2F48A

Crystal structure of a novel fructose 1,6-bisphosphate and alf3 containing pyrophosphate-dependent phosphofructo-1-kinase complex from borrelia burgdorferi
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
551
structure length
551
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords diphosphate--fructose-6-phosphate 1-phosphotransferase
publication title Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
total genus 199
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 2f48A03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A02
6PFKA 4FYHA 3O8OA 4KXLA 4P5DA 1RCUA 4FYIA 4JENA 3UQZA 4KXMA 4WL0A 3PFKA 1T35A 2F2TA 1F8XA 4LJLA 1S2LA 2Q4OA 4I36A 4I7EA 4A3SA 1WEHA 2F67A 4HX9A 4NPAA 4LJRA 2IZ6A 2KLHA 2A0KA 2F48A 1S3FA 1YDHA 3HNOA 3OPYB 4MEJA 1S2GA 4PFKA 2PMBA 4JELA 4KXNA 1S2DA 4P5EA 3U39A 3BQ9A 3O8LA 3GH1A 1PFKA 3EHDA 5AJTA 4I4IA 4LJKA 3MAJA 1S2IA 4MCJA 2IZ5A 2IZ7A 1KZHA 3OPYA 1F8YA 3F5MA 1WEKA 2NX2A 2F64A 2HIGA 4OHBA 2Q4DA 3K2QA 4U1RA 3O8OB 3IMKA 5AJUA 1MTOA 3O8NA 4RH3A 1ZXXA 2F62A 2A33A 4JEMA 3SBXA 2KHZA 5ITSA 4OHRA 3QUAA 4FYKA 2PFKA
chains in the Genus database with same CATH superfamily
3EGDA 5G4KA 1K61A 3HSRA 4WJKB 2ZJYA 4UAUA 1RYEA 3WLHA 2QT0A 2VP4A 4Y3OA 4GECA 2VP6A 4S0XA 2FMIA 3AI7A 2VTBB 4DRXA 3M3HA 1XJ5A 4GR5A 3KEGA 2A5LA 2COUA 5FFFA 1CQJB 1WDWB 5K5OA 3HR4A 4MJ3A 2BHTA 4Y2XA 1O87A 1E69A 4WTOA 3L8CA 1U9NA 2GK3A 2RV8A 4XKVA 4CICA 1L4FA 1FTQA 1O77A 2WTUA 4Y7DA 4F3YA 4HLNA 1LBIA 3K0CC 4NLLA 5A7GA 5DYNA 3D2CA 3W3AD 3PGA1 5E6RB 3JASA 3FXAA 2D4AA 2Z33A 4PLPA 4CV2A 2W85A 1PYOA 1Z2CA 3LL7A 1YB5A 2SKEA 4UOQA 2J1LA 4ZCLA 2P5LC 5IM5A 2ENUA 1FS6A 4P3KA 1N9GA 1EGAA 3H4IA 1SKUA 1WJGA 4IPTA 1AQNA 9ANTA 3B02A 4N0BA 4G12A 2BONA 1PT9A 3G0OA 4KYIB 4OQYA 3L4EA 1K98A 4KYWA 1HDZA 3CZCA 3TOZA 1H9AA 3X1XA 3OX3A 2X0LA 3ZIDA 1DTEA 1JUDA 1NUUA 4EF6A 1T2CA 2JRLA 2QZZA 1IATA 3NYQA 4YRLA 1X87A 3ZWQA 3F74A 4DDVA 1QF7A 1OB5A 1XP5A 5BP7A 3AINA 3RRNA 1MEOA 1V6SA 3M6WA 3ZQKA 1JGSA 2YJ5A 2GASA 2RDPA 3FPBA 4CIVA 1ZCJA 2AVDA 4XKCA 2YIVX 1JJBA 2M9HA 2FSVA 4Q1CA 4XDYA 4K40A 1Y9DA 4XWOA 5DD4A 4E09A 3HMKA 1FLDA 4IGFA 4ND1A 1LLQA 3I9JA 1TLTA 4LYJA 2G70A 4JI8B 1FIAA 1MPTA 4GMKA 2VZ9A 1J2RA 3DZCA 5LZ7A 2CXRA 3DTVA 4ND7A 3OT1B 4YP7A 3EEBA 2WABA 2EFHB 3A2KA 1RKTA 2E21A 5BSVA 3L8EA 4G3XA 4HATA 4HB3A 4GICA 4P96A 2ZRIA 3JQ8A 3ERCA 3RK0A 3F73A 5EJIA 3AI2A 1A4IA 3ZHBA 3H87A 4O2BF 2JGRA 5E1WA 3O8HA 4HOBA 2OPTA 5E7MA 4OHWA 5KOJA 2QE7A 3BGOS 4RD4A 3J80A 1DIBA 3K6GA 3FXLA 1YE9A 1KJ9A 3UBTA 1BJTA 3EQ2A 2CQ7A 4TKUB 1FUEA 2VWPA 3ZE8A 1XTSA 2PKXA 3F7MA 3GW2A 4BZXA 1FDIA 2BL4A 1DC6A 2GWRA 3M4XA 2ACEA 3C5WP 4W5WA 3THWA 3LHIA 2FXVA 2HZBA 3HVRA 4U7TB 2FZGA 1AH2A 1VLVA 2H52A 2I10A 2VHQA 4RFSA 7GPBA 3FYDA 5LYJB 3UICA 2OV3A 3T7KA 4J90A 4G94A 2H5EA 4MR8A 4ZTZB 3UJ9A 2OLEA 2PKQO 4QHSA 2W4SA 1NUTA 2Z09A 2ZWAA 4EY3A 1J99A 1ONNA 4ESVA 1GZDA 1VNDA 4UULA 1N7IA 1N9KA 3NJ4A 5EVJA 5JNLA 3D4IA 2B3TA 5KAPA 1D2AA 5CBPB 4UCFA 1KZ9A 1R1TA 3WTTC 1GG8A 2D0PB 5BOXA 2B69A 3BD9A 1K66A 3VDRA 3HA2A 2ZJ4A 4P8RA 3ZUGA 1T9AA 3A3YA 5AIBA 2C4WA 3GLSA 4TM8A 4KLRA 1F9NA 1EV7A 3F72A 4XGKA 2QK4A 4J29A 5MGNA 1AKVA 2V9VA 1F17A 1KH3A 4DMMA 5A5EA 3GB9A 1KZGB 2OFOA 4HP8A 2ZYAA 1P0IA 4B6JA 3T1OA 3TLGB 1A5BB 2A5JA 1SIBE 2K5UA 3DC2A 2K7LA 4GOJA 5KWJA 3PFKA 1EWQA 4ER3A 1ADJA 4A0YA 1AZTA 4I4TA 1WXGA 5AW8A 2O3TA 3E8MA 4BNXA 5CX4A 5K0SA 3RUHA 1FJGB 2X0NA 4OI1A 2OPBA 1X4OA 3NDBB 3SNKA 3IH4A 3R4VA 1W52X 5FR1A 1DNPA 4NFSA 4NC9A 3NARA 4LJ8A 5EFOA 3B1JA 2QJRA 2ORED 3L07A 3G49A 4DDKA 3K6SB 1G21E 3BK7A 2JB9A 5J2TA 5KEIA 4KIJA 4IS3A 1D6MA 1YB1A 1VIVA 2A8YA 2M87A 1AUOA 4RHYA 2GK6A 4IXAA 3C85A 3B3AA 2LK2A 4JOSA 1E1LA 3LX5A 4TPKA 4C2UA 2WFMA 1U3GA 3GY0A 3AH8A 1R8XA 2OHHA 5LXTA 1JWAB 3ZV7A 1BXGA 1SVSA 4JI2B 3HM9A 2BEVB 3CMAI 1F20A 4HWTA 4PAWA 1JT0A 2PCJA 3SS8A 3DHYA 2PPLA 1CP2A 1M72A 1WZUA 2ZYHA 1B6GA 2P0WA 3ZYZA 3PJDA 2P2YA 1DQYA 4F3NA 1II9A 2OD9A 4DM7A 2XPWA 1E4VA 3FUCA 4YONB 2V7QA 4C4OA 1R0XA 1G8AA 3E8XA 5ERYA 2B0LA 3TIGA 2P6OA 1XDGA 3FWPA 1WUJS 2RCNA 1ZGJA 5KYTA 4WGGA 2A59A 2COEA 1USUA 3IB3A 3OL4A 2J87A 1MB3A 5CDUA 4EHJA 4NCXA 8ABPA 2W6NA 4OXXA 4PSKA 2CMGA 2FOXA 1HCRA 1Q19A 3AEKB 3HB9A 1XZQA 3QPSA 1GT0C 1KZ1A 2PUJA 1PW7A 1TVMA 1QIFA 3LWFA 2V9ZA 2VOPA 1M0EA 4POAA 5DEQA 3L6BA 2JGNA 1TT5A 5JFTA 3AKDA 4CIDA 3AKYA 4AK9A 3S1MJ 5JNWA 1T9DA 3MWLA 3KCCA 2YY7A 3DZDA 1SC3A 2FJUA 2HA5A 4F52A 2P2ZA 4KUEA 2ZRLA 2VDRB 4WXRA 4KXLA 2DY0A 1XEFA 3IULA 4C87A 3AM1A 3PHJA 4E88A 1JDTA 3IQXA 1ZVQA 2XBUA 3A6DA 3BGDA 2EAUA 4CLOA 5IKPA 4DY4A 4AF7A 2J9FA 1DPRA 2G06A 3HQ4O 4LBYA 1FFAA 2QN7A 1MBEA 2HY7A 4P9FA 2KLBA 4PK4A 1EDEA 4KRFA 1PX0A 2GLXA 4BN0A 1YLFA 2CDCA 2Z3YA 2YR2A 4A5NA 3OC6A 4ZMSA 3LVQE 3IMEA 2XKBA 5BOSB 4WPGA 1DMSA 1E5XA 3BMOA 1NAIA 4C2MJ 3KUDA 5TB5A 5CA0B 4I50B 4NONA 4GU5A 1H8ED 3VNBA 4UU8A 1EZZA 1B8VA 4GLOA 5HX7A 5D1HA 4A0RA 3NB0A 4IWNA 4FKBA 4PLZA 3FDYA 5ALXA 4YV0A 2RI1A 4F3QA 4R1MA 2O20A 4I3GA 4L02A 1FX0A 4QUAA 3MTQA 4NG4A 3KQPA 4WK0B 4XIDA 1GFSA 3OAAD 3TIIA 3S2DJ 1O94C 4YFKF 3D3WA 2FDCA 3U16A 5FLVA 1TGYA 3FCOA 1G7TA 1ONPA 1P2TA 5BQFA 