4HF1A

Crystal structure of iscr bound to its promoter
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
129
Chain Sequence
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDESVDALTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSGRQHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator IscR
publication title Studies of IscR reveal a unique mechanism for metal-dependent regulation of DNA binding specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 43
structure length 129
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hf1A00
2DQRA 1TQMA 3J7AO 2PEXA 2Z33A 5E8GA 3HTSB 4BH9A 2LNBA 5JR3A 2ELHA 2R7FA 4HLXA 3TQNA 4EM1A 5LHGA 3TDZC 1R00A 2JRTA 1IN5A 3TO9A 1KU7A 2E1NA 3SFZA 4OIRF 4ON0A 3WTSC 1JXSA 5L3FA 2V1XA 4G7HF 4GCVA 3C3WA 2QBYB 3L9FA 2VE9A 4LGWA 4RGSA 5HLIA 3V8LA 4I09A 1HKSA 4OMYA 2HYGD 1MJ9A 1KU3A 4ESFA 2VXZA 4WXCA 4OIPF 3I5UA 1EV7A 3DFGA 3FHZA 1R1VA 4DQ2A 3MCZA 3TO6A 3VOEA 1FSEA 1L0OC 3HSFA 3WGIA 1RUOA 1W5TA 4HZFA 1H0MA 5A2QZ 4CYDA 4LB6B 2FXAA 2PN6A 2KIMA 3I53A 3KP5A 4IPAA 2DTRA 3T8TA 2NNYA 4BHBA 3SZPA 1XMAA 3LWFA 3ZMTA 4IHTA 2F2EA 1KYWA 2UWMA 3B73A 3DXJF 3FF5A 1ODDA 2OAZA 3HRUA 4M72A 4A0XA 1LDKB 1W7PB 5ERIA 3Q9VA 1PP8F 1K78B 3F6VA 4OIOF 4PGHA 2AXLA 2MLGA 3T5XA 1FP2A 1U78A 4HA8A 5LHIA 5D5VB 3K1MA 5EEHA 5FFXA 3LFKA 4ENNA 2QLZA 2OQRA 4EM2A 4MEYF 1XMKA 2ACJA 4NQWA 1RNLA 2XHKA 4KN4X 4L5IA 3HIFA 4Z2YA 4QLCU 4HDVA 5H6RA 1XGNA 5DCMA 4FX4A 1PUEE 1QNTA 4A12A 1MGTA 1UCRA 2AS5F 2XUBA 4MTEA 4XLNF 2H94A 1LDDA 1I5ZA 2XAHA 4Y15A 2BBYA 1YW8A 4H0EA 1ON1A 4UVBA 2W25A 2P7CB 3C7JA 3E6DA 1FYKA 3HHHA 3T8RA 4JK1X 2XROA 2J5PA 4KIGA 3JAMK 3QAHA 3TDUC 2K4JA 3PFIA 4HF0A 1FY7A 1U5TC 2OA4A 3CO7C 3KP3A 4N9HA 4AVPA 3VFZA 4HX7A 3QU3A 3V7RA 1R5HA 5BQTA 3CO6C 2EV6A 2JPCA 4HOBA 2M8EA 3GWZA 4EVIA 3CUQA 1HXDA 2VT3A 4A2UA 1ZAOA 3G73A 1TQIA 4PGGA 3WTTC 3JTGA 2FE3A 5AIQA 4L9JA 1FX7A 2Z99A 4OU0A 4CZZA 3P9IA 1Z91A 2QVOA 4EJUA 3F8CA 1WKMA 2GXGA 3COAC 3DQVC 1HKQA 2O8XA 1W5SA 3V4GA 2DQLA 2A3SA 4PDKA 2V1UA 1R1UA 2F5FA 2EFWA 2VOOA 5CYVA 2ZMEA 1J7KA 3MEXA 4GGGA 2Y75A 2HOEA 2IP2A 1FWZA 2QM3A 1B1BA 1KQ0A 2FQ3A 1IXCA 4BXUA 3K9TA 3I59B 2DI3A 2BV6A 3DPLC 2GQQA 4AIHA 1KQ8A 2KIUA 4HF2A 4K2EA 1QGPA 5LGUA 1YO5C 4I0BA 3TKYA 1U2WA 1QO0D 5DUIA 4P55A 2DT5A 4AIJA 4FT8A 2Z3YA 4UUVA 5J8FA 3C18A 2DU9A 1FOKA 4O3MA 1FNNA 4IXAA 4ZH4F 4WXDA 2EV0A 4G94A 1JHHA 4HYEA 1U6GA 5E8IA 1WWXA 3IC7A 1H9TA 4RGRA 2P5LC 3QOPA 4WCGA 1NHAA 5DYMA 5BPIA 3E6MA 3BPXA 2CGPA 4R1HA 2XKPA 2NNNA 5DD8A 2CWEA 2EB7A 4BNCA 3HRTA 5DV5A 4HX4A 2QQAA 4KT5C 3OOPA 2EFQA 3SHFA 3IRRA 3ABUA 3FZVA 1EH7A 1EH8A 3I0TA 1OYYA 1IN4A 4MEXF 1BN5A 1IRFA 2EK5A 1HSJA 3F3XA 1IZ1A 4XBFA 2V1DA 1BI3A 4IRIA 5TJJA 4GXOA 2OU2A 4CICA 3ZMZA 4LG0A 4TV7A 3H92A 1Z9CA 1QBJA 2OBPA 5H20A 1BI1A 2P7VB 1YG2A 4UXNA 2NAZA 4KDPA 1GHCA 4IF4A 2F5CA 3HHGA 3BJ6A 1OYWA 4L5JA 4BQAA 5CVJA 1TQPA 4R8HA 4BHCA 3AAFA 1KU9A 4F7ZA 3BDDA 3BPVA 2VC1A 3BZ6A 2HKOA 3I64A 2L3DA 2QQBA 5JFRA 1YW9A 2G7HA 1JE8A 2DBBA 2RC4A 1MDMA 2OQGA 1K79A 1MJBA 1DP7P 2CO5A 1SFUA 1IUYA 2COMA 2W84A 1MJAA 3M9AA 2FMYA 4EGZA 2FF4A 4RAZA 1CF7B 1XDUA 5E1XA 2K27A 2V9VA 3EYYA 2IT0A 2A6EF 4ENJA 3KE2A 3BY6A 2M87A 3CUOA 4ZYGA 1Z05A 4PCQA 2M5WA 2KKOA 3HRMA 1DPUA 1SD6A 5J6XA 3ZN1A 1BC8C 1P6RA 2CSOA 3LAJA 1G6NA 3WTYC 3K2ZA 2HR3A 2HTSA 2EFOA 5K5QA 4M9SA 3RTRA 2P8TA 3CLOA 3IL2A 2FBHA 4JQFA 3IRQA 5D6EA 3WGHA 1G3WA 2L01A 2M1BA 5FO5A 2RV8A 1TW3A 2KRFA 2D1HA 2A69F 3ECOA 2XAQA 5HOOA 4LMYA 4MTDA 4G9YA 2TDXA 1AOYA 1ZARA 4HW0A 3HSEA 5CJ9A 4ENKA 2VODA 4ZYDA 1I6XA 1QZYA 2EJRA 4U0VA 1J0RA 3I54A 4DNCA 2ZBKA 1GXPA 3VB2A 1BIBA 1IXRC 2M45A 2ZNZA 1UFMA 3EETA 2V79A 3PQKA 1JGSA 1I27A 4Y17A 2FA5A 1C0WA 2UZKA 3V8KA 3WE3A 3F8NA 1W4MA 1SMTA 5HS8A 5K1YA 1MD0A 4IJAA 2RVCA 4M9XA 4RB0A 3KEQA 2V6CA 3W6KB 3KLOA 1LQ1A 4OOIA 3G3ZA 2PMUA 3KETA 4B09A 4GO1A 5E20A 2GIVA 5FB2A 2LF8A 1OYIA 4L0ZB 1IF1A 2ADUA 1TLHB 3RKWA 2L4AA 3DKWA 5ICEA 5D8LB 5DD4A 3I58A 1WQ2A 1P92A 4KMUX 5E1ZB 2X0LA 4Q48A 5ILVA 2IA2A 1SMYF 3MZYA 2PFBA 5A2QK 2CFXA 2RNJA 2O61A 1L3LA 3NQOA 5D8KB 4UV9A 3RI4A 1YLFA 2XAGA 4LLGF 5L3DA 1R23A 4YFXF 5CLSA 1XD7A 2DAOA 1T2KA 1G3TA 1KQ9A 4LD5A 1RUNA 2HZTA 1B9MA 2P6SA 2C6YA 5EEGA 1O7FA 3LQQA 5DCMB 5BS6A 1O57A 2G9WA 1XCVA 3GZ6A 1R5GA 1FP1D 4GYGA 2RDPA 5ICFA 5J8CA 1XB4A 2FU4A 5E18F 5LGNA 4IHSA 3QU6A 3LAPA 4G7ZF 2H6CA 2VBYA 2WTEA 5KVRA 3QP6A 4R79A 3GFLA 5IT3A 1HSTA 2P6TA 2DPUA 2UXNA 1BIAA 1UHMA 1HKTA 5ILSA 3MQ0A 2DPDA 1LB2A 1USSA 4Q4ZF 1G3YA 4LLLA 3BJAA 3REOA 3L7WA 3JSPA 2GZWA 4RB3C 1AWCA 2UXXA 3CUQB 3U2RA 3R0JA 1R22A 2QZ8A 3M8FA 4Q47A 2A61A 3V7SA 4EV0A 2VOPA 1OPCA 5BPDA 1BC7C 2M30A 4ZYEA 5DDGA 1LNWA 4LK1F 3V8JA 2CQKA 5F1RA 2CW0F 2E7XA 2OZUA 2HYFA 3GUDA 5F6FA 5LLQA 4NB5A 4HDUA 4HV5A 1J9IA 1B4AA 1A04A 4L9VA 3C1DA 2GWRA 2FRHA 3IHUA 2O3FA 3KLNA 1YIOA 4QWQA 4RB2C 3ML6A 3ZP5A 3NRVA 2ZMEB 2CYYA 1ZG5A 1IRGA 1Z1DA 4JBAA 3RKYA 1FLIA 2XRNA 3E6CC 1F1ZA 4RGXA 2FNAA 2MH9A 5ICCA 1W7PD 3JSOA 4B8XA 1R36A 3WG9A 2PMHA 4ENMA 5H6QA 2K02A 1OMIA 1I1GA 1WI9A 3JTHA 2H09A 3GEZA 5CVUA 1SD7A 3WGGA 5LGTA 5D6FA 4EJVA 3QPHA 4LFUA 1PP7U 3LA2A 5DCFA 3RYRA 5LEKA 1O3SA 3RDIA 1SD5A 3V7CA 4KIBA 4G6QA 4HF1A 4MHGA 1DUXC 4N9IA 5ED4A 2QUFA 1E17A 5FD6A 3FMQA 1UHWA 1QZZA 3ZQ7A 2LSOA 1ZGAA 4I7HA 3VODA 4EJOA 3ULQB 4WF2A 2IJLA 1XGOA 2HGCA 4KYWA 2HTJA 2DLLA 2ZFWA 1K7AA 3MZHA 2WC2A 5D5XB 2BEOA 2F5EA 1OKRA 5BOXA 3H3UA 1S7OA 3N97A 4KIFA 4UV8A 2ESNA 1HQCA 2B0LA 4EJWA 3GO5A 1Z7UA 3L2CA 3LA7A 2D2WA 5E17F 1T98A 1EH6A 3CDHA 4EQQA 2FSWA 1SD4A 1XSVA 2X4HA 3MAJA 4U7BA 2KJCA 2F5DA 1CGPA 5E1WA 4G7OF 1IAWA 5IT9Z 2VN2A 4E70A 4XLPF 3ZN0A 4G8XA 2W85A 3F8BA 1KYZA 1ONVA 1T39A 3BOQA 2DFIA 1R7JA 1O3QA 4CDGA 4IRHA 2OD5A 2Z5UA 2K4BA 1IN7A 2E7WA 4LG0B 1DPRA 1OR7A 2PLYA 4RGUA 3ISPA 3J81Z 2QQ9A 1FC3A 3J81K 4A6DA 1STZA 5BMZA 4U7DA 4Y13A 5D4SA 5ICGA 3RYPA 2PJPA 4IVNA 1S3JA 1MDMB 2ZNYA 2EA2A 3WTWC 4I0AA 5FGMA 2G7UA 3HSRA 6PAXA 1P2FA 2RN7A 2QYOA 2VONA 2L54A 3ERED 3CTAA 2W57A 1D8KA 3ZMDA 4G6DA 2IW5A 3Q5FA 3E6BA 4IRGA 4I02A 1TNSA 1REPC 1U5TA 3M1EA 1HW5A 3EDPA 4EMSA 3DEUA 4L9NA 2ZJ2A 1LDJA 2PQ8A 4P9UA 2EFNA 1X3UA 4UHTA 3S2WA 3BP8A 3FX3A 4UNOA 3WU0A 5FLXZ 4GYIA 3DV8A 3HUGA 4P5OA 3LQRA 1K6OA 5JI6A 1TBXA 3TGNA 1BM9A 4CXFA 4PZJA 3SXYA 3RKXA 1ZG1A 1ON2A 4U0WA 4ESJA 2KIFA 1B6AA 5DEQA 5LRRA 2PI0A 3F23A 4LJZF 3HOTA 3ZPLA 4P96A 4HLYA 3WTVC 3KFWX 2QENA 1T6SA 2Y0MA 2VE8A 3GFJA 3R61A 2A5YB 2EFPA 4O6JA 5HVQC 3F22A 1S8NA 4KNYA 1KU2A 3IWZA 2HKXA 2YX7A 1KGSA 1U3EM 3I71A 2Y48A 1WRJA 1ULYA 4A6EA 2LDUA 3CUQC 3WU1B 2OZ6A 5TRDA 1XSDA 4WX9A 3I4PA 1V3FA 3T1BA 4WK8F 1DDNA 1IXSB 2HQRA 2FEZA 2STWA 2O6GE 3J80Z 3K69A 3HTUA 3LSTA 2RGVA 3WTUC 4WXHA 4ASNA 4L0YB 1XGMA 3JW4A 1P4AA 2JPBA 1RI7A 2FMLA 3ELKA 4M73A 1G3SA 2ZCWA 3FXUA 3KP7A 1YYVA 4FHTA 3P9KA 2XAJA 2PG4A 2H27A 1PDNC 4WWCA 1GVJA 5HS7A 3GX4X 3KP6A 2ZO4A 1ZRDA 1USTA 4M6XA 3ZMSA 2YSRA 1FSHA 3GW2A 1SAXA 3F6OA 1E2XA 3RIRA 4MGRA 3MWMA 2XV4S 1QQIA 1BJAA 3U9GA 1B59A 2O03A 5AONA 2DK5A 3KP4A 1ZG3A 2IA1A 1D3YA 1F9NA 1FBUA 1YS6A 3KP2A 3F8MA 3FXQA 2HWVA 5HLGA 3GXOA 2YPRA 3P9CA 3QPTA 1Y0UA 2WWYA 4YG2F 3QRFF 5ILUA 1YS7A 5CVVA 1XGSA 4M6YA 3B02A 2ETHA 5AIPA 1BBYA 4XRFA 3IWFA 3GYHX 2DO7A 3ZMVA 2QBYA 3R6SA 1VTNC 2GA2A 2ISZA 1J59A 3R60A 1YTYA 1T38A 1TNTA 4KUMA 1J2XA 3DPTA 4LB5A 2FNPA 2BE5F 2D45A 2STTA 3M8EA 5LHHA 5K5RA 4A5NA 4ZZDA 1S7AA 1Z6RA 2Q2EA 3W6JB 4MNUA 1LEBA 5CVIA 3GF2A 3Q9SA 2E1CA 1ZHFA 2VT2A 4ETSA 2XAFA 3T0YA 5KK1A 4XSZF 4A0ZA 2IA0A 3KCCA 4AD9A 3TOBA 1XN7A 3ZMUA 2BGCA 2NYXA 2A07F 4UVAA 1Q1HA 3DP7A 1W7PA 4HX8A 4L18B 4NHJA 3WE2A 1K78A 3GVAA 1YFHA 3O6BB 3L09A 2JSCA 1ZRFA 1KA8A 1RIOH 2IPQX 2HQNA 5HDNA 3O2PE 1LJ9A 2Q0OA 3H3ZA 2EV5A 2XKOA 3JAMZ 2XGXA 3QP5A 2JTVA 4HAMA 2D1VA 4RAYA 4U88A 1ZLKA 4HBLA 1XSXA 2JZYA 1FYLA 3F21A 1WSUA 3E97A 1FBQA 2WV0A 2IVMA 3GZ5A 2KJBA 4U0YA 1HW1A 5HS9A 4EGYA 2A68F 3KEOA 2EA4A 3P7NA 4HV6A 1SFXA 3ROUA 4BHPA 3SQNA 1FYMA 3RPQA 5FFZA 2HEOA 3KZYA 1P4XA 1D5VA 1LEAA 3D0SA 1ZYRF 3K0LA 2MD5A 2MBFA 1F4KA 3VEPA 3BWGA 4RS8A 4ZZLA 3ECHA 3EYIA 2YU3A 2R3SA 2VBWA 3FMSA 4AWXB 4ESBA 5D4RA 2DW4A 4LK0F 3R4KA 4S05A 3FWEA 2HDCA 2YR2A 2NRAC 3FM3A 2DK8A 3F72A 4N0BA 4AIKA 2YX4A 1V4RA 3FM5A 2FBIA 1HBXG 2GA1A 4M74A 1U8RA 1O3TA 3BROA 2XIGA 4ZYHA 2ZXJA 4CHUA 1FBSA 3WTXC 1YQAA 3RJPA 3HOSA 1FPQA 2BYVE 5HLHA 1XDSA 1BI2A 2JT1A 2FBKA 4MQ9F 5FD5A 3CJNA 4FX0A 3E5QA 1T0FA 3I59A 4BYYA 2MC3A 2O0YA 1O3RA 2MLKA 3U1DA 3HRSA 1SFEA 4BAYA 1GXQA 2P5KA 4KICA 3IKTA 5JVTA 4KA4A 5IT9K 4I98B 4RB1A 1D8JA 3TOAA 1B9NA 1H9GA 4Q5SF 4KMFA 2NS0A 2HS5A 3EQLF 2ISYA 2VBXA 1J5YA 1ZREA 5HDKA 5F64A 3DF8A 1ZGJA 2RKHA 1TW2A 4D0PA 2P5VA 1S29A 1S6LA 1IN6A 2R7DA 1ZRCA 2MA3A 3SZTA 2VBZA 1ZLJA 3K1PA 1J75A 4YFKF 3M7GA 4EM0B 1ZN2A 1U5TB 1Z6TA 1MKMA 4L9TA 4LLNA 2A6HF 4CGZA 2HFHA 1QPMA 4A5MA 5LBQA 4YIIA 3NEUA 3IKVA 4UVCA 4HQEA 5L3BA 4YFNF 1JHFA 2CG4A 1R1TA 1MZBA 5D5WB 2W24A 3RPUA 5JHUA 2QWWA 1YW7A 2Z9OA 2FOKA 2L02A 4CO8A 5LEJA 3BJOA 3WODF 1BI0A 2ESHA 5CVRA 1IN8A 5K5OA 1UB9A 4M71A 4A0YA 4KFCA 5FLXK 3E5XA 4M9ZA 2EWNA 2XASA 5DUKA 3FMRA 3GFIA 1F5TA 1BOAA 3L00A 1FZPB 1O7LA 4OINF 1P4WA 4XSXF 4MQVA 3EUHA 3GLXA 1TTYA 4OMZA 5L3GA 4OIQF 4S04A 5L3EA 3WTZA 3LA3A 4HQMA 4KN7X 4I2OA 1RZ4A 2RQPA 3TO7A 3E5UA 2Q8KA 2L4MA 1FT9A 3OV8A 4EJTA 2GXBA 2LF7A 1CF7A 1G4DA 2ZKZA 2H6BA 5HDGA 3GFMA 4O5VA 3N4MA 3F8FA 5LRSA 2J5OA 4P9FA 4I01A 4YIFA 2MH2A 5D5UB 1ZH5A 3FXRA 3R0AA 2P4WA 1R58A 2VC0A 1I1SA 3ABTA 2IRFG 5L3CA 2LKPA 2K86A 2XVCA 3J80K 3D5LA 3HYIA 1HW2A 3E3VA 3PQJA 3K1NA 3O3KA 1LVAA 2GAUA 2PBIA 3MFKA 2K7LA 1IW7F 3KZZA 1XCBA
chains in the Genus database with same CATH superfamily
2DQRA 3K70D 1TQMA 3J7AO 2PEXA 1HLVA 2R92J 2VL8A 2Z33A 3BR5A 5E8GA 4HNUA 3HTSB 2EINH 4BH9A 2R7WA 2LNBA 5JR3A 5J4VA 2ELHA 2R7FA 2WADA 4HLXA 4RBOA 3TQNA 4EM1A 5LHGA 2D5VA 1W5CC 2X6YA 3TDZC 3U21A 4F3QA 5B3SH 1R00A 3C2BA 5FLVA 2JRTA 1IN5A 3CDIA 3RZOJ 4F55A 3OSGA 3TO9A 1EA3A 4DYRA 3D5SC 3M3YJ 2B63J 1KU7A 5H2FC 1DP3A 2E1NA 3SFZA 4OIRF 1F36A 4UB6C 2VPRA 4KISA 1ITYA 2AHQA 1U9OA 4ON0A 3WTSC 1JXSA 5J47A 5B1BH 5L3FA 2V1XA 5GAGJ 4G7HF 4GCVA 3C3WA 3NAUA 2QBYB 3L9FA 1WJBA 2HVQA 2KFDA 2VE9A 3G2BA 1R5ID 1WVRA 4LGWA 4RGSA 5HLIA 1JKPC 3V8LA 4A3GJ 4I09A 1HKSA 4OMYA 1Y1WJ 2Z1DA 2AXTC 2HYGD 4BEHB 4GDFA 5EG0A 3DBLB 1MJ9A 3DLLF 3PSFA 3W2WA 2JQ7A 1Y0NA 2V4JC 4XLEA 2VJIA 1KU3A 4ESFA 4QTRA 2VXZA 4WXCA 4HNTA 2LP0A 1P7IA 2RAEA 1G59A 4OIPF 1AU7A 3I5UA 2VASA 4XR6A 2XF6A 5DM7F 1NK3P 1EV7A 4CCKA 5TISC 3DFGA 1TWHJ 2HVSA 3PUBA 3FHZA 1R1VA 2ME6A 5E3OA 4DQ2A 3MCZA 3TO6A 2DA1A 1ZK8A 3CESA 3VOEA 4AM3A 1FSEA 1L0OC 3HSFA 3WGIA 3S1RJ 2Q2EB 1RUOA 1W5TA 4HZFA 4JX5A 1P7JA 3OWTA 1H0MA 3QPLA 5A2QZ 3KIOA 4CYDA 4LB6B 2FXAA 3GTKJ 2PN6A 4U87A 1X1BA 3GTLJ 5IP9J 1ZTRA 2KIMA 3I53A 3KP5A 4IPAA 4ABZA 3AG1H 2DTRA 3T8TA 2NNYA 4BHBA 3SZPA 1XMAA 3LWFA 3ZMTA 4IHTA 3FHNA 1JJ8C 2R0QC 1IUFA 2F2EA 3HZJA 1KYWA 4NC7A 2R7VA 2UWMA 3B73A 3DXJF 1WZ2A 1ZQ3P 1V54H 2V26A 3FF5A 1ODDA 4C3IJ 1Y39A 2OAZA 2ZXIA 3HRUA 4M72A 4A0XA 1LDKB 1W7PB 2IS4A 4BY1J 1JKRC 5ERIA 1U8BA 3Q9VA 3ESWB 1PP8F 1ETVA 1OR7C 5EZGA 1K78B 3F6VA 4OIOF 3ZQFA 4PGHA 2AXLA 3VYSB 2MLGA 3T5XA 1FP2A 4DGWB 3S3OA 1XG1A 1U78A 4HA8A 5LHIA 1QPIA 5D5VB 2QSGX 3ABKH 2K9QA 3AL0C 3S2DJ 2I8DA 3K1MA 5EEHA 5FFXA 1XPXA 1NH3A 3LFKA 5FJ8J 3GLLA 3OYDA 1YRNA 4ENNA 2QLZA 2OQRA 4EM2A 4MEYF 2IAIA 1X1AA 1XMKA 3LSIA 2QEXI 4IHXA 1T33A 2ACJA 3H3VK 4JX6A 3FISA 4NQWA 1RNLA 2XHKA 4KN4X 4L5IA 2MW8A 3HIFA 4Z2YA 4QLCU 4HDVA 4XOPA 5H6RA 4C2MJ 1RETA 1XGNA 2MD0A 5DCMA 1XX5A 4FX4A 1PUEE 1V5EA 1QNTA 4A12A 4DBQA 4XL9A 1MGTA 5C4XJ 2WB1N 3HM5A 3PO2J 1UCRA 2AS5F 2XUBA 1WPKA 4XLAA 4MTEA 2H94A 1LDDA 1I5ZA 4XLNF 4AYBA 4HNVA 3PIOF 4ZDOA 1YJNI 1VQ8I 2XAHA 3DU5A 3LSMA 2BBYA 4XM3A 4Y15A 1YW8A 2E35A 4H0EA 3GTQJ 1ON1A 