2F48A

Crystal structure of a novel fructose 1,6-bisphosphate and alf3 containing pyrophosphate-dependent phosphofructo-1-kinase complex from borrelia burgdorferi
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
551
structure length
551
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
molecule keywords diphosphate--fructose-6-phosphate 1-phosphotransferase
total genus 199
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 2f48A03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f48A02
2Q4DA 1F8XA 4LJRA 4LJLA 1WEHA 2F48A 4JEMA 3K2QA 2IZ5A 1MTOA 1ZXXA 4P5EA 4NPAA 3IMKA 2PMBA 4WL0A 4FYHA 4HX9A 3O8OB 3QUAA 2KLHA 1YDHA 3O8LA 4I7EA 2F67A 2KHZA 2A33A 3O8OA 4I36A 3HNOA 3OPYB 4KXNA 4JELA 4MCJA 1PFKA 1WEKA 2F2TA 1RCUA 3EHDA 4MEJA 5AJTA 5AJUA 3MAJA 1S3FA 4RH3A 4FYIA 3GH1A 4U1RA 3SBXA 6PFKA 1S2LA 1S2GA 1S2IA 3UQZA 2F64A 2Q4OA 3BQ9A 3O8NA 3OPYA 2PFKA 5ITSA 4JENA 4A3SA 2IZ7A 4I4IA 4KXLA 2F62A 3U39A 1F8YA 4KXMA 3PFKA 1S2DA 2A0KA 4PFKA 4FYKA 2IZ6A 1KZHA 4P5DA 2HIGA 4OHBA 4OHRA 3F5MA 2NX2A 1T35A 4LJKA
chains in the Genus database with same CATH superfamily
2AJ8A 4HG2A 5AK4A 1QC5B 4AP6A 1H4QA 4I2OA 3BMNB 3CRNA 4E5NA 5COAA 2IITA 3K96A 4DZTA 2GK7A 2UKDA 3JASB 4N3NA 4QGBA 4DM3A 1ZCAA 5HX7A 4ME6A 1QYWA 4Y67A 2QL7A 4HAIA 2VLAA 2LDBA 4QOFA 4X64B 3O31A 2MYNA 2V7FA 1XEFA 2Z56A 2R66A 1EJ0A 4PHTA 3L18A 5FL7A 2HB6A 1WD7A 4IZZA 4HXFB 3TG2A 1DRWA 3ELUA 4NS1A 1DC3A 2QD5A 1DTEA 1RETA 1L7VC 2W0SA 3C4JA 1TIPA 1V1RA 3OPXA 4G0ZA 4F5DA 4B09A 3EB9A 1P45A 3LSJA 2Q2VA 4BE2A 3T5BA 4H7HA 5KJCA 5KYWA 3Q7EA 1BW9B 3A4TA 2G7ZA 1DRVA 1T0HB 3EIEA 4Q3BA 3P7NA 1NNI1 3BB4A 3BRWD 3QVMA 1YNOA 4GLLA 4INPA 4QSHA 4NTZA 3MCWA 3TMKA 4II3A 6ABPA 2PS9A 4TTRA 1PTJA 5I7WA 3HYSA 1S3JA 1UHSA 1U0SY 4FX2A 4OMFG 2XKKA 4PC6A 2HWWA 1DG1G 1WVMA 3B48A 1V37A 3K9HA 5BVHB 4EPRA 1B72A 2EZTA 3E82A 4XEUA 3BEDA 1RT9A 4Y0AA 2O3FA 1XN1A 3T3NA 1ATIA 2ZUWA 2H51A 2ATXA 1T0BA 3AR8A 4ZVRA 1NHAA 4B3RB 3IWFA 1W6UA 3QYPA 4AN4A 4FB4A 1TZKA 1UHMA 1O2DA 3AONB 3D3WA 3C3YA 4JB2A 3CVUA 3B78A 1GPLA 5HPYB 4D6XA 2I03A 4D9EA 1KOGA 2IAIA 1VPTA 4AKGA 2GILA 3G0DA 3SZRA 2IBDA 2XB9A 5DHRA 5JOQA 5B12A 1Z6RA 4AO7A 4BATA 4O2BA 3DULA 5LLDA 2HU8A 4DJAA 1M7GA 2QRMA 2E4ZA 1JYFA 1V1MA 4L50A 5H3LA 4G23A 2XNHA 3BB3A 5C1DA 2R7UA 3ICEA 1NN3A 1KQGA 4FFWA 2I4NA 5E1WA 2GEFA 1G2QA 4P3OA 3W9BA 1GZ7A 1OX4A 2NNLD 4I5IA 3UNXA 2EW2A 3W3AH 4DBLC 1GG9A 3DTVD 4I1UA 4GMHA 3CSDA 4XGQA 2HZBA 4Q3OA 1K79A 3TINA 3P96A 4IILA 2HMSA 5KYYA 1Z2EA 1SY7A 4UZSA 1P33A 3FD8A 4Y6SA 4EG3A 1OYYA 3CINA 1QAQA 1RR6A 1XROA 2GTPA 1HNNA 2H9AA 1L4NA 2VLBA 3EMKA 5AXBA 3QBEA 2XBLA 3BQ9A 4UDYX 1GGVA 1PFYA 3D6FA 1POGA 2XECA 1RHKA 2E49A 1GU7A 2CDNA 1LD3A 2I6SA 4LFBB 5FADA 4MV7A 3OPQA 4W4TA 3JQ8B 4XYMA 4DLRA 4AG6A 4BMPB 2P27A 5CT9A 4HV4A 1GA4A 2WB1A 2Z16A 2GZ2A 3JYNA 4G5QA 3H0EA 4DTCA 3TTWA 2BOVA 4H0NA 1JUSA 4TGLA 5LQMA 3KP3A 3IMEA 1TP4A 1EGVB 2WJ4A 3U39A 5B7QA 4OGWA 4KMFA 4ARAA 2QQEA 2ZDQA 1BE0A 4C03A 3B3AA 2Q8NA 1JIJA 2BYVE 4KOEC 3LPDA 3R0AA 1I3CA 5TMBA 4DSAA 3C6QA 5DP2A 5I7HA 3UA3A 1YNSA 3UA4A 3DAYA 3SC2A 1P5RA 1PZEA 3WO1A 5JXJA 2IEKA 3E4CA 3QVVA 1A9TA 5H02A 2X3FA 4LGMA 3KIOA 3ROTA 4Z7QB 2ZB4A 1KZ4A 2QY9A 3GJ4A 4BNVA 3E3MA 4QARA 1QPZA 1JEYA 3OIQA 4H31A 4TXJA 4CI0B 1WSBA 2H0AA 1WXGA 3PV0A 2XMBA 3VU9A 2WA1A 2OE2A 1EJ9A 1SHUX 3IR7A 1PE0A 3QVJA 4MPTA 2RVCA 3PPXA 2WIGA 4MR8A 4UU7A 3SDZA 5K5QA 2FPOA 4UDOA 4WGGA 1C29B 4QVGA 5DGXA 2K2QB 5LOVB 1FSZA 4H7KA 1M2HA 4CEHA 4C3JJ 2ZNYA 5HOOA 3TQCA 3M6FA 1CEYA 1BL0A 4IOKA 1W0TA 4MR9B 3S5JA 4OWRB 2LGJA 4PSAA 1FZTA 5CFQA 2RAPA 5KDDA 5TMPA 3ICCA 4I9GA 1LVGA 4D79A 2UV1A 1Z7BA 5JWOA 2DCUA 2LUOA 4KXXA 1HNZB 2XT0A 3H8VA 5IVIA 3SE7A 1B7GO 1ULZA 1LY1A 3B60A 3KELA 4TLBA 2B69A 3W6ZA 5C5CA 5JJIA 1S8AA 1USUA 2K27A 3GRPA 1MNDA 1F7UA 4NJMA 3SFTA 3ZG6A 3GRVA 3HZHA 3GLHE 1Q7RA 1IBSA 5T4HA 1E0AA 3MOSA 1SBNE 4KG7A 1C50A 4QPPA 4G4GA 3D5RC 5LHHA 4HLCA 4B4DA 2RJ3A 4RSGA 1K4YA 4EPVA 2CHEA 2LR0A 5DW3A 3EFHA 4V39A 2CKMA 1CJKC 3BRCA 2EZLA 4ETSA 4IFEA 5IVKA 1UQUA 3EJ6A 2A9RA 1I7DA 4N41A 2IXBA 2GZ3A 4WXHA 1A3CA 2MH9A 1GPNA 4G8CA 1QDUA 4M83A 1UJMA 5E7MA 1C7JA 3C1TA 1PVVA 4QPDA 1HYBA 2RD2A 1ZZGA 3RVBA 2VAWA 1LDDA 2WTAA 5J4KA 3PEFA 3PTLA 2R7OA 1FUYB 1X7HA 3T41A 1TM4E 2BGRA 3JQGA 3WGOA 5CFMA 1RXWA 2REOA 2IH4A 1OWNA 3ZDEA 1ABEA 1OXMA 1A7JA 1F4PA 3F98A 2YHSA 2CNDA 1XEAA 3O82A 2I7CA 2PPLA 1EKEA 4Q19A 4F6LA 5ILSA 1RLIA 4O1MA 3TGNA 5FLKA 4CU5A 1T5LA 5E6SA 2R7KA 4M8LA 3M6MD 4FLMA 4D4IA 2A07F 1AHHA 1E9CA 4ZJZA 2Y1CA 1TCBA 3OPYI 1YX3A 1NT2A 5J5CA 4N9WA 2E7WA 1P60A 1TTPB 3CPSA 3RYCA 3IAM1 3VZBA 1N2BA 1LVUA 1YU6A 4NONA 4JZKA 2JVGA 1YV9A 1GAQA 4EDFA 3VHLB 1HKQA 2VPLA 2F6RA 1Z7LA 2JKYA 2PD3A 2V65A 2HY7A 3E4DA 3DEEA 3NUZA 4K9MA 4Q03A 2LPMA 3GGDA 4GXRA 3RTBA 2GF0A 2E6UX 4RVFA 4ZDIA 3DKYA 1DQUA 3FXRA 3U7RA 1DU0A 5DISB 5EESA 4B6SA 3BMCB 4EBBA 1KQFA 4JI8B 2VBXA 2GK4A 3VKHA 3VTZA 1JP7A 1T38A 1Q83A 3MA0A 1JQ3A 2R93J 2VSXA 1MBHA 3GRAA 3TLGB 1QFZA 2IUTA 4OIMA 4BVBA 1YJAA 5J63A 4KXLA 3K7AJ 1RW4A 4R68A 4C4PA 3SG0A 1KXZA 2FW7A 2O0LA 3JATB 2VAMA 2ZXIA 3QVSA 3NHZA 3S6JA 1HL3A 3CF2A 1XCGB 