2WAQN

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2waqN00
5BNGA 1MH4A 1CQTA 3HEFA 3FK7A 5IP7J 1Z0XA 1LE8B 4V2GA 1OFCX 4J19A 2PMZN 2DMNA 5F27A 1U78A 4MFEA 3JRBA 3GTOJ 1RPWA 3HOUJ 3M3YJ 3S14J 3PM1A 2EZIA 5EYRA 5FKKA 1VF9A 3MVPA 5IYBJ 2EQRA 1F36A 2L7MP 1VFCA 1B8IA 5M5WJ 1YRNA 4M6VA 4AC0A 4A3MJ 2XGCA 3FK6A 2XPWA 2Y9YA 4X1EA 4IHXA 1FIPA 2X6OA 3BG9A 3SDGA 1YRNB 2DMUA 1HCRA 2IEKA 1QVTA 3JRFA 1WI3A 1LFBA 3A01B 2R5YA 3JR9A 1LFUP 2XGDA 1VI0A 2M8GX 2FQ4A 4B1RA 1P7IA 1QPIA 3CCYA 2R5YB 1FTZA 2LVSA 1HOMA 2R93J 1MBGA 3O8GA 1TWAJ 3HGYA 4FE4A 5FKOA 2M9HA 3GTPJ 3BQZA 2XB5A 2QF7A 1DU0A 1ETXA 2EZHA 1NK2P 1JTXA 1XG1A 2XSDC 1XC5A 4LOCA 4BBSJ 2ME0A 2NS7A 4A3BJ 1ZQ3P 2G0EA 2JJ7A 1IV6A 2VKEA 4UUSA 3WHCA 2R92J 2JA7J 4QSHA 2DMPA 2DTZA 2K9SA 4IHVA 3QPLA 5EF6A 2M34A 3IV5A 2LP0A 3BR3A 2EBIA 2HI3A 5J1YA 1UMQA 1K83J 2JMWA 5M3FJ 3S1QJ 5DTDA 5GPCA 1RR7A 1GV2A 5F1JA 1GT0C 3GTGJ 2NOGA 3JRDA 2KDZA 1GDTA 2AHQA 2HXIA 2XPVA 2OPTA 4ABZA 2E2HJ 4I76A 2K9NA 1MSFC 3CMYA 3RZDJ 1T33A 2O7OA 2ID6A 5HODA 4M3EA 5IP9J 2NVTJ 2CQQA 3C2BA 3L1PA 3ZQLA 3HDDA 2I10A 2YU9J 3MN2A 2IBDA 1RETA 3JRIA 4BY1J 1JKPC 3GTJJ 3JRHA 1FTTA 1VNDA 4IHYA 3H3VK 2RAEA 4CYCB 2DA5A 3S16J 1POGA 5EEAA 1B72B 1APLC 4MFDA 3Q0VA 5F0FA 3MKLA 1Z77A 3HGGA 1GV5A 4B3AA 2L9RA 2ZB9A 1U9NA 1W0TA 2H8RA 3BTIA 2YS9A 1RKTA 9ANTA 3WHBA 4X6AJ 1JUMA 3OSGA 2EH3A 3DEWA 4IHWA 2EZKA 4HNVA 5IPAA 5FKNA 1ETWA 3FKIJ 1MBEA 2CU7A 1BA5A 2Y31A 3VPRA 4JP0A 3B6CA 5JLXA 1IUFA 3TP0A 1ZR2A 3E7LA 4XRSG 3K7AJ 2D5VA 4GFBA 4A3GJ 5M3MJ 1ORKA 3GTKJ 2NVXJ 4I6ZA 3PO3J 1B8IB 1JT6A 3BG3A 4A3JJ 1ETVA 3D1NI 2CJJA 3S17J 2NVYJ 2CQXA 3BR1A 1HDPA 2VI6A 1ZR4A 1U9OA 2XRLA 3TEDA 3HB9A 2COBA 2CRGA 5FLMJ 2DJNA 4L5EA 5K7HA 4BBRJ 3TW6A 1WH5A 3G1MA 3ZOBA 1MBFA 2O8KA 4C3HJ 3FIWA 1AHDP 1RKWA 5FKMA 3LSRA 3QQAA 4DYCA 3HM5A 5EG0A 5FJ8J 3BR5A 4XICA 5IYDJ 3HOZJ 4A3IJ 3RZOJ 1PUFA 1HDDC 2FX0A 4A3CJ 2GLOA 3JRGA 2N8GA 1EF4A 1P7JA 2IAIA 4FE7A 2DA6A 5IOZA 3IH3A 1IRZA 4JX6A 1BL0A 5EZHA 4QIWN 2KT0A 2LK2A 3TP3A 1O4XA 4UUSB 2ECBA 5E3LA 1DU6A 1A5JA 3BR6A 3BR0A 5F0HA 5F08A 1W0UA 3BTLA 3HKZN 5F0CA 1IGNA 1IC8A 1S7EA 3Q3SA 3SFIA 3F0CA 2R5ZA 4FISA 2EZLA 1TWCJ 4B4CA 2LR8A 3LSPA 2L7ZA 3RQIA 1LE8A 5JLWA 3A03A 4A3DJ 2JK3A 5FKLA 3JRCA 1WH7A 1JKQC 3JREA 1RESA 4D7NA 1BW5A 1MNMC 1UG2A 4C3JJ 4MIMA 4XRSA 1K61A 5M5YJ 3Q0UA 2DA3A 2HOAA 3DCFA 3CDLA 4QTRA 4RBOA 4UUTA 2M0CA 2ECCA 1IG7A 3HOYJ 4FCYA 3IH4A 2K40A 5EGOA 4FTHA 1H89C 1U8BA 3NAUA 1OCPA 1I6HJ 4D5FA 2H1KA 1I3QJ 3LSGA 5K7ZA 5M5XJ 5F04A 2O9LA 1ZKGA 1QVUA 3BT9A 4DW6A 1NK3P 1IJWC 2HDDA 4BY7J 2TCTA 3G1OA 1AKHA 1G2HA 4A69C 1TWHJ 2XPUA 2HXOA 3S2HJ 1SFOJ 2GBYA 5J1UA 2HYJA 2DMQA 2LY9A 3ZQHA 4DYQA 4C2MJ 1T56A 2ELKA 4JX5A 3OOUA 4M3FA 2NS8A 2DA7A 1FJLA 4BXXJ 1GUUA 2CUFA 5FLVA 1MH3A 3FISA 2Y0SN 1JGGA 3Q0WA 2ME6A 2JA5J 1ITYA 2DA1A 1WPKA 2HOTA 2OF7A 1X2MA 1JTYA 4XIDA 4MLOA 2E2IJ 1OJLA 1TC3C 2B63J 2DA4A 2LTPA 2AO9A 3I4NJ 1MSEC 4Y52J 2X9DA 2MSYA 2VKVA 1F43A 1UHSA 1ETYA 1XS9A 2X48A 2LD5A 3ZQIA 1Y1VJ 2CUEA 2XGEA 1TWFJ 2DN0A 4D7MA 3BTJA 1X58A 2DA2A 2JA8J 3S1MJ 2WV1A 5DS9A 5E3OA 3O8HA 5E3MA 3PO2J 3A01A 2NVQJ 3HOWJ 2GM4A 2E2JJ 1ZK8A 1JJ6C 5C4JJ 3HBLA 5EG0B 1MBHA 1NTCA 3CQZJ 4EEFG 2LKXA 3G1LA 4W97A 2L7FP 1PUFB 1JUPA 3K2AA 5EDNA 3IH2A 3BQYA 3S15J 4M3BA 2VPRA 3SJMA 4AUXA 1QRYA 1WGXA 2W48A 3OSFA 4W1UA 2P81A 1D5YA 4A3FJ 2JA6J 2QCOA 3S1NJ 5EZGA 2JWTA 3NARA 2R0QC 4A3LJ 1WCMJ 1BW6A 1JUSA 5IOYA 1JKRC 2Y30A 3JRAA 1ETQA 2MW8A 1ZGWA 4DZPA 1IDYA 4JX4A 4AYBN 2R7ZJ 3TW7A 4S0HB 4C3IJ 3UKGA 4RDUA 4NDLA 3A02A 5K7FA 1ETOA 1H88C 3LNQA 4MO7A 2FJ1A 2R5ZB 3ZQCA 1MBJA 2VUMJ 4Y7NJ 1GVDA 2TRTA 3BTCA 4XK4A 5C44J 3GTQJ 4BKXA 1JJ8C 2WAQN 1ETKA 5GPAA 1ZTRA 3BG5A 3W6VA 2MG4A 3GBGA 3LSJA 1A6IA 2E1OA 3QPSA 5GP9A 4DYRA 3LOCA 1Q1VA 2E19A 2ID3A 4XRMA 2DMTA 2XB0X 3I4MJ 2Y9ZA 4M3GA 3GTLJ 5C4XJ 4A3EJ 2WB1N 5J1RA 1H8AC 1FEXA 2L0KA 4M3DA 2JN6A 1ENHA 3B6AA 5EGOB 3ZQGA 1HLVA 4JYKA 2Y2ZA 5IP6A 4CYCA 1BJZA 3S2DJ 3ZQFA 1B72A 4IEJA 2FD5A 5E3NA 3GTMJ 1TWGJ 1OCTC 2LFBA 5J3LA 2HOSA 2LLKA 3S1RJ 1HF0A 1AU7A 3HOVJ 3RKQA 1SANA 2MGQA 1E3OC 1Y1WJ 3H0GJ 4A3KJ 3HOXJ 1AKHB 1X2NA 1IDZA 2HQ5A 3BR2A 4V2FA 1MBKA 1R9TJ 3M4OJ 4DZJA 2YUSA 1I50J 2K9QA 1JT0A 5C3EJ 5IYCJ 4D5CA 1JKOC 4A93J 2M2EA 4G12A 1FIAA 3OIOA
chains in the Genus database with same CATH superfamily