4KA4A 3U4MA 3GLLA 1LSOA 1JPVA 1YS6A 3B20A 2IXAA 2JLXA 2NZVG 2MYNA 1SG9A 2Y2ZA 4B1RA 3RLFA 4GL2A 5F0FA 5IT4A 3OU6A 3OWXA 3FM9A 4KZKA 3MINB 4QUKA 2QW0X 2B4TO 2NRAC 1BE6A 4HVLA 2FHPA 1RIFA 3RYTC 4REOA 1I1OA 1AD2A 2C5AA 4PUSA 2BWJA 2IA1A 4BXOA 3EG9B 3BJAA 4UVGA 2XUJA 5BXYA 1PZHA 2EZ4A 3ESRA 3SXUB 3UC9A 1YGYA 2D5AA 4QREA 3RROA 1A5SB 5E3OA 2RGCA 1ETVA 2VJCA 7YASA 2G1KA 3NXKA 4OQDA 5FT9A 4KNVA 2PX3A 4ZAYA 3MB8A 5GONA 1BXKA 1MH1A 4J0CA 2F2TA 2FUEA 5JNRA 4B9EA 5GJCA 3ORSA 1SIOA 4BXUA 1CV2A 4IIYA 2V7VA 1L5RA 1E32A 5ALKA 1OYIA 1F12A 1Z6PA 1XDSA 8ADHA 2YV3A 1NF2A 5A9SA 4XONA 2M6SA 4ZDJA 4TYPA 3A1EA 3UOGA 4X85A 2G17A 5J8FA 3L9WA 1G8GA 5DZSA 3KPHA 5ESDA 1CFZA 4FFDA 5A4KA 2VXBA 1GSOA 3O8DA 1OZAA 4M6XA 4S1VA 3GRZA 1ZM3A 3C6BA 4RIEA 4AKGA 3QUCA 5K09A 2XA1A 5HNKA 4K9OA 5JHUA 2G9WA 5JSZA 5HZMA 3BXPA 5JQGF 1PW5A 3BH0A 3KM0A 3U31A 2FSIA 5UKDA 4MITA 2UXNA 4B33A 3LDFA 2EGHA 5L53A 3TZHA 2Q2NA 1Y1TA 4F11A 3V3KA 2NVBA 4RVDA 1ZJ5A 5FRDA 4PC3A 3NBQA 4JODA 3UJNA 2HK7A 4CM4A 1FOEB 4HQMA 5ALNA 2I9PA 5IT9Z 4LOAA 5JS7A 4US2R 1IBSA 1K6EA 1HZZA 2CNWD 5DI3B 3DDNA 2W2XA 3RFFA 2FQ4A 3W6VA 4HQOA 5LDDC 3O84A 5JVGF 3QVWA 4MEJA 3CH7A 3TNJA 3FPEA 5CEFA 4F56A 3R3JA 2O54A 3C3CA 5JO0A 4YP9A 1G9TA 3Q1LA 3FTQA 3FYTA 1AMOA 1YACA 4LJ5A 3RS9A 2AX3A 2EH3A 4QBHA 2JAQA 2B4KA 4UAJA 3AXSA 4CDRA 4XEHA 5EE3A 1KYIA 1AKUA 1UBGA 1JHPA 1H9GA 4O4IF 4U9UA 1O58A 2P6PA 5FKJA 1NVUQ 4A3MJ 3M6IA 1T95A 2D1TA 9ABPA 3HKDA 3HKZN 5KVSA 3P5SA 4PXAA 1ISGA 4R1TA 3ZDEA 4BX0A 1JDUA 1D5VA 4RF5A 1NK2P 5GADJ 5FJIA 5EMHA 3CJTA 5L3SB 3RVRA 1PG5A 1ZL2A 4LVNA 5HIAA 1U1FA 2WYVA 1ODIA 1GPWB 4Y2RA 2I29A 5IM4F 3BTVA 2PX2A 4XQGA 2PHZA 2VP3A 1MA3A 2GK4A 2N75A 5K1ZA 2PCLA 5KNDD 4BPRA 3SHTA 3UF0A 5CHEA 1W1WA 5FWNA 1EJBA 3GBPA 2A94A 1UBRS 1WH7A 2TS1A 2WG1A 1EXDA 4WY8A 1EFLA 2FUNB 3B3JA 4ENWA 1OROA 4NRDA 3W0LB 2Y9MB 4DJTA 4Q82A 6LDHA 2N46A 2QXYA 3BXXA 4IXMA 4BO1A 4JQYA 4OHZA 5D7NA 3RTAA 5JRJA 2F6CA 3DGFC 3W5HA 1S0UA 1KY4A 2A1IA 4J7UA 3AGQA 4YASA 4L72A 3GUVA 4ACBA 1FJ2A 4MPRA 2WVHA 3NOVA 1NTOA 4PC6A 3AOGA 5ESWA 5LSAA 5ALFA 4IOKA 3SMVA 3SVTA 2CV2A 2DHCA 1LNQA 1R0ZA 2BZ1A 4NMMA 5HF8A 4W5QA 1CE8A 2J3QA 13PKA 1KETA 5TQ0B 2X5KO 3H2JA 2D2EA 5EZYF 1UCRA 3OM9A 5IH3A 4FDUA 3ZV4A 1AA6A 4BVAA 4MQEA 3EE6A 4FB4A 1GG2A 5LBIA 3WMWA 3UFXB 1YJCA 5CW2A 4J0HA 1XTZA 2HR1A 1FW6A 3A26A 3EXG1 1TQPA 1LBHA 4D3ZA 3BQMB 3KX2A 5DOZA 2ZRQA 3K4KA 3JRHA 2G4CA 1I24A 1T4CB 4BV2A 1U9OA 3ZPLA 3ZDYB 2QLZA 2WK1A 2WJYA 4NCKA 1QK3A 1W96A 4DV5B 3REFA 4IO0A 2JVJA 5A4DA 3JQBA 2P6UA 4FLMA 5H3CA 1COWA 3LK7A 1FLNA 1FP1D 3I5YA 3JATA 3TI9A 3KD3A 3VOBA 4U2KA 2VODA 1H0RA 1N6PA 4CEIB 4K8OA 3ZI0A 1EFPA 1PT8A 1S8FA 4YFYA 3NWEA 2DMQA 2CV0A 4FI3F 3K6RA 1UEIA 4Y6QA 2I7VA 3TM5A 1PD0A 3USES 2F5VA 3QU6A 3IR5A 1JKMA 1L5QA 1PJ2A 4G0OA 3F0TA 2WHEA 3N2IA 2OY0A 4BKQA 3QXJA 3BICA 1MBJA 1Q0HA 4MP6A 1DTSA 1GIAA 5JNUA 5CGZA 1RE1A 2IGKA 2P67A 2VPZA 3IVXA 3AR9A 3WYFA 3UK1A 2H6BA 1BVYF 1IHDA 2A7QA 4A3CJ 4TLCA 2VSYA 4HF0A 1KQNA 4BFTA 2CLOB 1OX4A 3MSCA 4DDWA 1N2ZA 1DC5A 3DU6A 1KEPA 2IIBA 3QEBZ 4TLBA 2DA5A 5BRJA 2BFFB 4H31A 2W2MA 2GEJA 2VYCA 4JBWA 2EJWA 5JS6A 4G0ZA 2XWQA 4PN7A 4DBQA 4UBIA 5EHIA 1PFWA 1V6AA 2M2IA 2OHIA 4IUCS 4YRGA 2D5CA 4HDRB 2Y1LA 1T0IA 1OBVA 2JJ2D 1YVRA 5G2OA 3LY8A 1HH4A 4DUGD 3HPQA 1EI9A 5C34B 5DMHA 4BFZA 1KGSA 4KSBA 2HF8A 4XLZA 3KBBA 2LCQA 3OA2A 2AF4C 5FQNA 4A2PA 1KARA 3CEAA 3H97A 2K4BA 4LHVA 4I9NA 3ETGA 1UMCB 5JWRA 2CBZA 4L9WA 3G79A 1HNNA 1VLJA 3RBVA 5IK2A 3CCJI 4CQMA 4HNRA 4C4AA 2DULA 4NBKA 3PHGA 1SCQA 1EG2A 2DTEA 2FR8C 2LTAA 2ZR0A 3NFRA 3EGVA 2ZYTX 2G9QA 5JY1A 2GXUA 3Q5EA 4KK4A 4C06A 1QO7A 3MBIA 4DR7B 5BV7A 4E5MA 2L2QA 3LPLA 5F33A 5CLJA 5ICMA 5IYZB 1R6BX 4L8LA 3MWKA 1C2TA 4A10A 1NSTA 1J21A 5D84A 4DR1B 2QROA 4UPVA 5F7OA 1JTXA 3CJRB 3CC4I 2HREA 1AURA 1U7WA 1UKCA 3QVJA 2W00A 3CUQB 1L5VA 2VCHA 3D4PA 2VSNA 4EJFA 4MEXF 3B12A 1EJ6A 4MARA 5TS2A 1K4TA 5ALPA 2Z16A 2VUMJ 1ADYA 1UIMA 3R0XA 2K40A 2A3RA 3MUEA 4LSMA 3DR5A 2BEWA 3T0GA 5HFAA 4RDUA 2CJWB 1IC8A 1YE5A 4ZYVA 2PEZA 1WJCA 4GP9A 3D7MA 4YMIA 3RZDJ 4HK4A 3BWBA 1ZGHA 1WLYA 2W93A 3R61A 3OFSA 3TUJC 1NBWB 1P5ZB 2OGWA 2Q1WA 4BBSJ 3GAFA 2YU9J 3SD7A 4UTZA 2NZ2A 2VDMB 4JYCA 1U5CA 3WWCA 2FG6C 1HKUA 1J0CA 5U1PA 2FMYA 4JP3A 3KHKA 2VA8A 4LECA 3ZQIA 2YOFA 4L9NA 1XS9A 4HWKA 1VPWA 3EUHC 1CIJA 4XLHA 3AM5A 1YULA 3FWHA 1EGVB 1NP6A 2A0KA 1SCIA 3DOEA 1YL7A 2X9QA 1Z6AA 4XLEA 3SZRA 1D2CA 1FTWA 4DYCA 4XOPA 2B83A 1N2JA 1GT91 1EFDN 2V4JC 2PT6A 5BQPA 2F8SA 1BX3A 1VHLA 2VAXA 4F9TA 2NQ8A 1FJHA 2J31A 4KXQA 2DHEA 1IJBA 4X66B 4LRTB 1WOMA 3ECSA 5A5DA 2JLYA 1B43A 2XUKA 2Q41A 4CCAA 3OLWA 4E7LA 3JU3A 1EDBA 3ECCA 2AK2A 1HE2A 1V7ZA 3ZHZA 5C5EA 2Y75A 1NTRA 4BNTA 2F17A 1E2QA 4NE9A 4MIEA 2DFHA 1JR3D 4EUEA 2Q8PA 2N47A 2RHDA 2J9XB 2Z3ZA 4KXXA 2HKXA 3IHTA 3V48A 5DCLA 4HEJA 3M3PA 4NWIA 1MZVA 4FT2A 2I4RA 1J42A 1GCIA 3I0ZA 1E5LA 1VA5A 4NSNA 1N75A 5BW5A 1HDPA 5EAIA 3LP8A 2WNIA 1X6VA 4EJ2A 5K6RA 1PR2A 2J7PD 4BZWA 2OKGA 2QTGA 2HU8A 3WSTA 2QXUA 2CEKA 2Z1NA 3PPXA 1NFFA 5IDYA 3IKTA 1E2KA 2B9SA 4BL5A 5CYFA 1OU4A 5BYKA 2XYVA 3V8EA 3M07A 1O9BA 4PPFA 3LWBA 3RC9A 2NW6A 4H3HB 4BNNA 1E3JA 2F9LA 