2M0MA

Structural characterization of minor ampullate spidroin domains and their distinct roles in fibroin solubility and fiber formation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
107
structure length
107
Chain Sequence
VGTTVASTTSRLSTAEASSRISTAASTLVSGGYLNTAALPSVIADLFAQVGASSPGVSDSEVLIQVLLEIVSSLIHILSSSSVGQVDFSSVGSSAAAVGQSMQVVMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein fibril
molecule keywords Minor ampullate fibroin 1
publication title Structural characterization of minor ampullate spidroin domains and their distinct roles in fibroin solubility and fiber formation
pubmed doi rcsb
source organism Nephila antipodiana
total genus 36
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m0mA00
2KHMA 2MABA 2MFZA 2M0MA 2K3PA
chains in the Genus database with same CATH superfamily
3CUQC 4HA8A 5IP7J 3G6EI 3PQKA 1L0OC 3V4GA 2CFOA 4DYQA 1QNTA 4E7JA 5IYDJ 3PM1A 1DDNA 3I58A 5TISC 3PFYA 3KP4A 3JRDA 3TGNA 1SFEA 3OOPA 2MH9A 1BOAA 3BTIA 1JHHA 3CQZJ 2VBYA 4HQEA 2XAQA 2JJ7A 2KRHA 1K6OA 1T98A 1REPC 2LMDA 4OOIA 4AYBN 3K4CA 1TNTA 1ETWA 1IDYA 3W6JB 5B1BH 3MN2A 3AKZA 3E1SA 1J7KA 2HFHA 1YHQI 1FYLA 2NNYA 3KP5A 3OS2A 1P4AA 1JUMA 3F22A 2M7AA 3HUGB 2BZTA 2BXYA 3C2GA 1SAXA 2GZWA 4BS9A 5GAEJ 3M07A 3PUFA 1B59A 4HSRA 1X58A 2H09A 2ISYA 2CQKA 4P9FA 1K4TA 1LDDA 1B8IB 1B8IA 3CF5F 4D7MA 2KZGA 3K4JA 4IZZA 4DYCA 2PI0A 1B1BA 4RAYA 2OQRA 2RGVA 2HTSA 1EH8A 3HRTA 2DI3A 3G1MA 2D45A 5EDNA 2WAQN 4IQJA 1XD7A 2IS2A 2CUJA 1PP7U 3PFIA 1QBJA 2XSDC 5EG0B 4O3MA 4A6DA 5EG0A 3RCOA 3RPQA 1D1AA 1SVOA 1DU6A 5LHGA 2CV0A 1FP2A 4PJNA 1XPXA 3OYLA 4EQQA 2GA2A 3CC4I 2ESHA 4CCOA 1USTA 5AONA 3L9FA 6PAXA 1X3WB 3H92A 1TT0A 1QVTA 4BDZA 1U6GA 1FBSA 2O03A 1UZCA 2A6EF 3K10A 4OMZA 1FX7A 1FNNA 4NBQA 4EMSA 2CW7A 2ECBA 9ANTA 3C1DA 3ZQQA 1IN7A 3GVAA 3D1NI 2CYYA 5ILVA 3F8NA 1NG6A 1A35A 1B4AA 1ZELA 1PUFB 5HODA 1PUFA 1MJAA 1BI3A 3PL8A 2W1OA 3K6GA 5GADJ 4BY1J 4BBSJ 5DUIA 3KYDB 2QWWA 3K1NA 3Q9VA 4BH9A 3REOA 2IVMA 2JK3A 5E3OA 2UV1A 4L5JA 5J8CA 1XSXA 2X6OA 4IX7A 1YX3A 1ZREA 3BCAA 4U0VA 5GAGJ 2EJRA 2X48A 1WCMJ 2M45A 4V19K 1W7PD 1UB9A 4IEJA 3EDPA 1X3UA 2MC3A 3B73A 1WKMA 1GUUA 2F6CA 5K5OA 5GPCA 3ZMDA 1P4XA 1MD0A 1MZBA 1WPKA 2LLKA 5BPDA 4HX8A 4IL6C 2LKXA 1X3ZB 4KT5C 2L0KA 4HEA2 4IVNA 4NB5A 4RGRA 2DMTA 3T1BA 1B6AA 2PMZN 4A3CJ 1D8JA 3FMSA 1MDMB 2JA8J 4FX0A 3G3ZA 2JTVA 4PCQA 4ZYEA 1Z0XA 1X4OA 1HF0A 3IAS2 3DPLC 3H36A 1I1SA 2VE9A 1YQAA 1TT5B 3W2AA 4M3DA 3WGGA 3SDBA 2LKPA 2KP6A 3K4BA 4A0ZA 4WX9A 2MLKA 1R6RA 5L3FA 1R5HA 2MG4A 3T0YA 2YU3A 4S0HB 3B02A 2EV5A 2DW4A 3BJOA 4RDUA 2RV8A 2JT1A 4HLXA 3VEPA 3CCSI 2R7VA 5EZHA 2KDOA 2WY7Q 1VQ6I 3ZQ7A 2MC4A 3DEEA 5JLXA 1SMYF 5KNLA 3BWGA 2DA7A 3HPGA 3K70D 1T2KA 2OTLI 4KFCA 4BHBA 3GWZA 5FROA 2R7DA 5LGUA 5DV5A 4UVAA 4YRVA 1MGTA 2P8TA 3LAPA 2BY1A 2PEXA 3I55I 5CKTA 4I76A 5FO5A 1GVDA 1ETVA 3KP3A 5KCMA 3TQNA 3NEUA 3H0DA 3NAUA 3S1NJ 3UR3C 1MJBA 2ELJA 2Y0SA 4RB0A 3OYDA 2GXAA 1AA7A 2QQ9A 3HOTA 3DPUA 3F0CA 5E79C 1L3LA 3CO7C 1LFBA 4A3MJ 4G6DA 3E5QA 3MEXA 2WV0A 3I53A 2IS6A 5J3LA 5L3CA 2EINH 1G59A 2EBIA 1R4MB 1H0MA 3CCVI 1H9GA 2FF4A 3ABTA 2P5VA 1ZGAA 1ZARA 4PJ0C 2OZUA 3FKIJ 2KIQA 4H0EA 1KONA 3GMEA 2BW3B 3IWZA 1J9IA 4P96A 5B5EC 4DIQA 1X1CA 4YIIA 2JA5J 1ZH5A 2O0YA 4XORA 4A3KJ 4YIRX 5E17F 3L7WA 2L7ZA 1TTYA 4WCGA 1RESA 2DU9A 3JRAA 5EYRA 1UHSA 2R7SA 4XKVA 4DBRA 4BL0B 2QZ8A 1TQPA 5A2QZ 4N0BA 5D4RA 2CS3A 3WU0A 1IW7F 4JX4A 4IOCF 3D5SC 3FBNB 3HSRA 2VOPA 4FCYA 5CVIA 3S3MA 1WGXA 4A0XA 5DDGA 1X1DA 5BMZA 2EH3A 1U2WA 4BE0A 3QYEA 5IYBJ 1ZRDA 3S3NA 1VQOI 3Q0WA 4XQFA 3RJPA 2CFXA 4D1QA 2A69F 3FXJA 1XSVA 4ZYGA 2E34A 3ZMUA 4Q5SF 2O8XA 1BA5A 3DTIA 2HKOA 3CCLI 1QVUA 2DOEA 3E97A 2ZJPF 3DWLE 5EJCA 3F23A 1BI0A 5GTIC 1MKMA 2H6BA 3ZQHA 4D0PA 1I27A 4M9XA 5CVJA 2DDAA 2DMUA 3H9JA 1GXPA 4XN3A 1SD5A 3HTSB 2VJJA 2L3DA 3CMAI 3BPXA 1JJ6C 5FB2A 3TO9A 5ICEA 4HNUA 2KISA 2E1CA 2XPVA 2M9HA 1EH7A 1R23A 3I59A 2H94A 2KHMA 3SQNA 4A6EA 4HLYA 1XG1A 1AOYA 4L0ZB 2XF5A 1EA3A 4AIKA 1YS6A 1BJAA 1ULYA 4E7ZA 3JRIA 2OC6A 1HDPA 2MD0A 3DQVC 2WC2A 3HEFA 1MH4A 2CW0F 2GAUA 2K5CA 3IH4A 3BDDA 4PJLA 2VASA 3L2WA 4IRIA 1FSEA 1IUFA 2HVRA 1MW7A 3FX3A 2LBFA 4NC8A 2LC2A 3HHHA 1JKQC 2DCEA 5ICGA 2XKOA 2VODA 1UJ8A 3ZXSA 2HDDA 2NS8A 2XRNA 4XM3A 1I50J 3BG6A 3HRSA 4GFBA 1IXRC 3NWTA 2EZHA 1Z21A 1RKWA 2EV0A 4RBOA 5FLVA 2EV6A 1GV5A 2ZNYA 3EETA 3BPVA 4M3GA 1T38A 4AIJA 1LQ1A 5LBQA 2IEKA 1RETA 2LY1A 4LK0F 1ETQA 4LLNA 3CMYA 2RREA 4L9TA 3K69A 4I99C 2DA3A 2DTRA 4L9NA 3DEWA 4XKCA 2V1XA 2XSJC 3CJQB 4RGUA 1SVLA 1HBXG 4BAYA 2RN7A 4MFEA 3AAFA 3L2UA 2EFQA 4E7HA 3U1KA 2HEOA 2VIXA 1FIPA 4IJAA 3ERED 4QSHA 5JFRA 1YI2I 1YO5C 3GTLJ 3S2DJ 4H4KC 5FRMA 4CCLA 3BP8A 3K4MA 2M4GA 5HLTA 4U0WA 2JVHA 4UHTA 1R00A 3G1OA 3OR1C 1VQPI 2E35A 3O6BB 3RPUA 5BS6A 3QQAA 3SEQA 3S1RJ 3LAJA 2MW8A 3QWLA 1PDNC 1QQIA 2M2EA 4MLOA 4CUGA 4ZZLA 3Q9SA 1XCVA 4MNUA 3BTLA 2OV7A 2GWRA 4BXUA 3P9IA 2GXBA 2X6YA 2CUEA 1R1VA 3E5XA 2VJ5A 2K9LA 3RDIA 3A02A 1JTYA 5CVUA 5HLIA 3BTCA 4LG3A 3WTXC 3IRRA 4L5EA 1UG2A 2ETHA 3CLOA 2HTJA 3HSFA 1MBJA 4AVPA 1FSHA 4QWQA 1WQ2A 4G7ZF 1W1WE 3BLYA 1G4DA 1IRFA 5DCMB 1XMKA 1M1EB 1N75A 2OTJI 1VQ7I 1I3AA 3WE3A 4BHPA 3GFJA 4ESJA 1OKRA 3LFUA 4LOCA 1TWAJ 1KYZA 1OYIA 2EA2A 2PMUA 2GXGA 3RKYA 1P7JA 3TOAA 5IT3A 1W0UA 3FZVA 1Z9CA 3ABLH 2DPDA 4FASD 5D4SA 4FHTA 4EEFG 1BR1A 3HKZA 1VQ8I 2LF8A 5K5QA 3BOQA 1KU3A 2AO9A 5IOYA 4Q48A 2BOLA 4RMNA 4LMYA 3U21A 3F21A 1RUOA 1LEAA 2EFOA 5ILUA 1QO0D 1IV6A 1ZG5A 1LFPA 2ZKZA 4MEXF 1W36C 2QBYB 1TP4A 2QBYA 1WJ5A 1QGPA 3OL4A 5HS7A 3RQ4A 2DPUA 2FOWA 2RC4A 1BIBA 3F6OA 1FEXA 2XIGA 2VLAA 3WGIA 2NVQJ 4HAMA 2A5YB 1OCRH 1PVEA 4L9JA 4U7DA 3K4LA 2R7QA 3ESWB 3L2CA 2K9QA 4XLFA 4ENKA 1Y0NA 1W0TA 3IKTA 4EJVA 2NVXJ 2FNPA 2CQQA 2XRLA 3K4KA 2K85A 3FK7A 1PUEE 3CO6C 3RKQA 3WG7H 4LLGF 1HSTA 2KQRA 1V5EA 2RAEA 3I9V2 3D5RC 4M6XA 5M5WJ 2JN6A 5J8FA 1BM9A 4DNCA 4UVBA 1ACIA 3PO2J 2NRAC 3K0LA 4C2MJ 2W57A 2IW5A 4XLEA 3OYAA 4BACA 4MQ9F 4GO1A 2JQ7A 4O5VA 3WTVC 2QYOA 4CICA 1YRNB 3JR9A 3K2AA 1XS9A 4CYCA 1YJWI 1R36A 3V7CA 2ISZA 1SEUA 3ABMH 5GPAA 3S32A 1Y1VJ 1TLHB 3BQYA 4MEYF 3KEOA 2H6CA 2V4JC 1WZ2A 2R7TA 3L09A 4UUSB 4UUSA 2PLYA 1S7AA 4U0YA 1IAWA 4YG2F 4R1HA 3GZ5A 1E2XA 2QUFA 1AKHA 3SYTA 2HYGD 2NVTJ 5IOZA 1QZZA 3RZOJ 1BW5A 1GDTA 1RKTA 2P81A 3W6KB 3HOYJ 2CSOA 4KNYA 3BG7A 2YPRA 1Z77A 3S15J 5JI6A 3OWTA 5CJ9A 1BN5A 2O6GE 2E2IJ 1WI3A 2VB6A 4XBFA 2W48A 3WTZA 4IO9F 1J75A 2VXZA 1FC3A 1T39A 4HNVA 2DLLA 4BJ6C 4G12A 2E7WA 3BR0A 4LB6B 3HC7A 4BJTA 1HW5A 1I1GA 1SANA 1X2MA 4HF1A 2R93J 4A3BJ 1YITI 2W85A 3WU2C 5FLMJ 2HOSA 1YJNI 2UXXA 2OU2A 3V8JA 5D5XB 2MD5A 2DODA 4XSZF 3EUKL 3B6AA 2XF6A 2R7WA 2LYCA 3EYIA 4BQOA 4YFXF 3ZQCA 3RSNA 1S7OA 3CDIA 4XLHA 5J4VA 4WK8F 5FKLA 3CCUI 4XRSA 3J81K 2O5RA 1B72A 1JKOC 2ELHA 2FOKA 3OOUA 3S2HJ 3MWMA 2Q8KA 2XHKA 1U9NA 3G71I 2ZC2A 1MMNA 3ECOA 2FXAA 2OCEA 3I4MJ 2XGXA 3EPZA 2M0CA 4M72A 4XLCA 2L9RA 1U9OA 2FA5A 4G8XA 2KIUA 4BQQA 3J80Z 1KZHA 2QQAA 2DQLA 4UB8C 2GLOA 4IRGA 2M5WA 2AXTC 4A12A 4F7ZA 3OYHA 2DMPA 1F4KA 1WJBA 3ISPA 1D8KA 1D0YA 3N97A 1NTCA 3KZYA 4I2OA 5JVTA 2R5YB 5FLXK 2R5YA 3MZ8A 2GOXB 5LRRA 3HGGA 2R4GA 2XAGA 1I5ZA 2WB1N 2HQAA 2BXZA 2QLZA 1USSA 2LSOA 4BBRJ 4RM3A 2KRCA 1X1PA 2XKPA 2EK5A 2GOMA 4IHWA 4OAYA 2F5EA 1OCTC 2F4MB 4NNJA 4L0YB 2MSYA 4FE7A 1J2XA 2JZYA 4KN4X 3EUHA 5FKKA 1T0FA 3IL2A 3T8RA 3FF5A 2D2WA 1J5YA 4AUXA 1YTYA 3M8FA 3GUDA 2VQLA 3GLXA 5DUKA 2YSRA 5FKMA 1GLNA 1BC7C 2OPTA 3MCZA 1IN8A 2YUSA 3ASOH 1JT0A 2FUG2 2M1BA 2HPMA 1HW2A 2GM4A 1MMSA 2DK8A 1R71A 2HQNA 4XICA 4YFNF 