3AHIA 4P4SB 1WGXA 3B02A 1TQPA 3KPWA 3OFSA 4L5YA 2QMYA 2GUWA 2WM9B 5GGXA 3EWIA 3H65A 1IBLB 1UBRS 1BM9A 2BXYA 2PX5A 4YFXF 3GAAA 3NP7A 1U2WA 2ZT5A 4L3WA 4LRXA 5EUQB 3SSNA 3VR5A 3G1WA 4D8YA 1KZHA 2XMSA 1IBRA 2W70A 2K9MA 3DUFB 2B2CA 4DQDA 1SEPA 1PWEA 2O2SA 2ZKIA 2ZP1A 4CF6A 4RGSA 1QO0D 2VQDA 3TNLA 1T5DX 5LR6A 3BR6A 3C3AA 4Q3CA 2FN7A 4BLOA 5C46F 4TLLB 1OCRH 3HRIA 4OATA 4LF9B 1G1AA 1ZWLA 1XC5A 2N46A 4WK6A 4OAYA 3BA1A 1Q6YA 4RFLA 3CRVA 4HDMA 1FVHA 3V7RA 2FVXA 5IKXA 4FASD 1NP7A 1L5MA 2WFZA 3DVLA 1L3BA 3DM5A 2AQKA 3GVIA 5LYYA 1Y3IA 3O1IC 5EMMA 1EA5A 4KDRA 1OTXA 2QUFA 3C2GA 3T1BA 2BI4A 3LO8A 4RY0A 3SZOA 5MN6A 1OASA 2L02A 2VKHA 4UB8C 2P7CB 2ECKA 1UXKA 4WZAE 2OHFA 3C7JA 2ZE7A 1Q57A 2HREA 2D7DA 1WJBA 2OILA 1CQXA 2BH2A 5C4IA 5EWLB 1UFQA 1UODA 3K1JA 3L84A 1P92A 1XZNA 1V3VA 1SD2A 5C31A 4HBZA 3TW0A 4N48A 5D5QA 4OVKA 1RC1A 2DKNA 3ASVA 2VC1A 1JQLB 1IVNA 3E2IA 4Y2HA 1EXVA 3RADC 3E15A 2E71A 4IOAF 2VBZA 1SA0B 4NC8A 1XJQA 3H2YA 4FGLA 5JAUA 2Y9MB 4BTEA 4L0DA 3C6KA 5KVCA 3VB2A 2O19A 2KWIA 2QV7A 3EUFA 3RQIA 1A9SA 2AUTA 2FMUA 4CCMA 4UV9A 3HA7A 3I52A 3OFNA 3B38A 3IVMA 2Z4TA 1VMAA 3QKIA 3RG8A 2B35A 4FJ0A 4DA8A 4DCCA 4L2IA 3NEUA 1E8NA 4B1RA 1QYIA 3SDBA 2YVLA 2MMCA 3SGLA 1BSVA 3CA8A 7REQA 3H3ZA 3FCEA 3DHYA 3VXKA 1SMTA 5IAGA 1E7WA 4Z49A 1T4GA 3LK7A 2AOTA 3RGGA 4H1WA 4AS3A 1AGRA 1XCBA 1QIJA 3E2MA 3L1KA 1UIMA 1HLDA 3ABSB 2C3UA 5D3MA 1N5DA 5I7FA 5C81A 1GQOA 3TP3A 2G1KA 5FBZA 2LZ0A 4I6JA 1YZUA 5F3WB 3EPRA 2XQFA 5FWAA 5FUBA 3IE2A 5CK5A 4PR3A 2VPZA 4GGPA 2HU9A 4YGXB 4LRQA 2IGKA 1Y6RA 2NVUA 2O8VA 4PS0A 1EXDA 3L79A 4HNSA 4DVGA 2FOXA 2O7NA 2FW6A 3NTXA 4AECA 5JDIC 3ZWXA 5E6UA 1YZYA 3CZMA 4BPRA 4W63A 2ZM5A 3I9V2 1Z5WA 3K0CC 3KYIB 3AINA 2EFEB 2JA1A 3OQIA 3ZBUA 4G9YA 4ILKA 3TXXA 5A3QA 5IYDJ 2RGCA 6ADHA 4H4KC 4GYKA 1JMKC 2QTAA 2PYIA 2KFDA 4CG3A 1YO6A 1EH6A 1N6RA 1RPAA 4YRQA 3B8EA 1HDGO 4CLHA 1QYVA 1Z07A 4FDTA 3HEFA 1IULA 4ZOBA 3SZLA 4UTPA 2XWPA 4JMLA 4YRGA 1T5BA 3A7EA 3OTQA 3RU7A 3VX4A 5L40A 3NTVA 4ZV4A 4QTUB 3UGJA 2OU2A 4BRUA 1MIJA 1YZKA 3ZGVA 3CRW1 1K78A 1Y6JA 2K7LA 1HI9A 3CNEA 2DTRA 3DFIA 2X8BA 3K5WA 4KNWA 4XORA 3MJVA 4PLYA 3TSOA 3VPBA 4LZZA 1RM4A 2VTVA 1IE3A 1SK9A 3WRXC 5IK2D 2A9OA 3O4GA 3O47A 4M1MA 4I9HA 1TJYA 1F8FA 1X3WB 1M5UA 3F3SA 1RAEA 2F90A 2R60A 3H0KA 1E1QA 3I0MA 4QGFA 1HT1E 2Q29A 3C3MA 3FZEA 3GLLA 4KN5A 3WLLA 3Q9SA 2Y0DA 4PLFA 4HDNA 2ZJ4A 4CNBA 5KKAA 2EH3A 4NZOA 5KTSA 1JF8A 4B4WA 1M6YA 2PXAA 3JRFA 3LP8A 4X93A 1DQRA 4I7HA 1X2MA 3BAZA 1F2DA 4E6KG 4GKBA 3TLEA 3TAHA 4CEIA 1HK7A 1T2EA 1SFRA 4OP2A 2AFVA 3FX3A 4TL7A 4DIOA 5KNBD 1F17A 1MNAA 1Q77A 3PFYA 5C5EA 3HCOA 1HFEL 2BGKA 3D0SA 4AM3A 1QNFA 5K3BA 4Q3LA 2G0NA 3LQ1A 2XA1A 1BD4A 4NB5A 3TQHA 4ROSA 1OQYA 2BKAA 4Y2YA 4DYRA 5DI9A 4LHYA 4XRGA 2RV8A 3QKWA 2Q0SA 5KYUA 5AESA 2AJLI 3DC7A 3DHEA 3RTGA 1JKQC 3HPRA 2IK8A 2NZUG 3FWYA 3W5VA 1HV8A 4L8FA 5IDYA 5EN4A 2PS3A 5I6DA 5JV5A 1P5HA 5JCOA 3WVNA 2A5JA 4QVIA 4BXOB 3Q0UA 2FMYA 2HXYA 3P4YA 3CG0A 5DHTA 2FWJA 2IZZA 3EZFA 3FF5A 2F9MA 2GESA 2J67A 2Q99A 3K94A 3LI2A 4E7HA 3LW7A 3LZ6A 4HDOB 4V0ME 4WGFA 1H4TA 3RYIA 4BLQA 3Q8MA 4FE7A 1P7CA 4FW9A 2AN4A 3OL4A 4E5YA 1ZIPA 3GL9A 1IHUA 3ZD6A 2CMGA 3TMOA 1L4YA 2HFKA 2WV0A 1H0SA 3HJRA 3BH0A 3I4FA 3ADCA 5KQLA 1JE0A 3ITNA 3DZFA 4GM1A 1NVEA 5C5IA 2JIMA 3G2LA 2E4WA 2WJAA 2ZAOA 1XJ5A 2ECCA 2QQ8A 2M8EA 3O9MA 4LWZA 7ABPA 1X7DA 2IDKA 4J0QA 4Y15A 3E5QA 4EYOA 3L00A 1XXHE 3HYRA 4U7DA 4BB0A 2R7TA 3LK6A 4XQEA 2E7ZA 3AHFA 1XMIA 4JP3A 3ZJ5A 4ZYHA 4D74A 2C4TA 4UUOA 1J2RA 1KK1A 2Q5QA 4XE5A 3WICA 5A4KA 1TDJA 1K1EA 4BNWA 4EV0A 2KLBA 3LWBA 1QRSA 2GX6A 4GNRA 4ARUA 1R58A 3AFOA 1SXJD 3L4JA 3FNFA 1T8IA 4D5GA 2AZDA 4BV8A 3S2FA 3WLAA 3FXAA 3GCXA 4YUYA 4PQFA 3OYLA 1T9AA 3C8ZA 3K0CA 3OCVA 4BO0A 1LKZA 1C30B 4JKIA 1DEKA 2W11A 3UATA 2UYCA 2BH9A 5KWEA 1PD1A 4YBRA 4XR6A 2RB5A 2KKOA 3FAKA 2XIJA 2Z09A 3W2FA 1DEAA 1X7ZB 3IV9A 4TVOA 4WNCA 3UJ7A 4MHOA 1JKJB 2GWRA 1JTXA 1Q15A 3LZDA 5LJIA 3JQAA 1P18A 2HYFA 2CYBA 4FK8A 5EXXA 5IKPA 4Q18A 4P4UA 3UC9A 1NL3A 3IYLW 5CFZA 1DGQA 1KZYC 1R0KA 2A5YB 1PBNA 5CG1A 5GWXA 1XG5A 1FL9A 2X6YA 3OEWA 5KVRA 5CD1A 4B8YA 4BBAA 3KHKA 3OIYA 3AYZB 5BUSA 2BP7A 3TTTA 3PI7A 5JY1A 1JQBA 1DJMA 2ZYUX 1EJBA 4ZK2A 4GU5A 1RPNA 1VOTA 5B58T 2OZ6A 3R3ZA 1P4JA 1P17A 3EARA 2HZTA 1AK9A 3SY8A 1XQ1A 3CZCA 1K6IA 1G18A 4ZAGA 3S40A 1JG6A 1ZSYA 2EZ9A 3GA0A 4TTTS 4Y0VA 4B76A 4WXCA 1IJEA 5ALZA 3GMTA 3BL5A 4Q4CA 4B47A 1M7HA 4MPJA 4UBIA 2YKGA 1JKXA 1XSXA 1C7FA 1MC1A 4Y1GA 1L5LA 2O5RA 1I6LA 4F72A 3FBWA 1KRWA 1QLWA 3FYSA 4FZ5A 2IKSA 4RHEA 1T6SA 3IQDB 3ICWA 2WKSA 4H18A 3L8GA 3SVZA 2IXSA 1ZD4A 3WGTA 4A7PA 3F8MA 2CVOA 1T4CA 1DBRA 1PR5A 2DHDA 4LV6A 3GFSA 1L7PA 1HFJA 3FSEA 4JBXA 3JZFA 1M34E 4NMMA 2VRCD 2ZIUB 1VTKA 3A6KA 3KQVA 2VOEA 1T4BA 4JP0A 2EDAA 2G5GX 3AEZA 1SB8A 5D5XB 3TIIA 1BZYA 2PT7A 3ZE0B 4YCMA 3TQNA 3LQRA 1G42A 1BBYA 4DJEC 4WBNF 1OW3B 5KJ1A 5KOHA 3PFFA 4IHXA 3FWHA 2H1SA 4KK4A 1DRJA 1GNVA 4FEYA 2K86A 2JBAB 4BIIA 3HXQA 3T7TA 2BZ0A 1KYZA 1L5YA 2Q8QA 4UUSB 1JSLA 4KV7A 4O8ZA 3T8YA 2ZANA 3P9CA 5LQNA 1GUDA 2Y05A 3KQMA 4IWYA 3QXGA 2A58A 4BAYA 3SM9A 2F1OA 4FOSA 3UUEA 2ZAIA 4EHBA 4JXXA 2BD0A 4LK3A 