2F48A

Crystal structure of a novel fructose 1,6-bisphosphate and alf3 containing pyrophosphate-dependent phosphofructo-1-kinase complex from borrelia burgdorferi
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
551
structure length
551
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
molecule keywords diphosphate--fructose-6-phosphate 1-phosphotransferase
total genus 199
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 2f48A03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A02
1ZXXA 1F8YA 2A0KA 1S3FA 4KXMA 1S2LA 1YDHA 3BQ9A 3O8LA 1T35A 2F67A 1MTOA 2KHZA 4JELA 4FYHA 4I4IA 4MCJA 2F64A 4U1RA 5ITSA 4P5DA 1WEKA 4MEJA 4PFKA 3IMKA 2PFKA 1S2DA 4HX9A 4KXNA 2IZ7A 3PFKA 4LJRA 1S2IA 3F5MA 2F62A 4LJLA 4FYIA 2IZ6A 4I7EA 4JEMA 2PMBA 1F8XA 3O8OA 3O8OB 3EHDA 3MAJA 4A3SA 3OPYB 4I36A 2F48A 2Q4OA 1PFKA 3HNOA 3QUAA 4RH3A 4OHBA 4WL0A 1RCUA 2NX2A 3SBXA 6PFKA 3K2QA 4KXLA 1S2GA 4JENA 2HIGA 3GH1A 4LJKA 2A33A 4OHRA 5AJTA 1WEHA 2Q4DA 4NPAA 4P5EA 5AJUA 2IZ5A 2KLHA 4FYKA 1KZHA 3O8NA 3OPYA 3U39A 3UQZA 2F2TA
chains in the Genus database with same CATH superfamily
1BAPA 3I9JA 1IEQA 4XD7D 3TBIA 5L3GA 2YV4A 5BVHB 5IKXA 4TLCA 1E2BA 3A1TA 2R6JA 2Y1KA 5EDNA 1JDSA 2O5RA 4BWGA 4GGGA 1KMNA 3CRMA 4BNGA 4JXZA 2UUPA 2V55B 1U3CA 3H13A 4G0MA 4KDEA 2JGFA 3B1WA 2QIOA 4N54A 4XX1A 5LKAA 2YFYA 3I6MA 4TMFA 3NI2A 5ECDA 3WYEA 2WT9A 3OPNA 3IEMA 2I4LA 5LQDA 4DM3A 4FUTA 3CLSC 4WSOA 1HEYA 2FX3A 1GLGA 2LH9A 1U0RA 2I4RA 5E9AA 4DC9A 3OYKA 4K40A 3RIRA 2WWWA 3WTZA 3DKWA 1ERDA 2WWHA 3GU3A 4RK4A 5A6VA 1E7RA 5TRDA 4HLNA 1LEHA 3IAXA 4M9QA 1F8UA 4F56A 5F7JA 1XROA 1G4UR 2E2JJ 1G21B 1NX6A 3ASVA 2RB4A 4XWAA 4LDNA 3TEJA 1H0RA 1RXVA 5EEGA 1V1RB 3B1ZA 3N1UA 2VTBA 1IN6A 3DQVC 1RRGA 2OYRA 4GR4A 1N33B 1AQIA 3AR2A 3OTOB 2IHKA 1BG6A 3R4CA 2HFJA 4Z1OA 2ZDQA 4XQEA 2W4MA 3WK5A 1NNUA 1K6EA 4U2FA 4B7AA 4RA2A 5TMDA 3OQJA 2HOTA 4CKCA 1L7PA 1OI2A 2ZI4A 3OZWA 4P55A 4DIOA 4FHEA 1UKVY 2H65A 2ZXFA 3CZQA 3T7AA 4D74A 5FOQA 4UPEA 4EPYA 4Z4IA 5BR1A 4HNAA 4TXNA 2ZIGA 1I1SA 1I6HJ 1ZCJA 1VDZA 3KJEA 4GNKA 5J2TB 3H9CA 2W4IA 3HUGA 5CJJA 1LV7A 2VEDA 1GAQA 2ODEA 3GK3A 3EC7A 1FW8A 2F55A 3S3NA 3E7LA 1ZN8A 2ZT5A 4A0GA 1VQNI 2GN8A 2JQ7A 1XSEA 1OWLA 3E53A 3HVHA 3NHMA 4J9VA 5DKFA 1MG5A 2PV0A 2WKPA 3HR4A 5JC1A 1E58A 4AMUA 1U5TC 3HKCA 3WTTC 4MWOA 2OILA 1VBKA 4MR7B 1GEGA 5H83A 1R74A 1Z16A 2K4BA 2WKSA 3HGMA 4U6QA 5DHTA 1QG6A 1QYXA 4XLCA 2Y1WA 4M1SA 4NU6A 4ZZ3A 1YR9A 3ZOKA 3OEHA 5C3UA 2DF8A 2YJTD 4A7PA 1ESMA 1Y3IA 3VNQA 2C4MA 4LF6B 1ZSYA 3TECE 1YJNI 1F2DA 3E8XA 2KKOA 1EWVA 2W11A 2WJ4A 2WFLA 3DGEC 3NBQA 1RRKA 4OJYA 4QUAA 4RJIA 4ZO4A 4Z54A 1C2YA 2H4ZA 1KTIA 3RC9A 1UBJS 3C85A 3CW8X 1KRWA 4G8BA 5HF8A 4C29A 3DEHA 2RJNA 1ZL0A 2HQ5A 5SYAA 2FG6C 3KKQA 3M3DA 1E7SA 4EUEA 1OZFA 4JS0A 1YOBA 2HGSA 3TBKA 5E79C 1F3OA 1HL3A 2O9LA 1M2KA 2ORYA 2W6OA 2I71A 4LS3A 1RZ3A 2QRNA 1T3ZA 5E3JA 3U3RA 3CZ9A 4CEHB 3E6DA 1AKUA 2I4NA 3O8QA 4YJ3A 3ODPA 4ARZA 1ZP6A 4WFJA 3G2OA 3ZMUA 3NTQA 1AKEA 3S93A 4IXTA 2JDID 2OQVA 3V1UA 1JKFA 4AC9A 5LRSA 1UWKA 3LT0A 4Y7DA 1ON2A 1SKAA 5I9BA 3SYNA 3ZV7A 1KI6B 3SOPA 1NASA 3HZJA 3TJMA 5M7EA 1JEQA 1XCLA 1QMGA 2MSCB 1HDOA 4WKGA 2MH9A 2WWFA 3BXPA 4OKNA 1YX5A 4NK4A 1RKUA 1M2VA 3A6EA 1JA1A 4I3HA 4DCSA 3AG5A 3ENVA 2DY0A 5GPCA 1DNPA 1K92A 2AA3A 4JVMA 5AKHA 2FLVA 2Y9YA 3FDJA 3O75A 5D3QA 4X9XA 3ER9A 2J5PA 4IJ6A 3IURA 5TMEA 2LCQA 3I2HA 5EWLB 5EY5B 2KPOA 3CRW1 1XLUA 1LGYA 4BFZA 2XB5A 1D7AA 1VDMA 1LVGA 3FRJA 2BBOA 2PZGA 3DO6A 3GCZA 3ML6A 4CETA 1O97C 5CEFA 3B6IA 4FX2A 1L5YA 1LBTA 1ZQ9A 3TRJA 2DUMA 1XZGA 1P1HA 4GKAA 4K1XA 2ZB7A 4H0CA 4J1TA 4P4GA 3GBVA 1W1WA 1T8WA 1F7VA 2QV0A 5IN5A 3HDDA 4PFOA 3Q0WA 4NTZA 5KNBH 1I4TD 1FDUA 1UH5A 1Z6XA 3QEMA 4K0RA 2XSZD 4B3CA 3HA2A 4RHCA 3FM9A 3V48A 4A10A 3OQIB 4KR3A 1H2BA 1JZSA 3DKXA 4QLOA 4E70A 3DC7A 3GT0A 3NTOA 3SMQA 1LDKB 2YR0A 4F91B 4V02A 3KQVA 5FBWB 3V7UA 2C7GA 4AAYA 4MVWA 2YBDA 4ZYTA 1VJRA 3VPHA 3T0GA 5JATA 2O0YA 3NHAA 1O87A 4P6VF 4PHGA 3K8OE 1YDMA 4L3WA 4CJXA 2HXGA 2ZI7A 4F85A 4AF6A 3C1UA 3FUTA 4OHCA 3QVUA 2Z5UA 3ZE1B 3ZXIA 1OIWA 1MW9X 4GC9A 3UV3A 5CCXA 4ZEXA 3HXTA 3LQFA 4XX0B 4G5SA 5J4LA 4EI9A 1AA7A 2WJ3A 1KS9A 4AJ2A 5BT8A 1WBJB 3KAQA 5FPTA 2MSDB 1GL7A 1PWYE 2VA8A 4G0NA 4D99A 3BQZA 2F8MA 3WYBA 1C2TA 4NC8A 4Z5XA 3DCIA 4HEHA 5GJBA 2VJAA 2IZ6A 1AKTA 3EWSA 2Y0DA 3FHLA 3TW6A 4QDXA 5CJ2A 1P9WA 2QVOA 2GX6A 3CUQC 3W5UA 4KXXA 1A0OA 1JR6A 5LXTF 1MB3A 3IOEA 2K4MA 2R7NA 1IEVA 3EBLA 2H5EA 4YEJA 5KNBD 3I64A 2CYBA 3IUSA 1J9GA 5LEJA 2I65A 4MW0A 2IP1A 1YGPA 4MIYA 5FF9A 5FBQB 4I6GA 5EEAA 4P93A 1ZW1A 3NOVA 1KYIA 3S15J 2D5CA 3O4IA 3JRGA 5H70A 4CFSA 4AM8A 3H5AA 2ZC2A 1SKYE 1YT5A 3ZIAA 2QEXI 1BI2A 4UUVA 3OFJA 3B6EA 3GAZA 4KP7A 4W5HA 3ZHYA 3Q7PA 5IKOA 5JCPA 3SSAA 2OQIA 2WAOA 4XRGA 5JQGF 2J9XB 1LFBA 3OLYA 1BH6A 4CCOA 3F6CA 1BXZA 2MR6A 3IUMA 3PHBE 4OQMA 1YRNB 3HSYA 3Q5DA 2I33A 2WR8A 4UUMA 2CC2A 2P5LC 4TMZA 1HDPA 2ECCA 2OD2A 4NE7A 3QEJA 4OHVA 3A32A 3WFZA 1FTWA 1EXNA 1HSZA 2D06A 3IERA 1HQDA 1WS6A 3INGA 4TXHA 3ETCA 3GCXA 5G0TA 1M6YA 2YIVX 4ZVLA 1SG6A 4II2A 3QI7A 1XQ6A 3RYFA 4G07A 4TT3A 2PVCA 3OQVA 3QRFF 1EBUA 2QSJA 