3JSOA 1DPRA 3G1LA 2KT0A 5LD2C 2NS0A 3F8BA 1YIJI 4HW0A 2XV4S 4A2UA 3AL0B 3FK6A 2LREA 2GIZA 2ADUA 2EZLA 2WADA 1NHAA 3FDYA 2ZNZA 5F1RA 1WJEA 3AFHA 2VE8A 3M9AA 2LTPA 2G9WA 2XGDA 2HI3A 3H9QA 1KA8A 3WTYC 2DK5A 3BJAA 1O4XA 2IA2A 2M87A 3DPTA 3LSHA 2HDCA 1A31A 2DOFA 2R5ZB 2R5ZA 1XGMA 2UXNA 3NARA 1XMAA 5DD8A 2FQ4A 3DXJF 3OR2C 2FSWA 1J0RA 4KISA 2VONA 4BEHA 3GFLA 1IN6A 2XAFA 5F27A 4F52A 4A5MA 4M74A 3HGYA 4RLFA 4ZJZA 4IHTA 2PN6A 3DTEA 3O8GA 4IPAA 3OYCA 1Y39A 4ITVA 2QA4I 4NQWB 4BUPA 4NQWA 3OSFA 4LFUA 3M1EA 1BIAA 4HPQA 1D1BA 1U0JA 3R6SA 1WJDA 2XB0X 3KZIC 4EV0A 3JW4A 4W1UA 4A3EJ 4NC6A 3OSGA 2HWVA 1OFCX 1XC5A 3RIRA 1VQLI 4I98B 3M7GA 3KCCA 1OR7A 2ZXWH 4B1RA 4C3JJ 2XASA 5BQTA 3TOBA 2JVGA 5C3EJ 3MZYA 4R8HA 5J4YA 3VYSB 2X0LA 2F48A 3GO5A 2RDPA 4OIQF 2ZSIB 2LOOA 4EJWA 5IP6A 2VUMJ 1YG2A 2EIMH 1W36D 3CUQB 3CUQA 2K40A 5D6FA 2DA5A 1ZRCA 4CHUA 5J1UA 3DKWA 3TP3A 2LR8A 1JHFA 2JA7J 3E6DA 3GTQJ 3A0HC 3F72A 5AIQA 1LNWA 4BHCA 4YEJA 4QPQA 4DYRA 3KEYA 2ME0A 2ZFUA 1ON1A 3IH3A 1I6HJ 4M3FA 3HIFA 3LA7A 3S1MJ 3Q0VA 3JCUC 4I0BA 3GXOA 2JRTA 2X1DA 4XLAA 2L9VA 1FJLA 1GT0C 3J7ZI 3ZQIA 3RQIA 3V7SA 1WI9A 4MO7A 1XDUA 4Y33A 3ELKA 5LHIA 5HNHA 5FKNA 3MZHA 1Z6RA 3PIOF 4II2A 3JAMZ 3KYLA 2R7RA 2W00A 3CD6I 3FXOA 1O3RA 1C0WA 2A3SA 3MVPA 1HLVA 4IQ4A 4GYGA 4HF0A 5LFAA 4Y3OA 4FETA 2ZJRF 2DYSH 4OMYA 1YYVA 4D9JA 1V55H 4MQVA 4XIDA 3MD2A 4Y17A 4OWRB 3GTMJ 3UNGC 2L9SA 2LY2A 3F6VA 3HL2A 5EEGA 1VQ9I 4I6ZA 2Z3YA 4AU7A 3OYFA 3OYKA 4L5IA 2DFIA 2CRGA 1X2NA 2Y9YA 2VC1A 1G3TA 1FMWA 2CO5A 2FBKA 1XSDA 5D6EA 2DFHA 3S1QJ 3SDGA 3SFZA 2GQQA 5KAFC 2EILH 2IPQX 5CVRA 5CQGA 3AG4H 4RB3C 3CZ6A 4KUMA 2K9SA 3CDHA 2RNGA 5E1WA 4LITA 2DA1A 1OISA 2HZTA 3Q0UA 3CUOA 2BV6A 2P6SA 2VPRA 3FXKA 2CUFA 2WAEA 5ICFA 3I5UA 2ID6A 3LQQA 1I39A 5KAIC 1LKXA 1T08B 3LFKA 4E7SA 3OS1A 3W3CA 1KQ0A 3HZJA 1NH3A 3IRQA 1GV2A 4ZYDA 4U7BA 2Y69H 5FD5A 1YOVB 2ID3A 4BJ5C 3RZDJ 1XTAA 4X6AJ 3AG2H 2WAFA 3HOXJ 2V9PA 3H0GJ 3A01B 3A01A 1D1CA 4ESFA 3PSFA 3R60A 3L1PA 5LLQA 2F5DA 1T8IA 2R7ZJ 3T8TA 3NQOA 4Z6YA 3H3ZA 2VXDA 3E6MA 4RGSA 1G2HA 3PO3J 5H2FC 1BR2A 3W2WA 4E6KG 5F1JA 1RR7A 5EGOB 4XK4A 5EGOA 2NOGA 3EUAA 4M6YA 2L2OA 2X1CA 3HJEA 2NAZA 4M6VA 1OCOH 1RIOH 1FIAA 4ON0A 4HX4A 2TDXA 1IRGA 4DW6A 2IAIA 1IRZA 2VOOA 4UV9A 1W4MA 1LVAA 3E5UA 4KYWA 2JA6J 2PG4A 4OAZA 1SD6A 4A5NA 1QHHD 2VT3A 1Z05A 2BHYA 1N77A 1X19A 3FXRA 2JA2A 1PP8F 1ZGWA 2FBIA 1P92A 2L7MP 2O8KA 3PUBA 5J1YA 4PSXA 2DJIA 3R4KA 3BR6A 2KDZA 2EIJH 4J01A 3HDDA 1X1BA 2EA4A 5A2QK 3LSTA 2LKSA 1V5GA 4DZPA 2OZ6A 1SFOJ 2AXLA 3IKVA 2QCOA 1JTXA 4XOTA 2LG4A 3I59B 1WWXA 2UZKA 4I02A 2Y9ZA 1S29A 1YIOA 2VPLA 2M0MA 3I3LA 3CESA 4GCVA 1TBXA 5M5YJ 3KX2A 1PYVA 1GVJA 3WTSC 3GX4X 4ENJA 2STWA 5L3DA 5J6XA 4A3JJ 2BY2A 3OYNA 3CC7I 1O3SA 1G3YA 3H5NA 1ON2A 2KLOA 2PBIA 2E2HJ 2Y0SN 4XMYA 4LB5A 3KYCB 1YE9A 3NWSA 2LBFB 5DTDA 3DTKA 3CTAA 5TJJA 3CJNA 3CMMA 2DFEA 3ULQB 2HVQA 4DBQA 2GIVA 1BI2A 1FPQA 2ZO4A 2FNAA 5DM7F 4A3FJ 2M7BA 2Z1DA 3CP2A 5IT9Z 2GA1A 3ZN0A 4AM3A 4C9YA 3HPHA 5LGNA 2VKEA 2CG4A 2PMHA 1BI1A 5E3MA 4J00A 3ASNH 3IH2A 3QYFA 1OPCA 4F93B 4EJTA 3I54A 3P5JA 3HOVJ 1F1ZA 1ZQ3P 4BE1A 4DJAA 2FD5A 2KIMA 3I71A 4TV7A 1IG7A 3BT9A 5LRSA 4IHYA 3GW2A 1MNEA 2D5VA 3DKYA 1TL8A 3S17J 2JWTA 1CGPA 3BZKA 2CQ7A 5E18F 3BG3A 2TCTA 3DLAA 2XUBA 2QENA 3HRUA 2XAUA 3G2BA 3TP0A 5GAHJ 1O3QA 4EGZA 4FISA 1DUXC 3M4OJ 2G7HA 3ABKH 1EJ9A 3C7JA 3F8FA 3DBRB 3DU6A 3V7RA 3O2PE 3MFKA 4IRHA 2IGNA 4XRSG 2P7VB 4XRFA 3H35A 1IUYA 3HOWJ 4NUBA 2WA0A 1FBUA 1O57A 1TQIA 2E1NA 2L02A 4XSXF 3OIQA 1TC3C 3LSMA 4U88A 1K6YA 1LDKB 5EEHA 2Q2EB 3E6CC 2Q2EA 1UELB 1LJ9A 1BR4A 3CP8A 2HXIA 3CCQI 2BEOA 4XLNF 5IP9J 1U3EM 2ZB9A 1ZR2A 1IXSB 1KU9A 2F4IA 1K79A 3TBIA 1LUJB 3I4PA 4F91B 3OY9A 1WJFA 2LH9A 3SZGA 3HRMA 3FISA 1ZLJA 2JRMA 5E3NA 2HOTA 3VWBA 3JRGA 4ESBA 1VNDA 4GDFA 4QLCU 4IOAF 1U8RA 1OQYA 5GP9A 4PJJA 2Z33A 5KK1A 2CU7A 1A6IA 2DBBA 1QZYA 3ZQLA 4A3GJ 1MBFA 4PGGA 3GF2A 2OD5A 3I64A 1WVRA 1U5TC 2K3FA 1TW2A 1S5LC 3A4CA 5HDNA 5F08A 1J09A 3TO6A 4CDGA 2AQFA 3JTHA 2M34A 3M1CA 1SFKA 1TWFJ 4F3QA 3KE2A 2LDUA 3P7NA 3BROA 2IGMA 1VTNC 1Z7UA 2HOAA 2MA3A 4XONA 5DYMA 4NHJA 1G8XA 2CUZA 4IF4A 3CCEI 3H5AA 1ZK8A 1P6RA 2K4JA 1FOWA 3HG9A 1Y6IA 3OYGA 2HYFA 3TW6A 3MKYB 2CH0A 1FBQA 2IP2A 2MH2A 3K2ZA 2KJCA 4PUSA 4RLQA 2KRFA 3TL4X 1ZN2A 4BE2A 1DU0A 4IHXA 1ETYA 2WV1A 1BW6A 5JVGF 4M9SA 3E3VA 1T56A 4L9VA 1STZA 2B7EA 3OL3A 1D3YA 1MJ9A 4RAGA 2E1MC 1MH3A 2HYJA 5J40A 1EKEA 1A36A 1XMXA 1XDSA 5H6QA 1XX5A 2VT2A 1VZ0A 2WTEA 2ZBKA 2R0QC 2QSGX 2UWMA 2W4SA 3DF8A 1WJCA 4F92B 2ZMEC 3VB2A 4B3XA 5B1AH 4X1EA 1KGSA 4HV6A 1JT6A 1POGA 2OUMA 3TEDA 1H9TA 4M71A 4RAZA 1XGNA 4XKWA 2HQRA 3L2QA 2DYRH 1XN7A 2L01A 2L4AA 1VQ5I 5HNFA 3GTKJ 2CV2A 2MYSA 4KIGA 3C2BA 2BYVE 2V9KA 2O9LA 3FXMA 4Z2YA 1K78A 4HRIA 4ZC3A 2E71A 4F55A 1R49A 4CYCB 1GXQA 2FBHA 4ZH4F 2P0WA 2XGCA 2IRFG 1YW8A 2ZXHA 1X4PA 4O6JA 4M73A 5K7FA 2Z16A 1AHDP 4KJZA 2H8RA 4JX6A 3WODF 4LK1F 3IAM2 4I0AA 4RB1A 2RNJA 3MKZA 5D5UB 4KMUX 3S16J 2EFNA 2Y0MA 1AKHB 2FE3A 2F5VA 3GBGA 3RKXA 5IY5H 1T6SA 1JUPA 2BE5F 2L7FP 4PDKA 5EZGA 3ZN1A 1FOYA 1Y56A 1ZTRA 1UHMA 3F8CA 1VQKI 4EGYA 4L18B 3F3XA 4UNOA 3V8LA 4ANJA 3O8HA 2QM3A 4ZDLA 1LPQA 5E3LA 5HDKA 2E5NA 2X85A 3DCFA 1RRJA 1RR8C 2E60A 4V2GA 4G7HF 4HF2A 4AYBA 3W6VA 1F36A 3ZGKA 5M3FJ 1HDDC 4JQFA 3HKZN 3JRBA 1R5ID 3BZ6A 1IJWC 3K1PA 3H3VK 3BR5A 5JHFA 2ZFWA 4ZDPA 1KQ9A 1ZG3A 3OV8A 1IRXA 2A5WA 2KMUA 3QODA 3M8JA 5IPAA 3D0SA 1FOXA 2HPIA 3FBIB 4XKBA 2COBA 3TMOA 4W97A 2Q1ZB 2R7UA 2X9DA 3OIPA 1UHWA 3ZMZA 4MGRA 4B8XA 4KA4A 4JYKA 1TNSA 4GYIA 5F0HA 3EQLF 3KLNA 2IXSA 4IXAA 4Y15A 4AIHA 1B72B 4ENNA 3QP5A 2Y30A 3M8EA 5HS8A 2VQHA 1W7PB 2WAQA 1W7PA 1NK3P 2K27A 1YS7A 4FT8A 5CQEA 2DO7A 3TDZC 3ML6A 2Y31A 4UV8A 2LY9A 2NVUB 4G94A 2F2EA 3C2HA 4Q47A 3GZ6A 2VQGA 2EB7A 1FTTA 1X1AA 4LIVA 2XROA 4YELA 1FLIA 5CLSA 2PQ8A 2YX4A 3WTWC 3JREA 1ZYRF 2Z9OA 4KDPA 1CQTA 1IZ1A 1AWCA 4WF2A 4N9HA 1Z3YA 5H20A 1DPUA 1MBHA 3F8MA 1Y1WJ 4CCMA 1BC8C 5F04A 4HYEA 1F5TA 2OQGA 4ZZDA 1RPWA 5CPRB 4BDYA 2DOAA 4ASNA 1D5VA 4CCJA 4IHSA 3LSPA 2NNNA 1A04A 2ZJQF 2LFBA 3ZP5A 4A69C 1TQMA 4WWCA 1JKPC 1F9NA 5CVVA 1WH7A 1Z67A 1V54H 5FGMA 3X2QH 4KT6A 3H3UA 4CH7A 4BU2A 3HOUJ 1Q1VA 5D5VB 3J80K 1HQCA 1WSUA 3D5LA 4UY8I 2DDBA 2IGKA 2DA4A 1MBEA 2DT7B 3I0TA 5K5RA 1VQ4I 1Y0UA 3GFMA 4JBAA 2KZVA 4CZCA 5HVQC 5KHDA 5L3GA 4E7KA 4Y13A 3ECHA 2IS4A 1MSFC 1W5TA 3HXLA 4ZDOA 3FXUA 4D5FA 2LNBA 3FIWA 5LHHA 5E20A 2XB5A 5HDGA 1XB4A 1EH6A 1ITYA 1OMIA 1OLTA 3E6BA 1FZPB 2QSFX 3KP2A 1ERDA 2XPWA 1RC9A 1ZGJA 5F0FA 2EIKH 1Z6TA 4PSWA 2PMZA 2X51A 3K7AJ 4AIDA 1AU7A 1KYWA 4KMFA 1E17A 2KPMA 5ILSA 3SEZA 3HUGA 3COAC 2ECCA 1RI7A 3AG1H 1OCCH 1ZKGA 3WTUC 4E7IA 1R22A 2V1UA 2AQEA 3IWFA 3TDUC 3FXQA 3LOCA 2Q0OA 5F0CA 3AG3H 4BEHB 4Y4RA 4B48A 3WG9A 2V6EA 3VSLA 4EM1A 4BKXA 1R9TJ 1ONVA 4RB2C 2COMA 4XOPA 1UMQA 3I56I 1S72I 1ODDA 4LLLA 1HSJA 4Q4ZF 4CCKA 1HC8A 3ABUA 3VSKA 2XVCA 4V2FA 2FX0A 5LEJA 3JTGA 2C6YA 3PSIA 1KQ8A 2OAZA 4HSTA 2OBPA 3OIOA 4ABZA 2FEZA 1EF4A 1LEBA 4G6QA 4OINF 1O3TA 4HG2A 3QU3A 1DQUA 2ZSHB 4OU0A 2OCCH 4EM0B 2XPUA 4KITB 3CJRB 1J59A 2QGUA 3A03A 2E1OA 3HBLA 1R5GA 2A05A 2ICWG 1A5JA 3ZR8X 4X0GA 1YJ9I 2V1DA 3PNYA 1MBKA 3BR1A 4GRIA 2Y2ZA 1YLFA 4PJMA 1MMAA 1VQMI 2H8WA 1K61A 3OYMA 2Z5UA 4IHVA 3EYYA 4EM2A 1OYYA 4D5CA 4CSWA 3A2KA 3CCMI 4G6TB 1U8BA 4IKFA 3WE2A 2ME6A 3SXYA 2B0LA 3E7LA 4DOZA 2KFDA 5C4XJ 1V3FA 2K9NA 4C2TA 5BPIA 1SFUA 1FYMA 2TRTA 2X4HA 3ZOBA 3V8KA 3CJTB 1W5CC 3SHFA 4AC0A 1O7FA 1U78A 3ROUA 1B9MA 5D5WB 1KU7A 4FTHA 2K02A 1YFHA 2MFZA 3MKLA 1T33A 2IBDA 1LB2A 2VL8A 3RYRA 