2F48A

Crystal structure of a novel fructose 1,6-bisphosphate and alf3 containing pyrophosphate-dependent phosphofructo-1-kinase complex from borrelia burgdorferi
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
551
structure length
551
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords diphosphate--fructose-6-phosphate 1-phosphotransferase
publication title Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
total genus 199
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 2f48A03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A02
3O8NA 3HNOA 3O8LA 3SBXA 4I36A 2IZ6A 1S2IA 4LJKA 1S3FA 6PFKA 4OHBA 2KHZA 2F48A 1YDHA 1F8XA 2A0KA 5ITSA 3MAJA 4PFKA 1S2LA 4FYIA 3F5MA 4U1RA 3BQ9A 4MCJA 4LJLA 3O8OB 1S2DA 3OPYA 1RCUA 4WL0A 2F2TA 2Q4OA 2Q4DA 4FYHA 1S2GA 3O8OA 2IZ7A 1MTOA 3EHDA 4KXMA 2IZ5A 4I7EA 1PFKA 3UQZA 4I4IA 2NX2A 2F64A 3GH1A 3U39A 4MEJA 2PMBA 2HIGA 3QUAA 1T35A 4P5DA 4JEMA 4P5EA 5AJUA 2F62A 4LJRA 4RH3A 4KXNA 4JENA 4FYKA 1F8YA 1WEHA 4KXLA 3K2QA 2F67A 4OHRA 3IMKA 5AJTA 4HX9A 1KZHA 3PFKA 1ZXXA 1WEKA 2A33A 2KLHA 4A3SA 3OPYB 2PFKA 4JELA 4NPAA
chains in the Genus database with same CATH superfamily
3PSAA 1EUQA 2OD2A 2EVWX 4FKBA 4HF1A 3LXRA 4MW9A 5BQTA 3D0QA 1OGYA 1DAKA 2FF4A 3WGOA 5M29A 1T0UA 2QTVB 1U7PA 2V7WA 3G59A 2TRSB 1WM1A 1NASA 1YIOA 5BW4A 2REBA 3BR3A 3BIXA 3OUZA 2W1OA 2HD4A 4BGEA 5IUNC 4HDSB 4Q9NA 4AYTA 3OLZA 4OHFA 3NGLA 1FUEA 5HFAA 1I7QB 2O06A 3L2WA 1FU4A 3RYFB 1QUEA 1V8PA 3PPXA 1H8ED 4ASNA 1ITZA 3V8PA 3G8AA 2WE7A 4HNTA 2OLKA 3IKMB 3AY3A 4J03A 4N7BA 3T8RA 4E15A 4JKYA 4X94A 3BQZA 2QCOA 1RQNA 2JBAB 2WYIA 1JB1A 2YJ4A 3I8OA 4D42A 1IJFA 4R1UA 3OKPA 3Q8XB 4IS2A 3CEMA 2Q6VA 4HN9A 1ULYA 3SXUB 4EA8A 3OIOA 3STXA 1PP7U 5AJZA 1NVBA 3HZRA 5CFRA 4OL9A 3BCUA 2YC2C 4R8VA 2FW9A 1T5IA 4BGDA 4YPVA 2H4XA 3OM0A 1JKJB 1FLDA 4URWR 3HOVJ 1LH0A 2L02A 4UM7A 2BFDA 3RARA 1ETUA 2FPXA 3FKQA 1YRNB 5CKTA 4IUYA 4KKXB 3ZHXA 2RC5A 3F9RA 1DTEA 3TB6A 3LUDA 3DTKA 1OB2A 2IX9A 4TMXA 2FWMX 4N0BA 4NIMA 2HCJB 4EFNA 9LDBA 1XMKA 3L4EA 4JA2A 3NHMA 4PSXA 2GPBA 3NWOA 3VO9A 3GVAA 2B82A 5DBEX 1JDBB 3DBLA 2PD4A 1EDDA 3M6AA 5C81A 4N5NA 4KYIB 1CR1A 5JW6A 3CCQI 3OYMA 3BMNB 3HUDA 5CDGA 4B6EA 4KIJA 2AR0A 1PUFA 1D09A 1CY4A 1JU3A 1HT2E 3B1WA 3C8UA 1ONPA 4IXWA 3MLEA 3DEEA 3THYA 4L73A 3SJUA 3KJNA 1RRFA 2H4YA 3GIDA 2C57A 2OCGA 3ABIA 2RBGA 2I1QA 3NPAA 2I03A 3L4BC 3AYZB 2QQBA 1SO8A 2CLFB 3E2MA 3IMEA 2C58A 3K4PA 4WNAB 1IBRA 2IYYA 1IM5A 3QEJA 3LRXA 1W581 1IV8A 2PUAA 3E70C 2VJCA 4QASA 3E22B 1XPRA 4J4TA 1UIRA 1DL5A 1LPPA 4Y9SA 4WX2B 3F71A 2GN9A 2FVXA 4GWKA 4TXMA 2JGJA 4GKAA 4UBOA 3IE0A 3RV4A 1SXPA 1N4DA 3SAJA 1KDTA 2PSEA 1VJTA 1QANA 3D8UA 4FQ5A 3ZNNA 5EYRA 3OT1B 4AVPA 1N3LA 3H0KA 2EARA 5GPAA 3GL9A 4X1KA 3K70B 3CLTD 1B74A 3VHXB 1E6WA 4CKCA 4DMGA 4WASA 2YBEA 3FWYA 3L09A 1JSRA 3KC2A 1OXUA 1NDUA 2XMZA 1G6KA 2D0OB 2Q62A 2BAGA 4JK1X 2ETHA 3VV2A 2GA2A 3P5SA 5CM9C 4UVGA 2CL7X 2H2FA 1BWSA 4BGVA 4GRIA 2IDMA 2VNIA 2CMKA 2A8YA 3UUEA 3ULKA 2J59A 4U3JB 4HTFB 4C4RA 2Q2WA 1EXVA 4YECA 3MJSA 5D5UB 4QXAA 1OGIA 1YS9A 2LVSA 4TWBA 5FV7A 2FSIA 1T35A 5HCUA 3EARA 5AHOA 1QHSA 5F2NA 1OAAA 3LDUA 3V8BA 4BNNA 3PQ5A 5CH3A 5KPDA 1L0OC 3A6KA 4I99C 2VOPA 3WJ7A 3JQFC 3OY9A 2DT6A 4EITA 3L7AA 4J00A 1G4UR 4DJJA 3IAM1 1K8XB 1QS0B 5JHGB 4GKKB 4G7OF 4R01A 4EPRA 4B71A 4Q3OA 1DBPA 3TYXA 3I92A 2MABA 3GJ0A 2QTLA 1R0LA 4D5GA 1LQTA 4QDTA 2QQ5A 4QU0A 1QRSA 4QNNA 2QSHX 1N2CE 2WK1A 2FZ5A 2VYCA 1JAZA 4HUQB 2C6YA 4NEGA 1ZMXA 1XZNA 2X1DA 4PYIA 1E4YA 4RIIA 4MGIR 4JQYA 1LA2A 1JKRC 4DGWB 4YP5A 2X4IA 1YJAA 3H8JA 4IUDS 5GTIC 1FXSA 2C97A 2VUUA 3RI3A 1DEHA 4AJEA 2VQDA 2V58A 4DOMA 4YFYA 4LMBA 3KZKA 3QPAA 5DGXA 4ABZA 3VPXA 3KEQA 2CC2A 4KPYA 3RUCA 4UXIA 1GDTA 3BMOB 1YUMA 4YHHB 4MKIA 3GRKA 1GG9A 4UVIA 1C7ZA 2CFCA 4NMXB 3AR4A 2OV6A 1DAOA 4MQBA 5B3LA 4LFBB 4MQFB 1I01A 1JKPC 1CUWA 1XLVA 2PU5A 5K5OA 2AMFA 2FE4A 3E84A 1IEWA 1T0HB 1PGNA 1JEDA 4PZJA 4LY0A 3S40A 1X7ZB 2XZOA 1NP7A 2X0KA 3DG9A 1LBHA 1QRYA 3F9KA 3MBIA 4C87A 3AOGA 3KLMX 3R60A 4JJ8A 2APJA 5TJJA 1GNPA 2WT8A 5DCMB 3DB1A 1CEEA 1NQXA 1T08B 4YRBA 5HLHA 4GPTA 3D3QA 1SXJC 5IT4A 4U2KA 3R09A 2D2WA 2OGWA 3O8HA 2Z33A 4ROTA 3GEBA 4U2DA 3FCAA 5LYJA 3E81A 1IQ0A 4Q3LA 1YACA 1BM9A 2KW5A 3QOEA 1FZTA 1KAGA 4EBBA 3FPAA 2PR2A 3CT4A 3DEZA 4BTLA 3PM1A 3EEQA 1DIAA 1LU9A 1U0GA 2Y92A 1ZN8A 1B14A 1TA4A 1MBHA 3KR2A 1H2EA 4DA9A 2EX0A 1K7CA 2FEZA 2V7TA 7ABPA 2NLOA 2CUEA 4X54A 3WHPA 3D54D 1RWMA 2ODPA 3KPJA 3L82B 3E3LA 1L8LA 5B4TA 1VE5A 1D1QA 2FPSA 4YUWA 3WKBA 5FTMA 4GH5A 4DB2A 1D2AA 3LA7A 4RD3A 3M4NA 3TKYA 1GNTA 1UMBA 1Y1KE 4ZN6A 1Y3BE 4M9CA 1G5QA 1JAYA 1AQUA 1QPMA 3MWYW 4GECA 2GM4A 1EB8A 4FCWA 2IPAB 1T9HA 1OTXA 1AQLA 1G21B 5KDLA 3RRMA 2SKEA 2MYNA 3WP0A 2HR1A 4TVSA 1TVCA 3SSAA 1A9XB 2AEFA 1EQAA 2DFTA 4B6PA 1DAPA 3EK2A 4MRVA 1Y8CA 3AVPA 1Z5VA 2XMBA 3CNQS 3RTDA 3C70A 3RBXA 3EODA 1SAUA 4RGXA 3PNYA 3IH2A 5EJFA 2JVHA 1F2UB 3LNCA 2QT9A 1UEXC 3GUZA 1IUYA 5U9CA 1IF1A 3OQNA 4D9FA 4A3IJ 4GPBA 4H4KC 5HCIA 4KXQA 1OISA 4ZVPA 1OT5A 1XDDA 5DTMA 3VAZA 1Y3DE 2QG9A 5JO0A 1GPYA 4FFLA 5GY7A 3BWXA 1K6EA 4KN9S 3JZMA 4TL6A 3NBXX 3FRHA 2V55B 