3V42A 4UVBA 2W25A 2P7CB 1OCPA 1T08B 3C7JA 3E6DA 1FYKA 4Y4RA 3KZIC 3HHHA 3T8RA 5HNFA 3ZR8X 4A69C 3DEWA 3PSIA 4JK1X 2XROA 4BE0A 2VPLA 2J5PA 4PJMA 4KIGA 3JAMK 1HCRA 3QAHA 3KPHA 4X1EA 3TDUC 2K4JA 4OWRB 1SANA 3PFIA 2OF7A 4HF0A 5K7FA 1TWAJ 5M3MJ 1FY7A 1U5TC 2E36A 2OA4A 3D1NI 3CO7C 3WHBA 1H89C 3KP3A 4N9HA 4AVPA 3CMMA 3VFZA 2V9KA 5B66C 5TGTA 2CRGA 3QU3A 4HX7A 2GXAA 3V7RA 1R5HA 5BQTA 3CO6C 2EV6A 2JPCA 4HOBA 2M8EA 2XGEA 4JYKA 1ETQA 4YEJA 1X2MA 3GWZA 4EVIA 2Y30A 3CUQA 2VKDA 3H0GJ 2ZJPF 1HXDA 2VT3A 4A2UA 1ZAOA 1U0JA 5BNGA 3G73A 2CQQA 1TQIA 1HC8A 1MBGA 4PGGA 3WTTC 3JTGA 1FOXA 1FMWA 4Y33A 2FE3A 3K70C 4FETA 1SAUA 4AU7A 4YRVA 2JA8J 5AIQA 5FRNA 4L9JA 1FX7A 2Z99A 2JUCA 1RR7A 1YHQI 1Q1VA 4OU0A 4CZZA 3P9IA 3G1OA 3O8GA 3ASOH 1Z91A 2QVOA 3TBIA 4EJUA 1YJ9I 3MMYB 3A01A 3F8CA 4DBRA 3LSRA 3Q0WA 1WKMA 3ZQLA 2GXGA 1ERDA 3COAC 3DQVC 1HKQA 4ZTFA 2O8XA 1LUJB 1FEXA 1W5SA 3V4GA 2DQLA 2A3SA 4PDKA 2V1UA 1R1UA 2F5FA 2NVYJ 2EFWA 2HI3A 4PSWA 5CYVA 2VOOA 1I6HJ 2ZMEA 1AKHA 1XTAA 1J7KA 3MEXA 4GGGA 2Y75A 3VSLA 4XRSG 3HOXJ 2HOEA 2IP2A 3RKQA 3NARA 1FWZA 2QM3A 4PJJA 1K4TA 1B1BA 2VJ5A 1KQ0A 5EF6A 2FQ3A 1IXCA 4JP0A 4BXUA 3H35A 3K9TA 3I59B 3OOUA 2DI3A 2BV6A 2PX9A 1JUSA 1X3WB 1XMXA 1N77A 3DPLC 2GQQA 4DYQA 3CMAI 2BVLA 1ETKA 1R4NB 1WFXA 4ZC3A 4B4CA 4F52A 4AIHA 5F08A 1KQ8A 2KIUA 5EGOA 2KZGA 1RC9A 3CQZJ 4HF2A 3MN2A 1W0UA 3QQAA 4K2EA 1QGPA 5LGUA 1YO5C 4I0BA 2VKHA 3TKYA 3PUFA 2EBIA 1VNDA 1U2WA 1QO0D 5DUIA 2M9HA 4PJNA 4P55A 3SYTA 2DT5A 3BCAA 4YIRX 4AIJA 5DTDA 1BR2A 5EYRA 4FT8A 2Z3YA 2EZIA 4UUVA 2W1OA 3AKZA 5J8FA 3C18A 2DU9A 3C2HA 1FOKA 4O3MA 1FNNA 4IXAA 3PM1A 4ZH4F 4WXDA 4XMYA 2EV0A 4I76A 5FKOA 4G94A 1JHHA 3A0BC 4KJZA 4HYEA 1U6GA 5E8IA 1PUFB 1MIJA 3PO3J 1WWXA 1GDTA 1VQ9I 2PI0A 3FKIJ 3DWLE 3IC7A 1H9TA 4RGRA 3OYIA 2P5LC 3QOPA 2EQRA 4WCGA 5HNHA 5JLXA 1NHAA 5DYMA 4BY7J 2XRLA 3CC7I 3KYLA 5BPIA 2L2OA 3E6MA 2MYSA 2DA6A 2L7MP 4BJ5C 2LKXA 2YU9J 2FX0A 1TL8A 2DXIA 3BPXA 2OTJI 2CGPA 4OAZA 4R1HA 2EIKH 2XKPA 2NNNA 1QHHD 2CWEA 2EB7A 3K2AA 5DD8A 2RREA 4BNCA 3HRTA 2X85A 5DV5A 4HX4A 1VQ5I 2QQAA 1JKOC 2X48A 4FTHA 4KT5C 3OOPA 2EFQA 1IRXA 3CCLI 3SHFA 3IRRA 2KPMA 3ABUA 1ETYA 3K4KA 1SVLA 1W36D 4CCMA 1BJZA 3FZVA 1EH7A 3A02A 1EH8A 1WJCA 3I0TA 3QYBA 1OYYA 2DT6A 3WHCA 1IN4A 5GPAA 2X6OA 5E3MA 3CCSI 4MEXF 1BN5A 1IRZA 3J7ZI 3OR2C 1IRFA 4E7HA 3PL8A 4CCOA 2EK5A 1HSJA 4FISA 2ECBA 3F3XA 4XQFA 3J7AY 1MMGA 1IZ1A 4XBFA 2EZLA 2V1DA 1BI3A 1P9QC 4IRIA 5KAIC 4W97A 5TJJA 4GXOA 3HOWJ 2OU2A 3JR9A 4CICA 1IDYA 3HG9A 5J4YA 2CS3A 3HEFA 2DOAA 3ZMZA 2X1EA 3RZDJ 1B8IB 4E7ZA 4LG0A 2HNHA 2QKLB 2CW8A 3H92A 4TV7A 1Z9CA 1QBJA 2OBPA 5H20A 4BBRJ 1Z7LA 1BI1A 2P7VB 5EDNA 1YG2A 4UXNA 3BG7A 2NAZA 4IZZA 4KDPA 1GHCA 4IF4A 2F5CA 3HHGA 3BJ6A 1OYWA 3G4SI 2L0KA 2CV1A 4L5JA 4F93B 4BQAA 5CVJA 1TQPA 3SEQA 4R8HA 2XF5A 4BHCA 4B48A 2X9DA 3AAFA 1KU9A 4F7ZA 3BDDA 3BPVA 4D7MA 1I39A 2VC1A 4DZPA 3BZ6A 2ME0A 3ERMA 2KRHA 3JRIA 2HKOA 3I64A 2L3DA 2QQBA 3HKZN 5JFRA 2HYJA 1YW9A 4DIQA 5JHFA 2G7HA 2R5ZB 1JE8A 3OL3A 1SVMA 2DBBA 3ZQGA 2RC4A 1MDMA 2OQGA 1K79A 1ZELA 1MJBA 4RAFA 1DP7P 1BR4A 3CCEI 2CO5A 5F1JA 1SFUA 2CQNA 1IUYA 2COMA 2W84A 4D5FA 1MJAA 3M9AA 3H5AA 2FMYA 4EGZA 3OSFA 4IQJA 1UHSA 1HF0A 2FF4A 4E7KA 3TEDA 4RAZA 1CF7B 1XDUA 3BCBA 4LIUA 5E1XA 2K27A 2V9VA 1HA8A 3M1CA 4RAGA 3EYYA 4V2FA 5M3FJ 2IT0A 1FMVA 2R7QA 2A6EF 4ENJA 3KE2A 3P5JA 3BY6A 3K4MA 1Y8RB 2M87A 5GPCA 2IGMA 3CUOA 4ZYGA 1Z05A 2RNGA 4PCQA 2M5WA 2KKOA 2VKVA 3HRMA 4ZJZA 2KMUA 4CYCB 3HB9A 1DPUA 3I4NJ 1SD6A 5J6XA 2CW7A 1FJLA 3OYKA 2XPVA 2CFOA 2EPFA 3ZN1A 1BC8C 3HOUJ 3H0DA 1P6RA 1Z3YA 2CSOA 2V7FA 1GT0C 3A03A 1D1AA 2N8GA 3LAJA 1G6NA 3CCYA 3WTYC 3K2ZA 2HR3A 1QVTA 5CPRB 5CQGA 2HTSA 4MO7A 4EATA 2EFOA 5K5QA 4M9SA 3RTRA 2P8TA 3CLOA 1UG2A 4PK4A 3IL2A 2DYRH 2FBHA 4JQFA 2DJNA 4CZCA 3FBNB 3H9GA 3IRQA 2DT7B 3HPHA 3K4BA 5D6EA 5JLWA 1POGA 5C4JJ 3WGHA 1G3WA 2L01A 2M1BA 5FO5A 3RPUD 2LR8A 1VQNI 2ZJQF 2LBFB 1X4PA 2RV8A 1E3PA 3CMYA 1TW3A 2KRFA 3RSNA 1YIJI 2E5ZA 2HDWA 2DA5A 2D1HA 2A69F 5HLTA 2JK3A 4UUSA 2KT0A 2JA6J 3ECOA 2Y9YA 3OIPA 3FXLA 2XAQA 5HOOA 5B1AH 2ZXHA 4LMYA 2DA4A 3ZOBA 1OCOH 2CUZA 4HG2A 4MTDA 1LFBA 4G9YA 2TDXA 2IS2A 1AOYA 1ZARA 2LRDA 3OIOA 3UKGA 4HW0A 1I3QJ 3HSEA 5CJ9A 4UY8I 4ENKA 2VODA 4ZYDA 1I6XA 3S17J 4BL0B 3OYGA 1QZYA 2EJRA 4U0VA 1H8AC 1J0RA 3K4NA 3I54A 4DNCA 2ZBKA 1MBJA 5FKMA 3TP3A 2R93J 1GXPA 3OYMA 3VB2A 1BIBA 4BJ6C 1IXRC 2M45A 2Y31A 2F6CA 2ZNZA 4XRSA 5FRMA 1UFMA 3EETA 3S1NJ 2V79A 1VF9A 1PJRA 3ZXSA 3PQKA 1JGSA 1I27A 3PJRA 3EUKL 4Y17A 2BHZA 2FA5A 1C0WA 2W00A 4LOCA 5EG0B 2UZKA 3V8KA 2MSYA 3BQYA 3WE3A 3F8NA 2Z2SB 1GUUA 1W4MA 2JRMA 4ZTJA 4C2TA 1SMTA 5HS8A 5K1YA 1MD0A 2L9SA 4IJAA 1W1WE 2RVCA 4HSRA 4M9XA 4RB0A 2E2HJ 1EKEA 2M34A 4ZYAA 3L1PA 4J19A 3KEQA 3LOCA 2V6CA 4BUPA 2DMUA 2HOTA 3DLAA 3W6KB 3KLOA 1W36C 1LQ1A 4OOIA 3G3ZA 2PMUA 3KETA 4B09A 2FJ1A 5HODA 2L9RA 2JWTA 4GO1A 5E20A 2GIVA 4LITA 2YUSA 5FB2A 3JRCA 1EJ9A 2WB1A 3S14J 4RM2A 2LF8A 4A93J 1IJWC 1S72I 1OYIA 3F9KA 4CSWA 4L0ZB 1IF1A 4QIWN 2ADUA 1TLHB 3K10A 2OUMA 3RKWA 1UAAA 1VQ6I 2L4AA 2MFZA 3DKWA 5ICEA 3BTIA 1ORKA 5D8LB 5DD4A 1OLTA 3I58A 1WQ2A 1P92A 4KMUX 5E1ZB 2X0LA 2ZXWH 1D1BA 4Q48A 5ILVA 3AG2H 2R7ZJ 2IA2A 1SMYF 3MZYA 3PIPF 3FBIB 2HDDA 1E3HA 3W2AA 2PFBA 5A2QK 2CFXA 1T0FC 2RNJA 2OPTA 2H1LA 3B6CA 1MBHA 4F91B 2O61A 1L3LA 3L2WA 2NOJB 1Z77A 2XB0X 3NQOA 5D8KB 4XRMA 4UV9A 3RI4A 2NVUB 1VZ0A 4II3A 4DOZA 1YLFA 2O9LA 2X6XA 2HVRA 2XAGA 4LLGF 5L3DA 1Z3XA 3CF5F 1R23A 4YFXF 5CLSA 1XD7A 2DAOA 4L5EA 5CQEA 1T2KA 1G3TA 2JVHA 1KQ9A 1YRNB 1GV2A 4LD5A 1RUNA 2HZTA 4BDZA 1WCMJ 1B9MA 3CP2A 2JN6A 3JRHA 2P6SA 1IC8A 3BTCA 4NQWB 2C6YA 3VWBA 2X1DA 3S1QJ 5EEGA 4RM3A 1O7FA 3LQQA 4IOAF 1V55H 3CLQA 1D0XA 5DCMB 4B47A 5BS6A 1O57A 1NTCA 2M3AA 1X1PA 2G9WA 1XCVA 3GZ6A 3E1SA 4ZDLA 1R5GA 2P0WA 1TC3C 3F0CA 2ZFUA 1FP1D 2O5RA 1M1EB 4GYGA 2RDPA 5ICFA 5J8CA 3CCUI 1XB4A 2FU4A 3D5RC 4CH7A 5E18F 5LGNA 4IHSA 3QU6A 1YOVB 3TL4X 3LAPA 4G7ZF 1LVKA 2H6CA 2VJJA 3A4CA 3CCQI 2WTEA 2VBYA 3K4CA 2V9PA 5KVRA 1VQ4I 3QP6A 3TMOA 4R79A 3GFLA 5IT3A 3OYNA 3PNYA 1HSTA 1MH3A 2P6TA 2DPUA 2LH9A 2UXNA 1BIAA 4NNJA 1UHMA 1HKTA 5ILSA 3MQ0A 3DBRB 2DPDA 2PJRA 2WAEA 4BBSJ 2DMTA 1LB2A 1USSA 3LMMA 4Q4ZF 1TT0A 1E0EA 3BR3A 1G3YA 4LLLA 3ZRGA 2ECCA 3BJAA 2H1KA 2L9NA 5C44J 3BR6A 3REOA 4F92B 1JGGA 2M4GA 2JMWA 3L7WA 3JSPA 2KLOA 4W1UA 2GZWA 2L7ZA 1G8XA 4RB3C 1AWCA 3HC7A 2UXXA 3IH4A 1I3AA 3CUQB 1Z67A 3U2RA 3R0JA 1R22A 2QZ8A 3M8FA 2XDVA 2Y2ZA 4Q47A 2A61A 3V7SA 2K40A 4EV0A 4QPOA 2VOPA 1OPCA 5BPDA 1BC7C 2M30A 2K9NA 4ZYEA 1ETWA 5DDGA 1LNWA 4LK1F 5JVGF 2ID3A 3V8JA 2CQKA 2KRCA 5F1RA 3CCMI 4NC8A 1Y56A 2KP6A 2CW0F 2E7XA 4X6AJ 2OZUA 4RLFA 2HYFA 3GUDA 2CJJA 2JVGA 5F6FA 2JA7J 1KONA 4Y3OA 5LLQA 4NB5A 1AHDP 4HDUA 4HV5A 2XB5A 1J9IA 1B4AA 1IV6A 1A04A 4L9VA 3C1DA 2GWRA 2FRHA 3IHUA 2O3FA 3KLNA 4IOCF 1YIOA 2EH3A 4CCNA 1MBKA 4QWQA 1JT0A 4RB2C 1EF4A 3OS0A 3ML6A 3MD2A 1SVOA 3ZP5A 3LSPA 3NRVA 2ZMEB 2M0CA 1AKHB 2CYYA 2E1MB 3GZNB 3MZ8A 1ZG5A 1VQ7I 1IRGA 1XS9A 1Z1DA 2L7KA 4JBAA 5J40A 3RKYA 1FLIA 3C2GA 1HDPA 3OY9A 2GBYA 2OCEA 2XRNA 3E6CC 3EUHC 1F1ZA 4RGXA 2FNAA 2MH9A 5ICCA 1W7PD 2IGOA 3JSOA 2L7FP 3S16J 4DJAA 4B8XA 1S7EA 1R36A 3WG9A 2PMHA 3L2QA 2PMZN 4ENMA 2LY9A 2KIQA 5H6QA 2K02A 1OMIA 2A5WA 1I1GA 1B72A 2O7OA 5K7HA 3DU6A 1WI9A 3JTHA 2H09A 3GEZA 5CVUA 1SD7A 3WGGA 5LGTA 4A3DJ 4XN0A 3K7AJ 5D6FA 4A3EJ 1IG7A 4EJVA 3QPHA 4LFUA 3PNVA 2ZSHB 1PP7U 3I56I 3LA2A 1ENHA 5DCFA 2FUG2 3RYRA 1BW5A 4MLOA 5LEKA 4A3IJ 1O3SA 3RDIA 1SD5A 3V7CA 4KIBA 2P81A 4G6QA 5K7ZA 4MHGA 4HF1A 4BE2A 2LG4A 1DUXC 4N9IA 5ED4A 5GP9A 5M5WJ 2Y0SN 3W3CA 4BQOA 2QUFA 1E17A 5FD6A 3I55I 2LREA 3FMQA 1J09A 5F27A 1UHWA 1QZZA 3ZQ7A 2LSOA 1ZGAA 2DMNA 4I7HA 1WJDA 3VODA 3FDYA 4EJOA 1IGNA 1A31A 1VQKI 4M3BA 3ULQB 2NVXJ 4WF2A 2IJLA 4I99C 2XPUA 1XGOA 2CV2A 2HGCA 4KYWA 2HTJA 2DLLA 5GTIC 2ZFWA 1K7AA 3MZHA 2WC2A 1TT5B 5D5XB 2KHMA 2R5YA 2UV1A 2BEOA 2F5EA 1OKRA 3IUOA 1R6RA 5BOXA 3H3UA 3WG7H 3JCUC 3RCOA 1RKTA 3AG3H 1S7OA 5J3LA 3N97A 3DTEA 1PVEA 2BW3A 3BG9A 3HKZA 4KIFA 4UV8A 2CQ7A 2ESNA 2KDZA 2QGUA 4M3GA 1HQCA 1MNMC 1MW7A 2B0LA 4EJWA 3BR0A 1Z7UA 3GO5A 4FASD 4GRIA 3MKZA 2FOWA 3L2CA 3LA7A 1SEUA 2M2EA 3J7YJ 2QA4I 2D2WA 1YITI 4IKFA 5E17F 1JKQC 1FOWA 1NK2P 1T98A 1XC5A 1EH6A 1YX3A 3CDHA 4XN3A 2ICWG 4EQQA 1MMSA 4RDUA 2NOGA 2FSWA 1SD4A 1D1CA 1XSVA 2X4HA 1APLC 1Y8QB 3MAJA 2KJCA 2WAQN 4CUGA 2F5DA 4U7BA 3GTGJ 3CJRB 4S0HB 1CGPA 4RMNA 3EUAA 5E1WA 2IXSA 4G7OF 1X19A 3DCFA 1IAWA 2CUFA 5IT9Z 2VN2A 2XGDA 4E70A 4XLPF 3ZN0A 4G8XA 1LFUP 3HL2A 2W85A 3H9QA 3F8BA 1Z0XA 2HU9A 2VB6A 1KYZA 1ONVA 1T39A 3BOQA 2DFIA 1R7JA 5IPAA 2IEKA 1JUMA 1O3QA 2DOEA 4CDGA 1ACIA 4Y52J 4IRHA 1RPWA 5IY5H 2OD5A 2Z5UA 4BDYA 2QF7A 1OJLA 3E0JB 2K4BA 1IN7A 2E7WA 4LG0B 1DPRA 1OR7A 2PLYA 1D0ZA 4I6ZA 4RGUA 3ISPA 3X2QH 3J81Z 2QQ9A 2E60A 1FC3A 3ASNH 3SFIA 3IP4B 3J81K 2EILH 4A6DA 4CCJA 3JREA 2QQ8A 3CC2I 1STZA 4G6TB 3ZGKA 2K3FA 2Y9ZA 2F48A 2E71A 3KEYA 1IDZA 3GTJJ 1F43A 3NWTA 5BMZA 2I10A 2NVTJ 4U7DA 2TCTA 3QODA 5FKNA 4Y13A 3A0HC 5D4SA 5ICGA 3GMEA 2BVMA 4D9JA 2MG4A 4XONA 3RYPA 2PJPA 4IX7A 1X1CA 1VI0A 1NG6A 4IVNA 3K4JA 3JRGA 1T8IA 1ZR4A 1S3JA 3GBGA 1LE8A 1MDMB 2ZNYA 2EA2A 2UUZA 3WTWC 5M5XJ 4I0AA 5FGMA 3OYHA 2BY0A 2H8WA 2XC7A 2G7UA 3HSRA 2ELKA 3ZQHA 2VUMJ 2NS7A 6PAXA 2AQEA 1P2FA 2RN7A 2QYOA 2VONA 2L54A 3ERED 5CKTA 3CTAA 2W57A 1D8KA 3AG4H 3ZMDA 5J1UA 2WBMA 4G6DA 2ID6A 2IW5A 2V1NA 3Q5FA 3E6BA 4IRGA 4M3FA 4I02A 3H5RA 3L2VA 1TNSA 1REPC 1U5TA 2EZKA 3M1EA 1HW5A 3EDPA 4EMSA 3DEUA 4L9NA 2OTLI 2TRTA 5F0FA 4BXXJ 2FD5A 2VQGA 2ZJ2A 2MABA 3G71I 1DGWY 1LDJA 2DDAA 2B7EA 2MC4A 5DS9A 3S2HJ 2PQ8A 1BA5A 4P9UA 2EFNA 1X3UA 4UHTA 3S2WA 4J00A 1Y1VJ 2BXZA 2F5VA 3BP8A 3FX3A 4UNOA 2FQ4A 3CF2A 3DTIA 3WU0A 3BC8A 2GOXB 1A5JA 1Y6IA 4JX4A 4GYIA 5FLXZ 3DV8A 3HUGA 2QSHX 4P5OA 1UMQA 3LQRA 4B43A 1K6OA 1AA7A 4IEJA 5JI6A 4M3DA 5FLMJ 1TBXA 2LTPA 3OYAA 5FROA 2LYCA 3TGNA 1BM9A 4CXFA 4PZJA 3SXYA 3RKXA 1FIAA 4XLHA 4PFOA 1ZG1A 1ON2A 2KDOA 1DU0A 5E79C 4U0WA 2K5CA 3DTKA 4ESJA 2KIFA 1B6AA 3H36A 4RA2A 3N05A 5DEQA 5LRRA 4UUSB 2W4SA 4LJZF 3HOTA 3IV5A 3F23A 4A3JJ 3ZPLA 4P96A 4HLYA 3CJTB 4E6KG 3WTVC 1OQYA 3KFWX 2JJ7A 2QENA 2WY7Q 1T6SA 2Y0MA 2CH0A 4MFDA 5EZHA 2VE8A 1TZLA 2LY2A 3GFJA 5KHDA 3R61A 2HPMA 1RR8C 2BOLA 3VYRB 2A5YB 2V6EA 2EFPA 4O6JA 2COBA 5HVQC 1S8NA 3F22A 4KNYA 1ETOA 1X58A 3BTLA 5FKKA 2LFBA 2HQAA 3CMEI 1KU2A 2E1OA 3IWZA 2HKXA 2YX7A 3NWSA 2BZTA 1KGSA 1WJEA 2GOMA 4NDLA 1NG7A 4HSTA 4NBQA 4Z6YA 4MFEA 1U3EM 3I71A 2Y48A 1WRJA 5KNLA 1ULYA 3SZGA 4NC6A 4A6EA 4BE1A 2LDUA 3CUQC 3OMYA 3WU1B 2CMPA 2OZ6A 5TRDA 1XSDA 4WX9A 3BR2A 3I4PA 2BY1A 5IYDJ 1V3FA 1OCCH 2LOOA 3T1BA 4WK8F 1E3OC 1DDNA 1IXSB 2HQRA 3OS1A 4EEFG 2FEZA 1OFCX 2E2IJ 2STWA 2O6GE 2CUJA 3J80Z 3SJMA 3K69A 3HTUA 4PFPA 1LPQA 3LSTA 2RGVA 3WTUC 4H4KC 3HDDA 4WXHA 3ABLH 4ASNA 2HOSA 4L0YB 1FIPA 1W0TA 3WU2C 1XGMA 3JW4A 1P4AA 3LNQA 2JPBA 1MMDA 1RI7A 3B6AA 2FMLA 3ELKA 4M73A 1G3SA 3AFHA 2ZCWA 1YE9A 3FXUA 3A1YA 3KP7A 1YYVA 4FHTA 2LBFA 3P9KA 2XAJA 5IOYA 1G2HA 4A3KJ 2PG4A 2H27A 1PDNC 4WWCA 1GVJA 4D1QA 2HPIA 3A2KA 5HS7A 4CA0A 4ZDPA 5GADJ 3GX4X 3KP6A 3HOVJ 2ZMEC 1VQLI 2E1MC 2ZO4A 1ZRDA 1K6YA 2ZSIB 4XKWA 2W48A 1USTA 4M6XA 3CD6I 3ZMSA 4PSXA 2KZVA 2YSRA 3M8JA 3BQZA 1WJFA 4IHWA 1FSHA 3GW2A 1SAXA 3F6OA 1E2XA 3RIRA 4DW6A 1U9NA 2F4OB 4DZJA 4MGRA 3MWMA 1IO2A 2XV4S 1QQIA 1BJAA 4A3FJ 3U9GA 1B59A 1WHUA 4A3MJ 4LIVA 1QZEA 4UUTA 3I4MJ 2L9VA 2O03A 5AONA 2DK5A 3KP4A 1ZG3A 1DGRM 2IA1A 3KYCB 2VIXA 2LLKA 1D3YA 2LD5A 1F9NA 1FBUA 1A6QA 1YS6A 3CP8A 1R71A 4JOMA 3KP2A 1FTZA 3F8MA 1MBEA 3FXQA 2HWVA 5HLGA 3GXOA 1A6IA 2YPRA 3P9CA 4BGDA 3TP0A 2ZB9A 2R7RA 4V19K 3QPTA 1Y0UA 2WWYA 1QU3A 1S9HA 4FQGA 4YG2F 3QRFF 4IHVA 3FXOA 1BR1A 5GTHC 5ILUA 1YS7A 4PJ0C 5CVVA 1XGSA 3ONQA 3BR1A 4M6YA 3B02A 3FXJA 2ETHA 1YX5A 5AIPA 1K4SA 