2XC7A

Solution structure of phax-rbd in complex with ssrna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
GAMAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORYLATED ADAPTER RNA EXPORT PROTEIN
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xc7A00
2W4SA 2XC7A
chains in the Genus database with same CATH superfamily
4LD5A 2ETHA 2HXOA 3DEUA 3S1RJ 1T6SA 3M7GA 3GUDA 3DU5A 4HLYA 3VEPA 3LAPA 2A3SA 3FM3A 3U21A 1FX7A 3L9FA 3CP2A 3LQRA 3S3MA 4HYEA 1XD7A 1POGA 4PGHA 4HBLA 1BA5A 2E5ZA 1GLNA 4Y4RA 1JUSA 2OZ6A 1MKMA 5HS9A 2GZWA 1MBGA 4UB6C 2JSPA 4C3IJ 1FSHA 1P4WA 3OYHA 5DD8A 1LVKA 2DN0A 4XKBA 4FCYA 4KT6A 3WE2A 2F5DA 3JRDA 4PFOA 5BOXA 3BY6A 2XGCA 4LB6B 2VBWA 3E6BA 1X1DA 2DBBA 2X0LA 1VQNI 3C2GA 2IS6A 2WAEA 2JVHA 4I76A 3LA2A 2NOGA 1J09A 1CF7B 4RS8A 3ZMZA 3HPGA 5FLVA 4ENMA 3DTIA 2ZXIA 4ENNA 5IP7J 3KYDB 3TP0A 5DCMA 1JGGA 4F52A 1IG7A 4CCNA 3S17J 3BG3A 1GV2A 3HRUA 2KT0A 3S16J 3HB9A 4AWXB 2PJRA 1W4MA 3HXLA 1SD6A 2R7RA 1YFHA 3KLOA 4A3GJ 3KP4A 1SVMA 1UELB 2M34A 4L18B 3KP5A 1HXDA 1MDMB 2QENA 2DO7A 4B48A 4I2OA 2DMTA 3OYFA 2H1LA 4FT8A 2LKPA 2F5VA 2K3PA 2ZMEA 2IW5A 5CVUA 3P9IA 2R7OA 1Q1VA 4KICA 3GZ6A 5J4YA 1JTYA 4JX6A 4KMFA 4P5OA 1I5ZA 1K79A 1K4TA 4I09A 3E5QA 3JTHA 4N0BA 3CCUI 1U8BA 2FF4A 1HOMA 2LVSA 5FLMJ 4S05A 2W1OA 3L2QA 4PJ0C 3BPXA 5J47A 2XHKA 2E2IJ 3DQVC 1RR8C 3LAJA 3BCBA 4DYRA 3VSLA 2HVQA 1V5EA 1H89C 1UAAA 2W7NA 3IRRA 3WG9A 3I55I 2DPDA 1ZREA 4F92B 3QPSA 4UV8A 2NS8A 1P4AA 2YSRA 2JT1A 3SEZA 4NHJA 4LLGF 2CUZA 1YI2I 2Y2ZA 3QOPA 1PVEA 2TRTA 2Y31A 3A02A 3MMYB 5EGOB 2O7OA 2QVOA 2ZCWA 4HSRA 1T2KA 2ELKA 1ZG5A 2EIKH 3G73A 2LYCA 2FOKA 2D1VA 1A35A 1SFEA 2RDPA 4G6QA 3VYTB 4U88A 1K6YA 5FKOA 3PUFA 4E7IA 2IA0A 1F4KA 4IOAF 1GHCA 3VYRB 2Q8KA 4HNVA 2OCCH 2V1NA 2EINH 3RIRA 1QQIA 1RNLA 1WQ2A 2HS5A 1JKPC 2XPWA 2ZO4A 4D7MA 5B1BH 2A5WA 4J00A 1FMWA 3DTKA 4IO9F 4XLFA 3JRIA 2M45A 4EJUA 3M4OJ 1LPQA 1ZR2A 1S7OA 3ABTA 4H4KC 5ED4A 1J0RA 4RB0A 3OYAA 1UHWA 2XKPA 2NVQJ 3CDLA 3RJPA 3F8FA 2ZNYA 1LFUP 1LKXA 4U0WA 1LJ9A 2HNHA 3CLQA 3PIOF 4N4OB 2H09A 5LEKA 1MBFA 1MNMC 1Z7LA 1XB4A 4S04A 1WI3A 5BQTA 2OZUA 3NEUA 2L7KA 2JZYA 2DTZA 2E34A 2KDZA 4J01A 1H0MA 4CZCA 1FJLA 2DLLA 3SQNA 4PJMA 2D5VA 1VTNC 3K6GA 1R9TJ 3LSGA 3AG4H 1TWGJ 2KKOA 2RNGA 4BKXA 4EMSA 3LSJA 4A6EA 1QHHD 2EB7A 3VSKA 3GTOJ 2E19A 4V2FA 3JR9A 2PQ8A 2UUZA 5LHIA 3FXJA 2Y9ZA 1BC8C 4G9YA 4RBOA 2XGDA 4A6DA 4AM3A 2WAFA 3SYTA 1E2XA 1HKQA 2KJCA 1IN7A 3K7AJ 5KVRA 2XASA 1YRNB 1QHGA 3IWZA 1S6LA 4XK4A 4FX0A 4QWQA 4KJZA 5EYRA 2GA2A 4G94A 5ERIA 5TISC 2PN6A 1YS6A 1P2FA 3UNGC 2O61A 1UHSA 3Q0WA 2I5UA 4XOTA 1XSDA 2M0CA 2JRMA 3F3XA 3H0GJ 5D6FA 3I4NJ 5IPAA 5BMZA 1Q1HA 1MMGA 2TDXA 3DPUA 5HVQC 4HAMA 4HSTA 4OMZA 1T38A 2Y75A 4UUTA 1M1EB 3CF2A 2DU9A 5CQEA 2PG4A 4NBQA 2M7AA 5L3CA 1QGPA 2ZBKA 3E1SA 4MIMA 2XF6A 2ZMEC 2CQ7A 3HRMA 4ZZDA 3CCLI 2V6CA 3TL4X 5JI6A 1HW2A 2Y0MA 2ISYA 4BGDA 1PYVA 4UVAA 2W00A 5JLXA 2CG4A 4XLAA 2EIMH 2E1CA 1BW6A 1GUUA 2L0KA 5DCFA 3DCFA 2WB1A 3VOEA 4B43A 3J81K 3KP7A 1K61A 4ENJA 2KDOA 2V9KA 2GA1A 3CCQI 3I59A 3GTPJ 3TBIA 2NNYA 4L0YB 4XLEA 1XPXA 2O3FA 4HX8A 1HW1A 5F08A 3K70D 2K9SA 1WJAA 4BS9A 1U2WA 4CHUA 2LG4A 1RESA 2UXXA 2XPVA 3KIOA 2A5YB 5EF6A 1H88C 3GVAA 3D5RC 1FIPA 3SEQA 1ACIA 2KRFA 3DKWA 1YO5C 3HSFA 4HLXA 3ZMTA 3WTXC 2QWWA 2QBYB 2WC2A 2STWA 1ZAOA 2LY1A 4W97A 3CCRI 2BE5F 2KL4A 1XSXA 3G1LA 2E1NA 1MNEA 2EQRA 3JTGA 3L2CA 5BPDA 1PUFB 1JXSA 1SMTA 2EV6A 1ZLJA 4R1HA 5J6XA 5TGTA 1XSVA 4D9JA 2YPRA 4Z2YA 2GBYA 3BTIA 2MFZA 2HPIA 1MH3A 3RQIA 4KMUX 3ZQIA 4F55A 1SFXA 1UMQA 2L2OA 1MMNA 3MKZA 3F8NA 1FWZA 2RV8A 2BEOA 1CGPA 2P7VB 1S5LC 2G0EA 3HDDA 3N97A 1TT0A 2NVYJ 3O8GA 3TQNA 2E7WA 5HOOA 1YJ9I 1ZGJA 2ME6A 3HL2A 1UB9A 3C2BA 5EG0A 2QLZA 4KN7X 4LJZF 1FYKA 3RCOA 5DYMA 2L3DA 4CSWA 3CMYA 5HDGA 2VLAA 2V1DA 4IHWA 2CS3A 2G7HA 2E1OA 1UZCA 3W6JB 4HDVA 1Z9CA 4HX4A 2PFBA 2DA5A 3GTLJ 1ETYA 3P7NA 5CLSA 4NUBA 3OYCA 4AIJA 2LDUA 4F7ZA 4Q47A 4MO7A 1TP4A 3J80Z 2M9HA 3VDXA 3G1MA 2BHYA 2Z3YA 3IL2A 2DJIA 4Y52J 1XGNA 2IP2A 2CWEA 1KU3A 2QF7A 5HS7A 3WU0A 4G7HF 4ZTJA 1BIBA 3IC7A 4L9JA 3H5AA 1Z1DA 3ERED 5JHUA 2LY2A 3BR1A 2K9NA 3LSIA 1T39A 1ZG1A 4YRVA 5F1JA 2DMQA 1OFCX 1O3TA 1KQ8A 3LSKA 3TKYA 5HLIA 1KGSA 4AC0A 2RKHA 2DW4A 2K27A 1XX5A 5L3FA 1JUPA 4A3CJ 4C9YA 4A3BJ 1O57A 3FXOA 3I53A 3K2AA 3RZOJ 2OC6A 2W25A 3G4SI 2IBDA 3U9GA 4XBFA 2B63J 2ACJA 2VPLA 4B47A 4ZTFA 4LG3A 4MTDA 4YELA 3CDIA 4LG0A 4LK1F 1QNTA 2HWVA 4B3AA 2DA4A 3AL0B 1D1BA 1RIOH 4RAZA 1LDJA 2XB0X 3ZP5A 4Y7NJ 5JFRA 2DOFA 3OS0A 2NXNB 5J4VA 2XC7A 2GIZA 2CSOA 2EFOA 2YR2A 3BJ6A 2L02A 1GV5A 1JT0A 1L0OC 3AG2H 3K4NA 1XS9A 4BJ6C 3J7YJ 3OIOA 5E18F 1WJFA 2FJ1A 2GWRA 2WY7Q 5H6QA 1BW5A 2LH9A 4A3LJ 2R3SA 3RKYA 2RVCA 4BHBA 1IZ1A 1NTCA 2HOAA 1IN8A 1SD7A 2LKSA 5M5WJ 1WRJA 2E1MC 1RKWA 3CESA 3TGNA 2ID6A 2K9LA 5F64A 4E7SA 1TNTA 2MLKA 1ZG3A 3LSTA 3Q3SA 3M1CA 4P1WA 1TLHB 4E7JA 4BDZA 5FO5A 1V5FA 2L5QA 3CCSI 4U0YA 3FX3A 5GAHJ 5E1ZB 2J5PA 3CCYA 2IA1A 1R36A 4GXOA 5GAEJ 3BG6A 2Z16A 4M6VA 2G9WA 1QBJA 2LMDA 3HKZN 1ZH5A 4DBRA 1FP1D 4LLLA 5A2QZ 4QPQA 1IV8A 1Y8QB 3RQ4A 5M3MJ 5F27A 1VQKI 2Y9YA 2VT2A 3GYHX 2D1HA 4F3QA 4OMYA 5J1UA 1IRZA 2HOEA 4U7BA 2VBXA 1X19A 2XAQA 1D8KA 2CQQA 2W57A 2WA0A 2L7MP 2IXSA 2DYRH 1ZQ3P 2FE3A 2M8EA 2RQPA 5FKMA 3WTYC 5BPIA 2MBFA 3QRFF 2M2EA 2AHQA 2K3FA 4LB5A 5IOZA 3O3KA 2VC0A 5ILSA 4LLNA 5D8LB 2CV1A 2RC4A 3D5SC 1Z7UA 1D0XA 3GWZA 4GO1A 2JN6A 4P9UA 2HYGD 1I3AA 1Y0UA 4LIVA 4M74A 1ETWA 2EV0A 4C2MJ 1G59A 1B72B 4I7HA 3BCAA 2K85A 4CZZA 2KIMA 2IGNA 3JCUC 2HI3A 3DF8A 3OL3A 1HDDC 1FYLA 3PQKA 2ID3A 1E0EA 1LE8B 1D0ZA 3ZN1A 3HKZA 5CYVA 5M3FJ 1BR4A 2DJNA 1BI2A 3ABKH 2VJ5A 2DFFA 3F8MA 4XKCA 1R5ID 1WFXA 2HZTA 2XAJA 5ICFA 4B1RA 5FB2A 5E8GA 2QEXI 1R4MB 2DDAA 3PL8A 2KQRA 3HTSB 4ETSA 1J59A 2BXYA 2MH2A 1W7PA 4IJAA 2LK2A 2VQCA 1VZ0A 2C6YA 3KEYA 3AAFA 4ZJZA 2KZVA 4JYKA 4NQWA 1VFCA 2FBKA 3IHUA 2V1XA 3IAS2 1NK2P 4U87A 5DD4A 2E71A 3M07A 4I99C 1YQAA 3CLOA 4HF1A 1LVAA 1Z91A 3MZ8A 4L9VA 1T0FA 2DMPA 2OCEA 2BBYA 2LC2A 3DP7A 2V26A 2Q2EA 3TMOA 2KFDA 3KP6A 2LF8A 3BTJA 2OUMA 1ZRDA 1S29A 3GLLA 1LQ1A 1RKTA 5BNGA 4Y13A 3FMRA 1XC5A 1XGSA 1IAWA 2ISZA 4A2UA 3HBLA 1AU7A 2L54A 3VB2A 5FLXZ 1C0WA 3IKTA 4M9XA 3HOSA 2VN2A 3QYFA 3FK7A 1TT5B 3LA3A 3QPHA 2CW7A 4V19K 2DI3A 3BR6A 2JA8J 5B5EC 4DIQA 3E0JB 2NS0A 4DW6A 2R7UA 1KU9A 3GZNB 3A2KA 3V8KA 1HA8A 5DCMB 3S2WA 2FRHA 3PQJA 3GFJA 4JP0A 3SDBA 2IS1A 4IRGA 1ZK8A 2EFPA 2CFXA 4WXCA 1D3YA 1ZYRF 1TW3A 1ZTRA 4AVZA 4EQQA 3H36A 1HLVA 2PJRB 1R5HA 3Q9SA 5D5XB 3ABMH 1JGSA 3BOQA 3ESWB 1OCOH 5IYCJ 1D0YA 1ZN2A 3FMQA 4PCQA 3TDUC 1MJ9A 2STTA 4XOPA 4S0HB 2X6XA 2ZMEB 5JVTA 5J1RA 2CMPA 2QCOA 4M9ZA 3E6CC 3T5XA 1PP8F 4MEYF 2VIXA 1OCTC 3HM5A 3MN2A 3HZJA 4EJOA 3TO9A 1W36C 5FRMA 2HKXA 2K5CA 3A0HC 3FBIB 1AHDP 1TWHJ 2PX9A 1Y6IA 2B9SA 1X3WB 3BZCA 1GT0C 1QZEA 4BY1J 2PEXA 5E3LA 1MMDA 4P9FA 4DYQA 3WHCA 1QU3A 4YIRX 4M71A 3KYLA 3M9AA 4BH9A 1YJNI 3PJRA 4RGUA 2ZJPF 2DA2A 5GADJ 2LBFA 2MA3A 1XGOA 1WPKA 5M5XJ 5J8CA 2ICWG 3IV5A 5C4XJ 2HVRA 3HRSA 4BY7J 1FTZA 2DA6A 5CVJA 1VQMI 3F8CA 4FE7A 3ZMVA 1D1CA 3N4MA 3O8HA 3RSNA 2ZC2A 1QO0D 1DDNA 4XONA 2PMZN 4LMYA 3E6DA 4KYWA 2DDBA 1HQCA 2ZJ2A 1O3SA 4LOCA 3L7WA 4G7OF 2XSJC 2R5ZA 3FM5A 2R7XA 2W24A 3GEZA 4ZZLA 2ZXWH 2BY3A 5C3EJ 1ZGWA 1X1PA 3LSPA 2VQHA 2X85A 1YW8A 2P5VA 1U78A 2R0QC 2M5WA 3CJRB 2EBIA 1D5YA 2H94A 2IRFG 1WJCA 3MWMA 3KLNA 2BXZA 4EGZA 2GM4A 2R7SA 1MD0A 2IT0A 1X58A 1KQ9A 1OYIA 4ZDLA 2QA4I 5E17F 2P6SA 2V6EA 1U5TB 2H6BA 3ECOA 1FLIA 2XUBA 2OPTA 4YFNF 