2XC7A

Solution structure of phax-rbd in complex with ssrna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
GAMAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORYLATED ADAPTER RNA EXPORT PROTEIN
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xc7A00
2XC7A 2W4SA
chains in the Genus database with same CATH superfamily
2HXOA 5HS9A 2QM3A 4UUVA 2ZKZA 2A68F 4XLCA 1AU7A 3W6VA 2P81A 2IA1A 5J47A 2XUBA 1V5FA 5JHFA 2X1DA 2R7OA 1Q1HA 4LLLA 2FQ3A 1ZARA 1APLC 1Z7UA 3BTCA 4N4OB 4UVBA 1J59A 3ZQGA 1KYZA 4DBRA 4A3LJ 3VODA 2HYFA 3VOEA 1X19A 3DKXA 1KU9A 1WWXA 1GDTA 3J81K 2R7RA 5J1YA 3PIPF 2V6CA 2XC7A 1I6HJ 1B6AA 5E79C 3OYEA 4E7SA 4ENJA 4A93J 2Y31A 3K4LA 4HAMA 4E6KG 4J00A 2ID6A 4BHBA 3VSKA 3CCRI 3KPHA 4PJLA 1AKHB 2VXZA 3GW2A 2NVTJ 5KHDA 1K4SA 3PNVA 4JP0A 5K5QA 1R1UA 1FC3A 2R7UA 2X85A 5GAEJ 2DQRA 1JGGA 3LA2A 5FD5A 4C9YA 1A6QA 3OYDA 5F0FA 3ERMA 2BBYA 1YTYA 1PJRA 1KU3A 2V1XA 2JA6J 1FYKA 4A3GJ 1N25A 1D0YA 3S1MJ 2QKMB 1PDNC 3FXQA 3AG1H 4HLXA 4PJ0C 4ABZA 5C3EJ 3WTUC 5DDGA 1WSUA 2LR8A 4E7JA 2OC6A 1KQ9A 3BDDA 2L5QA 4Y3OA 4EJVA 2JUGA 3H0GJ 2HOAA 2VQHA 5D4SA 4HZFA 2DK5A 1GLNA 3ZMDA 2FOKA 1OPCA 3M07A 2L3DA 3CCVI 1KQ0A 4A5NA 4X6AJ 2E2IJ 1BN5A 5HLGA 4GO1A 1RR8C 2QQBA 3CCQI 4KICA 1QHHD 3VWBA 4HRIA 1JHHA 2E35A 2HVQA 2FE3A 3OOPA 3PUBA 3QODA 3F0CA 1HA8A 3OV8A 5LEKA 3BR5A 3TP3A 1FOKA 3MKZA 1XMXA 2MABA 1MSFC 4F93B 5L3DA 2VC0A 4II3A 5HDNA 4OIPF 3CTAA 3ECHA 2L01A 1JKRC 3J80Z 4UY8I 2PN6A 1LNWA 1SVLA 5F0CA 3JRGA 3UKGA 3BG7A 5JVGF 3MQ0A 4IHXA 1B1BA 3DEUA 3ZN0A 2GLOA 2GZWA 3G73A 3J7AO 3BLYA 3LSJA 4KT6A 5A2QZ 4NB5A 3JRIA 3L2UA 1BIAA 4BHPA 3BZCA 2K9SA 5LGUA 2LC2A 3PJRA 3V7SA 1MKMA 2L9RA 4IJAA 3E6DA 3DEWA 2WWYA 5J4YA 4I0AA 1HLVA 2Y75A 4R1HA 4XICA 1RR7A 4A6DA 4V2FA 1U8RA 2R92J 1T0FA 3RTRA 1IF1A 5TGTA 2M1BA 1MH3A 2E7WA 3QPTA 1S7OA 4XK4A 2DA6A 2STTA 4V19K 3FXUA 1VNDA 2V9KA 4L0ZB 4YEJA 1U9NA 4KITB 1TWFJ 1SEUA 2FU4A 1PYVA 2XPWA 5TISC 1VZ0A 3D5LA 4EMSA 1V5GA 2FBHA 3F8BA 3PL8A 3WTXC 1JGSA 1IUYA 4BH9A 2ZJQF 5ILUA 3B02A 4C3HJ 1N77A 3BR1A 2ZJ2A 3MN2A 4RLQA 3RZOJ 3KCCA 2P6SA 2TDXA 4E7LA 1W1WE 3IC7A 4YRVA 1ETXA 2JMWA 3K1NA 5CVUA 4FASD 2LY1A 2CV0A 4I2OA 1Y39A 2V1UA 3AL0C 1IRXA 2EK5A 1SD7A 2KIUA 4AYBA 1YFHA 3RPQA 4HOBA 1KGSA 3JRFA 1FEXA 2DDBA 5EEGA 2XV4S 3BY6A 2R93J 3G71I 3HOZJ 4F91B 2AHQA 2O5RA 1UJ8A 3I55I 3DEEA 2NOGA 2JPBA 3BQYA 1KU7A 4KUMA 3I59B 2CFXA 4P55A 1MJBA 2VKDA 3ZOBA 5BS6A 3EUAA 2RN7A 2VXDA 3MWMA 2B0LA 3SZGA 3J81Z 2NNNA 2ZFWA 1RI7A 3WE3A 2Z1DA 3V8KA 3CC7I 2CSOA 3IWZA 3E1SA 3SYTA 3PQKA 4BE2A 2UXXA 4AVZA 2F4IA 3RCOA 1RRJA 1MBGA 3RJPA 1ZR2A 1XTAA 1PP7U 3CUQC 4DW6A 3H1CA 1F36A 2DO7A 5J4VA 2CQNA 2P8TA 1K78A 5LGNA 1GXQA 2LDUA 1T33A 2E36A 4M3BA 2IA0A 3JRHA 5LD2C 3BOQA 1MNEA 2P5VA 2J5OA 5CVJA 2HOEA 1S5LC 1Y1VJ 2HKXA 2XRLA 4BYYA 4HNTA 1FP1D 3V8LA 4HDVA 4MIMA 3OOUA 2QYOA 3OYJA 2G7HA 4XONA 3RKQA 5FKMA 3OYIA 2DTZA 1SD5A 4AUXA 4XLHA 1YRNB 2K3PA 2VJ5A 1REPC 1G59A 4XLFA 2VONA 5GAGJ 1MMGA 1V4RA 4GDFA 1NG6A 4FE4A 1RUNA 1ZKGA 1ZYRF 1UHWA 2HNHA 1MZBA 1OKRA 3EUKL 2XAJA 2PQ8A 1W5SA 3RYPA 3FHZA 1B9NA 4BHCA 4NQWA 3FBIB 2XKPA 5HLIA 5CYVA 1MMSA 1Z7LA 1MBEA 3EQLF 5E1WA 1PVEA 3JRCA 3GTGJ 2RREA 2AQFA 4XN3A 2N8GA 2JK3A 4D5FA 2F5EA 2ZXIA 2DA2A 2H6CA 2E1MC 2MBFA 1ORKA 3R4KA 5JI6A 1GT0C 5F6FA 3ABUA 3KEYA 3K69A 1JUPA 2M7AA 4AIKA 3WTYC 1YX5A 4Z6YA 1IDZA 4ON0A 2OQGA 4FTHA 1K78B 3BT9A 2OCEA 3DBRB 2XGCA 3HPHA 1YI2I 4AYBN 3DCFA 1L3LA 5IP7J 4L5IA 4IRIA 2ZXWH 4CGZA 4PJMA 1SFEA 1X3WB 2IAIA 3PO3J 5F1JA 4RGSA 3IKTA 3L2CA 2HDCA 3HDDA 4LJZF 1YHQI 2GA1A 1VTNC 2GXAA 2XPVA 2Z9OA 2EIJH 2L2OA 1DPUA 2E60A 1VQMI 1H89C 2EA2A 3G2BA 2M4GA 4ESBA 2D45A 3T1BA 1QPIA 3H5AA 1WJDA 3O6BB 3HB9A 2HYJA 4W97A 2KP6A 3O3KA 1BBYA 4ITVA 2CQKA 2YUSA 1QA6A 3H36A 2GBYA 2ZMEC 3CCYA 2CW8A 3CESA 2VBZA 4PJJA 3QP5A 3CP8A 4HV6A 4XRSG 4BXXJ 4XLEA 1FNNA 2VE8A 4CCLA 2NS7A 4JX6A 3C2HA 2XB0X 1F5TA 1AHDP 1TBXA 4G7ZF 3C7JA 2WY7Q 5FJ8J 1HW5A 2KL4A 1W36C 3PM1A 2VJJA 2R7FA 2F5DA 5L3EA 3BR3A 3L2RA 4IO9F 5AIPA 4FE7A 3KP7A 2MH2A 1RUOA 3ZQCA 5HLHA 3IRQA 2X1EA 3HJEA 3A2KA 3CCUI 4YIFA 1XG1A 2VQCA 3CDIA 4HX7A 2HQAA 4ZYAA 4OWRB 4RA2A 1BW6A 4AU7A 3EUHA 4ZYHA 3ZMSA 2JA7J 2DFIA 1XSDA 1XGNA 2H94A 3IRRA 1P4WA 2NNYA 4A6EA 1B72A 2BYVE 1K61A 5EJCA 1BI3A 3U1DA 3WTTC 5DCMA 4AWXB 1FOXA 1JJ8C 2ACJA 3VEPA 4HQEA 1BJZA 9ANTA 5FLVA 1JTYA 4HSRA 3VYRB 2WB1A 4LB5A 1X3ZB 2M8GX 4EJOA 2LVSA 3IUOA 2HR3A 2M7BA 2YX4A 5C4XJ 1S7EA 3FM5A 2HVSA 3TDZC 1S8NA 4RBOA 4EM1A 2W85A 3NWSA 4G6TB 4ENMA 2E1CA 1LFUP 5IYBJ 3QYFA 4C3JJ 2ELHA 2UWMA 4Y17A 1OYYA 1NG7A 2HQRA 1UAAA 4HF1A 1Y0NA 2D5VA 5JFRA 3LSGA 5IOZA 2BY1A 5IOYA 1IJWC 2DA7A 1XSVA 2Z99A 1BI1A 1IW7F 1T38A 3LSRA 1DPRA 1M1EB 2UV1A 4N9IA 1S29A 3ZQHA 1U6GA 2PX9A 4RGRA 1A31A 1B9MA 5F64A 2BV6A 3U2RA 4F7ZA 1W0TA 3RKYA 2R7QA 4HX4A 3DTEA 1U2WA 3EDPA 4JYKA 4M71A 3JRDA 1Q1VA 3CCEI 4ZYEA 2KPMA 3VPRA 3ZCOA 3G1OA 4Y52J 2O6GE 2ZNZA 3BR6A 4LG0A 2HOTA 1B72B 4RMNA 1LFPA 1NTCA 4QPQA 3ABMH 3MKLA 3OS0A 3IV5A 3U1KA 3JAMK 4UV8A 2QENA 3FBNB 4ANJA 1Z91A 5DCMB 5C4JJ 2ELKA 1IRGA 4I99C 2OQRA 1X1CA 2COMA 4HSTA 2KIMA 2Y30A 4IOCF 2EV6A 3H9GA 4BJTA 2XPUA 1FTTA 4B3AA 2TRTA 3KIOA 2PEXA 1NHAA 1ENHA 2XGEA 3F23A 2VOOA 2KQRA 2XF5A 2UZKA 1C0WA 2JN6A 5C44J 3G1LA 3OIQA 1K4TA 3HG9A 5IYCJ 3OYMA 3ZXSA 2LF8A 3HGYA 5E3OA 1I39A 2DMUA 1BM9A 4A0XA 3HOTA 4A12A 2V26A 1BOAA 1OJLA 2KFDA 2VBXA 5L3GA 5M5YJ 4XRSA 4FT8A 3DFGA 5DUKA 3HKZN 2X6XA 4XBFA 2Z16A 1K79A 2LMDA 5ERIA 2XSDC 1BR2A 1QHGA 2ZO4A 3AG3H 3QRFF 2DYRH 2DJIA 4CA0A 2R7DA 1JE8A 5DEQA 3J7AY 1X58A 2F4MB 3WGGA 5E3NA 3UNGC 2CJJA 4JK1X 3ISPA 1YW8A 3BCAA 3AG4H 2XB5A 4LK1F 4LG0B 4LITA 2DPDA 2K9NA 2P5KA 3M1EA 3PIOF 3BJ6A 4PZJA 3BQZA 4OAZA 1F1ZA 2ZB9A 3A01A 3OL4A 1WFXA 2Q2EA 3OYKA 1TNTA 2ADUA 5B66C 1ITYA 1YQAA 4IRGA 1ODDA 3K0LA 3MD2A 1EH8A 2OF7A 1QVTA 2HTSA 2V6EA 3ZRGA 1IUFA 2EZKA 3HEFA 4CICA 2E5NA 3KETA 1B8IA 1DQUA 3BR0A 2FA5A 5DM6F 2BHZA 4PSXA 2LLKA 2VB6A 3E0JB 4XM3A 5D6EA 1ZH5A 1FOYA 3GBGA 4WK8F 2BXYA 5HS7A 1LVAA 4ZJZA 1XX5A 3GYHX 3K4MA 4HF2A 3SFIA 2DLLA 3D1NI 1EJ9A 3JSPA 1YE9A 1CF7A 2HVRA 1FLIA 1WPKA 2MW8A 1DDNA 1D5YA 1FJLA 1ZHFA 2IBDA 1IN5A 2VC1A 2BZTA 4AM3A 3CC2I 4DQ2A 4IQJA 3MMYB 2ZFUA 1FY7A 1QVUA 1WI3A 3AFHA 2C6YA 1FX7A 1JHFA 2P6TA 2DFEA 1H9TA 1T8IA 3H3VK 2EIMH 4FX0A 3BROA 2L02A 2LTPA 4Z2YA 1WJCA 5IT9K 2EQRA 4PDKA 5CVIA 5F27A 2CQ7A 1D0ZA 2OU2A 3KP2A 3PFIA 4D7NA 3FK7A 3M1CA 1S9HA 2DMPA 1G3TA 1E3OC 3VB2A 1V54H 1X3UA 4KNYA 4PCQA 1H9GA 1V55H 3Q0WA 1X1PA 2QKLB 1UB9A 2PMZA 4HV5A 1LFBA 3E7LA 1TT0A 3GFIA 4YG2F 4UNOA 2R3SA 2K40A 1FSHA 2X6YA 1B59A 4ZC3A 5FROA 3K4CA 2ECCA 3H3ZA 1ZTRA 1X4PA 3A01B 3BPVA 2Q2EB 4AC0A 1QGPA 1ZRDA 1OYIA 4ZTJA 3O2PE 4CUGA 5BQTA 3BZ6A 1XMKA 1TW3A 3HRMA 1FYLA 3PO2J 2HDDA 3S17J 5J8CA 2E2JJ 1JI8A 1TT5B 1FWZA 2NAZA 2WTEA 2V9PA 3MZYA 2A3SA 2RQQA 3CUQA 2CS3A 3H0DA 3TOAA 2QQ8A 1WJAA 3VYUB 4DOZA 3R0JA 2FNAA 4XRFA 1FMVA 4S04A 4D5CA 1D1BA 2DA4A 1WJFA 3FIWA 3KP5A 4PJNA 2EWNA 4GFBA 4UXNA 5HODA 2JRTA 4A3EJ 2AO9A 5GPAA 1ZGWA 5DM7F 2EIKH 3IAS2 3LSHA 3BTJA 3BTLA 1JUMA 1U78A 1E17A 2XHKA 1WJ5A 1Z0XA 4CO8A 5HNHA 1R1TA 5FKLA 1VQ4I 2ZCWA 2Q8KA 3JR9A 2EA4A 4MQ9F 4GYIA 3JAMZ 3KFWX 3WHCA 4L9JA 4S05A 1TC3C 3HOWJ 1XCVA 6PAXA 2GOMA 2MH9A 4RS8A 2XVCA 1G3SA 1X1BA 4LMYA 5EEAA 1T95A 1BJAA 3CUOA 2QLZA 3B6AA 4QSHA 3S16J 2BW3A 2I5UA 3HOUJ 3NQOA 3SEZA 1TZLA 4DYCA 3GTMJ 4GXOA 2AXTC 3QOPA 2R5ZA 3R60A 1SD6A 2EV5A 2HKOA 1U5TC 5TRDA 2KRCA 4BBSJ 3G3ZA 4Y15A 2YSRA 3FXRA 4N4NB 4EM0B 3LSIA 3ZMVA 3T0YA 