA 1R58A 2XPVA 4L0YB 3R0AA 4Z6YA 2VXZA 2W48A 2IGNA 1B6AA 3OSFA 3L7WA 3B6AA 1BN5A 1GV2A 3R60A 2EINH 1X2MA 2FBHA 4MNUA 5JI6A 2QQBA 1SEUA 1R49A 2YX4A 1EA3A 2NVTJ 1MMGA 1A04A 2IGMA 2DU9A 1RRJA 1B72B 1DU6A 2P5LC 1YW9A 1TWAJ 1HW2A 2LRDA
chains in the Genus database with same CATH topology
1JTXA 1MBKA 1NK2P 4QTRA 3FK7A 2R92J 1U9OA 2XGDA 1WCMJ 3BG9A 1SFOJ 2DA2A 2DMPA 5EG0B 5EG0A 4AUXA 2JJ7A 1YRNB 1YRNA 1Y1VJ 1MBJA 2JA8J 1Y1WJ 1FTTA 3BTCA 2M34A 3LSJA 4MIMA 1MBGA 2M8GX 1T33A 3ZOBA 1IJWC 1ETXA 5J1YA 3IH3A 4A3FJ 4XRSG 4C2MJ 3LNQA 2XSDC 2LP0A 3IH4A 5FJ8J 4CYCB 1ORKA 4CYCA 2X48A 5F04A 3BR2A 3NARA 3GTOJ 3D1NI 3IH2A 4I76A 2DMQA 1JT0A 3JRHA 5DS9A 1RKWA 2O7OA 1F43A 1OCPA 2I10A 2K40A 1JJ8C 3I4NJ 4V2GA 1TWFJ 2XB0X 2DJNA 2L7MP 2XPWA 1HCRA 3BR1A 1FEXA 4D7MA 2NOGA 3ZQIA 3RQIA 5FKKA 2R7ZJ 3PM1A 1XG1A 2GM4A 2VKVA 1ENHA 1SANA 1GV5A 3JRAA 1U78A 4A3GJ 2WAQN 4DZJA 1X2NA 1EF4A 1S7EA 4B4CA 3BR6A 1ZQ3P 3ZQGA 3CQZJ 4RBOA 5FKMA 5K7HA 2GBYA 2DMUA 5IYCJ 1WH5A 3JRDA 1XS9A 2EZLA 2NS7A 3PO3J 4M3FA 3S2HJ 5IP7J 3BG3A 4M3DA 2WV1A 2JK3A 1GDTA 3CDLA 4XICA 2LD5A 2O9LA 2E19A 4BBSJ 3BTLA 1HDPA 3G1MA 4B1RA 3BTJA 3S17J 2VPRA 4A3IJ 3HBLA 2CRGA 2XPUA 3B6CA 2ID6A 2DA1A 5F1JA 3OSGA 2GLOA 3JRCA 3ZQHA 3JREA 2K9NA 1H8AC 3S14J 1IRZA 2OPTA 4M3GA 3PO2J 3K2AA 4RDUA 2N8GA 4M6VA 2R5ZB 5F0CA 2R5ZA 1BL0A 3GTLJ 1P7IA 4JX4A 4L5EA 2JN6A 4M3EA 1NTCA 1FJLA 4C3HJ 2L7FP 2X9DA 5IYDJ 5C4JJ 3GTGJ 1I3QJ 5K7FA 1MSFC 2HOTA 4W97A 2R5YB 5J1RA 4A93J 1GVDA 3S1NJ 1RPWA 2K9QA 1XC5A 2CUFA 1HOMA 2DA4A 1JTYA 4DW6A 1R9TJ 2DA6A 2LY9A 4JX6A 5F0FA 5IYBJ 5J1UA 3S1RJ 1WI3A 3HOXJ 1JGGA 2DA3A 3BG5A 3FISA 2HYJA 1UHSA 4XIDA 2R0QC 3HDDA 2NVXJ 1BA5A 1ZR2A 2B63J 3TEDA 1PUFB 2VKEA 5FKLA 1PUFA 4I6ZA 1ETYA 2XGCA 4X6AJ 1FTZA 1LFUP 3H3VK 2YS9A 4D5FA 2M2EA 2D5VA 5EYRA 2E2HJ 3LSGA 1ETKA 1JJ6C 3HB9A 2K9SA 3HGGA 4DYQA 1JUPA 1MBEA 3NAUA 3H0GJ 3LSRA 5EZHA 2HI3A 1ZGWA 4ABZA 1JKRC 3ZQFA 4FTHA 4A3LJ 5EF6A 4A3CJ 1TC3C 2HDDA 1ZK8A 1WPKA 1D5YA 1MBFA 3BTIA 4BY1J 3S16J 1QRYA 3TP3A 3IV5A 2HXOA 1G2HA 2DA5A 4FISA 4GFBA 2MGQA 3L1PA 3HM5A 3LOCA 1RKTA 3RZOJ 3FK6A 1WH7A 3HOZJ 5JLXA 2FD5A 1VNDA 2ID3A 4NDLA 4FE7A 5HODA 2ECBA 5E3MA 2VI6A 4A3KJ 1BW6A 2WB1N 3S1MJ 1H89C 2H8RA 2LKXA 1AHDP 1MH4A 1HF0A 5M5XJ 2IEKA 3GTMJ 2LVSA 1AU7A 4IHWA 4C3JJ 3WHCA 3LSPA 1ETWA 2H1KA 4B3AA 5EZGA 1CQTA 2CU7A 3GTQJ 2FJ1A 3SJMA 2EZHA 1H88C 1GUUA 5IOZA 1JT6A 1U8BA 5BNGA 4A3EJ 3QQAA 3M4OJ 1T56A 2JA7J 3BR0A 5IP6A 1IC8A 5IOYA 3Q0WA 3WHBA 4MO7A 5M3MJ 4J19A 1UMQA 1JKOC 1OCTC 3GTKJ 2L7ZA 3CCYA 2ELKA 2EZKA 4JX5A 5F08A 1IDYA 3O8GA 2ECCA 1W0TA 5FLVA 5E3NA 5FKOA 4BBRJ 2IBDA 3HEFA 2MG4A 4W1UA 5K7ZA 5EGOB 5EGOA 5EEAA 3Q0VA 2IAIA 3DEWA 2FQ4A 2DTZA 2HOSA 5M3FJ 1JKPC 1ETQA 4JP0A 3TP0A 2O8KA 1Z77A 5JLWA 1LFBA 4MFEA 1Q1VA 4FE4A 2HOAA 4XRMA 3C2BA 4BKXA 3S15J 2ME0A 2YU9J 3RZDJ 2L0KA 2R5YA 2EZIA 2DMNA 3MN2A 3DCFA 2E1OA 2RAEA 1RESA 2XGEA 2LK2A 1P7JA 1A6IA 3TW7A 3O8HA 2JMWA 4Y7NJ 2NS8A 5E3OA 2E2IJ 2XB5A 4X1EA 1DU0A 3SFIA 5GP9A 2CQQA 4BY7J 3ZQCA 1O4XA 1I6HJ 2LR8A 1BJZA 2PMZN 1Z0XA 3MVPA 4IHYA 5C3EJ 1MSEC 1E3OC 4A3JJ 2P81A 1WGXA 1I50J 3BQYA 2EH3A 1IDZA 3M3YJ 3Q0UA 2X6OA 3HKZN 3OOUA 5F27A 1TWHJ 5M5WJ 4A3BJ 2MW8A 2DN0A 4FCYA 3S1QJ 3HOYJ 4S0HB 5F0HA 1ZTRA 3BR5A 3F0CA 1MBHA 3BR3A 2M9HA 2CJJA 1F36A 2Y31A 4UUTA 3JRIA 3JR9A 1ZR4A 2Y9ZA 4DZPA 2QCOA 4IHVA 1OJLA 4AYBN 1AKHB 1MH3A 1HDDC 1AKHA 4QIWN 3W6VA 5FLMJ 3HOWJ 2JA5J 1APLC 2CUEA 2MSYA 4MFDA 1JUSA 3JRBA 3GTPJ 2COBA 4M3BA 1POGA 3S2DJ 1IV6A 2NVYJ 2Y30A 2EBIA 3A03A 1RETA 2YUSA 3Q3SA 1IUFA 3GBGA 3HOUJ 1ITYA 5FKNA 1JKQC 1FIAA 1B8IB 1B8IA 2AHQA 4XK4A 4DYCA 3A02A 4D5CA 5IPAA 3FIWA 2HXIA 3G1OA 3QPSA 3HOVJ 4UUSB 2R93J 2JWTA 4UUSA 1ETVA 5E3LA 2Y0SN 3SDGA 3BT9A 3K7AJ 2LFBA 5EDNA 2ZB9A 1VF9A 1A5JA 1X58A 4HNVA 3A01B 3A01A 2XRLA 1VI0A 4A69C 9ANTA 2LTPA 3E7LA 5J3LA 1TWCJ 4G12A 5IP9J 5DTDA 3TW6A 3JRFA 1K61A 4MLOA 4DYRA 1HLVA 2TRTA 5GPCA 5C4XJ 2Y2ZA 1FIPA 1UG2A 3CMYA 1K83J 1RR7A 2AO9A 4Y52J 3QPLA 2HQ5A 2JA6J 1IGNA 2KT0A 3OIOA 2M0CA 1QVUA 2KDZA 4JYKA 3I4MJ 1ZKGA 1GT0C 2E2JJ 3HGYA 1TWGJ 1NK3P 4QSHA 4XRSA 1MNMC 3MKLA 4A3DJ 2Y9YA 2TCTA 1VFCA 2CQXA 1QVTA 3G1LA 1ETOA 4AC0A 2L9RA 4C3IJ 2QF7A 3ZQLA 1IG7A 1BW5A 3GTJJ 2DMTA 1OFCX 1U9NA 2G0EA 1JUMA 3BQZA 1LE8B 1LE8A 4A3MJ 5GPAA 2DA7A 1QPIA 2OF7A 4LOCA 4V2FA 2XPVA 4IHXA 2LLKA 2ME6A 3UKGA 2W48A 3RKQA 3OSFA 4BXXJ 5C44J 3B6AA 1GV2A 1X2MA 3JRGA 2NVTJ 4IEJA 2FX0A 1W0UA 2EQRA 2NVQJ 3FKIJ 1B72B 2VUMJ 1DU6A 1B72A 4EEFG 4D7NA 5M5YJ 1TWAJ 3VPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTX A;  1MBK A;  1NK2 P;  4QTR A;  3FK7 A;  2R92 J;  1U9O A;  2XGD A;  1WCM J;  3BG9 A;  1SFO J;  2DA2 A;  2DMP A;  5EG0 B;  5EG0 A;  4AUX A;  2JJ7 A;  1YRN B;  1YRN A;  1Y1V J;  1MBJ A;  2JA8 J;  1Y1W J;  1FTT A;  3BTC A;  2M34 A;  3LSJ A;  4MIM A;  1MBG A;  2M8G X;  1T33 A;  3ZOB A;  1IJW C;  1ETX A;  5J1Y A;  3IH3 A;  4A3F J;  4XRS G;  4C2M J;  3LNQ A;  2XSD C;  2LP0 A;  3IH4 A;  5FJ8 J;  4CYC B;  1ORK A;  4CYC A;  2X48 A;  5F04 A;  3BR2 A;  3NAR A;  3GTO J;  3D1N I;  3IH2 A;  4I76 A;  2DMQ A;  1JT0 A;  3JRH A;  5DS9 A;  1RKW A;  2O7O A;  1F43 A;  1OCP A;  2I10 A;  2K40 A;  1JJ8 C;  3I4N J;  4V2G A;  1TWF J;  2XB0 X;  2DJN A;  2L7M P;  2XPW A;  1HCR A;  3BR1 A;  1FEX A;  4D7M A;  2NOG A;  3ZQI A;  3RQI A;  5FKK A;  2R7Z J;  3PM1 A;  1XG1 A;  2GM4 A;  2VKV A;  1ENH A;  1SAN A;  1GV5 A;  3JRA A;  1U78 A;  4A3G J;  2WAQ N;  4DZJ A;  1X2N A;  1EF4 A;  1S7E A;  4B4C A;  3BR6 A;  1ZQ3 P;  3ZQG A;  3CQZ J;  4RBO A;  5FKM A;  5K7H A;  2GBY A;  2DMU A;  5IYC J;  1WH5 A;  3JRD A;  1XS9 A;  2EZL A;  2NS7 A;  3PO3 J;  4M3F A;  3S2H J;  5IP7 J;  3BG3 A;  4M3D A;  2WV1 A;  2JK3 A;  1GDT A;  3CDL A;  4XIC A;  2LD5 A;  2O9L A;  2E19 A;  4BBS J;  3BTL