4EQQA

Structure of ltp, a superinfection exclusion protein from the streptococcus thermophilus temperate phage tp-j34
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
102
structure length
102
Chain Sequence
PEFSKVPKEYRTAVSKAKQYASTVHMSKEELRSQLVSFDKYSQDASDYAVENSGIDYNKQALEKAKQYQDTLSMSPDAIRDQLVSFDKFTQEEADYAVANLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Putative host cell surface-exposed lipoprotein
publication title X-ray structure of a superinfection exclusion lipoprotein from phage TP-J34 and identification of the tape measure protein as its target.
pubmed doi rcsb
source organism Streptococcus phage tp-j34
total genus 44
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07553 Lipoprotein_Ltp Host cell surface-exposed lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4eqqA02
1LEAA 5FGMA 3I53A 5DD4A 2D1HA 5DEQA 3QP6A 4G6DA 1W4MA 5K1YA 2IRFG 2MA3A 1YQAA 1IXRC 4CO8A 3F72A 4S05A 1DDNA 3IHUA 2DW4A 1KU9A 3W6JB 4ESFA 4A12A 1K7AA 1YLFA 4XLNF 4WXHA 3Q9VA 5LHHA 2G7HA 1MJAA 4U7DA 2KIFA 3TDZC 1USTA 3MEXA 2STTA 3LSTA 4H0EA 3QU3A 1E17A 1IXSB 2Z99A 2H09A 5FD6A 1R36A 2XVCA 3T0YA 3COAC 4I0BA 3E6MA 3BDDA 2Y0MA 3H3ZA 1R5GA 3F8CA 2XAQA 2D1VA 1BOAA 3QP5A 4KMFA 2DBBA 3QRFF 1IF1A 1ZLJA 2V9VA 1Z91A 1DP7P 1QPMA 2JPBA 2EA4A 1TW3A 1MJBA 2EV0A 2X4HA 1R23A 2EA2A 1D5VA 2QM3A 4S04A 1HKQA 2AXLA 4JBAA 5JFRA 4BXUA 1QBJA 3U1DA 2M1BA 3I4PA 4O5VA 2IW5A 1YW7A 2QBYB 1TTYA 1JE8A 3C1DA 3MWMA 3E6CC 4BHCA 2HTSA 2M87A 4IRGA 2JPCA 4GCVA 1XGMA 2FE3A 4PZJA 3FXRA 1LNWA 2Y75A 3L7WA 1BM9A 5CVUA 3JSOA 2D45A 4Y17A 1ZGJA 3CJNA 4N9HA 3WTZA 5DYMA 1F9NA 2CSOA 4OIQF 2NNYA 1KYZA 4A5NA 2NAZA 5J8CA 2UZKA 1FPQA 3EYYA 2IA1A 3PFIA 3E6DA 1LQ1A 4WWCA 1MGTA 4UUVA 1P4AA 1S7OA 1YS7A 1U8RA 2YU3A 5DDGA 2VBYA 3GXOA 3VFZA 2A6EF 2OAZA 5E1XA 1S8NA 2RV8A 4L5IA 5E8GA 3IRRA 2VBXA 1RI7A 1RUOA 5ED4A 1O57A 2GIVA 2ZNYA 3GX4X 2CGPA 4HV6A 4XRFA 1QO0D 3RYRA 5D6FA 3FX3A 3F8MA 5E18F 4IHSA 3WGGA 4I98B 5CVRA 4XSZF 1WWXA 3AAFA 4ON0A 2FQ3A 3TKYA 2DAOA 3KZZA 1XCBA 4GYIA 2M45A 5BQTA 3BJAA 2FSWA 4EGZA 3WGIA 3CUQB 4EM2A 2EV6A 4LD5A 2FBIA 2FRHA 2L3DA 5L3FA 1IN5A 2L54A 4P96A 4OIRF 5DUIA 1FZPB 5E20A 4HLXA 3SZPA 4HF2A 3TO6A 1J9IA 3FHZA 1K79A 3DXJF 2M5WA 4IF4A 2O3FA 3DKWA 2L01A 1TBXA 2EB7A 3DFGA 4PDKA 2OQRA 4M71A 5ICEA 2HQNA 4OMZA 2XKPA 1HKSA 3WTSC 1XGSA 5K5RA 2LKPA 5H6QA 2P4WA 3CO6C 3GYHX 1ZREA 3HRMA 4KIFA 3MZYA 4EM0B 2ISYA 1ZRFA 2J5PA 3V7RA 4HBLA 1XSDA 4P55A 2COMA 2Q2EA 4L9VA 4OOIA 3HHHA 3KE2A 1QGPA 2A5YB 3HOSA 1ZARA 1TW2A 2K27A 2M8EA 2CG4A 1I1GA 4I09A 1ZG5A 3L09A 2H94A 4L9JA 4RGSA 4UVAA 3IRQA 4FX4A 4A0YA 4PGHA 4HAMA 2OQGA 3HSEA 3M7GA 2FEZA 2RKHA 2O61A 4G9YA 4OMYA 1USSA 2YX4A 2RDPA 2H27A 2VC0A 1GVJA 2PG4A 3IKVA 5A2QK 3ELKA 1Z1DA 4ZZLA 1B9MA 4KDPA 1SD4A 2VBZA 4RB0A 3FM5A 3WU0A 3SFZA 4HYEA 1L0OC 5CYVA 3QPHA 4L9TA 1J0RA 5DCMA 1TLHB 4ZH4F 3EETA 2QWWA 1KQ0A 1KA8A 1ZG1A 2P7VB 2QYOA 3ABTA 5LRRA 2QLZA 5A2QZ 4ESJA 3PQJA 2HFHA 5F1RA 5HLGA 3K0LA 1G3TA 6PAXA 3V4GA 2WTEA 4CDGA 4KN4X 5E1WA 4EGYA 3KP5A 1BJAA 3L9FA 4RGXA 3JTGA 5FFXA 2P8TA 3GZ6A 1O7FA 1U6GA 3ML6A 5ILVA 2BBYA 1IRGA 1WKMA 2ZKZA 1FC3A 3BJ6A 3FMSA 2PQ8A 3M1EA 5CVVA 4M73A 2A69F 3LA3A 4OIOF 1B59A 1QQIA 3FZVA 4R1HA 1IN6A 2L4MA 4IXAA 2ESNA 1FP1D 2HS5A 3F8BA 3K1PA 2LDUA 2HKXA 3HSRA 1BN5A 3GWZA 2ZMEA 2ZJ2A 2O8XA 1XB4A 2V6CA 2LF8A 1BI1A 1S29A 4R8HA 1YW9A 1YIOA 3GZ5A 3TQNA 4HX8A 4IJAA 4HX4A 4ZZDA 1IXCA 3FF5A 4MQVA 1T38A 4EM1A 3C3WA 1G3SA 5F64A 4NQWA 1E2XA 4G94A 3WTYC 1SD7A 1O3RA 4YG2F 1I5ZA 1MZBA 2EWNA 1SD6A 2HGCA 5JHUA 1W7PA 2MLGA 5JVTA 1F5TA 4I01A 1HW5A 2WC2A 2IT0A 1Z6TA 2JRTA 4EJVA 3J80K 1R22A 3BJOA 2RGVA 3CUOA 5CJ9A 1Z6RA 4M74A 5BPIA 2FBHA 5HOOA 2Q8KA 3JAMK 4FX0A 1FOKA 3TO7A 1JXSA 1XD7A 2DTRA 4ZYEA 2JTVA 2PMUA 3J80Z 5LGUA 2FBKA 3QPTA 2O6GE 3GW2A 1FSEA 3M9AA 3SHFA 3V8LA 1LJ9A 1J7KA 2EK5A 4U88A 5EEHA 1OYWA 3VODA 4UV8A 3JAMZ 1R7JA 3KZYA 4BAYA 3IKTA 2UXNA 2QQBA 1ON1A 5D5WB 3ZMVA 1GXPA 2TDXA 2F5FA 2K4JA 4U7BA 4HF0A 2STWA 2FNAA 2GWRA 2J5OA 1MJ9A 4AVPA 1I1SA 4HW0A 1K78A 1T39A 1D8KA 4DNCA 4XLPF 1B6AA 3K1MA 3PQKA 3FMRA 3ZMTA 2RVCA 1KU7A 3GO5A 5LEKA 5HDNA 2W85A 3HRSA 3KCCA 5L3BA 2E1NA 1P2FA 4LLGF 3LQQA 3F22A 4Y13A 1S7AA 4JQFA 3RKWA 3KP7A 3HTUA 4RB3C 1HQCA 4P5OA 5TRDA 3K1NA 4G6QA 2V1XA 5E1ZB 1YW8A 3I71A 5HS7A 3DP7A 2BYVE 4ESBA 2B0LA 2MH9A 2DPDA 3MZHA 3F3XA 2NNNA 4AIHA 2VT2A 2PMHA 1LDDA 1YO5C 1ZN2A 2JSCA 3HTSB 1FBUA 2VT3A 3U9GA 2V1DA 4BH9A 4BNCA 5L3EA 3W6KB 1FY7A 3WODF 2P5LC 2HR3A 1F4KA 2JT1A 1J75A 4L0YB 3V8JA 1RIOH 3BOQA 4KYWA 4PGGA 1R58A 4CGZA 1XSXA 3BROA 4XSXF 2EFNA 1ZG3A 3ZMUA 4EJOA 2WWYA 2IVMA 3ZMSA 3DPTA 1ZHFA 3RKXA 2DI3A 2NRAC 1UFMA 3WU1B 1JHHA 4LLLA 2K02A 4L5JA 1TNSA 2XAJA 5HDKA 2OD5A 1XDUA 4HQEA 2ZNZA 3E5XA 4AWXB 2PJPA 2PFBA 3T8TA 4LLNA 2H6BA 1O3SA 4CHUA 4EV0A 3DPLC 3KP6A 1IAWA 1P4WA 3KLOA 4M6YA 4BYYA 2Z9OA 4U0WA 4KMUX 4ZYHA 2DPUA 3P9IA 2HEOA 4Q4ZF 4YFNF 4N9IA 2P6TA 5E8IA 2CO5A 3RPQA 3DEUA 4YFKF 4TV7A 4M9ZA 2XV4S 2A3SA 2OZ6A 2Q0OA 2F5DA 3LA7A 1ZH5A 4UXNA 1V3FA 1O7LA 2PN6A 4WXCA 4KFCA 2HYGD 1IW7F 5CLSA 3RTRA 1PP7U 1Z7UA 4BQAA 4O3MA 3RPUA 3TOBA 1IN8A 1IN4A 4MTDA 3EUHA 2IPQX 4HX7A 3K9TA 2GA2A 1Z05A 3ZN1A 2QENA 2R3SA 2GZWA 2RQPA 2GA1A 1D8JA 2XRNA 1VTNC 3P9KA 4UNOA 1W7PB 2K86A 2DQLA 2W84A 2XROA 4OU0A 3F23A 5FD5A 3ZN0A 2IJLA 2E1CA 5EEGA 1G3YA 5LHGA 1BC7C 4HZFA 2HQRA 1H9TA 2DLLA 4KIBA 5JI6A 1SFXA 4WK8F 1F1ZA 3WE3A 3CLOA 4RB1A 2LSOA 3HYIA 2K4BA 3VB2A 5D5UB 4UV9A 2ZO4A 3JTHA 3M8FA 4A2UA 2KJCA 4HF1A 5BS6A 4OIPF 3OV8A 4MNUA 1ON2A 2OBPA 3HUGA 2FOKA 1STZA 2F5EA 5J8FA 4FT8A 4IVNA 1BI2A 4N0BA 3F21A 2DFIA 1MDMA 3R0JA 3FMQA 4LFUA 1FYLA 1BC8C 1XDSA 2FMYA 4Q47A 2VC1A 1KYWA 2FXAA 4LG0A 4P9UA 1R1UA 3GFJA 3FWEA 1X3UA 2DK8A 4HLYA 4AIKA 2ZFWA 1CF7A 4KIGA 5BMZA 4GXOA 3HHGA 3F6OA 2HDCA 5F6FA 5H20A 1JGSA 1MD0A 1SMTA 3E3VA 5HLIA 1EH7A 1FYMA 5K5OA 1OKRA 3H3UA 1FWZA 3S2WA 3QOPA 3RJPA 4IPAA 1TQIA 3WTUC 1ULYA 4CICA 3MAJA 2KJBA 4BHBA 2DQRA 2IA2A 2EFOA 1TQPA 3T1BA 3RI4A 4EQQA 1P6RA 1U2WA 5FB2A 4ETSA 5ICFA 5BPDA 3O2PE 3J81K 2QZ8A 3EDPA 5K5QA 2LF7A 3IWZA 1KQ9A 2EFPA 1U5TC 3ZMDA 3ABUA 4WX9A 3V7SA 3NQOA 4A6EA 1Q1HA 4AIJA 4LK1F 2M30A 2EFQA 4M9SA 4LGWA 4Y15A 1HKTA 3BPXA 2FU4A 4UVCA 3K69A 4U0VA 3OOPA 3VEPA 4ZYDA 2HWVA 2R7FA 2V79A 1KU2A 1ZGAA 4P9FA 4PCQA 2VONA 2ELHA 3SXYA 2VE9A 4AD9A 3RDIA 1BBYA 1XMAA 5BOXA 1T0FA 2W57A 4L0ZB 1B4AA 2H6CA 1IZ1A 5D4SA 1J2XA 4RGUA 4WCGA 2QUFA 1B1BA 3O6BB 4L9NA 3HSFA 3F8NA 5AIQA 3U2RA 3E6BA 1YG2A 3R61A 3LWFA 1LB2A 1IN7A 2P6SA 5FFZA 4HDUA 3G3ZA 4M72A 4WXDA 3K2ZA 3RYPA 2GXGA 2ESHA 2E7WA 2BEOA 3ZPLA 1LVAA 4MTEA 4RS8A 3LA2A 4YIIA 3F8FA 3HRTA 5JR3A 2QVOA 1IUYA 3I54A 3HOTA 1HSJA 5HS9A 5L3CA 4KICA 3REOA 2XKOA 2OA4A 2W25A 2MLKA 1SMYF 3TOAA 4MEYF 2VBWA 1FYKA 1TNTA 1UHMA 4L18B 1B9NA 2DT5A 1IRFA 3CO7C 1ZRCA 4U0YA 1FBSA 1A04A 1U3EM 2Z3YA 2HKOA 4WF2A 1SD5A 2MD5A 4I02A 2AS5F 1XMKA 2WV0A 2K7LA 3ERED 4KUMA 4LMYA 1BI3A 4HDVA 2EV5A 4ENNA 2BGCA 3V8KA 2YX7A 1HW2A 1LDKB 1S6LA 1BI0A 3DQVC 3Q9SA 1EH6A 1R1VA 2Z5UA 3WE2A 1AWCA 4KN7X 3WTVC 5FO5A 1FBQA 3WTTC 1YYVA 1SAXA 1DPUA 2F2EA 2A68F 2FNPA 2DU9A 2QQ9A 2CQKA 3RIRA 5D6EA 5CVJA 1YTYA 2KIMA 1QNTA 4G7HF 3F6VA 5L3GA 4KT5C 2ETHA 4A5MA 1DUXC 4YIFA 2P7CB 2NYXA 5KVRA 1WQ2A 1MDMB 1T6SA 2W24A 3QAHA 4A0XA 5LGNA 4F7ZA 3KLNA 4I2OA 1WSUA 5ICGA 4LG0B 4RGRA 3E5QA 1HSTA 4LJZF 3KEQA 1WI9A 3B02A 1G4DA 1CF7B 3KETA 5J6XA 2XGXA 3GLXA 3NEUA 4Z2YA 1XN7A 4EJTA 4KNYA 1XGOA 2ZCWA 2JZYA 3SZTA 2QQAA 3R4KA 3ECHA 2D2WA 2A61A 3I58A 1Z9CA 2IP2A 3FXUA 4NHJA 1R5HA 4FHTA 4EJWA 5D4RA 1DPRA 2PI0A 1L3LA 2OZUA 3DV8A 4B09A 5DCMB 1Y0UA 4LB6B 3R6SA 3MFKA 1T98A 2KIUA 2O0YA 2VE8A 1U5TA 5DUKA 4I7HA 1GXQA 4LK0F 5LRSA 2GXBA 3I59A 5ILUA 3WGHA 3BPVA 4CYDA 2UWMA 3D5LA 4IHTA 1ZYRF 4B8XA 2PEXA 2BV6A 3KP2A 4JK1X 3I5UA 3V7CA 2XUBA 1W5SA 5AONA 5D5XB 1ODDA 1J59A 4BHPA 3BWGA 4A0ZA 4OINF 1WRJA 4QWQA 3IC7A 2HZTA 3NRVA 3JSPA 1FNNA 1S3JA 3L2CA 1RZ4A 2A6HF 2HTJA 3DF8A 2XASA 4G7OF 2YR2A 3CTAA 3KP4A 3LAPA 3R0AA 2VOOA 4EVIA 2A07F 1O3QA 3GVAA 4CXFA 2MC3A 4GGGA 2ZMEB 5FLXK 3GF2A 3D0SA 2YSRA 4HA8A 1G3WA 1QZYA 2FF4A 3CUQC 1I27A 2C6YA 1RNLA 3KFWX 5DCFA 4M9XA 3FXQA 3BP8A 1GHCA 3RKYA 5FLXZ 4CZZA 4ZYGA 4UHTA 2KKOA 1HW1A 2L4AA 1BIAA 5IT3A 4MHGA 1D3YA 4NB5A 2RNJA 4R79A 3IL2A 4Q5SF 1OPCA 1AOYA 2HYFA 5L3DA 1J5YA 2IA0A 3L00A 4RB2C 2ZBKA 3GUDA 4IRHA 3SQNA 5HLHA 1V4RA 1EH8A 2FMLA 5LGTA 3ISPA 2PLYA 2KRFA 3LQRA 2CWEA 1SFEA 4KA4A 1MKMA 1SFUA 1KQ8A 3LFKA 1ONVA 3BY6A 3H92A 4UVBA 4MQ9F 2Z33A 5CVIA 2L02A 1ZAOA 1U78A 3P7NA 1T2KA 3ZP5A 1TQMA 2MBFA 2X0LA 3VOEA 3C7JA 2XAFA 5HVQC 1RUNA 2O03A 5AIPA 1UCRA 1OYIA 3Q5FA 2P5VA 3WG9A 2CYYA 3R60A 2XIGA 1G6NA 2ZXJA 4G7ZF 4K2EA 1FT9A 4ENMA 1PUEE 1FSHA 3O3KA 3TO9A 1NHAA 1HXDA 1I6XA 2VODA 4Q48A 2XAGA 1KU3A 2CFXA 5ERIA 3E5UA 4O6JA 5HS8A 3EQLF 1FX7A 3T8RA 1C0WA 2DO7A 4YFXF 2EJRA 3E97A 3MQ0A 1K78B 5KK1A 3I0TA 3IWFA 5ILSA 1YS6A 4M6XA 3ZQ7A 1PP8F 2FA5A 1PDNC 1HBXG 3BZ6A 4QLCU 3ECOA 2ADUA 2LNBA 1R00A 4RAZA 1H9GA 1W7PD 3GFLA 2QBYA 3QU6A 3TGNA 1OMIA 1BIBA 2P5KA 3P9CA 5D8KB 2DK5A 5LHIA 2HOEA 4MGRA 3J7AO 3T5XA 3N4MA 4EMSA 5DV5A 3LAJA 2CW0F 2Y48A 1QZZA 3GFIA 5D8LB 1LEBA 2BE5F 2ISZA 5E17F 3TDUC 1OR7A 3M8EA 2VN2A 2ACJA 4IRIA 4MEXF 3WTWC 3ROUA 2OU2A 3G73A 1CGPA 1P92A 3I64A 4ASNA 4E70A 3J81Z 3ULQB 1JHFA 2V1UA 1U5TB 2PBIA 5H6RA 4HOBA 3JW4A 1EV7A 2VOPA 3FM3A 3I59B 3GEZA 2MH2A 3HRUA 3B73A 1ZRDA 3GFMA 5DD8A 2UXXA 1K6OA 1UHWA 4G8XA 3KP3A 1YFHA 3C18A 3EYIA 4I0AA 1XCVA 4GO1A 2E7XA 2RC4A 5D5VB 2EFWA 5IT9K 2XAHA 1R1TA 2R7DA 2XHKA 2NS0A 3N97A 2G7UA 3MCZA 1P4XA 1O3TA 4GYGA 4EJUA 4LB5A 3CUQA 5LBQA 1W5TA 3WTXC 4HV5A 1LDJA 5IT9Z 1UB9A 5ICCA 1ZLKA 4RAYA 5LEJA 4A6DA 4ENJA 2VXZA 1XSVA 1KGSA 1FLIA 5LLQA 2RN7A 2GQQA 2F5CA 1FP2A 3ZMZA 3CDHA 1XGNA 4HQMA 3HIFA 1OYYA 3KEOA 5TJJA 4XBFA 4D0PA 2G9WA 4DQ2A 4ENKA 2YPRA 5HDGA 1H0MA 2GAUA 1REPC
chains in the Genus database with same CATH superfamily
1LEAA 5FGMA 3VYUB 3GTLJ 1DU6A 1A5JA 3I53A 5DD4A 2D1HA 1T08B 4BS9A 5DEQA 1MBGA 2HDDA 2IGNA 3AFHA 3QP6A 2KMUA 2JJ7A 1X3WB 4G6DA 1W4MA 5K1YA 2IRFG 2MA3A 1YQAA 4RLQA 2VKHA 1IXRC 4CO8A 3B6CA 1X19A 3F72A 3BG6A 4S05A 2JVGA 4F91B 1DDNA 3HC7A 3IHUA 2DW4A 4XOPA 1TP4A 4RLFA 1KU9A 3BR5A 1R4NB 1N78A 1JTXA 3W6JB 2FOWA 3OMYA 4ESFA 4A12A 2R5YB 2BY1A 1K7AA 1YLFA 3DBRB 4XLNF 5C4XJ 2HYJA 4WXHA 3PIOF 2K40A 3IAM2 3Q9VA 5LHHA 3S8PA 1ZK8A 3ASNH 2IS4A 2G7HA 1MJAA 2LH9A 3OS0A 4DIQA 4U7DA 2LP0A 2VQHA 2KIFA 3DPUA 3TDZC 1USTA 2KDOA 3MEXA 3S3OA 2STTA 4M6VA 3LSTA 4H0EA 3QU3A 2JRMA 1E17A 1A6IA 1IXSB 2Z99A 3LSPA 2H09A 3IH4A 3OL3A 5FD6A 1R36A 3OYFA 1Z3YA 2XVCA 1U0JA 2EZKA 4ZTFA 3OIOA 3T0YA 1SFOJ 4IO9F 4PJ0C 4CCOA 3COAC 2OCEA 4I0BA 3E6MA 2X6WA 3BDDA 4C3IJ 4XLAA 2Y0MA 4JX4A 3H3ZA 1R5GA 3F8CA 3CC7I 1WH7A 2XAQA 2D1VA 4FE4A 1BOAA 3QP5A 4DW6A 4KMFA 2TRTA 4XKVA 4ZTJA 4FE7A 3K4MA 2CRGA 2DBBA 3QRFF 1WHUA 2W82A 3OS2A 2WAQA 1IF1A 1ZLJA 3N05A 3UKGA 2V9VA 1Z91A 1G8XA 1DP7P 3SEQA 1QVUA 1QPMA 4A3BJ 2JPBA 3OWTA 2EA4A 4ZJZA 1E3HA 1TW3A 1MJBA 2EV0A 1WJAA 2OUMA 3DEEA 2X4HA 2E2JJ 4IX7A 1R23A 2DYSH 3RPUD 1UMQA 2EA2A 3QPLA 3Q0VA 1D5VA 2QM3A 3CLQA 3BG7A 4S04A 4CCKA 3MKYB 1HKQA 3GBGA 2LOOA 3ABLH 2AXLA 4JBAA 5JFRA 4BXUA 2Q1ZB 1QBJA 4LIVA 2VKEA 3OYLA 3U1DA 2M1BA 3PUBA 3I4PA 1D5YA 4O5VA 2IW5A 1X1CA 1YW7A 3W2WA 3K4BA 2QBYB 5JHFA 2X1DA 1VQ7I 1TTYA 2V9PA 1OR7C 1TWAJ 1JE8A 5FKMA 4BE1A 2XPUA 3C1DA 3LSKA 3JRBA 4B4CA 3MWMA 3E6CC 2K85A 2Y9ZA 2OV7A 5J47A 4DZPA 2VI6A 4BHCA 1H88C 3BQZA 4PSWA 1B8IB 2KQRA 3SJMA 2HTSA 2R0QC 2M87A 3A0BC 2JPCA 4IRGA 4RM2A 4GCVA 1VI0A 1MNMC 1SVOA 3SYTA 1XGMA 2EZHA 2FE3A 1Z7LA 4PZJA 2HQAA 2MFZA 2DMUA 4PJMA 1K6YA 2DN0A 2HOTA 2QSFX 2NVUB 3FXRA 3K4CA 1LNWA 3J7AY 2Y75A 3L7WA 2K9LA 1BM9A 5CVUA 3JSOA 2LTPA 3OIQA 1V55H 2EIKH 5CQEA 2D45A 3DTIA 4Y17A 1ZGJA 3CJNA 2L9NA 3VYRB 1MW7A 4C2UA 3GMEA 