1FJLA

Homeodomain from the drosophila paired protein bound to a dna oligonucleotide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
b'KQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRKQHTSVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAIRED PROTEIN
publication title High resolution crystal structure of a paired (Pax) class cooperative homeodomain dimer on DNA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 25
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1995-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fjlA00
5M5XJ 1ZKGA 3BR0A 2DMTA 3S1QJ 4Y52J 3JRFA 5EYRA 2WB1N 1QVUA 5J1RA 2MW8A 3BR1A 2R5YA 3HOZJ 1JUSA 4IHVA 3MVPA 3DCFA 4X1EA 3CMYA 1FEXA 3IH3A 1D5YA 3OOUA 1WH5A 5EGOA 2HXIA 2HI3A 4W97A 4DYQA 1ETVA 5FKMA 5EG0B 2E1OA 4B4CA 1BL0A 3H3VK 3S16J 1MH4A 1XC5A 1JKQC 3H0GJ 3HOWJ 2LK2A 1OCTC 3GTOJ 3TW7A 2FQ4A 4B1RA 3HOYJ 2MSYA 1B72A 2Y9ZA 4JP0A 4UUSA 5EDNA 2XRLA 3IH2A 2LY9A 2Y31A 4ABZA 2CJJA 3GTMJ 1S7EA 5FLMJ 1ZQ3P 3GTPJ 2X6OA 1UHSA 3OSFA 1RR7A 4C2MJ 1U8BA 4G12A 3TP3A 2JK3A 3B6CA 1APLC 1GVDA 1JGGA 1TWAJ 3RQIA 2DMPA 1LE8B 5F1JA 5IOYA 4GFBA 3ZQFA 1ITYA 2NOGA 1B8IB 2L7MP 1XS9A 3JRDA 2L9RA 2NS7A 4M3BA 1VF9A 4A3KJ 2LFBA 1IRZA 3LSGA 1P7JA 3LSPA 2ZB9A 1VI0A 1X2NA 4CYCB 5C4XJ 3E7LA 4A3LJ 1MSEC 4DYRA 4DZPA 2R5YB 1IV6A 2R5ZA 4HNVA 2KT0A 2VKVA 1HCRA 2AHQA 2Y30A 3I4MJ 3S2HJ 1MBKA 3HGGA 1SFOJ 5F0CA 5M5YJ 3SJMA 4IEJA 4M3EA 1H8AC 5FKNA 1FJLA 3G1OA 3RZOJ 2EH3A 2D5VA 2CUEA 2CUFA 1Q1VA 1TWCJ 2I10A 3FK6A 2VUMJ 2LLKA 2QCOA 2ELKA 5FKKA 3DEWA 2VI6A 3HOXJ 1K61A 4XIDA 3O8HA 3MN2A 4A69C 5K7ZA 3MKLA 2ME6A 5C4JJ 3HKZN 1LE8A 1ETXA 1LFUP 2M2EA 4C3HJ 4XICA 1F43A 2LP0A 2OF7A 3UKGA 1GV2A 1RPWA 1CQTA 1Z77A 2E2HJ 4QIWN 5IP7J 4BKXA 2GLOA 3CQZJ 3BQYA 4MIMA 3ZQGA 3C2BA 4D7MA 1ETYA 2L7FP 2HXOA 2XPUA 4C3IJ 4NDLA 3HEFA 3S1RJ 4CYCA 1AKHA 2K9SA 2P81A 2RAEA 4M3DA 1NK2P 2H8RA 1BW5A 2CRGA 3BTIA 1H89C 1MBFA 1HF0A 1EF4A 1VNDA 1BW6A 2MG4A 2O8KA 1K83J 1TWGJ 3SFIA 3QQAA 3M3YJ 2K9NA 3GTQJ 3TP0A 3S1NJ 2E19A 3BTCA 3GTGJ 5DTDA 4C3JJ 1SANA 1RKTA 3HBLA 2E2IJ 4X6AJ 3GTJJ 3JREA 1POGA 4J19A 4FTHA 5GP9A 3BT9A 3GTLJ 2JA7J 5IYBJ 3D1NI 2R5ZB 2EZLA 3FIWA 2GM4A 4M3GA 4BBSJ 3NAUA 3S1MJ 2O7OA 4A3FJ 1MH3A 5M3MJ 1ETKA 3A02A 4XRSA 2R92J 3A03A 5JLWA 3ZQHA 2VKEA 4UUTA 2M9HA 1JKOC 5F04A 2DA6A 4DYCA 1BA5A 2HOSA 1TWHJ 2NVQJ 1A6IA 3BG9A 3HM5A 3WHBA 5DS9A 5E3OA 2NS8A 3S2DJ 1MSFC 2DN0A 2DMQA 1W0UA 3BG5A 2JA6J 1ZK8A 1H88C 2LD5A 2L0KA 2M8GX 1WGXA 4EEFG 4DW6A 4FE4A 1MNMC 3HDDA 2M34A 5J1YA 4JX6A 3WHCA 1GDTA 1QVTA 2QF7A 1ETOA 2L7ZA 1AKHB 1YRNA 5F0HA 1R9TJ 2H1KA 5K7HA 4QTRA 1Y1WJ 1MBHA 4AC0A 2YUSA 1HDPA 5GPAA 1O4XA 3S15J 2NVTJ 1ETWA 3Q0WA 1T33A 1RESA 3L1PA 1NK3P 1XG1A 4L5EA 4AYBN 1AU7A 5E3NA 5HODA 2XGEA 2FJ1A 5IP9J 3PO2J 5J1UA 1QRYA 3TW6A 4IHXA 3M4OJ 1TWFJ 5F27A 1IC8A 1JUMA 1RKWA 2DA5A 5C3EJ 2EZKA 4BBRJ 3VPRA 2KDZA 3S17J 2Y9YA 2Y0SN 1IUFA 1ZGWA 2R7ZJ 2JA8J 4AUXA 1IDYA 2TCTA 1HLVA 3LSRA 1UMQA 1DU6A 3JRGA 2FX0A 3JRAA 4LOCA 2B63J 3LNQA 5F0FA 3BR5A 3HB9A 3QPSA 5EF6A 4XRSG 3CDLA 1VFCA 2DA1A 3BG3A 4I76A 2JMWA 1RETA 1WPKA 2K40A 5M5WJ 2JN6A 3OSGA 1JKPC 2R93J 3ZQCA 5J3LA 3Q0UA 3HGYA 1FIPA 2LVSA 2HOTA 4A3DJ 1NTCA 2PMZN 1HDDC 3FKIJ 2E2JJ 5BNGA 1ETQA 2EZIA 1Z0XA 5FKLA 5JLXA 2DA2A 2MGQA 2NVYJ 2K9QA 1YRNB 5IPAA 2VPRA 1ZR2A 2CQQA 2NVXJ 2N8GA 4M3FA 2ID3A 3A01A 1ORKA 3JRHA 3SDGA 1I50J 3K7AJ 1PUFA 2O9LA 2HYJA 2XPVA 1QPIA 3G1LA 3S14J 1IDZA 1MBEA 4A3CJ 2XGDA 1MBJA 3NARA 2JWTA 5FLVA 5EEAA 3HOVJ 2IAIA 3JRCA 3ZOBA 3G1MA 2YU9J 2IBDA 5IOZA 3I4NJ 2ID6A 2YS9A 3BTLA 1U78A 1Y1VJ 1HOMA 3LSJA 3TEDA 2LTPA 3ZQLA 5FKOA 2EBIA 4B3AA 2EQRA 4A3JJ 1F36A 2G0EA 2M0CA 2ME0A 3LOCA 1JTYA 4I6ZA 2DA3A 2JJ7A 1JJ8C 4A3BJ 2OPTA 1A5JA 2CQXA 1FTZA 3GTKJ 2R0QC 1U9OA 9ANTA 1WCMJ 3ZQIA 3CCYA 3QPLA 3Q3SA 1DU0A 3IH4A 3Q0VA 1TC3C 4D5CA 1GUUA 3W6VA 1OFCX 4MO7A 2HDDA 1FIAA 3BR6A 1AHDP 5GPCA 5EZHA 4A93J 2DMUA 3PO3J 1GV5A 4MFDA 1T56A 1ZR4A 5E3LA 5E3MA 4RDUA 3HOUJ 2DJNA 4XK4A 1JT0A 3BR2A 3JR9A 2XB5A 1IG7A 3OIOA 1OCPA 2LR8A 1ZTRA 4Y7NJ 4V2FA 5EZGA 1GT0C 2X48A 4IHWA 4JX5A 3B6AA 3A01B 1I6HJ 1G2HA 4MLOA 4JYKA 3BQZA 4IHYA 2IEKA 4D5FA 1PUFB 5EG0A 4XRMA 1IGNA 1X2MA 3JRBA 3RZDJ 1E3OC 3GBGA 1IJWC 5C44J 1OJLA 4MFEA 5EGOB 1JUPA 3FK7A 1X58A 1WI3A 2AO9A 1UG2A 2X9DA 3RKQA 1BJZA 4A3IJ 5K7FA 4BY1J 1FTTA 4DZJA 3FISA 2ECBA 1LFBA 3PM1A 1ENHA 2HQ5A 2EZHA 2TRTA 2WAQN 2XPWA 3F0CA 5F08A 1MBGA 2DA4A 2COBA 1W0TA 1I3QJ 2LKXA 4S0HB 1P7IA 1JT6A 4QSHA 2ECCA 3JRIA 4A3EJ 4A3GJ 1B72B 5IP6A 5IYCJ 3K2AA 4UUSB 4A3MJ 2XB0X 4JX4A 3BTJA 5IYDJ 1JTXA 2XSDC 4FCYA 5FJ8J 2W48A 2DTZA 4V2GA 2DMNA 2WV1A 1JKRC 3IV5A 2GBYA 1B8IA 2FD5A 4RBOA 5M3FJ 2CU7A 2HOAA 2XGCA 4M6VA 4W1UA 4FE7A 4FISA 3BR3A 2Y2ZA 1U9NA 1WH7A 2DA7A 4BXXJ 3O8GA 4D7NA 1JJ6C 4BY7J 2JA5J
chains in the Genus database with same CATH superfamily
1D0YA 5M5XJ 2ADUA 2K4BA 4A6EA 3JRFA 5EYRA 1QVUA 4FT8A 4AIDA 2V9KA 2R5YA 3HOZJ 3MVPA 2YR2A 2WC2A 3CMYA 4Y17A 2STWA 2HYGD 1D5YA 2BW3A 3OOUA 3IRQA 4Y13A 5AIPA 2EA4A 2PN6A 3G3ZA 4BL0B 4XKVA 2Z1DA 4P1WA 2E1OA 1J7KA 1MH4A 3VOEA 1JKQC 3H0GJ 2OA4A 2OTJI 4CA0A 2LK2A 2KQRA 3GTOJ 1JE8A 1G59A 1MMDA 2FQ4A 3HL2A 5EEGA 1T0FA 2UV1A 2M45A 4YRVA 2MSYA 5FRNA 3K70D 4IQ4A 2DYSH 4GYGA 2PG4A 3OYEA 1K6YA 3NWSA 3CO7C 2LY9A 2XASA 2Y31A 3OYAA 1HBXG 3IAM2 1ZQ3P 2XF5A 3T0YA 2VC0A 1HW5A 2GOMA 1ON2A 2XDVA 1IN6A 1FP2A 4UHTA 4BHPA 1Z21A 3SEQA 3OSFA 1RR7A 2GAUA 2LSOA 3DTKA 1JHFA 5K1YA 4G12A 4B3XA 2FA5A 1I5ZA 3QAHA 3OYJA 3B6CA 4IQJA 4LLNA 2KRCA 2HTJA 4CHUA 2KPMA 1G6NA 4PJLA 1LE8B 3CC2I 2XGXA 2AQEA 1FZPB 3RKWA 3ZQFA 5BQTA 1B8IB 2KRFA 2HZDA 2ZNZA 3FWEA 3G4SI 2MLKA 1TL8A 3K1PA 1XCVA 4EGYA 3VYUB 1SMYF 2DDBA 2Z99A 4RAGA 4IRIA 2DFIA 1K4TA 1FY7A 4OOIA 4RGXA 2O03A 1B9MA 5HLTA 4HDVA 1P7JA 3LSPA 4PGGA 1IUYA 4DYRA 1VQKI 2QYOA 1FOYA 3OYNA 1Y6IA 4UY8I 1WJBA 1IV6A 2R5ZA 2KT0A 4XLEA 4PJNA 1R4MB 3VSKA 4M9SA 4GRIA 1MKMA 1MMNA 3VYSB 2RGVA 3K9TA 4IEJA 5B1AH 2V26A 5DCMB 3LQQA 1FLIA 3RZOJ 5IY5H 2D5VA 1YFHA 3CMEI 2EJRA 2I10A 3FK6A 2F48A 2ELKA 1XB4A 4HF2A 3AL0B 3BPXA 5CLSA 3DEWA 2VI6A 3K4LA 5E1XA 1YS6A 3HOXJ 3WTSC 3O8HA 4UB6C 3LMMA 1TW2A 4EJTA 5ERIA 2O5RA 1ZG1A 3MKLA 1IRXA 2GIZA 1ETXA 3H92A 2EFWA 2VB6A 3DEEA 4ETSA 2V6CA 3UR3C 3UKGA 4A6DA 4BE1A 2JSPA 2E2HJ 1LVAA 1GHCA 3KYLA 2Q0OA 2V7FA 2GLOA 2PMHA 1T38A 4ASNA 2L4AA 1T08B 3C2BA 5CYVA 4YELA 2DO7A 3S1RJ 2K9SA 2P81A 3K4MA 4XLPF 4ZTJA 2H8RA 1BW5A 3MCZA 3WTXC 1H89C 1O7FA 4AYBA 1VNDA 1BW6A 2OQGA 3LA2A 1TWGJ 2QKLB 1V54H 2XAHA 3J7ZI 3REOA 3M9AA 4XR6A 3TP0A 5LRSA 1RUNA 3S1NJ 3H9GA 2KMUA 5GADJ 4OIPF 4CGZA 4C3JJ 2P6SA 1SANA 4GYIA 1QZYA 1RKTA 2E2IJ 2R7SA 3JREA 3CCEI 5HLIA 2XSJC 3OYFA 3BT9A 3I53A 1FT9A 2M8EA 4JOMA 1BOAA 5DUKA 2JA7J 3D1NI 4ZDPA 2JVHA 2NOJB 2F5VA 3LFKA 3NAUA 1I3AA 4A3FJ 2VXZA 3E1SA 3A02A 2R92J 3ABMH 3LFUA 4BHBA 5JLWA 1SVMA 3ZQHA 3PSIA 4UUTA 2M9HA 3O3KA 3ESWB 2Y75A 2R7FA 2P8TA 4HBLA 1U8RA 4DYCA 1SEUA 2ICWG 4LG3A 3CC4I 3LAJA 2AQFA 4GDFA 3BG9A 3HM5A 3WHBA 3KYCB 5LHIA 2NS8A 1P6RA 3PSFA 5KAIC 1MNDA 3MKZA 1MSFC 3BG5A 3A2KA 2A61A 1J75A 4XN3A 2JA6J 3R61A 2ZFWA 2LD5A 4EATA 1Y8RB 2F5EA 4NC7A 2FF4A 3HG9A 1SFUA 4G7ZF 4PFOA 2HNHA 3K4JA 3HDDA 2RNJA 5J1YA 1Z05A 3F8FA 3ERED 1ETOA 1O3TA 1IN8A 2ZXIA 3V7CA 1KU9A 2L7ZA 2LH9A 1YRNA 4XL9A 3OYMA 1R9TJ 2BVMA 3C1DA 2H1KA 2V1UA 1QZEA 4QTRA 1MBHA 2YUSA 2VE8A 5J4YA 1HDPA 3MD2A 4RLQA 4G8XA 3S15J 4FHTA 1ETWA 2Z3YA 4PFPA 1T33A 4GGGA 4AWXB 1MMSA 1P2FA 4HG2A 4ON0A 5E3NA 5HODA 2V1DA 2BEOA 4G7OF 4E7KA 3ZPLA 4LIUA 4TV7A 2DT6A 3KPHA 3PO2J 1BN5A 1G3YA 2L01A 2WA0A 3MZYA 4ZC3A 1IC8A 1JUMA 2DA5A 3OS1A 1DQUA 3RSNA 2EZKA 4BBRJ 4ZH4F 3BCAA 1MIJA 2KDZA 1VQLI 2CH0A 4Q5SF 4M71A 2PBIA 3RJPA 2NNNA 3CLQA 1WVRA 4AVPA 2JA8J 4A0ZA 1U3EM 2WWYA 2P7VB 3I59B 3QU6A 5LGUA 1HW2A 1KYZA 2F4OB 3DP7A 3SHFA 3PIPF 2ZCWA 4OIRF 2B63J 1P4AA 2WTEA 5F0FA 4O5VA 3BR5A 4HNUA 5E8IA 1LPQA 4UUVA 2YX7A 4NB5A 5EF6A 1E0EA 5H2FC 1VQPI 2GIVA 2VASA 1VFCA 1MNEA 2W4SA 2R7VA 4LITA 2K40A 3LSHA 3S93A 5TJJA 1MJBA 1RNLA 1PVEA 1YI2I 5F64A 3FXQA 3QOPA 1NTCA 2PMZN 3DTEA 4OINF 3FXLA 4HEA2 4BDZA 2HKOA 3ERMA 3NWTA 2Q2EA 1ETQA 1WJFA 5ILUA 2HQNA 2ZMEB 2NVYJ 2RNGA 1ZG3A 2VPRA 4F91B 2CQQA 3E0JB 2N8GA 4M3FA 2BXYA 3DV8A 4CZZA 3EUAA 2BHYA 1AOYA 3I55I 2EV0A 4UXNA 3SDGA 3K10A 3K7AJ 3H0DA 1YTYA 1DPUA 2QSFX 1MZBA 4R1HA 1BI1A 2JVGA 1K79A 2BYVE 3OYKA 2VBWA 4JBAA 4A3CJ 1D8KA 3WTZA 1G4DA 4EM1A 2LDUA 3CD6I 3R6SA 2HKXA 2FBKA 2NAZA 3E6MA 5GTHC 3HOVJ 1F5TA 4LFUA 3G1MA 3KZYA 1U78A 5D4SA 4ENNA 1HOMA 4IOAF 3PNVA 4PUSA 4YFNF 3ZQLA 1DPRA 5J40A 2ISYA 4B3AA 2STTA 1R00A 2VC1A 1F36A 2G0EA 1FX7A 1JTYA 4I6ZA 3BZKA 1T2KA 2VODA 2LMDA 5HS8A 4WK8F 3GFJA 3I64A 1A5JA 1ZLJA 2Q1ZB 3DKXA 1U9OA 3QYFA 2D45A 5D6EA 2ZJ2A 2IS6A 3SZTA 3KCCA 2QA4I 2BXZA 1LJ9A 2H1LA 3Q0VA 3KP6A 1OFCX 1D1BA 1FIAA 1AHDP 