2XC7A

Solution structure of phax-rbd in complex with ssrna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
GAMAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords PHOSPHORYLATED ADAPTER RNA EXPORT PROTEIN
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xc7A00
2XC7A 2W4SA
chains in the Genus database with same CATH superfamily
1I50J 2EFPA 1IW7F 2LF7A 1W1WE 1R4NB 4RLFA 3U9GA 1O4XA 3VFZA 4HX8A 3EUHC 5JLWA 3QODA 4UNOA 3LSJA 4DZPA 1Y1WJ 1GVJA 3IAS2 2GXAA 2YU3A 3KETA 4Y52J 1LDDA 1WRJA 3FXLA 3ZQHA 3OYMA 4PCQA 1I1GA 3F6VA 4YEJA 1FLIA 2W1OA 2A6HF 4MTEA 3GFJA 4XLFA 5BPDA 5F0CA 4RM2A 3BDDA 2DJIA 3TOAA 2KQRA 4E6KG 3VB2A 2KDOA 2X6XA 3G4SI 1RIOH 1BI2A 2ZNYA 4MGRA 3ABKH 2M45A 2EWNA 3ZGKA 1Y56A 4KYWA 5LGTA 3CCMI 3IUOA 3KZZA 3RKWA 3L09A 3VSLA 3Q0UA 4C3IJ 1WFXA 1MDMA 3I59A 1E2XA 1HDPA 4I98B 4JX5A 2DPDA 4JX6A 3K4CA 2BVLA 3P9KA 3T8RA 3TBIA 4ABZA 1XN7A 4UV9A 2R4GA 3BPVA 2FU4A 2FD5A 2IW5A 2DLLA 1SC7A 2XB5A 1U8RA 2LMDA 3HUGB 4M3FA 3H35A 4PFPA 2VL8A 4D5FA 3GTMJ 1G4DA 2PQ8A 2DMNA 2DOFA 2AXLA 2O5RA 4KIGA 4B48A 2L9VA 4BS9A 3WGHA 4RDUA 1UB9A 2CS3A 3OIPA 5TGTA 2KL4A 3HTUA 5DEQA 5EGOA 2A07F 2GBYA 3PQKA 5J3LA 3KZYA 4HLYA 1IDZA 3IC7A 1FX7A 3G71I 1TT0A 3MN2A 1EH7A 1MBEA 5FFZA 2EZLA 1USTA 3A02A 3HHHA 2CV1A 2R7FA 3GX4X 2VC0A 3JRFA 4KUMA 3ASNH 5E1ZB 4C30A 1VQOI 1TL8A 3BPXA 2DPUA 2CWEA 3V8JA 2XKPA 1A6QA 2H6CA 1QU3A 1WWXA 4OIOF 4ZYEA 1I6XA 3PFIA 2X9DA 3WHCA 5BS6A 2QF7A 1FBSA 1T38A 2EFQA 2MABA 1N77A 3WHBA 3OYDA 3ZMSA 4B4CA 2WAQN 2DMTA 1IRXA 1ZRFA 3CDHA 2IGKA 1FYKA 1T39A 2EBIA 2XVCA 3EQLF 3WGIA 3E7LA 2ZO4A 1UZCA 1K7AA 1RNLA 4ENNA 5CYVA 5KHDA 3E5QA 4ZZLA 3GXOA 2E5ZA 4FCYA 2GA1A 4GCVA 4JYKA 4ASNA 2XC7A 4XKVA 3OSGA 4CZCA 3KEYA 4LLGF 4KMUX 4XL9A 2BVMA 1CF7B 2R7SA 3DWLE 4LD5A 2E71A 1KQ8A 2CQKA 3K4LA 1TLHB 4LGWA 4GXOA 1BM9A 4RAGA 1V55H 5FRNA 2VONA 1HKSA 4RGRA 1IN5A 2K02A 3M07A 2BHZA 1IO2A 2A5YB 3ABTA 3TP0A 3CD6I 3EUHA 4NUBA 3RJPA 3OWTA 1QHGA 3DCFA 2MG4A 2K7LA 1P92A 2MC3A 3K1PA 1WGXA 1SD5A 3OYJA 1U78A 1ENHA 1DP3A 3W6KB 1Z7LA 4OIQF 4RS8A 3WE2A 3CUQC 2LBFA 1WQ2A 2ADUA 2VKDA 2AO9A 2LG4A 1Z6TA 3TL4X 4XLPF 1MJAA 2R7TA 1STZA 3ONQA 2VASA 4GFBA 2EZHA 2RC4A 4HNTA 3KP3A 3GO5A 4B8XA 5F1JA 3DPUA 4U88A 2EK5A 1EKEA 1IXRC 3VYTB 3OYBA 3T8TA 2K85A 2ZXIA 1GV5A 3DU6A 1T0FA 2XPWA 4KIFA 4IRGA 4BJ6C 1BA5A 1OLTA 4M74A 1MBGA 5K7FA 1B8IB 1P4WA 2YR2A 1MBHA 2JRTA 1KZHA 4XBFA 2OD5A 1MJ9A 5HOOA 3F23A 2GLOA 3G1LA 1JKPC 2MLKA 1R7JA 2GM4A 2LH9A 2R5ZA 2I10A 4BQOA 3F72A 2DMQA 3ECOA 3LA7A 1DPRA 1KU7A 3PL8A 1HA8A 4UB6C 2FOWA 1VQ4I 1OJLA 4XNFA 1K4TA 2ZJ2A 3K4KA 4ZYGA 3KLOA 4BDYA 2KIUA 2VBZA 3W2AA 3PNYA 1ZG3A 5CPRB 2MSYA 3D5SC 2V4JC 3M1CA 4BUPA 3OIQA 5F0FA 3QYFA 3H9QA 4FE7A 3RTRA 4XKWA 2XF6A 5FKLA 1XB4A 2EFNA 5J40A 3JRBA 1OR7C 3CC7I 2DFFA 2V9VA 1UCRA 2ZMEC 5JLXA 3RYPA 1UFMA 1XTAA 2AHQA 3SFZA 4I2OA 3LFUA 3WTTC 1IAWA 4OMZA 2X48A 1TQMA 1REPC 4HAMA 3F21A 1KU2A 1Y39A 3KP2A 4LB5A 5KK1A 5D4SA 2PX9A 5H20A 2AQEA 4XRSG 2PBIA 2Q1ZB 5CKTA 1MBKA 2OZUA 1SAXA 3SZGA 3IKTA 2QEXI 3H0DA 3F8FA 2CW8A 1YX3A 2FX0A 2JUCA 5D8LB 1DDNA 4A6DA 1W4MA 1B4AA 5TRDA 1A31A 3DEEA 4DQ2A 4CCOA 2OV7A 1IRZA 2HVQA 3G2BA 3HRTA 4I0AA 2STTA 2Y31A 3PNVA 4Q47A 2VOOA 2NAZA 3JAMK 3E97A 3S1QJ 2DW4A 3OS0A 2VODA 4XOPA 1POGA 1RUOA 2L9RA 5ERIA 1U6GA 4AYBN 3S3MA 5C4JJ 5EEAA 5ICGA 2JMWA 1WKMA 1KYWA 4WXHA 3JRGA 4P96A 3SEQA 3S1MJ 4R1HA 3I64A 3ZMVA 4ZH4F 3A0BC 1QZYA 5BMZA 1S5LC 5FB2A 5FJ8J 1DGWY 1J0RA 2O3FA 2L7ZA 4MLOA 2BXZA 2K40A 2X0LA 1WCMJ 2V1NA 1S7EA 3H5NA 3I9V2 1J75A 1ZRCA 4P9FA 2PN6A 5L3DA 1ZG5A 4HQMA 4ETSA 1FIAA 2OQGA 1XGSA 2A6EF 2QA4I 1PJRA 3FWEA 3HIFA 3MVPA 2NNYA 3ZPLA 1VQNI 1V4RA 1QPMA 1VQ9I 1RZ4A 4AC0A 2LR8A 2VT3A 5M5WJ 5CVJA 1A04A 2JA5J 1H9GA 4V2GA 2M3AA 4ESFA 3HOTA 1W0TA 1E3PA 1PVEA 2ID3A 2KIMA 2EZKA 5HS9A 1SFXA 3BLYA 4DIQA 3D0SA 3WTUC 4E7JA 2A3SA 2TCTA 4PFOA 4BQNA 5L3GA 3S8PA 2NXNB 5JR3A 1K78A 2K27A 1ZGJA 3Q3SA 2PJPA 1FP1D 3E3VA 1UHWA 3F8NA 1S8NA 4DOZA 1BIBA 1T98A 2UV1A 1WHUA 2W00A 3ZP5A 5FFXA 2MFZA 3MKYB 3ZXSA 5FLXZ 3J7YJ 3FXKA 4AWXB 4CCKA 2DXIA 1IRFA 5IPAA 4D5CA 1SAUA 2A69F 3HB9A 4OAZA 1SVLA 4KFCA 1OISA 3JSPA 4HG2A 3PO3J 1T0FC 1LKXA 4EM2A 1QVUA 4XSZF 3BQYA 1U5TC 4FQGA 1JUPA 5DUIA 1FOKA 2M4GA 2BY2A 1X1PA 3K1MA 3HOVJ 4WK8F 5F6FA 1S7OA 3I4PA 3OYAA 1U8BA 1ZELA 1XS9A 2V79A 2DCEA 1W7PD 3FBNB 4G6DA 4J19A 1AWCA 3FISA 4NHJA 3PFYA 2MA3A 3GFIA 3H5AA 2ELHA 4RB2C 2IS6A 3RCOA 2F5VA 5GP9A 3HGGA 3S32A 2HOSA 4UUTA 1B72A 1A36A 3I55I 4QPOA 4ENJA 2CJJA 5LGUA 2Z3YA 4HSRA 2E1OA 4XLAA 4EJVA 4F93B 2WB1N 3OYEA 2DA3A 2MD0A 3BZKA 1WZ2A 4BE0A 3SXYA 4EMSA 3VEPA 4D1QA 1R49A 5E1WA 1J09A 3CJQB 3QOEA 4A5NA 4A3GJ 2BV6A 2JRMA 2DA7A 5JHFA 4EGZA 5F08A 3OYNA 1D0ZA 3NARA 3ASOH 4DZJA 3CCVI 1EJ9A 3BJ6A 2G0EA 2HI3A 4M3DA 2B63J 4B43A 1JUMA 2ECCA 1PUFA 3HSFA 3KYLA 2DN0A 3FK7A 3COAC 4PJNA 1SD6A 1TT5B 2VQHA 3IRQA 1ZR2A 1VNDA 5JFRA 2Y0SA 5L3BA 1ZH5A 2QYOA 1YLFA 1YIJI 1FIPA 1XCBA 3UR3C 2VB6A 2L02A 2M8EA 4A69C 3RPQA 1ETXA 4H0EA 2RV8A 4BQQA 2XAHA 4NNJA 3V4GA 3RI4A 1YO5C 3VDXA 3FHZA 3CCUI 1W7PA 3TO7A 2GAUA 3DPLC 3V8LA 3BG5A 1RESA 5ED4A 2HVSA 1U9OA 2DK8A 3FXMA 3BTIA 2K4BA 1X1AA 1R23A 1XC5A 1WJEA 5AIPA 3ZMZA 2BOLA 1S3JA 4RB0A 4ZYHA 1BI1A 4LITA 5GTIC 3H0GJ 1ETVA 1LUJB 2XGEA 2F48A 3HKZN 2R7UA 5EEHA 3RDIA 1I1SA 3CCSI 2Z2SB 3KP4A 1G3WA 3OIOA 4LOCA 4B3XA 5EG0B 3C2BA 2CU7A 3BR3A 3HSRA 3FIWA 4JP0A 2L9SA 4FISA 1TWCJ 4XRMA 5EDNA 3DLLF 1FYMA 4M3EA 2J5OA 5D5UB 3HPGA 3U2RA 3N05A 5A2QK 3SZPA 1JGGA 3M4OJ 4N9HA 2MC4A 4Z6YA 3NQOA 1HSTA 1JE8A 2BBYA 3I54A 5GAHJ 2W48A 1S6LA 4A3KJ 1USSA 3CCJI 2GOMA 3W3CA 3ZQFA 1V5GA 3WG9A 1DGRM 2DA2A 2PI0A 2M1BA 4IX7A 3IHUA 2CQQA 3DTKA 1IXSB 3JRDA 3E6CC 2Z9OA 5B66C 2IS4A 1IG7A 3RPUD 1FMVA 1R6RA 5HNHA 1W36D 1UAAA 3I4NJ 1OCCH 2RQPA 2CQ7A 3S17J 4IO9F 2EFOA 4PJLA 5HODA 1SANA 1NTCA 4A3JJ 4XQFA 3TDZC 1IC8A 1ETWA 3SFIA 3QAHA 2R7WA 2EH3A 3CLQA 3QYBA 2TRTA 3QP6A 4BXUA 1YJNI 4G6QA 4GGGA 3HC7A 1MSEC 1HCRA 2BY1A 2J5PA 1FTZA 1HW1A 9ANTA 2F5DA 4CGZA 5IOYA 4EGYA 3RKXA 4ZJZA 2DT5A 2C6YA 3CMEI 1ACIA 2IEKA 1JKOC 1OPCA 5FKKA 1LPQA 1A6IA 2X6WA 3C3WA 1FSEA 1WJDA 2GIVA 1GVDA 2NRAC 1D1CA 1FPQA 1IZ1A 2HKXA 4M6XA 4G7HF 3ULQB 4A3CJ 1J5YA 1TZLA 3LSTA 2OUMA 3K1NA 3L00A 1I3QJ 1T2KA 2LY9A 2IT0A 1SMYF 3ESWB 2NNNA 2OF7A 2E7WA 4HLXA 3JRCA 1Z05A 4GRIA 2LC2A 4XICA 2V9PA 5D4RA 1WJBA 3R61A 2QM3A 3FF5A 3JAMZ 5D6FA 1T6SA 2VIXA 1X1BA 1RKWA 5TJJA 1UG2A 2EZIA 3BWGA 4QPQA 2UXXA 1JTYA 4MFDA 2FNPA 1Z3XA 1FNNA 4XLEA 3TGNA 1UG0A 3CJTB 3H3ZA 4LG0A 3ERED 1ODDA 5LRSA 1FJLA 2XASA 3U21A 6PAXA 3S16J 4WXDA 1LDJA 2COMA 4E4HA 2FQ4A 4WX9A 5BQTA 4EQQA 3P7NA 4Q5SF 2VUMJ 2QUFA 5E20A 1XSVA 1O3QA 1IUYA 2A6TA 3KP5A 4O5VA 3LSHA 2VKEA 5K7HA 4E7LA 3R4KA 2HGCA 3ZOBA 2VQLA 3WTZA 3C1DA 5BOXA 3SDBA 2P6TA 2PFBA 4PGHA 1FOYA 5LHHA 2NOGA 4C9YA 1BR4A 1R58A 3V7CA 4ZZDA 2FNAA 5KCMA 1IUFA 1KU3A 1RETA 4CYCA 3QYEA 2MW8A 3GZ6A 1YFHA 2XF5A 3WTVC 4MEXF 3F9KA 1LVAA 1AKHB 1Z3YA 5CJ9A 1HW5A 1MMNA 3VPRA 4CUGA 3BOQA 2M0CA 3EYIA 3BR6A 1BW6A 3I4MJ 4DGWB 2H8WA 3KPHA 3G1MA 5FD5A 1KA8A 1TW3A 2WAQA 3M1EA 4U87A 1U3EM 2PJRB 4HF2A 3OYHA 3PJRA 2R3SA 4IHVA 2HQAA 1UJ8A 4BL0B 2QSHX 4P9UA 4Y33A 4UHTA 4L5EA 1B59A 3GLXA 3SZTA 1ZHFA 1RR8C 4EJUA 4A3EJ 3K0LA 3O3KA 3BJOA 2V1UA 4O3MA 3GVAA 4P5OA 4XLHA 1ZRDA 4JK1X 1ZARA 5IP7J 1D1AA 5IYBJ 3PUBA 3ZQCA 4YIRX 4RGUA 2M2EA 4XLCA 5KAIC 3CJNA 5DS9A 4CYCB 3WU1B 3WTXC 2V7FA 2YUSA 3VSKA 3H9GA 4BKXA 2ISYA 2O6GE 3DKXA 1KU9A 1ETQA 2N8GA 1ORKA 5K5RA 1IN7A 3V8KA 1FZPB 1LDKB 3KX2A 