4N9HA 3QYFA 4M3FA 3WTZA 4AYBN 2R7OA 5DYMA 3GTKJ 2DA1A 2UV1A 3OYHA 1F9NA 2CSOA 5CQGA 2DFHA 4OIQF 2NNYA 2RNGA 1N77A 1KYZA 4A5NA 2NAZA 5J8CA 2UZKA 3VDXA 1FPQA 3EYYA 4ITVA 4XK4A 2IA1A 2VJJA 3BQYA 3M1CA 3PFIA 5H2FC 1WH5A 3E6DA 1LQ1A 4WWCA 1MGTA 2W4SA 3PM1A 3KYLA 1P4AA 1IUFA 4RA2A 4UUVA 1S7OA 1VQ5I 2CV1A 1YS7A 2EINH 5EYRA 3HL2A 1U8RA 2YU3A 5DDGA 4AU7A 2VBYA 3GXOA 3VFZA 2A6EF 2OAZA 3M8JA 1IRZA 5E1XA 4BQQA 2HXIA 3S93A 1S8NA 2RV8A 4L5IA 5E8GA 3IRRA 1BW6A 3CMAI 5DTDA 2VBXA 1RI7A 3ZXSA 2XDVA 1RUOA 5ED4A 1O57A 1I50J 2EZLA 4B43A 4NC6A 4A69C 4F93B 2GIVA 2HI3A 2ZNYA 3GX4X 2CGPA 3HOYJ 4HV6A 4LIUA 4E7KA 4XRFA 1QO0D 3RYRA 5D6FA 4XKWA 2ZJQF 3FX3A 3F8MA 5E18F 3KX2A 1VQLI 4IHSA 3WGGA 2ZJRF 4I98B 5CVRA 4XSZF 1WWXA 1J09A 3AAFA 2XPVA 4ON0A 1W5CC 2FQ3A 1W36D 3TKYA 2DAOA 2F4MB 3KZZA 3RCOA 1XCBA 4GYIA 2M45A 5BQTA 1AHDP 3L2VA 3BJAA 3L2WA 1ETVA 2FSWA 2BY3A 4EGZA 4DYCA 3WGIA 3CUQB 5HODA 5FRNA 4EM2A 2DFEA 2PMZN 2GIZA 2EV6A 2CQXA 4LD5A 1XPXA 2GXAA 2FBIA 2FRHA 2L3DA 2M7AA 2RAEA 5L3FA 1Y6IA 2LR8A 1IN5A 4YEJA 4HNTA 2L54A 4P96A 5J40A 1HOMA 4OIRF 2BHZA 5DUIA 1FZPB 5E20A 4HLXA 1MMAA 3SZPA 4HF2A 1SEUA 3TO6A 2A05A 3BTLA 1J9IA 3FHZA 1K79A 3DXJF 2M5WA 1ZGWA 4IF4A 2O3FA 3DKWA 3PFYA 4NC7A 4RAGA 2L01A 1TBXA 4DYQA 2P0WA 1BW5A 2ELJA 2CUFA 2EB7A 1NG7A 3DFGA 2OQRA 4PDKA 4M71A 3RKQA 5ICEA 1N75A 2BHYA 2HQNA 3BLYA 1I3AA 4OMZA 3GTOJ 2R7WA 3GLLA 2XKPA 2CH0A 4M3EA 3MN2A 4A3CJ 1HKSA 3WTSC 3TEDA 1XGSA 2VB6A 2LKPA 3LSGA 1P9QC 5K5RA 1AKHA 2EZIA 5H6QA 4KJZA 3FXOA 2P4WA 3CO6C 2WAQN 4E7SA 3GYHX 2X9DA 1ETWA 1ZREA 3HRMA 2IXSA 2E2HJ 3BR3A 3QYBA 5TISC 4KIFA 3MZYA 4EM0B 2ISYA 3FK6A 1ZRFA 2VPRA 2J5PA 3V7RA 2E2IJ 3HPHA 2F4IA 3LNQA 4HBLA 1XSDA 4P55A 2COMA 2Q2EA 3DLLF 1FMWA 4L9VA 2NS8A 2V4JC 3FKIJ 4F55A 1IJWC 4XLCA 4OOIA 3HGYA 3HHHA 3KE2A 1QGPA 2A5YB 3HOSA 1YX3A 1ZARA 1TW2A 2K27A 2WADA 2M8EA 3D5SC 5FRMA 2CG4A 2E1OA 3L2QA 3OYJA 2A5WA 3HB9A 1I1GA 3JRCA 4I09A 3KIOA 1ZG5A 3L09A 2H94A 5EEAA 3FK7A 3ABMH 2LYCA 4L9JA 4RGSA 4UVAA 3IRQA 2PJRA 4FX4A 4A0YA 3K70C 3VYSB 3PL8A 1XG1A 4PGHA 5JLWA 3HSEA 2OQGA 2E1MB 3M7GA 2FEZA 2RKHA 4HAMA 4AVZA 1GT0C 1BR1A 1JJ8C 1FTTA 2O61A 3TP3A 1X1AA 9ANTA 2OTJI 2FQ4A 5K7HA 4G9YA 3HOWJ 4IOAF 4OMYA 1USSA 1BOBA 2YX4A 2RDPA 2H27A 1X1DA 2VC0A 3K4NA 1GVJA 1K83J 3OY9A 3LSJA 2PG4A 3MKWB 3IKVA 4E7HA 5FLVA 5A2QK 1VF9A 4B47A 3ELKA 1Z1DA 4ZZLA 1B9MA 2LVSA 4KDPA 1TT5B 1X3ZB 1IC8A 1SD4A 3W3CA 1EF4A 2VBZA 2KZGA 5JVGF 4II3A 4RB0A 3OYIA 3FM5A 3WU0A 4W1UA 2KRHA 1LFPA 4NC8A 3SFZA 4HYEA 1L0OC 1ZR2A 1MMDA 2LC2A 5CYVA 3QPHA 2Y30A 3DBLB 4L9TA 1J0RA 3MKLA 5DCMA 1TLHB 3D1NI 2CU7A 4ZH4F 4XL9A 3EETA 2QWWA 1KQ0A 3H5AA 5GTIC 1KA8A 2WBMA 3G2BA 1ZG1A 4PUSA 2P7VB 2QYOA 3ABTA 5LRRA 2QLZA 3VPRA 5A2QZ 4ESJA 1FIPA 1HDDC 2DA2A 2DT6A 3PQJA 3L2RA 4DOZA 2HFHA 3AL0C 2HVRA 5F1RA 4CCLA 3J7ZI 4E7IA 2K5CA 3G6EI 3NARA 1RR7A 1K61A 5HLGA 1NH3A 3K0LA 4IEJA 3HEFA 1G3TA 1ERDA 6PAXA 3V4GA 4X1EA 1HCRA 2WTEA 2EQRA 4CDGA 4KN4X 5E1WA 1ENHA 4EGYA 3OYGA 3KP5A 1M1EB 1WJ5A 2X6YA 4A3DJ 3GZNB 4XR6A 1W0UA 1BJAA 2M34A 4YIRX 2OF7A 2CMPA 3L9FA 4RGXA 5EGOA 3JTGA 5FFXA 2P8TA 3UR3C 3GZ6A 2JQ7A 1O7FA 1U6GA 3ML6A 4U87A 2CV2A 2H8WA 3OOUA 5ILVA 3BZCA 4AM3A 4FCYA 2BBYA 3KYDB 1IRGA 1WKMA 3OIPA 2ZKZA 1FC3A 1Q1VA 3BJ6A 3ESWB 2X1CA 2ZXWH 2PQ8A 3FMSA 3BTIA 3M1EA 2EBIA 3DTKA 4MFDA 5CVVA 3A0HC 2W1OA 3BR6A 4M73A 2A69F 3QYEA 2R5ZA 1YITI 3HOVJ 3LA3A 4OIOF 1B59A 1QQIA 1JUMA 1ZELA 3FZVA 4QIWN 4R1HA 1IN6A 5IOZA 2ZJPF 2L4MA 1SC7A 4PK4A 2QF7A 4IXAA 3CDIA 2ESNA 3K10A 5FKOA 2EIJH 5FKLA 1FP1D 2HS5A 3F8BA 2H8RA 1F36A 3K1PA 2LDUA 2HKXA 3HSRA 2RQQA 5K7FA 2VPLA 2L5QA 4A3MJ 3I3LA 1BN5A 3GWZA 2ZMEA 2ZJ2A 1RRJA 1YOVB 3CESA 1IGNA 2AQEA 2O8XA 1TL8A 1XB4A 2V6CA 2LF8A 1BI1A 4UUSA 1S29A 2W00A 1MBJA 2XGEA 4HEA2 4R8HA 1DU0A 2LKXA 1YW9A 1Y8RB 2F48A 1YIOA 3GZ5A 1WVRA 2VJ5A 3S3NA 3TQNA 4HX8A 1QA6A 4IJAA 3CCRI 4HX4A 1MBFA 2CQQA 2WA0A 4ZZDA 3FHNA 1H8AC 1IXCA 3FF5A 1OFCX 4MQVA 2FJ1A 4AYBA 1T38A 4ZDOA 1QVTA 3C3WA 4EM1A 1G3SA 3CMEI 5F64A 1IRXA 4NQWA 1E2XA 2Z1DA 4G94A 3S2HJ 3S1NJ 1V5GA 2BY2A 2XB5A 1UELB 2KISA 3WTYC 3JRDA 1SD7A 2XC7A 1O3RA 4YG2F 4N4OB 1I5ZA 1MZBA 1ACIA 2I10A 2EWNA 2JSPA 1SD6A 2HGCA 5JHUA 2VKVA 1W7PA 3MMYB 3M3YJ 3I4MJ 2L7ZA 1D0YA 1XC5A 2MLGA 3HXLA 5JVTA 2K9QA 1F5TA 1P7IA 4I01A 3LSIA 1HW5A 2WC2A 2IT0A 1Z6TA 2JRTA 4EJVA 3J80K 1R22A 1T56A 3AG3H 3BJOA 2RGVA 1JUSA 2AQFA 3CUOA 1GVDA 5CJ9A 4J01A 1RKWA 3TP0A 1Z6RA 1T8IA 2L9VA 4M74A 1VQ9I 3L1PA 3RQIA 5BPIA 2FBHA 2MABA 5HOOA 3HG9A 4MFEA 3OR1C 2L2OA 2Q8KA 1Z67A 2R7TA 3JAMK 1ITYA 2Y69H 4PFPA 2ID6A 5E3LA 4FX0A 3U1KA 3TO7A 4FISA 1FOKA 1JXSA 1XD7A 4AC0A 2K9SA 2DTRA 3PNVA 2JTVA 4ZYEA 1O4XA 2PMUA 2JA5J 3SDBA 3J80Z 5LGUA 2FBKA 4J00A 3S15J 1YX5A 3QPTA 2IGKA 2O6GE 2LY9A 1G2HA 4D9JA 2R93J 3GW2A 5M5XJ 1FSEA 4D7NA 1D0ZA 3M9AA 3SHFA 2JUGA 3V8LA 5J1RA 1LJ9A 3S2DJ 1QHGA 2F5VA 1J7KA 4HRIA 2EK5A 4U88A 5EEHA 1OYWA 3VODA 2PMZA 4UV8A 3JAMZ 4J19A 2YU9J 1IDZA 1R7JA 3KZYA 4BAYA 3IKTA 3F9KA 2VLAA 2UXNA 3JRAA 5FROA 2QQBA 4BL0B 2DODA 1ON1A 3A01A 2O9LA 1WJDA 5HNHA 5D5WB 1JTYA 3ZMVA 1GXPA 2TDXA 3CJQB 4GFBA 1JKQC 1AKHB 2F5FA 2K4JA 1Y8QB 2AXTC 2VJ4A 4U7BA 2IBDA 2OCCH 4HF0A 2STWA 2XGCA 2FNAA 2FX0A 2VQCA 4A3KJ 5CKTA 2GWRA 2J5OA 1MJ9A 2BXZA 4AVPA 3RQ4A 1I1SA 4ANJA 4V2FA 4HW0A 1K78A 3PUFA 1T39A 2BOLA 3H0GJ 1D8KA 3SEZA 3TBIA 4DNCA 2E5ZA 4XLPF 3CF5F 5E3OA 3FXLA 1B6AA 1RETA 1JI8A 3K1MA 2E60A 3FMRA 3PQKA 4A3JJ 3PJRA 2BVLA 3BTCA 3ZMTA 1TWHJ 3CCUI 2RVCA 1KU7A 2KPMA 2XF7A 5GAHJ 3GO5A 3JRHA 5LEKA 2QGUA 2BW3A 1P7JA 3H1CA 5HDNA 2W85A 1MBHA 2ZXIA 3HRSA 3KCCA 1A31A 5L3BA 2E1NA 1P2FA 4LLGF 1OCCH 3LQQA 3F22A 4Y13A 1S7AA 2K3PA 2LKSA 3JRIA 4JQFA 3QWLA 3RKWA 2XSDC 3KP7A 2CUJA 3HTUA 4RB3C 1HQCA 3PNTA 4P5OA 2PJRB 2ICWG 4HPQA 5TRDA 3K1NA 4G6QA 2V1XA 2IEKA 4JYKA 3QOEA 5E1ZB 1YW8A 3I71A 5HS7A 2VQGA 3DP7A 5F0HA 2BYVE 4ESBA 2B0LA 2GOMA 2MH9A 5BNGA 2DPDA 3MZHA 1E0EA 3F3XA 2NNNA 3DU5A 3C2BA 3I9V2 4C9YA 2R92J 2LY1A 4Y52J 2HPIA 3ZQIA 1I6HJ 4AIHA 2VT2A 2PMHA 1LDDA 5DM6F 1YO5C 3HOUJ 1ZN2A 2JSCA 1R71A 1FEXA 3HTSB 1FBUA 2VT3A 3U9GA 2V1DA 4BH9A 3TW7A 4BNCA 5L3EA 4E7LA 5TGTA 5CPRB 3CDLA 3W6KB 1FY7A 2MSYA 3S16J 3WODF 2P5LC 1WZ2A 2HR3A 1ZKGA 1F4KA 2JT1A 1J75A 4L0YB 3V8JA 1RIOH 3BOQA 3GCMA 2VASA 4KYWA 4PGGA 4XKBA 2WY7Q 1R58A 4CGZA 1XSXA 1JKPC 3BROA 3JRFA 2E35A 4XSXF 2EFNA 1ZG3A 3DCFA 3ZMUA 3WHBA 1D1BA 4EJOA 1WFXA 5IYBJ 2E19A 2WWYA 1VQNI 2IVMA 1W0TA 3ZMSA 3S32A 3DPTA 1ZHFA 3RKXA 2DI3A 4BU2A 2NRAC 3H5NA 3S1MJ 1UFMA 3WU1B 3AG1H 3V42A 3O8GA 4XKCA 1JHHA 4LLLA 4B44A 2K02A 5J4VA 3DU6A 2WY8Q 5B66C 4L5JA 3CD6I 5EGOB 1TNSA 2HQ5A 2XAJA 2OD5A 5HDKA 2DCEA 1FJLA 3VWBA 5DM7F 2R7SA 1XDUA 4HQEA 2ZNZA 3E5XA 4AWXB 2PJPA 2PFBA 3T8TA 1MH3A 3NAUA 2KP6A 2M8GX 4LLNA 2H6BA 1O3SA 2GM4A 4I99C 4HNUA 1LUJB 4CHUA 2X1EA 4EV0A 3DPLC 1UJ8A 3KP6A 1IAWA 1P4WA 3KLOA 5F27A 2ME0A 1NTCA 2DOEA 2R5ZB 1T0FC 4M6YA 4BQNA 4BYYA 2Z9OA 2ZMEC 4U0WA 4KMUX 1JJ6C 1U9OA 2ZFUA 4ZYHA 3Q0UA 2DPUA 4IHXA 3P9IA 4XLHA 1WGXA 4Q4ZF 2HEOA 4YFNF 4N9IA 2P6TA 5E8IA 2CO5A 3RPQA 2MD0A 1IG7A 2VQLA 1S72I 4GDFA 3DEUA 5GADJ 4YFKF 4TV7A 2EPFA 4M9ZA 2XV4S 2A3SA 1VQKI 2OZ6A 1QZEA 2Q0OA 2LY2A 3ZGKA 1I39A 2F5DA 3K4JA 3LA7A 1LE8A 2ZB9A 1ZH5A 4UXNA 1GV5A 2N8GA 1V3FA 4L5EA 3CCEI 4OAZA 1O7LA 4C3HJ 2PN6A 4WXCA 2H1KA 3BCBA 4X0GA 4UUSB 4KFCA 2HYGD 1IW7F 3NWSA 5CLSA 3KYCB 3RTRA 1VQOI 1PP7U 2FUG2 2LD5A 1MBEA 3IP4B 1Y1WJ 1RKTA 3QPSA 4BY1J 1Z7UA 3OYAA 4BQAA 4O3MA 2M0CA 3RPUA 3BTJA 3FXKA 1IN8A 2WAEA 3TOBA 5M5WJ 1IN4A 5EJCA 4IZZA 1JUPA 3RZOJ 3K4KA 1YE9A 4MTDA 3EUHA 2IPQX 4HX7A 3K9TA 4IHWA 2GA2A 2JA8J 4NQWB 1AU7A 2R7UA 1Z05A 4ZYAA 3ZN1A 1VQMI 2QENA 2R3SA 2KHMA 1PJRA 3BR2A 4IOCF 2GZWA 2RQPA 3FXMA 2GA1A 1LFBA 1ETXA 1D8JA 2XRNA 1VTNC 1MIJA 3TW6A 2R7QA 3P9KA 4UNOA 1W7PB 1UHSA 1WPKA 2DQLA 1OISA 2K86A 3FIWA 3EUKL 3S14J 2KZVA 2W84A 2XROA 1RR8C 4OU0A 4B3XA 3FKJA 3F23A 2LBFB 5KAFC 5FD5A 4IKFA 3ZN0A 4JX6A 2IJLA 2LMDA 4Y4RA 2FD5A 2E1CA 5EEGA 1G3YA 2R5YA 5LHGA 4BE0A 1BC7C 4HZFA 5C4JJ 5EZHA 2HQRA 1H9TA 4Y3OA 4XMYA 5EDNA 2DLLA 4KIBA 5JI6A 4NUBA 1F43A 1SFXA 1PYVA 2DA4A 4WK8F 4F92B 1F1ZA 4KITB 3WE3A 3CLOA 5IP7J 2LSOA 4RB1A 3HYIA 2E36A 2K4BA 3VB2A 1SFKA 5D5UB 3OYBA 4NDLA 4UV9A 1T33A 5KHDA 2ZO4A 4MO7A 3JTHA 1Y1VJ 3M8FA 4A2UA 2KJCA 4HF1A 2QA4I 5BS6A 1X4OA 2BZTA 4EATA 4OIPF 3OV8A 4MNUA 1ON2A 1D1AA 2KL4A 2OBPA 1GLNA 1MMNA 5B1AH 3HUGA 1S7EA 2FOKA 1STZA 1A36A 3CP2A 1GV2A 2F5EA 2COBA 5J8FA 2KT0A 3RZDJ 1ETYA 4FT8A 4IVNA 2HXOA 1BI2A 4N0BA 3F21A 2DFIA 1RC9A 3A01B 1MDMA 3R0JA 3PSFA 3U21A 5FKKA 3FMQA 4LFUA 2KDZA 4B1RA 1FYLA 1DGRM 1BC8C 1XDSA 2FMYA 4Q47A 2VC1A 3FDYA 1KYWA 2FXAA 4LG0A 4P9UA 1R1UA 2ZXHA 3GFJA 4HSRA 3FWEA 1X3UA 2DK8A 2LFBA 2VKDA 2DFFA 4QPQA 4XRSG 4HLYA 3I4NJ 2ME6A 3K2AA 4AIKA 2ZFWA 1CF7A 4KIGA 3LFUA 5BMZA 1KZHA 3ZQQA 4GXOA 3HHGA 3F6OA 2HDCA 2DOFA 5F6FA 1V54H 1JGSA 2Y0SN 1RPWA 1MD0A 5H20A 1SMTA 3E3VA 5HLIA 5FJ8J 3K4LA 1PUFA 1EH7A 1FYMA 5K5OA 1BA5A 1OKRA 3H3UA 2MC4A 2LREA 1FWZA 2HNHA 2LG4A 5E79C 2BW3B 3S2WA 3QOPA 3RJPA 1Z3XA 1MMSA 1LVKA 3ASOH 4IPAA 1Z77A 3G1OA 1TQIA 3G1LA 1JKRC 3WTUC 3HOZJ 1ULYA 3IUOA 4CICA 3MAJA 3ABKH 2QQ8A 2NS7A 1FIAA 2KJBA 3E7LA 4BHBA 2DQRA 2IA2A 3I56I 4XICA 1JGGA 3VSKA 2EFOA 1TQPA 3T1BA 3RI4A 4EQQA 1P6RA 1B8IA 3Q3SA 4BXFA 3HPGA 1U2WA 2V9KA 5FB2A 4ETSA 1G59A 1K4TA 5ICFA 4A3LJ 5BPDA 3O2PE 3H9JA 4KT6A 3J81K 4V2GA 2I8DA 3S1RJ 2QZ8A 3DWLE 1TT0A 3EDPA 1LKXA 3A02A 5F08A 5KNLA 5K5QA 2R7XA 2LF7A 3IWZA 1KQ9A 2DYRH 2EFPA 2HOAA 5IYCJ 4GRIA 3AL0B 1U5TC 3ZMDA 3ABUA 4D5FA 4WX9A 3V7SA 3NQOA 4A6EA 2HDWA 1Q1HA 4AIJA 2ID3A 4LK1F 1GUUA 2QKMB 2B63J 2M30A 2EFQA 4M9SA 1BR2A 4LGWA 2RREA 1X2NA 3OS1A 2DT7B 4Y15A 2A6TA 3PO3J 1HKTA 3BPXA 2FU4A 3LMMA 2DTZA 2NVQJ 4UVCA 4BEHA 3K69A 1JT0A 5F1JA 5E3NA 4U0VA 3OOPA 3BR0A 2XF6A 3VEPA 5C44J 4ZYDA 2HWVA 4QSHA 2R7FA 2V79A 3M07A 5GPAA 1APLC 3HBLA 1PVEA 1KU2A 1ZGAA 4P9FA 4PCQA 2VONA 2ELHA 3SXYA 5LFAA 3AG2H 1XX5A 1EJ9A 5J1YA 4RM3A 2JN6A 2VE9A 3VSLA 4AD9A 3RDIA 1JKOC 1BBYA 4XOTA 1XMAA 5BOXA 1OCPA 3E0JB 1T0FA 5F0FA 2W57A 2ZC2A 1BL0A 1OCTC 4L0ZB 1B4AA 3H35A 3L2UA 2H6CA 3HJEA 4HG2A 1IZ1A 5D4SA 2JA2A 1J2XA 4RGUA 4WCGA 2M4GA 1FTZA 2QUFA 1B1BA 3O6BB 4L9NA 3HSFA 3F8NA 5AIQA 5J3LA 3ZRGA 3U2RA 3KEYA 4N4NB 4XNFA 2IS6A 3E6BA 1YG2A 3R61A 3C2GA 3LWFA 1LB2A 1IN7A 2P6SA 3K70D 5FFZA 4HDUA 3ONQA 2MYSA 3OYNA 3G3ZA 4M72A 4WXDA 1SVMA 3K2ZA 1IV8A 5M5YJ 2WB1N 3RYPA 1T95A 2QKLB 2GXGA 3H9QA 4RAFA 4PSXA 2ESHA 2E7WA 3OSFA 2BEOA 5GPCA 3ZPLA 1LVAA 4MTEA 4RS8A 2JK3A 5J1UA 4BBSJ 3LA2A 4XM3A 4YIIA 2E71A 3F8FA 3HRTA 1YJWI 2CQ7A 3P5JA 1Y0NA 5JR3A 2QVOA 4A93J 2DA5A 1DGWY 3CJRB 2NVTJ 1IUYA 3I54A 4H4KC 3HOTA 1HSJA 1LE8B 5HS9A 3CC4I 5L3CA 4KICA 3FXJA 3KZIC 3REOA 2IS1A 2XKOA 2OA4A 3EUHC 4LG3A 1YIJI 1Y56A 2W25A 5IY5H 2KIQA 2O7OA 2MLKA 1SMYF 4CSWA 3J7YJ 1IV6A 2DDAA 4XLEA 3TOAA 4MEYF 2VBWA 1FYKA 1TNTA 2Y31A 1UHMA 4A3GJ 4L18B 3GTQJ 2X48A 3JRGA 3CMYA 3GTMJ 4XORA 1B9NA 2DT5A 2MW8A 4ABZA 1IRFA 5IPAA 3CO7C 2E5NA 2K3FA 2B9SA 1ZRCA 4IQ4A 4U0YA 4HNVA 1QHHD 1FBSA 1LFUP 2OTLI 1AA7A 2X6OA 1A04A 4E4HA 1U3EM 2Z3YA 2HKOA 3C2HA 2EIMH 4WF2A 1SD5A 2R7VA 2M7BA 3B6AA 4HSTA 2MD5A 4I02A 4IQJA 4X6AJ 4LITA 5FKNA 4B48A 5B3SH 3ZQCA 2AS5F 1XMKA 2WV0A 2K7LA 4I76A 1X2MA 3CZ6A 1HDPA 2V7FA 3MD2A 3ERED 4KUMA 4LMYA 1BI3A 4E7JA 4A3FJ 3PSIA 4HDVA 2CJJA 1B72A 2Y2ZA 2EV5A 4ENNA 2BGCA 2W48A 3V8KA 2YX7A 4YRVA 1HW2A 3FBIB 5EF6A 3PNYA 1OCOH 4PJNA 2VIXA 1SANA 1LDKB 4DBRA 3A2KA 1S6LA 1BI0A 3DQVC 3Q9SA 1EH6A 3HKZA 3OYCA 1R1VA 2Z5UA 3WE2A 1AWCA 1S9HA 2HU9A 4KN7X 3WTVC 5M3FJ 5FO5A 2X85A 1FBQA 3WTTC 4ZDPA 2EH3A 1YYVA 1ETQA 1SAXA 2M3AA 1DPUA 1OCRH 2F2EA 3OYKA 4IL6C 3ZQLA 4BXXJ 3BT9A 2A68F 2XSJC 2FNPA 2DDBA 2DU9A 2QQ9A 4PFOA 2VJIA 1UG0A 2Q2EB 2CQKA 3LSRA 3RIRA 4BDYA 5D6EA 1YRNA 1UG2A 5CVJA 1YTYA 2HVQA 5KAIC 3HUGB 2AO9A 2KIMA 3GTPJ 1QNTA 2IGOA 4BQOA 2ECCA 1UZCA 