1LE8B

Crystal structure of the mata1/matalpha2-3a heterodimer bound to dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVAARRAKEKTITIAPELADLLSGEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*CP*AP*TP*GP*TP*AP*AP*AP*AP*AP*TP*TP*TP*AP*CP*AP*TP*
publication title Structural and Thermodynamic Characterization of the DNA Binding Properties of a Triple Alanine Mutant of MATalpha2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 22
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1le8B00
4A3JJ 4A69C 1JUPA 2Y31A 4UUTA 3BG3A 3K2AA 5J3LA 1JT6A 3TW7A 5IYDJ 1TWHJ 2B63J 4A3GJ 1SANA 3FISA 4BBRJ 4JX6A 1BW5A 3S17J 4BKXA 1IDZA 3BQZA 3BT9A 2HQ5A 3I4NJ 1ZGWA 5E3LA 3L1PA 2YU9J 9ANTA 2DA1A 2WB1N 1X2MA 4UUSA 5IOZA 3BG9A 2ID6A 1RESA 5IPAA 2FX0A 3IV5A 1K83J 5E3MA 5F27A 2R5YB 1UHSA 1AKHA 3HOYJ 5GPCA 3S1RJ 1WCMJ 4NDLA 4L5EA 3RZDJ 1HOMA 2KT0A 1MSEC 2OF7A 1MBFA 4MFDA 1WGXA 2Y2ZA 2MSYA 5F0CA 2HDDA 5F0FA 1UG2A 1YRNB 1H89C 2EH3A 1XC5A 1FTZA 1P7JA 2JA6J 1A6IA 1IDYA 1JJ6C 2M8GX 1P7IA 3S2HJ 5K7ZA 4XIDA 2XSDC 3MVPA 1GDTA 1R9TJ 3C2BA 3H0GJ 3GTGJ 5FKMA 2R92J 4DYQA 1UMQA 2K9QA 3Q0VA 3IH2A 2KDZA 2JA5J 2Y0SN 1JKPC 4RBOA 3HOUJ 1JUSA 1JTXA 1U9NA 3CDLA 1W0TA 2LVSA 1X2NA 4LOCA 1ETQA 3GTKJ 2XGCA 1NTCA 1FIAA 1IV6A 4IHXA 2G0EA 2LP0A 1RETA 2E1OA 3BR2A 1IGNA 5EZGA 4UUSB 4S0HB 2GM4A 3LNQA 1JTYA 1QPIA 3S1MJ 2JMWA 2XGDA 1FTTA 1H88C 3IH4A 3S2DJ 5EF6A 1AKHB 1F43A 5BNGA 1G2HA 1I3QJ 1U8BA 5K7FA 1WH5A 5EZHA 2WV1A 1GV5A 2X6OA 4XICA 4DYCA 3JRBA 1B8IA 3TEDA 1XG1A 5GP9A 1HCRA 1VFCA 3LSRA 1D5YA 2DA2A 1MBJA 2XB0X 2MGQA 4FE7A 3D1NI 3Q3SA 3ZQFA 3QPSA 4MO7A 3ZQIA 1JKRC 5C4JJ 1WPKA 3HGYA 2QF7A 3I4MJ 1ENHA 1ITYA 1WH7A 4V2GA 2VI6A 1GVDA 5EYRA 4BY7J 5J1YA 1I6HJ 3SJMA 3BR3A 3GBGA 3RQIA 1MBEA 4A3BJ 2R0QC 3M3YJ 2EQRA 4M3EA 1MH3A 2VPRA 4XRMA 1MSFC 3MKLA 1SFOJ 2IBDA 3MN2A 5M3FJ 2E2JJ 4BXXJ 3IH3A 4XRSA 2R93J 3FKIJ 3S14J 3ZQHA 2IEKA 2NVQJ 2GBYA 2CJJA 2M2EA 5M5YJ 3BTLA 1HDDC 4M3BA 3GTQJ 5C4XJ 3DEWA 3JRAA 2CQQA 4XRSG 3O8HA 3PO2J 3HOVJ 5EGOA 2HOTA 2CUEA 4W1UA 2NVXJ 4M3FA 4FISA 4ABZA 2ZB9A 1ZK8A 3G1LA 2W48A 2YUSA 1OJLA 3E7LA 4G12A 2X48A 1ZR2A 1MBHA 1RKWA 4DW6A 1B8IB 2XRLA 2ECCA 5F04A 5DS9A 2EZLA 2P81A 2MG4A 4D5FA 2ME6A 2XGEA 2LTPA 3OOUA 2ECBA 2HYJA 1APLC 1ETVA 3HBLA 2L0KA 4AC0A 2AO9A 2WAQN 5JLXA 3LSJA 1ZTRA 1HDPA 3BTCA 2K9NA 2N8GA 1RR7A 5M5XJ 1F36A 3FK6A 4RDUA 2DMNA 2ME0A 1MNMC 3B6CA 1BJZA 3HOXJ 2DTZA 2YS9A 2DA5A 2FD5A 1BW6A 1JKOC 4AUXA 2DMTA 1ETOA 2K40A 1NK2P 1IRZA 1OCTC 1B72A 4A93J 1ETWA 3ZQGA 4EEFG 2EZIA 4X6AJ 2ID3A 3G1OA 4W97A 1FJLA 3QQAA 4B1RA 1H8AC 2NVYJ 5EGOB 3BR0A 1ZR4A 3LOCA 5J1UA 2XPVA 4JX5A 4V2FA 1Q1VA 1ZQ3P 3O8GA 2H1KA 3ZQLA 2DMQA 1FEXA 5EG0A 4IHWA 1HLVA 2I10A 1Z0XA 5M3MJ 1GUUA 2FQ4A 2HOAA 2XPWA 5FJ8J 2K9SA 1QVTA 4CYCA 3CMYA 3M4OJ 5FKOA 2EBIA 1Y1VJ 3PM1A 1FIPA 3GTLJ 3GTMJ 2JWTA 1K61A 4D7NA 2JK3A 5FKLA 3FK7A 5F08A 4B4CA 1U9OA 2Y30A 4A3KJ 2LR8A 3BR5A 2LLKA 4A3CJ 4MIMA 3G1MA 2GLOA 5M5WJ 3H3VK 1I50J 4JX4A 2LY9A 1RKTA 1MH4A 5C3EJ 1B72B 2HOSA 2O9LA 5EDNA 5IP6A 2DA4A 2L7FP 2LD5A 4D5CA 3A01A 2QCOA 2CQXA 1BL0A 1LFBA 3FIWA 2TRTA 2MW8A 3TW6A 5IP7J 3RZOJ 4Y52J 2R7ZJ 5HODA 2Y9ZA 2TCTA 2X9DA 1LFUP 2DA7A 3A02A 4FTHA 1JT0A 1O4XA 2NS8A 4C2MJ 4A3LJ 4BY1J 1E3OC 2E2IJ 1BA5A 1TWFJ 5EG0B 1AU7A 3S16J 5E3NA 5E3OA 1DU0A 4AYBN 4M3DA 1TWCJ 3HM5A 2VKVA 4IHVA 1GT0C 2ELKA 3HOZJ 4JP0A 5EEAA 4CYCB 1DU6A 3BTJA 3TP0A 4HNVA 1TWAJ 3TP3A 4JYKA 2JJ7A 4IEJA 5IYBJ 2CRGA 2M0CA 3JRHA 4B3AA 2JA8J 3Q0WA 1VNDA 4IHYA 2FJ1A 1ETKA 3HGGA 2RAEA 3RKQA 1Z77A 3BR1A 3S1QJ 4C3HJ 1T33A 2NS7A 1PUFA 3OSFA 3NARA 1POGA 1OCPA 5F1JA 5IP9J 1QRYA 2O7OA 3JRDA 1VF9A 3GTJJ 2DA3A 2E2HJ 1JKQC 1Y1WJ 5K7HA 5F0HA 1VI0A 5C44J 4BBSJ 1LE8A 2XPUA 3A01B 3SDGA 3HB9A 2R5ZA 3CCYA 2H8RA 3SFIA 3K7AJ 4DYRA 2NOGA 3BR6A 2EZKA 5IYCJ 1U78A 3JREA 3DCFA 4D7MA 2HI3A 3QPLA 3VPRA 4I76A 4QIWN 3UKGA 1GV2A 1MBKA 2HXOA 4M6VA 4A3IJ 2AHQA 5IOYA 2CU7A 1WI3A 2COBA 5FLMJ 2HXIA 4MFEA 1CQTA 4A3MJ 4Y7NJ 1ETXA 2NVTJ 2L7MP 3JR9A 4XK4A 4DZJA 3WHCA 4A3EJ 2E19A 3WHBA 3GTPJ 2M9HA 2Y9YA 1TC3C 5J1RA 1PUFB 3LSGA 1IJWC 2VKEA 4I6ZA 3BTIA 1IC8A 5GPAA 2L7ZA 5DTDA 2M34A 2LKXA 4FCYA 3HDDA 2PMZN 4M3GA 3PO3J 1LE8B 4QSHA 4GFBA 2L9RA 3ZOBA 4J19A 2R5ZB 1TWGJ 3JRFA 1AHDP 1ZKGA 2DMPA 2EZHA 1T56A 2O8KA 5JLWA 2DJNA 1ORKA 3NAUA 3BG5A 3W6VA 1NK3P 2DA6A 2LFBA 3Q0UA 2JA7J 3BQYA 4X1EA 3HOWJ 1W0UA 4A3DJ 1JJ8C 3ZQCA 3JRCA 1EF4A 1RPWA 1IUFA 2R5YA 5FLVA 3JRIA 5FKKA 4QTRA 3OSGA 3B6AA 1JGGA 1A5JA 3A03A 4FE4A 4C3JJ 3OIOA 2D5VA 4A3FJ 1IG7A 2DMUA 3S15J 1QVUA 2VUMJ 2XB5A 4DZPA 2LK2A 2DN0A 1OFCX 3LSPA 1YRNA 1X58A 3HEFA 4MLOA 3F0CA 1JUMA 3CQZJ 1ETYA 1HF0A 3HKZN 2CUFA 2JN6A 1XS9A 4C3IJ 2IAIA 1S7EA 1MBGA 3GTOJ 2OPTA 5FKNA 3JRGA 3S1NJ
chains in the Genus database with same CATH superfamily
4YIFA 1XSVA 2W25A 3HPGA 1YIJI 2FSWA 1WJBA 3FHZA 3TDZC 4A69C 5FLXK 5HS8A 1QQIA 2PJPA 4XSZF 2CO5A 1JT6A 1CGPA 2E35A 1X3ZB 2B63J 4A3GJ 4D9JA 4BBRJ 3ABLH 1BW5A 2PJRA 3F23A 4BKXA 2K9LA 2FMLA 2HQ5A 4IJAA 4ZDPA 3CLQA 2DTRA 1TTYA 3C2HA 3I4NJ 4IOCF 2ETHA 1T0FC 3MAJA 4Y4RA 2FOWA 1QZYA 2OV7A 3LWFA 3BG9A 4S05A 2RN7A 3GEZA 1FWZA 2A5WA 3E1SA 3IV5A 1BR4A 2FX0A 3L7WA 2EA2A 2HGCA 2IW5A 5ILVA 5E3MA 2UXNA 4N9IA 2LKPA 4LK1F 4E70A 1J7KA 2MA3A 3SEQA 1G59A 3OIQA 1JXSA 1DP3A 4GCVA 1J2XA 2OF7A 1IN7A 2Y2ZA 2CYYA 1X3WB 5F0CA 3W2VA 2VKDA 2FF4A 3J7YJ 1UG2A 1YRNB 1XC5A 1FTZA 2LH9A 3FMRA 2JA6J 3LAPA 1Z91A 3V7RA 2K9MA 2GZWA 4CYDA 3S2HJ 4XIDA 2M0MA 2XDVA 2QSFX 3MVPA 2UWMA 4YFKF 2XIGA 3VYTB 3S3MA 2R7OA 3GTGJ 2RDPA 4DJAA 2ZSIB 2K9QA 1F9NA 2MH9A 3RYPA 3G6EI 2OAZA 3ERMA 1JKPC 3OMYA 5L3CA 1JTXA 1W0TA 1X2NA 2ESHA 1ETQA 1IRXA 1FIAA 2ELHA 1VZ0A 1DDNA 5ICEA 2G7HA 1N77A 4S0HB 3OS2A 3S1MJ 1JHHA 2JMWA 3ZXSA 1H88C 3SHFA 3S2DJ 2VJ5A 3BPXA 1G2HA 3P5JA 2DJIA 4RAYA 1WH5A 1UAAA 1WWXA 4X0GA 1H9TA 5EZHA 3KEYA 2WV1A 3QOPA 2DOAA 2X6OA 3TO6A 2VL8A 3V8KA 2KZVA 3WGGA 1Z6TA 2X1DA 1HCRA 4AD9A 1MNDA 4GRIA 1PP7U 2H1LA 2NS0A 4RLFA 4ITVA 2XB0X 3OYGA 5HNHA 2MGQA 1USSA 1W4MA 3D1NI 3H9JA 2EIMH 3Q3SA 3QPSA 3O6BB 3OL3A 4MO7A 1ONVA 2KJCA 3BG7A 1H0MA 3JAMZ 1X19A 4IXAA 2VONA 3BDDA 2WB1A 3DLLF 4BNCA 1ITYA 1SVMA 3K9TA 4RGUA 5J1YA 1I6HJ 3F6VA 3GBGA 1IUYA 5ICGA 3AKZA 1MBEA 4A3BJ 2R0QC 4E7KA 5GTIC 1W1WE 4M3EA 2OZ6A 2V6CA 4XRMA 4NQWA 1MSFC 1ON2A 2DFEA 2IBDA 4ZYDA 3KIOA 3BPVA 2ADUA 2ZFWA 3NQOA 2OUMA 2QGUA 1A04A 4ZC3A 3E3VA 3ZQHA 1X1AA 2GBYA 1U6GA 3JCUC 3BTLA 1HDDC 4E4HA 2WY8Q 4HNUA 3T8RA 3GTQJ 1V54H 3TBIA 2BZTA 4XRSG 4U0VA 1WSUA 4CSWA 5EGOA 4R1HA 2NVXJ 3ZR8X 1XGNA 2XC7A 2VJIA 2E5NA 4HZFA 4PGGA 4ABZA 2ZB9A 3BOQA 2DDBA 1OMIA 4OU0A 4KN4X 1LNWA 1O3QA 4CCNA 4DW6A 4ZDLA 3KLOA 1ZG3A 4RB2C 3J7AY 1Z05A 3WTSC 2Y0SA 4CCMA 3CUQC 2JRTA 1X4OA 2FE3A 2Z99A 2EZLA 1Z7UA 2XF5A 3DKXA 2MG4A 3PNVA 1VQPI 3IRRA 1EKEA 2HYJA 1G6NA 4Z2YA 4L9JA 4L0YB 3CUQA 3F8CA 3T8TA 4RB3C 1FBQA 1ZTRA 3BTCA 2K9NA 2ZBKA 1XSXA 4CICA 4G94A 1MDMA 5M5XJ 2EIJH 4CCOA 4IZZA 1W7PB 3IRQA 2FUG2 3TOAA 3ZMZA 2DA5A 2FD5A 3GUDA 2EB7A 1JKOC 4AUXA 3M8EA 3P9KA 1ZELA 1YO5C 2NNNA 3IAM2 2MD5A 2K40A 3KP7A 1IRZA 4CO8A 3VOEA 3CMAI 1K79A 4A93J 1B72A 2R3SA 1FP1D 4BEHB 3F21A 1C0WA 1W5CC 4BQAA 1R1UA 2ID3A 3G1OA 5E18F 3V7SA 4BJ6C 1RUOA 4E7ZA 1EH8A 1YOVB 4L9VA 1ZR4A 2KKOA 1X4PA 2XPVA 4V2FA 2BY1A 1ZQ3P 2P5VA 3O8GA 4XKCA 4CZZA 3A1YA 1ZYRF 3WODF 2EWNA 3KZIC 4EGYA 5KHDA 1HLVA 1UELB 1RZ4A 4YFXF 2FQ4A 2A6EF 4S04A 1DGRM 1QVTA 3CMYA 1J9IA 1MMAA 1LJ9A 2P5KA 3CJNA 3GXOA 3ZP5A 2JWTA 2ZC2A 3QYEA 1XDUA 5JFRA 1FX7A 4RGSA 2VQGA 2Y30A 1V3FA 1KU7A 3SXYA 2LR8A 5DUKA 3BZCA 1YW8A 2A3SA 2QZ8A 5K5OA 1XPXA 3GZNB 3PIOF 2IA0A 4A3CJ 3I55I 5LD2C 5H20A 1XGSA 2E36A 4LIVA 3OYJA 1TQIA 5HS7A 4WF2A 1MH4A 5K1YA 3OYEA 2YSRA 2O9LA 3PUFA 2F5CA 2IGOA 3M1CA 1L3LA 2NRAC 1GVJA 2X6WA 2HU9A 2DA4A 3CJTB 2L7FP 2LD5A 2ZNYA 3VEPA 2BE5F 5CVVA 2W84A 4A5MA 3L2UA 2GXAA 4D1QA 1W7PD 2TRTA 5IP7J 4IHTA 4Y52J 4U0YA 1P4WA 1KU2A 2BVMA 1TT0A 3HOTA 2PN6A 2E2IJ 1TWFJ 5EG0B 3MKWB 3K1PA 4F52A 4G7OF 1TT5B 2LDUA 4IO9F 4M6YA 1FMWA 2KHMA 2GXGA 1NH3A 2A5YB 4CCJA 1JGSA 1TWCJ 3X2QH 2NAZA 2VKVA 3VFZA 2HZDA 4U7DA 2ELKA 3K4MA 5EEAA 2F6CA 4HNVA 2LRDA 3TP3A 3DV8A 4Q4ZF 5D5WB 2OTJI 3ZGKA 4OIRF 1N78A 4JK1X 4HBLA 4B3AA 4LIUA 3JRHA 2JA8J 3T5XA 1USTA 1VNDA 4ENJA 3CJQB 4IHYA 2LOOA 2VN2A 3DPUA 3BR1A 3F8FA 3M9AA 2B0LA 1T33A 2NS7A 3H5RA 4KT6A 4R79A 4BXFA 1SFUA 4F55A 1BC7C 2VXZA 3ASOH 1A31A 3D5SC 4J00A 1JKQC 4UVBA 4E7LA 1VI0A 2Z3YA 4ON0A 1LE8A 4LGWA 1VQKI 2V6EA 1QA6A 1LEAA 2K4BA 3ML6A 2Z9OA 4YG2F 3PIPF 3N4MA 2H27A 2DT7B 2MC4A 2PEXA 3TDUC 2EV5A 1RNLA 2NOGA 3WU2C 2IS6A 3OYLA 5IYCJ 1ZRFA 3CC2I 2XRNA 2FNPA 5LGTA 3I58A 5JI6A 1T95A 2VLAA 1SMTA 3ECHA 4EMSA 5IT3A 2PMZA 2DODA 2EFPA 1I1SA 3VPRA 3ABMH 4HOBA 2W57A 1GV2A 1MBKA 4NBQA 4M6VA 4ENKA 2PX9A 3ABUA 4A3IJ 5IOYA 4IKFA 1SVLA 4IPAA 2HXIA 