2XC7A

Solution structure of phax-rbd in complex with ssrna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'GAMAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORYLATED ADAPTER RNA EXPORT PROTEIN
molecule tags Rna binding protein
source organism Homo sapiens
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xc7A00
2W4SA 2XC7A
chains in the Genus database with same CATH superfamily
2IA0A 3ECOA 2XAFA 5E17F 3IH3A 2DODA 1GLNA 4BUPA 1LDJA 4U0VA 5IOYA 4PJLA 4AIJA 4RB3C 4AVZA 3FXOA 3GTMJ 3FMSA 3SFIA 1J09A 4PUSA 1YJNI 2CV2A 1BC7C 1X1DA 2DFFA 4XNFA 1RZ4A 2MABA 2F5DA 1N75A 4C2TA 5M5WJ 2OU2A 2VQHA 3ROUA 2DA2A 5JVTA 2JVGA 2KZVA 3GTPJ 2Y0SA 1WKMA 1Z7UA 2AXTC 4BE0A 2VE8A 5LD2C 3HYIA 4G7ZF 5K7FA 4WXDA 3VPRA 1Y8RB 3K4BA 2QUFA 1TC3C 1ZRFA 2UXXA 3IAM2 5DUKA 2HQRA 5J8CA 3M1EA 5F1JA 5KNLA 3JRDA 2XAUA 4A6DA 1MJBA 4PJ0C 1W4MA 2FOWA 3KP7A 4KJZA 2W1OA 2R7XA 3E0JB 1O3SA 4PJMA 3BP8A 3K69A 2HFHA 1W0TA 2M87A 2G9WA 2KQRA 3PQKA 1W5SA 1TT0A 5D4RA 1SMYF 1A35A 2K27A 1Z6TA 3L2CA 2G7HA 3GW2A 3VYRB 2E2HJ 1ON1A 3AFHA 2JA5J 4NB5A 1OCCH 2VASA 4DNCA 2IS2A 2XRLA 4XKCA 1FLIA 2VKEA 3TQNA 3X2QH 1E17A 2DQRA 1R5HA 3CZ6A 2HVSA 1TNTA 4A93J 2V9VA 1DP7P 2FEZA 1YW9A 2PMZA 2JA6J 3H0GJ 3GXOA 3JRIA 1RI7A 5F1RA 1B6AA 5EDNA 3CF5F 4WF2A 1FBSA 5FJ8J 2FMLA 1QU3A 4HAMA 2LOOA 3OYGA 1MMAA 4XLAA 4A5NA 2RC4A 3H1CA 2CV0A 1XSDA 3BTLA 3QPHA 2LF8A 5F0FA 2VJIA 4AIHA 3IWZA 4PK4A 1BI3A 4MLOA 4U7BA 2R0QC 3RPQA 1G3WA 1OYYA 3AL0B 1YW8A 4Q5SF 4A3GJ 2EFQA 2HQAA 3K70D 3FXKA 1ODDA 3L00A 1IN8A 5K5OA 2DFHA 3KLNA 5EGOB 1Y39A 3EPZA 3WTUC 4M3EA 2DA5A 3KYLA 4JBAA 4NC6A 2OZ6A 4CCJA 4KMUX 4F93B 3QPLA 1B4AA 4EGYA 2DYRH 4ZDPA 2KISA 3W3CA 3G1OA 2M2EA 2HTJA 3PNTA 4CH7A 3DU6A 1EV7A 4A69C 3WTTC 4HSTA 2ECBA 3FM5A 5EZGA 3BCAA 1SD7A 3RYPA 1R71A 1WWXA 2DMPA 2HWVA 4ZYHA 3A02A 1ZRCA 4N9IA 3JTGA 5CVRA 2BHYA 3QWLA 5EG0B 1D8JA 3F6VA 2HOSA 1X2MA 2RNGA 2A5WA 3NQOA 1O3QA 3FHZA 1BBYA 3ZMZA 1PUEE 3ZN1A 2Y48A 2MGQA 4AVPA 4PJJA 4PSWA 4I0AA 4CICA 2CUZA 5D5WB 1NG6A 4IXAA 2BXYA 5DS9A 2Q2EB 4AUXA 1R1VA 2L7KA 3C3WA 3ASNH 2DK8A 3QAHA 2XB0X 5LEJA 4CZCA 1WJ5A 2GIZA 4JQFA 5F0CA 2B7EA 1TQIA 1Z3YA 1WJEA 2LKPA 4XOPA 5L3GA 3GTJJ 3ZPLA 4EM2A 4BH9A 1ZKGA 2XUBA 3EUAA 1G8XA 4M3BA 5E8IA 3RKQA 3A2KA 1EKEA 4M3FA 1WH7A 1LNWA 2O5RA 4IHXA 1S6LA 1U0JA 3LSHA 1BL0A 1PYVA 2X6YA 4B48A 2STWA 1F4KA 4FX0A 1YOVB 1BOAA 1I27A 3IKTA 4E4HA 3CP8A 4DW6A 4HF2A 2JJ7A 2LNBA 3AG2H 2GXBA 3F72A 1QPMA 2FRHA 2ZNZA 1ETYA 3NRVA 1XMKA 1MBFA 1E3HA 4E6KG 3TGNA 2ZJQF 2EPFA 1BA5A 1R36A 1OJLA 5CPRB 2HZTA 5E3LA 2WB1A 2HXOA 1Z6RA 3VOEA 3HEFA 2CW8A 1VQLI 3IWFA 4NQWA 2D1VA 4U0WA 4IHTA 2YU3A 2O0YA 5GTIC 1YITI 3ZQ7A 2QSHX 2BHZA 1ZR2A 2BYVE 1VQ6I 3C2HA 1HXDA 4M6XA 3PUFA 4ZTJA 4DZPA 2HOEA 2LREA 1ETXA 2OQGA 3CUQA 3HXLA 3DKWA 5HOOA 4DIQA 4IHWA 3MWMA 1A31A 1YJ9I 4LLNA 2ZFWA 3QPSA 1MDMB 2LH9A 3JW4A 2XGEA 1J0RA 3GBGA 1TLHB 3LA2A 4A3FJ 2VKVA 3ESWB 3ABTA 3OOPA 2LLKA 1XS9A 2R7UA 2KIMA 5BS6A 3P9KA 3GEZA 1JKQC 2HKOA 2K4BA 2A5YB 5JHUA 2ISYA 5E3NA 3HJEA 2W7NA 4BXFA 5LFAA 5IT9Z 1X3UA 3DEEA 5EF6A 1TNSA 4KNYA 3CCVI 4YFNF 2XASA 4AD9A 2E1OA 3JAMK 1LB2A 5FD5A 1UELB 3PFYA 3WU2C 4OOIA 4XRFA 3TEDA 2CQ7A 4KIGA 2WADA 1QVTA 1R5GA 2PMZN 2VQLA 5DDGA 4DYCA 4BY1J 5M5YJ 2MC3A 3WU0A 3CDHA 4HNTA 5EGOA 2B63J 1K83J 2I10A 4NQWB 2PEXA 1DGRM 1SVLA 2QSGX 2ZB9A 1UJ8A 3GFLA 3LSPA 4XSZF 3TW6A 1O3TA 2R5YB 3OMYA 2FSWA 4MO7A 4BXUA 2D2WA 1XPXA 1LFBA 4AU7A 2RDPA 5JR3A 1U9OA 3F3XA 3BPXA 2GA1A 3H3ZA 3KX2A 3BR3A 5EJCA 2L9RA 3CLOA 3BOQA 4XKBA 2F5EA 1AWCA 2BBYA 2UXNA 2FOKA 2W25A 4BS9A 4FHTA 3MMYB 2H1LA 1V54H 4KT6A 3RCOA 3Q9SA 2IT0A 1VQ8I 1U3EM 3WTXC 3W2VA 3LMMA 2M45A 5IT3A 2ZC2A 4E7ZA 2AXLA 4BACA 4G6TB 2A05A 2CMPA 2HYJA 2MLKA 1KGSA 1X58A 4DBRA 3BR1A 1Z9CA 2OBPA 4Q47A 5E3OA 1NK3P 4UHTA 1ZHFA 2QM3A 1AOYA 5K5QA 2L7ZA 4Y7NJ 2L9VA 3C7JA 4IKFA 3KP6A 1SD6A 1ENHA 2K7LA 1WCMJ 2A6HF 3J81K 4UVCA 2VQGA 1G3YA 1O57A 3GFIA 4EVIA 3W6VA 1IJWC 1LJ9A 1ZYRF 5F04A 4B8XA 2CV1A 4PSXA 2H6CA 2A69F 3ZMSA 1TW3A 2PMHA 3BPVA 4UB8C 3SEZA 2IS1A 4QPQA 2DTZA 3FISA 1ZRDA 4Y4RA 4NC8A 1A04A 4I0BA 1GVDA 4FTHA 5J40A 2A07F 2M7BA 2FU4A 3LQRA 2E1MB 5B66C 1MNDA 3ZR8X 1FEXA 4ENNA 1JTYA 1FIPA 1KQ0A 3E6MA 1KYWA 2RQQA 5J47A 1N77A 1APLC 1KU7A 2WB1N 1T95A 3CJQB 4AWXB 4CCOA 3VSKA 3V7RA 4FQGA 4HBLA 1MZBA 1G4DA 2QCOA 4BGDA 3N05A 3FXRA 4A3JJ 2H6BA 2AO9A 5EEHA 1D5VA 2F2EA 2E19A 2P8TA 3BY6A 1PVEA 2JVHA 4UVAA 3G4SI 3HUGB 2ZJ2A 2F4MB 2CUEA 3VSLA 1HDDC 3HIFA 4RDUA 2J5OA 4PGGA 2E35A 2HQNA 3W6KB 3F21A 3DKXA 1X1AA 2CO5A 1IV6A 3K7AJ 2ZFUA 2Z33A 1U2WA 5HDKA 2PX9A 4H4KC 1TTYA 3GLXA 4S0HB 3G2BA 2DT6A 2ISZA 2I5UA 1XCVA 3H9QA 2DCEA 5KAIC 1ITYA 2DA3A 4OINF 3HRMA 3L2WA 1JT6A 5JLWA 5LRSA 1LVKA 2HGCA 3LFUA 1E2XA 2RAEA 3HKZN 5CLSA 2X1CA 4FCYA 1LKXA 3RZDJ 4ENMA 1YLFA 4N0BA 4IJAA 2YSRA 4HOBA 3KEQA 3U1DA 3QYBA 2O3FA 2YX4A 2HI3A 3V7CA 5DCMA 1VQKI 5J4VA 4XLHA 1FSHA 3MD2A 4HF0A 4JX5A 1K78B 2X6OA 2ETHA 2CFXA 5ILSA 1WSUA 3BC8A 4MHGA 2MG4A 2DA6A 1T38A 2R7TA 4U7DA 1R5ID 4C3JJ 2ELJA 2R7DA 4C30A 5D4SA 3WTYC 2OCEA 3GFJA 3HC7A 4F52A 2K40A 4M72A 2HPMA 1YRNB 1YX3A 4W97A 3M7GA 2BY1A 1JT0A 4KDPA 1Z91A 3MVPA 3WTZA 2VXZA 1ZREA 1MKMA 2LR8A 4Y17A 3EQLF 4BU2A 5BOXA 3V8JA 4IRGA 3BQYA 5EZHA 1MMGA 3KCCA 4C3HJ 3T8RA 3FXJA 4XLFA 1HQCA 3OR2C 3LA7A 5CJ9A 2XHKA 1MBKA 2EFNA 2JT1A 2VIXA 1WZ2A 1PUFA 2LMDA 2XVCA 3VYTB 3KETA 1B8IB 2NVXJ 3EUHC 2PMUA 4IOCF 3MKWB 1CF7B 5ICCA 4KYWA 1YFHA 3SDBA 5CVJA 4HLYA 4HV6A 2BW3B 3OYJA 3GYHX 2XGXA 1RKTA 2VKDA 4QTRA 2FNAA 2EA4A 2L9SA 4MGRA 3AG3H 1QZZA 4BAYA 3HBLA 3GCMA 5HS9A 2VODA 3HSRA 4CXFA 2R92J 3M3YJ 4P9UA 2BGCA 2DOFA 3DEWA 3ZCOA 2FBHA 1RR8C 2MH2A 5HLGA 1B8IA 2EV6A 3R0AA 4CO8A 3VDXA 3S16J 4EJUA 3HL2A 2ZJRF 1OCPA 1J2XA 3PQJA 5FROA 2X6WA 3NAUA 3PNYA 4M71A 1ZR4A 1HOMA 2P5KA 5DM7F 1WI9A 1A5JA 1KA8A 1F1ZA 5FO5A 1Y8QB 1O7LA 4C9YA 1XTAA 3DTIA 2QLZA 3OR1C 3P9IA 4JYKA 3LSMA 3S1NJ 9ANTA 4PDKA 1FTTA 2O6GE 4ABZA 2XAJA 1R6RA 4IRHA 3KZZA 4BL0B 3HOUJ 4N9HA 5HLTA 1JKPC 2JPCA 3K4MA 2Y75A 4IZZA 1ZLKA 1B9NA 4L0ZB 2Y9ZA 3FKJA 1S9HA 4D5FA 5L3DA 5DV5A 4I99C 4RGXA 3GX4X 4XRSG 4I7HA 3G73A 2QENA 4R79A 2L7FP 4M9ZA 4KIFA 3CD6I 5J1UA 2PQ8A 5M3FJ 3F8BA 4YRVA 3BR0A 2BVMA 4BQAA 1IN7A 1A6IA 3CCYA 5GTHC 1ETKA 3OY9A 5DYMA 2YUSA 1GHCA 3L2UA 1KYZA 1N78A 3R0JA 1BI2A 5CVUA 4XR6A 4EJWA 1AA7A 3CC2I 2K3PA 2CUJA 1XGSA 4OAZA 5FRMA 3PJRA 4RAYA 4WXHA 1LUJB 3G1LA 4XLNF 3EUHA 1TT5B 5B3SH 3CUQC 1SFKA 1UB9A 2COMA 2HDCA 5CYVA 3KP3A 4A3IJ 1W7PA 3I4NJ 4QWQA 3C18A 2P5VA 5FGMA 4X6AJ 3K4NA 3ML6A 4UB6C 4O3MA 4D7NA 3TKYA 1AHDP 4HYEA 4M3DA 4ASNA 5GAEJ 4AIDA 3REOA 3KPHA 2P7VB 3B73A 4LLGF 5FLVA 4S04A 4DBQA 3P7NA 4BJ6C 1K4SA 5E79C 1W36C 3K2AA 1OCTC 1YW7A 1H9GA 2JK3A 3K70C 3K10A 3W2WA 1JGGA 2QWWA 4I01A 2XF6A 3JR9A 3GTKJ 1DQUA 1UHWA 3U9GA 1ZGWA 3T5XA 4LMYA 2W00A 3BG6A 2EZKA 4ZH4F 3ELKA 4LOCA 1IN6A 3GLLA 2I8DA 3I53A 3IHUA 4DZJA 4QLCU 2JRMA 3DBHB 1FOWA 2PJRA 4KT5C 1WFXA 2P5LC 3DWLE 4A2UA 1ULYA 4IO9F 3M8FA 4AYBN 1IGNA 4R1HA 3PM1A 2CG4A 1R9TJ 1H8AC 3CMEI 1K78A 3JAMZ 3O8HA 1I1SA 2R93J 3OV8A 1MD0A 1SVOA 1T33A 2HU9A 4V2GA 3CDLA 3KP2A 1QGPA 3DPUA 2K9NA 2ZKZA 4FETA 3HRTA 4IHSA 1OYWA 1XMXA 1CGPA 3S2HJ 4Y15A 3ZN0A 1LPQA 1H9TA 2W82A 2F48A 1IUFA 4M73A 2QEXI 1LFPA 5DUIA 3MCZA 3R61A 2L3DA 2Y30A 3DPLC 2M9HA 2EIMH 5DM6F 3PSIA 4NDLA 3MZHA 2ZXJA 1LDDA 1D1AA 2XAGA 1MSFC 1S72I 3GFMA 1OR7A 1FT9A 3FK6A 4A3EJ 3GWZA 4XK4A 4RBOA 3HOXJ 1KONA 2VKHA 3EUKL 3GZ5A 3L9FA 4XIDA 3FDYA 5J6XA 2GXAA 4HW0A 2VUMJ 4L9TA 3HOZJ 1I5ZA 3CUOA 4LK0F 