3KX2A 2HDDA 4LB5A 3K6GA 3R0AA 4XLCA 1OR7C 2DMUA 2LRDA 3DWLE 4ZYDA 4BE2A 1GV5A 3QP6A 4MFDA 4ZTFA 4B09A 3CDHA 1ODDA 1E3PA 3KEQA 3Q9VA 1JT0A 3BR2A 2A6HF 1IG7A 3OIOA 4XLFA 2NVUB 3GZNB 3F72A 1OCPA 2XRNA 1D5VA 5E1ZB 2QBYB 5EZGA 4LGWA 5KK1A 3I9V2 5BMZA 4IKFA 4JYKA 5TGTA 2H09A 2DBBA 2JRMA 2QUFA 2MH9A 4CDGA 2M87A 2IEKA 4IHYA 2DT5A 2FOKA 1PUFB 4C2TA 3LSIA 3E6DA 1E3OC 2KIFA 3RZDJ 2D2WA 1GVJA 3OL3A 2DODA 1OJLA 3VDXA 3OS2A 4CCMA 3ABLH 4MFEA 4LG0B 2A6TA 4XLNF 4IX7A 2BY1A 2X9DA 1WI3A 1OLTA 4UVBA 5K7FA 2MA3A 2A69F 1L0OC 3SEZA 1S6LA 1G3TA 1OKRA 4MTDA 3IKTA 5A2QZ 1O3QA 3CUQA 3F0CA 3HXLA 1U6GA 1I3QJ 5HLGA 4S0HB 1P7IA 3T1BA 1JT6A 3RTRA 3CCJI 5ILSA 1E3HA 3CP2A 2UUZA 4ITVA 4ZYGA 3JRIA 2QM3A 1FPQA 1I39A 5IP6A 1R5ID 1SD4A 2XB0X 1MDMB 4XORA 4FCYA 3B73A 3PFYA 4IZZA 2W48A 2XVCA 3ZN1A 3WODF 2WV1A 3IV5A 2GBYA 1R49A 2FD5A 5M3FJ 4G7HF 3FMRA 1FMVA 3P5JA 2OC6A 2XGCA 4W1UA 4EJVA 4M9ZA 1FBUA 2LY1A 2Y2ZA 2IS2A 2VQGA 4BXXJ 1W1WE 5L3CA 3K4NA 1XPXA 1P4WA 5E1WA 5KVRA 4E4HA 1MJAA 5L3DA 2JA5J 2L5QA 3BR0A 1OYIA 4LLLA 3MEXA 2MW8A 1KZHA 2QLZA 4IHVA 2D1HA 2GA1A 1S29A 3ZN0A 3AL0C 1YW8A 5DEQA 2M4KA 2A68F 5J6XA 1A04A 3H1CA 1XSDA 2HXIA 4XN0A 3I58A 4DYQA 2DI3A 1XDSA 3HRSA 1ETVA 5EG0B 4B4CA 2Z33A 1EKEA 4EJWA 3QRFF 1EV7A 2HVSA 3HOWJ 2MFZA 3KP4A 5DM6F 3ASNH 2ZC2A 3TW7A 3IWFA 3K4KA 3O6BB 4EJOA 3SZGA 4P9UA 1X4PA 3LA3A 4HF0A 3HOYJ 2EIKH 2KP6A 2Y9ZA 1N75A 2FRHA 4E7ZA 3EETA 5J4VA 3IH2A 3D5LA 4ABZA 3DEUA 1R4NB 5BPIA 3GTPJ 4Q48A 1K78B 3GYHX 4XSZF 2KZVA 1IF1A 4HQMA 4PDKA 1LDDA 3EPZA 4P9FA 1CGPA 1IZ1A 1WJ5A 3BG7A 2EINH 1HQCA 2EFQA 2MD5A 1JGGA 4NUBA 1UFMA 2H6CA 5F1JA 4F52A 1P9QC 1ITYA 2A6EF 1V3FA 3TO6A 3HUGA 3FKJA 5D8LB 1VF9A 2BE5F 1WHUA 1FOWA 2F5FA 2Z16A 2PFBA 1RRJA 2LFBA 1X19A 2IP2A 1IRZA 1TNTA 2E71A 4ENKA 2DPDA 2ZFUA 5B66C 2CS3A 5C4XJ 1X2NA 3DU5A 4HSTA 4RMNA 3S3OA 4A5MA 2HU9A 1ACIA 3R0JA 1XMKA 3RYRA 4HNVA 4KDPA 3DLAA 3M07A 5ILVA 2PI0A 4OIOF 4BUPA 2M4GA 1X4OA 5FD6A 3VB2A 1C0WA 1YE9A 2FMYA 2CG4A 3F3XA 5ICEA 1FJLA 1H8AC 1XSVA 3PUBA 4ESBA 5BOXA 4F92B 1B6AA 2EH3A 3FXRA 3ISPA 2HEOA 3ZMTA 2ZXHA 1WI9A 3MAJA 1TWCJ 3BLYA 2M3AA 3Q9SA 4HYEA 2VUMJ 2IS1A 3BCBA 4UVCA 3WTTC 4II3A 1AWCA 1R5GA 2IGMA 3ZMSA 1YG2A 4XOPA 1H9GA 4DBQA 3MN2A 3BOQA 5K7ZA 3H5NA 2R4GA 5H6RA 2E5NA 2ME6A 3S8PA 3CJTB 4Z6YA 3WGGA 1F43A 1GV2A 1YJWI 3WTVC 1FWZA 3O2PE 4MIMA 3ZQGA 3I71A 4D7MA 3OWTA 3TDZC 1A35A 3ZQ7A 4C3IJ 2ZJQF 1ONVA 3HEFA 2MYSA 3MFKA 2ACJA 1HSTA 2CRGA 1MBFA 2DK8A 4WXDA 2XROA 2KJBA 1IV8A 2O8KA 3KIOA 4MHGA 4KT6A 2R7XA 2IJLA 1USTA 2BY3A 3QQAA 3M3YJ 3GCMA 4IHTA 3GTQJ 4Y4RA 2MC4A 1W5SA 4ZZLA 1U5TB 3M7GA 4R8HA 2DFEA 2FXAA 3L2UA 2VKHA 1Y0UA 2H6BA 5JHFA 4J19A 5GP9A 3L2RA 1GXPA 2V1XA 5IYBJ 2EZLA 4ZYAA 1LNWA 3HKZA 3E6BA 2O6GE 3QYEA 4YIFA 2DXIA 5M3MJ 3G71I 1ETKA 1TBXA 4L9JA 4ESJA 3I3LA 3ASOH 3ABUA 5CPRB 4WF2A 4HZFA 2HZTA 3COAC 1SMTA 1UHMA 2L3DA 2BY2A 4IRHA 4DOZA 1W5CC 2P4WA 3EYYA 1QBJA 1BA5A 2DW4A 2HOSA 3VODA 3I0TA 1A6IA 3FM5A 2CGPA 2ESHA 5DS9A 1JI8A 2AXLA 2NS0A 3KP5A 4AM3A 3HHGA 2ZNYA 3SFZA 4N4OB 3SQNA 2ZMEC 2LBFA 4N9HA 5F6FA 1YIJI 1VQMI 3KP7A 1ZK8A 4YIIA 2PLYA 1XSXA 2K3FA 4O3MA 4KIGA 4HV5A 4DW6A 1KQ9A 1MNMC 3A4CA 3L7WA 2M34A 2OAZA 4HOBA 4HLYA 4WCGA 5AIQA 3NRVA 1N77A 1AKHB 1QHGA 5F0HA 4PJJA 5K7HA 2FBIA 1Y1WJ 4ZDLA 1FSEA 1RR8C 2W85A 3HPGA 2PX9A 2O8XA 4OAYA 2WADA 3OYBA 1O4XA 2AS5F 2ZSIB 2NVTJ 4RB2C 2IA2A 2BVLA 1PP8F 3Q0WA 3H3ZA 1RESA 1SVLA 3L1PA 2GZWA 1YLFA 5LGNA 1XG1A 1AU7A 3PQKA 4EQQA 3OOPA 2VONA 4HX7A 2R3SA 2FJ1A 2V1NA 5J1UA 4HRIA 3MQ0A 3M4OJ 5F27A 1R58A 2KIQA 1RKWA 1YITI 4PK4A 4DJAA 3DBRB 2HPIA 3AFHA 1W5TA 1W7PB 1BR1A 2O0YA 2E1NA 5DUIA 5KNLA 1QNTA 1XGOA 1OCRH 3HZJA 4NC8A 4N4NB 1YX3A 2DOAA 2VOOA 1IDYA 1HXDA 1NG6A 1UMQA 5A2QK 4UV9A 2RDPA 4E7SA 3FBIB 5LFAA 3LA7A 1O57A 3HB9A 4BJ6C 3BP8A 2ZXJA 1S8NA 2E1MB 2L9VA 5HDKA 1FBQA 3B02A 1I27A 4A0YA 2JMWA 1RETA 3OSGA 1REPC 1LEAA 2B9SA 4HX4A 2BZTA 3Q0UA 1ZAOA 1N78A 1A31A 4U88A 2HOTA 2VXDA 4XOTA 4HNTA 1HDDC 1DP7P 4ZJZA 4V19K 1YO5C 2EILH 5BNGA 2EZIA 5D5UB 3UNGC 3R4KA 3ZMDA 5CVIA 4EV0A 5FKLA 2V9VA 2CWEA 2Y0SA 5IPAA 3T8RA 1IO2A 3A01A 3WG9A 3JW4A 3U2RA 2QQBA 3TGNA 3CP8A 3IL2A 3GVAA 1I50J 3P9IA 2CQ7A 1S5LC 1KGSA 2HYJA 1WJDA 4XKBA 1UZCA 2F5CA 3L2CA 1QPIA 2DOFA 3G1LA 2KHMA 2Z9OA 1IDZA 4XQFA 2MH2A 2H8WA 1WZ2A 2XGDA 2X1EA 2YU3A 3V8JA 2DTRA 1IXSB 2JWTA 5EEAA 2X6YA 3RYPA 3CLOA 4F7ZA 1E2XA 2K27A 1FYLA 2KL4A 2IBDA 4B44A 2ID6A 2IGKA 5L3BA 1Y8QB 3BTLA 3FHNA 1Y1VJ 3WU2C 2V6EA 2DQRA 2QGUA 4BXFA 2FBHA 4CCJA 5FKOA 3L09A 1FOKA 2IGOA 2Z5UA 5HDGA 1QZZA 4C2UA 3JSOA 4E7LA 1LVKA 2XF6A 2MC3A 4RAZA 4JK1X 3AG4H 2TDXA 1ZARA 3CUQB 2WY7Q 3IHUA 3TQNA 2CQXA 1FTZA 5DM7F 1KQ0A 4ESFA 4G9YA 3ZGKA 9ANTA 1YJ9I 5JFRA 4BQOA 1XD7A 1O7LA 4YFKF 5LHGA 3QPLA 3HC7A 1TC3C 2QSGX 2JUGA 4BACA 5EZHA 3PO3J 3M8EA 4RDUA 4OU0A 3RPUD 1R23A 3DPTA 3FMQA 3KLOA 5J47A 1KONA 3CO6C 1IRGA 2LR8A 2R7DA 4LIVA 1Y39A 1L3LA 2GA2A 4I02A 4U0WA 4IHWA 4JX5A 3B6AA 6PAXA 1ZLKA 5HNHA 3ULQB 2P5LC 2MLGA 1F4KA 2M7BA 5E20A 1DP3A 4XRMA 1W7PD 1ZHFA 2CW7A 2QVOA 4GXOA 1X2MA 2RVCA 3JRBA 4NHJA 1YIOA 3GBGA 1IJWC 2VN2A 2VJJA 1E17A 1XX5A 2R7OA 4MQVA 5LD2C 3A0HC 3EUKL 3C7JA 2AO9A 1UG2A 4DQ2A 4A3IJ 2ZBKA 2RV8A 2QZ8A 3FISA 4G6DA 4CCOA 1LFBA 2OBPA 3PM1A 3QOEA 2JRTA 2K85A 3BC8A 3L00A 2COBA 5LBQA 3H9QA 2W7NA 3W2VA 4QSHA 2ECCA 1TZLA 4A3EJ 4A3GJ 1OMIA 4JX4A 3OYHA 2O61A 1LDJA 1KYWA 2XSDC 3M8JA 2Y0MA 1MJ9A 1X3UA 2K86A 3QPTA 2LY2A 4S05A 1WWXA 2JPBA 1JKRC 1T39A 1PYVA 1B8IA 2BGCA 4U87A 1UAAA 4RS8A 4RBOA 2IRFG 4NC6A 3X2QH 2MABA 4WXHA 4M6VA 4FE7A 4WX9A 4MEYF 2HVRA 4M73A 4B48A 2DA7A 1CF7A 5HDNA 2LYCA 4FQGA 5GTIC 4BY7J 3V4GA 3EUHA 2DMTA 2JTVA 4Y52J 4KITB 1SVOA 1WSUA 4RGSA 4BH9A 4KFCA 3BR1A 1JUSA 4NBQA 5LRRA 3DCFA 2WAQA 5L3FA 3IH3A 3KP3A 2KIMA 3ABTA 5K5RA 1A36A 1R5HA 1WH5A 1TQIA 4L9TA 3I56I 1UJ8A 3FXJA 2HI3A 1OYYA 4W97A 5FKMA 3H3VK 4XRFA 5DCMA 4KN7X 4BEHA 2EFPA 1TQMA 5DYMA 2CW8A 1MD0A 1TP4A 4E70A 4AIJA 5LGTA 1B72A 3CF2A 3ZCOA 2M30A 4UUSA 1QQIA 2KDOA 2OCCH 4L5JA 3HPHA 3ML6A 1X3ZB 2JA2A 4M6YA 1R7JA 3GTMJ 4AIHA 5FLMJ 2FUG2 3K1NA 2X6OA 2NYXA 1MMGA 3CCVI 3KZIC 4BGDA 2P7CB 3MKWB 2WB1A 1G3WA 2JQ7A 3GO5A 1DGWY 2KJCA 2PEXA 3TP3A 1U5TC 2J5OA 3MZHA 2DMPA 2P0WA 2XHKA 4DBRA 1VQOI 2OCEA 4GFBA 2KLOA 2X1CA 2EIJH 1JHHA 2NOGA 3CZ6A 3BDDA 2L7MP 2IGNA 2K02A 2NS7A 2V79A 4OWRB 1IW7F 3JCUC 4L0YB 1N25A 2VT2A 3K4BA 3LSGA 3ZMUA 3FF5A 1KA8A 2ZB9A 1VI0A 3CCLI 1YHQI 3MZ8A 1XGNA 2K4JA 2VQLA 4IRGA 4DZPA 3FHZA 2R5YB 2FE3A 2VKVA 3HIFA 5KCMA 2DCEA 5ICCA 2BW3B 2NXNB 5H6QA 3I4MJ 5D6FA 3H36A 3S2HJ 1F1ZA 3HGGA 1SFOJ 2KZGA 5F0CA 2IA0A 3CCQI 3EQLF 4KYWA 2QQ8A 5FKNA 1LDKB 3DPLC 1YQAA 3V7SA 1Y0NA 3L2QA 3C3WA 1KU7A 2LNBA 5K5OA 2FOWA 2CUFA 1I1GA 1J5YA 5B1BH 1GXQA 1PP7U 4U0VA 2G7HA 1QHHD 2LLKA 2QCOA 1OQYA 4OIQF 3HRUA 2ELHA 1K61A 1HKQA 1XGMA 3KZZA 4AIKA 2VQHA 4A69C 1R1UA 2WV0A 3RPQA 1USSA 3OL4A 3HKZN 1LFUP 2JSCA 2M2EA 4C3HJ 3DF8A 4XICA 3OR2C 2LP0A 2OF7A 5J8CA 2VT3A 4MTEA 5EEHA 1CQTA 1Z77A 4QIWN 2E36A 2K7LA 3PUFA 5IP7J 3J81Z 2QKMB 2G7UA 3CQZJ 3BQYA 1R6RA 3GMEA 5HS7A 3AG2H 2LBFB 3L9FA 1KU3A 5DD4A 2XC7A 3I5UA 4RAFA 2L7FP 2XPUA 4XBFA 4CYCA 4Q47A 1NHAA 3WU0A 3BTIA 1HF0A 1EF4A 2M1BA 5LEJA 5IT9Z 2W57A 4HLXA 3FXKA 2OU2A 2L54A 2ZJRF 3HTUA 1Z3YA 3U1KA 1BIAA 3CUOA 3BTCA 4Y15A 3W3CA 2GWRA 5CQEA 3GTGJ 5F1RA 4OMYA 3KE2A 4X6AJ 2H27A 4BJ5C 1OISA 4AU7A 3GTJJ 1POGA 4FTHA 1WFXA 4LJZF 2I5UA 3GTLJ 4LD5A 4E6KG 2WY8Q 3DKYA 2R5ZB 1MGTA 1PUEE 3FIWA 3PL8A 3N97A 4M3GA 5CVUA 2WAFA 1IN4A 4BBSJ 1ZG5A 2HPMA 3S1MJ 1HW1A 3OV8A 4QLCU 2E1MC 4BQAA 3I4PA 1ZN2A 4KMUX 3F21A 1IN5A 2R7WA 3A03A 2PJPA 1Z1DA 2VKEA 3HSEA 1JKOC 3HOSA 2VBYA 2ESNA 3L2VA 5F04A 5HNFA 3I59A 3V8KA 2DA6A 2LKSA 4LMYA 2L2OA 1ZH5A 5LHHA 3OMYA 3WTUC 3F6OA 1TWHJ 3OS0A 1XMXA 1OYWA 4BHCA 4BAYA 3SYTA 5KAFC 2QWWA 2KIUA 1X1BA 1FSHA 5E3OA 4L0ZB 3EDPA 3JAMZ 4UNOA 2DN0A 1W0UA 3ZMZA 3J80Z 3LQRA 5HOOA 1U2WA 2IPQX 2DQLA 2L0KA 2HDWA 1VQNI 2M8GX 3CCSI 1WGXA 3KLNA 4BXUA 4F55A 5B5EC 3P7NA 5ED4A 3LSMA 3QPHA 4I0BA 4JX6A 3VYTB 2LC2A 2QF7A 2DFHA 2CFOA 3LSKA 3PNYA 1S72I 2QQAA 1FC3A 3G2BA 4OMZA 1D3YA 4HDUA 4AC0A 5J8FA 1IXCA 1WKMA 4BJTA 3AAFA 2DFFA 3CJRB 4XKCA 4CH7A 4EGZA 1K7AA 1K4SA 2A5YB 3F8CA 3QODA 1NK3P 3P9CA 2IT0A 4MGRA 2E5ZA 4AYBN 1V5GA 1FBSA 2GQQA 2XGEA 4CO8A 2V9PA 1YJNI 2HDCA 5IP9J 4RM3A 1VQ7I 2E7WA 1QRYA 4IHXA 3OYDA 1B1BA 4I0AA 4Z2YA 3E6CC 2CUJA 4J00A 2VQCA 4ZYEA 4P5OA 4BE0A 3VPRA 4G6TB 2DU9A 2Y0SN 2CUZA 4MQ9F 3IRRA 1IUFA 1ZGWA 3S32A 1WRJA 4Y33A 1Z91A 2R7ZJ 3LWFA 2EWNA 2K9MA 2XAQA 3WGHA 4AUXA 3DLLF 3W6KB 2JUCA 4KIBA 2TCTA 4WXCA 3CCUI 2JT1A 3JRGA 2VLAA 1XTAA 3U21A 2DK5A 3SXYA 4U7DA 3ZQQA 2X4HA 4LB6B 4ZZDA 3LNQA 3VSLA 2IS4A 1M1EB 3F23A 2G9WA 1DUXC 1BI3A 2EFNA 3GZ5A 4EM0B 3CDLA 3LSTA 2DA1A 3BG3A 4I76A 2PMUA 1WPKA 3H3UA 2LF7A 4XSXF 5M5WJ 4A12A 3OYIA 