2DFNA 4HQKA 1G63A 1HG1A 4RA6A 6AT1A 5KEIA 1AM4D 3BY6A 1IEVA 3FZVA 4KPUA 3V55A 3V8QA 4XK4A 1RI5A 3X2SA 3ZBTA 2VQHA 3V8LA 3AR6A 4CMBA 1MVOA 1E62A 3SJAA 2A6HF 1NKTA 3AEXA 1H3NA 4YAOA 1XRLA 3NONA 3K35A 4BEHB 4YIRX 1QE5A 3O9VA 3R6GA 4QQRA 4M71A 4Q9HA 5HE8A 4RMHA 2BHTA 3G7SA 1UFRA 2QTRA 2FEOA 1J6UA 3PEVA 3QTLA 1EKXA 1XAGA 1U0HC 3B3JA 4AZVA 1XFDA 1PUFB 2EA4A 4QBKA 4U8HA 5EP3A 4NZYA 4FB5A 3L9WA 4MCHA 2K6GA 2JFVA 4FWIB 5DV9A 4ENUA 1HA3A 3O73A 1SQGA 2Q5FA 4MINA 3PC7A 2R5ZA 2CWWA 2FJPA 2A05A 3PHCA 4O1HA 5AJUA 2N1MA 4K6OA 4WCGA 4WY5A 5ANRB 5JYCA 2UWMA 1O9BA 4YV2A 4ZYDA 1AHDP 1RHMA 1T9CA 3AVPA 3BMNA 4OOEA 4DNPA 1XB4A 1BJKA 3LRTA 2XUBA 4RF2A 3WHKA 4L3VA 3A8TA 4QTTB 1AKVA 2XB5A 2JIQA 3UGKA 4ZYUA 1GYQA 5CG2A 1Y6FA 1BJAA 3KZYA 2P78A 4PIMA 3VR3A 3DXYA 4P4LA 1PIWA 1CUDA 1FXWF 1W4RA 2PBIA 1YIAA 2WFLB 4M0PA 3GI1A 3WLIA 4CQMA 1F5NA 3TQFA 2JGDA 1TA4A 3EETA 1FMJA 1Y7LA 1J75A 1ZQ9A 4D0LB 4GVXA 3N58A 5EXEA 4F60A 4CIWA 3AP3A 2OHOA 5JAHA 5DRYA 1KYWA 5AONA 2BVMA 3PQDA 3BZKA 3OYGA 3HS3A 4GX2A 1Z06A 4N39A 3JVUA 2LE0A 5ESRA 4ZYZA 3J81k 4W97A 3E6MA 2B83A 2C5LA 1X1QA 3CGWA 3E22B 4FZRA 4AJ4A 5JC8A 4GZ6A 3FVQA 4EDHA 1SRRA 1UK6A 1UZAA 3MOIA 1QVWA 3ZXYA 4DLLA 5JHHB 4DR6B 3OZRA 3KOUA 1RMQA 3RJMA 1A4UA 3RVDA 5CTAA 4N6GA 4UUTA 3GRFA 3GQBB 3FRIA 4UFOA 1APLC 2R86A 3KKMA 2FOLA 1IJWC 2EV5A 3FK7A 3DTVA 3D1NI 3MIZA 4DLXA 4X8MA 4BS9A 3A9TA 5JU6A 4Z2YA 3L07A 3PFKA 3ZU2A 2DOFA 3H36A 1DWOA 1RE0A 1RQPA 5E3HA 4GMKA 3KFLA 1T1EA 4HPXB 1BKSB 3D3WB 4X20B 1C7ZA 5DLDA 5L3QB 4Z3OA 3WGKA 2DHCA 4JBGA 1Z3CA 2BC9A 2OCDA 3MWFA 4GFDA 2HC9A 2XGCA 4IXNA 3ROXA 1J0EA 2DUWA 5EMNA 2AEFA 3A3KA 5CNMA 1A7KA 2HMYB 3WKBA 1GGHA 4IEEA 1ESEA 1OFTA 2A94A 3RG2A 3OZFA 3ER9A 1J9GA 4XWAA 2PLRA 4O4HF 2VOPA 3GZ5A 1K6OA 1UBGA 1OWOA 5EKDA 1IH8A 2FKNA 3B6ZA 5EKTA 3PNOA 5BQOA 2XJ9A 1HDIA 1N2OA 4FWTA 4L18B 3DQQA 1EUYA 2VJMA 1DAOA 2BEUA 2BHYA 1KH3A 2LF8A 3L8FA 4R05A 1IXRC 3SFVA 5LXTA 3GC6A 3V2HA 4UB6C 3VR2A 5J3LA 1OU0A 1P91A 2ZIXA 4XUCA 3KVVA 2GD6A 4G86A 2AUMA 1NTCA 4TKLA 3GP5A 1VYTA 3AJEA 3PSAA 2BFBB 3N6XA 4BP9A 2WOOA 4D25A 1VIDA 1KI8A 4RZXA 5AW3A 1HE2A 1ZYRF 1JR3D 1KJNA 1EVQA 3G68A 1HT2E 4M8KA 3UC5A 1CC1S 2W25A 3DKVA 4MUGA 3WA6A 2EFWA 3P5SA 3LT4A 2FBIA 4DIUA 3H0DA 5SY4A 2P8TA 4Z4HA 1E3MA 4E3WA 1QYXA 2PGJA 3EX7C 3PIOF 1MGTA 2PX0A 3BRSA 4ZQHA 3ZWYA 2ZDGA 2R7QA 2N3ZA 2PBLA 3IJ5A 4AJOA 1UWLA 2CSUA 3RS2A 4BNDA 4WBNA 3JQ8A 5I7EA 5B3KA 3EZYA 1DDNA 1HQKA 1G21B 4WACA 4ZAWA 1URPA 1WUKS 2JI7A 3CC7I 5AJXA 2WU4A 4CT0A 3AKDA 5C4XJ 5KDLA 5GAJA 3IDQA 4S12A 1TPZA 2CZQA 1E5LA 4LRTB 1HBJA 2EC5A 2J41A 4NOMA 3LC2O 4JASB 4O29A 4DJDC 4MV4A 1EQ2A 2KJCA 4FTWA 3GGCA 3QFFA 3HBLA 4JI6B 3SIRA 3ZH9B 3PHGA 3SC2B 3JD3A 3T5MA 1YB7A 2DJ5A 3DE1X 3U40A 2QT1A 2COBA 3WMGA 3I6MA 4H6VA 3O03A 1QA6A 5FFXA 1KDOA 2G17A 2PZ8A 2VN2A 1ECPA 2QUZA 1IXZA 2R7AA 4LLLA 2W2PA 1CR6A 1ODTC 2PR2A 3AEQB 3IP5A 2QTHA 4OHOA 4ZZ3A 1VYUA 2E4AA 1U9OA 3R5FA 2ZIEA 3FXQA 3SYTA 2B4YA 3WHCA 3OM0A 1XGMA 2ON6A 3MWJA 4K9SA 1WCWA 2GZMA 4MQ6A 3DF7A 1SJ9A 1SZJG 3K1TA 3BF8A 3OLYA 4XRRA 4QJ3A 1UEJA 8LDHA 1OZHA 2MHCA 1VJ0A 4NJEB 4GPD1 4LY0A 3REQA 1TT5B 3I6QA 2JGLA 4PAOA 4QDUA 2Z5GA 5BMVB 5FEUA 4NAUA 5J43A 4I09A 5E3MA 1C8LA 1L4HA 2B92A 1C9MA 3CO6C 5DTJA 4ATNA 4JR0A 1YZQA 2K7ZA 1T34A 2XDQB 3WAKA 4JCCA 1RR8C 3CCJI 1QG4A 3DJYA 4JLDA 1T2FA 2VJYA 3AIOA 4N0MA 4MKGA 1KWGA 1TTYA 4C0LA 1A72A 1JQ5A 3TF5A 3L7IA 1FXWA 3N7TA 1RZRD 1WV1A 3Q3CA 4A3BJ 2QQFA 3K9LA 4KX5A 2NUAB 1QNTA 1V8DA 3GDOA 1Z4KA 2FEAA 3LWNA 3QFHA 4IIUA 4ZXPA 1SIWA 2Z3WA 3FUUA 4OH1A 3JRDA 3AY3A 3FHLA 3OOWA 1ISIA 2EA2A 5TVGA 4ZYVA 3NU1A 2OFFA 3AV0B 3LOCA 1YITI 2Z95A 4LHVA 1A50B 2O7QA 5AW0A 5JMTA 4PZYA 3AAFA 1NLYA 3NAQA 4LHSA 3JAMK 1B73A 1FYDA 1NI4A 4XD2A 3JTGA 3ZQHA 4N0PA 5IHPA 3NTLA 1RLMA 1ZMOA 5CVRA 3EIOA 2CQ7A 3W1VA 2CS3A 4UAVA 2FXAA 1QOPB 1YS1X 2NVYJ 2HDCA 1J39A 1UM9B 3DZJA 3NEPX 4ND1A 4XH9B 1H2FA 4DKXA 4F0JA 4EY8A 3WAJA 4G1CA 1LK0A 1CF4A 2OD5A 4DT1A 3U1TA 3C3CA 1TF5A 5AJZA 1MFPA 4P80A 2KZGA 1F8GA 2O1WA 4HHEA 4U2GA 5C32A 1GV5A 2RMKA 3OFJA 2M7AA 5D86A 5DLPA 1C1XB 3HRKA 1FVOA 3PIDA 5J9FA 3SNKA 5JSUA 4U7GA 5JUWA 2XMQA 1OKKD 1AD2A 3UJ9A 3I42A 1X3LA 1R4AA 4HV6A 3RYCB 1P7YA 2G09A 2NNWB 2Q3HA 3ONQA 1AKRA 1EUDB 1MIOB 2FPGA 2XA2A 2ZKLA 4PG5A 4REOA 3TLMA 2QLTA 4DMUB 1E94E 2NZJA 1T3ZA 1UWVA 4PSCA 1DE0A 3VYUB 4IZ6A 1G8PA 1D6JA 2ZJQF 4TYNA 1JAZA 2IOFK 5CYFA 1U0FA 2QVLA 2X7XA 2G1AA 4OXKA 4FD3A 4FXPA 4IDOA 3TEJA 2QR3A 1SKYB 2JSCA 2EX0A 2YMLA 3BXPA 1KJZA 1Q2UA 1EEXB 1ZMXA 3H5LA 5E18F 1OLSA 2ZRIA 2EV0A 2C7QA 2AGVA 4WX9A 3NHSA 4HZUB 7YASA 1P6UA 4WT7A 1GKIA 3EY9A 4ND4A 3SI7A 4DB4A 1FK8A 3PX7A 3WHPA 1K7SN 4JHLA 3CQ9A 1M6NA 3FUCA 3DB1A 4RIGA 3CH5A 2NZ2A 1KZ6A 1PL0A 4BHPA 1RKUA 4KO3S 2C2BA 3F7TA 4BCBA 1KY3A 3FMSA 3ABQB 3ET4A 5HFJA 1XK6A 2G9NA 3EC2A 1I7PA 3ENZA 2GVZC 4PYLA 1DCMA 1R1DA 1K75A 2ADFA 5H59A 1QO0A 2ORED 2JLRA 2VF7A 3IAEA 3B82A 3R5SA 1PHRA 2LR8A 1KH1A 1I8TA 2GS9A 1AUPA 3JAKB 1NX9A 3PUJA 4BE4A 4KQ9A 2DYRH 3QEJA 1WW3A 5AIAA 3UOAB 4BNNA 1S8FA 2P5KA 4J4TA 4NH4A 4AW9A 4EKYA 4A0SA 1ECJA 4JUIA 5FNZA 4A0XA 1L3IA 3O95A 4XWOA 2YJ3A 5FT9A 2WMNB 4RX1A 3AG1H 