1ORKA 3TP3A 4M6XA 5TJJA 1U8RA 1WWXA 3G2BA 1SANA 2DYSH 3LFUA 3I4MJ 1R1TA 1UG2A 5LD2C 1XG1A 3U2RA 3W6KB 2P5KA 2P7CB 1S7EA 2CU7A 4DQ2A 3CMAI 4ZDOA 3QPLA 1T0FC 3CCJI 2FU4A 2VC1A 3SXYA 2PMZA 1S72I 2FX0A 1R49A 1G3WA 2YU3A 4LITA 3K10A 5GPCA 2DK8A 5B66C 3MKLA 4ITVA 3LSRA 3DPLC 1GXPA 1X1AA 1FOYA 3V7CA 2OBPA 3BJOA 3CP8A 3DKYA 2MW8A 3BG5A 2PMHA 4XRMA 1FIAA 3TO6A 4IHSA 2NRAC 2YX7A 1SMYF 2Y48A 4BQNA 3DLAA 4R79A 2CUJA 2YUSA 3ECHA 1B8IA 1ETQA 4M3GA 4Q4ZF 3AKZA 3QQAA 4DYCA 2L4AA 3L1PA 4L0ZB 3ZGKA 2HYJA 1U9OA 1ZHFA 1A31A 1W0TA 2FMYA 1V4RA 3GTQJ 4PK4A 2UXNA 4BE1A 1H9TA 2ECBA 2F4IA 1LDDA 3D0SA 3BR3A 1BL0A 2BHZA 2CV0A 2LKXA 4CCOA 1LUJB 2E7XA 1R5GA 1DGWY 4XR6A 3K4BA 2QQAA 1WKMA 1IJWC 4RM2A 2VPRA 1LEAA 4O6JA 1VQ5I 4JBAA 4GYIA 1FSEA 2Y30A 4RAGA 3JSPA 1QZZA 3HC7A 4DBQA 2XAHA 2RQQA 2N8GA 2M7BA 2VE8A 1BI0A 4RLFA 1V5GA 3HHHA 4HW0A 1AWCA 3I5UA 2FQ4A 2EH3A 3VYSB 3I59B 2JMWA 4JX4A 6PAXA 2F5CA 3EUHC 4D1QA 2IVMA 4N9IA 5LRSA 1E3OC 2FNAA 3PNVA 1G8XA 3H9QA 4CO8A 2JSCA 3DBLB 4CCJA 5H20A 4JOMA 4A5MA 3T8TA 1DQUA 4A3FJ 2FMLA 3FF5A 4OINF 1STZA 1B59A 3EYIA 3GW2A 3CO7C 1FY7A 3WTTC 2LOOA 2DK5A 1DU0A 1ZKGA 3J7AO 3P9CA 2P4WA 4KITB 3HOWJ 1NG7A 3LNQA 2DOAA 1BM9A 4BQOA 3KZYA 3FKIJ 2K9QA 4HX7A 3L00A 3R4KA 4A69C 4B3XA 3AFHA 1R6RA 3B6AA 4ZC3A 3L2UA 2V4JC 3KEQA 2KLOA 4BE0A 2CGPA 2AXLA 2FD5A 5K7HA 2MH9A 4CCMA 1S8NA 3S14J 2R7WA 2IAIA 1BR2A 3DBHB 4HRIA 2IPQX 5DM6F 4IRHA 3HOUJ 4ASNA 5CPRB 2JTVA 3FXQA 1MZBA 1X4PA 3RYPA 4DZPA 3F0CA 2OQRA 3CF5F 3BC8A 2ZB9A 5AIPA 3BJAA 2Z9OA 3WTWC 5L3BA 5EG0B 3GZ5A 2RAEA 3H1CA 3QYEA 4I01A 3B6CA 3RKWA 1RR7A 1JHHA 5K1YA 1K4SA 2R4GA 4BNCA 4M9SA 3ZPLA 5KHDA 1YX3A 3NARA 5DV5A 3E6MA 3BR2A 1YX5A 3FHNA 1HSJA 4AIDA 1OISA 4AYBN 2ZXHA 2MABA 2GXGA 1I1GA 3BZ6A 2VJJA 4BL0B 3WTSC 4RB3C 4IHXA 2JA2A 9ANTA 4YEJA 4KIGA 1ZARA 2HZDA 3NAUA 4MQVA 1AOYA 4EVIA 3K9TA 3I58A 2BOLA 3KCCA 5GPAA 3Q5FA 3G1OA 1X3UA 2IEKA 2OA4A 3CZ6A 2X48A 5HLGA 4HNTA 2E2HJ 2XV4S 1FC3A 3I9V2 5HDKA 5JLWA 2W82A 2DT5A 4DZJA 3OL4A 2KJBA 1BBYA 1OCPA 1RI7A 3I0TA 5D5UB 1G3YA 2XSDC 2DQRA 1KZHA 1REPC 4XQFA 2XROA 3W3CA 2ME0A 1JJ6C 3HUGA 4LG0B 1RRJA 3Q0UA 3E7LA 3DEWA 4PJNA 3CJNA 3R0AA 2JK3A 5F0FA 2XB5A 2RREA 3BLYA 4R8HA 3E5XA 1ULYA 3JW4A 3GBGA 2JPCA 2VXZA 2H8WA 5FRNA 2VKVA 1WCMJ 2LREA 1IN6A 2HQ5A 2KISA 2LSOA 2H27A 2XRNA 4ZYAA 4BQQA 5KAFC 4QPOA 1LEBA 1B9NA 2E2JJ 3OYJA 2D2WA 3WGGA 3GX4X 4HQEA 4L9NA 1NK3P 1R71A 2BY1A 1PP7U 3H35A 1HSTA 2R92J 4EGYA 3DU6A 4RGSA 2EA2A 3ABUA 4OAZA 1W36D 5B3SH 3C18A 2VASA 4II3A 3L09A 2K4BA 4L5JA 4UVBA 3HIFA 3BZKA 5J3LA 1OCZH 4PUSA 2Q0OA 1WI9A 1R00A 3J81Z 1K6OA 2CYYA 2M1BA 2JWTA 2QKLB 3V7SA 3HSEA 5KAIC 1K7AA 2GOXB 1PJRA 3E5UA 1TL8A 3F72A 1BN5A 4I0AA 2BW3A 2W85A 4KDPA 1R1VA 1OJLA 5AIQA 4G7ZF 4L5IA 1VQ6I 3EUKL 5AONA 2HFHA 4ESJA 5DEQA 3EDPA 3EETA 2WADA 4Y15A 2H6CA 1MMAA 4BE2A 3FISA 1SEUA 1Y0NA 3G3ZA 3BWGA 4H0EA 5EEAA 4M3DA 1F5TA 2O8KA 2EIJH 1GVJA 2D45A 1FBUA 3OOUA 2FBHA 1CQTA 1A04A 3HPHA 2LR8A 2KIFA 2F6CA 1YOVB 3J7AY 3JSOA 1DU6A 4CYDA 3PO2J 2OV7A 4KIBA 3OYNA 1EKEA 1Z0XA 1ZR4A 4PFPA 3MZYA 2GLOA 1YW7A 4I0BA 3C2HA 3MCZA 4HV6A 4HPQA 4F93B 2VOPA 5HDNA 5EZHA 1Z05A 3ASOH 1FBSA 3SZPA 4A3MJ 2K86A 2BYVE 4EJWA 1IF1A 1Y39A 3BDDA 2W84A 5FD5A 1UHMA 1FP2A 3TW6A 3GF2A 2MC3A 3W6VA 5CKTA 1EJ9A 3GTGJ 2COBA 3SHFA 1ERDA 3A01A 3TW7A 3HOVJ 3KZZA 1TWCJ 2QQ8A 3DLLF 4IPAA 2DCEA 4IX7A 3COAC 3ELKA 1L3LA 3PNYA 3ML6A 1EA3A 1W7PB 3KZIC 3IKVA 4TV7A 5HLTA 3CUQA 2OAZA 3SFIA 3CC2I 1DP7P 4NQWB 1ON1A 2VI6A 3BROA 4KN4X 3ZXSA 3A0BC 5F6FA 5CVRA 3LMMA 2A6HF 3I3LA 1FZPB 5GTIC 2O6GE 1Z21A 3MAJA 5E20A 1YTYA 4A3DJ 2CRGA 4M72A 1P92A 2Q2EB 4K2EA 1I6XA 2LF7A 4IEJA 2FNPA 1ETVA 2IGOA 3S93A 2ELHA 2DPUA 4P96A 1S3JA 1R1UA 1A5JA 2EPFA 4HOBA 5HNFA 4BQAA 2OTJI 1X4OA 5LLQA 5JVGF 2ADUA 1TNSA 2JA5J 1W5SA 2R7TA 3K4KA 2KPMA 4UUVA 5ICEA 3VFZA 4CCLA 4X6AJ 1LNWA 1FNNA 3VPRA 3NWTA 1GDTA 2XVCA 1D5VA 4UHTA 4EM1A 3NQOA 4MLOA 2ZXJA 5ILVA 1WGXA 5L3EA 2EZKA 1ZRFA 1IC8A 2DT7B 1V54H 1FOKA 4JQFA 1R7JA 4XNFA 5KNLA 4HV5A 2LNBA 2HVSA 1G3TA 5FGMA 1N25A 1ZGAA 4AUXA 4D0PA 2IS2A 4B44A 2ZFUA 2DOEA 1X1CA 1V55H 4E6KG 3LA7A 3FXKA 4PSWA 4OOIA 3GTMJ 2FUG2 2EZHA 3EUAA 4RGXA 4KIFA 1O7FA 4ZH4F 3IUOA 1YLFA 2DA1A 3RKQA 2NYXA 1YIJI 3OYGA 1WJDA 1XN7A 2EK5A 2DA7A 3FIWA 2LTPA 3HRTA 2MC4A 1W5CC 2UZKA 3MEXA 2E35A 2FSWA 2XF7A 3V42A 2R7DA 3PUBA 2QQ9A 2H8RA 2DXIA 4G8XA 4XICA 2RN7A 2TCTA 4C3HJ 3G71I 3F8BA 1U0JA 4UUSB 4C2UA 4I02A 4MQ9F 1A36A 1G4DA 2P0WA 1F43A 5K7FA 5LGTA 1QVTA 3ZQHA 2HTJA 1JE8A 3BPVA 1IDZA 3H3UA 3VYUB 2CJJA 2LBFB 1H8AC 2X51A 2VOOA 4RB2C 3PFIA 2EA4A 3VWBA 4BUPA 1J75A 5LGUA 3GXOA 4OIOF 2A69F 2Y69H 3LOCA 3SFZA 1SVOA 4YFXF 2CH0A 1RPWA 2X1DA 1TWFJ 1RC9A 2WV1A 2L9SA 2VODA 4Z6YA 2OU2A 4ZYEA 1RUNA 3GFMA 4ABZA 4ESBA 3EPZA 1XCBA 3WGHA 2JJ7A 4EV0A 3WU2C 2ZSHB 5FFXA 2R7VA 2R5ZB 3PSIA 3RPQA 2MD5A 3K1MA 4P55A 3OR2C 1W1WE 1F9NA 1K78A 1KONA 3H9JA 3KP2A 5DM7F 2LP0A 1TQIA 1DPRA 4GCVA 5E1WA 1TW2A 1IRXA 1BR1A 4JX5A 3DXJF 5IP6A 2CUEA 3PO3J 4IF4A 3O2PE 4BXXJ 1IXSB 5E3NA 2QKMB 3RZDJ 3NRVA 3FHZA 4BAYA 3GFIA 3ASNH 1WJEA 4M6YA 3QU6A 2LD5A 3C7JA 3OYMA 1KYWA 2F4MB 4FISA 3W2WA 2CO5A 3CUQC 2CQKA 2VKEA 3CJTB 2V1UA 1AKHA 2IJLA 2OF7A 4DOZA 1AA7A 3REOA 1OCRH 2AQFA 2MGQA 3HG9A 5IT9K 4BYYA 3PNTA 4C30A 4XN3A 3F21A 2CQNA 1EH8A 2HQNA 2ZNZA 2M4KA 4BEHA 4A3IJ 2L7FP 3MVPA 1Y1WJ 2KRHA 3U1KA 4E4HA 1MGTA 4AD9A 1Y56A 2O0YA 2NNNA 1TC3C 2HYFA 4G6DA 1NHAA 4LIUA 2HDCA 2GXBA 2CQXA 5K5QA 3WTZA 2O9LA 3S3NA 4MNUA 1UJ8A 1G2HA 2V9VA 3I4PA 4AIHA 1B8IB 4IRIA 2JA7J 4ANJA 1XTAA 3I71A 4DJAA 3JRCA 2JRTA 3HJEA 3KP3A 1QPMA 3EUHA 5F0CA 1J2XA 5LBQA 2X1EA 3B02A 4FETA 3GTKJ 3QP6A 3J7ZI 1R58A 3K4MA 2AO9A 3EQLF 2EZLA 3H3ZA 4W1UA 1PUEE 5GAGJ 3CJQB 2VB6A 4LGWA 1WSUA 2VQLA 4CGZA 2X9DA 4NNJA 4XMYA 3LSMA 4U0VA 3ABLH 3FK6A 1YE9A 5CQGA 3CC4I 3BQZA 3IH2A 2LRDA 3I56I 4A93J 3ZMDA 3CO6C 2IGKA 4HDUA 5JHFA 2R7FA 2IGMA 3JAMZ 4ENKA 3CUOA 2QYOA 2FEZA 5DUIA 1VQLI 2QUFA 3QYBA 2YX4A 5D4SA 3CCVI 2HOTA 2QQBA 2Z1DA 3KX2A 1DPUA 1YIOA 5F1RA 2A68F 5GTHC 2V9PA 3ZR8X 4CYCA 3OIPA 3KEOA 1ODDA 2JUCA 3R61A 1RETA 3C1DA 2R93J 3P5JA 1WH7A 3M1EA 5C44J 1PDNC 3GFLA 4YIIA 4WWCA 3IH3A 3PIPF 4FHTA 3BQYA 4OWRB 3K69A 3K1NA 2EFQA 1E3PA 2BZTA 4EATA 3RPUA 3ZMUA 2KRCA 1HKTA 4N4NB 5EJCA 2R5YA 3V8LA 2E5NA 2FA5A 1R23A 2PBIA 4KNYA 3WU1B 4O3MA 1N77A 1XMXA 2DMNA 4LFUA 3UKGA 2PMUA 3FWEA 3PSFA 3CTAA 4MEXF 3FKJA 1JKQC 4DNCA 3G6EI 4Q48A 3S32A 3AL0C 3ZOBA 4CCKA 1T95A 3BT9A 4B8XA 4HA8A 1VQ9I 3MKYB 1MBKA 3LQQA 2XKOA 3BR5A 2RNJA 5D5VB 3S2HJ 1A6QA 3R0JA 2DA3A 2FBIA 1VQ8I 2JUGA 5DS9A 4MFEA 1EF4A 3HTUA 3F23A 3MD2A 2JQ7A 4RLQA 2EILH 1FOXA 3OS1A 1IXCA 4IQ4A 3R60A 1USSA 2X6WA 3GMEA 1XGMA 4A5NA 3K4JA 4QIWN 5BS6A 4GRIA 1JI8A 1B6AA 2HKOA 1ONVA 2ESHA 2KIUA 3RKXA 1T8IA 3S1MJ 4D5CA 2GIVA 3WTVC 2FQ3A 3ISPA 5TRDA 2GQQA 5HODA 2X1CA 1JHFA 1SAXA 4FASD 1OR7A 4XRFA 2X4HA 2WBMA 4QTRA 3QODA 3E97A 2KZGA 2XPUA 3HHGA 3JREA 3DKXA 3OYIA 1BC7C 5J40A 3PM1A 1MNDA 4WXDA 5CVVA 1IRFA 4UXNA 1FMVA 2DFEA 2M4GA 4AVPA 1T56A 4U7DA 3KFWX 2PJPA 1V3FA 2QGUA 5IYDJ 2LFBA 2ZKZA 4NC6A 1WH5A 2NVXJ 3F22A 1YJWI 4IHTA 1OQYA 3V8JA 2HEOA 2FOWA 3M8JA 3DEEA 1IN5A 3FDYA 5H6RA 1FPQA 1OYYA 4CH7A 2E1MB 1GXQA 2K02A 3HUGB 5K5OA 3HSRA 2NAZA 4RMNA 2B7EA 1T98A 4QSHA 2K7LA 3QWLA 3JRGA 2NVTJ 1W0UA 2IS4A 2IA2A 5ICCA 5D4RA 4RA2A 1IV6A 4XRSG 4Q5SF 1MBHA 1SVLA 1S9HA 2BY0A 1Y1VJ 1DGRM 2XAUA 4KT5C 2ZFWA 2HGCA 4E70A 1ETKA 1SFOJ 2JA6J 1P7JA 5HNHA 3ULQB 3OS2A 4IZZA 4L9TA 5FROA 3BP8A 1HBXG 2R7QA 1IXRC 1T08B 2E36A 