4IHSA 3ZCOA 4EV0A 1CQTA 3FK7A 1Z0XA 1TZLA 1LB2A 1WJDA 1CF7A 1ZLJA 2BGCA 2LKPA 3OYNA 3CC2I 3C2GA 2A5YB 4J19A 5F27A 2BHZA 3ZMUA 3V7RA 3JRBA 1XTAA 3OIPA 1EH7A 3EPZA 3BC8A 4E7IA 1R23A 1W7PD 3IRQA 3RKYA 3RKXA 4RA2A 4XL9A 4A3MJ 2XGCA 1YJWI 2X6OA 3DEEA 2DMUA 3JSOA 1HCRA 5HS8A 3KYCB 2IXSA 2O0YA 3WTYC 1LFBA 2LREA 3M7GA 3F3XA 1LFUP 2XGDA 1YOVB 1VI0A 3DP7A 2EA2A 2CFOA 1FOWA 2XAGA 3K4MA 3OYEA 5K5OA 2IA2A 2ZSIB 1X4OA 4FE4A 3OS2A 5FKOA 2M9HA 3GTPJ 4PCQA 2OC6A 2O6GE 5DEQA 1TW3A 2CO5A 4CZCA 1ODDA 3QP6A 5ICGA 2QQAA 1NK2P 3LSHA 2HTJA 1EH6A 2LDUA 1PDNC 1XG1A 3CCUI 3KP2A 2XSDC 2VQCA 2KQRA 3IRRA 1O7LA 1XC5A 5DM6F 3J80K 2ME0A 3PUBA 3TGNA 4RS8A 4UV8A 1M1EB 2IS2A 1GXPA 4NBQA 4D9JA 3BJOA 2OAZA 2W7NA 1ZQ3P 4B8XA 1BC8C 2JJ7A 2VKEA 1I39A 2RQQA 4UUSA 4EM1A 4S04A 3WG9A 3FF5A 4FX0A 2DTZA 2ZSHB 4F52A 1SVMA 2M5WA 3AG2H 2QQ9A 3GUDA 4GYGA 5J1YA 4II2A 4A6DA 2QUFA 3DKYA 2DOFA 2BXZA 2WTEA 2P6SA 5F64A 3FMSA 1UHWA 3ZRGA 2ZC2A 2OPTA 5L3BA 4I98B 1T33A 1R49A 3QPTA 2ID6A 4KDPA 5E1XA 1X19A 2LSOA 4LB6B 3N4MA 2CQQA 2RV8A 3SDBA 1XB4A 3AKZA 1YX3A 5TISC 3J7AO 2IBDA 3VODA 1ONVA 2XGXA 3H35A 4BY1J 1WZ2A 1FTTA 2FSWA 1RC9A 2KJCA 3WTSC 3FWEA 3W2AA 2K3PA 3G6EI 1FYKA 4RAFA 3H3VK 2RAEA 2ZFWA 2RVCA 1POGA 1B72B 4OIOF 1WRJA 4L9TA 1APLC 1V4RA 4MFDA 2VN2A 4DBRA 1Z77A 3FKJA 4S05A 2FU4A 2L9RA 4OMYA 3GLXA 3KYLA 1U9NA 3FM5A 3CC4I 4L0YB 1A04A 5D5UB 2YS9A 1JXSA 2KRHA 3A4CA 4LG0A 1ACIA 4KMUX 3DEWA 3DKXA 3GZ5A 1V5FA 1IN8A 2L02A 5HVQC 3FKIJ 2GZWA 2KMUA 5FFXA 3K2ZA 4IRIA 3W2WA 2VJ4A 4E7JA 2DODA 1MGTA 4ESBA 3SZTA 1CF7B 2OD5A 1G59A 2OTLI 2FUG2 3TP0A 3PSIA 2FNPA 3K7AJ 4WF2A 2NNYA 3V7CA 5E18F 1U8RA 4MEYF 2QBYA 3NEUA 3WODF 2CSOA 1ORKA 3AL0B 4WX9A 2J5OA 2NXNB 1J75A 1QPMA 3JW4A 4I7HA 2OU2A 4LK0F 4BQQA 4U7BA 4A3JJ 1ETVA 1G3YA 1USTA 3PQKA 4OU0A 1Y8QB 4RM2A 3T8TA 3S17J 1I27A 3D5SC 3W2VA 2HGCA 3BR1A 1HDPA 3ABUA 2PFBA 1U9OA 4BEHA 2KDOA 1OISA 4PJJA 2DJNA 2XASA 4HX8A 2HYGD 4BBRJ 1WH5A 3G1MA 4U0YA 3KIOA 1ZLKA 4XMYA 4PK4A 1C0WA 5FKMA 3LSRA 3H5NA 4BYYA 1MKMA 1BI0A 5LLQA 3CLOA 4M71A 4Q47A 4XICA 5CKTA 1IN5A 1PUFA 4PFPA 1HDDC 2LMDA 2K02A 4A3CJ 3QP5A 2ELHA 4I99C 1EF4A 3G71I 4OAYA 4R1HA 5LRSA 1YHQI 3BROA 4I0AA 3P7NA 2KT0A 3V8KA 2M1BA 4XLHA 1J2XA 2IGNA 4HPQA 4IVNA 1V5GA 3E6BA 5E1WA 4AIHA 1O4XA 4UUSB 4IJAA 3U9GA 3GF2A 5DD8A 3CLQA 3GX4X 2QQBA 5LBQA 3BCBA 3HKZN 3EYIA 4P55A 2L01A 3S3MA 4G7ZF 2UV1A 2R5ZA 2HPIA 4FISA 2XV4S 1ZH5A 4IPAA 2R7RA 4ZYGA 3DV8A 3RQIA 2G7UA 2CGPA 5FKLA 2W57A 3DTEA 3U21A 4RAZA 3LA2A 4B09A 2IA1A 4D7NA 1S7OA 3VDXA 2CMPA 3F8CA 1FOXA 2XC7A 3MKZA 2X6XA 1BW5A 1SMTA 4MIMA 4XRSA 2K3FA 3M8JA 1IRGA 3Q0UA 2E7XA 2OZ6A 2L2OA 3KP6A 2HOAA 4WXDA 2QM3A 3CJTB 1S9HA 1W5TA 4C9YA 4EM2A 4QTRA 4RBOA 2M0CA 2ECCA 1KA8A 1LVKA 3CCJI 3HUGA 3CP2A 2QA4I 1F4KA 3DBRB 3Q5FA 4J00A 2H1KA 3HTSB 4LG3A 1VQKI 3LSGA 5K7ZA 5EEGA 4OIPF 4Y3OA 1ZKGA 2PMZA 4DW6A 2RGVA 1NK3P 4FT8A 1X1DA 2M8EA 2R7OA 4MHGA 3ZPLA 1HKSA 4LG0B 1BBYA 2GA1A 2QGUA 1RUOA 1W36C 1SFOJ 2CQ7A 4A0ZA 1U5TC 2M4GA 2VBWA 3ZQHA 4DYQA 4JX5A 2OJED 3I9V2 1FYMA 2DYSH 2IJLA 2PI0A 4C2TA 4IRGA 3FXOA 3WTVC 2DA7A 3ERED 5L3EA 2F4OB 1P92A 4YFKF 4HG2A 3BZCA 4BHBA 4HSRA 1TT0A 2QBYB 2DA1A 2DYRH 4KUMA 1K7AA 2HOTA 2OF7A 3CJRB 1OJLA 4BU2A 2LTPA 3HHHA 3CO7C 3GEZA 2X9DA 3DU5A 3FBIB 1H9TA 2MSYA 2IGMA 5D4RA 2W82A 1ETYA 4GCVA 1XS9A 2QKMB 2LF7A 3EDPA 1YQAA 4NC7A 5HNHA 2ZXJA 2W84A 2VBYA 3IC7A 3K10A 4IQJA 2DN0A 3O2PE 4D7MA 1SAXA 3V7SA 2JSPA 3I4PA 4XBFA 5DS9A 3AG3H 3A01A 3VYSB 2ZJPF 4BDZA 2GM4A 3K4BA 2E2JJ 4A6EA 2HPMA 5KK1A 3I54A 2GWRA 4CSWA 2FE3A 3WU1B 2Z9OA 3ZR8X 1PUFB 3FXMA 2NAZA 3K2AA 4LLNA 3L00A 1FWZA 4A12A 2HTSA 2WC2A 3ULQB 3F22A 3GO5A 1K79A 2LG4A 4DBQA 1QRYA 1WGXA 2COMA 2VQHA 4II3A 3CCEI 4BE1A 3T5XA 2W00A 3ERMA 4UXNA 2GOMA 2V6CA 5EZGA 2L9NA 2JWTA 3CCSI 4IOAF 2H8WA 4A3LJ 1JUSA 5IOYA 4Y13A 2QVOA 3CF2A 3LA7A 2CS3A 2HNHA 4AYBN 1JHFA 4TV7A 2CV1A 3TW7A 1YW8A 3CCVI 1ZYRF 5FROA 1OR7C 3PSFA 4RDUA 1WVRA 1ZGAA 1QZZA 3DU6A 2KHMA 2M45A 4G7OF 3G2BA 2R5ZB 2R7FA 2QZ8A 3NWSA 3IP4B 5GAHJ 1EKEA 4BKXA 2X1DA 4YIFA 4BHCA 5JHFA 2R7SA 3R4KA 3W6VA 2ICWG 3EUHC 1R5ID 4EJWA 3DBHB 1K78B 2ZXIA 2E1OA 3QPSA 3I53A 5GP9A 4DYRA 3CZ6A 3OS0A 1WJEA 5JHUA 2EFQA 3OYHA 2XB0X 3M8EA 2OA4A 5HLIA 1SAUA 4M3GA 1R5HA 4P1WA 2JZYA 2JUGA 3V8JA 5AONA 4UB8C 3DFGA 2STTA 3WE3A 2MA3A 4M3DA 3B6AA 2HZTA 2Y2ZA 5IP6A 3HUGB 1T8IA 3S2DJ 4BQNA 5LGUA 4CA0A 3KLOA 3AFHA 3TMOA 2BHYA 5E3NA 2MBFA 3A1YA 4U87A 1TWGJ 2H09A 4B47A 1G3TA 5HOOA 2LLKA 2HOSA 3RKQA 1VQOI 1IN6A 3D5LA 1SANA 3KZYA 2XAUA 2QSGX 2IVMA 1Z9CA 3H36A 4A3KJ 3BR2A 4PFOA 1YG2A 3KFWX 4V2FA 3E1SA 3NWTA 3M4OJ 4DZJA 2BYVE 3ISPA 3KE2A 4EGZA 2E7WA 4Q5SF 1TLHB 4YEJA 3OIOA 4ZYHA 2WWYA 1Y6IA 5D5WB 2HOEA 3F6OA 1TT5B 3C3WA 5DD4A 4D0PA 1MNDA 1SD4A 1LE8B 1XMXA 1JI8A 1GLNA 1SD5A 5TRDA 2H94A 3P9CA 1U78A 4XR6A 4FQGA 4MFEA 5JFRA 2DOAA 3GTOJ 1RPWA 2P4WA 3S14J 3PM1A 1JHHA 5FKKA 1VF9A 1Z1DA 3MVPA 2UZKA 2EQRA 1F36A 3PFIA 5H20A 1B8IA 1OCOH 3MFKA 1RI7A 1N25A 2WBMA 4AC0A 3UNGC 3K1PA 2VB6A 3T8RA 4Q4ZF 1XGMA 4X1EA 4IHXA 1FIPA 2MLKA 2FF4A 5K5RA 2DT6A 3BOQA 1YRNB 3ZMZA 3L2RA 1DQUA 3KP5A 4PJMA 1QVTA 4XKCA 1E3HA 2R7QA 1YW7A 4I0BA 3A01B 4P9UA 2CYYA 2RN7A 2M8GX 1BIAA 5CJ9A 1P7IA 3OYMA 3RI4A 3KPHA 2FQ3A 1ZN2A 4B43A 4N9IA 3OL3A 4RB3C 3EYYA 5CVUA 1TWAJ 2V7FA 1ZAOA 1MNEA 3BQZA 4BQOA 2XB5A 4LIUA 4N4OB 4RLFA 4KJZA 1T2KA 2QF7A 4CHUA 1LJ9A 3VYRB 4P9FA 1ETXA 2DAOA 3E97A 3TL4X 4AYBA 3HPGA 3GLLA 3OYBA 2R7TA 2EB7A 4GO1A 2FMLA 4BBSJ 1FT9A 2E1NA 1S3JA 4A3BJ 3KETA 3OOPA 4PGGA 4ENNA 4HW0A 1IV6A 1P6RA 3CC7I 4L0ZB 1TQMA 4XKWA 1BIBA 4QSHA 2K9SA 4IHVA 2GAUA 3IV5A 5B1AH 2OTJI 2EBIA 2V1UA 1MMGA 2H6CA 2JMWA 2A6HF 2E71A 5DCMA 5F1JA 2E34A 2XVCA 