3BSWA 3AVUA 2D2WA 4HN2A 1YBMA 1M2OB 2ZSIB 4L50A 4ZZIA 3NARA 4XBFA 1QYIA 2ANCA 2F2EA 2W2LD 4R0NA 4RGVA 2UYOA 3OIOA 4YAFA 4OHWA 1GN8A 4XEHA 4PW0A 1E8NA 3VPAA 4E7PA 4RGQA 2CQXA 1GITA 1PLJA 2A78A 2LSOA 1NWHA 3H9UA 1HYGA 3EA0A 1I2MA 4NJEA 4GDFA 1R6DA 2VJBA 3SC4A 6AT1A 2R7XA 3ANLA 3QYFA 1UMCA 4C1BA 3AF6A 4QIWN 3T9DA 1WSUA 4JI0B 2HCBA 2QRJA 4GXTA 3RPQA 5FOUA 3SFVA 3NG1A 5AFSA 2K7FA 2QM3A 2LCFA 5GADJ 3NM5A 5KJFA 5H6QA 2UVPA 4RZHA 1Z21A 3L0OA 1MX1A 2OP0A 4BO8A 4I5EA 4GEGA 5IJXA 3IPAA 3BULA 1DC7A 2FEZA 3CR3C 3G9XA 3BQNB 4UBOA 1A9ZA 2GZ3A 4V0OA 1GADO 3ETLA 1ZUNB 1NF2A 1GZDA 5HGJA 3G8YA 4H1HA 2H8RA 1Q14A 2ZWOA 1SVKA 3W2GA 1G3YA 1J1IA 2QA5A 3T5CA 4CBVA 4P38A 3IKJA 4LXUA 4RIFA 3HOZJ 5EIEA 1MR3F 4GGPA 2R7VA 2QTGA 3MTBA 1XZAA 3A3YA 2W2NA 3KYIB 4N1AA 2VZ0A 5JT1A 1MSEC 3L07A 1HQYE 3PSFA 2LVBA 1Z3XA 3N6RA 4UFNA 4UUQA 5LA6F 4EYSA 5FKKA 1ECFA 2PFBA 2OWEA 4LY0A 3KUDA 3MS4A 5GJVC 3V3TA 5EMLA 4O29A 1MMGA 1ZNZA 2ACVA 3L7LA 4KB5A 3ISJA 3Q8KA 2NACA 3SJCA 1DEAA 1K5GA 4OWRB 2WWVD 2H18A 3HBAA 4LK0F 3SGLA 1Q16A 4X24A 3EAQA 2EZ4A 1ODIA 3EQ6A 3HBMA 3BLYA 4ID3A 1MGTA 2CW5A 2FW7A 1EFCA 2JAOA 3HKDA 3PQFA 4RD6A 4WLVA 3ZGVA 3HRMA 1T4CA 3UV7A 2DVMA 3LYHA 3U7FB 2QZZA 1BL0A 1YIDA 2ZBKA 4W5NA 4O59O 1Z6YA 3MINA 2WF5A 5FJ8J 3NZEA 4EPWA 1SUAA 3T54A 3S2UA 1Z7GA 1JJAA 2KZGA 2DUUA 4FSXA 3BPSA 5F1KA 4L9VA 3ZQLA 3M3PA 2OQ2A 1NW8A 2HKXA 1WJGA 4DLUA 3FZNA 1E1YA 5BNZA 5L9AA 3ELKA 1A7KA 3QFFA 5EIBC 2EJCA 4EYEA 1L4MA 2PD4A 5TGZA 1T4BA 4B8ZA 1GT0C 2ZXJA 5DHRA 3KBBA 3SQMA 4YV7A 3FMSA 1HE4A 2XGGA 5DBEX 2ONYA 1EVJA 2Q4EA 2BFBB 3HCAA 4I2NA 4ZA2A 3RT1A 4X3PA 2P9CA 3Q3HA 3V5NA 5DM60 4MULA 4Q1AA 3GCDA 4IZHA 4B8YA 1GYRA 1EHYA 2FRHA 4OI0A 4CKBA 4M2LA 1BRTA 1ORTA 3H1TA 1B2RA 3BD6A 2PBZA 2WJAA 2NUBA 1QGUB 1ECGA 2NVXJ 3V8RA 1RWVA 2Y71A 3H4VA 3NHFA 2GCPA 1SQ6A 3VZSA 1I4WA 2EIHA 2BHLA 2AFVA 1DUSA 2QLNA 4DMFA 1GA1A 1L0BA 1X1CA 2EA4A 2IA0A 2F4IA 2OCAA 3HB4X 4Z86A 1TYBE 5ICSA 4X97A 2BGCA 4TVSA 2IYQA 1ZVKA 3FETA 4HLUA 3C4JA 1BC8C 1GU0A 1T9KA 1W87A 1JJFA 1SB8A 1DFIA 1E3EA 1Z3CA 3COPA 3QF7A 4KR0A 1BDMA 4WX9A 5DDIP 5ERYA 1FK8A 2W82A 5G4LA 5CA0A 2JUGA 3BORA 1K83J 3QOXA 1K8ZB 3WLEA 1POGA 1PZMA 1S3IA 5AJWA 3IQDB 4GKVA 4C0SA 3CP2A 3ETJA 3NBUA 2BJVA 4RCZA 1C1DB 3OOHA 4MPJA 5HKKD 1QS0B 2ZP1A 1U4OA 3Q3SA 1NULA 2GDJA 3LW8A 4P5EA 5EJ8A 1QRUA 3WI7A 4N9HA 2Z5FA 4DTCA 3EARA 1VQ7I 2HJWA 3S7TA 3ZGOA 4YFXF 4KT5C 1BA2A 3NAUA 1F5NA 2QBYB 2BVNA 3OZXA 4I5DA 3GIWA 3WGZA 2Q8QA 1DELA 1HE3A 1JQ5A 3AQ4A 3D5QA 3P5SA 4IJUA 4L5JA 4LHWA 2X4LA 5FLYA 5AXDA 3W2EA 3F47A 4YK7A 1K4TA 2VO1A 1COZA 1IBSA 2F2TA 4JKYA 1PNQA 2B8EA 3C2QA 4UDXX 1C1XB 4X8MA 2H17A 5EKUA 1KH2A 4WBNF 1YDGA 2G63A 3AIMA 4LXTA 3MERA 3R0AA 2R92J 3OOPA 2V0CA 4LJ6A 3E9RA 3S29A 2FP3A 3TLBA 1IN4A 5AIBA 4PRYA 1LVAA 4CIYA 4FX5A 3TOVA 1E5XA 4XSGA 2FSPA 1KE2A 1NQXA 4W8GA 2VK8A 3BROA 3WAJA 3L6EA 1OV4A 1P5JA 2V96A 3RYCB 3L7CA 2QRQA 1ZIPA 2JFZA 2XCOA 1J8FA 1JQJC 1C1DA 5GQSA 4NYIQ 1KF0A 5JNSA 1KBOA 1ZD9A 5D5HA 4AQDA 1UT5A 5DLYA 4H3SA 1Q92A 4HRXA 1YCGA 2R7DA 4RS8A 1TZMA 4KBGA 9ABPA 1U2EA 1UMDB 1C0IA 2VLIA 1CF9A 4FGUA 4IGEA 3IIKA 1IRGA 1V7PC 4XM2A 1J8MF 4LBZA 3SG0A 3OMYA 4RGBA 3UWMA 1LBQA 1X1TA 4JIMA 1Y5RA 5IRCD 2GAUA 2DRIA 3GBPA 3P9ZA 4D25A 1EGAA 2EERA 2H63A 3VDQA 3CQZJ 5CVEA 4E3WA 1VG0B 4M99A 2FSSA 2PCLA 3P0FA 4MQEA 3VHLB 1G19A 3MVPA 2V0NA 3AETA 4HVAA 3H3ZA 3I5AA 1YHNA 1FMTA 1SU8A 2A86A 1P0PA 1VSUA 2RGCA 2ST1A 1NAIA 1CUFA 3DDSA 2R47A 3G17A 1RXIA 3G1TA 3I2KA 4LNAA 3F6BX 4M0DA 1L5VA 1T6XA 4QDZA 2WMOB 2QW0X 1GNVA 1WKMA 4R51A 1P18A 3Q0IA 1XDDA 1XZFA 2R6DA 3DPIA 2RH4A 3ZGZA 4BP9A 3K6GA 5JCXA 1A8SA 1E96A 4GCVA 4GR9A 2NUTA 5E7JA 4BU1A 3O1LA 2AEMA 3BX1A 5TDHA 3GW8A 5FQOA 2OHOA 2ECQA 3GF4A 3GJQA 3NC4A 4X93A 1XB2A 3B73A 2KM1A 3AERA 2G6BA 4PXYA 5HR5A 4K9SA 1J5XA 5JJBA 2NS8A 2OU2A 1IBKB 3RASA 5KWSA 4CF4A 1XTIA 3LFHA 3A10A 3RIHA 4F55A 3TUIC 5CT5A 1U8TA 1ZOIA 4I98B 2A5WA 4QLAA 2E5ZA 1C3LA 4CV2A 4P83A 3G2QA 4XORA 3ZHOA 3P9XA 2Y6UA 1F4LA 2YYYA 4FGLA 2CUFA 1KH3A 2OO7A 2QN8A 1Z25A 5JZOA 3CGWA 2HXOA 2OCGA 2QTFA 3KQSA 2M8GX 3DNPA 3BIXA 2G7UA 2W43A 3FMGA 4PCLA 1IIBA 4BZWA 4HVTA 1WWXA 4NHOA 2QM0A 4CT4B 4EFNA 3WU1B 1BOBA 1N3IA 1NWCA 1S96A 1UK7A 3VR5D 5J1YA 1DPUA 3CG4A 1RYHA 4LCBA 2OPHA 3E2PA 3IRQA 5THKA 4P7BA 5JS8A 2WD7B 2QVXX 5DTMA 1IZ9A 4AY3A 1U63A 2PMHA 4GH5A 3IAM6 3LK6A 4F2DA 1WULS 4Z3KA 3FLEA 3TQCA 1F6WA 3DTYA 1AU7A 1H9BA 3TVYA 2PKWA 2H1OA 5KMGA 1GKLA 1ZY2A 2F59A 3S17J 3M3HA 3QYBA 1FIAA 4RKRA 2X0FA 3TZ6A 3BCBA 1NOJA 3PRKE 1SWWA 4UAGA 1LFUP 1POWA 3MZ0A 1KE1A 3V4FA 1TK9A 4MKIA 2O3SA 1O08A 4L08A 2PHZA 1XZ8A 2EG5A 4M3FA 2GCNA 2R9VA 4IXAA 1MDMA 1KIFA 3EGCA 3G9ZA 2QD2A 4G5HA 3REGA 3FJYA 3X2SA 1P60A 5F7XA 1Z28A 3ICPA 3BXZA 1MH1A 4ZYEA 4FYKA 1Q57A 4NBVA 5D87A 2Q8NA 3UKGA 4BY1J 1DTSA 2XUFA 3ETEA 5JAOA 3A6JA 5LVAA 2P7IA 2IYWA 2ZRDA 4P80A 4YREA 1HZZC 1B14A 1IGNA 5L3VA 1OXTA 3BJIC 4FMBB 1D7OA 4DQDA 2HRZA 4PC6A 2F6RA 2XT6A 3SX2A 3SXJA 3VVBA 4KUGA 4TGLA 5BV0A 3OE5A 3FYHA 2HDHA 4GQAA 3TLJA 2YJZA 1R16A 2GF9A 4HZGA 3MWKA 4GGOA 3UEOA 1NUUA 1R7RA 4PLZA 5JEDA 3OEHD 4E5YA 1U7WA 2XB8A 3T4PA 2GO7A 3LM8A 5CT8A 1QNLA 4HGYA 