2X6XA 3AKZA 4G7HF 1QPIA 3F6VA 2LRDA 5L3GA 4KT5C 2ETHA 4A5MA 1DUXC 4YIFA 2P7CB 2NYXA 5KVRA 1V5EA 4XRMA 1WQ2A 1MDMB 1T6SA 2BY0A 3K6GA 1NK2P 5B1BH 2IAIA 1IO2A 4ZC3A 4C2TA 2W24A 1TWCJ 2CS3A 3BZKA 4CYCA 3QAHA 4A0XA 5LGNA 1Z0XA 2L7FP 4F7ZA 2EILH 3KLNA 5IOYA 3CF2A 2D5VA 1EA3A 1WJEA 4I2OA 1WSUA 5ICGA 3BG9A 4LG0B 2KRCA 4MLOA 4RGRA 1W36C 2CV0A 3E5QA 1HSTA 5GP9A 2I5UA 4LJZF 3KEQA 1WI9A 3B02A 4XONA 1G4DA 2L9RA 4D1QA 1CF7B 3ZQFA 3KETA 4UUTA 5J6XA 1UAAA 2XGXA 3GLXA 3NEUA 4Z2YA 1XN7A 4G12A 1DQUA 4EJTA 4KNYA 1XGOA 2ZCWA 2JZYA 4E7ZA 3Q0WA 1BJZA 4AIDA 2XB0X 3SZTA 4DJAA 2QQAA 3I55I 3R4KA 4BE2A 3ECHA 2A61A 2D2WA 4BY7J 3I58A 3M4OJ 2L7MP 1PUFB 4A3IJ 1Z9CA 1R9TJ 2IP2A 1WCMJ 3FXUA 4NHJA 1R5HA 3EUAA 2NVYJ 4FHTA 4QPOA 4EJWA 5D4RA 1DPRA 2PI0A 1ETKA 1L3LA 1S5LC 2OZUA 3S3MA 3DV8A 4B09A 5DCMB 1Y0UA 4LB6B 3QQAA 2P81A 3MKZA 3R6SA 3MFKA 1T98A 2NVXJ 2KIUA 2O0YA 4E6KG 2VE8A 1U5TA 1ZR4A 1FOYA 5DUKA 3DKXA 4I7HA 1GXQA 4LK0F 5LRSA 5GAEJ 1E3PA 2Y0SA 4F52A 2GXBA 3H36A 2MG4A 1VNDA 2JVHA 4G6TB 3I59A 5ILUA 3WGHA 3BPVA 4CYDA 2UWMA 1Y39A 2CW7A 3D5LA 4IHTA 2CFOA 1ZYRF 4B8XA 5EG0A 1N25A 1HA8A 2PEXA 4IHYA 2BV6A 2KLOA 3KP2A 2DMPA 4JK1X 3I5UA 3V7CA 2XUBA 3KPHA 3PO2J 3GTGJ 1W5SA 5AONA 5D5XB 1ODDA 3CCMI 1XTAA 3TMOA 4DZJA 1FOXA 1OQYA 1J59A 3A03A 4BHPA 3BWGA 4A0ZA 3QODA 4BJTA 3OL4A 4OINF 2M9HA 1WRJA 3HGGA 2XAUA 2JA7J 3CCSI 4QWQA 1RESA 3IC7A 5DS9A 2HZTA 1OJLA 3NRVA 5IP6A 3ZOBA 3JSPA 1MNEA 3IAS2 4BEHB 1FNNA 1S3JA 3L2CA 1HLVA 1RZ4A 2A6HF 2HTJA 3DF8A 2XASA 3LOCA 3ZQHA 4G7OF 3CP8A 2YR2A 3CTAA 2Z16A 3KP4A 3LAPA 3R0AA 5F04A 5GAGJ 2VOOA 4EVIA 2A07F 1U8BA 3S1QJ 2GOXB 2M0MA 1O3QA 3GVAA 2XF5A 1EKEA 4CXFA 3SFIA 2MC3A 2DJIA 4GGGA 2ZMEB 1TC3C 5FLXK 3GF2A 2ZSIB 1R5ID 3D0SA 3G1MA 1E3OC 2YSRA 2NOJB 4HA8A 4XQFA 1G3WA 1OLTA 2R7ZJ 1QZYA 4B3AA 2CUZA 2FF4A 3CUQC 1I27A 5E3MA 2DA6A 2C6YA 1RNLA 1WJBA 1MMGA 3KFWX 5DCFA 4M9XA 4CA0A 5KCMA 1Z21A 2OC6A 3FXQA 4Z6YA 3BP8A 1W1WE 1GHCA 2DMTA 3RKYA 4KISA 3EPZA 2QSHX 5FLXZ 3HOXJ 4CZZA 2OPTA 4ZYGA 4UHTA 2KKOA 4C30A 2HVSA 3WG7H 3CC2I 1HW1A 2L4AA 4FQGA 1D1CA 1BIAA 5IT3A 4MHGA 2CUEA 1D3YA 3LL7A 2ELKA 2R4GA 3CQZJ 4NB5A 4W97A 1XS9A 1MH4A 3HKZN 2LK2A 3OYDA 4M3BA 5EZGA 3G4SI 2RNJA 2BXYA 4BKXA 3BG3A 4R79A 3IL2A 1K4SA 3JREA 4Q5SF 1OPCA 1AOYA 2K9MA 2HYFA 5L3DA 2UUZA 1VQPI 1MSFC 1A6QA 1J5YA 2WV1A 4BBRJ 2IA0A 3L00A 2WB1A 4II2A 4RB2C 2F6CA 3VYTB 1R4MB 2ZBKA 2DJNA 2F4OB 3CCJI 4S0HB 3GUDA 3HZJA 4IRHA 3SQNA 5HLHA 1V4RA 1EH8A 2FMLA 1JT6A 1ETOA 5LGTA 3ISPA 2PLYA 1SAUA 2KRFA 3LQRA 2CWEA 1SFEA 4KA4A 1MKMA 1SFUA 1KQ8A 4C3JJ 2HZDA 3LFKA 1U9NA 3H0DA 1ZQ3P 3D5RC 1WJFA 1ONVA 2X51A 2DOAA 3BY6A 4CUGA 3H92A 4UVBA 4DYRA 4MQ9F 2L7KA 3OYEA 2Z33A 3A1YA 3E1SA 5CVIA 5M3MJ 2L02A 1ZAOA 1U78A 3P7NA 1T2KA 4BJ6C 4ZDLA 1TQMA 3ZP5A 3SDGA 2MBFA 2X0LA 3CCYA 3S17J 1VFCA 4NBQA 3VOEA 4XIDA 2O5RA 1VQ4I 3C7JA 2XAFA 3BG5A 3OR2C 3PIPF 3OYMA 5HVQC 1R49A 1RUNA 2O03A 4XN3A 5F0CA 3JR9A 5AIPA 4XRSA 1ORKA 2NOGA 3IH2A 1UCRA 1OYIA 3Q5FA 2P5VA 2YUSA 3WG9A 2CYYA 4CZCA 5K7ZA 3R60A 2L9SA 2XIGA 1G6NA 2ECBA 2ZXJA 3FBNB 4K2EA 4G7ZF 1B72B 1FT9A 2HOSA 4DGWB 1X58A 4ENMA 4XLFA 1PUEE 4P1WA 3W6VA 2W7NA 1FSHA 3O3KA 3HDDA 3MVPA 3H5RA 3TO9A 2E1MC 3IH3A 1NHAA 4BACA 4YELA 1HXDA 1FOWA 2E34A 1I6XA 2VODA 4Q48A 2XAGA 1KU3A 2CFXA 5ERIA 1YJNI 3E5UA 4O6JA 5HS8A 1NG6A 3EQLF 1FX7A 4PJJA 4XN0A 4C2MJ 3T8RA 3IV5A 1C0WA 2QSGX 2DO7A 2DXIA 1NK3P 4YFXF 1CQTA 1KONA 2EJRA 3E97A 1YJ9I 4AUXA 3MQ0A 1K78B 4RDUA 3MZ8A 2XGDA 5GTHC 5KK1A 4MIMA 3LSHA 3I0TA 3IWFA 5ILSA 3DBHB 1BR4A 1YS6A 2G0EA 4EEFG 1YRNB 4M6XA 3ZQ7A 2CQNA 2IGMA 1PP8F 2FA5A 3CCLI 1PDNC 1HBXG 2XRLA 3BZ6A 4QLCU 2NXNB 3W2VA 3ECOA 3DEWA 2ADUA 2LNBA 2CW8A 1R00A 4RAZA 1H9GA 1W7PD 1TWGJ 3GFLA 4CCMA 2QBYA 3CJTB 3QU6A 3TGNA 1OMIA 1BIBA 2P5KA 3P9CA 5D8KB 5HNFA 2DK5A 5LHIA 2HOEA 4MGRA 4CH7A 4CYCB 1V5FA 4RMNA 3J7AO 3T5XA 3N4MA 1FMVA 4EMSA 3H3VK 4M3DA 5DV5A 4PJLA 1MBKA 3LAJA 2CW0F 2Y48A 1YI2I 1QZZA 1HF0A 4LOCA 4I6ZA 2DMQA 4Y7NJ 3ZCOA 3GFIA 5D8LB 1LEBA 2BE5F 2ISZA 4BUPA 5E17F 3TDUC 1A35A 1OR7A 3M8EA 2VN2A 1HC8A 2ACJA 3H9GA 4IRIA 1X1BA 4MEXF 2JA6J 2GBYA 3WTWC 3ROUA 3FISA 2OU2A 2M2EA 4M3GA 2DA3A 3G73A 1QU3A 1VZ0A 3AG4H 2VL8A 2QEXI 3HM5A 2VXDA 1WJCA 1CGPA 3TL4X 1P92A 1X4PA 2V26A 3I64A 4ASNA 3OSGA 4E70A 2DMNA 3BC8A 3J81Z 4BGDA 4FETA 1JHFA 2B7EA 3ULQB 2V1UA 1U5TB 3BR1A 4DBQA 2PBIA 2Y9YA 5H6RA 4HOBA 3JW4A 2AHQA 1YHQI 1EV7A 3ZR8X 1ZTRA 3GTJJ 2VOPA 3FM3A 3I59B 2OJED 2V1NA 5HLTA 3UNGC 3GEZA 1OCZH 2MH2A 3HRUA 3X2QH 3LSMA 1R6RA 3B73A 1LPQA 4IHVA 2DA7A 1DP3A 1I3QJ 5EG0B 1ZRDA 2WAFA 3ERMA 3GFMA 3RSNA 4UB6C 1H89C 5DD8A 4JX5A 2YS9A 1TWFJ 2JWTA 2O8KA 1VQ6I 3JCUC 2UXXA 1K6OA 2KFDA 1UHWA 4G8XA 1X1PA 3DLAA 1D0XA 1TZLA 2QCOA 3KP3A 1YFHA 5IP9J 3C18A 3EYIA 4F3QA 2H1LA 4I0AA 5B5EC 1XCVA 1MSEC 5IYDJ 4CCNA 2ZSHB 3A4CA 4GO1A 2E7XA 3ZQGA 2PX9A 2RC4A 5C3EJ 4JP0A 1SVLA 5D5VB 2VUMJ 2EFWA 5IT9K 2XAHA 3CMMA 3F0CA 1R1TA 4CCJA 2R7DA 2XHKA 2NS0A 3WU2C 3N97A 2G7UA 3MCZA 3O8HA 1P4XA 1O3TA 4GYGA 2MGQA 4EJUA 4LB5A 3CUQA 5LBQA 4D7MA 1VQ8I 3WHCA 1W5TA 2V6EA 4OAYA 4FTHA 2JMWA 2Z2SB 5LD2C 3WTXC 2BVMA 4HV5A 4NNJA 1LDJA 2M4KA 4D5CA 3BCAA 3CCVI 5JLXA 5FLMJ 2L0KA 1IDYA 2TCTA 2R7RA 5IT9Z 1UB9A 4QTRA 5ICCA 1ZLKA 4RAYA 5LEJA 4A6DA 4ENJA 3G71I 2VXZA 4OWRB 1XSVA 1KGSA 4UB8C 1FLIA 5LLQA 2RN7A 2GQQA 2F5CA 1FP2A 2K9NA 3ZMZA 4V19K 3CCQI 3W2AA 2JUCA 4BDZA 1XMXA 3CDHA 4UY8I 1GDTA 1XGNA 2LLKA 3NWTA 2LBFA 3DTEA 3HIFA 3DKYA 4HQMA 1OYYA 3KEOA 5TJJA 2GLOA 1WI3A 4XBFA 4BJ5C 4Y33A 3K7AJ 2XPWA 4D0PA 1QRYA 2G9WA 4JOMA 4DQ2A 4FASD 5J4YA 4ENKA 2YPRA 5HDGA 1H0MA 1MNDA 1POGA 2GAUA 2IS2A 1REPC 4A3EJ 3SZGA 4RBOA 2HPMA
chains in the Genus database with same CATH topology
1LEAA 5FGMA 3I53A 5DD4A 2D1HA 5DEQA 3QP6A 4G6DA 1W4MA 5K1YA 2IRFG 2MA3A 1YQAA 1IXRC 4CO8A 3F72A 4S05A 1DDNA 3IHUA 2DW4A 1KU9A 3W6JB 4ESFA 4A12A 1K7AA 1YLFA 4XLNF 4WXHA 3Q9VA 5LHHA 2G7HA 1MJAA 4U7DA 2KIFA 3TDZC 1USTA 3MEXA 2STTA 3LSTA 4H0EA 3QU3A 1E17A 1IXSB 2Z99A 2H09A 5FD6A 1R36A 2XVCA 3T0YA 3COAC 4I0BA 3E6MA 3BDDA 2Y0MA 3H3ZA 1R5GA 3F8CA 2XAQA 2D1VA 1BOAA 3QP5A 4KMFA 2DBBA 3QRFF 1IF1A 1ZLJA 2V9VA 1Z91A 1DP7P 1QPMA 2JPBA 2EA4A 1TW3A 1MJBA 2EV0A 2X4HA 1R23A 2EA2A 1D5VA 2QM3A 4S04A 1HKQA 2AXLA 4JBAA 5JFRA 4BXUA 1QBJA 3U1DA 2M1BA 3I4PA 4O5VA 2IW5A 1YW7A 2QBYB 1TTYA 1JE8A 3C1DA 3MWMA 3E6CC 4BHCA 2HTSA 2M87A 4IRGA 2JPCA 4GCVA 1XGMA 2FE3A 4PZJA 3FXRA 1LNWA 2Y75A 3L7WA 1BM9A 5CVUA 3JSOA 2D45A 4Y17A 1ZGJA 3CJNA 4N9HA 3WTZA 5DYMA 1F9NA 2CSOA 4OIQF 2NNYA 1KYZA 4A5NA 2NAZA 5J8CA 2UZKA 1FPQA 3EYYA 2IA1A 3PFIA 3E6DA 1LQ1A 4WWCA 1MGTA 4UUVA 1P4AA 1S7OA 1YS7A 1U8RA 2YU3A 5DDGA 2VBYA 3GXOA 3VFZA 2A6EF 2OAZA 5E1XA 1S8NA 2RV8A 4L5IA 5E8GA 3IRRA 2VBXA 1RI7A 1RUOA 5ED4A 1O57A 2GIVA 2ZNYA 3GX4X 2CGPA 4HV6A 4XRFA 1QO0D 3RYRA 5D6FA 3FX3A 3F8MA 5E18F 4IHSA 3WGGA 4I98B 5CVRA 4XSZF 1WWXA 3AAFA 4ON0A 2FQ3A 3TKYA 2DAOA 3KZZA 1XCBA 4GYIA 2M45A 5BQTA 3BJAA 2FSWA 4EGZA 3WGIA 3CUQB 4EM2A 2EV6A 4LD5A 2FBIA 2FRHA 2L3DA 5L3FA 1IN5A 2L54A 4P96A 4OIRF 5DUIA 1FZPB 5E20A 4HLXA 3SZPA 4HF2A 3TO6A 1J9IA 3FHZA 1K79A 3DXJF 2M5WA 4IF4A 2O3FA 3DKWA 2L01A 1TBXA 2EB7A 3DFGA 4PDKA 2OQRA 4M71A 5ICEA 2HQNA 4OMZA 2XKPA 1HKSA 3WTSC 1XGSA 5K5RA 2LKPA 5H6QA 2P4WA 3CO6C 3GYHX 1ZREA 3HRMA 4KIFA 3MZYA 4EM0B 2ISYA 1ZRFA 2J5PA 3V7RA 4HBLA 1XSDA 4P55A 2COMA 2Q2EA 4L9VA 4OOIA 3HHHA 3KE2A 1QGPA 2A5YB 3HOSA 1ZARA 1TW2A 2K27A 2M8EA 2CG4A 1I1GA 4I09A 1ZG5A 3L09A 2H94A 4L9JA 4RGSA 4UVAA 3IRQA 4FX4A 4A0YA 4PGHA 4HAMA 2OQGA 3HSEA 3M7GA 2FEZA 2RKHA 2O61A 4G9YA 4OMYA 1USSA 2YX4A 2RDPA 2H27A 2VC0A 1GVJA 2PG4A 3IKVA 5A2QK 3ELKA 1Z1DA 4ZZLA 1B9MA 4KDPA 1SD4A 2VBZA 4RB0A 3FM5A 3WU0A 3SFZA 4HYEA 1L0OC 5CYVA 3QPHA 4L9TA 1J0RA 5DCMA 1TLHB 4ZH4F 3EETA 2QWWA 1KQ0A 1KA8A 1ZG1A 2P7VB 2QYOA 3ABTA 5LRRA 2QLZA 5A2QZ 4ESJA 3PQJA 2HFHA 5F1RA 5HLGA 3K0LA 1G3TA 6PAXA 3V4GA 2WTEA 4CDGA 4KN4X 5E1WA 4EGYA 3KP5A 1BJAA 3L9FA 4RGXA 3JTGA 5FFXA 2P8TA 3GZ6A 1O7FA 1U6GA 3ML6A 5ILVA 2BBYA 1IRGA 1WKMA 2ZKZA 1FC3A 3BJ6A 3FMSA 2PQ8A 3M1EA 5CVVA 4M73A 2A69F 3LA3A 4OIOF 1B59A 1QQIA 3FZVA 4R1HA 1IN6A 2L4MA 4IXAA 2ESNA 1FP1D 2HS5A 3F8BA 3K1PA 2LDUA 2HKXA 3HSRA 1BN5A 3GWZA 2ZMEA 2ZJ2A 2O8XA 1XB4A 2V6CA 2LF8A 1BI1A 1S29A 4R8HA 1YW9A 1YIOA 3GZ5A 3TQNA 4HX8A 4IJAA 4HX4A 4ZZDA 1IXCA 3FF5A 4MQVA 1T38A 4EM1A 3C3WA 1G3SA 5F64A 4NQWA 1E2XA 4G94A 3WTYC 1SD7A 1O3RA 4YG2F 1I5ZA 1MZBA 2EWNA 1SD6A 2HGCA 5JHUA 1W7PA 2MLGA 5JVTA 1F5TA 4I01A 1HW5A 2WC2A 2IT0A 1Z6TA 2JRTA 4EJVA 3J80K 1R22A 3BJOA 2RGVA 3CUOA 5CJ9A 1Z6RA 4M74A 5BPIA 2FBHA 5HOOA 2Q8KA 3JAMK 4FX0A 1FOKA 3TO7A 1JXSA 1XD7A 2DTRA 4ZYEA 2JTVA 2PMUA 3J80Z 5LGUA 2FBKA 3QPTA 2O6GE 3GW2A 1FSEA 3M9AA 3SHFA 3V8LA 1LJ9A 1J7KA 2EK5A 4U88A 5EEHA 1OYWA 3VODA 4UV8A 3JAMZ 1R7JA 3KZYA 4BAYA 3IKTA 2UXNA 2QQBA 1ON1A 5D5WB 3ZMVA 1GXPA 2TDXA 2F5FA 2K4JA 4U7BA 4HF0A 2STWA 2FNAA 2GWRA 2J5OA 1MJ9A 4AVPA 1I1SA 4HW0A 1K78A 1T39A 1D8KA 4DNCA 4XLPF 1B6AA 3K1MA 3PQKA 3FMRA 3ZMTA 2RVCA 1KU7A 3GO5A 5LEKA 5HDNA 2W85A 3HRSA 3KCCA 5L3BA 2E1NA 1P2FA 4LLGF 3LQQA 3F22A 4Y13A 1S7AA 4JQFA 3RKWA 3KP7A 3HTUA 4RB3C 1HQCA 4P5OA 5TRDA 3K1NA 4G6QA 2V1XA 5E1ZB 1YW8A 3I71A 5HS7A 3DP7A 2BYVE 4ESBA 2B0LA 2MH9A 2DPDA 3MZHA 3F3XA 2NNNA 4AIHA 2VT2A 2PMHA 1LDDA 1YO5C 1ZN2A 2JSCA 3HTSB 1FBUA 2VT3A 3U9GA 2V1DA 4BH9A 4BNCA 5L3EA 3W6KB 1FY7A 3WODF 2P5LC 2HR3A 1F4KA 2JT1A 1J75A 4L0YB 3V8JA 1RIOH 3BOQA 4KYWA 4PGGA 1R58A 4CGZA 1XSXA 3BROA 4XSXF 2EFNA 1ZG3A 3ZMUA 4EJOA 2WWYA 2IVMA 3ZMSA 3DPTA 1ZHFA 3RKXA 2DI3A 2NRAC 1UFMA 3WU1B 1JHHA 4LLLA 2K02A 4L5JA 1TNSA 2XAJA 5HDKA 2OD5A 1XDUA 4HQEA 2ZNZA 3E5XA 4AWXB 2PJPA 2PFBA 3T8TA 4LLNA 2H6BA 1O3SA 4CHUA 4EV0A 3DPLC 3KP6A 1IAWA 1P4WA 3KLOA 4M6YA 4BYYA 2Z9OA 4U0WA 4KMUX 4ZYHA 2DPUA 3P9IA 2HEOA 4Q4ZF 4YFNF 4N9IA 2P6TA 5E8IA 2CO5A 3RPQA 3DEUA 4YFKF 4TV7A 4M9ZA 2XV4S 2A3SA 2OZ6A 2Q0OA 2F5DA 3LA7A 1ZH5A 4UXNA 1V3FA 1O7LA 2PN6A 4WXCA 4KFCA 2HYGD 1IW7F 5CLSA 3RTRA 1PP7U 1Z7UA 4BQAA 4O3MA 3RPUA 3TOBA 1IN8A 1IN4A 4MTDA 3EUHA 2IPQX 4HX7A 3K9TA 2GA2A 1Z05A 3ZN1A 2QENA 2R3SA 2GZWA 2RQPA 2GA1A 1D8JA 2XRNA 1VTNC 3P9KA 4UNOA 1W7PB 2K86A 2DQLA 2W84A 2XROA 4OU0A 3F23A 5FD5A 3ZN0A 2IJLA 2E1CA 5EEGA 1G3YA 5LHGA 1BC7C 4HZFA 2HQRA 1H9TA 2DLLA 4KIBA 5JI6A 1SFXA 4WK8F 1F1ZA 3WE3A 3CLOA 4RB1A 2LSOA 3HYIA 2K4BA 3VB2A 5D5UB 4UV9A 2ZO4A 3JTHA 3M8FA 4A2UA 2KJCA 4HF1A 5BS6A 4OIPF 3OV8A 4MNUA 1ON2A 2OBPA 3HUGA 2FOKA 1STZA 2F5EA 5J8FA 4FT8A 4IVNA 1BI2A 4N0BA 3F21A 2DFIA 1MDMA 3R0JA 3FMQA 4LFUA 1FYLA 1BC8C 1XDSA 2FMYA 4Q47A 2VC1A 1KYWA 2FXAA 4LG0A 4P9UA 1R1UA 3GFJA 3FWEA 1X3UA 2DK8A 4HLYA 4AIKA 2ZFWA 1CF7A 4KIGA 5BMZA 4GXOA 3HHGA 3F6OA 2HDCA 5F6FA 5H20A 1JGSA 1MD0A 1SMTA 3E3VA 5HLIA 1EH7A 1FYMA 5K5OA 1OKRA 3H3UA 1FWZA 3S2WA 3QOPA 3RJPA 4IPAA 1TQIA 3WTUC 1ULYA 4CICA 3MAJA 2KJBA 4BHBA 2DQRA 2IA2A 2EFOA 1TQPA 3T1BA 3RI4A 4EQQA 1P6RA 1U2WA 5FB2A 4ETSA 5ICFA 5BPDA 3O2PE 3J81K 2QZ8A 3EDPA 5K5QA 2LF7A 3IWZA 1KQ9A 2EFPA 1U5TC 3ZMDA 3ABUA 4WX9A 3V7SA 3NQOA 4A6EA 1Q1HA 4AIJA 4LK1F 2M30A 2EFQA 4M9SA 4LGWA 4Y15A 1HKTA 3BPXA 2FU4A 4UVCA 3K69A 4U0VA 3OOPA 3VEPA 4ZYDA 2HWVA 2R7FA 2V79A 1KU2A 1ZGAA 4P9FA 4PCQA 2VONA 2ELHA 3SXYA 2VE9A 4AD9A 3RDIA 1BBYA 1XMAA 5BOXA 1T0FA 2W57A 4L0ZB 1B4AA 2H6CA 1IZ1A 5D4SA 1J2XA 4RGUA 4WCGA 2QUFA 1B1BA 3O6BB 4L9NA 3HSFA 3F8NA 5AIQA 3U2RA 3E6BA 1YG2A 3R61A 3LWFA 1LB2A 1IN7A 2P6SA 5FFZA 4HDUA 3G3ZA 4M72A 4WXDA 3K2ZA 3RYPA 2GXGA 2ESHA 2E7WA 2BEOA 3ZPLA 1LVAA 4MTEA 4RS8A 3LA2A 4YIIA 3F8FA 3HRTA 5JR3A 2QVOA 1IUYA 3I54A 3HOTA 1HSJA 5HS9A 5L3CA 4KICA 3REOA 2XKOA 2OA4A 2W25A 2MLKA 1SMYF 3TOAA 4MEYF 2VBWA 1FYKA 1TNTA 1UHMA 4L18B 1B9NA 2DT5A 1IRFA 3CO7C 1ZRCA 4U0YA 1FBSA 1A04A 1U3EM 2Z3YA 2HKOA 4WF2A 1SD5A 2MD5A 4I02A 2AS5F 1XMKA 2WV0A 2K7LA 3ERED 4KUMA 4LMYA 1BI3A 4HDVA 2EV5A 4ENNA 2BGCA 3V8KA 2YX7A 1HW2A 1LDKB 1S6LA 