4DYQA 5FB2A 1I1GA 1MNEA 3I64A 1U8BA 4LG0A 3WE3A 2UWMA 4RA2A 4EGZA 3J7AY 3FMQA 5H20A 4XL9A 4C3IJ 1T08B 1O4XA 4BXXJ 2A6TA 4HPQA 2RGVA 5LGTA 1UG2A 2P0WA 4QIWN 2NYXA 3ABMH 2V4JC 1N25A 1UFMA 1ORKA 1LDKB 4UXNA 2A6EF 1BOBA 1PDNC 4RM3A 5K7ZA 3CJRB 5L3CA 4E7LA 2R5YA 2K3FA 4HNVA 2K9SA 1MSEC 2K85A 2STTA 2KDOA 3TOBA 5DCFA 4CYCB 1QQIA 2E71A 4OWRB 4OIPF 1FOXA 5A2QK 1JHFA 4RGRA 4DGWB 3HHGA 3BG9A 2BY2A 5AIPA 1XCBA 3K1NA 3DQVC 4XORA 5FFXA 5D5XB 1YYVA 2H94A 2NOGA 3A0BC 2WAFA 3WU1B 1F43A 2IGMA 3NWTA 2ZMEB 5ERIA 1NG7A 4A0ZA 4EJOA 2O8KA 4HG2A 1FSEA 2RVCA 5GAGJ 3U21A 4AIKA 2HNHA 2V1DA 3O3KA 2VN2A 2XIGA 5LHGA 1E0EA 1X4PA 4OMYA 5JFRA 3C1DA 1I3QJ 2NS0A 5J1YA 1H0MA 3ERED 3AG1H 2JSCA 3B6AA 3GMEA 3DLLF 2VB6A 2L2OA 2FXAA 2M4KA 1UAAA 3S3OA 4AM3A 2DAOA 4CYDA 1A36A 4A0XA 4GCVA 4YELA 3MQ0A 3HPHA 3RYRA 1YJWI 1YS7A 1ZELA 2IP2A 2OA4A 1JGSA 1D8KA 2DTRA 2W57A 3LA3A 4ZYGA 1EH6A 5EG0A 3RSNA 5LHIA 4JX6A 3ERMA 5AIQA 4H0EA 2HPIA 1H88C 1GDTA 1FOKA 1TBXA 2NAZA 4WK8F 3F9KA 4DYRA 3S1QJ 3BLYA 2Q0OA 3CC4I 1BJZA 3BDDA 2KKOA 4O6JA 1KZHA 3CESA 1TWGJ 2R5ZB 3TO7A 2QKLB 1XG1A 2ME6A 4X0GA 4A3LJ 3HOVJ 1QRYA 2TRTA 4P5OA 2R7QA 3ABLH 2DW4A 1ZLJA 4KIBA 3ABUA 2IGNA 2NVYJ 3I0TA 3K4LA 4XN3A 1GV5A 2GQQA 1T39A 1Y1VJ 2RQPA 1TQPA 3F6OA 1OCZH 2XC7A 2LRDA 4V19K 1ETOA 1MMDA 3LSTA 2VC1A 2HXIA 2WAQA 5L3FA 5J1RA 2GAUA 4CSWA 4DOZA 1RR7A 2LG4A 3PIOF 2LFBA 3UR3C 5KVRA 3U1KA 3LAJA 1JUSA 2AS5F 2X9DA 1EF4A 3K4CA 4ETSA 5IYCJ 2CJJA 2XAQA 4EQQA 1QNTA 2EZHA 2DMUA 2OTJI 1FPQA 2ZSIB 2FA5A 4S05A 2M1BA 4NBQA 3S3NA 2XDVA 4UNOA 2L54A 4RM2A 2XGDA 2Z2SB 1PP8F 2VLAA 4B47A 2DMTA 1P2FA 4GO1A 3V8KA 4B09A 1DPRA 1IDZA 3TDUC 5HDNA 4P55A 3LFKA 4E7HA 2E60A 1FMWA 2O7OA 1U8RA 2R7FA 1X1PA 5IYBJ 5HDGA 3HOYJ 3IC7A 5AONA 1SFEA 1AKHA 1MGTA 3HOSA 1BI1A 2VI6A 4L0YB 5CKTA 2E2IJ 2CS3A 3IH4A 5F64A 3DTEA 1JHHA 4M74A 4RAZA 5HS8A 2O8XA 1ZG5A 2K9MA 4D5CA 2XSDC 2OTLI 1TWHJ 3I4MJ 3G1MA 4BDZA 3RKXA 2VBYA 1ETQA 2HVRA 1J9IA 2IEKA 3H3UA 3T0YA 2GM4A 1KU2A 1TW2A 3S17J 3GUDA 3MZ8A 1Z77A 1A6QA 1O7FA 4B44A 1D1CA 2LY2A 4CCKA 1JE8A 4EEFG 1RUOA 2KRCA 5DEQA 1T98A 3HUGA 3H5RA 4RB2C 2W24A 1BW6A 2UZKA 2MD0A 2CU7A 2KPMA 5KHDA 2UUZA 2JPBA 3C2GA 2DI3A 1RRJA 2Z3YA 3JRFA 1G59A 2VBZA 3CF2A 4PFOA 4LITA 4NUBA 3K9TA 4IHYA 4V2FA 3F23A 3CJNA 3A0HC 1S3JA 5FKKA 2LP0A 3D5SC 3PO3J 1D3YA 4HF1A 3V42A 1E3PA 2R7OA 1ETWA 3A1YA 4M9SA 4ZDOA 2H8RA 4JOMA 2CGPA 2EWNA 3CCQI 3FK7A 3W6JB 2DDAA 1W36D 2YU9J 3HG9A 5TISC 2IPQX 3PO2J 4ITVA 1SD4A 4I2OA 4IQ4A 4A5MA 2NVTJ 2OUMA 4M6YA 1STZA 2F6CA 2Y69H 4PFPA 4AC0A 3LAPA 2X85A 5HNFA 4IOAF 1R4MB 5HS7A 3AKZA 3B6CA 1WJFA 4Z6YA 2EH3A 2BY0A 3BG7A 2VXDA 1LVAA 3OL4A 4EMSA 2MSYA 3N97A 2VQCA 4ON0A 4Y52J 2FBIA 5BPIA 4IVNA 2WA0A 2HR3A 3TW7A 1V5EA 3FWEA 3HSEA 4C2MJ 3RTRA 3WODF 3J80Z 2ELHA 2F5VA 3QP6A 3E6CC 5C4JJ 2ZMEA 4FE4A 3Q0WA 2BOLA 3I3LA 2NOJB 3HGYA 1RUNA 2IS4A 1D1BA 2M7AA 2JSPA 4F91B 1AU7A 4UUSB 3ZQLA 2DLLA 2QQ8A 3ULQB 3VODA 3COAC 2N8GA 2VJ4A 2FUG2 2ZSHB 4LB6B 1RNLA 4M3GA 1HSJA 4CGZA 2Z9OA 4ANJA 2HQ5A 2DA1A 1P4AA 3HRUA 1OCOH 2PG4A 4NNJA 1IN5A 1OR7C 2VT2A 4HX7A 1ZGAA 2M0MA 2HOTA 2NXNB 2FD5A 2HVQA 4N4OB 2RKHA 2RN7A 3J7AO 4I98B 3S15J 1IRXA 1EA3A 2P6TA 4XLPF 2F5CA 2VJJA 2MBFA 3O8GA 5LBQA 5K5RA 4XONA 2LC2A 4HRIA 3K6GA 4JK1X 3HDDA 1H89C 2BZTA 3ABKH 1SFXA 3SZTA 1HW2A 5BQTA 2V9PA 1BIBA 3KFWX 2BE5F 2VOPA 3HOWJ 2LBFB 5CQGA 1P92A 4BEHB 1ETVA 4A3BJ 4KN7X 2AQEA 2XSJC 4ESBA 3FXLA 2Q8KA 4JP0A 2HKXA 5KK1A 1S8NA 2DBBA 1UZCA 5ICFA 4KMFA 3O2PE 5K7HA 5LGNA 3HOTA 3JRHA 2KDZA 1MBGA 1T6SA 1XSXA 2IBDA 2LDUA 2ICWG 3JRGA 2ZMEC 4BHBA 2HS5A 1GXQA 2MH9A 1OFCX 1O3RA 1Y56A 2EFOA 3L7WA 2L01A 1NTCA 2VBXA 4BQNA 2PLYA 2LBFA 2Y0MA 1W0UA 1ZQ3P 2Q2EA 1UMQA 2ELKA 1YS6A 1TQMA 1J59A 1QA6A 4KUMA 5HLHA 1MH3A 2X4HA 4G8XA 3WHCA 5IP9J 3G6EI 2R7WA 4HSRA 2GOXB 5IT9K 2Q1ZB 1K6OA 2MYSA 1U6GA 1GUUA 4XRMA 3IH2A 1K7AA 1WJDA 3DF8A 2O61A 2VBWA 1G2HA 4MNUA 1SVMA 3Q9VA 2CH0A 1E3OC 2OZUA 2WTEA 3I9V2 2IVMA 3K1MA 2DOEA 2NVQJ 3AAFA 3M8EA 3S32A 1VQOI 1B1BA 1G3SA 1WI3A 1S7EA 2XF5A 4BDYA 3A03A 5A2QZ 1ERDA 2EILH 2JZYA 1ZTRA 2V1UA 2DU9A 2V6CA 1WPKA 2DYSH 1X1BA 4GFBA 3IUOA 1FBUA 1BR4A 1MIJA 1J5YA 2CUFA 2XKPA 1U5TB 1TWFJ 2ID6A 1HLVA 3MAJA 1PJRA 5FLMJ 2NRAC 2TCTA 3OIPA 5JI6A 1HSTA 1RKWA 2PBIA 4GYIA 2EB7A 1REPC 3SXYA 4BBRJ 1IW7F 2HYFA 5F6FA 4UY8I 4LD5A 1T56A 2KJBA 3ZGKA 5HODA 3WTVC 4G6DA 3JRAA 2E5ZA 5DCMB 2KRHA 4CCMA 1IXSB 2DMQA 4F7ZA 3H3VK 3MKYB 5FKOA 4G94A 3OIQA 3VEPA 4ZZLA 1LE8B 3BR5A 1MH4A 2KMUA 4Y33A 1B72B 1Z7LA 1HC8A 3SYTA 1X19A 1HW1A 2V7FA 3E3VA 3WGHA 4KITB 3OSGA 4BEHA 5L3BA 4XMYA 3CLQA 3E6DA 2H1KA 4G6QA 2M0CA 1OLTA 5TJJA 1D0ZA 1WQ2A 1FOYA 4ZC3A 4HQEA 2BV6A 1X1CA 3GTOJ 2MFZA 2EZLA 5E20A 4HDVA 1DU0A 2E1MC 1ZARA 1IAWA 1NH3A 1QHHD 1LE8A 2K02A 3FM3A 3GZ6A 1VTNC 3PFIA 2V1NA 5BNGA 2GZWA 3PSFA 2E5NA 1KQ9A 2XGCA 1J75A 1F5TA 3OYMA 2V1XA 3OYHA 1P9QC 3H35A 4XOTA 4EV0A 2ADUA 1YX5A 1DP3A 2KHMA 2XAHA 3H0DA 4Y3OA 2VPLA 2EIJH 1EH8A 3H9JA 3WG7H 4Q48A 1QBJA 2ECCA 1ONVA 1T0FA 2F4OB 3QODA 1FC3A 2TDXA 2HOAA 2MW8A 3H92A 2KJCA 1BIAA 3A4CA 1YRNA 1UCRA 5D8LB 1F36A 2KLOA 3V7SA 3S93A 4A12A 2PFBA 5J4YA 3FXUA 4PGHA 4L5JA 2E1NA 2B0LA 2DT7B 1NHAA 2X48A 5FKNA 3I58A 4EJTA 5KCMA 3BT9A 1Y0NA 1Z05A 2HTSA 3N4MA 4WWCA 1LQ1A 3BG5A 1PUFB 3TOAA 5EEAA 2DMNA 2LK2A 3CCRI 4EATA 3U2RA 3AL0C 4HLXA 3BTIA 4XSXF 2XB5A 1VF9A 1R22A 2HEOA 2CQKA 2OAZA 5JHFA 4PCQA 2WY7Q 3KEYA 2JA8J 5EYRA 3C2BA 4RS8A 4PJNA 1JTXA 4BKXA 1S5LC 2VPRA 4LK1F 3ZMUA 4U87A 1XDSA 2E2JJ 4B3XA 1ACIA 4OU0A 5M3MJ 3CC7I 4XQFA 2M34A 3S3MA 4KICA 1J7KA 2G7UA 3OYNA 5C44J 2GIVA 2KZGA 1JXSA 1RC9A 4ZYDA 4C2UA 1HKSA 2QGUA 4HX8A 3RPUA 3WG9A 4I09A 2QZ8A 2PI0A 2L5QA 2HDDA 4LLLA 5IY5H 1WJCA 2IS6A 2KIUA 3Q5FA 1U78A 4P96A 2WC2A 1XGOA 5LLQA 3L2VA 2ZNYA 2EIKH 4BJTA 2KT0A 3TP3A 1XGMA 1OQYA 3DEUA 5ICGA 2XPUA 4IHVA 4X1EA 3CCMI 3BWGA 2L9NA 3VYUB 2GLOA 4KA4A 2BVLA 4RAGA 2VL8A 4A6EA 1VI0A 1X3WB 3S14J 3PL8A 3WE2A 2ACJA 1RESA 1SAXA 4F92B 4BY7J 5IP7J 5TGTA 2O03A 1XGNA 4UV9A 2L02A 1WVRA 3BJOA 3PUBA 3BG3A 1FP2A 2X0LA 1U9NA 2XKOA 4RB1A 4CZZA 5HNHA 5LRRA 1QZEA 2FQ3A 5LGUA 3Q3SA 2CW7A 2VT3A 3CO6C 5B1AH 4CDGA 4CA0A 2OQRA 1ON2A 5ILUA 3ASOH 2M3AA 4BYYA 1MDMA 4CCLA 2XV4S 4LIVA 2KL4A 3BTJA 3FKIJ 5CVVA 1U5TA 2L4MA 3DP7A 4LGWA 4D0PA 4Q4ZF 1FWZA 3IKVA 4LFUA 3AG4H 3OWTA 4FISA 4M9XA 4HA8A 3KZIC 4GGGA 3S1RJ 4IPAA 3ZOBA 4RLFA 4R8HA 4MEYF 2NVUB 1FMVA 2M8EA 4KN4X 1C0WA 3KLOA 3GTQJ 1W5CC 4NC7A 2V6EA 1IDYA 1B59A 4XM3A 1NK2P 1USSA 4MIMA 3NARA 1HDPA 2QYOA 1I39A 1YG2A 4G7OF 3CUQB 1MW7A 3W2AA 1VNDA 3E97A 3BJ6A 5CQEA 4A3MJ 1R1UA 5C4XJ 2M5WA 4IL6C 2GOMA 2DPDA 3D1NI 1IRFA 2CQNA 1P6RA 1IN4A 2JN6A 2WAQN 4D7MA 1WGXA 3E5XA 2F4IA 2QQAA 3KP5A 2ID3A 1RPWA 2DDBA 1GVJA 3BR6A 3LOCA 3ONQA 2M8GX 1IXCA 3QP5A 2EINH 1ZAOA 2CQQA 2FQ4A 3IP4B 3E1SA 2ZXHA 4Y13A 5E1ZB 2ME0A 1DDNA 3FX3A 1OPCA 4UUTA 3HTUA 1MBJA 3HM5A 4E7IA 3E6BA 3Q0UA 2RNJA 2E7XA 3ZQHA 4UVBA 1R4NB 1G6NA 1L0OC 2O9LA 2MD5A 2Z16A 3F8NA 4LIUA 2X6XA 1FYLA 1JUMA 1SMTA 1I6HJ 5FLXK 1W7PD 4PZJA 3OS1A 3I4PA 2P4WA 5JLXA 1FJLA 3LSGA 2FMYA 4EM0B 1YIOA 1FYMA 2D5VA 1FIAA 1ZG1A 2PJPA 1L3LA 2EK5A 4RLQA 4MQVA 3JREA 2FX0A 2JWTA 1KQ8A 3WTSC 2A68F 1QO0D 2M4GA 5E1WA 3DBLB 2ZJPF 5C3EJ 1GXPA 3IAS2 4HZFA 4LJZF 4MFEA 4CUGA 3DBRB 1FBQA 4G9YA 2Z5UA 3A01A 3CMMA 1YQAA 3D5RC 1MBEA 3J80K 3MN2A 4ZTFA 1V55H 1YO5C 3S2DJ 1IRZA 2EQRA 5JVGF 1SC7A 3OYKA 4EJVA 3M4OJ 3J81Z 3BZ6A 3K0LA 3LNQA 3OL3A 1FYKA 1FTZA 2DA4A 4L18B 2NS8A 1I3AA 4EM1A 1FZPB 2HDWA 1Y6IA 4MTDA 1MBHA 2JRTA 2K4JA 3EYYA 3TL4X 