3ZCOA 1JUSA 3OYIA 3KZZA 2VBZA 2AS5F 4JK1X 2O3FA 4UB6C 4MHGA 2QKLB 5F64A 1K7AA 2Y75A 5FKOA 3ONQA 3B6CA 2QKMB 3GTOJ 2HU9A 1MDMA 1R58A 3H9GA 4E4HA 4CCNA 2B63J 5K7HA 4EVIA 1S3JA 4B09A 3GTJJ 2A6HF 5TRDA 4RS8A 4HOBA 3SFIA 4BYYA 2MGQA 3WGHA 3DFGA 1T95A 4BQAA 2HOEA 2ZJ2A 5D8LB 3HYIA 5J47A 2B9SA 5EF6A 3S14J 1EV7A 2A6TA 2A07F 3CDLA 5CYVA 1HKSA 3LNQA 1FY7A 3W2VA 4A3LJ 2BVMA 4HDUA 1QA6A 4HDVA 5FFZA 2STTA 3HOZJ 2IA0A 4CO8A 5E1XA 2ELKA 3BCBA 4QPOA 4LGWA 3JAMK 1IC8A 1MNMC 3CCRI 2EQRA 1O7LA 4HX7A 1QHGA 2R3SA 3FWEA 3BG5A 2E36A 3FMQA 1YX5A 1HKQA 3LSGA 2IGOA 5DEQA 1ZLKA 2H1KA 3WTTC 1HA8A 1Y8QB 2JPBA 4MIMA 2X6XA 5HLGA 1HW1A 1KU2A 2W25A 1P9QC 4PK4A 5ED4A 4I09A 4NC7A 5FJ8J 2E19A 2M4KA 3U2RA 2HQ5A 3SZTA 2ESNA 1GHCA 1JKRC 4EATA 4HNTA 4C3HJ 2MABA 3HHGA 4ENMA 3DU5A 2R7XA 3ZQGA 3BY6A 4N4OB 4BNCA 2J5PA 2LK2A 3BC8A 2EZIA 2VQCA 4A93J 4CYDA 2MBFA 3T5XA 1H8AC 3H5RA 3GTPJ 4CXFA 3ZQFA 1JE8A 3BG9A 2VKDA 5B66C 3JSPA 1E3HA 3J7AO 2F4OB 5JR3A 1HXDA 2CQXA 3V42A 4HQMA 1JJ8C 4BQNA 5F6FA 4CZZA 2NYXA 4P9UA 2BW3A 2WBMA 2P5KA 4QIWN 2FRHA 1R1UA 1NK2P 1VQNI 3L2RA 1LE8B 1LE8A 4M3EA 4G7OF 4M3BA 3RTRA 2HKXA 3K9TA 3K1MA 1UCRA 1OCPA 5L3EA 4G9YA 1JGGA 2EFPA 2W82A 2DA6A 4M9ZA 2HGCA 1R4NB 2PJPA 4PGHA 5E8IA 1K83J 2OJED 3KIOA 2JSPA 3FMRA 4HBLA 2YX7A 3HOSA 4DZJA 2QQ8A 2BHZA 3BQZA 3LA2A 1UFMA 1VFCA 2O61A 2A61A 3BJ6A 3DLLF 4UVCA 3DBLB 2HXOA 2X1EA 1R1TA 3R0JA 2LVSA 2HVSA 2FJ1A 1WJAA 3KEQA 3KPHA 1ENHA 2JPCA 1IGNA 3FM5A 2HR3A 2V9VA 2VBXA 3QYBA 3N4MA 2YR2A 3S2WA 1P7IA 4UUTA 2DA2A 3VPRA 1JI8A 5E8GA 4A3IJ 3GFIA 1N78A 2IT0A 4XN0A 4JP0A 1LFUP 2KL4A 2QQBA 3ZMVA 3I4NJ 4BY7J 1SMTA 2DMQA 2DN0A 1D0ZA 2JUCA 1IV8A 1IO2A 4YIFA 3Q5FA 1MSEC 1IF1A 3OMYA 2N8GA 1MMGA 3OYBA 4II3A 2E2JJ 3VOEA 2M30A 2UUZA 2XAHA 1TWGJ 2LF7A 4B4CA 4ZTJA 2EWNA 4DGWB 3CLQA 3CF2A 2AHQA 3QOEA 4OIPF 2V7FA 2PJRB 2PJRA 4OIRF 3A1YA 2K86A 2E7XA 2YS9A 1TW3A 2D1VA 1H88C 1WRJA 4GXOA 2IA1A 1ETXA 5AIPA 1TWHJ 1MIJA 4JOMA 4E70A 3HSEA 5DS9A 2W7NA 2CV1A 1MMDA 4OIOF 3A0BC 4AWXB 1P4WA 3LWFA 3S8PA 4ZYAA 1ZRFA 4CGZA 2ZXJA 5IT9K 4N9IA 2VI6A 4Y7NJ 4YFKF 1PJRA 3ZRGA 4C30A 2E5ZA 1DP3A 1JGSA 2XC7A 2GBYA 2K3PA 2KKOA 3N05A 3E0JB 1QU3A 2H27A 2LD5A 3KFWX 1WHUA 2LRDA 1K4SA 1APLC 1G3SA 1WFXA 3ZMTA 4B43A 2MLGA 1CF7A 1CF7B 3K4NA 2HDWA 3L00A 2CGPA 4HZFA 5DCFA 2V1NA 1QRYA 2Z99A 3F9KA 5DD4A 2NOJB 5K1YA 2I5UA 4MTEA 5H6RA 4Y52J 1V5FA 1VI0A 1DGRM 3QPLA 3PNVA 5DM6F 2FMYA 3C18A 3L2VA 2FU4A 3DV8A 2QSHX 1DP7P 4UUVA 3CMEI 2DAOA 3U9GA 5LGTA 2XAJA 4PZJA 3LA3A 1IXCA 4LD5A 2PX9A 5IYCJ 2BGCA 3LL7A 2M8EA 1SC7A 3IP4B 1YW9A 3GLLA 2V26A 1VF9A 4LIUA 3DBHB 5ERIA 5ICCA 3JRFA 1RUNA 3KP7A 2I8DA 2FMLA 2P5LC 1UAAA 2KJBA 2RKHA 3LQRA 4S05A 4FX4A 1IN4A 4U87A 4P1WA 1XCBA 5HOOA 4B47A 2H1LA 1V4RA 1Z1DA 3S93A 3RYPA 2PFBA 2P4WA 5HS9A 1E3OC 2OF7A 4HV5A 2JMWA 3WHCA 3VYTB 3M3YJ 3WU1B 3P9CA 4KN7X 2L4MA 2EZKA 4C2UA 2DT6A 1IDZA 5L3BA 3OS0A 2VJIA 3MQ0A 1S8NA 1D5YA 4B3AA 2V6CA 5BOXA 5DCMA 3QU6A 1SFXA 2G0EA 1S7EA 2KIFA 2XGEA 5C4JJ 1BOBA 1OYWA 3QRFF 4FQGA 3DEUA 3VODA 2JUGA 4WXDA 2L54A 3FM3A 5HLHA 2W24A 3QOPA 3R0AA 4UXNA 5B3SH 3UKGA 3G4SI 2J5OA 2CWEA 2IJLA 4RGXA 2RVCA 2L7KA 5E1ZB 3QP6A 4ZTFA 1I3QJ 2OA4A 3VDXA 1ETOA 3IV5A 3IHUA 2IS1A 2HNHA 2BY0A 1Z91A 3IC7A 2V79A 4BGDA 3RI4A 2CJJA 3ZPLA 1OCZH 2Y48A 1HOMA 3CC2I 1FWZA 1MNDA 4BXXJ 1FMVA 2NXNB 1G3WA 2K7LA 1ETKA 1FT9A 1LVKA 2CW8A 1QPMA 4CA0A 5KVRA 2HZDA 4RAFA 3VYRB 4N4NB 5C44J 4LG0B 1P2FA 4P5OA 2VJ4A 4LG0A 4NDLA 2WWYA 2G7UA 1SAUA 5D8KB 1IN5A 2QVOA 3FKJA 3BTJA 4K2EA 2P6TA 2XF7A 2M3AA 1W5SA 3FHNA 3SZPA 3GYHX 3VFZA 2VKHA 2EPFA 4WXHA 1XGSA 3J7AY 4A0YA 3J7YJ 4EJOA 1K78B 3IUOA 1I6XA 1FTZA 3OYJA 3LSKA 4E7LA 2DQRA 1Z7LA 3C3WA 4MFDA 3GCMA 3HM5A 5M3MJ 1QPIA 4QTRA 3Q3SA 3CCJI 2BY3A 1UG0A 1YW7A 3DKXA 2P7CB 1WH5A 3QAHA 3DP7A 3TO7A 1S6LA 2DFFA 1G6NA 3OYEA 1MBGA 1QZEA 1SD4A 4D7NA 2L9NA 1B9NA 2VKVA 4XL9A 3KP6A 3JRCA 1LDJA 4KIBA 3PJRA 4JX5A 1TWCJ 2BBYA 1SVMA 1YRNA 2DXIA 5M5XJ 4A3DJ 2DTZA 1NG7A 4ETSA 3ZMSA 2WB1A 1BJZA 4J19A 3PQJA 3FHZA 2ZCWA 3GTGJ 2Z2SB 1ZR4A 1U5TB 1U5TA 3WHBA 5BNGA 3EUHC 4WXCA 1T0FC 1E0EA 2JSCA 2ZXIA 3MMYB 4PFOA 3U1DA 3GEZA 1ZG1A 3TKYA 4AD9A 4MTDA 3K70C 3MKWB 4C3IJ 2D1HA 2M8GX 2R7FA 4XR6A 4PFPA 1FYKA 2K9MA 3QPHA 1DGWY 2QEXI 3LSJA 3RPUD 2A68F 1F43A 2L5QA 1JXSA 1R7JA 3ERMA 2NS7A 1FP1D 2DJNA 2CMPA 5EEAA 1ORKA 3J81Z 2LP0A 4EJUA 3LMMA 2X6WA 4BXFA 4I7HA 2DMNA 1HCRA 3AL0C 2HS5A 2DT5A 3PNTA 3BR2A 4I01A 1RZ4A 2NVYJ 3FXLA 4GGGA 5FFXA 1S9HA 5LEKA 3KETA 3S3OA 1Y8RB 2CQNA 2BVLA 2VBWA 4KICA 4AVZA 2E1MB 1BL0A 2XDVA 3RKWA 3LSIA 3MAJA 2RQPA 2I10A 2VC0A 3GZNB 4S04A 4B44A 2VN2A 1TZLA 1SD7A 1D0XA 1E3PA 2FQ3A 4KIFA 4RM2A 2ZMEB 2ZMEA 5GTHC 3KLOA 3QPTA 5FLXZ 3CCYA 3H1CA 3HB9A 2W84A 5JLWA 2QF7A 5K7ZA 4ZYHA 1H89C 4FE4A 1N25A 4DQ2A 3VYUB 4RA2A 3NRVA 1BBYA 3SJMA 1HKTA 3P9KA 1XGOA 3QPSA 2R92J 3TW7A 5FD6A 2WY8Q 3BR3A 2RQQA 1FOKA 5FRNA 1ZAOA 1Z3XA 3R61A 2R7OA 4LJZF 1OR7C 3PIPF 1RNLA 2K4BA 3LSRA 5TGTA 1OJLA 5JHUA 2ACJA 4XRMA 5J1RA 1A6QA 1Q1HA 2F5FA 3BZCA 2O7OA 4XLPF 2YU9J 3G73A 3O3KA 4P55A 1ZHFA 3JRHA 4XNFA 3HTUA 2F5CA 4R79A 2EFWA
chains in the Genus database with same CATH topology
3CMMA 3RQ4A 4DBQA 2HVQA 3H9GA 4E4HA 4CCNA 2CFOA 4E7JA 2VLAA 2M7BA 3PFYA 3K4LA 2Z1DA 3CP2A 2R7QA 1T95A 4XLFA 4C9YA 3HPHA 4J00A 2A6TA 3K4KA 4F93B 3QYFA 2KRHA 2KQRA 1V5EA 3I9V2 3W2VA 4BE1A 2BVMA 3D5RC 4DJAA 3K4CA 3BCBA 4QPOA 1MNEA 3DKYA 3AKZA 1QHGA 3E1SA 4XLEA 3OYAA 4BACA 1YX5A 3DLAA 3LSGA 2IGOA 3OS2A 2M7AA 3HUGB 2XAUA 3G2BA 3C2GA 4BS9A 1HA8A 2X6XA 3S32A 4HSRA 1P9QC 3K4JA 4PK4A 4IZZA 3DU6A 2V4JC 4NC7A 2R7TA 2M4KA 2IGNA 3H35A 4EATA 4HNTA 4NUBA 2WA0A 2MABA 3DU5A 3SYTA 2R7XA 3OIQA 3LSMA 4IQJA 2IS2A 4N4OB 2CUJA 1K6YA 3BC8A 1LDKB 2Q2EB 1UELB 2VQCA 1BR4A 3H5RA 3CP8A 3RCOA 1D1AA 3BG7A 2VKDA 2CV0A 4PJNA 3OWTA 2F4IA 3OYLA 3TBIA 3V42A 3OY9A 4F91B 4BQNA 2VB6A 4CCOA 1WJFA 2LH9A 1TT0A 3SZGA 2BW3A 2VXZA 2WBMA 4BDZA 3VWBA 3L2RA 4BJ6C 3K10A 3RTRA 3HC7A 4BJTA 4PJJA 2CW7A 2W82A 3ZQQA 1NG6A 2JSPA 3HOSA 3EUKL 1ZELA 3A4CA 2XF6A 2R7WA 2LYCA 1J09A 2W1OA 3K6GA 3PL8A 4BQOA 2AQFA 3RSNA 4XLHA 3M1CA 1SFKA 4F3QA 2O5RA 2UV1A 2X1EA 2IGMA 3OOUA 2HVSA 4XONA 1WJAA 4IX7A 1YX3A 1G8XA 3BCAA 1MMNA 2CUZA 3H5AA 3EPZA 3QYBA 3HG9A 4XLCA 1Y6IA 3OYGA 3MKYB 2CH0A 2F6CA 4RLQA 4PUSA 3TL4X 4BQQA 4BE2A 1JI8A 1N78A 4XN0A 2KL4A 4HEA2 3OYHA 3OL3A 1WJBA 1D0YA 2E1MC 1D0ZA 3OMYA 2GOXB 1MMGA 3OYBA 4II3A 2UUZA 2R4GA 1X4OA 4ZTJA 3IAS2 3DPLC 4DGWB 3CF2A 1VZ0A 2HQAA 3W2AA 2UWMA 2W4SA 1WJCA 4F92B 4RM3A 3K4BA 2KP6A 2KRCA 3SDBA 4B3XA 1R6RA 3QOEA 2V7FA 2GOMA 2PJRB 4XNFA 2PJRA 4OAYA 2OUMA 4NNJA 3A1YA 4XKWA 3L2QA 2R7VA 2KDOA 5HNFA 2WY7Q 2VQLA 2CV2A 2MC4A 2MYSA 3DEEA 5KNLA 2V9KA 3HPGA 3K70D 4JOMA 1GLNA 2W7NA 2CV1A 4HRIA 1MMDA 4ZC3A 5FROA 4F55A 2FUG2 2HPMA 3S8PA 4ZYAA 2P0WA 4YRVA 2ZXHA 1X4PA 5CKTA 5LD2C 2Z16A 5KCMA 4KJZA 1PJRA 3ZRGA 3H0DA 4C30A 2E5ZA 3UR3C 1DP3A 2XC7A 3AL0B 2ELJA 2K3PA 2LREA 2Y0SA 3N05A 3OYDA 3E0JB 3IAM2 1QU3A 1AA7A 2LRDA 2WADA 3HOTA 3MKZA 3DPUA 3FDYA 1WFXA 1WJEA 4B43A 2F5VA 3AFHA 3GBGA 3K4NA 3H9QA 2HDWA 1Y56A 3DPTA 3LSHA 2IS6A 2V1NA 3F9KA 2NOJB 1G59A 3OR2C 4ANJA 1V5FA 4KISA 4ZDLA 1DGRM 3PNVA 4BEHA 2E5NA 2X85A 4F52A 2E60A 4RLFA 3L2VA 4ZJZA 4AYBA 1KONA 3DTEA 3OYCA 2BW3B 3ZGKA 4ITVA 4DIQA 1X1CA 4NQWB 4BUPA 4JQFA 4XORA 4HPQA 1D1BA 1U0JA 5JHFA 1WJDA 4ZDPA 3LL7A 3IP4B 1IRXA 2A5WA 2KMUA 2V26A 3QODA 3M8JA 4LIUA 2HPIA 3FBIB 4XKBA 2I8DA 2R7SA 4XKVA 4DBRA 4BL0B 1UAAA 2CS3A 3TMOA 3D5SC 3FBNB 4U87A 2Q1ZB 4P1WA 5HOOA 3OIPA 2JVGA 4B47A 3S3MA 2R7UA 3S93A 3VYSB 1X1DA 2ZSIB 4BE0A 3QYEA 