1BI0A 3DQVC 3Q9SA 1EH6A 1R1VA 2Z5UA 3WE2A 1AWCA 4KN7X 3WTVC 5FO5A 1FBQA 3WTTC 1YYVA 1SAXA 1DPUA 2F2EA 2A68F 2FNPA 2DU9A 2QQ9A 2CQKA 3RIRA 5D6EA 5CVJA 1YTYA 2KIMA 1QNTA 4G7HF 3F6VA 5L3GA 4KT5C 2ETHA 4A5MA 1DUXC 4YIFA 2P7CB 2NYXA 5KVRA 1WQ2A 1MDMB 1T6SA 2W24A 3QAHA 4A0XA 5LGNA 4F7ZA 3KLNA 4I2OA 1WSUA 5ICGA 4LG0B 4RGRA 3E5QA 1HSTA 4LJZF 3KEQA 1WI9A 3B02A 1G4DA 1CF7B 3KETA 5J6XA 2XGXA 3GLXA 3NEUA 4Z2YA 1XN7A 4EJTA 4KNYA 1XGOA 2ZCWA 2JZYA 3SZTA 2QQAA 3R4KA 3ECHA 2D2WA 2A61A 3I58A 1Z9CA 2IP2A 3FXUA 4NHJA 1R5HA 4FHTA 4EJWA 5D4RA 1DPRA 2PI0A 1L3LA 2OZUA 3DV8A 4B09A 5DCMB 1Y0UA 4LB6B 3R6SA 3MFKA 1T98A 2KIUA 2O0YA 2VE8A 1U5TA 5DUKA 4I7HA 1GXQA 4LK0F 5LRSA 2GXBA 3I59A 5ILUA 3WGHA 3BPVA 4CYDA 2UWMA 3D5LA 4IHTA 1ZYRF 4B8XA 2PEXA 2BV6A 3KP2A 4JK1X 3I5UA 3V7CA 2XUBA 1W5SA 5AONA 5D5XB 1ODDA 1J59A 4BHPA 3BWGA 4A0ZA 4OINF 1WRJA 4QWQA 3IC7A 2HZTA 3NRVA 3JSPA 1FNNA 1S3JA 3L2CA 1RZ4A 2A6HF 2HTJA 3DF8A 2XASA 4G7OF 2YR2A 3CTAA 3KP4A 3LAPA 3R0AA 2VOOA 4EVIA 2A07F 1O3QA 3GVAA 4CXFA 2MC3A 4GGGA 2ZMEB 5FLXK 3GF2A 3D0SA 2YSRA 4HA8A 1G3WA 1QZYA 2FF4A 3CUQC 1I27A 2C6YA 1RNLA 3KFWX 5DCFA 4M9XA 3FXQA 3BP8A 1GHCA 3RKYA 5FLXZ 4CZZA 4ZYGA 4UHTA 2KKOA 1HW1A 2L4AA 1BIAA 5IT3A 4MHGA 1D3YA 4NB5A 2RNJA 4R79A 3IL2A 4Q5SF 1OPCA 1AOYA 2HYFA 5L3DA 1J5YA 2IA0A 3L00A 4RB2C 2ZBKA 3GUDA 4IRHA 3SQNA 5HLHA 1V4RA 1EH8A 2FMLA 5LGTA 3ISPA 2PLYA 2KRFA 3LQRA 2CWEA 1SFEA 4KA4A 1MKMA 1SFUA 1KQ8A 3LFKA 1ONVA 3BY6A 3H92A 4UVBA 4MQ9F 2Z33A 5CVIA 2L02A 1ZAOA 1U78A 3P7NA 1T2KA 3ZP5A 1TQMA 2MBFA 2X0LA 3VOEA 3C7JA 2XAFA 5HVQC 1RUNA 2O03A 5AIPA 1UCRA 1OYIA 3Q5FA 2P5VA 3WG9A 2CYYA 3R60A 2XIGA 1G6NA 2ZXJA 4G7ZF 4K2EA 1FT9A 4ENMA 1PUEE 1FSHA 3O3KA 3TO9A 1NHAA 1HXDA 1I6XA 2VODA 4Q48A 2XAGA 1KU3A 2CFXA 5ERIA 3E5UA 4O6JA 5HS8A 3EQLF 1FX7A 3T8RA 1C0WA 2DO7A 4YFXF 2EJRA 3E97A 3MQ0A 1K78B 5KK1A 3I0TA 3IWFA 5ILSA 1YS6A 4M6XA 3ZQ7A 1PP8F 2FA5A 1PDNC 1HBXG 3BZ6A 4QLCU 3ECOA 2ADUA 2LNBA 1R00A 4RAZA 1H9GA 1W7PD 3GFLA 2QBYA 3QU6A 3TGNA 1OMIA 1BIBA 2P5KA 3P9CA 5D8KB 2DK5A 5LHIA 2HOEA 4MGRA 3J7AO 3T5XA 3N4MA 4EMSA 5DV5A 3LAJA 2CW0F 2Y48A 1QZZA 3GFIA 5D8LB 1LEBA 2BE5F 2ISZA 5E17F 3TDUC 1OR7A 3M8EA 2VN2A 2ACJA 4IRIA 4MEXF 3WTWC 3ROUA 2OU2A 3G73A 1CGPA 1P92A 3I64A 4ASNA 4E70A 3J81Z 3ULQB 1JHFA 2V1UA 1U5TB 2PBIA 5H6RA 4HOBA 3JW4A 1EV7A 2VOPA 3FM3A 3I59B 3GEZA 2MH2A 3HRUA 3B73A 1ZRDA 3GFMA 5DD8A 2UXXA 1K6OA 1UHWA 4G8XA 3KP3A 1YFHA 3C18A 3EYIA 4I0AA 1XCVA 4GO1A 2E7XA 2RC4A 5D5VB 2EFWA 5IT9K 2XAHA 1R1TA 2R7DA 2XHKA 2NS0A 3N97A 2G7UA 3MCZA 1P4XA 1O3TA 4GYGA 4EJUA 4LB5A 3CUQA 5LBQA 1W5TA 3WTXC 4HV5A 1LDJA 5IT9Z 1UB9A 5ICCA 1ZLKA 4RAYA 5LEJA 4A6DA 4ENJA 2VXZA 1XSVA 1KGSA 1FLIA 5LLQA 2RN7A 2GQQA 2F5CA 1FP2A 3ZMZA 3CDHA 1XGNA 4HQMA 3HIFA 1OYYA 3KEOA 5TJJA 4XBFA 4D0PA 2G9WA 4DQ2A 4ENKA 2YPRA 5HDGA 1H0MA 2GAUA 1REPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LEA A;  5FGM A;  3I53 A;  5DD4 A;  2D1H A;  5DEQ A;  3QP6 A;  4G6D A;  1W4M A;  5K1Y A;  2IRF G;  2MA3 A;  1YQA A;  1IXR C;  4CO8 A;  3F72 A;  4S05 A;  1DDN A;  3IHU A;  2DW4 A;  1KU9 A;  3W6J B;  4ESF A;  4A12 A;  1K7A A;  1YLF A;  4XLN F;  4WXH A;  3Q9V A;  5LHH A;  2G7H A;  1MJA A;  4U7D A;  2KIF A;  3TDZ C;  1UST A;  3MEX A;  2STT A;  3LST A;  4H0E A;  3QU3 A;  1E17 A;  1IXS B;  2Z99 A;  2H09 A;  5FD6 A;  1R36 A;  2XVC A;  3T0Y A;  3COA C;  4I0B A;  3E6M A;  3BDD A;  2Y0M A;  3H3Z A;  1R5G A;  3F8C A;  2XAQ A;  2D1V A;  1BOA A;  3QP5 A;  4KMF A;  2DBB A;  3QRF F;  1IF1 A;  1ZLJ A;  2V9V A;  1Z91 A;  1DP7 P;  1QPM A;  2JPB A;  2EA4 A;  1TW3 A;  1MJB A;  2EV0 A;  2X4H A;  1R23 A;  2EA2 A;  1D5V A;  2QM3 A;  4S04 A;  1HKQ A;  2AXL A;  4JBA A;  5JFR A;  4BXU A;  1QBJ A;  3U1D A;  2M1B A;  3I4P A;  4O5V A;  2IW5 A;  1YW7 A;  2QBY B;  1TTY A;  1JE8 A;  3C1D A;  3MWM A;  3E6C C;  4BHC A;  2HTS A;  2M87 A;  4IRG A;  2JPC A;  4GCV A;  1XGM A;  2FE3 A;  4PZJ A;  3FXR A;  1LNW A;  2Y75 A;  3L7W A;  1BM9 A;  5CVU A;  3JSO A;  2D45 A;  4Y17 A;  1ZGJ A;  3CJN A;  4N9H A;  3WTZ A;  5DYM A;  1F9N A;  2CSO A;  4OIQ F;  2NNY A;  1KYZ A;  4A5N A;  2NAZ A;  5J8C A;  2UZK A;  1FPQ A;  3EYY A;  2IA1 A;  3PFI A;  3E6D A;  1LQ1 A;  4WWC A;  1MGT A;  4UUV A;  1P4A A;  1S7O A;  1YS7 A;  1U8R A;  2YU3 A;  5DDG A;  2VBY A;  3GXO A;  3VFZ A;  2A6E F;  2OAZ A;  5E1X A;  1S8N A;  2RV8 A;  4L5I A;  5E8G A;  3IRR A;  2VBX A;  1RI7 A;  1RUO A;  5ED4 A;  1O57 A;  2GIV A;  2ZNY A;  3GX4 X;  2CGP A;  4HV6 A;  4XRF A;  1QO0 D;  3RYR A;  5D6F A;  3FX3 A;  3F8M A;  5E18 F;  4IHS A;  3WGG A;  4I98 B;  5CVR A;  4XSZ F;  1WWX A;  3AAF A;  4ON0 A;  2FQ3 A;  3TKY A;  2DAO A;  3KZZ A;  1XCB A;  4GYI A;  2M45 A;  5BQT A;  3BJA A;  2FSW A;  4EGZ A;  3WGI A;  3CUQ B;  4EM2 A;  2EV6 A;  4LD5 A;  2FBI A;  2FRH A;  2L3D A;  5L3F A;  1IN5 A;  2L54 A;  4P96 A;  4OIR F;  5DUI A;  1FZP B;  5E20 A;  4HLX A;  3SZP A;  4HF2 A;  3TO6 A;  1J9I A;  3FHZ A;  1K79 A;  3DXJ F;  2M5W A;  4IF4 A;  2O3F A;  3DKW A;  2L01 A;  1TBX A;  2EB7 A;  3DFG A;  4PDK A;  2OQR A;  4M71 A;  5ICE A;  2HQN A;  4OMZ A;  2XKP A;  1HKS A;  3WTS C;  1XGS A;  5K5R A;  2LKP A;  5H6Q A;  2P4W A;  3CO6 C;  3GYH X;  1ZRE A;  3HRM A;  4KIF A;  3MZY A;  4EM0 B;  2ISY A;  1ZRF A;  2J5P A;  3V7R A;  4HBL A;  1XSD A;  4P55 A;  2COM A;  2Q2E A;  4L9V A;  4OOI A;  3HHH A;  3KE2 A;  1QGP A;  2A5Y B;  3HOS A;  1ZAR A;  1TW2 A;  2K27 A;  2M8E A;  2CG4 A;  1I1G A;  4I09 A;  1ZG5 A;  3L09 A;  2H94 A;  4L9J A;  4RGS A;  4UVA A;  3IRQ A;  4FX4 A;  4A0Y A;  4PGH A;  4HAM A;  2OQG A;  3HSE A;  3M7G A;  2FEZ A;  2RKH A;  2O61 A;  4G9Y A;  4OMY A;  1USS A;  2YX4 A;  2RDP A;  2H27 A;  2VC0 A;  1GVJ A;  2PG4 A;  3IKV A;  5A2Q K;  3ELK A;  1Z1D A;  4ZZL A;  1B9M A;  4KDP A;  1SD4 A;  2VBZ A;  4RB0 A;  3FM5 A;  3WU0 A;  3SFZ A;  4HYE A;  1L0O C;  5CYV A;  3QPH A;  4L9T A;  1J0R A;  5DCM A;  1TLH B;  4ZH4 F;  3EET A;  2QWW A;  1KQ0 A;  1KA8 A;  1ZG1 A;  2P7V B;  2QYO A;  3ABT A;  5LRR A;  2QLZ A;  5A2Q Z;  4ESJ A;  3PQJ A;  2HFH A;  5F1R A;  5HLG A;  3K0L A;  1G3T A;  6PAX A;  3V4G A;  2WTE A;  4CDG A;  4KN4 X;  5E1W A;  4EGY A;  3KP5 A;  1BJA A;  3L9F A;  4RGX A;  3JTG A;  5FFX A;  2P8T A;  3GZ6 A;  1O7F A;  1U6G A;  3ML6 A;  5ILV A;  2BBY A;  1IRG A;  1WKM A;  2ZKZ A;  1FC3 A;  3BJ6 A;  3FMS A;  2PQ8 A;  3M1E A;  5CVV A;  4M73 A;  2A69 F;  3LA3 A;  4OIO F;  1B59 A;  1QQI A;  3FZV A;  4R1H A;  1IN6 A;  2L4M A;  4IXA A;  2ESN A;  1FP1 D;  2HS5 A;  3F8B A;  3K1P A;  2LDU A;  2HKX A;  3HSR A;  1BN5 A;  3GWZ A;  2ZME A;  2ZJ2 A;  2O8X A;  1XB4 A;  2V6C A;  2LF8 A;  1BI1 A;  1S29 A;  4R8H A;  1YW9 A;  1YIO A;  3GZ5 A;  3TQN A;  4HX8 A;  4IJA A;  4HX4 A;  4ZZD A;  1IXC A;  3FF5 A;  4MQV A;  1T38 A;  4EM1 A;  3C3W A;  1G3S A;  5F64 A;  4NQW A;  1E2X A;  4G94 A;  3WTY C;  1SD7 A;  1O3R A;  4YG2 F;  1I5Z A;  1MZB A;  2EWN A;  1SD6 A;  2HGC A;  5JHU A;  1W7P A;  2MLG A;  5JVT A;  1F5T A;  4I01 A;  1HW5 A;  2WC2 A;  2IT0 A;  1Z6T A;  2JRT A;  4EJV A;  3J80 K;  1R22 A;  3BJO A;  2RGV A;  3CUO A;  5CJ9 A;  1Z6R A;  4M74 A;  5BPI A;  2FBH A;  5HOO A;  2Q8K A;  3JAM K;  4FX0 A;  1FOK A;  3TO7 A;  1JXS A;  1XD7 A;  2DTR A;  4ZYE A;  2JTV A;  2PMU A;  3J80 Z;  5LGU A;  2FBK A;  3QPT A;  2O6G E;  3GW2 A;  1FSE A;  3M9A A;  3SHF A;  3V8L A;  1LJ9 A;  1J7K A;  2EK5 A;  4U88 A;  5EEH A;  1OYW A;  3VOD A;  4UV8 A;  3JAM Z;  1R7J A;  3KZY A;  4BAY A;  3IKT A;  2UXN A;  2QQB A;  1ON1 A;  5D5W B;  3ZMV A;  1GXP A;  2TDX A;  2F5F A;  2K4J A;  4U7B A;  4HF0 A;  2STW A;  2FNA A;  2GWR A;  2J5O A;  1MJ9 A;  4AVP A;  1I1S A;  4HW0 A;  1K78 A;  1T39 A;  1D8K A;  4DNC A;  4XLP F;  1B6A A;  3K1M A;  3PQK A;  3FMR A;  3ZMT A;  2RVC A;  1KU7 A;  3GO5 A;  5LEK A;  5HDN A;  2W85 A;  3HRS A;  3KCC A;  5L3B A;  2E1N A;  1P2F A;  4LLG F;  3LQQ A;  3F22 A;  4Y13 A;  1S7A A;  4JQF A;  3RKW A;  3KP7 A;  3HTU A;  4RB3 C;  1HQC A;  4P5O A;  5TRD A;  3K1N A;  4G6Q A;  2V1X A;  5E1Z B;  1YW8 A;  3I71 A;  5HS7 A;  3DP7 A;  2BYV E;  4ESB A;  2B0L A;  2MH9 A;  2DPD A;  3MZH A;  3F3X A;  2NNN A;  4AIH A;  2VT2 A;  2PMH A;  1LDD A;  1YO5 C;  1ZN2 A;  2JSC A;  3HTS B;  1FBU A;  2VT3 A;  3U9G A;  2V1D A;  4BH9 A;  4BNC A;  5L3E A;  3W6K B;  1FY7 A;  3WOD F;  2P5L C;  2HR3 A;  1F4K A;  2JT1 A;  1J75 A;  4L0Y B;  3V8J A;  1RIO H;  3BOQ A;  4KYW A;  4PGG A;  1R58 A;  4CGZ A;  1XSX A;  3BRO A;  4XSX F;  2EFN A;  1ZG3 A;  3ZMU A;  4EJO A;  2WWY A;  2IVM A;  3ZMS A;  3DPT A;  1ZHF A;  3RKX A;  2DI3 A;  2NRA C;  1UFM A;  3WU1 B;  1JHH A;  4LLL A;  2K02 A;  4L5J A;  1TNS A;  2XAJ A;  5HDK A;  2OD5 A;  1XDU A;  4HQE A;  2ZNZ A;  3E5X A;  4AWX B;  2PJP A;  2PFB A;  3T8T A;  4LLN A;  2H6B A;  1O3S A;  4CHU A;  4EV0 A;  3DPL C;  3KP6 A;  1IAW A;  1P4W A;  3KLO A;  4M6Y A;  4BYY A;  2Z9O A;  4U0W A;  4KMU X;  4ZYH A;  2DPU A;  3P9I A;  2HEO A;  4Q4Z F;  4YFN F;  4N9I A;  2P6T A;  5E8I A;  2CO5 A;  3RPQ A;  3DEU A;  4YFK F;  4TV7 A;  4M9Z A;  2XV4 S;  2A3S A;  2OZ6 A;  2Q0O A;  2F5D A;  3LA7 A;  1ZH5 A;  4UXN A;  1V3F A;  1O7L A;  2PN6 A;  4WXC A;  4KFC A;  2HYG D;  1IW7 F;  5CLS A;  3RTR A;  1PP7 U;  1Z7U A;  4BQA A;  4O3M A;  3RPU A;  3TOB A;  1IN8 A;  1IN4 A;  4MTD A;  3EUH A;  2IPQ X;  4HX7 A;  3K9T A;  2GA2 A;  1Z05 A;  3ZN1 A;  2QEN A;  2R3S A;  2GZW A;  2RQP A;  2GA1 A;  1D8J A;  2XRN A;  1VTN C;  3P9K A;  4UNO A;  1W7P B;  2K86 A;  2DQL A;  2W84 A;  2XRO A;  4OU0 A;  3F23 A;  5FD5 A;  3ZN0 A;  2IJL A;  2E1C A;  5EEG A;  1G3Y A;  5LHG A;  1BC7 C;  4HZF A;  2HQR A;  1H9T A;  2DLL A;  4KIB A;  5JI6 A;  1SFX A;  4WK8 F;  1F1Z A;  3WE3 A;  3CLO A;  4RB1 A;  2LSO A;  3HYI A;  2K4B A;  3VB2 A;  5D5U B;  4UV9 A;  2ZO4 A;  3JTH A;  3M8F A;  4A2U A;  2KJC A;  4HF1 A;  5BS6 A;  4OIP F;  3OV8 A;  4MNU A;  1ON2 A;  2OBP A;  3HUG A;  2FOK A;  1STZ A;  2F5E A;  5J8F A;  4FT8 A;  4IVN A;  1BI2 A;  4N0B A;  3F21 A;  2DFI A;  1MDM A;  3R0J A;  3FMQ A;  4LFU A;  1FYL A;  1BC8 C;  1XDS A;  2FMY A;  4Q47 A;  2VC1 A;  1KYW A;  2FXA A;  4LG0 A;  4P9U A;  1R1U A;  3GFJ A;  3FWE A;  1X3U A;  2DK8 A;  4HLY A;  4AIK A;  2ZFW A;  1CF7 A;  4KIG A;  5BMZ A;  4GXO A;  3HHG A;  3F6O A;  2HDC A;  5F6F A;  5H20 A;  1JGS A;  1MD0 A;  1SMT A;  3E3V A;  5HLI A;  1EH7 A;  1FYM A;  5K5O A;  1OKR A;  3H3U A;  1FWZ A;  3S2W A;  3QOP A;  3RJP A;  4IPA A;  1TQI A;  3WTU C;  1ULY A;  4CIC A;  3MAJ A;  2KJB A;  4BHB A;  2DQR A;  2IA2 A;  2EFO A;  1TQP A;  3T1B A;  3RI4 A;  4EQQ A;  1P6R A;  1U2W A;  5FB2 A;  4ETS A;  5ICF A;  5BPD A;  3O2P E;  3J81 K;  2QZ8 A;  3EDP A;  5K5Q A;  2LF7 A;  3IWZ A;  1KQ9 A;  2EFP A;  1U5T C;  3ZMD A;  3ABU A;  4WX9 A;  3V7S A;  3NQO A;  4A6E A;  1Q1H A;  4AIJ A;  4LK1 F;  2M30 A;  2EFQ A;  4M9S A;  4LGW A;  4Y15 A;  1HKT A;  3BPX A;  2FU4 A;  4UVC A;  3K69 A;  4U0V A;  3OOP A;  3VEP A;  4ZYD A;  2HWV A;  2R7F A;  2V79 A;  1KU2 A;  1ZGA A;  4P9F A;  4PCQ A;  2VON A;  2ELH A;  3SXY A;  2VE9 A;  4AD9 A;  3RDI A;  1BBY A;  1XMA A;  5BOX A;  1T0F A;  2W57 A;  4L0Z B;  1B4A A;  2H6C A;  1IZ1 A;  5D4S A;  1J2X A;  4RGU A;  4WCG A;  2QUF A;  1B1B A;  3O6B B;  4L9N A;  3HSF A;  3F8N A;  5AIQ A;  3U2R A;  3E6B A;  1YG2 A;  3R61 A;  3LWF A;  1LB2 A;  1IN7 A;  2P6S A;  5FFZ A;  4HDU A;  3G3Z A;  4M72 A;  4WXD A;  3K2Z A;  3RYP A;  2GXG A;  2ESH A;  2E7W A;  2BEO A;  3ZPL A;  1LVA A;  4MTE A;  4RS8 A;  3LA2 A;  4YII A;  3F8F A;  3HRT A;  5JR3 A;  2QVO A;  1IUY A;  3I54 A;  3HOT A;  1HSJ A;  5HS9 A;  5L3C A;  4KIC A;  3REO A;  2XKO A;  2OA4 A;  2W25 A;  2MLK A;  1SMY F;  3TOA A;  4MEY F;  2VBW A;  1FYK A;  1TNT A;  1UHM A;  4L18 B;  1B9N A;  