5J8FA 5D5VB 3RQIA 5E3MA 1K79A 3QOEA 2DOAA 4LG3A 4UUSA 2K5CA 4IRIA 2L4AA 1LEAA 1SANA 1FX7A 3H5NA 2VOOA 4XN0A 2DT5A 2W4SA 5D8KB 4BE2A 2QBYA 3EETA 1IXRC 2D45A 1HCRA 1JKRC 3MZYA 2ZO4A 3FZVA 5F0HA 3HHHA 3V8LA 2DJIA 2MLGA 1T2KA 2F5FA 1TP4A 4E7KA 5D6EA 4BQQA 5GP9A 1P7IA 2IW5A 4XLEA 2M30A 2WBMA 3TO6A 2IAIA 3SEQA 5ICEA 3L09A 4M6VA 5K1YA 3M07A 4OMZA 1V3FA 4A3DJ 3R6SA 3DU5A 1MJ9A 2LKXA 1K61A 3MKZA 2QBYB 1JKOC 4TV7A 3ZMDA 3JRCA 3RJPA 5CVIA 2K86A 3DLAA 1UHSA 4F55A 2V26A 3GO5A 1SEUA 1HKQA 1P7JA 4A3KJ 2OF7A 5FD6A 3BZCA 2EFPA 4MFDA 1YTYA 4D9JA 4I02A 5FRNA 2CWEA 2V9KA 2MC4A 3CCLI 2VONA 2CFOA 2RREA 4U88A 3CP2A 1WHUA 2OV7A 3VYSB 1BW5A 4K2EA 1IG7A 3CMAI 3L2QA 1CQTA 3ZMTA 1FNNA 3OYDA 4ESJA 1FY7A 3RZOJ 1UG0A 5IOZA 2XPWA 1KU9A 1VZ0A 3Q0VA 1WJBA 1SFOJ 2QQBA 3V4GA 4L5EA 1FP1D 4WXCA 3SFZA 1RIOH 3RIRA 2AHQA 3F8CA 2DPUA 4L9JA 3LL7A 3OYEA 2C6YA 1IF1A 3VWBA 2LY9A 3FF5A 3GZNB 1OCRH 1B9MA 3RDIA 3CCJI 1V4RA 2LF7A 3WTWC 4DJAA 5GPAA 3M8JA 3ZQIA 4O5VA 4AYBA 4BBSJ 4XBFA 3M9AA 1XD7A 4BHCA 4IX7A 1HF0A 3KYDB 3TP0A 3BCBA 4YFKF 4E70A 4YFXF 1MNMC 2OD5A 4J00A 3IRQA 3I5UA 3QQAA 2OC6A 1EH7A 2LSOA 2EBIA 3DTKA 5F27A 3ZQGA 3ZP5A 2VE9A 2CYYA 2EA2A 1VQMI 4ZDLA 1BC8C 3VFZA 3MFKA 3JRBA 2B9SA 5FFZA 4ZJZA 3CCUI 1JJ6C 4E7JA 2P7CB 4XLCA 1TL8A 3LSRA 1UHMA 3I59A 5IYDJ 3ISPA 3KEOA 2HZDA 3OOUA 5GAHJ 4OIQF 2DQLA 1IO2A 5B1BH 3ECHA 2W84A 4UV8A 1HBXG 4XRSA 1BN5A 4B1RA 2FE3A 1R49A 4OAYA 2JUGA 1T8IA 5B5EC 2DJNA 3S1MJ 2E34A 2H8WA 1USTA 3ZQFA 5FLXZ 4BHPA 2E1CA 1ZN2A 4YIIA 5H2FC 4UUVA 1MMSA 3HTSB 3DV8A 3LSIA 4B4CA 4RGSA 5ILVA 4FX4A 4A3CJ 5M5XJ 3WHBA 2JTVA 1HW5A 3O6BB 4RMNA 4LB5A 2COBA 3T1BA 5DTDA 1QVUA 5TRDA 1Y1WJ 3K1PA 3MKLA 2IA1A 2R7VA 2BEOA 3QU6A 1IV8A 3R4KA 4HDUA 2R7ZJ 2Y2ZA 5D6FA 1I6XA 4CYCA 2Y0SN 4QSHA 3TO9A 1VQ9I 4MTEA 1B72A 3KE2A 3IL2A 1OYIA 1G3TA 3I71A 1MJAA 1XDUA 2FF4A 1TZLA 3QYFA 3DKYA 3PIPF 5FKMA 4G12A 3SHFA 3LQQA 3UNGC 3OYBA 2WY8Q 2QA4I 1V5GA 5DD8A 1QHGA 2WAEA 3RPUD 3S8PA 3ZQQA 4YIFA 2QSFX 1S7AA 4GXOA 3TBIA 3SJMA 4YG2F 4XKVA 2WV1A 4FE7A 1OMIA 3DPTA 2R7SA 5EEGA 2L0KA 3E7LA 3H9GA 2JUCA 4FT8A 5LHHA 3SQNA 4II3A 1YI2I 2A3SA 3CDIA 3QRFF 2K9LA 2R7RA 3CCEI 2PJRB 3OYFA 2Z99A 3F8FA 3E5QA 3IRRA 3OYIA 2FBKA 3QYEA 5FKLA 4HQMA 2QVOA 3EYIA 2AQFA 4KISA 1SD5A 3HZJA 3I59B 1ZH5A 3T8TA 1I50J 3F8MA 2GA2A 5GPCA 2A61A 5DD4A 3WGGA 4ZYEA 4P1WA 1YHQI 2JQ7A 4CHUA 4ZYAA 3S2WA 1OKRA 3VB2A 1XC5A 4L9NA 2EV5A 1XMAA 4P9FA 3K2ZA 2W48A 3QPTA 4J01A 3D0SA 3SZPA 2BY3A 2EZIA 1W1WE 5E8GA 1R7JA 3OS0A 6PAXA 4IF4A 1IC8A 1SAUA 1JJ8C 3FBIB 2YS9A 1Z21A 3KP4A 2CQXA 2XPVA 3FBNB 2D1HA 3HSFA 3RKYA 4B43A 3L1PA 2X51A 4I76A 1XX5A 3K4JA 4MEXF 4HV5A 4QPOA 1Y0UA 1XSVA 2V79A 5BMZA 3DFGA 4HX4A 2E7WA 5LEKA 1Q1HA 3I54A 4ESFA 1R00A 2LYCA 2KFDA 1W5TA 3F22A 3LWFA 3JTHA 4II2A 1DU6A 2L7MP 1Z67A 2G0EA 2KIQA 2YPRA 2Y9YA 3R60A 1TWAJ 4ZZDA 1AKHB 4F3QA 4L9VA 4W1UA 5KAFC 2H09A 3FXQA 4KFCA 1WH5A 3G71I 2VJ5A 1Q1VA 2ZXIA 2NNYA 3NEUA 4BE1A 1HKTA 1OISA 4LG0B 1DUXC 3A01B 1GT0C 4ENKA 4G7HF 1VFCA 2QQ9A 2R3SA 3ZRGA 3GTGJ 4WX9A 2NS7A 2Y31A 1YE9A 2X1EA 1XN7A 1CF7A 3GTLJ 5HVQC 5GADJ 1X2NA 1VQ5I 2IJLA 3BZKA 3EDPA 1KU3A 2IXSA 1Z1DA 3KZYA 3L2RA 2XROA 2OJED 4RGUA 2DFEA 1K6YA 2DK5A 4RAFA 2WV0A 2ZBKA 2EV0A 1MMNA 4HEA2 3RKWA 1WJAA 2Z1DA 4YIRX 2UV1A 3DCFA 2CSOA 2LVSA 3HGGA 1BM9A 1ZG3A 1ZK8A 3FMRA 4ENJA 4B3AA 5L3EA 4GDFA 2FNPA 3BROA 3LSKA 4D1QA 1R58A 4N4NB 1LFUP 4CCNA 4BNCA 5ED4A 2QF7A 1VQ7I 1Z3XA 2LY1A 1V5FA 2RV8A 3K4KA 2LTPA 3TMOA 3FHNA 1XB4A 3H5AA 2K9QA 2MA3A 2NNNA 1IZ1A 2CRGA 3SDGA 4A0YA 3BR2A 3NWSA 4RB0A 2EJRA 2IGOA 2P6SA 1VQ4I 2QKMB 3QU3A 3CMYA 2P81A 5HLIA 1D5YA 1BJAA 3ZMVA 5IPAA 3FXMA 3GVAA 2W85A 3J7YJ 3CO7C 4J19A 3ZXSA 1VQNI 1S7OA 2X1DA 2H27A 3BTCA 1R23A 1S29A 3B02A 3P9CA 3PNVA 2ESHA 1D0XA 4WCGA 4YEJA 2IRFG 4HNUA 1PP7U 1RETA 4XKWA 3TDZC 2HYGD 4MQ9F 3CTAA 3HPGA 3P5JA 1YIJI 4OIOF 2KIFA 2JA2A 4XICA 3OYCA 2DA7A 3FIWA 1BI0A 4DQ2A 1D0YA 1LEBA 2J5PA 3OYAA 1JI8A 3JSOA 3D5LA 3HKZA 4JX4A 1BR1A 4E7SA 2IA2A 3JCUC 1X3ZB 3GF2A 2KP6A 3OIOA 4I6ZA 1DPUA 4IEJA 2OPTA 2XRNA 4GYGA 2JMWA 3LSJA 2WWYA 2LD5A 2DO7A 3E5UA 1ZGJA 5H6RA 2LKSA 2DXIA 1IRGA 3HB9A 1GV2A 4OIRF 5E18F 1P4WA 2BXZA 2DN0A 1W7PB 4FASD 5E1XA 3F0CA 2R4GA 3DXJF 3G3ZA 4Z2YA 1M1EB 2YX7A 2GWRA 3RI4A 2GXGA 3KIOA 1R1TA 2KRFA 4L5IA 2GBYA 3CJTB 1QPIA 1P4XA 2ESNA 3CQZJ 2ZXWH 3ZQCA 2E36A 5IP6A 3I56I 3I55I 1X4OA 2CW0F 1HA8A 2JA7J 1DGWY 5F08A 1QZYA 1Z0XA 4NHJA 5BPDA 1TWCJ 1WRJA 1F9NA 3BJAA 3CCSI 3RQ4A 2OCCH 3BQZA 4U0YA 1T0FC 1JUPA 2XF7A 3H36A 3HRSA 5H6QA 2VC0A 2EFWA 5J3LA 5D5UB 1U5TC 3UKGA 1VQPI 4IQJA 1IUYA 3IV5A 2BW3A 3SZGA 1K4TA 2IGKA 3WGIA 2PN6A 2FJ1A 4GRIA 2YR2A 1BR2A 3OSFA 3KYCB 1SFUA 1EJ9A 3QOPA 1POGA 2DFIA 3M1CA 3MEXA 4BJ5C 4BQOA 3J7ZI 3OYLA 3OS2A 3JSPA 2R5ZA 2ZCWA
chains in the Genus database with same CATH topology
2M4GA 3EUHC 3MKWB 3IAS2 4CUGA 3SDBA 1GLNA 2BOLA 3I3LA 2BW3B 4BUPA 2NOJB 4PJLA 4AVZA 3OYJA 1D1BA 2M7AA 2IS4A 3CMMA 3D5RC 2VKDA 2JSPA 4F91B 4ZTFA 2L9SA 2CV2A 1J09A 4PUSA 2VJ4A 2FUG2 2ZSHB 1X1DA 3OYKA 4XNFA 2MABA 1N75A 3ZCOA 3OL3A 4C2TA 2VQHA 4ANJA 2JVGA 2KZVA 3VDXA 2Y0SA 3HL2A 4BE0A 2HDWA 1Y6IA 5LD2C 3TL4X 5FROA 2X6WA 3PNYA 4NNJA 3QOEA 1OR7C 2DOAA 4LG3A 2K5CA 3K4BA 2M0MA 3H5NA 3IAM2 4XN0A 4N4OB 2HVQA 5KNLA 4C9YA 2W4SA 4BE2A 2XAUA 3DTIA 1IRXA 3OR1C 1EA3A 4KJZA 3LSMA 2W1OA 2R7XA 3E0JB 4PJMA 2DJIA 2VJJA 1R6RA 4BL0B 2KQRA 5HLTA 1TT0A 4E7KA 4BQQA 3K4MA 4IZZA 4XONA 4XLEA 2LC2A 4HRIA 3FKJA 1S9HA 3K6GA 3VYRB 2WBMA 3SEQA 3AFHA 2VASA 4R79A 3DU5A 2IS2A 4XKCA 3MKZA 2LBFB 5CQGA 4YRVA 2HVSA 2BVMA 3CZ6A 4BEHB 2AQEA 2XSJC 3OY9A 2PMZA 3DLAA 3L2UA 1N78A 4F55A 2V26A 4XR6A 1AA7A 2K3PA 2CUJA 4OAZA 3HOTA 1QU3A 5FRMA 3PJRA 2LOOA 3OYGA 1MMAA 4XLAA 4D9JA 2CV0A 5FRNA 1Y56A 2V9KA 2MC4A 1SFKA 2VJIA 2CFOA 4PK4A 4MLOA 2RREA 4BQNA 3CP2A 3VYSB 2OV7A 2LBFA 4U7BA 3L2QA 3AL0B 3K4NA 3OYDA 1UG0A 2HQAA 2R7WA 3K70D 1VZ0A 1WJBA 4HSRA 2GOXB 2Q1ZB 3EPZA 2MYSA 3KYLA 4CCJA 1WJDA 4F93B 4DBQA 4BJ6C 3LL7A 4ZDPA 3W3CA 3OYEA 2CH0A 3VWBA 3PNTA 4CH7A 3I9V2 3DU6A 1W36C 4HSTA 4DJAA 3M8JA 3S32A 3BCAA 4AYBA 2XF5A 4BDYA 3K70C 3K10A 4IX7A 3W2WA 1ERDA 2XF6A 1DQUA 3BCBA 2W00A 3BG6A 4J00A 1X1BA 2RNGA 2A5WA 3IUOA 2OC6A 2I8DA 3DTKA 1BR4A 4ZDLA 4PJJA 4PSWA 4ZJZA 2PJRA 2CUZA 1WFXA 4E7JA 3DWLE 4XLCA 1PJRA 1NG6A 3OIPA 2Q2EB 2HZDA 3OOUA 2L7KA 2HU9A 4FETA 3DPUA 3ZGKA 4OAYA 2W82A 2JUGA 4CZCA 1WJ5A 1LFPA 4JQFA 2E5ZA 2KRHA 4CCMA 1Z3YA 3DPLC 1WJEA 4XOPA 3PSIA 3MKYB 3OIQA 3LSIA 1D1AA 3EUAA 2KMUA 1G8XA 4Y33A 1Z7LA 3A2KA 3SYTA 1X19A 2V7FA 4RMNA 4KITB 4BEHA 4XMYA 1KONA 2VKHA 3EUKL 1OLTA 2O5RA 2R7VA 1D0ZA 1U0JA 3FDYA 3LSHA 1PYVA 2X6YA 4ZC3A 1MNEA 4B48A 1X1CA 2MFZA 2UWMA 2E1MC 3J7AY 4E4HA 3CP8A 1QHHD 4XL9A 1TZLA 2V1NA 3QYFA 2A6TA 3DKYA 3PSFA 3OYBA 3UNGC 2E5NA 4HPQA 2WY8Q 3OYMA 1V5GA 2P0WA 1QHGA 2WAEA 3RPUD 3S8PA 3ZQQA 3OYHA 1P9QC 4E6KG 3H35A 4XOTA 3TBIA 2V4JC 4XKVA 1LDKB 1YX5A 5CPRB 1DP3A 2KHMA 3DPTA 2R7SA 2WB1A 3H9GA 1BOBA 3H0DA 4RM3A 4Y3OA 3CJRB 4E7LA 2CW8A 4II3A 2VPLA 2KDOA 2K9LA 3H9JA 2R7RA 2PJRB 3OYFA 3QODA 4OWRB 3C2HA 3OYIA 4ZTJA 3A4CA 2LREA 3QYEA 2KLOA 3HXLA 2AQFA 3S93A 4KISA 4DGWB 5HOOA 4DIQA 3DQVC 4XORA 2LH9A 2DT7B 2WAFA 2IGMA 3GBGA 3NWTA 1NG7A 4P1WA 5KCMA 4HG2A 2R7UA 4ZYAA 3U21A 2HNHA 1E0EA 1X4PA 4J01A 4EATA 2W7NA 4BXFA 5LFAA 3AL0C 3DEEA 3OS0A 1SAUA 3FBIB 2VB6A 1Z21A 2L2OA 5JHFA 1UELB 3FBNB 3PFYA 2M4KA 4B43A 2WY7Q 1UAAA 3KEYA 3S3OA 2X51A 4YELA 2WADA 2VQLA 4PJNA 3HPHA 1ZELA 3K4JA 4QPOA 4HNTA 4U87A 3RSNA 4NQWB 4B3XA 1DGRM 2HPIA 