2M0MA

Structural characterization of minor ampullate spidroin domains and their distinct roles in fibroin solubility and fiber formation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
107
structure length
107
Chain Sequence
VGTTVASTTSRLSTAEASSRISTAASTLVSGGYLNTAALPSVIADLFAQVGASSPGVSDSEVLIQVLLEIVSSLIHILSSSSVGQVDFSSVGSSAAAVGQSMQVVMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor ampullate fibroin 1
publication title Structural characterization of minor ampullate spidroin domains and their distinct roles in fibroin solubility and fiber formation
pubmed doi rcsb
source organism Nephila antipodiana
molecule tags Protein fibril
total genus 36
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m0mA00
2MABA 2KHMA 2K3PA 2M0MA 2MFZA
chains in the Genus database with same CATH superfamily
1HA8A 1AU7A 2VT3A 3ZMDA 2EILH 3CCJI 1PP7U 1PUFA 2NVQJ 4HV5A 1XGMA 1R5ID 3RPQA 5GAHJ 4AIKA 4C2UA 1A04A 2R5ZA 1MH4A 3DTIA 1A35A 1P9QC 2MA3A 4F93B 5LFAA 5E3MA 2DQLA 2RQPA 4UUSB 4JX6A 4CCMA 4XLEA 3OYLA 4IQJA 1VNDA 3RKYA 4I0AA 1S3JA 2LF7A 2X51A 3L2QA 4NC8A 1R5GA 3O8GA 4CH7A 1O3TA 2K27A 3JAMZ 2QQBA 3ZMSA 1KU2A 3ABTA 3PNYA 3BT9A 2OTJI 1OCRH 2MG4A 1KYWA 2E2HJ 3H92A 2VQLA 2R7VA 3CDHA 3P9CA 3LAJA 5LGNA 1OCPA 5D5WB 2L9RA 1HXDA 3M3YJ 1N78A 4FETA 4NNJA 1LEAA 3L7WA 4EM0B 3RQ4A 2DA4A 4I98B 1KU7A 2EINH 2E5NA 2CJJA 3MEXA 1ZREA 2NNYA 2D1HA 3R4KA 3DLAA 3BR0A 2HXIA 2ETHA 4D1QA 3L00A 3F72A 2CV0A 1ON2A 4O3MA 4LLGF 1QPIA 2VPRA 5FRNA 2VKHA 4IZZA 3KYLA 2G7HA 3S8PA 3ERED 4ENMA 2GA2A 1ONVA 2X6WA 5DUKA 1XTAA 3HYIA 2IGMA 4FASD 1FIPA 1VQ8I 3PNVA 5DS9A 4DBRA 4B48A 4MTDA 4NB5A 2XV4S 4U0YA 4A3MJ 1ZGWA 3Q9VA 1BR4A 2V7FA 4AIDA 5HLGA 2QZ8A 2VKDA 5F04A 1T38A 2CUEA 2E1MC 2A05A 4MEYF 2VN2A 4M9ZA 4BJ6C 2EFPA 3BR1A 3MKYB 2VOPA 2BY1A 2X6XA 3G1MA 2K3FA 4KUMA 5J8CA 1FOWA 3CMAI 3H9GA 2XAFA 4DNCA 2TDXA 2DW4A 2Y69H 4MFDA 2LKPA 5AIQA 4RMNA 3QP5A 2DI3A 4DBQA 4BXFA 2Z1DA 5B66C 4AYBN 4M6YA 2K9MA 4BGDA 3ZXSA 1TWGJ 4QSHA 5LEKA 5FLXZ 1SFOJ 3DPUA 3OL3A 1T56A 2W4SA 3ERMA 1YO5C 1R23A 1EF4A 2DOEA 4B3XA 3BQYA 2L7ZA 3TDUC 3GMEA 1FBQA 3FBIB 5K7ZA 2IVMA 3F6OA 4V19K 2E7XA 3A01A 3W6VA 2MH9A 1JXSA 3CJTB 1KU3A 4R8HA 3V7RA 2HKXA 4RLQA 1HKQA 4RLFA 3PO2J 2PFBA 2DMTA 4U0VA 1CF7B 2WB1A 1Z1DA 1YI2I 3FF5A 3OYFA 2PMZA 3WTXC 5FFZA 3KPHA 2I5UA 3M8JA 3EUHC 2LY9A 5E3OA 1YOVB 3JRCA 2DA3A 3LWFA 1ODDA 3A0HC 1HQCA 2X0LA 4MHGA 3CESA 2FXAA 4MIMA 5TISC 5ICEA 4KYWA 2K9SA 1J7KA 2WY8Q 3VYUB 3ZQFA 2VQGA 3IHUA 3OL4A 4AC0A 2A69F 3QP6A 3AL0C 2V1XA 1KA8A 4A93J 1BW6A 4CCKA 5J1RA 2IJLA 4IHWA 4A6DA 1B6AA 3K0LA 3CD6I 3QYBA 4YFNF 4HZFA 3H5NA 3HPGA 1WJFA 3LL7A 2CV2A 2CH0A 2K4BA 4I01A 4EJOA 3CMMA 4E4HA 4GYGA 2FOWA 2Z3YA 1FP1D 1D0YA 1W5SA 4BJ5C 3MAJA 3ZMVA 1PJRA 2GOMA 3SDGA 5CKTA 2VXZA 1SFKA 2QKLB 5B1AH 3F22A 3QU6A 2WBMA 4PJ0C 1B72B 4JBAA 4EJVA 2BW3A 5LGUA 3IL2A 2W84A 4ASNA 1XCVA 4IRGA 2W7NA 3OSGA 2RVCA 1T95A 1DQUA 2ID6A 3OYKA 4M3FA 4E7KA 2KRHA 4HNUA 2CW7A 1TWCJ 4D9JA 4BQQA 1B9MA 3ROUA 1OR7C 2VE8A 3G71I 4A3IJ 2R7XA 4E7LA 4FISA 5ERIA 1N77A 5IOZA 2FJ1A 4UVCA 2X6OA 4ZH4F 1SD4A 5FLXK 4BAYA 3CCRI 3BDDA 4GO1A 3RKWA 1YG2A 2KZVA 4D0PA 4A3LJ 3PSIA 4UB8C 2V79A 4BQAA 2R7UA 1YHQI 5JLWA 1MDMB 4XLPF 5EYRA 1YIOA 2GZWA 4WXDA 1WJCA 5HDGA 1MMAA 3VYRB 3MKZA 4CHUA 4FCYA 5L3EA 2FRHA 1VQKI 1P92A 4DYCA 1CGPA 1DGWY 1FT9A 3BCAA 3K1NA 4CCLA 4BY1J 5EEHA 1HBXG 4PFOA 1G59A 4H4KC 2COMA 4LK0F 1NTCA 3FISA 2V9KA 2HQRA 3FHNA 4L9TA 5LHGA 1AHDP 4M74A 3R61A 3U21A 5L3FA 1YS6A 5EEGA 1UFMA 4PUSA 2X1DA 5K5RA 3WHCA 1W0UA 5J6XA 1K4SA 1EKEA 3RKQA 2HU9A 1MNEA 3ZR8X 2WB1N 3BPVA 3IH3A 3FM3A 3ZQLA 4RA2A 2E5ZA 2K02A 1Q1HA 3RZDJ 1X3UA 3GFLA 3HPHA 1Y1WJ 4PCQA 1TT0A 2AS5F 4L0YB 3E1SA 1WSUA 3OS1A 2DODA 2BHZA 5B1BH 4E7HA 3CCVI 2B63J 2BOLA 3MZ8A 1UAAA 3ABKH 3SEQA 1ITYA 4L9NA 2DOAA 2F4OB 4M9SA 1HCRA 5DYMA 3IRRA 1USSA 1W7PB 3ZMTA 2LSOA 5HS9A 4Y17A 2K40A 2O5RA 3I55I 9ANTA 1T0FC 3CMEI 4PJNA 2EV5A 2P7CB 1POGA 2EWNA 2VASA 3ISPA 2E1NA 1FIAA 2Q0OA 3AG1H 4OAYA 2VQHA 4HX4A 1I1GA 1G3WA 4HLYA 4KFCA 4M3DA 3SYTA 5JVTA 2CQKA 4QIWN 2AXTC 4WX9A 3B6CA 2FE3A 3CUQB 5D5VB 2R5YB 4BQNA 2BBYA 2ZFUA 1ETWA 2ISYA 1Y6IA 1H9GA 2VE9A 2FUG2 3BWGA 3CCSI 5F0CA 1HSJA 1ZG1A 1QA6A 3OYNA 3TO7A 2LYCA 4EJWA 3LSRA 5TRDA 3C18A 2FF4A 1ETQA 3DCFA 1BI1A 3FMRA 3IKTA 3TGNA 3HDDA 3HM5A 3G1LA 4DQ2A 3GTGJ 3IUOA 1ZRDA 1X2NA 1XD7A 3K4MA 3VPRA 4EM2A 2X9DA 5IP9J 2DMUA 2LF8A 1B8IB 4MFEA 3I9V2 3FXQA 3AAFA 3S2HJ 4NC6A 5E8GA 2O0YA 2XVCA 2R7WA 1IW7F 2HPMA 5HODA 4II2A 1FTTA 3D5SC 3K1PA 2O6GE 4ESJA 1R6RA 1I39A 1YW7A 2Z2SB 4GCVA 3P9KA 4ZTJA 2L4MA 4XSZF 1HW2A 2I8DA 3K4BA 1MBGA 2R7RA 4F91B 1IN8A 2DT5A 3K4LA 2M2EA 3Q9SA 2F5FA 4R1HA 5M5WJ 2QLZA 3H3UA 4ESFA 2J5OA 2HNHA 3TW6A 5E8IA 1U78A 1FSHA 3AG3H 3BTCA 2A6HF 3CF2A 1PYVA 4AVZA 4D5FA 3LAPA 1F4KA 2TCTA 3HKZN 1A6IA 2Y0SN 1WFXA 5LHHA 3ZP5A 1CF7A 4D7NA 3GZNB 3ECOA 3AG4H 1KGSA 5HS8A 4G7HF 1P6RA 1H9TA 4MO7A 2IA1A 1D1AA 3KEYA 4G8XA 2GAUA 5K7FA 4HA8A 5A2QZ 4UB6C 1T39A 3CO7C 1K78A 3BG3A 1O7FA 4ANJA 1SVLA 4HSTA 3BJ6A 1GVJA 5E3LA 4XONA 3CCQI 3TBIA 5J1UA 2LREA 3TP3A 3IV5A 3BJOA 3CCEI 2CW0F 4HNVA 3HRSA 1WWXA 2MC3A 1LDKB 4LITA 3ZN1A 2DJNA 4A6EA 4CZCA 3RSNA 4I6ZA 2Y75A 3JREA 3FKJA 3LSTA 2DN0A 1AKHB 1HOMA 5KAIC 3BZKA 3S1RJ 4DYRA 5DD4A 3LSIA 1USTA 4N0BA 2EFQA 3HGGA 3TOAA 2PI0A 3DV8A 5FRMA 3FWEA 2L01A 3QOPA 1R1VA 2HKOA 1R4NB 3S16J 1F43A 1B72A 2P6SA 2PEXA 4NBQA 1LFUP 3ECHA 5ICFA 1P2FA 3LFKA 3AG2H 1MBJA 1LPQA 1WZ2A 1HW1A 4PFPA 3JTGA 1FYMA 2CFOA 3F8NA 4UUTA 1VQOI 3HOSA 1XDSA 3C3WA 3FMQA 3JRIA 1P4AA 1ZAOA 5JHUA 2R7DA 1WJEA 5J3LA 4HBLA 3A02A 2RAEA 1ETKA 4ESBA 2LP0A 2R0QC 5LEJA 3RPUD 1JT6A 2Y0MA 4HEA2 1RPWA 1QHGA 3F3XA 5CQEA 3NEUA 1OLTA 4RDUA 1MSFC 5DTDA 4X6AJ 3QU3A 1UJ8A 3VWBA 4RGXA 3HGYA 4QPQA 4RB3C 3CCUI 3D5LA 1BI0A 3LMMA 1YIJI 1U5TB 3BCBA 2ZNZA 1EV7A 4XQFA 3HOUJ 1GXPA 1IXRC 2Z99A 5GTHC 1Z7LA 4A5NA 2CGPA 4C9YA 5IYCJ 4LG0A 1IC8A 4IL6C 4UVAA 1DUXC 2D2WA 3COAC 1ZELA 2PJRB 2H1KA 2IGKA 2KIMA 5A2QK 2F5CA 1FEXA 2CU7A 2DTZA 2XF5A 4IKFA 2NS8A 2O61A 3CCYA 2Q2EB 4M3BA 3BG6A 3LA7A 1EJ9A 2Y2ZA 2JT1A 2VKEA 4F52A 1ZG5A 1IRZA 3OYGA 5TJJA 2WAQN 3WGGA 3HSFA 3G2BA 1JJ6C 3FIWA 1GUUA 5LLQA 2QBYB 2EIJH 3GTKJ 2CQQA 1OCOH 2R7SA 3L09A 2AXLA 3H0DA 1I3QJ 1UHMA 4YELA 4BL0B 1BIAA 3HUGB 1SMYF 1BL0A 4P1WA 2E60A 2KP6A 4XK4A 3I4MJ 3K7AJ 1U2WA 1DPRA 1W7PA 4E7ZA 3CMYA 3K2AA 2A07F 4YRVA 2OJED 1SD7A 1MNDA 4S05A 2ICWG 3I5UA 2MD5A 4MTEA 3ZPLA 3ZQQA 3K70D 3D1NI 3PJRA 1J0RA 1IDZA 1QZZA 1FBUA 2JPCA 2ZJQF 5LGTA 3GLLA 1ZARA 3I3LA 1TQMA 1MMSA 5EZHA 3GO5A 2JZYA 2R5YA 5K5QA 1RZ4A 2Q1ZB 2ZCWA 1ZTRA 1D8JA 3LA2A 4CYDA 1VZ0A 4S0HB 1WQ2A 3GF2A 3MMYB 2OZUA 1EH8A 2LMDA 2HXOA 4BQOA 2K7LA 3OYCA 2OPTA 1Y0NA 3LA3A 4PJJA 3T8TA 5CVIA 4OINF 4J01A 5GTIC 4X1EA 1WJDA 2IS1A 2M0MA 4QWQA 2ZJPF 2HQAA 2CYYA 2L5QA 5J40A 2M4KA 1S6LA 3AFHA 1B8IA 1XMXA 2DJIA 4H0EA 4CSWA 2H1LA 4IRIA 1S8NA 1I5ZA 3I4PA 2GXBA 1LB2A 3R0JA 4PJLA 3OS0A 4CO8A 1VF9A 4D5CA 4E7SA 3BG5A 4GGGA 3VYSB 5ICCA 4I0BA 3WODF 4PZJA 5D4RA 4LOCA 2BY3A 5DM6F 2ZXIA 3G1OA 1VQ5I 4MQVA 4AYBA 1XGSA 2DO7A 3M1EA 4BUPA 4KJZA 3ZQIA 3JCUC 5LBQA 2WY7Q 1IV6A 1X3WB 1Y1VJ 3VDXA 2HZDA 4ZDLA 4EGYA 4Q5SF 2PLYA 2DK8A 2M30A 1D0ZA 2QCOA 4QTRA 1JKRC 2F4IA 4FE4A 3KX2A 2H8RA 2M9HA 1Z0XA 3T5XA 1R49A 3MD2A 1S5LC 4UXNA 3VEPA 3RDIA 3OYMA 3WTYC 1S7AA 2KJCA 2XASA 3LSMA 1ZR4A 4EVIA 1GV2A 4P9FA 1Y8QB 2IPQX 5F1JA 2L02A 4RGUA 2X1EA 1D0XA 2DT6A 1OYWA 3LNQA 2JQ7A 5H2FC 1B9NA 2FNAA 4LGWA 1FJLA 1FBSA 2VBYA 3WU2C 5D8KB 3I0TA 1KQ9A 1QZYA 5L3CA 3LFUA 2HWVA 1G4DA 1P7JA 2XRLA 