2IXSA 3VYTB 2LOOA 3S3NA 1W36D 4C2UA 2DT6A 4XQFA 2VQHA 2WAQA 4D1QA 3OS0A 5CQEA 2VJIA 4YEJA 3DTIA 4QPQA 1BOBA 3C2HA 2VQGA 3KEYA 3DWLE 2ZFUA 1X1AA 4LIVA 2JUGA 4YELA 3H9JA 4XN3A 2VJJA 2L7KA 2X1DA 4XLAA 4ZTFA 1Z3YA 4HNUA 4CCMA 3VDXA 2IS1A 5CPRB 2KHMA 4BDYA 2DOAA 2HNHA 4CCJA 4BGDA 4Y33A 2XF5A 1EA3A 1MNDA 5HNHA 4E7ZA 1FMVA 2OC6A 1LVKA 2MD0A 2CW8A 3DQVC 4II2A 3KYLA 2R7RA 2K5CA 2W00A 4CA0A 2HZDA 4PJLA 2VASA 3VYRB 3L2WA 2HVRA 1MW7A 4N4NB 4KT6A 4P5OA 2LBFA 2VJ4A 4IQ4A 4BU2A 4CH7A 4NC8A 2LC2A 5LFAA 4Y3OA 4FETA 1SAUA 3D5LA 2DCEA 2IGKA 3FKJA 4D9JA 2XF7A 2M3AA 3FHNA 2DT7B 3ZXSA 3MD2A 2KZVA 4XM3A 4OWRB 4CZCA 3BG6A 2VKHA 3UNGC 5HVQC 2L9SA 5KHDA 2LY2A 4E7KA 3HL2A 3J7AY 3OYFA 3IUOA 4AU7A 3OYKA 3OYJA 3LSKA 4E7LA 2IS4A 1Z7LA 3NWTA 3HXLA 4ZDOA 1Z21A 1FMWA 1UG0A 3DKXA 1OLTA 3OYEA 1ERDA 2L9NA 4PSWA 4XL9A 2PMZA 2X51A 5CQGA 2LY1A 3CZ6A 3PJRA 2RREA 2RNGA 2KPMA 3SEZA 4XKCA 2DXIA 2XSJC 3CJQB 4LITA 1NG7A 4E7IA 2WB1A 3L2UA 2AQEA 4E7HA 2VIXA 2Z2SB 2WAEA 4H4KC 5FRMA 3EUHC 4CCLA 3K4MA 4BEHB 1T0FC 2M4GA 4Y4RA 4B48A 2ZXIA 1LKXA 3MMYB 4PFOA 5HLTA 1E0EA 2V6EA 2JVHA 3VSLA 4E7SA 3OS1A 4XOPA 3OR1C 3K70C 3MKWB 3W3CA 4XR6A 4PFPA 3SEQA 2K9MA 1DGWY 3RPUD 4CCKA 4U7BA 4MLOA 3VSKA 4CUGA 2L5QA 3PSIA 4BJ5C 2OV7A 2WAFA 4HSTA 1D1CA 2CMPA 2X6YA 3PSFA 3LMMA 2X6WA 4HG2A 4BXFA 3AL0C 2VJ5A 2K9LA 1DQUA 2ZSHB 2VXDA 3PNTA 4KITB 3CJRB 1S9HA 3S3OA 1BR2A 3W2WA 4E6KG 2BVLA 3ZR8X 4X0GA 4AVZA 2E1MB 3EUAA 4LG3A 2XDVA 2L2OA 2X1CA 3LSIA 3PNYA 4GRIA 4PJMA 1MMAA 3OYMA 4B44A 3BLYA 4CSWA 3A2KA 1TZLA 4OAZA 1D0XA 1N75A 4G6TB 1QHHD 4IKFA 4RM2A 1N77A 1X19A 2JA2A 3LFUA 4DOZA 3PUBA 4PSXA 2DJIA 4J01A 4C2TA 1X1BA 3VYUB 1V5GA 4FASD 1BR1A 2WY8Q 2RQQA 3HKZA 5FRNA 4XOTA 2LG4A 1Z3XA 2R7OA 2BOLA 4RMNA 2MFZA 2VPLA 1OR7C 2M0MA 3U21A 3I3LA 2VL8A 3ZCOA 5TGTA 3CESA 3OYIA 3KX2A 1PYVA 3OYNA 2QKLB 3H5NA 1LFPA 2KLOA 4XMYA 1W36C 1YE9A 3ONQA 3NWSA 1WJ5A 2QKMB 3DTKA 2LBFB 2HU9A 4R79A 3OL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHM A;  2MAB A;  2MFZ A;  2M0M A;  2K3P A; 
#chains in the Genus database with same CATH topology
 3CUQ C;  4HA8 A;  5IP7 J;  3G6E I;  3PQK A;  1L0O C;  3V4G A;  2CFO A;  4DYQ A;  1QNT A;  4E7J A;  5IYD J;  3PM1 A;  1DDN A;  3I58 A;  5TIS C;  3PFY A;  3KP4 A;  3JRD A;  3TGN A;  1SFE A;  3OOP A;  2MH9 A;  1BOA A;  3BTI A;  1JHH A;  3CQZ J;  2VBY A;  4HQE A;  2XAQ A;  2JJ7 A;  2KRH A;  1K6O A;  1T98 A;  1REP C;  2LMD A;  4OOI A;  4AYB N;  3K4C A;  1TNT A;  1ETW A;  1IDY A;  3W6J B;  5B1B H;  3MN2 A;  3AKZ A;  3E1S A;  1J7K A;  2HFH A;  1YHQ I;  1FYL A;  2NNY A;  3KP5 A;  3OS2 A;  1P4A A;  1JUM A;  3F22 A;  2M7A A;  3HUG B;  2BZT A;  2BXY A;  3C2G A;  1SAX A;  2GZW A;  4BS9 A;  5GAE J;  3M07 A;  3PUF A;  1B59 A;  4HSR A;  1X58 A;  2H09 A;  2ISY A;  2CQK A;  4P9F A;  1K4T A;  1LDD A;  1B8I B;  1B8I A;  3CF5 F;  4D7M A;  2KZG A;  3K4J A;  4IZZ A;  4DYC A;  2PI0 A;  1B1B A;  4RAY A;  2OQR A;  2RGV A;  2HTS A;  1EH8 A;  3HRT A;  2DI3 A;  3G1M A;  2D45 A;  5EDN A;  2WAQ N;  4IQJ A;  1XD7 A;  2IS2 A;  2CUJ A;  1PP7 U;  3PFI A;  1QBJ A;  2XSD C;  5EG0 B;  4O3M A;  4A6D A;  5EG0 A;  3RCO A;  3RPQ A;  1D1A A;  1SVO A;  1DU6 A;  5LHG A;  2CV0 A;  1FP2 A;  4PJN A;  1XPX A;  3OYL A;  4EQQ A;  2GA2 A;  3CC4 I;  2ESH A;  4CCO A;  1UST A;  5AON A;  3L9F A;  6PAX A;  1X3W B;  3H92 A;  1TT0 A;  1QVT A;  4BDZ A;  1U6G A;  1FBS A;  2O03 A;  1UZC A;  2A6E F;  3K10 A;  4OMZ A;  1FX7 A;  1FNN A;  4NBQ A;  4EMS A;  2CW7 A;  2ECB A;  9ANT A;  3C1D A;  3ZQQ A;  1IN7 A;  3GVA A;  3D1N I;  2CYY A;  5ILV A;  3F8N A;  1NG6 A;  1A35 A;  1B4A A;  1ZEL A;  1PUF B;  5HOD A;  1PUF A;  1MJA A;  1BI3 A;  3PL8 A;  2W1O A;  3K6G A;  5GAD J;  4BY1 J;  4BBS J;  5DUI A;  3KYD B;  2QWW A;  3K1N A;  3Q9V A;  4BH9 A;  3REO A;  2IVM A;  2JK3 A;  5E3O A;  2UV1 A;  4L5J A;  5J8C A;  1XSX A;  2X6O A;  4IX7 A;  1YX3 A;  1ZRE A;  3BCA A;  4U0V A;  5GAG J;  2EJR A;  2X48 A;  1WCM J;  2M45 A;  4V19 K;  1W7P D;  1UB9 A;  4IEJ A;  3EDP A;  1X3U A;  2MC3 A;  3B73 A;  1WKM A;  1GUU A;  2F6C A;  5K5O A;  5GPC A;  3ZMD A;  1P4X A;  1MD0 A;  1MZB A;  1WPK A;  2LLK A;  5BPD A;  4HX8 A;  4IL6 C;  2LKX A;  1X3Z B;  4KT5 C;  2L0K A;  4HEA 2;  4IVN A;  4NB5 A;  4RGR A;  2DMT A;  3T1B A;  1B6A A;  2PMZ N;  4A3C J;  1D8J A;  3FMS A;  1MDM B;  2JA8 J;  4FX0 A;  3G3Z A;  2JTV A;  4PCQ A;  4ZYE A;  1Z0X A;  1X4O A;  1HF0 A;  3IAS 2;  3DPL C;  3H36 A;  1I1S A;  2VE9 A;  1YQA A;  1TT5 B;  3W2A A;  4M3D A;  3WGG A;  3SDB A;  2LKP A;  2KP6 A;  3K4B A;  4A0Z A;  4WX9 A;  2MLK A;  1R6R A;  5L3F A;  1R5H A;  2MG4 A;  3T0Y A;  2YU3 A;  4S0H B;  3B02 A;  2EV5 A;  2DW4 A;  3BJO A;  4RDU A;  2RV8 A;  2JT1 A;  4HLX A;  3VEP A;  3CCS I;  2R7V A;  5EZH A;  2KDO A;  2WY7 Q;  1VQ6 I;  3ZQ7 A;  2MC4 A;  3DEE A;  5JLX A;  1SMY F;  5KNL A;  3BWG A;  2DA7 A;  3HPG A;  3K70 D;  1T2K A;  2OTL I;  4KFC A;  4BHB A;  3GWZ A;  5FRO A;  2R7D A;  5LGU A;  5DV5 A;  4UVA A;  4YRV A;  1MGT A;  2P8T A;  3LAP A;  2BY1 A;  2PEX A;  3I55 I;  5CKT A;  4I76 A;  5FO5 A;  1GVD A;  1ETV A;  3KP3 A;  5KCM A;  3TQN A;  3NEU A;  3H0D A;  3NAU A;  3S1N J;  3UR3 C;  1MJB A;  2ELJ A;  2Y0S A;  4RB0 A;  3OYD A;  2GXA A;  1AA7 A;  2QQ9 A;  3HOT A;  3DPU A;  3F0C A;  5E79 C;  1L3L A;  3CO7 C;  1LFB A;  4A3M J;  4G6D A;  3E5Q A;  3MEX A;  2WV0 A;  3I53 A;  2IS6 A;  5J3L A;  5L3C A;  2EIN H;  1G59 A;  2EBI A;  1R4M B;  1H0M A;  3CCV I;  1H9G A;  2FF4 A;  3ABT A;  2P5V A;  1ZGA A;  1ZAR A;  4PJ0 C;  2OZU A;  3FKI J;  2KIQ A;  4H0E A;  1KON A;  3GME A;  2BW3 B;  3IWZ A;  1J9I A;  4P96 A;  5B5E C;  4DIQ A;  1X1C A;  4YII A;  2JA5 J;  1ZH5 A;  2O0Y A;  4XOR A;  4A3K J;  4YIR X;  5E17 F;  3L7W A;  2L7Z A;  1TTY A;  4WCG A;  1RES A;  2DU9 A;  3JRA A;  5EYR A;  1UHS A;  2R7S A;  4XKV A;  4DBR A;  4BL0 B;  2QZ8 A;  1TQP A;  5A2Q Z;  4N0B A;  5D4R A;  2CS3 A;  3WU0 A;  1IW7 F;  4JX4 A;  4IOC F;  3D5S C;  3FBN B;  3HSR A;  2VOP A;  4FCY A;  5CVI A;  3S3M A;  1WGX A;  4A0X A;  5DDG A;  1X1D A;  5BMZ A;  2EH3 A;  1U2W A;  4BE0 A;  3QYE A;  5IYB J;  1ZRD A;  3S3N A;  1VQO I;  3Q0W A;  4XQF A;  3RJP A;  2CFX A;  4D1Q A;  2A69 F;  3FXJ A;  1XSV A;  4ZYG A;  2E34 A;  3ZMU A;  4Q5S F;  2O8X A;  1BA5 A;  3DTI A;  2HKO A;  3CCL I;  1QVU A;  2DOE A;  3E97 A;  2ZJP F;  3DWL E;  5EJC A;  3F23 A;  1BI0 A;  5GTI C;  1MKM A;  2H6B A;  3ZQH A;  4D0P A;  1I27 A;  4M9X A;  5CVJ A;  2DDA A;  2DMU A;  3H9J A;  1GXP A;  4XN3 A;  1SD5 A;  3HTS B;  2VJJ A;  2L3D A;  3CMA I;  3BPX A;  1JJ6 C;  5FB2 A;  3TO9 A;  5ICE A;  4HNU A;  2KIS A;  2E1C A;  2XPV A;  2M9H A;  1EH7 A;  1R23 A;  3I59 A;  2H94 A;  2KHM A;  3SQN A;  4A6E A;  4HLY A;  1XG1 A;  1AOY A;  4L0Z B;  2XF5 A;  1EA3 A;  4AIK A;  1YS6 A;  1BJA A;  1ULY A;  4E7Z A;  3JRI A;  2OC6 A;  1HDP A;  2MD0 A;  3DQV C;  2WC2 A;  3HEF A;  1MH4 A;  2CW0 F;  2GAU A;  2K5C A;  3IH4 A;  3BDD A;  4PJL A;  2VAS A;  3L2W A;  4IRI A;  1FSE A;  1IUF A;  2HVR A;  1MW7 A;  3FX3 A;  2LBF A;  4NC8 A;  2LC2 A;  3HHH A;  1JKQ C;  2DCE A;  5ICG A;  2XKO A;  2VOD A;  1UJ8 A;  3ZXS A;  2HDD A;  2NS8 A;  2XRN A;  4XM3 A;  1I50 J;  3BG6 A;  3HRS A;  4GFB A;  1IXR C;  3NWT A;  2EZH A;  1Z21 A;  1RKW A;  2EV0 A;  4RBO A;  5FLV A;  2EV6 A;  1GV5 A;  2ZNY A;  3EET A;  3BPV A;  4M3G A;  1T38 A;  4AIJ A;  1LQ1 A;  5LBQ A;  2IEK A;  1RET A;  2LY1 A;  4LK0 F;  1ETQ A;  4LLN A;  3CMY A;  2RRE A;  4L9T A;  3K69 A;  4I99 