2FEOA 4FOSA 1S4QA 5EXDA 1GM5A 4B4CA 1G20A 4FOOA 1YZUA 3ICEA 3A11A 4IF6A 4RIEA 5KQSA 4YHBA 1DOAA 1KK3A 3C3WA 4C21A 4Q7QA 1N3LA 1OHHA 1WPKA 4OIQF 3HCFA 4C2MJ 4CYCA 4KZKA 2EKZA 2WF6A 3PEFA 4JUCA 5SZIA 1Z73A 1GCGA 4EY3A 4ITVA 1ORIA 2H2FA 2BM8A 4ND8A 4BN5A 3B82A 1H8AC 5E18F 4HNGA 5LP6B 1EJ0A 2QN2A 2IPAB 4P4TA 3WGGA 3H17A 5BN1A 4HLXA 2FMTA 3WK7A 1B8UA 3K9FC 1H3FA 1S3SA 3J7AY 1MA3A 3LT1A 1AKHB 1WQ1R 2HDOA 1DRVA 2UZIR 4BBJA 7GPBA 1ODTC 3PLAE 1C4XA 1P7YA 1X1SA 3V7CA 1NBMA 2Y2UA 4L0QA 4MUHA 5DN9A 4D3XA 2YU9J 1NLMA 3PDCA 4MV4A 5HS6A 4PZYA 2P75A 2FCAA 4DWOA 1UBGA 3BB4A 1WXHA 1SC3A 1IVNA 2PIDA 4L9SA 2TECE 3VTZA 3TSYA 1QB7A 3DP9A 4CKBB 3E5HA 3MIIA 1PJQA 1Y6ZA 2LNBA 2NNLD 1ICIA 3NGMA 3I3OA 3V46A 3X1JA 3VKVA 4S1VA 3BMQA 5JFRA 2Z2JA 2RGBA 4XA8A 5CTAA 3AHJA 3H9EO 3CJTB 5DWVA 1FUEA 2DH6A 1EUZA 1WUTA 4DIKA 1YVEI 1K8RA 3BSSA 4NXNB 1AOYA 1TF5A 4FSHA 3QEOA 4ITUA 4KV9A 1H85A 1MMAA 5F08A 1PRYA 3IO5A 1AM4D 3STHA 3H3FA 4P9UA 3ACCA 5A0VA 4FW9A 4OXXA 1EBBA 3F78A 4XUDA 3ZDXB 3K72B 6REQA 4KBYA 3DTKA 4G6ZA 4R05A 2XHKA 2FPRA 2VP9A 1RXUA 2O8EA 2ZRKA 2XODA 2QG4A 4Z0PA 1UPBA 2VIXA 5AKZA 3HU5A 1OXKB 4YRTA 4IIVA 5A1TA 4FDMA 3QE9Y 3E6BA 1BHQ1 2HYGD 2V9KA 4AIKA 3CEJA 3QE4A 5AKKA 5IVKA 2IDZA 4ON0A 2VOEA 4BVJA 2BFCB 4L5BA 2FEMA 4GYKA 1T9BA 1CLUA 1JIVA 3IXLA 3PYMA 3PQ7A 4EUKA 2OR3A 5M3BA 2JIQA 1PAUA 1Q0TA 1LPOA 1YJQA 2ZGVA 1RKBA 3I83A 4CZZA 3IA7A 1PKEA 2EKLA 4J7XA 1TU0A 4YNBA 1VPDA 3VYUB 3DW3X 4JAVC 5F23A 4P9FA 1XCPA 4P08A 4BVGA 3KIPA 1B0AA 2DFFA 5AHOA 4Q6BA 3A0BC 3TAUA 3RK1A 1B9MA 1ODSA 3F6SA 4GX2A 4RZUA 2Q2QA 3PQ5A 1JA9A 3I04M 3QPVA 3PC3A 4G26A 4MCIA 3PD0A 3GYBA 1W0KA 5DMXA 1WY5A 2MINA 1H0SA 3BXFA 4NJOA 4UDYX 4NOLA 4BY9E 1VLVA 1ULUA 2HKOA 3D4NA 3L7MA 5JAPA 3HPHA 4ZAYA 3MEXA 1OZAA 5ICFA 1V4RA 2RONA 3GFRA 3HSFA 1FYXA 4JX6A 1W34A 2W2MA 3CSSA 4EABA 1FTQA 3UKDA 3JAKB 4C3HJ 2QD1A 2CNDA 3OHSX 5DX1A 1SO8A 4NBWA 5D00A 1UJ8A 2BBYA 1Q1QA 5EWMA 4B17A 4UZSA 3LYAA 3U9LA 2VDRB 1YJ9I 3AUKA 2J6CA 4R3UC 4EGYA 3A25A 1L7AA 1FRZA 1GUBA 1IY1A 3LPAA 4WCFB 3WNDA 2ZSFA 2NAPA 1W5AA 2UYCA 1YRNA 4O3MA 1JR2A 3P4YA 4S3MA 3ZNOA 5K6RA 2L7KA 2B4YA 5CLGA 3HXMA 2EFNA 4HDCA 4YT8A 4CU2A 1A8IA 1NBIA 1KAHA 5LWHA 3WTUC 2Y31A 2IXSA 2M2EA 4N4NB 1MXFA 2VF4X 2W98A 5FPPA 3O8DA 1NJ8A 2IWHA 3RD5A 1Q12A 3S2ZA 3EYIA 3VYVA 3QVVA 1UBOS 3ZWBA 3C2BA 2H29A 2Q5HA 2PKQO 1X2NA 1CUVA 1EFPB 2D5AA 3MJRA 3WRWA 4HUTA 3DXJF 5L3EA 1ESEA 4JOMA 2XWSA 3A1EA 4MVJI 3T3GA 1XRLA 4MW1A 2DP4E 1PZGA 3K0FB 4KVGA 3TXXA 3E1KA 3GTKJ 1MPTA 2R7AA 5IOYA 3TTUA 4RB1A 2R7FA 3GYHX 2HQOA 4BN0A 2HMTA 1ZRHA 4DMLA 4NH4A 5CIWA 5J2UA 2ASEA 3ME5A 4BNIA 4B73A 5EF6A 1DDOA 2IIQA 1I3CA 2ODTX 5EJCA 2OGWA 2D5LA 2R1UA 4D0LB 3RHFA 2X42A 1ECJA 3RQSA 3GMEA 4AVZA 1G3WA 1NHGA 1ZUIA 4AZTA 2N46A 2PLWA 1OKKA 1GPDG 3IMKA 1TZBA 1W75A 3GOHA 1T5BA 1GCAA 4JBNA 4F7ZA 1E5LA 3LA3A 4UDNA 5DNCA 2G0NA 2QTHA 3I59A 3I72A 3LVFO 4AO7A 4AZWA 2VN8A 2J41A 3JQFA 5KREA 1GRQA 1KZGB 1R66A 2WQZA 1I4OA 1VIDA 2M1BA 1J2JA 3CLTD 1BCSA 1PX0A 1VLHA 3PE3A 4N12A 5A7FA 3K9NA 1JBEA 1KJJA 5K3AA 2BSQA 1OQAA 2CG4A 2XWQA 3E5RA 1YDWA 3KXIA 3OMWA 4QQNA 3TQHA 5K8LA 1XZIA 1H9AA 4XYBA 1G3RA 2H11A 3LPCA 1PJSA 3DHNA 4WFKA 4IZZA 2PL9A 1DOHA 5HTKA 3P9RA 3IRRA 4KQWA 3QIAA 4LJYA 1QG2A 4XRSG 4B3AA 5G2OA 4C5CA 5AVSA 3QX3A 1NQVA 2WNIA 2ID6A 2M0CA 4G6DA 2F9FA 4M1OA 3R5HA 5ULLA 4H7JA 1E3QA 3ND9A 1JTYA 2WT8A 2VDMB 4PLGA 1B0PA 1Q3TA 5BN5A 2B2CA 2OSBA 2H7CA 1FMCA 4JCOA 3VZPA 4E15A 4EPTA 4FB5A 4ZDIA 1X19A 3P9IA 5CFLA 1ZD1A 3BP8A 2BKAA 2YWCA 4KQ1A 4OKIA 4N3BA 2AXTC 2Q5IA 3OZGA 1DBIA 3BCRA 4JXKA 2HS5A 2WFLB 4XOPA 2WWYA 1F14A 5CNJA 5C31A 2F00A 3UJ7A 3CVJA 4UBNA 3ROKA 3GVIA 3OZVA 4LF5B 3DLBA 3I56I 4I6ZA 4Q15A 1GNLA 3FGZA 3KZCA 4BJ6A 1Y1TA 2ZYDA 1KEEB 4YJGA 1JE1A 1SUIA 5K7SA 3DE1X 2D0PB 3QU6A 2FB9A 3DVRX 3I42A 3VHRA 4QBKA 3IKLA 4E88A 2E1NA 1JNXX 1Q1HA 2DBBA 2HOEA 4BUPA 2KFDA 2R751 4EX6A 2C2YA 5CFPA 3D3EA 3HLKA 2VHXA 4K28A 2Q4DA 5THXA 1NFFA 2FZLA 1MBHA 1VXOA 3FYUC 3IPLA 2Z1NA 4EARA 4DV7B 3D3NA 3PUFA 3JRAA 1RBMA 5A03A 3JU3A 3R3SA 3RREA 4LJZF 5AKXA 4ARBA 5FTNA 5JY6A 2CFTA 4H7FA 2HUNA 4DR1B 3AB7A 3AIOA 1RJDA 4LNHA 1RD4A 2DMQA 1JFFA 2ONKA 3QXSA 3TZEA 2WTNA 4X6LA 1GTMA 1HOXA 1UOOA 3S4YA 2DZDA 4ETMA 3EEOA 1TNSA 1QKIA 3OYEA 4DOZA 3L1IA 1G291 3DLTA 1LQTA 3TQIA 1FYMA 1XMPA 1I7NA 2J5KA 2NU6A 2VJPA 1ZUHA 5DSTA 4BFCA 1LVHA 3C5HA 1NA5A 1YB6A 2AK2A 4HD8A 4ND5A 5HXAA 3KKZA 2A9JA 4EM2A 3PKIA 3WLTA 4BLUA 2BEVB 4WLFA 1TAUA 2AJ8A 2P7HA 3OG9A 5CAEA 4MAAA 5KVSA 5KX5F 2AX4A 3JAMK 3EFOA 3A6KA 2XCLA 3GZTB 4IZIA 1PDVA 3IIJA 4QSMA 3FOZA 3HGYA 4YALA 2HLHA 3D0KA 1WJAA 4N7RA 4JLPA 5E3IA 1IWPB 1MCZA 2P11A 4M8SA 4ZYHA 3M9XA 4MLPA 5CK5A 4ERNA 3I59B 4V0KA 2F5CA 4QYMA 5JWHA 1EFPA 3MT9A 4XICA 5CCBA 2IW5A 1DHRA 1SXIA 2J30A 4KWIA 1EXVA 4PY2A 1GAEO 1ZRNA 3U7EB 1SOWA 3C7TA 3ZDZB 2ZUWA 1B59A 4HAOA 1E1CB 1NXPA 1E2XA 3CIOA 3W4JA 4BKPA 1ESNA 4FE3A 3W7VA 2OD9A 2DA3A 1ONNA 3KQKA 2FUG1 3KYDA 3N07A 2VTVA 4O2LA 4UM8B 2QMOA 1Z5ZA 1Z18A 1VB5A 5HNKA 1TQDA 4EYKA 3UFXA 1M34B 4PFKA 2JJ8A 2O23A 1VTNC 4LLLA 1JEAA 2VYFA 3OEWA 5A5EA 3OJWA 5AW8A 1EH5A 4J3FA 4DWWA 1XELA 2I5UA 4B3XA 1NX9A 1Z7BA 