4N4NB 4ETSA 1ORKA 4LB5A 5C4XJ 4XOPA 5DCMB 2LRDA 3PNTA 4HW0A 2FD5A 5CVVA 4BHCA 5HVQC 2WTEA 3SFIA 4HG2A 3QRFF 2DTRA 4L18B 4RGRA 2L9VA 3AL0B 4J19A 3FXJA 3FXOA 4HSRA 1AOYA 2A61A 2DA2A 3E6DA 3FXRA 3OOUA 2V1NA 3HRTA 3ONQA 1W5CC 1FX7A 5K5OA 2J5PA 1RUOA 2VKVA 3S3MA 2GA1A 4M6VA 5EGOA 1JUPA 1R00A 2P5LC 3V8KA 3OIOA 2Y9ZA 1JGGA 1Z77A 4CYCA 3CF5F 1FOYA 1SAUA 2JA5J 2O9LA 4UUVA 3F9KA 4FTHA 3X2QH 1Z91A 1R71A 2GOXB 4IXAA 1KYZA 4LIUA 4OU0A 3TW7A 3OYJA 4I7HA 4YFXF 4OIPF 3HOZJ 1YJNI 5KAFC 1GHCA 3DFGA 3KP2A 2JMWA 4Z6YA 2AO9A 4V2FA 2XF6A 4XLNF 1T08B 2HVSA 4KISA 1X3ZB 1QU3A 4DZPA 2N8GA 3IP4B 3WU1B 4Q47A 4IF4A 1ZYRF 3OSFA 1RKTA 1X1BA 2HYGD 5HLHA 4YIFA 1BA5A 3FK6A 2LTPA 1OJLA 5F0FA 5JI6A 3FXLA 2JK3A 3G4SI 5HLTA 1WH7A 2O03A 5LD2C 1BIBA 3JRBA 2QSFX 4G6TB 5H6RA 3FXUA 1LKXA 5BNGA 3FXKA 5FKMA 5LHIA 1G3SA 4XN0A 1XSXA 5FKKA 4PGHA 2BHYA 3W6JB 2PMHA 1KQ8A 1WKMA 1HW5A 3DTKA 3K4NA 4NUBA 2ZKZA 3E6MA 1L0OC 3BG7A 3QPLA 2DA5A 1BR2A 3I58A 1X1CA 5DCFA 3JAMK 2NOJB 3HIFA 3N97A 1G6NA 4AVPA 3I59A 3QAHA 1A31A 3RZOJ 2PJRA 1MMGA 3IH4A 4JYKA 1OYYA 3ZMZA 1T2KA 2ZO4A 3WE3A 3A4CA 3HJEA 2M1BA 4BDZA 2VXDA 5J1YA 4LLLA 4L9JA 1DDNA 1MBKA 1YX3A 1I50J 3HG9A 5DUIA 1LE8B 5CVUA 4UHTA 1D8KA 3VODA 2X85A 3I4NJ 4BE1A 4M72A 2UXXA 4XNFA 2E71A 4V2GA 1OPCA 3FX3A 3ZQCA 2R93J 2VONA 5J4YA 3E6CC 4WCGA 1IXCA 2XROA 3HUGA 2XAQA 1XMAA 2CUJA 1FZPB 1TTYA 3WTVC 2H6BA 4A0ZA 3UNGC 2F2EA 2OQGA 5D5XB 2CUZA 4JQFA 2KJBA 2MGQA 2K9LA 1KONA 1RKWA 1KZHA 3LSKA 1V4RA 5IT3A 2DPUA 2EZIA 2P81A 3S32A 4KA4A 2VUMJ 2HYFA 3KYCB 1QNTA 4EGZA 4G94A 5F64A 3ZCOA 1OMIA 4U7BA 1SD5A 1UG0A 2B0LA 2MD0A 3K70C 1Z9CA 3M1CA 2ISZA 1O4XA 3GFMA 2RV8A 2IS2A 3REOA 4AWXB 4MGRA 3GLXA 2W24A 1IXSB 3FXMA 4NQWB 1Z3XA 3PQKA 1BM9A 1LNWA 3PM1A 3JRGA 5GPAA 1ENHA 5BOXA 5EDNA 2VJ5A 2XKOA 1I3AA 1W5TA 3MVPA 3I64A 1R9TJ 4KIGA 3KZIC 5D6FA 2LKXA 1WVRA 1V5GA 2EJRA 3IAM2 2HVQA 1TBXA 3WU0A 2R7QA 2HOEA 1BI2A 4M3EA 4IJAA 2H27A 4BEHB 4BXXJ 2QVOA 3S1QJ 2VOOA 1UG2A 4RAYA 5C44J 2IT0A 5BQTA 4HRIA 3K9TA 1BI3A 1TWAJ 2K9QA 2UWMA 3BR6A 4G12A 3F6VA 4WK8F 3HB9A 3HBLA 2LY2A 1N25A 5FKOA 3QODA 4UV9A 1HLVA 1ULYA 2JUCA 2V1DA 2XAUA 4GFBA 3J7AY 3S1NJ 1QQIA 1W1WE 2MW8A 3M07A 2DXIA 1HC8A 1ETXA 5ILUA 1S7OA 2Y30A 1FY7A 3HKZA 4UUSA 2Y0SA 2W00A 1XG1A 5HS7A 3E0JB 1RC9A 2HDDA 4CICA 1TP4A 1G3YA 3SFZA 3H5RA 4TV7A 2NVTJ 1QO0D 2HZTA 2KPMA 3W2AA 4LB6B 1YLFA 3DPLC 4ZYHA 1I6HJ 5HOOA 1JHFA 3OYEA 1QVTA 1BC7C 2DDAA 4HF1A 3ZOBA 3LSJA 2OD5A 2M34A 2VBZA 3NARA 2IS4A 2XPVA 4C2MJ 3SZTA 5EEAA 2A6TA 2CS3A 1R1TA 3L2CA 3DKYA 4PJMA 2IGOA 1WJAA 4OOIA 2D5VA 2QM3A 1T8IA 4U87A 3HOTA 5AIPA 1H89C 3GTOJ 5DCMA 1WI9A 3BR2A 2QEXI 3I56I 3OMYA 4LD5A 2E36A 1FMWA 2QWWA 3S2WA 3SXYA 2VB6A 4BKXA 1O3QA 1J9IA 3KE2A 1F9NA 3BZ6A 1ERDA 2HGCA 3JRFA 5BS6A 2KFDA 3TP0A 4A3DJ 1FPQA 3CDLA 5F08A 1HSTA 2G9WA 3SDBA 3GBGA 1NHAA 2QYOA 3H0GJ 2LVSA 2V9VA 4XKCA 1XSDA 3DEUA 4A0XA 3UR3C 2PG4A 1U3EM 1MNMC 1G8XA 2CV1A 1PUEE 1GLNA 3E5QA 3V8LA 1DP3A 1B1BA 2K3PA 1YJWI 3O3KA 3RYRA 3S1MJ 3QPHA 2EZHA 2P6TA 2IA0A 2W82A 3BP8A 3EQLF 3JRAA 1V54H 2YU9J 2O7OA 1J5YA 2JN6A 1OR7A 2L9NA 3GTQJ 1MMDA 2OBPA 2RKHA 2L3DA 2PBIA 4ZDPA 3KLOA 4OIRF 3J80Z 3KEQA 4N4OB 1A36A 2ME6A 2BV6A 3H35A 2GXGA 4RM2A 5ICGA 3OYHA 3L2UA 2XB0X 3CP2A 1OISA 3C1DA 3ULQB 4ON0A 2BE5F 1LDDA 4ABZA 4A3JJ 2DFEA 4DZJA 2DAOA 4KNYA 3E97A 5HDKA 1WH5A 3HRMA 3CP8A 2PQ8A 5FD5A 2QKMB 2STTA 5B5EC 2O8KA 4RAZA 1FLIA 2OCEA 2UV1A 2KHMA 2GIVA 1YW9A 5F0HA 1VQNI 2M7BA 4KIFA 4XIDA 4HQEA 4A3CJ 1DPUA 3CCLI 4XOTA 2OA4A 2W1OA 2GBYA 1DGRM 4M73A 2B9SA 3HSEA 2VBXA 3OV8A 2QA4I 1V5EA 4C3HJ 5GPCA 2XF7A 3MQ0A 3CC4I 1ZH5A 2VIXA 3SHFA 2YR2A 5IOYA 4ZDOA 2XC7A 1IRGA 2H8WA 4HDUA 1BW5A 1U0JA 4UVBA 4NHJA 5K7HA 2AQEA 2ESHA 1LE8A 4OMYA 3BPXA 3V8JA 2WAQA 2WWYA 4ENNA 4C3IJ 1IN6A 3TOBA 2PN6A 2XGXA 2ME0A 2VT2A 3H36A 1N75A 4XLAA 2OCCH 1IUYA 1LDJA 4B3AA 2IA2A 5CYVA 4B4CA 4BJTA 4IHYA 5J47A 4G6DA 3DBRB 3EUAA 3S93A 5L3BA 2F4MB 4RBOA 4IO9F 3GTLJ 1ZGAA 3PSFA 1JJ8C 1BBYA 1X4PA 1UELB 2HTJA 2EBIA 3C2HA 3TL4X 1R58A 4LG3A 1JI8A 1F1ZA 1X1AA 1IF1A 1DU0A 2XRNA 5E17F 3CJQB 1SFXA 2VBWA 2CG4A 4YIIA 4IEJA 4XMYA 4AD9A 3U2RA 4OMZA 3QWLA 2P5KA 5M5XJ 1TQIA 1PP8F 3FHZA 4HDVA 2FMYA 2M3AA 4J00A 2XSDC 3KP6A 1B59A 1XB4A 2QF7A 4IHTA 2Y48A 1NK3P 4B1RA 1IAWA 3A2KA 3A03A 3RQIA 4L0ZB 4ENKA 2ESNA 2EK5A 2M8GX 3IWZA 4XRSG 1FTZA 1JTYA 2MSYA 1TLHB 3ABUA 2VI6A 3HXLA 3M9AA 1HDPA 3L9FA 4NQWA 5JFRA 1FNNA 2DMPA 1U9OA 5BPDA 4A3KJ 2XAJA 2XPUA 3U9GA 1RR8C 3CUOA 1JUSA 4IOAF 1J75A 1BN5A 1TL8A 4E7IA 3K4JA 3NWSA 3HL2A 4R79A 1YFHA 1IN4A 3KEOA 1MIJA 3KP5A 1BC8C 1IV8A 2FX0A 2HQ5A 1K7AA 1MMNA 1XPXA 2VC0A 1W4MA 2GIZA 3IKVA 3MFKA 2E35A 4BDYA 2GLOA 2JSCA 3P9IA 2ZMEC 2I10A 4IRHA 4BEHA 3RYPA 4P96A 1MDMA 3OIQA 3W2VA 1PVEA 4BU2A 2B7EA 5CLSA 2LC2A 3BR5A 4BH9A 2KKOA 3ML6A 2XB5A 3KP7A 2FU4A 5FFXA 5M3MJ 4HQMA 2HVRA 5E18F 3G6EI 2KRFA 2AHQA 2KLOA 3HRUA 2VQCA 1HKSA 1PDNC 2JTVA 4AIHA 1OYIA 3FMSA 3HHHA 1MH3A 2JSPA 4L5EA 1EH7A 1FOXA 3PUFA 3DU5A 1IRXA 3PFIA 5D4SA 2XDVA 4CUGA 3CC7I 4B09A 3RCOA 4UNOA 1AWCA 3S15J 1K6YA 2GXAA 4L9VA 3HC7A 2G7UA 1UHSA 1V5FA 4RS8A 1T98A 4N9IA 2JPBA 3DP7A 1OKRA 1J2XA 4WWCA 4ZZLA 3CTAA 1S9HA 1O3SA 2NNNA 4BACA 2NS0A 2BYVE 2HOTA 2HOAA 2EZLA 3LSPA 4ITVA 3BTIA 3WHBA 3DBHB 3T8RA 1GVDA 1WGXA 3B6AA 1JKOC 1EH6A 1ZKGA 2LY1A 1G3TA 5KHDA 2MH2A 3CO6C 1VQ6I 2IGNA 3O8HA 2ZB9A 4XLCA 5L3GA 3GFJA 1NK2P 5IYDJ 4IVNA 4WXCA 2ZBKA 2DFIA 3Q5FA 1XC5A 3HOVJ 3CUQA 4HV6A 1LVAA 1MJAA 1ZHFA 3HSRA 3JSOA 2EPFA 2M4GA 3FZVA 1VQ4I 2Y9YA 2JRMA 3S3NA 3V7CA 3BTLA 4U7DA 4LK1F 1J59A 4A5MA 5FLVA 1E2XA 5AONA 2VPLA 3KP3A 3DXJF 2KISA 4RB2C 4B43A 3U1DA 1J09A 2KQRA 1V55H 3F0CA 2FQ4A 3MKLA 2UXNA 3F23A 5DV5A 2BW3B 2M5WA 2RNGA 2OV7A 4OAZA 2BXZA 3BY6A 4BBSJ 5LRRA 2RNJA 4PK4A 3LSGA 1S72I 2JA7J 2E34A 2VJIA 3BOQA 2E1MB 3JRHA 2DFFA 3HOYJ 3A1YA 3GWZA 3HOWJ 2LLKA 4KICA 4IOCF 4Y33A 4A3GJ 1A6QA 2DCEA 3NAUA 3WTSC 2EZKA 1WJ5A 3WG7H 1MBHA 4DOZA 5ILVA 3WTWC 1JGSA 2C6YA 3CLOA 3QYEA 2XHKA 1FYLA 4EEFG 2NVUB 3SEZA 3BR3A 4GDFA 1GV5A 1ZRFA 3BC8A 3H5AA 1JTXA 5FO5A 3OS2A 3BQZA 1O3RA 4ZYDA 2R4GA 3DQVC 4A3FJ 4IQ4A 1T6SA 1YRNB 2CO5A 3ZN0A 4F7ZA 3BJAA 2BZTA 1Z6TA 4A0YA 2TRTA 1HDDC 2FSWA 1H0MA 4MNUA 2DA1A 1OCCH 4ZYAA 4IX7A 1TW3A 4BNCA 5E3NA 4UY8I 4I76A 4RM3A 1MKMA 5GAEJ 3E7LA 2IAIA 5B3SH 4I2OA 4P55A 3TDZC 1ZG3A 2G0EA 4XLHA 1LJ9A 1FMVA 1S7EA 4A2UA 1R22A 5E79C 1FP2A 1QBJA 4PGGA 2JVHA 3KZYA 2WADA 2RGVA 4LJZF 5D5UB 3U1KA 3I53A 2KDZA 2CQNA 2BY0A 2DA6A 2LG4A 1R7JA 2Z33A 4IHXA 4IHSA 2XUBA 4ENJA 3CDIA 4I09A 3J7ZI 4M3GA 3EPZA 1X4OA 4HX7A 5GP9A 3TO6A 1QZEA 3JSPA 2EQRA 1Z3YA 4BXUA 3ABMH 4WF2A 2HDCA 3PO3J 1D5VA 4Z2YA 3QQAA 3TMOA 4M9XA 2IBDA 3CJNA 1KQ0A 3CLQA 3W6KB 1AKHA 2E2JJ 4A3BJ 4Q4ZF 2LKSA 2YSRA 4I99C 2JRTA 1VQ7I 2CSOA 2IW5A 4MLOA 2R7ZJ 2ECBA 4LFUA 4RB0A 4YG2F 2D1VA 3K10A 3N4MA 2WV1A 5M3FJ 2V6CA 4XRSA 4RB1A 3ZQGA 1SANA 1MJ9A 4NDLA 1K6OA 2KRCA 2E1OA 3WTTC 2PJPA 4L5IA 2M45A 2K4JA 2WC2A 4M6XA 2DYSH 3F8CA 2W48A 1REPC 1FOKA 3PL8A 2ZJ2A 1SFUA 3EYIA 3IWFA 2L54A 2GWRA 1VQLI 5ILSA 5IP7J 4Y13A 3GZ5A 2HDWA 4D7MA 2XSJC 1W36C 1ZLJA 1RR7A 2XPWA 5K1YA 2QQ8A 4XICA 2ELHA 2JA2A 3NWTA 1Y39A 2OF7A 5J8FA 5HDNA 3GTJJ 4W97A 1MD0A 3J7AO 5E20A 1U5TA 1UCRA 4U88A 4XKBA 4FE7A 4XL9A 3F21A 3FKIJ 3T0YA 2XAGA 5M5YJ 2EIMH 2JUGA 4GXOA 4P5OA 2HYJA 1ZRCA 2MABA 4KT6A 1TT5B 2QUFA 1U8BA 4Y52J 2CUFA 2W85A 5IP6A 1OCZH 2OU2A 3GX4X 2XGCA 3H9QA 2HPIA 1X19A 2R92J 4XLFA 4AUXA 2GM4A 1OFCX 3ABLH 1IUFA 1E3PA 2F5VA 1FYKA 2R7FA 4Q48A 2HS5A 5KVRA 3E3VA 1FC3A 1W0TA 2NXNB 3VSLA 4CGZA 1D5YA 2KIFA 2COBA 4G7OF 2Q2EA 1U6GA 