2EL9A 4Q1VA 4FTWA 2VXOA 4ZO8A 4CLDA 4C7OB 4PW0A 3LMMA 1MX9A 1EBBA 4DIDA 4C0XA 3OE7A 3C97A 4Q12A 3C3BA 3BGIA 3S32A 2RHWA 4FKMA 1JEAA 3CF6R 1X80A 2VNSA 3B1KA 1U0GA 2X58A 1MTZA 5HS8A 1QYXA 1IBMB 1K2VN 3GJZA 1F7VA 3BMQA 3CGGA 4KWCA 2JT1A 1SANA 2VNAA 1RAFA 2JNWA 2NQ2C 1AK2A 5H7XA 3EWIA 2X76A 3UGTA 4P3NA 4EH1A 3C7KA 3PX7A 3ENVA 1L3LA 1KK3A 4B4KA 1IFXA 2QMEA 1MZBA 4M4SA 5CNJA 3Q7SA 4CQLB 1UFRA 2XGGA 1XTAA 4F1WA 3SJZA 1DKLA 3VGJA 2E1OA 1I80A 4D79A 4M8IA 1QIEA 5EDNA 1CNEA 3K7EA 1DE0A 1J8QA 2C9ZA 1Z82A 2GHIA 2X22A 1B73A 5K6AA 2EFNA 3N5CA 3A1SA 4WKNA 4DADA 4XH9B 3F8TA 1LI5A 1OXMA 2ZSKA 3CUUA 4PWYA 2YOGA 4BQQA 1IK6A 2QLFA 3ROFA 1R5ID 2D6FA 4M46A 2YNMC 4R2KA 3C5HA 5TXGA 2OR3A 2W2LA 3HFJA 1Z7UA 4QBGB 4MVWA 1E61A 3PHHA 1CUJA 1XR3A 5C1DA 2X6WA 5A7FA 4BNUA 1E3TA 1KO4A 1O95D 4KQ2A 1Q0ZA 3NZEA 2WIFA 2MH9A 1LVAA 3Q0IA 3NTXA 4JB3A 3W8NA 2WY7Q 5DLQC 1PKEA 3HFGA 2P2DA 1SXGA 2HGSA 4LK0F 2PDAA 1LNWA 4RMGA 1B00A 3K09A 4H7KA 4EEZA 1ZNQO 3URKA 2WU0A 2XBLA 4URYR 1V2HE 3RW9A 3FPJA 2IEYA 1Q21A 1MHTA 2IW1A 4WXPA 2PZEA 4I55A 2IYPA 5CDFA 3T06B 1JUMA 2R0QC 2A6TA 4LXHA 1Z18A 4XFKA 4RHCA 4WZ6A 3P19A 4Q9KA 4ZTUB 3T7RA 1XAIA 5I45A 2VZ8A 4YFXF 4RJKA 3WTSC 3EZGA 4I2NA 1MN6A 5CB6A 4FIZA 3HCBA 4AMUA 1RKXA 1P5HA 2HMTA 2I6FA 1H85A 4PSXA 3M1EA 2FZCA 3R7WB 4W8HA 4LXIA 2YXBA 3DNMA 1HQYE 5BPHA 1IZ7A 3U17A 2LD4A 3NNSA 1E1NA 2W2QA 5D4SA 2HU9A 2Y3IA 3ESYA 1SKMA 3HN2A 3CZ4A 4F3KA 2B98A 2J3EA 2ZZMA 3NTLA 5FL3A 4MKZA 4D7AA 3QSGA 3A36A 1EEXB 1T6NA 1U2PA 1UWVA 1BMDA 3M4ZA 4YFVA 4CL2A 2CKMA 3KKZA 4XIFA 3L4BA 4L74A 4LSWA 5ESRA 2FWIA 3BF8A 1YWGO 5TEVA 1H5NA 3TIFA 4XBFA 4ZYDA 2WF5A 3HHPA 2M7BA 1QDUA 5BN4A 3TKAA 4CMJA 5IULC 5IAJA 3RIMA 4BMPB 4WKBA 1X3LA 2RREA 2OTCA 1ZN2A 2LFBA 2DFIA 4ACAA 4ABYA 4FOLA 3RWBA 1AKMA 1CHDA 4RDXA 4AX8A 1YBVA 4MGRA 3F90A 3R6TA 1G41A 4LV8B 4KKVA 3M1YA 4JQZA 1ZZGA 3QITA 4GH5A 3DVAB 2IU3A 1NJGA 3J81K 3P9RA 2PKEA 2NOAA 1MQ9A 1ST3A 4G85A 4WNAB 4ANJA 1H2EA 2PA0A 3TOXA 2R7UA 3KSUA 1KMHB 5D01A 4TV9A 1XQ6A 3W34A 2AC4A 3TB4A 3VR3A 3TTVA 4A6EA 3P2MA 4BQFA 4FHCA 5JMTA 4TLAA 4HX9A 1THMA 4ER0A 3REQB 1NPYA 2POCA 2EZLA 3HO1A 4N5HX 2PMBA 2ZS8A 3V8PA 1I4LD 3CRZA 4Q19A 3U2RA 4R79A 2JAHA 4QWMA 4I6GA 1P45A 1P4XA 1JZTA 1WCIA 5GGYA 1R15A 3TJZA 3DLHA 3GA0A 3DQVC 3CCEI 3BM5A 3OCUA 2XRLA 2NPOA 2CHEA 1L4GA 4EECA 5FUVA 3G2JA 4RL4A 3S8YA 3QLTA 4HI0E 4RD1A 1VKRA 3QLJA 4ZI5A 1ZRMA 4NJEA 4WGFA 1D2RA 3DYBA 4EELA 1I5RA 2VUUA 3GJRA 1MBZA 2PMHA 3RPEA 1UBNA 4UZEA 2PUVA 4JIMA 1Z88A 3OSGA 3NM4A 3V33A 2B82A 4LV6A 4OQXA 4X8HA 4XSZF 2P6TA 1EUYA 4PLWA 1YZLA 1B59A 3I01A 3DDCA 4U0VA 3REGA 1F0KA 4WDRA 3ULQB 2P5KA 1Q74A 1O7JA 1BD3A 3MJHA 3D81A 3JS5A 4DC9A 2YWDA 1M75A 5P21A 1JPNA 4I99C 4X90A 4B3GA 1G6HA 3ZLTA 2CNBA 3KP4A 2YWFA 3RPUD 1KR5A 5EJFA 2VASA 2ZE5A 2X2PA 3VR2D 2FRDA 5CFRA 1G4HA 3MS4A 2IW5A 5C9ZA 2JJMA 1U6GA 4LA4A 2LYCA 3RM3A 3B1ZA 4YGYA 4O4LA 3TTUA 4G8JA 3TI7A 2VJ5A 4PRLA 5IDWA 4I2VA 4O25A 3DCNA 1H94A 1B1CA 2F64A 1O6BA 3WK8A 1X3WB 1FFSA 1E3IA 5E17F 2RAVA 3PIDA 2XT9A 3QPBA 2ZE8A 1GTJ1 4ID3A 1SURA 2VO1A 2WIBA 2Z8YA 3R6LA 3H0GJ 2LRDA 2Y99A 1RABA 2H06A 3C5VA 3EA0A 1SK8A 5E1OA 5EWLA 5HDBB 2VH5R 2QKMB 1UPTA 2R7TA 4JYZA 2NU6A 4Z9FA 5KU7A 2HBZA 2JFBA 2HBYA 5G40A 3D9QX 1Y3CE 1OWPA 4DYHA 2SCUA 1V1RB 4K86A 3BE4A 4BUJA 2C3UA 3PF9A 5TDHA 1K5HA 2OO5C 1OD6A 2GCEA 4XSVA 5BV1A 3KB2A 1EVZA 1EM6A 2BM8A 2ZU0C 3GR6A 4FYVA 4ZDPA 4PJJA 4CR8A 3FMIA 4RY2A 4Z3KA 4U7DA 3NS7A 2PBRA 2C0CA 4Q4JB 4RVHA 4RA6B 2RGNC 4P0PB 2QU8A 4EQ6B 4XB6B 3DMGA 4S1OA 1RYMA 2CDNA 2FPMA 4D4IA 2Q3BA 4YPFA 3R0JA 4PAOA 1TF2A 1W0KD 4EM0B 3C3PA 3UANA 1XHLA 2I8CA 2VPWA 1HDIA 4OM8A 1OH6A 1OE0A 3E4DA 3F8FA 2YBEA 6ABPA 3X1ZA 2OLJA 3VV3A 3QODA 2ZJ3A 1Y9AA 3MC1A 3NHUA 4MYHA 1XMPA 1K5PA 1S2LA 1LB1B 3GJ0A 5L3FA 5AUPB 1D4FA 3ZDAA 3CT4A 4NC7A 4KMMA 2GKSA 1XCBA 1R0SA 3C3MA 1N6HA 2GOMA 3WAGA 3JW4A 3QF4B 5ICEA 1RLTA 4G67A 1JSLA 4MUMA 1WWXA 4HNSA 3I6IA 3JD3A 3AHEA 5K8LA 2A92A 3PD1A 4D3DA 4A91A 1I1GA 5BWCA 3ZQFA 1KVSA 5FLKA 3MJSA 2A0FA 1WJEA 3MA0A 2OPHA 5DK4A 4B47A 3OJEA 4AUEA 2D00A 2O7SA 3U09A 4X7PA 1AC5A 2ZBEA 4CDNA 3N3BC 4DUZB 4QDUA 2FXAA 4GOXA 3MQ2A 2XNCA 2J5PA 3PFIA 4DWWA 4GRAA 3IP8A 3LFTA 1LLUA 3LUGA 1AUVA 1PDVA 2FFBA 3BWVA 1JSRA 3FDIA 4E30A 3R2JA 4U4AA 4IWYA 3LSPA 4KBYA 1AKRA 3K3PA 2JCXA 4BO3A 3LCVB 1U2GC 2GPAA 2BHNA 2W5UA 1W48A 2Z5VA 1ZU4A 2ZDHA 5CW1A 3DZJA 1MO6A 3HDHA 2DPYA 2AHQA 3GAMA 3DXXA 5IVKA 1WAMA 1SZPA 3ZN1A 1T5BA 1RRJA 3ZCOA 1PFVA 1XVIA 3B6IA 5JJBA 5FPYA 3MMXA 4QDZA 1QVTA 1L4UA 3TSWA 4HH0A 3L2WA 2ISCA 1YB6A 5CXUA 5AOBA 2UYGA 4WZAB 5M04A 1TVKA 4EKIA 1BFUA 1GCUA 1TZBA 3P9SA 4JBGA 2CXTA 3ABOB 5DHPA 5G53C 5FPKA 2W48A 2JFYA 3IB6A 2IV7A 3AETB 1YHYA 1UXOA 4G1CA 2ZAIA 3NC1C 2QN1A 3MOIA 4HA8A 3JYQA 5CNIA 2ZVDA 1P80A 1PF7E 1XSDA 2UKDA 5I7RA 3LT1A 5AJZA 2B4AA 3HZOA 2IE0A 2K86A 3MZ0A 3L5OA 3PWKA 4UHCA 4MWOA 3BL8A 5F78A 2P4HX 5KK1A 3RT9A 2I34A 3BCUA 1HV8A 3JSOA 3FSEA 1V47A 2Z5LA 2PO5A 1Z15A 2X2EA 3L04A 1Z3CA 3B5IA 2DTDA 4BUPA 3KO8A 3TLKA 2FEAA 3IKVA 4BEHA 2JI7A 3GG9A 4ZZ0A 4CL0A 1WVIA 3ILVA 2EX1A 2FPIA 3DOUA 4OXKA 1NXXA 3LGXA 3SIWA 2HNKA 4R8HA 4RZSA 1PTKA 1KQ0A 4ON9A 3P1JA 