4KN7X 3LSRA 3BCBA 3NAUA 1OKRA 2M34A 2VXDA 3S3NA 2QBYB 2MD5A 5D5VB 3AL0C 3L2RA 1HF0A 2FA5A 3TP3A 2QQ9A 2DK5A 3CMYA 1SMTA 1MMDA 3KZIC 2R0QC 5HDGA 1W5SA 2LOOA 2M9HA 3KYCB 3WGGA 5E79C 3D5RC 4EATA 1SD7A 3H92A 5DV5A 3PIOF 3ZQLA 1B8IA 2XROA 2ETHA 3I5UA 4ITVA 2WY8Q 2EA2A 5DCMB 1D0YA 3BCAA 1XCVA 2FE3A 2PMZA 3GF2A 4OOIA 4YFXF 2YX4A 2MYSA 1YRNA 5DD4A 2XPUA 3M8EA 2P7VB 3M8JA 1LB2A 1IN8A 3I53A 3LA2A 1S29A 4AYBA 3LSKA 2K86A 1AOYA 4HYEA 5HNFA 2JA6J 3W2WA 1I27A 2YS9A 2VQCA 1YQAA 4PZJA 2BE5F 4TV7A 1XX5A 4EJWA 3CC4I 4QSHA 2VBWA 3JRIA 1X58A 2XHKA 3LA3A 3VYSB 5H2FC 1KGSA 2QBYA 1VF9A 3C18A 4HDUA 3JSOA 1HC8A 3OYLA 2X4HA 3J7AO 3CO7C 4U0VA 2HKOA 3GTGJ 2D45A 2FRHA 5J8CA 3CCQI 1O57A 2XRNA 2OCEA 4HNUA 3I0TA 5ILVA 4J00A 1B6AA 3BR1A 2CG4A 1QZZA 2KFDA 5D8KB 3L2WA 3ERMA 3TW6A 2KT0A 3E5UA 2PMZN 5GPAA 1PYVA 4CSWA 2CSOA 4MQ9F 5DM6F 2HR3A 2EIMH 2DYRH 1IV6A 1YI2I 1F5TA 3IH3A 4IOAF 3K7AJ 4XN0A 2VQGA 2X6YA 5A2QZ 5FLXK 3LNQA 2P5VA 2XIGA 3BTCA 1OCPA 1LE8B 1AA7A 1C0WA 2JWTA 2XF7A 1WJFA 3REOA 5IT3A 2BY3A 2DMPA 2DT7B 3BP8A 3PNTA 1HSJA 4E7KA 4XORA 2VN2A 3RIRA 2K3PA 2LY2A 4IHYA 2OTJI 1FP2A 2IA1A 2H6BA 3UKGA 2KISA 5D5XB 1G3SA 4LFUA 2GWRA 1XGOA 5JVTA 3BZ6A 3E1SA 2FUG2 1VQ6I 1E0EA 4LG3A 2E2JJ 2IAIA 5FROA 5DM7F 1JI8A 2HDDA 2CMPA 1Y0UA 4NDLA 3PQJA 2Y9YA 3WU2C 1DUXC 3HOUJ 2DA4A 2HXIA 4YG2F 1FY7A 2UZKA 3QPLA 3MEXA 2EILH 2IJLA 2CQXA 2XSJC 4EV0A 4OU0A 2LP0A 4U7BA 4L0ZB 2Y2ZA 4I99C 4BY7J 1Z91A 1FBQA 1ZK8A 4KA4A 1LEAA 4II2A 3ZQQA 3MWMA 1GHCA 3S3OA 4CHUA 4M71A 1YJWI 2F4OB 3HJEA 2R5ZB 2JA2A 5K1YA 5EZHA 1U0JA 1R22A 1RKTA 5IOZA 2BGCA 3CDIA 3FZVA 4L9TA 4M6VA 5LHIA 5LBQA 4Y17A 1ZAOA 1LE8A 5F27A 3DEUA 2QQAA 4AVZA 2DFEA 2ICWG 3F8MA 1FWZA 3VYUB 4ZYDA 2QQ8A 3DBLB 1ZGWA 1BR1A 1DQUA 4ENKA 1YIOA 1EA3A 3K9TA 1U5TB 2R7OA 1Z6RA 2Y0SN 4AU7A 1BN5A 2Y30A 1R71A 1YOVB 2L01A 4XONA 4CH7A 1T33A 1WJAA 3KEQA 2ESHA 5CQEA 1DU0A 1GDTA 3KYDB 2OTLI 2NVUB 3NEUA 1YW8A 3BR5A 4BDZA 2F4MB 2DU9A 4JX4A 4XLNF 2CH0A 1RRJA 3GLLA 2K3FA 2F2EA 4XKBA 4LMYA 3K70C 2VJ5A 3GFMA 4BBRJ 4F92B 3QU6A 4B1RA 2E2HJ 3ZQGA 3J80K 4IVNA 1KQ0A 2GZWA 1JUSA 1VQ5I 3DU5A 1NK3P 2W82A 1P2FA 2STWA 3AG3H 2HYJA 3IWZA 2EB7A 1X3UA 2IGNA 1VZ0A 3MCZA 4S0HB 3MFKA 1I39A 2ZFUA 3OOPA 1SVMA 4A93J 4AIJA 2QWWA 4BEHB 4ZDPA 4BXFA 3HEFA 2CFOA 4RLQA 2IBDA 1FTTA 4N4NB 5J47A 4OAYA 2VE8A 2DO7A 3GTOJ 4PJ0C 1X1DA 2WAFA 1OCZH 3F6OA 1KONA 5LEJA 4X1EA 2P6SA 4Q4ZF 1H0MA 1WVRA 3L2VA 1K79A 4A3BJ 1X1CA 2KRCA 1F43A 2ZB9A 1O3TA 1G2HA 5BPIA 3ML6A 3TOBA 3DKWA 5HLHA 4XKCA 4A3MJ 1IGNA 2NS7A 2TDXA 2F5FA 5HLGA 2D5VA 2BEOA 3OMYA 5CQGA 2XAFA 5LEKA 3K4MA 4B47A 1WJCA 3LSPA 3BTJA 5HVQC 3N97A 4BYYA 1JXSA 2WB1A 2JN6A 2R5YB 2HDCA 3BQZA 2HVRA 2WY7Q 2GQQA 3HM5A 4AIDA 1ZYRF 2ZBKA 3HYIA 1ZG1A 1J7KA 2XGCA 2RREA 2FBIA 2LRDA 3NWTA 2VXZA 1H9TA 2UXNA 2K5CA 2K9QA 3P5JA 4U7DA 2E5NA 5B3SH 2X6OA 2HPMA 5GAEJ 2DDAA 3OR1C 4CDGA 3BG9A 2Q0OA 3T5XA 4BE2A 1BC7C 1L0OC 3WTWC 1ULYA 1ZGAA 4HV5A 2BYVE 2L7KA 2M30A 1F9NA 1MNDA 1ZLJA 3KP6A 1ON1A 2ZCWA 4D7NA 2WADA 3F8CA 3FMSA 4RAYA 1HXDA 5ILUA 5CVVA 2DI3A 5E3OA 1N75A 2EV5A 2KHMA 2EFWA 4YIIA 5EYRA 5ICFA 1JKRC 4BHCA 2M87A 1TQPA 3B6CA 3FXQA 5KVRA 2E1MB 2ZKZA 2FOKA 3CTAA 1OFCX 3IH2A 2OA4A 2K9SA 2D1VA 3AG2H 4RGXA 1LEBA 1D5YA 3FDYA 4MFEA 2IS1A 3JCUC 3TQNA 2VKHA 1QO0D 4P55A 5KNLA 2WAEA 4G8XA 1MBJA 2JK3A 1I6HJ 3HOSA 1EF4A 3PSFA 1TWAJ 3DPTA 2P5LC 1MD0A 2ESNA 3BG6A 4M3GA 3A01A 2X1CA 5IYDJ 3CESA 4O6JA 3TDUC 2W24A 3B6AA 2QQBA 1Y8RB 4ZDOA 4HQEA 4WWCA 3PO2J 4Y15A 2DTRA 4HBLA 1X2NA 1IDYA 2CRGA 5F0HA 4DBRA 1K83J 1APLC 4KITB 3HSEA 5HDKA 1V54H 3R6SA 3IV5A 5EF6A 1XGNA 1B72B 1X2MA 2LY1A 3CMAI 4FHTA 1S9HA 2A5WA 3W2VA 2RNJA 5L3FA 1OYIA 4NQWA 1Q1HA 3CC2I 4FTHA 1Z0XA 1RUNA 3BTLA 1U2WA 3HTSB 3DEWA 1R9TJ 1B9MA 1S72I 2NS8A 3IL2A 5M5XJ 2VJ4A 4J01A 5HLIA 1NK2P 1Z21A 1R5ID 4LK1F 4JOMA 4FETA 3HOZJ 3HRMA 3CUQB 4AM3A 3A01B 3JTHA 2O9LA 2W7NA 1J2XA 1IJWC 2BZTA 2H09A 3GMEA 1W0UA 1R4MB 1MIJA 2E36A 3EYYA 2NOJB 2O8XA 4M9SA 4G7ZF 2O0YA 3FXOA 2PMUA 4X6AJ 2HZTA 2AQFA 3O2PE 1BL0A 3H1CA 3OYGA 4ZTFA 2DAOA 3CP2A 1VQKI 3E5XA 2QGUA 3HL2A 2YU9J 3BR0A 3LAPA 3ELKA 2HTJA 4G94A 3MAJA 2Z16A 3DV8A 3OR2C 4I09A 1K6OA 3QPTA 4KNYA 2IRFG 2ZSHB 3K70D 4Q48A 2VBYA 2HOAA 2HYGD 5FKMA 2EINH 1LQ1A 5JI6A 4S05A 1UMQA 3ABLH 3ISPA 1BJZA 5EZGA 2VBXA 4BBSJ 4N0BA 2KRHA 3HG9A 3OS1A 5LFAA 5FKNA 3E0JB 3PIPF 2MLGA 4BJ5C 1UELB 1HQCA 3N4MA 3M3YJ 3W6JB 4HPQA 1D5VA 1RPWA 3DTEA 5LRRA 5EG0A 5H6QA 2QLZA 1YE9A 3KFWX 5CLSA 2COBA 3CO6C 1ETOA 4OINF 1O3RA 5DCFA 3DXJF 1R5GA 4UVCA 4HEA2 3ZMTA 1DPUA 4JBAA 4RAZA 5GAGJ 2VOPA 1W36C 2HOTA 2L5QA 2GIZA 2QSGX 3K4NA 2WV1A 3MQ0A 1F1ZA 5LLQA 1GV2A 3CUOA 1Z7UA 2DJNA 4A3IJ 3HUGA 1I5ZA 3J7AY 1F36A 2Z99A 4DW6A 2BW3A 4RMNA 1S7AA 4L18B 3J81K 3DLAA 4IJAA 4FX0A 3P9IA 1G59A 5DUKA 3A4CA 1R00A 3RSNA 3ZQ7A 2OQRA 3S1RJ 1G8XA 1ZKGA 2CW0F 2RGVA 1MW7A 3KP7A 3GTQJ 3IKVA 3S1NJ 2Y69H 2DT6A 1MBFA 2R7RA 1R1TA 4A2UA 3HXLA 5DTDA 4LIVA 2LLKA 1WJ5A 1X4PA 2DTZA 4C2MJ 4YFNF 3BG3A 1B1BA 5DD8A 2R7ZJ 2IA2A 1YTYA 2AXTC 2WC2A 5F04A 2VI6A 2A05A 5J1YA 1A35A 4BACA 1X4OA 2G9WA 3WG7H 5E17F 3E6DA 4RBOA 1MMAA 1IN4A 3GCMA 5CVRA 2JTVA 2P5KA 3U1DA 3HRUA 3MKWB 1G3YA 2KMUA 3GTPJ 5HLTA 1GT0C 1Q1VA 2B0LA 4G12A 3ZN1A 4DNCA 4CCMA 4F55A 4PDKA 4DBQA 4EJOA 3RKQA 2VPLA 5AIQA 3IWFA 1SD4A 5J1UA 3BJAA 1T56A 5C3EJ 1PUEE 4UUVA 2BW3B 1VQ8I 1TC3C 5K7ZA 3PUFA 1WH5A 2OZ6A 4CA0A 1VTNC 3QQAA 3O8GA 5J1RA 3JW4A 2AS5F 4H4KC 3FM5A 4B44A 2F5EA 2R7DA 1BI0A 2V26A 1UHMA 3HGYA 2L3DA 3VOEA 4S04A 2H8RA 3W6VA 3AL0B 2V1DA 1QGPA 4CCNA 2G7UA 1BOAA 3K4BA 4CICA 3F22A 4QLCU 4IKFA 3GEZA 5J6XA 4LLLA 2JZYA 3DF8A 2ZMEA 2H94A 2P4WA 1Z67A 4KICA 1OMIA 2CGPA 4IHTA 3D1NI 3CCRI 2PG4A 3CF5F 3JR9A 2JSCA 3QRFF 1T08B 2K4JA 3CJRB 3RQ4A 4BU2A 4E7SA 3S93A 1QHHD 2LKSA 4YELA 5TISC 4QIWN 1TWGJ 4L5JA 3GTJJ 2W84A 4N9IA 1O7FA 4XK4A 5C44J 3FBIB 5M5YJ 4XM3A 5J8FA 2L9NA 2WBMA 4NBQA 2WA0A 2MGQA 4I6ZA 3LL7A 1WSUA 3Q0VA 3C2GA 4LIUA 4BAYA 2M5WA 3AKZA 4QWQA 5GTHC 4W1UA 3FXUA 1M1EB 1TP4A 1NHAA 1X3ZB 3M7GA 4BQAA 2O61A 2P8TA 4MNUA 3DP7A 3I3LA 4IF4A 1TWHJ 3ZR8X 4BHBA 4NC6A 2EJRA 4NC7A 1WPKA 5IY5H 4MHGA 1FOWA 3VODA 1Z1DA 1OQYA 4Y3OA 2PLYA 1SFOJ 1JTXA 1PDNC 1LFUP 2LNBA 4ENMA 3I59B 5FLMJ 1OCOH 1JHFA 4E7HA 1XGMA 3A2KA 4BGDA 2H1LA 3DKYA 1MNMC 2DDBA 3TO6A 1XMXA 2QCOA 4XN3A 5ILSA 1LFBA 3TW7A 2D1HA 2O7OA 5GPCA 2O8KA 3B02A 4IEJA 3GTLJ 1QBJA 5ICEA 5LGNA 3S14J 2E1NA 3RQIA 2XGDA 1VQPI 3LFKA 4OMYA 4Y7NJ 2BY0A 3ZRGA 1O3SA 4EEFG 4QTRA 2HQ5A 4G7OF 2VJJA 3OV8A 3KCCA 1P6RA 5EGOB 2CO5A 3MZ8A 4PK4A 2I8DA 1U9NA 1HOMA 5E3MA 5E18F 1ON2A 3BC8A 2XDVA 2XSDC 3EUKL 1T95A 2LREA 1XSDA 1IV8A 5B1AH 1G6NA 3FKJA 3ZMDA 4CCJA 2BXYA 1D3YA 2HPIA 2XAGA 1BI3A 5IP6A 3RZOJ 5E3LA 2YSRA 2EPFA 2Y75A 2KIFA 1AU7A 1FMWA 1ONVA 4C3JJ 2DQLA 2ME6A 2HEOA 4V2FA 2OPTA 1X19A 3WODF 4B09A 1F4KA 2CUFA 1K6YA 3K10A 3LQRA 4L5IA 4IQJA 3H9JA 4F52A 1TTYA 2ISZA 2Z5UA 2E1CA 3A03A 3KLNA 1FT9A 2CYYA 4M3BA 1WH7A 3GBGA 2QENA 2ZSIB 4RA2A 4KT6A 3FM3A 3ZMUA 4C2UA 3VWBA 1WI9A 2ID6A 3DQVC 2RVCA 1IXCA 4GYIA 2FF4A 1MH4A 1P4AA 1P4XA 4XRSA 2GXGA 4BH9A 2MH9A 4R79A 1SFEA 2JT1A 4IZZA 3HOWJ 1BW5A 4A5MA 1I3AA 1D8KA 2L4AA 1YS7A 3LSMA 2VE9A 3F8BA 3TKYA 5FLVA 1GXQA 1P7JA 3GUDA 3ZCOA 3R60A 4CCLA 1JT0A 3SDGA 3MZYA 4I0BA 4V19K 4ANJA 2K9NA 4D7MA 2XB0X 1QRYA 2Z1DA 4XIDA 1G3TA 2KZGA 3SJMA 1MDMB 2ZJRF 3HKZA 2BHYA 3L2CA 1NH3A 4UB8C 3CCEI 2R7XA 1XG1A 5HS7A 3WTSC 1WI3A 2EA4A 5EEGA 2YX7A 3RZDJ 5ICCA 1P7IA 1MJBA 1ETKA 2XAJA 4L9JA 4M6YA 3S2DJ 4IHXA 2RQQA 1XPXA 3FHNA 4EM1A 