2LYCA 4XQFA 3S3MA 3F9KA 3BLYA 4II2A 3OYNA 3OMYA 4F3QA 4C2UA 4AU7A 3CESA 2L5QA 2QKLB 3KX2A 4X0GA 2VJ5A 1WJCA 2ZXIA 4P5OA 4BE1A 2R7QA 4XKBA 2IS6A 4BS9A 3ZRGA 2IGNA 3MMYB 3RCOA 4KT6A 3K4LA 4XN3A 3L2VA 1YE9A 2X1EA 4BJTA 3W2VA 3LMMA 5HVQC 2XC7A 2LRDA 4E7ZA 1MMDA 3VYUB 2L9NA 4BACA 4G6TB 2IXSA 2CMPA 3L2RA 2BVLA 2VL8A 2WAQA 4DBRA 1K6YA 4CSWA 4DOZA 3PL8A 2LG4A 1MMNA 4HEA2 3UR3C 4F92B 1WJAA 4IKFA 5TGTA 2Z1DA 2UV1A 2VQGA 4D1QA 3K4CA 3LSKA 4N4NB 3PUBA 4CCNA 2CV1A 4PSXA 2IS1A 3SEZA 1Z3XA 2LY1A 4QPQA 5HNHA 1V5FA 2ZSIB 4Y4RA 3K4KA 4NC8A 3S3NA 2XDVA 3TMOA 3FHNA 2CW7A 4RM2A 2Z2SB 3H5AA 2M7BA 4CA0A 2VLAA 2E1MB 2M3AA 3NWSA 4CCLA 2IGOA 4B47A 4LIVA 1MNDA 2QKMB 3ZR8X 2KL4A 4E7HA 2E60A 1FMWA 2RQQA 1N77A 3CJQB 1T95A 4CCOA 3ZXSA 3VSKA 2X1DA 3PNVA 1D0XA 3OWTA 4YEJA 4BGDA 3N05A 4HNUA 3HOSA 4XKWA 3HPGA 5CKTA 4RLFA 2CS3A 2JVHA 3DTEA 3HUGB 1FMVA 2JA2A 2K9MA 3OYCA 3VSLA 4NC7A 3DKXA 1X1AA 4BDZA 2V6EA 1D0YA 2HVRA 4XM3A 2ZFUA 3OYAA 1MW7A 1JI8A 3D5LA 4H4KC 3HKZA 1BR1A 3G2BA 3W2AA 4E7SA 2DT6A 4B44A 1D1CA 2LY2A 3H9QA 5CQEA 2DCEA 4CCKA 2KP6A 3L2WA 2GOMA 2KRCA 1LVKA 3LFUA 3H5RA 2X1CA 1LKXA 2DXIA 2MD0A 2KPMA 5KHDA 2F4IA 2UUZA 4FASD 3C2GA 2R4GA 3QYBA 1G59A 3ONQA 3CF2A 4PFOA 4LITA 4NUBA 4XLHA 3MD2A 3D5SC 3IP4B 3E1SA 3V42A 2ZXHA 2R7OA 4ZDOA 3A1YA 3BC8A 4JOMA 1X4OA 1HA8A 2R7TA 4E7IA 2ELJA 1W36D 1DGWY 3HG9A 4C30A 4ITVA 3HC7A 4F52A 2HPMA 4IQ4A 2OUMA 1YX3A 2F6CA 3RQ4A 2Z16A 4PFPA 4LIUA 2X6XA 2VXZA 2X85A 5HNFA 1T0FC 2XF7A 3OS1A 4BU2A 3AKZA 1WJFA 4IQJA 3BG7A 1MMGA 2VXDA 3LSGA 2BW3A 3OL4A 3SZGA 2IGKA 4XLFA 2VQCA 3OR2C 4GRIA 1BR2A 2WA0A 4RLQA 2VIXA 3M1CA 1V5EA 4BJ5C 4BQOA 3OYLA 3OS2A 3VYTB 3RTRA 2F5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W4S A;  2XC7 A; 
#chains in the Genus database with same CATH topology
 2IA0 A;  3ECO A;  2XAF A;  5E17 F;  3IH3 A;  2DOD A;  1GLN A;  4BUP A;  1LDJ A;  4U0V A;  5IOY A;  4PJL A;  4AIJ A;  4RB3 C;  4AVZ A;  3FXO A;  3GTM J;  3FMS A;  3SFI A;  1J09 A;  4PUS A;  1YJN I;  2CV2 A;  1BC7 C;  1X1D A;  2DFF A;  4XNF A;  1RZ4 A;  2MAB A;  2F5D A;  1N75 A;  4C2T A;  5M5W J;  2OU2 A;  2VQH A;  3ROU A;  2DA2 A;  5JVT A;  2JVG A;  2KZV A;  3GTP J;  2Y0S A;  1WKM A;  1Z7U A;  2AXT C;  4BE0 A;  2VE8 A;  5LD2 C;  3HYI A;  4G7Z F;  5K7F A;  4WXD A;  3VPR A;  1Y8R B;  3K4B A;  2QUF A;  1TC3 C;  1ZRF A;  2UXX A;  3IAM 2;  5DUK A;  2HQR A;  5J8C A;  3M1E A;  5F1J A;  5KNL A;  3JRD A;  2XAU A;  4A6D A;  1MJB A;  4PJ0 C;  1W4M A;  2FOW A;  3KP7 A;  4KJZ A;  2W1O A;  2R7X A;  3E0J B;  1O3S A;  4PJM A;  3BP8 A;  3K69 A;  2HFH A;  1W0T A;  2M87 A;  2G9W A;  2KQR A;  3PQK A;  1W5S A;  1TT0 A;  5D4R A;  1SMY F;  1A35 A;  2K27 A;  1Z6T A;  3L2C A;  2G7H A;  3GW2 A;  3VYR B;  2E2H J;  1ON1 A;  3AFH A;  2JA5 J;  4NB5 A;  1OCC H;  2VAS A;  4DNC A;  2IS2 A;  2XRL A;  4XKC A;  1FLI A;  2VKE A;  3TQN A;  3X2Q H;  1E17 A;  2DQR A;  1R5H A;  3CZ6 A;  2HVS A;  1TNT A;  4A93 J;  2V9V A;  1DP7 P;  2FEZ A;  1YW9 A;  2PMZ A;  2JA6 J;  3H0G J;  3GXO A;  3JRI A;  1RI7 A;  5F1R A;  1B6A A;  5EDN A;  3CF5 F;  4WF2 A;  1FBS A;  5FJ8 J;  2FML A;  1QU3 A;  4HAM A;  2LOO A;  3OYG A;  1MMA A;  4XLA A;  4A5N A;  2RC4 A;  3H1C A;  2CV0 A;  1XSD A;  3BTL A;  3QPH A;  2LF8 A;  5F0F A;  2VJI A;  4AIH A;  3IWZ A;  4PK4 A;  1BI3 A;  4MLO A;  4U7B A;  2R0Q C;  3RPQ A;  1G3W A;  1OYY A;  3AL0 B;  1YW8 A;  4Q5S F;  4A3G J;  2EFQ A;  2HQA A;  3K70 D;  3FXK A;  1ODD A;  3L00 A;  1IN8 A;  5K5O A;  2DFH A;  3KLN A;  5EGO B;  1Y39 A;  3EPZ A;  3WTU C;  4M3E A;  2DA5 A;  3KYL A;  4JBA A;  4NC6 A;  2OZ6 A;  4CCJ A;  4KMU X;  4F93 B;  3QPL A;  1B4A A;  4EGY A;  2DYR H;  4ZDP A;  2KIS A;  3W3C A;  3G1O A;  2M2E A;  2HTJ A;  3PNT A;  4CH7 A;  3DU6 A;  1EV7 A;  4A69 C;  3WTT C;  4HST A;  2ECB A;  3FM5 A;  5EZG A;  3BCA A;  1SD7 A;  3RYP A;  1R71 A;  1WWX A;  2DMP A;  2HWV A;  4ZYH A;  3A02 A;  1ZRC A;  4N9I A;  3JTG A;  5CVR A;  2BHY A;  3QWL A;  5EG0 B;  1D8J A;  3F6V A;  2HOS A;  1X2M A;  2RNG A;  2A5W A;  3NQO A;  1O3Q A;  3FHZ A;  1BBY A;  3ZMZ A;  1PUE E;  3ZN1 A;  2Y48 A;  2MGQ A;  4AVP A;  4PJJ A;  4PSW A;  4I0A A;  4CIC A;  2CUZ A;  5D5W B;  1NG6 A;  4IXA A;  2BXY A;  5DS9 A;  2Q2E B;  4AUX A;  1R1V A;  2L7K A;  3C3W A;  3ASN H;  2DK8 A;  3QAH A;  2XB0 X;  5LEJ A;  4CZC A;  1WJ5 A;  2GIZ A;  4JQF A;  5F0C A;  2B7E A;  1TQI A;  1Z3Y A;  1WJE A;  2LKP A;  4XOP A;  5L3G A;  3GTJ J;  3ZPL A;  4EM2 A;  4BH9 A;  1ZKG A;  2XUB A;  3EUA A;  1G8X A;  4M3B A;  5E8I A;  3RKQ A;  3A2K A;  1EKE A;  4M3F A;  1WH7 A;  1LNW A;  2O5R A;  4IHX A;  1S6L A;  1U0J A;  3LSH A;  1BL0 A;  1PYV A;  2X6Y A;  4B48 A;  2STW A;  1F4K A;  4FX0 A;  1YOV B;  1BOA A;  1I27 A;  3IKT A;  4E4H A;  3CP8 A;  4DW6 A;  4HF2 A;  2JJ7 A;  2LNB A;  3AG2 H;  2GXB A;  3F72 A;  1QPM A;  2FRH A;  2ZNZ A;  1ETY A;  3NRV A;  1XMK A;  1MBF A;  1E3H A;  4E6K G;  3TGN A;  2ZJQ F;  2EPF A;  1BA5 A;  1R36 A;  1OJL A;  5CPR B;  2HZT A;  5E3L A;  2WB1 A;  2HXO A;  1Z6R A;  3VOE A;  3HEF A;  2CW8 A;  1VQL I;  3IWF A;  4NQW A;  2D1V A;  4U0W A;  4IHT A;  2YU3 A;  2O0Y A;  5GTI C;  1YIT I;  3ZQ7 A;  2QSH X;  2BHZ A;  1ZR2 A;  2BYV E;  1VQ6 I;  3C2H A;  1HXD A;  4M6X A;  3PUF A;  4ZTJ A;  4DZP A;  2HOE A;  2LRE A;  1ETX A;  2OQG A;  3CUQ A;  3HXL A;  3DKW A;  5HOO A;  4DIQ A;  4IHW A;  3MWM A;  1A31 A;  1YJ9 I;  4LLN A;  2ZFW A;  3QPS A;  1MDM B;  2LH9 A;  3JW4 A;  2XGE A;  1J0R A;  3GBG A;  1TLH B;  3LA2 A;  4A3F J;  2VKV A;  3ESW B;  3ABT A;  3OOP A;  2LLK A;  1XS9 A;  2R7U A;  2KIM A;  5BS6 A;  3P9K A;  3GEZ A;  1JKQ C;  2HKO A;  2K4B A;  2A5Y B;  5JHU A;  2ISY A;  5E3N A;  3HJE A;  2W7N A;  4BXF A;  5LFA A;  5IT9 Z;  1X3U A;  3DEE A;  5EF6 A;  1TNS A;  4KNY A;  3CCV I;  4YFN F;  2XAS A;  4AD9 A;  2E1O A;  3JAM K;  1LB2 A;  5FD5 A;  1UEL B;  3PFY A;  3WU2 C;  4OOI A;  4XRF A;  3TED A;  2CQ7 A;  4KIG A;  2WAD A;  1QVT A;  1R5G A;  2PMZ N;  2VQL A;  5DDG A;  4DYC A;  4BY1 J;  5M5Y J;  2MC3 A;  3WU0 A;  3CDH A;  4HNT A;  5EGO A;  2B63 J;  1K83 J;  2I10 A;  4NQW B;  2PEX A;  1DGR M;  1SVL A;  2QSG X;  2ZB9 A;  1UJ8 A;  3GFL A;  3LSP A;  4XSZ F;  3TW6 A;  1O3T A;  2R5Y B;  3OMY A;  2FSW A;  4MO7 A;  4BXU A;  2D2W A;  1XPX A;  1LFB A;  4AU7 A;  2RDP A;  5JR3 A;  1U9O A;  3F3X A;  3BPX A;  2GA1 A;  3H3Z A;  3KX2 A;  3BR3 A;  5EJC A;  2L9R A;  3CLO A;  3BOQ A;  4XKB A;  2F5E A;  1AWC A;  2BBY A;  2UXN A;  2FOK A;  2W25 A;  4BS9 A;  4FHT A;  3MMY B;  2H1L A;  1V54 H;  4KT6 A;  3RCO A;  3Q9S A;  2IT0 A;  1VQ8 I;  1U3E M;  3WTX C;  3W2V A;  3LMM A;  2M45 A;  5IT3 A;  2ZC2 A;  4E7Z A;  2AXL A;  4BAC A;  4G6T B;  2A05 A;  2CMP A;  2HYJ A;  2MLK A;  1KGS A;  1X58 A;  4DBR A;  3BR1 A;  1Z9C A;  2OBP A;  4Q47 A;  5E3O A;  1NK3 P;  4UHT A;  1ZHF A;  2QM3 A;  1AOY A;  5K5Q A;  2L7Z A;  4Y7N J;  2L9V A;  3C7J A;  4IKF A;  3KP6 A;  1SD6 A;  1ENH A;  2K7L A;  1WCM J;  2A6H F;  3J81 K;  4UVC A;  2VQG A;  1G3Y A;  1O57 A;  3GFI A;  4EVI A;  3W6V A;  1IJW C;  1LJ9 A;  1ZYR F;  5F04 A;  4B8X A;  2CV1 A;  4PSX A;  2H6C A;  2A69 F;  3ZMS A;  1TW3 A;  2PMH A;  3BPV A;  4UB8 C;  3SEZ A;  2IS1 A;  4QPQ A;  2DTZ A;  3FIS A;  1ZRD A;  4Y4R A;  4NC8 A;  1A04 A;  4I0B A;  1GVD A;  4FTH A;  5J40 A;  2A07 F;  2M7B A;  2FU4 A;  3LQR A;  2E1M B;  5B66 C;  1MND A;  3ZR8 X;  1FEX A;  4ENN A;  1JTY A;  1FIP A;  1KQ0 A;  3E6M A;  