2F48A

Crystal structure of a novel fructose 1,6-bisphosphate and alf3 containing pyrophosphate-dependent phosphofructo-1-kinase complex from borrelia burgdorferi
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
551
structure length
551
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
molecule keywords diphosphate--fructose-6-phosphate 1-phosphotransferase
total genus 199
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 2f48A03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A02
2PFKA 2F48A 4I4IA 1PFKA 1T35A 4KXMA 4U1RA 4KXLA 4LJRA 3O8NA 3MAJA 2KLHA 2IZ6A 3OPYA 4HX9A 2F2TA 4MEJA 2KHZA 4OHBA 1ZXXA 5ITSA 4I36A 5AJTA 1KZHA 3IMKA 5AJUA 4PFKA 4I7EA 4FYKA 2F67A 4P5EA 4A3SA 3O8OB 3O8LA 3OPYB 1F8XA 3HNOA 1WEKA 1S2DA 4JENA 4FYIA 4RH3A 4NPAA 3PFKA 2F64A 3K2QA 2IZ5A 4LJKA 3O8OA 4MCJA 1WEHA 4WL0A 1F8YA 2A33A 3UQZA 2PMBA 1MTOA 1RCUA 1S2GA 2F62A 2HIGA 4P5DA 2IZ7A 3F5MA 1YDHA 2A0KA 2Q4OA 3QUAA 4LJLA 3GH1A 3SBXA 2NX2A 4JEMA 6PFKA 1S3FA 3U39A 2Q4DA 1S2IA 4JELA 4KXNA 4FYHA 3BQ9A 4OHRA 3EHDA 1S2LA
chains in the Genus database with same CATH superfamily
1NM5C 3PWZA 1ZN2A 1DGRM 2QBYB 4BTLA 2XQKA 4B32A 1E9AA 1XTKA 1L5NA 4RGYA 3NTQA 4ASUA 1KSHA 4N8DA 5AKYA 1N8TA 3H04A 4GMXA 4WERA 4WLVA 3UHOA 2P40A 3CCJI 3EDYA 1JSZA 1MX1A 1QGUB 2YY6A 1E8MA 2GBGA 2ZTVA 1P3DA 3BTUA 3G88A 3M6MD 4WINA 1G3QA 3DPTA 3ESQA 4RD2A 4AZ3A 5I4IA 5KTSA 2ZUDA 3JYOA 4ZEVA 2NXNB 2FRHA 2PGOA 2QZSA 2JDID 2PUHA 1SA0B 5CUQA 3CZPA 4XIYA 1GA6A 1W1IA 4YRRA 2H6BA 2L7MP 1U7ZA 1WB4A 2ETXA 3KSRA 1K66A 4JSRA 2ZSKA 1HZZA 3B73A 2BZSA 4MTCA 1M34B 4FB5A 5CQEA 3H9GA 2P1RA 2QRZA 4FMCF 3PIIA 3LVQE 4O02B 3M33A 2IU0A 4NSNA 4V1CI 3I42A 1X4OA 4UY8I 1N0UA 5GONB 4KO4S 3R7LA 1DCTA 1I3MA 3ZGZA 1RC0A 1E1CA 1GRQA 2XKAA 3LOPA 4MTDA 1BFUA 1RM3A 2Z4RA 3N7AA 1UMKA 2FJ0A 5ALSA 3TSYA 3HQ4O 4PUSA 3NOQA 4X20B 4F3RA 5IT0A 2F3UA 2QTCA 1HY3A 4LOAA 4OQPA 1PNRA 3GB9A 2NAPA 3X1YA 2J1LA 1VSVA 1PP7U 2VHYA 3L6OO 1MV8A 4I6EA 1E89A 3BWVA 4TROA 1MVNA 1C41A 4RB0A 1JMYA 1X74A 1XSEA 1IZ1A 2XAJA 3D0QA 1YOVA 1WDKA 4RYDA 4XD7A 1SQ5A 4Y9DA 5DW3A 3R60A 2ZPUA 3DZFA 3TW8B 3ER6A 3I6ZA 1B00A 1N9GA 2C8LA 5SZIA 1A9RA 1Y48E 2O2IA 3MUNA 3ZE2B 5AVZA 3NNNA 5JFOA 5JAOA 3CO6C 3ZV3A 1QCCA 3SFZA 3HNPA 5P21A 3W7AA 3WYEA 5K51A 1N2IA 4R51A 5DCUA 1RI2A 4HBGA 4MAMA 4Q3CA 2HF7A 5C5CA 1TM7E 1Y33E 3B6EA 4FBLA 3ZMSA 1W4RA 1NW8A 3CZQA 4IHQA 1CBUA 1J00A 2F64A 3EC7A 3UCXA 3L79A 1E3WA 2BEKA 1VGRA 4NFSA 4J01A 3EGDA 4B81A 1KJNA 1B7GO 1F0NA 4JV5B 5DYMA 4ON0A 2PAAA 3A37A 3OJFA 5FO5A 5A5VA 3HCNA 1VDZA 5H0IA 1X1CA 3DBHB 2L17A 2O8XA 2GXBA 2XMPA 5K2MA 4D98A 1U65A 2YASA 1P7ZA 1YJNI 1U2TA 2O8BB 4UB6C 1JTFA 3WHLA 3CJNA 3GZJA 2FAXA 1VRVA 4ZT3A 1JALA 4DCJA 4YAGA 2RGUA 5DH9A 1N0HA 5BPIA 4I5DA 1WBJB 4U9IS 1R15A 5HVQC 1LI5A 2BFCB 3WHCA 1F5TA 4OIRF 3F6PA 1GV0A 1F1ZA 1N6OA 4MQEB 3GW8A 2G3YA 4P82A 3IA7A 1K8RA 4NFYA 2H57A 5EJ7A 2B69A 2ZYAA 1LRLA 5FEUA 4KTTE 4Y6OA 4NE7A 5J8FA 5BMZA 1QKKA 3EXFB 3FBTA 1A8UA 3OAAD 4P6VF 2FUNB 2PBZA 5FL7D 1QK4A 4F46A 3QX3A 1ZIDA 2VXZA 3HRUA 3FM9A 4LQ4A 2XUDA 3KVOA 4OSPA 4ZO4A 3TI9A 4ND8A 3VV2A 2ZXUA 2RGRA 1UKBA 2H4WA 3VKFA 4I1IA 3D8BA 3RVLA 4FX0A 3SHVA 5FBWB 2R7VA 1V16B 4CCAA 4XDHA 4BBSJ 5J9FA 2K4MA 4CETA 1YW9A 2QZPA 3AWIA 4ZARA 5F3WB 5B30A 2WFLB 1P0FA 1ESMA 3N8HA 3N58A 2JGEA 3LV8A 5FPSA 2IV2X 1MJNA 3JD3A 1DRUA 2H9IA 3DU5A 1LK0A 1XMIA 5KAMA 1JLKA 2PMDA 3FNGA 3H1PA 3I23A 5BSMA 2BOLA 1M6NA 2J33A 3SZUA 1MFPA 4B7UA 3NWOA 3IT3A 4WEOA 3WGYA 2MDTA 1Z0IA 4QVKA 2OO3A 3B9PA 5DUKA 2RE8A 3R6DA 3FB1A 4Q3LA 3U3OA 2ZS7A 3BMXA 3Q3CA 5IVIA 4OK5A 5EE5B 5G3YA 3QYBA 4XYLA 2B3TA 3B1WA 4NDZA 4UBJA 1G6KA 1GPAA 1TYDE 1BJAA 3AL0B 2GHTA 3BILA 2HWYA 4PZ9A 4FTWA 4N6OA 3OYGA 2M7AA 3A04A 1JBKA 3N7TA 3S3NA 3O4RA 4XOUA 2V6CA 1PL8A 1RXCA 3O2SB 4PGMA 5C1OA 7YASA 2WB2A 2X77A 3W2IA 3O75A 1IN8A 4EGSA 2IU4A 1Y7LA 2V5VA 4QEZA 5E4YA 3NM4A 3RC3A 4W1PA 4EP1A 1JKJB 3JQDA 4BV8A 1CGPA 4EO4A 2VBWA 3FGOA 2PZGA 2EFNA 1S7CA 1X2EA 3K69A 3DEAA 4V0QA 1RUOA 1PFWA 1T8TA 3K32A 3SEZA 1DIHA 3B1VA 1ZD5A 3NT2A 4N9QA 4XTCS 3T0FA 2WAXA 3TOZA 2HI0A 3M4NA 2DO7A 3L9FA 1X7YA 4F8EA 4EUEA 2Y1CA 2IH4A 1NI3A 3OYNA 2ZBKA 1E2NA 2EPFA 2XHZA 3OM1A 3K30A 1II9A 3FWNA 5C2JB 2JA8J 1EIZA 4RV5A 1XF1A 2FWMX 1B93A 2PL9A 3K6RA 1CZUA 3PT5A 2PJPA 3TEFA 3K9BA 1IB0A 2IVZA 4CVNA 2YVLA 3AJ8A 1QRUA 4I99C 1G7SA 4NBNA 4C0XA 4MPPA 2IWRA 2PQ0A 2VDLB 1TWAJ 2VF2A 4UM5A 1PLKA 2J41A 1JQLB 2DTEA 3TIGA 5A6VA 3L2VA 3NFYA 4YDSA 3ZTYA 2XXAB 2YUSA 3PEYA 2WA1A 1SOWA 5K9ZA 5HGXA 3FKSD 4FGKA 4CA0A 2PWYA 3JYHA 3RIXA 1P75A 1ZJ4A 3A9RA 3DOIA 4HNAB 4MQ6A 3IPAA 3GRRA 3KAKA 2GA2A 2GPBA 2RHJA 2BDEA 3EBLA 4LJYA 1GTJ1 5FPHA 4DIEA 1E9VA 2DPGA 5HYVA 5EWLA 1EDZA 2GILA 2F1RA 4PAOA 1XAGA 2VKVA 3RF6A 2G8NA 4XVHA 4DF3A 3ETNA 4KYWA 1PGOA 2CHQA 4OV6B 2YX7A 3V4RA 2D1VA 2IXSA 1SU4A 3IAS6 5CVDA 3UJPA 1LZKA 4F5DA 2ZYHA 1FLVA 3BK1A 1QOQB 2W6JD 4UBOA 1UBRS 5F33A 1QHFA 2AW3A 3NJ4A 3I01M 3R1IA 4WRRA 1VIVA 2ZTHA 2JF0A 3AFMA 3RTGA 5FLMJ 1PR5A 1PSZA 4B34A 4QG3A 1H0KA 2EFQA 4GI5A 4JU8A 4WTOA 4IUCS 1PL7A 3IAUA 4W1QA 4ZAWA 3TUIC 3HC7A 2EZ4A 4QPCA 4LGCA 4JLPA 2O8FB 3F73A 