2XC7A

Solution structure of phax-rbd in complex with ssrna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
GAMAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords PHOSPHORYLATED ADAPTER RNA EXPORT PROTEIN
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xc7A00
2XC7A 2W4SA
chains in the Genus database with same CATH superfamily
4ENKA 1YS7A 5J4VA 2GIZA 3ASOH 4EM0B 3CC7I 2Z5UA 1R6RA 1A04A 4FQGA 4L5EA 4PFPA 5DCFA 3M4OJ 1S6LA 5F1JA 3ZRGA 5IT3A 2Q2EA 2NXNB 1DGRM 5DD4A 4ZYGA 1HKQA 3VFZA 2W1OA 2L5QA 4I98B 1QVTA 1MNMC 2X0LA 2VQCA 2A61A 2P8TA 4BE1A 2BYVE 3DBLB 2VLAA 5F08A 1YJWI 1O7FA 1HW1A 1R00A 1XN7A 2HWVA 3BR1A 2XGCA 4I76A 3ZQLA 3GLLA 5K5RA 2DT6A 1TQPA 2VPLA 4I99C 4L18B 4HZFA 3VPRA 4RGUA 1H89C 2HOAA 1FOWA 5L3GA 3S1NJ 1SFEA 3L7WA 3LSRA 4BY7J 5JHFA 3DU6A 2BXYA 1EF4A 3DQVC 1P7JA 3F21A 1WJAA 2CO5A 2GLOA 2HOSA 3LSJA 4ITVA 3PUFA 2V1UA 5FKKA 3PFYA 4P5OA 2F4IA 1R1TA 4C3JJ 3EUHA 2DA4A 3BP8A 3HRUA 3I59B 3I4MJ 2XRNA 4BDZA 3MZ8A 2TCTA 2G7HA 4RGRA 4XR6A 1F36A 3WGIA 4IJAA 4B3XA 4II2A 4A2UA 2X51A 2MH9A 4P55A 3T0YA 3WTSC 4L5IA 3OYLA 1JJ8C 1U8BA 1P9QC 1IN8A 5E1WA 2EBIA 2YX4A 2Y9ZA 1K6YA 1J5YA 5CLSA 1WJEA 1A6QA 1Y6IA 5LHGA 6PAXA 3A0HC 4OAYA 4UXNA 2W85A 2O6GE 2K9MA 1ZH5A 1PVEA 3D5LA 4JX4A 3SFIA 4M3GA 5K7ZA 3FK6A 2HTSA 3S14J 1D3YA 2VJIA 2B7EA 1VQNI 4RMNA 4EJVA 5DUKA 1RZ4A 3HOSA 2R7DA 4ON0A 4HV5A 2E1MC 2VASA 1RI7A 3RDIA 2VONA 4DYCA 2OA4A 5GPCA 2IS6A 4AUXA 3I64A 4ETSA 1S7EA 2QCOA 2R5ZB 1FYMA 2KQRA 1FY7A 3WTWC 3HGGA 4GFBA 1D8JA 2KDOA 4ENMA 3Q3SA 4IHWA 1STZA 2CS3A 4LLNA 3A4CA 1U78A 2UWMA 3GZ6A 4V2FA 5ICGA 1WCMJ 1QHGA 1X1AA 4G7HF 2FSWA 3IV5A 1QU3A 1G3SA 1XMAA 1JKOC 3SZGA 2CMPA 3W6JB 4HDUA 2STTA 1DUXC 1BA5A 5AIPA 4AIJA 3TEDA 3R61A 1Z0XA 1BR2A 3NWSA 3VSKA 4PCQA 2R5YB 2ECBA 2V9PA 4AC0A 4CYCB 2E71A 3A2KA 1FOYA 1I3QJ 4IHSA 5FGMA 4BEHA 3DPLC 1QPMA 5F0CA 4XRFA 5L3CA 3Q9SA 3V7RA 2M3AA 3ZQIA 4HF0A 4M72A 2JK3A 1I1GA 4K2EA 2M0MA 2FXAA 1H88C 4E4HA 2IGKA 1IN4A 2Y48A 2V79A 4IRHA 1P4AA 4E7JA 2Z3YA 4HBLA 2NVXJ 3B73A 3R60A 5ICCA 2ZXWH 3WTXC 2M30A 3OYCA 2GXGA 3KLOA 5DYMA 2YUSA 3MKYB 5IP6A 2IA2A 2VL8A 1UG0A 5LRRA 4ANJA 3O6BB 2ZJRF 1PP7U 5FKNA 2BY3A 5F64A 1RKTA 4KMUX 4CZCA 4IOCF 4RDUA 1K83J 1ETVA 4I0BA 1ZK8A 4H4KC 3KX2A 1WJBA 1LDDA 4E7LA 2DA6A 5M3MJ 2K85A 3F8BA 1WRJA 3G73A 2A68F 3I0TA 1R1VA 4YG2F 3GZNB 3MFKA 5BMZA 3AG3H 3WTZA 4DW6A 3ZMVA 2HFHA 3TO7A 4BQNA 3TBIA 1X58A 3CCMI 1A36A 4F93B 2CUZA 1AOYA 1S5LC 3CCEI 3QP5A 2IS1A 3ESWB 5HS8A 2CWEA 2DMNA 2KIMA 4P9UA 3CCVI 3BJ6A 3QOPA 5EJCA 1HLVA 2VQHA 2MLKA 1GUUA 3DP7A 3CCLI 2OCCH 2LVSA 5IYDJ 3OIQA 2OF7A 1O3QA 1SMTA 3ABMH 2VJ4A 2L4AA 3QPSA 3WE2A 2X1CA 3C2HA 1YRNA 1XMKA 2KHMA 4OINF 3E6MA 2R7UA 2DA2A 3O3KA 4IX7A 1USSA 3JTHA 3SXYA 4OAZA 1MDMB 1Z9CA 2F4OB 5IT9Z 1R4NB 1JKQC 2E19A 1UELB 1VQOI 1NHAA 2HVSA 4UVCA 2HU9A 1ENHA 3DEUA 1XDSA 3GF2A 4NC6A 3HHGA 1WZ2A 5LRSA 3J7YJ 4E70A 2BOLA 2X48A 1KZHA 4YIFA 1JUPA 2P7CB 3FKJA 1Y56A 1R49A 4GGGA 2LF7A 2WV0A 3FK7A 3GTMJ 5EGOA 4FT8A 1FJLA 3RSNA 3ABKH 4ZH4F 2XPUA 4OU0A 3H9QA 3V8LA 2IXSA 2HDWA 3RPUD 3QODA 2K9LA 1USTA 3RKXA 3IH3A 4IVNA 3WTUC 4XRMA 4U87A 2YU9J 3PL8A 4LFUA 4Y52J 2CUJA 3ZQQA 4E7ZA 1X1BA 4F52A 2PMZN 2BW3B 4I7HA 3S3OA 1LUJB 2CSOA 3O8GA 5EG0B 4B48A 1T95A 2MC3A 2AQEA 2V1NA 2CFOA 1XMXA 2OZ6A 2IPQX 1ONVA 1PUFA 1A6IA 3OOPA 3CCYA 4ZYEA 3ZN0A 4L9JA 2VQLA 1ZARA 4NDLA 1IRXA 1R9TJ 2R7TA 3ZQGA 2VE8A 2RAEA 3CF2A 1ZRFA 1S7OA 3K9TA 5HDKA 3ML6A 4CCLA 3E5UA 4E7SA 2AXTC 5D5WB 5TISC 4MTEA 4RA2A 4XIDA 2P81A 2NAZA 1VZ0A 3L2WA 2XF5A 3HRTA 3CLQA 1T39A 2YS9A 2VKEA 5D6EA 4E7HA 5J1UA 3WU1B 3JREA 2M5WA 3CMYA 2QLZA 2VBXA 1D5YA 1MBFA 5E18F 4J00A 1IXSB 3UKGA 3F0CA 1ETXA 1B8IB 1VNDA 2Q0OA 1D0XA 2HVQA 3JRBA 3L00A 3CMAI 2IAIA 4S0HB 4ZDOA 4YIRX 2K9QA 3K4MA 3G1OA 1L0OC 2B9SA 2IS4A 1UHSA 3J80Z 3S2DJ 2A5YB 1OISA 3HSEA 2NS8A 1O3SA 2DPUA 1IJWC 4GYGA 4L5JA 3HBLA 5K7FA 2PI0A 2R0QC 1MBEA 3RCOA 2VIXA 1LPQA 3CQZJ 1WHUA 5J8FA 1SEUA 4ENJA 1BL0A 3QU6A 2LY2A 3PQKA 1BJAA 2VBWA 3TDUC 5B1BH 4DQ2A 2L9NA 2O9LA 2ME0A 2BY1A 3CD6I 1W5SA 4BL0B 3CJQB 4KA4A 2KRCA 4DOZA 5HNFA 3CDLA 2VXZA 2FX0A 2ZFWA 3KP3A 2R3SA 1VQ7I 1EJ9A 4D1QA 3ROUA 1FTTA 2ZXHA 2VC0A 4NNJA 3ECHA 2V1XA 3CO7C 3I59A 3FX3A 1G8XA 3GEZA 1V54H 1XSXA 2QQ9A 4D0PA 3S3NA 3FZVA 2ZBKA 5LFAA 2P5LC 3LSHA 4D5CA 3OYKA 2HOTA 4ZJZA 1T56A 3FBIB 3CCJI 2MYSA 2Z16A 3H3UA 1VI0A 3J81K 4KIFA 3K2AA 5CVIA 2J5OA 3W2VA 1VQMI 4KJZA 1TTYA 2QSGX 1LFBA 3ZMTA 2D45A 5F1RA 2HVRA 3PSFA 4RB1A 5F0HA 3IKTA 2NRAC 1ZR2A 3D1NI 1E17A 4BJ5C 1J59A 4IF4A 3KP7A 1ORKA 3FXKA 4M3FA 4RM2A 1QZYA 2EFWA 4BGDA 2XKOA 5JVGF 4Z2YA 3MZHA 5EEAA 4M6XA 2HDDA 1N25A 1H0MA 2ZMEC 4YFXF 4AU7A 1CGPA 2DA5A 2EFQA 2W82A 1VQPI 1V3FA 2R5ZA 3RZOJ 2L9VA 2EFOA 1LDJA 1XGOA 4UB8C 4BHPA 4IEJA 4LOCA 3FHZA 3H9JA 1BN5A 2CUEA 4EM2A 4XOPA 2HOEA 3G71I 2LYCA 3BR5A 1GVJA 3V8JA 2WTEA 3E6CC 2OD5A 2HKXA 3S17J 5KAFC 5HLIA 5EEHA 1W7PB 2ZNYA 3LNQA 5A2QZ 2DA7A 2WAEA 1QPIA 3M7GA 5D5UB 3K1MA 3SEQA 4Y7NJ 3A03A 1Z77A 1JKRC 2EJRA 2WB1N 3E3VA 2CQQA 3Q0VA 2ICWG 3AAFA 3HHHA 3BTIA 2MGQA 3GCMA 3K1PA 1HC8A 3JRCA 4N0BA 4H0EA 3HEFA 1IAWA 2Q8KA 3NAUA 4JBAA 1MD0A 5HODA 2JJ7A 5GP9A 4Z6YA 3G1MA 2JPCA 5FROA 2Y2ZA 1U5TB 1TWCJ 5AONA 2HPMA 5JFRA 1MBJA 2R5YA 2EV5A 4CYCA 4KIGA 4AIKA 2EA2A 4I6ZA 3MVPA 4CH7A 2A05A 3BG7A 3FXOA 1OCRH 1X3UA 1XPXA 1WWXA 4IQ4A 5FLVA 3ZQ7A 2F6CA 3K10A 3WU0A 1FBSA 2PMHA 2DXIA 1OR7C 2ELHA 3CJNA 1VQ6I 4JYKA 5J3LA 3BQYA 4IQJA 4M9SA 1B6AA 2ZJ2A 3ZP5A 3BZ6A 2KIUA 3WTTC 1YW8A 1HW2A 4PZJA 1T0FA 1FLIA 4G94A 3I53A 2COMA 4RAYA 2OAZA 2JUCA 2KZGA 3K70C 1K6OA 2DFIA 2HYJA 4L0YB 1SMYF 4X6AJ 4UVAA 1I50J 4CZZA 1SD7A 3HRSA 1G3WA 2QQAA 4OOIA 1E3OC 2M34A 4UV9A 2LBFB 2XDVA 3HL2A 1LNWA 1GV5A 5B66C 2PJPA 1YQAA 2R92J 2O0YA 2Z1DA 2AO9A 2Z99A 5F0FA 1WH7A 1KU7A 4HRIA 2E5NA 2EK5A 1SANA 3M3YJ 5C3EJ 3H3VK 2CV2A 2MH2A 4QSHA 2CH0A 2OJED 4KISA 1XS9A 2O03A 2VKHA 4CHUA 4XK4A 3GZ5A 2PMZA 3OYGA 3QRFF 3I4PA 4HYEA 2IT0A 2G7UA 5KHDA 4A3KJ 3I56I 2CGPA 3V4GA 3M8EA 5BS6A 3PUBA 4U0WA 3BR6A 4ABZA 2QKLB 3BZKA 1X19A 1V5EA 2DMPA 2QWWA 1G6NA 3JAMZ 3HTSB 1ZLJA 4QIWN 2EIKH 2EILH 2E1MB 2H09A 5IOZA 4MEYF 1HKSA 2P6TA 2C6YA 4XM3A 3K1NA 2E34A 2X6OA 1H9TA 4CGZA 4B3AA 2LG4A 5D5VB 2DOAA 3E1SA 4XLAA 3BR0A 1WH5A 1MIJA 4C2MJ 1Y1VJ 4LJZF 4XONA 1MDMA 4XMYA 1FP2A 4MQVA 1BOAA 3OYHA 5IYCJ 3QPTA 5JVTA 3OYEA 1IN7A 2HXOA 3P9IA 1X3WB 1FC3A 3L2QA 3CJRB 3ZMZA 1RRJA 1ZREA 1YJNI 5ICFA 1TNSA 1Z05A 1ITYA 4R79A 1D0ZA 3F6OA 4MGRA 3AL0C 1ZHFA 1VFCA 1X1DA 2O5RA 1L3LA 4CCNA 2HR3A 1U5TC 2BZTA 3KCCA 4HV6A 3D0SA 4L0ZB 4KDPA 1FBUA 3QPLA 4HSRA 1U9OA 1F4KA 3HOZJ 3LOCA 2F48A 4LB6B 1BM9A 4UUSB 2QGUA 2F5CA 2QZ8A 3DPUA 1FYLA 4KICA 5HLTA 3F8NA 2WY8Q 5LEKA 1UJ8A 1OCOH 5CPRB 2M2EA 1YJ9I 1E2XA 4A0XA 3WTYC 2VT2A 2X6WA 3PSIA 2LOOA 4ZYAA 4AWXB 4WX9A 1ZRCA 1UHMA 4V19K 2BW3A 3Q0UA 3CDIA 4LK0F 5IYBJ 5EG0A 1OCZH 3TL4X 1FZPB 1U6GA 5ED4A 3OYNA 2OUMA 2KMUA 3I9V2 3ZMUA 2CG4A 2JUGA 3RKYA 2XIGA 2HEOA 2FA5A 1N75A 3LSPA 5H6RA 4C3IJ 4OWRB 4HEA2 2KIQA 5KAIC 4F55A 3FM3A 2NVTJ 3CF5F 1JJ6C 1MSFC 1R4MB 1IZ1A 2JA5J 2B63J 2LR8A 2F5DA 5HS9A 3MMYB 1ZR4A 3BG3A 4LIVA 1BC7C 3HTUA 1I5ZA 1C0WA 2VOOA 2X85A 2OBPA 3OYBA 2CFXA 4OIPF 3KYLA 4BHCA 2PN6A 3CUQC 4HDVA 5TRDA 2NOGA 4A6DA 3K2ZA 1FOKA 3IP4B 2DOFA 4XSXF 1RKWA 4PSWA 1B8IA 1MNDA 4G9YA 3GTLJ 2FQ3A 1JHHA 2DAOA 2K9SA 1LE8A 3H36A 4O5VA 3FKIJ 5BPIA 5E17F 2HGCA 2FMLA 2FBIA 1IV6A 4M9ZA 2XPWA 2NS0A 3M1EA 1V55H 3DBRB 4FE4A 1K79A 3SQNA 4RAGA 3U1KA 2EFNA 1IXRC 2ISYA 2QQ8A 4UHTA 5LLQA 