3GTPJ 1IG7A 1ZN2A 1X1DA 4QPOA 3CCMI 1XS9A 4RGSA 3PUBA 1ZK8A 4KDPA 3F8BA 3OR1C 4B47A 2MLGA 2OC6A 1ETYA 3C2GA 2R7OA 2QBYA 1SMTA 4LLNA 4BBRJ 2CFXA 3K6GA 1WCMJ 2F5EA 2NOGA 3OR2C 2K86A 4CZZA 2VC1A 1D3YA 4L5JA 2V9PA 5C3EJ 1OQYA 5LRSA 1GT0C 1W7PD 1A5JA 1R5HA 1BJZA 1JKQC 2EV6A 3Q3SA 2NVXJ 4DW6A 3S17J 1AA7A 2WA0A 1VQ9I 4LMYA 2M8EA 4U0WA 1K78B 2E1CA 2LDUA 3O6BB 1NH3A 2X6YA 5JHFA 1QHHD 2NS7A 3JRDA 3V42A 4A12A 3BTJA 1JE8A 3H1CA 3HHGA 2X48A 3KCCA 2FBKA 4JX4A 1RESA 1QPMA 3VFZA 5E1WA 3B73A 3A0BC 4XKVA 1WJBA 1SAXA 3DBLB 3K4CA 5CQGA 3ASNH 3JR9A 1XDUA 2FA5A 2NRAC 3WTZA 4C2TA 3L2WA 4YIRX 2LFBA 1ON1A 2VL8A 3H3VK 2DYRH 3M4OJ 3WGIA 1TWFJ 3GYHX 2WV0A 4GRIA 4PSXA 4AU7A 2QGUA 5KCMA 3LOCA 3E6BA 2OZ6A 1ZQ3P 3DU6A 3EUKL 5FB2A 4EJTA 1GXQA 4P9UA 5BPIA 4G6QA 5DM7F 2X4HA 3MZYA 2NVYJ 3R6SA 3OYDA 5KK1A 4DYQA 1S29A 1IZ1A 2ZXWH 1P4XA 3NQOA 4DJAA 2DK5A 2KL4A 3EETA 3DKXA 3GFIA 1SVMA 2LBFB 4CXFA 5L3DA 4FQGA 1BOBA 3S14J 2BEOA 3FBNB 5EG0B 4EV0A 5GADJ 1TW2A 4Y7NJ 3SZGA 5CJ9A 2DPDA 2VLAA 1XCBA 3JW4A 4FX0A 5FKLA 3RJPA 2QQAA 1L3LA 1KU9A 1K83J 3RPUA 1LUJB 3WE2A 1STZA 1JT0A 3KZZA 1WI3A 3C7JA 3DKWA 5CVRA 3VSKA 2F6CA 2E19A 5DEQA 1XX5A 1U8RA 2XIGA 2DT7B 1IRFA 1YX5A 2ECCA 2Q8KA 3PIOF 1K61A 1YRNA 2L7KA 2OTLI 2ADUA 2R7TA 5FKNA 2E2IJ 2WAFA 5FJ8J 1SC7A 4KITB 4LG0B 2OAZA 2VODA 1XGOA 1LVKA 2EA4A 1JKPC 5H20A 3Q0VA 3CZ6A 2L7MP 2CQXA 2YS9A 1R1UA 1MBFA 4K2EA 3W2WA 3GCMA 4AM3A 4OIQF 3K4KA 2RC4A 4CCJA 4E7JA 2FBIA 3RTRA 3EUHA 2IEKA 1Z67A 3MKWB 2DFHA 4W1UA 2P5VA 1VQPI 2KZGA 1Y0UA 1YW8A 3KETA 1JUMA 2PMZN 4JK1X 3DEEA 1MSEC 3GVAA 4ZC3A 3E5XA 1ETOA 5ED4A 2BVLA 3PIPF 3R0AA 6PAXA 4BYYA 3PFYA 3TEDA 1ACIA 2JJ7A 1LEBA 4EM1A 1UB9A 2ID3A 3HEFA 2A5WA 4FHTA 2ACJA 1LFBA 2EFNA 2XGEA 4O5VA 5FD6A 3VYTB 3MCZA 4UV8A 3V7SA 2Z5UA 4S04A 3IC7A 2FNPA 2DMQA 3I54A 3ASOH 3BG9A 3GW2A 1IGNA 4IHVA 3IRQA 1G2HA 2VJJA 1T33A 1K4TA 4PSWA 3I71A 4II3A 2MFZA 1XGNA 1M1EB 5HLIA 3GUDA 2HQNA 2A6EF 1TNTA 4LIVA 1I6XA 2K85A 3ESWB 3TO9A 4XKWA 4HF2A 3E5UA 1I27A 2ZNYA 3Q0UA 2L0KA 1YYVA 5FGMA 3CQZJ 2KDOA 3OYBA 1MBEA 1RUNA 2ZXHA 3NRVA 2GQQA 1EA3A 3ZMUA 2H09A 4EATA 2K9NA 3QPTA 5DD8A 5F1RA 1HKTA 1IN7A 2STWA 1TQPA 3F8FA 2L2OA 3HTUA 2MC4A 4XRFA 2DLLA 5TGTA 4EMSA 2RDPA 1P7IA 1RETA 1TZLA 1K79A 3HOXJ 2QSGX 2DA7A 2A5YB 3MN2A 4XSXF 4Y3OA 1Y56A 2P7VB 3WG9A 1P4WA 2ZMEB 3S3OA 2KIUA 1V3FA 4Y15A 1RIOH 5IPAA 2Z9OA 3FDYA 2HOSA 2V4JC 3MZHA 4XN3A 5CPRB 4BE2A 4XBFA 4HNTA 1FSEA 2ZFWA 3GEZA 2A68F 3C2BA 2QENA 4BE0A 3AKZA 2P8TA 3J7YJ 2LD5A 3DLLF 4ZYEA 3P5JA 2ZSIB 2QQ9A 2DOFA 4KT5C 1RNLA 1PUFB 1GDTA 1Q1VA 1JHHA 1O57A 1CQTA 5JVGF 1FWZA 4C30A 1SFEA 3SJMA 2OQRA 2R5ZB 2ZSHB 1YE9A 5JR3A 1VFCA 5DDGA 2ZC2A 4OWRB 1ZR2A 4RAGA 1IO2A 3KYDB 3QOEA 4JX5A 2YU3A 2V26A 1H8AC 3BLYA 1U9NA 2EB7A 1BOAA 4N9HA 4XORA 3BZCA 4ZJZA 3GXOA 3BROA 4KIBA 2HEOA 3QYFA 4C3JJ 3TQNA 2DU9A 4HAMA 5JLXA 2RQQA 2RN7A 4HF0A 2EV0A 3J81Z 3V4GA 5HNHA 2X1CA 4HX8A 3PQJA 2IXSA 1DU6A 3DTEA 1I1SA 5KNLA 3ZRGA 1Z05A 1Z7UA 1SEUA 1T0FA 4KN7X 2PX9A 3OY9A 4G9YA 3L1PA 1Y8RB 1LQ1A 2M87A 4BS9A 2W57A 3ELKA 1YS7A 1HF0A 3CJRB 4Y4RA 2UZKA 3M7GA 3K1MA 3VOEA 2ZXJA 1IJWC 1APLC 4GYIA 4FX4A 3QPSA 5EF6A 5IYBJ 1QGPA 2DQRA 5FROA 3KLNA 2W25A 1OCTC 3OWTA 2LH9A 3CUQC 4CCNA 4PDKA 1IN5A 3ZQ7A 5EGOB 5IT9Z 2HFHA 3J80K 3EYYA 5J4VA 2XKPA 5H6QA 4KMUX 2BXYA 2EH3A 2CW8A 2IP2A 2EA2A 3H3ZA 1W36D 4JOMA 4CYCB 4IPAA 2R3SA 4ZTFA 1QVUA 2Z16A 2QSHX 3P7NA 2ELKA 2LOOA 1YJ9I 3OOPA 4E6KG 1YTYA 3KFWX 2ZJRF 5F27A 2BGCA 2YUSA 3S2DJ 1MZBA 1E3OC 4YEJA 2LBFA 3M8FA 1NG6A 5EG0A 1DP7P 1F5TA 3DWLE 2L9SA 1ZLKA 3ZQHA 3FM5A 1Z6RA 3RIRA 3RKXA 4NC7A 2EIKH 2LK2A 1RI7A 3GTMJ 5EJCA 3DF8A 2HR3A 3O2PE 2P4WA 4ZZDA 5FLMJ 1WRJA 3VB2A 4BHPA 1B4AA 4F92B 2EFWA 3OYIA 4F55A 2L7FP 2FMLA 3DEWA 2MBFA 3DPTA 2EFOA 2OUMA 3ZGKA 1XSVA 2HTSA 1VI0A 2XAHA 2F48A 2HI3A 2NAZA 3RI4A 1QRYA 3TKYA 4BY7J 2CMPA 3K69A 3WTUC 3G3ZA 3L2RA 1VTNC 4M71A 1BR1A 1SVOA 1TC3C 1E0EA 3J81K 3IAS2 2VJ4A 3I59B 2D45A 3A01B 3T1BA 4JP0A 4CA0A 2K5CA 2KIQA 3WGHA 3SQNA 2FOKA 1YITI 1IDYA 2YPRA 4HLXA 5F6FA 3GZ6A 1MJBA 1TNSA 4B8XA 4BHBA 2LNBA 4HYEA 2DDBA 5D8LB 3IH2A 1XMKA 3LSHA 1C0WA 3D5RC 1D1BA 4KN4X 3MWMA 4ZYGA 4E70A 1X58A 3K2ZA 2E7WA 3LQRA 4HPQA 4EJUA 2P0WA 1R36A 1UHWA 2Y31A 5IY5H 1X1PA 1WPKA 4FT8A 4G7ZF 3OYAA 4DGWB 3R60A 3G73A 2L4AA 2DMNA 2F5DA 2XGDA 5EZGA 3EDPA 4DIQA 3Q0WA 5IT9K 2FBHA 3F8MA 4OIOF 2H94A 4RAFA 2WAEA 3HTSB 1ZGJA 4I02A 1NG7A 2LR8A 2IRFG 2ELJA 2FQ3A 3JTHA 3LQQA 3SZPA 1WHUA 2JWTA 2MYSA 1E17A 1Z21A 2M0CA 1F36A 1X2MA 5GAGJ 4QLCU 1E3HA 5BMZA 4AIJA 2MLKA 2O8XA 4CCOA 4YFKF 2NYXA 2DBBA 4XRMA 2V1UA 1SD6A 1R4MB 3UKGA 2RREA 2H6CA 2CQ7A 2V6EA 1UMQA 4MQ9F 2FEZA 4X0GA 4XM3A 4F3QA 1TWHJ 1MW7A 4WXHA 1XN7A 2A3SA 3KIOA 1H88C 2IS6A 4XR6A 3W3CA 3CC2I 1BJAA 2O3FA 1ETVA 3KP4A 2KMUA 2JA8J 1VQMI 1RRJA 1MGTA 2KT0A 5C4JJ 4A3EJ 1D1CA 2UUZA 1O7LA 3H9JA 3N05A 4B44A 2BY2A 2M7AA 2BVMA 4CDGA 3M8EA 5E1XA 2YX7A 5E1ZB 4EQQA 5D6EA 2ZMEA 3D0SA 3B02A 1UZCA 4O6JA 2PMUA 2YX4A 5HNFA 5CVJA 2AQFA 3FK7A 4KMFA 1YQAA 2JVGA 3L2VA 1U5TC 4A69C 4HOBA 2JA6J 1LFPA 2CWEA 3OIPA 4MEXF 2CRGA 3HZJA
chains in the Genus database with same CATH topology
1HA8A 1ERDA 1WJEA 4C2UA 3RPUD 3SDBA 3GBGA 4HEA2 3DTIA 1QHGA 1P9QC 1AA7A 4XKCA 5CQEA 4F93B 2WA0A 1OLTA 5LFAA 3VWBA 3UR3C 1G8XA 4QPQA 2CV1A 3D5LA 4CCMA 1GLNA 3LMMA 4XLEA 3OYLA 2X6YA 4IQJA 1DP3A 2K3PA 5JHFA 1QHHD 3V42A 3BCBA 4XQFA 2W82A 3L2QA 2X51A 1Z7LA 4NC8A 4C9YA 4CH7A 4XKVA 1WJBA 4C2TA 3K4CA 5CQGA 2L9NA 3PNYA 3L2WA 1MMDA 4ZDPA 2VL8A 1ZELA 2VQLA 2PJRB 2R7VA 4N4OB 2IGKA 3H35A 4GRIA 4RM2A 4PSXA 4AU7A 3OYHA 5KCMA 3CP2A 3L2UA 2XF5A 3DU6A 3EUKL 1N78A 4IKFA 2Q2EB 4FETA 3BG6A 4NNJA 3OYDA 3CP8A 3RQ4A 4F52A 2QKMB 3OYGA 2UV1A 4DJAA 2KHMA 2E5NA 2KL4A 3G2BA 2M7BA 3DKXA 2LBFB 3DLAA 4XOTA 2W1OA 1BOBA 2R7SA 3FBNB 1DGRM 4D1QA 3H0DA 2CV0A 4YELA 4BL0B 3HUGB 1V5EA 2XF7A 3SZGA 2VKHA 5FRNA 4IZZA 3KYLA 2VLAA 4P1WA 2E60A 2KP6A 2VIXA 4ZDOA 3S8PA 2XC7A 1U0JA 4E7ZA 4YRVA 2AQEA 1MNDA 2WAQA 2X6WA 2IGMA 4FASD 1N75A 4XLAA 3VSKA 3ZQQA 3K70D 2F6CA 3PJRA 3PNVA 4DBRA 4B48A 3I3LA 4BJTA 2DT7B 1BR4A 1YX5A 2V7FA 3EUAA 2VKDA 2Q1ZB 3S93A 2L7KA 2R7TA 2E1MC 1VZ0A 3PSFA 2WAFA 4BJ6C 1X4PA 3C2HA 1UELB 3MMYB 3MKYB 3TL4X 4KITB 1LVKA 2X6XA 4LG3A 1JI8A 4BQOA 3OYCA 3CZ6A 1X1AA 4PJJA 4J01A 3CJQB 3H9GA 3W2WA 1WJDA 3K4KA 2IS1A 2M0MA 4XMYA 2HQAA 4CCJA 4E7JA 2L5QA 4RMNA 3RTRA 2M4KA 4DBQA 4BXFA 2Z1DA 3AFHA 3MKWB 2DJIA 4CSWA 2M3AA 2K9MA 4BGDA 3ZXSA 4J00A 3DPUA 3OL3A 3DEEA 2W4SA 3A2KA 4B3XA 4PJLA 3OS0A 4E7SA 3FBIB 4ZC3A 2BVLA 3VYSB 3PFYA 3HXLA 2A5WA 4RLQA 4RLFA 2ZXIA 4AYBA 3VYTB 2WB1A 4BUPA 4E7IA 4KJZA 3K4JA 3NWSA 2WY7Q 4R79A 3OYFA 3HL2A 2PMZA 3VDXA 2HZDA 4ZDLA 1MMNA 3M8JA 3EUHC 1D0ZA 2VJJA 2F4IA 3KX2A 4PSWA 3CESA 3MD2A 4BDYA 4II3A 2MFZA 3OYMA 4BEHA 3OIQA 2WY8Q 4LIVA 3LSMA 3VYUB 3W2VA 4BU2A 2VQGA 2LC2A 3OL4A 4XKWA 3AL0C 4CCKA 2X1EA 1D0XA 2KDOA 3OYBA 2DT6A 2HVRA 2ZXHA 3QYBA 1EA3A 3H5NA 3HPGA 1WJFA 3LL7A 2CV2A 2CH0A 4EATA 2KLOA 3CMMA 2VQCA 2L2OA 2MC4A 5TGTA 4E4HA 1TZLA 3LFUA 4BJ5C 1D0YA 2JSPA 1PJRA 2GOMA 3DU5A 1IRXA 5CKTA 4CUGA 2VXZA 1SFKA 2QKLB 2XDVA 4N4NB 1Y56A 4Y3OA 3RCOA 2WBMA 3S3OA 1K6YA 2BW3A 4XOPA 3HC7A 2LRDA 3FDYA 2V4JC 3PNTA 5HVQC 1V5FA 4HG2A 4XN3A 5CPRB 2W7NA 4HNTA 4BE2A 1T95A 1DQUA 3AL0B 3OYKA 4HSRA 4BE0A 3AKZA 4E7KA 3OOUA 2KRHA 4HNUA 2V1NA 3ONQA 2CW7A 4D9JA 4BQQA 3S3MA 1S9HA 1OR7C 2R7XA 4BACA 4E7LA 2ZSIB 1N77A 4ITVA 4C30A 1SAUA 3F9KA 2ZSHB 1YE9A 2LY1A 2GOXB 4LIUA 5KHDA 2IGNA 3OYJA 4OWRB 2KZVA 3PSIA 4XLCA 3QOEA 2R7UA 2V26A 3BLYA 2XF6A 2HVSA 4XORA 4KISA 4ZJZA 1QU3A 