1KYW A;  2RQQ A;  5J47 A;  1N77 A;  1APL C;  1KU7 A;  2WB1 N;  1T95 A;  3CJQ B;  4AWX B;  4CCO A;  3VSK A;  3V7R A;  4FQG A;  4HBL A;  1MZB A;  1G4D A;  2QCO A;  4BGD A;  3N05 A;  3FXR A;  4A3J J;  2H6B A;  2AO9 A;  5EEH A;  1D5V A;  2F2E A;  2E19 A;  2P8T A;  3BY6 A;  1PVE A;  2JVH A;  4UVA A;  3G4S I;  3HUG B;  2ZJ2 A;  2F4M B;  2CUE A;  3VSL A;  1HDD C;  3HIF A;  4RDU A;  2J5O A;  4PGG A;  2E35 A;  2HQN A;  3W6K B;  3F21 A;  3DKX A;  1X1A A;  2CO5 A;  1IV6 A;  3K7A J;  2ZFU A;  2Z33 A;  1U2W A;  5HDK A;  2PX9 A;  4H4K C;  1TTY A;  3GLX A;  4S0H B;  3G2B A;  2DT6 A;  2ISZ A;  2I5U A;  1XCV A;  3H9Q A;  2DCE A;  5KAI C;  1ITY A;  2DA3 A;  4OIN F;  3HRM A;  3L2W A;  1JT6 A;  5JLW A;  5LRS A;  1LVK A;  2HGC A;  3LFU A;  1E2X A;  2RAE A;  3HKZ N;  5CLS A;  2X1C A;  4FCY A;  1LKX A;  3RZD J;  4ENM A;  1YLF A;  4N0B A;  4IJA A;  2YSR A;  4HOB A;  3KEQ A;  3U1D A;  3QYB A;  2O3F A;  2YX4 A;  2HI3 A;  3V7C A;  5DCM A;  1VQK I;  5J4V A;  4XLH A;  1FSH A;  3MD2 A;  4HF0 A;  4JX5 A;  1K78 B;  2X6O A;  2ETH A;  2CFX A;  5ILS A;  1WSU A;  3BC8 A;  4MHG A;  2MG4 A;  2DA6 A;  1T38 A;  2R7T A;  4U7D A;  1R5I D;  4C3J J;  2ELJ A;  2R7D A;  4C30 A;  5D4S A;  3WTY C;  2OCE A;  3GFJ A;  3HC7 A;  4F52 A;  2K40 A;  4M72 A;  2HPM A;  1YRN B;  1YX3 A;  4W97 A;  3M7G A;  2BY1 A;  1JT0 A;  4KDP A;  1Z91 A;  3MVP A;  3WTZ A;  2VXZ A;  1ZRE A;  1MKM A;  2LR8 A;  4Y17 A;  3EQL F;  4BU2 A;  5BOX A;  3V8J A;  4IRG A;  3BQY A;  5EZH A;  1MMG A;  3KCC A;  4C3H J;  3T8R A;  3FXJ A;  4XLF A;  1HQC A;  3OR2 C;  3LA7 A;  5CJ9 A;  2XHK A;  1MBK A;  2EFN A;  2JT1 A;  2VIX A;  1WZ2 A;  1PUF A;  2LMD A;  2XVC A;  3VYT B;  3KET A;  1B8I B;  2NVX J;  3EUH C;  2PMU A;  4IOC F;  3MKW B;  1CF7 B;  5ICC A;  4KYW A;  1YFH A;  3SDB A;  5CVJ A;  4HLY A;  4HV6 A;  2BW3 B;  3OYJ A;  3GYH X;  2XGX A;  1RKT A;  2VKD A;  4QTR A;  2FNA A;  2EA4 A;  2L9S A;  4MGR A;  3AG3 H;  1QZZ A;  4BAY A;  3HBL A;  3GCM A;  5HS9 A;  2VOD A;  3HSR A;  4CXF A;  2R92 J;  3M3Y J;  4P9U A;  2BGC A;  2DOF A;  3DEW A;  3ZCO A;  2FBH A;  1RR8 C;  2MH2 A;  5HLG A;  1B8I A;  2EV6 A;  3R0A A;  4CO8 A;  3VDX A;  3S16 J;  4EJU A;  3HL2 A;  2ZJR F;  1OCP A;  1J2X A;  3PQJ A;  5FRO A;  2X6W A;  3NAU A;  3PNY A;  4M71 A;  1ZR4 A;  1HOM A;  2P5K A;  5DM7 F;  1WI9 A;  1A5J A;  1KA8 A;  1F1Z A;  5FO5 A;  1Y8Q B;  1O7L A;  4C9Y A;  1XTA A;  3DTI A;  2QLZ A;  3OR1 C;  3P9I A;  4JYK A;  3LSM A;  3S1N J;  9ANT A;  4PDK A;  1FTT A;  2O6G E;  4ABZ A;  2XAJ A;  1R6R A;  4IRH A;  3KZZ A;  4BL0 B;  3HOU J;  4N9H A;  5HLT A;  1JKP C;  2JPC A;  3K4M A;  2Y75 A;  4IZZ A;  1ZLK A;  1B9N A;  4L0Z B;  2Y9Z A;  3FKJ A;  1S9H A;  4D5F A;  5L3D A;  5DV5 A;  4I99 C;  4RGX A;  3GX4 X;  4XRS G;  4I7H A;  3G73 A;  2QEN A;  4R79 A;  2L7F P;  4M9Z A;  4KIF A;  3CD6 I;  5J1U A;  2PQ8 A;  5M3F J;  3F8B A;  4YRV A;  3BR0 A;  2BVM A;  4BQA A;  1IN7 A;  1A6I A;  3CCY A;  5GTH C;  1ETK A;  3OY9 A;  5DYM A;  2YUS A;  1GHC A;  3L2U A;  1KYZ A;  1N78 A;  3R0J A;  1BI2 A;  5CVU A;  4XR6 A;  4EJW A;  1AA7 A;  3CC2 I;  2K3P A;  2CUJ A;  1XGS A;  4OAZ A;  5FRM A;  3PJR A;  4RAY A;  4WXH A;  1LUJ B;  3G1L A;  4XLN F;  3EUH A;  1TT5 B;  5B3S H;  3CUQ C;  1SFK A;  1UB9 A;  2COM A;  2HDC A;  5CYV A;  3KP3 A;  4A3I J;  1W7P A;  3I4N J;  4QWQ A;  3C18 A;  2P5V A;  5FGM A;  4X6A J;  3K4N A;  3ML6 A;  4UB6 C;  4O3M A;  4D7N A;  3TKY A;  1AHD P;  4HYE A;  4M3D A;  4ASN A;  5GAE J;  4AID A;  3REO A;  3KPH A;  2P7V B;  3B73 A;  4LLG F;  5FLV A;  4S04 A;  4DBQ A;  3P7N A;  4BJ6 C;  1K4S A;  5E79 C;  1W36 C;  3K2A A;  1OCT C;  1YW7 A;  1H9G A;  2JK3 A;  3K70 C;  3K10 A;  3W2W A;  1JGG A;  2QWW A;  4I01 A;  2XF6 A;  3JR9 A;  3GTK J;  1DQU A;  1UHW A;  3U9G A;  1ZGW A;  3T5X A;  4LMY A;  2W00 A;  3BG6 A;  2EZK A;  4ZH4 F;  3ELK A;  4LOC A;  1IN6 A;  3GLL A;  2I8D A;  3I53 A;  3IHU A;  4DZJ A;  4QLC U;  2JRM A;  3DBH B;  1FOW A;  2PJR A;  4KT5 C;  1WFX A;  2P5L C;  3DWL E;  4A2U A;  1ULY A;  4IO9 F;  3M8F A;  4AYB N;  1IGN A;  4R1H A;  3PM1 A;  2CG4 A;  1R9T J;  1H8A C;  3CME I;  1K78 A;  3JAM Z;  3O8H A;  1I1S A;  2R93 J;  3OV8 A;  1MD0 A;  1SVO A;  1T33 A;  2HU9 A;  4V2G A;  3CDL A;  3KP2 A;  1QGP A;  3DPU A;  2K9N A;  2ZKZ A;  4FET A;  3HRT A;  4IHS A;  1OYW A;  1XMX A;  1CGP A;  3S2H J;  4Y15 A;  3ZN0 A;  1LPQ A;  1H9T A;  2W82 A;  2F48 A;  1IUF A;  4M73 A;  2QEX I;  1LFP A;  5DUI A;  3MCZ A;  3R61 A;  2L3D A;  2Y30 A;  3DPL C;  2M9H A;  2EIM H;  5DM6 F;  3PSI A;  4NDL A;  3MZH A;  2ZXJ A;  1LDD A;  1D1A A;  2XAG A;  1MSF C;  1S72 I;  3GFM A;  1OR7 A;  1FT9 A;  3FK6 A;  4A3E J;  3GWZ A;  4XK4 A;  4RBO A;  3HOX J;  1KON A;  2VKH A;  3EUK L;  3GZ5 A;  3L9F A;  4XID A;  3FDY A;  5J6X A;  2GXA A;  4HW0 A;  2VUM J;  4L9T A;  3HOZ J;  1I5Z A;  3CUO A;  4LK0 F;  4DYQ A;  5FB2 A;  1I1G A;  1MNE A;  3I64 A;  1U8B A;  4LG0 A;  3WE3 A;  2UWM A;  4RA2 A;  4EGZ A;  3J7A Y;  3FMQ A;  5H20 A;  4XL9 A;  4C3I J;  1T08 B;  1O4X A;  4BXX J;  2A6T A;  4HPQ A;  2RGV A;  5LGT A;  1UG2 A;  2P0W A;  4QIW N;  2NYX A;  3ABM H;  2V4J C;  1N25 A;  1UFM A;  1ORK A;  1LDK B;  4UXN A;  2A6E F;  1BOB A;  1PDN C;  4RM3 A;  5K7Z A;  3CJR B;  5L3C A;  4E7L A;  2R5Y A;  2K3F A;  4HNV A;  2K9S A;  1MSE C;  2K85 A;  2STT A;  2KDO A;  3TOB A;  5DCF A;  4CYC B;  1QQI A;  2E71 A;  4OWR B;  4OIP F;  1FOX A;  5A2Q K;  1JHF A;  4RGR A;  4DGW B;  3HHG A;  3BG9 A;  2BY2 A;  5AIP A;  1XCB A;  3K1N A;  3DQV C;  4XOR A;  5FFX A;  5D5X B;  1YYV A;  2H94 A;  2NOG A;  3A0B C;  2WAF A;  3WU1 B;  1F43 A;  2IGM A;  3NWT A;  2ZME B;  5ERI A;  1NG7 A;  4A0Z A;  4EJO A;  2O8K A;  4HG2 A;  1FSE A;  2RVC A;  5GAG J;  3U21 A;  4AIK A;  2HNH A;  2V1D A;  3O3K A;  2VN2 A;  2XIG A;  5LHG A;  1E0E A;  1X4P A;  4OMY A;  5JFR A;  3C1D A;  1I3Q J;  2NS0 A;  5J1Y A;  1H0M A;  3ERE D;  3AG1 H;  2JSC A;  3B6A A;  3GME A;  3DLL F;  2VB6 A;  2L2O A;  2FXA A;  2M4K A;  1UAA A;  3S3O A;  4AM3 A;  2DAO A;  4CYD A;  1A36 A;  4A0X A;  4GCV A;  4YEL A;  3MQ0 A;  3HPH A;  3RYR A;  1YJW I;  1YS7 A;  1ZEL A;  2IP2 A;  2OA4 A;  1JGS A;  1D8K A;  2DTR A;  2W57 A;  3LA3 A;  4ZYG A;  1EH6 A;  5EG0 A;  3RSN A;  5LHI A;  4JX6 A;  3ERM A;  5AIQ A;  4H0E A;  2HPI A;  1H88 C;  1GDT A;  1FOK A;  1TBX A;  2NAZ A;  4WK8 F;  3F9K A;  4DYR A;  3S1Q J;  3BLY A;  2Q0O A;  3CC4 I;  1BJZ A;  3BDD A;  2KKO A;  4O6J A;  1KZH A;  3CES A;  1TWG J;  2R5Z B;  3TO7 A;  2QKL B;  1XG1 A;  2ME6 A;  4X0G A;  4A3L J;  3HOV J;  1QRY A;  2TRT A;  4P5O A;  2R7Q A;  3ABL H;  2DW4 A;  1ZLJ A;  4KIB A;  3ABU A;  2IGN A;  2NVY J;  3I0T A;  3K4L A;  4XN3 A;  1GV5 A;  2GQQ A;  1T39 A;  1Y1V J;  2RQP A;  1TQP A;  3F6O A;  1OCZ H;  2XC7 A;  2LRD A;  4V19 K;  1ETO A;  1MMD A;  3LST A;  2VC1 A;  2HXI A;  2WAQ A;  5L3F A;  5J1R A;  2GAU A;  4CSW A;  4DOZ A;  1RR7 A;  2LG4 A;  3PIO F;  2LFB A;  3UR3 C;  5KVR A;  3U1K A;  3LAJ A;  1JUS A;  2AS5 F;  2X9D A;  1EF4 A;  3K4C A;  4ETS A;  5IYC J;  2CJJ A;  2XAQ A;  4EQQ A;  1QNT A;  2EZH A;  2DMU A;  2OTJ I;  1FPQ A;  2ZSI B;  2FA5 A;  4S05 A;  2M1B A;  4NBQ A;  3S3N A;  2XDV A;  4UNO A;  2L54 A;  4RM2 A;  2XGD A;  2Z2S B;  1PP8 F;  2VLA A;  4B47 A;  2DMT A;  1P2F A;  4GO1 A;  3V8K A;  4B09 A;  1DPR A;  1IDZ A;  3TDU C;  5HDN A;  4P55 A;  3LFK A;  4E7H A;  2E60 A;  1FMW A;  2O7O A;  