1HW5A 2NVTJ 1B9NA 3PFIA 3OYFA 4MNUA 2XUBA 1ZN2A 1K78B 3QP5A 2E19A 4DNCA 2R4GA 2L7KA 5F6FA 2MABA 2W1OA 2XF6A 2M9HA 2HQAA 4JBAA 4XBFA 3OYAA 2IS2A 4BE0A 4P9UA 3CCLI 1TC3C 5BPIA 5GADJ 5HDKA 2L02A 1IJWC 2VKEA 3FXMA 2HQNA 4I6ZA 1IAWA 3EETA 3CCMI 3BTIA 1WI9A 2M34A 1VQ6I 3DTEA 2J5PA 4IRGA 1LDJA 3QP6A 4QPQA 3WE3A 3HDDA 5KAFC 1LFPA 2PMZN 2KRHA 1OYIA 3MWMA 4GFBA 3FXRA 3IC7A 1AHDP 4EJOA 2EZHA 4XONA 5CQGA 5D5UB 4IHSA 5HDNA 3DF8A 5HVQC 2O8KA 5JLWA 2DJNA 1FMVA 1SD5A 3LSTA 2LG4A 2NNYA 3ABKH 3SQNA 4AIJA 4HEA2 2V1DA 2LFBA 2F5DA 2LF7A 3BQYA 3OYMA 3TO7A 3DKWA 1RPWA 5EEGA 3FM5A 5CKTA 5FLVA 3RQ4A 1JGGA 3QWLA 4FE4A 3SEZA 2DFIA 3EDPA 2KIFA 4M9ZA 4XLFA 3W6JB 4Z6YA 3FXQA 5E8GA 2M87A 2L4AA 3P9CA 2LK2A 3UNGC 3MMYB 4DQ2A 1BJAA 2Y0MA 1YRNA 2I5UA 2OTLI 1W5SA 2QYOA 2RQPA 4MLOA 3W3CA 3CQZJ 3EUHC 4PK4A 5DDGA 3PNYA 1HF0A 3HKZN 3KE2A 4XLAA 1XMKA 3IL2A 3I0TA 1WRJA 4UV8A 4NUBA 1KQ8A 5FKNA 2QWWA 2GIZA 1IV8A 3WTZA 3OYKA 4G6TB 3CP2A 2HPMA 1S3JA 1LKXA 2OQRA 4IF4A 2OZUA 2HVQA 3K2AA 2JVGA 5J3LA 3P7NA 4B47A 5IYDJ 3TW7A 1D5VA 3AL0B 3FISA 1V5FA 4JX6A 3BQZA 4XLHA 3ESWB 2DFFA 3E5UA 1Z6RA 1BI2A 1AA7A 2E7XA 2EFNA 5D4SA 5E3LA 3L1PA 3KYLA 2DA1A 1LDDA 1T8IA 3OOPA 5IOZA 3FXOA 4BACA 5H2FC 2NYXA 5HLGA 2ID6A 1VQMI 3BROA 3GWZA 5B3SH 4KYWA 2MLKA 1Z9CA 2Y69H 4E7SA 1HBXG 3RZDJ 3KYCB 1QHGA 2CV1A 2KT0A 1MSEC 3AG1H 4MFDA 4M9XA 2ELJA 4FHTA 4MEYF 1Z3YA 2ZKZA 5F0FA 2Q8KA 1YE9A 4KMFA 2R7FA 3CD6I 5TRDA 1KQ9A 2QENA 1LUJB 4FASD 4LJZF 3U9GA 5CYVA 2M8GX 1F1ZA 2P5LC 5K7ZA 1G3TA 1R9TJ 2VODA 4LG0B 2BGCA 1O3SA 1V5GA 2K02A 2JRMA 4DYQA 2QKMB 3PQKA 4EM1A 2IS1A 2EK5A 3NRVA 3U1DA 3IH2A 1FT9A 2BY3A 3SYTA 2KDZA 3HUGA 1PVEA 3DBLB 3BZKA 3F22A 3HHHA 3CDLA 5FD5A 4LOCA 1IXSB 3HSFA 4CGZA 3TGNA 4HYEA 2XGCA 1TQPA 5CJ9A 3GTKJ 2BVLA 5L3FA 4Q5SF 3PL8A 2DT6A 2EJRA 4BQQA 2CQ7A 3FBIB 4FX0A 1Y8RB 2IGMA 1Z1DA 3CO6C 4C30A 1QPIA 1JI8A 1SMYF 4I0BA 1FTTA 5A2QZ 3GFLA 3IH4A 1F43A 1AKHB 3J80Z 2L01A 4P55A 4HRIA 1YLFA 2E1MB 5K7FA 2L3DA 1U8BA 5J8CA 4U7BA 4AIKA 1S7OA 2HVSA 1GV5A 3Q9SA 2JSCA 1UFMA 3JSOA 1N25A 5ICFA 4XOTA 4EGZA 1PYVA 2FQ3A 4UB8C 3GZ6A 2VC1A 2FBHA 1FSHA 4RA2A 1BR2A 2R7DA 4P96A 3ZQIA 1JKRC 3JAMK 4OOIA 2OJED 1WPKA 3HGYA 2QF7A 3I4MJ 1ENHA 3CCEI 4V2GA 2VI6A 2BW3B 4G9YA 3NWSA 2MBFA 4BYYA 2PMUA 2KLOA 6PAXA 3DBHB 4GGGA 5B66C 1W7PA 3FM3A 4LB5A 1EH7A 4WXCA 3M3YJ 1Y39A 3JW4A 3BZ6A 3MKLA 1P6RA 2DK8A 1R23A 5E1WA 2ISZA 3ULQB 2ZJ2A 2R93J 2V79A 3QRFF 3FKIJ 3S14J 1XGOA 1U0JA 4BEHA 5J6XA 3CLOA 4RM2A 2IEKA 5E79C 5C4XJ 1RR8C 1Y0UA 1YG2A 3VB2A 2CQQA 5DCMB 5LHHA 2F5FA 1ODDA 1TW2A 4H4KC 1E2XA 3PO2J 3HOVJ 2HOTA 1R1TA 2E5ZA 3WG9A 1FYMA 4M3FA 4FISA 4KN7X 2OU2A 4I7HA 5ICCA 3K0LA 1OJLA 3Q9VA 4ZYEA 4HSTA 3E7LA 4G12A 1G3WA 2IJLA 2X48A 4LK0F 4HLYA 2XAJA 1WFXA 1OLTA 1QZEA 1UB9A 2XRLA 1ULYA 1B8IB 4UUVA 1MIJA 3K2ZA 2OCCH 1T0FA 1WQ2A 5DCFA 5D5XB 5F1RA 2P81A 3V42A 1TW3A 1Y6IA 3R6SA 2W4SA 3CTAA 1ZLJA 1ZG1A 2ME6A 5KCMA 3OOUA 2ECBA 1APLC 3HBLA 3OYHA 1FNNA 2L0KA 2WAQN 2AQEA 4XSXF 2VKHA 2FMYA 1PJRA 1RR7A 2N8GA 3OYIA 4XM3A 3GVAA 3GFIA 4RDUA 2DMNA 2P6SA 2QVOA 2MFZA 3B6CA 1BJZA 3G73A 3S3NA 3LA3A 2R7VA 1PP8F 1Y0NA 4UY8I 1TP4A 3C18A 2AXTC 2Z2SB 3KEOA 5BPDA 1ETOA 1OCTC 1ETWA 3ZQGA 2EZIA 2ZMEB 1FSEA 3I64A 1FJLA 2HTJA 3QQAA 1MMNA 1DPRA 3FDYA 3HXLA 1FYLA 4PDKA 4N4NB 3ZN0A 4KFCA 5J1UA 1MW7A 2KZGA 3H5AA 1MMSA 2W24A 2X85A 5EJCA 1F4KA 1FEXA 2DMQA 5EG0A 1WJDA 3V8LA 3EPZA 2FXAA 2HKOA 4RS8A 3MEXA 3ZRGA 4C9YA 4Y3OA 3HRTA 1FOYA 2I10A 2HTSA 3CF2A 2HOAA 2KIQA 4DGWB 4E7JA 2X4HA 2VQCA 2XPWA 5FJ8J 2OBPA 4WX9A 1XGMA 5FKOA 4ZJZA 2DYSH 2BXYA 1Y1VJ 2HPIA 3DWLE 3GFJA 2K3FA 3PM1A 2EA4A 4I98B 3GTMJ 2V1UA 1KONA 1ACIA 3H9QA 1R5GA 3H92A 2X1EA 3KLNA 1D1CA 1R71A 1ZREA 3QPTA 4EJTA 4HV6A 3EYYA 4OWRB 4EJWA 3CC4I 1KQ0A 1YHQI 4KJZA 3AG4H 1K6YA 2FBIA 2WAEA 2JQ7A 2ZNZA 5M5WJ 2GAUA 4JX4A 2A68F 5C3EJ 5KVRA 1X1PA 3QOEA 2DOEA 2DXIA 2CW0F 5EDNA 5IP6A 4N4OB 3VYSB 1E0EA 2DAOA 3SZPA 3RDIA 2ISYA 3L2VA 4ZYHA 2UUZA 3RZOJ 3TW6A 5ILSA 2R7ZJ 2TCTA 2UZKA 2H6CA 1JT0A 2CG4A 2EFQA 2R7UA 1O4XA 4OINF 2KIUA 1XX5A 3DKYA 4A3LJ 1BM9A 2XAUA 4B44A 3ZMSA 4BE2A 2JUGA 3S16J 3LAJA 3GFMA 1BA5A 1R36A 5CLSA 5E3NA 4LITA 5E3OA 1DU0A 4AYBN 4EQQA 1ZGAA 3KP6A 2OC6A 4ZTJA 5BOXA 4PFPA 5HLHA 3M1EA 2VBWA 1GT0C 1VQLI 3HTSB 4BS9A 3H9GA 2KL4A 2VOOA 1I39A 3WG7H 1TWAJ 2OCEA 4IEJA 2M0CA 1SD6A 1K78A 2WC2A 3HRMA 3BCAA 2BYVE 4U0WA 1FOXA 3HPHA 2CW7A 3PSFA 2RAEA 3DU6A 3PQJA 4XLCA 1RRJA 4XLPF 1BIAA 4JQFA 3HL2A 1OYYA 1S7AA 2IRFG 4NNJA 1POGA 4HF2A 1OCPA 4RAGA 5D5VB 3JRDA 3GTJJ 3I53A 3LQRA 4G8XA 2PQ8A 2V1NA 5C44J 3OWTA 2XPUA 3REOA 3A01B 4F3QA 4GO1A 2KDOA 2DQLA 3CCYA 3NEUA 3FMSA 2H8RA 3K7AJ 3BC8A 1LQ1A 4DYRA 3OIPA 2R7XA 1W36C 1YS6A 2EZKA 1QGPA 4O5VA 2RC4A 3ZMUA 1ZHFA 3DCFA 1DUXC 2R7WA 3VSLA 1Z21A 3KCCA 2YU3A 2E7WA 2CFOA 4DIQA 1VQ5I 1MJAA 5CVIA 2TDXA 1WI3A 1Y8QB 2COBA 3MZHA 5FB2A 4A3MJ 1XMAA 3IAS2 4Y7NJ 1GXQA 4MHGA 2KPMA 3JR9A 3ZCOA 1S8NA 5CVRA 3V4GA 3C2GA 4XKWA 1XDSA 3GX4X 1D1BA 2RNJA 3JTHA 5D6FA 3SFZA 2X6XA 3L2CA 1K6OA 2Y9YA 1Z3XA 3DEUA 4E7HA 4RB0A 3DBRB 1BC8C 2BY0A 3W2AA 3AL0C 3RKXA 2B9SA 3OS1A 5DTDA 2LKXA 4FCYA 3BP8A 4M3GA 4FX4A 2JTVA 3T0YA 2L2OA 2L9RA 2DK5A 3ZOBA 4J19A 1TWGJ 3EUKL 3GLLA 3JRFA 4HAMA 1YYVA 3E6CC 1ZKGA 3ISPA 4OIQF 4OMYA 2K4JA 1ORKA 2GWRA 4OIPF 2DA6A 5L3BA 4OAZA 1OCOH 1MJ9A 3E0JB 3Q0UA 2VE8A 4U87A 1W0UA 4A3DJ 4RAFA 2HDCA 1EF4A 3IKTA 1FBSA 1IUFA 1WJAA 2L54A 3JRIA 5FKKA 4QTRA 3OSGA 2H09A 4IX7A 2IXSA 3A03A 4HPQA 4XN0A 4Q48A 4C3JJ 2X6YA 3BLYA 3GF2A 4PJJA 3LFKA 4AIDA 3S15J 4U88A 4YELA 4D0PA 1X1DA 2L9VA 4ZYGA 1ZRCA 2HR3A 2XB5A 2VQHA 4DZPA 2CV0A 1NG7A 4XKVA 4AVZA 1OFCX 3LSPA 1OR7C 3SZTA 3HEFA 3RI4A 1SD7A 2M4KA 3S93A 3OYNA 4KMUX 3VYRB 4BDZA 2R7QA 1HSJA 3QODA 2YX4A 3F8BA 2CUFA 4KT5C 2WWYA 4LG0A 1OR7A 3KX2A 4HF0A 4M9SA 4MGRA 2OPTA 3C1DA 2QEXI 3S1NJ 2JT1A 5LRSA 1LEBA 1U2WA 3WGHA 2FU4A 4Q47A 2Y31A 4DBRA 1TWHJ 5HLIA 1SANA 3PFYA 3PUBA 2CUJA 4UB6C 1IDZA 3BT9A 4CUGA 3OL4A 1J09A 3K6GA 1ZGWA 2COMA 2M3AA 2YU9J 1MNEA 1MMGA 1X3UA 1X2MA 2P7VB 2WAFA 1BR1A 3W2WA 3I59B 2E1MC 3RJPA 5IPAA 3CESA 5TGTA 2KP6A 2IA2A 2V7FA 2R5YB 1AKHA 3RCOA 2VB6A 3J81Z 3S1RJ 2XAHA 5FFZA 3M8FA 4PFOA 1HOMA 5LLQA 4EATA 5HNFA 1J59A 4ESJA 1WGXA 3H1CA 2CH0A 2V1XA 2WV0A 1H89C 4P5OA 1P7JA 1T98A 1A6IA 1IDYA 2VOPA 1MKMA 2QKLB 2W82A 3F3XA 1P7IA 5HDGA 1TLHB 4BE1A 3AG3H 2W85A 4BHPA 1WJ5A 3G71I 3H0GJ 5FKMA 2R92J 1TNTA 1R5HA 2ZXHA 4ETSA 1IN4A 2BW3A 3BJAA 2PBIA 5JVTA 3N05A 2EIKH 3KEQA 2JA5J 4HW0A 1XTAA 3HOUJ 3IKVA 2KRCA 1JUSA 4I99C 4LFUA 2AQFA 2K7LA 2VT2A 4EM2A 3WGIA 2LVSA 3K10A 3RPQA 2LREA 1UHMA 2QQAA 1IV6A 4IHXA 2G0EA 2Y48A 1RETA 5K5QA 1T2KA 2PI0A 1EJ9A 1IGNA 5EZGA 4UUSB 2GM4A 4MQVA 3WTXC 3LNQA 1EV7A 5DCMA 4IQJA 2EFWA 2XGDA 1ZRDA 5A2QK 4BDYA 2X1CA 3PNTA 5EF6A 5ED4A 3J80K 1R00A 3HKZA 4HF1A 2F4OB 4AIHA 3CZ6A 2JA2A 3IWZA 2DW4A 2L4MA 4HQMA 2ZXJA 1KZHA 2LNBA 3JRBA 3TEDA 1B8IA 1VFCA 4B09A 2JPCA 1D5YA 2DA2A 2H8WA 1TQMA 4HV5A 3K1NA 1V5EA 3VDXA 5FD6A 1YJWI 2V9VA 4OAYA 4C2UA 3HOSA 4UVAA 1D8JA 1ZARA 2RREA 4XN3A 3ZQFA 3L9FA 3GYHX 2K85A 2Q1ZB 5C4JJ 4KDPA 4B8XA 3I54A 4QWQA 3LA7A 1WH7A 4WXHA 2FRHA 3AG2H 3SJMA 4CH7A 5IT9Z 3EYIA 3RQIA 4YIIA 1VQOI 3DU5A 2M7AA 1ZAOA 5LFAA 4PCQA 2VPRA 2Z16A 1T38A 3U21A 2ZMEC 1G4DA 3I71A 2XF7A 1SFOJ 3MN2A 5M3FJ 4BXXJ 5TJJA 3HRSA 2FOKA 5L3EA 3S32A 3EUHA 3M8JA 2CQNA 4HSRA 2CV2A 3FHNA 1SFXA 3IUOA 2ZMEA 4M3BA 2XROA 2QBYB 3DEWA 1HKQA 3BY6A 3QPHA 3HTUA 2EV6A 2IP2A 2K27A 3O8HA 2ZCWA 4A0ZA 1S9HA 2CUEA 2ZXIA 1R22A 3O2PE 5LHGA 4WK8F 1HA8A 1ZK8A 1BIBA 2W48A 2YUSA 2IVMA 1WJCA 5DD4A 3KYDB 2L5QA 5LGNA 1MBHA 3A2KA 1RKWA 1QPMA 5F04A 2VQLA 2I8DA 1DGWY 3RKWA 2OA4A 3MKYB 4CZCA 4P1WA 2XGEA 2LTPA 2G7UA 1ETVA 1EA3A 5CQEA 4XLEA 3U2RA 3RKYA 1OISA 2XAGA 2AO9A 4LLGF 4AC0A 2ZJRF 3LSJA 4L9NA 1HDPA 1P92A 1J0RA 1A35A 2Q2EB 3D5LA 2DT5A 3LFUA 4MEXF 2NXNB 1KA8A 2WTEA 2QQ8A 4A12A 2V26A 2ME0A 1ZG5A 1SD4A 2EPFA 2UXXA 3C7JA 4Y33A 2DTZA 3TMOA 2WA0A 1W36D 2HFHA 2EV0A 2B7EA 4XL9A 2LF8A 4LLLA 3VODA 4MTDA 2KISA 2XHKA 3TKYA 2R7TA 3CCVI 4X6AJ 4W97A 3CMMA 4O6JA 5HS9A 1Y56A 4BHBA 4PSXA 4XMYA 3H35A 1F5TA 2NVYJ 4M74A 2G9WA 1B1BA 1AOYA 4ZZLA 2F5VA 3LOCA 5LBQA 2VPLA 3OR1C 5BQTA 2VE9A 2L9SA 2VJJA 1YTYA 3PJRA 3HHGA 2M4GA 4DOZA 3ONQA 3WTTC 3H0DA 5E1XA 4UNOA 4BUPA 1SFKA 2VC0A 3HYIA 2QSGX 2QSHX 5HLTA 2RVCA 3P9IA 3I56I 5M3MJ 2E34A 1GUUA 3BWGA 4LMYA 3O3KA 3KZYA 3DQVC 2K9SA 3M4OJ 4AU7A 2E1NA 1FIPA 1B59A 5GTHC 2F4IA 5GAEJ 2JK3A 4GYIA 1HQCA 3GCMA 5FKLA 1OQYA 3ERED 5F08A 2ZJPF 5K5RA 2STTA 4B4CA 4A3KJ 3F8NA 1OCZH 2IGKA 5DD8A 2RV8A 3BR5A 2LLKA 4B43A 2W00A 1YIOA 2NVUB 4YRVA 3FX3A 2M30A 2GLOA 1D0XA 1I50J 2LY9A 1DPUA 4Y15A 4GYGA 2HOSA 1HKTA 4L5JA 4D5CA 3A01A 1S5LC 2QCOA 2CQXA 2GOXB 1BL0A 2JPBA 1YW9A 3M7GA 3S8PA 2GQQA 2MW8A 1V55H 3K4KA 4BXUA 4IQ4A 5HODA 3WTYC 2X9DA 