2F48A

Crystal structure of a novel fructose 1,6-bisphosphate and alf3 containing pyrophosphate-dependent phosphofructo-1-kinase complex from borrelia burgdorferi
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
551
structure length
551
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords diphosphate--fructose-6-phosphate 1-phosphotransferase
publication title Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
total genus 199
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 2f48A03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A02
2A33A 3O8OB 4JEMA 3PFKA 3SBXA 2A0KA 4RH3A 5AJTA 2IZ5A 3MAJA 4FYHA 1ZXXA 4I7EA 2PFKA 3BQ9A 1S2GA 2NX2A 3OPYB 1PFKA 4P5DA 1RCUA 4MEJA 2KHZA 4OHRA 4FYIA 4WL0A 1T35A 2F62A 2Q4DA 1WEKA 3K2QA 4LJKA 3F5MA 4JENA 1KZHA 2IZ6A 3UQZA 3QUAA 4FYKA 4PFKA 2F2TA 4HX9A 5AJUA 3O8LA 4JELA 2PMBA 2Q4OA 4A3SA 4OHBA 3EHDA 4LJRA 4I4IA 1S2DA 1YDHA 4KXNA 3O8OA 3U39A 4NPAA 1WEHA 1F8XA 2F48A 2IZ7A 3IMKA 4LJLA 1S3FA 1F8YA 4U1RA 1MTOA 3OPYA 2F67A 4I36A 3O8NA 2HIGA 4KXLA 1S2IA 4P5EA 5ITSA 2F64A 4KXMA 3GH1A 6PFKA 2KLHA 4MCJA 1S2LA 3HNOA
chains in the Genus database with same CATH superfamily
1F2DA 2PLNA 2PUWA 3LVRE 1G5PA 3T94A 2YJ6A 2JD1A 3BD8A 2GPSA 4M0UA 4A0FA 1GGHA 4UVAA 3BM5A 1EWYA 3NAUA 3VZCA 2GLUA 4Y1RB 2DMQA 1U2QA 5DNCA 4HZGA 1KXZA 5JANA 3RT9A 4ZZIA 1FX7A 1SMKA 1D2GA 4WZZA 2EF0A 4IZOA 3QVLA 4AUMA 2YWCA 2Q8KA 3ZY3A 3RF6A 4S0ZA 1WMFA 1WF3A 2VHCA 3VOTA 1FDOA 2IVFA 2FBHA 1LE8A 1N5IA 4JGGA 2AXEA 3ODGA 3HU1A 3LX6A 3QVTA 4RHYA 2IKSA 3PDJA 2UUZA 1DKMA 4OUDB 2E7XA 4M3GA 5LYJF 1THGA 4RCVA 3BHNA 4NS4A 4DZRA 4L9AA 3C5WP 3HJRA 5J47A 1JAHA 5JSYA 3WHKA 5E95A 2KP6A 4BATA 1E0EA 2Y9PB 4EM6A 5DMXA 2CHVA 3NTQA 2XXAA 4RY0A 2ZUFA 2PKRA 1IW7F 2GPBA 4HYQA 2QQ8A 2P8SA 1TD9A 4L74A 4PSCA 1IVNA 3RR2A 4FR0A 2OXEA 3JVVA 1OZHA 3WHCA 2D1QA 4N48A 4UHFA 3WB1A 4ZZ3A 1DDGA 5HNFA 1Y3CE 4OSEA 4AS2A 2O0MA 5JY1A 3DAYA 1N4AA 4CIAA 2PO5A 3FN4A 4IY1A 2PMZN 2OBXA 1B3RA 1F36A 1NJSA 1OFVA 2Z98A 9MHTA 1BGWA 4ERNA 3U4GA 1J9ZA 4L0YB 3V1YA 5BT8A 4ZTJA 1V3FA 4ID3A 1TLLA 2ZJYA 2WAFA 3ZCQA 3MK31 1U31A 4RWEA 1N5KA 1MBFA 3B6EA 1UWKA 1Y1WJ 3CX6A 2ZSHB 1HO3A 1JILA 3KUUA 5L7TA 4D0SA 4FFMA 1MGOA 5F7XA 2XPWA 3JAWA 2ZJRF 3IQHX 4BKQA 3WO0A 5CJ9A 3KPVA 3UNXA 3ZWAA 1BDBA 3C70A 2HQ5A 2L7KA 3OFJA 4L9RA 4Z4FA 2XYPA 1G8HA 2GTPA 3B6MA 5BUSA 1VGQA 2BISA 4JXZA 2LMDA 9LDBA 2YIDA 2I6GA 2CJYA 4TYNA 4DMRA 1UBCA 2HZDA 1UEXC 3TQTA 5EIBD 3MRSA 5ES3A 2QTHA 3AB7A 2PBFA 1OYVA 1CQXA 4L22A 4L78A 4IBOA 4OQNA 1D1AA 4ID9A 2XSDC 4YAJA 4EX6A 2V7QA 1E9FA 2Y67A 1YQDA 3A25A 3T6KA 1BI1A 5IYZA 1OOEA 2PUTA 2VHZA 2NYUA 1QCCA 3HR7A 3NRJA 2ELHA 2XMSA 1PWZA 1UJ2A 1XCOA 5M3FJ 1FY7A 3ADCA 521PA 4AULA 3ZCPA 4RJ2A 2OKGA 1E62A 4BX3A 4G81A 5HVQC 3A4IA 2I33A 1MQSA 2L9SA 1WVMA 3DUFB 4HS9A 2CXXA 4QTXA 1DDNA 1GEEA 3JQQA 1XPRA 2MYNA 4KUEA 1I94B 4QIWN 1W0KD 2J9RA 5E1DA 4DMLA 1CJTC 1TCBA 1DPGA 2WHPA 3FCCA 1TNTA 3RSGA 4MQ5A 2HIAA 5B2EA 4HQRA 4GI5A 2XI4A 1NUQA 4Y98A 4M76B 3TKAA 5TE9A 1VL6A 3LTNC 1SXJE 3EPPA 4RSGA 1QTRA 1ES9A 3LC2O 3IBTA 4GM4A 3L00A 4G1CA 3CLSD 4J49A 1F5TA 2JK3A 3RIHA 2G9QA 1YB5A 1PNQA 1P3DA 2O8CA 1U6IA 4LBYA 4QG3A 2V26A 4CTJA 1WW8A 3PITA 1UBGA 4S0XA 2JARA 1LDNA 3KWJA 2D7JA 1BHO1 2BGKA 3SNKA 1FFYA 5DM1A 1X3LA 3WFZA 1I9CA 4PFQA 4RDUA 1HW1A 5TPWB 4MAFA 2EV5A 2B1GA 3INRA 4N0EA 2UUCB 1TWAJ 3PP8A 2AJBA 4Y2QA 3EA4A 2P3OA 1WDWB 3FUWA 5JFOA 4UVHA 1BDJA 5FORA 1W52X 4BHTA 3CO7C 1Y34E 4IEJA 2EPFA 3GO5A 3OSFA 1H5NA 4YJ2F 4QUJA 2AXLA 3BTCA 4MMZB 1Z4PX 1TWCJ 5LD2C 2G63A 3ZZ0A 5DEOA 4E15A 5EUBA 3V48A 3N6XA 1XC7A 3CS3A 2W2VA 1DTWB 1Q3KA 4XDYA 4F4IA 1YB6A 2ODPA 3G9TA 3F6SA 3LIPA 1YRYE 1EI9A 3GFVA 2ZXEA 2F4VB 1UFQA 2NQ8A 1U2ZA 1FNBA 3WI7A 2ZI4A 1P3Y1 1VLHA 4EF4A 2A07F 3ADDA 1SD2A 4J3NA 1GEGA 3KKKA 4UB8C 3BB1A 1VBMA 1ODSA 3TFWA 1ILWA 3GLXA 1GGJA 3UAYA 1R88A 1J9IA 3JVIA 4K9RA 3HXKA 2INGX 2ZJ0A 3V80A 3RQIA 3QM1A 1G5FA 1G55A 3CR3C 3DBRB 4E21A 3FMRA 3HJTA 1DINA 2EXXA 4A0QA 3S8MA 1KO1A 2IGKA 3CU5A 4J0GA 3OA0A 1NHWA 2LF7A 3HYCA 3FWPA 3K92A 2Y75A 4YIRX 2CLHB 2M30A 2FJPA 1KYTA 2GCPA 4EQ6B 1QIKA 4FB5A 3BMXA 3AL2A 1X1DA 4IHTA 2J32A 5HRCA 1FJHA 2BSAA 4IPAA 4NY1A 2BR3A 3WZMA 3QPBA 2W48A 8MHTA 5D01A 1F3LA 1TCUA 1UQRA 4P58A 4E0BA 1SVSA 2I6UA 4NPAA 2FPOA 1WMAA 3WYEA 4PBRA 2FUCA 5FYQA 3PL5A 3MAGA 3ICOA 2ONZA 4PFOA 4BNKA 3RQSA 1UFMA 3A6PC 5CHEA 2AQ8A 1JFLA 3VVLA 1Q6ZA 4Q4AB 5DHFA 2CKMA 1Y0BA 5EKTA 3ST7A 1RKBA 4BJTA 5GONB 1X9HA 4KJZA 4M9UA 1Y3FE 1AZTA 2NSYA 2BI4A 2JEYA 4HZUA 4E5YA 5EGOB 1ZD4A 5AUOB 3FNFA 2H16A 2DT7B 4P5DA 2O4CA 3MWEA 4RMGA 2BJWA 1QVAA 1U11A 1SU7A 1UPUA 4PG8A 3B3AA 3LXUX 1QVRA 1CUDA 3PQ2A 2QMHA 1IN5A 1GGEA 1D1CA 4YRAA 2IYOA 2XC7A 1JYFA 3F8TA 3PXBA 4LA4A 2RI1A 4ECEA 1H88C 3QFSA 4L8GA 2GSDA 2WAYA 4HN2A 1PJCA 3TW7A 3SZMA 3BJ6A 1HE8B 1RM4A 1ZONA 2EA2A 3BA1A 1FXWA 1TM1E 1U1DA 3DT9A 4TLCA 2QQBA 4RESA 1VQMI 2QX6A 1S0UA 5EQDA 1ZJZA 5AW3A 3B5IA 5JCXA 1XL0A 1KH2A 1XEWX 5DX1A 4JJ6A 2EZIA 4J19A 1AS3A 1M0SA 3CH7A 1T9GS 4RH3A 4PUSA 1AWCA 2Q6TA 4M49A 4O5OA 1QV9A 3EQ6A 4TKZA 3B6CA 2VJCA 1TD1A 1Z0UA 1FQJA 2WU8A 4FFLA 1UBLS 4CU2A 3ZNNA 3NT5A 