2XKOA 2Y48A 5J3LA 3RDIA 1FIPA 1S7AA 4A3DJ 1XN7A 5D5XB 5DCFA 1RIOH 3FKIJ 3KFWX 2E2JJ 2BY0A 3K0LA 4IF4A 1Z0XA 5JLXA 3CTAA 2MGQA 2VBZA 1YS7A 1W36C 5FD5A 1RUOA 1YRNB 4HF1A 2VBXA 4K2EA 1ZR2A 2A07F 3KETA 1IAWA 5JR3A 4KICA 3N05A 1ORKA 2LOOA 2O9LA 2HGCA 1PUFA 3T8TA 2P5VA 1I6XA 3AG3H 1O3SA 1D1AA 1Z7LA 2LREA 1XGSA 3RI4A 2C6YA 2KFDA 3S14J 1KU2A 4YIRX 5TRDA 1MBEA 4LG0A 2ELJA 1P92A 2P5KA 2VKDA 3HRMA 3ZP5A 1FMWA 4BS9A 4DNCA 3K69A 2IAIA 1Z9CA 3JRCA 4GO1A 1OPCA 4UVAA 3ZOBA 2YU9J 5IOZA 1VQ6I 2YS9A 1FOXA 2KKOA 1KQ8A 3LSJA 4KT5C 1UELB 1T8IA 3IAS2 1A6QA 2UZKA 2KRHA 1SAUA 3RKYA 3HYIA 5KHDA 2OZ6A 4RGUA 3DFGA 3TL4X 4C30A 1MDMA 2ME0A 3GX4X 5CKTA 3J7AO 2DA3A 1R22A 2JJ7A 2XAGA 1ZGJA 3C2GA 1IN7A 2LKPA 1JJ8C 2CV0A 3ONQA 1BJAA 3K1MA 2CV2A 4RB1A 3OY9A 3AG1H 5GAHJ 4A2UA 1J9IA 5D5WB 1WCMJ 5CVJA 4E7IA 3CCYA 2K5CA 4CCNA 1Z6RA 3CMMA 1SC7A 2LF8A 1VZ0A 4MO7A 3F6VA 1WJAA 4M72A 1SD5A 1R1VA 1T56A 1ZR4A 5E17F 5E3MA 1FNNA 1MMAA 3R60A 3NQOA 4XK4A 2GXAA 2IA1A 2Q2EB 3FZVA 4A5NA 3GEZA 2OJED 3GW2A 3JR9A 4CUGA 2BHZA 2XB5A 1FYKA 2HTSA 2XUBA 4KMFA 1ULYA 5H20A 2OUMA 3U1DA 4V2FA 4Y7NJ 2VL8A 1CF7B 2X48A 3FXOA 3E3VA 3V7RA 2FSWA 2K3PA 3KEYA 4PSWA 1J2XA 3BQZA 4RGRA 1VQ5I 1S7OA 1SAXA 4D5FA 3FXMA 5EG0A 3OIPA 1IGNA 2BOLA 1O3RA 3KP2A 1EH8A 4IHSA 1YX5A 2ETHA 1Q1HA 3ELKA 4CICA 4I7HA 2HYFA 5GAEJ 1BIBA 1JUPA 3FK7A 2W82A 3K4CA 3RKQA 1BJZA 4BY1J 5CVVA 4R79A 2ECBA 5E79C 1OCCH 1TNSA 5L3GA 4L18B 3H9JA 2HQ5A 2Z2SB 2EZHA 2WAQN 3P9KA 3VFZA 3E5QA 4BEHB 2RREA 1W0TA 1K78A 2DDAA 5JVTA 4JQFA 4CZCA 1X3WB 4IO9F 3CJNA 4ENJA 1VQ8I 4D1QA 1WJEA 5FLXZ 3NEUA 4XMYA 1B72B 3K2AA 4UUSB 3BTJA 5IYDJ 4RLFA 4AD9A 5FJ8J 1VQ9I 1P4XA 2DMNA 3TOBA 1BC7C 3GF2A 4C9YA 1I1SA 3J81K 3F22A 1DGRM 2CU7A 4G94A 4XLAA 4FISA 2NRAC 2Y69H 3BR3A 3FXUA 3W2AA 1WH7A 2L9SA 3SZPA 3HTSB 3O8GA 2HQAA 4D7NA 3TMOA 2K9LA 2XAJA 5IT9K 1HC8A 2W24A 3TO7A 1ZKGA 3S1QJ 2WB1N 4IVNA 3G73A 2HFHA 5J1RA 4U7BA 4QPQA 1EH6A 2M0MA 3ZRGA 4X1EA 2EIMH 4F3QA 3I54A 3DQVC 3VEPA 1FEXA 5JI6A 2F4IA 3DPUA 1D1CA 1T0FC 2CO5A 1PDNC 5EGOA 5FFZA 1BOBA 5D5VB 5IT3A 2PJRA 2FNAA 4NNJA 3W2WA 1BL0A 3S16J 2HS5A 4O6JA 1XC5A 2MBFA 4PGHA 2M5WA 3CCMI 4IPAA 4NQWA 1OCTC 2A3SA 3OR1C 2ZSHB 4II2A 1YW9A 1ZYRF 3ZXSA 1S9HA 4B1RA 3FDYA 4KISA 2F2EA 3FMSA 4JP0A 2X85A 1TQPA 5EDNA 2VPLA 4GCVA 3V42A 2XRLA 1ERDA 3QYBA 2CJJA 3GLLA 3ABKH 1S7EA 3JTGA 3EYIA 4UB8C 4ZYHA 4ANJA 1UHSA 1BR2A 4BNCA 4EJUA 3F8MA 4N0BA 5CVRA 1TLHB 4C2MJ 3JAMK 1U8BA 4QWQA 5ICFA 2JK3A 1APLC 5BS6A 3BZCA 1GVDA 4HW0A 4KN4X 1TWAJ 1V5FA 3RQIA 3J80K 2X6XA 4H4KC 2H94A 4MNUA 3BY6A 3BZ6A 2HOEA 3H5RA 5IOYA 5D8KB 5CQGA 1W4MA 1XS9A 3JRDA 2F4MB 4B8XA 2L9RA 1OCZH 4RAYA 1LKXA 1TTYA 3BG6A 4M3BA 4CYDA 5JHUA 3JTHA 1LQ1A 4L9NA 2W25A 3H35A 2HVQA 1QGPA 4A3KJ 3GFIA 3LL7A 4CYCB 1U5TA 3E7LA 4A3LJ 1OR7A 3CCRI 1MSEC 1T98A 5B3SH 3IP4B 3G6EI 3VWBA 4IJAA 5E18F 1IRFA 3CESA 1HCRA 2AHQA 2Y30A 4HAMA 3F8BA 2DJIA 2ISZA 1MBKA 1V4RA 1G3SA 2PQ8A 4OAZA 3J7AY 1S3JA 4XONA 1B9NA 1R1TA 4CCKA 5M5YJ 3SJMA 4M3EA 4BU2A 3DU6A 1ZGAA 4XLHA 3G1OA 2JZYA 2XV4S 3K70C 1QPMA 2UXXA 2OTLI 4I09A 2CUEA 4XNFA 1Q1VA 3PFIA 4Y3OA 3TO9A 5FKKA 1D0ZA 1LUJB 4XIDA 2QQ9A 2XF7A 4D0PA 1H9TA 2ZO4A 3WE2A 5C4JJ 1LE8A 1J09A 2F5DA 2RC4A 2M7AA 3U9GA 1B4AA 1RPWA 1RI7A 1LB2A 1HKTA 4BKXA 1ETYA 4CSWA 2OD5A 2YX4A 2HXOA 1R71A 4NDLA 1AKHA 2CSOA 2RAEA 3DTIA 3D0SA 4LK0F 4M3DA 1NK2P 3CMAI 3IC7A 3OYGA 2VJ5A 2EV6A 2IVMA 1V5EA 2MG4A 1BI0A 3HUGB 4HA8A 1K83J 3SFIA 3WTWC 2K9NA 3DBHB 2QENA 3A1YA 3IKVA 2HR3A 3V8LA 4YG2F 2KISA 2CFXA 2VJIA 2E19A 2W1OA 5FO5A 3RPUA 2E7XA 5DTDA 3S2WA 3HBLA 1XCBA 4A0XA 4EVIA 2YPRA 1ON1A 4CCLA 2CMPA 1BR4A 3S3NA 4KA4A 2GM4A 3PNTA 2VOPA 4BYYA 3M1CA 3QP5A 2FMLA 2O7OA 4I2OA 1MH3A 1W7PA 3KYDB 3OYCA 1QA6A 2XAUA 3A0BC 3T5XA 3JSPA 4XRSA 1EA3A 3ECOA 2L02A 2E35A 2BBYA 1RC9A 4KJZA 1ZRDA 3RKXA 1U0JA 2EA2A 2R7UA 2NVQJ 5FRMA 2DAOA 2AXTC 4LLGF 3S2DJ 4FASD 3CC7I 1Z7UA 1SD6A 2X0LA 3TKYA 3ZMVA 1H0MA 2B0LA 2P6TA 2VIXA 4ENMA 2DMQA 3GLXA 2W00A 1Z3XA 1SFXA 5LEKA 3QWLA 1H88C 2EK5A 2RKHA 4E7JA 4FX4A 3FBNB 4B43A 4DGWB 4EEFG 2EB7A 3IUOA 5JVGF 4FE4A 4N9IA 3WHCA 2D1VA 1GDTA 4ZDOA 1QVTA 2IW5A 3BWGA 1ZELA 4I99C 1D0XA 3K2ZA 2W84A 4M74A 2E1CA 1Z6TA 4IXAA 4RM2A 1YW7A 4L9VA 2L9NA 5FROA 2V4JC 3GUDA 5D4RA 1BBYA 3E5XA 5GPAA 1W36D 4I01A 1UG0A 1JXSA 4HV6A 4G6QA 4P96A 3C18A 3ROUA 4L5EA 1PJRA 2E34A 3WU1B 1F9NA 2COMA 4PJ0C 4M6XA 1K6OA 2Q8KA 3E97A 1T95A 1T6SA 2DLLA 2FQ3A 2L7KA 3TW6A 4AVZA 1X1PA 2QSHX 1TWFJ 2DT7B 1UCRA 4U0YA 1J59A 2R7TA 1V55H 2ZXWH 5C3EJ 3M1EA 3S17J 5FB2A 2Y9YA 4RB3C 2XAFA 3FM3A 4KUMA 3BJAA 4EM2A 5AONA 2RQPA 4D9JA 2VE9A 5K5QA 4XM3A 1HLVA 3LSRA 1QO0D 2EFOA 1DU6A 2ZJPF 2FX0A 3F9KA 3JRAA 4HX8A 4E7HA 4LOCA 4BQNA 1LFPA 4MEXF 1EJ9A 1STZA 1X1CA 2B7EA 2UXNA 3BJ6A 3QPSA 3KEOA 3BROA 3HHHA 4L5IA 3WTYC 3SDBA 4XRSG 4B47A 5FLXK 5CJ9A 1XMAA 2J5PA 2JN6A 1B59A 4QPOA 2EPFA 4UV8A 3TDUC 3VYRB 1JKPC 2R93J 3ZQCA 1SD7A 4RA2A 5DD8A 3HGYA 1BI2A 2DYRH 1BM9A 1TT5B 2LVSA 3MMYB 3EUHC 1XDUA 3DXJF 1ZRFA 5FFXA 2QEXI 2F6CA 1UHWA 2MD0A 1D8JA 2DA2A 3Q5FA 4I98B 2K9QA 4PCQA 3RIRA 4BDYA 1TT0A 3FX3A 1NH3A 3L2WA 2CV1A 2NVXJ 5GAGJ 2ID3A 1Y56A 5DDGA 4H0EA 5FGMA 1IXRC 3OYLA 3JRHA 3ZR8X 3PJRA 3MKYB 2XPVA 4KNYA 2L4MA 2CYYA 3GXOA 3RQ4A 3TOAA 4EMSA 2CW0F 1G8XA 3S3MA 2UWMA 1MBJA 1WJCA 4KIFA 3W6JB 3HOTA 1SFKA 3NARA 2RN7A 5FLVA 4X0GA 4F93B 4M9XA 2OZUA 3I4NJ 2BV6A 2FEZA 3TBIA 4CXFA 2PMZA 1X1DA 3TEDA 1FYMA 2NNYA 2LTPA 4PZJA 5TISC 2EBIA 4HQEA 1VQ4I 2X6WA 2EQRA 2FNPA 3MWMA 4DIQA 1OCOH 1GLNA 2GXGA 3BJOA 4A3JJ 1ZREA 2M0CA 3DBLB 2RQQA 3LOCA 3WG7H 3HSFA 4YFXF 2HWVA 3HRTA 4XKWA 1FP1D 2IXSA 1Z67A 2OPTA 5DV5A 4S04A 4A3BJ 1HSJA 4P55A 3GTKJ 3OIQA 1AA7A 2R0QC 3F8NA 3PQJA 4LK1F 1ZRCA 3ZQIA 2ZMEA 2R7QA 3HJEA 3Q3SA 1DU0A 3IH4A 2WAEA 4D5CA 1GUUA 3DKWA 3W6VA 2FU4A 3BR6A 3D5SC 5GPCA 3AKZA 4A93J 2EV5A 3E5UA 2XIGA 1DDNA 5E3LA 3HOUJ 4BQQA 3IWZA 2DJNA 3C2HA 3ECHA 3CDIA 4PSXA 4HPQA 2O3FA 3PIOF 1UB9A 2X1DA 5L3EA 1J0RA 1ZTRA 2HQRA 1GT0C 3GFMA 2JPCA 3A01B 3D5RC 1I6HJ 3QU3A 2XKPA 4MLOA 1G2HA 3H5AA 4FX0A 3CUQC 5HVQC 1R36A 3CF5F 5C44J 1YOVB 3CJQB 5EGOB 1X58A 2PJRB 3GWZA 4YEJA 1HKSA 1LEBA 4DZJA 1FTTA 5BPDA 4J01A 1VTNC 4IL6C 1SFEA 2ZKZA 3J7YJ 1MW7A 2VJ4A 1ENHA 2E60A 1BC8C 5F08A 2TRTA 2XPWA 2OQRA 1MBGA 2DA4A 5EJCA 4NQWB 2LKXA 2DOEA 4Q4ZF 1RZ4A 3HSRA 3WE3A 4HSRA 5E8GA 5IYCJ 4A3MJ 4FETA 1JTXA 1EH7A 4PJMA 2YSRA 3WGIA 3N4MA 2A5WA 2DTZA 4V2GA 3RCOA 2CQNA 5LLQA 4IOCF 2LG4A 2WBMA 5HS9A 3GZ6A 1X1AA 5ICGA 2X51A 2CQKA 2HOAA 2DPUA 1NG7A 2I8DA 1QU3A 3LAPA 2A05A 4RB0A 1TW3A 2QBYA 3BPVA 2R7RA 1U9NA 2OV7A 3M8FA 2GOXB 1HA8A 1YYVA 1WQ2A 1JJ6C 4WWCA 3GFLA 1JGSA 5HLHA 2GXBA
chains in the Genus database with same CATH topology
5M5XJ 1ZKGA 3BR0A 2DMTA 3S1QJ 4Y52J 3JRFA 5EYRA 2WB1N 1QVUA 5J1RA 2MW8A 3BR1A 2R5YA 3HOZJ 1JUSA 4IHVA 3MVPA 3DCFA 4X1EA 3CMYA 1FEXA 3IH3A 1D5YA 3OOUA 1WH5A 5EGOA 2HXIA 2HI3A 4W97A 4DYQA 1ETVA 5FKMA 5EG0B 2E1OA 4B4CA 1BL0A 3H3VK 3S16J 1MH4A 1XC5A 1JKQC 3H0GJ 3HOWJ 2LK2A 1OCTC 3GTOJ 3TW7A 2FQ4A 4B1RA 3HOYJ 2MSYA 1B72A 2Y9ZA 4JP0A 4UUSA 5EDNA 2XRLA 3IH2A 2LY9A 2Y31A 4ABZA 2CJJA 3GTMJ 1S7EA 5FLMJ 1ZQ3P 3GTPJ 2X6OA 1UHSA 3OSFA 1RR7A 4C2MJ 1U8BA 4G12A 3TP3A 2JK3A 3B6CA 1APLC 1GVDA 1JGGA 1TWAJ 3RQIA 2DMPA 1LE8B 5F1JA 5IOYA 4GFBA 3ZQFA 1ITYA 2NOGA 1B8IB 2L7MP 1XS9A 3JRDA 2L9RA 2NS7A 4M3BA 1VF9A 4A3KJ 2LFBA 1IRZA 3LSGA 1P7JA 3LSPA 2ZB9A 1VI0A 1X2NA 4CYCB 5C4XJ 3E7LA 4A3LJ 1MSEC 4DYRA 4DZPA 2R5YB 1IV6A 2R5ZA 4HNVA 2KT0A 2VKVA 1HCRA 2AHQA 2Y30A 3I4MJ 3S2HJ 1MBKA 3HGGA 1SFOJ 5F0CA 5M5YJ 3SJMA 4IEJA 4M3EA 1H8AC 5FKNA 1FJLA 3G1OA 3RZOJ 2EH3A 2D5VA 2CUEA 2CUFA 1Q1VA 1TWCJ 2I10A 3FK6A 2VUMJ 2LLKA 2QCOA 2ELKA 5FKKA 3DEWA 2VI6A 3HOXJ 1K61A 4XIDA 3O8HA 3MN2A 4A69C 5K7ZA 3MKLA 2ME6A 5C4JJ 3HKZN 1LE8A 1ETXA 1LFUP 2M2EA 4C3HJ 4XICA 1F43A 2LP0A 2OF7A 3UKGA 1GV2A 1RPWA 1CQTA 1Z77A 2E2HJ 4QIWN 5IP7J 4BKXA 2GLOA 3CQZJ 3BQYA 4MIMA 3ZQGA 3C2BA 4D7MA 1ETYA 2L7FP 2HXOA 2XPUA 4C3IJ 4NDLA 3HEFA 3S1RJ 4CYCA 1AKHA 2K9SA 2P81A 2RAEA 4M3DA 1NK2P 2H8RA 1BW5A 2CRGA 3BTIA 1H89C 1MBFA 1HF0A 1EF4A 1VNDA 1BW6A 2MG4A 2O8KA 1K83J 1TWGJ 3SFIA 3QQAA 3M3YJ 2K9NA 3GTQJ 3TP0A 3S1NJ 2E19A 3BTCA 3GTGJ 5DTDA 4C3JJ 1SANA 1RKTA 3HBLA 2E2IJ 4X6AJ 3GTJJ 3JREA 1POGA 4J19A 4FTHA 5GP9A 3BT9A 3GTLJ 2JA7J 5IYBJ 3D1NI 2R5ZB 2EZLA 3FIWA 2GM4A 4M3GA 4BBSJ 3NAUA 3S1MJ 2O7OA 4A3FJ 1MH3A 5M3MJ 1ETKA 3A02A 4XRSA 2R92J 3A03A 5JLWA 3ZQHA 2VKEA 4UUTA 2M9HA 1JKOC 5F04A 2DA6A 4DYCA 1BA5A 2HOSA 1TWHJ 2NVQJ 1A6IA 3BG9A 3HM5A 3WHBA 5DS9A 5E3OA 2NS8A 3S2DJ 1MSFC 2DN0A 2DMQA 1W0UA 3BG5A 2JA6J 1ZK8A 1H88C 2LD5A 2L0KA 2M8GX 1WGXA 4EEFG 4DW6A 4FE4A 1MNMC 3HDDA 2M34A 5J1YA 4JX6A 3WHCA 1GDTA 1QVTA 2QF7A 1ETOA 2L7ZA 1AKHB 1YRNA 5F0HA 1R9TJ 2H1KA 5K7HA 4QTRA 1Y1WJ 1MBHA 4AC0A 2YUSA 1HDPA 5GPAA 1O4XA 3S15J 2NVTJ 