4HF1A

Crystal structure of iscr bound to its promoter
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
129
Chain Sequence
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDESVDALTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSGRQHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator IscR
publication title Studies of IscR reveal a unique mechanism for metal-dependent regulation of DNA binding specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 43
structure length 129
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hf1A00
1WKMA 2FBIA 3ROUA 4R8HA 3TGNA 2QUFA 4MQ9F 3BOQA 4YFXF 3V7CA 4HF2A 3HTSB 4A6EA 4UVCA 1ZG1A 1ZYRF 2HKXA 3L09A 1FBUA 1WQ2A 3P7NA 4HQMA 2KKOA 2OU2A 1HW2A 5CYVA 2D1HA 3FMSA 5A2QK 2M45A 3ZN1A 2ZBKA 2QBYB 4ETSA 2Q0OA 3LA2A 2RQPA 3K1PA 2KJBA 4Y13A 3TO7A 4CGZA 3ERED 4XBFA 1BN5A 1JHHA 2FRHA 2ACJA 3KEQA 4RGSA 2UXNA 1RUNA 1J75A 4IJAA 4RGXA 4RB2C 1U6GA 3MWMA 3I54A 1TLHB 3FXRA 5ILVA 3ZMVA 5LLQA 2W24A 2K4JA 2V9VA 4OIRF 2QQ9A 2XAHA 2HS5A 2RKHA 2PI0A 4UUVA 2MLGA 1J0RA 1MD0A 2CFXA 3HHGA 3Q9VA 3GFMA 4UV8A 2DU9A 1XDSA 4P5OA 3V7RA 2VE8A 2MA3A 1EV7A 2WC2A 1K79A 1S7OA 4KFCA 5H20A 2A6HF 3FXUA 3LAJA 4N9IA 1S6LA 5D5VB 3SHFA 4L9JA 1WRJA 2GIVA 1T0FA 4OIPF 1YW7A 4MQVA 4M72A 3W6KB 3QP5A 1IXRC 2MBFA 3GFIA 4PDKA 4TV7A 1FP1D 4ASNA 4KDPA 3R0AA 4BQAA 4KMFA 3EETA 3ZMSA 1XCVA 3L00A 1RIOH 1YS6A 5D5UB 1PDNC 1P4XA 3F8NA 3JW4A 1KYZA 4EVIA 4KIBA 3CTAA 1MGTA 4QLCU 4HF1A 4WX9A 3O3KA 2YPRA 3HRUA 2W85A 1ZREA 1FYKA 3HSFA 4RAYA 3T5XA 3RI4A 4F7ZA 2EFWA 4LG0B 3F8BA 1BI3A 3PFIA 4L5IA 1W7PB 1RI7A 3M9AA 1K78A 3GUDA 3JSPA 3MEXA 3GZ5A 2AXLA 2IA2A 1JXSA 2G9WA 4G6QA 1FYLA 2PFBA 3P9IA 4EM2A 3PQKA 3VFZA 3JSOA 2ZCWA 4ZYDA 1OYYA 3LQQA 4HAMA 1BOAA 2PLYA 2DQRA 3G3ZA 5TRDA 2DW4A 3DKWA 2VN2A 1T98A 1KGSA 1UHWA 2M30A 1XSDA 1Y0UA 3WTXC 1L0OC 1BIBA 2PMHA 3RKXA 2R7DA 4L18B 3DFGA 2F2EA 3GXOA 4CHUA 1QZYA 2W57A 3NEUA 2FMLA 2PMUA 3CLOA 1TNSA 2FE3A 4ENNA 2H6BA 2P4WA 2LKPA 3I71A 2J5PA 4AWXB 5JR3A 1FX7A 2A68F 2IRFG 4KIFA 3QOPA 1LB2A 1UHMA 2G7HA 3IWZA 1KU2A 2ZFWA 1IN4A 1YIOA 3FM3A 3K1NA 2XKPA 4FX0A 3DP7A 4OIQF 5LRRA 3WTUC 4MGRA 1KU9A 5HLHA 3RJPA 2A6EF 2XAJA 1TTYA 5DD8A 1OKRA 4KN4X 3I5UA 1PP8F 4EM0B 4D0PA 3S2WA 4HW0A 2ADUA 4IHTA 2RDPA 3SFZA 3U2RA 2M5WA 4EMSA 3V7SA 4QWQA 1YFHA 1G6NA 5ILUA 4L9VA 2NNYA 3D0SA 4BXUA 5LGUA 4A5MA 2WV0A 3QPTA 1R1TA 3F8FA 4ZYHA 1R1VA 5F1RA 3F6VA 3RYPA 2QWWA 2L02A 1QO0D 3M7GA 5D5XB 1KQ0A 2P6TA 3B73A 4CDGA 4A6DA 2F5EA 5HDGA 4I7HA 4MNUA 5FD6A 1FSEA 2KIFA 3CUQB 2DK8A 3B02A 5DUKA 3BDDA 2X4HA 3BZ6A 3I53A 3I59A 5FLXK 2P7VB 1EH7A 2OQGA 2P6SA 2HZTA 4RB3C 4A0YA 4I0AA 3LFKA 4PCQA 3GVAA 1O7FA 3CO6C 1FWZA 2FF4A 2VBZA 3E5QA 4PGGA 3R6SA 4BHBA 2FBKA 3LWFA 3EUHA 4HQEA 2RVCA 3ABTA 3DXJF 4WF2A 1AWCA 3R4KA 2FNAA 2DO7A 3GW2A 4AIJA 4JQFA 1OYWA 1IN8A 1Z6TA 3E97A 2XUBA 2P7CB 2ZXJA 3P9CA 4IVNA 3G73A 1BBYA 1J7KA 5LHGA 4L0YB 3ABUA 2KJCA 4HDUA 3WTSC 2MD5A 3ECOA 3F6OA 5K5OA 1IZ1A 2M1BA 1T39A 1K7AA 2OBPA 1CF7A 3KP2A 4YG2F 2Z99A 3GO5A 4HA8A 3IWFA 3L9FA 2ESHA 1U8RA 1LVAA 1Q1HA 3QAHA 4P9FA 5BPDA 1YTYA 1YS7A 1D8JA 2ZKZA 1TW2A 4DNCA 3NRVA 3BWGA 3CUQC 3RTRA 1SFUA 1U5TB 2P5KA 2BYVE 4U0WA 3GFJA 2AS5F 2VONA 1G3YA 2QM3A 4HLYA 2OQRA 3LA7A 2IA0A 1Z1DA 2KIMA 4AIKA 3SZTA 2Z33A 1LEBA 2HTSA 2B0LA 2XV4S 3ZP5A 5F64A 4G7ZF 4KUMA 2R7FA 2CW0F 3GZ6A 4EJVA 4DQ2A 2M87A 3WTWC 3KCCA 2H27A 1IUYA 2YU3A 2ZMEB 3C7JA 3R61A 3HTUA 3ZMTA 4LFUA 3R0JA 4AVPA 1I27A 3R60A 5IT9Z 3REOA 1KA8A 1HSJA 1QNTA 1BM9A 4EJTA 4GYGA 1FLIA 1YG2A 4Y17A 5DDGA 1LNWA 1L3LA 1IRFA 4EM1A 5HS7A 1IXSB 4LB5A 1SMTA 3OV8A 2XRNA 1XGMA 1IN6A 2X0LA 1T2KA 3DEUA 1F5TA 4U88A 3BY6A 1GXPA 4U0VA 5ERIA 5HS8A 1O3SA 3HUGA 1R5HA 2QLZA 1STZA 3BP8A 3E6BA 1MDMA 2EB7A 2K27A 1BJAA 4M9ZA 3KETA 1I1GA 2BEOA 1FBSA 2HKOA 1V3FA 3VB2A 2HQRA 3BPVA 2EA2A 1XD7A 2PBIA 1XDUA 2PN6A 2EFPA 1XSVA 3HYIA 2GWRA 1ZRFA 2GXGA 4KMUX 3HOTA 1B4AA 4BHPA 5AIQA 3LAPA 5D5WB 2V1UA 4XSXF 4Q47A 3RKYA 1BC8C 2HDCA 1HKSA 1HW1A 2Q8KA 1ZARA 5D8KB 1TNTA 1G4DA 1ZLKA 4M74A 4IXAA 1SD7A 4IHSA 2LF8A 2JZYA 4G6DA 3GLXA 1FSHA 4WXHA 2UZKA 3LSTA 4YFNF 3AAFA 2YX7A 3QP6A 4I98B 3BJAA 2FBHA 2P8TA 3T0YA 3T8TA 2LF7A 4KA4A 2STTA 4LMYA 3ML6A 2VBXA 4A5NA 2KIUA 1I5ZA 3ZMZA 2ELHA 4YFKF 2E7WA 3U1DA 4HX8A 1Z6RA 3ZQ7A 4G9YA 5HVQC 1QZZA 2R3SA 5CJ9A 2Z9OA 4IRGA 1B59A 1FYMA 3KP5A 2BGCA 2NNNA 1S29A 3WGHA 2XAQA 4ON0A 4RB1A 1H0MA 4A0ZA 4I09A 4UV9A 5K5RA 4U0YA 2G7UA 2HWVA 4ESFA 4EQQA 2GA2A 1XSXA 1T6SA 4ENKA 3T1BA 3K2ZA 5D6FA 3BJ6A 1KYWA 1SD4A 5DCMA 3IL2A 1K6OA 4L5JA 2FSWA 4Q5SF 3U9GA 1KQ9A 2P5LC 4UVAA 2H09A 1LJ9A 3JAMZ 3KLNA 4CXFA 4MTDA 1MKMA 2HGCA 4M71A 2HTJA 4AD9A 4LD5A 2GAUA 2Q2EA 5DV5A 1H9TA 4BH9A 4L9NA 4P55A 4MEYF 3WTYC 3CJNA 3IHUA 3N4MA 5FB2A 5H6QA 2WTEA 1J9IA 3SQNA 5BQTA 2JTVA 3TDUC 1MZBA 4HYEA 4A2UA 2CSOA 1U78A 2W25A 2IPQX 4O6JA 4FHTA 3F23A 2CO5A 2DPUA 2LSOA 1K78B 2JPBA 2XVCA 4LB6B 4ZYGA 1B9NA 1TW3A 3O2PE 1ZH5A 4ZH4F 3JAMK 3WTVC 5K1YA 3GYHX 2L3DA 2IVMA 2VODA 1B1BA 3WU1B 4FX4A 1GHCA 2MLKA 3FMRA 1BI2A 1ZG5A 1ZG3A 1O57A 4Q48A 5LRSA 2ESNA 4WK8F 2EWNA 2HYFA 2HEOA 3GX4X 4YIIA 2EJRA 4RB0A 3ZPLA 5F6FA 4G8XA 3WE3A 1HKTA 1DDNA 5BPIA 2L4MA 2GXBA 1XCBA 4GYIA 1DP7P 3CDHA 4MHGA 3H3UA 1BC7C 4M73A 4A0XA 3IRRA 3TOBA 3WG9A 2ETHA 2D2WA 1DPUA 1OMIA 2K02A 5E1ZB 2VC0A 1FNNA 3C3WA 2A3SA 5E8GA 4WXDA 3HIFA 2QZ8A 3F21A 3ULQB 2FOKA 4P9UA 5TJJA 2FXAA 1XMAA 5L3GA 4L0ZB 2HQNA 2DPDA 2RC4A 1P4WA 4Z2YA 2BBYA 4IRIA 2JPCA 4LLGF 4IRHA 2EK5A 1P92A 3MAJA 1REPC 1RUOA 2EA4A 2GQQA 2COMA 4M9XA 5CVRA 5ICCA 1I1SA 3IKVA 5L3DA 1HXDA 3FMQA 1LDKB 5LHHA 3I0TA 2XAGA 2UXXA 2H6CA 4N9HA 5D4RA 1YLFA 2NS0A 2FMYA 5LEKA 4I02A 3DPLC 1Z05A 4GGGA 4A12A 4M6YA 4XSZF 4HDVA 2RV8A 3D5LA 3EQLF 3JTHA 1UCRA 3ZN0A 5EEGA 2ZNYA 3TQNA 1SAXA 1DPRA 2VC1A 3OOPA 3GWZA 4LLNA 2HR3A 3I59B 3TO6A 5ICGA 1Z9CA 1XGOA 3EDPA 4NB5A 4FT8A 1TQIA 3FHZA 3CUOA 1XGSA 4XRFA 1TQMA 1J59A 3M8EA 3KEOA 1IF1A 3N97A 1LDJA 4CICA 2H94A 2STWA 5ICEA 2EFNA 4ZZDA 3M1EA 4L9TA 3W6JB 5BMZA 2DT5A 1GXQA 4JBAA 2FEZA 2YX4A 2WWYA 1LDDA 4GCVA 2Y75A 6PAXA 4HLXA 2VT2A 4UVBA 3V8KA 2DQLA 2EV0A 3GF2A 4S04A 2A69F 3QPHA 2XASA 1J2XA 1ULYA 3BROA 2HYGD 3TKYA 1PUEE 4OMYA 1U2WA 4CYDA 3BJOA 5CLSA 1OR7A 2GZWA 2OD5A 2ISZA 5FGMA 1CF7B 2L01A 1I6XA 5FO5A 4U7DA 2NRAC 3BPXA 1YO5C 3E5XA 5LEJA 2ZJ2A 4HF0A 4LK1F 4I01A 4M9SA 3CO7C 2E1CA 1U3EM 2V6CA 4IPAA 3GFLA 1A04A 3KP4A 5K5QA 1G3WA 4ENMA 4EGZA 2EV5A 5CVIA 4YIFA 2F5FA 3F8MA 1IRGA 2VBYA 2MH9A 3WGGA 5ICFA 3FX3A 1O3QA 5H6RA 1X3UA 5LHIA 1P6RA 1ODDA 2IW5A 3FZVA 2HFHA 5JI6A 1ZGJA 3I58A 1SMYF 4MTEA 1W5SA 2BE5F 2A61A 2A07F 1BI0A 1BIAA 2HOEA 2QYOA 4LK0F 1Z91A 2OA4A 3FXQA 4R79A 2XGXA 4N0BA 3E3VA 4B8XA 3L7WA 5FD5A 3K69A 1ZGAA 1SD6A 2LDUA 2UWMA 1FZPB 2DK5A 4B09A 2PQ8A 3Q5FA 3RPQA 1G3SA 3J80Z 1IXCA 1HBXG 1FT9A 3WODF 4UXNA 2QBYA 1ON2A 3QU6A 3HRTA 3EYIA 4P96A 3Q9SA 3HSRA 1H9GA 1U5TC 3KE2A 2Z5UA 2V1XA 5IT9K 1WSUA 2XROA 2OZ6A 1B9MA 2RNJA 1R36A 3RIRA 1KU7A 4CZZA 2NAZA 5CVJA 1EH8A 2JT1A 1FP2A 4BHCA 1MDMB 2L4AA 5DYMA 2ZNZA 1J5YA 3T8RA 3VOEA 3DV8A 1E17A 1UFMA 3QRFF 1QPMA 3HOSA 4BYYA 3VEPA 5ED4A 3MZYA 1D3YA 2BV6A 1S3JA 1ZN2A 4EJWA 2VBWA 1YQAA 3J80K 1HKQA 3V8JA 4NHJA 1RZ4A 2DI3A 5ILSA 4MEXF 2DAOA 1ZHFA 1MJAA 2CG4A 2IA1A 3ZMDA 2PEXA 5E8IA 5DUIA 1O3RA 4HOBA 4UNOA 2E1NA 2ZO4A 4G7HF 1KQ8A 1GVJA 1R7JA 1W4MA 1IN7A 4I0BA 3KP6A 4R1HA 1HW5A 2W84A 3K0LA 1E2XA 2IT0A 2RGVA 2KRFA 2O0YA 3H92A 4H0EA 5D4SA 3F8CA 1JHFA 1DUXC 1D8KA 1WWXA 2D1VA 4ZZLA 3NQOA 1TBXA 3TOAA 2CWEA 4GO1A 3MZHA 3J7AO 4BNCA 1F4KA 4HBLA 1MJ9A 4LLLA 5L3EA 1XMKA 4EV0A 5J8CA 4RGUA 3M8FA 4LG0A 5CVVA 1W7PA 4OMZA 3HRSA 2XHKA 4HV6A 4KT5C 5DCMB 2VXZA 2O3FA 3LQRA 1JGSA 5KK1A 5LBQA 2F5CA 1ZRDA 5J8FA 4ENJA 4JK1X 3J81Z 3TDZC 4ESBA 1R22A 2J5OA 2IP2A 3ELKA 1WI9A 4AIHA 3DPTA 2CYYA 3SXYA 1W7PD 4HX4A 2PG4A 5E1XA 2DFIA 3KP7A 1QGPA 2P5VA 2GA1A 5HS9A 2FNPA 3E6MA 2MH2A 5D8LB 3GEZA 1FY7A 1SFXA 1EH6A 3RKWA 5E20A 5LGTA 5HOOA 3DF8A 1Z7UA 3F3XA 5IT3A 1XN7A 3WU0A 2QVOA 1B6AA 3E6CC 1O3TA 3J81K 5JFRA 3C1DA 4HV5A 5DEQA 5BS6A 1LEAA 4E70A 4PZJA 2XIGA 1O7LA 2XKOA 1SD5A 2QENA 3MQ0A 1R23A 1PP7U 4RS8A 4WWCA 3F22A 3HHHA 3FM5A 2VOPA 5HDKA 2MC3A 1TQPA 5DCFA 4CO8A 4LJZF 2ISYA 3MCZA 4KICA 4G7OF 1FOKA 2DBBA 3WE2A 3WTZA 2A5YB 1NHAA 1AOYA 4OOIA 2K4BA 1S8NA 4HX7A 3VODA 2QQAA 4M6XA 4Y15A 1T38A 4KIGA 5HLGA 4K2EA 5FLXZ 1ZRCA 5KVRA 5J6XA 3QU3A 2D45A 1R5GA 4ESJA 3IKTA 4EGYA 3WGIA 3IRQA 1F1ZA 1OPCA 5HDNA 4OINF 2FA5A 3H3ZA 5FFZA 4LGWA 4GXOA 2Y0MA 3CUQA 3F72A 4NQWA 2JSCA 1OYIA 1LQ1A 3I4PA 3V8LA 4IF4A 5DD4A 3HRMA 1YW9A 2QQBA 1P4AA 4O5VA 5L3BA 1RNLA 3COAC 4WXCA 3TO9A 3C18A 1S7AA 4PGHA 3LA3A 1JE8A 2EFOA 1HQCA 1FBQA 3RYRA 2XAFA 4KN7X 5L3CA 2M8EA 1C0WA 1ZLJA 1KU3A 2FU4A 3K1MA 3L2CA 4UHTA 5JVTA 2YSRA 4EJOA 2Z3YA 2EV6A 2VT3A 3KFWX 3RDIA 3ZMUA 4OU0A 1YW8A 4I2OA 4ZYEA 4XLNF 3E5UA 2O61A 1SFEA 2TDXA 3O6BB 1XB4A 3FF5A 2L54A 1CGPA 2NYXA 3KZYA 1QQIA 3P9KA 3IC7A 2PJPA 1VTNC 1YYVA 3EYYA 2V1DA 4Q4ZF 5D6EA 3PQJA 3ECHA 1IN5A 2K7LA 4RAZA 5E17F 2F5DA 2FQ3A 5JHUA 5BOXA 5CVUA 3I64A 1U5TA 2E7XA 1R1UA 5FFXA 3WTTC 1R58A 1UB9A 3SZPA 1USTA 4KNYA 1ONVA 4EJUA 1G3TA 2VOOA 3HSEA 5EEHA 3ISPA 3JTGA 2O03A 2CQKA 4S05A 5E18F 4OIOF 3KZZA 2Y48A 3DQVC 4U7BA 2DTRA 2OZUA 2ZMEA 2OAZA 4BAYA 4XLPF 2O6GE 4KYWA 2LNBA 5AIPA 1USSA 2VE9A 3KP3A 1R00A 5L3FA 2C6YA 1F9NA 1QBJA 5LGNA 2JRTA 4RGRA 4HZFA 3V4GA 1BI1A 4WCGA 3K9TA 1MJBA 1W5TA 1V4RA 2EFQA 2IJLA 2RN7A 1P2FA 3E6DA 4O3MA 5E1WA 3RPUA 2CGPA 5A2QZ 4G94A 3KLOA 3MFKA 1D5VA 1IW7F 1FC3A 1XGNA 2K86A 3FWEA 1ON1A 5AONA 1IAWA 1FPQA 2YR2A 2V79A 1HSTA 2O8XA 5HLIA 1ZAOA 2DLLA
chains in the Genus database with same CATH superfamily
1WKMA 5EF6A 2FBIA 3RPUD 3ROUA 4BE1A 2PJRA 4R8HA 3TGNA 2BZTA 1ZK8A 2QUFA 2XGCA 3BR3A 4NBQA 4MQ9F 3BOQA 1RR7A 4YFXF 3V7CA 1X1BA 4HF2A 2DJNA 3HTSB 4BQOA 2XPWA 2VB6A 4A6EA 4X1EA 4UVCA 1ZG1A 2CJJA 3BTJA 1ZYRF 2HKXA 2W48A 3L09A 1FBUA 1WQ2A 1JI8A 2QSFX 3BG6A 3BZKA 3FISA 4X6AJ 3P7NA 5JVGF 4HQMA 4GDFA 2KKOA 3LSIA 1B8IB 2OU2A 4PSXA 1HW2A 3MZ8A 5CYVA 2D1HA 2K9LA 3FMSA 1ITYA 5A2QK 5IPAA 2M45A 2XF5A 1JKQC 3ZN1A 2ZBKA 2QBYB 2NVYJ 1WI3A 1GT0C 1D5YA 4XONA 4ETSA 3G1LA 2Q0OA 3HG9A 3CMMA 3A1YA 3W3CA 2CFOA 3LA2A 3CJRB 2RQPA 3K1PA 1SC7A 4JX5A 3VSLA 4ZDPA 1ETYA 2KJBA 4Y13A 3TO7A 4E7SA 3VYUB 2NVQJ 4CGZA 4FISA 3ERED 3PNYA 4XBFA 4A3KJ 1WJEA 2VKDA 1BN5A 1BA5A 3NWTA 1GUUA 1JHHA 2FRHA 2ACJA 4A3LJ 3KEQA 4RGSA 1YJWI 3ZXSA 2UXNA 3S8PA 1RUNA 1TWFJ 4BS9A 5FKNA 1J75A 4IJAA 4RGXA 4RB2C 3ESWB 1U6GA 3MWMA 3I54A 1TLHB 4B4CA 3FXRA 1Y6IA 5ILVA 1G2HA 3ZMVA 2QF7A 5LLQA 3H5RA 2W24A 5EYRA 5B66C 2K4JA 2V9VA 2E2HJ 4OIRF 2QQ9A 2XAHA 1I3QJ 5FKMA 3ZQQA 2HS5A 1V55H 2RKHA 2PI0A 3IUOA 2Z2SB 5DTDA 3H5NA 2JUGA 4UUVA 2KZVA 1VQ6I 2MLGA 1J0RA 1MD0A 1Z3XA 2CFXA 3HHGA 3GFMA 3Q9VA 4UV8A 2DU9A 2LH9A 3DLAA 3LSPA 1XDSA 3JRGA 2IAIA 1YE9A 4FETA 4P5OA 3V7RA 1AKHB 2VE8A 2MA3A 2UUZA 2CH0A 1EV7A 2WC2A 3FKJA 1K79A 3AKZA 1S7OA 3OL3A 4KFCA 5H20A 3GTMJ 1P9QC 3Q3SA 2A6HF 3FXUA 4PJ0C 3E7LA 3LAJA 4N9IA 2W4SA 1S6LA 5D5VB 4DIQA 3GLLA 3SHFA 4L9JA 1JKPC 1WJAA 1WRJA 2GIVA 1N77A 1T0FA 3RZOJ 4OIPF 1YW7A 1OLTA 4P1WA 3NWSA 4MQVA 4M72A 3W6KB 3QP5A 1IXRC 2DT6A 5F04A 1BR1A 2MBFA 3GFIA 5EZHA 4PDKA 4TV7A 1FP1D 2DXIA 3V42A 4ASNA 3DBLB 3QWLA 2R92J 4KDPA 2LVSA 3L1PA 2NS7A 3R0AA 4BQAA 4KMFA 3EETA 4DBQA 3HOXJ 3ZMSA 2I5UA 3ZCOA 3H0GJ 3CC2I 1XCVA 2LP0A 3L00A 3VSKA 1RIOH 1YS6A 2QEXI 1EF4A 5D5UB 4ZTJA 1PDNC 2F4IA 1P4XA 3K4BA 3F8NA 3JW4A 2LR8A 2Y69H 3HOVJ 1KYZA 2LMDA 4EVIA 4KIBA 1R71A 3QPSA 4HNTA 3CTAA 1MGTA 4QLCU 1OCRH 4HF1A 1MBGA 2CS3A 4WX9A 4CYCA 3O3KA 2YPRA 3HRUA 1ETWA 4XLHA 2F6CA 3P5JA 2W85A 1ZREA 1FYKA 2QKLB 3LL7A 3HSFA 4BEHA 3CDLA 4RAYA 3BG9A 3T5XA 3RI4A 4F7ZA 2EFWA 1W0UA 4MIMA 5C4JJ 3BQYA 4LG0B 3F8BA 1BI3A 2EZKA 2Z1DA 3PFIA 4L5IA 3LOCA 3OL4A 2VUMJ 