4HF1A

Crystal structure of iscr bound to its promoter
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
129
Chain Sequence
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDESVDALTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSGRQHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords HTH-type transcriptional regulator IscR
publication title Studies of IscR reveal a unique mechanism for metal-dependent regulation of DNA binding specificity.
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 129
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hf1A00
5ILVA 2Z9OA 5HLGA 3KP7A 3TO9A 3EETA 1MZBA 4ZYHA 2ZKZA 3GYHX 4EJWA 3L2CA 1R58A 3FF5A 4QLCU 5D4SA 3TO7A 3REOA 2QQAA 5K5RA 5JFRA 2JPBA 2EV0A 4A0YA 5L3EA 4EJVA 1WKMA 2HDCA 2CQKA 1H9GA 1GVJA 2IP2A 2MA3A 1BIBA 2EB7A 4KIFA 4IRHA 2ZNYA 3R6SA 2M1BA 3BROA 5IT9K 2W57A 4AWXB 3IRQA 5FLXK 1V4RA 4I2OA 4Q47A 1J0RA 4GCVA 3O2PE 3I71A 2XAHA 3Q9VA 4GGGA 2DK8A 4WXCA 5CVJA 2QUFA 3WODF 4PGHA 3WTWC 3QAHA 1I1GA 3HTUA 3CO6C 4MNUA 4CZZA 3DPLC 3NEUA 1D8KA 4XBFA 4S05A 4K2EA 1PP8F 4ETSA 5DCMA 2HR3A 4BXUA 1F5TA 1BM9A 1DUXC 2O8XA 4CDGA 4B8XA 2LSOA 1U3EM 5HVQC 2STTA 5FB2A 2EA2A 1DDNA 1WWXA 4Y15A 2G7HA 1Q1HA 3P9CA 5ILUA 1FNNA 1S29A 5ICGA 1ODDA 2H09A 2YX7A 1U5TA 2NRAC 2EFOA 1BI0A 5D6EA 1G3YA 4M72A 4MQVA 1TQMA 4Q48A 3GZ6A 3KEQA 3ZMVA 3DP7A 1HSTA 2K02A 5ICEA 2BGCA 2M87A 3KP3A 2DPDA 1STZA 1K78A 4ESBA 3GO5A 2ZNZA 4EVIA 4HLYA 3W6KB 1KA8A 1CF7A 1HW2A 1ZGAA 5ICFA 1UCRA 3TQNA 3B73A 4UVAA 2DQLA 1ON1A 1FYLA 1ULYA 1S7AA 4EGZA 2QZ8A 2M5WA 1XGOA 2LF7A 4A5NA 1KU2A 1IN8A 2PN6A 3BJOA 3CUQB 5HLIA 5DDGA 2DW4A 4LG0B 1BIAA 3BJ6A 2ISYA 4HV5A 2KIFA 1ZG1A 1W5SA 3F22A 2JPCA 2KRFA 6PAXA 1BI2A 3F8FA 3TGNA 3ZMUA 2O03A 1V3FA 3MQ0A 5FD5A 1GHCA 1R00A 4I09A 3SQNA 3BPVA 1FP2A 2IW5A 1Z6RA 5L3GA 1T98A 4L18B 1I1SA 4U7BA 1NHAA 3ABTA 4ASNA 2STWA 4IHSA 1AOYA 4NB5A 5HS7A 3U9GA 3ECOA 4ESFA 4UXNA 1L0OC 3WE2A 4ZZDA 3HIFA 1I27A 3JAMZ 1IW7F 1SAXA 1FT9A 3BZ6A 4ZZLA 3M1EA 3VB2A 2QYOA 2PFBA 5HOOA 1XMKA 4L0ZB 1YS6A 3ABUA 3ZPLA 4NHJA 4BHCA 5D5UB 1X3UA 4KUMA 1HKTA 1IN4A 1R1TA 4RB0A 5D5VB 3I58A 1U5TB 2EV5A 2HZTA 3I53A 1D8JA 3QPHA 2H94A 2IA2A 1REPC 3L00A 5H6RA 3KP6A 3BDDA 5FGMA 5HS9A 4EGYA 3F8NA 1ZAOA 3H92A 5E8GA 3F6OA 4DQ2A 4Q4ZF 2VBXA 1K78B 4RGXA 1FP1D 1MJBA 1GXPA 2CGPA 2L3DA 3L09A 4ENMA 4M73A 1USTA 3DPTA 4M6XA 2RN7A 5JI6A 1QNTA 1XCVA 2WV0A 1R5GA 1HW1A 1ZH5A 2GAUA 1ZG3A 1TLHB 5DD8A 3R60A 1D5VA 2HEOA 4LK1F 1XD7A 2A5YB 3LA2A 3C1DA 2RNJA 4RB3C 3V4GA 4H0EA 2KJBA 4AIJA 3L7WA 3ZN0A 1YW7A 1YS7A 4IPAA 2Q2EA 2XROA 1ON2A 3K1NA 2EFPA 4OU0A 1P4XA 2FBKA 4RGRA 1Z91A 3VOEA 3JTGA 4LB5A 1DPUA 1QPMA 4CO8A 3ZQ7A 1BC8C 2BE5F 5LHGA 3HYIA 2UXNA 2A61A 3I59B 3IC7A 5L3DA 1G3TA 4FX0A 2G7UA 3LFKA 4G6QA 3TKYA 2XVCA 1HSJA 3JAMK 3IKVA 3KEOA 1IUYA 2D2WA 2V1XA 4PCQA 2VT3A 2VT2A 4P9FA 1W7PD 3WG9A 5K5OA 2FNAA 3KFWX 2BV6A 5EEGA 5LEKA 1R36A 1S6LA 4HOBA 3K69A 2F2EA 1Z1DA 3BP8A 1OYWA 4ON0A 2HQRA 3HHHA 3C3WA 1YO5C 2V1DA 3C18A 3TOAA 3FZVA 3P9KA 3QU6A 3GLXA 4L9NA 2DTRA 2D1VA 2FOKA 2V1UA 3ZN1A 4O3MA 3WTUC 1O3QA 5ED4A 3LSTA 2Z5UA 4B09A 1FYMA 1JXSA 3ZP5A 5LEJA 1A04A 2RVCA 5D5WB 1RUNA 4P9UA 5FLXZ 1O7LA 2OZUA 3BOQA 1XGNA 5BPIA 3FMQA 1FYKA 3AAFA 1E2XA 3KP4A 3N4MA 4IRGA 1ZRCA 2W24A 4HZFA 2A07F 3MAJA 5BMZA 3IRRA 2OQGA 1O57A 5TJJA 1P4WA 1IN5A 1YLFA 1SMYF 3MWMA 2ZMEA 2L4AA 2GIVA 3FM3A 4RAYA 5AIQA 2PMUA 1Z7UA 4M71A 2ADUA 4LJZF 1XB4A 1SD5A 4LFUA 2Y48A 4HDVA 5KVRA 1OMIA 2BBYA 2QLZA 3HRTA 1FSEA 5DCFA 3RYRA 4A6DA 3E6CC 2CG4A 3BY6A 3KLOA 4JK1X 1XSDA 3F8CA 4L9JA 1T2KA 1LEBA 2W85A 2VE8A 3MZHA 2Y0MA 4HYEA 3R61A 2HYFA 2A6EF 4I98B 2BYVE 3FHZA 2FEZA 3L9FA 2HFHA 1KU3A 4G9YA 4M74A 2O3FA 3KETA 4P5OA 2JSCA 4ZH4F 2V9VA 1QQIA 2FU4A 2VONA 1O3SA 2VBZA 1HW5A 2M30A 1D3YA 2K7LA 3FXUA 1ZREA 2IJLA 2ELHA 1HBXG 5J8CA 1B6AA 2IVMA 4L9VA 4F7ZA 3T0YA 2LNBA 3LA7A 5LHHA 4AVPA 3T5XA 2XKPA 2IRFG 3LQRA 4ZYGA 3GFJA 1PP7U 1B1BA 1W5TA 2NAZA 2QVOA 3CUQC 1FZPB 3F23A 1U2WA 4XSZF 3V8LA 3QPTA 4UNOA 5CYVA 1FLIA 4BHPA 1G3WA 5DYMA 1FC3A 1BOAA 2R7DA 3LA3A 1Z05A 2H6BA 1ZHFA 2ESNA 4KMUX 1E17A 4G6DA 2B0LA 2PQ8A 1PDNC 2P6SA 2XV4S 1MGTA 2FMLA 5CVRA 2LF8A 3WTXC 4U0VA 2F5EA 3HRUA 4IHTA 3J81K 4YFNF 3G73A 3LAPA 1FBQA 2VODA 1KYZA 4L5JA 2D1HA 3LWFA 1J9IA 4PZJA 2FA5A 5AIPA 3OOPA 4UVBA 1IXRC 4WCGA 4OIOF 2RV8A 5DEQA 2HOEA 5LLQA 4G7HF 1OYIA 2F5FA 1UFMA 4R79A 2FE3A 2BEOA 2OU2A 2EV6A 4Z2YA 1USSA 4HQMA 2UWMA 3GFLA 5JHUA 2HQNA 2HGCA 3V8JA 3WTSC 2GXBA 3CJNA 1MD0A 2DO7A 1G3SA 2MH9A 1HQCA 2DAOA 2YSRA 4RGSA 2PJPA 1IZ1A 2OA4A 4BHBA 2O61A 4AD9A 3H3ZA 2M45A 4O6JA 3DV8A 2RKHA 5CLSA 2KIMA 4I0BA 1W7PA 4XRFA 5L3CA 3F3XA 1IRGA 2XAFA 3VEPA 2VE9A 1DPRA 2WWYA 4ZYDA 4HAMA 3Q9SA 5LGTA 3QRFF 3N97A 2ISZA 1K6OA 3R0JA 3KZZA 1TBXA 3O3KA 2PLYA 4G94A 1TQPA 2ESHA 3H3UA 2ZBKA 2MC3A 4M9SA 3BPXA 5F6FA 1LB2A 3M9AA 3EQLF 1O7FA 2P7CB 1F1ZA 2RQPA 3GW2A 3K0LA 5AONA 1G6NA 4RGUA 4OIPF 5LRRA 4IVNA 2MBFA 2E1NA 1B59A 3GEZA 5DCMB 4EJUA 4KFCA 3GFIA 4MHGA 1ONVA 5BOXA 2QM3A 2DQRA 2QQBA 4S04A 2GZWA 2J5OA 4I0AA 1BI1A 1XSXA 4KNYA 3MEXA 5E8IA 1IXCA 3GFMA 3HHGA 3K9TA 1QGPA 3PQJA 2GA2A 3NQOA 4U0WA 1FWZA 2VOOA 1EV7A 1LDKB 1T0FA 5D8KB 2NNYA 3COAC 1XDUA 4U7DA 4I7HA 1MDMA 3RJPA 2VBYA 2PEXA 5E18F 2JTVA 4WXHA 1C0WA 2L01A 2KIUA 4XLPF 5HDGA 5EEHA 1CF7B 2KJCA 2MD5A 4RB1A 4HX7A 5LHIA 2XIGA 2K4JA 2Y75A 2YPRA 3E6DA 1QO0D 2ZFWA 2YR2A 3LQQA 2QQ9A 5FFXA 1HXDA 2E1CA 2P4WA 2JRTA 3S2WA 4LGWA 1BI3A 2P5VA 4R1HA 4HF1A 4XLNF 3QP5A 5LRSA 4UV9A 3GXOA 3TOBA 4UVCA 4G7ZF 5BS6A 2VOPA 4HF2A 1J5YA 4GYGA 3RYPA 5HS8A 4U88A 4CICA 3CTAA 4MTDA 2QBYA 4KICA 2YU3A 3F21A 1YW8A 3EYIA 1HKQA 2XAQA 4OIQF 1BC7C 5BQTA 2OBPA 1KQ0A 1XGSA 5DUKA 4NQWA 2O6GE 1XDSA 4I01A 2ETHA 4N9HA 4ENJA 4D0PA 4BAYA 3IL2A 5ERIA 1TNSA 3FMSA 3SXYA 3V8KA 1YIOA 4LLGF 4L0YB 4IJAA 4CGZA 4LB6B 3TDUC 5FO5A 1YG2A 2JT1A 4IXAA 3IKTA 3JTHA 2PBIA 3R4KA 4ZYEA 3U2RA 1Z9CA 4AIKA 3KP5A 1U8RA 2PMHA 3F8BA 3JSPA 3SZPA 3WTTC 3EUHA 4FX4A 2L02A 3I5UA 1LDDA 4PGGA 1QZZA 3RIRA 5A2QZ 2JZYA 4KIGA 2HYGD 1LNWA 4OMZA 1SFEA 5D8LB 1TW3A 3T1BA 2FF4A 1SFUA 3PFIA 4OIRF 1QZYA 2P5LC 2XGXA 1S7OA 5E20A 3ULQB 3I54A 3G3ZA 1RUOA 3ISPA 5E1ZB 2RC4A 1EH7A 1IN7A 3K1PA 1FSHA 2GXGA 4MGRA 1I6XA 3ELKA 4L5IA 5D4RA 2XHKA 3GVAA 2FQ3A 1JHHA 4A0XA 4JBAA 5CVVA 2ZO4A 2DK5A 3GZ5A 3MFKA 5FFZA 4L9TA 2OAZA 2CO5A 1YYVA 4QWQA 4WX9A 3D5LA 3ML6A 1J2XA 5ICCA 3FM5A 3WE3A 2RGVA 4YIFA 3RPUA 5HLHA 2R7FA 1TNTA 1H0MA 3E5QA 3HSFA 4HX4A 1K7AA 2UXXA 3J81Z 2F5CA 4RS8A 3HOSA 3CLOA 2EA4A 2G9WA 1T38A 4UUVA 1S8NA 4LK0F 2FBIA 3RKYA 1YTYA 2RDPA 1ZLJA 3JSOA 3M8FA 2XAGA 1OKRA 3E5XA 4KN7X 1R5HA 4A12A 4CXFA 2MLGA 1FBUA 3GUDA 2W84A 3E6MA 2FMYA 5F64A 4MTEA 4LMYA 4I02A 3QU3A 2CYYA 3J7AO 3WU0A 3WGHA 1FY7A 1RI7A 2NYXA 4HDUA 1IRFA 1MKMA 4YFKF 4O5VA 1SD7A 1RNLA 2L4MA 2XUBA 1FX7A 1MJAA 4KIBA 4DNCA 3FWEA 1ZARA 4GYIA 4EJOA 5A2QK 2DI3A 3EDPA 4Q5SF 5LGNA 3SHFA 2Q0OA 3MZYA 1HKSA 1LVAA 5E1WA 2PI0A 2L54A 4BYYA 3HOTA 3C7JA 3J80Z 2A69F 3I0TA 3VFZA 1UHWA 4ENKA 2H27A 1I5ZA 2ZJ2A 5CVIA 4N0BA 1XCBA 3CUQA 2OZ6A 1BJAA 1P4AA 1T6SA 4LG0A 3M7GA 5K5QA 1KU7A 1XSVA 3ZMSA 4U0YA 3DKWA 3DFGA 2NS0A 1SFXA 4WF2A 2P8TA 1IAWA 1IF1A 1R22A 3F6VA 4HV6A 4Y13A 4P96A 1ZRFA 3ZMDA 3KCCA 5L3BA 5J6XA 1B9MA 4LD5A 1YQAA 3KZYA 1R1UA 5CVUA 1T39A 3WGIA 4RAZA 2ZMEB 5LGUA 1Y0UA 3GWZA 2ACJA 2DLLA 2FBHA 3O6BB 1ZRDA 1OR7A 4HQEA 2AS5F 2YX4A 4KMFA 3IHUA 2A3SA 1UB9A 2VBWA 1XGMA 3WTYC 1Z6TA 1K79A 1BBYA 4M9XA 4HLXA 3R0AA 2HTJA 3RI4A 4KYWA 1U5TC 3K1MA 3WTZA 3QOPA 1RZ4A 1SD4A 5L3FA 2MLKA 1G4DA 1B4AA 2FRHA 4A5MA 4E70A 4WWCA 4EJTA 2P6TA 3B02A 3PQKA 2COMA 2OD5A 4P55A 4WK8F 2DU9A 4ESJA 3ERED 3DF8A 3CDHA 5FD6A 4MEXF 1KYWA 1LQ1A 2AXLA 3TDZC 2MH2A 2E7XA 5JVTA 2Z99A 3CUOA 1O3TA 3KE2A 2TDXA 3E3VA 1KGSA 2HS5A 3FXRA 1ZGJA 1TQIA 3J80K 2FXAA 3E97A 5BPDA 1W4MA 2IA1A 3M8EA 2HWVA 1J75A 3GX4X 1R23A 5KK1A 5H20A 1P2FA 2VC1A 3FMRA 4EM2A 1IN6A 2LKPA 2FSWA 3BJAA 2DBBA 3DEUA 3HSRA 4FT8A 3KP2A 4PDKA 1JGSA 1PUEE 4KT5C 2CWEA 2IPQX 4BQAA 3FXQA 2UZKA 4KA4A 2X4HA 3V7SA 5D5XB 4MEYF 3BWGA 1CGPA 2DFIA 3I59A 3FX3A 1O3RA 4G8XA 4YG2F 3IWZA 3P7NA 2M8EA 4CYDA 4A6EA 3WTVC 1LEAA 2XKOA 4FHTA 4LLLA 3ROUA 1SD6A 1MJ9A 1SMTA 4R8HA 3SFZA 2K27A 1AWCA 3RDIA 2ZCWA 1OPCA 1S3JA 3RTRA 4HX8A 4G7OF 2XRNA 1R7JA 5E17F 3D0SA 3JW4A 1XMAA 2A6HF 3MCZA 4YIIA 2EJRA 4KN4X 3ZMTA 2EFQA 2DT5A 2CW0F 1JHFA 3KLNA 3HRMA 3U1DA 2HTSA 2QWWA 2PG4A 2IT0A 3K2ZA 1U78A 2IA0A 5CJ9A 3T8RA 3QP6A 2GWRA 2Z33A 5F1RA 1J59A 4A2UA 1W7PB 1QBJA 2J5PA 4OINF 1ZYRF 3I64A 3IWFA 3VODA 1YW9A 2D45A 1YFHA 4A0ZA 5JR3A 4ENNA 4HA8A 5J8FA 3GF2A 3ZMZA 2OQRA 4BH9A 2Z3YA 3OV8A 3V7CA 1OYYA 4Y17A 1WSUA 3T8TA 4M6YA 4WXDA 4N9IA 3SZTA 3HTSB 4HF0A 4EV0A 4IRIA 1UHMA 2QENA 4EM1A 3CO7C 1J7KA 1LDJA 2ZXJA 4MQ9F 4HW0A 5H6QA 3ECHA 5DUIA 1DP7P 2HKXA 2V6CA 4KDPA 3NRVA 2HKOA 1GXQA 2VXZA 1WI9A 3RKWA 3WGGA 2LDUA 5IT3A 5ILSA 4EQQA 2O0YA 1P6RA 3W6JB 3TO6A 2EWNA 4UHTA 4YFXF 1MDMB 5D6FA 3RKXA 4JQFA 4BNCA 4GO1A 1F4KA 2KKOA 3DQVC 1VTNC 1BN5A 2E7WA 2EFNA 3DXJF 4RB2C 4IF4A 2H6CA 2VN2A 2P7VB 2WC2A 1EH6A 2R3SA 2NNNA 2WTEA 1B9NA 3V7RA 4GXOA 4M9ZA 5IT9Z 2DPUA 1L3LA 1WRJA 4EMSA 2Q8KA 1FOKA 3WU1B 2K86A 3F8MA 2VC0A 3RPQA 4AIHA 4CHUA 4TV7A 2GA1A 2W25A 1H9TA 3HSEA 2XAJA 1R1VA 1KQ9A 3LAJA 1ZN2A 3HUGA 3Q5FA 2FNPA 4EM0B 4UV8A 1ZLKA 5HDNA 1RIOH 2V79A 3P9IA 2EFWA 4OMYA 1KQ8A 2CFXA 2QBYB 4OOIA 1KU9A 1TW2A 5DV5A 5DD4A 1LJ9A 2EK5A 1ZG5A 5K1YA 2K4BA 2F5DA 1TTYA 2CSOA 5TRDA 2GQQA 1IXSB 3HRSA 2X0LA 3F72A 1P92A 1F9NA 3E5UA 1FPQA 4XSXF 1EH8A 5LBQA 3I4PA 4LLNA 2C6YA 5HDKA 1U6GA 3EYYA 4HBLA 1JE8A 3E6BA 1WQ2A 2XASA 1XN7A 2A68F 1FBSA 2P5KA 5E1XA
chains in the Genus database with same CATH superfamily
5ILVA 2Z9OA 5HLGA 3KP7A 3TO9A 3EETA 5M5WJ 4C2UA 3GBGA 1MZBA 4JX6A 1D1CA 4ZYHA 2ZKZA 3FXJA 3GYHX 2JQ7A 4EJWA 3L2CA 1R58A 2OF7A 3FF5A 3DEEA 5D4SA 5EZHA 4M3BA 3TO7A 4QLCU 1TZLA 3REOA 2QQAA 5K5RA 2BHZA 2HOAA 3A4CA 4DBRA 5JFRA 2JPBA 2O7OA 2X51A 2EV0A 4A0YA 5L3EA 1WVRA 4EJVA 1WKMA 1H8AC 1ZTRA 3OS1A 2E35A 2HDCA 2CQKA 1H9GA 1GVJA 2IP2A 2P81A 2WAFA 3QPSA 2MA3A 2VPLA 1BIBA 1OFCX 4XRSG 2EB7A 4XQFA 1D0YA 4KIFA 2Z16A 4IRHA 2ZNYA 3R6SA 3SZGA 4CSWA 2AQFA 2M1BA 2QF7A 3BROA 5IT9K 2W57A 4E7IA 2K3FA 4AWXB 1WGXA 3IRQA 5FLXK 1V4RA 1X4OA 4I2OA 2OPTA 4E6KG 2CJJA 4Q47A 4BJTA 5FKOA 1HF0A 1J0RA 4GCVA 3O8GA 4BKXA 3O2PE 3QOEA 3I71A 2XAHA 3Q9VA 4GGGA 3S93A 2DK8A 3K4JA 4WXCA 2LVSA 3MD2A 5CVJA 2QUFA 3WODF 4PGHA 2LBFA 3WTWC 3QAHA 3KYLA 1FTTA 1VI0A 1I1GA 4M6VA 1WJFA 2NS7A 2E1OA 3SEQA 2L7ZA 4F92B 3DBHB 3QYEA 2CV1A 4RA2A 4RDUA 4XLAA 2LFBA 1VQLI 2AXTC 3HTUA 3CO6C 4MNUA 4A69C 4CZZA 4I76A 3TMOA 3DPLC 3NEUA 1D8KA 4XBFA 5E3OA 4S05A 4K2EA 1N25A 3H0DA 1PP8F 1ERDA 4ETSA 4XMYA 4JOMA 5DCMA 5C3EJ 2HR3A 1N78A 4BXUA 2BVMA 1BM9A 2IAIA 1F5TA 1X3ZB 2W7NA 1DUXC 3SFIA 2BXYA 2QA4I 3K4KA 2O8XA 3K70C 4CDGA 2WAEA 4B8XA 2LSOA 1U3EM 5HVQC 3FBIB 4XKVA 2STTA 4CA0A 5FB2A 4BXFA 2DFHA 2EA2A 1DDNA 1WWXA 4Y15A 4AC0A 2G7HA 5HODA 1Q1HA 3P9CA 1G59A 3AG2H 3HOWJ 5ILUA 1FNNA 1S29A 1X1PA 5ICGA 1ODDA 2H09A 3OR2C 2YX7A 2CFOA 3FIWA 1AKHB 5KAFC 2E2HJ 1A6QA 3LSMA 4FISA 1U5TA 3VYTB 2NRAC 2NOJB 1CQTA 2ME6A 3OOUA 3QQAA 3PIPF 2EFOA 4PSXA 1BI0A 3OSGA 2HXOA 5D6EA 1G3YA 4LIUA 3EPZA 1E3PA 4M72A 4MQVA 1TQMA 1MW7A 4UUSB 4Q48A 1LFPA 3GZ6A 3KEQA 3ZMVA 1ZELA 2GOXB 3CCQI 3DP7A 3I4MJ 1HSTA 3QYFA 4NNJA 2K02A 1T33A 5ICEA 2BGCA 1Y1WJ 2M87A 3KP3A 4Y4RA 5HLTA 2DPDA 1STZA 1K78A 1WJ5A 4ESBA 2R7ZJ 3L2WA 3IUOA 4G6TB 4CH7A 1XC5A 1YOVB 3GO5A 2ZNZA 3DKYA 5FROA 4EVIA 4HLYA 1FOXA 3W6KB 2DJNA 1M1EB 4FASD 1KA8A 1CF7A 1HW2A 3LSRA 1ZGAA 5ICFA 2OCCH 1ZQ3P 2VJ4A 1UCRA 3TQNA 3B73A 4UVAA 2XF6A 5E79C 4A3KJ 1VQNI 2DQLA 1ON1A 2IEKA 3H36A 3PIOF 4A3BJ 1FYLA 1X1DA 1ULYA 1LUJB 1YHQI 1A35A 1S7AA 3QWLA 4EGZA 4BQOA 2QZ8A 2M5WA 1XGOA 4BEHA 4QTRA 2LF7A 5GTHC 