2DCEA 1BBYA 3S15J 4KT6A 4XRFA 2IGNA 2QSFX 3IWFA 3GYHX 2DO7A 3ZMVA 2QBYA 2NVQJ 2LKSA 2DN0A 3FXMA 3L2RA 3R6SA 3S32A 1WH7A 1VTNC 2GA2A 2ISZA 5C3EJ 4BEHA 1J59A 3FXKA 3G1LA 2VQHA 3R60A 5FKLA 1YTYA 1MSEC 1T38A 4BJTA 1X1DA 1TNTA 1HDDC 5EJCA 4IHYA 4KUMA 5F04A 1J2XA 3DKXA 2DA7A 3CC4I 3DPTA 4LB5A 2FNPA 2ZJRF 2BE5F 2D45A 2STTA 4X0GA 3HPGA 2X1CA 3OYEA 3M8EA 5LHHA 1MMNA 5K5RA 3S3MA 2HXIA 4A5NA 2XAUA 2VI6A 4ZZDA 1S7AA 3HGYA 3IAM2 1Z6RA 2Q2EA 3W6JB 2PJRB 2DA3A 4FE7A 3QOEA 2X6WA 4MNUA 1LEBA 2DODA 5CVIA 1WI3A 4PUSA 3GF2A 3Q9SA 3TW7A 2E1CA 1GV5A 1ZHFA 2PMZA 4XK4A 2VT2A 1SFOJ 4ETSA 2XAFA 3CDLA 3T0YA 5KK1A 4XKVA 4XSZF 2DMPA 4A0ZA 2BXYA 1UELB 2IA0A 4C3JJ 2I5UA 3KCCA 1TP4A 2JUGA 2OC6A 4AD9A 3TOBA 1XN7A 3ZMUA 5IYBJ 2BGCA 2NYXA 1R49A 4UVAA 2A07F 2BHYA 1JJ6C 1Q1HA 2F4MB 3L2UA 3DP7A 4E7JA 1W7PA 5B5EC 2AQFA 4HX8A 5EEAA 4L18B 4NHJA 2Y0SA 2O8KA 3WE2A 1K78A 3GVAA 1YFHA 3O6BB 3CCVI 3L09A 2JSCA 2OV7A 4XLCA 1ZRFA 1KA8A 3BG5A 2F4IA 3VYUB 1RIOH 3JRFA 3H5NA 2R7XA 2IPQX 1QVUA 2HQNA 1X2NA 4YELA 5HDNA 3O2PE 4IQ4A 1WJAA 1LJ9A 2Q0OA 2A05A 3IH2A 3H3ZA 3UNGC 2EV5A 2XKOA 2DJIA 2W82A 3JAMZ 2XGXA 3QP5A 2JTVA 2X51A 4HAMA 2D1VA 4RAYA 1IV8A 3A01B 2VJ4A 4U88A 4HBLA 1ZLKA 1XSXA 2JZYA 2NS8A 1FYLA 2WY8Q 1OCTC 2EIMH 4XLFA 3F21A 1V5GA 1WSUA 4XIDA 3E97A 4BU2A 1FBQA 2LC2A 1UG0A 2K3PA 2R7UA 2WV0A 4LG3A 3HBLA 2IVMA 3GZ5A 2KJBA 4U0YA 1HW1A 5HS9A 3VDXA 2VQCA 1TWCJ 4EGYA 4J01A 1B72B 2A68F 3KEOA 1ZGWA 1FTTA 2EA4A 3P7NA 1RESA 4HV6A 1SFXA 3ROUA 4BHPA 2WAQA 4M6VA 2M4KA 3SQNA 1FYMA 2HXOA 3RPQA 4CCLA 3H1CA 2B9SA 1X4OA 1QA6A 2CUEA 1QRYA 5FFZA 2HEOA 3KZYA 1P4XA 4IL6C 5IP6A 4BS9A 3IAS2 1D0YA 1D5VA 1LEAA 1ETXA 3K6GA 3D0SA 1ZYRF 2YS9A 3K0LA 2MD5A 2MBFA 4OAYA 5EGOB 2QCOA 1F4KA 3VEPA 2ZC2A 3BWGA 3S1MJ 1LFPA 4RS8A 2GIZA 1VQMI 4B3AA 3ECHA 3OR1C 4ZZLA 3EYIA 1MMAA 3Q0VA 2K85A 3GCMA 2YU3A 1DU6A 2R3SA 3LSKA 3QWLA 2VBWA 2DMQA 3FMSA 2XPWA 3OYFA 2R5YB 3HGGA 2A6TA 2NXNB 4AWXB 4ESBA 4C3HJ 5D4RA 3ZQCA 2DW4A 3ABMH 4LK0F 2K9LA 3R4KA 2L5QA 4XNFA 4Y7NJ 1I50J 4S05A 2XSDC 5LD2C 4GFBA 3H9JA 2DA2A 2BW3B 3FWEA 2HDCA 2YR2A 2NRAC 3FM3A 1MH4A 3SDGA 5DM6F 2WV1A 2DK8A 4AYBN 3F72A 4N0BA 4AIKA 3HJEA 2YX4A 5IOZA 4XOTA 4FCYA 1V4RA 4HRIA 3FM5A 4A3CJ 2FBIA 1HBXG 4V2GA 4D5CA 2WA0A 4E7SA 2GA1A 4M74A 3PFYA 4ITVA 3FKJA 1U8RA 1VQPI 1O3TA 3BROA 2XIGA 3CCRI 4ZYHA 1JTXA 2KISA 2ZXJA 3BT9A 4CHUA 1FBSA 3WTXC 1YQAA 3RJPA 3OYLA 3HOSA 1FPQA 1OCZH 2BYVE 5HLHA 2VKEA 3FIWA 5E3LA 1XDSA 1BI2A 2JT1A 3I9V2 4G12A 2FBKA 4MQ9F 5FD5A 3CJNA 3DKYA 1LKXA 1JUPA 2IGKA 4FX0A 1GVDA 4XKBA 2G0EA 3E5QA 1SFKA 1T0FA 5J1RA 2XF7A 2DTZA 3I59A 3GTMJ 2LVSA 4BYYA 2MC3A 2KL4A 1FOYA 2DFEA 3I3LA 2O0YA 1O3RA 2MLKA 9ANTA 1YI2I 2R7TA 3U1DA 3SEZA 3HRSA 1VFCA 1SFEA 3LSJA 4M3EA 3TW6A 3W6VA 4A3BJ 1X3ZB 2WAFA 1GXQA 2P5KA 3QPSA 4BAYA 2LMDA 2E2JJ 4KITB 3DEEA 4KICA 3AL0B 3IKTA 3EPZA 5JVTA 3BG3A 4KA4A 5IT9K 2Q1ZB 4I98B 3UR3C 4C9YA 5GAEJ 4RB1A 1D8JA 2BY3A 4N4OB 3TOAA 1B9NA 3KYDB 1H9GA 5J1YA 4Q5SF 1GLNA 2M0MA 4KMFA 4QSHA 1O4XA 2NS0A 2HS5A 5GAHJ 3EQLF 1DQUA 2ISYA 2VLAA 2VBXA 1PUFA 1LE8B 1J5YA 3QYFA 3ZCOA 3CCJI 1ZREA 5HDKA 5F64A 3DF8A 3QYEA 1H88C 4BQQA 2E5NA 1ZGJA 1JI8A 2RKHA 2XGCA 1TW2A 4HEA2 4AC0A 3OYJA 1Z21A 3BTJA 2EIJH 4D0PA 2P5VA 1S29A 1A35A 3VSKA 2GLOA 2DOFA 1S6LA 1IN6A 2R7DA 1ZRCA 2DFFA 2MA3A 2R7OA 3ZQIA 4RLQA 3SZTA 1QHGA 4UB8C 5KCMA 1TWFJ 2VBZA 1ZLJA 3K1PA 1J75A 1R4MB 2DDBA 2IBDA 3FK7A 3M7GA 4YFKF 4EM0B 3RQ4A 1ZN2A 4MIMA 3JRBA 1T56A 3S8PA 1V5FA 3HXLA 1U5TB 1Z6TA 1MKMA 4L9TA 1MSFC 3DPUA 4ANJA 5E3NA 1K83J 4LLNA 2A6HF 4CGZA 2HFHA 1QPMA 3M4OJ 3OS2A 2DYSH 2CQXA 4A5MA 2M8GX 2MGQA 3MKYB 5LBQA 2IS1A 3PNTA 4YIIA 1CQTA 1N78A 3NEUA 4C2UA 1N75A 3IKVA 3VYTB 2OCCH 4UVCA 4D7NA 5F0HA 4A3LJ 4HQEA 4XKCA 2HOAA 5L3BA 4YFNF 1JHFA 2CG4A 2AO9A 1R1TA 3W2VA 3ZQQA 1MZBA 5D5WB 2W24A 2JA2A 3HUGB 3RPUA 5JHUA 2QWWA 3CZ6A 3JRAA 4XICA 4IO9F 1YJWI 3LSGA 1YW7A 2OJED 2Z9OA 1WJ5A 2FOKA 2Y69H 1R9TJ 2L02A 4CO8A 5LEJA 3BJOA 3WODF 3GTOJ 4E4HA 1JTYA 2R7SA 1JT6A 1BI0A 1MNEA 1OCRH 2ESHA 3K4LA 1N25A 5CVRA 2W7NA 4BACA 1B8IA 1TWGJ 4B44A 4QPQA 3FK6A 2IS6A 1HOMA 1BOBA 1MBFA 3E7LA 1KZHA 1IN8A 1BL0A 5K5OA 1SC7A 1UB9A 4M71A 4A0YA 3GTPJ 4KFCA 5FLXK 3E5XA 4M9ZA 2LK2A 2Z16A 4C30A 2EWNA 3JRDA 3U1KA 4BQNA 3SDBA 1A36A 2XASA 1WH5A 4HPQA 5DUKA 3FMRA 3GFIA 1F5TA 2GM4A 3HOYJ 1BOAA 3L00A 1FZPB 2M7BA 3BZKA 1O7LA 4OINF 3LL7A 2KQRA 1P4WA 2E34A 4MQVA 4XSXF 3EUHA 3GLXA 1TTYA 4OMZA 3VPRA 5L3GA 2K9MA 4OIQF 2R5ZA 4S04A 5L3EA 3WTZA 1ZR2A 3LA3A 2ELJA 1BW6A 3O8HA 4HQMA 4KN7X 4I2OA 1RZ4A 2RQPA 3S93A 3TO7A 4AIDA 4FE4A 1MNDA 3E5UA 3G1MA 2Q8KA 2VXDA 2L4MA 1FT9A 3OV8A 4EJTA 3LFUA 4P1WA 2GXBA 5LFAA 2VQLA 2LF7A 1K61A 1UZCA 5IYCJ 2QKMB 2E19A 1CF7A 3CJQB 1G4DA 2ZKZA 4NUBA 4XORA 2H6BA 5HDGA 3KX2A 3GFMA 1S5LC 4BXFA 5M5YJ 2JA5J 4O5VA 2BY2A 4BKXA 3MKLA 3HOZJ 3N4MA 3F8FA 5LRSA 2J5OA 4P9FA 4I01A 4II2A 2XSJC 3OIQA 4YIFA 1RRJA 1RKWA 2MH2A 5D5UB 1ZKGA 1ZH5A 3FXRA 3BG6A 4CYCA 2DFHA 3DBHB 3R0AA 2P4WA 1R58A 2R4GA 4AUXA 2VC0A 1UJ8A 1I1SA 5F0CA 2H8RA 2M7AA 5IP7J 3OYCA 1WGXA 3ABTA 2EZHA 2JSPA 3S3NA 2IRFG 3OYBA 3LSHA 3RQIA 5L3CA 3BZCA 4AVZA 2LKPA 1D5YA 2K86A 2XVCA 3MVPA 3Q0UA 3J80K 4B3XA 3D5LA 3MKWB 2CU7A 3HYIA 1OISA 3G6EI 3Q3SA 4N4NB 1HW2A 3IH3A 3E3VA 3PQJA 3K1NA 1VQOI 1PYVA 4PJLA 3O3KA 3M07A 1LVAA 2K9SA 3BLYA 4B1RA 2CV0A 2GAUA 2LY1A 2PBIA 2K7LA 3MFKA 1IW7F 2HZDA 3KZZA 3OL4A 5KAFC 4DYCA 4E7IA 2RQQA 1XCBA 4E7LA 1T95A 2HQ5A
chains in the Genus database with same CATH topology
2DQRA 1TQMA 3J7AO 2PEXA 2Z33A 5E8GA 3HTSB 4BH9A 2LNBA 5JR3A 2ELHA 2R7FA 4HLXA 3TQNA 4EM1A 5LHGA 3TDZC 1R00A 2JRTA 1IN5A 3TO9A 1KU7A 2E1NA 3SFZA 4OIRF 4ON0A 3WTSC 1JXSA 5L3FA 2V1XA 4G7HF 4GCVA 3C3WA 2QBYB 3L9FA 2VE9A 4LGWA 4RGSA 5HLIA 3V8LA 4I09A 1HKSA 4OMYA 2HYGD 1MJ9A 1KU3A 4ESFA 2VXZA 4WXCA 4OIPF 3I5UA 1EV7A 3DFGA 3FHZA 1R1VA 4DQ2A 3MCZA 3TO6A 3VOEA 1FSEA 1L0OC 3HSFA 3WGIA 1RUOA 1W5TA 4HZFA 1H0MA 5A2QZ 4CYDA 4LB6B 2FXAA 2PN6A 2KIMA 3I53A 3KP5A 4IPAA 2DTRA 3T8TA 2NNYA 4BHBA 3SZPA 1XMAA 3LWFA 3ZMTA 4IHTA 2F2EA 1KYWA 2UWMA 3B73A 3DXJF 3FF5A 1ODDA 2OAZA 3HRUA 4M72A 4A0XA 1LDKB 1W7PB 5ERIA 3Q9VA 1PP8F 1K78B 3F6VA 4OIOF 4PGHA 2AXLA 2MLGA 3T5XA 1FP2A 1U78A 4HA8A 5LHIA 5D5VB 3K1MA 5EEHA 5FFXA 3LFKA 4ENNA 2QLZA 2OQRA 4EM2A 4MEYF 1XMKA 2ACJA 4NQWA 1RNLA 2XHKA 4KN4X 4L5IA 3HIFA 4Z2YA 4QLCU 4HDVA 5H6RA 1XGNA 5DCMA 4FX4A 1PUEE 1QNTA 4A12A 1MGTA 1UCRA 2AS5F 2XUBA 4MTEA 4XLNF 2H94A 1LDDA 1I5ZA 2XAHA 4Y15A 2BBYA 1YW8A 4H0EA 1ON1A 4UVBA 2W25A 2P7CB 3C7JA 3E6DA 1FYKA 3HHHA 3T8RA 4JK1X 2XROA 2J5PA 4KIGA 3JAMK 3QAHA 3TDUC 2K4JA 3PFIA 4HF0A 1FY7A 1U5TC 2OA4A 3CO7C 3KP3A 4N9HA 4AVPA 3VFZA 4HX7A 3QU3A 3V7RA 1R5HA 5BQTA 3CO6C 2EV6A 2JPCA 4HOBA 2M8EA 3GWZA 4EVIA 3CUQA 1HXDA 2VT3A 4A2UA 1ZAOA 3G73A 1TQIA 4PGGA 3WTTC 3JTGA 2FE3A 5AIQA 4L9JA 1FX7A 2Z99A 4OU0A 4CZZA 3P9IA 1Z91A 2QVOA 4EJUA 3F8CA 1WKMA 2GXGA 3COAC 3DQVC 1HKQA 2O8XA 1W5SA 3V4GA 2DQLA 2A3SA 4PDKA 2V1UA 1R1UA 2F5FA 2EFWA 2VOOA 5CYVA 2ZMEA 1J7KA 3MEXA 4GGGA 2Y75A 2HOEA 2IP2A 1FWZA 2QM3A 1B1BA 1KQ0A 2FQ3A 1IXCA 4BXUA 3K9TA 3I59B 2DI3A 2BV6A 3DPLC 2GQQA 4AIHA 1KQ8A 2KIUA 4HF2A 4K2EA 1QGPA 5LGUA 1YO5C 4I0BA 3TKYA 1U2WA 1QO0D 5DUIA 4P55A 2DT5A 4AIJA 4FT8A 2Z3YA 4UUVA 5J8FA 3C18A 2DU9A 1FOKA 4O3MA 1FNNA 4IXAA 4ZH4F 4WXDA 2EV0A 4G94A 1JHHA 4HYEA 1U6GA 5E8IA 1WWXA 3IC7A 1H9TA 4RGRA 2P5LC 3QOPA 4WCGA 1NHAA 5DYMA 5BPIA 3E6MA 3BPXA 2CGPA 4R1HA 2XKPA 2NNNA 5DD8A 2CWEA 2EB7A 4BNCA 3HRTA 5DV5A 4HX4A 2QQAA 4KT5C 3OOPA 2EFQA 3SHFA 3IRRA 3ABUA 3FZVA 1EH7A 1EH8A 3I0TA 1OYYA 1IN4A 4MEXF 1BN5A 1IRFA 2EK5A 1HSJA 3F3XA 1IZ1A 4XBFA 2V1DA 1BI3A 4IRIA 5TJJA 4GXOA 2OU2A 4CICA 3ZMZA 4LG0A 4TV7A 3H92A 1Z9CA 1QBJA 2OBPA 5H20A 1BI1A 2P7VB 1YG2A 4UXNA 2NAZA 4KDPA 1GHCA 4IF4A 2F5CA 3HHGA 3BJ6A 1OYWA 4L5JA 4BQAA 5CVJA 1TQPA 4R8HA 4BHCA 3AAFA 1KU9A 4F7ZA 3BDDA 3BPVA 2VC1A 3BZ6A 2HKOA 3I64A 2L3DA 2QQBA 5JFRA 1YW9A 2G7HA 1JE8A 2DBBA 2RC4A 1MDMA 2OQGA 1K79A 1MJBA 1DP7P 2CO5A 1SFUA 1IUYA 2COMA 2W84A 1MJAA 3M9AA 2FMYA 4EGZA 2FF4A 4RAZA 1CF7B 1XDUA 5E1XA 2K27A 2V9VA 3EYYA 2IT0A 2A6EF 4ENJA 3KE2A 3BY6A 2M87A 3CUOA 4ZYGA 1Z05A 4PCQA 2M5WA 2KKOA 3HRMA 1DPUA 1SD6A 5J6XA 3ZN1A 1BC8C 1P6RA 2CSOA 3LAJA 1G6NA 3WTYC 3K2ZA 2HR3A 2HTSA 2EFOA 5K5QA 4M9SA 3RTRA 2P8TA 3CLOA 3IL2A 2FBHA 4JQFA 3IRQA 5D6EA 3WGHA 1G3WA 2L01A 2M1BA 5FO5A 2RV8A 1TW3A 2KRFA 2D1HA 2A69F 3ECOA 2XAQA 5HOOA 4LMYA 4MTDA 4G9YA 2TDXA 1AOYA 1ZARA 4HW0A 3HSEA 5CJ9A 4ENKA 2VODA 4ZYDA 1I6XA 1QZYA 2EJRA 4U0VA 1J0RA 3I54A 4DNCA 2ZBKA 1GXPA 3VB2A 1BIBA 1IXRC 2M45A 2ZNZA 1UFMA 3EETA 2V79A 3PQKA 1JGSA 1I27A 4Y17A 2FA5A 1C0WA 2UZKA 3V8KA 3WE3A 3F8NA 1W4MA 1SMTA 5HS8A 5K1YA 1MD0A 4IJAA 2RVCA 4M9XA 4RB0A 3KEQA 2V6CA 3W6KB 3KLOA 1LQ1A 4OOIA 3G3ZA 2PMUA 3KETA 4B09A 4GO1A 5E20A 2GIVA 5FB2A 2LF8A 1OYIA 4L0ZB 1IF1A 2ADUA 1TLHB 3RKWA 2L4AA 3DKWA 5ICEA 5D8LB 5DD4A 3I58A 1WQ2A 1P92A 4KMUX 5E1ZB 2X0LA 4Q48A 5ILVA 2IA2A 1SMYF 3MZYA 2PFBA 5A2QK 2CFXA 2RNJA 2O61A 1L3LA 3NQOA 5D8KB 4UV9A 3RI4A 1YLFA 2XAGA 4LLGF 5L3DA 1R23A 4YFXF 5CLSA 1XD7A 2DAOA 1T2KA 1G3TA 1KQ9A 4LD5A 1RUNA 2HZTA 1B9MA 2P6SA 2C6YA 5EEGA 1O7FA 3LQQA 5DCMB 5BS6A 1O57A 2G9WA 1XCVA 3GZ6A 1R5GA 1FP1D 4GYGA 2RDPA 5ICFA 5J8CA 1XB4A 2FU4A 5E18F 5LGNA 4IHSA 3QU6A 3LAPA 4G7ZF 2H6CA 2VBYA 2WTEA 5KVRA 3QP6A 4R79A 3GFLA 5IT3A 1HSTA 2P6TA 2DPUA 2UXNA 1BIAA 1UHMA 1HKTA 5ILSA 3MQ0A 2DPDA 1LB2A 1USSA 4Q4ZF 1G3YA 4LLLA 3BJAA 3REOA 3L7WA 3JSPA 2GZWA 4RB3C 1AWCA 2UXXA 3CUQB 3U2RA 3R0JA 1R22A 2QZ8A 3M8FA 4Q47A 2A61A 3V7SA 4EV0A 2VOPA 1OPCA 5BPDA 1BC7C 2M30A 4ZYEA 5DDGA 1LNWA 4LK1F 3V8JA 2CQKA 5F1RA 2CW0F 2E7XA 2OZUA 2HYFA 3GUDA 5F6FA 5LLQA 4NB5A 4HDUA 4HV5A 1J9IA 1B4AA 1A04A 4L9VA 3C1DA 2GWRA 2FRHA 3IHUA 2O3FA 3KLNA 1YIOA 4QWQA 4RB2C 3ML6A 3ZP5A 3NRVA 2ZMEB 2CYYA 1ZG5A 1IRGA 1Z1DA 4JBAA 3RKYA 1FLIA 2XRNA 3E6CC 1F1ZA 4RGXA 2FNAA 2MH9A 5ICCA 1W7PD 3JSOA 4B8XA 1R36A 3WG9A 2PMHA 4ENMA 5H6QA 2K02A 1OMIA 1I1GA 1WI9A 3JTHA 2H09A 3GEZA 5CVUA 1SD7A 3WGGA 5LGTA 5D6FA 4EJVA 3QPHA 4LFUA 1PP7U 3LA2A 5DCFA 3RYRA 5LEKA 1O3SA 3RDIA 1SD5A 3V7CA 4KIBA 4G6QA 4HF1A 4MHGA 1DUXC 4N9IA 5ED4A 2QUFA 1E17A 5FD6A 3FMQA 1UHWA 1QZZA 3ZQ7A 2LSOA 1ZGAA 4I7HA 3VODA 4EJOA 3ULQB 4WF2A 2IJLA 1XGOA 2HGCA 4KYWA 2HTJA 2DLLA 2ZFWA 1K7AA 3MZHA 2WC2A 5D5XB 2BEOA 2F5EA 1OKRA 5BOXA 3H3UA 1S7OA 3N97A 4KIFA 4UV8A 2ESNA 1HQCA 2B0LA 4EJWA 3GO5A 1Z7UA 3L2CA 3LA7A 2D2WA 5E17F 1T98A 1EH6A 3CDHA 4EQQA 2FSWA 1SD4A 1XSVA 2X4HA 3MAJA 4U7BA 2KJCA 2F5DA 1CGPA 5E1WA 4G7OF 1IAWA 5IT9Z 2VN2A 4E70A 4XLPF 3ZN0A 4G8XA 2W85A 3F8BA 1KYZA 1ONVA 1T39A 3BOQA 2DFIA 1R7JA 1O3QA 4CDGA 4IRHA 2OD5A 2Z5UA 2K4BA 1IN7A 2E7WA 4LG0B 1DPRA 1OR7A 2PLYA 4RGUA 3ISPA 3J81Z 2QQ9A 1FC3A 3J81K 4A6DA 1STZA 5BMZA 4U7DA 4Y13A 5D4SA 5ICGA 3RYPA 2PJPA 4IVNA 1S3JA 1MDMB 2ZNYA 2EA2A 3WTWC 4I0AA 5FGMA 2G7UA 3HSRA 6PAXA 1P2FA 2RN7A 2QYOA 2VONA 2L54A 3ERED 3CTAA 2W57A 1D8KA 3ZMDA 4G6DA 2IW5A 3Q5FA 3E6BA 4IRGA 4I02A 1TNSA 1REPC 1U5TA 3M1EA 1HW5A 3EDPA 4EMSA 3DEUA 4L9NA 2ZJ2A 1LDJA 2PQ8A 4P9UA 2EFNA 1X3UA 4UHTA 3S2WA 3BP8A 3FX3A 4UNOA 3WU0A 5FLXZ 4GYIA 3DV8A 3HUGA 4P5OA 3LQRA 1K6OA 5JI6A 1TBXA 3TGNA 1BM9A 4CXFA 4PZJA 3SXYA 3RKXA 1ZG1A 1ON2A 4U0WA 4ESJA 2KIFA 1B6AA 5DEQA 5LRRA 2PI0A 3F23A 4LJZF 3HOTA 3ZPLA 4P96A 4HLYA 3WTVC 3KFWX 2QENA 1T6SA 2Y0MA 2VE8A 3GFJA 3R61A 2A5YB 2EFPA 4O6JA 5HVQC 3F22A 1S8NA 4KNYA 1KU2A 3IWZA 2HKXA 2YX7A 1KGSA 1U3EM 3I71A 2Y48A 1WRJA 1ULYA 4A6EA 2LDUA 3CUQC 3WU1B 2OZ6A 5TRDA 1XSDA 4WX9A 3I4PA 1V3FA 3T1BA 4WK8F 1DDNA 1IXSB 2HQRA 2FEZA 2STWA 2O6GE 3J80Z 3K69A 3HTUA 3LSTA 2RGVA 3WTUC 4WXHA 4ASNA 4L0YB 1XGMA 3JW4A 1P4AA 2JPBA 1RI7A 2FMLA 3ELKA 4M73A 1G3SA 2ZCWA 3FXUA 3KP7A 1YYVA 4FHTA 3P9KA 2XAJA 2PG4A 2H27A 1PDNC 4WWCA 1GVJA 5HS7A 3GX4X 3KP6A 2ZO4A 1ZRDA 1USTA 4M6XA 