3UY4A 4QNRA 4QG7A 2EDCA 2DU8A 5TPZA 3RUEA 1LXCA 3FX3A 1IWBB 2J9YB 4Y9RA 4RF3A 5F1JA 1J8MF 5HJ7A 1QIHA 2Y27A 1Z8FA 1DLIA 4I1RA 4X6LA 1SIWA 4B5LA 1YCGA 2R7QA 1R0KA 5TJHA 1U0OC 4L27A 3OQ6A 1HEYA 1SFOJ 1ZG3A 1BMTA 4YCLA 3CVUA 4PXYA 3O8LA 4B73A 2ZCWA 3CF4G 2NTJA 1SD2A 2AS5F 2WF7A 4EDHA 1X7XB 4Z51A 5FO1A 2NXNB 1XDBA 4J4BA 4MYCA 5FUQA 1S2IA 2PH7A 3KQWA 4HQNA 1W1IA 1EP3B 1UFVA 4N6OA 1XPUA 3H9JA 3AJRA 1UMQA 3GO5A 3KQKA 2YUSA 1OYVA 5L40A 2PS3A 3VI3B 3HO8A 1FBNA 4PIVA 2JK1A 3VTAA 2A1UB 2I4IA 4XB1A 4S1NA 3JRWA 1CJUC 2VCEA 1FPMA 2JCBA 1YI0A 1V25A 4XASA 4EA9A 1HEIA 4FR2A 1P91A 1DOAA 1LQ1A 5LQDA 4KFRA 1FNSA 4BCCA 1PZEA 3OTHA 1E66A 2M0CA 3IAM2 4FEEA 1FDRA 5I7HA 1YBHA 3NBFA 3M70A 3DTKA 1U5TB 1K3UB 2QTMA 1YF3A 3R0ZA 1JS1X 2VJBA 3T52A 3VI4B 3DO8A 1L7MA 4PR3A 4NDAA 1VSBA 4G1MB 1WJAA 2JIQA 4TX1A 3V97A 3LA2A 4LOJA 2LZ0A 2XKOA 4C03A 3O1HB 4WXYB 1DTWB 2C6YA 1ZVVA 5KMGA 3FCYA 4X1KA 2E1MC 3BE5A 4HDQB 1ODKA 5ITVA 4NBWA 4L8VA 3KOYA 1C3LA 4PV7A 2ZM5A 1BH2A 3NBYC 5TGZA 1ZAYA 5HTKA 4Z0TA 4RTNA 3QUAA 2G25A 4QU0A 1MNQA 1GHCA 2DE0X 4R51A 2G67A 2KE5A 4HTFB 2FRXA 2HHLA 1R16A 1KAOA 2PQ0A 3II6X 1SKBA 4P3YA 5JAOA 1KC3A 3B3QA 4V0OA 2XYPA 5K3FB 4LJAA 4DMRA 2R8PA 5BSRA 2WJAA 4D9BA 1PFYA 2QY6A 1IC6A 4TSFA 2PEYA 3LPMA 4S2EA 5H0IA 4FJ2A 3LQYA 4QO7A 5CA1A 1QP0A 3HOTA 4I1PA 1ISFA 2ZT8A 2AQFA 4G65A 2LKXA 2TRTA 4UNOA 1SZCA 4H2DA 3GGSA 4OM7A 4HO1X 1JTYA 3MB5A 1MRSA 1TUBA 1FBSA 3PVZA 4ZQFA 2IGBA 2DDBA 1ZH5A 1HW5A 1A7AA 4FYWA 1HT2E 1T0FC 1YTYA 5HIKA 2CB9A 1I7NA 2ZSHB 4U0KA 1PHPA 3FYSA 1IY0A 5JPCA 1D09A 2FSWA 1IBRA 4PQFA 2OXTA 1MDMA 2AKAB 3EFHA 3PKJA 2D2IA 4F9EA 3BN3A 1BOFA 2ZIGA 1UBJS 1Z35A 4XFJA 3TBHA 4U02A 1JEQB 4PSWA 2XF8A 3WGIA 1TQ8A 5CLHA 3ANLA 1PR1A 2W58A 2Q2EA 5DV9A 3SOZA 2WZCA 3QYEA 3C3YA 3W9BA 1QHEA 3OIGA 4F04A 3RJMA 2H18A 3PUWA 3RS2A 2QN3A 5HODA 5BUZA 3T4EA 2JH9A 2ZT5A 3HN7A 3A1VA 4ZVQA 1WSBA 4DIKA 3DCIA 1FE8A 3DT8A 4Y1GA 3FYUA 4LIUA 2PS0A 5K5RA 2OCAA 2DQYA 4RVFA 1G2OA 3NBKA 4BTLA 3FVVA 3RS3A 2L9VA 1P0QA 5ULLA 3QW2A 5FUXA 1SUFA 1FIUA 1QV6A 1TZCA 3G0CA 1O03A 2Y9PB 3QFHA 3REOA 4JYBA 2CFOA 3OQHA 5TQ2A 3JSXA 2CO5A 4BLPA 2W11A 3T5CA 1FMTA 3B38A 4R1OA 3RARA 3LTEA 4LY9A 2ZMEC 3EVNA 4X61A 1WMBA 5K4HA 4OL0A 2FSPA 1T3TA 4NV0A 5HNHA 1IZ0A 3GBSA 3VU8A 1OWNA 3DFKA 2O5CA 2WILA 2CMDA 4R5HA 3ZBTA 4RIFA 4I4NA 1L4KA 3QZUA 1NVMB 4S0HB 5T4BA 2P79A 2QJTA 3M81A 1U6IA 1RRGA 4UEOA 2NSJA 3E7DA 4F45A 1L1QA 1VOTA 4OHMA 3JQRA 5BV0A 3I52A 2X9VA 3HGQA 2H31A 3DTVD 5FWXB 1FTSA 3EGDB 5G4KB 3LCUA 3S5JA 1VG8A 4FDVA 2O3QA 1M2VA 1W4AA 3T3OA 4MQVA 2JANA 5CVDA 1DKQA 4ISBA 4KJZA 2JI9A 3WI7A 3NEYA 4ASUD 4V19K 3NRVA 4U7BA 4DRXB 5AK6A 2GZ2A 2CDRA 4CG3A 3T35A 1XZCA 4CMBA 3QUTA 2B1RA 4QELA 1RKWA 5E3HA 1RR8C 4UPEA 3ZTTA 2GTHA 4XCVA 4KXWA 2NU9B 1D0YA 4GXTA 1T43A 4NQWA 2WM2A 5EI5A 4V1CB 5T3YA 4UEJA 4EPTA 1MO2A 3ZHRA 3PM1A 5I7AA 3QPDA 3RDPA 2I6SA 3PFCA 4PRZA 1Z0FA 1HQDA 2QE7D 5E4YA 2WSLA 1QB7A 4YCDA 3ZNNA 2JBWA 4N3AA 4QA9A 3JASB 1W5TA 3ADCA 4K9SA 2IHJA 1N4AA 3QA9A 1PJQA 4TM7A 4NY1A 6REQB 5JSFA 3W5DA 4R9UC 4HEA2 1N2CA 5GMOA 1N9GB 2VHJA 3J7AY 1ZUWA 2XXBA 4P4SA 1G3RA 3DFMA 4OK5A 1L5LA 1GLNA 2VR1A 4KACA 4CTKA 1ML4A 2DLDA 4KNWA 2JGEA 1LV7A 1XHEA 3WHBA 2R00C 1R18A 3TDMA 1YU9A 3WRXC 2BHSA 3QG5A 3DONA 1J5EB 4DE5A 1IV8A 3DZFA 1UCFA 2AG0A 4RSGA 4ZOLF 4ABZA 4Y2QA 1RXEA 4Z4CA 4L75A 4DT1A 4AZWA 4OGGA 4L6IA 3KPYA 4BDZA 4PBSA 3WLTA 2G7MC 5F9MA 4KK3A 2R5WA 2OHJA 1IH8A 4TRJA 4EPXA 3S29A 1QFYA 3GLTA 3M82A 4XRFA 5GZ3A 3OS0A 3R8XA 3PV0A 1Z2OX 1F7UA 1VECA 3ZX4A 2L0XA 5L4LA 3SR0A 4ENKA 4YIFA 4QGFA 1F36A 2R2GA 3ROUA 4M1QA 2H1KA 4Q3AA 4ZVNA 1UBSB 3OKAA 1F2UA 1X7DA 2GEUA 3VO8A 1MJHA 1R7JA 4DLTA 4WZAE 3DTVB 4CV3A 2GA9A 3ORFA 5LNK6 4M72A 2BEOA 5I8PA 1AA7A 2BKXA 2AN9A 1TA4A 4YAKA 4RK4A 1PL0A 4OJTA 4JX6A 2PJRB 3P8ZA 1EUDA 3VDMA 1N5DA 2Q46A 2IYWA 2IYVA 3SF8A 4ED9A 4AKEA 5HKOA 5GADl 1TDJA 2QZJA 5ALTA 3I59A 3R9IA 1W88B 4RJJA 3QV2A 4NARA 3L92A 2CFXA 1BR1A 3NORA 1L7BA 1MNMC 2VQEB 3GYBA 1U2QA 1MMAA 1RWNA 4DRYA 2WWIA 5KOJB 4YP1A 1N25A 2XLBA 3PL8A 3A2MA 2XD9A 3K4MA 2FW6A 1PEKE 5FJJA 4IJUA 3GO4A 2PRSA 4AJOA 2AFHB 1ETHA 4MI3A 1B6RA 1XTUA 4US0R 1GR0A 2W6JA 3KYCA 1E0EA 4RB3C 2C2XA 2XGDA 4H1VA 4WERA 1Q1VA 2O2SA 3ESWB 3WVNA 1RJDA 4ZO4A 1RI7A 2WOJA 3DKIA 1PUFA 2FW1A 4FS8A 2W71A 2BF4A 4RFSB 4KNYA 5LN1A 3HJBA 2YUIA 4HCJA 3UHAA 5BNZA 1QTIA 1ZI9A 4M76B 1JJIA 4OMYA 4JJEA 1N2SA 5HLTA 5CXQA 1OKRA 2P2GA 2GDJA 4CM6A 2QG6A 2YWCA 2WVGA 4R2HA 1I3MA 2RJ3A 5B7QA 3TOAA 4XX0A 1JXQA 3CR3C 4IZOA 3CF0A 1Q11A 2HGCA 3NJ8A 3WO0A 3GUZA 4RK1A 4OL9A 4JU8A 2PTHA 2NNYA 4LG1A 3RGWS 4GDFA 5D5QA 3SXPA 1JBEA 3WL6A 3F6EX 3VPXA 4MEYF 1L5WA 2JA2A 3RV4A 2IS2A 1WXXA 3OYMA 1OKKD 1HE5A 3HJRA 3VZCA 2KLOA 1BO6A 4AZVA 2GFHA 1CUCA 2ONYA 4WOKA 4XZ3A 4CCWA 3I5MA 5JADA 3FKQA 3BMXA 1SHJA 1YYVA 3LMKA 4UARA 2EJRA 2AR7A 3K5IA 3FX2A 1LRKA 4KJXA 2V1XA 3H7IA 1TZMA 1N1EA 3PYLA 1Z9CA 1FVHA 2IYLD 3HP7A 1ZUD1 3ED1A 3DLAA 1FTTA 3GFBA 2VKVA 1DFGA 2C59A 4L76A 5KB3A 3A27A 1MO4A 1MA0A 4AKHA 5J2TB 1BOBA 3DWIA 4ZDOA 5IEJA 3ZI7A 1DGWY 2NNWB 4XICA 1A4RA 5FI5A 4MLOA 4L18B 2BELA 2BJWA 1OC2A 1Q7RA 1W4LA 1Z33A 1ZS9A 2J0UA 2W43A 4LCBA 