4HF1A

Crystal structure of iscr bound to its promoter
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
129
Chain Sequence
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDESVDALTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSGRQHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies of IscR reveal a unique mechanism for metal-dependent regulation of DNA binding specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords HTH-type transcriptional regulator IscR
total genus 43
structure length 129
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hf1A00
2L54A 3E3VA 4GCVA 1EV7A 1MGTA 3M1EA 1P4XA 3V8JA 1MD0A 2EV5A 2WV0A 1XGOA 3ELKA 2STTA 5CJ9A 5LGNA 2PEXA 2W85A 3WTYC 2QBYA 2EWNA 1U6GA 1WI9A 4LK0F 2NRAC 3DFGA 1OYIA 4WXHA 1IF1A 3VFZA 3KP5A 2DPDA 4MQ9F 2Q2EA 3HHGA 4R1HA 5BMZA 1PUEE 2EB7A 2Y75A 1D8JA 1ZG5A 1F5TA 5BS6A 2FBIA 5F6FA 1B4AA 1R1VA 3HSEA 4HV6A 2YPRA 5F1RA 5L3DA 4HF0A 2CO5A 2EK5A 3IKTA 1J2XA 5FGMA 3KP7A 1ZLJA 2JRTA 2EFWA 4CDGA 5DEQA 3COAC 2KRFA 4LFUA 1T2KA 4LLLA 3HTSB 3E6BA 2IT0A 4EM2A 1O3SA 3P9CA 4UV9A 3C7JA 3O2PE 4I0BA 5DYMA 3DPTA 2UXXA 3MFKA 2WTEA 2DW4A 1OMIA 2JZYA 3KLNA 2XRNA 4OOIA 3E6MA 2JT1A 3J81K 2OU2A 3KZYA 5K5OA 2A61A 2VBZA 2FMYA 1HKQA 4ENMA 1W5TA 4ZYEA 4ESBA 3GFLA 1W7PB 3WTWC 3HIFA 3S2WA 4WWCA 2M30A 4OIOF 4ETSA 1IZ1A 1IRGA 1UFMA 3OV8A 1YS7A 4MNUA 2PBIA 4PZJA 3MCZA 3HRUA 3IWFA 3FM3A 4XBFA 4Q4ZF 1FOKA 1KGSA 2K86A 2X4HA 2G9WA 1CF7B 3RYPA 2P6TA 5KVRA 1ONVA 4YG2F 3RKXA 2LF8A 3NEUA 2IP2A 2UZKA 3WU1B 2XV4S 4CO8A 2V9VA 3LSTA 4WCGA 1K6OA 2LSOA 2CQKA 4A0YA 4HQEA 4EJTA 3E6CC 1Q1HA 1TNTA 1V4RA 1F4KA 2KIMA 4HZFA 4L9VA 2YR2A 3REOA 1ZRDA 4LG0A 1SD6A 1BI2A 5TJJA 5CVIA 4M72A 2DU9A 3EETA 4K2EA 1IXRC 3DXJF 5ICFA 2M45A 1OPCA 5ILUA 2ISYA 3N97A 4QWQA 1WRJA 4XLPF 2FRHA 4Z2YA 1USSA 3C1DA 1HW2A 1QNTA 3HRMA 4Y13A 2XAJA 2OQGA 3E97A 3MAJA 3CUQB 4GGGA 2W25A 1SD5A 4JK1X 2FEZA 4FHTA 5D4SA 1KU7A 4L0YB 1P4WA 4ON0A 2AS5F 4HBLA 5H20A 3WG9A 3J7AO 3CUOA 1D3YA 1JE8A 1TQIA 1PP7U 2HR3A 2KJBA 1R7JA 4M9XA 3J80Z 5ERIA 2RC4A 3E5XA 4IXAA 1MZBA 1FBQA 1QZZA 2YX7A 5JFRA 1FLIA 2ZMEB 1R00A 4I2OA 1J9IA 4ENNA 1U3EM 2DK8A 4LMYA 1W4MA 4AIKA 4M9SA 1RUNA 4D0PA 2W84A 5LEJA 5A2QZ 1ON2A 5D5XB 4ESJA 1UHMA 2PLYA 1RI7A 2QZ8A 4AVPA 4HDVA 3WTUC 2NYXA 1XCBA 3LAJA 2VXZA 1E17A 1HXDA 4P9FA 2CW0F 2E1CA 1U5TC 4N0BA 2QYOA 3CO7C 1FSEA 4ZZLA 3JTGA 1K7AA 4UVCA 1TW3A 4KDPA 1ZG3A 1LEAA 1I5ZA 4GXOA 3VOEA 5FFZA 2DT5A 4PCQA 1ON1A 4B09A 3DPLC 2COMA 1DPRA 1FT9A 4MEXF 5H6RA 1WQ2A 2D1HA 2Q0OA 2OZ6A 3TDZC 2FNPA 3WGIA 2DFIA 3F8CA 1Z6TA 2O6GE 5D5VB 2ZCWA 2IA0A 4G94A 3RIRA 1IXCA 1USTA 1T39A 4KT5C 1I1GA 5EEHA 2L4AA 1LDJA 1BI1A 3K0LA 1SAXA 1LJ9A 3O3KA 5LGUA 2XKOA 1IW7F 4U7DA 2QLZA 4IHTA 4AWXB 3TOAA 3H3UA 5LEKA 3LWFA 1HKSA 3ZMDA 1Z7UA 3LQQA 1QPMA 4NB5A 2FSWA 2QM3A 1PP8F 3LA3A 2JPBA 5H6QA 4RB1A 3R4KA 1MDMA 4N9IA 1KU9A 1DDNA 4MTEA 1R23A 3QAHA 1I6XA 1LNWA 4HLYA 1Z6RA 5DUIA 2ZJ2A 2L4MA 2DQRA 3CLOA 2OQRA 5LHIA 3KP2A 3ABTA 5IT9Z 1FYKA 3DQVC 5ED4A 1CF7A 2TDXA 2BGCA 1S29A 5DV5A 5ILSA 2CYYA 1BI0A 4L9NA 5JHUA 2QQAA 4EM1A 3IC7A 1GXQA 5HLGA 1FWZA 3GW2A 1YTYA 2EA2A 3KZZA 4H0EA 1O57A 2LNBA 3BDDA 5E20A 4RGRA 2CFXA 3WGHA 2P7CB 1ZLKA 3TDUC 2PG4A 4NHJA 1MJBA 1XD7A 3F8NA 4U7BA 1ZGAA 3SFZA 3M7GA 3GXOA 5FO5A 3WE2A 1ZRFA 3HUGA 1QZYA 2R7FA 1Z05A 4MTDA 3BPXA 3GEZA 6PAXA 1X3UA 2VBXA 3J80K 2ZFWA 2FA5A 5DCMA 2ISZA 2BYVE 5CVRA 2P4WA 2VC0A 4LLNA 3RDIA 3CUQA 4KUMA 5E18F 4JBAA 2OD5A 3ZPLA 1BIAA 4O3MA 5IT9K 2DK5A 1XSXA 1B59A 2CGPA 3ZP5A 2Z99A 2V1DA 5FFXA 4UVBA 2V79A 2DPUA 2FBKA 1DP7P 1P4AA 1S6LA 4UV8A 5D8LB 1BOAA 4EV0A 4A5MA 5HOOA 2Z5UA 1B9MA 1ZARA 1BIBA 1SFEA 2MD5A 2A3SA 4N9HA 5CLSA 1HSTA 2MLKA 4RAZA 4G7OF 4M74A 4CXFA 1JHFA 1YQAA 3ZN1A 3IRRA 2OBPA 2FBHA 5K5QA 3ML6A 2P8TA 1T0FA 3TKYA 1H9GA 4OMZA 2V1XA 5D5UB 4HF2A 3QPTA 3KP3A 3K69A 5CVUA 2DBBA 2HFHA 2RKHA 2JTVA 3MZYA 4I0AA 3FXQA 3GYHX 4L0ZB 3KE2A 4CZZA 5L3EA 5HS9A 5JR3A 1ZGJA 1WSUA 4U0YA 4RB0A 4WXCA 1A04A 4HYEA 4A12A 1R5GA 1Z1DA 3F8BA 3L2CA 1KQ9A 3I71A 3FXRA 5HS7A 2HDCA 4BNCA 2MH9A 3ZMTA 1I1SA 2O8XA 2H6CA 5J8CA 1J0RA 5DUKA 1J59A 4UXNA 1LVAA 4TV7A 3IWZA 3ROUA 5E17F 4XRFA 2GWRA 4I98B 4Y15A 4EJUA 2IA2A 3GZ6A 4U0WA 1P6RA 2XVCA 4HW0A 5L3GA 5HVQC 2ZO4A 2HTJA 2RDPA 1XMKA 1BBYA 4PDKA 3WTZA 3KETA 2J5OA 1S7AA 2MBFA 2O61A 4BYYA 1L3LA 3FXUA 3N4MA 4I01A 1BC7C 1L0OC 3I59B 4O6JA 4RGUA 4I02A 3CTAA 4LK1F 4LG0B 4L18B 2FU4A 1T98A 2ZBKA 4M6XA 2NS0A 3P9IA 1T6SA 5E8IA 2QQ9A 1IRFA 3I53A 5CVVA 4ENKA 3QU3A 2ELHA 1UCRA 1YFHA 3F21A 3HHHA 1OYWA 2HTSA 2P7VB 1XN7A 3EQLF 5D6EA 5DCMB 1W7PA 1XSDA 2BBYA 4A2UA 1J75A 5HS8A 3QP6A 1FYMA 3BZ6A 2X0LA 2F5FA 2GZWA 3E5UA 4KICA 1AWCA 5D6FA 5L3FA 1MJAA 5IT3A 3KEOA 4G6QA 4EJOA 2A07F 4G9YA 3IKVA 4L9TA 3W6JB 3U9GA 4A6EA 1BN5A 4KIBA 1WWXA 4Q5SF 4L9JA 2XASA 2GA2A 4I7HA 3AAFA 4ZYGA 3JSPA 2D2WA 2QENA 4IHSA 4GO1A 1RUOA 2Y48A 2H09A 4A0XA 1O7FA 4RS8A 4EJWA 3DV8A 4U88A 3H92A 4OIRF 1SD4A 2EV0A 1BJAA 4G7ZF 2PJPA 3GVAA 1NHAA 1DUXC 5E1XA 1D5VA 4L5IA 2DLLA 5D5WB 3KCCA 3BROA 4P5OA 4EVIA 5D4RA 1KA8A 4GYIA 3D0SA 4JQFA 5LBQA 4BAYA 2GA1A 4HOBA 4L5JA 2IRFG 4YFNF 3CJNA 3L7WA 1HW5A 3HSFA 5A2QK 1GXPA 2FQ3A 4HDUA 3NQOA 2A69F 5K1YA 2L3DA 4OINF 1FP2A 1KU2A 3K1NA 1R1UA 1YW7A 2V1UA 2V6CA 2PI0A 3H3ZA 3V8KA 3TQNA 3TOBA 1BI3A 4KMUX 3P7NA 2RNJA 5E1WA 1S3JA 2P5KA 3JAMK 1HBXG 2A68F 2XUBA 3C18A 2KIUA 2OA4A 4BXUA 4E70A 3NRVA 2RV8A 4CICA 3QPHA 3ISPA 4YFXF 1O3QA 1GVJA 4R8HA 4FT8A 1BC8C 2WC2A 4P96A 2K4BA 5CYVA 4LD5A 2H6BA 2VODA 4PGHA 2F5EA 1LEBA 3T0YA 3JW4A 3I64A 2EFOA 1FP1D 2HS5A 3I59A 3M8FA 1REPC 1H9TA 2ESHA 4IRGA 1Z9CA 3F23A 4QLCU 4HX7A 3DKWA 3G73A 3I5UA 3HOTA 2P6SA 2HYFA 2Z3YA 1LDKB 4LGWA 5BPDA 3GZ5A 4HX8A 4IJAA 2Z9OA 3BJ6A 1G3TA 4FX0A 2F5CA 3F8MA 3E6DA 4ENJA 2IW5A 4KFCA 4KN7X 3RKYA 3ECHA 1OYYA 3L00A 3G3ZA 1FY7A 5ICEA 5ICCA 2E7XA 3F6VA 3U2RA 2P5VA 3TO7A 2A6HF 3R61A 1UB9A 1XDUA 2VOPA 3V7CA 1EH7A 2GIVA 2HEOA 1ZHFA 2CSOA 3I58A 3BJAA 4I09A 5DCFA 4XSXF 2C6YA 1RZ4A 5HDKA 3ULQB 1I27A 3I4PA 2Y0MA 1FYLA 5HLIA 2K27A 2PMUA 2K02A 1B6AA 3F3XA 3MQ0A 2G7UA 3JSOA 5FLXK 4G7HF 3PQJA 5LHGA 3CO6C 2G7HA 2K4JA 4HAMA 1EH8A 3FHZA 1FZPB 1FC3A 4MQVA 3WTSC 1U2WA 1IN4A 1LQ1A 4BQAA 2ESNA 2RN7A 4AD9A 1D8KA 2XKPA 3HRTA 2FMLA 2FOKA 3R0JA 4OIPF 1R58A 4WXDA 3U1DA 2UWMA 2XAGA 2E1NA 1H0MA 5J8FA 3L09A 3SXYA 4B8XA 3KEQA 2J5PA 4DNCA 4S04A 4OMYA 4G8XA 3BOQA 2IVMA 1FBUA 5BQTA 3WODF 2GXGA 2HYGD 4XSZF 3MZHA 3LA7A 1RIOH 5F64A 4KNYA 3B02A 4BHBA 1FNNA 4LB5A 2L01A 4HA8A 1TTYA 2MA3A 4NQWA 1XCVA 1KYWA 4LJZF 2ZKZA 2BE5F 5J6XA 2M1BA 4IF4A 1O3TA 3CDHA 1O3RA 2EFNA 2EFPA 4A6DA 4RGXA 2VONA 3ECOA 4ESFA 2VT3A 2QVOA 3V7SA 3IHUA 1G3SA 2QQBA 2VT2A 3C3WA 2A6EF 3R0AA 4M73A 1TBXA 3F8FA 3QRFF 1XGMA 1B1BA 1LB2A 1YW9A 1V3FA 3TGNA 5LHHA 1TLHB 4Y17A 3I54A 3LAPA 1S7OA 1IN5A 4AIHA 4EMSA 2HWVA 5ILVA 2O03A 1VTNC 1R22A 3RJPA 3WU0A 4OIQF 4M9ZA 3T8RA 3F22A 3FMSA 2HQNA 2KJCA 2OZUA 4KIGA 1XDSA 1F9NA 1CGPA 4BHPA 1U5TB 4FX4A 1G3WA 1YLFA 1KQ0A 3T1BA 1SD7A 3EYYA 3DEUA 4ZYDA 2WWYA 1K78B 1HQCA 4UHTA 1LDDA 2PFBA 5HDGA 1MKMA 1TQPA 2EA4A 2ZNYA 3QP5A 2XAFA 5L3CA 2CG4A 3SHFA 1YIOA 4MEYF 3OOPA 5E8GA 1IXSB 3KLOA 1XB4A 3LFKA 4LLGF 4Q47A 4F7ZA 2VN2A 1GHCA 4EGZA 1J7KA 2O3FA 1FBSA 4HX4A 1AOYA 2GAUA 4P9UA 3K1MA 3RPQA 2Z33A 3JTHA 3GLXA 3V4GA 3FWEA 3SZTA 2XAHA 5BPIA 2MH2A 4YIIA 1S8NA 3T5XA 5DDGA 4RAYA 3K9TA 2ZNZA 1SMYF 3SZPA 2DQLA 1U5TA 3TO6A 4MGRA 4HF1A 3KP6A 3MWMA 4DQ2A 2LDUA 1SFUA 1R5HA 2F5DA 2NNYA 3IL2A 3FMQA 2FF4A 3BY6A 3F72A 2B0LA 3BP8A 3E5QA 3GO5A 3EYIA 4KN4X 3VB2A 1Z91A 5FD5A 3Q9VA 1QBJA 1P2FA 1R36A 5E1ZB 3ZMSA 2HZTA 1MJ9A 4EJVA 4UVAA 3RPUA 4M71A 2GXBA 1YG2A 2IA1A 5L3BA 2W57A 2YSRA 4RB2C 2VBWA 5JI6A 1C0WA 2RQPA 5FLXZ 2RVCA 2IPQX 2ADUA 3RYRA 3GX4X 1SFXA 5AONA 2PMHA 3ZQ7A 5LRSA 2H94A 4HLXA 1ZRCA 2FNAA 3RI4A 3PFIA 3CUQC 5HLHA 2QUFA 1XGSA 3GFMA 3HOSA 4EQQA 2FXAA 2NAZA 1TNSA 3V8LA 2IJLA 3WE3A 2DO7A 3M9AA 3ZMZA 5D8KB 1B9NA 3Q9SA 5FD6A 3WTVC 1QGPA 1ODDA 3ABUA 2M5WA 3WTXC 5TRDA 3KFWX 3BPVA 5CVJA 2XGXA 2VE8A 1EH6A 2ETHA 2D1VA 1HW1A 2OAZA 2VC1A 1IAWA 2JSCA 2VBYA 5BOXA 5FB2A 1E2XA 3WTTC 2M87A 3IRQA 3RKWA 2ZXJA 5KK1A 3FMRA 3D5LA 1ZN2A 2FE3A 2NNNA 4YFKF 3VODA 3B73A 1KQ8A 4U0VA 1FSHA 4BHCA 1W5SA 2Q8KA 4KMFA 2A5YB 2LKPA 3BJOA 4BH9A 4HQMA 1T38A 5HDNA 4EGYA 3K2ZA 1UHWA 2VOOA 2AXLA 3HTUA 3VEPA 1DPUA 2QBYB 2GQQA 1MDMB 4KIFA 4GYGA 5AIPA 4MHGA 3FX3A 2XHKA 3FZVA 1U78A 1OR7A 2HOEA 1P92A 1XGNA 2F2EA 2BV6A 3MEXA 2XAQA 1YW8A 3BWGA 4IVNA 4P55A 2W24A 2K7LA 4XLNF 4YIFA 2XROA 3FF5A 4G6DA 3W6KB 3ZMUA 1U8RA 3Q5FA 5AIQA 1JGSA 4M6YA 4OU0A 1G3YA 3F6OA 4A0ZA 3EUHA 4CYDA 5EEGA 1G6NA 2EFQA 1JXSA 3QU6A 3GWZA 4WX9A 1KYZA 2DAOA 3ZMVA 2KIFA 1O7LA 1ZAOA 2QWWA 5LGTA 2P5LC 4ASNA 4IPAA 3J81Z 1ULYA 4UNOA 2BEOA 1J5YA 3DP7A 1XSVA 3GF2A 1IN6A 2PQ8A 2HKXA 4ZH4F 1Y0UA 5JVTA 3GFJA 1TQMA 4AIJA 3T8TA 3V7RA 4KA4A 4ZYHA 1XMAA 1R1TA 3L9FA 1IUYA 1BM9A 2XIGA 4Q48A 1TW2A 3JAMZ 5DD4A 2H27A 1RNLA 2L02A 3WGGA 1ZYRF 1QQIA 5DD8A 4KYWA 2MLGA 4R79A 5LLQA 1W7PD 3DF8A 2CWEA 4EM0B 3QOPA 2M8EA 3TO9A 4S05A 3ZN0A 4CHUA 1F1ZA 2HQRA 4O5VA 3R60A 2DI3A 1HSJA 2EV6A 2JPCA 3HYIA 2KKOA 1IN8A 2PN6A 2ACJA 4LB6B 3K1PA 3PQKA 4RB3C 3I0TA 1STZA 4CGZA 4PGGA 1K79A 1YYVA 4WK8F 3KP4A 2R3SA 3EDPA 1K78A 4UUVA 1G4DA 3R6SA 1YO5C 4HV5A 2D45A 1PDNC 5K5RA 1IN7A 1ZREA 3P9KA 3FM5A 4IRHA 2O0YA 5LRRA 1QO0D 2VE9A 1FX7A 4RGSA 3GFIA 2EJRA 1ZG1A 1ZH5A 1JHHA 3HRSA 2UXNA 2YX4A 1OKRA 2R7DA 3RTRA 3M8EA 1FPQA 4A5NA 3GUDA 2HKOA 2MC3A 4IRIA 2YU3A 3ERED 2ZMEA 1SMTA 2RGVA 1HKTA 3O6BB 2E7WA 3LA2A 2DTRA 2STWA 2LF7A 4ZZDA 3LQRA 1YS6A 3HSRA 3SQNA 1WKMA 5ICGA 1KU3A 4WF2A 2HGCA
chains in the Genus database with same CATH superfamily
2L54A 4QIWN 2BVMA 3E3VA 4GCVA 1EV7A 1MGTA 1TWAJ 1SVOA 3M1EA 1P4XA 3L2QA 3V8JA 1MD0A 2EV5A 1KONA 1V54H 4CCJA 2Y9ZA 1YJNI 2WV0A 2KPMA 1EA3A 1XGOA 3ELKA 4AC0A 3BT9A 2STTA 4J00A 1PJRA 5CJ9A 5IP7J 3OIQA 2G0EA 5LGNA 1MNEA 2JJ7A 2PEXA 1JJ8C 2W85A 2DA3A 3WTYC 1MMAA 2QBYA 2EWNA 1U6GA 2VASA 1WI9A 4A3EJ 2GLOA 2LOOA 4LK0F 2NRAC 3LSKA 3DFGA 1OYIA 4WXHA 1R71A 4XORA 1IF1A 3VFZA 3KP5A 4L5EA 2DPDA 4MQ9F 1APLC 2Q2EA 3E7LA 2RNGA 2M7AA 3HHGA 1DU6A 4R1HA 3JRCA 5BMZA 2DYRH 2WV1A 1PUEE 2EB7A 4A3DJ 2Y75A 1D8JA 1ZG5A 4ZJZA 5BS6A 1F5TA 2FBIA 3NARA 2WY8Q 1B4AA 2A5WA 5F6FA 1KZHA 4PJJA 5M5WJ 1R1VA 5M5YJ 3HSEA 4HV6A 2LBFA 3J7AY 2YPRA 2HOAA 5F1RA 5L3DA 1S7EA 3FXLA 4HF0A 3GBGA 3KYCB 2CO5A 2EK5A 3IKTA 3FK6A 1J2XA 4B3XA 5FGMA 4IO9F 1NG6A 3KP7A 5E3NA 2IS1A 5GAGJ 1T8IA 2R92J 1E3PA 3OIOA 3AL0C 1ZLJA 2JRTA 2EFWA 4CDGA 5DEQA 2BHZA 3QPLA 3COAC 1SAUA 2KRFA 2RAEA 3A0HC 4LFUA 3A01B 3OYCA 4AUXA 1T2KA 4LLLA 3HTSB 1V5GA 1ORKA 3JRIA 2KDZA 3EUHC 3E6BA 2BY0A 2IT0A 3HGGA 4XLCA 4EM2A 1O3SA 3P9CA 5FRMA 3DPUA 5C44J 1X58A 4S0HB 4M3BA 4FASD 1ENHA 1FEXA 4UV9A 4A93J 3JRDA 3C7JA 3O2PE 4I0BA 2GXAA 5DYMA 3DPTA 2DA4A 2UXXA 3MFKA 4RLQA 4XLHA 2WTEA 1XS9A 2DW4A 1OMIA 2JZYA 3KLNA 3CCLI 2MABA 4CZCA 2A05A 4B48A 2EQRA 2XRNA 4OOIA 1WH5A 1LFBA 1YX3A 3E6MA 2JT1A 3NWSA 3J81K 1WPKA 5HODA 2OU2A 4AYBA 3KIOA 3KZYA 1BL0A 1S5LC 1MMGA 2ZSHB 3CMMA 5K5OA 2R7UA 2A61A 2VBZA 2FMYA 1HKQA 4ENMA 1JUSA 2JWTA 1W5TA 2LH9A 4ZYEA 4ESBA 2DDBA 3GFLA 4RAGA 1W7PB 3WTWC 3HIFA 3S2WA 4WWCA 2M30A 3CDIA 4OIOF 3H9JA 4ETSA 1IZ1A 1IRGA 3ZXSA 5B1BH 1P7JA 1UFMA 1AKHB 3GTOJ 3OV8A 1YS7A 1CQTA 4MNUA 2PBIA 4PZJA 3MCZA 3HRUA 3BR1A 3IH3A 3FM3A 3IWFA 3BG5A 4XBFA 2BW3A 2DOEA 4Q4ZF 1FOKA 1KGSA 2K86A 2X4HA 2G9WA 1CF7B 4OWRB 3RYPA 2P6TA 5KVRA 1ONVA 4YG2F 2GM4A 3RKXA 1I50J 4A3LJ 2LF8A 3NEUA 2IP2A 2UZKA 3WU1B 2EPFA 2XV4S 4CO8A 1P7IA 4BQNA 4ANJA 2V9VA 2KISA 3W2VA 3LSTA 4WCGA 2VJ5A 1K6OA 2LSOA 2CQKA 4A0YA 5FLVA 1T56A 4Y7NJ 4AM3A 4HQEA 4C2MJ 4EJTA 3E6CC 4CYCB 1Q1HA 1TNTA 3BQZA 1V4RA 3BLYA 4BQQA 4J01A 1F4KA 2KIMA 4HZFA 4L9VA 3FK7A 2YR2A 2MG4A 3REOA 1ZRDA 