1VMDA 2CLSA 4MIOA 1P1BA 3EVZA 3MTGA 5F3RA 3D4BA 3HFSA 4KIFA 3D4OA 3NHAA 3USZA 4QT0A 3HBLA 1V1RA 1T9BA 1L7PA 2ZUUA 3DLAA 3STYA 1KJ9A 1OIXA 1L2TA 5E7IA 4C3HJ 5K0SA 1XXHA 3ZZNA 2O2IA 4ZO7A 1BEZA 1AUXA 1ETVA 2L18A 1J1ZA 4ALJA 1LDBA 1ZA2A 1UDBA 2DPUA 4CN8A 1QIEA 2MYUA 5KPDA 4IDBA 1L5QA 4IMJB 3FX2A 2IYYA 5CA1F 5FDFA 3IOYA 4GBGA 3JD2A 1GNQA 1EJ2A 1G8XA 1ZH5A 3K1TA 2B4RO 2MBFA 3QLEA 2PMUA 1G18A 3J7ZI 2QKMB 2D5BA 5DZSA 1Y3HA 4E14A 3ROPA 2ZYUX 2OAGA 2E49A 4ETMA 3D7SA 2B7CA 1F1ZA 1ESMA 2ZXWH 2HAEA 3A05A 4DYQA 4PVDA 2DLLA 1IN7A 3ORFA 1SPBS 1HDZA 4EB8A 2RE8A 1TL7C 3HVKA 2Z3YA 3OX3A 2QGZA 3JRWA 3SXUA 3JCUC 4KEAA 4A3SA 2WIGA 4M3EA 1LJ8A 2PD4A 4LJRA 1BMQA 2VF5X 2I62A 3VRHA 4HVCA 5JSQA 2B0CA 2BGJA 4EYSA 5AIAA 4I1VA 2XMRA 4R40A 4HSEA 3U1TA 5H3CA 4C4XA 3CZCA 3QLVA 2QG6A 3SLGA 5JISA 1XDSA 1DBIA 4J1NA 2CQXA 3HVUA 2PBRA 4Z53A 5FULA 1ZOSA 3BSSA 3H83A 3S2EA 3GNQA 4QTUB 3VHLB 4CCLA 4UUQA 4Z51A 2GNPA 1B74A 1RBMA 1LWNA 2B7BA 4N9QA 4TVOA 1OYIA 1Y1PA 2QTBA 5BYJA 5ER9A 5SZIA 3I64A 3ZTWA 2NTEA 2AHRA 3MS2A 1E58A 2YFHA 2XROA 1KKUA 4EI7A 4XVQA 2PAFA 1AGYA 4GSYA 3TLGB 5DYMA 3K9BA 4Y6OA 1C7IA 1RKWA 5AW9A 4DS3A 2Y69H 2VRCA 4IJMA 4TLLB 4IQGA 3PQJA 1UJNA 3ABQB 3LG2A 1Y4ZA 2Q3HA 2BV6A 4TMKA 3N39C 3AETA 4YCMA 4XSHA 3AR4A 3UMMA 1B6RA 1TAUA 5K6AC 1HYQA 1ZFNA 3LRPA 2PGOA 3EVEA 4JLVA 4MW9A 1UAYA 2KPMA 3R0IA 3RWMB 2ZSIB 3UK0A 4DILA 3TCNA 2MR6A 1MX5A 1FF9A 4FYJA 3RJZA 4PWYA 2DA1A 4WGFA 3EQ8A 1OLUB 5F9FA 3IT3A 3UH1A 4D9FA 3VVCA 4Q21A 1YE3A 1SN7A 2IDZA 1PDNC 3S93A 3ITEA 4QYMA 4GW3A 2E2HJ 3RTGA 2A1UA 4F4HA 4MH0R 4NEHB 5U9CA 5GZ6A 4WKPA 4FM9A 3G85A 3RS2A 1IXKA 4MVJP 2IC5A 4XLZA 4WZBB 1KEZA 4GL4A 3RD5A 1YJQA 4E4TA 5H02A 4Q1EA 1X87A 3CTPA 4G7ZF 3FWNA 4AVPA 4BJHB 3K0HA 2XZPA 3IH3A 4KUHA 2QE7A 1R5HA 4MLZA 2JKZA 3M4JA 2EZTA 1QQIA 3TL4X 3E5HA 4KUMA 1GQSA 1T5HX 1ZRMA 2IPLA 2OYRA 2V7FA 1QOQB 3LI2A 4Z3DA 1ECGA 2RQPA 3ETDA 1SBZA 1L8LA 3DG9A 1XI2A 3CC4I 5I9BA 4ZTBA 1V47A 1R3DA 3KPJA 3NLLA 3DKKA 3L06A 2ZUTA 5EZYA 4IG9A 3A0UA 2CLCX 1K2WA 2OCCH 1T2FA 1KSHA 1A96A 3FPEA 1XZHA 2BE9A 4DUPA 2HTFA 1G16A 4RZSA 1F4VA 2VONA 1NT4A 1UMBA 1ZDMA 4UU7A 3Q40A 4ZAZA 4E7IA 3OCXA 3MJRA 2CMGA 4UUSA 5HA5A 1VBKA 4JC5A 4DXHA 1WKCA 3BJAA 1JSXA 4ILKA 2UYYA 2RIRA 5DCFA 2QTMA 3KWLA 4CL0A 5AP9A 4YLEA 4K6HA 1ZO8A 3IVRA 2HBZA 4DCNA 1Y8QA 5J3LA 1H0KA 3ND8A 5ELLA 3U16A 3MBIA 3OSUA 1G0NA 2OTCA 1Q7RA 5TQ2B 4PRZA 4RGXA 3AR9A 1ULAA 1NMZA 2POCA 1ZWLA 2IELA 4EJSA 7REQA 3C45A 3QITA 5CA0A 3VHQA 1AHPA 3CLVA 3KJFA 2FR1A 1OVMA 3USCS 3CNQS 1A69A 1PTKA 4ZYUA 2D7CA 1UBJS 2NMVA 1I27A 2FX3A 2WD7B 5C3MA 5B3LA 1H4SA 3EBLA 3AJRA 1XRNA 1E6CA 2WUFA 3VZDA 1RYNA 3RUAA 5JXJA 2BGRA 4MYCA 1DQRA 1YW8A 4NFSA 2FSWA 2D2EA 1JYSA 2QSZA 1YAHA 1P9NA 4X1YA 1QHSA 2YX1A 4G67A 2YY6A 5LRRA 1NL3A 3WRXA 1RC0A 2W93A 2Y77A 3P9ZA 1UJ5A 2EWMA 1LA2A 3JQ9A 3RVDA 3DFGA 3BMNA 3G2PA 1CETA 3R4KA 3QFCA 1K6MA 4URZR 3G2KA 4LK1F 4XQGA 4OL9A 5LWQA 4DSAA 4F5ZA 2JLVA 1UM8A 3RVKA 5M5WJ 4OJMX 5M7EA 4ISCA 4GPIB 3QVUA 2VRCD 4ENSA 3EARA 4D46A 4E7OA 3OFKA 1YONA 5LYYA 2A88A 2V7GA 3EYIA 4XB2A 3FUVA 4A0SA 4OMFG 5IC6A 1X92A 3GNTA 1ODLA 2H2AA 3F6CA 1ZKDA 2DPXA 3ER9A 3GLFB 1A7JA 1L4NA 4PX2A 4JJ4A 1VQLI 2WU0A 3TNDA 3IVMA 5AVWA 1SM4A 1P4AA 1FYKA 3PHGA 3QVXA 5K3EA 3ZV6A 1PNRA 4M21A 4YEJA 2PRJA 3RFUA 1KI6B 1BDHA 3JWIA 2KB0A 3RRNA 3HOSA 3ZI0A 3U80A 4P2BA 1IOWA 4O63O 3N07A 2OMKA 4NYIQ 1ZKMA 1D2EA 2WZCA 4GLJA 4I1IA 2O5EA 1AB6A 5TISC 2LW7A 3GDGA 1KJIA 1ZUIA 4B40A 1CHNA 2P4QA 3ZHSA 4YLYA 2OFWA 3N2YA 3TVTA 3QEBZ 3O4IA 4FX5A 3RPUA 5JNTA 2YRWA 5CVUA 4YR9A 4EM1A 1XAJA 5FO5A 2NZXA 1IRZA 2V97A 5CTAA 3M0EA 1SC6A 1SG0A 1PL0A 2QE7D 4ENWA 2BFFA 1JIQA 2DK5A 4IDPA 3RYPA 1J8VA 3UV7A 1CEXA 1ONBA 2A5LA 4GKBA 1H2EA 5CJPA 1YZFA 4FMDB 3X1WA 1VC2A 3IE2A 4IDCA 1F43A 2ORYA 3GFJA 2X0FA 4XOIA 3HB1A 2VCYA 1TK2A 3F2IA 1BXZA 4PSWA 4FIDA 2RC5A 1VZ2A 2NUTB 3LHIA 1ZRNA 3LSKA 1ETWA 4XDHA 3ERED 1EH5A 3TOSA 3HCBA 3VH4A 1E1CB 1THTA 4U2GA 5AJZA 3FNBA 4R8RA 4ZV4A 3BE6A 4C43A 3FKJA 4B3DA 4EFNA 2EGGA 4ND8B 3BIJA 2LTPA 5DS9A 5LDDC 4BV2A 2QYHA 3S2WA 1XDBA 3MIIA 3CMCO 4KLCA 4XR4A 3ORRA 5IVDA 1VHWA 3EGVA 5C52B 2ZQZA 4G0QA 4CMJA 1AKEA 4AYWA 7ABPA 2NVUB 3LYHA 1JAYA 3GLVA 1BEEA 2IHUA 3X1ZA 2H8RA 3RIYA 4FHTA 2VJYA 1P44A 4GP7A 5EIHA 4PR3A 1HZJA 4P0PB 4LCBA 4YUYA 3AUUA 1VE5A 4EMTA 3QLJA 4YPOA 2X7JA 5DF1A 4ARZA 1OI7A 1J0RA 1RXWA 5F4BA 1H4VB 3SQMA 1WXQA 3VTKA 2EQRA 2FZLA 3GGGA 3HDDA 1KIMA 3ZOKA 1W19A 4E2ZA 3GYGA 5E38A 4B1RA 2ME0A 1Z2PX 3ILYA 4IHVA 5LZ4A 4ARBA 3SEFA 2OF7A 1PQWA 3N53A 2RHWA 1ZSNA 1OFHA 3BFXA 4BN4A 1M7BA 3FTFA 3JRBA 4L2IA 2V3VA 1I5OA 4LWZA 2BWJA 1SVWA 1NXPA 1UK9A 1FSGA 1D07A 2PWBA 3LP5A 4RE6A 2JRMA 2GSWA 2JFWA 2HK9A 2W4IA 3LD9A 2R8YA 2OBBA 1YHNA 1JEAA 4B09A 5GOZA 3DUWA 1NKSA 2LE0A 4FPXA 1UC8A 4M9RA 3NARA 4ENQA 4YJFA 1VI5A 2Q6LA 3QY9A 1B23P 4KCGA 3IVXA 3GFBA 3R1IA 2DFTA 1FFBA 1NWHA 4EUNA 4E46A 3THXA 2GJAA 2QMYA 2Q7DA 3HYNA 4F71A 1NONA 3DVQX 4NJMB 2DC1A 4IR7A 1E1KA 1EE1A 2FMIA 4WJZA 5ERGB 2R5YA 3V1LA 1DXYA 3FMFA 4P4NA 3E58A 2ZRNA 1Y0UA 1C14A 3S5UA 3UAVA 3QTTA 3T1QA 1R49A 5JARA 2DR3A 4G8JA 5F08A 1MAAA 4FGUA 5EWLB 2IU4A 1Y56A 1WULS 4FEYA 2HS5A 