3TRHA 4LC0A 5F1PA 2ERCA 1IZ9A 3U16A 3O8QA 4XLAA 2A9VA 2PGLA 1ORIA 4M36A 4A27A 1P7VA 2FN9A 4OHUA 3WMRA 2Z1DA 3NEJA 4G36A 3RIGA 2PE5A 3JQ7A 4WLUA 4CPDA 4E6PA 3A1DA 3HY3A 4PVDA 2VOOA 4C87A 4AI6A 3HZOA 1E8DA 4RMIA 5K3DA 1Z1DA 2JBHA 4PG8A 4Z4CA 4C3HJ 1T98A 4IZIA 4GPZA 3U7IA 5HJEA 2Z6AA 3ONWA 1FNSA 4I5DA 4EQ6B 4D9GA 2X51A 3TFWA 3V8BA 5K0CA 2SHKA 2VYFA 3R8XA 1SIUA 1MG5A 3RKRA 4CF7A 3BT7A 3A9VA 3OWHA 1EQUA 4P08A 1DIHA 3MTIA 2PUJA 3VHXB 1HURA 1Z26A 2G9UA 3WY9A 1ZIDA 1ARZA 3A0HC 3AXTA 3PGMA 2W71A 4QQNA 3SU8A 4C6SA 1BC8C 4I3FA 5LKAA 1W9HA 1AZLA 2QW8A 5J1TB 3OJEA 4X24A 1CBUA 2GNAA 1DDOA 4IJVA 1F6BA 1YJBA 4J2TA 3U1BA 3W5HA 1LXCA 1SC9A 2FN8A 4HATA 3IVRA 4C7XA 5FUQA 1RJFA 2B99A 4OI0A 2V6CA 4RHTA 4YONB 2A0FA 4YMTA 1Q7TA 2ICAA 3HADA 3ZEAA 5LP6B 3FMGA 3M5WA 3ABKH 1E1YA 2ZUBA 1C7IA 5GTIC 2HOEA 5CR9A 5IAJA 4YASA 1Y1RA 3V8JA 4I02A 1K6YA 2FSVC 2FXIA 4O4JA 4TWAA 1PWXA 3JXEA 5H9WA 3OYAA 5MGBA 5BP7A 1FRZA 2GCGA 3LNCA 2WC2A 3QOWA 5C8YA 1ISPA 1TZJA 3H9QA 1OAAA 4G07A 2WRZA 5EQJB 5IHXA 2IY8A 2B4TO 2Q3BA 4H4CA 4BKXA 2H92A 4A0GA 1QRAA 4G81A 3KWJA 4XIFA 3AEKB 5EYRA 4BNLA 1MLDA 4E4YA 5GM2A 2J0UB 3AF0A 3DPSA 4LYAA 4H1TA 5CVIA 1MXHA 4MO7A 2PSHA 3P8ZA 4R79A 2Y68A 4QRDA 3WBKA 3THWA 3X1YA 1EG2A 5IPAA 2H27A 3GTMJ 1NQXA 3EK2A 3EZ9A 3PQ5A 3AI2A 3T9DA 4B6PA 2OYRA 5L8VA 4MUAA 3DFFA 4MUFA 2HW8A 5A5DA 2LLKA 1B2RA 1FW6A 1Y8QB 1VGRA 1VM6A 1GUAA 4M88A 4ZXFA 1R37A 2B30A 3WGLA 1NVFA 2HJHA 1IU9A 2RGBA 3CPEA 3DDUA 3EVTA 1PVDA 1SIBE 2ZE5A 3QUAA 2J9YB 4HQMA 3RREA 4R9VA 4YNBA 3PNLA 3TM5A 1ZK4A 2AO9A 3QE9Y 2HGSA 2O3JA 2WD7A 1MN6A 5C7IO 4GZ3A 5B2ZA 4D8UA 2EG9A 3V32A 1E4YA 1ICIA 3GRRA 3Q3JB 3PFCA 5F1OA 2M4GA 1G6KA 1P0IA 1RJ9A 3IAXA 4DXAA 3UWSA 3M8FA 3KDSE 1LJ8A 4GI2A 4QNMA 3ORRA 3E9QA 3PLAE 4C7VA 4NBQA 2GD2A 3ZGKA 4BFUA 4UHBA 4JGIA 1DKMA 1Y5NA 4TKUA 4BB9A 2R7XA 1XIVA 1HG0A 3A06A 3CWQA 3M4JA 1U8ZA 2ATCA 2QRNA 4FZVA 1MF7A 4HGPA 4XIJA 1QIIA 2JCSA 4IOJA 1I1OA 3CJTB 2HRDA 4XRSA 1IF1A 1E6KA 1L5FA 4PM4A 1QSGA 2X1CA 5IPFA 1TKAA 3BFPA 1PUIA 3DR3A 3JATA 4YMIA 3F97A 3GLIA 1HE3A 3RARA 3TB4A 4HB2A 2M7BA 4E7SA 4P54A 2IV3A 5I51A 3IILA 3MUEA 2HTEA 1M1EB 1HYEA 5A1JA 3OSUA 1XZQA 2M9HA 3KLMX 4QYWA 4BYYA 4CXFA 1XA4A 1Z6YA 3B3FA 2CXXA 2J3EA 1NURA 3V4GA 4ITRC 1D8AA 2EKBA 4YI5A 5KJEA 3LY7A 1W59A 4AMUA 5A5FA 3WA7A 3S27A 3ABUA 1WZ2A 3LUFA 1I2MA 4TWBA 1G19A 2CQNA 4GEGA 2V7VA 1EJ6A 1WSAA 3NIFB 1VFNA 4TMZA 1R16A 2GGSA 1WBJB 2GUGA 4AIIA 1G4HA 4YLYA 4E1VA 3LAJA 5CPRB 2ONCA 3QMPA 1FRVA 3HO1A 3I45A 1OT5A 5GTDA 5FO1A 4N5LA 2R1VA 2X41A 1ND5A 1RYDA 3L7LA 2H08A 2GM5A 2ID4A 5K0GA 2B98A 1CZKA 1ZA1A 3D8NA 4MX8A 2ORYA 5FKKA 2CXOA 2WJ3A 4O4HA 1GL9B 3R2JA 2FR1A 4UZEA 4V0RA 5EHQA 2XUZA 2BFAA 2X48A 1GNTA 3QRFF 1U1IA 2BPOA 3H9BA 4XARA 5EJAA 1DKUA 2YVAA 3AVXA 2X7JA 1LQUA 2OZUA 4NJOA 2PN6A 3QKUA 4I14A 3H1EA 4MJ7A 3P0FA 1IPHA 3OUTA 3ECHA 4KQXA 4U2CA 2H4JA 2BSQA 2MG4A 3J81Z 4RBOA 2E82A 2NVWA 3KEQA 2IIBA 3U7QA 2Y1WA 4C0HA 1IOVA 4CLOA 1D09A 3TCXB 3E8XA 3RSHA 3G0HA 2VZ8A 1IUKA 3WNQA 1TL8A 3HDQA 1ZHFA 4C3ZA 2WJJA 1XLTA 4MA0A 1XEWY 3SJCA 3K0AB 3S5UA 3RIXA 3BZ6A 4MI3A 1EHYA 2ZWOA 4QXOA 4V1CB 2GN4A 2YZKA 4QU8A 2FGJA 3THXB 1LI4A 2H5JA 3RT9A 4PBSA 4YJ3B 3ZW7A 2E1CA 5U4QA 4WKBA 5JADA 4FMPA 3BWDD 4ZOAA 4B7UA 1XNHA 1TQ4A 3EXEA 1SD6A 4XYBA 1FSPA 1J0DA 4B6QA 4CT5A 3QVGA 4E5VA 3A26A 1KDYA 4RL6A 3Q5EA 2IYEA 3GG2A 3DP7A 2BE5F 2PV0A 3D8UA 3OAAD 4KHZA 3V4SA 4A26A 1D1AA 3BG3A 4Y52J 1Z5PA 3AP2A 3LTEA 4HDRA 1M34A 4JJGA 1MH3A 1UG0A 3TSYA 4AZTA 2DG2A 5K0BA 1Y4AE 5CT4A 1AGPA 3G1TA 3PJRA 4GOND 2E7XA 4YCAA 4JROA 3T1TA 2J4DA 3EVNA 1HZZA 2DECA 1J1IA 1SHZA 1T0JB 4YR9A 2H48A 3CMCO 1D1BA 1DJOA 2YN2A 1GQFA 3P0IA 4YUXA 2XB2A 2BY3A 5JCJD 1RKQA 3R0XA 3WOHA 2KLHA 1R0RE 4LG1A 4F12A 4RNCA 2BEWA 2QL6A 2F67A 3UK7A 3A03A 4YMUA 3R60A 2JKZA 3KZKA 5B6JA 5PGMA 1G3MA 4AX4A 1MJGA 5LQKA 2R97A 2P77A 3AEUA 4M0UA 4WPGA 3UV3A 3EA5A 4DIFA 1L2TA 1OGYA 1TFRA 4K9PA 4F55A 4QL3A 4W1RA 2P69A 1X1CA 1CJMA 1NG7A 1C4WA 3LLSA 3BCUA 1ZRNA 1THGA 2X14A 3S2ZA 2B8EA 3TZCA 5KC8A 4KICA 1WPQA 3UG7A 1UJCA 3EC1A 1NA5A 4J0FA 1RQ7A 3DC2A 3GLFE 2HDOA 3EGDB 4LA4A 5CYPA 4LMYA 5HM8A 4FQGA 3BJIC 5IU6A 3ZDXB 1KYVA 4YRMA 5F27A 1PJBA 2HQBA 4O2BF 4UD2A 1QCCA 3NHKA 2W6QA 1XZBA 3NJRA 1G3UA 1HSTA 3NANA 5TEVA 3G9XA 2FWPA 4KXQA 5JYDA 3PIPF 4ALLA 1L7XA 4QJ4A 5J1YA 1XZMA 1Z0AA 4D0NA 4E31A 2IEZA 5A4JA 1YL7A 4I01A 1FZPB 1VGQA 1SM4A 2VDKB 3HOSA 4H2DA 4HQFA 3D2LA 3IR6A 1XRMA 1ZNZA 3VPCA 5TRDA 1FQWA 2IPOA 2VPPA 1LVKA 3N8NA 4WFIA 5ICFA 2PLFA 1IDOA 1RS0A 1TC3C 5IT9Z 5KWVA 4J1QA 2YV3A 3F96A 5DD8A 3VODA 1FX0B 3EGIA 4KGVA 4YDHB 1M66A 2QGNA 1XA3A 2Q5EA 1NQTA 1NT4A 1PKXA 2PT9A 2Q3JA 4IIJF 5IP5A 3SYNA 1WH7A 4FFMA 5BSEA 1EK6A 2P6PA 2Q0HA 2VPTA 5EGSA 4G0UA 1X1BA 2W22A 4MQBA 4QEDA 4UVBA 4TZKA 4TSFA 3OQPA 3U9SA 4CCYA 3KV1A 3IJEB 3GLTA 4EW3A 5C7YA 3OESA 1UOQA 1N6IA 1QMGA 1XXHA 2NV2B 4H0CA 4S24A 4DCTA 3G0IA 4ZI7F 1JFSA 3KB1A 3HGMA 1WMEA 4F5YA 4FS3A 2YL2A 1HBXG 1OGIA 2D54A 3D8HA 2XTAA 4BGVA 4AJHA 2B1JA 3AF2A 4IDEA 3VKVA 2N9UA 4RVGA 1E1RD 4EJWA 3HKZA 3UQYS 3ZWMA 3ADKA 2QRVA 2BY0A 4IJ6A 3I4CA 3ZLVA 3AERB 1IN1A 2K4JA 2DPLA 3A27A 2YWGA 1ADJA 4DYHA 