3ZMSA 2YSRA 1FSHA 3GW2A 1SAXA 3F6OA 1E2XA 3RIRA 4MGRA 3MWMA 2XV4S 1QQIA 1BJAA 3U9GA 1B59A 2O03A 5AONA 2DK5A 3KP4A 1ZG3A 2IA1A 1D3YA 1F9NA 1FBUA 1YS6A 3KP2A 3F8MA 3FXQA 2HWVA 5HLGA 3GXOA 2YPRA 3P9CA 3QPTA 1Y0UA 2WWYA 4YG2F 3QRFF 5ILUA 1YS7A 5CVVA 1XGSA 4M6YA 3B02A 2ETHA 5AIPA 1BBYA 4XRFA 3IWFA 3GYHX 2DO7A 3ZMVA 2QBYA 3R6SA 1VTNC 2GA2A 2ISZA 1J59A 3R60A 1YTYA 1T38A 1TNTA 4KUMA 1J2XA 3DPTA 4LB5A 2FNPA 2BE5F 2D45A 2STTA 3M8EA 5LHHA 5K5RA 4A5NA 4ZZDA 1S7AA 1Z6RA 2Q2EA 3W6JB 4MNUA 1LEBA 5CVIA 3GF2A 3Q9SA 2E1CA 1ZHFA 2VT2A 4ETSA 2XAFA 3T0YA 5KK1A 4XSZF 4A0ZA 2IA0A 3KCCA 4AD9A 3TOBA 1XN7A 3ZMUA 2BGCA 2NYXA 2A07F 4UVAA 1Q1HA 3DP7A 1W7PA 4HX8A 4L18B 4NHJA 3WE2A 1K78A 3GVAA 1YFHA 3O6BB 3L09A 2JSCA 1ZRFA 1KA8A 1RIOH 2IPQX 2HQNA 5HDNA 3O2PE 1LJ9A 2Q0OA 3H3ZA 2EV5A 2XKOA 3JAMZ 2XGXA 3QP5A 2JTVA 4HAMA 2D1VA 4RAYA 4U88A 1ZLKA 4HBLA 1XSXA 2JZYA 1FYLA 3F21A 1WSUA 3E97A 1FBQA 2WV0A 2IVMA 3GZ5A 2KJBA 4U0YA 1HW1A 5HS9A 4EGYA 2A68F 3KEOA 2EA4A 3P7NA 4HV6A 1SFXA 3ROUA 4BHPA 3SQNA 1FYMA 3RPQA 5FFZA 2HEOA 3KZYA 1P4XA 1D5VA 1LEAA 3D0SA 1ZYRF 3K0LA 2MD5A 2MBFA 1F4KA 3VEPA 3BWGA 4RS8A 4ZZLA 3ECHA 3EYIA 2YU3A 2R3SA 2VBWA 3FMSA 4AWXB 4ESBA 5D4RA 2DW4A 4LK0F 3R4KA 4S05A 3FWEA 2HDCA 2YR2A 2NRAC 3FM3A 2DK8A 3F72A 4N0BA 4AIKA 2YX4A 1V4RA 3FM5A 2FBIA 1HBXG 2GA1A 4M74A 1U8RA 1O3TA 3BROA 2XIGA 4ZYHA 2ZXJA 4CHUA 1FBSA 3WTXC 1YQAA 3RJPA 3HOSA 1FPQA 2BYVE 5HLHA 1XDSA 1BI2A 2JT1A 2FBKA 4MQ9F 5FD5A 3CJNA 4FX0A 3E5QA 1T0FA 3I59A 4BYYA 2MC3A 2O0YA 1O3RA 2MLKA 3U1DA 3HRSA 1SFEA 4BAYA 1GXQA 2P5KA 4KICA 3IKTA 5JVTA 4KA4A 5IT9K 4I98B 4RB1A 1D8JA 3TOAA 1B9NA 1H9GA 4Q5SF 4KMFA 2NS0A 2HS5A 3EQLF 2ISYA 2VBXA 1J5YA 1ZREA 5HDKA 5F64A 3DF8A 1ZGJA 2RKHA 1TW2A 4D0PA 2P5VA 1S29A 1S6LA 1IN6A 2R7DA 1ZRCA 2MA3A 3SZTA 2VBZA 1ZLJA 3K1PA 1J75A 4YFKF 3M7GA 4EM0B 1ZN2A 1U5TB 1Z6TA 1MKMA 4L9TA 4LLNA 2A6HF 4CGZA 2HFHA 1QPMA 4A5MA 5LBQA 4YIIA 3NEUA 3IKVA 4UVCA 4HQEA 5L3BA 4YFNF 1JHFA 2CG4A 1R1TA 1MZBA 5D5WB 2W24A 3RPUA 5JHUA 2QWWA 1YW7A 2Z9OA 2FOKA 2L02A 4CO8A 5LEJA 3BJOA 3WODF 1BI0A 2ESHA 5CVRA 1IN8A 5K5OA 1UB9A 4M71A 4A0YA 4KFCA 5FLXK 3E5XA 4M9ZA 2EWNA 2XASA 5DUKA 3FMRA 3GFIA 1F5TA 1BOAA 3L00A 1FZPB 1O7LA 4OINF 1P4WA 4XSXF 4MQVA 3EUHA 3GLXA 1TTYA 4OMZA 5L3GA 4OIQF 4S04A 5L3EA 3WTZA 3LA3A 4HQMA 4KN7X 4I2OA 1RZ4A 2RQPA 3TO7A 3E5UA 2Q8KA 2L4MA 1FT9A 3OV8A 4EJTA 2GXBA 2LF7A 1CF7A 1G4DA 2ZKZA 2H6BA 5HDGA 3GFMA 4O5VA 3N4MA 3F8FA 5LRSA 2J5OA 4P9FA 4I01A 4YIFA 2MH2A 5D5UB 1ZH5A 3FXRA 3R0AA 2P4WA 1R58A 2VC0A 1I1SA 3ABTA 2IRFG 5L3CA 2LKPA 2K86A 2XVCA 3J80K 3D5LA 3HYIA 1HW2A 3E3VA 3PQJA 3K1NA 3O3KA 1LVAA 2GAUA 2PBIA 3MFKA 2K7LA 1IW7F 3KZZA 1XCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DQR A;  1TQM A;  3J7A O;  2PEX A;  2Z33 A;  5E8G A;  3HTS B;  4BH9 A;  2LNB A;  5JR3 A;  2ELH A;  2R7F A;  4HLX A;  3TQN A;  4EM1 A;  5LHG A;  3TDZ C;  1R00 A;  2JRT A;  1IN5 A;  3TO9 A;  1KU7 A;  2E1N A;  3SFZ A;  4OIR F;  4ON0 A;  3WTS C;  1JXS A;  5L3F A;  2V1X A;  4G7H F;  4GCV A;  3C3W A;  2QBY B;  3L9F A;  2VE9 A;  4LGW A;  4RGS A;  5HLI A;  3V8L A;  4I09 A;  1HKS A;  4OMY A;  2HYG D;  1MJ9 A;  1KU3 A;  4ESF A;  2VXZ A;  4WXC A;  4OIP F;  3I5U A;  1EV7 A;  3DFG A;  3FHZ A;  1R1V A;  4DQ2 A;  3MCZ A;  3TO6 A;  3VOE A;  1FSE A;  1L0O C;  3HSF A;  3WGI A;  1RUO A;  1W5T A;  4HZF A;  1H0M A;  5A2Q Z;  4CYD A;  4LB6 B;  2FXA A;  2PN6 A;  2KIM A;  3I53 A;  3KP5 A;  4IPA A;  2DTR A;  3T8T A;  2NNY A;  4BHB A;  3SZP A;  1XMA A;  3LWF A;  3ZMT A;  4IHT A;  2F2E A;  1KYW A;  2UWM A;  3B73 A;  3DXJ F;  3FF5 A;  1ODD A;  2OAZ A;  3HRU A;  4M72 A;  4A0X A;  1LDK B;  1W7P B;  5ERI A;  3Q9V A;  1PP8 F;  1K78 B;  3F6V A;  4OIO F;  4PGH A;  2AXL A;  2MLG A;  3T5X A;  1FP2 A;  1U78 A;  4HA8 A;  5LHI A;  5D5V B;  3K1M A;  5EEH A;  5FFX A;  3LFK A;  4ENN A;  2QLZ A;  2OQR A;  4EM2 A;  4MEY F;  1XMK A;  2ACJ A;  4NQW A;  1RNL A;  2XHK A;  4KN4 X;  4L5I A;  3HIF A;  4Z2Y A;  4QLC U;  4HDV A;  5H6R A;  1XGN A;  5DCM A;  4FX4 A;  1PUE E;  1QNT A;  4A12 A;  1MGT A;  1UCR A;  2AS5 F;  2XUB A;  4MTE A;  4XLN F;  2H94 A;  1LDD A;  1I5Z A;  2XAH A;  4Y15 A;  2BBY A;  1YW8 A;  4H0E A;  1ON1 A;  4UVB A;  2W25 A;  2P7C B;  3C7J A;  3E6D A;  1FYK A;  3HHH A;  3T8R A;  4JK1 X;  2XRO A;  2J5P A;  4KIG A;  3JAM K;  3QAH A;  3TDU C;  2K4J A;  3PFI A;  4HF0 A;  1FY7 A;  1U5T C;  2OA4 A;  3CO7 C;  3KP3 A;  4N9H A;  4AVP A;  3VFZ A;  4HX7 A;  3QU3 A;  3V7R A;  1R5H A;  5BQT A;  3CO6 C;  2EV6 A;  2JPC A;  4HOB A;  2M8E A;  3GWZ A;  4EVI A;  3CUQ A;  1HXD A;  2VT3 A;  4A2U A;  1ZAO A;  3G73 A;  1TQI A;  4PGG A;  3WTT C;  3JTG A;  2FE3 A;  5AIQ A;  4L9J A;  1FX7 A;  2Z99 A;  4OU0 A;  4CZZ A;  3P9I A;  1Z91 A;  2QVO A;  4EJU A;  3F8C A;  1WKM A;  2GXG A;  3COA C;  3DQV C;  1HKQ A;  2O8X A;  1W5S A;  3V4G A;  2DQL A;  2A3S A;  4PDK A;  2V1U A;  1R1U A;  2F5F A;  2EFW A;  2VOO A;  5CYV A;  2ZME A;  1J7K A;  3MEX A;  4GGG A;  2Y75 A;  2HOE A;  2IP2 A;  1FWZ A;  2QM3 A;  1B1B A;  1KQ0 A;  2FQ3 A;  1IXC A;  4BXU A;  3K9T A;  3I59 B;  2DI3 A;  2BV6 A;  3DPL C;  2GQQ A;  4AIH A;  1KQ8 A;  2KIU A;  4HF2 A;  4K2E A;  1QGP A;  5LGU A;  1YO5 C;  4I0B A;  3TKY A;  1U2W A;  1QO0 D;  5DUI A;  4P55 A;  2DT5 A;  4AIJ A;  4FT8 A;  2Z3Y A;  4UUV A;  5J8F A;  3C18 A;  2DU9 A;  1FOK A;  4O3M A;  1FNN A;  4IXA A;  4ZH4 F;  4WXD A;  2EV0 A;  4G94 A;  1JHH A;  4HYE A;  1U6G A;  5E8I A;  1WWX A;  3IC7 A;  1H9T A;  4RGR A;  2P5L C;  3QOP A;  4WCG A;  1NHA A;  5DYM A;  5BPI A;  3E6M A;  3BPX A;  2CGP A;  4R1H A;  2XKP A;  2NNN A;  5DD8 A;  2CWE A;  2EB7 A;  4BNC A;  3HRT A;  5DV5 A;  4HX4 A;  2QQA A;  4KT5 C;  3OOP A;  2EFQ A;  3SHF A;  3IRR A;  3ABU A;  3FZV A;  1EH7 A;  1EH8 A;  3I0T A;  1OYY A;  1IN4 A;  4MEX F;  1BN5 A;  1IRF A;  2EK5 A;  1HSJ A;  3F3X A;  1IZ1 A;  4XBF A;  2V1D A;  1BI3 A;  4IRI A;  5TJJ A;  4GXO A;  2OU2 A;  4CIC A;  3ZMZ A;  4LG0 A;  4TV7 A;  3H92 A;  1Z9C A;  1QBJ A;  2OBP A;  5H20 A;  1BI1 A;  2P7V B;  1YG2 A;  4UXN A;  2NAZ A;  4KDP A;  1GHC A;  4IF4 A;  2F5C A;  3HHG A;  3BJ6 A;  1OYW A;  4L5J A;  4BQA A;  5CVJ A;  1TQP A;  4R8H A;  4BHC A;  3AAF A;  1KU9 A;  4F7Z A;  3BDD A;  3BPV A;  2VC1 A;  3BZ6 A;  2HKO A;  3I64 A;  2L3D A;  2QQB A;  5JFR A;  1YW9 A;  2G7H A;  1JE8 A;  2DBB A;  2RC4 A;  1MDM A;  2OQG A;  1K79 A;  1MJB A;  1DP7 P;  2CO5 A;  1SFU A;  1IUY A;  2COM A;  2W84 A;  1MJA A;  3M9A A;  2FMY A;  4EGZ A;  2FF4 A;  4RAZ A;  1CF7 B;  1XDU A;  5E1X A;  2K27 A;  2V9V A;  3EYY A;  2IT0 A;  2A6E F;  4ENJ A;  3KE2 A;  3BY6 A;  2M87 A;  3CUO A;  4ZYG A;  1Z05 A;  4PCQ A;  2M5W A;  2KKO A;  3HRM A;  1DPU A;  1SD6 A;  5J6X A;  3ZN1 A;  1BC8 C;  1P6R A;  2CSO A;  3LAJ A;  1G6N A;  3WTY C;  3K2Z A;  2HR3 A;  2HTS A;  2EFO A;  5K5Q A;  4M9S A;  3RTR A;  2P8T A;  3CLO A;  3IL2 A;  2FBH A;  4JQF A;  3IRQ A;  5D6E A;  3WGH A;  1G3W A;  2L01 A;  2M1B A;  5FO5 A;  2RV8 A;  1TW3 A;  2KRF A;  2D1H A;  2A69 F;  3ECO A;  2XAQ A;  5HOO A;  4LMY A;  4MTD A;  4G9Y A;  2TDX A;  1AOY A;  1ZAR A;  4HW0 A;  3HSE A;  5CJ9 A;  4ENK A;  2VOD A;  4ZYD A;  1I6X A;  1QZY A;  2EJR A;  4U0V A;  1J0R A;  3I54 A;  4DNC A;  2ZBK A;  1GXP A;  3VB2 A;  1BIB A;  1IXR C;  2M45 A;  2ZNZ A;  1UFM A;  3EET A;  2V79 A;  3PQK A;  1JGS A;  1I27 A;  4Y17 A;  2FA5 A;  1C0W A;  2UZK A;  3V8K A;  3WE3 A;  3F8N A;  1W4M A;  1SMT A;  5HS8 A;  5K1Y A;  1MD0 A;  4IJA A;  2RVC A;  4M9X A;  4RB0 A;  3KEQ A;  2V6C A;  3W6K B;  3KLO A;  1LQ1 A;  4OOI A;  3G3Z A;  2PMU A;  3KET A;  4B09 A;  4GO1 A;  5E20 A;  2GIV A;  5FB2 A;  2LF8 A;  1OYI A;  4L0Z B;  1IF1 A;  2ADU A;  1TLH B;  3RKW A;  2L4A A;  3DKW A;  5ICE A;  5D8L B;  5DD4 A;  3I58 A;  1WQ2 A;  1P92 A;  4KMU X;  5E1Z B;  2X0L A;  4Q48 A;  5ILV A;  2IA2 A;  1SMY F;  3MZY A;  2PFB A;  5A2Q K;  2CFX A;  2RNJ A;  2O61 A;  1L3L A;  3NQO A;  5D8K B;  4UV9 A;  3RI4 A;  1YLF A;  2XAG A;  4LLG F;  5L3D A;  1R23 A;  4YFX F;  5CLS A;  1XD7 A;  2DAO A;  1T2K A;  1G3T A;  1KQ9 A;  4LD5 A;  1RUN A;  2HZT A;  1B9M A;  2P6S A;  2C6Y A;  5EEG A;  1O7F A;  3LQQ A;  5DCM B;  5BS6 A;  1O57 A;  2G9W A;  1XCV A;  3GZ6 A;  1R5G A;  1FP1 D;  4GYG A;  2RDP A;  5ICF A;  5J8C A;  1XB4 A;  2FU4 A;  5E18 F;  5LGN A;  4IHS A;  3QU6 A;  3LAP A;  4G7Z F;  2H6C A;  2VBY A;  2WTE A;  5KVR A;  3QP6 A;  4R79 A;  3GFL A;  5IT3 A;  1HST A;  2P6T A;  2DPU A;  2UXN A;  1BIA A;  1UHM A;  1HKT A;  5ILS A;  3MQ0 A;  2DPD A;  1LB2 A;  1USS A;  4Q4Z F;  1G3Y A;  4LLL A;  3BJA A;  3REO A;  3L7W A;  3JSP A;  2GZW A;  4RB3 C;  1AWC A;  2UXX A;  3CUQ B;  3U2R A;  3R0J A;  1R22 A;  2QZ8 A;  3M8F A;  4Q47 A;  2A61 A;  3V7S A;  4EV0 A;  2VOP A;  1OPC A;  5BPD A;  1BC7 C;  2M30 A;  4ZYE A;  5DDG A;  1LNW A;  4LK1 F;  3V8J A;  2CQK A;  5F1R A;  2CW0 F;  2E7X A;  2OZU A;  2HYF A;  3GUD A;  5F6F A;  5LLQ A;  4NB5 A;  4HDU A;  4HV5 A;  1J9I A;  1B4A A;  1A04 A;  4L9V A;  3C1D A;  2GWR A;  2FRH A;  3IHU A;  2O3F A;  3KLN A;  1YIO A;  4QWQ A;  4RB2 C;  3ML6 A;  3ZP5 A;  3NRV A;  2ZME B;  2CYY A;  1ZG5 A;  1IRG A;  1Z1D A;  4JBA A;  3RKY A;  1FLI A;  2XRN A;  3E6C C;  1F1Z A;  4RGX A;  2FNA A;  2MH9 A;  5ICC A;  1W7P D;  3JSO A;  4B8X A;  1R36 A;  3WG9 A;  2PMH A;  4ENM A;  5H6Q A;  2K02 A;  1OMI A;  1I1G A;  1WI9 A;  3JTH A;  2H09 A;  3GEZ A;  5CVU A;  1SD7 A;  3WGG A;  5LGT A;  5D6F A;  4EJV A;  3QPH A;  4LFU A;  1PP7 U;  3LA2 A;  5DCF A;  3RYR A;  5LEK A;  1O3S A;  3RDI A;  1SD5 A;  3V7C A;  4KIB A;  4G6Q A;  4HF1 A;  4MHG A;  1DUX C;  4N9I A;  5ED4 A;  2QUF A;  1E17 A;  5FD6 A;  3FMQ A;  1UHW A;  1QZZ A;  3ZQ7 A;  2LSO A;  1ZGA A;  4I7H A;  3VOD A;  4EJO A;  3ULQ B;  4WF2 A;  2IJL A;  1XGO A;  2HGC A;  4KYW A;  2HTJ A;  2DLL A;  2ZFW A;  1K7A A;  3MZH A;  2WC2 A;  5D5X B;  2BEO A;  2F5E A;  1OKR A;  5BOX A;  3H3U A;  1S7O A;  3N97 A;  4KIF A;  4UV8 A;  2ESN A;  1HQC A;  2B0L A;  4EJW A;  3GO5 A;  1Z7U A;  3L2C A;  3LA7 A;  2D2W A;  5E17 F;  1T98 A;  1EH6 A;  3CDH A;  4EQQ A;  2FSW A;  1SD4 A;  1XSV A;  2X4H A;  3MAJ A;  4U7B A;  2KJC A;  2F5D A;  1CGP A;  5E1W A;  4G7O F;  1IAW A;  5IT9 Z;  2VN2 A;  4E70 A;  4XLP F;  3ZN0 A;  4G8X A;  2W85 A;  3F8B A;  1KYZ A;  1ONV A;  1T39 A;  3BOQ A;  2DFI A;  1R7J A;  1O3Q A;  4CDG A;  4IRH A;  2OD5 A;  2Z5U A;  2K4B A;  1IN7 A;  2E7W A;  4LG0 B;  1DPR A;  1OR7 A;  2PLY A;  4RGU A;  3ISP A;  3J81 Z;  2QQ9 A;  1FC3 A;  3J81 K;  4A6D A;  1STZ A;  5BMZ A;  4U7D A;  4Y13 A;  5D4S A;  5ICG A;  3RYP A;  2PJP A;  4IVN A;  1S3J A;  1MDM B;  2ZNY A;  2EA2 A;  3WTW C;  4I0A A;  5FGM A;  2G7U A;  3HSR A;  6PAX A;  1P2F A;  2RN7 A;  2QYO A;  2VON A;  2L54 A;  3ERE D;  3CTA A;  2W57 A;  1D8K A;  3ZMD A;  4G6D A;  2IW5 A;  3Q5F A;  3E6B A;  4IRG A;  4I02 A;  1TNS A;  1REP C;  1U5T A;  3M1E A;  1HW5 A;  3EDP A;  4EMS A;  3DEU A;  4L9N A;  2ZJ2 A;  1LDJ A;  2PQ8 A;  4P9U A;  2EFN A;  1X3U A;  4UHT A;  3S2W A;  3BP8 A;  3FX3 A;  4UNO A;  3WU0 A;  5FLX Z;  4GYI A;  3DV8 A;  3HUG A;  4P5O A;  3LQR A;  1K6O A;  5JI6 A;  1TBX A;  3TGN A;  1BM9 A;  4CXF A;  4PZJ A;  3SXY A;  3RKX A;  1ZG1 A;  1ON2 A;  4U0W A;  4ESJ A;  2KIF A;  1B6A A;  5DEQ A;  5LRR A;  2PI0 A;  3F23 A;  4LJZ F;  3HOT A;  3ZPL A;  4P96 A;  4HLY A;  3WTV C;  3KFW X;  2QEN A;  1T6S A;  2Y0M A;  2VE8 A;  3GFJ A;  3R61 A;  2A5Y B;  2EFP A;  4O6J A;  5HVQ C;  3F22 A;  1S8N A;  4KNY A;  1KU2 A;  3IWZ A;  2HKX A;  2YX7 A;  1KGS A;  1U3E M;  3I71 A;  2Y48 A;  1WRJ A;  1ULY A;  4A6E A;  2LDU A;  3CUQ C;  3WU1 B;  2OZ6 A;  5TRD A;  1XSD A;  4WX9 A;  3I4P A;  1V3F A;  3T1B A;  4WK8 F;  