3R0JA 2DA7A 3A02A 4A0YA 5D6EA 2P4WA 3A0BC 2NS8A 2P8TA 2WAQA 4ZYAA 1E3OC 4BY1J 1KU3A 1FOKA 3F6OA 4BL0B 2O8XA 4XQFA 4IHVA 1X1BA 2D2WA 3R60A 3TL4X 3HOZJ 4R8HA 5E8IA 4JP0A 4I2OA 1DU6A 4CYCB 2XAQA 5FFXA 2DQRA 2FEZA 2VIXA 5AIQA 5IYBJ 3QYFA 3TQNA 4RB1A 1R4NB 5KAIC 2KJBA 4IL6C 2BY2A 3L2WA 3PSIA 3ELKA 1BI1A 2YR2A 2QQBA 3HGGA 3RKQA 1E3PA 1Z77A 3DPLC 2KFDA 2D1HA 5BMZA 1D0YA 4N0BA 5L3GA 4UHTA 5TISC 3OSFA 4FETA 1MMDA 3RYRA 1TL8A 5F1JA 1BN5A 5IP9J 2DA3A 3CF5F 1Y1WJ 1HXDA 5K7HA 5F0HA 2VBXA 4II2A 1WZ2A 2H94A 1O7FA 3SDGA 3ASNH 5LHIA 2O61A 2M8EA 1BOBA 2EILH 3EQLF 3G4SI 2M45A 2MYSA 3CCSI 4M73A 4RGXA 3SFIA 3ABTA 3RIRA 2HNHA 2AXLA 2M7BA 3RTRA 3CUOA 3T1BA 2HVRA 1U78A 3G3ZA 5DM6F 1YITI 3K1MA 1BI0A 1FC3A 5FROA 2E1CA 2P7CB 4O3MA 3QPLA 1H9GA 3NWTA 1K4TA 4I76A 4QIWN 5FRNA 3UKGA 1OYWA 2K3PA 3FZVA 4EJUA 1R6RA 2VT3A 2LY1A 2CU7A 2BBYA 3TO9A 1LPQA 5FLMJ 1ON1A 4BU2A 4ENNA 1NHAA 4F7ZA 1ETXA 1VTNC 2CUZA 5J4VA 2L7MP 1CF7B 4NHJA 3WHCA 1SEUA 4A0XA 4A3EJ 5DYMA 1WVRA 1TZLA 4RAZA 4HX7A 5B5EC 4KISA 3WHBA 3ZQQA 2BEOA 3F8MA 3OR2C 2PMHA 4Y13A 3U1KA 1FYKA 3V8JA 1PUFB 3K4CA 1U5TB 3B02A 3LSGA 1IC8A 2XGXA 3WE2A 2L7ZA 2JZYA 3Q5FA 1A6QA 5J40A 3PO3J 2X51A 4FQGA 3R4KA 5ERIA 4QSHA 4AYBA 2R5ZB 4AVPA 1S29A 3GLXA 1NG6A 2DMPA 2GA1A 5AONA 1T56A 1IN5A 4KIGA 5LEKA 3AAFA 2LBFB 2UV1A 2V9KA 1U8RA 3FXJA 3BG5A 1I5ZA 1XB4A 4LB6B 3W6VA 1NK3P 2M5WA 1RUNA 4CHUA 4LD5A 3I59A 4OIOF 1WJEA 1JJ8C 3K4LA 3WTVC 1YI2I 2R5YA 2CS3A 1IF1A 1QO0D 5BS6A 1A5JA 2BOLA 2Z33A 1IRGA 1IW7F 1LDKB 3OIOA 3QYBA 1T08B 2DMUA 2YPRA 1VQ7I 1QVUA 5DEQA 4C2TA 2DN0A 5CPRB 2HKXA 4ZZDA 3HUGB 4HX8A 2A6TA 1ETYA 1GXPA 3CDIA 2VBYA 1RIOH 4ZH4F 2JN6A 3KPHA 2F2EA 3K69A 4C3IJ 1IN8A 2IAIA 1UCRA 1R58A 2J5OA 1R4MB 4HX4A 1P9QC 2QA4I 1TNSA 3OYCA 3K4BA 4IRHA 4A3JJ 4ENMA 5FLXZ 1B4AA 1JUPA 1XCBA 4UUTA 3BG3A 2W7NA 1UJ8A 4BAYA 2DDAA 2KRFA 2JVHA 3S17J 2PG4A 3J7ZI 2CWEA 2AS5F 1S6LA 4KICA 3CDHA 5E20A 5EEHA 9ANTA 1S72I 2WB1N 5DUIA 4EJVA 3I4PA 3DTIA 4UUSA 4HG2A 4P9FA 1RESA 1RC9A 1M1EB 1K83J 2F5EA 2K5CA 3HSRA 3IWFA 5F27A 1I6XA 1UHSA 2NOJB 3HOYJ 1E3HA 4QPOA 4KIBA 3J81K 1FBUA 5GPCA 1WCMJ 4NDLA 4L5EA 3HG9A 3CCJI 4LG3A 1D8KA 1SC7A 1JE8A 2QLZA 4G6DA 1VQ8I 1IXCA 1RI7A 3E5QA 3FXLA 1MBFA 4F91B 1R49A 3ZMTA 4ASNA 2MSYA 1PUEE 2STWA 2HDDA 2V4JC 4B48A 2ZO4A 2O03A 1OKRA 4K2EA 2EH3A 5LGUA 3FBNB 2D1VA 2XKPA 3HZJA 2VBZA 1JJ6C 3IHUA 3HC7A 1G8XA 3E6DA 1B9MA 2XSDC 2DFHA 1GDTA 4Y17A 3RSNA 1OPCA 3C2BA 4UXNA 1UMQA 4HLXA 2LC2A 3K70C 2A61A 3Q0VA 2VASA 1DP7P 1BBYA 2DLLA 2CQKA 2WBMA 2Y0SN 4XORA 4PGHA 4RBOA 3LA2A 4G7HF 3WTUC 2ZJQF 2ICWG 4DBQA 3LSHA 2A05A 1U9NA 4CCLA 2PJRB 1FOWA 1YX5A 2FBKA 2FNAA 3N97A 1NTCA 4EVIA 2Z1DA 4L9TA 2LP0A 2HS5A 2K86A 2E1OA 2XV4S 3BR2A 4CA0A 3JSPA 2QBYA 5FGMA 2GOMA 1JTYA 4H0EA 4RM3A 3RPUA 5CVJA 3R61A 4F93B 5BNGA 2QQ9A 1PDNC 1I3QJ 4EM0B 2E60A 2H6BA 4M72A 3ZMVA 2E71A 4YFNF 1J75A 3MKZA 2O0YA 3DEEA 2OD5A 1IRFA 1I3AA 4PJMA 3S3OA 1O3TA 2A07F 3SDBA 4XICA 4DYCA 1XG1A 5GP9A 3MFKA 1IZ1A 1QU3A 4ANJA 3LSRA 4PJ0C 4ZDOA 3F72A 1MBJA 4FE7A 4HA8A 5JHUA 3KP2A 4QLCU 4UVCA 3CCRI 4NC8A 4M6XA 1QHHD 4J01A 2WY7Q 4MQ9F 1GVDA 2Q2EA 5EYRA 4BY7J 1ZGJA 1T39A 2ZSHB 3BR3A 3AFHA 5IT9K 2RKHA 1W5TA 4II3A 1P4XA 2EQRA 4GDFA 1MH3A 2QM3A 2MLGA 2HDWA 2IS4A 4XNFA 4IRIA 2E2JJ 1FP2A 3KZZA 2LMDA 3IH3A 5FRMA 3D0SA 2EINH 1G3YA 5B1BH 4XRSA 5L3DA 3L09A 1LVAA 2YX7A 4XKBA 3DXJF 3I3LA 2NVQJ 2CJJA 2GA2A 2M2EA 5M5YJ 3DFGA 3FWEA 2DU9A 3K4JA 1U3EM 1GLNA 1VQ4I 1GHCA 3JRAA 1I27A 3ZMDA 2IA1A 3OY9A 1HW1A 3ZQ7A 1R5ID 1Z7LA 1ERDA 2LSOA 4W1UA 2HQRA 5FO5A 1KGSA 3MQ0A 3G1LA 2QUFA 2O5RA 4LLNA 1IO2A 1X1CA 5F64A 1ZR2A 2O3FA 2ECCA 1YX3A 3L2RA 2M1BA 4PJLA 2HYGD 5DS9A 1JHFA 5B1AH 3L2QA 4NB5A 4D5FA 1L0OC 2XASA 5ILUA 4XR6A 2ZXWH 2DOFA 1FZPB 3B73A 5JLXA 4HDVA 2CFXA 2L9NA 1IXRC 4JOMA 4PUSA 1UZCA 1F36A 1J5YA 3FK6A 1KYZA 1MNMC 3HOXJ 2BHYA 2YS9A 4NQWB 1BW6A 2GIVA 1WKMA 2JSPA 1SAUA 2BXZA 2DMTA 2XKOA 2A6HF 1NK2P 2PLYA 3LL7A 4EEFG 4KA4A 5JHFA 4L5IA 3FXUA 3L00A 4TV7A 1O57A 3S2WA 1EH6A 5DM7F 5CVUA 2HZTA 3F9KA 2PFBA 2XVCA 3BJOA 1ZH5A 4B1RA 1H8AC 1WHUA 4MTEA 5JR3A 5EGOB 2IT0A 3BR0A 4UV9A 2HYFA 2X0LA 3BJ6A 4JX5A 3OYDA 1YQAA 4YEJA 1Q1VA 4XLNF 4BGDA 2H1KA 4KIFA 4WXDA 1MZBA 4BH9A 5GAGJ 3ZQLA 5D4RA 1SAXA 3ECOA 5D8KB 1STZA 4BHCA 4IHWA 2DPDA 2CGPA 2BV6A 1DQUA 1YS7A 1SFEA 3OYBA 1Z0XA 3KP5A 4PSWA 4CYCA 2FA5A 2EBIA 1IN6A 4BJ5C 3GTLJ 1V4RA 3CUQB 1REPC 1K61A 4D7NA 3E5XA 3CO7C 4HQEA 3GMEA 3H3UA 4E7IA 3FK7A 1U9OA 4KUMA 1T6SA 5AIPA 2KIMA 1MDMB 1K4SA 2KQRA 3SZGA 1YFHA 3GO5A 5E17F 1TBXA 4MIMA 4A2UA 3VWBA 1P4AA 4AWXB 3G1MA 1YW7A 2RGVA 1UG0A 2F4MB 4CCKA 3H3VK 3TOBA 2ESNA 1RKTA 3OS0A 1LVKA 1K7AA 3G2BA 1B72B 4WWCA 1HSTA 2JUCA 1FLIA 5KNLA 2CSOA 4GXOA 3WTWC 2GXBA 2KMUA 3V7CA 2O6GE 3K4NA 4OMZA 4FT8A 3LQQA 1P2FA 1LFBA 3FIWA 3CCQI 1R1VA 2Y75A 4CXFA 3MZ8A 2MC3A 3LSKA 3MZYA 2Y9ZA 2DPUA 3J7AO 1LFUP 5KK1A 4FTHA 1QBJA 3ZN1A 4C2MJ 3CMEI 2VXDA 4G6QA 3C3WA 1AU7A 4EV0A 4E6KG 3WU1B 4A5NA 3KP4A 5LEJA 3KETA 3H5NA 1FY7A 4I0AA 4I02A 4M3DA 3COAC 3HM5A 1VQ9I 3JTGA 3GZ5A 3MD2A 2LYCA 3QAHA 1XN7A 4XRFA 4A6DA 2BHZA 3BTJA 3I9V2 5E1ZB 3TP0A 4JYKA 2HWVA 2JJ7A 1XCVA 4B3XA 2CRGA 1WJFA 2IGNA 1CF7A 5HOOA 1Q1HA 5H6RA 2RNGA 3Q0WA 2RQQA 1N75A 1U5TC 2FJ1A 1ETKA 2HOEA 3W6KB 3S1QJ 2P0WA 1SVOA 3EUAA 1UHWA 3LMMA 4C3HJ 3FKJA 4NC6A 1PUFA 1U5TA 3NARA 3QU3A 3ZPLA 1D0ZA 2D45A 3LSIA 3VSKA 1QRYA 2O7OA 2P6TA 1VQNI 1VF9A 4I09A 1B6AA 2E2HJ 3BCBA 4WCGA 1XD7A 1HC8A 4BBSJ 1OCRH 3HB9A 3DLAA 2R5ZA 1KU9A 4ZTFA 5LRRA 4XOPA 4I01A 2ACJA 2Z5UA 2LBFA 1O3RA 1BI3A 4V19K 5J47A 3OV8A 1O7LA 3BR6A 3MCZA 1Z67A 1MD0A 2Q0OA 4RMNA 3QU6A 3JREA 2ZFUA 4D7MA 2HI3A 3E6MA 2MD0A 2DI3A 4G7ZF 3KFWX 4CDGA 4BJTA 2WADA 2A69F 2HXOA 5IY5H 1HW2A 3E97A 2LY2A 2XSJC 3H36A 5D8LB 2AHQA 4ESFA 3D5RC 1D3YA 3K70D 3HSEA 2OQGA 4MFEA 1CQTA 4RLQA 4YIRX 4HNTA 2C6YA 3KP3A 3LSMA 5GAHJ 2DO7A 4XK4A 3UR3C 4BQNA 4DZJA 3FF5A 1AWCA 3BG6A 4PZJA 1BOAA 3GTPJ 1HKSA 4NC7A 1MJBA 3RPUD 2MH2A 1LB2A 4IOAF 2F48A 3GW2A 1QNTA 3R0AA 5J1RA 2EFOA 1I1GA 3WU0A 4A6EA 1FPQA 5J8FA 3FMQA 5GPAA 2HEOA 3CP8A 2LKSA 4RGRA 3CC7I 3HRUA 2CMPA 2DCEA 1LE8B 4KITB 2IPQX 3IP4B 2CW8A 3DTKA 1R7JA 1E17A 4PJNA 2DYRH 1XSDA 1D1AA 3NAUA 4F92B 3FXKA 1MGTA 4AM3A 3DPTA 2JA7J 1XMXA 4X1EA 3HOWJ 3HIFA 4M71A 3ZQCA 3JRCA 1A36A 5JVGF 1YJNI 4L18B 1KYWA 5DV5A 3B6AA 2R7RA 3A0HC 3ROUA 2XAFA 3E6BA 2D5VA 4A3FJ 1G3SA 1IG7A 3HJEA 1QZZA 2VUMJ 3I5UA 3CJRB 2R7SA 5H6QA 4HDUA 5J4YA 1OCCH 3M07A 3VYUB 3DP7A 1X58A 2DBBA 2V9PA 1JUMA 2VJ4A 3F0CA 1YJ9I 3H3ZA 4L0ZB 4N9HA 4KNYA 1XS9A 4IVNA 4ESBA 1S7EA 1MBGA 3GTOJ 3CCUI 3A4CA 1ZLKA 3JRGA 4BQOA
chains in the Genus database with same CATH topology
4A3JJ 4A69C 1JUPA 2Y31A 4UUTA 3BG3A 3K2AA 5J3LA 1JT6A 3TW7A 5IYDJ 1TWHJ 2B63J 4A3GJ 1SANA 3FISA 4BBRJ 4JX6A 1BW5A 3S17J 4BKXA 1IDZA 3BQZA 3BT9A 2HQ5A 3I4NJ 1ZGWA 5E3LA 3L1PA 2YU9J 9ANTA 2DA1A 2WB1N 1X2MA 4UUSA 5IOZA 3BG9A 2ID6A 1RESA 5IPAA 2FX0A 3IV5A 1K83J 5E3MA 5F27A 2R5YB 1UHSA 1AKHA 3HOYJ 5GPCA 3S1RJ 1WCMJ 4NDLA 4L5EA 3RZDJ 1HOMA 2KT0A 1MSEC 2OF7A 1MBFA 4MFDA 1WGXA 2Y2ZA 2MSYA 5F0CA 2HDDA 5F0FA 1UG2A 1YRNB 1H89C 2EH3A 1XC5A 1FTZA 1P7JA 2JA6J 1A6IA 1IDYA 1JJ6C 2M8GX 1P7IA 3S2HJ 5K7ZA 4XIDA 2XSDC 3MVPA 1GDTA 1R9TJ 3C2BA 3H0GJ 3GTGJ 5FKMA 2R92J 4DYQA 1UMQA 2K9QA 3Q0VA 3IH2A 2KDZA 2JA5J 2Y0SN 1JKPC 4RBOA 3HOUJ 1JUSA 1JTXA 1U9NA 3CDLA 1W0TA 2LVSA 1X2NA 4LOCA 1ETQA 3GTKJ 2XGCA 1NTCA 1FIAA 1IV6A 4IHXA 2G0EA 2LP0A 1RETA 2E1OA 3BR2A 1IGNA 5EZGA 4UUSB 4S0HB 2GM4A 3LNQA 1JTYA 1QPIA 3S1MJ 2JMWA 2XGDA 1FTTA 1H88C 3IH4A 3S2DJ 5EF6A 1AKHB 1F43A 5BNGA 1G2HA 1I3QJ 1U8BA 5K7FA 1WH5A 5EZHA 2WV1A 1GV5A 2X6OA 4XICA 4DYCA 3JRBA 1B8IA 3TEDA 1XG1A 5GP9A 1HCRA 1VFCA 3LSRA 1D5YA 2DA2A 1MBJA 2XB0X 2MGQA 4FE7A 3D1NI 3Q3SA 3ZQFA 3QPSA 4MO7A 3ZQIA 1JKRC 5C4JJ 1WPKA 3HGYA 2QF7A 3I4MJ 1ENHA 1ITYA 1WH7A 4V2GA 2VI6A 1GVDA 5EYRA 4BY7J 5J1YA 1I6HJ 3SJMA 3BR3A 3GBGA 3RQIA 1MBEA 4A3BJ 2R0QC 3M3YJ 2EQRA 4M3EA 1MH3A 2VPRA 4XRMA 1MSFC 3MKLA 1SFOJ 2IBDA 3MN2A 5M3FJ 2E2JJ 4BXXJ 3IH3A 4XRSA 2R93J 3FKIJ 3S14J 3ZQHA 2IEKA 2NVQJ 2GBYA 2CJJA 2M2EA 5M5YJ 3BTLA 1HDDC 4M3BA 3GTQJ 5C4XJ 3DEWA 3JRAA 2CQQA 4XRSG 3O8HA 3PO2J 3HOVJ 5EGOA 2HOTA 2CUEA 4W1UA 2NVXJ 4M3FA 4FISA 4ABZA 2ZB9A 1ZK8A 3G1LA 2W48A 2YUSA 1OJLA 3E7LA 4G12A 2X48A 1ZR2A 1MBHA 1RKWA 4DW6A 1B8IB 2XRLA 2ECCA 5F04A 5DS9A 2EZLA 2P81A 2MG4A 4D5FA 2ME6A 2XGEA 2LTPA 3OOUA 2ECBA 2HYJA 1APLC 1ETVA 3HBLA 2L0KA 4AC0A 2AO9A 2WAQN 5JLXA 3LSJA 1ZTRA 1HDPA 3BTCA 2K9NA 2N8GA 1RR7A 5M5XJ 1F36A 3FK6A 4RDUA 2DMNA 2ME0A 1MNMC 3B6CA 1BJZA 3HOXJ 2DTZA 2YS9A 2DA5A 2FD5A 1BW6A 1JKOC 4AUXA 2DMTA 1ETOA 2K40A 1NK2P 1IRZA 1OCTC 1B72A 4A93J 1ETWA 3ZQGA 4EEFG 2EZIA 4X6AJ 2ID3A 3G1OA 4W97A 1FJLA 3QQAA 4B1RA 1H8AC 2NVYJ 5EGOB 3BR0A 1ZR4A 3LOCA 5J1UA 2XPVA 4JX5A 4V2FA 1Q1VA 