1W7PB 1RI7A 2Y31A 3M9AA 1K78A 3ZOBA 3GUDA 3S2HJ 3JSPA 3MEXA 2GLOA 3GZ5A 4XN3A 3OYLA 2BHZA 2AXLA 2JRMA 2IA2A 2LRDA 1JXSA 3M8JA 4AYBA 2G9WA 4G6QA 1E3HA 1FYLA 2M34A 2KQRA 2PFBA 2CQXA 3P9IA 1ZGWA 4EM2A 4F3QA 3PQKA 1AHDP 3VFZA 3JSOA 2ZCWA 4ZYDA 4DYRA 3OYBA 3BTIA 1OYYA 3MN2A 4IOCF 1T08B 3LQQA 2IS1A 2L9RA 4HAMA 1BOAA 1GV2A 4FE7A 4Y4RA 2DYRH 2ZXWH 2F48A 4D7NA 2PLYA 5CPRB 2DQRA 1TP4A 3G3ZA 3L2RA 2EZLA 5TRDA 1I39A 3H35A 2DW4A 3DKWA 2VN2A 2IEKA 3AL0B 4ABZA 3ABKH 3WU2C 1T98A 1KGSA 1UHWA 2DMPA 2M30A 1XSDA 1Y0UA 4XNFA 3WTXC 1L0OC 3KYCB 1BIBA 4BBSJ 2PMHA 3RKXA 2R7DA 4L18B 3DFGA 2F2EA 3GXOA 3RQIA 2LC2A 2GXAA 2KIQA 4CHUA 1QZYA 2W57A 3NEUA 3HOZJ 2FMLA 2PMUA 3CLOA 1SFOJ 1TNSA 2KISA 2FE3A 4ENNA 4FQGA 3PO3J 2H6BA 2P4WA 4ITVA 4HPQA 2LKPA 3I71A 2J5PA 1Z67A 3PJRA 2JJ7A 3OIOA 4AWXB 2VQCA 5JR3A 1FIAA 1FX7A 2A68F 5M5YJ 2L5QA 2IRFG 3KYDB 4KIFA 2LREA 3QOPA 1LB2A 5F0HA 4PJNA 4XORA 1Y0NA 1JT6A 1UHMA 2G7HA 3IWZA 1KU2A 2ZFWA 1IN4A 1YIOA 3FM3A 3K1NA 2XKPA 3S3MA 1K83J 3GTGJ 4L5EA 4FX0A 1MBJA 3DP7A 4OIQF 5LRRA 4E7ZA 3WTUC 2DOFA 4HG2A 4MGRA 3A4CA 1KU9A 5HLHA 3H9QA 4IKFA 2CV2A 2LTPA 3RJPA 2A6EF 2XAJA 3HEFA 3PUBA 1TTYA 5F1JA 3L2WA 5DD8A 1OKRA 4KN4X 2RNGA 2X6XA 4BE2A 2O9LA 3I5UA 3CCLI 1YX3A 3ZQCA 1PP8F 2L7FP 3AFHA 1ETVA 4EM0B 3FXMA 4D0PA 1WH5A 3S2WA 3GTLJ 3OYKA 1XG1A 4HW0A 2ADUA 4IHTA 2RDPA 3DEEA 4NC7A 3SFZA 2VJ5A 3GTJJ 3OIPA 1GDTA 3U2RA 2M5WA 4EMSA 3V7SA 4QWQA 1YFHA 4C3JJ 1E3PA 2CUZA 1G6NA 5K7FA 5ILUA 4L9VA 2NNYA 3K10A 3D0SA 3CCJI 4FTHA 4BXUA 5LGUA 1YOVB 2DCEA 4A5MA 3IAS2 2WV0A 3QPTA 1R1TA 4W97A 3F8FA 1JKOC 4ZYHA 4V2GA 1R1VA 5F1RA 4A3DJ 3F6VA 3GCMA 3TEDA 2VJ4A 3RYPA 2QWWA 2L02A 2JMWA 1QO0D 3M7GA 3FXJA 2KLOA 5D5XB 1KQ0A 2P6TA 3B73A 4CDGA 1IJWC 4A6DA 2F5EA 5FLMJ 5KNLA 3BG7A 3DTIA 5HDGA 3SEZA 4PUSA 4I7HA 4MNUA 5FD6A 1FSEA 2KIFA 2P81A 2VQLA 2DA2A 3Q0UA 2TRTA 4A69C 3CUQB 2DK8A 3B02A 5IP6A 2X9DA 5DUKA 3BDDA 2R7WA 2X4HA 4NQWB 3K70D 3BZ6A 3I53A 1TT5B 1JJ8C 2WA0A 1SEUA 2BVMA 2ELKA 2M9HA 2M2EA 3I59A 3LNQA 5FLXK 5B5EC 2P7VB 1RPWA 1EH7A 2OQGA 2P6SA 2HZTA 1S9HA 4RB3C 4A0YA 4I0AA 3LSRA 3A2KA 1UJ8A 3G2BA 3LFKA 4PCQA 4XOPA 3GVAA 2EZIA 1O7FA 1HC8A 3CO6C 4MFDA 2VKEA 1FWZA 1X4OA 2FF4A 3H9GA 5CQEA 5FRNA 2VBZA 4D5CA 5E3NA 3E5QA 4PGGA 3R6SA 1K6YA 1GV5A 4BHBA 1ENHA 2FBKA 2EILH 2LOOA 3FXLA 3LWFA 3EUHA 3UKGA 2R7ZJ 2K3FA 2V9PA 5J3LA 4BY7J 4HQEA 2RVCA 3ABTA 3DXJF 2LK2A 1A36A 4WF2A 1I3AA 1AWCA 3R4KA 2FNAA 3CZ6A 5FKLA 5C4XJ 3FBIB 2VJJA 5J1RA 2DO7A 3GW2A 3OYCA 3FIWA 1TWHJ 1UG2A 2ZJRF 1Q1VA 1YI2I 4AIJA 2VXDA 3RQ4A 4JQFA 1OYWA 4GFBA 2XDVA 1IN8A 1Z6TA 3E97A 4IHVA 2XUBA 1WJBA 4QIWN 1G8XA 4D7MA 2P7CB 2ZXJA 1ETQA 1JUPA 3P9CA 1RKWA 1HDDC 4IVNA 3HC7A 3G73A 4C3HJ 1A5JA 1X4PA 3I55I 1BBYA 3M1CA 4UUSA 1J7KA 5LHGA 4L0YB 3ABUA 4C30A 2KJCA 2JWTA 3GBGA 4HDUA 1VI0A 3MD2A 3WTSC 1X58A 2MD5A 3ECOA 3F6OA 3K6GA 2G0EA 5K5OA 1X2NA 2XRLA 4I76A 1IZ1A 1XC5A 2M1BA 2YS9A 4IHWA 1T39A 1K7AA 3K70C 2OBPA 1CF7A 3KP2A 1JTYA 2Z99A 3GO5A 4HA8A 4YG2F 3OYGA 3IWFA 2HVRA 3L9FA 2ESHA 1U8RA 1LVAA 1Q1HA 3QAHA 2YU9J 4P9FA 5BPDA 1YTYA 4IX7A 4LG3A 1YS7A 1YHQI 1SAUA 1D8JA 3K2AA 4M3EA 2CQNA 2ZKZA 1TW2A 1VQKI 4DNCA 3NRVA 4F93B 2B7EA 3BWGA 3CUQC 3RTRA 4B48A 2KHMA 1SFUA 5FJ8J 2E36A 3KPHA 2CUJA 1R49A 1U9OA 1X1CA 4BJ6C 2H1KA 4BUPA 4BACA 1U5TB 2P5KA 2BYVE 4U0WA 4HRIA 3GFJA 1U9NA 4XLCA 3C2GA 2AS5F 2VONA 3CJTB 3ONQA 3FXKA 5GAGJ 1G3YA 3BTLA 5E3MA 2QM3A 4HLYA 3LFUA 3PL8A 2OQRA 3LA7A 2L9NA 2IA0A 1Z1DA 2KIMA 4AIKA 3SZTA 1D1BA 4XLFA 1V5GA 5EGOB 2Z33A 1LEBA 2HTSA 2X51A 2B0LA 2XV4S 1V5FA 1JTXA 2COBA 3ZP5A 1A31A 4NDLA 5F64A 3HGGA 4G7ZF 4KUMA 2R7FA 5M5WJ 2CW0F 3GZ6A 1T56A 4IL6C 4EJVA 2R7TA 4DQ2A 2M87A 3WTWC 3KCCA 3DCFA 2H27A 1IUYA 2YU3A 2ZMEB 3C7JA 3R61A 1POGA 3HTUA 3CMEI 4RA2A 3ZMTA 4LFUA 4XM3A 2HPIA 3R0JA 2M7BA 4AVPA 2BY0A 1X3ZB 1I27A 4RDUA 3AG2H 2RREA 1DGRM 3R60A 2RAEA 5IT9Z 3REOA 1KA8A 1HSJA 3JRCA 4H4KC 1QU3A 1QNTA 2K9QA 1BM9A 3CESA 3I3LA 4EJTA 2IGNA 3PFYA 2JVGA 3MMYB 4GYGA 2XF7A 1FIPA 1FLIA 1YG2A 4Y17A 4XQFA 2R7QA 1IO2A 5DDGA 1LNWA 3WG7H 4J19A 2X1EA 1IRFA 5M3MJ 1L3LA 4EM1A 5HS7A 1IXSB 4LB5A 1SMTA 2QGUA 2LD5A 3OV8A 5J4VA 5J47A 2XRNA 1XGMA 3NARA 4ZJZA 1IN6A 2H8RA 4Y52J 3DTEA 2KMUA 2X0LA 1D0YA 1Y1VJ 3BR2A 1T2KA 2IXSA 1OCPA 3FDYA 3S15J 3DEUA 3PNVA 1VF9A 4B3AA 4U88A 3CCMI 3BY6A 1F5TA 1GXPA 2WV1A 4U0VA 5ERIA 5HS8A 1TWCJ 1O3SA 1FOXA 2HU9A 3HUGA 1R5HA 3PSIA 2QLZA 1STZA 2HNHA 1ERDA 3HPHA 4A3EJ 3BP8A 5M3FJ 3E6BA 1KONA 1TC3C 3S14J 1MDMA 4XR6A 2RQQA 2PJRB 2EB7A 2K27A 4C2UA 1ZR4A 1BJAA 1PVEA 4M9ZA 4E7HA 3KETA 1I1GA 5LFAA 3RZDJ 5HODA 2BEOA 1FBSA 2HKOA 4C2MJ 1V3FA 3VB2A 1OR7C 3SEQA 2HQRA 3BPVA 2EA2A 1XD7A 2PBIA 1XDUA 2PN6A 1JUMA 1UHSA 2EFPA 1XSVA 3HYIA 2GWRA 1K61A 2DDBA 1LE8A 1X3WB 2E19A 1ZRFA 1IGNA 2GXGA 1OISA 4KMUX 3DWLE 2MGQA 4BQQA 3HOTA 4E7JA 1OCTC 2IS4A 1B4AA 4BHPA 1W0TA 3OS0A 5AIQA 2HXIA 1WJDA 3JREA 1T33A 3LAPA 1RR8C 5D5WB 4IOAF 2V1UA 3LMMA 5GTHC 4XSXF 3IP4B 4Q47A 3RKYA 5M5XJ 2BW3A 4XRSG 1BC8C 1W1WE 2BHYA 2HDCA 2ECCA 1HKSA 1HW1A 2DFHA 2K40A 2Q8KA 1ZARA 2XGDA 3G1OA 5D8KB 2E5ZA 3KX2A 2E1OA 1TNTA 1NH3A 1G4DA 1ZLKA 1MNMC 4M74A 3S93A 4IXAA 2HDWA 1SD7A 5IOZA 4IHSA 3OSGA 4A3IJ 2LF8A 2JZYA 2NXNB 3S1MJ 4G6DA 3ZQHA 2X6WA 3GLXA 3CDIA 1WJCA 2KDZA 5EZGA 1FSHA 2DJIA 2M4GA 4WXHA 5B3SH 2UZKA 1W5CC 3LSTA 4YFNF 2KDOA 2CUFA 5DM6F 2M0CA 3AAFA 2YX7A 3JRIA 3QP6A 4I98B 3TL4X 2L9SA 3BJAA 3CCUI 4UB8C 2FBHA 2P8TA 1WFXA 3T0YA 2DT7B 3T8TA 3GTQJ 2LF7A 4YEJA 4KA4A 4A93J 2STTA 1Z3YA 5J1YA 4LMYA 5K7HA 2MW8A 2DA3A 3ML6A 2VBXA 4A5NA 2KIUA 4DZPA 1I5ZA 4E4HA 2F4OB 3ZMZA 2ELHA 4YFKF 2E7WA 3U1DA 2LG4A 2AHQA 4HX8A 1Z6RA 3ZQ7A 4G9YA 5HVQC 1QZZA 2R3SA 2ZXIA 4DOZA 5CJ9A 2WY8Q 4IRGA 3UR3C 2Z9OA 1B59A 1TT0A 2X48A 1FYMA 3KP5A 2BGCA 3RCOA 2NNNA 3B6CA 1S29A 1MMNA 4W1UA 3WGHA 2XAQA 4ON0A 4GRIA 4RB1A 1H0MA 2MG4A 4A0ZA 4I09A 4UV9A 5K5RA 5FKKA 4U0YA 2XSDC 1MMGA 3SDGA 4D9JA 2G7UA 1MMSA 3CCRI 1HA8A 2HWVA 2LY2A 4ESFA 3BR1A 4EQQA 4V19K 2GA2A 1XSXA 5C44J 4YELA 1T6SA 4ENKA 1OFCX 2DMQA 3T1BA 2JA8J 1XPXA 3K2ZA 1IG7A 3H36A 5D6FA 3BJ6A 1KYWA 1SD4A 5DCMA 3IL2A 1K6OA 3RSNA 2JA6J 4ZYAA 1X1DA 4L5JA 2FSWA 4Q5SF 3U9GA 1KQ9A 2P5LC 3DKXA 1VZ0A 2KRCA 4UVAA 2H09A 1LJ9A 4QSHA 1SVLA 2HXOA 3JAMZ 3KLNA 4CXFA 2KP6A 2EQRA 4MTDA 1MKMA 3KEYA 2HGCA 4M71A 3DPUA 1UMQA 5GTIC 2HTJA 1KZHA 4AD9A 3S3OA 4LD5A 3DLLF 2LLKA 2GAUA 3SZGA 4B44A 2Q2EA 5EG0A 1AU7A 3ABMH 5DV5A 3IAM2 1H9TA 4BH9A 4L9NA 3IV5A 4P55A 4MEYF 5KHDA 3WTYC 4LOCA 3CJNA 3IHUA 3N4MA 5FB2A 2CW7A 5H6QA 2WTEA 1J9IA 4CYCB 4Y33A 1YJNI 4C3IJ 2CMPA 1RESA 2Y2ZA 5IYBJ 3SQNA 5BQTA 2JTVA 3TDUC 1MZBA 4HYEA 4A2UA 2CSOA 4PJJA 1WHUA 1U78A 1OCOH 4BEHB 1T8IA 2W25A 4X0GA 3BCBA 2IPQX 2KT0A 4FHTA 4O6JA 4CUGA 2M3AA 3F23A 2BVLA 1MNDA 2BXYA 2CO5A 1K4SA 2DPUA 2LSOA 1XMXA 2R5YA 2JPBA 4DBRA 1K78B 2XVCA 2E2IJ 1QZEA 2W00A 4LB6B 3I4MJ 4JP0A 1ORKA 4ZYGA 1WH7A 1JUSA 1B9NA 1TW3A 3O2PE 1ZH5A 4ZH4F 3HKZA 3N05A 3JAMK 3VWBA 3WTVC 4RM3A 2L3DA 5K1YA 1V54H 4UUTA 4CCNA 3GYHX 2IVMA 1BL0A 4DJAA 2OTLI 2VODA 1ZQ3P 3A01A 2JSPA 1B1BA 4UB6C 3WU1B 4FX4A 4RMNA 2R7UA 3U1KA 1GHCA 2R0QC 2MLKA 3VYSB 3FMRA 3DU6A 2CU7A 2HOAA 1VQ8I 1IDZA 3PUFA 1BI2A 3CJQB 1ZG5A 3DBRB 3Q0WA 1ZG3A 1O57A 4Q48A 3LSMA 5LRSA 2ESNA 4WK8F 4XN0A 1QPIA 2EWNA 2HYFA 3TW7A 3S1QJ 2E60A 2HEOA 3GX4X 4YIIA 1UG0A 3DKYA 2B63J 2W1OA 1QVTA 3AG3H 3C2BA 4M3FA 2EJRA 2ZSIB 4RB0A 4Y3OA 1S72I 3ZPLA 5F6FA 4G8XA 2LBFA 2ICWG 3UNGC 3WE3A 1HKTA 2I8DA 2OC6A 5KAFC 1DDNA 5BPIA 2L4MA 1K4TA 2GXBA 1XCBA 3HKZN 4GYIA 3BC8A 3WHCA 5E3LA 4BL0B 1DP7P 3K7AJ 3CDHA 4PJMA 4MHGA 3H3UA 1BC7C 4M73A 4A0XA 4JX4A 3IRRA 3D1NI 3TOBA 4BDZA 1YITI 2E1MB 2H1LA 2MSYA 3WG9A 5J1UA 2ETHA 2GM4A 4M3DA 5GAEJ 2D2WA 4XKWA 1WZ2A 1MW7A 1DPUA 1OMIA 2K02A 5E1ZB 4Z6YA 3PO2J 2IGOA 2VC0A 1FNNA 1R6RA 3OYNA 3C3WA 5GAHJ 2A3SA 5E8GA 4LIUA 3CQZJ 4WXDA 1VQLI 3HIFA 2QZ8A 2WAEA 3F21A 2XF6A 2FOKA 2XB5A 3SFIA 3ULQB 4P9UA 5TJJA 2FXAA 2DA5A 2NVUB 5LD2C 4XRMA 1VQ9I 4IHXA 1XMAA 2WY7Q 5L3GA 4L0ZB 2HQNA 4E6KG 1H89C 2DPDA 4BDYA 2RC4A 2L0KA 1P4WA 4XMYA 2KRHA 4XOTA 4Z2YA 2BBYA 4IRIA 2JPCA 1MNEA 4LLGF 4RLFA 4IRHA 4IEJA 1LVKA 2R7VA 3CCQI 3TP0A 4HNVA 3S3NA 2EK5A 1P92A 1Y39A 3MAJA 1REPC 1RUOA 2EA4A 3M3YJ 2GQQA 2COMA 4M9XA 5CVRA 5ICCA 3L2QA 1I1SA 2HVQA 3IKVA 1R4MB 5L3DA 1X1AA 3AL0C 1HXDA 3FMQA 1BR2A 1LDKB 1JT0A 2V6EA 2IBDA 5LHHA 1A6IA 2XAGA 2UXXA 3I0TA 1G59A 2JA2A 2H6CA 1D0XA 3A02A 5IOYA 4N9HA 5D4RA 1YLFA 2NS0A 2FMYA 5LEKA 4I02A 3CCYA 3DPLC 1YX5A 1Z05A 4GGGA 4A12A 4M6YA 4XSZF 3ZRGA 5JHFA 1IDYA 4HDVA 2RV8A 3D5LA 3EQLF 2VLAA 4EATA 1N75A 3JTHA 1UCRA 4U87A 3H5AA 5EEGA 3ZN0A 4F91B 2ME0A 1JKRC 2ZNYA 5GPAA 3TQNA 2O7OA 3CLQA 1SAXA 1DPRA 2VC1A 3OOPA 2LY9A 3GWZA 1GLNA 1SVMA 4LLNA 2ECBA 2HR3A 3I59B 4YRVA 2V7FA 3LSKA 3W2WA 3M07A 3TO6A 1E3OC 3ZQGA 5ICGA 5IY5H 1Z9CA 1HOMA 1RRJA 1XGOA 1MMAA 3EDPA 4NB5A 2VQGA 2Z16A 4XKCA 4FT8A 1TQIA 3FHZA 1BJZA 3CUOA 2BXZA 1XGSA 3OYDA 4XRFA 2EBIA 1TQMA 2OCCH 1J59A 3M8EA 3KEOA 2XPVA 1IF1A 1TWGJ 3N97A 4YIRX 1FOWA 1LDJA 1VQOI 2DMUA 4CICA 2H94A 4BJ5C 2DA7A 2DODA 1R5ID 4M3GA 2STWA 2B9SA 5ICEA 2EFNA 4ZZDA 2NS8A 2NVTJ 2X1CA 3M1EA 3W6VA 1N78A 1MBFA 2MFZA 4L9TA 5C3EJ 3W6JB 5BMZA 4CCOA 1YRNA 1Y8QB 1LFUP 2DT5A 1GXQA 4JBAA 2HZDA 2R93J 4AIDA 2VL8A 3OR2C 2WB1N 2FEZA 3G71I 2YX4A 2WWYA 4C2TA 1LDDA 2AQFA 3QYEA 3PIOF 3JRDA 4GCVA 1FMWA 2NVXJ 3MKZA 1ACIA 4CSWA 2Y75A 6PAXA 4HLXA 4RBOA 1MIJA 2VT2A 4UVBA 3V8KA 5CKTA 3OYEA 2DQLA 3HL2A 2EV0A 3GF2A 4S04A 1B72A 2A69F 3QPHA 2MD0A 2XASA 3BLYA 3CP8A 1J2XA 1ULYA 3BROA 4LIVA 3CCVI 4UUSB 2HYGD 3TKYA 1PUEE 2V1NA 3EUKL 1PUFA 4OMYA 3OIQA 4FE4A 1U2WA 2QQ8A 4DGWB 2K85A 4BXXJ 3G1MA 4CYDA 2DYSH 2OTJI 3BJOA 5CLSA 1OR7A 1NK3P 2GZWA 2OD5A 2ISZA 2KZGA 2FOWA 4II2A 3CC4I 3BTCA 1Z0XA 4IZZA 1LPQA 5FGMA 4BQNA 1CF7B 2L01A 4OAZA 1I6XA 5FO5A 3ZQFA 4U7DA 2L7KA 2VKHA 4FASD 3BCAA 2NRAC 4BGDA 3BPXA 1YO5C 1LKXA 3E5XA 2ZJQF 4ZDOA 2ZJ2A 4HF0A 5LEJA 2L9VA 3HXLA 4I01A 4LK1F 4AC0A 4M9SA 3CO7C 2E1CA 1QHHD 4PJLA 1U3EM 2KL4A 2V6CA 1J09A 3TMOA 4IPAA 2OV7A 3GFLA 3HOWJ 2Q1ZB 1A04A 3OMYA 3CMYA 1MBKA 3GMEA 3KP4A 4IQ4A 2UV1A 5K5QA 3QYBA 1G3WA 3G4SI 4ENMA 4EGZA 2EV5A 1IRZA 5CVIA 4YIFA 2F5FA 3F8MA 1IRGA 4II3A 1MMDA 2VBYA 4XRSA 2DDAA 2X85A 2LY1A 2MH9A 4QPOA 3WGGA 3LSHA 2LYCA 5ICFA 3FX3A 4KJZA 1LUJB 1O3QA 5H6RA 1X3UA 1OCCH 2DOAA 5LHIA 3H3VK 4XK4A 3QPLA 1WGXA 3K4KA 1P6RA 3GTOJ 1ODDA 2R7RA 2IW5A 2R5ZA 2M0MA 4A3GJ 3FZVA 2HFHA 5JI6A 1ZGJA 2A05A 2KPMA 3I58A 1LFBA 1SMYF 3BG5A 5JLWA 4MTEA 1W5SA 2BE5F 2A61A 2FX0A 4MLOA 2A07F 1BI0A 1BIAA 3CF2A 1Y1WJ 2HOEA 1DGWY 2DA4A 2QYOA 4LK0F 3ZQIA 2QKMB 4BU2A 2W7NA 4QPQA 4PK4A 1Z91A 4G6TB 3FKIJ 2OA4A 3FXQA 2EIMH 1PJRA 2OCEA 4R79A 2I10A 2XGXA 3DBHB 1FEXA 2K5CA 4N0BA 2F5VA 3E3VA 4RAGA 3B6AA 3FK6A 3W2VA 3L7WA 2LFBA 5FD5A 4B8XA 3K69A 1ZGAA 3L2UA 4NUBA 1SD6A 2LDUA 2UWMA 3HZJA 1FZPB 1B8IA 2DK5A 4B09A 1MBHA 2K9SA 2PQ8A 3GZNB 3Q5FA 3RPQA 1G3SA 3FHNA 3J80Z 1IXCA 2DMNA 4BKXA 1HBXG 1FT9A 3WODF 4XLEA 1DP3A 4UXNA 4A3BJ 3J7ZI 2QBYA 3IH3A 1ON2A 1NTCA 3QU6A 3HRTA 3EYIA 4P96A 2KFDA 3Q9SA 1UAAA 1A6QA 3IH2A 3TBIA 3OYFA 3HSRA 5B1AH 1SANA 1H9GA 1U5TC 3KE2A 3K4NA 1U0JA 1Y56A 4V2FA 2Z5UA 4NC8A 2V1XA 1QVUA 5IT9K 1WSUA 2XROA 2XSJC 4E7LA 4PFPA 3A0HC 3DEWA 5TGTA 1R9TJ 1VQ5I 3HUGB 2OZ6A 2R7SA 1B9MA 2RNJA 1R36A 1WJFA 1WJ5A 4RLQA 3RIRA 1KU7A 3KZIC 4CZZA 2D5VA 3OYHA 2NAZA 1T95A 5CVJA 1EH8A 2CW8A 2JT1A 1FP2A 4BHCA 1MDMB 2L4AA 1IV8A 3W2AA 5DYMA 2ZNZA 1J5YA 3RKQA 3T8RA 3VOEA 2HPMA 1FTTA 3DV8A 1E17A 2O8KA 3VPRA 1UFMA 3QRFF 1QPMA 3HOSA 4BYYA 1P7IA 3VEPA 5ED4A 3MZYA 1D3YA 3A03A 1OQYA 5GPCA 2ZMEC 2BV6A 4KITB 1LE8B 1WVRA 1S3JA 1ZN2A 2EZHA 4EJWA 3K4JA 2VBWA 2DA6A 1YQAA 3GTPJ 3J80K 2V26A 1HKQA 2FD5A 1HLVA 1X1PA 3V8JA 1BR4A 3ABLH 3LSJA 4NHJA 1RZ4A 2DI3A 5ILSA 1AKHA 1H88C 4MEXF 3GTKJ 2BW3B 2DAOA 1ZHFA 1JGGA 4EEFG 1O4XA 1MJAA 2DMTA 