1DDN A;  1IXS B;  2HQR A;  2FEZ A;  2STW A;  2O6G E;  3J80 Z;  3K69 A;  3HTU A;  3LST A;  2RGV A;  3WTU C;  4WXH A;  4ASN A;  4L0Y B;  1XGM A;  3JW4 A;  1P4A A;  2JPB A;  1RI7 A;  2FML A;  3ELK A;  4M73 A;  1G3S A;  2ZCW A;  3FXU A;  3KP7 A;  1YYV A;  4FHT A;  3P9K A;  2XAJ A;  2PG4 A;  2H27 A;  1PDN C;  4WWC A;  1GVJ A;  5HS7 A;  3GX4 X;  3KP6 A;  2ZO4 A;  1ZRD A;  1UST A;  4M6X A;  3ZMS A;  2YSR A;  1FSH A;  3GW2 A;  1SAX A;  3F6O A;  1E2X A;  3RIR A;  4MGR A;  3MWM A;  2XV4 S;  1QQI A;  1BJA A;  3U9G A;  1B59 A;  2O03 A;  5AON A;  2DK5 A;  3KP4 A;  1ZG3 A;  2IA1 A;  1D3Y A;  1F9N A;  1FBU A;  1YS6 A;  3KP2 A;  3F8M A;  3FXQ A;  2HWV A;  5HLG A;  3GXO A;  2YPR A;  3P9C A;  3QPT A;  1Y0U A;  2WWY A;  4YG2 F;  3QRF F;  5ILU A;  1YS7 A;  5CVV A;  1XGS A;  4M6Y A;  3B02 A;  2ETH A;  5AIP A;  1BBY A;  4XRF A;  3IWF A;  3GYH X;  2DO7 A;  3ZMV A;  2QBY A;  3R6S A;  1VTN C;  2GA2 A;  2ISZ A;  1J59 A;  3R60 A;  1YTY A;  1T38 A;  1TNT A;  4KUM A;  1J2X A;  3DPT A;  4LB5 A;  2FNP A;  2BE5 F;  2D45 A;  2STT A;  3M8E A;  5LHH A;  5K5R A;  4A5N A;  4ZZD A;  1S7A A;  1Z6R A;  2Q2E A;  3W6J B;  4MNU A;  1LEB A;  5CVI A;  3GF2 A;  3Q9S A;  2E1C A;  1ZHF A;  2VT2 A;  4ETS A;  2XAF A;  3T0Y A;  5KK1 A;  4XSZ F;  4A0Z A;  2IA0 A;  3KCC A;  4AD9 A;  3TOB A;  1XN7 A;  3ZMU A;  2BGC A;  2NYX A;  2A07 F;  4UVA A;  1Q1H A;  3DP7 A;  1W7P A;  4HX8 A;  4L18 B;  4NHJ A;  3WE2 A;  1K78 A;  3GVA A;  1YFH A;  3O6B B;  3L09 A;  2JSC A;  1ZRF A;  1KA8 A;  1RIO H;  2IPQ X;  2HQN A;  5HDN A;  3O2P E;  1LJ9 A;  2Q0O A;  3H3Z A;  2EV5 A;  2XKO A;  3JAM Z;  2XGX A;  3QP5 A;  2JTV A;  4HAM A;  2D1V A;  4RAY A;  4U88 A;  1ZLK A;  4HBL A;  1XSX A;  2JZY A;  1FYL A;  3F21 A;  1WSU A;  3E97 A;  1FBQ A;  2WV0 A;  2IVM A;  3GZ5 A;  2KJB A;  4U0Y A;  1HW1 A;  5HS9 A;  4EGY A;  2A68 F;  3KEO A;  2EA4 A;  3P7N A;  4HV6 A;  1SFX A;  3ROU A;  4BHP A;  3SQN A;  1FYM A;  3RPQ A;  5FFZ A;  2HEO A;  3KZY A;  1P4X A;  1D5V A;  1LEA A;  3D0S A;  1ZYR F;  3K0L A;  2MD5 A;  2MBF A;  1F4K A;  3VEP A;  3BWG A;  4RS8 A;  4ZZL A;  3ECH A;  3EYI A;  2YU3 A;  2R3S A;  2VBW A;  3FMS A;  4AWX B;  4ESB A;  5D4R A;  2DW4 A;  4LK0 F;  3R4K A;  4S05 A;  3FWE A;  2HDC A;  2YR2 A;  2NRA C;  3FM3 A;  2DK8 A;  3F72 A;  4N0B A;  4AIK A;  2YX4 A;  1V4R A;  3FM5 A;  2FBI A;  1HBX G;  2GA1 A;  4M74 A;  1U8R A;  1O3T A;  3BRO A;  2XIG A;  4ZYH A;  2ZXJ A;  4CHU A;  1FBS A;  3WTX C;  1YQA A;  3RJP A;  3HOS A;  1FPQ A;  2BYV E;  5HLH A;  1XDS A;  1BI2 A;  2JT1 A;  2FBK A;  4MQ9 F;  5FD5 A;  3CJN A;  4FX0 A;  3E5Q A;  1T0F A;  3I59 A;  4BYY A;  2MC3 A;  2O0Y A;  1O3R A;  2MLK A;  3U1D A;  3HRS A;  1SFE A;  4BAY A;  1GXQ A;  2P5K A;  4KIC A;  3IKT A;  5JVT A;  4KA4 A;  5IT9 K;  4I98 B;  4RB1 A;  1D8J A;  3TOA A;  1B9N A;  1H9G A;  4Q5S F;  4KMF A;  2NS0 A;  2HS5 A;  3EQL F;  2ISY A;  2VBX A;  1J5Y A;  1ZRE A;  5HDK A;  5F64 A;  3DF8 A;  1ZGJ A;  2RKH A;  1TW2 A;  4D0P A;  2P5V A;  1S29 A;  1S6L A;  1IN6 A;  2R7D A;  1ZRC A;  2MA3 A;  3SZT A;  2VBZ A;  1ZLJ A;  3K1P A;  1J75 A;  4YFK F;  3M7G A;  4EM0 B;  1ZN2 A;  1U5T B;  1Z6T A;  1MKM A;  4L9T A;  4LLN A;  2A6H F;  4CGZ A;  2HFH A;  1QPM A;  4A5M A;  5LBQ A;  4YII A;  3NEU A;  3IKV A;  4UVC A;  4HQE A;  5L3B A;  4YFN F;  1JHF A;  2CG4 A;  1R1T A;  1MZB A;  5D5W B;  2W24 A;  3RPU A;  5JHU A;  2QWW A;  1YW7 A;  2Z9O A;  2FOK A;  2L02 A;  4CO8 A;  5LEJ A;  3BJO A;  3WOD F;  1BI0 A;  2ESH A;  5CVR A;  1IN8 A;  5K5O A;  1UB9 A;  4M71 A;  4A0Y A;  4KFC A;  5FLX K;  3E5X A;  4M9Z A;  2EWN A;  2XAS A;  5DUK A;  3FMR A;  3GFI A;  1F5T A;  1BOA A;  3L00 A;  1FZP B;  1O7L A;  4OIN F;  1P4W A;  4XSX F;  4MQV A;  3EUH A;  3GLX A;  1TTY A;  4OMZ A;  5L3G A;  4OIQ F;  4S04 A;  5L3E A;  3WTZ A;  3LA3 A;  4HQM A;  4KN7 X;  4I2O A;  1RZ4 A;  2RQP A;  3TO7 A;  3E5U A;  2Q8K A;  2L4M A;  1FT9 A;  3OV8 A;  4EJT A;  2GXB A;  2LF7 A;  1CF7 A;  1G4D A;  2ZKZ A;  2H6B A;  5HDG A;  3GFM A;  4O5V A;  3N4M A;  3F8F A;  5LRS A;  2J5O A;  4P9F A;  4I01 A;  4YIF A;  2MH2 A;  5D5U B;  1ZH5 A;  3FXR A;  3R0A A;  2P4W A;  1R58 A;  2VC0 A;  1I1S A;  3ABT A;  2IRF G;  5L3C A;  2LKP A;  2K86 A;  2XVC A;  3J80 K;  3D5L A;  3HYI A;  1HW2 A;  3E3V A;  3PQJ A;  3K1N A;  3O3K A;  1LVA A;  2GAU A;  2PBI A;  3MFK A;  2K7L A;  1IW7 F;  3KZZ A;  1XCB A; 
#chains in the Genus database with same CATH topology
 2DQR A;  3K70 D;  1TQM A;  3J7A O;  2PEX A;  1HLV A;  2R92 J;  2VL8 A;  2Z33 A;  3BR5 A;  5E8G A;  4HNU A;  3HTS B;  2EIN H;  4BH9 A;  2R7W A;  2LNB A;  5JR3 A;  5J4V A;  2ELH A;  2R7F A;  2WAD A;  4HLX A;  4RBO A;  3TQN A;  4EM1 A;  5LHG A;  2D5V A;  1W5C C;  2X6Y A;  3TDZ C;  3U21 A;  4F3Q A;  5B3S H;  1R00 A;  3C2B A;  5FLV A;  2JRT A;  1IN5 A;  3CDI A;  3RZO J;  4F55 A;  3OSG A;  3TO9 A;  1EA3 A;  4DYR A;  3D5S C;  3M3Y J;  2B63 J;  1KU7 A;  5H2F C;  1DP3 A;  2E1N A;  3SFZ A;  4OIR F;  1F36 A;  4UB6 C;  2VPR A;  4KIS A;  1ITY A;  2AHQ A;  1U9O A;  4ON0 A;  3WTS C;  1JXS A;  5J47 A;  5B1B H;  5L3F A;  2V1X A;  5GAG J;  4G7H F;  4GCV A;  3C3W A;  3NAU A;  2QBY B;  3L9F A;  1WJB A;  2HVQ A;  2KFD A;  2VE9 A;  3G2B A;  1R5I D;  1WVR A;  4LGW A;  4RGS A;  5HLI A;  1JKP C;  3V8L A;  4A3G J;  4I09 A;  1HKS A;  4OMY A;  1Y1W J;  2Z1D A;  2AXT C;  2HYG D;  4BEH B;  4GDF A;  5EG0 A;  3DBL B;  1MJ9 A;  3DLL F;  3PSF A;  3W2W A;  2JQ7 A;  1Y0N A;  2V4J C;  4XLE A;  2VJI A;  1KU3 A;  4ESF A;  4QTR A;  2VXZ A;  4WXC A;  4HNT A;  2LP0 A;  1P7I A;  2RAE A;  1G59 A;  4OIP F;  1AU7 A;  3I5U A;  2VAS A;  4XR6 A;  2XF6 A;  5DM7 F;  1NK3 P;  1EV7 A;  4CCK A;  5TIS C;  3DFG A;  1TWH J;  2HVS A;  3PUB A;  3FHZ A;  1R1V A;  2ME6 A;  5E3O A;  4DQ2 A;  3MCZ A;  3TO6 A;  2DA1 A;  1ZK8 A;  3CES A;  3VOE A;  4AM3 A;  1FSE A;  1L0O C;  3HSF A;  3WGI A;  3S1R J;  2Q2E B;  1RUO A;  1W5T A;  4HZF A;  4JX5 A;  1P7J A;  3OWT A;  1H0M A;  3QPL A;  5A2Q Z;  3KIO A;  4CYD A;  4LB6 B;  2FXA A;  3GTK J;  2PN6 A;  4U87 A;  1X1B A;  3GTL J;  5IP9 J;  1ZTR A;  2KIM A;  3I53 A;  3KP5 A;  4IPA A;  4ABZ A;  3AG1 H;  2DTR A;  3T8T A;  2NNY A;  4BHB A;  3SZP A;  1XMA A;  3LWF A;  3ZMT A;  4IHT A;  3FHN A;  1JJ8 C;  2R0Q C;  1IUF A;  2F2E A;  3HZJ A;  1KYW A;  4NC7 A;  2R7V A;  2UWM A;  3B73 A;  3DXJ F;  1WZ2 A;  1ZQ3 P;  1V54 H;  2V26 A;  3FF5 A;  1ODD A;  4C3I J;  1Y39 A;  2OAZ A;  2ZXI A;  3HRU A;  4M72 A;  4A0X A;  1LDK B;  1W7P B;  2IS4 A;  4BY1 J;  1JKR C;  5ERI A;  1U8B A;  3Q9V A;  3ESW B;  1PP8 F;  1ETV A;  1OR7 C;  5EZG A;  1K78 B;  3F6V A;  4OIO F;  3ZQF A;  4PGH A;  2AXL A;  3VYS B;  2MLG A;  3T5X A;  1FP2 A;  4DGW B;  3S3O A;  1XG1 A;  1U78 A;  4HA8 A;  5LHI A;  1QPI A;  5D5V B;  2QSG X;  3ABK H;  2K9Q A;  3AL0 C;  3S2D J;  2I8D A;  3K1M A;  5EEH A;  5FFX A;  1XPX A;  1NH3 A;  3LFK A;  5FJ8 J;  3GLL A;  3OYD A;  1YRN A;  4ENN A;  2QLZ A;  2OQR A;  4EM2 A;  4MEY F;  2IAI A;  1X1A A;  1XMK A;  3LSI A;  2QEX I;  4IHX A;  1T33 A;  2ACJ A;  3H3V K;  4JX6 A;  3FIS A;  4NQW A;  1RNL A;  2XHK A;  4KN4 X;  4L5I A;  2MW8 A;  3HIF A;  4Z2Y A;  4QLC U;  4HDV A;  4XOP A;  5H6R A;  4C2M J;  1RET A;  1XGN A;  2MD0 A;  5DCM A;  1XX5 A;  4FX4 A;  1PUE E;  1V5E A;  1QNT A;  4A12 A;  4DBQ A;  4XL9 A;  1MGT A;  5C4X J;  2WB1 N;  3HM5 A;  3PO2 J;  1UCR A;  2AS5 F;  2XUB A;  1WPK A;  4XLA A;  4MTE A;  2H94 A;  1LDD A;  1I5Z A;  4XLN F;  4AYB A;  4HNV A;  3PIO F;  4ZDO A;  1YJN I;  1VQ8 I;  2XAH A;  3DU5 A;  3LSM A;  2BBY A;  4XM3 A;  4Y15 A;  1YW8 A;  2E35 A;  4H0E A;  3GTQ J;  1ON1 A;  3V42 A;  4UVB A;  2W25 A;  2P7C B;  1OCP A;  1T08 B;  3C7J A;  3E6D A;  1FYK A;  4Y4R A;  3KZI C;  3HHH A;  3T8R A;  5HNF A;  3ZR8 X;  4A69 C;  3DEW A;  3PSI A;  4JK1 X;  2XRO A;  4BE0 A;  2VPL A;  2J5P A;  4PJM A;  4KIG A;  3JAM K;  1HCR A;  3QAH A;  3KPH A;  4X1E A;  3TDU C;  2K4J A;  4OWR B;  1SAN A;  3PFI A;  2OF7 A;  4HF0 A;  5K7F A;  1TWA J;  5M3M J;  1FY7 A;  1U5T C;  2E36 A;  2OA4 A;  3D1N I;  3CO7 C;  3WHB A;  1H89 C;  3KP3 A;  4N9H A;  4AVP A;  3CMM A;  3VFZ A;  2V9K A;  5B66 C;  5TGT A;  2CRG A;  3QU3 A;  4HX7 A;  2GXA A;  3V7R A;  1R5H A;  5BQT A;  3CO6 C;  2EV6 A;  2JPC A;  4HOB A;  2M8E A;  2XGE A;  4JYK A;  1ETQ A;  4YEJ A;  1X2M A;  3GWZ A;  4EVI A;  2Y30 A;  3CUQ A;  2VKD A;  3H0G J;  2ZJP F;  1HXD A;  2VT3 A;  4A2U A;  1ZAO A;  1U0J A;  5BNG A;  3G73 A;  2CQQ A;  1TQI A;  1HC8 A;  1MBG A;  4PGG A;  3WTT C;  3JTG A;  1FOX A;  1FMW A;  4Y33 A;  2FE3 A;  3K70 C;  4FET A;  1SAU A;  4AU7 A;  4YRV A;  2JA8 J;  5AIQ A;  5FRN A;  4L9J A;  1FX7 A;  2Z99 A;  2JUC A;  1RR7 A;  1YHQ I;  1Q1V A;  4OU0 A;  4CZZ A;  3P9I A;  3G1O A;  3O8G A;  3ASO H;  1Z91 A;  2QVO A;  3TBI A;  4EJU A;  1YJ9 I;  3MMY B;  3A01 A;  3F8C A;  4DBR A;  3LSR A;  3Q0W A;  1WKM A;  3ZQL A;  2GXG A;  1ERD A;  3COA C;  3DQV C;  1HKQ A;  4ZTF A;  2O8X A;  1LUJ B;  1FEX A;  1W5S A;  3V4G A;  2DQL A;  2A3S A;  4PDK A;  2V1U A;  1R1U A;  2F5F A;  2NVY J;  2EFW A;  2HI3 A;  4PSW A;  5CYV A;  2VOO A;  1I6H J;  2ZME A;  1AKH A;  1XTA A;  1J7K A;  3MEX A;  4GGG A;  2Y75 A;  3VSL A;  4XRS G;  3HOX J;  2HOE A;  2IP2 A;  3RKQ A;  3NAR A;  1FWZ A;  2QM3 A;  4PJJ A;  1K4T A;  1B1B A;  2VJ5 A;  1KQ0 A;  5EF6 A;  2FQ3 A;  1IXC A;  4JP0 A;  4BXU A;  3H35 A;  3K9T A;  3I59 B;  3OOU A;  2DI3 A;  2BV6 A;  2PX9 A;  1JUS A;  1X3W B;  1XMX A;  1N77 A;  3DPL C;  2GQQ A;  4DYQ A;  3CMA I;  2BVL A;  1ETK A;  1R4N B;  1WFX A;  4ZC3 A;  4B4C A;  4F52 A;  4AIH A;  5F08 A;  1KQ8 A;  2KIU A;  5EGO A;  2KZG A;  1RC9 A;  3CQZ J;  4HF2 A;  3MN2 A;  1W0U A;  3QQA A;  4K2E A;  1QGP A;  5LGU A;  1YO5 C;  4I0B A;  2VKH A;  3TKY A;  3PUF A;  2EBI A;  1VND A;  1U2W A;  1QO0 D;  5DUI A;  2M9H A;  4PJN A;  4P55 A;  3SYT A;  2DT5 A;  3BCA A;  4YIR X;  4AIJ A;  5DTD A;  1BR2 A;  5EYR A;  4FT8 A;  2Z3Y A;  2EZI A;  4UUV A;  2W1O A;  3AKZ A;  5J8F A;  3C18 A;  2DU9 A;  3C2H A;  1FOK A;  4O3M A;  1FNN A;  4IXA A;  3PM1 A;  4ZH4 F;  4WXD A;  4XMY A;  2EV0 A;  4I76 A;  5FKO A;  4G94 A;  1JHH A;  3A0B C;  4KJZ A;  4HYE A;  1U6G A;  5E8I A;  1PUF B;  1MIJ A;  3PO3 J;  1WWX A;  1GDT A;  1VQ9 I;  2PI0 A;  3FKI J;  3DWL E;  3IC7 A;  1H9T A;  4RGR A;  3OYI A;  2P5L C;  3QOP A;  2EQR A;  4WCG A;  5HNH A;  5JLX A;  1NHA A;  5DYM A;  4BY7 J;  2XRL A;  3CC7 I;  3KYL A;  5BPI A;  2L2O A;  3E6M A;  2MYS A;  2DA6 A;  2L7M P;  4BJ5 C;  2LKX A;  2YU9 J;  2FX0 A;  1TL8 A;  2DXI A;  3BPX A;  2OTJ I;  2CGP A;  4OAZ A;  4R1H A;  2EIK H;  2XKP A;  2NNN A;  1QHH D;  2CWE A;  2EB7 A;  3K2A A;  5DD8 A;  2RRE A;  4BNC A;  3HRT A;  2X85 A;  5DV5 A;  4HX4 A;  1VQ5 I;  2QQA A;  1JKO C;  2X48 A;  4FTH A;  4KT5 C;  3OOP A;  2EFQ A;  1IRX A;  3CCL I;  3SHF A;  3IRR A;  2KPM A;  3ABU A;  1ETY A;  3K4K A;  1SVL A;  1W36 D;  4CCM A;  1BJZ A;  3FZV A;  1EH7 A;  3A02 A;  1EH8 A;  1WJC A;  3I0T A;  3QYB A;  1OYY A;  2DT6 A;  3WHC A;  1IN4 A;  5GPA A;  2X6O A;  5E3M A;  3CCS I;  4MEX F;  1BN5 A;  1IRZ A;  3J7Z I;  3OR2 C;  1IRF A;  4E7H A;  3PL8 A;  4CCO A;  2EK5 A;  1HSJ A;  4FIS A;  2ECB A;  3F3X A;  4XQF A;  3J7A Y;  1MMG A;  1IZ1 A;  4XBF A;  2EZL A;  2V1D A;  1BI3 A;  1P9Q C;  4IRI A;  5KAI C;  4W97 A;  5TJJ A;  4GXO A;  3HOW J;  2OU2 A;  3JR9 A;  4CIC A;  1IDY A;  3HG9 A;  5J4Y A;  2CS3 A;  3HEF A;  2DOA A;  3ZMZ A;  2X1E A;  3RZD J;  1B8I B;  4E7Z A;  4LG0 A;  2HNH A;  2QKL B;  2CW8 A;  3H92 A;  4TV7 A;  1Z9C A;  1QBJ A;  2OBP A;  5H20 A;  4BBR J;  1Z7L A;  1BI1 A;  2P7V B;  5EDN A;  1YG2 A;  4UXN A;  3BG7 A;  2NAZ A;  4IZZ A;  