2DQRA 3ZN0A 4CXFA 1Y0NA 4GDFA 2QSFX 5L3EA 3J7ZI 1PP7U 2IP2A 3I56I 2Q8KA 2RN7A 2GOXB 4A6EA 3R0JA 1AKHA 4PJMA 2HOEA 4E7ZA 4XRFA 2P81A 2M7AA 2LBFB 3L1PA 2V6EA 1XMKA 2KKOA 2KZVA 4LLNA 5E3NA 4YFKF 1O7LA 4BE1A 2W85A 1FBUA 3FXJA 1QA6A 1T8IA 3PSIA 1GUUA 1RI7A 4PGGA 2QZ8A 4AIHA 1BBYA 2QVOA 1Y6IA 2IXSA 2PJRA 4BEHA 1QQIA 3EPZA 1YG2A 2E60A 3H5RA 3MKZA 3IH4A 2ZXHA 3FMRA 3LMMA 2XKOA 3BG7A 3LSGA 3K2ZA 1LJ9A 4GO1A 3SEZA 4OIPF 3K4JA 2KPMA 1MMSA 1LNWA 2B9SA 2F4IA 3DFGA 3F0CA 3B73A 3I58A 2X1DA 3QWLA 1FSHA 2A61A 3HDDA 1EH8A 3O8HA 2XRLA 1HKTA 4LB6B 2ELJA 4MEYF 2E19A 2IS2A 4IRIA 1YW7A 3AFHA 4E70A 4F3QA 1XDUA 1W5CC 2FMLA 1HDDC 5FD6A 3H3UA 1BIAA 3QPHA 4WCGA 3Q5FA 3S15J 2W4SA 2EIKH 2KRFA 4Y13A 3S2WA 3G3ZA 1BR2A 1EH6A 3H36A 2P7CB 2E1MC 1GLNA 3CF2A 2DOEA 4FT8A 4FASD 2ZXWH 2HNHA 3SHFA 4HRIA 1MZBA 1SVOA 3V7RA 2O03A 4L9NA 2ELKA 1EV7A 4EVIA 3L2UA 3AG1H 1QVTA 5EJCA 5E1XA 1XMAA 2RDPA 5JHUA 3FKIJ 5B5EC 2Y0MA 1CF7A 4M73A 1U5TA 1XDSA 1IRGA 5D6EA 3E6MA 1ZREA 2Z33A 4ON0A 2LVSA 4I7HA 3BT9A 2XAUA 1B9NA 2OAZA 2IGMA 2FXAA 1UHSA 5DCMA 2R92J 2WTEA 5B1BH 4I01A 1DP7P 3FMQA 5IT9Z 2R93J 1YRNB 3CLOA 1BJAA 2JQ7A 2RNGA 1FC3A 2DA6A 4IQ4A 4ZYAA 2E35A 3OYCA 3K69A 2LKXA 2R7VA 1RR7A 1AHDP 2L7FP 4AD9A 2JJ7A 2L2OA 1ITYA 4A0XA 1YYVA 4HNVA 3D5LA 2JA8J 1MSFC 5IT9K 2UWMA 1JKQC 2XV4S 1ETYA 2NVTJ 3NWSA 4U0YA 3SYTA 3G6EI 3GZ5A 2E7XA 4K2EA 1SEUA 2GXBA 3JTGA 2LDUA 1SFKA 4EM0B 2DFHA 3EETA 4N4OB 5F1RA 4MTDA 3HOXJ 1J59A 4L0YB 2JPCA 3LWFA 4P1WA 4CYDA 2HTSA 1FEXA 3K2AA 4PJJA 2M0MA 4JQFA 5FO5A 4CZZA 3BR2A 2ZNZA 4F91B 2HS5A 1V3FA 1OCTC 4Z2YA 2WWYA 5JVGF 3L2QA 3OSFA 3KEOA 5GADJ 3J80Z 4ESJA 1E3OC 3M8FA 1V5FA 1R5HA 2DYSH 2IVMA 1QPIA 1JHHA 1TBXA 2HXOA 2EV0A 2CV2A 1FYLA 5FGMA 3Q9VA 4HF1A 1KYZA 3AG4H 3WE3A 1LFPA 1TWFJ 2HDWA 2KLOA 1HKQA 1Y1VJ 5DDGA 4GYGA 4HZFA 2ME0A 2LFBA 1P9QC 1D0XA 4A3LJ 1MNEA 2VKVA 2VJIA 1MMGA 2G7HA 3WTYC 4BNCA 2CUEA 1ZLKA 1HLVA 3VYRB 2FJ1A 2XGXA 2LYCA 2P0WA 3J81Z 2GA2A 2CV0A 3R0AA 4UV8A 2LD5A 5D5WB 4XOTA 3MMYB 4A0ZA 2Y48A 4M9XA 4NC8A 2RKHA 2NVXJ 5FRMA 3HPHA 3L9FA 1OCRH 3PM1A 1MKMA 3T1BA 1GXPA 2DODA 2VC1A 2FBHA 1K78B 2ECBA 3V7SA 3OS2A 1TNTA 4XR6A 5J4YA 1K61A 2L4MA 2ZJPF 3UNGC 2MBFA 3FK6A 4C3HJ 3P9CA 4KMFA 5LD2C 1Z77A 4A3FJ 2B7EA 3DBHB 4HX7A 3O6BB 3CZ6A 4UUSB 3T0YA 4HF0A 5HS8A 3V42A 1N25A 2E34A 4XMYA 4ZDLA 1NG6A 3S2HJ 1VFCA 2Y9ZA 4XSXF 5IP9J 3SQNA 2NVYJ 1TQIA 2LSOA 2QKLB 3OOUA 4KT5C 4A0YA 1H88C 2DBBA 2VPRA 1YJ9I 3IAM2 4IHWA 1HW2A 3OL3A 2WV0A 4WF2A 2OU2A 3BROA 2K9LA 4A3DJ 2OJED 2ZFWA 4OIRF 1E3HA 2DA1A 2IGOA 2IA0A 4LJZF 4F7ZA 3K6GA 1JT6A 2I5UA 3C2HA 2D2WA 4IPAA 2NS0A 5H6RA 4E7IA 2FMYA 5FKOA 2OCCH 2X51A 1SFUA 4RAFA 4DJAA 1R1VA 3GYHX 3AAFA 3X2QH 1V5EA 4UUSA 3RPUA 4D0PA 4UY8I 2PMHA 1FOXA 4KISA 3I71A 2A68F 3DTIA 3F3XA 4PSXA 3QPSA 2VLAA 5F64A 2DFIA 2CW7A 1YX5A 5BNGA 2QKMB 2DOAA 2HQNA 4EJTA 4C2TA 3CCLI 4YRVA 1NG7A 2E2IJ 1IF1A 2FQ3A 3QU3A 5M3FJ 2ZJQF 4PUSA 2HWVA 4BJTA 3HOYJ 3GWZA 2ZXJA 3FX3A 1D1BA 3GZNB 3OYFA 1YITI 2HYFA 4IXAA 1JGSA 2DA5A 1ERDA 3H3VK 3CCYA 4AVPA 1N78A 3C7JA 3IRRA 1PUFB 2Q2EB 1Z9CA 2JA7J 3CQZJ 2M7BA 4HA8A 4LG0B 2KJCA 4KDPA 2H1KA 3CMMA 3EUAA 2IPQX 3OYIA 4G6TB 3BZCA 1XSXA 4RB3C 4AUXA 3JRAA 3WU0A 3HBLA 3HZJA 2HFHA 3GW2A 5K5QA 3A0HC 2JVHA 4MIMA 2V9KA 1JJ6C 1ZR4A 2JSPA 2UUZA 4G9YA 3RKYA 4UXNA 4M72A 3M9AA 1W7PB 4BY1J 3FXRA 4YIFA 4HW0A 4B3AA 2K9MA 1A5JA 1PP8F 3ABMH 3Q9SA 2CUZA 5IYCJ 1JJ8C 1J9IA 1MGTA 2XPVA 2FEZA 3KE2A 1VI0A 5AONA 2R5YA 2L54A 1YS6A 3TO9A 5E8IA 2KJBA 4PSWA 5L3CA 4U0WA 4IHSA 2V6CA 4NB5A 2H27A 1Y8QB 5J4VA 4MQVA 3ECHA 4RGSA 2EV6A 3GFLA 3CP8A 2Q2EA 1QNTA 1TW2A 5CVUA 1BOBA 2HZDA 3RYRA 3MD2A 3G1OA 4MO7A 3OL4A 3U1KA 4Y4RA 1X3WB 3G73A 2YPRA 1R1UA 4FE4A 1HBXG 4HDVA 2EQRA 2ACJA 1H89C 1ZN2A 3LOCA 4IOCF 2DMUA 3LSIA 4DYRA 5K5OA 2KDZA 2LTPA 4ZC3A 3ROUA 4BHPA 2CFXA 1CGPA 4A12A 2ZC2A 1K4SA 1OR7A 3EDPA 2LKPA 3BY6A 3QOPA 1E17A 2NYXA 1D8JA 4IRHA 1LVKA 2M4KA 3OYKA 2X85A 1KQ9A 2NVQJ 2V1XA 5LHGA 4IL6C 4DYQA 2PEXA 4WXCA 4RM3A 4KIBA 4OWRB 4II3A 3LAJA 3HRSA 1XD7A 3L7WA 5M3MJ 3A1YA 2EIJH 1OYWA 2KIQA 3Q0WA 1IN6A 2LF8A 1QZEA 2VT2A 2HQRA 5HDNA 3DBRB 5CVIA 1VQMI 4KJZA 2F6CA 2XAQA 3ZQIA 2JPBA 1CQTA 2JVGA 1YHQI 4HSTA 1YW9A 3TMOA 4ZTJA 1W5TA 4L9VA 3MKLA 2W57A 2CUJA 4HX4A 2X1EA 2W25A 2R7QA 4UVAA 4RB1A 2HU9A 3HHGA 5KAFC 3NRVA 4I02A 3ABUA 3E6BA 3TEDA 1MH3A 4CO8A 3JREA 2CQNA 1H8AC 1DU6A 2LK2A 3GTKJ 5E8GA 4DYCA 2KP6A 4NQWB 1BC8C 1ZTRA 2JUGA 1RC9A 2XUBA 5DYMA 4M9ZA 1VQLI 4AIKA 3OY9A 3KIOA 4R8HA 1VQ7I 4I76A 2FSWA 2L0KA 4HOBA 2M8GX 1OYYA 1R36A 3QP5A 2OC6A 3IP4B 3JRHA 1TNSA 3LQQA 2F5CA 2OBPA 5C4XJ 3CUQA 4W97A 1ZQ3P 3MZHA 4X0GA 4ESBA 4FX4A 2FBKA 4BXXJ 2RAEA 4LK0F 4D9JA 4HV6A 2MH2A 2L7MP 2ZMEB 4KN4X 4UVBA 3CDLA 1L3LA
chains in the Genus database with same CATH topology
2R7XA 1X1DA 2WAFA 3UR3C 2VB6A 4RLFA 1KONA 3L2VA 3EUHC 1X1CA 2KRCA 4BQQA 3QODA 4NNJA 2RQQA 4XKCA 3FHNA 3IAS2 3VDXA 3DPLC 3OMYA 5CQGA 3OYMA 2HVSA 2GOXB 1X1AA 3K4MA 4B47A 1WJCA 4PJMA 4YEJA 4E7ZA 1WJEA 2W1OA 2LBFB 2BOLA 2M7AA 5HVQC 2V6EA 2KZVA 4XLFA 2WB1A 4LITA 4RM2A 4BE1A 2DJIA 2HVRA 2WY7Q 2KQRA 4E6KG 3PSIA 2R7UA 2KDOA 2X6XA 2Z2SB 1Y6IA 2IXSA 2RREA 2LRDA 3NWTA 2PJRA 2VXZA 4BEHA 2K5CA 3EPZA 2E60A 3H5RA 4B3XA 3MKZA 3ZGKA 1Y56A 2E5NA 2ZXHA 2L9SA 3LMMA 2HPMA 3BG7A 3IUOA 3LSGA 3OR1C 3SEZA 3VSLA 3K4JA 3HPGA 4BE2A 2KPMA 1WFXA 3N05A 2F4IA 2L7KA 3K4CA 2BVLA 3TBIA 2MC4A 1MNDA 2X1DA 2R4GA 2ELJA 2WADA 2IS2A 3AFHA 4F3QA 3HUGB 2GOMA 3W3CA 1V5GA 3H35A 4PFPA 1DGRM 1N75A 2KHMA 2VL8A 4IX7A 3DTKA 2O5RA 4B48A 2IS4A 3RPUD 1FMVA 1R6RA 2W4SA 5HNHA 2E1MB 1W36D 1UAAA 1BR2A 4BS9A 2CS3A 2E1MC 1GLNA 4PJLA 3CF2A 3OIPA 2KL4A 5TGTA 4FASD 3FDYA 4XQFA 2IS1A 2HNHA 4HRIA 2R7WA 3QYBA 2VKHA 5KNLA 1TT0A 2WAEA 3L2UA 3HC7A 3HOSA 2CV1A 3PSFA 3DPTA 3BG6A 2X1CA 4ZJZA 3CESA 2XAUA 4C30A 2X6WA 2IGMA 1WJDA 4ZDOA 1QU3A 4DBRA 1D1CA 4KITB 1TZLA 2OUMA 2RNGA 2LY1A 4IQ4A 4ZYAA 2MABA 3OYCA 1N77A 1S9HA 2R7VA 3OYDA 2A5WA 3W2VA 4GRIA 2L2OA 2LC2A 1WJBA 1IRXA 2IGKA 3D5LA 2VIXA 1X1BA 4QPQA 2UWMA 1Z3XA 5KHDA 4XLEA 1UG0A 2VJ4A 2E5ZA 4J01A 1Z21A 3NWSA 3U21A 4JOMA 3SYTA 2XC7A 4FETA 4XKVA 4CZCA 3KEYA 1SFKA 4E4HA 4XL9A 4N4OB 2BVMA 2R7SA 3DWLE 4P1WA 4PJJA 3K4LA 2W7NA 2M0MA 4JQFA 5FRNA 2A6TA 3LSHA 4F91B 4E7LA 2VQLA 3SDBA 2NOJB 4C9YA 3L2QA 4NUBA 1BR4A 3OWTA 5KCMA 1QHGA 2AQFA 3OYGA 4ZTFA 3CP2A 1V5FA 3HL2A 2CV2A 3QYEA 3OYJA 1DP3A 2XF5A 3OR2C 2Z16A 1LFPA 1Z7LA 2HDWA 3F9KA 2KLOA 2ZSHB 1Z3YA 3K70D 1MMNA 2LBFA 4CUGA 3TL4X 2LG4A 2VKDA 2R7TA 1P9QC 3ONQA 4DGWB 2VASA 1D0XA 1MNEA 4HNTA 2KRHA 2VJIA 3HG9A 1MMGA 3OS1A 5LFAA 2WAQA 3DPUA 3E0JB 3VYRB 4U87A 4BJ5C 2LYCA 1UELB 2P0WA 4HPQA 3VYTB 3OYBA 2PJRB 3OYHA 3DTEA 2CV0A 3PJRA 2ZXIA 2HQAA 4BL0B 4XOTA 3MMYB 3DU6A 1YE9A 4NC8A 4Y33A 5FRMA 4BJ6C 1OLTA 3HPHA 4HEA2 3OS2A 4XR6A 3UNGC 5HOOA 1W36C 2L5QA 4P5OA 3K4NA 5LD2C 4XLHA 2LH9A 3CZ6A 4BQOA 3J7AY 1D1AA 3PUBA 3PL8A 1HA8A 4XLCA 2BW3A 3V42A 4RMNA 2V7FA 4XMYA 4XNFA 4ZDLA 3DLAA 1NG6A 3VSKA 3H9GA 3K4KA 3DKXA 1G59A 3A4CA 3RSNA 2QKLB 3OOUA 4BDYA 1G8XA 1MW7A 1LDKB 3KX2A 3IAM2 2DT6A 3BCBA 3OL3A 2R7RA 3W2AA 2VXDA 3PNYA 5CPRB 3S3NA 3D5SC 3HXLA 4LIVA 3AL0C 2V4JC 3L2RA 3M1CA 4BUPA 2K9LA 1WJ5A 3OIQA 1X4PA 3QYFA 2IGOA 3H9QA 3RTRA 4XKWA 1MMDA 2XF6A 4BACA 1X4OA 2LOOA 1OR7C 1MMAA 3K6GA 3MKWB 3C2HA 2KMUA 3D5RC 4EATA 5HLTA 4E7IA 4ITVA 2WY8Q 3LFUA 1D0YA 3BCAA 4CCMA 4F55A 2X51A 4DBQA 2VPLA 2PMZA 4DJAA 2MYSA 1V5EA 2AQEA 3M8JA 2Q1ZB 5CKTA 4KISA 2BW3B 3DTIA 4PSXA 3SZGA 2VLAA 3H0DA 4AYBA 2CW7A 1YX5A 3LSKA 