4A5NA 3OY9A 1KU2A 4BY7J 1IN8A 3JRCA 3S1MJ 4HPQA 3ZRGA 2CQXA 1IRZA 2PN6A 3BJOA 2DA6A 3CUQB 1U9NA 2F4OB 5HLIA 3CD6I 5DDGA 2DW4A 4LG0B 1BIAA 3BJ6A 2ISYA 4HV5A 2KIFA 1HLVA 3E7LA 1WFXA 1ZG1A 1Z3XA 1W5SA 3F22A 2JPCA 2KRFA 6PAXA 4DYQA 2AHQA 1BI2A 2WB1N 3F8FA 1DU6A 3IH4A 1BOBA 2DOAA 3TGNA 3ZMUA 2VUMJ 2DMQA 3L2VA 2O03A 1MMDA 4F52A 1V3FA 2YS9A 1XG1A 2L7KA 2W00A 1R49A 3MQ0A 4BU2A 2D5VA 1A6IA 5FD5A 1VQ8I 2LBFB 1R00A 4I09A 3SQNA 1GHCA 1ZR2A 3BPVA 2X6XA 2EZLA 3CF2A 3AKZA 5IP6A 1FP2A 2IW5A 1Z6RA 3HPHA 5L3GA 1T98A 3A1YA 4L18B 1I1SA 4U7BA 1NHAA 3ABTA 5F08A 4ASNA 2STWA 4IHSA 1AOYA 4NB5A 5HS7A 1P7JA 3U9GA 3BG6A 3ECOA 4ESFA 1IUFA 4UXNA 2B63J 1TT0A 1L0OC 3WE2A 2IS1A 4ZZDA 4BBSJ 3HIFA 1I27A 2R7OA 3JAMZ 2CUZA 1IW7F 4CCKA 1SAXA 5B1BH 1FT9A 3BZ6A 4F3QA 2HI3A 4ZZLA 1F43A 3M1EA 3CCMI 3OYLA 2GOMA 3VB2A 2ZC2A 2QYOA 4XN0A 2PFBA 4NBQA 1JKOC 5HOOA 2XDVA 1XMKA 4L0ZB 1YS6A 2OC6A 3S8PA 3ABUA 2KRCA 3ZPLA 4NHJA 4BHCA 5D5UB 1X3UA 4KUMA 2Q1ZB 3DCFA 1HKTA 1IN4A 1R1TA 4RB0A 5D5VB 1T0FC 3I58A 2LKXA 4FQGA 2HOSA 1U5TB 2CS3A 2EV5A 1QU3A 2HZTA 3I53A 3X2QH 3OYEA 1D8JA 2WADA 2NOGA 2CQNA 2WA0A 3I3LA 3QPHA 3TP0A 2H94A 2BXZA 3ZR8X 2AQEA 2DJIA 4PJNA 2IA2A 1RRJA 1REPC 1UHSA 3L00A 5H6RA 2XPWA 1B8IB 3MKWB 3KP6A 3BDDA 2VL8A 5FGMA 2XSJC 4MFEA 5HS9A 5IPAA 4EGYA 2JUCA 4OAZA 3F8NA 1ZAOA 5J47A 3H5NA 3PUBA 3H92A 5GTIC 5E8GA 3F6OA 4DQ2A 2M0MA 4Q4ZF 1BR4A 2CH0A 2CV0A 4AVZA 4CZCA 2VBXA 1K78B 4RGXA 1FP1D 1MJBA 3K4LA 1GXPA 2HOTA 3CCUI 3HL2A 2VKVA 2QEXI 4BE0A 2L3DA 4OAYA 2CGPA 3L09A 3HOXJ 4ENMA 4M73A 4A3LJ 4F91B 1USTA 3DPTA 4M6XA 2RN7A 3BLYA 5JI6A 1SVMA 3OYKA 3SYTA 3FXKA 1MBKA 1QNTA 1XCVA 2WV0A 4ZTJA 3C2GA 1R5GA 2R7XA 5EDNA 1HW1A 1ZH5A 3RZOJ 4OWRB 2GAUA 2F4MB 1VQ6I 5EF6A 3KYDB 3DKXA 4XORA 3HDDA 1ZG3A 1TLHB 5DD8A 3R60A 2XSDC 1D5VA 4BEHB 1DGWY 4AUXA 2LR8A 4LK1F 2HEOA 1XD7A 3BR6A 2A5YB 3LA2A 3C1DA 2RNJA 4RB3C 3I55I 3V4GA 2K9LA 4H0EA 1R71A 2KJBA 3DPUA 4AIJA 1ETVA 3L7WA 3ZN0A 1YW7A 1YS7A 2LLKA 4IPAA 5F04A 2Q2EA 4N4NB 4XRMA 4D5CA 2XROA 1ON2A 3K1NA 3ZQCA 4H4KC 2JWTA 2EFPA 4OU0A 1P4XA 2FBKA 4RGRA 1Z91A 2XGEA 2PJRA 3VOEA 3JTGA 2UV1A 1QHGA 4LB5A 4DIQA 1Y56A 1QPMA 1DPUA 3TP3A 5LFAA 4CO8A 1V5FA 2K9NA 3KPHA 1W1WE 3ZQ7A 1ETKA 1BC8C 1WH5A 3PO3J 1BW6A 2BE5F 5LHGA 3HYIA 1Y8QB 2UXNA 2A61A 3I59B 3IC7A 5L3DA 1G3TA 4A3FJ 4XKBA 4FX0A 2G7UA 1MMNA 3LFKA 3OYHA 4G6QA 4Y33A 2XVCA 3HEFA 3TKYA 2LYCA 4BE1A 1HSJA 3JAMK 1E0EA 3IKVA 2ZXIA 3KEOA 1IUYA 2D2WA 2V1XA 4PCQA 4FCYA 1JTYA 3A03A 3CCVI 5HNFA 5M3FJ 2VT3A 2VT2A 1K83J 2HZDA 4P9FA 1W7PD 1JTXA 4PFOA 3WG9A 5K5OA 2FNAA 4EEFG 3KFWX 2BV6A 5EEGA 2R7QA 1HDDC 2MFZA 5LEKA 1SVOA 1WH7A 2L2OA 3AL0C 1R36A 1S6LA 4HOBA 2IGNA 4XLCA 3J7YJ 2Y0SA 4B1RA 2R5ZA 2XGDA 3K69A 2F2EA 1X1CA 2W1OA 3FDYA 3KZIC 1Z1DA 3BP8A 2MW8A 5GAGJ 2L9SA 3UR3C 3EUHC 4FTHA 4XN3A 1OYWA 4L5EA 5K7ZA 4IOCF 1ITYA 2HDDA 4ON0A 2HQRA 3JRGA 3HHHA 3C3WA 2B7EA 1YO5C 2V1DA 3C18A 3DWLE 3TOAA 2COBA 3FZVA 3P9KA 2WY7Q 2DT7B 3QU6A 4XKWA 3GLXA 1R4NB 5DM7F 4A3JJ 1IDZA 4L9NA 2DTRA 2D1VA 2FOKA 2V1UA 3GTQJ 3ZN1A 3TW6A 4O3MA 3WTUC 1O3QA 1H89C 3AG4H 1K4TA 5ED4A 4UUTA 3LSTA 2IXSA 2Z5UA 4B09A 1VQMI 1FYMA 2H8RA 1T56A 1JXSA 1U0JA 2FUG2 3ZP5A 1MIJA 4RM2A 1ACIA 5LEJA 1A04A 2RVCA 3M8JA 5D5WB 2Y30A 2QSFX 1RUNA 3PO2J 4P9UA 1OCTC 2CUFA 5FLXZ 1VQKI 3MN2A 1O7LA 2KISA 2OZUA 3BOQA 2R7SA 1XGNA 2R92J 1XTAA 4II3A 4NUBA 4B48A 5BPIA 3GTGJ 4S0HB 2H1KA 3FMQA 2DA2A 5J4VA 1FYKA 1TC3C 3S2HJ 3AAFA 1MBFA 4HEA2 1E2XA 1UELB 2VASA 2LC2A 3KP4A 3N4MA 4IRGA 1ZRCA 2W24A 3BG9A 3JRAA 4XNFA 4HZFA 2A07F 3MAJA 5BMZA 1Y1VJ 3IRRA 3H1CA 2V9PA 5JHFA 4YRVA 2OQGA 1O57A 2ZMEC 2VI6A 3H9JA 5TJJA 1P4WA 2KPMA 1IN5A 1YLFA 1SMYF 4FE4A 3KIOA 1B72A 5IOYA 3MWMA 2ZMEA 2L4AA 2GIVA 4E7KA 3FM3A 2LY9A 2PJRB 3CMEI 5GPCA 3BTIA 4RAYA 5AIQA 1OCZH 2PMUA 3GLLA 5JLXA 3ZQIA 3S14J 2A05A 1MNMC 1Z7UA 4M71A 3MVPA 2ADUA 2KDZA 4YELA 2MD0A 4LJZF 4M3EA 1XB4A 4RAGA 1Z67A 2QSHX 1SD5A 4LFUA 2Y48A 1Y39A 4PJLA 4HDVA 5KVRA 1IGNA 3RZDJ 1HCRA 1OMIA 1Z77A 2BBYA 2QLZA 3F0CA 1IV6A 1BL0A 2QQ8A 3BTCA 3HRTA 1FSEA 2JA2A 3JREA 5DCFA 3RYRA 4A6DA 2OJED 4QPOA 2M0CA 5EJCA 3E6CC 2CG4A 3A02A 3BY6A 1ZKGA 2K85A 3KLOA 2V4JC 4JK1X 3F8CA 5KCMA 1XSDA 4XKCA 4L9JA 1T2KA 1LEBA 2W85A 2VE8A 2VXDA 2FOWA 3S16J 3G1LA 3MZHA 2ZJQF 4DJAA 4I6ZA 2Y0MA 4HYEA 3Q0UA 3H9QA 3R61A 2HYFA 4NC8A 1JT6A 2A6EF 4I98B 2BYVE 3LSKA 3FHZA 2FEZA 1VQ7I 2KZVA 5F0CA 3L9FA 1PUFA 2HFHA 1KU3A 4G9YA 3S1QJ 1HDPA 5B5EC 2R5ZB 4M74A 4B3AA 3FBNB 3FHNA 2JA7J 2O3FA 3KETA 3G1MA 4P5OA 2JSCA 4ZH4F 2V9VA 1QQIA 2FU4A 2VONA 4ZDOA 1O3SA 2VBZA 4KITB 3G1OA 1HW5A 5F0FA 1KZHA 2M30A 5KHDA 1E3HA 1XX5A 1D3YA 2K7LA 2F6CA 3FXUA 2TRTA 3VPRA 1ZREA 2IJLA 3BCBA 2K40A 2DFEA 2ELHA 2R5YB 2DA3A 1HBXG 5J8CA 3N05A 1B6AA 2IVMA 4L9VA 1NK3P 4F7ZA 3T0YA 1GT0C 2LNBA 3LA7A 2R93J 2R7VA 5LHHA 1LE8B 4AVPA 3T5XA 2XKPA 1FJLA 2IRFG 3LQRA 3L1PA 4ZYGA 4MLOA 2X6WA 3GFJA 1PP7U 3S3MA 1B1BA 1W5TA 2NAZA 1N77A 2QVOA 5B1AH 3CUQC 4A3GJ 4E7SA 3HC7A 1FZPB 1U2WA 4XSZF 3V8LA 2O5RA 3F23A 3QPTA 4UNOA 2Z2SB 5CYVA 3CCYA 1FLIA 4BHPA 4CCJA 1G3WA 2WB1A 2QKMB 5DYMA 1FC3A 1XS9A 1BOAA 2R7DA 3LA3A 3Q0WA 1Z05A 3BZCA 3K6GA 4JYKA 3HBLA 2H6BA 1ZHFA 2ESNA 2JN6A 1JKQC 1WJDA 2KHMA 4KMUX 3ZQHA 1E17A 2E19A 4G6DA 2BZTA 2KDOA 2B0LA 2KT0A 2PQ8A 3ZQFA 3L2QA 1PDNC 2M3AA 3TEDA 2P6SA 2XV4S 1WJEA 3OS2A 1MGTA 2FMLA 3HUGB 1EF4A 4YIRX 1ETQA 5CVRA 2NVTJ 3I56I 2M4KA 1VQ9I 2LF8A 1VQPI 2VB6A 3WTXC 4U0VA 2F5EA 3HRUA 4IHTA 1BJZA 2K3PA 4CCMA 3CZ6A 3J81K 4BXXJ 4YFNF 3G73A 3LAPA 1OR7C 3LSGA 1FBQA 2M7AA 2VODA 3LMMA 3HOVJ 3HGGA 1K4SA 1KYZA 4IQJA 4L5JA 2D1HA 3CP8A 3LWFA 2OTJI 1J9IA 1DP3A 2E2JJ 2N8GA 4PZJA 1RR8C 2FA5A 3J7AY 5AIPA 3OOPA 3A01A 4UVBA 1IXRC 1ZGWA 4WCGA 4OIOF 1TWGJ 2QCOA 2RV8A 5DEQA 3ZXSA 3OYFA 2HOEA 5LLQA 2YU9J 2LMDA 4HNTA 1I3AA 4UY8I 4G7HF 1OYIA 4U87A 4I99C 2F5FA 2X1DA 1Z0XA 2KZGA 2KL4A 1IV8A 1UFMA 4R79A 2FE3A 9ANTA 1Y0NA 2BEOA 2OU2A 5CQEA 2EV6A 4Z2YA 3RCOA 2QKLB 4B4CA 5K7HA 1SANA 1USSA 1LVKA 5C44J 4HQMA 4IEJA 2UWMA 3IAM2 4RM3A 2X85A 4CYCB 3GFLA 1MBHA 5JHUA 4B3XA 5IP9J 2HQNA 2HGCA 3V8JA 3WTSC 2H8WA 1ENHA 1VZ0A 2GXBA 3CJNA 3RSNA 3RPUD 1MD0A 2DO7A 1G3SA 2MH9A 1HQCA 2DAOA 3HGYA 2NVQJ 2YSRA 1MSEC 1GV5A 4RGSA 3NARA 2DXIA 4A93J 2DA5A 5J3LA 3K10A 1PUFB 2PJPA 1IZ1A 3HPGA 1DU0A 4Y3OA 2CW8A 2OA4A 2OUMA 4BHBA 3Q0VA 4DZPA 2O61A 5FKKA 4AD9A 1XMXA 2ME0A 3S1RJ 2DT6A 3H3ZA 2XGCA 2M45A 4O6JA 3DV8A 2RKHA 4ZC3A 4CCNA 4BDYA 5CLSA 1DQUA 2KLOA 2KIMA 4I0BA 4IHVA 1W7PA 4XRFA 5L3CA 1MH4A 3F3XA 4M3GA 1IRGA 2XAFA 3VEPA 3FXMA 3WHBA 4GDFA 4BQQA 2VE9A 1DPRA 2WWYA 3ZQLA 4ZYDA 1JKPC 1FOYA 5IOZA 4IKFA 4HAMA 1D1BA 3Q9SA 5LGTA 3QRFF 3MKLA 3GTPJ 1IO2A 2JA6J 1V55H 3N97A 2ISZA 1K6OA 3R0JA 3KZZA 1TBXA 3HKZN 3O3KA 4X0GA 2PLYA 4G94A 1TQPA 2VJIA 2WAQA 2ZJRF 2ESHA 3H3UA 1S7EA 2ZBKA 2MC3A 3OR1C 4M9SA 4BY1J 3BPXA 5F6FA 1LB2A 3M07A 3M9AA 1LFBA 3EQLF 2H1LA 4ANJA 3JRIA 1YI2I 1POGA 1O7FA 2VPRA 1Z3YA 2P7CB 2Y9YA 1F1ZA 2RQPA 3GW2A 4RBOA 1ZK8A 1IC8A 3K0LA 5AONA 1G6NA 2LY2A 1GDTA 4RGUA 4OIPF 5LRRA 5EG0A 4IVNA 2MBFA 3GTJJ 2E1NA 1B59A 5IP7J 3GEZA 5DCMB 4EJUA 3S17J 1X3WB 3OYBA 1WI3A 4KFCA 3GFIA 4MHGA 1ONVA 5BOXA 1EKEA 2QM3A 4MIMA 2DQRA 4NDLA 2QQBA 4S04A 2CRGA 3VYUB 2GZWA 2J5OA 3LL7A 4I0AA 4PFPA 3BG3A 1BI1A 3IH2A 1XSXA 2KMUA 4KNYA 3PL8A 3MEXA 3AG1H 2F48A 2CQ7A 1IDYA 5E8IA 2L0KA 1IXCA 2L9RA 3GFMA 3IP4B 2RNGA 2HVRA 3H5RA 3HHGA 3K9TA 1QGPA 1H88C 3PQJA 2GA2A 3U1KA 2JUGA 3NQOA 1FOWA 4U0WA 1FWZA 3E0JB 1PJRA 2K9MA 2MG4A 4D7NA 1S9HA 2ECBA 3A01B 2VOOA 1EV7A 1G8XA 3ABLH 2KQRA 3EUKL 1JUSA 1LDKB 1T0FA 5D8KB 5J40A 2NNYA 2IS2A 1D1AA 3S3NA 1QVUA 2VKHA 3COAC 1T8IA 1XDUA 4U7DA 4I7HA 1MDMA 3DU5A 3RJPA 4KJZA 2VBYA 2PEXA 1UJ8A 5E18F 4AU7A 2JTVA 4XLEA 4WXHA 2Y9ZA 1C0WA 5GADJ 2L01A 3ABKH 3CCJI 2KIUA 3I9V2 4XLPF 4J00A 5HDGA 5EEHA 4J19A 2VKDA 4HNUA 2CMPA 3RQ4A 1CF7B 4B47A 3PFYA 3BQZA 4ITVA 2KJCA 2MD5A 1RC9A 4RB1A 3BR1A 4HX7A 5LHIA 2XIGA 2K4JA 2BOLA 1GLNA 2Y75A 3CDIA 3E1SA 2MSYA 1S5LC 2YPRA 3E6DA 3JRHA 4E7HA 1QO0D 2ZFWA 2YR2A 3LQQA 2QQ9A 3PUFA 5FFXA 1HXDA 2V9KA 3CCEI 1W5CC 2E1CA 2P4WA 2VJJA 3BC8A 1U9OA 2JRTA 3ASOH 1BI3A 4LGWA 3S2WA 2VQGA 3V42A 4ZTFA 2P5VA 4R1HA 4HF1A 4XLNF 3QP5A 3CC2I 5CKTA 5LRSA 5BNGA 1WJAA 4UV9A 4M3FA 3GXOA 1V5EA 3TOBA 4UVCA 2HXIA 2RAEA 3PNYA 4G7ZF 5BS6A 3LOCA 3W3CA 1D5YA 1YE9A 3NWTA 2NVYJ 2WAQN 3L2RA 1UZCA 1K61A 2VOPA 3MZ8A 2VLAA 2EQRA 4HF2A 1J5YA 2ECCA 5E3NA 4PJMA 4GYGA 3RYPA 5HS8A 4U88A 2ELKA 2AO9A 1O4XA 4CICA 1MSFC 3GCMA 1UG2A 5DM6F 2DFFA 3CTAA 4MTDA 2QBYA 1OCCH 4KICA 2YU3A 5IY5H 3F21A 1YW8A 3AG3H 3EYIA 1VQ5I 1MNDA 1IJWC 3PNVA 1ETOA 1HKQA 2EZIA 2XAQA 1BC7C 4OIQF 5BQTA 2OBPA 1KQ0A 1XGSA 5DUKA 4NQWA 4B43A 2O6GE 1XDSA 4BBRJ 4I01A 5FKNA 1D0XA 2JVHA 5EGOA 2ETHA 1X4PA 4N9HA 2L9VA 2EZKA 3CP2A 2I5UA 4ENJA 5F0HA 4D0PA 1NK2P 3LSJA 5F27A 5GPAA 4BAYA 3IL2A 5ERIA 2DOFA 1TNSA 3FMSA 1A5JA 3SXYA 3V8KA 1YIOA 1BW5A 4LLGF 4L0YB 2FQ4A 4IJAA 4CGZA 4LB6B 3TDUC 4JX4A 5FO5A 1FMVA 1YG2A 2JT1A 4NC7A 4BJ5C 4IXAA 2O9LA 1TWFJ 3IKTA 3JTHA 3ONQA 2PBIA 3R4KA 4ZYEA 3U2RA 1APLC 3OYDA 1Z9CA 4AIKA 3KP5A 1U8RA 2PMHA 3HOUJ 3F8BA 2E60A 3JSPA 3SZPA 3WTTC 3AFHA 4DBQA 3EUHA 4FX4A 1JJ6C 3HXLA 2L02A 3I5UA 1LDDA 3PSFA 4PGGA 3ZQGA 2L7MP 3H35A 4QSHA 1QZZA 3D5RC 3RIRA 5A2QZ 1J09A 5DS9A 2JZYA 4KIGA 2K5CA 2HYGD 4XRSA 1LNWA 4OMZA 4A3DJ 4M3DA 1SFEA 5D8LB 1OLTA 1ORKA 2LY1A 4C3IJ 2R0QC 1TW3A 4XLFA 4Z6YA 3T1BA 4AM3A 2FF4A 4E7LA 2IGOA 2JMWA 1T08B 1SFUA 1X1AA 3DU6A 3PFIA 2XF5A 1QZEA 4OIRF 1QZYA 1WJBA 2M34A 2P5LC 3DEWA 1A31A 2XGXA 1S7OA 5FLVA 1UG0A 5E20A 1ETYA 3ULQB 4HSTA 1MH3A 2A6TA 3I54A 3G3ZA 1RUOA 4IHXA 2Z1DA 3ISPA 4IX7A 5E1ZB 2DODA 2RC4A 3OL4A 1EH7A 1IN7A 2E5ZA 3K1PA 1FSHA 2GXGA 1RKTA 1IRXA 4MGRA 1I6XA 3ELKA 4L5IA 4A3IJ 5B3SH 5J1RA 5D4RA 3LSPA 2XHKA 1SC7A 2WBMA 1EA3A 3CF5F 2QGUA 3GVAA 2FQ3A 4C3HJ 3BR5A 1JHHA 4A0XA 4JBAA 3BR2A 3HM5A 5CVVA 2IS6A 2ZO4A 3A2KA 5E3MA 2DK5A 3GZ5A 4LOCA 3MFKA 5FFZA 2DN0A 4L9TA 1YJNI 2OAZA 1TWHJ 1VNDA 2CO5A 1DGRM 1YYVA 4QWQA 3RQIA 4WX9A 2M9HA 1Y6IA 2PMZN 3D5LA 3CMMA 3ML6A 3CCSI 1J2XA 3FM5A 2Q2EB 3H9GA 4QPQA 2RGVA 3WE3A 5ICCA 4YIFA 3RPUA 2CV2A 4IHWA 5HLHA 2W82A 2R7FA 2QSGX 4XK4A 2GM4A 1TNTA 1H0MA 3MKYB 3E5QA 3HSFA 3OYJA 2B9SA 4HX4A 1X19A 1K7AA 4DOZA 2UXXA 1R5ID 3J81Z 3ZCOA 2F5CA 4RS8A 3HOSA 2BY3A 3CLOA 4ABZA 2EA4A 2G9WA 1T38A 3W2WA 4F55A 2ZJPF 4UUVA 1S8NA 1JI8A 2KRHA 4LK0F 2FBIA 1R6RA 3RKYA 3CLQA 1YTYA 2RDPA 3OL3A 3FISA 3OYNA 1TT5B 2K9SA 3UKGA 1ZLJA 3JSOA 4GRIA 3M8FA 2MABA 1OCOH 2XAGA 1OKRA 4RLQA 5K7FA 3GTLJ 3E5XA 3ZGKA 4KN7X 1R5HA 4A12A 1KONA 5HNHA 2LREA 2JSPA 4CXFA 4NQWB 2MLGA 1FBUA 3GUDA 2W84A 1FTZA 3DBRB 2E1MB 2FMYA 3E6MA 5F64A 4MTEA 4LMYA 5EGOB 3HZJA 4I02A 2L5QA 2LTPA 3QU3A 1WZ2A 4BQNA 2X48A 2CYYA 1VQ4I 3J7AO 5JVGF 3WU0A 2XB0X 4BJ6C 5FJ8J 4DYRA 3ERMA 3WGHA 1QHHD 1FY7A 2XB5A 3B6CA 1RI7A 2NYXA 3VDXA 1IRFA 4HDUA 1MKMA 5JLWA 2M2EA 4DGWB 4C9YA 1HOMA 4YFKF 3AL0B 4O5VA 2LG4A 3O8HA 3CESA 1SD7A 1RNLA 2L7FP 2EH3A 2L4MA 2XUBA 3OYAA 1FX7A 5LD2C 4MFDA 1MJAA 2DMTA 3F9KA 4KIBA 3J7ZI 4BACA 4AIDA 4X1EA 4DNCA 2Y2ZA 3DTIA 2GIZA 3FWEA 1ZARA 2F4IA 4GYIA 2LH9A 2DI3A 3EDPA 4EJOA 5A2QK 2MYSA 1P7IA 2MGQA 3ABMH 3JRBA 4Q5SF 1VQOI 5LGNA 1WJCA 4C2MJ 3SDGA 3SHFA 5IYCJ 2Q0OA 3MZYA 3M4OJ 1HKSA 1LVAA 2XPUA 2K9QA 5E1WA 2PI0A 2L54A 4BYYA 3HOTA 1IG7A 3C7JA 2DDBA 2VKEA 3J80Z 2NVXJ 2FJ1A 4A3EJ 1X2NA 2A69F 3I0TA 4V2FA 3VFZA 1UHWA 4ENKA 1JUPA 2IGMA 2H27A 1I5ZA 3S1NJ 2EILH 2HU9A 3IH3A 1HA8A 1X2MA 2ZJ2A 5CVIA 1ETWA 3GTMJ 2CUJA 4N0BA 2DA4A 1XCBA 3CUQA 4UB8C 2OZ6A 3PSIA 1BJAA 1P4AA 5FRNA 1T6SA 4LIVA 4LG0A 3K4CA 3M7GA 5K5QA 1KU7A 1XSVA 2IGKA 1PVEA 3D5SC 1QA6A 3ZMSA 4U0YA 3OYCA 5KAIC 3BR3A 4FE7A 3DKWA 3HKZA 3FK7A 4JP0A 4PJ0C 3DFGA 2NS0A 1SFXA 4WF2A 3L2UA 2R7TA 3VYRB 2P8TA 1IAWA 1IF1A 3S2DJ 3DLAA 3HG9A 1R22A 3MMYB 3D1NI 3F6VA 4HV6A 4Y13A 4P96A 1ZRFA 5DTDA 3ZMDA 