1Z5UA 3WGYA 4GP7A 2QJFA 1KEKA 3BZUA 3DXJF 1SBZA 1KI4A 1AA9A 1NA5A 2R751 4Z49A 2BCGY 5LKAA 4MVWA 4B4WA 3UKOA 2E9SA 1GTZA 1FU8A 3SOZA 4RAOA 1QTNA 3BHNA 1A8IA 2X1HA 2WU8A 4C2BA 4CLRA 1UXGA 1DCFA 1D3YA 1JMYA 3BIFA 4RESA 2JK1A 1JJ6C 2FPPB 1XCOA 2Y71A 1R64A 2IT0A 1LTQA 1P4SA 1PDVA 4O4HB 1C9DB 1K6MA 4PYOA 4YJ2B 3EMVA 2REOA 4JAVC 3BC8A 4MWZA 1VBKA 5EWJB 1FRNA 1LWOA 1BC7C 3HKZA 4LWPA 1U78A 1Y7PA 4Q15A 1HNNA 1IV6A 3D3JA 1IRIA 2J45A 4TQAA 2R7LA 3MIIA 3T5PA 2ZIVB 2RK4A 3L3BA 4D0PA 3OLYA 1QBGA 1XHLA 4KLCA 2IZ5A 1PFQA 1LB1B 1IY0A 5K5RA 4EY5A 3M6MD 4QJ5A 3RW9A 3W34A 3W3CA 3LDAA 4L5EA 3EWAA 1FTNA 3FGZA 1E20A 1XJWA 1KPHA 1I9CA 2ZAIA 4QULA 4GXNA 4EMUA 1TF5A 2PGAA 2IIPA 1BC5A 5FKLA 1RXVA 1DZIA 4EJSC 4C5CA 3BQMB 1GQ2A 3CVWA 3BDDA 3G9XA 3G5LA 3LSYA 4WWHA 3N2NA 1CY6A 1NW4A 2X7HA 3I6ZA 2IPMA 3TX2A 1HNZB 3CONA 1H6BA 5KKAA 2PO5A 1WXEA 3FPCA 5JEDA 5HTKA 5JCJA 3KETA 4QYTA 1WU8A 1BW5A 4TZKA 5EEGA 3VAYA 3Q10A 3Q5GA 3DKWA 2FK8A 3PHGA 2I2FA 3AU8A 2ONKA 3I34X 3NGXA 2QNRA 1AVTA 4ZV9A 2ORVA 4KQ2A 3CXRA 3NALA 5DB4A 2WB1A 1DRVA 2PUWA 5J6XA 1G3UA 1TLHB 1QVVA 2CK3A 1Z63A 4ADSG 3SJMA 4KVZA 2QMEA 1HDPA 2V1DA 2JGDA 4RJ2A 3GNSA 5JARA 4H3SA 2WAXA 4MUJA 3BXFA 3NC4A 1AKTA 2NS8A 4BE4A 4EEZA 3R23A 1IOLA 3WY9A 1GR0A 3HJTA 1KR2A 1N9GB 3GGPA 2XWQA 1R6DA 4K6CA 3ETJA 5JOQA 5ILGA 4JL6A 5DNAA 1JHFA 4ZYLA 2A9KA 3DPIA 2NRAC 3KZ1E 4HAIA 1EK0A 2PH3A 4YP0A 4ZVLA 2OZKA 4F72A 3QLTA 4I1PA 1BMFD 1VBMA 1B7GO 4Y7CA 2H2DA 3CZ9A 1Z38A 3F8WA 4ZH4F 3IVRA 1APLC 3K1PA 3NEAA 4BZPA 4XQGA 4EL5A 2BFOA 5BSUA 2ZMEA 3U4GA 4XQCA 1SUEA 4D1YA 4NC6A 3KE2A 2VWPA 3FNHA 5I7RA 4HCJA 3HNRA 1T2UA 3ANTA 5JAHA 3DLCA 4A3BJ 4LIPD 2Z83A 4EGSA 4Y1GA 3PS9A 3D2CA 2ZTVA 4HWGA 1ZQ3P 4I0BA 2I2WA 3LMMA 2B35A 4LHVA 3C3YA 3I58A 2XTNA 4LOAA 3MB8A 1ST2A 2WJJA 3FDJA 2G76A 1HT1E 4LQCA 4NAUA 4KDRA 2QZZA 4CDGA 3IEKA 2IJLA 4UPEA 1JYFA 3DZJA 4LXIA 3A1VA 2ZTMA 4WVLA 3A4IA 3L2CA 2TMGA 1LY1A 3L7KA 5PNTA 3SZOA 4TV9B 5AFSA 4X1YA 1TWAJ 1VGVA 3AEZA 1U7HA 4AM3A 4MAFA 1KH3A 4LQ4A 5K8VA 2EHDA 1R8QA 2PM8A 5E3NA 3VEPA 1MVOA 1JG2A 4TVBA 5FBHA 5IT9K 5IFKA 4WMLA 4B3HA 4KXWA 3DMNA 5DSXA 1G5PA 4R1QA 4BYYA 5COAA 4RNCA 2AFVA 5AUOB 4EGJA 1H4SA 3T3HA 4BNYA 1WZUA 3BGVA 1DGRM 3N2YA 2A94A 1K4MA 4TTIA 1DC3A 2OCAA 4NBRA 2IT1A 1E3OC 1KOLA 3UQYS 1AKWA 3TLYA 3N87A 4QBGB 1V7CA 3KCNA 3VU9B 1CS0A 4RZHA 4OBXA 3A03A 3ZXXA 4IDFA 4LSZA 3L7BA 2R3SA 1STOA 4L15A 5CR9A 1Y8RA 2WWYA 1GUBA 4B7AA 3P71T 1OH5A 5KYXB 3RS8A 1DBWA 1J0CA 3CJQA 2YWCA 4ICIA 5TMPA 3V9AA 1CW2B 4PIPA 1XF9A 3HSFA 1PTKA 1XZLA 5J2TB 3UHFA 2WNSA 4IVPA 3ZE0B 1NMSA 1IH8A 4ZDWA 4J94A 4AFNA 4UDYX 2FBHA 5DE3A 5ULLA 4Q21A 1H0SA 5C8XA 3O73A 4K9RA 1U3DA 5KQSA 4F3YA 1ISPA 1NN1A 1GNSA 3QY0A 3IEUA 3CMAI 4CEHA 4ANFA 1RKTA 2C2BA 3HVHA 3IEXA 3WB9A 2XRYA 1HSJA 2E21A 4NDAA 3ZIAA 2HWKA 4QVKA 5L6LB 3W2HA 3G2OA 3TZHA 2EA4A 5A4KA 2ZRKA 5CPBA 2PR7A 1NOKA 5KWSA 3IQXA 4I5IA 5GJWC 4G2TA 3WOHA 1HE4A 2H6CA 2CW5A 4HQOA 1E3EA 2JRTA 2OD9A 1FX0B 2HMAA 2L9RA 2CJWB 5LA6B 2HFHA 2NSHA 1SVUA 4LRXA 1PUXA 2E2HJ 1WCV1 3DLBA 4XJVA 3S5UA 1JBEA 1JI8A 1GKIA 2RHRA 3CDIA 3PC8A 2QGFA 2V7QA 3EXEB 5GADJ 2QZ8A 4EVRA 4RABA 3W5JA 1E3DA 1JT9A 3CCEI 4I7HA 3QFFA 1X7WB 4QXRA 3SU8A 5CFMA 5FUXA 1CDOA 1UFVA 3NNSA 1NVGA 1IRGA 1SHKA 5M2QA 1RR6A 3MMNA 2QQ9A 4DGSA 4YJFB 2XHEA 4I09A 3JSPA 2KJQA 4D92A 1YT5A 4DV6B 1YB2A 2O1EA 1YYVA 4B5KA 4WLEA 1PD0A 4IZHA 4IDBA 1H22A 3I2YX 1H1LB 2FJPA 2J48A 4HSRA 1ACJA 3IJPA 5CDSA 1J9GA 4YG2F 1UBTS 2ZJYA 2DQLA 3K9HA 2R7OA 1DSSG 2PH1A 2IU6A 3RAGA 1P91A 3W5VA 1E63A 3QU3A 4I76A 1KEPA 4J90A 4PZAA 4U2EA 1J20A 3MUFA 5LGNA 1XRQA 3KO8A 5B2EA 1NBME 3QUSA 1VI0A 3IVMA 1XVTA 2JFVA 2ZR7A 3FTNA 1Z0IA 4OB8A 1YFKA 3FPKA 5FUWA 3RYCB 3N2LA 4BAUA 1U2WA 2OV2A 1G16A 2ZBPA 1SC3A 2GESA 2XOKD 2EZIA 4E6PA 3MZ0A 3PC4A 3TXXA 5FUVA 3A7DA 5IUKC 3IELA 4UNQA 1P1FA 1JL3A 1VE6A 4Q4AB 3EPKA 5CCXA 1L5QA 4FWIB 1T56A 4QYIB 3ZDFA 2MYTA 5H70A 1ADYA 3TQHA 2YR0A 4L07A 5KBYA 2JTVA 5JJCA 3SJZA 4XLNF 3GRRA 3CPHA 5TC4A 4DSZA 1VIMA 2Y68A 2CW8A 1YRLA 1RI1A 4TPKA 2AR7A 4YS6A 4AI6A 5K0GA 1RXWA 2PJZA 1KJIA 3M1AA 1UKBA 4DR7B 1CQIA 5CW2A 4MPDA 1OC4A 4MI9A 4FWTA 3GX1A 1TGYA 5E3MA 1PJLA 1GRRA 5CA0F 2DHRA 4DILA 1SUIA 2LCIA 3KKLA 2B7BA 1DXHA 5IKXA 1YHQI 5CVDA 3AETA 3AFMA 4YELA 1KKMA 2QUFA 2K4BA 1CLUA 4G8DA 1XZQA 3DTEA 3J81K 4M1KA 4HAUA 4II7A 3SF0A 1RLJA 1P0PA 3DE0X 3ZU2A 2AKEA 5AMXA 4Y0NA 1GCUA 4RVGA 2Y2VA 2G1PA 4Z51A 3RIEA 1UIMA 5AW7A 1VQ1A 4H4EA 2QW0X 5B3JA 1A4RA 3NEUA 4EELA 1CNEA 1ZINA 5D5HA 1MAAA 4E2XA 1N92A 4KYVA 4ZOBA 4TKVA 4DZRA 2FSSA 1GUFA 4MS4A 3ETNA 2BJVA 2ORIA 1CE8B 3K94A 3OOJA 4WA8A 5D6FA 4PXYA 4ZI7B 5AQEA 2Q3JA 2V4ZA 3K16A 2V6EA 3BJZA 4A9AA 2IUFA 1I4WA 8ABPA 1DWPA 2NO9A 4YIKA 5IEJA 4BVHA 2QX8A 4GYIA 3LC0A 3A1YA 3MPUA 1JB9A 3H92A 4CTNA 2H65A 2Y6UA 3O3OB 5F76A 4I19A 1YDMA 4LE2A 3OYHA 3C4QA 1OH6A 4IQGA 5J40A 3K4JA 3IC5A 3QPTA 3JAMA 3GRFA 3BN3A 1BW9A 4N5LA 2E35A 5K0NA 4P38A 4FONA 2EQAA 2O48X 3I8SA 3DTIA 1H42A 3Q15C 3L0CA 5FNVA 3ROGA 2VA9A 3OYGA 1IYZA 2RCNA 3JPWA 2NACA 4PX2A 2ADMA 2BKUA 1GTL1 1N5MA 4MB2A 3HA3A 1MZVA 1HMPA 5FOSA 4X90A 1SQGA 3BCHA 3ZW9A 1Y6QA 4BBZA 2I8LA 2ZIXA 3UOWA 3PNQA 4IEEA 