2XC7A

Solution structure of phax-rbd in complex with ssrna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
GAMAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords PHOSPHORYLATED ADAPTER RNA EXPORT PROTEIN
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xc7A00
2W4SA 2XC7A
chains in the Genus database with same CATH superfamily
3O8HA 3A03A 4I99C 2FA5A 5ERIA 3I64A 2FMLA 4AYBN 3GTOJ 1ORKA 1XC5A 2ELHA 2WA0A 1QHHD 2H27A 1BC7C 1JKOC 3PUFA 3BCAA 4B44A 3IKVA 1HW5A 2CV0A 3H92A 4HDVA 5GAHJ 2R5ZB 4D0PA 3VB2A 1I3AA 4L9NA 2HDDA 3V8JA 4BAYA 4G12A 2MBFA 2WADA 4JK1X 2DMTA 4A2UA 4Y13A 1RKTA 4L0ZB 2CW7A 1IN8A 2KL4A 2EWNA 2WBMA 1WFXA 1O4XA 1BA5A 1A6QA 1TL8A 1WQ2A 3KIOA 4MNUA 4C3JJ 4YRVA 3SFIA 4XRMA 1B72B 1R71A 3JRDA 3SFZA 2GZWA 2AXLA 3FBNB 2DK5A 3IWFA 1OCPA 5LRSA 3S2DJ 2OZUA 2E19A 1SC7A 4V2FA 4N4OB 3TBIA 4I98B 4ESFA 4G6DA 2K7LA 3PM1A 2XF6A 3WTVC 4FCYA 1XMKA 4IKFA 3BG5A 3GWZA 3IUOA 1D0ZA 2LKSA 2YSRA 1F5TA 2JA6J 3I55I 3H0DA 5EG0B 4HOBA 2E2IJ 1T08B 1QPMA 1D1AA 2NOGA 3OR2C 4OIRF 4P9UA 5ED4A 2XROA 3K70C 1ZR2A 2BVMA 5EGOB 3J80Z 1EJ9A 1FSEA 3S14J 5M5XJ 3FMRA 3SEZA 4N4NB 2LFBA 3HXLA 1NK2P 2ID6A 3S3NA 4ASNA 4BACA 1JJ8C 2WY7Q 3ZMSA 4V19K 2L3DA 2M3AA 3CDLA 4J19A 3ECHA 2MYSA 4UV9A 2NS7A 3K0LA 2D45A 5E17F 2ISZA 1MNEA 2KISA 2LDUA 2Y9YA 1T0FA 1FOKA 4DYQA 3L2RA 3TMOA 2Q2EB 3MKZA 3CUOA 3GFMA 4G7HF 4LMYA 1O7FA 2DU9A 1BOAA 2Y0SN 4XMYA 2XSJC 1SMTA 1JHFA 1BC8C 1LE8A 3DBLB 2E35A 5HLHA 3WTWC 3J7AY 1YW9A 2KT0A 4XN0A 2M2EA 2I10A 4BS9A 5K5RA 2R7QA 3CDHA 4PUSA 4Y4RA 3DPTA 1H9TA 2LRDA 4XLFA 2KZVA 2P6SA 3S93A 5FLVA 5K7FA 4LIVA 4WWCA 5TGTA 3WG9A 3RZOJ 3E0JB 2L4AA 2NVYJ 4XOPA 4JX6A 5IY5H 3CCUI 3HPHA 4II3A 3K2AA 2XGCA 4A6DA 5KCMA 4BBSJ 5ICGA 1V5GA 4HG2A 4DBQA 4HPQA 4KN7X 4EATA 4R79A 1OYWA 1YJ9I 2L7FP 1EH8A 3DKWA 1ZQ3P 1K78A 2JRMA 4LJZF 5F6FA 1FNNA 4H4KC 1X2NA 4S04A 4ETSA 4IQ4A 1VQLI 1WH5A 2E60A 2K9NA 2OTJI 1IN6A 5IP9J 1SD7A 3TOAA 2CSOA 2YU3A 2FJ1A 5DDGA 2ZSIB 1XD7A 2CH0A 4Y17A 1YX5A 3A4CA 1O7LA 3DBHB 5L3EA 4BXFA 5CVVA 4A3IJ 4X1EA 5DV5A 3OYDA 2GXBA 3KPHA 3I0TA 1J7KA 1R4NB 4YFXF 2M8GX 2V79A 1AA7A 3GBGA 3DPUA 2HOTA 2XUBA 4RM3A 6PAXA 5HS9A 1HSTA 2HDWA 2K9MA 4GCVA 2Q1ZB 1FJLA 2PQ8A 5E3NA 2H94A 1LVAA 4A5NA 1S7AA 5J1YA 1N75A 3J7ZI 1Y8RB 4B4CA 3ZQHA 2VIXA 2PJRB 2ZJPF 3B73A 4LFUA 2JN6A 1Z1DA 2CS3A 4NB5A 3X2QH 5HVQC 1GLNA 1Z05A 3DKXA 4RGRA 4LGWA 4Q4ZF 1S6LA 2CUZA 3MVPA 2YX7A 1DQUA 3EQLF 3JREA 2OV7A 4IHSA 3CDIA 3HRUA 3RTRA 2MSYA 3N4MA 3BQYA 1WRJA 1X3WB 2V9PA 4PK4A 2LK2A 3TO6A 4LD5A 2K3FA 2HWVA 2CU7A 4ZDOA 1VQ6I 4XIDA 3FHZA 3FF5A 3OYBA 1VQ5I 3BQZA 1LDKB 3FK6A 3CC7I 1XSXA 4MTDA 2PX9A 1A36A 2R7WA 2LBFA 5LHHA 4OIQF 3FHNA 5IT9K 3V4GA 4A0XA 2M9HA 2Z2SB 1F43A 1DU0A 3NEUA 3HJEA 3LA7A 3G1LA 4AVPA 3DLAA 4XLEA 2XAQA 1LE8B 1LB2A 5B1BH 1EKEA 3S8PA 4BL0B 4E7SA 2MW8A 3G3ZA 4O5VA 5IP7J 2HQNA 3VYUB 5AIQA 1HW2A 3I3LA 4IHXA 1T0FC 3R60A 1X1AA 3LSTA 2K40A 4ZC3A 3TOBA 2O8XA 4XBFA 1RZ4A 1Z91A 4FETA 5FB2A 2JZYA 3PO3J 4LIUA 2QEXI 3WODF 1W7PB 3JCUC 1IDYA 3HOWJ 2GIVA 1QO0D 5CVRA 3RKYA 4NC6A 3HRTA 5H20A 1ZLKA 2CFOA 3QPLA 3F22A 3J7AO 2R7UA 2VKEA 3WGHA 1I1SA 2DQRA 3HBLA 1FLIA 3D1NI 4BEHA 1BBYA 3ZGKA 4QLCU 2CW8A 3SQNA 4ESBA 4BJTA 2R5ZA 2L2OA 2VJIA 2E1MC 1D8KA 5GTHC 4I01A 2XAHA 5ICCA 2HOSA 3KYLA 2YS9A 3REOA 3S1QJ 3V7RA 3IH4A 1ZELA 4CSWA 1ITYA 2ZMEC 5L3DA 1B9MA 5K5QA 1U3EM 2VKDA 2YU9J 3CF2A 4BKXA 3KFWX 1OLTA 1MMDA 3BTLA 1TZLA 3NWTA 3LAPA 1JI8A 3ESWB 1S5LC 2BXZA 3K70D 3WTXC 3ZCOA 2ZFUA 2KZGA 3KLOA 2DBBA 4G7ZF 3TEDA 4ABZA 1ETVA 4GXOA 3ABUA 4CYDA 4BE1A 3OYFA 1S8NA 2KIUA 3KCCA 1HF0A 2ZXIA 4A0YA 1XS9A 2BHZA 4KISA 3NARA 2HGCA 3D5RC 1WZ2A 3RJPA 1T8IA 1KU3A 3BROA 2K02A 1WJDA 2GOXB 1BI1A 4XR6A 4LK0F 3E6MA 3HRMA 4XOTA 2X0LA 3H35A 1IN4A 2M1BA 3EUAA 5IYCJ 1NG6A 3KETA 2CWEA 2R7SA 2CV1A 5IT9Z 3CLOA 4GFBA 1SFKA 2F2EA 4M6VA 3S2WA 3QP6A 2OPTA 2K9LA 4N9HA 3T0YA 4A3GJ 3FKIJ 2EV0A 2JTVA 3K4JA 2O6GE 1XTAA 4QSHA 1IRZA 2DFEA 2JA7J 3F23A 4P5OA 3GTMJ 1Z0XA 2ZMEB 3C1DA 2WAEA 1Y8QB 2M7AA 3WHBA 3F8NA 1YI2I 1IGNA 2CW0F 1NK3P 1S7EA 2IP2A 2RNGA 3HTUA 2HDCA 1WJFA 3T1BA 1YX3A 5DM7F 4B3AA 5KK1A 4CCKA 5HNHA 1O3QA 3LWFA 4EJWA 3V8KA 2W7NA 1VQ9I 3HHGA 3KYDB 4GYGA 2KJCA 5BQTA 3G1MA 2HZDA 3W6KB 1FYLA 2IT0A 2BGCA 2K85A 4HA8A 2VLAA 3GTPJ 3B6AA 1QZEA 2QKLB 1ZRDA 2YPRA 4UUSA 3QPSA 3TKYA 4F52A 2Y2ZA 3DU6A 4BH9A 1X4OA 2M34A 2W57A 3MZ8A 1LFUP 2K4BA 3K4BA 5JI6A 2OD5A 2BZTA 1UFMA 4A3BJ 5HODA 3QP5A 3VSKA 3IAM2 2DA1A 2QM3A 4BGDA 2XHKA 1BIAA 2FX0A 2L02A 4Z2YA 2LP0A 3OYMA 3TP3A 1Z67A 1BJAA 2JQ7A 4LG0B 3LQRA 2DA3A 5HLIA 2K86A 2CQKA 2IA0A 4NNJA 5H2FC 3RPUA 1A6IA 2P8TA 4WXHA 3CMYA 3PSIA 3CZ6A 4C2TA 2W48A 3VYRB 3PIPF 5H6RA 2R7FA 2Y30A 3HZJA 1SFXA 2A61A 3L2QA 1P4AA 3EPZA 4P9FA 1Y39A 1Q1HA 3KP2A 4JBAA 2RC4A 2GXAA 3ZQLA 2NS8A 1ZRCA 1TWGJ 3I56I 4MQVA 4N9IA 5TISC 5JHUA 2L9NA 3ML6A 5CJ9A 2QUFA 2JVHA 2NVQJ 2DW4A 2LMDA 2X6WA 2Y0MA 2IJLA 2LLKA 1FBSA 1GV2A 3P9IA 4PJMA 2ME6A 1VQNI 4UB6C 3ZQ7A 1E3PA 4NHJA 2DMQA 3FXQA 3HL2A 2EZLA 3S17J 2LVSA 1ZG3A 2P81A 3WTZA 1IV8A 4RA2A 2OF7A 3QU3A 1MH3A 5EJCA 4BXUA 4FE4A 3FXKA 2V4JC 3H5RA 4CCNA 3WE3A 3FXLA 3OYNA 3HOVJ 3H3ZA 1CGPA 1QQIA 1GXPA 2KRHA 4MGRA 2UZKA 4DW6A 2FD5A 2V9KA 3JTGA 1D0XA 4XL9A 5E3OA 2VN2A 3WTYC 2MLKA 2KMUA 2M4GA 4HSRA 4PJNA 2E34A 5FFZA 4XM3A 1TW2A 2E71A 1FX7A 3I9V2 2JSCA 2EH3A 2QCOA 4AUXA 3F6VA 1POGA 3VODA 2L7KA 5FKOA 3DLLF 1WKMA 4XK4A 2M45A 4XKBA 3O2PE 1SVOA 3LSHA 4MFDA 1W7PD 4RGSA 2F5FA 3HDDA 1YITI 1I6HJ 3RQIA 3ZPLA 3F6OA 4RS8A 1XGMA 1PP7U 4HV5A 3J80K 3BLYA 4AU7A 4M6XA 2MGQA 4L9TA 3FZVA 1K6YA 4DYRA 4XLPF 4FISA 2KDZA 2HPMA 3L2UA 4YIRX 1LEBA 3GCMA 1OJLA 2A07F 4A5MA 4M3BA 5FD5A 2DYSH 4M74A 2VKHA 1D1BA 3FXJA 3P9KA 2MH9A 4PCQA 4YFNF 1OCOH 1TWFJ 2XB5A 2IS6A 1SVMA 4XICA 5D4RA 4KA4A 3NQOA 3BPXA 1FOXA 4IO9F 1GXQA 2MG4A 2L5QA 3R4KA 3WU2C 3K7AJ 2X6OA 1BW6A 3MKLA 4NQWA 4XSZF 4QIWN 1I50J 1AKHB 1SD6A 2J5OA 4A69C 3BR1A 3PQKA 4P96A 2EBIA 3TW7A 1R36A 3HM5A 3OMYA 1AHDP 4L18B 4ZYAA 3E1SA 2M8EA 3M1EA 1G59A 2DFFA 1V55H 2LF8A 3S1NJ 4ENKA 2G0EA 1VZ0A 1N77A 3ROUA 1K83J 2KPMA 3HKZN 3A0HC 4QWQA 1KONA 2VONA 1RETA 2FU4A 2X48A 2XB0X 4IJAA 5C44J 1G2HA 1FY7A 1U5TC 3HGYA 1K4TA 4KIBA 1BR1A 3CQZJ 4K2EA 2RVCA 2PFBA 5F04A 2X6YA 4F7ZA 1ONVA 1OR7C 1VI0A 4RAYA 2GLOA 1QZZA 4Q47A 1V5FA 2KIMA 1G3TA 2JUGA 1HBXG 2V6CA 3N97A 1GT0C 2FBHA 4P1WA 1DPUA 1ETOA 1W1WE 2L4MA 2VODA 1I6XA 4LLNA 2PMHA 4C3IJ 1VQOI 3S16J 3KP5A 1Q1VA 1LEAA 5IOZA 3QOPA 3MQ0A 4A0ZA 4XLAA 3AG1H 1XDUA 3RKWA 2DOEA 2OZ6A 2FQ4A 3OOPA 1H88C 3IL2A 2XC7A 4WK8F 1IUFA 1YIJI 4BE0A 1YRNB 1ETYA 2VJJA 3LSIA 2PG4A 3MCZA 1IG7A 1ETKA 2COMA 5EF6A 5FJ8J 1SAXA 5IYDJ 2E1CA 5HLGA 1FTZA 2R0QC 1AU7A 5M3FJ 3RDIA 5LFAA 4RLFA 1LFBA 1P4XA 3M8JA 3RKXA 3HOUJ 3GW2A 3OYAA 5LEKA 1IC8A 2B0LA 9ANTA 1KYZA 1WH7A 2HQ5A 2KIFA 5D8LB 4CZCA 1B8IB 2ZMEA 2HTSA 5LGNA 1JXSA 3MKYB 4RB2C 1FP2A 3U1DA 1RC9A 2NNNA 2QLZA 4FX4A 2LOOA 3BZ6A 3HSRA 4M3DA 2D2WA 5DCMB 4YIFA 2ZCWA 1OCZH 2X9DA 3Q0WA 4PSXA 5J8CA 5DUKA 2XPUA 3HOSA 1OISA 1OR7A 1T2KA 4ZYEA 5E1WA 3ZR8X 1N78A 1WPKA 1RNLA 3WG7H 2GA1A 3GYHX 2E2HJ 1MBFA 3DTEA 1JTXA 4KICA 1S9HA 2VQHA 1D0YA 2ZFWA 2E1NA 3OS2A 4U87A 2DT5A 4RGXA 3JSOA 2V7FA 3LOCA 3U2RA 1WI3A 5HS7A 5LBQA 3WU1B 3FISA 3IRQA 2ECCA 2RN7A 5GTIC 3PL8A 1J9IA 2DODA 1HQCA 2ZB9A 3CMEI 1UG2A 2XV4S 4ITVA 5C3EJ 2K3PA 3K69A 4RGUA 3BTJA 2QQBA 1D1CA 2DO7A 1P9QC 3GFLA 5BS6A 4NBQA 2FOKA 1X3UA 1XB4A 2OCEA 4YEJA 1YFHA 4HQEA 2IA1A 1K78B 3VYSB 1Y1VJ 5DEQA 2EA2A 4KMUX 4HSTA 3LSJA 1NG7A 4ANJA 