3KCCA 5J6XA 5L3BA 1B9MA 4AYBA 1ZR4A 1LFUP 2OCEA 1V5GA 1I6HJ 4LD5A 1MBGA 1YQAA 2X1CA 3DTKA 3KZYA 2OV7A 5J4YA 1R1UA 5CVUA 1T39A 3DTEA 1B72B 1AA7A 4XONA 3WGIA 4RAZA 5J1UA 2ZMEB 5LGUA 3KEYA 4PSWA 1BR2A 1Y0UA 3GWZA 3OYGA 2R7UA 2ACJA 2DLLA 3GMEA 2FBHA 3O6BB 3FXLA 1ZRDA 3IAS2 4BE2A 1OR7A 1JGGA 4X6AJ 4HQEA 2AS5F 2YX4A 2HVQA 4KMFA 2W4SA 3IHUA 3BQYA 2A3SA 1TWCJ 1UB9A 2VBWA 4NC6A 1XGMA 2A5WA 3WTYC 1AU7A 1Z6TA 3CMYA 1K79A 1BBYA 4M9XA 1TL8A 4HLXA 3R0AA 2HTJA 3RI4A 1XPXA 2E34A 2XF7A 4KYWA 1U5TC 3H5AA 2I10A 3K1MA 3WTZA 1RZ4A 3QOPA 1SD4A 5L3FA 2RQQA 1N75A 3W2AA 5CPRB 2MLKA 5M5XJ 5FKMA 1G4DA 3JRFA 3PJRA 4C30A 1B4AA 2P0WA 2FRHA 2ZSIB 4A5MA 1MNEA 1AHDP 2BY1A 4E70A 4WWCA 4EJTA 2P6TA 3G71I 4II2A 3B02A 3PQKA 5GAHJ 4A3CJ 2COMA 1OJLA 2OD5A 4P55A 1B8IA 1FMWA 2DU9A 4WK8F 4ESJA 3VSLA 1WCMJ 3ERED 3DF8A 3CDHA 3W6VA 5FD6A 4MEXF 4E7JA 1KYWA 1LQ1A 2AXLA 3TDZC 2MH2A 2E7XA 5JVTA 2NVUB 2Z99A 3CUOA 4ZYAA 1O3TA 1NG7A 3OIOA 3KE2A 3S3OA 2X9DA 2TDXA 3E3VA 1RR7A 1KGSA 4IQ4A 2HS5A 1Z21A 1W0UA 3FXRA 2WY8Q 1ZGJA 1TQIA 2BW3A 3J80K 3K2AA 2FXAA 3BG7A 1W36C 1VFCA 4PUSA 3E97A 5TGTA 1GVDA 5BPDA 4D5FA 4IHYA 2EIKH 1W4MA 2IA1A 1I3QJ 2CUEA 2LKSA 3M8EA 2LD5A 3HB9A 2HWVA 3OWTA 1J75A 2JJ7A 1FEXA 4J01A 1P9QC 3GX4X 2CW7A 1R23A 1YJ9I 4IL6C 1A36A 5KK1A 5H20A 3JRDA 2NS8A 1BR1A 1P2FA 2VC1A 3FMRA 2BHYA 4EM2A 2Y69H 3K4NA 1IN6A 2X6YA 3LFUA 3W2VA 2V6EA 2KP6A 2LKPA 2FSWA 5IYDJ 4CCOA 5EEAA 3BJAA 3BT9A 1OCRH 2ZSHB 2DBBA 3DEUA 3HSRA 4FT8A 3I4NJ 3KP2A 4PDKA 1JGSA 1PUEE 1MBEA 4KT5C 3K7AJ 1S72I 4AYBN 2CWEA 2IPQX 4BQAA 2XPVA 3FXQA 2UZKA 4XOTA 4KA4A 1SFOJ 2V26A 3C2BA 2X4HA 3V7SA 3H0GJ 5D5XB 2HQAA 2JA8J 1YRNA 4MEYF 2M8GX 1TWAJ 3BWGA 4DZJA 4EATA 5M5YJ 3OS0A 1Y8RB 2DFIA 1SFKA 3I59A 1CGPA 3FX3A 3A0HC 1O3RA 1JUMA 4G8XA 3PNTA 2VQHA 2ICWG 2ZB9A 1PYVA 5FKLA 4YG2F 3IWZA 4MO7A 5E3LA 2E36A 3P7NA 3CC4I 1GUUA 1R9TJ 1VF9A 2M8EA 4CYDA 3B6AA 3BZKA 4A6EA 3WTVC 2DOEA 1LEAA 2E5NA 2XKOA 4FHTA 3UNGC 1WHUA 3CJRB 1RESA 3CJQB 4LLLA 3OYIA 3A0BC 3ROUA 1SD6A 2PX9A 4QIWN 1MJ9A 2VIXA 4W97A 4D9JA 1SMTA 4R8HA 3SFZA 2EINH 2K27A 3OIPA 4G12A 2JRMA 1AWCA 1RPWA 4XOPA 2CQQA 3RDIA 2ZCWA 1OPCA 4DYCA 1EJ9A 2GBYA 2CU7A 1S3JA 2E2IJ 5GP9A 3RTRA 4HX8A 4G7OF 3TW7A 2XRNA 1R7JA 5E17F 3VSKA 3D0SA 3JW4A 2EPFA 5M3MJ 4RLFA 4RMNA 1NTCA 1XMAA 2A6HF 3MCZA 3CQZJ 1E3OC 4YIIA 2EJRA 4D7MA 4KN4X 3ZMTA 2EFQA 1QRYA 2DT5A 1LPQA 4C2TA 2CW0F 1JHFA 3KLNA 4ZDLA 4XIDA 1R4MB 4HNVA 4BL0B 1YX3A 3HRMA 3KYCB 3HOZJ 2BY0A 3U1DA 2R4GA 2HTSA 2O8KA 2BY2A 2HPIA 2PG4A 1RETA 2LK2A 2QWWA 3C2HA 2IT0A 3K2ZA 1U78A 1LKXA 1MMAA 2IA0A 2ID3A 5CJ9A 4BUPA 2X6OA 3T8RA 3DLLF 1YITI 4HSRA 3QP6A 4BGDA 2GWRA 2Z33A 1X1BA 3K70D 2M7BA 2ZXHA 5F1RA 1J59A 2BW3B 4A2UA 4F93B 2HDWA 2V1NA 3FKIJ 1W7PB 1WPKA 1X58A 1QBJA 2J5PA 3GTKJ 4OINF 1ZYRF 2VQLA 3I64A 3SDBA 3G6EI 3IWFA 4E7ZA 3VODA 1YW9A 2HQ5A 4ZJZA 2D45A 1YFHA 3FK6A 4BDZA 2PMZA 4A0ZA 1G2HA 3CCLI 3NWSA 5CQGA 5JR3A 4ENNA 4HA8A 2OTLI 5J8FA 1OISA 4KISA 2FX0A 2EIMH 3TL4X 2MC4A 1MMGA 4Y52J 3GF2A 4JX5A 3LSHA 3ZMZA 1SEUA 3JR9A 2DYSH 3M1CA 2OQRA 2ELJA 1Q1VA 4BH9A 2Z3YA 4HG2A 2JA5J 3OV8A 3HOYJ 3V7CA 1OYYA 3G2BA 4Y17A 3MKZA 1WSUA 3T8TA 2DMPA 5C4XJ 2DA7A 4M6YA 4WXDA 2I8DA 2LRDA 4N9IA 3SZTA 3HTSB 3QODA 4HF0A 4PJJA 2F5VA 4EV0A 1YRNB 4IRIA 5EG0B 4E4HA 1UHMA 2QENA 4C3JJ 4EM1A 3CO7C 3G4SI 2DCEA 3K4MA 1J7KA 2TCTA 5C4JJ 1T95A 3QPLA 1W36D 4CCLA 1LDJA 3ESWB 2E1MC 3WG7H 3OMYA 3BTJA 2ZXJA 1RKWA 3M3YJ 4MQ9F 2ZFUA 4XICA 4HW0A 1UMQA 5H6QA 3ECHA 3WHCA 5DUIA 1DP7P 2HKXA 3CC7I 1MBJA 2V6CA 4BS9A 4KDPA 2DYRH 3NRVA 2HKOA 1GXQA 2VXZA 1WI9A 3RKWA 2YUSA 2DMNA 2DDAA 3WGGA 2LDUA 2IBDA 3ZOBA 3VWBA 3CMAI 5IT3A 3RKQA 5ILSA 4EQQA 3BTLA 2HNHA 2O0YA 1P6RA 3W6JB 3TO6A 4ZDPA 2XAUA 2M4GA 2EWNA 2X1EA 4UHTA 3Q3SA 5TISC 3SEZA 3OSFA 4XL9A 4YFXF 1MDMB 5D6FA 5F1JA 3RKXA 4FETA 4JQFA 4BNCA 2KFDA 5GAEJ 4GO1A 1F4KA 2KKOA 1JJ8C 3DQVC 4KT6A 1SVLA 2R5YA 3FKJA 1VTNC 1BN5A 2BVLA 2E7WA 2EFNA 2R7RA 3DXJF 4RB2C 3DBLB 5FLMJ 4IO9F 3WU2C 1UAAA 4IF4A 1YIJI 1LE8A 2H6CA 1QPIA 3LNQA 2VN2A 2LP0A 1F36A 4IOAF 2P7VB 4N4OB 2WC2A 1EH6A 2R3SA 1I39A 3NAUA 2NNNA 2NXNB 2WTEA 1B9NA 3ZQQA 3V7RA 2DA1A 4GXOA 4RAFA 3SJMA 1OCPA 4XM3A 5IYBJ 3BCAA 4M9ZA 5IT9Z 3QYBA 2FD5A 3S32A 2DPUA 2EBIA 4CUGA 1V54H 4XR6A 5KNLA 1L3LA 3P5JA 1WRJA 3IV5A 3BR0A 1ETXA 2EZHA 3CJTB 2VQCA 4EMSA 3PM1A 2Q8KA 4P1WA 3JCUC 1FOKA 3WU1B 3OIQA 1HC8A 2WV1A 2K86A 4V19K 3F8MA 2L9NA 4HRIA 2VC0A 1YX5A 5EZGA 3RPQA 4AIHA 2UUZA 4TV7A 2GA1A 2GXAA 4CHUA 3OYMA 4LITA 2W25A 4XLHA 2XC7A 1H9TA 2DTZA 3HSEA 2XAJA 1R1VA 4V2GA 1KQ9A 3LAJA 1JKRC 1ZN2A 1OQYA 3HUGA 3VYSB 3Q5FA 1Z7LA 1NG6A 2FNPA 2Y31A 2DMUA 4EM0B 4UV8A 1GV2A 4PK4A 1ZLKA 5HDNA 1RIOH 1W0TA 2V79A 2HYJA 3P9IA 4LG3A 2EFWA 2KIQA 2HVSA 3CDLA 1TP4A 4OMYA 2JK3A 4B44A 3GZNB 1KQ8A 3FXOA 2CFXA 4IZZA 2QBYB 4A3MJ 4OOIA 1KU9A 4YEJA 1I50J 1TW2A 4DW6A 1FIAA 2ID6A 2JVGA 5DV5A 1AKHA 3HJEA 5DD4A 2R7WA 3S15J 1LJ9A 3LSIA 2ZXWH 2EK5A 4W1UA 1ZG5A 5K1YA 2W48A 2K4BA 2F5DA 1TTYA 2CSOA 5TRDA 2V7FA 2GQQA 3BG5A 3GTOJ 5H2FC 1IXSB 3HRSA 1QVTA 2X0LA 5B66C 2GLOA 3F72A 1P92A 1F9NA 3E5UA 4UUSA 3TBIA 1FIPA 1FPQA 1JT0A 4XSXF 2LOOA 2XRLA 2G0EA 1EH8A 5LBQA 2EIJH 3EUAA 3I4PA 4LLNA 2C6YA 4Y7NJ 5FRMA 5J1YA 3ASNH 5HDKA 3K4BA 1U6GA 4CYCA 1K6YA 2IS4A 3CCRI 1U8BA 3EYYA 1SAUA 4D1QA 2E71A 4HBLA 3KX2A 1JE8A 3E6BA 2Y0SN 4UB6C 1WQ2A 2XASA 3U21A 1BA5A 3H3VK 1D0ZA 1XN7A 2VJ5A 2A68F 1NH3A 5EYRA 2RREA 1FBSA 2P5KA 2HPMA 1MMSA 5E1XA 1YJWI 4GFBA
chains in the Genus database with same CATH topology
5ILVA 2Z9OA 5HLGA 3KP7A 3TO9A 3EETA 1MZBA 4ZYHA 2ZKZA 3GYHX 4EJWA 3L2CA 1R58A 3FF5A 4QLCU 5D4SA 3TO7A 3REOA 2QQAA 5K5RA 5JFRA 2JPBA 2EV0A 4A0YA 5L3EA 4EJVA 1WKMA 2HDCA 2CQKA 1H9GA 1GVJA 2IP2A 2MA3A 1BIBA 2EB7A 4KIFA 4IRHA 2ZNYA 3R6SA 2M1BA 3BROA 5IT9K 2W57A 4AWXB 3IRQA 5FLXK 1V4RA 4I2OA 4Q47A 1J0RA 4GCVA 3O2PE 3I71A 2XAHA 3Q9VA 4GGGA 2DK8A 4WXCA 5CVJA 2QUFA 3WODF 4PGHA 3WTWC 3QAHA 1I1GA 3HTUA 3CO6C 4MNUA 4CZZA 3DPLC 3NEUA 1D8KA 4XBFA 4S05A 4K2EA 1PP8F 4ETSA 5DCMA 2HR3A 4BXUA 1F5TA 1BM9A 1DUXC 2O8XA 4CDGA 4B8XA 2LSOA 1U3EM 5HVQC 2STTA 5FB2A 2EA2A 1DDNA 1WWXA 4Y15A 2G7HA 1Q1HA 3P9CA 5ILUA 1FNNA 1S29A 5ICGA 1ODDA 2H09A 2YX7A 1U5TA 2NRAC 2EFOA 1BI0A 5D6EA 1G3YA 4M72A 4MQVA 1TQMA 4Q48A 3GZ6A 3KEQA 3ZMVA 3DP7A 1HSTA 2K02A 5ICEA 2BGCA 2M87A 3KP3A 2DPDA 1STZA 1K78A 4ESBA 3GO5A 2ZNZA 4EVIA 4HLYA 3W6KB 1KA8A 1CF7A 1HW2A 1ZGAA 5ICFA 1UCRA 3TQNA 3B73A 4UVAA 2DQLA 1ON1A 1FYLA 1ULYA 1S7AA 4EGZA 2QZ8A 2M5WA 1XGOA 2LF7A 4A5NA 1KU2A 1IN8A 2PN6A 3BJOA 3CUQB 5HLIA 5DDGA 2DW4A 4LG0B 1BIAA 3BJ6A 2ISYA 4HV5A 2KIFA 1ZG1A 1W5SA 3F22A 2JPCA 2KRFA 6PAXA 1BI2A 3F8FA 3TGNA 3ZMUA 2O03A 1V3FA 3MQ0A 5FD5A 1GHCA 1R00A 4I09A 3SQNA 3BPVA 1FP2A 2IW5A 1Z6RA 5L3GA 1T98A 4L18B 1I1SA 4U7BA 1NHAA 3ABTA 4ASNA 2STWA 4IHSA 1AOYA 4NB5A 5HS7A 3U9GA 3ECOA 4ESFA 4UXNA 1L0OC 3WE2A 4ZZDA 3HIFA 1I27A 3JAMZ 1IW7F 1SAXA 1FT9A 3BZ6A 4ZZLA 3M1EA 3VB2A 2QYOA 2PFBA 5HOOA 1XMKA 4L0ZB 1YS6A 3ABUA 3ZPLA 4NHJA 4BHCA 5D5UB 1X3UA 4KUMA 1HKTA 1IN4A 1R1TA 4RB0A 5D5VB 3I58A 1U5TB 2EV5A 2HZTA 3I53A 1D8JA 3QPHA 2H94A 2IA2A 1REPC 3L00A 5H6RA 3KP6A 3BDDA 5FGMA 5HS9A 4EGYA 3F8NA 1ZAOA 3H92A 5E8GA 3F6OA 4DQ2A 4Q4ZF 2VBXA 1K78B 4RGXA 1FP1D 1MJBA 1GXPA 2CGPA 2L3DA 3L09A 4ENMA 4M73A 1USTA 3DPTA 4M6XA 2RN7A 5JI6A 1QNTA 1XCVA 2WV0A 1R5GA 1HW1A 1ZH5A 2GAUA 1ZG3A 1TLHB 5DD8A 3R60A 1D5VA 2HEOA 4LK1F 1XD7A 2A5YB 3LA2A 3C1DA 2RNJA 4RB3C 3V4GA 4H0EA 2KJBA 4AIJA 3L7WA 3ZN0A 1YW7A 1YS7A 4IPAA 2Q2EA 2XROA 1ON2A 3K1NA 2EFPA 4OU0A 1P4XA 2FBKA 4RGRA 1Z91A 3VOEA 3JTGA 4LB5A 1DPUA 1QPMA 4CO8A 3ZQ7A 1BC8C 2BE5F 5LHGA 3HYIA 2UXNA 2A61A 3I59B 3IC7A 5L3DA 1G3TA 4FX0A 2G7UA 3LFKA 4G6QA 3TKYA 2XVCA 1HSJA 3JAMK 3IKVA 3KEOA 1IUYA 2D2WA 2V1XA 4PCQA 2VT3A 2VT2A 4P9FA 1W7PD 3WG9A 5K5OA 2FNAA 3KFWX 2BV6A 5EEGA 5LEKA 1R36A 1S6LA 4HOBA 3K69A 2F2EA 1Z1DA 3BP8A 1OYWA 4ON0A 2HQRA 3HHHA 3C3WA 1YO5C 2V1DA 3C18A 3TOAA 3FZVA 3P9KA 3QU6A 3GLXA 4L9NA 2DTRA 2D1VA 2FOKA 2V1UA 3ZN1A 4O3MA 3WTUC 1O3QA 5ED4A 3LSTA 2Z5UA 4B09A 1FYMA 1JXSA 3ZP5A 5LEJA 1A04A 2RVCA 5D5WB 1RUNA 4P9UA 5FLXZ 1O7LA 2OZUA 3BOQA 1XGNA 5BPIA 3FMQA 1FYKA 3AAFA 1E2XA 3KP4A 3N4MA 4IRGA 1ZRCA 2W24A 4HZFA 2A07F 3MAJA 5BMZA 3IRRA 2OQGA 1O57A 5TJJA 1P4WA 1IN5A 1YLFA 1SMYF 3MWMA 2ZMEA 2L4AA 2GIVA 3FM3A 4RAYA 5AIQA 2PMUA 1Z7UA 4M71A 2ADUA 4LJZF 1XB4A 1SD5A 4LFUA 2Y48A 4HDVA 5KVRA 1OMIA 2BBYA 2QLZA 3HRTA 1FSEA 5DCFA 3RYRA 4A6DA 3E6CC 2CG4A 3BY6A 3KLOA 4JK1X 1XSDA 3F8CA 4L9JA 1T2KA 1LEBA 2W85A 2VE8A 3MZHA 2Y0MA 4HYEA 3R61A 2HYFA 2A6EF 4I98B 2BYVE 3FHZA 2FEZA 3L9FA 2HFHA 1KU3A 4G9YA 4M74A 2O3FA 3KETA 4P5OA 2JSCA 4ZH4F 2V9VA 1QQIA 2FU4A 2VONA 1O3SA 2VBZA 1HW5A 2M30A 1D3YA 2K7LA 3FXUA 1ZREA 2IJLA 2ELHA 1HBXG 5J8CA 1B6AA 2IVMA 4L9VA 4F7ZA 3T0YA 2LNBA 3LA7A 5LHHA 4AVPA 3T5XA 2XKPA 2IRFG 3LQRA 4ZYGA 3GFJA 1PP7U 1B1BA 1W5TA 2NAZA 2QVOA 3CUQC 1FZPB 3F23A 1U2WA 4XSZF 3V8LA 3QPTA 4UNOA 5CYVA 1FLIA 4BHPA 1G3WA 5DYMA 1FC3A 1BOAA 2R7DA 3LA3A 1Z05A 2H6BA 1ZHFA 2ESNA 4KMUX 1E17A 4G6DA 2B0LA 2PQ8A 1PDNC 2P6SA 2XV4S 1MGTA 2FMLA 5CVRA 2LF8A 3WTXC 4U0VA 2F5EA 3HRUA 4IHTA 3J81K 4YFNF 3G73A 3LAPA 1FBQA 2VODA 1KYZA 4L5JA 2D1HA 3LWFA 1J9IA 4PZJA 2FA5A 5AIPA 3OOPA 4UVBA 1IXRC 4WCGA 4OIOF 2RV8A 5DEQA 2HOEA 5LLQA 4G7HF 1OYIA 2F5FA 1UFMA 4R79A 2FE3A 2BEOA 2OU2A 2EV6A 4Z2YA 1USSA 4HQMA 2UWMA 3GFLA 5JHUA 2HQNA 2HGCA 3V8JA 3WTSC 2GXBA 3CJNA 1MD0A 2DO7A 1G3SA 2MH9A 1HQCA 2DAOA 2YSRA 4RGSA 2PJPA 1IZ1A 2OA4A 4BHBA 2O61A 4AD9A 3H3ZA 2M45A 4O6JA 3DV8A 2RKHA 5CLSA 2KIMA 4I0BA 1W7PA 4XRFA 5L3CA 3F3XA 1IRGA 2XAFA 3VEPA 2VE9A 1DPRA 2WWYA 4ZYDA 4HAMA 3Q9SA 5LGTA 3QRFF 3N97A 2ISZA 1K6OA 3R0JA 3KZZA 1TBXA 3O3KA 2PLYA 4G94A 1TQPA 2ESHA 3H3UA 2ZBKA 2MC3A 4M9SA 3BPXA 5F6FA 1LB2A 3M9AA 3EQLF 1O7FA 2P7CB 1F1ZA 2RQPA 3GW2A 3K0LA 5AONA 1G6NA 4RGUA 4OIPF 5LRRA 4IVNA 2MBFA 2E1NA 1B59A 3GEZA 5DCMB 4EJUA 4KFCA 3GFIA 4MHGA 1ONVA 5BOXA 2QM3A 2DQRA 2QQBA 4S04A 2GZWA 2J5OA 4I0AA 1BI1A 1XSXA 4KNYA 3MEXA 5E8IA 1IXCA 3GFMA 3HHGA 3K9TA 1QGPA 3PQJA 2GA2A 3NQOA 4U0WA 1FWZA 2VOOA 1EV7A 1LDKB 1T0FA 5D8KB 2NNYA 3COAC 1XDUA 4U7DA 4I7HA 1MDMA 3RJPA 2VBYA 2PEXA 5E18F 2JTVA 4WXHA 1C0WA 2L01A 2KIUA 4XLPF 5HDGA 5EEHA 1CF7B 2KJCA 2MD5A 4RB1A 4HX7A 5LHIA 2XIGA 2K4JA 2Y75A 2YPRA 3E6DA 1QO0D 2ZFWA 2YR2A 3LQQA 2QQ9A 5FFXA 1HXDA 2E1CA 2P4WA 2JRTA 3S2WA 4LGWA 1BI3A 2P5VA 4R1HA 4HF1A 4XLNF 3QP5A 5LRSA 4UV9A 3GXOA 3TOBA 4UVCA 4G7ZF 5BS6A 2VOPA 4HF2A 1J5YA 4GYGA 3RYPA 5HS8A 4U88A 4CICA 3CTAA 4MTDA 2QBYA 4KICA 2YU3A 3F21A 1YW8A 3EYIA 1HKQA 2XAQA 4OIQF 1BC7C 5BQTA 2OBPA 1KQ0A 1XGSA 5DUKA 4NQWA 2O6GE 1XDSA 4I01A 2ETHA 4N9HA 4ENJA 4D0PA 4BAYA 3IL2A 5ERIA 1TNSA 3FMSA 3SXYA 3V8KA 1YIOA 4LLGF 4L0YB 4IJAA 4CGZA 4LB6B 3TDUC 5FO5A 1YG2A 2JT1A 4IXAA 3IKTA 3JTHA 2PBIA 3R4KA 4ZYEA 3U2RA 1Z9CA 4AIKA 3KP5A 1U8RA 2PMHA 3F8BA 3JSPA 3SZPA 3WTTC 3EUHA 4FX4A 2L02A 3I5UA 1LDDA 4PGGA 1QZZA 3RIRA 5A2QZ 2JZYA 4KIGA 2HYGD 1LNWA 4OMZA 1SFEA 5D8LB 1TW3A 3T1BA 2FF4A 1SFUA 3PFIA 4OIRF 1QZYA 2P5LC 2XGXA 1S7OA 5E20A 3ULQB 3I54A 3G3ZA 1RUOA 3ISPA 5E1ZB 2RC4A 1EH7A 1IN7A 3K1PA 1FSHA 2GXGA 4MGRA 1I6XA 3ELKA 4L5IA 5D4RA 2XHKA 3GVAA 2FQ3A 1JHHA 4A0XA 4JBAA 5CVVA 2ZO4A 2DK5A 3GZ5A 3MFKA 5FFZA 4L9TA 2OAZA 2CO5A 1YYVA 4QWQA 4WX9A 3D5LA 3ML6A 1J2XA 5ICCA 3FM5A 3WE3A 2RGVA 4YIFA 3RPUA 5HLHA 2R7FA 1TNTA 1H0MA 3E5QA 3HSFA 4HX4A 1K7AA 2UXXA 3J81Z 2F5CA 4RS8A 3HOSA 3CLOA 2EA4A 2G9WA 1T38A 4UUVA 1S8NA 4LK0F 2FBIA 3RKYA 1YTYA 2RDPA 1ZLJA 3JSOA 3M8FA 2XAGA 1OKRA 3E5XA 4KN7X 1R5HA 4A12A 4CXFA 2MLGA 1FBUA 3GUDA 2W84A 3E6MA 2FMYA 5F64A 4MTEA 4LMYA 4I02A 3QU3A 2CYYA 3J7AO 3WU0A 3WGHA 1FY7A 1RI7A 2NYXA 4HDUA 1IRFA 1MKMA 4YFKF 4O5VA 1SD7A 1RNLA 2L4MA 2XUBA 1FX7A 1MJAA 4KIBA 4DNCA 3FWEA 1ZARA 4GYIA 4EJOA 5A2QK 2DI3A 3EDPA 4Q5SF 5LGNA 3SHFA 