3RS5A 2FNPA 4DQ2A 3T5TA 2IV2X 1ZVMA 1JKFA 2FLWA 1ZY2A 4GI3A 4DLTA 2OG1A 4G1UC 5CNKA 4RMJA 1K88A 4YUYA 1EGVB 3BGIA 1RETA 2HQ5A 3WGQA 1VI5A 2P3SA 3L7YA 3BLYA 2A6TA 1EP3B 3UAVA 4LDNA 3TBFA 2VDPB 2OV3A 4H35A 4H0EA 4YIIA 5CT8A 3INRA 1VCIA 4JFRA 1P6XA 2C4MA 2NV0A 3I0NA 2F5FA 3NCTA 2FFJA 2Q3FA 1Y6JA 2B6NA 3NVMB 2QIPA 3IL2A 3AQIA 4AIIA 3VTFA 1JHYA 5D3KA 4X8OA 3OYJA 2X41A 3BEOA 4F97A 2CFTA 2ZO4A 3KPVA 4EQQA 5K9ZA 2WU1A 1ON1A 2C54A 1VE3A 4JSTA 2CLLB 1Y1WJ 4KRFA 4F84A 1N2CB 4RXTA 1TK2A 1WD5A 1OX6A 1SCAA 5I7SA 1G19A 1QE5A 2Y77A 1JDBC 2WYWA 4NARA 2YVKA 4N5DA 3CISA 1PYOA 4RFLA 2ZAGA 3OL4A 1VL1A 1ZGWA 1DU0A 5A5GA 3G8BA 3A4NA 3GXOA 1BAPA 2I7CA 5I7AA 1CQXA 4ARBA 3IAS6 3KEYA 4JVLA 4JBLA 2WAEA 2GI4A 1SOMA 1Z6PA 1VHLA 3F4KA 2D8MA 4XLTA 4PHTA 3V34A 4FR0A 3PDHA 2VAXA 1Q1HA 1XZDA 1UZNA 3ZVNA 1NQVA 1OBCA 3V00A 1YW8A 1B15A 1M6VB 3K71B 1AXGA 2IGOA 4CIYA 3FWKA 4L5YA 2R7KA 4TLEA 4C2UA 4C0KA 2DFFA 2GEBA 1XMIA 3S8EA 4O4JA 3G2MA 1A98A 2OQIA 1ZM4A 1LDYA 3HV0A 2CLEB 4Q34A 1AIPA 4CTOA 3WV5A 4RVFA 1ZVKA 3JVVA 1CUHA 3KLNA 3I01A 4MI3A 2BLNA 3DD1A 4ETNA 2VHUA 4ZJPA 4CA0A 4UUSB 3K31A 5AO9A 3WSTA 3ZDYB 1KP9A 4D9CA 3CCSI 4D99A 1A8PA 4L9RA 4WBXC 4XN0A 1ZL0A 3K70C 1U1EA 5AW1A 5A5VA 2VFAA 2A6EF 3Q6NA 4N40A 2ZJQF 4OYRA 3G2BA 1GDDA 3R0XA 3S4YA 3S8YA 4M71A 1YBAA 4PWZA 5IAJA 1VE7A 1JDPA 3ET4A 5TS2A 2ELJA 2MYSA 3C2GA 4YUZA 6LDHA 5B66C 3WHCA 1Z0AA 1TYAE 4D26A 1OXMA 5ALNA 1SJ9A 3IAS1 2I8AA 3THXB 1W5SA 2AK3A 3RPUD 5C8ZA 7AT1A 2JL1A 3YASA 2CVOA 4ID9A 1RZUA 4OJTA 4LRQA 4OP3A 5JRZA 3KK0A 4EM0B 3EB9A 1KU9A 5JVTA 2DQZA 1W76A 5I7OA 2E1PA 2XA1A 2EBFX 3BQNB 3FPSA 3BMCA 3SC2A 1T6ZA 1K4SA 1U7DA 4B44A 1JWBB 5ALKA 2C31A 1U9IC 1QRRA 4LXUA 3AR3A 4WK0B 3CRRA 4TVKA 1Z56C 1R27A 1I7LA 5JTTA 3TN7A 3TD2A 5FOQA 2AL7A 3HJEA 3OH8A 5EG0A 2HF2A 2I22A 1YOBA 4MB6A 2JKYA 3BJMA 2II6A 2I4OA 1B6SA 3D3WA 3RYRA 4C0JA 4WXEA 4NBQA 1CY0A 4HH3C 1R9GA 1LX7A 2KRCA 2Y0EA 4WXMA 1WHTA 5DHPA 3LSRA 2PZJA 4LDQA 5K3CA 1QGUA 4Y67A 4MUGA 5LRRA 4EUKA 2GT1A 3KYJB 4NATA 4BO3A 2V6IA 4LF9B 1SKAA 3IP5A 2LVBA 4BY7J 1PD1A 3RBZA 2BM9A 4D46A 3FUUA 1Q1EA 4PPGA 2Q29A 3FCOA 2WUVA 2Q5JA 5H59A 4D8XA 1Q0HA 3SYNA 2Q9UA 5KSPA 2AQKA 1HXHA 3EFHA 3C74A 121PA 4EJOA 2A9FA 4H3VA 3ZQKA 4F46A 1GPKA 5DM7F 4R2WA 3GTKJ 2NPFA 2JH9A 2ECFA 3CLUD 3JVUA 3TTTA 1MBZA 4O3MA 1CP2A 1ZA2A 2YXNA 3NOXA 2ZRDA 2Q46A 3QMPA 5CIQA 4Y2RA 1KY4A 3FBWA 4MGKR 4ZU1X 1QTQA 1DKPA 5HIJA 3NX4A 5HQ3B 4XGRA 3UMGA 2LDBA 1T2KA 4MLOA 4P96A 2GZ3A 2XAAA 4J6EA 5LQSA 1E0EA 5G4KA 1N0WA 2QN6A 2PKYX 2ECQA 3OYCA 2YXEA 2XDWA 3IP8A 5EMKA 3Q9UA 2P9ZA 4OQDA 2G9VA 3LFKA 3EJWA 3OWXA 1OX5A 3AR7A 2ZXFA 4DA4A 1HM5A 1LJUA 4E5KA 4LX8A 1B4AA 2ZFWA 2QOEA 4NAHA 5LUBA 2CG4A 5I51A 1T9DA 4JLKA 2XR1A 2DMNA 5L3DA 4QOEA 3Q8LA 3NHKA 1Y5IA 3U1TA 2GXSA 4RMIA 1X9IA 1BGXT 1LVKA 4K88A 1PKXA 4ENWA 4G12A 4MDEA 3ZHUA 1VHTA 3RG2A 3RUAA 3IEIA 3MSXA 4C4XA 4NUBA 1JHDA 4OUDA 3A1CA 4OJQA 1ZRHA 3V7UA 3A58B 2J7PA 3K0AB 1NSFA 4C2MJ 1HOXA 4RVUA 3M6VA 1BQ4A 1HFWA 2H7YA 3PRYA 5FBRB 4RCZA 3THSA 1C9EA 1I80A 1CJMA 1OGJA 1YJ9I 4ZDJA 4ATNA 4FVTA 2UYQA 3RVKA 3GLUA 3FOFC 3LQ4A 1TAUA 2QORA 3GJ5A 2DA1A 1G5FA 4F55A 1YWGO 3I1YA 1UH5A 2FW6A 3LCRA 3ZNQA 4LXGA 5JZ9A 1QMPA 3BYZA 4BLQA 3T34A 3LTNC 3ASOH 6NULA 4AJLA 3IALA 2ARKA 5TPWA 1IAWA 4JNCA 4JUDX 3K5HA 4URUR 3Q3VA 3FX2A 1H93A 3UWKA 4E32A 3FBIB 1BS1A 3DFZA 2RAUA 1QBKC 2B4TO 4PCQA 2ZSDA 5AOBA 2WD9A 2IDJA 3WTYC 1WXGA 3M6IA 5AKXA 3DMPA 4TMFA 4QNRA 3T61A 4GX5A 3A10A 1EH6A 4X93A 4CMIA 2FF7A 1XLUA 3TJRA 4KITB 2OD5A 3K6KA 5H3HA 1SCUB 4OAPA 3H2KA 1SD6A 4FFBB 1EX6A 5DBIA 4G37A 1TWHJ 3EIWA 3M9XA 5L7TA 3HXMA 1U9CA 1D1SA 1PQUA 3E3AA 1WV0A 5L3BA 1N2ZA 3ABQB 2P0EA 2R1TA 4S24A 1XCLA 4TZ0A 1RFLA 5I7UA 3CHYA 5F3RA 1K6JA 1T0PA 4KQKA 3H0DA 4YJHA 4MDFA 1C1XB 5FPHA 2JKVA 3C3CA 1J7KA 2HKXA 4LA4A 1N2EA 3GGCA 3T9FA 5LLQA 5KSWB 4BAYA 4B3MB 2HMSA 3PUJA 4IV0A 2HF9A 2JARA 3NC1C 3P0HA 5A6SA 2R93J 4ZCPA 4IVNA 1FMWA 3LA2A 2FHPA 2R5WA 3L2QA 3F0CA 1TIPA 1EM8A 3KPHA 2VXBA 3OM9A 1F5SA 1S5PA 1WJFA 2ZQYA 3QQPA 3ENQA 1UPXA 2CLDX 2B83A 1MO4A 1D0IA 4F38A 3S2UA 3LT2A 2YVLA 5I48A 2ZT5A 1WZEA 1XZBA 2V0CA 3TM4A 4UHHA 5JISA 4L6CA 4H1UA 3BS4A 3TVTA 1G8GA 4BQQA 4BMOB 3CPSA 3NAZA 2ECKA 3GMSA 2LC2A 2WYUA 5CVIA 1CC1S 3DV0A 3U0BA 4DMUB 1FC0A 2A1IA 1LPQA 2G72A 3L04A 1I4LD 3H0EA 2NZYA 5EMLA 3UG7A 3C4JA 3EXG2 3GUVA 2FQ3A 5AXBA 1N6NA 3ODGA 3FXQA 4RVOA 4A3KJ 5IT9Z 3G1UA 4KW7A 4BIIA 3NAMA 3MQ2A 3KYCA 4F6RA 2CL6X 3UJ6A 4IRXA 1IHOA 3GLIB 3EUAA 1JVBA 2GBFA 5JXIA 1OTHA 4I6EA 1FBNA 5FDFA 5D5XB 1NN3A 1BIBA 2RFLA 1RLUA 4PSDA 4HUTA 2IXTA 5CG1A 2FEMA 2VJOA 3PD7A 4DHWA 2NYAA 4O4LB 2HTJA 1QO9A 1K5HA 4JNKA 3ZY2A 1D4OA 3DDHA 4S04A 2BXYA 4L9VA 3VDQA 1JYEA 3OR1C 2D5AA 4BQIA 1ECCA 3HXTA 5AKHA 4KLZA 5KB3A 4OIOF 4UHDA 2OC9A 2EW2A 4BN0A 1LVHA 5ERIA 5B7QA 4OYHA 2VEDA 3LFUA 4EV0A 3R44A 1MC1A 5IJ9B 3JQDA 2O0LA 3VSCA 5F23A 5G40A 3TGLA 4P84A 3EE6A 4QL3A 5C4MA 3IV7A 3JTEA 4G0WA 1PR0A 3NDIA 4OGLA 1MVLA 3JZDA 4IZOA 5CVEA 1PNTA 1CUSA 1YQDA 4KDPA 3MS7A 1EJ0A 3DQVC 1LNQA 2LIVA 3E3NA 3R1IA 1MDMA 3W9YA 1M8PA 2Z99A 3M4JA 3UOAB 3HCWA 3K92A 1G60A 1K8YB 1FT9A 1Z77A 2Z1DA 1M6NA 3SE7A 2NAPA 4KJXA 