1ETWA 3Q0WA 1T33A 1RESA 3L1PA 1NK3P 1XG1A 4L5EA 4AYBN 1AU7A 5E3NA 5HODA 2XGEA 2FJ1A 5IP9J 3PO2J 5J1UA 1QRYA 3TW6A 4IHXA 3M4OJ 1TWFJ 5F27A 1IC8A 1JUMA 1RKWA 2DA5A 5C3EJ 2EZKA 4BBRJ 3VPRA 2KDZA 3S17J 2Y9YA 2Y0SN 1IUFA 1ZGWA 2R7ZJ 2JA8J 4AUXA 1IDYA 2TCTA 1HLVA 3LSRA 1UMQA 1DU6A 3JRGA 2FX0A 3JRAA 4LOCA 2B63J 3LNQA 5F0FA 3BR5A 3HB9A 3QPSA 5EF6A 4XRSG 3CDLA 1VFCA 2DA1A 3BG3A 4I76A 2JMWA 1RETA 1WPKA 2K40A 5M5WJ 2JN6A 3OSGA 1JKPC 2R93J 3ZQCA 5J3LA 3Q0UA 3HGYA 1FIPA 2LVSA 2HOTA 4A3DJ 1NTCA 2PMZN 1HDDC 3FKIJ 2E2JJ 5BNGA 1ETQA 2EZIA 1Z0XA 5FKLA 5JLXA 2DA2A 2MGQA 2NVYJ 2K9QA 1YRNB 5IPAA 2VPRA 1ZR2A 2CQQA 2NVXJ 2N8GA 4M3FA 2ID3A 3A01A 1ORKA 3JRHA 3SDGA 1I50J 3K7AJ 1PUFA 2O9LA 2HYJA 2XPVA 1QPIA 3G1LA 3S14J 1IDZA 1MBEA 4A3CJ 2XGDA 1MBJA 3NARA 2JWTA 5FLVA 5EEAA 3HOVJ 2IAIA 3JRCA 3ZOBA 3G1MA 2YU9J 2IBDA 5IOZA 3I4NJ 2ID6A 2YS9A 3BTLA 1U78A 1Y1VJ 1HOMA 3LSJA 3TEDA 2LTPA 3ZQLA 5FKOA 2EBIA 4B3AA 2EQRA 4A3JJ 1F36A 2G0EA 2M0CA 2ME0A 3LOCA 1JTYA 4I6ZA 2DA3A 2JJ7A 1JJ8C 4A3BJ 2OPTA 1A5JA 2CQXA 1FTZA 3GTKJ 2R0QC 1U9OA 9ANTA 1WCMJ 3ZQIA 3CCYA 3QPLA 3Q3SA 1DU0A 3IH4A 3Q0VA 1TC3C 4D5CA 1GUUA 3W6VA 1OFCX 4MO7A 2HDDA 1FIAA 3BR6A 1AHDP 5GPCA 5EZHA 4A93J 2DMUA 3PO3J 1GV5A 4MFDA 1T56A 1ZR4A 5E3LA 5E3MA 4RDUA 3HOUJ 2DJNA 4XK4A 1JT0A 3BR2A 3JR9A 2XB5A 1IG7A 3OIOA 1OCPA 2LR8A 1ZTRA 4Y7NJ 4V2FA 5EZGA 1GT0C 2X48A 4IHWA 4JX5A 3B6AA 3A01B 1I6HJ 1G2HA 4MLOA 4JYKA 3BQZA 4IHYA 2IEKA 4D5FA 1PUFB 5EG0A 4XRMA 1IGNA 1X2MA 3JRBA 3RZDJ 1E3OC 3GBGA 1IJWC 5C44J 1OJLA 4MFEA 5EGOB 1JUPA 3FK7A 1X58A 1WI3A 2AO9A 1UG2A 2X9DA 3RKQA 1BJZA 4A3IJ 5K7FA 4BY1J 1FTTA 4DZJA 3FISA 2ECBA 1LFBA 3PM1A 1ENHA 2HQ5A 2EZHA 2TRTA 2WAQN 2XPWA 3F0CA 5F08A 1MBGA 2DA4A 2COBA 1W0TA 1I3QJ 2LKXA 4S0HB 1P7IA 1JT6A 4QSHA 2ECCA 3JRIA 4A3EJ 4A3GJ 1B72B 5IP6A 5IYCJ 3K2AA 4UUSB 4A3MJ 2XB0X 4JX4A 3BTJA 5IYDJ 1JTXA 2XSDC 4FCYA 5FJ8J 2W48A 2DTZA 4V2GA 2DMNA 2WV1A 1JKRC 3IV5A 2GBYA 1B8IA 2FD5A 4RBOA 5M3FJ 2CU7A 2HOAA 2XGCA 4M6VA 4W1UA 4FE7A 4FISA 3BR3A 2Y2ZA 1U9NA 1WH7A 2DA7A 4BXXJ 3O8GA 4D7NA 1JJ6C 4BY7J 2JA5J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5X J;  1ZKG A;  3BR0 A;  2DMT A;  3S1Q J;  4Y52 J;  3JRF A;  5EYR A;  2WB1 N;  1QVU A;  5J1R A;  2MW8 A;  3BR1 A;  2R5Y A;  3HOZ J;  1JUS A;  4IHV A;  3MVP A;  3DCF A;  4X1E A;  3CMY A;  1FEX A;  3IH3 A;  1D5Y A;  3OOU A;  1WH5 A;  5EGO A;  2HXI A;  2HI3 A;  4W97 A;  4DYQ A;  1ETV A;  5FKM A;  5EG0 B;  2E1O A;  4B4C A;  1BL0 A;  3H3V K;  3S16 J;  1MH4 A;  1XC5 A;  1JKQ C;  3H0G J;  3HOW J;  2LK2 A;  1OCT C;  3GTO J;  3TW7 A;  2FQ4 A;  4B1R A;  3HOY J;  2MSY A;  1B72 A;  2Y9Z A;  4JP0 A;  4UUS A;  5EDN A;  2XRL A;  3IH2 A;  2LY9 A;  2Y31 A;  4ABZ A;  2CJJ A;  3GTM J;  1S7E A;  5FLM J;  1ZQ3 P;  3GTP J;  2X6O A;  1UHS A;  3OSF A;  1RR7 A;  4C2M J;  1U8B A;  4G12 A;  3TP3 A;  2JK3 A;  3B6C A;  1APL C;  1GVD A;  1JGG A;  1TWA J;  3RQI A;  2DMP A;  1LE8 B;  5F1J A;  5IOY A;  4GFB A;  3ZQF A;  1ITY A;  2NOG A;  1B8I B;  2L7M P;  1XS9 A;  3JRD A;  2L9R A;  2NS7 A;  4M3B A;  1VF9 A;  4A3K J;  2LFB A;  1IRZ A;  3LSG A;  1P7J A;  3LSP A;  2ZB9 A;  1VI0 A;  1X2N A;  4CYC B;  5C4X J;  3E7L A;  4A3L J;  1MSE C;  4DYR A;  4DZP A;  2R5Y B;  1IV6 A;  2R5Z A;  4HNV A;  2KT0 A;  2VKV A;  1HCR A;  2AHQ A;  2Y30 A;  3I4M J;  3S2H J;  1MBK A;  3HGG A;  1SFO J;  5F0C A;  5M5Y J;  3SJM A;  4IEJ A;  4M3E A;  1H8A C;  5FKN A;  1FJL A;  3G1O A;  3RZO J;  2EH3 A;  2D5V A;  2CUE A;  2CUF A;  1Q1V A;  1TWC J;  2I10 A;  3FK6 A;  2VUM J;  2LLK A;  2QCO A;  2ELK A;  5FKK A;  3DEW A;  2VI6 A;  3HOX J;  1K61 A;  4XID A;  3O8H A;  3MN2 A;  4A69 C;  5K7Z A;  3MKL A;  2ME6 A;  5C4J J;  3HKZ N;  1LE8 A;  1ETX A;  1LFU P;  2M2E A;  4C3H J;  4XIC A;  1F43 A;  2LP0 A;  2OF7 A;  3UKG A;  1GV2 A;  1RPW A;  1CQT A;  1Z77 A;  2E2H J;  4QIW N;  5IP7 J;  4BKX A;  2GLO A;  3CQZ J;  3BQY A;  4MIM A;  3ZQG A;  3C2B A;  4D7M A;  1ETY A;  2L7F P;  2HXO A;  2XPU A;  4C3I J;  4NDL A;  3HEF A;  3S1R J;  4CYC A;  1AKH A;  2K9S A;  2P81 A;  2RAE A;  4M3D A;  1NK2 P;  2H8R A;  1BW5 A;  2CRG A;  3BTI A;  1H89 C;  1MBF A;  1HF0 A;  1EF4 A;  1VND A;  1BW6 A;  2MG4 A;  2O8K A;  1K83 J;  1TWG J;  3SFI A;  3QQA A;  3M3Y J;  2K9N A;  3GTQ J;  3TP0 A;  3S1N J;  2E19 A;  3BTC A;  3GTG J;  5DTD A;  4C3J J;  1SAN A;  1RKT A;  3HBL A;  2E2I J;  4X6A J;  3GTJ J;  3JRE A;  1POG A;  4J19 A;  4FTH A;  5GP9 A;  3BT9 A;  3GTL J;  2JA7 J;  5IYB J;  3D1N I;  2R5Z B;  2EZL A;  3FIW A;  2GM4 A;  4M3G A;  4BBS J;  3NAU A;  3S1M J;  2O7O A;  4A3F J;  1MH3 A;  5M3M J;  1ETK A;  3A02 A;  4XRS A;  2R92 J;  3A03 A;  5JLW A;  3ZQH A;  2VKE A;  4UUT A;  2M9H A;  1JKO C;  5F04 A;  2DA6 A;  4DYC A;  1BA5 A;  2HOS A;  1TWH J;  2NVQ J;  1A6I A;  3BG9 A;  3HM5 A;  3WHB A;  5DS9 A;  5E3O A;  2NS8 A;  3S2D J;  1MSF C;  2DN0 A;  2DMQ A;  1W0U A;  3BG5 A;  2JA6 J;  1ZK8 A;  1H88 C;  2LD5 A;  2L0K A;  2M8G X;  1WGX A;  4EEF G;  4DW6 A;  4FE4 A;  1MNM C;  3HDD A;  2M34 A;  5J1Y A;  4JX6 A;  3WHC A;  1GDT A;  1QVT A;  2QF7 A;  1ETO A;  2L7Z A;  1AKH B;  1YRN A;  5F0H A;  1R9T J;  2H1K A;  5K7H A;  4QTR A;  1Y1W J;  1MBH A;  4AC0 A;  2YUS A;  1HDP A;  5GPA A;  1O4X A;  3S15 J;  2NVT J;  1ETW A;  3Q0W A;  1T33 A;  1RES A;  3L1P A;  1NK3 P;  1XG1 A;  4L5E A;  4AYB N;  1AU7 A;  5E3N A;  5HOD A;  2XGE A;  2FJ1 A;  5IP9 J;  3PO2 J;  5J1U A;  1QRY A;  3TW6 A;  4IHX A;  3M4O J;  1TWF J;  5F27 A;  1IC8 A;  1JUM A;  1RKW A;  2DA5 A;  5C3E J;  2EZK A;  4BBR J;  3VPR A;  2KDZ A;  3S17 J;  2Y9Y A;  2Y0S N;  1IUF A;  1ZGW A;  2R7Z J;  2JA8 J;  4AUX A;  1IDY A;  2TCT A;  1HLV A;  3LSR A;  1UMQ A;  1DU6 A;  3JRG A;  2FX0 A;  3JRA A;  4LOC A;  2B63 J;  3LNQ A;  5F0F A;  3BR5 A;  3HB9 A;  3QPS A;  5EF6 A;  4XRS G;  3CDL A;  1VFC A;  2DA1 A;  3BG3 A;  4I76 A;  2JMW A;  1RET A;  1WPK A;  2K40 A;  5M5W J;  2JN6 A;  3OSG A;  1JKP C;  2R93 J;  3ZQC A;  5J3L A;  3Q0U A;  3HGY A;  1FIP A;  2LVS A;  2HOT A;  4A3D J;  1NTC A;  2PMZ N;  1HDD C;  3FKI J;  2E2J J;  5BNG A;  1ETQ A;  2EZI A;  1Z0X A;  5FKL A;  5JLX A;  2DA2 A;  2MGQ A;  2NVY J;  2K9Q A;  1YRN B;  5IPA A;  2VPR A;  1ZR2 A;  2CQQ A;  2NVX J;  2N8G A;  4M3F A;  2ID3 A;  3A01 A;  1ORK A;  3JRH A;  3SDG A;  1I50 J;  3K7A J;  1PUF A;  2O9L A;  2HYJ A;  2XPV A;  1QPI A;  3G1L A;  3S14 J;  1IDZ A;  1MBE A;  4A3C J;  2XGD A;  1MBJ A;  3NAR A;  2JWT A;  5FLV A;  5EEA A;  3HOV J;  2IAI A;  3JRC A;  3ZOB A;  3G1M A;  2YU9 J;  2IBD A;  5IOZ A;  3I4N J;  2ID6 A;  2YS9 A;  3BTL A;  1U78 A;  1Y1V J;  1HOM A;  3LSJ A;  3TED A;  2LTP A;  3ZQL A;  5FKO A;  2EBI A;  4B3A A;  2EQR A;  4A3J J;  1F36 A;  2G0E A;  2M0C A;  2ME0 A;  3LOC A;  1JTY A;  4I6Z A;  2DA3 A;  2JJ7 A;  1JJ8 C;  4A3B J;  2OPT A;  1A5J A;  2CQX A;  1FTZ A;  3GTK J;  2R0Q C;  1U9O A;  9ANT A;  1WCM J;  3ZQI A;  3CCY A;  3QPL A;  3Q3S A;  1DU0 A;  3IH4 A;  3Q0V A;  1TC3 C;  4D5C A;  1GUU A;  3W6V A;  1OFC X;  4MO7 A;  2HDD A;  1FIA A;  3BR6 A;  1AHD P;  5GPC A;  5EZH A;  4A93 J;  2DMU A;  3PO3 J;  1GV5 A;  4MFD A;  1T56 A;  1ZR4 A;  5E3L A;  5E3M A;  4RDU A;  3HOU J;  2DJN A;  4XK4 A;  1JT0 A;  3BR2 A;  3JR9 A;  2XB5 A;  1IG7 A;  3OIO A;  1OCP A;  2LR8 A;  1ZTR A;  4Y7N J;  4V2F A;  5EZG A;  1GT0 C;  2X48 A;  4IHW A;  4JX5 A;  3B6A A;  3A01 B;  1I6H J;  1G2H A;  4MLO A;  4JYK A;  3BQZ A;  4IHY A;  2IEK A;  4D5F A;  1PUF B;  5EG0 A;  4XRM A;  1IGN A;  1X2M A;  3JRB A;  3RZD J;  1E3O C;  3GBG A;  1IJW C;  5C44 J;  1OJL A;  4MFE A;  5EGO B;  1JUP A;  3FK7 A;  1X58 A;  1WI3 A;  2AO9 A;  1UG2 A;  2X9D A;  3RKQ A;  1BJZ A;  4A3I J;  5K7F A;  4BY1 J;  1FTT A;  4DZJ A;  3FIS A;  2ECB A;  1LFB A;  3PM1 A;  1ENH A;  2HQ5 A;  2EZH A;  2TRT A;  2WAQ N;  2XPW A;  3F0C A;  5F08 A;  1MBG A;  2DA4 A;  2COB A;  1W0T A;  1I3Q J;  2LKX A;  4S0H B;  1P7I A;  1JT6 A;  4QSH A;  2ECC A;  3JRI A;  4A3E J;  4A3G J;  1B72 B;  5IP6 A;  5IYC J;  3K2A A;  4UUS B;  4A3M J;  2XB0 X;  4JX4 A;  3BTJ A;  5IYD J;  1JTX A;  2XSD C;  4FCY A;  5FJ8 J;  2W48 A;  2DTZ A;  4V2G A;  2DMN A;  2WV1 A;  1JKR C;  3IV5 A;  2GBY A;  1B8I A;  2FD5 A;  4RBO A;  5M3F J;  2CU7 A;  2HOA A;  2XGC A;  4M6V A;  4W1U A;  4FE7 A;  4FIS A;  3BR3 A;  2Y2Z A;  1U9N A;  1WH7 A;  2DA7 A;  4BXX J;  3O8G A;  4D7N A;  1JJ6 C;  4BY7 J;  2JA5 J; 
#chains in the Genus database with same CATH topology