2XAUA 3S32A 2CG4A 1AA7A 2IA1A 3E0JB 3ZMDA 2PEXA 1QA6A 5E8IA 2TCTA 1ETKA 3AG4H 1R4NB 5DUIA 1O3RA 1JJ6C 4A3FJ 4NC6A 4HOBA 3PM1A 2JK3A 4F55A 3S2DJ 4UNOA 4M3BA 1I50J 2E1NA 5H2FC 1NG7A 2ZO4A 1BW5A 4G7HF 1KQ8A 1GVJA 1R7JA 1W4MA 1IN7A 2GOXB 4I0BA 1MBEA 3KP6A 3SYTA 1MH4A 3H9JA 4R1HA 1HW5A 4CCJA 3HJEA 3OOUA 2PX9A 2W84A 3K0LA 4A3MJ 3HBLA 3U21A 1BW6A 1E2XA 1CQTA 3MKYB 3AG1H 2IT0A 2N8GA 2RGVA 2KRFA 2O0YA 2OPTA 3H92A 4H0EA 5D4SA 3F8CA 1JHFA 1DUXC 1D8KA 1ETXA 1WWXA 2D1VA 4XIDA 5K7ZA 2X6OA 2M7AA 4ZZLA 3M4OJ 2Y0SA 3CF5F 3HB9A 2JA5J 4KT6A 3NQOA 5J4YA 1TBXA 3CP2A 3TOAA 1DU0A 2CWEA 1RKTA 2FQ4A 4GO1A 3MZHA 4BY1J 4BNCA 2E34A 3J7AO 2DN0A 3BT9A 4B3XA 4D1QA 1F4KA 4HBLA 1MJ9A 4LLLA 5L3EA 3JRHA 2FJ1A 1XMKA 1E0EA 2DFEA 2K3PA 4EV0A 5J8CA 5CQGA 4RGUA 3QQAA 3BZCA 3M8FA 4JYKA 4LG0A 5CVVA 4OAYA 2ID3A 1W7PA 1RETA 1FOYA 4OMZA 1XTAA 4N4OB 4JX6A 3HRSA 3J7AY 4KISA 2XHKA 4HV6A 4KT5C 5DCMB 3D5SC 2VXZA 2O3FA 3LQRA 2CQ7A 2LKSA 1JGSA 5KK1A 1IV6A 5LBQA 2F5CA 2VIXA 3DU5A 1ZRDA 2E35A 5J8FA 4ENJA 3JR9A 3CMAI 3VYTB 4JK1X 4D5FA 3J81Z 2QA4I 1VNDA 3TDZC 4ESBA 2L2OA 2Y0SN 1R22A 2J5OA 2IP2A 3BQZA 5EG0B 2Q2EB 3ELKA 1WI9A 2JA7J 5HNFA 3CCSI 4AIHA 2AQEA 1RC9A 2M8GX 1Y8RB 2CYYA 3DPTA 3NAUA 1W7PD 2ZXHA 1HDPA 4HX4A 3SXYA 3OY9A 2PG4A 5E1XA 2GOMA 2IS6A 1GVDA 2DFIA 3DTKA 3KP7A 1PYVA 5FLVA 1NK2P 1QGPA 2P5VA 3C2HA 5F0FA 3KYLA 2GA1A 4XL9A 2NOGA 2BY3A 5HS9A 2FNPA 3E6MA 2MH2A 5D8LB 3BR5A 3GEZA 1FY7A 4F92B 1SFXA 1EH6A 4CCMA 3F9KA 3RKWA 4BBRJ 2V9KA 5E20A 1MSEC 5LGTA 2OJED 4ZDLA 5HOOA 4E7IA 3DF8A 1Z7UA 3K4LA 5E3OA 1VQNI 3F3XA 5IT3A 3HM5A 2V4JC 1TL8A 1Z21A 1XN7A 2R5YB 3WU0A 2QVOA 5KAIC 2BY2A 2WAQA 1B6AA 3I56I 4IQJA 2L7MP 3PNTA 1OCZH 4B47A 3E6CC 1FJLA 1APLC 3HDDA 2MYSA 2JUCA 1BOBA 3PSFA 3HPGA 3ZGKA 4CZCA 3ZQLA 1O3TA 2GIZA 3J81K 1M1EB 5JFRA 3HOUJ 5KCMA 3C1DA 4HV5A 5DEQA 4NNJA 1YJ9I 5DM7F 3Q0VA 5BS6A 4M6VA 1LEAA 4E70A 1T0FC 2EIJH 4G12A 4PZJA 2XIGA 3A01B 1O7LA 2XKOA 1SD5A 2QENA 3MQ0A 4AYBN 3H0DA 5F27A 2BOLA 1R23A 4DW6A 1PP7U 4RS8A 5J40A 4WWCA 3F22A 3HHHA 3EUAA 4RM2A 3S1NJ 3FM5A 2VOPA 4XKBA 2H8WA 4OWRB 5HDKA 2MC3A 4J00A 1TQPA 5DCFA 4CO8A 1VQ7I 4LJZF 2P0WA 2ISYA 3MCZA 4KICA 4G7OF 3MKLA 1FOKA 2DBBA 3WE2A 3WTZA 2Y9ZA 4XLAA 2A5YB 2EH3A 4PFOA 1NHAA 1SVOA 1MH3A 3F0CA 4AVZA 4CA0A 4CCLA 1AOYA 4S0HB 4ZC3A 2XB0X 3HGYA 4OOIA 2K4BA 1S8NA 4HX7A 3VODA 4E7KA 2QQAA 4M6XA 2HOSA 4Y15A 2WAQN 3FBNB 3A0BC 4HEA2 5EDNA 2LBFB 3FXOA 3OS2A 4UY8I 1QRYA 3TW6A 1T38A 4KIGA 5HLGA 4B1RA 4K2EA 2GBYA 5FLXZ 1ZRCA 2L7ZA 4ZTFA 5KVRA 1TZLA 5J6XA 2O5RA 3CCEI 2A6TA 3QU3A 2D45A 4N4NB 1ZTRA 1R5GA 4ESJA 3IKTA 4EGYA 5F08A 3WGIA 3IRQA 1F1ZA 2EPFA 1OPCA 5HDNA 4OINF 2FA5A 3WHBA 3H3ZA 5FFZA 4LGWA 2CRGA 4GXOA 2WAFA 5GADJ 2Y0MA 2BY1A 3CUQA 3F72A 4NQWA 2NOJB 5F0CA 1V5EA 2JSCA 3S16J 2DOEA 1OYIA 1W36D 3K4MA 3PIPF 1LQ1A 3I4PA 4MFEA 3V8LA 3G6EI 4IF4A 5DD4A 3HRMA 1Z7LA 1YW9A 2QQBA 1D1CA 3BR0A 1P4AA 4O5VA 3OYIA 2ZJPF 2QSHX 3FK7A 5L3BA 1RNLA 3K4CA 3COAC 4WXCA 3E1SA 3TO9A 3C18A 1S7AA 4PGHA 5FRMA 3LA3A 4BE0A 4Y7NJ 4XICA 1JE8A 2EFOA 1HQCA 3H1CA 1FBQA 2CV1A 3RYRA 2XAFA 2R7XA 4KN7X 1DQUA 5L3CA 1WPKA 2M8EA 1C0WA 1U8BA 1ZLJA 2HQ5A 3CC7I 1KU3A 3OSFA 4FCYA 2WB1A 5BNGA 2FU4A 3ERMA 1S5LC 3K1MA 2VKVA 4ANJA 3L2CA 4HNUA 3QYFA 3VYRB 3S17J 3ASNH 3KIOA 5IYCJ 2IGKA 1EA3A 4UHTA 1I6HJ 1LFPA 5JVTA 2HYJA 2CUEA 2YSRA 5B1BH 4EJOA 1QHGA 3L2VA 2Z3YA 2WBMA 2EV6A 4JOMA 3OYJA 1EKEA 4IHYA 2VT3A 3KFWX 3RDIA 3ZMUA 2XGEA 4F52A 2MC4A 4OU0A 1YW8A 2E71A 3OWTA 3JRBA 4I2OA 3IH4A 1S7EA 4XLNF 4ZYEA 3O8GA 2HQAA 2MABA 3E5UA 2O61A 1SFEA 2TDXA 2DFFA 1WCMJ 2M4KA 2K9NA 3O6BB 2R4GA 1XB4A 3FF5A 2L54A 2E1MC 1IRXA 4AU7A 2F4MB 5EJCA 4XKVA 5FROA 1CGPA 5IP7J 3SDBA 2YUSA 3QODA 4PSWA 5JLXA 5TISC 3ZR8X 2NYXA 2OF7A 3MKWB 2W82A 1XX5A 2X1DA 4DZJA 3CD6I 3I4NJ 2Y9YA 3KZYA 2ME6A 2FUG2 1VQ4I 1QQIA 3P9KA 1IUFA 1OJLA 1W36C 3BR6A 4HSTA 5FKOA 4J01A 3IC7A 2PJPA 2JVHA 1D0ZA 2X6YA 1VTNC 1YYVA 3BG3A 3EYYA 5GP9A 1ZR2A 3VDXA 4A3JJ 2VPRA 2V1DA 2ID6A 5D6EA 4Q4ZF 3PQJA 3ECHA 2HI3A 3TP3A 2CQQA 1IN5A 2K7LA 3JRAA 4RAZA 2EIKH 5E17F 1NG6A 1VQPI 2HOTA 2F5DA 2FQ3A 5JHUA 1YRNB 4C9YA 5BOXA 5CVUA 3I64A 5EEAA 2PMZA 1HCRA 1ETOA 3JRFA 3I9V2 1U5TA 2CV0A 1R1UA 2E7XA 5FFXA 5IP9J 2ZB9A 3MVPA 2ZC2A 3WTTC 3QOEA 1HF0A 3LSGA 1UELB 1R58A 1UB9A 1ZELA 1USTA 2XPUA 3SZPA 4KNYA 5HLTA 1ONVA 2ELJA 1MSFC 4EJUA 4HSRA 1G3TA 4CCKA 3J7YJ 2VOOA 1VQMI 4A3CJ 1B72B 2LKXA 2HVSA 3HSEA 2JN6A 5EEHA 5HNHA 2IS2A 3ISPA 1N25A 3JTGA 1TWAJ 1PUFB 2K9MA 2O03A 2CQKA 5EGOA 2E5NA 3OR1C 4S05A 1XS9A 5E18F 4OIOF 3OS1A 2OUMA 3KZZA 3SJMA 1FMVA 2Y48A 5E79C 2HDDA 1UZCA 1F36A 5DS9A 3DQVC 3HOYJ 2ZFUA 4B43A 4CH7A 4U7BA 4I6ZA 2DTRA 2R7OA 2OZUA 2ZMEA 2VPLA 2OAZA 1D1AA 4BAYA 4IO9F 2QCOA 1ZKGA 1H8AC 4XLPF 2DA1A 2JQ7A 3S1RJ 3OYMA 2O6GE 1A35A 1DU6A 4KYWA 2LNBA 5AIPA 1USSA 3OYAA 1VFCA 2VE9A 2PMZN 3KP3A 3X2QH 3EPZA 1R00A 5L3FA 4I99C 2C6YA 1F9NA 4RAFA 2AXTC 1QBJA 5LGNA 2JRTA 3ASOH 4HZFA 4RGRA 3D5RC 3V4GA 1BI1A 4WCGA 2Y30A 3K9TA 4AM3A 1MJBA 1W5TA 1X19A 2E2JJ 2AO9A 2IGMA 1V4RA 2EFQA 2VASA 4MO7A 1Z77A 4DYQA 2IJLA 1EJ9A 2RN7A 1P2FA 3E6DA 2DTZA 3JCUC 3EUHC 1SFKA 4O3MA 5E1WA 3RPUA 2WADA 5A2QZ 2CGPA 9ANTA 2ZSHB 4BXFA 3O8HA 4G94A 3KLOA 5IYDJ 2XC7A 4LITA 3MFKA 2VQHA 4DYCA 1D5VA 2EINH 1IW7F 1FC3A 1YIJI 1XGNA 1FTZA 2K86A 3FWEA 2A5WA 1ON1A 4AUXA 5AONA 1IAWA 4QTRA 2QSGX 1FPQA 1P7JA 2YR2A 4BJTA 1X2MA 2V79A 2VJIA 1IC8A 2R5ZB 1F43A 1HSTA 2O8XA 5HLIA 1ZAOA 2DLLA 2VI6A
chains in the Genus database with same CATH topology
1WKMA 2FBIA 3ROUA 4R8HA 3TGNA 2QUFA 4MQ9F 3BOQA 4YFXF 3V7CA 4HF2A 3HTSB 4A6EA 4UVCA 1ZG1A 1ZYRF 2HKXA 3L09A 1FBUA 1WQ2A 3P7NA 4HQMA 2KKOA 2OU2A 1HW2A 5CYVA 2D1HA 3FMSA 5A2QK 2M45A 3ZN1A 2ZBKA 2QBYB 4ETSA 2Q0OA 3LA2A 2RQPA 3K1PA 2KJBA 4Y13A 3TO7A 4CGZA 3ERED 4XBFA 1BN5A 1JHHA 2FRHA 2ACJA 3KEQA 4RGSA 2UXNA 1RUNA 1J75A 4IJAA 4RGXA 4RB2C 1U6GA 3MWMA 3I54A 1TLHB 3FXRA 5ILVA 3ZMVA 5LLQA 2W24A 2K4JA 2V9VA 4OIRF 2QQ9A 2XAHA 2HS5A 2RKHA 2PI0A 4UUVA 2MLGA 1J0RA 1MD0A 2CFXA 3HHGA 3Q9VA 3GFMA 4UV8A 2DU9A 1XDSA 4P5OA 3V7RA 2VE8A 2MA3A 1EV7A 2WC2A 1K79A 1S7OA 4KFCA 5H20A 2A6HF 3FXUA 3LAJA 4N9IA 1S6LA 5D5VB 3SHFA 4L9JA 1WRJA 2GIVA 1T0FA 4OIPF 1YW7A 4MQVA 4M72A 3W6KB 3QP5A 1IXRC 2MBFA 3GFIA 4PDKA 4TV7A 1FP1D 4ASNA 4KDPA 3R0AA 4BQAA 4KMFA 3EETA 3ZMSA 1XCVA 3L00A 1RIOH 1YS6A 5D5UB 1PDNC 1P4XA 3F8NA 3JW4A 1KYZA 4EVIA 4KIBA 3CTAA 1MGTA 4QLCU 4HF1A 4WX9A 3O3KA 2YPRA 3HRUA 2W85A 1ZREA 1FYKA 3HSFA 4RAYA 3T5XA 3RI4A 4F7ZA 2EFWA 4LG0B 3F8BA 1BI3A 3PFIA 4L5IA 1W7PB 1RI7A 3M9AA 1K78A 3GUDA 3JSPA 3MEXA 3GZ5A 2AXLA 2IA2A 1JXSA 2G9WA 4G6QA 1FYLA 2PFBA 3P9IA 4EM2A 3PQKA 3VFZA 3JSOA 2ZCWA 4ZYDA 1OYYA 3LQQA 4HAMA 1BOAA 2PLYA 2DQRA 3G3ZA 5TRDA 2DW4A 3DKWA 2VN2A 1T98A 1KGSA 1UHWA 2M30A 1XSDA 1Y0UA 3WTXC 1L0OC 1BIBA 2PMHA 3RKXA 2R7DA 4L18B 3DFGA 2F2EA 3GXOA 4CHUA 1QZYA 2W57A 3NEUA 2FMLA 2PMUA 3CLOA 1TNSA 2FE3A 4ENNA 2H6BA 2P4WA 2LKPA 3I71A 2J5PA 4AWXB 5JR3A 1FX7A 2A68F 2IRFG 4KIFA 3QOPA 1LB2A 1UHMA 2G7HA 3IWZA 1KU2A 2ZFWA 1IN4A 1YIOA 3FM3A 3K1NA 2XKPA 4FX0A 3DP7A 4OIQF 5LRRA 3WTUC 4MGRA 1KU9A 5HLHA 3RJPA 2A6EF 2XAJA 1TTYA 5DD8A 1OKRA 4KN4X 3I5UA 1PP8F 4EM0B 4D0PA 3S2WA 4HW0A 2ADUA 4IHTA 2RDPA 3SFZA 3U2RA 2M5WA 4EMSA 3V7SA 4QWQA 1YFHA 1G6NA 5ILUA 4L9VA 2NNYA 3D0SA 4BXUA 5LGUA 4A5MA 2WV0A 3QPTA 1R1TA 3F8FA 4ZYHA 1R1VA 5F1RA 3F6VA 3RYPA 2QWWA 2L02A 1QO0D 3M7GA 5D5XB 1KQ0A 2P6TA 3B73A 4CDGA 4A6DA 2F5EA 5HDGA 4I7HA 4MNUA 5FD6A 1FSEA 2KIFA 3CUQB 2DK8A 3B02A 5DUKA 3BDDA 2X4HA 3BZ6A 3I53A 3I59A 5FLXK 2P7VB 1EH7A 2OQGA 2P6SA 2HZTA 4RB3C 4A0YA 4I0AA 3LFKA 4PCQA 3GVAA 1O7FA 3CO6C 1FWZA 2FF4A 2VBZA 3E5QA 4PGGA 3R6SA 4BHBA 2FBKA 3LWFA 3EUHA 4HQEA 2RVCA 3ABTA 3DXJF 4WF2A 1AWCA 3R4KA 2FNAA 2DO7A 3GW2A 4AIJA 4JQFA 1OYWA 1IN8A 1Z6TA 3E97A 2XUBA 2P7CB 2ZXJA 3P9CA 4IVNA 3G73A 1BBYA 1J7KA 5LHGA 4L0YB 3ABUA 2KJCA 4HDUA 3WTSC 2MD5A 3ECOA 3F6OA 5K5OA 1IZ1A 2M1BA 1T39A 1K7AA 2OBPA 1CF7A 3KP2A 4YG2F 2Z99A 3GO5A 4HA8A 3IWFA 3L9FA 2ESHA 1U8RA 1LVAA 1Q1HA 3QAHA 4P9FA 5BPDA 1YTYA 1YS7A 1D8JA 2ZKZA 1TW2A 4DNCA 3NRVA 3BWGA 3CUQC 3RTRA 1SFUA 1U5TB 2P5KA 2BYVE 4U0WA 3GFJA 2AS5F 2VONA 1G3YA 2QM3A 4HLYA 2OQRA 3LA7A 2IA0A 1Z1DA 2KIMA 4AIKA 3SZTA 2Z33A 1LEBA 2HTSA 2B0LA 2XV4S 3ZP5A 5F64A 4G7ZF 4KUMA 2R7FA 2CW0F 3GZ6A 4EJVA 4DQ2A 2M87A 3WTWC 3KCCA 2H27A 1IUYA 2YU3A 2ZMEB 3C7JA 3R61A 3HTUA 3ZMTA 4LFUA 3R0JA 4AVPA 1I27A 3R60A 5IT9Z 3REOA 1KA8A 1HSJA 1QNTA 1BM9A 4EJTA 4GYGA 1FLIA 1YG2A 4Y17A 5DDGA 1LNWA 1L3LA 1IRFA 4EM1A 5HS7A 1IXSB 4LB5A 1SMTA 3OV8A 2XRNA 1XGMA 1IN6A 2X0LA 1T2KA 3DEUA 1F5TA 4U88A 3BY6A 1GXPA 4U0VA 5ERIA 5HS8A 1O3SA 3HUGA 1R5HA 2QLZA 1STZA 3BP8A 3E6BA 1MDMA 2EB7A 2K27A 1BJAA 4M9ZA 3KETA 1I1GA 2BEOA 1FBSA 2HKOA 1V3FA 3VB2A 2HQRA 3BPVA 2EA2A 1XD7A 2PBIA 1XDUA 2PN6A 2EFPA 1XSVA 3HYIA 2GWRA 1ZRFA 2GXGA 4KMUX 3HOTA 1B4AA 4BHPA 5AIQA 3LAPA 5D5WB 2V1UA 4XSXF 4Q47A 3RKYA 1BC8C 2HDCA 1HKSA 1HW1A 2Q8KA 1ZARA 5D8KB 1TNTA 1G4DA 1ZLKA 4M74A 4IXAA 1SD7A 4IHSA 2LF8A 2JZYA 4G6DA 3GLXA 1FSHA 4WXHA 2UZKA 3LSTA 4YFNF 3AAFA 2YX7A 3QP6A 4I98B 3BJAA 2FBHA 2P8TA 3T0YA 3T8TA 2LF7A 4KA4A 2STTA 4LMYA 3ML6A 2VBXA 4A5NA 2KIUA 1I5ZA 3ZMZA 2ELHA 4YFKF 2E7WA 3U1DA 4HX8A 1Z6RA 3ZQ7A 4G9YA 5HVQC 1QZZA 2R3SA 5CJ9A 2Z9OA 4IRGA 1B59A 1FYMA 3KP5A 2BGCA 2NNNA 1S29A 3WGHA 2XAQA 4ON0A 4RB1A 1H0MA 4A0ZA 4I09A 4UV9A 5K5RA 4U0YA 2G7UA 2HWVA 4ESFA 4EQQA 2GA2A 1XSXA 1T6SA 4ENKA 3T1BA 3K2ZA 5D6FA 3BJ6A 1KYWA 1SD4A 5DCMA 3IL2A 1K6OA 4L5JA 2FSWA 4Q5SF 3U9GA 1KQ9A 2P5LC 4UVAA 2H09A 1LJ9A 3JAMZ 3KLNA 4CXFA 4MTDA 1MKMA 2HGCA 4M71A 2HTJA 4AD9A 4LD5A 2GAUA 2Q2EA 5DV5A 1H9TA 4BH9A 4L9NA 4P55A 4MEYF 3WTYC 3CJNA 3IHUA 3N4MA 5FB2A 5H6QA 2WTEA 1J9IA 3SQNA 5BQTA 2JTVA 3TDUC 1MZBA 4HYEA 4A2UA 2CSOA 1U78A 2W25A 2IPQX 4O6JA 4FHTA 3F23A 2CO5A 2DPUA 2LSOA 1K78B 2JPBA 2XVCA 4LB6B 4ZYGA 1B9NA 1TW3A 3O2PE 1ZH5A 4ZH4F 3JAMK 3WTVC 5K1YA 3GYHX 2L3DA 2IVMA 2VODA 1B1BA 3WU1B 4FX4A 1GHCA 2MLKA 3FMRA 1BI2A 1ZG5A 1ZG3A 1O57A 4Q48A 5LRSA 2ESNA 4WK8F 2EWNA 2HYFA 2HEOA 3GX4X 4YIIA 2EJRA 4RB0A 3ZPLA 5F6FA 4G8XA 3WE3A 1HKTA 1DDNA 5BPIA 2L4MA 2GXBA 1XCBA 4GYIA 1DP7P 3CDHA 4MHGA 3H3UA 1BC7C 4M73A 4A0XA 3IRRA 3TOBA 3WG9A 2ETHA 2D2WA 1DPUA 1OMIA 2K02A 5E1ZB 2VC0A 1FNNA 3C3WA 2A3SA 5E8GA 4WXDA 3HIFA 2QZ8A 3F21A 3ULQB 2FOKA 4P9UA 5TJJA 2FXAA 1XMAA 5L3GA 4L0ZB 2HQNA 2DPDA 2RC4A 1P4WA 4Z2YA 2BBYA 4IRIA 2JPCA 4LLGF 4IRHA 2EK5A 1P92A 3MAJA 1REPC 1RUOA 2EA4A 2GQQA 2COMA 4M9XA 5CVRA 5ICCA 1I1SA 3IKVA 5L3DA 1HXDA 3FMQA 1LDKB 5LHHA 3I0TA 2XAGA 2UXXA 2H6CA 4N9HA 5D4RA 1YLFA 2NS0A 2FMYA 5LEKA 4I02A 3DPLC 1Z05A 4GGGA 4A12A 4M6YA 4XSZF 4HDVA 2RV8A 3D5LA 3EQLF 3JTHA 1UCRA 3ZN0A 5EEGA 2ZNYA 3TQNA 1SAXA 1DPRA 2VC1A 3OOPA 3GWZA 4LLNA 2HR3A 3I59B 3TO6A 5ICGA 1Z9CA 1XGOA 3EDPA 4NB5A 4FT8A 1TQIA 3FHZA 3CUOA 1XGSA 4XRFA 1TQMA 1J59A 3M8EA 3KEOA 1IF1A 3N97A 1LDJA 4CICA 2H94A 2STWA 5ICEA 2EFNA 4ZZDA 3M1EA 4L9TA 3W6JB 5BMZA 2DT5A 1GXQA 4JBAA 2FEZA 2YX4A 2WWYA 1LDDA 4GCVA 2Y75A 6PAXA 4HLXA 2VT2A 4UVBA 3V8KA 2DQLA 2EV0A 3GF2A 4S04A 2A69F 3QPHA 2XASA 1J2XA 1ULYA 3BROA 2HYGD 3TKYA 1PUEE 4OMYA 1U2WA 4CYDA 3BJOA 5CLSA 1OR7A 2GZWA 2OD5A 2ISZA 5FGMA 1CF7B 2L01A 1I6XA 5FO5A 4U7DA 2NRAC 3BPXA 1YO5C 3E5XA 5LEJA 2ZJ2A 4HF0A 4LK1F 4I01A 4M9SA 3CO7C 2E1CA 1U3EM 2V6CA 4IPAA 3GFLA 1A04A 3KP4A 5K5QA 1G3WA 4ENMA 4EGZA 2EV5A 5CVIA 4YIFA 2F5FA 3F8MA 1IRGA 2VBYA 2MH9A 3WGGA 5ICFA 3FX3A 1O3QA 5H6RA 1X3UA 5LHIA 1P6RA 1ODDA 2IW5A 3FZVA 2HFHA 5JI6A 1ZGJA 3I58A 1SMYF 4MTEA 1W5SA 2BE5F 2A61A 2A07F 1BI0A 1BIAA 2HOEA 2QYOA 4LK0F 1Z91A 2OA4A 3FXQA 4R79A 2XGXA 4N0BA 3E3VA 4B8XA 3L7WA 5FD5A 3K69A 1ZGAA 1SD6A 2LDUA 2UWMA 1FZPB 2DK5A 4B09A 2PQ8A 3Q5FA 3RPQA 1G3SA 3J80Z 1IXCA 1HBXG 1FT9A 3WODF 4UXNA 2QBYA 1ON2A 3QU6A 3HRTA 3EYIA 4P96A 3Q9SA 3HSRA 1H9GA 1U5TC 3KE2A 