3TL2A 2EPFA 1V11A 3VSLA 4KPEC 4G6DA 4WNYA 3DT6A 3NDJA 2QAJA 4QFDA 2LTPA 3ESBA 1E79A 3NYQA 3NYWA 3ORQA 3RBXA 3U62A 5L95A 4LSMA 3I64A 1BIBA 2OHIA 3RU3A 1FXSA 1CY8A 1XTQA 2HJ9A 3PUXA 2QEQA 5HF5A 3ADBA 1G0NA 2H2HA 2H31A 3S2UA 3EG9B 1QQAA 2PWPA 4X1EA 3ZMUA 2ZR8A 1XOIA 2WPDA 3MUFA 2V6EA 1GNSA 1N25A 3L1PA 5A5GA 4DIQA 1NXOA 1QIKA 2IYXA 3BH7A 1W88B 2Q50A 3QHPA 2QZ4A 3OCWA 5JEDA 3VNUA 2GIZA 3C6YA 3BXZA 3ND5A 4RFVA 1LVHA 4RK7A 1ZRMA 1GAEO 1W85A 3JWHA 3F2VA 1F2VA 2QEXI 1CE8A 3H6GA 3VM6A 3WK6A 4TYYA 5D87A 3R41A 5CHEA 1IFXA 2E5LB 3F8WA 3H17A 3MERA 1SD7A 2VJ5A 3C45A 4LYEA 3AETA 3PS9A 4HUQB 3LVFO 3ZU3A 3HOYJ 2YZGA 4UBJA 3R7SA 4MQ5A 4JP2A 1R3DA 4BU0A 2IA5A 4L5JA 1DX6A 2PT5A 2AQFA 5JLXA 3A6JA 4IOLA 1ZGBA 1L7MA 4G6TB 1IWBB 1PR9A 2Q3DA 2PQ0A 2D1YA 2JKVA 3P71T 4PYJA 2IEGA 2QJWA 1KMQA 4FS8A 2DA6A 2K9LA 1MEOA 2QU8A 2YW9A 3KOYA 4P98A 4DQLA 1FP4A 2DBRA 1NIPA 2AS5F 4FZ3A 2AZTA 4G9EA 4DDTA 2Z1NA 2FFHA 2KPMA 2II6A 3K4MA 3KT6A 4Z7NB 1W7PD 3BWBA 4C08A 1RI2A 2KE5A 4RV4A 1BRMA 3BWMA 4XTRA 1OYVA 3OC0A 3L6CA 4AMBA 4RTQA 4F92B 2ZCJA 3IDOA 4RZIA 2IEBA 1FUEA 2D7CA 4TV7A 1ZA2A 1ZN7A 3AM1A 2YYZA 4KPFC 5B36A 5IT9K 1N5OX 3T3IA 3ZX4A 4YV1A 5JSZA 1AMNA 3SP1A 1E3IA 2F9LA 1IZ1A 4GYWA 4IDDA 1B8IB 3GPCA 4IRGA 3JQAB 4GH5A 4PNEA 2CYCA 3L3BA 4OHXA 5B58C 1WDTA 1WG8A 1NPYA 3FYDA 3GJYA 3CHYA 4IDNA 1ZLKA 4JKOA 3UMCA 3ZIAD 4F4CA 4AZ3B 2X76A 3SQXA 1LLQA 1KI2A 2PAAA 1E18A 1ECGA 2G4CA 2VBGA 1BC5A 1LH0A 2BHSA 2VEOA 2XMGA 2DW4A 1OILA 3PXEA 4LYFA 3W2GA 2QE6A 4ZPJA 3WL3A 1T6ZA 2VF2A 1KI1A 2ZNZA 1V43A 3HSEA 5JI6A 2VBWA 2X7HA 2XYQA 1W0UA 3AHJA 3IGFA 3PBKA 5KINB 1CSEE 1CUHA 1OLOA 2YBDA 1G8FA 1IHPA 2FSHA 5DEQA 2VNHA 3H8JA 4GYYA 1IB0A 5D6OA 5IZCC 4FGJA 2L4AA 1LC0A 3I9FA 2H85A 4QUAA 4W6QA 4MKFA 2XKAA 1VLVA 4JCOA 4Z4GA 2OA4A 2NLOA 4AF8A 2FRHA 4LDJA 2NQ2C 1JN0A 2CMPA 3OLVA 4G7OF 3QYBA 3DKPA 3JR3A 1Z0KA 3E9YA 1EIWA 4I81A 4HQ0A 4IWNA 2XZOA 2PUWA 1HWYA 2RARA 3LC1O 2ACJA 4DADA 3VGPA 3N2KB 1Y3BE 4NH0A 5JO0A 5DXAA 4DLKA 3A4CA 3Q0VA 4I9UA 1A2BA 4WDRA 3TPZA 4OX9B 3VO9A 3W5SA 2VCYA 5DYYA 2B0LA 2ID7A 1GTMA 1LFPA 1IY9A 1T8UA 1PDNC 2GZRA 3Q5DA 4L0CA 1Z28A 2FSFA 3VYVA 2GA2A 1MCZA 4Z99A 1Z6ZA 2F62A 4RLHA 3X1MA 5KYWB 2P5LC 3I34X 4ZTZB 4EX6A 6LDHA 2G72A 4JBAA 2ZJ5A 1DAIA 1NTRA 2ZR7A 4ZMSA 3HJNA 4TWJA 5CKTA 4OYRA 1ITZA 3GRUA 4JJIA 2DFFA 1RQGA 4XDYA 4MW7A 3BK2A 4C5CA 1PQYA 3V34A 2V6JA 4O5AA 2KIFA 1P2VA 2G1UA 3ISPA 1H22A 2NX2A 4FD2A 4JLMA 1SNYA 4KXFB 2J6BA 4R98A 4M3DA 1UOPA 3NQ41 4I55B 4F21A 2ZUCA 3DFGA 4TOIA 1MFZA 5EMJA 3H2KA 5CNIA 2H4HA 4G0VA 2V7UA 3VUEA 4B81A 2HRBA 3R5HA 3RUCA 4RHXA 4F52A 3PDIB 3NXKA 4MAFA 4UMDA 4JJZA 4JEIA 2V59A 4PZ0A 3MGGA 2E1PA 2FK7A 1XMQB 2AYZA 3CCQI 2RHJA 4ENKA 3I01M 3INGA 3MJEA 4YP0A 2XXAB 5D3QA 1FFXB 3DOCA 4D41A 1SFEA 4TYMA 2C2YA 1HE4A 3EVEA 5FTWA 4L9JA 4KK3A 2IP2A 1KC1A 1Q6ZA 1GR1A 2OHXA 3E3AA 5AVKA 3CONA 3UMJA 2I6FA 4P9FA 4KVFA 3TOCA 3VC7A 2ZO4A 4BQAA 3V4OA 4EZEA 1O94A 4V2IA 1F6DA 2R5ZB 3UPUA 1Q1EA 5FOTA 3FVVA 4QYIA 3ERCA 4MW6A 1K9SA 4JITA 1CUXA 3VBCA 3UCFA 1HQCA 2A30A 1IQPA 4NABA 1WCIB 4ZT3A 2G9QA 3TKAA 3U0BA 3WWPA 2QKLB 5IC6A 2SCUA 5AVUA 3EEYA 2M0CA 1SKQA 2GPAA 1JJ7A 4GGMX 1WHSA 2IV2X 2ZRCA 5KYXA 3K70B 1WUJS 2ZI6A 3RYHB 1ZIXA 4PU0A 1T6BY 4IIFA 3NUGA 2AN1A 4N3AA 3LIPA 4HOYA 3RC9A 3D3EA 2PLAA 1G8SA 3ILXA 4FWBA 3GTGJ 2WK1A 4WESB 2OB1A 5IAOA 4JT4A 5D6NA 3DGFC 3FDZA 5B3JA 4FYJA 1GN9A 1E0JA 2XVYA 4ZU1X 1EM8B 4NATA 2CJPA 3JWJA 5CLIA 3SLRA 3HBAA 3L41A 3VJKA 2IHJA 2YJNA 3RU9A 5LP6C 3SSAA 3GLXA 1R23A 1JZTA 1UQRA 4JB0A 1A9XA 2WY7Q 1UBCA 3PZBA 2G8NA 4Y6RA 2Q9UA 5D1NA 5FPYA 5KTMA 5B53A 2XUAA 5GZ3A 5AVTA 4DLNA 3D3JA 2C9MA 2W84A 2OGZA 4DT1B 4G97A 4F4JA 1BH6A 4LE0A 1Y5RA 2HSGA 2UZ1B 1PNTA 1TQ6A 3TNJA 3WWZA 4HUTA 1C1XA 4ZN6A 3LV8A 3L0IB 4OYHA 5C5DA 5JVDA 1FPQA 2Q0XA 2FPLA 1D3AA 2G4LA 5A5VA 3WS7A 5K20A 2FW1A 4CMEC 3AV3A 2W6IA 1YBHA 4Q47A 1DKPA 2VXCA 4QXAA 1ZJWA 4D46A 2F5CA 3GCZA 3MOGA 4MWOA 1JHRA 4TLEA 2QGUA 2ZTMA 2J3LA 4X8LA 4ES6A 4RB1A 1BWQA 1CHDA 1Z4JA 1TVEA 1SG9A 4NHEA 5TNXA 3IH4A 1AUVA 2VR1A 3MQ4A 3Q3VA 5TSDA 3KVNA 1Y81A 2IOHA 3DAOA 2F5DA 2DVMA 1GXPA 2DT7B 2H17A 2WSYB 3GT4A 2GLOA 1GUZA 4HGRA 4L4SA 4RTMA 2VXDA 2DODA 1Y34E 2P91A 2VJMB 4HLQB 4DV1B 3WGIA 3BGDA 3LOUA 3V9PA 4DMKA 4FHZA 4QYMA 4TMKA 4N7MA 4QREA 3RU2A 1U3GA 4LXYA 1A9OA 1W4LA 2Z30A 1PTKA 3VYWA 1W73A 4IRHA 2W83A 2BM1A 1DJLA 5KSWB 3IAS2 4HF0A 4IR7A 3CVOA 4RSHA 5E1OA 1OD6A 1PFQA 2REBA 1ESMA 1I5OA 1N4AA 3SFZA 5CFNA 1SAXA 2RI0A 3IR5A 5CBKA 2YUTA 5KKNB 4R9NA 3L92A 2X22A 3NORA 4B5KA 2Q0QA 1MT0A 1A2OA 1EWKA 3IAFA 4OB7A 1GPBA 4G5FA 1LUAA 2XIQA 4Q9AA 1WJ5A 4WLVA 4JI3B 3R40A 2B94A 4MRMB 2ZI5A 2W2OA 3HR7A 4KQCA 4DPMA 3OYFA 4EENA 1FFEA 2P9ZA 1XPXA 2GYWA 1OBVA 4ZI7B 5SYAA 3WYDA 2I4LA 2NV6A 1B41A 1P1FA 2Q2EB 3QWHA 1DZ3A 2JPDA 3OZEA 4V1CI 2UUAB 1Z21A 4H3SA 4PIVA 3RTDA 1MMDA 3JU3A 1TE2A 2I65A 2G82A 4B79A 2VA8A 3I3OA 2XUKA 5I7UA 1MNEA 2C83A 3FYTA 4NBSA 4BJ3A 1IC6A 3EZNA 4ZVKA 1PGPA 3KTAB 4Q4JA 1A82A 4AS2A 5I7OA 1BWSA 3H2GA 1XU7A 3K9BA 4U00A 2XF5A 4YJ2F 2FBHA 1EXNA 4NAVA 1RLJA 4BNHA 3JY6A 4LDNA 1U5TC 4YRRA 1J2EA 1T15A 4BMCA 3IUMA 1H23A 4LK2A 3STHA 3OYDA 3CLQA 