2P5LC 2EWNA 4IOCF 1QA6A 2YS9A 3H3VK 3RDIA 1TWAJ 1U5TA 4L5EA 5LHGA 1CF7A 1FYMA 1G6NA 2OQGA 4B09A 2L9RA 2FXAA 3JRFA 1T33A 3OWTA 3I54A 4PJJA 5E8IA 1U3EM 2XIGA 1R22A 4E7LA 2CW0F 3SDGA 5K5RA 1P4XA 3ZMSA 3WODF 4RAFA 2M30A 1D8JA 1W5TA 1MDMA 2BY2A 2HOSA 1DUXC 2BVLA 1SFUA 2BW3B 1BJAA 4C3JJ 2EFNA 1MBEA 5FKNA 2NVUB 2ZSIB 4XN0A 2JVGA 2ESNA 1OLTA 4RB1A 3EYYA 5DUKA 5LRRA 2M0MA 1P6RA 2WB1N 3V4GA 3OIQA 5E3OA 1KQ0A 3QPTA 2G7UA 3OSFA 2OTLI 3JRHA 4PSXA 2R7ZJ 2VKDA 1VF9A 4BDYA 3SZGA 1MJAA 1O4XA 3H5NA 5IYBJ 1RZ4A 3A03A 4FTHA 2M87A 3DFGA 4BACA 1F36A 3QU3A 4PZJA 2DTRA 2DFIA 1SFKA 4XLCA 2OJED 3T8RA 3S3OA 4FQGA 3T1BA 3L2WA 3GCMA 1LB2A 1ZELA 3OMYA 3RI4A 1FOWA 4A0XA 5HLHA 4PDKA 2EFWA 1ZRCA 3S15J 2NS7A 5ILUA 3QAHA 4GYGA 4CUGA 4E7HA 2K4JA 2V7FA 3A01B 3FXUA 5EGOA 4KUMA 2VQGA 3Q0VA 1OR7C 4XSZF 4NDLA 1EH7A 4G12A 4AYBA 3CUQB 5LHHA 3FXMA 4BHCA 1JUMA 1VQOI 4KFCA 4AIKA 5FJ8J 3L2VA 3ERMA 1F1ZA 1O3RA 1E3HA 2I10A 1VQ4I 1ITYA 4NC8A 4IQJA 3CCEI 1Z3YA 4OIQF 5EZGA 3QP5A 5EEGA 1I27A 2UWMA 2HDDA 4WCGA 3N05A 2OD5A 5JR3A 2CW8A 1VI0A 2JPBA 1J7KA 3OYBA 2VJIA 1QPIA 3J80K 4UV9A 2WY8Q 1QVUA 3FBNB 1JT6A 2A05A 4XLHA 2AQEA 1P7IA 4MFDA 1UCRA 1Z6TA 3OSGA 1X2MA 3BR0A 3S2DJ 2H1KA 3E3VA 4HG2A 3SZTA 1SD5A 3H9GA 3LWFA 4EJVA 1NG6A 1MIJA 3CC7I 4I98B 5CVIA 2MLGA 3TOBA 2Z2SB 1MW7A 4DGWB 2E60A 2ZJQF 3UR3C 4A0ZA 2WWYA 2P81A 1UG0A 1B9MA 5KCMA 3O6BB 5LFAA 2VE9A 4XSXF 4MHGA 1YHQI 1J9IA 1J5YA 1VNDA 3FXLA 3KYCB 1E17A 2HTSA 1YRNA 3P9KA 3HOZJ 4CA0A 5LGNA 2LLKA 2XRLA 4HZFA 4B4CA 2K40A 3ZQLA 1U5TC 3K1PA 2A61A 4KA4A 2QSGX 2NOJB 2L9VA 4M73A 2GAUA 1X2NA 1QZYA 3MQ0A 3DTEA 4ON0A 3DV8A 3F6VA 1KU7A 4I6ZA 2QM3A 2EV5A 2HXIA 1MSFC 4M3FA 5LEJA 2WAQN 4MTEA 3S1NJ 3DBRB 1UFMA 5ICGA 3SJMA 3ONQA 4Y33A 5GP9A 1FT9A 4OAYA 1U6GA 1I50J 1A6IA 1W7PD 2M3AA 2L01A 4M3BA 2PI0A 4XORA 1LFBA 3M3YJ 2RGVA 3IAM2 2VBYA 5KK1A 3OY9A 4GDFA 4UVCA 3WG7H 4D7NA 3OYKA 1HC8A 1B4AA 3MKWB 3BTCA 1APLC 2DQLA 1OCCH 1XDUA 4ZYHA 2HDWA 3BG7A 1YG2A 3HEFA 4D5FA 2CUFA 4LK0F 2Y0SN 3OYEA 3L2RA 4YIFA 3M8EA 1WJ5A 2F5EA 3LL7A 3U1DA 2MG4A 1WVRA 4HQMA 1BI3A 2O03A 3C3WA 4BBRJ 4IKFA 3OV8A 2AXTC 4N9HA 3A4CA 5F0HA 5J8FA 2A6TA 5EDNA 5A2QK 1O3QA 2DAOA 4BJTA 3JRBA 1XCVA 2WAQA 4EEFG 1JJ8C 1B1BA 1K78B 3CQZJ 2DODA 3VODA 2UV1A 1DP3A 2HQRA 3OYDA 5DDGA 4ZYGA 2VT3A 1TBXA 4RGRA 3Q9VA 5FD6A 1Z6RA 2Z5UA 4ZYDA 2COMA 2QBYA 4XLPF 1ENHA 2ZJRF 1IGNA 4RAYA 5K7ZA 1KYZA 1OYWA 3K4LA 3HOYJ 5E1XA 1Y8RB 3WGIA 2P6TA 4O5VA 2BGCA 4AU7A 1P9QC 2QZ8A 5HS8A 1S7AA 3OYLA 4QLCU 2M8GX 2HR3A 2L7ZA 3T0YA 2LY9A 2BVMA 5L3GA 4CICA 2AS5F 1PUFA 3CCMI 1ON2A 3ZQ7A 1AKHB 2EZIA 4IL6C 4UY8I 2F4OB 1GVDA 2Y0SA 5IY5H 3CMMA 5B1AH 1X1BA 5DTDA 2VXDA 1I1SA 3V7RA 2A6EF 2YU9J 3QOEA 3HYIA 3R6SA 1N75A 3FXRA 3GTJJ 4BEHB 3ZQFA 3FZVA 5J1YA 3K4CA 1IRGA 5H2FC 5CJ9A 1JKRC 1KU2A 1HF0A 1XDSA 2HPMA 1OPCA 1EV7A 2VUMJ 2MSYA 4EM2A 4XIDA 1O7LA 3TDZC 1IUYA 2QSHX 1FTTA 3JRAA 3RTRA 5E3MA 4NB5A 1MH4A 3H0DA 2VBZA 4FX4A 1TTYA 5D6EA 4Y3OA 4UB8C 1MBJA 2J5OA 4E7ZA 5M5YJ 2ELJA 4XKVA 1Z67A 3H92A 5E79C 3NWSA 4ZDPA 1LDKB 3ZQQA 4ESFA 1MSEC 4YFKF 1XMKA 5FKLA 1HKSA 5IT3A 1I6HJ 3K2ZA 1QRYA 5FFZA 1D1AA 4G6TB 3TOAA 3X2QH 3HOTA 3MZHA 5FLXK 1YS7A 1Z3XA 1R4NB 4X1EA 1N78A 3K0LA 3D1NI 2X6YA 1H9GA 1VQ7I 2A07F 3WTUC 1HCRA 1SD4A 2BV6A 4CDGA 2HU9A 4EJTA 3S8PA 1OMIA 4IHVA 1WJBA 2Z33A 3W2VA 4RDUA 1BI1A 2O8XA 4J19A 4KISA 2GXAA 2V79A 1FEXA 2WV0A 2L4MA 3TO7A 5EEHA 3RPUD 2QSFX 3GO5A 1YITI 4BU2A 3B73A 3LSHA 4RM3A 4XM3A 4YG2F 3W2AA 4CYCB 4V2GA 3CDHA 4XL9A 5C4JJ 2KP6A 4BJ5C 1X3ZB 2XAFA 1Z77A 3HGYA 4GGGA 4II2A 4A12A 2W4SA 4C2TA 1FBQA 3IH4A 1SC7A 4IVNA 1BOBA 5IOYA 3RYRA 3IRQA 1I39A 2MD0A 4IHYA 4XRSA 1IDYA 1HW5A 5FKKA 1IW7F 2Q1ZB 3CMEI 3A1YA 2CFOA 4HEA2 1NH3A 3S1QJ 1U9NA 1USTA 1XMAA 1G3SA 2KHMA 2R5YB 4EM0B 5D5WB 2DFHA 4XLNF 3ZRGA 2GOMA 1OKRA 3BTLA 3IP4B 1WZ2A 1IN4A 3ZCOA 3KETA 4F91B 4OIRF 3AG3H 5L3DA 3ZQGA 4OIPF 4WX9A 2VONA 1LFPA 3F6OA 3ROUA 2VL8A 1HDPA 2XDVA 3AG1H 3D5LA 2F2EA 3F9KA 3M8FA 3DPTA 3ZN0A 2XGEA 2O5RA 2B0LA 2ECCA 2WTEA 4BXUA 4UNOA 1MJBA 3I64A 1YW9A 3WE3A 4BHPA 4XKWA 3OR1C 3WHBA 1TQPA 1JKOC 3IWFA 2DMUA 2CV2A 4HNUA 1TQMA 3MFKA 4HF2A 4A0YA 2PLYA 3BG9A 4WK8F 3CD6I 4PGGA 1EH6A 2W48A 4X0GA 3K70C 4FE4A 4A3KJ 1JTXA 2KIQA 1YYVA 2EJRA 1VQPI 1SAUA 3JAMK 2XF5A 2XAGA 3FMSA 2VKHA 3KE2A 4IXAA 1WHUA 3KPHA 1KA8A 5D8KB 2DT6A 1BIAA 3DWLE 4A3JJ 2X6OA 2KMUA 5IP9J 1MMSA 4MGRA 4BBSJ 4M3EA 2Z99A 4CXFA 3TEDA 1K83J 1TZLA 2XGXA 1I3QJ 2F5FA 4WF2A 4WXHA 3HGGA 1B72A 1ETOA 3GLXA 4PJLA 2I8DA 4A3EJ 2L9NA 4Y17A 2K9MA 2MYSA 5F04A 5IT9Z 4NC7A 4UUSA 4E7KA 1LE8A 1BOAA 1RUOA 4JK1X 4OU0A 3LFKA 4BXFA 2F48A 4GFBA 1ZLKA 1ETXA 3ZQCA 4HF0A 3OOPA 1IO2A 3H5RA 2VJ4A 3HOXJ 1BJZA 2P8TA 3PFYA 2HQAA 1IUFA
chains in the Genus database with same CATH topology
3D5SC 3OS2A 1D0XA 2GOXB 1PJRA 4IZZA 5FROA 4LIVA 3DU5A 2R7QA 2BW3A 1G59A 3BCAA 3U21A 2IGNA 3CP2A 3OL3A 3S3MA 3EUKL 1E0EA 4PJJA 3OWTA 2WADA 4BE2A 1MMAA 2E5ZA 1D0ZA 1GLNA 4Y4RA 3HKZA 1BR4A 2JSPA 3OOUA 2VJ5A 4E7LA 3HPHA 4XKCA 3OYHA 1WFXA 1LVKA 4XKBA 2F6CA 4KT6A 3PL8A 2KQRA 3J7AY 4PFOA 2OV7A 3OYNA 2VQCA 1VZ0A 4PFPA 3KEYA 2BVLA 3C2HA 4ZJZA 1X1DA 4HPQA 2BW3B 4F93B 3C2GA 2IS6A 2KZVA 2JVHA 2WAEA 1J09A 2ZSIB 4XN0A 3IAS2 2JVGA 4U87A 1OLTA 3HPGA 2M0MA 3OIQA 3DTIA 2ZXIA 4F52A 2LC2A 4CCNA 2V26A 5CKTA 4PSXA 3TMOA 2VKDA 4BDYA 1ERDA 2OUMA 3SZGA 3H5NA 4IX7A 2DCEA 2PJRA 3HXLA 3PNYA 2R7RA 4BACA 1EA3A 1UELB 1SFKA 5HLTA 4XLCA 3HOSA 3QYFA 3S3OA 4B48A 4NQWB 3OYFA 3L2WA 3ZXSA 2F5VA 1ZELA 2CW7A 2K3PA 3OMYA 3LMMA 4DIQA 3E0JB 3I3LA 2R7OA 1Z21A 2R7UA 3A2KA 1HA8A 3SDBA 2IS1A 4P5OA 2Q2EB 4CUGA 4E7HA 2IGOA 2V7FA 3S93A 4AVZA 2PJRB 2VQGA 5HNHA 2W1OA 3L2QA 1OR7C 5HNFA 1X4OA 4AYBA 3DQVC 1D0YA 3BCBA 3VSLA 2HVQA 4XOPA 1V5EA 3L2VA 2R7TA 2X6XA 3K4KA 1UAAA 2W7NA 2KPMA 4NC8A 4IQJA 4CCLA 4F92B 1Z3YA 2CMPA 3NWTA 3SEZA 2CUZA 2UWMA 2VIXA 3N05A 4MLOA 2CW8A 3MMYB 3OYBA 2VJIA 1W36C 5FRMA 2DT7B 2K5CA 4HSRA 2WY8Q 3FBIB 3FBNB 2LYCA 4JQFA 4XNFA 1Y6IA 3VYTB 5KNLA 4E7IA 1K6YA 4XLHA 2AQEA 3VYRB 1MMDA 2HVSA 2V1NA 1QU3A 3KYLA 3PJRA 2IS2A 4B44A 4HG2A 2ZFUA 2LBFA 1X1CA 2A5WA 3H9GA 4E6KG 4PSWA 4J00A 1FMWA 2FUG2 1NG6A 3DTKA 3EUAA 4XLFA 2Z2SB 3IUOA 1MW7A 4DGWB 2E60A 2HVRA 3OYGA 1WJDA 3UR3C 4H4KC 1UG0A 1D1CA 2MC4A 3OYAA 5KCMA 2XF7A 5LFAA 3V42A 3RSNA 3PUBA 4XONA 1LKXA 2DXIA 2HNHA 4N4OB 1Z7LA 1U0JA 4C2UA 4CA0A 2XSJC 2L7KA 2R7XA 2P0WA 4J01A 4CZCA 2NOJB 4PJMA 2VQHA 3DTEA 3K6GA 3VYUB 2X85A 3LSGA 2LBFB 2X51A 2RNGA 1QHHD 3VSKA 3VWBA 4BUPA 3CJRB 1WJCA 2CH0A 2UUZA 2R7SA 3ONQA 4Y33A 2X1DA 2L9SA 2WAFA 3SYTA 4OAYA 4ZDLA 3EPZA 2V6EA 2M3AA 1QHGA 2ZSHB 4XORA 2R7VA 4KJZA 3PSIA 3G2BA 3LFUA 3IAM2 3OR2C 5LD2C 3OY9A 1KONA 3H9JA 4ZDOA 3OYKA 3UNGC 1T0FC 1IRXA 1BR1A 3MKWB 2PMZA 4XOTA 4LITA 2HDWA 3BG7A 3K10A 2QKMB 3L2RA 4ITVA 3OYEA 1MMGA 3DPLC 3DPUA 1WJ5A 1X1AA 3LL7A 5HVQC 1WJEA 4HSTA 3CP8A 3DKYA 3OYMA 3CF2A 3W2WA 4IKFA 3A4CA 5CQEA 2A6TA 2M7AA 3E1SA 4BJTA 2XF6A 2WAQA 4BQNA 3DLAA 4DOZA 4R79A 1DP3A 1AA7A 2UV1A 3TL4X 2CUJA 2AQFA 3HG9A 3OYDA 3AKZA 3PNTA 4BGDA 1PYVA 4C30A 4XN3A 2W00A 4XLAA 3ZGKA 2WB1A 2M4KA 4BEHA 4B43A 3K4LA 4PK4A 2KDOA 2V9KA 2KRHA 4BE1A 4E4HA 4AU7A 1P9QC 2F4IA 3OYLA 3TBIA 2CV0A 1Y56A 2BVMA 4LIUA 4XLEA 4CCOA 1DGWY 4XR6A 3K4BA 3K70D 4RM2A 1WJAA 4BS9A 3S3NA 2Y0SA 2LG4A 3CMMA 1X1BA 2VXDA 3HC7A 4ANJA 4DBQA 3D5RC 4DJAA 2RQQA 3SEQA 3QOEA 1N75A 2X1EA 4FETA 4BEHB 2M7BA 4RLFA 1V5GA 3K4MA 2LY1A 3K4CA 3VYSB 2KL4A 3EUHC 3CJQB 2VB6A 4D1QA 2HPMA 2VQLA 1MNEA 4NNJA 4XMYA 3LSMA 3PNVA 