 1D0Y A;  5M5X J;  2ADU A;  2K4B A;  4A6E A;  3JRF A;  5EYR A;  1QVU A;  4FT8 A;  4AID A;  2V9K A;  2R5Y A;  3HOZ J;  3MVP A;  2YR2 A;  2WC2 A;  3CMY A;  4Y17 A;  2STW A;  2HYG D;  1D5Y A;  2BW3 A;  3OOU A;  3IRQ A;  4Y13 A;  5AIP A;  2EA4 A;  2PN6 A;  3G3Z A;  4BL0 B;  4XKV A;  2Z1D A;  4P1W A;  2E1O A;  1J7K A;  1MH4 A;  3VOE A;  1JKQ C;  3H0G J;  2OA4 A;  2OTJ I;  4CA0 A;  2LK2 A;  2KQR A;  3GTO J;  1JE8 A;  1G59 A;  1MMD A;  2FQ4 A;  3HL2 A;  5EEG A;  1T0F A;  2UV1 A;  2M45 A;  4YRV A;  2MSY A;  5FRN A;  3K70 D;  4IQ4 A;  2DYS H;  4GYG A;  2PG4 A;  3OYE A;  1K6Y A;  3NWS A;  3CO7 C;  2LY9 A;  2XAS A;  2Y31 A;  3OYA A;  1HBX G;  3IAM 2;  1ZQ3 P;  2XF5 A;  3T0Y A;  2VC0 A;  1HW5 A;  2GOM A;  1ON2 A;  2XDV A;  1IN6 A;  1FP2 A;  4UHT A;  4BHP A;  1Z21 A;  3SEQ A;  3OSF A;  1RR7 A;  2GAU A;  2LSO A;  3DTK A;  1JHF A;  5K1Y A;  4G12 A;  4B3X A;  2FA5 A;  1I5Z A;  3QAH A;  3OYJ A;  3B6C A;  4IQJ A;  4LLN A;  2KRC A;  2HTJ A;  4CHU A;  2KPM A;  1G6N A;  4PJL A;  1LE8 B;  3CC2 I;  2XGX A;  2AQE A;  1FZP B;  3RKW A;  3ZQF A;  5BQT A;  1B8I B;  2KRF A;  2HZD A;  2ZNZ A;  3FWE A;  3G4S I;  2MLK A;  1TL8 A;  3K1P A;  1XCV A;  4EGY A;  3VYU B;  1SMY F;  2DDB A;  2Z99 A;  4RAG A;  4IRI A;  2DFI A;  1K4T A;  1FY7 A;  4OOI A;  4RGX A;  2O03 A;  1B9M A;  5HLT A;  4HDV A;  1P7J A;  3LSP A;  4PGG A;  1IUY A;  4DYR A;  1VQK I;  2QYO A;  1FOY A;  3OYN A;  1Y6I A;  4UY8 I;  1WJB A;  1IV6 A;  2R5Z A;  2KT0 A;  4XLE A;  4PJN A;  1R4M B;  3VSK A;  4M9S A;  4GRI A;  1MKM A;  1MMN A;  3VYS B;  2RGV A;  3K9T A;  4IEJ A;  5B1A H;  2V26 A;  5DCM B;  3LQQ A;  1FLI A;  3RZO J;  5IY5 H;  2D5V A;  1YFH A;  3CME I;  2EJR A;  2I10 A;  3FK6 A;  2F48 A;  2ELK A;  1XB4 A;  4HF2 A;  3AL0 B;  3BPX A;  5CLS A;  3DEW A;  2VI6 A;  3K4L A;  5E1X A;  1YS6 A;  3HOX J;  3WTS C;  3O8H A;  4UB6 C;  3LMM A;  1TW2 A;  4EJT A;  5ERI A;  2O5R A;  1ZG1 A;  3MKL A;  1IRX A;  2GIZ A;  1ETX A;  3H92 A;  2EFW A;  2VB6 A;  3DEE A;  4ETS A;  2V6C A;  3UR3 C;  3UKG A;  4A6D A;  4BE1 A;  2JSP A;  2E2H J;  1LVA A;  1GHC A;  3KYL A;  2Q0O A;  2V7F A;  2GLO A;  2PMH A;  1T38 A;  4ASN A;  2L4A A;  1T08 B;  3C2B A;  5CYV A;  4YEL A;  2DO7 A;  3S1R J;  2K9S A;  2P81 A;  3K4M A;  4XLP F;  4ZTJ A;  2H8R A;  1BW5 A;  3MCZ A;  3WTX C;  1H89 C;  1O7F A;  4AYB A;  1VND A;  1BW6 A;  2OQG A;  3LA2 A;  1TWG J;  2QKL B;  1V54 H;  2XAH A;  3J7Z I;  3REO A;  3M9A A;  4XR6 A;  3TP0 A;  5LRS A;  1RUN A;  3S1N J;  3H9G A;  2KMU A;  5GAD J;  4OIP F;  4CGZ A;  4C3J J;  2P6S A;  1SAN A;  4GYI A;  1QZY A;  1RKT A;  2E2I J;  2R7S A;  3JRE A;  3CCE I;  5HLI A;  2XSJ C;  3OYF A;  3BT9 A;  3I53 A;  1FT9 A;  2M8E A;  4JOM A;  1BOA A;  5DUK A;  2JA7 J;  3D1N I;  4ZDP A;  2JVH A;  2NOJ B;  2F5V A;  3LFK A;  3NAU A;  1I3A A;  4A3F J;  2VXZ A;  3E1S A;  3A02 A;  2R92 J;  3ABM H;  3LFU A;  4BHB A;  5JLW A;  1SVM A;  3ZQH A;  3PSI A;  4UUT A;  2M9H A;  3O3K A;  3ESW B;  2Y75 A;  2R7F A;  2P8T A;  4HBL A;  1U8R A;  4DYC A;  1SEU A;  2ICW G;  4LG3 A;  3CC4 I;  3LAJ A;  2AQF A;  4GDF A;  3BG9 A;  3HM5 A;  3WHB A;  3KYC B;  5LHI A;  2NS8 A;  1P6R A;  3PSF A;  5KAI C;  1MND A;  3MKZ A;  1MSF C;  3BG5 A;  3A2K A;  2A61 A;  1J75 A;  4XN3 A;  2JA6 J;  3R61 A;  2ZFW A;  2LD5 A;  4EAT A;  1Y8R B;  2F5E A;  4NC7 A;  2FF4 A;  3HG9 A;  1SFU A;  4G7Z F;  4PFO A;  2HNH A;  3K4J A;  3HDD A;  2RNJ A;  5J1Y A;  1Z05 A;  3F8F A;  3ERE D;  1ETO A;  1O3T A;  1IN8 A;  2ZXI A;  3V7C A;  1KU9 A;  2L7Z A;  2LH9 A;  1YRN A;  4XL9 A;  3OYM A;  1R9T J;  2BVM A;  3C1D A;  2H1K A;  2V1U A;  1QZE A;  4QTR A;  1MBH A;  2YUS A;  2VE8 A;  5J4Y A;  1HDP A;  3MD2 A;  4RLQ A;  4G8X A;  3S15 J;  4FHT A;  1ETW A;  2Z3Y A;  4PFP A;  1T33 A;  4GGG A;  4AWX B;  1MMS A;  1P2F A;  4HG2 A;  4ON0 A;  5E3N A;  5HOD A;  2V1D A;  2BEO A;  4G7O F;  4E7K A;  3ZPL A;  4LIU A;  4TV7 A;  2DT6 A;  3KPH A;  3PO2 J;  1BN5 A;  1G3Y A;  2L01 A;  2WA0 A;  3MZY A;  4ZC3 A;  1IC8 A;  1JUM A;  2DA5 A;  3OS1 A;  1DQU A;  3RSN A;  2EZK A;  4BBR J;  4ZH4 F;  3BCA A;  1MIJ A;  2KDZ A;  1VQL I;  2CH0 A;  4Q5S F;  4M71 A;  2PBI A;  3RJP A;  2NNN A;  3CLQ A;  1WVR A;  4AVP A;  2JA8 J;  4A0Z A;  1U3E M;  2WWY A;  2P7V B;  3I59 B;  3QU6 A;  5LGU A;  1HW2 A;  1KYZ A;  2F4O B;  3DP7 A;  3SHF A;  3PIP F;  2ZCW A;  4OIR F;  2B63 J;  1P4A A;  2WTE A;  5F0F A;  4O5V A;  3BR5 A;  4HNU A;  5E8I A;  1LPQ A;  4UUV A;  2YX7 A;  4NB5 A;  5EF6 A;  1E0E A;  5H2F C;  1VQP I;  2GIV A;  2VAS A;  1VFC A;  1MNE A;  2W4S A;  2R7V A;  4LIT A;  2K40 A;  3LSH A;  3S93 A;  5TJJ A;  1MJB A;  1RNL A;  1PVE A;  1YI2 I;  5F64 A;  3FXQ A;  3QOP A;  1NTC A;  2PMZ N;  3DTE A;  4OIN F;  3FXL A;  4HEA 2;  4BDZ A;  2HKO A;  3ERM A;  3NWT A;  2Q2E A;  1ETQ A;  1WJF A;  5ILU A;  2HQN A;  2ZME B;  2NVY J;  2RNG A;  1ZG3 A;  2VPR A;  4F91 B;  2CQQ A;  3E0J B;  2N8G A;  4M3F A;  2BXY A;  3DV8 A;  4CZZ A;  3EUA A;  2BHY A;  1AOY A;  3I55 I;  2EV0 A;  4UXN A;  3SDG A;  3K10 A;  3K7A J;  3H0D A;  1YTY A;  1DPU A;  2QSF X;  1MZB A;  4R1H A;  1BI1 A;  2JVG A;  1K79 A;  2BYV E;  3OYK A;  2VBW A;  4JBA A;  4A3C J;  1D8K A;  3WTZ A;  1G4D A;  4EM1 A;  2LDU A;  3CD6 I;  3R6S A;  2HKX A;  2FBK A;  2NAZ A;  3E6M A;  5GTH C;  3HOV J;  1F5T A;  4LFU A;  3G1M A;  3KZY A;  1U78 A;  5D4S A;  4ENN A;  1HOM A;  4IOA F;  3PNV A;  4PUS A;  4YFN F;  3ZQL A;  1DPR A;  5J40 A;  2ISY A;  4B3A A;  2STT A;  1R00 A;  2VC1 A;  1F36 A;  2G0E A;  1FX7 A;  1JTY A;  4I6Z A;  3BZK A;  1T2K A;  2VOD A;  2LMD A;  5HS8 A;  4WK8 F;  3GFJ A;  3I64 A;  1A5J A;  1ZLJ A;  2Q1Z B;  3DKX A;  1U9O A;  3QYF A;  2D45 A;  5D6E A;  2ZJ2 A;  2IS6 A;  3SZT A;  3KCC A;  2QA4 I;  2BXZ A;  1LJ9 A;  2H1L A;  3Q0V A;  3KP6 A;  1OFC X;  1D1B A;  1FIA A;  1AHD P;  3KX2 A;  2HDD A;  4LB5 A;  3K6G A;  3R0A A;  4XLC A;  1OR7 C;  2DMU A;  2LRD A;  3DWL E;  4ZYD A;  4BE2 A;  1GV5 A;  3QP6 A;  4MFD A;  4ZTF A;  4B09 A;  3CDH A;  1ODD A;  1E3P A;  3KEQ A;  3Q9V A;  1JT0 A;  3BR2 A;  2A6H F;  1IG7 A;  3OIO A;  4XLF A;  2NVU B;  3GZN B;  3F72 A;  1OCP A;  2XRN A;  1D5V A;  5E1Z B;  2QBY B;  5EZG A;  4LGW A;  5KK1 A;  3I9V 2;  5BMZ A;  4IKF A;  4JYK A;  5TGT A;  2H09 A;  2DBB A;  2JRM A;  2QUF A;  2MH9 A;  4CDG A;  2M87 A;  2IEK A;  4IHY A;  2DT5 A;  2FOK A;  1PUF B;  4C2T A;  3LSI A;  3E6D A;  1E3O C;  2KIF A;  3RZD J;  2D2W A;  1GVJ A;  3OL3 A;  2DOD A;  1OJL A;  3VDX A;  3OS2 A;  4CCM A;  3ABL H;  4MFE A;  4LG0 B;  2A6T A;  4XLN F;  4IX7 A;  2BY1 A;  2X9D A;  1WI3 A;  1OLT A;  4UVB A;  5K7F A;  2MA3 A;  2A69 F;  1L0O C;  3SEZ A;  1S6L A;  1G3T A;  1OKR A;  4MTD A;  3IKT A;  5A2Q Z;  1O3Q A;  3CUQ A;  3F0C A;  3HXL A;  1U6G A;  1I3Q J;  5HLG A;  4S0H B;  1P7I A;  3T1B A;  1JT6 A;  3RTR A;  3CCJ I;  5ILS A;  1E3H A;  3CP2 A;  2UUZ A;  4ITV A;  4ZYG A;  3JRI A;  2QM3 A;  1FPQ A;  1I39 A;  5IP6 A;  1R5I D;  1SD4 A;  2XB0 X;  1MDM B;  4XOR A;  4FCY A;  3B73 A;  3PFY A;  4IZZ A;  2W48 A;  2XVC A;  3ZN1 A;  3WOD F;  2WV1 A;  3IV5 A;  2GBY A;  1R49 A;  2FD5 A;  5M3F J;  4G7H F;  3FMR A;  1FMV A;  3P5J A;  2OC6 A;  2XGC A;  4W1U A;  4EJV A;  4M9Z A;  1FBU A;  2LY1 A;  2Y2Z A;  2IS2 A;  2VQG A;  4BXX J;  1W1W E;  5L3C A;  3K4N A;  1XPX A;  1P4W A;  5E1W A;  5KVR A;  4E4H A;  1MJA A;  5L3D A;  2JA5 J;  2L5Q A;  3BR0 A;  1OYI A;  4LLL A;  3MEX A;  2MW8 A;  1KZH A;  2QLZ A;  4IHV A;  2D1H A;  2GA1 A;  1S29 A;  3ZN0 A;  3AL0 C;  1YW8 A;  5DEQ A;  2M4K A;  2A68 F;  5J6X A;  1A04 A;  3H1C A;  1XSD A;  2HXI A;  4XN0 A;  3I58 A;  4DYQ A;  2DI3 A;  1XDS A;  3HRS A;  1ETV A;  5EG0 B;  4B4C A;  2Z33 A;  1EKE A;  4EJW A;  3QRF F;  1EV7 A;  2HVS A;  3HOW J;  2MFZ A;  3KP4 A;  5DM6 F;  3ASN H;  2ZC2 A;  3TW7 A;  3IWF A;  3K4K A;  3O6B B;  4EJO A;  3SZG A;  4P9U A;  1X4P A;  3LA3 A;  4HF0 A;  3HOY J;  2EIK H;  2KP6 A;  2Y9Z A;  1N75 A;  2FRH A;  4E7Z A;  3EET A;  5J4V A;  3IH2 A;  3D5L A;  4ABZ A;  3DEU A;  1R4N B;  5BPI A;  3GTP J;  4Q48 A;  1K78 B;  3GYH X;  4XSZ F;  2KZV A;  1IF1 A;  4HQM A;  4PDK A;  1LDD A;  3EPZ A;  4P9F A;  1CGP A;  1IZ1 A;  1WJ5 A;  3BG7 A;  2EIN H;  1HQC A;  2EFQ A;  2MD5 A;  1JGG A;  4NUB A;  1UFM A;  2H6C A;  5F1J A;  4F52 A;  1P9Q C;  1ITY A;  2A6E F;  1V3F A;  3TO6 A;  3HUG A;  3FKJ A;  5D8L B;  1VF9 A;  2BE5 F;  1WHU A;  1FOW A;  2F5F A;  2Z16 A;  2PFB A;  1RRJ A;  2LFB A;  1X19 A;  2IP2 A;  1IRZ A;  1TNT A;  2E71 A;  4ENK A;  2DPD A;  2ZFU A;  5B66 C;  2CS3 A;  5C4X J;  1X2N A;  3DU5 A;  4HST A;  4RMN A;  3S3O A;  4A5M A;  2HU9 A;  1ACI A;  3R0J A;  1XMK A;  3RYR A;  4HNV A;  4KDP A;  3DLA A;  3M07 A;  5ILV A;  2PI0 A;  4OIO F;  4BUP A;  2M4G A;  1X4O A;  5FD6 A;  3VB2 A;  1C0W A;  1YE9 A;  2FMY A;  2CG4 A;  3F3X A;  5ICE A;  1FJL A;  1H8A C;  1XSV A;  3PUB A;  4ESB A;  5BOX A;  4F92 B;  1B6A A;  2EH3 A;  3FXR A;  3ISP A;  2HEO A;  3ZMT A;  2ZXH A;  1WI9 A;  3MAJ A;  1TWC J;  3BLY A;  2M3A A;  3Q9S A;  4HYE A;  2VUM J;  2IS1 A;  3BCB A;  4UVC A;  3WTT C;  4II3 A;  1AWC A;  1R5G A;  2IGM A;  3ZMS A;  1YG2 A;  4XOP A;  1H9G A;  4DBQ A;  3MN2 A;  3BOQ A;  5K7Z A;  3H5N A;  2R4G A;  5H6R A;  2E5N A;  2ME6 A;  3S8P A;  3CJT B;  4Z6Y A;  3WGG A;  1F43 A;  1GV2 A;  1YJW I;  3WTV C;  1FWZ A;  3O2P E;  4MIM A;  3ZQG A;  3I71 A;  4D7M A;  3OWT A;  3TDZ C;  1A35 A;  3ZQ7 A;  4C3I J;  2ZJQ F;  1ONV A;  3HEF A;  2MYS A;  3MFK A;  2ACJ A;  1HST A;  2CRG A;  1MBF A;  2DK8 A;  4WXD A;  2XRO A;  2KJB A;  1IV8 A;  2O8K A;  3KIO A;  4MHG A;  4KT6 A;  2R7X A;  2IJL A;  1UST A;  2BY3 A;  3QQA A;  3M3Y J;  3GCM A;  4IHT A;  3GTQ J;  4Y4R A;  2MC4 A;  1W5S A;  4ZZL A;  1U5T B;  3M7G A;  4R8H A;  2DFE A;  2FXA A;  3L2U A;  2VKH A;  1Y0U A;  2H6B A;  5JHF A;  4J19 A;  5GP9 A;  3L2R A;  1GXP A;  2V1X A;  5IYB J;  2EZL A;  4ZYA A;  1LNW A;  3HKZ A;  3E6B A;  2O6G E;  3QYE A;  4YIF A;  2DXI A;  5M3M J;  3G71 I;  1ETK A;  1TBX A;  4L9J A;  4ESJ A;  3I3L A;  3ASO H;  3ABU A;  5CPR B;  4WF2 A;  4HZF A;  2HZT A;  3COA C;  1SMT A;  1UHM A;  2L3D A;  2BY2 A;  4IRH A;  4DOZ A;  1W5C C;  2P4W A;  3EYY A;  1QBJ A;  1BA5 A;  2DW4 A;  2HOS A;  3VOD A;  3I0T A;  1A6I A;  3FM5 A;  2CGP A;  2ESH A;  5DS9 A;  1JI8 A;  2AXL A;  2NS0 A;  3KP5 A;  4AM3 A;  3HHG A;  2ZNY A;  3SFZ A;  4N4O B;  3SQN A;  2ZME C;  2LBF A;  4N9H A;  5F6F A;  1YIJ I;  1VQM I;  3KP7 A;  1ZK8 A;  4YII A;  2PLY A;  1XSX A;  2K3F A;  4O3M A;  4KIG A;  4HV5 A;  4DW6 A;  1KQ9 A;  1MNM C;  3A4C A;  3L7W A;  2M34 A;  2OAZ A;  4HOB A;  4HLY A;  4WCG A;  5AIQ A;  3NRV A;  1N77 A;  1AKH B;  1QHG A;  5F0H A;  4PJJ A;  5K7H A;  2FBI A;  1Y1W J;  4ZDL A;  1FSE A;  1RR8 C;  2W85 A;  3HPG A;  2PX9 A;  2O8X A;  4OAY A;  2WAD A;  3OYB A;  1O4X A;  2AS5 F;  2ZSI B;  2NVT J;  4RB2 C;  2IA2 A;  2BVL A;  1PP8 F;  3Q0W A;  3H3Z A;  1RES A;  1SVL A;  3L1P A;  2GZW A;  1YLF A;  5LGN A;  1XG1 A;  1AU7 A;  3PQK A;  4EQQ A;  3OOP A;  2VON A;  4HX7 A;  2R3S A;  2FJ1 A;  2V1N A;  5J1U A;  4HRI A;  3MQ0 A;  3M4O J;  5F27 A;  1R58 A;  2KIQ A;  1RKW A;  1YIT I;  4PK4 A;  4DJA A;  3DBR B;  2HPI A;  3AFH A;  1W5T A;  1W7P B;  1BR1 A;  2O0Y A;  2E1N A;  5DUI A;  5KNL A;  1QNT A;  1XGO A;  1OCR H;  3HZJ A;  4NC8 A;  4N4N B;  1YX3 A;  2DOA A;  2VOO A;  1IDY A;  1HXD A;  1NG6 A;  1UMQ A;  5A2Q K;  4UV9 A;  2RDP A;  4E7S A;  3FBI B;  5LFA A;  3LA7 A;  1O57 A;  3HB9 A;  4BJ6 C;  3BP8 A;  2ZXJ A;  1S8N A;  2E1M B;  2L9V A;  5HDK A;  1FBQ A;  3B02 A;  1I27 A;  4A0Y A;  2JMW A;  1RET A;  3OSG A;  1REP C;  1LEA A;  2B9S A;  4HX4 A;  2BZT A;  3Q0U A;  1ZAO A;  1N78 A;  1A31 A;  4U88 A;  2HOT A;  2VXD A;  4XOT A;  4HNT A;  1HDD C;  1DP7 P;  4ZJZ A;  4V19 K;  1YO5 C;  2EIL H;  5BNG A;  2EZI A;  5D5U B;  3UNG C;  3R4K A;  3ZMD A;  5CVI A;  4EV0 A;  5FKL A;  2V9V A;  2CWE A;  2Y0S A;  5IPA A;  3T8R A;  1IO2 A;  3A01 A;  3WG9 A;  3JW4 A;  3U2R A;  2QQB A;  3TGN A;  3CP8 A;  3IL2 A;  3GVA A;  1I50 J;  3P9I A;  2CQ7 A;  1S5L C;  1KGS A;  2HYJ A;  1WJD A;  4XKB A;  1UZC A;  2F5C A;  3L2C A;  1QPI A;  2DOF A;  3G1L A;  2KHM A;  2Z9O A;  1IDZ A;  4XQF A;  2MH2 A;  2H8W A;  1WZ2 A;  2XGD A;  2X1E A;  2YU3 A;  3V8J A;  2DTR A;  1IXS B;  2JWT A;  5EEA A;  2X6Y A;  3RYP A;  3CLO A;  4F7Z A;  1E2X A;  2K27 A;  1FYL A;  2KL4 A;  2IBD A;  4B44 A;  2ID6 A;  2IGK A;  5L3B A;  1Y8Q B;  3BTL A;  3FHN A;  1Y1V J;  3WU2 C;  2V6E A;  2DQR A;  2QGU A;  4BXF A;  2FBH A;  4CCJ A;  5FKO A;  3L09 A;  1FOK A;  2IGO A;  2Z5U A;  5HDG A;  1QZZ A;  4C2U A;  3JSO A;  4E7L A;  1LVK A;  2XF6 A;  2MC3 A;  4RAZ A;  4JK1 X;  3AG4 H;  2TDX A;  1ZAR A;  3CUQ B;  2WY7 Q;  3IHU A;  3TQN A;  2CQX A;  1FTZ A;  5DM7 F;  1KQ0 A;  4ESF A;  4G9Y A;  3ZGK A;  9ANT A;  1YJ9 I;  5JFR A;  4BQO A;  1XD7 A;  1O7L A;  4YFK F;  5LHG A;  3QPL A;  3HC7 A;  1TC3 C;  2QSG X;  2JUG A;  4BAC A;  5EZH A;  3PO3 J;  3M8E A;  4RDU A;  4OU0 A;  3RPU D;  1R23 A;  3DPT A;  3FMQ A;  3KLO A;  5J47 A;  1KON A;  3CO6 C;  1IRG A;  2LR8 A;  2R7D A;  4LIV A;  1Y39 A;  1L3L A;  2GA2 A;  4I02 A;  4U0W A;  4IHW A;  4JX5 A;  3B6A A;  6PAX A;  1ZLK A;  5HNH A;  3ULQ B;  2P5L C;  2MLG A;  1F4K A;  2M7B A;  5E20 A;  1DP3 A;  4XRM A;  1W7P D;  1ZHF A;  2CW7 A;  2QVO A;  4GXO A;  1X2M A;  2RVC A;  3JRB A;  4NHJ A;  1YIO A;  3GBG A;  1IJW C;  2VN2 A;  2VJJ A;  1E17 A;  1XX5 A;  2R7O A;  4MQV A;  5LD2 C;  3A0H C;  3EUK L;  3C7J A;  2AO9 A;  1UG2 A;  4DQ2 A;  4A3I J;  2ZBK A;  2RV8 A;  2QZ8 A;  3FIS A;  4G6D A;  4CCO A;  1LFB A;  2OBP A;  3PM1 A;  3QOE A;  2JRT A;  2K85 A;  3BC8 A;  3L00 A;  2COB A;  5LBQ A;  3H9Q A;  2W7N A;  3W2V A;  4QSH A;  2ECC A;  1TZL A;  4A3E J;  4A3G J;  1OMI A;  4JX4 A;  3OYH A;  2O61 A;  1LDJ A;  1KYW A;  2XSD C;  3M8J A;  2Y0M A;  1MJ9 A;  1X3U A;  2K86 A;  3QPT A;  2LY2 A;  4S05 A;  1WWX A;  2JPB A;  1JKR C;  1T39 A;  1PYV A;  1B8I A;  2BGC A;  4U87 A;  1UAA A;  4RS8 A;  4RBO A;  2IRF G;  4NC6 A;  3X2Q H;  2MAB A;  4WXH A;  4M6V A;  4FE7 A;  4WX9 A;  4MEY F;  2HVR A;  4M73 A;  4B48 A;  2DA7 A;  1CF7 A;  5HDN A;  2LYC A;  4FQG A;  5GTI C;  4BY7 J;  3V4G A;  3EUH A;  2DMT A;  2JTV A;  4Y52 J;  4KIT B;  1SVO A;  1WSU A;  4RGS A;  4BH9 A;  4KFC A;  3BR1 A;  1JUS A;  4NBQ A;  5LRR A;  3DCF A;  2WAQ A;  5L3F A;  3IH3 A;  3KP3 A;  2KIM A;  3ABT A;  5K5R A;  1A36 A;  1R5H A;  1WH5 A;  1TQI A;  4L9T A;  3I56 I;  1UJ8 A;  3FXJ A;  2HI3 A;  1OYY A;  4W97 A;  5FKM A;  3H3V K;  4XRF A;  5DCM A;  4KN7 X;  4BEH A;  2EFP A;  1TQM A;  5DYM A;  2CW8 A;  1MD0 A;  1TP4 A;  4E70 A;  4AIJ A;  5LGT A;  1B72 A;  3CF2 A;  3ZCO A;  2M30 A;  4UUS A;  1QQI A;  2KDO A;  2OCC H;  4L5J A;  3HPH A;  3ML6 A;  1X3Z B;  2JA2 A;  4M6Y A;  1R7J A;  3GTM J;  4AIH A;  5FLM J;  2FUG 2;  3K1N A;  2X6O A;  2NYX A;  1MMG A;  3CCV I;  3KZI C;  4BGD A;  2P7C B;  3MKW B;  2WB1 A;  1G3W A;  2JQ7 A;  3GO5 A;  1DGW Y;  2KJC A;  2PEX A;  3TP3 A;  1U5T C;  2J5O A;  3MZH A;  2DMP A;  2P0W A;  2XHK A;  4DBR A;  1VQO I;  2OCE A;  4GFB A;  2KLO A;  2X1C A;  2EIJ H;  1JHH A;  2NOG A;  3CZ6 A;  3BDD A;  2L7M P;  2IGN A;  2K02 A;  2NS7 A;  2V79 A;  4OWR B;  1IW7 F;  3JCU C;  4L0Y B;  1N25 A;  2VT2 A;  3K4B A;  3LSG A;  3ZMU A;  3FF5 A;  1KA8 A;  2ZB9 A;  1VI0 A;  3CCL I;  1YHQ I;  3MZ8 A;  1XGN A;  2K4J A;  2VQL A;  4IRG A;  4DZP A;  3FHZ A;  2R5Y B;  2FE3 A;  2VKV A;  3HIF A;  5KCM A;  2DCE A;  5ICC A;  2BW3 B;  2NXN B;  5H6Q A;  3I4M J;  5D6F A;  3H36 A;  3S2H J;  1F1Z A;  3HGG A;  1SFO J;  2KZG A;  5F0C A;  2IA0 A;  3CCQ I;  3EQL F;  4KYW A;  2QQ8 A;  5FKN A;  1LDK B;  3DPL C;  1YQA A;  3V7S A;  1Y0N A;  3L2Q A;  3C3W A;  1KU7 A;  2LNB A;  5K5O A;  2FOW A;  2CUF A;  1I1G A;  1J5Y A;  5B1B H;  1GXQ A;  1PP7 U;  4U0V A;  2G7H A;  1QHH D;  2LLK A;  2QCO A;  1OQY A;  4OIQ F;  3HRU A;  2ELH A;  1K61 A;  1HKQ A;  1XGM A;  3KZZ A;  4AIK A;  2VQH A;  4A69 C;  1R1U A;  2WV0 A;  3RPQ A;  1USS A;  3OL4 A;  3HKZ N;  1LFU P;  2JSC A;  2M2E A;  4C3H J;  3DF8 A;  4XIC A;  3OR2 C;  2LP0 A;  2OF7 A;  5J8C A;  2VT3 A;  4MTE A;  5EEH A;  1CQT A;  1Z77 A;  4QIW N;  2E36 A;  2K7L A;  3PUF A;  5IP7 J;  3J81 Z;  2QKM B;  2G7U A;  3CQZ J;  3BQY A;  1R6R A;  3GME A;  5HS7 A;  3AG2 H;  2LBF B;  3L9F A;  1KU3 A;  5DD4 A;  2XC7 A;  3I5U A;  4RAF A;  2L7F P;  2XPU A;  4XBF A;  4CYC A;  4Q47 A;  1NHA A;  3WU0 A;  3BTI A;  1HF0 A;  1EF4 A;  2M1B A;  5LEJ A;  5IT9 Z;  2W57 A;  4HLX A;  3FXK A;  2OU2 A;  2L54 A;  2ZJR F;  3HTU A;  1Z3Y A;  3U1K A;  1BIA A;  3CUO A;  3BTC A;  4Y15 A;  3W3C A;  2GWR A;  5CQE A;  3GTG J;  5F1R A;  4OMY A;  3KE2 A;  4X6A J;  2H27 A;  4BJ5 C;  1OIS A;  4AU7 A;  3GTJ J;  1POG A;  4FTH A;  1WFX A;  4LJZ F;  2I5U A;  3GTL J;  4LD5 A;  4E6K G;  2WY8 Q;  3DKY A;  2R5Z B;  1MGT A;  1PUE E;  3FIW A;  3PL8 A;  3N97 A;  4M3G A;  5CVU A;  2WAF A;  1IN4 A;  4BBS J;  1ZG5 A;  2HPM A;  3S1M J;  1HW1 A;  3OV8 A;  4QLC U;  2E1M C;  4BQA A;  3I4P A;  1ZN2 A;  4KMU X;  3F21 A;  1IN5 A;  2R7W A;  3A03 A;  2PJP A;  1Z1D A;  2VKE A;  3HSE A;  1JKO C;  3HOS A;  2VBY A;  2ESN A;  3L2V A;  5F04 A;  5HNF A;  3I59 A;  3V8K A;  2DA6 A;  2LKS A;  4LMY A;  2L2O A;  1ZH5 A;  5LHH A;  3OMY A;  3WTU C;  3F6O A;  1TWH J;  3OS0 A;  1XMX A;  1OYW A;  4BHC A;  4BAY A;  3SYT A;  5KAF C;  2QWW A;  2KIU A;  1X1B A;  1FSH A;  5E3O A;  4L0Z B;  3EDP A;  3JAM Z;  4UNO A;  2DN0 A;  1W0U A;  3ZMZ A;  3J80 Z;  3LQR A;  5HOO A;  1U2W A;  2IPQ X;  2DQL A;  2L0K A;  2HDW A;  1VQN I;  2M8G X;  3CCS I;  1WGX A;  3KLN A;  4BXU A;  4F55 A;  5B5E C;  3P7N A;  5ED4 A;  3LSM A;  3QPH