C;  2DA3 A;  2DTR A;  4L9N A;  3DEW A;  4XKC A;  2V1X A;  2XSJ C;  3CJQ B;  4RGU A;  1SVL A;  1HBX G;  4BAY A;  2RN7 A;  4MFE A;  3AAF A;  3L2U A;  2EFQ A;  4E7H A;  3U1K A;  2HEO A;  2VIX A;  1FIP A;  4IJA A;  3ERE D;  4QSH A;  5JFR A;  1YI2 I;  1YO5 C;  3GTL J;  3S2D J;  4H4K C;  5FRM A;  4CCL A;  3BP8 A;  3K4M A;  2M4G A;  5HLT A;  4U0W A;  2JVH A;  4UHT A;  1R00 A;  3G1O A;  3OR1 C;  1VQP I;  2E35 A;  3O6B B;  3RPU A;  5BS6 A;  3QQA A;  3SEQ A;  3S1R J;  3LAJ A;  2MW8 A;  3QWL A;  1PDN C;  1QQI A;  2M2E A;  4MLO A;  4CUG A;  4ZZL A;  3Q9S A;  1XCV A;  4MNU A;  3BTL A;  2OV7 A;  2GWR A;  4BXU A;  3P9I A;  2GXB A;  2X6Y A;  2CUE A;  1R1V A;  3E5X A;  2VJ5 A;  2K9L A;  3RDI A;  3A02 A;  1JTY A;  5CVU A;  5HLI A;  3BTC A;  4LG3 A;  3WTX C;  3IRR A;  4L5E A;  1UG2 A;  2ETH A;  3CLO A;  2HTJ A;  3HSF A;  1MBJ A;  4AVP A;  1FSH A;  4QWQ A;  1WQ2 A;  4G7Z F;  1W1W E;  3BLY A;  1G4D A;  1IRF A;  5DCM B;  1XMK A;  1M1E B;  1N75 A;  2OTJ I;  1VQ7 I;  1I3A A;  3WE3 A;  4BHP A;  3GFJ A;  4ESJ A;  1OKR A;  3LFU A;  4LOC A;  1TWA J;  1KYZ A;  1OYI A;  2EA2 A;  2PMU A;  2GXG A;  3RKY A;  1P7J A;  3TOA A;  5IT3 A;  1W0U A;  3FZV A;  1Z9C A;  3ABL H;  2DPD A;  4FAS D;  5D4S A;  4FHT A;  4EEF G;  1BR1 A;  3HKZ A;  1VQ8 I;  2LF8 A;  5K5Q A;  3BOQ A;  1KU3 A;  2AO9 A;  5IOY A;  4Q48 A;  2BOL A;  4RMN A;  4LMY A;  3U21 A;  3F21 A;  1RUO A;  1LEA A;  2EFO A;  5ILU A;  1QO0 D;  1IV6 A;  1ZG5 A;  1LFP A;  2ZKZ A;  4MEX F;  1W36 C;  2QBY B;  1TP4 A;  2QBY A;  1WJ5 A;  1QGP A;  3OL4 A;  5HS7 A;  3RQ4 A;  2DPU A;  2FOW A;  2RC4 A;  1BIB A;  3F6O A;  1FEX A;  2XIG A;  2VLA A;  3WGI A;  2NVQ J;  4HAM A;  2A5Y B;  1OCR H;  1PVE A;  4L9J A;  4U7D A;  3K4L A;  2R7Q A;  3ESW B;  3L2C A;  2K9Q A;  4XLF A;  4ENK A;  1Y0N A;  1W0T A;  3IKT A;  4EJV A;  2NVX J;  2FNP A;  2CQQ A;  2XRL A;  3K4K A;  2K85 A;  3FK7 A;  1PUE E;  3CO6 C;  3RKQ A;  3WG7 H;  4LLG F;  1HST A;  2KQR A;  1V5E A;  2RAE A;  3I9V 2;  3D5R C;  4M6X A;  5M5W J;  2JN6 A;  5J8F A;  1BM9 A;  4DNC A;  4UVB A;  1ACI A;  3PO2 J;  2NRA C;  3K0L A;  4C2M J;  2W57 A;  2IW5 A;  4XLE A;  3OYA A;  4BAC A;  4MQ9 F;  4GO1 A;  2JQ7 A;  4O5V A;  3WTV C;  2QYO A;  4CIC A;  1YRN B;  3JR9 A;  3K2A A;  1XS9 A;  4CYC A;  1YJW I;  1R36 A;  3V7C A;  2ISZ A;  1SEU A;  3ABM H;  5GPA A;  3S32 A;  1Y1V J;  1TLH B;  3BQY A;  4MEY F;  3KEO A;  2H6C A;  2V4J C;  1WZ2 A;  2R7T A;  3L09 A;  4UUS B;  4UUS A;  2PLY A;  1S7A A;  4U0Y A;  1IAW A;  4YG2 F;  4R1H A;  3GZ5 A;  1E2X A;  2QUF A;  1AKH A;  3SYT A;  2HYG D;  2NVT J;  5IOZ A;  1QZZ A;  3RZO J;  1BW5 A;  1GDT A;  1RKT A;  2P81 A;  3W6K B;  3HOY J;  2CSO A;  4KNY A;  3BG7 A;  2YPR A;  1Z77 A;  3S15 J;  5JI6 A;  3OWT A;  5CJ9 A;  1BN5 A;  2O6G E;  2E2I J;  1WI3 A;  2VB6 A;  4XBF A;  2W48 A;  3WTZ A;  4IO9 F;  1J75 A;  2VXZ A;  1FC3 A;  1T39 A;  4HNV A;  2DLL A;  4BJ6 C;  4G12 A;  2E7W A;  3BR0 A;  4LB6 B;  3HC7 A;  4BJT A;  1HW5 A;  1I1G A;  1SAN A;  1X2M A;  4HF1 A;  2R93 J;  4A3B J;  1YIT I;  2W85 A;  3WU2 C;  5FLM J;  2HOS A;  1YJN I;  2UXX A;  2OU2 A;  3V8J A;  5D5X B;  2MD5 A;  2DOD A;  4XSZ F;  3EUK L;  3B6A A;  2XF6 A;  2R7W A;  2LYC A;  3EYI A;  4BQO A;  4YFX F;  3ZQC A;  3RSN A;  1S7O A;  3CDI A;  4XLH A;  5J4V A;  4WK8 F;  5FKL A;  3CCU I;  4XRS A;  3J81 K;  2O5R A;  1B72 A;  1JKO C;  2ELH A;  2FOK A;  3OOU A;  3S2H J;  3MWM A;  2Q8K A;  2XHK A;  1U9N A;  3G71 I;  2ZC2 A;  1MMN A;  3ECO A;  2FXA A;  2OCE A;  3I4M J;  2XGX A;  3EPZ A;  2M0C A;  4M72 A;  4XLC A;  2L9R A;  1U9O A;  2FA5 A;  4G8X A;  2KIU A;  4BQQ A;  3J80 Z;  1KZH A;  2QQA A;  2DQL A;  4UB8 C;  2GLO A;  4IRG A;  2M5W A;  2AXT C;  4A12 A;  4F7Z A;  3OYH A;  2DMP A;  1F4K A;  1WJB A;  3ISP A;  1D8K A;  1D0Y A;  3N97 A;  1NTC A;  3KZY A;  4I2O A;  5JVT A;  2R5Y B;  5FLX K;  2R5Y A;  3MZ8 A;  2GOX B;  5LRR A;  3HGG A;  2R4G A;  2XAG A;  1I5Z A;  2WB1 N;  2HQA A;  2BXZ A;  2QLZ A;  1USS A;  2LSO A;  4BBR J;  4RM3 A;  2KRC A;  1X1P A;  2XKP A;  2EK5 A;  2GOM A;  4IHW A;  4OAY A;  2F5E A;  1OCT C;  2F4M B;  4NNJ A;  4L0Y B;  2MSY A;  4FE7 A;  1J2X A;  2JZY A;  4KN4 X;  3EUH A;  5FKK A;  1T0F A;  3IL2 A;  3T8R A;  3FF5 A;  2D2W A;  1J5Y A;  4AUX A;  1YTY A;  3M8F A;  3GUD A;  2VQL A;  3GLX A;  5DUK A;  2YSR A;  5FKM A;  1GLN A;  1BC7 C;  2OPT A;  3MCZ A;  1IN8 A;  2YUS A;  3ASO H;  1JT0 A;  2FUG 2;  2M1B A;  2HPM A;  1HW2 A;  2GM4 A;  1MMS A;  2DK8 A;  1R71 A;  2HQN A;  4XIC A;  4YFN F;  3JSO A;  1DPR A;  3G1L A;  2KT0 A;  5LD2 C;  2NS0 A;  3F8B A;  1YIJ I;  4HW0 A;  2XV4 S;  4A2U A;  3AL0 B;  3FK6 A;  2LRE A;  2GIZ A;  2ADU A;  2EZL A;  2WAD A;  1NHA A;  3FDY A;  2ZNZ A;  5F1R A;  1WJE A;  3AFH A;  2VE8 A;  3M9A A;  2LTP A;  2G9W A;  2XGD A;  2HI3 A;  3H9Q A;  1KA8 A;  3WTY C;  2DK5 A;  3BJA A;  1O4X A;  2IA2 A;  2M87 A;  3DPT A;  3LSH A;  2HDC A;  1A31 A;  2DOF A;  2R5Z B;  2R5Z A;  1XGM A;  2UXN A;  3NAR A;  1XMA A;  5DD8 A;  2FQ4 A;  3DXJ F;  3OR2 C;  2FSW A;  1J0R A;  4KIS A;  2VON A;  4BEH A;  3GFL A;  1IN6 A;  2XAF A;  5F27 A;  4F52 A;  4A5M A;  4M74 A;  3HGY A;  4RLF A;  4ZJZ A;  4IHT A;  2PN6 A;  3DTE A;  3O8G A;  4IPA A;  3OYC A;  1Y39 A;  4ITV A;  2QA4 I;  4NQW B;  4BUP A;  4NQW A;  3OSF A;  4LFU A;  3M1E A;  1BIA A;  4HPQ A;  1D1B A;  1U0J A;  3R6S A;  1WJD A;  2XB0 X;  3KZI C;  4EV0 A;  3JW4 A;  4W1U A;  4A3E J;  4NC6 A;  3OSG A;  2HWV A;  1OFC X;  1XC5 A;  3RIR A;  1VQL I;  4I98 B;  3M7G A;  3KCC A;  1OR7 A;  2ZXW H;  4B1R A;  4C3J J;  2XAS A;  5BQT A;  3TOB A;  2JVG A;  5C3E J;  3MZY A;  4R8H A;  5J4Y A;  3VYS B;  2X0L A;  2F48 A;  3GO5 A;  2RDP A;  4OIQ F;  2ZSI B;  2LOO A;  4EJW A;  5IP6 A;  2VUM J;  1YG2 A;  2EIM H;  1W36 D;  3CUQ B;  3CUQ A;  2K40 A;  5D6F A;  2DA5 A;  1ZRC A;  4CHU A;  5J1U A;  3DKW A;  3TP3 A;  2LR8 A;  1JHF A;  2JA7 J;  3E6D A;  3GTQ J;  3A0H C;  3F72 A;  5AIQ A;  1LNW A;  4BHC A;  4YEJ A;  4QPQ A;  4DYR A;  3KEY A;  2ME0 A;  2ZFU A;  1ON1 A;  3IH3 A;  1I6H J;  4M3F A;  3HIF A;  3LA7 A;  3S1M J;  3Q0V A;  3JCU C;  4I0B A;  3GXO A;  2JRT A;  2X1D A;  4XLA A;  2L9V A;  1FJL A;  1GT0 C;  3J7Z I;  3ZQI A;  3RQI A;  3V7S A;  1WI9 A;  4MO7 A;  1XDU A;  4Y33 A;  3ELK A;  5LHI A;  5HNH A;  5FKN A;  3MZH A;  1Z6R A;  3PIO F;  4II2 A;  3JAM Z;  3KYL A;  2R7R A;  2W00 A;  3CD6 I;  3FXO A;  1O3R A;  1C0W A;  2A3S A;  3MVP A;  1HLV A;  4IQ4 A;  4GYG A;  4HF0 A;  5LFA A;  4Y3O A;  4FET A;  2ZJR F;  2DYS H;  4OMY A;  1YYV A;  4D9J A;  1V55 H;  4MQV A;  4XID A;  3MD2 A;  4Y17 A;  4OWR B;  3GTM J;  3UNG C;  2L9S A;  2LY2 A;  3F6V A;  3HL2 A;  5EEG A;  1VQ9 I;  4I6Z A;  2Z3Y A;  4AU7 A;  3OYF A;  3OYK A;  4L5I A;  2DFI A;  2CRG A;  1X2N A;  2Y9Y A;  2VC1 A;  1G3T A;  1FMW A;  2CO5 A;  2FBK A;  1XSD A;  5D6E A;  2DFH A;  3S1Q J;  3SDG A;  3SFZ A;  2GQQ A;  5KAF C;  2EIL H;  2IPQ X;  5CVR A;  5CQG A;  3AG4 H;  4RB3 C;  3CZ6 A;  4KUM A;  2K9S A;  3CDH A;  2RNG A;  5E1W A;  4LIT A;  2DA1 A;  1OIS A;  2HZT A;  3Q0U A;  3CUO A;  2BV6 A;  2P6S A;  2VPR A;  3FXK A;  2CUF A;  2WAE A;  5ICF A;  3I5U A;  2ID6 A;  3LQQ A;  1I39 A;  5KAI C;  1LKX A;  1T08 B;  3LFK A;  4E7S A;  3OS1 A;  3W3C A;  1KQ0 A;  3HZJ A;  1NH3 A;  3IRQ A;  1GV2 A;  4ZYD A;  4U7B A;  2Y69 H;  5FD5 A;  1YOV B;  2ID3 A;  4BJ5 C;  3RZD J;  1XTA A;  4X6A J;  3AG2 H;  2WAF A;  3HOX J;  2V9P A;  3H0G J;  3A01 B;  3A01 A;  1D1C