5FLXZ 5LXTB 4KGVA 4E21A 1BXGB 3CRMA 4H7PA 2W83A 3OR2C 1XO1A 1U81A 2XD4A 4M8SA 4P35A 4I3HA 4PQRA 3DR3A 1JTEA 1K6IA 2EU8A 4PLFA 2NUAA 2XIGA 2FQQA 3E7XA 4UTOA 3RVJA 3LL4A 3KK0A 1MT3A 2Q7DA 1JNYA 4LIPD 4IIDA 5CIYA 2AOTA 2HLDD 4BYGA 1XSXA 3QKWA 3A3PA 3HH8A 3KXPA 4O02B 1DPUA 2I6TA 4BKOA 3O3MB 3O7MA 1SUAA 3X1DA 1GOTA 4YA6A 4ZVSA 3BMCB 5T64A 4RM3A 4YRTA 3ZV5A 4US1R 2HQBA 2G9VA 3IO5A 5K20A 1K4YA 4JP5A 4FSHA 1EBFA 1G2IA 2HWWA 1Q44A 2FX5A 3F23A 5EJ9A 3I54A 1OZHA 4Q37A 1XFDA 3NHJA 3UXHA 1YOVA 2GCPA 3MMZA 2JFHA 3DYIA 4JI0B 3K4LA 1FJXA 3PNBA 1TT5B 2XB2A 2WBMA 2WVJA 2ESRA 1A6IA 3BQNB 4BNLA 4OU4A 5DNVA 5B3KA 4YELA 4WXCA 3RWOA 2PQ6A 3I04A 3DUFB 2IV3A 1J09A 3CX3A 3A4IA 2AXPA 5JALA 2GFQA 2B7EA 2Y0PA 5CDGA 3MN2A 3G13A 3N8KA 1PEDA 4DMKA 2JGAA 3D1NI 1R1VA 3QPAA 1Z0IA 3D3JA 1SCDA 4EGZA 2R6CA 1I13A 3UAOA 3L2QA 2ACVA 3WQHA 3I92A 3WHKA 2YV2A 4IVPA 4B45A 1NPDA 2ZR7A 2AT1A 3IH2A 1F0PA 3W6ZA 5KC8A 1NVKA 3ZDQA 4Y15A 4HNAB 4K2AA 2P81A 2HXIA 3ITDA 3CP2A 1TWAJ 4M3FA 3ZGLA 1FDUA 4HXEB 4HYYA 1U0SY 4DHWA 3WB1A 1S2GA 2G7HA 4BEBA 2A30A 1ULSA 2BBSA 4L7VA 1ZP6A 4L4ZA 3WK5A 2VZEA 2DA3A 2QRVA 2Y66A 1D7OA 4QU5A 2F3PA 4S35A 4PIMA 1GZ3A 1E58A 3DL7A 3QAHA 3KKNA 5DHUA 3V7UA 1GTMA 1H2FA 3KJZA 1BRMA 1CUUA 4RMJA 2GR9A 3SP1A 4XN3A 4TXJA 4X63A 2PKCA 5K8TA 2X7JA 5IAKA 1TWCJ 1X0XA 2VBCA 2NZYA 3D3WB 3RI4A 2R7OA 4LZJA 4B8YA 2DPXA 1SZDA 5J1UA 1ZUHA 4L0CA 5ESXA 4WXHA 3FWKA 4WRRA 3IP7A 1TNSA 3ROQA 2R7KA 2QLTA 4XA8A 4K9DA 3MF4A 4RYDA 3FPGA 1GZ4A 3R3VA 3RKUA 2DOKA 3VZRA 4CCMA 1CKEA 1Q1QA 4RGUA 5EEHA 3I8XA 4ARBA 3FDZA 1RLJA 4P34A 3IJPA 5IVIA 2JAOA 3TL4X 2WPDD 1PN3A 3OIFA 1VE5A 3I1FA 5JSQA 1G19A 4ZXFA 2QVXX 2R1TA 5KSZA 1JAXA 4BXOB 1FBTA 2HWKA 1RR6A 4L78A 5LA6B 2P11A 3OLVA 4N41A 2B6HA 1WQ1R 1LFBA 3W6PA 1ULYA 4GYKA 2C8KA 4PICA 4M83A 2AQIA 4CMKA 2PAAA 1WQ2A 3MYRA 3V4FA 1UQRA 5H2FC 4KQIA 4L9AA 4JI7B 5GONB 1E2FA 3MAAC 3OQMA 1U78A 3W6JB 2DMUA 4IQ0A 4WXMA 1WY5A 3E5HA 4QJBA 9ATCA 3VVLA 1UMDA 2C0PA 4G2NA 5BMVB 1AXEA 4A03A 5A9SB 3AY3A 1JLLA 4JA0A 2GHTA 4XTRA 2I71A 1BMQA 3L43A 4TMTA 1G3UA 1ODCA 3LX8A 2QM7A 3VAAA 3KJXA 4JT9A 3PPVA 4YCSA 2VAMA 2X6TA 2P5TB 2PLYA 1XFAA 1K68A 2E4WA 3FXJA 3STWA 2XMQA 4LHSA 1K79A 2JFVA 2QGUA 4RY9A 2Z6AA 2RBGA 4R83A 5T8KA 1DXYA 1JHXA 5FFNA 3PQEA 1TO1E 5JSZB 4ZYHA 2QIOA 3WLIA 3TSYA 4CSWA 1DQUA 2R6R1 3WODF 2ELHA 5C7YA 3WGLA 5EIBC 4WV3A 1E9AA 1SMKA 3IXLA 2V7EA 1TMKA 4K6MA 3N39C 3ZMSA 2EFEB 2B4QA 4JWTA 4C6RA 5KSYA 4EKEA 5AUQA 2OAGA 2MFZA 2NO7A 3RFCA 2IUYA 1OV4A 5FKNA 3VYSB 4IIJF 2FF7A 1IIBA 4PZCA 2Q7XA 2PUDA 3GJYA 1SEVA 3O8OA 1HWYA 1WNFA 1PNTA 3VHXA 5HVNA 3ZCQA 1KP3A 1RC9A 3OD5A 3NTUA 3FNIA 5IVHA 3JRIA 1Y33E 3HYLA 1JVSA 3QU7A 4E6KG 3IOMA 3IAHA 3V34A 2YQ4A 3HFSA 4RMHA 1R6UA 3BIOA 3OH8A 3VKVA 1I7PA 4LG0A 3QHPA 4IX7A 1PJTA 5DX8A 3E7FA 2P4SA 4NF2A 3WV5A 5L51A 3DFIA 3HKDB 1UBTS 3R23A 4LI3X 4C1BA 5M3FJ 3YASA 1A9PA 5CB4F 5EYRA 4ZAZA 1M2EA 3NPAA 1RPJA 3IE1A 1L1EA 3R5TA 4GBJA 5D5HA 4NVRA 4RXUA 2VYQA 3KTOA 4B4OA 1MH3A 4CQNA 2YIJA 3O8NA 3FZNA 1IPHA 4LC1A 3BSYA 3TEMA 1BVRA 2X7HA 4M49A 3S1NJ 1ZK1A 1LS1A 3RIXA 2DPHA 1RI4A 2R4GA 2C31A 1ISIA 2GM4A 3BC8A 3LSIA 4J01A 3KYIB 5HCUA 4ENQA 3TO7A 1GG5A 4RZ3A 3X1WA 2FPRA 1I36A 3H9BA 5EGOA 1ZY2A 3HVHA 5JY6A 4LJRA 3DD1A 2AFHE 2IRWA 3KOZA 3ECOA 4E94A 3UWKA 3LSGA 2DQKA 1U3TA 4G01B 1DOZA 1T3HA 1L8QA 1OCZH 2W7TA 3CSUA 1HQCA 2H0AA 10MHA 2CNOA 1PGJA 4EG6A 1AY0A 1CUXA 4OGFA 3FIUA 1Y39A 1EA3A 2I3DA 5FTKA 2JLUA 1R5OA 3KUUA 3GU3A 3WJAA 4XRSG 2CQQA 1KHTA 4IDFA 3D7RA 4U1RA 1S8NA 3FA2A 4RHXA 4KQKA 1YQXA 2VP5A 1E0SA 4INAA 3USZA 3DKVA 3DE5X 4ZKEA 1HOMA 2M45A 4AQ7A 5IT9K 1I50J 1I7SB 1OBHA 2B30A 4MQEB 4FU0A 4ER5A 3BWEA 5CHYA 2B7BA 2HRQA 5LMNB 4V0QA 3AVYA 1XTQA 4ZCPA 5IK2D 4CM3A 4CQMD 4KMFA 1YJ5A 4CF4A 3ZOBA 3LT4A 4V03A 2HSGA 3L18A 3MWMA 4QFDA 5H6QA 3H1AA 1L8AA 2O2EA 1HFWA 4EYGA 3VSKA 3VTZA 4DCOA 4J0QA 2VWHA 1WBBA 1J6UA 2IT0A 5ERIA 1I10A 1BI3A 5J4HA 3OPNA 2KS6A 4BZPA 2IOQA 2QUFA 3MTBA 3JWPA 3HL4A 5J3LA 1PGPA 2XRZA 1T9GS 1LZLA 1APBA 1TB4A 2C98A 5CUQA 3OU2A 1FUYB 3M5WA 4MRMB 1PYDA 2I03A 3D4LA 2AA3A 3TQCA 3ZQLA 1RC1A 4UV9A 1DQNA 1EFPB 2Y1KA 5HOQA 3LOUA 3WAJA 4G5QA 2IK8A 4EF5A 1UFOA 2NP7A 3MYYA 2XH8A 3SFIA 1XEAA 4X44A 5BSHA 2I8DA 3TECE 4LZWA 3RYPA 2GBYA 5I01A 1RWKA 4DR4B 5I6DA 2RHLA 4G2TA 4AIRA 3G4SI 3BWYA 5FBKA 5TSDA 3ND6A 4PVCA 1NYQA 4O0MA 4Y6LA 3Q0UA 4Z53A 1K97A 3FUXA 2Y0DA 4MQ9F 2H4FA 2OD2A 3A0UA 4G25A 5JCZA 5J1SB 3D64A 1YJ8A 4MUNA 1AKHA 4QBIA 4L15A 3OX1A 2DUUA 1VQPI 4WJZA 3EF0A 2RC4A 1X8JA 4PYRA 3CCBA 4KTTE 1GTZA 1XTBA 2PBIA 1PFUA 3DB1A 1QG4A 4M2LA 1A50B 2QNBA 2C54A 3NH9A 4FXPA 5ENDA 3JPWA 2R7WA 5C4IA 4CF5A 4FOOA 4WCFC 3L49A 2JGDA 1CJBA 2UZIR 2M0MA 3W7VA 1FOKA 1U2ZA 2XCRB 1RUOA 4IRIA 5CVUA 3R75A 2TDXA 2XNHA 3HXPA 5DD8A 1UBKS 1GAWA 4KT5C 4EY6A 4I46A 1OZFA 2OENG 2I2XB 3AR5A 3TG8A 1FBUA 5LGTA 3LXRA 4HDMA 3EFEA 4CQMB 3T7TA 3UK2A 2MSDB 3ZHYA 2MSNA 4X8OA 2BR3A 4H0EA 4FISA 2EGUA 2QX9A 4JX5A 2B5OA 3U4CA 2R4QA 5CVIA 1WF6A 3EUFA 1QE5A 4IEJA 1UP4A 4EDFA 5DHAA 4AMBA 2GQQA 4ER7A 2E71A 1E9CA 4OQMA 1YRYE 3CLTC 1P6QA 3GT0A 5KTNA 1LA2A 2AW3A 1HC8A 2VDLB 5EJMA 4C1NA 2RK3A 3L7DA 3FNBA 1NT2A 