4AIDA 5TGTA 3GTPJ 3LQQA 3IUOA 2Z2SB 1Y0NA 4DZJA 2WV1A 3ASNH 4HG2A 1HW5A 1F43A 2XGEA 3U21A 5LBQA 5C44J 4A6EA 3LA3A 3GTJJ 1IDYA 2MABA 3C18A 1T38A 1Z7LA 3I3LA 1MGTA 1TBXA 4XN3A 2HNHA 4BAYA 3FXLA 3BTJA 1VQ9I 2PJRB 3H35A 5M5XJ 2W24A 2FNPA 2XVCA 2FJ1A 4ZYDA 3MN2A 2QA4I 3CUOA 3IKVA 4XQFA 2HS5A 3KEOA 2GA1A 3KP4A 2IVMA 2RN7A 2PEXA 3DBHB 2R7FA 2EB7A 3R6SA 4U7DA 3RZDJ 1BI3A 1BI1A 1K7AA 2D1HA 4S05A 2WY7Q 2WB1A 3P7NA 4BKXA 1DU6A 2D1VA 3D5RC 2ZXIA 2CW8A 1SFUA 3FBNB 1VQ4I 4AIHA 2HQRA 3HUGB 4XORA 3RJPA 3I54A 1D1CA 3HG9A 4LB5A 2F5FA 1JXSA 3C2BA 5FKOA 1W36D 4BHBA 2YU3A 4FHTA 1FNNA 5HS7A 2GOMA 3WU2C 4B47A 4A3MJ 1ETOA 2EWNA 4D7MA 3FISA 4JP0A 4CCOA 2XGXA 3HJEA 3K6GA 4M73A 4DNCA 3ZMSA 5E1XA 2XAGA 3MCZA 9ANTA 1OYWA 2O7OA 4RLFA 1P4WA 2JRMA 3ECOA 4GO1A 1ACIA 2MFZA 5EF6A 3TO6A 1JKPC 3TW7A 3BR3A 3NRVA 4W1UA 3IAS2 1YI2I 4RB3C 1Y0UA 3T8TA 3BLYA 3GTQJ 3W6VA 1K78A 2ZB9A 4M3BA 1JTYA 5FO5A 3WG9A 1GXPA 5E8IA 4D7NA 3K0LA 2IJLA 3RI4A 1OMIA 1SFKA 4GCVA 5GTIC 5M5YJ 3RYPA 4HNUA 5HLHA 5DM7F 3KZYA 2CQKA 3K4JA 1NG6A 2CUFA 2XKPA 1LFPA 1JTXA 4XRSG 2BHYA 2FBHA 4F3QA 3HGYA 3GWZA 2DOEA 4KNYA 1OJLA 1VQ5I 2COBA 2UUZA 2QENA 1W7PA 3CDHA 3UNGC 2KJCA 2IGMA 3H92A 4PJ0C 2CW7A 3ZOBA 1TC3C 1MJAA 3BTCA 5DCMB 5FB2A 1FPQA 1LEBA 3F23A 2DDBA 1X2NA 2F5EA 4C3HJ 2DJNA 5F6FA 2L0KA 2LNBA 2MBFA 4YRVA 1E0EA 2E7XA 1YG2A 2YSRA 4N9HA 2BXZA 3AG2H 3GUDA 1YTYA 3C7JA 3M9AA 2M7AA 4G6TB 4BE0A 3NQOA 4BQAA 1BI0A 2FMYA 1U5TA 1LVAA 5E3NA 3ULQB 2E2HJ 1TNTA 2MG4A 2RQPA 1FT9A 4PFOA 2QUFA 1E3PA 1J75A 1MZBA 1TWAJ 2ZKZA 4NQWB 2KP6A 2LP0A 3L1PA 2ZJPF 1HDDC 1KQ8A 2ELJA 3CLOA 3R0JA 3WHBA 5J1RA 3QAHA 1OPCA 3N97A 3OS2A 1J0RA 5BNGA 3DWLE 3F6VA 3BROA 3KP5A 1W5CC 1ON2A 2W25A 3ZQHA 4EQQA 1W5TA 3H5AA 4JK1X 3SDBA 4A3FJ 4O3MA 2ZFUA 3GBGA 4JOMA 1AKHB 1Z3XA 5E20A 2Y0SN 4JX6A 4R8HA 4A3CJ 5CVRA 2H8RA 1N78A 1B9MA 2MSYA 2E35A 1EV7A 2H27A 4BUPA 3OL3A 4RBOA 4ESFA 2QSFX 1KU2A 1OCTC 4GRIA 2HQAA 2JVHA 3P9KA 2JA8J 4C30A 2V1DA 1TW3A 3ZGKA 2R7QA 5LD2C 1FEXA 2ID3A 3SJMA 2M0CA 2LBFA 4NC8A 1ZN2A 2AXLA 3FXUA 4Q48A 2VOPA 2MC4A 4BJ6C 3K4KA 4HW0A 2PLYA 3LQRA 2A6TA 5DV5A 4HA8A 5FFXA 5B3SH 3LAJA 3I58A 5IT9K 2EH3A 4CDGA 1LB2A 1O4XA 1YS6A 1IF1A 4OMYA 4HX8A 1XGMA 2PQ8A 1VQKI 4PK4A 1WSUA 4XKBA 3H5RA 2EV0A 4BBSJ 2DMUA 3OL4A 2JN6A 2XSDC 1OKRA 3JW4A 2DW4A 4AYBN 4HOBA 3OMYA 3IRRA 1S7AA 4MFDA 1SFXA 2BEOA 2KIFA 2LH9A 1U8RA 2RQQA 3IL2A 3S1RJ 2XAJA 1YW9A 3HSFA 5FJ8J 3MAJA 1MSEC 3CC4I 1TWHJ 2K40A 2KL4A 2ZSHB 2ZMEB 1OQYA 3HC7A 3IH2A 1U2WA 1POGA 2DODA 2KT0A 2VKVA 4I02A 4CXFA 1AU7A 1HQCA 2W84A 2XSJC 5K7HA 1YOVB 3CJTB 2K86A 1SD6A 4MTDA 3RKWA 2W7NA 4FCYA 1DP3A 1YLFA 4G6QA 5EZGA 5IY5H 3TOAA 3TQNA 3DFGA 2VB6A 3OOUA 1RESA 2RNGA 3OR1C 1IXCA 4HX7A 1D5VA 1QRYA 3AFHA 3S8PA 3WG7H 3OYDA 3JRHA 1P6RA 5B5EC 3E97A 5L3BA 2K4BA 3QYBA 1Y8QB 2IGOA 3VYUB 3F8CA 2BV6A 2UXXA 1MMNA 3IAM2 3BG9A 2M9HA 2VPRA 3BG6A 1GHCA 2XAFA 2NOJB 3FF5A 4UUSA 4HF2A 1UHWA 4MFEA 3RIRA 5GAGJ 1DP7P 3BCBA 3SYTA 2Z33A 2UZKA 3D5SC 1I6XA 4IO9F 2IW5A 2XV4S 4ZTFA 3J7AY 1X4PA 1I1SA 2E2IJ 2P5KA 1WI9A 3EDPA 3OR2C 4DBRA 3MEXA 3MKZA 4B1RA 1HKTA 2OTLI 1UCRA 4HQEA 1RR8C 4HQMA 3CZ6A 5H20A 1ZGWA 3G1LA 3FXJA 1QNTA 3GX4X 4M71A 1PP8F 1PDNC 2A07F 1H9GA 1P7IA 2IRFG 2RC4A 1I39A 1TT0A 1G2HA 4ZZLA 3GTKJ 2W4SA 1YITI 3MD2A 1KQ9A 3J80K 3NEUA 3VEPA 2IA1A 3SZPA 1IDZA 3I5UA 1KGSA 2NVUB 1IN6A 4EVIA 5B1AH 4MO7A 1TT5B 3TGNA 1ETQA 2DO7A 4LLLA 3X2QH 5EYRA 2EIMH 2L9RA 1Z67A 4Q5SF 2N8GA 2EZHA 4MQ9F 1XC5A 4O6JA 1IRZA 4L9VA 4G8XA 5FKLA 2LREA 2GXAA 2EINH 2YX7A 2CQ7A 3ISPA 4N4OB 1KYWA 2K3FA 5JLWA 2A69F 3FIWA 2K02A 4M3DA 1REPC 2AHQA 2Y69H 4Q47A 4F92B 2DBBA 5KCMA 1P2FA 2D5VA 1O57A 5HDNA 4XKWA 1X1CA 1R5GA 2FE3A 1SD4A 4U88A 1G59A 5FRNA 2QM3A 4PJMA 5H2FC 2ZCWA 2J5PA 2QBYB 2DMTA 4YFNF 5M5WJ 3I4NJ 1EH6A 2ZO4A 3HIFA 4Y15A 1BC8C 1ZG3A 1BIAA 4GYIA 1RPWA 3DTEA 1TL8A 1G3TA 3K4BA 3LSIA 2RV8A 1FX7A 2DMQA 5BPDA 2WADA 3DXJF 3ZXSA 3KE2A 4CSWA 4U7BA 3K69A 3M1CA 5CVUA 3WHCA 4C2UA 4FTHA 4IXAA 2DA3A 5FKMA 1SAUA 2H6CA 3R4KA 1GT0C 5IPAA 1RNLA 2ZC2A 3WE3A 1NK3P 2O3FA 2PJRA 3FMSA 1BW6A 2DI3A 4L9NA 3LMMA 3EQLF 3S15J 3OS1A 3CP8A 3JSOA 1QBJA 1S3JA 1Z91A 1GXQA 2OQGA 2V4JC 1R5ID 2IA0A 1RR7A 1S9HA 3DKWA 1LFUP 3AL0B 1XTAA 1V5GA 3BZCA 2LKXA 4Y3OA 1P92A 3HPGA 3DKYA 5EZHA 4YFKF 1D1BA 4XSZF 4EMSA 1EH8A 5D8KB 1B1BA 1WJFA 4NB5A 2ISZA 1EA3A 1XX5A 3HUGA 4RAFA 5BOXA 2HYGD 4E7IA 3PM1A 1Y1WJ 2CJJA 4G6DA 3FDYA 2IGNA 2Y30A 2DQRA 2ELKA 3FHNA 1S72I 2STWA 3PIOF 3LFKA 4DBQA 5A2QK 2Y75A 5HOOA 2KKOA 3ZQCA 1ZGJA 2QEXI 1W0UA 5LEJA 5CVVA 2KDZA 5CKTA 1Z6TA 1A35A 2R7WA 2RKHA 5LHHA 3JRGA 1XSVA 1JE8A 5F27A 2A5WA 1UMQA 2ESNA 4BQQA 4DGWB 1HSTA 2VE9A 1E3HA 5JHUA 1ZG1A 1TZLA 3HOYJ 1VQ8I 2R7RA 3TP0A 2VKDA 4XBFA 4LK1F 3KEYA 1TQMA 1R58A 1BW5A 1HA8A 3SZTA 4BH9A 2Y0SA 2EA4A 3DF8A 4X0GA 3H5NA 4BJTA 3K7AJ 2L7KA 3Q9VA 3CESA 1ZGAA 2BGCA 5D4SA 2O61A 1QHHD 1JGSA 4PJNA 1R23A 4LMYA 2CQNA 3IC7A 1IG7A 2GBYA 3VYSB 1XB4A 1IRFA 2I5UA 1Y8RB 2R4GA 3F72A 4CA0A 1WVRA 2XAQA 2H6BA 3E7LA 1FMVA 5DCMA 4E6KG 3CUQB 1TLHB 1O7LA 4BXFA 3DLAA 2F5VA 4A5NA 2VC1A 4I2OA 1XCBA 4HNVA 3M07A 2FEZA 3CCUI 4BYYA 3VWBA 1X4OA 3RTRA 3TKYA 3TOBA 2ACJA 2Z9OA 2DU9A 4QTRA 1GVDA 3WTVC 5KVRA 2DYSH 3K4NA 5FFZA 4A0YA 2FOKA 3CCRI 2R7SA 4AYBA 2X1EA 5KNLA 1X2MA 1XGSA 1ZAOA 4A5MA 4J01A 1FSEA 2OQRA 5ILSA 4NQWA 3QPHA 5F04A 3T1BA 2R7VA 2LK2A 3LFUA 3VODA 3LSGA 1MH3A 4CUGA 5LGNA 3HM5A 2LRDA 1D1AA 2FQ4A 3PNTA 1BR4A 3HOXJ 3MZYA 2HQNA 4PUSA 4WK8F 3PIPF 2GAUA 4A3DJ 4XN0A 3DU5A 3E6BA 3BJOA 2ME6A 1AKHA 3ZPLA 3ONQA 4EJWA 2H1KA 1JI8A 2CW0F 1FIAA 3BPVA 3LA2A 3IRQA 2A3SA 5CVJA 4BBRJ 2L9SA 4BE2A 1YX3A 2DPDA 1BI2A 2KRFA 3JAMK 2JSPA 4EJTA 2LFBA 2ZSIB 4FX0A 3KZIC 1S29A 4PGGA 2D2WA 5E8GA 3QWLA 3B6CA 1OCPA 1FWZA 1MJBA 2W57A 5E1ZB 5HVQC 1U3EM 2VT3A 1RC9A 1G4DA 1W1WE 2LF8A 2IBDA 3HOTA 2WBMA 2P6SA 3CP2A 3ZR8X 1RUNA 3C2GA 2Y0MA 2CRGA 1IV8A 5LGTA 5FD5A 2NS7A 3P5JA 1CF7B 4IKFA 2K4JA 2LY1A 2M4KA 3GYHX 3S1MJ 3REOA 2UXNA 3RQIA 1R22A 4XNFA 4JX5A 1SC7A 2H8WA 2EZLA 3L09A 2M1BA 5ILUA 4G7ZF 3S2HJ 3E5XA 4X1EA 3HOWJ 5HDGA 3L2CA 2EQRA 4BDYA 2DLLA 3R0AA 4PDKA 1AA7A 2ETHA 2FD5A 1YIJI 1TWGJ 4OMZA 2IP2A 1MMSA 3U2RA 3CMEI 2ZXJA 4XL9A 3BC8A 3BG5A 2FOWA 1T6SA 2OCEA 3IHUA 2KJBA 4N9IA 2Y31A 2ZMEA 2BY2A 3PQJA 3GW2A 4IOAF 1Q1VA 1D8KA 1NTCA 3OIPA 3FXRA 2DN0A 3GTOJ 3CO6C 5DD8A 1RIOH 1G3YA 4UUVA 1PYVA 1XDUA 2TRTA 4D5FA 4PJJA 5IP7J 3S93A 1I6HJ 1IGNA 3EUKL 3TMOA 4EGYA 1TW2A 4XLPF 1K61A 4HSTA 2FUG2 1O3RA 1IN5A 4V2GA 3DTIA 2E1OA 1MKMA 4XLFA 3ZMDA 4CICA 3OY9A 3U1DA 2LDUA 5D8LB 3K70D 1Z3YA 3TO9A 4E7KA 2DA1A 3RYRA 5CJ9A 3GFIA 1FTZA 1EKEA 4KFCA 3CCQI 1YO5C 5DTDA 3KPHA 2DTZA 5CQEA 4M3EA 2XGDA 1F5TA 4GDFA 2VJJA 1JT6A 3HSRA 4RLQA 1IUFA 3SFZA 3I55I 4ESBA 4PSXA 1ODDA 4XLEA 3A0BC 3EETA 4IHYA 3DTKA 1ZLKA 4BY1J 2V6EA 4C2TA 2EZKA 4Y13A 1JUSA 1ULYA 2M7BA 4M6YA 1SVOA 1FP1D 1KA8A 4KUMA 3DLLF 2JTVA 3F8MA 5E3LA 4ESJA 1OR7A 4UV8A 2HTJA 2L7MP 4B4CA 4BU2A 3RKQA 3BDDA 1MNEA 2CV1A 2EV6A 2FRHA 4ZDLA 2HKOA 2E1NA 3OYJA 2XASA 4BXXJ 3F3XA 4ASNA 2L2OA 3W6KB 1B9NA 1H8AC 4WXHA 4LD5A 5CYVA 4S04A 4MNUA 3WGHA 4WWCA 4B09A 3LL7A 1SVLA 3L2VA 2DDAA 5GPAA 3Q5FA 3FM5A 5DS9A 1W7PD 2L4MA 3BCAA 5EEGA 1N77A 2VBYA 5KK1A 3JCUC 2PFBA 3WGGA 1WQ2A 3E6DA 3QP6A 3JR9A 3G3ZA 1VF9A 2DTRA 1JUMA 2CYYA 4XLCA 4WXDA 2Y9YA 2GQQA 2JRTA 4UB6C 3PNVA 4BACA 4DJAA 4GXOA 1PJRA 2KLOA 2V26A 4KT5C 5BQTA 5D6FA 2P5VA 4KN4X 4XICA 3OWTA 3GFLA 3OS0A 1RUOA 1MBGA 3GXOA 1Y39A 2GOXB 2NNNA 1FOXA 2XUBA 4A3IJ 4L9TA 2LY9A 3PNYA 3GFMA 2QBYA 