2Z5UA 2V1XA 5IT9K 1WSUA 2XROA 2OZ6A 1B9MA 2RNJA 1R36A 3RIRA 1KU7A 4CZZA 2NAZA 5CVJA 1EH8A 2JT1A 1FP2A 4BHCA 1MDMB 2L4AA 5DYMA 2ZNZA 1J5YA 3T8RA 3VOEA 3DV8A 1E17A 1UFMA 3QRFF 1QPMA 3HOSA 4BYYA 3VEPA 5ED4A 3MZYA 1D3YA 2BV6A 1S3JA 1ZN2A 4EJWA 2VBWA 1YQAA 3J80K 1HKQA 3V8JA 4NHJA 1RZ4A 2DI3A 5ILSA 4MEXF 2DAOA 1ZHFA 1MJAA 2CG4A 2IA1A 3ZMDA 2PEXA 5E8IA 5DUIA 1O3RA 4HOBA 4UNOA 2E1NA 2ZO4A 4G7HF 1KQ8A 1GVJA 1R7JA 1W4MA 1IN7A 4I0BA 3KP6A 4R1HA 1HW5A 2W84A 3K0LA 1E2XA 2IT0A 2RGVA 2KRFA 2O0YA 3H92A 4H0EA 5D4SA 3F8CA 1JHFA 1DUXC 1D8KA 1WWXA 2D1VA 4ZZLA 3NQOA 1TBXA 3TOAA 2CWEA 4GO1A 3MZHA 3J7AO 4BNCA 1F4KA 4HBLA 1MJ9A 4LLLA 5L3EA 1XMKA 4EV0A 5J8CA 4RGUA 3M8FA 4LG0A 5CVVA 1W7PA 4OMZA 3HRSA 2XHKA 4HV6A 4KT5C 5DCMB 2VXZA 2O3FA 3LQRA 1JGSA 5KK1A 5LBQA 2F5CA 1ZRDA 5J8FA 4ENJA 4JK1X 3J81Z 3TDZC 4ESBA 1R22A 2J5OA 2IP2A 3ELKA 1WI9A 4AIHA 3DPTA 2CYYA 3SXYA 1W7PD 4HX4A 2PG4A 5E1XA 2DFIA 3KP7A 1QGPA 2P5VA 2GA1A 5HS9A 2FNPA 3E6MA 2MH2A 5D8LB 3GEZA 1FY7A 1SFXA 1EH6A 3RKWA 5E20A 5LGTA 5HOOA 3DF8A 1Z7UA 3F3XA 5IT3A 1XN7A 3WU0A 2QVOA 1B6AA 3E6CC 1O3TA 3J81K 5JFRA 3C1DA 4HV5A 5DEQA 5BS6A 1LEAA 4E70A 4PZJA 2XIGA 1O7LA 2XKOA 1SD5A 2QENA 3MQ0A 1R23A 1PP7U 4RS8A 4WWCA 3F22A 3HHHA 3FM5A 2VOPA 5HDKA 2MC3A 1TQPA 5DCFA 4CO8A 4LJZF 2ISYA 3MCZA 4KICA 4G7OF 1FOKA 2DBBA 3WE2A 3WTZA 2A5YB 1NHAA 1AOYA 4OOIA 2K4BA 1S8NA 4HX7A 3VODA 2QQAA 4M6XA 4Y15A 1T38A 4KIGA 5HLGA 4K2EA 5FLXZ 1ZRCA 5KVRA 5J6XA 3QU3A 2D45A 1R5GA 4ESJA 3IKTA 4EGYA 3WGIA 3IRQA 1F1ZA 1OPCA 5HDNA 4OINF 2FA5A 3H3ZA 5FFZA 4LGWA 4GXOA 2Y0MA 3CUQA 3F72A 4NQWA 2JSCA 1OYIA 1LQ1A 3I4PA 3V8LA 4IF4A 5DD4A 3HRMA 1YW9A 2QQBA 1P4AA 4O5VA 5L3BA 1RNLA 3COAC 4WXCA 3TO9A 3C18A 1S7AA 4PGHA 3LA3A 1JE8A 2EFOA 1HQCA 1FBQA 3RYRA 2XAFA 4KN7X 5L3CA 2M8EA 1C0WA 1ZLJA 1KU3A 2FU4A 3K1MA 3L2CA 4UHTA 5JVTA 2YSRA 4EJOA 2Z3YA 2EV6A 2VT3A 3KFWX 3RDIA 3ZMUA 4OU0A 1YW8A 4I2OA 4ZYEA 4XLNF 3E5UA 2O61A 1SFEA 2TDXA 3O6BB 1XB4A 3FF5A 2L54A 1CGPA 2NYXA 3KZYA 1QQIA 3P9KA 3IC7A 2PJPA 1VTNC 1YYVA 3EYYA 2V1DA 4Q4ZF 5D6EA 3PQJA 3ECHA 1IN5A 2K7LA 4RAZA 5E17F 2F5DA 2FQ3A 5JHUA 5BOXA 5CVUA 3I64A 1U5TA 2E7XA 1R1UA 5FFXA 3WTTC 1R58A 1UB9A 3SZPA 1USTA 4KNYA 1ONVA 4EJUA 1G3TA 2VOOA 3HSEA 5EEHA 3ISPA 3JTGA 2O03A 2CQKA 4S05A 5E18F 4OIOF 3KZZA 2Y48A 3DQVC 4U7BA 2DTRA 2OZUA 2ZMEA 2OAZA 4BAYA 4XLPF 2O6GE 4KYWA 2LNBA 5AIPA 1USSA 2VE9A 3KP3A 1R00A 5L3FA 2C6YA 1F9NA 1QBJA 5LGNA 2JRTA 4RGRA 4HZFA 3V4GA 1BI1A 4WCGA 3K9TA 1MJBA 1W5TA 1V4RA 2EFQA 2IJLA 2RN7A 1P2FA 3E6DA 4O3MA 5E1WA 3RPUA 2CGPA 5A2QZ 4G94A 3KLOA 3MFKA 1D5VA 1IW7F 1FC3A 1XGNA 2K86A 3FWEA 1ON1A 5AONA 1IAWA 1FPQA 2YR2A 2V79A 1HSTA 2O8XA 5HLIA 1ZAOA 2DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKM A;  2FBI A;  3ROU A;  4R8H A;  3TGN A;  2QUF A;  4MQ9 F;  3BOQ A;  4YFX F;  3V7C A;  4HF2 A;  3HTS B;  4A6E A;  4UVC A;  1ZG1 A;  1ZYR F;  2HKX A;  3L09 A;  1FBU A;  1WQ2 A;  3P7N A;  4HQM A;  2KKO A;  2OU2 A;  1HW2 A;  5CYV A;  2D1H A;  3FMS A;  5A2Q K;  2M45 A;  3ZN1 A;  2ZBK A;  2QBY B;  4ETS A;  2Q0O A;  3LA2 A;  2RQP A;  3K1P A;  2KJB A;  4Y13 A;  3TO7 A;  4CGZ A;  3ERE D;  4XBF A;  1BN5 A;  1JHH A;  2FRH A;  2ACJ A;  3KEQ A;  4RGS A;  2UXN A;  1RUN A;  1J75 A;  4IJA A;  4RGX A;  4RB2 C;  1U6G A;  3MWM A;  3I54 A;  1TLH B;  3FXR A;  5ILV A;  3ZMV A;  5LLQ A;  2W24 A;  2K4J A;  2V9V A;  4OIR F;  2QQ9 A;  2XAH A;  2HS5 A;  2RKH A;  2PI0 A;  4UUV A;  2MLG A;  1J0R A;  1MD0 A;  2CFX A;  3HHG A;  3Q9V A;  3GFM A;  4UV8 A;  2DU9 A;  1XDS A;  4P5O A;  3V7R A;  2VE8 A;  2MA3 A;  1EV7 A;  2WC2 A;  1K79 A;  1S7O A;  4KFC A;  5H20 A;  2A6H F;  3FXU A;  3LAJ A;  4N9I A;  1S6L A;  5D5V B;  3SHF A;  4L9J A;  1WRJ A;  2GIV A;  1T0F A;  4OIP F;  1YW7 A;  4MQV A;  4M72 A;  3W6K B;  3QP5 A;  1IXR C;  2MBF A;  3GFI A;  4PDK A;  4TV7 A;  1FP1 D;  4ASN A;  4KDP A;  3R0A A;  4BQA A;  4KMF A;  3EET A;  3ZMS A;  1XCV A;  3L00 A;  1RIO H;  1YS6 A;  5D5U B;  1PDN C;  1P4X A;  3F8N A;  3JW4 A;  1KYZ A;  4EVI A;  4KIB A;  3CTA A;  1MGT A;  4QLC U;  4HF1 A;  4WX9 A;  3O3K A;  2YPR A;  3HRU A;  2W85 A;  1ZRE A;  1FYK A;  3HSF A;  4RAY A;  3T5X A;  3RI4 A;  4F7Z A;  2EFW A;  4LG0 B;  3F8B A;  1BI3 A;  3PFI A;  4L5I A;  1W7P B;  1RI7 A;  3M9A A;  1K78 A;  3GUD A;  3JSP A;  3MEX A;  3GZ5 A;  2AXL A;  2IA2 A;  1JXS A;  2G9W A;  4G6Q A;  1FYL A;  2PFB A;  3P9I A;  4EM2 A;  3PQK A;  3VFZ A;  3JSO A;  2ZCW A;  4ZYD A;  1OYY A;  3LQQ A;  4HAM A;  1BOA A;  2PLY A;  2DQR A;  3G3Z A;  5TRD A;  2DW4 A;  3DKW A;  2VN2 A;  1T98 A;  1KGS A;  1UHW A;  2M30 A;  1XSD A;  1Y0U A;  3WTX C;  1L0O C;  1BIB A;  2PMH A;  3RKX A;  2R7D A;  4L18 B;  3DFG A;  2F2E A;  3GXO A;  4CHU A;  1QZY A;  2W57 A;  3NEU A;  2FML A;  2PMU A;  3CLO A;  1TNS A;  2FE3 A;  4ENN A;  2H6B A;  2P4W A;  2LKP A;  3I71 A;  2J5P A;  4AWX B;  5JR3 A;  1FX7 A;  2A68 F;  2IRF G;  4KIF A;  3QOP A;  1LB2 A;  1UHM A;  2G7H A;  3IWZ A;  1KU2 A;  2ZFW A;  1IN4 A;  1YIO A;  3FM3 A;  3K1N A;  2XKP A;  4FX0 A;  3DP7 A;  4OIQ F;  5LRR A;  3WTU C;  4MGR A;  1KU9 A;  5HLH A;  3RJP A;  2A6E F;  2XAJ A;  1TTY A;  5DD8 A;  1OKR A;  4KN4 X;  3I5U A;  1PP8 F;  4EM0 B;  4D0P A;  3S2W A;  4HW0 A;  2ADU A;  4IHT A;  2RDP A;  3SFZ A;  3U2R A;  2M5W A;  4EMS A;  3V7S A;  4QWQ A;  1YFH A;  1G6N A;  5ILU A;  4L9V A;  2NNY A;  3D0S A;  4BXU A;  5LGU A;  4A5M A;  2WV0 A;  3QPT A;  1R1T A;  3F8F A;  4ZYH A;  1R1V A;  5F1R A;  3F6V A;  3RYP A;  2QWW A;  2L02 A;  1QO0 D;  3M7G A;  5D5X B;  1KQ0 A;  2P6T A;  3B73 A;  4CDG A;  4A6D A;  2F5E A;  5HDG A;  4I7H A;  4MNU A;  5FD6 A;  1FSE A;  2KIF A;  3CUQ B;  2DK8 A;  3B02 A;  5DUK A;  3BDD A;  2X4H A;  3BZ6 A;  3I53 A;  3I59 A;  5FLX K;  2P7V B;  1EH7 A;  2OQG A;  2P6S A;  2HZT A;  4RB3 C;  4A0Y A;  4I0A A;  3LFK A;  4PCQ A;  3GVA A;  1O7F A;  3CO6 C;  1FWZ A;  2FF4 A;  2VBZ A;  3E5Q A;  4PGG A;  3R6S A;  4BHB A;  2FBK A;  3LWF A;  3EUH A;  4HQE A;  2RVC A;  3ABT A;  3DXJ F;  4WF2 A;  1AWC A;  3R4K A;  2FNA A;  2DO7 A;  3GW2 A;  4AIJ A;  4JQF A;  1OYW A;  1IN8 A;  1Z6T A;  3E97 A;  2XUB A;  2P7C B;  2ZXJ A;  3P9C A;  4IVN A;  3G73 A;  1BBY A;  1J7K A;  5LHG A;  4L0Y B;  3ABU A;  2KJC A;  4HDU A;  3WTS C;  2MD5 A;  3ECO A;  3F6O A;  5K5O A;  1IZ1 A;  2M1B A;  1T39 A;  1K7A A;  2OBP A;  1CF7 A;  3KP2 A;  4YG2 F;  2Z99 A;  3GO5 A;  4HA8 A;  3IWF A;  3L9F A;  2ESH A;  1U8R A;  1LVA A;  1Q1H A;  3QAH A;  4P9F A;  5BPD A;  1YTY A;  1YS7 A;  1D8J A;  2ZKZ A;  1TW2 A;  4DNC A;  3NRV A;  3BWG A;  3CUQ C;  3RTR A;  1SFU A;  1U5T B;  2P5K A;  2BYV E;  4U0W A;  3GFJ A;  2AS5 F;  2VON A;  1G3Y A;  2QM3 A;  4HLY A;  2OQR A;  3LA7 A;  2IA0 A;  1Z1D A;  2KIM A;  4AIK A;  3SZT A;  2Z33 A;  1LEB A;  2HTS A;  2B0L A;  2XV4 S;  3ZP5 A;  5F64 A;  4G7Z F;  4KUM A;  2R7F A;  2CW0 F;  3GZ6 A;  4EJV A;  4DQ2 A;  2M87 A;  3WTW C;  3KCC A;  2H27 A;  1IUY A;  2YU3 A;  2ZME B;  3C7J A;  3R61 A;  3HTU A;  3ZMT A;  4LFU A;  3R0J A;  4AVP A;  1I27 A;  3R60 A;  5IT9 Z;  3REO A;  1KA8 A;  1HSJ A;  1QNT A;  1BM9 A;  4EJT A;  4GYG A;  1FLI A;  1YG2 A;  4Y17 A;  5DDG A;  1LNW A;  1L3L A;  1IRF A;  4EM1 A;  5HS7 A;  1IXS B;  4LB5 A;  1SMT A;  3OV8 A;  2XRN A;  1XGM A;  1IN6 A;  2X0L A;  1T2K A;  3DEU A;  1F5T A;  4U88 A;  3BY6 A;  1GXP A;  4U0V A;  5ERI A;  5HS8 A;  1O3S A;  3HUG A;  1R5H A;  2QLZ A;  1STZ A;  3BP8 A;  3E6B A;  1MDM A;  2EB7 A;  2K27 A;  1BJA A;  4M9Z A;  3KET A;  1I1G A;  2BEO A;  1FBS A;  2HKO A;  1V3F A;  3VB2 A;  2HQR A;  3BPV A;  2EA2 A;  1XD7 A;  2PBI A;  1XDU A;  2PN6 A;  2EFP A;  1XSV A;  3HYI A;  2GWR A;  1ZRF A;  2GXG A;  4KMU X;  3HOT A;  1B4A A;  4BHP A;  5AIQ A;  3LAP A;  5D5W B;  2V1U A;  4XSX F;  4Q47 A;  3RKY A;  1BC8 C;  2HDC A;  1HKS A;  1HW1 A;  2Q8K A;  1ZAR A;  5D8K B;  1TNT A;  1G4D A;  1ZLK A;  4M74 A;  4IXA A;  1SD7 A;  4IHS A;  2LF8 A;  2JZY A;  4G6D A;  3GLX A;  1FSH A;  4WXH A;  2UZK A;  3LST A;  4YFN F;  3AAF A;  2YX7 A;  3QP6 A;  4I98 B;  3BJA A;  2FBH A;  2P8T A;  3T0Y A;  3T8T A;  2LF7 A;  4KA4 A;  2STT A;  4LMY A;  3ML6 A;  2VBX A;  4A5N A;  2KIU A;  1I5Z A;  3ZMZ A;  2ELH A;  4YFK F;  2E7W A;  3U1D A;  4HX8 A;  1Z6R A;  3ZQ7 A;  4G9Y A;  5HVQ C;  1QZZ A;  2R3S A;  5CJ9 A;  2Z9O A;  4IRG A;  1B59 A;  1FYM A;  3KP5 A;  2BGC A;  2NNN A;  1S29 A;  3WGH A;  2XAQ A;  4ON0 A;  4RB1 A;  1H0M A;  4A0Z A;  4I09 A;  4UV9 A;  5K5R A;  4U0Y A;  2G7U A;  2HWV A;  4ESF A;  4EQQ A;  2GA2 A;  1XSX A;  1T6S A;  4ENK A;  3T1B A;  3K2Z A;  5D6F A;  3BJ6 A;  1KYW A;  1SD4 A;  5DCM A;  3IL2 A;  1K6O A;  4L5J A;  2FSW A;  4Q5S F;  3U9G A;  1KQ9 A;  2P5L C;  4UVA A;  2H09 A;  1LJ9 A;  3JAM Z;  3KLN A;  4CXF A;  4MTD A;  1MKM A;  2HGC A;  4M71 A;  2HTJ A;  4AD9 A;  4LD5 A;  2GAU A;  2Q2E A;  5DV5 A;  1H9T A;  4BH9 A;  4L9N A;  4P55 A;  4MEY F;  3WTY C;  3CJN A;  3IHU A;  3N4M A;  5FB2 A;  5H6Q A;  2WTE A;  1J9I A;  3SQN A;  5BQT A;  2JTV A;  3TDU C;  1MZB A;  4HYE A;  4A2U A;  2CSO A;  1U78 A;  2W25 A;  2IPQ X;  4O6J A;  4FHT A;  3F23 A;  2CO5 A;  2DPU A;  2LSO A;  1K78 B;  2JPB A;  2XVC A;  4LB6 B;  4ZYG A;  1B9N A;  1TW3 A;  3O2P E;  1ZH5 A;  4ZH4 F;  3JAM K;  3WTV C;  5K1Y A;  3GYH X;  2L3D A;  2IVM A;  2VOD A;  1B1B A;  3WU1 B;  4FX4 A;  1GHC A;  2MLK A;  3FMR A;  1BI2 A;  1ZG5 A;  1ZG3 A;  1O57 A;  4Q48 A;  5LRS A;  2ESN A;  4WK8 F;  2EWN A;  2HYF A;  2HEO A;  3GX4 X;  4YII A;  2EJR A;  4RB0 A;  3ZPL A;  5F6F A;  4G8X A;  3WE3 A;  1HKT A;  1DDN A;  5BPI A;  2L4M A;  2GXB A;  1XCB A;  4GYI A;  1DP7 P;  3CDH A;  4MHG A;  3H3U A;  1BC7 C;  4M73 A;  4A0X A;  3IRR A;  3TOB A;  3WG9 A;  2ETH A;  2D2W A;  1DPU A;  1OMI A;  2K02 A;  5E1Z B;  2VC0 A;  1FNN A;  3C3W A;  2A3S A;  5E8G A;  4WXD A;  3HIF A;  2QZ8 A;  3F21 A;  3ULQ B;  2FOK A;  4P9U A;  5TJJ A;  2FXA A;  1XMA A;  5L3G A;  4L0Z B;  2HQN A;  2DPD A;  2RC4 A;  1P4W A;  4Z2Y A;  2BBY A;  4IRI A;  2JPC A;  4LLG F;  4IRH A;  2EK5 A;  1P92 A;  3MAJ A;  1REP C;  1RUO A;  2EA4 A;  2GQQ A;  2COM A;  4M9X A;  5CVR A;  5ICC A;  1I1S A;  3IKV A;  5L3D A;  1HXD A;  3FMQ A;  1LDK B;  5LHH A;  3I0T A;  2XAG A;  2UXX A;  2H6C A;  4N9H A;  5D4R A;  1YLF A;  2NS0 A;  2FMY A;  5LEK A;  4I02 A;  3DPL C;  1Z05 A;  4GGG A;  4A12 A;  4M6Y A;  4XSZ F;  4HDV A;  2RV8 A;  3D5L A;  3EQL F;  3JTH A;  1UCR A;  3ZN0 A;  5EEG A;  2ZNY A;  3TQN A;  1SAX A;  1DPR A;  2VC1 A;  3OOP A;  3GWZ A;  4LLN A;  2HR3 A;  3I59 B;  3TO6 A;  5ICG A;  1Z9C A;  1XGO A;  3EDP A;  4NB5 A;  4FT8 A;  1TQI A;  3FHZ A;  3CUO A;  1XGS A;  4XRF A;  1TQM A;  1J59 A;  3M8E A;  3KEO A;  1IF1 A;  3N97 A;  1LDJ A;  4CIC A;  2H94 A;  2STW A;  5ICE A;  2EFN A;  4ZZD A;  3M1E A;  4L9T A;  3W6J B;  5BMZ A;  2DT5 A;  1GXQ A;  4JBA A;  2FEZ A;  2YX4 A;  2WWY A;  1LDD A;  4GCV A;  2Y75 A;  6PAX A;  4HLX A;  2VT2 A;  4UVB A;  3V8K A;  2DQL A;  2EV0 A;  3GF2 A;  4S04 A;  2A69 F;  3QPH A;  2XAS A;  1J2X A;  1ULY A;  3BRO A;  2HYG D;  3TKY A;  1PUE E;  4OMY A;  1U2W A;  4CYD A;  3BJO A;  5CLS A;  1OR7 A;  2GZW A;  2OD5 A;  2ISZ A;  5FGM A;  1CF7 B;  2L01 A;  1I6X A;  5FO5 A;  4U7D A;  2NRA C;  3BPX A;  1YO5 C;  3E5X A;  5LEJ A;  2ZJ2 A;  4HF0 A;  4LK1 F;  4I01 A;  4M9S A;  3CO7 C;  2E1C A;  1U3E M;  2V6C A;  4IPA A;  3GFL A;  1A04 A;  3KP4 A;  5K5Q A;  1G3W A;  4ENM A;  4EGZ A;  2EV5 A;  5CVI A;  4YIF A;  2F5F A;  3F8M A;  1IRG A;  2VBY A;  2MH9 A;  3WGG A;  5ICF A;  3FX3 A;  1O3Q A;  5H6R A;  1X3U A;  5LHI A;  1P6R A;  1ODD A;  2IW5 A;  3FZV A;  2HFH A;  5JI6 A;  1ZGJ A;  3I58 A;  1SMY F;  4MTE A;  1W5S A;  2BE5 F;  2A61 A;  2A07 F;  1BI0 A;  1BIA A;  