5CQEA 1S9HA 4LG0A 1SD6A 3A2KA 1BI2A 5TJJA 2MYSA 5CVIA 3IH2A 4M72A 3S3NA 2CUJA 1A31A 1BR2A 4BY1J 2DU9A 2VPLA 4XMYA 2X6YA 3CC7I 2DT6A 3EETA 4K2EA 5J1RA 2PX9A 5CKTA 1IXRC 1D0ZA 4DW6A 5FLMJ 3DXJF 2WAQN 5ICFA 2M45A 1OPCA 5ILUA 3MKZA 5K7ZA 2DXIA 4XLFA 2ISYA 3N97A 4QWQA 1JTXA 1WRJA 4XLPF 3TBIA 5JLWA 2FRHA 4NUBA 4XKWA 4Z2YA 5GADJ 1USSA 3C1DA 1HW2A 1OCRH 1QNTA 3HRMA 1WFXA 1YITI 3I55I 4Y13A 2XAJA 4M3DA 2OQGA 2NVUB 1AHDP 3E97A 2ID6A 3MAJA 2L5QA 5IYBJ 4I99C 2Y30A 3CUQB 4GGGA 2W25A 1SD5A 2Y9YA 3HKZA 4JK1X 3LSGA 1VQPI 2FEZA 3MKYB 4FHTA 3TW6A 5D4SA 1WVRA 3CMAI 2H8RA 1KU7A 4DBRA 4L0YB 3OYJA 3HG9A 2OC6A 1P4WA 4ON0A 2HDWA 2E1MC 2AS5F 3BCAA 3TEDA 4HBLA 4C30A 5H20A 1IJWC 4JX5A 4JX4A 5E3LA 5B5EC 2M7BA 2QCOA 3DTKA 4II2A 3WG9A 2VLAA 4PUSA 3J7AO 1IUFA 3CUOA 4F93B 1D3YA 1JE8A 1TQIA 1PP7U 2HR3A 2KJBA 2AXTC 3OYMA 4XRSA 1R7JA 4M9XA 3J80Z 4FE7A 5ERIA 2VUMJ 2RC4A 3E5XA 4IXAA 1A35A 1MZBA 1T95A 3S8PA 1HDDC 3OYNA 1MBJA 1FBQA 2XGCA 1QZZA 2YX7A 3BG3A 5EZHA 3AFHA 5JFRA 3FBIB 5J1YA 1FLIA 2ZMEB 1R00A 4I2OA 3RQIA 4A69C 1J9IA 2NXNB 2H8WA 2F4IA 2CJJA 4I76A 4Y4RA 2E5NA 5LD2C 4ENNA 1U3EM 2DK8A 4LMYA 1I6HJ 1W4MA 5FKLA 4X1EA 4AIKA 4M9SA 1VQMI 1RUNA 1U0JA 1X19A 3PNYA 4D7NA 4D0PA 4XOTA 2W84A 5LEJA 5A2QZ 4E7KA 1WGXA 1ITYA 2OCCH 3OYAA 3LSHA 2EBIA 2X1EA 3OYLA 1X1AA 1ON2A 3CQZJ 3RZDJ 5D5XB 1QZEA 4ESJA 1UHMA 3S2HJ 2PLYA 1RI7A 2QZ8A 2VKHA 3IV5A 3L2UA 1D1CA 4AVPA 4HDVA 3WTUC 1I39A 3H35A 3SYTA 2NYXA 1XCBA 2EZIA 3ZQFA 3LAJA 1W36C 4RDUA 2VXZA 3KYDB 3S32A 1E17A 4JX6A 1HXDA 4P9FA 3AG1H 2CW0F 3FKJA 2E1CA 2ZXWH 4ZDLA 1U5TC 4PFOA 4N0BA 2QYOA 4XR6A 4B43A 2XSDC 2Z16A 3CO7C 1FSEA 4ZZLA 3JTGA 1P9QC 3DKXA 1K7AA 3AG2H 2O8KA 4UVCA 1B72B 1TW3A 4KDPA 1ZG3A 2LREA 1LEAA 1I5ZA 4GXOA 3PJRA 3VOEA 5FFZA 2DDAA 2DT5A 2UV1A 1R4NB 1VQ4I 2QKMB 1M1EB 3K7AJ 3KPHA 4PCQA 3AL0B 4X6AJ 4DJAA 1ON1A 4ZDOA 2MSYA 1Y1WJ 3CJRB 4B09A 5E3MA 3DPLC 2COMA 1UG2A 5JLXA 1DPRA 1FT9A 4MEXF 3DU5A 2E35A 1W5CC 5H6RA 1WQ2A 1R4MB 2D1HA 5F08A 2Q0OA 2OZ6A 1WJDA 3TDZC 2DA5A 2FNPA 3WGIA 2DFIA 3F8CA 3OYKA 2XGEA 3ZQHA 4Y52J 1Z6TA 2O6GE 3HGYA 5D5VB 2ZCWA 3CCSI 1VQOI 1OCTC 2IA0A 5B66C 2LFBA 4YRVA 3F0CA 1VF9A 4G94A 3L2RA 3IP4B 2LLKA 1IXCA 3CESA 4N4NB 3RIRA 1X1CA 1USTA 1T39A 4V2FA 3U1KA 1VQKI 1LFUP 2R7XA 4AU7A 4KT5C 3HC7A 1I1GA 5EEHA 2L4AA 1LDJA 1BI1A 4BQOA 3K0LA 4DIQA 1SAXA 2XPWA 1LJ9A 3O3KA 3ZRGA 5LGUA 2ME6A 2JN6A 2HYJA 2XKOA 1IW7F 4CCLA 4U7DA 2QLZA 4PJNA 4IHTA 4AWXB 3TOAA 3H3UA 5LEKA 3OYDA 1I3AA 2DCEA 1Z3XA 1D0XA 3LWFA 2R7SA 1HKSA 3ZMDA 1Z7UA 3DBRB 3LQQA 4BDZA 1QPMA 2BOLA 2WBMA 4NB5A 2FSWA 3Q3SA 2QM3A 1Y1VJ 1PP8F 3LA3A 2JPBA 5H6QA 1NTCA 4RB1A 3R4KA 4QSHA 1MIJA 2EZKA 1ETYA 3M1CA 1MDMA 3BR6A 5M5XJ 3K70D 5K7FA 4N9IA 1KU9A 3D5RC 1DDNA 4B47A 4MTEA 4XKVA 2XDVA 4B44A 1R23A 4NDLA 4QTRA 3IH4A 2JVHA 2LYCA 3QAHA 2I10A 2ZMEC 1I6XA 1LNWA 2OPTA 1UG0A 4HLYA 2E2HJ 3VPRA 1LUJB 1Z6RA 3VYUB 2CUFA 5DUIA 2ZJ2A 1ZK8A 2L4MA 2DQRA 3CLOA 9ANTA 2OQRA 4BXFA 5LHIA 3KP2A 3ABTA 2O9LA 1QA6A 5IT9Z 1FYKA 3DQVC 5ED4A 2CV2A 4MFDA 3BG7A 1CF7A 2B7EA 2TDXA 2BGCA 1JI8A 1S29A 5DV5A 2X6XA 5ILSA 3CJQB 2CYYA 4IHVA 3FXKA 2CS3A 1BI0A 4L9NA 5JHUA 4A3FJ 2QQAA 2QQ8A 4DGWB 4GRIA 4IEJA 4EM1A 1ZR4A 3IC7A 1GXQA 3GLLA 4HPQA 3PSFA 5HLGA 2V7FA 1FWZA 3GW2A 1YTYA 2EA2A 2V4JC 4XK4A 3KZZA 4H0EA 1O57A 5GPCA 2LNBA 3BDDA 3MKWB 5E20A 4RGRA 2ELJA 4E6KG 2CFXA 3M4OJ 3VYTB 3WGHA 3MKLA 1WZ2A 4D5FA 3H5AA 2P7CB 4RLFA 1ZLKA 3TDUC 1LKXA 2PG4A 3EUKL 4NHJA 1MJBA 4HG2A 1XD7A 5LFAA 5KAIC 4YIRX 3F8NA 4U7BA 4A3KJ 1ZGAA 4J19A 3OS0A 1SANA 2WB1N 3SFZA 3M7GA 3GXOA 5FO5A 3WE2A 1ZRFA 3HUGA 1QZYA 2P0WA 2R7FA 2DN0A 1Z05A 2L7FP 1X1DA 3ZQLA 4MTDA 3BPXA 3GEZA 1XG1A 1YJ9I 3LL7A 5IYCJ 1E3OC 4LG3A 6PAXA 2K5CA 1BJZA 1MH3A 1BOBA 1X3UA 2VBXA 2EILH 2W4SA 3J80K 2ZFWA 2FA5A 1GDTA 2OCEA 5E3OA 4HNTA 2M4GA 3S2DJ 1N75A 5DCMA 1R49A 2ISZA 3CF2A 2BYVE 5CVRA 4FQGA 2XF5A 2P4WA 2VC0A 1QRYA 4LIUA 1OCCH 3W2AA 2Z2SB 1SFKA 4LLNA 3RDIA 3CUQA 4KUMA 2I5UA 4PJ0C 5E18F 4JBAA 4ZYAA 2OD5A 3ZPLA 1BIAA 4O3MA 5IT9K 3QPSA 2W00A 2DK5A 3LSPA 1XSXA 1B59A 2CGPA 2GBYA 3ZP5A 1X2MA 2Z99A 2V1DA 3PUBA 3O8GA 3KYLA 4G12A 5FFXA 1LE8A 3CCMI 3DTEA 4UVBA 1PUFB 1PYVA 2V79A 2DPUA 2JA7J 2FBKA 1P4AA 1S6LA 4UV8A 5M3MJ 1DP7P 3D1NI 1VQ8I 3MVPA 5D8LB 1BOAA 1GLNA 3Q0WA 4EV0A 4A5MA 3HBLA 3BTJA 5HOOA 3DU6A 2Z5UA 1B72A 4IOAF 1F43A 1B9MA 4IOCF 2HOTA 1TZLA 1ZARA 3BR0A 1BIBA 1SFEA 2X48A 2MD5A 2A3SA 4N9HA 2DA6A 3H3VK 5CLSA 4XIDA 1HSTA 2MLKA 4RAZA 3PUFA 4G7OF 1R5ID 4M74A 4CXFA 1JHFA 1YQAA 3ZN1A 1W1WE 3Q0VA 2MD0A 2OBPA 2FBHA 3IRRA 1H89C 1MBHA 3ZGKA 5JVGF 5K5QA 2EIJH 3ML6A 2HI3A 1IRXA 2P8TA 1T0FA 3TKYA 2KFDA 2L9RA 1H9GA 4BEHB 4OMZA 2V1XA 5D5UB 2EINH 4HF2A 3QPTA 2R0QC 1ZTRA 2R5YB 3KP3A 3DKYA 3K69A 5CVUA 3L2VA 2DBBA 2HFHA 2M4KA 1LPQA 2RKHA 2JTVA 3MZYA 4I0AA 3FXQA 1N77A 3GYHX 1V5FA 4YEJA 2VJIA 3GTLJ 1GVDA 3CP2A 4L0ZB 1TWCJ 3KE2A 2H1LA 4CZZA 5L3EA 3M3YJ 1MMNA 1MMSA 1JT6A 5HS9A 1SVLA 5JR3A 3K2AA 1WJEA 1E3HA 3RZOJ 1OISA 1SVMA 1ZGJA 1WSUA 3GCMA 4U0YA 4RB0A 4WXCA 2HOSA 1A04A 5KHDA 3K4CA 1T08B 2X1DA 4HYEA 3A4CA 2DA7A 1YJWI 4XRMA 4A12A 1R5GA 1Z1DA 3F8BA 1DP3A 1NH3A 1FIPA 1PVEA 3L2CA 1K61A 4BJ6C 1KQ9A 2COBA 2TRTA 3I71A 3MD2A 3FXRA 5HS7A 1XTAA 5K7HA 4ZC3A 2HDDA 2HDCA 2JMWA 4BNCA 2ELKA 1WH7A 3HXLA 3ZQQA 2IBDA 2GOMA 3K70C 2DMNA 4F52A 2MH9A 4HSTA 2HPMA 3ZMTA 1I1SA 2O8XA 2H6CA 4DYCA 2DJNA 5J8CA 1J0RA 3CJTB 1MSFC 3OSGA 5DUKA 1J59A 4B3AA 4UXNA 5F04A 4FISA 1LVAA 4TV7A 3OYGA 3IWZA 3ROUA 5E17F 4A3MJ 2M0CA 4XRFA 2AO9A 1HCRA 2GWRA 4F92B 4I98B 4Y15A 3PSIA 3RKQA 4EJUA 3CCVI 2IA2A 3K4KA 3GZ6A 3WG7H 2IS4A 5TISC 1YE9A 4U0WA 1P6RA 2XVCA 4HW0A 5L3GA 5HVQC 1GV2A 2ZO4A 2HTJA 2RDPA 4XKBA 3U21A 1XMKA 1BBYA 4PDKA 1F36A 2HU9A 3WTZA 1RRJA 1K6YA 3KETA 2J5OA 1IDZA 3ZQGA 1S7AA 2R7QA 2MBFA 2KRCA 2V1NA 2O61A 4BYYA 1L3LA 3FXUA 4BJTA 3CCRI 3N4MA 4I01A 1BC7C 1L0OC 3HB9A 3I59B 4XN3A 2HXIA 4O6JA 4RGUA 4I02A 3CTAA 4LK1F 5EGOB 4LG0B 4L18B 2FU4A 5DTDA 1T98A 2E36A 2ZBKA 1H88C 2E1OA 4M6XA 2NS0A 3P9IA 1T6SA 3GZNB 2FQ4A 5EYRA 2AQFA 4IHYA 2FD5A 2X85A 5FKOA 5E8IA 1IG7A 5F0FA 1MBKA 2QQ9A 1IRFA 1D0YA 5KCMA 3CMYA 2F4MB 2JQ7A 4I6ZA 3TP3A 3I53A 2BXYA 2BY3A 1TP4A 5CVVA 3HOXJ 4ENKA 3QU3A 2ELHA 3CCUI 1UCRA 2GIZA 3EUAA 1YFHA 3MZ8A 2HQAA 3F21A 3HHHA 1JKRC 4UY8I 1OYWA 3MN2A 2HTSA 2P7VB 4CUGA 1XN7A 3ASNH 3EQLF 4YELA 1WJ5A 5D6EA 5B3SH 5DCMB 1W7PA 2R7RA 1XSDA 2BBYA 4A2UA 5FJ8J 1J75A 1SC7A 5HS8A 3QP6A 4NBQA 1OLTA 5GTIC 1FYMA 3BZ6A 3WU2C 4CCMA 2X0LA 4NC7A 2F5FA 4RAFA 1A36A 4G6TB 3OWTA 3K6GA 2GZWA 3E5UA 4KICA 1AWCA 3FXMA 2K9MA 5FKNA 5D6FA 2VB6A 5L3FA 1MJAA 5IT3A 3KEOA 4G6QA 4HEA2 4EJOA 5TGTA 3IAM2 4ZDPA 2A07F 4G9YA 1JKOC 2LP0A 3IKVA 3GTMJ 4L9TA 2LBFB 3W6JB 4CCNA 1JUPA 1BW6A 4NNJA 3U9GA 4A6EA 4BACA 1BN5A 3G4SI 4KIBA 1WWXA 3H0GJ 4Q5SF 4L9JA 3BZCA 4NC8A 4D9JA 4PK4A 2XASA 4P1WA 2GA2A 5J4VA 2AHQA 4I7HA 3AAFA 2M2EA 4ZYGA 1TL8A 2V9PA 2KHMA 3JSPA 3OS1A 3OR2C 1OQYA 4F55A 2D2WA 2KMUA 3UNGC 3LNQA 2QENA 1B8IB 4IHSA 4GO1A 1RUOA 2Y48A 2H09A 4A0XA 1O7FA 4RS8A 4EJWA 3QODA 4DYQA 3FXOA 3DV8A 4U88A 3H92A 4OIRF 1SD4A 2EV0A 1BJAA 4G7ZF 2R5ZB 2PJPA 4Z6YA 2R7TA 2W7NA 3GVAA 3CCEI 3ABMH 5CPRB 1NHAA 3FHNA 1DUXC 1TWGJ 5E1XA 1D5VA 2MC4A 4L5IA 2DLLA 2XPVA 4XNFA 1YHQI 5FKKA 2HVQA 1ETOA 2DTZA 5D5WB 3KCCA 4UB6C 3VDXA 3OYIA 3BROA 2ME0A 4P5OA 4EVIA 5F0HA 1XX5A 2E19A 3HDDA 5D4RA 3HEFA 2DA2A 1J09A 1KA8A 2VQLA 1EF4A 2HQ5A 5FRNA 3AG4H 4GYIA 3D0SA 4JQFA 5LBQA 2M8GX 4BAYA 2GA1A 4XM3A 4HOBA 4L5JA 2IRFG 2L2OA 4YFNF 3CJNA 3L7WA 1HW5A 3HSFA 4Y33A 5A2QK 4X0GA 2FQ3A 4XRSG 1GXPA 5F0CA 4HDUA 3VYRB 3NQOA 2A69F 4XLEA 5K1YA 1SEUA 2HVRA 5IPAA 2JUCA 4PSXA 3CC2I 2OJED 3J7ZI 2L3DA 4OINF 2IS2A 1V5EA 1FP2A 1KU2A 3FIWA 3K1NA 4RM3A 1R1UA 1YW7A 3QWLA 2V1UA 1VNDA 4A3IJ 2PJRB 2V6CA 2PI0A 3K10A 4DBQA 3I4NJ 1SFOJ 2JSPA 1U8BA 3H3ZA 3V8KA 3TQNA 4B4CA 3HOUJ 1VQ7I 1ERDA 4IQJA 1Z77A 2KLOA 3TOBA 3JRBA 2E5ZA 1WJBA 1BI3A 4KMUX 1Y0NA 3P7NA 4IKFA 2RNJA 3HOYJ 5E1WA 1S3JA 3G6EI 4D5CA 2P5KA 3JAMK 2R7OA 1HBXG 1XPXA 2A68F 2XUBA 3C18A 2KIUA 2OA4A 4M3EA 5IOYA 4BXUA 1K4TA 4E70A 3NRVA 3CF5F 2RV8A 4CICA 2X6OA 1JGGA 3QPHA 1X2NA 1X1PA 3OYBA 2QF7A 1FMWA 2L9NA 3ISPA 4YFXF 2LTPA 2Y69H 1GVJA 1O3QA 4OAZA 2DT7B 2KL4A 4R8HA 3DWLE 4FT8A 2KRHA 4BXXJ 1HF0A 2ECBA 3W6VA 1VI0A 3PM1A 1BC8C 2XPUA 4ZTJA 1ZQ3P 2WC2A 1RESA 4P96A 4DZJA 2LRDA 2K40A 4KT6A 2K4BA 5CYVA 2L9VA 4E7IA 2CW8A 3HM5A 1JT0A 3OY9A 4LD5A 2BVLA 2UUZA 2H6BA 2VODA 3ESWB 1T33A 3S15J 4PGHA 1MW7A 2F5EA 1LEBA 1BR1A 2DA1A 3T0YA 5FKMA 3JW4A 3I64A 2JRMA 2EFOA 1FP1D 5F27A 5IP6A 2HS5A 1EKEA 2DFHA 3I59A 3M8FA 1REPC 3FKIJ 1H9TA 2ESHA 2NVTJ 3RCOA 2ZXHA 2L7KA 2E2IJ 2XB0X 2Z1DA 4IZZA 2QGUA 4IRGA 1Z9CA 3F23A 4QLCU 4HX7A 4UUTA 2ZJRF 3I9V2 1HDPA 3DKWA 1D1AA 2P81A 1D5YA 3G73A 2VI6A 3OMYA 1DGRM 3I5UA 3CCQI 3HOWJ 3HOTA 2R7WA 2P6SA 2HYFA 2Z3YA 4H4KC 1LDKB 2LMDA 4LGWA 5BPDA 3G1MA 1JTYA 2W82A 1TT0A 3GZ5A 4ABZA 2IGOA 4A3GJ 3KEYA 4HX8A 1HC8A 4JOMA 3CD6I 2QSHX 4IJAA 2XC7A 2EIKH 5J40A 2Z9OA 2OTJI 3BJ6A 4E7LA 3BG6A 1G3TA 2WADA 3GMEA 4FX0A 2F5CA 3F8MA 2DFFA 3E6DA 4ENJA 2IW5A 4KFCA 2PJRA 1WJAA 4KN7X 3CP8A 4PFPA 3RKYA 1NK3P 3ECHA 1OYYA 1K83J 3L00A 3G3ZA 5HNHA 1FY7A 5ICEA 3H9GA 5EG0B 5ICCA 2KT0A 2E7XA 3F6VA 3UKGA 1RETA 3U2RA 2P5VA 2HVSA 3TO7A 2A6HF 2IEKA 5BNGA 3LSJA 2F6CA 3R61A 4C3IJ 3CZ6A 2Q1ZB 1UB9A 4BKXA 1W0UA 1XDUA 2VOPA 3V7CA 1EH7A 1MBEA 4DOZA 2GIVA 2M3AA 2HEOA 1ZHFA 2NOGA 2CSOA 2E1MB 1I3QJ 3N05A 3BG9A 3I58A 3JR9A 2R7ZJ 4CCKA 3HOZJ 3BJAA 3DBHB 4I09A 5DCFA 4XSXF 2F4OB 2M34A 2C6YA 1RZ4A 1MBGA 2F48A 2YUSA 5HDKA 3ULQB 1I27A 2W48A 3I4PA 2W1OA 1JKPC 3ONQA 3HZJA 3V42A 3WHCA 2Y0MA 1FYLA 4E7SA 1HOMA 5HLIA 2K27A 1DQUA 4MO7A 2PMUA 2K02A 1B6AA 3F3XA 2LVSA 2WAFA 3MQ0A 3GTJJ 4PJMA 2G7UA 5EZGA 4LITA 2X51A 3JSOA 5FLXK 3HL2A 3PQJA 4G7HF 5LHGA 3CO6C 2WA0A 2G7HA 2K4JA 2FJ1A 4HAMA 1EH8A 3FHZA 2LKSA 1FC3A 1FZPB 3FXJA 1H8AC 4MQVA 4N4OB 3WTSC 1U2WA 1IN4A 1LQ1A 4BQAA 2EIMH 2ESNA 3BR3A 5IY5H 2RN7A 4AD9A 1D8KA 2XKPA 3Q0UA 2BHYA 3HRTA 2YU9J 2FMLA 2FOKA 2BW3B 3R0JA 4OIPF 4ZTFA 1R58A 4WXDA 2OUMA 3U1DA 2UWMA 1X4OA 2XAGA 1BR4A 2I8DA 2CQXA 4II3A 1AKHA 1QU3A 2E1NA 1JJ6C 1H0MA 5J8FA 3L09A 4LIVA 3KEQA 3SXYA 3WHBA 4B8XA 2J5PA 5KAFC 4A3JJ 4LOCA 4DNCA 3C2HA 4S04A 3OYFA 3SFIA 4OMYA 4G8XA 2V26A 3BOQA 1A6QA 2HNHA 4JYKA 2IVMA 2DMUA 1N25A 1FBUA 2CFOA 5EGOA 1TC3C 5BQTA 1PUFA 1WHUA 3A1YA 2JA6J 3WODF 2GXGA 1POGA 2HYGD 1E0EA 4XSZF 1XMXA 5B1AH 3LA7A 3MZHA 1RIOH 5F64A 4KNYA 3B02A 4C2TA 4XICA 3ABLH 3FBNB 4BHBA 1FNNA 4LB5A 2L01A 4PSWA 4HA8A 1TTYA 2MA3A 5EDNA 3F9KA 4NQWA 1XCVA 1KYWA 2KP6A 2L7MP 4LJZF 3RQ4A 2ZKZA 3LMMA 2BE5F 1RKWA 5J6XA 4E4HA 1HA8A 3OR1C 2BZTA 2LC2A 2CMPA 2M1BA 3LSIA 5EF6A 4IF4A 1O3TA 2JA2A 3CDHA 1BA5A 1XC5A 2CH0A 5GPAA 3IAS2 2XRLA 1TWFJ 3QYFA 2VKEA 1O3RA 2EFNA 2EFPA 4A6DA 1IC8A 1WJFA 1X4PA 3BC8A 4RGXA 2VONA 3ECOA 3G2BA 4ESFA 2VT3A 2X1CA 2QVOA 3V7SA 3IHUA 1G3SA 2KDOA 4CA0A 2QQBA 4E7JA 2VT2A 3C3WA 2A6EF 1Z67A 3R0AA 4M73A 1WJCA 2Y31A 1TBXA 1Z7LA 2XGDA 3DEEA 4M3FA 3F8FA 3UR3C 3QRFF 1XGMA 1B1BA 1LB2A 1YW9A 3HKZN 4C3JJ 2QA4I 1V3FA 3BZKA 3TGNA 5KNLA 5LHHA 2KZGA 1TLHB 4Y17A 3CLQA 3I54A 4QPOA 3LAPA 1S7OA 1IN5A 3L1PA 4AIHA 4EMSA 2HWVA 5ILVA 2ZXIA 2O03A 1R22A 1VTNC 3E0JB 3PFYA 3RJPA 3WU0A 4OIQF 3A02A 3OYHA 2E71A 4M9ZA 3T8RA 3F22A 3FMSA 2HQNA 4HNVA 2FOWA 2KJCA 2OZUA 4BUPA 3TP0A 4KIGA 1XDSA 2Q2EB 4RMNA 3ZQCA 1F9NA 3D5SC 1CGPA 1MBFA 2MGQA 2D5VA 4BHPA 1UJ8A 1FTTA 4NQWB 1U5TB 4FX4A 1G3WA 4KISA 2VKVA 3DCFA 1YLFA 1YIJI 3S1NJ 1KQ0A 3T1BA 4BL0B 1SD7A 3EYYA 4GDFA 3JREA 4IHWA 4FTHA 3DEUA 2QEXI 1ZGWA 4ZYDA 4AIDA 4CSWA 3QYBA 4B1RA 2R5YA 2WWYA 3VYSB 4BEHA 2CUZA 3SEQA 1K78B 3S14J 3FISA 2HZDA 2K3PA 1HQCA 4UHTA 1LDDA 3DLLF 4KITB 2HGCA 2PFBA 5HDGA 1MKMA 1TQPA 2EA4A 2ZNYA 3QP5A 4MIMA 2XAFA 4A3CJ 5L3CA 2CG4A 2EZHA 3SHFA 3L2WA 4BU2A 4XL9A 1YIOA 1WCMJ 2K9NA 1OCPA 