1ZQ3P 3O8GA 2H1KA 3ZQLA 2DMQA 1FEXA 5EG0A 4IHWA 1HLVA 2I10A 1Z0XA 5M3MJ 1GUUA 2FQ4A 2HOAA 2XPWA 5FJ8J 2K9SA 1QVTA 4CYCA 3CMYA 3M4OJ 5FKOA 2EBIA 1Y1VJ 3PM1A 1FIPA 3GTLJ 3GTMJ 2JWTA 1K61A 4D7NA 2JK3A 5FKLA 3FK7A 5F08A 4B4CA 1U9OA 2Y30A 4A3KJ 2LR8A 3BR5A 2LLKA 4A3CJ 4MIMA 3G1MA 2GLOA 5M5WJ 3H3VK 1I50J 4JX4A 2LY9A 1RKTA 1MH4A 5C3EJ 1B72B 2HOSA 2O9LA 5EDNA 5IP6A 2DA4A 2L7FP 2LD5A 4D5CA 3A01A 2QCOA 2CQXA 1BL0A 1LFBA 3FIWA 2TRTA 2MW8A 3TW6A 5IP7J 3RZOJ 4Y52J 2R7ZJ 5HODA 2Y9ZA 2TCTA 2X9DA 1LFUP 2DA7A 3A02A 4FTHA 1JT0A 1O4XA 2NS8A 4C2MJ 4A3LJ 4BY1J 1E3OC 2E2IJ 1BA5A 1TWFJ 5EG0B 1AU7A 3S16J 5E3NA 5E3OA 1DU0A 4AYBN 4M3DA 1TWCJ 3HM5A 2VKVA 4IHVA 1GT0C 2ELKA 3HOZJ 4JP0A 5EEAA 4CYCB 1DU6A 3BTJA 3TP0A 4HNVA 1TWAJ 3TP3A 4JYKA 2JJ7A 4IEJA 5IYBJ 2CRGA 2M0CA 3JRHA 4B3AA 2JA8J 3Q0WA 1VNDA 4IHYA 2FJ1A 1ETKA 3HGGA 2RAEA 3RKQA 1Z77A 3BR1A 3S1QJ 4C3HJ 1T33A 2NS7A 1PUFA 3OSFA 3NARA 1POGA 1OCPA 5F1JA 5IP9J 1QRYA 2O7OA 3JRDA 1VF9A 3GTJJ 2DA3A 2E2HJ 1JKQC 1Y1WJ 5K7HA 5F0HA 1VI0A 5C44J 4BBSJ 1LE8A 2XPUA 3A01B 3SDGA 3HB9A 2R5ZA 3CCYA 2H8RA 3SFIA 3K7AJ 4DYRA 2NOGA 3BR6A 2EZKA 5IYCJ 1U78A 3JREA 3DCFA 4D7MA 2HI3A 3QPLA 3VPRA 4I76A 4QIWN 3UKGA 1GV2A 1MBKA 2HXOA 4M6VA 4A3IJ 2AHQA 5IOYA 2CU7A 1WI3A 2COBA 5FLMJ 2HXIA 4MFEA 1CQTA 4A3MJ 4Y7NJ 1ETXA 2NVTJ 2L7MP 3JR9A 4XK4A 4DZJA 3WHCA 4A3EJ 2E19A 3WHBA 3GTPJ 2M9HA 2Y9YA 1TC3C 5J1RA 1PUFB 3LSGA 1IJWC 2VKEA 4I6ZA 3BTIA 1IC8A 5GPAA 2L7ZA 5DTDA 2M34A 2LKXA 4FCYA 3HDDA 2PMZN 4M3GA 3PO3J 1LE8B 4QSHA 4GFBA 2L9RA 3ZOBA 4J19A 2R5ZB 1TWGJ 3JRFA 1AHDP 1ZKGA 2DMPA 2EZHA 1T56A 2O8KA 5JLWA 2DJNA 1ORKA 3NAUA 3BG5A 3W6VA 1NK3P 2DA6A 2LFBA 3Q0UA 2JA7J 3BQYA 4X1EA 3HOWJ 1W0UA 4A3DJ 1JJ8C 3ZQCA 3JRCA 1EF4A 1RPWA 1IUFA 2R5YA 5FLVA 3JRIA 5FKKA 4QTRA 3OSGA 3B6AA 1JGGA 1A5JA 3A03A 4FE4A 4C3JJ 3OIOA 2D5VA 4A3FJ 1IG7A 2DMUA 3S15J 1QVUA 2VUMJ 2XB5A 4DZPA 2LK2A 2DN0A 1OFCX 3LSPA 1YRNA 1X58A 3HEFA 4MLOA 3F0CA 1JUMA 3CQZJ 1ETYA 1HF0A 3HKZN 2CUFA 2JN6A 1XS9A 4C3IJ 2IAIA 1S7EA 1MBGA 3GTOJ 2OPTA 5FKNA 3JRGA 3S1NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J J;  4A69 C;  1JUP A;  2Y31 A;  4UUT A;  3BG3 A;  3K2A A;  5J3L A;  1JT6 A;  3TW7 A;  5IYD J;  1TWH J;  2B63 J;  4A3G J;  1SAN A;  3FIS A;  4BBR J;  4JX6 A;  1BW5 A;  3S17 J;  4BKX A;  1IDZ A;  3BQZ A;  3BT9 A;  2HQ5 A;  3I4N J;  1ZGW A;  5E3L A;  3L1P A;  2YU9 J;  9ANT A;  2DA1 A;  2WB1 N;  1X2M A;  4UUS A;  5IOZ A;  3BG9 A;  2ID6 A;  1RES A;  5IPA A;  2FX0 A;  3IV5 A;  1K83 J;  5E3M A;  5F27 A;  2R5Y B;  1UHS A;  1AKH A;  3HOY J;  5GPC A;  3S1R J;  1WCM J;  4NDL A;  4L5E A;  3RZD J;  1HOM A;  2KT0 A;  1MSE C;  2OF7 A;  1MBF A;  4MFD A;  1WGX A;  2Y2Z A;  2MSY A;  5F0C A;  2HDD A;  5F0F A;  1UG2 A;  1YRN B;  1H89 C;  2EH3 A;  1XC5 A;  1FTZ A;  1P7J A;  2JA6 J;  1A6I A;  1IDY A;  1JJ6 C;  2M8G X;  1P7I A;  3S2H J;  5K7Z A;  4XID A;  2XSD C;  3MVP A;  1GDT A;  1R9T J;  3C2B A;  3H0G J;  3GTG J;  5FKM A;  2R92 J;  4DYQ A;  1UMQ A;  2K9Q A;  3Q0V A;  3IH2 A;  2KDZ A;  2JA5 J;  2Y0S N;  1JKP C;  4RBO A;  3HOU J;  1JUS A;  1JTX A;  1U9N A;  3CDL A;  1W0T A;  2LVS A;  1X2N A;  4LOC A;  1ETQ A;  3GTK J;  2XGC A;  1NTC A;  1FIA A;  1IV6 A;  4IHX A;  2G0E A;  2LP0 A;  1RET A;  2E1O A;  3BR2 A;  1IGN A;  5EZG A;  4UUS B;  4S0H B;  2GM4 A;  3LNQ A;  1JTY A;  1QPI A;  3S1M J;  2JMW A;  2XGD A;  1FTT A;  1H88 C;  3IH4 A;  3S2D J;  5EF6 A;  1AKH B;  1F43 A;  5BNG A;  1G2H A;  1I3Q J;  1U8B A;  5K7F A;  1WH5 A;  5EZH A;  2WV1 A;  1GV5 A;  2X6O A;  4XIC A;  4DYC A;  3JRB A;  1B8I A;  3TED A;  1XG1 A;  5GP9 A;  1HCR A;  1VFC A;  3LSR A;  1D5Y A;  2DA2 A;  1MBJ A;  2XB0 X;  2MGQ A;  4FE7 A;  3D1N I;  3Q3S A;  3ZQF A;  3QPS A;  4MO7 A;  3ZQI A;  1JKR C;  5C4J J;  1WPK A;  3HGY A;  2QF7 A;  3I4M J;  1ENH A;  1ITY A;  1WH7 A;  4V2G A;  2VI6 A;  1GVD A;  5EYR A;  4BY7 J;  5J1Y A;  1I6H J;  3SJM A;  3BR3 A;  3GBG A;  3RQI A;  1MBE A;  4A3B J;  2R0Q C;  3M3Y J;  2EQR A;  4M3E A;  1MH3 A;  2VPR A;  4XRM A;  1MSF C;  3MKL A;  1SFO J;  2IBD A;  3MN2 A;  5M3F J;  2E2J J;  4BXX J;  3IH3 A;  4XRS A;  2R93 J;  3FKI J;  3S14 J;  3ZQH A;  2IEK A;  2NVQ J;  2GBY A;  2CJJ A;  2M2E A;  5M5Y J;  3BTL A;  1HDD C;  4M3B A;  3GTQ J;  5C4X J;  3DEW A;  3JRA A;  2CQQ A;  4XRS G;  3O8H A;  3PO2 J;  3HOV J;  5EGO A;  2HOT A;  2CUE A;  4W1U A;  2NVX J;  4M3F A;  4FIS A;  4ABZ A;  2ZB9 A;  1ZK8 A;  3G1L A;  2W48 A;  2YUS A;  1OJL A;  3E7L A;  4G12 A;  2X48 A;  1ZR2 A;  1MBH A;  1RKW A;  4DW6 A;  1B8I B;  2XRL A;  2ECC A;  5F04 A;  5DS9 A;  2EZL A;  2P81 A;  2MG4 A;  4D5F A;  2ME6 A;  2XGE A;  2LTP A;  3OOU A;  2ECB A;  2HYJ A;  1APL C;  1ETV A;  3HBL A;  2L0K A;  4AC0 A;  2AO9 A;  2WAQ N;  5JLX A;  3LSJ A;  1ZTR A;  1HDP A;  3BTC A;  2K9N A;  2N8G A;  1RR7 A;  5M5X J;  1F36 A;  3FK6 A;  4RDU A;  2DMN A;  2ME0 A;  1MNM C;  3B6C A;  1BJZ A;  3HOX J;  2DTZ A;  2YS9 A;  2DA5 A;  2FD5 A;  1BW6 A;  1JKO C;  4AUX A;  2DMT A;  1ETO A;  2K40 A;  1NK2 P;  1IRZ A;  1OCT C;  1B72 A;  4A93 J;  1ETW A;  3ZQG A;  4EEF G;  2EZI A;  4X6A J;  2ID3 A;  3G1O A;  4W97 A;  1FJL A;  3QQA A;  4B1R A;  1H8A C;  2NVY J;  5EGO B;  3BR0 A;  1ZR4 A;  3LOC A;  5J1U A;  2XPV A;  4JX5 A;  4V2F A;  1Q1V A;  1ZQ3 P;  3O8G A;  2H1K A;  3ZQL A;  2DMQ A;  1FEX A;  5EG0 A;  4IHW A;  1HLV A;  2I10 A;  1Z0X A;  5M3M J;  1GUU A;  2FQ4 A;  2HOA A;  2XPW A;  5FJ8 J;  2K9S A;  1QVT A;  4CYC A;  3CMY A;  3M4O J;  5FKO A;  2EBI A;  1Y1V J;  3PM1 A;  1FIP A;  3GTL J;  3GTM J;  2JWT A;  1K61 A;  4D7N A;  2JK3 A;  5FKL A;  3FK7 A;  5F08 A;  4B4C A;  1U9O A;  2Y30 A;  4A3K J;  2LR8 A;  3BR5 A;  2LLK A;  4A3C J;  4MIM A;  3G1M A;  2GLO A;  5M5W J;  3H3V K;  1I50 J;  4JX4 A;  2LY9 A;  1RKT A;  1MH4 A;  5C3E J;  1B72 B;  2HOS A;  2O9L A;  5EDN A;  5IP6 A;  2DA4 A;  2L7F P;  2LD5 A;  4D5C A;  3A01 A;  2QCO A;  2CQX A;  1BL0 A;  1LFB A;  3FIW A;  2TRT A;  2MW8 A;  3TW6 A;  5IP7 J;  3RZO J;  4Y52 J;  2R7Z J;  5HOD A;  2Y9Z A;  2TCT A;  2X9D A;  1LFU P;  2DA7 A;  3A02 A;  4FTH A;  1JT0 A;  1O4X A;  2NS8 A;  4C2M J;  4A3L J;  4BY1 J;  1E3O C;  2E2I J;  1BA5 A;  1TWF J;  5EG0 B;  1AU7 A;  3S16 J;  5E3N A;  5E3O A;  1DU0 A;  4AYB N;  4M3D A;  1TWC J;  3HM5 A;  2VKV A;  4IHV A;  1GT0 C;  2ELK A;  3HOZ J;  4JP0 A;  5EEA A;  4CYC B;  1DU6 A;  3BTJ A;  3TP0 A;  4HNV A;  1TWA J;  3TP3 A;  4JYK A;  2JJ7 A;  4IEJ A;  5IYB J;  2CRG A;  2M0C A;  3JRH A;  4B3A A;  2JA8 J;  3Q0W A;  1VND A;  4IHY A;  2FJ1 A;  1ETK A;  3HGG A;  2RAE A;  3RKQ A;  1Z77 A;  3BR1 A;  3S1Q J;  4C3H J;  1T33 A;  2NS7 A;  1PUF A;  3OSF A;  3NAR A;  1POG A;  1OCP A;  5F1J A;  5IP9 J;  1QRY A;  2O7O A;  3JRD A;  1VF9 A;  3GTJ J;  2DA3 A;  2E2H J;  1JKQ C;  1Y1W J;  5K7H A;  5F0H A;  1VI0 A;  5C44 J;  4BBS J;  1LE8 A;  2XPU A;  3A01 B;  3SDG A;  3HB9 A;  2R5Z A;  3CCY A;  2H8R A;  3SFI A;  3K7A J;  4DYR A;  2NOG A;  3BR6 A;  2EZK A;  5IYC J;  1U78 A;  3JRE A;  3DCF A;  4D7M A;  2HI3 A;  3QPL A;  3VPR A;  4I76 A;  4QIW N;  3UKG A;  1GV2 A;  1MBK A;  2HXO A;  4M6V A;  4A3I J;  2AHQ A;  5IOY A;  2CU7 A;  1WI3 A;  2COB A;  5FLM J;  2HXI A;  4MFE A;  1CQT A;  4A3M J;  4Y7N J;  1ETX A;  2NVT J;  2L7M P;  3JR9 A;  4XK4 A;  4DZJ A;  3WHC A;  4A3E J;  2E19 A;  3WHB A;  3GTP J;  2M9H A;  2Y9Y A;  1TC3 C;  5J1R A;  1PUF B;  3LSG A;  1IJW C;  2VKE A;  4I6Z A;  3BTI A;  1IC8 A;  5GPA A;  2L7Z A;  5DTD A;  2M34 A;  2LKX A;  4FCY A;  3HDD A;  2PMZ N;  4M3G A;  3PO3 J;  1LE8 B;  4QSH A;  4GFB A;  2L9R A;  3ZOB A;  4J19 A;  2R5Z B;  1TWG J;  3JRF A;  1AHD P;  1ZKG A;  2DMP A;  2EZH A;  1T56 A;  2O8K A;  5JLW A;  2DJN A;  1ORK A;  3NAU A;  3BG5 A;  3W6V A;  1NK3 P;  2DA6 A;  2LFB A;  3Q0U A;  2JA7 J;  3BQY A;  4X1E A;  3HOW J;  1W0U A;  4A3D J;  1JJ8 C;  3ZQC A;  3JRC A;  1EF4 A;  1RPW A;  1IUF A;  2R5Y A;  5FLV A;  3JRI A;  5FKK A;  4QTR A;  3OSG A;  3B6A A;  1JGG A;  1A5J A;  3A03 A;  4FE4 A;  4C3J J;  3OIO A;  2D5V A;  4A3F J;  1IG7 A;  2DMU A;  3S15 J;  1QVU A;  2VUM J;  2XB5 A;  4DZP A;  2LK2 A;  2DN0 A;  1OFC X;  3LSP A;  1YRN A;  1X58 A;  3HEF A;  4MLO A;  3F0C A;  1JUM A;  3CQZ J;  1ETY A;  1HF0 A;  3HKZ N;  2CUF A;  2JN6 A;  1XS9 A;  4C3I J;  2IAI A;  1S7E A;  1MBG A;  3GTO J;  2OPT A;  5FKN A;  3JRG A;  3S1N J; 
#chains in the Genus database with same CATH topology