2HOE A;  2QYO A;  4LK0 F;  1Z91 A;  2OA4 A;  3FXQ A;  4R79 A;  2XGX A;  4N0B A;  3E3V A;  4B8X A;  3L7W A;  5FD5 A;  3K69 A;  1ZGA A;  1SD6 A;  2LDU A;  2UWM A;  1FZP B;  2DK5 A;  4B09 A;  2PQ8 A;  3Q5F A;  3RPQ A;  1G3S A;  3J80 Z;  1IXC A;  1HBX G;  1FT9 A;  3WOD F;  4UXN A;  2QBY A;  1ON2 A;  3QU6 A;  3HRT A;  3EYI A;  4P96 A;  3Q9S A;  3HSR A;  1H9G A;  1U5T C;  3KE2 A;  2Z5U A;  2V1X A;  5IT9 K;  1WSU A;  2XRO A;  2OZ6 A;  1B9M A;  2RNJ A;  1R36 A;  3RIR A;  1KU7 A;  4CZZ A;  2NAZ A;  5CVJ A;  1EH8 A;  2JT1 A;  1FP2 A;  4BHC A;  1MDM B;  2L4A A;  5DYM A;  2ZNZ A;  1J5Y A;  3T8R A;  3VOE A;  3DV8 A;  1E17 A;  1UFM A;  3QRF F;  1QPM A;  3HOS A;  4BYY A;  3VEP A;  5ED4 A;  3MZY A;  1D3Y A;  2BV6 A;  1S3J A;  1ZN2 A;  4EJW A;  2VBW A;  1YQA A;  3J80 K;  1HKQ A;  3V8J A;  4NHJ A;  1RZ4 A;  2DI3 A;  5ILS A;  4MEX F;  2DAO A;  1ZHF A;  1MJA A;  2CG4 A;  2IA1 A;  3ZMD A;  2PEX A;  5E8I A;  5DUI A;  1O3R A;  4HOB A;  4UNO A;  2E1N A;  2ZO4 A;  4G7H F;  1KQ8 A;  1GVJ A;  1R7J A;  1W4M A;  1IN7 A;  4I0B A;  3KP6 A;  4R1H A;  1HW5 A;  2W84 A;  3K0L A;  1E2X A;  2IT0 A;  2RGV A;  2KRF A;  2O0Y A;  3H92 A;  4H0E A;  5D4S A;  3F8C A;  1JHF A;  1DUX C;  1D8K A;  1WWX A;  2D1V A;  4ZZL A;  3NQO A;  1TBX A;  3TOA A;  2CWE A;  4GO1 A;  3MZH A;  3J7A O;  4BNC A;  1F4K A;  4HBL A;  1MJ9 A;  4LLL A;  5L3E A;  1XMK A;  4EV0 A;  5J8C A;  4RGU A;  3M8F A;  4LG0 A;  5CVV A;  1W7P A;  4OMZ A;  3HRS A;  2XHK A;  4HV6 A;  4KT5 C;  5DCM B;  2VXZ A;  2O3F A;  3LQR A;  1JGS A;  5KK1 A;  5LBQ A;  2F5C A;  1ZRD A;  5J8F A;  4ENJ A;  4JK1 X;  3J81 Z;  3TDZ C;  4ESB A;  1R22 A;  2J5O A;  2IP2 A;  3ELK A;  1WI9 A;  4AIH A;  3DPT A;  2CYY A;  3SXY A;  1W7P D;  4HX4 A;  2PG4 A;  5E1X A;  2DFI A;  3KP7 A;  1QGP A;  2P5V A;  2GA1 A;  5HS9 A;  2FNP A;  3E6M A;  2MH2 A;  5D8L B;  3GEZ A;  1FY7 A;  1SFX A;  1EH6 A;  3RKW A;  5E20 A;  5LGT A;  5HOO A;  3DF8 A;  1Z7U A;  3F3X A;  5IT3 A;  1XN7 A;  3WU0 A;  2QVO A;  1B6A A;  3E6C C;  1O3T A;  3J81 K;  5JFR A;  3C1D A;  4HV5 A;  5DEQ A;  5BS6 A;  1LEA A;  4E70 A;  4PZJ A;  2XIG A;  1O7L A;  2XKO A;  1SD5 A;  2QEN A;  3MQ0 A;  1R23 A;  1PP7 U;  4RS8 A;  4WWC A;  3F22 A;  3HHH A;  3FM5 A;  2VOP A;  5HDK A;  2MC3 A;  1TQP A;  5DCF A;  4CO8 A;  4LJZ F;  2ISY A;  3MCZ A;  4KIC A;  4G7O F;  1FOK A;  2DBB A;  3WE2 A;  3WTZ A;  2A5Y B;  1NHA A;  1AOY A;  4OOI A;  2K4B A;  1S8N A;  4HX7 A;  3VOD A;  2QQA A;  4M6X A;  4Y15 A;  1T38 A;  4KIG A;  5HLG A;  4K2E A;  5FLX Z;  1ZRC A;  5KVR A;  5J6X A;  3QU3 A;  2D45 A;  1R5G A;  4ESJ A;  3IKT A;  4EGY A;  3WGI A;  3IRQ A;  1F1Z A;  1OPC A;  5HDN A;  4OIN F;  2FA5 A;  3H3Z A;  5FFZ A;  4LGW A;  4GXO A;  2Y0M A;  3CUQ A;  3F72 A;  4NQW A;  2JSC A;  1OYI A;  1LQ1 A;  3I4P A;  3V8L A;  4IF4 A;  5DD4 A;  3HRM A;  1YW9 A;  2QQB A;  1P4A A;  4O5V A;  5L3B A;  1RNL A;  3COA C;  4WXC A;  3TO9 A;  3C18 A;  1S7A A;  4PGH A;  3LA3 A;  1JE8 A;  2EFO A;  1HQC A;  1FBQ A;  3RYR A;  2XAF A;  4KN7 X;  5L3C A;  2M8E A;  1C0W A;  1ZLJ A;  1KU3 A;  2FU4 A;  3K1M A;  3L2C A;  4UHT A;  5JVT A;  2YSR A;  4EJO A;  2Z3Y A;  2EV6 A;  2VT3 A;  3KFW X;  3RDI A;  3ZMU A;  4OU0 A;  1YW8 A;  4I2O A;  4ZYE A;  4XLN F;  3E5U A;  2O61 A;  1SFE A;  2TDX A;  3O6B B;  1XB4 A;  3FF5 A;  2L54 A;  1CGP A;  2NYX A;  3KZY A;  1QQI A;  3P9K A;  3IC7 A;  2PJP A;  1VTN C;  1YYV A;  3EYY A;  2V1D A;  4Q4Z F;  5D6E A;  3PQJ A;  3ECH A;  1IN5 A;  2K7L A;  4RAZ A;  5E17 F;  2F5D A;  2FQ3 A;  5JHU A;  5BOX A;  5CVU A;  3I64 A;  1U5T A;  2E7X A;  1R1U A;  5FFX A;  3WTT C;  1R58 A;  1UB9 A;  3SZP A;  1UST A;  4KNY A;  1ONV A;  4EJU A;  1G3T A;  2VOO A;  3HSE A;  5EEH A;  3ISP A;  3JTG A;  2O03 A;  2CQK A;  4S05 A;  5E18 F;  4OIO F;  3KZZ A;  2Y48 A;  3DQV C;  4U7B A;  2DTR A;  2OZU A;  2ZME A;  2OAZ A;  4BAY A;  4XLP F;  2O6G E;  4KYW A;  2LNB A;  5AIP A;  1USS A;  2VE9 A;  3KP3 A;  1R00 A;  5L3F A;  2C6Y A;  1F9N A;  1QBJ A;  5LGN A;  2JRT A;  4RGR A;  4HZF A;  3V4G A;  1BI1 A;  4WCG A;  3K9T A;  1MJB A;  1W5T A;  1V4R A;  2EFQ A;  2IJL A;  2RN7 A;  1P2F A;  3E6D A;  4O3M A;  5E1W A;  3RPU A;  2CGP A;  5A2Q Z;  4G94 A;  3KLO A;  3MFK A;  1D5V A;  1IW7 F;  1FC3 A;  1XGN A;  2K86 A;  3FWE A;  1ON1 A;  5AON A;  1IAW A;  1FPQ A;  2YR2 A;  2V79 A;  1HST A;  2O8X A;  5HLI A;  1ZAO A;  2DLL A; 
#chains in the Genus database with same CATH topology
 1WKM A;  5EF6 A;  2FBI A;  3RPU D;  3ROU A;  4BE1 A;  2PJR A;  4R8H A;  3TGN A;  2BZT A;  1ZK8 A;  2QUF A;  2XGC A;  3BR3 A;  4NBQ A;  4MQ9 F;  3BOQ A;  1RR7 A;  4YFX F;  3V7C A;  1X1B A;  4HF2 A;  2DJN A;  3HTS B;  4BQO A;  2XPW A;  2VB6 A;  4A6E A;  4X1E A;  4UVC A;  1ZG1 A;  2CJJ A;  3BTJ A;  1ZYR F;  2HKX A;  2W48 A;  3L09 A;  1FBU A;  1WQ2 A;  1JI8 A;  2QSF X;  3BG6 A;  3BZK A;  3FIS A;  4X6A J;  3P7N A;  5JVG F;  4HQM A;  4GDF A;  2KKO A;  3LSI A;  1B8I B;  2OU2 A;  4PSX A;  1HW2 A;  3MZ8 A;  5CYV A;  2D1H A;  2K9L A;  3FMS A;  1ITY A;  5A2Q K;  5IPA A;  2M45 A;  2XF5 A;  1JKQ C;  3ZN1 A;  2ZBK A;  2QBY B;  2NVY J;  1WI3 A;  1GT0 C;  1D5Y A;  4XON A;  4ETS A;  3G1L A;  2Q0O A;  3HG9 A;  3CMM A;  3A1Y A;  3W3C A;  2CFO A;  3LA2 A;  3CJR B;  2RQP A;  3K1P A;  1SC7 A;  4JX5 A;  3VSL A;  4ZDP A;  1ETY A;  2KJB A;  4Y13 A;  3TO7 A;  4E7S A;  3VYU B;  2NVQ J;  4CGZ A;  4FIS A;  3ERE D;  3PNY A;  4XBF A;  4A3K J;  1WJE A;  2VKD A;  1BN5 A;  1BA5 A;  3NWT A;  1GUU A;  1JHH A;  2FRH A;  2ACJ A;  4A3L J;  3KEQ A;  4RGS A;  1YJW I;  3ZXS A;  2UXN A;  3S8P A;  1RUN A;  1TWF J;  4BS9 A;  5FKN A;  1J75 A;  4IJA A;  4RGX A;  4RB2 C;  3ESW B;  1U6G A;  3MWM A;  3I54 A;  1TLH B;  4B4C A;  3FXR A;  1Y6I A;  5ILV A;  1G2H A;  3ZMV A;  2QF7 A;  5LLQ A;  3H5R A;  2W24 A;  5EYR A;  5B66 C;  2K4J A;  2V9V A;  2E2H J;  4OIR F;  2QQ9 A;  2XAH A;  1I3Q J;  5FKM A;  3ZQQ A;  2HS5 A;  1V55 H;  2RKH A;  2PI0 A;  3IUO A;  2Z2S B;  5DTD A;  3H5N A;  2JUG A;  4UUV A;  2KZV A;  1VQ6 I;  2MLG A;  1J0R A;  1MD0 A;  1Z3X A;  2CFX A;  3HHG A;  3GFM A;  3Q9V A;  4UV8 A;  2DU9 A;  2LH9 A;  3DLA A;  3LSP A;  1XDS A;  3JRG A;  2IAI A;  1YE9 A;  4FET A;  4P5O A;  3V7R A;  1AKH B;  2VE8 A;  2MA3 A;  2UUZ A;  2CH0 A;  1EV7 A;  2WC2 A;  3FKJ A;  1K79 A;  3AKZ A;  1S7O A;  3OL3 A;  4KFC A;  5H20 A;  3GTM J;  1P9Q C;  3Q3S A;  2A6H F;  3FXU A;  4PJ0 C;  3E7L A;  3LAJ A;  4N9I A;  2W4S A;  1S6L A;  5D5V B;  4DIQ A;  3GLL A;  3SHF A;  4L9J A;  1JKP C;  1WJA A;  1WRJ A;  2GIV A;  1N77 A;  1T0F A;  3RZO J;  4OIP F;  1YW7 A;  1OLT A;  4P1W A;  3NWS A;  4MQV A;  4M72 A;  3W6K B;  3QP5 A;  1IXR C;  2DT6 A;  5F04 A;  1BR1 A;  2MBF A;  3GFI A;  5EZH A;  4PDK A;  4TV7 A;  1FP1 D;  2DXI A;  3V42 A;  4ASN A;  3DBL B;  3QWL A;  2R92 J;  4KDP A;  2LVS A;  3L1P A;  2NS7 A;  3R0A A;  4BQA A;  4KMF A;  3EET A;  4DBQ A;  3HOX J;  3ZMS A;  2I5U A;  3ZCO A;  3H0G J;  3CC2 I;  1XCV A;  2LP0 A;  3L00 A;  3VSK A;  1RIO H;  1YS6 A;  2QEX I;  1EF4 A;  5D5U B;  4ZTJ A;  1PDN C;  2F4I A;  1P4X A;  3K4B A;  3F8N A;  3JW4 A;  2LR8 A;  2Y69 H;  3HOV J;  1KYZ A;  2LMD A;  4EVI A;  4KIB A;  1R71 A;  3QPS A;  4HNT A;  3CTA A;  1MGT A;  4QLC U;  1OCR H;  4HF1 A;  1MBG A;  2CS3 A;  4WX9 A;  4CYC A;  3O3K A;  2YPR A;  3HRU A;  1ETW A;  4XLH A;  2F6C A;  3P5J A;  2W85 A;  1ZRE A;  1FYK A;  2QKL B;  3LL7 A;  3HSF A;  4BEH A;  3CDL A;  4RAY A;  3BG9 A;  3T5X A;  3RI4 A;  4F7Z A;  2EFW A;  1W0U A;  4MIM A;  5C4J J;  3BQY A;  4LG0 B;  3F8B A;  1BI3 A;  2EZK A;  2Z1D A;  3PFI A;  4L5I A;  3LOC A;  3OL4 A;  2VUM J;  1W7P B;  1RI7 A;  2Y31 A;  3M9A A;  1K78 A;  3ZOB A;  3GUD A;  3S2H J;  3JSP A;  3MEX A;  2GLO A;  3GZ5 A;  4XN3 A;  3OYL A;  2BHZ A;  2AXL A;  2JRM A;  2IA2 A;  2LRD A;  1JXS A;  3M8J A;  4AYB A;  2G9W A;  4G6Q A;  1E3H A;  1FYL A;  2M34 A;  2KQR A;  2PFB A;  2CQX A;  3P9I A;  1ZGW A;  4EM2 A;  4F3Q A;  3PQK A;  1AHD P;  3VFZ A;  3JSO A;  2ZCW A;  4ZYD A;  4DYR A;  3OYB A;  3BTI A;  1OYY A;  3MN2 A;  4IOC F;  1T08 B;  3LQQ A;  2IS1 A;  2L9R A;  4HAM A;  1BOA A;  1GV2 A;  4FE7 A;  4Y4R A;  2DYR H;  2ZXW H;  2F48 A;  4D7N A;  2PLY A;  5CPR B;  2DQR A;  1TP4 A;  3G3Z A;  3L2R A;  2EZL A;  5TRD A;  1I39 A;  3H35 A;  2DW4 A;  3DKW A;  2VN2 A;  2IEK A;  3AL0 B;  4ABZ A;  3ABK H;  3WU2 C;  1T98 A;  1KGS A;  1UHW A;  2DMP A;  2M30 A;  1XSD A;  1Y0U A;  4XNF A;  3WTX C;  1L0O C;  3KYC B;  1BIB A;  4BBS J;  2PMH A;  3RKX A;  2R7D A;  4L18 B;  3DFG A;  2F2E A;  3GXO A;  3RQI A;  2LC2 A;  2GXA A;  2KIQ A;  4CHU A;  1QZY A;  2W57 A;  3NEU A;  3HOZ J;  2FML A;  2PMU A;  3CLO A;  1SFO J;  1TNS A;  2KIS A;  2FE3 A;  4ENN A;  4FQG A;  3PO3 J;  2H6B A;  2P4W A;  4ITV A;  4HPQ A;  2LKP A;  3I71 A;  2J5P A;  1Z67 A;  3PJR A;  2JJ7 A;  3OIO A;  4AWX B;  2VQC A;  5JR3 A;  1FIA A;  1FX7 A;  2A68 F;  5M5Y J;  2L5Q A;  2IRF G;  3KYD B;  4KIF A;  2LRE A;  3QOP A;  1LB2 A;  5F0H A;  4PJN A;  4XOR A;  1Y0N A;  1JT6 A;  1UHM A;  2G7H A;  3IWZ A;  1KU2 A;  2ZFW A;  1IN4 A;  1YIO A;  3FM3 A;  3K1N A;  2XKP A;  3S3M A;  1K83 J;  3GTG J;  4L5E A;  4FX0 A;  1MBJ A;  3DP7 A;  4OIQ F;  5LRR A;  4E7Z A;  3WTU C;  2DOF A;  4HG2 A;  4MGR A;  3A4C A;  1KU9 A;  5HLH A;  3H9Q A;  4IKF A;  2CV2 A;  2LTP A;  3RJP A;  2A6E F;  2XAJ A;  3HEF A;  3PUB A;  1TTY A;  5F1J A;  3L2W A;  5DD8 A;  1OKR A;  4KN4 X;  2RNG A;  2X6X A;  4BE2 A;  2O9L A;  3I5U A;  3CCL I;  1YX3 A;  3ZQC A;  1PP8 F;  2L7F P;  3AFH A;  1ETV A;  4EM0 B;  3FXM A;  4D0P A;  1WH5 A;  3S2W A;  3GTL J;  3OYK A;  1XG1 A;  4HW0 A;  2ADU A;  4IHT A;  2RDP A;  3DEE A;  4NC7 A;  3SFZ A;  2VJ5 A;  3GTJ J;  3OIP A;  1GDT A;  3U2R A;  2M5W A;  4EMS A;  3V7S A;  4QWQ A;  1YFH A;  4C3J J;  1E3P A;  2CUZ A;  1G6N A;  5K7F A;  5ILU A;  4L9V A;  2NNY A;  3K10 A;  3D0S A;  3CCJ I;  4FTH A;  4BXU A;  5LGU A;  1YOV B;  2DCE A;  4A5M A;  3IAS 2;  2WV0 A;  3QPT A;  1R1T A;  4W97 A;  3F8F A;  1JKO C;  4ZYH A;  4V2G A;  1R1V A;  5F1R A;  4A3D J;  3F6V A;  3GCM A;  3TED A;  2VJ4 A;  3RYP A;  2QWW A;  2L02 A;  2JMW A;  1QO0 D;  3M7G A;  3FXJ A;  2KLO A;  5D5X B;  1KQ0 A;  2P6T A;  3B73 A;  4CDG A;  1IJW C;  4A6D A;  2F5E A;  5FLM J;  5KNL A;  3BG7 A;  3DTI A;  5HDG A;  3SEZ A;  4PUS A;  4I7H A;  4MNU A;  5FD6 A;  1FSE A;  2KIF A;  2P81 A;  2VQL A;  2DA2 A;  3Q0U A;  2TRT A;  4A69 C;  3CUQ B;  2DK8 A;  3B02 A;  5IP6 A;  2X9D A;  5DUK A;  3BDD A;  2R7W A;  2X4H A;  4NQW B;  3K70 D;  3BZ6 A;  3I53 A;  1TT5 B;  1JJ8 C;  2WA0 A;  1SEU A;  2BVM A;  2ELK A;  2M9H A;  2M2E A;  3I59 A;  3LNQ A;  5FLX K;  5B5E C;  2P7V B;  1RPW A;  1EH7 A;  2OQG A;  2P6S A;  2HZT A;  1S9H A;  4RB3 C;  4A0Y A;  4I0A A;  3LSR A;  3A2K A;  1UJ8 A;  3G2B A;  3LFK A;  4PCQ A;  4XOP A;  3GVA A;  2EZI A;  1O7F A;  1HC8 A;  3CO6 C;  4MFD A;  2VKE A;  1FWZ A;  1X4O A;  2FF4 A;  3H9G A;  5CQE A;  5FRN A;  2VBZ A;  4D5C A;  5E3N A;  3E5Q A;  4PGG A;  3R6S A;  1K6Y A;  1GV5 A;  4BHB A;  1ENH A;  2FBK A;  2EIL H;  2LOO A;  3FXL A;  3LWF A;  3EUH A;  3UKG A;  2R7Z J;  2K3F A;  2V9P A;  5J3L A;  4BY7 J;  4HQE A;  2RVC A;  3ABT A;  3DXJ F;  2LK2 A;  1A36 A;  4WF2 A;  1I3A A;  1AWC A;  3R4K A;  2FNA A;  3CZ6 A;  5FKL A;  5C4X J;  3FBI B;  2VJJ A;  5J1R A;  2DO7 A;  3GW2 A;  3OYC A;  3FIW A;  1TWH J;  1UG2 A;  2ZJR F;  1Q1V A;  1YI2 I;  4AIJ A;  2VXD A;  3RQ4 A;  4JQF A;  1OYW A;  4GFB A;  2XDV A;  1IN8 A;  1Z6T A;  3E97 A;  4IHV A;  2XUB A;  1WJB A;  4QIW N;  1G8X A;  4D7M A;  2P7C B;  2ZXJ A;  1ETQ A;  1JUP A;  3P9C A;  1RKW A;  1HDD C;  4IVN A;  3HC7 A;  3G73 A;  4C3H J;  