3FETA 4Q3CA 2M1BA 2RD2A 4P82A 3NHSA 2Y0SA 3JAMZ 2ROQA 4XM3A 1EHYA 1YMVA 3NBXX 1YR2A 4IEFB 4YCDA 4WUTA 1MJHA 3EGDA 2QNRA 2MWMA 4Y2TA 3PKIA 3GUDA 4Y2UA 2MU1A 4QDKA 1JE1A 3AP3A 3F7OA 2DUNA 4TS1A 4KFCA 3AAFA 2ONKA 1RHUA 3UAWA 2H3HA 2WSMA 4GZ6A 4EGSA 4R79A 4BRUA 3QWBA 4CETA 3D7RA 4JQCA 1PJ3A 4D3SA 4B9AA 1EWQA 4A5OA 3RUHA 4R4JA 3SFZA 1YHZA 4YJKA 3ILSA 2QGUA 1VG8A 3DWEX 2RGNA 5J58A 1CY6A 1KTIA 1SD6A 1YDEA 4EATA 3IUQA 3RPUD 4QFDA 3GRRA 2C2HA 4BS9A 3GX1A 1PX0A 1SXIA 2GARA 3JQDA 1YACA 3DOEA 4MV4A 3FM5A 1GGKA 5JALA 2OFFA 3I6IA 1QHNA 2GD2A 2Y0SN 4OQQA 2HRCA 4ZALA 2IOFA 3EC2A 2DTZA 1QZTA 1IQUA 5EF6A 3ML6A 1PYGA 4DIMA 1WUTA 3D8TA 3QXJA 1L5NA 4JX6A 4Q48A 4WESA 3LIIA 3OYKA 4RIIA 1SMYF 3RVPA 1P2TA 2WQZA 3D6VA 5ALNA 1XZIA 2UZIR 1DQSA 1RLOA 1U7ZA 1R0WA 1X80A 5LQDA 4M0EA 1RS0A 2QJFA 1A8QA 2DWOA 4JHLA 3GLGB 1NP3A 1RLUA 4XDZA 5KREA 4LZWA 4ZO8A 1Z75A 3LT0A 2GD1O 4CM8B 1NI3A 1WRBA 4ZU3A 3FMQA 3W1EA 1B72B 1KI2A 1HY3A 4REQA 1YQWA 4B82A 4FGZA 1HMYA 2BHZA 2QUAA 2EX1A 1IYZA 3Q7RA 1QH1B 3D64A 4O5VA 5ICEA 4KXWA 4CO8A 1N36B 4KAXA 1ZJ4A 3LKVA 1QLJA 2ZCWA 2I34A 4UOQA 2AZDA 3PWZA 1OY1A 3M1YA 1R4NB 2R96A 2QTCA 2M5WA 4B7ZA 4AIIA 4DRXA 2I5PO 1KGSA 5HRUA 1XMQB 3WB2A 4C4YA 1H8HA 3GJYA 3CUYA 5CRIA 4IO1A 4ARIA 5ALSA 3JYNA 4OVKA 1XMXA 5I9SA 2WYWA 1F17A 4JQFA 3SFVA 3MB8A 4X1OA 4DLNA 4AY5A 2W57A 4Y2GA 3TMAA 4DQDA 1QQBA 1XK7A 4NZMA 1DVRA 4KV9A 3FM9A 1E99A 2JLUA 1UJ4A 4ODIA 4MKFA 2IU0A 4L7VA 4HYYA 5IC4A 3FJOA 2Z4TA 3GPDG 4A15A 4BMSA 5D3ZA 4H9GA 5AXBA 1T36B 4EZBA 3BQNB 2JLQA 2JA5J 5SZKB 4F4JA 3DEIA 5KTPA 2OC6A 4JENA 1H6BA 1MJGM 1NBHA 3JQRA 4WW0A 2CJPA 5KK1A 5B5EC 3LPDA 5K0LA 3K9WA 1QZXA 1QHHA 4D81A 1RI1A 5JCJA 3CN9A 1R6DA 5J4VA 5A04A 2EJVA 3DV0B 2VBIA 5CDUA 1ECCA 5IASA 4B3RB 4Z7QB 4TRJA 3ZLJA 4DG5A 4CM5A 3RRXA 2VUMJ 3UF0A 4O4HA 2EZUA 2E19A 2IS6A 1VE9A 2XT0A 2CJXA 3QW4B 1QYRA 3BFJA 5CVCA 3G3EA 1TMYA 1G5QA 4Q5IA 5P21A 1VIVA 4DGQA 1NW7A 2HCFA 4RJJA 4FDUA 3PZRA 4HEA2 3UV6A 3W2AA 5CYPA 2GILA 2O2XA 2O8EB 4HRIA 5FOTA 1X4OA 4BNYA 3QQAA 4Z6YA 1PR1A 3E4DA 2R751 2VJKA 1RBQA 1U0EA 4JL6A 1G8SA 3BWYA 2ZPAA 2ESNA 4D6XA 4FHEA 5AR1A 2VJIA 1Z16A 2W6OA 3CZ9A 1KDOA 4CQMA 1OBHA 1RQRA 5LZ5A 1A04A 2C61A 1XLTA 3DPSA 1BC5A 1ND6A 4MI9A 6CHYA 1NG7A 3OOYA 4Q03A 1Q7GA 5DCMB 5AVRA 1CF7A 1NK2P 3R7AA 3BR5A 5FPTA 1MDFA 1P4HA 3JY6A 1JEYA 2PIDA 3C3BA 5K8JB 1ZKGA 1JR3E 3PR2B 3TRDA 1AN9A 3E0XA 4PLCA 3K30A 1KDYA 4MITA 2PPLA 3MEXA 3ZGXA 2RGYA 3U7FB 2A3NA 3OQIA 3FSGD 3S2DJ 1JS1X 2NTVA 3FYTA 2FQ4A 3H11B 2C4NA 2PJPA 1H5UA 3RYHB 1PGQA 4FFOA 1TT5A 3IPAA 1F1BA 4I7HA 3BCAA 4P3KA 1M54A 4MRSA 4JGBA 4Q05A 2K5CA 1OV6A 3EUEA 4UBNA 2FF7A 3MILA 4KFSA 3WJ1A 2CHEA 2PNFA 3IUYA 4U5QA 2Z43A 4ESEA 3LLUA 1MH9A 1BA5A 3O0DA 3RUIA 1A4IA 4TKUB 4EFMA 3BWCA 4RENA 1FZQA 2ZXJA 4XGRA 4RTQA 5K9ZA 2WJIA 1XKQA 2GHRA 2WWXA 4MS4B 2XKPA 1VQOI 3W5SA 3FVRA 2ZZKA 4KGVA 4FETA 1V4RA 1YF3A 4KKXB 3TVDA 3BMOB 3R6LA 1VQ8I 3IHWA 4EJ2A 2JFOA 3DZHA 1AUPA 1GAEO 2Z99A 1ZBQA 1ZZEA 2F8TA 5E6UA 5JXWA 2ALJA 3C5EA 4ZVUA 2IQ5A 4RD4A 4WOBA 4EA9A 4EG5A 5E8IA 3AJ9A 1GYPA 5FOXA 4HTFB 4O4LA 1TZCA 2JH8A 3K1JA 2PS0A 1KH3A 3AU8A 1Z6XA 4Z6KA 3RS5A 1EXWA 1JJ8C 5EWJA 2EBWA 4DSNA 1IV8A 3GEPA 3ITNA 3RVLA 2GFHA 2H59A 3VBEA 2HOAA 1T2NA 5LHHA 4WKOA 1O7LA 4ON9A 4D5FA 4JQYA 2DA6A 4BV3A 4AI6A 1Y39A 4LHZA 5SYMA 2I4MA 5BQ3A 4NF2A 4QM7A 1PT6A 1AJEA 4XUCA 1QHHD 2IPOA 2FFRA 2PLRA 4CF4A 5JCJD 3N3AC 1M1XB 1GVHA 2BFCB 5JASA 3MFKA 1K7EB 5IN4A 5A4IS 3RV3A 2C9ZA 2QVYX 4INAA 1V39A 2LH9A 3G2LA 1UMKA 4N9WA 5IEBA 1XRQA 3OJXA 3C8ZA 4TYWA 1L6RA 2BDUA 2CNNA 4INPA 3OH8A 4AKTA 4DLZA 2G0NA 3IOEA 6ADHA 3CF4A 5FD5A 3D6JA 1PG5A 2ZT6A 4Y0VA 1QU2A 1YVPA 4A3MJ 2YZ7A 1ZP6A 1SAYA 4GOND 4MDFA 2FP4A 3IDSA 2HDWA 1XNGA 2ZUSA 1KRHA 3O8RA 5ENDA 1JHYA 1MABB 3DZFA 2VCHA 1M2VB 1RPJA 4FCTA 4P80A 2DFLA 4OMDA 1VRWA 4MFEA 1SFEA 4CEHB 1CJUC 1Z8FA 4B7XA 2HMAA 4FFDA 1Y6GA 3SF8B 2F64A 3P9RA 4B7UA 1U0HC 4CNQA 3SIXA 2MSCB 1UHWA 4JKOA 2ERYA 1UZMA 2HJ9A 1NQ5A 2P4UA 2VNHA 2YXEA 4QIHA 3CCSI 3S1LA 4I55F 2JCXA 5ULLA 4K40A 4CQMD 3B1WA 1FSEA 5ARDA 3D7KA 4XAQA 3KB6A 3MZYA 3MLAA 4U6NA 4XLEA 3PNOA 4XPIA 2P78A 5AXCA 1WMSA 2E4ZA 2V54A 5F64A 2M0CA 1Z6ZA 2HWWA 3OTGA 4EGZA 1XZKA 2IYUA 4KOEC 2ISSD 3R8XA 2VHQA 4E5MA 4ETSA 3ZY4A 2RB4A 3C6XA 4XWGA 3W5UA 4QGHA 4MWGA 2XTNA 4RGYA 3FMPB 1R0LA 2GTHA 4PLPA 5KX5F 2WMOB 2QENA 4MW6A 3R4CA 5CM2Z 4FHZA 1G21B 1UMCB 5B53A 4BYMA 5D6EA 1A9TA 1KDZA 1P2GA 2GERA 3TGNA 2CXPA 1TT0A 4MQFB 1Q91A 4DJTA 4OTZA 1YE9A 4KZPA 5HLTA 3OZRA 4TVBA 1P4SA 4PLTA 3U6BA 3PPWA 3CMMA 1DT5A 4AKGA 3NBFA 4R2IA 2YJ5A 4LJAA 5ITSA 2ZYDA 4KC0A 2IHNA 1PU2A 2YN2A 2MH2A 3GFQA 1BL0A 2H7YA 3DXZA 3PHJA 1OHHD 4JLDA 4P53A 4PCLA 2C20A 4JSRA 5A4FS 5FYDA 1O0BA 2EZ4A 4I4TB 3B1JA 4IUBS 1JR4A 4WHMA 4D4JA 2R6DA 4C01A 3CLHA 1MZBA 5EDNA 1FB5A 4BLPA 4IF6A 4IIUA 2CE2X 3DOUA 4IL5A 1ZMRA 3L9WA 4XSGA 1HH4A 2CVPA 4QYTA 1Q19A 2WAXA 4BL0B 1EFAA 3EZ6A 2AFHA 5BR1A 5B66C 4ARAA 1AH2A 3S1QJ 1IIBA 3KX2A 1TF2A 3ABUA 2I22A 2CLDX 5HJ5A 3L05A 1LSSA 5DLDA 5CDYA 3RJMA 2HJSA 3T5BA 1S3GA 2ZCVA 4TTTS 4CXMA 3CW9A 1GCIA 3WK7A 4B6SA 4EECA 3SDZA 4P3XA 1C5KA 4DBVO 1V2GA 1FXSA 3FNEA 1TK9A 3A9SA 2CBXA 