A;  4ESF A;  3PSF A;  3R60 A;  3L1P A;  5LLQ A;  2F5D A;  1T8I A;  2R7Z J;  3T8T A;  3NQO A;  4Z6Y A;  3H3Z A;  2VXD A;  3E6M A;  4RGS A;  1G2H A;  3PO3 J;  5H2F C;  1BR2 A;  3W2W A;  4E6K G;  5F1J A;  1RR7 A;  5EGO B;  4XK4 A;  5EGO A;  2NOG A;  3EUA A;  4M6Y A;  2L2O A;  2X1C A;  3HJE A;  2NAZ A;  4M6V A;  1OCO H;  1RIO H;  1FIA A;  4ON0 A;  4HX4 A;  2TDX A;  1IRG A;  4DW6 A;  2IAI A;  1IRZ A;  2VOO A;  4UV9 A;  1W4M A;  1LVA A;  3E5U A;  4KYW A;  2JA6 J;  2PG4 A;  4OAZ A;  1SD6 A;  4A5N A;  1QHH D;  2VT3 A;  1Z05 A;  2BHY A;  1N77 A;  1X19 A;  3FXR A;  2JA2 A;  1PP8 F;  1ZGW A;  2FBI A;  1P92 A;  2L7M P;  2O8K A;  3PUB A;  5J1Y A;  4PSX A;  2DJI A;  3R4K A;  3BR6 A;  2KDZ A;  2EIJ H;  4J01 A;  3HDD A;  1X1B A;  2EA4 A;  5A2Q K;  3LST A;  2LKS A;  1V5G A;  4DZP A;  2OZ6 A;  1SFO J;  2AXL A;  3IKV A;  2QCO A;  1JTX A;  4XOT A;  2LG4 A;  3I59 B;  1WWX A;  2UZK A;  4I02 A;  2Y9Z A;  1S29 A;  1YIO A;  2VPL A;  2M0M A;  3I3L A;  3CES A;  4GCV A;  1TBX A;  5M5Y J;  3KX2 A;  1PYV A;  1GVJ A;  3WTS C;  3GX4 X;  4ENJ A;  2STW A;  5L3D A;  5J6X A;  4A3J J;  2BY2 A;  3OYN A;  3CC7 I;  1O3S A;  1G3Y A;  3H5N A;  1ON2 A;  2KLO A;  2PBI A;  2E2H J;  2Y0S N;  4XMY A;  4LB5 A;  3KYC B;  1YE9 A;  3NWS A;  2LBF B;  5DTD A;  3DTK A;  3CTA A;  5TJJ A;  3CJN A;  3CMM A;  2DFE A;  3ULQ B;  2HVQ A;  4DBQ A;  2GIV A;  1BI2 A;  1FPQ A;  2ZO4 A;  2FNA A;  5DM7 F;  4A3F J;  2M7B A;  2Z1D A;  3CP2 A;  5IT9 Z;  2GA1 A;  3ZN0 A;  4AM3 A;  4C9Y A;  3HPH A;  5LGN A;  2VKE A;  2CG4 A;  2PMH A;  1BI1 A;  5E3M A;  4J00 A;  3ASN H;  3IH2 A;  3QYF A;  1OPC A;  4F93 B;  4EJT A;  3I54 A;  3P5J A;  3HOV J;  1F1Z A;  1ZQ3 P;  4BE1 A;  4DJA A;  2FD5 A;  2KIM A;  3I71 A;  4TV7 A;  1IG7 A;  3BT9 A;  5LRS A;  4IHY A;  3GW2 A;  1MNE A;  2D5V A;  3DKY A;  1TL8 A;  3S17 J;  2JWT A;  1CGP A;  3BZK A;  2CQ7 A;  5E18 F;  3BG3 A;  2TCT A;  3DLA A;  2XUB A;  2QEN A;  3HRU A;  2XAU A;  3G2B A;  3TP0 A;  5GAH J;  1O3Q A;  4EGZ A;  4FIS A;  1DUX C;  3M4O J;  2G7H A;  3ABK H;  1EJ9 A;  3C7J A;  3F8F A;  3DBR B;  3DU6 A;  3V7R A;  3O2P E;  3MFK A;  4IRH A;  2IGN A;  4XRS G;  2P7V B;  4XRF A;  3H35 A;  1IUY A;  3HOW J;  4NUB A;  2WA0 A;  1FBU A;  1O57 A;  1TQI A;  2E1N A;  2L02 A;  4XSX F;  3OIQ A;  1TC3 C;  3LSM A;  4U88 A;  1K6Y A;  1LDK B;  5EEH A;  2Q2E B;  3E6C C;  2Q2E A;  1UEL B;  1LJ9 A;  1BR4 A;  3CP8 A;  2HXI A;  3CCQ I;  2BEO A;  4XLN F;  5IP9 J;  1U3E M;  2ZB9 A;  1ZR2 A;  1IXS B;  1KU9 A;  2F4I A;  1K79 A;  3TBI A;  1LUJ B;  3I4P A;  4F91 B;  3OY9 A;  1WJF A;  2LH9 A;  3SZG A;  3HRM A;  3FIS A;  1ZLJ A;  2JRM A;  5E3N A;  2HOT A;  3VWB A;  3JRG A;  4ESB A;  1VND A;  4GDF A;  4QLC U;  4IOA F;  1U8R A;  1OQY A;  5GP9 A;  4PJJ A;  2Z33 A;  5KK1 A;  2CU7 A;  1A6I A;  2DBB A;  1QZY A;  3ZQL A;  4A3G J;  1MBF A;  4PGG A;  3GF2 A;  2OD5 A;  3I64 A;  1WVR A;  1U5T C;  2K3F A;  1TW2 A;  1S5L C;  3A4C A;  5HDN A;  5F08 A;  1J09 A;  3TO6 A;  4CDG A;  2AQF A;  3JTH A;  2M34 A;  3M1C A;  1SFK A;  1TWF J;  4F3Q A;  3KE2 A;  2LDU A;  3P7N A;  3BRO A;  2IGM A;  1VTN C;  1Z7U A;  2HOA A;  2MA3 A;  4XON A;  5DYM A;  4NHJ A;  1G8X A;  2CUZ A;  4IF4 A;  3CCE I;  3H5A A;  1ZK8 A;  1P6R A;  2K4J A;  1FOW A;  3HG9 A;  1Y6I A;  3OYG A;  2HYF A;  3TW6 A;  3MKY B;  2CH0 A;  1FBQ A;  2IP2 A;  2MH2 A;  3K2Z A;  2KJC A;  4PUS A;  4RLQ A;  2KRF A;  3TL4 X;  1ZN2 A;  4BE2 A;  1DU0 A;  4IHX A;  1ETY A;  2WV1 A;  1BW6 A;  5JVG F;  4M9S A;  3E3V A;  1T56 A;  4L9V A;  1STZ A;  2B7E A;  3OL3 A;  1D3Y A;  1MJ9 A;  4RAG A;  2E1M C;  1MH3 A;  2HYJ A;  5J40 A;  1EKE A;  1A36 A;  1XMX A;  1XDS A;  5H6Q A;  1XX5 A;  2VT2 A;  1VZ0 A;  2WTE A;  2ZBK A;  2R0Q C;  2QSG X;  2UWM A;  2W4S A;  3DF8 A;  1WJC A;  4F92 B;  2ZME C;  3VB2 A;  4B3X A;  5B1A H;  4X1E A;  1KGS A;  4HV6 A;  1JT6 A;  1POG A;  2OUM A;  3TED A;  1H9T A;  4M71 A;  4RAZ A;  1XGN A;  4XKW A;  2HQR A;  3L2Q A;  2DYR H;  1XN7 A;  2L01 A;  2L4A A;  1VQ5 I;  5HNF A;  3GTK J;  2CV2 A;  2MYS A;  4KIG A;  3C2B A;  2BYV E;  2V9K A;  2O9L A;  3FXM A;  4Z2Y A;  1K78 A;  4HRI A;  4ZC3 A;  2E71 A;  4F55 A;  1R49 A;  4CYC B;  1GXQ A;  2FBH A;  4ZH4 F;  2P0W A;  2XGC A;  2IRF G;  1YW8 A;  2ZXH A;  1X4P A;  4O6J A;  4M73 A;  5K7F A;  2Z16 A;  1AHD P;  4KJZ A;  2H8R A;  4JX6 A;  3WOD F;  4LK1 F;  3IAM 2;  4I0A A;  4RB1 A;  2RNJ A;  3MKZ A;  5D5U B;  4KMU X;  3S16 J;  2EFN A;  2Y0M A;  1AKH B;  2FE3 A;  2F5V A;  3GBG A;  3RKX A;  5IY5 H;  1T6S A;  1JUP A;  2BE5 F;  2L7F P;  4PDK A;  5EZG A;  3ZN1 A;  1FOY A;  1Y56 A;  1ZTR A;  1UHM A;  3F8C A;  1VQK I;  4EGY A;  4L18 B;  3F3X A;  4UNO A;  3V8L A;  4ANJ A;  3O8H A;  2QM3 A;  4ZDL A;  1LPQ A;  5E3L A;  5HDK A;  2E5N A;  2X85 A;  3DCF A;  1RRJ A;  1RR8 C;  2E60 A;  4V2G A;  4G7H F;  4HF2 A;  4AYB A;  3W6V A;  1F36 A;  3ZGK A;  5M3F J;  1HDD C;  4JQF A;  3HKZ N;  3JRB A;  1R5I D;  3BZ6 A;  1IJW C;  3K1P A;  3H3V K;  3BR5 A;  5JHF A;  2ZFW A;  4ZDP A;  1KQ9 A;  1ZG3 A;  3OV8 A;  1IRX A;  2A5W A;  2KMU A;  3QOD A;  3M8J A;  5IPA A;  3D0S A;  1FOX A;  2HPI A;  3FBI B;  4XKB A;  2COB A;  3TMO A;  4W97 A;  2Q1Z B;  2R7U A;  2X9D A;  3OIP A;  1UHW A;  3ZMZ A;  4MGR A;  4B8X A;  4KA4 A;  4JYK A;  1TNS A;  4GYI A;  5F0H A;  3EQL F;  3KLN A;  2IXS A;  4IXA A;  4Y15 A;  4AIH A;  1B72 B;  4ENN A;  3QP5 A;  2Y30 A;  3M8E A;  5HS8 A;  2VQH A;  1W7P B;  2WAQ A;  1W7P A;  1NK3 P;  2K27 A;  1YS7 A;  4FT8 A;  5CQE A;  2DO7 A;  3TDZ C;  3ML6 A;  2Y31 A;  4UV8 A;  2LY9 A;  2NVU B;  4G94 A;  2F2E A;  3C2H A;  4Q47 A;  3GZ6 A;  2VQG A;  2EB7 A;  1FTT A;  1X1A A;  4LIV A;  2XRO A;  4YEL A;  1FLI A;  5CLS A;  2PQ8 A;  2YX4 A;  3WTW C;  3JRE A;  1ZYR F;  2Z9O A;  4KDP A;  1CQT A;  1IZ1 A;  1AWC A;  4WF2 A;  4N9H A;  1Z3Y A;  5H20 A;  1DPU A;  1MBH A;  3F8M A;  1Y1W J;  4CCM A;  1BC8 C;  5F04 A;  4HYE A;  1F5T A;  2OQG A;  4ZZD A;  1RPW A;  5CPR B;  4BDY A;  2DOA A;  4ASN A;  1D5V A;  4CCJ A;  4IHS A;  3LSP A;  2NNN A;  1A04 A;  2ZJQ F;  2LFB A;  3ZP5 A;  4A69 C;  1TQM A;  4WWC A;  1JKP C;  1F9N A;  5CVV A;  1WH7 A;  1Z67 A;  1V54 H;  5FGM A;  3X2Q H;  4KT6 A;  3H3U A;  4CH7 A;  4BU2 A;  3HOU J;  1Q1V A;  5D5V B;  3J80 K;  1HQC A;  1WSU A;  3D5L A;  4UY8 I;  2DDB A;  2IGK A;  2DA4 A;  1MBE A;  2DT7 B;  3I0T A;  5K5R A;  1VQ4 I;  1Y0U A;  3GFM A;  4JBA A;  2KZV A;  4CZC A;  5HVQ C;  5KHD A;  5L3G A;  4E7K A;  4Y13 A;  3ECH A;  2IS4 A;  1MSF C;  1W5T A;  3HXL A;  4ZDO A;  3FXU A;  4D5F A;  2LNB A;  3FIW A;  5LHH A;  5E20 A;  2XB5 A;  5HDG A;  1XB4 A;  1EH6 A;  1ITY A;  1OMI A;  1OLT A;  3E6B A;  1FZP B;  2QSF X;  3KP2 A;  1ERD A;  2XPW A;  1RC9 A;  1ZGJ A;  5F0F A;  2EIK H;  1Z6T A;  4PSW A;  2PMZ A;  2X51 A;  3K7A J;  4AID A;  1AU7 A;  1KYW A;  4KMF A;  1E17 A;  2KPM A;  5ILS A;  3SEZ A;  3HUG A;  3COA C;  2ECC A;  1RI7 A;  3AG1 H;  1OCC H;  1ZKG A;  3WTU C;  4E7I A;  1R22 A;  2V1U A;  2AQE A;  3IWF A;  3TDU C;  3FXQ A;  3LOC A;  2Q0O A;  5F0C A;  3AG3 H;  4BEH B;  4Y4R A;  4B48 A;  3WG9 A;  2V6E A;  3VSL A;  4EM1 A;  4BKX A;  1R9T J;  1ONV A;  4RB2 C;  2COM A;  4XOP A;  1UMQ A;  3I56 I;  1S72 I;  1ODD A;  4LLL A;  1HSJ A;  4Q4Z F;  4CCK A;  1HC8 A;  3ABU A;  3VSK A;  2XVC A;  4V2F A;  2FX0 A;  5LEJ A;  3JTG A;  2C6Y A;  3PSI A;  1KQ8 A;  2OAZ A;  4HST A;  2OBP A;  3OIO A;  4ABZ A;  2FEZ A;  1EF4 A;  1LEB A;  4G6Q A;  4OIN F;  1O3T A;  4HG2 