1JLLB 3VR4H 4JWKA 5D6EA 4FASD 3TCNA 1MX5A 2NOJB 3SLKA 4TWIA 4P0QB 3EA5A 3LUKA 4KLAA 5E3IA 3WNBA 2HZDA 5BQXA 4AG3A 2Q3EA 5CDYA 1JH9A 1ZG3A 1L4BA 2H16A 3R7AA 4G1MB 4DQXA 5C5IA 4Q18A 2J7KA 3FW1A 2OV1A 5HRCA 5T4EA 4YBZA 1C9MA 5J5VA 2X0FA 3TEMA 3JZIA 3UK6A 1X3LA 2QDKA 1DARA 3I4LA 1P5FA 3OA0A 4Y3UA 4INZA 3ZE2B 5H6RA 4OQLA 4ON0A 1KKLA 1KOJA 4OHBA 1UMKA 3Q4GA 1VFNA 1WMBA 4YCSA 1IO2A 4MGEA 2DXIA 1XTUA 1V26A 3A25A 3F8CA 2XPCA 2FG6C 3K05A 1Y0BA 1UJMA 1GOTA 2PV7A 4DRXA 1JLSA 3FFAA 4DIFA 4LG0A 2E18A 3QYAA 1BMQA 2W8BB 3CIFA 4TRNA 5AK5A 3PEYA 4HAWA 4JWTA 1S89A 2D4HA 1C9NA 1Z0FA 1O54A 4FSXA 5DX1A 3KZVA 4LY9A 1BL0A 4JD5A 1KAEA 3H4MA 1HYQA 4CL8A 4ZYZA 2I3AA 4OG2A 5C0OE 4HDOB 3FLBA 3KAQA 3OHMA 2N75A 4CHTA 2VKTA 4S3MA 4ITVA 5DCYA 2P3LA 4OOEA 1O95D 1SK9A 2XT9A 4J0CA 4DPKA 3EIQA 3OBBA 1M33A 5D87A 3O8LA 2GJ8A 1TQ2A 2YV2A 4OMUA 3KHTA 3IULA 1YMVA 4ND8A 5GJVC 3W6ZA 4PSCA 2H3HA 3ASVA 5BRAA 4IZZA 3KZMA 3BE8A 1V6SA 3BTLA 3ER9A 1ZOPA 4AUEA 3I39X 4GOLD 3I4FA 1JHUA 2CXOA 4G4GA 4PZUA 4I1SA 1P4HA 3FNFA 4FU0A 2EZ4A 2J41A 2Z4TA 3PFCA 5K2OA 5GQSA 5TF4A 1ZVVA 1AZLA 3WLFA 3AUFA 2IP2A 2WFZA 3O3CA 3QU9A 1YRWA 4R84A 3JS5A 1MO3A 3H0CA 3L7OA 4AMGA 3VR6A 4XKVA 4EF6A 1C1DA 2CDAA 2B1JA 1AMOA 1QH1A 4AY2A 3D4IA 1IB6A 4DUZB 4Z86A 3W5HA 3GO4A 1UB9A 3AG1H 4JEMA 1V8FA 1L4KA 1U11A 1SUSA 4KMUX 2BVMA 4ZREA 4UY8I 1OF1A 1IN1A 1RFGE 3C7DB 2Q1TA 4O4IF 3G2JA 1K68A 4AY4A 3KEGA 1GUAA 5FOUA 2QX7A 1ZK2A 1AS3A 4ZDPA 3I8XA 3SBXA 4RS4A 4G26A 4BNGA 1KL7A 4H0CA 1OWLA 3WO0A 2P77A 3DM9B 3IDFA 5IKOA 2ZUFA 3WB1A 5I3CA 3BJ6A 1L9KA 4HB4A 2O3QA 4QEDA 3NI2A 4N4NB 1C0KA 2RBEA 2WLSA 4C0BA 1KZ9A 1TZBA 3DQZA 4WINA 3UENA 4D82A 2IH4A 1LSUA 2AN9A 5E3JA 1IJEA 4WCFB 5JJLA 2PQ2A 3R3WA 1Q50A 5FI5A 1E7QA 2JLYA 5F4ZA 2CL5A 4QJBA 5EAIA 1OTYA 2HQRA 3AM3A 3J81Z 4LJ5A 4KWCA 2QGUA 3AG2H 3ORRA 2YS6A 5D4RA 1WETA 3TP3A 2B69A 5ILSA 1Z62A 1ULSA 3HMQA 1JEJA 2QWXA 1XB2A 1BGWA 2WFLB 3NYIA 1AQNA 1RZRD 4NYIQ 2GAOA 1T13A 5G3ZA 2EJVA 1R6XA 5J1SB 4E11A 4K3UA 4F8EA 4MIOA 4HC4A 3SS7X 4BN4A 5TEWA 3ZNOA 2DETA 1G42A 2QTGA 4M49A 4XGNA 1YONA 3LGXA 2DR3A 3LBAA 1IN6A 3B73A 4UE6A 5K1ZA 2ID3A 3WAKA 1COWD 3OAAD 3DU6A 2HA0A 2WMNB 2YWEA 1HC8A 5B1AH 2IPLA 2PEYA 2QVBA 1U9YA 2V6FA 4XK4A 3GYGA 3HUTA 2ZKZA 2UAGA 5HJEA 2QL9A 1W44A 4IEIA 5J2UF 2FMLA 2CQ7A 2VT2A 4ME6A 2N47A 3MTGA 1B6TA 1FNDA 2PCLA 1G8HA 5CPFA 3RPEA 4KH1A 3NHUA 3KPYA 4BJ6C 1ST3A 2CNDA 3V2GA 4L8VA 3HFSA 2BI7A 4UMFA 4XM1A 1IATA 2C4NA 3ENZA 4LGVA 3GQVA 1ONVA 5GJBA 3LV8A 2QBYA 1JUSA 4DBLE 4E1VA 4KQXA 4KGDA 3JYPA 1G2QA 4BV9A 4JELA 2BFEB 3QKTA 4RGRA 5HHTA 1H3FA 2L7FP 4QLCU 3MFYA 5AONA 3NFYA 4RKYA 2GO7A 3ADCA 4XVCA 1OD6A 3MS2A 3FMSA 3V7FA 5DT2A 3D5QA 5EZ5A 4IILA 3N4MA 1BX3A 1EHYA 3EY4A 2E82A 2EQBA 5HW0A 3C6YA 3LBHA 1E0DA 1WP4A 3MWJA 2XODA 3AR2A 1XD9A 3KYDA 1QIDA 4C7OB 1DKUA 2GPAA 1B72B 3GN1A 4BQEA 5JDCA 3OJLA 2JGIA 1Q0RA 1Y80A 4B9EA 5JAMA 1L1EA 1JQBA 4F3TA 4P36A 3H1FA 2ZQ5A 3QVKA 4E5DA 3TW8B 1KQPA 5BUSA 5E9QA 1YVUA 2H9IA 1M7GA 2PZAA 2P6TA 1MKMA 1APBA 3HKEA 4FGUA 4F11A 3WSVA 3PHJA 3GLLA 1MH4A 2P6MA 4H18A 2QTMA 1SHUX 3AY0A 4POAA 4ALLA 2QF7A 5KNCH 2B98A 2C2HA 2RAPA 5EPOA 1FDWA 3QFRA 2DG2A 4ZYHA 4TROA 3TDZC 4EI7A 2R11A 3LPNA 5DM0A 1M2OB 2DR2A 4FINA 3TGWA 1JF8A 1K7EB 3IDSA 3ZLTA 1TAGA 5JS6A 1K9VF 2RH4A 2G1JA 4V1CB 3HXKA 1YJCA 5EA2A 3PBKA 2HOEA 2QN9A 4HLDA 2XHZA 3FDFA 3HCNA 4LHZA 1CUGA 5EHGA 3UKDA 1JDVA 3FCEA 1WJ5A 4R8MA 3BH6A 4JC4A 1T4CA 1G9SA 2DUJA 2XQVA 2AZXA 3I04M 4HAVA 3G1LA 3OOEA 3E7XA 1YR6A 3O4HA 3OQOA 2XF6A 3LCUA 2XWPA 1GGMA 1VJ1A 3ZHZA 5HZKA 1E2BA 4DCSA 5CCDA 2ZI5A 1Z6ZA 1KJNA 2V1XA 1LV7A 1TA9A 3U81A 5ALMA 2FB9A 4M4SA 1GUUA 4TYWA 4DOZA 2PT6A 1UJ4A 4JEIA 2C7OA 1Y4DE 1W36D 2XDVA 3CBGA 1O3SA 1Z68A 3KSDO 2IYSA 3HDYA 2BDTA 3IH5A 1WUKS 1T9CA 1UFRA 4KU4A 1UDBA 1GCAA 5GPCA 4URHA 4F60A 2OK7A 5FTKA 4QU8A 5AJHA 4AJIA 1HZZC 4EJ0A 1IUKA 2NO6A 2JCGA 2HDHA 4ND6A 1M1NA 3INGA 1Z0JA 4IO0A 3FLAA 2J9GA 1U65A 3AKYA 1OPXA 5LKRA 1SCBA 1Z34A 4P7GA 1WS6A 5KJEA 4ALMA 1NN0A 1O6CA 2PMZN 5AI4A 5LMZA 5BN1A 1B8IB 2OXIA 1R18A 3RFFA 4YQYA 3ZU3A 4HR7A 1E4EB 2C82A 5CIWA 3DMTC 1S7CA 1FA9A 1Q15A 1P8JA 2XBLA 3AP1A 1VMAA 4K40A 3ROKA 3MCTA 3ZQHA 1CYEA 2JD2A 1WW2A 4CM4B 2I2XB 1VYUA 3LFTA 1YQGA 5AUPB 2V0GA 3HR4A 2P6SA 5IEBA 2LREA 2O2HA 3RVQA 3ZZNA 3GJRA 5LQRA 4J1TC 4BNZA 3IWZA 2EL7A 3QKSB 1TUBB 4RK6A 3QLEA 3MGAA 4NE9A 2F8SA 4AQ7A 2L7ZA 1LKXA 2QUJA 5EP2A 4R1LA 5D5WB 3GNTA 1KBOA 1P4RA 3GJYA 4XSHA 1V4VA 4GUAA 2ATCA 4PFSA 1MXFA 1ZFNA 3M5CA 1KNXA 5SYAA 3FTEA 2P0AA 4QICA 1SXIA 4P58A 4MUHA 3ECOA 1KYZA 1J25A 1LLDA 2PD3A 3AM4A 1TGVA 2ZPUA 4FEEA 4RVSA 1YJNI 1P1HA 4BUPA 2JAHA 3D9QX 3O8QA 2H54A 1UQRA 4PO8A 1HFJA 3FZEA 3JQ6A 4B73A 3S27A 3NQOA 6ABPA 2FUG6 4HT3B 2D06A 1T15A 4GPEA 9LDTA 2CE7A 1YUBA 2GCEA 1Q22A 1VECA 2UVPB 3MPOA 2LKSA 2D2EA 3H83A 2ZZNA 3HVRA 4J0IA 2PX2A 2Q5LA 2AGVA 4AJPA 4BX3A 1BEEA 3QPCA 1ZBQA 2FXIA 2LY2A 4JGGA 2NU8B 1ZGCA 1ID1A 4IKPA 5EJEA 1MA3A 3ACCA 4OI4A 2WJWA 3K9QO 3O9VA 1FU7A 5CFOA 3KFVA 1E69A 4NZNA 1FYXA 5IASA 1J8YF 1K2WA 3RK1A 3G0OA 1YOVA 5A4DA 2ZR9A 1TCVA 3DGEC 1JHRA 1E3MA 1JKQC 1NG7A 5DTQA 4OQZA 2C2YA 3BP8A 2A30A 3KXPA 4GRAA 1XD7A 