2Q0OA 3MZYA 1HKSA 1LVAA 5E1WA 2PI0A 2L54A 4BYYA 3HOTA 3C7JA 3J80Z 2A69F 3I0TA 3VFZA 1UHWA 4ENKA 2H27A 1I5ZA 2ZJ2A 5CVIA 4N0BA 1XCBA 3CUQA 2OZ6A 1BJAA 1P4AA 1T6SA 4LG0A 3M7GA 5K5QA 1KU7A 1XSVA 3ZMSA 4U0YA 3DKWA 3DFGA 2NS0A 1SFXA 4WF2A 2P8TA 1IAWA 1IF1A 1R22A 3F6VA 4HV6A 4Y13A 4P96A 1ZRFA 3ZMDA 3KCCA 5L3BA 5J6XA 1B9MA 4LD5A 1YQAA 3KZYA 1R1UA 5CVUA 1T39A 3WGIA 4RAZA 2ZMEB 5LGUA 1Y0UA 3GWZA 2ACJA 2DLLA 2FBHA 3O6BB 1ZRDA 1OR7A 4HQEA 2AS5F 2YX4A 4KMFA 3IHUA 2A3SA 1UB9A 2VBWA 1XGMA 3WTYC 1Z6TA 1K79A 1BBYA 4M9XA 4HLXA 3R0AA 2HTJA 3RI4A 4KYWA 1U5TC 3K1MA 3WTZA 3QOPA 1RZ4A 1SD4A 5L3FA 2MLKA 1G4DA 1B4AA 2FRHA 4A5MA 4E70A 4WWCA 4EJTA 2P6TA 3B02A 3PQKA 2COMA 2OD5A 4P55A 4WK8F 2DU9A 4ESJA 3ERED 3DF8A 3CDHA 5FD6A 4MEXF 1KYWA 1LQ1A 2AXLA 3TDZC 2MH2A 2E7XA 5JVTA 2Z99A 3CUOA 1O3TA 3KE2A 2TDXA 3E3VA 1KGSA 2HS5A 3FXRA 1ZGJA 1TQIA 3J80K 2FXAA 3E97A 5BPDA 1W4MA 2IA1A 3M8EA 2HWVA 1J75A 3GX4X 1R23A 5KK1A 5H20A 1P2FA 2VC1A 3FMRA 4EM2A 1IN6A 2LKPA 2FSWA 3BJAA 2DBBA 3DEUA 3HSRA 4FT8A 3KP2A 4PDKA 1JGSA 1PUEE 4KT5C 2CWEA 2IPQX 4BQAA 3FXQA 2UZKA 4KA4A 2X4HA 3V7SA 5D5XB 4MEYF 3BWGA 1CGPA 2DFIA 3I59A 3FX3A 1O3RA 4G8XA 4YG2F 3IWZA 3P7NA 2M8EA 4CYDA 4A6EA 3WTVC 1LEAA 2XKOA 4FHTA 4LLLA 3ROUA 1SD6A 1MJ9A 1SMTA 4R8HA 3SFZA 2K27A 1AWCA 3RDIA 2ZCWA 1OPCA 1S3JA 3RTRA 4HX8A 4G7OF 2XRNA 1R7JA 5E17F 3D0SA 3JW4A 1XMAA 2A6HF 3MCZA 4YIIA 2EJRA 4KN4X 3ZMTA 2EFQA 2DT5A 2CW0F 1JHFA 3KLNA 3HRMA 3U1DA 2HTSA 2QWWA 2PG4A 2IT0A 3K2ZA 1U78A 2IA0A 5CJ9A 3T8RA 3QP6A 2GWRA 2Z33A 5F1RA 1J59A 4A2UA 1W7PB 1QBJA 2J5PA 4OINF 1ZYRF 3I64A 3IWFA 3VODA 1YW9A 2D45A 1YFHA 4A0ZA 5JR3A 4ENNA 4HA8A 5J8FA 3GF2A 3ZMZA 2OQRA 4BH9A 2Z3YA 3OV8A 3V7CA 1OYYA 4Y17A 1WSUA 3T8TA 4M6YA 4WXDA 4N9IA 3SZTA 3HTSB 4HF0A 4EV0A 4IRIA 1UHMA 2QENA 4EM1A 3CO7C 1J7KA 1LDJA 2ZXJA 4MQ9F 4HW0A 5H6QA 3ECHA 5DUIA 1DP7P 2HKXA 2V6CA 4KDPA 3NRVA 2HKOA 1GXQA 2VXZA 1WI9A 3RKWA 3WGGA 2LDUA 5IT3A 5ILSA 4EQQA 2O0YA 1P6RA 3W6JB 3TO6A 2EWNA 4UHTA 4YFXF 1MDMB 5D6FA 3RKXA 4JQFA 4BNCA 4GO1A 1F4KA 2KKOA 3DQVC 1VTNC 1BN5A 2E7WA 2EFNA 3DXJF 4RB2C 4IF4A 2H6CA 2VN2A 2P7VB 2WC2A 1EH6A 2R3SA 2NNNA 2WTEA 1B9NA 3V7RA 4GXOA 4M9ZA 5IT9Z 2DPUA 1L3LA 1WRJA 4EMSA 2Q8KA 1FOKA 3WU1B 2K86A 3F8MA 2VC0A 3RPQA 4AIHA 4CHUA 4TV7A 2GA1A 2W25A 1H9TA 3HSEA 2XAJA 1R1VA 1KQ9A 3LAJA 1ZN2A 3HUGA 3Q5FA 2FNPA 4EM0B 4UV8A 1ZLKA 5HDNA 1RIOH 2V79A 3P9IA 2EFWA 4OMYA 1KQ8A 2CFXA 2QBYB 4OOIA 1KU9A 1TW2A 5DV5A 5DD4A 1LJ9A 2EK5A 1ZG5A 5K1YA 2K4BA 2F5DA 1TTYA 2CSOA 5TRDA 2GQQA 1IXSB 3HRSA 2X0LA 3F72A 1P92A 1F9NA 3E5UA 1FPQA 4XSXF 1EH8A 5LBQA 3I4PA 4LLNA 2C6YA 5HDKA 1U6GA 3EYYA 4HBLA 1JE8A 3E6BA 1WQ2A 2XASA 1XN7A 2A68F 1FBSA 2P5KA 5E1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILV A;  2Z9O A;  5HLG A;  3KP7 A;  3TO9 A;  3EET A;  1MZB A;  4ZYH A;  2ZKZ A;  3GYH X;  4EJW A;  3L2C A;  1R58 A;  3FF5 A;  4QLC U;  5D4S A;  3TO7 A;  3REO A;  2QQA A;  5K5R A;  5JFR A;  2JPB A;  2EV0 A;  4A0Y A;  5L3E A;  4EJV A;  1WKM A;  2HDC A;  2CQK A;  1H9G A;  1GVJ A;  2IP2 A;  2MA3 A;  1BIB A;  2EB7 A;  4KIF A;  4IRH A;  2ZNY A;  3R6S A;  2M1B A;  3BRO A;  5IT9 K;  2W57 A;  4AWX B;  3IRQ A;  5FLX K;  1V4R A;  4I2O A;  4Q47 A;  1J0R A;  4GCV A;  3O2P E;  3I71 A;  2XAH A;  3Q9V A;  4GGG A;  2DK8 A;  4WXC A;  5CVJ A;  2QUF A;  3WOD F;  4PGH A;  3WTW C;  3QAH A;  1I1G A;  3HTU A;  3CO6 C;  4MNU A;  4CZZ A;  3DPL C;  3NEU A;  1D8K A;  4XBF A;  4S05 A;  4K2E A;  1PP8 F;  4ETS A;  5DCM A;  2HR3 A;  4BXU A;  1F5T A;  1BM9 A;  1DUX C;  2O8X A;  4CDG A;  4B8X A;  2LSO A;  1U3E M;  5HVQ C;  2STT A;  5FB2 A;  2EA2 A;  1DDN A;  1WWX A;  4Y15 A;  2G7H A;  1Q1H A;  3P9C A;  5ILU A;  1FNN A;  1S29 A;  5ICG A;  1ODD A;  2H09 A;  2YX7 A;  1U5T A;  2NRA C;  2EFO A;  1BI0 A;  5D6E A;  1G3Y A;  4M72 A;  4MQV A;  1TQM A;  4Q48 A;  3GZ6 A;  3KEQ A;  3ZMV A;  3DP7 A;  1HST A;  2K02 A;  5ICE A;  2BGC A;  2M87 A;  3KP3 A;  2DPD A;  1STZ A;  1K78 A;  4ESB A;  3GO5 A;  2ZNZ A;  4EVI A;  4HLY A;  3W6K B;  1KA8 A;  1CF7 A;  1HW2 A;  1ZGA A;  5ICF A;  1UCR A;  3TQN A;  3B73 A;  4UVA A;  2DQL A;  1ON1 A;  1FYL A;  1ULY A;  1S7A A;  4EGZ A;  2QZ8 A;  2M5W A;  1XGO A;  2LF7 A;  4A5N A;  1KU2 A;  1IN8 A;  2PN6 A;  3BJO A;  3CUQ B;  5HLI A;  5DDG A;  2DW4 A;  4LG0 B;  1BIA A;  3BJ6 A;  2ISY A;  4HV5 A;  2KIF A;  1ZG1 A;  1W5S A;  3F22 A;  2JPC A;  2KRF A;  6PAX A;  1BI2 A;  3F8F A;  3TGN A;  3ZMU A;  2O03 A;  1V3F A;  3MQ0 A;  5FD5 A;  1GHC A;  1R00 A;  4I09 A;  3SQN A;  3BPV A;  1FP2 A;  2IW5 A;  1Z6R A;  5L3G A;  1T98 A;  4L18 B;  1I1S A;  4U7B A;  1NHA A;  3ABT A;  4ASN A;  2STW A;  4IHS A;  1AOY A;  4NB5 A;  5HS7 A;  3U9G A;  3ECO A;  4ESF A;  4UXN A;  1L0O C;  3WE2 A;  4ZZD A;  3HIF A;  1I27 A;  3JAM Z;  1IW7 F;  1SAX A;  1FT9 A;  3BZ6 A;  4ZZL A;  3M1E A;  3VB2 A;  2QYO A;  2PFB A;  5HOO A;  1XMK A;  4L0Z B;  1YS6 A;  3ABU A;  3ZPL A;  4NHJ A;  4BHC A;  5D5U B;  1X3U A;  4KUM A;  1HKT A;  1IN4 A;  1R1T A;  4RB0 A;  5D5V B;  3I58 A;  1U5T B;  2EV5 A;  2HZT A;  3I53 A;  1D8J A;  3QPH A;  2H94 A;  2IA2 A;  1REP C;  3L00 A;  5H6R A;  3KP6 A;  3BDD A;  5FGM A;  5HS9 A;  4EGY A;  3F8N A;  1ZAO A;  3H92 A;  5E8G A;  3F6O A;  4DQ2 A;  4Q4Z F;  2VBX A;  1K78 B;  4RGX A;  1FP1 D;  1MJB A;  1GXP A;  2CGP A;  2L3D A;  3L09 A;  4ENM A;  4M73 A;  1UST A;  3DPT A;  4M6X A;  2RN7 A;  5JI6 A;  1QNT A;  1XCV A;  2WV0 A;  1R5G A;  1HW1 A;  1ZH5 A;  2GAU A;  1ZG3 A;  1TLH B;  5DD8 A;  3R60 A;  1D5V A;  2HEO A;  4LK1 F;  1XD7 A;  2A5Y B;  3LA2 A;  3C1D A;  2RNJ A;  4RB3 C;  3V4G A;  4H0E A;  2KJB A;  4AIJ A;  3L7W A;  3ZN0 A;  1YW7 A;  1YS7 A;  4IPA A;  2Q2E A;  2XRO A;  1ON2 A;  3K1N A;  2EFP A;  4OU0 A;  1P4X A;  2FBK A;  4RGR A;  1Z91 A;  3VOE A;  3JTG A;  4LB5 A;  1DPU A;  1QPM A;  4CO8 A;  3ZQ7 A;  1BC8 C;  2BE5 F;  5LHG A;  3HYI A;  2UXN A;  2A61 A;  3I59 B;  3IC7 A;  5L3D A;  1G3T A;  4FX0 A;  2G7U A;  3LFK A;  4G6Q A;  3TKY A;  2XVC A;  1HSJ A;  3JAM K;  3IKV A;  3KEO A;  1IUY A;  2D2W A;  2V1X A;  4PCQ A;  2VT3 A;  2VT2 A;  4P9F A;  1W7P D;  3WG9 A;  5K5O A;  2FNA A;  3KFW X;  2BV6 A;  5EEG A;  5LEK A;  1R36 A;  1S6L A;  4HOB A;  3K69 A;  2F2E A;  1Z1D A;  3BP8 A;  1OYW A;  4ON0 A;  2HQR A;  3HHH A;  3C3W A;  1YO5 C;  2V1D A;  3C18 A;  3TOA A;  3FZV A;  3P9K A;  3QU6 A;  3GLX A;  4L9N A;  2DTR A;  2D1V A;  2FOK A;  2V1U A;  3ZN1 A;  4O3M A;  3WTU C;  1O3Q A;  5ED4 A;  3LST A;  2Z5U A;  4B09 A;  1FYM A;  1JXS A;  3ZP5 A;  5LEJ A;  1A04 A;  2RVC A;  5D5W B;  1RUN A;  4P9U A;  5FLX Z;  1O7L A;  2OZU A;  3BOQ A;  1XGN A;  5BPI A;  3FMQ A;  1FYK A;  3AAF A;  1E2X A;  3KP4 A;  3N4M A;  4IRG A;  1ZRC A;  2W24 A;  4HZF A;  2A07 F;  3MAJ A;  5BMZ A;  3IRR A;  2OQG A;  1O57 A;  5TJJ A;  1P4W A;  1IN5 A;  1YLF A;  1SMY F;  3MWM A;  2ZME A;  2L4A A;  2GIV A;  3FM3 A;  4RAY A;  5AIQ A;  2PMU A;  1Z7U A;  4M71 A;  2ADU A;  4LJZ F;  1XB4 A;  1SD5 A;  4LFU A;  2Y48 A;  4HDV A;  5KVR A;  1OMI A;  2BBY A;  2QLZ A;  3HRT A;  1FSE A;  5DCF A;  3RYR A;  4A6D A;  3E6C C;  2CG4 A;  3BY6 A;  3KLO A;  4JK1 X;  1XSD A;  3F8C A;  4L9J A;  1T2K A;  1LEB A;  2W85 A;  2VE8 A;  3MZH A;  2Y0M A;  4HYE A;  3R61 A;  2HYF A;  2A6E F;  4I98 B;  2BYV E;  3FHZ A;  2FEZ A;  3L9F A;  2HFH A;  1KU3 A;  4G9Y A;  4M74 A;  2O3F A;  3KET A;  4P5O A;  2JSC A;  4ZH4 F;  2V9V A;  1QQI A;  2FU4 A;  2VON A;  1O3S A;  2VBZ A;  1HW5 A;  2M30 A;  1D3Y A;  2K7L A;  3FXU A;  1ZRE A;  2IJL A;  2ELH A;  1HBX G;  5J8C A;  1B6A A;  2IVM A;  4L9V A;  4F7Z A;  3T0Y A;  2LNB A;  3LA7 A;  5LHH A;  4AVP A;  3T5X A;  2XKP A;  2IRF G;  3LQR A;  4ZYG A;  3GFJ A;  1PP7 U;  1B1B A;  1W5T A;  2NAZ A;  2QVO A;  3CUQ C;  1FZP B;  3F23 A;  1U2W A;  4XSZ F;  3V8L A;  3QPT A;  4UNO A;  5CYV A;  1FLI A;  4BHP A;  1G3W A;  5DYM A;  1FC3 A;  1BOA A;  2R7D A;  3LA3 A;  1Z05 A;  2H6B A;  1ZHF A;  2ESN A;  4KMU X;  1E17 A;  4G6D A;  2B0L A;  2PQ8 A;  1PDN C;  2P6S A;  2XV4 S;  1MGT A;  2FML A;  5CVR A;  2LF8 A;  3WTX C;  4U0V A;  2F5E A;  3HRU A;  4IHT A;  3J81 K;  4YFN F;  3G73 A;  3LAP A;  1FBQ A;  2VOD A;  1KYZ A;  4L5J A;  2D1H A;  3LWF A;  1J9I A;  4PZJ A;  2FA5 A;  5AIP A;  3OOP A;  4UVB A;  1IXR C;  4WCG A;  4OIO F;  2RV8 A;  5DEQ A;  2HOE A;  5LLQ A;  4G7H F;  1OYI A;  2F5F A;  1UFM A;  4R79 A;  2FE3 A;  2BEO A;  2OU2 A;  2EV6 A;  4Z2Y A;  1USS A;  4HQM A;  2UWM A;  3GFL A;  5JHU A;  2HQN A;  2HGC A;  3V8J A;  3WTS C;  2GXB A;  3CJN A;  1MD0 A;  2DO7 A;  1G3S A;  2MH9 A;  1HQC A;  2DAO A;  2YSR A;  4RGS A;  2PJP A;  1IZ1 A;  2OA4 A;  4BHB A;  2O61 A;  4AD9 A;  3H3Z A;  2M45 A;  4O6J A;  3DV8 A;  2RKH A;  5CLS A;  2KIM A;  4I0B A;  1W7P A;  4XRF A;  5L3C A;  3F3X A;  1IRG A;  2XAF A;  3VEP A;  2VE9 A;  1DPR A;  2WWY A;  4ZYD A;  4HAM A;  3Q9S A;  5LGT A;  3QRF F;  3N97 A;  2ISZ A;  1K6O A;  3R0J A;  3KZZ A;  1TBX A;  3O3K A;  2PLY A;  4G94 A;  1TQP A;  2ESH A;  3H3U A;  2ZBK A;  2MC3 A;  4M9S A;  3BPX A;  5F6F A;  1LB2 A;  3M9A A;  3EQL F;  1O7F A;  2P7C B;  1F1Z A;  2RQP A;  3GW2 A;  3K0L A;  5AON A;  1G6N A;  4RGU A;  4OIP F;  5LRR A;  4IVN A;  2MBF A;  2E1N A;  1B59 A;  3GEZ A;  5DCM B;  4EJU A;  4KFC A;  3GFI A;  4MHG A;  1ONV A;  5BOX A;  2QM3 A;  2DQR A;  2QQB A;  4S04 A;  2GZW A;  2J5O A;  4I0A A;  1BI1 A;  1XSX A;  4KNY A;  3MEX A;  5E8I A;  1IXC A;  3GFM A;  3HHG A;  3K9T A;  1QGP A;  3PQJ A;  2GA2 A;  3NQO A;  4U0W A;  1FWZ A;  2VOO A;  1EV7 A;  1LDK B;  1T0F A;  5D8K B;  2NNY A;  3COA C;  1XDU A;  4U7D A;  4I7H A;  1MDM A;  3RJP A;  2VBY A;  2PEX A;  5E18 F;  2JTV A;  4WXH A;  1C0W A;  2L01 A;  2KIU A;  4XLP F;  5HDG A;  5EEH A;  1CF7 B;  2KJC A;  2MD5 A;  4RB1 A;  4HX7 A;  5LHI A;  2XIG A;  2K4J A;  2Y75 A;  2YPR A;  3E6D A;  1QO0 D;  2ZFW A;  2YR2 A;  3LQQ A;  2QQ9 A;  5FFX A;  1HXD A;  2E1C A;  2P4W A;  2JRT A;  3S2W A;  4LGW A;  1BI3 A;  2P5V A;  4R1H A;  4HF1 A;  4XLN F;  3QP5 A;  5LRS A;  4UV9 A;  3GXO A;  3TOB A;  4UVC A;  4G7Z F;  5BS6 A;  2VOP A;  4HF2 A;  1J5Y A;  4GYG A;  3RYP A;  5HS8 A;  4U88 A;  4CIC A;  3CTA A;  4MTD A;  2QBY A;  4KIC A;  2YU3 A;  3F21 A;  1YW8 A;  3EYI A;  1HKQ A;  2XAQ A;  4OIQ F;  1BC7 C;  5BQT A;  2OBP A;  1KQ0 A;  1XGS A;  5DUK A;  4NQW A;  2O6G E;  1XDS A;  4I01 A;  2ETH A;  4N9H A;  4ENJ A;  4D0P A;  4BAY A;  3IL2 A;  5ERI A;  1TNS A;  3FMS A;  3SXY A;  3V8K A;  1YIO A;  4LLG F;  4L0Y B;  4IJA A;  4CGZ A;  4LB6 B;  3TDU C;  5FO5 A;  1YG2 A;  2JT1 A;  4IXA A;  3IKT A;  3JTH A;  2PBI A;  3R4K A;  4ZYE A;  3U2R A;  1Z9C A;  4AIK A;  3KP5 A;  1U8R A;  2PMH A;  3F8B A;  3JSP A;  3SZP A;  3WTT C;  3EUH A;  4FX4 A;  2L02 A;  3I5U A;  1LDD A;  4PGG A;  1QZZ A;  3RIR A;  5A2Q Z;  2JZY A;  4KIG A;  2HYG D;  1LNW A;  4OMZ A;  1SFE A;  5D8L B;  1TW3 A;  3T1B A;  2FF4 A;  1SFU A;  3PFI A;  4OIR F;  1QZY A;  2P5L C;  2XGX A;  1S7O A;  5E20 A;  3ULQ B;  3I54 A;  3G3Z A;  1RUO A;  3ISP A;  5E1Z B;  2RC4 A;  1EH7 A;  1IN7 A;  3K1P A;  1FSH A;  2GXG A;  4MGR A;  1I6X A;  3ELK A;  4L5I A;  5D4R A;  2XHK A;  3GVA A;  2FQ3 A;  1JHH A;  4A0X A;  4JBA A;  5CVV A;  2ZO4 A;  2DK5 A;  3GZ5 A;  3MFK A;  5FFZ A;  4L9T A;  2OAZ A;  2CO5 A;  1YYV A;  4QWQ A;  4WX9 A;  3D5L A;  3ML6 A;  1J2X A;  5ICC A;  3FM5 A;  3WE3 A;  2RGV A;  4YIF A;  3RPU A;  5HLH A;  2R7F A;  1TNT A;  1H0M A;  3E5Q A;  3HSF A;  4HX4 A;  1K7A A;  2UXX A;  3J81 Z;  2F5C A;  4RS8 A;  3HOS A;  3CLO A;  2EA4 A;  2G9W A;  1T38 A;  4UUV A;  1S8N A;  4LK0 F;  2FBI A;  3RKY A;  1YTY A;  2RDP A;  1ZLJ A;  3JSO A;  3M8F A;  2XAG A;  1OKR A;  3E5X A;  4KN7 X;  1R5H A;  4A12 A;  4CXF