3IVRA 4EM6A 1EFPA 3LPLA 4BQFA 1KDTA 2BUBA 1I2DA 2W5UA 2QEXI 1U9IA 2QNIA 4XLFA 3B85A 4Y3OA 1ZH8A 4QXRA 4ZANA 1RRJA 1BWQA 2WD8A 4UEOA 5F73A 3KQWA 3OF5A 3S1AA 1L7QA 3GNTA 3T7AA 3M5WA 4KFCA 3BXXA 1ADCA 3W9UA 2OHJA 2W2KB 2C7RA 2FSHA 1GVJA 3RVQA 5CA1F 5EAIA 1D2RA 3NDBB 1E3IA 1OBHA 1Z68A 1BMQA 1QLJA 3TE6A 4H4EA 3ZQ4A 2IXFA 1DELA 4AZ0B 1U9NA 3ANYB 4ED9A 1BW9A 1FVXA 5IXSA 5LU8A 2QN3A 1E1QA 4JEUA 4EW3A 3TP0A 2ZU6A 2ABWA 3BG3A 1SN7A 3IP7A 3K4HA 4LLLA 4QJ3A 4NQWA 3E03A 1D2EA 3P0JA 2COMA 4NARA 4P4UA 5I7HA 3A9UA 1B1CA 1P1BA 5EMKA 1FTZA 1BI0A 2NU6B 2HD4A 4PX3A 2QP3A 2NYRA 3OZXA 4IH9A 5JCZA 3SVLA 4RL6A 4MQLA 4TV8A 4H27A 3PXUA 4B85A 1L7EA 4EJWA 2LR8A 1AXEA 3MXTA 1HE3A 3HZHA 4FYPA 2V96A 3U7IA 2OK8A 3FLAA 1R1VA 4RY9A 5LL6P 3RR2A 4NDNE 2G1KA 4EF5A 1GR0A 2QMQA 1NOJA 2CWWA 2A14A 4GEGA 1RWPA 3VJLA 4DSAA 2BFAA 1KVRA 2D1TA 2FY8A 3V4FA 4DQVA 5C1BA 1I5EA 4KQEA 4E08A 1TAGA 1KAEA 3F6EX 1SAXA 3FYUC 3LI2A 4HDNB 5EUBA 2P41A 5K3SA 4IILA 3ET4A 2POCA 3A14A 3A4TA 1M7HA 1ZN7A 3EGIA 4ZU3A 3IH2A 2VJ5A 2GBYA 1GPKA 2BH2A 3IBGA 3AX6A 4EG0A 1BKSB 1LDJA 3ANLA 2VPYA 1YS1X 2P69A 2OV2A 3BJ6A 3OHSX 4O59O 5T6MA 3DEFA 3UTDA 1F8FA 1JYSA 2CG4A 3L02A 3RTAA 3HCCA 4L9TA 2A7QA 1HFKA 2FSIA 2Y8EA 4LG3A 3F0CA 1VMKA 2Z2KA 4IX9A 4KYVA 3ZWOA 4KHZA 3OKCA 4FYYA 2R7TA 4ACAA 5H81A 1W35A 4BRUA 4YRBA 2H4ZA 2PL1A 1C8KA 1G3YA 4J0DA 4ENNA 5AM2A 2ZYRA 2VJMB 1NNEA 1DAGA 4BVBA 3PL8A 1HDXA 5IYBJ 1XBTA 2E7ZA 3VYTB 1IDYA 2I29A 3PZBA 4IHJA 4WJZA 2XTZA 3ASZA 1I7LA 1ONPA 1Y3CE 3AUFA 4C2MJ 4NCNA 1ZH6A 3C7KA 3FM5A 3UK2A 3AYXB 3MLEA 4Q1CA 3H36A 2FRXA 5CT6A 1BQ3A 2QQ5A 2RKBA 2QUHA 3DPIA 4B4KA 1GYPA 1OFTA 1W34A 1WCXA 4U63A 1ODDA 2MCFA 1XQ6A 1U6JA 2HEIA 3N2IA 3DE4X 5TRTA 3V8QA 4BWGA 2UZKA 2HHCA 4NTZA 3AETA 3LM8A 1A35A 4N3GA 3UMVA 2CLOB 3KP3A 1XCJA 2YZ2A 5AHWA 2QN7A 5CLJA 1JLHA 1NPYA 1QR6A 4X93A 1SU7A 2Q9UA 3CH6A 2VXOA 1G3IA 1L7AA 1O4VA 1XKQA 3G6KA 4GZ6A 1VG0B 3V1KA 4DJFC 5CA1B 5FTJA 2IEBA 4JNKA 3GXBA 1I0LA 4E13A 4RM2A 1R6VA 4I6ZA 1KFBB 1ND5A 3CRNA 1X6VA 4DQLA 5FO0A 5F98A 2FR8C 2W2QA 5G0WA 4MUGA 4EBBA 3EMDA 3FVVA 2FFHA 4Y2QA 1HGXA 4UUTA 2G9NA 4M71A 3VPHA 4TN5A 5HIKA 4H60A 2L0XA 1AIPA 1T2KA 2WP8J 1MBJA 1VL2A 3QQ5A 5HK8A 3S8YA 4MLZA 4OAQA 2EBWA 1D4ZA 3ZI0A 4V2IA 5LD2B 2GKSA 1XS9A 4IX7A 3E0JB 1RU3A 4C9YA 3SVTA 1DMSA 1QJ4A 1UBNA 1WMAA 4RD4A 4A2PA 2D7JA 2A4MA 1FMWA 1WP4A 3UK1A 1WD5A 4ENUA 3DOFA 4BXOA 1YL6A 3FYSA 3VKHA 3FCUB 1G20E 5EZQA 5EFOA 4UHJA 1ORTA 1OASA 1N0IA 1OLOA 5L3BA 3OYDA 3HYRA 1JFVA 4RFSA 3PR3A 2FUKA 1LB2A 3JYPA 3KWLA 1HNNA 2IBDA 3HOXJ 3E9RA 3I28A 1RDFA 3GI1A 5JSYA 2J5OA 3GT7A 3ULKA 3U39A 1H6CA 2IVMA 1F2DA 3QU2A 3W1WA 1Y6GA 2H4FA 2FUCA 2C1ZA 2XWPA 3K53A 4X0EA 1LB1B 2MLKA 4KMFA 2JGFA 3S70A 4WXHA 1DDOA 1Y6JA 4B82A 4CI0B 1TI7A 5DXFA 3WAGA 2ZSIB 3H1TA 4F93B 1N5KA 4PLWA 5TNXA 2BGTA 1XCVA 1JHXA 2JD1A 2I3DA 3EZ2A 3QXHA 1O5IA 2CUTA 2UVQA 1OPRA 1E62A 3JSPA 1Y1TA 1VKOA 2JAXA 4LI0A 5FTMA 2Q5HA 1JLSA 3OUUA 4Y6RA 4ZI7F 5F2NA 4OLFA 2CO5A 2PIDA 3NV9A 4YELA 1HBXG 4I6GA 4DLUA 2PHZA 4OXNA 1YZKA 3AI1A 3KZOA 2G9ZA 1GPLA 5TF0A 4QPPA 1KZ4A 2F3RA 4PSCA 1XRJA 2O2JA 3LUGA 4HNUA 1PP4A 1AOXA 1K75A 2FVXA 2M9MA 4AMGA 4NATA 4KSBA 5KYXA 5J4VA 1C3JA 2PN1A 5HUHA 3FYCA 3U4IA 2FPPA 2YBEA 2C3PA 4BXFA 3D2LA 3SC6A 5E20A 4G9YA 3BGSA 4V19K 1ZRCA 1V25A 4FGSA 5BNFA 2OO5C 2Q5CA 3ZVNA 1LDEA 3CPHA 2ZYGA 2VWQA 3H0KA 4GMGA 4QDOA 2LF7A 1IRXA 1J06A 4X92A 1P2UA 1OZHA 3VAYA 4BX2A 2P6OA 4WDRA 4PS1A 1COZA 2GM3A 4RXUA 3ZGXA 3PD1A 1SOMA 4YRGA 2WT9A 2ZMEC 1JJVA 4PRKA 4RY2A 5CDUA 1S2MA 4M1YA 1NL3A 4M6XA 2X4DA 2IRFG 4XIJA 3S99A 3ZE7A 3JRXA 3BVPA 3HADA 1DP4A 2HLDD 2WVAA 1ZD2P 3QVXA 4KDRA 4DCOA 3R6TA 1JR3E 1L5LA 4GHWA 4F2HA 2FUEA 1LBQA 1ZONA 4BRSA 1EXDA 3NRJA 2GXUA 2G7HA 5IFLA 1QOZA 5HF8A 2HPAA 1IK4A 1U0HC 1JHAA 2TCTA 3ZY3A 5FV4A 3H8SA 2HA2A 3WADA 1OGYA 3JQFA 2NT3A 4RQUA 3TF5A 4XYMA 2JAWA 2LDUA 2GSWA 2ZDQA 4MYTA 5D85A 4CU2A 3IOCA 1F2TB 4WBNF 3UH1A 4HWGA 3I5YA 1I1GA 1EDDA 1PS9A 1NXWA 5CAEA 3AFOA 2IPXA 5HNHA 1Y1KE 2AEMA 2ZRNA 5L7TA 2H48A 2FX2A 2RFLA 4YFYA 1MUUA 1XQVA 4M89A 4MCJA 1Q1ZA 4I9GA 4QD3A 2ZUEA 1NBME 1QVWA 3EQLF 3B3AA 3J7TA 3JY6A 1XMXA 2IXAA 3OPVA 2J3EA 2B5OA 1DVRA 4PHCA 4B3HA 4DWWA 3L0DA 4ZIRB 5A0VA 1O97C 2C94A 3NBAA 1MH3A 3MVPA 3LLUA 1RRPA 3ICOA 3AJAA 1SBZA 3PWKA 4GVLA 4O0MA 1P5JA 3TIIA 3R9IA 1B4AA 3QPHA 3F21A 1WIWA 3WRXC 3HCOA 4AF7A 2MT9A 4MPTA 1O94C 4RNDB 1P61B 4DCVA 1W7PD 4TVKA 4X9XA 2HO4A 4RB2C 4DVJA 1FSEA 2AUMA 5CW1A 3TSCA 3QPWA 2Y3IA 4C0KA 1NBMD 1VQKI 2BZ1A 4GOJA 5GZ6A 4PVDA 1EX6A 5JNRA 3TCXB 5BV2P 1IY2A 5CFNA 4KAAA 1AKRA 4AM8A 3NHPA 4G84A 4UNQA 1GQSA 5FAKA 2UZAA 2XRNA 3T7TA 2R1ZA 1M83A 4KGVA 5CVVA 4AC9A 2EV6A 1J7KA 1EGMB 2HWVA 1FCJA 1CJCA 2VNSA 4RY8A 4E3WA 1BN7A 1K8ZB 1Z7GA 3LBIA 4J9UE 3E8SA 4HF7A 2Q4DA 4J90A 4ZEWA 1WULS 2QGFA 1D3YA 5DP2A 4UPDA 3ZV4A 4W97A 4EARA 5AUNB 5HZGA 1UPTA 3Q12A 4BEHB 4FJ1A 5CA0F 5B1BH 4BKXA 2O8KA 1W6RA 2DQSA 5G2OA 1HEIA 3CMEI 2R7ZJ 2A35A 2XY4A 5DBOA 5F08A 3UKGA 1CDEA 2H51A 5DK4A 4BVGA 4GRDA 4KISA 3TNLA 4BWVA 2FQYA 4QGBA 1PSWA 1R36A 1YCDA 2TECE 3AY6A 4ESBA 3IUQA 4XE5A 5AW5A 3SJMA 1E3EA 4RLSA 3ND9A 1WSUA 4ZJYA 3EQ2A 1F06A 1MVLA 