2DT5 A;  1IRF A;  3CO7 C;  1ZRC A;  4U0Y A;  1FBS A;  1A04 A;  1U3E M;  2Z3Y A;  2HKO A;  4WF2 A;  1SD5 A;  2MD5 A;  4I02 A;  2AS5 F;  1XMK A;  2WV0 A;  2K7L A;  3ERE D;  4KUM A;  4LMY A;  1BI3 A;  4HDV A;  2EV5 A;  4ENN A;  2BGC A;  3V8K A;  2YX7 A;  1HW2 A;  1LDK B;  1S6L A;  1BI0 A;  3DQV C;  3Q9S A;  1EH6 A;  1R1V A;  2Z5U A;  3WE2 A;  1AWC A;  4KN7 X;  3WTV C;  5FO5 A;  1FBQ A;  3WTT C;  1YYV A;  1SAX A;  1DPU A;  2F2E A;  2A68 F;  2FNP A;  2DU9 A;  2QQ9 A;  2CQK A;  3RIR A;  5D6E A;  5CVJ A;  1YTY A;  2KIM A;  1QNT A;  4G7H F;  3F6V A;  5L3G A;  4KT5 C;  2ETH A;  4A5M A;  1DUX C;  4YIF A;  2P7C B;  2NYX A;  5KVR A;  1WQ2 A;  1MDM B;  1T6S A;  2W24 A;  3QAH A;  4A0X A;  5LGN A;  4F7Z A;  3KLN A;  4I2O A;  1WSU A;  5ICG A;  4LG0 B;  4RGR A;  3E5Q A;  1HST A;  4LJZ F;  3KEQ A;  1WI9 A;  3B02 A;  1G4D A;  1CF7 B;  3KET A;  5J6X A;  2XGX A;  3GLX A;  3NEU A;  4Z2Y A;  1XN7 A;  4EJT A;  4KNY A;  1XGO A;  2ZCW A;  2JZY A;  3SZT A;  2QQA A;  3R4K A;  3ECH A;  2D2W A;  2A61 A;  3I58 A;  1Z9C A;  2IP2 A;  3FXU A;  4NHJ A;  1R5H A;  4FHT A;  4EJW A;  5D4R A;  1DPR A;  2PI0 A;  1L3L A;  2OZU A;  3DV8 A;  4B09 A;  5DCM B;  1Y0U A;  4LB6 B;  3R6S A;  3MFK A;  1T98 A;  2KIU A;  2O0Y A;  2VE8 A;  1U5T A;  5DUK A;  4I7H A;  1GXQ A;  4LK0 F;  5LRS A;  2GXB A;  3I59 A;  5ILU A;  3WGH A;  3BPV A;  4CYD A;  2UWM A;  3D5L A;  4IHT A;  1ZYR F;  4B8X A;  2PEX A;  2BV6 A;  3KP2 A;  4JK1 X;  3I5U A;  3V7C A;  2XUB A;  1W5S A;  5AON A;  5D5X B;  1ODD A;  1J59 A;  4BHP A;  3BWG A;  4A0Z A;  4OIN F;  1WRJ A;  4QWQ A;  3IC7 A;  2HZT A;  3NRV A;  3JSP A;  1FNN A;  1S3J A;  3L2C A;  1RZ4 A;  2A6H F;  2HTJ A;  3DF8 A;  2XAS A;  4G7O F;  2YR2 A;  3CTA A;  3KP4 A;  3LAP A;  3R0A A;  2VOO A;  4EVI A;  2A07 F;  1O3Q A;  3GVA A;  4CXF A;  2MC3 A;  4GGG A;  2ZME B;  5FLX K;  3GF2 A;  3D0S A;  2YSR A;  4HA8 A;  1G3W A;  1QZY A;  2FF4 A;  3CUQ C;  1I27 A;  2C6Y A;  1RNL A;  3KFW X;  5DCF A;  4M9X A;  3FXQ A;  3BP8 A;  1GHC A;  3RKY A;  5FLX Z;  4CZZ A;  4ZYG A;  4UHT A;  2KKO A;  1HW1 A;  2L4A A;  1BIA A;  5IT3 A;  4MHG A;  1D3Y A;  4NB5 A;  2RNJ A;  4R79 A;  3IL2 A;  4Q5S F;  1OPC A;  1AOY A;  2HYF A;  5L3D A;  1J5Y A;  2IA0 A;  3L00 A;  4RB2 C;  2ZBK A;  3GUD A;  4IRH A;  3SQN A;  5HLH A;  1V4R A;  1EH8 A;  2FML A;  5LGT A;  3ISP A;  2PLY A;  2KRF A;  3LQR A;  2CWE A;  1SFE A;  4KA4 A;  1MKM A;  1SFU A;  1KQ8 A;  3LFK A;  1ONV A;  3BY6 A;  3H92 A;  4UVB A;  4MQ9 F;  2Z33 A;  5CVI A;  2L02 A;  1ZAO A;  1U78 A;  3P7N A;  1T2K A;  3ZP5 A;  1TQM A;  2MBF A;  2X0L A;  3VOE A;  3C7J A;  2XAF A;  5HVQ C;  1RUN A;  2O03 A;  5AIP A;  1UCR A;  1OYI A;  3Q5F A;  2P5V A;  3WG9 A;  2CYY A;  3R60 A;  2XIG A;  1G6N A;  2ZXJ A;  4G7Z F;  4K2E A;  1FT9 A;  4ENM A;  1PUE E;  1FSH A;  3O3K A;  3TO9 A;  1NHA A;  1HXD A;  1I6X A;  2VOD A;  4Q48 A;  2XAG A;  1KU3 A;  2CFX A;  5ERI A;  3E5U A;  4O6J A;  5HS8 A;  3EQL F;  1FX7 A;  3T8R A;  1C0W A;  2DO7 A;  4YFX F;  2EJR A;  3E97 A;  3MQ0 A;  1K78 B;  5KK1 A;  3I0T A;  3IWF A;  5ILS A;  1YS6 A;  4M6X A;  3ZQ7 A;  1PP8 F;  2FA5 A;  1PDN C;  1HBX G;  3BZ6 A;  4QLC U;  3ECO A;  2ADU A;  2LNB A;  1R00 A;  4RAZ A;  1H9G A;  1W7P D;  3GFL A;  2QBY A;  3QU6 A;  3TGN A;  1OMI A;  1BIB A;  2P5K A;  3P9C A;  5D8K B;  2DK5 A;  5LHI A;  2HOE A;  4MGR A;  3J7A O;  3T5X A;  3N4M A;  4EMS A;  5DV5 A;  3LAJ A;  2CW0 F;  2Y48 A;  1QZZ A;  3GFI A;  5D8L B;  1LEB A;  2BE5 F;  2ISZ A;  5E17 F;  3TDU C;  1OR7 A;  3M8E A;  2VN2 A;  2ACJ A;  4IRI A;  4MEX F;  3WTW C;  3ROU A;  2OU2 A;  3G73 A;  1CGP A;  1P92 A;  3I64 A;  4ASN A;  4E70 A;  3J81 Z;  3ULQ B;  1JHF A;  2V1U A;  1U5T B;  2PBI A;  5H6R A;  4HOB A;  3JW4 A;  1EV7 A;  2VOP A;  3FM3 A;  3I59 B;  3GEZ A;  2MH2 A;  3HRU A;  3B73 A;  1ZRD A;  3GFM A;  5DD8 A;  2UXX A;  1K6O A;  1UHW A;  4G8X A;  3KP3 A;  1YFH A;  3C18 A;  3EYI A;  4I0A A;  1XCV A;  4GO1 A;  2E7X A;  2RC4 A;  5D5V B;  2EFW A;  5IT9 K;  2XAH A;  1R1T A;  2R7D A;  2XHK A;  2NS0 A;  3N97 A;  2G7U A;  3MCZ A;  1P4X A;  1O3T A;  4GYG A;  4EJU A;  4LB5 A;  3CUQ A;  5LBQ A;  1W5T A;  3WTX C;  4HV5 A;  1LDJ A;  5IT9 Z;  1UB9 A;  5ICC A;  1ZLK A;  4RAY A;  5LEJ A;  4A6D A;  4ENJ A;  2VXZ A;  1XSV A;  1KGS A;  1FLI A;  5LLQ A;  2RN7 A;  2GQQ A;  2F5C A;  1FP2 A;  3ZMZ A;  3CDH A;  1XGN A;  4HQM A;  3HIF A;  1OYY A;  3KEO A;  5TJJ A;  4XBF A;  4D0P A;  2G9W A;  4DQ2 A;  4ENK A;  2YPR A;  5HDG A;  1H0M A;  2GAU A;  1REP C; 
#chains in the Genus database with same CATH topology
 1LEA A;  5FGM A;  3VYU B;  3GTL J;  1DU6 A;  1A5J A;  3I53 A;  5DD4 A;  2D1H A;  1T08 B;  4BS9 A;  5DEQ A;  1MBG A;  2HDD A;  2IGN A;  3AFH A;  3QP6 A;  2KMU A;  2JJ7 A;  1X3W B;  4G6D A;  1W4M A;  5K1Y A;  2IRF G;  2MA3 A;  1YQA A;  4RLQ A;  2VKH A;  1IXR C;  4CO8 A;  3B6C A;  1X19 A;  3F72 A;  3BG6 A;  4S05 A;  2JVG A;  4F91 B;  1DDN A;  3HC7 A;  3IHU A;  2DW4 A;  4XOP A;  1TP4 A;  4RLF A;  1KU9 A;  3BR5 A;  1R4N B;  1N78 A;  1JTX A;  3W6J B;  2FOW A;  3OMY A;  4ESF A;  4A12 A;  2R5Y B;  2BY1 A;  1K7A A;  1YLF A;  3DBR B;  4XLN F;  5C4X J;  2HYJ A;  4WXH A;  3PIO F;  2K40 A;  3IAM 2;  3Q9V A;  5LHH A;  3S8P A;  1ZK8 A;  3ASN H;  2IS4 A;  2G7H A;  1MJA A;  2LH9 A;  3OS0 A;  4DIQ A;  4U7D A;  2LP0 A;  2VQH A;  2KIF A;  3DPU A;  3TDZ C;  1UST A;  2KDO A;  3MEX A;  3S3O A;  2STT A;  4M6V A;  3LST A;  4H0E A;  3QU3 A;  2JRM A;  1E17 A;  1A6I A;  1IXS B;  2Z99 A;  3LSP A;  2H09 A;  3IH4 A;  3OL3 A;  5FD6 A;  1R36 A;  3OYF A;  1Z3Y A;  2XVC A;  1U0J A;  2EZK A;  4ZTF A;  3OIO A;  3T0Y A;  1SFO J;  4IO9 F;  4PJ0 C;  4CCO A;  3COA C;  2OCE A;  4I0B A;  3E6M A;  2X6W A;  3BDD A;  4C3I J;  4XLA A;  2Y0M A;  4JX4 A;  3H3Z A;  1R5G A;  3F8C A;  3CC7 I;  1WH7 A;  2XAQ A;  2D1V A;  4FE4 A;  1BOA A;  3QP5 A;  4DW6 A;  4KMF A;  2TRT A;  4XKV A;  4ZTJ A;  4FE7 A;  3K4M A;  2CRG A;  2DBB A;  3QRF F;  1WHU A;  2W82 A;  3OS2 A;  2WAQ A;  1IF1 A;  1ZLJ A;  3N05 A;  3UKG A;  2V9V A;  1Z91 A;  1G8X A;  1DP7 P;  3SEQ A;  1QVU A;  1QPM A;  4A3B J;  2JPB A;  3OWT A;  2EA4 A;  4ZJZ A;  1E3H A;  1TW3 A;  1MJB A;  2EV0 A;  1WJA A;  2OUM A;  3DEE A;  2X4H A;  2E2J J;  4IX7 A;  1R23 A;  2DYS H;  3RPU D;  1UMQ A;  2EA2 A;  3QPL A;  3Q0V A;  1D5V A;  2QM3 A;  3CLQ A;  3BG7 A;  4S04 A;  4CCK A;  3MKY B;  1HKQ A;  3GBG A;  2LOO A;  3ABL H;  2AXL A;  4JBA A;  5JFR A;  4BXU A;  2Q1Z B;  1QBJ A;  4LIV A;  2VKE A;  3OYL A;  3U1D A;  2M1B A;  3PUB A;  3I4P A;  1D5Y A;  4O5V A;  2IW5 A;  1X1C A;  1YW7 A;  3W2W A;  3K4B A;  2QBY B;  5JHF A;  2X1D A;  1VQ7 I;  1TTY A;  2V9P A;  1OR7 C;  1TWA J;  1JE8 A;  5FKM A;  4BE1 A;  2XPU A;  3C1D A;  3LSK A;  3JRB A;  4B4C A;  3MWM A;  3E6C C;  2K85 A;  2Y9Z A;  2OV7 A;  5J47 A;  4DZP A;  2VI6 A;  4BHC A;  1H88 C;  3BQZ A;  4PSW A;  1B8I B;  2KQR A;  3SJM A;  2HTS A;  2R0Q C;  2M87 A;  3A0B C;  2JPC A;  4IRG A;  4RM2 A;  4GCV A;  1VI0 A;  1MNM C;  1SVO A;  3SYT A;  1XGM A;  2EZH A;  2FE3 A;  1Z7L A;  4PZJ A;  2HQA A;  2MFZ A;  2DMU A;  4PJM A;  1K6Y A;  2DN0 A;  2HOT A;  2QSF X;  2NVU B;  3FXR A;  3K4C A;  1LNW A;  3J7A Y;  2Y75 A;  3L7W A;  2K9L A;  1BM9 A;  5CVU A;  3JSO A;  2LTP A;  3OIQ A;  1V55 H;  2EIK H;  5CQE A;  2D45 A;  3DTI A;  4Y17 A;  1ZGJ A;  3CJN A;  2L9N A;  3VYR B;  1MW7 A;  4C2U A;  3GME A;  4N9H A;  3QYF A;  4M3F A;  3WTZ A;  4AYB N;  2R7O A;  5DYM A;  3GTK J;  2DA1 A;  2UV1 A;  3OYH A;  1F9N A;  2CSO A;  5CQG A;  2DFH A;  4OIQ F;  2NNY A;  2RNG A;  1N77 A;  1KYZ A;  4A5N A;  2NAZ A;  5J8C A;  2UZK A;  3VDX A;  1FPQ A;  3EYY A;  4ITV A;  4XK4 A;  2IA1 A;  2VJJ A;  3BQY A;  3M1C A;  3PFI A;  5H2F C;  1WH5 A;  3E6D A;  1LQ1 A;  4WWC A;  1MGT A;  2W4S A;  3PM1 A;  3KYL A;  1P4A A;  1IUF A;  4RA2 A;  4UUV A;  1S7O A;  1VQ5 I;  2CV1 A;  1YS7 A;  2EIN H;  5EYR A;  3HL2 A;  1U8R A;  2YU3 A;  5DDG A;  4AU7 A;  2VBY A;  3GXO A;  3VFZ A;  2A6E F;  2OAZ A;  3M8J A;  1IRZ A;  5E1X A;  4BQQ A;  2HXI A;  3S93 A;  1S8N A;  2RV8 A;  4L5I A;  5E8G A;  3IRR A;  1BW6 A;  3CMA I;  5DTD A;  2VBX A;  1RI7 A;  3ZXS A;  2XDV A;  1RUO A;  5ED4 A;  1O57 A;  1I50 J;  2EZL A;  4B43 A;  4NC6 A;  4A69 C;  4F93 B;  2GIV A;  2HI3 A;  2ZNY A;  3GX4 X;  2CGP A;  3HOY J;  4HV6 A;  4LIU A;  4E7K A;  4XRF A;  1QO0 D;  3RYR A;  5D6F A;  4XKW A;  2ZJQ F;  3FX3 A;  3F8M A;  5E18 F;  3KX2 A;  1VQL I;  4IHS A;  3WGG A;  2ZJR F;  4I98 B;  5CVR A;  4XSZ F;  1WWX A;  1J09 A;  3AAF A;  2XPV A;  4ON0 A;  1W5C C;  2FQ3 A;  1W36 D;  3TKY A;  2DAO A;  2F4M B;  3KZZ A;  3RCO A;  1XCB A;  4GYI A;  2M45 A;  5BQT A;  1AHD P;  3L2V A;  3BJA A;  3L2W A;  1ETV A;  2FSW A;  2BY3 A;  4EGZ A;  4DYC A;  3WGI A;  3CUQ B;  5HOD A;  5FRN A;  4EM2 A;  2DFE A;  2PMZ N;  2GIZ A;  2EV6 A;  2CQX A;  4LD5 A;  1XPX A;  2GXA A;  2FBI A;  2FRH A;  2L3D A;  2M7A A;  2RAE A;  5L3F A;  1Y6I A;  2LR8 A;  1IN5 A;  4YEJ A;  4HNT A;  2L54 A;  4P96 A;  5J40 A;  1HOM A;  4OIR F;  2BHZ A;  5DUI A;  1FZP B;  5E20 A;  4HLX A;  1MMA A;  3SZP A;  4HF2 A;  1SEU A;  3TO6 A;  2A05 A;  3BTL A;  1J9I A;  3FHZ A;  1K79 A;  3DXJ F;  2M5W A;  1ZGW A;  4IF4 A;  2O3F A;  3DKW A;  3PFY A;  4NC7 A;  4RAG A;  2L01 A;  1TBX A;  4DYQ A;  2P0W A;  1BW5 A;  2ELJ A;  2CUF A;  2EB7 A;  1NG7 A;  3DFG A;  2OQR A;  4PDK A;  4M71 A;  3RKQ A;  5ICE A;  1N75 A;  2BHY A;  2HQN A;  3BLY A;  1I3A A;  4OMZ A;  3GTO J;  2R7W A;  3GLL A;  2XKP A;  2CH0 A;  4M3E A;  3MN2 A;  4A3C J;  1HKS A;  3WTS C;  3TED A;  1XGS A;  2VB6 A;  2LKP A;  3LSG A;  1P9Q C;  5K5R A;  1AKH A;  2EZI A;  5H6Q A;  4KJZ A;  3FXO A;  2P4W A;  3CO6 C;  2WAQ N;  4E7S A;  3GYH X;  2X9D A;  1ETW A;  1ZRE A;  3HRM A;  2IXS A;  2E2H J;  3BR3 A;  3QYB A;  5TIS C;  4KIF A;  3MZY A;  4EM0 B;  2ISY A;  3FK6 A;  1ZRF A;  2VPR A;  2J5P A;  3V7R A;  2E2I J;  3HPH A;  2F4I A;  3LNQ A;  4HBL A;  1XSD A;  4P55 A;  2COM A;  2Q2E A;  3DLL F;  1FMW A;  4L9V A;  2NS8 A;  2V4J C;  3FKI J;  4F55 A;  1IJW C;  4XLC A;  4OOI A;  3HGY A;  3HHH A;  3KE2 A;  1QGP A;  2A5Y B;  3HOS A;  1YX3 A;  1ZAR A;  1TW2 A;  2K27 A;  2WAD A;  2M8E A;  3D5S C;  5FRM A;  2CG4 A;  2E1O A;  3L2Q A;  3OYJ A;  2A5W A;  3HB9 A;  1I1G A;  3JRC A;  4I09 A;  3KIO A;  1ZG5 A;  3L09 A;  2H94 A;  5EEA A;  3FK7 A;  3ABM H;  2LYC A;  4L9J A;  4RGS A;  4UVA A;  3IRQ A;  2PJR A;  4FX4 A;  4A0Y A;  3K70 C;  3VYS B;  3PL8 A;  1XG1 A;  4PGH A;  5JLW A;  3HSE A;  2OQG A;  2E1M B;  3M7G A;  2FEZ A;  2RKH A;  4HAM A;  4AVZ A;  1GT0 C;  1BR1 A;  1JJ8 C;  1FTT A;  2O61 A;  3TP3 A;  1X1A A;  9ANT A;  2OTJ I;  2FQ4 A;  5K7H A;  4G9Y A;  3HOW J;  4IOA F;  4OMY A;  1USS A;  1BOB A;  2YX4 A;  2RDP A;  2H27 A;  1X1D A;  2VC0 A;  3K4N A;  1GVJ A;  1K83 J;  3OY9 A;  3LSJ A;  2PG4 A;  3MKW B;  3IKV A;  4E7H A;  5FLV A;  5A2Q K;  1VF9 A;  4B47 A;  3ELK A;  1Z1D A;  4ZZL A;  1B9M A;  2LVS A;  4KDP A;  1TT5 B;  1X3Z B;  1IC8 A;  1SD4 A;  3W3C A;  1EF4 A;  2VBZ A;  2KZG A;  5JVG F;  4II3 A;  4RB0 A;  3OYI A;  3FM5 A;  3WU0 A;  4W1U A;  2KRH A;  1LFP A;  4NC8 A;  3SFZ A;  4HYE A;  1L0O C;  1ZR2 A;  1MMD A;  2LC2 A;  5CYV A;  3QPH A;  2Y30 A;  3DBL B;  4L9T A;  1J0R A;  3MKL A;  5DCM A;  1TLH B;  3D1N I;  2CU7 A;  4ZH4 F;  4XL9 A;  3EET A;  2QWW A;  1KQ0 A;  3H5A A;  5GTI C;  1KA8 A;  2WBM A;  3G2B A;  1ZG1 A;  4PUS A;  2P7V B;  2QYO A;  3ABT A;  5LRR A;  2QLZ A;  3VPR A;  5A2Q Z;  4ESJ A;  1FIP A;  1HDD C;  2DA2 A;  2DT6 A;  3PQJ A;  3L2R A;  4DOZ A;  2HFH A;  3AL0 C;  2HVR A;  5F1R A;  4CCL A;  3J7Z I;  4E7I A;  2K5C A;  3G6E I;  3NAR A;  1RR7 A;  1K61 A;  5HLG A;  1NH3 