4M36A 5HFAA 1QRDA 1COWA 2WC2A 3P45A 3QBEA 5DCUA 1YQEA 2FMFA 1UFKA 3BA6A 4D9HA 5I47A 1SD1A 3S81A 3VNUA 2RGYA 4PZCA 2H54A 3CNEA 3HKCB 3L1HA 3ZKAA 1QIIA 2VJIA 3BMCA 5AI0A 4LMAA 2EQAA 3U3JA 2P9EA 4ZWNA 2ATCA 3CVWA 1PYVA 3RUCA 4UU1A 2AQHA 2V97A 3CINA 1F06A 3A6LA 1U28C 4DBLC 5A1JA 4B6EA 4NAHA 3R5SA 3VYSB 5JDIC 3FMIA 4EGQA 4IMJB 2FOWA 3TZBA 3OY2A 3C6QA 1S7CA 3ABQB 4KZPA 4LNUB 2PJDA 2EFOA 3STWA 1Z74A 1QLJA 1VCHA 2XHZA 1VM6A 3LGSA 3OT1A 2C2HA 5K7ZA 1C9JA 3PXCX 4HXFB 4OOFA 4XWYA 5D6FA 4G1VA 4UD2A 4MHSA 1A2KC 4C4PA 1G8JA 2QZ9A 2ZIWB 2XCIA 1LDDA 3G2HA 4K88A 2CFOA 5EEHA 1ZD8A 1YACA 3VGPA 3VHXA 4BNJA 4MA5A 4DLZA 1PQUA 3JAKA 1JJIA 3LI2A 1VSVA 4RA6B 4HNUA 1XSVA 2Y93A 2BLNA 3E27A 4BJHB 3G2KA 2DFKB 2IWRA 4PZJA 4E2YA 3KTAA 4PS0A 5C51B 1J1UA 3W9UA 2ZFWA 1R6UA 4DLPA 4TXLA 1UXHA 5IM4F 2DYSH 4OXNA 4GP7A 4ZC3A 2R7UA 1NVDA 2WTAA 4MS4A 4B46A 2A4MA 2QSHX 2GYUA 2CNKA 2XE7A 4S2UA 3TW8A 2OMKA 1N5MA 3GPDG 1WEHA 2DCUA 3VOTA 4A73A 1Z37A 1P5FA 2V7VA 2XAUA 1CS0A 4R3WA 1OGIA 3L7JA 2DR3A 5FL7A 1YV9A 2Y2ZA 3FXLA 2GHTA 1L6IA 2QE7A 2ZMEC 2BFCA 1C9MA 4A3EJ 1R49A 1G9TA 1JR4A 1XQ1A 1TTPB 2AOUB 2VJYA 2GEFA 4OJNA 4YAEA 5FFZA 1QF7A 1UBRS 1DI0A 3UHPA 1DP3A 1FQJA 1U5BA 4IFEA 2UU9B 1XKXA 1GTSA 2XXBA 2Q0OA 2Z98A 3IJEB 4TM8A 1JHQA 3HMKA 4J6FA 1QPIA 4W9NA 4OL0A 4MA4A 2HEIA 2HU5A 2QGFA 3S2YA 5L3RA 3HDYA 1VI5A 1ULAA 3I30X 3FFAA 2VUSA 1IN7A 5EIOA 2QRGA 4AYTA 3AF4A 3IVMA 5AIPA 3VODA 3VO2A 4HGQA 3TX6A 2H92A 4D9EA 5L8VA 1IBMB 4M89A 1R58A 1ST2A 2IXBA 2ZXIA 3LQ4A 3V4RA 4UUBA 2V6FA 4RVGA 5JBNA 4RJ2A 1TUBA 1RQNA 3ZK9A 4CCWA 1P8AA 2IU4A 3DMTC 4KHZA 3WR5A 4EJ2A 3PS9A 3SIWA 3WDMA 1FQOA 3AFMA 1EI9A 3I4CA 4XGIA 2VQ3A 3LUFA 4TV8A 2MJLA 3NOQA 1AK9A 2DA5A 5L45A 2O8KA 3WTCA 1HMYA 4RNDB 2HY7A 3PJGA 1M7GA 1OCPA 5AI8A 1KU7A 2P2DA 4L9AA 3GRRA 3JAWA 3KCCA 1KI9A 3TMAA 3GFPA 3FROA 3V4ZA 1H2FA 2LIPA 1RAFA 2XJ9A 1ZO8A 3GZ5A 2HF9A 1CNMA 5FTJA 4M0MA 4D9IA 1EVEA 2I34A 4MLCA 4US0R 4ZKDA 3MJSA 3Q8XB 3V1MA 4Z4GA 4PIPA 1NATA 4LMYA 3THXA 3WGIA 2O2SA 3IKMB 1GG5A 2AS5F 2HTSA 1AKQA 1TJ3A 1V1JA 1ZONA 3FKQA 2B2NA 3HSSA 4D9MA 1GPLA 1N2BA 2Q6OA 3LXMA 2Q49A 3RRYA 4BDTA 4D8YA 3S8YA 4KHPB 1AY0A 2GD1O 4MDYA 3EUFA 2CXXA 2GUWA 4IILA 4O2AB 1I2BA 4K05A 3WLFA 1X70A 4RHUA 4JC0A 4DBVO 1OD6A 2PGOA 3OU7A 3ORYA 4YIIA 3RYIA 4EUNA 5JMOA 4BVBA 1X7ZB 1K0FA 2RHRA 3ST7A 3DBLB 4XOUA 4ESBA 3ZLBA 2WYOA 4X1YA 5JZBA 3AP1A 1RIFA 1O0CA 3N2GA 4BCBA 3PUXA 3W5AA 1PK9A 1F7UA 5H81A 3R3XA 5AM4A 5AJYA 3GF2A 1U2PA 1HEIA 1VJTA 4PG7A 4Q1VA 4TL6A 2CFCA 3F3KA 2QKYA 4RAFA 3IUNA 2L2QA 1IONA 1TWGJ 2CLSA 2Q2NA 1WXQA 3LKBA 3OF5A 1XNHA 5BW6B 1MB0A 1V3VA 3NCTA 4Q9NA 5H8WA 3CC2I 5CHYA 9ATCA 5KQGA 4WKBA 4OU0A 3UC5A 1N78A 2X0RA 1G6Q1 2PKRA 4K46A 2YPRA 4L8VA 4UAVA 3VTKA 1MENA 5I7WA 4DKXA 5JJLA 1E9SA 1JSRA 3EBOA 4JLNA 1GXSB 2HYJA 1E6KA 4YV0A 3W5CA 4NCNA 2XECA 2M87A 1N3BA 2YZ2A 1F17A 1KDPA 3PQKA 1QQ7A 2ACJA 4BBSJ 3KP3A 2EAUA 2GAFA 3LIIA 3NEAA 2P2ZA 5EZGA 3G4SI 1YC5A 2GPBA 5HZKA 4L9RA 3NONA 1Y1VJ 4RXMA 5JJCA 3E5MA 2JLUA 4JDUA 3C1AA 3UG7A 1C50A 1XPJA 4FU0A 5IJZA 1BGVA 2ICAA 4PYOA 3D1NI 4UVEA 4P86A 5ELXA 2ZJ2A 1YZGA 4JX5A 2ZYWX 2ONZA 2IPXA 5IWCA 2VXBA 1P7ZA 1UKYA 2I66A 3NCHA 2PQ8A 2ZSKA 3SJMA 1IXKA 4G84A 4HJRA 2M6SA 4CCNA 4MR8B 2H00A 4C43A 1W7AA 1WR8A 3MWDA 4RVSA 3FYSA 4BJ6C 2Q2WA 4YMVA 1EESA 4F46A 2CE7A 3A3NA 4NCBA 3UMGA 1Z2CA 3ND7A 3OLVA 4RANA 2XAJA 4CCAA 3BGVA 1LZKA 4GRAA 4BDYA 1RXCA 1UDWA 5EKSA 1XZNA 4AX8A 2V6IA 3IE0A 1RPTA 1OW3B 5JSQA 4A69C 5LZ2A 4FMDB 3FPJA 2PRSA 2JIMA 3BVPA 2BIFA 4Y6GB 5BMOA 1UR5A 3C3YA 3O9ZA 3BF8A 3TPCA 4E6PA 1W2GA 3ZWPA 1KQGA 3N70A 3SI7A 2L9RA 3ZK7A 2J9ZB 5I5EA 4JJFA 3MGKA 1LY1A 1M0SA 4DYHA 1KQ9A 4LGYA 3MMZA 2VQFB 3I9FA 3FNGA 3U7QB 4PUSA 3OYFA 4LG3A 2BM0A 2H2DA 4KUMA 1U0OC 2IHJA 4X85A 3ZXYA 5FPKA 3FPLA 1EVIA 1JI0A 2FMXA 2G82A 5FI0B 1DBRA 5LMZA 2PT9A 4XRFA 4ADSG 4OHZA 4V19K 3FKJA 1ZRSA 4EL5A 5JSKA 4BRZA 4F72A 1TCCA 4EHKA 4ICIA 5JLWA 1D3AA 2F64A 4BFLA 2VT2A 2XBLA 1INLA 1DG9A 1ILWA 1IPFA 1QC5A 1EX1A 1BCSB 3DMTA 4O4HA 5FHRA 4WJZA 3DKRA 2V6JA 1JQBA 2RGNC 3FTQA 4YJDA 4BQFA 3FTPA 2X40A 1EZZA 3OIYA 3NC1C 3REQB 4CZ2A 2LKSA 5LD2C 4TYMA 1GZ5A 2Y1XA 4URYR 3ABOB 1NPDA 3QNMA 4CNBA 5B4UA 1OYYA 1Z6QA 2AOXA 2GEJA 3MWEB 2E4WA 1PFWA 1XIVA 2V7PA 4HGZA 4QRHA 4RPLA 5C5IA 2WV1A 3VDXA 2XF7A 2X6WA 2QW8A 4R1TA 2RGXA 5IK2A 4YAGA 1ZR4A 1WOMA 2VOPA 2OEPA 2P5UA 5DO9A 1G8KA 3WYNA 4CRWB 4DR2B 1L7RA 4MX8A 2IS4A 4H59A 3BPXA 4R7GA 4HPQA 3N74A 2ID8A 2PLAA 4YFNF 4A8PA 1U7TA 1F8GA 4A5SA 4L27A 3ZBTA 4I0AA 1L7DA 4XJSA 1GARA 4K8RB 2DBYA 1DPGA 2J0UA 3MMPA 1FY2A 1ODLA 3OU6A 3OUZA 3Q8WA 4X1OA 4BB6A 5DH9A 4GICA 2XSDC 1M0TA 1UCRA 1O7JA 2C3MA 2V7BA 1YRQA 4FHDA 4A3SA 4KCGA 4DR6B 1ULBA 4IDOA 3IV6A 1TQIA 3UT0A 3HU2A 4Q4JA 4YAKA 1JR3D 3DXYA 4JD5A 1V3TA 4GPD1 1Y5MA 1JG2A 2W25A 1SVUA 1ZK1A 2HGZA 4FNOA 3RV4A 3WICA 3FN4A 2OBXA 3NDJA 4FBMA 4XM1A 2UUBB 2GD6A 2NO1A 4JJZA 4IL6C 4DUGA 5D3MB 3QLUC 3OPXA 1Q3KA 4L3VA 4JNCA 1ZDMA 1YRBA 4ZOLB 3LAPA 4MTLA 2VB6A 1RR8C 2FW0A 4CFZA 5IYZA 3F6VA 1DRWA 3W4IA 3AL0B 5FWYB 3ZIDA 5BSEA 3MJHA 3H6GA 5IF3A 4KRGA 3KZZA 4TOIA 3C7JA 2RIRA 3MOGA 4RBNA 3HI6A 1D0IA 4DGSA 1XCBA 