1WJCA 3QYFA 3IP4B 1MMAA 3VYRB 2RQQA 2M4GA 1X1BA 3MKZA 3S3NA 1DGWY 5HNHA 3BCAA 2X1CA 4CCLA 5HLTA 2IXSA 5LD2C 3DTEA 4PFOA 5KNLA 1G59A 3ZRGA 4H4KC 4G6TB 2VPLA 1LKXA 2V9KA 3FHNA 3OY9A 3U21A 4PUSA 2X1DA 4XN0A 1J09A 4B43A 4BS9A 2KQRA 2HU9A 1MNEA 3CJRB 4Y4RA 3ZR8X 2BW3B 3DTKA 3K4NA 4NUBA 2E5ZA 2RNGA 3BG7A 2OV7A 5FROA 4OAZA 3HPHA 1TT0A 3OWTA 2LH9A 4PK4A 3LSGA 4CCNA 1BR2A 2VJIA 3E1SA 3OS1A 1X1CA 4E7HA 2NOJB 2E1MB 3A1YA 2BOLA 1UAAA 4Y33A 2DCEA 3SEQA 2DOAA 2PJRA 1MMGA 1WJ5A 3A4CA 4DOZA 4BDZA 1W36D 2CW8A 2VXDA 4JOMA 4ZTFA 2O5RA 2Z16A 1YX3A 1T0FC 3HG9A 3QYEA 4PJNA 2LOOA 2VASA 2X85A 3SEZA 3BC8A 4BE1A 4OAYA 4E6KG 2VQHA 4XNFA 3H5AA 4YEJA 3SYTA 3OS2A 2LBFA 2R4GA 3DQVC 4IQ4A 1NG6A 4BQNA 2ZFUA 3DWLE 2CUJA 2L9SA 1Y6IA 2FUG2 3UNGC 4ZYAA 2CUZA 4JQFA 4IX7A 2K9LA 1KONA 3OYNA 3LSKA 2LYCA 4RM3A 4NC7A 3S32A 4XLHA 1FMVA 4F92B 3OYIA 4F55A 3IUOA 3ZCOA 3DPTA 2JVHA 2OUMA 2WADA 3K4MA 3ZGKA 4U7BA 1UG0A 3I9V2 2MD0A 2LG4A 3K70C 3M1CA 2CMPA 3L2RA 1BR1A 2R7WA 2IS2A 1E0EA 3EPZA 2HPMA 1X4OA 3IAS2 2VJ4A 4II2A 3D5SC 1Z3YA 4CA0A 2K5CA 4NQWB 1Z3XA 1R6RA 2Z2SB 3TMOA 4ZTJA 2VJ5A 2I8DA 3K4BA 2R7RA 4F91B 3LSHA 3D5RC 1D1BA 3K4LA 1V5GA 4MLOA 4HPQA 3IAM2 2HVQA 3K10A 2P0WA 2HNHA 2R7QA 3OYAA 4BEHB 4DGWB 2KRCA 3CF2A 1PYVA 4AVZA 4HRIA 4DIQA 1WFXA 2UWMA 2WAEA 3PL8A 1NG7A 2LY2A 2ELJA 3QODA 2HDWA 1W36C 1D1AA 2XSJC 3KEYA 2XAUA 2MYSA 1Z21A 3J7AY 2JA2A 3NWTA 2DXIA 4CCOA 3HKZA 2Y0SA 2W00A 4ANJA 4HSTA 3E0JB 4XONA 3TBIA 2V6EA 2RREA 2LREA 3H5RA 4XKBA 4XL9A 4X0GA 3W2AA 4XM3A 2KPMA 4F3QA 1MW7A 3DPLC 5HOOA 2JUGA 4P5OA 2IS6A 2MABA 1LDKB 4KT6A 4LITA 4XR6A 3W3CA 4CZCA 3RSNA 3OYEA 3FKJA 3H9QA 2KMUA 2HPIA 1X19A 4XLFA 3LSIA 1D1CA 2F5VA 2IS4A 2UUZA 5FRMA 3H9JA 2A6TA 2CS3A 3N05A 2M7AA 4B44A 2BVMA 3VSLA 3DKYA 4PJMA 2IGOA 1WJAA 1X1DA 4QPOA 4U87A 3HOTA 3PUBA 5HNFA 2AQFA 3OR1C 2JVGA 4B47A 3L2VA 3OMYA 2OC6A 3C2GA 2R7OA 1FMWA 1LFPA 3OIPA 2VB6A 4PFPA 3K6GA 2CFOA 3OR2C 3HOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAB A;  2KHM A;  2K3P A;  2M0M A;  2MFZ A; 
#chains in the Genus database with same CATH topology
 1HA8 A;  1AU7 A;  2VT3 A;  3ZMD A;  2EIL H;  3CCJ I;  1PP7 U;  1PUF A;  2NVQ J;  4HV5 A;  1XGM A;  1R5I D;  3RPQ A;  5GAH J;  4AIK A;  4C2U A;  1A04 A;  2R5Z A;  1MH4 A;  3DTI A;  1A35 A;  1P9Q C;  2MA3 A;  4F93 B;  5LFA A;  5E3M A;  2DQL A;  2RQP A;  4UUS B;  4JX6 A;  4CCM A;  4XLE A;  3OYL A;  4IQJ A;  1VND A;  3RKY A;  4I0A A;  1S3J A;  2LF7 A;  2X51 A;  3L2Q A;  4NC8 A;  1R5G A;  3O8G A;  4CH7 A;  1O3T A;  2K27 A;  3JAM Z;  2QQB A;  3ZMS A;  1KU2 A;  3ABT A;  3PNY A;  3BT9 A;  2OTJ I;  1OCR H;  2MG4 A;  1KYW A;  2E2H J;  3H92 A;  2VQL A;  2R7V A;  3CDH A;  3P9C A;  3LAJ A;  5LGN A;  1OCP A;  5D5W B;  2L9R A;  1HXD A;  3M3Y J;  1N78 A;  4FET A;  4NNJ A;  1LEA A;  3L7W A;  4EM0 B;  3RQ4 A;  2DA4 A;  4I98 B;  1KU7 A;  2EIN H;  2E5N A;  2CJJ A;  3MEX A;  1ZRE A;  2NNY A;  2D1H A;  3R4K A;  3DLA A;  3BR0 A;  2HXI A;  2ETH A;  4D1Q A;  3L00 A;  3F72 A;  2CV0 A;  1ON2 A;  4O3M A;  4LLG F;  1QPI A;  2VPR A;  5FRN A;  2VKH A;  4IZZ A;  3KYL A;  2G7H A;  3S8P A;  3ERE D;  4ENM A;  2GA2 A;  1ONV A;  2X6W A;  5DUK A;  1XTA A;  3HYI A;  2IGM A;  4FAS D;  1FIP A;  1VQ8 I;  3PNV A;  5DS9 A;  4DBR A;  4B48 A;  4MTD A;  4NB5 A;  2XV4 S;  4U0Y A;  4A3M J;  1ZGW A;  3Q9V A;  1BR4 A;  2V7F A;  4AID A;  5HLG A;  2QZ8 A;  2VKD A;  5F04 A;  1T38 A;  2CUE A;  2E1M C;  2A05 A;  4MEY F;  2VN2 A;  4M9Z A;  4BJ6 C;  2EFP A;  3BR1 A;  3MKY B;  2VOP A;  2BY1 A;  2X6X A;  3G1M A;  2K3F A;  4KUM A;  5J8C A;  1FOW A;  3CMA I;  3H9G A;  2XAF A;  4DNC A;  2TDX A;  2DW4 A;  2Y69 H;  4MFD A;  2LKP A;  5AIQ A;  4RMN A;  3QP5 A;  2DI3 A;  4DBQ A;  4BXF A;  2Z1D A;  5B66 C;  4AYB N;  4M6Y A;  2K9M A;  4BGD A;  3ZXS A;  1TWG J;  4QSH A;  5LEK A;  5FLX Z;  1SFO J;  3DPU A;  3OL3 A;  1T56 A;  2W4S A;  3ERM A;  1YO5 C;  1R23 A;  1EF4 A;  2DOE A;  4B3X A;  3BQY A;  2L7Z A;  3TDU C;  3GME A;  1FBQ A;  3FBI B;  5K7Z A;  2IVM A;  3F6O A;  4V19 K;  2E7X A;  3A01 A;  3W6V A;  2MH9 A;  1JXS A;  3CJT B;  1KU3 A;  4R8H A;  3V7R A;  2HKX A;  4RLQ A;  1HKQ A;  4RLF A;  3PO2 J;  2PFB A;  2DMT A;  4U0V A;  1CF7 B;  2WB1 A;  1Z1D A;  1YI2 I;  3FF5 A;  3OYF A;  2PMZ A;  3WTX C;  5FFZ A;  3KPH A;  2I5U A;  3M8J A;  3EUH C;  2LY9 A;  5E3O A;  1YOV B;  3JRC A;  2DA3 A;  3LWF A;  1ODD A;  3A0H C;  1HQC A;  2X0L A;  4MHG A;  3CES A;  2FXA A;  4MIM A;  5TIS C;  5ICE A;  4KYW A;  2K9S A;  1J7K A;  2WY8 Q;  3VYU B;  3ZQF A;  2VQG A;  3IHU A;  3OL4 A;  4AC0 A;  2A69 F;  3QP6 A;  3AL0 C;  2V1X A;  1KA8 A;  4A93 J;  1BW6 A;  4CCK A;  5J1R A;  2IJL A;  4IHW A;  4A6D A;  1B6A A;  3K0L A;  3CD6 I;  3QYB A;  4YFN F;  4HZF A;  3H5N A;  3HPG A;  1WJF A;  3LL7 A;  2CV2 A;  2CH0 A;  2K4B A;  4I01 A;  4EJO A;  3CMM A;  4E4H A;  4GYG A;  2FOW A;  2Z3Y A;  1FP1 D;  1D0Y A;  1W5S A;  4BJ5 C;  3MAJ A;  3ZMV A;  1PJR A;  2GOM A;  3SDG A;  5CKT A;  2VXZ A;  1SFK A;  2QKL B;  5B1A H;  3F22 A;  3QU6 A;  2WBM A;  4PJ0 C;  1B72 B;  4JBA A;  4EJV A;  2BW3 A;  5LGU A;  3IL2 A;  2W84 A;  4ASN A;  1XCV A;  4IRG A;  2W7N A;  3OSG A;  2RVC A;  1T95 A;  1DQU A;  2ID6 A;  3OYK A;  4M3F A;  4E7K A;  2KRH A;  4HNU A;  2CW7 A;  1TWC J;  4D9J A;  4BQQ A;  1B9M A;  3ROU A;  1OR7 C;  2VE8 A;  3G71 I;  4A3I J;  2R7X A;  4E7L A;  4FIS A;  5ERI A;  1N77 A;  5IOZ A;  2FJ1 A;  4UVC A;  2X6O A;  4ZH4 F;  1SD4 A;  5FLX K;  4BAY A;  3CCR I;  3BDD A;  4GO1 A;  3RKW A;  1YG2 A;  2KZV A;  4D0P A;  4A3L J;  3PSI A;  4UB8 C;  2V79 A;  4BQA A;  2R7U A;  1YHQ I;  5JLW A;  1MDM B;  4XLP F;  5EYR A;  1YIO A;  2GZW A;  4WXD A;  1WJC A;  5HDG A;  1MMA A;  3VYR B;  3MKZ A;  4CHU A;  4FCY A;  5L3E A;  2FRH A;  1VQK I;  1P92 A;  4DYC A;  1CGP A;  1DGW Y;  1FT9 A;  3BCA A;  3K1N A;  4CCL A;  4BY1 J;  5EEH A;  1HBX G;  4PFO A;  1G59 A;  4H4K C;  2COM A;  4LK0 F;  1NTC A;  3FIS A;  2V9K A;  2HQR A;  3FHN A;  4L9T A;  5LHG A;  1AHD P;  4M74 A;  3R61 A;  3U21 A;  5L3F A;  1YS6 A;  5EEG A;  1UFM A;  4PUS A;  2X1D A;  5K5R A;  3WHC A;  1W0U A;  5J6X A;  1K4S A;  1EKE A;  3RKQ A;  2HU9 A;  1MNE A;  3ZR8 X;  2WB1 N;  3BPV A;  3IH3 A;  3FM3 A;  3ZQL A;  4RA2 A;  2E5Z A;  2K02 A;  1Q1H A;  3RZD J;  1X3U A;  3GFL A;  3HPH A;  1Y1W J;  4PCQ A;  1TT0 A;  2AS5 F;  4L0Y B;  3E1S A;  1WSU A;  3OS1 A;  2DOD A;  2BHZ A;  5B1B H;  4E7H A;  3CCV I;  2B63 J;  2BOL A;  3MZ8 A;  1UAA A;  3ABK H;  3SEQ A;  1ITY A;  4L9N A;  2DOA A;  2F4O B;  4M9S A;  1HCR A;  5DYM A;  3IRR A;  1USS A;  1W7P B;  3ZMT A;  2LSO A;  5HS9 A;  4Y17 A;  2K40 A;  2O5R A;  3I55 I;  9ANT A;  1T0F C;  3CME I;  4PJN A;  2EV5 A;  2P7C B;  1POG A;  2EWN A;  2VAS A;  3ISP A;  2E1N A;  1FIA A;  2Q0O A;  3AG1 H;  4OAY A;  2VQH A;  4HX4 A;  1I1G A;  1G3W A;  4HLY A;  4KFC A;  4M3D A;  3SYT A;  5JVT A;  2CQK A;  4QIW N;  2AXT C;  4WX9 A;  3B6C A;  2FE3 A;  3CUQ B;  5D5V B;  2R5Y B;  4BQN A;  2BBY A;  2ZFU A;  1ETW A;  2ISY A;  1Y6I A;  1H9G A;  2VE9 A;  2FUG 2;  3BWG A;  3CCS I;  5F0C A;  1HSJ A;  1ZG1 A;  1QA6 A;  3OYN A;  3TO7 A;  2LYC A;  4EJW A;  3LSR A;  5TRD A;  3C18 A;  2FF4 A;  1ETQ A;  3DCF A;  1BI1 A;  3FMR A;  3IKT A;  3TGN A;  3HDD A;  3HM5 A;  3G1L A;  4DQ2 A;  3GTG J;  3IUO A;  1ZRD A;  1X2N A;  1XD7 A;  3K4M A;  3VPR A;  4EM2 A;  2X9D A;  5IP9 J;  2DMU A;  2LF8 A;  1B8I B;  4MFE A;  3I9V 2;  3FXQ A;  3AAF A;  3S2H J;  4NC6 A;  5E8G A;  2O0Y A;  2XVC A;  2R7W A;  1IW7 F;  2HPM A;  5HOD A;  4II2 A;  1FTT A;  3D5S C;  3K1P A;  2O6G E;  4ESJ A;  1R6R A;  1I39 A;  1YW7 A;  2Z2S B;  4GCV A;  3P9K A;  4ZTJ A;  2L4M A;  4XSZ F;  1HW2 A;  2I8D A;  3K4B A;  1MBG A;  2R7R A;  4F91 B;  1IN8 A;  2DT5 A;  3K4L A;  2M2E A;  3Q9S A;  2F5F A;  4R1H A;  5M5W J;  2QLZ A;  3H3U A;  4ESF A;  2J5O A;  2HNH A;  3TW6 A;  5E8I A;  1U78 A;  1FSH A;  3AG3 H;  3BTC A;  2A6H F;  3CF2 A;  1PYV A;  4AVZ A;  4D5F A;  3LAP A;  1F4K A;  2TCT A;  3HKZ N;  1A6I A;  2Y0S N;  1WFX A;  5LHH A;  3ZP5 A;  1CF7 A;  4D7N A;  3GZN B;  3ECO A;  3AG4 H;  1KGS A;  5HS8 A;  4G7H F;  1P6R A;  1H9T A;  4MO7 A;  2IA1 A;  1D1A A;  3KEY A;  4G8X A;  2GAU A;  5K7F A;  4HA8 A;  5A2Q Z;  4UB6 C;  1T39 A;  3CO7 C;  1K78 A;  3BG3 A;  1O7F A;  4ANJ A;  1SVL A;  4HST A;  3BJ6 A;  1GVJ A;  5E3L A;  4XON A;  3CCQ I;  3TBI A;  5J1U A;  2LRE A;  3TP3 A;  3IV5 A;  3BJO A;  3CCE I;  2CW0 F;  4HNV A;  3HRS A;  1WWX A;  2MC3 A;  1LDK B;  4LIT A;  3ZN1 A;  2DJN A;  4A6E A;  4CZC A;  3RSN A;  4I6Z A;  2Y75 A;  3JRE A;  3FKJ A;  3LST A;  2DN0 A;  1AKH B;  1HOM A;  5KAI C;  3BZK A;  3S1R J;  4DYR A;  5DD4 A;  3LSI A;  1UST A;  4N0B A;  2EFQ A;  3HGG A;  3TOA A;  2PI0 A;  3DV8 A;  5FRM A;  3FWE A;  2L01 A;  3QOP A;  1R1V A;  2HKO A;  1R4N B;  3S16 J;  1F43 A;  1B72 A;  2P6S A;  2PEX A;  4NBQ A;  1LFU P;  3ECH A;  5ICF A;  1P2F A;  3LFK A;  3AG2 H;  1MBJ A;  1LPQ A;  1WZ2 A;  1HW1 A;  4PFP A;  3JTG A;  1FYM A;  2CFO A;  3F8N A;  4UUT A;  1VQO I;  3HOS A;  1XDS A;  3C3W A;  3FMQ A;  3JRI A;  1P4A A;  1ZAO A;  5JHU A;  2R7D A;  1WJE A;  5J3L A;  4HBL A;  3A02 A;  2RAE A;  1ETK A;  4ESB A;  2LP0 A;  2R0Q C;  5LEJ A;  3RPU D;  1JT6 A;  2Y0M A;  4HEA 2;  1RPW A;  1QHG A;  3F3X A;  5CQE A;  3NEU A;  1OLT A;  4RDU A;  1MSF C;  5DTD A;  4X6A J;  3QU3 A;  1UJ8 A;  3VWB A;  4RGX A;  3HGY A;  4QPQ A;  4RB3 C;  3CCU I;  3D5L A;  1BI0 A;  3LMM A;  1YIJ I;  1U5T B;  3BCB A;  2ZNZ A;  1EV7 A;  4XQF A;  3HOU J;  1GXP A;  1IXR C;  2Z99 A;  5GTH C;  1Z7L A;  4A5N A;  2CGP A;  4C9Y A;  5IYC J;  4LG0 A;  1IC8 A;  4IL6 C;  4UVA A;  1DUX C;  2D2W A;  3COA C;  1ZEL A;  2PJR B;  2H1K A;  2IGK A;  2KIM A;  5A2Q K;  2F5C A;  1FEX A;  2CU7 A;  2DTZ A;  2XF5 A;  4IKF A;  2NS8 A;  2O61 A;  3CCY A;  2Q2E B;  4M3B A;  3BG6 A;  3LA7 A;  1EJ9 A;  2Y2Z A;  2JT1 A;  2VKE A;  4F52 A;  1ZG5 A;  1IRZ A;  3OYG A;  5TJJ A;  2WAQ N;  3WGG A;  3HSF A;  3G2B A;  1JJ6 C;  3FIW A;  1GUU A;  5LLQ A;  2QBY B;  2EIJ H;  3GTK J;  2CQQ A;  1OCO H;  2R7S A;  3L09 A;  2AXL A;  3H0D A;  1I3Q J;  1UHM A;  4YEL A;  4BL0 B;  1BIA A;  3HUG B;  1SMY F;  1BL0 A;  4P1W A;  2E60 A;  2KP6 A;  4XK4 A;  3I4M J;  3K7A J;  1U2W A;  1DPR A;  1W7P A;  4E7Z A;  3CMY A;  3K2A A;  2A07 F;  4YRV A;  2OJE D;  1SD7 A;  1MND A;  4S05 A;  2ICW G;  3I5U A;  2MD5 A;  4MTE A;  3ZPL A;  3ZQQ A;  3K70 D;  3D1N I;  3PJR A;  1J0R A;  1IDZ A;  1QZZ A;  1FBU A;  2JPC A;  2ZJQ F;  5LGT A;  3GLL A;  1ZAR A;  3I3L A;  1TQM A;  1MMS A;  5EZH A;  3GO5 A;  2JZY A;  2R5Y A;  5K5Q A;  1RZ4 A;  2Q1Z B;  2ZCW A;  1ZTR A;  1D8J A;  3LA2 A;  4CYD A;  1VZ0 A;  4S0H B;  1WQ2 A;  3GF2 A;  3MMY B;  2OZU A;  1EH8 A;  2LMD A;  2HXO A;  4BQO A;  2K7L A;  3OYC A;  2OPT A;  1Y0N A;  3LA3 A;  4PJJ A;  3T8T A;  5CVI A;  4OIN F;  4J01 A;  5GTI C;  4X1E A;  1WJD A;  2IS1 A;  2M0M A;  4QWQ A;  2ZJP F;  2HQA A;  2CYY A;  2L5Q A;  5J40 A;  2M4K A;  1S6L A;  3AFH A;  1B8I A;  1XMX A;  2DJI A;  4H0E A;  4CSW A;  2H1L A;  4IRI A;  1S8N A;  1I5Z A;  3I4P A;  2GXB A;  1LB2 A;  3R0J A;  4PJL A;  3OS0 A;  4CO8 A;  1VF9 A;  4D5C A;  4E7S A;  3BG5 A;  4GGG A;  3VYS B;  5ICC A;  4I0B A;  3WOD F;  4PZJ A;  5D4R A;  4LOC A;  2BY3 A;  5DM6 F;  2ZXI A;  3G1O A;  1VQ5 I;  4MQV A;  4AYB A;  1XGS A;  2DO7 A;  3M1E A;  4BUP A;  4KJZ A;  3ZQI A;  3JCU C;  5LBQ A;  2WY7 Q;  1IV6 A;  1X3W B;  1Y1V J;  3VDX A;  2HZD A;  4ZDL A;  4EGY A;  4Q5S F;  2PLY A;  2DK8 A;  2M30 A;  1D0Z A;  2QCO A;  4QTR A;  1JKR C;  2F4I A;  4FE4 A;  3KX2 A;  2H8R A;  2M9H A;  1Z0X A;  3T5X A;  1R49 A;  3MD2 A;  1S5L C;  4UXN A;  3VEP A;  3RDI A;  3OYM A;  3WTY C;  1S7A A;  2KJC A;  2XAS A;  3LSM A;  1ZR4 A;  4EVI A;  1GV2 A;  4P9F A;  1Y8Q B;  2IPQ X;  5F1J A;  2L02 A;  4RGU A;  2X1E A;  1D0X A;  2DT6 A;  1OYW A;  3LNQ A;  2JQ7 A;  5H2F C;  1B9N A;  2FNA A;  4LGW A;  1FJL A;  1FBS A;  2VBY A;  3WU2 C;  5D8K B;  3I0T A;  1KQ9 A;  1QZY A;  5L3C A;  3LFU A;  2HWV A;  1G4D A;  1P7J A;  2XRL A;  4N4N B;  4ETS A;  1ORK A;  4LB5 A;  5C4X J;  4XOP A;  5DCM B;  2LRD A;  3PNT A;  4HW0 A;  2FD5 A;  5CVV A;  4BHC A;  5HVQ C;  2WTE A;  3SFI A;  4HG2 A;  3QRF F;  2DTR A;  4L18 B;  4RGR A;  2L9V A;  3AL0 B;  4J19 A;  3FXJ A;  3FXO A;  4HSR A;  1AOY A;  2A61 A;  2DA2 A;  3E6D A;  3FXR A;  3OOU A;  2V1N A;  3HRT A;  3ONQ A;  1W5C C;  1FX7 A;  5K5O A;  2J5P A;  1RUO A;  2VKV A;  3S3M A;  2GA1 A;  4M6V A;  5EGO A;  1JUP A;  1R00 A;  2P5L C;  3V8K A;  3OIO A;  2Y9Z A;  1JGG A;  1Z77 A;  4CYC A;  3CF5 F;  1FOY A;  1SAU A;  2JA5 J;  2O9L A;  4UUV A;  3F9K A;  4FTH A;  3X2Q H;  1Z91 A;  1R71 A;  2GOX B;  4IXA A;  1KYZ A;  4LIU A;  4OU0 A;  3TW7 A;  3OYJ A;  4I7H A;  4YFX F;  4OIP F;  3HOZ J;  1YJN I;  5KAF C;  1GHC A;  3DFG A;  3KP2 A;  2JMW A;  4Z6Y A;  2AO9 A;  4V2F A;  2XF6 A;  4XLN F;  1T08 B;  2HVS A;  4KIS A;  1X3Z B;  1QU3 A;  4DZP A;  2N8G A;  3IP4 B;  3WU1 B;  4Q47 A;  4IF4 A;  1ZYR F;  3OSF A;  1RKT A;  1X1B A;  2HYG D;  5HLH A;  4YIF A;  1BA5 A;  3FK6 A;  2LTP A;  1OJL A;  5F0F A;  5JI6 A;  3FXL A;  2JK3 A;  3G4S I;  5HLT A;  1WH7 A;  2O03 A;  5LD2 C;  1BIB A;  3JRB A;  2QSF X;  4G6T B;  5H6R A;  3FXU A;  1LKX A;  5BNG A;  3FXK A;  5FKM A;  5LHI A;  1G3S A;  4XN0 A;  1XSX A;  5FKK A;  4PGH A;  2BHY A;  3W6J B;  2PMH A;  1KQ8 A;  1WKM A;  1HW5 A;  3DTK A;  3K4N A;  4NUB A;  2ZKZ A;  3E6M A;  1L0O C;  3BG7 A;  3QPL A;  2DA5 A;  1BR2 A;  3I58 A;  1X1C A;  5DCF A;  3JAM K;  2NOJ B;  3HIF A;  3N97 A;  1G6N A;  4AVP A;  3I59 A;  3QAH A;  1A31 A;  3RZO J;  2PJR A;  1MMG A;  3IH4 A;  4JYK A;  1OYY A;  3ZMZ A;  1T2K A;  2ZO4 A;  3WE3 A;  3A4C A;  3HJE A;  2M1B A;  4BDZ A;  2VXD A;  5J1Y A;  4LLL A;  4L9J A;  1DDN A;  1MBK A;  1YX3 A;  1I50 J;  3HG9 A;  5DUI A;  1LE8 B;  5CVU A;  4UHT A;  1D8K A;  3VOD A;  2X85 A;  3I4N J;  4BE1 A;  4M72 A;  2UXX A;  4XNF A;  2E71 A;  4V2G A;  1OPC A;  3FX3 A;  3ZQC A;  2R93 J;  2VON A;  5J4Y A;  3E6C C;  4WCG A;  1IXC A;  2XRO A;  3HUG A;  2XAQ A;  1XMA A;  2CUJ A;  1FZP B;  1TTY A;  3WTV C;  2H6B A;  4A0Z A;  3UNG C;  2F2E A;  2OQG A;  5D5X B;  2CUZ A;  4JQF A;  2KJB A;  2MGQ A;  2K9L A;  1KON A;  1RKW A;  1KZH A;  3LSK A;  1V4R A;  5IT3 A;  2DPU A;  2EZI A;  2P81 A;  3S32 A;  4KA4 A;  2VUM J;  2HYF A;  3KYC B;  1QNT A;  4EGZ A;  4G94 A;  5F64 A;  3ZCO A;  1OMI A;  4U7B A;  1SD5 A;  1UG0 A;  2B0L A;  2MD0 A;  3K70 C;  1Z9C A;  3M1C A;  2ISZ A;  1O4X A;  3GFM A;  2RV8 A;  2IS2 A;  3REO A;  4AWX B;  4MGR A;  3GLX A;  2W24 A;  1IXS B;  3FXM A;  4NQW B;  1Z3X A;  3PQK A;  1BM9 A;  1LNW A;  3PM1 A;  3JRG A;  5GPA A;  1ENH A;  5BOX A;  5EDN A;  2VJ5 A;  2XKO A;  1I3A A;  1W5T A;  3MVP A;  3I64 A;  1R9T J;  4KIG A;  3KZI C;  5D6F A;  2LKX A;  1WVR A;  1V5G A;  2EJR A;  3IAM 2;  2HVQ A;  1TBX A;  3WU0 A;  2R7Q A;  2HOE A;  1BI2 A;  4M3E A;  4IJA A;  2H27 A;  4BEH B;  4BXX J;  2QVO A;  3S1Q J;  