2QG4A 2W2OA 4MV8A 4OX9Y 4TZTA 4IEJA 3HCFA 5IM4A 3DFGA 2WWXA 1CEEA 3FRIA 2R6CA 4X41A 5LA6A 2ECBA 2EFJA 2P4EA 4D4HA 4E5VA 2A9OA 4U88A 4WI1A 4BMVA 5EJ4A 2STWA 1LVGA 2VA8A 5AJVB 1X1AA 1YUNA 1AGXA 2JLAA 4PFQA 3ZS9A 4JBAA 4M9ZA 1PWHA 2IPAB 5HM6A 3N53A 2P5VA 3O8DA 4DMKA 5JVGF 2P30A 3EW9A 4M54A 3R40A 1PP8F 1Y8CA 4BZXA 4R2IA 1T8UA 2A68F 3QWBA 4PANA 2CMFA 2GNOA 5AK4A 2VIXA 5E2BA 1W4MA 3KOUA 3VDQA 1TQ8A 3BD8A 4D2IA 1I6LA 2D4AA 4C5CA 2Z8YA 3QE2A 2OCKA 3J80Z 2CWEA 3GCZA 5AM4A 5KKAA 1UBKS 1WQ1R 5GOTA 3GGCA 1NKTA 4QAJA 1CR1A 3A0RB 2C9BA 3FPHA 4Q93A 4QUDA 5GJCA 5C1PA 1JFLA 2LVBA 1DBQA 4QTXA 4FT8A 1XL1A 2ORED 3PX3A 5CVIA 1CY4A 1SEPA 1RZ3A 3AMVA 3DAGA 3L8GA 3PE4A 4GBJA 3L2QA 5A3QA 1QKJA 2FCAA 1UJ5A 4KQWA 3V1TC 4LQCA 3BKWA 6NULA 1Y3FE 3NB0A 3MD2A 1C81A 2FWPA 2YCLA 3SHQA 6Q21A 4ZV4A 5JT1A 2V7GA 3KKNA 5K8LA 3RSGA 1DE0A 1FNSA 1GNQA 3HVJA 2Q0SA 4WLFA 4IHWA 3QXGA 3MMYB 4L5JA 4R8KA 2HPHA 3TOXA 1A97A 4BVHA 2NADA 3G8BA 3R41A 4RMHA 1O58A 4HSGA 1OFCX 2QUIA 3BCBA 2AC2A 1HLGA 4BV9A 4BJHB 4EELA 4EYEA 4EY4A 3QI7A 3T1BA 3RIGA 5TGDA 3IH4A 4B3GA 1CQJB 4EI7A 2AOUA 3JTMA 1B73A 1LLQA 3TPCA 4DC0A 3JATB 5BMVA 4AUEA 2NO7A 1NHWA 5FLYA 4PLYA 2X19A 1BD3A 3MCVA 4MVJF 3UWOA 3W3ZB 1JEJA 1QAOA 4QXOA 5EZHA 3ICEA 4JKYA 4ZVVA 3DO6A 3PFIA 3WKEA 3W5DA 1Y1VJ 5HDKA 1U8UA 4H77A 3CVVA 1CF4A 4Z49A 4HVAA 1N1EA 3FOBA 3NVMB 1GNPA 3B6JA 4XLZA 4ZRNA 3VSLA 1Z63A 4BO3A 2AFRA 2WD7B 1N8KA 3ZGOA 5G0SA 5JS2A 4ES6A 3OPNA 1CS4C 4IS3A 2Z9DA 5KOYA 5K0ZA 4BBAA 1MORA 4S2UA 2PKQP 4Y2SA 3RJZA 2DKFA 4CE6A 3CF0A 3NT4A 1IAQA 2FZGA 1F20A 3RTEA 1KZ6A 1EFAA 4TQ9A 1KRHA 2QD3A 2VTVA 1EGQA 3F4BA 3DTEA 2XA9A 1W4CA 3U7HB 1QPIA 2OPBA 1Y7TA 3VV3A 1PT7A 3QG1A 1RM4A 3KTDA 3LUDA 4WF2A 4PW0A 3IRQA 3KJNA 3RM3A 2VTDA 5G1NA 2AN9A 2NVOA 3BE6A 3FUCA 5GY7A 4RHTA 4PJMA 4DM4A 3HUEA 5BV1A 3HBFA 4XUDA 4KV7A 2V7BA 3P1JA 4DBLE 4Y8VA 3H0DA 2CL0X 1GQRA 3S1QJ 3LS2A 3CUOA 3GUDA 2CMDA 2WHQA 2FSWA 2QF7A 1BIBA 1EDBA 2ID4A 4KPUB 4LHVA 4OYHA 5LFAA 2G28A 3GA5A 2V26A 4JT9A 4OMFG 1MAUA 3MGGA 4UBLA 1A5JA 1F38A 1G2QA 4XQGA 4EJ0A 3HP7A 1MVOA 3LWBA 1RC1A 2HTEA 2OMKA 2PKCA 3COVA 3H2IA 3I73A 5BWBA 4HPQA 3GLGE 4W82A 2X2PA 1JUDA 3MGBA 4KIJA 2RBEA 2Y0DA 4Q21A 1WL8A 2DE0X 2KX7A 5DI9A 2O7OA 1I33A 2QTGA 4C05A 1JG6A 1V7PC 3SLGA 3HBJA 3QQAA 1CZLA 2G5PA 2Q9AA 4JDPA 2XKBA 4LY3A 4UBNA 3F7NA 5K5QA 2VRCD 1FTNA 2BBOA 4MCIA 3W78A 3T8TA 1JXMA 2DCMA 3ZHOA 4EJSA 3O8CA 1TPYA 2E5LB 3SQNA 4PQFA 2GAAA 3RREA 3I59B 4KMUX 3INRA 1NF3A 3R3VA 2QLZA 3BA1A 4KXVA 1X7GA 4NOKA 1WW2A 3RSLA 1ZM4A 5HFNA 5TC4A 1DWUA 1HMYA 1AHNA 2VDUE 2BGKA 1X8LA 5ARDA 1NI4A 2JIOA 3M3DA 2YV3A 1T9DA 4LI3X 2OHIA 4NS4A 1U28C 4IZZA 2D2EA 3PI6A 3VX4A 1O54A 3MJFA 4MGIR 2R1UA 4R71A 3SDZA 5CLFA 2R1VA 4H4DA 2HM7A 3HLKA 2RBGA 5ALHA 3FNQA 5AM3A 2ATVA 2EJUA 2PX4A 2YIMA 3OYEA 4KYUA 1IU9A 4AX4A 3D6FA 4LSWA 3JRFA 3GDHA 2BFMA 1VP9A 3OMYA 4UMFA 3V8KA 4H1HA 3E7PA 1SZPA 1MB0A 3FWYA 4NC9A 3HHEA 5JQWA 1L0OC 4TLMB 1BIAA 3HGTA 4NHOA 2DMPA 2E6KA 4U9HS 3SGLA 4CG1A 5FUMA 3UWPA 5JCOC 3VKGA 2WFAA 3M34A 1V3VA 4PLGA 5GADl 4BC1A 5CIYA 3B8EA 1I6WA 1G5HA 2Z2JA 4LB5A 3ZVMA 1YE8A 2GCOA 1CHNA 2V5UA 4J4BA 2DYRH 2ZJ0A 1W1UA 4FFVA 2RB4A 1C7FA 3AKDA 4HXYA 2OCEA 2UYGA 4GS5A 1ETHA 4NHEA 3NKFA 1JWBB 2ZG6A 3GEMA 1AGPA 4I7HA 2Y9MB 5HS7A 3C0KA 3UBTA 4LX0A 3DDHA 4MW1A 3IVCA 2FSSA 1E2DA 3FR7A 4G5FA 4F9FA 3TXAA 3RZDJ 1UBJS 2AR9A 4HQNA 1W4AA 2GZ3A 1FNDA 2BSAA 3DL0A 5I8WA 2O8EB 1MZVA 4CM9D 3A3OA 4IRXA 1ZH0A 1DEHA 4M6YA 4HDCA 5C7IO 4JYZA 2YY5A 1TQMA 2LP4Y 3G0HA 1ZU4A 3LTEA 1XMQB 3BFJA 4FASD 5DX1A 3QEMA 3AT1A 4F4CA 5L3CA 1FX1A 4KGXA 4D0NA 1QP4A 1QRRA 2HUNA 4P33A 3AONB 4X61A 5BSWA 1Y6IA 4DCCA 4IJQA 1NUQA 1B42A 2CLDX 2GBCA 2W2VA 3OIYA 4EJ2A 3IP1A 1CW2B 4MPDA 4S24A 3TH5A 2AOTB 4XWOA 3FOCA 1Z12A 4DV3B 4Y0VA 1I0ZA 1V4VA 2YTZA 121PA 2GOXB 3FOAA 4MR9B 2PQ8A 2MSLA 2X51A 4I66A 1N2CE 2PT7A 2CCJA 3OTGA 2OD9A 3ZU5A 1MW8X 1CZRA 4ZU6X 4B80A 2VRBA 1OAOC 3DOJA 2E19A 1A7UA 2X86A 3C5VA 2M3AA 1FC0A 3AVQA 1WWKA 3ZMZA 2PO7A 2IOFK 4MUHA 1XMAA 1L7BA 3CR7A 4NZNA 4ZAGA 3SQXA 3IESA 4Q05A 1GAEO 1QUEA 1NH3A 2OZVA 3HA2A 3EIEA 4R1LA 1KXJA 4LLNA 1GV5A 3QVJA 4HGYA 2HHLA 4Q19A 1OVMA 1XJQA 3LSKA 2Y27A 4KBYA 4OUDA 4OXQA 4DGSA 3M9AA 4AMVA 1T2UA 3OMWA 3PXGA 1E7SA 4LXGA 1I32A 1MNEA 1CXZA 1LX6A 1H0HA 2FQWA 1TT7A 3E82A 4QOEA 1X7XA 4GBGA 1EH6A 2XGDA 4X1KB 3W8DA 5I7UA 4OFWA 2UYHA 1ZIPA 2B99A 4EPWA 3DE1X 3U0VA 3BQZA 5EEAA 2KYRA 2NPIA 3A1UA 2D1HA 1A2OA 1U2DC 2AX4A 3EGWA 3MTEA 4K5QA 4X84A 4BATA 4F21A 4KDCA 1DPFA 4EKYA 3JREA 5E9JA 1NMQA 1PT9A 4NBRA 3ZBQA 3HGGA 4Q82A 3RRFA 4DA0A 1KQ9A 4ASNA 1EE1A 3OMLA 2JFOA 2P4QA 2WHXA 4P3OA 2QV7A 1MMFB 2FA5A 1SFUA 1V2HE 2NVWA 3V7SA 2FBIA 3ABTA 3GLVA 3N75A 3PNKA 4NZZA 3GVIA 3CLOA 1KC1A 1QVUA 1R4NB 3GBPA 3A6EA 5BSTA 4F4DA 1AMNA 1X3LA 2QS9A 2HB6A 1Q6ZA 2W58A 3HRIA 4G67A 4MV6A 4V0RA 1O94D 1Y81A 1RWVA 3I53A 3A6KA 4A0XA 3R76A 3GWGA 3QX7A 5AJWA 1Q0ZA 1JZTA 2DA7A 2H5EA 3MWFA 3VR1A 2LCIA 3KBOA 1IYZA 4HF1A 2H54A 3N76A 5ALDA 4N7JA 3RS4A 4URXR 2XDWA 1L8XA 3IKJA 1DPRA 4UDOA 4KYIB 1E1YA 1Y3IA 2IOQA 3T0YA 2O1SA 2PVPA 3GFGA 3BMOB 4K0RA 2OM6A 2VF4X 4F71A 4KPYA 1E60A 1J2EA 3O9VA 4XJTA 