1G8XA 1YE9A 5CQGA 3H9QA 4CCJA 5TGTA 2LRDA 4D9JA 3RTRA 4JOMA 2MFZA 2HPIA 1DQUA 3H0DA 4F55A 2L2OA 1MMNA 4Y3OA 2IGKA 3MKZA 4E7ZA 5JHFA 2ELJA 4XKVA 2IGMA 2LOOA 3NWSA 4ZDPA 1LDKB 3ZQQA 1TT0A 4KITB 3QYBA 5HOOA 1NG7A 3HL2A 2DOAA 2Z1DA 3KX2A 4BQOA 1D1AA 4G6TB 3HOTA 3ZR8X 3RCOA 3OIPA 4CSWA 1Z3XA 4B3XA 3AFHA 1R6RA 3L2UA 4ZC3A 2VLAA 1N78A 2V4JC 2CS3A 2KLOA 4BE0A 2X6YA 4CCMA 4NUBA 2HU9A 3OYCA 3S8PA 2R7WA 4HRIA 1BR2A 4OWRB 1WJBA 5CPRB 3VDXA 3W2VA 4EATA 2DJIA 2KRCA 1X4PA 4N4NB 4KISA 3BC8A 4ZTJA 2E5NA 3H5AA 2LY2A 3RPUD 4BU2A 1N77A 3LSIA 3LSHA 3QYEA 4RM3A 3PSFA 4XM3A 4YRVA 3W2AA 3FKJA 4XL9A 3S32A 2KP6A 4BJ5C 3AL0C 2R4GA 4CCKA 1T95A 3LSKA 4II2A 5KHDA 1YX3A 3MKYB 2W4SA 4C2TA 1YX5A 3FHNA 1BOBA 4C9YA 2MD0A 2ZXHA 2MABA 2OC6A 2Q1ZB 2VJJA 2CFOA 3A1YA 4HEA2 2VPLA 4B47A 4BL0B 4ZTFA 2KHMA 2JA2A 2JUGA 4LG3A 4YELA 4YEJA 3MD2A 2HZDA 3ZRGA 3AL0B 1D1BA 2GOMA 3IP4B 4RLQA 2BOLA 3OS1A 4IQ4A 3ZCOA 4F91B 2X6WA 1LFPA 3K4JA 2VL8A 3OS0A 2XC7A 4GRIA 1JI8A 3CZ6A 2XDVA 3D5LA 4HNTA 3F9KA 3DPTA 3I9V2 2O5RA 3K4NA 2W82A 4BJ6C 4XKWA 3OR1C 3OL4A 1WJFA 2WY7Q 2X1CA 2CV2A 2LH9A 4HNUA 4FASD 4XQFA 3W3CA 2WBMA 3QODA 4X0GA 3K70C 3DKXA 4PJNA 3OYIA 3BLYA 2RREA 1SAUA 1MNDA 2E1MC 2XF5A 2VXZA 3CESA 2VKHA 3GBGA 5FRNA 2K9LA 4E7SA 1FMVA 2M4GA 3M1CA 4P1WA 2DT6A 2LREA 3DWLE 4E7JA 4BDZA 1V5FA 2L5QA 4ZYAA 4BQQA 4QPOA 2KMUA 3OYJA 3BG6A 2Z16A 3M8JA 3DEEA 1TZLA 3FDYA 4DBRA 4QPQA 4CH7A 3H35A 2E1MB 3RQ4A 4PJLA 2I8DA 3DU6A 3HUGB 4OAZA 1W36D 2L9NA 4RMNA 4F3QA 2K9MA 2MYSA 2VASA 4II3A 4NC7A 4U7BA 4E7KA 1X19A 2IS4A 2WA0A 2IXSA 4BXFA 4PUSA 1S9HA 1DGRM 2XAUA 3H5RA 2VJ4A 3PFYA 2QKLB 2CV1A 2HQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W4S A;  2XC7 A; 
#chains in the Genus database with same CATH topology
 4LD5 A;  2ETH A;  2HXO A;  3DEU A;  3S1R J;  1T6S A;  3M7G A;  3GUD A;  3DU5 A;  4HLY A;  3VEP A;  3LAP A;  2A3S A;  3FM3 A;  3U21 A;  1FX7 A;  3L9F A;  3CP2 A;  3LQR A;  3S3M A;  4HYE A;  1XD7 A;  1POG A;  4PGH A;  4HBL A;  1BA5 A;  2E5Z A;  1GLN A;  4Y4R A;  1JUS A;  2OZ6 A;  1MKM A;  5HS9 A;  2GZW A;  1MBG A;  4UB6 C;  2JSP A;  4C3I J;  1FSH A;  1P4W A;  3OYH A;  5DD8 A;  1LVK A;  2DN0 A;  4XKB A;  4FCY A;  4KT6 A;  3WE2 A;  2F5D A;  3JRD A;  4PFO A;  5BOX A;  3BY6 A;  2XGC A;  4LB6 B;  2VBW A;  3E6B A;  1X1D A;  2DBB A;  2X0L A;  1VQN I;  3C2G A;  2IS6 A;  2WAE A;  2JVH A;  4I76 A;  3LA2 A;  2NOG A;  1J09 A;  1CF7 B;  4RS8 A;  3ZMZ A;  3HPG A;  5FLV A;  4ENM A;  3DTI A;  2ZXI A;  4ENN A;  5IP7 J;  3KYD B;  3TP0 A;  5DCM A;  1JGG A;  4F52 A;  1IG7 A;  4CCN A;  3S17 J;  3BG3 A;  1GV2 A;  3HRU A;  2KT0 A;  3S16 J;  3HB9 A;  4AWX B;  2PJR A;  1W4M A;  3HXL A;  1SD6 A;  2R7R A;  1YFH A;  3KLO A;  4A3G J;  3KP4 A;  1SVM A;  1UEL B;  2M34 A;  4L18 B;  3KP5 A;  1HXD A;  1MDM B;  2QEN A;  2DO7 A;  4B48 A;  4I2O A;  2DMT A;  3OYF A;  2H1L A;  4FT8 A;  2LKP A;  2F5V A;  2K3P A;  2ZME A;  2IW5 A;  5CVU A;  3P9I A;  2R7O A;  1Q1V A;  4KIC A;  3GZ6 A;  5J4Y A;  1JTY A;  4JX6 A;  4KMF A;  4P5O A;  1I5Z A;  1K79 A;  1K4T A;  4I09 A;  3E5Q A;  3JTH A;  4N0B A;  3CCU I;  1U8B A;  2FF4 A;  1HOM A;  2LVS A;  5FLM J;  4S05 A;  2W1O A;  3L2Q A;  4PJ0 C;  3BPX A;  5J47 A;  2XHK A;  2E2I J;  3DQV C;  1RR8 C;  3LAJ A;  3BCB A;  4DYR A;  3VSL A;  2HVQ A;  1V5E A;  1H89 C;  1UAA A;  2W7N A;  3IRR A;  3WG9 A;  3I55 I;  2DPD A;  1ZRE A;  4F92 B;  3QPS A;  4UV8 A;  2NS8 A;  1P4A A;  2YSR A;  2JT1 A;  3SEZ A;  4NHJ A;  4LLG F;  2CUZ A;  1YI2 I;  2Y2Z A;  3QOP A;  1PVE A;  2TRT A;  2Y31 A;  3A02 A;  3MMY B;  5EGO B;  2O7O A;  2QVO A;  2ZCW A;  4HSR A;  1T2K A;  2ELK A;  1ZG5 A;  2EIK H;  3G73 A;  2LYC A;  2FOK A;  2D1V A;  1A35 A;  1SFE A;  2RDP A;  4G6Q A;  3VYT B;  4U88 A;  1K6Y A;  5FKO A;  3PUF A;  4E7I A;  2IA0 A;  1F4K A;  4IOA F;  1GHC A;  3VYR B;  2Q8K A;  4HNV A;  2OCC H;  2V1N A;  2EIN H;  3RIR A;  1QQI A;  1RNL A;  1WQ2 A;  2HS5 A;  1JKP C;  2XPW A;  2ZO4 A;  4D7M A;  5B1B H;  2A5W A;  4J00 A;  1FMW A;  3DTK A;  4IO9 F;  4XLF A;  3JRI A;  2M45 A;  4EJU A;  3M4O J;  1LPQ A;  1ZR2 A;  1S7O A;  3ABT A;  4H4K C;  5ED4 A;  1J0R A;  4RB0 A;  3OYA A;  1UHW A;  2XKP A;  2NVQ J;  3CDL A;  3RJP A;  3F8F A;  2ZNY A;  1LFU P;  1LKX A;  4U0W A;  1LJ9 A;  2HNH A;  3CLQ A;  3PIO F;  4N4O B;  2H09 A;  5LEK A;  1MBF A;  1MNM C;  1Z7L A;  1XB4 A;  4S04 A;  1WI3 A;  5BQT A;  2OZU A;  3NEU A;  2L7K A;  2JZY A;  2DTZ A;  2E34 A;  2KDZ A;  4J01 A;  1H0M A;  4CZC A;  1FJL A;  2DLL A;  3SQN A;  4PJM A;  2D5V A;  1VTN C;  3K6G A;  1R9T J;  3LSG A;  3AG4 H;  1TWG J;  2KKO A;  2RNG A;  4BKX A;  4EMS A;  3LSJ A;  4A6E A;  1QHH D;  2EB7 A;  3VSK A;  3GTO J;  2E19 A;  4V2F A;  3JR9 A;  2PQ8 A;  2UUZ A;  5LHI A;  3FXJ A;  2Y9Z A;  1BC8 C;  4G9Y A;  4RBO A;  2XGD A;  4A6D A;  4AM3 A;  2WAF A;  3SYT A;  1E2X A;  1HKQ A;  2KJC A;  1IN7 A;  3K7A J;  5KVR A;  2XAS A;  1YRN B;  1QHG A;  3IWZ A;  1S6L A;  4XK4 A;  4FX0 A;  4QWQ A;  4KJZ A;  5EYR A;  2GA2 A;  4G94 A;  5ERI A;  5TIS C;  2PN6 A;  1YS6 A;  1P2F A;  3UNG C;  2O61 A;  1UHS A;  3Q0W A;  2I5U A;  4XOT A;  1XSD A;  2M0C A;  2JRM A;  3F3X A;  3H0G J;  5D6F A;  3I4N J;  5IPA A;  5BMZ A;  1Q1H A;  1MMG A;  2TDX A;  3DPU A;  5HVQ C;  4HAM A;  4HST A;  4OMZ A;  1T38 A;  2Y75 A;  4UUT A;  1M1E B;  3CF2 A;  2DU9 A;  5CQE A;  2PG4 A;  4NBQ A;  2M7A A;  5L3C A;  1QGP A;  2ZBK A;  3E1S A;  4MIM A;  2XF6 A;  2ZME C;  2CQ7 A;  3HRM A;  4ZZD A;  3CCL I;  2V6C A;  3TL4 X;  5JI6 A;  1HW2 A;  2Y0M A;  2ISY A;  4BGD A;  1PYV A;  4UVA A;  2W00 A;  5JLX A;  2CG4 A;  4XLA A;  2EIM H;  2E1C A;  1BW6 A;  1GUU A;  2L0K A;  5DCF A;  3DCF A;  2WB1 A;  3VOE A;  4B43 A;  3J81 K;  3KP7 A;  1K61 A;  4ENJ A;  2KDO A;  2V9K A;  2GA1 A;  3CCQ I;  3I59 A;  3GTP J;  3TBI A;  2NNY A;  4L0Y B;  4XLE A;  1XPX A;  2O3F A;  4HX8 A;  1HW1 A;  5F08 A;  3K70 D;  2K9S A;  1WJA A;  4BS9 A;  1U2W A;  4CHU A;  2LG4 A;  1RES A;  2UXX A;  2XPV A;  3KIO A;  2A5Y B;  5EF6 A;  1H88 C;  3GVA A;  3D5R C;  1FIP A;  3SEQ A;  1ACI A;  2KRF A;  3DKW A;  1YO5 C;  3HSF A;  4HLX A;  3ZMT A;  3WTX C;  2QWW A;  2QBY B;  2WC2 A;  2STW A;  1ZAO A;  2LY1 A;  4W97 A;  3CCR I;  2BE5 F;  2KL4 A;  1XSX A;  3G1L A;  2E1N A;  1MNE A;  2EQR A;  3JTG A;  3L2C A;  5BPD A;  1PUF B;  1JXS A;  1SMT A;  2EV6 A;  1ZLJ A;  4R1H A;  5J6X A;  5TGT A;  1XSV A;  4D9J A;  2YPR A;  4Z2Y A;  2GBY A;  3BTI A;  2MFZ A;  2HPI A;  1MH3 A;  3RQI A;  4KMU X;  3ZQI A;  4F55 A;  1SFX A;  1UMQ A;  2L2O A;  1MMN A;  3MKZ A;  3F8N A;  1FWZ A;  2RV8 A;  2BEO A;  1CGP A;  2P7V B;  1S5L C;  2G0E A;  3HDD A;  3N97 A;  1TT0 A;  2NVY J;  3O8G A;  3TQN A;  2E7W A;  5HOO A;  1YJ9 I;  1ZGJ A;  2ME6 A;  3HL2 A;  1UB9 A;  3C2B A;  5EG0 A;  2QLZ A;  4KN7 X;  4LJZ F;  1FYK A;  3RCO A;  5DYM A;  2L3D A;  4CSW A;  3CMY A;  5HDG A;  2VLA A;  2V1D A;  4IHW A;  2CS3 A;  2G7H A;  2E1O A;  1UZC A;  3W6J B;  4HDV A;  1Z9C A;  4HX4 A;  2PFB A;  2DA5 A;  3GTL J;  1ETY A;  3P7N A;  5CLS A;  4NUB A;  3OYC A;  4AIJ A;  2LDU A;  4F7Z A;  4Q47 A;  4MO7 A;  1TP4 A;  3J80 Z;  2M9H A;  3VDX A;  3G1M A;  2BHY A;  2Z3Y A;  3IL2 A;  2DJI A;  4Y52 J;  1XGN A;  2IP2 A;  2CWE A;  1KU3 A;  2QF7 A;  5HS7 A;  3WU0 A;  4G7H F;  4ZTJ A;  1BIB A;  3IC7 A;  4L9J A;  3H5A A;  1Z1D A;  3ERE D;  5JHU A;  2LY2 A;  3BR1 A;  2K9N A;  3LSI A;  1T39 A;  1ZG1 A;  4YRV A;  5F1J