4B47A 3PSFA 1XPXA 3LFUA 1UHMA 3L1PA 3DU5A 3M4OJ 2RDPA 1A36A 5J6XA 2M4KA 5B3SH 3ONQA 3TO7A 3M8EA 4N0BA 1A04A 3H5RA 3L00A 2BGCA 2V1NA 3TL4X 3O8HA 4KMFA 1ZAOA 3HYIA 1DP3A 2F5FA 3KZIC 4XKCA 5H6RA 3OS1A 5GP9A 4M6VA 3JRAA 2VASA 1VQ5I 1SAUA 4JBAA 3N4MA 4EVIA 2FD5A 5FRNA 3LA7A 5M3FJ 3Q0VA 3RYRA 5HDGA 3FKIJ 5GTIC 4PGGA 4J19A 2A5YB 2PMZN 1G3YA 3HHGA 3H9QA 2VL8A 4OIRF 3BJAA 3TO9A 4XLAA 4LB6B 4HPQA 2E7XA 1WH5A 2WADA 3K6GA 3O8GA 5FO5A 1OISA 4P9UA 4XKWA 3QU6A 3W6JB 1YJ9I 5FRMA 3I53A 4CXFA 4HX8A 3GLLA 1J2XA 4MHGA 3GMEA 1I5ZA 3DLLF 4UB6C 2LD5A 1QZEA 1TQIA 3R6SA 2HYGD 2FBKA 3LNQA 2JA8J 3H5NA 5DYMA 2ZJRF 3HL2A 5K5RA 2GXBA 4A3DJ 1SVOA 2DI3A 5IPAA 3IH2A 1VQ6I 2BE5F 2DA5A 2F48A 4BE0A 2JQ7A 2XAFA 2LH9A 1QPMA 2D1VA 3P9CA 3WTVC 3QAHA 2STWA 2QF7A 1IZ1A 2L7KA 4B8XA 4AVPA 4LG3A 4BJ6C 4RM2A 2IS2A 1K83J 3TDUC 3TMOA 3VFZA 2O3FA 2R7ZJ 3C2BA 3JCUC 4IPAA 5IT9Z 2P4WA 2BEOA 1ONVA 1Z05A 1ZK8A 3SDBA 2NVXJ 3HOYJ 2IPQX 1IN8A 1YS7A 2IGKA 2X6OA 4R8HA 2BXZA 2Y0MA 4CZZA 2L7ZA 2P0WA 2GIVA 1P4AA 1IXCA 2KDOA 3K1PA 4TV7A 2XROA 4RM3A 4NDLA 4B1RA 2E5ZA 1MMAA 3T8RA 2CUEA 5JVTA 2LKSA 2H8WA 1XDSA 4M72A 3LMMA 3E6BA 1HOMA 1SFKA 2BOLA 3DLAA 1JT0A 5H20A 5FKNA 1R1VA 1KZHA 2OD5A 1Z77A 4C2TA 2YU9J 2E71A 3TP0A 1P7JA 1RIOH 1ZELA 2PJRA 1R4NB 3OSFA 3BG9A 2VLAA 4LD5A 2M34A 1OR7A 2VQLA 1P4XA 2ESHA 2IP2A 2VJIA 2XDVA 2MC4A 1T56A 5M5XJ 3UR3C 1EH6A 2E34A 2HI3A 2L9SA 3RPUD 3HSRA 5D8KB 2W84A 3KZYA 2KJCA 3E5UA 3WODF 5FLMJ 5EZGA 3FXJA 1WJBA 4M9ZA 2DMTA 2GA2A 1OCZH 5J3LA 2ZXHA 1PUFA 1TWAJ 2IJLA 1TQMA 4XIDA 3RQ4A 2ZSIB 3K2AA 1TWGJ 2FF4A 1QNTA 3LAJA 2K9QA 2FMYA 3WE2A 3FHNA 2EV0A 3JW4A 1HDDC 3L2QA 1A5JA 3CLOA 2EPFA 3H35A 4MGRA 2PLYA 3SEQA 4BY1J 3WGHA 4IHVA 3NRVA 1Y8RB 5L3CA 3KX2A 2ELJA 2K3FA 5GAHJ 4Q5SF 3V8JA 4IRHA 4KJZA 4H4KC 5D5VB 2GQQA 1I3AA 2JVHA 1Y6IA 4W1UA 2RC4A 4CCOA 1YS6A 5JLWA 1TLHB 2HZDA 3TQNA 4IZZA 3HRUA 2EZIA 2OPTA 4RAGA 1E0EA 1LE8A 1LB2A 1HXDA 5E3LA 1RETA 3S8PA 3EPZA 3MKYB 1GV2A 2HQ5A 1D8JA 1PP8F 2AXLA 2XASA 1GHCA 1K6YA 2KMUA 4O5VA 2W7NA 3KLOA 3MEXA 4RB1A 2NRAC 3EYYA 3P9IA 2PJRB 3DKWA 3HTSB 1H88C 2CFOA 3HM5A 3BG3A 4ETSA 4O3MA 4HLYA 3OSGA 4AIJA 3H9JA 2IS4A 3TGNA 2M0MA 3P7NA 1MSEC 3L7WA 2EFOA 2KKOA 1BC8C 5E8IA 2CV1A 2DT5A 2VBYA 2OAZA 5FLXK 2V4JC 4OMZA 5EG0A 2EINH 2KRFA 2LSOA 1G2HA 3CCSI 1Z6RA 3KEOA 2MYSA 3OYFA 1SVMA 3LA3A 5BPDA 2A6TA 4G6DA 2VN2A 2CGPA 4HA8A 3FM3A 3AKZA 3ZMTA 4BNCA 2CUZA 1USTA 3E5QA 2Q1ZB 3FXMA 1H0MA 3SHFA 3GTKJ 4A3BJ 4X1EA 1Z67A 4G7OF 1ZLKA 2K5CA 1P2FA 1TTYA 1WVRA 2OBPA 4BBRJ 2MLGA 1ZR4A 2AS5F 5LEJA 3F72A 1A6IA 2H27A 5HDKA 1DU0A 1Z9CA 4LFUA 4JX5A 4IX7A 2QA4I 4NBQA 2KDZA 3BC8A 4B4CA 2D1HA 3M7GA 2O8XA 4B09A 4B3XA 1LE8B 3F8FA 1AWCA 4IOAF 2FNPA 2YU3A 2EBIA 3SZPA 4KT5C 1R5ID 1FBUA 1ZREA 1ZN2A 4NQWB 2R7SA 3DTKA 4PUSA 1T08B 3V7RA 1SD4A 3M3YJ 3DF8A 2EZLA 4LGWA 3ELKA 5B1AH 1LEAA 4BQAA 5ILVA 1TQPA 2QBYA 4A0YA 3F9KA 5EGOA 1ETVA 3DV8A 1VQOI 4FISA 2IRFG 1TW2A 2ME0A 1IO2A 1IAWA 2PBIA 4QIWN 2R0QC 2MGQA 5DTDA 3CO6C 1NK2P 2JA5J 1G3WA 1ETYA 3SFZA 4HEA2 3GTJJ 4HBLA 2MA3A 1J09A 2A61A 2H1LA 1K6OA 4MO7A 3MFKA 4WCGA 2QSHX 1IGNA 3HKZA 2IW5A 2XGXA 3BR2A 2DMNA 4KN7X 1VI0A 4MTDA 3HZJA 4EM2A 4ZTFA 1KA8A 3VYSB 1BOBA 4EQQA 3PQJA 1ULYA 2VKVA 2IGMA 4CCJA 1R49A 3SQNA 3ERED 1OFCX 3CLQA 2Z2SB 3GCMA 3FDYA 1JKOC 2HS5A 4UUSA 3WU1B 1K7AA 2CU7A 4XKBA 3VDXA 3HC7A 3TW7A 1W7PA 5BMZA 2VPLA 3OIOA 4EV0A 3ZR8X 3ZN1A 2M45A 4Y13A 3AAFA 2BVMA 1IRZA 2F5VA 3GWZA 3IH3A 5K1YA 1FYMA 3K4BA 2F5CA 4L9VA 2OTJI 3GFJA 2CUJA 4MEXF 3CZ6A 3OY9A 4KYWA 1KU2A 3HPGA 3FXOA 4IQ4A 1ON2A 4DZPA 2QZ8A 1O3RA 2KIFA 4LLGF 2F6CA 3KYLA 2L54A 1E3HA 4BEHA 5K7HA 5TJJA 1JJ6C 4S0HB 3W2VA 2FBIA 2JPCA 1J5YA 1S7AA 3AG2H 5KK1A 5IT3A 3J7YJ 3RIRA 2Q0OA 1UFMA 4IHYA 2IS1A 3QPSA 2ICWG 2QBYB 1HC8A 1IV8A 3QPLA 2DK8A 2VT2A 4MTEA 1SFUA 1R23A 1R4MB 1IN7A 4E7HA 3GTPJ 3A0BC 4HNUA 2QCOA 4F52A 2BVLA 2I10A 4XSZF 1MBFA 2CO5A 2CW0F 2FRHA 1E3PA 2ID3A 2NVQJ 3OS2A 3VYTB 2I8DA 1LEBA 1GV5A 2BHYA 3S3OA 3E97A 3ZMUA 5CVRA 2VKEA 2HDWA 2DODA 5D5WB 3LSMA 5K7FA 3MAJA 3ABTA 1UELB 2LY9A 1V5EA 2VKHA 3G4SI 2M2EA 1Z3XA 4QPOA 2L7FP 4G8XA 5KVRA 4BXUA 2K27A 1W4MA 1XDUA 2ME6A 5GADJ 1EH7A 2K9MA 2R5YA 3FZVA 1FOWA 1Z1DA 2XGDA 3GZ6A 1U5TA 2RV8A 4WXHA 3DTIA 2WAFA 2CV2A 1XCBA 4CSWA 1LKXA 4ZH4F 2R7XA 1YIJI 4BGDA 1AA7A 2QUFA 3V7CA 4U87A 3CJNA 3HOSA 1FBQA 1BW5A 1FMWA 2KIQA 1STZA 3PNYA 4L5JA 3NEUA 4G94A 1QRYA 3GVAA 1LDDA 5AIQA 2ETHA 3F3XA 5FLXZ 2JVGA 4DYQA 3WGIA 2EILH 1RPWA 3FMQA 4BEHB 4R79A 2XRNA 3IL2A 2CQQA 3FF5A 2ZC2A 4EEFG 4I7HA 1ZGAA 4DGWB 1A35A 4N9HA 2K85A 4CCNA 1CQTA 1DP7P 1ETKA 3GF2A 2TCTA 2RAEA 1F43A 4IHSA 4I0BA 3W3CA 3BG6A 2RNGA 1T98A 1LJ9A 4PGHA 2IVMA 3DWLE 5KNLA 3CJQB 4QLCU 1GVDA 5LHGA 2LKPA 4UUTA 4A5MA 3WG7H 4QWQA 3N05A 2AQEA 2ZSHB 3ZQFA 1XS9A 3RQIA 5ICEA 3K2ZA 2OA4A 3QWLA 3QQAA 1EA3A 2WY8Q 1IDYA 3HSFA 5E3MA 3KLNA 2PMHA 3I54A 1FIPA 2Y2ZA 3OMYA 2NVYJ 5D6FA 4AD9A 2PFBA 2IXSA 2JTVA 3I4MJ 1QZZA 1RKTA 2XIGA 4K2EA 2DJNA 2V9VA 2R4GA 1O3QA 1SANA 4NHJA 4U7DA 5J8FA 3BG5A 2FSWA 3HUGA 5KAFC 1O57A 2P7CB 4UV9A 3W2AA 3HRTA 3JTGA 3HGGA 4MNUA 2QQ9A 2GIZA 1Y56A 3IH4A 3LOCA 4CYCA 5IP6A 4DYRA 5LRSA 4XQFA 2QQAA 2XAGA 4KIGA 3GZNB 5F04A 3R61A 4BKXA 4DBQA 2HQNA 4ZZDA 2VJ4A 4UB8C 3E6MA 3FISA 4XRMA 4HG2A 2V7FA 1LDKB 4L5EA 4D9JA 1BIBA 3DBHB 2A69F 4M3GA 4L9TA 2GWRA 2L9NA 3MCZA 5E18F 4I76A 3S2HJ 2JA2A 3CP2A 4BDYA 3I9V2 2VODA 1KYWA 3GEZA 3ZQQA 1X4OA 2X4HA 4C2UA 4Q47A 2YX7A 5GPCA 3G1MA 3F8NA 1DU6A 4A2UA 4FHTA 1J0RA 2P5LC 1O3SA 4GRIA 1R5GA 1F9NA 4RGUA 4YIRX 3KEQA 3L9FA 1MDMA 2HU9A 1Y1WJ 3M9AA 4MQVA 4HF0A 4EATA 5E1XA 1T6SA 1UMQA 4XLPF 2LP0A 1KONA 1ZGJA 1YW7A 2WAQA 1OCTC 3DKYA 3P5JA 2GM4A 1FT9A 3HHHA 4D7MA 1WQ2A 3OYAA 1OCRH 4BXFA 3FMSA 5BNGA 2EFNA 3EUHC 4LK0F 3JREA 4HW0A 3ULQB 1FSEA 3I3LA 2Y9YA 3IAM2 3CDHA 2J5PA 2EFPA 1B8IB 1I1GA 1SMYF 1U8BA 1VQ7I 3ZP5A 5BOXA 4XN0A 5J1UA 3ML6A 1R5HA 2FMLA 3Q9SA 4RAFA 5M3MJ 1Z6TA 3I64A 4B48A 5E1ZB 3V42A 1MD0A 1CF7B 2PI0A 4L18B 2B7EA 4LIUA 2ISYA 4D0PA 3F6VA 2WV1A 4M9XA 1WCMJ 4J01A 1F4KA 1HW1A 1RKWA 1YYVA 3GTOJ 1ETQA 2NS8A 3LQQA 5FGMA 5E8GA 1L0OC 5B5EC 4BAYA 3TOBA 1MGTA 3AL0B 2HWVA 3G6EI 2JWTA 2H8RA 1T39A 4A3KJ 4KFCA 2A6HF 2VT3A 5EYRA 1QU3A 5LLQA 3W2WA 4CCMA 4FETA 4ASNA 4XNFA 3MKWB 2K4JA 3BTIA 4ENNA 3K4NA 1MDMB 3D5SC 4F3QA 5EF6A 3OR2C 1YO5C 4H0EA 3I4NJ 2LF7A 2UUZA 3DP7A 3OYLA 2Y69H 1VQKI 2HFHA 4Q48A 3VSLA 5LHIA 2DT7B 2DDAA 3B73A 3ZQ7A 4C30A 4ESFA 4KDPA 4O6JA 2DA3A 4P96A 2DFFA 5CVVA 2MC3A 2QVOA 3LAPA 3L2WA 5L3BA 3PNTA 2IT0A 3BWGA 2EJRA 4V2GA 4OIQF 4PK4A 3OYHA 1VQ8I 1FPQA 1YJNI 4KISA 3GUDA 2O61A 1ZG5A 2A05A 2XKOA 2DT6A 2MFZA 5F1RA 1ZRCA 2W25A 3A0HC 4B44A 1Z3YA 3CUQB 1W36D 2DCEA 3S3MA 2NOJB 4IHWA 5D5XB 3CC4I 4BJ5C 3WU2C 1O3TA 5CPRB 4I02A 3S14J 5ICCA 3K4JA 2BY0A 2BY3A 5ICFA 2GXGA 2X51A 3WHBA 3EETA 2K02A 1FBSA 2WC2A 1ZG1A 2DBBA 1U0JA 1I27A 3CMMA 5FFXA 2G9WA 2KZGA 1NH3A 2NS0A 2DMQA 1YX3A 1JT6A 2LNBA 2VPRA 1R9TJ 3FXKA 4BACA 3J7ZI 2WAQN 4CZCA 2KISA 1ACIA 4UVAA 4KA4A 1V3FA 3T8TA 2DAOA 3CDLA 3K70D 2ZNYA 3R0AA 2JJ7A 2EFQA 2DOAA 1I1SA 4IVNA 3IKVA 2E1NA 2EH3A 2JRMA 4XOPA 4IF4A 4U0WA 2X9DA 2VBWA 4YIIA 2ZMEA 2O9LA 3S1NJ 2X1CA 2BW3B 4BE1A 1IXSB 2M9HA 3BJOA 1R71A 3OYCA 1HSTA 4D1QA 4XORA 2R5ZB 2DU9A 1W5TA 1GUUA 3GFMA 4RAYA 1UZCA 3GO5A 1WJEA 1WRJA 4BQQA 3K7AJ 2E1MB 2O7OA 3FKJA 2PJPA 3ABKH 1OMIA 1OCOH 3HIFA 3I59A 4M3EA 2O03A 2Z5UA 4YFXF 5J1RA 1S6LA 4RGXA 5D5UB 3RKXA 2VIXA 2WAEA 1VQ9I 1VQLI 2QEXI 2KLOA 2HXIA 3ASNH 3RZDJ 1ON1A 2W1OA 3HRSA 3L09A 5H6QA 5D8LB 