2BY0A 4DGWB 1R1UA 2BXYA 1GHCA 1I5ZA 1LDDA 2QVOA 1SMYF 1MSFC 3DU5A 1FSHA 3TP0A 1NTCA 1R58A 2WB1A 2R5YA 2JMWA 2W24A 1FC3A 3ZQIA 3EUKL 5F0HA 4EMSA 1WJ5A 1Y1WJ 2HU9A 2ZJRF 4BJ5C 1FBUA 4MLOA 5EGOA 1ZR4A 3GFIA 1X1BA 3OYIA 4ZZLA 3GMEA 5FD6A 1PJRA 4W1UA 2NRAC 1WJBA 3H3VK 3M1CA 4JP0A 3DKYA 3DV8A 2KHMA 3C7JA 1QRYA 3MZYA 3W6JB 3GTGJ 1F1ZA 3I71A 4IVNA 2IPQX 1U2WA 2DPUA 1W5CC 3CP8A 4U7DA 4MO7A 2HZTA 1XCBA 4YG2F 2A6HF 3ELKA 4I09A 3ERED 2WC2A 2PJRA 3SDGA 3KEOA 4Y52J 2R7XA 2EPFA 2BW3B 2OA4A 4D5CA 4M9ZA 3Q3SA 4PJ0C 3K9TA 3OSGA 2XF5A 5DM6F 2VPRA 1UB9A 2LYCA 1Z77A 4UHTA 3AL0B 2TRTA 1TW3A 1K7AA 1JHHA 3SJMA 1S72I 2X6XA 2IS1A 1YS6A 3FXOA 3BJAA 1VF9A 4B47A 3AFHA 4IX7A 4F92B 3WTUC 4I76A 2HEOA 4ZH4F 1ZN2A 5A2QZ 4ZDLA 1BM9A 4LG3A 2JA2A 1ZREA 1T95A 4KNYA 2VASA 3K4MA 3COAC 1VQMI 3P7NA 1ZLJA 1PVEA 1FZPB 5JVTA 5IYBJ 5K7ZA 4E4HA 2ZBKA 2A6TA 1DP3A 3Q0UA 3Q5FA 4EGZA 2H09A 4U0VA 2QSGX 3L2VA 1ERDA 3OV8A 1AKHA 1HKQA 3SYTA 2W00A 2KIQA 1MBKA 1R9TJ 5FKNA 3U21A 3DCFA 1KQ8A 1WVRA 1F36A 1YLFA 3LA2A 3S3OA 1BR4A 4IRHA 3IWZA 2FEZA 2DJIA 5FLMJ 3G73A 5J4VA 4OAYA 1HDPA 2XDVA 1IZ1A 2XRNA 3C2HA 3S3MA 2E7XA 1UELB 3CO7C 3PUBA 1U78A 3RSNA 3BG9A 3HOXJ 1D5VA 3VDXA 2BE5F 1T6SA 1VQ8I 2JA5J 3BG3A 4EM1A 5FLXZ 5CLSA 1YS7A 2V1UA 5F0CA 3HGGA 1QVTA 1QVUA 4EQQA 1TNSA 3E7LA 4LB6B 1TP4A 1B72A 4YIIA 4KT5C 4DYCA 1R5GA 1CF7A 3VWBA 3OR1C 5CKTA 4RM2A 2FNAA 2AO9A 5EYRA 5ILUA 2BYVE 3LSKA 4BY1J 2FRHA 5JVGF 2DOFA 1SANA 4L5IA 1HOMA 1K6OA 3D5SC 4Y3OA 4I02A 4EV0A 1ZK8A 3BJ6A 3TW6A 3ABLH 4RAZA 1MW7A 4RBOA 2HQAA 1OPCA 1GVJA 5C4JJ 5GP9A 2UUZA 1JKPC 4GRIA 2QQ8A 5CYVA 3K1MA 2IBDA 3F8BA 2RREA 5KVRA 4KDPA 4D7MA 2Z9OA 3IC7A 1XCVA 3SXYA 3OYLA 3QU6A 4J00A 4G6TB 4U88A 1H0MA 1E0EA 3GZ5A 3RPQA 3KZYA 3SZPA 1A04A 1U8BA 4CGZA 4I7HA 2O3FA 2OC6A 5ICEA 4I2OA 3QRFF 3BOQA 4II2A 1FOYA 3GUDA 3GTKJ 4IXAA 4Y15A 4NQWB 2EZIA 4LLLA 5J1RA 1B59A 2IS2A 1BI2A 5TRDA 2UV1A 4OMZA 1AOYA 4J01A 3WTSC 3PNTA 1TT5B 2TCTA 3FK7A 2OTLI 3QQAA 4FT8A 1XSVA 4Q48A 5E3LA 3HEFA 3FXRA 1OYYA 2HYGD 1MMAA 2YUSA 1UHWA 2JUCA 2DFIA 2Y31A 3ZQGA 2DLLA 3Q9SA 4M9XA 2NS0A 3R0JA 5KHDA 3J81Z 2IW5A 1USTA 4BU2A 1FP1D 1MNDA 2XAFA 1XN7A 1RR7A 4S05A 2K5CA 3H1CA 1REPC 1BJZA 4HW0A 3UNGC 3C2GA 2GWRA 2OCCH 1H9GA 2LBFB 2QBYB 2UXNA 2M0CA 1DDNA 3CUQC 4CH7A 2LC2A 3OSFA 3BP8A 4WCGA 1UJ8A 1IRGA 3IHUA 3RYRA 3GO5A 4HEA2 5J6XA 2DTZA 2XASA 1R23A 2F6CA 5CQEA 1UAAA 1PUEE 3M8EA 2L54A 2AQFA 4RB3C 2X4HA 1MDMB 2HVRA 1X3ZB 2QA4I 3FMQA 3FWEA 1GV5A 2EQRA 5FGMA 3OYJA 2XKPA 4DOZA 5LHIA 1GDTA 5GPAA 1LKXA 1Z21A 5EDNA 3CJQB 4BE2A 2VI6A 3S15J 3F21A 1E17A 3F9KA 5DD4A 2RDPA 3LSMA 1FBQA 4CDGA 1G6NA 4OIPF 3HSEA 2GXGA 1RR8C 2R5YB 1D3YA 2R7OA 4L5EA 1TWCJ 2ELKA 1RESA 2F48A 4E7IA 4G6QA 1FMWA 3DPLC 2GAUA 3FDYA 5F0FA 4JOMA 3GTLJ 3P5JA 5F1JA 2LY2A 2CYYA 2ELJA 1OCCH 3FMSA 4F91B 2DK8A 4KYWA 4ENNA 2M87A 3E5QA 2KJBA 2VXZA 1VTNC 1W5SA 2VQGA 2DA5A 4PFPA 3BTCA 4IL6C 1JUPA 1IF1A 1PYVA 2F4MB 4DBRA 1TBXA 4HQMA 3CJRB 4UVAA 2G7UA 1BOBA 2MC3A 1X2MA 2XRLA 4JQFA 3A1YA 5AONA 2L0KA 3A01A 4B09A 2XVCA 1Z6TA 3DWLE 4BQOA 2RQPA 4ZYHA 4CCLA 4IZZA 3RCOA 1WSUA 2ZO4A 2O03A 1ZKGA 3ZQFA 3BR2A 4X6AJ 3M3YJ 3OIOA 3BZKA 3L00A 5J47A 2JA8J 4IRIA 2OQGA 1MBEA 3V8LA 1CQTA 3JRBA 5J1UA 1WI9A 2E5ZA 5F27A 5E18F 3BCBA 2HVSA 3GZ6A 3H36A 2EIJH 2IGMA 4BUPA 3H9QA 2DPDA 2OU2A 2IS4A 3HUGA 3WE2A 3KEYA 5LGTA 2R7VA 2LY9A 3CMMA 2H8WA 2QYOA 4KN4X 2BVLA 4A3FJ 1TLHB 1ZG5A 1XMAA 1YO5C 1EV7A 2E2JJ 4I0AA 2R7ZJ 1JJ6C 3C3WA 4BJ6C 4RAFA 1B6AA 2V1XA 4EM0B 4A3KJ 5L3CA 2LH9A 4IPAA 1SAUA 4BQNA 1XGSA 3AKZA 1LJ9A 4LK1F 2BEOA 1NHAA 2F5EA 3O8GA 1HCRA 4U7BA 4HLYA 2GA2A 1MNMC 1XGNA 4XRSG 4XKWA 4C2MJ 1TNTA 2VPLA 4XN3A 1D8JA 4MIMA 3F8MA 2E7WA 4UXNA 2K9SA 1ZRFA 1SVLA 2PMZA 3K10A 4PFOA 1MZBA 2VBZA 3N05A 4DZPA 1UHSA 2DJNA 5HLTA 4IEJA 3JR9A 3G4SI 4GDFA 3H0GJ 4XRFA 2B63J 3BTIA 3RKQA 4AC0A 4BNCA 5CQGA 4S0HB 3DTIA 2ECBA 4UVCA 3RPUD 4PZJA 4E7HA 1YTYA 3ERMA 5F64A 3OL4A 3I53A 4JX5A 3CF5F 1YHQI 2DMUA 2B7EA 3VSLA 3TL4X 3GVAA 4BY7J 1A5JA 3AG3H 3BG7A 3H9GA 2M5WA 4UUTA 1DUXC 2ISYA 5J8FA 5KNLA 2JRTA 2BHYA 1EH6A 2KFDA 3DP7A 2BY1A 1MDMA 2X51A 1VFCA 4IHVA 1STZA 2XKOA 2VJ4A 2ZJ2A 2BV6A 2EFWA 2A3SA 2STTA 3CC4I 2GOMA 2H1KA 2Y0SA 4A6EA 3NAUA 2CUJA 4L0YB 4E7ZA 3IP4B 3P9CA 3SHFA 3OOUA 1WHUA 3LNQA 1HA8A 2X85A 3KP4A 2FF4A 1U6GA 4HZFA 4CCOA 3OY9A 1VQKI 2V1NA 1FTTA 1Y0NA 3ZOBA 2MD5A 1FYMA 2HNHA 3I54A 4AYBA 1Z3YA 1G3WA 2XAGA 3VEPA 5LLQA 1V3FA 1U9OA 2NAZA 4EEFG 3VOEA 1FT9A 3W6VA 3TDZC 5M5WJ 2JWTA 5BPDA 3IH3A 1YRNA 4H0EA 3HUGB 1L0OC 2Y48A 2V26A 4L5JA 1SFUA 2LNBA 2RQQA 2O8KA 5D5UB 1J2XA 2JJ7A 3OYEA 3AL0C 2EFPA 1JTYA 1S3JA 4G7OF 1TQMA 1YYVA 1W0UA 1HKTA 4AWXB 2QBYA 5KAIC 2QF7A 1BW5A 1OFCX 2W84A 5L3BA 1UZCA 2Z16A 4C30A 3MAJA 2CQQA 2EB7A 4F55A 1H89C 2WV0A 1X58A 3SDBA 1R5HA 4EJTA 2AQEA 2CFXA 2H1LA 3AG4H 2QSFX 3H3UA 2H6CA 3BC8A 2XAUA 4MFEA 2FUG2 2X1CA 4JYKA 2KRFA 3JRHA 3TO7A 1R49A 1JGGA 4O3MA 1ZGWA 2HQRA 2G7HA 1DU6A 2QQ9A 5E8GA 3MWMA 1RUNA 4CHUA 1J0RA 4KFCA 1TQIA 2YX4A 2NNYA 2FSWA 4UVBA 3S32A 3RZDJ 4MQ9F 3ZMTA 2GQQA 3CCSI 3GFJA 2GIZA 2RGVA 3ZP5A 1XGOA 4XNFA 2OAZA 3C2BA 1LNWA 1OYIA 1P7IA 3MN2A 4HLXA 3JAMK 4QTRA 4L9JA 4P55A 4OMYA 3L2CA 1ZARA 5JLWA 2FMYA 4TV7A 2Y9ZA 4CO8A 3UKGA 3C18A 1E3OC 2UXXA 4O6JA 5F08A 5B1AH 2L9VA 1IUYA 3KYCB 2H8RA 2DT6A 4E6KG 4ESJA 5EEHA 2XGXA 1WJEA 3FKJA 2WTEA 2XPWA 1B9NA 1I3QJ 1P6RA 4ZYGA 4W97A 2JSPA 1Z7UA 4OIOF 2R7TA 5D5XB 1W36D 3LSGA 1BN5A 5GADJ 3OWTA 4YFKF 2J5PA 2I5UA 5CVJA 3ISPA 1I27A 1CF7B 2W85A 3NWSA 1O57A 3BR5A 2DCEA 3KP7A 1U5TA 3VPRA 2KKOA 4L9VA 2AHQA 3E3VA 2HS5A 2X1DA 4ZTJA 4A3DJ 3HSFA 2DDAA 1OCTC 1RRJA 3B6CA 3LMMA 4AIDA 3EDPA 4HNVA 3GX4X 4PJJA 1QPIA 3HTSB 2OJED 1R7JA 3ASOH 4WF2A 2IGOA 2L01A 4BBRJ 3TQNA 2A05A 1P7JA 2FNPA 2W25A 4EVIA 2M0MA 3JAMZ 1U0JA 3DFGA 4CCMA 1MJ9A 1HDDC 3ZMVA 4XONA 2M30A 1ZH5A 3BJOA 1SFOJ 3ZN1A 1WGXA 1K79A 2FXAA 4MEYF 1UG0A 4PGHA 2EFQA 1I1GA 4BHPA 4KIGA 1DGRM 1KU7A 1P2FA 2DA4A 3CCEI 3HOTA 2P5KA 1EH7A 3JSPA 1KA8A 1GVDA 2I8DA 4Y7NJ 4IQJA 5LEJA 3H5AA 1FWZA 2OUMA 1OMIA 4F93B 2ZJQF 1LQ1A 2HR3A 3ZMUA 3QPTA 4CUGA 4BDYA 2PLYA 2PMZN 1E2XA 1XG1A 2GBYA 2DXIA 2Z1DA 1VQ7I 3CD6I 5L3FA 1E3HA 5D5VB 3SEQA 1W4MA 4FX0A 3HRSA 1YJNI 4EJOA 1VNDA 3GLLA 3HKZA 1EF4A 2VBXA 4BXXJ 5D6FA 3OIQA 4M9SA 1UMQA 3VYTB 4DNCA 3J7YJ 2VBWA 2HOAA 2LF7A 1MD0A 3W2WA 3CUQB 1R4MB 3CCVI 5L3GA 1QZYA 2L9RA 4PGGA 2NVXJ 1MMGA 1B4AA 4KMFA 3M4OJ 2BY2A 3LAJA 2P7VB 2IA2A 4M3GA 1LPQA 1IN7A 2DA6A 3HB9A 2HXIA 4XQFA 1J75A 1OCRH 4LITA 2L9SA 3OS1A 4UY8I 2KQRA 3BT9A 1QGPA 4BYYA 1T98A 3DXJF 2HOEA 3MMYB 2WAQN 1JT0A 3JRFA 2TDXA 3A01B 5KAFC 2WAFA 3K1PA 5FROA 3EUHA 4PSWA 1YW8A 3ZQQA 4BQAA 3ZN0A 2VE8A 4FQGA 3GF2A 1IXCA 1JT6A 4RAGA 3GZNB 1T56A 1SFEA 4KJZA 3HOZJ 1C0WA 2HTJA 2IRFG 5J3LA 1IRXA 3PFYA 2CUEA 4CA0A 1U5TB 1ACIA 3E5UA 5EEGA 1TTYA 1M1EB 2EV6A 3PSFA 3U9GA 4KT6A 5J4YA 2LR8A 1WJAA 4CYCB 3D5LA 2JPCA 3FM3A 5FFXA 4HRIA 4N0BA 4ZZDA 1TT0A 5CPRB 3V42A 1W7PA 5E20A 3FXMA 5FRMA 3SZTA 5BOXA 4IHWA 2D5VA 2DMNA 2ESHA 2PN6A 4LOCA 1XSDA 1N25A 4E70A 2XAJA 2W1OA 3VFZA 2VT2A 1W5TA 5DD8A 1ZG1A 1R1TA 4IHYA 3DEEA 3F0CA 2F5CA 1APLC 2CQXA 4XLCA 1X4PA 1ETQA 3G1OA 3IRRA 3CCRI 5H6QA 3WU0A 1QU3A 4AIHA 1I39A 5B66C 3F8FA 1UCRA 4R1HA 1EA3A 4MTEA 4C2UA 2MABA 2EA4A 4GO1A 3H9JA 3T8TA 2VB6A 3DBRB 5ICFA 2R7RA 1NH3A 4HX8A 1L3LA 2A68F 4EJUA 4E7JA 2W4SA 2X1EA 2IEKA 3EUHC 5BMZA 1KU2A 2NXNB 3LSPA 4MEXF 2CQNA 3MD2A 2VT3A 1MBJA 1FEXA 2VKVA 1LUJB 2ADUA 3I59A 1ZTRA 2HVQA 3NRVA 2VC1A 2IVMA 3TO9A 4EGYA 2Y69H 1YG2A 