4MEYF 1FOXA 2NVXJ 3OOPA 5E8GA 2OTLI 1IXSB 3KLOA 4XQFA 3JRFA 2O5RA 2LY9A 1XB4A 3LFKA 2WB1A 2Y0SN 3W2WA 4BE2A 4LLGF 4Q47A 4F7ZA 2VN2A 3PIOF 2XAUA 1GHCA 2IS6A 2CV0A 4EGZA 1J7KA 2O3FA 3SZGA 1FBSA 4HX4A 1AOYA 4PJLA 1Q1VA 2GAUA 3QOEA 2CRGA 4MFEA 4P9UA 3K1MA 4XOPA 4CYCA 4V19K 3RPQA 4IHXA 2RQQA 4KJZA 2Z33A 3JTHA 5EJCA 3GLXA 2KZVA 3FWEA 3V4GA 3SZTA 2IGKA 3H5RA 2FX0A 2ID3A 2XAHA 2DMPA 1EJ9A 1O4XA 5BPIA 2B9SA 2MH2A 4YIIA 1RC9A 2XF7A 1S8NA 3BTIA 3T5XA 1G59A 2Y0SA 1QHHD 2JA8J 5DDGA 4RAYA 2N8GA 3K9TA 2ZNZA 1SMYF 4CCOA 1FTZA 3SZPA 2DQLA 1U5TA 3IUOA 4C9YA 3TO6A 3KZIC 4MGRA 4HF1A 3KP6A 1ETKA 3MWMA 5IP9J 4DQ2A 1IO2A 2LDUA 1SFUA 1V55H 1R5HA 2F5DA 2NNYA 3IL2A 1VFCA 3FMQA 4BE1A 2X9DA 2FF4A 1LVKA 4MLOA 1RKTA 5H2FC 1FIAA 1T0FC 3EPZA 3BY6A 3F72A 1HLVA 2B0LA 3BP8A 3E5QA 3GO5A 5DS9A 3EYIA 4KN4X 4HNUA 3VB2A 2PMZA 4AVZA 3HPGA 1Z91A 1ZR2A 2M9HA 5FD5A 3Q9VA 1QBJA 1P2FA 2NS7A 1R36A 4W1UA 5E1ZB 1MSEC 3ZMSA 2HZTA 4DYRA 2MW8A 3LSRA 3PO2J 1U9NA 1MJ9A 4EJVA 4UVAA 3RPUA 3TMOA 4M71A 3I56I 3M8JA 2EH3A 3W3CA 5C4XJ 1OCOH 3DEWA 4Y3OA 2GXBA 1ETQA 3TL4X 1ETVA 1X3ZB 1YG2A 2IA1A 5L3BA 2W57A 4UUSB 2YSRA 4RB2C 2E34A 4V2GA 2VBWA 3ASOH 3B6CA 5JI6A 2RREA 1C0WA 2LG4A 2F5VA 2L0KA 2RQPA 3A01A 1IV6A 3ABKH 4U87A 5FLXZ 3HJEA 2RVCA 2IPQX 3LOCA 1YRNA 1Y6IA 2ADUA 2K9LA 2A6TA 3DTIA 3RYRA 1TWHJ 1MNDA 3GX4X 1SFXA 2CQQA 2R4GA 4FCYA 2JA5J 4M6VA 5AONA 2PMHA 3QYEA 3ZQ7A 3JRGA 3BR2A 5LRSA 3G71I 2H94A 2ZJQF 4HLXA 1ZRCA 4BY7J 2FNAA 4AYBN 3BTCA 4RM2A 3RI4A 3I4MJ 3NAUA 3PFIA 3CUQC 2LY1A 3K4JA 1X3WB 3C2BA 3JCUC 2NVQJ 5HLHA 2QUFA 1XGSA 3GFMA 3BCBA 4EQQA 3HOSA 2FXAA 2NAZA 1WI3A 1TNSA 3RPUD 3V8LA 1QVUA 2IJLA 3WE3A 2DO7A 5IOZA 2CU7A 3M9AA 4F3QA 3ZMZA 5D8KB 1B9NA 3H36A 3Q9SA 5FD6A 2CQ7A 1QGPA 3WTVC 3BR5A 3JRAA 1ODDA 1G2HA 3S17J 2HXOA 3ABUA 2M5WA 2CUEA 3WTXC 3ZQIA 5TRDA 3KFWX 3BPVA 3HPHA 5CVJA 3TW7A 2LR8A 2XGXA 4M3GA 2K3FA 2MFZA 1Z3YA 1GUUA 2VE8A 1EH6A 3C2GA 2ETHA 2VXDA 2DOFA 3GTQJ 1IRZA 2D1VA 1HW1A 2OAZA 3OSFA 2VC1A 1W0TA 3S16J 4UUSA 1QHGA 3G1LA 3P5JA 1IAWA 2JSCA 2VBYA 3CCYA 4IQ4A 5BOXA 1Y56A 5FB2A 5J1UA 2BY1A 1NK2P 1QVTA 1E2XA 3WTTC 3J7YJ 2ZFUA 5J47A 2M87A 3IRQA 4A3BJ 3RKWA 1VQ9I 2ZXJA 2DYSH 2ECCA 5KK1A 3FMRA 3D5LA 1ZN2A 2FE3A 3SDBA 4D1QA 1A6IA 2HPIA 2NNNA 3PL8A 4YFKF 3VODA 3B73A 5FROA 1KQ8A 5EG0A 4U0VA 1FSHA 4BHCA 1W5SA 5HNFA 2Q8KA 4KMFA 1Z0XA 2DJIA 2ZSIB 2A5YB 2LKPA 2VQCA 2OF7A 3BJOA 4BH9A 3OS2A 4HQMA 5J3LA 3QQAA 1T38A 2K9SA 5HDNA 3PO3J 3CCJI 2VQGA 1DU0A 2VPRA 4BBSJ 3A0BC 4CH7A 4D7MA 1N78A 1AU7A 2DFEA 4EGYA 3K2ZA 3S3MA 2GOXB 1UHWA 2WAEA 2VOOA 2NS8A 3S93A 2AXLA 3HTUA 3VEPA 1OJLA 1VQ6I 3LFUA 2QBYB 1DPUA 2GQQA 2ICWG 4EATA 1MDMB 4DZPA 1R9TJ 4KIFA 3OL3A 4GYGA 5AIPA 4MHGA 1FOYA 3FX3A 2XHKA 1YI2I 3FZVA 4IL6C 1U78A 1OR7A 2HOEA 1VZ0A 1P92A 1XGNA 2ZJPF 2F2EA 2BV6A 3MEXA 2XAQA 1YW8A 4JP0A 3BWGA 1ETWA 1GV5A 4IVNA 4BBRJ 4P55A 1UMQA 2W24A 2XB5A 2K9QA 3OOUA 2DOAA 2K7LA 4BDYA 1Y8QB 4XLNF 4E7HA 2IGNA 4YIFA 3OIPA 2XROA 5M3FJ 3FF5A 4G6DA 3H9QA 3ERMA 3W6KB 3ZMUA 1U8RA 3VWBA 3Q5FA 3GTPJ 5AIQA 1JGSA 4M6YA 4OU0A 1G3YA 3F6OA 4A0ZA 2VIXA 3EUHA 4CYDA 1RPWA 5EEGA 1G6NA 2EFQA 1JXSA 4BE0A 2O7OA 3E1SA 1R6RA 5DM7F 2LD5A 2LY2A 4EEFG 1LFPA 3QU6A 3GWZA 3K4NA 4WX9A 1KYZA 2DAOA 1MMDA 3ZMVA 2LKXA 2CV1A 2KIFA 3M07A 1D1BA 3OL4A 1O7LA 5JHFA 3ZR8X 1ZAOA 2QWWA 2FUG2 3X2QH 2V6EA 5LGTA 2P5LC 4ASNA 4FE4A 4IPAA 1ULYA 3J81Z 4UNOA 3A03A 2BEOA 1Y8RB 4UB8C 1J5YA 3DP7A 1XSVA 2VJ4A 3GF2A 1IN6A 2JK3A 2PQ8A 2IXSA 2HKXA 4ZH4F 3JRHA 4XLAA 1Y0UA 5JVTA 3GFJA 5C4JJ 2L9SA 1UAAA 2ZC2A 2BXZA 3AKZA 1TQMA 4KA4A 3T8TA 3V7RA 4AIJA 3H5NA 1YOVB 4ZYHA 1JUMA 1S72I 1XMAA 1R1TA 1UZCA 1ZELA 3H0DA 2DMTA 2XSJC 3L9FA 1IUYA 3SJMA 1BM9A 2XIGA 4Q48A 3CMEI 1TW2A 3JAMZ 1FMVA 5DD4A 5EEAA 5E79C 5IYDJ 2H27A 3G1OA 2AQEA 4OAYA 2V9KA 1RNLA 2TCTA 2L02A 2CQNA 2WY7Q 4ITVA 1BW5A 3AG3H 2E60A 5GP9A 1DGWY 5C3EJ 5CQGA 3WGGA 2PMZN 1ZYRF 5GTHC 1GT0C 1QQIA 5DD8A 1IDYA 4KYWA 2NVYJ 3MMYB 2MLGA 4R79A 5LLQA 3S1QJ 1IGNA 4HRIA 1K4SA 1OFCX 1W7PD 3DF8A 2CWEA 2CW7A 3BQYA 4EM0B 1G8XA 3PNTA 2KQRA 3GTKJ 3QOPA 2M8EA 1YRNB 3TO9A 1QPIA 4S05A 3KX2A 3ZN0A 1Y39A 4CHUA 1F1ZA 1VQNI 3BTLA 2DMQA 4W97A 2HQRA 1VQLI 5DM6F 5J4YA 4O5VA 3R60A 1Z21A 2ZB9A 4HSRA 3HOVJ 4XKCA 2JUGA 2DI3A 1HSJA 3S3OA 3HUGB 2EV6A 3VSKA 1OCZH 2JPCA 2NOJB 3HYIA 1UELB 1UHSA 2KKOA 1IN8A 3DLAA 1OR7C 2VQHA 2PN6A 2ACJA 2XF6A 3B6AA 3H1CA 3ZCOA 3CC4I 4NC6A 4QPQA 1B8IA 4LB6B 4C3HJ 1LE8B 3K1PA 3PQKA 3LSMA 2DODA 4RB3C 2B63J 1U9OA 2H1KA 2R7VA 2R5ZA 3K4MA 3I0TA 1RR8C 1STZA 1IV8A 2LK2A 1ACIA 4CGZA 4PGGA 3SDGA 1K79A 1YYVA 2EZLA 3VSLA 4WK8F 3KP4A 2R3SA 3EDPA 1W36D 1K78A 4IX7A 4UUVA 1G4DA 3R6SA 1FOWA 1YO5C 4HV5A 3PIPF 2D45A 1PDNC 3K4LA 5K5RA 1IN7A 2Y2ZA 1TT5B 1ZREA 1AA7A 1YX5A 2VKDA 1ZKGA 2X6WA 3CDLA 3P9KA 3PNVA 3FM5A 4XONA 4IRHA 3DBLB 4F91B 3K4BA 1MH4A 2O0YA 3FDYA 4XN0A 5GAHJ 5LRRA 1QO0D 2E2JJ 4BS9A 2VE9A 1JKQC 1FX7A 4RGSA 2QKLB 3GFIA 2EJRA 1ZG1A 1MNMC 2M0MA 5HLTA 1ZH5A 1JHHA 3HRSA 3I3LA 3OYEA 2BY2A 2UXNA 2VJJA 2YX4A 3O8HA 1NG7A 2IGMA 2WAQA 1OKRA 2R7DA 5GAEJ 3RSNA 3RTRA 3M8EA 3ZOBA 4RA2A 4E7ZA 4C2UA 1FPQA 4A5NA 2YS9A 3GUDA 1VQ5I 2HKOA 2MC3A 4IRIA 2R93J 2K85A 1FJLA 1ETXA 2YU3A 3ERED 2QSGX 3S1MJ 1A5JA 2JVGA 2ZMEA 5F1JA 4RBOA 3GTGJ 1SMTA 2VL8A 2RGVA 1HKTA 3O6BB 3NWTA 2E7WA 4GFBA 3LA2A 2DTRA 2STWA 2LF7A 2QSFX 4ZZDA 3SEZA 3LQRA 2IAIA 1YS6A 2OV7A 3HSRA 1RR7A 3SQNA 1WKMA 4BJ5C 5ICGA 3S1RJ 1X1BA 1KU3A 4WF2A 4FETA 2L7ZA 4BGDA 2KIQA
chains in the Genus database with same CATH topology
2L54A 3E3VA 4GCVA 1EV7A 1MGTA 3M1EA 1P4XA 3V8JA 1MD0A 2EV5A 2WV0A 1XGOA 3ELKA 2STTA 5CJ9A 5LGNA 2PEXA 2W85A 3WTYC 2QBYA 2EWNA 1U6GA 1WI9A 4LK0F 2NRAC 3DFGA 1OYIA 4WXHA 1IF1A 3VFZA 3KP5A 2DPDA 4MQ9F 2Q2EA 3HHGA 4R1HA 5BMZA 1PUEE 2EB7A 2Y75A 1D8JA 1ZG5A 1F5TA 5BS6A 2FBIA 5F6FA 1B4AA 1R1VA 3HSEA 4HV6A 2YPRA 5F1RA 5L3DA 4HF0A 2CO5A 2EK5A 3IKTA 1J2XA 5FGMA 3KP7A 1ZLJA 2JRTA 2EFWA 4CDGA 5DEQA 3COAC 2KRFA 4LFUA 1T2KA 4LLLA 3HTSB 3E6BA 2IT0A 4EM2A 1O3SA 3P9CA 4UV9A 3C7JA 3O2PE 4I0BA 5DYMA 3DPTA 2UXXA 3MFKA 2WTEA 2DW4A 1OMIA 2JZYA 3KLNA 2XRNA 4OOIA 3E6MA 2JT1A 3J81K 2OU2A 3KZYA 5K5OA 2A61A 2VBZA 2FMYA 1HKQA 4ENMA 1W5TA 4ZYEA 4ESBA 3GFLA 1W7PB 3WTWC 3HIFA 3S2WA 4WWCA 2M30A 4OIOF 4ETSA 1IZ1A 1IRGA 1UFMA 3OV8A 1YS7A 4MNUA 2PBIA 4PZJA 3MCZA 3HRUA 3IWFA 3FM3A 4XBFA 4Q4ZF 1FOKA 1KGSA 2K86A 2X4HA 2G9WA 1CF7B 3RYPA 2P6TA 5KVRA 1ONVA 4YG2F 3RKXA 2LF8A 3NEUA 2IP2A 2UZKA 3WU1B 2XV4S 4CO8A 2V9VA 3LSTA 4WCGA 1K6OA 2LSOA 2CQKA 4A0YA 4HQEA 4EJTA 3E6CC 1Q1HA 1TNTA 1V4RA 1F4KA 2KIMA 4HZFA 4L9VA 2YR2A 3REOA 1ZRDA 4LG0A 1SD6A 1BI2A 5TJJA 5CVIA 4M72A 2DU9A 3EETA 4K2EA 1IXRC 3DXJF 5ICFA 2M45A 1OPCA 5ILUA 2ISYA 3N97A 4QWQA 1WRJA 4XLPF 2FRHA 4Z2YA 1USSA 3C1DA 1HW2A 1QNTA 3HRMA 4Y13A 2XAJA 2OQGA 3E97A 3MAJA 3CUQB 4GGGA 2W25A 1SD5A 4JK1X 2FEZA 4FHTA 5D4SA 1KU7A 4L0YB 1P4WA 4ON0A 2AS5F 4HBLA 5H20A 3WG9A 3J7AO 3CUOA 1D3YA 1JE8A 1TQIA 1PP7U 2HR3A 2KJBA 1R7JA 4M9XA 3J80Z 5ERIA 2RC4A 3E5XA 4IXAA 1MZBA 1FBQA 1QZZA 2YX7A 5JFRA 1FLIA 2ZMEB 1R00A 4I2OA 1J9IA 4ENNA 1U3EM 2DK8A 4LMYA 1W4MA 4AIKA 4M9SA 1RUNA 4D0PA 2W84A 5LEJA 5A2QZ 1ON2A 5D5XB 4ESJA 1UHMA 2PLYA 1RI7A 2QZ8A 4AVPA 4HDVA 3WTUC 2NYXA 1XCBA 3LAJA 2VXZA 1E17A 1HXDA 4P9FA 2CW0F 2E1CA 1U5TC 4N0BA 2QYOA 3CO7C 1FSEA 4ZZLA 3JTGA 1K7AA 4UVCA 1TW3A 4KDPA 1ZG3A 1LEAA 1I5ZA 4GXOA 3VOEA 5FFZA 2DT5A 4PCQA 1ON1A 4B09A 3DPLC 2COMA 1DPRA 1FT9A 4MEXF 5H6RA 1WQ2A 2D1HA 2Q0OA 2OZ6A 3TDZC 2FNPA 3WGIA 2DFIA 3F8CA 1Z6TA 2O6GE 5D5VB 2ZCWA 2IA0A 4G94A 3RIRA 1IXCA 1USTA 1T39A 4KT5C 1I1GA 5EEHA 2L4AA 1LDJA 1BI1A 3K0LA 1SAXA 1LJ9A 3O3KA 5LGUA 2XKOA 1IW7F 4U7DA 2QLZA 4IHTA 4AWXB 3TOAA 3H3UA 5LEKA 3LWFA 1HKSA 3ZMDA 1Z7UA 3LQQA 1QPMA 4NB5A 2FSWA 2QM3A 1PP8F 3LA3A 2JPBA 5H6QA 4RB1A 3R4KA 1MDMA 4N9IA 1KU9A 1DDNA 4MTEA 1R23A 3QAHA 1I6XA 1LNWA 4HLYA 1Z6RA 5DUIA 2ZJ2A 2L4MA 2DQRA 3CLOA 2OQRA 5LHIA 3KP2A 3ABTA 5IT9Z 1FYKA 3DQVC 5ED4A 1CF7A 2TDXA 2BGCA 1S29A 5DV5A 5ILSA 2CYYA 1BI0A 4L9NA 5JHUA 2QQAA 4EM1A 3IC7A 1GXQA 5HLGA 1FWZA 3GW2A 1YTYA 2EA2A 3KZZA 4H0EA 1O57A 2LNBA 3BDDA 5E20A 4RGRA 2CFXA 3WGHA 2P7CB 1ZLKA 3TDUC 2PG4A 4NHJA 1MJBA 1XD7A 3F8NA 4U7BA 1ZGAA 3SFZA 3M7GA 3GXOA 5FO5A 3WE2A 1ZRFA 3HUGA 1QZYA 2R7FA 1Z05A 4MTDA 3BPXA 3GEZA 6PAXA 1X3UA 2VBXA 3J80K 2ZFWA 2FA5A 5DCMA 2ISZA 2BYVE 5CVRA 2P4WA 2VC0A 4LLNA 3RDIA 3CUQA 4KUMA 5E18F 4JBAA 2OD5A 3ZPLA 1BIAA 4O3MA 5IT9K 2DK5A 1XSXA 1B59A 2CGPA 3ZP5A 2Z99A 2V1DA 5FFXA 4UVBA 2V79A 2DPUA 2FBKA 1DP7P 1P4AA 1S6LA 4UV8A 5D8LB 1BOAA 4EV0A 4A5MA 5HOOA 2Z5UA 1B9MA 1ZARA 1BIBA 1SFEA 2MD5A 2A3SA 4N9HA 5CLSA 1HSTA 2MLKA 4RAZA 4G7OF 4M74A 4CXFA 1JHFA 1YQAA 3ZN1A 3IRRA 2OBPA 2FBHA 5K5QA 3ML6A 2P8TA 1T0FA 3TKYA 1H9GA 4OMZA 2V1XA 5D5UB 4HF2A 3QPTA 3KP3A 3K69A 5CVUA 2DBBA 2HFHA 2RKHA 2JTVA 3MZYA 4I0AA 3FXQA 3GYHX 4L0ZB 3KE2A 4CZZA 5L3EA 5HS9A 5JR3A 1ZGJA 1WSUA 4U0YA 4RB0A 4WXCA 1A04A 4HYEA 4A12A 1R5GA 1Z1DA 3F8BA 3L2CA 1KQ9A 3I71A 3FXRA 5HS7A 2HDCA 4BNCA 2MH9A 3ZMTA 1I1SA 2O8XA 2H6CA 5J8CA 1J0RA 5DUKA 1J59A 4UXNA 1LVAA 4TV7A 3IWZA 3ROUA 5E17F 4XRFA 2GWRA 4I98B 4Y15A 4EJUA 2IA2A 3GZ6A 4U0WA 1P6RA 2XVCA 4HW0A 5L3GA 5HVQC 2ZO4A 2HTJA 2RDPA 1XMKA 1BBYA 4PDKA 3WTZA 3KETA 2J5OA 1S7AA 2MBFA 2O61A 4BYYA 1L3LA 3FXUA 3N4MA 4I01A 1BC7C 1L0OC 3I59B 4O6JA 4RGUA 4I02A 3CTAA 4LK1F 4LG0B 4L18B 2FU4A 1T98A 2ZBKA 4M6XA 2NS0A 3P9IA 1T6SA 5E8IA 2QQ9A 1IRFA 3I53A 5CVVA 4ENKA 3QU3A 2ELHA 1UCRA 1YFHA 3F21A 3HHHA 1OYWA 2HTSA 2P7VB 1XN7A 3EQLF 5D6EA 5DCMB 1W7PA 1XSDA 2BBYA 4A2UA 1J75A 5HS8A 3QP6A 1FYMA 3BZ6A 2X0LA 2F5FA 2GZWA 3E5UA 4KICA 1AWCA 5D6FA 5L3FA 1MJAA 5IT3A 3KEOA 4G6QA 4EJOA 2A07F 4G9YA 3IKVA 4L9TA 3W6JB 3U9GA 4A6EA 1BN5A 4KIBA 1WWXA 4Q5SF 4L9JA 2XASA 2GA2A 4I7HA 3AAFA 4ZYGA 3JSPA 2D2WA 2QENA 4IHSA 4GO1A 1RUOA 2Y48A 2H09A 4A0XA 1O7FA 4RS8A 4EJWA 3DV8A 4U88A 3H92A 4OIRF 1SD4A 2EV0A 1BJAA 4G7ZF 2PJPA 3GVAA 1NHAA 1DUXC 5E1XA 1D5VA 4L5IA 2DLLA 5D5WB 3KCCA 3BROA 4P5OA 4EVIA 5D4RA 1KA8A 4GYIA 3D0SA 4JQFA 5LBQA 4BAYA 2GA1A 4HOBA 4L5JA 2IRFG 4YFNF 3CJNA 3L7WA 1HW5A 3HSFA 5A2QK 1GXPA 2FQ3A 4HDUA 3NQOA 2A69F 5K1YA 2L3DA 4OINF 1FP2A 1KU2A 3K1NA 1R1UA 1YW7A 2V1UA 2V6CA 2PI0A 3H3ZA 3V8KA 3TQNA 3TOBA 1BI3A 4KMUX 3P7NA 2RNJA 5E1WA 1S3JA 2P5KA 3JAMK 1HBXG 2A68F 2XUBA 3C18A 2KIUA 2OA4A 4BXUA 4E70A 3NRVA 2RV8A 4CICA 3QPHA 3ISPA 4YFXF 1O3QA 1GVJA 4R8HA 4FT8A 1BC8C 2WC2A 4P96A 2K4BA 5CYVA 4LD5A 2H6BA 2VODA 4PGHA 2F5EA 1LEBA 3T0YA 3JW4A 3I64A 2EFOA 1FP1D 2HS5A 3I59A 3M8FA 1REPC 1H9TA 2ESHA 4IRGA 1Z9CA 3F23A 4QLCU 4HX7A 3DKWA 3G73A 3I5UA 3HOTA 2P6SA 2HYFA 2Z3YA 1LDKB 4LGWA 5BPDA 3GZ5A 4HX8A 4IJAA 2Z9OA 3BJ6A 1G3TA 4FX0A 2F5CA 3F8MA 3E6DA 4ENJA 2IW5A 4KFCA 4KN7X 3RKYA 3ECHA 1OYYA 3L00A 3G3ZA 1FY7A 5ICEA 5ICCA 2E7XA 3F6VA 3U2RA 2P5VA 3TO7A 2A6HF 3R61A 1UB9A 1XDUA 2VOPA 3V7CA 1EH7A 2GIVA 2HEOA 1ZHFA 2CSOA 3I58A 3BJAA 4I09A 5DCFA 4XSXF 2C6YA 1RZ4A 5HDKA 3ULQB 1I27A 3I4PA 2Y0MA 1FYLA 5HLIA 2K27A 2PMUA 2K02A 1B6AA 3F3XA 3MQ0A 2G7UA 3JSOA 5FLXK 4G7HF 3PQJA 5LHGA 3CO6C 2G7HA 2K4JA 4HAMA 1EH8A 3FHZA 1FZPB 1FC3A 4MQVA 3WTSC 1U2WA 1IN4A 1LQ1A 4BQAA 2ESNA 2RN7A 4AD9A 1D8KA 2XKPA 3HRTA 2FMLA 2FOKA 3R0JA 4OIPF 1R58A 4WXDA 3U1DA 2UWMA 2XAGA 2E1NA 1H0MA 5J8FA 3L09A 3SXYA 4B8XA 3KEQA 2J5PA 4DNCA 4S04A 4OMYA 4G8XA 3BOQA 2IVMA 1FBUA 5BQTA 3WODF 2GXGA 2HYGD 4XSZF 3MZHA 3LA7A 1RIOH 5F64A 4KNYA 3B02A 4BHBA 1FNNA 4LB5A 2L01A 4HA8A 1TTYA 2MA3A 4NQWA 1XCVA 1KYWA 4LJZF 2ZKZA 2BE5F 5J6XA 2M1BA 4IF4A 1O3TA 3CDHA 1O3RA 2EFNA 2EFPA 4A6DA 4RGXA 2VONA 3ECOA 4ESFA 2VT3A 2QVOA 3V7SA 3IHUA 1G3SA 2QQBA 2VT2A 3C3WA 2A6EF 3R0AA 4M73A 1TBXA 3F8FA 3QRFF 1XGMA 1B1BA 1LB2A 1YW9A 1V3FA 3TGNA 5LHHA 1TLHB 4Y17A 3I54A 3LAPA 1S7OA 1IN5A 4AIHA 4EMSA 2HWVA 5ILVA 2O03A 1VTNC 1R22A 3RJPA 3WU0A 4OIQF 4M9ZA 3T8RA 3F22A 3FMSA 