1U8R A;  2R7F A;  1X1P A;  5IYB J;  5HDG A;  3HOY J;  3IC7 A;  5AON A;  1SFE A;  1AKH A;  1MGT A;  3HOS A;  1BI1 A;  2VI6 A;  4L0Y B;  5CKT A;  2E2I J;  2CS3 A;  3IH4 A;  5F64 A;  3DTE A;  1JHH A;  4M74 A;  4RAZ A;  5HS8 A;  2O8X A;  1ZG5 A;  2K9M A;  4D5C A;  2XSD C;  2OTL I;  1TWH J;  3I4M J;  3G1M A;  4BDZ A;  3RKX A;  2VBY A;  1ETQ A;  2HVR A;  1J9I A;  2IEK A;  3H3U A;  3T0Y A;  2GM4 A;  1KU2 A;  1TW2 A;  3S17 J;  3GUD A;  3MZ8 A;  1Z77 A;  1A6Q A;  1O7F A;  4B44 A;  1D1C A;  2LY2 A;  4CCK A;  1JE8 A;  4EEF G;  1RUO A;  2KRC A;  5DEQ A;  1T98 A;  3HUG A;  3H5R A;  4RB2 C;  2W24 A;  1BW6 A;  2UZK A;  2MD0 A;  2CU7 A;  2KPM A;  5KHD A;  2UUZ A;  2JPB A;  3C2G A;  2DI3 A;  1RRJ A;  2Z3Y A;  3JRF A;  1G59 A;  2VBZ A;  3CF2 A;  4PFO A;  4LIT A;  4NUB A;  3K9T A;  4IHY A;  4V2F A;  3F23 A;  3CJN A;  3A0H C;  1S3J A;  5FKK A;  2LP0 A;  3D5S C;  3PO3 J;  1D3Y A;  4HF1 A;  3V42 A;  1E3P A;  2R7O A;  1ETW A;  3A1Y A;  4M9S A;  4ZDO A;  2H8R A;  4JOM A;  2CGP A;  2EWN A;  3CCQ I;  3FK7 A;  3W6J B;  2DDA A;  1W36 D;  2YU9 J;  3HG9 A;  5TIS C;  2IPQ X;  3PO2 J;  4ITV A;  1SD4 A;  4I2O A;  4IQ4 A;  4A5M A;  2NVT J;  2OUM A;  4M6Y A;  1STZ A;  2F6C A;  2Y69 H;  4PFP A;  4AC0 A;  3LAP A;  2X85 A;  5HNF A;  4IOA F;  1R4M B;  5HS7 A;  3AKZ A;  3B6C A;  1WJF A;  4Z6Y A;  2EH3 A;  2BY0 A;  3BG7 A;  2VXD A;  1LVA A;  3OL4 A;  4EMS A;  2MSY A;  3N97 A;  2VQC A;  4ON0 A;  4Y52 J;  2FBI A;  5BPI A;  4IVN A;  2WA0 A;  2HR3 A;  3TW7 A;  1V5E A;  3FWE A;  3HSE A;  4C2M J;  3RTR A;  3WOD F;  3J80 Z;  2ELH A;  2F5V A;  3QP6 A;  3E6C C;  5C4J J;  2ZME A;  4FE4 A;  3Q0W A;  2BOL A;  3I3L A;  2NOJ B;  3HGY A;  1RUN A;  2IS4 A;  1D1B A;  2M7A A;  2JSP A;  4F91 B;  1AU7 A;  4UUS B;  3ZQL A;  2DLL A;  2QQ8 A;  3ULQ B;  3VOD A;  3COA C;  2N8G A;  2VJ4 A;  2FUG 2;  2ZSH B;  4LB6 B;  1RNL A;  4M3G A;  1HSJ A;  4CGZ A;  2Z9O A;  4ANJ A;  2HQ5 A;  2DA1 A;  1P4A A;  3HRU A;  1OCO H;  2PG4 A;  4NNJ A;  1IN5 A;  1OR7 C;  2VT2 A;  4HX7 A;  1ZGA A;  2M0M A;  2HOT A;  2NXN B;  2FD5 A;  2HVQ A;  4N4O B;  2RKH A;  2RN7 A;  3J7A O;  4I98 B;  3S15 J;  1IRX A;  1EA3 A;  2P6T A;  4XLP F;  2F5C A;  2VJJ A;  2MBF A;  3O8G A;  5LBQ A;  5K5R A;  4XON A;  2LC2 A;  4HRI A;  3K6G A;  4JK1 X;  3HDD A;  1H89 C;  2BZT A;  3ABK H;  1SFX A;  3SZT A;  1HW2 A;  5BQT A;  2V9P A;  1BIB A;  3KFW X;  2BE5 F;  2VOP A;  3HOW J;  2LBF B;  5CQG A;  1P92 A;  4BEH B;  1ETV A;  4A3B J;  4KN7 X;  2AQE A;  2XSJ C;  4ESB A;  3FXL A;  2Q8K A;  4JP0 A;  2HKX A;  5KK1 A;  1S8N A;  2DBB A;  1UZC A;  5ICF A;  4KMF A;  3O2P E;  5K7H A;  5LGN A;  3HOT A;  3JRH A;  2KDZ A;  1MBG A;  1T6S A;  1XSX A;  2IBD A;  2LDU A;  2ICW G;  3JRG A;  2ZME C;  4BHB A;  2HS5 A;  1GXQ A;  2MH9 A;  1OFC X;  1O3R A;  1Y56 A;  2EFO A;  3L7W A;  2L01 A;  1NTC A;  2VBX A;  4BQN A;  2PLY A;  2LBF A;  2Y0M A;  1W0U A;  1ZQ3 P;  2Q2E A;  1UMQ A;  2ELK A;  1YS6 A;  1TQM A;  1J59 A;  1QA6 A;  4KUM A;  5HLH A;  1MH3 A;  2X4H A;  4G8X A;  3WHC A;  5IP9 J;  3G6E I;  2R7W A;  4HSR A;  2GOX B;  5IT9 K;  2Q1Z B;  1K6O A;  2MYS A;  1U6G A;  1GUU A;  4XRM A;  3IH2 A;  1K7A A;  1WJD A;  3DF8 A;  2O61 A;  2VBW A;  1G2H A;  4MNU A;  1SVM A;  3Q9V A;  2CH0 A;  1E3O C;  2OZU A;  2WTE A;  3I9V 2;  2IVM A;  3K1M A;  2DOE A;  2NVQ J;  3AAF A;  3M8E A;  3S32 A;  1VQO I;  1B1B A;  1G3S A;  1WI3 A;  1S7E A;  2XF5 A;  4BDY A;  3A03 A;  5A2Q Z;  1ERD A;  2EIL H;  2JZY A;  1ZTR A;  2V1U A;  2DU9 A;  2V6C A;  1WPK A;  2DYS H;  1X1B A;  4GFB A;  3IUO A;  1FBU A;  1BR4 A;  1MIJ A;  1J5Y A;  2CUF A;  2XKP A;  1U5T B;  1TWF J;  2ID6 A;  1HLV A;  3MAJ A;  1PJR A;  5FLM J;  2NRA C;  2TCT A;  3OIP A;  5JI6 A;  1HST A;  1RKW A;  2PBI A;  4GYI A;  2EB7 A;  1REP C;  3SXY A;  4BBR J;  1IW7 F;  2HYF A;  5F6F A;  4UY8 I;  4LD5 A;  1T56 A;  2KJB A;  3ZGK A;  5HOD A;  3WTV C;  4G6D A;  3JRA A;  2E5Z A;  5DCM B;  2KRH A;  4CCM A;  1IXS B;  2DMQ A;  4F7Z A;  3H3V K;  3MKY B;  5FKO A;  4G94 A;  3OIQ A;  3VEP A;  4ZZL A;  1LE8 B;  3BR5 A;  1MH4 A;  2KMU A;  4Y33 A;  1B72 B;  1Z7L A;  1HC8 A;  3SYT A;  1X19 A;  1HW1 A;  2V7F A;  3E3V A;  3WGH A;  4KIT B;  3OSG A;  4BEH A;  5L3B A;  4XMY A;  3CLQ A;  3E6D A;  2H1K A;  4G6Q A;  2M0C A;  1OLT A;  5TJJ A;  1D0Z A;  1WQ2 A;  1FOY A;  4ZC3 A;  4HQE A;  2BV6 A;  1X1C A;  3GTO J;  2MFZ A;  2EZL A;  5E20 A;  4HDV A;  1DU0 A;  2E1M C;  1ZAR A;  1IAW A;  1NH3 A;  1QHH D;  1LE8 A;  2K02 A;  3FM3 A;  3GZ6 A;  1VTN C;  3PFI A;  2V1N A;  5BNG A;  2GZW A;  3PSF A;  2E5N A;  1KQ9 A;  2XGC A;  1J75 A;  1F5T A;  3OYM A;  2V1X A;  3OYH A;  1P9Q C;  3H35 A;  4XOT A;  4EV0 A;  2ADU A;  1YX5 A;  1DP3 A;  2KHM A;  2XAH A;  3H0D A;  4Y3O A;  2VPL A;  2EIJ H;  1EH8 A;  3H9J A;  3WG7 H;  4Q48 A;  1QBJ A;  2ECC A;  1ONV A;  1T0F A;  2F4O B;  3QOD A;  1FC3 A;  2TDX A;  2HOA A;  2MW8 A;  3H92 A;  2KJC A;  1BIA A;  3A4C A;  1YRN A;  1UCR A;  5D8L B;  1F36 A;  2KLO A;  3V7S A;  3S93 A;  4A12 A;  2PFB A;  5J4Y A;  3FXU A;  4PGH A;  4L5J A;  2E1N A;  2B0L A;  2DT7 B;  1NHA A;  2X48 A;  5FKN A;  3I58 A;  4EJT A;  5KCM A;  3BT9 A;  1Y0N A;  1Z05 A;  2HTS A;  3N4M A;  4WWC A;  1LQ1 A;  3BG5 A;  1PUF B;  3TOA A;  5EEA A;  2DMN A;  2LK2 A;  3CCR I;  4EAT A;  3U2R A;  3AL0 C;  4HLX A;  3BTI A;  4XSX F;  2XB5 A;  1VF9 A;  1R22 A;  2HEO A;  2CQK A;  2OAZ A;  5JHF A;  4PCQ A;  2WY7 Q;  3KEY A;  2JA8 J;  5EYR A;  3C2B A;  4RS8 A;  4PJN A;  1JTX A;  4BKX A;  1S5L C;  2VPR A;  4LK1 F;  3ZMU A;  4U87 A;  1XDS A;  2E2J J;  4B3X A;  1ACI A;  4OU0 A;  5M3M J;  3CC7 I;  4XQF A;  2M34 A;  3S3M A;  4KIC A;  1J7K A;  2G7U A;  3OYN A;  5C44 J;  2GIV A;  2KZG A;  1JXS A;  1RC9 A;  4ZYD A;  4C2U A;  1HKS A;  2QGU A;  4HX8 A;  3RPU A;  3WG9 A;  4I09 A;  2QZ8 A;  2PI0 A;  2L5Q A;  2HDD A;  4LLL A;  5IY5 H;  1WJC A;  2IS6 A;  2KIU A;  3Q5F A;  1U78 A;  4P96 A;  2WC2 A;  1XGO A;  5LLQ A;  3L2V A;  2ZNY A;  2EIK H;  4BJT A;  2KT0 A;  3TP3 A;  1XGM A;  1OQY A;  3DEU A;  5ICG A;  2XPU A;  4IHV A;  4X1E A;  3CCM I;  3BWG A;  2L9N A;  3VYU B;  2GLO A;  4KA4 A;  2BVL A;  4RAG A;  2VL8 A;  4A6E A;  1VI0 A;  1X3W B;  3S14 J;  3PL8 A;  3WE2 A;  2ACJ A;  1RES A;  1SAX A;  4F92 B;  4BY7 J;  5IP7 J;  5TGT A;  2O03 A;  1XGN A;  4UV9 A;  2L02 A;  1WVR A;  3BJO A;  3PUB A;  3BG3 A;  1FP2 A;  2X0L A;  1U9N A;  2XKO A;  4RB1 A;  4CZZ A;  5HNH A;  5LRR A;  1QZE A;  2FQ3 A;  5LGU A;  3Q3S A;  2CW7 A;  2VT3 A;  3CO6 C;  5B1A H;  4CDG A;  4CA0 A;  2OQR A;  1ON2 A;  5ILU A;  3ASO H;  2M3A A;  4BYY A;  1MDM A;  4CCL A;  2XV4 S;  4LIV A;  2KL4 A;  3BTJ A;  3FKI J;  5CVV A;  1U5T A;  2L4M A;  3DP7 A;  4LGW A;  4D0P A;  4Q4Z F;  1FWZ A;  3IKV A;  4LFU A;  3AG4 H;  3OWT A;  4FIS A;  4M9X A;  4HA8 A;  3KZI C;  4GGG A;  3S1R J;  4IPA A;  3ZOB A;  4RLF A;  4R8H A;  4MEY F;  2NVU B;  1FMV A;  2M8E A;  4KN4 X;  1C0W A;  3KLO A;  3GTQ J;  1W5C C;  4NC7 A;  2V6E A;  1IDY A;  1B59 A;  4XM3 A;  1NK2 P;  1USS A;  4MIM A;  3NAR A;  1HDP A;  2QYO A;  1I39 A;  1YG2 A;  4G7O F;  3CUQ B;  1MW7 A;  3W2A A;  1VND A;  3E97 A;  3BJ6 A;  5CQE A;  4A3M J;  1R1U A;  5C4X J;  2M5W A;  4IL6 C;  2GOM A;  2DPD A;  3D1N I;  1IRF A;  2CQN A;  1P6R A;  1IN4 A;  2JN6 A;  2WAQ N;  4D7M A;  1WGX A;  3E5X A;  2F4I A;  2QQA A;  3KP5 A;  2ID3 A;  1RPW A;  2DDB A;  1GVJ A;  3BR6 A;  3LOC