3P9PA 4LK1F 3SICE 1QX4A 2K5UA 1DHRA 2RK3A 3A05A 2NSDA 4OSEA 5G02A 1Q7GA 1UM9B 2XB2A 4B2LA 4YJ3A 2P9TA 3G5LA 4XB2A 4G23A 1LH0A 4FGWA 4KI7A 4C4TA 2NS7A 1D1QA 4O4LF 1FE8A 1MXHA 1G6OA 4LZOA 3B7WA 4LYHA 4I4CA 2E60A 2M7BA 2OC9A 1Q1VA 1QUFA 4DRXA 3FZQA 4Q4CA 3ZXSA 4DIUA 4QEDA 4ABTA 2JI9A 3UJBA 4YUXA 9LDBA 4Z53A 1OXUA 4E70A 1LLDA 4RX1A 2IYAA 2ZUFA 2YC4C 1G0NA 3GVAA 1EM8A 1IXRC 3DKIA 2GJAA 4CN9A 9ATCA 3A6PC 3EEFA 1BU5A 2QKYA 4YRIA 3CDLA 5BPDA 4NMXB 1PJ4A 1RKXA 3A70A 2GPAA 3OE1A 5EUCA 4ZYZA 4UXJA 4LNUA 4YRVA 1AGRA 4RKWA 2R1TA 3C8DA 3PSAA 1U8CB 2R7DA 2AVDA 2OKCA 4NBWA 3OS0A 4IJAA 4DMMA 5C3UA 3T7KA 4H7HA 4TYQA 4FGLA 3F9CA 4RPHA 5K4AA 5LZ4A 4NS1A 1ZCAA 4Q4AB 1JSXA 5J1TB 2QJWA 1XVVA 4H59A 4PLPA 4WADA 3PPXA 1AMOA 1JIIA 1XALA 2IIVA 4ZYYA 2Q3BA 2CXOA 1G20B 3L7NA 4J0GA 3V8JA 3SR3A 2QRVA 4MW0A 5M34A 4EY7A 3EPHA 5H9WA 1P91A 2FNAA 1FXUA 3ZPLA 1PQUA 2IE8A 2ZROA 3ECCA 3M83A 4N9HA 4KPFC 1OOEA 3LLMA 1E5DA 2G7ZA 2BYTA 2ODWA 3RKYA 2UXNA 4M9QA 3UWDA 3HVRA 2Z6UA 2WADA 4DGWB 1J24A 1BJRE 3HBNA 4MS1B 4XARA 1NLYA 1QYXA 2ZXFA 2CBZA 5G1OA 2FD5A 4Z2YA 3SEFA 1ONOA 3WXMA 3UB4A 4OTZA 4ENWA 2UUCB 2TDXA 2ZYWX 5FLXK 3OCZA 3ED1A 3FMIA 4K9LA 1HT2E 4KOAA 5B1AH 5BNZA 1NPDA 1KJ8A 3WTTC 3ZZ1A 4B6QA 3C1TA 3P8ZA 3VPRA 4URUR 1TX4B 3WL3A 5EIBC 1A77A 2XSZA 4GYWA 4LSGA 2BSXA 5A7GA 1DIAA 2YH2A 4MW9A 4WY8A 5E8GA 1OU4A 2D5AA 1AQIA 3WE3A 2PGNA 3CIFA 1IBKB 4MVXA 4MX8A 4KQHA 4TKVA 4L5IA 2XECA 3RC2A 1YD7A 2WJ4A 2JIMA 3H9UA 2ESNA 2B1GA 1JJ6C 1FDRA 1ECLA 2OBXA 5KYYB 3IEMA 1BL0A 1KONA 4IZ6A 4AX8A 2NU8A 2HA0A 3NT5A 2Y0SA 1WP9A 2IKQA 3VC3A 4PQEA 4RNCA 3D1NI 3ICCA 2GCEA 3IEIA 1RYEA 1AN0A 5F76A 3UYLA 3ZR8X 4XLEA 2XGCA 1IM5A 1X7XB 2JJ8A 2XKPA 2RH4A 3ZCPA 3NH6A 3QPTA 4ARSA 2FDCA 5B3KA 3LAJA 1KARA 1V6SA 2GK3A 3R0VA 4UMEA 2ORIA 3CLUD 3NYIA 4YJFA 5IP7J 3BSWA 3KT8A 1QIGA 1B8UA 3CG4A 3QAHA 3OPQA 1V3FA 4MUMA 4E4RA 2XTNA 4H7DA 1YU9A 4HAWA 4ZVPA 1SB8A 1N5LA 1Z4IA 4RE6A 5NULA 1FJHA 3ENKA 4Q9HA 2AG6A 5E17F 2QORA 4RFVA 3NAZA 3W7VA 1N3LA 3R6LA 3LAPA 2YHIA 3L8CA 5EWMB 2IS1A 4MUAA 3S93A 3CT4A 4F6RA 4ZEMA 2HADA 1H4SA 4Y2PA 5BNGA 3W79A 4G1FA 5JSZA 1DOHA 5DCFA 2AFVA 2D1FA 2G0EA 3KKOA 1IN5A 3K31A 2BIFA 1XGOA 3UG6A 3A4IA 4Q1BA 2HEGA 2M98A 2LY2A 1NBWB 1Z7YA 4IZIA 4NY1A 4KO2S 3OQHA 1FMCA 2DBQA 2C3OA 4G6ZA 3L6EA 1OILA 1N78A 2VF5X 3AESB 2RAVA 4KI0A 3U4CA 3T3OA 3FXLA 1E5XA 3EJWA 1C14A 4RLFA 3ZRGA 2VSOA 1D03A 2R3SA 2ESRA 4MIEA 1QGED 3TRIA 1FUYB 3U3MA 1FOWA 3MWEB 1L4LA 4UEQA 2R7QA 1R4AA 2IEKA 1G8SA 1XD2B 1PGNA 3ETCA 1U3UA 4KQFA 4RH3A 2ZT5A 4E6EA 5T3YA 4E15A 5AVVA 5DM7F 4LFBB 1OXMA 1C30B 5LRRA 4JP2A 2PS3A 2IYZA 2JMWA 1CUDA 4R7ZA 4N7BA 2Y68A 5KYUA 3RVOA 4FIDA 3GTJJ 4BNUA 2ZIFA 3WV4A 5AVXA 2N9UA 1DT5A 1JXOA 4BNFA 4C4AA 3CH4B 3AL3A 2W70A 1L8OA 3BA6A 1JHVA 3IKVA 1FNBA 1KZYC 1VLVA 2AFHE 3OOHA 4HZUA 3FTCA 4P7GA 3PHIA 4PNHA 5JXJA 4IRIA 1CUVA 1GILA 3MWJA 1ISRA 4HDOB 3J81Z 1H93A 4HEA2 2WILA 3BXEA 2V1NA 4JEIA 4RHUA 4RSGA 4WOBA 4WNAA 4UZEA 3ROEA 5KSOA 1CQTA 1NZDA 3C8MA 3IP4B 1KMCA 1V8PA 3QU6A 4YR7A 5AW7A 4M60A 1OLUA 2QM8A 3EQ6A 3EWNA 3C8ZA 1CUEA 3GMDA 2RC6A 3PVSA 4FDLA 4GNKA 3DULA 4HHEA 4INJA 3R3UA 4A8HA 3DW1X 1H9TA 1Z33A 5D6FA 1F9AA 2IZ7A 2NV6A 2K4BA 4F5EA 3FXQA 4B2PA 3L2WA 4JMPA 1KQ8A 3UFXB 4FSDA 4JASB 1B26A 3CVYA 2GARA 1XXHB 4ZDLA 3WU1B 2ZS8A 2ZWPA 4QO8A 5EHIA 4ZT5A 3RUFA 3SBXA 1MW9X 3W5SA 4B46A 3B02A 2GETA 1ILEA 4KR3A 4XKCA 3DZCA 3G0BA 3UJDA 3HA5A 1Y8QA 4JHLA 4A3EJ 4XGRA 4JYBA 4Q48A 1IC8A 4MQ5A 5FIUA 3KP2A 1T0PA 3DMNA 4RZHA 5C7YA 2ADMA 1NF2A 3PC6A 1DEKA 3G9ZA 4BO5A 2YWXA 4CTMA 5F7ZA 4JI7B 3L93A 4PPGA 5JWHA 1TM3E 2P65A 2ZJBA 3ETEA 2R7RA 2UZ4A 3LA3A 1PYVA 1W6UA 1VA4A 2EA2A 1QH1A 1HYEA 4ND2A 4OP2A 3GWZA 3MERA 4UUSA 1K6XA 4YO8A 2ZB3A 1N1DA 1QVVA 1JL3A 1Z8FA 1E0JA 1HYQA 2O14A 3IE0A 3GGJA 4MVJG 2ZIAA 4V0NA 4GOKA 3K7AJ 2JGJA 4WZBB 1M10A 2HVRA 1H5NA 2PRSA 2VRNA 3W9YA 2X4LA 2P8SA 2XSDC 3WRYC 2B92A 2FZKA 1MDFA 2PKEA 4FLMA 3LDHA 4H0NA 4OBBA 2WF5A 4NOJA 1Q7BA 3PLNA 4TMKA 4RDIA 2G4CA 5F12A 3K4LA 1NW3A 5FTWA 4EFMA 3IIEA 3HWWA 1Q0QA 3WYGA 5LQUA 4AQ7A 2EZ9A 1WDLA 1Y1RA 4ECEA 1W85A 1ZM7A 1JA1A 1GL6A 3O31A 4U8HA 4DJDC 1A4UA 4PHTA 1D1BA 2Q2EB 4Q4HA 2Q0OA 5EPUA 2XA2A 4ALNA 4BZQA 1VPVA 1I6KA 4WFJA 1R9TJ 4WNIA 1SCBA 1QZZA 1WZ2A 1E4EB 1EFKA 4C20A 1GRVA 3M4XA 1UPAA 1A9YA 1HE4A 3QM1A 4B76A 4POOA 3RVRA 2DODA 5FLVA 2BBSA 2PWAA 2I87A 2W2MA 3GROA 1FFWA 2R5WA 4UVGA 3ZOZA 3PLAE 1LNZA 4WX9A 5LD2C 1IZYA 2VO1A 2VQSA 2DOKA 1BXGB 4EX7A 3ADOA 4CCOA 2VP6A 5E6SB 2JB9A 4Q3KA 2WUDA 4N7MA 1L9KA 4QPOA 3G6EI 5TR9A 1H3EA 2V7WA 4PZLA 2VUUA 3FDFA 1E2BA 3RVBA 4NZ9A 3IV5A 3L82B 3PGLA 4MS3A 4PBSA 3DLHA 2XJ4A 4OG2A 2H85A 5E6UB 3VPSA 3DBRB 5CB8A 3ORYA 1U6IA 2ATCA 5FDFA 1YDWA 5ICCA 5GOZA 2O8FA 2ZRMA 3D2AA 3ZV6A 3LFKA 2J08A 2JJ2A 4M8KA 5LZ5A 1DO8A 3OT1A 4HWKA 5GM1A 4E4YA 2BM8A 3QGMA 4I76A 5JTUA 4FIZA 4MRPA 5BOXA 2ZCUA 4FCWA 5F6FA 1P6XA 4LTMA 7REQB 3MJCA 4RPGA 3C2QA 1X94A 1WXGA 3W04A 5B57C 1UFKA 3L7BA 2R8RA 2R6AA 3IAM2 1VKRA 2FSGA 4YJHB 4V3CA 1W2HA 1TVEA 3REQA 1UFMA 2C2KA 2RGWA 3K0BA 3HYCA 5CFOA 3HCWA 5BN4A 2OGZA 1UP7A 5IC5A 3T7EA 1OJ7A 4Q24A 1LPOA 2JAPA 2WWGA 2LREA 3KKZA 4Q5SF 