A;  1HDP A;  3G1M A;  4B1R A;  3BTJ A;  3S17 J;  2VPR A;  4A3I J;  3HBL A;  2CRG A;  2XPU A;  3B6C A;  2ID6 A;  2DA1 A;  5F1J A;  3OSG A;  2GLO A;  3JRC A;  3ZQH A;  3JRE A;  2K9N A;  1H8A C;  3S14 J;  1IRZ A;  2OPT A;  4M3G A;  3PO2 J;  3K2A A;  4RDU A;  2N8G A;  4M6V A;  2R5Z B;  5F0C A;  2R5Z A;  1BL0 A;  3GTL J;  1P7I A;  4JX4 A;  4L5E A;  2JN6 A;  4M3E A;  1NTC A;  1FJL A;  4C3H J;  2L7F P;  2X9D A;  5IYD J;  5C4J J;  3GTG J;  1I3Q J;  5K7F A;  1MSF C;  2HOT A;  4W97 A;  2R5Y B;  5J1R A;  4A93 J;  1GVD A;  3S1N J;  1RPW A;  2K9Q A;  1XC5 A;  2CUF A;  1HOM A;  2DA4 A;  1JTY A;  4DW6 A;  1R9T J;  2DA6 A;  2LY9 A;  4JX6 A;  5F0F A;  5IYB J;  5J1U A;  3S1R J;  1WI3 A;  3HOX J;  1JGG A;  2DA3 A;  3BG5 A;  3FIS A;  2HYJ A;  1UHS A;  4XID A;  2R0Q C;  3HDD A;  2NVX J;  1BA5 A;  1ZR2 A;  2B63 J;  3TED A;  1PUF B;  2VKE A;  5FKL A;  1PUF A;  4I6Z A;  1ETY A;  2XGC A;  4X6A J;  1FTZ A;  1LFU P;  3H3V K;  2YS9 A;  4D5F A;  2M2E A;  2D5V A;  5EYR A;  2E2H J;  3LSG A;  1ETK A;  1JJ6 C;  3HB9 A;  2K9S A;  3HGG A;  4DYQ A;  1JUP A;  1MBE A;  3NAU A;  3H0G J;  3LSR A;  5EZH A;  2HI3 A;  1ZGW A;  4ABZ A;  1JKR C;  3ZQF A;  4FTH A;  4A3L J;  5EF6 A;  4A3C J;  1TC3 C;  2HDD A;  1ZK8 A;  1WPK A;  1D5Y A;  1MBF A;  3BTI A;  4BY1 J;  3S16 J;  1QRY A;  3TP3 A;  3IV5 A;  2HXO A;  1G2H A;  2DA5 A;  4FIS A;  4GFB A;  2MGQ A;  3L1P A;  3HM5 A;  3LOC A;  1RKT A;  3RZO J;  3FK6 A;  1WH7 A;  3HOZ J;  5JLX A;  2FD5 A;  1VND A;  2ID3 A;  4NDL A;  4FE7 A;  5HOD A;  2ECB A;  5E3M A;  2VI6 A;  4A3K J;  1BW6 A;  2WB1 N;  3S1M J;  1H89 C;  2H8R A;  2LKX A;  1AHD P;  1MH4 A;  1HF0 A;  5M5X J;  2IEK A;  3GTM J;  2LVS A;  1AU7 A;  4IHW A;  4C3J J;  3WHC A;  3LSP A;  1ETW A;  2H1K A;  4B3A A;  5EZG A;  1CQT A;  2CU7 A;  3GTQ J;  2FJ1 A;  3SJM A;  2EZH A;  1H88 C;  1GUU A;  5IOZ A;  1JT6 A;  1U8B A;  5BNG A;  4A3E J;  3QQA A;  3M4O J;  1T56 A;  2JA7 J;  3BR0 A;  5IP6 A;  1IC8 A;  5IOY A;  3Q0W A;  3WHB A;  4MO7 A;  5M3M J;  4J19 A;  1UMQ A;  1JKO C;  1OCT C;  3GTK J;  2L7Z A;  3CCY A;  2ELK A;  2EZK A;  4JX5 A;  5F08 A;  1IDY A;  3O8G A;  2ECC A;  1W0T A;  5FLV A;  5E3N A;  5FKO A;  4BBR J;  2IBD A;  3HEF A;  2MG4 A;  4W1U A;  5K7Z A;  5EGO B;  5EGO A;  5EEA A;  3Q0V A;  2IAI A;  3DEW A;  2FQ4 A;  2DTZ A;  2HOS A;  5M3F J;  1JKP C;  1ETQ A;  4JP0 A;  3TP0 A;  2O8K A;  1Z77 A;  5JLW A;  1LFB A;  4MFE A;  1Q1V A;  4FE4 A;  2HOA A;  4XRM A;  3C2B A;  4BKX A;  3S15 J;  2ME0 A;  2YU9 J;  3RZD J;  2L0K A;  2R5Y A;  2EZI A;  2DMN A;  3MN2 A;  3DCF A;  2E1O A;  2RAE A;  1RES A;  2XGE A;  2LK2 A;  1P7J A;  1A6I A;  3TW7 A;  3O8H A;  2JMW A;  4Y7N J;  2NS8 A;  5E3O A;  2E2I J;  2XB5 A;  4X1E A;  1DU0 A;  3SFI A;  5GP9 A;  2CQQ A;  4BY7 J;  3ZQC A;  1O4X A;  1I6H J;  2LR8 A;  1BJZ A;  2PMZ N;  1Z0X A;  3MVP A;  4IHY A;  5C3E J;  1MSE C;  1E3O C;  4A3J J;  2P81 A;  1WGX A;  1I50 J;  3BQY A;  2EH3 A;  1IDZ A;  3M3Y J;  3Q0U A;  2X6O A;  3HKZ N;  3OOU A;  5F27 A;  1TWH J;  5M5W J;  4A3B J;  2MW8 A;  2DN0 A;  4FCY A;  3S1Q J;  3HOY J;  4S0H B;  5F0H A;  1ZTR A;  3BR5 A;  3F0C A;  1MBH A;  3BR3 A;  2M9H A;  2CJJ A;  1F36 A;  2Y31 A;  4UUT A;  3JRI A;  3JR9 A;  1ZR4 A;  2Y9Z A;  4DZP A;  2QCO A;  4IHV A;  1OJL A;  4AYB N;  1AKH B;  1MH3 A;  1HDD C;  1AKH A;  4QIW N;  3W6V A;  5FLM J;  3HOW J;  2JA5 J;  1APL C;  2CUE A;  2MSY A;  4MFD A;  1JUS A;  3JRB A;  3GTP J;  2COB A;  4M3B A;  1POG A;  3S2D J;  1IV6 A;  2NVY J;  2Y30 A;  2EBI A;  3A03 A;  1RET A;  2YUS A;  3Q3S A;  1IUF A;  3GBG A;  3HOU J;  1ITY A;  5FKN A;  1JKQ C;  1FIA A;  1B8I B;  1B8I A;  2AHQ A;  4XK4 A;  4DYC A;  3A02 A;  4D5C A;  5IPA A;  3FIW A;  2HXI A;  3G1O A;  3QPS A;  3HOV J;  4UUS B;  2R93 J;  2JWT A;  4UUS A;  1ETV A;  5E3L A;  2Y0S N;  3SDG A;  3BT9 A;  3K7A J;  2LFB A;  5EDN A;  2ZB9 A;  1VF9 A;  1A5J A;  1X58 A;  4HNV A;  3A01 B;  3A01 A;  2XRL A;  1VI0 A;  4A69 C;  9ANT A;  2LTP A;  3E7L A;  5J3L A;  1TWC J;  4G12 A;  5IP9 J;  5DTD A;  3TW6 A;  3JRF A;  1K61 A;  4MLO A;  4DYR A;  1HLV A;  2TRT A;  5GPC A;  5C4X J;  2Y2Z A;  1FIP A;  1UG2 A;  3CMY A;  1K83 J;  1RR7 A;  2AO9 A;  4Y52 J;  3QPL A;  2HQ5 A;  2JA6 J;  1IGN A;  2KT0 A;  3OIO A;  2M0C A;  1QVU A;  2KDZ A;  4JYK A;  3I4M J;  1ZKG A;  1GT0 C;  2E2J J;  3HGY A;  1TWG J;  1NK3 P;  4QSH A;  4XRS A;  1MNM C;  3MKL A;  4A3D J;  2Y9Y A;  2TCT A;  1VFC A;  2CQX A;  1QVT A;  3G1L A;  1ETO A;  4AC0 A;  2L9R A;  4C3I J;  2QF7 A;  3ZQL A;  1IG7 A;  1BW5 A;  3GTJ J;  2DMT A;  1OFC X;  1U9N A;  2G0E A;  1JUM A;  3BQZ A;  1LE8 B;  1LE8 A;  4A3M J;  5GPA A;  2DA7 A;  1QPI A;  2OF7 A;  4LOC A;  4V2F A;  2XPV A;  4IHX A;  2LLK A;  2ME6 A;  3UKG A;  2W48 A;  3RKQ A;  3OSF A;  4BXX J;  5C44 J;  3B6A A;  1GV2 A;  1X2M A;  3JRG A;  2NVT J;  4IEJ A;  2FX0 A;  1W0U A;  2EQR A;  2NVQ J;  3FKI J;  1B72 B;  2VUM J;  1DU6 A;  1B72 A;  4EEF G;  4D7N A;  5M5Y J;  1TWA J;  3VPR A; 
#chains in the Genus database with same CATH topology