2DFIA 2XVZA 4G2TA 5DLQC 3M8JA 3E0XA 4ZVOA 4R2HA 1GADO 2QJTA 3CMAI 4LKRA 2PRIA 1ESZA 4OSPA 4RXUA 5BR8B 3AEQA 1IXSB 1FOYA 1R6XA 3DUWA 3PNMA 2GAFA 4UVIA 2QMZA 4HH0A 4POAA 3NWEA 3FIWA 3GCGA 2AN5A 5LZ5A 4Q16A 3RI4A 4CEIB 1JB9A 1B00A 2LOOA 1F3LA 1UPXA 1USKA 4X1YA 4ZEVA 5B6IA 1G38A 3R3XA 2HS5A 3IFSA 3U2RA 3Q0IA 2DLCX 2CLIB 3MZ8A 1ZRFA 2L9VA 3MGAA 4U2BA 1LW6E 4R2WA 1YVRA 3TEFA 3WBJA 3DR5A 2PUTA 4ZTUB 1N3LA 3WYFA 4B8ZA 4BUZA 5D5VB 4WUTA 3KU4A 1EWYA 4POOA 4KO1S 1GSOA 5B4UA 3RTAA 3DOUA 3Q12A 1Q17A 1HC8A 4AVPA 2V7PA 2GBFA 4MCJA 4MS4B 4U8GA 2BGGA 4NQWA 1USSA 1XX5A 1NDQA 2DHEA 2QVXX 1I4EB 3RDPA 5ISMA 1U7DA 2WLTA 2J7PA 3NKLA 5K7SA 1I4WA 3NNDA 4LB6B 3D81A 4B1FA 2ANCA 3ZQFA 3LXXA 3VR0A 1XPUA 3MRXA 4EEKA 4MVJF 1GYPA 5C8YB 4RAZA 4AG5A 3A6HA 3F6PA 1UP7A 3M6LA 4JU8A 4O4LA 3TL6A 4BLSA 4ZI7A 2BEOA 1XQ6A 3OCUA 3RFFA 3ZQ7A 1BMQA 4HNTA 4NJEA 2ISQA 5B7PA 1L7OA 4ZTJA 3DM9B 3O75A 1DUXC 1W93A 2GD0A 1H5UA 4PX5A 4XDHA 4ND2A 4ZQGA 4OQFA 2FLKA 2BIFA 3BL6A 1SURA 2JN6A 2IXAA 4LS3A 5JJ5A 2YUIA 1DPUA 3B85A 1OXTA 2CVHA 5CGZA 3GFRA 4LOHA 3PLNA 1DLIA 2ZRAA 3ZRGA 4NCIA 5ULLA 3O6VA 1P6RA 2W00A 1POXA 2TECE 3BYZA 3PLRA 4FBGA 2FQ3A 5F5LA 4XZ3A 2OXTA 5CB4B 4KQ1A 2Y1XA 5H81A 2Y77A 1N6LA 2JAQA 3J7AO 1T3LA 4PJMA 3L2CA 2Q1SA 2VAPA 3GLVA 4TLDA 5I4KA 5I7SA 1SBTA 5FRNA 3C39A 4QNNA 2AL7A 1O4WA 2DPUA 2G7UA 2P4EA 3JAWB 2YWXA 2V5UA 3JQBC 1L5KA 3NDRA 4OLJA 1UDBA 3IP3A 3NV7A 3NOVA 4GMGA 3KE8A 4RA2A 4OHZA 1SG6A 1LK5A 2DQKA 3TUJC 3OS0A 4YRPA 1J9IA 1QGUB 3KU1A 3BDAA 4JYCA 3ECOA 5ALQA 5BQ3A 4US0R 4FYKA 3UWOA 1Q95A 4PZEA 5CT8A 2YV5A 3GBSA 1DIGA 5BPDA 1XA0A 3JD1A 4HO1X 2DMTA 4OXQA 4Y9DA 2A1UA 1UJ6A 2HCTA 3KQQA 2ZXEA 4NYMR 4C7OB 2VZLA 4PC1A 5DWVA 1OFVA 3RKYA 4LJKA 4R9RA 3NKFA 3EYYA 5HNFA 1R88A 1VE5A 3KB2A 2NPOA 4OAPA 1TIKA 2WEKA 2HX1A 2X2OA 3CWZA 3L1UA 3NZEA 1U8TA 3I54A 1CUVA 4QO7A 5EIHA 2VUHB 2ZYIA 5NLLA 4CCSA 1UC5B 3KXIA 3W6PA 2GXAA 4BCCA 3BSYA 4OOIA 2UUZA 3LSGA 3PD1A 3CUKA 3GFIA 3PUKA 2B37A 4FQ5A 3V4FA 4BJ5A 5KTYA 4CCKA 1E8MA 4XVHA 1WI3A 1BCRA 2I80A 3KWFA 4ND7A 5EWJB 1ONSA 2GAJA 1X9GA 3EHEA 4MS1A 1TCUA 4M74A 1E5QA 3QQ5A 3UAGA 5EZQA 1FUUA 1Y3CE 2VFAA 5JAQA 3THRA 2JDIA 2DBYA 2R5NA 3DOHA 4RSMA 4ASNA 4KC0A 4R3WA 5EXPA 3P2EA 3TCNA 1XEXB 4L9VA 2AE1A 1P0MA 1FS5A 3I23A 1XHFA 1JH9A 1SZDA 1IN4A 3NWOA 4PRYA 3ERMA 5FWXB 1W1WA 3LS2A 4MRAA 4Y2UA 2V9VA 2XUFA 4ZD6A 5EKSA 5HDBB 1AV6A 4BQSA 2L82A 5A9TA 2B36A 1NY5A 2Q1UA 3CF4G 1TWCJ 3H4VA 3M6VA 1T1RA 1MSFC 3DEAA 2Z6QA 1BA3A 1Z91A 1JNXX 5CVEA 1LRJA 4HMOA 3E7DA 4CSWA 3WFZA 1HQYE 1Q14A 1TLTA 1TK2A 4G1VA 2VF8A 1A5AB 3B1KA 1V9SA 1RCTE 3MWMA 1IG7A 5B55A 1SUIA 4RKWA 4B73A 2VBYA 3A6PC 2O3TA 2NYUA 2AMVA 2ORVA 4NC7A 4MYDA 4QEZA 4KQJA 4NYJR 3BG5A 2ZS9A 2J7PD 1IO2A 2NTEA 2XADA 1F1BA 4HEA2 1RI4A 2OXFA 5BRJA 1LEAA 1M75A 4JBIA 3ZDCA 3IH3A 4US1R 3H7IA 3KBBA 3M2TA 3GTLJ 1DNPA 2XRFA 3KP4A 1W19A 4CLOB 2VQFB 3EHDA 1AK2A 5IC5A 1MJFA 1NZDA 4X1KA 3CC4I 1UBUS 1LBQA 3QMMA 1P7IA 1RWVA 1UKYA 5IM4F 2QB5A 3F8BA 2OKGA 4WXEA 1S5PA 2DLDA 3R9KA 1T9HA 2OCXA 1HC7A 1S2OA 3II6X 1EA3A 1YCDA 2B1RA 5AT1A 3IEVA 2F3PA 3E8SA 1QQIA 3LSRA 4CMKA 3O2QB 4BASA 4F86A 2CFIA 2BMJA 3QSYA 1MG0A 3OE4A 3GW2A 4GMFA 5H7XA 3CKLA 4LXTA 3COSA 2BCGY 4P84A 1LDEA 3VVBA 1NN1A 3UQZA 1S02A 2XCLA 2H8WA 2ZRDA 3FBTA 3AUUA 3IXQA 3Q0WA 4I99A 3MFYA 3VO1A 3HN7A 1O77A 1PZFA 4W1QA 4D5CA 3S1QJ 1V7PC 2Y93A 4ZA2A 1P8JA 3QF4A 3GFQA 4PRZA 1HDYA 4Q7KA 3ELBA 1CWUA 4KMUX 2AI1A 2GSWA 4XQ9A 4WZAB 2HJRA 1WJGA 1LJ9A 4ZVQA 3TSZA 3SYRA 4GL2A 3HVJA 4MKZA 1GOTA 1AVTA 4KN9S 3D9QX 4HAUA 3Q7TA 4X3PA 3FCOA 2XAQA 1ST2A 4IIEA 4OIFA 3VPXA 4IXAA 1AZSC 3BJZA 2A1TR 1Q44A 1I6XA 2I55A 2IL1A 4M4SA 3DVAA 721PA 5DBHX 1KO1A 4PONA 1G5QA 4WLEA 3SS7X 1BYUA 3OVMA 4LJ6A 4YCBA 1QAMA 2NPIA 2Z8YM 3DXZA 3F5MA 4ZVMA 1HUQA 3LYAA 2C54A 1K27A 2FQ1A 1TQIA 1JE8A 3IX7A 5JJLA 5ICSA 2BDEA 2C8JA 3GGOA 2RFLA 4KXUA 3W3CA 2OXIA 5FAKA 3F5FA 2PZBA 1U3DA 2F3UA 4MQVA 3OCXA 5GQSA 5A6VA 1VPVA 5C8XA 4GPBA 1D5CA 4QQFA 5K6AA 1K7FB 2PK3A 4FMCB 4M0CA 4MUBA 4YH1A 4H3VA 3DV8A 2E2WA 2EJBA 2FDRA 4ZREA 3WLPA 4CKBB 3FOFC 3SR3A 2GKOA 1MW7A 4EM2A 3OX4A 2OJED 3A14A 1H0MA 1QK5A 3MUNA 4K7JA 5BQFA 2CL5A 5IEBA 2IVMA 5BV0A 1GQSA 3BCSA 3WQQA 3AU8A 3ISTA 3RTRA 1TZBA 4N0EA 1RXIA 2D5BA 3BP8A 3GEMA 4BB5A 1ZG5A 3BOSA 4C0KA 3GR6A 3QEKA 3LYHA 1N7HA 4G1FA 2ZYTX 2AWOA 2P68A 4DR4B 2QD1A 5F0FA 2GEDA 3CJTA 2AG8A 4AYTA 5ADHA 3WRXA 2KT0A 2XBMA 1Y5MA 3S8MA 1E2HA 4DUGD 4RKFA 1ESNA 3WLNA 4TSRA 3KZXA 1H5QA 4DWOA 1DRUA 4B3XA 3BZUA 4RGVA 1EU1A 2VJIA 4YB8A 5FL3A 5DHAA 4ZZDA 2ZBPA 2EFQA 3WJ1A 4F4UA 2YXLA 3L04A 2WPDD 3RF7A 1R8JA 1ZELA 2ZKZA 1L1QA 2EL7A 1I4LD 3T0IA 5JS6A 4LV5B 3TDZC 3LY9A 3NPMA 2BM9A 1N57A 5JZVA 1SUDA 3PSIA 4RF3A 3N74A 3H9JA 4MWCA 3FKIJ 4Q1BA 1EG7A 4C9YA 5SV2A 2Y76A 2IHNA 4NXNB 3EEBA 2XHEA 1E2GA 3RLFA 2XGGA 1H8HD 3BROA 3QP6A 5FPSA 5GJWC 1GDTA 3EIQA 1RLUA 2WYIA 1ODFA 1XRQA 2ENUA 4DUPA 4J6EA 3DTKA 3T3OA 5ERIA 2W4IA 3D4LA 3JW8A 4DR7B 2NZVG 4E2FA 3U56A 3CTMA 3JYOA 1Y37A 4O4HB 2PZLA 3W4KA 3OIDA 1HKHA 3HB9A 1J5YA 1NZFA 1S3FA 1JEQB 2CXHA 4G84A 4ZRMA 1AHPA 3P4UA 2GVDC 3FB4A 2C3OA 3ITEA 3OA0A 2I10A 4ZHSA 2E35A 2VJQA 4BFYA 