A;  2DMQ A;  1OFC X;  1O3T A;  1KQ8 A;  3LSK A;  3TKY A;  5HLI A;  1KGS A;  4AC0 A;  2RKH A;  2DW4 A;  2K27 A;  1XX5 A;  5L3F A;  1JUP A;  4A3C J;  4C9Y A;  4A3B J;  1O57 A;  3FXO A;  3I53 A;  3K2A A;  3RZO J;  2OC6 A;  2W25 A;  3G4S I;  2IBD A;  3U9G A;  4XBF A;  2B63 J;  2ACJ A;  2VPL A;  4B47 A;  4ZTF A;  4LG3 A;  4MTD A;  4YEL A;  3CDI A;  4LG0 A;  4LK1 F;  1QNT A;  2HWV A;  4B3A A;  2DA4 A;  3AL0 B;  1D1B A;  1RIO H;  4RAZ A;  1LDJ A;  2XB0 X;  3ZP5 A;  4Y7N J;  5JFR A;  2DOF A;  3OS0 A;  2NXN B;  5J4V A;  2XC7 A;  2GIZ A;  2CSO A;  2EFO A;  2YR2 A;  3BJ6 A;  2L02 A;  1GV5 A;  1JT0 A;  1L0O C;  3AG2 H;  3K4N A;  1XS9 A;  4BJ6 C;  3J7Y J;  3OIO A;  5E18 F;  1WJF A;  2FJ1 A;  2GWR A;  2WY7 Q;  5H6Q A;  1BW5 A;  2LH9 A;  4A3L J;  2R3S A;  3RKY A;  2RVC A;  4BHB A;  1IZ1 A;  1NTC A;  2HOA A;  1IN8 A;  1SD7 A;  2LKS A;  5M5W J;  1WRJ A;  2E1M C;  1RKW A;  3CES A;  3TGN A;  2ID6 A;  2K9L A;  5F64 A;  4E7S A;  1TNT A;  2MLK A;  1ZG3 A;  3LST A;  3Q3S A;  3M1C A;  4P1W A;  1TLH B;  4E7J A;  4BDZ A;  5FO5 A;  1V5F A;  2L5Q A;  3CCS I;  4U0Y A;  3FX3 A;  5GAH J;  5E1Z B;  2J5P A;  3CCY A;  2IA1 A;  1R36 A;  4GXO A;  5GAE J;  3BG6 A;  2Z16 A;  4M6V A;  2G9W A;  1QBJ A;  2LMD A;  3HKZ N;  1ZH5 A;  4DBR A;  1FP1 D;  4LLL A;  5A2Q Z;  4QPQ A;  1IV8 A;  1Y8Q B;  3RQ4 A;  5M3M J;  5F27 A;  1VQK I;  2Y9Y A;  2VT2 A;  3GYH X;  2D1H A;  4F3Q A;  4OMY A;  5J1U A;  1IRZ A;  2HOE A;  4U7B A;  2VBX A;  1X19 A;  2XAQ A;  1D8K A;  2CQQ A;  2W57 A;  2WA0 A;  2L7M P;  2IXS A;  2DYR H;  1ZQ3 P;  2FE3 A;  2M8E A;  2RQP A;  5FKM A;  3WTY C;  5BPI A;  2MBF A;  3QRF F;  2M2E A;  2AHQ A;  2K3F A;  4LB5 A;  5IOZ A;  3O3K A;  2VC0 A;  5ILS A;  4LLN A;  5D8L B;  2CV1 A;  2RC4 A;  3D5S C;  1Z7U A;  1D0X A;  3GWZ A;  4GO1 A;  2JN6 A;  4P9U A;  2HYG D;  1I3A A;  1Y0U A;  4LIV A;  4M74 A;  1ETW A;  2EV0 A;  4C2M J;  1G59 A;  1B72 B;  4I7H A;  3BCA A;  2K85 A;  4CZZ A;  2KIM A;  2IGN A;  3JCU C;  2HI3 A;  3DF8 A;  3OL3 A;  1HDD C;  1FYL A;  3PQK A;  2ID3 A;  1E0E A;  1LE8 B;  1D0Z A;  3ZN1 A;  3HKZ A;  5CYV A;  5M3F J;  1BR4 A;  2DJN A;  1BI2 A;  3ABK H;  2VJ5 A;  2DFF A;  3F8M A;  4XKC A;  1R5I D;  1WFX A;  2HZT A;  2XAJ A;  5ICF A;  4B1R A;  5FB2 A;  5E8G A;  2QEX I;  1R4M B;  2DDA A;  3PL8 A;  2KQR A;  3HTS B;  4ETS A;  1J59 A;  2BXY A;  2MH2 A;  1W7P A;  4IJA A;  2LK2 A;  2VQC A;  1VZ0 A;  2C6Y A;  3KEY A;  3AAF A;  4ZJZ A;  2KZV A;  4JYK A;  4NQW A;  1VFC A;  2FBK A;  3IHU A;  2V1X A;  3IAS 2;  1NK2 P;  4U87 A;  5DD4 A;  2E71 A;  3M07 A;  4I99 C;  1YQA A;  3CLO A;  4HF1 A;  1LVA A;  1Z91 A;  3MZ8 A;  4L9V A;  1T0F A;  2DMP A;  2OCE A;  2BBY A;  2LC2 A;  3DP7 A;  2V26 A;  2Q2E A;  3TMO A;  2KFD A;  3KP6 A;  2LF8 A;  3BTJ A;  2OUM A;  1ZRD A;  1S29 A;  3GLL A;  1LQ1 A;  1RKT A;  5BNG A;  4Y13 A;  3FMR A;  1XC5 A;  1XGS A;  1IAW A;  2ISZ A;  4A2U A;  3HBL A;  1AU7 A;  2L54 A;  3VB2 A;  5FLX Z;  1C0W A;  3IKT A;  4M9X A;  3HOS A;  2VN2 A;  3QYF A;  3FK7 A;  1TT5 B;  3LA3 A;  3QPH A;  2CW7 A;  4V19 K;  2DI3 A;  3BR6 A;  2JA8 J;  5B5E C;  4DIQ A;  3E0J B;  2NS0 A;  4DW6 A;  2R7U A;  1KU9 A;  3GZN B;  3A2K A;  3V8K A;  1HA8 A;  5DCM B;  3S2W A;  2FRH A;  3PQJ A;  3GFJ A;  4JP0 A;  3SDB A;  2IS1 A;  4IRG A;  1ZK8 A;  2EFP A;  2CFX A;  4WXC A;  1D3Y A;  1ZYR F;  1TW3 A;  1ZTR A;  4AVZ A;  4EQQ A;  3H36 A;  1HLV A;  2PJR B;  1R5H A;  3Q9S A;  5D5X B;  3ABM H;  1JGS A;  3BOQ A;  3ESW B;  1OCO H;  5IYC J;  1D0Y A;  1ZN2 A;  3FMQ A;  4PCQ A;  3TDU C;  1MJ9 A;  2STT A;  4XOP A;  4S0H B;  2X6X A;  2ZME B;  5JVT A;  5J1R A;  2CMP A;  2QCO A;  4M9Z A;  3E6C C;  3T5X A;  1PP8 F;  4MEY F;  2VIX A;  1OCT C;  3HM5 A;  3MN2 A;  3HZJ A;  4EJO A;  3TO9 A;  1W36 C;  5FRM A;  2HKX A;  2K5C A;  3A0H C;  3FBI B;  1AHD P;  1TWH J;  2PX9 A;  1Y6I A;  2B9S A;  1X3W B;  3BZC A;  1GT0 C;  1QZE A;  4BY1 J;  2PEX A;  5E3L A;  1MMD A;  4P9F A;  4DYQ A;  3WHC A;  1QU3 A;  4YIR X;  4M71 A;  3KYL A;  3M9A A;  4BH9 A;  1YJN I;  3PJR A;  4RGU A;  2ZJP F;  2DA2 A;  5GAD J;  2LBF A;  2MA3 A;  1XGO A;  1WPK A;  5M5X J;  5J8C A;  2ICW G;  3IV5 A;  5C4X J;  2HVR A;  3HRS A;  4BY7 J;  1FTZ A;  2DA6 A;  5CVJ A;  1VQM I;  3F8C A;  4FE7 A;  3ZMV A;  1D1C A;  3N4M A;  3O8H A;  3RSN A;  2ZC2 A;  1QO0 D;  1DDN A;  4XON A;  2PMZ N;  4LMY A;  3E6D A;  4KYW A;  2DDB A;  1HQC A;  2ZJ2 A;  1O3S A;  4LOC A;  3L7W A;  4G7O F;  2XSJ C;  2R5Z A;  3FM5 A;  2R7X A;  2W24 A;  3GEZ A;  4ZZL A;  2ZXW H;  2BY3 A;  5C3E J;  1ZGW A;  1X1P A;  3LSP A;  2VQH A;  2X85 A;  1YW8 A;  2P5V A;  1U78 A;  2R0Q C;  2M5W A;  3CJR B;  2EBI A;  1D5Y A;  2H94 A;  2IRF G;  1WJC A;  3MWM A;  3KLN A;  2BXZ A;  4EGZ A;  2GM4 A;  2R7S A;  1MD0 A;  2IT0 A;  1X58 A;  1KQ9 A;  1OYI A;  4ZDL A;  2QA4 I;  5E17 F;  2P6S A;  2V6E A;  1U5T B;  2H6B A;  3ECO A;  1FLI A;  2XUB A;  2OPT A;  4YFN F;  1ORK A;  3TP3 A;  4M6X A;  5TJJ A;  1U8R A;  1WWX A;  3G2B A;  1SAN A;  2DYS H;  3LFU A;  3I4M J;  1R1T A;  1UG2 A;  5LD2 C;  1XG1 A;  3U2R A;  3W6K B;  2P5K A;  2P7C B;  1S7E A;  2CU7 A;  4DQ2 A;  3CMA I;  4ZDO A;  3QPL A;  1T0F C;  3CCJ I;  2FU4 A;  2VC1 A;  3SXY A;  2PMZ A;  1S72 I;  2FX0 A;  1R49 A;  1G3W A;  2YU3 A;  4LIT A;  3K10 A;  5GPC A;  2DK8 A;  5B66 C;  3MKL A;  4ITV A;  3LSR A;  3DPL C;  1GXP A;  1X1A A;  1FOY A;  3V7C A;  2OBP A;  3BJO A;  3CP8 A;  3DKY A;  2MW8 A;  3BG5 A;  2PMH A;  4XRM A;  1FIA A;  3TO6 A;  4IHS A;  2NRA C;  2YX7 A;  1SMY F;  2Y48 A;  4BQN A;  3DLA A;  4R79 A;  2CUJ A;  2YUS A;  3ECH A;  1B8I A;  1ETQ A;  4M3G A;  4Q4Z F;  3AKZ A;  3QQA A;  4DYC A;  2L4A A;  3L1P A;  4L0Z B;  3ZGK A;  2HYJ A;  1U9O A;  1ZHF A;  1A31 A;  1W0T A;  2FMY A;  1V4R A;  3GTQ J;  4PK4 A;  2UXN A;  4BE1 A;  1H9T A;  2ECB A;  2F4I A;  1LDD A;  3D0S A;  3BR3 A;  1BL0 A;  2BHZ A;  2CV0 A;  2LKX A;  4CCO A;  1LUJ B;  2E7X A;  1R5G A;  1DGW Y;  4XR6 A;  3K4B A;  2QQA A;  1WKM A;  1IJW C;  4RM2 A;  2VPR A;  1LEA A;  4O6J A;  1VQ5 I;  4JBA A;  4GYI A;  1FSE A;  2Y30 A;  4RAG A;  3JSP A;  1QZZ A;  3HC7 A;  4DBQ A;  2XAH A;  2RQQ A;  2N8G A;  2M7B A;  2VE8 A;  1BI0 A;  4RLF A;  1V5G A;  3HHH A;  4HW0 A;  1AWC A;  3I5U A;  2FQ4 A;  2EH3 A;  3VYS B;  3I59 B;  2JMW A;  4JX4 A;  6PAX A;  2F5C A;  3EUH C;  4D1Q A;  2IVM A;  4N9I A;  5LRS A;  1E3O C;  2FNA A;  3PNV A;  1G8X A;  3H9Q A;  4CO8 A;  2JSC A;  3DBL B;  4CCJ A;  5H20 A;  4JOM A;  4A5M A;  3T8T A;  1DQU A;  4A3F J;  2FML A;  3FF5 A;  4OIN F;  1STZ A;  1B59 A;  3EYI A;  3GW2 A;  3CO7 C;  1FY7 A;  3WTT C;  2LOO A;  2DK5 A;  1DU0 A;  1ZKG A;  3J7A O;  3P9C A;  2P4W A;  4KIT B;  3HOW J;  1NG7 A;  3LNQ A;  2DOA A;  1BM9 A;  4BQO A;  3KZY A;  3FKI J;  2K9Q A;  4HX7 A;  3L00 A;  3R4K A;  4A69 C;  4B3X A;  3AFH A;  1R6R A;  3B6A A;  4ZC3 A;  3L2U A;  2V4J C;  3KEQ A;  2KLO A;  4BE0 A;  2CGP A;  2AXL A;  2FD5 A;  5K7H A;  2MH9 A;  4CCM A;  1S8N A;  3S14 J;  2R7W A;  2IAI A;  1BR2 A;  3DBH B;  4HRI A;  2IPQ X;  5DM6 F;  4IRH A;  3HOU J;  4ASN A;  5CPR B;  2JTV A;  3FXQ A;  1MZB A;  1X4P A;  3RYP A;  4DZP A;  3F0C A;  2OQR A;  3CF5 F;  3BC8 A;  2ZB9 A;  5AIP A;  3BJA A;  2Z9O A;  3WTW C;  5L3B A;  5EG0 B;  3GZ5 A;  2RAE A;  3H1C A;  3QYE A;  4I01 A;  3B6C A;  3RKW A;  1RR7 A;  1JHH A;  5K1Y A;  1K4S A;  2R4G A;  4BNC A;  4M9S A;  3ZPL A;  5KHD A;  1YX3 