4CCMA 4EJOA 4MHGA 4WXCA 1UAAA 2ESHA 2NNYA 1O3TA 1OFCX 2MA3A 4I01A 3VB2A 2DFEA 1ZTRA 3OV8A 4B43A 2Q1ZB 1I27A 2QKMB 3PO3J 4M74A 4XKVA 3TP3A 4P1WA 5J1YA 3BOQA 3HKZN 4AVZA 2JA7J 1Z1DA 2XROA 2I10A 2E1CA 2OV7A 1W0TA 2GA2A 1LEAA 1B72B 4QLCU 5JLXA 1ZRDA 1X1PA 4OIOF 2PG4A 3QQAA 4XOTA 2L7FP 5DDGA 1SD5A 4M6VA 4UNOA 1NK2P 1WJ5A 2OZUA 3OYMA 2JVGA 4RAZA 4Q4ZF 3KEQA 2O8KA 4ZYHA 1ZYRF 3MKLA 1QQIA 4LG0B 1DPUA 4FISA 4U0YA 4EM1A 1MH4A 3UR3C 3O8HA 3JRFA 5GAEJ 1MMAA 1UG2A 3U9GA 3DCFA 4IPAA 5TJJA 1ZG5A 5DUIA 3F8FA 1QA6A 3IWFA 1KQ0A 4RB0A 4DZPA 2VQGA 5K1YA 3M8JA 2EZIA 1RETA 3H9GA 3ERED 4M9XA 1BBYA 3COAC 3BR2A 2QF7A 2F4MB 1MBHA 4XLNF 4RB2C 1BIBA 3L2RA 1Z7UA 2MD5A 3CCSI 1R7JA 1T2KA 4A3GJ 5J6XA 1WFXA 2DK8A 5LGUA 3VOEA 1MW7A 2DT7B 2JMWA 4N4NB 1ETKA 2VI6A 3B6AA 1KU3A 3BQZA 3IWZA 2HPIA 4RGXA 5K5QA 4IZZA 1LJ9A 1YYVA 3ABLH 2EPFA 2KZVA 5FLMJ 2K9NA 3GMEA 2E7WA 3T5XA 4DYQA 2KISA 1SFOJ 2MLGA 5HNHA 3A01B 5E3OA 2ZNZA 2GWRA 3GTGJ 2H94A 3H1CA 4B8XA 4KMFA 4F7ZA 2QVOA 1V4RA 3AKZA 2P7VB 1IO2A 3JRDA 1WKMA 3I71A 2VXDA 5JR3A 1FBQA 1UFMA 3W2WA 4A3JJ 2GIVA 1VQLI 2OU2A 3Q0WA 5DEQA 3SHFA 2JT1A 3EYYA 3F22A 4UY8I 4KIBA 3FXMA 4XLHA 4DIQA 1CQTA 3W3CA 2AS5F 2OC6A 3OSFA 3JRIA 2VBZA 2Q2EB 3BPXA 1UB9A 3OIOA 2WAQA 3C3WA 4RS8A 3ZCOA 2V7FA 2WWYA 4YELA 1X3ZB 2K7LA 1JHFA 3C1DA 4J19A 2V6CA 3VDXA 1JT0A 3CUQA 2R7ZJ 2R7XA 1M1EB 3LAPA 5D4RA 4ZC3A 2CQXA 2RNJA 5LHIA 4IRIA 2DCEA 2YR2A 4AVPA 3QYFA 1T0FC 2O8XA 3E0JB 5M3FJ 5DM6F 2JWTA 2R93J 4FETA 2ID6A 2VUMJ 3KETA 2X4HA 4EEFG 4CYDA 5C4XJ 2TDXA 4HAMA 3O2PE 1J09A 4LGWA 1OLTA 2GZWA 4FX4A 5GAHJ 3CC2I 3GVAA 2RGVA 3ZQFA 4HNTA 2H1LA 2HZDA 2MW8A 3S1QJ 1EH7A 1HDPA 2M4GA 2RREA 2JPBA 2WC2A 2QQBA 4KYWA 1IC8A 1BJZA 2XB5A 4B44A 2OPTA 5FLXZ 3JTGA 1LVKA 3RPUA 4BS9A 2X1DA 2A6EF 4LIUA 2L02A 4FASD 3HOVJ 3LA7A 4YIIA 2QSHX 5C4JJ 1XD7A 3HRMA 2M45A 3ABTA 2GM4A 2BBYA 1T08B 2YPRA 4AD9A 4LITA 5AIQA 4AM3A 5ICEA 1DU0A 1F9NA 3V8KA 3W2AA 1QZEA 2NVQJ 1LE8B 4A3EJ 1XCVA 1WI3A 5J47A 4IHXA 3LSKA 5FRMA 4A69C 4G7OF 1K4SA 1HBXG 2JQ7A 3B02A 3DEWA 4FE7A 2IEKA 5JI6A 4RM3A 1CF7A 1T98A 2HI3A 2E36A 3KLNA 2DYRH 3HDDA 2QYOA 1U9NA 2PBIA 2WAFA 1R5HA 1FMWA 5FLXK 2LMDA 1R71A 4MIMA 2M8EA 3EUAA 3J81Z 3PJRA 1XG1A 5HLGA 3KYCB 1ERDA 4I0AA 1WPKA 1SVMA 3P9CA 3ERMA 2LKSA 3KP6A 3BWGA 3KFWX 4C9YA 4KITB 1YFHA 3JSPA 1T33A 3H3ZA 3GO5A 4NC7A 4XKCA 3OYAA 1LQ1A 1J2XA 4IL6C 2PX9A 3H0DA 3DV8A 1MJ9A 1FYKA 1AWCA 3EYIA 2W48A 2FNAA 4LG3A 3EPZA 2LTPA 2WA0A 3DKXA 3MQ0A 4IHTA 3QOEA 2HYFA 1ZELA 1ETYA 4CCKA 1BOBA 1K4TA 1Z6RA 3DPTA 1SAXA 3S2WA 3ZN1A 3SEZA 4EATA 3S32A 1TP4A 3V7CA 1XGNA 1LDKB 3CMMA 3N05A 4CO8A 2OTJI 3OSGA 5L3DA 4BEHB 2BHZA 3HB9A 4W97A 2JA2A 3HYIA 3J7ZI 1Q1HA 1GLNA 2LC2A 1OYIA 2G9WA 2LLKA 2LSOA 2NVYJ 1YIOA 1YX5A 2X6XA 5GTHC 5ILVA 3G2BA 4QWQA 2VJ5A 1IUYA 4NUBA 3LWFA 4Y17A 4TV7A 4P96A 1A31A 3A02A 2DJIA 2DFFA 3CTAA 2HXIA 2I8DA 1HF0A 3EUHC 4F91B 2HDCA 1U0JA 1JGGA 1MMGA 5D5XB 4WCGA 3VYTB 2RVCA 1QO0D 1HOMA 4KT6A 2XC7A 4A12A 3VYRB 2FU4A 1WJCA 3KP2A 1R1UA 2V9KA 3S3MA 4HPQA 1K78B 1W4MA 4YEJA 1DPRA 4ZDPA 1I3AA 1APLC 5H6QA 2E60A 1HCRA 1WGXA 3QYEA 3T8RA 1DDNA 3DEEA 4Y4RA 1D0YA 5EDNA 1DQUA 4D9JA 1VTNC 3HKZA 1NG7A 2P4WA 3NARA 2L54A 3BY6A 2CU7A 2XHKA 4LLGF 1QGPA 4BNCA 1WJDA 3RQ4A 2JA6J 1YHQI 2G0EA 4R1HA 5IOYA 1ZQ3P 3V42A 2KRHA 1S8NA 4I09A 4CCJA 2FF4A 3H0GJ 2M87A 1YE9A 1QZZA 3A1YA 3BTLA 3MKWB 1TQIA 2BY0A 2LKPA 4BQOA 1XSDA 4A93J 4HLYA 2K5CA 1ETWA 2XAHA 3ABUA 3HOUJ 4PGHA 4BXUA 4U0VA 2VN2A 2L01A 2ECCA 3KYDB 1Z21A 3N4MA 1KYZA 4P9FA 1V5FA 1P4XA 2X9DA 2XRLA 5ERIA 4UVBA 2BE5F 1TWFJ 2GXBA 4EV0A 4A3BJ 4NHJA 4ZTJA 1YRNB 3KIOA 3AG1H 1B59A 2L7ZA 3AG4H 1NH3A 3GFJA 3IH4A 4MLOA 2DK5A 4MEXF 2P0WA 2KPMA 3E5QA 5IP9J 3J7AO 2LD5A 1B4AA 2V9VA 5L3FA 2A6HF 2E2JJ 1J9IA 4IRGA 3OYFA 3SDGA 2XAUA 4ZZDA 4ENNA 1OYYA 4EJUA 1FIPA 2F2EA 3PFIA 3LSMA 1MMDA 2IS2A 1HSJA 1OCCH 2JSCA 4Y33A 3WODF 5EGOB 5J40A 2M8GX 3OYIA 3JRAA 3G4SI 2KFDA 2EIJH 3QU3A 4HF1A 3FWEA 1GV2A 2DT5A 2HZTA 3K4LA 4NBQA 1AHDP 1B72A 1BR1A 2RDPA 3V7SA 4WF2A 2K3PA 2B0LA 5K5OA 1YW7A 4A3LJ 1R36A 4II3A 2K27A 3S16J 3BJAA 3TW6A 4QPQA 3FXQA 3MWMA 2X6YA 4LG0A 2HQ5A 1IRGA 3TDZC 4KN7X 4A0ZA 2ADUA 5J4YA 3ELKA 3VSLA 5J8CA 2JZYA 1KONA 4RGSA 4EGZA 2AQFA 1PUEE 2NYXA 2FBKA 4JQFA 3FMQA 1FSHA 2XF7A 4QPOA 1PUFB 1HXDA 2E5ZA 1LKXA 2L3DA 2ZJQF 3LSTA 3PO2J 4IHVA 3M8FA 3HZJA 4HLXA 2R7OA 1T8IA 5GADJ 4OIRF 1KU9A 3G6EI 4UUTA 3HPHA 1MBKA 1F1ZA 2XB0X 5L3EA 4PJLA 4OIQF 5E3MA 3F9KA 3L2UA 2BVLA 2PMUA 3KZZA 4G12A 2VODA 1W36C 2EFPA 2BVMA 2UV1A 1J7KA 3BT9A 1ON1A 3L9FA 3A01A 1QVUA 3FMRA 5CQGA 3HXLA 1DGWY 1ZKGA 3K4CA 1IW7F 2DQLA 2W00A 4XRSA 5FD6A 1GDTA 5E79C 3NWTA 2XF6A 2CV0A 3GLXA 1UZCA 4HX4A 2MD0A 2XPVA 4DYRA 3RPQA 2WAQN 2DFHA 1A5JA
chains in the Genus database with same CATH topology
2KLOA 2V26A 3OMYA 2LH9A 1R6RA 2RQQA 4XOPA 4PFPA 3OWTA 3OS0A 2WAEA 3ZRGA 2GOXB 2KL4A 2ZSHB 3SEQA 1DGRM 3HC7A 2W1OA 2L5QA 3PNYA 4BE1A 2VQCA 2XSJC 4CCMA 2VLAA 1UAAA 2W7NA 1DP3A 2DT6A 2VPLA 2VB6A 3OOUA 4B43A 2Q1ZB 2QKMB 5FROA 3OR1C 2RNGA 2HPMA 4XKVA 4P1WA 3AFHA 3S8PA 3OYDA 4AVZA 3QYBA 5JHFA 2OV7A 3DU6A 2IGOA 4CH7A 3BG7A 3DQVC 3VYUB 4XOTA 4IQ4A 1WJAA 2F6CA 3K10A 2DXIA 1MMNA 1WJ5A 3IAM2 4ITVA 1OR7C 3BG6A 3OYMA 3PFYA 4P5OA 2F4IA 2NOJB 2JVGA 4IQJA 3BCBA 3SYTA 4BDZA 3D5SC 4ZTFA 3UR3C 1X4PA 3J7AY 4XR6A 1MMAA 4B3XA 4II2A 2X51A 3OR2C 4DBRA 3OYLA 2VQGA 3MKZA 3M8JA 1P9QC 3K70C 3H9GA 3CZ6A 1K6YA 1WJEA 1Y6IA 4OAYA 1TT0A 3L2RA 1WFXA 2K9MA 2LBFB 2XDVA 2W4SA 3D5LA 3MD2A 3HL2A 1MW7A 2DT7B 4N4NB 2VJIA 2Z1DA 2HPIA 4IZZA 4RMNA 4HRIA 2E5NA 3HOSA 2KZVA 2E1MC 2VASA 2CV2A 5HNHA 2CH0A 4KISA 2IS6A 2VKHA 3AKZA 2LREA 2PMZA 2KQRA 3OYGA 4N4OB 5KHDA 2KDOA 2VXDA 2CS3A 3W2WA 3PUBA 2QKLB 3A4CA 2UWMA 1X19A 1V5EA 4F92B 5KCMA 4XLHA 2E1MB 4DIQA 3W3CA 1QHGA 4XKWA 1X1AA 2OC6A 1X1CA 4XM3A 1G59A 5FRNA 2Q2EB 4PJMA 1QU3A 2LG4A 2WAQA 2DOAA 3E1SA 2V7FA 3ZCOA 4XLAA 4YELA 3SZGA 2CMPA 4XONA 3VDXA 4XMYA 2R7XA 3OYHA 3DTEA 3OYEA 3K4BA 3LSIA 4ZC3A 3L2QA 3CJRB 2WADA 3ZXSA 4CSWA 1BR2A 2DCEA 3NWSA 3VSKA 4U7BA 3M1CA 1D0ZA 4R79A 3AL0C 3A2KA 1X1DA 3QYFA 2O5RA 1T0FC 3E0JB 4CCNA 4C2UA 1SAUA 4FETA 3DPLC 4BEHA 2M3AA 4HSRA 2PJRA 3LMMA 2M0MA 3OS1A 3CP8A 1J09A 4E4HA 1OLTA 2IGKA 3DPUA 2V4JC 5HLTA 4HNTA 2HZDA 4E7JA 2WY8Q 1S9HA 2M4GA 5CPRB 3AL0B 2RREA 1V5GA 2X6WA 4ZYAA 3PSIA 2LOOA 4Y3OA 3OYCA 3HPGA 3DKYA 1D1BA 3MKYB 4B44A 2BW3A 1WJFA 1LVKA 2VL8A 1UG0A 4BS9A 1EA3A 2X1DA 4LIUA 4ANJA 4FASD 3TL4X 4E7IA 3OYNA 2OUMA 3FDYA 4CZCA 2IGNA 2KMUA 3FHNA 3I9V2 2JUGA 4H4KC 4LITA 4DBQA 3KX2A 1WJBA 1N75A 5HOOA 4E7LA 3W2AA 5CKTA 4OWRB 4HEA2 4F55A 2R7WA 5FRMA 3LSKA 2A5WA 4BQQA 4DGWB 3MMYB 3TBIA 4BQNA 4F93B 2CUZA 4LIVA 1TZLA 4RM3A 2R7RA 2IS1A 2VKDA 2X85A 3KEYA 3OYBA 1HA8A 2WAFA 2Y0SA 1FMWA 2VQHA 3KYLA 3EUAA 4X0GA 3PJRA 3H5NA 4BJTA 2L7KA 1ERDA 3IP4B 3CESA 1QHHD 4PSWA 4PJNA 1MNDA 3OIQA 3VYSB 4KITB 4C9YA 2VJ4A 2X1CA 3C2HA 2R4GA 2KHMA 2R7UA 4NC7A 4CA0A 4XKCA 3OYAA 4IX7A 3H0DA 1FMVA 4OAZA 4E6KG 4LG3A 3EPZA 4BXFA 3DLAA 1UELB 2F5VA 2WA0A 3DKXA 2HVSA 2HU9A 3QOEA 1ZELA 4CCKA 1BOBA 3DPTA 5TGTA 3VWBA 1X4OA 2BOLA 2Z2SB 3IUOA 3RTRA 3SEZA 4HG2A 4EATA 3S32A 3FKJA 1Y56A 3CMMA 1LDKB 3N05A 3U21A 3K4NA 2MABA 4BEHB 2R7SA 1Z7LA 3I3LA 4AYBA 4XN3A 3RSNA 2HNHA 2JA2A 2X1EA 5KNLA 1GLNA 2LC2A 4J01A 2PJRB 3H35A 2X6XA 1YX5A 3G2BA 3H9QA 2IXSA 2VJ5A 4NUBA 2HDWA 2R7VA 3RPUD 3QODA 2K9LA 3LFUA 4XQFA 3LSGA 2DJIA 2I8DA 4CUGA 2LRDA 3EUHC 4F91B 1D1AA 3PNTA 4U87A 1BR4A 3PL8A 1U0JA 4PUSA 2CUJA 1MMGA 3ZQQA 2WY7Q 2WB1A 