4X8LA 2WKPA 2Y1CA 2H4HA 5BN3B 1P73A 2X85A 1IB0A 3TN7A 4MWSA 5EIXA 4E4HA 1U5BA 4CV3A 4AJ1A 4IHYA 2Y48A 4MWBA 2D1TA 3QKRB 2FQYA 1D0SA 4R69A 5E2BA 1CUAA 5IF9A 3F78A 5K0CA 3ZUPA 4OHVA 4JYAB 5ERIA 3IPXA 1JQAA 1C7JA 1XS9A 3HEMA 3D3WA 5IT9K 2NNYA 2GHTA 3AB3A 3KT3A 4TRNA 1PUEE 4A3CJ 1Y6JA 1KO7A 3F7TA 2HMWA 1F60A 4AJKA 4QOEA 5IP9J 1FYEA 1TM2A 3E9ZA 2FSFA 2JGRA 4WY8A 1PTJC 1ID1A 5J6XA 2WADA 3G17A 2BUAA 1DXOA 4BJ1A 5LQNA 2PRZA 2YS7A 3AY7A 1L4BA 4RF3A 1TM4E 1G3WA 1JUDA 1G63A 4PPYA 2PX8A 4WJKB 1LPOA 3SWWA 3ZDFA 1U7WA 5LVAA 2TCTA 3HOVJ 3VAYA 2ZKIA 1T4MA 4DHEA 2QJTA 1R8YA 1PJ8A 4LGWA 3A36A 4IGFA 4X3PA 4RHTA 2VOOA 5FXMA 3T95A 1WR8A 3KYIB 3MJ4A 5DUKA 3CUSA 3K6KA 3Q11A 5I48A 4MV0A 1EK0A 4FT4A 2P91A 2IW5A 2O0HA 5G1NA 3MB5A 5LKRA 1GRQA 4MDYA 2H1IA 3WLIA 5MHTA 3FDJA 3KIOA 1U2DA 1UJMA 1XP8A 4MA5A 5DIFA 3L18A 3TYXA 3K0CC 5B1IA 1A3CA 5BOSA 1XHLA 3UMYA 5ABPA 3VUEA 3A1TA 3SC6A 1RYMA 1SBYA 2FSGA 3FCYA 5GPAA 1V8ZA 1T2UA 4GVXA 4WXDA 2BOLA 1KP9A 2FK8A 1PUJA 3A1NA 4P7JA 1M1NA 2JRCA 4L57A 2NXNA 1TU3A 5JJBA 4KQ2A 5E1OA 1CXZA 4YALA 2JWTA 4GT1A 4M83A 5EXTA 3F9RA 2X8WA 4N7JA 1FFGA 1HETA 3IH2A 1OWMA 3JTHA 2C07A 2IE0A 5DI3B 1N9GA 2O50A 3OKAA 1RCUA 3WGLA 4IVPA 2ZJ6A 1DP4A 2C83A 1MMNA 1KI1A 1W93A 3RLFA 1EWKA 2OK8A 1RXYA 3HK2A 1V3UA 3HKBA 3GLRA 1JQ5A 4LC9A 3PHHA 3BIOA 3PEFA 2B21A 3G8BA 1PS0A 4UVIA 1AX9A 3RSCA 1SVLA 2JCSA 2XAFA 2EW8A 3SKVA 4F3CA 1X13A 2SBTA 1RQGA 3MRTA 3QX7A 4FOLA 3IUJA 3FHLA 2F2EA 1M2WA 1KEEA 3WKEA 5C9ZA 2QORA 1XG1A 1TLTA 3JTMA 1WJBA 2DCEA 1JP7A 1W35A 1Q15A 2QYTA 4BVEA 4A82A 1G98A 4X93A 3KFVA 3QU3A 5AO9A 3AINA 3GVIA 4WNAB 3I3LA 4RIFA 2Z8YM 4JDPA 4I50B 4OK5A 1PG0A 4PZYA 2VOPA 4P86A 1JA0A 2C29D 4K9OA 3WOHA 1PFKA 2ZTVA 2QN3A 4LSGA 2B6NA 3VX4A 3ZWKA 1MRNA 2W0MA 1G6KA 4H6WA 1YU6A 1AKNA 4EA7A 3OD5A 4D7MA 4K6GA 1QE0A 1SEPA 3C1DA 1SCBA 4Z3OA 4KOAA 4PAQA 1GDHA 2D00A 5IAGA 5CQGA 4A6DA 1OLXA 3IIMA 4LXQA 1HE2A 1QAOA 2ZM6B 1HL3A 4HL6A 4NBKA 4AIKA 4ZREA 4HEA1 2Q9UA 3H9GA 2HLPA 4XVCA 3D8HA 5GM1A 2B34A 1F9AA 1M74A 4F52A 2QBYA 4CEIB 4IIGA 4AWAA 4CCYA 2GN9A 5G3ZA 4B47A 3FHOA 1XDWA 2ZJZA 4E5SA 1K08A 4ZVKA 3KKNA 3G71I 2C4VA 1M2OA 2R1TA 4CF6A 5JAHA 1F14A 2HX1A 4FQ5A 5ADUS 5AIBA 5TMEA 3FI9A 1NMQA 2W37A 4M73A 1O57A 1VL2A 3R9WA 1JE0A 2NTYC 1N3YA 5B1HA 3S15J 4ALLA 4OB8A 5KHOC 1M6EX 2G0AA 1KU0A 1HDOA 2N1BA 1IZ9A 2I7CA 1E0KA 1XMVA 1DCKA 2RGWA 4HDUA 5BSVA 3QKSA 2W6MA 3QVOA 4QXRA 3OMLA 4ZI7A 4H0NA 8ADHA 1M67A 1H3NA 3Q8XB 2EP5A 4U0VA 4D96A 2QJOA 4N6OA 2Q45A 3KJIA 3DPIA 1Z56C 3GLQA 4AKHA 1CC1S 3EIFA 1R6TA 3TGLA 3NVDA 2ZRHA 2F3UA 4FS3A 3ZXYA 2PMDA 3NEAA 2BHSA 4LQ4A 5F1JA 1G6OA 3GEGA 4I99C 1ZM4A 4UTOA 5JRZA 4CV0A 1E4VA 5C5IA 5AIQA 3SPXA 3KZKA 3OUTA 3V4ZA 4ZCPA 2NO1A 1IRIA 1BXRB 3L1PA 1XUOA 4HX7A 4K81B 3DW3X 3QVGA 4YCNA 4IX7A 1D3YA 4IJVA 4HDMB 2PZEA 3GPCA 2X0DA 4ZYXA 2AOUB 2P2CA 2X23A 1JUSA 2EBUA 3AVWA 3A6FA 1L5MA 4TV8F 5DM6F 5DBOA 5CDTA 1KNXA 1BCRA 4Y52J 1YVDA 1P1CA 1XZPA 4BNDA 2ID8A 3ISTA 4Z86A 3QPAA 4F45A 3WL4A 5TB5A 2R8BA 3KCNA 1YB2A 2SKEA 2IW1A 3CIOA 2NNLD 4DMFA 2YUIA 3B7WA 4B2LA 5L3QB 2BTQB 5DD4A 2H2GA 3C14C 2OHIA 5AKJA 4OX9B 1K6OA 1TLFA 5H0IA 3RFVA 3GA7A 4RD0A 2AFIA 1VCHA 2GVZC 1E8NA 2IK8A 4F9FA 2Y0PA 4LHVA 4O2AA 1CS0B 1D4ZA 1CNMA 3PUBA 3ZYCA 3S2YA 2JAXA 1C3VA 2PWPA 2YJTD 1AUOA 3JVUA 2G8LA 1V4VA 2AKAB 3EXEB 1Z7UA 3H2KA 4LYYA 3ENWA 2NPIA 3KD2A 4N7MA 3WK9A 2J85A 2BEUA 2BHRA 2QHXA 1T15A 2GFIA 1EK1A 3LT4A 2PPVA 1FJGB 2NZWA 1NNEA 3GDFA 5KC8A 5K05A 1ENOA 4E5UA 3VDXA 3ZVNA 3GVHA 4B87A 3DZ8A 2HF2A 1IWBB 2XIGA 3EMBA 3ZTTA 1C8VB 3C4JA 4YDSA 1WJEA 2DKFA 2V7QD 5H2FC 4AP5A 5CVRA 2WT9A 1GZ3A 1HFWA 2IYSA 4YP9A 2RB5A 5IARA 3AR7A 1X0XA 3EODA 1Q1BA 2YWGA 1N6KA 4HP8A 3GH1A 1V6SA 3RS8A 3O8QB 2WB2A 5IX8A 2DA5A 5JMWA 1MZPA 4ZQEA 3F1LA 4R54A 3ZQHA 1S72I 2RV8A 3GZTB 5M3MJ 3MN2A 5EPEA 4IV5A 4IW3B 1XPJA 4B4VA 4CKWA 3OCCA 1D1SA 4B4KA 3EETA 2IS4A 4M3BA 1OWPA 3PKZA 1N33B 3LA7A 3CQ9A 1E3PA 1X1SA 3PO3J 4LV5B 4LXIA 1H1DA 3E5QA 1NU8A 1L1RA 1YTLA 1U2GC 3BORA 2XWSA 3KPWA 5ELXA 5KKAA 3DAGA 2OYCA 5C8DA 4MYUA 1RCFA 5FJ8J 2DHRA 3EEFA 4URHA 1Y7LA 1A8HA 2ZM5A 3TQFA 1AKYA 4BFYA 1TZJA 2L5QA 4EMUA 3QELA 3FNHA 3ZZTA 4F93B 5A6VA 2RH5A 1IJKA 5FLMJ 4HDKB 3O4VA 1XAGA 1KAEA 2C7VA 3E2IA 1GRRA 1Z5ZA 3H05A 4LRQA 3OWHA 4O3MA 2P1DA 3MJHA 2HH9A 4XRSA 4WK0B 3F9KA 2PUEA 3BIXA 1SWWA 1T5IA 1HEYA 2G09A 3ULQB 5B6PA 1WBJB 3U5ZB 2V4ZA 4W8GA 1G8YA 4DLVA 2GJSA 2FRXA 3FGNA 5IZCC 1GILA 4J1TA 4ZT4A 3HS3A 1BQ3A 4TOIA 3KEFA 1A8SA 2KIMA 1LTHR 3WTYC 1L4HA 5TMPA 3UK2A 2P9BA 4I5GA 1I51A 2V59A 2BMDA 3M3HA 2Z5LA 3IA2A 4BO3A 2LY9A 3QIAA 3H3VK 3KKPA 1DWQA 1KY3A 1IUNA 5AUNB 2D62A 5FHRA 2VT6A 2P6PA 2ZTLA 4DIBA 3QJGA 2I67A 1ULBA 4KQCA 1DKNA 3R60A 4CLRB 3NRBA 2M8GX 4A3IJ 3K1AA 1N6LA 1E77A 5ELMA 2KM1A 2VWQA 1EEHA 5HOOA 2O0KA 3QP5A 3CESA 4OOIA 3F3YA 1E1YA 4FDTA 4KMUX 4BB6A 2VO1A 5FO0A 3KKZA 3ETCA 2ZAGA 1GU7A 3LCMA 2E1PA 4MW5A 4R51A 4CWAA 3NKVA 2FW6A 4NK4A 5DNUA 3TQNA 5LA6B 2KSQA 4NARA 2ZDGA 3T12A 4NNJA 2D5LA 5C8YA 4YONB 3CC2I 3C7TA 1M0WA 1KYXA 1P7WA 3PA6A 3CP2A 1VMIA 2CNKA 1W5AA 2I8CA 4EKNB 1I4DD 3SZTA 2OBNA 1FC0A 4J7CA 4M4SA 3JR9A 3NBUA 4BO1A 5MFZA 5L4SA 9GPBA 3N0WA 