1A5J A;  1X4P A;  3I55 I;  1BBY A;  3M1C A;  4UUS A;  1J7K A;  5LHG A;  4L0Y B;  3ABU A;  4C30 A;  2KJC A;  2JWT A;  3GBG A;  4HDU A;  1VI0 A;  3MD2 A;  3WTS C;  1X58 A;  2MD5 A;  3ECO A;  3F6O A;  3K6G A;  2G0E A;  5K5O A;  1X2N A;  2XRL A;  4I76 A;  1IZ1 A;  1XC5 A;  2M1B A;  2YS9 A;  4IHW A;  1T39 A;  1K7A A;  3K70 C;  2OBP A;  1CF7 A;  3KP2 A;  1JTY A;  2Z99 A;  3GO5 A;  4HA8 A;  4YG2 F;  3OYG A;  3IWF A;  2HVR A;  3L9F A;  2ESH A;  1U8R A;  1LVA A;  1Q1H A;  3QAH A;  2YU9 J;  4P9F A;  5BPD A;  1YTY A;  4IX7 A;  4LG3 A;  1YS7 A;  1YHQ I;  1SAU A;  1D8J A;  3K2A A;  4M3E A;  2CQN A;  2ZKZ A;  1TW2 A;  1VQK I;  4DNC A;  3NRV A;  4F93 B;  2B7E A;  3BWG A;  3CUQ C;  3RTR A;  4B48 A;  2KHM A;  1SFU A;  5FJ8 J;  2E36 A;  3KPH A;  2CUJ A;  1R49 A;  1U9O A;  1X1C A;  4BJ6 C;  2H1K A;  4BUP A;  4BAC A;  1U5T B;  2P5K A;  2BYV E;  4U0W A;  4HRI A;  3GFJ A;  1U9N A;  4XLC A;  3C2G A;  2AS5 F;  2VON A;  3CJT B;  3ONQ A;  3FXK A;  5GAG J;  1G3Y A;  3BTL A;  5E3M A;  2QM3 A;  4HLY A;  3LFU A;  3PL8 A;  2OQR A;  3LA7 A;  2L9N A;  2IA0 A;  1Z1D A;  2KIM A;  4AIK A;  3SZT A;  1D1B A;  4XLF A;  1V5G A;  5EGO B;  2Z33 A;  1LEB A;  2HTS A;  2X51 A;  2B0L A;  2XV4 S;  1V5F A;  1JTX A;  2COB A;  3ZP5 A;  1A31 A;  4NDL A;  5F64 A;  3HGG A;  4G7Z F;  4KUM A;  2R7F A;  5M5W J;  2CW0 F;  3GZ6 A;  1T56 A;  4IL6 C;  4EJV A;  2R7T A;  4DQ2 A;  2M87 A;  3WTW C;  3KCC A;  3DCF A;  2H27 A;  1IUY A;  2YU3 A;  2ZME B;  3C7J A;  3R61 A;  1POG A;  3HTU A;  3CME I;  4RA2 A;  3ZMT A;  4LFU A;  4XM3 A;  2HPI A;  3R0J A;  2M7B A;  4AVP A;  2BY0 A;  1X3Z B;  1I27 A;  4RDU A;  3AG2 H;  2RRE A;  1DGR M;  3R60 A;  2RAE A;  5IT9 Z;  3REO A;  1KA8 A;  1HSJ A;  3JRC A;  4H4K C;  1QU3 A;  1QNT A;  2K9Q A;  1BM9 A;  3CES A;  3I3L A;  4EJT A;  2IGN A;  3PFY A;  2JVG A;  3MMY B;  4GYG A;  2XF7 A;  1FIP A;  1FLI A;  1YG2 A;  4Y17 A;  4XQF A;  2R7Q A;  1IO2 A;  5DDG A;  1LNW A;  3WG7 H;  4J19 A;  2X1E A;  1IRF A;  5M3M J;  1L3L A;  4EM1 A;  5HS7 A;  1IXS B;  4LB5 A;  1SMT A;  2QGU A;  2LD5 A;  3OV8 A;  5J4V A;  5J47 A;  2XRN A;  1XGM A;  3NAR A;  4ZJZ A;  1IN6 A;  2H8R A;  4Y52 J;  3DTE A;  2KMU A;  2X0L A;  1D0Y A;  1Y1V J;  3BR2 A;  1T2K A;  2IXS A;  1OCP A;  3FDY A;  3S15 J;  3DEU A;  3PNV A;  1VF9 A;  4B3A A;  4U88 A;  3CCM I;  3BY6 A;  1F5T A;  1GXP A;  2WV1 A;  4U0V A;  5ERI A;  5HS8 A;  1TWC J;  1O3S A;  1FOX A;  2HU9 A;  3HUG A;  1R5H A;  3PSI A;  2QLZ A;  1STZ A;  2HNH A;  1ERD A;  3HPH A;  4A3E J;  3BP8 A;  5M3F J;  3E6B A;  1KON A;  1TC3 C;  3S14 J;  1MDM A;  4XR6 A;  2RQQ A;  2PJR B;  2EB7 A;  2K27 A;  4C2U A;  1ZR4 A;  1BJA A;  1PVE A;  4M9Z A;  4E7H A;  3KET A;  1I1G A;  5LFA A;  3RZD J;  5HOD A;  2BEO A;  1FBS A;  2HKO A;  4C2M J;  1V3F A;  3VB2 A;  1OR7 C;  3SEQ A;  2HQR A;  3BPV A;  2EA2 A;  1XD7 A;  2PBI A;  1XDU A;  2PN6 A;  1JUM A;  1UHS A;  2EFP A;  1XSV A;  3HYI A;  2GWR A;  1K61 A;  2DDB A;  1LE8 A;  1X3W B;  2E19 A;  1ZRF A;  1IGN A;  2GXG A;  1OIS A;  4KMU X;  3DWL E;  2MGQ A;  4BQQ A;  3HOT A;  4E7J A;  1OCT C;  2IS4 A;  1B4A A;  4BHP A;  1W0T A;  3OS0 A;  5AIQ A;  2HXI A;  1WJD A;  3JRE A;  1T33 A;  3LAP A;  1RR8 C;  5D5W B;  4IOA F;  2V1U A;  3LMM A;  5GTH C;  4XSX F;  3IP4 B;  4Q47 A;  3RKY A;  5M5X J;  2BW3 A;  4XRS G;  1BC8 C;  1W1W E;  2BHY A;  2HDC A;  2ECC A;  1HKS A;  1HW1 A;  2DFH A;  2K40 A;  2Q8K A;  1ZAR A;  2XGD A;  3G1O A;  5D8K B;  2E5Z A;  3KX2 A;  2E1O A;  1TNT A;  1NH3 A;  1G4D A;  1ZLK A;  1MNM C;  4M74 A;  3S93 A;  4IXA A;  2HDW A;  1SD7 A;  5IOZ A;  4IHS A;  3OSG A;  4A3I J;  2LF8 A;  2JZY A;  2NXN B;  3S1M J;  4G6D A;  3ZQH A;  2X6W A;  3GLX A;  3CDI A;  1WJC A;  2KDZ A;  5EZG A;  1FSH A;  2DJI A;  2M4G A;  4WXH A;  5B3S H;  2UZK A;  1W5C C;  3LST A;  4YFN F;  2KDO A;  2CUF A;  5DM6 F;  2M0C A;  3AAF A;  2YX7 A;  3JRI A;  3QP6 A;  4I98 B;  3TL4 X;  2L9S A;  3BJA A;  3CCU I;  4UB8 C;  2FBH A;  2P8T A;  1WFX A;  3T0Y A;  2DT7 B;  3T8T A;  3GTQ J;  2LF7 A;  4YEJ A;  4KA4 A;  4A93 J;  2STT A;  1Z3Y A;  5J1Y A;  4LMY A;  5K7H A;  2MW8 A;  2DA3 A;  3ML6 A;  2VBX A;  4A5N A;  2KIU A;  4DZP A;  1I5Z A;  4E4H A;  2F4O B;  3ZMZ A;  2ELH A;  4YFK F;  2E7W A;  3U1D A;  2LG4 A;  2AHQ A;  4HX8 A;  1Z6R A;  3ZQ7 A;  4G9Y A;  5HVQ C;  1QZZ A;  2R3S A;  2ZXI A;  4DOZ A;  5CJ9 A;  2WY8 Q;  4IRG A;  3UR3 C;  2Z9O A;  1B59 A;  1TT0 A;  2X48 A;  1FYM A;  3KP5 A;  2BGC A;  3RCO A;  2NNN A;  3B6C A;  1S29 A;  1MMN A;  4W1U A;  3WGH A;  2XAQ A;  4ON0 A;  4GRI A;  4RB1 A;  1H0M A;  2MG4 A;  4A0Z A;  4I09 A;  4UV9 A;  5K5R A;  5FKK A;  4U0Y A;  2XSD C;  1MMG A;  3SDG A;  4D9J A;  2G7U A;  1MMS A;  3CCR I;  1HA8 A;  2HWV A;  2LY2 A;  4ESF A;  3BR1 A;  4EQQ A;  4V19 K;  2GA2 A;  1XSX A;  5C44 J;  4YEL A;  1T6S A;  4ENK A;  1OFC X;  2DMQ A;  3T1B A;  2JA8 J;  1XPX A;  3K2Z A;  1IG7 A;  3H36 A;  5D6F A;  3BJ6 A;  1KYW A;  1SD4 A;  5DCM A;  3IL2 A;  1K6O A;  3RSN A;  2JA6 J;  4ZYA A;  1X1D A;  4L5J A;  2FSW A;  4Q5S F;  3U9G A;  1KQ9 A;  2P5L C;  3DKX A;  1VZ0 A;  2KRC A;  4UVA A;  2H09 A;  1LJ9 A;  4QSH A;  1SVL A;  2HXO A;  3JAM Z;  3KLN A;  4CXF A;  2KP6 A;  2EQR A;  4MTD A;  1MKM A;  3KEY A;  2HGC A;  4M71 A;  3DPU A;  1UMQ A;  5GTI C;  2HTJ A;  1KZH A;  4AD9 A;  3S3O A;  4LD5 A;  3DLL F;  2LLK A;  2GAU A;  3SZG A;  4B44 A;  2Q2E A;  5EG0 A;  1AU7 A;  3ABM H;  5DV5 A;  3IAM 2;  1H9T A;  4BH9 A;  4L9N A;  3IV5 A;  4P55 A;  4MEY F;  5KHD A;  3WTY C;  4LOC A;  3CJN A;  3IHU A;  3N4M A;  5FB2 A;  2CW7 A;  5H6Q A;  2WTE A;  1J9I A;  4CYC B;  4Y33 A;  1YJN I;  4C3I J;  2CMP A;  1RES A;  2Y2Z A;  5IYB J;  3SQN A;  5BQT A;  2JTV A;  3TDU C;  1MZB A;  4HYE A;  4A2U A;  2CSO A;  4PJJ A;  1WHU A;  1U78 A;  1OCO H;  4BEH B;  1T8I A;  2W25 A;  4X0G A;  3BCB A;  2IPQ X;  2KT0 A;  4FHT A;  4O6J A;  4CUG A;  2M3A A;  3F23 A;  2BVL A;  1MND A;  2BXY A;  2CO5 A;  1K4S A;  2DPU A;  2LSO A;  1XMX A;  2R5Y A;  2JPB A;  4DBR A;  1K78 B;  2XVC A;  2E2I J;  1QZE A;  2W00 A;  4LB6 B;  3I4M J;  4JP0 A;  1ORK A;  4ZYG A;  1WH7 A;  1JUS A;  1B9N A;  1TW3 A;  3O2P E;  1ZH5 A;  4ZH4 F;  3HKZ A;  3N05 A;  3JAM K;  3VWB A;  3WTV C;  4RM3 A;  2L3D A;  5K1Y A;  1V54 H;  4UUT A;  4CCN A;  3GYH X;  2IVM A;  1BL0 A;  4DJA A;  2OTL I;  2VOD A;  1ZQ3 P;  3A01 A;  2JSP A;  1B1B A;  4UB6 C;  3WU1 B;  4FX4 A;  4RMN A;  2R7U A;  3U1K A;  1GHC A;  2R0Q C;  2MLK A;  3VYS B;  3FMR A;  3DU6 A;  2CU7 A;  2HOA A;  1VQ8 I;  1IDZ A;  3PUF A;  1BI2 A;  3CJQ B;  1ZG5 A;  3DBR B;  3Q0W A;  1ZG3 A;  1O57 A;  4Q48 A;  3LSM A;  5LRS A;  2ESN A;  4WK8 F;  4XN0 A;  1QPI A;  2EWN A;  2HYF A;  3TW7 A;  3S1Q J;  2E60 A;  2HEO A;  3GX4 X;  4YII A;  1UG0 A;  3DKY A;  2B63 J;  2W1O A;  1QVT A;  3AG3 H;  3C2B A;  4M3F A;  2EJR A;  2ZSI B;  4RB0 A;  4Y3O A;  1S72 I;  3ZPL A;  5F6F A;  4G8X A;  2LBF A;  2ICW G;  3UNG C;  3WE3 A;  1HKT A;  2I8D A;  2OC6 A;  5KAF C;  1DDN A;  5BPI A;  2L4M A;  1K4T A;  2GXB A;  1XCB A;  3HKZ N;  4GYI A;  3BC8 A;  3WHC A;  5E3L A;  4BL0 B;  1DP7 P;  3K7A J;  3CDH A;  4PJM A;  4MHG A;  3H3U A;  1BC7 C;  4M73 A;  4A0X A;  4JX4 A;  3IRR A;  3D1N I;  3TOB A;  4BDZ A;  1YIT I;  2E1M B;  2H1L A;  2MSY A;  3WG9 A;  5J1U A;  2ETH A;  2GM4 A;  4M3D A;  5GAE J;  2D2W A;  4XKW A;  1WZ2 A;  1MW7 A;  1DPU A;  1OMI A;  2K02 A;  5E1Z B;  4Z6Y A;  3PO2 J;  2IGO A;  2VC0 A;  1FNN A;  1R6R A;  3OYN A;  3C3W A;  5GAH J;  2A3S A;  5E8G A;  4LIU A;  3CQZ J;  4WXD A;  1VQL I;  3HIF A;  2QZ8 A;  2WAE A;  3F21 A;  2XF6 A;  2FOK A;  2XB5 A;  3SFI A;  3ULQ B;  4P9U A;  5TJJ A;  2FXA A;  2DA5 A;  2NVU B;  5LD2 C;  4XRM A;  1VQ9 I;  4IHX A;  1XMA A;  2WY7 Q;  5L3G A;  4L0Z B;  2HQN A;  4E6K G;  1H89 C;  2DPD A;  4BDY A;  2RC4 A;  2L0K A;  1P4W A;  4XMY A;  2KRH A;  4XOT A;  4Z2Y A;  2BBY A;  4IRI A;  2JPC A;  1MNE A;  4LLG F;  4RLF A;  4IRH A;  4IEJ A;  1LVK A;  2R7V A;  3CCQ I;  3TP0 A;  4HNV A;  3S3N A;  2EK5 A;  1P92 A;  1Y39 A;  3MAJ A;  1REP C;  1RUO A;  2EA4 A;  3M3Y J;  2GQQ A;  2COM A;  4M9X A;  5CVR A;  5ICC A;  3L2Q A;  1I1S A;  2HVQ A;  3IKV A;  1R4M B;  5L3D A;  1X1A A;  3AL0 C;  1HXD A;  3FMQ A;  1BR2 A;  1LDK B;  1JT0 A;  2V6E A;  2IBD A;  5LHH A;  1A6I A;  2XAG A;  2UXX A;  3I0T A;  1G59 A;  2JA2 A;  2H6C A;  1D0X A;  3A02 A;  5IOY A;  4N9H A;  5D4R A;  1YLF A;  2NS0 A;  2FMY A;  5LEK A;  4I02 A;  3CCY A;  3DPL C;  1YX5 A;  1Z05 A;  4GGG A;  4A12 A;  4M6Y A;  4XSZ F;  3ZRG A;  5JHF A;  1IDY A;  4HDV A;  2RV8 A;  3D5L A;  3EQL F;  2VLA A;  4EAT A;  1N75 A;  3JTH A;  1UCR A;  4U87 A;  3H5A A;  5EEG A;  3ZN0 A;  4F91 B;  2ME0 A;  1JKR C;  2ZNY A;  5GPA A;  3TQN A;  2O7O A;  3CLQ A;  1SAX A;  1DPR A;  2VC1 A;  3OOP A;  2LY9 A;  3GWZ A;  1GLN A;  1SVM A;  4LLN A;  2ECB A;  2HR3 A;  3I59 B;  4YRV A;  2V7F A;  3LSK A;  3W2W A;  3M07 A;  3TO6 A;  1E3O C;  3ZQG A;  5ICG A;  5IY5 H;  1Z9C A;  1HOM A;  1RRJ A;  1XGO A;  1MMA A;  3EDP A;  4NB5 A;  2VQG A;  2Z16 A;  4XKC A;  4FT8 A;  1TQI A;  3FHZ A;  1BJZ A;  3CUO A;  2BXZ A;  1XGS A;  3OYD A;  4XRF A;  2EBI A;  1TQM A;  2OCC H;  1J59 A;  3M8E A;  3KEO A;  2XPV A;  1IF1 A;  1TWG J;  3N97 A;  4YIR X;  1FOW A;  1LDJ A;  1VQO I;  2DMU A;  4CIC A;  2H94 A;  4BJ5 C;  2DA7 A;  2DOD A;  1R5I D;  4M3G A;  2STW A;  2B9S A;  5ICE A;  2EFN A;  4ZZD A;  2NS8 A;  2NVT J;  2X1C A;  3M1E A;  3W6V A;  1N78 A;  1MBF A;  2MFZ A;  4L9T A;  5C3E J;  3W6J B;  5BMZ A;  4CCO A;  1YRN A;  1Y8Q B;  1LFU P;  2DT5 A;  1GXQ A;  4JBA A;  2HZD A;  2R93 J;  4AID A;  2VL8 A;  3OR2 C;  2WB1 N;  2FEZ A;  3G71 I;  2YX4 A;  2WWY A;  4C2T A;  1LDD A;  2AQF A;  3QYE A;  3PIO F;  3JRD A;  4GCV A;  1FMW A;  2NVX J;  3MKZ A;  1ACI A;  4CSW A;  2Y75 A;  6PAX A;  4HLX A;  4RBO A;  1MIJ A;  2VT2 A;  4UVB A;  3V8K A;  5CKT A;  3OYE A;  2DQL A;  3HL2 A;  2EV0 A;  3GF2 A;  4S04 A;  1B72 A;  2A69 F;  3QPH A;  2MD0 A;  2XAS A;  3BLY A;  3CP8 A;  1J2X A;  1ULY A;  3BRO A;  4LIV A;  3CCV I;  4UUS B;  2HYG D;  3TKY A;  1PUE E;  2V1N A;  3EUK L;  1PUF A;  4OMY A;  3OIQ A;  4FE4 A;  1U2W A;  2QQ8 A;  4DGW B;  2K85 A;  4BXX J;  3G1M A;  4CYD A;  2DYS H;  2OTJ I;  3BJO A;  5CLS A;  1OR7 A;  1NK3 P;  2GZW A;  2OD5 A;  2ISZ A;  2KZG A;  2FOW A;  4II2 A;  3CC4 I;  3BTC A;  1Z0X A;  4IZZ A;  1LPQ A;  5FGM A;  4BQN A;  1CF7 B;  2L01 A;  4OAZ A;  1I6X A;  5FO5 A;  3ZQF A;  4U7D A;  2L7K A;  2VKH A;  4FAS D;  3BCA A;  2NRA C;  4BGD A;  3BPX A;  1YO5 C;  1LKX A;  3E5X A;  2ZJQ F;  4ZDO A;  2ZJ2 A;  4HF0 A;  5LEJ A;  2L9V A;  3HXL A;  4I01 A;  4LK1 F;  4AC0 A;  4M9S A;  3CO7 C;  2E1C A;  1QHH D;  4PJL A;  1U3E M;  2KL4 A;  2V6C A;  1J09 A;  3TMO A;  4IPA A;  2OV7 A;  3GFL A;  3HOW J;  2Q1Z B;  1A04 A;  3OMY A;  3CMY A;  1MBK A;  3GME A;  3KP4 A;  4IQ4 A;  2UV1 A;  5K5Q A;  3QYB A;  1G3W A;  3G4S I;  4ENM A;  4EGZ A;  2EV5 A;  1IRZ A;  5CVI A;  4YIF A;  2F5F A;  3F8M A;  1IRG A;  4II3 A;  1MMD A;  2VBY A;  4XRS A;  2DDA A;  2X85 A;  2LY1 A;  2MH9 A;  4QPO A;  3WGG A;  3LSH A;  2LYC A;  5ICF A;  3FX3 A;  4KJZ A;  1LUJ B;  1O3Q A;  5H6R A;  1X3U A;  1OCC H;  2DOA A;  5LHI A;  3H3V K;  4XK4 A;  3QPL A;  1WGX A;  3K4K A;  1P6R A;  3GTO J;  1ODD A;  2R7R A;  2IW5 A;  2R5Z A;  2M0M A;  4A3G J;  3FZV A;  2HFH A;  5JI6 A;  1ZGJ A;  2A05 A;  2KPM A;  3I58 A;  1LFB A;  1SMY F;  3BG5 A;  5JLW A;  4MTE A;  1W5S A;  2BE5 F;  2A61 A;  2FX0 A;  4MLO A;  2A07 F;  1BI0 A;  1BIA A;  3CF2 A;  1Y1W J;  2HOE A;  1DGW Y;  2DA4 A;  2QYO A;  4LK0 F;  3ZQI A;  2QKM B;  4BU2 A;  2W7N A;  4QPQ A;  4PK4 A;  1Z91 