3W5DA 3TB4A 1X87A 1L7RA 4CYCB 3W5IA 4KPUA 2JLQA 3HBJA 1B1AA 4PQRA 2WF5A 3KD3A 2ZPTX 3NBUA 2DQYA 2WBLC 1RR7A 4ZT2A 1N8TA 2PT9A 3UA3A 2H1SA 1H8HA 4ZDLA 1CUVA 2F3PA 1FFHA 3B2QA 4XFDA 1PSWA 3HG7A 1NXOA 4RAQA 5TJHA 5F64A 3UF0A 2X7XA 2FUG1 3WLPA 2Z09A 3BSFA 4XMYA 3NTRA 5L3QA 1UZMA 2RGNA 2XGMA 3R8XA 1HKSA 3HRMA 4ESFA 2HN9A 3QV1A 4R1HA 3U3KA 1E3JA 4B3TB 1RVDA 3STYA 3HB7A 2SECE 2GEKA 2R7FA 1DE0A 4MHGA 2YU3A 1RWNA 3A6EA 1USTA 5A5FA 2M8EA 4OB6A 1ZGGA 4S1PA 3WWDA 5JTUA 2P27A 4BFCA 1NTRA 4YCBA 1ENYA 2WWTA 3PRKE 2B2NA 1JT0A 1OYYA 2JAXA 2Q3HA 3MQ0A 5A7HA 4K28A 1OV6A 1JR6A 1ZCAA 5KOHA 3IR7A 4BKQA 2QTHA 2WAFA 1LZLA 1A8SA 2AZMA 5LUAA 2QXTA 2C77A 4QJ4A 1FTQA 2NP6A 4F04A 3ZVKA 5AM2A 1V55H 1EU1A 4DV7B 2G36A 2PK3A 3RTCA 3DXYA 1WBBA 3MM4A 4FYMA 2YIMA 3PHBE 4DFDA 4JI1B 1KDVA 1EZ1A 1OASA 2XF7A 2WJAA 4BFXA 4HFNA 3WK8A 4GXOA 1K1EA 1IQRA 4JKOA 1N5RA 3IUSA 2W2XA 3WLAA 2Z2YA 1X4PA 4LWQA 3MKWB 2YQ4A 4OQXA 1Y8ZA 3RS0A 2XMSA 4O0LA 2ZYTX 4IDCA 1XD8A 1X7YB 2FUNB 2FR1A 2MINB 5IANA 4B80A 4NCNA 3FSEA 1XXLA 2BCEA 3BIWA 1XSEA 3S2EA 1PGPA 4KMRA 4QRIA 3VYWA 2EINH 5KAIC 3DONA 1ZI8A 1YDFA 5IDVA 2ORYA 4EI2A 1V5GA 3W90A 1YS7A 4NZOA 4OHOA 1QIJA 3GLIE 2GB4A 1QV7A 3A0BC 4OQPA 3GRYA 1EX1A 1NVMB 3D7KA 3Q11A 5FBZA 4XAQA 5E8GA 2MU1A 4QEZA 1DJPA 2Q1XA 1U0FA 4XQFA 3UJ8A 3BM5A 1SCDA 3ZHVA 1G5HA 3H35A 5HLIA 1EE2A 4UTRA 5CXSA 4BU0A 2VH5R 3DFMA 1XSDA 4DCPA 1RKVA 2AMLA 4U6SA 2HM7A 4CHUA 3VDMA 4FCTA 4PQFA 2P2NA 3ZDEA 1QNLA 2HSJA 3AP3A 2RAFA 5EY5B 5K6RA 3IQWA 2QE7A 3SC6A 5HJ2A 3P32A 4X65B 3LL7A 3OS2A 4UBNA 2CNBA 3IWFA 3RQ4A 2RHTA 3PQFA 4OOFA 4PLYA 3TE6A 3VQTA 5CJJA 4ARSA 1ZJZA 2DDAA 1YC5A 3OPVA 2QM8A 4Z1MA 3X2QH 3B9PA 3G2NA 4TKLA 2OF7A 1WO8A 3UAXA 2H00A 1L4LA 2XSJC 4UD2A 4BO9A 3GI1A 3LPLA 3T06B 1HQYE 4RIFA 3BTCA 4LKOA 3UEOA 2VI5A 3DVSX 3T5AA 1WNFA 5DEQA 5HUHA 1GJRA 3U7QA 1HFKA 4PGGA 4RD1A 5GP9A 1T4DA 1YFLA 3C2HA 3P19A 5IMBA 1ZQ1A 1PR1A 2XIQA 3JYLA 2MLGA 4BO4A 3EOAI 3WOVA 1K6XA 1NM5A 2Q7DA 2DA2A 3HB9A 4XCXA 1G1AA 5M5XJ 4QUBA 1HLVA 2BMVA 1SHZA 3MWEB 2P5LC 2C9CA 2WSSD 4ZTUB 1H9BA 1CUAA 2VC2B 4EG4A 3EZ6A 2YBDA 1E2MA 1XTRA 1ADBA 1FNBA 2KIFA 3EPRA 3VJLA 4IJVA 3CR3C 4XIYA 1WI9A 4C07A 6PFKA 1RAFA 1GXSB 5HEKA 4MHOA 2CCKA 1IWOA 2Y9PB 4X92A 1L4MA 3TLCA 4LI0A 4ZAFA 1NVVQ 2F4NA 3A6JA 1Q3TA 4ZOAA 3EBLA 2NUTB 2FX3A 3QBTA 2NXNB 4JBGA 4LBWA 3HM5A 1OFTA 4JLVA 4I4NA 4XWGA 2WF7A 5EE9A 1NTCA 1RWVA 1HXDA 1VE9A 1I3LA 3K0HA 3V7CA 3DYBA 3H1EA 1M1ZA 2GEJA 3R7DA 3WZ2A 4HRIA 4BE2A 4N39A 4M1ZA 4D5EA 3D5TA 4MWBA 3KZOA 2DHEA 2W57A 4AIHA 3VH2A 4CUGA 4TGLA 4JUCA 3BBPA 5IYZB 1TL7C 4U7WA 1JQKA 3E35A 1USSA 3WU0A 4DLWA 3CVOA 4REMA 4CM9D 1EH5A 4JK3A 4LOJA 4YWJA 2O8VA 5C8YA 3TNDA 2CQKA 2R66A 5F1RA 4F9TA 5AVVA 1EFPB 2MH2A 1RJWA 4NX2A 5CJPA 2QL7A 4BWFB 3V8QA 4QHSA 1AKNA 3AUUA 3LOQA 2A5JA 4U8HA 1ACIA 2YZGA 4NCKA 2KIQA 5L51A 2LY1A 3JQRA 1QG4A 1M0WA 1QDEA 2FEPA 1WOYA 4KAJA 3MA0A 2I4TA 2N1MA 5JQGA 3VHRA 1AHNA 5K01A 5JRDS 2KYRA 5BOSA 3RSCA 3CZMA 3JQCA 2LBPA 2OLEA 5CHEA 5JSZB 5A9SA 1KZHA 5K5EA 1DXOA 2PUTA 4KMOA 4U00A 1JTEA 2HIHA 3BC1A 2M30A 4YEJA 1DAGA 4W6ZA 3JRWA 4R1NA 4NBLA 3VSDA 4FLMA 3PE4A 2ZQZA 5FIUA 5AVRA 3V7WA 4XRFA 2QZPA 2VC1A 3BZCA 3MTAA 1JNXX 2W22A 5JAQA 1I7NA 4LJ4A 1EFLA 3VR4D 2EBWA 3TK1A 2FWPA 2DGDA 2DCMA 1B0ZA 4I0WB 2PLRA 1HDOA 3PEWA 1T0IA 2VUIB 2C7PA 4MDYA 3CF4G 3VR3D 1J0EA 1NPDA 2HI3A 2REXB 2MSYA 4CKBA 3S5JA 1JUMA 1GSOA 3ZCUA 2JZNA 4KL8S 2XB2A 1VJDA 2IYOA 1MIOB 2XITA 2QRVA 1ZOIA 2E5NA 2Z9OA 2EEZA 2JRCA 2XQGA 3I6YA 2HNBA 1R0YA 3UK2A 3W7BA 3QU5A 1U9JA 1K08A 1R8YA 2QZJA 3ESAA 1Y1RA 4XGKA 4ZC8A 1CJVC 4YMUA 4KWIA 2VQ6A 3UKJA 5MN4A 3MHPA 4QAJA 1YQUA 5BPFA 3U31A 3FLEA 4XRGA 2IPNA 4RAFA 4EY6A 2HQBA 3ROPA 3R9IA 1QG2A 3U4QA 4LD5A 2DFHA 4L74A 2OAZA 1U2EA 3ME5A 4XD2A 4AS1A 4ZD6A 3JR7A 2XZLA 1F43A 3EQ7A 1RYMA 4JITA 2H06A 5K20A 4GD3Q 2ODWA 3C7KA 3RU9A 3CTPA 1XAJA 2R7UA 1J2UA 2A5GA 4C7MA 1YASA 5DP2A 1T9AA 3L8ZA 2R62A 2NXWA 4WZBA 3A9SA 3BRWA 2CMPA 2FOXA 5LOVF 1G0NA 3ZK7A 4E13A 5JCPA 3PL1A 3T7AA 2ZSIA 4UVAA 2FCRA 1O7LA 5KOJB 5DYMA 1I3AA 1H05A 5CQEA 5CNJA 2QI9F 1UR5A 3QEBZ 1R0BA 4XNFA 3QZUA 2RH9B 3PA6A 1S6LA 2OHJA 2CBGA 4GOND 1LQ2A 4U4AA 4JBAA 5HE9A 3UK0A 2VCHA 2WHYA 2Q8PA 1R1VA 3VUEA 1KSHA 2YWXA 2J3KA 4EYSA 3PUZA 4FYIA 3VPAA 5FUQA 4XVRA 2Z08A 3J7AC 1QJCA 2WT9A 3ZHOA 4YAWA 2PMFA 1QO7A 2VTEA 3OQPA 5LC1A 3L0YA 2X5JO 4OU0A 4XD7D 1P0MA 4D8WA 2UUBB 2Y75A 1KMQA 2Q2VA 4RTPA 1QGED 3SM3A 1X1TA 2OZPA 2ROQA 1HDGO 2ZYWX 1ZOLA 4H1WA 1VKOA 5FEUA 2HA5A 1AKHA 1AKVA 1CQZA 3Q0UA 1NYRA 3N1UA 2XNJA 1RVV1 4HA8A 4UM8B 2GRJA 4M37A 5CBPA 5CA1A 3SHQA 5D3MA 3RTEA 3I6IA 3V7RA 1G38A 4KUGA 2ISYA 4AT1A 2AOTA 3FMVA 3KE8A 1UBLS 3BCAA 4J75A 1SIWA 4YMWA 4IWYA 2O2EA 3B3JA 4HQMA 4AUMA 4DEVA 1ND6A 1P61B 4XIFA 1HYEA 2ZJZA 4RSRA 2W2KA 3DWFA 4R5HA 5LQAA 3VVMA 3Q9SA 1DJQA 2HX1A 1BJKA 2WWWA 4UVCA 4Q5SF 3GELA 1K4KA 3P26A 2Q9AA 1V9LA 4PFJA 1VMDA 1SXJD 2QV0A 3RJTA 1OCPA 4V39A 3WKCA 3TL3A 3RHSA 2OGTA 5GM1A 3ADPA 1VJCA 1HNXB 4UTOA 4RHUA 3MD9A 2YHUA 2I6TA 1X42A 1OLSA 1E3IA 4RV9A 2ID7A 3FKSD 1HE3A 3U3XA 3A2KA 1L2TA 1Y1LA 3UT5B 2AZ4A 3KHUA 1NUPA 1FDIA 3UMVA 3L0BA 3OP1A 5DBFA 2ZCVA 5JVDB 3H04A 