2ZJ2A 3JRDA 1GDTA 1S6LA 2AHQA 2XPVA 1FSHA 2VASA 2V4JC 2K9NA 3KLNA 2W1OA 1MSFC 4JOMA 1HQCA 3RZDJ 3OYKA 4HV5A 3F8FA 2X4HA 2K27A 4XN3A 5HODA 1VQ8I 3C2BA 4E7ZA 2MD0A 3ZQLA 2I10A 4OOIA 2O03A 3MN2A 3Q9VA 1V55H 2QENA 3GTJJ 1XDUA 2MC4A 3IHUA 1A36A 4IHYA 2VJJA 4PSWA 2BOLA 3S16J 4KISA 4FHTA 2QQ8A 3Q0VA 3TO7A 3RCOA 2OV7A 4KN4X 3MKLA 1HKQA 1GV5A 2BZTA 1E0EA 2V1DA 4HEA2 1XX5A 4RLQA 1LQ1A 3R61A 2JSCA 1UFMA 2VBXA 3I3LA 3SYTA 1R7JA 1T95A 1PP7U 1RKTA 5GAEJ 3HOSA 4OWRB 4ESFA 4ZH4F 4IHWA 1VQ5I 4HNVA 5L3DA 5IPAA 1ETWA 1W5CC 1I5ZA 4RM3A 3MZHA 4JP0A 3B6CA 3GFLA 3NQOA 2IRFG 3N97A 4KFCA 2JPCA 2WY7Q 4HLXA 2KZVA 1D1AA 2GOXB 1OYIA 3TO6A 5BQTA 4A3GJ 3GTKJ 5B3SH 2FBHA 4I6ZA 1B8IB 3DXJF 3WTZA 2DCEA 4XLEA 3E3VA 4U0VA 5B5EC 4OMZA 3DWLE 2NVYJ 1YO5C 3CUQB 2OBPA 2F2EA 2XRLA 3TEDA 3OL4A 2A3SA 3PIPF 2VC1A 1YIJI 3TW6A 1R1TA 5J47A 4E6KG 1Z6RA 1R4NB 3AL0C 4PJNA 3TDZC 3FIWA 1AHDP 1SMYF 1B9MA 3ML6A 1LPQA 3QQAA 1I1SA 1S7AA 1DP7P 1F9NA 3HM5A 5EG0A 2LBFA 2IS1A 2Q8KA 1DDNA 3HOZJ 2JT1A 5EJCA 4A3IJ 3RZOJ 1PJRA 1Z7UA 4L9NA 5D6EA 2W85A 3CJQB 3JRGA 1F1ZA 1G4DA 1UG0A 3KP3A 4RB0A 1R4MB 2IAIA 2IP2A 3BJAA 3IH3A 4F7ZA 1IRZA 5D8LB 1BL0A 3V4GA 1VQ6I 2WAQA 5D6FA 4MEXF 2UXXA 3REOA 4CCLA 1QNTA 1DU6A 5D5XB 3BR6A 2HU9A 5F0HA 3A0HC 1VTNC 5F08A 3OYDA 3BTLA 1XSDA 5H2FC 1KU3A 3ZXSA 2K4BA 1IC8A 4A0XA 3SFIA 1S29A 4NQWB 3A2KA 2FOWA 2A07F 2EZLA 2XUBA 1TWCJ 5DCMB 2A6EF 2FEZA 1D8JA 1V3FA 3LSPA 5FB2A 3K4KA 4XOTA 3JRCA 1D8KA 1WH7A 1KYWA 2F5VA 2L5QA 3LWFA 2XAQA 1RESA 4XRFA 2PEXA 1ON2A 4XM3A 1DP3A 3ECOA 1VQLI 2IA0A 5M5YJ 5LEJA 1IUYA 3FXKA 2Z33A 1LVAA 2DA3A 4XONA 4XOPA 4ON0A 2A6TA 3HTUA 3WU2C 3L2WA 3DEUA 3KZIC 3SXYA 3HPHA 1T39A 4UUTA 1IG7A 3HOYJ 4M6YA 1K4TA 4RGUA 4HQEA 2KRFA 3VEPA 3H9GA 1N78A 4D5FA 4BHPA 3EQLF 5M5XJ 3N05A 5F04A 3DLAA 3BT9A 4BNCA 3KEYA 1IJWC 2L9SA 5J40A 4BY7J 2TCTA 1G2HA 2I5UA 1O3RA 1R5GA 4XLCA 4KIBA 2VJIA 3S2HJ 4U88A 4KITB 1MW7A 1G6NA 2E35A 1REPC 4M72A 4ZZDA 2ELKA 2GA2A 2XF7A 1ZHFA 3OOUA 3R6SA 3BP8A 3BZ6A 4PSXA 3FXQA 5J8FA 1GUUA 3OR1C 5DUKA 2ZMEA 4HX7A 1BR4A 3BWGA 2VKDA 2Z1DA 1MH3A 2EFNA 3FISA 3FXLA 3SEZA 5J8CA 2Y0SN 3CDHA 3DLLF 2JA5J 3ZMTA 4RAGA 2FBKA 1X2MA 2DQLA 3LSMA 5LEKA 2K86A 3R0AA 2JTVA 2B63J 2MD5A 3H5AA 1UAAA 2AO9A 3FHZA 2IS6A 1YS7A 1RIOH 3I55I 3PQJA 1YIOA 2VKVA 2VOOA 4PUSA 4WXHA 1UHSA 2VIXA 4XN0A 2Y0MA 5ILSA 1IV8A 3K70C 2HVRA 4IO9F 2CUEA 1YFHA 1TBXA 3VWBA 3BTJA 4N4NB 3PNTA 2NVQJ 3KEOA 4NC6A 3HOWJ 4LFUA 1YS6A 2DDBA 5ILUA 4IL6C 3RPUD 3TBIA 5JVTA 2LBFB 5EG0B 3OS1A 2XRNA 1WFXA 1WI9A 3CQZJ 3G1LA 3H92A 2L7FP 3MKWB 1MJ9A 3H9QA 4B3XA 2HKOA 2PLYA 1QA6A 2VPRA 1SVLA 2P5VA 1Y8RB 3FBNB 2W4SA 1R71A 1S5LC 2EFPA 2W48A 5L3FA 1ZARA 2P81A 1D5YA 3PJRA 2M30A 1ZRDA 1AA7A 1SVOA 2JA6J 3S1NJ 3G73A 2Q1ZB 1LEBA 1K6YA 1GHCA 3QYFA 3QRFF 1BW6A 2L7KA 3DPTA 4H4KC 1ZGWA 2DPDA 4DZPA 4JQFA 5LFAA 2R7ZJ 5HS9A 1QBJA 1D0YA 4C3IJ 5FD5A 3A02A 1ETOA 1BC7C 3K1MA 4MO7A 3T0YA 3BCAA 1MBJA 4D1QA 5J4VA 5AIQA 1K78A 4ZJZA 1JJ8C 1A35A 3PUFA 1LNWA 1ZTRA 3H9JA 5B1BH 1FMWA 3KCCA 5HLTA 1IAWA 1PP8F 2MG4A 1VQMI 2HQNA 1BN5A 5A2QZ 1SD6A 1A6IA 3FM3A 4E7HA 3CMAI 2CQKA 5GTHC 4JBAA 2CFXA 3MD2A 1B1BA 1W7PA 1OKRA 2Y9ZA 3FHNA 4RB2C 3F8MA 1FEXA 2WB1N 3KX2A 1HSTA 1TW2A 5K1YA 3ZQGA 4A5NA 2VT2A 1HLVA 4IXAA 4CYCA 3G4SI 1IF1A 4IEJA 4BACA 1BOAA 3VSKA 4ZDLA 2F4MB 1W1WE 2M7BA 1KU7A 1EH8A 1OCTC 3RYRA 3OY9A 3QAHA 2PJRA 2A61A 4DNCA 4HX4A 2MGQA 2DFHA 4MTEA 3MAJA 2KIMA 2E60A 2DU9A 3SZPA 4Y17A 2EV6A 3FXJA 2YUSA 1HC8A 1I50J 1WJCA 2K9QA 1JT0A 5C3EJ 1BJAA 4A93J 2M2EA 4LIVA 1LE8A 2JA7J 1FIAA 2VXZA 3HRTA 3IUOA 3HEFA 2M4KA 4FX4A 2ZMEB 3ABMH 3WU0A 2DMNA 4ZC3A 1B59A 4CO8A 4HA8A 1QHHD 1WHUA 3CUOA 2FXAA 2E5NA 2IW5A 3M3YJ 4E7KA 3C1DA 3K69A 4ITVA 3U1KA 1DPUA 2GIVA 1XMKA 3I71A 1VFCA 1HW1A 5M5WJ 1YRNA 2L4AA 4M6VA 5LHGA 5LGTA 4PGHA 4CCJA 2PG4A 3FK6A 5ED4A 3DBLB 3F6VA 4O5VA 1YX5A 4YIIA 3H0DA 1SD7A 2LY1A 3JRFA 2F5EA 5AIPA 2KKOA 1WI3A 2EIMH 2MABA 2E36A 1ULYA 3HG9A 1Z05A 3WGIA 3OIQA 1FPQA 2FQ4A 5HDGA 4B1RA 3GMEA 5JR3A 3CCYA 2R5YB 1FTZA 2LVSA 2PN6A 3I56I 2A68F 2R93J 1DUXC 3L2UA 3HYIA 3HGYA 2Q2EB 3DQVC 1YI2I 1Y39A 5K5QA 4EJVA 1ZG5A 2DDAA 4ZYDA 3PNYA 1DU0A 4RGSA 1QZYA 2EZHA 3HKZA 1JTXA 4HZFA 4UVCA 2DBBA 4F55A 4DIQA 3QU3A 3H1CA 4N0BA 3LQQA 2E1MB 3FMQA 1WSUA 2YU3A 3HOTA 2DW4A 5CQGA 5HLGA 3J7ZI 3CTAA 1J09A 4FASD 1AWCA 2RREA 2VPLA 1IRXA 5FD6A 2DMPA 3ASOH 4MTDA 5A2QK 3QPLA 2LH9A 4YELA 2HVSA 4L9JA 1O3TA 2LP0A 2P0WA 1J7KA 3BR3A 3QYBA 3MWMA 3C7JA 2L54A 2WV0A 3HIFA 2LYCA 4R8HA 5M3FJ 3S1QJ 5DTDA 1B4AA 5GPCA 1GV2A 1GT0C 4KICA 4CZZA 5FLXZ 3GTGJ 2E2HJ 2PMUA 4I76A 1DGRM 1IN7A 5TJJA 3CMYA 3V8LA 2FNAA 2C6YA 2O7OA 1OLTA 2GQQA 1SFKA 3ABKH 2NVTJ 3BJ6A 4AM3A 3L1PA 2ZJRF 4E70A 1W7PB 3HDDA 1I3AA 3COAC 4AIJA 3K9TA 1RETA 3JRIA 3F8BA 3MKYB 3L2CA 3JRHA 3AAFA 2GXBA 1VNDA 1Z21A 2OQGA 5H6QA 3RYPA 4LGWA 1XGOA 1RRJA 4AD9A 4CYCB 1TTYA 3J81Z 3PNVA 1KQ9A 4F93B 3WE2A 4AU7A 5EEAA 3DTKA 4ZDOA 4IOCF 2D45A 1B6AA 4HF0A 5HDNA 2PJRB 3CP8A 1ZRFA 2BY0A 2F48A 2K5CA 3E5UA 4ENMA 