2HQNA 2KJCA 2OZUA 4KIGA 1XDSA 1F9NA 1CGPA 4BHPA 1U5TB 4FX4A 1G3WA 1YLFA 1KQ0A 3T1BA 1SD7A 3EYYA 3DEUA 4ZYDA 2WWYA 1K78B 1HQCA 4UHTA 1LDDA 2PFBA 5HDGA 1MKMA 1TQPA 2EA4A 2ZNYA 3QP5A 2XAFA 5L3CA 2CG4A 3SHFA 1YIOA 4MEYF 3OOPA 5E8GA 1IXSB 3KLOA 1XB4A 3LFKA 4LLGF 4Q47A 4F7ZA 2VN2A 1GHCA 4EGZA 1J7KA 2O3FA 1FBSA 4HX4A 1AOYA 2GAUA 4P9UA 3K1MA 3RPQA 2Z33A 3JTHA 3GLXA 3V4GA 3FWEA 3SZTA 2XAHA 5BPIA 2MH2A 4YIIA 1S8NA 3T5XA 5DDGA 4RAYA 3K9TA 2ZNZA 1SMYF 3SZPA 2DQLA 1U5TA 3TO6A 4MGRA 4HF1A 3KP6A 3MWMA 4DQ2A 2LDUA 1SFUA 1R5HA 2F5DA 2NNYA 3IL2A 3FMQA 2FF4A 3BY6A 3F72A 2B0LA 3BP8A 3E5QA 3GO5A 3EYIA 4KN4X 3VB2A 1Z91A 5FD5A 3Q9VA 1QBJA 1P2FA 1R36A 5E1ZB 3ZMSA 2HZTA 1MJ9A 4EJVA 4UVAA 3RPUA 4M71A 2GXBA 1YG2A 2IA1A 5L3BA 2W57A 2YSRA 4RB2C 2VBWA 5JI6A 1C0WA 2RQPA 5FLXZ 2RVCA 2IPQX 2ADUA 3RYRA 3GX4X 1SFXA 5AONA 2PMHA 3ZQ7A 5LRSA 2H94A 4HLXA 1ZRCA 2FNAA 3RI4A 3PFIA 3CUQC 5HLHA 2QUFA 1XGSA 3GFMA 3HOSA 4EQQA 2FXAA 2NAZA 1TNSA 3V8LA 2IJLA 3WE3A 2DO7A 3M9AA 3ZMZA 5D8KB 1B9NA 3Q9SA 5FD6A 3WTVC 1QGPA 1ODDA 3ABUA 2M5WA 3WTXC 5TRDA 3KFWX 3BPVA 5CVJA 2XGXA 2VE8A 1EH6A 2ETHA 2D1VA 1HW1A 2OAZA 2VC1A 1IAWA 2JSCA 2VBYA 5BOXA 5FB2A 1E2XA 3WTTC 2M87A 3IRQA 3RKWA 2ZXJA 5KK1A 3FMRA 3D5LA 1ZN2A 2FE3A 2NNNA 4YFKF 3VODA 3B73A 1KQ8A 4U0VA 1FSHA 4BHCA 1W5SA 2Q8KA 4KMFA 2A5YB 2LKPA 3BJOA 4BH9A 4HQMA 1T38A 5HDNA 4EGYA 3K2ZA 1UHWA 2VOOA 2AXLA 3HTUA 3VEPA 1DPUA 2QBYB 2GQQA 1MDMB 4KIFA 4GYGA 5AIPA 4MHGA 3FX3A 2XHKA 3FZVA 1U78A 1OR7A 2HOEA 1P92A 1XGNA 2F2EA 2BV6A 3MEXA 2XAQA 1YW8A 3BWGA 4IVNA 4P55A 2W24A 2K7LA 4XLNF 4YIFA 2XROA 3FF5A 4G6DA 3W6KB 3ZMUA 1U8RA 3Q5FA 5AIQA 1JGSA 4M6YA 4OU0A 1G3YA 3F6OA 4A0ZA 3EUHA 4CYDA 5EEGA 1G6NA 2EFQA 1JXSA 3QU6A 3GWZA 4WX9A 1KYZA 2DAOA 3ZMVA 2KIFA 1O7LA 1ZAOA 2QWWA 5LGTA 2P5LC 4ASNA 4IPAA 3J81Z 1ULYA 4UNOA 2BEOA 1J5YA 3DP7A 1XSVA 3GF2A 1IN6A 2PQ8A 2HKXA 4ZH4F 1Y0UA 5JVTA 3GFJA 1TQMA 4AIJA 3T8TA 3V7RA 4KA4A 4ZYHA 1XMAA 1R1TA 3L9FA 1IUYA 1BM9A 2XIGA 4Q48A 1TW2A 3JAMZ 5DD4A 2H27A 1RNLA 2L02A 3WGGA 1ZYRF 1QQIA 5DD8A 4KYWA 2MLGA 4R79A 5LLQA 1W7PD 3DF8A 2CWEA 4EM0B 3QOPA 2M8EA 3TO9A 4S05A 3ZN0A 4CHUA 1F1ZA 2HQRA 4O5VA 3R60A 2DI3A 1HSJA 2EV6A 2JPCA 3HYIA 2KKOA 1IN8A 2PN6A 2ACJA 4LB6B 3K1PA 3PQKA 4RB3C 3I0TA 1STZA 4CGZA 4PGGA 1K79A 1YYVA 4WK8F 3KP4A 2R3SA 3EDPA 1K78A 4UUVA 1G4DA 3R6SA 1YO5C 4HV5A 2D45A 1PDNC 5K5RA 1IN7A 1ZREA 3P9KA 3FM5A 4IRHA 2O0YA 5LRRA 1QO0D 2VE9A 1FX7A 4RGSA 3GFIA 2EJRA 1ZG1A 1ZH5A 1JHHA 3HRSA 2UXNA 2YX4A 1OKRA 2R7DA 3RTRA 3M8EA 1FPQA 4A5NA 3GUDA 2HKOA 2MC3A 4IRIA 2YU3A 3ERED 2ZMEA 1SMTA 2RGVA 1HKTA 3O6BB 2E7WA 3LA2A 2DTRA 2STWA 2LF7A 4ZZDA 3LQRA 1YS6A 3HSRA 3SQNA 1WKMA 5ICGA 1KU3A 4WF2A 2HGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L54 A;  3E3V A;  4GCV A;  1EV7 A;  1MGT A;  3M1E A;  1P4X A;  3V8J A;  1MD0 A;  2EV5 A;  2WV0 A;  1XGO A;  3ELK A;  2STT A;  5CJ9 A;  5LGN A;  2PEX A;  2W85 A;  3WTY C;  2QBY A;  2EWN A;  1U6G A;  1WI9 A;  4LK0 F;  2NRA C;  3DFG A;  1OYI A;  4WXH A;  1IF1 A;  3VFZ A;  3KP5 A;  2DPD A;  4MQ9 F;  2Q2E A;  3HHG A;  4R1H A;  5BMZ A;  1PUE E;  2EB7 A;  2Y75 A;  1D8J A;  1ZG5 A;  1F5T A;  5BS6 A;  2FBI A;  5F6F A;  1B4A A;  1R1V A;  3HSE A;  4HV6 A;  2YPR A;  5F1R A;  5L3D A;  4HF0 A;  2CO5 A;  2EK5 A;  3IKT A;  1J2X A;  5FGM A;  3KP7 A;  1ZLJ A;  2JRT A;  2EFW A;  4CDG A;  5DEQ A;  3COA C;  2KRF A;  4LFU A;  1T2K A;  4LLL A;  3HTS B;  3E6B A;  2IT0 A;  4EM2 A;  1O3S A;  3P9C A;  4UV9 A;  3C7J A;  3O2P E;  4I0B A;  5DYM A;  3DPT A;  2UXX A;  3MFK A;  2WTE A;  2DW4 A;  1OMI A;  2JZY A;  3KLN A;  2XRN A;  4OOI A;  3E6M A;  2JT1 A;  3J81 K;  2OU2 A;  3KZY A;  5K5O A;  2A61 A;  2VBZ A;  2FMY A;  1HKQ A;  4ENM A;  1W5T A;  4ZYE A;  4ESB A;  3GFL A;  1W7P B;  3WTW C;  3HIF A;  3S2W A;  4WWC A;  2M30 A;  4OIO F;  4ETS A;  1IZ1 A;  1IRG A;  1UFM A;  3OV8 A;  1YS7 A;  4MNU A;  2PBI A;  4PZJ A;  3MCZ A;  3HRU A;  3IWF A;  3FM3 A;  4XBF A;  4Q4Z F;  1FOK A;  1KGS A;  2K86 A;  2X4H A;  2G9W A;  1CF7 B;  3RYP A;  2P6T A;  5KVR A;  1ONV A;  4YG2 F;  3RKX A;  2LF8 A;  3NEU A;  2IP2 A;  2UZK A;  3WU1 B;  2XV4 S;  4CO8 A;  2V9V A;  3LST A;  4WCG A;  1K6O A;  2LSO A;  2CQK A;  4A0Y A;  4HQE A;  4EJT A;  3E6C C;  1Q1H A;  1TNT A;  1V4R A;  1F4K A;  2KIM A;  4HZF A;  4L9V A;  2YR2 A;  3REO A;  1ZRD A;  4LG0 A;  1SD6 A;  1BI2 A;  5TJJ A;  5CVI A;  4M72 A;  2DU9 A;  3EET A;  4K2E A;  1IXR C;  3DXJ F;  5ICF A;  2M45 A;  1OPC A;  5ILU A;  2ISY A;  3N97 A;  4QWQ A;  1WRJ A;  4XLP F;  2FRH A;  4Z2Y A;  1USS A;  3C1D A;  1HW2 A;  1QNT A;  3HRM A;  4Y13 A;  2XAJ A;  2OQG A;  3E97 A;  3MAJ A;  3CUQ B;  4GGG A;  2W25 A;  1SD5 A;  4JK1 X;  2FEZ A;  4FHT A;  5D4S A;  1KU7 A;  4L0Y B;  1P4W A;  4ON0 A;  2AS5 F;  4HBL A;  5H20 A;  3WG9 A;  3J7A O;  3CUO A;  1D3Y A;  1JE8 A;  1TQI A;  1PP7 U;  2HR3 A;  2KJB A;  1R7J A;  4M9X A;  3J80 Z;  5ERI A;  2RC4 A;  3E5X A;  4IXA A;  1MZB A;  1FBQ A;  1QZZ A;  2YX7 A;  5JFR A;  1FLI A;  2ZME B;  1R00 A;  4I2O A;  1J9I A;  4ENN A;  1U3E M;  2DK8 A;  4LMY A;  1W4M A;  4AIK A;  4M9S A;  1RUN A;  4D0P A;  2W84 A;  5LEJ A;  5A2Q Z;  1ON2 A;  5D5X B;  4ESJ A;  1UHM A;  2PLY A;  1RI7 A;  2QZ8 A;  4AVP A;  4HDV A;  3WTU C;  2NYX A;  1XCB A;  3LAJ A;  2VXZ A;  1E17 A;  1HXD A;  4P9F A;  2CW0 F;  2E1C A;  1U5T C;  4N0B A;  2QYO A;  3CO7 C;  1FSE A;  4ZZL A;  3JTG A;  1K7A A;  4UVC A;  1TW3 A;  4KDP A;  1ZG3 A;  1LEA A;  1I5Z A;  4GXO A;  3VOE A;  5FFZ A;  2DT5 A;  4PCQ A;  1ON1 A;  4B09 A;  3DPL C;  2COM A;  1DPR A;  1FT9 A;  4MEX F;  5H6R A;  1WQ2 A;  2D1H A;  2Q0O A;  2OZ6 A;  3TDZ C;  2FNP A;  3WGI A;  2DFI A;  3F8C A;  1Z6T A;  2O6G E;  5D5V B;  2ZCW A;  2IA0 A;  4G94 A;  3RIR A;  1IXC A;  1UST A;  1T39 A;  4KT5 C;  1I1G A;  5EEH A;  2L4A A;  1LDJ A;  1BI1 A;  3K0L A;  1SAX A;  1LJ9 A;  3O3K A;  5LGU A;  2XKO A;  1IW7 F;  4U7D A;  2QLZ A;  4IHT A;  4AWX B;  3TOA A;  3H3U A;  5LEK A;  3LWF A;  1HKS A;  3ZMD A;  1Z7U A;  3LQQ A;  1QPM A;  4NB5 A;  2FSW A;  2QM3 A;  1PP8 F;  3LA3 A;  2JPB A;  5H6Q A;  4RB1 A;  3R4K A;  1MDM A;  4N9I A;  1KU9 A;  1DDN A;  4MTE A;  1R23 A;  3QAH A;  1I6X A;  1LNW A;  4HLY A;  1Z6R A;  5DUI A;  2ZJ2 A;  2L4M A;  2DQR A;  3CLO A;  2OQR A;  5LHI A;  3KP2 A;  3ABT A;  5IT9 Z;  1FYK A;  3DQV C;  5ED4 A;  1CF7 A;  2TDX A;  2BGC A;  1S29 A;  5DV5 A;  5ILS A;  2CYY A;  1BI0 A;  4L9N A;  5JHU A;  2QQA A;  4EM1 A;  3IC7 A;  1GXQ A;  5HLG A;  1FWZ A;  3GW2 A;  1YTY A;  2EA2 A;  3KZZ A;  4H0E A;  1O57 A;  2LNB A;  3BDD A;  5E20 A;  4RGR A;  2CFX A;  3WGH A;  2P7C B;  1ZLK A;  3TDU C;  2PG4 A;  4NHJ A;  1MJB A;  1XD7 A;  3F8N A;  4U7B A;  1ZGA A;  3SFZ A;  3M7G A;  3GXO A;  5FO5 A;  3WE2 A;  1ZRF A;  3HUG A;  1QZY A;  2R7F A;  1Z05 A;  4MTD A;  3BPX A;  3GEZ A;  6PAX A;  1X3U A;  2VBX A;  3J80 K;  2ZFW A;  2FA5 A;  5DCM A;  2ISZ A;  2BYV E;  5CVR A;  2P4W A;  2VC0 A;  4LLN A;  3RDI A;  3CUQ A;  4KUM A;  5E18 F;  4JBA A;  2OD5 A;  3ZPL A;  1BIA A;  4O3M A;  5IT9 K;  2DK5 A;  1XSX A;  1B59 A;  2CGP A;  3ZP5 A;  2Z99 A;  2V1D A;  5FFX A;  4UVB A;  2V79 A;  2DPU A;  2FBK A;  1DP7 P;  1P4A A;  1S6L A;  4UV8 A;  5D8L B;  1BOA A;  4EV0 A;  4A5M A;  5HOO A;  2Z5U A;  1B9M A;  1ZAR A;  1BIB A;  1SFE A;  2MD5 A;  2A3S A;  4N9H A;  5CLS A;  1HST A;  2MLK A;  4RAZ A;  4G7O F;  4M74 A;  4CXF A;  1JHF A;  1YQA A;  3ZN1 A;  3IRR A;  2OBP A;  2FBH A;  5K5Q A;  3ML6 A;  2P8T A;  1T0F A;  3TKY A;  1H9G A;  4OMZ A;  2V1X A;  5D5U B;  4HF2 A;  3QPT A;  3KP3 A;  3K69 A;  5CVU A;  2DBB A;  2HFH A;  2RKH A;  2JTV A;  3MZY A;  4I0A A;  3FXQ A;  3GYH X;  4L0Z B;  3KE2 A;  4CZZ A;  5L3E A;  5HS9 A;  5JR3 A;  1ZGJ A;  1WSU A;  4U0Y A;  4RB0 A;  4WXC A;  1A04 A;  4HYE A;  4A12 A;  1R5G A;  1Z1D A;  3F8B A;  3L2C A;  1KQ9 A;  3I71 A;  3FXR A;  5HS7 A;  2HDC A;  4BNC A;  2MH9 A;  3ZMT A;  1I1S A;  2O8X A;  2H6C A;  5J8C A;  1J0R A;  5DUK A;  1J59 A;  4UXN A;  1LVA A;  4TV7 A;  3IWZ A;  3ROU A;  5E17 F;  4XRF A;  2GWR A;  4I98 B;  4Y15 A;  4EJU A;  2IA2 A;  3GZ6 A;  4U0W A;  1P6R A;  2XVC A;  4HW0 A;  5L3G A;  5HVQ C;  2ZO4 A;  2HTJ A;  2RDP A;  1XMK A;  1BBY A;  4PDK A;  3WTZ A;  3KET A;  2J5O A;  1S7A A;  2MBF A;  2O61 A;  4BYY A;  1L3L A;  3FXU A;  3N4M A;  4I01 A;  1BC7 C;  1L0O C;  3I59 B;  4O6J A;  4RGU A;  4I02 A;  3CTA A;  4LK1 F;  4LG0 B;  4L18 B;  2FU4 A;  1T98 A;  2ZBK A;  4M6X A;  2NS0 A;  3P9I A;  1T6S A;  5E8I A;  2QQ9 A;  1IRF A;  3I53 A;  5CVV A;  4ENK A;  3QU3 A;  2ELH A;  1UCR A;  1YFH A;  3F21 A;  3HHH A;  1OYW A;  2HTS A;  2P7V B;  1XN7 A;  3EQL F;  5D6E A;  5DCM B;  1W7P A;  1XSD A;  2BBY A;  4A2U A;  1J75 A;  5HS8 A;  3QP6 A;  1FYM A;  3BZ6 A;  2X0L A;  2F5F A;  2GZW A;  3E5U A;  4KIC A;  1AWC A;  5D6F A;  5L3F A;  1MJA A;  5IT3 A;  3KEO A;  4G6Q A;  4EJO A;  2A07 F;  4G9Y A;  3IKV A;  4L9T A;  3W6J B;  3U9G A;  4A6E A;  1BN5 A;  4KIB A;  1WWX A;  4Q5S F;  4L9J A;  2XAS A;  2GA2 A;  4I7H A;  3AAF A;  4ZYG A;  3JSP A;  2D2W A;  2QEN A;  4IHS A;  4GO1 A;  1RUO A;  2Y48 A;  2H09 A;  4A0X A;  1O7F A;  4RS8 A;  4EJW A;  3DV8 A;  4U88 A;  3H92 A;  4OIR F;  1SD4 A;  2EV0 A;  1BJA A;  4G7Z F;  2PJP A;  3GVA A;  1NHA A;  1DUX C;  5E1X A;  1D5V A;  4L5I A;  2DLL A;  5D5W B;  3KCC A;  3BRO A;  4P5O A;  4EVI A;  5D4R A;  1KA8 A;  4GYI A;  3D0S A;  4JQF A;  5LBQ A;  4BAY A;  2GA1 A;  4HOB A;  4L5J A;  2IRF G;  4YFN F;  3CJN A;  3L7W A;  1HW5 A;  3HSF A;  5A2Q K;  1GXP A;  2FQ3 A;  4HDU A;  3NQO A;  2A69 F;  5K1Y A;  2L3D A;  4OIN F;  1FP2 A;  1KU2 A;  3K1N A;  1R1U A;  1YW7 A;  2V1U A;  2V6C A;  2PI0 A;  3H3Z A;  3V8K A;  3TQN A;  3TOB A;  1BI3 A;  4KMU X;  3P7N A;  2RNJ A;  5E1W A;  1S3J A;  2P5K A;  3JAM K;  1HBX G;  2A68 F;  2XUB A;  3C18 A;  2KIU A;  2OA4 A;  4BXU A;  4E70 A;  3NRV A;  2RV8 A;  4CIC A;  3QPH A;  3ISP A;  4YFX F;  1O3Q A;  1GVJ A;  4R8H A;  4FT8 A;  1BC8 C;  2WC2 A;  4P96 A;  2K4B A;  5CYV A;  4LD5 A;  2H6B A;  2VOD A;  4PGH A;  2F5E A;  1LEB A;  3T0Y A;  3JW4 A;  3I64 A;  2EFO A;  1FP1 D;  2HS5 A;  3I59 A;  3M8F A;  1REP C;  1H9T A;  2ESH A;  4IRG A;  1Z9C A;  3F23 A;  4QLC U;  4HX7 A;  3DKW A;  3G73 A;  3I5U A;  3HOT A;  2P6S A;  2HYF A;  2Z3Y A;  1LDK B;  4LGW A;  5BPD A;  3GZ5 A;  4HX8 A;  4IJA A;  2Z9O A;  3BJ6 A;  1G3T A;  4FX0 A;  2F5C A;  3F8M A;  3E6D A;  4ENJ A;  2IW5 A;  4KFC A;  4KN7 X;  3RKY A;  3ECH A;  1OYY A;  3L00 A;  3G3Z A;  1FY7 A;  5ICE A;  5ICC A;  2E7X A;  3F6V A;  3U2R A;  2P5V A;  3TO7 A;  2A6H F;  3R61 A;  1UB9 A;  1XDU A;  2VOP A;  3V7C A;  1EH7 A;  2GIV A;  2HEO A;  1ZHF A;  2CSO A;  3I58 A;  3BJA A;  4I09 A;  5DCF A;  4XSX F;  2C6Y A;  1RZ4 A;  5HDK A;  3ULQ B;  1I27 A;  3I4P A;  2Y0M A;  1FYL A;  5HLI A;  2K27 A;  2PMU A;  2K02 A;  1B6A A;  3F3X A;  3MQ0 A;  2G7U A;  3JSO A;  5FLX K;  4G7H F;  3PQJ A;  5LHG A;  3CO6 C;  2G7H A;  2K4J A;  4HAM A;  1EH8 A;  3FHZ A;  1FZP B;  1FC3 A;  4MQV A;  3WTS C;  1U2W A;  1IN4 A;  1LQ1 A;  4BQA A;  2ESN A;  2RN7 A;  4AD9 A;  1D8K A;  2XKP A;  3HRT A;  2FML A;  2FOK A;  3R0J A;  4OIP F;  1R58 A;  4WXD A;  3U1D A;  2UWM A;  2XAG A;  2E1N A;  1H0M A;  5J8F A;  3L09 A;  3SXY A;  4B8X A;  3KEQ A;  2J5P A;  4DNC A;  4S04 A;  4OMY A;  4G8X A;  3BOQ A;  2IVM A;  1FBU A;  5BQT A;  3WOD F;  2GXG A;  2HYG D;  4XSZ F;  3MZH A;  3LA7 A;  1RIO H;  5F64 A;  4KNY A;  3B02 A;  4BHB A;  1FNN A;  4LB5 A;  2L01 A;  4HA8 A;  1TTY A;  2MA3 A;  4NQW A;  1XCV A;  1KYW A;  4LJZ F;  2ZKZ A;  2BE5 F;  5J6X A;  2M1B A;  4IF4 A;  1O3T A;  3CDH A;  1O3R A;  2EFN A;  2EFP A;  4A6D A;  4RGX A;  2VON A;  3ECO A;  4ESF