A;  2MLG A;  1FBU A;  3GUD A;  2W84 A;  3E6M A;  2FMY A;  5F64 A;  4MTE A;  4LMY A;  4I02 A;  3QU3 A;  2CYY A;  3J7A O;  3WU0 A;  3WGH A;  1FY7 A;  1RI7 A;  2NYX A;  4HDU A;  1IRF A;  1MKM A;  4YFK F;  4O5V A;  1SD7 A;  1RNL A;  2L4M A;  2XUB A;  1FX7 A;  1MJA A;  4KIB A;  4DNC A;  3FWE A;  1ZAR A;  4GYI A;  4EJO A;  5A2Q K;  2DI3 A;  3EDP A;  4Q5S F;  5LGN A;  3SHF A;  2Q0O A;  3MZY A;  1HKS A;  1LVA A;  5E1W A;  2PI0 A;  2L54 A;  4BYY A;  3HOT A;  3C7J A;  3J80 Z;  2A69 F;  3I0T A;  3VFZ A;  1UHW A;  4ENK A;  2H27 A;  1I5Z A;  2ZJ2 A;  5CVI A;  4N0B A;  1XCB A;  3CUQ A;  2OZ6 A;  1BJA A;  1P4A A;  1T6S A;  4LG0 A;  3M7G A;  5K5Q A;  1KU7 A;  1XSV A;  3ZMS A;  4U0Y A;  3DKW A;  3DFG A;  2NS0 A;  1SFX A;  4WF2 A;  2P8T A;  1IAW A;  1IF1 A;  1R22 A;  3F6V A;  4HV6 A;  4Y13 A;  4P96 A;  1ZRF A;  3ZMD A;  3KCC A;  5L3B A;  5J6X A;  1B9M A;  4LD5 A;  1YQA A;  3KZY A;  1R1U A;  5CVU A;  1T39 A;  3WGI A;  4RAZ A;  2ZME B;  5LGU A;  1Y0U A;  3GWZ A;  2ACJ A;  2DLL A;  2FBH A;  3O6B B;  1ZRD A;  1OR7 A;  4HQE A;  2AS5 F;  2YX4 A;  4KMF A;  3IHU A;  2A3S A;  1UB9 A;  2VBW A;  1XGM A;  3WTY C;  1Z6T A;  1K79 A;  1BBY A;  4M9X A;  4HLX A;  3R0A A;  2HTJ A;  3RI4 A;  4KYW A;  1U5T C;  3K1M A;  3WTZ A;  3QOP A;  1RZ4 A;  1SD4 A;  5L3F A;  2MLK A;  1G4D A;  1B4A A;  2FRH A;  4A5M A;  4E70 A;  4WWC A;  4EJT A;  2P6T A;  3B02 A;  3PQK A;  2COM A;  2OD5 A;  4P55 A;  4WK8 F;  2DU9 A;  4ESJ A;  3ERE D;  3DF8 A;  3CDH A;  5FD6 A;  4MEX F;  1KYW A;  1LQ1 A;  2AXL A;  3TDZ C;  2MH2 A;  2E7X A;  5JVT A;  2Z99 A;  3CUO A;  1O3T A;  3KE2 A;  2TDX A;  3E3V A;  1KGS A;  2HS5 A;  3FXR A;  1ZGJ A;  1TQI A;  3J80 K;  2FXA A;  3E97 A;  5BPD A;  1W4M A;  2IA1 A;  3M8E A;  2HWV A;  1J75 A;  3GX4 X;  1R23 A;  5KK1 A;  5H20 A;  1P2F A;  2VC1 A;  3FMR A;  4EM2 A;  1IN6 A;  2LKP A;  2FSW A;  3BJA A;  2DBB A;  3DEU A;  3HSR A;  4FT8 A;  3KP2 A;  4PDK A;  1JGS A;  1PUE E;  4KT5 C;  2CWE A;  2IPQ X;  4BQA A;  3FXQ A;  2UZK A;  4KA4 A;  2X4H A;  3V7S A;  5D5X B;  4MEY F;  3BWG A;  1CGP A;  2DFI A;  3I59 A;  3FX3 A;  1O3R A;  4G8X A;  4YG2 F;  3IWZ A;  3P7N A;  2M8E A;  4CYD A;  4A6E A;  3WTV C;  1LEA A;  2XKO A;  4FHT A;  4LLL A;  3ROU A;  1SD6 A;  1MJ9 A;  1SMT A;  4R8H A;  3SFZ A;  2K27 A;  1AWC A;  3RDI A;  2ZCW A;  1OPC A;  1S3J A;  3RTR A;  4HX8 A;  4G7O F;  2XRN A;  1R7J A;  5E17 F;  3D0S A;  3JW4 A;  1XMA A;  2A6H F;  3MCZ A;  4YII A;  2EJR A;  4KN4 X;  3ZMT A;  2EFQ A;  2DT5 A;  2CW0 F;  1JHF A;  3KLN A;  3HRM A;  3U1D A;  2HTS A;  2QWW A;  2PG4 A;  2IT0 A;  3K2Z A;  1U78 A;  2IA0 A;  5CJ9 A;  3T8R A;  3QP6 A;  2GWR A;  2Z33 A;  5F1R A;  1J59 A;  4A2U A;  1W7P B;  1QBJ A;  2J5P A;  4OIN F;  1ZYR F;  3I64 A;  3IWF A;  3VOD A;  1YW9 A;  2D45 A;  1YFH A;  4A0Z A;  5JR3 A;  4ENN A;  4HA8 A;  5J8F A;  3GF2 A;  3ZMZ A;  2OQR A;  4BH9 A;  2Z3Y A;  3OV8 A;  3V7C A;  1OYY A;  4Y17 A;  1WSU A;  3T8T A;  4M6Y A;  4WXD A;  4N9I A;  3SZT A;  3HTS B;  4HF0 A;  4EV0 A;  4IRI A;  1UHM A;  2QEN A;  4EM1 A;  3CO7 C;  1J7K A;  1LDJ A;  2ZXJ A;  4MQ9 F;  4HW0 A;  5H6Q A;  3ECH A;  5DUI A;  1DP7 P;  2HKX A;  2V6C A;  4KDP A;  3NRV A;  2HKO A;  1GXQ A;  2VXZ A;  1WI9 A;  3RKW A;  3WGG A;  2LDU A;  5IT3 A;  5ILS A;  4EQQ A;  2O0Y A;  1P6R A;  3W6J B;  3TO6 A;  2EWN A;  4UHT A;  4YFX F;  1MDM B;  5D6F A;  3RKX A;  4JQF A;  4BNC A;  4GO1 A;  1F4K A;  2KKO A;  3DQV C;  1VTN C;  1BN5 A;  2E7W A;  2EFN A;  3DXJ F;  4RB2 C;  4IF4 A;  2H6C A;  2VN2 A;  2P7V B;  2WC2 A;  1EH6 A;  2R3S A;  2NNN A;  2WTE A;  1B9N A;  3V7R A;  4GXO A;  4M9Z A;  5IT9 Z;  2DPU A;  1L3L A;  1WRJ A;  4EMS A;  2Q8K A;  1FOK A;  3WU1 B;  2K86 A;  3F8M A;  2VC0 A;  3RPQ A;  4AIH A;  4CHU A;  4TV7 A;  2GA1 A;  2W25 A;  1H9T A;  3HSE A;  2XAJ A;  1R1V A;  1KQ9 A;  3LAJ A;  1ZN2 A;  3HUG A;  3Q5F A;  2FNP A;  4EM0 B;  4UV8 A;  1ZLK A;  5HDN A;  1RIO H;  2V79 A;  3P9I A;  2EFW A;  4OMY A;  1KQ8 A;  2CFX A;  2QBY B;  4OOI A;  1KU9 A;  1TW2 A;  5DV5 A;  5DD4 A;  1LJ9 A;  2EK5 A;  1ZG5 A;  5K1Y A;  2K4B A;  2F5D A;  1TTY A;  2CSO A;  5TRD A;  2GQQ A;  1IXS B;  3HRS A;  2X0L A;  3F72 A;  1P92 A;  1F9N A;  3E5U A;  1FPQ A;  4XSX F;  1EH8 A;  5LBQ A;  3I4P A;  4LLN A;  2C6Y A;  5HDK A;  1U6G A;  3EYY A;  4HBL A;  1JE8 A;  3E6B A;  1WQ2 A;  2XAS A;  1XN7 A;  2A68 F;  1FBS A;  2P5K A;  5E1X A; 
#chains in the Genus database with same CATH topology
 5ILV A;  2Z9O A;  5HLG A;  3KP7 A;  3TO9 A;  3EET A;  5M5W J;  4C2U A;  3GBG A;  1MZB A;  4JX6 A;  1D1C A;  4ZYH A;  2ZKZ A;  3FXJ A;  3GYH X;  2JQ7 A;  4EJW A;  3L2C A;  1R58 A;  2OF7 A;  3FF5 A;  3DEE A;  5D4S A;  5EZH A;  4M3B A;  3TO7 A;  4QLC U;  1TZL A;  3REO A;  2QQA A;  5K5R A;  2BHZ A;  2HOA A;  3A4C A;  4DBR A;  5JFR A;  2JPB A;  2O7O A;  2X51 A;  2EV0 A;  4A0Y A;  5L3E A;  1WVR A;  4EJV A;  1WKM A;  1H8A C;  1ZTR A;  3OS1 A;  2E35 A;  2HDC A;  2CQK A;  1H9G A;  1GVJ A;  2IP2 A;  2P81 A;  2WAF A;  3QPS A;  2MA3 A;  2VPL A;  1BIB A;  1OFC X;  4XRS G;  2EB7 A;  4XQF A;  1D0Y A;  4KIF A;  2Z16 A;  4IRH A;  2ZNY A;  3R6S A;  3SZG A;  4CSW A;  2AQF A;  2M1B A;  2QF7 A;  3BRO A;  5IT9 K;  2W57 A;  4E7I A;  2K3F A;  4AWX B;  1WGX A;  3IRQ A;  5FLX K;  1V4R A;  1X4O A;  4I2O A;  2OPT A;  4E6K G;  2CJJ A;  4Q47 A;  4BJT A;  5FKO A;  1HF0 A;  1J0R A;  4GCV A;  3O8G A;  4BKX A;  3O2P E;  3QOE A;  3I71 A;  2XAH A;  3Q9V A;  4GGG A;  3S93 A;  2DK8 A;  3K4J A;  4WXC A;  2LVS A;  3MD2 A;  5CVJ A;  2QUF A;  3WOD F;  4PGH A;  2LBF A;  3WTW C;  3QAH A;  3KYL A;  1FTT A;  1VI0 A;  1I1G A;  4M6V A;  1WJF A;  2NS7 A;  2E1O A;  3SEQ A;  2L7Z A;  4F92 B;  3DBH B;  3QYE A;  2CV1 A;  4RA2 A;  4RDU A;  4XLA A;  2LFB A;  1VQL I;  2AXT C;  3HTU A;  3CO6 C;  4MNU A;  4A69 C;  4CZZ A;  4I76 A;  3TMO A;  3DPL C;  3NEU A;  1D8K A;  4XBF A;  5E3O A;  4S05 A;  4K2E A;  1N25 A;  3H0D A;  1PP8 F;  1ERD A;  4ETS A;  4XMY A;  4JOM A;  5DCM A;  5C3E J;  2HR3 A;  1N78 A;  4BXU A;  2BVM A;  1BM9 A;  2IAI A;  1F5T A;  1X3Z B;  2W7N A;  1DUX C;  3SFI A;  2BXY A;  2QA4 I;  3K4K A;  2O8X A;  3K70 C;  4CDG A;  2WAE A;  4B8X A;  2LSO A;  1U3E M;  5HVQ C;  3FBI B;  4XKV A;  2STT A;  4CA0 A;  5FB2 A;  4BXF A;  2DFH A;  2EA2 A;  1DDN A;  1WWX A;  4Y15 A;  4AC0 A;  2G7H A;  5HOD A;  1Q1H A;  3P9C A;  1G59 A;  3AG2 H;  3HOW J;  5ILU A;  1FNN A;  1S29 A;  1X1P A;  5ICG A;  1ODD A;  2H09 A;  3OR2 C;  2YX7 A;  2CFO A;  3FIW A;  1AKH B;  5KAF C;  2E2H J;  1A6Q A;  3LSM A;  4FIS A;  1U5T A;  3VYT B;  2NRA C;  2NOJ B;  1CQT A;  2ME6 A;  3OOU A;  3QQA A;  3PIP F;  2EFO A;  4PSX A;  1BI0 A;  3OSG A;  2HXO A;  5D6E A;  1G3Y A;  4LIU A;  3EPZ A;  1E3P A;  4M72 A;  4MQV A;  1TQM A;  1MW7 A;  4UUS B;  4Q48 A;  1LFP A;  3GZ6 A;  3KEQ A;  3ZMV A;  1ZEL A;  2GOX B;  3CCQ I;  3DP7 A;  3I4M J;  1HST A;  3QYF A;  4NNJ A;  2K02 A;  1T33 A;  5ICE A;  2BGC A;  1Y1W J;  2M87 A;  3KP3 A;  4Y4R A;  5HLT A;  2DPD A;  1STZ A;  1K78 A;  1WJ5 A;  4ESB A;  2R7Z J;  3L2W A;  3IUO A;  4G6T B;  4CH7 A;  1XC5 A;  1YOV B;  3GO5 A;  2ZNZ A;  3DKY A;  5FRO A;  4EVI A;  4HLY A;  1FOX A;  3W6K B;  2DJN A;  1M1E B;  4FAS D;  1KA8 A;  1CF7 A;  1HW2 A;  3LSR A;  1ZGA A;  5ICF A;  2OCC H;  1ZQ3 P;  2VJ4 A;  1UCR A;  3TQN A;  3B73 A;  4UVA A;  2XF6 A;  5E79 C;  4A3K J;  1VQN I;  2DQL A;  1ON1 A;  2IEK A;  3H36 A;  3PIO F;  4A3B J;  1FYL A;  1X1D A;  1ULY A;  1LUJ B;  1YHQ I;  1A35 A;  1S7A A;  3QWL A;  4EGZ A;  4BQO A;  2QZ8 A;  2M5W A;  1XGO A;  4BEH A;  4QTR A;  2LF7 A;  5GTH C;  4A5N A;  3OY9 A;  1KU2 A;  4BY7 J;  1IN8 A;  3JRC A;  3S1M J;  4HPQ A;  3ZRG A;  2CQX A;  1IRZ A;  2PN6 A;  3BJO A;  2DA6 A;  3CUQ B;  1U9N A;  2F4O B;  5HLI A;  3CD6 I;  5DDG A;  2DW4 A;  4LG0 B;  1BIA A;  3BJ6 A;  2ISY A;  4HV5 A;  2KIF A;  1HLV A;  3E7L A;  1WFX A;  1ZG1 A;  1Z3X A;  1W5S A;  3F22 A;  2JPC A;  2KRF A;  6PAX A;  4DYQ A;  2AHQ A;  1BI2 A;  2WB1 N;  3F8F A;  1DU6 A;  3IH4 A;  1BOB A;  2DOA A;  3TGN A;  3ZMU A;  2VUM J;  2DMQ A;  3L2V A;  2O03 A;  1MMD A;  4F52 A;  1V3F A;  2YS9 A;  1XG1 A;  2L7K A;  2W00 A;  1R49 A;  3MQ0 A;  4BU2 A;  2D5V A;  1A6I A;  5FD5 A;  1VQ8 I;  2LBF B;  1R00 A;  4I09 A;  3SQN A;  1GHC A;  1ZR2 A;  3BPV A;  2X6X A;  2EZL A;  3CF2 A;  3AKZ A;  5IP6 A;  1FP2 A;  2IW5 A;  1Z6R A;  3HPH A;  5L3G A;  1T98 A;  3A1Y A;  4L18 B;  1I1S A;  4U7B A;  1NHA A;  3ABT A;  5F08 A;  4ASN A;  2STW A;  4IHS A;  1AOY A;  4NB5 A;  5HS7 A;  1P7J A;  3U9G A;  3BG6 A;  3ECO A;  4ESF A;  1IUF A;  4UXN A;  2B63 J;  1TT0 A;  1L0O C;  3WE2 A;  2IS1 A;  4ZZD A;  4BBS J;  3HIF A;  1I27 A;  2R7O A;  3JAM Z;  2CUZ A;  1IW7 F;  4CCK A;  1SAX A;  5B1B H;  1FT9 A;  3BZ6 A;  4F3Q A;  2HI3 A;  4ZZL A;  1F43 A;  3M1E A;  3CCM I;  3OYL A;  2GOM A;  3VB2 A;  2ZC2 A;  2QYO A;  4XN0 A;  2PFB A;  4NBQ A;  1JKO C;  5HOO A;  2XDV A;  1XMK A;  4L0Z B;  1YS6 A;  2OC6 A;  3S8P A;  3ABU A;  2KRC A;  3ZPL A;  4NHJ A;  4BHC A;  5D5U B;  1X3U A;  4KUM A;  2Q1Z B;  3DCF A;  1HKT A;  1IN4 A;  1R1T A;  4RB0 A;  5D5V B;  1T0F C;  3I58 A;  2LKX A;  4FQG A;  2HOS A;  1U5T B;  2CS3 A;  2EV5 A;  1QU3 A;  2HZT A;  3I53 A;  3X2Q H;  3OYE A;  1D8J A;  2WAD A;  2NOG A;  2CQN A;  2WA0 A;  3I3L A;  3QPH A;  3TP0 A;  2H94 A;  2BXZ A;  3ZR8 X;  2AQE A;  2DJI A;  4PJN A;  2IA2 A;  1RRJ A;  1REP C;  1UHS A;  3L00 A;  5H6R A;  2XPW A;  1B8I B;  3MKW B;  3KP6 A;  3BDD A;  2VL8 A;  5FGM A;  2XSJ C;  4MFE A;  5HS9 A;  5IPA A;  4EGY A;  2JUC A;  4OAZ A;  3F8N A;  1ZAO A;  5J47 A;  3H5N A;  3PUB A;  3H92 A;  5GTI C;  5E8G A;  3F6O A;  4DQ2 A;  2M0M A;  4Q4Z F;  1BR4 A;  2CH0 A;  2CV0 A;  4AVZ A;  4CZC A;  2VBX A;  1K78 B;  4RGX A;  1FP1 D;  1MJB A;  3K4L A;  1GXP A;  2HOT A;  3CCU I;  3HL2 A;  2VKV A;  2QEX I;  4BE0 A;  2L3D A;  4OAY A;  2CGP A;  3L09 A;  3HOX J;  4ENM A;  4M73 A;  4A3L J;  4F91 B;  1UST A;  3DPT A;  4M6X A;  2RN7 A;  3BLY A;  5JI6 A;  1SVM A;  3OYK A;  3SYT A;  3FXK A;  1MBK A;  1QNT A;  1XCV A;  2WV0 A;  4ZTJ A;  3C2G A;  1R5G A;  2R7X A;  5EDN A;  1HW1 A;  1ZH5 A;  3RZO J;  4OWR B;  2GAU A;  2F4M B;  1VQ6 I;  5EF6 A;  3KYD B;  3DKX A;  4XOR A;  3HDD A;  1ZG3 A;  1TLH B;  5DD8 A;  3R60 A;  2XSD C;  1D5V A;  4BEH B;  1DGW Y;  4AUX A;  2LR8 A;  4LK1 F;  2HEO A;  1XD7 A;  3BR6 A;  2A5Y B;  3LA2 A;  3C1D A;  2RNJ A;  4RB3 C;  3I55 I;  3V4G A;  2K9L A;  4H0E A;  1R71 A;  2KJB A;  3DPU A;  4AIJ A;  1ETV A;  3L7W A;  3ZN0 A;  1YW7 A;  1YS7 A;  2LLK A;  4IPA A;  5F04 A;  2Q2E A;  4N4N B;  4XRM A;  4D5C A;  2XRO A;  1ON2 A;  3K1N A;  3ZQC A;  4H4K C;  2JWT A;  2EFP A;  4OU0 A;  1P4X A;  2FBK A;  4RGR A;  1Z91 A;  2XGE A;  2PJR A;  3VOE A;  3JTG A;  2UV1 A;  1QHG A;  4LB5 A;  4DIQ A;  1Y56 A;  1QPM A;  1DPU A;  3TP3 A;  5LFA A;  4CO8 A;  1V5F A;  2K9N A;  3KPH A;  1W1W E;  3ZQ7 A;  1ETK A;  1BC8 C;  1WH5 A;  3PO3 J;  1BW6 A;  2BE5 F;  5LHG A;  3HYI A;  1Y8Q B;  2UXN A;  2A61 A;  3I59 B;  3IC7 A;  5L3D A;  1G3T A;  4A3F J;  4XKB A;  4FX0 A;  2G7U A;  1MMN A;  3LFK A;  3OYH A;  4G6Q A;  4Y33 A;  2XVC A;  3HEF A;  3TKY A;  2LYC A;  4BE1 A;  1HSJ A;  3JAM K;  1E0E A;  3IKV A;  2ZXI A;  3KEO A;  1IUY A;  2D2W A;  2V1X A;  4PCQ A;  4FCY A;  1JTY A;  3A03 A;  3CCV I;  5HNF A;  5M3F J;  2VT3 A;  2VT2 A;  1K83 J;  2HZD A;  4P9F A;  1W7P D;  1JTX A;  4PFO A;  3WG9 A;  5K5O A;  2FNA A;  4EEF G;  3KFW X;  2BV6 A;  5EEG A;  2R7Q A;  1HDD C;  2MFZ A;  5LEK A;  1SVO A;  1WH7 A;  2L2O A;  3AL0 C;  1R36 A;  1S6L A;  4HOB A;  2IGN A;  4XLC A;  3J7Y J;  2Y0S A;  4B1R A;  2R5Z A;  2XGD A;  3K69 A;  