3FK6A 2OJED 1QZYA 1D1CA 3P9KA 1UCRA 3H3UA 1I50J 3I58A 4WF2A 5FKKA 4M6XA 4UVCA 2CQXA 1HKSA 1XGOA 2VE9A 2WA0A 2OTLI 1WHUA 1HDPA 2PMUA 4WWCA 1OCCH 4ZDLA 3HOXJ 4P1WA 4NC6A 1YW9A 4LIVA 4KIBA 5FKOA 3WTSC 4KIFA 2KRHA 4KMUX 4GCVA 4P5OA 2W24A 4MEYF 2DXIA 5IP9J 4JX4A 3SXYA 3BP8A 1IV6A 1QO0D 4IKFA 4PSWA 4EGYA 5E20A 3E5XA 2R7WA 2O8KA 4I6ZA 4II2A 1EF4A 3MZ8A 3K4KA 2HOSA 3JSOA 1YRNA 5L3FA 2ZMEB 3TKYA 3ZMZA 5LGTA 1E2XA 2ESNA 4ZZLA 5JR3A 3C2GA 3CCLI 1LQ1A 4P9FA 2HGCA 3I5UA 1U9OA 3Q5FA 3REOA 3GZ5A 3LL7A 3I56I 4BU2A 5EEHA 1R58A 3F22A 3S2WA 2W00A 4C2MJ 2DA1A 4MLOA 4M3FA 1MBHA 4RLFA 4BS9A 2VI6A 1UG2A 4U0VA 4IEJA 5IYDJ 1HSJA 4OMYA 1ZG3A 5ILSA 2CMPA 2L0KA 3K9TA 3HBLA 1SAXA 1TNSA 2V1DA 2WV0A 1T2KA 4XMYA 4E7ZA 1GXPA 1XN7A 2RQPA 2XAQA 3V4GA 3COAC 2M0CA 2M87A 4CDGA 2GAUA 1G8XA 2LK2A 1LDJA 4I09A 5ED4A 4XOTA 2OV7A 2DQLA 3CJTB 4U7BA 3WTWC 2RGVA 1SFXA 2R7VA 1IRFA 2DW4A 1NK3P 3ABLH 4XKVA 3F21A 1P9QC 4AIHA 2O0YA 2XSJC 3GX4X 1AOYA 2DOEA 2DFHA 5DD8A 1SMTA 4JOMA 3H92A 3KYCB 3W6KB 4RB0A 2Y9ZA 5JLXA 2IGNA 4C3IJ 1PUEE 1VF9A 1QQIA 2R7TA 3X2QH 4JQFA 3OYGA 1Y8QB 2K4BA 5DCFA 3A02A 3LSPA 1JUSA 4G7HF 1HKQA 4OU0A 1EKEA 2PG4A 2CYYA 2MD5A 3DXJF 1DGWY 5CKTA 5M5WJ 1R36A 3RDIA 3FWEA 3NWTA 5KAIC 2JSCA 3F6OA 1N75A 1XSXA 4ZDOA 3QYEA 4XR6A 1QBJA 4MFDA 3CCJI 1MH4A 3GXOA 3KYDB 4A3JJ 2E1OA 1IN6A 4FQGA 4BDZA 1PUFB 1KQ8A 3RPUA 4RB2C 3SDGA 5DS9A 4ENKA 1ZLJA 2WBMA 1ETOA 5HOOA 1R6RA 4HYEA 4DIQA 1YITI 3F8CA 3JTHA 2W57A 1LPQA 1GVJA 1G6NA 2H1KA 5D4RA 3CO7C 1D0XA 1BR4A 2D2WA 4E7KA 2LFBA 2QSFX 4CCKA 4F92B 2F2EA 3WTZA 3E6CC 3DPTA 4XL9A 4HDUA 3I71A 3ZQIA 2E19A 5CJ9A 2RKHA 3RSNA 1FP2A 1X1AA 5B1BH 3ZQLA 3M8FA 2XF7A 1MNMC 4FCYA 3HSEA 3D0SA 3NAUA 3BZKA 1O7LA 1SC7A 1RC9A 5E17F 4BQNA 2FQ4A 2M3AA 5AONA 4A3FJ 1W7PD 1IC8A 3LWFA 4LLNA 5J40A 4DJAA 2V79A 1J75A 5HLTA 4EGZA 1VQNI 2FOWA 1MJ9A 1OYWA 4EJUA 2W4SA 5DD4A 1BI0A 3PSIA 1JTXA 2RVCA 2LG4A 4I98B 3JRBA 2M8EA 5H2FC 1BL0A 1FIAA 4DNCA 2OCCH 1ETWA 3IWFA 1S72I 3WG9A 1USSA 4QTRA 1YLFA 2HTJA 2JT1A 1XGSA 3GTQJ 2COBA 3FMRA 3BPXA 3CMYA 1OQYA 2EZHA 3C1DA 1T0FC 3C3WA 4A0ZA 3HOVJ 2NYXA 5EG0B 1XMAA 3NARA 2KT0A 2Y48A 3OYNA 3ZGKA 5LRRA 2HEOA 3CJRB 1JKQC 1WKMA 3A4CA 5F08A 1BI2A 4ZDPA 1RESA 3SJMA 1IXRC 2UXNA 2DPUA 1TWHJ 3E3VA 2JSPA 4B43A 4EJWA 1W0UA 3S3NA 1HQCA 3CF2A 2FUG2 4RB3C 2YR2A 1HCRA 2DOFA 1B4AA 2NVUB 3F8MA 4M3DA 2KZVA 1P92A 1POGA 4ZYGA 4M74A 1LVKA 4HNVA 4GYGA 2A6EF 2OZ6A 2OZUA 4M6YA 5EDNA 2FX0A 2VQGA 4HQMA 4ESJA 2LKXA 5LBQA 2LBFA 4Y4RA 2JUCA 1O7FA 3GFLA 1BC7C 2B9SA 1BA5A 1TP4A 4BY7J 1G4DA 3A1YA 3DPLC 3FX3A 4X0GA 4OINF 1IN4A 4BL0B 2YPRA 3K70C 3KZZA 1XGMA 5CQGA 1SFOJ 1R7JA 2OUMA 1H8AC 2QSGX 4NC7A 2LY2A 4PFOA 4M9SA 3S1QJ 2LOOA 2ZBKA 1EV7A 2DYSH 4LOCA 3QP6A 1R22A 2HPIA 4GGGA 4PFPA 4Y33A 5GTHC 3OYBA 5FFZA 4DZJA 3C18A 1I3QJ 2H6BA 1XD7A 3ASOH 3N97A 5EGOB 1ERDA 3TEDA 4AIDA 5JHUA 3T5XA 4A3IJ 3OR1C 4U0YA 2FEZA 3Q9VA 3CMEI 4L0YB 1OR7C 4CYDA 4A3CJ 4U88A 4G12A 3TBIA 2L7MP 2Z33A 3TW6A 1S3JA 2H09A 4NC8A 5DUIA 4MFEA 1RNLA 2NXNB 1I6XA 2MD0A 2K9LA 1TWCJ 1HW2A 5EZHA 3QOEA 1ZQ3P 1WH7A 5KCMA 2IGOA 1CGPA 3HXLA 3U21A 2IA2A 1RZ4A 4E4HA 1J7KA 5HNFA 4UUSB 3DBLB 2K7LA 1UG0A 4YFNF 2M30A 4KN4X 1W7PB 5DV5A 2L4AA 2KJBA 3OL3A 5K5OA 5ICGA 4RAZA 1YIOA 4YELA 3K1MA 2ISZA 2LBFB 3KE2A 5IY5H 1JKPC 1MMDA 4BQOA 2X0LA 3CQZJ 2G7UA 4OOIA 2BY2A 2L4MA 3MZHA 3LQRA 2A07F 1MNDA 2IEKA 2FXAA 2XF6A 3MVPA 2CG4A 1VFCA 1MW7A 2Y0SA 4WXCA 3CF5F 1HBXG 2CW7A 3U9GA 4XSXF 3LSKA 1DGRM 4CHUA 2Z3YA 1YG2A 3B6CA 1D5VA 2YS9A 1OCPA 1WGXA 2RNJA 2EB7A 4G9YA 4F55A 1JXSA 1LUJB 2IS6A 1WZ2A 1HF0A 2LRDA 4Q4ZF 2B63J 1Z21A 2KHMA 4WXDA 3KP6A 1BR1A 2K86A 5LFAA 2ZJPF 1VQPI 4NUBA 2L9VA 4OAYA 3ECOA 1W5CC 1MBKA 2MSYA 1XC5A 2MLKA 2DTRA 4WX9A 2LYCA 2W48A 2VOPA 2M5WA 3DU6A 3J80K 3S32A 3EYIA 5FB2A 1X2MA 2HZTA 3KP4A 3ESWB 1X1DA 3CCMI 1FZPB 5K7ZA 3Q0UA 3QYBA 5FD6A 3S93A 1ZRFA 3GLXA 2R5YB 4A3MJ 5A2QK 5HVQC 2FJ1A 1U5TB 3M8JA 4Y7NJ 3OIPA 1TL8A 4CH7A 2F4OB 2G0EA 2WB1N 1X2NA 2MG4A 2QWWA 4I01A 1IG7A 4IHTA 2DN0A 1WI9A 2XAHA 1J9IA 3PUFA 2XAUA 2JZYA 4FX4A 3ZPLA 3IP4B 2ECBA 2LREA 3WU0A 3SZTA 2CWEA 3TO6A 4RDUA 2W82A 2CUFA 5LHHA 2X48A 3L2VA 5F0HA 3A03A 3CD6I 4YFKF 4BUPA 1O4XA 3ROUA 3RKWA 1R00A 2A5WA 4ZYDA 4IL6C 4UHTA 1N78A 4NNJA 3I0TA 1OLTA 4IXAA 2VUMJ 3IHUA 1UHSA 3S15J 3QU3A 3HTUA 3LFKA 3QPHA 1AKHA 3I4PA 5BPIA 3DPUA 5CLSA 4EJTA 3PFYA 3S2DJ 1MIJA 1HKTA 3D5RC 3KP3A 3GTLJ 2P7VB 1D8KA 2CH0A 4A69C 3BCBA 3S1RJ 3CMAI 1P6RA 1MJAA 1U3EM 4OIOF 2EFWA 2GOXB 3OWTA 3K10A 3FXLA 2HPMA 4E70A 4XLNF 3RI4A 5CQEA 4E7IA 3DQVC 1YJWI 2X6WA 4M73A 4G6QA 3LSTA 1Y0UA 1YOVB 1P7IA 1FTZA 1MMNA 1DUXC 1MBJA 2QGUA 4L9NA 3HUGB 1XB4A 2E2HJ 2CRGA 5HS8A 3Q3SA 2ZXJA 4CYCB 1D3YA 1D1AA 2Y0SN
chains in the Genus database with same CATH topology
3ZCOA 2KLOA 4XLCA 1V5FA 2W1OA 5JHFA 2X1DA 2R7OA 3AKZA 4RMNA 2CUZA 1LFPA 1D1CA 4QPQA 2Q1ZB 3OS0A 4N4OB 3FBNB 4ANJA 4DBRA 2K5CA 1X1CA 4HSTA 1X19A 3DKXA 2WA0A 3H9GA 4BJTA 2R7RA 2XC7A 4IX7A 4ZDLA 4P1WA 3OYEA 4E7SA 4LIVA 3BC8A 2KRHA 3K4LA 4E6KG 2KQRA 4J00A 2XF5A 4P5OA 3VSKA 4B3XA 2DXIA 4PJLA 2VXZA 3OIQA 5KHDA 3HG9A 3PNVA 4IKFA 4PSWA 3OYMA 4NQWB 3ZXSA 2R7UA 2X85A 2R7WA 2R7SA 4II2A 3DTKA 4PUSA 3K4KA 4C9YA 2V26A 3OYDA 3HOTA 3C2GA 1PJRA 2X6XA 3F9KA 2Z16A 1D1AA 1BR2A 1QHGA 3LL7A 1D0YA 2DJIA 4BU2A 2QKMB 4CA0A 2W00A 4MLOA 4E7JA 4HEA2 2OC6A 4RLFA 4BS9A 3J7AY 2L5QA 4Y3OA 2JUGA 3UNGC 1J09A 2VQHA 1GLNA 3BCAA 3HKZA 2CMPA 4LITA 4ZTFA 3VYSB 1BOBA 4XMYA 4E7ZA 1QHHD 3VWBA 4HRIA 4CCJA 2IGMA 4OAZA 2HVQA 3PUBA 3QODA 3OL4A 1HA8A 2Z2SB 1WFXA 3OYKA 3FDYA 1G8XA 4XOTA 2OV7A 4XKBA 3MD2A 4U7BA 3VDXA 3HC7A 2VPLA 3MKZA 2V6EA 3ZRGA 2R7VA 2MABA 2E5NA 4XKVA 3ZR8X 1DQUA 1P9QC 4F93B 2BVMA 2XSJC 4PSXA 2F5VA 4II3A 2VB6A 4XM3A 3E0JB 4JOMA 3K4BA 3GBGA 3BG7A 4ZJZA 2CUJA 2IGNA 3K4MA 3CZ6A 3OY9A 3HPGA 4IQ4A 1YE9A 2HVRA 2R7TA 4JQFA 3OYGA 3BLYA 4KT6A 4IQJA 2F6CA 3MMYB 2ZFUA 3KYLA 3L2UA 4BEHA 3AFHA 1DGWY 5CKTA 3W2VA 2LC2A 2IS1A 3PJRA 3NWTA 1N75A 4ZDOA 3QYEA 4XR6A 1WJCA 4E7HA 1D0ZA 4BDZA 3M1CA 1S9HA 4HNUA 4F52A 2BVLA 2WBMA 5HOOA 1R6RA 4DIQA 3OS2A 3VYTB 2I8DA 3RTRA 3S3OA 2QKLB 2PMZA 5TGTA 2HDWA 1D0XA 1TT0A 1BR4A 3LSMA 4E7KA 2X6YA 1UELB 4CCKA 4ZC3A 5FROA 1V5EA 4F92B 2VKHA 2V9KA 3DPTA 3K4CA 1Z3XA 4QPOA 4XL9A 1X4PA 4YEJA 4KITB 2Q2EB 1PYVA 2K9MA 4ZTJA 3RSNA 4CUGA 1VZ0A 1X1AA 3D5LA 1V5GA 3PL8A 2XF7A 3DTIA 1JI8A 2WAFA 2CV2A 4CSWA 2RQQA 3H0DA 2CS3A 1LKXA 2R7XA 4BGDA 1AA7A 1N77A 1WJAA 4U87A 3VYUB 4BQNA 4DOZA 3HOSA 2M3AA 4RLQA 1FMVA 1FMWA 1D1BA 4DJAA 1WJFA 4E7LA 3PNYA 4YRVA 5HLTA 4PJNA 4FASD 2LY1A 2CV0A 2W4SA 2JVGA 3PSIA 3AL0C 1IRXA 2LG4A 4BEHB 4R79A 4AYBA 3IAS2 3LSHA 4DGWB 4CCNA 1WJ5A 5HNHA 4F91B 3W3CA 2O5RA 3BG6A 2RNGA 3DWLE 3DEEA 5KNLA 3CJQB 1T0FC 2GOMA 3OYNA 2VKDA 2AQEA 2ZSHB 3N05A 3ZGKA 1X1BA 3EUAA 2VXDA 3CJRB 1T95A 3A4CA 3SZGA 4ZDPA 1EA3A 2WY8Q 2Z1DA 2BW3A 3OMYA 3SEZA 2IXSA 1TZLA 2JSPA 4B43A 3E1SA 3SYTA 3S3NA 4BE2A 3CF2A 2FUG2 4AVZA 2F4IA 3RCOA 2R4GA 2KRCA 2KZVA 3W2AA 4N4NB 1LVKA 1Y56A 3LSIA 4B47A 4XQFA 3PSFA 3LFUA 5LD2C 1MNEA 2VQGA 3DU5A 2LBFA 4Y4RA 4DBQA 2M4KA 4HNTA 3ONQA 2VJ4A 3A1YA 3DPLC 3H5RA 2V7FA 1LDKB 4HG2A 2V1NA 3TL4X 4D9JA 3OOUA 4X0GA 3OYJA 4BL0B 3K70C 1DP3A 2L9NA 4XONA 5CQGA 4XKCA 2OUMA 3OS1A 3OYIA 4NC7A 2LY2A 4PFOA 2JA2A 3CP2A 4BDYA 3I9V2 2LOOA 2VASA 4XLHA 3ZQQA 1SAUA 4C2UA 1X4OA 2K3PA 2HPIA 2VJ5A 4PFPA 4Y33A 5FRNA 1G59A 4XLFA 3OYBA 1ERDA 1MMGA 3H9QA 2VL8A 1NG6A 4GRIA 3OR1C 4XLAA 4HPQA 2HNHA 3EUKL 2WADA 1OR7C 3K6GA 4XKWA 3FBIB 3TBIA 