A;  4I0B A;  4JX6 A;  3VYT B;  2LC2 A;  2QF7 A;  2DFH A;  2CFO A;  3LSK A;  3PNY A;  1S72 I;  2QQA A;  1FC3 A;  3G2B A;  4OMZ A;  1D3Y A;  4HDU A;  4AC0 A;  5J8F A;  1IXC A;  1WKM A;  4BJT A;  3AAF A;  2DFF A;  3CJR B;  4XKC A;  4CH7 A;  4EGZ A;  1K7A A;  1K4S A;  2A5Y B;  3F8C A;  3QOD A;  1NK3 P;  3P9C A;  2IT0 A;  4MGR A;  2E5Z A;  4AYB N;  1V5G A;  1FBS A;  2GQQ A;  2XGE A;  4CO8 A;  2V9P A;  1YJN I;  2HDC A;  5IP9 J;  4RM3 A;  1VQ7 I;  2E7W A;  1QRY A;  4IHX A;  3OYD A;  1B1B A;  4I0A A;  4Z2Y A;  3E6C C;  2CUJ A;  4J00 A;  2VQC A;  4ZYE A;  4P5O A;  4BE0 A;  3VPR A;  4G6T B;  2DU9 A;  2Y0S N;  2CUZ A;  4MQ9 F;  3IRR A;  1IUF A;  1ZGW A;  3S32 A;  1WRJ A;  4Y33 A;  1Z91 A;  2R7Z J;  3LWF A;  2EWN A;  2K9M A;  2XAQ A;  3WGH A;  4AUX A;  3DLL F;  3W6K B;  2JUC A;  4KIB A;  2TCT A;  4WXC A;  3CCU I;  2JT1 A;  3JRG A;  2VLA A;  1XTA A;  3U21 A;  2DK5 A;  3SXY A;  4U7D A;  3ZQQ A;  2X4H A;  4LB6 B;  4ZZD A;  3LNQ A;  3VSL A;  2IS4 A;  1M1E B;  3F23 A;  2G9W A;  1DUX C;  1BI3 A;  2EFN A;  3GZ5 A;  4EM0 B;  3CDL A;  3LST A;  2DA1 A;  3BG3 A;  4I76 A;  2PMU A;  1WPK A;  3H3U A;  2LF7 A;  4XSX F;  5M5W J;  4A12 A;  3OYI A;  2XKO A;  2Y48 A;  5J3L A;  3RDI A;  1FIP A;  1S7A A;  4A3D J;  1XN7 A;  5D5X B;  5DCF A;  1RIO H;  3FKI J;  3KFW X;  2E2J J;  2BY0 A;  3K0L A;  4IF4 A;  1Z0X A;  5JLX A;  3CTA A;  2MGQ A;  2VBZ A;  1YS7 A;  1W36 C;  5FD5 A;  1RUO A;  1YRN B;  4HF1 A;  2VBX A;  4K2E A;  1ZR2 A;  2A07 F;  3KET A;  1IAW A;  5JR3 A;  4KIC A;  3N05 A;  1ORK A;  2LOO A;  2O9L A;  2HGC A;  1PUF A;  3T8T A;  2P5V A;  1I6X A;  3AG3 H;  1O3S A;  1D1A A;  1Z7L A;  2LRE A;  1XGS A;  3RI4 A;  2C6Y A;  2KFD A;  3S14 J;  1KU2 A;  4YIR X;  5TRD A;  1MBE A;  4LG0 A;  2ELJ A;  1P92 A;  2P5K A;  2VKD A;  3HRM A;  3ZP5 A;  1FMW A;  4BS9 A;  4DNC A;  3K69 A;  2IAI A;  1Z9C A;  3JRC A;  4GO1 A;  1OPC A;  4UVA A;  3ZOB A;  2YU9 J;  5IOZ A;  1VQ6 I;  2YS9 A;  1FOX A;  2KKO A;  1KQ8 A;  3LSJ A;  4KT5 C;  1UEL B;  1T8I A;  3IAS 2;  1A6Q A;  2UZK A;  2KRH A;  1SAU A;  3RKY A;  3HYI A;  5KHD A;  2OZ6 A;  4RGU A;  3DFG A;  3TL4 X;  4C30 A;  1MDM A;  2ME0 A;  3GX4 X;  5CKT A;  3J7A O;  2DA3 A;  1R22 A;  2JJ7 A;  2XAG A;  1ZGJ A;  3C2G A;  1IN7 A;  2LKP A;  1JJ8 C;  2CV0 A;  3ONQ A;  1BJA A;  3K1M A;  2CV2 A;  4RB1 A;  3OY9 A;  3AG1 H;  5GAH J;  4A2U A;  1J9I A;  5D5W B;  1WCM J;  5CVJ A;  4E7I A;  3CCY A;  2K5C A;  4CCN A;  1Z6R A;  3CMM A;  1SC7 A;  2LF8 A;  1VZ0 A;  4MO7 A;  3F6V A;  1WJA A;  4M72 A;  1SD5 A;  1R1V A;  1T56 A;  1ZR4 A;  5E17 F;  5E3M A;  1FNN A;  1MMA A;  3R60 A;  3NQO A;  4XK4 A;  2GXA A;  2IA1 A;  2Q2E B;  3FZV A;  4A5N A;  3GEZ A;  2OJE D;  3GW2 A;  3JR9 A;  4CUG A;  2BHZ A;  2XB5 A;  1FYK A;  2HTS A;  2XUB A;  4KMF A;  1ULY A;  5H20 A;  2OUM A;  3U1D A;  4V2F A;  4Y7N J;  2VL8 A;  1CF7 B;  2X48 A;  3FXO A;  3E3V A;  3V7R A;  2FSW A;  2K3P A;  3KEY A;  4PSW A;  1J2X A;  3BQZ A;  4RGR A;  1VQ5 I;  1S7O A;  1SAX A;  4D5F A;  3FXM A;  5EG0 A;  3OIP A;  1IGN A;  2BOL A;  1O3R A;  3KP2 A;  1EH8 A;  4IHS A;  1YX5 A;  2ETH A;  1Q1H A;  3ELK A;  4CIC A;  4I7H A;  2HYF A;  5GAE J;  1BIB A;  1JUP A;  3FK7 A;  2W82 A;  3K4C A;  3RKQ A;  1BJZ A;  4BY1 J;  5CVV A;  4R79 A;  2ECB A;  5E79 C;  1OCC H;  1TNS A;  5L3G A;  4L18 B;  3H9J A;  2HQ5 A;  2Z2S B;  2EZH A;  2WAQ N;  3P9K A;  3VFZ A;  3E5Q A;  4BEH B;  2RRE A;  1W0T A;  1K78 A;  2DDA A;  5JVT A;  4JQF A;  4CZC A;  1X3W B;  4IO9 F;  3CJN A;  4ENJ A;  1VQ8 I;  4D1Q A;  1WJE A;  5FLX Z;  3NEU A;  4XMY A;  1B72 B;  3K2A A;  4UUS B;  3BTJ A;  5IYD J;  4RLF A;  4AD9 A;  5FJ8 J;  1VQ9 I;  1P4X A;  2DMN A;  3TOB A;  1BC7 C;  3GF2 A;  4C9Y A;  1I1S A;  3J81 K;  3F22 A;  1DGR M;  2CU7 A;  4G94 A;  4XLA A;  4FIS A;  2NRA C;  2Y69 H;  3BR3 A;  3FXU A;  3W2A A;  1WH7 A;  2L9S A;  3SZP A;  3HTS B;  3O8G A;  2HQA A;  4D7N A;  3TMO A;  2K9L A;  2XAJ A;  5IT9 K;  1HC8 A;  2W24 A;  3TO7 A;  1ZKG A;  3S1Q J;  2WB1 N;  4IVN A;  3G73 A;  2HFH A;  5J1R A;  4U7B A;  4QPQ A;  1EH6 A;  2M0M A;  3ZRG A;  4X1E A;  2EIM H;  4F3Q A;  3I54 A;  3DQV C;  3VEP A;  1FEX A;  5JI6 A;  2F4I A;  3DPU A;  1D1C A;  1T0F C;  2CO5 A;  1PDN C;  5EGO A;  5FFZ A;  1BOB A;  5D5V B;  5IT3 A;  2PJR A;  2FNA A;  4NNJ A;  3W2W A;  1BL0 A;  3S16 J;  2HS5 A;  4O6J A;  1XC5 A;  2MBF A;  4PGH A;  2M5W A;  3CCM I;  4IPA A;  4NQW A;  1OCT C;  2A3S A;  3OR1 C;  2ZSH B;  4II2 A;  1YW9 A;  1ZYR F;  3ZXS A;  1S9H A;  4B1R A;  3FDY A;  4KIS A;  2F2E A;  3FMS A;  4JP0 A;  2X85 A;  1TQP A;  5EDN A;  2VPL A;  4GCV A;  3V42 A;  2XRL A;  1ERD A;  3QYB A;  2CJJ A;  3GLL A;  3ABK H;  1S7E A;  3JTG A;  3EYI A;  4UB8 C;  4ZYH A;  4ANJ A;  1UHS A;  1BR2 A;  4BNC A;  4EJU A;  3F8M A;  4N0B A;  5CVR A;  1TLH B;  4C2M J;  3JAM K;  1U8B A;  4QWQ A;  5ICF A;  2JK3 A;  1APL C;  5BS6 A;  3BZC A;  1GVD A;  4HW0 A;  4KN4 X;  1TWA J;  1V5F A;  3RQI A;  3J80 K;  2X6X A;  4H4K C;  2H94 A;  4MNU A;  3BY6 A;  3BZ6 A;  2HOE A;  3H5R A;  5IOY A;  5D8K B;  5CQG A;  1W4M A;  1XS9 A;  3JRD A;  2F4M B;  4B8X A;  2L9R A;  1OCZ H;  4RAY A;  1LKX A;  1TTY A;  3BG6 A;  4M3B A;  4CYD A;  5JHU A;  3JTH A;  1LQ1 A;  4L9N A;  2W25 A;  3H35 A;  2HVQ A;  1QGP A;  4A3K J;  3GFI A;  3LL7 A;  4CYC B;  1U5T A;  3E7L A;  4A3L J;  1OR7 A;  3CCR I;  1MSE C;  1T98 A;  5B3S H;  3IP4 B;  3G6E I;  3VWB A;  4IJA A;  5E18 F;  1IRF A;  3CES A;  1HCR A;  2AHQ A;  2Y30 A;  4HAM A;  3F8B A;  2DJI A;  2ISZ A;  1MBK A;  1V4R A;  1G3S A;  2PQ8 A;  4OAZ A;  3J7A Y;  1S3J A;  4XON A;  1B9N A;  1R1T A;  4CCK A;  5M5Y J;  3SJM A;  4M3E A;  4BU2 A;  3DU6 A;  1ZGA A;  4XLH A;  3G1O A;  2JZY A;  2XV4 S;  3K70 C;  1QPM A;  2UXX A;  2OTL I;  4I09 A;  2CUE A;  4XNF A;  1Q1V A;  3PFI A;  4Y3O A;  3TO9 A;  5FKK A;  1D0Z A;  1LUJ B;  4XID A;  2QQ9 A;  2XF7 A;  4D0P A;  1H9T A;  2ZO4 A;  3WE2 A;  5C4J J;  1LE8 A;  1J09 A;  2F5D A;  2RC4 A;  2M7A A;  3U9G A;  1B4A A;  1RPW A;  1RI7 A;  1LB2 A;  1HKT A;  4BKX A;  1ETY A;  4CSW A;  2OD5 A;  2YX4 A;  2HXO A;  1R71 A;  4NDL A;  1AKH A;  2CSO A;  2RAE A;  3DTI A;  3D0S A;  4LK0 F;  4M3D A;  1NK2 P;  3CMA I;  3IC7 A;  3OYG A;  2VJ5 A;  2EV6 A;  2IVM A;  1V5E A;  2MG4 A;  1BI0 A;  3HUG B;  4HA8 A;  1K83 J;  3SFI A;  3WTW C;  2K9N A;  3DBH B;  2QEN A;  3A1Y A;  3IKV A;  2HR3 A;  3V8L A;  4YG2 F;  2KIS A;  2CFX A;  2VJI A;  2E19 A;  2W1O A;  5FO5 A;  3RPU A;  2E7X A;  5DTD A;  3S2W A;  3HBL A;  1XCB A;  4A0X A;  4EVI A;  2YPR A;  1ON1 A;  4CCL A;  2CMP A;  1BR4 A;  3S3N A;  4KA4 A;  2GM4 A;  3PNT A;  2VOP A;  4BYY A;  3M1C A;  3QP5 A;  2FML A;  2O7O A;  4I2O A;  1MH3 A;  1W7P A;  3KYD B;  3OYC A;  1QA6 A;  2XAU A;  3A0B C;  3T5X A;  3JSP A;  4XRS A;  1EA3 A;  3ECO A;  2L02 A;  2E35 A;  2BBY A;  1RC9 A;  4KJZ A;  1ZRD A;  3RKX A;  1U0J A;  2EA2 A;  2R7U A;  2NVQ J;  5FRM A;  2DAO A;  2AXT C;  4LLG F;  3S2D J;  4FAS D;  3CC7 I;  1Z7U A;  1SD6 A;  2X0L A;  3TKY A;  3ZMV A;  1H0M A;  2B0L A;  2P6T A;  2VIX A;  4ENM A;  2DMQ A;  3GLX A;  2W00 A;  1Z3X A;  1SFX A;  5LEK A;  3QWL A;  1H88 C;  2EK5 A;  2RKH A;  4E7J A;  4FX4 A;  3FBN B;  4B43 A;  4DGW B;  4EEF G;  2EB7 A;  3IUO A;  5JVG F;  4FE4 A;  4N9I A;  3WHC A;  2D1V A;  1GDT A;  4ZDO A;  1QVT A;  2IW5 A;  3BWG A;  1ZEL A;  4I99 C;  1D0X A;  3K2Z A;  2W84 A;  4M74 A;  2E1C A;  1Z6T A;  4IXA A;  4RM2 A;  1YW7 A;  4L9V A;  2L9N A;  5FRO A;  2V4J C;  3GUD A;  5D4R A;  1BBY A;  3E5X A;  5GPA A;  1W36 D;  4I01 A;  1UG0 A;  1JXS A;  4HV6 A;  4G6Q A;  4P96 A;  3C18 A;  3ROU A;  4L5E A;  1PJR A;  2E34 A;  3WU1 B;  1F9N A;  2COM A;  4PJ0 C;  4M6X A;  1K6O A;  2Q8K A;  3E97 A;  1T95 A;  1T6S A;  2DLL A;  2FQ3 A;  2L7K A;  3TW6 A;  4AVZ A;  1X1P A;  2QSH X;  1TWF J;  2DT7 B;  1UCR A;  4U0Y A;  1J59 A;  2R7T A;  1V55 H;  2ZXW H;  5C3E J;  3M1E A;  3S17 J;  5FB2 A;  2Y9Y A;  4RB3 C;  2XAF A;  3FM3 A;  4KUM A;  3BJA A;  4EM2 A;  5AON A;  2RQP A;  4D9J A;  2VE9 A;  5K5Q A;  4XM3 A;  1HLV A;  3LSR A;  1QO0 D;  2EFO A;  1DU6 A;  2ZJP F;  2FX0 A;  3F9K A;  3JRA A;  4HX8 A;  4E7H A;  4LOC A;  4BQN A;  1LFP A;  4MEX F;  1EJ9 A;  1STZ A;  1X1C A;  2B7E A;  2UXN A;  3BJ6 A;  3QPS A;  3KEO A;  3BRO A;  3HHH A;  4L5I A;  3WTY C;  3SDB A;  4XRS G;  4B47 A;  5FLX K;  5CJ9 A;  1XMA A;  2J5P A;  2JN6 A;  1B59 A;  4QPO A;  2EPF A;  4UV8 A;  3TDU C;  3VYR B;  1JKP C;  2R93 J;  3ZQC A;  1SD7 A;  4RA2 A;  5DD8 A;  3HGY A;  1BI2 A;  2DYR H;  1BM9 A;  1TT5 B;  2LVS A;  3MMY B;  3EUH C;  1XDU A;  3DXJ F;  1ZRF A;  5FFX A;  2QEX I;  2F6C A;  1UHW A;  2MD0 A;  1D8J A;  2DA2 A;  3Q5F A;  4I98 