A;  3NAR A;  5DV5 A;  3E6M A;  3BR2 A;  1YX5 A;  3FHN A;  1HSJ A;  4AID A;  1OIS A;  4AYB N;  2ZXH A;  2MAB A;  2GXG A;  1I1G A;  3BZ6 A;  2VJJ A;  4BL0 B;  3WTS C;  4RB3 C;  4IHX A;  2JA2 A;  9ANT A;  4YEJ A;  4KIG A;  1ZAR A;  2HZD A;  3NAU A;  4MQV A;  1AOY A;  4EVI A;  3K9T A;  3I58 A;  2BOL A;  3KCC A;  5GPA A;  3Q5F A;  3G1O A;  1X3U A;  2IEK A;  2OA4 A;  3CZ6 A;  2X48 A;  5HLG A;  4HNT A;  2E2H J;  2XV4 S;  1FC3 A;  3I9V 2;  5HDK A;  5JLW A;  2W82 A;  2DT5 A;  4DZJ A;  3OL4 A;  2KJB A;  1BBY A;  1OCP A;  1RI7 A;  3I0T A;  5D5U B;  1G3Y A;  2XSD C;  2DQR A;  1KZH A;  1REP C;  4XQF A;  2XRO A;  3W3C A;  2ME0 A;  1JJ6 C;  3HUG A;  4LG0 B;  1RRJ A;  3Q0U A;  3E7L A;  3DEW A;  4PJN A;  3CJN A;  3R0A A;  2JK3 A;  5F0F A;  2XB5 A;  2RRE A;  3BLY A;  4R8H A;  3E5X A;  1ULY A;  3JW4 A;  3GBG A;  2JPC A;  2VXZ A;  2H8W A;  5FRN A;  2VKV A;  1WCM J;  2LRE A;  1IN6 A;  2HQ5 A;  2KIS A;  2LSO A;  2H27 A;  2XRN A;  4ZYA A;  4BQQ A;  5KAF C;  4QPO A;  1LEB A;  1B9N A;  2E2J J;  3OYJ A;  2D2W A;  3WGG A;  3GX4 X;  4HQE A;  4L9N A;  1NK3 P;  1R71 A;  2BY1 A;  1PP7 U;  3H35 A;  1HST A;  2R92 J;  4EGY A;  3DU6 A;  4RGS A;  2EA2 A;  3ABU A;  4OAZ A;  1W36 D;  5B3S H;  3C18 A;  2VAS A;  4II3 A;  3L09 A;  2K4B A;  4L5J A;  4UVB A;  3HIF A;  3BZK A;  5J3L A;  1OCZ H;  4PUS A;  2Q0O A;  1WI9 A;  1R00 A;  3J81 Z;  1K6O A;  2CYY A;  2M1B A;  2JWT A;  2QKL B;  3V7S A;  3HSE A;  5KAI C;  1K7A A;  2GOX B;  1PJR A;  3E5U A;  1TL8 A;  3F72 A;  1BN5 A;  4I0A A;  2BW3 A;  2W85 A;  4KDP A;  1R1V A;  1OJL A;  5AIQ A;  4G7Z F;  4L5I A;  1VQ6 I;  3EUK L;  5AON A;  2HFH A;  4ESJ A;  5DEQ A;  3EDP A;  3EET A;  2WAD A;  4Y15 A;  2H6C A;  1MMA A;  4BE2 A;  3FIS A;  1SEU A;  1Y0N A;  3G3Z A;  3BWG A;  4H0E A;  5EEA A;  4M3D A;  1F5T A;  2O8K A;  2EIJ H;  1GVJ A;  2D45 A;  1FBU A;  3OOU A;  2FBH A;  1CQT A;  1A04 A;  3HPH A;  2LR8 A;  2KIF A;  2F6C A;  1YOV B;  3J7A Y;  3JSO A;  1DU6 A;  4CYD A;  3PO2 J;  2OV7 A;  4KIB A;  3OYN A;  1EKE A;  1Z0X A;  1ZR4 A;  4PFP A;  3MZY A;  2GLO A;  1YW7 A;  4I0B A;  3C2H A;  3MCZ A;  4HV6 A;  4HPQ A;  4F93 B;  2VOP A;  5HDN A;  5EZH A;  1Z05 A;  3ASO H;  1FBS A;  3SZP A;  4A3M J;  2K86 A;  2BYV E;  4EJW A;  1IF1 A;  1Y39 A;  3BDD A;  2W84 A;  5FD5 A;  1UHM A;  1FP2 A;  3TW6 A;  3GF2 A;  2MC3 A;  3W6V A;  5CKT A;  1EJ9 A;  3GTG J;  2COB A;  3SHF A;  1ERD A;  3A01 A;  3TW7 A;  3HOV J;  3KZZ A;  1TWC J;  2QQ8 A;  3DLL F;  4IPA A;  2DCE A;  4IX7 A;  3COA C;  3ELK A;  1L3L A;  3PNY A;  3ML6 A;  1EA3 A;  1W7P B;  3KZI C;  3IKV A;  4TV7 A;  5HLT A;  3CUQ A;  2OAZ A;  3SFI A;  3CC2 I;  1DP7 P;  4NQW B;  1ON1 A;  2VI6 A;  3BRO A;  4KN4 X;  3ZXS A;  3A0B C;  5F6F A;  5CVR A;  3LMM A;  2A6H F;  3I3L A;  1FZP B;  5GTI C;  2O6G E;  1Z21 A;  3MAJ A;  5E20 A;  1YTY A;  4A3D J;  2CRG A;  4M72 A;  1P92 A;  2Q2E B;  4K2E A;  1I6X A;  2LF7 A;  4IEJ A;  2FNP A;  1ETV A;  2IGO A;  3S93 A;  2ELH A;  2DPU A;  4P96 A;  1S3J A;  1R1U A;  1A5J A;  2EPF A;  4HOB A;  5HNF A;  4BQA A;  2OTJ I;  1X4O A;  5LLQ A;  5JVG F;  2ADU A;  1TNS A;  2JA5 J;  1W5S A;  2R7T A;  3K4K A;  2KPM A;  4UUV A;  5ICE A;  3VFZ A;  4CCL A;  4X6A J;  1LNW A;  1FNN A;  3VPR A;  3NWT A;  1GDT A;  2XVC A;  1D5V A;  4UHT A;  4EM1 A;  3NQO A;  4MLO A;  2ZXJ A;  5ILV A;  1WGX A;  5L3E A;  2EZK A;  1ZRF A;  1IC8 A;  2DT7 B;  1V54 H;  1FOK A;  4JQF A;  1R7J A;  4XNF A;  5KNL A;  4HV5 A;  2LNB A;  2HVS A;  1G3T A;  5FGM A;  1N25 A;  1ZGA A;  4AUX A;  4D0P A;  2IS2 A;  4B44 A;  2ZFU A;  2DOE A;  1X1C A;  1V55 H;  4E6K G;  3LA7 A;  3FXK A;  4PSW A;  4OOI A;  3GTM J;  2FUG 2;  2EZH A;  3EUA A;  4RGX A;  4KIF A;  1O7F A;  4ZH4 F;  3IUO A;  1YLF A;  2DA1 A;  3RKQ A;  2NYX A;  1YIJ I;  3OYG A;  1WJD A;  1XN7 A;  2EK5 A;  2DA7 A;  3FIW A;  2LTP A;  3HRT A;  2MC4 A;  1W5C C;  2UZK A;  3MEX A;  2E35 A;  2FSW A;  2XF7 A;  3V42 A;  2R7D A;  3PUB A;  2QQ9 A;  2H8R A;  2DXI A;  4G8X A;  4XIC A;  2RN7 A;  2TCT A;  4C3H J;  3G71 I;  3F8B A;  1U0J A;  4UUS B;  4C2U A;  4I02 A;  4MQ9 F;  1A36 A;  1G4D A;  2P0W A;  1F43 A;  5K7F A;  5LGT A;  1QVT A;  3ZQH A;  2HTJ A;  1JE8 A;  3BPV A;  1IDZ A;  3H3U A;  3VYU B;  2CJJ A;  2LBF B;  1H8A C;  2X51 A;  2VOO A;  4RB2 C;  3PFI A;  2EA4 A;  3VWB A;  4BUP A;  1J75 A;  5LGU A;  3GXO A;  4OIO F;  2A69 F;  2Y69 H;  3LOC A;  3SFZ A;  1SVO A;  4YFX F;  2CH0 A;  1RPW A;  2X1D A;  1TWF J;  1RC9 A;  2WV1 A;  2L9S A;  2VOD A;  4Z6Y A;  2OU2 A;  4ZYE A;  1RUN A;  3GFM A;  4ABZ A;  4ESB A;  3EPZ A;  1XCB A;  3WGH A;  2JJ7 A;  4EV0 A;  3WU2 C;  2ZSH B;  5FFX A;  2R7V A;  2R5Z B;  3PSI A;  3RPQ A;  2MD5 A;  3K1M A;  4P55 A;  3OR2 C;  1W1W E;  1F9N A;  1K78 A;  1KON A;  3H9J A;  3KP2 A;  5DM7 F;  2LP0 A;  1TQI A;  1DPR A;  4GCV A;  5E1W A;  1TW2 A;  1IRX A;  1BR1 A;  4JX5 A;  3DXJ F;  5IP6 A;  2CUE A;  3PO3 J;  4IF4 A;  3O2P E;  4BXX J;  1IXS B;  5E3N A;  2QKM B;  3RZD J;  3NRV A;  3FHZ A;  4BAY A;  3GFI A;  3ASN H;  1WJE A;  4M6Y A;  3QU6 A;  2LD5 A;  3C7J A;  3OYM A;  1KYW A;  2F4M B;  4FIS A;  3W2W A;  2CO5 A;  3CUQ C;  2CQK A;  2VKE A;  3CJT B;  2V1U A;  1AKH A;  2IJL A;  2OF7 A;  4DOZ A;  1AA7 A;  3REO A;  1OCR H;  2AQF A;  2MGQ A;  3HG9 A;  5IT9 K;  4BYY A;  3PNT A;  4C30 A;  4XN3 A;  3F21 A;  2CQN A;  1EH8 A;  2HQN A;  2ZNZ A;  2M4K A;  4BEH A;  4A3I J;  2L7F P;  3MVP A;  1Y1W J;  2KRH A;  3U1K A;  4E4H A;  1MGT A;  4AD9 A;  1Y56 A;  2O0Y A;  2NNN A;  1TC3 C;  2HYF A;  4G6D A;  1NHA A;  4LIU A;  2HDC A;  2GXB A;  2CQX A;  5K5Q A;  3WTZ A;  2O9L A;  3S3N A;  4MNU A;  1UJ8 A;  1G2H A;  2V9V A;  3I4P A;  4AIH A;  1B8I B;  4IRI A;  2JA7 J;  4ANJ A;  1XTA A;  3I71 A;  4DJA A;  3JRC A;  2JRT A;  3HJE A;  3KP3 A;  1QPM A;  3EUH A;  5F0C A;  1J2X A;  5LBQ A;  2X1E A;  3B02 A;  4FET A;  3GTK J;  3QP6 A;  3J7Z I;  1R58 A;  3K4M A;  2AO9 A;  3EQL F;  2EZL A;  3H3Z A;  4W1U A;  1PUE E;  5GAG J;  3CJQ B;  2VB6 A;  4LGW A;  1WSU A;  2VQL A;  4CGZ A;  2X9D A;  4NNJ A;  4XMY A;  3LSM A;  4U0V A;  3ABL H;  3FK6 A;  1YE9 A;  5CQG A;  3CC4 I;  3BQZ A;  3IH2 A;  2LRD A;  3I56 I;  4A93 J;  3ZMD A;  3CO6 C;  2IGK A;  4HDU A;  5JHF A;  2R7F A;  2IGM A;  3JAM Z;  4ENK A;  3CUO A;  2QYO A;  2FEZ A;  5DUI A;  1VQL I;  2QUF A;  3QYB A;  2YX4 A;  5D4S A;  3CCV I;  2HOT A;  2QQB A;  2Z1D A;  3KX2 A;  1DPU A;  1YIO A;  5F1R A;  2A68 F;  5GTH C;  2V9P A;  3ZR8 X;  4CYC A;  3OIP A;  3KEO A;  1ODD A;  2JUC A;  3R61 A;  1RET A;  3C1D A;  2R93 J;  3P5J A;  1WH7 A;  3M1E A;  5C44 J;  1PDN C;  3GFL A;  4YII A;  4WWC A;  3IH3 A;  3PIP F;  4FHT A;  3BQY A;  4OWR B;  3K69 A;  3K1N A;  2EFQ A;  1E3P A;  2BZT A;  4EAT A;  3RPU A;  3ZMU A;  2KRC A;  1HKT A;  4N4N B;  5EJC A;  2R5Y A;  3V8L A;  2E5N A;  2FA5 A;  1R23 A;  2PBI A;  4KNY A;  3WU1 B;  4O3M A;  1N77 A;  1XMX A;  2DMN A;  4LFU A;  3UKG A;  2PMU A;  3FWE A;  3PSF A;  3CTA A;  4MEX F;  3FKJ A;  1JKQ C;  4DNC A;  3G6E I;  4Q48 A;  3S32 A;  3AL0 C;  3ZOB A;  4CCK A;  1T95 A;  3BT9 A;  4B8X A;  4HA8 A;  1VQ9 I;  3MKY B;  1MBK A;  3LQQ A;  2XKO A;  3BR5 A;  2RNJ A;  5D5V B;  3S2H J;  1A6Q A;  3R0J A;  2DA3 A;  2FBI A;  1VQ8 I;  2JUG A;  5DS9 A;  4MFE A;  1EF4 A;  3HTU A;  3F23 A;  3MD2 A;  2JQ7 A;  4RLQ A;  2EIL H;  1FOX A;  3OS1 A;  1IXC A;  4IQ4 A;  3R60 A;  1USS A;  2X6W A;  3GME A;  1XGM