2CWEA 1W0TA 2H8RA 3TOAA 9ANTA 3RPUA 2WADA 3K4CA 4I2OA 3I0TA 3TQNA 2A05A 1VQ4I 1U0JA 2JQ7A 4RB1A 2IGOA 4LITA 2P5LC 1LFPA 2X51A 5FKNA 5CLSA 3FMRA 5D4SA 2VODA 5H6RA 4HLYA 1X4PA 2CU7A 2Z5UA 3GVAA 5CVIA 2Y31A 3VPRA 1BA5A 1O3QA 1VQPI 3PFYA 1ZR2A 1Z6TA 3ZMDA 2D5VA 4KIGA 3RSNA 4FETA 3CF5F 4GFBA 3ABLH 1MMSA 1Y56A 3HSEA 3QPHA 4HF2A 4PJLA 4HYEA 2EV5A 3F72A 2DK5A 4WCGA 2PQ8A 2NVXJ 3CO6C 1BR1A 2J5PA 3CUQA 2AQFA 3QOPA 3BG3A 4H0EA 4UVBA 2ZBKA 2D1HA 3F23A 1NG7A 1JGSA 3LL7A 5LRRA 4L5IA 3AG1H 1ZR4A 3OYCA 4HQMA 4GXOA 2CRGA 2XSJC 2PX9A 2XF5A 5FLMJ 4L5EA 3LAJA 4PJ0C 3SZGA 5CYVA 1OYWA 4YIRX 4C3HJ 1RKWA 1PYVA 1QGPA 2P8TA 3DF8A 3L2VA 3HL2A 2R4GA 2WA0A 3X2QH 1KU9A 1KYZA 5KNLA 6PAXA 4LB5A 1UZCA 1BI1A 2DFFA 5IYDJ 2NS0A 3ELKA 4IF4A 3CUQC 2FX0A 3D0SA 3BZKA 2ACJA 1RNLA 2XROA 2WY8Q 1FP2A 4IQ4A 1IN4A 3BPVA 2G7HA 4FE7A 2IT0A 1PVEA 4JX6A 5EZHA 4XLPF 3CCMI 4ZYEA 1YE9A 2LK2A 1L3LA 2X1CA 1AOYA 3J7YJ 5FLXK 3K4NA 3TP3A 1IW7F 2STWA 1XGSA 1Z3YA 1I1GA 2ECBA 3P9KA 4HNTA 2YX4A 4O3MA 4XKVA 5E3LA 1O57A 3BR0A 3L9FA 3H5RA 4LLGF 4NQWA 4ESJA 2KIFA 4YFNF 1W0UA 1D0XA 4XORA 5F0CA 3W6JB 4E7LA 4EJOA 4BAYA 1IGNA 1S7EA 3K4JA 3Q3SA 3F0CA 2E5ZA 4CDGA 2F4IA 4XLFA 1XN7A 4CUGA 2EFOA 4CYDA 2QSHX 3A03A 4A3DJ 2ZXWH 2VL8A 1FX7A 5D8KB 2UUZA 2RNJA 1JKQC 4OIQF 2EIJH 3F9KA 3J81K 3JREA 3S3OA 3KP4A 4X0GA 1Y0NA 2BEOA 4GRIA 3WTUC 4HDVA 1UG2A 1K61A 2RC4A 5DYMA 1T0FA 2V6EA 5E1ZB 1MMDA 1TQPA 5E17F 1A6QA 2LNBA 5F6FA 1T38A 1TL8A 3DCFA 2BW3A 2KISA 3CDLA 2LF8A 3IH4A 2K40A 3W3CA 4FCYA 4FTHA 1UJ8A 1U8BA 3NAUA 4UV9A 1I6HJ 3VOEA 2UWMA 4BJTA 2L9VA 2FBIA 2XKOA 3GFMA 3RJPA 5FGMA 4B48A 2R7DA 1VQNI 1BR2A 1FBUA 2X6YA 3FZVA 3QWLA 1EV7A 3PL8A 3OYFA 2HQAA 2P6TA 2OZUA 1QVUA 2RNGA 1QQIA 2HFHA 1O3SA 3G1OA 5LHIA 5CQEA 4A69C 1T0FC 3LSIA 1X3WB 3AG4H 2GBYA 2W24A 5J1UA 3GZNB 4AIKA 1VQ9I 4CGZA 2MYSA 5JI6A 4YRVA 2MH2A 1SEUA 2XDVA 1U2WA 1XMAA 2NS8A 3BPXA 1QHGA 3BG6A 3FDYA 3E0JB 5KVRA 4BE0A 1FJLA 4IRHA 2CUFA 3TO9A 5FLVA 4M9ZA 3GXOA 3OYGA 1R58A 1O7FA 2V1XA 1JGGA 3Q0WA 2ME6A 2F5DA 1ITYA 1MMNA 1FYLA 2V26A 2GXAA 2JUCA 4MLOA 2E2IJ 2BY1A 1J59A 5DV5A 1JE8A 3B02A 1XCBA 4Y52J 1MSEC 5JVGF 3WG7H 1D3YA 1EA3A 1W36D 1X3ZB 1QO0D 1RR8C 1FOKA 4Q48A 2LD5A 1VQ7I 1Y1VJ 2XGEA 3HZJA 1TWFJ 3KP7A 3GW2A 5BS6A 2MLGA 2JA8J 3S1MJ 2WV1A 1LDKB 2VT3A 4RMNA 1S8NA 1X1CA 3K6GA 3O8HA 3HSRA 3SFZA 1P9QC 5E3MA 3G3ZA 4E4HA 2DPUA 1YJNI 4Z6YA 4EJTA 3SHFA 1KZHA 1ZK8A 5C4JJ 2EJRA 1MBHA 1NTCA 4EEFG 2LKXA 3ZN0A 4UY8I 2K9MA 1JUPA 1TNTA 4EQQA 5EDNA 3ZQ7A 4M9SA 2QLZA 3S15J 3QYEA 3E6MA 5KAFC 4BDYA 3J7AY 2M87A 4LK1F 4W1UA 3HRSA 1HA8A 2FRHA 1RUNA 2VQLA 1SC7A 4G6QA 3M1EA 2IGKA 2QCOA 2WAFA 4A2UA 3EETA 4ENJA 1R1UA 4Z2YA 4BGDA 2VE8A 2V9PA 3LSKA 3RKWA 5E3OA 2R0QC 2F5FA 1BOBA 1G3WA 2Y30A 3JRAA 4IKFA 1ETQA 2MW8A 1T98A 1IDYA 4JX4A 1DPRA 4EATA 1MJAA 1USSA 2X1EA 4S0HB 5HLHA 1OCRH 1FNNA 2KZGA 1QU3A 3S32A 5IT3A 2XAHA 4NDLA 2Y48A 4E7SA 2OCEA 5K7FA 5ILVA 1H88C 3RQ4A 3LNQA 2FJ1A 3JAMZ 4EMSA 3ONQA 1XDSA 3GZ6A 2VUMJ 4Y7NJ 1GVDA 3BTCA 4MQ9F 4XK4A 5C44J 1R1VA 2A69F 3QOEA 4A5MA 3E5QA 3OYLA 3I59A 1XPXA 5GPAA 3BG5A 3QODA 4HNUA 2OUMA 2ESHA 2BV6A 2H27A 3GBGA 4YFXF 4QWQA 3LSJA 3P5JA 4F91B 2OCCH 3ABTA 1R00A 2LY2A 3E6DA 3ZQQA 5LHHA 1Q1VA 4ANJA 2ID3A 5HS7A 4L18B 2DMTA 2NYXA 1UCRA 2QSFX 3WGGA 2PMHA 2OQRA 4NHJA 2M0MA 1XCVA 3GTLJ 4A3EJ 5J1RA 1YITI 4BE2A 1H8AC 3KZZA 1LDDA 2BW3B 2JN6A 3IAM2 2F6CA 4BJ5C 1N77A 1V5EA 4XNFA 1KQ0A 4RAYA 3L7WA 3ZQFA 2QEXI 1ZREA 3M1CA 2EFWA 2P7CB 3B73A 2EINH 3LA3A 2CV0A 2NNNA 4HRIA 5J4YA 3GTMJ 2YR2A 3RDIA 2LFBA 1LKXA 3S1RJ 4LJZF 1AU7A 1P4XA 4XSZF 3H3UA 2FMYA 1FBSA 2AS5F 1Y1WJ 3H0GJ 3HOXJ 3RIRA 1XSXA 3CD6I 3LMMA 1R9TJ 3VFZA 4UHTA 5J6XA 1ZG3A 2CUJA 1NHAA 1XD7A 3S8PA 5DCFA 1BM9A 4D5CA 2HZDA 2Z99A 5ERIA 1FLIA 3LAPA 5BNGA 2DOEA 1MH4A 3S93A 5IP7J 1SFUA 2EWNA 4G7HF 2X0LA 4V2GA 1OFCX 2PMZN 2IPQX 1TQIA 1B9NA 2GIZA 2K7LA 4DQ2A 4CCOA 5EEHA 3HOUJ 2Z2SB 1YLFA 2EZIA 5EYRA 2EK5A 1D1BA 5IYBJ 4C30A 2L7MP 1I6XA 3FXRA 4M9XA 1IRFA 2E1CA 1X1AA 4Y33A 1U6GA 3BY6A 2TDXA 2XPWA 3LQRA 4L5JA 2Y9YA 4ZZLA 3BG9A 2R7VA 3SDGA 4DOZA 1ZGJA 2ZMEC 1GXQA 3LFKA 4BH9A 4ASNA 2IEKA 2D1VA 2EA4A 3DPLC 2R5YA 5CVRA 2JRMA 4G8XA 3JR9A 1BI2A 3BDDA 1UB9A 4G94A 4I09A 2Q2EA 3GWZA 3BLYA 1QPIA 2XAJA 1MD0A 5E20A 1HOMA 1MBGA 3O8GA 2ZNYA 3VB2A 2L4MA 1MDMA 4WK8F 1FOYA 3V42A 3WTTC 4CCKA 3KYDB 1U3EM 2DK8A 4MQVA 2VOPA 2JPBA 2XF6A 5FO5A 3NRVA 4WWCA 4UVAA 2KP6A 5CVJA 1J9IA 3JAMK 4I01A 4LOCA 1Q1HA 3WGHA 3JTGA 4GDFA 4QLCU 2LC2A 2NS7A 3CMMA 3HHGA 2ZO4A 2ZFUA 2G0EA 3M9AA 4M73A 3WHCA 2R3SA 2R92J 4B44A 1R36A 3U1DA 2ADUA 5EF6A 2ETHA 5L3CA 2M34A 1IZ1A 1P2FA 3UR3C 3K1NA 3MQ0A 2HI3A 4L9VA 3R0JA 4QPOA 5BMZA 3S3NA 1STZA 1UMQA 1K83J 2E1MC 3IAS2 2KL4A 4HF1A 1RR7A 1WWXA 3I59B 2JA2A 2NOGA 2KDZA 2AXTC 1W4MA 1IXSB 2CW0F 2HXIA 1HKTA 4ABZA 1Y0UA 2BVLA 1Z91A 1MIJA 2MH9A 2XHKA 3ZMVA 2YPRA 3DPUA 4M3EA 5IP9J 2HYFA 2JVGA 4BS9A 2Y69H 4M74A 1W5SA 5ICEA 4NB5A 4A0YA 4ENKA 2YU9J 1OYYA 5L3GA 2EPFA 2VKHA 1G3SA 1YTYA 1JKPC 5GAGJ 1ON1A 2Z16A 