1G1MA 3ELYA 2F1IA 4YRCA 1W7PB 2Q62A 4XCQA 4AS3A 1VL0A 5GVRA 4ESVA 4R8SA 2WTEA 1Q0UA 1FNMA 1O4VA 1QF9A 2YHAA 3RVJA 4RTNA 3AUAA 1QM5A 1NM5A 2O48X 4YP7A 4DA0A 3SXPA 2Q1XA 2WABA 3KHTA 3L8FA 3LUDA 1MNEA 1RKQA 1XL1A 2XRFA 3QMWA 2BELA 2A5JA 3BR1A 2PZKA 3E3VA 4B32A 3KT8A 2M7AA 3K1MA 2EKLA 4XONA 3AVTA 5LMCA 4H2DA 1DADA 5EJEA 3NBZC 1GIAA 1WJGA 2Z83A 4DQ2A 2Q3LA 3ZTYA 1QPIA 1KS9A 1P1KA 3VJRA 4EFLA 5JYBA 4BMDA 3K9FC 1XWFA 5TEWA 5EXXA 1E6WA 1UJ8A 3RBVA 2CMPA 3JALA 1E2LA 2WUEA 3ZK9A 2RK6A 4NG5A 2PUBA 5BSKA 1FMTA 2H6CA 4CCNA 4X91A 5JQGF 3THWB 4H1UA 4DM4A 4C08A 1RWOA 1FTTA 5FIUA 1RJGA 4CZZA 1ZICA 2FG5A 1KO5A 3VDMA 1J49A 4ETIA 2XDVA 1S3FA 4G0VA 4EJFA 3LSRA 1G7CA 4I5IA 4MWDA 3SJAA 4YMSA 1IBLB 3PJGA 1XRPA 4L6CA 4IYJA 1DKOA 3KWFA 2HVSA 1PAUA 4LMBA 1TVKA 3KJQA 3FDIA 2ECKA 2G72A 2WR8A 2COKA 3PYXA 1T6BY 3TL3A 4LJ5A 2FUG2 2BEKA 3ZCVA 4N03A 1SQ6A 3E8SA 3AVUA 3R40A 1YNSA 3IBSA 5D5HA 5IKEA 3LLMA 2QEQA 4Q39A 2OUMA 5E3HA 4CTOA 1OLOA 5KYWA 2Q3MA 4NFYA 2A78A 2Q5HA 3O2JA 3EOZA 2R44A 2G7MC 3HA5A 2FEKA 4ZMRA 2AC4A 2B37A 2FQWA 2Y1DA 2HLNA 4BP9A 2ZJBA 1LK7A 3AV0B 2E37A 1OKRA 1QYCA 1B0UA 1VE1A 1TB4A 4R98A 4D9CA 4UTZA 3G1UA 5I9TA 2RHTA 2XAAA 4URVR 4CKEB 1N7GA 3CFYA 1TCCA 4CLHA 1QC5B 3JWPA 5K0BA 3AG5A 1AZLA 5EZQA 3L5KA 3U2RA 3BQYA 1YBMA 2GI4A 1NF2A 5SY4A 3H9JA 3N8HA 5B58C 5FLXA 2GH1A 1WCV1 3LGAA 2F4IA 1X4PA 4LC0A 3EZ2A 2PKEA 2DFKB 2BH2A 2AN9A 1E9CA 4K3VA 3ISPA 3A4TA 2AC2A 4HB2A 5HNHA 1HSTA 3NHKA 5CK5A 1LD3A 2XB0X 4BMZA 4MGKR 4X1EA 2AYXA 4UW9A 5HZMA 2C5EA 1PZHA 4C4PA 5D6FA 1L7MA 3DJYA 3TEFA 2AH5A 1ZU4A 4MHGA 4FXOA 4BV9A 1EM8B 1YDGA 2YYSA 1E3WB 2JHFA 3HFJA 2I7XA 3WGOA 2YJZA 4IV0A 3SFTA 1X1BA 3O8GA 2KE5A 5DLQC 1IV6A 2E5ZA 1OAAA 4OQLA 3R3VA 2DQLA 1IJWC 3PF8A 2JBWA 2NU8B 3G7UA 2DZDA 3E1GA 1TM7E 2HHAA 3FF5A 1K86A 3FLMA 3D6HA 4UAJA 3BTVA 4QBGB 3H3UA 3UBMA 1RRFA 1DRKA 3OLQA 3HL4A 3RVBA 4PFPA 3HQ4O 3KYBA 3QNUA 4YIKA 2V3CC 2HK8A 1VYUA 1QZYA 8GPBA 2M7BA 2HFJA 3U5TA 1M5TA 4QREA 2Z5FA 3ZHBA 4H16A 5AKYA 3FRIA 3HP4A 2ZAIA 1I7LA 1EK6A 4YAGA 4V0LA 3A7EA 1JLMA 1YS4A 1IAVA 2HGCA 1FPMA 2AVDA 2MSNA 5JZVA 4GM1A 3ZPXA 5I4CA 2R7TA 2R7VA 2C82A 721PA 2R6HA 3DHVA 3KYDA 1CPYA 5ADVA 1VMKA 2ZR0A 2CFTA 4N49A 4YBRA 4C4ZA 5CK4A 5BSMA 4X7PA 1JGSA 1ZPDA 1TYDE 1EH7A 2EDAA 3JQCA 3FAZA 4B3CA 1HEUA 3RYFA 4AJ2A 4D57A 4P1ZA 5AHKA 3UTCA 1KYIA 4ZRNA 4BNNA 4XCXA 3WTCA 4Y2PA 1D0IA 3N5KA 3W4JA 3HU2A 3UR3C 2XUJA 5ENVA 1HYHA 1Q7BA 2R8ZA 4RJIA 2VN8A 3CV3A 1SVOA 5EHXA 2A0KA 2V1XA 1QH0A 5K3CA 2QZ4A 1KZ6A 4M0PA 2CYYA 2ZRIA 3K4HA 1JE8A 1IO2A 3TW4A 3OQNA 3QJYA 1DX6A 2AQIA 3WAKA 5K7ZA 4FASD 3GXBA 2G7UA 4QGAA 2FW7A 2XW6A 4LLGF 3SP1A 2ZWAA 2NO4A 3WJ2A 1DOZA 4K28A 5BNWA 2LKPA 3K09C 2Q5IA 4XYMA 1VM6A 2C1EA 5JVDB 4IO9F 5ITZA 4J94A 2QTWB 5HIIA 3Q1KA 4BV8A 3GEZA 3P9IA 1E18A 4IIJB 1U7DA 3HO8A 3HKEA 4G4IA 5FTNA 2XRMA 5A9RA 3ABZA 5KTMA 3FNGA 3AKEA 4LXXA 5H59A 4UOZA 3GIDA 4U9UA 4TTRA 1TYEB 4EUEA 4XFKA 1PX2A 4CUGA 2H85A 3A10A 4LB6B 1Z0JA 1WZNA 3IEPA 1RWNA 1WL8A 4LX8A 5E3LA 3PRHA 4S0HB 1RYHA 5AVUA 2QW1A 4BVAA 2VKQA 1QHIA 4MIEA 2Q9AA 2R7ZJ 1BHQ1 4FC6A 3A1SA 4MPPA 2XCIA 4EY7A 4ZAWA 2H9IA 1DKPA 5JYDA 4KYIB 1I50J 1YRAA 1HT3A 1TFUA 3LYLA 1RXEA 4LFCB 1ZAKA 1RUNA 4V1CB 3JTEA 3Q9LA 5E1BA 5LFAA 2PXAA 4I9FA 1ZNYA 2BEVB 3P4XA 2HGSA 5BSGA 4XPZA 2FWAA 3H2HA 2YDYA 1WSAA 3CA8A 5G0SA 1D0XA 2P0AA 4K5QA 4JBNA 3PIPF 1RRMA 5EP4A 4EVQA 5AW6A 3V1UA 3BDVA 1QK4A 3T1VA 4IHJB 3EZYA 3K2ZA 3WWPA 3TUJC 1N2CB 4TXLA 3SHWA 1PYOA 3RGWS 4WBNF 1Z15A 2NVWA 3FHTA 3T52A 3Q98A 1OR8A 1Y7IA 2J3LA 2L82A 2HQRA 5JFGA 1G7RA 2A6HF 2D59A 3T0FA 4AJ9A 2Q5CA 4CIXA 1CX9B 1BO6A 5HS6A 4IOCF 4JHXA 3L2VA 3WLOA 1H2XA 4J9UE 5H16A 4A1OA 2VYQA 4RKQA 1U9OA 4XSZF 4Y18A 3KE9A 2ZSUA 4MGZR 1TPYA 4LGYA 3B8EA 4F5YA 3T61A 4RAZA 1A5SB 3VVMA 4Z0PA 4EYOA 1IMOA 3BQMB 1YH3A 3WRYA 5T3YA 3IPCA 1OSNA 2FMKA 3R6DA 1MMAA 2A9KA 1BW6A 1DV1A 3I6QA 3K1NA 1QF6A 4UM5A 1SC1A 4TMXA 4KFTA 2GEUA 2OFXA 4M88A 3GTLJ 1TXGA 2PUJA 5JFRA 4EZEA 1STOA 3DVAA 1W85B 3JTGA 3LUCA 3CLRD 2PT7A 2BJHA 1A98A 3ECSA 5MDHA 4CXFA 1N1MA 3HPRA 1N5JA 1FVFA 2PU7A 1U2RA 4D44A 3IMFA 5E7QA 1UXHA 3S7TA 3WHBA 5SV2A 1TQ2A 4IXDA 5C4JJ 1B59A 1Q0HA 3UHFA 2H92A 2C2YA 2L3DA 4OQDA 1PV4A 2JHCA 3KP2A 1WCXA 2JLWA 1SQFA 2FNAA 2P41A 4IDDA 4MVXA 2NZYA 4MUEA 5ECWA 1FX0A 4L7QA 3D7LA 2RJNA 5CFRA 1UCFA 4OBWA 2GZDA 3ED5A 5C46F 4LJ8A 4WIAA 1T9ZA 3K4JA 2V74B 3BY6A 1MPTA 4K46A 3CVXA 4DPMA 4MUFA 4IQ4A 1T26A 2PJRA 1A9XB 4OA5A 3HZZA 1BHJA 4QHSA 2YMMA 4X7RA 3PR1A 4LITA 3IP4B 4K88A 1WSDA 5KJFA 5GINE 3ZY5A 2CE7A 1DKUA 3DLLF 2O8DB 1LTQA 3LF1A 4DLWA 3KE8A 2WVHA 1BMFA 4A8JA 4D4MA 2QQ0A 5AFSA 3GFRA 4N6NA 1L4GA 2XNDA 1WH7A 3RC9A 1UXKA 4H08A 2A35A 3KTFA 1YQQA 3NS7A 2FEWB 1PL8A 1RZUA 3GGDA 4OHPA 3K2QA 2NIPA 3KSBC 1XZMA 1QG2A 2G8NA 4REMA 2A9OA 3BXEA 4PLWA 4U9IS 2GM9A 5A7FA 1U3CA 4JBAA 1SZPA 2NSDA 4IDAA 3TNJA 4PLZA 3WQHA 1Z9CA 2JA6J 2ORIA 2XASA 5K0ZA 3WGUA 4JBYA 4W8OA 1RTTA 3HOTA 2DLNA 3K71B 3HZOA 2FZ5A 3H8VA 2ZOSA 4PINA 1YMQA 4UKDA 3LX8A 1ULHA 1XJ0A 4O4JF 1CQZA 4P35A 5LQRA 1JKIA 2RJ3A 1VCMA 3B1ZA 4DNOA 5G0VA 3WDMA 1ORRA 2AOWA 2XQGA 1KU9A 4NBUA 1Z45A 5JLAA 3V7NA 2QAGA 5KYXA 4J7UA 3DE3X 