2O61A 3H0EA 4MWZA 1E3DA 4MZDA 4EHFA 3CO0S 4ZICA 5BOSB 2PH3A 1UJ6A 1Y7TA 3LT2A 3DM5A 4OJKA 4N8SA 2Y9MB 2VTEA 3IJRA 4FNGA 5I9NA 1Z4QA 5IP6A 3VPRA 1LDBA 3I2YX 4PLYA 2V7XA 4C7XA 4GYYA 1MDMB 2E4XA 1A9QA 1MO2A 3EDCA 1WIWA 4KK3A 4CMBA 1XFDA 4BMZA 1WF3A 4URZR 3AUYA 3CR8A 1C9KA 2H0RA 4IWNA 4QTXA 1ZM9A 3H0CA 5TJ9A 2LFBA 2Z3WA 5B7GA 3CZAA 2RCNA 1DBVO 1W93A 1XE3A 3A6GA 3AHDA 1FOWA 4XQFA 1A35A 1HXHA 3KKKA 1ZZGA 4RIGA 3EC1A 3MQ0A 1ZZEA 2G9UA 3QZUA 4FJ1A 5AOVA 5SZHB 3R75A 2HRRA 1QHHD 4S1TA 3PHJA 3EWIA 3JALB 2IVMA 3CH4B 4CMAA 2Y9PB 1IBCA 2DETA 2IJLA 1X1BA 5DEQA 1MQ8B 3RVNA 2IX9A 4EBFA 2QV7A 4KN7X 1JH9A 5AJVB 3AM1A 4EAAA 4OMUA 2AUMA 3SNHA 4OLHA 5L4SA 2CGEA 4XN0A 2XNDA 2ILTA 4HDQB 3OM0A 3DZFA 2VTDA 4HPJB 4D82A 1HV8A 4A6PA 4EUFA 4YPOA 4DXDA 4BS9A 1FFCA 2V9VA 2F17A 5IM5A 3OTQA 1NUHA 4NC7A 4XKCA 1WHTB 4F52A 2ISCA 3H2IA 3JQCA 4G1BA 4ER7A 4B6JA 1ZVJA 2CLOB 2ZRLA 4QXQA 1C8BA 2QENA 2DODA 2JCYA 2OP1A 3QLVA 4RVCA 3RO7A 4F4CA 3GGJA 3B8EA 4YT2A 1DG3A 4M1WA 2I6TA 1MZVA 2QUIA 4MKXA 4WAUA 4F4JA 1KI3A 4J16C 4AM3A 3M8JA 3Q3EA 1JHRA 1MV8A 2I67A 2OBYA 3V8PA 3ZDAA 5IW8A 4GVLA 4HAVA 1P0CA 4XLAA 3BIWA 4V2UA 5K03A 4S0HB 1PJTA 3ROTA 3F90A 3L7NA 4JITA 4OLBA 1Z0AA 1EEHA 3BR1A 4ZVMA 5CDSA 2AQ8A 2QVCA 2F90A 3AUXA 5AKJA 1R5OA 2PKYX 3RDPA 5AM2A 5BWLA 3K4BA 5CB0A 1XD9A 4MQ4A 4BUCA 1HNZB 3K0EA 2HCFA 1KARA 1GHTA 1FC0A 1QH1B 4BASA 3KFLA 5J1SB 3GRKA 2RGUA 4C0QC 5JO0A 2GMWA 4IRMA 3PFWO 2IHNA 4IBOA 2BTEA 2WE8A 1CW2B 2GZMA 3NIGB 4ISBA 2BP7A 3HN7A 4L5EA 2YJ5A 1TJ5A 2Z2XA 2L4AA 5CT4A 3ADOA 3CV3A 3P4UA 3I62A 2E7XA 1YZFA 2CXTA 1DMSA 2F7SA 2L82A 5C8XA 2W93A 3RZDJ 2HYIC 4ZZDA 3DP7A 5GZ3A 1M5RA 1WP4A 4L4YA 5HMLA 2NVYJ 2ZJ5A 4BZZA 4E21A 4U7FA 1YZQA 1Y4AE 3ZEIA 2E7WA 2ZYGA 1QO9A 3CMEI 4OMDA 4XUGB 2VQGA 5DCFA 1ABEA 2QRVA 4V2GA 3HVUA 4QFMA 4Y2XA 4BFTA 1T0IA 5GM1A 2EFPA 4BGIA 2X7XA 4X62B 4HDKB 1Y89A 4BO3A 3JTHA 2L54A 1LVUA 1V43A 3RYTC 1XPOA 4YUWA 3TM5A 3GLFB 1QXSA 3BWGA 2DTEA 2X5JO 3K9BA 5AVKA 4XKWA 4BE4A 5M34A 5JARA 2EJVA 2JJMA 3GBSA 5U4QA 4EB3A 2IYTA 2PFGA 3H18A 5JI6A 3L49A 4LBYA 4XAQA 3TQRA 4BXOA 5CGQB 1SD2A 4ERXA 1R64A 3NFRA 4PHHA 3MM4A 2FN9A 1STZA 3OETA 1L7MA 1RTKA 5T8KC 2CJFA 5AVWA 5HIKA 4PZEA 3H36A 2RHTA 1W0KD 5B2FA 1A9XB 4Z1MA 5ADHA 2DT5A 4MW2A 1Q1GA 3WLMA 4CMHA 2Y1GA 4QDUA 1XA4A 1F0PA 3ADPA 5DYMA 2E6UX 3C1OA 2RV8A 1NC3A 2SKDA 4K6CA 4LTNA 1HDIA 3GY0A 3AYZB 1NN3A 5ILSA 1SEVA 1XZKA 3QUQA 1D2MA 4P81A 1FZPB 1XN1A 1EPUA 2GPNA 1F2UA 4J90A 4JJIA 5DTQA 4E5VA 4PG8A 1BBYA 1L4LA 2W6CX 3KR1A 4XX0A 4ZREA 1YW9A 2YX1A 4CWAA 2COMA 1G8FA 1L5SA 5JXHA 1XR3A 3LWZA 2Z2SB 6ABPA 4P58A 3CIFA 3K8QA 3UAOA 4WKOA 1E62A 1HA8A 4B6RA 3GUYA 4QVGA 3SQDA 2V7TA 3OT5A 5D3MA 2Q4BA 5KTNA 1F6BA 2GM4A 2JAXA 4OLFA 4X66B 3SZTA 3K35A 4ZJPA 4ZK2A 4TYPA 1JE8A 1WXFA 1C8VB 2ZWIA 3PLRA 3WWDA 3KT8A 2XUGA 5AJZA 3H4IA 1XRMA 3VMMA 3VJKA 4XR6A 2TMKA 2WIBA 3L0BA 4PX2A 2C82A 4QOGA 5GONB 3RS7A 4F0JA 5EVJA 3DE3X 2GESA 5DEIA 1NTRA 3BXHA 4DJAA 3I4NJ 1V11B 3K31A 4BNWA 3OWXA 5AW3A 3LBYA 2IEZA 3KYLA 2FQQA 3B6AA 5BY2A 2NUPB 1E6MA 1GUUA 4ZVQA 1BOOA 3SZ3A 5JLAA 1F48A 3EXHB 3IDZA 3WQSB 4BLWA 4OJMX 3G79A 3ZD8A 2W7NA 1HPLA 4IVPA 4NF2A 2K9SA 3D7RA 4CN8A 3BHIA 1IZ8A 4Y3UA 3T38A 4M8IA 5JSZA 4KR6A 3AQIA 3C2GA 1Q74A 4LK2A 3TW0A 1WJ5A 1KZ9A 3A7EA 1BXRB 3IJPA 1UK6A 4ESJA 3GEMA 3QEKA 4HH0A 3SAJA 2O4CA 3TI9A 1QRSA 4DC0A 1MKYA 1QG0A 5COQA 4BQOA 1GPKA 1YBVA 4GBGA 1KIAA 3QV2A 2AUTA 4HDVA 4G0OA 5SY4A 4LXXA 2GBPA 5DSXA 1R5HA 4M3BA 2G3YA 3MUOA 1ND6A 3QYEA 2EFQA 1KI4A 3B78A 4GOXA 4D4MA 5L7TA 1SA0A 4DMGA 3CJQA 1K7AA 1JFLA 3W9SA 5ER6A 4DDKA 1PFYA 2OXIA 2AUNA 1KJIA 1PDWA 3GRUA 1G6HA 1E1KA 4KREA 1DE0A 4M9ZA 2RH8A 3FCYA 1S9HA 1WSAA 3GQVA 4JL6A 1N6NA 2FWAA 2CUKA 2EDCA 3O8QB 4QX6A 5EWLA 2YASA 1RM5A 3ZCOA 5T6BA 1OI4A 3STUA 5DV9A 1D0ZA 1OPXA 5KUTA 3WKEA 1KTVA 2I2XB 4DSOA 5IBRA 3OZTA 2V7WA 1N5LA 1IHPA 2YWRA 2HHCA 3IR6A 4EH1A 5FLMJ 4XIFA 3WHBA 3M6FA 2XI4A 2YL2A 2GJ8A 4I7HA 3HOWJ 1KI6A 2LY9A 3KALA 4CM1A 2P4UA 5C35A 2JTVA 3K96A 4EW6A 5IT4A 3IEPA 4RHXA 3IH4A 4ZALA 3UGKA 1OU4A 2XE8A 1NRXA 4H7HA 5J40A 1Q2UA 4FYXA 3KSBC 2IEAA 2PV7A 3HA5A 5JUWA 4JX9A 1DHTA 1JL3A 5KYVA 3ESYA 4K1LA 1SXJD 3SE0A 1RWOA 3L7DA 1U94A 3TTXA 2XUQA 1RRJA 4KT6A 2B0LA 3KPHA 2FUCA 2ZQYA 1E7YA 2QI9F 3EY9A 1WH5A 1DAPA 5F2OA 1XZEA 4MYCA 3V6MA 1NNI1 4BH9A 1UQTA 2CVQA 4L8WB 3T4XA 1U8CB 5AJHA 3J81K 4DNFA 2QUZA 3CX8A 3PNOA 4DWVA 2ACWA 3B38A 3KJXA 3ZGNA 3COVA 3LK7A 1A9TA 1JB1A 5DRYA 4LV8B 5DX0A 1QIGA 5NLLA 2E18A 2VRCA 2JEZA 4A0QA 2B1GA 4YS6A 3SHQA 3ZUGA 2Y0EA 2VC1A 3CCSI 1E89A 1CSEE 2MW8A 2IZ5A 2QG6A 2ZTLA 4ALNA 1U6IA 4BMOB 3F7OA 5IJ9A 2EP8A 3VR5A 3DOUA 2QKMB 3D8TA 2ZVJA 1H5UA 1Y6QA 2BFAA 2PZ8A 3PI6A 3UK6A 5IZ4A 2XRNA 1MJ9A 3FFWA 121PA 3BTLA 1UZNA 3H5OA 1F0YA 4PPYA 1I0ZA 4PBRA 4KODA 5BYBA 2A05A 4REMA 4EFDA 3GPLA 2M34A 4F04A 5I48A 3IMGA 3CF6R 2BT4A 4DHEA 4G5OA 1FNDA 4QDTA 2FA9A 2BEUA 2JIRA 5ARDA 3OYGA 2RAPA 3I73A 2XNKA 1E3HA 3LF2A 1LDGA 4B09A 3NTLA 2ZB9A 3O2QB 1JILA 3C0KA 3I53A 2X1EA 3OL4A 4XD2A 3ZY6A 4QHYA 4LYYA 3G73A 3EISA 3F1KA 4IJWA 4MS3B 4NAUA 4UARA 3I58A 2KISA 4ZGGA 4X92A 3U6BA 2F8TA 2C4HA 4KLAA 4BL0B 1EFDN 3MWLA 4BVKA 