1Z7LA 5FRMA 2HU9A 4NC8A 4EATA 2RREA 2AQFA 4XN3A 1KONA 2MD0A 2K9LA 2WAQA 2ZXIA 2E1MC 3DKYA 3QOEA 3H5NA 5KCMA 3HL2A 2IGOA 3HXLA 3KEYA 3U21A 3OYAA 2M7AA 4E4HA 4BE0A 4BXFA 5HNFA 1YX5A 2LH9A 1UG0A 3EUHC 3I3LA 2L7KA 3IAM2 4LG3A 4BJ6C 4RM2A 3HPHA 2IS2A 3OL3A 3TMOA 4XN0A 4YELA 2LBFB 1MMDA 4PJMA 4B48A 4BQOA 3V42A 3SDBA 1MNDA 2XF6A 4LIUA 1MW7A 2IGKA 2Y0SA 2CW7A 3LSKA 4J01A 1DGRM 2L2OA 2P0WA 2E60A 2KDOA 3G2BA 2M4GA 4RM3A 3H5AA 3AL0B 1WJDA 4F55A 2E5ZA 1MMAA 2KP6A 2IS6A 3LMMA 1SFKA 2BOLA 4ITVA 3DLAA 1QU3A 3W2WA 4CCMA 4FETA 4XNFA 3MKWB 4C2TA 2CW8A 2LRDA 3CESA 1Z21A 2KHMA 4PJJA 1BR1A 3K4NA 3CP8A 5LFAA 1ZELA 4NUBA 4XLEA 3D5SC 4OAYA 4F3QA 2PJRA 4CCLA 3OR2C 3C2HA 2VLAA 2UUZA 3OYLA 2VQLA 2WY7Q 2KL4A 2VJIA 2XDVA 1W36C 2LYCA 2VJJA 2MC4A 3VSLA 3UR3C 2DT7B 3DU6A 2L9SA 3RPUD 4C30A 3S32A 3L2RA 3L2WA 3PNTA 1WJBA 1X1DA 4PK4A 3OYHA 2ZXHA 3QYBA 3S93A 4KISA 2X1EA 5HVQC 3A2KA 2VQCA 2DT6A 2HQAA 3M8JA 3RQ4A 2MFZA 2ZSIB 4ZYAA 3OIPA 4OWRB 4CH7A 4B44A 1Z3YA 4AU7A 1W36D 2DCEA 3FHNA 3S3MA 2NOJB 2XAUA 3L2QA 3H35A 3SEQA 4BJ5C 3IP4B 2LREA 3KX2A 5CPRB 2ELJA 3K4JA 2W82A 4KJZA 2X51A 4H4KC 3L2VA 3CMMA 1U0JA 1Y6IA 2JVHA 4HSRA 3VYRB 2WB1A 4BUPA 4CCOA 1YX3A 2A5WA 3IUOA 2HZDA 2M7BA 4NNJA 1N78A 4IZZA 1OLTA 4BACA 2HVSA 4CZCA 1E0EA 3S8PA 3EPZA 3MKYB 3DPUA 3NWSA 3PFYA 4G6TB 3K70D 1K6YA 2KMUA 3D5RC 3QYFA 2W7NA 2DOAA 2PJRB 2UWMA 1NG7A 4XOPA 2CH0A 2CFOA 3BCBA 1UAAA 3LSGA 2GOXB 2X1CA 2BW3B 3OWTA 3K10A 4BE1A 2HPMA 3OYCA 4D1QA 5CQEA 4E7IA 3H9JA 2IS4A 3DQVC 4XORA 2UV1A 2X6WA 2M0MA 1WJEA 4BQQA 1MMNA 2E1MB 3FKJA 2CV1A 2V4JC 3HUGB 2R7QA 3DTEA 2MYSA 2VIXA 3OYFA 2WAEA 2A6TA 2KPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XC7 A;  2W4S A; 
#chains in the Genus database with same CATH topology
 2HXO A;  5HS9 A;  2QM3 A;  4UUV A;  2ZKZ A;  2A68 F;  4XLC A;  1AU7 A;  3W6V A;  2P81 A;  2IA1 A;  5J47 A;  2XUB A;  1V5F A;  5JHF A;  2X1D A;  2R7O A;  1Q1H A;  4LLL A;  2FQ3 A;  1ZAR A;  1APL C;  1Z7U A;  3BTC A;  4N4O B;  4UVB A;  1J59 A;  3ZQG A;  1KYZ A;  4DBR A;  4A3L J;  3VOD A;  2HYF A;  3VOE A;  1X19 A;  3DKX A;  1KU9 A;  1WWX A;  1GDT A;  3J81 K;  2R7R A;  5J1Y A;  3PIP F;  2V6C A;  2XC7 A;  1I6H J;  1B6A A;  5E79 C;  3OYE A;  4E7S A;  4ENJ A;  4A93 J;  2Y31 A;  3K4L A;  4HAM A;  4E6K G;  4J00 A;  2ID6 A;  4BHB A;  3VSK A;  3CCR I;  3KPH A;  4PJL A;  1AKH B;  2VXZ A;  3GW2 A;  2NVT J;  5KHD A;  1K4S A;  3PNV A;  4JP0 A;  5K5Q A;  1R1U A;  1FC3 A;  2R7U A;  2X85 A;  5GAE J;  2DQR A;  1JGG A;  3LA2 A;  5FD5 A;  4C9Y A;  1A6Q A;  3OYD A;  5F0F A;  3ERM A;  2BBY A;  1YTY A;  1PJR A;  1KU3 A;  2V1X A;  2JA6 J;  1FYK A;  4A3G J;  1N25 A;  1D0Y A;  3S1M J;  2QKM B;  1PDN C;  3FXQ A;  3AG1 H;  4HLX A;  4PJ0 C;  4ABZ A;  5C3E J;  3WTU C;  5DDG A;  1WSU A;  2LR8 A;  4E7J A;  2OC6 A;  1KQ9 A;  3BDD A;  2L5Q A;  4Y3O A;  4EJV A;  2JUG A;  3H0G J;  2HOA A;  2VQH A;  5D4S A;  4HZF A;  2DK5 A;  1GLN A;  3ZMD A;  2FOK A;  1OPC A;  3M07 A;  2L3D A;  3CCV I;  1KQ0 A;  4A5N A;  4X6A J;  2E2I J;  1BN5 A;  5HLG A;  4GO1 A;  1RR8 C;  2QQB A;  3CCQ I;  4KIC A;  1QHH D;  3VWB A;  4HRI A;  1JHH A;  2E35 A;  2HVQ A;  2FE3 A;  3OOP A;  3PUB A;  3QOD A;  3F0C A;  1HA8 A;  3OV8 A;  5LEK A;  3BR5 A;  3TP3 A;  1FOK A;  3MKZ A;  1XMX A;  2MAB A;  1MSF C;  4F93 B;  5L3D A;  2VC0 A;  4II3 A;  5HDN A;  4OIP F;  3CTA A;  3ECH A;  2L01 A;  1JKR C;  3J80 Z;  4UY8 I;  2PN6 A;  1LNW A;  1SVL A;  5F0C A;  3JRG A;  3UKG A;  3BG7 A;  5JVG F;  3MQ0 A;  4IHX A;  1B1B A;  3DEU A;  3ZN0 A;  2GLO A;  2GZW A;  3G73 A;  3J7A O;  3BLY A;  3LSJ A;  4KT6 A;  5A2Q Z;  4NB5 A;  3JRI A;  3L2U A;  1BIA A;  4BHP A;  3BZC A;  2K9S A;  5LGU A;  2LC2 A;  3PJR A;  3V7S A;  1MKM A;  2L9R A;  4IJA A;  3E6D A;  3DEW A;  2WWY A;  5J4Y A;  4I0A A;  1HLV A;  2Y75 A;  4R1H A;  4XIC A;  1RR7 A;  4A6D A;  4V2F A;  1U8R A;  2R92 J;  1T0F A;  3RTR A;  1IF1 A;  5TGT A;  2M1B A;  1MH3 A;  2E7W A;  3QPT A;  1S7O A;  4XK4 A;  2DA6 A;  2STT A;  4V19 K;  3FXU A;  1VND A;  2V9K A;  4L0Z B;  4YEJ A;  1U9N A;  4KIT B;  1TWF J;  1SEU A;  2FU4 A;  1PYV A;  2XPW A;  5TIS C;  1VZ0 A;  3D5L A;  4EMS A;  1V5G A;  2FBH A;  3F8B A;  3PL8 A;  3WTX C;  1JGS A;  1IUY A;  4BH9 A;  2ZJQ F;  5ILU A;  3B02 A;  4C3H J;  1N77 A;  3BR1 A;  2ZJ2 A;  3MN2 A;  4RLQ A;  3RZO J;  3KCC A;  2P6S A;  2TDX A;  4E7L A;  1W1W E;  3IC7 A;  4YRV A;  1ETX A;  2JMW A;  3K1N A;  5CVU A;  4FAS D;  2LY1 A;  2CV0 A;  4I2O A;  1Y39 A;  2V1U A;  3AL0 C;  1IRX A;  2EK5 A;  1SD7 A;  2KIU A;  4AYB A;  1YFH A;  3RPQ A;  4HOB A;  1KGS A;  3JRF A;  1FEX A;  2DDB A;  5EEG A;  2XV4 S;  3BY6 A;  2R93 J;  3G71 I;  3HOZ J;  4F91 B;  2AHQ A;  2O5R A;  1UJ8 A;  3I55 I;  3DEE A;  2NOG A;  2JPB A;  3BQY A;  1KU7 A;  4KUM A;  3I59 B;  2CFX A;  4P55 A;  1MJB A;  2VKD A;  3ZOB A;  5BS6 A;  3EUA A;  2RN7 A;  2VXD A;  3MWM A;  2B0L A;  3SZG A;  3J81 Z;  2NNN A;  2ZFW A;  1RI7 A;  3WE3 A;  2Z1D A;  3V8K A;  3CC7 I;  2CSO A;  3IWZ A;  3E1S A;  3SYT A;  3PQK A;  4BE2 A;  2UXX A;  4AVZ A;  2F4I A;  3RCO A;  1RRJ A;  1MBG A;  3RJP A;  1ZR2 A;  1XTA A;  1PP7 U;  3CUQ C;  4DW6 A;  3H1C A;  1F36 A;  2DO7 A;  5J4V A;  2CQN A;  2P8T A;  1K78 A;  5LGN A;  1GXQ A;  2LDU A;  1T33 A;  2E36 A;  4M3B A;  2IA0 A;  3JRH A;  5LD2 C;  3BOQ A;  1MNE A;  2P5V A;  2J5O A;  5CVJ A;  2HOE A;  1S5L C;  1Y1V J;  2HKX A;  2XRL A;  4BYY A;  4HNT A;  1FP1 D;  3V8L A;  4HDV A;  4MIM A;  3OOU A;  2QYO A;  3OYJ A;  2G7H A;  4XON A;  3RKQ A;  5FKM A;  3OYI A;  2DTZ A;  1SD5 A;  4AUX A;  4XLH A;  1YRN B;  2K3P A;  2VJ5 A;  1REP C;  1G59 A;  4XLF A;  2VON A;  5GAG J;  1MMG A;  1V4R A;  4GDF A;  1NG6 A;  4FE4 A;  1RUN A;  1ZKG A;  1ZYR F;  1UHW A;  2HNH A;  1MZB A;  1OKR A;  3EUK L;  2XAJ A;  2PQ8 A;  1W5S A;  3RYP A;  3FHZ A;  1B9N A;  4BHC A;  4NQW A;  3FBI B;  2XKP A;  5HLI A;  5CYV A;  1MMS A;  1Z7L A;  1MBE A;  3EQL F;  5E1W A;  1PVE A;  3JRC A;  3GTG J;  2RRE A;  2AQF A;  4XN3 A;  2N8G A;  2JK3 A;  4D5F A;  2F5E A;  2ZXI A;  2DA2 A;  2H6C A;  2E1M C;  2MBF A;  1ORK A;  3R4K A;  5JI6 A;  1GT0 C;  5F6F A;  3ABU A;  3KEY A;  3K69 A;  1JUP A;  2M7A A;  4AIK A;  3WTY C;  1YX5 A;  4Z6Y A;  1IDZ A;  4ON0 A;  2OQG A;  4FTH A;  1K78 B;  3BT9 A;  2OCE A;  3DBR B;  2XGC A;  3HPH A;  1YI2 I;  4AYB N;  3DCF A;  1L3L A;  5IP7 J;  4L5I A;  4IRI A;  2ZXW H;  4CGZ A;  4PJM A;  1SFE A;  1X3W B;  2IAI A;  3PO3 J;  5F1J A;  4RGS A;  3IKT A;  3L2C A;  2HDC A;  3HDD A;  4LJZ F;  1YHQ I;  2GA1 A;  1VTN C;  2GXA A;  2XPV A;  2Z9O A;  2EIJ H;  2L2O A;  1DPU A;  2E60 A;  1VQM I;  1H89 C;  2EA2 A;  3G2B A;  2M4G A;  4ESB A;  2D45 A;  3T1B A;  1QPI A;  3H5A A;  1WJD A;  3O6B B;  3HB9 A;  2HYJ A;  4W97 A;  2KP6 A;  3O3K A;  1BBY A;  4ITV A;  2CQK A;  2YUS A;  1QA6 A;  3H36 A;  2GBY A;  2ZME C;  3CCY A;  2CW8 A;  3CES A;  2VBZ A;  4PJJ A;  3QP5 A;  3CP8 A;  4HV6 A;  4XRS G;  4BXX J;  4XLE A;  1FNN A;  2VE8 A;  4CCL A;  2NS7 A;  4JX6 A;  3C2H A;  2XB0 X;  1F5T A;  1AHD P;  1TBX A;  4G7Z F;  3C7J A;  2WY7 Q;  5FJ8 J;  1HW5 A;  2KL4 A;  1W36 C;  3PM1 A;  2VJJ A;  2R7F A;  2F5D A;  5L3E A;  3BR3 A;  3L2R A;  4IO9 F;  5AIP A;  4FE7 A;  3KP7 A;  2MH2 A;  1RUO A;  3ZQC A;  5HLH A;  3IRQ A;  2X1E A;  3HJE A;  3A2K A;  3CCU I;  4YIF A;  1XG1 A;  2VQC A;  3CDI A;  4HX7 A;  2HQA A;  4ZYA A;  4OWR B;  4RA2 A;  1BW6 A;  4AU7 A;  3EUH