2JD2A 4KMRA 5DN9A 5TGZA 2ZUEA 4UVDA 1ZXXA 3X1XA 4F11A 3K6SB 4U0JA 3DEWA 3K73O 3Q3SA 5IT5A 2VDKB 4ADSG 3B3FA 1T4CB 3L7YA 3N0VA 3X3HA 4G85A 4KREA 1EDZA 2BY3A 1X77A 3H13A 1QZZA 2QZSA 2D4AA 1IUFA 1IAQA 2GOXB 4GOKA 2P90A 1Q92A 4DCMA 1C3EA 1X9GA 4GOJA 3ZYZA 4LHEA 4Q16A 1PW5A 3GP8A 4CG1A 3J7AY 2Z8ZA 4HMPA 1ZC4A 3RYCA 3MA0A 3LKZA 1H8EA 4CA0A 4FMPA 4U9HS 1MIOB 2Q5FA 5LDGA 5F78A 3FOEC 1VKOA 1XMOB 4X20A 1ILEA 4CEJA 2PFGA 2RAPA 1XEXB 1U5TB 3RT7A 3I0ZA 4XQFA 1HT0A 1V5IA 4UUTA 5LLQA 2BVLA 4DR4B 3HVHA 2JUGA 2QZ8A 3W6KB 4C05A 1NTRA 2EWNA 3DV8A 5C3UA 4FLMA 1VJ5A 2AR7A 3U3OA 3BKWA 4EHJA 1HF3A 2E35A 3RG2A 3ZGZA 3T3GA 1PF7E 4ZYTA 1YOVA 1ZM7A 1R6RA 2RBKA 4KQWA 3EUHC 1QOZA 2R48A 2X0KA 1FT9A 1Z6AA 2OA0A 2Q8NA 4PNZA 5I3CA 2JAOA 1ETOA 2A57A 4PG6A 3R20A 3WLSA 2JEOA 1JA9A 3EHDA 1US8B 2E5NA 1TW2A 1EDBA 5ERXA 1HBJA 5EE1A 1H0HA 1R00A 2Q1WA 1WB6A 3MD0A 1TKBA 4JP8A 1W96A 1HRDA 2OP0A 2HCTA 1L8AA 2BC9A 3WO1A 3EXIA 3STXA 2XXJA 4PCAA 3U44B 3EQZA 1XD7A 1E3SA 5DMHA 3SX2A 1SZCA 4EJVA 1SR8A 5FV4A 4F6RB 3W34A 4RYLA 1XRMA 4UEOA 4ASUA 5EKUA 3P26A 1U7OA 3PX2A 2JLAA 3HJGA 2CW8A 2JFFA 3U60B 1KJ8A 3MCVA 3UCEA 4RK1A 4DANA 1DFGA 4QULA 4BIMA 2JAUA 5FO1A 4LE2A 4S2UA 2UVPB 3OU7A 1POXA 2ETXA 2PXXA 1RADA 3KZZA 1I1HA 2WU1A 3I55I 2C2OA 2P3QA 2VZ0A 3ZHZA 5AI6A 1BMFD 3ELWA 4LY3A 1A71A 2XNDD 2PXCA 1YJ8A 4NJEB 4R9UC 4LXGA 4PANA 1NVTA 1Y7HA 3C6YA 3QE2A 3QYAA 1ZESA 4IRHA 1WEHA 4KWEA 3KU1A 4DV4B 1PZMA 1PJAA 2A84A 5KNDA 3AR2A 5HODA 2E82A 3NUGA 4M8NE 2BAGA 3DUFA 4NE7A 5DDGA 3T3NA 1OCRH 1O96A 5JMOA 2IDMA 4AN0A 3I76A 4ZICA 4XQCA 2PKQP 3KKMA 3MC1A 4X95A 1EESA 5ADHA 1YA6A 3C7DB 1RP7A 5CR9A 5ARBA 2FHPA 3H9BA 4LRSB 4Q1BA 4C4TA 3GJ6A 1MH3A 4RJTA 2B2XA 2RHHA 5LLSA 3FBWA 1QB8A 4P4LA 4BLOA 1DAKA 1MC8A 2P30A 1AD2A 2DF8A 3NCTA 2H57A 1FBQA 3ETNA 1XZQA 3N0XA 5K0TA 4R1UA 5J1TB 3C1AA 3F3MA 3IHTA 1NE2A 2Z2IA 4FILA 4P4TA 2PEZA 1XVTA 4WF2A 4NYIR 2JANA 5A2QA 3PG5A 1EVLA 2XQJA 1T29A 1UKCA 3AK4A 1I2CA 2ZVJA 3RABA 3EGXB 3W05A 4WE3A 3WYBA 4BL5A 5I8WA 1D5CA 3HWSA 3IULA 1C7QA 2YV4A 2GM4A 3E35A 4CT0A 4U39A 1WDLA 4RLQA 3V2UA 4AM8A 1KI8A 3JRHA 3TD2A 1ETYA 3LFHA 4DOMA 4LG3A 3SVTA 3HRMA 4TSKA 1JKRC 5KOJA 2NACA 4JJEA 2DB3A 4GPD1 1H8HD 5G4LA 2P2ZA 1G7TA 4X6YA 2HCBA 4JWTA 5THQA 4QT4A 4COOA 2H4XA 2GPTA 1JMKC 3C85A 3QWIA 4B74A 4HDAA 4KE6A 5IPFA 2ZIUB 5EXSA 1IB6A 1H8ED 5CVIA 3CCJI 2R7XA 2XVYA 4HO1X 3QE0A 5JD4A 4LJKA 1PZXA 4MR7B 1MC4A 4LY9A 2LV8A 3Q3IA 4W5RA 4X97A 1BIBA 1E96A 3ZS8A 4W4TA 3CKMA 3LCJA 1NE7A 1DO8A 2Q4OA 5A4MS 3ZJVA 1MO4A 1XDGA 1WHUA 3UIEA 1Q1NA 5HMLA 1JBQA 1ZUNB 3WXBA 4DXAA 4MRMA 2FZWA 1I4OA 5JDIC 4DR1B 4GKAA 4R5MA 5TF4A 1P2DA 2IZ7A 4S3MA 5JH7A 1CIJA 4NKRA 3F6RA 4DYRA 2UXBB 1L4FA 3RK4A 1INLA 5DHTA 2Y0DA 4OCZA 2WJPA 4KTVE 4L5CA 5T8KA 5T6BA 1TYZA 4OD0A 3D5LA 3ZQQA 3ZBTA 1R16A 5A3JA 4I1RA 1SRRA 4CZ2A 4DLAA 1TWFJ 4H3HB 1JZSA 4ZQBA 1A9YA 4WY5A 4I5FA 3VPAA 3FMOB 1K5PA 2BBSA 3PTAA 4EQ6A 2I66A 2IYVA 4S05A 2IX3A 1GD1O 2G83A 4QPZA 2QROA 5KOYA 1T5OA 2WMYA 2EFWA 1DWUA 4N9HA 4KRGA 3W3CA 4BO7A 3WKCA 1Z6QA 3DO8A 1G3IA 3HL2A 4UHDA 2GJ8A 4ASUD 3PPVA 3HKCA 5M5XJ 4IFEA 4WKNA 3IP3A 4JYBA 5REQB 2RSLA 1GQYA 3I45A 4Y15A 2MSKA 3TOAA 1RXCA 3RVRA 3E9MA 1OBVA 1XKXA 4BNMA 5HUQA 2ADMA 4RTSA 4J2TA 4ITRC 2GM5A 4JNCA 1U3FA 3RC3A 4JX4A 1M0EA 3SQNA 2R7RA 1CR6A 1PR2A 4CYDA 1ADCA 5K99A 4KB5A 1USSA 1N2OA 4R71A 1UOQA 2V6FA 4G41A 2N75A 3GRCA 2P4WA 1ACLA 1FS6A 3CUWA 3PFFA 2XITA 4BNGA 1THZA 3W8RA 2ZULA 4PO9A 2VUHB 3SICE 4X3CA 3MGGA 3PDIB 4DQXA 4PO1A 5JS1A 2QNBA 1WQ2A 3NEYA 3GVPA 5CLSA 1Y7TA 1J1IA 2VP3A 4YR7A 2YOFA 3LRXA 1F8FA 3WGNA 3BF7A 1OFCX 5K7FA 4N8DA 4P31A 4TLAA 1NFRA 3H5AA 1CULC 2B8WA 2XB4A 3UGKA 3NASA 3AERA 1VNDA 1E4EA 3U4CA 4Q47A 3RBZA 4TXMA 1IBRA 2W58A 1BWSA 3I56I 2J4CA 4TSFA 3DE6X 3A1VA 3JARA 4DWWA 3NBMA 1A2QA 2FQ3A 1C30B 5ALOA 4RMIA 1BE8A 2FMUA 3ZNPA 2PMEA 1NXTA 4RANA 5J1UA 4HDNA 4FDLA 2PG3A 2ATIA 3ZH2A 4NMHA 1Y5LA 2JGLA 5EESA 4J6EA 5LOVA 1L3IA 2BLNA 1DAPA 4JP2A 4HG2A 2YDXA 4RVGA 2OXIA 2EGHA 4K9SA 2VTBB 3C8DA 1H8AC 4FEEA 2QN8A 5FOWA 4ZQGA 1Y3AA 1F2TA 3T38A 4MNTA 2IOYA 1OQYA 3I6ZA 1EVIA 1KWKA 5DP1A 2JAHA 2O2ZA 2RONA 3QUAA 2F59A 2QRNA 1WWKA 3F4BA 2BM9A 3OM9A 1WHSB 5BQFA 4Q5SF 1L4YA 2NZVG 3IHKA 2WJ4A 4EGFA 3I09A 1CUBA 4LUCA 1PFGA 2VPXA 1R66A 3F6EX 4O1MA 3DF8A 4EYKA 3MKYB 1R8QA 1Y4SA 3UEOA 3WSWA 3VAAA 3CNLA 1U5TC 2P69A 5JHFA 1A8IA 1TT7A 4DGWB 2C7PA 4OFBA 4AYTA 1VFNA 2QRVA 4J3FA 1BOFA 4X62B 4AYXA 2CLFB 2IH4A 3TUZC 3K96A 4TMYA 3K5WA 3OPQA 4QRDA 3GT7A 3Q5EA 4M6WB 1JKMA 2GA2A 5B3AA 1KAQA 3DCNA 2H52A 1VJCA 1F12A 1ISSA 3WGMA 2M6RA 3UFXA 5DTJA 3PIOF 1PP7U 4G2NA 1D3AA 3WLHA 3RSZA 3NKLA 3PQ5A 3CNOA 3HDHA 2JZCA 3WGHA 2VQGA 3M8EA 1QZ3A 2XDYA 3M9XA 3KKEA 3SSAA 4AIDA 3IBGA 2XZDA 4EAAA 1T8TA 3R3SA 2OG1A 5IH7A 1U4SA 4CV2A 3AVQA 1Z18A 2CV1A 5IDVA 3ISVA 3SZPA 4S1PA 1MBEA 3N9IA 2W1OA 4CMKA 1H9GA 1JHAA 2FXIA 3VOBA 4ENRA 1EUDA 2RHCA 4GX2A 1EBUA 4BC0A 1F48A 1MAWA 5E8JA 1NW4A 1J2JA 3FXKA 4PCQA 3OCZA 2PKYX 4L5JA 2J48A 3VODA 2V0CA 3U0VA 4ZWNA 1PGNA 3KUCA 3UMGA 3MMZA 3SE0A 1UFRA 2IHTA 3QLUC 3DCIA 3H1EA 3LAJA 3KAJA 2JLCA 4IOMA 4G1BA 3T8YA 2XKJE 4RHFA 2LRDA 3CURA 2AN5A 2V5VA 2E1RA 