5K4GA 1XG1A 3HJUA 1JKQC 4OL9A 4IQ4A 5CLLA 1H1DA 4ZU1X 3ZIUA 1KP3A 4AJJA 4D9MA 2L2OA 4E31A 2ESHA 1J07A 2CJWA 2VUTA 3K5HA 1MNQA 3UGQA 5LM3A 3QTTA 3LYUA 4IVQA 5TIIA 3L1UA 4XFDA 5CHYA 3MUOA 2NXJA 4HX5A 3PGVA 5H3HA 4CUZA 4F4JA 5EXDA 2NAZA 1H0MA 4KZPA 4QWQA 4OMUA 1YDHA 4DB4A 1EJ0A 4YT8A 5IUKC 4DREA 3TPZA 1K4MA 1RPJA 2Y1LA 4POAA 4IFIA 3E2PA 5IUJC 3NHZA 4J7CA 4UUPA 5TGZA 1YWGO 4FWBA 4G86A 1IAVA 4OK6A 3HN6A 4QDKA 1DQZA 5LN1A 4CF7A 2LMDA 1N8NA 2QLBA 3EGXB 4GU5A 4Z7JA 3BR3A 6PFKA 4PR3A 4ZYWA 4IV0A 4F1KA 3PNOA 1JB1A 5LQJA 4Y33A 3L0ZA 2EH3A 2C95A 4FNGA 5LMNB 4HEQA 3I72A 1FS5A 3Q10A 4MLCA 3WAKA 3SEQA 2BHRA 1K2WA 1C1YA 2JD2A 2JGLA 4G85A 4M9CA 1YMQA 1ULBA 5H1YA 4FGUA 2XVXA 2DCEA 4IZHA 1W88A 3DQQA 1JT9A 2ADFA 2YDXA 1B8IA 2XWSA 4L16A 4N5DA 1UCRA 1IOLA 1ZCBA 4E88A 5A1JA 2XUPA 4CO8A 4D41A 1W76A 1N5JA 1OLTA 4BNDB 2DJ5A 3EA0A 4KE8A 2OXIA 3RVMA 5JRDS 1LX7A 5BSHA 3NBKA 1EH5A 4GD3Q 2O54A 3T15A 1FYKA 2X13A 1TIBA 3IVMA 4J76A 4OFXA 4RACA 5DM4A 3UT0A 5TMDA 4YQFA 1W47A 3D6HA 2OFOA 4JQCA 4KR2A 3GT0A 8ATCA 1PWYE 1IOVA 3GTPJ 3AR4A 3C5WP 3IHWA 5AT1A 3CLUC 4W63A 1C9JA 5EQFA 4DYHA 5HIMA 5K5EA 2VKHA 2AC7A 3W34A 1IN1A 1UJMA 2QTAA 2FN4A 4IQ0A 4MR8B 4O2BB 3CC2I 4FSXA 4BBRJ 1SXIA 5JRZA 1ECJA 1DFHA 1B59A 2G06A 3O7MA 3D4BA 3K1JA 4HFJA 5DDGA 4JJGA 2I6XA 2Q2QA 1IB6A 1OZFA 1UKYA 3L1KA 3VR4H 2ZRFA 2FG5A 3F6BX 4DADA 2MGQA 1GR1A 2CCGA 2Y31A 5A62A 5CT5A 3NORA 1DGQA 1WG8A 1TPZA 5COBA 3HJNA 2VP5A 1QO7A 3OIWA 3TW0A 5BVGA 1MIOB 2VUIB 3H1GA 3EFOA 2RHBA 2QU7A 3CINA 3QEMB 4EGYA 1S3JA 4R69A 3DPLC 3IUPA 5CNKA 4FFDA 1KZ1A 3NIDB 4IUYA 1Y1LA 3PXDA 4DKXA 3H75A 1UFOA 1YQ9A 1EP3B 2OXEA 3II6X 4IGIA 1B1BA 2WTUA 4DQXA 1R88A 1R64A 4MQ9F 1FMJA 2VAMA 1FUIA 3K9NA 4JJ7A 4OXIA 4YRDA 1Z47A 5ELLA 4YT2A 4NENA 1ZNQO 5COQA 1TJ3A 2AW5A 5I7OA 1JPJA 4FFLA 3PDIA 2BW3B 1W8DA 3DXXA 5KJ1A 4HDVA 2HPIA 3HJEA 3NM5A 3TX6A 3OZDA 3C6QA 4WLOA 3TTUA 2A9PA 2ATXA 2WVHA 1IQPA 1WXIA 3OT4A 4H0FA 4OJYA 1O6FA 5AH0A 5DBIA 1RJDA 4BKPA 3AVUA 3EUKL 1XWWA 4AYXA 5JFRA 5GPCA 4DAEA 4M3BA 1R5OA 3KIPA 5ETJA 1VKJA 4BFWA 4WZAB 1TEXA 5EKTA 2R8EA 1LV8A 3EDQA 2E1NA 2JT1A 4PG4A 1G5IA 2B4TO 2Q5QA 1ON1A 1XDWA 1GTG1 4IIYA 4W8OA 2WTEA 5GP1A 5JZMA 4ND6A 2A9FA 5DGIA 3URMA 4GOND 2GH1A 4IIBA 3X1WA 3PPIA 1QRTA 4W5WA 2FQXA 2D06A 2ORVA 3HU5A 2WQ6A 1I4OA 3P5SA 2RGAA 2R7LA 1U2GC 4CR6A 3U4QB 1NUSA 1LGYA 4ZHQA 3ASUA 3EDRA 3R3YA 3R9WA 4QU8A 4G81A 4BP9A 1CRQA 2VRWA 2WB1N 4E1AA 1XPOA 4N8EA 1QGUA 2FR1A 2BELA 3S2DJ 3LFTA 3I4CA 4ZTBA 3ZWKA 3HMQA 1YOVB 2QR2A 2BOVA 4UUMA 5G0UA 3UK7A 1Q95A 1LPNA 2XYRA 3CCQI 3WC4A 4BCDA 4I46A 4FNAA 2GCNA 2C58A 4N1AA 5HVNA 4MVJM 3LTNC 2BGUA 2AJLI 2R7KA 3ZW7A 3U3RA 1QF7A 3B60A 2IY7A 3M49A 1Q7TA 1YSCA 3DEUA 1SQ6A 4MSUA 2Q2WA 4NENB 3IH3A 4GDMA 4MQ4A 3A4MA 1P4JA 3N8GA 3V34A 5B1HA 2NYUA 2P6MA 4Z9AA 2R7WA 1S8OA 3ANMA 1XROA 5IXJA 3TG8A 1R49A 4DCSA 5FPYA 3GRFA 3D0RA 4MKHA 2EFEB 3AM5A 2WMNB 4EYGA 3VHXA 2IW3A 3TLBA 1RI3A 2VOPA 1JT2A 2DTXA 5HWSA 1OISA 1DIRA 2G80A 2VUHB 1QHNA 1C2TA 5BOSA 1MIOA 2IGKA 4KNYA 1T0JB 2Q1SA 3AOEA 4KDFA 3E9NA 5K3DA 1XLTA 1ZA2A 2NYAA 3L9WA 5D3KA 3C4QA 4JYCA 4NZPA 3BG6A 3DF9A 3LUBA 2B8EA 5JW6A 2FPKA 2JKZA 2W22A 4GGGA 3FCYA 5CLHA 3PFWO 4K6MA 5ILQA 4DWJA 1I2BA 3BCSA 3H2BA 2ACVA 1YX3A 5MFPA 1ZOOA 1F3OA 2VAVA 3W2HA 2RGVA 4OM8A 5KOIA 4DPMA 4UTRA 2ASVA 2V7FA 3ZMUA 2WZCA 2R5YB 5DV9A 2QGUA 2BGNA 1G8GA 1VHQA 3UN1A 3RD5A 1YQUA 3G5TA 1JI0A 3BERA 4IDFA 4IKEA 2GASA 1IVNA 3N2GB 1ZW6A 4F97A 4MFDA 3DV2A 5FULA 4UUQA 4F85A 5B4TA 2FUG2 4QASA 4YJ3F 4E21A 4KVFA 4KVGA 1CJVC 3AFHA 1LTHR 2OTCA 1LDNA 2JCVA 1K5DA 3AY7A 3FPAA 4QWMA 2CXPA 5JR3A 1MN6A 4KRXA 2CNOA 2XYVA 3KEGA 1T9GS 1RWOA 3GJ3A 4L6IA 1BI1A 3KLOA 2WM8A 4HSEA 4DCMA 4EJSB 4DPKA 3MIZA 1EWQA 4EY6A 3N2ZB 3WTUC 2ERCA 1U2QA 3F6VA 1EFTA 1OBCA 2FDRA 4BBJA 3OWHA 4DBQA 4EQZA 1OT3A 2MSDB 5DT9A 1RXVA 3PNTA 3HK2A 1H85A 2MHCA 2PLWA 2WB4A 3EAFA 2Z2ZA 2ZQZA 3E6MA 1BHO1 3T1NA 5BOSB 1UOPA 6GPBA 5HOQA 2AF3C 2NVQJ 3IB3A 1WHTA 5D87A 3TYXA 2JFZA 2PVCA 1YA4A 1WCIA 4OH1A 1MOZA 2BSQA 1EKXA 1F2UA 5T8KC 1Y5LA 1Q44A 2WA0A 3CRMA 1FTYA 4FOPA 3V8MA 2GD6A 1TQ4A 2ZULA 3HM2A 4I3GA 2IS2A 2I2BA 4CM6A 1TWHJ 2DM6A 3S8MA 4JOSA 2Z6QA 1X0VA 2PSDA 4GM4A 2CHEA 5I7FA 1W0TA 3QWFA 4R0NA 3DD1A 4X66B 4AWBA 3TKYA 3KL2A 1U8RA 1RI1A 3DM9B 1SKAA 3DJYA 5CVUA 2FPLA 2YN2A 4MB0A 4TSKA 3IMCA 1UADA 2C1EA 1FZTA 4OOEA 4OK3A 3K4QA 3RYPA 3FN4A 4IGFA 4E5DA 2KZVA 2OGSA 2OOSA 2PG3A 1FNMA 3FYUB 3I9OA 3RSOA 4XM3A 4IJKA 4LCBA 2AQEA 2VE8A 4UQOA 1IONA 2DPMA 2F1IA 5E4TA 1NR1A 1RJ9A 1Y0BA 3EA4A 3WWCA 4KDPA 2JJYA 3VKUA 2DR2A 1ZIOA 2W2TA 1QZEA 1C7ZA 5KI6A 2VNIA 4E11A 3V7RA 2BT4A 3CQZJ 3FBNB 1B8IB 4ENTA 4BNZA 2J6IA 4IDAA 1EFUA 3BD9A 1PUEE 5IARA 4CEJB 3MGKA 3QK7A 3JRWA 5GTIC 1T9AA 3DVAB 1FK8A 2OESA 1RYMA 3I5UA 1XHFA 5EEHA 1N1MA 1NR5A 2NVBA 4FYHA 1IXZA 4ZTFA 2C77A 4R2JA 2NMVA 1N9GB 4M1WA 4AS2A 3FCAA 1O6BA 2WAFA 3QE3A 2X0FA 2EU8A 2V3CC 2M0MA 1DP7P 4WJLA 3NTRA 1M8KA 4Q9LA 3SNHA 5CMLA 1J2UA 1FP4A 1ZUIA 4EYKA 3HKEB 4DY6A 4QLCU 2QP4A 2E37A 5ALZA 4N4OB 2JK0A 3GZ6A 3LIIA 4ZOLA 2J7PA 3GFTA 2HMUA 2FEMA 2YWJA 2GQQA 2QG9A 1QGYA 3DKVA 1P2VA 4KQMA 1UXJA 4BKOA 3U1VA 2YKGA 4BB5A 