2CW8A 4CA0A 2QKMB 1YX3A 2DOAA 4C2TA 5HNFA 1NG7A 3W2WA 4YRVA 4H4KC 2VQCA 4B44A 3DEEA 4PUSA 4BJTA 2OV7A 4CCOA 2HVQA 1D1BA 3OYFA 3G2BA 2V26A 3PNVA 1ERDA 3AL0B 3VYSB 1N78A 3OS0A 2Q2EB 4XOPA 4CCNA 3K4BA 2M7BA 4IKFA 3OYLA 3CMMA 3EUAA 3S3MA 3OYIA 4G6TB 4HNUA 4J00A 3SEQA 3RQ4A 3CJRB 4BU2A 4E7SA 3L2WA 3S93A 1QHHD 4YELA 4CSWA 1PYVA 2JVHA 2V9KA 1DGWY 2JSPA 2UUZA 4MLOA 2V1NA 3FBIB 3I9V2 3H5NA 4XM3A 4XN0A 2K9MA 2VQGA 2L9NA 2X6YA 2WBMA 2CUZA 2WA0A 1PJRA 1AA7A 3LL7A 2XF7A 1WJFA 3C2GA 4LIUA 2DT7B 4PSWA 3AKZA 3PNTA 4E7KA 4XORA 2K3PA 2LY2A 3I3LA 3CP8A 3ZR8X 2M3AA 4NC7A 3E1SA 3HOTA 4Y3OA 2FUG2 1E0EA 4DIQA 1BOBA 2HZDA 3BLYA 4LG3A 5FROA 4E7JA 1JI8A 2CMPA 3MD2A 3OL4A 4PFOA 4BQNA 4Y4RA 4E7HA 3A2KA 4BGDA 3S8PA 3DKYA 2XSJC 4U7BA 4XN3A 3LSIA 4DOZA 4ZC3A 2UV1A 4II2A 3ZQQA 2W00A 3S3OA 2MFZA 3MKYB 3ZXSA 2JA2A 4CCKA 2DXIA 1U0JA 3ZRGA 1SAUA 4OAZA 1LVKA 2VJJA 2M4KA 3OYKA 2X85A 4HG2A 4PK4A 2I8DA 1T0FC 1LKXA 4AVZA 3BC8A 2XDVA 3EUKL 1T95A 2LREA 3VYUB 3FKJA 4RM3A 4OWRB 4CCJA 4II3A 1BR1A 2HPIA 1DQUA 2M4GA 3A1YA 1EA3A 2R7OA 4AU7A 3OYAA 1ZELA 2DCEA 1FMWA 3FBNB 2F6CA 4KJZA 4XONA 4CH7A 2JVGA 4HSTA 3TMOA 1WJAA 5CQEA 4ZTJA 3PFYA 1X19A 3H5AA 4BDZA 2IS6A 1K6YA 2CUJA 3K10A 3RCOA 2F5VA 4IQJA 3H9JA 4F52A 2X1EA 2R7QA 2CH0A 3S32A 2HU9A 3GBGA 2ZSIB 4QPOA 4KT6A 4XKBA 3K70C 2VJ5A 4HSRA 2KP6A 4XLAA 3VWBA 4C2UA 4NQWB 4F93B 2JUGA 4F92B 3OYEA 3DQVC 2MD0A 3OY9A 4BE0A 3DU5A 4D1QA 2W82A 1J09A 3CJQB 3QOEA 4R79A 2IGNA 4IZZA 5JHFA 1VZ0A 2ZFUA 3LSMA 3OYNA 1D0ZA 2OC6A 3IP4B 4BEHB 4ZDPA 4BXFA 4B43A 3ZCOA 4CCLA 2CFOA 4X0GA 4RLQA 3KYLA 4N4NB 4PJNA 4ANJA 4D9JA 2Z1DA 4OAYA 2VQHA 3HKZA 2Y0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XC7 A;  2W4S A; 
#chains in the Genus database with same CATH topology
 1I50 J;  2EFP A;  1IW7 F;  2LF7 A;  1W1W E;  1R4N B;  4RLF A;  3U9G A;  1O4X A;  3VFZ A;  4HX8 A;  3EUH C;  5JLW A;  3QOD A;  4UNO A;  3LSJ A;  4DZP A;  1Y1W J;  1GVJ A;  3IAS 2;  2GXA A;  2YU3 A;  3KET A;  4Y52 J;  1LDD A;  1WRJ A;  3FXL A;  3ZQH A;  3OYM A;  4PCQ A;  1I1G A;  3F6V A;  4YEJ A;  1FLI A;  2W1O A;  2A6H F;  4MTE A;  3GFJ A;  4XLF A;  5BPD A;  5F0C A;  4RM2 A;  3BDD A;  2DJI A;  3TOA A;  2KQR A;  4E6K G;  3VB2 A;  2KDO A;  2X6X A;  3G4S I;  1RIO H;  1BI2 A;  2ZNY A;  4MGR A;  3ABK H;  2M45 A;  2EWN A;  3ZGK A;  1Y56 A;  4KYW A;  5LGT A;  3CCM I;  3IUO A;  3KZZ A;  3RKW A;  3L09 A;  3VSL A;  3Q0U A;  4C3I J;  1WFX A;  1MDM A;  3I59 A;  1E2X A;  1HDP A;  4I98 B;  4JX5 A;  2DPD A;  4JX6 A;  3K4C A;  2BVL A;  3P9K A;  3T8R A;  3TBI A;  4ABZ A;  1XN7 A;  4UV9 A;  2R4G A;  3BPV A;  2FU4 A;  2FD5 A;  2IW5 A;  2DLL A;  1SC7 A;  2XB5 A;  1U8R A;  2LMD A;  3HUG B;  4M3F A;  3H35 A;  4PFP A;  2VL8 A;  4D5F A;  3GTM J;  1G4D A;  2PQ8 A;  2DMN A;  2DOF A;  2AXL A;  2O5R A;  4KIG A;  4B48 A;  2L9V A;  4BS9 A;  3WGH A;  4RDU A;  1UB9 A;  2CS3 A;  3OIP A;  5TGT A;  2KL4 A;  3HTU A;  5DEQ A;  5EGO A;  2A07 F;  2GBY A;  3PQK A;  5J3L A;  3KZY A;  4HLY A;  1IDZ A;  3IC7 A;  1FX7 A;  3G71 I;  1TT0 A;  3MN2 A;  1EH7 A;  1MBE A;  5FFZ A;  2EZL A;  1UST A;  3A02 A;  3HHH A;  2CV1 A;  2R7F A;  3GX4 X;  2VC0 A;  3JRF A;  4KUM A;  3ASN H;  5E1Z B;  4C30 A;  1VQO I;  1TL8 A;  3BPX A;  2DPU A;  2CWE A;  3V8J A;  2XKP A;  1A6Q A;  2H6C A;  1QU3 A;  1WWX A;  4OIO F;  4ZYE A;  1I6X A;  3PFI A;  2X9D A;  3WHC A;  5BS6 A;  2QF7 A;  1FBS A;  1T38 A;  2EFQ A;  2MAB A;  1N77 A;  3WHB A;  3OYD A;  3ZMS A;  4B4C A;  2WAQ N;  2DMT A;  1IRX A;  1ZRF A;  3CDH A;  2IGK A;  1FYK A;  1T39 A;  2EBI A;  2XVC A;  3EQL F;  3WGI A;  3E7L A;  2ZO4 A;  1UZC A;  1K7A A;  1RNL A;  4ENN A;  5CYV A;  5KHD A;  3E5Q A;  4ZZL A;  3GXO A;  2E5Z A;  4FCY A;  2GA1 A;  4GCV A;  4JYK A;  4ASN A;  2XC7 A;  4XKV A;  3OSG A;  4CZC A;  3KEY A;  4LLG F;  4KMU X;  4XL9 A;  2BVM A;  1CF7 B;  2R7S A;  3DWL E;  4LD5 A;  2E71 A;  1KQ8 A;  2CQK A;  3K4L A;  1TLH B;  4LGW A;  4GXO A;  1BM9 A;  4RAG A;  1V55 H;  5FRN A;  2VON A;  1HKS A;  4RGR A;  1IN5 A;  2K02 A;  3M07 A;  2BHZ A;  1IO2 A;  2A5Y B;  3ABT A;  3TP0 A;  3CD6 I;  3EUH A;  4NUB A;  3RJP A;  3OWT A;  1QHG A;  3DCF A;  2MG4 A;  2K7L A;  1P92 A;  2MC3 A;  3K1P A;  1WGX A;  1SD5 A;  3OYJ A;  1U78 A;  1ENH A;  1DP3 A;  3W6K B;  1Z7L A;  4OIQ F;  4RS8 A;  3WE2 A;  3CUQ C;  2LBF A;  1WQ2 A;  2ADU A;  2VKD A;  2AO9 A;  2LG4 A;  1Z6T A;  3TL4 X;  4XLP F;  1MJA A;  2R7T A;  1STZ A;  3ONQ A;  2VAS A;  4GFB A;  2EZH A;  2RC4 A;  4HNT A;  3KP3 A;  3GO5 A;  4B8X A;  5F1J A;  3DPU A;  4U88 A;  2EK5 A;  1EKE A;  1IXR C;  3VYT B;  3OYB A;  3T8T A;  2K85 A;  2ZXI A;  1GV5 A;  3DU6 A;  1T0F A;  2XPW A;  4KIF A;  4IRG A;  4BJ6 C;  1BA5 A;  1OLT A;  4M74 A;  1MBG A;  5K7F A;  1B8I B;  1P4W A;  2YR2 A;  1MBH A;  2JRT A;  1KZH A;  4XBF A;  2OD5 A;  1MJ9 A;  5HOO A;  3F23 A;  2GLO A;  3G1L A;  1JKP C;  2MLK A;  1R7J A;  2GM4 A;  2LH9 A;  2R5Z A;  2I10 A;  4BQO A;  3F72 A;  2DMQ A;  3ECO A;  3LA7 A;  1DPR A;  1KU7 A;  3PL8 A;  1HA8 A;  4UB6 C;  2FOW A;  1VQ4 I;  1OJL A;  4XNF A;  1K4T A;  2ZJ2 A;  3K4K A;  4ZYG A;  3KLO A;  4BDY A;  2KIU A;  2VBZ A;  3W2A A;  3PNY A;  1ZG3 A;  5CPR B;  2MSY A;  3D5S C;  2V4J C;  3M1C A;  4BUP A;  3OIQ A;  5F0F A;  3QYF A;  3H9Q A;  4FE7 A;  3RTR A;  4XKW A;  2XF6 A;  5FKL A;  1XB4 A;  2EFN A;  5J40 A;  3JRB A;  1OR7 C;  3CC7 I;  2DFF A;  2V9V A;  1UCR A;  2ZME C;  5JLX A;  3RYP A;  1UFM A;  1XTA A;  2AHQ A;  3SFZ A;  4I2O A;  3LFU A;  3WTT C;  1IAW A;  4OMZ A;  2X48 A;  1TQM A;  1REP C;  4HAM A;  3F21 A;  1KU2 A;  1Y39 A;  3KP2 A;  4LB5 A;  5KK1 A;  5D4S A;  2PX9 A;  5H20 A;  2AQE A;  4XRS G;  2PBI A;  2Q1Z B;  5CKT A;  1MBK A;  2OZU A;  1SAX A;  3SZG A;  3IKT A;  2QEX I;  3H0D A;  3F8F A;  2CW8 A;  1YX3 A;  2FX0 A;  2JUC A;  5D8L B;  1DDN A;  4A6D A;  1W4M A;  1B4A A;  5TRD A;  1A31 A;  3DEE A;  4DQ2 A;  4CCO A;  2OV7 A;  1IRZ A;  2HVQ A;  3G2B A;  3HRT A;  4I0A A;  2STT A;  2Y31 A;  3PNV A;  4Q47 A;  2VOO A;  2NAZ A;  3JAM K;  3E97 A;  3S1Q J;  2DW4 A;  3OS0 A;  2VOD A;  4XOP A;  1POG A;  1RUO A;  2L9R A;  5ERI A;  1U6G A;  4AYB N;  3S3M A;  5C4J J;  5EEA A;  5ICG A;  2JMW A;  1WKM A;  1KYW A;  4WXH A;  3JRG A;  4P96 A;  3SEQ A;  3S1M J;  4R1H A;  3I64 A;  3ZMV A;  4ZH4 F;  3A0B C;  1QZY A;  5BMZ A;  1S5L C;  5FB2 A;  5FJ8 J;  1DGW Y;  1J0R A;  2O3F A;  2L7Z A;  4MLO A;  2BXZ A;  2K40 A;  2X0L A;  1WCM J;  2V1N A;  1S7E A;  3H5N A;  3I9V 2;  1J75 A;  1ZRC A;  4P9F A;  2PN6 A;  5L3D A;  1ZG5 A;  4HQM A;  4ETS A;  1FIA A;  2OQG A;  1XGS A;  2A6E F;  2QA4 I;  1PJR A;  3FWE A;  3HIF A;  3MVP A;  2NNY A;  3ZPL A;  1VQN I;  1V4R A;  1QPM A;  1VQ9 I;  1RZ4 A;  4AC0 A;  2LR8 A;  2VT3 A;  5M5W J;  5CVJ A;  1A04 A;  2JA5 J;  1H9G A;  4V2G A;  2M3A A;  4ESF A;  3HOT A;  1W0T A;  1E3P A;  1PVE A;  2ID3 A;  2KIM A;  2EZK A;  5HS9 A;  1SFX A;  3BLY A;  4DIQ A;  3D0S A;  3WTU C;  4E7J A;  2A3S A;  2TCT A;  4PFO A;  4BQN A;  5L3G A;  3S8P A;  2NXN B;  5JR3 A;  1K78 A;  2K27 A;  1ZGJ A;  3Q3S A;  2PJP A;  1FP1 D;  3E3V A;  1UHW A;  3F8N A;  1S8N A;  4DOZ A;  1BIB A;  1T98 A;  2UV1 A;  1WHU A;  2W00 A;  3ZP5 A;  5FFX A;  2MFZ A;  3MKY B;  3ZXS A;  5FLX Z;  3J7Y J;  3FXK A;  4AWX B;  4CCK A;  2DXI A;  1IRF A;  5IPA A;  4D5C A;  1SAU A;  2A69 F;  3HB9 A;  4OAZ A;  1SVL A;  4KFC A;  1OIS A;  3JSP A;  4HG2 A;  3PO3 J;  1T0F C;  1LKX