B;  2K9Q A;  4PCQ A;  3RIR A;  4BDY A;  1TT0 A;  3FX3 A;  1NH3 A;  3L2W A;  2CV1 A;  2NVX J;  5GAG J;  2ID3 A;  1Y56 A;  5DDG A;  4H0E A;  5FGM A;  1IXR C;  3OYL A;  3JRH A;  3ZR8 X;  3PJR A;  3MKY B;  2XPV A;  4KNY A;  2L4M A;  2CYY A;  3GXO A;  3RQ4 A;  3TOA A;  4EMS A;  2CW0 F;  1G8X A;  3S3M A;  2UWM A;  1MBJ A;  1WJC A;  4KIF A;  3W6J B;  3HOT A;  1SFK A;  3NAR A;  2RN7 A;  5FLV A;  4X0G A;  4F93 B;  4M9X A;  2OZU A;  3I4N J;  2BV6 A;  2FEZ A;  3TBI A;  4CXF A;  2PMZ A;  1X1D A;  3TED A;  1FYM A;  2NNY A;  2LTP A;  4PZJ A;  5TIS C;  2EBI A;  4HQE A;  1VQ4 I;  2X6W A;  2EQR A;  2FNP A;  3MWM A;  4DIQ A;  1OCO H;  1GLN A;  2GXG A;  3BJO A;  4A3J J;  1ZRE A;  2M0C A;  3DBL B;  2RQQ A;  3LOC A;  3WG7 H;  3HSF A;  4YFX F;  2HWV A;  3HRT A;  4XKW A;  1FP1 D;  2IXS A;  1Z67 A;  2OPT A;  5DV5 A;  4S04 A;  4A3B J;  1HSJ A;  4P55 A;  3GTK J;  3OIQ A;  1AA7 A;  2R0Q C;  3F8N A;  3PQJ A;  4LK1 F;  1ZRC A;  3ZQI A;  2ZME A;  2R7Q A;  3HJE A;  3Q3S A;  1DU0 A;  3IH4 A;  2WAE A;  4D5C A;  1GUU A;  3DKW A;  3W6V A;  2FU4 A;  3BR6 A;  3D5S C;  5GPC A;  3AKZ A;  4A93 J;  2EV5 A;  3E5U A;  2XIG A;  1DDN A;  5E3L A;  3HOU J;  4BQQ A;  3IWZ A;  2DJN A;  3C2H A;  3ECH A;  3CDI A;  4PSX A;  4HPQ A;  2O3F A;  3PIO F;  1UB9 A;  2X1D A;  5L3E A;  1J0R A;  1ZTR A;  2HQR A;  1GT0 C;  3GFM A;  2JPC A;  3A01 B;  3D5R C;  1I6H J;  3QU3 A;  2XKP A;  4MLO A;  1G2H A;  3H5A A;  4FX0 A;  3CUQ C;  5HVQ C;  1R36 A;  3CF5 F;  5C44 J;  1YOV B;  3CJQ B;  5EGO B;  1X58 A;  2PJR B;  3GWZ A;  4YEJ A;  1HKS A;  1LEB A;  4DZJ A;  1FTT A;  5BPD A;  4J01 A;  1VTN C;  4IL6 C;  1SFE A;  2ZKZ A;  3J7Y J;  1MW7 A;  2VJ4 A;  1ENH A;  2E60 A;  1BC8 C;  5F08 A;  2TRT A;  2XPW A;  2OQR A;  1MBG A;  2DA4 A;  5EJC A;  4NQW B;  2LKX A;  2DOE A;  4Q4Z F;  1RZ4 A;  3HSR A;  3WE3 A;  4HSR A;  5E8G A;  5IYC J;  4A3M J;  4FET A;  1JTX A;  1EH7 A;  4PJM A;  2YSR A;  3WGI A;  3N4M A;  2A5W A;  2DTZ A;  4V2G A;  3RCO A;  2CQN A;  5LLQ A;  4IOC F;  2LG4 A;  2WBM A;  5HS9 A;  3GZ6 A;  1X1A A;  5ICG A;  2X51 A;  2CQK A;  2HOA A;  2DPU A;  1NG7 A;  2I8D A;  1QU3 A;  3LAP A;  2A05 A;  4RB0 A;  1TW3 A;  2QBY A;  3BPV A;  2R7R A;  1U9N A;  2OV7 A;  3M8F A;  2GOX B;  1HA8 A;  1YYV A;  1WQ2 A;  1JJ6 C;  4WWC A;  3GFL A;  1JGS A;  5HLH A;  2GXB A; 
#chains in the Genus database with same CATH homology
 5M5X J;  1ZKG A;  3BR0 A;  2DMT A;  3S1Q J;  4Y52 J;  3JRF A;  5EYR A;  2WB1 N;  1QVU A;  5J1R A;  2MW8 A;  3BR1 A;  2R5Y A;  3HOZ J;  1JUS A;  4IHV A;  3MVP A;  3DCF A;  4X1E A;  3CMY A;  1FEX A;  3IH3 A;  1D5Y A;  3OOU A;  1WH5 A;  5EGO A;  2HXI A;  2HI3 A;  4W97 A;  4DYQ A;  1ETV A;  5FKM A;  5EG0 B;  2E1O A;  4B4C A;  1BL0 A;  3H3V K;  3S16 J;  1MH4 A;  1XC5 A;  1JKQ C;  3H0G J;  3HOW J;  2LK2 A;  1OCT C;  3GTO J;  3TW7 A;  2FQ4 A;  4B1R A;  3HOY J;  2MSY A;  1B72 A;  2Y9Z A;  4JP0 A;  4UUS A;  5EDN A;  2XRL A;  3IH2 A;  2LY9 A;  2Y31 A;  4ABZ A;  2CJJ A;  3GTM J;  1S7E A;  5FLM J;  1ZQ3 P;  3GTP J;  2X6O A;  1UHS A;  3OSF A;  1RR7 A;  4C2M J;  1U8B A;  4G12 A;  3TP3 A;  2JK3 A;  3B6C A;  1APL C;  1GVD A;  1JGG A;  1TWA J;  3RQI A;  2DMP A;  1LE8 B;  5F1J A;  5IOY A;  4GFB A;  3ZQF A;  1ITY A;  2NOG A;  1B8I B;  2L7M P;  1XS9 A;  3JRD A;  2L9R A;  2NS7 A;  4M3B A;  1VF9 A;  4A3K J;  2LFB A;  1IRZ A;  3LSG A;  1P7J A;  3LSP A;  2ZB9 A;  1VI0 A;  1X2N A;  4CYC B;  5C4X J;  3E7L A;  4A3L J;  1MSE C;  4DYR A;  4DZP A;  2R5Y B;  1IV6 A;  2R5Z A;  4HNV A;  2KT0 A;  2VKV A;  1HCR A;  2AHQ A;  2Y30 A;  3I4M J;  3S2H J;  1MBK A;  3HGG A;  1SFO J;  5F0C A;  5M5Y J;  3SJM A;  4IEJ A;  4M3E A;  1H8A C;  5FKN A;  1FJL A;  3G1O A;  3RZO J;  2EH3 A;  2D5V A;  2CUE A;  2CUF A;  1Q1V A;  1TWC J;  2I10 A;  3FK6 A;  2VUM J;  2LLK A;  2QCO A;  2ELK A;  5FKK A;  3DEW A;  2VI6 A;  3HOX J;  1K61 A;  4XID A;  3O8H A;  3MN2 A;  4A69 C;  5K7Z A;  3MKL A;  2ME6 A;  5C4J J;  3HKZ N;  1LE8 A;  1ETX A;  1LFU P;  2M2E A;  4C3H J;  4XIC A;  1F43 A;  2LP0 A;  2OF7 A;  3UKG A;  1GV2 A;  1RPW A;  1CQT A;  1Z77 A;  2E2H J;  4QIW N;  5IP7 J;  4BKX A;  2GLO A;  3CQZ J;  3BQY A;  4MIM A;  3ZQG A;  3C2B A;  4D7M A;  1ETY A;  2L7F P;  2HXO A;  2XPU A;  4C3I J;  4NDL A;  3HEF A;  3S1R J;  4CYC A;  1AKH A;  2K9S A;  2P81 A;  2RAE A;  4M3D A;  1NK2 P;  2H8R A;  1BW5 A;  2CRG A;  3BTI A;  1H89 C;  1MBF A;  1HF0 A;  1EF4 A;  1VND A;  1BW6 A;  2MG4 A;  2O8K A;  1K83 J;  1TWG J;  3SFI A;  3QQA A;  3M3Y J;  2K9N A;  3GTQ J;  3TP0 A;  3S1N J;  2E19 A;  3BTC A;  3GTG J;  5DTD A;  4C3J J;  1SAN A;  1RKT A;  3HBL A;  2E2I J;  4X6A J;  3GTJ J;  3JRE A;  1POG A;  4J19 A;  4FTH A;  5GP9 A;  3BT9 A;  3GTL J;  2JA7 J;  5IYB J;  3D1N I;  2R5Z B;  2EZL A;  3FIW A;  2GM4 A;  4M3G A;  4BBS J;  3NAU A;  3S1M J;  2O7O A;  4A3F J;  1MH3 A;  5M3M J;  1ETK A;  3A02 A;  4XRS A;  2R92 J;  3A03 A;  5JLW A;  3ZQH A;  2VKE A;  4UUT A;  2M9H A;  1JKO C;  5F04 A;  2DA6 A;  4DYC A;  1BA5 A;  2HOS A;  1TWH J;  2NVQ J;  1A6I A;  3BG9 A;  3HM5 A;  3WHB A;  5DS9 A;  5E3O A;  2NS8 A;  3S2D J;  1MSF C;  2DN0 A;  2DMQ A;  1W0U A;  3BG5 A;  2JA6 J;  1ZK8 A;  1H88 C;  2LD5 A;  2L0K A;  2M8G X;  1WGX A;  4EEF G;  4DW6 A;  4FE4 A;  1MNM C;  3HDD A;  2M34 A;  5J1Y A;  4JX6 A;  3WHC A;  1GDT A;  1QVT A;  2QF7 A;  1ETO A;  2L7Z A;  1AKH B;  1YRN A;  5F0H A;  1R9T J;  2H1K A;  5K7H A;  4QTR A;  1Y1W J;  1MBH A;  4AC0 A;  2YUS A;  1HDP A;  5GPA A;  1O4X A;  3S15 J;  2NVT J;  1ETW A;  3Q0W A;  1T33 A;  1RES A;  3L1P A;  1NK3 P;  1XG1 A;  4L5E A;  4AYB N;  1AU7 A;  5E3N A;  5HOD A;  2XGE A;  2FJ1 A;  5IP9 J;  3PO2 J;  5J1U A;  1QRY A;  3TW6 A;  4IHX A;  3M4O J;  1TWF J;  5F27 A;  1IC8 A;  1JUM A;  1RKW A;  2DA5 A;  5C3E J;  2EZK A;  4BBR J;  3VPR A;  2KDZ A;  3S17 J;  2Y9Y A;  2Y0S N;  1IUF A;  1ZGW A;  2R7Z J;  2JA8 J;  4AUX A;  1IDY A;  2TCT A;  1HLV A;  3LSR A;  1UMQ A;  1DU6 A;  3JRG A;  2FX0 A;  3JRA A;  4LOC A;  2B63 J;  3LNQ A;  5F0F A;  3BR5 A;  3HB9 A;  3QPS A;  5EF6 A;  4XRS G;  3CDL A;  1VFC A;  2DA1 A;  3BG3 A;  4I76 A;  2JMW A;  1RET A;  1WPK A;  2K40 A;  5M5W J;  2JN6 A;  3OSG A;  1JKP C;  2R93 J;  3ZQC A;  5J3L A;  3Q0U A;  3HGY A;  1FIP A;  2LVS A;  2HOT A;  4A3D J;  1NTC A;  2PMZ N;  1HDD C;  3FKI J;  2E2J J;  5BNG A;  1ETQ A;  2EZI A;  1Z0X A;  5FKL A;  5JLX A;  2DA2 A;  2MGQ A;  2NVY J;  2K9Q A;  1YRN B;  5IPA A;  2VPR A;  1ZR2 A;  2CQQ A;  2NVX J;  2N8G A;  4M3F A;  2ID3 A;  3A01 A;  1ORK A;  3JRH A;  3SDG A;  1I50 J;  3K7A J;  1PUF A;  2O9L A;  2HYJ A;  2XPV A;  1QPI A;  3G1L A;  3S14 J;  1IDZ A;  1MBE A;  4A3C J;  2XGD A;  1MBJ A;  3NAR A;  2JWT A;  5FLV A;  5EEA A;  3HOV J;  2IAI A;  3JRC A;  3ZOB A;  3G1M A;  2YU9 J;  2IBD A;  5IOZ A;  3I4N J;  2ID6 A;  2YS9 A;  3BTL A;  1U78 A;  1Y1V J;  1HOM A;  3LSJ A;  3TED A;  2LTP A;  3ZQL A;  5FKO A;  2EBI A;  4B3A A;  2EQR A;  4A3J J;  1F36 A;  2G0E A;  2M0C A;  2ME0 A;  3LOC A;  1JTY A;  4I6Z A;  2DA3 A;  2JJ7 A;  1JJ8 C;  4A3B J;  2OPT A;  1A5J A;  2CQX A;  1FTZ A;  3GTK J;  2R0Q C;  1U9O A;  9ANT A;  1WCM J;  3ZQI A;  3CCY A;  3QPL A;  3Q3S A;  1DU0 A;  3IH4 A;  3Q0V A;  1TC3 C;  4D5C A;  1GUU A;  3W6V A;  1OFC X;  4MO7 A;  2HDD A;  1FIA A;  3BR6 A;  1AHD P;  5GPC A;  5EZH A;  4A93 J;  2DMU A;  3PO3 J;  1GV5 A;  4MFD A;  1T56 A;  1ZR4 A;  5E3L A;  5E3M A;  4RDU A;  3HOU J;  2DJN A;  4XK4 A;  1JT0 A;  3BR2 A;  3JR9 A;  2XB5 A;  1IG7 A;  3OIO A;  1OCP A;  2LR8 A;  1ZTR A;  4Y7N J;  4V2F A;  5EZG A;  1GT0 C;  2X48 A;  4IHW A;  4JX5 A;  3B6A A;  3A01 B;  1I6H J;  1G2H A;  4MLO A;  4JYK A;  3BQZ A;  4IHY A;  2IEK A;  4D5F A;  1PUF B;  5EG0 A;  4XRM A;  1IGN A;  1X2M A;  3JRB A;  3RZD J;  1E3O C;  3GBG A;  1IJW C;  5C44 J;  1OJL A;  4MFE A;  5EGO B;  1JUP A;  3FK7 A;  1X58 A;  1WI3 A;  2AO9 A;  1UG2 A;  2X9D A;  3RKQ A;  1BJZ A;  4A3I J;  5K7F A;  4BY1 J;  1FTT A;  4DZJ A;  3FIS A;  2ECB A;  1LFB A;  3PM1 A;  1ENH A;  2HQ5 A;  2EZH A;  2TRT A;  2WAQ N;  2XPW A;  3F0C A;  5F08 A;  1MBG A;  2DA4 A;  2COB A;  1W0T A;  1I3Q J;  2LKX A;  4S0H B;  1P7I A;  1JT6 A;  4QSH A;  2ECC A;  3JRI A;  4A3E J;  4A3G J;  1B72 B;  5IP6 A;  5IYC J;  3K2A A;  4UUS B;  4A3M J;  2XB0 X;  4JX4 A;  3BTJ A;  5IYD J;  1JTX A;  2XSD C;  4FCY A;  5FJ8 J;  2W48 A;  2DTZ A;  4V2G A;  2DMN A;  2WV1 A;  1JKR C;  3IV5 A;  2GBY A;  1B8I A;  2FD5 A;  4RBO A;  5M3F J;  2CU7 A;  2HOA A;  2XGC A;  4M6V A;  4W1U A;  4FE7 A;  4FIS A;  3BR3 A;  2Y2Z A;  1U9N A;  1WH7 A;  2DA7 A;  4BXX J;  3O8G A;  4D7N A;  1JJ6 C;  4BY7 J;  2JA5 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...