 1XX5 A;  3KP4 A;  4EJO A;  1MBK A;  1NK2 P;  2L2O A;  4HF1 A;  2VJ5 A;  4BJT A;  4XSX F;  4RGR A;  4Q5S F;  1X4O A;  1YIT I;  4HLX A;  5EG0 B;  3FXL A;  2XKO A;  3FXM A;  4ITV A;  4PGG A;  4ZYD A;  1FMW A;  2LOO A;  1FTT A;  3BTC A;  2Z3Y A;  3M7G A;  2M34 A;  3LSJ A;  4IO9 F;  1FBS A;  5DCM B;  2TDX A;  1W5T A;  1T33 A;  3WTS C;  4PSW A;  2R7O A;  5IT9 K;  4BEH A;  3R61 A;  2X1C A;  2VON A;  2BVM A;  3I4P A;  2R7R A;  2CWE A;  2LP0 A;  3GCM A;  1ZHF A;  2BHZ A;  2KZG A;  3IH4 A;  5FJ8 J;  3EUH A;  3KPH A;  3OS1 A;  4XBF A;  5F1R A;  4CYC A;  2BXY A;  3HHG A;  4P96 A;  3NAR A;  1SD5 A;  3KYC B;  5KAI C;  4PFP A;  1ZEL A;  1RC9 A;  4B3X A;  4LFU A;  2FNP A;  1VQO I;  1JT0 A;  1WJA A;  1HC8 A;  1OCP A;  1OYI A;  1T38 A;  4V2G A;  5FRN A;  4YFN F;  2DJN A;  1HCR A;  3DEU A;  5D5W B;  1FEX A;  5HDN A;  2DCE A;  4AD9 A;  1W5S A;  2OJE D;  1XG1 A;  2GM4 A;  3CJQ B;  2ZXH A;  1OR7 C;  3FXO A;  5E8I A;  4X0G A;  4G9Y A;  3K70 C;  2JA2 A;  2KIU A;  3ISP A;  3F23 A;  3O2P E;  4N0B A;  1A35 A;  5D6E A;  3ABT A;  1X2N A;  2HVR A;  1YIO A;  3ASO H;  1F1Z A;  2X6W A;  3PUB A;  1S8N A;  3G2B A;  4DGW B;  3KE2 A;  5FKM A;  2GBY A;  2DMU A;  2JVH A;  5FGM A;  3K4L A;  3JRD A;  2F5E A;  3QU3 A;  2RKH A;  2NS7 A;  3GZ5 A;  4RB1 A;  5TRD A;  5HDG A;  2V6E A;  1UG0 A;  2XVC A;  3FMQ A;  4KIF A;  2XF7 A;  3W6K B;  3BG6 A;  2L7K A;  3LFK A;  1GDT A;  4XIC A;  1C0W A;  4PJJ A;  1E3H A;  1SVM A;  4NHJ A;  3H35 A;  3VWB A;  5HVQ C;  3CD6 I;  3BTL A;  1HDP A;  3ABM H;  2STT A;  3G1M A;  3BTJ A;  2O8X A;  1I1S A;  4A3I J;  2GWR A;  3B6C A;  3K6G A;  5F1J A;  3ZQ7 A;  1VQP I;  1MMS A;  5H6R A;  3KEO A;  4LB5 A;  1QO0 D;  1IRZ A;  2CV1 A;  2NXN B;  3WU1 B;  3D0S A;  5ICC A;  4N4N B;  4RDU A;  4HQM A;  2QKL B;  3DF8 A;  3H3Z A;  3VYS B;  3ZMT A;  1Y0U A;  1P7I A;  2OBP A;  3RCO A;  3S32 A;  3JTG A;  1VZ0 A;  4ZYG A;  1XD7 A;  4OIP F;  4PJ0 C;  3CUO A;  1YHQ I;  3S8P A;  3SEZ A;  2VOD A;  4RB2 C;  2L7F P;  1TT5 B;  3MFK A;  4DNC A;  5C4J J;  1J09 A;  5DM7 F;  1VQ8 I;  2HS5 A;  2R5Y B;  4EGY A;  3J7Z I;  4ZTJ A;  1ZRF A;  2OA4 A;  2K9Q A;  5LFA A;  1HOM A;  2DA4 A;  3L2W A;  3AG3 H;  3M1C A;  2QBY B;  3CUQ C;  2JRM A;  2DA3 A;  2VOO A;  2L9N A;  4PJM A;  5D6F A;  2DT7 B;  1K78 A;  3CP8 A;  1P2F A;  1UHS A;  2HYJ A;  2JPB A;  3CO6 C;  3HDD A;  4GXO A;  1PUF B;  3D5R C;  5DYM A;  1MDM B;  1BI0 A;  3MKZ A;  3HG9 A;  4ENM A;  2XGC A;  1FOK A;  4X6A J;  2JPC A;  1WSU A;  2DYR H;  3TQN A;  2NNN A;  1LFU P;  1FTZ A;  2QQ8 A;  1LFP A;  2OZ6 A;  3I0T A;  3LSG A;  1JJ6 C;  2IXS A;  3HB9 A;  4KIG A;  3F6O A;  2K86 A;  4XLC A;  2P4W A;  1WFX A;  5EZH A;  4A3L J;  1JKR C;  1U5T C;  4FTH A;  4A3C J;  1TC3 C;  2HDD A;  2K4J A;  4MHG A;  2IPQ X;  3W6J B;  4G7H F;  1R4N B;  3G71 I;  2P5V A;  3TO9 A;  1K79 A;  2HXO A;  2UV1 A;  4FIS A;  4RAY A;  2MGQ A;  2CO5 A;  1MMD A;  4CZC A;  2CMP A;  2BHY A;  4G8X A;  3LOC A;  4L9V A;  4RB3 C;  2BV6 A;  2STW A;  4XSZ F;  2XRO A;  3RZO J;  2K3F A;  1D8J A;  3LA2 A;  1LVA A;  1KU2 A;  1VND A;  2ID3 A;  4NDL A;  3IKT A;  4FE7 A;  2V6C A;  1T0F A;  5D8L B;  2ECB A;  3E1S A;  5HOD A;  3VFZ A;  1GHC A;  3F8N A;  4HEA 2;  4RM3 A;  2WB1 N;  4IXA A;  3U21 A;  3S1M J;  5HLG A;  1T98 A;  3GZ6 A;  1H89 C;  2H8R A;  4BNC A;  2K5C A;  1HF0 A;  3F72 A;  5M5X J;  1RUN A;  4S04 A;  1X1P A;  4UVC A;  2LVS A;  1V5F A;  1AU7 A;  5HLH A;  4IHW A;  1BJA A;  1PVE A;  1ETW A;  1BOA A;  1TZL A;  3FZV A;  3ZMU A;  2H1K A;  3L09 A;  4CGZ A;  2CU7 A;  3GTQ J;  3CJT B;  3IWF A;  1D1C A;  3SXY A;  3WTY C;  2QUF A;  1Z3Y A;  2HQN A;  1O3S A;  1EH7 A;  3QQA A;  3M4O J;  1T56 A;  4I0A A;  1XSV A;  3BR0 A;  5IP6 A;  3GME A;  5IOY A;  2CYY A;  2KRH A;  4MO7 A;  4XKV A;  2GIZ A;  3KP5 A;  1BC7 C;  2YX7 A;  1P6R A;  2A3S A;  3LSK A;  2IS6 A;  3CUQ A;  3GTK J;  2WBM A;  3FM5 A;  2PJR A;  1Z9C A;  2EZK A;  4JX5 A;  1K7A A;  5GTH C;  2KKO A;  4PJN A;  4LK0 F;  3OL4 A;  3E6C C;  3O8G A;  1CGP A;  4B43 A;  1EV7 A;  3RQ4 A;  1QU3 A;  5FLV A;  1QZY A;  3LQR A;  4BBR J;  3QU6 A;  1SFU A;  5EGO A;  3Q0V A;  2EFP A;  3RKW A;  2JVG A;  2VKH A;  2HOS A;  4R1H A;  1YJW I;  1ETQ A;  4JP0 A;  1PDN C;  1R5G A;  1ZYR F;  2E34 A;  1UHW A;  1Q1V A;  4KJZ A;  5KAF C;  3WOD F;  2CFX A;  1D5V A;  2YU9 J;  2XV4 S;  1HXD A;  4EMS A;  2ZC2 A;  5LHG A;  3AL0 B;  2DMN A;  4YIR X;  3D5L A;  3MN2 A;  3MQ0 A;  2E5N A;  3WE3 A;  2OCE A;  2XF6 A;  1H9T A;  3CCQ I;  2RAE A;  1RES A;  1ULY A;  2LK2 A;  4XLP F;  3I3L A;  2RQP A;  3ZP5 A;  3QYB A;  3L2R A;  2V9K A;  3DU6 A;  3TW7 A;  4WWC A;  2JMW A;  2OU2 A;  1BR2 A;  4G7Z F;  1IW7 F;  3AG2 H;  3W3C A;  4I0B A;  2DBB A;  4B47 A;  4I09 A;  5B3S H;  4JOM A;  4MEY F;  2ISZ A;  2LR8 A;  3GZN B;  1ZAR A;  3UR3 C;  5KVR A;  1X3U A;  1WGX A;  2EB7 A;  2LF8 A;  4XR6 A;  1T8I A;  2PLY A;  4XNF A;  2FEZ A;  3OYL A;  2W25 A;  2X6O A;  3Q0U A;  4LB6 B;  5M5W J;  2B9S A;  1AA7 A;  2D1H A;  4OAZ A;  1OQY A;  2KL4 A;  1W4M A;  3LSM A;  3WG9 A;  4FCY A;  2L4A A;  2Y0S A;  5BMZ A;  5F0H A;  4YII A;  1D0Y A;  3F0C A;  3ECO A;  2A68 F;  2QGU A;  4KFC A;  5LHH A;  1F36 A;  3HSE A;  3IKV A;  2EV6 A;  3BJ6 A;  3JRI A;  2VAS A;  2FOW A;  3DXJ F;  3ECH A;  3LFU A;  4KT5 C;  4IHV A;  1KA8 A;  1VQN I;  1AKH B;  4GYI A;  2YR2 A;  1HDD C;  2COM A;  3A2K A;  1MZB A;  2KZV A;  3V7R A;  1KQ8 A;  2VE8 A;  2RNJ A;  2DFE A;  1OPC A;  4L18 B;  2W00 A;  2M1B A;  4NBQ A;  4CCN A;  1YJ9 I;  5JHU A;  1B59 A;  5LGU A;  2KFD A;  2W84 A;  3CC7 I;  1Z1D A;  4EGZ A;  4C9Y A;  1ZRC A;  3HOU J;  5FKN A;  1JKQ C;  3CLQ A;  2KLO A;  3HRM A;  2AHQ A;  3GFJ A;  1B8I A;  5IPA A;  1BM9 A;  3OYE A;  2HKX A;  2HZT A;  4HNU A;  4LGW A;  1SFE A;  3DFG A;  5ERI A;  2R93 J;  2F6C A;  3I59 B;  4Y15 A;  5TJJ A;  1XMA A;  4ENJ A;  1GVJ A;  1BI3 A;  1X1C A;  3K7A J;  4ZZD A;  4MGR A;  2QEN A;  5EDN A;  3KX2 A;  2BVL A;  4XMY A;  1FZP B;  1X58 A;  3LQQ A;  1W7P A;  3DPT A;  3A01 A;  5BQT A;  2CFO A;  9ANT A;  2KRF A;  4DQ2 A;  1TWC J;  4G12 A;  3W2W A;  5IP9 J;  2DDB A;  2NYX A;  3E6D A;  4MLO A;  1FNN A;  1AOY A;  4OMZ A;  1KYW A;  5C4X J;  4PSX A;  2OV7 A;  1Z91 A;  3CMY A;  4Y52 J;  3ZPL A;  3QPL A;  1FT9 A;  2A6H F;  1VTN C;  2MC4 A;  3QP5 A;  3OIO A;  1JHF A;  5KHD A;  5KK1 A;  1Q1H A;  1QVU A;  3ZMZ A;  2KDZ A;  3IHU A;  2B0L A;  2K3P A;  2E2J J;  3PJR A;  3HPG A;  3J7A O;  2VBW A;  3EET A;  4QSH A;  2W1O A;  3LSH A;  4A3D J;  3VOD A;  1B9N A;  2PX9 A;  2H6C A;  3GO5 A;  2A61 A;  3OIQ A;  4XQF A;  5H6Q A;  2QF7 A;  4NUB A;  2IS1 A;  2M87 A;  3ZQL A;  3K2Z A;  4PUS A;  2E5Z A;  4FT8 A;  3RJP A;  4BHC A;  3GTJ J;  1MGT A;  4QPO A;  1U9N A;  2XAS A;  4BE1 A;  1LE8 A;  2EIM H;  5GPA A;  2HFH A;  3T0Y A;  4FX4 A;  2OF7 A;  2DTR A;  3BLY A;  2BGC A;  4M74 A;  5ED4 A;  3Q9S A;  4IHX A;  2VXD A;  4BE0 A;  4ESJ A;  2F4M B;  4QPQ A;  2ME6 A;  3TBI A;  3WU0 A;  1MKM A;  1RI7 A;  2HGC A;  3G73 A;  2M30 A;  3K69 A;  2R7U A;  4HDV A;  1P4W A;  4IEJ A;  2FX0 A;  2VUM J;  4EQQ A;  2CQN A;  4EEF G;  2Y75 A;  2LKS A;  5LBQ A;  4M9S A;  5M5Y J;  1HKQ A;  1JTX A;  2PG4 A;  5DUI A;  4A0Z A;  1FSE A;  4QTR A;  2R7S A;  3DTK A;  5E1Z B;  4E7K A;  2XGD A;  1D0X A;  3GLL A;  3DU5 A;  1R00 A;  1WCM J;  4LD5 A;  2GXA A;  1SAX A;  1UAA A;  1TQI A;  5KNL A;  3IUO A;  4AUX A;  5HS8 A;  2ZSI B;  1QA6 A;  1YRN A;  1Y1V J;  1MBJ A;  3BZK A;  1AWC A;  4MEX F;  5BPI A;  4HF0 A;  1LNW A;  4H0E A;  3QP6 A;  1MBG A;  5E20 A;  2WAQ A;  3ZOB A;  3IH3 A;  5F64 A;  1SC7 A;  4XRS G;  1I27 A;  3CZ6 A;  3A0H C;  4II2 A;  4E7J A;  2Y0M A;  4YFX F;  2E36 A;  2K9L A;  2RGV A;  3SFZ A;  1V5G A;  4C30 A;  3W2V A;  3CCM I;  4C2T A;  3DEE A;  2VBY A;  4Q47 A;  1H9G A;  1ORK A;  4F52 A;  3KYL A;  3QPH A;  4II3 A;  3GTO J;  3PSF A;  4I76 A;  1WJ5 A;  2CH0 A;  4HF2 A;  2ZME C;  1F43 A;  1UJ8 A;  2I10 A;  2V4J C;  4Y4R A;  2K40 A;  4GYG A;  1JJ8 C;  4KN7 X;  1FOX A;  1LB2 A;  1HW5 A;  2XB0 X;  4UV9 A;  2MAB A;  4D7M A;  1CF7 A;  3ZQI A;  3CDI A;  5B1A H;  5FKK A;  1OMI A;  3PM1 A;  4PCQ A;  3UNG C;  4HBL A;  2VKV A;  3S93 A;  2LBF B;  5FLX Z;  2A05 A;  2LMD A;  4XN0 A;  5H20 A;  5L3B A;  1GV5 A;  3JRA A;  4ZDO A;  2DQL A;  1SD4 A;  4DZJ A;  2LY2 A;  4D1Q A;  1XB4 A;  4B4C A;  3BR6 A;  3HL2 A;  2W57 A;  4N9H A;  3VYU B;  2Q2E B;  4UHT A;  4HDU A;  1VQ5 I;  1QGP A;  4Y17 A;  2FF4 A;  5JFR A;  1FBQ A;  4CDG A;  5BOX A;  1T95 A;  3CF2 A;  4ENN A;  4YG2 F;  3PIO F;  1NHA A;  3Q9V A;  3BG3 A;  3OYD A;  3ULQ B;  2LD5 A;  2O9L A;  3ZR8 X;  4EJW A;  2E19 A;  2EA4 A;  2PJR B;  4NQW B;  3P9I A;  2IA1 A;  4B1R A;  3TO7 A;  3VB2 A;  3S17 J;  3HBL A;  2CRG A;  4HST A;  5GAE J;  1HST A;  3BY6 A;  3QOD A;  3EUK L;  3OSG A;  1E2X A;  4XL9 A;  2GLO A;  3BG7 A;  3MZY A;  1YYV A;  3S14 J;  4P1W A;  3EYI A;  4I2O A;  3H5N A;  5GTI C;  3HUG A;  3K2A A;  1BOB A;  3X2Q H;  4M6V A;  2R5Z A;  1U5T B;  1B1B A;  1R23 A;  3I64 A;  5A2Q Z;  4M3E A;  1NTC A;  1LVK A;  2V26 A;  1R6R A;  2M5W A;  3DKY A;  2WA0 A;  3K0L A;  4YFK F;  5IYD J;  1L0O C;  1I3Q J;  3IRR A;  5K7F A;  2G9W A;  4W97 A;  1RPW A;  2ZME A;  3DTI A;  5LEK A;  3KLN A;  2XAJ A;  2CUF A;  1JTY A;  2OAZ A;  4G94 A;  5CVR A;  4DW6 A;  1F4K A;  4LIT A;  3F3X A;  3OYK A;  3F8M A;  3GVA A;  3M8J A;  1GXP A;  3BG5 A;  2A6E F;  3FIS A;  1W7P D;  1WJC A;  3HZJ A;  1KON A;  2ZBK A;  4XID A;  3PQJ A;  4CH7 A;  3VYT B;  5CKT A;  1QHG A;  2E1M C;  2XIG A;  1IAW A;  2B63 J;  2EWN A;  4KA4 A;  3CMA I;  2Y48 A;  1DUX C;  3BZC A;  3LA3 A;  2QWW A;  1EJ9 A;  1S29 A;  4WF2 A;  2BY1 A;  2E1C A;  5AIP A;  3BOQ A;  3R4K A;  1U3E M;  4D5F A;  1MW7 A;  2M2E A;  1S7A A;  5HNF A;  5EYR A;  5FFZ A;  2D5V A;  2E2H J;  1XGM A;  2EIK H;  4XOT A;  2A07 F;  2PMU A;  2K9S A;  2L4M A;  3HGG A;  3OR1 C;  3T8T A;  1ZGW A;  3MEX A;  2EV5 A;  4OAY A;  4ABZ A;  3E97 A;  3SYT A;  1W5C C;  2H94 A;  1R71 A;  4KNY A;  1ZK8 A;  3CCS I;  4AIJ A;  3J7Y J;  1WPK A;  4BY1 J;  4LG0 B;  1QRY A;  3A4C A;  2XF5 A;  2EFO A;  3IV5 A;  2BW3 B;  2JUG A;  4OIN F;  2DA5 A;  5AON A;  3TL4 X;  2L02 A;  2QQA A;  2QZ8 A;  5JHF A;  3HSF A;  4JQF A;  2XAQ A;  1SAU A;  1TW2 A;  4A0X A;  1UFM A;  2M4G A;  4LIV A;  1WH7 A;  3HOZ J;  1RZ4 A;  4BS9 A;  4EM1 A;  5E79 C;  4N9I A;  3QOE A;  1SFX A;  3K4N A;  4Y33 A;  2IA0 A;  3NQO A;  3L9F A;  2DW4 A;  1AHD P;  3WTZ A;  1MH4 A;  3LST A;  2BZT A;  3GTM J;  3GUD A;  2R7V A;  4B09 A;  2PEX A;  1Z21 A;  1Z7U A;  4I02 A;  4E7I A;  1PP8 F;  4LG3 A;  3K10 A;  3GYH X;  1E3P A;  2FJ1 A;  4BXU A;  5JR3 A;  4P55 A;  3RI4 A;  1NH3 A;  1H88 C;  1GUU A;  5IOZ A;  1JT6 A;  2LH9 A;  2XAF A;  1Y6I A;  2BY3 A;  1U8B A;  5HNH A;  4KN4 X;  2F5C A;  2QSH X;  2JA7 J;  5DUK A;  2M8E A;  1OYW A;  2GQQ A;  3HPH A;  3WHB A;  5CLS A;  2LNB A;  2X0L A;  2NOJ B;  3OMY A;  2D2W A;  1O3R A;  1OCT C;  4OIQ F;  1WQ2 A;  2L7Z A;  3B73 A;  4LIU A;  2EIJ H;  3PIP F;  3HXL A;  2ETH A;  3FWE A;  1A6Q A;  2GAU A;  1FOW A;  1X1A A;  2HTS A;  1IN8 A;  4CCM A;  2ICW G;  1IDY A;  3JW4 A;  5J8C A;  1Z7L A;  2LKP A;  4MTD A;  4XLH A;  4I01 A;  3SQN A;  4BH9 A;  1S9H A;  1T0F C;  4GDF A;  5E3N A;  2H09 A;  5EEA A;  2FQ4 A;  4MTE A;  1H0M A;  4Y3O A;  5M3F J;  3L2C A;  4L0Z B;  1Z77 A;  2EFQ A;  1Y0N A;  4MFE A;  3TDZ C;  2PQ8 A;  5J47 A;  3C2B A;  3FMR A;  4BKX A;  2DOA A;  3VSL A;  2AXL A;  1VQ7 I;  3ASN H;  4HPQ A;  2DT5 A;  4NC8 A;  2CW0 F;  2ZKZ A;  3NEU A;  1UEL B;  3L2U A;  1ZN2 A;  3ABL H;  3QRF F;  5JVT A;  1WJF A;  1YFH A;  2GIV A;  3S3M A;  1S6L A;  1L3L A;  2HOE A;  1IRF A;  2VQL A;  1LDK B;  3QWL A;  2HYF A;  2Q8K A;  1WJD A;  2C6Y A;  3ERM A;  5E3O A;  3E5Q A;  5E17 F;  2E2I J;  3R6S A;  1DU0 A;  1FY7 A;  3SFI A;  5ICE A;  1JHH A;  5B5E C;  4BY7 J;  1I6H J;  1STZ A;  2O0Y A;  1IN6 A;  1D8K A;  4U88 A;  4UB6 C;  1LPQ A;  1Z0X A;  3MVP A;  2LRE A;  3ML6 A;  2CW7 A;  4JK1 X;  2BOL A;  3WG7 H;  1I50 J;  2BY0 A;  1IDZ A;  3D5S C;  1TWH J;  1N25 A;  1B4A A;  4A3B J;  3S1Q J;  3BZ6 A;  