1QHIA 4KLAA 4G01B 4KR9A 4Z3KA 5AVWA 4LZJA 2Y0EA 1K98A 4G0NA 3K2IA 3N74A 3QV2A 4G1CA 3EIQA 1O97D 4HBLA 1CUIA 3AG5A 4BPBA 4O1IA 2QZZA 4MVJE 4TWBA 4JB3A 3ZHXA 4ZICA 1KEWA 1ZAYA 3QP5A 2XQFA 2QVYX 2IYFA 4Y0AA 1KQFA 4G8DA 4TQGA 1ODKA 3H4TA 2D45A 5IH3A 3G2NA 3NJRA 3B1JA 4U7DA 1XNJA 1MA0A 3CLHA 1WY5A 1ZUD1 2EJRA 1PBTA 1XPXA 2W2KA 2XUOA 2NTNA 5JLXA 4HRAA 4H6WA 2WOJA 3L2OB 1RZRA 5DV5A 2K4JA 3E5QA 3OP1A 2XEDA 3LY8A 4Q00A 2OQ2A 3RYIA 5CJ2A 1KO8A 3ZHSA 4YP5A 4AKIA 1SIUA 4RHFA 1MGTA 4YQZA 2WWVD 3V7FA 3WSVA 3EW7A 2PMEA 4L9JA 1P2DA 3DR5A 2PT9A 4C0JA 5ALFA 4ZMBA 3F3XA 3LUPA 2GA8A 3AV3A 3N4MA 4IIEA 5ECYA 4GC5A 5EP4A 4ZC1A 1KYTA 3TX2A 1UHSA 4AFNA 3L0SA 1P7PA 1KEVA 3KFVA 3DHYA 3ZK7A 2DUJA 3X1DA 4F84A 2PD4A 5EWMA 4CW7A 1G9TA 3GFFA 4Q9IA 3TQCA 4BQRA 3TXXA 3OETA 2WYWA 1MO5A 3CX4A 3O83A 1GKKA 2HYDA 2PH7A 1P7IA 2YICA 1NUPA 3QTBA 4AKSA 5TT1A 4EB3A 3OJEA 2OMEA 3H2ZA 5HKLA 2P2YA 5FB2A 4OQFA 4LJKA 2CJJA 1YBMA 2XI4A 3MTGA 5J2TA 2IZZA 3BMCB 3TTSA 4OHKA 1TM2A 1I7PA 1OD6A 4OVKA 2ZSIA 3I4PA 1FFAA 1V4BA 2O4CA 1TCUA 3QEKA 5KYWA 2JBWA 4DLSA 2K9LA 2V0GA 3ZY6A 2ATIA 1JAZA 1XZLA 4OGGA 4A91A 1Z5GA 1Y6RA 1HH4A 1B3RA 5AMXA 3WL7A 1IQUA 1MGPA 1SRRA 2JGKA 2O3QA 2VHQA 3BRWD 3IQXA 2CLKB 2JHFA 4G5SA 4NYMQ 3H9QA 2GPSA 2JK1A 1GUYA 2PV0A 3LPNA 3PRYA 3T1QA 1ETVA 1MJHA 1I51A 4HQEA 2O6GE 3BQMB 1KPGA 1TAHA 2IYEA 2P5TB 2X3YA 4L8VA 4PYIA 3HL2A 3RYIB 3SOPA 3LVBA 3ABIA 4YTEA 3TZCA 1HSZA 1T0UA 3KK0A 2AZTA 3CX6A 4UNRA 5CCXA 1QMGA 1I13A 1U90A 2P3LA 2YX1A 2WPNA 3L8FA 4F96A 4HLUA 1VFPA 2FPGA 2PXAA 3ILXA 3DEZA 4HWPA 3R61A 4WEQA 4YJ2F 1IH8A 1Z6PA 1AM4D 3SXUB 3VYSB 1B15A 1VFCA 1MRNA 2RH9B 4XIFA 4D9KA 4EG3A 3FMSA 4F1JA 4F3KA 1YASA 5T5QA 3OVMA 2YPRA 4MQBA 3JAMK 1NW7A 2GDZA 1HDPA 3L8EA 1L4YA 2VDJA 5KWVA 3OCXA 1VOTA 4XYBA 1EUCA 1PR4A 3IMGA 2O5VA 4NV3A 5DHAA 4HAYA 4L5BA 5DYWA 4RTNA 3VJRA 3ZGLA 3T4XA 2OKGA 1L7DA 2TS1A 4MGRA 2ORYA 4IXTA 3M8FA 4D5EA 1E58A 2XUFA 4FBGA 1JP7A 1U3FA 3NXSA 3REQB 3MZYA 3TZLA 4B83A 1OB5A 2MSNA 1ZWLA 2PL5A 2YSRA 1PUJA 4GF5A 1NMEA 4HYTA 5D3QA 3AF6A 1TQPA 3HDHA 4C08A 1W7AA 4PHFA 4QUIA 5JCPA 5E9AA 5C4XJ 1KEKA 2CQ7A 2I91A 4ER6A 3UXEA 5LQAA 3AUXA 2IUEA 2H1OA 3V6LA 4X0GA 1AK1A 1EE9A 1OFHA 1ZITA 3PK0A 4MJLA 2BMWA 1N6NA 1DOAA 1SZDA 1XZFA 3G59A 5A7HA 1JDNA 4C0QC 4J0QA 3ZU4A 4CQLB 4F3NA 2HVQA 2XH8A 4B6GA 3WGKA 1TLTA 2YHAA 3E9MA 5TE9A 1HDZA 3JRCA 4CF6A 1CUHA 2PRJA 5A5FA 3A01A 3ZHRA 4DNOA 1WU8A 2UKDA 5FT9A 1EUDA 5BXQC 1D4FA 2PE5A 3B6IA 2QD5A 2VLAA 1DG3A 4U3JB 1TC3C 1YVEI 4XZ3A 4BHTA 3P0FA 2IYRA 4ETWA 5B4VA 3VPGA 1CUCA 3DZKA 4IMRA 4QJBA 1T24A 4UU8A 4CR7A 2H92A 2RH5A 1JX6A 1JJFA 2FUG1 3UOGA 1SVIA 2BY4A 2WWWA 4MUNA 4FSHA 1O89A 2G07A 4JYMA 3ZQQA 3TSAA 1K4TA 1U7XA 3QPBA 3V46A 4ITRC 3WGHA 3L01A 2HCJB 1YO6A 4JODA 3ONQA 1YS6A 1JIXA 2IYVA 1WH7A 5DO9A 3ROFA 5KYYA 1RQGA 1LLUA 4UUVA 3DL7A 1MTZA 2A9RA 4HDNA 5JCOA 2FN3A 4ZYTA 5M7EA 3P4YA 2MYPA 3QSYA 2H6CA 1KI6B 5C32A 1WXWA 2C6YA 3D7SA 5B1DA 4BN5A 3TEJA 4J4HA 1L4UA 2OOKA 2HNKA 2C3YA 2YN4A 2B9EA 2D8AA 4IW3B 3C3DA 4L51A 3ZOKA 4E5MA 3C3YA 2LSOA 3C7JA 3DVQX 3OZAA 1JXSA 4ZCPA 1X7DA 1KTVA 2JCGA 1CTQA 1P72A 1T13A 4L9VA 3KR1A 3AILA 3VC2A 3DTTA 1M1YB 4AICA 1Z7EA 4C7MA 2X6YA 1M5TA 1C1HA 2B25A 4FE3A 3RGGA 5DCMB 1TUBB 4N3AA 4BO4A 1WZUA 3CM0A 3L0IB 2WVGA 3WICA 3IP5A 1QU3A 5DM60 5HZMA 2OGWA 2J3KA 4ZVQA 4PGGA 2QTWB 1CLUA 4F5ZA 3FIWA 4BGDA 2IDJA 1XJ5A 1I2ZA 3E18A 3QPUA 1V2GA 4Z8XA 3S2IA 3SF0A 3UJCA 5HK9A 2PMBA 2YXEA 2VC0A 2H08A 2OCBA 2VDVE 4LHXA 4Y1RB 2X0EA 5CM2Z 4HDAA 3QLJA 5HCUA 2ONYA 1EBFA 1INLA 4IFBA 5JEEA 2WNHA 1L7OA 4XQ0A 4HA8A 1FRNA 2QVCA 3E8MA 4M3NA 4DMLA 3A02A 2WNSA 5HLIA 2DWOA 3CFYA 4QHYA 2GD2A 5U1PA 3UANA 1JEQB 2B0LA 3JD2A 3STHA 3QENA 4NBKA 4E4HA 4KLCA 4EKIA 3T5PA 2IF0A 3BD7A 4OMCA 4RIGA 2E3JA 4HYEA 1AB5A 1VLZA 3HKZA 4XN3A 2W71A 4NC7A 1TKBA 3H2KA 2X76A 1Z3CA 3D0OA 4YAOA 5FB3A 2IWHA 4DG5A 5I9TA 2PYZA 3PC8A 1DCKA 4GPIB 1P18A 4ZDKA 1A6IA 2ONZA 2VDWA 2PQMA 2A67A 3T5TA 4AYTA 5KQMA 3BJOA 4ZODA 5F1KA 4UZSA 3AY0A 5EUMA 1DQNA 2GVNA 1XTPA 2CMHA 4GYGA 1LFPA 2OBPA 2FG7C 3O92A 1ZM2A 3WTSC 1M1XB 1RBYA 4W9NA 4BAYA 4K6KA 1JU9A 4S05A 1EVIA 1WKBA 3RNLA 4HT3B 2JLVA 3X3HA 5GAJA 4JBGA 5FPQA 1YTLA 4R3UC 1Q1AA 2RCNA 1KF0A 1PJ3A 1TVKB 1SVKA 2W6ZA 2X0LA 2CNDA 3ILVA 2FQQA 3IMFA 3U17A 3WIDA 3EHEA 3M8EA 1UBSB 4YJ3B 5KNDH 3HGMA 4OHVA 5TPWA 1YUMA 2Q2OA 1XZJA 1NIJA 4FONA 3ZN2A 4JX6A 1ZZEA 2H1HA 4MUXA 4J1TC 1KPIA 3G7UA 1X1BA 1VI2A 3M6LA 2V7UA 1XCLA 4TL8A 1I24A 3UCEA 3ML1A 3WMGA 1XZQA 3VC7A 4OFBA 1O2DA 2ODAA 2OXFA 3ORQA 4R31A 5D86A 5ILGA 4ND3A 5DCWA 2QYOA 3NEUA 1FEXA 1OE0A 2CL6X 3RKWA 1Y9ZA 2WV7A 4AXXA 2JRCA 3F7TA 1CJKC 4KN4X 3F1LA 3CJRB 3GEBA 3H13A 4E7JA 1DOZA 3E1GA 3QKTA 2YZMA 4GGPA 2JA2A 3M2TA 3PI7A 3OE4A 2F90A 5ICGA 2OY0A 4IDQA 4R1SA 4Y1FA 5EKDA 1Z77A 1K6EA 5IJ9A 4JOMA 1AG9A 3H42B 4O4IB 1AN9A 4Z0TA 4UTNA 3FHLA 1F36A 2RGYA 4LSMA 4MCAA 1AA6A 3CE6A 2QOEA 1QIMA 2QM7A 4GLOA 2IOYA 3BS4A 5BSUA 2EKQA 4ZQEA 2GKOA 2FEOA 4JLSA 2HRBA 4CCWA 2ENWA 3R5KA 4PYRA 1JFRA 1DEAA 1T34A 2AN5A 3H9BA 4B87A 4A92A 3Q1KA 3VR0A 1ABFA 3A7DA 3AI7A 3B6KA 3LXXA 4UEJA 4A8JB 16PKA 3KTFA 4K86A 3QKRA 2CSUA 3L8YA 1VBFA 3H92A 