A;  4EM2 A;  1QVU A;  4XSZ F;  3BQY A;  1U5T C;  4FQG A;  1JUP A;  5DUI A;  1FOK A;  2M4G A;  2BY2 A;  1X1P A;  3K1M A;  3HOV J;  4WK8 F;  5F6F A;  1S7O A;  3I4P A;  3OYA A;  1U8B A;  1ZEL A;  1XS9 A;  2V79 A;  2DCE A;  1W7P D;  3FBN B;  4G6D A;  4J19 A;  1AWC A;  3FIS A;  4NHJ A;  3PFY A;  2MA3 A;  3GFI A;  3H5A A;  2ELH A;  4RB2 C;  2IS6 A;  3RCO A;  2F5V A;  5GP9 A;  3HGG A;  3S32 A;  2HOS A;  4UUT A;  1B72 A;  1A36 A;  3I55 I;  4QPO A;  4ENJ A;  2CJJ A;  5LGU A;  2Z3Y A;  4HSR A;  2E1O A;  4XLA A;  4EJV A;  4F93 B;  2WB1 N;  3OYE A;  2DA3 A;  2MD0 A;  3BZK A;  1WZ2 A;  4BE0 A;  3SXY A;  4EMS A;  3VEP A;  4D1Q A;  1R49 A;  5E1W A;  1J09 A;  3CJQ B;  3QOE A;  4A5N A;  4A3G J;  2BV6 A;  2JRM A;  2DA7 A;  5JHF A;  4EGZ A;  5F08 A;  3OYN A;  1D0Z A;  3NAR A;  3ASO H;  4DZJ A;  3CCV I;  1EJ9 A;  3BJ6 A;  2G0E A;  2HI3 A;  4M3D A;  2B63 J;  4B43 A;  1JUM A;  2ECC A;  1PUF A;  3HSF A;  3KYL A;  2DN0 A;  3FK7 A;  3COA C;  4PJN A;  1SD6 A;  1TT5 B;  2VQH A;  3IRQ A;  1ZR2 A;  1VND A;  5JFR A;  2Y0S A;  5L3B A;  1ZH5 A;  2QYO A;  1YLF A;  1YIJ I;  1FIP A;  1XCB A;  3UR3 C;  2VB6 A;  2L02 A;  2M8E A;  4A69 C;  3RPQ A;  1ETX A;  4H0E A;  2RV8 A;  4BQQ A;  2XAH A;  4NNJ A;  3V4G A;  3RI4 A;  1YO5 C;  3VDX A;  3FHZ A;  3CCU I;  1W7P A;  3TO7 A;  2GAU A;  3DPL C;  3V8L A;  3BG5 A;  1RES A;  5ED4 A;  2HVS A;  1U9O A;  2DK8 A;  3FXM A;  3BTI A;  2K4B A;  1X1A A;  1R23 A;  1XC5 A;  1WJE A;  5AIP A;  3ZMZ A;  2BOL A;  1S3J A;  4RB0 A;  4ZYH A;  1BI1 A;  4LIT A;  5GTI C;  3H0G J;  1ETV A;  1LUJ B;  2XGE A;  2F48 A;  3HKZ N;  2R7U A;  5EEH A;  3RDI A;  1I1S A;  3CCS I;  2Z2S B;  3KP4 A;  1G3W A;  3OIO A;  4LOC A;  4B3X A;  5EG0 B;  3C2B A;  2CU7 A;  3BR3 A;  3HSR A;  3FIW A;  4JP0 A;  2L9S A;  4FIS A;  1TWC J;  4XRM A;  5EDN A;  3DLL F;  1FYM A;  4M3E A;  2J5O A;  5D5U B;  3HPG A;  3U2R A;  3N05 A;  5A2Q K;  3SZP A;  1JGG A;  3M4O J;  4N9H A;  2MC4 A;  4Z6Y A;  3NQO A;  1HST A;  1JE8 A;  2BBY A;  3I54 A;  5GAH J;  2W48 A;  1S6L A;  4A3K J;  1USS A;  3CCJ I;  2GOM A;  3W3C A;  3ZQF A;  1V5G A;  3WG9 A;  1DGR M;  2DA2 A;  2PI0 A;  2M1B A;  4IX7 A;  3IHU A;  2CQQ A;  3DTK A;  1IXS B;  3JRD A;  3E6C C;  2Z9O A;  5B66 C;  2IS4 A;  1IG7 A;  3RPU D;  1FMV A;  1R6R A;  5HNH A;  1W36 D;  1UAA A;  3I4N J;  1OCC H;  2RQP A;  2CQ7 A;  3S17 J;  4IO9 F;  2EFO A;  4PJL A;  5HOD A;  1SAN A;  1NTC A;  4A3J J;  4XQF A;  3TDZ C;  1IC8 A;  1ETW A;  3SFI A;  3QAH A;  2R7W A;  2EH3 A;  3CLQ A;  3QYB A;  2TRT A;  3QP6 A;  4BXU A;  1YJN I;  4G6Q A;  4GGG A;  3HC7 A;  1MSE C;  1HCR A;  2BY1 A;  2J5P A;  1FTZ A;  1HW1 A;  9ANT A;  2F5D A;  4CGZ A;  5IOY A;  4EGY A;  3RKX A;  4ZJZ A;  2DT5 A;  2C6Y A;  3CME I;  1ACI A;  2IEK A;  1JKO C;  1OPC A;  5FKK A;  1LPQ A;  1A6I A;  2X6W A;  3C3W A;  1FSE A;  1WJD A;  2GIV A;  1GVD A;  2NRA C;  1D1C A;  1FPQ A;  1IZ1 A;  2HKX A;  4M6X A;  4G7H F;  3ULQ B;  4A3C J;  1J5Y A;  1TZL A;  3LST A;  2OUM A;  3K1N A;  3L00 A;  1I3Q J;  1T2K A;  2LY9 A;  2IT0 A;  1SMY F;  3ESW B;  2NNN A;  2OF7 A;  2E7W A;  4HLX A;  3JRC A;  1Z05 A;  4GRI A;  2LC2 A;  4XIC A;  2V9P A;  5D4R A;  1WJB A;  3R61 A;  2QM3 A;  3FF5 A;  3JAM Z;  5D6F A;  1T6S A;  2VIX A;  1X1B A;  1RKW A;  5TJJ A;  1UG2 A;  2EZI A;  3BWG A;  4QPQ A;  2UXX A;  1JTY A;  4MFD A;  2FNP A;  1Z3X A;  1FNN A;  4XLE A;  3TGN A;  1UG0 A;  3CJT B;  3H3Z A;  4LG0 A;  3ERE D;  1ODD A;  5LRS A;  1FJL A;  2XAS A;  3U21 A;  6PAX A;  3S16 J;  4WXD A;  1LDJ A;  2COM A;  4E4H A;  2FQ4 A;  4WX9 A;  5BQT A;  4EQQ A;  3P7N A;  4Q5S F;  2VUM J;  2QUF A;  5E20 A;  1XSV A;  1O3Q A;  1IUY A;  2A6T A;  3KP5 A;  4O5V A;  3LSH A;  2VKE A;  5K7H A;  4E7L A;  3R4K A;  2HGC A;  3ZOB A;  2VQL A;  3WTZ A;  3C1D A;  5BOX A;  3SDB A;  2P6T A;  2PFB A;  4PGH A;  1FOY A;  5LHH A;  2NOG A;  4C9Y A;  1BR4 A;  1R58 A;  3V7C A;  4ZZD A;  2FNA A;  5KCM A;  1IUF A;  1KU3 A;  1RET A;  4CYC A;  3QYE A;  2MW8 A;  3GZ6 A;  1YFH A;  2XF5 A;  3WTV C;  4MEX F;  3F9K A;  1LVA A;  1AKH B;  1Z3Y A;  5CJ9 A;  1HW5 A;  1MMN A;  3VPR A;  4CUG A;  3BOQ A;  2M0C A;  3EYI A;  3BR6 A;  1BW6 A;  3I4M J;  4DGW B;  2H8W A;  3KPH A;  3G1M A;  5FD5 A;  1KA8 A;  1TW3 A;  2WAQ A;  3M1E A;  4U87 A;  1U3E M;  2PJR B;  4HF2 A;  3OYH A;  3PJR A;  2R3S A;  4IHV A;  2HQA A;  1UJ8 A;  4BL0 B;  2QSH X;  4P9U A;  4Y33 A;  4UHT A;  4L5E A;  1B59 A;  3GLX A;  3SZT A;  1ZHF A;  1RR8 C;  4EJU A;  4A3E J;  3K0L A;  3O3K A;  3BJO A;  2V1U A;  4O3M A;  3GVA A;  4P5O A;  4XLH A;  1ZRD A;  4JK1 X;  1ZAR A;  5IP7 J;  1D1A A;  5IYB J;  3PUB A;  3ZQC A;  4YIR X;  4RGU A;  2M2E A;  4XLC A;  5KAI C;  3CJN A;  5DS9 A;  4CYC B;  3WU1 B;  3WTX C;  2V7F A;  2YUS A;  3VSK A;  3H9G A;  4BKX A;  2ISY A;  2O6G E;  3DKX A;  1KU9 A;  1ETQ A;  2N8G A;  1ORK A;  5K5R A;  1IN7 A;  3V8K A;  1FZP B;  1LDK B;  3KX2 A;  4KN7 X;  3LSR A;  3BCB A;  3NAU A;  1OKR A;  2M34 A;  2VXD A;  3S3N A;  2QBY B;  2MD5 A;  5D5V B;  3AL0 C;  3L2R A;  1HF0 A;  2FA5 A;  3TP3 A;  2QQ9 A;  2DK5 A;  3CMY A;  1SMT A;  1MMD A;  3KZI C;  2R0Q C;  5HDG A;  1W5S A;  2LOO A;  2M9H A;  3KYC B;  3WGG A;  5E79 C;  3D5R C;  4EAT A;  1SD7 A;  3H92 A;  5DV5 A;  3PIO F;  3ZQL A;  1B8I A;  2XRO A;  2ETH A;  3I5U A;  4ITV A;  2WY8 Q;  2EA2 A;  5DCM B;  1D0Y A;  3BCA A;  1XCV A;  2FE3 A;  2PMZ A;  3GF2 A;  4OOI A;  4YFX F;  2YX4 A;  2MYS A;  1YRN A;  5DD4 A;  2XPU A;  3M8E A;  2P7V B;  3M8J A;  1LB2 A;  1IN8 A;  3I53 A;  3LA2 A;  1S29 A;  4AYB A;  3LSK A;  2K86 A;  1AOY A;  4HYE A;  5HNF A;  2JA6 J;  3W2W A;  1I27 A;  2YS9 A;  2VQC A;  1YQA A;  4PZJ A;  2BE5 F;  4TV7 A;  1XX5 A;  4EJW A;  3CC4 I;  4QSH A;  2VBW A;  3JRI A;  1X58 A;  2XHK A;  3LA3 A;  3VYS B;  5H2F C;  1KGS A;  2QBY A;  1VF9 A;  3C18 A;  4HDU A;  3JSO A;  1HC8 A;  3OYL A;  2X4H A;  3J7A O;  3CO7 C;  4U0V A;  2HKO A;  3GTG J;  2D45 A;  2FRH A;  5J8C A;  3CCQ I;  1O57 A;  2XRN A;  2OCE A;  4HNU A;  3I0T A;  5ILV A;  4J00 A;  1B6A A;  3BR1 A;  2CG4 A;  1QZZ A;  2KFD A;  5D8K B;  3L2W A;  3ERM A;  3TW6 A;  2KT0 A;  3E5U A;  2PMZ N;  5GPA A;  1PYV A;  4CSW A;  2CSO A;  4MQ9 F;  5DM6 F;  2HR3 A;  2EIM H;  2DYR H;  1IV6 A;  1YI2 I;  1F5T A;  3IH3 A;  4IOA F;  3K7A J;  4XN0 A;  2VQG A;  2X6Y A;  5A2Q Z;  5FLX K;  3LNQ A;  2P5V A;  2XIG A;  3BTC A;  1OCP A;  1LE8 B;  1AA7 A;  1C0W A;  2JWT A;  2XF7 A;  1WJF A;  3REO A;  5IT3 A;  2BY3 A;  2DMP A;  2DT7 B;  3BP8 A;  3PNT A;  1HSJ A;  4E7K A;  4XOR A;  2VN2 A;  3RIR A;  2K3P A;  2LY2 A;  4IHY A;  2OTJ I;  1FP2 A;  2IA1 A;  2H6B A;  3UKG A;  2KIS A;  5D5X B;  1G3S A;  4LFU A;  2GWR A;  1XGO A;  5JVT A;  3BZ6 A;  3E1S A;  2FUG 2;  1VQ6 I;  1E0E A;  4LG3 A;  2E2J J;  2IAI A;  5FRO A;  5DM7 F;  1JI8 A;  2HDD A;  2CMP A;  1Y0U A;  4NDL A;  3PQJ A;  2Y9Y A;  3WU2 C;  1DUX C;  3HOU J;  2DA4 A;  2HXI A;  4YG2 F;  1FY7 A;  2UZK A;  3QPL A;  3MEX A;  2EIL H;  2IJL A;  2CQX A;  2XSJ C;  4EV0 A;  4OU0 A;  2LP0 A;  4U7B A;  4L0Z B;  2Y2Z A;  4I99 C;  4BY7 J;  1Z91 A;  1FBQ A;  1ZK8 A;  4KA4 A;  1LEA A;  4II2 A;  3ZQQ A;  3MWM A;  1GHC A;  3S3O A;  4CHU A;  4M71 A;  1YJW I;  2F4O B;  3HJE A;  2R5Z B;  2JA2 A;  5K1Y A;  5EZH A;  1U0J A;  1R22 A;  1RKT A;  5IOZ A;  2BGC A;  3CDI A;  3FZV A;  4L9T A;  4M6V A;  5LHI A;  5LBQ A;  4Y17 A;  1ZAO A;  1LE8 A;  5F27 A;  3DEU A;  