4P82A 3LKVA 1J9ZA 3ILYA 1Z5PA 4B9AA 3WJ7A 2F62A 1Z6RA 3K30A 3DA8A 1ATZA 5AVQA 2R8RA 3JQ9A 4BAGA 3L1HA 3QPCA 2DJIA 4QYIA 3VX3A 4CKEA 1XD7A 1JFRA 2A5YB 1QX4A 3LY9A 1R5BA 2BN4A 4AB1A 2HHCA 3LUKA 1X4PA 2IAIA 4JK1X 3AGPA 4J1TA 3EAGA 2QL7A 5EJ5A 1GL9B 1R66A 3BYZA 3FMRA 4L8GA 4ZC3A 3IEPA 4NH0A 2AK3A 5F7JA 4C2AA 5E3IA 2BEWB 2Y48A 3UMSA 4QHTA 3HDVA 3VVBA 2I3BA 4LMBA 4JEUA 4YIHA 4JKYA 2YS9A 4AM8A 4OQLA 4NOMA 3UT5A 5H4HA 5KIAA 2XAQA 1XPXA 3D1JA 5G3YA 3OZUA 1T6BY 2WD9A 1T38A 1J8DA 5G0TA 1TFRA 4HLUA 4HAYA 3D5QA 1VZ0A 3FOWA 2XUBA 2XMPA 2E5WA 4B82A 3A31A 5B1EA 1F4KA 4JJ7A 1MFZA 4BB6A 1O9HA 3FUUA 4RZXA 1JB9A 4C2TA 1ZG5A 1JQAA 3F7NA 1SU6A 3M8FA 4OHFA 4PCVA 3H86A 3K2EA 4MR7A 1F4LA 2EXXA 2VYFA 1PYVA 1Y89A 2I67A 3U3RA 3PNYA 3DAFA 4ND2A 1MGOA 3AEYA 2FZKA 3EXHC 5ERGB 1GN9A 2LWIA 1P31A 3HJNA 1WXFA 2Z5UA 5B3AA 3ZHOA 4ZT6A 3N28A 3DTYA 1CQPA 5IFKA 1OH8A 5KX5A 1GHTA 1KBOA 1ST2A 3A25A 4F5DA 2WF8A 1J7KA 4U3JA 1G5QA 2VBYA 5IFLA 3ITEA 1KK1A 2F1JA 2JQ7A 2CD7A 1P9LA 3OX2A 4FC7A 2W2LD 2O8CB 3QX7A 5REQA 2D62A 4OAYA 3LDGA 1L4NA 4CCOA 4DL9A 1HURA 1K4MA 3G8AA 1SU4A 1ENZA 1YFJA 1ZKMA 4XDHA 1WMEA 2YRWA 4IICA 3GNTA 4F2PA 1C80A 5DO9A 1QYDA 1FC0A 2M34A 3JY6A 3M49A 3LV8A 1ZW6A 4UZFA 2GXBA 1FB5A 4W5NA 1CVRA 1V9SA 2WWVD 4AZ0A 5CDHA 3NVKI 5JYDA 1P4GA 3HOWJ 1KKUA 2OL4A 2VDOB 3HDDA 1T39A 3ONDA 3SDGA 2ZUWA 5ECYA 3PHCA 3V4GA 5K0TA 3HEFA 1N2XA 3BQ9A 4E5KA 2JC3A 2ZM6B 2JZNA 2MYTA 3ABUA 1U2EA 2R751 1QOPB 4N0DA 3G17A 4YRPA 3ZY5A 2MSCB 5IARA 2A84A 4U9HS 4F1JA 1Z07A 2A9VA 1SC6A 1X80B 2V58A 3HSSA 2XHEA 3FDXA 4DNFA 5I7SA 2XNKA 3OJXA 2BISA 2WA0A 3KJGA 1KR2A 3FAKA 5CIWA 4H1UA 3BMQB 3A37A 4S1PA 2J5RA 4QYTA 5JMPA 1ADCA 2J6CA 3H04A 2H2AA 4PCAA 3CUWA 2W2OA 4TXHA 3FISA 4Y4RA 4L4UA 4PLHA 1SQ0A 4ZCSA 4EZIA 2NM0A 4EEXA 2Y71A 2ANCA 2WSIA 1OXTA 4BLUA 1XZGA 3PP8A 3STYA 4MS4A 5BNIA 1P77A 5BSTA 4CI9A 3SJBA 1RMYA 1WL8A 4H6VA 5C1BA 2Q2QA 3WTZA 1S02A 3CTMA 4ND8A 3QFTA 4DDHA 2FZWA 2XCLA 1MB4A 3GAZA 4OHXA 4Q1FA 1OYOA 1O4VA 1ZH4A 4RKQA 4Y0VA 2G3YA 1SCJA 1DS6A 1P3JA 3DXFA 3QLUC 1ZYUA 5FB3A 3ZS8A 5K3DA 4TTPA 3IEMA 1TD9A 3QKUA 2VYVD 4DGSA 1QFJA 2WHRA 5L3EA 4TVKA 4G84A 3PQ8A 4JU9A 4M88A 1YR3A 3NAZA 1BZYA 1XRMA 3QV1A 4DLUA 2C2KA 3DTEA 4I2OA 2CHVA 4BNZA 1HE4A 1Z4KA 5AO9A 4YJ2F 4DIEA 1YHQI 2JBAB 2XA2A 4DUYB 3LPCA 1W1WE 4NBLA 1KI7A 4Z4FA 4U2GA 2EV5A 4HBLA 1XCMA 4DLNA 2JBHA 4JOMA 3KPJA 5IEBA 1T33A 4HX2A 3BR1A 3MWDA 4OA8A 4UDYX 2L9RA 4KSYA 2RGXA 1LEBA 3KSBC 4M98A 3KZNA 4V0LA 3BTOA 1TZJA 3CTAA 1FJLA 3G2QA 2MMCA 2LDBA 2DG2A 2HZ7A 1FRZA 1CU1A 1GDTA 4ARAA 2VHUA 4M1OA 4B6RA 4E22A 2XNDA 1E77A 5IF9A 3AG2H 5J4YA 3Q7PA 1KJ8A 1UBMS 3FIJA 5J3JA 4HFNA 1R0WA 3LD9A 1AIPA 1NBAA 2IVMA 2BI8A 3TYXA 3SKVA 3PLNA 2GK7A 3MCUA 2I4MA 1SPBS 4D3YA 3UH1A 5LBTA 3NDRA 2GVZC 5EZQA 5C8DA 1DCTA 5LD2B 1HORA 3LQ1A 1AXRA 4JZYA 1QZUA 3ZQGA 5G0WA 1XQWA 3EPRA 3V1UA 5K3EA 1NF9A 1RVV1 4MFDA 5AVJA 2DQSA 3W2EA 4IOCF 3PUZA 3SX2A 1N6NA 3GEMA 1O6CA 3IT3A 1XQXA 1W5EA 1I32A 3RS5A 3ZJUA 4YJ3B 2V7GA 5CIQA 4FGUA 2WIGA 3M5CA 5BN4B 4WX2B 1Y9EA 2B1IA 3QRFF 4LQLA 2ZIXA 2FQXA 1LWOA 3HG7A 5EP4A 1Y1RA 4X00A 4PEVA 3QKRA 5HS4A 4V0MA 1CY1A 4RNCA 1AHHA 3KQNA 2GEDA 3EHEA 5FOVA 1A5ZA 4GFDA 3PJGA 2H5JA 4DMCA 1LEAA 3GLKA 1DU6A 2XDQB 3RRBA 4RKFA 2VZ0A 4QDOA 3DO5A 2Q3MA 1JYFA 2GD1O 3HJUA 5H68A 5IP9J 3A2NA 4C6HA 1STOA 4GOND 1ZKDA 4Z3OA 1S3IA 3K2QA 2WBLC 1SKAA 2VJPA 4QBKA 3B5EA 4HZFA 1GVHA 4L9VA 1C7EA 1QUFA 2A67A 4N5MA 1YDWA 2Y68A 1KSHA 2BY3A 4RORA 1Q3TA 3OMWA 1SHTX 2KL4A 2CDBA 5BVGA 1RWVA 4S3MA 3CCMI 4D80A 3ILHA 2NIPA 3CKKA 4ZT7A 4LFUA 2XUDA 4O6JA 3IJRA 1Y6JA 1XRRA 4RZIA 4XMYA 1PJ8A 1QHYA 3JRNA 2FF4A 2IIPA 5HLIA 3BWXA 2NZJA 5IN5A 2DR0A 4CCNA 5FOSA 1XP8A 3OUUA 2GF0A 3VKGA 3F47A 4J0KA 1JF8A 721PA 1E7WA 1VE6A 3VPGA 4H35A 1AK9A 2VBWA 4QJ5A 4RTQA 2ZXUA 4DJDC 5BSMA 2ZUSA 5M7EA 1QXSA 1UUFA 1LBQA 2ODTX 4OPMA 3H0EA 1JDJA 3COYA 3CSSA 5J4VA 2NZWA 1D1CA 4EBFA 5K7FA 3HRSA 3QYFA 1TKCA 1WVGA 1J2JA 3JRGA 5ECDA 2PAFA 2EG5A 4HVTA 2FEWB 4BNDA 1R74A 4H3SA 3U4QB 2Z2JA 3AXTA 4AG3A 1EMDA 4ZT3A 1FQKA 2XQKA 5DBHX 3STVA 5JHGB 4M7WA 4X95A 1RMTA 5AK3A 1YIAA 3A1TA 1XTTA 2JVIA 4BTVA 3N2EA 2ZWIA 4F06A 1HY3A 4QGGA 2KT0A 3HCOA 2JLRA 3FWEA 4AJ4A 4LJLA 1WFXA 1XEXA 3QMPA 5JJCA 1LW6E 2K9QA 1T13A 4O4LB 4EHLA 3RSHA 1TMYA 1NFQA 1YMQA 1PSWA 1NQ5A 4N4NB 1OGJA 5JHHB 4X1IA 1NG6A 2HD4A 5CFLA 4JI4B 1E6MA 4XVQA 1LBSA 3WZMA 2OTJI 4KDEA 3QPUA 1F8YA 4Q05A 3E8SA 3RYCB 1K6OA 1YZQA 4U8HA 3CH5A 4BUCA 3BXZA 3VTKA 2NU6B 2VJYA 4DIUA 3WYDA 4RKWA 1OFHA 1E63A 2PGOA 3ZNOA 3MXTA 1WVRA 1POGA 2ES4A 4NCIA 3L02A 4B2YA 2RD2A 3EGIA 3AR7A 1OOEA 1M6EX 4REMA 5C1PA 1UJMA 1HA8A 2CQXA 3IRRA 4BJ5A 2XASA 1TM1E 1RQ7A 1OI4A 5SYNA 3P9NA 2FDRA 1BWRA 3I2HA 3MBOA 3UMVA 3HO6A 2HYFA 4MWTA 4AF6A 2ERYA 2J4FA 3EEQA 3PG5A 3TNDA 4DARA 4M9RA 1KFEB 3ZPXA 1BWQA 4MQLA 3ZKWB 1HK7A 3RVPA 2JIMA 2FP4A 1V5GA 3RU2A 1XTKA 3O2SB 4LSZA 1LRJA 2F1OA 2G7ZA 3ROGA 2J6IA 3OP1A 1KZHA 1GCOA 3WE3A 1DX9A 3ML1A 1B0PA 4N03A 3OSZA 4UHDA 3LI2A 2RN7A 3DF8A 2DA1A 2OFPA 4MVYA 5FRMA 5L3CA 2QAJA 5F08A 1MF7A 3EZ9A 3TL6A 3ZVMA 2B2XA 5DNCA 3GNSA 2X5NA 4IMPA 3EZ7A 5LZ4A 4IZ6A 4HH1A 5A3JA 3M8KA 4JQSA 1YFLA 1C7ZA 