4GPD1 2MYSA 1UMDB 3WLFA 3AL0C 2STTA 1V11B 2J8ZA 3ZK9A 5FP0A 3W8NA 3MK31 4C3OB 3N28A 5JHGB 4OIOF 2EW2A 4MEBA 4S1NA 2QBYA 1ULSA 4W6QA 4L5CA 4XRRA 3JRHA 3P5BA 4WK6A 3HOVJ 2X2FA 3W2TA 3S8EA 2RNGA 3J81K 4JJAA 2QENA 3OY7A 4C7XA 1TTTA 2P6RA 4ENQA 1XLVA 2H5LA 3PO3J 2VH1A 5KDLA 4CM1A 2PX2A 3ZN0A 5FH9A 4JC8A 3QPSA 4HAUA 1Z34A 3HUDA 2XKOA 3U1TA 4O33A 2OA0A 1OTXA 3V8EA 1W5AA 1XCOA 1TT5A 3L05A 4GMHA 4RKRA 1B9NA 5ALWA 3M6FA 3ADBA 3ESAA 3QEJA 3QLVA 4RE5A 3CC7I 5CR9A 2YJ6A 1Z82A 3F3KA 4NOLA 3T61A 1LI7A 3I5MA 4YJGA 5CX1A 2WHPB 5DIZA 3OURA 1LWOA 5CYGA 4FMPA 1QANA 3N2EA 1QDLB 1KDYA 1EB8A 5K5RA 3SC2A 3TZKA 4DMHA 4PAQA 4BNVA 7ABPA 3LD9A 3DE2X 4X6YA 5LB2A 3G9TA 2C7VA 2GVZC 3KPHA 2O7QA 2F5DA 2CK3A 1UM8A 3USES 2C9YA 2QAJA 4YMIA 2OZ6A 1E5VA 2XZDA 5MFZA 3QH4A 3VB2A 1A1SA 2O6LA 1R74A 3N07A 1H2WA 3L7AA 3SJ7A 3HE3A 4B75A 4ESFA 2FF5A 3D8HA 1ZRNA 3S44A 3CUYA 4IO1A 2OHFA 2WZDA 1U81A 3X44A 1IY0A 2AVNA 1SR8A 3RI4A 2DYKA 3QXSA 4PZPA 4E03A 4KE6A 2G7UA 4R8HA 1BXGA 2Y4OA 2B20A 1WV0A 5JAQA 4HD8A 5IC6A 3OQIB 1XO1A 4JLMA 5B3SH 3VNQA 1JE1A 3D6MA 3QEOA 3VZDA 3ORHA 3PTLA 1R58A 1YRQA 3AV0B 5GTDA 2DQYA 4RZSA 3E7WA 5ER6A 3I05A 3WLQA 5I01A 3IRUA 4KICA 2I4LA 2IEZA 3QLVC 4D4MA 2YJ5A 1E66A 5JVDF 1E96A 1OC4A 5GONA 3E4CA 1YGYA 1ECFA 3FFWA 1R10A 3IAM1 3TDZC 1PGJA 4FFWA 5CTAA 2WM9B 5BQOA 3WGNA 3R4CA 4C7KA 1UPBA 4OXKA 3RRNA 4CT4B 1CF2O 4E30A 3UJ6A 3I9FA 4KLZA 1I5OA 2PDAA 4IWXA 1E6LA 1TL7C 4YEJA 1V26A 2WM2A 3MTAA 2OENG 4PZJA 5A71A 3KE9A 4FHEA 3GLHA 4HFMA 2Q7OE 1ISSA 4X1IB 1I3QJ 4JX8A 1V96A 1WJFA 2RHWA 2D2FA 1MBKA 3LQRA 2XDYA 3WKDA 2GFIA 5BUCA 4RK6A 3SZGA 4EHLA 2CB9A 1NW4A 3DDOA 3SDSA 2BGGA 2PQ6A 4HNAA 3S7TA 3DMYA 4KL8S 3B6MA 4XGQA 5KYGA 5JLWA 1BCRB 1T1EA 1E2HA 2WSIA 1BDMA 3CF4A 3G9UA 2JAUA 5JZ9A 1Y89A 3N0WA 3NDJA 2W8ZA 1H4QA 2FJ1A 3GH3A 3I83A 1G0OA 1NA5A 2CXSA 2L3DA 2L9VA 1AUOA 2PZMA 5AD1A 5FJIA 1RPWA 1U9IC 2SKDA 3GJSA 2DETA 2HMAA 3FWHA 3PIOF 5HDNA 3M3YJ 1UC5B 2BFEB 2CLFB 1OSNA 3DZDA 3E5HA 3KVVA 4MA4A 4UHKA 4YRFA 5LIRA 4FYKA 1IJBA 4XD7D 3C1DA 3E5UA 4LE2A 6REQB 1NXTA 1IXSB 2CXHA 1RRCA 1XRNA 2CFTA 1DCFA 3BXZA 4O4HF 5DDIP 4BNDA 2QA5A 2Y1EA 3C6ZA 1YA6A 3ZWMA 1XB2A 1YDMA 3M2PA 1QHHB 5DYNA 2KRHA 4YB8A 3OCVA 3ZCXA 4GO1A 2EG5A 4JVNA 5EYPA 2GWRA 2IPNA 2WDPA 2XGOA 2YR0A 4EKGA 2XVCA 3KT6A 2IHJA 3IPCA 2B4YA 1LDBA 3OA2A 5EXPA 5HG0A 1D5YA 3OF3A 3DLAA 4BO2A 4TZ0A 3K10A 3HZOA 3K73O 5DI3B 1ZG1A 1NRWA 2WIFA 5AW1A 3ABOB 3MNFA 5KCMA 4RYLA 3EF3A 5DT2A 2H63A 1K6YA 4Y7NJ 1HKTA 1M1NB 3CW2A 2IJLA 1K8XB 4GWKA 4XQEA 2DZDA 2ORWA 3BFKA 5ADHA 1QRAA 1WR8A 2AEJA 1ISGA 3JQBA 5EIHA 1Q21A 3DTVD 2VG8A 4QSMA 3RFVA 4DIOA 3E2MA 2HOTA 1CJSA 1EVKA 3MBOA 3MMZA 4L73A 4R7GA 1XAJA 3QVOA 4WAUA 2G4VA 1QTIA 2E89A 1FP7A 4NJEB 5IVPA 3DONA 3C3BA 5IAOA 1CX9B 3N6RA 3QW2A 1B6RA 1SQ0A 1V41E 3COAC 1YHZA 2YC2C 4TRNA 5U4XA 1Q14A 2EP5A 1PU2A 5A4DA 2OCYC 4BYGA 3CEAA 1P0CA 4IS2A 4L0MA 1WQ4A 2J9YB 3RSSA 4EJVA 4DR2B 4R0VA 2WC1A 3OIVA 5C8XA 1YIJI 1NG1A 3AKYA 2M1ZA 4C0AC 3QF7A 5ILUA 1CE8B 3RS0A 4B4DA 2QLFA 1M34A 3GFIA 4D8TA 3CW9A 5JMWA 1Q0LA 5K0TA 1QGDA 2QTBA 4LJSA 1OC2A 3DG9A 2B94A 1ONNA 2GCPA 3IEPA 1X1EA 2J5PA 4DW8A 1WXFA 4HVCA 3G5AA 4ID9A 5K0FA 3R4VA 2SKCA 3S29A 3F5FA 2C4WA 4TOIA 4HB4A 5K0SA 2PUGA 3EX7C 5JE8A 4EM2A 5JVDB 1V7ZA 2QR5A 2FRDA 2GKGA 3UB2A 4CM8A 3CU5A 2Y2UA 3BXFA 3EMKA 4PX2A 1YG2A 1P7JA 5AVUA 3I1JA 1O96B 1TM5E 2WWIA 3SXPA 5JJCA 1IUPA 2EV9A 1U7WA 2X8AA 4LYDA 1TJYA 3K4JA 3ECOA 1B72B 1SCQA 5EJCA 2H9AA 2XGGA 5C35A 1YMUA 2ZBGA 3CN7A 3NJ8A 5T57A 4Z1OA 2LGJA 4BNNA 1RAHA 1LKXA 1AF7A 4KOEC 4NBQA 3HN2A 1Z3IX 3G85A 4OEHA 1V1RB 2F6RA 5I5GA 5T41A 2ZI6A 1SC9A 2ZVQX 1WVMA 3U3XA 2UV8A 4BLQA 3QVGA 5KOHB 4AO8A 1G41A 1P62B 4Q02A 4E5UA 4GP9A 5CP8A 1H2ZA 3KZ1E 4L57A 1KY3A 1L8AA 4NCAA 1F17A 5D8DA 4CDNA 3ABUA 3PWTA 5FEMA 3KS9A 3AG4H 4XX0B 4JR2A 4MYRA 3SIPA 5B6JA 1WNTA 1H89C 4EZEA 1RM5A 4D7AA 4MP3A 3TQQA 1FUEA 3BTLA 2YCBA 4JKIA 4B4WA 3OICA 2Z6AA 4TRRA 1E5LA 4EMSA 1I30A 4Q47A 2BCEA 3KV3O 4KR7A 1RCTE 2DOEA 1UFVA 1R00A 2XZTA 3RSNA 3LQ1A 3OX4A 3IIJA 1SXPA 3FNFA 3H4VA 3NMUF 4NKRA 1JSCA 4ZDOA 2E1MB 4L7VA 4B4UA 4YCCA 1U0FA 4AJ2A 3K8OE 1RT9A 4KR0A 3EZYA 1XVLA 3IJ5A 4EF4A 5HNKA 2NVUA 5FD8A 2NW6A 1XPRA 1O94A 2Z2SB 2HLDA 4NMLA 3EMBA 3UK0A 2WLSA 5JZOA 4CG3A 1R23A 4PCQA 4G7OF 3LDAA 3NTUA 1XUOA 1WMFA 2HBRA 1S3SA 2O2XA 3BZ6A 3UBMA 3BCHA 3VJKA 4CL0A 2QIOA 1W0KD 3U7QA 1RYYA 1DUIA 4M73A 4KLNA 1KP2A 2BTQB 3GQVA 2PKRA 2IGOA 1QIDA 1X0XA 2QRUA 2VQDA 2IHTA 2WQZA 1D3AA 1M2HA 3C85A 3IHKA 5DYIA 3A03A 5JC8A 3DQVC 2G25A 2VVTA 2B5VA 1ZNZA 1R6DA 1HFEL 4RDXA 4URHA 5HW0A 3KALA 3M3HA 5ESXA 4LDQA 2FMUA 3GPIA 2PR7A 3EXHC 1FS6A 3E81A 4L4ZA 3FI0A 4BZWA 4ZCQA 3ZQJA 4EDFA 2ZCJA 5EXTA 2IGBA 3ANTA 1Y7PA 3BHJA 1DKLA 1DRVA 4D42A 2RHHA 2R11A 2XSZD 3IPXA 1W94A 3MBKA 2Z08A 4WCFB 1WMSA 4EIWA 1Z56C 5ARBA 3ITNA 4WUVA 2JCXA 4P2GA 1B6TA 2F1KA 2YZ7A 1JJBA 4KWIA 4YYZA 2RB5A 4GPBA 1IZ0A 4AY5A 2OLJA 2XUAA 1VQ1A 1LBHA 2C2WA 3K9QO 2ZT7A 4O2AF 4PXYA 2JIZA 1BYIA 2XOEA 3CF4G 3HG7A 4A3JJ 3MJVA 3OEEA 1XRPA 3V1UA 3V7UA 1USKA 2IF2A 3V33A 2O50A 2UZ3A 1BNCA 3BPSA 4Q12A 3U4AA 4BQNA 2PUEA 1Z2OX 3DM5A 3RFUA 1O5OA 2NLOA 