1RWBA 3WIBA 3VRHA 3W9UA 2J48A 1TD1A 4CICA 4UDNA 5IX8A 3ND9A 3DAFA 3HUUA 1WB6A 3L6EA 5IW8A 5JNUA 5ILOA 2FB9A 2XZTA 2BUAA 3LHKA 5HKLA 1BG6A 3K1NA 4KPYA 1VHJA 1CLUA 1YZGA 3C24A 3ZIUA 2WAAA 3RS9A 4N4NB 1L4UA 2YXPX 2O14A 2XASA 4TZTA 1WUTA 4W1PA 5JARA 1YA8A 4DLTA 3JZIA 3D1JA 4JYBA 3OIPA 2AZMA 2IZ1A 3N8DA 4YFVA 3CYFA 4BX0A 3IP4B 2D59A 4F2HA 1WUIS 3K6KA 4DUZB 4CZCA 4DKJA 1FY2A 3W1EA 3ROQA 2DBQA 4WN3A 3K1MA 1X86B 1WUHS 3M1EA 2PR7A 1NP3A 2G36A 2PU5A 2XXBA 4RANA 3IP1A 2AF3C 1XD8A 4GQIA 5FFNA 5HMLA 4A5SA 5LOVF 1A96A 2YQZA 4HGOA 3ZVKA 4FINA 4V0LA 4I4NA 1AKEA 2YRWA 1Q74A 3C6MA 3EDCA 1RXCA 5LKRA 3ZE8A 3KDAA 1TEXA 1X7XB 2RGWA 2YYYA 3OQ1A 3GMEA 1U80A 3PJGA 4PFKA 4DDUA 5CA1B 4YELA 1A76A 1P2GA 1RHQA 2RAEA 2OO5A 2RHTA 2VT6A 3PYLA 2FFAA 5EE1A 3GLGE 3O8GA 2J5OA 1GT91 1VB5A 2V4MA 2FLVA 5DGIA 1A97A 3HWWA 1VJ5A 2OYSA 1ZU5A 4KAFA 4R6WA 2IRWA 2I33A 1ISHA 2P9YA 1IG0A 2HIMA 1NBIA 2YXEA 2A5LA 4UU1A 1XTAA 1NC3A 2D8MA 1W7PA 5AM5A 1L4LA 2ZREA 3KUUA 2WD9A 4XLHA 1O3YA 3WGHA 3WTWC 1TOAA 2VYNA 2PAFA 2ZBFA 2P67A 1BHO1 1QIGA 2W4QA 4HB0A 4UATA 4C0JA 1NONA 1IIBA 1OF1A 4URVR 4OGGA 4G0PA 1K6MA 3HRUA 2EIHA 1R15A 2W37A 1SR8A 3QEMB 1YE8A 3OURA 4FSXA 4GBGA 4JA2A 2V0CA 4JWTA 4PG6A 5HKBA 2PANA 1DIOB 1N2JA 2VVTA 3OT1B 4YXWD 1FSGA 4KN4X 1C4OA 1F38A 3KQTA 3ZKAA 1G16A 1YBMA 3G9QA 3HDDA 1LV8A 3N75A 3IOMA 4B5LA 1Z7WA 4NPAA 4BDTA 5H80A 1P3Y1 3RV4A 3VTFA 1XGKA 3ZNNA 1KSJA 2EG5A 3V00A 4EFMA 3H0GJ 1TAQA 1EINA 3FLAA 4JQYA 4CM8B 3Q9UA 4DL9A 4LZWA 1TUBA 3HJBA 1G3QA 4XUEA 1QFSA 4JBYA 5WRFA 4CKEB 4EUSA 4QVKA 4A0RA 1JEDA 2QTTA 3R09A 5E17F 2L3DA 1YI8A 1M72A 4JB8A 1P9OA 1SCKA 3HNPA 4IKPA 3VH2A 2OXRA 3PB3A 3RUHA 4A5OA 3LA3A 3GBVA 4WADA 1GTSA 1W5FA 2QKYA 4RZ3A 1G20B 3IP8A 5BWOA 2AK2A 1A95A 2GEKA 2X0NA 4EVRA 5JMOA 3IAS6 1G9SA 4N6NA 1DBSA 2ORWA 1Q16A 2UZIR 3IQHX 4UU8A 4NF2A 4ZVUA 4KT5C 1UKAA 1YRAA 1JKMA 2CEKA 2VYND 5JHFA 3S2HJ 3RC7A 1X1AA 2FHSA 2QRUA 5F1RA 1VE9A 4MUKA 4CIDA 3HUDA 3PQEA 3Q8KA 5IT3A 1LPBB 3LKZA 4N40A 1RKWA 2GA9A 2PMWB 2ZEJA 5COQA 5SYMA 3SS8A 3NQOA 2QQAA 4MRRA 2VT3A 1NLFA 1O7JA 4PZJA 1Y82A 2GHRA 2HCRA 2WE8A 4F6RB 4RM3A 1RKXA 5EY5B 3S2IA 4AWXA 3ZPXA 5JNSA 1E0SA 1PLKA 5GPCA 4E14A 5EZ6B 2R4TA 1XTPA 2P5SA 1FTWA 2WSMA 5ESWA 5SICE 4C78A 4ETMA 3EEFA 3PYMA 2JEZA 2BR3A 2H3EA 4MLCA 4XOUA 3BSSA 1OGJA 1RLTA 1GPAA 1UBLS 2OD2A 4YJKA 2RAUA 3VZSA 2HHLA 4ZHQB 5B3JC 3LCUA 4Z9YA 1R64A 1VBFA 2QRVB 1JMYA 2A5WA 5DNEA 5ITZB 5JC1A 3ASOH 4I1PA 4KA4A 3I58A 2BFOA 3PG5A 4U7FA 4LQDA 5D51S 3WKAA 5HNKA 1YQWA 2P0AA 3QUCA 4JBWA 3UK2A 4PCUA 1VJDA 2F3RA 2GAAA 2CBXA 2I76A 3G2KA 4A23A 1IHOA 4A91A 4BEBA 5JMPA 1LFBA 1ZNQO 1DSSG 1EI9A 2WWTA 4YIHA 4C4SA 2EFGA 1FYEA 3KP6A 2L9RA 4ESBA 4B3JA 1OR8A 3LP5A 1S9HA 1MU0A 4FOLA 4A6DA 1E61A 1UJBA 3BIFA 3GAFA 4J7UA 4YEJA 3JQ9C 2LIPA 4QBGB 1EDZA 2FX2A 4JC5A 4DJ5X 3W8NA 1HW5A 4ASUD 1BMDA 1CYDA 1V8ZA 3SC3A 4BYGA 6YASA 1QHIA 1HTBA 1UMKA 2NUBA 4QLCU 1UF9A 2PXCA 1CE8B 3M6UA 2W1OA 4OREX 1RJGA 1Z0DA 5EZSA 1OCCH 4GCVA 2BR4A 4J0GA 1H93A 2WE7A 4LE2A 1I5ZA 3ZHXA 4FJ2A 5TQ2B 4D82A 4IO9F 2IPLA 2ODBA 3IDAA 1ECBA 1R7JA 4YPFA 4ARZA 4YMHA 2Z1MA 1E9FA 3T15A 4YP6A 2XYRA 4NG4A 3W5IA 3ESXA 1SU4A 3Q7PA 1KJYA 4LK1F 2EFPA 3BULA 2WHEA 3GNSA 4KSCA 2LRHA 3RLIA 3VISA 1UKEA 3AUJB 4MP3A 1NOJA 2E60A 1H2YA 2HO5A 3LXRA 2K7FA 1W8DA 3BXFA 4XR4A 3MEQA 1W46A 3GUDA 3TBFA 4M9XA 3HKBB 3K5PA 3EMVA 3Q4GA 5LOVA 1P74A 3O21A 2EB7A 3ZLJA 1FSFA 1WFXA 4B83A 1X1EA 2BFDA 1T1SA 2EEPA 5J1RA 1YJWI 2OCLA 2WI8A 3CLRD 1P73A 1WEHA 3AHEA 1QGYA 1QTRA 1PYVA 1T25A 2FD5A 1CX9B 3PFBA 2GBYA 1HDDC 2BSXA 3EULA 4KE8A 4PSUA 5K3CA 2G6BA 4LAFA 1D0XA 4PZ9A 4JT8A 5KQRA 1GO2A 1JBQA 3ZWDA 5CEFA 1Y63A 2GJSA 4AKHA 1VQMI 4IIJA 4PGHA 4FFLA 2K9QA 1DQPA 2EJVA 2RDPA 1ZMTA 5KJ6A 2BHZA 1FYKA 3ADPA 3IPAA 1A5BB 3RROA 1OHHD 3ZU5A 5K5EA 2V54A 1TJPB 1DBQA 4OMUA 3CZ4A 1DIRA 4C2TA 4OYYA 3WX0A 4K87A 3D5EA 4KSYA 3DLHA 3D7SA 4X3CA 2DTDA 1C9DB 3PJDA 2PLWA 4TLMB 1NYLA 5CVUA 2ZATA 3R6WA 1BW9A 4JL6A 1JNYA 2ZSFA 2C03A 1E1CB 4N54A 1PUXA 4BGEA 1U3TA 4I4TA 4JH0A 4YMWA 4KIGA 4AKTA 3FMQA 1E2PA 1V54H 1MP0A 1PNQA 4QODA 5CLQA 4CDRA 2BBTA 1WXIA 3C43A 2WF9A 3IVXA 4S3MA 5LLSA 3IHKA 3MS7A 2PMEA 5EG0A 2WSSD 1N5JA 1L9KA 1WW8A 1ONBA 1YR7A 3LBHA 1B4DA 2XRLA 3MTEA 4TMWA 3T3GA 3H9EO 4OXNA 4Z9XA 2OUKA 3KETA 1O94C 1Q7GA 4GR9A 4YG2F 5B1DA 4TTIA 3S7TA 3PPWA 3VPHA 5IDXA 5B1EA 1FVFA 4YIIA 4IX1A 4LFAB 3I3LA 2AK3A 2O8CB 4IQ8A 3UCXA 3QPLA 1DVRA 2A6EF 2HTSA 3HVIA 5TJHA 2BF4A 4DBLE 1VLZA 2R84A 2YPRA 1BOOA 1IUNA 1SC4A 1E3TA 2JLCA 1NJ2A 1Y6QA 2GVNA 4UUQA 1THTA 2QVGA 4WVLA 2DMPA 3O6BB 4N9HA 1A9ZA 4WK2B 5DBEX 4CUZA 5A5EA 3TLKA 1KE1A 2I2CA 1H9GA 1KVQA 1ZOOA 1RQNA 2NTNA 2VLIA 2KBFA 3S2SA 2VF5X 1B6AA 2FPXA 1P7JA 1RPWA 3H3VK 1AU9A 3I55I 1T13A 1TT7A 2JC3A 2LP4Y 4JLPA 1K7XB 4QDTA 5HW0A 1NLUA 3BDVA 2X40A 4BFXA 5EHIA 1Z8DA 3KKEA 3C3XA 1KR5A 1JTEA 2OGUA 4HMPA 4M1OA 4H0EA 3BTUA 3VU3A 5MF6A 4MR7A 1A0OA 4MWDA 2IT1A 3WQHA 4EB6B 3ODGA 1JFRA 1XLWA 3PE3A 1MVLA 3Q6IA 1W0JD 1BE6A 1KYTA 2WZCA 3N1UA 3VDXA 1MOPA 4DSNA 3Q0EA 2R0QC 2PFKA 4S1PA 2H2FA 3DYBA 1BYIA 5LNK6 5EIOA 1S1CA 2BJVA 3QH4A 3E23A 3PPIA 4KDFA 2PG3A 3DPIA 1APBA 1QRDA 4PY2A 