A;  3K0L A;  4IEJ A;  3HEF A;  1G3T A;  1ERD A;  6PAX A;  3V4G A;  4X1E A;  1HCR A;  2WTE A;  2EQR A;  4CDG A;  4KN4 X;  5E1W A;  1ENH A;  4EGY A;  3OYG A;  3KP5 A;  1M1E B;  1WJ5 A;  2X6Y A;  4A3D J;  3GZN B;  4XR6 A;  1W0U A;  1BJA A;  2M34 A;  4YIR X;  2OF7 A;  2CMP A;  3L9F A;  4RGX A;  5EGO A;  3JTG A;  5FFX A;  2P8T A;  3UR3 C;  3GZ6 A;  2JQ7 A;  1O7F A;  1U6G A;  3ML6 A;  4U87 A;  2CV2 A;  2H8W A;  3OOU A;  5ILV A;  3BZC A;  4AM3 A;  4FCY A;  2BBY A;  3KYD B;  1IRG A;  1WKM A;  3OIP A;  2ZKZ A;  1FC3 A;  1Q1V A;  3BJ6 A;  3ESW B;  2X1C A;  2ZXW H;  2PQ8 A;  3FMS A;  3BTI A;  3M1E A;  2EBI A;  3DTK A;  4MFD A;  5CVV A;  3A0H C;  2W1O A;  3BR6 A;  4M73 A;  2A69 F;  3QYE A;  2R5Z A;  1YIT I;  3HOV J;  3LA3 A;  4OIO F;  1B59 A;  1QQI A;  1JUM A;  1ZEL A;  3FZV A;  4QIW N;  4R1H A;  1IN6 A;  5IOZ A;  2ZJP F;  2L4M A;  1SC7 A;  4PK4 A;  2QF7 A;  4IXA A;  3CDI A;  2ESN A;  3K10 A;  5FKO A;  2EIJ H;  5FKL A;  1FP1 D;  2HS5 A;  3F8B A;  2H8R A;  1F36 A;  3K1P A;  2LDU A;  2HKX A;  3HSR A;  2RQQ A;  5K7F A;  2VPL A;  2L5Q A;  4A3M J;  3I3L A;  1BN5 A;  3GWZ A;  2ZME A;  2ZJ2 A;  1RRJ A;  1YOV B;  3CES A;  1IGN A;  2AQE A;  2O8X A;  1TL8 A;  1XB4 A;  2V6C A;  2LF8 A;  1BI1 A;  4UUS A;  1S29 A;  2W00 A;  1MBJ A;  2XGE A;  4HEA 2;  4R8H A;  1DU0 A;  2LKX A;  1YW9 A;  1Y8R B;  2F48 A;  1YIO A;  3GZ5 A;  1WVR A;  2VJ5 A;  3S3N A;  3TQN A;  4HX8 A;  1QA6 A;  4IJA A;  3CCR I;  4HX4 A;  1MBF A;  2CQQ A;  2WA0 A;  4ZZD A;  3FHN A;  1H8A C;  1IXC A;  3FF5 A;  1OFC X;  4MQV A;  2FJ1 A;  4AYB A;  1T38 A;  4ZDO A;  1QVT A;  3C3W A;  4EM1 A;  1G3S A;  3CME I;  5F64 A;  1IRX A;  4NQW A;  1E2X A;  2Z1D A;  4G94 A;  3S2H J;  3S1N J;  1V5G A;  2BY2 A;  2XB5 A;  1UEL B;  2KIS A;  3WTY C;  3JRD A;  1SD7 A;  2XC7 A;  1O3R A;  4YG2 F;  4N4O B;  1I5Z A;  1MZB A;  1ACI A;  2I10 A;  2EWN A;  2JSP A;  1SD6 A;  2HGC A;  5JHU A;  2VKV A;  1W7P A;  3MMY B;  3M3Y J;  3I4M J;  2L7Z A;  1D0Y A;  1XC5 A;  2MLG A;  3HXL A;  5JVT A;  2K9Q A;  1F5T A;  1P7I A;  4I01 A;  3LSI A;  1HW5 A;  2WC2 A;  2IT0 A;  1Z6T A;  2JRT A;  4EJV A;  3J80 K;  1R22 A;  1T56 A;  3AG3 H;  3BJO A;  2RGV A;  1JUS A;  2AQF A;  3CUO A;  1GVD A;  5CJ9 A;  4J01 A;  1RKW A;  3TP0 A;  1Z6R A;  1T8I A;  2L9V A;  4M74 A;  1VQ9 I;  3L1P A;  3RQI A;  5BPI A;  2FBH A;  2MAB A;  5HOO A;  3HG9 A;  4MFE A;  3OR1 C;  2L2O A;  2Q8K A;  1Z67 A;  2R7T A;  3JAM K;  1ITY A;  2Y69 H;  4PFP A;  2ID6 A;  5E3L A;  4FX0 A;  3U1K A;  3TO7 A;  4FIS A;  1FOK A;  1JXS A;  1XD7 A;  4AC0 A;  2K9S A;  2DTR A;  3PNV A;  2JTV A;  4ZYE A;  1O4X A;  2PMU A;  2JA5 J;  3SDB A;  3J80 Z;  5LGU A;  2FBK A;  4J00 A;  3S15 J;  1YX5 A;  3QPT A;  2IGK A;  2O6G E;  2LY9 A;  1G2H A;  4D9J A;  2R93 J;  3GW2 A;  5M5X J;  1FSE A;  4D7N A;  1D0Z A;  3M9A A;  3SHF A;  2JUG A;  3V8L A;  5J1R A;  1LJ9 A;  3S2D J;  1QHG A;  2F5V A;  1J7K A;  4HRI A;  2EK5 A;  4U88 A;  5EEH A;  1OYW A;  3VOD A;  2PMZ A;  4UV8 A;  3JAM Z;  4J19 A;  2YU9 J;  1IDZ A;  1R7J A;  3KZY A;  4BAY A;  3IKT A;  3F9K A;  2VLA A;  2UXN A;  3JRA A;  5FRO A;  2QQB A;  4BL0 B;  2DOD A;  1ON1 A;  3A01 A;  2O9L A;  1WJD A;  5HNH A;  5D5W B;  1JTY A;  3ZMV A;  1GXP A;  2TDX A;  3CJQ B;  4GFB A;  1JKQ C;  1AKH B;  2F5F A;  2K4J A;  1Y8Q B;  2AXT C;  2VJ4 A;  4U7B A;  2IBD A;  2OCC H;  4HF0 A;  2STW A;  2XGC A;  2FNA A;  2FX0 A;  2VQC A;  4A3K J;  5CKT A;  2GWR A;  2J5O A;  1MJ9 A;  2BXZ A;  4AVP A;  3RQ4 A;  1I1S A;  4ANJ A;  4V2F A;  4HW0 A;  1K78 A;  3PUF A;  1T39 A;  2BOL A;  3H0G J;  1D8K A;  3SEZ A;  3TBI A;  4DNC A;  2E5Z A;  4XLP F;  3CF5 F;  5E3O A;  3FXL A;  1B6A A;  1RET A;  1JI8 A;  3K1M A;  2E60 A;  3FMR A;  3PQK A;  4A3J J;  3PJR A;  2BVL A;  3BTC A;  3ZMT A;  1TWH J;  3CCU I;  2RVC A;  1KU7 A;  2KPM A;  2XF7 A;  5GAH J;  3GO5 A;  3JRH A;  5LEK A;  2QGU A;  2BW3 A;  1P7J A;  3H1C A;  5HDN A;  2W85 A;  1MBH A;  2ZXI A;  3HRS A;  3KCC A;  1A31 A;  5L3B A;  2E1N A;  1P2F A;  4LLG F;  1OCC H;  3LQQ A;  3F22 A;  4Y13 A;  1S7A A;  2K3P A;  2LKS A;  3JRI A;  4JQF A;  3QWL A;  3RKW A;  2XSD C;  3KP7 A;  2CUJ A;  3HTU A;  4RB3 C;  1HQC A;  3PNT A;  4P5O A;  2PJR B;  2ICW G;  4HPQ A;  5TRD A;  3K1N A;  4G6Q A;  2V1X A;  2IEK A;  4JYK A;  3QOE A;  5E1Z B;  1YW8 A;  3I71 A;  5HS7 A;  2VQG A;  3DP7 A;  5F0H A;  2BYV E;  4ESB A;  2B0L A;  2GOM A;  2MH9 A;  5BNG A;  2DPD A;  3MZH A;  1E0E A;  3F3X A;  2NNN A;  3DU5 A;  3C2B A;  3I9V 2;  4C9Y A;  2R92 J;  2LY1 A;  4Y52 J;  2HPI A;  3ZQI A;  1I6H J;  4AIH A;  2VT2 A;  2PMH A;  1LDD A;  5DM6 F;  1YO5 C;  3HOU J;  1ZN2 A;  2JSC A;  1R71 A;  1FEX A;  3HTS B;  1FBU A;  2VT3 A;  3U9G A;  2V1D A;  4BH9 A;  3TW7 A;  4BNC A;  5L3E A;  4E7L A;  5TGT A;  5CPR B;  3CDL A;  3W6K B;  1FY7 A;  2MSY A;  3S16 J;  3WOD F;  2P5L C;  1WZ2 A;  2HR3 A;  1ZKG A;  1F4K A;  2JT1 A;  1J75 A;  4L0Y B;  3V8J A;  1RIO H;  3BOQ A;  3GCM A;  2VAS A;  4KYW A;  4PGG A;  4XKB A;  2WY7 Q;  1R58 A;  4CGZ A;  1XSX A;  1JKP C;  3BRO A;  3JRF A;  2E35 A;  4XSX F;  2EFN A;  1ZG3 A;  3DCF A;  3ZMU A;  3WHB A;  1D1B A;  4EJO A;  1WFX A;  5IYB J;  2E19 A;  2WWY A;  1VQN I;  2IVM A;  1W0T A;  3ZMS A;  3S32 A;  3DPT A;  1ZHF A;  3RKX A;  2DI3 A;  4BU2 A;  2NRA C;  3H5N A;  3S1M J;  1UFM A;  3WU1 B;  3AG1 H;  3V42 A;  3O8G A;  4XKC A;  1JHH A;  4LLL A;  4B44 A;  2K02 A;  5J4V A;  3DU6 A;  2WY8 Q;  5B66 C;  4L5J A;  3CD6 I;  5EGO B;  1TNS A;  2HQ5 A;  2XAJ A;  2OD5 A;  5HDK A;  2DCE A;  1FJL A;  3VWB A;  5DM7 F;  2R7S A;  1XDU A;  4HQE A;  2ZNZ A;  3E5X A;  4AWX B;  2PJP A;  2PFB A;  3T8T A;  1MH3 A;  3NAU A;  2KP6 A;  2M8G X;  4LLN A;  2H6B A;  1O3S A;  2GM4 A;  4I99 C;  4HNU A;  1LUJ B;  4CHU A;  2X1E A;  4EV0 A;  3DPL C;  1UJ8 A;  3KP6 A;  1IAW A;  1P4W A;  3KLO A;  5F27 A;  2ME0 A;  1NTC A;  2DOE A;  2R5Z B;  1T0F C;  4M6Y A;  4BQN A;  4BYY A;  2Z9O A;  2ZME C;  4U0W A;  4KMU X;  1JJ6 C;  1U9O A;  2ZFU A;  4ZYH A;  3Q0U A;  2DPU A;  4IHX A;  3P9I A;  4XLH A;  1WGX A;  4Q4Z F;  2HEO A;  4YFN F;  4N9I A;  2P6T A;  5E8I A;  2CO5 A;  3RPQ A;  2MD0 A;  1IG7 A;  2VQL A;  1S72 I;  4GDF A;  3DEU A;  5GAD J;  4YFK F;  4TV7 A;  2EPF A;  4M9Z A;  2XV4 S;  2A3S A;  1VQK I;  2OZ6 A;  1QZE A;  2Q0O A;  2LY2 A;  3ZGK A;  1I39 A;  2F5D A;  3K4J A;  3LA7 A;  1LE8 A;  2ZB9 A;  1ZH5 A;  4UXN A;  1GV5 A;  2N8G A;  1V3F A;  4L5E A;  3CCE I;  4OAZ A;  1O7L A;  4C3H J;  2PN6 A;  4WXC A;  2H1K A;  3BCB A;  4X0G A;  4UUS B;  4KFC A;  2HYG D;  1IW7 F;  3NWS A;  5CLS A;  3KYC B;  3RTR A;  1VQO I;  1PP7 U;  2FUG 2;  2LD5 A;  1MBE A;  3IP4 B;  1Y1W J;  1RKT A;  3QPS A;  4BY1 J;  1Z7U A;  3OYA A;  4BQA A;  4O3M A;  2M0C A;  3RPU A;  3BTJ A;  3FXK A;  1IN8 A;  2WAE A;  3TOB A;  5M5W J;  1IN4 A;  5EJC A;  4IZZ A;  1JUP A;  3RZO J;  3K4K A;  1YE9 A;  4MTD A;  3EUH A;  2IPQ X;  4HX7 A;  3K9T A;  4IHW A;  2GA2 A;  2JA8 J;  4NQW B;  1AU7 A;  2R7U A;  1Z05 A;  4ZYA A;  3ZN1 A;  1VQM I;  2QEN A;  2R3S A;  2KHM A;  1PJR A;  3BR2 A;  4IOC F;  2GZW A;  2RQP A;  3FXM A;  2GA1 A;  1LFB A;  1ETX A;  1D8J A;  2XRN A;  1VTN C;  1MIJ A;  3TW6 A;  2R7Q A;  3P9K A;  4UNO A;  1W7P B;  1UHS A;  1WPK A;  2DQL A;  1OIS A;  2K86 A;  3FIW A;  3EUK L;  3S14 J;  2KZV A;  2W84 A;  2XRO A;  1RR8 C;  4OU0 A;  4B3X A;  3FKJ A;  3F23 A;  2LBF B;  5KAF C;  5FD5 A;  4IKF A;  3ZN0 A;  4JX6 A;  2IJL A;  2LMD A;  4Y4R A;  2FD5 A;  2E1C A;  5EEG A;  1G3Y A;  2R5Y A;  5LHG A;  4BE0 A;  1BC7 C;  4HZF A;  5C4J J;  5EZH A;  2HQR A;  1H9T A;  4Y3O A;  4XMY A;  5EDN A;  2DLL A;  4KIB A;  5JI6 A;  4NUB A;  1F43 A;  1SFX A;  1PYV A;  2DA4 A;  4WK8 F;  4F92 B;  1F1Z A;  4KIT B;  3WE3 A;  3CLO A;  5IP7 J;  2LSO A;  4RB1 A;  3HYI A;  2E36 A;  2K4B A;  3VB2 A;  1SFK A;  5D5U B;  3OYB A;  4NDL A;  4UV9 A;  1T33 A;  5KHD A;  2ZO4 A;  4MO7 A;  3JTH A;  1Y1V J;  3M8F A;  4A2U A;  2KJC A;  4HF1 A;  2QA4 I;  5BS6 A;  1X4O A;  2BZT A;  4EAT A;  4OIP F;  3OV8 A;  4MNU A;  1ON2 A;  1D1A A;  2KL4 A;  2OBP A;  1GLN A;  1MMN A;  5B1A H;  3HUG A;  1S7E A;  2FOK A;  1STZ A;  1A36 A;  3CP2 A;  1GV2 A;  2F5E A;  2COB A;  5J8F A;  2KT0 A;  3RZD J;  1ETY A;  4FT8 A;  4IVN A;  2HXO A;  1BI2 A;  4N0B A;  3F21 A;  2DFI A;  1RC9 A;  3A01 B;  1MDM A;  3R0J A;  3PSF A;  3U21 A;  5FKK A;  3FMQ A;  4LFU A;  2KDZ A;  4B1R A;  1FYL A;  1DGR M;  1BC8 C;  1XDS A;  2FMY A;  4Q47 A;  2VC1 A;  3FDY A;  1KYW A;  2FXA A;  4LG0 A;  4P9U A;  1R1U A;  2ZXH A;  3GFJ A;  4HSR A;  3FWE A;  1X3U A;  2DK8 A;  2LFB A;  2VKD A;  2DFF A;  4QPQ A;  4XRS G;  4HLY A;  3I4N J;  2ME6 A;  3K2A A;  4AIK A;  2ZFW A;  1CF7 A;  4KIG A;  3LFU A;  5BMZ A;  1KZH A;  3ZQQ A;  4GXO A;  3HHG A;  3F6O A;  2HDC A;  2DOF A;  5F6F A;  1V54 H;  1JGS A;  2Y0S N;  1RPW A;  1MD0 A;  5H20 A;  1SMT A;  3E3V A;  5HLI A;  5FJ8 J;  3K4L A;  1PUF A;  1EH7 A;  1FYM A;  5K5O A;  1BA5 A;  1OKR A;  3H3U A;  2MC4 A;  2LRE A;  1FWZ A;  2HNH A;  2LG4 A;  5E79 C;  2BW3 B;  3S2W A;  3QOP A;  3RJP A;  1Z3X A;  1MMS A;  1LVK A;  3ASO H;  4IPA A;  1Z77 A;  3G1O A;  1TQI A;  3G1L A;  1JKR C;  3WTU C;  3HOZ J;  1ULY A;  3IUO A;  4CIC A;  3MAJ A;  3ABK H;  2QQ8 A;  2NS7 A;  1FIA A;  2KJB A;  3E7L A;  4BHB A;  2DQR A;  2IA2 A;  3I56 I;  4XIC A;  1JGG A;  3VSK A;  2EFO A;  1TQP A;  3T1B A;  3RI4 A;  4EQQ A;  1P6R A;  1B8I A;  3Q3S A;  4BXF A;  3HPG A;  1U2W A;  2V9K A;  5FB2 A;  4ETS A;  1G59 A;  1K4T A;  5ICF A;  4A3L J;  5BPD A;  3O2P E;  3H9J A;  4KT6 A;  3J81 K;  4V2G A;  2I8D A;  3S1R J;  2QZ8 A;  3DWL E;  1TT0 A;  3EDP A;  1LKX A;  3A02 A;  5F08 A;  5KNL A;  5K5Q A;  2R7X A;  2LF7 A;  3IWZ A;  1KQ9 A;  2DYR H;  2EFP A;  2HOA A;  5IYC J;  4GRI A;  3AL0 B;  1U5T C;  3ZMD A;  3ABU A;  4D5F A;  4WX9 A;  3V7S A;  3NQO A;  4A6E A;  2HDW A;  1Q1H A;  4AIJ A;  2ID3 A;  4LK1 F;  1GUU A;  2QKM B;  2B63 J;  2M30 A;  2EFQ A;  4M9S A;  1BR2 A;  4LGW A;  2RRE A;  1X2N A;  3OS1 A;  2DT7 B;  4Y15 A;  2A6T A;  3PO3 J;  1HKT A;  3BPX A;  2FU4 A;  3LMM A;  2DTZ A;  2NVQ J;  4UVC A;  4BEH A;  3K69 A;  1JT0 A;  5F1J A;  5E3N A;  4U0V A;  3OOP A;  3BR0 A;  2XF6 A;  3VEP A;  5C44 J;  4ZYD A;  2HWV A;  4QSH A;  2R7F A;  2V79 A;  3M07 A;  5GPA A;  1APL C;  3HBL A;  1PVE A;  1KU2 A;  1ZGA A;  4P9F A;  4PCQ A;  2VON A;  2ELH A;  3SXY A;  5LFA A;  3AG2 H;  1XX5 A;  1EJ9 A;  5J1Y A;  4RM3 A;  2JN6 A;  2VE9 A;  3VSL A;  4AD9 A;  3RDI A;  1JKO C;  1BBY A;  4XOT A;  1XMA A;  5BOX A;  1OCP A;  3E0J B;  1T0F A;  5F0F A;  2W57 A;  2ZC2 A;  1BL0 A;  1OCT C;  4L0Z B;  1B4A A;  3H35 A;  3L2U A;  2H6C A;  3HJE A;  4HG2 A;  1IZ1 A;  5D4S A;  2JA2 A;  1J2X A;  4RGU A;  4WCG A;  2M4G A;  1FTZ A;  2QUF A;  1B1B A;  3O6B B;  4L9N A;  3HSF A;  3F8N A;  5AIQ A;  5J3L A;  3ZRG A;  3U2R A;  3KEY A;  4N4N B;  4XNF A;  2IS6 A;  3E6B A;  1YG2 A;  3R61 A;  3C2G A;  3LWF A;  1LB2 A;  1IN7 A;  2P6S A;  3K70 D;  5FFZ A;  4HDU A;  3ONQ A;  2MYS A;  3OYN A;  3G3Z A;  4M72 A;  4WXD A;  1SVM A;  3K2Z A;  1IV8 A;  5M5Y J;  2WB1 N;  3RYP A;  1T95 A;  2QKL B;  2GXG A;  3H9Q A;  4RAF A;  4PSX A;  2ESH A;  2E7W A;  3OSF A;  2BEO A;  5GPC A;  3ZPL A;  1LVA A;  4MTE A;  4RS8 A;  2JK3 A;  5J1U A;  4BBS J;  3LA2 A;  4XM3 A;  4YII A;  2E71 A;  3F8F A;  3HRT A;  1YJW I;  2CQ7 A;  3P5J A;  1Y0N A;  5JR3 A;  2QVO A;  4A93 J;  2DA5 A;  1DGW Y;  3CJR B;  2NVT J;  1IUY A;  3I54 A;  4H4K C;  3HOT A;  1HSJ A;  1LE8 B;  5HS9 A;  3CC4 I;  5L3C A;  4KIC A;  3FXJ A;  3KZI C;  3REO A;  2IS1 A;  2XKO A;  2OA4 A;  3EUH C;  4LG3 A;  1YIJ I;  1Y56 A;  2W25 A;  5IY5 H;  2KIQ A;  2O7O A;  2MLK A;  1SMY F;  4CSW A;  