A;  4ZYH A;  3ZMS A;  2JA7 J;  2DFI A;  1XSD A;  1XGN A;  2H94 A;  3IRR A;  1P4W A;  2NNY A;  4A6E A;  1B72 A;  2BYV E;  1K61 A;  5EJC A;  1BI3 A;  3U1D A;  3WTT C;  5DCM A;  4AWX B;  1FOX A;  1JJ8 C;  2ACJ A;  3VEP A;  4HQE A;  1BJZ A;  9ANT A;  5FLV A;  1JTY A;  4HSR A;  3VYR B;  2WB1 A;  4LB5 A;  1X3Z B;  2M8G X;  4EJO A;  2LVS A;  3IUO A;  2HR3 A;  2M7B A;  2YX4 A;  5C4X J;  1S7E A;  3FM5 A;  2HVS A;  3TDZ C;  1S8N A;  4RBO A;  4EM1 A;  2W85 A;  3NWS A;  4G6T B;  4ENM A;  2E1C A;  1LFU P;  5IYB J;  3QYF A;  4C3J J;  2ELH A;  2UWM A;  4Y17 A;  1OYY A;  1NG7 A;  2HQR A;  1UAA A;  4HF1 A;  1Y0N A;  2D5V A;  5JFR A;  3LSG A;  5IOZ A;  2BY1 A;  5IOY A;  1IJW C;  2DA7 A;  1XSV A;  2Z99 A;  1BI1 A;  1IW7 F;  1T38 A;  3LSR A;  1DPR A;  1M1E B;  2UV1 A;  4N9I A;  1S29 A;  3ZQH A;  1U6G A;  2PX9 A;  4RGR A;  1A31 A;  1B9M A;  5F64 A;  2BV6 A;  3U2R A;  4F7Z A;  1W0T A;  3RKY A;  2R7Q A;  4HX4 A;  3DTE A;  1U2W A;  3EDP A;  4JYK A;  4M71 A;  3JRD A;  1Q1V A;  3CCE I;  4ZYE A;  2KPM A;  3VPR A;  3ZCO A;  3G1O A;  4Y52 J;  2O6G E;  2ZNZ A;  3BR6 A;  4LG0 A;  2HOT A;  1B72 B;  4RMN A;  1LFP A;  1NTC A;  4QPQ A;  3ABM H;  3MKL A;  3OS0 A;  3IV5 A;  3U1K A;  3JAM K;  4UV8 A;  2QEN A;  3FBN B;  4ANJ A;  1Z91 A;  5DCM B;  5C4J J;  2ELK A;  1IRG A;  4I99 C;  2OQR A;  1X1C A;  2COM A;  4HST A;  2KIM A;  2Y30 A;  4IOC F;  2EV6 A;  3H9G A;  4BJT A;  2XPU A;  1FTT A;  4B3A A;  2TRT A;  3KIO A;  2PEX A;  1NHA A;  1ENH A;  2XGE A;  3F23 A;  2VOO A;  2KQR A;  2XF5 A;  2UZK A;  1C0W A;  2JN6 A;  5C44 J;  3G1L A;  3OIQ A;  1K4T A;  3HG9 A;  5IYC J;  3OYM A;  3ZXS A;  2LF8 A;  3HGY A;  5E3O A;  1I39 A;  2DMU A;  1BM9 A;  4A0X A;  3HOT A;  4A12 A;  2V26 A;  1BOA A;  1OJL A;  2KFD A;  2VBX A;  5L3G A;  5M5Y J;  4XRS A;  4FT8 A;  3DFG A;  5DUK A;  3HKZ N;  2X6X A;  4XBF A;  2Z16 A;  1K79 A;  2LMD A;  5ERI A;  2XSD C;  1BR2 A;  1QHG A;  2ZO4 A;  3AG3 H;  3QRF F;  2DYR H;  2DJI A;  4CA0 A;  2R7D A;  1JE8 A;  5DEQ A;  3J7A Y;  1X58 A;  2F4M B;  3WGG A;  5E3N A;  3UNG C;  2CJJ A;  4JK1 X;  3ISP A;  1YW8 A;  3BCA A;  3AG4 H;  2XB5 A;  4LK1 F;  4LG0 B;  4LIT A;  2DPD A;  2K9N A;  2P5K A;  3M1E A;  3PIO F;  3BJ6 A;  4PZJ A;  3BQZ A;  4OAZ A;  1F1Z A;  2ZB9 A;  3A01 A;  3OL4 A;  1WFX A;  2Q2E A;  3OYK A;  1TNT A;  2ADU A;  5B66 C;  1ITY A;  1YQA A;  4IRG A;  1ODD A;  3K0L A;  3MD2 A;  1EH8 A;  2OF7 A;  1QVT A;  2HTS A;  2V6E A;  3ZRG A;  1IUF A;  2EZK A;  3HEF A;  4CIC A;  2E5N A;  3KET A;  1B8I A;  1DQU A;  3BR0 A;  2FA5 A;  5DM6 F;  2BHZ A;  4PSX A;  2LLK A;  2VB6 A;  3E0J B;  4XM3 A;  5D6E A;  1ZH5 A;  1FOY A;  3GBG A;  4WK8 F;  2BXY A;  5HS7 A;  1LVA A;  4ZJZ A;  1XX5 A;  3GYH X;  3K4M A;  4HF2 A;  3SFI A;  2DLL A;  3D1N I;  1EJ9 A;  3JSP A;  1YE9 A;  1CF7 A;  2HVR A;  1FLI A;  1WPK A;  2MW8 A;  1DDN A;  1D5Y A;  1FJL A;  1ZHF A;  2IBD A;  1IN5 A;  2VC1 A;  2BZT A;  4AM3 A;  3CC2 I;  4DQ2 A;  4IQJ A;  3MMY B;  2ZFU A;  1FY7 A;  1QVU A;  1WI3 A;  3AFH A;  2C6Y A;  1FX7 A;  1JHF A;  2P6T A;  2DFE A;  1H9T A;  1T8I A;  3H3V K;  2EIM H;  4FX0 A;  3BRO A;  2L02 A;  2LTP A;  4Z2Y A;  1WJC A;  5IT9 K;  2EQR A;  4PDK A;  5CVI A;  5F27 A;  2CQ7 A;  1D0Z A;  2OU2 A;  3KP2 A;  3PFI A;  4D7N A;  3FK7 A;  3M1C A;  1S9H A;  2DMP A;  1G3T A;  1E3O C;  3VB2 A;  1V54 H;  1X3U A;  4KNY A;  4PCQ A;  1H9G A;  1V55 H;  3Q0W A;  1X1P A;  2QKL B;  1UB9 A;  2PMZ A;  4HV5 A;  1LFB A;  3E7L A;  1TT0 A;  3GFI A;  4YG2 F;  4UNO A;  2R3S A;  2K40 A;  1FSH A;  2X6Y A;  1B59 A;  4ZC3 A;  5FRO A;  3K4C A;  2ECC A;  3H3Z A;  1ZTR A;  1X4P A;  3A01 B;  3BPV A;  2Q2E B;  4AC0 A;  1QGP A;  1ZRD A;  1OYI A;  4ZTJ A;  3O2P E;  4CUG A;  5BQT A;  3BZ6 A;  1XMK A;  1TW3 A;  3HRM A;  1FYL A;  3PO2 J;  2HDD A;  3S17 J;  5J8C A;  2E2J J;  1JI8 A;  1TT5 B;  1FWZ A;  2NAZ A;  2WTE A;  2V9P A;  3MZY A;  2A3S A;  2RQQ A;  3CUQ A;  2CS3 A;  3H0D A;  3TOA A;  2QQ8 A;  1WJA A;  3VYU B;  4DOZ A;  3R0J A;  2FNA A;  4XRF A;  1FMV A;  4S04 A;  4D5C A;  1D1B A;  2DA4 A;  1WJF A;  3FIW A;  3KP5 A;  4PJN A;  2EWN A;  4GFB A;  4UXN A;  5HOD A;  2JRT A;  4A3E J;  2AO9 A;  5GPA A;  1ZGW A;  5DM7 F;  2EIK H;  3IAS 2;  3LSH A;  3BTJ A;  3BTL A;  1JUM A;  1U78 A;  1E17 A;  2XHK A;  1WJ5 A;  1Z0X A;  4CO8 A;  5HNH A;  1R1T A;  5FKL A;  1VQ4 I;  2ZCW A;  2Q8K A;  3JR9 A;  2EA4 A;  4MQ9 F;  4GYI A;  3JAM Z;  3KFW X;  3WHC A;  4L9J A;  4S05 A;  1TC3 C;  3HOW J;  1XCV A;  6PAX A;  2GOM A;  2MH9 A;  4RS8 A;  2XVC A;  1G3S A;  1X1B A;  4LMY A;  5EEA A;  1T95 A;  1BJA A;  3CUO A;  2QLZ A;  3B6A A;  4QSH A;  3S16 J;  2BW3 A;  2I5U A;  3HOU J;  3NQO A;  3SEZ A;  1TZL A;  4DYC A;  3GTM J;  4GXO A;  2AXT C;  3QOP A;  2R5Z A;  3R60 A;  1SD6 A;  2EV5 A;  2HKO A;  1U5T C;  5TRD A;  2KRC A;  4BBS J;  3G3Z A;  4Y15 A;  2YSR A;  3FXR A;  4N4N B;  4EM0 B;  3LSI A;  3ZMV A;  3T0Y A;  4B47 A;  3PSF A;  1XPX A;  3LFU A;  1UHM A;  3L1P A;  3DU5 A;  3M4O J;  2RDP A;  1A36 A;  5J6X A;  2M4K A;  5B3S H;  3ONQ A;  3TO7 A;  3M8E A;  4N0B A;  1A04 A;  3H5R A;  3L00 A;  2BGC A;  2V1N A;  3TL4 X;  3O8H A;  4KMF A;  1ZAO A;  3HYI A;  1DP3 A;  2F5F A;  3KZI C;  4XKC A;  5H6R A;  3OS1 A;  5GP9 A;  4M6V A;  3JRA A;  2VAS A;  1VQ5 I;  1SAU A;  4JBA A;  3N4M A;  4EVI A;  2FD5 A;  5FRN A;  3LA7 A;  5M3F J;  3Q0V A;  3RYR A;  5HDG A;  3FKI J;  5GTI C;  4PGG A;  4J19 A;  2A5Y B;  2PMZ N;  1G3Y A;  3HHG A;  3H9Q A;  2VL8 A;  4OIR F;  3BJA A;  3TO9 A;  4XLA A;  4LB6 B;  4HPQ A;  2E7X A;  1WH5 A;  2WAD A;  3K6G A;  3O8G A;  5FO5 A;  1OIS A;  4P9U A;  4XKW A;  3QU6 A;  3W6J B;  1YJ9 I;  5FRM A;  3I53 A;  4CXF A;  4HX8 A;  3GLL A;  1J2X A;  4MHG A;  3GME A;  1I5Z A;  3DLL F;  4UB6 C;  2LD5 A;  1QZE A;  1TQI A;  3R6S A;  2HYG D;  2FBK A;  3LNQ A;  2JA8 J;  3H5N A;  5DYM A;  2ZJR F;  3HL2 A;  5K5R A;  2GXB A;  4A3D J;  1SVO A;  2DI3 A;  5IPA A;  3IH2 A;  1VQ6 I;  2BE5 F;  2DA5 A;  2F48 A;  4BE0 A;  2JQ7 A;  2XAF A;  2LH9 A;  1QPM A;  2D1V A;  3P9C A;  3WTV C;  3QAH A;  2STW A;  2QF7 A;  1IZ1 A;  2L7K A;  4B8X A;  4AVP A;  4LG3 A;  4BJ6 C;  4RM2 A;  2IS2 A;  1K83 J;  3TDU C;  3TMO A;  3VFZ A;  2O3F A;  2R7Z J;  3C2B A;  3JCU C;  4IPA A;  5IT9 Z;  2P4W A;  2BEO A;  1ONV A;  1Z05 A;  1ZK8 A;  3SDB A;  2NVX J;  3HOY J;  2IPQ X;  1IN8 A;  1YS7 A;  2IGK A;  2X6O A;  4R8H A;  2BXZ A;  2Y0M A;  4CZZ A;  2L7Z A;  2P0W A;  2GIV A;  1P4A A;  1IXC A;  2KDO A;  3K1P A;  4TV7 A;  2XRO A;  4RM3 A;  4NDL A;  4B1R A;  2E5Z A;  1MMA A;  3T8R A;  2CUE A;  5JVT A;  2LKS A;  2H8W A;  1XDS A;  4M72 A;  3LMM A;  3E6B A;  1HOM A;  1SFK A;  2BOL A;  3DLA A;  1JT0 A;  5H20 A;  5FKN A;  1R1V A;  1KZH A;  2OD5 A;  1Z77 A;  4C2T A;  2YU9 J;  2E71 A;  3TP0 A;  1P7J A;  1RIO H;  1ZEL A;  2PJR A;  1R4N B;  3OSF A;  3BG9 A;  2VLA A;  4LD5 A;  2M34 A;  1OR7 A;  2VQL A;  1P4X A;  2ESH A;  2IP2 A;  2VJI A;  2XDV A;  2MC4 A;  1T56 A;  5M5X J;  3UR3 C;  1EH6 A;  2E34 A;  2HI3 A;  2L9S A;  3RPU D;  3HSR A;  5D8K B;  2W84 A;  3KZY A;  2KJC A;  3E5U A;  3WOD F;  5FLM J;  5EZG A;  3FXJ A;  1WJB A;  4M9Z A;  2DMT A;  2GA2 A;  1OCZ H;  5J3L A;  2ZXH A;  1PUF A;  1TWA J;  2IJL A;  1TQM A;  4XID A;  3RQ4 A;  2ZSI B;  3K2A A;  1TWG J;  2FF4 A;  1QNT A;  3LAJ A;  2K9Q A;  2FMY A;  3WE2 A;  3FHN A;  2EV0 A;  3JW4 A;  1HDD C;  3L2Q A;  1A5J A;  3CLO