A;  2VT3 A;  2QVO A;  3V7S A;  3IHU A;  1G3S A;  2QQB A;  2VT2 A;  3C3W A;  2A6E F;  3R0A A;  4M73 A;  1TBX A;  3F8F A;  3QRF F;  1XGM A;  1B1B A;  1LB2 A;  1YW9 A;  1V3F A;  3TGN A;  5LHH A;  1TLH B;  4Y17 A;  3I54 A;  3LAP A;  1S7O A;  1IN5 A;  4AIH A;  4EMS A;  2HWV A;  5ILV A;  2O03 A;  1VTN C;  1R22 A;  3RJP A;  3WU0 A;  4OIQ F;  4M9Z A;  3T8R A;  3F22 A;  3FMS A;  2HQN A;  2KJC A;  2OZU A;  4KIG A;  1XDS A;  1F9N A;  1CGP A;  4BHP A;  1U5T B;  4FX4 A;  1G3W A;  1YLF A;  1KQ0 A;  3T1B A;  1SD7 A;  3EYY A;  3DEU A;  4ZYD A;  2WWY A;  1K78 B;  1HQC A;  4UHT A;  1LDD A;  2PFB A;  5HDG A;  1MKM A;  1TQP A;  2EA4 A;  2ZNY A;  3QP5 A;  2XAF A;  5L3C A;  2CG4 A;  3SHF A;  1YIO A;  4MEY F;  3OOP A;  5E8G A;  1IXS B;  3KLO A;  1XB4 A;  3LFK A;  4LLG F;  4Q47 A;  4F7Z A;  2VN2 A;  1GHC A;  4EGZ A;  1J7K A;  2O3F A;  1FBS A;  4HX4 A;  1AOY A;  2GAU A;  4P9U A;  3K1M A;  3RPQ A;  2Z33 A;  3JTH A;  3GLX A;  3V4G A;  3FWE A;  3SZT A;  2XAH A;  5BPI A;  2MH2 A;  4YII A;  1S8N A;  3T5X A;  5DDG A;  4RAY A;  3K9T A;  2ZNZ A;  1SMY F;  3SZP A;  2DQL A;  1U5T A;  3TO6 A;  4MGR A;  4HF1 A;  3KP6 A;  3MWM A;  4DQ2 A;  2LDU A;  1SFU A;  1R5H A;  2F5D A;  2NNY A;  3IL2 A;  3FMQ A;  2FF4 A;  3BY6 A;  3F72 A;  2B0L A;  3BP8 A;  3E5Q A;  3GO5 A;  3EYI A;  4KN4 X;  3VB2 A;  1Z91 A;  5FD5 A;  3Q9V A;  1QBJ A;  1P2F A;  1R36 A;  5E1Z B;  3ZMS A;  2HZT A;  1MJ9 A;  4EJV A;  4UVA A;  3RPU A;  4M71 A;  2GXB A;  1YG2 A;  2IA1 A;  5L3B A;  2W57 A;  2YSR A;  4RB2 C;  2VBW A;  5JI6 A;  1C0W A;  2RQP A;  5FLX Z;  2RVC A;  2IPQ X;  2ADU A;  3RYR A;  3GX4 X;  1SFX A;  5AON A;  2PMH A;  3ZQ7 A;  5LRS A;  2H94 A;  4HLX A;  1ZRC A;  2FNA A;  3RI4 A;  3PFI A;  3CUQ C;  5HLH A;  2QUF A;  1XGS A;  3GFM A;  3HOS A;  4EQQ A;  2FXA A;  2NAZ A;  1TNS A;  3V8L A;  2IJL A;  3WE3 A;  2DO7 A;  3M9A A;  3ZMZ A;  5D8K B;  1B9N A;  3Q9S A;  5FD6 A;  3WTV C;  1QGP A;  1ODD A;  3ABU A;  2M5W A;  3WTX C;  5TRD A;  3KFW X;  3BPV A;  5CVJ A;  2XGX A;  2VE8 A;  1EH6 A;  2ETH A;  2D1V A;  1HW1 A;  2OAZ A;  2VC1 A;  1IAW A;  2JSC A;  2VBY A;  5BOX A;  5FB2 A;  1E2X A;  3WTT C;  2M87 A;  3IRQ A;  3RKW A;  2ZXJ A;  5KK1 A;  3FMR A;  3D5L A;  1ZN2 A;  2FE3 A;  2NNN A;  4YFK F;  3VOD A;  3B73 A;  1KQ8 A;  4U0V A;  1FSH A;  4BHC A;  1W5S A;  2Q8K A;  4KMF A;  2A5Y B;  2LKP A;  3BJO A;  4BH9 A;  4HQM A;  1T38 A;  5HDN A;  4EGY A;  3K2Z A;  1UHW A;  2VOO A;  2AXL A;  3HTU A;  3VEP A;  1DPU A;  2QBY B;  2GQQ A;  1MDM B;  4KIF A;  4GYG A;  5AIP A;  4MHG A;  3FX3 A;  2XHK A;  3FZV A;  1U78 A;  1OR7 A;  2HOE A;  1P92 A;  1XGN A;  2F2E A;  2BV6 A;  3MEX A;  2XAQ A;  1YW8 A;  3BWG A;  4IVN A;  4P55 A;  2W24 A;  2K7L A;  4XLN F;  4YIF A;  2XRO A;  3FF5 A;  4G6D A;  3W6K B;  3ZMU A;  1U8R A;  3Q5F A;  5AIQ A;  1JGS A;  4M6Y A;  4OU0 A;  1G3Y A;  3F6O A;  4A0Z A;  3EUH A;  4CYD A;  5EEG A;  1G6N A;  2EFQ A;  1JXS A;  3QU6 A;  3GWZ A;  4WX9 A;  1KYZ A;  2DAO A;  3ZMV A;  2KIF A;  1O7L A;  1ZAO A;  2QWW A;  5LGT A;  2P5L C;  4ASN A;  4IPA A;  3J81 Z;  1ULY A;  4UNO A;  2BEO A;  1J5Y A;  3DP7 A;  1XSV A;  3GF2 A;  1IN6 A;  2PQ8 A;  2HKX A;  4ZH4 F;  1Y0U A;  5JVT A;  3GFJ A;  1TQM A;  4AIJ A;  3T8T A;  3V7R A;  4KA4 A;  4ZYH A;  1XMA A;  1R1T A;  3L9F A;  1IUY A;  1BM9 A;  2XIG A;  4Q48 A;  1TW2 A;  3JAM Z;  5DD4 A;  2H27 A;  1RNL A;  2L02 A;  3WGG A;  1ZYR F;  1QQI A;  5DD8 A;  4KYW A;  2MLG A;  4R79 A;  5LLQ A;  1W7P D;  3DF8 A;  2CWE A;  4EM0 B;  3QOP A;  2M8E A;  3TO9 A;  4S05 A;  3ZN0 A;  4CHU A;  1F1Z A;  2HQR A;  4O5V A;  3R60 A;  2DI3 A;  1HSJ A;  2EV6 A;  2JPC A;  3HYI A;  2KKO A;  1IN8 A;  2PN6 A;  2ACJ A;  4LB6 B;  3K1P A;  3PQK A;  4RB3 C;  3I0T A;  1STZ A;  4CGZ A;  4PGG A;  1K79 A;  1YYV A;  4WK8 F;  3KP4 A;  2R3S A;  3EDP A;  1K78 A;  4UUV A;  1G4D A;  3R6S A;  1YO5 C;  4HV5 A;  2D45 A;  1PDN C;  5K5R A;  1IN7 A;  1ZRE A;  3P9K A;  3FM5 A;  4IRH A;  2O0Y A;  5LRR A;  1QO0 D;  2VE9 A;  1FX7 A;  4RGS A;  3GFI A;  2EJR A;  1ZG1 A;  1ZH5 A;  1JHH A;  3HRS A;  2UXN A;  2YX4 A;  1OKR A;  2R7D A;  3RTR A;  3M8E A;  1FPQ A;  4A5N A;  3GUD A;  2HKO A;  2MC3 A;  4IRI A;  2YU3 A;  3ERE D;  2ZME A;  1SMT A;  2RGV A;  1HKT A;  3O6B B;  2E7W A;  3LA2 A;  2DTR A;  2STW A;  2LF7 A;  4ZZD A;  3LQR A;  1YS6 A;  3HSR A;  3SQN A;  1WKM A;  5ICG A;  1KU3 A;  4WF2 A;  2HGC A; 
#chains in the Genus database with same CATH topology
 2L54 A;  4QIW N;  2BVM A;  3E3V A;  4GCV A;  1EV7 A;  1MGT A;  1TWA J;  1SVO A;  3M1E A;  1P4X A;  3L2Q A;  3V8J A;  1MD0 A;  2EV5 A;  1KON A;  1V54 H;  4CCJ A;  2Y9Z A;  1YJN I;  2WV0 A;  2KPM A;  1EA3 A;  1XGO A;  3ELK A;  4AC0 A;  3BT9 A;  2STT A;  4J00 A;  1PJR A;  5CJ9 A;  5IP7 J;  3OIQ A;  2G0E A;  5LGN A;  1MNE A;  2JJ7 A;  2PEX A;  1JJ8 C;  2W85 A;  2DA3 A;  3WTY C;  1MMA A;  2QBY A;  2EWN A;  1U6G A;  2VAS A;  1WI9 A;  4A3E J;  2GLO A;  2LOO A;  4LK0 F;  2NRA C;  3LSK A;  3DFG A;  1OYI A;  4WXH A;  1R71 A;  4XOR A;  1IF1 A;  3VFZ A;  3KP5 A;  4L5E A;  2DPD A;  4MQ9 F;  1APL C;  2Q2E A;  3E7L A;  2RNG A;  2M7A A;  3HHG A;  1DU6 A;  4R1H A;  3JRC A;  5BMZ A;  2DYR H;  2WV1 A;  1PUE E;  2EB7 A;  4A3D J;  2Y75 A;  1D8J A;  1ZG5 A;  4ZJZ A;  5BS6 A;  1F5T A;  2FBI A;  3NAR A;  2WY8 Q;  1B4A A;  2A5W A;  5F6F A;  1KZH A;  4PJJ A;  5M5W J;  1R1V A;  5M5Y J;  3HSE A;  4HV6 A;  2LBF A;  3J7A Y;  2YPR A;  2HOA A;  5F1R A;  5L3D A;  1S7E A;  3FXL A;  4HF0 A;  3GBG A;  3KYC B;  2CO5 A;  2EK5 A;  3IKT A;  3FK6 A;  1J2X A;  4B3X A;  5FGM A;  4IO9 F;  1NG6 A;  3KP7 A;  5E3N A;  2IS1 A;  5GAG J;  1T8I A;  2R92 J;  1E3P A;  3OIO A;  3AL0 C;  1ZLJ A;  2JRT A;  2EFW A;  4CDG A;  5DEQ A;  2BHZ A;  3QPL A;  3COA C;  1SAU A;  2KRF A;  2RAE A;  3A0H C;  4LFU A;  3A01 B;  3OYC A;  4AUX A;  1T2K A;  4LLL A;  3HTS B;  1V5G A;  1ORK A;  3JRI A;  2KDZ A;  3EUH C;  3E6B A;  2BY0 A;  2IT0 A;  3HGG A;  4XLC A;  4EM2 A;  1O3S A;  3P9C A;  5FRM A;  3DPU A;  5C44 J;  1X58 A;  4S0H B;  4M3B A;  4FAS D;  1ENH A;  1FEX A;  4UV9 A;  4A93 J;  3JRD A;  3C7J A;  3O2P E;  4I0B A;  2GXA A;  5DYM A;  3DPT A;  2DA4 A;  2UXX A;  3MFK A;  4RLQ A;  4XLH A;  2WTE A;  1XS9 A;  2DW4 A;  1OMI A;  2JZY A;  3KLN A;  3CCL I;  2MAB A;  4CZC A;  2A05 A;  4B48 A;  2EQR A;  2XRN A;  4OOI A;  1WH5 A;  1LFB A;  1YX3 A;  3E6M A;  2JT1 A;  3NWS A;  3J81 K;  1WPK A;  5HOD A;  2OU2 A;  4AYB A;  3KIO A;  3KZY A;  1BL0 A;  1S5L C;  1MMG A;  2ZSH B;  3CMM A;  5K5O A;  2R7U A;  2A61 A;  2VBZ A;  2FMY A;  1HKQ A;  4ENM A;  1JUS A;  2JWT A;  1W5T A;  2LH9 A;  4ZYE A;  4ESB A;  2DDB A;  3GFL A;  4RAG A;  1W7P B;  3WTW C;  3HIF A;  3S2W A;  4WWC A;  2M30 A;  3CDI A;  4OIO F;  3H9J A;  4ETS A;  1IZ1 A;  1IRG A;  3ZXS A;  5B1B H;  1P7J A;  1UFM A;  1AKH B;  3GTO J;  3OV8 A;  1YS7 A;  1CQT A;  4MNU A;  2PBI A;  4PZJ A;  3MCZ A;  3HRU A;  3BR1 A;  3IH3 A;  3FM3 A;  3IWF A;  3BG5 A;  4XBF A;  2BW3 A;  2DOE A;  4Q4Z F;  1FOK A;  1KGS A;  2K86 A;  2X4H A;  2G9W A;  1CF7 B;  4OWR B;  3RYP A;  2P6T A;  5KVR A;  1ONV A;  4YG2 F;  2GM4 A;  3RKX A;  1I50 J;  4A3L J;  2LF8 A;  3NEU A;  2IP2 A;  2UZK A;  3WU1 B;  2EPF A;  2XV4 S;  4CO8 A;  1P7I A;  4BQN A;  4ANJ A;  2V9V A;  2KIS A;  3W2V A;  3LST A;  4WCG A;  2VJ5 A;  1K6O A;  2LSO A;  2CQK A;  4A0Y A;  5FLV A;  1T56 A;  4Y7N J;  4AM3 A;  4HQE A;  4C2M J;  4EJT A;  3E6C C;  4CYC B;  1Q1H A;  1TNT A;  3BQZ A;  1V4R A;  3BLY A;  4BQQ A;  4J01 A;  1F4K A;  2KIM A;  4HZF A;  4L9V A;  3FK7 A;  2YR2 A;  2MG4 A;  3REO A;  1ZRD A;  5CQE A;  1S9H A;  4LG0 A;  1SD6 A;  3A2K A;  1BI2 A;  5TJJ A;  2MYS A;  5CVI A;  3IH2 A;  4M72 A;  3S3N A;  2CUJ A;  1A31 A;  1BR2 A;  4BY1 J;  2DU9 A;  2VPL A;  4XMY A;  2X6Y A;  3CC7 I;  2DT6 A;  3EET A;  4K2E A;  5J1R A;  2PX9 A;  5CKT A;  1IXR C;  1D0Z A;  4DW6 A;  5FLM J;  3DXJ F;  2WAQ N;  5ICF A;  2M45 A;  1OPC A;  5ILU A;  3MKZ A;  5K7Z A;  2DXI A;  4XLF A;  2ISY A;  3N97 A;  4QWQ A;  1JTX A;  1WRJ A;  4XLP F;  3TBI A;  5JLW A;  2FRH A;  4NUB A;  4XKW A;  4Z2Y A;  5GAD J;  1USS A;  3C1D A;  1HW2 A;  1OCR H;  1QNT A;  3HRM A;  1WFX A;  1YIT I;  3I55 I;  4Y13 A;  2XAJ A;  4M3D A;  2OQG A;  2NVU B;  1AHD P;  3E97 A;  2ID6 A;  3MAJ A;  2L5Q A;  5IYB J;  4I99 C;  2Y30 A;  3CUQ B;  4GGG A;  2W25 A;  1SD5 A;  2Y9Y A;  3HKZ A;  4JK1 X;  3LSG A;  1VQP I;  2FEZ A;  3MKY B;  4FHT A;  3TW6 A;  5D4S A;  1WVR A;  3CMA I;  2H8R A;  1KU7 A;  4DBR A;  4L0Y B;  3OYJ A;  3HG9 A;  2OC6 A;  1P4W A;  4ON0 A;  2HDW A;  2E1M C;  2AS5 F;  3BCA A;  3TED A;  4HBL A;  4C30 A;  5H20 A;  1IJW C;  4JX5 A;  4JX4 A;  5E3L A;  5B5E C;  2M7B A;  2QCO A;  3DTK A;  4II2 A;  3WG9 A;  2VLA A;  4PUS A;  3J7A O;  1IUF A;  3CUO A;  4F93 B;  1D3Y A;  1JE8 A;  1TQI A;  1PP7 U;  2HR3 A;  2KJB A;  2AXT C;  3OYM A;  4XRS A;  1R7J A;  4M9X A;  3J80 Z;  4FE7 A;  5ERI A;  2VUM J;  2RC4 A;  3E5X A;  4IXA A;  1A35 A;  1MZB A;  1T95 A;  3S8P A;  1HDD C;  3OYN A;  1MBJ A;  1FBQ A;  2XGC A;  1QZZ A;  2YX7 A;  3BG3 A;  5EZH A;  3AFH A;  5JFR A;  3FBI B;  5J1Y A;  1FLI A;  2ZME B;  1R00 A;  4I2O A;  3RQI A;  4A69 C;  1J9I A;  2NXN B;  2H8W A;  2F4I A;  2CJJ A;  4I76 A;  4Y4R A;  2E5N A;  5LD2 C;  4ENN A;  1U3E M;  2DK8 A;  4LMY A;  1I6H J;  1W4M A;  5FKL A;  4X1E A;  4AIK A;  4M9S A;  1VQM I;  1RUN A;  1U0J A;  1X19 A;  3PNY A;  4D7N A;  4D0P A;  4XOT A;  2W84 A;  5LEJ A;  5A2Q Z;  4E7K A;  1WGX A;  1ITY A;  2OCC H;  3OYA A;  3LSH A;  2EBI A;  2X1E A;  3OYL A;  1X1A A;  1ON2 A;  3CQZ J;  3RZD J;  5D5X B;  1QZE A;  4ESJ A;  1UHM A;  3S2H J;  2PLY A;  1RI7 A;  2QZ8 A;  2VKH A;  3IV5 A;  3L2U A;  1D1C A;  4AVP A;  4HDV A;  3WTU C;  1I39 A;  3H35 A;  3SYT A;  2NYX A;  1XCB A;  2EZI A;  3ZQF A;  3LAJ A;  1W36 C;  4RDU A;  2VXZ A;  3KYD B;  3S32 A;  1E17 A;  4JX6 A;  1HXD A;  4P9F A;  3AG1 H;  2CW0 F;  3FKJ A;  2E1C A;  2ZXW H;  4ZDL A;  1U5T C;  4PFO A;  4N0B A;  2QYO A;  4XR6 A;  4B43 A;  2XSD C;  2Z16 A;  3CO7 C;  1FSE A;  4ZZL A;  3JTG A;  1P9Q C;  3DKX A;  1K7A A;  3AG2 H;  2O8K A;  4UVC A;  1B72 B;  1TW3 A;  4KDP A;  1ZG3 A;  2LRE A;  1LEA A;  1I5Z A;  4GXO A;  3PJR A;  3VOE A;  5FFZ A;  2DDA A;  2DT5 A;  2UV1 A;  1R4N B;  1VQ4 I;  2QKM B;  1M1E B;  3K7A J;  3KPH A;  4PCQ A;  3AL0 B;  4X6A J;  4DJA A;  1ON1 A;  4ZDO A;  2MSY A;  1Y1W J;  3CJR B;  4B09 A;  5E3M A;  3DPL C;  2COM A;  1UG2 A;  5JLX A;  1DPR A;  1FT9 A;  4MEX F;  3DU5 A;  2E35 A;  1W5C C;  5H6R A;  1WQ2 A;  1R4M B;  2D1H A;  5F08 A;  2Q0O A;  2OZ6 A;  1WJD A;  3TDZ C;  2DA5 A;  2FNP A;  3WGI A;  2DFI A;  3F8C A;  3OYK A;  2XGE A;  3ZQH A;  4Y52 J;  1Z6T A;  2O6G E;  3HGY A;  5D5V B;  2ZCW A;  3CCS I;  1VQO I;  1OCT C;  2IA0 A;  5B66 C;  2LFB A;  4YRV A;  3F0C A;  1VF9 A;  4G94 A;  3L2R A;  3IP4 B;  2LLK A;  1IXC A;  3CES A;  4N4N B;  3RIR A;  1X1C A;  1UST A;  1T39 A;  4V2F A;  3U1K A;  1VQK I;  1LFU P;  2R7X A;  4AU7 A;  4KT5 C;  3HC7 A;  1I1G A;  5EEH A;  2L4A A;  1LDJ A;  1BI1 A;  4BQO A;  3K0L A;  4DIQ A;  1SAX A;  2XPW A;  1LJ9 A;  3O3K A;  3ZRG A;  5LGU A;  2ME6 A;  2JN6 A;  2HYJ A;  2XKO A;  1IW7 F;  4CCL A;  4U7D A;  2QLZ A;  4PJN A;  4IHT A;  4AWX B;  3TOA A;  3H3U A;  5LEK A;  3OYD A;  1I3A A;  2DCE A;  1Z3X A;  1D0X A;  3LWF A;  2R7S A;  1HKS A;  3ZMD A;  1Z7U A;  3DBR B;  3LQQ A;  4BDZ A;  1QPM A;  2BOL A;  2WBM A;  4NB5 A;  2FSW A;  3Q3S A;  2QM3 A;  1Y1V J;  1PP8 F;  3LA3 A;  2JPB A;  5H6Q A;  1NTC A;  4RB1 A;  3R4K A;  4QSH A;  1MIJ A;  2EZK A;  1ETY A;  3M1C A;  1MDM A;  3BR6 A;  5M5X J;  3K70 D;  5K7F A;  4N9I A;  1KU9 A;  