3OYJA 2VLAA 1UELB 5CPRB 1CGPA 3ROUA 1NG6A 2VJ5A 2DA5A 4U7DA 4EVIA 2CH0A 3TOBA 4YG2F 4PZJA 1U5TA 3O3KA 1OCZH 4HOBA 2CW8A 5F0FA 2X6WA 3HSFA 2ZJQF 3HGGA 2MFZA 4B3AA 1IXCA 4XSXF 2DFEA 2ZB9A 2EIKH 2V79A 3D5RC 3EUKL 4RGRA 1HSJA 2X85A 2Y0SA 2I8DA 1YW9A 3BTIA 1HBXG 3MEXA 3WHBA 4R79A 3I5UA 1JUMA 4X6AJ 2B0LA 5ICFA 3OSGA 2EH3A 3M8FA 2O3FA 1GVJA 2YSRA 4O6JA 1QZEA 2MC3A 2BY2A 2EZKA 3VYTB 1MBEA 4CICA 1KGSA 1E3PA 4M6XA 3DKWA 4XQFA 2HDWA 2NVUB 4F3QA 1SFEA 5JLXA 1IUFA 3HRUA 2DO7A 4P96A 3E7LA 4LMYA 3L2QA 4XRSG 2CV2A 2DXIA 2HWVA 4G6TB 2ZCWA 1BI3A 2RKHA 2KPMA 5FFZA 5TGTA 1F5TA 5M3MJ 1IXRC 3IWFA 4NNJA 1VZ0A 1TNSA 3T1BA 4KIFA 4Y4RA 3PO3J 1YYVA 2RDPA 1JT6A 3K4LA 1OQYA 3D1NI 3OMYA 2CJJA 1PUEE 4XLAA 2CQXA 3PIOF 1P4AA 2K85A 2VI6A 2KJBA 2COBA 3HB9A 5HNFA 5K7HA 2W25A 2LKSA 3ZOBA 3S2WA 1K4SA 1MBFA 2CQNA 1YJ9I 3FXUA 4BEHB 4GGGA 1J0RA 2ESNA 3FX3A 4CXFA 2O8KA 4BQAA 5DUIA 3C18A 2FOKA 4DYCA 2ISYA 3MMYB 1N75A 3TDUC 2HEOA 4KYWA 5FJ8J 3BR5A 4DGWB 2V9KA 4QPQA 4MNUA 2Z3YA 3BG7A 2VC0A 1MDMB 4KNYA 2VONA 3CDIA 3TKYA 2GLOA 4CCMA 2ELJA 2N8GA 2L3DA 1D1CA 5F1RA 3P9IA 1OR7A 1P7JA 2DA6A 3ZMSA 1X1BA 2DT5A 5IOZA 1FZPB 5BOXA 1FP1D 4QIWN 4J01A 3KEQA 5BPIA 4CH7A 1LUJB 4OAZA 4IX7A 2DQRA 1R22A 4G6DA 5B66C 4P5OA 3EUHA 2CW7A 2QWWA 1A5JA 4U0WA 2IS4A 4LLLA 4MGRA 5ICCA 3GYHX 1D5VA 1P4WA 2HKXA 2BE5F 1R6RA 3IKVA 1ZRCA 1UHMA 2PBIA 2WB1A 2HQRA 3LSTA 4B4CA 2LR8A 3I64A 2BBYA 1KU2A 2B7EA 2L7ZA 2NRAC 5JLWA 2JK3A 3VSLA 5FRMA 2ZKZA 5HDKA 2A5WA 1S72I 1NH3A 4NC8A 2KRCA 1FMVA 1D0ZA 2NOJB 3HC7A 1WJBA 1MNMC 1H9GA 2VE9A 4C3JJ 3JCUC 1LEAA 4BXFA 4GYIA 2VQGA 3CESA 1LDJA 1FY7A 2KIQA 4KN7X 4ZTJA 4Y15A 3GFIA 3GCMA 2B9SA 5EGOA 1H89C 1KQ8A 1OCPA 3JSPA 4JK1X 1U5TB 3MCZA 4XLNF 4AWXB 5IY5H 3ZN1A 2O5RA 3QU6A 3ZGKA 5DDGA 4N9HA 1I3QJ 2DJIA 1L0OC 2O9LA 1H0MA 2KIUA 3IWZA 2R7WA 2HDDA 1AKHA 5LD2C 1FC3A 1TWHJ 1WQ2A 2XPUA 4OIRF 4KA4A 3DTIA 2HXOA 2LOOA 5E8IA 2DI3A 4UNOA 1XGNA 2HYJA 2DMQA 2BY3A 3OYIA 2LY9A 2RQPA 3LFUA 4C2MJ 2JVHA 1T56A 4F92B 4DJAA 2AQEA 5IT9Z 3W6KB 4M3FA 2UXNA 4AIDA 4CCNA 4BXXJ 3A0BC 3ECHA 4BXUA 1WJFA 3ESWB 2EILH 1X3UA 1FSEA 5KHDA 1FBQA 2Q0OA 3VYUB 3F8NA 1ERDA 3OYAA 1WPKA 4HDUA 3CCRI 2VBZA 1JTYA 3HJEA 4LD5A 4XIDA 2V9VA 1TC3C 2YX7A 2DA4A 2EV0A 2R7XA 2K4JA 3I4NJ 4HAMA 3F21A 1XSVA 3SEQA 5LGNA 1F43A 1MZBA 3K0LA 3OWTA 1V54H 2FA5A 2X48A 3ZQIA 3HRMA 3M07A 1TP4A 3C2HA 4EM0B 2WAEA 1X58A 2P7VB 4KT6A 2DA2A 3CJNA 2ZXHA 2CG4A 4OINF 4ZDPA 3PO2J 3MZ8A 1K6OA 2JRTA 2XIGA 1JJ6C 5E79C 3HBLA 4XKBA 5D5VB 1OMIA 4ZTFA 4W97A 5GTIC 3E6CC 2XAFA 1WKMA 3Q9SA 3OV8A 3RPQA 2H1LA 5KCMA 3ASNH 5BPDA 1MMAA 2HR3A 4UB6C 4ETSA 3IH2A 3BQYA 2G9WA 4M3BA 3MZYA 5CVVA 3IL2A 3SJMA 1SFXA 1T6SA 4AUXA 3IKTA 1WJAA 3CCQI 2GXGA 3K70D 3OSFA 4IZZA 1KONA 2V1NA 1J5YA 1ZG1A 3CMEI 3OR2C 4A3FJ 4UUVA 1ZELA 2P5KA 1T08B 2H6BA 2O8XA 3NARA 1WCMJ 5GADJ 4G9YA 5E8GA 1JKRC 2DFIA 4BL0B 2HDCA 1DGWY 3WTWC 4KMFA 2HS5A 4HBLA 1EJ9A 3UKGA 2LRDA 4EGYA 2CUZA 3SQNA 3E5XA 3R60A 3J80Z 3ZQCA 3GTQJ 2TRTA 3H3ZA 2WAQN 1ETKA 2DTRA 1IO2A 4K2EA 1G8XA 5KAIC 2D2WA 1OCCH 3O6BB 4IHTA 1OPCA 2AXLA 4NUBA 1E2XA 3ZP5A 4I02A 3LOCA 4RGXA 3RTRA 2E19A 2M3AA 4XRMA 5FRNA 3GFJA 3I4MJ 2K9LA 4WXCA 5C4XJ 4AVPA 2BXYA 2QYOA 1Z7LA 4KT5C 2L0KA 2O61A 3CCLI 1ENHA 4HSTA 2HVQA 1Z67A 5EGOB 2ZNZA 3EUAA 1HW2A 1A31A 4JYKA 1BJZA 3JTHA 1B72A 3L09A 2FD5A 1HW5A 2VXDA 5J3LA 2QKLB 5IT9K 2Y75A 2DLLA 2KFDA 3WTXC 1HF0A 3HOVJ 2DT7B 2M7AA 2KLOA 2R7UA 4AVZA 4EJUA 1E3OC 4HV6A 4BJ6C 1X1PA 1IDZA 4PDKA 1AKHB 1X2NA 2XKPA 2HQ5A 3I58A 1Z3XA 1MBKA 4BUPA 4C2UA 2ISZA 1E17A 1RZ4A 2PJPA 1HXDA 5IYCJ 3U2RA 4ZYAA 3HXLA 1JKOC 2BVMA 1WJ5A 4V19K 4G12A 5DM7F 1MJBA 2F5CA
chains in the Genus database with same CATH topology
5BNGA 1MH4A 1CQTA 3HEFA 3FK7A 5IP7J 1Z0XA 1LE8B 4V2GA 1OFCX 4J19A 2PMZN 2DMNA 5F27A 1U78A 4MFEA 3JRBA 3GTOJ 1RPWA 3HOUJ 3M3YJ 3S14J 3PM1A 2EZIA 5EYRA 5FKKA 1VF9A 3MVPA 5IYBJ 2EQRA 1F36A 2L7MP 1VFCA 1B8IA 5M5WJ 1YRNA 4M6VA 4AC0A 4A3MJ 2XGCA 3FK6A 2XPWA 2Y9YA 4X1EA 4IHXA 1FIPA 2X6OA 3BG9A 3SDGA 1YRNB 2DMUA 1HCRA 2IEKA 1QVTA 3JRFA 1WI3A 1LFBA 3A01B 2R5YA 3JR9A 1LFUP 2XGDA 1VI0A 2M8GX 2FQ4A 4B1RA 1P7IA 1QPIA 3CCYA 2R5YB 1FTZA 2LVSA 1HOMA 2R93J 1MBGA 3O8GA 1TWAJ 3HGYA 4FE4A 5FKOA 2M9HA 3GTPJ 3BQZA 2XB5A 2QF7A 1DU0A 1ETXA 2EZHA 1NK2P 1JTXA 1XG1A 2XSDC 1XC5A 4LOCA 4BBSJ 2ME0A 2NS7A 4A3BJ 1ZQ3P 2G0EA 2JJ7A 1IV6A 2VKEA 4UUSA 3WHCA 2R92J 2JA7J 4QSHA 2DMPA 2DTZA 2K9SA 4IHVA 3QPLA 5EF6A 2M34A 3IV5A 2LP0A 3BR3A 2EBIA 2HI3A 5J1YA 1UMQA 1K83J 2JMWA 5M3FJ 3S1QJ 5DTDA 5GPCA 1RR7A 1GV2A 5F1JA 1GT0C 3GTGJ 2NOGA 3JRDA 2KDZA 1GDTA 2AHQA 2HXIA 2XPVA 2OPTA 4ABZA 2E2HJ 4I76A 2K9NA 1MSFC 3CMYA 3RZDJ 1T33A 2O7OA 2ID6A 5HODA 4M3EA 5IP9J 2NVTJ 2CQQA 3C2BA 3L1PA 3ZQLA 3HDDA 2I10A 2YU9J 3MN2A 2IBDA 1RETA 3JRIA 4BY1J 1JKPC 3GTJJ 3JRHA 1FTTA 1VNDA 4IHYA 3H3VK 2RAEA 4CYCB 2DA5A 3S16J 1POGA 5EEAA 1B72B 1APLC 4MFDA 3Q0VA 5F0FA 3MKLA 1Z77A 3HGGA 1GV5A 4B3AA 2L9RA 2ZB9A 1U9NA 1W0TA 2H8RA 3BTIA 2YS9A 1RKTA 9ANTA 3WHBA 4X6AJ 1JUMA 