2VOO A;  1UG2 A;  4RAY A;  5C44 J;  2IT0 A;  5BQT A;  4HRI A;  3K9T A;  1BI3 A;  1TWA J;  2K9Q A;  2UWM A;  3BR6 A;  4G12 A;  3F6V A;  4WK8 F;  3HB9 A;  3HBL A;  2LY2 A;  1N25 A;  5FKO A;  3QOD A;  4UV9 A;  1HLV A;  1ULY A;  2JUC A;  2V1D A;  2XAU A;  4GFB A;  3J7A Y;  3S1N J;  1QQI A;  1W1W E;  2MW8 A;  3M07 A;  2DXI A;  1HC8 A;  1ETX A;  5ILU A;  1S7O A;  2Y30 A;  1FY7 A;  3HKZ A;  4UUS A;  2Y0S A;  2W00 A;  1XG1 A;  5HS7 A;  3E0J B;  1RC9 A;  2HDD A;  4CIC A;  1TP4 A;  1G3Y A;  3SFZ A;  3H5R A;  4TV7 A;  2NVT J;  1QO0 D;  2HZT A;  2KPM A;  3W2A A;  4LB6 B;  1YLF A;  3DPL C;  4ZYH A;  1I6H J;  5HOO A;  1JHF A;  3OYE A;  1QVT A;  1BC7 C;  2DDA A;  4HF1 A;  3ZOB A;  3LSJ A;  2OD5 A;  2M34 A;  2VBZ A;  3NAR A;  2IS4 A;  2XPV A;  4C2M J;  3SZT A;  5EEA A;  2A6T A;  2CS3 A;  1R1T A;  3L2C A;  3DKY A;  4PJM A;  2IGO A;  1WJA A;  4OOI A;  2D5V A;  2QM3 A;  1T8I A;  4U87 A;  3HOT A;  5AIP A;  1H89 C;  3GTO J;  5DCM A;  1WI9 A;  3BR2 A;  2QEX I;  3I56 I;  3OMY A;  4LD5 A;  2E36 A;  1FMW A;  2QWW A;  3S2W A;  3SXY A;  2VB6 A;  4BKX A;  1O3Q A;  1J9I A;  3KE2 A;  1F9N A;  3BZ6 A;  1ERD A;  2HGC A;  3JRF A;  5BS6 A;  2KFD A;  3TP0 A;  4A3D J;  1FPQ A;  3CDL A;  5F08 A;  1HST A;  2G9W A;  3SDB A;  3GBG A;  1NHA A;  2QYO A;  3H0G J;  2LVS A;  2V9V A;  4XKC A;  1XSD A;  3DEU A;  4A0X A;  3UR3 C;  2PG4 A;  1U3E M;  1MNM C;  1G8X A;  2CV1 A;  1PUE E;  1GLN A;  3E5Q A;  3V8L A;  1DP3 A;  1B1B A;  2K3P A;  1YJW I;  3O3K A;  3RYR A;  3S1M J;  3QPH A;  2EZH A;  2P6T A;  2IA0 A;  2W82 A;  3BP8 A;  3EQL F;  3JRA A;  1V54 H;  2YU9 J;  2O7O A;  1J5Y A;  2JN6 A;  1OR7 A;  2L9N A;  3GTQ J;  1MMD A;  2OBP A;  2RKH A;  2L3D A;  2PBI A;  4ZDP A;  3KLO A;  4OIR F;  3J80 Z;  3KEQ A;  4N4O B;  1A36 A;  2ME6 A;  2BV6 A;  3H35 A;  2GXG A;  4RM2 A;  5ICG A;  3OYH A;  3L2U A;  2XB0 X;  3CP2 A;  1OIS A;  3C1D A;  3ULQ B;  4ON0 A;  2BE5 F;  1LDD A;  4ABZ A;  4A3J J;  2DFE A;  4DZJ A;  2DAO A;  4KNY A;  3E97 A;  5HDK A;  1WH5 A;  3HRM A;  3CP8 A;  2PQ8 A;  5FD5 A;  2QKM B;  2STT A;  5B5E C;  2O8K A;  4RAZ A;  1FLI A;  2OCE A;  2UV1 A;  2KHM A;  2GIV A;  1YW9 A;  5F0H A;  1VQN I;  2M7B A;  4KIF A;  4XID A;  4HQE A;  4A3C J;  1DPU A;  3CCL I;  4XOT A;  2OA4 A;  2W1O A;  2GBY A;  1DGR M;  4M73 A;  2B9S A;  3HSE A;  2VBX A;  3OV8 A;  2QA4 I;  1V5E A;  4C3H J;  5GPC A;  2XF7 A;  3MQ0 A;  3CC4 I;  1ZH5 A;  2VIX A;  3SHF A;  2YR2 A;  5IOY A;  4ZDO A;  2XC7 A;  1IRG A;  2H8W A;  4HDU A;  1BW5 A;  1U0J A;  4UVB A;  4NHJ A;  5K7H A;  2AQE A;  2ESH A;  1LE8 A;  4OMY A;  3BPX A;  3V8J A;  2WAQ A;  2WWY A;  4ENN A;  4C3I J;  1IN6 A;  3TOB A;  2PN6 A;  2XGX A;  2ME0 A;  2VT2 A;  3H36 A;  1N75 A;  4XLA A;  2OCC H;  1IUY A;  1LDJ A;  4B3A A;  2IA2 A;  5CYV A;  4B4C A;  4BJT A;  4IHY A;  5J47 A;  4G6D A;  3DBR B;  3EUA A;  3S93 A;  5L3B A;  2F4M B;  4RBO A;  4IO9 F;  3GTL J;  1ZGA A;  3PSF A;  1JJ8 C;  1BBY A;  1X4P A;  1UEL B;  2HTJ A;  2EBI A;  3C2H A;  3TL4 X;  1R58 A;  4LG3 A;  1JI8 A;  1F1Z A;  1X1A A;  1IF1 A;  1DU0 A;  2XRN A;  5E17 F;  3CJQ B;  1SFX A;  2VBW A;  2CG4 A;  4YII A;  4IEJ A;  4XMY A;  4AD9 A;  3U2R A;  4OMZ A;  3QWL A;  2P5K A;  5M5X J;  1TQI A;  1PP8 F;  3FHZ A;  4HDV A;  2FMY A;  2M3A A;  4J00 A;  2XSD C;  3KP6 A;  1B59 A;  1XB4 A;  2QF7 A;  4IHT A;  2Y48 A;  1NK3 P;  4B1R A;  1IAW A;  3A2K A;  3A03 A;  3RQI A;  4L0Z B;  4ENK A;  2ESN A;  2EK5 A;  2M8G X;  3IWZ A;  4XRS G;  1FTZ A;  1JTY A;  2MSY A;  1TLH B;  3ABU A;  2VI6 A;  3HXL A;  3M9A A;  1HDP A;  3L9F A;  4NQW A;  5JFR A;  1FNN A;  2DMP A;  1U9O A;  5BPD A;  4A3K J;  2XAJ A;  2XPU A;  3U9G A;  1RR8 C;  3CUO A;  1JUS A;  4IOA F;  1J75 A;  1BN5 A;  1TL8 A;  4E7I A;  3K4J A;  3NWS A;  3HL2 A;  4R79 A;  1YFH A;  1IN4 A;  3KEO A;  1MIJ A;  3KP5 A;  1BC8 C;  1IV8 A;  2FX0 A;  2HQ5 A;  1K7A A;  1MMN A;  1XPX A;  2VC0 A;  1W4M A;  2GIZ A;  3IKV A;  3MFK A;  2E35 A;  4BDY A;  2GLO A;  2JSC A;  3P9I A;  2ZME C;  2I10 A;  4IRH A;  4BEH A;  3RYP A;  4P96 A;  1MDM A;  3OIQ A;  3W2V A;  1PVE A;  4BU2 A;  2B7E A;  5CLS A;  2LC2 A;  3BR5 A;  4BH9 A;  2KKO A;  3ML6 A;  2XB5 A;  3KP7 A;  2FU4 A;  5FFX A;  5M3M J;  4HQM A;  2HVR A;  5E18 F;  3G6E I;  2KRF A;  2AHQ A;  2KLO A;  3HRU A;  2VQC A;  1HKS A;  1PDN C;  2JTV A;  4AIH A;  1OYI A;  3FMS A;  3HHH A;  1MH3 A;  2JSP A;  4L5E A;  1EH7 A;  1FOX A;  3PUF A;  3DU5 A;  1IRX A;  3PFI A;  5D4S A;  2XDV A;  4CUG A;  3CC7 I;  4B09 A;  3RCO A;  4UNO A;  1AWC A;  3S15 J;  1K6Y A;  2GXA A;  4L9V A;  3HC7 A;  2G7U A;  1UHS A;  1V5F A;  4RS8 A;  1T98 A;  4N9I A;  2JPB A;  3DP7 A;  1OKR A;  1J2X A;  4WWC A;  4ZZL A;  3CTA A;  1S9H A;  1O3S A;  2NNN A;  4BAC A;  2NS0 A;  2BYV E;  2HOT A;  2HOA A;  2EZL A;  3LSP A;  4ITV A;  3BTI A;  3WHB A;  3DBH B;  3T8R A;  1GVD A;  1WGX A;  3B6A A;  1JKO C;  1EH6 A;  1ZKG A;  2LY1 A;  1G3T A;  5KHD A;  2MH2 A;  3CO6 C;  1VQ6 I;  2IGN A;  3O8H A;  2ZB9 A;  4XLC A;  5L3G A;  3GFJ A;  1NK2 P;  5IYD J;  4IVN A;  4WXC A;  2ZBK A;  2DFI A;  3Q5F A;  1XC5 A;  3HOV J;  3CUQ A;  4HV6 A;  1LVA A;  1MJA A;  1ZHF A;  3HSR A;  3JSO A;  2EPF A;  2M4G A;  3FZV A;  1VQ4 I;  2Y9Y A;  2JRM A;  3S3N A;  3V7C A;  3BTL A;  4U7D A;  4LK1 F;  1J59 A;  4A5M A;  5FLV A;  1E2X A;  5AON A;  2VPL A;  3KP3 A;  3DXJ F;  2KIS A;  4RB2 C;  4B43 A;  3U1D A;  1J09 A;  2KQR A;  1V55 H;  3F0C A;  2FQ4 A;  3MKL A;  2UXN A;  3F23 A;  5DV5 A;  2BW3 B;  2M5W A;  2RNG A;  2OV7 A;  4OAZ A;  2BXZ A;  3BY6 A;  4BBS J;  5LRR A;  2RNJ A;  4PK4 A;  3LSG A;  1S72 I;  2JA7 J;  2E34 A;  2VJI A;  3BOQ A;  2E1M B;  3JRH A;  2DFF A;  3HOY J;  3A1Y A;  3GWZ A;  3HOW J;  2LLK A;  4KIC A;  4IOC F;  4Y33 A;  4A3G J;  1A6Q A;  2DCE A;  3NAU A;  3WTS C;  2EZK A;  1WJ5 A;  3WG7 H;  1MBH A;  4DOZ A;  5ILV A;  3WTW C;  1JGS A;  2C6Y A;  3CLO A;  3QYE A;  2XHK A;  1FYL A;  4EEF G;  2NVU B;  3SEZ A;  3BR3 A;  4GDF A;  1GV5 A;  1ZRF A;  3BC8 A;  3H5A A;  1JTX A;  5FO5 A;  3OS2 A;  3BQZ A;  1O3R A;  4ZYD A;  2R4G A;  3DQV C;  4A3F J;  4IQ4 A;  1T6S A;  1YRN B;  2CO5 A;  3ZN0 A;  4F7Z A;  3BJA A;  2BZT A;  1Z6T A;  4A0Y A;  2TRT A;  1HDD C;  2FSW A;  1H0M A;  4MNU A;  2DA1 A;  1OCC H;  4ZYA A;  4IX7 A;  1TW3 A;  4BNC A;  5E3N A;  4UY8 I;  4I76 A;  4RM3 A;  1MKM A;  5GAE J;  3E7L A;  2IAI A;  5B3S H;  4I2O A;  4P55 A;  3TDZ C;  1ZG3 A;  2G0E A;  4XLH A;  1LJ9 A;  1FMV A;  1S7E A;  4A2U A;  1R22 A;  5E79 C;  1FP2 A;  1QBJ A;  4PGG A;  2JVH A;  3KZY A;  2WAD A;  2RGV A;  4LJZ F;  5D5U B;  3U1K A;  3I53 A;  2KDZ A;  2CQN A;  2BY0 A;  2DA6 A;  2LG4 A;  1R7J A;  2Z33 A;  4IHX A;  4IHS A;  2XUB A;  4ENJ A;  3CDI A;  4I09 A;  3J7Z I;  4M3G A;  3EPZ A;  1X4O A;  4HX7 A;  5GP9 A;  3TO6 A;  1QZE A;  3JSP A;  2EQR A;  1Z3Y A;  4BXU A;  3ABM H;  4WF2 A;  2HDC A;  3PO3 J;  1D5V A;  4Z2Y A;  3QQA A;  3TMO A;  4M9X A;  2IBD A;  3CJN A;  1KQ0 A;  3CLQ A;  3W6K B;  1AKH A;  2E2J J;  4A3B J;  4Q4Z F;  2LKS A;  2YSR A;  4I99 C;  2JRT A;  1VQ7 I;  2CSO A;  2IW5 A;  4MLO A;  2R7Z J;  2ECB A;  4LFU A;  4RB0 A;  4YG2 F;  2D1V A;  3K10 A;  3N4M A;  2WV1 A;  5M3F J;  2V6C A;  4XRS A;  4RB1 A;  3ZQG A;  1SAN A;  1MJ9 A;  4NDL A;  1K6O A;  2KRC A;  2E1O A;  3WTT C;  2PJP A;  4L5I A;  2M45 A;  2K4J A;  2WC2 A;  4M6X A;  2DYS H;  3F8C A;  2W48 A;  1REP C;  1FOK A;  3PL8 A;  2ZJ2 A;  1SFU A;  3EYI A;  3IWF A;  2L54 A;  2GWR A;  1VQL