1QCYA 4IDHA 2FBKA 2K9NA 4LLGF 3FMVA 3VTZA 2QKMB 4YAIA 4YIHA 3NZEA 2FX3A 3RFTA 3V2IA 1CS0B 1TGVA 2GZSA 5A0TA 2HKIA 5MN5A 2IHKA 4OWRB 3B82A 3EEIA 2Y1KA 3M1IA 2N1MA 2FEWB 3QELA 2GQ0A 1ERDA 1R2QA 1S2IA 2IXBA 3GLIB 2L5QA 1D8TA 3DAPA 3QXJA 3AEQB 1P6UA 4NHJA 2Q07A 4JLWA 5IAKA 5D5UB 1ADFA 2R86A 3BWBA 3H0EA 1C3OB 1NJFA 3PQDA 4B8YA 3U31A 2ALJA 4FC7A 3KEMA 4DJAA 1J21A 2BONA 2V0NA 3KHTA 4TS3A 5CIQA 3Q0VA 3W5UA 2E85A 2YU9J 3N5KA 4U39A 3LQ2A 3L0BA 3ZE1B 1F14A 3O2QB 4NB5A 4QPZA 3CR3C 1YOBA 3F3MA 1U8FO 1ZNXA 4CDMA 1RNLA 4HAXA 3V4VB 2NZYA 2B34A 5CBPA 3CJTB 2VFAA 1E94E 3MT0A 4L75A 5EXEA 3V4LA 2FH5B 4DJEC 5JVDA 5HMMA 1ZINA 3ICPA 4JITA 1UQUA 1UXHA 3JXEA 2VXYA 4Y6SA 5ALKA 1FY2A 2D0DA 3E35A 2R7OA 1I14A 3V3TA 2NNYA 3SNKA 3QBEA 3EVZA 4L08A 1U3WA 4PSUA 1DAEA 3FK6A 1PFYA 2Q1XA 4OH7A 4Q3OA 4RVDA 4TT8A 3KSAC 1HNWB 1GSIA 1WJAA 2II6A 4MO9A 1YONA 2JFBA 4HADA 3UUFA 3C5CA 3OECA 2XMBA 4JHXA 5D51S 3GMSA 2M87A 2ZR9A 3IUEA 2H07A 4PE5B 5ERYA 2R7MA 3RYHB 2XCRB 2VP2A 2ZAIA 4TVSA 1NWHA 1R12A 3P0HA 4EHBA 4DANA 3SZRA 4LB6B 3F72A 2YHBA 5KNCA 3LSJA 1A3CA 1JU3A 2QSGX 2ZRAA 3OV8A 1P9OA 3I9V1 3DTKA 2G77B 2VYVD 3F8MA 2GOMA 1P8AA 3L8MA 5C5DA 4BKMA 5A03A 2MJLA 4N0BA 1NPTO 5JQGF 1S5LC 2QSJA 2RNJA 1L0BA 4FR5A 3B9RA 1Y42X 1HLFA 1NIPA 4UREA 1JKFA 4DSTA 3Q11A 2P9CA 3CCCA 3HIFA 3EF0A 2HYFA 3N8IA 5HQ3B 2BTEA 2HZ7A 3VPAA 2JASA 1Y4UA 2I6UA 4GPTA 3BQNB 2ELKA 4IHXA 1SUFA 3S1AB 3U4GA 5GM2A 4YX9A 1J56A 2HR3A 3CG0A 4PO9A 4RF3A 1K97A 4MCHA 2JA5J 3I09A 2XMZA 1WOMA 2H59A 2W98A 1E2JA 1Y1WJ 1HFWA 1ZGBA 3ZQUA 4BFZA 1W85B 2FEKA 1GY8A 2AE2A 2WTAA 4WQMA 2AQFA 1CUAA 1JEQA 1WMBA 3QXXA 4HGQA 4HLXA 1LE8B 4YRJA 5CHEA 3GTLJ 2FX0A 1ILWA 3EXEA 2ZYDA 1XKLA 5AONA 2M32A 2XGXA 3PC7A 3JD0A 1A76A 3ZBUA 3ZG6A 2ZB9A 1RYFA 2YINC 1GKUB 4O6JA 1PDVA 3RDPA 1CUWA 3T1VA 4EX6A 4F9TA 2WMDA 1ZMRA 4RJIA 4AY4A 2C5GA 4AY2A 1WEHA 2WHRA 4YAJA 3VR6A 3ZHBA 4LBWA 3COJA 2C5EA 4N40A 3NCHA 4D5FA 1ITZA 4I8IA 2NSLA 4XDYA 3V7NA 4F6RB 3UAWA 1P3Y1 3U7EB 2PX3A 3WXBA 2LR0A 1D5VA 4HRIA 1HDGO 2VJMA 4J2OA 4QT4A 2AUTA 3RODA 1JN0A 1M5UA 2Z57A 3LDGA 3I5XA 3MKLA 4DYCA 1W36D 4LY6A 4DJTA 5CW2A 2E5NA 5F23A 2XT9A 3K6KA 1O6ZA 3A25A 5JG7A 2X23A 1E4VA 1CIJA 3PDJA 1JR6A 3L40A 1UP6A 4ON9A 4RD0A 2R6ZA 5DOVA 5HZKA 1BR4A 5KHAA 2HF9A 2H09A 1EG2A 3HPGA 1HRKA 3K1ZA 3HCBA 5I6DA 3F98A 2RSLA 3PQ2A 4BFUA 4H6XA 1R5GA 4OMZA 5H16A 2XQVA 3TFQA 3UATA 3VH1A 2NTYC 3WZLA 2ZXEA 4WZAE 4KNWA 4XEHA 3GTMJ 4AP6A 3WMXA 1JFSA 1Z6TA 4DV6B 3RUIA 1VDMA 4R9RA 5EIWA 4P9NA 2DLLA 3VPFA 1ZMTA 4RBNA 4WWHA 4DEXA 3PGJA 3R7SA 3ROKA 3B3FA 1MBGA 1H69A 1U3VA 3D5SC 4I5GA 4MS1A 3HY3A 4PO1A 5L53A 4TV9A 3FI9A 4ZO8A 3STVA 4OLAA 5C18A 1TC1A 1UMBB 3UKDA 4DUYB 5CIWA 4WOPA 4DV1B 4Z1MA 2X7HA 1BWPA 1GZHB 2BJHA 4LISA 3DNMA 2B83A 4ND5A 1V1MA 4ZD6A 1PV4A 2AK2A 5AQEA 1KWKA 1DJLA 1P74A 3OPYA 2GBLC 4IF6A 5IASA 1XLTC 2HHHB 3RK0A 2LCFA 1MC8A 3M1AA 3RBZA 3N2YA 5AW8A 1OLXA 4HX7A 2ZAMA 3ANSA 3ROUA 3IGFA 2FE4A 1CY0A 2ZI9A 2QCOA 2D5BA 3ESCA 4ZV9A 2VZ0A 1UZNA 4HX2A 4O8ZA 2YIJA 1L5MA 4JEHA 4U2CA 4FMDF 4M38A 4YI5A 5FOSA 4DIBA 5BN4B 3DA8A 1TFUA 2C0PA 4BDYA 4YXWA 3C3EA 3U40A 4BJ1A 4OOIA 1N7HA 1FMTA 4JJEA 2YWEA 3W5IA 1ADYA 1TZCA 3ZNQA 4YP0A 5MGBA 3U61B 3GG9A 1X1DA 3RPEA 4DIDA 5C5IA 3PFFA 4DLZA 3MRSA 5EESA 4B3FX 4UXNA 2FQ1A 4U2GA 1XF9A 3H35A 3IIMA 4LVUA 3RSQA 4HS4A 4K05A 3G3ZA 2CLSA 2QK4A 4XH9B 4R2LA 4BVEA 3N8DA 3RW9A 2NU6A 3UKJA 1VLHA 2YNMC 3CSUA 1WW8A 1XVTA 2BCJQ 3KJXA 4H18A 4TMZA 1TA9A 2PO5A 3A1WA 1N8SA 5D5XB 2VJNA 3PR2B 4FEAA 4I55B 1F4PA 1V1JA 4IWNA 4ZAXA 3WB1A 3HOWJ 4O5VA 4U5XA 4BB6A 4ENPA 4JLKA 2WAYA 3SY8A 1VE9A 5AP9A 5FXMA 2IZ5A 5LQDA 3O4JA 4Y1RA 4F92B 3PQJA 2IYYA 4GBMA 2VQFB 5EHXA 1Z5NA 2NO9A 5JI6A 3PGA1 3S4YA 1R7RA 5DWQA 1MO4A 2MFZA 1WCWA 2AJTA 2X14A 2Y2ZA 4QSHA 1VHWA 4UJ3A 4MYDA 1HKSA 1GO2A 3TDMA 2QLMA 5ITWA 4S2EA 5T8KA 1KFKB 4KPEC 1ORWA 2AEEA 1V55H 2GA1A 2H8KA 1WCYA 3JQCA 3NAQA 2PGAA 1S2NA 4I4TB 1QC5A 4U7GA 1G66A 3QXCA 1SRQA 4PLVA 2HWUA 3Q5DA 4P08A 4UUAA 1TZLA 2GK6A 1JZSA 5IT3A 1ST2A 1ENPA 4MIMA 2VDOB 1GUDA 2VK8A 2VF7A 3PX2A 4HMOA 1Y9EA 3NOXA 4TSFA 3WGVA 2CEAA 1PKXA 4EYSA 1T29A 2ZR7A 4OQ4A 1EAMA 4TL6A 1T5TA 4XDZA 1BO6A 2GCIA 3VTKA 1D2MA 2AYXA 3FZGA 1WJCA 4BLOA 1N34B 2YNMA 3K4KA 1ATZA 4RZ2A 3N87A 1UMQA 1LPPA 2XADA 1E59A 2G9QA 1XEWX 3A28A 1OX4B 2JCSA 4LOKA 3DP7A 3RS8A 1SC4A 1YVRA 2R6JA 4II7A 2ZWIA 1IY8A 1UDWA 3H05A 3TSZA 1L9XA 3J7AC 1H5QA 2X2EA 3EUWA 5DKFA 2WQ7A 4I3FA 5EZYB 3GMTA 4CM7A 3RSFA 1C1XA 3GJ8A 4OQXA 3ZCVA 4DCPA 4ZI2A 3H3VK 1T5DX 1T8PA 1KAOA 3LE8A 5IN5A 4BMSA 4KQ9A 2BEWB 4ZI5A 2V55B 3OJLA 4ZWNA 2VLIA 1VYVA 421PA 2G82A 2ISQA 1KP9A 5IKPA 2Y9ZA 3IVXA 3D59A 2FMLA 4YIIA 2C07A 3K2EA 2R7XA 2C96A 2H2IA 3GZ5A 3JQRA 3OAAA 1CIPA 3INNA 4F4IA 2V7EA 4PLTA 5B7QA 2OD7A 2EGGA 3HPQA 3KU1A 3M1YA 1TOAA 4NK5A 4P81A 5HJ2A 3CWCA 3SKYA 1E6CA 1V9CA 4I4IA 5DHPA 1EH7A 3RDIA 2C4KA 1ZJZA 2WV9A 4Q18A 3FNIA 5IMSA 1ZD9A 2CYAA 3NAMA 3ZXIA 1L5OA 3O84A 3OZUA 4HAMA 1B76A 3SYKA 3ZHQA 2O0KA 1AHDP 2I2WA 1H8HA 1PJAA 4N0QA 4Q3EA 3R9KA 4GKVA 4ENJA 2OVBA 2H1IA 3BAZA 1ZVQA 2QPOA 1L4BA 3D3QA 4LK0F 3DDNA 3HI6A 1J5PA 2WIKA 1EFRA 4KGDA 1RW4A 2O8DB 1PUFB 5T4BA