3TP0A 1N7HA 5ETJA 3PO3J 4WWCA 2PBFA 3OT5A 4RW0A 5JI3E 3QNUA 4TLBA 9ATCA 3ASYA 5GM2A 1UELB 4WCFC 3E1SA 4P3KA 4XBFA 1NMEA 1NNLA 4DUGA 3IUQA 3S7TA 2J67A 3T1NA 1H8AC 2VF7A 1OR7C 3AXSA 1MD0A 1F06A 2V65A 4KE6A 4FW8A 1S2MA 4OHMA 1XWFA 1F5NA 2X48A 1FS6A 3TTUA 5EJCA 5ICEA 2WMOB 4QTUB 4LZWA 3WL7A 3L2VA 3P9XA 1XCGB 2IYVA 4RQAA 3K8OE 2YW9A 3S0JA 3HADA 4X63A 4FT4A 5HIAA 2J31A 2Q8NA 4RGYA 4I02A 2QTWB 4F0JA 2O8FB 4TLDA 1FX1A 2HT1A 1BQ3A 5LDHA 3T7KA 3PYMA 4ZAVA 4E2YA 3UVEA 1EWRA 3I23A 10MHA 3V97A 5JLJA 3AEUB 2DOKA 1MPTA 4EFLA 3SEZA 2PMCA 2FRDA 3BT7A 5B1DA 2JATA 1JPUA 5DBGA 4PANA 1KDZA 4OQQA 4ZDIA 3CZQA 2OBPA 1MO5A 4YCJA 2MWMA 2CVHA 1KJYA 1WMDA 4X1IB 4CKXA 2A68F 1OFUA 4U39A 4HLCA 4CL2A 1PFYA 1DG1G 3RYHB 3RD5A 1DWOA 4MINA 2ST1A 3RYIA 3CUEF 3NTUA 2YN4A 2VAMA 4LDZA 4UHCA 2VDLB 5KNCD 1P7ZA 5HS6A 3ZBTA 3E3MA 1QK3A 1HEIA 3WMWA 4UTPA 3DWIA 4QNMA 1Q1GA 4TKMA 2HMTA 2K7FA 2JGMA 4BLTA 1ZJJA 3NEPX 1OYVA 2V7BA 2FD5A 2Z2XA 1X6VA 4YT5A 5KMGB 4AYBA 1T2AA 3K2IA 4PQGA 1WKMA 4A91A 1BXKA 2C3UA 1AMNA 3D4BA 4BNDB 3TPFA 4JZYA 1EFRA 3JQAB 4EK9A 5IJWA 3KZZA 1AA7A 4CCYA 2OCPA 4MHSA 3QU6A 2C9DA 4MROA 3N2GB 4GS5A 4Z4IA 1W9HA 3G2LA 2WM8A 3QELA 1V1MA 4C6TA 2GKGA 4FDTA 1T8TA 4BNWA 1I36A 3PJFA 4IKFA 3QHQA 4WY2A 2V8OA 3STUA 3UT6A 4LG1A 3MJDA 3PI7A 2MD5A 3OX2A 3TIFA 3O21A 1ZS9A 5E4YA 4EKIA 1R4AA 2HMWA 5LIPA 3MKLA 3ROZA 4PYNA 3WRYA 4G6ZA 3D4PA 1UT5A 2ZJ5A 2NU7B 3U61B 4M9ZA 3OZAA 2ZRNA 4MEAA 4TV8F 1PR4A 3AWIA 5HGJA 2V6GA 2FSGA 4FX4A 1RRGA 1IU9A 3AJ9A 4QIWN 1H65A 4AJ1A 2OK8A 1TA0A 4O2AA 5KNBA 4FYWA 3GJ6A 5LB4A 1MV8A 1PZXA 5F3WB 3KP2A 1BVHA 4DG5A 3FJYA 1OJ7A 2HSDA 3UC5A 3I83A 4TYMA 4I6GA 4MUNA 5ELXA 4U2FA 2NO7A 3RBVA 5D85A 3T38A 3PGXA 1XN7A 3TNFA 4BRZA 2IVMA 3H6HA 1GZ5A 2QX4A 5JMWA 5LZ7A 1LS1A 2VSOA 4US0R 2JFOA 2YQ5A 1PI3A 4R71A 4DNPA 1XPXA 3ZHRA 1L4NA 3B6KA 2WG0A 2D1RA 2XA9A 3J80K 4X24A 1QP8A 3RFTA 3I4CA 1JZSA 2K5CA 5HLTA 3Q9LA 5A7FA 4DV0B 1OLUA 3NETA 4XB2A 2WFAA 4IIEA 3DTVA 5CEEA 3OZGA 4EY7A 2ZANA 2JHAA 4PAWA 2J5XA 1IAQA 3CLRC 1E1LA 4GRDA 1P6QA 3KT8A 4FMDF 2GBYA 5LWHA 1AJEA 3CA8A 1MBKA 1IPFA 1S5LC 1HPLA 2VPZA 2BGNA 4H16A 2R4GA 4Z1OA 3AG3H 2KLHA 4ZCLA 2HDDA 3WE2A 1DMRA 2DLLA 4D81A 3W5BA 1Z7BA 1P2BA 3PTZA 1EYZA 2JJ7A 1D4AA 3KTAA 4E09A 1IN8A 3GP8A 1XP5A 4LE0A 3JCZA 4YAUA 4I55B 4R2KA 2V7XA 4Y33A 2OB2A 3OFSA 3DW1X 5GONA 2I0FA 4QQKA 4LK1F 1XTBA 2CXNA 2EFJA 3LS2A 4WPGA 5TMBA 5F04A 3JASB 3ZWBA 1IOZA 2DW4A 1E2LA 1WUJS 1TJ4A 3LP8A 4P1ZA 3WL3A 5L3SB 4I4IA 4DV1B 4PC7A 3E4CA 4Q7EA 3USES 3CCYA 3ZLJA 4OIFA 1L5HA 3HXQA 4RK5A 3QQAA 5F5LA 1G3YA 3AMVA 2MA3A 1PVOA 3N9IA 4EGYA 1AKYA 3UJ9A 4JU9A 2GFHA 3KTFA 2Y2UA 4INJA 5L3EA 2M7AA 1V41E 1L8AA 2WUEA 3MRTA 4KNVA 3AOEA 4O02B 2DDBA 5B2FA 3C8MA 1BDJA 2G1UA 4GW3A 3RGGA 2I62A 4HVLA 5THKA 4R0MA 4IKOA 2IEKA 3FUWA 1LLCA 3A28A 1X1RA 1N5DA 4AKSA 1T6BY 5B58T 3OX4A 1M1YA 5C80A 3LA3A 1CP3A 3QM1A 2ZIWB 2KI5A 1K5PA 2IPQX 5C5DA 3VZSA 2BGWA 2GZRA 4BMZA 3WYGA 5IJ0A 4RM2A 1ADCA 5ILUA 4AC9A 2AX4A 3MKZA 2PZLA 3LCCA 5IH3A 3ZU5A 4XM0A 3VAAA 3HBMA 1E9VA 3HKDB 5FO1A 5DM70 4QA9A 4EG3A 2RREA 1E99A 2ZRLA 5HR5A 1DKQA 4NDLA 3QA9A 1E1QA 2VDVE 4UKDA 2GHQA 4V0SA 1RYDA 3BHIA 4WCGA 4IJUA 1XRPA 3ZZ0A 3OCVA 4H1VA 2Z4SA 5A3JA 4HW0A 1IJKA 4PLFA 4MW0A 4Z7OB 4Q4JB 1JMVA 1R8XA 4ZVTA 4ZYUA 4PLTA 1GPLA 2ZREA 1DPUA 3D6TB 4GBED 4FNOA 4NYJQ 1K5GA 3NJ8A 2G1AA 4OIRF 2PQ0A 1QUFA 2WJGA 4LV8B 4HAOA 2PMEA 4F93B 2EWMA 2IHUA 4MW2A 4RA6A 2QXUA 4S0HB 1N77A 4DMHA 2PANA 4QPNA 1MOSA 5A3QA 4GOXA 3RC3A 3R7WB 3GGOA 3LPMA 1LUAA 1OZFA 5C1BA 4M22A 3KE9A 4NC8A 2VPXA 2P9TA 2Z8YM 4AD9A 1DP7P 2EFNA 2AG8A 1ULAA 1A9PA 2Y99A 4X3CA 3I9MA 4JI8B 4HOYA 1JQAA 4O6JA 1MAVA 3BJAA 5MN5A 5GVSA 4KYUA 4U2CA 4P9FA 3FFWA 3IOMA 1FSFA 2RHCA 4A27A 3H65A 2PA3A 1KGDA 1TCCA 1P60A 3C2BA 5IRCD 4U7BA 1KOFA 3KOXA 4EENA 1YO5C 1BU5A 1E0AA 3E1KA 4DG9A 5JALA 1VC2A 3PT9A 9GPBA 5K45A 3JSAA 3COAC 3USCS 3Q0WA 2K7LA 4OPMA 5KYYA 2BY1A 1E2PA 2DX7A 5L8VA 3IILA 3UHOA 4E6EA 5H2FC 1RWXA 2WJZB 4MMXB 4BEJA 2BFFB 4DJ5X 3WLRA 1UDRA 3H3ZA 2JFPA 3AF3A 3SDBA 3UFXB 2OCDA 4UBIA 3LOUA 2AD1A 3GRZA 1ND5A 1WUHS 1T1EA 1HW2A 2VYFA 1PS8A 1SRQA 2X5XA 4Y2PA 4DLSA 3HYSA 3TO6A 2PQ6A 2XBUA 2N8GA 2B8JA 3WBJA 3KWJA 1QZXA 1WVIA 4ARVA 2Q1SA 1ZGHA 3UM9A 4QGHA 2ZU6A 1U80A 2YOHA 4RIGA 3PGLA 3QFHA 4FOOA 4G0UA 3W77A 4YCAA 5KYUA 3QW4B 2JFZA 1AK1A 2A92A 3KIPA 1TUEA 3Q1KA 5D3ZA 3I53A 1GPMA 1VFPA 2YZKA 1K7FB 1UP7A 1TP4A 5HKAA 2O0JA 2XAUA 1RQLA 2H1KA 4L0DA 2OYSA 3DDUA 1ZYUA 2WAAA 3FM9A 2WIAA 3EF3A 2ZZMA 3OE7A 5CDFE 1U2DA 3CEJA 2NXJA 3A9VA 3SSOA 2NQ8A 3RHZA 1G3IA 1PL8A 2REQA 5AM1A 4XGQA 4PYLA 4XARA 2XMDA 3T3DA 2IF0A 3NORA 4LC0A 4PC3A 3KBOA 2QKMB 3CUYA 4P54A 4LB5A 2NAZA 2Y3IA 5T41A 1HEUA 4QTZA 5D1NA 3IUEA 2J4CA 5CVUA 4DJTA 1PDNC 2GASA 4JOSA 4NZZA 3VSKA 1B6RA 3ACBA 5ILOA 3C43A 1TO2E 3AU9A 3F2VA 3A14A 4ETWA 1AF4A 4JV5B 3K9NA 5FBVB 3H0GJ 5F1KA 3MAAC 3KJIA 3R6WA 2G25A 5IVIA 3AEQA 4D74A 4J6FA 4B7CA 3IHUA 2K86A 3TO5A 3AR6A 2A7QA 3D31A 1TT0A 3BD6A 3C39A 3P9KA 4I81A 3IP9A 2XY4A 3ZDAA 4WD3A 2O4UX 1KQGA 2KSQA 3EOBI 5ADHA 2CHQA 4ARCA 2ECBA 1YRAA 3WQRA 1T5TA 3UO8B 1E2QA 2WAMA 1DGQA 2B21A 2VDJA 4KRGA 4PX9A 1L4GA 