I;  5ILS A;  5IP7 J;  4Y13 A;  3GZ5 A;  2HDW A;  4D7M A;  2XSJ C;  1W36 C;  1ZLJ A;  1RR7 A;  2XPW A;  5K1Y A;  2QQ8 A;  4XIC A;  2ELH A;  2JA2 A;  3NWT A;  1Y39 A;  2OF7 A;  5J8F A;  5HDN A;  3GTJ J;  4W97 A;  1MD0 A;  3J7A O;  5E20 A;  1U5T A;  1UCR A;  4U88 A;  4XKB A;  4FE7 A;  4XL9 A;  3F21 A;  3FKI J;  3T0Y A;  2XAG A;  5M5Y J;  2EIM H;  2JUG A;  4GXO A;  4P5O A;  2HYJ A;  1ZRC A;  2MAB A;  4KT6 A;  1TT5 B;  2QUF A;  1U8B A;  4Y52 J;  2CUF A;  2W85 A;  5IP6 A;  1OCZ H;  2OU2 A;  3GX4 X;  2XGC A;  3H9Q A;  2HPI A;  1X19 A;  2R92 J;  4XLF A;  4AUX A;  2GM4 A;  1OFC X;  3ABL H;  1IUF A;  1E3P A;  2F5V A;  1FYK A;  2R7F A;  4Q48 A;  2HS5 A;  5KVR A;  3E3V A;  1FC3 A;  1W0T A;  2NXN B;  3VSL A;  4CGZ A;  1D5Y A;  2KIF A;  2COB A;  4G7O F;  2Q2E A;  1U6G A;  3GTP J;  1IG7 A;  1ZN2 A;  1X1D A;  4QPO A;  3CCM I;  1XS9 A;  4RGS A;  3PUB A;  1ZK8 A;  4KDP A;  3F8B A;  3OR1 C;  4B47 A;  2MLG A;  2OC6 A;  1ETY A;  3C2G A;  2R7O A;  2QBY A;  1SMT A;  4LLN A;  4BBR J;  2CFX A;  3K6G A;  1WCM J;  2F5E A;  2NOG A;  3OR2 C;  2K86 A;  4CZZ A;  2VC1 A;  1D3Y A;  4L5J A;  2V9P A;  5C3E J;  1OQY A;  5LRS A;  1GT0 C;  1W7P D;  1A5J A;  1R5H A;  1BJZ A;  1JKQ C;  2EV6 A;  3Q3S A;  2NVX J;  4DW6 A;  3S17 J;  1AA7 A;  2WA0 A;  1VQ9 I;  4LMY A;  2M8E A;  4U0W A;  1K78 B;  2E1C A;  2LDU A;  3O6B B;  1NH3 A;  2X6Y A;  5JHF A;  1QHH D;  2NS7 A;  3JRD A;  3V42 A;  4A12 A;  3BTJ A;  1JE8 A;  3H1C A;  3HHG A;  2X48 A;  3KCC A;  2FBK A;  4JX4 A;  1RES A;  1QPM A;  3VFZ A;  5E1W A;  3B73 A;  3A0B C;  4XKV A;  1WJB A;  1SAX A;  3DBL B;  3K4C A;  5CQG A;  3ASN H;  3JR9 A;  1XDU A;  2FA5 A;  2NRA C;  3WTZ A;  4C2T A;  3L2W A;  4YIR X;  2LFB A;  1ON1 A;  2VL8 A;  3H3V K;  2DYR H;  3M4O J;  3WGI A;  1TWF J;  3GYH X;  2WV0 A;  4GRI A;  4PSX A;  4AU7 A;  2QGU A;  5KCM A;  3LOC A;  3E6B A;  2OZ6 A;  1ZQ3 P;  3DU6 A;  3EUK L;  5FB2 A;  4EJT A;  1GXQ A;  4P9U A;  5BPI A;  4G6Q A;  5DM7 F;  2X4H A;  3MZY A;  2NVY J;  3R6S A;  3OYD A;  5KK1 A;  4DYQ A;  1S29 A;  1IZ1 A;  2ZXW H;  1P4X A;  3NQO A;  4DJA A;  2DK5 A;  2KL4 A;  3EET A;  3DKX A;  3GFI A;  1SVM A;  2LBF B;  4CXF A;  5L3D A;  4FQG A;  1BOB A;  3S14 J;  2BEO A;  3FBN B;  5EG0 B;  4EV0 A;  5GAD J;  1TW2 A;  4Y7N J;  3SZG A;  5CJ9 A;  2DPD A;  2VLA A;  1XCB A;  3JW4 A;  4FX0 A;  5FKL A;  3RJP A;  2QQA A;  1L3L A;  1KU9 A;  1K83 J;  3RPU A;  1LUJ B;  3WE2 A;  1STZ A;  1JT0 A;  3KZZ A;  1WI3 A;  3C7J A;  3DKW A;  5CVR A;  3VSK A;  2F6C A;  2E19 A;  5DEQ A;  1XX5 A;  1U8R A;  2XIG A;  2DT7 B;  1IRF A;  1YX5 A;  2ECC A;  2Q8K A;  3PIO F;  1K61 A;  1YRN A;  2L7K A;  2OTL I;  2ADU A;  2R7T A;  5FKN A;  2E2I J;  2WAF A;  5FJ8 J;  1SC7 A;  4KIT B;  4LG0 B;  2OAZ A;  2VOD A;  1XGO A;  1LVK A;  2EA4 A;  1JKP C;  5H20 A;  3Q0V A;  3CZ6 A;  2L7M P;  2CQX A;  2YS9 A;  1R1U A;  1MBF A;  4K2E A;  3W2W A;  3GCM A;  4AM3 A;  4OIQ F;  3K4K A;  2RC4 A;  4CCJ A;  4E7J A;  2FBI A;  3RTR A;  3EUH A;  2IEK A;  1Z67 A;  3MKW B;  2DFH A;  4W1U A;  2P5V A;  1VQP I;  2KZG A;  1Y0U A;  1YW8 A;  3KET A;  1JUM A;  2PMZ N;  4JK1 X;  3DEE A;  1MSE C;  3GVA A;  4ZC3 A;  3E5X A;  1ETO A;  5ED4 A;  2BVL A;  3PIP F;  3R0A A;  6PAX A;  4BYY A;  3PFY A;  3TED A;  1ACI A;  2JJ7 A;  1LEB A;  4EM1 A;  1UB9 A;  2ID3 A;  3HEF A;  2A5W A;  4FHT A;  2ACJ A;  1LFB A;  2EFN A;  2XGE A;  4O5V A;  5FD6 A;  3VYT B;  3MCZ A;  4UV8 A;  3V7S A;  2Z5U A;  4S04 A;  3IC7 A;  2FNP A;  2DMQ A;  3I54 A;  3ASO H;  3BG9 A;  3GW2 A;  1IGN A;  4IHV A;  3IRQ A;  1G2H A;  2VJJ A;  1T33 A;  1K4T A;  4PSW A;  3I71 A;  4II3 A;  2MFZ A;  1XGN A;  1M1E B;  5HLI A;  3GUD A;  2HQN A;  2A6E F;  1TNT A;  4LIV A;  1I6X A;  2K85 A;  3ESW B;  3TO9 A;  4XKW A;  4HF2 A;  3E5U A;  1I27 A;  2ZNY A;  3Q0U A;  2L0K A;  1YYV A;  5FGM A;  3CQZ J;  2KDO A;  3OYB A;  1MBE A;  1RUN A;  2ZXH A;  3NRV A;  2GQQ A;  1EA3 A;  3ZMU A;  2H09 A;  4EAT A;  2K9N A;  3QPT A;  5DD8 A;  5F1R A;  1HKT A;  1IN7 A;  2STW A;  1TQP A;  3F8F A;  2L2O A;  3HTU A;  2MC4 A;  4XRF A;  2DLL A;  5TGT A;  4EMS A;  2RDP A;  1P7I A;  1RET A;  1TZL A;  1K79 A;  3HOX J;  2QSG X;  2DA7 A;  2A5Y B;  3MN2 A;  4XSX F;  4Y3O A;  1Y56 A;  2P7V B;  3WG9 A;  1P4W A;  2ZME B;  3S3O A;  2KIU A;  1V3F A;  4Y15 A;  1RIO H;  5IPA A;  2Z9O A;  3FDY A;  2HOS A;  2V4J C;  3MZH A;  4XN3 A;  5CPR B;  4BE2 A;  4XBF A;  4HNT A;  1FSE A;  2ZFW A;  3GEZ A;  2A68 F;  3C2B A;  2QEN A;  4BE0 A;  3AKZ A;  2P8T A;  3J7Y J;  2LD5 A;  3DLL F;  4ZYE A;  3P5J A;  2ZSI B;  2QQ9 A;  2DOF A;  4KT5 C;  1RNL A;  1PUF B;  1GDT A;  1Q1V A;  1JHH A;  1O57 A;  1CQT A;  5JVG F;  1FWZ A;  4C30 A;  1SFE A;  3SJM A;  2OQR A;  2R5Z B;  2ZSH B;  1YE9 A;  5JR3 A;  1VFC A;  5DDG A;  2ZC2 A;  4OWR B;  1ZR2 A;  4RAG A;  1IO2 A;  3KYD B;  3QOE A;  4JX5 A;  2YU3 A;  2V26 A;  1H8A C;  3BLY A;  1U9N A;  2EB7 A;  1BOA A;  4N9H A;  4XOR A;  3BZC A;  4ZJZ A;  3GXO A;  3BRO A;  4KIB A;  2HEO A;  3QYF A;  4C3J J;  3TQN A;  2DU9 A;  4HAM A;  5JLX A;  2RQQ A;  2RN7 A;  4HF0 A;  2EV0 A;  3J81 Z;  3V4G A;  5HNH A;  2X1C A;  4HX8 A;  3PQJ A;  2IXS A;  1DU6 A;  3DTE A;  1I1S A;  5KNL A;  3ZRG A;  1Z05 A;  1Z7U A;  1SEU A;  1T0F A;  4KN7 X;  2PX9 A;  3OY9 A;  4G9Y A;  3L1P A;  1Y8R B;  1LQ1 A;  2M87 A;  4BS9 A;  2W57 A;  3ELK A;  1YS7 A;  1HF0 A;  3CJR B;  4Y4R A;  2UZK A;  3M7G A;  3K1M A;  3VOE A;  2ZXJ A;  1IJW C;  1APL C;  4GYI A;  4FX4 A;  3QPS A;  5EF6 A;  5IYB J;  1QGP A;  2DQR A;  5FRO A;  3KLN A;  2W25 A;  1OCT C;  3OWT A;  2LH9 A;  3CUQ C;  4CCN A;  4PDK A;  1IN5 A;  3ZQ7 A;  5EGO B;  5IT9 Z;  2HFH A;  3J80 K;  3EYY A;  5J4V A;  2XKP A;  5H6Q A;  4KMU X;  2BXY A;  2EH3 A;  2CW8 A;  2IP2 A;  2EA2 A;  3H3Z A;  1W36 D;  4JOM A;  4CYC B;  4IPA A;  2R3S A;  4ZTF A;  1QVU A;  2Z16 A;  2QSH X;  3P7N A;  2ELK A;  2LOO A;  1YJ9 I;  3OOP A;  4E6K G;  1YTY A;  3KFW X;  2ZJR F;  5F27 A;  2BGC A;  2YUS A;  3S2D J;  1MZB A;  1E3O C;  4YEJ A;  2LBF A;  3M8F A;  1NG6 A;  5EG0 A;  1DP7 P;  1F5T A;  3DWL E;  2L9S A;  1ZLK A;  3ZQH A;  3FM5 A;  1Z6R A;  3RIR A;  3RKX A;  4NC7 A;  2EIK H;  2LK2 A;  1RI7 A;  3GTM J;  5EJC A;  3DF8 A;  2HR3 A;  3O2P E;  2P4W A;  4ZZD A;  5FLM J;  1WRJ A;  3VB2 A;  4BHP A;  1B4A A;  4F92 B;  2EFW A;  3OYI A;  4F55 A;  2L7F P;  2FML A;  3DEW A;  2MBF A;  3DPT A;  2EFO A;  2OUM A;  3ZGK A;  1XSV A;  2HTS A;  1VI0 A;  2XAH A;  2F48 A;  2HI3 A;  2NAZ A;  3RI4 A;  1QRY A;  3TKY A;  4BY7 J;  2CMP A;  3K69 A;  3WTU C;  3G3Z A;  3L2R A;  1VTN C;  4M71 A;  1BR1 A;  1SVO A;  1TC3 C;  1E0E A;  3J81 K;  3IAS 2;  2VJ4 A;  3I59 B;  2D45 A;  3A01 B;  3T1B A;  4JP0 A;  4CA0 A;  2K5C A;  2KIQ A;  3WGH A;  3SQN A;  2FOK A;  1YIT I;  1IDY A;  2YPR A;  4HLX A;  5F6F A;  3GZ6 A;  1MJB A;  1TNS A;  4B8X A;  4BHB A;  2LNB A;  4HYE A;  2DDB A;  5D8L B;  3IH2 A;  1XMK A;  3LSH A;  1C0W A;  3D5R C;  1D1B A;  4KN4 X;  3MWM A;  4ZYG A;  4E70 A;  1X58 A;  3K2Z A;  2E7W A;  3LQR A;  4HPQ A;  4EJU A;  2P0W A;  1R36 A;  1UHW A;  2Y31 A;  5IY5 H;  1X1P A;  1WPK A;  4FT8 A;  4G7Z F;  3OYA A;  4DGW B;  3R60 A;  3G73 A;  2L4A A;  2DMN A;  2F5D A;  2XGD A;  5EZG A;  3EDP A;  4DIQ A;  3Q0W A;  5IT9 K;  2FBH A;  3F8M A;  4OIO F;  2H94 A;  4RAF A;  2WAE A;  3HTS B;  1ZGJ A;  4I02 A;  1NG7 A;  2LR8 A;  2IRF G;  2ELJ A;  2FQ3 A;  3JTH A;  3LQQ A;  3SZP A;  1WHU A;  2JWT A;  2MYS A;  1E17 A;  1Z21 A;  2M0C A;  1F36 A;  1X2M A;  5GAG J;  4QLC U;  1E3H A;  5BMZ A;  4AIJ A;  2MLK A;  2O8X A;  4CCO A;  4YFK F;  2NYX A;  2DBB A;  4XRM A;  2V1U A;  1SD6 A;  1R4M B;  3UKG A;  2RRE A;  2H6C A;  2CQ7 A;  2V6E A;  1UMQ A;  4MQ9 F;  2FEZ A;  4X0G A;  4XM3 A;  4F3Q A;  1TWH J;  1MW7 A;  4WXH A;  1XN7 A;  2A3S A;  3KIO A;  1H88 C;  2IS6 A;  4XR6 A;  3W3C A;  3CC2 I;  1BJA A;  2O3F A;  1ETV A;  3KP4 A;  2KMU A;  2JA8 J;  1VQM I;  1RRJ A;  1MGT A;  2KT0 A;  5C4J J;  4A3E J;  1D1C A;  2UUZ A;  1O7L A;  3H9J A;  3N05 A;  4B44 A;  2BY2 A;  2M7A A;  2BVM A;  4CDG A;  3M8E A;  5E1X A;  2YX7 A;  5E1Z B;  4EQQ A;  5D6E A;  2ZME A;  3D0S A;  3B02 A;  1UZC A;  4O6J A;  2PMU A;  2YX4 A;  5HNF A;  5CVJ A;  2AQF A;  3FK7 A;  4KMF A;  1YQA A;  2JVG A;  3L2V A;  1U5T C;  4A69 C;  4HOB A;  2JA6 J;  1LFP A;  2CWE A;  3OIP A;  4MEX F;  2CRG A;  3HZJ A; 