A;  2EPF A;  3H35 A;  4MGR A;  2PLY A;  3SEQ A;  4BY1 J;  3WGH A;  4IHV A;  3NRV A;  1Y8R B;  5L3C A;  3KX2 A;  2ELJ A;  2K3F A;  5GAH J;  4Q5S F;  3V8J A;  4IRH A;  4KJZ A;  4H4K C;  5D5V B;  2GQQ A;  1I3A A;  2JVH A;  1Y6I A;  4W1U A;  2RC4 A;  4CCO A;  1YS6 A;  5JLW A;  1TLH B;  2HZD A;  3TQN A;  4IZZ A;  3HRU A;  2EZI A;  2OPT A;  4RAG A;  1E0E A;  1LE8 A;  1LB2 A;  1HXD A;  5E3L A;  1RET A;  3S8P A;  3EPZ A;  3MKY B;  1GV2 A;  2HQ5 A;  1D8J A;  1PP8 F;  2AXL A;  2XAS A;  1GHC A;  1K6Y A;  2KMU A;  4O5V A;  2W7N A;  3KLO A;  3MEX A;  4RB1 A;  2NRA C;  3EYY A;  3P9I A;  2PJR B;  3DKW A;  3HTS B;  1H88 C;  2CFO A;  3HM5 A;  3BG3 A;  4ETS A;  4O3M A;  4HLY A;  3OSG A;  4AIJ A;  3H9J A;  2IS4 A;  3TGN A;  2M0M A;  3P7N A;  1MSE C;  3L7W A;  2EFO A;  2KKO A;  1BC8 C;  5E8I A;  2CV1 A;  2DT5 A;  2VBY A;  2OAZ A;  5FLX K;  2V4J C;  4OMZ A;  5EG0 A;  2EIN H;  2KRF A;  2LSO A;  1G2H A;  3CCS I;  1Z6R A;  3KEO A;  2MYS A;  3OYF A;  1SVM A;  3LA3 A;  5BPD A;  2A6T A;  4G6D A;  2VN2 A;  2CGP A;  4HA8 A;  3FM3 A;  3AKZ A;  3ZMT A;  4BNC A;  2CUZ A;  1UST A;  3E5Q A;  2Q1Z B;  3FXM A;  1H0M A;  3SHF A;  3GTK J;  4A3B J;  4X1E A;  1Z67 A;  4G7O F;  1ZLK A;  2K5C A;  1P2F A;  1TTY A;  1WVR A;  2OBP A;  4BBR J;  2MLG A;  1ZR4 A;  2AS5 F;  5LEJ A;  3F72 A;  1A6I A;  2H27 A;  5HDK A;  1DU0 A;  1Z9C A;  4LFU A;  4JX5 A;  4IX7 A;  2QA4 I;  4NBQ A;  2KDZ A;  3BC8 A;  4B4C A;  2D1H A;  3M7G A;  2O8X A;  4B09 A;  4B3X A;  1LE8 B;  3F8F A;  1AWC A;  4IOA F;  2FNP A;  2YU3 A;  2EBI A;  3SZP A;  4KT5 C;  1R5I D;  1FBU A;  1ZRE A;  1ZN2 A;  4NQW B;  2R7S A;  3DTK A;  4PUS A;  1T08 B;  3V7R A;  1SD4 A;  3M3Y J;  3DF8 A;  2EZL A;  4LGW A;  3ELK A;  5B1A H;  1LEA A;  4BQA A;  5ILV A;  1TQP A;  2QBY A;  4A0Y A;  3F9K A;  5EGO A;  1ETV A;  3DV8 A;  1VQO I;  4FIS A;  2IRF G;  1TW2 A;  2ME0 A;  1IO2 A;  1IAW A;  2PBI A;  4QIW N;  2R0Q C;  2MGQ A;  5DTD A;  3CO6 C;  1NK2 P;  2JA5 J;  1G3W A;  1ETY A;  3SFZ A;  4HEA 2;  3GTJ J;  4HBL A;  2MA3 A;  1J09 A;  2A61 A;  2H1L A;  1K6O A;  4MO7 A;  3MFK A;  4WCG A;  2QSH X;  1IGN A;  3HKZ A;  2IW5 A;  2XGX A;  3BR2 A;  2DMN A;  4KN7 X;  1VI0 A;  4MTD A;  3HZJ A;  4EM2 A;  4ZTF A;  1KA8 A;  3VYS B;  1BOB A;  4EQQ A;  3PQJ A;  1ULY A;  2VKV A;  2IGM A;  4CCJ A;  1R49 A;  3SQN A;  3ERE D;  1OFC X;  3CLQ A;  2Z2S B;  3GCM A;  3FDY A;  1JKO C;  2HS5 A;  4UUS A;  3WU1 B;  1K7A A;  2CU7 A;  4XKB A;  3VDX A;  3HC7 A;  3TW7 A;  1W7P A;  5BMZ A;  2VPL A;  3OIO A;  4EV0 A;  3ZR8 X;  3ZN1 A;  2M45 A;  4Y13 A;  3AAF A;  2BVM A;  1IRZ A;  2F5V A;  3GWZ A;  3IH3 A;  5K1Y A;  1FYM A;  3K4B A;  2F5C A;  4L9V A;  2OTJ I;  3GFJ A;  2CUJ A;  4MEX F;  3CZ6 A;  3OY9 A;  4KYW A;  1KU2 A;  3HPG A;  3FXO A;  4IQ4 A;  1ON2 A;  4DZP A;  2QZ8 A;  1O3R A;  2KIF A;  4LLG F;  2F6C A;  3KYL A;  2L54 A;  1E3H A;  4BEH A;  5K7H A;  5TJJ A;  1JJ6 C;  4S0H B;  3W2V A;  2FBI A;  2JPC A;  1J5Y A;  1S7A A;  3AG2 H;  5KK1 A;  5IT3 A;  3J7Y J;  3RIR A;  2Q0O A;  1UFM A;  4IHY A;  2IS1 A;  3QPS A;  2ICW G;  2QBY B;  1HC8 A;  1IV8 A;  3QPL A;  2DK8 A;  2VT2 A;  4MTE A;  1SFU A;  1R23 A;  1R4M B;  1IN7 A;  4E7H A;  3GTP J;  3A0B C;  4HNU A;  2QCO A;  4F52 A;  2BVL A;  2I10 A;  4XSZ F;  1MBF A;  2CO5 A;  2CW0 F;  2FRH A;  1E3P A;  2ID3 A;  2NVQ J;  3OS2 A;  3VYT B;  2I8D A;  1LEB A;  1GV5 A;  2BHY A;  3S3O A;  3E97 A;  3ZMU A;  5CVR A;  2VKE A;  2HDW A;  2DOD A;  5D5W B;  3LSM A;  5K7F A;  3MAJ A;  3ABT A;  1UEL B;  2LY9 A;  1V5E A;  2VKH A;  3G4S I;  2M2E A;  1Z3X A;  4QPO A;  2L7F P;  4G8X A;  5KVR A;  4BXU A;  2K27 A;  1W4M A;  1XDU A;  2ME6 A;  5GAD J;  1EH7 A;  2K9M A;  2R5Y A;  3FZV A;  1FOW A;  1Z1D A;  2XGD A;  3GZ6 A;  1U5T A;  2RV8 A;  4WXH A;  3DTI A;  2WAF A;  2CV2 A;  1XCB A;  4CSW A;  1LKX A;  4ZH4 F;  2R7X A;  1YIJ I;  4BGD A;  1AA7 A;  2QUF A;  3V7C A;  4U87 A;  3CJN A;  3HOS A;  1FBQ A;  1BW5 A;  1FMW A;  2KIQ A;  1STZ A;  3PNY A;  4L5J A;  3NEU A;  4G94 A;  1QRY A;  3GVA A;  1LDD A;  5AIQ A;  2ETH A;  3F3X A;  5FLX Z;  2JVG A;  4DYQ A;  3WGI A;  2EIL H;  1RPW A;  3FMQ A;  4BEH B;  4R79 A;  2XRN A;  3IL2 A;  2CQQ A;  3FF5 A;  2ZC2 A;  4EEF G;  4I7H A;  1ZGA A;  4DGW B;  1A35 A;  4N9H A;  2K85 A;  4CCN A;  1CQT A;  1DP7 P;  1ETK A;  3GF2 A;  2TCT A;  2RAE A;  1F43 A;  4IHS A;  4I0B A;  3W3C A;  3BG6 A;  2RNG A;  1T98 A;  1LJ9 A;  4PGH A;  2IVM A;  3DWL E;  5KNL A;  3CJQ B;  4QLC U;  1GVD A;  5LHG A;  2LKP A;  4UUT A;  4A5M A;  3WG7 H;  4QWQ A;  3N05 A;  2AQE A;  2ZSH B;  3ZQF A;  1XS9 A;  3RQI A;  5ICE A;  3K2Z A;  2OA4 A;  3QWL A;  3QQA A;  1EA3 A;  2WY8 Q;  1IDY A;  3HSF A;  5E3M A;  3KLN A;  2PMH A;  3I54 A;  1FIP A;  2Y2Z A;  3OMY A;  2NVY J;  5D6F A;  4AD9 A;  2PFB A;  2IXS A;  2JTV A;  3I4M J;  1QZZ A;  1RKT A;  2XIG A;  4K2E A;  2DJN A;  2V9V A;  2R4G A;  1O3Q A;  1SAN A;  4NHJ A;  4U7D A;  5J8F A;  3BG5 A;  2FSW A;  3HUG A;  5KAF C;  1O57 A;  2P7C B;  4UV9 A;  3W2A A;  3HRT A;  3JTG A;  3HGG A;  4MNU A;  2QQ9 A;  2GIZ A;  1Y56 A;  3IH4 A;  3LOC A;  4CYC A;  5IP6 A;  4DYR A;  5LRS A;  4XQF A;  2QQA A;  2XAG A;  4KIG A;  3GZN B;  5F04 A;  3R61 A;  4BKX A;  4DBQ A;  2HQN A;  4ZZD A;  2VJ4 A;  4UB8 C;  3E6M A;  3FIS A;  4XRM A;  4HG2 A;  2V7F A;  1LDK B;  4L5E A;  4D9J A;  1BIB A;  3DBH B;  2A69 F;  4M3G A;  4L9T A;  2GWR A;  2L9N A;  3MCZ A;  5E18 F;  4I76 A;  3S2H J;  2JA2 A;  3CP2 A;  4BDY A;  3I9V 2;  2VOD A;  1KYW A;  3GEZ A;  3ZQQ A;  1X4O A;  2X4H A;  4C2U A;  4Q47 A;  2YX7 A;  5GPC A;  3G1M A;  3F8N A;  1DU6 A;  4A2U A;  4FHT A;  1J0R A;  2P5L C;  1O3S A;  4GRI A;  1R5G A;  1F9N A;  4RGU A;  4YIR X;  3KEQ A;  3L9F A;  1MDM A;  2HU9 A;  1Y1W J;  3M9A A;  4MQV A;  4HF0 A;  4EAT A;  5E1X A;  1T6S A;  1UMQ A;  4XLP F;  2LP0 A;  1KON A;  1ZGJ A;  1YW7 A;  2WAQ A;  1OCT C;  3DKY A;  3P5J A;  2GM4 A;  1FT9 A;  3HHH A;  4D7M A;  1WQ2 A;  3OYA A;  1OCR H;  4BXF A;  3FMS A;  5BNG A;  2EFN A;  3EUH C;  4LK0 F;  3JRE A;  4HW0 A;  3ULQ B;  1FSE A;  3I3L A;  2Y9Y A;  3IAM 2;  3CDH A;  2J5P A;  2EFP A;  1B8I B;  1I1G A;  1SMY F;  1U8B A;  1VQ7 I;  3ZP5 A;  5BOX A;  4XN0 A;  5J1U A;  3ML6 A;  1R5H A;  2FML A;  3Q9S A;  4RAF A;  5M3M J;  1Z6T A;  3I64 A;  4B48 A;  5E1Z B;  3V42 A;  1MD0 A;  1CF7 B;  2PI0 A;  4L18 B;  2B7E A;  4LIU A;  2ISY A;  4D0P A;  3F6V A;  2WV1 A;  4M9X A;  1WCM J;  4J01 A;  1F4K A;  1HW1 A;  1RKW A;  1YYV A;  3GTO J;  1ETQ A;  2NS8 A;  3LQQ A;  5FGM A;  5E8G A;  1L0O C;  5B5E C;  4BAY A;  3TOB A;  1MGT A;  3AL0 B;  2HWV A;  3G6E I;  2JWT A;  2H8R A;  1T39 A;  4A3K J;  4KFC A;  2A6H F;  2VT3 A;  5EYR A;  1QU3 A;  5LLQ A;  3W2W A;  4CCM A;  4FET A;  4ASN A;  4XNF A;  3MKW B;  2K4J A;  3BTI A;  4ENN A;  3K4N A;  1MDM B;  3D5S C;  4F3Q A;  5EF6 A;  3OR2 C;  1YO5 C;  4H0E A;  3I4N J;  2LF7 A;  2UUZ A;  3DP7 A;  3OYL A;  2Y69 H;  1VQK I;  2HFH A;  4Q48 A;  3VSL A;  5LHI A;  2DT7 B;  2DDA A;  3B73 A;  3ZQ7 A;  4C30 A;  4ESF A;  4KDP A;  4O6J A;  2DA3 A;  4P96 A;  2DFF A;  5CVV A;  2MC3 A;  2QVO A;  3LAP A;  3L2W A;  5L3B A;  3PNT A;  2IT0 A;  3BWG A;  2EJR A;  4V2G A;  4OIQ F;  4PK4 A;  3OYH A;  1VQ8 I;  1FPQ A;  1YJN I;  4KIS A;  3GUD A;  2O61 A;  1ZG5 A;  2A05 A;  2XKO A;  2DT6 A;  2MFZ A;  5F1R A;  1ZRC A;  2W25 A;  3A0H C;  4B44 A;  1Z3Y A;  3CUQ B;  1W36 D;  2DCE