3D5R C;  1DDN A;  4B47 A;  4MTE A;  4XKV A;  2XDV A;  4B44 A;  1R23 A;  4NDL A;  4QTR A;  3IH4 A;  2JVH A;  2LYC A;  3QAH A;  2I10 A;  2ZME C;  1I6X A;  1LNW A;  2OPT A;  1UG0 A;  4HLY A;  2E2H J;  3VPR A;  1LUJ B;  1Z6R A;  3VYU B;  2CUF A;  5DUI A;  2ZJ2 A;  1ZK8 A;  2L4M A;  2DQR A;  3CLO A;  9ANT A;  2OQR A;  4BXF A;  5LHI A;  3KP2 A;  3ABT A;  2O9L A;  1QA6 A;  5IT9 Z;  1FYK A;  3DQV C;  5ED4 A;  2CV2 A;  4MFD A;  3BG7 A;  1CF7 A;  2B7E A;  2TDX A;  2BGC A;  1JI8 A;  1S29 A;  5DV5 A;  2X6X A;  5ILS A;  3CJQ B;  2CYY A;  4IHV A;  3FXK A;  2CS3 A;  1BI0 A;  4L9N A;  5JHU A;  4A3F J;  2QQA A;  2QQ8 A;  4DGW B;  4GRI A;  4IEJ A;  4EM1 A;  1ZR4 A;  3IC7 A;  1GXQ A;  3GLL A;  4HPQ A;  3PSF A;  5HLG A;  2V7F A;  1FWZ A;  3GW2 A;  1YTY A;  2EA2 A;  2V4J C;  4XK4 A;  3KZZ A;  4H0E A;  1O57 A;  5GPC A;  2LNB A;  3BDD A;  3MKW B;  5E20 A;  4RGR A;  2ELJ A;  4E6K G;  2CFX A;  3M4O J;  3VYT B;  3WGH A;  3MKL A;  1WZ2 A;  4D5F A;  3H5A A;  2P7C B;  4RLF A;  1ZLK A;  3TDU C;  1LKX A;  2PG4 A;  3EUK L;  4NHJ A;  1MJB A;  4HG2 A;  1XD7 A;  5LFA A;  5KAI C;  4YIR X;  3F8N A;  4U7B A;  4A3K J;  1ZGA A;  4J19 A;  3OS0 A;  1SAN A;  2WB1 N;  3SFZ A;  3M7G A;  3GXO A;  5FO5 A;  3WE2 A;  1ZRF A;  3HUG A;  1QZY A;  2P0W A;  2R7F A;  2DN0 A;  1Z05 A;  2L7F P;  1X1D A;  3ZQL A;  4MTD A;  3BPX A;  3GEZ A;  1XG1 A;  1YJ9 I;  3LL7 A;  5IYC J;  1E3O C;  4LG3 A;  6PAX A;  2K5C A;  1BJZ A;  1MH3 A;  1BOB A;  1X3U A;  2VBX A;  2EIL H;  2W4S A;  3J80 K;  2ZFW A;  2FA5 A;  1GDT A;  2OCE A;  5E3O A;  4HNT A;  2M4G A;  3S2D J;  1N75 A;  5DCM A;  1R49 A;  2ISZ A;  3CF2 A;  2BYV E;  5CVR A;  4FQG A;  2XF5 A;  2P4W A;  2VC0 A;  1QRY A;  4LIU A;  1OCC H;  3W2A A;  2Z2S B;  1SFK A;  4LLN A;  3RDI A;  3CUQ A;  4KUM A;  2I5U A;  4PJ0 C;  5E18 F;  4JBA A;  4ZYA A;  2OD5 A;  3ZPL A;  1BIA A;  4O3M A;  5IT9 K;  3QPS A;  2W00 A;  2DK5 A;  3LSP A;  1XSX A;  1B59 A;  2CGP A;  2GBY A;  3ZP5 A;  1X2M A;  2Z99 A;  2V1D A;  3PUB A;  3O8G A;  3KYL A;  4G12 A;  5FFX A;  1LE8 A;  3CCM I;  3DTE A;  4UVB A;  1PUF B;  1PYV A;  2V79 A;  2DPU A;  2JA7 J;  2FBK A;  1P4A A;  1S6L A;  4UV8 A;  5M3M J;  1DP7 P;  3D1N I;  1VQ8 I;  3MVP A;  5D8L B;  1BOA A;  1GLN A;  3Q0W A;  4EV0 A;  4A5M A;  3HBL A;  3BTJ A;  5HOO A;  3DU6 A;  2Z5U A;  1B72 A;  4IOA F;  1F43 A;  1B9M A;  4IOC F;  2HOT A;  1TZL A;  1ZAR A;  3BR0 A;  1BIB A;  1SFE A;  2X48 A;  2MD5 A;  2A3S A;  4N9H A;  2DA6 A;  3H3V K;  5CLS A;  4XID A;  1HST A;  2MLK A;  4RAZ A;  3PUF A;  4G7O F;  1R5I D;  4M74 A;  4CXF A;  1JHF A;  1YQA A;  3ZN1 A;  1W1W E;  3Q0V A;  2MD0 A;  2OBP A;  2FBH A;  3IRR A;  1H89 C;  1MBH A;  3ZGK A;  5JVG F;  5K5Q A;  2EIJ H;  3ML6 A;  2HI3 A;  1IRX A;  2P8T A;  1T0F A;  3TKY A;  2KFD A;  2L9R A;  1H9G A;  4BEH B;  4OMZ A;  2V1X A;  5D5U B;  2EIN H;  4HF2 A;  3QPT A;  2R0Q C;  1ZTR A;  2R5Y B;  3KP3 A;  3DKY A;  3K69 A;  5CVU A;  3L2V A;  2DBB A;  2HFH A;  2M4K A;  1LPQ A;  2RKH A;  2JTV A;  3MZY A;  4I0A A;  3FXQ A;  1N77 A;  3GYH X;  1V5F A;  4YEJ A;  2VJI A;  3GTL J;  1GVD A;  3CP2 A;  4L0Z B;  1TWC J;  3KE2 A;  2H1L A;  4CZZ A;  5L3E A;  3M3Y J;  1MMN A;  1MMS A;  1JT6 A;  5HS9 A;  1SVL A;  5JR3 A;  3K2A A;  1WJE A;  1E3H A;  3RZO J;  1OIS A;  1SVM A;  1ZGJ A;  1WSU A;  3GCM A;  4U0Y A;  4RB0 A;  4WXC A;  2HOS A;  1A04 A;  5KHD A;  3K4C A;  1T08 B;  2X1D A;  4HYE A;  3A4C A;  2DA7 A;  1YJW I;  4XRM A;  4A12 A;  1R5G A;  1Z1D A;  3F8B A;  1DP3 A;  1NH3 A;  1FIP A;  1PVE A;  3L2C A;  1K61 A;  4BJ6 C;  1KQ9 A;  2COB A;  2TRT A;  3I71 A;  3MD2 A;  3FXR A;  5HS7 A;  1XTA A;  5K7H A;  4ZC3 A;  2HDD A;  2HDC A;  2JMW A;  4BNC A;  2ELK A;  1WH7 A;  3HXL A;  3ZQQ A;  2IBD A;  2GOM A;  3K70 C;  2DMN A;  4F52 A;  2MH9 A;  4HST A;  2HPM A;  3ZMT A;  1I1S A;  2O8X A;  2H6C A;  4DYC A;  2DJN A;  5J8C A;  1J0R A;  3CJT B;  1MSF C;  3OSG A;  5DUK A;  1J59 A;  4B3A A;  4UXN A;  5F04 A;  4FIS A;  1LVA A;  4TV7 A;  3OYG A;  3IWZ A;  3ROU A;  5E17 F;  4A3M J;  2M0C A;  4XRF A;  2AO9 A;  1HCR A;  2GWR A;  4F92 B;  4I98 B;  4Y15 A;  3PSI A;  3RKQ A;  4EJU A;  3CCV I;  2IA2 A;  3K4K A;  3GZ6 A;  3WG7 H;  2IS4 A;  5TIS C;  1YE9 A;  4U0W A;  1P6R A;  2XVC A;  4HW0 A;  5L3G A;  5HVQ C;  1GV2 A;  2ZO4 A;  2HTJ A;  2RDP A;  4XKB A;  3U21 A;  1XMK A;  1BBY A;  4PDK A;  1F36 A;  2HU9 A;  3WTZ A;  1RRJ A;  1K6Y A;  3KET A;  2J5O A;  1IDZ A;  3ZQG A;  1S7A A;  2R7Q A;  2MBF A;  2KRC A;  2V1N A;  2O61 A;  4BYY A;  1L3L A;  3FXU A;  4BJT A;  3CCR I;  3N4M A;  4I01 A;  1BC7 C;  1L0O C;  3HB9 A;  3I59 B;  4XN3 A;  2HXI A;  4O6J A;  4RGU A;  4I02 A;  3CTA A;  4LK1 F;  5EGO B;  4LG0 B;  4L18 B;  2FU4 A;  5DTD A;  1T98 A;  2E36 A;  2ZBK A;  1H88 C;  2E1O A;  4M6X A;  2NS0 A;  3P9I A;  1T6S A;  3GZN B;  2FQ4 A;  5EYR A;  2AQF A;  4IHY A;  2FD5 A;  2X85 A;  5FKO A;  5E8I A;  1IG7 A;  5F0F A;  1MBK A;  2QQ9 A;  1IRF A;  1D0Y A;  5KCM A;  3CMY A;  2F4M B;  2JQ7 A;  4I6Z A;  3TP3 A;  3I53 A;  2BXY A;  2BY3 A;  1TP4 A;  5CVV A;  3HOX J;  4ENK A;  3QU3 A;  2ELH A;  3CCU I;  1UCR A;  2GIZ A;  3EUA A;  1YFH A;  3MZ8 A;  2HQA A;  3F21 A;  3HHH A;  1JKR C;  4UY8 I;  1OYW A;  3MN2 A;  2HTS A;  2P7V B;  4CUG A;  1XN7 A;  3ASN H;  3EQL F;  4YEL A;  1WJ5 A;  5D6E A;  5B3S H;  5DCM B;  1W7P A;  2R7R A;  1XSD A;  2BBY A;  4A2U A;  5FJ8 J;  1J75 A;  1SC7 A;  5HS8 A;  3QP6 A;  4NBQ A;  1OLT A;  5GTI C;  1FYM A;  3BZ6 A;  3WU2 C;  4CCM A;  2X0L A;  4NC7 A;  2F5F A;  4RAF A;  1A36 A;  4G6T B;  3OWT A;  3K6G A;  2GZW A;  3E5U A;  4KIC A;  1AWC A;  3FXM A;  2K9M A;  5FKN A;  5D6F A;  2VB6 A;  5L3F A;  1MJA A;  5IT3 A;  3KEO A;  4G6Q A;  4HEA 2;  4EJO A;  5TGT A;  3IAM 2;  4ZDP A;  2A07 F;  4G9Y A;  1JKO C;  2LP0 A;  3IKV A;  3GTM J;  4L9T A;  2LBF B;  3W6J B;  4CCN A;  1JUP A;  1BW6 A;  4NNJ A;  3U9G A;  4A6E A;  4BAC A;  1BN5 A;  3G4S I;  4KIB A;  1WWX A;  3H0G J;  4Q5S F;  4L9J A;  3BZC A;  4NC8 A;  4D9J A;  4PK4 A;  2XAS A;  4P1W A;  2GA2 A;  5J4V A;  2AHQ A;  4I7H A;  3AAF A;  2M2E A;  4ZYG A;  1TL8 A;  2V9P A;  2KHM A;  3JSP A;  3OS1 A;  3OR2 C;  1OQY A;  4F55 A;  2D2W A;  2KMU A;  3UNG C;  3LNQ A;  2QEN A;  1B8I B;  4IHS A;  4GO1 A;  1RUO A;  2Y48 A;  2H09 A;  4A0X A;  1O7F A;  4RS8 A;  4EJW A;  3QOD A;  4DYQ A;  3FXO A;  3DV8 A;  4U88 A;  3H92 A;  4OIR F;  1SD4 A;  2EV0 A;  1BJA A;  4G7Z F;  2R5Z B;  2PJP A;  4Z6Y A;  2R7T A;  2W7N A;  3GVA A;  3CCE I;  3ABM H;  5CPR B;  1NHA A;  3FHN A;  1DUX C;  1TWG J;  5E1X A;  1D5V A;  2MC4 A;  4L5I A;  2DLL A;  2XPV A;  4XNF A;  1YHQ I;  5FKK A;  2HVQ A;  1ETO A;  2DTZ A;  5D5W B;  3KCC A;  4UB6 C;  3VDX A;  3OYI A;  3BRO A;  2ME0 A;  4P5O A;  4EVI A;  5F0H A;  1XX5 A;  2E19 A;  3HDD A;  5D4R A;  3HEF A;  2DA2 A;  1J09 A;  1KA8 A;  2VQL A;  1EF4 A;  2HQ5 A;  5FRN A;  3AG4 H;  4GYI A;  3D0S A;  4JQF A;  5LBQ A;  2M8G X;  4BAY A;  2GA1 A;  4XM3 A;  4HOB A;  4L5J A;  2IRF G;  2L2O A;  4YFN F;  3CJN A;  3L7W A;  1HW5 A;  3HSF A;  4Y33 A;  5A2Q K;  4X0G A;  2FQ3 A;  4XRS G;  1GXP A;  5F0C A;  4HDU A;  3VYR B;  3NQO A;  2A69 F;  4XLE A;  5K1Y A;  1SEU A;  2HVR A;  5IPA A;  2JUC A;  4PSX A;  3CC2 I;  2OJE D;  3J7Z I;  2L3D A;  4OIN F;  2IS2 A;  1V5E A;  1FP2 A;  1KU2 A;  3FIW A;  3K1N A;  4RM3 A;  1R1U A;  1YW7 A;  3QWL A;  2V1U A;  1VND A;  4A3I J;  2PJR B;  2V6C A;  2PI0 A;  3K10 A;  4DBQ A;  3I4N J;  1SFO J;  2JSP A;  1U8B A;  3H3Z A;  3V8K A;  3TQN A;  4B4C A;  3HOU J;  1VQ7 I;  1ERD A;  4IQJ A;  1Z77 A;  2KLO A;  3TOB A;  3JRB A;  2E5Z A;  1WJB A;  1BI3 A;  4KMU X;  1Y0N A;  3P7N A;  4IKF A;  2RNJ A;  3HOY J;  5E1W A;  1S3J A;  3G6E I;  4D5C A;  2P5K A;  3JAM K;  2R7O A;  1HBX G;  1XPX A;  2A68 F;  2XUB A;  3C18 A;  2KIU A;  2OA4 A;  4M3E A;  5IOY A;  4BXU A;  1K4T A;  4E70 A;  3NRV A;  3CF5 F;  2RV8 A;  4CIC A;  2X6O A;  1JGG A;  3QPH A;  1X2N A;  1X1P A;  3OYB A;  2QF7 A;  1FMW A;  2L9N A;  3ISP A;  4YFX F;  2LTP A;  2Y69 H;  1GVJ A;  1O3Q A;  4OAZ A;  2DT7 B;  2KL4 A;  4R8H A;  3DWL E;  4FT8 A;  2KRH A;  4BXX J;  1HF0 A;  2ECB A;  3W6V A;  1VI0 A;  3PM1 A;  1BC8 C;  2XPU A;  4ZTJ A;  1ZQ3 P;  2WC2 A;  1RES A;  4P96 A;  4DZJ A;  2LRD A;  2K40 A;  4KT6 A;  2K4B A;  5CYV A;  2L9V A;  4E7I A;  2CW8 A;  3HM5 A;  1JT0 A;  3OY9 A;  4LD5 A;  2BVL A;  2UUZ A;  2H6B A;  2VOD A;  3ESW B;  1T33 A;  3S15 J;  4PGH A;  1MW7 A;  2F5E A;  1LEB A;  1BR1 A;  2DA1 A;  3T0Y A;  5FKM A;  3JW4 A;  3I64 A;  2JRM A;  2EFO A;  1FP1 D;  5F27 A;  5IP6 A;  2HS5 A;  1EKE A;  2DFH A;  3I59 A;  3M8F A;  1REP C;  3FKI J;  1H9T A;  2ESH A;  2NVT J;  3RCO A;  2ZXH A;  2L7K A;  2E2I J;  2XB0 X;  2Z1D A;  4IZZ A;  2QGU A;  4IRG A;  1Z9C A;  3F23 A;  4QLC U;  4HX7 A;  4UUT A;  2ZJR F;  3I9V 2;  1HDP A;  3DKW A;  1D1A A;  2P81 A;  1D5Y A;  3G73 A;  2VI6 A;  3OMY A;  1DGR M;  3I5U A;  3CCQ I;  3HOW J;  3HOT A;  2R7W A;  2P6S A;  2HYF A;  2Z3Y A;  4H4K C;  1LDK B;  2LMD A;  4LGW A;  5BPD A;  3G1M A;  1JTY A;  2W82 A;  1TT0 A;  3GZ5 A;  4ABZ A;  2IGO A;  4A3G J;  3KEY A;  4HX8 A;  1HC8 A;  4JOM A;  3CD6 I;  2QSH X;  4IJA A;  2XC7 A;  2EIK H;  5J40 A;  2Z9O A;  2OTJ I;  3BJ6 A;  4E7L A;  3BG6 A;  1G3T A;  2WAD A;  3GME A;  4FX0 A;  2F5C A;  3F8M A;  2DFF A;  3E6D A;  4ENJ A;  2IW5 A;  4KFC A;  2PJR A;  1WJA A;  4KN7 X;  3CP8 A;  4PFP A;  3RKY A;  1NK3 P;  3ECH A;  1OYY A;  1K83 J;  3L00 A;  3G3Z A;  5HNH A;  1FY7 A;  5ICE A;  3H9G A;  5EG0 B;  5ICC A;  2KT0 A;  2E7X A;  3F6V A;  3UKG A;  1RET A;  3U2R A;  2P5V A;  2HVS A;  3TO7 A;  2A6H F;  2IEK A;  5BNG A;  3LSJ A;  2F6C A;  3R61 A;  4C3I J;  3CZ6 A;  2Q1Z B;  1UB9 A;  4BKX A;  1W0U A;  1XDU A;  2VOP A;  3V7C A;  1EH7 A;  1MBE A;  4DOZ A;  2GIV A;  2M3A A;  2HEO A;  1ZHF A;  2NOG A;  2CSO A;  2E1M B;  1I3Q J;  3N05 A;  3BG9 A;  3I58 A;  3JR9 A;  2R7Z J;  4CCK A;  3HOZ J;  3BJA A;  3DBH B;  4I09 A;  5DCF A;  4XSX F;  2F4O B;  2M34 A;  2C6Y A;  1RZ4 A;  1MBG A;  2F48 A;  2YUS A;  5HDK A;  3ULQ B;  1I27 A;  2W48 A;  3I4P A;  2W1O A;  1JKP C;  3ONQ A;  3HZJ A;  3V42 A;  3WHC A;  2Y0M A;  1FYL A;  4E7S A;  1HOM A;  5HLI A;  2K27 A;  1DQU A;  4MO7 A;  2PMU A;  2K02 A;  1B6A A;  3F3X A;  2LVS A;  2WAF A;  3MQ0 A;  3GTJ J;  4PJM A;  2G7U A;  5EZG A;  4LIT A;  2X51 A;  3JSO A;  5FLX K;  3HL2 A;  3PQJ A;  4G7H F;  5LHG A;  3CO6 C;  2WA0 A;  2G7H A;  2K4J A;  2FJ1 A;  4HAM A;  1EH8 A;  3FHZ A;  2LKS A;  1FC3 A;  1FZP B;  3FXJ A;  1H8A C;  4MQV A;  4N4O B;  3WTS C;  1U2W A;  1IN4 A;  1LQ1 A;  4BQA A;  2EIM H;  2ESN A;  3BR3 A;  5IY5 H;  2RN7 A;  4AD9 A;  1D8K A;  2XKP A;  3Q0U A;  2BHY A;  3HRT A;  2YU9 J;  2FML A;  2FOK A;  2BW3 B;  3R0J A;  4OIP F;  4ZTF A;  1R58 A;  4WXD A;  2OUM A;  3U1D A;  2UWM A;  1X4O A;  2XAG A;  1BR4 A;  2I8D A;  2CQX A;  4II3 A;  1AKH A;  1QU3 A;  2E1N A;  1JJ6 C;  1H0M A;  5J8F A;  3L09 A;  4LIV A;  3KEQ A;  3SXY A;  3WHB A;  4B8X A;  2J5P A;  5KAF C;  4A3J J;  4LOC A;  4DNC A;  3C2H A;  4S04 A;  3OYF A;  3SFI A;  4OMY A;  4G8X A;  2V26 A;  3BOQ A;  1A6Q A;  2HNH A;  4JYK A;  2IVM A;  2DMU A;  1N25 A;  1FBU A;  2CFO A;  5EGO A;  1TC3 C;  5BQT A;  1PUF A;  1WHU A;  3A1Y A;  2JA6 J;  3WOD F;  2GXG A;  1POG A;  2HYG D;  1E0E A;  4XSZ F;  1XMX A;  5B1A H;  3LA7 A;  3MZH A;  1RIO H;  5F64 A;  4KNY A;  3B02 A;  4C2T A;  4XIC A;  3ABL H;  3FBN B;  4BHB A;  1FNN A;  4LB5 A;  2L01 A;  4PSW A;  4HA8 A;  1TTY A;  2MA3 A;  5EDN A;  3F9K A;  4NQW A;  1XCV A;  1KYW A;  2KP6 A;  2L7M P;  4LJZ F;  3RQ4 A;  2ZKZ A;  3LMM A;  2BE5 F;  1RKW A;  5J6X A;  4E4H A;  1HA8 A;  