#chains in the Genus database with same CATH homology
 1HA8 A;  1ERD A;  1WJE A;  4C2U A;  3RPU D;  3SDB A;  3GBG A;  4HEA 2;  3DTI A;  1QHG A;  1P9Q C;  1AA7 A;  4XKC A;  5CQE A;  4F93 B;  2WA0 A;  1OLT A;  5LFA A;  3VWB A;  3UR3 C;  1G8X A;  4QPQ A;  2CV1 A;  3D5L A;  4CCM A;  1GLN A;  3LMM A;  4XLE A;  3OYL A;  2X6Y A;  4IQJ A;  1DP3 A;  2K3P A;  5JHF A;  1QHH D;  3V42 A;  3BCB A;  4XQF A;  2W82 A;  3L2Q A;  2X51 A;  1Z7L A;  4NC8 A;  4C9Y A;  4CH7 A;  4XKV A;  1WJB A;  4C2T A;  3K4C A;  5CQG A;  2L9N A;  3PNY A;  3L2W A;  1MMD A;  4ZDP A;  2VL8 A;  1ZEL A;  2VQL A;  2PJR B;  2R7V A;  4N4O B;  2IGK A;  3H35 A;  4GRI A;  4RM2 A;  4PSX A;  4AU7 A;  3OYH A;  5KCM A;  3CP2 A;  3L2U A;  2XF5 A;  3DU6 A;  3EUK L;  1N78 A;  4IKF A;  2Q2E B;  4FET A;  3BG6 A;  4NNJ A;  3OYD A;  3CP8 A;  3RQ4 A;  4F52 A;  2QKM B;  3OYG A;  2UV1 A;  4DJA A;  2KHM A;  2E5N A;  2KL4 A;  3G2B A;  2M7B A;  3DKX A;  2LBF B;  3DLA A;  4XOT A;  2W1O A;  1BOB A;  2R7S A;  3FBN B;  1DGR M;  4D1Q A;  3H0D A;  2CV0 A;  4YEL A;  4BL0 B;  3HUG B;  1V5E A;  2XF7 A;  3SZG A;  2VKH A;  5FRN A;  4IZZ A;  3KYL A;  2VLA A;  4P1W A;  2E60 A;  2KP6 A;  2VIX A;  4ZDO A;  3S8P A;  2XC7 A;  1U0J A;  4E7Z A;  4YRV A;  2AQE A;  1MND A;  2WAQ A;  2X6W A;  2IGM A;  4FAS D;  1N75 A;  4XLA A;  3VSK A;  3ZQQ A;  3K70 D;  2F6C A;  3PJR A;  3PNV A;  4DBR A;  4B48 A;  3I3L A;  4BJT A;  2DT7 B;  1BR4 A;  1YX5 A;  2V7F A;  3EUA A;  2VKD A;  2Q1Z B;  3S93 A;  2L7K A;  2R7T A;  2E1M C;  1VZ0 A;  3PSF A;  2WAF A;  4BJ6 C;  1X4P A;  3C2H A;  1UEL B;  3MMY B;  3MKY B;  3TL4 X;  4KIT B;  1LVK A;  2X6X A;  4LG3 A;  1JI8 A;  4BQO A;  3OYC A;  3CZ6 A;  1X1A A;  4PJJ A;  4J01 A;  3CJQ B;  3H9G A;  3W2W A;  1WJD A;  3K4K A;  2IS1 A;  2M0M A;  4XMY A;  2HQA A;  4CCJ A;  4E7J A;  2L5Q A;  4RMN A;  3RTR A;  2M4K A;  4DBQ A;  4BXF A;  2Z1D A;  3AFH A;  3MKW B;  2DJI A;  4CSW A;  2M3A A;  2K9M A;  4BGD A;  3ZXS A;  4J00 A;  3DPU A;  3OL3 A;  3DEE A;  2W4S A;  3A2K A;  4B3X A;  4PJL A;  3OS0 A;  4E7S A;  3FBI B;  4ZC3 A;  2BVL A;  3VYS B;  3PFY A;  3HXL A;  2A5W A;  4RLQ A;  4RLF A;  2ZXI A;  4AYB A;  3VYT B;  2WB1 A;  4BUP A;  4E7I A;  4KJZ A;  3K4J A;  3NWS A;  2WY7 Q;  4R79 A;  3OYF A;  3HL2 A;  2PMZ A;  3VDX A;  2HZD A;  4ZDL A;  1MMN A;  3M8J A;  3EUH C;  1D0Z A;  2VJJ A;  2F4I A;  3KX2 A;  4PSW A;  3CES A;  3MD2 A;  4BDY A;  4II3 A;  2MFZ A;  3OYM A;  4BEH A;  3OIQ A;  2WY8 Q;  4LIV A;  3LSM A;  3VYU B;  3W2V A;  4BU2 A;  2VQG A;  2LC2 A;  3OL4 A;  4XKW A;  3AL0 C;  4CCK A;  2X1E A;  1D0X A;  2KDO A;  3OYB A;  2DT6 A;  2HVR A;  2ZXH A;  3QYB A;  1EA3 A;  3H5N A;  3HPG A;  1WJF A;  3LL7 A;  2CV2 A;  2CH0 A;  4EAT A;  2KLO A;  3CMM A;  2VQC A;  2L2O A;  2MC4 A;  5TGT A;  4E4H A;  1TZL A;  3LFU A;  4BJ5 C;  1D0Y A;  2JSP A;  1PJR A;  2GOM A;  3DU5 A;  1IRX A;  5CKT A;  4CUG A;  2VXZ A;  1SFK A;  2QKL B;  2XDV A;  4N4N B;  1Y56 A;  4Y3O A;  3RCO A;  2WBM A;  3S3O A;  1K6Y A;  2BW3 A;  4XOP A;  3HC7 A;  2LRD A;  3FDY A;  2V4J C;  3PNT A;  5HVQ C;  1V5F A;  4HG2 A;  4XN3 A;  5CPR B;  2W7N A;  4HNT A;  4BE2 A;  1T95 A;  1DQU A;  3AL0 B;  3OYK A;  4HSR A;  4BE0 A;  3AKZ A;  4E7K A;  3OOU A;  2KRH A;  4HNU A;  2V1N A;  3ONQ A;  2CW7 A;  4D9J A;  4BQQ A;  3S3M A;  1S9H A;  1OR7 C;  2R7X A;  4BAC A;  4E7L A;  2ZSI B;  1N77 A;  4ITV A;  4C30 A;  1SAU A;  3F9K A;  2ZSH B;  1YE9 A;  2LY1 A;  2GOX B;  4LIU A;  5KHD A;  2IGN A;  3OYJ A;  4OWR B;  2KZV A;  3PSI A;  4XLC A;  3QOE A;  2R7U A;  2V26 A;  3BLY A;  2XF6 A;  2HVS A;  4XOR A;  4KIS A;  4ZJZ A;  1QU3 A;  1WJC A;  3QYF A;  3IP4 B;  1MMA A;  3VYR B;  2RQQ A;  2M4G A;  1X1B A;  3MKZ A;  3S3N A;  1DGW Y;  5HNH A;  3BCA A;  2X1C A;  4CCL A;  5HLT A;  2IXS A;  5LD2 C;  3DTE A;  4PFO A;  5KNL A;  1G59 A;  3ZRG A;  4H4K C;  4G6T B;  2VPL A;  1LKX A;  2V9K A;  3FHN A;  3OY9 A;  3U21 A;  4PUS A;  2X1D A;  4XN0 A;  1J09 A;  4B43 A;  4BS9 A;  2KQR A;  2HU9 A;  1MNE A;  3CJR B;  4Y4R A;  3ZR8 X;  2BW3 B;  3DTK A;  3K4N A;  4NUB A;  2E5Z A;  2RNG A;  3BG7 A;  2OV7 A;  5FRO A;  4OAZ A;  3HPH A;  1TT0 A;  3OWT A;  2LH9 A;  4PK4 A;  3LSG A;  4CCN A;  1BR2 A;  2VJI A;  3E1S A;  3OS1 A;  1X1C A;  4E7H A;  2NOJ B;  2E1M B;  3A1Y A;  2BOL A;  1UAA A;  4Y33 A;  2DCE A;  3SEQ A;  2DOA A;  2PJR A;  1MMG A;  1WJ5 A;  3A4C A;  4DOZ A;  4BDZ A;  1W36 D;  2CW8 A;  2VXD A;  4JOM A;  4ZTF A;  2O5R A;  2Z16 A;  1YX3 A;  1T0F C;  3HG9 A;  3QYE A;  4PJN A;  2LOO A;  2VAS A;  2X85 A;  3SEZ A;  3BC8 A;  4BE1 A;  4OAY A;  4E6K G;  2VQH A;  4XNF A;  3H5A A;  4YEJ A;  3SYT A;  3OS2 A;  2LBF A;  2R4G A;  3DQV C;  4IQ4 A;  1NG6 A;  4BQN A;  2ZFU A;  3DWL E;  2CUJ A;  2L9S A;  1Y6I A;  2FUG 2;  3UNG C;  4ZYA A;  2CUZ A;  4JQF A;  4IX7 A;  2K9L A;  1KON A;  3OYN A;  3LSK A;  2LYC A;  4RM3 A;  4NC7 A;  3S32 A;  4XLH A;  1FMV A;  4F92 B;  3OYI A;  4F55 A;  3IUO A;  3ZCO A;  3DPT A;  2JVH A;  2OUM A;  2WAD A;  3K4M A;  3ZGK A;  4U7B A;  1UG0 A;  3I9V 2;  2MD0 A;  2LG4 A;  3K70 C;  3M1C A;  2CMP A;  3L2R A;  1BR1 A;  2R7W A;  2IS2 A;  1E0E A;  3EPZ A;  2HPM A;  1X4O A;  3IAS 2;  2VJ4 A;  4II2 A;  3D5S C;  1Z3Y A;  4CA0 A;  2K5C A;  4NQW B;  1Z3X A;  1R6R A;  2Z2S B;  3TMO A;  4ZTJ A;  2VJ5 A;  2I8D A;  3K4B A;  2R7R A;  4F91 B;  3LSH A;  3D5R C;  1D1B A;  3K4L A;  1V5G A;  4MLO A;  4HPQ A;  3IAM 2;  2HVQ A;  3K10 A;  2P0W A;  2HNH A;  2R7Q A;  3OYA A;  4BEH B;  4DGW B;  2KRC A;  3CF2 A;  1PYV A;  4AVZ A;  4HRI A;  4DIQ A;  1WFX A;  2UWM A;  2WAE A;  3PL8 A;  1NG7 A;  2LY2 A;  2ELJ A;  3QOD A;  2HDW A;  1W36 C;  1D1A A;  2XSJ C;  3KEY A;  2XAU A;  2MYS A;  1Z21 A;  3J7A Y;  2JA2 A;  3NWT A;  2DXI A;  4CCO A;  3HKZ A;  2Y0S A;  2W00 A;  4ANJ A;  4HST A;  3E0J B;  4XON A;  3TBI A;  2V6E A;  2RRE A;  2LRE A;  3H5R A;  4XKB A;  4XL9 A;  4X0G A;  3W2A A;  4XM3 A;  2KPM A;  4F3Q A;  1MW7 A;  3DPL C;  5HOO A;  2JUG A;  4P5O A;  2IS6 A;  2MAB A;  1LDK B;  4KT6 A;  4LIT A;  4XR6 A;  3W3C A;  4CZC A;  3RSN A;  3OYE A;  3FKJ A;  3H9Q A;  2KMU A;  2HPI A;  1X19 A;  4XLF A;  3LSI A;  1D1C A;  2F5V A;  2IS4 A;  2UUZ A;  5FRM A;  3H9J A;  2A6T A;  2CS3 A;  3N05 A;  2M7A A;  4B44 A;  2BVM A;  3VSL A;  3DKY A;  4PJM A;  2IGO A;  1WJA A;  1X1D A;  4QPO A;  4U87 A;  3HOT A;  3PUB A;  5HNF A;  2AQF A;  3OR1 C;  2JVG A;  4B47 A;  3L2V A;  3OMY A;  2OC6 A;  3C2G A;  2R7O A;  1FMW A;  1LFP A;  3OIP A;  2VB6 A;  4PFP A;  3K6G A;  2CFO A;  3OR2 C;  3HOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...