4WAUA 2PRJA 2X8JA 3PR2B 1T9GR 1KP3A 5DM0A 5FFMA 1ERDA 1FFXA 4YT4A 1TEHA 5DUKA 1XDZA 2G07A 2PWYA 3F7OA 4R2IA 4EG7A 2DUMA 2FUG2 5C53B 2JGFA 2Z5LA 2GERA 4BLWA 5ICEA 4V0KA 3ONDA 1YO5C 2VNJA 1O54A 1U9JA 3HM5A 2BELA 2VHVA 3FM5A 1MJHA 4CMEA 2R7RA 4UV8A 2P7IA 2YTZA 2BY4A 5DM1A 1FRNA 3ORYA 4ZC8A 3ZN1A 3QWLA 1GVHA 2WVHA 1J0CA 2YY6A 2RGDA 3Q3GE 1YTLA 4JX6A 1H2HA 2ZJZA 3J7ZI 2X42A 4JODA 1QVVA 4U2EA 4KFCA 4FHEA 1KU2A 2MSYA 1OX6A 3HR8A 3BR5A 1PP7U 3B1FA 2CDRA 3ORFA 4WOKA 4OXRA 4AO8A 4B7ZA 3R3WA 4HX2A 3GQVA 2QF7A 3L6RA 3OJCA 2V7EA 4MWZA 5ED4A 2EHJA 5I5GA 1UAYA 4BMNA 3OQVA 4ZARA 3PKJA 4BLRA 5JS8A 3AESA 1LS1A 3AL3A 4IDCA 2K87A 3VJRA 3FHNA 7ADHA 5BPFA 1VBNA 3CRMA 3DFMA 3P9RA 3QX8A 4OFZA 4JY7A 2XCUA 1U28C 4FT8A 3DHWC 2IU0A 4AXXA 1ZGAA 5JZOA 3ERED 3CLSD 4JGGA 4U0WA 1ODDA 2AR0A 1RACA 4G4SO 4QOSA 5F5NA 3HKZN 1BX1A 2BSAA 5A2QZ 3PHLA 4ZT4A 1KO7A 4JX8A 3SHQA 3K1PA 2J3JA 4BJ5C 3GUCA 4UHJA 3V3TA 2EQRA 4F8YA 4YAEA 2JASA 4XGKA 5HUQA 1HKSA 3O4RA 4LC9A 4JFAA 1OYIA 2WJIA 3UTDA 5IF9A 4MQ9F 3PD0A 3PIRA 4LYDA 1ORWA 1U5TB 4RVUA 5DOZA 4EJSC 2AFIA 3O8LA 4IHAA 1HXHA 4WNAB 1GD1O 2GCEA 3FF4A 1BMTA 3ZQCA 3PC8A 4WK4B 4UQLA 1ZM3A 1KO5A 1QRRA 1KEVA 1UXJA 3KHSA 4ZO7A 2DPGA 4BBPA 5KTOA 4IICA 2OUIA 4N76A 4AMVA 3ANNA 4A2WA 1GAXA 1YDFA 1P4GA 1WXWA 1D7AA 1FP2A 3LRXA 3CCEI 2XYGA 1ZREA 1V9LA 1H6DA 3PFIA 1GTZA 3JZMA 4DPKA 3JQBA 4WFQA 4Y2PA 3DTIA 2RHGB 2I66A 2IU6A 1L7RA 2YC2C 3ACDA 2GCOB 3A1EA 3DDWA 2OBBA 3JV7A 2LCFA 4R83A 3TB6A 2F1HA 1F5TA 1ML3A 1IYZA 1QIEA 1DL5A 3IKVA 4KN7X 3KTFA 1PWHA 3N0XA 121PA 4IDPA 4QOIA 2Z2ZA 4J3NA 2F2TA 1YHZA 1U0NA 2XOEA 5L3CA 2QRLA 2YQ4A 4OJMX 1Q1BA 4R2XA 1I3AA 5AVSA 5LL6P 2CT8A 2AVNA 5FDFA 4CQJA 3KIPA 3O7MA 1MJ5A 4DR3B 5DOVA 3RT1A 5E6UB 1ANKA 2POQX 2RIPA 1VA4A 1QG6A 3CZAA 1NVAA 3DNMA 1KI9A 5CFLA 4MNTA 4NBKA 3LCVB 3PQJA 3GJ7A 5EJ4A 3KWMA 3DLLF 1EA7A 2A84A 3DLIA 1PFVA 3FZNA 5AVOA 2XUGA 2DH5A 3H1TA 3WHIA 1QGAA 2WM3A 2OHGA 2K40A 1QHNA 3R0IA 4L22A 4DWJA 4URXR 1YR9A 2IW3A 4J43A 4MDEA 4FX4A 1FFBA 1SZCA 2YW2A 4G5OA 3S28A 4AD9A 1JXAA 4XWTA 1AS2A 4AYWA 1EBUA 2WY8Q 2J07A 3R74A 3EGXB 4PTYA 3DWIA 3VSCA 1E20A 5DMHA 2ZTLA 4YJGB 4AUMA 5AM1A 2XV1A 3PVCA 5K0NA 3QM1A 3GJ0A 1USVA 1SANA 1Z9BA 2QQ5A 1U0LA 3HYLA 3ISJA 4XM3A 5KOIA 2P2LA 5J6XA 4WCFB 2I91A 4CIAA 4CGZA 2CJWA 3T3PB 2F5VA 2YZMA 1HLVA 2HBQA 3G6WA 1XGNA 4DM7A 4IX7A 4AK9A 5HFNA 1Z73A 3MMYB 1H66A 1N7GA 2VKTA 1ZD8A 2CB9A 3A2MA 1PEKE 1BX0A 3C7AA 3CF0A 4O2LA 2GRJA 2RJOA 3IBGA 1TD9A 1KA8A 4Z9AA 4KR3A 1Z4MA 1BWRA 1YL5A 3QXCA 4RLQA 3A1UA 3CR7A 3BF7A 1W94A 3A04A 4KITB 3CV3A 4DRXB 4GYJA 1JWLA 1LBSA 3N2GB 2D0PB 2CK3D 3L7CA 1OUMA 2BCEA 2VHWA 1NH3A 2PFSA 3LUBA 1FIUA 2VHZA 1XF1A 1VG1A 4W8HA 4ACAA 4CF5A 4DC1A 1XZCA 2MDTA 2NACA 1U04A 3KC2A 4I08A 5TY0A 4BO5A 4DYVA 1D8KA 4QUEA 2R87A 3H1GA 3KSUA 2KRCA 3M9LA 4EFLA 3DEZA 4OQ4A 5K3AA 2O0JA 4J29A 5CHYA 4CYMA 2YFYA 3PVZA 4RD2A 4B2IA 5J4VA 2AOUA 4REQB 5H6QA 2VSQA 2P90A 3F2IA 4IFBA 5LJLA 2HV8A 2FGKA 4JL5A 4B3GA 3IH2A 1GNRA 1SXGA 1Q7EA 3LGAA 3Q40A 4OJYA 4XQ0A 5CT5A 4EKDA 2LBPA 3E97A 1K7AA 3O5AA 4RESA 3TJMA 1TNDA 1E69A 3CCYA 2M32A 5T3YA 1XDSA 1QX3A 4OYLA 1XBTA 5IDQA 1FJXA 4HZUA 3WDMA 1YOVB 2AG1A 5JZ9A 1PQPA 1KJ9A 4GI3A 3ICVA 1JPJA 3H4MA 4MS4A 1ZVMA 3DMTC 5LGTA 1HMYA 4RB2C 4PPFA 2R5YB 4HVCA 1GV2A 2R7WA 2BFCA 3AB3A 2C94A 4KQ6A 1QP0A 1YG2A 1SU6A 3BBLA 1QZEA 9MHTA 4JSRA 1ONPA 2ZSBA 1V35A 3T8RA 2CMFA 2W98A 3G0GA 3GN1A 2JI8A 5HQJA 5ERYA 3N4MA 1MBFA 2FEXA 3AIIA 4EI2A 2GZAA 3HWSA 4B33A 2HEOA 5DGCA 4D9BA 2XNCA 3O8DA 5CMLA 1N8KA 2O2JA 1V6AA 3ROGA 5GMOA 5BN5B 3EQZA 2LP0A 5K3SA 3U9TA 3TDMA 4ZCTA 4WZAA 2KP6A 3UENA 2J3QA 1SQ6A 1U65A 3FDFA 5EAIA 4COKA 3B6JA 4I1IA 2EQAA 1WDKA 5SZKB 4ZOLF 2A1IA 2NSJA 3ZWQA 1DBWA 2BGJA 1U3UA 2EBFX 4N12A 1JQJC 3DMPA 2IEYA 4BPBA 2UYOA 3ZWCA 3KZOA 3PTZA 2Q5JA 4EBFA 5J3JA 1OBCA 4DA6A 4OGFA 5J1UA 1KXJA 3EQ8A 3RTEA 3STWA 1WQ2A 4ZKDA 1AH2A 5D5UB 1X7YA 2Y0BA 4G67A 2RC6A 4IHVA 3OCYA 1P4SA 1W87A 3N7UA 2R1TB 2IJLA 1G5FA 2V4ZA 2Y1DA 3TTVA 3V2IA 3X0DA 2QSJA 5EUBA 2CUFA 3HN2A 3STTA 2AFRA 3HWX1 3ZQUA 3EFOB 3ZI7A 2AFIE 2HN9A 3DE3X 4E7JA 1F4KA 4G1MB 3G2JA 3JAWA 3AF1A 4D97A 3FPJA 3K9NA 2E2JJ 2O54A 2P6OA 2NTJA 4U1RA 4Y1EA 3QOEA 5K45A 3LC0A 2EFCB 4MMXB 1FYLA 3BREA 2CSXA 2M6SA 2Q7OE 4B45A 3C5VA 3JTHA 1MQ9A 4D43A 1XTJA 5A3VA 3UBTA 3T9EA 3OYHA 1VE1A 2LBFB 1V7QA 4TKVB 4DN6A 2Y8EA 2HMVA 3SEFA 3PUFA 2CXSA 3VDMA 3NJ4A 2TMYA 3PTAA 1MAUA 1CPYA 1H6BA 1S8OA 3SVLA 1J0BA 3X2QH 3MQ2A 3E1GA 1TAUA 4X5OA 3O90A 3OZXA 3Q3HA 2NU6A 5DCWA 2WILA 4TYPA 3THYB 3AF4A 3EISA 3QIAA 3R3UA 4YRCA 4BNZA 3PA8A 2AIRA 3K72B 4LMAA 3OSZA 3X1JA 5KB3A 1GYRA 4UU0A 3JVIA 4DXDA 1WXDA 5AHRA 1R0CA 3GN2A 2MA3A 1E9BA 4W5WA 2FKAA 4MW4A 1Z0XA 3THSA 2AR7A 2B2NA 3FPEA 1MJ9A 3TS1A 4J16C 3CURA 3V7YA 4CKWB 1UL1X 2O3SA 1EGQA 2WIKA 2OAEA 1GKYA 1TIBA 2AG5A 5AQEA 1F2UB 4ODIA 1RFGE 3ZNOA 4XBFA 1ZGCA 2I3DA 2R00A 2K5UA 3KZCA 3LOPA 4WCFC 4UBOA 1N7IA 1YZLA 1XMSA 1PV1A 3MXOA 3NM5A 1T8YA 2AG0A 3UT6A 2RI1A 4ON9A 3WZMA 1B1BA 1A7UA 1OPRA 2P8JA 3LFTA 3MTJA 3SBEA 1XVTA 5CAEA 1YQGA 5IZ4A 3R44A 1ZC3A 3BICA 5A3RA 1NM5A 4R7GA 5K1ZA 3ZD7A 1NKVA 2VUUA 2QV0A 3V4PB 4NKRA 2O2CA