3OR1 C;  2BZT A;  2LC2 A;  2CMP A;  2M1B A;  3LSI A;  5EF6 A;  4IF4 A;  1O3T A;  2JA2 A;  3CDH A;  1BA5 A;  1XC5 A;  2CH0 A;  5GPA A;  3IAS 2;  2XRL A;  1TWF J;  3QYF A;  2VKE A;  1O3R A;  2EFN A;  2EFP A;  4A6D A;  1IC8 A;  1WJF A;  1X4P A;  3BC8 A;  4RGX A;  2VON A;  3ECO A;  3G2B A;  4ESF A;  2VT3 A;  2X1C A;  2QVO A;  3V7S A;  3IHU A;  1G3S A;  2KDO A;  4CA0 A;  2QQB A;  4E7J A;  2VT2 A;  3C3W A;  2A6E F;  1Z67 A;  3R0A A;  4M73 A;  1WJC A;  2Y31 A;  1TBX A;  1Z7L A;  2XGD A;  3DEE A;  4M3F A;  3F8F A;  3UR3 C;  3QRF F;  1XGM A;  1B1B A;  1LB2 A;  1YW9 A;  3HKZ N;  4C3J J;  2QA4 I;  1V3F A;  3BZK A;  3TGN A;  5KNL A;  5LHH A;  2KZG A;  1TLH B;  4Y17 A;  3CLQ A;  3I54 A;  4QPO A;  3LAP A;  1S7O A;  1IN5 A;  3L1P A;  4AIH A;  4EMS A;  2HWV A;  5ILV A;  2ZXI A;  2O03 A;  1R22 A;  1VTN C;  3E0J B;  3PFY A;  3RJP A;  3WU0 A;  4OIQ F;  3A02 A;  3OYH A;  2E71 A;  4M9Z A;  3T8R A;  3F22 A;  3FMS A;  2HQN A;  4HNV A;  2FOW A;  2KJC A;  2OZU A;  4BUP A;  3TP0 A;  4KIG A;  1XDS A;  2Q2E B;  4RMN A;  3ZQC A;  1F9N A;  3D5S C;  1CGP A;  1MBF A;  2MGQ A;  2D5V A;  4BHP A;  1UJ8 A;  1FTT A;  4NQW B;  1U5T B;  4FX4 A;  1G3W A;  4KIS A;  2VKV A;  3DCF A;  1YLF A;  1YIJ I;  3S1N J;  1KQ0 A;  3T1B A;  4BL0 B;  1SD7 A;  3EYY A;  4GDF A;  3JRE A;  4IHW A;  4FTH A;  3DEU A;  2QEX I;  1ZGW A;  4ZYD A;  4AID A;  4CSW A;  3QYB A;  4B1R A;  2R5Y A;  2WWY A;  3VYS B;  4BEH A;  2CUZ A;  3SEQ A;  1K78 B;  3S14 J;  3FIS A;  2HZD A;  2K3P A;  1HQC A;  4UHT A;  1LDD A;  3DLL F;  4KIT B;  2HGC A;  2PFB A;  5HDG A;  1MKM A;  1TQP A;  2EA4 A;  2ZNY A;  3QP5 A;  4MIM A;  2XAF A;  4A3C J;  5L3C A;  2CG4 A;  2EZH A;  3SHF A;  3L2W A;  4BU2 A;  4XL9 A;  1YIO A;  1WCM J;  2K9N A;  1OCP A;  4MEY F;  1FOX A;  2NVX J;  3OOP A;  5E8G A;  2OTL I;  1IXS B;  3KLO A;  4XQF A;  3JRF A;  2O5R A;  2LY9 A;  1XB4 A;  3LFK A;  2WB1 A;  2Y0S N;  3W2W A;  4BE2 A;  4LLG F;  4Q47 A;  4F7Z A;  2VN2 A;  3PIO F;  2XAU A;  1GHC A;  2IS6 A;  2CV0 A;  4EGZ A;  1J7K A;  2O3F A;  3SZG A;  1FBS A;  4HX4 A;  1AOY A;  4PJL A;  1Q1V A;  2GAU A;  3QOE A;  2CRG A;  4MFE A;  4P9U A;  3K1M A;  4XOP A;  4CYC A;  4V19 K;  3RPQ A;  4IHX A;  2RQQ A;  4KJZ A;  2Z33 A;  3JTH A;  5EJC A;  3GLX A;  2KZV A;  3FWE A;  3V4G A;  3SZT A;  2IGK A;  3H5R A;  2FX0 A;  2ID3 A;  2XAH A;  2DMP A;  1EJ9 A;  1O4X A;  5BPI A;  2B9S A;  2MH2 A;  4YII A;  1RC9 A;  2XF7 A;  1S8N A;  3BTI A;  3T5X A;  1G59 A;  2Y0S A;  1QHH D;  2JA8 J;  5DDG A;  4RAY A;  2N8G A;  3K9T A;  2ZNZ A;  1SMY F;  4CCO A;  1FTZ A;  3SZP A;  2DQL A;  1U5T A;  3IUO A;  4C9Y A;  3TO6 A;  3KZI C;  4MGR A;  4HF1 A;  3KP6 A;  1ETK A;  3MWM A;  5IP9 J;  4DQ2 A;  1IO2 A;  2LDU A;  1SFU A;  1V55 H;  1R5H A;  2F5D A;  2NNY A;  3IL2 A;  1VFC A;  3FMQ A;  4BE1 A;  2X9D A;  2FF4 A;  1LVK A;  4MLO A;  1RKT A;  5H2F C;  1FIA A;  1T0F C;  3EPZ A;  3BY6 A;  3F72 A;  1HLV A;  2B0L A;  3BP8 A;  3E5Q A;  3GO5 A;  5DS9 A;  3EYI A;  4KN4 X;  4HNU A;  3VB2 A;  2PMZ A;  4AVZ A;  3HPG A;  1Z91 A;  1ZR2 A;  2M9H A;  5FD5 A;  3Q9V A;  1QBJ A;  1P2F A;  2NS7 A;  1R36 A;  4W1U A;  5E1Z B;  1MSE C;  3ZMS A;  2HZT A;  4DYR A;  2MW8 A;  3LSR A;  3PO2 J;  1U9N A;  1MJ9 A;  4EJV A;  4UVA A;  3RPU A;  3TMO A;  4M71 A;  3I56 I;  3M8J A;  2EH3 A;  3W3C A;  5C4X J;  1OCO H;  3DEW A;  4Y3O A;  2GXB A;  1ETQ A;  3TL4 X;  1ETV A;  1X3Z B;  1YG2 A;  2IA1 A;  5L3B A;  2W57 A;  4UUS B;  2YSR A;  4RB2 C;  2E34 A;  4V2G A;  2VBW A;  3ASO H;  3B6C A;  5JI6 A;  2RRE A;  1C0W A;  2LG4 A;  2F5V A;  2L0K A;  2RQP A;  3A01 A;  1IV6 A;  3ABK H;  4U87 A;  5FLX Z;  3HJE A;  2RVC A;  2IPQ X;  3LOC A;  1YRN A;  1Y6I A;  2ADU A;  2K9L A;  2A6T A;  3DTI A;  3RYR A;  1TWH J;  1MND A;  3GX4 X;  1SFX A;  2CQQ A;  2R4G A;  4FCY A;  2JA5 J;  4M6V A;  5AON A;  2PMH A;  3QYE A;  3ZQ7 A;  3JRG A;  3BR2 A;  5LRS A;  3G71 I;  2H94 A;  2ZJQ F;  4HLX A;  1ZRC A;  4BY7 J;  2FNA A;  4AYB N;  3BTC A;  4RM2 A;  3RI4 A;  3I4M J;  3NAU A;  3PFI A;  3CUQ C;  2LY1 A;  3K4J A;  1X3W B;  3C2B A;  3JCU C;  2NVQ J;  5HLH A;  2QUF A;  1XGS A;  3GFM A;  3BCB A;  4EQQ A;  3HOS A;  2FXA A;  2NAZ A;  1WI3 A;  1TNS A;  3RPU D;  3V8L A;  1QVU A;  2IJL A;  3WE3 A;  2DO7 A;  5IOZ A;  2CU7 A;  3M9A A;  4F3Q A;  3ZMZ A;  5D8K B;  1B9N A;  3H36 A;  3Q9S A;  5FD6 A;  2CQ7 A;  1QGP A;  3WTV C;  3BR5 A;  3JRA A;  1ODD A;  1G2H A;  3S17 J;  2HXO A;  3ABU A;  2M5W A;  2CUE A;  3WTX C;  3ZQI A;  5TRD A;  3KFW X;  3BPV A;  3HPH A;  5CVJ A;  3TW7 A;  2LR8 A;  2XGX A;  4M3G A;  2K3F A;  2MFZ A;  1Z3Y A;  1GUU A;  2VE8 A;  1EH6 A;  3C2G A;  2ETH A;  2VXD A;  2DOF A;  3GTQ J;  1IRZ A;  2D1V A;  1HW1 A;  2OAZ A;  3OSF A;  2VC1 A;  1W0T A;  3S16 J;  4UUS A;  1QHG A;  3G1L A;  3P5J A;  1IAW A;  2JSC A;  2VBY A;  3CCY A;  4IQ4 A;  5BOX A;  1Y56 A;  5FB2 A;  5J1U A;  2BY1 A;  1NK2 P;  1QVT A;  1E2X A;  3WTT C;  3J7Y J;  2ZFU A;  5J47 A;  2M87 A;  3IRQ A;  4A3B J;  3RKW A;  1VQ9 I;  2ZXJ A;  2DYS H;  2ECC A;  5KK1 A;  3FMR A;  3D5L A;  1ZN2 A;  2FE3 A;  3SDB A;  4D1Q A;  1A6I A;  2HPI A;  2NNN A;  3PL8 A;  4YFK F;  3VOD A;  3B73 A;  5FRO A;  1KQ8 A;  5EG0 A;  4U0V A;  1FSH A;  4BHC A;  1W5S A;  5HNF A;  2Q8K A;  4KMF A;  1Z0X A;  2DJI A;  2ZSI B;  2A5Y B;  2LKP A;  2VQC A;  2OF7 A;  3BJO A;  4BH9 A;  3OS2 A;  4HQM A;  5J3L A;  3QQA A;  1T38 A;  2K9S A;  5HDN A;  3PO3 J;  3CCJ I;  2VQG A;  1DU0 A;  2VPR A;  4BBS J;  3A0B C;  4CH7 A;  4D7M A;  1N78 A;  1AU7 A;  2DFE A;  4EGY A;  3K2Z A;  3S3M A;  2GOX B;  1UHW A;  2WAE A;  2VOO A;  2NS8 A;  3S93 A;  2AXL A;  3HTU A;  3VEP A;  1OJL A;  1VQ6 I;  3LFU A;  2QBY B;  1DPU A;  2GQQ A;  2ICW G;  4EAT A;  1MDM B;  4DZP A;  1R9T J;  4KIF A;  3OL3 A;  4GYG A;  5AIP A;  4MHG A;  1FOY A;  3FX3 A;  2XHK A;  1YI2 I;  3FZV A;  4IL6 C;  1U78 A;  1OR7 A;  2HOE A;  1VZ0 A;  1P92 A;  1XGN A;  2ZJP F;  2F2E A;  2BV6 A;  3MEX A;  2XAQ A;  1YW8 A;  4JP0 A;  3BWG A;  1ETW A;  1GV5 A;  4IVN A;  4BBR J;  4P55 A;  1UMQ A;  2W24 A;  2XB5 A;  2K9Q A;  3OOU A;  2DOA A;  2K7L A;  4BDY A;  1Y8Q B;  4XLN F;  4E7H A;  2IGN A;  4YIF A;  3OIP A;  2XRO A;  5M3F J;  3FF5 A;  4G6D A;  3H9Q A;  3ERM A;  3W6K B;  3ZMU A;  1U8R A;  3VWB A;  3Q5F A;  3GTP J;  5AIQ A;  1JGS A;  4M6Y A;  4OU0 A;  1G3Y A;  3F6O A;  4A0Z A;  2VIX A;  3EUH A;  4CYD A;  1RPW A;  5EEG A;  1G6N A;  2EFQ A;  1JXS A;  4BE0 A;  2O7O A;  3E1S A;  1R6R A;  5DM7 F;  2LD5 A;  2LY2 A;  4EEF G;  1LFP A;  3QU6 A;  3GWZ A;  3K4N A;  4WX9 A;  1KYZ A;  2DAO A;  1MMD A;  3ZMV A;  2LKX A;  2CV1 A;  2KIF A;  3M07 A;  1D1B A;  3OL4 A;  1O7L A;  5JHF A;  3ZR8 X;  1ZAO A;  2QWW A;  2FUG 2;  3X2Q H;  2V6E A;  5LGT A;  2P5L C;  4ASN A;  4FE4 A;  4IPA A;  1ULY A;  3J81 Z;  4UNO A;  3A03 A;  2BEO A;  1Y8R B;  4UB8 C;  1J5Y A;  3DP7 A;  1XSV A;  2VJ4 A;  3GF2 A;  1IN6 A;  2JK3 A;  2PQ8 A;  2IXS A;  2HKX A;  4ZH4 F;  3JRH A;  4XLA A;  1Y0U A;  5JVT A;  3GFJ A;  5C4J J;  2L9S A;  1UAA A;  2ZC2 A;  2BXZ A;  3AKZ A;  1TQM A;  4KA4 A;  3T8T A;  3V7R A;  4AIJ A;  3H5N A;  1YOV B;  4ZYH A;  1JUM A;  1S72 I;  1XMA A;  1R1T A;  1UZC A;  1ZEL A;  3H0D A;  2DMT A;  2XSJ C;  3L9F A;  1IUY A;  3SJM A;  1BM9 A;  2XIG A;  4Q48 A;  3CME I;  1TW2 A;  3JAM Z;  1FMV A;  5DD4 A;  5EEA A;  5E79 C;  5IYD J;  2H27 A;  3G1O A;  2AQE A;  4OAY A;  2V9K A;  1RNL A;  2TCT A;  2L02 A;  2CQN A;  2WY7 Q;  4ITV A;  1BW5 A;  3AG3 H;  2E60 A;  5GP9 A;  1DGW Y;  5C3E J;  5CQG A;  3WGG A;  2PMZ N;  1ZYR F;  5GTH C;  1GT0 C;  1QQI A;  5DD8 A;  1IDY A;  4KYW A;  2NVY J;  3MMY B;  2MLG A;  4R79 A;  5LLQ A;  3S1Q J;  1IGN A;  4HRI A;  1K4S A;  1OFC X;  1W7P D;  3DF8 A;  2CWE A;  2CW7 A;  3BQY A;  4EM0 B;  1G8X A;  3PNT A;  2KQR A;  3GTK J;  3QOP A;  2M8E A;  1YRN B;  3TO9 A;  1QPI A;  4S05 A;  3KX2 A;  3ZN0 A;  1Y39 A;  4CHU A;  1F1Z A;  1VQN I;  3BTL A;  2DMQ A;  4W97 A;  2HQR A;  1VQL I;  5DM6 F;  5J4Y A;  4O5V A;  3R60 A;  1Z21 A;  2ZB9 A;  4HSR A;  3HOV J;  4XKC A;  2JUG A;  2DI3 A;  1HSJ A;  3S3O A;  3HUG B;  2EV6 A;  3VSK A;  1OCZ H;  2JPC A;  2NOJ B;  3HYI A;  1UEL B;  1UHS A;  2KKO A;  1IN8 A;  3DLA A;  1OR7 C;  2VQH A;  2PN6 A;  2ACJ A;  2XF6 A;  3B6A A;  3H1C A;  3ZCO A;  3CC4 I;  4NC6 A;  4QPQ A;  1B8I A;  4LB6 B;  4C3H J;  1LE8 B;  3K1P A;  3PQK A;  3LSM A;  2DOD A;  4RB3 C;  2B63 J;  1U9O A;  2H1K A;  2R7V A;  2R5Z A;  3K4M A;  3I0T A;  1RR8 C;  1STZ A;  1IV8 A;  2LK2 A;  1ACI A;  4CGZ A;  4PGG A;  3SDG A;  1K79 A;  1YYV A;  2EZL A;  3VSL A;  4WK8 F;  3KP4 A;  2R3S A;  3EDP A;  1W36 D;  1K78 A;  4IX7 A;  4UUV A;  1G4D A;  3R6S A;  1FOW A;  1YO5 C;  4HV5 A;  3PIP F;  2D45 A;  1PDN C;  3K4L A;  5K5R A;  1IN7 A;  2Y2Z A;  1TT5 B;  1ZRE A;  1AA7 A;  1YX5 A;  2VKD A;  1ZKG A;  2X6W A;  3CDL A;  3P9K A;  3PNV A;  3FM5 A;  4XON A;  4IRH A;  3DBL B;  4F91 B;  3K4B A;  1MH4 A;  2O0Y A;  3FDY A;  4XN0 A;  5GAH J;  5LRR A;  1QO0 D;  2E2J J;  4BS9 A;  2VE9 A;  1JKQ C;  1FX7 A;  4RGS A;  2QKL B;  3GFI A;  2EJR A;  1ZG1 A;  1MNM C;  2M0M A;  5HLT A;  1ZH5 A;  1JHH A;  3HRS A;  3I3L A;  3OYE A;  2BY2 A;  2UXN A;  2VJJ A;  2YX4 A;  3O8H A;  1NG7 A;  2IGM A;  2WAQ A;  1OKR A;  2R7D A;  5GAE J;  3RSN A;  3RTR A;  3M8E A;  3ZOB A;  4RA2 A;  4E7Z A;  4C2U A;  1FPQ A;  4A5N A;  2YS9 A;  3GUD A;  1VQ5 I;  2HKO A;  2MC3 A;  4IRI A;  2R93 J;  2K85 A;  1FJL A;  1ETX A;  2YU3 A;  3ERE D;  2QSG X;  3S1M J;  1A5J A;  2JVG A;  2ZME A;  5F1J A;  4RBO A;  3GTG J;  1SMT A;  2VL8 A;  2RGV A;  1HKT A;  3O6B B;  3NWT A;  2E7W A;  4GFB A;  3LA2 A;  2DTR A;  2STW A;  2LF7 A;  2QSF X;  4ZZD A;  3SEZ A;  3LQR A;  2IAI A;  1YS6 A;  2OV7 A;  3HSR A;  1RR7 A;  3SQN A;  1WKM A;  4BJ5 C;  5ICG A;  3S1R J;  1X1B A;  1KU3 A;  4WF2 A;  4FET A;  2L7Z A;  4BGD A;  2KIQ A; 
#chains in the Genus database with same CATH homology