1SUIA 2PV7A 4DM3A 3OOYA 2NWQA 1T1SA 5EHQA 1GPH1 5D8DA 4Q66C 1TL8A 1J00A 4CJXA 1AKTA 4ZDWA 1WPGA 1WA5A 2W2TA 3KCQA 2QRZA 4HQ6A 1E6KA 7MDHA 1D1SA 4D7MA 2LOOA 2FWBA 4JYMA 5DF1A 5E9QA 5AVUA 3JAMZ 3I1YA 1E1QA 5DRTA 2M1ZA 1ZGZA 4A8JC 4ZDIA 2H2GA 3OIYA 1K7CA 2I1WA 4TL8A 2NOJB 3HACA 2FMLA 3L7OA 4NZMA 4BB5A 4X9XA 3O8BA 1SUPA 4JNKA 3OO0A 4AC9A 1P0MA 1XB2A 5KSPA 4RJIA 1YXMA 4KXUA 3Q7RA 3TZQA 4AYWA 4IMIB 1C50A 4YB8A 4DILA 3IFSA 2PR2A 4C7XA 4J91A 4GPTA 5TPZD 4O4JA 1DIHA 4FONA 1YQDA 1QC5B 3LZ6A 2ZKZA 1BC7C 1SD6A 1ISMA 2GHQA 3SQXA 4JGGA 5H9VA 3PNLA 3FRHA 2ZRGA 2DPMA 5CD1A 1HDDC 2FUG1 3QBJA 2R7XA 1SOUA 3M33A 1ULTA 5DPMA 1NLUA 3DVSX 4YCNA 3MQFA 1TC3C 3QU4A 4JLJA 4NS1A 3PFYA 3UKJA 4G63A 4MAAA 5FWYA 4KG7A 2GRJA 4C0HA 4FEAA 4Y9DA 3TIVA 1WTAA 3U7EB 1IG0A 4PLTA 4DQ0A 1TTYA 1W5FA 2AIRA 2J3KA 4YBZA 3SE7A 4TZKA 1HLVA 3SJ7A 5E2AA 5JDIA 2Z2IA 1SC7A 2C97A 1A6QA 1X3ZB 1RHKA 4YCJA 1WDMA 2O7NA 2I62A 4AJHA 5FUBA 1TVKB 3DLBA 3DB2A 1SCBA 3QWAA 3TFQA 3WDKA 3G1OA 4Q39A 1I3QJ 3KEYA 4D9MA 3GNQA 2A14A 3VXKA 1C3EA 3D4BA 4J0GA 2EZ8A 3NOQA 4UNIA 2UZ0A 2DK5A 3QNUA 1Y5NA 4P4UA 1SD5A 2J5QA 4DV4B 5E9JA 2PMFA 3P4YA 1X7HA 3GFMA 4KHPB 2ESHA 4GVPA 5LBUA 2XIQA 4F5YA 2PMCA 1NRJB 2O2YA 3DDUA 2MGQA 2CJYA 3A9CA 4AI6A 3ILXA 1K4SA 4A12A 1X39A 1IHUA 4TZ6A 4TUYA 4TVOA 2VPIA 4IEFB 1W59A 3PEVA 3G2LA 3S0JA 3S8EA 3LQRA 1MP0A 4WX9A 3C39A 1NI3A 3MCAA 2ZC2A 1G5IA 3PRHA 1R9MA 4XRGA 5DIZA 4CA0A 5C81A 4BEHB 3RUPA 1ISPA 2FPIB 2F00A 3GJXC 2OOKA 3EDQA 3D5EA 1H0SA 3DFFA 3E18A 3N97A 4BJTA 3TL2A 5HOEA 1R4AA 1DBWA 2G0NA 3ELYA 4JX8A 3RAJA 5GAJA 1CS0A 1D5WA 2VRBA 5GTDA 3SQOA 2P3LA 1HDOA 3KV3O 5C32A 1O96B 4S1WA 2JKYA 3Q87B 3W2WA 2W6CX 1P1HA 4XB2A 2BRUC 5KYUA 3EIOA 4NG5A 3LOQA 4XSGA 2BTQA 3C7DB 3WBJA 5CDFE 1Y9JA 1R4MA 5IAOA 2P7CB 1O7FA 2BSXA 5L9AA 4IVNA 2YZMA 4WWHA 5KI6A 1U8XX 2IY9A 4EV0A 1J59A 4JYAB 2COKA 1M0SA 4BNCA 4O5OA 3IBGA 5HWSA 1TL7C 4PFJA 1JE1A 2ZFWA 4L8WB 4GWLA 2M3AA 3ONVA 4IYRA 4IQJA 3U48A 2ZSEA 4FI3C 3BR3A 3IOYA 1AO0A 4ZJPA 1L4MA 4HPXB 4QJ4A 3GP8A 4FX4A 1FXUA 1F5SA 1HPLA 1UT8A 4W5RA 2XHZA 4XGQA 3UAXA 2O8EA 4CLEA 1RWXA 4JWKA 1TAUA 2BY0A 1VPLA 2DYRH 3RO7A 3HDYA 2FR1A 4PTYA 1SVLA 4PU0A 4UDNA 3ICVA 3MT8A 2GA8A 4B3SB 4M7OA 2W70A 3HXQA 4R8KA 2DH6A 2J3MA 4KQFA 5CTAA 2HJ9A 4HR7A 1AWCA 2HK6A 3SEZA 1RJFA 5KQMA 2G8LA 2QZPA 4ZGWA 2QTLA 1KE1A 3JD1A 4KC0A 5K0LA 2ZSBA 1XK6A 1LX6A 3IH5A 2XGSA 2BM0A 1DIAA 4X8MA 4NNOA 2F1HA 4G1UC 3OZVA 3WTYC 4IDNA 1UDWA 3PRYA 4LJZF 2IPOA 1LSSA 1Z6GA 3OPVA 1G2HA 5GIPE 2PBFA 4YR7A 4PZYA 4GFBA 1X1TA 5K8UA 3CEHA 4OHVA 3IODA 1XC5A 1JLKA 1XJCA 2JVGA 5IT0A 1HDGO 2PX9A 4A1FA 3TFOA 3AY0A 1E4EA 3K9GA 3K9LA 2BOLA 2IYRA 4PZ0A 3ZGOA 1EX9A 1OSNA 5G3ZA 3CYFA 5K05A 1ZK0A 4AXXA 2DP4E 4ZAXA 3KDPA 2BD0A 2R6GA 3QKTA 5K8JB 4RAZA 4PYNA 3O91A 4FT4A 2AXNA 3FLBA 2IEZA 1ZMBA 2PQ2A 3T7IA 3M2TA 1M1NA 1E94E 5J9FA 1PT6A 3TZKA 2A4MA 3OYBA 5CA1B 4GZ6A 4DLZA 1D2NA 4ZO7A 5PNTA 2AVNA 4AUNA 2OYRA 1JJVA 3UJDA 3BK2A 1TUBB 3F2IA 4IR7A 2FU5C 3ZWYA 3WGHA 5JAUA 2DYSH 2VJAA 1KVQA 2C88A 3L1PA 1AE1A 4UU7A 5DWDA 4YRZA 1BQEA 5GVSA 3STTA 4GLLA 1MDMB 4HWRA 4G0QA 4OA5A 4KKXB 3AVQA 5CPBA 1OLTA 4FK8A 1QQAA 3JQ8B 5DSXA 3RSGA 1GU1A 1XZDA 2GD2A 3HYCA 1KMNA 4HH4A 4HB0A 5JD4A 3VR1A 3QX3A 1VFPA 3M8JA 4FMDF 3N07A 4ZO9A 3FI0A 2XT6A 5CNKA 3CIFA 3ZWBA 5E1ZB 2GM5A 3MRVA 3UH0A 2P27A 3JVEA 2ISZA 2OV4A 2H1VA 3ESQA 4IM7A 5FV4A 3MG9A 3CPJB 4OP2A 3WAKA 2XUIA 2XIJA 3D7SA 2JCVA 3AV0B 3WB9A 3M1AA 1R0BA 3FYUB 1ZOIA 4KXNA 1JUPA 6YASA 3THWB 1GP2A 2YSRA 4Y8VA 2QX4A 5ALHA 4Y2UA 1UK9A 2HU5A 2V7QD 2FWAA 2ZI3A 1XYYA 2VBGA 4P31A 3LNTA 3ONQA 2M4GA 4I1VA 4D6XA 4XIYA 2EJTA 3IIKA 4GOLD 1JMKC 3RG8A 3SG0A 3RDIA 2Y1XA 4MR8B 2XE4A 2GIZA 4KLZA 3UV3A 2NAPA 2RK4A 1PV4A 5MFZA 3A1YA 3G1WA 1PU2A 5GGXA 4DYDA 4PZZA 2LBFA 2XB9A 3NHZA 5DUKA 4J0EA 2H1CA 4KE8A 3GFVA 3EAQA 3AG5A 4JHLA 1AKYA 2EEPA 3C7CB 3H84A 2A07F 1T2AA 4Q4LA 2DO7A 1YTUA 4P32A 1W0UA 2QTRA 4W5TA 1QVWA 4R2LA 5KSOA 2NO1A 1W4CA 5ILVA 2ZIWB 1VYVA 4D9HA 4EPVA 2O0JA 1MC5A 3K4CA 1DOHA 3S3OA 4X64B 3P9QA 3DFUA 3KAQA 5C1OA 2W84A 3PC8C 3JVVA 1RI3A 1B6SA 2C5LA 4KCGA 1M7BA 3HDJA 2P1ZA 3K4NA 1V5WA 3GPBA 1ZK4A 1P9WA 2O8FA 3NIWA 4I4TB 2DHDA 5CYOA 4GZ3A 4D3SA 2PN6A 1Z21A 1ZGBA 1BEEA 2C2BA 1V11A 2R5YA 2HTEA 2XF5A 2XRMA 4DSOA 3I3SR 3U56A 2ZBDA 3BQZA 1FC3A 2BFEA 3O6VA 5HS9A 1B4DA 2IH2A 2R62A 2WMNB 1VLZA 4IDCA 3GLRA 4OFXA 4GS5A 2F59A 3HI4A 2K7ZA 3DMRA 3E9YA 3U3XA 3V8VA 5B53A 4EO7A 4N8SA 2DQRA 3IAS1 1E4YA 2HU7A 4BUZA 2W6JD 4HEHA 1NJ1A 4FTHA 4QLOA 3COAC 4MB2A 1WP4A 4P4SB 1OFTA 1KEEA 2JFXA 1WMFA 2HMVA 4QU9A 2ZE7A 1BYUA 5DNYB 2WZQA 1QLJA 1Z4QA 2VLAA 1A31A 3VH1A 2PX8A 3DLPX 3SQMA 5KVVA 4OYYA 5JXJA 4M1EA 2RHOA 1OT3A 3HXMA 4RY8A 3J7TA 2JPCA 1CZHA 4TL9A 4V24A 5G1OA 3IMGA 3VJMA 1NVVQ 1YVPA 1QR6A 4KE9A 3TKLA 4GUAA 2OB2A 2IZZA 2V74B 2XAHA 2GUWA 1DV1A 4A16A 4M71A 4OFWA 2GPSA 2WB2A 4DQ2A 1LY1A 3G23A 3WTCA 4E4YA 5C8YA 3OLXA 3NKVA 3C16C 3ONWA 4EKDA 3TAUA 3OQ1A 4RD2A 3BR5A 1Z4MA 1D1BA 2JRCA 3HUUA 3A6HA 3I45A 3FKIJ 3LSYA 5LVAA 4GXNA 3VU3A 1G6NA 3FSJX 4KI7A 1V8OA 1BQ3A 2EFQA 5AM2A 3PA6A 1DUVG 1U94A 1E3HA 5LUAA 4LBWA 4JLKA 4DS3A 2P9HA 1ADFA 3QVKA 3PTZA 2HSEA 