 4YIF A;  1XSV A;  2W25 A;  3HPG A;  1YIJ I;  2FSW A;  1WJB A;  3FHZ A;  3TDZ C;  4A69 C;  5FLX K;  5HS8 A;  1QQI A;  2PJP A;  4XSZ F;  2CO5 A;  1JT6 A;  1CGP A;  2E35 A;  1X3Z B;  2B63 J;  4A3G J;  4D9J A;  4BBR J;  3ABL H;  1BW5 A;  2PJR A;  3F23 A;  4BKX A;  2K9L A;  2FML A;  2HQ5 A;  4IJA A;  4ZDP A;  3CLQ A;  2DTR A;  1TTY A;  3C2H A;  3I4N J;  4IOC F;  2ETH A;  1T0F C;  3MAJ A;  4Y4R A;  2FOW A;  1QZY A;  2OV7 A;  3LWF A;  3BG9 A;  4S05 A;  2RN7 A;  3GEZ A;  1FWZ A;  2A5W A;  3E1S A;  3IV5 A;  1BR4 A;  2FX0 A;  3L7W A;  2EA2 A;  2HGC A;  2IW5 A;  5ILV A;  5E3M A;  2UXN A;  4N9I A;  2LKP A;  4LK1 F;  4E70 A;  1J7K A;  2MA3 A;  3SEQ A;  1G59 A;  3OIQ A;  1JXS A;  1DP3 A;  4GCV A;  1J2X A;  2OF7 A;  1IN7 A;  2Y2Z A;  2CYY A;  1X3W B;  5F0C A;  3W2V A;  2VKD A;  2FF4 A;  3J7Y J;  1UG2 A;  1YRN B;  1XC5 A;  1FTZ A;  2LH9 A;  3FMR A;  2JA6 J;  3LAP A;  1Z91 A;  3V7R A;  2K9M A;  2GZW A;  4CYD A;  3S2H J;  4XID A;  2M0M A;  2XDV A;  2QSF X;  3MVP A;  2UWM A;  4YFK F;  2XIG A;  3VYT B;  3S3M A;  2R7O A;  3GTG J;  2RDP A;  4DJA A;  2ZSI B;  2K9Q A;  1F9N A;  2MH9 A;  3RYP A;  3G6E I;  2OAZ A;  3ERM A;  1JKP C;  3OMY A;  5L3C A;  1JTX A;  1W0T A;  1X2N A;  2ESH A;  1ETQ A;  1IRX A;  1FIA A;  2ELH A;  1VZ0 A;  1DDN A;  5ICE A;  2G7H A;  1N77 A;  4S0H B;  3OS2 A;  3S1M J;  1JHH A;  2JMW A;  3ZXS A;  1H88 C;  3SHF A;  3S2D J;  2VJ5 A;  3BPX A;  1G2H A;  3P5J A;  2DJI A;  4RAY A;  1WH5 A;  1UAA A;  1WWX A;  4X0G A;  1H9T A;  5EZH A;  3KEY A;  2WV1 A;  3QOP A;  2DOA A;  2X6O A;  3TO6 A;  2VL8 A;  3V8K A;  2KZV A;  3WGG A;  1Z6T A;  2X1D A;  1HCR A;  4AD9 A;  1MND A;  4GRI A;  1PP7 U;  2H1L A;  2NS0 A;  4RLF A;  4ITV A;  2XB0 X;  3OYG A;  5HNH A;  2MGQ A;  1USS A;  1W4M A;  3D1N I;  3H9J A;  2EIM H;  3Q3S A;  3QPS A;  3O6B B;  3OL3 A;  4MO7 A;  1ONV A;  2KJC A;  3BG7 A;  1H0M A;  3JAM Z;  1X19 A;  4IXA A;  2VON A;  3BDD A;  2WB1 A;  3DLL F;  4BNC A;  1ITY A;  1SVM A;  3K9T A;  4RGU A;  5J1Y A;  1I6H J;  3F6V A;  3GBG A;  1IUY A;  5ICG A;  3AKZ A;  1MBE A;  4A3B J;  2R0Q C;  4E7K A;  5GTI C;  1W1W E;  4M3E A;  2OZ6 A;  2V6C A;  4XRM A;  4NQW A;  1MSF C;  1ON2 A;  2DFE A;  2IBD A;  4ZYD A;  3KIO A;  3BPV A;  2ADU A;  2ZFW A;  3NQO A;  2OUM A;  2QGU A;  1A04 A;  4ZC3 A;  3E3V A;  3ZQH A;  1X1A A;  2GBY A;  1U6G A;  3JCU C;  3BTL A;  1HDD C;  4E4H A;  2WY8 Q;  4HNU A;  3T8R A;  3GTQ J;  1V54 H;  3TBI A;  2BZT A;  4XRS G;  4U0V A;  1WSU A;  4CSW A;  5EGO A;  4R1H A;  2NVX J;  3ZR8 X;  1XGN A;  2XC7 A;  2VJI A;  2E5N A;  4HZF A;  4PGG A;  4ABZ A;  2ZB9 A;  3BOQ A;  2DDB A;  1OMI A;  4OU0 A;  4KN4 X;  1LNW A;  1O3Q A;  4CCN A;  4DW6 A;  4ZDL A;  3KLO A;  1ZG3 A;  4RB2 C;  3J7A Y;  1Z05 A;  3WTS C;  2Y0S A;  4CCM A;  3CUQ C;  2JRT A;  1X4O A;  2FE3 A;  2Z99 A;  2EZL A;  1Z7U A;  2XF5 A;  3DKX A;  2MG4 A;  3PNV A;  1VQP I;  3IRR A;  1EKE A;  2HYJ A;  1G6N A;  4Z2Y A;  4L9J A;  4L0Y B;  3CUQ A;  3F8C A;  3T8T A;  4RB3 C;  1FBQ A;  1ZTR A;  3BTC A;  2K9N A;  2ZBK A;  1XSX A;  4CIC A;  4G94 A;  1MDM A;  5M5X J;  2EIJ H;  4CCO A;  4IZZ A;  1W7P B;  3IRQ A;  2FUG 2;  3TOA A;  3ZMZ A;  2DA5 A;  2FD5 A;  3GUD A;  2EB7 A;  1JKO C;  4AUX A;  3M8E A;  3P9K A;  1ZEL A;  1YO5 C;  2NNN A;  3IAM 2;  2MD5 A;  2K40 A;  3KP7 A;  1IRZ A;  4CO8 A;  3VOE A;  3CMA I;  1K79 A;  4A93 J;  1B72 A;  2R3S A;  1FP1 D;  4BEH B;  3F21 A;  1C0W A;  1W5C C;  4BQA A;  1R1U A;  2ID3 A;  3G1O A;  5E18 F;  3V7S A;  4BJ6 C;  1RUO A;  4E7Z A;  1EH8 A;  1YOV B;  4L9V A;  1ZR4 A;  2KKO A;  1X4P A;  2XPV A;  4V2F A;  2BY1 A;  1ZQ3 P;  2P5V A;  3O8G A;  4XKC A;  4CZZ A;  3A1Y A;  1ZYR F;  3WOD F;  2EWN A;  3KZI C;  4EGY A;  5KHD A;  1HLV A;  1UEL B;  1RZ4 A;  4YFX F;  2FQ4 A;  2A6E F;  4S04 A;  1DGR M;  1QVT A;  3CMY A;  1J9I A;  1MMA A;  1LJ9 A;  2P5K A;  3CJN A;  3GXO A;  3ZP5 A;  2JWT A;  2ZC2 A;  3QYE A;  1XDU A;  5JFR A;  1FX7 A;  4RGS A;  2VQG A;  2Y30 A;  1V3F A;  1KU7 A;  3SXY A;  2LR8 A;  5DUK A;  3BZC A;  1YW8 A;  2A3S A;  2QZ8 A;  5K5O A;  1XPX A;  3GZN B;  3PIO F;  2IA0 A;  4A3C J;  3I55 I;  5LD2 C;  5H20 A;  1XGS A;  2E36 A;  4LIV A;  3OYJ A;  1TQI A;  5HS7 A;  4WF2 A;  1MH4 A;  5K1Y A;  3OYE A;  2YSR A;  2O9L A;  3PUF A;  2F5C A;  2IGO A;  3M1C A;  1L3L A;  2NRA C;  1GVJ A;  2X6W A;  2HU9 A;  2DA4 A;  3CJT B;  2L7F P;  2LD5 A;  2ZNY A;  3VEP A;  2BE5 F;  5CVV A;  2W84 A;  4A5M A;  3L2U A;  2GXA A;  4D1Q A;  1W7P D;  2TRT A;  5IP7 J;  4IHT A;  4Y52 J;  4U0Y A;  1P4W A;  1KU2 A;  2BVM A;  1TT0 A;  3HOT A;  2PN6 A;  2E2I J;  1TWF J;  5EG0 B;  3MKW B;  3K1P A;  4F52 A;  4G7O F;  1TT5 B;  2LDU A;  4IO9 F;  4M6Y A;  1FMW A;  2KHM A;  2GXG A;  1NH3 A;  2A5Y B;  4CCJ A;  1JGS A;  1TWC J;  3X2Q H;  2NAZ A;  2VKV A;  3VFZ A;  2HZD A;  4U7D A;  2ELK A;  3K4M A;  5EEA A;  2F6C A;  4HNV A;  2LRD A;  3TP3 A;  3DV8 A;  4Q4Z F;  5D5W B;  2OTJ I;  3ZGK A;  4OIR F;  1N78 A;  4JK1 X;  4HBL A;  4B3A A;  4LIU A;  3JRH A;  2JA8 J;  3T5X A;  1UST A;  1VND A;  4ENJ A;  3CJQ B;  4IHY A;  2LOO A;  2VN2 A;  3DPU A;  3BR1 A;  3F8F A;  3M9A A;  2B0L A;  1T33 A;  2NS7 A;  3H5R A;  4KT6 A;  4R79 A;  4BXF A;  1SFU A;  4F55 A;  1BC7 C;  2VXZ A;  3ASO H;  1A31 A;  3D5S C;  4J00 A;  1JKQ C;  4UVB A;  4E7L A;  1VI0 A;  2Z3Y A;  4ON0 A;  1LE8 A;  4LGW A;  1VQK I;  2V6E A;  1QA6 A;  1LEA A;  2K4B A;  3ML6 A;  2Z9O A;  4YG2 F;  3PIP F;  3N4M A;  2H27 A;  2DT7 B;  2MC4 A;  2PEX A;  3TDU C;  2EV5 A;  1RNL A;  2NOG A;  3WU2 C;  2IS6 A;  3OYL A;  5IYC J;  1ZRF A;  3CC2 I;  2XRN A;  2FNP A;  5LGT A;  3I58 A;  5JI6 A;  1T95 A;  2VLA A;  1SMT A;  3ECH A;  4EMS A;  5IT3 A;  2PMZ A;  2DOD A;  2EFP A;  1I1S A;  3VPR A;  3ABM H;  4HOB A;  2W57 A;  1GV2 A;  1MBK A;  4NBQ A;  4M6V A;  4ENK A;  2PX9 A;  3ABU A;  4A3I J;  5IOY A;  4IKF A;  1SVL A;  4IPA A;  2HXI A;  1HW5 A;  2NVT J;  1B9N A;  3PFI A;  3OYF A;  4MNU A;  2XUB A;  1ZN2 A;  1K78 B;  3QP5 A;  2E19 A;  4DNC A;  2R4G A;  2L7K A;  5F6F A;  2MAB A;  2W1O A;  2XF6 A;  2M9H A;  2HQA A;  4JBA A;  4XBF A;  3OYA A;  2IS2 A;  4BE0 A;  4P9U A;  3CCL I;  1TC3 C;  5BPI A;  5GAD J;  5HDK A;  2L02 A;  1IJW C;  2VKE A;  3FXM A;  2HQN A;  4I6Z A;  1IAW A;  3EET A;  3CCM I;  3BTI A;  1WI9 A;  2M34 A;  1VQ6 I;  3DTE A;  2J5P A;  4IRG A;  1LDJ A;  3QP6 A;  4QPQ A;  3WE3 A;  3HDD A;  5KAF C;  1LFP A;  2PMZ N;  2KRH A;  1OYI A;  3MWM A;  4GFB A;  3FXR A;  3IC7 A;  1AHD P;  4EJO A;  2EZH A;  4XON A;  5CQG A;  5D5U B;  4IHS A;  5HDN A;  3DF8 A;  5HVQ C;  2O8K A;  5JLW A;  2DJN A;  1FMV A;  1SD5 A;  3LST A;  2LG4 A;  2NNY A;  3ABK H;  3SQN A;  4AIJ A;  4HEA 2;  2V1D A;  2LFB A;  2F5D A;  2LF7 A;  3BQY A;  3OYM A;  3TO7 A;  3DKW A;  1RPW A;  5EEG A;  3FM5 A;  5CKT A;  5FLV A;  3RQ4 A;  1JGG A;  3QWL A;  4FE4 A;  3SEZ A;  2DFI A;  3EDP A;  2KIF A;  4M9Z A;  4XLF A;  3W6J B;  4Z6Y A;  3FXQ A;  5E8G A;  2M87 A;  2L4A A;  3P9C A;  2LK2 A;  3UNG C;  3MMY B;  4DQ2 A;  1BJA A;  2Y0M A;  1YRN A;  2I5U A;  2OTL I;  1W5S A;  2QYO A;  2RQP A;  4MLO A;  3W3C A;  3CQZ J;  3EUH C;  4PK4 A;  5DDG A;  3PNY A;  1HF0 A;  3HKZ N;  3KE2 A;  4XLA A;  1XMK A;  3IL2 A;  3I0T A;  1WRJ A;  4UV8 A;  4NUB A;  1KQ8 A;  5FKN A;  2QWW A;  2GIZ A;  1IV8 A;  3WTZ A;  3OYK A;  4G6T B;  3CP2 A;  2HPM A;  1S3J A;  1LKX A;  2OQR A;  4IF4 A;  2OZU A;  2HVQ A;  3K2A A;  2JVG A;  5J3L A;  3P7N A;  4B47 A;  5IYD J;  3TW7 A;  1D5V A;  3AL0 B;  3FIS A;  1V5F A;  4JX6 A;  3BQZ A;  4XLH A;  3ESW B;  2DFF A;  3E5U A;  1Z6R A;  1BI2 A;  1AA7 A;  2E7X A;  2EFN A;  5D4S A;  5E3L A;  3L1P A;  3KYL A;  2DA1 A;  1LDD A;  1T8I A;  3OOP A;  5IOZ A;  3FXO A;  4BAC A;  5H2F C;  2NYX A;  5HLG A;  2ID6 A;  1VQM I;  3BRO A;  3GWZ A;  5B3S H;  4KYW A;  2MLK A;  1Z9C A;  2Y69 H;  4E7S A;  1HBX G;  3RZD J;  3KYC B;  1QHG A;  2CV1 A;  2KT0 A;  1MSE C;  3AG1 H;  4MFD A;  4M9X A;  2ELJ A;  4FHT A;  4MEY F;  1Z3Y A;  2ZKZ A;  5F0F A;  2Q8K A;  1YE9 A;  4KMF A;  2R7F A;  3CD6 I;  5TRD A;  1KQ9 A;  2QEN A;  1LUJ B;  4FAS D;  4LJZ F;  3U9G A;  5CYV A;  2M8G X;  1F1Z A;  2P5L C;  5K7Z A;  1G3T A;  1R9T J;  2VOD A;  4LG0 B;  2BGC A;  1O3S A;  1V5G A;  2K02 A;  2JRM A;  4DYQ A;  2QKM B;  3PQK A;  4EM1 A;  2IS1 A;  2EK5 A;  3NRV A;  3U1D A;  3IH2 A;  1FT9 A;  2BY3 A;  3SYT A;  2KDZ A;  3HUG A;  1PVE A;  3DBL B;  3BZK A;  3F22 A;  3HHH A;  3CDL A;  5FD5 A;  4LOC A;  1IXS B;  3HSF A;  4CGZ A;  3TGN A;  4HYE A;  2XGC A;  1TQP A;  5CJ9 A;  3GTK J;  2BVL A;  5L3F A;  4Q5S F;  3PL8 A;  2DT6 A;  2EJR A;  4BQQ A;  2CQ7 A;  3FBI B;  4FX0 A;  1Y8R B;  2IGM A;  1Z1D A;  3CO6 C;  4C30 A;  1QPI A;  1JI8 A;  1SMY F;  4I0B A;  1FTT A;  5A2Q Z;  3GFL A;  3IH4 A;  1F43 A;  1AKH B;  3J80 Z;  2L01 A;  4P55 A;  4HRI A;  1YLF A;  2E1M B;  5K7F A;  2L3D A;  1U8B A;  5J8C A;  4U7B A;  4AIK A;  1S7O A;  2HVS A;  1GV5 A;  3Q9S A;  2JSC A;  1UFM A;  3JSO A;  1N25 A;  5ICF A;  4XOT