1FSPA 2P6NA 1ULZA 2C9OA 4TYQA 1JYSA 1Z2PX 1M6VB 2F1KA 5A5GA 3EGDA 4X7RA 3DTIA 4P3KA 2FQ4A 3IP6A 4F12A 3PGVA 2B21A 4WINA 1RWQA 4TVOA 5M29A 4QUIA 2R4TA 1N2GA 2DBQA 3GGOA 4K6GA 5EGSA 3IAM2 1KRHA 2CJPA 1D9ZA 2AN4A 3TVTA 3B7GA 2ID3A 1RI1A 3KV1A 4Q82A 2ZCVA 5IH7A 1FJHA 2ZPUA 4R2HA 1NOIA 3E22B 3VJMA 5C3EJ 4AKTA 1TA0A 1KEVA 2I7VA 3REOA 5BYKA 1W0UA 2VNAA 1NV8A 3IAHA 2JJQA 4XDZA 4IMIB 2C7OA 1TTTA 4IM7A 2ETXA 1RHJA 2QX6A 1BC5A 3GX1A 3P9SA 4QKQA 3EPJA 4RB3C 1U31A 3H5NA 4WFIA 4Z2YA 1UXKA 2K9QA 3W8RA 4CQMD 5HRUA 3ISPA 2YH2A 2VRWA 4CQLB 3EUEA 2QRVB 3PQ4A 3GHYA 4MNUA 3I6ZA 4KUEA 5TX7A 3BMOB 4E2ZA 2WE7A 1XMVA 5KDOA 2H5LA 1DFHA 4NZNA 3S0JA 4D43A 3OYCA 4URXR 5ICCA 5DYIA 2FEWB 3VKGA 4RVDA 4PEVA 1GFIA 4YACA 5IAAA 1LEBA 4BV9A 2WIFA 4ARUA 3MHTA 4JFRA 4TN5A 1QGYA 3QKUA 2AR9A 4IEFB 2XGXA 4II7A 2PKEA 4F5YA 3W6PA 2XQIA 3CF0A 4JL8A 3F4KA 4MP8A 3K15A 2X8JA 4PYNA 3ZY4A 1VG8A 4WPGA 4ZO9A 1AV6A 2DULA 3D4IA 1T1EA 4MJ7A 1REPC 5GVSA 1T98A 5EYRA 2WKQA 2E2HJ 3ZHVA 5U9CA 1GPJA 3UHFA 1YI2I 2H6EA 2C2XA 2XOKA 3VVMA 3EPHA 1QH1A 4CI0B 3HR7A 3DAGA 2QGUA 3T99A 3ZCQA 4LV5B 5F78A 1ZX1A 3JPYA 2ZB4A 3QWLA 3U3ZA 4J8PA 1WWKA 3M3YJ 2CUTA 3IKTA 5DYGA 2Y1FA 1YB1A 1HE1C 3ZH2A 1GL3A 2LF8A 2EFHB 3MFYA 4EVRA 3D6MA 4ZEOA 1Y9JA 1LDMA 4D7AA 2NNWB 2SCUB 4P1WA 5B53A 1X6VA 2H4HA 1T13A 3T9BA 2BCGY 1WHUA 2W48A 2PS0A 3WGJA 2VUUA 5ARBA 3GAMA 4XVQA 2ZAGA 4Q05A 1X8KA 2PT6A 4FS8A 4WACA 4Q7LA 3RKQA 5F5LA 3T15A 2BEVA 3UTCA 3GFLA 3MTJA 2Y67A 3MT7A 1B00A 3ULQB 3OLZA 4QYTA 3RRZA 3WZMA 5LYJF 2QVZX 2PSHA 5K5OA 1G5QA 2V9CA 1GQOA 3BEDA 4BQRA 3V7SA 2DJIA 4NU8X 1R18A 4R2IA 3DPUA 4UE3S 2J09A 1ZW6A 2MSLA 3STXA 4HW0A 3T95A 3U60B 2NSJA 5AIAA 1NVXQ 3MXOA 3S44A 2WWXA 2WIJA 4YV2A 3KJGA 5JXIA 3VKHA 2YWGA 1DEXA 1CEXA 4P7FA 2GFIA 4MHOA 2V1NA 5HODA 1G0NA 2J5QA 2R5YA 3ZHTA 4EVIA 5BMVF 5TARA 2QD3A 3K5IA 4W5OA 1XJ5A 2RFLA 1M2JA 1RAHA 4LRWA 1DJLA 4TVBA 1B3BA 2IE0A 1P2GA 2FBHA 3Q0VA 4HV6A 1W47A 2VHUA 4IYJA 1XRQA 5F6FA 2EARA 3CUYA 4L7QA 1J8DA 4O2RA 3VYWA 3NRVA 1JIKA 3T3NA 2X1DA 1RQ7A 1ANKA 4LKOA 1U1EA 3HPQA 4BLRA 1IQ0A 1NLFA 3HJTA 5BSKA 2FRXA 1KK0A 4CYDA 2XZOA 1V8OA 5B1YA 2R0QC 1RWBA 2M5WA 2VKDA 2W2TA 3HL2A 2C1ZA 3A9TA 4IXWA 3RV3A 1GNQA 3TR6A 1BKYA 4C4ZA 2G88A 1PUIA 3BMNB 2IA5A 2GN0A 2VYND 2ZAOA 2WJIA 3L18A 4IHYA 2YYAA 3JCZA 4AIHA 4TSKA 3L9WA 3L00A 3GTPJ 2EW8A 1BE6A 1B43A 2DWQA 2BGNA 1ZIYA 5M5XJ 2MYPA 3BILA 4NNPA 2KIQA 3TLGB 2O2XA 2PUWA 4J16A 4HAYA 1T33A 2CMPA 1DCMA 1H69A 2LMDA 2IUEA 2I1QA 1D4ZA 2MC3A 4CYCB 1KEZA 2C3PA 3A0RB 5ES3A 3WL5A 2OHGA 3DBHA 3WNBA 2QHXA 1NXVA 3AKZA 3AOGA 3FPKA 4WUTA 2NS7A 3GIDA 5CD1A 1NR7A 2UV8A 4UB6C 1KPGA 1XTVA 1UFMA 5FUVA 3T3PB 3VU8A 3VNVA 4M6WB 4XFKA 2AE1A 4BVHA 2E36A 2WINI 3HJRA 5FO0A 2DR2A 2G7HA 1HETA 1E1CA 2H5IA 4RGSA 3CX4A 4JT4A 3ORQA 1B8OA 1MB4A 3JRHA 4HVCA 1NU8A 2XGJA 1T2EA 1TO1E 1JG6A 2VAVA 2YZKA 4JB3A 1RTTA 2O8NA 3SR3A 4C6SA 2BGGA 3IP9A 5EJFA 4E2WA 3EZGA 3FTCA 3T52A 3TGPA 1EEXB 3KSRA 2OXCA 3EFEA 3PM1A 3SXPA 2JFVA 3H3XA 4K8OA 3AGPA 4KMFA 2PEZA 5JMTA 1G6OA 1CVRA 1GZ4A 2W90A 3GLHA 3ZEAA 1QIHA 1X8JA 5HYVA 4Y33A 1E5TA 4M9CA 3L0YA 1YITI 3QKRA 4BCCA 2J0SA 3ACBA 1I9CA 1MBKA 1J0RA 5L7YA 3AX6A 4RY9A 1CQIB 4PN7A 2DAOA 2O03A 2AVDA 2FPPB 2WPNA 2F4VB 1GXPA 1R36A 4QPOA 3ZPLA 1D09A 4JUAA 1LPAB 1XDUA 1ORHA 2IYEA 2GF0A 1EP3B 3G8AA 3GVPA 3HFJA 3SLRA 5KI6A 5ALGA 4D8VA 4E11A 2UYGA 2ZSHA 4IOKA 4PNPA 5FNVB 4KOEC 4C78A 3T1NA 3T06B 3CSDA 1D8AA 3G68A 2W2LA 3R3ZA 1U7UA 3H7AA 2XKAA 3IV9A 4K9RA 2A3SA 1KORA 3BTVA 1TP4A 1AE1A 3FBIB 1N9GA 1T9DA 4L75A 3S1AA 2J9RA 3QQPA 1D1CA 1QRAA 3Q85A 5DGHA 1OAAA 4YC7A 3KKNA 4CE6A 5JAIA 3RSGA 5BV1A 2LNDA 3CKLA 2IV2X 3VV3A 2JFQA 3VR2A 4Z8XA 3K5HA 4KE6A 2ZM5A 2DFHA 1EFVB 1PGPA 3DEAA 2XLBA 5F1JA 3MCTA 4LCEA 4UFPA 5B6JA 5CFMA 3UPUA 4HXGA 4BO9A 3EF0A 4ZTZB 4U3JB 6NULA 1TT7A 2E0IA 2PYIA 1FUUA 1Y98A 3D7NA 1LFDB 3IAS2 4QNRA 4YFVA 2PU7A 2R8RA 2AF4C 4GUDA 4DF3A 2FSWA 4LQLA 3RI3A 1LJ8A 1MEJA 1S3FA 4MDFA 4HX2A 3PJRA 1SQFA 2E34A 1CC1S 2ZBVA 3FLMA 4LGCA 2HJRA 3H9BA 1D1AA 4EQZA 2QUHA 2Z8YM 1FDSA 2C99A 3BC1A 3NEJA 2E5NA 2R5YB 1BU8A 4IOMA 3G1LA 2IT1A 4O5AA 4HB0A 5DM2A 4CLDA 2DA6A 1XEXB 2H1SA 4EB0A 5KTYA 3N0TA 2HPVA 4C9BA 3MT0A 4ETSA 3KQYA 3SJUA 4YCSA 5B6IA 3K7AJ 1A9PA 4FOTA 3WVNA 1AZSC 4A0FA 3CM0A 4NZMA 2QRKA 3MILA 4YFYA 3SQOA 1ZCFA 2O07A 4CDRA 2X14A 5IVPA 3OIQA 2CL0X 1G4DA 1RACA 4M6XA 2BY4A 4EHDA 2ZUTA 4ZFNA 3RSLA 2NSLA 4TMTA 1Y7PA 1Z77A 5LR6A 4BEHA 4U6SA 4KH1A 1QO0A 4OJQA 4J19A 4HNAB 2K7LA 1QHNA 4UNSA 4B31A 3IUBA 1GGVA 1X8XA 5JHHB 1ZMRA 3FLAA 4KU4A 5CIYA 1IHXA 2XXJA 3TO5A 4BU0A 3QEAZ 1UAYA 2H1IA 2AN3A 4L5IA 1M66A 4NZ9A 5IBPA 3JQGB 4YRPA 3UCXA 3F67A 3MCUA 2FZ4A 2Q50A 2R1ZA 3OQPA 3OTWA 5JSYA 1U7OA 5K51A 1NMSA 1JHYA 1Z4IA 3FYUA 3PITA 1E2QA 4X1IB 5I8PA 3BQMB 2F62A 4IG9A 4QRDA 2FEAA 3IRUA 5BV8A 4G63A 5REQA 1TQHA 5JJKA 2VDWB 5DK4A 5TS3A 1MNAA 2I10A 3WZ2A 2EKDA 1I9GA 1QU3A 1NNLA 1PE0A 2GLTA 2HJ9A 2ZIZA 4HFMA 4UHJA 3LCMA 3R7BA 4JEMA 1E4YA 4HH1A 1LU9A 1M8FA 3D1LA 1KDOA 1CQJB 3JASB 2GJ9A 4TWZA 5FR2A 5T4BA 3ABSB 3PC4A 1ORWA 4BMNA 4C08A 1X1QA 4ND2A 1JT0A 2B35A 2VDLB 2QLBA 3Q9LA 3FDYA 1FFSA 2CN1A 1JU3A 1HL7A 2ZT8A 4PQRA 4DA6A 3KVNA 2WSMA 1H66A 2PY6A 3AFOA 3CRZA 1RUOA 3B70A 3ELYA 4FW8A 2SNIE 1XA0A 3ELWA 3UB2A 5CLFA 2IZ0A 1HNWB 1NVAA 2JJ2D 4X64B 4J0HA 4J94A 5IJ0B 2K3PA 1VIAA 3L2VA 4FQ7A 3TOXA 3UT5B 2WB2A 4A3CJ 1T9AA 4TUYF 5ALWA 1AV7A 2HSWA 5CYVA 1HTWA 1LW6E 1TMOA 5HF9A 5L53A 4OXIA 2VODA 5EZ6B 3RS5A 1FJLA 1CZLA 5DCMB 5FLXK 1TYAE 3MINB 3TTSA 2KRHA 1XFAA 3SDGA 3G8BA 1GZHB 1Y0NA 1RPWA 1CXZA 2Q3MA 4QYIA 2HKIA 1L8XA 1TK3A 5BP7A 3KJNA 1ZD2P 3THXB 4WZBA 4HF1A 3ELUA 2DFTA 4FHCA 3DB2A 4HDKA 4ZDPA 3H2YA 2A1IA 1W25A 4IS3A 3U9SA 3WYGA 5ITWA 5JXJA 1YA6A 2ZUEA 3HBLA 5K0BA 2X9GA 3RI4A 2DA2A 5HWSA 5L3ZA 1ZUD1 4DA9A 3DNFA 3D6FA 3KLMX 4J2OA 2QUFA 3MRSA 3GP3A 3MMSA 1GPNA 2Q46A 1T3HA 4JQZA 2GBIA 4WH0A 4EKNB 3U2RA 2PQ0A 2WPDA 5FRMA 3GO4A 4OINF 4LLNA 1AZLA 1MD9A 1PGNA 3Q7IA 1QYDA 1VMEA 5DYTA 2RK6A 4IZ6A 4Q4JB 4RPGA 2DQSA 4QFDA 5BUZA 3N2IA 2HI3A 3G71I 1Q1ZA 1CERA 2C5FA 3KRTA 4UASA 4UVAA 4EO7A 5TLSA 5HLGA 3LPMA 1QG4A 1I8TA 5E17F 2EKPA 2C42A 5K8CA 1BC7C 5JW6A 1YFZA 3CXUA 4YIKA 3P9KA 3LAWA 4I5GA 3GEPA 4C0AC 1JEDA 1K3FA 3H99A 4BP8A 2PWZA 4LHVA 2ZXWH 5IAEA 3ZGLA 2UVPB 2Z09A 5FROA 4GFDA 4NYJR 4G8DA 2C4WA 1RRMA 2GTIA 3DKIA 4V0RA 2QP3A 1EVQA 4S2EA 1RMTA 2E1CA 4QVKA 3WU0A 1ZRFA 1DLIA 3N97A 2L02A 1B74A 1N2XA 3R0XA 2R7MA 4XIJA 4ZU3A 3UMBA 4ZIRA 3WIEA 4H1VA 1KQ0A 4ZI7B 1IO2A 2HV8A 2EB7A 4RLQA 3KQPA 3RSNA 3BTOA 3IR7A 4IXMA 4JP0A 3WZLA 3TD2A 3QOEA 2G7ZA 2E87A 2XUHA 1TNDA 2V5VA 2YX7A 3TXYA 3U7RA 1MORA 4O4JB 3W9YA 1C5KA 1ZGGA 2QAIA 3MJEA 4F4IA 4AWXB 2DAPA 4NATA 3ZDRA 4OJTA 3CCBA 1ZIDA 4RMJA 4W5QA 1E3TA 4QT0A 1TQ2A 2EBUA 4MEYF 1CUXA 2FWRA 2QPTA 1GRVA 5DYNA 3TJRA 4WZBB 1BX3A 2CVFA 5GADl 4M8LA 4TVKA 3KKEA 5AKLA 3G49A 4NWIA 2OXTA 2Q3FA 3SKXA 1YAJA 4EIWA 3O4GA 4I1IA 5KQMA 2WB4A 1E7MA 3LLCA 2I3AA 3AVQA 3MJDA 1P2VA 1BWRA 1ZM4A 3MW8A 4R8KA 4DJFC 2X0IA 4ZJUA 3B52X 3VR6D 4AY5A 4KC0A 4YMHA 1WMBA 3EBPA 3OJOA 5M2QA 1SK9A 4EEXA 1O89A 3A7DA 4DR7B 1N5RA 1V5FA 1YO5C 1PYGA 4HAUA 4O6JA 1HG1A 4N3AA 3D1VA 3M4OJ 3Q3JB 4UNIA 4Y67A 1D4FA 1E9BA 5I8WA 1WFXA 2HHLA 2AHOA 4Y9TA 5HIJA 4ALKA 5EZYA 2J46A 1NHWA 2I54A 2GN4A 2QLFA 4OYYA 4RHTA 1K1EA 4DV5B 3GZNB 4D81A 3SS9X 3NQOA 5EP3A 3ABTA 3KFWX 4IHXA 2FSHA 5BQ3A 2PS1A 1W85A 2W2QA 4LK3A 1U78A 2WYUA 3CA8A 3RVDA 5C4JJ 3M49A 2GD2A 4AF7A 2NNNA 2RARA 4A15A 1OT3A 1GDHA 5FUWA 5JISA 1XXLA 2Q1SA 1QP8A 2CNLA 2YZMA 3DW1X 2X1MA 4Q1FA 1NVUQ 5JPCA 3E7WA 4BFSA 4WKCA 4MQEB 3FJ1A 1T8IA 4M8KA 1YUMA 1BEZA 4M0LA 4NEGA 1Z17A 1GZ3A 1VBNA 4B75A 3NNDA 2A94A 5AUOB 2C94A 2JGEA 3ONNA 4IIHA 2ADFA 2C2OA 2QXYA 2PCJA 1GCIA 1J6UA 5ILQA 3RC2A 2WHPA 4WXMA 5EPOA 3OF3A 3IGFA 2AVNA 4JYAB 1IL0A 3NFYA 4X1IA 4DPLA 5G4KB 2FN4A 1E18A 2AYZA 3S2FA 4BBZA 2WFZA 2YHBA 3QMPA 5FT9A 4TYNA 4INOA 4NCJA 2P27A 4BNHA 2WV9A 5AK0A 4AJ9A 4IHJA 5L3FA 4IH1A 4U7GA 4O33A 4JK3A 2GR9A 4FEGA 3RVKA 4MUAA 4KW7A 1P1RA 3IVGA 1THMA 1Q1AA 1U2WA 4DY4A 4ZCIA 1OA0A 1XJWA 2JGDA 2RQQA 2COEA 4OQ4A 4HX5A 4UTNA 4EQ6B 4NARA 3CVYA 2QQ0A 1RRVA 2PPLA 2JVJA 3KWMA 4LK1F 4DT1A 1HE8B 1YD7A 4LISA 4YP0A 4L18B 4CEIB 2BM1A 3OIVA 2X2FA 3ESDA 1ISGA 4YONB 4WJKB 4KPFC 2H7VA 4HNTA 2XUPA 1I6MA 2QM7A 2Z4RA 4ZVKA 1AQYA 2BW0A 2I7TA 2QAGA 2QR3A 3UPTA 1D07A 1G3QA 3FE2A 4RPHA 2B7LA 4PNHA 4WRRA 4INAA 3TL6A 4YXFA 1QC5B 5D1NA 5GZ1A 1VLJA 3KD3A 4IGIA 3QPBA 4NCAA 4N03A 1GKYA 4HPXB 1ATZA 4MP3A 1SMKA 2NO5A 3BWDD 3FHOA 2P91A 1YVUA 2C84A 3I9MA 3K0CA 4UM5A 2D1HA 3VOBA 3ESWB 2ZJ8A 4LZNA 3LZCA 4H9GA 3OV8A 3K0BA 2J5OA 4KAAA 4NFYA 4RJJA 2XXAA 5F1OA 4L9JA 4KNVA 4B4WA 3D2BA 4G0UA 2Q1XA 2RG1A 1XPXA 3IH3A 5CJ9A 2L18A 3UGJA 2GVZC 4G5YA 1TU4A 1V5GA 1PLKA 2FWNA 1JJ8C 4KVZA 4AP9A 4ER3A 1SAYA 3RJZA 2JPCA 4WBXC 4K2HA 1OSNA 3DSRA 3ZY3A 2H06A 3BFKA 3KCQA 4IQGA 4DM7A 5A9SA 2PL5A 1RI5A 2Q1ZB 5AOAA 3H19A 4DBQA 1SKUA 3KWFA 4PZ0A 4JBXA 1G8GA 4G36A 3UQYS 1U8ZA 2IA1A 4OP3A 3NYQA 2ZRAA 2FJ1A 4UBLA 3DVQX 3JYPA 1F2VA 1JFRA 2LV8A 3ANYB 1UINA 5IANA 1MW8X 3N9IA 4MPDA 2WMNB 1U98A 4QPDA 3SSNA 1DDGA 2R65A 1DTWA 3JV7A 3LS2A 3OO1A 4RU1A 2VSYA 4V24A 4Q00A 4Q3KA 1LDYA 1GR0A 3M6VA 3PFKA 3HL0A 4U5XA 1GQQA 4LC1A 4N0MA 3UKJA 2XY4A 4E7SA 1ADCA 1U2TA 5J5AA 3CZ4A 1Z9BA 2CLHB 1Q0PA 3LSYA 1CZUA 3VNSA 3W79A 5JECA 3D4PA 4O2AF 1LVKA 2RH9B 2XB6A 1V47A 2OPBA 4OLJA 3JD1A 1CIJA 3KSUA 4H27A 2JJ7A 5B1DA 4CF3A 4AXBA 3EVZA 1U8RA 3LCUA 4L4SA 4ZYUA 4RL4A 2QLTA 1G8PA 1W88A 2E3JA 1SKMA 4MQVA 1BHO1 1M10A 3ID6C 3OS2A 1X0VA 4GD3Q 1N8TA 4WXDA 4FJ2A 1UC8A 1GLNA 4UTZA 721PA 4C2UA 1U3VA 3T1OA 4WNCA 1NXSA 3P96A 2AFHB 5IABA 2ZRIA 1CRLA 2INGX 2PMUA 4PSWA 1M2VB 3FMPB 3G6EI 1L7NA 1Z7EA 2IU6A 4X1KA 4EF5A 3F8BA 2WV7A 1EFAA 1Z13A 1KQFA 3A1CA 1JVNA 3TFOA 5CKTA 3E9ZA 5K6TA 5D5VB 1D5CA 2ZR0A 2Z99A 1QDUA 3MJCA 3LT4A 4XKBA 4FI3C 2Z3YA 3K2QA 3SE7A 5A2QA 4II3A 1ENOA 1R8XA 4PAWA 3G8DA 1Z22A 1N9GB 1X7YB 1GV1A 2XW6A 3RPEA 1N2CB 4OMCA 2GLUA 3GCMA 5GTHC 2WU8A 4NCXA 4V1CB 1C7JA 3UC9A 3WYAA 5HQ3A 2JSPA 1IQPA 1FRFS 3VWBA 1NC1A 3QU2A 4K6HA 5ED0A 2NSHA 1S7EA 1N0UA 1PJLA 2AMLA 3LUPA 4E1BA 2K5UA 4D92A 1KJ8A 3WADA 1FX7A 3CUTA 3I2FA 2FPLA 4R68A 5KHAA 3H11A 3PQCA 4QDJA 3RUDA 3T6KA 3AB3A 1BOFA 1H4TA 4H16A 5TJHA 4ARAA 2V03A 3HR8A 3LAJA 1G2OA 2J6BA 3P32A 1OZGA 1GRRA 