3CP2A 3PNYA 2LTPA 2K9QA 1ZAOA 2CJJA 3K4CA 4ZYDA 5F1RA 1FOWA 1F4KA 2JK3A 3M8FA 2WV1A 2DA2A 3CMAI 2W82A 2EIKH 2P5VA 3PO2J 2EZKA 2Q2EA 4D9JA 3MKWB 1BI0A 2Q0OA 3I5UA 3K6GA 2R4GA 2O7OA 2D1VA 4HV6A 3RYPA 2DDBA 4HF2A 2DAOA 2ZC2A 3PIOF 3JW4A 5GAEJ 1FMVA 3PQJA 3G71I 4FASD 1BR2A 3CESA 5DUIA 3H5NA 1V4RA 5C4XJ 2CRGA 1IN5A 1MBHA 4RMNA 2QZ8A 2ZKZA 1T39A 2ESNA 4A3JJ 4A3LJ 2XPVA 1QBJA 2QGUA 3L9FA 5ILVA 1G4DA 4OU0A 3UR3C 2DMPA 4A93J 2O5RA 1Z7LA 1IO2A 1XDSA 2D1HA 1TQPA 1TWAJ 2QENA 2F4IA 2H6BA 4GGGA 5LD2C 2CG4A 2ZNYA 3R0AA 4F3QA 1P92A 2P6TA 4NC7A 3D0SA 3K2ZA 2RKHA 3KE2A 2CV2A 1FIPA 4E7LA 1RKWA 4D5FA 1RI7A 1SD4A 2B9SA 1RUOA 2AXTC 1R6RA 2F4OB 4DQ2A 4M6YA 5LHGA 2CMPA 5ILSA 1HC8A 4UUVA 4A12A 2QSHX 3G2BA 4YELA 1Z3XA 1IXSB 3ABTA 1F9NA 3K4NA 1IDZA 3CCQI 5JHFA 5EZHA 2E5NA 2YR2A 2XIGA 2V1DA 3QYEA 3WGIA 1K61A 2WAQA 2VJ5A 3ONQA 1H8AC 1BIBA 2ZXJA 1K4SA 3B02A 5D6EA 1WCMJ 2R93J 1MIJA 5E79C 5M3MJ 5BNGA 2PEXA 2L7MP 2NVUB 3FBIB 3ZMZA 2Q8KA 3O3KA 2COBA 2ICWG 3OYHA 2NYXA 2DQLA 5FKLA 1HLVA 1OKRA 1P4WA 3BR6A 3OS0A 1QHGA 2P4WA 2R3SA 4UNOA 1Z6RA 2BY3A 3U1KA 4CZZA 2OQRA 2UWMA 3G6EI 4B3XA 1ZYRF 4M71A 3KZZA 1MBGA 3BZCA 4QPQA 3LFKA 2Z5UA 3ZQCA 4I0BA 2E36A 2ZNZA 3KX2A 2KP6A 3CC2I 2Z99A 2MA3A 2V6EA 1KQ9A 1R5ID 4LB5A 3KZIC 1ODDA 5HDKA 5LGUA 3J81K 5CVUA 2VE9A 1JE8A 1KGSA 1LDJA 2DFHA 1DPRA 4B43A 4UV8A 4IOCF 2IGKA 3O6BB 3MZHA 1VQPI 5BPIA 4DIQA 3OYCA 2PI0A 3M07A 5HDGA 4IHTA 1Y56A 3LFUA 3ABMH 5D8KB 4ON0A 1XPXA 2ACJA 1UHMA 3W2AA 4AIJA 2O0YA 2QQAA 2HYJA 3JRCA 3A2KA 1MGTA 2EFOA 3IKTA 1ZHFA 3DTKA 2KLOA 2K27A 2DTRA 5DCMA 2R7DA 2EV5A 1SD5A 3LA3A 4R8HA 2LSOA 5E1ZB 3QOEA 3CJNA 2XGDA 4M3EA 4UB8C 3L1PA 1O3SA 1MMSA 2LY1A 5TJJA 1S29A 1IW7F 3E97A 5HNFA 2DA7A 4B1RA 2DOAA 1ULYA 4M72A 1A35A 5EG0A 5IPAA 2KRCA 4CYCA 3QAHA 1Z9CA 2RAEA 3GXOA 5HDNA 3JRIA 1RIOH 4M3FA 2DT7B 3LL7A 4OWRB 2ETHA 1YOVB 4G8XA 2BBYA 2VXDA 4CICA 3HC7A 5GAGJ 4PDKA 3IAS2 3RQ4A 5FRNA 4HX7A 2P0WA 4KIFA 2EK5A 3RI4A 2P7CB 1S7OA 3EETA 2CO5A 5FKMA 3OYKA 4XRSA 1MKMA 4HF1A 5FLXK 2JT1A 4AIKA 3AAFA 1A31A 4XLHA 1HKSA 2NVTJ 1XX5A 3DF8A 3SZGA 4HNTA 3DQVC 1MJBA 3L09A 4IOAF 3LSRA 1BL0A 3S2HJ 2E1MB 2PBIA 4ENMA 1MJAA 3ZRGA 1DGWY 3QYFA 2ME0A 4D7NA 3T5XA 4CXFA 1AWCA 1YQAA 1PP8F 1ZGAA 1PUFA 3KLNA 3TGNA 1IV6A 2DN0A 3ASNH 3PFIA 2M4KA 3MEXA 4GYIA 1Y6IA 2FBIA 1TC3C 4KUMA 3ZXSA 3GTQJ 2ZSHB 4HNUA 3I59B 2Y75A 1KU9A 1MMNA 4U0WA 1B8IA 5IOYA 3CCYA 2A6EF 4CCJA 2KDOA 5AIPA 3HPGA 3K4KA 5HS8A 1JUMA 3F8CA 4U0YA 1WWXA 3M9AA 4IRGA 5J40A 2EZHA 2G9WA 3L2WA 2EINH 2F5DA 3A0BC 5EZGA 5D4SA 5K5OA 5FKKA 2C6YA 1KYWA 4PJLA 2WY8Q 3BY6A 3FM5A 1R22A 3FX3A 3OL3A 1RPWA 5E1XA 3ABKH 2MC4A 2LKXA 1U8RA 2ZXWH 1PUFB 2FBKA 3OIPA 3CCMI 3I58A 2XSDC 5A2QK 2A5WA 1R1VA 2CQ7A 3F72A 2XF7A 1LVKA 1LFPA 2LG4A 3I4PA 3QYBA 2MFZA 1FIAA 3KEQA 5E3MA 3OYGA 2EFNA 1KZHA 4FE7A 3DEUA 1JKQC 2A5YB 3E6CC 5DCFA 3W2VA 3ZMDA 4NUBA 4AD9A 2R92J 2VOOA 2A69F 3I4MJ 2MLGA 3FIWA 3PJRA 3AG2H 1O3TA 2VL8A 4QPOA 4A3EJ 4B8XA 4NDLA 1VQ4I 2HFHA 1W36C 4M73A 2RNJA 3BR3A 5HOOA 5D5WB 3F3XA 4HF0A 3TDUC 2HKXA 4D1QA 2XGEA 1KQ0A 3QODA 3QWLA 4LLGF 3DEWA 2ZXHA 1X1PA 3IV5A 2EIMH 3PNVA 2CUFA 4OAZA 1OQYA 2LREA 2VBYA 3EYIA 1T38A 1QA6A 3WTTC 1X1DA 3HYIA 4G94A 1YJWI 1MH4A 3ULQB 4BEHB 5JFRA 2VOPA 5E8IA 4HBLA 5IP6A 1ON1A 4G9YA 4I6ZA 3HHHA 1D5YA 4HX4A 5CVIA 1HW1A 5FO5A 5LRRA 4FHTA 2Z33A 3K1NA 1YE9A 2MD0A 1ETWA 3CUQA 3BDDA 4ZTFA 4HAMA 1J09A 4XKCA 4E7KA 2F5VA 1GUUA 1WJCA 1G3SA 2PJPA 2LKPA 2O61A 3S1MJ 1X19A 1FYKA 1FPQA 2MH2A 3BR0A 1X1CA 1O3RA 4EM2A 1IRFA 5M5YJ 3I4NJ 4JX4A 1IXRC 2OBPA 4BHBA 1USSA 5K7HA 4V2GA 5B5EC 4RB1A 3E6DA 3GEZA 2WWYA 5JR3A 4WXCA 2DI3A 4A3MJ 3HG9A 2BW3A 4ZDPA 3MFKA 1YIOA 4WXDA 3K4LA 3M7GA 4BQQA 3KP3A 4OOIA 3CLQA 1JUSA 2V9VA 4B48A 1ETXA 2FQ3A 2E1OA 2HKOA 2P5LC 4KITB 2HXOA 1HSJA 5GPCA 4RB0A 1G3YA 3CCJI 3JRAA 3IH2A 1JKRC 4BDZA 4MHGA 1W0TA 2HPIA 3WGGA 2Z3YA 3CJTB 2ID3A 2IXSA 4X0GA 4DZJA 2QWWA 4UUSB 3R61A 4OINF 4EJVA 5EEAA 4A3CJ 3FXUA 1ENHA 4C9YA 4XSXF 1J5YA 2JVGA 2RV8A 1DP7P 2STWA 1HXDA 3E5XA 3GLXA 1TWHJ 3KP6A 1U9NA 3L7WA 4RLQA 3BWGA 2EJRA 3R6SA 1Y0UA 3CTAA 1ON2A 3HIFA 2GM4A 5DTDA 3CO6C 1YW7A 4LG0A 3LQQA 4RDUA 3Q0VA 3W3CA 5JLXA 2JPBA 2N8GA 2O9LA 2PMUA 1XMXA 1G8XA 1PDNC 2VUMJ 3T8RA 4ENJA 2EILH 4AM3A 4C3HJ 1ZGJA 3QPHA 3JTHA 4ZJZA 2M7BA 2AS5F 2DYRH 4FTHA 3E6BA 4Y33A 5IT3A 4NC8A 4XORA 2CGPA 1T33A 5DS9A 2FOWA 4XLNF 1R00A 2LD5A 2BOLA 3RIRA 4Z6YA 2WB1N 3V7SA 3GTJJ 1J59A 1BI3A 1IJWC 3A02A 2VC0A 3HOYJ 2VQLA 1V5EA 1SEUA 5K1YA 2L7ZA 3BPVA 2HYFA 3BG6A 3WHCA 4DJAA 3CCLI 2IAIA 1JGSA 2HI3A 4IF4A 1IAWA 2NOJB 2FE3A 2K4JA 2QKMB 3Q9VA 1MSEC 3S1RJ 4AVZA 2VQCA 3EYYA 5DYMA 2IGNA 3JRGA 1B1BA 1QNTA 4BHCA 4XKVA 4HDUA 3V7CA 4Q5SF 3ECOA 5B3SH 4WX9A 1V54H 4HYEA
chains in the Genus database with same CATH topology
2HVQA 4E7IA 1FMWA 3DPLC 3FDYA 3CP2A 3PNYA 4JOMA 2WA0A 1QHHD 2LY2A 3BLYA 4AU7A 2ELJA 4B44A 3BCAA 3K4CA 4F91B 1K6YA 2HPMA 2CV0A 2VXZA 2VQGA 3L2UA 2W82A 4PFPA 3MKWB 4D9JA 2WADA 2VKHA 1D1BA 1PYVA 2R4GA 3K6GA 4DBRA 3CJRB 2CW7A 1BOBA 2KL4A 2WBMA 1WFXA 2IS6A 1FMVA 4JQFA 1BR2A 3A1YA 3CESA 4FASD 4YRVA 3H5NA 4BQOA 2L5QA 3DWLE 4CCLA 4IZZA 4RMNA 3RCOA 3FBNB 3UR3C 3TBIA 2O5RA 4N4OB 3OMYA 1Z7LA 4ZYAA 2XF6A 3E1SA 1G59A 4IKFA 2E5ZA 3IUOA 2F4IA 3BCBA 2HVSA 1D0ZA 1VZ0A 3H0DA 1N77A 5LD2C 2KPMA 2IGMA 4BUPA 3H9QA 4F3QA 1KONA 2IS4A 1D1AA 3OR2C 4NC7A 3K70C 3KEYA 2BVMA 2CV2A 2R7VA 4E7LA 3CMMA 2BVLA 3SEZA 4N4NB 3HXLA 1R6RA 1BR1A 3S3NA 4BACA 2WY7Q 2X6YA 2CMPA 2M3AA 1OR7C 3G2BA 4YELA 1Z3XA 2MYSA 4BJ6C 3K4NA 1V5FA 2LH9A 1SAUA 1MNEA 4BQNA 5JHFA 3AKZA 2JUGA 2E5NA 3QYEA 4U7BA 2WAQA 4P1WA 2VJ5A 3ONQA 4XKWA 3L2RA 3TMOA 2Q2EB 2VPLA 3MKZA 4XN3A 4XMYA 2XSJC 4XLAA 3FBIB 2PMZA 3K10A 4PFOA 3N05A 3J7AY 5HLTA 3OYHA 4XN0A 4BS9A 2R7QA 4PUSA 4Y4RA 3DPTA 2XC7A 2LRDA 4XLFA 5CQGA 2KZVA 3S93A 3OS0A 3DTIA 4BE0A 1QHGA 4LIVA 5TGTA 2VJJA 3LSIA 3E0JB 3RPUD 4E7HA 4XOPA 3OL4A 3HPHA 2UWMA 4II3A 4B3XA 5KCMA 3VSLA 3TL4X 1V5GA 4HG2A 4DBQA 3BG7A 4HPQA 3H9GA 4QPQA 4EATA 4RLFA 5LFAA 3M8JA 5KNLA 4R79A 3OYAA 3KX2A 2KP6A 4H4KC 4CZCA 2X51A 2V6EA 3MKYB 4IQ4A 2VJ4A 2E60A 2GOMA 2Y0SA 2ZSIB 2CH0A 2LOOA 1YX5A 3A4CA 4B43A 2CUJA 4BXFA 2IGKA 4E7ZA 3IP4B 3OYDA 3OOUA 4PSXA 4DIQA 3OYCA 1Y56A 3LFUA 3HOSA 1AA7A 3GBGA 3DPUA 4RM3A 1HA8A 2K9MA 2HDWA 2X85A 2Q1ZB 3ZR8X 4CCOA 3OY9A 3W2AA 1N78A 2V1NA 3A2KA 1N75A 3DTEA 2HNHA 3DTKA 2PJRB 2KLOA 2VIXA 4AYBA 1Z3YA 1S9HA 2VQHA 1D0YA 3OS2A 4U87A 2CS3A 2V7FA 5HVQC 1GLNA 3DKXA 3QOEA 3PL8A 2LY1A 2CUZA 3HUGB 2V26A 5HNFA 2RQQA 1DQUA 2DOAA 4ITVA 2K3PA 2OV7A 2KRCA 3RTRA 3OYEA 3AL0C 1D1CA 4PK4A 1P9QC 2DT7B 4ZDOA 3LL7A 4OWRB 4YEJA 2Z16A 4C30A 3OYBA 2VXDA 3VYSB 3HC7A 4F55A 4HSTA 1LDKB 3SDBA 2AQEA 1NG7A 4ANJA 3IAS2 3RQ4A 4DGWB 5FRNA 2P0WA 2R7WA 2LBFA 3FHNA 3BC8A 3DU5A 2XAUA 2Z2SB 2FUG2 2X1CA 2WB1A 3OYKA 3EUKL 3DLAA 1WJ5A 2HU9A 4XLHA 4BJ5C 4XLEA 4MLOA 3SZGA 4HNTA 1X1BA 3OYIA 3S8PA 3DQVC 4BL0B 4E7SA 1PJRA 3S32A 1WJBA 2E1MB 3M1CA 3VYUB 3DKYA 3ZRGA 1DGWY 3I3LA 2KHMA 1T0FC 3QYFA 1X1AA 4ZC3A 4FETA 4XNFA 3CP8A 2M4KA 4LIUA 1Y6IA 3ZXSA 2PJRA 2ZSHB 2R7XA 4HNUA 2BW3B 1MMNA 4CCJA 2CFOA 2KDOA 3HPGA 2R7UA 3K4KA 2XF5A 2DT6A 4E6KG 2LYCA 3AL0B 3L2WA 1WJEA 3FKJA 4BEHA 3ZGKA 4PJLA 2WY8Q 2CW8A 2JSPA 3OL3A 2X6XA 2IS1A 2R7TA 4BJTA 2MC4A 2L2OA 1W36D 3LSGA 4B47A 3AFHA 2VJIA 3OIPA 2E1MC 4F92B 4IX7A 3OWTA 4ZDLA 4LG3A 2JA2A 2A5WA 3KYLA 1T95A 2XF7A 1LVKA 1LFPA 3NWSA 2VASA 3K4MA 2LG4A 4CSWA 1ZELA 2DCEA 3QYBA 2MFZA 3OYGA 2VKDA 3CF2A 1OLTA 1MMDA 2X1DA 1TZLA 2A6TA 4E4HA 