3VYTB 4E7ZA 1X1BA 4XN0A 4F52A 4KT6A 2XC7A 3S3OA 2BW3B 3D5RC 3DU5A 2ZXIA 3VYRB 1WJCA 2CW8A 3ONQA 1JI8A 3FBNB 2V9KA 3S3MA 4HPQA 4B48A 1T95A 3HUGB 4XORA 4YEJA 2AQEA 2V1NA 4ZDPA 1D1CA 2CFOA 3HG9A 2E60A 2L9SA 4BE2A 1W36D 1YX3A 3QYEA 2GOMA 3DEEA 4Y4RA 4B47A 1D0YA 1DQUA 2JSPA 2ZSIB 4D9JA 3HKZA 4CCOA 3K6GA 1NG7A 2VQLA 5HVQC 1IRXA 4RLFA 1WJDA 2R7TA 3RQ4A 3CF2A 2MFZA 4CCLA 3HOTA 4E7SA 2WBMA 3V42A 3CP2A 3IAS2 3ZR8X 3C2GA 2KRHA 4CCJA 3BLYA 1VZ0A 3L2WA 2XF5A 4IKFA 1YE9A 3A1YA 3MKWB 2LY1A 2M4KA 4BQOA 1SFKA 2K5CA 4XNFA 4E7HA 4HNUA 4J00A 1Z21A 3K4JA 1NG6A 1V5FA 4BDYA 1LFPA 1D0XA 2HVQA 1AA7A 4F3QA 4ZDOA 2UUZA 3K4MA 4ZTJA 2IS4A 3UNGC 4XL9A 3BC8A 2IGMA 2CW7A 4MLOA 2P0WA 3OIPA 2KPMA 4YRVA 3RCOA 1E0EA 2VIXA 3OYFA 1PYVA 2XAUA 2M7AA 4PJJA 2LY2A 4G6TB 3S93A 3EUKL 3TMOA 4BE0A 3LSMA 4HSTA 2FUG2 1MMDA 2IS2A 4Y33A 3OYIA 2L9NA 3DTIA 4XLFA 4BL0B 3OY9A 3CJQB 4PFOA 3K4LA 2KRCA 4DOZA 4NQWB 5HNFA 2KP6A 1BR1A 2ELJA 2VXZA 3K70D 1Z3YA 4E7KA 2K3PA 4D1QA 3OS2A 2ZXHA 4NNJA 4II3A 3DWLE 4QPQA 5CQEA 2VJJA 2X6YA 1G8XA 3H5AA 3SDBA 4RLQA 2ZFUA 3GBGA 4JOMA 3S3NA 4PSXA 5LFAA 3VSLA 3LSHA 1Z3XA 4XLEA 3OYKA 1KONA 4ZJZA 3DTKA 1N78A 2V6EA 4C2TA 3FBIB 2AQFA 2M7BA 2MYSA 2Z16A 4JQFA 2XF7A 4BUPA 3OL3A 4QPOA 2E5ZA 3W2VA 1LKXA 4KJZA 4GRIA 2HQAA 4BU2A 2JVHA 1MNEA 2CV1A 2R7OA 4C30A 4ZDLA 3ZGKA 2R7QA 5LD2C 2HVRA 3PSFA 2LBFA 3OYJA 3HPHA 4NC8A 2L2OA 4BJ5C 2MC4A 4BJ6C 4PJLA 3K4KA 3F9KA 3L2UA 2BVLA 2A6TA 4RM2A 4BGDA 1W36C 2BVMA 3LL7A 2UV1A 3L2VA 4PK4A 4XKBA 3H5RA 5CQGA 3HXLA 1DGWY 4AU7A 2W82A 3K4CA 3BCAA 1N77A 2W00A 3OL4A 3NWTA 2XF6A 2CV0A 4XLCA 3H9JA 2MD0A 3PNVA 4BACA 4DJAA 1PJRA 2LYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XC7 A;  2W4S A; 
#chains in the Genus database with same CATH topology
 4ENK A;  1YS7 A;  5J4V A;  2GIZ A;  3ASO H;  4EM0 B;  3CC7 I;  2Z5U A;  1R6R A;  1A04 A;  4FQG A;  4L5E A;  4PFP A;  5DCF A;  3M4O J;  1S6L A;  5F1J A;  3ZRG A;  5IT3 A;  2Q2E A;  2NXN B;  1DGR M;  5DD4 A;  4ZYG A;  1HKQ A;  3VFZ A;  2W1O A;  2L5Q A;  4I98 B;  1QVT A;  1MNM C;  2X0L A;  2VQC A;  2A61 A;  2P8T A;  4BE1 A;  2BYV E;  3DBL B;  2VLA A;  5F08 A;  1YJW I;  1O7F A;  1HW1 A;  1R00 A;  1XN7 A;  2HWV A;  3BR1 A;  2XGC A;  4I76 A;  3ZQL A;  3GLL A;  5K5R A;  2DT6 A;  1TQP A;  2VPL A;  4I99 C;  4L18 B;  4HZF A;  3VPR A;  4RGU A;  1H89 C;  2HOA A;  1FOW A;  5L3G A;  3S1N J;  1SFE A;  3L7W A;  3LSR A;  4BY7 J;  5JHF A;  3DU6 A;  2BXY A;  1EF4 A;  3DQV C;  1P7J A;  3F21 A;  1WJA A;  2CO5 A;  2GLO A;  2HOS A;  3LSJ A;  4ITV A;  3PUF A;  2V1U A;  5FKK A;  3PFY A;  4P5O A;  2F4I A;  1R1T A;  4C3J J;  3EUH A;  2DA4 A;  3BP8 A;  3HRU A;  3I59 B;  3I4M J;  2XRN A;  4BDZ A;  3MZ8 A;  2TCT A;  2G7H A;  4RGR A;  4XR6 A;  1F36 A;  3WGI A;  4IJA A;  4B3X A;  4II2 A;  4A2U A;  2X51 A;  2MH9 A;  4P55 A;  3T0Y A;  3WTS C;  4L5I A;  3OYL A;  1JJ8 C;  1U8B A;  1P9Q C;  1IN8 A;  5E1W A;  2EBI A;  2YX4 A;  2Y9Z A;  1K6Y A;  1J5Y A;  5CLS A;  1WJE A;  1A6Q A;  1Y6I A;  5LHG A;  6PAX A;  3A0H C;  4OAY A;  4UXN A;  2W85 A;  2O6G E;  2K9M A;  1ZH5 A;  1PVE A;  3D5L A;  4JX4 A;  3SFI A;  4M3G A;  5K7Z A;  3FK6 A;  2HTS A;  3S14 J;  1D3Y A;  2VJI A;  2B7E A;  1VQN I;  4RMN A;  4EJV A;  5DUK A;  1RZ4 A;  3HOS A;  2R7D A;  4ON0 A;  4HV5 A;  2E1M C;  2VAS A;  1RI7 A;  3RDI A;  2VON A;  4DYC A;  2OA4 A;  5GPC A;  2IS6 A;  4AUX A;  3I64 A;  4ETS A;  1S7E A;  2QCO A;  2R5Z B;  1FYM A;  2KQR A;  1FY7 A;  3WTW C;  3HGG A;  4GFB A;  1D8J A;  2KDO A;  4ENM A;  3Q3S A;  4IHW A;  1STZ A;  2CS3 A;  4LLN A;  3A4C A;  1U78 A;  2UWM A;  3GZ6 A;  4V2F A;  5ICG A;  1WCM J;  1QHG A;  1X1A A;  4G7H F;  2FSW A;  3IV5 A;  1QU3 A;  1G3S A;  1XMA A;  1JKO C;  3SZG A;  2CMP A;  3W6J B;  4HDU A;  2STT A;  1DUX C;  1BA5 A;  5AIP A;  4AIJ A;  3TED A;  3R61 A;  1Z0X A;  1BR2 A;  3NWS A;  3VSK A;  4PCQ A;  2R5Y B;  2ECB A;  2V9P A;  4AC0 A;  4CYC B;  2E71 A;  3A2K A;  1FOY A;  1I3Q J;  4IHS A;  5FGM A;  4BEH A;  3DPL C;  1QPM A;  5F0C A;  4XRF A;  5L3C A;  3Q9S A;  3V7R A;  2M3A A;  3ZQI A;  4HF0 A;  4M72 A;  2JK3 A;  1I1G A;  4K2E A;  2M0M A;  2FXA A;  1H88 C;  4E4H A;  2IGK A;  1IN4 A;  2Y48 A;  2V79 A;  4IRH A;  1P4A A;  4E7J A;  2Z3Y A;  4HBL A;  2NVX J;  3B73 A;  3R60 A;  5ICC A;  2ZXW H;  3WTX C;  2M30 A;  3OYC A;  2GXG A;  3KLO A;  5DYM A;  2YUS A;  3MKY B;  5IP6 A;  2IA2 A;  2VL8 A;  1UG0 A;  5LRR A;  4ANJ A;  3O6B B;  2ZJR F;  1PP7 U;  5FKN A;  2BY3 A;  5F64 A;  1RKT A;  4KMU X;  4CZC A;  4IOC F;  4RDU A;  1K83 J;  1ETV A;  4I0B A;  1ZK8 A;  4H4K C;  3KX2 A;  1WJB A;  1LDD A;  4E7L A;  2DA6 A;  5M3M J;  2K85 A;  3F8B A;  1WRJ A;  3G73 A;  2A68 F;  3I0T A;  1R1V A;  4YG2 F;  3GZN B;  3MFK A;  5BMZ A;  3AG3 H;  3WTZ A;  4DW6 A;  3ZMV A;  2HFH A;  3TO7 A;  4BQN A;  3TBI A;  1X58 A;  3CCM I;  1A36 A;  4F93 B;  2CUZ A;  1AOY A;  1S5L C;  3CCE I;  3QP5 A;  2IS1 A;  3ESW B;  5HS8 A;  2CWE A;  2DMN A;  2KIM A;  4P9U A;  3CCV I;  3BJ6 A;  3QOP A;  5EJC A;  1HLV A;  2VQH A;  2MLK A;  1GUU A;  3DP7 A;  3CCL I;  2OCC H;  2LVS A;  5IYD J;  3OIQ A;  2OF7 A;  1O3Q A;  1SMT A;  3ABM H;  2VJ4 A;  2L4A A;  3QPS A;  3WE2 A;  2X1C A;  3C2H A;  1YRN A;  1XMK A;  2KHM A;  4OIN F;  3E6M A;  2R7U A;  2DA2 A;  3O3K A;  4IX7 A;  1USS A;  3JTH A;  3SXY A;  4OAZ A;  1MDM B;  1Z9C A;  2F4O B;  5IT9 Z;  1R4N B;  1JKQ C;  2E19 A;  1UEL B;  1VQO I;  1NHA A;  2HVS A;  4UVC A;  2HU9 A;  1ENH A;  3DEU A;  1XDS A;  3GF2 A;  4NC6 A;  3HHG A;  1WZ2 A;  5LRS A;  3J7Y J;  4E70 A;  2BOL A;  2X48 A;  1KZH A;  4YIF A;  1JUP A;  2P7C B;  3FKJ A;  1Y56 A;  1R49 A;  4GGG A;  2LF7 A;  2WV0 A;  3FK7 A;  3GTM J;  5EGO A;  4FT8 A;  1FJL A;  3RSN A;  3ABK H;  4ZH4 F;  2XPU A;  4OU0 A;  3H9Q A;  3V8L A;  2IXS A;  2HDW A;  3RPU D;  3QOD A;  2K9L A;  1UST A;  3RKX A;  3IH3 A;  4IVN A;  3WTU C;  4XRM A;  4U87 A;  2YU9 J;  3PL8 A;  4LFU A;  4Y52 J;  2CUJ A;  3ZQQ A;  4E7Z A;  1X1B A;  4F52 A;  2PMZ N;  2BW3 B;  4I7H A;  3S3O A;  1LUJ B;  2CSO A;  3O8G A;  5EG0 B;  4B48 A;  1T95 A;  2MC3 A;  2AQE A;  2V1N A;  2CFO A;  1XMX A;  2OZ6 A;  2IPQ X;  1ONV A;  1PUF A;  1A6I A;  3OOP A;  3CCY A;  4ZYE A;  3ZN0 A;  4L9J A;  2VQL A;  1ZAR A;  4NDL A;  1IRX A;  1R9T J;  2R7T A;  3ZQG A;  2VE8 A;  2RAE A;  3CF2 A;  1ZRF A;  1S7O A;  3K9T A;  5HDK A;  3ML6 A;  4CCL A;  3E5U A;  4E7S A;  2AXT C;  5D5W B;  5TIS C;  4MTE A;  4RA2 A;  4XID A;  2P81 A;  2NAZ A;  1VZ0 A;  3L2W A;  2XF5 A;  3HRT A;  3CLQ A;  1T39 A;  2YS9 A;  2VKE A;  5D6E A;  4E7H A;  5J1U A;  3WU1 B;  3JRE A;  2M5W A;  3CMY A;  2QLZ A;  2VBX A;  1D5Y A;  1MBF A;  5E18 F;  4J00 A;  1IXS B;  3UKG A;  3F0C A;  1ETX A;  1B8I B;  1VND A;  2Q0O A;  1D0X A;  2HVQ A;  3JRB A;  3L00 A;  3CMA I;  2IAI A;  4S0H B;  4ZDO A;  4YIR X;  2K9Q A;  3K4M A;  3G1O A;  1L0O C;  2B9S A;  2IS4 A;  1UHS A;  3J80 Z;  3S2D J;  2A5Y B;  1OIS A;  3HSE A;  2NS8 A;  1O3S A;  2DPU A;  1IJW C;  4GYG A;  4L5J A;  3HBL A;  5K7F A;  2PI0 A;  2R0Q C;  1MBE A;  3RCO A;  2VIX A;  1LPQ A;  3CQZ J;  1WHU A;  5J8F A;  1SEU A;  4ENJ A;  1BL0 A;  3QU6 A;  2LY2 A;  3PQK A;  1BJA A;  2VBW A;  3TDU C;  5B1B H;  4DQ2 A;  2L9N A;  2O9L A;  2ME0 A;  2BY1 A;  3CD6 I;  1W5S A;  4BL0 B;  3CJQ B;  4KA4 A;  2KRC A;  4DOZ A;  5HNF A;  3CDL A;  2VXZ A;  2FX0 A;  2ZFW A;  3KP3 A;  2R3S A;  1VQ7 I;  1EJ9 A;  4D1Q A;  3ROU A;  1FTT