1CNFA 2A57A 5AW3A 5EJ6A 2AZTA 2F17A 3G73A 4INAA 1IDYA 4R9UC 1N5KA 1RC1A 2H27A 1QYIA 1NG1A 2IYXA 1QX3A 2ZATA 1KTIA 3G4SI 4BB0A 3FXRA 3U4DA 2UXCB 2Q07A 4FTHA 3LUCA 3A27A 3N2EA 1RYYA 3FOZA 2E36A 2YWHA 1KI8A 3E58A 2E7XA 2H1RA 4WDQA 2OZLB 1XR3A 4M6VA 1S1MA 2Y48A 1XKQA 2VLIA 4DMCA 3O82A 3QYJA 4M9QA 3ADOA 2E6KA 2F00A 2ZDHA 5CXUA 4ZYTA 3D4OA 3C5HA 1MR3F 4JYBA 1K0FA 4RS8A 8GPBA 2DMRA 4GMDA 2JJQA 3O8OA 1R5JA 4K2HA 3S6JA 3Q5DA 1HY3A 3NBQA 2GTPA 4P4TA 3U6KA 2Q4TA 1PWXA 1ZSYA 4K8RB 2J5RA 3M81A 1GAXA 3DT6A 1XTTA 4DKXA 2WTUA 4KXLA 3EHEA 1GPDG 3ZJ4A 1R6VA 2XB9A 4A6DA 1GIAA 3JWPA 2OXTA 3IOBA 2BV6A 1Z7LA 3RO7A 1O3TA 2QTCA 3UAOA 3DVRX 4JXXA 2PCJA 4DABA 1DBVO 2I99A 1MNMC 4F12A 1L5LA 3PQDA 4PCVA 2O03A 3A0RB 5TARA 3IUYA 3TLXA 1RRJA 4Z7JA 4MRMB 4Q4DA 3KJEA 1NNI1 4YAEA 2ZJPF 2Q0HA 2BRUA 2ICAA 2BH9A 1X15A 3TXAA 4B83A 1ZJYA 4Z7NB 3R6TA 1JFSA 2FPMA 3WMFA 4IGEA 4PG5A 2C5SA 4ND4A 2OSVA 1EIWA 1Z7GA 1KYVA 2ZB3A 2FQYA 4UEWA 1NVTA 3L9FA 1DX4A 4A5NA 4HZGA 2R4TA 4KV9A 3SEQA 1ZLKA 2H1IA 2K2WA 3DV2A 1YB1A 2O0HA 2HGSA 5EZYF 2JVIA 5SY6A 3FR8A 1M2JA 2AX3A 4ZC1A 3JD4A 3M6WA 3QPWA 4M0PA 3RVMA 4LDAA 4E7OA 2O05A 2JRMA 3CDHA 4N65A 1IVSA 1R4MB 1N5JA 3IJ5A 2QM0A 3JQBA 2W82A 4LKRA 4M8SA 1OXBB 5AOVA 4BO0A 4WJZA 1USIA 4ROSA 4MEBA 1BJRE 2Q1WA 2P6UA 2QG4A 1L5VA 4PFOA 4U7JA 3EUHC 2OXCA 3HEMA 1T8SA 3DE4X 2H8RA 5HQTA 1IJWC 3P94A 1LRKA 2CH0A 1O8BA 1XLTC 3ITKA 3PDJA 5IOYA 3LT5A 1L3CA 2YHAA 5FWXB 1GVNB 2CZCA 1JA9A 1J56A 1H85A 4Y2QA 3C1AA 3TIXB 5ERGB 1KI2A 1W5AA 5TT0A 4Y2XA 2VRNA 3IHKA 4QM7A 1LTHR 2QGNA 3R40A 1RIIA 1XYGA 4CF7A 4YNBA 2YV1A 1LWNA 4GL2A 2O50A 1R10A 4MAAA 3QSYA 2HDOA 1EA3A 3E5RA 4PLPA 2X9NA 3C6BA 5E9WA 3S68A 4PS1A 1WDMA 3G2QA 4XLAA 4LNAA 3ORQA 3CEPB 3IPAA 4BP1A 4MIYA 3WWCA 1Z25A 4NOLA 3SFVA 3VSAA 4KEAA 1A2QA 1WXDA 3ZG6A 5FF9A 2CJJA 3TO9A 3N0VA 5CLJA 2ZE8A 3LF2A 3BTIA 2CMGA 2RHOA 3MHTA 3N74A 4C0SA 1Z6TA 4OHUA 5KNDH 3K9BA 2RHHA 1M1XB 1ESEA 1S2DA 4KUMA 4YAKA 1Z28A 3L7DA 1M66A 5HFNA 2XUFA 4D9BA 1E3TA 2YV5A 3PWSA 1IHPA 4CMJA 2V1NA 5MFZA 2VRCA 3W3AH 4YV0A 4HGOA 2HWVA 2X7JA 1MTOA 4PRYA 2G0EA 2HI0A 4GYKA 3DBLB 1I4DD 3OZTA 4UREA 2E7ZA 3SWWA 4BNKA 5BN3A 1B16A 3BGDA 3PFYA 5IMSA 4M7PA 4QPZA 3PYLA 3V1UA 2M98A 2EV5A 2AOXA 4Z4HA 4BVGA 4M6XA 1W52X 1RNLA 1Z2PX 1WEKA 1P7PA 3CCUI 3RLFA 1AQYA 3LM8A 3L5OA 2O6HA 1Z75A 3R3JA 5D51S 1ZGAA 4EYKA 4RKRA 3SM9A 3EJ6A 1GUZA 4URZR 5FI3A 4PICA 1BHQ1 2QJTA 2OE2A 2OGZA 2O1SA 4DLXA 1ULTA 3BK7A 1FFDA 2WT4A 3IUJA 2QTFA 4HJXA 1EWYA 4U7DA 4DIMA 4NMWA 4U9HS 1LEAA 1IUOA 5FLYA 1YR8A 4NK4A 3VNSA 3HE3A 4KFCA 5LBUA 1C3OB 1ZUNA 2OD7A 4RHCA 3CN7A 3JRNA 2P41A 3ONNA 4LVCA 3RHFA 1ENPA 5JBIA 4CLHA 4P5EA 1IN7A 3COVA 3Q0TA 1F4VA 3F78A 4YT2A 3DBHA 3Q3HA 4B17A 2JQ7A 4NCIA 2DCEA 1CEQA 2XDQA 4JUAA 4HWKA 2OHIA 5DYGA 2XZTA 1NFQA 3JQ8A 4BO6A 4GLOA 3EBPA 5KVQA 4N0EA 3FPHA 2WLTA 1DAIA 1Z8DA 4FD2A 4B4DA 5LSAA 1URPA 1PK8A 1QH9A 3DM5A 3WYAA 2IVZA 4AZ0A 2PBRA 1OCTC 4DJEC 1RQ7A 5K8LA 2ZJ0A 2YWGA 4DN6A 2ACEA 3MLAA 4JLJA 4NQWB 3OE5A 3DZ8A 4DBLC 4POOA 4U02A 4Q4HB 4F9GA 4CMKA 1E1RD 1YHZA 2OCXA 4U2BA 5JI2E 3G1TA 2I7TA 3CJTB 1W7AA 3LT1A 3DO8A 1RI4A 3ZX4A 1JQ5A 3LE8A 5L45A 3SYMA 4Y2YA 1BX0A 4EOGA 4DXDA 1QZTA 1XGOA 5FTNA 1VJ5A 1B41A 1U2PA 5FLXA 4O2BB 1NW3A 5DHRA 4WBNA 4MQMA 3KUXA 2IS1A 2W37A 5ARBA 3VBEA 1QORA 2LNDA 2FW7A 3LX5A 5K4GA 3RKQA 4GUDA 1ZREA 1E79A 2X1VA 3J7AO 2I6UA 1M1UA 4PZPA 3CLSD 3SMQA 5EPEA 4Y30A 3B3AA 4I36A 3CRZA 2PGDA 4LYFA 1VPLA 4MPTA 4F3NA 4JLOA 3DAFA 2D0IA 1HQKA 2PRIA 4GO1A 1Y5RA 2G9QA 4JLDA 4G23A 4ER5A 3I4NJ 1N0IA 2JAPA 3L0OA 2ETVA 1BXRB 4L7QA 3H9BA 1EVZA 3N2KA 4RM3A 3NIDB 2PZFA 4WLUA 2H11A 3RBAA 5H4GA 4RLFA 2QTNA 1P80A 2XMRA 5ICCA 2XKOA 1MC4A 3CWZA 3IE2A 1AKMA 4PW0A 4BO7A 3A70A 2VF8A 1IIRA 5JVGF 3EA4A 4CIXA 3RQSA 1I30A 5DTIA 1RIOH 3ZWKA 3RIRA 4YJ3A 1G8XA 1HSTA 3HG9A 1GGVA 4DUPA 2DWUA 1CETA 5E4JA 5BY2A 4UJ5A 3U9TA 3IIMA 4BXOB 4KRYA 1J06A 3BMQA 3WTWC 4XTRA 4RTMA 4JR1A 3UWOA 5EIEA 5GGYA 4UMVA 4Q01A 4RXUA 1VYHA 4A93J 3PNKA 1R4ZA 2FZKA 2EAUA 3AY7A 1MZBA 1BYIA 1ZK4A 3TTYA 5A71A 1Z15A 3F6YA 4L3VA 2QVCA 4RAYA 3ONVA 4C0AC 4AVYA 3NTOA 3AZQA 3ZCOA 4MVJA 2ZUDA 4H3KB 5BV8A 3ND6A 1MJNA 3AHIA 4AJOA 5AICA 3IT2A 4DLPA 3TMAA 1KDOA 2IHKA 2HXYA 4TUYF 3J80Z 4E07A 2QPTA 2E87A 4XX0A 1RE1A 5CVCA 3A02A 4DLRA 1UKCA 3R0QA 3B9BA 3UYKA 3WIDA 4F96A 4G1BA 2DTRA 3IMGA 3SZGA 4PTLA 4EABA 4O25A 1PJCA 4XOIA 1VDMA 3JU3A 3LLUA 4K81B 3MEQA 5LYJB 5BMOA 1JR3A 4ZDOA 1Z4KA 4UQLA 3DDOA 4Z3OA 1XZIA 1PT7A 4TMVA 2BV3A 3P9NA 4RKEA 4M1MA 2DJ5A 2XXAA 2LTPA 2PUDA 2GZSA 4HNRA 1NE7A 4DZPA 1AHIA 1MGTA 3IXLA 4RTQA 4EI8A 1A97A 3T3OA 4YQEA 2UXBB 4N54A 3NV9A 4CH7A 3EFOA 4IOAF 1O94C 1YC2A 1OHHD 5DOVA 3GLTA 3EQ8A 4BY9E 4YRJA 3I9LA 4MKHA 1UBJS 3HU1A 4RK0A 1QIIA 2HBZA 5IS2A 1H2ZA 3G0GA 4O1MA 4QPDA 2ZS9A 5EIFA 3M0EA 3R0AA 1U6GA 4R7GA 3I4MJ 1UMBB 4CJXA 4BCDA 2O57A 3SBEA 3IX7A 1A1SA 1ODSA 3F6SA 4B7XA 3E9DA 2A88A 1NONA 2VB6A 4H7KA 1NP3A 1YS6A 4TMKA 1DIGA 3W8NA 1YVDA 2AQ8A 3CO6C 3H2GA 2CDCA 1N6OA 3B85A 2F2EA 2HWUA 3L5KA 5JMOA 4RF4A 5LP6A 5EP4A 1CG6A 2OYCA 4UAUA 4DR2B 1TQPA 1UZAA 5DD4A 4B3SB 2D5VA 1GVHA 1FMFA 2ANBA 2J32A 4W7SA 3VI4B 1PVDA 4FMCF 5J4VA 