4ZTJA 1DP3A 3NWTA 1JI8A 3L2VA 1ERDA 3LMMA 3W2VA 4NUBA 3K70D 4PJJA 3ZCOA 2ZFUA 3PJRA 3SYTA 2W00A 2IGOA 2VL8A 4QPOA 2M0MA 4BE1A 1U0JA 3OYFA 3U21A 4CCMA 1W36C 3S3OA 4XONA 1BR4A 2ZXIA 5HOOA 2DJIA 4KISA 4D1QA 1UG0A 3QODA 4OAYA 2XDVA 3D5RC 2ZXHA 1DGRM 3C2HA 3S3MA 3PNVA 4OAZA 1UELB 3HOTA 2LREA 3PUBA 3RSNA 1WJDA 2GOXB 2I8DA 1X1DA 4XR6A 3VDXA 4BEHB 4XOTA 4IQJA 3H5AA 2OUMA 3H35A 4F93B 3EUAA 1NG6A 4CUGA 4BDYA 2R7SA 2CV1A 2DXIA 2Z1DA 1YE9A 2MD0A 1SFKA 4ZTFA 3SEQA 1J09A 4XKCA 2K9LA 4E7KA 2F5VA 1WJCA 3OR1C 4RM2A 5CKTA 3HKZA 3VWBA 3K4JA 3LSKA 1X19A 3OIQA 3VYTB 1X1CA 4P5OA 3D5SC 4Y3OA 3W2WA 2WAEA 2M7AA 1MW7A 2HQAA 2RNGA 1MMGA 1WJFA 2UUZA 1YX3A 4GRIA 4CCKA 4XQFA 4LITA 5HNHA 2L9SA 3OS1A 2KQRA 3HG9A 2BW3A 2W7NA 4ZDPA 2RREA 3K4LA 4BQQA 3OYLA 4J00A 4G6TB 3MMYB 2HZDA 4B48A 1E0EA 2VLAA 4KITB 2QKLB 2OC6A 2WAFA 5FROA 4II2A 4F52A 3DU6A 4PSWA 1X4OA 3ZQQA 4NQWB 4BDZA 3K4BA 2IS2A 2UV1A 2HPIA 3VSKA 4J01A 3IAM2 3PNTA 2IXSA 4X0GA 4BGDA 3OYMA 1MMAA 4KJZA 4C9YA 2JVGA 1IRXA 3PFYA 4NNJA 4CA0A 5KHDA 4BU2A 1MNDA 4RLQA 3PSFA 3PSIA 3CZ6A 4KT6A 4C2TA 1WJAA 3VYRB 2K5CA 3D5LA 3W3CA 4HRIA 1G8XA 3L2QA 3UNGC 3EPZA 3C2GA 1TT0A 2LBFB 5CPRB 3V42A 4ZJZA 2M7BA 4CH7A 5FRMA 2LC2A 4Y33A 4NC8A 2L9NA 4XORA 2JVHA 2X6WA 4PJMA 4HEA2 2W1OA 2F6CA 3HL2A 3DEEA 5CQEA 1UAAA 2BOLA 4XLCA 1X4PA 2AQFA 2HVRA 1QU3A 2V4JC 2VQLA 3H5RA 4CCNA 1V5EA 3OYNA 1EA3A 3BG6A 4DJAA 4C2UA 2MABA 3OYJA 4DOZA 3H9JA 2KRHA 2VB6A 2NOJB 1LKXA 2V9KA 1D0XA 1Z21A 4XL9A 2QKMB 2R7RA 2KMUA 2M4GA 4HSRA 4PJNA 4E7JA 2W4SA 3CJQB 4XM3A 4AVZA 3I9V2 2X1EA 4BE2A 3EUHC 3F9KA 2VQCA 2IGNA 3LSMA 2L7KA 4XKVA 4XKBA 3MD2A 3LSHA 2R7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W4S A;  2XC7 A; 
#chains in the Genus database with same CATH topology
 3O8H A;  3A03 A;  4I99 C;  2FA5 A;  5ERI A;  3I64 A;  2FML A;  4AYB N;  3GTO J;  1ORK A;  1XC5 A;  2ELH A;  2WA0 A;  1QHH D;  2H27 A;  1BC7 C;  1JKO C;  3PUF A;  3BCA A;  4B44 A;  3IKV A;  1HW5 A;  2CV0 A;  3H92 A;  4HDV A;  5GAH J;  2R5Z B;  4D0P A;  3VB2 A;  1I3A A;  4L9N A;  2HDD A;  3V8J A;  4BAY A;  4G12 A;  2MBF A;  2WAD A;  4JK1 X;  2DMT A;  4A2U A;  4Y13 A;  1RKT A;  4L0Z B;  2CW7 A;  1IN8 A;  2KL4 A;  2EWN A;  2WBM A;  1WFX A;  1O4X A;  1BA5 A;  1A6Q A;  1TL8 A;  1WQ2 A;  3KIO A;  4MNU A;  4C3J J;  4YRV A;  3SFI A;  4XRM A;  1B72 B;  1R71 A;  3JRD A;  3SFZ A;  2GZW A;  2AXL A;  3FBN B;  2DK5 A;  3IWF A;  1OCP A;  5LRS A;  3S2D J;  2OZU A;  2E19 A;  1SC7 A;  4V2F A;  4N4O B;  3TBI A;  4I98 B;  4ESF A;  4G6D A;  2K7L A;  3PM1 A;  2XF6 A;  3WTV C;  4FCY A;  1XMK A;  4IKF A;  3BG5 A;  3GWZ A;  3IUO A;  1D0Z A;  2LKS A;  2YSR A;  1F5T A;  2JA6 J;  3I55 I;  3H0D A;  5EG0 B;  4HOB A;  2E2I J;  1T08 B;  1QPM A;  1D1A A;  2NOG A;  3OR2 C;  4OIR F;  4P9U A;  5ED4 A;  2XRO A;  3K70 C;  1ZR2 A;  2BVM A;  5EGO B;  3J80 Z;  1EJ9 A;  1FSE A;  3S14 J;  5M5X J;  3FMR A;  3SEZ A;  4N4N B;  2LFB A;  3HXL A;  1NK2 P;  2ID6 A;  3S3N A;  4ASN A;  4BAC A;  1JJ8 C;  2WY7 Q;  3ZMS A;  4V19 K;  2L3D A;  2M3A A;  3CDL A;  4J19 A;  3ECH A;  2MYS A;  4UV9 A;  2NS7 A;  3K0L A;  2D45 A;  5E17 F;  2ISZ A;  1MNE A;  2KIS A;  2LDU A;  2Y9Y A;  1T0F A;  1FOK A;  4DYQ A;  3L2R A;  3TMO A;  2Q2E B;  3MKZ A;  3CUO A;  3GFM A;  4G7H F;  4LMY A;  1O7F A;  2DU9 A;  1BOA A;  2Y0S N;  4XMY A;  2XSJ C;  1SMT A;  1JHF A;  1BC8 C;  1LE8 A;  3DBL B;  2E35 A;  5HLH A;  3WTW C;  3J7A Y;  1YW9 A;  2KT0 A;  4XN0 A;  2M2E A;  2I10 A;  4BS9 A;  5K5R A;  2R7Q A;  3CDH A;  4PUS A;  4Y4R A;  3DPT A;  1H9T A;  2LRD A;  4XLF A;  2KZV A;  2P6S A;  3S93 A;  5FLV A;  5K7F A;  4LIV A;  4WWC A;  5TGT A;  3WG9 A;  3RZO J;  3E0J B;  2L4A A;  2NVY J;  4XOP A;  4JX6 A;  5IY5 H;  3CCU I;  3HPH A;  4II3 A;  3K2A A;  2XGC A;  4A6D A;  5KCM A;  4BBS J;  5ICG A;  1V5G A;  4HG2 A;  4DBQ A;  4HPQ A;  4KN7 X;  4EAT A;  4R79 A;  1OYW A;  1YJ9 I;  2L7F P;  1EH8 A;  3DKW A;  1ZQ3 P;  1K78 A;  2JRM A;  4LJZ F;  5F6F A;  1FNN A;  4H4K C;  1X2N A;  4S04 A;  4ETS A;  4IQ4 A;  1VQL I;  1WH5 A;  2E60 A;  2K9N A;  2OTJ I;  1IN6 A;  5IP9 J;  1SD7 A;  3TOA A;  2CSO A;  2YU3 A;  2FJ1 A;  5DDG A;  2ZSI B;  1XD7 A;  2CH0 A;  4Y17 A;  1YX5 A;  3A4C A;  1O7L A;  3DBH B;  5L3E A;  4BXF A;  5CVV A;  4A3I J;  4X1E A;  5DV5 A;  3OYD A;  2GXB A;  3KPH A;  3I0T A;  1J7K A;  1R4N B;  4YFX F;  2M8G X;  2V79 A;  1AA7 A;  3GBG A;  3DPU A;  2HOT A;  2XUB A;  4RM3 A;  6PAX A;  5HS9 A;  1HST A;  2HDW A;  2K9M A;  4GCV A;  2Q1Z B;  1FJL A;  2PQ8 A;  5E3N A;  2H94 A;  1LVA A;  4A5N A;  1S7A A;  5J1Y A;  1N75 A;  3J7Z I;  1Y8R B;  4B4C A;  3ZQH A;  2VIX A;  2PJR B;  2ZJP F;  3B73 A;  4LFU A;  2JN6 A;  1Z1D A;  2CS3 A;  4NB5 A;  3X2Q H;  5HVQ C;  1GLN A;  1Z05 A;  3DKX A;  4RGR A;  4LGW A;  4Q4Z F;  1S6L A;  2CUZ A;  3MVP A;  2YX7 A;  1DQU A;  3EQL F;  3JRE A;  2OV7 A;  4IHS A;  3CDI A;  3HRU A;  3RTR A;  2MSY A;  3N4M A;  3BQY A;  1WRJ A;  1X3W B;  2V9P A;  4PK4 A;  2LK2 A;  3TO6 A;  4LD5 A;  2K3F A;  2HWV A;  2CU7 A;  4ZDO A;  1VQ6 I;  4XID A;  3FHZ A;  3FF5 A;  3OYB A;  1VQ5 I;  3BQZ A;  1LDK B;  3FK6 A;  3CC7 I;  1XSX A;  4MTD A;  2PX9 A;  1A36 A;  2R7W A;  2LBF A;  5LHH A;  4OIQ F;  3FHN A;  5IT9 K;  3V4G A;  4A0X A;  2M9H A;  2Z2S B;  1F43 A;  1DU0 A;  3NEU A;  3HJE A;  3LA7 A;  3G1L A;  4AVP A;  3DLA A;  4XLE A;  2XAQ A;  1LE8 B;  1LB2 A;  5B1B H;  1EKE A;  3S8P A;  4BL0 B;  4E7S A;  2MW8 A;  3G3Z A;  4O5V A;  5IP7 J;  2HQN A;  3VYU B;  5AIQ A;  1HW2 A;  3I3L A;  4IHX A;  1T0F C;  3R60 A;  1X1A A;  3LST A;  2K40 A;  4ZC3 A;  3TOB A;  2O8X A;  4XBF A;  1RZ4 A;  1Z91 A;  4FET A;  5FB2 A;  2JZY A;  3PO3 J;  4LIU A;  2QEX I;  3WOD F;  1W7P B;  3JCU C;  1IDY A;  3HOW J;  2GIV A;  1QO0 D;  5CVR A;  3RKY A;  4NC6 A;  3HRT A;  5H20 A;  1ZLK A;  2CFO A;  3QPL A;  3F22 A;  3J7A O;  2R7U A;  2VKE A;  3WGH A;  1I1S A;  2DQR A;  3HBL A;  1FLI A;  3D1N I;  4BEH A;  1BBY A;  3ZGK A;  4QLC U;  2CW8 A;  3SQN A;  4ESB A;  4BJT A;  2R5Z A;  2L2O A;  2VJI A;  2E1M C;  1D8K A;  5GTH C;  4I01 A;  2XAH A;  5ICC A;  2HOS A;  3KYL A;  2YS9 A;  3REO A;  3S1Q J;  3V7R A;  3IH4 A;  1ZEL A;  4CSW A;  1ITY A;  2ZME C;  5L3D A;  1B9M A;  5K5Q A;  1U3E M;  2VKD A;  2YU9 J;  3CF2 A;  4BKX A;  3KFW X;  1OLT A;  1MMD A;  3BTL A;  1TZL A;  3NWT A;  3LAP A;  1JI8 A;  3ESW B;  1S5L C;  2BXZ A;  3K70 D;  3WTX C;  3ZCO A;  2ZFU A;  2KZG A;  3KLO A;  2DBB A;  4G7Z F;  3TED A;  4ABZ A;  1ETV A;  4GXO A;  3ABU A;  4CYD A;  4BE1 A;  3OYF A;  1S8N A;  2KIU A;  3KCC A;  1HF0 A;  2ZXI A;  4A0Y A;  1XS9 A;  2BHZ A;  4KIS A;  3NAR A;  2HGC A;  3D5R C;  1WZ2 A;  3RJP A;  1T8I A;  1KU3 A;  3BRO A;  2K02 A;  1WJD A;  2GOX B;  1BI1 A;  4XR6 A;  4LK0 F;  3E6M A;  3HRM A;  4XOT A;  2X0L A;  3H35 A;  1IN4 A;  2M1B A;  3EUA A;  5IYC J;  1NG6 A;  3KET A;  2CWE A;  2R7S A;  2CV1 A;  5IT9 Z;  3CLO A;  4GFB A;  1SFK A;  2F2E A;  4M6V A;  3S2W A;  3QP6 A;  2OPT A;  2K9L A;  4N9H A;  3T0Y A;  4A3G J;  3FKI J;  2EV0 A;  2JTV A;  3K4J A;  2O6G E;  1XTA A;  4QSH A;  1IRZ A;  2DFE A;  2JA7 J;  3F23 A;  4P5O A;  3GTM J;  1Z0X A;  2ZME B;  3C1D A;  2WAE A;  1Y8Q B;  2M7A A;  3WHB A;  3F8N A;  1YI2 I;  1IGN A;  2CW0 F;  1NK3 P;  1S7E A;  2IP2 A;  2RNG A;  3HTU A;  2HDC A;  1WJF A;  3T1B A;  1YX3 A;  5DM7 F;  4B3A A;  5KK1 A;  4CCK A;  5HNH A;  1O3Q A;  3LWF A;  4EJW A;  3V8K A;  2W7N