1LQ1 A;  3BP8 A;  1EKE A;  1MJ9 A;  4RLQ A;  1ZTR A;  2HDW A;  2F4I A;  4G6D A;  1MJB A;  2BY2 A;  3F8B A;  3NWT A;  2CJJ A;  3CCV I;  2EA2 A;  4UUT A;  4XN3 A;  1ZG1 A;  4CXF A;  3DTE A;  1IZ1 A;  2OZU A;  2Y9Z A;  4DZP A;  2HDC A;  1OJL A;  2EFW A;  2V1U A;  5GAD J;  2R7X A;  3CMM A;  1TNS A;  2DJI A;  3A0B C;  4YIF A;  1VQL I;  2CUE A;  4MFD A;  1FWZ A;  2HTJ A;  2P0W A;  4NC7 A;  5DD4 A;  1MJA A;  3GTP J;  2COB A;  2DFH A;  4AM3 A;  4BU2 A;  1ON2 A;  5CPR B;  2PBI A;  2IS2 A;  3A03 A;  3Q3S A;  5IY5 H;  1P4X A;  3GEZ A;  4WK8 F;  2VE9 A;  3MKY B;  1JXS A;  1FOY A;  3ZGK A;  1YQA A;  3AAF A;  2F5D A;  3FIW A;  3HOV J;  3KP7 A;  4UUS B;  5D4S A;  5IT3 A;  3L2V A;  5E1X A;  3JAM Z;  1MIJ A;  2Y0S N;  4RGX A;  3BT9 A;  4MQ9 F;  1QZZ A;  2BXZ A;  4DOZ A;  2LFB A;  2M0M A;  3VEP A;  2JZY A;  3RKY A;  1IXS B;  2R7F A;  1D3Y A;  1KGS A;  1VI0 A;  1XPX A;  3N4M A;  2LTP A;  1J7K A;  1WJE A;  4BYY A;  3KEY A;  4M72 A;  5DTD A;  2F4O B;  4PFO A;  1K61 A;  1U8R A;  2MC3 A;  2H6B A;  3PFI A;  5FB2 A;  4KIS A;  1SMT A;  2TRT A;  5GPC A;  1T6S A;  2RV8 A;  2DK5 A;  1UG2 A;  3O3K A;  2ZJQ F;  4IQJ A;  1K83 J;  2AO9 A;  2KIM A;  2HQ5 A;  4CCO A;  1N75 A;  1FP2 A;  3I4M J;  1ZKG A;  2CUZ A;  3QYF A;  2VBZ A;  3HGY A;  4XON A;  1O3T A;  1QNT A;  2GXB A;  2ZCW A;  3RPU A;  1SVO A;  3JSP A;  2FSW A;  4BQQ A;  1VFC A;  2L9S A;  1LDJ A;  5EEH A;  1ETO A;  1YOV B;  2HQA A;  2GXG A;  4NB5 A;  3HRS A;  4PJL A;  4N4O B;  2FE3 A;  4E7Z A;  3GF2 A;  3V42 A;  4F7Z A;  1KQ9 A;  5LHI A;  4ETS A;  2XSJ C;  1R5I D;  2QQ9 A;  2G7H A;  2HNH A;  1FC3 A;  1OFC X;  2DLL A;  1P92 A;  3VOE A;  3GLX A;  1FSH A;  3OS0 A;  5D5X B;  1QHH D;  2IP2 A;  2O3F A;  2YSR A;  1XDU A;  1YG2 A;  2DA7 A;  2EV0 A;  1QPI A;  1E0E A;  2P5K A;  4LOC A;  2K7L A;  2LLK A;  4HW0 A;  1OCZ H;  3OYC A;  1BIB A;  3CC2 I;  3RKQ A;  1OCO H;  1K4T A;  1Z6R A;  4BXX J;  5C44 J;  2ISY A;  1KU9 A;  3OYA A;  3BJO A;  4KUM A;  3HRT A;  5DDG A;  2DFF A;  1N78 A;  4A5N A;  2EQR A;  3LA7 A;  3VSK A;  1B72 A;  3ZMV A;  3F6V A;  1ERD A;  4LMY A;  3ABU A;  4AIK A;  2J5P A;  3FK7 A;  1WHU A;  2DK8 A;  2R92 J;  3H92 A;  4E4H A;  3BG9 A;  4ZYH A;  4BAY A;  1SFO J;  4M6X A;  2DMP A;  5JVG F;  3M07 A;  5EG0 A;  1VQ4 I;  4AVZ A;  2JJ7 A;  1W1W E;  3DV8 A;  4FAS D;  2JA8 J;  4F3Q A;  1DP3 A;  2P6T A;  3COA C;  1Y1W J;  2WAF A;  3OIP A;  4G6T B;  4MIM A;  4RLF A;  4M9X A;  1MND A;  2DQR A;  3C2H A;  5DCM A;  4M71 A;  3KZY A;  1IJW C;  1ETX A;  1NG7 A;  1FYK A;  4BEH B;  5E8G A;  2PJP A;  2GA1 A;  1F5T A;  3SHF A;  2Z16 A;  3KFW X;  5FD5 A;  2ZXJ A;  2B7E A;  4M6Y A;  2XSD C;  1V55 H;  2ESN A;  3OYG A;  2FU4 A;  1JI8 A;  3QYE A;  3J80 K;  2AQE A;  4CYC B;  1ZG5 A;  1TQP A;  4IHT A;  2X48 A;  5F04 A;  3BR2 A;  4ESF A;  2IGO A;  3IH2 A;  4G7O F;  3FKJ A;  2LG4 A;  3U9G A;  3FXJ A;  4ON0 A;  2O7O A;  3K1P A;  5FD6 A;  1WKM A;  3T5X A;  3I4N J;  1EH6 A;  4HAM A;  1YO5 C;  3BR1 A;  2M7A A;  2RC4 A;  1XTA A;  3RQI A;  2QYO A;  2R7Z J;  3KYD B;  4ZH4 F;  3OYB A;  1I5Z A;  4ZZL A;  3CCJ I;  4DJA A;  2H1L A;  2VJ4 A;  3RYR A;  1U78 A;  2XUB A;  3FHZ A;  4A3G J;  2WAQ N;  2R3S A;  2VL8 A;  2DYS H;  1EF4 A;  3RYP A;  3I58 A;  2D1V A;  3ZCO A;  1IN4 A;  1R7J A;  1R1V A;  4BHP A;  3P9K A;  5BPD A;  1ZQ3 P;  2IT0 A;  4OMY A;  4XLF A;  4F92 B;  3CDH A;  2RRE A;  4R8H A;  2CV0 A;  1R5H A;  4HRI A;  4I98 B;  3ZMS A;  3FXR A;  5IYC J;  1XS9 A;  3PO3 J;  4GRI A;  5IP7 J;  3FM3 A;  5ILS A;  3E5X A;  2HKO A;  3H9Q A;  1TL8 A;  2AXT C;  3CJR B;  1YX5 A;  3CDL A;  3IAM 2;  2R7Q A;  2A69 F;  5FFX A;  3V7S A;  4UV8 A;  1I3A A;  2VPR A;  4UVA A;  5K5O A;  2E1M B;  5FLX K;  2KP6 A;  2M3A A;  5CVU A;  5L3G A;  2Y69 H;  2ID6 A;  1XGS A;  1T2K A;  3JRC A;  3H9J A;  2DDA A;  1K4S A;  2DO7 A;  4A6E A;  1H8A C;  3H5R A;  3HC7 A;  1BIA A;  2OPT A;  4M3G A;  1RIO H;  4K2E A;  3CCL I;  5L3D A;  4IQ4 A;  2PFB A;  3K4J A;  4BHB A;  1TW3 A;  3DLL F;  2N8G A;  2RN7 A;  2VKD A;  4A0Y A;  5F0C A;  5K1Y A;  2CQ7 A;  3RPQ A;  3GTL J;  5CQG A;  3N05 A;  2JN6 A;  4EM0 B;  2HZD A;  1QPM A;  4E7L A;  1XGO A;  1IO2 A;  3A1Y A;  2X9D A;  3TDU C;  3GTG J;  1TBX A;  3BCA A;  4ZTF A;  2FMY A;  1XCV A;  3LAP A;  1IV8 A;  1MSF C;  2VLA A;  4A93 J;  2L9V A;  2MA3 A;  3QAH A;  1GVD A;  3OYF A;  3S1N J;  4HYE A;  1J5Y A;  3J80 Z;  4KYW A;  2BE5 F;  5CVJ A;  2L3D A;  3PUF A;  2DA6 A;  2LY9 A;  5IYB J;  1TQM A;  5J1U A;  1WI3 A;  2E1N A;  3VDX A;  3FDY A;  2QBY A;  1FBU A;  2IW5 A;  2VT3 A;  2XAH A;  1K78 B;  2L5Q A;  3DBH B;  1LEA A;  2XGX A;  2R0Q C;  2NVX J;  1I39 A;  2QLZ A;  2OTJ I;  1UST A;  5CYV A;  3IP4 B;  1PUF A;  4I6Z A;  4CCJ A;  3KZZ A;  3CC4 I;  1MDM A;  3ABK H;  4XLN F;  2RVC A;  2VQG A;  4AIH A;  5A2Q K;  5LD2 C;  4D0P A;  5DD8 A;  3H3V K;  3E0J B;  3K4C A;  4XKB A;  5K5R A;  2ZJR F;  3GX4 X;  3K9T A;  1ETK A;  2ZXI A;  4DIQ A;  3H1C A;  4YEJ A;  2BYV E;  3KP2 A;  3M1E A;  1X3W B;  4DYQ A;  5B66 C;  1JUP A;  3WTU C;  1MBE A;  3LSR A;  2HI3 A;  1TLH B;  4E70 A;  5EF6 A;  3BWG A;  3ELK A;  4Q4Z F;  3I53 A;  1X1D A;  5LGT A;  1K6Y A;  1MBF A;  1HA8 A;  4IRG A;  3S16 J;  5J6X A;  1WVR A;  4EJT A;  1G2H A;  3RPU D;  1G3S A;  5J4V A;  1KYZ A;  4IJA A;  3HM5 A;  4JBA A;  4HZF A;  2MBF A;  1FPQ A;  3G6E I;  4B8X A;  1KU3 A;  5LRR A;  3GFL A;  2FBI A;  3DQV C;  3I55 I;  2ZNY A;  2FD5 A;  1J2X A;  1TTY A;  4EVI A;  5AIQ A;  2V9P A;  3K1M A;  5E3M A;  4Z2Y A;  2VI6 A;  5EJC A;  4A3K J;  4WXC A;  3TO6 A;  2GA2 A;  3ZN1 A;  3T8R A;  3MZ8 A;  3RDI A;  1LDD A;  1ZRD A;  3WHC A;  3EUA A;  1IN7 A;  4BQO A;  3LSP A;  4P5O A;  4XLA A;  4BQA A;  4B3A A;  