4KDP A;  1GHC A;  4IF4 A;  2F5C A;  3HHG A;  3BJ6 A;  1OYW A;  3G4S I;  2L0K A;  2CV1 A;  4L5J A;  4F93 B;  4BQA A;  5CVJ A;  1TQP A;  3SEQ A;  4R8H A;  2XF5 A;  4BHC A;  4B48 A;  2X9D A;  3AAF A;  1KU9 A;  4F7Z A;  3BDD A;  3BPV A;  4D7M A;  1I39 A;  2VC1 A;  4DZP A;  3BZ6 A;  2ME0 A;  3ERM A;  2KRH A;  3JRI A;  2HKO A;  3I64 A;  2L3D A;  2QQB A;  3HKZ N;  5JFR A;  2HYJ A;  1YW9 A;  4DIQ A;  5JHF A;  2G7H A;  2R5Z B;  1JE8 A;  3OL3 A;  1SVM A;  2DBB A;  3ZQG A;  2RC4 A;  1MDM A;  2OQG A;  1K79 A;  1ZEL A;  1MJB A;  4RAF A;  1DP7 P;  1BR4 A;  3CCE I;  2CO5 A;  5F1J A;  1SFU A;  2CQN A;  1IUY A;  2COM A;  2W84 A;  4D5F A;  1MJA A;  3M9A A;  3H5A A;  2FMY A;  4EGZ A;  3OSF A;  4IQJ A;  1UHS A;  1HF0 A;  2FF4 A;  4E7K A;  3TED A;  4RAZ A;  1CF7 B;  1XDU A;  3BCB A;  4LIU A;  5E1X A;  2K27 A;  2V9V A;  1HA8 A;  3M1C A;  4RAG A;  3EYY A;  4V2F A;  5M3F J;  2IT0 A;  1FMV A;  2R7Q A;  2A6E F;  4ENJ A;  3KE2 A;  3P5J A;  3BY6 A;  3K4M A;  1Y8R B;  2M87 A;  5GPC A;  2IGM A;  3CUO A;  4ZYG A;  1Z05 A;  2RNG A;  4PCQ A;  2M5W A;  2KKO A;  2VKV A;  3HRM A;  4ZJZ A;  2KMU A;  4CYC B;  3HB9 A;  1DPU A;  3I4N J;  1SD6 A;  5J6X A;  2CW7 A;  1FJL A;  3OYK A;  2XPV A;  2CFO A;  2EPF A;  3ZN1 A;  1BC8 C;  3HOU J;  3H0D A;  1P6R A;  1Z3Y A;  2CSO A;  2V7F A;  1GT0 C;  3A03 A;  1D1A A;  2N8G A;  3LAJ A;  1G6N A;  3CCY A;  3WTY C;  3K2Z A;  2HR3 A;  1QVT A;  5CPR B;  5CQG A;  2HTS A;  4MO7 A;  4EAT A;  2EFO A;  5K5Q A;  4M9S A;  3RTR A;  2P8T A;  3CLO A;  1UG2 A;  4PK4 A;  3IL2 A;  2DYR H;  2FBH A;  4JQF A;  2DJN A;  4CZC A;  3FBN B;  3H9G A;  3IRQ A;  2DT7 B;  3HPH A;  3K4B A;  5D6E A;  5JLW A;  1POG A;  5C4J J;  3WGH A;  1G3W A;  2L01 A;  2M1B A;  5FO5 A;  3RPU D;  2LR8 A;  1VQN I;  2ZJQ F;  2LBF B;  1X4P A;  2RV8 A;  1E3P A;  3CMY A;  1TW3 A;  2KRF A;  3RSN A;  1YIJ I;  2E5Z A;  2HDW A;  2DA5 A;  2D1H A;  2A69 F;  5HLT A;  2JK3 A;  4UUS A;  2KT0 A;  2JA6 J;  3ECO A;  2Y9Y A;  3OIP A;  3FXL A;  2XAQ A;  5HOO A;  5B1A H;  2ZXH A;  4LMY A;  2DA4 A;  3ZOB A;  1OCO H;  2CUZ A;  4HG2 A;  4MTD A;  1LFB A;  4G9Y A;  2TDX A;  2IS2 A;  1AOY A;  1ZAR A;  2LRD A;  3OIO A;  3UKG A;  4HW0 A;  1I3Q J;  3HSE A;  5CJ9 A;  4UY8 I;  4ENK A;  2VOD A;  4ZYD A;  1I6X A;  3S17 J;  4BL0 B;  3OYG A;  1QZY A;  2EJR A;  4U0V A;  1H8A C;  1J0R A;  3K4N A;  3I54 A;  4DNC A;  2ZBK A;  1MBJ A;  5FKM A;  3TP3 A;  2R93 J;  1GXP A;  3OYM A;  3VB2 A;  1BIB A;  4BJ6 C;  1IXR C;  2M45 A;  2Y31 A;  2F6C A;  2ZNZ A;  4XRS A;  5FRM A;  1UFM A;  3EET A;  3S1N J;  2V79 A;  1VF9 A;  1PJR A;  3ZXS A;  3PQK A;  1JGS A;  1I27 A;  3PJR A;  3EUK L;  4Y17 A;  2BHZ A;  2FA5 A;  1C0W A;  2W00 A;  4LOC A;  5EG0 B;  2UZK A;  3V8K A;  2MSY A;  3BQY A;  3WE3 A;  3F8N A;  2Z2S B;  1GUU A;  1W4M A;  2JRM A;  4ZTJ A;  4C2T A;  1SMT A;  5HS8 A;  5K1Y A;  1MD0 A;  2L9S A;  4IJA A;  1W1W E;  2RVC A;  4HSR A;  4M9X A;  4RB0 A;  2E2H J;  1EKE A;  2M34 A;  4ZYA A;  3L1P A;  4J19 A;  3KEQ A;  3LOC A;  2V6C A;  4BUP A;  2DMU A;  2HOT A;  3DLA A;  3W6K B;  3KLO A;  1W36 C;  1LQ1 A;  4OOI A;  3G3Z A;  2PMU A;  3KET A;  4B09 A;  2FJ1 A;  5HOD A;  2L9R A;  2JWT A;  4GO1 A;  5E20 A;  2GIV A;  4LIT A;  2YUS A;  5FB2 A;  3JRC A;  1EJ9 A;  2WB1 A;  3S14 J;  4RM2 A;  2LF8 A;  4A93 J;  1IJW C;  1S72 I;  1OYI A;  3F9K A;  4CSW A;  4L0Z B;  1IF1 A;  4QIW N;  2ADU A;  1TLH B;  3K10 A;  2OUM A;  3RKW A;  1UAA A;  1VQ6 I;  2L4A A;  2MFZ A;  3DKW A;  5ICE A;  3BTI A;  1ORK A;  5D8L B;  5DD4 A;  1OLT A;  3I58 A;  1WQ2 A;  1P92 A;  4KMU X;  5E1Z B;  2X0L A;  2ZXW H;  1D1B A;  4Q48 A;  5ILV A;  3AG2 H;  2R7Z J;  2IA2 A;  1SMY F;  3MZY A;  3PIP F;  3FBI B;  2HDD A;  1E3H A;  3W2A A;  2PFB A;  5A2Q K;  2CFX A;  1T0F C;  2RNJ A;  2OPT A;  2H1L A;  3B6C A;  1MBH A;  4F91 B;  2O61 A;  1L3L A;  3L2W A;  2NOJ B;  1Z77 A;  2XB0 X;  3NQO A;  5D8K B;  4XRM A;  4UV9 A;  3RI4 A;  2NVU B;  1VZ0 A;  4II3 A;  4DOZ A;  1YLF A;  2O9L A;  2X6X A;  2HVR A;  2XAG A;  4LLG F;  5L3D A;  1Z3X A;  3CF5 F;  1R23 A;  4YFX F;  5CLS A;  1XD7 A;  2DAO A;  4L5E A;  5CQE A;  1T2K A;  1G3T A;  2JVH A;  1KQ9 A;  1YRN B;  1GV2 A;  4LD5 A;  1RUN A;  2HZT A;  4BDZ A;  1WCM J;  1B9M A;  3CP2 A;  2JN6 A;  3JRH A;  2P6S A;  1IC8 A;  3BTC A;  4NQW B;  2C6Y A;  3VWB A;  2X1D A;  3S1Q J;  5EEG A;  4RM3 A;  1O7F A;  3LQQ A;  4IOA F;  1V55 H;  3CLQ A;  1D0X A;  5DCM B;  4B47 A;  5BS6 A;  1O57 A;  1NTC A;  2M3A A;  1X1P A;  2G9W A;  1XCV A;  3GZ6 A;  3E1S A;  4ZDL A;  1R5G A;  2P0W A;  1TC3 C;  3F0C A;  2ZFU A;  1FP1 D;  2O5R A;  1M1E B;  4GYG A;  2RDP A;  5ICF A;  5J8C A;  3CCU I;  1XB4 A;  2FU4 A;  3D5R C;  4CH7 A;  5E18 F;  5LGN A;  4IHS A;  3QU6 A;  1YOV B;  3TL4 X;  3LAP A;  4G7Z F;  1LVK A;  2H6C A;  2VJJ A;  3A4C A;  3CCQ I;  2WTE A;  2VBY A;  3K4C A;  2V9P A;  5KVR A;  1VQ4 I;  3QP6 A;  3TMO A;  4R79 A;  3GFL A;  5IT3 A;  3OYN A;  3PNY A;  1HST A;  1MH3 A;  2P6T A;  2DPU A;  2LH9 A;  2UXN A;  1BIA A;  4NNJ A;  1UHM A;  1HKT A;  5ILS A;  3MQ0 A;  3DBR B;  2DPD A;  2PJR A;  2WAE A;  4BBS J;  2DMT A;  1LB2 A;  1USS A;  3LMM A;  4Q4Z F;  1TT0 A;  1E0E A;  3BR3 A;  1G3Y A;  4LLL A;  3ZRG A;  2ECC A;  3BJA A;  2H1K A;  2L9N A;  5C44 J;  3BR6 A;  3REO A;  4F92 B;  1JGG A;  2M4G A;  2JMW A;  3L7W A;  3JSP A;  2KLO A;  4W1U A;  2GZW A;  2L7Z A;  1G8X A;  4RB3 C;  1AWC A;  3HC7 A;  2UXX A;  3IH4 A;  1I3A A;  3CUQ B;  1Z67 A;  3U2R A;  3R0J A;  1R22 A;  2QZ8 A;  3M8F A;  2XDV A;  2Y2Z A;  4Q47 A;  2A61 A;  3V7S A;  2K40 A;  4EV0 A;  4QPO A;  2VOP A;  1OPC A;  5BPD A;  1BC7 C;  2M30 A;  2K9N A;  4ZYE A;  1ETW A;  5DDG A;  1LNW A;  4LK1 F;  5JVG F;  2ID3 A;  3V8J A;  2CQK A;  2KRC A;  5F1R A;  3CCM I;  4NC8 A;  1Y56 A;  2KP6 A;  2CW0 F;  2E7X A;  4X6A J;  2OZU A;  4RLF A;  2HYF A;  3GUD A;  2CJJ A;  2JVG A;  5F6F A;  2JA7 J;  1KON A;  4Y3O A;  5LLQ A;  4NB5 A;  1AHD P;  4HDU A;  4HV5 A;  2XB5 A;  1J9I A;  1B4A A;  1IV6 A;  1A04 A;  4L9V A;  3C1D A;  2GWR A;  2FRH A;  3IHU A;  2O3F A;  3KLN A;  4IOC F;  1YIO A;  2EH3 A;  4CCN A;  1MBK A;  4QWQ A;  1JT0 A;  4RB2 C;  1EF4 A;  3OS0 A;  3ML6 A;  3MD2 A;  1SVO A;  3ZP5 A;  3LSP A;  3NRV A;  2ZME B;  2M0C A;  1AKH B;  2CYY A;  2E1M B;  3GZN B;  3MZ8 A;  1ZG5 A;  1VQ7 I;  1IRG A;  1XS9 A;  1Z1D A;  2L7K A;  4JBA A;  5J40 A;  3RKY A;  1FLI A;  3C2G A;  1HDP A;  3OY9 A;  2GBY A;  2OCE A;  2XRN A;  3E6C C;  3EUH C;  1F1Z A;  4RGX A;  2FNA A;  2MH9 A;  5ICC A;  1W7P D;  2IGO A;  3JSO A;  2L7F P;  3S16 J;  4DJA A;  4B8X A;  1S7E A;  1R36 A;  3WG9 A;  2PMH A;  3L2Q A;  2PMZ N;  4ENM A;  2LY9 A;  2KIQ A;  5H6Q A;  2K02 A;  1OMI A;  2A5W A;  1I1G A;  1B72 A;  2O7O A;  5K7H A;  3DU6 A;  1WI9 A;  3JTH A;  2H09 A;  3GEZ A;  5CVU A;  1SD7 A;  3WGG A;  5LGT A;  4A3D J;  4XN0 A;  3K7A J;  5D6F A;  4A3E J;  1IG7 A;  4EJV A;  3QPH A;  4LFU A;  3PNV A;  2ZSH B;  1PP7 U;  3I56 I;  3LA2 A;  1ENH A;  5DCF A;  2FUG 2;  3RYR A;  1BW5 A;  4MLO A;  5LEK A;  4A3I J;  1O3S A;  3RDI A;  1SD5 A;  3V7C A;  4KIB A;  2P81 A;  4G6Q A;  5K7Z A;  4MHG A;  4HF1 A;  4BE2 A;  2LG4 A;  1DUX C;  4N9I A;  5ED4 A;  5GP9 A;  5M5W J;  2Y0S N;  3W3C A;  4BQO A;  2QUF A;  1E17 A;  5FD6 A;  3I55 I;  2LRE A;  3FMQ A;  1J09 A;  5F27 A;  1UHW A;  1QZZ A;  3ZQ7 A;  2LSO A;  1ZGA A;  2DMN A;  4I7H A;  1WJD A;  3VOD A;  3FDY A;  4EJO A;  1IGN A;  1A31 A;  1VQK I;  4M3B A;  3ULQ B;  2NVX J;  4WF2 A;  2IJL A;  4I99 C;  2XPU A;  1XGO A;  2CV2 A;  2HGC A;  4KYW A;  2HTJ A;  2DLL A;  5GTI C;  2ZFW A;  1K7A A;  3MZH A;  2WC2 A;  1TT5 B;  5D5X B;  2KHM A;  2R5Y A;  2UV1 A;  2BEO A;  2F5E A;  1OKR A;  3IUO A;  1R6R A;  5BOX A;  3H3U A;  3WG7 H;  3JCU C;  3RCO A;  1RKT A;  3AG3 H;  1S7O A;  5J3L A;  3N97 A;  3DTE A;  1PVE A;  2BW3 A;  3BG9 A;  3HKZ A;  4KIF A;  4UV8 A;  2CQ7 A;  2ESN A;  2KDZ A;  2QGU A;  4M3G A;  1HQC A;  1MNM C;  1MW7 A;  2B0L A;  4EJW A;  3BR0 A;  1Z7U A;  3GO5 A;  4FAS D;  4GRI A;  3MKZ A;  2FOW A;  3L2C A;  3LA7 A;  1SEU A;  2M2E A;  3J7Y J;  2QA4 I;  2D2W A;  1YIT I;  4IKF A;  5E17 F;  1JKQ C;  1FOW A;  1NK2 P;  1T98 A;  1XC5 A;  1EH6 A;  1YX3 A;  3CDH A;  4XN3 A;  2ICW G;  4EQQ A;  1MMS A;  4RDU A;  2NOG A;  2FSW A;  1SD4 A;  1D1C A;  1XSV A;  2X4H A;  1APL C;  1Y8Q B;  3MAJ A;  2KJC A;  2WAQ N;  4CUG A;  2F5D A;  4U7B A;  3GTG J;  3CJR B;  4S0H B;  1CGP A;  4RMN A;  3EUA A;  5E1W A;  2IXS A;  4G7O F;  1X19 A;  3DCF A;  1IAW A;  2CUF A;  5IT9 Z;  2VN2 A;  2XGD A;  4E70 A;  4XLP F;  3ZN0 A;  4G8X A;  1LFU P;  3HL2 A;  2W85 A;  3H9Q A;  3F8B A;  1Z0X A;  2HU9 A;  2VB6 A;  1KYZ A;  1ONV A;  1T39 A;  3BOQ A;  2DFI A;  1R7J A;  5IPA A;  2IEK A;  1JUM A;  1O3Q A;  2DOE A;  4CDG A;  1ACI A;  4Y52 J;  4IRH A;  1RPW A;  5IY5 H;  2OD5 A;  2Z5U A;  4BDY A;  2QF7 A;  1OJL A;  3E0J B;  2K4B A;  1IN7 A;  2E7W A;  4LG0 B;  1DPR A;  1OR7 A;  2PLY A;  1D0Z A;  4I6Z A;  4RGU A;  3ISP A;  3X2Q H;  3J81 Z;  2QQ9 A;  2E60 A;  1FC3 A;  3ASN H;  3SFI A;  3IP4 B;  3J81 K;  2EIL H;  4A6D A;  4CCJ A;  3JRE A;  2QQ8 A;  3CC2 I;  1STZ A;  4G6T B;  3ZGK A;  2K3F A;  2Y9Z A;  2F48 A;  2E71 A;  3KEY A;  1IDZ A;  3GTJ J;  1F43 A;  3NWT A;  5BMZ A;  2I10 A;  2NVT J;  4U7D A;  2TCT A;  3QOD A;  5FKN A;  4Y13 A;  3A0H C;  5D4S A;  5ICG A;  3GME A;  2BVM A;  4D9J A;  2MG4 A;  4XON A;  3RYP A;  2PJP A;  4IX7 A;  1X1C A;  1VI0 A;  1NG6 A;  4IVN A;  3K4J A;  3JRG A;  1T8I A;  1ZR4 A;  1S3J A;  3GBG A;  1LE8 A;  1MDM B;  2ZNY A;  2EA2 A;  2UUZ A;  3WTW C;  5M5X J;  4I0A A;  5FGM A;  3OYH A;  2BY0 A;  2H8W A;  2XC7 A;  2G7U A;  3HSR A;  2ELK A;  3ZQH A;  2VUM J;  2NS7 A;  6PAX A;  2AQE A;  1P2F A;  2RN7 A;  2QYO A;  2VON A;  2L54 A;  3ERE D;  5CKT A;  3CTA A;  2W57 A;  1D8K A;  3AG4 H;  3ZMD A;  5J1U A;  2WBM A;  4G6D A;  2ID6 A;  2IW5 A;  2V1N A;  3Q5F A;  3E6B A;  4IRG A;  4M3F A;  4I02 A;  3H5R A;  3L2V A;  1TNS A;  1REP C;  1U5T A;  2EZK A;  3M1E A;  1HW5 A;  3EDP A;  4EMS A;  3DEU A;  4L9N A;  2OTL I;  2TRT A;  5F0F A;  4BXX J;  2FD5 A;  2VQG A;  2ZJ2 A;  2MAB A;  3G71 I;  1DGW Y;  1LDJ A;  2DDA A;  2B7E A;  2MC4 A;  5DS9 A;  3S2H J;  2PQ8 A;  1BA5 A;  4P9U A;  2EFN A;  1X3U A;  4UHT A;  3S2W A;  4J00 A;  1Y1V J;  2BXZ A;  2F5V A;  3BP8 A;  3FX3 A;  4UNO A;  2FQ4 A;  3CF2 A;  3DTI A;  3WU0 A;  3BC8 A;  2GOX B;  1A5J A;  1Y6I A;  4JX4 A;  4GYI A;  5FLX Z;  3DV8 A;  3HUG A;  2QSH X;  4P5O A;  1UMQ A;  3LQR A;  4B43 A;  1K6O A;  1AA7 A;  4IEJ A;  5JI6 A;  4M3D A;  5FLM J;  1TBX A;  2LTP A;  3OYA A;  5FRO A;  2LYC A;  3TGN A;  1BM9 A;  4CXF A;  4PZJ A;  3SXY A;  3RKX A;  1FIA A;  4XLH A;  4PFO A;  1ZG1 A;  1ON2 A;  2KDO A;  1DU0 A;  5E79 C;  4U0W A;  2K5C A;  3DTK A;  4ESJ A;  2KIF A;  1B6A A;  3H36 A;  4RA2 A;  3N05 A;  5DEQ A;  5LRR A;  4UUS B;  2W4S A;  4LJZ F;  3HOT A;  3IV5 A;  3F23 A;  4A3J J;  3ZPL A;  4P96 A;  4HLY A;  3CJT B;  4E6K G;  3WTV C;  1OQY A;  3KFW X;  2JJ7 A;  2QEN A;  2WY7 Q;  1T6S A;  2Y0M A;  2CH0 A;  4MFD A;  5EZH A;  2VE8 A;  1TZL A;  2LY2 A;  3GFJ A;  5KHD A;  3R61 A;  2HPM A;  1RR8 C;  2BOL A;  3VYR B;  2A5Y B;  2V6E A;  2EFP A;  4O6J A;  2COB A;  5HVQ C;  1S8N A;  3F22 A;  4KNY A;  1ETO A;  1X58 A;  3BTL A;  5FKK A;  2LFB A;  2HQA A;  3CME I;  1KU2 A;  2E1O A;  3IWZ A;  2HKX A;  2YX7 A;  3NWS A;  2BZT A;  1KGS A;  1WJE A;  2GOM A;  4NDL A;  1NG7 A;  4HST A;  4NBQ A;  4Z6Y A;  4MFE A;  1U3E M;  3I71 A;  2Y48 A;  1WRJ A;  5KNL A;  1ULY A;  3SZG A;  4NC6 A;  4A6E A;  4BE1 A;  2LDU A;  3CUQ C;  3OMY A;  3WU1 B;  2CMP A;  2OZ6 A;  5TRD A;  1XSD