3J7Y J;  1IV6 A;  2DDA A;  4XLE A;  3TOA A;  4MEY F;  2VBW A;  1FYK A;  1TNT A;  2Y31 A;  1UHM A;  4A3G J;  4L18 B;  3GTQ J;  2X48 A;  3JRG A;  3CMY A;  3GTM J;  4XOR A;  1B9N A;  2DT5 A;  2MW8 A;  4ABZ A;  1IRF A;  5IPA A;  3CO7 C;  2E5N A;  2K3F A;  2B9S A;  1ZRC A;  4IQ4 A;  4U0Y A;  4HNV A;  1QHH D;  1FBS A;  1LFU P;  2OTL I;  1AA7 A;  2X6O A;  1A04 A;  4E4H A;  1U3E M;  2Z3Y A;  2HKO A;  3C2H A;  2EIM H;  4WF2 A;  1SD5 A;  2R7V A;  2M7B A;  3B6A A;  4HST A;  2MD5 A;  4I02 A;  4IQJ A;  4X6A J;  4LIT A;  5FKN A;  4B48 A;  5B3S H;  3ZQC A;  2AS5 F;  1XMK A;  2WV0 A;  2K7L A;  4I76 A;  1X2M A;  3CZ6 A;  1HDP A;  2V7F A;  3MD2 A;  3ERE D;  4KUM A;  4LMY A;  1BI3 A;  4E7J A;  4A3F J;  3PSI A;  4HDV A;  2CJJ A;  1B72 A;  2Y2Z A;  2EV5 A;  4ENN A;  2BGC A;  2W48 A;  3V8K A;  2YX7 A;  4YRV A;  1HW2 A;  3FBI B;  5EF6 A;  3PNY A;  1OCO H;  4PJN A;  2VIX A;  1SAN A;  1LDK B;  4DBR A;  3A2K A;  1S6L A;  1BI0 A;  3DQV C;  3Q9S A;  1EH6 A;  3HKZ A;  3OYC A;  1R1V A;  2Z5U A;  3WE2 A;  1AWC A;  1S9H A;  2HU9 A;  4KN7 X;  3WTV C;  5M3F J;  5FO5 A;  2X85 A;  1FBQ A;  3WTT C;  4ZDP A;  2EH3 A;  1YYV A;  1ETQ A;  1SAX A;  2M3A A;  1DPU A;  1OCR H;  2F2E A;  3OYK A;  4IL6 C;  3ZQL A;  4BXX J;  3BT9 A;  2A68 F;  2XSJ C;  2FNP A;  2DDB A;  2DU9 A;  2QQ9 A;  4PFO A;  2VJI A;  1UG0 A;  2Q2E B;  2CQK A;  3LSR A;  3RIR A;  4BDY A;  5D6E A;  1YRN A;  1UG2 A;  5CVJ A;  1YTY A;  2HVQ A;  5KAI C;  3HUG B;  2AO9 A;  2KIM A;  3GTP J;  1QNT A;  2IGO A;  4BQO A;  2ECC A;  1UZC A;  2X6X A;  3AKZ A;  4G7H F;  1QPI A;  3F6V A;  2LRD A;  5L3G A;  4KT5 C;  2ETH A;  4A5M A;  1DUX C;  4YIF A;  2P7C B;  2NYX A;  5KVR A;  1V5E A;  4XRM A;  1WQ2 A;  1MDM B;  1T6S A;  2BY0 A;  3K6G A;  1NK2 P;  5B1B H;  2IAI A;  1IO2 A;  4ZC3 A;  4C2T A;  2W24 A;  1TWC J;  2CS3 A;  3BZK A;  4CYC A;  3QAH A;  4A0X A;  5LGN A;  1Z0X A;  2L7F P;  4F7Z A;  2EIL H;  3KLN A;  5IOY A;  3CF2 A;  2D5V A;  1EA3 A;  1WJE A;  4I2O A;  1WSU A;  5ICG A;  3BG9 A;  4LG0 B;  2KRC A;  4MLO A;  4RGR A;  1W36 C;  2CV0 A;  3E5Q A;  1HST A;  5GP9 A;  2I5U A;  4LJZ F;  3KEQ A;  1WI9 A;  3B02 A;  4XON A;  1G4D A;  2L9R A;  4D1Q A;  1CF7 B;  3ZQF A;  3KET A;  4UUT A;  5J6X A;  1UAA A;  2XGX A;  3GLX A;  3NEU A;  4Z2Y A;  1XN7 A;  4G12 A;  1DQU A;  4EJT A;  4KNY A;  1XGO A;  2ZCW A;  2JZY A;  4E7Z A;  3Q0W A;  1BJZ A;  4AID A;  2XB0 X;  3SZT A;  4DJA A;  2QQA A;  3I55 I;  3R4K A;  4BE2 A;  3ECH A;  2A61 A;  2D2W A;  4BY7 J;  3I58 A;  3M4O J;  2L7M P;  1PUF B;  4A3I J;  1Z9C A;  1R9T J;  2IP2 A;  1WCM J;  3FXU A;  4NHJ A;  1R5H A;  3EUA A;  2NVY J;  4FHT A;  4QPO A;  4EJW A;  5D4R A;  1DPR A;  2PI0 A;  1ETK A;  1L3L A;  1S5L C;  2OZU A;  3S3M A;  3DV8 A;  4B09 A;  5DCM B;  1Y0U A;  4LB6 B;  3QQA A;  2P81 A;  3MKZ A;  3R6S A;  3MFK A;  1T98 A;  2NVX J;  2KIU A;  2O0Y A;  4E6K G;  2VE8 A;  1U5T A;  1ZR4 A;  1FOY A;  5DUK A;  3DKX A;  4I7H A;  1GXQ A;  4LK0 F;  5LRS A;  5GAE J;  1E3P A;  2Y0S A;  4F52 A;  2GXB A;  3H36 A;  2MG4 A;  1VND A;  2JVH A;  4G6T B;  3I59 A;  5ILU A;  3WGH A;  3BPV A;  4CYD A;  2UWM A;  1Y39 A;  2CW7 A;  3D5L A;  4IHT A;  2CFO A;  1ZYR F;  4B8X A;  5EG0 A;  1N25 A;  1HA8 A;  2PEX A;  4IHY A;  2BV6 A;  2KLO A;  3KP2 A;  2DMP A;  4JK1 X;  3I5U A;  3V7C A;  2XUB A;  3KPH A;  3PO2 J;  3GTG J;  1W5S A;  5AON A;  5D5X B;  1ODD A;  3CCM I;  1XTA A;  3TMO A;  4DZJ A;  1FOX A;  1OQY A;  1J59 A;  3A03 A;  4BHP A;  3BWG A;  4A0Z A;  3QOD A;  4BJT A;  3OL4 A;  4OIN F;  2M9H A;  1WRJ A;  3HGG A;  2XAU A;  2JA7 J;  3CCS I;  4QWQ A;  1RES A;  3IC7 A;  5DS9 A;  2HZT A;  1OJL A;  3NRV A;  5IP6 A;  3ZOB A;  3JSP A;  1MNE A;  3IAS 2;  4BEH B;  1FNN A;  1S3J A;  3L2C A;  1HLV A;  1RZ4 A;  2A6H F;  2HTJ A;  3DF8 A;  2XAS A;  3LOC A;  3ZQH A;  4G7O F;  3CP8 A;  2YR2 A;  3CTA A;  2Z16 A;  3KP4 A;  3LAP A;  3R0A A;  5F04 A;  5GAG J;  2VOO A;  4EVI A;  2A07 F;  1U8B A;  3S1Q J;  2GOX B;  2M0M A;  1O3Q A;  3GVA A;  2XF5 A;  1EKE A;  4CXF A;  3SFI A;  2MC3 A;  2DJI A;  4GGG A;  2ZME B;  1TC3 C;  5FLX K;  3GF2 A;  2ZSI B;  1R5I D;  3D0S A;  3G1M A;  1E3O C;  2YSR A;  2NOJ B;  4HA8 A;  4XQF A;  1G3W A;  1OLT A;  2R7Z J;  1QZY A;  4B3A A;  2CUZ A;  2FF4 A;  3CUQ C;  1I27 A;  5E3M A;  2DA6 A;  2C6Y A;  1RNL A;  1WJB A;  1MMG A;  3KFW X;  5DCF A;  4M9X A;  4CA0 A;  5KCM A;  1Z21 A;  2OC6 A;  3FXQ A;  4Z6Y A;  3BP8 A;  1W1W E;  1GHC A;  2DMT A;  3RKY A;  4KIS A;  3EPZ A;  2QSH X;  5FLX Z;  3HOX J;  4CZZ A;  2OPT A;  4ZYG A;  4UHT A;  2KKO A;  4C30 A;  2HVS A;  3WG7 H;  3CC2 I;  1HW1 A;  2L4A A;  4FQG A;  1D1C A;  1BIA A;  5IT3 A;  4MHG A;  2CUE A;  1D3Y A;  3LL7 A;  2ELK A;  2R4G A;  3CQZ J;  4NB5 A;  4W97 A;  1XS9 A;  1MH4 A;  3HKZ N;  2LK2 A;  3OYD A;  4M3B A;  5EZG A;  3G4S I;  2RNJ A;  2BXY A;  4BKX A;  3BG3 A;  4R79 A;  3IL2 A;  1K4S A;  3JRE A;  4Q5S F;  1OPC A;  1AOY A;  2K9M A;  2HYF A;  5L3D A;  2UUZ A;  1VQP I;  1MSF C;  1A6Q A;  1J5Y A;  2WV1 A;  4BBR J;  2IA0 A;  3L00 A;  2WB1 A;  4II2 A;  4RB2 C;  2F6C A;  3VYT B;  1R4M B;  2ZBK A;  2DJN A;  2F4O B;  3CCJ I;  4S0H B;  3GUD A;  3HZJ A;  4IRH A;  3SQN A;  5HLH A;  1V4R A;  1EH8 A;  2FML A;  1JT6 A;  1ETO A;  5LGT A;  3ISP A;  2PLY A;  1SAU A;  2KRF A;  3LQR A;  2CWE A;  1SFE A;  4KA4 A;  1MKM A;  1SFU A;  1KQ8 A;  4C3J J;  2HZD A;  3LFK A;  1U9N A;  3H0D A;  1ZQ3 P;  3D5R C;  1WJF A;  1ONV A;  2X51 A;  2DOA A;  3BY6 A;  4CUG A;  3H92 A;  4UVB A;  4DYR A;  4MQ9 F;  2L7K A;  3OYE A;  2Z33 A;  3A1Y A;  3E1S A;  5CVI A;  5M3M J;  2L02 A;  1ZAO A;  1U78 A;  3P7N A;  1T2K A;  4BJ6 C;  4ZDL A;  1TQM A;  3ZP5 A;  3SDG A;  2MBF A;  2X0L A;  3CCY A;  3S17 J;  1VFC A;  4NBQ A;  3VOE A;  4XID A;  2O5R A;  1VQ4 I;  3C7J A;  2XAF A;  3BG5 A;  3OR2 C;  3PIP F;  3OYM A;  5HVQ C;  1R49 A;  1RUN A;  2O03 A;  4XN3 A;  5F0C A;  3JR9 A;  5AIP A;  4XRS A;  1ORK A;  2NOG A;  3IH2 A;  1UCR A;  1OYI A;  3Q5F A;  2P5V A;  2YUS A;  3WG9 A;  2CYY A;  4CZC A;  5K7Z A;  3R60 A;  2L9S A;  2XIG A;  1G6N A;  2ECB A;  2ZXJ A;  3FBN B;  4K2E A;  4G7Z F;  1B72 B;  1FT9 A;  2HOS A;  4DGW B;  1X58 A;  4ENM A;  4XLF A;  1PUE E;  4P1W A;  3W6V A;  2W7N A;  1FSH A;  3O3K A;  3HDD A;  3MVP A;  3H5R A;  3TO9 A;  2E1M C;  3IH3 A;  1NHA A;  4BAC A;  4YEL A;  1HXD A;  1FOW A;  2E34 A;  1I6X A;  2VOD A;  4Q48 A;  2XAG A;  1KU3 A;  2CFX A;  5ERI A;  1YJN I;  3E5U A;  4O6J A;  5HS8 A;  1NG6 A;  3EQL F;  1FX7 A;  4PJJ A;  4XN0 A;  4C2M J;  3T8R A;  3IV5 A;  1C0W A;  2QSG X;  2DO7 A;  2DXI A;  1NK3 P;  4YFX F;  1CQT A;  1KON A;  2EJR A;  3E97 A;  1YJ9 I;  4AUX A;  3MQ0 A;  1K78 B;  4RDU A;  3MZ8 A;  2XGD A;  5GTH C;  5KK1 A;  4MIM A;  3LSH A;  3I0T A;  3IWF A;  5ILS A;  3DBH B;  1BR4 A;  1YS6 A;  2G0E A;  4EEF G;  1YRN B;  4M6X A;  3ZQ7 A;  2CQN A;  2IGM A;  1PP8 F;  2FA5 A;  3CCL I;  1PDN C;  1HBX G;  2XRL A;  3BZ6 A;  4QLC U;  2NXN B;  3W2V A;  3ECO A;  3DEW A;  2ADU A;  2LNB A;  2CW8 A;  1R00 A;  4RAZ A;  1H9G A;  1W7P D;  1TWG J;  3GFL A;  4CCM A;  2QBY A;  3CJT B;  3QU6 A;  3TGN A;  1OMI A;  1BIB A;  2P5K A;  3P9C A;  5D8K B;  5HNF A;  2DK5 A;  5LHI A;  2HOE A;  4MGR A;  4CH7 A;  4CYC B;  1V5F A;  4RMN A;  3J7A O;  3T5X A;  3N4M A;  1FMV A;  4EMS A;  3H3V K;  4M3D A;  5DV5 A;  4PJL A;  1MBK A;  3LAJ A;  2CW0 F;  2Y48 A;  1YI2 I;  1QZZ A;  1HF0 A;  4LOC A;  4I6Z A;  2DMQ A;  4Y7N J;  3ZCO A;  3GFI A;  5D8L B;  1LEB A;  2BE5 F;  2ISZ A;  4BUP A;  5E17 F;  3TDU C;  1A35 A;  1OR7 A;  3M8E A;  2VN2 A;  1HC8 A;  2ACJ A;  3H9G A;  4IRI A;  1X1B A;  4MEX F;  2JA6 J;  2GBY A;  3WTW C;  3ROU A;  3FIS A;  2OU2 A;  2M2E A;  4M3G A;  2DA3 A;  3G73 A;  1QU3 A;  1VZ0 A;  3AG4 H;  2VL8 A;  2QEX I;  3HM5 A;  2VXD A;  1WJC A;  1CGP A;  3TL4 X;  1P92 A;  1X4P A;  2V26 A;  3I64 A;  4ASN A;  3OSG A;  4E70 A;  2DMN A;  3BC8 A;  3J81 Z;  4BGD A;  4FET A;  1JHF A;  2B7E A;  3ULQ B;  2V1U A;  1U5T B;  3BR1 A;  4DBQ A;  2PBI A;  2Y9Y A;  5H6R A;  4HOB A;  3JW4 A;  2AHQ A;  1YHQ I;  1EV7 A;  3ZR8 X;  1ZTR A;  3GTJ J;  2VOP A;  3FM3 A;  3I59 B;  2OJE D;  2V1N A;  5HLT A;  3UNG C;  3GEZ A;  1OCZ H;  2MH2 A;  3HRU A;  3X2Q H;  3LSM A;  1R6R A;  3B73 A;  1LPQ A;  4IHV A;  2DA7 A;  1DP3 A;  1I3Q J;  5EG0 B;  1ZRD A;  2WAF A;  3ERM A;  3GFM A;  3RSN A;  4UB6 C;  1H89 C;  5DD8 A;  4JX5 A;  2YS9 A;  1TWF J;  2JWT A;  2O8K A;  1VQ6 I;  3JCU C;  2UXX A;  1K6O A;  2KFD A;  1UHW A;  4G8X A;  1X1P A;  3DLA A;  1D0X A;  1TZL A;  2QCO A;  3KP3 A;  1YFH A;  5IP9 J;  3C18 A;  3EYI A;  4F3Q A;  2H1L A;  4I0A A;  5B5E C;  1XCV A;  1MSE C;  5IYD J;  4CCN A;  2ZSH B;  3A4C A;  4GO1 A;  2E7X A;  3ZQG A;  2PX9 A;  2RC4 A;  5C3E J;  4JP0 A;  1SVL A;  5D5V B;  2VUM J;  2EFW A;  5IT9 K;  2XAH A;  3CMM A;  3F0C A;  1R1T A;  4CCJ A;  2R7D A;  2XHK A;  2NS0 A;  3WU2 C;  3N97 A;  2G7U A;  3MCZ A;  3O8H A;  1P4X A;  1O3T A;  4GYG A;  2MGQ A;  4EJU A;  4LB5 A;  3CUQ A;  5LBQ A;  4D7M A;  1VQ8 I;  3WHC A;  1W5T A;  2V6E A;  4OAY A;  4FTH A;  2JMW A;  2Z2S B;  5LD2 C;  3WTX C;  2BVM A;  4HV5 A;  4NNJ A;  1LDJ A;  2M4K A;  4D5C A;  3BCA A;  3CCV I;  5JLX A;  5FLM J;  2L0K A;  1IDY A;  2TCT A;  2R7R A;  5IT9 Z;  1UB9 A;  4QTR A;  5ICC A;  1ZLK A;  4RAY A;  5LEJ A;  4A6D A;  4ENJ A;  3G71 I;  2VXZ A;  4OWR B;  1XSV A;  1KGS A;  4UB8 C;  1FLI A;  5LLQ A;  2RN7 A;  2GQQ A;  2F5C A;  1FP2 A;  2K9N A;  3ZMZ A;  4V19 K;  3CCQ I;  3W2A A;  2JUC A;  4BDZ A;  1XMX A;  3CDH A;  4UY8 I;  1GDT A;  1XGN A;  2LLK A;  3NWT A;  2LBF A;  3DTE A;  3HIF A;  3DKY A;  4HQM A;  1OYY A;  3KEO A;  5TJJ A;  2GLO A;  1WI3 A;  4XBF A;  4BJ5 C;  4Y33 A;  3K7A J;  2XPW A;  4D0P A;  1QRY A;  2G9W A;  4JOM A;  4DQ2 A;  4FAS D;  5J4Y A;  4ENK A;  2YPR A;  5HDG A;  1H0M A;  1MND A;  1POG A;  2GAU A;  2IS2 A;  1REP C;  4A3E J;  3SZG A;  4RBO A;  2HPM A; 
#chains in the Genus database with same CATH homology