A;  4A5N A;  3K4J A;  4QIW N;  5BS6 A;  4GRI A;  1JI8 A;  1B6A A;  2HKO A;  1ONV A;  2ESH A;  2KIU A;  3RKX A;  1T8I A;  3S1M J;  4D5C A;  2GIV A;  3WTV C;  2FQ3 A;  3ISP A;  5TRD A;  2GQQ A;  5HOD A;  2X1C A;  1JHF A;  1SAX A;  4FAS D;  1OR7 A;  4XRF A;  2X4H A;  2WBM A;  4QTR A;  3QOD A;  3E97 A;  2KZG A;  2XPU A;  3HHG A;  3JRE A;  3DKX A;  3OYI A;  1BC7 C;  5J40 A;  3PM1 A;  1MND A;  4WXD A;  5CVV A;  1IRF A;  4UXN A;  1FMV A;  2DFE A;  2M4G A;  4AVP A;  1T56 A;  4U7D A;  3KFW X;  2PJP A;  1V3F A;  2QGU A;  5IYD J;  2LFB A;  2ZKZ A;  4NC6 A;  1WH5 A;  2NVX J;  3F22 A;  1YJW I;  4IHT A;  1OQY A;  3V8J A;  2HEO A;  2FOW A;  3M8J A;  3DEE A;  1IN5 A;  3FDY A;  5H6R A;  1FPQ A;  1OYY A;  4CH7 A;  2E1M B;  1GXQ A;  2K02 A;  3HUG B;  5K5O A;  3HSR A;  2NAZ A;  4RMN A;  2B7E A;  1T98 A;  4QSH A;  2K7L A;  3QWL A;  3JRG A;  2NVT J;  1W0U A;  2IS4 A;  2IA2 A;  5ICC A;  5D4R A;  4RA2 A;  1IV6 A;  4XRS G;  4Q5S F;  1MBH A;  1SVL A;  1S9H A;  2BY0 A;  1Y1V J;  1DGR M;  2XAU A;  4KT5 C;  2ZFW A;  2HGC A;  4E70 A;  1ETK A;  1SFO J;  2JA6 J;  1P7J A;  5HNH A;  3ULQ B;  3OS2 A;  4IZZ A;  4L9T A;  5FRO A;  3BP8 A;  1HBX G;  2R7Q A;  1IXR C;  1T08 B;  2E36 A;  2P5L C;  2EWN A;  4IOC F;  1QA6 A;  2YS9 A;  3H3V K;  3RDI A;  1TWA J;  1U5T A;  4L5E A;  5LHG A;  1CF7 A;  1FYM A;  1G6N A;  2OQG A;  4B09 A;  2L9R A;  2FXA A;  3JRF A;  1T33 A;  3OWT A;  3I54 A;  4PJJ A;  5E8I A;  1U3E M;  2XIG A;  1R22 A;  4E7L A;  2CW0 F;  3SDG A;  5K5R A;  1P4X A;  3ZMS A;  3WOD F;  4RAF A;  2M30 A;  1D8J A;  1W5T A;  1MDM A;  2BY2 A;  2HOS A;  1DUX C;  2BVL A;  1SFU A;  2BW3 B;  1BJA A;  4C3J J;  2EFN A;  1MBE A;  5FKN A;  2NVU B;  2ZSI B;  4XN0 A;  2JVG A;  2ESN A;  1OLT A;  4RB1 A;  3EYY A;  5DUK A;  5LRR A;  2M0M A;  1P6R A;  2WB1 N;  3V4G A;  3OIQ A;  5E3O A;  1KQ0 A;  3QPT A;  2G7U A;  3OSF A;  2OTL I;  3JRH A;  4PSX A;  2R7Z J;  2VKD A;  1VF9 A;  4BDY A;  3SZG A;  1MJA A;  1O4X A;  3H5N A;  5IYB J;  1RZ4 A;  3A03 A;  4FTH A;  2M87 A;  3DFG A;  4BAC A;  1F36 A;  3QU3 A;  4PZJ A;  2DTR A;  2DFI A;  1SFK A;  4XLC A;  2OJE D;  3T8R A;  3S3O A;  4FQG A;  3T1B A;  3L2W A;  3GCM A;  1LB2 A;  1ZEL A;  3OMY A;  3RI4 A;  1FOW A;  4A0X A;  5HLH A;  4PDK A;  2EFW A;  1ZRC A;  3S15 J;  2NS7 A;  5ILU A;  3QAH A;  4GYG A;  4CUG A;  4E7H A;  2K4J A;  2V7F A;  3A01 B;  3FXU A;  5EGO A;  4KUM A;  2VQG A;  3Q0V A;  1OR7 C;  4XSZ F;  4NDL A;  1EH7 A;  4G12 A;  4AYB A;  3CUQ B;  5LHH A;  3FXM A;  4BHC A;  1JUM A;  1VQO I;  4KFC A;  4AIK A;  5FJ8 J;  3L2V A;  3ERM A;  1F1Z A;  1O3R A;  1E3H A;  2I10 A;  1VQ4 I;  1ITY A;  4NC8 A;  4IQJ A;  3CCE I;  1Z3Y A;  4OIQ F;  5EZG A;  3QP5 A;  5EEG A;  1I27 A;  2UWM A;  2HDD A;  4WCG A;  3N05 A;  2OD5 A;  5JR3 A;  2CW8 A;  1VI0 A;  2JPB A;  1J7K A;  3OYB A;  2VJI A;  1QPI A;  3J80 K;  4UV9 A;  2WY8 Q;  1QVU A;  3FBN B;  1JT6 A;  2A05 A;  4XLH A;  2AQE A;  1P7I A;  4MFD A;  1UCR A;  1Z6T A;  3OSG A;  1X2M A;  3BR0 A;  3S2D J;  2H1K A;  3E3V A;  4HG2 A;  3SZT A;  1SD5 A;  3H9G A;  3LWF A;  4EJV A;  1NG6 A;  1MIJ A;  3CC7 I;  4I98 B;  5CVI A;  2MLG A;  3TOB A;  2Z2S B;  1MW7 A;  4DGW B;  2E60 A;  2ZJQ F;  3UR3 C;  4A0Z A;  2WWY A;  2P81 A;  1UG0 A;  1B9M A;  5KCM A;  3O6B B;  5LFA A;  2VE9 A;  4XSX F;  4MHG A;  1YHQ I;  1J9I A;  1J5Y A;  1VND A;  3FXL A;  3KYC B;  1E17 A;  2HTS A;  1YRN A;  3P9K A;  3HOZ J;  4CA0 A;  5LGN A;  2LLK A;  2XRL A;  4HZF A;  4B4C A;  2K40 A;  3ZQL A;  1U5T C;  3K1P A;  2A61 A;  4KA4 A;  2QSG X;  2NOJ B;  2L9V A;  4M73 A;  2GAU A;  1X2N A;  1QZY A;  3MQ0 A;  3DTE A;  4ON0 A;  3DV8 A;  3F6V A;  1KU7 A;  4I6Z A;  2QM3 A;  2EV5 A;  2HXI A;  1MSF C;  4M3F A;  5LEJ A;  2WAQ N;  4MTE A;  3S1N J;  3DBR B;  1UFM A;  5ICG A;  3SJM A;  3ONQ A;  4Y33 A;  5GP9 A;  1FT9 A;  4OAY A;  1U6G A;  1I50 J;  1A6I A;  1W7P D;  2M3A A;  2L01 A;  4M3B A;  2PI0 A;  4XOR A;  1LFB A;  3M3Y J;  2RGV A;  3IAM 2;  2VBY A;  5KK1 A;  3OY9 A;  4GDF A;  4UVC A;  3WG7 H;  4D7N A;  3OYK A;  1HC8 A;  1B4A A;  3MKW B;  3BTC A;  1APL C;  2DQL A;  1OCC H;  1XDU A;  4ZYH A;  2HDW A;  3BG7 A;  1YG2 A;  3HEF A;  4D5F A;  2CUF A;  4LK0 F;  2Y0S N;  3OYE A;  3L2R A;  4YIF A;  3M8E A;  1WJ5 A;  2F5E A;  3LL7 A;  3U1D A;  2MG4 A;  1WVR A;  4HQM A;  1BI3 A;  2O03 A;  3C3W A;  4BBR J;  4IKF A;  3OV8 A;  2AXT C;  4N9H A;  3A4C A;  5F0H A;  5J8F A;  2A6T A;  5EDN A;  5A2Q K;  1O3Q A;  2DAO A;  4BJT A;  3JRB A;  1XCV A;  2WAQ A;  4EEF G;  1JJ8 C;  1B1B A;  1K78 B;  3CQZ J;  2DOD A;  3VOD A;  2UV1 A;  1DP3 A;  2HQR A;  3OYD A;  5DDG A;  4ZYG A;  2VT3 A;  1TBX A;  4RGR A;  3Q9V A;  5FD6 A;  1Z6R A;  2Z5U A;  4ZYD A;  2COM A;  2QBY A;  4XLP F;  1ENH A;  2ZJR F;  1IGN A;  4RAY A;  5K7Z A;  1KYZ A;  1OYW A;  3K4L A;  3HOY J;  5E1X A;  1Y8R B;  3WGI A;  2P6T A;  4O5V A;  2BGC A;  4AU7 A;  1P9Q C;  2QZ8 A;  5HS8 A;  1S7A A;  3OYL A;  4QLC U;  2M8G X;  2HR3 A;  2L7Z A;  3T0Y A;  2LY9 A;  2BVM A;  5L3G A;  4CIC A;  2AS5 F;  1PUF A;  3CCM I;  1ON2 A;  3ZQ7 A;  1AKH B;  2EZI A;  4IL6 C;  4UY8 I;  2F4O B;  1GVD A;  2Y0S A;  5IY5 H;  3CMM A;  5B1A H;  1X1B A;  5DTD A;  2VXD A;  1I1S A;  3V7R A;  2A6E F;  2YU9 J;  3QOE A;  3HYI A;  3R6S A;  1N75 A;  3FXR A;  3GTJ J;  4BEH B;  3ZQF A;  3FZV A;  5J1Y A;  3K4C A;  1IRG A;  5H2F C;  5CJ9 A;  1JKR C;  1KU2 A;  1HF0 A;  1XDS A;  2HPM A;  1OPC A;  1EV7 A;  2VUM J;  2MSY A;  4EM2 A;  4XID A;  1O7L A;  3TDZ C;  1IUY A;  2QSH X;  1FTT A;  3JRA A;  3RTR A;  5E3M A;  4NB5 A;  1MH4 A;  3H0D A;  2VBZ A;  4FX4 A;  1TTY A;  5D6E A;  4Y3O A;  4UB8 C;  1MBJ A;  2J5O A;  4E7Z A;  5M5Y J;  2ELJ A;  4XKV A;  1Z67 A;  3H92 A;  5E79 C;  3NWS A;  4ZDP A;  1LDK B;  3ZQQ A;  4ESF A;  1MSE C;  4YFK F;  1XMK A;  5FKL A;  1HKS A;  5IT3 A;  1I6H J;  3K2Z A;  1QRY A;  5FFZ A;  1D1A A;  4G6T B;  3TOA A;  3X2Q H;  3HOT A;  3MZH A;  5FLX K;  1YS7 A;  1Z3X A;  1R4N B;  4X1E A;  1N78 A;  3K0L A;  3D1N I;  2X6Y A;  1H9G A;  1VQ7 I;  2A07 F;  3WTU C;  1HCR A;  1SD4 A;  2BV6 A;  4CDG A;  2HU9 A;  4EJT A;  3S8P A;  1OMI A;  4IHV A;  1WJB A;  2Z33 A;  3W2V A;  4RDU A;  1BI1 A;  2O8X A;  4J19 A;  4KIS A;  2GXA A;  2V79 A;  1FEX A;  2WV0 A;  2L4M A;  3TO7 A;  5EEH A;  3RPU D;  2QSF X;  3GO5 A;  1YIT I;  4BU2 A;  3B73 A;  3LSH A;  4RM3 A;  4XM3 A;  4YG2 F;  3W2A A;  4CYC B;  4V2G A;  3CDH A;  4XL9 A;  5C4J J;  2KP6 A;  4BJ5 C;  1X3Z B;  2XAF A;  1Z77 A;  3HGY A;  4GGG A;  4II2 A;  4A12 A;  2W4S A;  4C2T A;  1FBQ A;  3IH4 A;  1SC7 A;  4IVN A;  1BOB A;  5IOY A;  3RYR A;  3IRQ A;  1I39 A;  2MD0 A;  4IHY A;  4XRS A;  1IDY A;  1HW5 A;  5FKK A;  1IW7 F;  2Q1Z B;  3CME I;  3A1Y A;  2CFO A;  4HEA 2;  1NH3 A;  3S1Q J;  1U9N A;  1UST A;  1XMA A;  1G3S A;  2KHM A;  2R5Y B;  4EM0 B;  5D5W B;  2DFH A;  4XLN F;  3ZRG A;  2GOM A;  1OKR A;  3BTL A;  3IP4 B;  1WZ2 A;  1IN4 A;  3ZCO A;  3KET A;  4F91 B;  4OIR F;  3AG3 H;  5L3D A;  3ZQG A;  4OIP F;  4WX9 A;  2VON A;  1LFP A;  3F6O A;  3ROU A;  2VL8 A;  1HDP A;  2XDV A;  3AG1 H;  3D5L A;  2F2E A;  3F9K A;  3M8F A;  3DPT A;  3ZN0 A;  2XGE A;  2O5R A;  2B0L A;  2ECC A;  2WTE A;  4BXU A;  4UNO A;  1MJB A;  3I64 A;  1YW9 A;  3WE3 A;  4BHP A;  4XKW A;  3OR1 C;  3WHB A;  1TQP A;  1JKO C;  3IWF A;  2DMU A;  2CV2 A;  4HNU A;  1TQM A;  3MFK A;  4HF2 A;  4A0Y A;  2PLY A;  3BG9 A;  4WK8 F;  3CD6 I;  4PGG A;  1EH6 A;  2W48 A;  4X0G A;  3K70 C;  4FE4 A;  4A3K J;  1JTX A;  2KIQ A;  1YYV A;  2EJR A;  1VQP I;  1SAU A;  3JAM K;  2XF5 A;  2XAG A;  3FMS A;  2VKH A;  3KE2 A;  4IXA A;  1WHU A;  3KPH A;  1KA8 A;  5D8K B;  2DT6 A;  1BIA A;  3DWL E;  4A3J J;  2X6O A;  2KMU A;  5IP9 J;  1MMS A;  4MGR A;  4BBS J;  4M3E A;  2Z99 A;  4CXF A;  3TED A;  1K83 J;  1TZL A;  2XGX A;  1I3Q J;  2F5F A;  4WF2 A;  4WXH A;  3HGG A;  1B72 A;  1ETO A;  3GLX A;  4PJL A;  2I8D A;  4A3E J;  2L9N A;  4Y17 A;  2K9M A;  2MYS A;  5F04 A;  5IT9 Z;  4NC7 A;  4UUS A;  4E7K A;  1LE8 A;  1BOA A;  1RUO A;  4JK1 X;  4OU0 A;  3LFK A;  4BXF A;  2F48 A;  4GFB A;  1ZLK A;  1ETX A;  3ZQC A;  4HF0 A;  3OOP A;  1IO2 A;  3H5R A;  2VJ4 A;  3HOX J;  1BJZ A;  2P8T A;  3PFY A;  2HQA A;  1IUF A; 