A;  3S3M A;  2NOJ B;  4IHW A;  5D5X B;  3CC4 I;  4BJ5 C;  3WU2 C;  1O3T A;  5CPR B;  4I02 A;  3S14 J;  5ICC A;  3K4J A;  2BY0 A;  2BY3 A;  5ICF A;  2GXG A;  2X51 A;  3WHB A;  3EET A;  2K02 A;  1FBS A;  2WC2 A;  1ZG1 A;  2DBB A;  1U0J A;  1I27 A;  3CMM A;  5FFX A;  2G9W A;  2KZG A;  1NH3 A;  2NS0 A;  2DMQ A;  1YX3 A;  1JT6 A;  2LNB A;  2VPR A;  1R9T J;  3FXK A;  4BAC A;  3J7Z I;  2WAQ N;  4CZC A;  2KIS A;  1ACI A;  4UVA A;  4KA4 A;  1V3F A;  3T8T A;  2DAO A;  3CDL A;  3K70 D;  2ZNY A;  3R0A A;  2JJ7 A;  2EFQ A;  2DOA A;  1I1S A;  4IVN A;  3IKV A;  2E1N A;  2EH3 A;  2JRM A;  4XOP A;  4IF4 A;  4U0W A;  2X9D A;  2VBW A;  4YII A;  2ZME A;  2O9L A;  3S1N J;  2X1C A;  2BW3 B;  4BE1 A;  1IXS B;  2M9H A;  3BJO A;  1R71 A;  3OYC A;  1HST A;  4D1Q A;  4XOR A;  2R5Z B;  2DU9 A;  1W5T A;  1GUU A;  3GFM A;  4RAY A;  1UZC A;  3GO5 A;  1WJE A;  1WRJ A;  4BQQ A;  3K7A J;  2E1M B;  2O7O A;  3FKJ A;  2PJP A;  3ABK H;  1OMI A;  1OCO H;  3HIF A;  3I59 A;  4M3E A;  2O03 A;  2Z5U A;  4YFX F;  5J1R A;  1S6L A;  4RGX A;  5D5U B;  3RKX A;  2VIX A;  2WAE A;  1VQ9 I;  1VQL I;  2QEX I;  2KLO A;  2HXI A;  3ASN H;  3RZD J;  1ON1 A;  2W1O A;  3HRS A;  3L09 A;  5H6Q A;  5D8L B;  3FK6 A;  2OJE D;  1QZY A;  1D1C A;  3P9K A;  1UCR A;  3H3U A;  1I50 J;  3I58 A;  4WF2 A;  5FKK A;  4M6X A;  4UVC A;  2CQX A;  1HKS A;  1XGO A;  2VE9 A;  2WA0 A;  2OTL I;  1WHU A;  1HDP A;  2PMU A;  4WWC A;  1OCC H;  4ZDL A;  3HOX J;  4P1W A;  4NC6 A;  1YW9 A;  4LIV A;  4KIB A;  5FKO A;  3WTS C;  4KIF A;  2KRH A;  4KMU X;  4GCV A;  4P5O A;  2W24 A;  4MEY F;  2DXI A;  5IP9 J;  4JX4 A;  3SXY A;  3BP8 A;  1IV6 A;  1QO0 D;  4IKF A;  4PSW A;  4EGY A;  5E20 A;  3E5X A;  2R7W A;  2O8K A;  4I6Z A;  4II2 A;  1EF4 A;  3MZ8 A;  3K4K A;  2HOS A;  3JSO A;  1YRN A;  5L3F A;  2ZME B;  3TKY A;  3ZMZ A;  5LGT A;  1E2X A;  2ESN A;  4ZZL A;  5JR3 A;  3C2G A;  3CCL I;  1LQ1 A;  4P9F A;  2HGC A;  3I5U A;  1U9O A;  3Q5F A;  3REO A;  3GZ5 A;  3LL7 A;  3I56 I;  4BU2 A;  5EEH A;  1R58 A;  3F22 A;  3S2W A;  2W00 A;  4C2M J;  2DA1 A;  4MLO A;  4M3F A;  1MBH A;  4RLF A;  4BS9 A;  2VI6 A;  1UG2 A;  4U0V A;  4IEJ A;  5IYD J;  1HSJ A;  4OMY A;  1ZG3 A;  5ILS A;  2CMP A;  2L0K A;  3K9T A;  3HBL A;  1SAX A;  1TNS A;  2V1D A;  2WV0 A;  1T2K A;  4XMY A;  4E7Z A;  1GXP A;  1XN7 A;  2RQP A;  2XAQ A;  3V4G A;  3COA C;  2M0C A;  2M87 A;  4CDG A;  2GAU A;  1G8X A;  2LK2 A;  1LDJ A;  4I09 A;  5ED4 A;  4XOT A;  2OV7 A;  2DQL A;  3CJT B;  4U7B A;  3WTW C;  2RGV A;  1SFX A;  2R7V A;  1IRF A;  2DW4 A;  1NK3 P;  3ABL H;  4XKV A;  3F21 A;  1P9Q C;  4AIH A;  2O0Y A;  2XSJ C;  3GX4 X;  1AOY A;  2DOE A;  2DFH A;  5DD8 A;  1SMT A;  4JOM A;  3H92 A;  3KYC B;  3W6K B;  4RB0 A;  2Y9Z A;  5JLX A;  2IGN A;  4C3I J;  1PUE E;  1VF9 A;  1QQI A;  2R7T A;  3X2Q H;  4JQF A;  3OYG A;  1Y8Q B;  2K4B A;  5DCF A;  3A02 A;  3LSP A;  1JUS A;  4G7H F;  1HKQ A;  4OU0 A;  1EKE A;  2PG4 A;  2CYY A;  2MD5 A;  3DXJ F;  1DGW Y;  5CKT A;  5M5W J;  1R36 A;  3RDI A;  3FWE A;  3NWT A;  5KAI C;  2JSC A;  3F6O A;  1N75 A;  1XSX A;  4ZDO A;  3QYE A;  4XR6 A;  1QBJ A;  4MFD A;  3CCJ I;  1MH4 A;  3GXO A;  3KYD B;  4A3J J;  2E1O A;  1IN6 A;  4FQG A;  4BDZ A;  1PUF B;  1KQ8 A;  3RPU A;  4RB2 C;  3SDG A;  5DS9 A;  4ENK A;  1ZLJ A;  2WBM A;  1ETO A;  5HOO A;  1R6R A;  4HYE A;  4DIQ A;  1YIT I;  3F8C A;  3JTH A;  2W57 A;  1LPQ A;  1GVJ A;  1G6N A;  2H1K A;  5D4R A;  3CO7 C;  1D0X A;  1BR4 A;  2D2W A;  4E7K A;  2LFB A;  2QSF X;  4CCK A;  4F92 B;  2F2E A;  3WTZ A;  3E6C C;  3DPT A;  4XL9 A;  4HDU A;  3I71 A;  3ZQI A;  2E19 A;  5CJ9 A;  2RKH A;  3RSN A;  1FP2 A;  1X1A A;  5B1B H;  3ZQL A;  3M8F A;  2XF7 A;  1MNM C;  4FCY A;  3HSE A;  3D0S A;  3NAU A;  3BZK A;  1O7L A;  1SC7 A;  1RC9 A;  5E17 F;  4BQN A;  2FQ4 A;  2M3A A;  5AON A;  4A3F J;  1W7P D;  1IC8 A;  3LWF A;  4LLN A;  5J40 A;  4DJA A;  2V79 A;  1J75 A;  5HLT A;  4EGZ A;  1VQN I;  2FOW A;  1MJ9 A;  1OYW A;  4EJU A;  2W4S A;  5DD4 A;  1BI0 A;  3PSI A;  1JTX A;  2RVC A;  2LG4 A;  4I98 B;  3JRB A;  2M8E A;  5H2F C;  1BL0 A;  1FIA A;  4DNC A;  2OCC H;  1ETW A;  3IWF A;  1S72 I;  3WG9 A;  1USS A;  4QTR A;  1YLF A;  2HTJ A;  2JT1 A;  1XGS A;  3GTQ J;  2COB A;  3FMR A;  3BPX A;  3CMY A;  1OQY A;  2EZH A;  3C1D A;  1T0F C;  3C3W A;  4A0Z A;  3HOV J;  2NYX A;  5EG0 B;  1XMA A;  3NAR A;  2KT0 A;  2Y48 A;  3OYN A;  3ZGK A;  5LRR A;  2HEO A;  3CJR B;  1JKQ C;  1WKM A;  3A4C A;  5F08 A;  1BI2 A;  4ZDP A;  1RES A;  3SJM A;  1IXR C;  2UXN A;  2DPU A;  1TWH J;  3E3V A;  2JSP A;  4B43 A;  4EJW A;  1W0U A;  3S3N A;  1HQC A;  3CF2 A;  2FUG 2;  4RB3 C;  2YR2 A;  1HCR A;  2DOF A;  1B4A A;  2NVU B;  3F8M A;  4M3D A;  2KZV A;  1P92 A;  1POG A;  4ZYG A;  4M74 A;  1LVK A;  4HNV A;  4GYG A;  2A6E F;  2OZ6 A;  2OZU A;  4M6Y A;  5EDN A;  2FX0 A;  2VQG A;  4HQM A;  4ESJ A;  2LKX A;  5LBQ A;  2LBF A;  4Y4R A;  2JUC A;  1O7F A;  3GFL A;  1BC7 C;  2B9S A;  1BA5 A;  1TP4 A;  4BY7 J;  1G4D A;  3A1Y A;  3DPL C;  3FX3 A;  4X0G A;  4OIN F;  1IN4 A;  4BL0 B;  2YPR A;  3K70 C;  3KZZ A;  1XGM A;  5CQG A;  1SFO J;  1R7J A;  2OUM A;  1H8A C;  2QSG X;  4NC7 A;  2LY2 A;  4PFO A;  4M9S A;  3S1Q J;  2LOO A;  2ZBK A;  1EV7 A;  2DYS H;  4LOC A;  3QP6 A;  1R22 A;  2HPI A;  4GGG A;  4PFP A;  4Y33 A;  5GTH C;  3OYB A;  5FFZ A;  4DZJ A;  3C18 A;  1I3Q J;  2H6B A;  1XD7 A;  3ASO H;  3N97 A;  5EGO B;  1ERD A;  3TED A;  4AID A;  5JHU A;  3T5X A;  4A3I J;  3OR1 C;  4U0Y A;  2FEZ A;  3Q9V A;  3CME I;  4L0Y B;  1OR7 C;  4CYD A;  4A3C J;  4U88 A;  4G12 A;  3TBI A;  2L7M P;  2Z33 A;  3TW6 A;  1S3J A;  2H09 A;  4NC8 A;  5DUI A;  4MFE A;  1RNL A;  2NXN B;  1I6X A;  2MD0 A;  2K9L A;  1TWC J;  1HW2 A;  5EZH A;  3QOE A;  1ZQ3 P;  1WH7 A;  5KCM A;  2IGO A;  1CGP A;  3HXL A;  3U21 A;  2IA2 A;  1RZ4 A;  4E4H A;  1J7K A;  5HNF A;  4UUS B;  3DBL B;  2K7L A;  1UG0 A;  4YFN F;  2M30 A;  4KN4 X;  1W7P B;  5DV5 A;  2L4A A;  2KJB A;  3OL3 A;  5K5O A;  5ICG A;  4RAZ A;  1YIO A;  4YEL A;  3K1M A;  2ISZ A;  2LBF B;  3KE2 A;  5IY5 H;  1JKP C;  1MMD A;  4BQO A;  2X0L A;  3CQZ J;  2G7U A;  4OOI A;  2BY2 A;  2L4M A;  3MZH A;  3LQR A;  2A07 F;  1MND A;  2IEK A;  2FXA A;  2XF6 A;  3MVP A;  2CG4 A;  1VFC A;  1MW7 A;  2Y0S A;  4WXC A;  3CF5 F;  1HBX G;  2CW7 A;  3U9G A;  4XSX F;  3LSK A;  1DGR M;  4CHU A;  2Z3Y A;  1YG2 A;  3B6C A;  1D5V A;  2YS9 A;  1OCP A;  1WGX A;  2RNJ A;  2EB7 A;  4G9Y A;  4F55 A;  1JXS A;  1LUJ B;  2IS6 A;  1WZ2 A;  1HF0 A;  2LRD A;  4Q4Z F;  2B63 J;  1Z21 A;  2KHM A;  4WXD A;  3KP6 A;  1BR1 A;  2K86 A;  5LFA A;  2ZJP F;  1VQP I;  4NUB A;  2L9V A;  4OAY A;  3ECO A;  1W5C C;  1MBK A;  2MSY A;  1XC5 A;  2MLK A;  2DTR A;  4WX9 A;  2LYC A;  2W48 A;  2VOP A;  2M5W A;  3DU6 A;  3J80 K;  3S32 A;  3EYI A;  5FB2 A;  1X2M A;  2HZT A;  3KP4 A;  3ESW B;  1X1D A;  3CCM I;  1FZP B;  5K7Z A;  3Q0U A;  3QYB A;  5FD6 A;  3S93 A;  1ZRF A;  3GLX A;  2R5Y B;  4A3M J;  5A2Q K;  5HVQ C;  2FJ1 A;  1U5T B;  3M8J A;  4Y7N J;  3OIP A;  1TL8 A;  4CH7 A;  2F4O B;  2G0E A;  2WB1 N;  1X2N A;  2MG4 A;  2QWW A;  4I01 A;  1IG7 A;  4IHT A;  2DN0 A;  1WI9 A;  2XAH A;  1J9I A;  3PUF A;  2XAU A;  2JZY A;  4FX4 A;  3ZPL A;  3IP4 B;  2ECB A;  2LRE A;  3WU0 A;  3SZT A;  2CWE A;  3TO6 A;  4RDU A;  2W82 A;  2CUF A;  5LHH A;  2X48 A;  3L2V A;  5F0H A;  3A03 A;  3CD6 I;  4YFK F;  4BUP A;  1O4X A;  3ROU A;  3RKW A;  1R00 A;  2A5W A;  4ZYD A;  4IL6 C;  4UHT A;  1N78 A;  4NNJ A;  3I0T A;  1OLT A;  4IXA A;  2VUM J;  3IHU A;  1UHS A;  3S15 J;  3QU3 A;  3HTU A;  3LFK A;  3QPH A;  1AKH A;  3I4P A;  5BPI A;  3DPU A;  5CLS A;  4EJT A;  3PFY A;  3S2D J;  1MIJ A;  1HKT A;  3D5R C;  3KP3 A;  3GTL J;  2P7V B;  1D8K A;  2CH0 A;  4A69 C;  3BCB A;  3S1R J;  3CMA I;  1P6R A;  1MJA A;  1U3E M;  4OIO F;  2EFW A;  2GOX B;  3OWT A;  3K10 A;  3FXL A;  2HPM A;  4E70 A;  4XLN F;  3RI4 A;  5CQE A;  4E7I A;  3DQV C;  1YJW I;  2X6W A;  4M73 A;  4G6Q A;  3LST A;  1Y0U A;  1YOV B;  1P7I A;  1FTZ A;  1MMN A;  1DUX C;  1MBJ A;  2QGU A;  4L9N A;  3HUG B;  1XB4 A;  2E2H J;  2CRG A;  5HS8 A;  3Q3S A;  2ZXJ A;  4CYC B;  1D3Y A;  1D1A A;  2Y0S N; 