A;  4EGZ A;  1PYV A;  2FQ3 A;  4UB8 C;  3GZ6 A;  2VC1 A;  2FBH A;  1FSH A;  4RA2 A;  1BR2 A;  2R7D A;  4P96 A;  3ZQI A;  1JKR C;  3JAM K;  4OOI A;  2OJE D;  1WPK A;  3HGY A;  2QF7 A;  3I4M J;  1ENH A;  3CCE I;  4V2G A;  2VI6 A;  2BW3 B;  4G9Y A;  3NWS A;  2MBF A;  4BYY A;  2PMU A;  2KLO A;  6PAX A;  3DBH B;  4GGG A;  5B66 C;  1W7P A;  3FM3 A;  4LB5 A;  1EH7 A;  4WXC A;  3M3Y J;  1Y39 A;  3JW4 A;  3BZ6 A;  3MKL A;  1P6R A;  2DK8 A;  1R23 A;  5E1W A;  2ISZ A;  3ULQ B;  2ZJ2 A;  2R93 J;  2V79 A;  3QRF F;  3FKI J;  3S14 J;  1XGO A;  1U0J A;  4BEH A;  5J6X A;  3CLO A;  4RM2 A;  2IEK A;  5E79 C;  5C4X J;  1RR8 C;  1Y0U A;  1YG2 A;  3VB2 A;  2CQQ A;  5DCM B;  5LHH A;  2F5F A;  1ODD A;  1TW2 A;  4H4K C;  1E2X A;  3PO2 J;  3HOV J;  2HOT A;  1R1T A;  2E5Z A;  3WG9 A;  1FYM A;  4M3F A;  4FIS A;  4KN7 X;  2OU2 A;  4I7H A;  5ICC A;  3K0L A;  1OJL A;  3Q9V A;  4ZYE A;  4HST A;  3E7L A;  4G12 A;  1G3W A;  2IJL A;  2X48 A;  4LK0 F;  4HLY A;  2XAJ A;  1WFX A;  1OLT A;  1QZE A;  1UB9 A;  2XRL A;  1ULY A;  1B8I B;  4UUV A;  1MIJ A;  3K2Z A;  2OCC H;  1T0F A;  1WQ2 A;  5DCF A;  5D5X B;  5F1R A;  2P81 A;  3V42 A;  1TW3 A;  1Y6I A;  3R6S A;  2W4S A;  3CTA A;  1ZLJ A;  1ZG1 A;  2ME6 A;  5KCM A;  3OOU A;  2ECB A;  1APL C;  3HBL A;  3OYH A;  1FNN A;  2L0K A;  2WAQ N;  2AQE A;  4XSX F;  2VKH A;  2FMY A;  1PJR A;  1RR7 A;  2N8G A;  3OYI A;  4XM3 A;  3GVA A;  3GFI A;  4RDU A;  2DMN A;  2P6S A;  2QVO A;  2MFZ A;  3B6C A;  1BJZ A;  3G73 A;  3S3N A;  3LA3 A;  2R7V A;  1PP8 F;  1Y0N A;  4UY8 I;  1TP4 A;  3C18 A;  2AXT C;  2Z2S B;  3KEO A;  5BPD A;  1ETO A;  1OCT C;  1ETW A;  3ZQG A;  2EZI A;  2ZME B;  1FSE A;  3I64 A;  1FJL A;  2HTJ A;  3QQA A;  1MMN A;  1DPR A;  3FDY A;  3HXL A;  1FYL A;  4PDK A;  4N4N B;  3ZN0 A;  4KFC A;  5J1U A;  1MW7 A;  2KZG A;  3H5A A;  1MMS A;  2W24 A;  2X85 A;  5EJC A;  1F4K A;  1FEX A;  2DMQ A;  5EG0 A;  1WJD A;  3V8L A;  3EPZ A;  2FXA A;  2HKO A;  4RS8 A;  3MEX A;  3ZRG A;  4C9Y A;  4Y3O A;  3HRT A;  1FOY A;  2I10 A;  2HTS A;  3CF2 A;  2HOA A;  2KIQ A;  4DGW B;  4E7J A;  2X4H A;  2VQC A;  2XPW A;  5FJ8 J;  2OBP A;  4WX9 A;  1XGM A;  5FKO A;  4ZJZ A;  2DYS H;  2BXY A;  1Y1V J;  2HPI A;  3DWL E;  3GFJ A;  2K3F A;  3PM1 A;  2EA4 A;  4I98 B;  3GTM J;  2V1U A;  1KON A;  1ACI A;  3H9Q A;  1R5G A;  3H92 A;  2X1E A;  3KLN A;  1D1C A;  1R71 A;  1ZRE A;  3QPT A;  4EJT A;  4HV6 A;  3EYY A;  4OWR B;  4EJW A;  3CC4 I;  1KQ0 A;  1YHQ I;  4KJZ A;  3AG4 H;  1K6Y A;  2FBI A;  2WAE A;  2JQ7 A;  2ZNZ A;  5M5W J;  2GAU A;  4JX4 A;  2A68 F;  5C3E J;  5KVR A;  1X1P A;  3QOE A;  2DOE A;  2DXI A;  2CW0 F;  5EDN A;  5IP6 A;  4N4O B;  3VYS B;  1E0E A;  2DAO A;  3SZP A;  3RDI A;  2ISY A;  3L2V A;  4ZYH A;  2UUZ A;  3RZO J;  3TW6 A;  5ILS A;  2R7Z J;  2TCT A;  2UZK A;  2H6C A;  1JT0 A;  2CG4 A;  2EFQ A;  2R7U A;  1O4X A;  4OIN F;  2KIU A;  1XX5 A;  3DKY A;  4A3L J;  1BM9 A;  2XAU A;  4B44 A;  3ZMS A;  4BE2 A;  2JUG A;  3S16 J;  3LAJ A;  3GFM A;  1BA5 A;  1R36 A;  5CLS A;  5E3N A;  4LIT A;  5E3O A;  1DU0 A;  4AYB N;  4EQQ A;  1ZGA A;  3KP6 A;  2OC6 A;  4ZTJ A;  5BOX A;  4PFP A;  5HLH A;  3M1E A;  2VBW A;  1GT0 C;  1VQL I;  3HTS B;  4BS9 A;  3H9G A;  2KL4 A;  2VOO A;  1I39 A;  3WG7 H;  1TWA J;  2OCE A;  4IEJ A;  2M0C A;  1SD6 A;  1K78 A;  2WC2 A;  3HRM A;  3BCA A;  2BYV E;  4U0W A;  1FOX A;  3HPH A;  2CW7 A;  3PSF A;  2RAE A;  3DU6 A;  3PQJ A;  4XLC A;  1RRJ A;  4XLP F;  1BIA A;  4JQF A;  3HL2 A;  1OYY A;  1S7A A;  2IRF G;  4NNJ A;  1POG A;  4HF2 A;  1OCP A;  4RAG A;  5D5V B;  3JRD A;  3GTJ J;  3I53 A;  3LQR A;  4G8X A;  2PQ8 A;  2V1N A;  5C44 J;  3OWT A;  2XPU A;  3REO A;  3A01 B;  4F3Q A;  4GO1 A;  2KDO A;  2DQL A;  3CCY A;  3NEU A;  3FMS A;  2H8R A;  3K7A J;  3BC8 A;  1LQ1 A;  4DYR A;  3OIP A;  2R7X A;  1W36 C;  1YS6 A;  2EZK A;  1QGP A;  4O5V A;  2RC4 A;  3ZMU A;  1ZHF A;  3DCF A;  1DUX C;  2R7W A;  3VSL A;  1Z21 A;  3KCC A;  2YU3 A;  2E7W A;  2CFO A;  4DIQ A;  1VQ5 I;  1MJA A;  5CVI A;  2TDX A;  1WI3 A;  1Y8Q B;  2COB A;  3MZH A;  5FB2 A;  4A3M J;  1XMA A;  3IAS 2;  4Y7N J;  1GXQ A;  4MHG A;  2KPM A;  3JR9 A;  3ZCO A;  1S8N A;  5CVR A;  3V4G A;  3C2G A;  4XKW A;  1XDS A;  3GX4 X;  1D1B A;  2RNJ A;  3JTH A;  5D6F A;  3SFZ A;  2X6X A;  3L2C A;  1K6O A;  2Y9Y A;  1Z3X A;  3DEU A;  4E7H A;  4RB0 A;  3DBR B;  1BC8 C;  2BY0 A;  3W2A A;  3AL0 C;  3RKX A;  2B9S A;  3OS1 A;  5DTD A;  2LKX A;  4FCY A;  3BP8 A;  4M3G A;  4FX4 A;  2JTV A;  3T0Y A;  2L2O A;  2L9R A;  2DK5 A;  3ZOB A;  4J19 A;  1TWG J;  3EUK L;  3GLL A;  3JRF A;  4HAM A;  1YYV A;  3E6C C;  1ZKG A;  3ISP A;  4OIQ F;  4OMY A;  2K4J A;  1ORK A;  2GWR A;  4OIP F;  2DA6 A;  5L3B A;  4OAZ A;  1OCO H;  1MJ9 A;  3E0J B;  3Q0U A;  2VE8 A;  4U87 A;  1W0U A;  4A3D J;  4RAF A;  2HDC A;  1EF4 A;  3IKT A;  1FBS A;  1IUF A;  1WJA A;  2L54 A;  3JRI A;  5FKK A;  4QTR A;  3OSG A;  2H09 A;  4IX7 A;  2IXS A;  3A03 A;  4HPQ A;  4XN0 A;  4Q48 A;  4C3J J;  2X6Y A;  3BLY A;  3GF2 A;  4PJJ A;  3LFK A;  4AID A;  3S15 J;  4U88 A;  4YEL A;  4D0P A;  1X1D A;  2L9V A;  4ZYG A;  1ZRC A;  2HR3 A;  2XB5 A;  2VQH A;  4DZP A;  2CV0 A;  1NG7 A;  4XKV A;  4AVZ A;  1OFC X;  3LSP A;  1OR7 C;  3SZT A;  3HEF A;  3RI4 A;  1SD7 A;  2M4K A;  3S93 A;  3OYN A;  4KMU X;  3VYR B;  4BDZ A;  2R7Q A;  1HSJ A;  3QOD A;  2YX4 A;  3F8B A;  2CUF A;  4KT5 C;  2WWY A;  4LG0 A;  1OR7 A;  3KX2 A;  4HF0 A;  4M9S A;  4MGR A;  2OPT A;  3C1D A;  2QEX I;  3S1N J;  2JT1 A;  5LRS A;  1LEB A;  1U2W A;  3WGH A;  2FU4 A;  4Q47 A;  2Y31 A;  4DBR A;  1TWH J;  5HLI A;  1SAN A;  3PFY A;  3PUB A;  2CUJ A;  4UB6 C;  1IDZ A;  3BT9 A;  4CUG A;  3OL4 A;  1J09 A;  3K6G A;  1ZGW A;  2COM A;  2M3A A;  2YU9 J;  1MNE A;  1MMG A;  1X3U A;  1X2M A;  2P7V B;  2WAF A;  1BR1 A;  3W2W A;  3I59 B;  2E1M C;  3RJP A;  5IPA A;  3CES A;  5TGT A;  2KP6 A;  2IA2 A;  2V7F A;  2R5Y B;  1AKH A;  3RCO A;  2VB6 A;  3J81 Z;  3S1R J;  2XAH A;  5FFZ A;  3M8F A;  4PFO A;  1HOM A;  5LLQ A;  4EAT A;  5HNF A;  1J59 A;  4ESJ A;  1WGX A;  3H1C A;  2CH0 A;  2V1X A;  2WV0 A;  1H89 C;  4P5O A;  1P7J A;  1T98 A;  1A6I A;  1IDY A;  2VOP A;  1MKM A;  2QKL B;  2W82 A;  3F3X A;  1P7I A;  5HDG A;  1TLH B;  4BE1 A;  3AG3 H;  2W85 A;  4BHP A;  1WJ5 A;  3G71 I;  3H0G J;  5FKM A;  2R92 J;  1TNT A;  1R5H A;  2ZXH A;  4ETS A;  1IN4 A;  2BW3 A;  3BJA A;  2PBI A;  5JVT A;  3N05 A;  2EIK H;  3KEQ A;  2JA5 J;  4HW0 A;  1XTA A;  3HOU J;  3IKV A;  2KRC A;  1JUS A;  4I99 C;  4LFU A;  2AQF A;  2K7L A;  2VT2 A;  4EM2 A;  3WGI A;  2LVS A;  3K10 A;  3RPQ A;  2LRE A;  1UHM A;  2QQA A;  1IV6 A;  4IHX A;  2G0E A;  2Y48 A;  1RET A;  5K5Q A;  1T2K A;  2PI0 A;  1EJ9 A;  1IGN A;  5EZG A;  4UUS B;  2GM4 A;  4MQV A;  3WTX C;  3LNQ A;  1EV7 A;  5DCM A;  4IQJ A;  2EFW A;  2XGD A;  1ZRD A;  5A2Q K;  4BDY A;  2X1C A;  3PNT A;  5EF6 A;  5ED4 A;  3J80 K;  1R00 A;  3HKZ A;  4HF1 A;  2F4O B;  4AIH A;  3CZ6 A;  2JA2 A;  3IWZ A;  2DW4 A;  2L4M A;  4HQM A;  2ZXJ A;  1KZH A;  2LNB A;  3JRB A;  3TED A;  1B8I A;  1VFC A;  4B09 A;  2JPC A;  1D5Y A;  2DA2 A;  2H8W A;  1TQM A;  4HV5 A;  3K1N A;  1V5E A;  3VDX A;  5FD6 A;  1YJW I;  2V9V A;  4OAY A;  4C2U A;  3HOS A;  4UVA A;  1D8J A;  1ZAR A;  2RRE A;  4XN3 A;  3ZQF A;  3L9F A;  3GYH X;  2K85 A;  2Q1Z B;  5C4J J;  4KDP A;  4B8X A;  3I54 A;  4QWQ A;  3LA7 A;  1WH7 A;  4WXH A;  2FRH A;  3AG2 H;  3SJM A;  4CH7 A;  5IT9 Z;  3EYI A;  3RQI A;  4YII A;  1VQO I;  3DU5 A;  2M7A A;  1ZAO A;  5LFA A;  4PCQ A;  2VPR A;  2Z16 A;  1T38 A;  3U21 A;  2ZME C;  1G4D A;  3I71 A;  2XF7 A;  1SFO J;  3MN2 A;  5M3F J;  4BXX J;  5TJJ A;  3HRS A;  2FOK A;  5L3E A;  3S32 A;  3EUH A;  3M8J A;  2CQN A;  4HSR A;  2CV2 A;  3FHN A;  1SFX A;  3IUO A;  2ZME A;  4M3B A;  2XRO A;  2QBY B;  3DEW A;  1HKQ A;  3BY6 A;  3QPH A;  3HTU A;  2EV6 A;  2IP2 A;  2K27 A;  3O8H A;  2ZCW A;  4A0Z A;  1S9H A;  2CUE A;  2ZXI A;  1R22 A;  3O2P E;  5LHG A;  4WK8 F;  1HA8 A;  1ZK8 A;  1BIB A;  2W48 A;  2YUS A;  2IVM A;  1WJC A;  5DD4 A;  3KYD B;  2L5Q A;  5LGN A;  1MBH A;  3A2K A;  1RKW A;  1QPM A;  5F04 A;  2VQL A;  2I8D A;  1DGW Y;  3RKW A;  2OA4 A;  3MKY B;  4CZC A;  4P1W A;  2XGE A;  2LTP A;  2G7U A;  1ETV A;  1EA3 A;  5CQE A;  4XLE A;  3U2R A;  3RKY A;  1OIS A;  2XAG A;  2AO9 A;  4LLG F;  4AC0 A;  2ZJR F;  3LSJ A;  4L9N A;  1HDP A;  1P92 A;  1J0R A;  1A35 A;  2Q2E B;  3D5L A;  2DT5 A;  3LFU A;  4MEX F;  2NXN B;  1KA8 A;  2WTE A;  2QQ8 A;  4A12 A;  2V26 A;  2ME0 A;  1ZG5 A;  1SD4 A;  2EPF A;  2UXX A;  3C7J A;  4Y33 A;  2DTZ A;  3TMO A;  2WA0 A;  1W36 D;  2HFH A;  2EV0 A;  