#chains in the Genus database with same CATH homology
 3D5S C;  3OS2 A;  1D0X A;  2GOX B;  1PJR A;  4IZZ A;  5FRO A;  4LIV A;  3DU5 A;  2R7Q A;  2BW3 A;  1G59 A;  3BCA A;  3U21 A;  2IGN A;  3CP2 A;  3OL3 A;  3S3M A;  3EUK L;  1E0E A;  4PJJ A;  3OWT A;  2WAD A;  4BE2 A;  1MMA A;  2E5Z A;  1D0Z A;  1GLN A;  4Y4R A;  3HKZ A;  1BR4 A;  2JSP A;  3OOU A;  2VJ5 A;  4E7L A;  3HPH A;  4XKC A;  3OYH A;  1WFX A;  1LVK A;  4XKB A;  2F6C A;  4KT6 A;  3PL8 A;  2KQR A;  3J7A Y;  4PFO A;  2OV7 A;  3OYN A;  2VQC A;  1VZ0 A;  4PFP A;  3KEY A;  2BVL A;  3C2H A;  4ZJZ A;  1X1D A;  4HPQ A;  2BW3 B;  4F93 B;  3C2G A;  2IS6 A;  2KZV A;  2JVH A;  2WAE A;  1J09 A;  2ZSI B;  4XN0 A;  3IAS 2;  2JVG A;  4U87 A;  1OLT A;  3HPG A;  2M0M A;  3OIQ A;  3DTI A;  2ZXI A;  4F52 A;  2LC2 A;  4CCN A;  2V26 A;  5CKT A;  4PSX A;  3TMO A;  2VKD A;  4BDY A;  1ERD A;  2OUM A;  3SZG A;  3H5N A;  4IX7 A;  2DCE A;  2PJR A;  3HXL A;  3PNY A;  2R7R A;  4BAC A;  1EA3 A;  1UEL B;  1SFK A;  5HLT A;  4XLC A;  3HOS A;  3QYF A;  3S3O A;  4B48 A;  4NQW B;  3OYF A;  3L2W A;  3ZXS A;  2F5V A;  1ZEL A;  2CW7 A;  2K3P A;  3OMY A;  3LMM A;  4DIQ A;  3E0J B;  3I3L A;  2R7O A;  1Z21 A;  2R7U A;  3A2K A;  1HA8 A;  3SDB A;  2IS1 A;  4P5O A;  2Q2E B;  4CUG A;  4E7H A;  2IGO A;  2V7F A;  3S93 A;  4AVZ A;  2PJR B;  2VQG A;  5HNH A;  2W1O A;  3L2Q A;  1OR7 C;  5HNF A;  1X4O A;  4AYB A;  3DQV C;  1D0Y A;  3BCB A;  3VSL A;  2HVQ A;  4XOP A;  1V5E A;  3L2V A;  2R7T A;  2X6X A;  3K4K A;  1UAA A;  2W7N A;  2KPM A;  4NC8 A;  4IQJ A;  4CCL A;  4F92 B;  1Z3Y A;  2CMP A;  3NWT A;  3SEZ A;  2CUZ A;  2UWM A;  2VIX A;  3N05 A;  4MLO A;  2CW8 A;  3MMY B;  3OYB A;  2VJI A;  1W36 C;  5FRM A;  2DT7 B;  2K5C A;  4HSR A;  2WY8 Q;  3FBI B;  3FBN B;  2LYC A;  4JQF A;  4XNF A;  1Y6I A;  3VYT B;  5KNL A;  4E7I A;  1K6Y A;  4XLH A;  2AQE A;  3VYR B;  1MMD A;  2HVS A;  2V1N A;  1QU3 A;  3KYL A;  3PJR A;  2IS2 A;  4B44 A;  4HG2 A;  2ZFU A;  2LBF A;  1X1C A;  2A5W A;  3H9G A;  4E6K G;  4PSW A;  4J00 A;  1FMW A;  2FUG 2;  1NG6 A;  3DTK A;  3EUA A;  4XLF A;  2Z2S B;  3IUO A;  1MW7 A;  4DGW B;  2E60 A;  2HVR A;  3OYG A;  1WJD A;  3UR3 C;  4H4K C;  1UG0 A;  1D1C A;  2MC4 A;  3OYA A;  5KCM A;  2XF7 A;  5LFA A;  3V42 A;  3RSN A;  3PUB A;  4XON A;  1LKX A;  2DXI A;  2HNH A;  4N4O B;  1Z7L A;  1U0J A;  4C2U A;  4CA0 A;  2XSJ C;  2L7K A;  2R7X A;  2P0W A;  4J01 A;  4CZC A;  2NOJ B;  4PJM A;  2VQH A;  3DTE A;  3K6G A;  3VYU B;  2X85 A;  3LSG A;  2LBF B;  2X51 A;  2RNG A;  1QHH D;  3VSK A;  3VWB A;  4BUP A;  3CJR B;  1WJC A;  2CH0 A;  2UUZ A;  2R7S A;  3ONQ A;  4Y33 A;  2X1D A;  2L9S A;  2WAF A;  3SYT A;  4OAY A;  4ZDL A;  3EPZ A;  2V6E A;  2M3A A;  1QHG A;  2ZSH B;  4XOR A;  2R7V A;  4KJZ A;  3PSI A;  3G2B A;  3LFU A;  3IAM 2;  3OR2 C;  5LD2 C;  3OY9 A;  1KON A;  3H9J A;  4ZDO A;  3OYK A;  3UNG C;  1T0F C;  1IRX A;  1BR1 A;  3MKW B;  2PMZ A;  4XOT A;  4LIT A;  2HDW A;  3BG7 A;  3K10 A;  2QKM B;  3L2R A;  4ITV A;  3OYE A;  1MMG A;  3DPL C;  3DPU A;  1WJ5 A;  1X1A A;  3LL7 A;  5HVQ C;  1WJE A;  4HST A;  3CP8 A;  3DKY A;  3OYM A;  3CF2 A;  3W2W A;  4IKF A;  3A4C A;  5CQE A;  2A6T A;  2M7A A;  3E1S A;  4BJT A;  2XF6 A;  2WAQ A;  4BQN A;  3DLA A;  4DOZ A;  4R79 A;  1DP3 A;  1AA7 A;  2UV1 A;  3TL4 X;  2CUJ A;  2AQF A;  3HG9 A;  3OYD A;  3AKZ A;  3PNT A;  4BGD A;  1PYV A;  4C30 A;  4XN3 A;  2W00 A;  4XLA A;  3ZGK A;  2WB1 A;  2M4K A;  4BEH A;  4B43 A;  3K4L A;  4PK4 A;  2KDO A;  2V9K A;  2KRH A;  4BE1 A;  4E4H A;  4AU7 A;  1P9Q C;  2F4I A;  3OYL A;  3TBI A;  2CV0 A;  1Y56 A;  2BVM A;  4LIU A;  4XLE A;  4CCO A;  1DGW Y;  4XR6 A;  3K4B A;  3K70 D;  4RM2 A;  1WJA A;  4BS9 A;  3S3N A;  2Y0S A;  2LG4 A;  3CMM A;  1X1B A;  2VXD A;  3HC7 A;  4ANJ A;  4DBQ A;  3D5R C;  4DJA A;  2RQQ A;  3SEQ A;  3QOE A;  1N75 A;  2X1E A;  4FET A;  4BEH B;  2M7B A;  4RLF A;  1V5G A;  3K4M A;  2LY1 A;  3K4C A;  3VYS B;  2KL4 A;  3EUH C;  3CJQ B;  2VB6 A;  4D1Q A;  2HPM A;  2VQL A;  1MNE A;  4NNJ A;  4XMY A;  3LSM A;  3PNV A;  1G8X A;  1YE9 A;  5CQG A;  3H9Q A;  4CCJ A;  5TGT A;  2LRD A;  4D9J A;  3RTR A;  4JOM A;  2MFZ A;  2HPI A;  1DQU A;  3H0D A;  4F55 A;  2L2O A;  1MMN A;  4Y3O A;  2IGK A;  3MKZ A;  4E7Z A;  5JHF A;  2ELJ A;  4XKV A;  2IGM A;  2LOO A;  3NWS A;  4ZDP A;  1LDK B;  3ZQQ A;  1TT0 A;  4KIT B;  3QYB A;  5HOO A;  1NG7 A;  3HL2 A;  2DOA A;  2Z1D A;  3KX2 A;  4BQO A;  1D1A A;  4G6T B;  3HOT A;  3ZR8 X;  3RCO A;  3OIP A;  4CSW A;  1Z3X A;  4B3X A;  3AFH A;  1R6R A;  3L2U A;  4ZC3 A;  2VLA A;  1N78 A;  2V4J C;  2CS3 A;  2KLO A;  4BE0 A;  2X6Y A;  4CCM A;  4NUB A;  2HU9 A;  3OYC A;  3S8P A;  2R7W A;  4HRI A;  1BR2 A;  4OWR B;  1WJB A;  5CPR B;  3VDX A;  3W2V A;  4EAT A;  2DJI A;  2KRC A;  1X4P A;  4N4N B;  4KIS A;  3BC8 A;  4ZTJ A;  2E5N A;  3H5A A;  2LY2 A;  3RPU D;  4BU2 A;  1N77 A;  3LSI A;  3LSH A;  3QYE A;  4RM3 A;  3PSF A;  4XM3 A;  4YRV A;  3W2A A;  3FKJ A;  4XL9 A;  3S32 A;  2KP6 A;  4BJ5 C;  3AL0 C;  2R4G A;  4CCK A;  1T95 A;  3LSK A;  4II2 A;  5KHD A;  1YX3 A;  3MKY B;  2W4S A;  4C2T A;  1YX5 A;  3FHN A;  1BOB A;  4C9Y A;  2MD0 A;  2ZXH A;  2MAB A;  2OC6 A;  2Q1Z B;  2VJJ A;  2CFO A;  3A1Y A;  4HEA 2;  2VPL A;  4B47 A;  4BL0 B;  4ZTF A;  2KHM A;  2JA2 A;  2JUG A;  4LG3 A;  4YEL A;  4YEJ A;  3MD2 A;  2HZD A;  3ZRG A;  3AL0 B;  1D1B A;  2GOM A;  3IP4 B;  4RLQ A;  2BOL A;  3OS1 A;  4IQ4 A;  3ZCO A;  4F91 B;  2X6W A;  1LFP A;  3K4J A;  2VL8 A;  3OS0 A;  2XC7 A;  4GRI A;  1JI8 A;  3CZ6 A;  2XDV A;  3D5L A;  4HNT A;  3F9K A;  3DPT A;  3I9V 2;  2O5R A;  3K4N A;  2W82 A;  4BJ6 C;  4XKW A;  3OR1 C;  3OL4 A;  1WJF A;  2WY7 Q;  2X1C A;  2CV2 A;  2LH9 A;  4HNU A;  4FAS D;  4XQF A;  3W3C A;  2WBM A;  3QOD A;  4X0G A;  3K70 C;  3DKX A;  4PJN A;  3OYI A;  3BLY A;  2RRE A;  1SAU A;  1MND A;  2E1M C;  2XF5 A;  2VXZ A;  3CES A;  2VKH A;  3GBG A;  5FRN A;  2K9L A;  4E7S A;  1FMV A;  2M4G A;  3M1C A;  4P1W A;  2DT6 A;  2LRE A;  3DWL E;  4E7J A;  4BDZ A;  1V5F A;  2L5Q A;  4ZYA A;  4BQQ A;  4QPO A;  2KMU A;  3OYJ A;  3BG6 A;  2Z16 A;  3M8J A;  3DEE A;  1TZL A;  3FDY A;  4DBR A;  4QPQ A;  4CH7 A;  3H35 A;  2E1M B;  3RQ4 A;  4PJL A;  2I8D A;  3DU6 A;  3HUG B;  4OAZ A;  1W36 D;  2L9N A;  4RMN A;  4F3Q A;  2K9M A;  2MYS A;  2VAS A;  4II3 A;  4NC7 A;  4U7B A;  4E7K A;  1X19 A;  2IS4 A;  2WA0 A;  2IXS A;  4BXF A;  4PUS A;  1S9H A;  1DGR M;  2XAU A;  3H5R A;  2VJ4 A;  3PFY A;  2QKL B;  2CV1 A;  2HQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...