2QQA A;  4AVZ A;  2DFE A;  2ICW G;  3F8M A;  1FWZ A;  3VYU B;  4ZYD A;  2QQ8 A;  3DBL B;  1ZGW A;  1BR1 A;  1DQU A;  4ENK A;  1YIO A;  1EA3 A;  3K9T A;  1U5T B;  2R7O A;  1Z6R A;  2Y0S N;  4AU7 A;  1BN5 A;  2Y30 A;  1R71 A;  1YOV B;  2L01 A;  4XON A;  4CH7 A;  1T33 A;  1WJA A;  3KEQ A;  2ESH A;  5CQE A;  1DU0 A;  1GDT A;  3KYD B;  2OTL I;  2NVU B;  3NEU A;  1YW8 A;  3BR5 A;  4BDZ A;  2F4M B;  2DU9 A;  4JX4 A;  4XLN F;  2CH0 A;  1RRJ A;  3GLL A;  2K3F A;  2F2E A;  4XKB A;  4LMY A;  3K70 C;  2VJ5 A;  3GFM A;  4BBR J;  4F92 B;  3QU6 A;  4B1R A;  2E2H J;  3ZQG A;  3J80 K;  4IVN A;  1KQ0 A;  2GZW A;  1JUS A;  1VQ5 I;  3DU5 A;  1NK3 P;  2W82 A;  1P2F A;  2STW A;  3AG3 H;  2HYJ A;  3IWZ A;  2EB7 A;  1X3U A;  2IGN A;  1VZ0 A;  3MCZ A;  4S0H B;  3MFK A;  1I39 A;  2ZFU A;  3OOP A;  1SVM A;  4A93 J;  4AIJ A;  2QWW A;  4BEH B;  4ZDP A;  4BXF A;  3HEF A;  2CFO A;  4RLQ A;  2IBD A;  1FTT A;  4N4N B;  5J47 A;  4OAY A;  2VE8 A;  2DO7 A;  3GTO J;  4PJ0 C;  1X1D A;  2WAF A;  1OCZ H;  3F6O A;  1KON A;  5LEJ A;  4X1E A;  2P6S A;  4Q4Z F;  1H0M A;  1WVR A;  3L2V A;  1K79 A;  4A3B J;  1X1C A;  2KRC A;  1F43 A;  2ZB9 A;  1O3T A;  1G2H A;  5BPI A;  3ML6 A;  3TOB A;  3DKW A;  5HLH A;  4XKC A;  4A3M J;  1IGN A;  2NS7 A;  2TDX A;  2F5F A;  5HLG A;  2D5V A;  2BEO A;  3OMY A;  5CQG A;  2XAF A;  5LEK A;  3K4M A;  4B47 A;  1WJC A;  3LSP A;  3BTJ A;  5HVQ C;  3N97 A;  4BYY A;  1JXS A;  2WB1 A;  2JN6 A;  2R5Y B;  2HDC A;  3BQZ A;  2HVR A;  2WY7 Q;  2GQQ A;  3HM5 A;  4AID A;  1ZYR F;  2ZBK A;  3HYI A;  1ZG1 A;  1J7K A;  2XGC A;  2RRE A;  2FBI A;  2LRD A;  3NWT A;  2VXZ A;  1H9T A;  2UXN A;  2K5C A;  2K9Q A;  3P5J A;  4U7D A;  2E5N A;  5B3S H;  2X6O A;  2HPM A;  5GAE J;  2DDA A;  3OR1 C;  4CDG A;  3BG9 A;  2Q0O A;  3T5X A;  4BE2 A;  1BC7 C;  1L0O C;  3WTW C;  1ULY A;  1ZGA A;  4HV5 A;  2BYV E;  2L7K A;  2M30 A;  1F9N A;  1MND A;  1ZLJ A;  3KP6 A;  1ON1 A;  2ZCW A;  4D7N A;  2WAD A;  3F8C A;  3FMS A;  4RAY A;  1HXD A;  5ILU A;  5CVV A;  2DI3 A;  5E3O A;  1N75 A;  2EV5 A;  2KHM A;  2EFW A;  4YII A;  5EYR A;  5ICF A;  1JKR C;  4BHC A;  2M87 A;  1TQP A;  3B6C A;  3FXQ A;  5KVR A;  2E1M B;  2ZKZ A;  2FOK A;  3CTA A;  1OFC X;  3IH2 A;  2OA4 A;  2K9S A;  2D1V A;  3AG2 H;  4RGX A;  1LEB A;  1D5Y A;  3FDY A;  4MFE A;  2IS1 A;  3JCU C;  3TQN A;  2VKH A;  1QO0 D;  4P55 A;  5KNL A;  2WAE A;  4G8X A;  1MBJ A;  2JK3 A;  1I6H J;  3HOS A;  1EF4 A;  3PSF A;  1TWA J;  3DPT A;  2P5L C;  1MD0 A;  2ESN A;  3BG6 A;  4M3G A;  3A01 A;  2X1C A;  5IYD J;  3CES A;  4O6J A;  3TDU C;  2W24 A;  3B6A A;  2QQB A;  1Y8R B;  4ZDO A;  4HQE A;  4WWC A;  3PO2 J;  4Y15 A;  2DTR A;  4HBL A;  1X2N A;  1IDY A;  2CRG A;  5F0H A;  4DBR A;  1K83 J;  1APL C;  4KIT B;  3HSE A;  5HDK A;  1V54 H;  3R6S A;  3IV5 A;  5EF6 A;  1XGN A;  1B72 B;  1X2M A;  2LY1 A;  3CMA I;  4FHT A;  1S9H A;  2A5W A;  3W2V A;  2RNJ A;  5L3F A;  1OYI A;  4NQW A;  1Q1H A;  3CC2 I;  4FTH A;  1Z0X A;  1RUN A;  3BTL A;  1U2W A;  3HTS B;  3DEW A;  1R9T J;  1B9M A;  1S72 I;  2NS8 A;  3IL2 A;  5M5X J;  2VJ4 A;  4J01 A;  5HLI A;  1NK2 P;  1Z21 A;  1R5I D;  4LK1 F;  4JOM A;  4FET A;  3HOZ J;  3HRM A;  3CUQ B;  4AM3 A;  3A01 B;  3JTH A;  2O9L A;  2W7N A;  1J2X A;  1IJW C;  2BZT A;  2H09 A;  3GME A;  1W0U A;  1R4M B;  1MIJ A;  2E36 A;  3EYY A;  2NOJ B;  2O8X A;  4M9S A;  4G7Z F;  2O0Y A;  3FXO A;  2PMU A;  4X6A J;  2HZT A;  2AQF A;  3O2P E;  1BL0 A;  3H1C A;  3OYG A;  4ZTF A;  2DAO A;  3CP2 A;  1VQK I;  3E5X A;  2QGU A;  3HL2 A;  2YU9 J;  3BR0 A;  3LAP A;  3ELK A;  2HTJ A;  4G94 A;  3MAJ A;  2Z16 A;  3DV8 A;  3OR2 C;  4I09 A;  1K6O A;  3QPT A;  4KNY A;  2IRF G;  2ZSH B;  3K70 D;  4Q48 A;  2VBY A;  2HOA A;  2HYG D;  5FKM A;  2EIN H;  1LQ1 A;  5JI6 A;  4S05 A;  1UMQ A;  3ABL H;  3ISP A;  1BJZ A;  5EZG A;  2VBX A;  4BBS J;  4N0B A;  2KRH A;  3HG9 A;  3OS1 A;  5LFA A;  5FKN A;  3E0J B;  3PIP F;  2MLG A;  4BJ5 C;  1UEL B;  1HQC A;  3N4M A;  3M3Y J;  3W6J B;  4HPQ A;  1D5V A;  1RPW A;  3DTE A;  5LRR A;  5EG0 A;  5H6Q A;  2QLZ A;  1YE9 A;  3KFW X;  5CLS A;  2COB A;  3CO6 C;  1ETO A;  4OIN F;  1O3R A;  5DCF A;  3DXJ F;  1R5G A;  4UVC A;  4HEA 2;  3ZMT A;  1DPU A;  4JBA A;  4RAZ A;  5GAG J;  2VOP A;  1W36 C;  2HOT A;  2L5Q A;  2GIZ A;  2QSG X;  3K4N A;  2WV1 A;  3MQ0 A;  1F1Z A;  5LLQ A;  1GV2 A;  3CUO A;  1Z7U A;  2DJN A;  4A3I J;  3HUG A;  1I5Z A;  3J7A Y;  1F36 A;  2Z99 A;  4DW6 A;  2BW3 A;  4RMN A;  1S7A A;  4L18 B;  3J81 K;  3DLA A;  4IJA A;  4FX0 A;  3P9I A;  1G59 A;  5DUK A;  3A4C A;  1R00 A;  3RSN A;  3ZQ7 A;  2OQR A;  3S1R J;  1G8X A;  1ZKG A;  2CW0 F;  2RGV A;  1MW7 A;  3KP7 A;  3GTQ J;  3IKV A;  3S1N J;  2Y69 H;  2DT6 A;  1MBF A;  2R7R A;  1R1T A;  4A2U A;  3HXL A;  5DTD A;  4LIV A;  2LLK A;  1WJ5 A;  1X4P A;  2DTZ A;  4C2M J;  4YFN F;  3BG3 A;  1B1B A;  5DD8 A;  2R7Z J;  2IA2 A;  1YTY A;  2AXT C;  2WC2 A;  5F04 A;  2VI6 A;  2A05 A;  5J1Y A;  1A35 A;  4BAC A;  1X4O A;  2G9W A;  3WG7 H;  5E17 F;  3E6D A;  4RBO A;  1MMA A;  1IN4 A;  3GCM A;  5CVR A;  2JTV A;  2P5K A;  3U1D A;  3HRU A;  3MKW B;  1G3Y A;  2KMU A;  3GTP J;  5HLT A;  1GT0 C;  1Q1V A;  2B0L A;  4G12 A;  3ZN1 A;  4DNC A;  4CCM A;  4F55 A;  4PDK A;  4DBQ A;  4EJO A;  3RKQ A;  2VPL A;  5AIQ A;  3IWF A;  1SD4 A;  5J1U A;  3BJA A;  1T56 A;  5C3E J;  1PUE E;  4UUV A;  2BW3 B;  1VQ8 I;  1TC3 C;  5K7Z A;  3PUF A;  1WH5 A;  2OZ6 A;  4CA0 A;  1VTN C;  3QQA A;  3O8G A;  5J1R A;  3JW4 A;  2AS5 F;  4H4K C;  3FM5 A;  4B44 A;  2F5E A;  2R7D A;  1BI0 A;  2V26 A;  1UHM A;  3HGY A;  2L3D A;  3VOE A;  4S04 A;  2H8R A;  3W6V A;  3AL0 B;  2V1D A;  1QGP A;  4CCN A;  2G7U A;  1BOA A;  3K4B A;  4CIC A;  3F22 A;  4QLC U;  4IKF A;  3GEZ A;  5J6X A;  4LLL A;  2JZY A;  3DF8 A;  2ZME A;  2H94 A;  2P4W A;  1Z67 A;  4KIC A;  1OMI A;  2CGP A;  4IHT A;  3D1N I;  3CCR I;  2PG4 A;  3CF5 F;  3JR9 A;  2JSC A;  3QRF F;  1T08 B;  2K4J A;  3CJR B;  3RQ4 A;  4BU2 A;  4E7S A;  3S93 A;  1QHH D;  2LKS A;  4YEL A;  5TIS C;  4QIW N;  1TWG J;  4L5J A;  3GTJ J;  2W84 A;  4N9I A;  1O7F A;  4XK4 A;  5C44 J;  3FBI B;  5M5Y J;  4XM3 A;  5J8F A;  2L9N A;  2WBM A;  4NBQ A;  2WA0 A;  2MGQ A;  4I6Z A;  3LL7 A;  1WSU A;  3Q0V A;  3C2G A;  4LIU A;  4BAY A;  2M5W A;  3AKZ A;  4QWQ A;  5GTH C;  4W1U A;  3FXU A;  1M1E B;  1TP4 A;  1NHA A;  1X3Z B;  3M7G A;  4BQA A;  2O61 A;  2P8T A;  4MNU A;  3DP7 A;  3I3L A;  4IF4 A;  1TWH J;  3ZR8 X;  4BHB A;  4NC6 A;  2EJR A;  4NC7 A;  1WPK A;  5IY5 H;  4MHG A;  1FOW A;  3VOD A;  1Z1D A;  1OQY A;  4Y3O A;  2PLY A;  1SFO J;  1JTX A;  1PDN C;  1LFU P;  2LNB A;  4ENM A;  3I59 B;  5FLM J;  1OCO H;  1JHF A;  4E7H A;  1XGM A;  3A2K A;  4BGD A;  2H1L A;  3DKY A;  1MNM C;  2DDB A;  3TO6 A;  1XMX A;  2QCO A;  4XN3 A;  5ILS A;  1LFB A;  3TW7 A;  2D1H A;  2O7O A;  5GPC A;  2O8K A;  3B02 A;  4IEJ A;  3GTL J;  1QBJ A;  5ICE A;  5LGN A;  3S14 J;  2E1N A;  3RQI A;  2XGD A;  1VQP I;  3LFK A;  4OMY A;  4Y7N J;  2BY0 A;  3ZRG A;  1O3S A;  4EEF G;  4QTR A;  2HQ5 A;  4G7O F;  2VJJ A;  3OV8 A;  3KCC A;  1P6R A;  5EGO B;  2CO5 A;  3MZ8 A;  4PK4 A;  2I8D A;  1U9N A;  1HOM A;  5E3M A;  5E18 F;  1ON2 A;  3BC8 A;  2XDV A;  2XSD C;  3EUK L;  1T95 A;  2LRE A;  1XSD A;  1IV8 A;  5B1A H;  1G6N A;  3FKJ A;  3ZMD A;  4CCJ A;  2BXY A;  1D3Y A;  2HPI A;  2XAG A;  1BI3 A;  