4DDVA 3KOUA 2FP4A 5LXTA 2ERYA 4L57A 3UB3A 3D6JA 2RG1A 4WFIA 1A9TA 5LIRA 1I2MA 1NMZA 1QHNA 1SCQA 1VG8A 4HNGA 3AC0A 1D0ZA 4HGRA 3CMYA 2LXNA 1T38A 2WTAA 4RHTA 1KYYA 2B6HA 3WWOA 5EXSA 1JBKA 2DQSA 2V98A 5HJ7A 1YHYA 3AW9A 4CQMA 2PL1A 3CRQA 3BZKA 5GIOE 4B31A 2DA5A 1RBQA 4DLVA 1E3LA 3LWNA 4F7WA 1VB5A 4V3CA 1DUVG 4EHAA 3R77A 3RNLA 2VXDA 3PFGA 4GAEA 2QD4A 3P5JA 1AKEA 3H3JA 1NPYA 4CLRB 1CKEA 1H1DA 4NCXA 4EKDA 3HRKA 4JP5A 1FNCA 1QE3A 4L4ZA 4LY6A 5EJ2A 3WG9A 5SY4A 3OCZA 1I7DA 1ATZA 2E55A 3A31A 2W6ID 4JIMA 4MYUA 5A62A 3V1LA 1ORRA 2NNWB 3OFVA 1Y1VJ 1DQYA 2AE2A 1XUOA 3PHIA 1AURA 2KB0A 3R3ZA 1Q0QA 3G9TA 3DPUA 4HLXA 4TXHA 3DAOA 5FUMA 2EX4A 2C4TA 1VJ0A 2Y30A 2ZJ1A 3QIAA 1VHWA 4E21A 2LBFA 4J1QA 4R8SA 4G97A 1VDZA 4YQZA 3Q40A 2GR9A 2EL9A 1NJSA 3FXUA 3SLRA 4IPAA 2PLNA 4CDMA 2X6YA 2BPOA 3PSIA 2YJ6A 4ZGGA 2H5JA 3AF2A 2R65A 1W96A 1F2VA 1WH7A 1LDJA 4ES6A 5BNGA 1AO0A 3GUDA 4V0MA 4DVJA 2F4OB 3JWEA 3RRJA 6AT1A 3IDZA 2LR0A 4L9SA 4YDQA 3QTLA 4PGFA 3PWZA 3EC1A 1JFRA 3GVIA 4OF4A 2FH5B 1RM5A 3A1FA 1YLFA 4G8JA 4CETA 3RIGA 3GUUA 3JZFA 3RM3A 4XL9A 5DSTA 1WXWA 4CG1A 1SBIA 4Z4FA 1N2HA 2V1UA 4JDUA 1OBFO 3WG7H 4D7AA 1L5NA 1MMFB 1UHSA 2R2GA 1HEYA 3INTA 2PH7A 1TMYA 5I5GA 2HHHB 1G6OA 3ANLA 3DWGA 3U1BA 4KQWA 3PVSA 2ZB2A 5BYBA 1H0RA 3RK4A 3FKJA 2IXSA 1TCUA 1QYRA 5IK2D 4XYEA 3VZQA 3P2IA 3TLZA 4YR9A 1ODCA 5DI9A 1GDHA 2XCLA 1QYXA 4P93A 1T0BA 1W5CC 3E9MA 1MAWA 2O59A 3TLMA 1RPJA 4S2EA 5J1YA 2P75A 3P4XA 3JQ7A 3QHAA 6ADHA 2ZRCA 5T6BA 2WINI 4FFMA 3SP1A 2HBRA 1OJLA 4NXMB 1XTJA 5BMVA 1BW6A 1JA1A 1YBHA 2GHTA 3BTJA 5JFRA 5IXSA 2ONJA 4G84A 1QIGA 1H3NA 3HA2A 2OQVA 3E0QA 3RRNA 5LZ2A 1C80A 2OCLA 4FYXA 3FIUA 5AVXA 2O5RA 2O1WA 5FBQB 3FG9A 2VHJA 4X71A 3EPZA 3AFHA 2SHKA 2XASA 1JKXA 3EXIB 2O6GE 1LPNA 4MUBA 1RRKA 3U09A 3RV3A 3LA8A 3CJRB 3OL3A 5FROA 1KFEB 2YS7A 3ONFA 1DLJA 2R8OA 2ZBFA 1SKYE 4XXHA 2E85A 2J3IA 4H08A 3CV3A 2Q5CA 3U4AA 3OJEA 4L0MA 2BSAA 2EJUA 4ZHQA 3HGQA 3IAM2 1CJTC 4Z6YA 1RYHA 5KDDA 3U1DA 2YIVX 2XMGA 3A1UA 3E6DA 4KQJA 2WKQA 2RC4A 2F1KA 2NXCA 2MD0A 4TM7A 2IC5A 3ADDA 2DZDA 3HXPA 1J42A 2RGDA 1QAOA 5DXJA 4OXQA 3H4TA 1EVYA 2HPZA 4QWWA 1OIXA 2IS2A 1XNHA 4Q4ZF 4PZ9A 3DCNA 4OHWA 2GZWA 5AW5A 5M3FJ 3RUDA 3L40A 5U1PA 3M7GA 4NZ9A 2X1EA 3OPMA 5C18A 5IP6A 1QHYA 2YVAA 3W8FA 3T4PA 4HQEA 3BILA 4EZBA 3QKWA 2BISA 2Q8QA 4D6XA 2W6MA 3PO2J 4QFDA 1MB9A 3EVCA 3ZD7A 3CNLA 1SK8A 1JE8A 1C7IA 1VKZA 1GU7A 2C5LA 1U94A 1WB9A 3DBRB 1GG5A 3SS9X 4I46A 3HOXJ 2OLJA 2WKSA 3MSCA 1N3BA 1XZ8A 1DFIA 3R8FA 2RIPA 1Y8RB 2EJRA 3A04A 3KQSA 4L02A 4EHHA 4RPKA 2EIJH 1UFKA 1PBTA 1FBSA 1I7PA 4BEVA 1NJ2A 1WRBA 3DOCA 5HYVA 2WSIA 1ABEA 1WZNA 5B6IA 1SUFA 3KQWA 3BCSA 3K6RA 2NU6B 5IVPA 1SFXA 2QSGX 1F6DA 3F7OA 5E6RB 4G5RA 5KWJA 1J8MF 1GGHA 1RHRA 3PDWA 2YL2A 3N8NA 5BR1A 3T99A 3OIYA 4XN3A 2P2GA 3GLRA 5DLEA 3HA5A 1QHHB 2H4JA 1NWCA 1W0KD 2ZW9A 4LNHA 1W4RA 1UZLA 2XCRB 1KRHA 1P31A 3C87A 2BY4A 2PX5A 3G7SA 4G8CA 3V46A 1WSDA 4FUTA 2GNAA 3O74A 2JT1A 1AXRA 5JDIA 1XDGA 4BRWA 4ZCMA 1SWWA 3TAUA 1RMYA 3DOUA 1DNPA 4AWXA 4CIVA 2WILA 3WMGA 3AKZA 4HFMA 3EZ7A 2EX1A 3H2HA 1YDHA 3P52A 1HTBA 1V8BA 3A6DA 5A1TA 4ENTA 1MJBA 4A3DJ 2FP3A 1RI7A 4DQUA 4MW1A 3ESWB 2O8KA 2BGJA 3PPWA 2FN4A 4BUCA 3M6LA 4PFQA 4QQFA 1Z29A 3TLAA 4GC5A 4MMZB 3ZJVA 3QMVA 3N0WA 2JFYA 2WFMA 4V0QA 1TC3C 3MK31 4PYJA 3K9LA 2YXLA 4OHXA 4I8DA 2O2JA 1Z13A 4G7ZF 2CCJA 3CNHA 2CHUA 2YN0A 3R24A 3UMRA 1YS4A 3L92A 2DYKA 3FBGA 1WL8A 4N3AA 1IVNA 3EEYA 1N75A 3L1VA 1JG4A 2VHVA 5LMNB 1PR5A 2DQKA 2C1ZA 4I50B 2EF1A 1OLXB 1KC1A 3DMHA 2JF0A 1I6KA 3CY6A 1X58A 4AWBA 3C48A 1SQ6A 1YK0A 4FT2A 3EETA 5KS2A 2D0PB 2QRGA 2C84A 3W2TA 1NLYA 3S1AB 1W9MA 1GGKA 4DEXA 3ILVA 4Y52J 1FMJA 5FI0B 3BXOA 1S4MA 3GEPA 4PHHA 1EBFA 5JSFA 4MOWA 1HH4A 4DYHA 1I2DA 1KS9A 2QMUA 2HA2A 3R76A 1PNOA 2HJRA 3K0FB 2B8NA 2FSPA 3PKZA 1H9GA 1PUEE 1G3QA 5LHHA 5FPTA 2HREA 3AJEA 3G0BA 3CUKA 3DF9A 1VLHA 3EDRA 4F86A 3I1FA 2QLBA 5CM8B 2BE9A 4CV0A 3BGSA 5FD6A 5AQ1A 2QR3A 2EKPA 3L6BA 3MJ4A 3M8JA 3C6QA 2DA6A 1ZAOA 2FMYA 4LXHA 1ENZA 2IV7A 3DEHA 5IT5A 3S2YA 1TTPB 2QRMA 4M3NA 5JMTA 2XXJA 5B7GA 3FUTA 2PXHA 4W5HA 3LLMA 3DF7A 5BN4A 1HE8B 3LP5A 3KJHA 4GOJA 1RKQA 4QLAA 1A8UA 1V37A 3KLOA 4A69C 1F8XA 4EJMA 5JC8A 1LSOA 3QE4A 3WKEA 2VDOB 6CHYA 1DKOA 3F74A 3DTNA 4ZQGA 1M9NA 3SF8B 3EZGA 5A4FS 1C7QA 1K7SN 3RAJA 3SPXA 1UXOA 4QFBA 1LPOA 1T1JA 1LS6A 2FDXA 4JHXA 5FWDA 1FSHA 4AS2A 5CLHA 3HWWA 1O08A 1FRZA 1AN0A 3WWEA 4BIMA 3P9SA 3L8FA 2K40A 5BN5A 4N0MA 1GHCA 3AETB 1XEAA 1I32A 4LMPA 2DERA 2F64A 2R96A 4PR3A 5G1PA 3HDGA 1KO8A 5JCOA 3QRWA 4CM3A 4OINF 4UV9A 3WGIA 2ORWA 4FEYA 5KNLA 2XB5A 1A5SB 3KQKA 1II8B 4CN9A 3I71A 5I4IA 4M0FA 4ZVQA 2CHGA 1RPWA 5HIIA 1N5LA 1K78B 5JD3A 2IBMA 2X51A 2C0QA 4OXIA 3DLHA 5LMUB 4LF5B 3LZCA 4A3SA 1PT5A 2HK6A 2NOAA 1DUXC 5IBPA 4P0TA 3PL5A 2HEGA 1XGSA 5CBKA 4LHXA 5K8JB 4MICA 1FZPB 4CSWA 3TZCA 3RSOA 3PUBA 4WZ6A 2C78A 1FJHA 2UYCA 1T3TA 4XGIA 4Q9IA 3QW2A 2C7RA 4IHVA 1XJCA 1P5HA 1KI6A 2GZ1A 5LU8A 3T8TA 1PKEA 3KWFA 3ED1A 4FDUA 4M7RA 4OEHA 1WHUA 2A0WA 1DV2A 2PL9A 3ZJUA 3QP5A 4F92B 3EZ9A 5BSVA 5LGUA 1XJ5A 3WTVC 2XB0X 5B1YA 3FMOB 2AXPA 2ISQA 2ZB7A 3EG5A 5A3VA 1BW9B 1U8RA 2QMZA 4B2YA <