A;  2ZXH A;  2VC0 A;  4NNJ A;  3ECH A;  2V1X A;  3CO7 C;  3I59 A;  3FX3 A;  1G8X A;  3GEZ A;  1V54 H;  1XSX A;  2QQ9 A;  4D0P A;  3S3N A;  3FZV A;  2ZBK A;  5LFA A;  2P5L C;  3LSH A;  4D5C A;  3OYK A;  2HOT A;  4ZJZ A;  1T56 A;  3FBI B;  3CCJ I;  2MYS A;  2Z16 A;  3H3U A;  1VI0 A;  3J81 K;  4KIF A;  3K2A A;  5CVI A;  2J5O A;  3W2V A;  1VQM I;  4KJZ A;  1TTY A;  2QSG X;  1LFB A;  3ZMT A;  2D45 A;  5F1R A;  2HVR A;  3PSF A;  4RB1 A;  5F0H A;  3IKT A;  2NRA C;  1ZR2 A;  3D1N I;  1E17 A;  4BJ5 C;  1J59 A;  4IF4 A;  3KP7 A;  1ORK A;  3FXK A;  4M3F A;  4RM2 A;  1QZY A;  2EFW A;  4BGD A;  2XKO A;  5JVG F;  4Z2Y A;  3MZH A;  5EEA A;  4M6X A;  2HDD A;  1N25 A;  1H0M A;  2ZME C;  4YFX F;  4AU7 A;  1CGP A;  2DA5 A;  2EFQ A;  2W82 A;  1VQP I;  1V3F A;  2R5Z A;  3RZO J;  2L9V A;  2EFO A;  1LDJ A;  1XGO A;  4UB8 C;  4BHP A;  4IEJ A;  4LOC A;  3FHZ A;  3H9J A;  1BN5 A;  2CUE A;  4EM2 A;  4XOP A;  2HOE A;  3G71 I;  2LYC A;  3BR5 A;  1GVJ A;  3V8J A;  2WTE A;  3E6C C;  2OD5 A;  2HKX A;  3S17 J;  5KAF C;  5HLI A;  5EEH A;  1W7P B;  2ZNY A;  3LNQ A;  5A2Q Z;  2DA7 A;  2WAE A;  1QPI A;  3M7G A;  5D5U B;  3K1M A;  3SEQ A;  4Y7N J;  3A03 A;  1Z77 A;  1JKR C;  2EJR A;  2WB1 N;  3E3V A;  2CQQ A;  3Q0V A;  2ICW G;  3AAF A;  3HHH A;  3BTI A;  2MGQ A;  3GCM A;  3K1P A;  1HC8 A;  3JRC A;  4N0B A;  4H0E A;  3HEF A;  1IAW A;  2Q8K A;  3NAU A;  4JBA A;  1MD0 A;  5HOD A;  2JJ7 A;  5GP9 A;  4Z6Y A;  3G1M A;  2JPC A;  5FRO A;  2Y2Z A;  1U5T B;  1TWC J;  5AON A;  2HPM A;  5JFR A;  1MBJ A;  2R5Y A;  2EV5 A;  4CYC A;  4KIG A;  4AIK A;  2EA2 A;  4I6Z A;  3MVP A;  4CH7 A;  2A05 A;  3BG7 A;  3FXO A;  1OCR H;  1X3U A;  1XPX A;  1WWX A;  4IQ4 A;  5FLV A;  3ZQ7 A;  2F6C A;  3K10 A;  3WU0 A;  1FBS A;  2PMH A;  2DXI A;  1OR7 C;  2ELH A;  3CJN A;  1VQ6 I;  4JYK A;  5J3L A;  3BQY A;  4IQJ A;  4M9S A;  1B6A A;  2ZJ2 A;  3ZP5 A;  3BZ6 A;  2KIU A;  3WTT C;  1YW8 A;  1HW2 A;  4PZJ A;  1T0F A;  1FLI A;  4G94 A;  3I53 A;  2COM A;  4RAY A;  2OAZ A;  2JUC A;  2KZG A;  3K70 C;  1K6O A;  2DFI A;  2HYJ A;  4L0Y B;  1SMY F;  4X6A J;  4UVA A;  1I50 J;  4CZZ A;  1SD7 A;  3HRS A;  1G3W A;  2QQA A;  4OOI A;  1E3O C;  2M34 A;  4UV9 A;  2LBF B;  2XDV A;  3HL2 A;  1LNW A;  1GV5 A;  5B66 C;  2PJP A;  1YQA A;  2R92 J;  2O0Y A;  2Z1D A;  2AO9 A;  2Z99 A;  5F0F A;  1WH7 A;  1KU7 A;  4HRI A;  2E5N A;  2EK5 A;  1SAN A;  3M3Y J;  5C3E J;  3H3V K;  2CV2 A;  2MH2 A;  4QSH A;  2CH0 A;  2OJE D;  4KIS A;  1XS9 A;  2O03 A;  2VKH A;  4CHU A;  4XK4 A;  3GZ5 A;  2PMZ A;  3OYG A;  3QRF F;  3I4P A;  4HYE A;  2IT0 A;  2G7U A;  5KHD A;  4A3K J;  3I56 I;  2CGP A;  3V4G A;  3M8E A;  5BS6 A;  3PUB A;  4U0W A;  3BR6 A;  4ABZ A;  2QKL B;  3BZK A;  1X19 A;  1V5E A;  2DMP A;  2QWW A;  1G6N A;  3JAM Z;  3HTS B;  1ZLJ A;  4QIW N;  2EIK H;  2EIL H;  2E1M B;  2H09 A;  5IOZ A;  4MEY F;  1HKS A;  2P6T A;  2C6Y A;  4XM3 A;  3K1N A;  2E34 A;  2X6O A;  1H9T A;  4CGZ A;  4B3A A;  2LG4 A;  5D5V B;  2DOA A;  3E1S A;  4XLA A;  3BR0 A;  1WH5 A;  1MIJ A;  4C2M J;  1Y1V J;  4LJZ F;  4XON A;  1MDM A;  4XMY A;  1FP2 A;  4MQV A;  1BOA A;  3OYH A;  5IYC J;  3QPT A;  5JVT A;  3OYE A;  1IN7 A;  2HXO A;  3P9I A;  1X3W B;  1FC3 A;  3L2Q A;  3CJR B;  3ZMZ A;  1RRJ A;  1ZRE A;  1YJN I;  5ICF A;  1TNS A;  1Z05 A;  1ITY A;  4R79 A;  1D0Z A;  3F6O A;  4MGR A;  3AL0 C;  1ZHF A;  1VFC A;  1X1D A;  2O5R A;  1L3L A;  4CCN A;  2HR3 A;  1U5T C;  2BZT A;  3KCC A;  4HV6 A;  3D0S A;  4L0Z B;  4KDP A;  1FBU A;  3QPL A;  4HSR A;  1U9O A;  1F4K A;  3HOZ J;  3LOC A;  2F48 A;  4LB6 B;  1BM9 A;  4UUS B;  2QGU A;  2F5C A;  2QZ8 A;  3DPU A;  1FYL A;  4KIC A;  5HLT A;  3F8N A;  2WY8 Q;  5LEK A;  1UJ8 A;  1OCO H;  5CPR B;  2M2E A;  1YJ9 I;  1E2X A;  4A0X A;  3WTY C;  2VT2 A;  2X6W A;  3PSI A;  2LOO A;  4ZYA A;  4AWX B;  4WX9 A;  1ZRC A;  1UHM A;  4V19 K;  2BW3 A;  3Q0U A;  3CDI A;  4LK0 F;  5IYB J;  5EG0 A;  1OCZ H;  3TL4 X;  1FZP B;  1U6G A;  5ED4 A;  3OYN A;  2OUM A;  2KMU A;  3I9V 2;  3ZMU A;  2CG4 A;  2JUG A;  3RKY A;  2XIG A;  2HEO A;  2FA5 A;  1N75 A;  3LSP A;  5H6R A;  4C3I J;  4OWR B;  4HEA 2;  2KIQ A;  5KAI C;  4F55 A;  3FM3 A;  2NVT J;  3CF5 F;  1JJ6 C;  1MSF C;  1R4M B;  1IZ1 A;  2JA5 J;  2B63 J;  2LR8 A;  2F5D A;  5HS9 A;  3MMY B;  1ZR4 A;  3BG3 A;  4LIV A;  1BC7 C;  3HTU A;  1I5Z A;  1C0W A;  2VOO A;  2X85 A;  2OBP A;  3OYB A;  2CFX A;  4OIP F;  3KYL A;  4BHC A;  2PN6 A;  3CUQ C;  4HDV A;  5TRD A;  2NOG A;  4A6D A;  3K2Z A;  1FOK A;  3IP4 B;  2DOF A;  4XSX F;  1RKW A;  4PSW A;  1B8I A;  1MND A;  4G9Y A;  3GTL J;  2FQ3 A;  1JHH A;  2DAO A;  2K9S A;  1LE8 A;  3H36 A;  4O5V A;  3FKI J;  5BPI A;  5E17 F;  2HGC A;  2FML A;  2FBI A;  1IV6 A;  4M9Z A;  2XPW A;  2NS0 A;  3M1E A;  1V55 H;  3DBR B;  4FE4 A;  1K79 A;  3SQN A;  4RAG A;  3U1K A;  2EFN A;  1IXR C;  2ISY A;  2QQ8 A;  4UHT A;  5LLQ A;  4AID A;  5TGT A;  3GTP J;  3LQQ A;  3IUO A;  2Z2S B;  1Y0N A;  4DZJ A;  2WV1 A;  3ASN H;  4HG2 A;  1HW5 A;  1F43 A;  2XGE A;  3U21 A;  5LBQ A;  5C44 J;  4A6E A;  3LA3 A;  3GTJ J;  1IDY A;  2MAB A;  3C18 A;  1T38 A;  1Z7L A;  3I3L A;  1MGT A;  1TBX A;  4XN3 A;  2HNH A;  4BAY A;  3FXL A;  3BTJ A;  1VQ9 I;  2PJR B;  3H35 A;  5M5X J;  2W24 A;  2FNP A;  2XVC A;  2FJ1 A;  4ZYD A;  3MN2 A;  2QA4 I;  3CUO A;  3IKV A;  4XQF A;  2HS5 A;  3KEO A;  2GA1 A;  3KP4 A;  2IVM A;  2RN7 A;  2PEX A;  3DBH B;  2R7F A;  2EB7 A;  3R6S A;  4U7D A;  3RZD J;  1BI3 A;  1BI1 A;  1K7A A;  2D1H A;  4S05 A;  2WY7 Q;  2WB1 A;  3P7N A;  4BKX A;  1DU6 A;  2D1V A;  3D5R C;  2ZXI A;  2CW8 A;  1SFU A;  3FBN B;  1VQ4 I;  4AIH A;  2HQR A;  3HUG B;  4XOR A;  3RJP A;  3I54 A;  1D1C A;  3HG9 A;  4LB5 A;  2F5F A;  1JXS A;  3C2B A;  5FKO A;  1W36 D;  4BHB A;  2YU3 A;  4FHT A;  1FNN A;  5HS7 A;  2GOM A;  3WU2 C;  4B47 A;  4A3M J;  1ETO A;  2EWN A;  4D7M A;  3FIS A;  4JP0 A;  4CCO A;  2XGX A;  3HJE A;  3K6G A;  4M73 A;  4DNC A;  3ZMS A;  5E1X A;  2XAG A;  3MCZ A;  9ANT A;  1OYW A;  2O7O A;  4RLF A;  1P4W A;  2JRM A;  3ECO A;  4GO1 A;  1ACI A;  2MFZ A;  5EF6 A;  3TO6 A;  1JKP C;  3TW7 A;  3BR3 A;  3NRV A;  4W1U A;  3IAS 2;  1YI2 I;  4RB3 C;  1Y0U A;  3T8T A;  3BLY A;  3GTQ J;  3W6V A;  1K78 A;  2ZB9 A;  4M3B A;  1JTY A;  5FO5 A;  3WG9 A;  1GXP A;  5E8I A;  4D7N A;  3K0L A;  2IJL A;  3RI4 A;  1OMI A;  1SFK A;  4GCV A;  5GTI C;  5M5Y J;  3RYP A;  4HNU A;  5HLH A;  5DM7 F;  3KZY A;  2CQK A;  3K4J A;  1NG6 A;  2CUF A;  2XKP A;  1LFP A;  1JTX A;  4XRS G;  2BHY A;  2FBH A;  4F3Q A;  3HGY A;  3GWZ A;  2DOE A;  4KNY A;  1OJL A;  1VQ5 I;  2COB A;  2UUZ A;  2QEN A;  1W7P A;  3CDH A;  3UNG C;  2KJC A;  2IGM A;  3H92 A;  4PJ0 C;  2CW7 A;  3ZOB A;  1TC3 C;  1MJA A;  3BTC A;  5DCM B;  5FB2 A;  1FPQ A;  1LEB A;  3F23 A;  2DDB A;  1X2N A;  2F5E A;  4C3H J;  2DJN A;  5F6F A;  2L0K A;  2LNB A;  2MBF A;  4YRV A;  1E0E A;  2E7X A;  1YG2 A;  2YSR A;  4N9H A;  2BXZ A;  3AG2 H;  3GUD A;  1YTY A;  3C7J A;  3M9A A;  2M7A A;  4G6T B;  4BE0 A;  3NQO A;  4BQA A;  1BI0 A;  2FMY A;  1U5T A;  1LVA A;  5E3N A;  3ULQ B;  2E2H J;  1TNT A;  2MG4 A;  2RQP A;  1FT9 A;  4PFO A;  2QUF A;  1E3P A;  1J75 A;  1MZB A;  1TWA J;  2ZKZ A;  4NQW B;  2KP6 A;  2LP0 A;  3L1P A;  2ZJP F;  1HDD C;  1KQ8 A;  2ELJ A;  3CLO A;  3R0J A;  3WHB A;  5J1R A;  3QAH A;  1OPC A;  3N97 A;  3OS2 A;  1J0R A;  5BNG A;  