A;  3ONQ A;  2M8G X;  1IXC A;  3QP5 A;  2EIN H;  1ZAO A;  2CQQ A;  2FQ4 A;  3IP4 B;  3E1S A;  2ZXH A;  4Y13 A;  5E1Z B;  2ME0 A;  1DDN A;  3FX3 A;  1OPC A;  4UUT A;  3HTU A;  1MBJ A;  3HM5 A;  4E7I A;  3E6B A;  3Q0U A;  2RNJ A;  2E7X A;  3ZQH A;  4UVB A;  1R4N B;  1G6N A;  1L0O C;  2O9L A;  2MD5 A;  2Z16 A;  3F8N A;  4LIU A;  2X6X A;  1FYL A;  1JUM A;  1SMT A;  1I6H J;  5FLX K;  1W7P D;  4PZJ A;  3OS1 A;  3I4P A;  2P4W A;  5JLX A;  1FJL A;  3LSG A;  2FMY A;  4EM0 B;  1YIO A;  1FYM A;  2D5V A;  1FIA A;  1ZG1 A;  2PJP A;  1L3L A;  2EK5 A;  4RLQ A;  4MQV A;  3JRE A;  2FX0 A;  2JWT A;  1KQ8 A;  3WTS C;  2A68 F;  1QO0 D;  2M4G A;  5E1W A;  3DBL B;  2ZJP F;  5C3E J;  1GXP A;  3IAS 2;  4HZF A;  4LJZ F;  4MFE A;  4CUG A;  3DBR B;  1FBQ A;  4G9Y A;  2Z5U A;  3A01 A;  3CMM A;  1YQA A;  3D5R C;  1MBE A;  3J80 K;  3MN2 A;  4ZTF A;  1V55 H;  1YO5 C;  3S2D J;  1IRZ A;  2EQR A;  5JVG F;  1SC7 A;  3OYK A;  4EJV A;  3M4O J;  3J81 Z;  3BZ6 A;  3K0L A;  3LNQ A;  3OL3 A;  1FYK A;  1FTZ A;  2DA4 A;  4L18 B;  2NS8 A;  1I3A A;  4EM1 A;  1FZP B;  2HDW A;  1Y6I A;  4MTD A;  1MBH A;  2JRT A;  2K4J A;  3EYY A;  3TL4 X;  5J8F A;  5D5V B;  3RQI A;  5E3M A;  1K79 A;  3QOE A;  2DOA A;  4LG3 A;  4UUS A;  2K5C A;  4IRI A;  2L4A A;  1LEA A;  1SAN A;  1FX7 A;  3H5N A;  2VOO A;  4XN0 A;  2DT5 A;  2W4S A;  5D8K B;  4BE2 A;  2QBY A;  3EET A;  1IXR C;  2D45 A;  1HCR A;  1JKR C;  3MZY A;  2ZO4 A;  3FZV A;  5F0H A;  3HHH A;  3V8L A;  2DJI A;  2MLG A;  1T2K A;  2F5F A;  1TP4 A;  4E7K A;  5D6E A;  4BQQ A;  5GP9 A;  1P7I A;  2IW5 A;  4XLE A;  2M30 A;  2WBM A;  3TO6 A;  2IAI A;  3SEQ A;  5ICE A;  3L09 A;  4M6V A;  5K1Y A;  3M07 A;  4OMZ A;  1V3F A;  4A3D J;  3R6S A;  3DU5 A;  1MJ9 A;  2LKX A;  1K61 A;  3MKZ A;  2QBY B;  1JKO C;  4TV7 A;  3ZMD A;  3JRC A;  3RJP A;  5CVI A;  2K86 A;  3DLA A;  1UHS A;  4F55 A;  2V26 A;  3GO5 A;  1SEU A;  1HKQ A;  1P7J A;  4A3K J;  2OF7 A;  5FD6 A;  3BZC A;  2EFP A;  4MFD A;  1YTY A;  4D9J A;  4I02 A;  5FRN A;  2CWE A;  2V9K A;  2MC4 A;  3CCL I;  2VON A;  2CFO A;  2RRE A;  4U88 A;  3CP2 A;  1WHU A;  2OV7 A;  3VYS B;  1BW5 A;  4K2E A;  1IG7 A;  3CMA I;  3L2Q A;  1CQT A;  3ZMT A;  1FNN A;  3OYD A;  4ESJ A;  1FY7 A;  3RZO J;  1UG0 A;  5IOZ A;  2XPW A;  1KU9 A;  1VZ0 A;  3Q0V A;  1WJB A;  1SFO J;  2QQB A;  3V4G A;  4L5E A;  1FP1 D;  4WXC A;  3SFZ A;  1RIO H;  3RIR A;  2AHQ A;  3F8C A;  2DPU A;  4L9J A;  3LL7 A;  3OYE A;  2C6Y A;  1IF1 A;  3VWB A;  2LY9 A;  3FF5 A;  3GZN B;  1OCR H;  1B9M A;  3RDI A;  3CCJ I;  1V4R A;  2LF7 A;  3WTW C;  4DJA A;  5GPA A;  3M8J A;  3ZQI A;  4O5V A;  4AYB A;  4BBS J;  4XBF A;  3M9A A;  1XD7 A;  4BHC A;  4IX7 A;  1HF0 A;  3KYD B;  3TP0 A;  3BCB A;  4YFK F;  4E70 A;  4YFX F;  1MNM C;  2OD5 A;  4J00 A;  3IRQ A;  3I5U A;  3QQA A;  2OC6 A;  1EH7 A;  2LSO A;  2EBI A;  3DTK A;  5F27 A;  3ZQG A;  3ZP5 A;  2VE9 A;  2CYY A;  2EA2 A;  1VQM I;  4ZDL A;  1BC8 C;  3VFZ A;  3MFK A;  3JRB A;  2B9S A;  5FFZ A;  4ZJZ A;  3CCU I;  1JJ6 C;  4E7J A;  2P7C B;  4XLC A;  1TL8 A;  3LSR A;  1UHM A;  3I59 A;  5IYD J;  3ISP A;  3KEO A;  2HZD A;  3OOU A;  5GAH J;  4OIQ F;  2DQL A;  1IO2 A;  5B1B H;  3ECH A;  2W84 A;  4UV8 A;  1HBX G;  4XRS A;  1BN5 A;  4B1R A;  2FE3 A;  1R49 A;  4OAY A;  2JUG A;  1T8I A;  5B5E C;  2DJN A;  3S1M J;  2E34 A;  2H8W A;  1UST A;  3ZQF A;  5FLX Z;  4BHP A;  2E1C A;  1ZN2 A;  4YII A;  5H2F C;  4UUV A;  1MMS A;  3HTS B;  3DV8 A;  3LSI A;  4B4C A;  4RGS A;  5ILV A;  4FX4 A;  4A3C J;  5M5X J;  3WHB A;  2JTV A;  1HW5 A;  3O6B B;  4RMN A;  4LB5 A;  2COB A;  3T1B A;  5DTD A;  1QVU A;  5TRD A;  1Y1W J;  3K1P A;  3MKL A;  2IA1 A;  2R7V A;  2BEO A;  3QU6 A;  1IV8 A;  3R4K A;  4HDU A;  2R7Z J;  2Y2Z A;  5D6F A;  1I6X A;  4CYC A;  2Y0S N;  4QSH A;  3TO9 A;  1VQ9 I;  4MTE A;  1B72 A;  3KE2 A;  3IL2 A;  1OYI A;  1G3T A;  3I71 A;  1MJA A;  1XDU A;  2FF4 A;  1TZL A;  3QYF A;  3DKY A;  3PIP F;  5FKM A;  4G12 A;  3SHF A;  3LQQ A;  3UNG C;  3OYB A;  2WY8 Q;  2QA4 I;  1V5G A;  5DD8 A;  1QHG A;  2WAE A;  3RPU D;  3S8P A;  3ZQQ A;  4YIF A;  2QSF X;  1S7A A;  4GXO A;  3TBI A;  3SJM A;  4YG2 F;  4XKV A;  2WV1 A;  4FE7 A;  1OMI A;  3DPT A;  2R7S A;  5EEG A;  2L0K A;  3E7L A;  3H9G A;  2JUC A;  4FT8 A;  5LHH A;  3SQN A;  4II3 A;  1YI2 I;  2A3S A;  3CDI A;  3QRF F;  2K9L A;  2R7R A;  3CCE I;  2PJR B;  3OYF A;  2Z99 A;  3F8F A;  3E5Q A;  3IRR A;  3OYI A;  2FBK A;  3QYE A;  5FKL A;  4HQM A;  2QVO A;  3EYI A;  2AQF A;  4KIS A;  1SD5 A;  3HZJ A;  3I59 B;  1ZH5 A;  3T8T A;  1I50 J;  3F8M A;  2GA2 A;  5GPC A;  2A61 A;  5DD4 A;  3WGG A;  4ZYE A;  4P1W A;  1YHQ I;  2JQ7 A;  4CHU A;  4ZYA A;  3S2W A;  1OKR A;  3VB2 A;  1XC5 A;  4L9N A;  2EV5 A;  1XMA A;  4P9F A;  3K2Z A;  2W48 A;  3QPT A;  4J01 A;  3D0S A;  3SZP A;  2BY3 A;  2EZI A;  1W1W E;  5E8G A;  1R7J A;  3OS0 A;  6PAX A;  4IF4 A;  1IC8 A;  1SAU A;  1JJ8 C;  3FBI B;  2YS9 A;  1Z21 A;  3KP4 A;  2CQX A;  2XPV A;  3FBN B;  2D1H A;  3HSF A;  3RKY A;  4B43 A;  3L1P A;  2X51 A;  4I76 A;  1XX5 A;  3K4J A;  4MEX F;  4HV5 A;  4QPO A;  1Y0U A;  1XSV A;  2V79 A;  5BMZ A;  3DFG A;  4HX4 A;  2E7W A;  5LEK A;  1Q1H A;  3I54 A;  4ESF A;  1R00 A;  2LYC A;  2KFD A;  1W5T A;  3F22 A;  3LWF A;  3JTH A;  4II2 A;  1DU6 A;  2L7M P;  1Z67 A;  2G0E A;  2KIQ A;  2YPR A;  2Y9Y A;  3R60 A;  1TWA J;  4ZZD A;  1AKH B;  4F3Q A;  4L9V A;  4W1U A;  5KAF C;  2H09 A;  3FXQ A;  4KFC A;  1WH5 A;  3G71 I;  2VJ5 A;  1Q1V A;  2ZXI A;  2NNY A;  3NEU A;  4BE1 A;  1HKT A;  1OIS A;  4LG0 B;  1DUX C;  3A01 B;  1GT0 C;  4ENK A;  4G7H F;  1VFC A;  2QQ9 A;  2R3S A;  3ZRG A;  3GTG J;  4WX9 A;  2NS7 A;  2Y31 A;  1YE9 A;  2X1E A;  1XN7 A;  1CF7 A;  3GTL J;  5HVQ C;  5GAD J;  1X2N A;  1VQ5 I;  2IJL A;  3BZK A;  3EDP A;  1KU3 A;  2IXS A;  1Z1D A;  3KZY A;  3L2R A;  2XRO A;  2OJE D;  4RGU A;  2DFE A;  1K6Y A;  2DK5 A;  4RAF A;  2WV0 A;  2ZBK A;  2EV0 A;  1MMN A;  4HEA 2;  3RKW A;  1WJA A;  2Z1D A;  4YIR X;  2UV1 A;  3DCF A;  2CSO A;  2LVS A;  3HGG A;  1BM9 A;  1ZG3 A;  1ZK8 A;  3FMR A;  4ENJ A;  4B3A A;  5L3E A;  4GDF A;  2FNP A;  3BRO A;  3LSK A;  4D1Q A;  1R58 A;  4N4N B;  1LFU P;  4CCN A;  4BNC A;  5ED4 A;  2QF7 A;  1VQ7 I;  1Z3X A;  2LY1 A;  1V5F A;  2RV8 A;  3K4K A;  2LTP A;  3TMO A;  3FHN A;  1XB4 A;  3H5A A;  2K9Q A;  2MA3 A;  2NNN A;  1IZ1 A;  2CRG A;  3SDG A;  4A0Y A;  3BR2 A;  3NWS A;  4RB0 A;  2EJR A;  2IGO A;  2P6S A;  1VQ4 I;  2QKM B;  3QU3 A;  3CMY A;  2P81 A;  5HLI A;  1D5Y A;  1BJA A;  3ZMV A;  5IPA A;  3FXM A;  3GVA A;  2W85 A;  3J7Y J;  3CO7 C;  4J19 A;  3ZXS A;  1VQN I;  1S7O A;  2X1D A;  2H27 A;  3BTC A;  1R23 A;  1S29 A;  3B02 A;  3P9C A;  3PNV A;  2ESH A;  1D0X A;  4WCG A;  4YEJ A;  2IRF G;  4HNU A;  1PP7 U;  1RET A;  4XKW A;  3TDZ C;  2HYG D;  4MQ9 F;  3CTA A;  3HPG A;  3P5J A;  1YIJ I;  4OIO F;  2KIF A;  2JA2 A;  4XIC A;  3OYC A;  2DA7 A;  3FIW A;  1BI0 A;  4DQ2 A;  1D0Y A;  1LEB A;  2J5P A;  3OYA A;  1JI8 A;  3JSO A;  3D5L A;  3HKZ A;  4JX4 A;  1BR1 A;  4E7S A;  2IA2 A;  3JCU C;  1X3Z B;  3GF2 A;  2KP6 A;  3OIO A;  4I6Z A;  1DPU A;  4IEJ A;  2OPT A;  2XRN A;  4GYG A;  2JMW A;  3LSJ A;  2WWY A;  2LD5 A;  2DO7 A;  3E5U A;  1ZGJ A;  5H6R A;  2LKS A;  2DXI A;  1IRG A;  3HB9 A;  1GV2 A;  4OIR F;  5E18 F;  1P4W A;  2BXZ A;  2DN0 A;  1W7P B;  4FAS D;  5E1X A;  3F0C A;  2R4G A;  3DXJ F;  3G3Z A;  4Z2Y A;  1M1E B;  2YX7 A;  2GWR A;  3RI4 A;  2GXG A;  3KIO A;  1R1T A;  2KRF A;  4L5I A;  2GBY A;  3CJT B;  1QPI A;  1P4X A;  2ESN A;  3CQZ J;  2ZXW H;  3ZQC A;  2E36 A;  5IP6 A;  3I56 I;  3I55 I;  1X4O A;  2CW0 F;  1HA8 A;  2JA7 J;  1DGW Y;  5F08 A;  1QZY A;  1Z0X A;  4NHJ A;  5BPD A;  1TWC J;  1WRJ A;  1F9N A;  3BJA A;  3CCS I;  3RQ4 A;  2OCC H;  3BQZ A;  4U0Y A;  1T0F C;  1JUP A;  2XF7 A;  3H36 A;  3HRS A;  5H6Q A;  2VC0 A;  2EFW A;  5J3L A;  5D5U B;  1U5T C;  3UKG A;  1VQP I;  4IQJ A;  1IUY A;  3IV5 A;  2BW3 A;  3SZG A;  1K4T A;  2IGK A;  3WGI A;  2PN6 A;  2FJ1 A;  4GRI A;  2YR2 A;  1BR2 A;  3OSF A;  3KYC B;  1SFU A;  1EJ9 A;  3QOP A;  1POG A;  2DFI A;  3M1C A;  3MEX A;  4BJ5 C;  4BQO A;  3J7Z I;  3OYL A;  3OS2 A;  3JSP A;  2R5Z A;  2ZCW A; 