4ENPA 4XORA 5LLDA 1P2BA 4IKOA 2FW0A 4JJKA 1WPXA 5AKHA 3RTEA 4X45A 1IGNA 1XT6A 3H1CA 4MGIR 5HOQA 2V7VA 3O93A 5JSKA 4MAMA 1WZCA 2KIFA 2PDAA 4JIMA 3KSRA 1GZUA 2OBYA 1SD4A 3JVEA 2DA3A 2A0YA 3R61A 3S81A 4AP9A 2P7CB 3RDPA 4Z0NA 2WBMA 2XRYA 3AFOA 2R8EA 3HNOA 3AEQB 3OT1B 3PUJA 5G4KB 2QSGX 2HPZA 5FRDA 4LVNA 5KVCA 3PQKA 1OLUA 1NG6A 1QHYA 3FXOA 4A23A 4TSFD 2QPOA 2IHKA 3VH3A 4V2IA 3BF8A 3L8DA 3AHCA 5AK5A 4C21A 3ICEA 3M49A 1RC1A 3ZWVA 2Y1OA 3HMQA 4D7AA 3H0DA 2P68A 1S1CA 3G9QA 1MNQA 1UODA 4UMEA 3PWSA 4PZZA 1ENPA 1Y63A 1D8JA 1TJYA 4MUXA 5CB0A 4RQBA 3X0DA 1CP2A 1RP1A 2O0LA 2P9HA 3U1DA 4CJXA 1UHMA 1MOQA 1ZJ6A 4TKVB 2PGDA 1JKFA 4ND3A 2Y1FA 1FMLA 4R0VA 3PLNA 1P6UA 1GPAA 3JD4A 2CMFA 3AO0B 1RIFA 2NXEA 1TDJA 3Q5GA 5KJ1A 1U81A 1FE8A 1JJ6C 1R4MA 4P8RA 1DRUA 3TK1A 4ND5A 4ZOBA 3CN7A 3LSJA 4G9EA 2HQNA 5JCPA 3GTMJ 3S4YA 3EMVA 1LZKA 1XR3A 4BE9A 5HS4A 2B1JA 4IDQA 2R7NA 1JYEA 4LF4B 3THRA 1U99A 5B7GA 2QLJA 2QVBA 3P7MA 3OWTA 4ALNA 2WWWA 2AHOA 2PSSA 1UJ6A 2RHGB 4ZJPA 2VYFA 1TM5E 3X44A 3EY9A 4GLOA 1E5XA 4TL7A 4P1WA 5AHOA 3BL5A 3C2QA 1R4ZA 2Z6AA 4KVGA 1HE3A 4LOAA 4PGFA 4IDEA 5IKMA 1OFUX 1FBSA 1AF7A 1W34A 2G1KA 1SG9A 4QUEA 4Q7KA 1QH8A 1TTHA 3JQ7A 2XZTA 1P4WA 1C80A 1R0ZA 4IHAA 3NTRA 3T4UA 3GMIA 1SHTX 5H82A 2EILH 3O8OA 4RV5A 3BCSA 1UELB 2GAOA 2JSPA 4FSXA 4NCJA 5D86A 4ZCMA 4D0LB 2AQFA 1EFTA 3IVGA 3G73A 5IT9Z 2CGPA 1SCJA 3RUEA 3U7HB 2M2IA 1JIVA 3KEYA 3T7EA 2EW1A 3PJDA 3JRIA 4JAVC 5JC1A 5LQAA 1Z0XA 4POAA 3CONA 3M9WA 3S7ZA 1WXEA 1ZSYA 2K7LA 4FR2A 5K6RA 4EENA 2D2FA 1AK2A 2OZUA 4C3JJ 3CUVA 1OZAA 1TWGJ 2ZAYA 3FBGA 1FIUA 4JB3A 1U8UA 1BE0A 4F5WA 1WXIA 4LRYA 5ALWA 2OHVA 2FN4A 2HA6A 1N2HA 4B4CA 1IXRC 2WICA 1JU4A 4PYOA 4Q00A 3CCFA 3K0LA 2Q29A 4IIXA 1Y9DA 1W5FA 2OLKA 4E4YA 1P0MA 3ROUA 1EYZA 4I09A 1U0NA 4CT5A 3W7VA 4BNZA 1OXVA 4XLLA 4YN3A 3PNLA 1C1HA 2PS9A 3VU9B 4MI3A 4R9NA 3ODPA 4KE9A 3QYPA 1XTIA 5BVHA 2CDRA 5ALEA 3BZKA 2H65A 4EPTA 1G4UR 2A9QA 1JXAA 4BQFA 3FUTA 3WTSC 5BV8A 4IDFA 5K03A 1U5CA 4U7PB 5JAZA 3DTYA 4YCJA 1XVVA 1HDCA 2I6TA 3G5MA 5A2GA 3V34A 4OHRA 4K0RA 2C3MA 4OYYA 2ILTA 3FR8A 2OT3B 2VQSA 4ZKEA 2P65A 2PGIA 2BCJQ 2WIJA 3EC1A 3GLFA 4J8PA 3IHUA 1E3DA 4CF7A 5F3WB 4FGKA 1YR3A 4NC8A 1L5OA 2Y0CA 2IA0A 2WIBA 5IY5H 1KI6A 3NX4A 5BUZA 4BY9E 3RRZA 3U4QA 2C9OA 3ABMH 3K53A 4DCUA 1F0KA 1KEPA 4XTRA 3G2NA 3FVWA 2XLBA 3V4GA 2WPNA 4CMEC 2NOGA 3TOZA 4B3FX 3IAM2 5AKLA 5AW2A 2Q41A 1XJ5A 2ZANA 1XXHE 2GRUA 3KG2A 4LTMA 3ANTA 2J3DA 1MAVA 3MHPA 2F9FA 3ZN1A 1W48A 4NV0A 5IM4F 5FUVA 1P5RA 5ALHA 2K7ZA 2OB1A 3FZNA 3D81A 2LVBA 3PQDA 1YUMA 2REQB 5CNJA 3VYUB 3OYEA 3UGQA 5EVCA 2NPFA 1KJJA 4Q7JB 4V0SA 4JQOA 2DWUA 3GCZA 1LPSA 2EFJA 2IRWA 3KYLA 2XZOA 3V4SA 3EF0A 2M45A 4ER0A 1FUKA 1NQUA 3L9FA 1HFKA 4PR0A 4MRNA 4WCFB 2REOA 1E3LA 1KR2A 821PA 4LSZA 4RWZA 3DNFA 1EPUA 1RC8A 1KQ8A 1XALA 2O3TA 1ZINA 3FFAA 1IEQA 2Q3CA 1X7WA 4HHEA 2YUSA 1JV2B 1A9OA 2DPHA 2W90A 2VBCA 1ONOA 1EA3A 2CWEA 1RD4A 5ED4A 3FVVA 2Z57A 2OGSA 3CH5A 2YZNA 5EWMA 1HW5A 3O2QB 4OQXA 3QKIA 2XR1A 3R5SA 3R9XB 1JFVA 5GZ1A 1EM6A 3IUSA 5CCBA 2W8BA 3B6JA 3V46A 4NG4A 5L8VA 1YE8A 1Y5MA 5D4RA 1NK3P 3IAUA 2VFAA 5BW4A 3VNSA 4A8PA 3P2MA 5KMGA 1MG5A 4CIDA 3PJEA 3Q5FA 1AA9A 3WK8A 3L7LA 4FBMA 4QUIA 1YS7A 4FTHA 1NF3A 4BQEA 4CKCB 5IAEA 4ZZDA 3FB1A 3TINA 4F3NA 4C5CA 2D1HA 2RARA 3PD1A 2TRTA 3GZ6A 3CRRA 5JADA 3UK6A 3P9QA 1CY0A 2A5WA 3ZLVA 3U39A 3QOPA 3ZDRA 1P4RA 1I6XA 4DUZB 3GT0A 3QXSA 5A5EA 1P62B 4UM9B 2PYDA 4RVSA 5CB4F 2ODBA 3CJNA 3UC9A 3CC8A 3OWXA 2DR2A 2XWJI 3G88A 3GZ4A 1D0VA 2DPGA 5AVYA 2D2IA 1AC5A 1FUYB 5IJ0B 1ESCA 4EG3A 5J2TF 4X1IB 3WMXA 3FCOA 4YRRA 4BFTA 5SY9A 3PKJA 1WBBA 5LBUA 4NAUA 1I3MA 1RFGE 4E7KA 1PQYA 2XB2A 4RAYA 1VKNA 3KB2A 3ZC3A 1V5EA 1F6BA 3BSFA 5CTJA 1PDWA 1YX5A 2BZ0A 3VGJA 1QYVA 3QWHA 4ZO6A 3VJMA 2PUFA 1QBKC 1PEKE 2VTDA 4ZVPA 4IO0A 2W6JA 4ARSA 4B6QA 4D9JA 3UPDA 5HXAA 5K5QA 4I76A 2YVKA 1JEEA 4FP9A 5JZOA 3A6ZA 2H06A 1A5BB 3EG9A 1PVEA 3AH8A 4LHYA 3C1UA 1TQ4A 1S4QA 4AVYA 1YRHA 4DQUA 3NT4A 5T41A 2ZQYA 2DAOA 1WETA 1W0CA 4MJXA 2EG5A 4IIFA 2WYIA 3O1LA 4BLRA 3PICA 1DG1G 2B2CA 1BR1A 1Z38A 3ECCA 4HFJA 4M55A 5FBHA 2CFSA 4S1TA 1T8RA 1C4XA 2POQX 2JA2A 3JU3A 5M29A 1NDQA 2GN0A 5EUCA 1A2KC 4NESA 4PSUA 4IJ5A 4KPUB 2NAZA 4ZGGA 2A0XA 3IT2A 3MJEA 4M1QA 4MVJA 1XZDA 5DYNA 2WV1A 3RNLA 2DO7A 5FD6A 2WT4A 4KWHA 1K5GA 4ZRMA 3JS5A 6ABPA 4YROA 3VNRA 4BNTA 2JW5A 1I1QB 1RRGA 4BEBA 1N0UA 4ZH4F 2B63J 2V9PA 1NZFA 3KVRA 3PGKA 4ZT6A 1CY8A 3AHEA 4XLAA 4GLLA 4Z9FA 3K7EA 3H9EO 5E17F 2WYUA 3Q0UA 4KIWA 4TQGA 4MS1B 3VDQA 3FTQA 3FHJA 2HD4A 5EG0A 2EFYA 4U63A 5F35A 3OAAA 4KPEC 3VC3A 3DOHA 3V9AA 2C03A 3F72A 4IKEA 1IHXA 2HMTA 4I6EA 2DVMA 2YV2A 3S28A 3AXTA 4BPRA 3PNKA 4G0YA 4CQJA 4NNPA 1WY5A 4CM8A 4AY4A 1H69A 3IS3A 2I78A 2E1NA 3CJQA 1B72A 3L7KA 4IJAA 3A3OA 4KMFA 1ITZA 4ZU1X 1ZH4A 5KYYB 5BQPA 1KP3A 1QH1A 2OCYC 4LXTA 2WWRA 1Y8RB 2J5XA 4XVUA 2QZ9A 1CERA 4YRNA 4CF3A 1BJKA 1R4NA 3G7SA 1R10A 1QIFA 3RSOA 4PCVA 1XZCA 3RRJA 1M1YB 2DLCX 2WF9A 3SJZA 2OYSA 3A32A 4OP3A 2Q0SA 1HLDA 5FWXB 3W2FA 3ZHRA 4A2UA 4BVHA 1Q84A 1T56A 5E8GA 2NZJA 4ZK6A 3QU2A 1XCLA 3RH0A 4MGRA 1NBWB 1CY7A 3I9V2 3A8TA 4KXUA 1K6JA 2AG5A 3NV7A 5BWMA 3THSA 