3DWL E;  3F6V A;  3BRO A;  3KP5 A;  1W5C C;  1ON2 A;  2W25 A;  3ZQH A;  4EQQ A;  1W5T A;  3H5A A;  4JK1 X;  3SDB A;  4A3F J;  4O3M A;  2ZFU A;  3GBG A;  4JOM A;  1AKH B;  1Z3X A;  5E20 A;  2Y0S N;  4JX6 A;  4R8H A;  4A3C J;  5CVR A;  2H8R A;  1N78 A;  1B9M A;  2MSY A;  2E35 A;  1EV7 A;  2H27 A;  4BUP A;  3OL3 A;  4RBO A;  4ESF A;  2QSF X;  1KU2 A;  1OCT C;  4GRI A;  2HQA A;  2JVH A;  3P9K A;  2JA8 J;  4C30 A;  2V1D A;  1TW3 A;  3ZGK A;  2R7Q A;  5LD2 C;  1FEX A;  2ID3 A;  3SJM A;  2M0C A;  2LBF A;  4NC8 A;  1ZN2 A;  2AXL A;  3FXU A;  4Q48 A;  2VOP A;  2MC4 A;  4BJ6 C;  3K4K A;  4HW0 A;  2PLY A;  3LQR A;  2A6T A;  5DV5 A;  4HA8 A;  5FFX A;  5B3S H;  3LAJ A;  3I58 A;  5IT9 K;  2EH3 A;  4CDG A;  1LB2 A;  1O4X A;  1YS6 A;  1IF1 A;  4OMY A;  4HX8 A;  1XGM A;  2PQ8 A;  1VQK I;  4PK4 A;  1WSU A;  4XKB A;  3H5R A;  2EV0 A;  4BBS J;  2DMU A;  3OL4 A;  2JN6 A;  2XSD C;  1OKR A;  3JW4 A;  2DW4 A;  4AYB N;  4HOB A;  3OMY A;  3IRR A;  1S7A A;  4MFD A;  1SFX A;  2BEO A;  2KIF A;  2LH9 A;  1U8R A;  2RQQ A;  3IL2 A;  3S1R J;  2XAJ A;  1YW9 A;  3HSF A;  5FJ8 J;  3MAJ A;  1MSE C;  3CC4 I;  1TWH J;  2K40 A;  2KL4 A;  2ZSH B;  2ZME B;  1OQY A;  3HC7 A;  3IH2 A;  1U2W A;  1POG A;  2DOD A;  2KT0 A;  2VKV A;  4I02 A;  4CXF A;  1AU7 A;  1HQC A;  2W84 A;  2XSJ C;  5K7H A;  1YOV B;  3CJT B;  2K86 A;  1SD6 A;  4MTD A;  3RKW A;  2W7N A;  4FCY A;  1DP3 A;  1YLF A;  4G6Q A;  5EZG A;  5IY5 H;  3TOA A;  3TQN A;  3DFG A;  2VB6 A;  3OOU A;  1RES A;  2RNG A;  3OR1 C;  1IXC A;  4HX7 A;  1D5V A;  1QRY A;  3AFH A;  3S8P A;  3WG7 H;  3OYD A;  3JRH A;  1P6R A;  5B5E C;  3E97 A;  5L3B A;  2K4B A;  3QYB A;  1Y8Q B;  2IGO A;  3VYU B;  3F8C A;  2BV6 A;  2UXX A;  1MMN A;  3IAM 2;  3BG9 A;  2M9H A;  2VPR A;  3BG6 A;  1GHC A;  2XAF A;  2NOJ B;  3FF5 A;  4UUS A;  4HF2 A;  1UHW A;  4MFE A;  3RIR A;  5GAG J;  1DP7 P;  3BCB A;  3SYT A;  2Z33 A;  2UZK A;  3D5S C;  1I6X A;  4IO9 F;  2IW5 A;  2XV4 S;  4ZTF A;  3J7A Y;  1X4P A;  1I1S A;  2E2I J;  2P5K A;  1WI9 A;  3EDP A;  3OR2 C;  4DBR A;  3MEX A;  3MKZ A;  4B1R A;  1HKT A;  2OTL I;  1UCR A;  4HQE A;  1RR8 C;  4HQM A;  3CZ6 A;  5H20 A;  1ZGW A;  3G1L A;  3FXJ A;  1QNT A;  3GX4 X;  4M71 A;  1PP8 F;  1PDN C;  2A07 F;  1H9G A;  1P7I A;  2IRF G;  2RC4 A;  1I39 A;  1TT0 A;  1G2H A;  4ZZL A;  3GTK J;  2W4S A;  1YIT I;  3MD2 A;  1KQ9 A;  3J80 K;  3NEU A;  3VEP A;  2IA1 A;  3SZP A;  1IDZ A;  3I5U A;  1KGS A;  2NVU B;  1IN6 A;  4EVI A;  5B1A H;  4MO7 A;  1TT5 B;  3TGN A;  1ETQ A;  2DO7 A;  4LLL A;  3X2Q H;  5EYR A;  2EIM H;  2L9R A;  1Z67 A;  4Q5S F;  2N8G A;  2EZH A;  4MQ9 F;  1XC5 A;  4O6J A;  1IRZ A;  4L9V A;  4G8X A;  5FKL A;  2LRE A;  2GXA A;  2EIN H;  2YX7 A;  2CQ7 A;  3ISP A;  4N4O B;  1KYW A;  2K3F A;  5JLW A;  2A69 F;  3FIW A;  2K02 A;  4M3D A;  1REP C;  2AHQ A;  2Y69 H;  4Q47 A;  4F92 B;  2DBB A;  5KCM A;  1P2F A;  2D5V A;  1O57 A;  5HDN A;  4XKW A;  1X1C A;  1R5G A;  2FE3 A;  1SD4 A;  4U88 A;  1G59 A;  5FRN A;  2QM3 A;  4PJM A;  5H2F C;  2ZCW A;  2J5P A;  2QBY B;  2DMT A;  4YFN F;  5M5W J;  3I4N J;  1EH6 A;  2ZO4 A;  3HIF A;  4Y15 A;  1BC8 C;  1ZG3 A;  1BIA A;  4GYI A;  1RPW A;  3DTE A;  1TL8 A;  1G3T A;  3K4B A;  3LSI A;  2RV8 A;  1FX7 A;  2DMQ A;  5BPD A;  2WAD A;  3DXJ F;  3ZXS A;  3KE2 A;  4CSW A;  4U7B A;  3K69 A;  3M1C A;  5CVU A;  3WHC A;  4C2U A;  4FTH A;  4IXA A;  2DA3 A;  5FKM A;  1SAU A;  2H6C A;  3R4K A;  1GT0 C;  5IPA A;  1RNL A;  2ZC2 A;  3WE3 A;  1NK3 P;  2O3F A;  2PJR A;  3FMS A;  1BW6 A;  2DI3 A;  4L9N A;  3LMM A;  3EQL F;  3S15 J;  3OS1 A;  3CP8 A;  3JSO A;  1QBJ A;  1S3J A;  1Z91 A;  1GXQ A;  2OQG A;  2V4J C;  1R5I D;  2IA0 A;  1RR7 A;  1S9H A;  3DKW A;  1LFU P;  3AL0 B;  1XTA A;  1V5G A;  3BZC A;  2LKX A;  4Y3O A;  1P92 A;  3HPG A;  3DKY A;  5EZH A;  4YFK F;  1D1B A;  4XSZ F;  4EMS A;  1EH8 A;  5D8K B;  1B1B A;  1WJF A;  4NB5 A;  2ISZ A;  1EA3 A;  1XX5 A;  3HUG A;  4RAF A;  5BOX A;  2HYG D;  4E7I A;  3PM1 A;  1Y1W J;  2CJJ A;  4G6D A;  3FDY A;  2IGN A;  2Y30 A;  2DQR A;  2ELK A;  3FHN A;  1S72 I;  2STW A;  3PIO F;  3LFK A;  4DBQ A;  5A2Q K;  2Y75 A;  5HOO A;  2KKO A;  3ZQC A;  1ZGJ A;  2QEX I;  1W0U A;  5LEJ A;  5CVV A;  2KDZ A;  5CKT A;  1Z6T A;  1A35 A;  2R7W A;  2RKH A;  5LHH A;  3JRG A;  1XSV A;  1JE8 A;  5F27 A;  2A5W A;  1UMQ A;  2ESN A;  4BQQ A;  4DGW B;  1HST A;  2VE9 A;  1E3H A;  5JHU A;  1ZG1 A;  1TZL A;  3HOY J;  1VQ8 I;  2R7R A;  3TP0 A;  2VKD A;  4XBF A;  4LK1 F;  3KEY A;  1TQM A;  1R58 A;  1BW5 A;  1HA8 A;  3SZT A;  4BH9 A;  2Y0S A;  2EA4 A;  3DF8 A;  4X0G A;  3H5N A;  4BJT A;  3K7A J;  2L7K A;  3Q9V A;  3CES A;  1ZGA A;  2BGC A;  5D4S A;  2O61 A;  1QHH D;  1JGS A;  4PJN A;  1R23 A;  4LMY A;  2CQN A;  3IC7 A;  1IG7 A;  2GBY A;  3VYS B;  1XB4 A;  1IRF A;  2I5U A;  1Y8R B;  2R4G A;  3F72 A;  4CA0 A;  1WVR A;  2XAQ A;  2H6B A;  3E7L A;  1FMV A;  5DCM A;  4E6K G;  3CUQ B;  1TLH B;  1O7L A;  4BXF A;  3DLA A;  2F5V A;  4A5N A;  2VC1 A;  4I2O A;  1XCB A;  4HNV A;  3M07 A;  2FEZ A;  3CCU I;  4BYY A;  3VWB A;  1X4O A;  3RTR A;  3TKY A;  3TOB A;  2ACJ A;  2Z9O A;  2DU9 A;  4QTR A;  1GVD A;  3WTV C;  5KVR A;  2DYS H;  3K4N A;  5FFZ A;  4A0Y A;  2FOK A;  3CCR I;  2R7S A;  4AYB A;  2X1E A;  5KNL A;  1X2M A;  1XGS A;  1ZAO A;  4A5M A;  4J01 A;  1FSE A;  2OQR A;  5ILS A;  4NQW A;  3QPH A;  5F04 A;  3T1B A;  2R7V A;  2LK2 A;  3LFU A;  3VOD A;  3LSG A;  1MH3 A;  4CUG A;  5LGN A;  3HM5 A;  2LRD A;  1D1A A;  2FQ4 A;  3PNT A;  1BR4 A;  3HOX J;  3MZY A;  2HQN A;  4PUS A;  4WK8 F;  3PIP F;  2GAU A;  4A3D J;  4XN0 A;  3DU5 A;  3E6B A;  3BJO A;  2ME6 A;  1AKH A;  3ZPL A;  3ONQ A;  4EJW A;  2H1K A;  1JI8 A;  2CW0 F;  1FIA A;  3BPV A;  3LA2 A;  3IRQ A;  2A3S A;  5CVJ A;  4BBR J;  2L9S A;  4BE2 A;  1YX3 A;  2DPD A;  1BI2 A;  2KRF A;  3JAM K;  2JSP A;  4EJT A;  2LFB A;  2ZSI B;  4FX0 A;  3KZI C;  1S29 A;  4PGG A;  2D2W A;  5E8G A;  3QWL A;  3B6C A;  1OCP A;  1FWZ A;  1MJB A;  2W57 A;  5E1Z B;  5HVQ C;  1U3E M;  2VT3 A;  1RC9 A;  1G4D A;  1W1W E;  2LF8 A;  2IBD A;  3HOT A;  2WBM A;  2P6S A;  3CP2 A;  3ZR8 X;  1RUN A;  3C2G A;  2Y0M A;  2CRG A;  1IV8 A;  5LGT A;  5FD5 A;  2NS7 A;  3P5J A;  1CF7 B;  4IKF A;  2K4J A;  2LY1 A;  2M4K A;  3GYH X;  3S1M J;  3REO A;  2UXN A;  3RQI A;  1R22 A;  4XNF A;  4JX5 A;  1SC7 A;  2H8W A;  2EZL A;  3L09 A;  2M1B A;  5ILU A;  4G7Z F;  3S2H J;  3E5X A;  4X1E A;  3HOW J;  5HDG A;  3L2C A;  2EQR A;  4BDY A;  2DLL A;  3R0A A;  4PDK A;  1AA7 A;  2ETH A;  2FD5 A;  1YIJ I;  1TWG J;  4OMZ A;  2IP2 A;  1MMS A;  3U2R A;  3CME I;  2ZXJ A;  4XL9 A;  3BC8 A;  3BG5 A;  2FOW A;  1T6S A;  2OCE A;  3IHU A;  2KJB A;  4N9I A;  2Y31 A;  2ZME A;  2BY2 A;  3PQJ A;  3GW2 A;  4IOA F;  1Q1V A;  1D8K A;  1NTC A;  3OIP A;  3FXR A;  2DN0 A;  3GTO J;  3CO6 C;  5DD8 A;  1RIO H;  1G3Y A;  4UUV A;  1PYV A;  1XDU A;  2TRT A;  4D5F A;  4PJJ A;  5IP7 J;  3S93 A;  1I6H J;  1IGN A;  3EUK L;  3TMO A;  4EGY A;  1TW2 A;  4XLP F;  1K61 A;  4HST A;  2FUG 2;  1O3R A;  1IN5 A;  4V2G A;  3DTI A;  2E1O A;  1MKM A;  4XLF A;  3ZMD A;  4CIC A;  3OY9 A;  3U1D A;  2LDU A;  5D8L B;  3K70 D;  1Z3Y A;  3TO9 A;  4E7K A;  2DA1 A;  3RYR A;  5CJ9 A;  3GFI A;  1FTZ A;  1EKE A;  4KFC A;  3CCQ I;  1YO5 C;  5DTD A;  3KPH A;  2DTZ A;  5CQE A;  4M3E A;  2XGD A;  1F5T A;  4GDF A;  2VJJ A;  