3OSGA 2EH3A 3DEWA 4IHWA 2EZKA 4HNVA 5IPAA 5FKNA 1ETWA 3FKIJ 1MBEA 2CU7A 1BA5A 2Y31A 3VPRA 4JP0A 3B6CA 5JLXA 1IUFA 3TP0A 1ZR2A 3E7LA 4XRSG 3K7AJ 2D5VA 4GFBA 4A3GJ 5M3MJ 1ORKA 3GTKJ 2NVXJ 4I6ZA 3PO3J 1B8IB 1JT6A 3BG3A 4A3JJ 1ETVA 3D1NI 2CJJA 3S17J 2NVYJ 2CQXA 3BR1A 1HDPA 2VI6A 1ZR4A 1U9OA 2XRLA 3TEDA 3HB9A 2COBA 2CRGA 5FLMJ 2DJNA 4L5EA 5K7HA 4BBRJ 3TW6A 1WH5A 3G1MA 3ZOBA 1MBFA 2O8KA 4C3HJ 3FIWA 1AHDP 1RKWA 5FKMA 3LSRA 3QQAA 4DYCA 3HM5A 5EG0A 5FJ8J 3BR5A 4XICA 5IYDJ 3HOZJ 4A3IJ 3RZOJ 1PUFA 1HDDC 2FX0A 4A3CJ 2GLOA 3JRGA 2N8GA 1EF4A 1P7JA 2IAIA 4FE7A 2DA6A 5IOZA 3IH3A 1IRZA 4JX6A 1BL0A 5EZHA 4QIWN 2KT0A 2LK2A 3TP3A 1O4XA 4UUSB 2ECBA 5E3LA 1DU6A 1A5JA 3BR6A 3BR0A 5F0HA 5F08A 1W0UA 3BTLA 3HKZN 5F0CA 1IGNA 1IC8A 1S7EA 3Q3SA 3SFIA 3F0CA 2R5ZA 4FISA 2EZLA 1TWCJ 4B4CA 2LR8A 3LSPA 2L7ZA 3RQIA 1LE8A 5JLWA 3A03A 4A3DJ 2JK3A 5FKLA 3JRCA 1WH7A 1JKQC 3JREA 1RESA 4D7NA 1BW5A 1MNMC 1UG2A 4C3JJ 4MIMA 4XRSA 1K61A 5M5YJ 3Q0UA 2DA3A 2HOAA 3DCFA 3CDLA 4QTRA 4RBOA 4UUTA 2M0CA 2ECCA 1IG7A 3HOYJ 4FCYA 3IH4A 2K40A 5EGOA 4FTHA 1H89C 1U8BA 3NAUA 1OCPA 1I6HJ 4D5FA 2H1KA 1I3QJ 3LSGA 5K7ZA 5M5XJ 5F04A 2O9LA 1ZKGA 1QVUA 3BT9A 4DW6A 1NK3P 1IJWC 2HDDA 4BY7J 2TCTA 3G1OA 1AKHA 1G2HA 4A69C 1TWHJ 2XPUA 2HXOA 3S2HJ 1SFOJ 2GBYA 5J1UA 2HYJA 2DMQA 2LY9A 3ZQHA 4DYQA 4C2MJ 1T56A 2ELKA 4JX5A 3OOUA 4M3FA 2NS8A 2DA7A 1FJLA 4BXXJ 1GUUA 2CUFA 5FLVA 1MH3A 3FISA 2Y0SN 1JGGA 3Q0WA 2ME6A 2JA5J 1ITYA 2DA1A 1WPKA 2HOTA 2OF7A 1X2MA 1JTYA 4XIDA 4MLOA 2E2IJ 1OJLA 1TC3C 2B63J 2DA4A 2LTPA 2AO9A 3I4NJ 1MSEC 4Y52J 2X9DA 2MSYA 2VKVA 1F43A 1UHSA 1ETYA 1XS9A 2X48A 2LD5A 3ZQIA 1Y1VJ 2CUEA 2XGEA 1TWFJ 2DN0A 4D7MA 3BTJA 1X58A 2DA2A 2JA8J 3S1MJ 2WV1A 5DS9A 5E3OA 3O8HA 5E3MA 3PO2J 3A01A 2NVQJ 3HOWJ 2GM4A 2E2JJ 1ZK8A 1JJ6C 5C4JJ 3HBLA 5EG0B 1MBHA 1NTCA 3CQZJ 4EEFG 2LKXA 3G1LA 4W97A 2L7FP 1PUFB 1JUPA 3K2AA 5EDNA 3IH2A 3BQYA 3S15J 4M3BA 2VPRA 3SJMA 4AUXA 1QRYA 1WGXA 2W48A 3OSFA 4W1UA 2P81A 1D5YA 4A3FJ 2JA6J 2QCOA 3S1NJ 5EZGA 2JWTA 3NARA 2R0QC 4A3LJ 1WCMJ 1BW6A 1JUSA 5IOYA 1JKRC 2Y30A 3JRAA 1ETQA 2MW8A 1ZGWA 4DZPA 1IDYA 4JX4A 4AYBN 2R7ZJ 3TW7A 4S0HB 4C3IJ 3UKGA 4RDUA 4NDLA 3A02A 5K7FA 1ETOA 1H88C 3LNQA 4MO7A 2FJ1A 2R5ZB 3ZQCA 1MBJA 2VUMJ 4Y7NJ 1GVDA 2TRTA 3BTCA 4XK4A 5C44J 3GTQJ 4BKXA 1JJ8C 2WAQN 1ETKA 5GPAA 1ZTRA 3BG5A 3W6VA 2MG4A 3GBGA 3LSJA 1A6IA 2E1OA 3QPSA 5GP9A 4DYRA 3LOCA 1Q1VA 2E19A 2ID3A 4XRMA 2DMTA 2XB0X 3I4MJ 2Y9ZA 4M3GA 3GTLJ 5C4XJ 4A3EJ 2WB1N 5J1RA 1H8AC 1FEXA 2L0KA 4M3DA 2JN6A 1ENHA 3B6AA 5EGOB 3ZQGA 1HLVA 4JYKA 2Y2ZA 5IP6A 4CYCA 1BJZA 3S2DJ 3ZQFA 1B72A 4IEJA 2FD5A 5E3NA 3GTMJ 1TWGJ 1OCTC 2LFBA 5J3LA 2HOSA 2LLKA 3S1RJ 1HF0A 1AU7A 3HOVJ 3RKQA 1SANA 2MGQA 1E3OC 1Y1WJ 3H0GJ 4A3KJ 3HOXJ 1AKHB 1X2NA 1IDZA 2HQ5A 3BR2A 4V2FA 1MBKA 1R9TJ 3M4OJ 4DZJA 2YUSA 1I50J 2K9QA 1JT0A 5C3EJ 5IYCJ 4D5CA 1JKOC 4A93J 2M2EA 4G12A 1FIAA 3OIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNG A;  1MH4 A;  1CQT A;  3HEF A;  3FK7 A;  5IP7 J;  1Z0X A;  1LE8 B;  4V2G A;  1OFC X;  4J19 A;  2PMZ N;  2DMN A;  5F27 A;  1U78 A;  4MFE A;  3JRB A;  3GTO J;  1RPW A;  3HOU J;  3M3Y J;  3S14 J;  3PM1 A;  2EZI A;  5EYR A;  5FKK A;  1VF9 A;  3MVP A;  5IYB J;  2EQR A;  1F36 A;  2L7M P;  1VFC A;  1B8I A;  5M5W J;  1YRN A;  4M6V A;  4AC0 A;  4A3M J;  2XGC A;  3FK6 A;  2XPW A;  2Y9Y A;  4X1E A;  4IHX A;  1FIP A;  2X6O A;  3BG9 A;  3SDG A;  1YRN B;  2DMU A;  1HCR A;  2IEK A;  1QVT A;  3JRF A;  1WI3 A;  1LFB A;  3A01 B;  2R5Y A;  3JR9 A;  1LFU P;  2XGD A;  1VI0 A;  2M8G X;  2FQ4 A;  4B1R A;  1P7I A;  1QPI A;  3CCY A;  2R5Y B;  1FTZ A;  2LVS A;  1HOM A;  2R93 J;  1MBG A;  3O8G A;  1TWA J;  3HGY A;  4FE4 A;  5FKO A;  2M9H A;  3GTP J;  3BQZ A;  2XB5 A;  2QF7 A;  1DU0 A;  1ETX A;  2EZH A;  1NK2 P;  1JTX A;  1XG1 A;  2XSD C;  1XC5 A;  4LOC A;  4BBS J;  2ME0 A;  2NS7 A;  4A3B J;  1ZQ3 P;  2G0E A;  2JJ7 A;  1IV6 A;  2VKE A;  4UUS A;  3WHC A;  2R92 J;  2JA7 J;  4QSH A;  2DMP A;  2DTZ A;  2K9S A;  4IHV A;  3QPL A;  5EF6 A;  2M34 A;  3IV5 A;  2LP0 A;  3BR3 A;  2EBI A;  2HI3 A;  5J1Y A;  1UMQ A;  1K83 J;  2JMW A;  5M3F J;  3S1Q J;  5DTD A;  5GPC A;  1RR7 A;  1GV2 A;  5F1J A;  1GT0 C;  3GTG J;  2NOG A;  3JRD A;  2KDZ A;  1GDT A;  2AHQ A;  2HXI A;  2XPV A;  2OPT A;  4ABZ A;  2E2H J;  4I76 A;  2K9N A;  1MSF C;  3CMY A;  3RZD J;  1T33 A;  2O7O A;  2ID6 A;  5HOD A;  4M3E A;  5IP9 J;  2NVT J;  2CQQ A;  3C2B A;  3L1P A;  3ZQL A;  3HDD A;  2I10 A;  2YU9 J;  3MN2 A;  2IBD A;  1RET A;  3JRI A;  4BY1 J;  1JKP C;  3GTJ J;  3JRH A;  1FTT A;  1VND A;  4IHY A;  3H3V K;  2RAE A;  4CYC B;  2DA5 A;  3S16 J;  1POG A;  5EEA A;  1B72 B;  1APL C;  4MFD A;  3Q0V A;  5F0F A;  3MKL A;  1Z77 A;  3HGG A;  1GV5 A;  4B3A A;  2L9R A;  2ZB9 A;  1U9N A;  1W0T A;  2H8R A;  3BTI A;  2YS9 A;  1RKT A;  9ANT A;  3WHB A;  4X6A J;  1JUM A;  3OSG A;  2EH3 A;  3DEW A;  4IHW A;  2EZK A;  4HNV A;  5IPA A;  5FKN A;  1ETW A;  3FKI J;  1MBE A;  