5A9RA 5LDHA 1NUHA 3TLZA 3AIKA 1WXQA 1G3WA 1E9EA 2FEPA 1B8UA 4YQFA 1KJQA 4FE4A 1F2UB 4AJEA 2M7AA 1XLUA 3OECA 1YRLA 1GNPA 1U8BA 3A2LA 4LNHA 3PL1A 3ITKA 4ZDKA 1NYTA 3QLVA 3MBKA 3DT9A 3BDIA 4UU0A 1J70A 5AM1A 2RAPA 3KDAA 1EUDB 5FI0B 4CLOB 4LMPA 3OCWA 2I3GA 2J9FB 1A69A 3SF8B 4PLCA 2Z2YA 4LF4B 2BY2A 3I59B 1DAIA 3EW7A 3WIEA 4EX6A 2A33A 2AZ4A 5F2KA 3FGOA 2P4WA 5FI3A 2BV6A 3H05A 3OCJA 4BNMA 3Q7TA 4JJAA 4R31A 2WSYB 4HMPA 3WC4A 2OBNA 2XV1A 1T5HX 3BMOB 4XE5A 4BHPA 3W9YA 3GDHA 2HTJA 3T3HA 4AIDA 2CJPA 2G04A 5IU6A 2YQ5A 4MW4A 4IZZA 3W5UA 1GGKA 3KYCB 3JQFC 2Z2ZA 1FNNA 1AMNA 4L85A 1AZSC 3NHPA 4AWXA 4C89A 2JJ1A 2A57A 4FB5A 2UAGA 4D57A 1TM2A 3RFVA 1NU8A 1FX0B 3PQ4A 2O7RA 3PITA 5GPCA 1PUFB 3D2AA 5JD5A 3RU9A 1D0SA 1Z39A 3ENZA 3OYKA 1P72A 3H8VA 2ZI5A 5JOQA 1Y1QA 1DVRA 4PN3A 1JDBC 3W06A 1EGHA 4Q7KA 3WTVC 5M34A 2NP6A 2P4QA 4XRRA 2QV7A 2B35A 2J30A 3HUEA 4XX0B 3ZE7A 3OT5A 4BZZA 3ADDA 1Z6TA 1H0HA 3IDOA 3M9WA 1RWBA 5K01A 4PZAA 1G8JA 3EMKA 1L4LA 3V7YA 4LB6B 5K0ZA 3G2KA 4LSGA 3KB6A 3EQ6A 1EK2A 1K4KA 1E6LA 1D0IA 2W6IA 3RWMB 3U9TA 1IK4A 5FXMA 3WTUC 1B8IA 5F3DA 3GV0A 3GI1A 3AF3A 2GYUA 1ZNXA 1IUYA 3QFCA 4HXGA 4K3UA 3BRSA 5LL6P 3ZQ6A 1I8TA 4GO1A 3ZLVA 2MC4A 3KR9A 1K5DA 1QBJA 3B7WA 1T4GA 2XQFA 3GVIA 2HF7A 4XGIA 4DIBA 4QAJA 3G89A 2QQ0A 3N0XA 1ABEA 2QM0A 4KQMA 3RFXA 3E2IA 4F5EA 5AW4A 1HO3A 2P3SA 4OTZA 1YR9A 2W37A 3O21A 4KPFC 4R4JA 3NCTA 2FGJA 1LGYA 4S04A 1WDTA 3DMTC 1KJJA 1SFKA 1Z75A 4CCJA 2FLVA 2DQLA 2Y76A 4K0RA 5LR6A 4FNGA 5F9FA 3W8DA 1H5QA 1REPC 4BMZA 3Q0TA 1FP6A 2HADA 1KTIA 3MUOA 1TVEA 3FHLA 3DGEC 4C29A 4IIUA 2NUAB 4B09A 3QP9A 1POWA 4DY6A 3KVRA 3IA2A 2QDXA 4CO8A 2AOTB 3SFZA 4CM4B 1WJFA 4R9SA 2C3YA 2GLOA 4G4SP 2H48A 4BQAA 3DEIA 2ET6A 3ZGKA 1E9RA 3B9BA 3F6SA 3O1LA 2XB6A 1P60A 2QQGA 4V0SA 5EQDA 3D0QA 3RRMA 2ZB8A 2FVXA 3HDGA 5ES3A 1T3LA 2VAWA 5AIPA 4JA2A 2Y1GA 1JKIA 4IJAA 1Z73A 2IHBA 1GTVA 1XDWA 4TWZA 2TRSB 2CL5A 6PAXA 4PGFA 4KO1S 4BV9A 4YRRA 2B61A 2CZQA 3NHWA 1YOVB 1IG7A 3EZXA 3U19A 4FDAA 1ZC3A 1QCZA 4IHAA 2IXFA 3HRHA 4X62B 3O92A 3ABSB 1COWD 1MAAA 3AHHA 1WEHA 1ZXBA 2L02A 3WNQA 4K05A 2PVCA 1XCVA 1DDNA 3FWNA 2KX7A 2X5XA 5HIIA 1MJGA 4DG8A 1KDOA 4YS6A 4G4IA 1AUQA 3AZQA 3SEFA 3OEYA 1Z67A 1BIFA 4KQ6A 4KIUA 3CJTB 1QP7A 2DA6A 2IOHA 3ZHUA 3GCDA 3T5PA 2JCSA 4B34A 4BLOA 4GOKA 3R6DA 1WU8A 1JEDA 3E5RA 1VPTA 2RGUA 1UWCA 3DFGA 2GJKA 1X0VA 1EK5A 3AESA 2ORYA 3S2FA 2WAMA 4CCSA 4NS4A 2O6GE 3KOOA 4G37A 1G5HA 5K8CA 4B4VA 5LQJA 5IS2A 2H11A 3A14A 5AVYA 3H5TA 1GFWA 1MDBA 2AV6A 1FSPA 1SXHA 1GXSA 3GCXA 3ZLUA 1EK6A 4B44A 3PNQA 4OUDA 3ZBQA 2DHRA 2I8LA 2QRVB 2O6LA 3QQ5A 5FLXK 3RIEA 1P4HA 2E5FA 5DXJA 3E03A 1F14A 1CUZA 4LHXA 4ZVMA 1AF7A 2K6GA 5L3RA 3LBYA 2NYRA 3PXAA 4CYDA 1F9AA 2V4ZA 1CE8B 4Y3UA 1LC3A 4IHJF 1WQ3A 1KU2A 1ETOA 4CV1A 4X8LA 4P0TA 1CK4A 2IUUA 3W9UA 4W9NA 4RULA 4IGEA 5LB4A 4B6OA 2ZRAA 1Y6FA 3FM5A 5E3MA 4D6PA 1IB6A 3OTWA 3A1DA 2W6OA 2CW5A 3FDZB 5LCXA 2ZSUA 2HQAA 3OZDA 1CRQA 2BKUA 1A5TA 4Q47A 4Z4GA 1NW5A 2R1TB 4FN4A 4CHUA 4DV2B 4OHYA 2GOYA 3DBRA 3EJ6A 5HW0A 4RGBA 5DN6A 4OIQF 3V1TC 3U1BA 4U7HA 5DT9A 5ES4B 2KPMA 3TIXB 3JATB 4B7XA 4U5QA 4NCHA 1J90A 2BY4A 1UBLS 5EIOA 1ZHHA 3SLGA 5KYGA 4FHTA 3BP8A 1VC2A 1SCUA 1GFZA 2GYYA 2QX7A 2EX0A 3CLHA 3TINA 4BLQA 1P5FA 5C7OO 2WJPA 4JBIA 2QTWB 5JVDF 2LMDA 4LZOA 3TDKA 1ITYA 1QFZA 1UMDB 2GAAA 3PDHA 3MQ0A 3MCTA 1JLLB 3OYHA 3K2BA 2JGIA 4R7TA 4UBJA 5A04A 1ETXA 4BKPA 2AMLA 1D8TA 3TB6A 1RJ9A 2R6DA 4KVZA 5I8WA 1I0ZA 1Z4JA 3UV7A 1OX4B 1Z4NA 4NTZA 4EHKA 2XDVA 2K9MA 1TCUA 1N2CE 3O1JC 3Q3GE 2JD0A 4QC2A 4FCVA 3Q6MA 3R9WA 2HPAA 2AE2A 1NAHA 4PO8A 1JHVA 1ZIOA 4N54A 3KKEA 2PMZA 1WD7A 2HZTA 3IXMA 2QJWA 1NN3A 2IOFA 3X43A 3H13A 4YRQA 2DAOA 2GF2A 3LG2A 3ZZUA 3AFMA 1VMIA 2G08A 4LZZA 4C4RA 1Z5UA 1O4XA 1IDYA 3VTFA 1E2NA 5BUCA 1PR0A 3OJOA 3N7TA 1JHYA 4RWEA 3B36A 4QYMA 2Q4BA 1DEKA 4YAGA 1GA4A 2VT3A 1YD7A 2PWPA 3O8OB 2Z58A 4HWPA 4AN0A 1T2DA 3E2PA 3WG9A 1RXWA 1P1CA 2Z4TA 2WKSA 3PHLA 2DSTA 1PGNA 3RAFC 2QQAA 4EHAA 4C0LA 4EGYA 3GHHA 2N8GA 2F5EA 3Q5GA 4XJTA 4OP3A 3IPLA 4DMLA 4LG0B 1FFXA 3FF5A 3ET4A 4GBMA 2C96A 5JXGA 4RXMA 3DQQA 4KLCA 5C4MA 2PLAA 4KMSA 2AXEA 1GY8A 4R2MA 1QZEA 4Q4AA 1EWTA 4DLVA 1LI7A 2P0AA 3NFYA 4YEDA 4UQLA 4W1QA 4NZ9A 3S2SA 1NI4A 2ZW9A 1RPZA 2CCJA 5AJVB 3A70A 3CNNA 1NKTA 1QK4A 1IY8A 3V55A 5EA2A 1DJOA 1JT6A 1ZD8A 1YRWA 1FRVA 5T41A 2JKVA 2V6CA 3E97A 1XUOA 4AJIA 5DNUA 3DEAA 3Q7IA 1BEZA 1ZU5A 1X7ZA 1UC9A 1J33A 1HW2A 3B2EA 4D8UA 4OXIA 4TQGA 1Q7CA 3BJZA 3PXUA 3N6XA 1Z29A 1L0BA 3LUHA 5CRIA 5EGOB 2EIHA 1IOVA 1K6YA 1UP7A 1CQXA 4CW7A 3KZKA 1M1EB 3U2QA 4Z7JA 2UXBB 4DV6B 2HUNA 4XGNA 3UWOA 5GZ6A 4JLWA 1H4VB 3DEEA 4BLRA 1FRFS 2ID4A 1V1MA 3OE7D 3BKXA 2PMEA 3TDNA 3I39X 4Z49A 4S24A 1XU9A 5DNEA 5JEDA 3ZK8A 3EY4A 4U2BA 2GZ3A 4E5UA 2KIUA 4RGRA 3BB1A 4XIJA 2OLKA 4XYEA 2JLCA 3TLBA 1IM5A 1QA6A 1Z68A 4Y1RA 1PS9A 3GTOJ 2OP1A 3WLNA 1ESZA 4ERNA 1GADO 1KA8A 4ZTFA 3K2ZA 1C4XA 2CL7X 3BFPA 2B8TA 4P4NA 3JARA 3PUJA 4TMXA 5C37A 4D26A 2RB5A 2NYUA 4ISCA 1G42A 5B58C 4OB8A 2X4DA 3JRFA 1A71A 1S3SA 4WEOA 2G72A 4MPDA 2VVTA 2AFIA 4P4TA 3AR6A 2OUMA 5AUNB 1AQYA 4I7HA 4DQLA 2WAEA 3H8JA 3LSHA 2HXSA 2W0SA 4YIIA 4LK2A 2XMDA