A;  1VQ9 I;  3HHG A;  3KYD B;  4GYG A;  2KJC A;  5BQT A;  3G1M A;  2HZD A;  3W6K B;  1FYL A;  2IT0 A;  2BGC A;  2K85 A;  4HA8 A;  2VLA A;  3GTP J;  3B6A A;  1QZE A;  2QKL B;  1ZRD A;  2YPR A;  4UUS A;  3QPS A;  3TKY A;  4F52 A;  2Y2Z A;  3DU6 A;  4BH9 A;  1X4O A;  2M34 A;  2W57 A;  3MZ8 A;  1LFU P;  2K4B A;  3K4B A;  5JI6 A;  2OD5 A;  2BZT A;  1UFM A;  4A3B J;  5HOD A;  3QP5 A;  3VSK A;  3IAM 2;  2DA1 A;  2QM3 A;  4BGD A;  2XHK A;  1BIA A;  2FX0 A;  2L02 A;  4Z2Y A;  2LP0 A;  3OYM A;  3TP3 A;  1Z67 A;  1BJA A;  2JQ7 A;  4LG0 B;  3LQR A;  2DA3 A;  5HLI A;  2K86 A;  2CQK A;  2IA0 A;  4NNJ A;  5H2F C;  3RPU A;  1A6I A;  2P8T A;  4WXH A;  3CMY A;  3PSI A;  3CZ6 A;  4C2T A;  2W48 A;  3VYR B;  3PIP F;  5H6R A;  2R7F A;  2Y30 A;  3HZJ A;  1SFX A;  2A61 A;  3L2Q A;  1P4A A;  3EPZ A;  4P9F A;  1Y39 A;  1Q1H A;  3KP2 A;  4JBA A;  2RC4 A;  2GXA A;  3ZQL A;  2NS8 A;  1ZRC A;  1TWG J;  3I56 I;  4MQV A;  4N9I A;  5TIS C;  5JHU A;  2L9N A;  3ML6 A;  5CJ9 A;  2QUF A;  2JVH A;  2NVQ J;  2DW4 A;  2LMD A;  2X6W A;  2Y0M A;  2IJL A;  2LLK A;  1FBS A;  1GV2 A;  3P9I A;  4PJM A;  2ME6 A;  1VQN I;  4UB6 C;  3ZQ7 A;  1E3P A;  4NHJ A;  2DMQ A;  3FXQ A;  3HL2 A;  2EZL A;  3S17 J;  2LVS A;  1ZG3 A;  2P81 A;  3WTZ A;  1IV8 A;  4RA2 A;  2OF7 A;  3QU3 A;  1MH3 A;  5EJC A;  4BXU A;  4FE4 A;  3FXK A;  2V4J C;  3H5R A;  4CCN A;  3WE3 A;  3FXL A;  3OYN A;  3HOV J;  3H3Z A;  1CGP A;  1QQI A;  1GXP A;  2KRH A;  4MGR A;  2UZK A;  4DW6 A;  2FD5 A;  2V9K A;  3JTG A;  1D0X A;  4XL9 A;  5E3O A;  2VN2 A;  3WTY C;  2MLK A;  2KMU A;  2M4G A;  4HSR A;  4PJN A;  2E34 A;  5FFZ A;  4XM3 A;  1TW2 A;  2E71 A;  1FX7 A;  3I9V 2;  2JSC A;  2EH3 A;  2QCO A;  4AUX A;  3F6V A;  1POG A;  3VOD A;  2L7K A;  5FKO A;  3DLL F;  1WKM A;  4XK4 A;  2M45 A;  4XKB A;  3O2P E;  1SVO A;  3LSH A;  4MFD A;  1W7P D;  4RGS A;  2F5F A;  3HDD A;  1YIT I;  1I6H J;  3RQI A;  3ZPL A;  3F6O A;  4RS8 A;  1XGM A;  1PP7 U;  4HV5 A;  3J80 K;  3BLY A;  4AU7 A;  4M6X A;  2MGQ A;  4L9T A;  3FZV A;  1K6Y A;  4DYR A;  4XLP F;  4FIS A;  2KDZ A;  2HPM A;  3L2U A;  4YIR X;  1LEB A;  3GCM A;  1OJL A;  2A07 F;  4A5M A;  4M3B A;  5FD5 A;  2DYS H;  4M74 A;  2VKH A;  1D1B A;  3FXJ A;  3P9K A;  2MH9 A;  4PCQ A;  4YFN F;  1OCO H;  1TWF J;  2XB5 A;  2IS6 A;  1SVM A;  4XIC A;  5D4R A;  4KA4 A;  3NQO A;  3BPX A;  1FOX A;  4IO9 F;  1GXQ A;  2MG4 A;  2L5Q A;  3R4K A;  3WU2 C;  3K7A J;  2X6O A;  1BW6 A;  3MKL A;  4NQW A;  4XSZ F;  4QIW N;  1I50 J;  1AKH B;  1SD6 A;  2J5O A;  4A69 C;  3BR1 A;  3PQK A;  4P96 A;  2EBI A;  3TW7 A;  1R36 A;  3HM5 A;  3OMY A;  1AHD P;  4L18 B;  4ZYA A;  3E1S A;  2M8E A;  3M1E A;  1G59 A;  2DFF A;  1V55 H;  2LF8 A;  3S1N J;  4ENK A;  2G0E A;  1VZ0 A;  1N77 A;  3ROU A;  1K83 J;  2KPM A;  3HKZ N;  3A0H C;  4QWQ A;  1KON A;  2VON A;  1RET A;  2FU4 A;  2X48 A;  2XB0 X;  4IJA A;  5C44 J;  1G2H A;  1FY7 A;  1U5T C;  3HGY A;  1K4T A;  4KIB A;  1BR1 A;  3CQZ J;  4K2E A;  2RVC A;  2PFB A;  5F04 A;  2X6Y A;  4F7Z A;  1ONV A;  1OR7 C;  1VI0 A;  4RAY A;  2GLO A;  1QZZ A;  4Q47 A;  1V5F A;  2KIM A;  1G3T A;  2JUG A;  1HBX G;  2V6C A;  3N97 A;  1GT0 C;  2FBH A;  4P1W A;  1DPU A;  1ETO A;  1W1W E;  2L4M A;  2VOD A;  1I6X A;  4LLN A;  2PMH A;  4C3I J;  1VQO I;  3S16 J;  3KP5 A;  1Q1V A;  1LEA A;  5IOZ A;  3QOP A;  3MQ0 A;  4A0Z A;  4XLA A;  3AG1 H;  1XDU A;  3RKW A;  2DOE A;  2OZ6 A;  2FQ4 A;  3OOP A;  1H88 C;  3IL2 A;  2XC7 A;  4WK8 F;  1IUF A;  1YIJ I;  4BE0 A;  1YRN B;  1ETY A;  2VJJ A;  3LSI A;  2PG4 A;  3MCZ A;  1IG7 A;  1ETK A;  2COM A;  5EF6 A;  5FJ8 J;  1SAX A;  5IYD J;  2E1C A;  5HLG A;  1FTZ A;  2R0Q C;  1AU7 A;  5M3F J;  3RDI A;  5LFA A;  4RLF A;  1LFB A;  1P4X A;  3M8J A;  3RKX A;  3HOU J;  3GW2 A;  3OYA A;  5LEK A;  1IC8 A;  2B0L A;  9ANT A;  1KYZ A;  1WH7 A;  2HQ5 A;  2KIF A;  5D8L B;  4CZC A;  1B8I B;  2ZME A;  2HTS A;  5LGN A;  1JXS A;  3MKY B;  4RB2 C;  1FP2 A;  3U1D A;  1RC9 A;  2NNN A;  2QLZ A;  4FX4 A;  2LOO A;  3BZ6 A;  3HSR A;  4M3D A;  2D2W A;  5DCM B;  4YIF A;  2ZCW A;  1OCZ H;  2X9D A;  3Q0W A;  4PSX A;  5J8C A;  5DUK A;  2XPU A;  3HOS A;  1OIS A;  1OR7 A;  1T2K A;  4ZYE A;  5E1W A;  3ZR8 X;  1N78 A;  1WPK A;  1RNL A;  3WG7 H;  2GA1 A;  3GYH X;  2E2H J;  1MBF A;  3DTE A;  1JTX A;  4KIC A;  1S9H A;  2VQH A;  1D0Y A;  2ZFW A;  2E1N A;  3OS2 A;  4U87 A;  2DT5 A;  4RGX A;  3JSO A;  2V7F A;  3LOC A;  3U2R A;  1WI3 A;  5HS7 A;  5LBQ A;  3WU1 B;  3FIS A;  3IRQ A;  2ECC A;  2RN7 A;  5GTI C;  3PL8 A;  1J9I A;  2DOD A;  1HQC A;  2ZB9 A;  3CME I;  1UG2 A;  2XV4 S;  4ITV A;  5C3E J;  2K3P A;  3K69 A;  4RGU A;  3BTJ A;  2QQB A;  1D1C A;  2DO7 A;  1P9Q C;  3GFL A;  5BS6 A;  4NBQ A;  2FOK A;  1X3U A;  1XB4 A;  2OCE A;  4YEJ A;  1YFH A;  4HQE A;  2IA1 A;  1K78 B;  3VYS B;  1Y1V J;  5DEQ A;  2EA2 A;  4KMU X;  4HST A;  3LSJ A;  1NG7 A;  4ANJ A;  2BY0 A;  4DGW B;  1R1U A;  2BXY A;  1GHC A;  1I5Z A;  1LDD A;  2QVO A;  1SMY F;  1MSF C;  3DU5 A;  1FSH A;  3TP0 A;  1NTC A;  1R58 A;  2WB1 A;  2R5Y A;  2JMW A;  2W24 A;  1FC3 A;  3ZQI A;  3EUK L;  5F0H A;  4EMS A;  1WJ5 A;  1Y1W J;  2HU9 A;  2ZJR F;  4BJ5 C;  1FBU A;  4MLO A;  5EGO A;  1ZR4 A;  3GFI A;  1X1B A;  3OYI A;  4ZZL A;  3GME A;  5FD6 A;  1PJR A;  4W1U A;  2NRA C;  1WJB A;  3H3V K;  3M1C A;  4JP0 A;  3DKY A;  3DV8 A;  2KHM A;  3C7J A;  1QRY A;  3MZY A;  3W6J B;  3GTG J;  1F1Z A;  3I71 A;  4IVN A;  2IPQ X;  1U2W A;  2DPU A;  1W5C C;  3CP8 A;  4U7D A;  4MO7 A;  2HZT A;  1XCB A;  4YG2 F;  2A6H F;  3ELK A;  4I09 A;  3ERE D;  2WC2 A;  2PJR A;  3SDG A;  3KEO A;  4Y52 J;  2R7X A;  2EPF A;  2BW3 B;  2OA4 A;  4D5C A;  4M9Z A;  3Q3S A;  4PJ0 C;  3K9T A;  3OSG A;  2XF5 A;  5DM6 F;  2VPR A;  1UB9 A;  2LYC A;  1Z77 A;  4UHT A;  3AL0 B;  2TRT A;  1TW3 A;  1K7A A;  1JHH A;  3SJM A;  1S72 I;  2X6X A;  2IS1 A;  1YS6 A;  3FXO A;  3BJA A;  1VF9 A;  4B47 A;  3AFH A;  4IX7 A;  4F92 B;  3WTU C;  4I76 A;  2HEO A;  4ZH4 F;  1ZN2 A;  5A2Q Z;  4ZDL A;  1BM9 A;  4LG3 A;  2JA2 A;  1ZRE A;  1T95 A;  4KNY A;  2VAS A;  3K4M A;  3COA C;  1VQM I;  3P7N A;  1ZLJ A;  1PVE A;  1FZP B;  5JVT A;  5IYB J;  5K7Z A;  4E4H A;  2ZBK A;  2A6T A;  1DP3 A;  3Q0U A;  3Q5F A;  4EGZ A;  2H09 A;  4U0V A;  2QSG X;  3L2V A;  1ERD A;  3OV8 A;  1AKH A;  1HKQ A;  3SYT A;  2W00 A;  2KIQ A;  1MBK A;  1R9T J;  5FKN A;  3U21 A;  3DCF A;  1KQ8 A;  1WVR A;  1F36 A;  1YLF A;  3LA2 A;  3S3O A;  1BR4 A;  4IRH A;  3IWZ A;  2FEZ A;  2DJI A;  5FLM J;  3G73 A;  5J4V A;  4OAY A;  1HDP A;  2XDV A;  1IZ1 A;  2XRN A;  3C2H A;  3S3M A;  2E7X A;  1UEL B;  3CO7 C;  3PUB A;  1U78 A;  3RSN A;  3BG9 A;  3HOX J;  1D5V A;  3VDX A;  2BE5 F;  1T6S A;  1VQ8 I;  2JA5 J;  3BG3 A;  4EM1 A;  5FLX Z;  5CLS A;  1YS7 A;  2V1U A;  5F0C A;  3HGG A;  1QVT A;  1QVU A;  4EQQ A;  1TNS A;  3E7L A;  4LB6 B;  1TP4 A;  1B72 A;  4YII A;  4KT5 C;  4DYC A;  1R5G A;  1CF7 A;  3VWB A;  3OR1 C;  5CKT A;  4RM2 A;  2FNA A;  2AO9 A;  5EYR A;  5ILU A;  2BYV E;  3LSK A;  4BY1 J;  2FRH A;  5JVG F;  2DOF A;  1SAN A;  4L5I A;  1HOM A;  1K6O A;  3D5S C;  4Y3O A;  4I02 A;  4EV0 A;  1ZK8 A;  3BJ6 A;  3TW6 A;  3ABL H;  4RAZ A;  1MW7 A;  4RBO A;  2HQA A;  1OPC A;  1GVJ A;  5C4J J;  5GP9 A;  2UUZ A;  1JKP C;  4GRI A;  2QQ8 A;  5CYV A;  3K1M A;  2IBD A;  3F8B A;  2RRE A;  5KVR A;  4KDP A;  4D7M A;  2Z9O A;  3IC7 A;  