2CU7 A;  1BA5 A;  2Y31 A;  3VPR A;  4JP0 A;  3B6C A;  5JLX A;  1IUF A;  3TP0 A;  1ZR2 A;  3E7L A;  4XRS G;  3K7A J;  2D5V A;  4GFB A;  4A3G J;  5M3M J;  1ORK A;  3GTK J;  2NVX J;  4I6Z A;  3PO3 J;  1B8I B;  1JT6 A;  3BG3 A;  4A3J J;  1ETV A;  3D1N I;  2CJJ A;  3S17 J;  2NVY J;  2CQX A;  3BR1 A;  1HDP A;  2VI6 A;  1ZR4 A;  1U9O A;  2XRL A;  3TED A;  3HB9 A;  2COB A;  2CRG A;  5FLM J;  2DJN A;  4L5E A;  5K7H A;  4BBR J;  3TW6 A;  1WH5 A;  3G1M A;  3ZOB A;  1MBF A;  2O8K A;  4C3H J;  3FIW A;  1AHD P;  1RKW A;  5FKM A;  3LSR A;  3QQA A;  4DYC A;  3HM5 A;  5EG0 A;  5FJ8 J;  3BR5 A;  4XIC A;  5IYD J;  3HOZ J;  4A3I J;  3RZO J;  1PUF A;  1HDD C;  2FX0 A;  4A3C J;  2GLO A;  3JRG A;  2N8G A;  1EF4 A;  1P7J A;  2IAI A;  4FE7 A;  2DA6 A;  5IOZ A;  3IH3 A;  1IRZ A;  4JX6 A;  1BL0 A;  5EZH A;  4QIW N;  2KT0 A;  2LK2 A;  3TP3 A;  1O4X A;  4UUS B;  2ECB A;  5E3L A;  1DU6 A;  1A5J A;  3BR6 A;  3BR0 A;  5F0H A;  5F08 A;  1W0U A;  3BTL A;  3HKZ N;  5F0C A;  1IGN A;  1IC8 A;  1S7E A;  3Q3S A;  3SFI A;  3F0C A;  2R5Z A;  4FIS A;  2EZL A;  1TWC J;  4B4C A;  2LR8 A;  3LSP A;  2L7Z A;  3RQI A;  1LE8 A;  5JLW A;  3A03 A;  4A3D J;  2JK3 A;  5FKL A;  3JRC A;  1WH7 A;  1JKQ C;  3JRE A;  1RES A;  4D7N A;  1BW5 A;  1MNM C;  1UG2 A;  4C3J J;  4MIM A;  4XRS A;  1K61 A;  5M5Y J;  3Q0U A;  2DA3 A;  2HOA A;  3DCF A;  3CDL A;  4QTR A;  4RBO A;  4UUT A;  2M0C A;  2ECC A;  1IG7 A;  3HOY J;  4FCY A;  3IH4 A;  2K40 A;  5EGO A;  4FTH A;  1H89 C;  1U8B A;  3NAU A;  1OCP A;  1I6H J;  4D5F A;  2H1K A;  1I3Q J;  3LSG A;  5K7Z A;  5M5X J;  5F04 A;  2O9L A;  1ZKG A;  1QVU A;  3BT9 A;  4DW6 A;  1NK3 P;  1IJW C;  2HDD A;  4BY7 J;  2TCT A;  3G1O A;  1AKH A;  1G2H A;  4A69 C;  1TWH J;  2XPU A;  2HXO A;  3S2H J;  1SFO J;  2GBY A;  5J1U A;  2HYJ A;  2DMQ A;  2LY9 A;  3ZQH A;  4DYQ A;  4C2M J;  1T56 A;  2ELK A;  4JX5 A;  3OOU A;  4M3F A;  2NS8 A;  2DA7 A;  1FJL A;  4BXX J;  1GUU A;  2CUF A;  5FLV A;  1MH3 A;  3FIS A;  2Y0S N;  1JGG A;  3Q0W A;  2ME6 A;  2JA5 J;  1ITY A;  2DA1 A;  1WPK A;  2HOT A;  2OF7 A;  1X2M A;  1JTY A;  4XID A;  4MLO A;  2E2I J;  1OJL A;  1TC3 C;  2B63 J;  2DA4 A;  2LTP A;  2AO9 A;  3I4N J;  1MSE C;  4Y52 J;  2X9D A;  2MSY A;  2VKV A;  1F43 A;  1UHS A;  1ETY A;  1XS9 A;  2X48 A;  2LD5 A;  3ZQI A;  1Y1V J;  2CUE A;  2XGE A;  1TWF J;  2DN0 A;  4D7M A;  3BTJ A;  1X58 A;  2DA2 A;  2JA8 J;  3S1M J;  2WV1 A;  5DS9 A;  5E3O A;  3O8H A;  5E3M A;  3PO2 J;  3A01 A;  2NVQ J;  3HOW J;  2GM4 A;  2E2J J;  1ZK8 A;  1JJ6 C;  5C4J J;  3HBL A;  5EG0 B;  1MBH A;  1NTC A;  3CQZ J;  4EEF G;  2LKX A;  3G1L A;  4W97 A;  2L7F P;  1PUF B;  1JUP A;  3K2A A;  5EDN A;  3IH2 A;  3BQY A;  3S15 J;  4M3B A;  2VPR A;  3SJM A;  4AUX A;  1QRY A;  1WGX A;  2W48 A;  3OSF A;  4W1U A;  2P81 A;  1D5Y A;  4A3F J;  2JA6 J;  2QCO A;  3S1N J;  5EZG A;  2JWT A;  3NAR A;  2R0Q C;  4A3L J;  1WCM J;  1BW6 A;  1JUS A;  5IOY A;  1JKR C;  2Y30 A;  3JRA A;  1ETQ A;  2MW8 A;  1ZGW A;  4DZP A;  1IDY A;  4JX4 A;  4AYB N;  2R7Z J;  3TW7 A;  4S0H B;  4C3I J;  3UKG A;  4RDU A;  4NDL A;  3A02 A;  5K7F A;  1ETO A;  1H88 C;  3LNQ A;  4MO7 A;  2FJ1 A;  2R5Z B;  3ZQC A;  1MBJ A;  2VUM J;  4Y7N J;  1GVD A;  2TRT A;  3BTC A;  4XK4 A;  5C44 J;  3GTQ J;  4BKX A;  1JJ8 C;  2WAQ N;  1ETK A;  5GPA A;  1ZTR A;  3BG5 A;  3W6V A;  2MG4 A;  3GBG A;  3LSJ A;  1A6I A;  2E1O A;  3QPS A;  5GP9 A;  4DYR A;  3LOC A;  1Q1V A;  2E19 A;  2ID3 A;  4XRM A;  2DMT A;  2XB0 X;  3I4M J;  2Y9Z A;  4M3G A;  3GTL J;  5C4X J;  4A3E J;  2WB1 N;  5J1R A;  1H8A C;  1FEX A;  2L0K A;  4M3D A;  2JN6 A;  1ENH A;  3B6A A;  5EGO B;  3ZQG A;  1HLV A;  4JYK A;  2Y2Z A;  5IP6 A;  4CYC A;  1BJZ A;  3S2D J;  3ZQF A;  1B72 A;  4IEJ A;  2FD5 A;  5E3N A;  3GTM J;  1TWG J;  1OCT C;  2LFB A;  5J3L A;  2HOS A;  2LLK A;  3S1R J;  1HF0 A;  1AU7 A;  3HOV J;  3RKQ A;  1SAN A;  2MGQ A;  1E3O C;  1Y1W J;  3H0G J;  4A3K J;  3HOX J;  1AKH B;  1X2N A;  1IDZ A;  2HQ5 A;  3BR2 A;  4V2F A;  1MBK A;  1R9T J;  3M4O J;  4DZJ A;  2YUS A;  1I50 J;  2K9Q A;  1JT0 A;  5C3E J;  5IYC J;  4D5C A;  1JKO C;  4A93 J;  2M2E A;  4G12 A;  1FIA A;  3OIO A; 
#chains in the Genus database with same CATH topology