#chains in the Genus database with same CATH homology
 3ZCO A;  2KLO A;  4XLC A;  1V5F A;  2W1O A;  5JHF A;  2X1D A;  2R7O A;  3AKZ A;  4RMN A;  2CUZ A;  1LFP A;  1D1C A;  4QPQ A;  2Q1Z B;  3OS0 A;  4N4O B;  3FBN B;  4ANJ A;  4DBR A;  2K5C A;  1X1C A;  4HST A;  1X19 A;  3DKX A;  2WA0 A;  3H9G A;  4BJT A;  2R7R A;  2XC7 A;  4IX7 A;  4ZDL A;  4P1W A;  3OYE A;  4E7S A;  4LIV A;  3BC8 A;  2KRH A;  3K4L A;  4E6K G;  2KQR A;  4J00 A;  2XF5 A;  4P5O A;  3VSK A;  4B3X A;  2DXI A;  4PJL A;  2VXZ A;  3OIQ A;  5KHD A;  3HG9 A;  3PNV A;  4IKF A;  4PSW A;  3OYM A;  4NQW B;  3ZXS A;  2R7U A;  2X85 A;  2R7W A;  2R7S A;  4II2 A;  3DTK A;  4PUS A;  3K4K A;  4C9Y A;  2V26 A;  3OYD A;  3HOT A;  3C2G A;  1PJR A;  2X6X A;  3F9K A;  2Z16 A;  1D1A A;  1BR2 A;  1QHG A;  3LL7 A;  1D0Y A;  2DJI A;  4BU2 A;  2QKM B;  4CA0 A;  2W00 A;  4MLO A;  4E7J A;  4HEA 2;  2OC6 A;  4RLF A;  4BS9 A;  3J7A Y;  2L5Q A;  4Y3O A;  2JUG A;  3UNG C;  1J09 A;  2VQH A;  1GLN A;  3BCA A;  3HKZ A;  2CMP A;  4LIT A;  4ZTF A;  3VYS B;  1BOB A;  4XMY A;  4E7Z A;  1QHH D;  3VWB A;  4HRI A;  4CCJ A;  2IGM A;  4OAZ A;  2HVQ A;  3PUB A;  3QOD A;  3OL4 A;  1HA8 A;  2Z2S B;  1WFX A;  3OYK A;  3FDY A;  1G8X A;  4XOT A;  2OV7 A;  4XKB A;  3MD2 A;  4U7B A;  3VDX A;  3HC7 A;  2VPL A;  3MKZ A;  2V6E A;  3ZRG A;  2R7V A;  2MAB A;  2E5N A;  4XKV A;  3ZR8 X;  1DQU A;  1P9Q C;  4F93 B;  2BVM A;  2XSJ C;  4PSX A;  2F5V A;  4II3 A;  2VB6 A;  4XM3 A;  3E0J B;  4JOM A;  3K4B A;  3GBG A;  3BG7 A;  4ZJZ A;  2CUJ A;  2IGN A;  3K4M A;  3CZ6 A;  3OY9 A;  3HPG A;  4IQ4 A;  1YE9 A;  2HVR A;  2R7T A;  4JQF A;  3OYG A;  3BLY A;  4KT6 A;  4IQJ A;  2F6C A;  3MMY B;  2ZFU A;  3KYL A;  3L2U A;  4BEH A;  3AFH A;  1DGW Y;  5CKT A;  3W2V A;  2LC2 A;  2IS1 A;  3PJR A;  3NWT A;  1N75 A;  4ZDO A;  3QYE A;  4XR6 A;  1WJC A;  4E7H A;  1D0Z A;  4BDZ A;  3M1C A;  1S9H A;  4HNU A;  4F52 A;  2BVL A;  2WBM A;  5HOO A;  1R6R A;  4DIQ A;  3OS2 A;  3VYT B;  2I8D A;  3RTR A;  3S3O A;  2QKL B;  2PMZ A;  5TGT A;  2HDW A;  1D0X A;  1TT0 A;  1BR4 A;  3LSM A;  4E7K A;  2X6Y A;  1UEL B;  4CCK A;  4ZC3 A;  5FRO A;  1V5E A;  4F92 B;  2VKH A;  2V9K A;  3DPT A;  3K4C A;  1Z3X A;  4QPO A;  4XL9 A;  1X4P A;  4YEJ A;  4KIT B;  2Q2E B;  1PYV A;  2K9M A;  4ZTJ A;  3RSN A;  4CUG A;  1VZ0 A;  1X1A A;  3D5L A;  1V5G A;  3PL8 A;  2XF7 A;  3DTI A;  1JI8 A;  2WAF A;  2CV2 A;  4CSW A;  2RQQ A;  3H0D A;  2CS3 A;  1LKX A;  2R7X A;  4BGD A;  1AA7 A;  1N77 A;  1WJA A;  4U87 A;  3VYU B;  4BQN A;  4DOZ A;  3HOS A;  2M3A A;  4RLQ A;  1FMV A;  1FMW A;  1D1B A;  4DJA A;  1WJF A;  4E7L A;  3PNY A;  4YRV A;  5HLT A;  4PJN A;  4FAS D;  2LY1 A;  2CV0 A;  2W4S A;  2JVG A;  3PSI A;  3AL0 C;  1IRX A;  2LG4 A;  4BEH B;  4R79 A;  4AYB A;  3IAS 2;  3LSH A;  4DGW B;  4CCN A;  1WJ5 A;  5HNH A;  4F91 B;  3W3C A;  2O5R A;  3BG6 A;  2RNG A;  3DWL E;  3DEE A;  5KNL A;  3CJQ B;  1T0F C;  2GOM A;  3OYN A;  2VKD A;  2AQE A;  2ZSH B;  3N05 A;  3ZGK A;  1X1B A;  3EUA A;  2VXD A;  3CJR B;  1T95 A;  3A4C A;  3SZG A;  4ZDP A;  1EA3 A;  2WY8 Q;  2Z1D A;  2BW3 A;  3OMY A;  3SEZ A;  2IXS A;  1TZL A;  2JSP A;  4B43 A;  3E1S A;  3SYT A;  3S3N A;  4BE2 A;  3CF2 A;  2FUG 2;  4AVZ A;  2F4I A;  3RCO A;  2R4G A;  2KRC A;  2KZV A;  3W2A A;  4N4N B;  1LVK A;  1Y56 A;  3LSI A;  4B47 A;  4XQF A;  3PSF A;  3LFU A;  5LD2 C;  1MNE A;  2VQG A;  3DU5 A;  2LBF A;  4Y4R A;  4DBQ A;  2M4K A;  4HNT A;  3ONQ A;  2VJ4 A;  3A1Y A;  3DPL C;  3H5R A;  2V7F A;  1LDK B;  4HG2 A;  2V1N A;  3TL4 X;  4D9J A;  3OOU A;  4X0G A;  3OYJ A;  4BL0 B;  3K70 C;  1DP3 A;  2L9N A;  4XON A;  5CQG A;  4XKC A;  2OUM A;  3OS1 A;  3OYI A;  4NC7 A;  2LY2 A;  4PFO A;  2JA2 A;  3CP2 A;  4BDY A;  3I9V 2;  2LOO A;  2VAS A;  4XLH A;  3ZQQ A;  1SAU A;  4C2U A;  1X4O A;  2K3P A;  2HPI A;  2VJ5 A;  4PFP A;  4Y33 A;  5FRN A;  1G59 A;  4XLF A;  3OYB A;  1ERD A;  1MMG A;  3H9Q A;  2VL8 A;  1NG6 A;  4GRI A;  3OR1 C;  4XLA A;  4HPQ A;  2HNH A;  3EUK L;  2WAD A;  1OR7 C;  3K6G A;  4XKW A;  3FBI B;  3TBI A;  1Z7L A;  5FRM A;  2HU9 A;  4NC8 A;  4EAT A;  2RRE A;  2AQF A;  4XN3 A;  1KON A;  2MD0 A;  2K9L A;  2WAQ A;  2ZXI A;  2E1M C;  3DKY A;  3QOE A;  3H5N A;  5KCM A;  3HL2 A;  2IGO A;  3HXL A;  3KEY A;  3U21 A;  3OYA A;  2M7A A;  4E4H A;  4BE0 A;  4BXF A;  5HNF A;  1YX5 A;  2LH9 A;  1UG0 A;  3EUH C;  3I3L A;  2L7K A;  3IAM 2;  4LG3 A;  4BJ6 C;  4RM2 A;  3HPH A;  2IS2 A;  3OL3 A;  3TMO A;  4XN0 A;  4YEL A;  2LBF B;  1MMD A;  4PJM A;  4B48 A;  4BQO A;  3V42 A;  3SDB A;  1MND A;  2XF6 A;  4LIU A;  1MW7 A;  2IGK A;  2Y0S A;  2CW7 A;  3LSK A;  4J01 A;  1DGR M;  2L2O A;  2P0W A;  2E60 A;  2KDO A;  3G2B A;  2M4G A;  4RM3 A;  3H5A A;  3AL0 B;  1WJD A;  4F55 A;  2E5Z A;  1MMA A;  2KP6 A;  2IS6 A;  3LMM A;  1SFK A;  2BOL A;  4ITV A;  3DLA A;  1QU3 A;  3W2W A;  4CCM A;  4FET A;  4XNF A;  3MKW B;  4C2T A;  2CW8 A;  2LRD A;  3CES A;  1Z21 A;  2KHM A;  4PJJ A;  1BR1 A;  3K4N A;  3CP8 A;  5LFA A;  1ZEL A;  4NUB A;  4XLE A;  3D5S C;  4OAY A;  4F3Q A;  2PJR A;  4CCL A;  3OR2 C;  3C2H A;  2VLA A;  2UUZ A;  3OYL A;  2VQL A;  2WY7 Q;  2KL4 A;  2VJI A;  2XDV A;  1W36 C;  2LYC A;  2VJJ A;  2MC4 A;  3VSL A;  3UR3 C;  2DT7 B;  3DU6 A;  2L9S A;  3RPU D;  4C30 A;  3S32 A;  3L2R A;  3L2W A;  3PNT A;  1WJB A;  1X1D A;  4PK4 A;  3OYH A;  2ZXH A;  3QYB A;  3S93 A;  4KIS A;  2X1E A;  5HVQ C;  3A2K A;  2VQC A;  2DT6 A;  2HQA A;  3M8J A;  3RQ4 A;  2MFZ A;  2ZSI B;  4ZYA A;  3OIP A;  4OWR B;  4CH7 A;  4B44 A;  1Z3Y A;  4AU7 A;  1W36 D;  2DCE A;  3FHN A;  3S3M A;  2NOJ B;  2XAU A;  3L2Q A;  3H35 A;  3SEQ A;  4BJ5 C;  3IP4 B;  2LRE A;  3KX2 A;  5CPR B;  2ELJ A;  3K4J A;  2W82 A;  4KJZ A;  2X51 A;  4H4K C;  3L2V A;  3CMM A;  1U0J A;  1Y6I A;  2JVH A;  4HSR A;  3VYR B;  2WB1 A;  4BUP A;  4CCO A;  1YX3 A;  2A5W A;  3IUO A;  2HZD A;  2M7B A;  4NNJ A;  1N78 A;  4IZZ A;  1OLT A;  4BAC A;  2HVS A;  4CZC A;  1E0E A;  3S8P A;  3EPZ A;  3MKY B;  3DPU A;  3NWS A;  3PFY A;  4G6T B;  3K70 D;  1K6Y A;  2KMU A;  3D5R C;  3QYF A;  2W7N A;  2DOA A;  2PJR B;  2UWM A;  1NG7 A;  4XOP A;  2CH0 A;  2CFO A;  3BCB A;  1UAA A;  3LSG A;  2GOX B;  2X1C A;  2BW3 B;  3OWT A;  3K10 A;  4BE1 A;  2HPM A;  3OYC A;  4D1Q A;  5CQE A;  4E7I A;  3H9J A;  2IS4 A;  3DQV C;  4XOR A;  2UV1 A;  2X6W A;  2M0M A;  1WJE A;  4BQQ A;  1MMN A;  2E1M B;  3FKJ A;  2CV1 A;  2V4J C;  3HUG B;  2R7Q A;  3DTE A;  2MYS A;  2VIX A;  3OYF A;  2WAE A;  2A6T A;  2KPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...