5IP6 A;  3RZO J;  5E3L A;  2YSR A;  2EPF A;  2Y75 A;  2KIF A;  1AU7 A;  1FMW A;  1ONV A;  4C3J J;  2DQL A;  2ME6 A;  2HEO A;  4V2F A;  2OPT A;  1X19 A;  3WOD F;  4B09 A;  1F4K A;  2CUF A;  1K6Y A;  3K10 A;  3LQR A;  4L5I A;  4IQJ A;  3H9J A;  4F52 A;  1TTY A;  2ISZ A;  2Z5U A;  2E1C A;  3A03 A;  3KLN A;  1FT9 A;  2CYY A;  4M3B A;  1WH7 A;  3GBG A;  2QEN A;  2ZSI B;  4RA2 A;  4KT6 A;  3FM3 A;  3ZMU A;  4C2U A;  3VWB A;  1WI9 A;  2ID6 A;  3DQV C;  2RVC A;  1IXC A;  4GYI A;  2FF4 A;  1MH4 A;  1P4A A;  1P4X A;  4XRS A;  2GXG A;  4BH9 A;  2MH9 A;  4R79 A;  1SFE A;  2JT1 A;  4IZZ A;  3HOW J;  1BW5 A;  4A5M A;  1I3A A;  1D8K A;  2L4A A;  1YS7 A;  3LSM A;  2VE9 A;  3F8B A;  3TKY A;  5FLV A;  1GXQ A;  1P7J A;  3GUD A;  3ZCO A;  3R60 A;  4CCL A;  1JT0 A;  3SDG A;  3MZY A;  4I0B A;  4V19 K;  4ANJ A;  2K9N A;  4D7M A;  2XB0 X;  1QRY A;  2Z1D A;  4XID A;  1G3T A;  2KZG A;  3SJM A;  1MDM B;  2ZJR F;  3HKZ A;  2BHY A;  3L2C A;  1NH3 A;  4UB8 C;  3CCE I;  2R7X A;  1XG1 A;  5HS7 A;  3WTS C;  1WI3 A;  2EA4 A;  5EEG A;  2YX7 A;  3RZD J;  5ICC A;  1P7I A;  1MJB A;  1ETK A;  2XAJ A;  4L9J A;  4M6Y A;  3S2D J;  4IHX A;  2RQQ A;  1XPX A;  3FHN A;  4EM1 A;  2DQR A;  3ZN0 A;  4CXF A;  1Y0N A;  4GDF A;  2QSF X;  5L3E A;  3J7Z I;  1PP7 U;  2IP2 A;  3I56 I;  2Q8K A;  2RN7 A;  2GOX B;  4A6E A;  3R0J A;  1AKH A;  4PJM A;  2HOE A;  4E7Z A;  4XRF A;  2P81 A;  2M7A A;  2LBF B;  3L1P A;  2V6E A;  1XMK A;  2KKO A;  2KZV A;  4LLN A;  5E3N A;  4YFK F;  1O7L A;  4BE1 A;  2W85 A;  1FBU A;  3FXJ A;  1QA6 A;  1T8I A;  3PSI A;  1GUU A;  1RI7 A;  4PGG A;  2QZ8 A;  4AIH A;  1BBY A;  2QVO A;  1Y6I A;  2IXS A;  2PJR A;  4BEH A;  1QQI A;  3EPZ A;  1YG2 A;  2E60 A;  3H5R A;  3MKZ A;  3IH4 A;  2ZXH A;  3FMR A;  3LMM A;  2XKO A;  3BG7 A;  3LSG A;  3K2Z A;  1LJ9 A;  4GO1 A;  3SEZ A;  4OIP F;  3K4J A;  2KPM A;  1MMS A;  1LNW A;  2B9S A;  2F4I A;  3DFG A;  3F0C A;  3B73 A;  3I58 A;  2X1D A;  3QWL A;  1FSH A;  2A61 A;  3HDD A;  1EH8 A;  3O8H A;  2XRL A;  1HKT A;  4LB6 B;  2ELJ A;  4MEY F;  2E19 A;  2IS2 A;  4IRI A;  1YW7 A;  3AFH A;  4E70 A;  4F3Q A;  1XDU A;  1W5C C;  2FML A;  1HDD C;  5FD6 A;  3H3U A;  1BIA A;  3QPH A;  4WCG A;  3Q5F A;  3S15 J;  2W4S A;  2EIK H;  2KRF A;  4Y13 A;  3S2W A;  3G3Z A;  1BR2 A;  1EH6 A;  3H36 A;  2P7C B;  2E1M C;  1GLN A;  3CF2 A;  2DOE A;  4FT8 A;  4FAS D;  2ZXW H;  2HNH A;  3SHF A;  4HRI A;  1MZB A;  1SVO A;  3V7R A;  2O03 A;  4L9N A;  2ELK A;  1EV7 A;  4EVI A;  3L2U A;  3AG1 H;  1QVT A;  5EJC A;  5E1X A;  1XMA A;  2RDP A;  5JHU A;  3FKI J;  5B5E C;  2Y0M A;  1CF7 A;  4M73 A;  1U5T A;  1XDS A;  1IRG A;  5D6E A;  3E6M A;  1ZRE A;  2Z33 A;  4ON0 A;  2LVS A;  4I7H A;  3BT9 A;  2XAU A;  1B9N A;  2OAZ A;  2IGM A;  2FXA A;  1UHS A;  5DCM A;  2R92 J;  2WTE A;  5B1B H;  4I01 A;  1DP7 P;  3FMQ A;  5IT9 Z;  2R93 J;  1YRN B;  3CLO A;  1BJA A;  2JQ7 A;  2RNG A;  1FC3 A;  2DA6 A;  4IQ4 A;  4ZYA A;  2E35 A;  3OYC A;  3K69 A;  2LKX A;  2R7V A;  1RR7 A;  1AHD P;  2L7F P;  4AD9 A;  2JJ7 A;  2L2O A;  1ITY A;  4A0X A;  1YYV A;  4HNV A;  3D5L A;  2JA8 J;  1MSF C;  5IT9 K;  2UWM A;  1JKQ C;  2XV4 S;  1ETY A;  2NVT J;  3NWS A;  4U0Y A;  3SYT A;  3G6E I;  3GZ5 A;  2E7X A;  4K2E A;  1SEU A;  2GXB A;  3JTG A;  2LDU A;  1SFK A;  4EM0 B;  2DFH A;  3EET A;  4N4O B;  5F1R A;  4MTD A;  3HOX J;  1J59 A;  4L0Y B;  2JPC A;  3LWF A;  4P1W A;  4CYD A;  2HTS A;  1FEX A;  3K2A A;  4PJJ A;  2M0M A;  4JQF A;  5FO5 A;  4CZZ A;  3BR2 A;  2ZNZ A;  4F91 B;  2HS5 A;  1V3F A;  1OCT C;  4Z2Y A;  2WWY A;  5JVG F;  3L2Q A;  3OSF A;  3KEO A;  5GAD J;  3J80 Z;  4ESJ A;  1E3O C;  3M8F A;  1V5F A;  1R5H A;  2DYS H;  2IVM A;  1QPI A;  1JHH A;  1TBX A;  2HXO A;  2EV0 A;  2CV2 A;  1FYL A;  5FGM A;  3Q9V A;  4HF1 A;  1KYZ A;  3AG4 H;  3WE3 A;  1LFP A;  1TWF J;  2HDW A;  2KLO A;  1HKQ A;  1Y1V J;  5DDG A;  4GYG A;  4HZF A;  2ME0 A;  2LFB A;  1P9Q C;  1D0X A;  4A3L J;  1MNE A;  2VKV A;  2VJI A;  1MMG A;  2G7H A;  3WTY C;  4BNC A;  2CUE A;  1ZLK A;  1HLV A;  3VYR B;  2FJ1 A;  2XGX A;  2LYC A;  2P0W A;  3J81 Z;  2GA2 A;  2CV0 A;  3R0A A;  4UV8 A;  2LD5 A;  5D5W B;  4XOT A;  3MMY B;  4A0Z A;  2Y48 A;  4M9X A;  4NC8 A;  2RKH A;  2NVX J;  5FRM A;  3HPH A;  3L9F A;  1OCR H;  3PM1 A;  1MKM A;  3T1B A;  1GXP A;  2DOD A;  2VC1 A;  2FBH A;  1K78 B;  2ECB A;  3V7S A;  3OS2 A;  1TNT A;  4XR6 A;  5J4Y A;  1K61 A;  2L4M A;  2ZJP F;  3UNG C;  2MBF A;  3FK6 A;  4C3H J;  3P9C A;  4KMF A;  5LD2 C;  1Z77 A;  4A3F J;  2B7E A;  3DBH B;  4HX7 A;  3O6B B;  3CZ6 A;  4UUS B;  3T0Y A;  4HF0 A;  5HS8 A;  3V42 A;  1N25 A;  2E34 A;  4XMY A;  4ZDL A;  1NG6 A;  3S2H J;  1VFC A;  2Y9Z A;  4XSX F;  5IP9 J;  3SQN A;  2NVY J;  1TQI A;  2LSO A;  2QKL B;  3OOU A;  4KT5 C;  4A0Y A;  1H88 C;  2DBB A;  2VPR A;  1YJ9 I;  3IAM 2;  4IHW A;  1HW2 A;  3OL3 A;  2WV0 A;  4WF2 A;  2OU2 A;  3BRO A;  2K9L A;  4A3D J;  2OJE D;  2ZFW A;  4OIR F;  1E3H A;  2DA1 A;  2IGO A;  2IA0 A;  4LJZ F;  4F7Z A;  3K6G A;  1JT6 A;  2I5U A;  3C2H A;  2D2W A;  4IPA A;  2NS0 A;  5H6R A;  4E7I A;  2FMY A;  5FKO A;  2OCC H;  2X51 A;  1SFU A;  4RAF A;  4DJA A;  1R1V A;  3GYH X;  3AAF A;  3X2Q H;  1V5E A;  4UUS A;  3RPU A;  4D0P A;  4UY8 I;  2PMH A;  1FOX A;  4KIS A;  3I71 A;  2A68 F;  3DTI A;  3F3X A;  4PSX A;  3QPS A;  2VLA A;  5F64 A;  2DFI A;  2CW7 A;  1YX5 A;  5BNG A;  2QKM B;  2DOA A;  2HQN A;  4EJT A;  4C2T A;  3CCL I;  4YRV A;  1NG7 A;  2E2I J;  1IF1 A;  2FQ3 A;  3QU3 A;  5M3F J;  2ZJQ F;  4PUS A;  2HWV A;  4BJT A;  3HOY J;  3GWZ A;  2ZXJ A;  3FX3 A;  1D1B A;  3GZN B;  3OYF A;  1YIT I;  2HYF A;  4IXA A;  1JGS A;  2DA5 A;  1ERD A;  3H3V K;  3CCY A;  4AVP A;  1N78 A;  3C7J A;  3IRR A;  1PUF B;  2Q2E B;  1Z9C A;  2JA7 J;  3CQZ J;  2M7B A;  4HA8 A;  4LG0 B;  2KJC A;  4KDP A;  2H1K A;  3CMM A;  3EUA A;  2IPQ X;  3OYI A;  4G6T B;  3BZC A;  1XSX A;  4RB3 C;  4AUX A;  3JRA A;  3WU0 A;  3HBL A;  3HZJ A;  2HFH A;  3GW2 A;  5K5Q A;  3A0H C;  2JVH A;  4MIM A;  2V9K A;  1JJ6 C;  1ZR4 A;  2JSP A;  2UUZ A;  4G9Y A;  3RKY A;  4UXN A;  4M72 A;  3M9A A;  1W7P B;  4BY1 J;  3FXR A;  4YIF A;  4HW0 A;  4B3A A;  2K9M A;  1A5J A;  1PP8 F;  3ABM H;  3Q9S A;  2CUZ A;  5IYC J;  1JJ8 C;  1J9I A;  1MGT A;  2XPV A;  2FEZ A;  3KE2 A;  1VI0 A;  5AON A;  2R5Y A;  2L54 A;  1YS6 A;  3TO9 A;  5E8I A;  2KJB A;  4PSW A;  5L3C A;  4U0W A;  4IHS A;  2V6C A;  4NB5 A;  2H27 A;  1Y8Q B;  5J4V A;  4MQV A;  3ECH A;  4RGS A;  2EV6 A;  3GFL A;  3CP8 A;  2Q2E A;  1QNT A;  1TW2 A;  5CVU A;  1BOB A;  2HZD A;  3RYR A;  3MD2 A;  3G1O A;  4MO7 A;  3OL4 A;  3U1K A;  4Y4R A;  1X3W B;  3G73 A;  2YPR A;  1R1U A;  4FE4 A;  1HBX G;  4HDV A;  2EQR A;  2ACJ A;  1H89 C;  1ZN2 A;  3LOC A;  4IOC F;  2DMU A;  3LSI A;  4DYR A;  5K5O A;  2KDZ A;  2LTP A;  4ZC3 A;  3ROU A;  4BHP A;  2CFX A;  1CGP A;  4A12 A;  2ZC2 A;  1K4S A;  1OR7 A;  3EDP A;  2LKP A;  3BY6 A;  3QOP A;  1E17 A;  2NYX A;  1D8J A;  4IRH A;  1LVK A;  2M4K A;  3OYK A;  2X85 A;  1KQ9 A;  2NVQ J;  2V1X A;  5LHG A;  4IL6 C;  4DYQ A;  2PEX A;  4WXC A;  4RM3 A;  4KIB A;  4OWR B;  4II3 A;  3LAJ A;  3HRS A;  1XD7 A;  3L7W A;  5M3M J;  3A1Y A;  2EIJ H;  1OYW A;  2KIQ A;  3Q0W A;  1IN6 A;  2LF8 A;  1QZE A;  2VT2 A;  2HQR A;  5HDN A;  3DBR B;  5CVI A;  1VQM I;  4KJZ A;  2F6C A;  2XAQ A;  3ZQI A;  2JPB A;  1CQT A;  2JVG A;  1YHQ I;  4HST A;  1YW9 A;  3TMO A;  4ZTJ A;  1W5T A;  4L9V A;  3MKL A;  2W57 A;  2CUJ A;  4HX4 A;  2X1E A;  2W25 A;  2R7Q A;  4UVA A;  4RB1 A;  2HU9 A;  3HHG A;  5KAF C;  3NRV A;  4I02 A;  3ABU A;  3E6B A;  3TED A;  1MH3 A;  4CO8 A;  3JRE A;  2CQN A;  1H8A C;  1DU6 A;  2LK2 A;  3GTK J;  5E8G A;  4DYC A;  2KP6 A;  4NQW B;  1BC8 C;  1ZTR A;  2JUG A;  1RC9 A;  2XUB A;  5DYM A;  4M9Z A;  1VQL I;  4AIK A;  3OY9 A;  3KIO A;  4R8H A;  1VQ7 I;  4I76 A;  2FSW A;  2L0K A;  4HOB A;  2M8G X;  1OYY A;  1R36 A;  3QP5 A;  2OC6 A;  3IP4 B;  3JRH A;  1TNS A;  3LQQ A;  2F5C A;  2OBP A;  5C4X J;  3CUQ A;  4W97 A;  1ZQ3 P;  3MZH A;  4X0G A;  4ESB A;  4FX4 A;  2FBK A;  4BXX J;  2RAE A;  4LK0 F;  4D9J A;  4HV6 A;  2MH2 A;  2L7M P;  2ZME B;  4KN4 X;  4UVB A;  3CDL A;  1L3L A; 