1JT6 A;  3HSR A;  4RLQ A;  1IUF A;  3SFZ A;  3I55 I;  4ESB A;  4PSX A;  1ODD A;  4XLE A;  3A0B C;  3EET A;  4IHY A;  3DTK A;  1ZLK A;  4BY1 J;  2V6E A;  4C2T A;  2EZK A;  4Y13 A;  1JUS A;  1ULY A;  2M7B A;  4M6Y A;  1SVO A;  1FP1 D;  1KA8 A;  4KUM A;  3DLL F;  2JTV A;  3F8M A;  5E3L A;  4ESJ A;  1OR7 A;  4UV8 A;  2HTJ A;  2L7M P;  4B4C A;  4BU2 A;  3RKQ A;  3BDD A;  1MNE A;  2CV1 A;  2EV6 A;  2FRH A;  4ZDL A;  2HKO A;  2E1N A;  3OYJ A;  2XAS A;  4BXX J;  3F3X A;  4ASN A;  2L2O A;  3W6K B;  1B9N A;  1H8A C;  4WXH A;  4LD5 A;  5CYV A;  4S04 A;  4MNU A;  3WGH A;  4WWC A;  4B09 A;  3LL7 A;  1SVL A;  3L2V A;  2DDA A;  5GPA A;  3Q5F A;  3FM5 A;  5DS9 A;  1W7P D;  2L4M A;  3BCA A;  5EEG A;  1N77 A;  2VBY A;  5KK1 A;  3JCU C;  2PFB A;  3WGG A;  1WQ2 A;  3E6D A;  3QP6 A;  3JR9 A;  3G3Z A;  1VF9 A;  2DTR A;  1JUM A;  2CYY A;  4XLC A;  4WXD A;  2Y9Y A;  2GQQ A;  2JRT A;  4UB6 C;  3PNV A;  4BAC A;  4DJA A;  4GXO A;  1PJR A;  2KLO A;  2V26 A;  4KT5 C;  5BQT A;  5D6F A;  2P5V A;  4KN4 X;  4XIC A;  3OWT A;  3GFL A;  3OS0 A;  1RUO A;  1MBG A;  3GXO A;  1Y39 A;  2GOX B;  2NNN A;  1FOX A;  2XUB A;  4A3I J;  4L9T A;  2LY9 A;  3PNY A;  3GFM A;  2QBY A;  4CCM A;  4EJO A;  4MHG A;  4WXC A;  1UAA A;  2ESH A;  2NNY A;  1O3T A;  1OFC X;  2MA3 A;  4I01 A;  3VB2 A;  2DFE A;  1ZTR A;  3OV8 A;  4B43 A;  2Q1Z B;  1I27 A;  2QKM B;  3PO3 J;  4M74 A;  4XKV A;  3TP3 A;  4P1W A;  5J1Y A;  3BOQ A;  3HKZ N;  4AVZ A;  2JA7 J;  1Z1D A;  2XRO A;  2I10 A;  2E1C A;  2OV7 A;  1W0T A;  2GA2 A;  1LEA A;  1B72 B;  4QLC U;  5JLX A;  1ZRD A;  1X1P A;  4OIO F;  2PG4 A;  3QQA A;  4XOT A;  2L7F P;  5DDG A;  1SD5 A;  4M6V A;  4UNO A;  1NK2 P;  1WJ5 A;  2OZU A;  3OYM A;  2JVG A;  4RAZ A;  4Q4Z F;  3KEQ A;  2O8K A;  4ZYH A;  1ZYR F;  3MKL A;  1QQI A;  4LG0 B;  1DPU A;  4FIS A;  4U0Y A;  4EM1 A;  1MH4 A;  3UR3 C;  3O8H A;  3JRF A;  5GAE J;  1MMA A;  1UG2 A;  3U9G A;  3DCF A;  4IPA A;  5TJJ A;  1ZG5 A;  5DUI A;  3F8F A;  1QA6 A;  3IWF A;  1KQ0 A;  4RB0 A;  4DZP A;  2VQG A;  5K1Y A;  3M8J A;  2EZI A;  1RET A;  3H9G A;  3ERE D;  4M9X A;  1BBY A;  3COA C;  3BR2 A;  2QF7 A;  2F4M B;  1MBH A;  4XLN F;  4RB2 C;  1BIB A;  3L2R A;  1Z7U A;  2MD5 A;  3CCS I;  1R7J A;  1T2K A;  4A3G J;  5J6X A;  1WFX A;  2DK8 A;  5LGU A;  3VOE A;  1MW7 A;  2DT7 B;  2JMW A;  4N4N B;  1ETK A;  2VI6 A;  3B6A A;  1KU3 A;  3BQZ A;  3IWZ A;  2HPI A;  4RGX A;  5K5Q A;  4IZZ A;  1LJ9 A;  1YYV A;  3ABL H;  2EPF A;  2KZV A;  5FLM J;  2K9N A;  3GME A;  2E7W A;  3T5X A;  4DYQ A;  2KIS A;  1SFO J;  2MLG A;  5HNH A;  3A01 B;  5E3O A;  2ZNZ A;  2GWR A;  3GTG J;  2H94 A;  3H1C A;  4B8X A;  4KMF A;  4F7Z A;  2QVO A;  1V4R A;  3AKZ A;  2P7V B;  1IO2 A;  3JRD A;  1WKM A;  3I71 A;  2VXD A;  5JR3 A;  1FBQ A;  1UFM A;  3W2W A;  4A3J J;  2GIV A;  1VQL I;  2OU2 A;  3Q0W A;  5DEQ A;  3SHF A;  2JT1 A;  3EYY A;  3F22 A;  4UY8 I;  4KIB A;  3FXM A;  4XLH A;  4DIQ A;  1CQT A;  3W3C A;  2AS5 F;  2OC6 A;  3OSF A;  3JRI A;  2VBZ A;  2Q2E B;  3BPX A;  1UB9 A;  3OIO A;  2WAQ A;  3C3W A;  4RS8 A;  3ZCO A;  2V7F A;  2WWY A;  4YEL A;  1X3Z B;  2K7L A;  1JHF A;  3C1D A;  4J19 A;  2V6C A;  3VDX A;  1JT0 A;  3CUQ A;  2R7Z J;  2R7X A;  1M1E B;  3LAP A;  5D4R A;  4ZC3 A;  2CQX A;  2RNJ A;  5LHI A;  4IRI A;  2DCE A;  2YR2 A;  4AVP A;  3QYF A;  1T0F C;  2O8X A;  3E0J B;  5M3F J;  5DM6 F;  2JWT A;  2R93 J;  4FET A;  2ID6 A;  2VUM J;  3KET A;  2X4H A;  4EEF G;  4CYD A;  5C4X J;  2TDX A;  4HAM A;  3O2P E;  1J09 A;  4LGW A;  1OLT A;  2GZW A;  4FX4 A;  5GAH J;  3CC2 I;  3GVA A;  2RGV A;  3ZQF A;  4HNT A;  2H1L A;  2HZD A;  2MW8 A;  3S1Q J;  1EH7 A;  1HDP A;  2M4G A;  2RRE A;  2JPB A;  2WC2 A;  2QQB A;  4KYW A;  1IC8 A;  1BJZ A;  2XB5 A;  4B44 A;  2OPT A;  5FLX Z;  3JTG A;  1LVK A;  3RPU A;  4BS9 A;  2X1D A;  2A6E F;  4LIU A;  2L02 A;  4FAS D;  3HOV J;  3LA7 A;  4YII A;  2QSH X;  5C4J J;  1XD7 A;  3HRM A;  2M45 A;  3ABT A;  2GM4 A;  2BBY A;  1T08 B;  2YPR A;  4AD9 A;  4LIT A;  5AIQ A;  4AM3 A;  5ICE A;  1DU0 A;  1F9N A;  3V8K A;  3W2A A;  1QZE A;  2NVQ J;  1LE8 B;  4A3E J;  1XCV A;  1WI3 A;  5J47 A;  4IHX A;  3LSK A;  5FRM A;  4A69 C;  4G7O F;  1K4S A;  1HBX G;  2JQ7 A;  3B02 A;  3DEW A;  4FE7 A;  2IEK A;  5JI6 A;  4RM3 A;  1CF7 A;  1T98 A;  2HI3 A;  2E36 A;  3KLN A;  2DYR H;  3HDD A;  2QYO A;  1U9N A;  2PBI A;  2WAF A;  1R5H A;  1FMW A;  5FLX K;  2LMD A;  1R71 A;  4MIM A;  2M8E A;  3EUA A;  3J81 Z;  3PJR A;  1XG1 A;  5HLG A;  3KYC B;  1ERD A;  4I0A A;  1WPK A;  1SVM A;  3P9C A;  3ERM A;  2LKS A;  3KP6 A;  3BWG A;  3KFW X;  4C9Y A;  4KIT B;  1YFH A;  3JSP A;  1T33 A;  3H3Z A;  3GO5 A;  4NC7 A;  4XKC A;  3OYA A;  1LQ1 A;  1J2X A;  4IL6 C;  2PX9 A;  3H0D A;  3DV8 A;  1MJ9 A;  1FYK A;  1AWC A;  3EYI A;  2W48 A;  2FNA A;  4LG3 A;  3EPZ A;  2LTP A;  2WA0 A;  3DKX A;  3MQ0 A;  4IHT A;  3QOE A;  2HYF A;  1ZEL A;  1ETY A;  4CCK A;  1BOB A;  1K4T A;  1Z6R A;  3DPT A;  1SAX A;  3S2W A;  3ZN1 A;  3SEZ A;  4EAT A;  3S32 A;  1TP4 A;  3V7C A;  1XGN A;  1LDK B;  3CMM A;  3N05 A;  4CO8 A;  2OTJ I;  3OSG A;  5L3D A;  4BEH B;  2BHZ A;  3HB9 A;  4W97 A;  2JA2 A;  3HYI A;  3J7Z I;  1Q1H A;  1GLN A;  2LC2 A;  1OYI A;  2G9W A;  2LLK A;  2LSO A;  2NVY J;  1YIO A;  1YX5 A;  2X6X A;  5GTH C;  5ILV A;  3G2B A;  4QWQ A;  2VJ5 A;  1IUY A;  4NUB A;  3LWF A;  4Y17 A;  4TV7 A;  4P96 A;  1A31 A;  3A02 A;  2DJI A;  2DFF A;  3CTA A;  2HXI A;  2I8D A;  1HF0 A;  3EUH C;  4F91 B;  2HDC A;  1U0J A;  1JGG A;  1MMG A;  5D5X B;  4WCG A;  3VYT B;  2RVC A;  1QO0 D;  1HOM A;  4KT6 A;  2XC7 A;  4A12 A;  3VYR B;  2FU4 A;  1WJC A;  3KP2 A;  1R1U A;  2V9K A;  3S3M A;  4HPQ A;  1K78 B;  1W4M A;  4YEJ A;  1DPR A;  4ZDP A;  1I3A A;  1APL C;  5H6Q A;  2E60 A;  1HCR A;  1WGX A;  3QYE A;  3T8R A;  1DDN A;  3DEE A;  4Y4R A;  1D0Y A;  5EDN A;  1DQU A;  4D9J A;  1VTN C;  3HKZ A;  1NG7 A;  2P4W A;  3NAR A;  2L54 A;  3BY6 A;  2CU7 A;  2XHK A;  4LLG F;  1QGP A;  4BNC A;  1WJD A;  3RQ4 A;  2JA6 J;  1YHQ I;  2G0E A;  4R1H A;  5IOY A;  1ZQ3 P;  3V42 A;  2KRH A;  1S8N A;  4I09 A;  4CCJ A;  2FF4 A;  3H0G J;  2M87 A;  1YE9 A;  1QZZ A;  3A1Y A;  3BTL A;  3MKW B;  1TQI A;  2BY0 A;  2LKP A;  4BQO A;  1XSD A;  4A93 J;  4HLY A;  2K5C A;  1ETW A;  2XAH A;  3ABU A;  3HOU J;  4PGH A;  4BXU A;  4U0V A;  2VN2 A;  2L01 A;  2ECC A;  3KYD B;  1Z21 A;  3N4M A;  1KYZ A;  4P9F A;  1V5F A;  1P4X A;  2X9D A;  2XRL A;  5ERI A;  4UVB A;  2BE5 F;  1TWF J;  2GXB A;  4EV0 A;  4A3B J;  4NHJ A;  4ZTJ A;  1YRN B;  3KIO A;  3AG1 H;  1B59 A;  2L7Z A;  3AG4 H;  1NH3 A;  3GFJ A;  3IH4 A;  4MLO A;  2DK5 A;  4MEX F;  2P0W A;  2KPM A;  3E5Q A;  5IP9 J;  3J7A O;  2LD5 A;  1B4A A;  2V9V A;  5L3F A;  2A6H F;  2E2J J;  1J9I A;  4IRG A;  3OYF A;  3SDG A;  2XAU A;  4ZZD A;  4ENN A;  1OYY A;  4EJU A;  1FIP A;  2F2E A;  3PFI A;  3LSM A;  1MMD A;  2IS2 A;  1HSJ A;  1OCC H;  2JSC A;  4Y33 A;  3WOD F;  5EGO B;  5J40 A;  2M8G X;  3OYI A;  3JRA A;  3G4S I;  2KFD A;  2EIJ H;  3QU3 A;  4HF1 A;  3FWE A;  1GV2 A;  2DT5 A;  2HZT A;  3K4L A;  4NBQ A;  1AHD P;  1B72 A;  1BR1 A;  2RDP A;  3V7S A;  4WF2 A;  2K3P A;  2B0L A;  5K5O A;  1YW7 A;  4A3L J;  1R36 A;  4II3 A;  2K27 A;  3S16 J;  3BJA A;  3TW6 A;  4QPQ A;  3FXQ A;  3MWM A;  2X6Y A;  4LG0 A;  2HQ5 A;  1IRG A;  3TDZ C;  4KN7 X;  4A0Z A;  2ADU A;  5J4Y A;  3ELK A;  3VSL A;  5J8C A;  2JZY A;  1KON A;  4RGS A;  4EGZ A;  2AQF A;  1PUE E;  2NYX A;  2FBK A;  4JQF A;  3FMQ A;  1FSH A;  2XF7 A;  4QPO A;  1PUF B;  1HXD A;  2E5Z A;  1LKX A;  2L3D A;  2ZJQ F;  3LST A;  3PO2 J;  4IHV A;  3M8F A;  3HZJ A;  4HLX A;  2R7O A;  1T8I A;  5GAD J;  4OIR F;  1KU9 A;  3G6E I;  4UUT A;  3HPH A;  1MBK A;  1F1Z A;  2XB0 X;  5L3E A;  4PJL A;  4OIQ F;  5E3M A;  3F9K A;  3L2U A;  2BVL A;  2PMU A;  3KZZ A;  4G12 A;  2VOD A;  1W36 C;  2EFP A;  2BVM A;  2UV1 A;  1J7K A;  3BT9 A;  1ON1 A;  3L9F A;  3A01 A;  1QVU A;  3FMR A;  5CQG A;  3HXL A;  1DGW Y;  1ZKG A;  3K4C A;  1IW7 F;  2DQL A;  2W00 A;  4XRS A;  5FD6 A;  1GDT A;  5E79 C;  3NWT A;  2XF6 A;  2CV0 A;  3GLX A;  1UZC A;  4HX4 A;  2MD0 A;  2XPV A;  4DYR A;  3RPQ A;  2WAQ N;  2DFH A;  1A5J A; 