#chains in the Genus database with same CATH homology
 2M4G A;  3EUH C;  3MKW B;  3IAS 2;  4CUG A;  3SDB A;  1GLN A;  2BOL A;  3I3L A;  2BW3 B;  4BUP A;  2NOJ B;  4PJL A;  4AVZ A;  3OYJ A;  1D1B A;  2M7A A;  2IS4 A;  3CMM A;  3D5R C;  2VKD A;  2JSP A;  4F91 B;  4ZTF A;  2L9S A;  2CV2 A;  1J09 A;  4PUS A;  2VJ4 A;  2FUG 2;  2ZSH B;  1X1D A;  3OYK A;  4XNF A;  2MAB A;  1N75 A;  3ZCO A;  3OL3 A;  4C2T A;  2VQH A;  4ANJ A;  2JVG A;  2KZV A;  3VDX A;  2Y0S A;  3HL2 A;  4BE0 A;  2HDW A;  1Y6I A;  5LD2 C;  3TL4 X;  5FRO A;  2X6W A;  3PNY A;  4NNJ A;  3QOE A;  1OR7 C;  2DOA A;  4LG3 A;  2K5C A;  3K4B A;  2M0M A;  3H5N A;  3IAM 2;  4XN0 A;  4N4O B;  2HVQ A;  5KNL A;  4C9Y A;  2W4S A;  4BE2 A;  2XAU A;  3DTI A;  1IRX A;  3OR1 C;  1EA3 A;  4KJZ A;  3LSM A;  2W1O A;  2R7X A;  3E0J B;  4PJM A;  2DJI A;  2VJJ A;  1R6R A;  4BL0 B;  2KQR A;  5HLT A;  1TT0 A;  4E7K A;  4BQQ A;  3K4M A;  4IZZ A;  4XON A;  4XLE A;  2LC2 A;  4HRI A;  3FKJ A;  1S9H A;  3K6G A;  3VYR B;  2WBM A;  3SEQ A;  3AFH A;  2VAS A;  4R79 A;  3DU5 A;  2IS2 A;  4XKC A;  3MKZ A;  2LBF B;  5CQG A;  4YRV A;  2HVS A;  2BVM A;  3CZ6 A;  4BEH B;  2AQE A;  2XSJ C;  3OY9 A;  2PMZ A;  3DLA A;  3L2U A;  1N78 A;  4F55 A;  2V26 A;  4XR6 A;  1AA7 A;  2K3P A;  2CUJ A;  4OAZ A;  3HOT A;  1QU3 A;  5FRM A;  3PJR A;  2LOO A;  3OYG A;  1MMA A;  4XLA A;  4D9J A;  2CV0 A;  5FRN A;  1Y56 A;  2V9K A;  2MC4 A;  1SFK A;  2VJI A;  2CFO A;  4PK4 A;  4MLO A;  2RRE A;  4BQN A;  3CP2 A;  3VYS B;  2OV7 A;  2LBF A;  4U7B A;  3L2Q A;  3AL0 B;  3K4N A;  3OYD A;  1UG0 A;  2HQA A;  2R7W A;  3K70 D;  1VZ0 A;  1WJB A;  4HSR A;  2GOX B;  2Q1Z B;  3EPZ A;  2MYS A;  3KYL A;  4CCJ A;  1WJD A;  4F93 B;  4DBQ A;  4BJ6 C;  3LL7 A;  4ZDP A;  3W3C A;  3OYE A;  2CH0 A;  3VWB A;  3PNT A;  4CH7 A;  3I9V 2;  3DU6 A;  1W36 C;  4HST A;  4DJA A;  3M8J A;  3S32 A;  3BCA A;  4AYB A;  2XF5 A;  4BDY A;  3K70 C;  3K10 A;  4IX7 A;  3W2W A;  1ERD A;  2XF6 A;  1DQU A;  3BCB A;  2W00 A;  3BG6 A;  4J00 A;  1X1B A;  2RNG A;  2A5W A;  3IUO A;  2OC6 A;  2I8D A;  3DTK A;  1BR4 A;  4ZDL A;  4PJJ A;  4PSW A;  4ZJZ A;  2PJR A;  2CUZ A;  1WFX A;  4E7J A;  3DWL E;  4XLC A;  1PJR A;  1NG6 A;  3OIP A;  2Q2E B;  2HZD A;  3OOU A;  2L7K A;  2HU9 A;  4FET A;  3DPU A;  3ZGK A;  4OAY A;  2W82 A;  2JUG A;  4CZC A;  1WJ5 A;  1LFP A;  4JQF A;  2E5Z A;  2KRH A;  4CCM A;  1Z3Y A;  3DPL C;  1WJE A;  4XOP A;  3PSI A;  3MKY B;  3OIQ A;  3LSI A;  1D1A A;  3EUA A;  2KMU A;  1G8X A;  4Y33 A;  1Z7L A;  3A2K A;  3SYT A;  1X19 A;  2V7F A;  4RMN A;  4KIT B;  4BEH A;  4XMY A;  1KON A;  2VKH A;  3EUK L;  1OLT A;  2O5R A;  2R7V A;  1D0Z A;  1U0J A;  3FDY A;  3LSH A;  1PYV A;  2X6Y A;  4ZC3 A;  1MNE A;  4B48 A;  1X1C A;  2MFZ A;  2UWM A;  2E1M C;  3J7A Y;  4E4H A;  3CP8 A;  1QHH D;  4XL9 A;  1TZL A;  2V1N A;  3QYF A;  2A6T A;  3DKY A;  3PSF A;  3OYB A;  3UNG C;  2E5N A;  4HPQ A;  2WY8 Q;  3OYM A;  1V5G A;  2P0W A;  1QHG A;  2WAE A;  3RPU D;  3S8P A;  3ZQQ A;  3OYH A;  1P9Q C;  4E6K G;  3H35 A;  4XOT A;  3TBI A;  2V4J C;  4XKV A;  1LDK B;  1YX5 A;  5CPR B;  1DP3 A;  2KHM A;  3DPT A;  2R7S A;  2WB1 A;  3H9G A;  1BOB A;  3H0D A;  4RM3 A;  4Y3O A;  3CJR B;  4E7L A;  2CW8 A;  4II3 A;  2VPL A;  2KDO A;  2K9L A;  3H9J A;  2R7R A;  2PJR B;  3OYF A;  3QOD A;  4OWR B;  3C2H A;  3OYI A;  4ZTJ A;  3A4C A;  2LRE A;  3QYE A;  2KLO A;  3HXL A;  2AQF A;  3S93 A;  4KIS A;  4DGW B;  5HOO A;  4DIQ A;  3DQV C;  4XOR A;  2LH9 A;  2DT7 B;  2WAF A;  2IGM A;  3GBG A;  3NWT A;  1NG7 A;  4P1W A;  5KCM A;  4HG2 A;  2R7U A;  4ZYA A;  3U21 A;  2HNH A;  1E0E A;  1X4P A;  4J01 A;  4EAT A;  2W7N A;  4BXF A;  5LFA A;  3AL0 C;  3DEE A;  3OS0 A;  1SAU A;  3FBI B;  2VB6 A;  1Z21 A;  2L2O A;  5JHF A;  1UEL B;  3FBN B;  3PFY A;  2M4K A;  4B43 A;  2WY7 Q;  1UAA A;  3KEY A;  3S3O A;  2X51 A;  4YEL A;  2WAD A;  2VQL A;  4PJN A;  3HPH A;  1ZEL A;  3K4J A;  4QPO A;  4HNT A;  4U87 A;  3RSN A;  4NQW B;  4B3X A;  1DGR M;  2HPI A;  2LYC A;  4XQF A;  3S3M A;  3F9K A;  3BLY A;  4II2 A;  3OYN A;  3OMY A;  4F3Q A;  4C2U A;  4AU7 A;  3CES A;  2L5Q A;  2QKL B;  3KX2 A;  4X0G A;  2VJ5 A;  1WJC A;  2ZXI A;  4P5O A;  4BE1 A;  2R7Q A;  4XKB A;  2IS6 A;  4BS9 A;  3ZRG A;  2IGN A;  3MMY B;  3RCO A;  4KT6 A;  3K4L A;  4XN3 A;  3L2V A;  1YE9 A;  2X1E A;  4BJT A;  3W2V A;  3LMM A;  5HVQ C;  2XC7 A;  2LRD A;  4E7Z A;  1MMD A;  3VYU B;  2L9N A;  4BAC A;  4G6T B;  2IXS A;  2CMP A;  3L2R A;  2BVL A;  2VL8 A;  2WAQ A;  4DBR A;  1K6Y A;  4CSW A;  4DOZ A;  3PL8 A;  2LG4 A;  1MMN A;  4HEA 2;  3UR3 C;  4F92 B;  1WJA A;  4IKF A;  5TGT A;  2Z1D A;  2UV1 A;  2VQG A;  4D1Q A;  3K4C A;  3LSK A;  4N4N B;  3PUB A;  4CCN A;  2CV1 A;  4PSX A;  2IS1 A;  3SEZ A;  1Z3X A;  2LY1 A;  4QPQ A;  5HNH A;  1V5F A;  2ZSI B;  4Y4R A;  3K4K A;  4NC8 A;  3S3N A;  2XDV A;  3TMO A;  3FHN A;  2CW7 A;  4RM2 A;  2Z2S B;  3H5A A;  2M7B A;  4CA0 A;  2VLA A;  2E1M B;  2M3A A;  3NWS A;  4CCL A;  2IGO A;  4B47 A;  4LIV A;  1MND A;  2QKM B;  3ZR8 X;  2KL4 A;  4E7H A;  2E60 A;  1FMW A;  2RQQ A;  1N77 A;  3CJQ B;  1T95 A;  4CCO A;  3ZXS A;  3VSK A;  2X1D A;  3PNV A;  1D0X A;  3OWT A;  4YEJ A;  4BGD A;  3N05 A;  4HNU A;  3HOS A;  4XKW A;  3HPG A;  5CKT A;  4RLF A;  2CS3 A;  2JVH A;  3DTE A;  3HUG B;  1FMV A;  2JA2 A;  2K9M A;  3OYC A;  3VSL A;  4NC7 A;  3DKX A;  1X1A A;  4BDZ A;  2V6E A;  1D0Y A;  2HVR A;  4XM3 A;  2ZFU A;  3OYA A;  1MW7 A;  1JI8 A;  3D5L A;  4H4K C;  3HKZ A;  1BR1 A;  3G2B A;  3W2A A;  4E7S A;  2DT6 A;  4B44 A;  1D1C A;  2LY2 A;  3H9Q A;  5CQE A;  2DCE A;  4CCK A;  2KP6 A;  3L2W A;  2GOM A;  2KRC A;  1LVK A;  3LFU A;  3H5R A;  2X1C A;  1LKX A;  2DXI A;  2MD0 A;  2KPM A;  5KHD A;  2F4I A;  2UUZ A;  4FAS D;  3C2G A;  2R4G A;  3QYB A;  1G59 A;  3ONQ A;  3CF2 A;  4PFO A;  4LIT A;  4NUB A;  4XLH A;  3MD2 A;  3D5S C;  3IP4 B;  3E1S A;  3V42 A;  2ZXH A;  2R7O A;  4ZDO A;  3A1Y A;  3BC8 A;  4JOM A;  1X4O A;  1HA8 A;  2R7T A;  4E7I A;  2ELJ A;  1W36 D;  1DGW Y;  3HG9 A;  4C30 A;  4ITV A;  3HC7 A;  4F52 A;  2HPM A;  4IQ4 A;  2OUM A;  1YX3 A;  2F6C A;  3RQ4 A;  2Z16 A;  4PFP A;  4LIU A;  2X6X A;  2VXZ A;  2X85 A;  5HNF A;  1T0F C;  2XF7 A;  3OS1 A;  4BU2 A;  3AKZ A;  1WJF A;  4IQJ A;  3BG7 A;  1MMG A;  2VXD A;  3LSG A;  2BW3 A;  3OL4 A;  3SZG A;  2IGK A;  4XLF A;  2VQC A;  3OR2 C;  4GRI A;  1BR2 A;  2WA0 A;  4RLQ A;  2VIX A;  3M1C A;  1V5E A;  4BJ5 C;  4BQO A;  3OYL A;  3OS2 A;  3VYT B;  3RTR A;  2F5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...