1XCV A;  3SXY A;  3OYL A;  3QU6 A;  4J00 A;  4G6T B;  4U88 A;  1H0M A;  1E0E A;  3GZ5 A;  3RPQ A;  3KZY A;  3SZP A;  1A04 A;  1U8B A;  4CGZ A;  4I7H A;  2O3F A;  2OC6 A;  5ICE A;  4I2O A;  3QRF F;  3BOQ A;  4II2 A;  1FOY A;  3GUD A;  3GTK J;  4IXA A;  4Y15 A;  4NQW B;  2EZI A;  4LLL A;  5J1R A;  1B59 A;  2IS2 A;  1BI2 A;  5TRD A;  2UV1 A;  4OMZ A;  1AOY A;  4J01 A;  3WTS C;  3PNT A;  1TT5 B;  2TCT A;  3FK7 A;  2OTL I;  3QQA A;  4FT8 A;  1XSV A;  4Q48 A;  5E3L A;  3HEF A;  3FXR A;  1OYY A;  2HYG D;  1MMA A;  2YUS A;  1UHW A;  2JUC A;  2DFI A;  2Y31 A;  3ZQG A;  2DLL A;  3Q9S A;  4M9X A;  2NS0 A;  3R0J A;  5KHD A;  3J81 Z;  2IW5 A;  1UST A;  4BU2 A;  1FP1 D;  1MND A;  2XAF A;  1XN7 A;  1RR7 A;  4S05 A;  2K5C A;  3H1C A;  1REP C;  1BJZ A;  4HW0 A;  3UNG C;  3C2G A;  2GWR A;  2OCC H;  1H9G A;  2LBF B;  2QBY B;  2UXN A;  2M0C A;  1DDN A;  3CUQ C;  4CH7 A;  2LC2 A;  3OSF A;  3BP8 A;  4WCG A;  1UJ8 A;  1IRG A;  3IHU A;  3RYR A;  3GO5 A;  4HEA 2;  5J6X A;  2DTZ A;  2XAS A;  1R23 A;  2F6C A;  5CQE A;  1UAA A;  1PUE E;  3M8E A;  2L54 A;  2AQF A;  4RB3 C;  2X4H A;  1MDM B;  2HVR A;  1X3Z B;  2QA4 I;  3FMQ A;  3FWE A;  1GV5 A;  2EQR A;  5FGM A;  3OYJ A;  2XKP A;  4DOZ A;  5LHI A;  1GDT A;  5GPA A;  1LKX A;  1Z21 A;  5EDN A;  3CJQ B;  4BE2 A;  2VI6 A;  3S15 J;  3F21 A;  1E17 A;  3F9K A;  5DD4 A;  2RDP A;  3LSM A;  1FBQ A;  4CDG A;  1G6N A;  4OIP F;  3HSE A;  2GXG A;  1RR8 C;  2R5Y B;  1D3Y A;  2R7O A;  4L5E A;  1TWC J;  2ELK A;  1RES A;  2F48 A;  4E7I A;  4G6Q A;  1FMW A;  3DPL C;  2GAU A;  3FDY A;  5F0F A;  4JOM A;  3GTL J;  3P5J A;  5F1J A;  2LY2 A;  2CYY A;  2ELJ A;  1OCC H;  3FMS A;  4F91 B;  2DK8 A;  4KYW A;  4ENN A;  2M87 A;  3E5Q A;  2KJB A;  2VXZ A;  1VTN C;  1W5S A;  2VQG A;  2DA5 A;  4PFP A;  3BTC A;  4IL6 C;  1JUP A;  1IF1 A;  1PYV A;  2F4M B;  4DBR A;  1TBX A;  4HQM A;  3CJR B;  4UVA A;  2G7U A;  1BOB A;  2MC3 A;  1X2M A;  2XRL A;  4JQF A;  3A1Y A;  5AON A;  2L0K A;  3A01 A;  4B09 A;  2XVC A;  1Z6T A;  3DWL E;  4BQO A;  2RQP A;  4ZYH A;  4CCL A;  4IZZ A;  3RCO A;  1WSU A;  2ZO4 A;  2O03 A;  1ZKG A;  3ZQF A;  3BR2 A;  4X6A J;  3M3Y J;  3OIO A;  3BZK A;  3L00 A;  5J47 A;  2JA8 J;  4IRI A;  2OQG A;  1MBE A;  3V8L A;  1CQT A;  3JRB A;  5J1U A;  1WI9 A;  2E5Z A;  5F27 A;  5E18 F;  3BCB A;  2HVS A;  3GZ6 A;  3H36 A;  2EIJ H;  2IGM A;  4BUP A;  3H9Q A;  2DPD A;  2OU2 A;  2IS4 A;  3HUG A;  3WE2 A;  3KEY A;  5LGT A;  2R7V A;  2LY9 A;  3CMM A;  2H8W A;  2QYO A;  4KN4 X;  2BVL A;  4A3F J;  1TLH B;  1ZG5 A;  1XMA A;  1YO5 C;  1EV7 A;  2E2J J;  4I0A A;  2R7Z J;  1JJ6 C;  3C3W A;  4BJ6 C;  4RAF A;  1B6A A;  2V1X A;  4EM0 B;  4A3K J;  5L3C A;  2LH9 A;  4IPA A;  1SAU A;  4BQN A;  1XGS A;  3AKZ A;  1LJ9 A;  4LK1 F;  2BEO A;  1NHA A;  2F5E A;  3O8G A;  1HCR A;  4U7B A;  4HLY A;  2GA2 A;  1MNM C;  1XGN A;  4XRS G;  4XKW A;  4C2M J;  1TNT A;  2VPL A;  4XN3 A;  1D8J A;  4MIM A;  3F8M A;  2E7W A;  4UXN A;  2K9S A;  1ZRF A;  1SVL A;  2PMZ A;  3K10 A;  4PFO A;  1MZB A;  2VBZ A;  3N05 A;  4DZP A;  1UHS A;  2DJN A;  5HLT A;  4IEJ A;  3JR9 A;  3G4S I;  4GDF A;  3H0G J;  4XRF A;  2B63 J;  3BTI A;  3RKQ A;  4AC0 A;  4BNC A;  5CQG A;  4S0H B;  3DTI A;  2ECB A;  4UVC A;  3RPU D;  4PZJ A;  4E7H A;  1YTY A;  3ERM A;  5F64 A;  3OL4 A;  3I53 A;  4JX5 A;  3CF5 F;  1YHQ I;  2DMU A;  2B7E A;  3VSL A;  3TL4 X;  3GVA A;  4BY7 J;  1A5J A;  3AG3 H;  3BG7 A;  3H9G A;  2M5W A;  4UUT A;  1DUX C;  2ISY A;  5J8F A;  5KNL A;  2JRT A;  2BHY A;  1EH6 A;  2KFD A;  3DP7 A;  2BY1 A;  1MDM A;  2X51 A;  1VFC A;  4IHV A;  1STZ A;  2XKO A;  2VJ4 A;  2ZJ2 A;  2BV6 A;  2EFW A;  2A3S A;  2STT A;  3CC4 I;  2GOM A;  2H1K A;  2Y0S A;  4A6E A;  3NAU A;  2CUJ A;  4L0Y B;  4E7Z A;  3IP4 B;  3P9C A;  3SHF A;  3OOU A;  1WHU A;  3LNQ A;  1HA8 A;  2X85 A;  3KP4 A;  2FF4 A;  1U6G A;  4HZF A;  4CCO A;  3OY9 A;  1VQK I;  2V1N A;  1FTT A;  1Y0N A;  3ZOB A;  2MD5 A;  1FYM A;  2HNH A;  3I54 A;  4AYB A;  1Z3Y A;  1G3W A;  2XAG A;  3VEP A;  5LLQ A;  1V3F A;  1U9O A;  2NAZ A;  4EEF G;  3VOE A;  1FT9 A;  3W6V A;  3TDZ C;  5M5W J;  2JWT A;  5BPD A;  3IH3 A;  1YRN A;  4H0E A;  3HUG B;  1L0O C;  2Y48 A;  2V26 A;  4L5J A;  1SFU A;  2LNB A;  2RQQ A;  2O8K A;  5D5U B;  1J2X A;  2JJ7 A;  3OYE A;  3AL0 C;  2EFP A;  1JTY A;  1S3J A;  4G7O F;  1TQM A;  1YYV A;  1W0U A;  1HKT A;  4AWX B;  2QBY A;  5KAI C;  2QF7 A;  1BW5 A;  1OFC X;  2W84 A;  5L3B A;  1UZC A;  2Z16 A;  4C30 A;  3MAJ A;  2CQQ A;  2EB7 A;  4F55 A;  1H89 C;  2WV0 A;  1X58 A;  3SDB A;  1R5H A;  4EJT A;  2AQE A;  2CFX A;  2H1L A;  3AG4 H;  2QSF X;  3H3U A;  2H6C A;  3BC8 A;  2XAU A;  4MFE A;  2FUG 2;  2X1C A;  4JYK A;  2KRF A;  3JRH A;  3TO7 A;  1R49 A;  1JGG A;  4O3M A;  1ZGW A;  2HQR A;  2G7H A;  1DU6 A;  2QQ9 A;  5E8G A;  3MWM A;  1RUN A;  4CHU A;  1J0R A;  4KFC A;  1TQI A;  2YX4 A;  2NNY A;  2FSW A;  4UVB A;  3S32 A;  3RZD J;  4MQ9 F;  3ZMT A;  2GQQ A;  3CCS I;  3GFJ A;  2GIZ A;  2RGV A;  3ZP5 A;  1XGO A;  4XNF A;  2OAZ A;  3C2B A;  1LNW A;  1OYI A;  1P7I A;  3MN2 A;  4HLX A;  3JAM K;  4QTR A;  4L9J A;  4P55 A;  4OMY A;  3L2C A;  1ZAR A;  5JLW A;  2FMY A;  4TV7 A;  2Y9Z A;  4CO8 A;  3UKG A;  3C18 A;  1E3O C;  2UXX A;  4O6J A;  5F08 A;  5B1A H;  2L9V A;  1IUY A;  3KYC B;  2H8R A;  2DT6 A;  4E6K G;  4ESJ A;  5EEH A;  2XGX A;  1WJE A;  3FKJ A;  2WTE A;  2XPW A;  1B9N A;  1I3Q J;  1P6R A;  4ZYG A;  4W97 A;  2JSP A;  1Z7U A;  4OIO F;  2R7T A;  5D5X B;  1W36 D;  3LSG A;  1BN5 A;  5GAD J;  3OWT A;  4YFK F;  2J5P A;  2I5U A;  5CVJ A;  3ISP A;  1I27 A;  1CF7 B;  2W85 A;  3NWS A;  1O57 A;  3BR5 A;  2DCE A;  3KP7 A;  1U5T A;  3VPR A;  2KKO A;  4L9V A;  2AHQ A;  3E3V A;  2HS5 A;  2X1D A;  4ZTJ A;  4A3D J;  3HSF A;  2DDA A;  1OCT C;  1RRJ A;  3B6C A;  3LMM A;  4AID A;  3EDP A;  4HNV A;  3GX4 X;  4PJJ A;  1QPI A;  3HTS B;  2OJE D;  1R7J A;  3ASO H;  4WF2 A;  2IGO A;  2L01 A;  4BBR J;  3TQN A;  2A05 A;  1P7J A;  2FNP A;  2W25 A;  4EVI A;  2M0M A;  3JAM Z;  1U0J A;  3DFG A;  4CCM A;  1MJ9 A;  1HDD C;  3ZMV A;  4XON A;  2M30 A;  1ZH5 A;  3BJO A;  1SFO J;  3ZN1 A;  1WGX A;  1K79 A;  2FXA A;  4MEY F;  1UG0 A;  4PGH A;  2EFQ A;  1I1G A;  4BHP A;  4KIG A;  1DGR M;  1KU7 A;  1P2F A;  2DA4 A;  3CCE I;  3HOT A;  2P5K A;  1EH7 A;  3JSP A;  1KA8 A;  1GVD A;  2I8D A;  4Y7N J;  4IQJ A;  5LEJ A;  3H5A A;  1FWZ A;  2OUM A;  1OMI A;  4F93 B;  2ZJQ F;  1LQ1 A;  2HR3 A;  3ZMU A;  3QPT A;  4CUG A;  4BDY A;  2PLY A;  2PMZ N;  1E2X A;  1XG1 A;  2GBY A;  2DXI A;  2Z1D A;  1VQ7 I;  3CD6 I;  5L3F A;  1E3H A;  5D5V B;  3SEQ A;  1W4M A;  4FX0 A;  3HRS A;  1YJN I;  4EJO A;  1VND A;  3GLL A;  3HKZ A;  1EF4 A;  2VBX A;  4BXX J;  5D6F A;  3OIQ A;  4M9S A;  1UMQ A;  3VYT B;  4DNC A;  3J7Y J;  2VBW A;  2HOA A;  2LF7 A;  1MD0 A;  3W2W A;  3CUQ B;  1R4M B;  3CCV I;  5L3G A;  1QZY A;  2L9R A;  4PGG A;  2NVX J;  1MMG A;  1B4A A;  4KMF A;  3M4O J;  2BY2 A;  3LAJ A;  2P7V B;  2IA2 A;  4M3G A;  1LPQ A;  1IN7 A;  2DA6 A;  3HB9 A;  2HXI A;  4XQF A;  1J75 A;  1OCR H;  4LIT A;  2L9S A;  3OS1 A;  4UY8 I;  2KQR A;  3BT9 A;  1QGP A;  4BYY A;  1T98 A;  3DXJ F;  2HOE A;  3MMY B;  2WAQ N;  1JT0 A;  3JRF A;  2TDX A;  3A01 B;  5KAF C;  2WAF A;  3K1P A;  5FRO A;  3EUH A;  4PSW A;  1YW8 A;  3ZQQ A;  4BQA A;  3ZN0 A;  2VE8 A;  4FQG A;  3GF2 A;  1IXC A;  