2B7E A;  4XL9 A;  2LF8 A;  4LLL A;  3VOD A;  4MTD A;  2KIS A;  2XHK A;  3TKY A;  2R7T A;  3CCV I;  4X6A J;  4W97 A;  3CMM A;  4O6J A;  5HS9 A;  1Y56 A;  4BHB A;  4PSX A;  4XMY A;  3H35 A;  1F5T A;  2NVY J;  4M74 A;  2G9W A;  1B1B A;  1AOY A;  4ZZL A;  2F5V A;  3LOC A;  5LBQ A;  2VPL A;  3OR1 C;  5BQT A;  2VE9 A;  2L9S A;  2VJJ A;  1YTY A;  3PJR A;  3HHG A;  2M4G A;  4DOZ A;  3ONQ A;  3WTT C;  3H0D A;  5E1X A;  4UNO A;  4BUP A;  1SFK A;  2VC0 A;  3HYI A;  2QSG X;  2QSH X;  5HLT A;  2RVC A;  3P9I A;  3I56 I;  5M3M J;  2E34 A;  1GUU A;  3BWG A;  4LMY A;  3O3K A;  3KZY A;  3DQV C;  2K9S A;  3M4O J;  4AU7 A;  2E1N A;  1FIP A;  1B59 A;  5GTH C;  2F4I A;  5GAE J;  2JK3 A;  4GYI A;  1HQC A;  3GCM A;  5FKL A;  1OQY A;  3ERE D;  5F08 A;  2ZJP F;  5K5R A;  2STT A;  4B4C A;  4A3K J;  3F8N A;  1OCZ H;  2IGK A;  5DD8 A;  2RV8 A;  3BR5 A;  2LLK A;  4B43 A;  2W00 A;  1YIO A;  2NVU B;  4YRV A;  3FX3 A;  2M30 A;  2GLO A;  1D0X A;  1I50 J;  2LY9 A;  1DPU A;  4Y15 A;  4GYG A;  2HOS A;  1HKT A;  4L5J A;  4D5C A;  3A01 A;  1S5L C;  2QCO A;  2CQX A;  2GOX B;  1BL0 A;  2JPB A;  1YW9 A;  3M7G A;  3S8P A;  2GQQ A;  2MW8 A;  1V55 H;  3K4K A;  4BXU A;  4IQ4 A;  5HOD A;  3WTY C;  2X9D A;  3R0J A;  2DA7 A;  3A02 A;  4A0Y A;  5D6E A;  2P4W A;  3A0B C;  2NS8 A;  2P8T A;  2WAQ A;  4ZYA A;  1E3O C;  4BY1 J;  1KU3 A;  1FOK A;  3F6O A;  4BL0 B;  2O8X A;  4XQF A;  4IHV A;  1X1B A;  2D2W A;  3R60 A;  3TL4 X;  3HOZ J;  4R8H A;  5E8I A;  4JP0 A;  4I2O A;  1DU6 A;  4CYC B;  2XAQ A;  5FFX A;  2DQR A;  2FEZ A;  2VIX A;  5AIQ A;  5IYB J;  3QYF A;  3TQN A;  4RB1 A;  1R4N B;  5KAI C;  2KJB A;  4IL6 C;  2BY2 A;  3L2W A;  3PSI A;  3ELK A;  1BI1 A;  2YR2 A;  2QQB A;  3HGG A;  3RKQ A;  1E3P A;  1Z77 A;  3DPL C;  2KFD A;  2D1H A;  5BMZ A;  1D0Y A;  4N0B A;  5L3G A;  4UHT A;  5TIS C;  3OSF A;  4FET A;  1MMD A;  3RYR A;  1TL8 A;  5F1J A;  1BN5 A;  5IP9 J;  2DA3 A;  3CF5 F;  1Y1W J;  1HXD A;  5K7H A;  5F0H A;  2VBX A;  4II2 A;  1WZ2 A;  2H94 A;  1O7F A;  3SDG A;  3ASN H;  5LHI A;  2O61 A;  2M8E A;  1BOB A;  2EIL H;  3EQL F;  3G4S I;  2M45 A;  2MYS A;  3CCS I;  4M73 A;  4RGX A;  3SFI A;  3ABT A;  3RIR A;  2HNH A;  2AXL A;  2M7B A;  3RTR A;  3CUO A;  3T1B A;  2HVR A;  1U78 A;  3G3Z A;  5DM6 F;  1YIT I;  3K1M A;  1BI0 A;  1FC3 A;  5FRO A;  2E1C A;  2P7C B;  4O3M A;  3QPL A;  1H9G A;  3NWT A;  1K4T A;  4I76 A;  4QIW N;  5FRN A;  3UKG A;  1OYW A;  2K3P A;  3FZV A;  4EJU A;  1R6R A;  2VT3 A;  2LY1 A;  2CU7 A;  2BBY A;  3TO9 A;  1LPQ A;  5FLM J;  1ON1 A;  4BU2 A;  4ENN A;  1NHA A;  4F7Z A;  1ETX A;  1VTN C;  2CUZ A;  5J4V A;  2L7M P;  1CF7 B;  4NHJ A;  3WHC A;  1SEU A;  4A0X A;  4A3E J;  5DYM A;  1WVR A;  1TZL A;  4RAZ A;  4HX7 A;  5B5E C;  4KIS A;  3WHB A;  3ZQQ A;  2BEO A;  3F8M A;  3OR2 C;  2PMH A;  4Y13 A;  3U1K A;  1FYK A;  3V8J A;  1PUF B;  3K4C A;  1U5T B;  3B02 A;  3LSG A;  1IC8 A;  2XGX A;  3WE2 A;  2L7Z A;  2JZY A;  3Q5F A;  1A6Q A;  5J40 A;  3PO3 J;  2X51 A;  4FQG A;  3R4K A;  5ERI A;  4QSH A;  4AYB A;  2R5Z B;  4AVP A;  1S29 A;  3GLX A;  1NG6 A;  2DMP A;  2GA1 A;  5AON A;  1T56 A;  1IN5 A;  4KIG A;  5LEK A;  3AAF A;  2LBF B;  2UV1 A;  2V9K A;  1U8R A;  3FXJ A;  3BG5 A;  1I5Z A;  1XB4 A;  4LB6 B;  3W6V A;  1NK3 P;  2M5W A;  1RUN A;  4CHU A;  4LD5 A;  3I59 A;  4OIO F;  1WJE A;  1JJ8 C;  3K4L A;  3WTV C;  1YI2 I;  2R5Y A;  2CS3 A;  1IF1 A;  1QO0 D;  5BS6 A;  1A5J A;  2BOL A;  2Z33 A;  1IRG A;  1IW7 F;  1LDK B;  3OIO A;  3QYB A;  1T08 B;  2DMU A;  2YPR A;  1VQ7 I;  1QVU A;  5DEQ A;  4C2T A;  2DN0 A;  5CPR B;  2HKX A;  4ZZD A;  3HUG B;  4HX8 A;  2A6T A;  1ETY A;  1GXP A;  3CDI A;  2VBY A;  1RIO H;  4ZH4 F;  2JN6 A;  3KPH A;  2F2E A;  3K69 A;  4C3I J;  1IN8 A;  2IAI A;  1UCR A;  1R58 A;  2J5O A;  1R4M B;  4HX4 A;  1P9Q C;  2QA4 I;  1TNS A;  3OYC A;  3K4B A;  4IRH A;  4A3J J;  4ENM A;  5FLX Z;  1B4A A;  1JUP A;  1XCB A;  4UUT A;  3BG3 A;  2W7N A;  1UJ8 A;  4BAY A;  2DDA A;  2KRF A;  2JVH A;  3S17 J;  2PG4 A;  3J7Z I;  2CWE A;  2AS5 F;  1S6L A;  4KIC A;  3CDH A;  5E20 A;  5EEH A;  9ANT A;  1S72 I;  2WB1 N;  5DUI A;  4EJV A;  3I4P A;  3DTI A;  4UUS A;  4HG2 A;  4P9F A;  1RES A;  1RC9 A;  1M1E B;  1K83 J;  2F5E A;  2K5C A;  3HSR A;  3IWF A;  5F27 A;  1I6X A;  1UHS A;  2NOJ B;  3HOY J;  1E3H A;  4QPO A;  4KIB A;  3J81 K;  1FBU A;  5GPC A;  1WCM J;  4NDL A;  4L5E A;  3HG9 A;  3CCJ I;  4LG3 A;  1D8K A;  1SC7 A;  1JE8 A;  2QLZ A;  4G6D A;  1VQ8 I;  1IXC A;  1RI7 A;  3E5Q A;  3FXL A;  1MBF A;  4F91 B;  1R49 A;  3ZMT A;  4ASN A;  2MSY A;  1PUE E;  2STW A;  2HDD A;  2V4J C;  4B48 A;  2ZO4 A;  2O03 A;  1OKR A;  4K2E A;  2EH3 A;  5LGU A;  3FBN B;  2D1V A;  2XKP A;  3HZJ A;  2VBZ A;  1JJ6 C;  3IHU A;  3HC7 A;  1G8X A;  3E6D A;  1B9M A;  2XSD C;  2DFH A;  1GDT A;  4Y17 A;  3RSN A;  1OPC A;  3C2B A;  4UXN A;  1UMQ A;  4HLX A;  2LC2 A;  3K70 C;  2A61 A;  3Q0V A;  2VAS A;  1DP7 P;  1BBY A;  2DLL A;  2CQK A;  2WBM A;  2Y0S N;  4XOR A;  4PGH A;  4RBO A;  3LA2 A;  4G7H F;  3WTU C;  2ZJQ F;  2ICW G;  4DBQ A;  3LSH A;  2A05 A;  1U9N A;  4CCL A;  2PJR B;  1FOW A;  1YX5 A;  2FBK A;  2FNA A;  3N97 A;  1NTC A;  4EVI A;  2Z1D A;  4L9T A;  2LP0 A;  2HS5 A;  2K86 A;  2E1O A;  2XV4 S;  3BR2 A;  4CA0 A;  3JSP A;  2QBY A;  5FGM A;  2GOM A;  1JTY A;  4H0E A;  4RM3 A;  3RPU A;  5CVJ A;  3R61 A;  4F93 B;  5BNG A;  2QQ9 A;  1PDN C;  1I3Q J;  4EM0 B;  2E60 A;  2H6B A;  4M72 A;  3ZMV A;  2E71 A;  4YFN F;  1J75 A;  3MKZ A;  2O0Y A;  3DEE A;  2OD5 A;  1IRF A;  1I3A A;  4PJM A;  3S3O A;  1O3T A;  2A07 F;  3SDB A;  4XIC A;  4DYC A;  1XG1 A;  5GP9 A;  3MFK A;  1IZ1 A;  1QU3 A;  4ANJ A;  3LSR A;  4PJ0 C;  4ZDO A;  3F72 A;  1MBJ A;  4FE7 A;  4HA8 A;  5JHU A;  3KP2 A;  4QLC U;  4UVC A;  3CCR I;  4NC8 A;  4M6X A;  1QHH D;  4J01 A;  2WY7 Q;  4MQ9 F;  1GVD A;  2Q2E A;  5EYR A;  4BY7 J;  1ZGJ A;  1T39 A;  2ZSH B;  3BR3 A;  3AFH A;  5IT9 K;  2RKH A;  1W5T A;  4II3 A;  1P4X A;  2EQR A;  4GDF A;  1MH3 A;  2QM3 A;  2MLG A;  2HDW A;  2IS4 A;  4XNF A;  4IRI A;  2E2J J;  1FP2 A;  3KZZ A;  2LMD A;  3IH3 A;  5FRM A;  3D0S A;  2EIN H;  1G3Y A;  5B1B H;  4XRS A;  5L3D A;  3L09 A;  1LVA A;  2YX7 A;  4XKB A;  3DXJ F;  3I3L A;  2NVQ J;  2CJJ A;  2GA2 A;  2M2E A;  5M5Y J;  3DFG A;  3FWE A;  2DU9 A;  3K4J A;  1U3E M;  1GLN A;  1VQ4 I;  1GHC A;  3JRA A;  1I27 A;  3ZMD A;  2IA1 A;  3OY9 A;  1HW1 A;  3ZQ7 A;  1R5I D;  1Z7L A;  1ERD A;  2LSO A;  4W1U A;  2HQR A;  5FO5 A;  1KGS A;  3MQ0 A;  3G1L A;  2QUF A;  2O5R A;  4LLN A;  1IO2 A;  1X1C A;  5F64 A;  1ZR2 A;  2O3F A;  2ECC A;  1YX3 A;  3L2R A;  2M1B A;  4PJL A;  2HYG D;  5DS9 A;  1JHF A;  5B1A H;  3L2Q A;  4NB5 A;  4D5F A;  1L0O C;  2XAS A;  5ILU A;  4XR6 A;  2ZXW H;  2DOF A;  1FZP B;  3B73 A;  5JLX A;  4HDV A;  2CFX A;  2L9N A;  1IXR C;  4JOM A;  4PUS A;  1UZC A;  1F36 A;  1J5Y A;  3FK6 A;  1KYZ A;  1MNM C;  3HOX J;  2BHY A;  2YS9 A;  4NQW B;  1BW6 A;  2GIV A;  1WKM A;  2JSP A;  1SAU A;  2BXZ A;  2DMT A;  2XKO A;  2A6H F;  1NK2 P;  2PLY A;  3LL7 A;  4EEF G;  4KA4 A;  5JHF A;  4L5I A;  3FXU A;  3L00 A;  4TV7 A;  1O57 A;  3S2W A;  1EH6 A;  5DM7 F;  5CVU A;  2HZT A;  3F9K A;  2PFB A;  2XVC A;  3BJO A;  1ZH5 A;  4B1R A;  1H8A C;  1WHU A;  4MTE A;  5JR3 A;  5EGO B;  2IT0 A;  3BR0 A;  4UV9 A;  2HYF A;  2X0L A;  3BJ6 A;  4JX5 A;  3OYD A;  1YQA A;  4YEJ A;  1Q1V A;  4XLN F;  4BGD A;  2H1K A;  4KIF A;  4WXD A;  1MZB A;  4BH9 A;  5GAG J;  3ZQL A;  5D4R A;  1SAX A;  3ECO A;  5D8K B;  1STZ A;  4BHC A;  4IHW A;  2DPD A;  2CGP A;  2BV6 A;  1DQU A;  1YS7 A;  1SFE A;  3OYB A;  1Z0X A;  3KP5 A;  4PSW A;  4CYC A;  2FA5 A;  2EBI A;  1IN6 A;  4BJ5 C;  3GTL J;  1V4R A;  3CUQ B;  1REP C;  1K61 A;  4D7N A;  3E5X A;  3CO7 C;  4HQE A;  3GME A;  3H3U A;  4E7I A;  3FK7 A;  1U9O A;  4KUM A;  1T6S A;  5AIP A;  2KIM A;  1MDM B;  1K4S A;  2KQR A;  3SZG A;  1YFH A;  3GO5 A;  5E17 F;  1TBX A;  4MIM A;  4A2U A;  3VWB A;  1P4A A;  4AWX B;  3G1M A;  1YW7 A;  2RGV A;  1UG0 A;  2F4M B;  4CCK A;  3H3V K;  3TOB A;  2ESN A;  1RKT A;  3OS0 A;  1LVK A;  1K7A A;  3G2B A;  1B72 B;  4WWC A;  1HST A;  2JUC A;  1FLI A;  5KNL A;  2CSO A;  4GXO A;  3WTW C;  2GXB A;  2KMU A;  3V7C A;  2O6G E;  3K4N A;  4OMZ A;  4FT8 A;  3LQQ A;  1P2F A;  1LFB A;  3FIW A;  3CCQ I;  1R1V A;  2Y75 A;  4CXF A;  3MZ8 A;  2MC3 A;  3LSK A;  3MZY A;  2Y9Z A;  2DPU A;  3J7A O;  1LFU P;  5KK1 A;  4FTH A;  1QBJ A;  3ZN1 A;  4C2M J;  3CME I;  2VXD A;  4G6Q A;  3C3W A;  1AU7 A;  4EV0 A;  4E6K G;  3WU1 B;  4A5N A;  3KP4 A;  5LEJ A;  3KET A;  3H5N A;  1FY7 A;  4I0A A;  4I02 A;  4M3D A;  3COA