A;  4WX9 A;  3BR2 A;  3I4P A;  2BY1 A;  5IYD J;  1V3F A;  1OCC H;  2LOO A;  3T1B A;  4WK8 F;  1E3O C;  1DDN A;  1IXS B;  2HQR A;  3OS1 A;  4EEF G;  2FEZ A;  1OFC X;  2E2I J;  2STW A;  2O6G E;  2CUJ A;  3J80 Z;  3SJM A;  3K69 A;  3HTU A;  4PFP A;  1LPQ A;  3LST A;  2RGV A;  3WTU C;  4H4K C;  3HDD A;  4WXH A;  3ABL H;  4ASN A;  2HOS A;  4L0Y B;  1FIP A;  1W0T A;  3WU2 C;  1XGM A;  3JW4 A;  1P4A A;  3LNQ A;  2JPB A;  1MMD A;  1RI7 A;  3B6A A;  2FML A;  3ELK A;  4M73 A;  1G3S A;  3AFH A;  2ZCW A;  1YE9 A;  3FXU A;  3A1Y A;  3KP7 A;  1YYV A;  4FHT A;  2LBF A;  3P9K A;  2XAJ A;  5IOY A;  1G2H A;  4A3K J;  2PG4 A;  2H27 A;  1PDN C;  4WWC A;  1GVJ A;  4D1Q A;  2HPI A;  3A2K A;  5HS7 A;  4CA0 A;  4ZDP A;  5GAD J;  3GX4 X;  3KP6 A;  3HOV J;  2ZME C;  1VQL I;  2E1M C;  2ZO4 A;  1ZRD A;  1K6Y A;  2ZSI B;  4XKW A;  2W48 A;  1UST A;  4M6X A;  3CD6 I;  3ZMS A;  4PSX A;  2KZV A;  2YSR A;  3M8J A;  3BQZ A;  1WJF A;  4IHW A;  1FSH A;  3GW2 A;  1SAX A;  3F6O A;  1E2X A;  3RIR A;  4DW6 A;  1U9N A;  2F4O B;  4DZJ A;  4MGR A;  3MWM A;  1IO2 A;  2XV4 S;  1QQI A;  1BJA A;  4A3F J;  3U9G A;  1B59 A;  1WHU A;  4A3M J;  4LIV A;  1QZE A;  4UUT A;  3I4M J;  2L9V A;  2O03 A;  5AON A;  2DK5 A;  3KP4 A;  1ZG3 A;  1DGR M;  2IA1 A;  3KYC B;  2VIX A;  2LLK A;  1D3Y A;  2LD5 A;  1F9N A;  1FBU A;  1A6Q A;  1YS6 A;  3CP8 A;  1R71 A;  4JOM A;  3KP2 A;  1FTZ A;  3F8M A;  1MBE A;  3FXQ A;  2HWV A;  5HLG A;  3GXO A;  1A6I A;  2YPR A;  3P9C A;  4BGD A;  3TP0 A;  2ZB9 A;  2R7R A;  4V19 K;  3QPT A;  1Y0U A;  2WWY A;  1QU3 A;  1S9H A;  4FQG A;  4YG2 F;  3QRF F;  4IHV A;  3FXO A;  1BR1 A;  5GTH C;  5ILU A;  1YS7 A;  4PJ0 C;  5CVV A;  1XGS A;  3ONQ A;  3BR1 A;  4M6Y A;  3B02 A;  3FXJ A;  2ETH A;  1YX5 A;  5AIP A;  1K4S A;  2DCE A;  1BBY A;  3S15 J;  4KT6 A;  4XRF A;  2IGN A;  2QSF X;  3IWF A;  3GYH X;  2DO7 A;  3ZMV A;  2QBY A;  2NVQ J;  2LKS A;  2DN0 A;  3FXM A;  3L2R A;  3R6S A;  3S32 A;  1WH7 A;  1VTN C;  2GA2 A;  2ISZ A;  5C3E J;  4BEH A;  1J59 A;  3FXK A;  3G1L A;  2VQH A;  3R60 A;  5FKL A;  1YTY A;  1MSE C;  1T38 A;  4BJT A;  1X1D A;  1TNT A;  1HDD C;  5EJC A;  4IHY A;  4KUM A;  5F04 A;  1J2X A;  3DKX A;  2DA7 A;  3CC4 I;  3DPT A;  4LB5 A;  2FNP A;  2ZJR F;  2BE5 F;  2D45 A;  2STT A;  4X0G A;  3HPG A;  2X1C A;  3OYE A;  3M8E A;  5LHH A;  1MMN A;  5K5R A;  3S3M A;  2HXI A;  4A5N A;  2XAU A;  2VI6 A;  4ZZD A;  1S7A A;  3HGY A;  3IAM 2;  1Z6R A;  2Q2E A;  3W6J B;  2PJR B;  2DA3 A;  4FE7 A;  3QOE A;  2X6W A;  4MNU A;  1LEB A;  2DOD A;  5CVI A;  1WI3 A;  4PUS A;  3GF2 A;  3Q9S A;  3TW7 A;  2E1C A;  1GV5 A;  1ZHF A;  2PMZ A;  4XK4 A;  2VT2 A;  1SFO J;  4ETS A;  2XAF A;  3CDL A;  3T0Y A;  5KK1 A;  4XKV A;  4XSZ F;  2DMP A;  4A0Z A;  2BXY A;  1UEL B;  2IA0 A;  4C3J J;  2I5U A;  3KCC A;  1TP4 A;  2JUG A;  2OC6 A;  4AD9 A;  3TOB A;  1XN7 A;  3ZMU A;  5IYB J;  2BGC A;  2NYX A;  1R49 A;  4UVA A;  2A07 F;  2BHY A;  1JJ6 C;  1Q1H A;  2F4M B;  3L2U A;  3DP7 A;  4E7J A;  1W7P A;  5B5E C;  2AQF A;  4HX8 A;  5EEA A;  4L18 B;  4NHJ A;  2Y0S A;  2O8K A;  3WE2 A;  1K78 A;  3GVA A;  1YFH A;  3O6B B;  3CCV I;  3L09 A;  2JSC A;  2OV7 A;  4XLC A;  1ZRF A;  1KA8 A;  3BG5 A;  2F4I A;  3VYU B;  1RIO H;  3JRF A;  3H5N A;  2R7X A;  2IPQ X;  1QVU A;  2HQN A;  1X2N A;  4YEL A;  5HDN A;  3O2P E;  4IQ4 A;  1WJA A;  1LJ9 A;  2Q0O A;  2A05 A;  3IH2 A;  3H3Z A;  3UNG C;  2EV5 A;  2XKO A;  2DJI A;  2W82 A;  3JAM Z;  2XGX A;  3QP5 A;  2JTV A;  2X51 A;  4HAM A;  2D1V A;  4RAY A;  1IV8 A;  3A01 B;  2VJ4 A;  4U88 A;  4HBL A;  1ZLK A;  1XSX A;  2JZY A;  2NS8 A;  1FYL A;  2WY8 Q;  1OCT C;  2EIM H;  4XLF A;  3F21 A;  1V5G A;  1WSU A;  4XID A;  3E97 A;  4BU2 A;  1FBQ A;  2LC2 A;  1UG0 A;  2K3P A;  2R7U A;  2WV0 A;  4LG3 A;  3HBL A;  2IVM A;  3GZ5 A;  2KJB A;  4U0Y A;  1HW1 A;  5HS9 A;  3VDX A;  2VQC A;  1TWC J;  4EGY A;  4J01 A;  1B72 B;  2A68 F;  3KEO A;  1ZGW A;  1FTT A;  2EA4 A;  3P7N A;  1RES A;  4HV6 A;  1SFX A;  3ROU A;  4BHP A;  2WAQ A;  4M6V A;  2M4K A;  3SQN A;  1FYM A;  2HXO A;  3RPQ A;  4CCL A;  3H1C A;  2B9S A;  1X4O A;  1QA6 A;  2CUE A;  1QRY A;  5FFZ A;  2HEO A;  3KZY A;  1P4X A;  4IL6 C;  5IP6 A;  4BS9 A;  3IAS 2;  1D0Y A;  1D5V A;  1LEA A;  1ETX A;  3K6G A;  3D0S A;  1ZYR F;  2YS9 A;  3K0L A;  2MD5 A;  2MBF A;  4OAY A;  5EGO B;  2QCO A;  1F4K A;  3VEP A;  2ZC2 A;  3BWG A;  3S1M J;  1LFP A;  4RS8 A;  2GIZ A;  1VQM I;  4B3A A;  3ECH A;  3OR1 C;  4ZZL A;  3EYI A;  1MMA A;  3Q0V A;  2K85 A;  3GCM A;  2YU3 A;  1DU6 A;  2R3S A;  3LSK A;  3QWL A;  2VBW A;  2DMQ A;  3FMS A;  2XPW A;  3OYF A;  2R5Y B;  3HGG A;  2A6T A;  2NXN B;  4AWX B;  4ESB A;  4C3H J;  5D4R A;  3ZQC A;  2DW4 A;  3ABM H;  4LK0 F;  2K9L A;  3R4K A;  2L5Q A;  4XNF A;  4Y7N J;  1I50 J;  4S05 A;  2XSD C;  5LD2 C;  4GFB A;  3H9J A;  2DA2 A;  2BW3 B;  3FWE A;  2HDC A;  2YR2 A;  2NRA C;  3FM3 A;  1MH4 A;  3SDG A;  5DM6 F;  2WV1 A;  2DK8 A;  4AYB N;  3F72 A;  4N0B A;  4AIK A;  3HJE A;  2YX4 A;  5IOZ A;  4XOT A;  4FCY A;  1V4R A;  4HRI A;  3FM5 A;  4A3C J;  2FBI A;  1HBX G;  4V2G A;  4D5C A;  2WA0 A;  4E7S A;  2GA1 A;  4M74 A;  3PFY A;  4ITV A;  3FKJ A;  1U8R A;  1VQP I;  1O3T A;  3BRO A;  2XIG A;  3CCR I;  4ZYH A;  1JTX A;  2KIS A;  2ZXJ A;  3BT9 A;  4CHU A;  1FBS A;  3WTX C;  1YQA A;  3RJP A;  3OYL A;  3HOS A;  1FPQ A;  1OCZ H;  2BYV E;  5HLH A;  2VKE A;  3FIW A;  5E3L A;  1XDS A;  1BI2 A;  2JT1 A;  3I9V 2;  4G12 A;  2FBK A;  4MQ9 F;  5FD5 A;  3CJN A;  3DKY A;  1LKX A;  1JUP A;  2IGK A;  4FX0 A;  1GVD A;  4XKB A;  2G0E A;  3E5Q A;  1SFK A;  1T0F A;  5J1R A;  2XF7 A;  2DTZ A;  3I59 A;  3GTM J;  2LVS A;  4BYY A;  2MC3 A;  2KL4 A;  1FOY A;  2DFE A;  3I3L A;  2O0Y A;  1O3R A;  2MLK A;  9ANT A;  1YI2 I;  2R7T A;  3U1D A;  3SEZ A;  3HRS A;  1VFC A;  1SFE A;  3LSJ A;  4M3E A;  3TW6 A;  3W6V A;  4A3B J;  1X3Z B;  2WAF A;  1GXQ A;  2P5K A;  3QPS A;  4BAY A;  2LMD A;  2E2J J;  4KIT B;  3DEE A;  4KIC A;  3AL0 B;  3IKT A;  3EPZ A;  5JVT A;  3BG3 A;  4KA4 A;  5IT9 K;  2Q1Z B;  4I98 B;  3UR3 C;  4C9Y A;  5GAE J;  4RB1 A;  1D8J A;  2BY3 A;  4N4O B;  3TOA A;  1B9N A;  3KYD B;  1H9G A;  5J1Y A;  4Q5S F;  1GLN A;  2M0M A;  4KMF A;  4QSH A;  1O4X A;  2NS0 A;  2HS5 A;  5GAH J;  3EQL F;  1DQU A;  2ISY A;  2VLA A;  2VBX A;  1PUF A;  1LE8 B;  1J5Y A;  3QYF A;  3ZCO A;  3CCJ I;  1ZRE A;  5HDK A;  5F64 A;  3DF8 A;  3QYE A;  1H88 C;  4BQQ A;  2E5N A;  1ZGJ A;  1JI8 A;  2RKH A;  2XGC A;  1TW2 A;  4HEA 2;  4AC0 A;  3OYJ A;  1Z21 A;  3BTJ A;  2EIJ H;  4D0P A;  2P5V A;  1S29 A;  1A35 A;  3VSK A;  2GLO A;  2DOF A;  1S6L A;  1IN6 A;  2R7D A;  1ZRC A;  2DFF A;  2MA3 A;  2R7O A;  3ZQI A;  4RLQ A;  3SZT A;  1QHG A;  4UB8 C;  5KCM A;  1TWF J;  2VBZ A;  1ZLJ A;  3K1P A;  1J75 A;  1R4M B;  2DDB A;  2IBD A;  3FK7 A;  3M7G A;  4YFK F;  4EM0 B;  3RQ4 A;  1ZN2 A;  4MIM A;  3JRB A;  1T56 A;  3S8P A;  1V5F A;  3HXL A;  1U5T B;  1Z6T A;  1MKM A;  4L9T A;  1MSF C;  3DPU A;  4ANJ A;  5E3N A;  1K83 J;  4LLN A;  2A6H F;  4CGZ A;  2HFH A;  1QPM A;  3M4O J;  3OS2 A;  2DYS H;  2CQX A;  4A5M A;  2M8G X;  2MGQ A;  3MKY B;  5LBQ A;  2IS1 A;  3PNT A;  4YII A;  1CQT A;  1N78 A;  3NEU A;  4C2U A;  1N75 A;  3IKV A;  3VYT B;  2OCC H;  4UVC A;  4D7N A;  5F0H A;  4A3L J;  4HQE A;  4XKC A;  2HOA A;  5L3B A;  4YFN F;  1JHF A;  2CG4 A;  2AO9 A;  1R1T A;  3W2V A;  3ZQQ A;  1MZB A;  5D5W B;  2W24 A;  2JA2 A;  3HUG B;  3RPU A;  5JHU A;  2QWW A;  3CZ6 A;  3JRA A;  4XIC A;  4IO9 F;  1YJW I;  3LSG A;  1YW7 A;  2OJE D;  2Z9O A;  1WJ5 A;  2FOK A;  2Y69 H;  1R9T J;  2L02 A;  4CO8 A;  5LEJ A;  3BJO A;  3WOD F;  3GTO J;  4E4H A;  1JTY A;  2R7S A;  1JT6 A;  1BI0 A;  1MNE A;  1OCR H;  2ESH A;  3K4L A;  1N25 A;  5CVR A;  2W7N A;  4BAC A;  1B8I A;  1TWG J;  4B44 A;  4QPQ A;  3FK6 A;  2IS6 A;  1HOM A;  1BOB A;  1MBF A;  3E7L A;  1KZH A;  1IN8 A;  1BL0 A;  5K5O A;  1SC7 A;  1UB9 A;  4M71 A;  4A0Y A;  3GTP J;  4KFC A;  5FLX K;  3E5X A;  4M9Z A;  2LK2 A;  2Z16 A;  4C30 A;  2EWN A;  3JRD A;  3U1K A;  4BQN A;  3SDB A;  1A36 A;  2XAS A;  1WH5 A;  4HPQ A;  5DUK A;  3FMR A;  3GFI A;  1F5T A;  2GM4 A;  3HOY J;  1BOA A;  3L00 A;  1FZP B;  2M7B A;  3BZK A;  1O7L A;  4OIN F;  3LL7 A;  2KQR A;  1P4W A;  2E34 A;  4MQV A;  4XSX F;  3EUH A;  3GLX A;  1TTY A;  4OMZ A;  3VPR A;  5L3G A;  2K9M A;  4OIQ F;  2R5Z A;  4S04 A;  5L3E A;  3WTZ A;  1ZR2 A;  3LA3 A;  2ELJ A;  1BW6 A;  3O8H A;  4HQM A;  4KN7 X;  4I2O A;  1RZ4 A;  2RQP A;  3S93 A;  3TO7 A;  4AID A;  4FE4 A;  1MND A;  3E5U A;  3G1M A;  2Q8K A;  2VXD A;  2L4M A;  1FT9 A;  3OV8 A;  4EJT A;  3LFU A;  4P1W A;  2GXB A;  5LFA A;  2VQL A;  2LF7 A;  1K61 A;  1UZC A;  5IYC J;  2QKM B;  2E19 A;  1CF7 A;  3CJQ B;  1G4D A;  2ZKZ A;  4NUB A;  4XOR A;  2H6B A;  5HDG A;  3KX2 A;  3GFM A;  1S5L C;  4BXF A;  5M5Y J;  2JA5 J;  4O5V A;  2BY2 A;  4BKX A;  3MKL A;  3HOZ J;  3N4M A;  3F8F A;  5LRS A;  2J5O A;  4P9F A;  4I01 A;  4II2 A;  2XSJ C;  3OIQ A;  4YIF A;  1RRJ A;  1RKW A;  2MH2 A;  5D5U B;  1ZKG A;  1ZH5 A;  3FXR A;  3BG6 A;  4CYC A;  2DFH A;  3DBH B;  3R0A A;  2P4W A;  1R58 A;  2R4G A;  4AUX A;  2VC0 A;  1UJ8 A;  1I1S A;  5F0C A;  2H8R A;  2M7A A;  5IP7 J;  3OYC A;  1WGX A;  3ABT A;  2EZH A;  2JSP A;  3S3N A;  2IRF G;  3OYB A;  3LSH A;  3RQI A;  5L3C A;  3BZC A;  4AVZ A;  2LKP A;  1D5Y A;  2K86 A;  2XVC A;  3MVP A;  3Q0U A;  3J80 K;  4B3X A;  3D5L A;  3MKW B;  2CU7 A;  3HYI A;  1OIS A;  3G6E I;  3Q3S A;  4N4N B;  1HW2 A;  3IH3 A;  3E3V A;  3PQJ A;  3K1N A;  1VQO I;  1PYV A;  4PJL A;  3O3K A;  3M07 A;  1LVA A;  2K9S A;  3BLY A;  4B1R A;  2CV0 A;  2GAU A;  2LY1 A;  2PBI A;  2K7L A;  3MFK A;  1IW7 F;  2HZD A;  3KZZ A;  3OL4 A;  5KAF C;  4DYC A;  4E7I A;  2RQQ A;  1XCB A;  4E7L A;  1T95 A;  2HQ5 A; 
#chains in the Genus database with same CATH homology