 1LEA A;  5FGM A;  3I53 A;  5DD4 A;  2D1H A;  5DEQ A;  3QP6 A;  4G6D A;  1W4M A;  5K1Y A;  2IRF G;  2MA3 A;  1YQA A;  1IXR C;  4CO8 A;  3F72 A;  4S05 A;  1DDN A;  3IHU A;  2DW4 A;  1KU9 A;  3W6J B;  4ESF A;  4A12 A;  1K7A A;  1YLF A;  4XLN F;  4WXH A;  3Q9V A;  5LHH A;  2G7H A;  1MJA A;  4U7D A;  2KIF A;  3TDZ C;  1UST A;  3MEX A;  2STT A;  3LST A;  4H0E A;  3QU3 A;  1E17 A;  1IXS B;  2Z99 A;  2H09 A;  5FD6 A;  1R36 A;  2XVC A;  3T0Y A;  3COA C;  4I0B A;  3E6M A;  3BDD A;  2Y0M A;  3H3Z A;  1R5G A;  3F8C A;  2XAQ A;  2D1V A;  1BOA A;  3QP5 A;  4KMF A;  2DBB A;  3QRF F;  1IF1 A;  1ZLJ A;  2V9V A;  1Z91 A;  1DP7 P;  1QPM A;  2JPB A;  2EA4 A;  1TW3 A;  1MJB A;  2EV0 A;  2X4H A;  1R23 A;  2EA2 A;  1D5V A;  2QM3 A;  4S04 A;  1HKQ A;  2AXL A;  4JBA A;  5JFR A;  4BXU A;  1QBJ A;  3U1D A;  2M1B A;  3I4P A;  4O5V A;  2IW5 A;  1YW7 A;  2QBY B;  1TTY A;  1JE8 A;  3C1D A;  3MWM A;  3E6C C;  4BHC A;  2HTS A;  2M87 A;  4IRG A;  2JPC A;  4GCV A;  1XGM A;  2FE3 A;  4PZJ A;  3FXR A;  1LNW A;  2Y75 A;  3L7W A;  1BM9 A;  5CVU A;  3JSO A;  2D45 A;  4Y17 A;  1ZGJ A;  3CJN A;  4N9H A;  3WTZ A;  5DYM A;  1F9N A;  2CSO A;  4OIQ F;  2NNY A;  1KYZ A;  4A5N A;  2NAZ A;  5J8C A;  2UZK A;  1FPQ A;  3EYY A;  2IA1 A;  3PFI A;  3E6D A;  1LQ1 A;  4WWC A;  1MGT A;  4UUV A;  1P4A A;  1S7O A;  1YS7 A;  1U8R A;  2YU3 A;  5DDG A;  2VBY A;  3GXO A;  3VFZ A;  2A6E F;  2OAZ A;  5E1X A;  1S8N A;  2RV8 A;  4L5I A;  5E8G A;  3IRR A;  2VBX A;  1RI7 A;  1RUO A;  5ED4 A;  1O57 A;  2GIV A;  2ZNY A;  3GX4 X;  2CGP A;  4HV6 A;  4XRF A;  1QO0 D;  3RYR A;  5D6F A;  3FX3 A;  3F8M A;  5E18 F;  4IHS A;  3WGG A;  4I98 B;  5CVR A;  4XSZ F;  1WWX A;  3AAF A;  4ON0 A;  2FQ3 A;  3TKY A;  2DAO A;  3KZZ A;  1XCB A;  4GYI A;  2M45 A;  5BQT A;  3BJA A;  2FSW A;  4EGZ A;  3WGI A;  3CUQ B;  4EM2 A;  2EV6 A;  4LD5 A;  2FBI A;  2FRH A;  2L3D A;  5L3F A;  1IN5 A;  2L54 A;  4P96 A;  4OIR F;  5DUI A;  1FZP B;  5E20 A;  4HLX A;  3SZP A;  4HF2 A;  3TO6 A;  1J9I A;  3FHZ A;  1K79 A;  3DXJ F;  2M5W A;  4IF4 A;  2O3F A;  3DKW A;  2L01 A;  1TBX A;  2EB7 A;  3DFG A;  4PDK A;  2OQR A;  4M71 A;  5ICE A;  2HQN A;  4OMZ A;  2XKP A;  1HKS A;  3WTS C;  1XGS A;  5K5R A;  2LKP A;  5H6Q A;  2P4W A;  3CO6 C;  3GYH X;  1ZRE A;  3HRM A;  4KIF A;  3MZY A;  4EM0 B;  2ISY A;  1ZRF A;  2J5P A;  3V7R A;  4HBL A;  1XSD A;  4P55 A;  2COM A;  2Q2E A;  4L9V A;  4OOI A;  3HHH A;  3KE2 A;  1QGP A;  2A5Y B;  3HOS A;  1ZAR A;  1TW2 A;  2K27 A;  2M8E A;  2CG4 A;  1I1G A;  4I09 A;  1ZG5 A;  3L09 A;  2H94 A;  4L9J A;  4RGS A;  4UVA A;  3IRQ A;  4FX4 A;  4A0Y A;  4PGH A;  4HAM A;  2OQG A;  3HSE A;  3M7G A;  2FEZ A;  2RKH A;  2O61 A;  4G9Y A;  4OMY A;  1USS A;  2YX4 A;  2RDP A;  2H27 A;  2VC0 A;  1GVJ A;  2PG4 A;  3IKV A;  5A2Q K;  3ELK A;  1Z1D A;  4ZZL A;  1B9M A;  4KDP A;  1SD4 A;  2VBZ A;  4RB0 A;  3FM5 A;  3WU0 A;  3SFZ A;  4HYE A;  1L0O C;  5CYV A;  3QPH A;  4L9T A;  1J0R A;  5DCM A;  1TLH B;  4ZH4 F;  3EET A;  2QWW A;  1KQ0 A;  1KA8 A;  1ZG1 A;  2P7V B;  2QYO A;  3ABT A;  5LRR A;  2QLZ A;  5A2Q Z;  4ESJ A;  3PQJ A;  2HFH A;  5F1R A;  5HLG A;  3K0L A;  1G3T A;  6PAX A;  3V4G A;  2WTE A;  4CDG A;  4KN4 X;  5E1W A;  4EGY A;  3KP5 A;  1BJA A;  3L9F A;  4RGX A;  3JTG A;  5FFX A;  2P8T A;  3GZ6 A;  1O7F A;  1U6G A;  3ML6 A;  5ILV A;  2BBY A;  1IRG A;  1WKM A;  2ZKZ A;  1FC3 A;  3BJ6 A;  3FMS A;  2PQ8 A;  3M1E A;  5CVV A;  4M73 A;  2A69 F;  3LA3 A;  4OIO F;  1B59 A;  1QQI A;  3FZV A;  4R1H A;  1IN6 A;  2L4M A;  4IXA A;  2ESN A;  1FP1 D;  2HS5 A;  3F8B A;  3K1P A;  2LDU A;  2HKX A;  3HSR A;  1BN5 A;  3GWZ A;  2ZME A;  2ZJ2 A;  2O8X A;  1XB4 A;  2V6C A;  2LF8 A;  1BI1 A;  1S29 A;  4R8H A;  1YW9 A;  1YIO A;  3GZ5 A;  3TQN A;  4HX8 A;  4IJA A;  4HX4 A;  4ZZD A;  1IXC A;  3FF5 A;  4MQV A;  1T38 A;  4EM1 A;  3C3W A;  1G3S A;  5F64 A;  4NQW A;  1E2X A;  4G94 A;  3WTY C;  1SD7 A;  1O3R A;  4YG2 F;  1I5Z A;  1MZB A;  2EWN A;  1SD6 A;  2HGC A;  5JHU A;  1W7P A;  2MLG A;  5JVT A;  1F5T A;  4I01 A;  1HW5 A;  2WC2 A;  2IT0 A;  1Z6T A;  2JRT A;  4EJV A;  3J80 K;  1R22 A;  3BJO A;  2RGV A;  3CUO A;  5CJ9 A;  1Z6R A;  4M74 A;  5BPI A;  2FBH A;  5HOO A;  2Q8K A;  3JAM K;  4FX0 A;  1FOK A;  3TO7 A;  1JXS A;  1XD7 A;  2DTR A;  4ZYE A;  2JTV A;  2PMU A;  3J80 Z;  5LGU A;  2FBK A;  3QPT A;  2O6G E;  3GW2 A;  1FSE A;  3M9A A;  3SHF A;  3V8L A;  1LJ9 A;  1J7K A;  2EK5 A;  4U88 A;  5EEH A;  1OYW A;  3VOD A;  4UV8 A;  3JAM Z;  1R7J A;  3KZY A;  4BAY A;  3IKT A;  2UXN A;  2QQB A;  1ON1 A;  5D5W B;  3ZMV A;  1GXP A;  2TDX A;  2F5F A;  2K4J A;  4U7B A;  4HF0 A;  2STW A;  2FNA A;  2GWR A;  2J5O A;  1MJ9 A;  4AVP A;  1I1S A;  4HW0 A;  1K78 A;  1T39 A;  1D8K A;  4DNC A;  4XLP F;  1B6A A;  3K1M A;  3PQK A;  3FMR A;  3ZMT A;  2RVC A;  1KU7 A;  3GO5 A;  5LEK A;  5HDN A;  2W85 A;  3HRS A;  3KCC A;  5L3B A;  2E1N A;  1P2F A;  4LLG F;  3LQQ A;  3F22 A;  4Y13 A;  1S7A A;  4JQF A;  3RKW A;  3KP7 A;  3HTU A;  4RB3 C;  1HQC A;  4P5O A;  5TRD A;  3K1N A;  4G6Q A;  2V1X A;  5E1Z B;  1YW8 A;  3I71 A;  5HS7 A;  3DP7 A;  2BYV E;  4ESB A;  2B0L A;  2MH9 A;  2DPD A;  3MZH A;  3F3X A;  2NNN A;  4AIH A;  2VT2 A;  2PMH A;  1LDD A;  1YO5 C;  1ZN2 A;  2JSC A;  3HTS B;  1FBU A;  2VT3 A;  3U9G A;  2V1D A;  4BH9 A;  4BNC A;  5L3E A;  3W6K B;  1FY7 A;  3WOD F;  2P5L C;  2HR3 A;  1F4K A;  2JT1 A;  1J75 A;  4L0Y B;  3V8J A;  1RIO H;  3BOQ A;  4KYW A;  4PGG A;  1R58 A;  4CGZ A;  1XSX A;  3BRO A;  4XSX F;  2EFN A;  1ZG3 A;  3ZMU A;  4EJO A;  2WWY A;  2IVM A;  3ZMS A;  3DPT A;  1ZHF A;  3RKX A;  2DI3 A;  2NRA C;  1UFM A;  3WU1 B;  1JHH A;  4LLL A;  2K02 A;  4L5J A;  1TNS A;  2XAJ A;  5HDK A;  2OD5 A;  1XDU A;  4HQE A;  2ZNZ A;  3E5X A;  4AWX B;  2PJP A;  2PFB A;  3T8T A;  4LLN A;  2H6B A;  1O3S A;  4CHU A;  4EV0 A;  3DPL C;  3KP6 A;  1IAW A;  1P4W A;  3KLO A;  4M6Y A;  4BYY A;  2Z9O A;  4U0W A;  4KMU X;  4ZYH A;  2DPU A;  3P9I A;  2HEO A;  4Q4Z F;  4YFN F;  4N9I A;  2P6T A;  5E8I A;  2CO5 A;  3RPQ A;  3DEU A;  4YFK F;  4TV7 A;  4M9Z A;  2XV4 S;  2A3S A;  2OZ6 A;  2Q0O A;  2F5D A;  3LA7 A;  1ZH5 A;  4UXN A;  1V3F A;  1O7L A;  2PN6 A;  4WXC A;  4KFC A;  2HYG D;  1IW7 F;  5CLS A;  3RTR A;  1PP7 U;  1Z7U A;  4BQA A;  4O3M A;  3RPU A;  3TOB A;  1IN8 A;  1IN4 A;  4MTD A;  3EUH A;  2IPQ X;  4HX7 A;  3K9T A;  2GA2 A;  1Z05 A;  3ZN1 A;  2QEN A;  2R3S A;  2GZW A;  2RQP A;  2GA1 A;  1D8J A;  2XRN A;  1VTN C;  3P9K A;  4UNO A;  1W7P B;  2K86 A;  2DQL A;  2W84 A;  2XRO A;  4OU0 A;  3F23 A;  5FD5 A;  3ZN0 A;  2IJL A;  2E1C A;  5EEG A;  1G3Y A;  5LHG A;  1BC7 C;  4HZF A;  2HQR A;  1H9T A;  2DLL A;  4KIB A;  5JI6 A;  1SFX A;  4WK8 F;  1F1Z A;  3WE3 A;  3CLO A;  4RB1 A;  2LSO A;  3HYI A;  2K4B A;  3VB2 A;  5D5U B;  4UV9 A;  2ZO4 A;  3JTH A;  3M8F A;  4A2U A;  2KJC A;  4HF1 A;  5BS6 A;  4OIP F;  3OV8 A;  4MNU A;  1ON2 A;  2OBP A;  3HUG A;  2FOK A;  1STZ A;  2F5E A;  5J8F A;  4FT8 A;  4IVN A;  1BI2 A;  4N0B A;  3F21 A;  2DFI A;  1MDM A;  3R0J A;  3FMQ A;  4LFU A;  1FYL A;  1BC8 C;  1XDS A;  2FMY A;  4Q47 A;  2VC1 A;  1KYW A;  2FXA A;  4LG0 A;  4P9U A;  1R1U A;  3GFJ A;  3FWE A;  1X3U A;  2DK8 A;  4HLY A;  4AIK A;  2ZFW A;  1CF7 A;  4KIG A;  5BMZ A;  4GXO A;  3HHG A;  3F6O A;  2HDC A;  5F6F A;  5H20 A;  1JGS A;  1MD0 A;  1SMT A;  3E3V A;  5HLI A;  1EH7 A;  1FYM A;  5K5O A;  1OKR A;  3H3U A;  1FWZ A;  3S2W A;  3QOP A;  3RJP A;  4IPA A;  1TQI A;  3WTU C;  1ULY A;  4CIC A;  3MAJ A;  2KJB A;  4BHB A;  2DQR A;  2IA2 A;  2EFO A;  1TQP A;  3T1B A;  3RI4 A;  4EQQ A;  1P6R A;  1U2W A;  5FB2 A;  4ETS A;  5ICF A;  5BPD A;  3O2P E;  3J81 K;  2QZ8 A;  3EDP A;  5K5Q A;  2LF7 A;  3IWZ A;  1KQ9 A;  2EFP A;  1U5T C;  3ZMD A;  3ABU A;  4WX9 A;  3V7S A;  3NQO A;  4A6E A;  1Q1H A;  4AIJ A;  4LK1 F;  2M30 A;  2EFQ A;  4M9S A;  4LGW A;  4Y15 A;  1HKT A;  3BPX A;  2FU4 A;  4UVC A;  3K69 A;  4U0V A;  3OOP A;  3VEP A;  4ZYD A;  2HWV A;  2R7F A;  2V79 A;  1KU2 A;  1ZGA A;  4P9F A;  4PCQ A;  2VON A;  2ELH A;  3SXY A;  2VE9 A;  4AD9 A;  3RDI A;  1BBY A;  1XMA A;  5BOX A;  1T0F A;  2W57 A;  4L0Z B;  1B4A A;  2H6C A;  1IZ1 A;  5D4S A;  1J2X A;  4RGU A;  4WCG A;  2QUF A;  1B1B A;  3O6B B;  4L9N A;  3HSF A;  3F8N A;  5AIQ A;  3U2R A;  3E6B A;  1YG2 A;  3R61 A;  3LWF A;  1LB2 A;  1IN7 A;  2P6S A;  5FFZ A;  4HDU A;  3G3Z A;  4M72 A;  4WXD A;  3K2Z A;  3RYP A;  2GXG A;  2ESH A;  2E7W A;  2BEO A;  3ZPL A;  1LVA A;  4MTE A;  4RS8 A;  3LA2 A;  4YII A;  3F8F A;  3HRT A;  5JR3 A;  2QVO A;  1IUY A;  3I54 A;  3HOT A;  1HSJ A;  5HS9 A;  5L3C A;  4KIC A;  3REO A;  2XKO A;  2OA4 A;  2W25 A;  2MLK A;  1SMY F;  3TOA A;  4MEY F;  2VBW A;  1FYK A;  1TNT A;  1UHM A;  4L18 B;  1B9N A;  2DT5 A;  1IRF A;  3CO7 C;  1ZRC A;  4U0Y A;  1FBS A;  1A04 A;  1U3E M;  2Z3Y A;  2HKO A;  4WF2 A;  1SD5 A;  2MD5 A;  4I02 A;  2AS5 F;  1XMK A;  2WV0 A;  2K7L A;  3ERE D;  4KUM A;  4LMY A;  1BI3 A;  4HDV A;  2EV5 A;  4ENN A;  2BGC A;  3V8K A;  2YX7 A;  1HW2 A;  1LDK B;  1S6L A;  1BI0 A;  3DQV C;  3Q9S A;  1EH6 A;  1R1V A;  2Z5U A;  3WE2 A;  1AWC A;  4KN7 X;  3WTV C;  5FO5 A;  1FBQ A;  3WTT C;  1YYV A;  1SAX A;  1DPU A;  2F2E A;  2A68 F;  2FNP A;  2DU9 A;  2QQ9 A;  2CQK A;  3RIR A;  5D6E A;  5CVJ A;  1YTY A;  2KIM A;  1QNT A;  4G7H F;  3F6V A;  5L3G A;  4KT5 C;  2ETH A;  4A5M A;  1DUX C;  4YIF A;  2P7C B;  2NYX A;  5KVR A;  1WQ2 A;  1MDM B;  1T6S A;  2W24 A;  3QAH A;  4A0X A;  5LGN A;  4F7Z A;  3KLN A;  4I2O A;  1WSU A;  5ICG A;  4LG0 B;  4RGR A;  3E5Q A;  1HST A;  4LJZ F;  3KEQ A;  1WI9 A;  3B02 A;  1G4D A;  1CF7 B;  3KET A;  5J6X A;  2XGX A;  3GLX A;  3NEU A;  4Z2Y A;  1XN7 A;  4EJT A;  4KNY A;  1XGO A;  2ZCW A;  2JZY A;  3SZT A;  2QQA A;  3R4K A;  3ECH A;  2D2W A;  2A61 A;  3I58 A;  1Z9C A;  2IP2 A;  3FXU A;  4NHJ A;  1R5H A;  4FHT A;  4EJW A;  5D4R A;  1DPR A;  2PI0 A;  1L3L A;  2OZU A;  3DV8 A;  4B09 A;  5DCM B;  1Y0U A;  4LB6 B;  3R6S A;  3MFK A;  1T98 A;  2KIU A;  2O0Y A;  2VE8 A;  1U5T A;  5DUK A;  4I7H A;  1GXQ A;  4LK0 F;  5LRS A;  2GXB A;  3I59 A;  5ILU A;  3WGH A;  3BPV A;  4CYD A;  2UWM A;  3D5L A;  4IHT A;  1ZYR F;  4B8X A;  2PEX A;  2BV6 A;  3KP2 A;  4JK1 X;  3I5U A;  3V7C A;  2XUB A;  1W5S A;  5AON A;  5D5X B;  1ODD A;  1J59 A;  4BHP A;  3BWG A;  4A0Z A;  4OIN F;  1WRJ A;  4QWQ A;  3IC7 A;  2HZT A;  3NRV A;  3JSP A;  1FNN A;  1S3J A;  3L2C A;  1RZ4 A;  2A6H F;  2HTJ A;  3DF8 A;  2XAS A;  4G7O F;  2YR2 A;  3CTA A;  3KP4 A;  3LAP A;  3R0A A;  2VOO A;  4EVI A;  2A07 F;  1O3Q A;  3GVA A;  4CXF A;  2MC3 A;  4GGG A;  2ZME B;  5FLX K;  3GF2 A;  3D0S A;  2YSR A;  4HA8 A;  1G3W A;  1QZY A;  2FF4 A;  3CUQ C;  1I27 A;  2C6Y A;  1RNL A;  3KFW X;  5DCF A;  4M9X A;  3FXQ A;  3BP8 A;  1GHC A;  3RKY A;  5FLX Z;  4CZZ A;  4ZYG A;  4UHT A;  2KKO A;  1HW1 A;  2L4A A;  1BIA A;  5IT3 A;  4MHG A;  1D3Y A;  4NB5 A;  2RNJ A;  4R79 A;  3IL2 A;  4Q5S F;  1OPC A;  1AOY A;  2HYF A;  5L3D A;  1J5Y A;  2IA0 A;  3L00 A;  4RB2 C;  2ZBK A;  3GUD A;  4IRH A;  3SQN A;  5HLH A;  1V4R A;  1EH8 A;  2FML A;  5LGT A;  3ISP A;  2PLY A;  2KRF A;  3LQR A;  2CWE A;  1SFE A;  4KA4 A;  1MKM A;  1SFU A;  1KQ8 A;  3LFK A;  1ONV A;  3BY6 A;  3H92 A;  4UVB A;  4MQ9 F;  2Z33 A;  5CVI A;  2L02 A;  1ZAO A;  1U78 A;  3P7N A;  1T2K A;  3ZP5 A;  1TQM A;  2MBF A;  2X0L A;  3VOE A;  3C7J A;  2XAF A;  5HVQ C;  1RUN A;  2O03 A;  5AIP A;  1UCR A;  1OYI A;  3Q5F A;  2P5V A;  3WG9 A;  2CYY A;  3R60 A;  2XIG A;  1G6N A;  2ZXJ A;  4G7Z F;  4K2E A;  1FT9 A;  4ENM A;  1PUE E;  1FSH A;  3O3K A;  3TO9 A;  1NHA A;  1HXD A;  1I6X A;  2VOD A;  4Q48 A;  2XAG A;  1KU3 A;  2CFX A;  5ERI A;  3E5U A;  4O6J A;  5HS8 A;  3EQL F;  1FX7 A;  3T8R A;  1C0W A;  2DO7 A;  4YFX F;  2EJR A;  3E97 A;  3MQ0 A;  1K78 B;  5KK1 A;  3I0T A;  3IWF A;  5ILS A;  1YS6 A;  4M6X A;  3ZQ7 A;  1PP8 F;  2FA5 A;  1PDN C;  1HBX G;  3BZ6 A;  4QLC U;  3ECO A;  2ADU A;  2LNB A;  1R00 A;  4RAZ A;  1H9G A;  1W7P D;  3GFL A;  2QBY A;  3QU6 A;  3TGN A;  1OMI A;  1BIB A;  2P5K A;  3P9C A;  5D8K B;  2DK5 A;  5LHI A;  2HOE A;  4MGR A;  3J7A O;  3T5X A;  3N4M A;  4EMS A;  5DV5 A;  3LAJ A;  2CW0 F;  2Y48 A;  1QZZ A;  3GFI A;  5D8L B;  1LEB A;  2BE5 F;  2ISZ A;  5E17 F;  3TDU C;  1OR7 A;  3M8E A;  2VN2 A;  2ACJ A;  4IRI A;  4MEX F;  3WTW C;  3ROU A;  2OU2 A;  3G73 A;  1CGP A;  1P92 A;  3I64 A;  4ASN A;  4E70 A;  3J81 Z;  3ULQ B;  1JHF A;  2V1U A;  1U5T B;  2PBI A;  5H6R A;  4HOB A;  3JW4 A;  1EV7 A;  2VOP A;  3FM3 A;  3I59 B;  3GEZ A;  2MH2 A;  3HRU A;  3B73 A;  1ZRD A;  3GFM A;  5DD8 A;  2UXX A;  1K6O A;  1UHW A;  4G8X A;  3KP3 A;  1YFH A;  3C18 A;  3EYI A;  4I0A A;  1XCV A;  4GO1 A;  2E7X A;  2RC4 A;  5D5V B;  2EFW A;  5IT9 K;  2XAH A;  1R1T A;  2R7D A;  2XHK A;  2NS0 A;  3N97 A;  2G7U A;  3MCZ A;  1P4X A;  1O3T A;  4GYG A;  4EJU A;  4LB5 A;  3CUQ A;  5LBQ A;  1W5T A;  3WTX C;  4HV5 A;  1LDJ A;  5IT9 Z;  1UB9 A;  5ICC A;  1ZLK A;  4RAY A;  5LEJ A;  4A6D A;  4ENJ A;  2VXZ A;  1XSV A;  1KGS A;  1FLI A;  5LLQ A;  2RN7 A;  2GQQ A;  2F5C A;  1FP2 A;  3ZMZ A;  3CDH A;  1XGN A;  4HQM A;  3HIF A;  1OYY A;  3KEO A;  5TJJ A;  4XBF A;  4D0P A;  2G9W A;  4DQ2 A;  4ENK A;  2YPR A;  5HDG A;  1H0M A;  2GAU A;  1REP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...