2F2E A;  1X1C A;  2W1O A;  3FDY A;  3KZI C;  1Z1D A;  3BP8 A;  2MW8 A;  5GAG J;  2L9S A;  3UR3 C;  3EUH C;  4FTH A;  4XN3 A;  1OYW A;  4L5E A;  5K7Z A;  4IOC F;  1ITY A;  2HDD A;  4ON0 A;  2HQR A;  3JRG A;  3HHH A;  3C3W A;  2B7E A;  1YO5 C;  2V1D A;  3C18 A;  3DWL E;  3TOA A;  2COB A;  3FZV A;  3P9K A;  2WY7 Q;  2DT7 B;  3QU6 A;  4XKW A;  3GLX A;  1R4N B;  5DM7 F;  4A3J J;  1IDZ A;  4L9N A;  2DTR A;  2D1V A;  2FOK A;  2V1U A;  3GTQ J;  3ZN1 A;  3TW6 A;  4O3M A;  3WTU C;  1O3Q A;  1H89 C;  3AG4 H;  1K4T A;  5ED4 A;  4UUT A;  3LST A;  2IXS A;  2Z5U A;  4B09 A;  1VQM I;  1FYM A;  2H8R A;  1T56 A;  1JXS A;  1U0J A;  2FUG 2;  3ZP5 A;  1MIJ A;  4RM2 A;  1ACI A;  5LEJ A;  1A04 A;  2RVC A;  3M8J A;  5D5W B;  2Y30 A;  2QSF X;  1RUN A;  3PO2 J;  4P9U A;  1OCT C;  2CUF A;  5FLX Z;  1VQK I;  3MN2 A;  1O7L A;  2KIS A;  2OZU A;  3BOQ A;  2R7S A;  1XGN A;  2R92 J;  1XTA A;  4II3 A;  4NUB A;  4B48 A;  5BPI A;  3GTG J;  4S0H B;  2H1K A;  3FMQ A;  2DA2 A;  5J4V A;  1FYK A;  1TC3 C;  3S2H J;  3AAF A;  1MBF A;  4HEA 2;  1E2X A;  1UEL B;  2VAS A;  2LC2 A;  3KP4 A;  3N4M A;  4IRG A;  1ZRC A;  2W24 A;  3BG9 A;  3JRA A;  4XNF A;  4HZF A;  2A07 F;  3MAJ A;  5BMZ A;  1Y1V J;  3IRR A;  3H1C A;  2V9P A;  5JHF A;  4YRV A;  2OQG A;  1O57 A;  2ZME C;  2VI6 A;  3H9J A;  5TJJ A;  1P4W A;  2KPM A;  1IN5 A;  1YLF A;  1SMY F;  4FE4 A;  3KIO A;  1B72 A;  5IOY A;  3MWM A;  2ZME A;  2L4A A;  2GIV A;  4E7K A;  3FM3 A;  2LY9 A;  2PJR B;  3CME I;  5GPC A;  3BTI A;  4RAY A;  5AIQ A;  1OCZ H;  2PMU A;  3GLL A;  5JLX A;  3ZQI A;  3S14 J;  2A05 A;  1MNM C;  1Z7U A;  4M71 A;  3MVP A;  2ADU A;  2KDZ A;  4YEL A;  2MD0 A;  4LJZ F;  4M3E A;  1XB4 A;  4RAG A;  1Z67 A;  2QSH X;  1SD5 A;  4LFU A;  2Y48 A;  1Y39 A;  4PJL A;  4HDV A;  5KVR A;  1IGN A;  3RZD J;  1HCR A;  1OMI A;  1Z77 A;  2BBY A;  2QLZ A;  3F0C A;  1IV6 A;  1BL0 A;  2QQ8 A;  3BTC A;  3HRT A;  1FSE A;  2JA2 A;  3JRE A;  5DCF A;  3RYR A;  4A6D A;  2OJE D;  4QPO A;  2M0C A;  5EJC A;  3E6C C;  2CG4 A;  3A02 A;  3BY6 A;  1ZKG A;  2K85 A;  3KLO A;  2V4J C;  4JK1 X;  3F8C A;  5KCM A;  1XSD A;  4XKC A;  4L9J A;  1T2K A;  1LEB A;  2W85 A;  2VE8 A;  2VXD A;  2FOW A;  3S16 J;  3G1L A;  3MZH A;  2ZJQ F;  4DJA A;  4I6Z A;  2Y0M A;  4HYE A;  3Q0U A;  3H9Q A;  3R61 A;  2HYF A;  4NC8 A;  1JT6 A;  2A6E F;  4I98 B;  2BYV E;  3LSK A;  3FHZ A;  2FEZ A;  1VQ7 I;  2KZV A;  5F0C A;  3L9F A;  1PUF A;  2HFH A;  1KU3 A;  4G9Y A;  3S1Q J;  1HDP A;  5B5E C;  2R5Z B;  4M74 A;  4B3A A;  3FBN B;  3FHN A;  2JA7 J;  2O3F A;  3KET A;  3G1M A;  4P5O A;  2JSC A;  4ZH4 F;  2V9V A;  1QQI A;  2FU4 A;  2VON A;  4ZDO A;  1O3S A;  2VBZ A;  4KIT B;  3G1O A;  1HW5 A;  5F0F A;  1KZH A;  2M30 A;  5KHD A;  1E3H A;  1XX5 A;  1D3Y A;  2K7L A;  2F6C A;  3FXU A;  2TRT A;  3VPR A;  1ZRE A;  2IJL A;  3BCB A;  2K40 A;  2DFE A;  2ELH A;  2R5Y B;  2DA3 A;  1HBX G;  5J8C A;  3N05 A;  1B6A A;  2IVM A;  4L9V A;  1NK3 P;  4F7Z A;  3T0Y A;  1GT0 C;  2LNB A;  3LA7 A;  2R93 J;  2R7V A;  5LHH A;  1LE8 B;  4AVP A;  3T5X A;  2XKP A;  1FJL A;  2IRF G;  3LQR A;  3L1P A;  4ZYG A;  4MLO A;  2X6W A;  3GFJ A;  1PP7 U;  3S3M A;  1B1B A;  1W5T A;  2NAZ A;  1N77 A;  2QVO A;  5B1A H;  3CUQ C;  4A3G J;  4E7S A;  3HC7 A;  1FZP B;  1U2W A;  4XSZ F;  3V8L A;  2O5R A;  3F23 A;  3QPT A;  4UNO A;  2Z2S B;  5CYV A;  3CCY A;  1FLI A;  4BHP A;  4CCJ A;  1G3W A;  2WB1 A;  2QKM B;  5DYM A;  1FC3 A;  1XS9 A;  1BOA A;  2R7D A;  3LA3 A;  3Q0W A;  1Z05 A;  3BZC A;  3K6G A;  4JYK A;  3HBL A;  2H6B A;  1ZHF A;  2ESN A;  2JN6 A;  1JKQ C;  1WJD A;  2KHM A;  4KMU X;  3ZQH A;  1E17 A;  2E19 A;  4G6D A;  2BZT A;  2KDO A;  2B0L A;  2KT0 A;  2PQ8 A;  3ZQF A;  3L2Q A;  1PDN C;  2M3A A;  3TED A;  2P6S A;  2XV4 S;  1WJE A;  3OS2 A;  1MGT A;  2FML A;  3HUG B;  1EF4 A;  4YIR X;  1ETQ A;  5CVR A;  2NVT J;  3I56 I;  2M4K A;  1VQ9 I;  2LF8 A;  1VQP I;  2VB6 A;  3WTX C;  4U0V A;  2F5E A;  3HRU A;  4IHT A;  1BJZ A;  2K3P A;  4CCM A;  3CZ6 A;  3J81 K;  4BXX J;  4YFN F;  3G73 A;  3LAP A;  1OR7 C;  3LSG A;  1FBQ A;  2M7A A;  2VOD A;  3LMM A;  3HOV J;  3HGG A;  1K4S A;  1KYZ A;  4IQJ A;  4L5J A;  2D1H A;  3CP8 A;  3LWF A;  2OTJ I;  1J9I A;  1DP3 A;  2E2J J;  2N8G A;  4PZJ A;  1RR8 C;  2FA5 A;  3J7A Y;  5AIP A;  3OOP A;  3A01 A;  4UVB A;  1IXR C;  1ZGW A;  4WCG A;  4OIO F;  1TWG J;  2QCO A;  2RV8 A;  5DEQ A;  3ZXS A;  3OYF A;  2HOE A;  5LLQ A;  2YU9 J;  2LMD A;  4HNT A;  1I3A A;  4UY8 I;  4G7H F;  1OYI A;  4U87 A;  4I99 C;  2F5F A;  2X1D A;  1Z0X A;  2KZG A;  2KL4 A;  1IV8 A;  1UFM A;  4R79 A;  2FE3 A;  9ANT A;  1Y0N A;  2BEO A;  2OU2 A;  5CQE A;  2EV6 A;  4Z2Y A;  3RCO A;  2QKL B;  4B4C A;  5K7H A;  1SAN A;  1USS A;  1LVK A;  5C44 J;  4HQM A;  4IEJ A;  2UWM A;  3IAM 2;  4RM3 A;  2X85 A;  4CYC B;  3GFL A;  1MBH A;  5JHU A;  4B3X A;  5IP9 J;  2HQN A;  2HGC A;  3V8J A;  3WTS C;  2H8W A;  1ENH A;  1VZ0 A;  2GXB A;  3CJN A;  3RSN A;  3RPU D;  1MD0 A;  2DO7 A;  1G3S A;  2MH9 A;  1HQC A;  2DAO A;  3HGY A;  2NVQ J;  2YSR A;  1MSE C;  1GV5 A;  4RGS A;  3NAR A;  2DXI A;  4A93 J;  2DA5 A;  5J3L A;  3K10 A;  1PUF B;  2PJP A;  1IZ1 A;  3HPG A;  1DU0 A;  4Y3O A;  2CW8 A;  2OA4 A;  2OUM A;  4BHB A;  3Q0V A;  4DZP A;  2O61 A;  5FKK A;  4AD9 A;  1XMX A;  2ME0 A;  3S1R J;  2DT6 A;  3H3Z A;  2XGC A;  2M45 A;  4O6J A;  3DV8 A;  2RKH A;  4ZC3 A;  4CCN A;  4BDY A;  5CLS A;  1DQU A;  2KLO A;  2KIM A;  4I0B A;  4IHV A;  1W7P A;  4XRF A;  5L3C A;  1MH4 A;  3F3X A;  4M3G A;  1IRG A;  2XAF A;  3VEP A;  3FXM A;  3WHB A;  4GDF A;  4BQQ A;  2VE9 A;  1DPR A;  2WWY A;  3ZQL A;  4ZYD A;  1JKP C;  1FOY A;  5IOZ A;  4IKF A;  4HAM A;  1D1B A;  3Q9S A;  5LGT A;  3QRF F;  3MKL A;  3GTP J;  1IO2 A;  2JA6 J;  1V55 H;  3N97 A;  2ISZ A;  1K6O A;  3R0J A;  3KZZ A;  1TBX A;  3HKZ N;  3O3K A;  4X0G A;  2PLY A;  4G94 A;  1TQP A;  2VJI A;  2WAQ A;  2ZJR F;  2ESH A;  3H3U A;  1S7E A;  2ZBK A;  2MC3 A;  3OR1 C;  4M9S A;  4BY1 J;  3BPX A;  5F6F A;  1LB2 A;  3M07 A;  3M9A A;  1LFB A;  3EQL F;  2H1L A;  4ANJ A;  3JRI A;  1YI2 I;  1POG A;  1O7F A;  2VPR A;  1Z3Y A;  2P7C B;  2Y9Y A;  1F1Z A;  2RQP A;  3GW2 A;  4RBO A;  1ZK8 A;  1IC8 A;  3K0L A;  5AON A;  1G6N A;  2LY2 A;  1GDT A;  4RGU A;  4OIP F;  5LRR A;  5EG0 A;  4IVN A;  2MBF A;  3GTJ J;  2E1N A;  1B59 A;  5IP7 J;  3GEZ A;  5DCM B;  4EJU A;  3S17 J;  1X3W B;  3OYB A;  1WI3 A;  4KFC A;  3GFI A;  4MHG A;  1ONV A;  5BOX A;  1EKE A;  2QM3 A;  4MIM A;  2DQR A;  4NDL A;  2QQB A;  4S04 A;  2CRG A;  3VYU B;  2GZW A;  2J5O A;  3LL7 A;  4I0A A;  4PFP A;  3BG3 A;  1BI1 A;  3IH2 A;  1XSX A;  2KMU A;  4KNY A;  3PL8 A;  3MEX A;  3AG1 H;  2F48 A;  2CQ7 A;  1IDY A;  5E8I A;  2L0K A;  1IXC A;  2L9R A;  3GFM A;  3IP4 B;  2RNG A;  2HVR A;  3H5R A;  3HHG A;  3K9T A;  1QGP A;  1H88 C;  3PQJ A;  2GA2 A;  3U1K A;  2JUG A;  3NQO A;  1FOW A;  4U0W A;  1FWZ A;  3E0J B;  1PJR A;  2K9M A;  2MG4 A;  4D7N A;  1S9H A;  2ECB A;  3A01 B;  2VOO A;  1EV7 A;  1G8X A;  3ABL H;  2KQR A;  3EUK L;  1JUS A;  1LDK B;  1T0F A;  5D8K B;  5J40 A;  2NNY A;  2IS2 A;  1D1A A;  3S3N A;  1QVU A;  2VKH A;  3COA C;  1T8I A;  1XDU A;  4U7D A;  4I7H A;  1MDM A;  3DU5 A;  3RJP A;  4KJZ A;  2VBY A;  2PEX A;  1UJ8 A;  5E18 F;  4AU7 A;  2JTV A;  4XLE A;  4WXH A;  2Y9Z A;  1C0W A;  5GAD J;  2L01 A;  3ABK H;  3CCJ I;  2KIU A;  3I9V 2;  4XLP F;  4J00 A;  5HDG A;  5EEH A;  4J19 A;  2VKD A;  4HNU A;  2CMP A;  3RQ4 A;  1CF7 B;  4B47 A;  3PFY A;  3BQZ A;  4ITV A;  2KJC A;  2MD5 A;  1RC9 A;  4RB1 A;  3BR1 A;  4HX7 A;  5LHI A;  2XIG A;  2K4J A;  2BOL A;  1GLN A;  2Y75 A;  3CDI A;  3E1S A;  2MSY A;  1S5L C;  2YPR A;  3E6D A;  3JRH A;  4E7H A;  1QO0 D;  2ZFW A;  2YR2 A;  3LQQ A;  2QQ9 A;  3PUF A;  5FFX A;  1HXD A;  2V9K A;  3CCE I;  1W5C C;  2E1C A;  2P4W A;  2VJJ A;  3BC8 A;  1U9O A;  2JRT A;  3ASO H;  1BI3 A;  4LGW A;  3S2W A;  2VQG A;  3V42 A;  4ZTF A;  2P5V A;  4R1H A;  4HF1 A;  4XLN F;  3QP5 A;  3CC2 I;  5CKT A;  5LRS A;  5BNG A;  1WJA A;  4UV9 A;  4M3F A;  3GXO A;  1V5E A;  3TOB A;  4UVC A;  2HXI A;  2RAE A;  3PNY A;  4G7Z F;  5BS6 A;  3LOC A;  3W3C A;  1D5Y A;  1YE9 A;  3NWT A;  2NVY J;  2WAQ N;  3L2R A;  1UZC A;  1K61 A;  2VOP A;  3MZ8 A;  2VLA A;  2EQR A;  4HF2 A;  1J5Y A;  2ECC A;  5E3N A;  4PJM A;  4GYG A;  3RYP A;  5HS8 A;  4U88 A;  2ELK A;  2AO9 A;  1O4X A;  4CIC A;  1MSF C;  3GCM A;  1UG2 A;  5DM6 F;  2DFF A;  3CTA A;  4MTD A;  2QBY A;  1OCC H;  4KIC A;  2YU3 A;  5IY5 H;  3F21 A;  1YW8 A;  3AG3 H;  3EYI A;  1VQ5 I;  1MND A;  1IJW C;  3PNV A;  1ETO A;  1HKQ A;  2EZI A;  2XAQ A;  1BC7 C;  4OIQ F;  5BQT A;  2OBP A;  1KQ0 A;  1XGS A;  5DUK A;  4NQW A;  4B43 A;  2O6G E;  1XDS A;  4BBR J;  4I01 A;  5FKN A;  1D0X A;  2JVH A;  5EGO A;  2ETH A;  1X4P A;  4N9H A;  2L9V A;  2EZK A;  3CP2 A;  2I5U A;  4ENJ A;  5F0H A;  4D0P A;  1NK2 P;  3LSJ A;  5F27 A;  5GPA A;  4BAY A;  3IL2 A;  5ERI A;  2DOF A;  1TNS A;  3FMS A;  1A5J A;  3SXY A;  3V8K A;  1YIO A;  1BW5 A;  4LLG F;  4L0Y B;  2FQ4 A;  4IJA A;  4CGZ A;  4LB6 B;  3TDU C;  4JX4 A;  5FO5 A;  1FMV A;  1YG2 A;  2JT1 A;  4NC7 A;  4BJ5 C;  4IXA A;  2O9L A;  1TWF J;  3IKT A;  3JTH A;  3ONQ A;  2PBI A;  3R4K A;  4ZYE A;  3U2R A;  1APL C;  3OYD A;  1Z9C A;  4AIK A;  3KP5 A;  1U8R A;  2PMH A;  3HOU J;  3F8B A;  2E60 A;  3JSP A;  3SZP A;  3WTT C;  3AFH A;  4DBQ A;  3EUH A;  4FX4 A;  1JJ6 C;  3HXL A;  2L02 A;  3I5U A;  1LDD A;  3PSF A;  4PGG A;  3ZQG A;  2L7M P;  3H35 A;  4QSH A;  1QZZ A;  3D5R C;  3RIR A;  5A2Q Z;  1J09 A;  5DS9 A;  2JZY A;  4KIG A;  2K5C A;  2HYG D;  4XRS A;  1LNW A;  4OMZ A;  4A3D J;  4M3D A;  1SFE A;  5D8L B;  1OLT A;  1ORK A;  2LY1 A;  4C3I J;  2R0Q C;  1TW3 A;  4XLF A;  4Z6Y A;  3T1B A;  4AM3 A;  2FF4 A;  4E7L A;  2IGO A;  2JMW A;  1T08 B;  1SFU A;  1X1A A;  3DU6 A;  3PFI A;  2XF5 A;  1QZE A;  4OIR F;  1QZY A;  1WJB A;  2M34 A;  2P5L C;  3DEW A;  1A31 A;  2XGX A;  1S7O A;  5FLV A;  1UG0 A;  5E20 A;  1ETY A;  3ULQ B;  4HST A;  1MH3 A;  2A6T A;  3I54 A;  3G3Z A;  1RUO A;  4IHX A;  2Z1D A;  3ISP A;  4IX7 A;  5E1Z B;  2DOD A;  2RC4 A;  3OL4 A;  1EH7 A;  1IN7 A;  2E5Z A;  3K1P A;  1FSH A;  2GXG A;  1RKT A;  1IRX A;  4MGR A;  1I6X A;  3ELK A;  4L5I A;  4A3I J;  5B3S H;  5J1R A;  5D4R A;  3LSP A;  2XHK A;  1SC7 A;  2WBM A;  1EA3 A;  3CF5 F;  2QGU A;  3GVA A;  2FQ3 A;  4C3H J;  3BR5 A;  1JHH A;  4A0X A;  4JBA A;  3BR2 A;  3HM5 A;  5CVV A;  2IS6 A;  2ZO4 A;  3A2K A;  5E3M A;  2DK5 A;  3GZ5 A;  4LOC A;  3MFK A;  5FFZ A;  2DN0 A;  4L9T A;  1YJN I;  2OAZ A;  1TWH J;  1VND A;  2CO5 A;  1DGR M;  1YYV A;  4QWQ A;  3RQI A;  4WX9 A;  2M9H A;  1Y6I A;  2PMZ N;  3D5L A;  3CMM A;  3ML6 A;  3CCS I;  1J2X A;  3FM5 A;  2Q2E B;  3H9G A;  4QPQ A;  2RGV A;  3WE3 A;  5ICC A;  4YIF A;  3RPU A;  2CV2 A;  4IHW A;  5HLH A;  2W82 A;  2R7F A;  2QSG X;  4XK4 A;  2GM4 A;  1TNT A;  1H0M A;  3MKY B;  3E5Q A;  3HSF A;  3OYJ A;  2B9S A;  4HX4 A;  1X19 A;  1K7A A;  4DOZ A;  2UXX A;  1R5I D;  3J81 Z;  3ZCO A;  2F5C A;  4RS8 A;  3HOS A;  2BY3 A;  3CLO A;  4ABZ A;  2EA4 A;  2G9W A;  1T38 A;  3W2W A;  4F55 A;  2ZJP F;  4UUV A;  1S8N A;  1JI8 A;  2KRH A;  4LK0 F;  2FBI A;  1R6R A;  3RKY A;  3CLQ A;  1YTY A;  2RDP A;  3OL3 A;  3FIS A;  3OYN A;  1TT5 B;  2K9S A;  3UKG A;  1ZLJ A;  3JSO A;  4GRI A;  3M8F A;  2MAB A;  1OCO H;  2XAG A;  1OKR A;  4RLQ A;  5K7F A;  3GTL J;  3E5X A;  3ZGK A;  4KN7 X;  1R5H A;  4A12 A;  1KON A;  5HNH A;  2LRE A;  2JSP A;  4CXF A;  4NQW B;  2MLG A;  1FBU A;  3GUD A;  2W84 A;  1FTZ A;  3DBR B;  2E1M B;  2FMY A;  