A;  3QU3 A;  1DQU A;  2ZSH B;  4OU0 A;  2OCC H;  4EM0 B;  2XPU A;  4KIT B;  3CJR B;  1J59 A;  2QGU A;  3A03 A;  2E1O A;  3HBL A;  1R5G A;  2A05 A;  2ICW G;  1A5J A;  3ZR8 X;  4X0G A;  1YJ9 I;  2V1D A;  3PNY A;  1MBK A;  3BR1 A;  4GRI A;  2Y2Z A;  1YLF A;  4PJM A;  1MMA A;  1VQM I;  2H8W A;  1K61 A;  3OYM A;  2Z5U A;  4IHV A;  3EYY A;  4EM2 A;  1OYY A;  4D5C A;  4CSW A;  3A2K A;  3CCM I;  4G6T B;  1U8B A;  4IKF A;  3WE2 A;  2ME6 A;  3SXY A;  2B0L A;  3E7L A;  4DOZ A;  2KFD A;  5C4X J;  1V3F A;  2K9N A;  4C2T A;  5BPI A;  1SFU A;  1FYM A;  2TRT A;  2X4H A;  3ZOB A;  3V8K A;  3CJT B;  1W5C C;  3SHF A;  4AC0 A;  1O7F A;  1U78 A;  3ROU A;  1B9M A;  5D5W B;  1KU7 A;  4FTH A;  2K02 A;  1YFH A;  2MFZ A;  3MKL A;  1T33 A;  2IBD A;  1LB2 A;  2VL8 A;  3RYR A;  3ZCO A;  1JUS A;  3OYI A;  3KZZ A;  2VBZ A;  2AS5 F;  4JK1 X;  2O3F A;  4UB6 C;  4MHG A;  2QKL B;  5F64 A;  1K7A A;  2Y75 A;  5FKO A;  3ONQ A;  3B6C A;  2QKM B;  3GTO J;  2HU9 A;  1MDM A;  1R58 A;  3H9G A;  4E4H A;  4CCN A;  2B63 J;  5K7H A;  4EVI A;  1S3J A;  4B09 A;  3GTJ J;  2A6H F;  5TRD A;  4RS8 A;  4HOB A;  3SFI A;  4BYY A;  2MGQ A;  3WGH A;  3DFG A;  1T95 A;  4BQA A;  2HOE A;  2ZJ2 A;  5D8L B;  3HYI A;  5J47 A;  2B9S A;  5EF6 A;  3S14 J;  1EV7 A;  2A6T A;  2A07 F;  3CDL A;  5CYV A;  1HKS A;  3LNQ A;  1FY7 A;  3W2V A;  4A3L J;  2BVM A;  4HDU A;  1QA6 A;  4HDV A;  5FFZ A;  2STT A;  3HOZ J;  2IA0 A;  4CO8 A;  5E1X A;  2ELK A;  3BCB A;  4QPO A;  4LGW A;  3JAM K;  1IC8 A;  1MNM C;  3CCR I;  2EQR A;  1O7L A;  4HX7 A;  1QHG A;  2R3S A;  3FWE A;  3BG5 A;  2E36 A;  3FMQ A;  1YX5 A;  1HKQ A;  3LSG A;  2IGO A;  5DEQ A;  1ZLK A;  2H1K A;  3WTT C;  1HA8 A;  1Y8Q B;  2JPB A;  4MIM A;  2X6X A;  5HLG A;  1HW1 A;  1KU2 A;  2W25 A;  1P9Q C;  4PK4 A;  5ED4 A;  4I09 A;  4NC7 A;  5FJ8 J;  2E19 A;  2M4K A;  3U2R A;  2HQ5 A;  3SZT A;  2ESN A;  1GHC A;  1JKR C;  4EAT A;  4HNT A;  4C3H J;  2MAB A;  3HHG A;  4ENM A;  3DU5 A;  2R7X A;  3ZQG A;  3BY6 A;  4N4O B;  4BNC A;  2J5P A;  2LK2 A;  3BC8 A;  2EZI A;  2VQC A;  4A93 J;  4CYD A;  2MBF A;  3T5X A;  1H8A C;  3H5R A;  3GTP J;  4CXF A;  3ZQF A;  1JE8 A;  3BG9 A;  2VKD A;  5B66 C;  3JSP A;  1E3H A;  3J7A O;  2F4O B;  5JR3 A;  1HXD A;  2CQX A;  3V42 A;  4HQM A;  1JJ8 C;  4BQN A;  5F6F A;  4CZZ A;  2NYX A;  4P9U A;  2BW3 A;  2WBM A;  2P5K A;  4QIW N;  2FRH A;  1R1U A;  1NK2 P;  1VQN I;  3L2R A;  1LE8 B;  1LE8 A;  4M3E A;  4G7O F;  4M3B A;  3RTR A;  2HKX A;  3K9T A;  3K1M A;  1UCR A;  1OCP A;  5L3E A;  4G9Y A;  1JGG A;  2EFP A;  2W82 A;  2DA6 A;  4M9Z A;  2HGC A;  1R4N B;  2PJP A;  4PGH A;  5E8I A;  1K83 J;  2OJE D;  3KIO A;  2JSP A;  3FMR A;  4HBL A;  2YX7 A;  3HOS A;  4DZJ A;  2QQ8 A;  2BHZ A;  3BQZ A;  3LA2 A;  1UFM A;  1VFC A;  2O61 A;  2A61 A;  3BJ6 A;  3DLL F;  4UVC A;  3DBL B;  2HXO A;  2X1E A;  1R1T A;  3R0J A;  2LVS A;  2HVS A;  2FJ1 A;  1WJA A;  3KEQ A;  3KPH A;  1ENH A;  2JPC A;  1IGN A;  3FM5 A;  2HR3 A;  2V9V A;  2VBX A;  3QYB A;  3N4M A;  2YR2 A;  3S2W A;  1P7I A;  4UUT A;  2DA2 A;  3VPR A;  1JI8 A;  5E8G A;  4A3I J;  3GFI A;  1N78 A;  2IT0 A;  4XN0 A;  4JP0 A;  1LFU P;  2KL4 A;  2QQB A;  3ZMV A;  3I4N J;  4BY7 J;  1SMT A;  2DMQ A;  2DN0 A;  1D0Z A;  2JUC A;  1IV8 A;  1IO2 A;  4YIF A;  3Q5F A;  1MSE C;  1IF1 A;  3OMY A;  2N8G A;  1MMG A;  3OYB A;  4II3 A;  2E2J J;  3VOE A;  2M30 A;  2UUZ A;  2XAH A;  1TWG J;  2LF7 A;  4B4C A;  4ZTJ A;  2EWN A;  4DGW B;  3CLQ A;  3CF2 A;  2AHQ A;  3QOE A;  4OIP F;  2V7F A;  2PJR B;  2PJR A;  4OIR F;  3A1Y A;  2K86 A;  2E7X A;  2YS9 A;  1TW3 A;  2D1V A;  1H88 C;  1WRJ A;  4GXO A;  2IA1 A;  1ETX A;  5AIP A;  1TWH J;  1MIJ A;  4JOM A;  4E70 A;  3HSE A;  5DS9 A;  2W7N A;  2CV1 A;  1MMD A;  4OIO F;  3A0B C;  4AWX B;  1P4W A;  3LWF A;  3S8P A;  4ZYA A;  1ZRF A;  4CGZ A;  2ZXJ A;  5IT9 K;  4N9I A;  2VI6 A;  4Y7N J;  4YFK F;  1PJR A;  3ZRG A;  4C30 A;  2E5Z A;  1DP3 A;  1JGS A;  2XC7 A;  2GBY A;  2K3P A;  2KKO A;  3N05 A;  3E0J B;  1QU3 A;  2H27 A;  2LD5 A;  3KFW X;  1WHU A;  2LRD A;  1K4S A;  1APL C;  1G3S A;  1WFX A;  3ZMT A;  4B43 A;  2MLG A;  1CF7 A;  1CF7 B;  3K4N A;  2HDW A;  3L00 A;  2CGP A;  4HZF A;  5DCF A;  2V1N A;  1QRY A;  2Z99 A;  3F9K A;  5DD4 A;  2NOJ B;  5K1Y A;  2I5U A;  4MTE A;  5H6R A;  4Y52 J;  1V5F A;  1VI0 A;  1DGR M;  3QPL A;  3PNV A;  5DM6 F;  2FMY A;  3C18 A;  3L2V A;  2FU4 A;  3DV8 A;  2QSH X;  1DP7 P;  4UUV A;  3CME I;  2DAO A;  3U9G A;  5LGT A;  2XAJ A;  4PZJ A;  3LA3 A;  1IXC A;  4LD5 A;  2PX9 A;  5IYC J;  2BGC A;  3LL7 A;  2M8E A;  1SC7 A;  3IP4 B;  1YW9 A;  3GLL A;  2V26 A;  1VF9 A;  4LIU A;  3DBH B;  5ERI A;  5ICC A;  3JRF A;  1RUN A;  3KP7 A;  2I8D A;  2FML A;  2P5L C;  1UAA A;  2KJB A;  2RKH A;  3LQR A;  4S05 A;  4FX4 A;  1IN4 A;  4U87 A;  4P1W A;  1XCB A;  5HOO A;  4B47 A;  2H1L A;  1V4R A;  1Z1D A;  3S93 A;  3RYP A;  2PFB A;  2P4W A;  5HS9 A;  1E3O C;  2OF7 A;  4HV5 A;  2JMW A;  3WHC A;  3VYT B;  3M3Y J;  3WU1 B;  3P9C A;  4KN7 X;  2L4M A;  2EZK A;  4C2U A;  2DT6 A;  1IDZ A;  5L3B A;  3OS0 A;  2VJI A;  3MQ0 A;  1S8N A;  1D5Y A;  4B3A A;  2V6C A;  5BOX A;  5DCM A;  3QU6 A;  1SFX A;  2G0E A;  1S7E A;  2KIF A;  2XGE A;  5C4J J;  1BOB A;  1OYW A;  3QRF F;  4FQG A;  3DEU A;  3VOD A;  2JUG A;  4WXD A;  2L54 A;  3FM3 A;  5HLH A;  2W24 A;  3QOP A;  3R0A A;  4UXN A;  5B3S H;  3UKG A;  3G4S I;  2J5O A;  2CWE A;  2IJL A;  4RGX A;  2RVC A;  2L7K A;  5E1Z B;  3QP6 A;  4ZTF A;  1I3Q J;  2OA4 A;  3VDX A;  1ETO A;  3IV5 A;  3IHU A;  2IS1 A;  2HNH A;  2BY0 A;  1Z91 A;  3IC7 A;  2V79 A;  4BGD A;  3RI4 A;  2CJJ A;  3ZPL A;  1OCZ H;  2Y48 A;  1HOM A;  3CC2 I;  1FWZ A;  1MND A;  4BXX J;  1FMV A;  2NXN B;  1G3W A;  2K7L A;  1ETK A;  1FT9 A;  1LVK A;  2CW8 A;  1QPM A;  4CA0 A;  5KVR A;  2HZD A;  4RAF A;  3VYR B;  4N4N B;  5C44 J;  4LG0 B;  1P2F A;  4P5O A;  2VJ4 A;  4LG0 A;  4NDL A;  2WWY A;  2G7U A;  1SAU A;  5D8K B;  1IN5 A;  2QVO A;  3FKJ A;  3BTJ A;  4K2E A;  2P6T A;  2XF7 A;  2M3A A;  1W5S A;  3FHN A;  3SZP A;  3GYH X;  3VFZ A;  2VKH A;  2EPF A;  4WXH A;  1XGS A;  3J7A Y;  4A0Y A;  3J7Y J;  4EJO A;  1K78 B;  3IUO A;  1I6X A;  1FTZ A;  3OYJ A;  3LSK A;  4E7L A;  2DQR A;  1Z7L A;  3C3W A;  4MFD A;  3GCM A;  3HM5 A;  5M3M J;  1QPI A;  4QTR A;  3Q3S A;  3CCJ I;  2BY3 A;  1UG0 A;  1YW7 A;  3DKX A;  2P7C B;  1WH5 A;  3QAH A;  3DP7 A;  3TO7 A;  1S6L A;  2DFF A;  1G6N A;  3OYE A;  1MBG A;  1QZE A;  1SD4 A;  4D7N A;  2L9N A;  1B9N A;  2VKV A;  4XL9 A;  3KP6 A;  3JRC A;  1LDJ A;  4KIB A;  3PJR A;  4JX5 A;  1TWC J;  2BBY A;  1SVM A;  1YRN A;  2DXI A;  5M5X J;  4A3D J;  2DTZ A;  1NG7 A;  4ETS A;  3ZMS A;  2WB1 A;  1BJZ A;  4J19 A;  3PQJ A;  3FHZ A;  2ZCW A;  3GTG J;  2Z2S B;  1ZR4 A;  1U5T B;  1U5T A;  3WHB A;  5BNG A;  3EUH C;  4WXC A;  1T0F C;  1E0E A;  2JSC A;  2ZXI A;  3MMY B;  4PFO A;  3U1D A;  3GEZ A;  1ZG1 A;  3TKY A;  4AD9 A;  4MTD A;  3K70 C;  3MKW B;  4C3I J;  2D1H A;  2M8G X;  2R7F A;  4XR6 A;  4PFP A;  1FYK A;  2K9M A;  3QPH A;  1DGW Y;  2QEX I;  3LSJ A;  3RPU D;  2A68 F;  1F43 A;  2L5Q A;  1JXS A;  1R7J A;  3ERM A;  2NS7 A;  1FP1 D;  2DJN A;  2CMP A;  5EEA A;  1ORK A;  3J81 Z;  2LP0 A;  4EJU A;  3LMM A;  2X6W A;  4BXF A;  4I7H A;  2DMN A;  1HCR A;  3AL0 C;  2HS5 A;  2DT5 A;  3PNT A;  3BR2 A;  4I01 A;  1RZ4 A;  2NVY J;  3FXL A;  4GGG A;  5FFX A;  1S9H A;  5LEK A;  3KET A;  3S3O A;  1Y8R B;  2CQN A;  2BVL A;  2VBW A;  4KIC A;  4AVZ A;  2E1M B;  1BL0 A;  2XDV A;  3RKW A;  3LSI A;  3MAJ A;  2RQP A;  2I10 A;  2VC0 A;  3GZN B;  4S04 A;  4B44 A;  2VN2 A;  1TZL A;  1SD7 A;  1D0X A;  1E3P A;  2FQ3 A;  4KIF A;  4RM2 A;  2ZME B;  2ZME A;  5GTH C;  3KLO A;  3QPT A;  5FLX Z;  3CCY A;  3H1C A;  3HB9 A;  2W84 A;  5JLW A;  2QF7 A;  5K7Z A;  4ZYH A;  1H89 C;  4FE4 A;  1N25 A;  4DQ2 A;  3VYU B;  4RA2 A;  3NRV A;  1BBY A;  3SJM A;  1HKT A;  3P9K A;  1XGO A;  3QPS A;  2R92 J;  3TW7 A;  5FD6 A;  2WY8 Q;  3BR3 A;  2RQQ A;  1FOK A;  5FRN A;  1ZAO A;  1Z3X A;  3R61 A;  2R7O A;  4LJZ F;  1OR7 C;  3PIP F;  1RNL A;  2K4B A;  3LSR A;  5TGT A;  1OJL A;  5JHU A;  2ACJ A;  4XRM A;  5J1R A;  1A6Q A;  1Q1H A;  2F5F A;  3BZC A;  2O7O A;  4XLP F;  2YU9 J;  3G73 A;  3O3K A;  4P55 A;  1ZHF A;  3JRH A;  4XNF A;  3HTU A;  2F5C A;  4R79 A;  2EFW A; 