 2DQR A;  1TQM A;  3J7A O;  2PEX A;  2Z33 A;  5E8G A;  3HTS B;  4BH9 A;  2LNB A;  5JR3 A;  2ELH A;  2R7F A;  4HLX A;  3TQN A;  4EM1 A;  5LHG A;  3TDZ C;  1R00 A;  2JRT A;  1IN5 A;  3TO9 A;  1KU7 A;  2E1N A;  3SFZ A;  4OIR F;  4ON0 A;  3WTS C;  1JXS A;  5L3F A;  2V1X A;  4G7H F;  4GCV A;  3C3W A;  2QBY B;  3L9F A;  2VE9 A;  4LGW A;  4RGS A;  5HLI A;  3V8L A;  4I09 A;  1HKS A;  4OMY A;  2HYG D;  1MJ9 A;  1KU3 A;  4ESF A;  2VXZ A;  4WXC A;  4OIP F;  3I5U A;  1EV7 A;  3DFG A;  3FHZ A;  1R1V A;  4DQ2 A;  3MCZ A;  3TO6 A;  3VOE A;  1FSE A;  1L0O C;  3HSF A;  3WGI A;  1RUO A;  1W5T A;  4HZF A;  1H0M A;  5A2Q Z;  4CYD A;  4LB6 B;  2FXA A;  2PN6 A;  2KIM A;  3I53 A;  3KP5 A;  4IPA A;  2DTR A;  3T8T A;  2NNY A;  4BHB A;  3SZP A;  1XMA A;  3LWF A;  3ZMT A;  4IHT A;  2F2E A;  1KYW A;  2UWM A;  3B73 A;  3DXJ F;  3FF5 A;  1ODD A;  2OAZ A;  3HRU A;  4M72 A;  4A0X A;  1LDK B;  1W7P B;  5ERI A;  3Q9V A;  1PP8 F;  1K78 B;  3F6V A;  4OIO F;  4PGH A;  2AXL A;  2MLG A;  3T5X A;  1FP2 A;  1U78 A;  4HA8 A;  5LHI A;  5D5V B;  3K1M A;  5EEH A;  5FFX A;  3LFK A;  4ENN A;  2QLZ A;  2OQR A;  4EM2 A;  4MEY F;  1XMK A;  2ACJ A;  4NQW A;  1RNL A;  2XHK A;  4KN4 X;  4L5I A;  3HIF A;  4Z2Y A;  4QLC U;  4HDV A;  5H6R A;  1XGN A;  5DCM A;  4FX4 A;  1PUE E;  1QNT A;  4A12 A;  1MGT A;  1UCR A;  2AS5 F;  2XUB A;  4MTE A;  4XLN F;  2H94 A;  1LDD A;  1I5Z A;  2XAH A;  4Y15 A;  2BBY A;  1YW8 A;  4H0E A;  1ON1 A;  4UVB A;  2W25 A;  2P7C B;  3C7J A;  3E6D A;  1FYK A;  3HHH A;  3T8R A;  4JK1 X;  2XRO A;  2J5P A;  4KIG A;  3JAM K;  3QAH A;  3TDU C;  2K4J A;  3PFI A;  4HF0 A;  1FY7 A;  1U5T C;  2OA4 A;  3CO7 C;  3KP3 A;  4N9H A;  4AVP A;  3VFZ A;  4HX7 A;  3QU3 A;  3V7R A;  1R5H A;  5BQT A;  3CO6 C;  2EV6 A;  2JPC A;  4HOB A;  2M8E A;  3GWZ A;  4EVI A;  3CUQ A;  1HXD A;  2VT3 A;  4A2U A;  1ZAO A;  3G73 A;  1TQI A;  4PGG A;  3WTT C;  3JTG A;  2FE3 A;  5AIQ A;  4L9J A;  1FX7 A;  2Z99 A;  4OU0 A;  4CZZ A;  3P9I A;  1Z91 A;  2QVO A;  4EJU A;  3F8C A;  1WKM A;  2GXG A;  3COA C;  3DQV C;  1HKQ A;  2O8X A;  1W5S A;  3V4G A;  2DQL A;  2A3S A;  4PDK A;  2V1U A;  1R1U A;  2F5F A;  2EFW A;  2VOO A;  5CYV A;  2ZME A;  1J7K A;  3MEX A;  4GGG A;  2Y75 A;  2HOE A;  2IP2 A;  1FWZ A;  2QM3 A;  1B1B A;  1KQ0 A;  2FQ3 A;  1IXC A;  4BXU A;  3K9T A;  3I59 B;  2DI3 A;  2BV6 A;  3DPL C;  2GQQ A;  4AIH A;  1KQ8 A;  2KIU A;  4HF2 A;  4K2E A;  1QGP A;  5LGU A;  1YO5 C;  4I0B A;  3TKY A;  1U2W A;  1QO0 D;  5DUI A;  4P55 A;  2DT5 A;  4AIJ A;  4FT8 A;  2Z3Y A;  4UUV A;  5J8F A;  3C18 A;  2DU9 A;  1FOK A;  4O3M A;  1FNN A;  4IXA A;  4ZH4 F;  4WXD A;  2EV0 A;  4G94 A;  1JHH A;  4HYE A;  1U6G A;  5E8I A;  1WWX A;  3IC7 A;  1H9T A;  4RGR A;  2P5L C;  3QOP A;  4WCG A;  1NHA A;  5DYM A;  5BPI A;  3E6M A;  3BPX A;  2CGP A;  4R1H A;  2XKP A;  2NNN A;  5DD8 A;  2CWE A;  2EB7 A;  4BNC A;  3HRT A;  5DV5 A;  4HX4 A;  2QQA A;  4KT5 C;  3OOP A;  2EFQ A;  3SHF A;  3IRR A;  3ABU A;  3FZV A;  1EH7 A;  1EH8 A;  3I0T A;  1OYY A;  1IN4 A;  4MEX F;  1BN5 A;  1IRF A;  2EK5 A;  1HSJ A;  3F3X A;  1IZ1 A;  4XBF A;  2V1D A;  1BI3 A;  4IRI A;  5TJJ A;  4GXO A;  2OU2 A;  4CIC A;  3ZMZ A;  4LG0 A;  4TV7 A;  3H92 A;  1Z9C A;  1QBJ A;  2OBP A;  5H20 A;  1BI1 A;  2P7V B;  1YG2 A;  4UXN A;  2NAZ A;  4KDP A;  1GHC A;  4IF4 A;  2F5C A;  3HHG A;  3BJ6 A;  1OYW A;  4L5J A;  4BQA A;  5CVJ A;  1TQP A;  4R8H A;  4BHC A;  3AAF A;  1KU9 A;  4F7Z A;  3BDD A;  3BPV A;  2VC1 A;  3BZ6 A;  2HKO A;  3I64 A;  2L3D A;  2QQB A;  5JFR A;  1YW9 A;  2G7H A;  1JE8 A;  2DBB A;  2RC4 A;  1MDM A;  2OQG A;  1K79 A;  1MJB A;  1DP7 P;  2CO5 A;  1SFU A;  1IUY A;  2COM A;  2W84 A;  1MJA A;  3M9A A;  2FMY A;  4EGZ A;  2FF4 A;  4RAZ A;  1CF7 B;  1XDU A;  5E1X A;  2K27 A;  2V9V A;  3EYY A;  2IT0 A;  2A6E F;  4ENJ A;  3KE2 A;  3BY6 A;  2M87 A;  3CUO A;  4ZYG A;  1Z05 A;  4PCQ A;  2M5W A;  2KKO A;  3HRM A;  1DPU A;  1SD6 A;  5J6X A;  3ZN1 A;  1BC8 C;  1P6R A;  2CSO A;  3LAJ A;  1G6N A;  3WTY C;  3K2Z A;  2HR3 A;  2HTS A;  2EFO A;  5K5Q A;  4M9S A;  3RTR A;  2P8T A;  3CLO A;  3IL2 A;  2FBH A;  4JQF A;  3IRQ A;  5D6E A;  3WGH A;  1G3W A;  2L01 A;  2M1B A;  5FO5 A;  2RV8 A;  1TW3 A;  2KRF A;  2D1H A;  2A69 F;  3ECO A;  2XAQ A;  5HOO A;  4LMY A;  4MTD A;  4G9Y A;  2TDX A;  1AOY A;  1ZAR A;  4HW0 A;  3HSE A;  5CJ9 A;  4ENK A;  2VOD A;  4ZYD A;  1I6X A;  1QZY A;  2EJR A;  4U0V A;  1J0R A;  3I54 A;  4DNC A;  2ZBK A;  1GXP A;  3VB2 A;  1BIB A;  1IXR C;  2M45 A;  2ZNZ A;  1UFM A;  3EET A;  2V79 A;  3PQK A;  1JGS A;  1I27 A;  4Y17 A;  2FA5 A;  1C0W A;  2UZK A;  3V8K A;  3WE3 A;  3F8N A;  1W4M A;  1SMT A;  5HS8 A;  5K1Y A;  1MD0 A;  4IJA A;  2RVC A;  4M9X A;  4RB0 A;  3KEQ A;  2V6C A;  3W6K B;  3KLO A;  1LQ1 A;  4OOI A;  3G3Z A;  2PMU A;  3KET A;  4B09 A;  4GO1 A;  5E20 A;  2GIV A;  5FB2 A;  2LF8 A;  1OYI A;  4L0Z B;  1IF1 A;  2ADU A;  1TLH B;  3RKW A;  2L4A A;  3DKW A;  5ICE A;  5D8L B;  5DD4 A;  3I58 A;  1WQ2 A;  1P92 A;  4KMU X;  5E1Z B;  2X0L A;  4Q48 A;  5ILV A;  2IA2 A;  1SMY F;  3MZY A;  2PFB A;  5A2Q K;  2CFX A;  2RNJ A;  2O61 A;  1L3L A;  3NQO A;  5D8K B;  4UV9 A;  3RI4 A;  1YLF A;  2XAG A;  4LLG F;  5L3D A;  1R23 A;  4YFX F;  5CLS A;  1XD7 A;  2DAO A;  1T2K A;  1G3T A;  1KQ9 A;  4LD5 A;  1RUN A;  2HZT A;  1B9M A;  2P6S A;  2C6Y A;  5EEG A;  1O7F A;  3LQQ A;  5DCM B;  5BS6 A;  1O57 A;  2G9W A;  1XCV A;  3GZ6 A;  1R5G A;  1FP1 D;  4GYG A;  2RDP A;  5ICF A;  5J8C A;  1XB4 A;  2FU4 A;  5E18 F;  5LGN A;  4IHS A;  3QU6 A;  3LAP A;  4G7Z F;  2H6C A;  2VBY A;  2WTE A;  5KVR A;  3QP6 A;  4R79 A;  3GFL A;  5IT3 A;  1HST A;  2P6T A;  2DPU A;  2UXN A;  1BIA A;  1UHM A;  1HKT A;  5ILS A;  3MQ0 A;  2DPD A;  1LB2 A;  1USS A;  4Q4Z F;  1G3Y A;  4LLL A;  3BJA A;  3REO A;  3L7W A;  3JSP A;  2GZW A;  4RB3 C;  1AWC A;  2UXX A;  3CUQ B;  3U2R A;  3R0J A;  1R22 A;  2QZ8 A;  3M8F A;  4Q47 A;  2A61 A;  3V7S A;  4EV0 A;  2VOP A;  1OPC A;  5BPD A;  1BC7 C;  2M30 A;  4ZYE A;  5DDG A;  1LNW A;  4LK1 F;  3V8J A;  2CQK A;  5F1R A;  2CW0 F;  2E7X A;  2OZU A;  2HYF A;  3GUD A;  5F6F A;  5LLQ A;  4NB5 A;  4HDU A;  4HV5 A;  1J9I A;  1B4A A;  1A04 A;  4L9V A;  3C1D A;  2GWR A;  2FRH A;  3IHU A;  2O3F A;  3KLN A;  1YIO A;  4QWQ A;  4RB2 C;  3ML6 A;  3ZP5 A;  3NRV A;  2ZME B;  2CYY A;  1ZG5 A;  1IRG A;  1Z1D A;  4JBA A;  3RKY A;  1FLI A;  2XRN A;  3E6C C;  1F1Z A;  4RGX A;  2FNA A;  2MH9 A;  5ICC A;  1W7P D;  3JSO A;  4B8X A;  1R36 A;  3WG9 A;  2PMH A;  4ENM A;  5H6Q A;  2K02 A;  1OMI A;  1I1G A;  1WI9 A;  3JTH A;  2H09 A;  3GEZ A;  5CVU A;  1SD7 A;  3WGG A;  5LGT A;  5D6F A;  4EJV A;  3QPH A;  4LFU A;  1PP7 U;  3LA2 A;  5DCF A;  3RYR A;  5LEK A;  1O3S A;  3RDI A;  1SD5 A;  3V7C A;  4KIB A;  4G6Q A;  4HF1 A;  4MHG A;  1DUX C;  4N9I A;  5ED4 A;  2QUF A;  1E17 A;  5FD6 A;  3FMQ A;  1UHW A;  1QZZ A;  3ZQ7 A;  2LSO A;  1ZGA A;  4I7H A;  3VOD A;  4EJO A;  3ULQ B;  4WF2 A;  2IJL A;  1XGO A;  2HGC A;  4KYW A;  2HTJ A;  2DLL A;  2ZFW A;  1K7A A;  3MZH A;  2WC2 A;  5D5X B;  2BEO A;  2F5E A;  1OKR A;  5BOX A;  3H3U A;  1S7O A;  3N97 A;  4KIF A;  4UV8 A;  2ESN A;  1HQC A;  2B0L A;  4EJW A;  3GO5 A;  1Z7U A;  3L2C A;  3LA7 A;  2D2W A;  5E17 F;  1T98 A;  1EH6 A;  3CDH A;  4EQQ A;  2FSW A;  1SD4 A;  1XSV A;  2X4H A;  3MAJ A;  4U7B A;  2KJC A;  2F5D A;  1CGP A;  5E1W A;  4G7O F;  1IAW A;  5IT9 Z;  2VN2 A;  4E70 A;  4XLP F;  3ZN0 A;  4G8X A;  2W85 A;  3F8B A;  1KYZ A;  1ONV A;  1T39 A;  3BOQ A;  2DFI A;  1R7J A;  1O3Q A;  4CDG A;  4IRH A;  2OD5 A;  2Z5U A;  2K4B A;  1IN7 A;  2E7W A;  4LG0 B;  1DPR A;  1OR7 A;  2PLY A;  4RGU A;  3ISP A;  3J81 Z;  2QQ9 A;  1FC3 A;  3J81 K;  4A6D A;  1STZ A;  5BMZ A;  4U7D A;  4Y13 A;  5D4S A;  5ICG A;  3RYP A;  2PJP A;  4IVN A;  1S3J A;  1MDM B;  2ZNY A;  2EA2 A;  3WTW C;  4I0A A;  5FGM A;  2G7U A;  3HSR A;  6PAX A;  1P2F A;  2RN7 A;  2QYO A;  2VON A;  2L54 A;  3ERE D;  3CTA A;  2W57 A;  1D8K A;  3ZMD A;  4G6D A;  2IW5 A;  3Q5F A;  3E6B A;  4IRG A;  4I02 A;  1TNS A;  1REP C;  1U5T A;  3M1E A;  1HW5 A;  3EDP A;  4EMS A;  3DEU A;  4L9N A;  2ZJ2 A;  1LDJ A;  2PQ8 A;  4P9U A;  2EFN A;  1X3U A;  4UHT A;  3S2W A;  3BP8 A;  3FX3 A;  4UNO A;  3WU0 A;  5FLX Z;  4GYI A;  3DV8 A;  3HUG A;  4P5O A;  3LQR A;  1K6O A;  5JI6 A;  1TBX A;  3TGN A;  1BM9 A;  4CXF A;  4PZJ A;  3SXY A;  3RKX A;  1ZG1 A;  1ON2 A;  4U0W A;  4ESJ A;  2KIF A;  1B6A A;  5DEQ A;  5LRR A;  2PI0 A;  3F23 A;  4LJZ F;  3HOT A;  3ZPL A;  4P96 A;  4HLY A;  3WTV C;  3KFW X;  2QEN A;  1T6S A;  2Y0M A;  2VE8 A;  3GFJ A;  3R61 A;  2A5Y B;  2EFP A;  4O6J A;  5HVQ C;  3F22 A;  1S8N A;  4KNY A;  1KU2 A;  3IWZ A;  2HKX A;  2YX7 A;  1KGS A;  1U3E M;  3I71 A;  2Y48 A;  1WRJ A;  1ULY A;  4A6E A;  2LDU A;  3CUQ C;  3WU1 B;  2OZ6 A;  5TRD A;  1XSD A;  4WX9 A;  3I4P A;  1V3F A;  3T1B A;  4WK8 F;  1DDN A;  1IXS B;  2HQR A;  2FEZ A;  2STW A;  2O6G E;  3J80 Z;  3K69 A;  3HTU A;  3LST A;  2RGV A;  3WTU C;  4WXH A;  4ASN A;  4L0Y B;  1XGM A;  3JW4 A;  1P4A A;  2JPB A;  1RI7 A;  2FML A;  3ELK A;  4M73 A;  1G3S A;  2ZCW A;  3FXU A;  3KP7 A;  1YYV A;  4FHT A;  3P9K A;  2XAJ A;  2PG4 A;  2H27 A;  1PDN C;  4WWC A;  1GVJ A;  5HS7 A;  3GX4 X;  3KP6 A;  2ZO4 A;  1ZRD A;  1UST A;  4M6X A;  3ZMS A;  2YSR A;  1FSH A;  3GW2 A;  1SAX A;  3F6O A;  1E2X A;  3RIR A;  4MGR A;  3MWM A;  2XV4 S;  1QQI A;  1BJA A;  3U9G A;  1B59 A;  2O03 A;  5AON A;  2DK5 A;  3KP4 A;  1ZG3 A;  2IA1 A;  1D3Y A;  1F9N A;  1FBU A;  1YS6 A;  3KP2 A;  3F8M A;  3FXQ A;  2HWV A;  5HLG A;  3GXO A;  2YPR A;  3P9C A;  3QPT A;  1Y0U A;  2WWY A;  4YG2 F;  3QRF F;  5ILU A;  1YS7 A;  5CVV A;  1XGS A;  4M6Y A;  3B02 A;  2ETH A;  5AIP A;  1BBY A;  4XRF A;  3IWF A;  3GYH X;  2DO7 A;  3ZMV A;  2QBY A;  3R6S A;  1VTN C;  2GA2 A;  2ISZ A;  1J59 A;  3R60 A;  1YTY A;  1T38 A;  1TNT A;  4KUM A;  1J2X A;  3DPT A;  4LB5 A;  2FNP A;  2BE5 F;  2D45 A;  2STT A;  3M8E A;  5LHH A;  5K5R A;  4A5N A;  4ZZD A;  1S7A A;  1Z6R A;  2Q2E A;  3W6J B;  4MNU A;  1LEB A;  5CVI A;  3GF2 A;  3Q9S A;  2E1C A;  1ZHF A;  2VT2 A;  4ETS A;  2XAF A;  3T0Y A;  5KK1 A;  4XSZ F;  4A0Z A;  2IA0 A;  3KCC A;  4AD9 A;  3TOB A;  1XN7 A;  3ZMU A;  2BGC A;  2NYX A;  2A07 F;  4UVA A;  1Q1H A;  3DP7 A;  1W7P A;  4HX8 A;  4L18 B;  4NHJ A;  3WE2 A;  1K78 A;  3GVA A;  1YFH A;  3O6B B;  3L09 A;  2JSC A;  1ZRF A;  1KA8 A;  1RIO H;  2IPQ X;  2HQN A;  5HDN A;  3O2P E;  1LJ9 A;  2Q0O A;  3H3Z A;  2EV5 A;  2XKO A;  3JAM Z;  2XGX A;  3QP5 A;  2JTV A;  4HAM A;  2D1V A;  4RAY A;  4U88 A;  1ZLK A;  4HBL A;  1XSX A;  2JZY A;  1FYL A;  3F21 A;  1WSU A;  3E97 A;  1FBQ A;  2WV0 A;  2IVM A;  3GZ5 A;  2KJB A;  4U0Y A;  1HW1 A;  5HS9 A;  4EGY A;  2A68 F;  3KEO A;  2EA4 A;  3P7N A;  4HV6 A;  1SFX A;  3ROU A;  4BHP A;  3SQN A;  1FYM A;  3RPQ A;  5FFZ A;  2HEO A;  3KZY A;  1P4X A;  1D5V A;  1LEA A;  3D0S A;  1ZYR F;  3K0L A;  2MD5 A;  2MBF A;  1F4K A;  3VEP A;  3BWG A;  4RS8 A;  4ZZL A;  3ECH A;  3EYI A;  2YU3 A;  2R3S A;  2VBW A;  3FMS A;  4AWX B;  4ESB A;  5D4R A;  2DW4 A;  4LK0 F;  3R4K A;  4S05 A;  3FWE A;  2HDC A;  2YR2 A;  2NRA C;  3FM3 A;  2DK8 A;  3F72 A;  4N0B A;  4AIK A;  2YX4 A;  1V4R A;  3FM5 A;  2FBI A;  1HBX G;  2GA1 A;  4M74 A;  1U8R A;  1O3T A;  3BRO A;  2XIG A;  4ZYH A;  2ZXJ A;  4CHU A;  1FBS A;  3WTX C;  1YQA A;  3RJP A;  3HOS A;  1FPQ A;  2BYV E;  5HLH A;  1XDS A;  1BI2 A;  2JT1 A;  2FBK A;  4MQ9 F;  5FD5 A;  3CJN A;  4FX0 A;  3E5Q A;  1T0F A;  3I59 A;  4BYY A;  2MC3 A;  2O0Y A;  1O3R A;  2MLK A;  3U1D A;  3HRS A;  1SFE A;  4BAY A;  1GXQ A;  2P5K A;  4KIC A;  3IKT A;  5JVT A;  4KA4 A;  5IT9 K;  4I98 B;  4RB1 A;  1D8J A;  3TOA A;  1B9N A;  1H9G A;  4Q5S F;  4KMF A;  2NS0 A;  2HS5 A;  3EQL F;  2ISY A;  2VBX A;  1J5Y A;  1ZRE A;  5HDK A;  5F64 A;  3DF8 A;  1ZGJ A;  2RKH A;  1TW2 A;  4D0P A;  2P5V A;  1S29 A;  1S6L A;  1IN6 A;  2R7D A;  1ZRC A;  2MA3 A;  3SZT A;  2VBZ A;  1ZLJ A;  3K1P A;  1J75 A;  4YFK F;  3M7G A;  4EM0 B;  1ZN2 A;  1U5T B;  1Z6T A;  1MKM A;  4L9T A;  4LLN A;  2A6H F;  4CGZ A;  2HFH A;  1QPM A;  4A5M A;  5LBQ A;  4YII A;  3NEU A;  3IKV A;  4UVC A;  4HQE A;  5L3B A;  4YFN F;  1JHF A;  2CG4 A;  1R1T A;  1MZB A;  5D5W B;  2W24 A;  3RPU A;  5JHU A;  2QWW A;  1YW7 A;  2Z9O A;  2FOK A;  2L02 A;  4CO8 A;  5LEJ A;  3BJO A;  3WOD F;  1BI0 A;  2ESH A;  5CVR A;  1IN8 A;  5K5O A;  1UB9 A;  4M71 A;  4A0Y A;  4KFC A;  5FLX K;  3E5X A;  4M9Z A;  2EWN A;  2XAS A;  5DUK A;  3FMR A;  3GFI A;  1F5T A;  1BOA A;  3L00 A;  1FZP B;  1O7L A;  4OIN F;  1P4W A;  4XSX F;  4MQV A;  3EUH A;  3GLX A;  1TTY A;  4OMZ A;  5L3G A;  4OIQ F;  4S04 A;  5L3E A;  3WTZ A;  3LA3 A;  4HQM A;  4KN7 X;  4I2O A;  1RZ4 A;  2RQP A;  3TO7 A;  3E5U A;  2Q8K A;  2L4M A;  1FT9 A;  3OV8 A;  4EJT A;  2GXB A;  2LF7 A;  1CF7 A;  1G4D A;  2ZKZ A;  2H6B A;  5HDG A;  3GFM A;  4O5V A;  3N4M A;  3F8F A;  5LRS A;  2J5O A;  4P9F A;  4I01 A;  4YIF A;  2MH2 A;  5D5U B;  1ZH5 A;  3FXR A;  3R0A A;  2P4W A;  1R58 A;  2VC0 A;  1I1S A;  3ABT A;  2IRF G;  5L3C A;  2LKP A;  2K86 A;  2XVC A;  3J80 K;  3D5L A;  3HYI A;  1HW2 A;  3E3V A;  3PQJ A;  3K1N A;  3O3K A;  1LVA A;  2GAU A;  2PBI A;  3MFK A;  2K7L A;  1IW7 F;  3KZZ A;  1XCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...