#chains in the Genus database with same CATH homology
 2R7X A;  1X1D A;  2WAF A;  3UR3 C;  2VB6 A;  4RLF A;  1KON A;  3L2V A;  3EUH C;  1X1C A;  2KRC A;  4BQQ A;  3QOD A;  4NNJ A;  2RQQ A;  4XKC A;  3FHN A;  3IAS 2;  3VDX A;  3DPL C;  3OMY A;  5CQG A;  3OYM A;  2HVS A;  2GOX B;  1X1A A;  3K4M A;  4B47 A;  1WJC A;  4PJM A;  4YEJ A;  4E7Z A;  1WJE A;  2W1O A;  2LBF B;  2BOL A;  2M7A A;  5HVQ C;  2V6E A;  2KZV A;  4XLF A;  2WB1 A;  4LIT A;  4RM2 A;  4BE1 A;  2DJI A;  2HVR A;  2WY7 Q;  2KQR A;  4E6K G;  3PSI A;  2R7U A;  2KDO A;  2X6X A;  2Z2S B;  1Y6I A;  2IXS A;  2RRE A;  2LRD A;  3NWT A;  2PJR A;  2VXZ A;  4BEH A;  2K5C A;  3EPZ A;  2E60 A;  3H5R A;  4B3X A;  3MKZ A;  3ZGK A;  1Y56 A;  2E5N A;  2ZXH A;  2L9S A;  3LMM A;  2HPM A;  3BG7 A;  3IUO A;  3LSG A;  3OR1 C;  3SEZ A;  3VSL A;  3K4J A;  3HPG A;  4BE2 A;  2KPM A;  1WFX A;  3N05 A;  2F4I A;  2L7K A;  3K4C A;  2BVL A;  3TBI A;  2MC4 A;  1MND A;  2X1D A;  2R4G A;  2ELJ A;  2WAD A;  2IS2 A;  3AFH A;  4F3Q A;  3HUG B;  2GOM A;  3W3C A;  1V5G A;  3H35 A;  4PFP A;  1DGR M;  1N75 A;  2KHM A;  2VL8 A;  4IX7 A;  3DTK A;  2O5R A;  4B48 A;  2IS4 A;  3RPU D;  1FMV A;  1R6R A;  2W4S A;  5HNH A;  2E1M B;  1W36 D;  1UAA A;  1BR2 A;  4BS9 A;  2CS3 A;  2E1M C;  1GLN A;  4PJL A;  3CF2 A;  3OIP A;  2KL4 A;  5TGT A;  4FAS D;  3FDY A;  4XQF A;  2IS1 A;  2HNH A;  4HRI A;  2R7W A;  3QYB A;  2VKH A;  5KNL A;  1TT0 A;  2WAE A;  3L2U A;  3HC7 A;  3HOS A;  2CV1 A;  3PSF A;  3DPT A;  3BG6 A;  2X1C A;  4ZJZ A;  3CES A;  2XAU A;  4C30 A;  2X6W A;  2IGM A;  1WJD A;  4ZDO A;  1QU3 A;  4DBR A;  1D1C A;  4KIT B;  1TZL A;  2OUM A;  2RNG A;  2LY1 A;  4IQ4 A;  4ZYA A;  2MAB A;  3OYC A;  1N77 A;  1S9H A;  2R7V A;  3OYD A;  2A5W A;  3W2V A;  4GRI A;  2L2O A;  2LC2 A;  1WJB A;  1IRX A;  2IGK A;  3D5L A;  2VIX A;  1X1B A;  4QPQ A;  2UWM A;  1Z3X A;  5KHD A;  4XLE A;  1UG0 A;  2VJ4 A;  2E5Z A;  4J01 A;  1Z21 A;  3NWS A;  3U21 A;  4JOM A;  3SYT A;  2XC7 A;  4FET A;  4XKV A;  4CZC A;  3KEY A;  1SFK A;  4E4H A;  4XL9 A;  4N4O B;  2BVM A;  2R7S A;  3DWL E;  4P1W A;  4PJJ A;  3K4L A;  2W7N A;  2M0M A;  4JQF A;  5FRN A;  2A6T A;  3LSH A;  4F91 B;  4E7L A;  2VQL A;  3SDB A;  2NOJ B;  4C9Y A;  3L2Q A;  4NUB A;  1BR4 A;  3OWT A;  5KCM A;  1QHG A;  2AQF A;  3OYG A;  4ZTF A;  3CP2 A;  1V5F A;  3HL2 A;  2CV2 A;  3QYE A;  3OYJ A;  1DP3 A;  2XF5 A;  3OR2 C;  2Z16 A;  1LFP A;  1Z7L A;  2HDW A;  3F9K A;  2KLO A;  2ZSH B;  1Z3Y A;  3K70 D;  1MMN A;  2LBF A;  4CUG A;  3TL4 X;  2LG4 A;  2VKD A;  2R7T A;  1P9Q C;  3ONQ A;  4DGW B;  2VAS A;  1D0X A;  1MNE A;  4HNT A;  2KRH A;  2VJI A;  3HG9 A;  1MMG A;  3OS1 A;  5LFA A;  2WAQ A;  3DPU A;  3E0J B;  3VYR B;  4U87 A;  4BJ5 C;  2LYC A;  1UEL B;  2P0W A;  4HPQ A;  3VYT B;  3OYB A;  2PJR B;  3OYH A;  3DTE A;  2CV0 A;  3PJR A;  2ZXI A;  2HQA A;  4BL0 B;  4XOT A;  3MMY B;  3DU6 A;  1YE9 A;  4NC8 A;  4Y33 A;  5FRM A;  4BJ6 C;  1OLT A;  3HPH A;  4HEA 2;  3OS2 A;  4XR6 A;  3UNG C;  5HOO A;  1W36 C;  2L5Q A;  4P5O A;  3K4N A;  5LD2 C;  4XLH A;  2LH9 A;  3CZ6 A;  4BQO A;  3J7A Y;  1D1A A;  3PUB A;  3PL8 A;  1HA8 A;  4XLC A;  2BW3 A;  3V42 A;  4RMN A;  2V7F A;  4XMY A;  4XNF A;  4ZDL A;  3DLA A;  1NG6 A;  3VSK A;  3H9G A;  3K4K A;  3DKX A;  1G59 A;  3A4C A;  3RSN A;  2QKL B;  3OOU A;  4BDY A;  1G8X A;  1MW7 A;  1LDK B;  3KX2 A;  3IAM 2;  2DT6 A;  3BCB A;  3OL3 A;  2R7R A;  3W2A A;  2VXD A;  3PNY A;  5CPR B;  3S3N A;  3D5S C;  3HXL A;  4LIV A;  3AL0 C;  2V4J C;  3L2R A;  3M1C A;  4BUP A;  2K9L A;  1WJ5 A;  3OIQ A;  1X4P A;  3QYF A;  2IGO A;  3H9Q A;  3RTR A;  4XKW A;  1MMD A;  2XF6 A;  4BAC A;  1X4O A;  2LOO A;  1OR7 C;  1MMA A;  3K6G A;  3MKW B;  3C2H A;  2KMU A;  3D5R C;  4EAT A;  5HLT A;  4E7I A;  4ITV A;  2WY8 Q;  3LFU A;  1D0Y A;  3BCA A;  4CCM A;  4F55 A;  2X51 A;  4DBQ A;  2VPL A;  2PMZ A;  4DJA A;  2MYS A;  1V5E A;  2AQE A;  3M8J A;  2Q1Z B;  5CKT A;  4KIS A;  2BW3 B;  3DTI A;  4PSX A;  3SZG A;  2VLA A;  3H0D A;  4AYB A;  2CW7 A;  1YX5 A;  3LSK A;  2CW8 A;  4CA0 A;  2QKM B;  1YX3 A;  2DOA A;  4C2T A;  5HNF A;  1NG7 A;  3W2W A;  4YRV A;  4H4K C;  2VQC A;  4B44 A;  3DEE A;  4PUS A;  4BJT A;  2OV7 A;  4CCO A;  2HVQ A;  1D1B A;  3OYF A;  3G2B A;  2V26 A;  3PNV A;  1ERD A;  3AL0 B;  3VYS B;  1N78 A;  3OS0 A;  2Q2E B;  4XOP A;  4CCN A;  3K4B A;  2M7B A;  4IKF A;  3OYL A;  3CMM A;  3EUA A;  3S3M A;  3OYI A;  4G6T B;  4HNU A;  4J00 A;  3SEQ A;  3RQ4 A;  3CJR B;  4BU2 A;  4E7S A;  3L2W A;  3S93 A;  1QHH D;  4YEL A;  4CSW A;  1PYV A;  2JVH A;  2V9K A;  1DGW Y;  2JSP A;  2UUZ A;  4MLO A;  2V1N A;  3FBI B;  3I9V 2;  3H5N A;  4XM3 A;  4XN0 A;  2K9M A;  2VQG A;  2L9N A;  2X6Y A;  2WBM A;  2CUZ A;  2WA0 A;  1PJR A;  1AA7 A;  3LL7 A;  2XF7 A;  1WJF A;  3C2G A;  4LIU A;  2DT7 B;  4PSW A;  3AKZ A;  3PNT A;  4E7K A;  4XOR A;  2K3P A;  2LY2 A;  3I3L A;  3CP8 A;  3ZR8 X;  2M3A A;  4NC7 A;  3E1S A;  3HOT A;  4Y3O A;  2FUG 2;  1E0E A;  4DIQ A;  1BOB A;  2HZD A;  3BLY A;  4LG3 A;  5FRO A;  4E7J A;  1JI8 A;  2CMP A;  3MD2 A;  3OL4 A;  4PFO A;  4BQN A;  4Y4R A;  4E7H A;  3A2K A;  4BGD A;  3S8P A;  3DKY A;  2XSJ C;  4U7B A;  4XN3 A;  3LSI A;  4DOZ A;  4ZC3 A;  2UV1 A;  4II2 A;  3ZQQ A;  2W00 A;  3S3O A;  2MFZ A;  3MKY B;  3ZXS A;  2JA2 A;  4CCK A;  2DXI A;  1U0J A;  3ZRG A;  1SAU A;  4OAZ A;  1LVK A;  2VJJ A;  2M4K A;  3OYK A;  2X85 A;  4HG2 A;  4PK4 A;  2I8D A;  1T0F C;  1LKX A;  4AVZ A;  3BC8 A;  2XDV A;  3EUK L;  1T95 A;  2LRE A;  3VYU B;  3FKJ A;  4RM3 A;  4OWR B;  4CCJ A;  4II3 A;  1BR1 A;  2HPI A;  1DQU A;  2M4G A;  3A1Y A;  1EA3 A;  2R7O A;  4AU7 A;  3OYA A;  1ZEL A;  2DCE A;  1FMW A;  3FBN B;  2F6C A;  4KJZ A;  4XON A;  4CH7 A;  2JVG A;  4HST A;  3TMO A;  1WJA A;  5CQE A;  4ZTJ A;  3PFY A;  1X19 A;  3H5A A;  4BDZ A;  2IS6 A;  1K6Y A;  2CUJ A;  3K10 A;  3RCO A;  2F5V A;  4IQJ A;  3H9J A;  4F52 A;  2X1E A;  2R7Q A;  2CH0 A;  3S32 A;  2HU9 A;  3GBG A;  2ZSI B;  4QPO A;  4KT6 A;  4XKB A;  3K70 C;  2VJ5 A;  4HSR A;  2KP6 A;  4XLA A;  3VWB A;  4C2U A;  4NQW B;  4F93 B;  2JUG A;  4F92 B;  3OYE A;  3DQV C;  2MD0 A;  3OY9 A;  4BE0 A;  3DU5 A;  4D1Q A;  2W82 A;  1J09 A;  3CJQ B;  3QOE A;  4R79 A;  2IGN A;  4IZZ A;  5JHF A;  1VZ0 A;  2ZFU A;  3LSM A;  3OYN A;  1D0Z A;  2OC6 A;  3IP4 B;  4BEH B;  4ZDP A;  4BXF A;  4B43 A;  3ZCO A;  4CCL A;  2CFO A;  4X0G A;  4RLQ A;  3KYL A;  4N4N B;  4PJN A;  4ANJ A;  4D9J A;  2Z1D A;  4OAY A;  2VQH A;  3HKZ A;  2Y0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...