#chains in the Genus database with same CATH homology
 2KLO A;  2V26 A;  3OMY A;  2LH9 A;  1R6R A;  2RQQ A;  4XOP A;  4PFP A;  3OWT A;  3OS0 A;  2WAE A;  3ZRG A;  2GOX B;  2KL4 A;  2ZSH B;  3SEQ A;  1DGR M;  3HC7 A;  2W1O A;  2L5Q A;  3PNY A;  4BE1 A;  2VQC A;  2XSJ C;  4CCM A;  2VLA A;  1UAA A;  2W7N A;  1DP3 A;  2DT6 A;  2VPL A;  2VB6 A;  3OOU A;  4B43 A;  2Q1Z B;  2QKM B;  5FRO A;  3OR1 C;  2RNG A;  2HPM A;  4XKV A;  4P1W A;  3AFH A;  3S8P A;  3OYD A;  4AVZ A;  3QYB A;  5JHF A;  2OV7 A;  3DU6 A;  2IGO A;  4CH7 A;  3BG7 A;  3DQV C;  3VYU B;  4XOT A;  4IQ4 A;  1WJA A;  2F6C A;  3K10 A;  2DXI A;  1MMN A;  1WJ5 A;  3IAM 2;  4ITV A;  1OR7 C;  3BG6 A;  3OYM A;  3PFY A;  4P5O A;  2F4I A;  2NOJ B;  2JVG A;  4IQJ A;  3BCB A;  3SYT A;  4BDZ A;  3D5S C;  4ZTF A;  3UR3 C;  1X4P A;  3J7A Y;  4XR6 A;  1MMA A;  4B3X A;  4II2 A;  2X51 A;  3OR2 C;  4DBR A;  3OYL A;  2VQG A;  3MKZ A;  3M8J A;  1P9Q C;  3K70 C;  3H9G A;  3CZ6 A;  1K6Y A;  1WJE A;  1Y6I A;  4OAY A;  1TT0 A;  3L2R A;  1WFX A;  2K9M A;  2LBF B;  2XDV A;  2W4S A;  3D5L A;  3MD2 A;  3HL2 A;  1MW7 A;  2DT7 B;  4N4N B;  2VJI A;  2Z1D A;  2HPI A;  4IZZ A;  4RMN A;  4HRI A;  2E5N A;  3HOS A;  2KZV A;  2E1M C;  2VAS A;  2CV2 A;  5HNH A;  2CH0 A;  4KIS A;  2IS6 A;  2VKH A;  3AKZ A;  2LRE A;  2PMZ A;  2KQR A;  3OYG A;  4N4O B;  5KHD A;  2KDO A;  2VXD A;  2CS3 A;  3W2W A;  3PUB A;  2QKL B;  3A4C A;  2UWM A;  1X19 A;  1V5E A;  4F92 B;  5KCM A;  4XLH A;  2E1M B;  4DIQ A;  3W3C A;  1QHG A;  4XKW A;  1X1A A;  2OC6 A;  1X1C A;  4XM3 A;  1G59 A;  5FRN A;  2Q2E B;  4PJM A;  1QU3 A;  2LG4 A;  2WAQ A;  2DOA A;  3E1S A;  2V7F A;  3ZCO A;  4XLA A;  4YEL A;  3SZG A;  2CMP A;  4XON A;  3VDX A;  4XMY A;  2R7X A;  3OYH A;  3DTE A;  3OYE A;  3K4B A;  3LSI A;  4ZC3 A;  3L2Q A;  3CJR B;  2WAD A;  3ZXS A;  4CSW A;  1BR2 A;  2DCE A;  3NWS A;  3VSK A;  4U7B A;  3M1C A;  1D0Z A;  4R79 A;  3AL0 C;  3A2K A;  1X1D A;  3QYF A;  2O5R A;  1T0F C;  3E0J B;  4CCN A;  4C2U A;  1SAU A;  4FET A;  3DPL C;  4BEH A;  2M3A A;  4HSR A;  2PJR A;  3LMM A;  2M0M A;  3OS1 A;  3CP8 A;  1J09 A;  4E4H A;  1OLT A;  2IGK A;  3DPU A;  2V4J C;  5HLT A;  4HNT A;  2HZD A;  4E7J A;  2WY8 Q;  1S9H A;  2M4G A;  5CPR B;  3AL0 B;  2RRE A;  1V5G A;  2X6W A;  4ZYA A;  3PSI A;  2LOO A;  4Y3O A;  3OYC A;  3HPG A;  3DKY A;  1D1B A;  3MKY B;  4B44 A;  2BW3 A;  1WJF A;  1LVK A;  2VL8 A;  1UG0 A;  4BS9 A;  1EA3 A;  2X1D A;  4LIU A;  4ANJ A;  4FAS D;  3TL4 X;  4E7I A;  3OYN A;  2OUM A;  3FDY A;  4CZC A;  2IGN A;  2KMU A;  3FHN A;  3I9V 2;  2JUG A;  4H4K C;  4LIT A;  4DBQ A;  3KX2 A;  1WJB A;  1N75 A;  5HOO A;  4E7L A;  3W2A A;  5CKT A;  4OWR B;  4HEA 2;  4F55 A;  2R7W A;  5FRM A;  3LSK A;  2A5W A;  4BQQ A;  4DGW B;  3MMY B;  3TBI A;  4BQN A;  4F93 B;  2CUZ A;  4LIV A;  1TZL A;  4RM3 A;  2R7R A;  2IS1 A;  2VKD A;  2X85 A;  3KEY A;  3OYB A;  1HA8 A;  2WAF A;  2Y0S A;  1FMW A;  2VQH A;  3KYL A;  3EUA A;  4X0G A;  3PJR A;  3H5N A;  4BJT A;  2L7K A;  1ERD A;  3IP4 B;  3CES A;  1QHH D;  4PSW A;  4PJN A;  1MND A;  3OIQ A;  3VYS B;  4KIT B;  4C9Y A;  2VJ4 A;  2X1C A;  3C2H A;  2R4G A;  2KHM A;  2R7U A;  4NC7 A;  4CA0 A;  4XKC A;  3OYA A;  4IX7 A;  3H0D A;  1FMV A;  4OAZ A;  4E6K G;  4LG3 A;  3EPZ A;  4BXF A;  3DLA A;  1UEL B;  2F5V A;  2WA0 A;  3DKX A;  2HVS A;  2HU9 A;  3QOE A;  1ZEL A;  4CCK A;  1BOB A;  3DPT A;  5TGT A;  3VWB A;  1X4O A;  2BOL A;  2Z2S B;  3IUO A;  3RTR A;  3SEZ A;  4HG2 A;  4EAT A;  3S32 A;  3FKJ A;  1Y56 A;  3CMM A;  1LDK B;  3N05 A;  3U21 A;  3K4N A;  2MAB A;  4BEH B;  2R7S A;  1Z7L A;  3I3L A;  4AYB A;  4XN3 A;  3RSN A;  2HNH A;  2JA2 A;  2X1E A;  5KNL A;  1GLN A;  2LC2 A;  4J01 A;  2PJR B;  3H35 A;  2X6X A;  1YX5 A;  3G2B A;  3H9Q A;  2IXS A;  2VJ5 A;  4NUB A;  2HDW A;  2R7V A;  3RPU D;  3QOD A;  2K9L A;  3LFU A;  4XQF A;  3LSG A;  2DJI A;  2I8D A;  4CUG A;  2LRD A;  3EUH C;  4F91 B;  1D1A A;  3PNT A;  4U87 A;  1BR4 A;  3PL8 A;  1U0J A;  4PUS A;  2CUJ A;  1MMG A;  3ZQQ A;  2WY7 Q;  2WB1 A;  3VYT B;  4E7Z A;  1X1B A;  4XN0 A;  4F52 A;  4KT6 A;  2XC7 A;  3S3O A;  2BW3 B;  3D5R C;  3DU5 A;  2ZXI A;  3VYR B;  1WJC A;  2CW8 A;  3ONQ A;  1JI8 A;  3FBN B;  2V9K A;  3S3M A;  4HPQ A;  4B48 A;  1T95 A;  3HUG B;  4XOR A;  4YEJ A;  2AQE A;  2V1N A;  4ZDP A;  1D1C A;  2CFO A;  3HG9 A;  2E60 A;  2L9S A;  4BE2 A;  1W36 D;  1YX3 A;  3QYE A;  2GOM A;  3DEE A;  4Y4R A;  4B47 A;  1D0Y A;  1DQU A;  2JSP A;  2ZSI B;  4D9J A;  3HKZ A;  4CCO A;  3K6G A;  1NG7 A;  2VQL A;  5HVQ C;  1IRX A;  4RLF A;  1WJD A;  2R7T A;  3RQ4 A;  3CF2 A;  2MFZ A;  4CCL A;  3HOT A;  4E7S A;  2WBM A;  3V42 A;  3CP2 A;  3IAS 2;  3ZR8 X;  3C2G A;  2KRH A;  4CCJ A;  3BLY A;  1VZ0 A;  3L2W A;  2XF5 A;  4IKF A;  1YE9 A;  3A1Y A;  3MKW B;  2LY1 A;  2M4K A;  4BQO A;  1SFK A;  2K5C A;  4XNF A;  4E7H A;  4HNU A;  4J00 A;  1Z21 A;  3K4J A;  1NG6 A;  1V5F A;  4BDY A;  1LFP A;  1D0X A;  2HVQ A;  1AA7 A;  4F3Q A;  4ZDO A;  2UUZ A;  3K4M A;  4ZTJ A;  2IS4 A;  3UNG C;  4XL9 A;  3BC8 A;  2IGM A;  2CW7 A;  4MLO A;  2P0W A;  3OIP A;  2KPM A;  4YRV A;  3RCO A;  1E0E A;  2VIX A;  3OYF A;  1PYV A;  2XAU A;  2M7A A;  4PJJ A;  2LY2 A;  4G6T B;  3S93 A;  3EUK L;  3TMO A;  4BE0 A;  3LSM A;  4HST A;  2FUG 2;  1MMD A;  2IS2 A;  4Y33 A;  3OYI A;  2L9N A;  3DTI A;  4XLF A;  4BL0 B;  3OY9 A;  3CJQ B;  4PFO A;  3K4L A;  2KRC A;  4DOZ A;  4NQW B;  5HNF A;  2KP6 A;  1BR1 A;  2ELJ A;  2VXZ A;  3K70 D;  1Z3Y A;  4E7K A;  2K3P A;  4D1Q A;  3OS2 A;  2ZXH A;  4NNJ A;  4II3 A;  3DWL E;  4QPQ A;  5CQE A;  2VJJ A;  2X6Y A;  1G8X A;  3H5A A;  3SDB A;  4RLQ A;  2ZFU A;  3GBG A;  4JOM A;  3S3N A;  4PSX A;  5LFA A;  3VSL A;  3LSH A;  1Z3X A;  4XLE A;  3OYK A;  1KON A;  4ZJZ A;  3DTK A;  1N78 A;  2V6E A;  4C2T A;  3FBI B;  2AQF A;  2M7B A;  2MYS A;  2Z16 A;  4JQF A;  2XF7 A;  4BUP A;  3OL3 A;  4QPO A;  2E5Z A;  3W2V A;  1LKX A;  4KJZ A;  4GRI A;  2HQA A;  4BU2 A;  2JVH A;  1MNE A;  2CV1 A;  2R7O A;  4C30 A;  4ZDL A;  3ZGK A;  2R7Q A;  5LD2 C;  2HVR A;  3PSF A;  2LBF A;  3OYJ A;  3HPH A;  4NC8 A;  2L2O A;  4BJ5 C;  2MC4 A;  4BJ6 C;  4PJL A;  3K4K A;  3F9K A;  3L2U A;  2BVL A;  2A6T A;  4RM2 A;  4BGD A;  1W36 C;  2BVM A;  3LL7 A;  2UV1 A;  3L2V A;  4PK4 A;  4XKB A;  3H5R A;  5CQG A;  3HXL A;  1DGW Y;  4AU7 A;  2W82 A;  3K4C A;  3BCA A;  1N77 A;  2W00 A;  3OL4 A;  3NWT A;  2XF6 A;  2CV0 A;  4XLC A;  3H9J A;  2MD0 A;  3PNV A;  4BAC A;  4DJA A;  1PJR A;  2LYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...