 2L54 A;  3E3V A;  4GCV A;  1EV7 A;  1MGT A;  3M1E A;  1P4X A;  3V8J A;  1MD0 A;  2EV5 A;  2WV0 A;  1XGO A;  3ELK A;  2STT A;  5CJ9 A;  5LGN A;  2PEX A;  2W85 A;  3WTY C;  2QBY A;  2EWN A;  1U6G A;  1WI9 A;  4LK0 F;  2NRA C;  3DFG A;  1OYI A;  4WXH A;  1IF1 A;  3VFZ A;  3KP5 A;  2DPD A;  4MQ9 F;  2Q2E A;  3HHG A;  4R1H A;  5BMZ A;  1PUE E;  2EB7 A;  2Y75 A;  1D8J A;  1ZG5 A;  1F5T A;  5BS6 A;  2FBI A;  5F6F A;  1B4A A;  1R1V A;  3HSE A;  4HV6 A;  2YPR A;  5F1R A;  5L3D A;  4HF0 A;  2CO5 A;  2EK5 A;  3IKT A;  1J2X A;  5FGM A;  3KP7 A;  1ZLJ A;  2JRT A;  2EFW A;  4CDG A;  5DEQ A;  3COA C;  2KRF A;  4LFU A;  1T2K A;  4LLL A;  3HTS B;  3E6B A;  2IT0 A;  4EM2 A;  1O3S A;  3P9C A;  4UV9 A;  3C7J A;  3O2P E;  4I0B A;  5DYM A;  3DPT A;  2UXX A;  3MFK A;  2WTE A;  2DW4 A;  1OMI A;  2JZY A;  3KLN A;  2XRN A;  4OOI A;  3E6M A;  2JT1 A;  3J81 K;  2OU2 A;  3KZY A;  5K5O A;  2A61 A;  2VBZ A;  2FMY A;  1HKQ A;  4ENM A;  1W5T A;  4ZYE A;  4ESB A;  3GFL A;  1W7P B;  3WTW C;  3HIF A;  3S2W A;  4WWC A;  2M30 A;  4OIO F;  4ETS A;  1IZ1 A;  1IRG A;  1UFM A;  3OV8 A;  1YS7 A;  4MNU A;  2PBI A;  4PZJ A;  3MCZ A;  3HRU A;  3IWF A;  3FM3 A;  4XBF A;  4Q4Z F;  1FOK A;  1KGS A;  2K86 A;  2X4H A;  2G9W A;  1CF7 B;  3RYP A;  2P6T A;  5KVR A;  1ONV A;  4YG2 F;  3RKX A;  2LF8 A;  3NEU A;  2IP2 A;  2UZK A;  3WU1 B;  2XV4 S;  4CO8 A;  2V9V A;  3LST A;  4WCG A;  1K6O A;  2LSO A;  2CQK A;  4A0Y A;  4HQE A;  4EJT A;  3E6C C;  1Q1H A;  1TNT A;  1V4R A;  1F4K A;  2KIM A;  4HZF A;  4L9V A;  2YR2 A;  3REO A;  1ZRD A;  4LG0 A;  1SD6 A;  1BI2 A;  5TJJ A;  5CVI A;  4M72 A;  2DU9 A;  3EET A;  4K2E A;  1IXR C;  3DXJ F;  5ICF A;  2M45 A;  1OPC A;  5ILU A;  2ISY A;  3N97 A;  4QWQ A;  1WRJ A;  4XLP F;  2FRH A;  4Z2Y A;  1USS A;  3C1D A;  1HW2 A;  1QNT A;  3HRM A;  4Y13 A;  2XAJ A;  2OQG A;  3E97 A;  3MAJ A;  3CUQ B;  4GGG A;  2W25 A;  1SD5 A;  4JK1 X;  2FEZ A;  4FHT A;  5D4S A;  1KU7 A;  4L0Y B;  1P4W A;  4ON0 A;  2AS5 F;  4HBL A;  5H20 A;  3WG9 A;  3J7A O;  3CUO A;  1D3Y A;  1JE8 A;  1TQI A;  1PP7 U;  2HR3 A;  2KJB A;  1R7J A;  4M9X A;  3J80 Z;  5ERI A;  2RC4 A;  3E5X A;  4IXA A;  1MZB A;  1FBQ A;  1QZZ A;  2YX7 A;  5JFR A;  1FLI A;  2ZME B;  1R00 A;  4I2O A;  1J9I A;  4ENN A;  1U3E M;  2DK8 A;  4LMY A;  1W4M A;  4AIK A;  4M9S A;  1RUN A;  4D0P A;  2W84 A;  5LEJ A;  5A2Q Z;  1ON2 A;  5D5X B;  4ESJ A;  1UHM A;  2PLY A;  1RI7 A;  2QZ8 A;  4AVP A;  4HDV A;  3WTU C;  2NYX A;  1XCB A;  3LAJ A;  2VXZ A;  1E17 A;  1HXD A;  4P9F A;  2CW0 F;  2E1C A;  1U5T C;  4N0B A;  2QYO A;  3CO7 C;  1FSE A;  4ZZL A;  3JTG A;  1K7A A;  4UVC A;  1TW3 A;  4KDP A;  1ZG3 A;  1LEA A;  1I5Z A;  4GXO A;  3VOE A;  5FFZ A;  2DT5 A;  4PCQ A;  1ON1 A;  4B09 A;  3DPL C;  2COM A;  1DPR A;  1FT9 A;  4MEX F;  5H6R A;  1WQ2 A;  2D1H A;  2Q0O A;  2OZ6 A;  3TDZ C;  2FNP A;  3WGI A;  2DFI A;  3F8C A;  1Z6T A;  2O6G E;  5D5V B;  2ZCW A;  2IA0 A;  4G94 A;  3RIR A;  1IXC A;  1UST A;  1T39 A;  4KT5 C;  1I1G A;  5EEH A;  2L4A A;  1LDJ A;  1BI1 A;  3K0L A;  1SAX A;  1LJ9 A;  3O3K A;  5LGU A;  2XKO A;  1IW7 F;  4U7D A;  2QLZ A;  4IHT A;  4AWX B;  3TOA A;  3H3U A;  5LEK A;  3LWF A;  1HKS A;  3ZMD A;  1Z7U A;  3LQQ A;  1QPM A;  4NB5 A;  2FSW A;  2QM3 A;  1PP8 F;  3LA3 A;  2JPB A;  5H6Q A;  4RB1 A;  3R4K A;  1MDM A;  4N9I A;  1KU9 A;  1DDN A;  4MTE A;  1R23 A;  3QAH A;  1I6X A;  1LNW A;  4HLY A;  1Z6R A;  5DUI A;  2ZJ2 A;  2L4M A;  2DQR A;  3CLO A;  2OQR A;  5LHI A;  3KP2 A;  3ABT A;  5IT9 Z;  1FYK A;  3DQV C;  5ED4 A;  1CF7 A;  2TDX A;  2BGC A;  1S29 A;  5DV5 A;  5ILS A;  2CYY A;  1BI0 A;  4L9N A;  5JHU A;  2QQA A;  4EM1 A;  3IC7 A;  1GXQ A;  5HLG A;  1FWZ A;  3GW2 A;  1YTY A;  2EA2 A;  3KZZ A;  4H0E A;  1O57 A;  2LNB A;  3BDD A;  5E20 A;  4RGR A;  2CFX A;  3WGH A;  2P7C B;  1ZLK A;  3TDU C;  2PG4 A;  4NHJ A;  1MJB A;  1XD7 A;  3F8N A;  4U7B A;  1ZGA A;  3SFZ A;  3M7G A;  3GXO A;  5FO5 A;  3WE2 A;  1ZRF A;  3HUG A;  1QZY A;  2R7F A;  1Z05 A;  4MTD A;  3BPX A;  3GEZ A;  6PAX A;  1X3U A;  2VBX A;  3J80 K;  2ZFW A;  2FA5 A;  5DCM A;  2ISZ A;  2BYV E;  5CVR A;  2P4W A;  2VC0 A;  4LLN A;  3RDI A;  3CUQ A;  4KUM A;  5E18 F;  4JBA A;  2OD5 A;  3ZPL A;  1BIA A;  4O3M A;  5IT9 K;  2DK5 A;  1XSX A;  1B59 A;  2CGP A;  3ZP5 A;  2Z99 A;  2V1D A;  5FFX A;  4UVB A;  2V79 A;  2DPU A;  2FBK A;  1DP7 P;  1P4A A;  1S6L A;  4UV8 A;  5D8L B;  1BOA A;  4EV0 A;  4A5M A;  5HOO A;  2Z5U A;  1B9M A;  1ZAR A;  1BIB A;  1SFE A;  2MD5 A;  2A3S A;  4N9H A;  5CLS A;  1HST A;  2MLK A;  4RAZ A;  4G7O F;  4M74 A;  4CXF A;  1JHF A;  1YQA A;  3ZN1 A;  3IRR A;  2OBP A;  2FBH A;  5K5Q A;  3ML6 A;  2P8T A;  1T0F A;  3TKY A;  1H9G A;  4OMZ A;  2V1X A;  5D5U B;  4HF2 A;  3QPT A;  3KP3 A;  3K69 A;  5CVU A;  2DBB A;  2HFH A;  2RKH A;  2JTV A;  3MZY A;  4I0A A;  3FXQ A;  3GYH X;  4L0Z B;  3KE2 A;  4CZZ A;  5L3E A;  5HS9 A;  5JR3 A;  1ZGJ A;  1WSU A;  4U0Y A;  4RB0 A;  4WXC A;  1A04 A;  4HYE A;  4A12 A;  1R5G A;  1Z1D A;  3F8B A;  3L2C A;  1KQ9 A;  3I71 A;  3FXR A;  5HS7 A;  2HDC A;  4BNC A;  2MH9 A;  3ZMT A;  1I1S A;  2O8X A;  2H6C A;  5J8C A;  1J0R A;  5DUK A;  1J59 A;  4UXN A;  1LVA A;  4TV7 A;  3IWZ A;  3ROU A;  5E17 F;  4XRF A;  2GWR A;  4I98 B;  4Y15 A;  4EJU A;  2IA2 A;  3GZ6 A;  4U0W A;  1P6R A;  2XVC A;  4HW0 A;  5L3G A;  5HVQ C;  2ZO4 A;  2HTJ A;  2RDP A;  1XMK A;  1BBY A;  4PDK A;  3WTZ A;  3KET A;  2J5O A;  1S7A A;  2MBF A;  2O61 A;  4BYY A;  1L3L A;  3FXU A;  3N4M A;  4I01 A;  1BC7 C;  1L0O C;  3I59 B;  4O6J A;  4RGU A;  4I02 A;  3CTA A;  4LK1 F;  4LG0 B;  4L18 B;  2FU4 A;  1T98 A;  2ZBK A;  4M6X A;  2NS0 A;  3P9I A;  1T6S A;  5E8I A;  2QQ9 A;  1IRF A;  3I53 A;  5CVV A;  4ENK A;  3QU3 A;  2ELH A;  1UCR A;  1YFH A;  3F21 A;  3HHH A;  1OYW A;  2HTS A;  2P7V B;  1XN7 A;  3EQL F;  5D6E A;  5DCM B;  1W7P A;  1XSD A;  2BBY A;  4A2U A;  1J75 A;  5HS8 A;  3QP6 A;  1FYM A;  3BZ6 A;  2X0L A;  2F5F A;  2GZW A;  3E5U A;  4KIC A;  1AWC A;  5D6F A;  5L3F A;  1MJA A;  5IT3 A;  3KEO A;  4G6Q A;  4EJO A;  2A07 F;  4G9Y A;  3IKV A;  4L9T A;  3W6J B;  3U9G A;  4A6E A;  1BN5 A;  4KIB A;  1WWX A;  4Q5S F;  4L9J A;  2XAS A;  2GA2 A;  4I7H A;  3AAF A;  4ZYG A;  3JSP A;  2D2W A;  2QEN A;  4IHS A;  4GO1 A;  1RUO A;  2Y48 A;  2H09 A;  4A0X A;  1O7F A;  4RS8 A;  4EJW A;  3DV8 A;  4U88 A;  3H92 A;  4OIR F;  1SD4 A;  2EV0 A;  1BJA A;  4G7Z F;  2PJP A;  3GVA A;  1NHA A;  1DUX C;  5E1X A;  1D5V A;  4L5I A;  2DLL A;  5D5W B;  3KCC A;  3BRO A;  4P5O A;  4EVI A;  5D4R A;  1KA8 A;  4GYI A;  3D0S A;  4JQF A;  5LBQ A;  4BAY A;  2GA1 A;  4HOB A;  4L5J A;  2IRF G;  4YFN F;  3CJN A;  3L7W A;  1HW5 A;  3HSF A;  5A2Q K;  1GXP A;  2FQ3 A;  4HDU A;  3NQO A;  2A69 F;  5K1Y A;  2L3D A;  4OIN F;  1FP2 A;  1KU2 A;  3K1N A;  1R1U A;  1YW7 A;  2V1U A;  2V6C A;  2PI0 A;  3H3Z A;  3V8K A;  3TQN A;  3TOB A;  1BI3 A;  4KMU X;  3P7N A;  2RNJ A;  5E1W A;  1S3J A;  2P5K A;  3JAM K;  1HBX G;  2A68 F;  2XUB A;  3C18 A;  2KIU A;  2OA4 A;  4BXU A;  4E70 A;  3NRV A;  2RV8 A;  4CIC A;  3QPH A;  3ISP A;  4YFX F;  1O3Q A;  1GVJ A;  4R8H A;  4FT8 A;  1BC8 C;  2WC2 A;  4P96 A;  2K4B A;  5CYV A;  4LD5 A;  2H6B A;  2VOD A;  4PGH A;  2F5E A;  1LEB A;  3T0Y A;  3JW4 A;  3I64 A;  2EFO A;  1FP1 D;  2HS5 A;  3I59 A;  3M8F A;  1REP C;  1H9T A;  2ESH A;  4IRG A;  1Z9C A;  3F23 A;  4QLC U;  4HX7 A;  3DKW A;  3G73 A;  3I5U A;  3HOT A;  2P6S A;  2HYF A;  2Z3Y A;  1LDK B;  4LGW A;  5BPD A;  3GZ5 A;  4HX8 A;  4IJA A;  2Z9O A;  3BJ6 A;  1G3T A;  4FX0 A;  2F5C A;  3F8M A;  3E6D A;  4ENJ A;  2IW5 A;  4KFC A;  4KN7 X;  3RKY A;  3ECH A;  1OYY A;  3L00 A;  3G3Z A;  1FY7 A;  5ICE A;  5ICC A;  2E7X A;  3F6V A;  3U2R A;  2P5V A;  3TO7 A;  2A6H F;  3R61 A;  1UB9 A;  1XDU A;  2VOP A;  3V7C A;  1EH7 A;  2GIV A;  2HEO A;  1ZHF A;  2CSO A;  3I58 A;  3BJA A;  4I09 A;  5DCF A;  4XSX F;  2C6Y A;  1RZ4 A;  5HDK A;  3ULQ B;  1I27 A;  3I4P A;  2Y0M A;  1FYL A;  5HLI A;  2K27 A;  2PMU A;  2K02 A;  1B6A A;  3F3X A;  3MQ0 A;  2G7U A;  3JSO A;  5FLX K;  4G7H F;  3PQJ A;  5LHG A;  3CO6 C;  2G7H A;  2K4J A;  4HAM A;  1EH8 A;  3FHZ A;  1FZP B;  1FC3 A;  4MQV A;  3WTS C;  1U2W A;  1IN4 A;  1LQ1 A;  4BQA A;  2ESN A;  2RN7 A;  4AD9 A;  1D8K A;  2XKP A;  3HRT A;  2FML A;  2FOK A;  3R0J A;  4OIP F;  1R58 A;  4WXD A;  3U1D A;  2UWM A;  2XAG A;  2E1N A;  1H0M A;  5J8F A;  3L09 A;  3SXY A;  4B8X A;  3KEQ A;  2J5P A;  4DNC A;  4S04 A;  4OMY A;  4G8X A;  3BOQ A;  2IVM A;  1FBU A;  5BQT A;  3WOD F;  2GXG A;  2HYG D;  4XSZ F;  3MZH A;  3LA7 A;  1RIO H;  5F64 A;  4KNY A;  3B02 A;  4BHB A;  1FNN A;  4LB5 A;  2L01 A;  4HA8 A;  1TTY A;  2MA3 A;  4NQW A;  1XCV A;  1KYW A;  4LJZ F;  2ZKZ A;  2BE5 F;  5J6X A;  2M1B A;  4IF4 A;  1O3T A;  3CDH A;  1O3R A;  2EFN A;  2EFP A;  4A6D A;  4RGX A;  2VON A;  3ECO A;  4ESF A;  2VT3 A;  2QVO A;  3V7S A;  3IHU A;  1G3S A;  2QQB A;  2VT2 A;  3C3W A;  2A6E F;  3R0A A;  4M73 A;  1TBX A;  3F8F A;  3QRF F;  1XGM A;  1B1B A;  1LB2 A;  1YW9 A;  1V3F A;  3TGN A;  5LHH A;  1TLH B;  4Y17 A;  3I54 A;  3LAP A;  1S7O A;  1IN5 A;  4AIH A;  4EMS A;  2HWV A;  5ILV A;  2O03 A;  1VTN C;  1R22 A;  3RJP A;  3WU0 A;  4OIQ F;  4M9Z A;  3T8R A;  3F22 A;  3FMS A;  2HQN A;  2KJC A;  2OZU A;  4KIG A;  1XDS A;  1F9N A;  1CGP A;  4BHP A;  1U5T B;  4FX4 A;  1G3W A;  1YLF A;  1KQ0 A;  3T1B A;  1SD7 A;  3EYY A;  3DEU A;  4ZYD A;  2WWY A;  1K78 B;  1HQC A;  4UHT A;  1LDD A;  2PFB A;  5HDG A;  1MKM A;  1TQP A;  2EA4 A;  2ZNY A;  3QP5 A;  2XAF A;  5L3C A;  2CG4 A;  3SHF A;  1YIO A;  4MEY F;  3OOP A;  5E8G A;  1IXS B;  3KLO A;  1XB4 A;  3LFK A;  4LLG F;  4Q47 A;  4F7Z A;  2VN2 A;  1GHC A;  4EGZ A;  1J7K A;  2O3F A;  1FBS A;  4HX4 A;  1AOY A;  2GAU A;  4P9U A;  3K1M A;  3RPQ A;  2Z33 A;  3JTH A;  3GLX A;  3V4G A;  3FWE A;  3SZT A;  2XAH A;  5BPI A;  2MH2 A;  4YII A;  1S8N A;  3T5X A;  5DDG A;  4RAY A;  3K9T A;  2ZNZ A;  1SMY F;  3SZP A;  2DQL A;  1U5T A;  3TO6 A;  4MGR A;  4HF1 A;  3KP6 A;  3MWM A;  4DQ2 A;  2LDU A;  1SFU A;  1R5H A;  2F5D A;  2NNY A;  3IL2 A;  3FMQ A;  2FF4 A;  3BY6 A;  3F72 A;  2B0L A;  3BP8 A;  3E5Q A;  3GO5 A;  3EYI A;  4KN4 X;  3VB2 A;  1Z91 A;  5FD5 A;  3Q9V A;  1QBJ A;  1P2F A;  1R36 A;  5E1Z B;  3ZMS A;  2HZT A;  1MJ9 A;  4EJV A;  4UVA A;  3RPU A;  4M71 A;  2GXB A;  1YG2 A;  2IA1 A;  5L3B A;  2W57 A;  2YSR A;  4RB2 C;  2VBW A;  5JI6 A;  1C0W A;  2RQP A;  5FLX Z;  2RVC A;  2IPQ X;  2ADU A;  3RYR A;  3GX4 X;  1SFX A;  5AON A;  2PMH A;  3ZQ7 A;  5LRS A;  2H94 A;  4HLX A;  1ZRC A;  2FNA A;  3RI4 A;  3PFI A;  3CUQ C;  5HLH A;  2QUF A;  1XGS A;  3GFM A;  3HOS A;  4EQQ A;  2FXA A;  2NAZ A;  1TNS A;  3V8L A;  2IJL A;  3WE3 A;  2DO7 A;  3M9A A;  3ZMZ A;  5D8K B;  1B9N A;  3Q9S A;  5FD6 A;  3WTV C;  1QGP A;  1ODD A;  3ABU A;  2M5W A;  3WTX C;  5TRD A;  3KFW X;  3BPV A;  5CVJ A;  2XGX A;  2VE8 A;  1EH6 A;  2ETH A;  2D1V A;  1HW1 A;  2OAZ A;  2VC1 A;  1IAW A;  2JSC A;  2VBY A;  5BOX A;  5FB2 A;  1E2X A;  3WTT C;  2M87 A;  3IRQ A;  3RKW A;  2ZXJ A;  5KK1 A;  3FMR A;  3D5L A;  1ZN2 A;  2FE3 A;  2NNN A;  4YFK F;  3VOD A;  3B73 A;  1KQ8 A;  4U0V A;  1FSH A;  4BHC A;  1W5S A;  2Q8K A;  4KMF A;  2A5Y B;  2LKP A;  3BJO A;  4BH9 A;  4HQM A;  1T38 A;  5HDN A;  4EGY A;  3K2Z A;  1UHW A;  2VOO A;  2AXL A;  3HTU A;  3VEP A;  1DPU A;  2QBY B;  2GQQ A;  1MDM B;  4KIF A;  4GYG A;  5AIP A;  4MHG A;  3FX3 A;  2XHK A;  3FZV A;  1U78 A;  1OR7 A;  2HOE A;  1P92 A;  1XGN A;  2F2E A;  2BV6 A;  3MEX A;  2XAQ A;  1YW8 A;  3BWG A;  4IVN A;  4P55 A;  2W24 A;  2K7L A;  4XLN F;  4YIF A;  2XRO A;  3FF5 A;  4G6D A;  3W6K B;  3ZMU A;  1U8R A;  3Q5F A;  5AIQ A;  1JGS A;  4M6Y A;  4OU0 A;  1G3Y A;  3F6O A;  4A0Z A;  3EUH A;  4CYD A;  5EEG A;  1G6N A;  2EFQ A;  1JXS A;  3QU6 A;  3GWZ A;  4WX9 A;  1KYZ A;  2DAO A;  3ZMV A;  2KIF A;  1O7L A;  1ZAO A;  2QWW A;  5LGT A;  2P5L C;  4ASN A;  4IPA A;  3J81 Z;  1ULY A;  4UNO A;  2BEO A;  1J5Y A;  3DP7 A;  1XSV A;  3GF2 A;  1IN6 A;  2PQ8 A;  2HKX A;  4ZH4 F;  1Y0U A;  5JVT A;  3GFJ A;  1TQM A;  4AIJ A;  3T8T A;  3V7R A;  4KA4 A;  4ZYH A;  1XMA A;  1R1T A;  3L9F A;  1IUY A;  1BM9 A;  2XIG A;  4Q48 A;  1TW2 A;  3JAM Z;  5DD4 A;  2H27 A;  1RNL A;  2L02 A;  3WGG A;  1ZYR F;  1QQI A;  5DD8 A;  4KYW A;  2MLG A;  4R79 A;  5LLQ A;  1W7P D;  3DF8 A;  2CWE A;  4EM0 B;  3QOP A;  2M8E A;  3TO9 A;  4S05 A;  3ZN0 A;  4CHU A;  1F1Z A;  2HQR A;  4O5V A;  3R60 A;  2DI3 A;  1HSJ A;  2EV6 A;  2JPC A;  3HYI A;  2KKO A;  1IN8 A;  2PN6 A;  2ACJ A;  4LB6 B;  3K1P A;  3PQK A;  4RB3 C;  3I0T A;  1STZ A;  4CGZ A;  4PGG A;  1K79 A;  1YYV A;  4WK8 F;  3KP4 A;  2R3S A;  3EDP A;  1K78 A;  4UUV A;  1G4D A;  3R6S A;  1YO5 C;  4HV5 A;  2D45 A;  1PDN C;  5K5R A;  1IN7 A;  1ZRE A;  3P9K A;  3FM5 A;  4IRH A;  2O0Y A;  5LRR A;  1QO0 D;  2VE9 A;  1FX7 A;  4RGS A;  3GFI A;  2EJR A;  1ZG1 A;  1ZH5 A;  1JHH A;  3HRS A;  2UXN A;  2YX4 A;  1OKR A;  2R7D A;  3RTR A;  3M8E A;  1FPQ A;  4A5N A;  3GUD A;  2HKO A;  2MC3 A;  4IRI A;  2YU3 A;  3ERE D;  2ZME A;  1SMT A;  2RGV A;  1HKT A;  3O6B B;  2E7W A;  3LA2 A;  2DTR A;  2STW A;  2LF7 A;  4ZZD A;  3LQR A;  1YS6 A;  3HSR A;  3SQN A;  1WKM A;  5ICG A;  1KU3 A;  4WF2 A;  2HGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...