A;  4G6T B;  3FKI J;  2OA4 A;  3FXQ A;  2EIM H;  1PJR A;  2OCE A;  4R79 A;  2I10 A;  2XGX A;  3DBH B;  1FEX A;  2K5C A;  4N0B A;  2F5V A;  3E3V A;  4RAG A;  3B6A A;  3FK6 A;  3W2V A;  3L7W A;  2LFB A;  5FD5 A;  4B8X A;  3K69 A;  1ZGA A;  3L2U A;  4NUB A;  1SD6 A;  2LDU A;  2UWM A;  3HZJ A;  1FZP B;  1B8I A;  2DK5 A;  4B09 A;  1MBH A;  2K9S A;  2PQ8 A;  3GZN B;  3Q5F A;  3RPQ A;  1G3S A;  3FHN A;  3J80 Z;  1IXC A;  2DMN A;  4BKX A;  1HBX G;  1FT9 A;  3WOD F;  4XLE A;  1DP3 A;  4UXN A;  4A3B J;  3J7Z I;  2QBY A;  3IH3 A;  1ON2 A;  1NTC A;  3QU6 A;  3HRT A;  3EYI A;  4P96 A;  2KFD A;  3Q9S A;  1UAA A;  1A6Q A;  3IH2 A;  3TBI A;  3OYF A;  3HSR A;  5B1A H;  1SAN A;  1H9G A;  1U5T C;  3KE2 A;  3K4N A;  1U0J A;  1Y56 A;  4V2F A;  2Z5U A;  4NC8 A;  2V1X A;  1QVU A;  5IT9 K;  1WSU A;  2XRO A;  2XSJ C;  4E7L A;  4PFP A;  3A0H C;  3DEW A;  5TGT A;  1R9T J;  1VQ5 I;  3HUG B;  2OZ6 A;  2R7S A;  1B9M A;  2RNJ A;  1R36 A;  1WJF A;  1WJ5 A;  4RLQ A;  3RIR A;  1KU7 A;  3KZI C;  4CZZ A;  2D5V A;  3OYH A;  2NAZ A;  1T95 A;  5CVJ A;  1EH8 A;  2CW8 A;  2JT1 A;  1FP2 A;  4BHC A;  1MDM B;  2L4A A;  1IV8 A;  3W2A A;  5DYM A;  2ZNZ A;  1J5Y A;  3RKQ A;  3T8R A;  3VOE A;  2HPM A;  1FTT A;  3DV8 A;  1E17 A;  2O8K A;  3VPR A;  1UFM A;  3QRF F;  1QPM A;  3HOS A;  4BYY A;  1P7I A;  3VEP A;  5ED4 A;  3MZY A;  1D3Y A;  3A03 A;  1OQY A;  5GPC A;  2ZME C;  2BV6 A;  4KIT B;  1LE8 B;  1WVR A;  1S3J A;  1ZN2 A;  2EZH A;  4EJW A;  3K4J A;  2VBW A;  2DA6 A;  1YQA A;  3GTP J;  3J80 K;  2V26 A;  1HKQ A;  2FD5 A;  1HLV A;  1X1P A;  3V8J A;  1BR4 A;  3ABL H;  3LSJ A;  4NHJ A;  1RZ4 A;  2DI3 A;  5ILS A;  1AKH A;  1H88 C;  4MEX F;  3GTK J;  2BW3 B;  2DAO A;  1ZHF A;  1JGG A;  4EEF G;  1O4X A;  1MJA A;  2DMT A;  2XAU A;  3S32 A;  2CG4 A;  1AA7 A;  2IA1 A;  3E0J B;  3ZMD A;  2PEX A;  1QA6 A;  5E8I A;  2TCT A;  1ETK A;  3AG4 H;  1R4N B;  5DUI A;  1O3R A;  1JJ6 C;  4A3F J;  4NC6 A;  4HOB A;  3PM1 A;  2JK3 A;  4F55 A;  3S2D J;  4UNO A;  4M3B A;  1I50 J;  2E1N A;  5H2F C;  1NG7 A;  2ZO4 A;  1BW5 A;  4G7H F;  1KQ8 A;  1GVJ A;  1R7J A;  1W4M A;  1IN7 A;  2GOX B;  4I0B A;  1MBE A;  3KP6 A;  3SYT A;  1MH4 A;  3H9J A;  4R1H A;  1HW5 A;  4CCJ A;  3HJE A;  3OOU A;  2PX9 A;  2W84 A;  3K0L A;  4A3M J;  3HBL A;  3U21 A;  1BW6 A;  1E2X A;  1CQT A;  3MKY B;  3AG1 H;  2IT0 A;  2N8G A;  2RGV A;  2KRF A;  2O0Y A;  2OPT A;  3H92 A;  4H0E A;  5D4S A;  3F8C A;  1JHF A;  1DUX C;  1D8K A;  1ETX A;  1WWX A;  2D1V A;  4XID A;  5K7Z A;  2X6O A;  2M7A A;  4ZZL A;  3M4O J;  2Y0S A;  3CF5 F;  3HB9 A;  2JA5 J;  4KT6 A;  3NQO A;  5J4Y A;  1TBX A;  3CP2 A;  3TOA A;  1DU0 A;  2CWE A;  1RKT A;  2FQ4 A;  4GO1 A;  3MZH A;  4BY1 J;  4BNC A;  2E34 A;  3J7A O;  2DN0 A;  3BT9 A;  4B3X A;  4D1Q A;  1F4K A;  4HBL A;  1MJ9 A;  4LLL A;  5L3E A;  3JRH A;  2FJ1 A;  1XMK A;  1E0E A;  2DFE A;  2K3P A;  4EV0 A;  5J8C A;  5CQG A;  4RGU A;  3QQA A;  3BZC A;  3M8F A;  4JYK A;  4LG0 A;  5CVV A;  4OAY A;  2ID3 A;  1W7P A;  1RET A;  1FOY A;  4OMZ A;  1XTA A;  4N4O B;  4JX6 A;  3HRS A;  3J7A Y;  4KIS A;  2XHK A;  4HV6 A;  4KT5 C;  5DCM B;  3D5S C;  2VXZ A;  2O3F A;  3LQR A;  2CQ7 A;  2LKS A;  1JGS A;  5KK1 A;  1IV6 A;  5LBQ A;  2F5C A;  2VIX A;  3DU5 A;  1ZRD A;  2E35 A;  5J8F A;  4ENJ A;  3JR9 A;  3CMA I;  3VYT B;  4JK1 X;  4D5F A;  3J81 Z;  2QA4 I;  1VND A;  3TDZ C;  4ESB A;  2L2O A;  2Y0S N;  1R22 A;  2J5O A;  2IP2 A;  3BQZ A;  5EG0 B;  2Q2E B;  3ELK A;  1WI9 A;  2JA7 J;  5HNF A;  3CCS I;  4AIH A;  2AQE A;  1RC9 A;  2M8G X;  1Y8R B;  2CYY A;  3DPT A;  3NAU A;  1W7P D;  2ZXH A;  1HDP A;  4HX4 A;  3SXY A;  3OY9 A;  2PG4 A;  5E1X A;  2GOM A;  2IS6 A;  1GVD A;  2DFI A;  3DTK A;  3KP7 A;  1PYV A;  5FLV A;  1NK2 P;  1QGP A;  2P5V A;  3C2H A;  5F0F A;  3KYL A;  2GA1 A;  4XL9 A;  2NOG A;  2BY3 A;  5HS9 A;  2FNP A;  3E6M A;  2MH2 A;  5D8L B;  3BR5 A;  3GEZ A;  1FY7 A;  4F92 B;  1SFX A;  1EH6 A;  4CCM A;  3F9K A;  3RKW A;  4BBR J;  2V9K A;  5E20 A;  1MSE C;  5LGT A;  2OJE D;  4ZDL A;  5HOO A;  4E7I A;  3DF8 A;  1Z7U A;  3K4L A;  5E3O A;  1VQN I;  3F3X A;  5IT3 A;  3HM5 A;  2V4J C;  1TL8 A;  1Z21 A;  1XN7 A;  2R5Y B;  3WU0 A;  2QVO A;  5KAI C;  2BY2 A;  2WAQ A;  1B6A A;  3I56 I;  4IQJ A;  2L7M P;  3PNT A;  1OCZ H;  4B47 A;  3E6C C;  1FJL A;  1APL C;  3HDD A;  2MYS A;  2JUC A;  1BOB A;  3PSF A;  3HPG A;  3ZGK A;  4CZC A;  3ZQL A;  1O3T A;  2GIZ A;  3J81 K;  1M1E B;  5JFR A;  3HOU J;  5KCM A;  3C1D A;  4HV5 A;  5DEQ A;  4NNJ A;  1YJ9 I;  5DM7 F;  3Q0V A;  5BS6 A;  4M6V A;  1LEA A;  4E70 A;  1T0F C;  2EIJ H;  4G12 A;  4PZJ A;  2XIG A;  3A01 B;  1O7L A;  2XKO A;  1SD5 A;  2QEN A;  3MQ0 A;  4AYB N;  3H0D A;  5F27 A;  2BOL A;  1R23 A;  4DW6 A;  1PP7 U;  4RS8 A;  5J40 A;  4WWC A;  3F22 A;  3HHH A;  3EUA A;  4RM2 A;  3S1N J;  3FM5 A;  2VOP A;  4XKB A;  2H8W A;  4OWR B;  5HDK A;  2MC3 A;  4J00 A;  1TQP A;  5DCF A;  4CO8 A;  1VQ7 I;  4LJZ F;  2P0W A;  2ISY A;  3MCZ A;  4KIC A;  4G7O F;  3MKL A;  1FOK A;  2DBB A;  3WE2 A;  3WTZ A;  2Y9Z A;  4XLA A;  2A5Y B;  2EH3 A;  4PFO A;  1NHA A;  1SVO A;  1MH3 A;  3F0C A;  4AVZ A;  4CA0 A;  4CCL A;  1AOY A;  4S0H B;  4ZC3 A;  2XB0 X;  3HGY A;  4OOI A;  2K4B A;  1S8N A;  4HX7 A;  3VOD A;  4E7K A;  2QQA A;  4M6X A;  2HOS A;  4Y15 A;  2WAQ N;  3FBN B;  3A0B C;  4HEA 2;  5EDN A;  2LBF B;  3FXO A;  3OS2 A;  4UY8 I;  1QRY A;  3TW6 A;  1T38 A;  4KIG A;  5HLG A;  4B1R A;  4K2E A;  2GBY A;  5FLX Z;  1ZRC A;  2L7Z A;  4ZTF A;  5KVR A;  1TZL A;  5J6X A;  2O5R A;  3CCE I;  2A6T A;  3QU3 A;  2D45 A;  4N4N B;  1ZTR A;  1R5G A;  4ESJ A;  3IKT A;  4EGY A;  5F08 A;  3WGI A;  3IRQ A;  1F1Z A;  2EPF A;  1OPC A;  5HDN A;  4OIN F;  2FA5 A;  3WHB A;  3H3Z A;  5FFZ A;  4LGW A;  2CRG A;  4GXO A;  2WAF A;  5GAD J;  2Y0M A;  2BY1 A;  3CUQ A;  3F72 A;  4NQW A;  2NOJ B;  5F0C A;  1V5E A;  2JSC A;  3S16 J;  2DOE A;  1OYI A;  1W36 D;  3K4M A;  3PIP F;  1LQ1 A;  3I4P A;  4MFE A;  3V8L A;  3G6E I;  4IF4 A;  5DD4 A;  3HRM A;  1Z7L A;  1YW9 A;  2QQB A;  1D1C A;  3BR0 A;  1P4A A;  4O5V A;  3OYI A;  2ZJP F;  2QSH X;  3FK7 A;  5L3B A;  1RNL A;  3K4C A;  3COA C;  4WXC A;  3E1S A;  3TO9 A;  3C18 A;  1S7A A;  4PGH A;  5FRM A;  3LA3 A;  4BE0 A;  4Y7N J;  4XIC A;  1JE8 A;  2EFO A;  1HQC A;  3H1C A;  1FBQ A;  2CV1 A;  3RYR A;  2XAF A;  2R7X A;  4KN7 X;  1DQU A;  5L3C A;  1WPK A;  2M8E A;  1C0W A;  1U8B A;  1ZLJ A;  2HQ5 A;  3CC7 I;  1KU3 A;  3OSF A;  4FCY A;  2WB1 A;  5BNG A;  2FU4 A;  3ERM A;  1S5L C;  3K1M A;  2VKV A;  4ANJ A;  3L2C A;  4HNU A;  3QYF A;  3VYR B;  3S17 J;  3ASN H;  3KIO A;  5IYC J;  2IGK A;  1EA3 A;  4UHT A;  1I6H J;  1LFP A;  5JVT A;  2HYJ A;  2CUE A;  2YSR A;  5B1B H;  4EJO A;  1QHG A;  3L2V A;  2Z3Y A;  2WBM A;  2EV6 A;  4JOM A;  3OYJ A;  1EKE A;  4IHY A;  2VT3 A;  3KFW X;  3RDI A;  3ZMU A;  2XGE A;  4F52 A;  2MC4 A;  4OU0 A;  1YW8 A;  2E71 A;  3OWT A;  3JRB A;  4I2O A;  3IH4 A;  1S7E A;  4XLN F;  4ZYE A;  3O8G A;  2HQA A;  2MAB A;  3E5U A;  2O61 A;  1SFE A;  2TDX A;  2DFF A;  1WCM J;  2M4K A;  2K9N A;  3O6B B;  2R4G A;  1XB4 A;  3FF5 A;  2L54 A;  2E1M C;  1IRX A;  4AU7 A;  2F4M B;  5EJC A;  4XKV A;  5FRO A;  1CGP A;  5IP7 J;  3SDB A;  2YUS A;  3QOD A;  4PSW A;  5JLX A;  5TIS C;  3ZR8 X;  2NYX A;  2OF7 A;  3MKW B;  2W82 A;  1XX5 A;  2X1D A;  4DZJ A;  3CD6 I;  3I4N J;  2Y9Y A;  3KZY A;  2ME6 A;  2FUG 2;  1VQ4 I;  1QQI A;  3P9K A;  1IUF A;  1OJL A;  1W36 C;  3BR6 A;  4HST A;  5FKO A;  4J01 A;  3IC7 A;  2PJP A;  2JVH A;  1D0Z A;  2X6Y A;  1VTN C;  1YYV A;  3BG3 A;  3EYY A;  5GP9 A;  1ZR2 A;  3VDX A;  4A3J J;  2VPR A;  2V1D A;  2ID6 A;  5D6E A;  4Q4Z F;  3PQJ A;  3ECH A;  2HI3 A;  3TP3 A;  2CQQ A;  1IN5 A;  2K7L A;  3JRA A;  4RAZ A;  2EIK H;  5E17 F;  1NG6 A;  1VQP I;  2HOT A;  2F5D A;  2FQ3 A;  5JHU A;  1YRN B;  4C9Y A;  5BOX A;  5CVU A;  3I64 A;  5EEA A;  2PMZ A;  1HCR A;  1ETO A;  3JRF A;  3I9V 2;  1U5T A;  2CV0 A;  1R1U A;  2E7X A;  5FFX A;  5IP9 J;  2ZB9 A;  3MVP A;  2ZC2 A;  3WTT C;  3QOE A;  1HF0 A;  3LSG A;  1UEL B;  1R58 A;  1UB9 A;  1ZEL A;  1UST A;  2XPU A;  3SZP A;  4KNY A;  5HLT A;  1ONV A;  2ELJ A;  1MSF C;  4EJU A;  4HSR A;  1G3T A;  4CCK A;  3J7Y J;  2VOO A;  1VQM I;  4A3C J;  1B72 B;  2LKX A;  2HVS A;  3HSE A;  2JN6 A;  5EEH A;  5HNH A;  2IS2 A;  3ISP A;  1N25 A;  3JTG A;  1TWA J;  1PUF B;  2K9M A;  2O03 A;  2CQK A;  5EGO A;  2E5N A;  3OR1 C;  4S05 A;  1XS9 A;  5E18 F;  4OIO F;  3OS1 A;  2OUM A;  3KZZ A;  3SJM A;  1FMV A;  2Y48 A;  5E79 C;  2HDD A;  1UZC A;  1F36 A;  5DS9 A;  3DQV C;  3HOY J;  2ZFU A;  4B43 A;  4CH7 A;  4U7B A;  4I6Z A;  2DTR A;  2R7O A;  2OZU A;  2ZME A;  2VPL A;  2OAZ A;  1D1A A;  4BAY A;  4IO9 F;  2QCO A;  1ZKG A;  1H8A C;  4XLP F;  2DA1 A;  2JQ7 A;  3S1R J;  3OYM A;  2O6G E;  1A35 A;  1DU6 A;  4KYW A;  2LNB A;  5AIP A;  1USS A;  3OYA A;  1VFC A;  2VE9 A;  2PMZ N;  3KP3 A;  3X2Q H;  3EPZ A;  1R00 A;  5L3F A;  4I99 C;  2C6Y A;  1F9N A;  4RAF A;  2AXT C;  1QBJ A;  5LGN A;  2JRT A;  3ASO H;  4HZF A;  4RGR A;  3D5R C;  3V4G A;  1BI1 A;  4WCG A;  2Y30 A;  3K9T A;  4AM3 A;  1MJB A;  1W5T A;  1X19 A;  2E2J J;  2AO9 A;  2IGM A;  1V4R A;  2EFQ A;  2VAS A;  4MO7 A;  1Z77 A;  4DYQ A;  2IJL A;  1EJ9 A;  2RN7 A;  1P2F A;  3E6D A;  2DTZ A;  3JCU C;  3EUH C;  1SFK A;  4O3M A;  5E1W A;  3RPU A;  2WAD A;  5A2Q Z;  2CGP A;  9ANT A;  2ZSH B;  4BXF A;  3O8H A;  4G94 A;  3KLO A;  5IYD J;  2XC7 A;  4LIT A;  3MFK A;  2VQH A;  4DYC A;  1D5V A;  2EIN H;  1IW7 F;  1FC3 A;  1YIJ I;  1XGN A;  1FTZ A;  2K86 A;  3FWE A;  2A5W A;  1ON1 A;  4AUX A;  5AON A;  1IAW A;  4QTR A;  2QSG X;  1FPQ A;  1P7J A;  2YR2 A;  4BJT A;  1X2M A;  2V79 A;  2VJI A;  1IC8 A;  2R5Z B;  1F43 A;  1HST A;  2O8X A;  5HLI A;  1ZAO A;  2DLL A;  2VI6 A; 
#chains in the Genus database with same CATH homology