1JT6 A;  4RAG A;  3GZN B;  1T56 A;  1SFE A;  4KJZ A;  3HOZ J;  1C0W A;  2HTJ A;  2IRF G;  5J3L A;  1IRX A;  3PFY A;  2CUE A;  4CA0 A;  1U5T B;  1ACI A;  3E5U A;  5EEG A;  1TTY A;  1M1E B;  2EV6 A;  3PSF A;  3U9G A;  4KT6 A;  5J4Y A;  2LR8 A;  1WJA A;  4CYC B;  3D5L A;  2JPC A;  3FM3 A;  5FFX A;  4HRI A;  4N0B A;  4ZZD A;  1TT0 A;  5CPR B;  3V42 A;  1W7P A;  5E20 A;  3FXM A;  5FRM A;  3SZT A;  5BOX A;  4IHW A;  2D5V A;  2DMN A;  2ESH A;  2PN6 A;  4LOC A;  1XSD A;  1N25 A;  4E70 A;  2XAJ A;  2W1O A;  3VFZ A;  2VT2 A;  1W5T A;  5DD8 A;  1ZG1 A;  1R1T A;  4IHY A;  3DEE A;  3F0C A;  2F5C A;  1APL C;  2CQX A;  4XLC A;  1X4P A;  1ETQ A;  3G1O A;  3IRR A;  3CCR I;  5H6Q A;  3WU0 A;  1QU3 A;  4AIH A;  1I39 A;  5B66 C;  3F8F A;  1UCR A;  4R1H A;  1EA3 A;  4MTE A;  4C2U A;  2MAB A;  2EA4 A;  4GO1 A;  3H9J A;  3T8T A;  2VB6 A;  3DBR B;  5ICF A;  2R7R A;  1NH3 A;  4HX8 A;  1L3L A;  2A68 F;  4EJU A;  4E7J A;  2W4S A;  2X1E A;  2IEK A;  3EUH C;  5BMZ A;  1KU2 A;  2NXN B;  3LSP A;  4MEX F;  2CQN A;  3MD2 A;  2VT3 A;  1MBJ A;  1FEX A;  2VKV A;  1LUJ B;  2ADU A;  3I59 A;  1ZTR A;  2HVQ A;  3NRV A;  2VC1 A;  2IVM A;  3TO9 A;  4EGY A;  2Y69 H;  1YG2 A;  3CP2 A;  3PNY A;  2LTP A;  2K9Q A;  1ZAO A;  2CJJ A;  3K4C A;  4ZYD A;  5F1R A;  1FOW A;  1F4K A;  2JK3 A;  3M8F A;  2WV1 A;  2DA2 A;  3CMA I;  2W82 A;  2EIK H;  2P5V A;  3PO2 J;  2EZK A;  2Q2E A;  4D9J A;  3MKW B;  1BI0 A;  2Q0O A;  3I5U A;  3K6G A;  2R4G A;  2O7O A;  2D1V A;  4HV6 A;  3RYP A;  2DDB A;  4HF2 A;  2DAO A;  2ZC2 A;  3PIO F;  3JW4 A;  5GAE J;  1FMV A;  3PQJ A;  3G71 I;  4FAS D;  1BR2 A;  3CES A;  5DUI A;  3H5N A;  1V4R A;  5C4X J;  2CRG A;  1IN5 A;  1MBH A;  4RMN A;  2QZ8 A;  2ZKZ A;  1T39 A;  2ESN A;  4A3J J;  4A3L J;  2XPV A;  1QBJ A;  2QGU A;  3L9F A;  5ILV A;  1G4D A;  4OU0 A;  3UR3 C;  2DMP A;  4A93 J;  2O5R A;  1Z7L A;  1IO2 A;  1XDS A;  2D1H A;  1TQP A;  1TWA J;  2QEN A;  2F4I A;  2H6B A;  4GGG A;  5LD2 C;  2CG4 A;  2ZNY A;  3R0A A;  4F3Q A;  1P92 A;  2P6T A;  4NC7 A;  3D0S A;  3K2Z A;  2RKH A;  3KE2 A;  2CV2 A;  1FIP A;  4E7L A;  1RKW A;  4D5F A;  1RI7 A;  1SD4 A;  2B9S A;  1RUO A;  2AXT C;  1R6R A;  2F4O B;  4DQ2 A;  4M6Y A;  5LHG A;  2CMP A;  5ILS A;  1HC8 A;  4UUV A;  4A12 A;  2QSH X;  3G2B A;  4YEL A;  1Z3X A;  1IXS B;  3ABT A;  1F9N A;  3K4N A;  1IDZ A;  3CCQ I;  5JHF A;  5EZH A;  2E5N A;  2YR2 A;  2XIG A;  2V1D A;  3QYE A;  3WGI A;  1K61 A;  2WAQ A;  2VJ5 A;  3ONQ A;  1H8A C;  1BIB A;  2ZXJ A;  1K4S A;  3B02 A;  5D6E A;  1WCM J;  2R93 J;  1MIJ A;  5E79 C;  5M3M J;  5BNG A;  2PEX A;  2L7M P;  2NVU B;  3FBI B;  3ZMZ A;  2Q8K A;  3O3K A;  2COB A;  2ICW G;  3OYH A;  2NYX A;  2DQL A;  5FKL A;  1HLV A;  1OKR A;  1P4W A;  3BR6 A;  3OS0 A;  1QHG A;  2P4W A;  2R3S A;  4UNO A;  1Z6R A;  2BY3 A;  3U1K A;  4CZZ A;  2OQR A;  2UWM A;  3G6E I;  4B3X A;  1ZYR F;  4M71 A;  3KZZ A;  1MBG A;  3BZC A;  4QPQ A;  3LFK A;  2Z5U A;  3ZQC A;  4I0B A;  2E36 A;  2ZNZ A;  3KX2 A;  2KP6 A;  3CC2 I;  2Z99 A;  2MA3 A;  2V6E A;  1KQ9 A;  1R5I D;  4LB5 A;  3KZI C;  1ODD A;  5HDK A;  5LGU A;  3J81 K;  5CVU A;  2VE9 A;  1JE8 A;  1KGS A;  1LDJ A;  2DFH A;  1DPR A;  4B43 A;  4UV8 A;  4IOC F;  2IGK A;  3O6B B;  3MZH A;  1VQP I;  5BPI A;  4DIQ A;  3OYC A;  2PI0 A;  3M07 A;  5HDG A;  4IHT A;  1Y56 A;  3LFU A;  3ABM H;  5D8K B;  4ON0 A;  1XPX A;  2ACJ A;  1UHM A;  3W2A A;  4AIJ A;  2O0Y A;  2QQA A;  2HYJ A;  3JRC A;  3A2K A;  1MGT A;  2EFO A;  3IKT A;  1ZHF A;  3DTK A;  2KLO A;  2K27 A;  2DTR A;  5DCM A;  2R7D A;  2EV5 A;  1SD5 A;  3LA3 A;  4R8H A;  2LSO A;  5E1Z B;  3QOE A;  3CJN A;  2XGD A;  4M3E A;  4UB8 C;  3L1P A;  1O3S A;  1MMS A;  2LY1 A;  5TJJ A;  1S29 A;  1IW7 F;  3E97 A;  5HNF A;  2DA7 A;  4B1R A;  2DOA A;  1ULY A;  4M72 A;  1A35 A;  5EG0 A;  5IPA A;  2KRC A;  4CYC A;  3QAH A;  1Z9C A;  2RAE A;  3GXO A;  5HDN A;  3JRI A;  1RIO H;  4M3F A;  2DT7 B;  3LL7 A;  4OWR B;  2ETH A;  1YOV B;  4G8X A;  2BBY A;  2VXD A;  4CIC A;  3HC7 A;  5GAG J;  4PDK A;  3IAS 2;  3RQ4 A;  5FRN A;  4HX7 A;  2P0W A;  4KIF A;  2EK5 A;  3RI4 A;  2P7C B;  1S7O A;  3EET A;  2CO5 A;  5FKM A;  3OYK A;  4XRS A;  1MKM A;  4HF1 A;  5FLX K;  2JT1 A;  4AIK A;  3AAF A;  1A31 A;  4XLH A;  1HKS A;  2NVT J;  1XX5 A;  3DF8 A;  3SZG A;  4HNT A;  3DQV C;  1MJB A;  3L09 A;  4IOA F;  3LSR A;  1BL0 A;  3S2H J;  2E1M B;  2PBI A;  4ENM A;  1MJA A;  3ZRG A;  1DGW Y;  3QYF A;  2ME0 A;  4D7N A;  3T5X A;  4CXF A;  1AWC A;  1YQA A;  1PP8 F;  1ZGA A;  1PUF A;  3KLN A;  3TGN A;  1IV6 A;  2DN0 A;  3ASN H;  3PFI A;  2M4K A;  3MEX A;  4GYI A;  1Y6I A;  2FBI A;  1TC3 C;  4KUM A;  3ZXS A;  3GTQ J;  2ZSH B;  4HNU A;  3I59 B;  2Y75 A;  1KU9 A;  1MMN A;  4U0W A;  1B8I A;  5IOY A;  3CCY A;  2A6E F;  4CCJ A;  2KDO A;  5AIP A;  3HPG A;  3K4K A;  5HS8 A;  1JUM A;  3F8C A;  4U0Y A;  1WWX A;  3M9A A;  4IRG A;  5J40 A;  2EZH A;  2G9W A;  3L2W A;  2EIN H;  2F5D A;  3A0B C;  5EZG A;  5D4S A;  5K5O A;  5FKK A;  2C6Y A;  1KYW A;  4PJL A;  2WY8 Q;  3BY6 A;  3FM5 A;  1R22 A;  3FX3 A;  3OL3 A;  1RPW A;  5E1X A;  3ABK H;  2MC4 A;  2LKX A;  1U8R A;  2ZXW H;  1PUF B;  2FBK A;  3OIP A;  3CCM I;  3I58 A;  2XSD C;  5A2Q K;  2A5W A;  1R1V A;  2CQ7 A;  3F72 A;  2XF7 A;  1LVK A;  1LFP A;  2LG4 A;  3I4P A;  3QYB A;  2MFZ A;  1FIA A;  3KEQ A;  5E3M A;  3OYG A;  2EFN A;  1KZH A;  4FE7 A;  3DEU A;  1JKQ C;  2A5Y B;  3E6C C;  5DCF A;  3W2V A;  3ZMD A;  4NUB A;  4AD9 A;  2R92 J;  2VOO A;  2A69 F;  3I4M J;  2MLG A;  3FIW A;  3PJR A;  3AG2 H;  1O3T A;  2VL8 A;  4QPO A;  4A3E J;  4B8X A;  4NDL A;  1VQ4 I;  2HFH A;  1W36 C;  4M73 A;  2RNJ A;  3BR3 A;  5HOO A;  5D5W B;  3F3X A;  4HF0 A;  3TDU C;  2HKX A;  4D1Q A;  2XGE A;  1KQ0 A;  3QOD A;  3QWL A;  4LLG F;  3DEW A;  2ZXH A;  1X1P A;  3IV5 A;  2EIM H;  3PNV A;  2CUF A;  4OAZ A;  1OQY A;  2LRE A;  2VBY A;  3EYI A;  1T38 A;  1QA6 A;  3WTT C;  1X1D A;  3HYI A;  4G94 A;  1YJW I;  1MH4 A;  3ULQ B;  4BEH B;  5JFR A;  2VOP A;  5E8I A;  4HBL A;  5IP6 A;  1ON1 A;  4G9Y A;  4I6Z A;  3HHH A;  1D5Y A;  4HX4 A;  5CVI A;  1HW1 A;  5FO5 A;  5LRR A;  4FHT A;  2Z33 A;  3K1N A;  1YE9 A;  2MD0 A;  1ETW A;  3CUQ A;  3BDD A;  4ZTF A;  4HAM A;  1J09 A;  4XKC A;  4E7K A;  2F5V A;  1GUU A;  1WJC A;  1G3S A;  2PJP A;  2LKP A;  2O61 A;  3S1M J;  1X19 A;  1FYK A;  1FPQ A;  2MH2 A;  3BR0 A;  1X1C A;  1O3R A;  4EM2 A;  1IRF A;  5M5Y J;  3I4N J;  4JX4 A;  1IXR C;  2OBP A;  4BHB A;  1USS A;  5K7H A;  4V2G A;  5B5E C;  4RB1 A;  3E6D A;  3GEZ A;  2WWY A;  5JR3 A;  4WXC A;  2DI3 A;  4A3M J;  3HG9 A;  2BW3 A;  4ZDP A;  3MFK A;  1YIO A;  4WXD A;  3K4L A;  3M7G A;  4BQQ A;  3KP3 A;  4OOI A;  3CLQ A;  1JUS A;  2V9V A;  4B48 A;  1ETX A;  2FQ3 A;  2E1O A;  2HKO A;  2P5L C;  4KIT B;  2HXO A;  1HSJ A;  5GPC A;  4RB0 A;  1G3Y A;  3CCJ I;  3JRA A;  3IH2 A;  1JKR C;  4BDZ A;  4MHG A;  1W0T A;  2HPI A;  3WGG A;  2Z3Y A;  3CJT B;  2ID3 A;  2IXS A;  4X0G A;  4DZJ A;  2QWW A;  4UUS B;  3R61 A;  4OIN F;  4EJV A;  5EEA A;  4A3C J;  3FXU A;  1ENH A;  4C9Y A;  4XSX F;  1J5Y A;  2JVG A;  2RV8 A;  1DP7 P;  2STW A;  1HXD A;  3E5X A;  3GLX A;  1TWH J;  3KP6 A;  1U9N A;  3L7W A;  4RLQ A;  3BWG A;  2EJR A;  3R6S A;  1Y0U A;  3CTA A;  1ON2 A;  3HIF A;  2GM4 A;  5DTD A;  3CO6 C;  1YW7 A;  4LG0 A;  3LQQ A;  4RDU A;  3Q0V A;  3W3C A;  5JLX A;  2JPB A;  2N8G A;  2O9L A;  2PMU A;  1XMX A;  1G8X A;  1PDN C;  2VUM J;  3T8R A;  4ENJ A;  2EIL H;  4AM3 A;  4C3H J;  1ZGJ A;  3QPH A;  3JTH A;  4ZJZ A;  2M7B A;  2AS5 F;  2DYR H;  4FTH A;  3E6B A;  4Y33 A;  5IT3 A;  4NC8 A;  4XOR A;  2CGP A;  1T33 A;  5DS9 A;  2FOW A;  4XLN F;  1R00 A;  2LD5 A;  2BOL A;  3RIR A;  4Z6Y A;  2WB1 N;  3V7S A;  3GTJ J;  1J59 A;  1BI3 A;  1IJW C;  3A02 A;  2VC0 A;  3HOY J;  2VQL A;  1V5E A;  1SEU A;  5K1Y A;  2L7Z A;  3BPV A;  2HYF A;  3BG6 A;  3WHC A;  4DJA A;  3CCL I;  2IAI A;  1JGS A;  2HI3 A;  4IF4 A;  1IAW A;  2NOJ B;  2FE3 A;  2K4J A;  2QKM B;  3Q9V A;  1MSE C;  3S1R J;  4AVZ A;  2VQC A;  3EYY A;  5DYM A;  2IGN A;  3JRG A;  1B1B A;  1QNT A;  4BHC A;  4XKV A;  4HDU A;  3V7C A;  4Q5S F;  3ECO A;  5B3S H;  4WX9 A;  1V54 H;  4HYE A; 