5L3F A;  4PDK A;  2O61 A;  2YU3 A;  3E6B A;  3BC8 A;  2KQR A;  3DPU A;  5HLI A;  3IC7 A;  4U7B A;  2KPM A;  4BDZ A;  2DPD A;  4RM2 A;  1O3Q A;  3FXU A;  5BNG A;  1YE9 A;  4A3E J;  4M9Z A;  4XOR A;  5HOO A;  2AQF A;  1IC8 A;  2A6T A;  1V5E A;  3H9G A;  4U7D A;  1YS6 A;  4A5M A;  3PFY A;  4J19 A;  1UMQ A;  1JKO C;  2KJC A;  1NG6 A;  3CUQ B;  3TOA A;  1XGN A;  3J7A Y;  4RAF A;  3CCY A;  2ELK A;  5F08 A;  3FF5 A;  4RGU A;  1EH8 A;  3C3W A;  3JTH A;  3NWS A;  3PSI A;  2I5U A;  1Y8Q B;  2ZSH B;  2Z99 A;  2QSF X;  4OU0 A;  4Y13 A;  4CO8 A;  3U1D A;  2WV0 A;  2P8T A;  2F48 A;  1FP1 D;  5FKO A;  2IBD A;  2LYC A;  3OR2 C;  5K7Z A;  5EGO B;  3N97 A;  2PMZ A;  1MNE A;  2IAI A;  3BDD A;  4S05 A;  2DTZ A;  4IOA F;  2NRA C;  4I7H A;  4CCK A;  4LLN A;  3R0J A;  4HG2 A;  2O8K A;  3HKZ A;  5JLW A;  2VBX A;  4HV5 A;  1LFB A;  3H0D A;  4TV7 A;  2HOA A;  1T39 A;  3S15 J;  1FYM A;  1ZH5 A;  4GCV A;  1MMN A;  4OIR F;  3RZD J;  2EZI A;  3OV8 A;  4EJV A;  1YS7 A;  2LC2 A;  3U1K A;  1WWX A;  4HX8 A;  5ILV A;  2XGE A;  5DCF A;  6PAX A;  1XMX A;  3ERE D;  1P7J A;  5FRM A;  4F55 A;  2J5O A;  1JE8 A;  4H4K C;  2FOK A;  5HS9 A;  4EM2 A;  2W82 A;  1S5L C;  2CQQ A;  3F21 A;  1O4X A;  3WTT C;  4HNT A;  3W2A A;  3BCB A;  2Z1D A;  3MKW B;  3ZRG A;  3K1N A;  4IHY A;  3HTS B;  1MSE C;  4A3J J;  3BQY A;  3MD2 A;  1FMV A;  4M73 A;  3OOU A;  5F27 A;  1O7F A;  5LEJ A;  2CSO A;  4IRH A;  3ZXS A;  4IKF A;  2MYS A;  3O6B B;  3HOY J;  4S0H B;  1G6N A;  4HOB A;  1MBH A;  3BR3 A;  4WXH A;  2DOE A;  2XC7 A;  2R7W A;  2Y31 A;  2YPR A;  4QWQ A;  3KET A;  2E35 A;  3JR9 A;  3OYJ A;  2QCO A;  3RTR A;  4D9J A;  1USS A;  4AYB N;  2EJR A;  3CP2 A;  1MH3 A;  3IAS 2;  1AKH A;  3WTW C;  4QIW N;  3W6V A;  3ESW B;  3HOW J;  2JA5 J;  1IXC A;  3CCR I;  1OCC H;  4CIC A;  2P6S A;  4RAZ A;  1JUS A;  1DDN A;  2KHM A;  1IN5 A;  5BS6 A;  4M3B A;  4PK4 A;  1ZG3 A;  2NVY J;  2Y30 A;  3U2R A;  2EBI A;  1RET A;  1IUF A;  1T08 B;  1UCR A;  2R7D A;  3GBG A;  4CUG A;  1B8I B;  2HQR A;  2P7C B;  5KCM A;  1ZGA A;  3GWZ A;  4DYC A;  2HU9 A;  4OOI A;  1BR1 A;  5FRO A;  4O6J A;  2HXI A;  3PNT A;  2VJJ A;  3G1O A;  1W36 D;  3QPS A;  5ICF A;  3I59 A;  3ZN0 A;  2K9M A;  4BL0 B;  2VPL A;  5CJ9 A;  3KCC A;  1XSD A;  1S3J A;  1LJ9 A;  2QVO A;  1X4P A;  3B02 A;  2ZB9 A;  4L9J A;  1A5J A;  3OYH A;  2LSO A;  2OC6 A;  3CES A;  2O5R A;  1W7P B;  3K4K A;  2IJL A;  3MCZ A;  3A01 B;  3DBL B;  2LF7 A;  1S7O A;  4A69 C;  2E71 A;  2A5W A;  1S72 I;  3E7L A;  2I8D A;  3TKY A;  4BGD A;  3CCU I;  2E60 A;  3CO7 C;  4KIT B;  1G4D A;  3KLO A;  2ZJ2 A;  4AWX B;  2FXA A;  1FIP A;  5K5Q A;  1RR7 A;  2D45 A;  2DAO A;  1QQI A;  2JA6 J;  1IGN A;  5L3E A;  2WY7 Q;  4P9U A;  2M0C A;  3TMO A;  2DOD A;  4JYK A;  2V9V A;  4B44 A;  1Z67 A;  3JAM K;  2OD5 A;  2H8W A;  1TWG J;  2UXN A;  2NS0 A;  3DKW A;  4P9F A;  4U0Y A;  1LEB A;  4XLE A;  3GXO A;  4L5J A;  2L01 A;  4UXN A;  1VQK I;  3E5U A;  5DM6 F;  1KQ0 A;  1N77 A;  2KJB A;  1ONV A;  4CSW A;  1DGW Y;  4R79 A;  1IG7 A;  4DBQ A;  2X85 A;  1DQU A;  1LUJ B;  4OWR B;  1QZE A;  2DMT A;  1LE8 B;  1I6X A;  3BQZ A;  1JUM A;  1I1G A;  1OLT A;  2O6G E;  4A6D A;  2ZXW H;  1P9Q C;  5LGN A;  3PL8 A;  4RMN A;  2K85 A;  3MWM A;  4V2F A;  4OIO F;  3GW2 A;  4AYB A;  3CF5 F;  3ZQQ A;  3I9V 2;  3UKG A;  4PZJ A;  1YJN I;  2GOX B;  2PN6 A;  2CGP A;  5IT9 Z;  4FX0 A;  2AS5 F;  2CQK A;  4ZJZ A;  4J01 A;  3JRG A;  4IOC F;  4XRF A;  2NVQ J;  1W0U A;  3FKI J;  4RAG A;  2FNA A;  4D7N A;  2Z5U A;  4UNO A;  3FX3 A;  3VPR A;  2ACJ A;  4LLG F;  2FML A;  2XHK A;  2NNY A;  3IWZ A;  1U9O A;  1V3F A;  3LMM A;  4HX4 A;  3WTX C;  1OR7 A;  2DA2 A;  1DP7 P;  4A12 A;  2XAU A;  2LDU A;  2VT2 A;  1YRN B;  2CG4 A;  1YX3 A;  3L2Q A;  3KP6 A;  4HV6 A;  3G4S I;  2KIF A;  3P9C A;  2M8G X;  2ADU A;  3HHH A;  4A3F J;  5J1Y A;  3V8K A;  5D8K B;  4MQV A;  1FYL A;  2VOP A;  3J81 K;  4C2M J;  1KU7 A;  1VQ6 I;  2X51 A;  3QPT A;  2IRF G;  4RA2 A;  5LLQ A;  3LNQ A;  3I54 A;  2IS4 A;  2NVU B;  3SZT A;  5CQE A;  4QLC U;  2QEX I;  1HSJ A;  3WGH A;  3LSI A;  3VYR B;  3DPL C;  3F9K A;  3D1N I;  5LRS A;  2DMQ A;  2LY1 A;  2Q1Z B;  4GGG A;  3T1B A;  3OWT A;  1ZLJ A;  1G3Y A;  3V8L A;  3WU2 C;  5DS9 A;  1RKW A;  3JRH A;  3JSO A;  3CME I;  2X4H A;  3FBI B;  5L3C A;  4EV0 A;  5E18 F;  1TWF J;  2L7M P;  2XPW A;  1CF7 B;  3OYI A;  2NOG A;  1Z05 A;  3H3U A;  1IXR C;  1X3Z B;  2ELH A;  1E17 A;  3GFI A;  4UUV A;  2ZJP F;  1ENH A;  1V4R A;  2LBF A;  1SAN A;  3P5J A;  4O3M A;  1D1A A;  1O57 A;  1OKR A;  2V1N A;  1REP C;  4ENK A;  4FHT A;  2RNG A;  1S7E A;  1ACI A;  3DP7 A;  3OYM A;  3ZQG A;  1UHM A;  1J9I A;  3CQZ J;  4RBO A;  2WC2 A;  4XKC A;  2Q2E A;  5K7H A;  2XRN A;  1WH5 A;  3PQK A;  4WX9 A;  2KRC A;  2EZL A;  2M45 A;  4M3F A;  3S2H J;  4M3D A;  2WV1 A;  2JK3 A;  5D5U B;  1XCB A;  1U2W A;  4DBR A;  4L9T A;  1WI9 A;  3BJA A;  3KIO A;  2VQC A;  2Z2S B;  4BBS J;  4NQW A;  2V79 A;  2VC0 A;  3HJE A;  3HOT A;  4HLY A;  2KMU A;  4KDP A;  2BEO A;  2FRH A;  2ZO4 A;  1JGS A;  3AG4 H;  2XPU A;  4BUP A;  4ANJ A;  3KZI C;  5TGT A;  3OOP A;  2DA1 A;  2DXI A;  3PNY A;  4CA0 A;  4I99 C;  3ZQH A;  2K9N A;  3JRE A;  1SD6 A;  3OS2 A;  4HX7 A;  3DWL E;  3HUG B;  4ZYE A;  3PO2 J;  5DEQ A;  2RDP A;  1OIS A;  2UWM A;  3OL3 A;  2R5Z B;  1BL0 A;  4JX4 A;  3MMY B;  2MH9 A;  4L5E A;  1U5T A;  4YRV A;  1FJL A;  2VB6 A;  4C3H J;  3IRQ A;  3EDP A;  2IGK A;  3S2W A;  3WGI A;  2GZW A;  4IRI A;  3G3Z A;  3J81 Z;  3FXQ A;  4E7H A;  2WTE A;  4U87 A;  2W7N A;  1Z6T A;  2G7U A;  1HKS A;  3E3V A;  2HWV A;  2HOT A;  5J1R A;  3RSN A;  2ZME B;  3REO A;  1TT0 A;  5DV5 A;  3S3N