3E6M A;  5F64 A;  4MTE A;  4LMY A;  5EGO B;  3HZJ A;  4I02 A;  2L5Q A;  2LTP A;  3QU3 A;  1WZ2 A;  4BQN A;  2X48 A;  2CYY A;  1VQ4 I;  3J7A O;  5JVG F;  3WU0 A;  2XB0 X;  4BJ6 C;  5FJ8 J;  4DYR A;  3ERM A;  3WGH A;  1QHH D;  1FY7 A;  2XB5 A;  3B6C A;  1RI7 A;  2NYX A;  3VDX A;  1IRF A;  4HDU A;  1MKM A;  5JLW A;  2M2E A;  4DGW B;  4C9Y A;  1HOM A;  4YFK F;  3AL0 B;  4O5V A;  2LG4 A;  3O8H A;  3CES A;  1SD7 A;  1RNL A;  2L7F P;  2EH3 A;  2L4M A;  2XUB A;  3OYA A;  1FX7 A;  5LD2 C;  4MFD A;  1MJA A;  2DMT A;  3F9K A;  4KIB A;  3J7Z I;  4BAC A;  4AID A;  4X1E A;  4DNC A;  2Y2Z A;  3DTI A;  2GIZ A;  3FWE A;  1ZAR A;  2F4I A;  4GYI A;  2LH9 A;  2DI3 A;  3EDP A;  4EJO A;  5A2Q K;  2MYS A;  1P7I A;  2MGQ A;  3ABM H;  3JRB A;  4Q5S F;  1VQO I;  5LGN A;  1WJC A;  4C2M J;  3SDG A;  3SHF A;  5IYC J;  2Q0O A;  3MZY A;  3M4O J;  1HKS A;  1LVA A;  2XPU A;  2K9Q A;  5E1W A;  2PI0 A;  2L54 A;  4BYY A;  3HOT A;  1IG7 A;  3C7J A;  2DDB A;  2VKE A;  3J80 Z;  2NVX J;  2FJ1 A;  4A3E J;  1X2N A;  2A69 F;  3I0T A;  4V2F A;  3VFZ A;  1UHW A;  4ENK A;  1JUP A;  2IGM A;  2H27 A;  1I5Z A;  3S1N J;  2EIL H;  2HU9 A;  3IH3 A;  1HA8 A;  1X2M A;  2ZJ2 A;  5CVI A;  1ETW A;  3GTM J;  2CUJ A;  4N0B A;  2DA4 A;  1XCB A;  3CUQ A;  4UB8 C;  2OZ6 A;  3PSI A;  1BJA A;  1P4A A;  5FRN A;  1T6S A;  4LIV A;  4LG0 A;  3K4C A;  3M7G A;  5K5Q A;  1KU7 A;  1XSV A;  2IGK A;  1PVE A;  3D5S C;  1QA6 A;  3ZMS A;  4U0Y A;  3OYC A;  5KAI C;  3BR3 A;  4FE7 A;  3DKW A;  3HKZ A;  3FK7 A;  4JP0 A;  4PJ0 C;  3DFG A;  2NS0 A;  1SFX A;  4WF2 A;  3L2U A;  2R7T A;  3VYR B;  2P8T A;  1IAW A;  1IF1 A;  3S2D J;  3DLA A;  3HG9 A;  1R22 A;  3MMY B;  3D1N I;  3F6V A;  4HV6 A;  4Y13 A;  4P96 A;  1ZRF A;  5DTD A;  3ZMD A;  3KCC A;  5J6X A;  5L3B A;  1B9M A;  4AYB A;  1ZR4 A;  1LFU P;  2OCE A;  1V5G A;  1I6H J;  4LD5 A;  1MBG A;  1YQA A;  2X1C A;  3DTK A;  3KZY A;  2OV7 A;  5J4Y A;  1R1U A;  5CVU A;  1T39 A;  3DTE A;  1B72 B;  1AA7 A;  4XON A;  3WGI A;  4RAZ A;  5J1U A;  2ZME B;  5LGU A;  3KEY A;  4PSW A;  1BR2 A;  1Y0U A;  3GWZ A;  3OYG A;  2R7U A;  2ACJ A;  2DLL A;  3GME A;  2FBH A;  3O6B B;  3FXL A;  1ZRD A;  3IAS 2;  4BE2 A;  1OR7 A;  1JGG A;  4X6A J;  4HQE A;  2AS5 F;  2YX4 A;  2HVQ A;  4KMF A;  2W4S A;  3IHU A;  3BQY A;  2A3S A;  1TWC J;  1UB9 A;  2VBW A;  4NC6 A;  1XGM A;  2A5W A;  3WTY C;  1AU7 A;  1Z6T A;  3CMY A;  1K79 A;  1BBY A;  4M9X A;  1TL8 A;  4HLX A;  3R0A A;  2HTJ A;  3RI4 A;  1XPX A;  2E34 A;  2XF7 A;  4KYW A;  1U5T C;  3H5A A;  2I10 A;  3K1M A;  3WTZ A;  1RZ4 A;  3QOP A;  1SD4 A;  5L3F A;  2RQQ A;  1N75 A;  3W2A A;  5CPR B;  2MLK A;  5M5X J;  5FKM A;  1G4D A;  3JRF A;  3PJR A;  4C30 A;  1B4A A;  2P0W A;  2FRH A;  2ZSI B;  4A5M A;  1MNE A;  1AHD P;  2BY1 A;  4E70 A;  4WWC A;  4EJT A;  2P6T A;  3G71 I;  4II2 A;  3B02 A;  3PQK A;  5GAH J;  4A3C J;  2COM A;  1OJL A;  2OD5 A;  4P55 A;  1B8I A;  1FMW A;  2DU9 A;  4WK8 F;  4ESJ A;  3VSL A;  1WCM J;  3ERE D;  3DF8 A;  3CDH A;  3W6V A;  5FD6 A;  4MEX F;  4E7J A;  1KYW A;  1LQ1 A;  2AXL A;  3TDZ C;  2MH2 A;  2E7X A;  5JVT A;  2NVU B;  2Z99 A;  3CUO A;  4ZYA A;  1O3T A;  1NG7 A;  3OIO A;  3KE2 A;  3S3O A;  2X9D A;  2TDX A;  3E3V A;  1RR7 A;  1KGS A;  4IQ4 A;  2HS5 A;  1Z21 A;  1W0U A;  3FXR A;  2WY8 Q;  1ZGJ A;  1TQI A;  2BW3 A;  3J80 K;  3K2A A;  2FXA A;  3BG7 A;  1W36 C;  1VFC A;  4PUS A;  3E97 A;  5TGT A;  1GVD A;  5BPD A;  4D5F A;  4IHY A;  2EIK H;  1W4M A;  2IA1 A;  1I3Q J;  2CUE A;  2LKS A;  3M8E A;  2LD5 A;  3HB9 A;  2HWV A;  3OWT A;  1J75 A;  2JJ7 A;  1FEX A;  4J01 A;  1P9Q C;  3GX4 X;  2CW7 A;  1R23 A;  1YJ9 I;  4IL6 C;  1A36 A;  5KK1 A;  5H20 A;  3JRD A;  2NS8 A;  1BR1 A;  1P2F A;  2VC1 A;  3FMR A;  2BHY A;  4EM2 A;  2Y69 H;  3K4N A;  1IN6 A;  2X6Y A;  3LFU A;  3W2V A;  2V6E A;  2KP6 A;  2LKP A;  2FSW A;  5IYD J;  4CCO A;  5EEA A;  3BJA A;  3BT9 A;  1OCR H;  2ZSH B;  2DBB A;  3DEU A;  3HSR A;  4FT8 A;  3I4N J;  3KP2 A;  4PDK A;  1JGS A;  1PUE E;  1MBE A;  4KT5 C;  3K7A J;  1S72 I;  4AYB N;  2CWE A;  2IPQ X;  4BQA A;  2XPV A;  3FXQ A;  2UZK A;  4XOT A;  4KA4 A;  1SFO J;  2V26 A;  3C2B A;  2X4H A;  3V7S A;  3H0G J;  5D5X B;  2HQA A;  2JA8 J;  1YRN A;  4MEY F;  2M8G X;  1TWA J;  3BWG A;  4DZJ A;  4EAT A;  5M5Y J;  3OS0 A;  1Y8R B;  2DFI A;  1SFK A;  3I59 A;  1CGP A;  3FX3 A;  3A0H C;  1O3R A;  1JUM A;  4G8X A;  3PNT A;  2VQH A;  2ICW G;  2ZB9 A;  1PYV A;  5FKL A;  4YG2 F;  3IWZ A;  4MO7 A;  5E3L A;  2E36 A;  3P7N A;  3CC4 I;  1GUU A;  1R9T J;  1VF9 A;  2M8E A;  4CYD A;  3B6A A;  3BZK A;  4A6E A;  3WTV C;  2DOE A;  1LEA A;  2E5N A;  2XKO A;  4FHT A;  3UNG C;  1WHU A;  3CJR B;  1RES A;  3CJQ B;  4LLL A;  3OYI A;  3A0B C;  3ROU A;  1SD6 A;  2PX9 A;  4QIW N;  1MJ9 A;  2VIX A;  4W97 A;  4D9J A;  1SMT A;  4R8H A;  3SFZ A;  2EIN H;  2K27 A;  3OIP A;  4G12 A;  2JRM A;  1AWC A;  1RPW A;  4XOP A;  2CQQ A;  3RDI A;  2ZCW A;  1OPC A;  4DYC A;  1EJ9 A;  2GBY A;  2CU7 A;  1S3J A;  2E2I J;  5GP9 A;  3RTR A;  4HX8 A;  4G7O F;  3TW7 A;  2XRN A;  1R7J A;  5E17 F;  3VSK A;  3D0S A;  3JW4 A;  2EPF A;  5M3M J;  4RLF A;  4RMN A;  1NTC A;  1XMA A;  2A6H F;  3MCZ A;  3CQZ J;  1E3O C;  4YII A;  2EJR A;  4D7M A;  4KN4 X;  3ZMT A;  2EFQ A;  1QRY A;  2DT5 A;  1LPQ A;  4C2T A;  2CW0 F;  1JHF A;  3KLN A;  4ZDL A;  4XID A;  1R4M B;  4HNV A;  4BL0 B;  1YX3 A;  3HRM A;  3KYC B;  3HOZ J;  2BY0 A;  3U1D A;  2R4G A;  2HTS A;  2O8K A;  2BY2 A;  2HPI A;  2PG4 A;  1RET A;  2LK2 A;  2QWW A;  3C2H A;  2IT0 A;  3K2Z A;  1U78 A;  1LKX A;  1MMA A;  2IA0 A;  2ID3 A;  5CJ9 A;  4BUP A;  2X6O A;  3T8R A;  3DLL F;  1YIT I;  4HSR A;  3QP6 A;  4BGD A;  2GWR A;  2Z33 A;  1X1B A;  3K70 D;  2M7B A;  2ZXH A;  5F1R A;  1J59 A;  2BW3 B;  4A2U A;  4F93 B;  2HDW A;  2V1N A;  3FKI J;  1W7P B;  1WPK A;  1X58 A;  1QBJ A;  2J5P A;  3GTK J;  4OIN F;  1ZYR F;  2VQL A;  3I64 A;  3SDB A;  3G6E I;  3IWF A;  4E7Z A;  3VOD A;  1YW9 A;  2HQ5 A;  4ZJZ A;  2D45 A;  1YFH A;  3FK6 A;  4BDZ A;  2PMZ A;  4A0Z A;  1G2H A;  3CCL I;  3NWS A;  5CQG A;  5JR3 A;  4ENN A;  4HA8 A;  2OTL I;  5J8F A;  1OIS A;  4KIS A;  2FX0 A;  2EIM H;  3TL4 X;  2MC4 A;  1MMG A;  4Y52 J;  3GF2 A;  4JX5 A;  3LSH A;  3ZMZ A;  1SEU A;  3JR9 A;  2DYS H;  3M1C A;  2OQR A;  2ELJ A;  1Q1V A;  4BH9 A;  2Z3Y A;  4HG2 A;  2JA5 J;  3OV8 A;  3HOY J;  3V7C A;  1OYY A;  3G2B A;  4Y17 A;  3MKZ A;  1WSU A;  3T8T A;  2DMP A;  5C4X J;  2DA7 A;  4M6Y A;  4WXD A;  2I8D A;  2LRD A;  4N9I A;  3SZT A;  3HTS B;  3QOD A;  4HF0 A;  4PJJ A;  2F5V A;  4EV0 A;  1YRN B;  4IRI A;  5EG0 B;  4E4H A;  1UHM A;  2QEN A;  4C3J J;  4EM1 A;  3CO7 C;  3G4S I;  2DCE A;  3K4M A;  1J7K A;  2TCT A;  5C4J J;  1T95 A;  3QPL A;  1W36 D;  4CCL A;  1LDJ A;  3ESW B;  2E1M C;  3WG7 H;  3OMY A;  3BTJ A;  2ZXJ A;  1RKW A;  3M3Y J;  4MQ9 F;  2ZFU A;  4XIC A;  4HW0 A;  1UMQ A;  5H6Q A;  3ECH A;  3WHC A;  5DUI A;  1DP7 P;  2HKX A;  3CC7 I;  1MBJ A;  2V6C A;  4BS9 A;  4KDP A;  2DYR H;  3NRV A;  2HKO A;  1GXQ A;  2VXZ A;  1WI9 A;  3RKW A;  2YUS A;  2DMN A;  2DDA A;  3WGG A;  2LDU A;  2IBD A;  3ZOB A;  3VWB A;  3CMA I;  5IT3 A;  3RKQ A;  5ILS A;  4EQQ A;  3BTL A;  2HNH A;  2O0Y A;  1P6R A;  3W6J B;  3TO6 A;  4ZDP A;  2XAU A;  2M4G A;  2EWN A;  2X1E A;  4UHT A;  3Q3S A;  5TIS C;  3SEZ A;  3OSF A;  4XL9 A;  4YFX F;  1MDM B;  5D6F A;  5F1J A;  3RKX A;  4FET A;  4JQF A;  4BNC A;  2KFD A;  5GAE J;  4GO1 A;  1F4K A;  2KKO A;  1JJ8 C;  3DQV C;  4KT6 A;  1SVL A;  2R5Y A;  3FKJ A;  1VTN C;  1BN5 A;  2BVL A;  2E7W A;  2EFN A;  2R7R A;  3DXJ F;  4RB2 C;  3DBL B;  5FLM J;  4IO9 F;  3WU2 C;  1UAA A;  4IF4 A;  1YIJ I;  1LE8 A;  2H6C A;  1QPI A;  3LNQ A;  2VN2 A;  2LP0 A;  1F36 A;  4IOA F;  2P7V B;  4N4O B;  2WC2 A;  1EH6 A;  2R3S A;  1I39 A;  3NAU A;  2NNN A;  2NXN B;  2WTE A;  1B9N A;  3ZQQ A;  3V7R A;  2DA1 A;  4GXO A;  4RAF A;  3SJM A;  1OCP A;  4XM3 A;  5IYB J;  3BCA A;  4M9Z A;  5IT9 Z;  3QYB A;  2FD5 A;  3S32 A;  2DPU A;  2EBI A;  4CUG A;  1V54 H;  4XR6 A;  5KNL A;  1L3L A;  3P5J A;  1WRJ A;  3IV5 A;  3BR0 A;  1ETX A;  2EZH A;  3CJT B;  2VQC A;  4EMS A;  3PM1 A;  2Q8K A;  4P1W A;  3JCU C;  1FOK A;  3WU1 B;  3OIQ A;  1HC8 A;  2WV1 A;  2K86 A;  4V19 K;  3F8M A;  2L9N A;  4HRI A;  2VC0 A;  1YX5 A;  5EZG A;  3RPQ A;  4AIH A;  2UUZ A;  4TV7 A;  2GA1 A;  2GXA A;  4CHU A;  3OYM A;  4LIT A;  2W25 A;  4XLH A;  2XC7 A;  1H9T A;  2DTZ A;  3HSE A;  2XAJ A;  1R1V A;  4V2G A;  1KQ9 A;  3LAJ A;  1JKR C;  1ZN2 A;  1OQY A;  3HUG A;  3VYS B;  3Q5F A;  1Z7L A;  1NG6 A;  2FNP A;  2Y31 A;  2DMU A;  4EM0 B;  4UV8 A;  1GV2 A;  4PK4 A;  1ZLK A;  5HDN A;  1RIO H;  1W0T A;  2V79 A;  2HYJ A;  3P9I A;  4LG3 A;  2EFW A;  2KIQ A;  2HVS A;  3CDL A;  1TP4 A;  4OMY A;  2JK3 A;  4B44 A;  3GZN B;  1KQ8 A;  3FXO A;  2CFX A;  4IZZ A;  2QBY B;  4A3M J;  4OOI A;  1KU9 A;  4YEJ A;  1I50 J;  1TW2 A;  4DW6 A;  1FIA A;  2ID6 A;  2JVG A;  5DV5 A;  1AKH A;  3HJE A;  5DD4 A;  2R7W A;  3S15 J;  1LJ9 A;  3LSI A;  2ZXW H;  2EK5 A;  4W1U A;  1ZG5 A;  5K1Y A;  2W48 A;  2K4B A;  2F5D A;  1TTY A;  2CSO A;  5TRD A;  2V7F A;  2GQQ A;  3BG5 A;  3GTO J;  5H2F C;  1IXS B;  3HRS A;  1QVT A;  2X0L A;  5B66 C;  2GLO A;  3F72 A;  1P92 A;  1F9N A;  3E5U A;  4UUS A;  3TBI A;  1FIP A;  1FPQ A;  1JT0 A;  4XSX F;  2LOO A;  2XRL A;  2G0E A;  1EH8 A;  5LBQ A;  2EIJ H;  3EUA A;  3I4P A;  4LLN A;  2C6Y A;  4Y7N J;  5FRM A;  5J1Y A;  3ASN H;  5HDK A;  3K4B A;  1U6G A;  4CYC A;  1K6Y A;  2IS4 A;  3CCR I;  1U8B A;  3EYY A;  1SAU A;  4D1Q A;  2E71 A;  4HBL A;  3KX2 A;  1JE8 A;  3E6B A;  2Y0S N;  4UB6 C;  1WQ2 A;  2XAS A;  3U21 A;  1BA5 A;  3H3V K;  1D0Z A;  1XN7 A;  2VJ5 A;  2A68 F;  1NH3 A;  5EYR A;  2RRE A;  1FBS A;  2P5K A;  2HPM A;  1MMS A;  5E1X A;  1YJW I;  4GFB A; 
#chains in the Genus database with same CATH homology