#chains in the Genus database with same CATH homology
 2HVQ A;  4E7I A;  1FMW A;  3DPL C;  3FDY A;  3CP2 A;  3PNY A;  4JOM A;  2WA0 A;  1QHH D;  2LY2 A;  3BLY A;  4AU7 A;  2ELJ A;  4B44 A;  3BCA A;  3K4C A;  4F91 B;  1K6Y A;  2HPM A;  2CV0 A;  2VXZ A;  2VQG A;  3L2U A;  2W82 A;  4PFP A;  3MKW B;  4D9J A;  2WAD A;  2VKH A;  1D1B A;  1PYV A;  2R4G A;  3K6G A;  4DBR A;  3CJR B;  2CW7 A;  1BOB A;  2KL4 A;  2WBM A;  1WFX A;  2IS6 A;  1FMV A;  4JQF A;  1BR2 A;  3A1Y A;  3CES A;  4FAS D;  4YRV A;  3H5N A;  4BQO A;  2L5Q A;  3DWL E;  4CCL A;  4IZZ A;  4RMN A;  3RCO A;  3FBN B;  3UR3 C;  3TBI A;  2O5R A;  4N4O B;  3OMY A;  1Z7L A;  4ZYA A;  2XF6 A;  3E1S A;  1G59 A;  4IKF A;  2E5Z A;  3IUO A;  2F4I A;  3BCB A;  2HVS A;  1D0Z A;  1VZ0 A;  3H0D A;  1N77 A;  5LD2 C;  2KPM A;  2IGM A;  4BUP A;  3H9Q A;  4F3Q A;  1KON A;  2IS4 A;  1D1A A;  3OR2 C;  4NC7 A;  3K70 C;  3KEY A;  2BVM A;  2CV2 A;  2R7V A;  4E7L A;  3CMM A;  2BVL A;  3SEZ A;  4N4N B;  3HXL A;  1R6R A;  1BR1 A;  3S3N A;  4BAC A;  2WY7 Q;  2X6Y A;  2CMP A;  2M3A A;  1OR7 C;  3G2B A;  4YEL A;  1Z3X A;  2MYS A;  4BJ6 C;  3K4N A;  1V5F A;  2LH9 A;  1SAU A;  1MNE A;  4BQN A;  5JHF A;  3AKZ A;  2JUG A;  2E5N A;  3QYE A;  4U7B A;  2WAQ A;  4P1W A;  2VJ5 A;  3ONQ A;  4XKW A;  3L2R A;  3TMO A;  2Q2E B;  2VPL A;  3MKZ A;  4XN3 A;  4XMY A;  2XSJ C;  4XLA A;  3FBI B;  2PMZ A;  3K10 A;  4PFO A;  3N05 A;  3J7A Y;  5HLT A;  3OYH A;  4XN0 A;  4BS9 A;  2R7Q A;  4PUS A;  4Y4R A;  3DPT A;  2XC7 A;  2LRD A;  4XLF A;  5CQG A;  2KZV A;  3S93 A;  3OS0 A;  3DTI A;  4BE0 A;  1QHG A;  4LIV A;  5TGT A;  2VJJ A;  3LSI A;  3E0J B;  3RPU D;  4E7H A;  4XOP A;  3OL4 A;  3HPH A;  2UWM A;  4II3 A;  4B3X A;  5KCM A;  3VSL A;  3TL4 X;  1V5G A;  4HG2 A;  4DBQ A;  3BG7 A;  4HPQ A;  3H9G A;  4QPQ A;  4EAT A;  4RLF A;  5LFA A;  3M8J A;  5KNL A;  4R79 A;  3OYA A;  3KX2 A;  2KP6 A;  4H4K C;  4CZC A;  2X51 A;  2V6E A;  3MKY B;  4IQ4 A;  2VJ4 A;  2E60 A;  2GOM A;  2Y0S A;  2ZSI B;  2CH0 A;  2LOO A;  1YX5 A;  3A4C A;  4B43 A;  2CUJ A;  4BXF A;  2IGK A;  4E7Z A;  3IP4 B;  3OYD A;  3OOU A;  4PSX A;  4DIQ A;  3OYC A;  1Y56 A;  3LFU A;  3HOS A;  1AA7 A;  3GBG A;  3DPU A;  4RM3 A;  1HA8 A;  2K9M A;  2HDW A;  2X85 A;  2Q1Z B;  3ZR8 X;  4CCO A;  3OY9 A;  3W2A A;  1N78 A;  2V1N A;  3A2K A;  1N75 A;  3DTE A;  2HNH A;  3DTK A;  2PJR B;  2KLO A;  2VIX A;  4AYB A;  1Z3Y A;  1S9H A;  2VQH A;  1D0Y A;  3OS2 A;  4U87 A;  2CS3 A;  2V7F A;  5HVQ C;  1GLN A;  3DKX A;  3QOE A;  3PL8 A;  2LY1 A;  2CUZ A;  3HUG B;  2V26 A;  5HNF A;  2RQQ A;  1DQU A;  2DOA A;  4ITV A;  2K3P A;  2OV7 A;  2KRC A;  3RTR A;  3OYE A;  3AL0 C;  1D1C A;  4PK4 A;  1P9Q C;  2DT7 B;  4ZDO A;  3LL7 A;  4OWR B;  4YEJ A;  2Z16 A;  4C30 A;  3OYB A;  2VXD A;  3VYS B;  3HC7 A;  4F55 A;  4HST A;  1LDK B;  3SDB A;  2AQE A;  1NG7 A;  4ANJ A;  3IAS 2;  3RQ4 A;  4DGW B;  5FRN A;  2P0W A;  2R7W A;  2LBF A;  3FHN A;  3BC8 A;  3DU5 A;  2XAU A;  2Z2S B;  2FUG 2;  2X1C A;  2WB1 A;  3OYK A;  3EUK L;  3DLA A;  1WJ5 A;  2HU9 A;  4XLH A;  4BJ5 C;  4XLE A;  4MLO A;  3SZG A;  4HNT A;  1X1B A;  3OYI A;  3S8P A;  3DQV C;  4BL0 B;  4E7S A;  1PJR A;  3S32 A;  1WJB A;  2E1M B;  3M1C A;  3VYU B;  3DKY A;  3ZRG A;  1DGW Y;  3I3L A;  2KHM A;  1T0F C;  3QYF A;  1X1A A;  4ZC3 A;  4FET A;  4XNF A;  3CP8 A;  2M4K A;  4LIU A;  1Y6I A;  3ZXS A;  2PJR A;  2ZSH B;  2R7X A;  4HNU A;  2BW3 B;  1MMN A;  4CCJ A;  2CFO A;  2KDO A;  3HPG A;  2R7U A;  3K4K A;  2XF5 A;  2DT6 A;  4E6K G;  2LYC A;  3AL0 B;  3L2W A;  1WJE A;  3FKJ A;  4BEH A;  3ZGK A;  4PJL A;  2WY8 Q;  2CW8 A;  2JSP A;  3OL3 A;  2X6X A;  2IS1 A;  2R7T A;  4BJT A;  2MC4 A;  2L2O A;  1W36 D;  3LSG A;  4B47 A;  3AFH A;  2VJI A;  3OIP A;  2E1M C;  4F92 B;  4IX7 A;  3OWT A;  4ZDL A;  4LG3 A;  2JA2 A;  2A5W A;  3KYL A;  1T95 A;  2XF7 A;  1LVK A;  1LFP A;  3NWS A;  2VAS A;  3K4M A;  2LG4 A;  4CSW A;  1ZEL A;  2DCE A;  3QYB A;  2MFZ A;  3OYG A;  2VKD A;  3CF2 A;  1OLT A;  1MMD A;  2X1D A;  1TZL A;  2A6T A;  4E4H A;  4ZTJ A;  1DP3 A;  3NWT A;  1JI8 A;  3L2V A;  1ERD A;  3LMM A;  3W2V A;  4NUB A;  3K70 D;  4PJJ A;  3ZCO A;  2ZFU A;  3PJR A;  3SYT A;  2W00 A;  2IGO A;  2VL8 A;  4QPO A;  2M0M A;  4BE1 A;  1U0J A;  3OYF A;  3U21 A;  4CCM A;  1W36 C;  3S3O A;  4XON A;  1BR4 A;  2ZXI A;  5HOO A;  2DJI A;  4KIS A;  4D1Q A;  1UG0 A;  3QOD A;  4OAY A;  2XDV A;  3D5R C;  2ZXH A;  1DGR M;  3C2H A;  3S3M A;  3PNV A;  4OAZ A;  1UEL B;  3HOT A;  2LRE A;  3PUB A;  3RSN A;  1WJD A;  2GOX B;  2I8D A;  1X1D A;  4XR6 A;  3VDX A;  4BEH B;  4XOT A;  4IQJ A;  3H5A A;  2OUM A;  3H35 A;  4F93 B;  3EUA A;  1NG6 A;  4CUG A;  4BDY A;  2R7S A;  2CV1 A;  2DXI A;  2Z1D A;  1YE9 A;  2MD0 A;  1SFK A;  4ZTF A;  3SEQ A;  1J09 A;  4XKC A;  2K9L A;  4E7K A;  2F5V A;  1WJC A;  3OR1 C;  4RM2 A;  5CKT A;  3HKZ A;  3VWB A;  3K4J A;  3LSK A;  1X19 A;  3OIQ A;  3VYT B;  1X1C A;  4P5O A;  3D5S C;  4Y3O A;  3W2W A;  2WAE A;  2M7A A;  1MW7 A;  2HQA A;  2RNG A;  1MMG A;  1WJF A;  2UUZ A;  1YX3 A;  4GRI A;  4CCK A;  4XQF A;  4LIT A;  5HNH A;  2L9S A;  3OS1 A;  2KQR A;  3HG9 A;  2BW3 A;  2W7N A;  4ZDP A;  2RRE A;  3K4L A;  4BQQ A;  3OYL A;  4J00 A;  4G6T B;  3MMY B;  2HZD A;  4B48 A;  1E0E A;  2VLA A;  4KIT B;  2QKL B;  2OC6 A;  2WAF A;  5FRO A;  4II2 A;  4F52 A;  3DU6 A;  4PSW A;  1X4O A;  3ZQQ A;  4NQW B;  4BDZ A;  3K4B A;  2IS2 A;  2UV1 A;  2HPI A;  3VSK A;  4J01 A;  3IAM 2;  3PNT A;  2IXS A;  4X0G A;  4BGD A;  3OYM A;  1MMA A;  4KJZ A;  4C9Y A;  2JVG A;  1IRX A;  3PFY A;  4NNJ A;  4CA0 A;  5KHD A;  4BU2 A;  1MND A;  4RLQ A;  3PSF A;  3PSI A;  3CZ6 A;  4KT6 A;  4C2T A;  1WJA A;  3VYR B;  2K5C A;  3D5L A;  3W3C A;  4HRI A;  1G8X A;  3L2Q A;  3UNG C;  3EPZ A;  3C2G A;  1TT0 A;  2LBF B;  5CPR B;  3V42 A;  4ZJZ A;  2M7B A;  4CH7 A;  5FRM A;  2LC2 A;  4Y33 A;  4NC8 A;  2L9N A;  4XOR A;  2JVH A;  2X6W A;  4PJM A;  4HEA 2;  2W1O A;  2F6C A;  3HL2 A;  3DEE A;  5CQE A;  1UAA A;  2BOL A;  4XLC A;  1X4P A;  2AQF A;  2HVR A;  1QU3 A;  2V4J C;  2VQL A;  3H5R A;  4CCN A;  1V5E A;  3OYN A;  1EA3 A;  3BG6 A;  4DJA A;  4C2U A;  2MAB A;  3OYJ A;  4DOZ A;  3H9J A;  2KRH A;  2VB6 A;  2NOJ B;  1LKX A;  2V9K A;  1D0X A;  1Z21 A;  4XL9 A;  2QKM B;  2R7R A;  2KMU A;  2M4G A;  4HSR A;  4PJN A;  4E7J A;  2W4S A;  3CJQ B;  4XM3 A;  4AVZ A;  3I9V 2;  2X1E A;  4BE2 A;  3EUH C;  3F9K A;  2VQC A;  2IGN A;  3LSM A;  2L7K A;  4XKV A;  4XKB A;  3MD2 A;  3LSH A;  2R7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...