A;  3FHN A;  1XC5 A;  4AU7 A;  4RS8 A;  1R9T J;  2X6Y A;  2E7W A;  4JX6 A;  5F0F A;  3WE2 A;  3CCE I;  4ZC3 A;  4BJ6 C;  3S1R J;  3HOX J;  1JGG A;  3EQL F;  2JUC A;  3EPZ A;  4ZYA A;  5EEG A;  1OCR H;  3WTV C;  1DPU A;  2UZK A;  2OCC H;  1BA5 A;  1SVL A;  1DPR A;  3GFM A;  1ZR2 A;  3KEQ A;  1G3T A;  3TED A;  2VKE A;  1PJR A;  5FKL A;  2XAG A;  5D5V B;  1ETY A;  1PYV A;  1HW1 A;  2WB1 A;  1BI1 A;  2YS9 A;  2OUM A;  4ZDP A;  2QM3 A;  1Y56 A;  1MMA A;  4C2U A;  5CVI A;  4CCL A;  3LL7 A;  4UY8 I;  2GOM A;  1VQM I;  4KMF A;  3ZMD A;  1ZRE A;  2ELJ A;  3FXK A;  1IRG A;  4LJZ F;  3H0G J;  3NAU A;  2WWY A;  1UZC A;  3ZQF A;  3S3O A;  2MFZ A;  1RUO A;  2FBK A;  4IHS A;  1D5Y A;  2JSP A;  3BTI A;  3BPV A;  1W36 C;  4UVB A;  1YTY A;  4LG0 A;  2VQH A;  4XM3 A;  3TP3 A;  3AKZ A;  3AG1 H;  2BW3 A;  2MLG A;  2O03 A;  1G3W A;  1SMY F;  2DFI A;  4GFB A;  4FQG A;  3C2G A;  2X6X A;  3TGN A;  2EFN A;  3L1P A;  1VQ9 I;  3V8J A;  1U0J A;  4KIC A;  4HA8 A;  3BPX A;  5ILU A;  1QBJ A;  2UUZ A;  1RKT A;  2VC1 A;  3K4B A;  4G6Q A;  2VN2 A;  3FK6 A;  4HSR A;  2V1X A;  4GO1 A;  5JLX A;  3HIF A;  4CYD A;  4LK1 F;  1BW6 A;  2MH2 A;  2IA2 A;  2LKX A;  3M8E A;  4EAT A;  3NRV A;  2IEK A;  3CJN A;  3V7C A;  1BR4 A;  4C3J J;  3PNV A;  4AVP A;  3LWF A;  5EZG A;  4A2U A;  4WCG A;  1IUY A;  1CQT A;  4F91 B;  1BBY A;  1R36 A;  1ZGJ A;  3SJM A;  5J40 A;  3SZP A;  2EZH A;  3AFH A;  2BBY A;  4XOP A;  1YLF A;  5B1B H;  4NC6 A;  2HPM A;  2HYG D;  3H5A A;  2CS3 A;  2JTV A;  4J00 A;  4XKW A;  3Q0W A;  3ROU A;  5M3M J;  5J8F A;  4ESB A;  1BC8 C;  5GAG J;  1RR8 C;  1YW8 A;  3ONQ A;  3KP3 A;  4B48 A;  2V7F A;  3K70 D;  1OYY A;  4YEL A;  4E7S A;  3JCU C;  1J0R A;  2X1E A;  1D1B A;  1PUE E;  2QSG X;  2W85 A;  2A5Y B;  4L9N A;  3CLO A;  2ECC A;  4RB0 A;  2XDV A;  2K4B A;  3I5U A;  1R4M B;  1W0T A;  5CVV A;  4L5I A;  2FUG 2;  2M7B A;  2FQ3 A;  3E6M A;  3HEF A;  2MG4 A;  4W1U A;  3WGG A;  4BE2 A;  1XMK A;  4V19 K;  3M8F A;  3DEW A;  2CUJ A;  2L54 A;  5F6F A;  4KMU X;  2KIS A;  1JKP C;  1X19 A;  2DT6 A;  2QKM B;  3TP0 A;  3Q5F A;  4FE4 A;  3HTU A;  5HDK A;  1BI2 A;  4XRM A;  5ICG A;  1XDS A;  1HKT A;  1XN7 A;  2HVS A;  2ME0 A;  2OTL I;  4BAC A;  1ZLK A;  4U0V A;  2H27 A;  2HR3 A;  2L0K A;  4WXD A;  2R5Y A;  2VJI A;  3DCF A;  1GXQ A;  1X1B A;  4ZDL A;  3BRO A;  2E1O A;  1J59 A;  3RIR A;  1G8X A;  5H2F C;  2Z9O A;  2R7T A;  3DLA A;  3SEQ A;  3L00 A;  4IX7 A;  1A6I A;  3QOP A;  1M1E B;  3O8H A;  1Z3X A;  3V4G A;  1IF1 A;  4Y7N J;  2NS8 A;  4NNJ A;  2XB5 A;  2DI3 A;  4X1E A;  2JRT A;  2M4K A;  5GP9 A;  3ZQC A;  1SD7 A;  2DOF A;  2OQG A;  1RNL A;  1BJZ A;  2CV2 A;  2PMZ N;  2W4S A;  5C3E J;  1E3O C;  1ODD A;  1KZH A;  2P81 A;  4BDY A;  1D0Z A;  1MD0 A;  2EH3 A;  2NAZ A;  2ZNZ A;  3M3Y J;  1O7L A;  1F9N A;  3HKZ N;  4KT6 A;  5HS7 A;  1R1T A;  2MW8 A;  5E1W A;  2DPU A;  4O5V A;  2DN0 A;  4CHU A;  2ESH A;  4RGS A;  1UB9 A;  2MD5 A;  4BQN A;  1A31 A;  3BR5 A;  1G59 A;  4IL6 C;  2KIQ A;  4KIB A;  2M9H A;  1Y39 A;  1R22 A;  3FBN B;  3K4M A;  1XSX A;  1ZR4 A;  3F8C A;  1FLI A;  2XKP A;  3AL0 C;  2F5V A;  1TP4 A;  5TIS C;  2QA4 I;  5J4Y A;  5FLM J;  1APL C;  1ZAO A;  2MSY A;  1A36 A;  3JRB A;  3SZG A;  3S2D J;  1POG A;  2E7X A;  2X1D A;  1IV6 A;  1J75 A;  2ZFW A;  1FX7 A;  2YUS A;  5D4R A;  1ITY A;  4IF4 A;  1R1U A;  4IPA A;  4U0W A;  1FIA A;  1LKX A;  2W24 A;  3C1D A;  4XK4 A;  4E6K G;  2HEO A;  2EIL H;  3A02 A;  4D5C A;  3MZH A;  2ZFU A;  3CTA A;  4UB8 C;  3HYI A;  1Y8R B;  2JWT A;  4UUS A;  3TOB A;  1IRX A;  1ETV A;  2VIX A;  5E3L A;  4CZZ A;  3SDG A;  5HLT A;  4HQE A;  2OQR A;  2WAD A;  1SFK A;  3DKX A;  3RKX A;  1VF9 A;  4PGH A;  1YIJ I;  4HNV A;  2K27 A;  2PI0 A;  3H36 A;  2XRL A;  3M9A A;  3LAJ A;  2K02 A;  4IZZ A;  3I56 I;  1WRJ A;  2F5F A;  2JSC A;  1TNT A;  3MAJ A;  1GLN A;  2F2E A;  2EK5 A;  2HVQ A;  2PMH A;  2CW8 A;  5J3L A;  4ASN A;  4EJU A;  1U6G A;  1WZ2 A;  3TW6 A;  3EYY A;  1YI2 I;  2WAE A;  3C7J A;  3JRF A;  1DGR M;  3OY9 A;  1PP7 U;  4DYR A;  1HLV A;  2FA5 A;  2IVM A;  2Y2Z A;  4IVN A;  4BJ5 C;  1HQC A;  2RQQ A;  4FET A;  3EUH C;  4BXF A;  4F93 B;  3I71 A;  2KT0 A;  5FO5 A;  2WY8 Q;  3C18 A;  2Q0O A;  5GAH J;  1GT0 C;  1V54 H;  1K6O A;  3IL2 A;  1NK3 P;  4XRS A;  1MNM C;  1P4A A;  4AID A;  3MKL A;  2MD0 A;  2MLK A;  2Y9Y A;  2TCT A;  2JT1 A;  1YW7 A;  2EPF A;  2CQX A;  1QVT A;  2R4G A;  3G1L A;  2Z33 A;  1B9M A;  1HBX G;  4AC0 A;  3DBR B;  2L9R A;  2UXX A;  3SDB A;  4C3I J;  3F22 A;  3F8F A;  2JQ7 A;  4Q48 A;  3P7N A;  1BW5 A;  2V1D A;  3HSR A;  1ON1 A;  1WJB A;  3HRU A;  3OYN A;  3FMS A;  2G0E A;  4LLL A;  4A3M J;  2P7V B;  2KDO A;  3HOS A;  2HPI A;  1R58 A;  2XPV A;  4L0Y B;  3R0A A;  4Z6Y A;  2VXZ A;  2W48 A;  2IGN A;  1B6A A;  3OSF A;  3L7W A;  3B6A A;  1BN5 A;  1GV2 A;  3R60 A;  2EIN H;  1X2M A;  2FBH A;  4MNU A;  5JI6 A;  2QQB A;  1SEU A;  1R49 A;  2YX4 A;  1EA3 A;  2NVT J;  1MMG A;  1A04 A;  2IGM A;  2DU9 A;  1RRJ A;  1B72 B;  1DU6 A;  2P5L C;  1YW9 A;  1TWA J;  1HW2 A;  2LRD A; 
#chains in the Genus database with same CATH homology