#chains in the Genus database with same CATH homology
 3CMM A;  3RQ4 A;  4DBQ A;  2HVQ A;  3H9G A;  4E4H A;  4CCN A;  2CFO A;  4E7J A;  2VLA A;  2M7B A;  3PFY A;  3K4L A;  2Z1D A;  3CP2 A;  2R7Q A;  1T95 A;  4XLF A;  4C9Y A;  3HPH A;  4J00 A;  2A6T A;  3K4K A;  4F93 B;  3QYF A;  2KRH A;  2KQR A;  1V5E A;  3I9V 2;  3W2V A;  4BE1 A;  2BVM A;  3D5R C;  4DJA A;  3K4C A;  3BCB A;  4QPO A;  1MNE A;  3DKY A;  3AKZ A;  1QHG A;  3E1S A;  4XLE A;  3OYA A;  4BAC A;  1YX5 A;  3DLA A;  3LSG A;  2IGO A;  3OS2 A;  2M7A A;  3HUG B;  2XAU A;  3G2B A;  3C2G A;  4BS9 A;  1HA8 A;  2X6X A;  3S32 A;  4HSR A;  1P9Q C;  3K4J A;  4PK4 A;  4IZZ A;  3DU6 A;  2V4J C;  4NC7 A;  2R7T A;  2M4K A;  2IGN A;  3H35 A;  4EAT A;  4HNT A;  4NUB A;  2WA0 A;  2MAB A;  3DU5 A;  3SYT A;  2R7X A;  3OIQ A;  3LSM A;  4IQJ A;  2IS2 A;  4N4O B;  2CUJ A;  1K6Y A;  3BC8 A;  1LDK B;  2Q2E B;  1UEL B;  2VQC A;  1BR4 A;  3H5R A;  3CP8 A;  3RCO A;  1D1A A;  3BG7 A;  2VKD A;  2CV0 A;  4PJN A;  3OWT A;  2F4I A;  3OYL A;  3TBI A;  3V42 A;  3OY9 A;  4F91 B;  4BQN A;  2VB6 A;  4CCO A;  1WJF A;  2LH9 A;  1TT0 A;  3SZG A;  2BW3 A;  2VXZ A;  2WBM A;  4BDZ A;  3VWB A;  3L2R A;  4BJ6 C;  3K10 A;  3RTR A;  3HC7 A;  4BJT A;  4PJJ A;  2CW7 A;  2W82 A;  3ZQQ A;  1NG6 A;  2JSP A;  3HOS A;  3EUK L;  1ZEL A;  3A4C A;  2XF6 A;  2R7W A;  2LYC A;  1J09 A;  2W1O A;  3K6G A;  3PL8 A;  4BQO A;  2AQF A;  3RSN A;  4XLH A;  3M1C A;  1SFK A;  4F3Q A;  2O5R A;  2UV1 A;  2X1E A;  2IGM A;  3OOU A;  2HVS A;  4XON A;  1WJA A;  4IX7 A;  1YX3 A;  1G8X A;  3BCA A;  1MMN A;  2CUZ A;  3H5A A;  3EPZ A;  3QYB A;  3HG9 A;  4XLC A;  1Y6I A;  3OYG A;  3MKY B;  2CH0 A;  2F6C A;  4RLQ A;  4PUS A;  3TL4 X;  4BQQ A;  4BE2 A;  1JI8 A;  1N78 A;  4XN0 A;  2KL4 A;  4HEA 2;  3OYH A;  3OL3 A;  1WJB A;  1D0Y A;  2E1M C;  1D0Z A;  3OMY A;  2GOX B;  1MMG A;  3OYB A;  4II3 A;  2UUZ A;  2R4G A;  1X4O A;  4ZTJ A;  3IAS 2;  3DPL C;  4DGW B;  3CF2 A;  1VZ0 A;  2HQA A;  3W2A A;  2UWM A;  2W4S A;  1WJC A;  4F92 B;  4RM3 A;  3K4B A;  2KP6 A;  2KRC A;  3SDB A;  4B3X A;  1R6R A;  3QOE A;  2V7F A;  2GOM A;  2PJR B;  4XNF A;  2PJR A;  4OAY A;  2OUM A;  4NNJ A;  3A1Y A;  4XKW A;  3L2Q A;  2R7V A;  2KDO A;  5HNF A;  2WY7 Q;  2VQL A;  2CV2 A;  2MC4 A;  2MYS A;  3DEE A;  5KNL A;  2V9K A;  3HPG A;  3K70 D;  4JOM A;  1GLN A;  2W7N A;  2CV1 A;  4HRI A;  1MMD A;  4ZC3 A;  5FRO A;  4F55 A;  2FUG 2;  2HPM A;  3S8P A;  4ZYA A;  2P0W A;  4YRV A;  2ZXH A;  1X4P A;  5CKT A;  5LD2 C;  2Z16 A;  5KCM A;  4KJZ A;  1PJR A;  3ZRG A;  3H0D A;  4C30 A;  2E5Z A;  3UR3 C;  1DP3 A;  2XC7 A;  3AL0 B;  2ELJ A;  2K3P A;  2LRE A;  2Y0S A;  3N05 A;  3OYD A;  3E0J B;  3IAM 2;  1QU3 A;  1AA7 A;  2LRD A;  2WAD A;  3HOT A;  3MKZ A;  3DPU A;  3FDY A;  1WFX A;  1WJE A;  4B43 A;  2F5V A;  3AFH A;  3GBG A;  3K4N A;  3H9Q A;  2HDW A;  1Y56 A;  3DPT A;  3LSH A;  2IS6 A;  2V1N A;  3F9K A;  2NOJ B;  1G59 A;  3OR2 C;  4ANJ A;  1V5F A;  4KIS A;  4ZDL A;  1DGR M;  3PNV A;  4BEH A;  2E5N A;  2X85 A;  4F52 A;  2E60 A;  4RLF A;  3L2V A;  4ZJZ A;  4AYB A;  1KON A;  3DTE A;  3OYC A;  2BW3 B;  3ZGK A;  4ITV A;  4DIQ A;  1X1C A;  4NQW B;  4BUP A;  4JQF A;  4XOR A;  4HPQ A;  1D1B A;  1U0J A;  5JHF A;  1WJD A;  4ZDP A;  3LL7 A;  3IP4 B;  1IRX A;  2A5W A;  2KMU A;  2V26 A;  3QOD A;  3M8J A;  4LIU A;  2HPI A;  3FBI B;  4XKB A;  2I8D A;  2R7S A;  4XKV A;  4DBR A;  4BL0 B;  1UAA A;  2CS3 A;  3TMO A;  3D5S C;  3FBN B;  4U87 A;  2Q1Z B;  4P1W A;  5HOO A;  3OIP A;  2JVG A;  4B47 A;  3S3M A;  2R7U A;  3S93 A;  3VYS B;  1X1D A;  2ZSI B;  4BE0 A;  3QYE A;  2IXS A;  3VYT B;  2LOO A;  3S3N A;  1W36 D;  4C2U A;  2DT6 A;  4XQF A;  2VQH A;  2WAQ A;  4D1Q A;  3OS0 A;  5CQE A;  2VJI A;  4YEJ A;  3DTI A;  4QPQ A;  1BOB A;  3C2H A;  2VQG A;  3KEY A;  3DWL E;  2ZFU A;  1X1A A;  4LIV A;  2JUG A;  4YEL A;  3H9J A;  4XN3 A;  2VJJ A;  2L7K A;  2X1D A;  4XLA A;  4ZTF A;  1Z3Y A;  4HNU A;  4CCM A;  3VDX A;  2IS1 A;  5CPR B;  2KHM A;  4BDY A;  2DOA A;  2HNH A;  4CCJ A;  4BGD A;  4Y33 A;  2XF5 A;  1EA3 A;  1MND A;  5HNH A;  4E7Z A;  1FMV A;  2OC6 A;  1LVK A;  2MD0 A;  2CW8 A;  3DQV C;  4II2 A;  3KYL A;  2R7R A;  2K5C A;  2W00 A;  4CA0 A;  2HZD A;  4PJL A;  2VAS A;  3VYR B;  3L2W A;  2HVR A;  1MW7 A;  4N4N B;  4KT6 A;  4P5O A;  2LBF A;  2VJ4 A;  4IQ4 A;  4BU2 A;  4CH7 A;  4NC8 A;  2LC2 A;  5LFA A;  4Y3O A;  4FET A;  1SAU A;  3D5L A;  2DCE A;  2IGK A;  3FKJ A;  4D9J A;  2XF7 A;  2M3A A;  3FHN A;  2DT7 B;  3ZXS A;  3MD2 A;  2KZV A;  4XM3 A;  4OWR B;  4CZC A;  3BG6 A;  2VKH A;  3UNG C;  5HVQ C;  2L9S A;  5KHD A;  2LY2 A;  4E7K A;  3HL2 A;  3J7A Y;  3OYF A;  3IUO A;  4AU7 A;  3OYK A;  3OYJ A;  3LSK A;  4E7L A;  2IS4 A;  1Z7L A;  3NWT A;  3HXL A;  4ZDO A;  1Z21 A;  1FMW A;  1UG0 A;  3DKX A;  1OLT A;  3OYE A;  1ERD A;  2L9N A;  4PSW A;  4XL9 A;  2PMZ A;  2X51 A;  5CQG A;  2LY1 A;  3CZ6 A;  3PJR A;  2RRE A;  2RNG A;  2KPM A;  3SEZ A;  4XKC A;  2DXI A;  2XSJ C;  3CJQ B;  4LIT A;  1NG7 A;  4E7I A;  2WB1 A;  3L2U A;  2AQE A;  4E7H A;  2VIX A;  2Z2S B;  2WAE A;  4H4K C;  5FRM A;  3EUH C;  4CCL A;  3K4M A;  4BEH B;  1T0F C;  2M4G A;  4Y4R A;  4B48 A;  2ZXI A;  1LKX A;  3MMY B;  4PFO A;  5HLT A;  1E0E A;  2V6E A;  2JVH A;  3VSL A;  4E7S A;  3OS1 A;  4XOP A;  3OR1 C;  3K70 C;  3MKW B;  3W3C A;  4XR6 A;  4PFP A;  3SEQ A;  2K9M A;  1DGW Y;  3RPU D;  4CCK A;  4U7B A;  4MLO A;  3VSK A;  4CUG A;  2L5Q A;  3PSI A;  4BJ5 C;  2OV7 A;  2WAF A;  4HST A;  1D1C A;  2CMP A;  2X6Y A;  3PSF A;  3LMM A;  2X6W A;  4HG2 A;  4BXF A;  3AL0 C;  2VJ5 A;  2K9L A;  1DQU A;  2ZSH B;  2VXD A;  3PNT A;  4KIT B;  3CJR B;  1S9H A;  3S3O A;  1BR2 A;  3W2W A;  4E6K G;  2BVL A;  3ZR8 X;  4X0G A;  4AVZ A;  2E1M B;  3EUA A;  4LG3 A;  2XDV A;  2L2O A;  2X1C A;  3LSI A;  3PNY A;  4GRI A;  4PJM A;  1MMA A;  3OYM A;  4B44 A;  3BLY A;  4CSW A;  3A2K A;  1TZL A;  4OAZ A;  1D0X A;  1N75 A;  4G6T B;  1QHH D;  4IKF A;  4RM2 A;  1N77 A;  1X19 A;  2JA2 A;  3LFU A;  4DOZ A;  3PUB A;  4PSX A;  2DJI A;  4J01 A;  4C2T A;  1X1B A;  3VYU B;  1V5G A;  4FAS D;  1BR1 A;  2WY8 Q;  2RQQ A;  3HKZ A;  5FRN A;  4XOT A;  2LG4 A;  1Z3X A;  2R7O A;  2BOL A;  4RMN A;  2MFZ A;  2VPL A;  1OR7 C;  2M0M A;  3U21 A;  3I3L A;  2VL8 A;  3ZCO A;  5TGT A;  3CES A;  3OYI A;  3KX2 A;  1PYV A;  3OYN A;  2QKL B;  3H5N A;  1LFP A;  2KLO A;  4XMY A;  1W36 C;  1YE9 A;  3ONQ A;  3NWS A;  1WJ5 A;  2QKM B;  3DTK A;  2LBF B;  2HU9 A;  4R79 A;  3OL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...