4N1AA 4QPCA 4ZANA 2CMKA 1P8JA 2KHZA 1N3LA 2O2HA 1BRTA 2ADFA 1ZD5A 4J07A 4K6MA 4NMWA 2IGMA 3I8XA 5HFJA 4CM4B 4MW4A 2XE4A 4HV6A 4GM0A 3Q3JB 4I3FA 3DKYA 3TQOA 2C7BA 4L9JA 3N8IA 2QS9A 1YOBA 3IT1A 1M0TA 3OJLA 2B78A 4G9YA 5ERYA 2AIRA 4MMYB 5FTJA 1RQLA 1EFPA 1Y1SA 3OY7A 2F5CA 4BHCA 3OMWA 1JT6A 1Z6PA 3FWHA 5JLJA 4UNNA 4ENKA 1V35A 3ZE2B 4P5EA 2EKZA 3LO5A 3UJ8A 1P80A 3JAKB 1A6QA 3NH6A 1I0LA 2DFPA 4I1SA 3WLFA 4B9EA 3RKWA 4N3BA 3TBFA 5FR2A 2SECE 1GXSA 4OGWA 2AZ4A 2E3JA 2W6JD 4FHGA 1RLJA 2VDPB 2DBQA 4URUR 1NR1A 2JJ2A 3DZDA 4LWQA 5FA5A 3ND5A 4ZHQF 5LP6F 4IRGA 4IHKA 4C03A 4WX2B 5TMDA 4G6QA 2QQFA 4KN5A 1EG2A 2H4YA 2QD1A 1PT8A 3PRKE 2VBZA 1B26A 3DZGA 5COAA 1CUIA 2HF8A 4IVNA 4EEFG 3D4PA 4HX9A 3H0KA 1O7FA 4HAYA 1CE8B 5AM2A 2DE0X 2FLVA 5DCMA 2GYUA 2YQZA 2OHOA 4IEEA 5L3FA 1QVTA 1EFLA 1Y1RA 4OBEA 2XJ4A 2LNDA 4AF6A 4US0R 4FTWA 2ZQ5A 1OXSC 2XUFA 4LGCA 1FOXA 4MVJD 4BN0A 2WEKA 3T34A 5BRJA 1PR5A 4ZV7A 2CVQA 3N59A 3HHGA 2HPIA 1E1LA 1YMUA 3T7CA 3ZLTA 1HOMA 1BU5A 3ROMA 2PBLA 4QLAA 2K02A 2YHIA 4GIBA 1DJMA 2CQNA 3RI4A 3F8NA 1HDEA 1T6ZA 2J67A 1XYYA 1SUSA 1ADBA 4WCFC 4WOJA 4KT5C 4XWAA 3MTJA 2X8JB 3FIUA 1RAIA 2CW7A 3RKUA 2ENWA 2Y76A 3ZVKA 1Z4IA 1QKJA 3OAAD 4H77A 2JFNA 1DUIA 5K5EA 3A02A 2WOOA 1YL5A 3MWDB 3H8WA 4MYRA 3ZHQA 3ZHVA 4TKUA 4QFCA 2IEYA 3AYXB 3EEOA 1I3QJ 1Q1QA 2DGDA 3COAC 4TTPA 5DWDA 5F9HA 3GCDA 1NLMA 2C9DA 4MS4A 3EAGA 1E0JA 2FFBA 2DKNA 2HSDA 3VV2A 2FBIA 4DLXA 1BH6A 3FWEA 4RA2A 3EFOA 1Z37A 2F90A 5IDQA 3PDCA 4K86A 1V54H 4PX3A 4V0KA 2XOKA 1LS1A 5BPFA 2CO5A 2XADA 1EUCB 5EZHA 4JXKA 2PMFA 1LW6E 2EP7A 2VHVA 3DAPA 5JATA 3C98A 1V11B 4HTFA 1WOMA 1X7GA 2RHOA 2C7OA 3CPSA 4LXUA 4WZAA 4U00A 3QXCA 2VTEA 1DBVO 3SXJA 3IDFA 1QP7A 3VSBA 3DF7A 5CFZA 1AUVA 5AICA 2VF2A 1J2YA 3VH1A 2QI9F 3AL3A 4FFSA 1IHPA 1J8YF 3WC4A 1B14A 4FX2A 4OKNA 2HHJA 5CYGA 4HRVA 4BGUA 3C2HA 4MFDA 2IUEA 2NAPA 2WB1A 4H1WA 2FRDC 2Q2EA 5LLTA 2HN9A 1Z33A 4BASA 1XHFA 3P0JA 3NYRA 2VXBA 5KINB 1W1UA 1BHSA 2Y1WA 4UE2A 1DI0A 2EFDB 5B7PA 2EFGA 5KSYA 1XU9A 2RGAA 1RYFA 3KZYA 1NVEA 5LR6A 4URYR 3BBPA 3TAXA 4JC8A 1G3YA 2DFNA 3SR0A 1Z47A 1MMFB 3WHLA 2VJJA 3ZDBA 3TSOA 1KEWA 3ONWA 5C4IA 4ICIA 4QYIB 3AUTA 2QLTA 4QRIA 5HEKA 2XF6A 4EL5A 3L3BA 2GR9A 1TGVA 1E7SA 5GP9A 3UVEA 5NLLA 1YZTA 2O61A 5IAAA 3MS7A 4A6EA 1LPQA 3QZUA 5DX8A 1Q0LA 5KYGA 5EIOA 2O14A 4MR9A 2WB1N 1F8UA 2R2GA 2VHEA 5LXTF 3Q4GA 5CLHA 3P9KA 3HJCA 4E6KG 3HV0A 5D3KA 4FYMA 4P98A 5TV2A 1LCIA 1CUEA 1PT7A 5EPUA 1ULSA 1TRHA 2G6BA 2JJ2D 5DK4A 3DD5A 4CEHA 3DULA 3CX4A 3DO5A 4Y3UA 2PZLA 4R01A 4MW0A 1W5TA 4OAOA 4WN3A 1ETQA 4BWVA 3BWVA 3SIPA 3EIOA 1ZNQO 3R0JA 2H4FA 1XGNA 4FFNA 2CD9A 5FBRB 5HKLA 3IO3A 2PT9A 2O2DA 4CR8A 3K20A 5AI0A 3ZK8A 5F1RA 3LGXA 2B36A 1PK8A 5D3MA 5D00A 2HWYA 2XNCA 4U3JB 5FLEX 1UMCA 1XQ1A 3B1YA 2P6OA 1QGYA 1KJWA 3OF2A 4UTXA 3R8FA 1MIHA 2QT0A 3KNZA 3AZOA 5K1YA 3UAXA 2C2XA 4QQRA 1JTXA 5FFZA 3PFGA 3ZUGA 3AEUA 2ID9A 4TL6A 5CURA 2P35A 4F1JA 2RKHA 3O7MA 3ANLA 3I2YX 1LKZA 4BWGA 3PNYA 1NKVA 4NRDA 4CODB 3OJWA 3GFFA 3TIFA 1TA4A 1FLVA 2V6BA 5GAGJ 4YRDA 2IW3A 4MA0A 4ZDJA 2ON6A 2Q3DA 2NPOA 5KHAA 2HKOA 2Z2XA 2BH9A 3T1NA 3EBOA 2E7WA 1KI3A 3VA7A 4EW6A 1XGMA 2YBEA 1N4DA 2NV0A 2OVBA 3GRUA 4UQOA 4OXQA 3GG2A 3F3KA 3FE2A 2DETA 1P0IA 1FZPB 4U6SA 3DXJF 4WFKA 1DPRA 2GKSA 2PRSA 1I7DA 4GE0A 3O94A 2VSNA 4O4IF 2P9YA 2E5FA 5EZGA 4DYCA 3WX0A 3A6JA 5KAIC 5IS2A 1SKUA 1AMOA 3QU4A 2K9SA 2XOKD 2I29A 5FPSA 3FGPA 2HA4A 3MUFA 4XYGA 3MUEA 5HQ3A 3V8QA 2XA9A 2ZPTX 1LPAB 1JRLA 4FZ3A 4OHUA 3ZIDA 1WB9A 4L9VA 1BC8C 4QWMA 2YIMA 2OK7A 2BGGA 3DMRA 2MLKA 3EE6A 2BKEA 2IZZA 1IBKB 4CL3A 3RKRA 3NHZA 4YJ3A 1GCAA 2CG4A 2CL5A 3PDUA 3OZXA 4DKJA 1PUFA 3WQSB 2KLHA 1ODIA 3Q7PA 4NE9A 3BAFA 4Q3BA 4U7DA 5LQUA 4E2XA 1DEAA 3EZNA 3R74A 1AOYA 3QKRA 2J6BA 4U02A 3GVCA 4TUYA 3VAZA 5B6IA 3K0FB 1OYWA 3MELA 1H2RS 3E3AA 3I12A 1XD2B 3BSWA 2JJ1A 4LI0A 2WV7A 2FPSA 1J4AA 4R2KA 1WLYA 2BVMA 4LYDA 1GKLA 1NQWA 3A01B 4UHTA 4YI5A 3NBQA 4Q4HB 5AOAA 3JD1A 4R5HA 4DQVA 1SY7A 5H1YA 4Z2YA 1GRCA 4MXDA 3STWA 2GBYA 2MYPA 2AOTB 4BC1A 3ADBA 4QXQA 2DMPA 2AKYA 3ABRB 3ZMDA 1BDMA 1GA6A 1UXGA 3ABTA 4Y1RA 1E66A 2VOEA 3PVSA 4KXLA 4KR9A 2V1UA 3FR7A 3NC0C 3RBXA 5FTKA 3M9AA 1GGFA 1UP6A 1OMOA 1PT5A 2BLLA 4FZVA 1R5GA 2GAIA 1QWOA 3DBOB 4AO6A 5CJ2A 3GLHB 3TSZA 3CNBA 1P7CA 4OUDA 1Y3BE 2BHYA 3HLTA 2J6IA 1ZA1A 1RIOH 2OP1A 3D1VA 2MINB 2R8OA 4YV1A 3PC7A 1YIDA 3IESA 3UICA 1YZQA 4L27A 5BSUA 2VPPA 4FR5A 2IKQA 4UZFA 2W11A 1B8UA 4GXOA 1R6UA 3ZPLA 4M3FA 5LMZA 4D9KA 3S2IA 1SAXA 1ULZA 4HAIA 4M22A 1M34E 3LSMA 2A1TR 4LYEA 3EPZA 3JQBC 5KWSA 2ST1A 2A0WA 2YFYA 1QBJA 4BDZA 2WAQA 5C4XJ 5FBQB 1PWEA 3GNLA 5D5QA 1ZCZA 2AX3A 1MBJA 4UFNA 2I2XB 2IDKA 3GN2A 4M0KA 4Q82A 2M9MA 2NS7A 2BGTA 5GPBA 2R2AA 4N5DA 5C3EJ 2FP3A 1MA3A 1E69A 2QMEA 1DO2A 4G9GA 1ZHFA 3D0SA 3TLYA 1XNRB 4N9IA 4LDZA 4RSHA 2P81A 1YJXA 3R75A 4PYJA 5EIFA 2ZE8A 3FZQA 3OQPA 1BG6A 2WWTA 5AI5A 2W6ZA 3FSRA 3RFCA 2ZSHA 3D2AA 5AHRA 2B4TO 3HVIA 4QDZA 2J5PA 4XUDA 1COWA 2FUG1 2BY2A 1J0BA 2V7XA 4IRUB 4FNGA 1QRSA 3ELUA 1KMHB 1Z62A 2BOVA 3DEKA 5HGXA 2WAQN 4A36A 1IY2A 4Q15A 4IVRA 4MV7A 3FWYA 4KW7A 3NHYA 3I1IA 3OKFA 4Y1FA 5TT1A 1K3TA 4PONA 3B2EA 1C29B