 1JTX A;  1MBK A;  1NK2 P;  4QTR A;  3FK7 A;  2R92 J;  1U9O A;  2XGD A;  1WCM J;  3BG9 A;  1SFO J;  2DA2 A;  2DMP A;  5EG0 B;  5EG0 A;  4AUX A;  2JJ7 A;  1YRN B;  1YRN A;  1Y1V J;  1MBJ A;  2JA8 J;  1Y1W J;  1FTT A;  3BTC A;  2M34 A;  3LSJ A;  4MIM A;  1MBG A;  2M8G X;  1T33 A;  3ZOB A;  1IJW C;  1ETX A;  5J1Y A;  3IH3 A;  4A3F J;  4XRS G;  4C2M J;  3LNQ A;  2XSD C;  2LP0 A;  3IH4 A;  5FJ8 J;  4CYC B;  1ORK A;  4CYC A;  2X48 A;  5F04 A;  3BR2 A;  3NAR A;  3GTO J;  3D1N I;  3IH2 A;  4I76 A;  2DMQ A;  1JT0 A;  3JRH A;  5DS9 A;  1RKW A;  2O7O A;  1F43 A;  1OCP A;  2I10 A;  2K40 A;  1JJ8 C;  3I4N J;  4V2G A;  1TWF J;  2XB0 X;  2DJN A;  2L7M P;  2XPW A;  1HCR A;  3BR1 A;  1FEX A;  4D7M A;  2NOG A;  3ZQI A;  3RQI A;  5FKK A;  2R7Z J;  3PM1 A;  1XG1 A;  2GM4 A;  2VKV A;  1ENH A;  1SAN A;  1GV5 A;  3JRA A;  1U78 A;  4A3G J;  2WAQ N;  4DZJ A;  1X2N A;  1EF4 A;  1S7E A;  4B4C A;  3BR6 A;  1ZQ3 P;  3ZQG A;  3CQZ J;  4RBO A;  5FKM A;  5K7H A;  2GBY A;  2DMU A;  5IYC J;  1WH5 A;  3JRD A;  1XS9 A;  2EZL A;  2NS7 A;  3PO3 J;  4M3F A;  3S2H J;  5IP7 J;  3BG3 A;  4M3D A;  2WV1 A;  2JK3 A;  1GDT A;  3CDL A;  4XIC A;  2LD5 A;  2O9L A;  2E19 A;  4BBS J;  3BTL A;  1HDP A;  3G1M A;  4B1R A;  3BTJ A;  3S17 J;  2VPR A;  4A3I J;  3HBL A;  2CRG A;  2XPU A;  3B6C A;  2ID6 A;  2DA1 A;  5F1J A;  3OSG A;  2GLO A;  3JRC A;  3ZQH A;  3JRE A;  2K9N A;  1H8A C;  3S14 J;  1IRZ A;  2OPT A;  4M3G A;  3PO2 J;  3K2A A;  4RDU A;  2N8G A;  4M6V A;  2R5Z B;  5F0C A;  2R5Z A;  1BL0 A;  3GTL J;  1P7I A;  4JX4 A;  4L5E A;  2JN6 A;  4M3E A;  1NTC A;  1FJL A;  4C3H J;  2L7F P;  2X9D A;  5IYD J;  5C4J J;  3GTG J;  1I3Q J;  5K7F A;  1MSF C;  2HOT A;  4W97 A;  2R5Y B;  5J1R A;  4A93 J;  1GVD A;  3S1N J;  1RPW A;  2K9Q A;  1XC5 A;  2CUF A;  1HOM A;  2DA4 A;  1JTY A;  4DW6 A;  1R9T J;  2DA6 A;  2LY9 A;  4JX6 A;  5F0F A;  5IYB J;  5J1U A;  3S1R J;  1WI3 A;  3HOX J;  1JGG A;  2DA3 A;  3BG5 A;  3FIS A;  2HYJ A;  1UHS A;  4XID A;  2R0Q C;  3HDD A;  2NVX J;  1BA5 A;  1ZR2 A;  2B63 J;  3TED A;  1PUF B;  2VKE A;  5FKL A;  1PUF A;  4I6Z A;  1ETY A;  2XGC A;  4X6A J;  1FTZ A;  1LFU P;  3H3V K;  2YS9 A;  4D5F A;  2M2E A;  2D5V A;  5EYR A;  2E2H J;  3LSG A;  1ETK A;  1JJ6 C;  3HB9 A;  2K9S A;  3HGG A;  4DYQ A;  1JUP A;  1MBE A;  3NAU A;  3H0G J;  3LSR A;  5EZH A;  2HI3 A;  1ZGW A;  4ABZ A;  1JKR C;  3ZQF A;  4FTH A;  4A3L J;  5EF6 A;  4A3C J;  1TC3 C;  2HDD A;  1ZK8 A;  1WPK A;  1D5Y A;  1MBF A;  3BTI A;  4BY1 J;  3S16 J;  1QRY A;  3TP3 A;  3IV5 A;  2HXO A;  1G2H A;  2DA5 A;  4FIS A;  4GFB A;  2MGQ A;  3L1P A;  3HM5 A;  3LOC A;  1RKT A;  3RZO J;  3FK6 A;  1WH7 A;  3HOZ J;  5JLX A;  2FD5 A;  1VND A;  2ID3 A;  4NDL A;  4FE7 A;  5HOD A;  2ECB A;  5E3M A;  2VI6 A;  4A3K J;  1BW6 A;  2WB1 N;  3S1M J;  1H89 C;  2H8R A;  2LKX A;  1AHD P;  1MH4 A;  1HF0 A;  5M5X J;  2IEK A;  3GTM J;  2LVS A;  1AU7 A;  4IHW A;  4C3J J;  3WHC A;  3LSP A;  1ETW A;  2H1K A;  4B3A A;  5EZG A;  1CQT A;  2CU7 A;  3GTQ J;  2FJ1 A;  3SJM A;  2EZH A;  1H88 C;  1GUU A;  5IOZ A;  1JT6 A;  1U8B A;  5BNG A;  4A3E J;  3QQA A;  3M4O J;  1T56 A;  2JA7 J;  3BR0 A;  5IP6 A;  1IC8 A;  5IOY A;  3Q0W A;  3WHB A;  4MO7 A;  5M3M J;  4J19 A;  1UMQ A;  1JKO C;  1OCT C;  3GTK J;  2L7Z A;  3CCY A;  2ELK A;  2EZK A;  4JX5 A;  5F08 A;  1IDY A;  3O8G A;  2ECC A;  1W0T A;  5FLV A;  5E3N A;  5FKO A;  4BBR J;  2IBD A;  3HEF A;  2MG4 A;  4W1U A;  5K7Z A;  5EGO B;  5EGO A;  5EEA A;  3Q0V A;  2IAI A;  3DEW A;  2FQ4 A;  2DTZ A;  2HOS A;  5M3F J;  1JKP C;  1ETQ A;  4JP0 A;  3TP0 A;  2O8K A;  1Z77 A;  5JLW A;  1LFB A;  4MFE A;  1Q1V A;  4FE4 A;  2HOA A;  4XRM A;  3C2B A;  4BKX A;  3S15 J;  2ME0 A;  2YU9 J;  3RZD J;  2L0K A;  2R5Y A;  2EZI A;  2DMN A;  3MN2 A;  3DCF A;  2E1O A;  2RAE A;  1RES A;  2XGE A;  2LK2 A;  1P7J A;  1A6I A;  3TW7 A;  3O8H A;  2JMW A;  4Y7N J;  2NS8 A;  5E3O A;  2E2I J;  2XB5 A;  4X1E A;  1DU0 A;  3SFI A;  5GP9 A;  2CQQ A;  4BY7 J;  3ZQC A;  1O4X A;  1I6H J;  2LR8 A;  1BJZ A;  2PMZ N;  1Z0X A;  3MVP A;  4IHY A;  5C3E J;  1MSE C;  1E3O C;  4A3J J;  2P81 A;  1WGX A;  1I50 J;  3BQY A;  2EH3 A;  1IDZ A;  3M3Y J;  3Q0U A;  2X6O A;  3HKZ N;  3OOU A;  5F27 A;  1TWH J;  5M5W J;  4A3B J;  2MW8 A;  2DN0 A;  4FCY A;  3S1Q J;  3HOY J;  4S0H B;  5F0H A;  1ZTR A;  3BR5 A;  3F0C A;  1MBH A;  3BR3 A;  2M9H A;  2CJJ A;  1F36 A;  2Y31 A;  4UUT A;  3JRI A;  3JR9 A;  1ZR4 A;  2Y9Z A;  4DZP A;  2QCO A;  4IHV A;  1OJL A;  4AYB N;  1AKH B;  1MH3 A;  1HDD C;  1AKH A;  4QIW N;  3W6V A;  5FLM J;  3HOW J;  2JA5 J;  1APL C;  2CUE A;  2MSY A;  4MFD A;  1JUS A;  3JRB A;  3GTP J;  2COB A;  4M3B A;  1POG A;  3S2D J;  1IV6 A;  2NVY J;  2Y30 A;  2EBI A;  3A03 A;  1RET A;  2YUS A;  3Q3S A;  1IUF A;  3GBG A;  3HOU J;  1ITY A;  5FKN A;  1JKQ C;  1FIA A;  1B8I B;  1B8I A;  2AHQ A;  4XK4 A;  4DYC A;  3A02 A;  4D5C A;  5IPA A;  3FIW A;  2HXI A;  3G1O A;  3QPS A;  3HOV J;  4UUS B;  2R93 J;  2JWT A;  4UUS A;  1ETV A;  5E3L A;  2Y0S N;  3SDG A;  3BT9 A;  3K7A J;  2LFB A;  5EDN A;  2ZB9 A;  1VF9 A;  1A5J A;  1X58 A;  4HNV A;  3A01 B;  3A01 A;  2XRL A;  1VI0 A;  4A69 C;  9ANT A;  2LTP A;  3E7L A;  5J3L A;  1TWC J;  4G12 A;  5IP9 J;  5DTD A;  3TW6 A;  3JRF A;  1K61 A;  4MLO A;  4DYR A;  1HLV A;  2TRT A;  5GPC A;  5C4X J;  2Y2Z A;  1FIP A;  1UG2 A;  3CMY A;  1K83 J;  1RR7 A;  2AO9 A;  4Y52 J;  3QPL A;  2HQ5 A;  2JA6 J;  1IGN A;  2KT0 A;  3OIO A;  2M0C A;  1QVU A;  2KDZ A;  4JYK A;  3I4M J;  1ZKG A;  1GT0 C;  2E2J J;  3HGY A;  1TWG J;  1NK3 P;  4QSH A;  4XRS A;  1MNM C;  3MKL A;  4A3D J;  2Y9Y A;  2TCT A;  1VFC A;  2CQX A;  1QVT A;  3G1L A;  1ETO A;  4AC0 A;  2L9R A;  4C3I J;  2QF7 A;  3ZQL A;  1IG7 A;  1BW5 A;  3GTJ J;  2DMT A;  1OFC X;  1U9N A;  2G0E A;  1JUM A;  3BQZ A;  1LE8 B;  1LE8 A;  4A3M J;  5GPA A;  2DA7 A;  1QPI A;  2OF7 A;  4LOC A;  4V2F A;  2XPV A;  4IHX A;  2LLK A;  2ME6 A;  3UKG A;  2W48 A;  3RKQ A;  3OSF A;  4BXX J;  5C44 J;  3B6A A;  1GV2 A;  1X2M A;  3JRG A;  2NVT J;  4IEJ A;  2FX0 A;  1W0U A;  2EQR A;  2NVQ J;  3FKI J;  1B72 B;  2VUM J;  1DU6 A;  1B72 A;  4EEF G;  4D7N A;  5M5Y J;  1TWA J;  3VPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...