 5ILV A;  2Z9O A;  5HLG A;  3KP7 A;  3TO9 A;  3EET A;  1MZB A;  4ZYH A;  2ZKZ A;  3GYH X;  4EJW A;  3L2C A;  1R58 A;  3FF5 A;  4QLC U;  5D4S A;  3TO7 A;  3REO A;  2QQA A;  5K5R A;  5JFR A;  2JPB A;  2EV0 A;  4A0Y A;  5L3E A;  4EJV A;  1WKM A;  2HDC A;  2CQK A;  1H9G A;  1GVJ A;  2IP2 A;  2MA3 A;  1BIB A;  2EB7 A;  4KIF A;  4IRH A;  2ZNY A;  3R6S A;  2M1B A;  3BRO A;  5IT9 K;  2W57 A;  4AWX B;  3IRQ A;  5FLX K;  1V4R A;  4I2O A;  4Q47 A;  1J0R A;  4GCV A;  3O2P E;  3I71 A;  2XAH A;  3Q9V A;  4GGG A;  2DK8 A;  4WXC A;  5CVJ A;  2QUF A;  3WOD F;  4PGH A;  3WTW C;  3QAH A;  1I1G A;  3HTU A;  3CO6 C;  4MNU A;  4CZZ A;  3DPL C;  3NEU A;  1D8K A;  4XBF A;  4S05 A;  4K2E A;  1PP8 F;  4ETS A;  5DCM A;  2HR3 A;  4BXU A;  1F5T A;  1BM9 A;  1DUX C;  2O8X A;  4CDG A;  4B8X A;  2LSO A;  1U3E M;  5HVQ C;  2STT A;  5FB2 A;  2EA2 A;  1DDN A;  1WWX A;  4Y15 A;  2G7H A;  1Q1H A;  3P9C A;  5ILU A;  1FNN A;  1S29 A;  5ICG A;  1ODD A;  2H09 A;  2YX7 A;  1U5T A;  2NRA C;  2EFO A;  1BI0 A;  5D6E A;  1G3Y A;  4M72 A;  4MQV A;  1TQM A;  4Q48 A;  3GZ6 A;  3KEQ A;  3ZMV A;  3DP7 A;  1HST A;  2K02 A;  5ICE A;  2BGC A;  2M87 A;  3KP3 A;  2DPD A;  1STZ A;  1K78 A;  4ESB A;  3GO5 A;  2ZNZ A;  4EVI A;  4HLY A;  3W6K B;  1KA8 A;  1CF7 A;  1HW2 A;  1ZGA A;  5ICF A;  1UCR A;  3TQN A;  3B73 A;  4UVA A;  2DQL A;  1ON1 A;  1FYL A;  1ULY A;  1S7A A;  4EGZ A;  2QZ8 A;  2M5W A;  1XGO A;  2LF7 A;  4A5N A;  1KU2 A;  1IN8 A;  2PN6 A;  3BJO A;  3CUQ B;  5HLI A;  5DDG A;  2DW4 A;  4LG0 B;  1BIA A;  3BJ6 A;  2ISY A;  4HV5 A;  2KIF A;  1ZG1 A;  1W5S A;  3F22 A;  2JPC A;  2KRF A;  6PAX A;  1BI2 A;  3F8F A;  3TGN A;  3ZMU A;  2O03 A;  1V3F A;  3MQ0 A;  5FD5 A;  1GHC A;  1R00 A;  4I09 A;  3SQN A;  3BPV A;  1FP2 A;  2IW5 A;  1Z6R A;  5L3G A;  1T98 A;  4L18 B;  1I1S A;  4U7B A;  1NHA A;  3ABT A;  4ASN A;  2STW A;  4IHS A;  1AOY A;  4NB5 A;  5HS7 A;  3U9G A;  3ECO A;  4ESF A;  4UXN A;  1L0O C;  3WE2 A;  4ZZD A;  3HIF A;  1I27 A;  3JAM Z;  1IW7 F;  1SAX A;  1FT9 A;  3BZ6 A;  4ZZL A;  3M1E A;  3VB2 A;  2QYO A;  2PFB A;  5HOO A;  1XMK A;  4L0Z B;  1YS6 A;  3ABU A;  3ZPL A;  4NHJ A;  4BHC A;  5D5U B;  1X3U A;  4KUM A;  1HKT A;  1IN4 A;  1R1T A;  4RB0 A;  5D5V B;  3I58 A;  1U5T B;  2EV5 A;  2HZT A;  3I53 A;  1D8J A;  3QPH A;  2H94 A;  2IA2 A;  1REP C;  3L00 A;  5H6R A;  3KP6 A;  3BDD A;  5FGM A;  5HS9 A;  4EGY A;  3F8N A;  1ZAO A;  3H92 A;  5E8G A;  3F6O A;  4DQ2 A;  4Q4Z F;  2VBX A;  1K78 B;  4RGX A;  1FP1 D;  1MJB A;  1GXP A;  2CGP A;  2L3D A;  3L09 A;  4ENM A;  4M73 A;  1UST A;  3DPT A;  4M6X A;  2RN7 A;  5JI6 A;  1QNT A;  1XCV A;  2WV0 A;  1R5G A;  1HW1 A;  1ZH5 A;  2GAU A;  1ZG3 A;  1TLH B;  5DD8 A;  3R60 A;  1D5V A;  2HEO A;  4LK1 F;  1XD7 A;  2A5Y B;  3LA2 A;  3C1D A;  2RNJ A;  4RB3 C;  3V4G A;  4H0E A;  2KJB A;  4AIJ A;  3L7W A;  3ZN0 A;  1YW7 A;  1YS7 A;  4IPA A;  2Q2E A;  2XRO A;  1ON2 A;  3K1N A;  2EFP A;  4OU0 A;  1P4X A;  2FBK A;  4RGR A;  1Z91 A;  3VOE A;  3JTG A;  4LB5 A;  1DPU A;  1QPM A;  4CO8 A;  3ZQ7 A;  1BC8 C;  2BE5 F;  5LHG A;  3HYI A;  2UXN A;  2A61 A;  3I59 B;  3IC7 A;  5L3D A;  1G3T A;  4FX0 A;  2G7U A;  3LFK A;  4G6Q A;  3TKY A;  2XVC A;  1HSJ A;  3JAM K;  3IKV A;  3KEO A;  1IUY A;  2D2W A;  2V1X A;  4PCQ A;  2VT3 A;  2VT2 A;  4P9F A;  1W7P D;  3WG9 A;  5K5O A;  2FNA A;  3KFW X;  2BV6 A;  5EEG A;  5LEK A;  1R36 A;  1S6L A;  4HOB A;  3K69 A;  2F2E A;  1Z1D A;  3BP8 A;  1OYW A;  4ON0 A;  2HQR A;  3HHH A;  3C3W A;  1YO5 C;  2V1D A;  3C18 A;  3TOA A;  3FZV A;  3P9K A;  3QU6 A;  3GLX A;  4L9N A;  2DTR A;  2D1V A;  2FOK A;  2V1U A;  3ZN1 A;  4O3M A;  3WTU C;  1O3Q A;  5ED4 A;  3LST A;  2Z5U A;  4B09 A;  1FYM A;  1JXS A;  3ZP5 A;  5LEJ A;  1A04 A;  2RVC A;  5D5W B;  1RUN A;  4P9U A;  5FLX Z;  1O7L A;  2OZU A;  3BOQ A;  1XGN A;  5BPI A;  3FMQ A;  1FYK A;  3AAF A;  1E2X A;  3KP4 A;  3N4M A;  4IRG A;  1ZRC A;  2W24 A;  4HZF A;  2A07 F;  3MAJ A;  5BMZ A;  3IRR A;  2OQG A;  1O57 A;  5TJJ A;  1P4W A;  1IN5 A;  1YLF A;  1SMY F;  3MWM A;  2ZME A;  2L4A A;  2GIV A;  3FM3 A;  4RAY A;  5AIQ A;  2PMU A;  1Z7U A;  4M71 A;  2ADU A;  4LJZ F;  1XB4 A;  1SD5 A;  4LFU A;  2Y48 A;  4HDV A;  5KVR A;  1OMI A;  2BBY A;  2QLZ A;  3HRT A;  1FSE A;  5DCF A;  3RYR A;  4A6D A;  3E6C C;  2CG4 A;  3BY6 A;  3KLO A;  4JK1 X;  1XSD A;  3F8C A;  4L9J A;  1T2K A;  1LEB A;  2W85 A;  2VE8 A;  3MZH A;  2Y0M A;  4HYE A;  3R61 A;  2HYF A;  2A6E F;  4I98 B;  2BYV E;  3FHZ A;  2FEZ A;  3L9F A;  2HFH A;  1KU3 A;  4G9Y A;  4M74 A;  2O3F A;  3KET A;  4P5O A;  2JSC A;  4ZH4 F;  2V9V A;  1QQI A;  2FU4 A;  2VON A;  1O3S A;  2VBZ A;  1HW5 A;  2M30 A;  1D3Y A;  2K7L A;  3FXU A;  1ZRE A;  2IJL A;  2ELH A;  1HBX G;  5J8C A;  1B6A A;  2IVM A;  4L9V A;  4F7Z A;  3T0Y A;  2LNB A;  3LA7 A;  5LHH A;  4AVP A;  3T5X A;  2XKP A;  2IRF G;  3LQR A;  4ZYG A;  3GFJ A;  1PP7 U;  1B1B A;  1W5T A;  2NAZ A;  2QVO A;  3CUQ C;  1FZP B;  3F23 A;  1U2W A;  4XSZ F;  3V8L A;  3QPT A;  4UNO A;  5CYV A;  1FLI A;  4BHP A;  1G3W A;  5DYM A;  1FC3 A;  1BOA A;  2R7D A;  3LA3 A;  1Z05 A;  2H6B A;  1ZHF A;  2ESN A;  4KMU X;  1E17 A;  4G6D A;  2B0L A;  2PQ8 A;  1PDN C;  2P6S A;  2XV4 S;  1MGT A;  2FML A;  5CVR A;  2LF8 A;  3WTX C;  4U0V A;  2F5E A;  3HRU A;  4IHT A;  3J81 K;  4YFN F;  3G73 A;  3LAP A;  1FBQ A;  2VOD A;  1KYZ A;  4L5J A;  2D1H A;  3LWF A;  1J9I A;  4PZJ A;  2FA5 A;  5AIP A;  3OOP A;  4UVB A;  1IXR C;  4WCG A;  4OIO F;  2RV8 A;  5DEQ A;  2HOE A;  5LLQ A;  4G7H F;  1OYI A;  2F5F A;  1UFM A;  4R79 A;  2FE3 A;  2BEO A;  2OU2 A;  2EV6 A;  4Z2Y A;  1USS A;  4HQM A;  2UWM A;  3GFL A;  5JHU A;  2HQN A;  2HGC A;  3V8J A;  3WTS C;  2GXB A;  3CJN A;  1MD0 A;  2DO7 A;  1G3S A;  2MH9 A;  1HQC A;  2DAO A;  2YSR A;  4RGS A;  2PJP A;  1IZ1 A;  2OA4 A;  4BHB A;  2O61 A;  4AD9 A;  3H3Z A;  2M45 A;  4O6J A;  3DV8 A;  2RKH A;  5CLS A;  2KIM A;  4I0B A;  1W7P A;  4XRF A;  5L3C A;  3F3X A;  1IRG A;  2XAF A;  3VEP A;  2VE9 A;  1DPR A;  2WWY A;  4ZYD A;  4HAM A;  3Q9S A;  5LGT A;  3QRF F;  3N97 A;  2ISZ A;  1K6O A;  3R0J A;  3KZZ A;  1TBX A;  3O3K A;  2PLY A;  4G94 A;  1TQP A;  2ESH A;  3H3U A;  2ZBK A;  2MC3 A;  4M9S A;  3BPX A;  5F6F A;  1LB2 A;  3M9A A;  3EQL F;  1O7F A;  2P7C B;  1F1Z A;  2RQP A;  3GW2 A;  3K0L A;  5AON A;  1G6N A;  4RGU A;  4OIP F;  5LRR A;  4IVN A;  2MBF A;  2E1N A;  1B59 A;  3GEZ A;  5DCM B;  4EJU A;  4KFC A;  3GFI A;  4MHG A;  1ONV A;  5BOX A;  2QM3 A;  2DQR A;  2QQB A;  4S04 A;  2GZW A;  2J5O A;  4I0A A;  1BI1 A;  1XSX A;  4KNY A;  3MEX A;  5E8I A;  1IXC A;  3GFM A;  3HHG A;  3K9T A;  1QGP A;  3PQJ A;  2GA2 A;  3NQO A;  4U0W A;  1FWZ A;  2VOO A;  1EV7 A;  1LDK B;  1T0F A;  5D8K B;  2NNY A;  3COA C;  1XDU A;  4U7D A;  4I7H A;  1MDM A;  3RJP A;  2VBY A;  2PEX A;  5E18 F;  2JTV A;  4WXH A;  1C0W A;  2L01 A;  2KIU A;  4XLP F;  5HDG A;  5EEH A;  1CF7 B;  2KJC A;  2MD5 A;  4RB1 A;  4HX7 A;  5LHI A;  2XIG A;  2K4J A;  2Y75 A;  2YPR A;  3E6D A;  1QO0 D;  2ZFW A;  2YR2 A;  3LQQ A;  2QQ9 A;  5FFX A;  1HXD A;  2E1C A;  2P4W A;  2JRT A;  3S2W A;  4LGW A;  1BI3 A;  2P5V A;  4R1H A;  4HF1 A;  4XLN F;  3QP5 A;  5LRS A;  4UV9 A;  3GXO A;  3TOB A;  4UVC A;  4G7Z F;  5BS6 A;  2VOP A;  4HF2 A;  1J5Y A;  4GYG A;  3RYP A;  5HS8 A;  4U88 A;  4CIC A;  3CTA A;  4MTD A;  2QBY A;  4KIC A;  2YU3 A;  3F21 A;  1YW8 A;  3EYI A;  1HKQ A;  2XAQ A;  4OIQ F;  1BC7 C;  5BQT A;  2OBP A;  1KQ0 A;  1XGS A;  5DUK A;  4NQW A;  2O6G E;  1XDS A;  4I01 A;  2ETH A;  4N9H A;  4ENJ A;  4D0P A;  4BAY A;  3IL2 A;  5ERI A;  1TNS A;  3FMS A;  3SXY A;  3V8K A;  1YIO A;  4LLG F;  4L0Y B;  4IJA A;  4CGZ A;  4LB6 B;  3TDU C;  5FO5 A;  1YG2 A;  2JT1 A;  4IXA A;  3IKT A;  3JTH A;  2PBI A;  3R4K A;  4ZYE A;  3U2R A;  1Z9C A;  4AIK A;  3KP5 A;  1U8R A;  2PMH A;  3F8B A;  3JSP A;  3SZP A;  3WTT C;  3EUH A;  4FX4 A;  2L02 A;  3I5U A;  1LDD A;  4PGG A;  1QZZ A;  3RIR A;  5A2Q Z;  2JZY A;  4KIG A;  2HYG D;  1LNW A;  4OMZ A;  1SFE A;  5D8L B;  1TW3 A;  3T1B A;  2FF4 A;  1SFU A;  3PFI A;  4OIR F;  1QZY A;  2P5L C;  2XGX A;  1S7O A;  5E20 A;  3ULQ B;  3I54 A;  3G3Z A;  1RUO A;  3ISP A;  5E1Z B;  2RC4 A;  1EH7 A;  1IN7 A;  3K1P A;  1FSH A;  2GXG A;  4MGR A;  1I6X A;  3ELK A;  4L5I A;  5D4R A;  2XHK A;  3GVA A;  2FQ3 A;  1JHH A;  4A0X A;  4JBA A;  5CVV A;  2ZO4 A;  2DK5 A;  3GZ5 A;  3MFK A;  5FFZ A;  4L9T A;  2OAZ A;  2CO5 A;  1YYV A;  4QWQ A;  4WX9 A;  3D5L A;  3ML6 A;  1J2X A;  5ICC A;  3FM5 A;  3WE3 A;  2RGV A;  4YIF A;  3RPU A;  5HLH A;  2R7F A;  1TNT A;  1H0M A;  3E5Q A;  3HSF A;  4HX4 A;  1K7A A;  2UXX A;  3J81 Z;  2F5C A;  4RS8 A;  3HOS A;  3CLO A;  2EA4 A;  2G9W A;  1T38 A;  4UUV A;  1S8N A;  4LK0 F;  2FBI A;  3RKY A;  1YTY A;  2RDP A;  1ZLJ A;  3JSO A;  3M8F A;  2XAG A;  1OKR A;  3E5X A;  4KN7 X;  1R5H A;  4A12 A;  4CXF A;  2MLG A;  1FBU A;  3GUD A;  2W84 A;  3E6M A;  2FMY A;  5F64 A;  4MTE A;  4LMY A;  4I02 A;  3QU3 A;  2CYY A;  3J7A O;  3WU0 A;  3WGH A;  1FY7 A;  1RI7 A;  2NYX A;  4HDU A;  1IRF A;  1MKM A;  4YFK F;  4O5V A;  1SD7 A;  1RNL A;  2L4M A;  2XUB A;  1FX7 A;  1MJA A;  4KIB A;  4DNC A;  3FWE A;  1ZAR A;  4GYI A;  4EJO A;  5A2Q K;  2DI3 A;  3EDP A;  4Q5S F;  5LGN A;  3SHF A;  2Q0O A;  3MZY A;  1HKS A;  1LVA A;  5E1W A;  2PI0 A;  2L54 A;  4BYY A;  3HOT A;  3C7J A;  3J80 Z;  2A69 F;  3I0T A;  3VFZ A;  1UHW A;  4ENK A;  2H27 A;  1I5Z A;  2ZJ2 A;  5CVI A;  4N0B A;  1XCB A;  3CUQ A;  2OZ6 A;  1BJA A;  1P4A A;  1T6S A;  4LG0 A;  3M7G A;  5K5Q A;  1KU7 A;  1XSV A;  3ZMS A;  4U0Y A;  3DKW A;  3DFG A;  2NS0 A;  1SFX A;  4WF2 A;  2P8T A;  1IAW A;  1IF1 A;  1R22 A;  3F6V A;  4HV6 A;  4Y13 A;  4P96 A;  1ZRF A;  3ZMD A;  3KCC A;  5L3B A;  5J6X A;  1B9M A;  4LD5 A;  1YQA A;  3KZY A;  1R1U A;  5CVU A;  1T39 A;  3WGI A;  4RAZ A;  2ZME B;  5LGU A;  1Y0U A;  3GWZ A;  2ACJ A;  2DLL A;  2FBH A;  3O6B B;  1ZRD A;  1OR7 A;  4HQE A;  2AS5 F;  2YX4 A;  4KMF A;  3IHU A;  2A3S A;  1UB9 A;  2VBW A;  1XGM A;  3WTY C;  1Z6T A;  1K79 A;  1BBY A;  4M9X A;  4HLX A;  3R0A A;  2HTJ A;  3RI4 A;  4KYW A;  1U5T C;  3K1M A;  3WTZ A;  3QOP A;  1RZ4 A;  1SD4 A;  5L3F A;  2MLK A;  1G4D A;  1B4A A;  2FRH A;  4A5M A;  4E70 A;  4WWC A;  4EJT A;  2P6T A;  3B02 A;  3PQK A;  2COM A;  2OD5 A;  4P55 A;  4WK8 F;  2DU9 A;  4ESJ A;  3ERE D;  3DF8 A;  3CDH A;  5FD6 A;  4MEX F;  1KYW A;  1LQ1 A;  2AXL A;  3TDZ C;  2MH2 A;  2E7X A;  5JVT A;  2Z99 A;  3CUO A;  1O3T A;  3KE2 A;  2TDX A;  3E3V A;  1KGS A;  2HS5 A;  3FXR A;  1ZGJ A;  1TQI A;  3J80 K;  2FXA A;  3E97 A;  5BPD A;  1W4M A;  2IA1 A;  3M8E A;  2HWV A;  1J75 A;  3GX4 X;  1R23 A;  5KK1 A;  5H20 A;  1P2F A;  2VC1 A;  3FMR A;  4EM2 A;  1IN6 A;  2LKP A;  2FSW A;  3BJA A;  2DBB A;  3DEU A;  3HSR A;  4FT8 A;  3KP2 A;  4PDK A;  1JGS A;  1PUE E;  4KT5 C;  2CWE A;  2IPQ X;  4BQA A;  3FXQ A;  2UZK A;  4KA4 A;  2X4H A;  3V7S A;  5D5X B;  4MEY F;  3BWG A;  1CGP A;  2DFI A;  3I59 A;  3FX3 A;  1O3R A;  4G8X A;  4YG2 F;  3IWZ A;  3P7N A;  2M8E A;  4CYD A;  4A6E A;  3WTV C;  1LEA A;  2XKO A;  4FHT A;  4LLL A;  3ROU A;  1SD6 A;  1MJ9 A;  1SMT A;  4R8H A;  3SFZ A;  2K27 A;  1AWC A;  3RDI A;  2ZCW A;  1OPC A;  1S3J A;  3RTR A;  4HX8 A;  4G7O F;  2XRN A;  1R7J A;  5E17 F;  3D0S A;  3JW4 A;  1XMA A;  2A6H F;  3MCZ A;  4YII A;  2EJR A;  4KN4 X;  3ZMT A;  2EFQ A;  2DT5 A;  2CW0 F;  1JHF A;  3KLN A;  3HRM A;  3U1D A;  2HTS A;  2QWW A;  2PG4 A;  2IT0 A;  3K2Z A;  1U78 A;  2IA0 A;  5CJ9 A;  3T8R A;  3QP6 A;  2GWR A;  2Z33 A;  5F1R A;  1J59 A;  4A2U A;  1W7P B;  1QBJ A;  2J5P A;  4OIN F;  1ZYR F;  3I64 A;  3IWF A;  3VOD A;  1YW9 A;  2D45 A;  1YFH A;  4A0Z A;  5JR3 A;  4ENN A;  4HA8 A;  5J8F A;  3GF2 A;  3ZMZ A;  2OQR A;  4BH9 A;  2Z3Y A;  3OV8 A;  3V7C A;  1OYY A;  4Y17 A;  1WSU A;  3T8T A;  4M6Y A;  4WXD A;  4N9I A;  3SZT A;  3HTS B;  4HF0 A;  4EV0 A;  4IRI A;  1UHM A;  2QEN A;  4EM1 A;  3CO7 C;  1J7K A;  1LDJ A;  2ZXJ A;  4MQ9 F;  4HW0 A;  5H6Q A;  3ECH A;  5DUI A;  1DP7 P;  2HKX A;  2V6C A;  4KDP A;  3NRV A;  2HKO A;  1GXQ A;  2VXZ A;  1WI9 A;  3RKW A;  3WGG A;  2LDU A;  5IT3 A;  5ILS A;  4EQQ A;  2O0Y A;  1P6R A;  3W6J B;  3TO6 A;  2EWN A;  4UHT A;  4YFX F;  1MDM B;  5D6F A;  3RKX A;  4JQF A;  4BNC A;  4GO1 A;  1F4K A;  2KKO A;  3DQV C;  1VTN C;  1BN5 A;  2E7W A;  2EFN A;  3DXJ F;  4RB2 C;  4IF4 A;  2H6C A;  2VN2 A;  2P7V B;  2WC2 A;  1EH6 A;  2R3S A;  2NNN A;  2WTE A;  1B9N A;  3V7R A;  4GXO A;  4M9Z A;  5IT9 Z;  2DPU A;  1L3L A;  1WRJ A;  4EMS A;  2Q8K A;  1FOK A;  3WU1 B;  2K86 A;  3F8M A;  2VC0 A;  3RPQ A;  4AIH A;  4CHU A;  4TV7 A;  2GA1 A;  2W25 A;  1H9T A;  3HSE A;  2XAJ A;  1R1V A;  1KQ9 A;  3LAJ A;  1ZN2 A;  3HUG A;  3Q5F A;  2FNP A;  4EM0 B;  4UV8 A;  1ZLK A;  5HDN A;  1RIO H;  2V79 A;  3P9I A;  2EFW A;  4OMY A;  1KQ8 A;  2CFX A;  2QBY B;  4OOI A;  1KU9 A;  1TW2 A;  5DV5 A;  5DD4 A;  1LJ9 A;  2EK5 A;  1ZG5 A;  5K1Y A;  2K4B A;  2F5D A;  1TTY A;  2CSO A;  5TRD A;  2GQQ A;  1IXS B;  3HRS A;  2X0L A;  3F72 A;  1P92 A;  1F9N A;  3E5U A;  1FPQ A;  4XSX F;  1EH8 A;  5LBQ A;  3I4P A;  4LLN A;  2C6Y A;  5HDK A;  1U6G A;  3EYY A;  4HBL A;  1JE8 A;  3E6B A;  1WQ2 A;  2XAS A;  1XN7 A;  2A68 F;  1FBS A;  2P5K A;  5E1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...