2QDKA 5J4KA 1E9FA 2LUOA 2FI1A 2GYYA 4L02A 1H2EA 1JT9A 2WWIA 4PAQA 4YIHA 1KO7A 3CLUD 3NNNA 3QJGA 2OZLB 1XHFA 2XR1A 2I78A 3CWQA 3EAGA 1DINA 5CFQA 4YPFA 3P52A 6Q21A 5AVVA 1PTKA 4NU5A 4OF4A 4HSTA 4LYAA 1HKHA 2XGDA 4ZV7A 1VPWA 1KAGA 1P0MA 1QCDA 1XTSA 1Z0DA 2XITA 1HE5A 3F71A 3VQTA 5D4SA 1VKZA 3E82A 3LDAA 4KYTA 3VSEA 5I4CA 2NU9A 1WMEA 2X1CA 4DREA 1VE9A 1KK1A 4LFAB 3KT3A 5EGOB 1JLHA 3CH7A 3RTAA 1SFKA 1HORA 3E3AA 2AQKA 1L4BA 3W5JA 2OE2A 1KHTA 1NT4A 3NO4A 4AJ4A 5LD2B 2H27A 1ETVA 3ZBUA 5DZSA 1C9EA 3DFGA 3K8ZA 4KAJA 2H09A 1EQ2A 1T56A 3ZN0A 2PGAA 3K70D 2J0EA 4MPRA 5F21A 3GLIE 2C7RA 3IPRA 4N9QA 1WXIA 2V7GA 4FLEA 4AVPA 1JKIA 4MUJA 4W7IA 3Q7RA 2PSJA 1MGOA 2EP7A 1N9ZA 3FHCB 4Y1GA 4BO2A 2C3UA 2Z16A 2PX4A 1BMDA 1OLUA 4MXDA 5IYDJ 4N0QA 4A5MA 5EHQA 3C18A 5G02A 3AVWA 1Q6ZA 2N9UA 3AT1A 3HBJA 4WBNA 4OHOA 4FCTA 4Y2VA 4L9TA 1P1FA 2XE4A 2YN2A 4NQWA 1X7WB 1QFZA 4C0HA 3IR5A 3BT9A 1B15A 2XPVA 1Z5GA 2FPGA 1V3QE 3GLIB 3LL7A 3GN2A 3ZHUA 2DXIA 3QYPA 3KYCA 2XPCA 3KT6A 3IYLW 2JN6A 2P0WA 4DYCA 3M4YA 4I02A 4GZMA 4M0KA 2A9OA 1XQVA 2C29D 1PT7A 1RQLA 2I2WA 2PWBA 4BDZA 1GEEA 5DJ5A 3NEPX 3SLGA 3SR0A 4HNRA 1ZK4A 3RRNA 2ATEA 2IZ7A 2UVDA 4BRUA 5A2GA 4YAUA 4Q03A 1MC4A 3THWA 4IDGA 2ISQA 3PPYA 4HDNA 4U7TB 1V1MB 4OUDB 3BZKA 5ILVA 5FNZA 3SYKA 3THSA 4AN0A 4CLXA 1G7TA 1PNTA 1SUPA 4B3DA 1UAAA 2A69F 2DFVA 2DQ4A 3P94A 4MVCA 4XB2A 4EGZA 2X8WA 1P4HA 4L4XA 3BBLA 3GT4A 4S0XA 2GCGA 5K3BA 1TE2A 4E5PA 1M2OA 2HA7A 2B7BA 1DGWY 2YNMC 2AG1A 3KUUA 4R01A 2BPOA 1A1VA 3RE1A 3QPUA 3ZZ0A 3EVEA 3MWYW 1VP9A 1KEUA 1N2SA 1X74A 4IOJA 1L5ZA 5DULA 1L9XA 3W6KB 5D6NA 1K6MA 3FWEA 3R60A 4L2IA 2JFHA 4X1KB 3S40A 2EFCB 1GP2A 4BBRJ 2AFRA 3ND5A 4US2R 2NTNA 4N48A 3BZUA 4J75A 2R62A 6REQB 3BGWA 2AOUA 1IF1A 1T0JB 4JOQA 2EFEB 3IESA 3LFTA 1W4RA 1EUQA 4BX3A 2AN5A 3R23A 4RGUA 1ZJYA 1K7XB 2XUOA 2ATVA 2O0HA 4QUHA 4W6QA 1PK8A 4YJFA 4KBFA 4PS1A 4HEA1 1PD1A 4MGKR 4I6EA 1FU7A 2PVPA 5H3LA 5H4HA 2PSFA 1RKWA 4RKYA 3CUVA 2W4QA 3VPSA 4G56A 4PC3A 2YUSA 4BLQA 3ASZA 3CXRA 2W57A 9MHTA 1YBAA 3L92A 1K06A 4BB0A 1E9RA 2O8DA 4FFWA 2NOAA 3IAFA 3TNJA 4MMXB 4JYMA 1J4AA 2KYRA 4RLSA 4IJMA 1W96A 1LFAA 3R0ZA 1Z6RA 3JRBA 4ES6A 1CIVA 4XR4A 3UY4A 3ZI4A 4X45A 1TVMA 3KTFA 5KNDD 3BS4A 2RGEA 1KAQA 2EZUA 1KJ9A 1WSBA 1FSEA 4LOIA 4AW9A 2JHGA 2XDVA 3ZHXA 4K86A 1ULSA 4BP1A 3UAZA 4XGRA 1WQ2A 2VZ8A 4D56A 3HABA 3TG2A 5K8UA 4MUEA 1UG2A 1H0MA 3A27A 1OASA 3I6YA 1UZAA 4IDCA 3GP8A 4H6VA 4KO8A 4CM6A 1TTHA 3PVZA 4YDHB 4YECA 5E1ZB 1VPTA 1KVTA 5BN5B 1F8YA 1MMNA 2C9DA 1BO6A 1B4AA 4QOHA 3TP3A 4PLFA 3AR5A 3D6AA 3P9YA 4ZO8A 4HA8A 1PVVA 4LC9A 4QDKA 4QYXA 3C6ZA 4XWTA 1JIUA 4W5JA 5JXGA 3L9FA 1N32B 1YIOA 2Z2KA 3VR5H 2BYTA 1OFGA 1T3LA 3O7WA 1WRBA 3LVQE 3L8DA 5AHWA 4XLFA 2XGMA 5E3LA 5AUQA 4IIUA 1Y4SA 1RBQA 3L02A 4L16A 1QP7A 2YN0A 4AN4A 1SXPA 2OV6A 3Q0EA 3VVLA 4JVNA 1R00A 1T6YA 1TF2A 1PR9A 1UJBA 1XEWX 1UKCA 2JRCA 3H04A 1ETYA 1EDZA 3OCVA 3ZQ4A 1ZEJA 4CDMA 2O59A 1X7XB 4H60A 4N41A 4WGFA 3T5AA 3OFSA 2L9NA 2VJJA 2V9ZA 3SHWA 5JI2E 4OM8A 4DV3B 3JVVA 4XONA 3IV5A 4EUSA 3JZIA 3NBZC 2G9NA 3QXGA 2P2LA 3DMGA 4MRVA 2OORC 4JNKA 1CQIA 1HF3A 1WA5A 4KXVA 4ZAWA 4DLBA 3KQOA 2I6QA 1OCTC 1QIDA 1ESCA 2CBGA 2FGKA 1QGAA 1V26A 3WTBA 3ZHBA 2J87A 3FJOA 4AZSA 3DR3A 1DBSA 4LEIA 5AWFC 2J3HA 1XVVA 5TVGA 3FXOA 3PNQA 3OT4A 4HZFA 2ZIXB 2HU9A 3FUXA 2CRGA 1H5NA 2C59A 4MJ3A 4CCYB 3AR6A 3LOUA 2VHEA 4BFWA 4DQVA 2ANBA 3FNFA 1SCAA 3NHUA 4AYXA 4P4UA 1H8EA 1Y8CA 4OPMA 4CZCA 1FRNA 2QM8A 4I99A 3VU1A 5LOVA 3E7XA 5LZ4A 5CAEB 2Q07A 4QBFA 1USSA 1VMIA 3AU8A 2H52A 5KAIC 4YJ2A 1EH6A 3PGA1 2COKA 2EA2A 2IPNA 2GRJA 5A0TA 2QL5A 3JCUC 1EWYA 3T0YA 4LZAA 2AZ4A 4UD6A 1B8IA 2RAVA 2NADA 3NUQA 1PEDA 2E60A 1SRRA 3AEUB 2FR8C 2MHCA 3HDTA 4PO8A 1AXEA 3T0FA 4F3NA 1QAOA 1U9YA 3G2LA 1T10A 3V9PA 1E6EA 4YJGB 1JTVA 1VRVA 2KS6A 4A2WA 1KEEA 2ZTUA 2HXYA 3A4MA 3K0LA 3HFSA 4D1QA 2R7KA 2XOXA 2ZIEA 4G9EA 2NZJA 4M7OA 4M98A 3N8NA 4DG9A 2Z2YA 4EOGA 2JCSA 3KP5A 1M1ZA 2O7OA 1S7AA 2GVDC 3OYMA 1PGOA 2Z8ZA 2OXFA 2QP9X 3ZJYA 2JA5J 3WV4A 2IOYA 4REQA 4EGJA 3SM3A 3I4MJ 3Q7EA 4MITA 1F51E 3NLLA 7REQB 2YWHA 3JRNA 3WWCA 5IX8A 2X19A 4L0YB 4BFVA 3M81A 2XMBA 2XPWA 1R6VA 2G0AA 5H5JA 3PV0A 2NYXA 4E31A 4O08A 1T0UA 3EYWA 2O3UA 2EGUA 4S0ZA 2XMQA 3ABIA 2GOMA 1SFUA 1JBQA 2UZ1B 1ZAYA 1E79A 1GPAA 2V74B 4OV6B 4ZDWA 3T4EA 2W6NA 3I09A 1OILA 1FZTA 3C5EA 3OKFA 3P0IA 3QKWA 2XMCA 5LZ7A 1TLTA 2C3YA 3NDRA 1BI1A 4KQ2A 3A1NA 4EKYA 2NO6A 1E5DA 1KYWA 2VPQA 3OOWA 4UU0A 3FOFC 1CRQA 2C96A 1CFZA 4AP6A 5F52A 3LO8A 4KXUA 1S8OA 3IELA 5IVDA 3BH7A 5TSDA 2A5LA 3S7ZA 4RVFA 4GDMA 4B79A 2C98A 3WA7A 1R6TA 2M1XA 4Q02A 2F1HA 4X65B 3WHCA 5FAXA 4ZKEA 3FXJA 2CO5A 1ZG1A 1MEEA 1TMKA 2WG1A 4HYQA 1NUTA 1S5PA 2O4UX 1ZNQO 3ILYA 3KB2A 4RA6A 4YEDA 5DHAA 2FZKA 5JNLA 4HY3A 5I3ZA 1S7GA 2QT1A 1AH2A 1YDHA 3QHPA 4DLLA 3S1SA 2IEKA 3ZWWA 3TDKA 1BI3A 1W7PB 2WRZA 3BWXA 3DVAB 3LSIA 2X15A 1Q11A 1VQMI 3DL4A 2CVPA 3R6TA 4LXGA 4TRRA 2O8DB 2VSOA 5K5QA 1I80A 3BN3A 1GUYA 1RMYA 3BREA 4LQ4A 4MYSA 1EUDA 2KMLA 4RD2A 2R00C 1VPLA 5NULA 1CY4A 2GWHA 1BE8A 2PRYA 3EJWA 3WGLA 4OP2A 2LIVA 3BCUA 4BQQA 3G8CA 2COBA 3DHEA 3SZPA 4MAFA 4MUIA 3FX3A 5TF4A 3USCS 3PTLA