 1WKM A;  2FBI A;  3ROU A;  4R8H A;  3TGN A;  2QUF A;  4MQ9 F;  3BOQ A;  4YFX F;  3V7C A;  4HF2 A;  3HTS B;  4A6E A;  4UVC A;  1ZG1 A;  1ZYR F;  2HKX A;  3L09 A;  1FBU A;  1WQ2 A;  3P7N A;  4HQM A;  2KKO A;  2OU2 A;  1HW2 A;  5CYV A;  2D1H A;  3FMS A;  5A2Q K;  2M45 A;  3ZN1 A;  2ZBK A;  2QBY B;  4ETS A;  2Q0O A;  3LA2 A;  2RQP A;  3K1P A;  2KJB A;  4Y13 A;  3TO7 A;  4CGZ A;  3ERE D;  4XBF A;  1BN5 A;  1JHH A;  2FRH A;  2ACJ A;  3KEQ A;  4RGS A;  2UXN A;  1RUN A;  1J75 A;  4IJA A;  4RGX A;  4RB2 C;  1U6G A;  3MWM A;  3I54 A;  1TLH B;  3FXR A;  5ILV A;  3ZMV A;  5LLQ A;  2W24 A;  2K4J A;  2V9V A;  4OIR F;  2QQ9 A;  2XAH A;  2HS5 A;  2RKH A;  2PI0 A;  4UUV A;  2MLG A;  1J0R A;  1MD0 A;  2CFX A;  3HHG A;  3Q9V A;  3GFM A;  4UV8 A;  2DU9 A;  1XDS A;  4P5O A;  3V7R A;  2VE8 A;  2MA3 A;  1EV7 A;  2WC2 A;  1K79 A;  1S7O A;  4KFC A;  5H20 A;  2A6H F;  3FXU A;  3LAJ A;  4N9I A;  1S6L A;  5D5V B;  3SHF A;  4L9J A;  1WRJ A;  2GIV A;  1T0F A;  4OIP F;  1YW7 A;  4MQV A;  4M72 A;  3W6K B;  3QP5 A;  1IXR C;  2MBF A;  3GFI A;  4PDK A;  4TV7 A;  1FP1 D;  4ASN A;  4KDP A;  3R0A A;  4BQA A;  4KMF A;  3EET A;  3ZMS A;  1XCV A;  3L00 A;  1RIO H;  1YS6 A;  5D5U B;  1PDN C;  1P4X A;  3F8N A;  3JW4 A;  1KYZ A;  4EVI A;  4KIB A;  3CTA A;  1MGT A;  4QLC U;  4HF1 A;  4WX9 A;  3O3K A;  2YPR A;  3HRU A;  2W85 A;  1ZRE A;  1FYK A;  3HSF A;  4RAY A;  3T5X A;  3RI4 A;  4F7Z A;  2EFW A;  4LG0 B;  3F8B A;  1BI3 A;  3PFI A;  4L5I A;  1W7P B;  1RI7 A;  3M9A A;  1K78 A;  3GUD A;  3JSP A;  3MEX A;  3GZ5 A;  2AXL A;  2IA2 A;  1JXS A;  2G9W A;  4G6Q A;  1FYL A;  2PFB A;  3P9I A;  4EM2 A;  3PQK A;  3VFZ A;  3JSO A;  2ZCW A;  4ZYD A;  1OYY A;  3LQQ A;  4HAM A;  1BOA A;  2PLY A;  2DQR A;  3G3Z A;  5TRD A;  2DW4 A;  3DKW A;  2VN2 A;  1T98 A;  1KGS A;  1UHW A;  2M30 A;  1XSD A;  1Y0U A;  3WTX C;  1L0O C;  1BIB A;  2PMH A;  3RKX A;  2R7D A;  4L18 B;  3DFG A;  2F2E A;  3GXO A;  4CHU A;  1QZY A;  2W57 A;  3NEU A;  2FML A;  2PMU A;  3CLO A;  1TNS A;  2FE3 A;  4ENN A;  2H6B A;  2P4W A;  2LKP A;  3I71 A;  2J5P A;  4AWX B;  5JR3 A;  1FX7 A;  2A68 F;  2IRF G;  4KIF A;  3QOP A;  1LB2 A;  1UHM A;  2G7H A;  3IWZ A;  1KU2 A;  2ZFW A;  1IN4 A;  1YIO A;  3FM3 A;  3K1N A;  2XKP A;  4FX0 A;  3DP7 A;  4OIQ F;  5LRR A;  3WTU C;  4MGR A;  1KU9 A;  5HLH A;  3RJP A;  2A6E F;  2XAJ A;  1TTY A;  5DD8 A;  1OKR A;  4KN4 X;  3I5U A;  1PP8 F;  4EM0 B;  4D0P A;  3S2W A;  4HW0 A;  2ADU A;  4IHT A;  2RDP A;  3SFZ A;  3U2R A;  2M5W A;  4EMS A;  3V7S A;  4QWQ A;  1YFH A;  1G6N A;  5ILU A;  4L9V A;  2NNY A;  3D0S A;  4BXU A;  5LGU A;  4A5M A;  2WV0 A;  3QPT A;  1R1T A;  3F8F A;  4ZYH A;  1R1V A;  5F1R A;  3F6V A;  3RYP A;  2QWW A;  2L02 A;  1QO0 D;  3M7G A;  5D5X B;  1KQ0 A;  2P6T A;  3B73 A;  4CDG A;  4A6D A;  2F5E A;  5HDG A;  4I7H A;  4MNU A;  5FD6 A;  1FSE A;  2KIF A;  3CUQ B;  2DK8 A;  3B02 A;  5DUK A;  3BDD A;  2X4H A;  3BZ6 A;  3I53 A;  3I59 A;  5FLX K;  2P7V B;  1EH7 A;  2OQG A;  2P6S A;  2HZT A;  4RB3 C;  4A0Y A;  4I0A A;  3LFK A;  4PCQ A;  3GVA A;  1O7F A;  3CO6 C;  1FWZ A;  2FF4 A;  2VBZ A;  3E5Q A;  4PGG A;  3R6S A;  4BHB A;  2FBK A;  3LWF A;  3EUH A;  4HQE A;  2RVC A;  3ABT A;  3DXJ F;  4WF2 A;  1AWC A;  3R4K A;  2FNA A;  2DO7 A;  3GW2 A;  4AIJ A;  4JQF A;  1OYW A;  1IN8 A;  1Z6T A;  3E97 A;  2XUB A;  2P7C B;  2ZXJ A;  3P9C A;  4IVN A;  3G73 A;  1BBY A;  1J7K A;  5LHG A;  4L0Y B;  3ABU A;  2KJC A;  4HDU A;  3WTS C;  2MD5 A;  3ECO A;  3F6O A;  5K5O A;  1IZ1 A;  2M1B A;  1T39 A;  1K7A A;  2OBP A;  1CF7 A;  3KP2 A;  4YG2 F;  2Z99 A;  3GO5 A;  4HA8 A;  3IWF A;  3L9F A;  2ESH A;  1U8R A;  1LVA A;  1Q1H A;  3QAH A;  4P9F A;  5BPD A;  1YTY A;  1YS7 A;  1D8J A;  2ZKZ A;  1TW2 A;  4DNC A;  3NRV A;  3BWG A;  3CUQ C;  3RTR A;  1SFU A;  1U5T B;  2P5K A;  2BYV E;  4U0W A;  3GFJ A;  2AS5 F;  2VON A;  1G3Y A;  2QM3 A;  4HLY A;  2OQR A;  3LA7 A;  2IA0 A;  1Z1D A;  2KIM A;  4AIK A;  3SZT A;  2Z33 A;  1LEB A;  2HTS A;  2B0L A;  2XV4 S;  3ZP5 A;  5F64 A;  4G7Z F;  4KUM A;  2R7F A;  2CW0 F;  3GZ6 A;  4EJV A;  4DQ2 A;  2M87 A;  3WTW C;  3KCC A;  2H27 A;  1IUY A;  2YU3 A;  2ZME B;  3C7J A;  3R61 A;  3HTU A;  3ZMT A;  4LFU A;  3R0J A;  4AVP A;  1I27 A;  3R60 A;  5IT9 Z;  3REO A;  1KA8 A;  1HSJ A;  1QNT A;  1BM9 A;  4EJT A;  4GYG A;  1FLI A;  1YG2 A;  4Y17 A;  5DDG A;  1LNW A;  1L3L A;  1IRF A;  4EM1 A;  5HS7 A;  1IXS B;  4LB5 A;  1SMT A;  3OV8 A;  2XRN A;  1XGM A;  1IN6 A;  2X0L A;  1T2K A;  3DEU A;  1F5T A;  4U88 A;  3BY6 A;  1GXP A;  4U0V A;  5ERI A;  5HS8 A;  1O3S A;  3HUG A;  1R5H A;  2QLZ A;  1STZ A;  3BP8 A;  3E6B A;  1MDM A;  2EB7 A;  2K27 A;  1BJA A;  4M9Z A;  3KET A;  1I1G A;  2BEO A;  1FBS A;  2HKO A;  1V3F A;  3VB2 A;  2HQR A;  3BPV A;  2EA2 A;  1XD7 A;  2PBI A;  1XDU A;  2PN6 A;  2EFP A;  1XSV A;  3HYI A;  2GWR A;  1ZRF A;  2GXG A;  4KMU X;  3HOT A;  1B4A A;  4BHP A;  5AIQ A;  3LAP A;  5D5W B;  2V1U A;  4XSX F;  4Q47 A;  3RKY A;  1BC8 C;  2HDC A;  1HKS A;  1HW1 A;  2Q8K A;  1ZAR A;  5D8K B;  1TNT A;  1G4D A;  1ZLK A;  4M74 A;  4IXA A;  1SD7 A;  4IHS A;  2LF8 A;  2JZY A;  4G6D A;  3GLX A;  1FSH A;  4WXH A;  2UZK A;  3LST A;  4YFN F;  3AAF A;  2YX7 A;  3QP6 A;  4I98 B;  3BJA A;  2FBH A;  2P8T A;  3T0Y A;  3T8T A;  2LF7 A;  4KA4 A;  2STT A;  4LMY A;  3ML6 A;  2VBX A;  4A5N A;  2KIU A;  1I5Z A;  3ZMZ A;  2ELH A;  4YFK F;  2E7W A;  3U1D A;  4HX8 A;  1Z6R A;  3ZQ7 A;  4G9Y A;  5HVQ C;  1QZZ A;  2R3S A;  5CJ9 A;  2Z9O A;  4IRG A;  1B59 A;  1FYM A;  3KP5 A;  2BGC A;  2NNN A;  1S29 A;  3WGH A;  2XAQ A;  4ON0 A;  4RB1 A;  1H0M A;  4A0Z A;  4I09 A;  4UV9 A;  5K5R A;  4U0Y A;  2G7U A;  2HWV A;  4ESF A;  4EQQ A;  2GA2 A;  1XSX A;  1T6S A;  4ENK A;  3T1B A;  3K2Z A;  5D6F A;  3BJ6 A;  1KYW A;  1SD4 A;  5DCM A;  3IL2 A;  1K6O A;  4L5J A;  2FSW A;  4Q5S F;  3U9G A;  1KQ9 A;  2P5L C;  4UVA A;  2H09 A;  1LJ9 A;  3JAM Z;  3KLN A;  4CXF A;  4MTD A;  1MKM A;  2HGC A;  4M71 A;  2HTJ A;  4AD9 A;  4LD5 A;  2GAU A;  2Q2E A;  5DV5 A;  1H9T A;  4BH9 A;  4L9N A;  4P55 A;  4MEY F;  3WTY C;  3CJN A;  3IHU A;  3N4M A;  5FB2 A;  5H6Q A;  2WTE A;  1J9I A;  3SQN A;  5BQT A;  2JTV A;  3TDU C;  1MZB A;  4HYE A;  4A2U A;  2CSO A;  1U78 A;  2W25 A;  2IPQ X;  4O6J A;  4FHT A;  3F23 A;  2CO5 A;  2DPU A;  2LSO A;  1K78 B;  2JPB A;  2XVC A;  4LB6 B;  4ZYG A;  1B9N A;  1TW3 A;  3O2P E;  1ZH5 A;  4ZH4 F;  3JAM K;  3WTV C;  5K1Y A;  3GYH X;  2L3D A;  2IVM A;  2VOD A;  1B1B A;  3WU1 B;  4FX4 A;  1GHC A;  2MLK A;  3FMR A;  1BI2 A;  1ZG5 A;  1ZG3 A;  1O57 A;  4Q48 A;  5LRS A;  2ESN A;  4WK8 F;  2EWN A;  2HYF A;  2HEO A;  3GX4 X;  4YII A;  2EJR A;  4RB0 A;  3ZPL A;  5F6F A;  4G8X A;  3WE3 A;  1HKT A;  1DDN A;  5BPI A;  2L4M A;  2GXB A;  1XCB A;  4GYI A;  1DP7 P;  3CDH A;  4MHG A;  3H3U A;  1BC7 C;  4M73 A;  4A0X A;  3IRR A;  3TOB A;  3WG9 A;  2ETH A;  2D2W A;  1DPU A;  1OMI A;  2K02 A;  5E1Z B;  2VC0 A;  1FNN A;  3C3W A;  2A3S A;  5E8G A;  4WXD A;  3HIF A;  2QZ8 A;  3F21 A;  3ULQ B;  2FOK A;  4P9U A;  5TJJ A;  2FXA A;  1XMA A;  5L3G A;  4L0Z B;  2HQN A;  2DPD A;  2RC4 A;  1P4W A;  4Z2Y A;  2BBY A;  4IRI A;  2JPC A;  4LLG F;  4IRH A;  2EK5 A;  1P92 A;  3MAJ A;  1REP C;  1RUO A;  2EA4 A;  2GQQ A;  2COM A;  4M9X A;  5CVR A;  5ICC A;  1I1S A;  3IKV A;  5L3D A;  1HXD A;  3FMQ A;  1LDK B;  5LHH A;  3I0T A;  2XAG A;  2UXX A;  2H6C A;  4N9H A;  5D4R A;  1YLF A;  2NS0 A;  2FMY A;  5LEK A;  4I02 A;  3DPL C;  1Z05 A;  4GGG A;  4A12 A;  4M6Y A;  4XSZ F;  4HDV A;  2RV8 A;  3D5L A;  3EQL F;  3JTH A;  1UCR A;  3ZN0 A;  5EEG A;  2ZNY A;  3TQN A;  1SAX A;  1DPR A;  2VC1 A;  3OOP A;  3GWZ A;  4LLN A;  2HR3 A;  3I59 B;  3TO6 A;  5ICG A;  1Z9C A;  1XGO A;  3EDP A;  4NB5 A;  4FT8 A;  1TQI A;  3FHZ A;  3CUO A;  1XGS A;  4XRF A;  1TQM A;  1J59 A;  3M8E A;  3KEO A;  1IF1 A;  3N97 A;  1LDJ A;  4CIC A;  2H94 A;  2STW A;  5ICE A;  2EFN A;  4ZZD A;  3M1E A;  4L9T A;  3W6J B;  5BMZ A;  2DT5 A;  1GXQ A;  4JBA A;  2FEZ A;  2YX4 A;  2WWY A;  1LDD A;  4GCV A;  2Y75 A;  6PAX A;  4HLX A;  2VT2 A;  4UVB A;  3V8K A;  2DQL A;  2EV0 A;  3GF2 A;  4S04 A;  2A69 F;  3QPH A;  2XAS A;  1J2X A;  1ULY A;  3BRO A;  2HYG D;  3TKY A;  1PUE E;  4OMY A;  1U2W A;  4CYD A;  3BJO A;  5CLS A;  1OR7 A;  2GZW A;  2OD5 A;  2ISZ A;  5FGM A;  1CF7 B;  2L01 A;  1I6X A;  5FO5 A;  4U7D A;  2NRA C;  3BPX A;  1YO5 C;  3E5X A;  5LEJ A;  2ZJ2 A;  4HF0 A;  4LK1 F;  4I01 A;  4M9S A;  3CO7 C;  2E1C A;  1U3E M;  2V6C A;  4IPA A;  3GFL A;  1A04 A;  3KP4 A;  5K5Q A;  1G3W A;  4ENM A;  4EGZ A;  2EV5 A;  5CVI A;  4YIF A;  2F5F A;  3F8M A;  1IRG A;  2VBY A;  2MH9 A;  3WGG A;  5ICF A;  3FX3 A;  1O3Q A;  5H6R A;  1X3U A;  5LHI A;  1P6R A;  1ODD A;  2IW5 A;  3FZV A;  2HFH A;  5JI6 A;  1ZGJ A;  3I58 A;  1SMY F;  4MTE A;  1W5S A;  2BE5 F;  2A61 A;  2A07 F;  1BI0 A;  1BIA A;  2HOE A;  2QYO A;  4LK0 F;  1Z91 A;  2OA4 A;  3FXQ A;  4R79 A;  2XGX A;  4N0B A;  3E3V A;  4B8X A;  3L7W A;  5FD5 A;  3K69 A;  1ZGA A;  1SD6 A;  2LDU A;  2UWM A;  1FZP B;  2DK5 A;  4B09 A;  2PQ8 A;  3Q5F A;  3RPQ A;  1G3S A;  3J80 Z;  1IXC A;  1HBX G;  1FT9 A;  3WOD F;  4UXN A;  2QBY A;  1ON2 A;  3QU6 A;  3HRT A;  3EYI A;  4P96 A;  3Q9S A;  3HSR A;  1H9G A;  1U5T C;  3KE2 A;  2Z5U A;  2V1X A;  5IT9 K;  1WSU A;  2XRO A;  2OZ6 A;  1B9M A;  2RNJ A;  1R36 A;  3RIR A;  1KU7 A;  4CZZ A;  2NAZ A;  5CVJ A;  1EH8 A;  2JT1 A;  1FP2 A;  4BHC A;  1MDM B;  2L4A A;  5DYM A;  2ZNZ A;  1J5Y A;  3T8R A;  3VOE A;  3DV8 A;  1E17 A;  1UFM A;  3QRF F;  1QPM A;  3HOS A;  4BYY A;  3VEP A;  5ED4 A;  3MZY A;  1D3Y A;  2BV6 A;  1S3J A;  1ZN2 A;  4EJW A;  2VBW A;  1YQA A;  3J80 K;  1HKQ A;  3V8J A;  4NHJ A;  1RZ4 A;  2DI3 A;  5ILS A;  4MEX F;  2DAO A;  1ZHF A;  1MJA A;  2CG4 A;  2IA1 A;  3ZMD A;  2PEX A;  5E8I A;  5DUI A;  1O3R A;  4HOB A;  4UNO A;  2E1N A;  2ZO4 A;  4G7H F;  1KQ8 A;  1GVJ A;  1R7J A;  1W4M A;  1IN7 A;  4I0B A;  3KP6 A;  4R1H A;  1HW5 A;  2W84 A;  3K0L A;  1E2X A;  2IT0 A;  2RGV A;  2KRF A;  2O0Y A;  3H92 A;  4H0E A;  5D4S A;  3F8C A;  1JHF A;  1DUX C;  1D8K A;  1WWX A;  2D1V A;  4ZZL A;  3NQO A;  1TBX A;  3TOA A;  2CWE A;  4GO1 A;  3MZH A;  3J7A O;  4BNC A;  1F4K A;  4HBL A;  1MJ9 A;  4LLL A;  5L3E A;  1XMK A;  4EV0 A;  5J8C A;  4RGU A;  3M8F A;  4LG0 A;  5CVV A;  1W7P A;  4OMZ A;  3HRS A;  2XHK A;  4HV6 A;  4KT5 C;  5DCM B;  2VXZ A;  2O3F A;  3LQR A;  1JGS A;  5KK1 A;  5LBQ A;  2F5C A;  1ZRD A;  5J8F A;  4ENJ A;  4JK1 X;  3J81 Z;  3TDZ C;  4ESB A;  1R22 A;  2J5O A;  2IP2 A;  3ELK A;  1WI9 A;  4AIH A;  3DPT A;  2CYY A;  3SXY A;  1W7P D;  4HX4 A;  2PG4 A;  5E1X A;  2DFI A;  3KP7 A;  1QGP A;  2P5V A;  2GA1 A;  5HS9 A;  2FNP A;  3E6M A;  2MH2 A;  5D8L B;  3GEZ A;  1FY7 A;  1SFX A;  1EH6 A;  3RKW A;  5E20 A;  5LGT A;  5HOO A;  3DF8 A;  1Z7U A;  3F3X A;  5IT3 A;  1XN7 A;  3WU0 A;  2QVO A;  1B6A A;  3E6C C;  1O3T A;  3J81 K;  5JFR A;  3C1D A;  4HV5 A;  5DEQ A;  5BS6 A;  1LEA A;  4E70 A;  4PZJ A;  2XIG A;  1O7L A;  2XKO A;  1SD5 A;  2QEN A;  3MQ0 A;  1R23 A;  1PP7 U;  4RS8 A;  4WWC A;  3F22 A;  3HHH A;  3FM5 A;  2VOP A;  5HDK A;  2MC3 A;  1TQP A;  5DCF A;  4CO8 A;  4LJZ F;  2ISY A;  3MCZ A;  4KIC A;  4G7O F;  1FOK A;  2DBB A;  3WE2 A;  3WTZ A;  2A5Y B;  1NHA A;  1AOY A;  4OOI A;  2K4B A;  1S8N A;  4HX7 A;  3VOD A;  2QQA A;  4M6X A;  4Y15 A;  1T38 A;  4KIG A;  5HLG A;  4K2E A;  5FLX Z;  1ZRC A;  5KVR A;  5J6X A;  3QU3 A;  2D45 A;  1R5G A;  4ESJ A;  3IKT A;  4EGY A;  3WGI A;  3IRQ A;  1F1Z A;  1OPC A;  5HDN A;  4OIN F;  2FA5 A;  3H3Z A;  5FFZ A;  4LGW A;  4GXO A;  2Y0M A;  3CUQ A;  3F72 A;  4NQW A;  2JSC A;  1OYI A;  1LQ1 A;  3I4P A;  3V8L A;  4IF4 A;  5DD4 A;  3HRM A;  1YW9 A;  2QQB A;  1P4A A;  4O5V A;  5L3B A;  1RNL A;  3COA C;  4WXC A;  3TO9 A;  3C18 A;  1S7A A;  4PGH A;  3LA3 A;  1JE8 A;  2EFO A;  1HQC A;  1FBQ A;  3RYR A;  2XAF A;  4KN7 X;  5L3C A;  2M8E A;  1C0W A;  1ZLJ A;  1KU3 A;  2FU4 A;  3K1M A;  3L2C A;  4UHT A;  5JVT A;  2YSR A;  4EJO A;  2Z3Y A;  2EV6 A;  2VT3 A;  3KFW X;  3RDI A;  3ZMU A;  4OU0 A;  1YW8 A;  4I2O A;  4ZYE A;  4XLN F;  3E5U A;  2O61 A;  1SFE A;  2TDX A;  3O6B B;  1XB4 A;  3FF5 A;  2L54 A;  1CGP A;  2NYX A;  3KZY A;  1QQI A;  3P9K A;  3IC7 A;  2PJP A;  1VTN C;  1YYV A;  3EYY A;  2V1D A;  4Q4Z F;  5D6E A;  3PQJ A;  3ECH A;  1IN5 A;  2K7L A;  4RAZ A;  5E17 F;  2F5D A;  2FQ3 A;  5JHU A;  5BOX A;  5CVU A;  3I64 A;  1U5T A;  2E7X A;  1R1U A;  5FFX A;  3WTT C;  1R58 A;  1UB9 A;  3SZP A;  1UST A;  4KNY A;  1ONV A;  4EJU A;  1G3T A;  2VOO A;  3HSE A;  5EEH A;  3ISP A;  3JTG A;  2O03 A;  2CQK A;  4S05 A;  5E18 F;  4OIO F;  3KZZ A;  2Y48 A;  3DQV C;  4U7B A;  2DTR A;  2OZU A;  2ZME A;  2OAZ A;  4BAY A;  4XLP F;  2O6G E;  4KYW A;  2LNB A;  5AIP A;  1USS A;  2VE9 A;  3KP3 A;  1R00 A;  5L3F A;  2C6Y A;  1F9N A;  1QBJ A;  5LGN A;  2JRT A;  4RGR A;  4HZF A;  3V4G A;  1BI1 A;  4WCG A;  3K9T A;  1MJB A;  1W5T A;  1V4R A;  2EFQ A;  2IJL A;  2RN7 A;  1P2F A;  3E6D A;  4O3M A;  5E1W A;  3RPU A;  2CGP A;  5A2Q Z;  4G94 A;  3KLO A;  3MFK A;  1D5V A;  1IW7 F;  1FC3 A;  1XGN A;  2K86 A;  3FWE A;  1ON1 A;  5AON A;  1IAW A;  1FPQ A;  2YR2 A;  2V79 A;  1HST A;  2O8X A;  5HLI A;  1ZAO A;  2DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...