C;  3HM5 A;  1VQ9 I;  3JTG A;  3GZ5 A;  3MD2 A;  2LYC A;  3QAH A;  1XN7 A;  4XRF A;  4A6D A;  2BHZ A;  3BTJ A;  3I9V 2;  5E1Z B;  3TP0 A;  4JYK A;  2HWV A;  2JJ7 A;  1XCV A;  4B3X A;  2CRG A;  1WJF A;  2IGN A;  1CF7 A;  5HOO A;  1Q1H A;  5H6R A;  2RNG A;  3Q0W A;  2RQQ A;  1N75 A;  1U5T C;  2FJ1 A;  1ETK A;  2HOE A;  3W6K B;  3S1Q J;  2P0W A;  1SVO A;  3EUA A;  1UHW A;  3LMM A;  4C3H J;  3FKJ A;  4NC6 A;  1PUF A;  1U5T A;  3NAR A;  3QU3 A;  3ZPL A;  1D0Z A;  2D45 A;  3LSI A;  3VSK A;  1QRY A;  2O7O A;  2P6T A;  1VQN I;  1VF9 A;  4I09 A;  1B6A A;  2E2H J;  3BCB A;  4WCG A;  1XD7 A;  1HC8 A;  4BBS J;  1OCR H;  3HB9 A;  3DLA A;  2R5Z A;  1KU9 A;  4ZTF A;  5LRR A;  4XOP A;  4I01 A;  2ACJ A;  2Z5U A;  2LBF A;  1O3R A;  1BI3 A;  4V19 K;  5J47 A;  3OV8 A;  1O7L A;  3BR6 A;  3MCZ A;  1Z67 A;  1MD0 A;  2Q0O A;  4RMN A;  3QU6 A;  3JRE A;  2ZFU A;  4D7M A;  2HI3 A;  3E6M A;  2MD0 A;  2DI3 A;  4G7Z F;  3KFW X;  4CDG A;  4BJT A;  2WAD A;  2A69 F;  2HXO A;  5IY5 H;  1HW2 A;  3E97 A;  2LY2 A;  2XSJ C;  3H36 A;  5D8L B;  2AHQ A;  4ESF A;  3D5R C;  1D3Y A;  3K70 D;  3HSE A;  2OQG A;  4MFE A;  1CQT A;  4RLQ A;  4YIR X;  4HNT A;  2C6Y A;  3KP3 A;  3LSM A;  5GAH J;  2DO7 A;  4XK4 A;  3UR3 C;  4BQN A;  4DZJ A;  3FF5 A;  1AWC A;  3BG6 A;  4PZJ A;  1BOA A;  3GTP J;  1HKS A;  4NC7 A;  1MJB A;  3RPU D;  2MH2 A;  1LB2 A;  4IOA F;  2F48 A;  3GW2 A;  1QNT A;  3R0A A;  5J1R A;  2EFO A;  1I1G A;  3WU0 A;  4A6E A;  1FPQ A;  5J8F A;  3FMQ A;  5GPA A;  2HEO A;  3CP8 A;  2LKS A;  4RGR A;  3CC7 I;  3HRU A;  2CMP A;  2DCE A;  1LE8 B;  4KIT B;  2IPQ X;  3IP4 B;  2CW8 A;  3DTK A;  1R7J A;  1E17 A;  4PJN A;  2DYR H;  1XSD A;  1D1A A;  3NAU A;  4F92 B;  3FXK A;  1MGT A;  4AM3 A;  3DPT A;  2JA7 J;  1XMX A;  4X1E A;  3HOW J;  3HIF A;  4M71 A;  3ZQC A;  3JRC A;  1A36 A;  5JVG F;  1YJN I;  4L18 B;  1KYW A;  5DV5 A;  3B6A A;  2R7R A;  3A0H C;  3ROU A;  2XAF A;  3E6B A;  2D5V A;  4A3F J;  1G3S A;  1IG7 A;  3HJE A;  1QZZ A;  2VUM J;  3I5U A;  3CJR B;  2R7S A;  5H6Q A;  4HDU A;  5J4Y A;  1OCC H;  3M07 A;  3VYU B;  3DP7 A;  1X58 A;  2DBB A;  2V9P A;  1JUM A;  2VJ4 A;  3F0C A;  1YJ9 I;  3H3Z A;  4L0Z B;  4N9H A;  4KNY A;  1XS9 A;  4IVN A;  4ESB A;  1S7E A;  1MBG A;  3GTO J;  3CCU I;  3A4C A;  1ZLK A;  3JRG A;  4BQO A; 
#chains in the Genus database with same CATH homology
 4A3J J;  4A69 C;  1JUP A;  2Y31 A;  4UUT A;  3BG3 A;  3K2A A;  5J3L A;  1JT6 A;  3TW7 A;  5IYD J;  1TWH J;  2B63 J;  4A3G J;  1SAN A;  3FIS A;  4BBR J;  4JX6 A;  1BW5 A;  3S17 J;  4BKX A;  1IDZ A;  3BQZ A;  3BT9 A;  2HQ5 A;  3I4N J;  1ZGW A;  5E3L A;  3L1P A;  2YU9 J;  9ANT A;  2DA1 A;  2WB1 N;  1X2M A;  4UUS A;  5IOZ A;  3BG9 A;  2ID6 A;  1RES A;  5IPA A;  2FX0 A;  3IV5 A;  1K83 J;  5E3M A;  5F27 A;  2R5Y B;  1UHS A;  1AKH A;  3HOY J;  5GPC A;  3S1R J;  1WCM J;  4NDL A;  4L5E A;  3RZD J;  1HOM A;  2KT0 A;  1MSE C;  2OF7 A;  1MBF A;  4MFD A;  1WGX A;  2Y2Z A;  2MSY A;  5F0C A;  2HDD A;  5F0F A;  1UG2 A;  1YRN B;  1H89 C;  2EH3 A;  1XC5 A;  1FTZ A;  1P7J A;  2JA6 J;  1A6I A;  1IDY A;  1JJ6 C;  2M8G X;  1P7I A;  3S2H J;  5K7Z A;  4XID A;  2XSD C;  3MVP A;  1GDT A;  1R9T J;  3C2B A;  3H0G J;  3GTG J;  5FKM A;  2R92 J;  4DYQ A;  1UMQ A;  2K9Q A;  3Q0V A;  3IH2 A;  2KDZ A;  2JA5 J;  2Y0S N;  1JKP C;  4RBO A;  3HOU J;  1JUS A;  1JTX A;  1U9N A;  3CDL A;  1W0T A;  2LVS A;  1X2N A;  4LOC A;  1ETQ A;  3GTK J;  2XGC A;  1NTC A;  1FIA A;  1IV6 A;  4IHX A;  2G0E A;  2LP0 A;  1RET A;  2E1O A;  3BR2 A;  1IGN A;  5EZG A;  4UUS B;  4S0H B;  2GM4 A;  3LNQ A;  1JTY A;  1QPI A;  3S1M J;  2JMW A;  2XGD A;  1FTT A;  1H88 C;  3IH4 A;  3S2D J;  5EF6 A;  1AKH B;  1F43 A;  5BNG A;  1G2H A;  1I3Q J;  1U8B A;  5K7F A;  1WH5 A;  5EZH A;  2WV1 A;  1GV5 A;  2X6O A;  4XIC A;  4DYC A;  3JRB A;  1B8I A;  3TED A;  1XG1 A;  5GP9 A;  1HCR A;  1VFC A;  3LSR A;  1D5Y A;  2DA2 A;  1MBJ A;  2XB0 X;  2MGQ A;  4FE7 A;  3D1N I;  3Q3S A;  3ZQF A;  3QPS A;  4MO7 A;  3ZQI A;  1JKR C;  5C4J J;  1WPK A;  3HGY A;  2QF7 A;  3I4M J;  1ENH A;  1ITY A;  1WH7 A;  4V2G A;  2VI6 A;  1GVD A;  5EYR A;  4BY7 J;  5J1Y A;  1I6H J;  3SJM A;  3BR3 A;  3GBG A;  3RQI A;  1MBE A;  4A3B J;  2R0Q C;  3M3Y J;  2EQR A;  4M3E A;  1MH3 A;  2VPR A;  4XRM A;  1MSF C;  3MKL A;  1SFO J;  2IBD A;  3MN2 A;  5M3F J;  2E2J J;  4BXX J;  3IH3 A;  4XRS A;  2R93 J;  3FKI J;  3S14 J;  3ZQH A;  2IEK A;  2NVQ J;  2GBY A;  2CJJ A;  2M2E A;  5M5Y J;  3BTL A;  1HDD C;  4M3B A;  3GTQ J;  5C4X J;  3DEW A;  3JRA A;  2CQQ A;  4XRS G;  3O8H A;  3PO2 J;  3HOV J;  5EGO A;  2HOT A;  2CUE A;  4W1U A;  2NVX J;  4M3F A;  4FIS A;  4ABZ A;  2ZB9 A;  1ZK8 A;  3G1L A;  2W48 A;  2YUS A;  1OJL A;  3E7L A;  4G12 A;  2X48 A;  1ZR2 A;  1MBH A;  1RKW A;  4DW6 A;  1B8I B;  2XRL A;  2ECC A;  5F04 A;  5DS9 A;  2EZL A;  2P81 A;  2MG4 A;  4D5F A;  2ME6 A;  2XGE A;  2LTP A;  3OOU A;  2ECB A;  2HYJ A;  1APL C;  1ETV A;  3HBL A;  2L0K A;  4AC0 A;  2AO9 A;  2WAQ N;  5JLX A;  3LSJ A;  1ZTR A;  1HDP A;  3BTC A;  2K9N A;  2N8G A;  1RR7 A;  5M5X J;  1F36 A;  3FK6 A;  4RDU A;  2DMN A;  2ME0 A;  1MNM C;  3B6C A;  1BJZ A;  3HOX J;  2DTZ A;  2YS9 A;  2DA5 A;  2FD5 A;  1BW6 A;  1JKO C;  4AUX A;  2DMT A;  1ETO A;  2K40 A;  1NK2 P;  1IRZ A;  1OCT C;  1B72 A;  4A93 J;  1ETW A;  3ZQG A;  4EEF G;  2EZI A;  4X6A J;  2ID3 A;  3G1O A;  4W97 A;  1FJL A;  3QQA A;  4B1R A;  1H8A C;  2NVY J;  5EGO B;  3BR0 A;  1ZR4 A;  3LOC A;  5J1U A;  2XPV A;  4JX5 A;  4V2F A;  1Q1V A;  1ZQ3 P;  3O8G A;  2H1K A;  3ZQL A;  2DMQ A;  1FEX A;  5EG0 A;  4IHW A;  1HLV A;  2I10 A;  1Z0X A;  5M3M J;  1GUU A;  2FQ4 A;  2HOA A;  2XPW A;  5FJ8 J;  2K9S A;  1QVT A;  4CYC A;  3CMY A;  3M4O J;  5FKO A;  2EBI A;  1Y1V J;  3PM1 A;  1FIP A;  3GTL J;  3GTM J;  2JWT A;  1K61 A;  4D7N A;  2JK3 A;  5FKL A;  3FK7 A;  5F08 A;  4B4C A;  1U9O A;  2Y30 A;  4A3K J;  2LR8 A;  3BR5 A;  2LLK A;  4A3C J;  4MIM A;  3G1M A;  2GLO A;  5M5W J;  3H3V K;  1I50 J;  4JX4 A;  2LY9 A;  1RKT A;  1MH4 A;  5C3E J;  1B72 B;  2HOS A;  2O9L A;  5EDN A;  5IP6 A;  2DA4 A;  2L7F P;  2LD5 A;  4D5C A;  3A01 A;  2QCO A;  2CQX A;  1BL0 A;  1LFB A;  3FIW A;  2TRT A;  2MW8 A;  3TW6 A;  5IP7 J;  3RZO J;  4Y52 J;  2R7Z J;  5HOD A;  2Y9Z A;  2TCT A;  2X9D A;  1LFU P;  2DA7 A;  3A02 A;  4FTH A;  1JT0 A;  1O4X A;  2NS8 A;  4C2M J;  4A3L J;  4BY1 J;  1E3O C;  2E2I J;  1BA5 A;  1TWF J;  5EG0 B;  1AU7 A;  3S16 J;  5E3N A;  5E3O A;  1DU0 A;  4AYB N;  4M3D A;  1TWC J;  3HM5 A;  2VKV A;  4IHV A;  1GT0 C;  2ELK A;  3HOZ J;  4JP0 A;  5EEA A;  4CYC B;  1DU6 A;  3BTJ A;  3TP0 A;  4HNV A;  1TWA J;  3TP3 A;  4JYK A;  2JJ7 A;  4IEJ A;  5IYB J;  2CRG A;  2M0C A;  3JRH A;  4B3A A;  2JA8 J;  3Q0W A;  1VND A;  4IHY A;  2FJ1 A;  1ETK A;  3HGG A;  2RAE A;  3RKQ A;  1Z77 A;  3BR1 A;  3S1Q J;  4C3H J;  1T33 A;  2NS7 A;  1PUF A;  3OSF A;  3NAR A;  1POG A;  1OCP A;  5F1J A;  5IP9 J;  1QRY A;  2O7O A;  3JRD A;  1VF9 A;  3GTJ J;  2DA3 A;  2E2H J;  1JKQ C;  1Y1W J;  5K7H A;  5F0H A;  1VI0 A;  5C44 J;  4BBS J;  1LE8 A;  2XPU A;  3A01 B;  3SDG A;  3HB9 A;  2R5Z A;  3CCY A;  2H8R A;  3SFI A;  3K7A J;  4DYR A;  2NOG A;  3BR6 A;  2EZK A;  5IYC J;  1U78 A;  3JRE A;  3DCF A;  4D7M A;  2HI3 A;  3QPL A;  3VPR A;  4I76 A;  4QIW N;  3UKG A;  1GV2 A;  1MBK A;  2HXO A;  4M6V A;  4A3I J;  2AHQ A;  5IOY A;  2CU7 A;  1WI3 A;  2COB A;  5FLM J;  2HXI A;  4MFE A;  1CQT A;  4A3M J;  4Y7N J;  1ETX A;  2NVT J;  2L7M P;  3JR9 A;  4XK4 A;  4DZJ A;  3WHC A;  4A3E J;  2E19 A;  3WHB A;  3GTP J;  2M9H A;  2Y9Y A;  1TC3 C;  5J1R A;  1PUF B;  3LSG A;  1IJW C;  2VKE A;  4I6Z A;  3BTI A;  1IC8 A;  5GPA A;  2L7Z A;  5DTD A;  2M34 A;  2LKX A;  4FCY A;  3HDD A;  2PMZ N;  4M3G A;  3PO3 J;  1LE8 B;  4QSH A;  4GFB A;  2L9R A;  3ZOB A;  4J19 A;  2R5Z B;  1TWG J;  3JRF A;  1AHD P;  1ZKG A;  2DMP A;  2EZH A;  1T56 A;  2O8K A;  5JLW A;  2DJN A;  1ORK A;  3NAU A;  3BG5 A;  3W6V A;  1NK3 P;  2DA6 A;  2LFB A;  3Q0U A;  2JA7 J;  3BQY A;  4X1E A;  3HOW J;  1W0U A;  4A3D J;  1JJ8 C;  3ZQC A;  3JRC A;  1EF4 A;  1RPW A;  1IUF A;  2R5Y A;  5FLV A;  3JRI A;  5FKK A;  4QTR A;  3OSG A;  3B6A A;  1JGG A;  1A5J A;  3A03 A;  4FE4 A;  4C3J J;  3OIO A;  2D5V A;  4A3F J;  1IG7 A;  2DMU A;  3S15 J;  1QVU A;  2VUM J;  2XB5 A;  4DZP A;  2LK2 A;  2DN0 A;  1OFC X;  3LSP A;  1YRN A;  1X58 A;  3HEF A;  4MLO A;  3F0C A;  1JUM A;  3CQZ J;  1ETY A;  1HF0 A;  3HKZ N;  2CUF A;  2JN6 A;  1XS9 A;  4C3I J;  2IAI A;  1S7E A;  1MBG A;  3GTO J;  2OPT A;  5FKN A;  3JRG A;  3S1N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...