 4IHS A;  3ZCO A;  4EV0 A;  1CQT A;  3FK7 A;  1Z0X A;  1TZL A;  1LB2 A;  1WJD A;  1CF7 A;  1ZLJ A;  2BGC A;  2LKP A;  3OYN A;  3CC2 I;  3C2G A;  2A5Y B;  4J19 A;  5F27 A;  2BHZ A;  3ZMU A;  3V7R A;  3JRB A;  1XTA A;  3OIP A;  1EH7 A;  3EPZ A;  3BC8 A;  4E7I A;  1R23 A;  1W7P D;  3IRQ A;  3RKY A;  3RKX A;  4RA2 A;  4XL9 A;  4A3M J;  2XGC A;  1YJW I;  2X6O A;  3DEE A;  2DMU A;  3JSO A;  1HCR A;  5HS8 A;  3KYC B;  2IXS A;  2O0Y A;  3WTY C;  1LFB A;  2LRE A;  3M7G A;  3F3X A;  1LFU P;  2XGD A;  1YOV B;  1VI0 A;  3DP7 A;  2EA2 A;  2CFO A;  1FOW A;  2XAG A;  3K4M A;  3OYE A;  5K5O A;  2IA2 A;  2ZSI B;  1X4O A;  4FE4 A;  3OS2 A;  5FKO A;  2M9H A;  3GTP J;  4PCQ A;  2OC6 A;  2O6G E;  5DEQ A;  1TW3 A;  2CO5 A;  4CZC A;  1ODD A;  3QP6 A;  5ICG A;  2QQA A;  1NK2 P;  3LSH A;  2HTJ A;  1EH6 A;  2LDU A;  1PDN C;  1XG1 A;  3CCU I;  3KP2 A;  2XSD C;  2VQC A;  2KQR A;  3IRR A;  1O7L A;  1XC5 A;  5DM6 F;  3J80 K;  2ME0 A;  3PUB A;  3TGN A;  4RS8 A;  4UV8 A;  1M1E B;  2IS2 A;  1GXP A;  4NBQ A;  4D9J A;  3BJO A;  2OAZ A;  2W7N A;  1ZQ3 P;  4B8X A;  1BC8 C;  2JJ7 A;  2VKE A;  1I39 A;  2RQQ A;  4UUS A;  4EM1 A;  4S04 A;  3WG9 A;  3FF5 A;  4FX0 A;  2DTZ A;  2ZSH B;  4F52 A;  1SVM A;  2M5W A;  3AG2 H;  2QQ9 A;  3GUD A;  4GYG A;  5J1Y A;  4II2 A;  4A6D A;  2QUF A;  3DKY A;  2DOF A;  2BXZ A;  2WTE A;  2P6S A;  5F64 A;  3FMS A;  1UHW A;  3ZRG A;  2ZC2 A;  2OPT A;  5L3B A;  4I98 B;  1T33 A;  1R49 A;  3QPT A;  2ID6 A;  4KDP A;  5E1X A;  1X19 A;  2LSO A;  4LB6 B;  3N4M A;  2CQQ A;  2RV8 A;  3SDB A;  1XB4 A;  3AKZ A;  1YX3 A;  5TIS C;  3J7A O;  2IBD A;  3VOD A;  1ONV A;  2XGX A;  3H35 A;  4BY1 J;  1WZ2 A;  1FTT A;  2FSW A;  1RC9 A;  2KJC A;  3WTS C;  3FWE A;  3W2A A;  2K3P A;  3G6E I;  1FYK A;  4RAF A;  3H3V K;  2RAE A;  2ZFW A;  2RVC A;  1POG A;  1B72 B;  4OIO F;  1WRJ A;  4L9T A;  1APL C;  1V4R A;  4MFD A;  2VN2 A;  4DBR A;  1Z77 A;  3FKJ A;  4S05 A;  2FU4 A;  2L9R A;  4OMY A;  3GLX A;  3KYL A;  1U9N A;  3FM5 A;  3CC4 I;  4L0Y B;  1A04 A;  5D5U B;  2YS9 A;  1JXS A;  2KRH A;  3A4C A;  4LG0 A;  1ACI A;  4KMU X;  3DEW A;  3DKX A;  3GZ5 A;  1V5F A;  1IN8 A;  2L02 A;  5HVQ C;  3FKI J;  2GZW A;  2KMU A;  5FFX A;  3K2Z A;  4IRI A;  3W2W A;  2VJ4 A;  4E7J A;  2DOD A;  1MGT A;  4ESB A;  3SZT A;  1CF7 B;  2OD5 A;  1G59 A;  2OTL I;  2FUG 2;  3TP0 A;  3PSI A;  2FNP A;  3K7A J;  4WF2 A;  2NNY A;  3V7C A;  5E18 F;  1U8R A;  4MEY F;  2QBY A;  3NEU A;  3WOD F;  2CSO A;  1ORK A;  3AL0 B;  4WX9 A;  2J5O A;  2NXN B;  1J75 A;  1QPM A;  3JW4 A;  4I7H A;  2OU2 A;  4LK0 F;  4BQQ A;  4U7B A;  4A3J J;  1ETV A;  1G3Y A;  1UST A;  3PQK A;  4OU0 A;  1Y8Q B;  4RM2 A;  3T8T A;  3S17 J;  1I27 A;  3D5S C;  3W2V A;  2HGC A;  3BR1 A;  1HDP A;  3ABU A;  2PFB A;  1U9O A;  4BEH A;  2KDO A;  1OIS A;  4PJJ A;  2DJN A;  2XAS A;  4HX8 A;  2HYG D;  4BBR J;  1WH5 A;  3G1M A;  4U0Y A;  3KIO A;  1ZLK A;  4XMY A;  4PK4 A;  1C0W A;  5FKM A;  3LSR A;  3H5N A;  4BYY A;  1MKM A;  1BI0 A;  5LLQ A;  3CLO A;  4M71 A;  4Q47 A;  4XIC A;  5CKT A;  1IN5 A;  1PUF A;  4PFP A;  1HDD C;  2LMD A;  2K02 A;  4A3C J;  3QP5 A;  2ELH A;  4I99 C;  1EF4 A;  3G71 I;  4OAY A;  4R1H A;  5LRS A;  1YHQ I;  3BRO A;  4I0A A;  3P7N A;  2KT0 A;  3V8K A;  2M1B A;  4XLH A;  1J2X A;  2IGN A;  4HPQ A;  4IVN A;  1V5G A;  3E6B A;  5E1W A;  4AIH A;  1O4X A;  4UUS B;  4IJA A;  3U9G A;  3GF2 A;  5DD8 A;  3CLQ A;  3GX4 X;  2QQB A;  5LBQ A;  3BCB A;  3HKZ N;  3EYI A;  4P55 A;  2L01 A;  3S3M A;  4G7Z F;  2UV1 A;  2R5Z A;  2HPI A;  4FIS A;  2XV4 S;  1ZH5 A;  4IPA A;  2R7R A;  4ZYG A;  3DV8 A;  3RQI A;  2G7U A;  2CGP A;  5FKL A;  2W57 A;  3DTE A;  3U21 A;  4RAZ A;  3LA2 A;  4B09 A;  2IA1 A;  4D7N A;  1S7O A;  3VDX A;  2CMP A;  3F8C A;  1FOX A;  2XC7 A;  3MKZ A;  2X6X A;  1BW5 A;  1SMT A;  4MIM A;  4XRS A;  2K3F A;  3M8J A;  1IRG A;  3Q0U A;  2E7X A;  2OZ6 A;  2L2O A;  3KP6 A;  2HOA A;  4WXD A;  2QM3 A;  3CJT B;  1S9H A;  1W5T A;  4C9Y A;  4EM2 A;  4QTR A;  4RBO A;  2M0C A;  2ECC A;  1KA8 A;  1LVK A;  3CCJ I;  3HUG A;  3CP2 A;  2QA4 I;  1F4K A;  3DBR B;  3Q5F A;  4J00 A;  2H1K A;  3HTS B;  4LG3 A;  1VQK I;  3LSG A;  5K7Z A;  5EEG A;  4OIP F;  4Y3O A;  1ZKG A;  2PMZ A;  4DW6 A;  2RGV A;  1NK3 P;  4FT8 A;  1X1D A;  2M8E A;  2R7O A;  4MHG A;  3ZPL A;  1HKS A;  4LG0 B;  1BBY A;  2GA1 A;  2QGU A;  1RUO A;  1W36 C;  1SFO J;  2CQ7 A;  4A0Z A;  1U5T C;  2M4G A;  2VBW A;  3ZQH A;  4DYQ A;  4JX5 A;  2OJE D;  3I9V 2;  1FYM A;  2DYS H;  2IJL A;  2PI0 A;  4C2T A;  4IRG A;  3FXO A;  3WTV C;  2DA7 A;  3ERE D;  5L3E A;  2F4O B;  1P92 A;  4YFK F;  4HG2 A;  3BZC A;  4BHB A;  4HSR A;  1TT0 A;  2QBY B;  2DA1 A;  2DYR H;  4KUM A;  1K7A A;  2HOT A;  2OF7 A;  3CJR B;  1OJL A;  4BU2 A;  2LTP A;  3HHH A;  3CO7 C;  3GEZ A;  2X9D A;  3DU5 A;  3FBI B;  1H9T A;  2MSY A;  2IGM A;  5D4R A;  2W82 A;  1ETY A;  4GCV A;  1XS9 A;  2QKM B;  2LF7 A;  3EDP A;  1YQA A;  4NC7 A;  5HNH A;  2ZXJ A;  2W84 A;  2VBY A;  3IC7 A;  3K10 A;  4IQJ A;  2DN0 A;  3O2P E;  4D7M A;  1SAX A;  3V7S A;  2JSP A;  3I4P A;  4XBF A;  5DS9 A;  3AG3 H;  3A01 A;  3VYS B;  2ZJP F;  4BDZ A;  2GM4 A;  3K4B A;  2E2J J;  4A6E A;  2HPM A;  5KK1 A;  3I54 A;  2GWR A;  4CSW A;  2FE3 A;  3WU1 B;  2Z9O A;  3ZR8 X;  1PUF B;  3FXM A;  2NAZ A;  3K2A A;  4LLN A;  3L00 A;  1FWZ A;  4A12 A;  2HTS A;  2WC2 A;  3ULQ B;  3F22 A;  3GO5 A;  1K79 A;  2LG4 A;  4DBQ A;  1QRY A;  1WGX A;  2COM A;  2VQH A;  4II3 A;  3CCE I;  4BE1 A;  3T5X A;  2W00 A;  3ERM A;  4UXN A;  2GOM A;  2V6C A;  5EZG A;  2L9N A;  2JWT A;  3CCS I;  4IOA F;  2H8W A;  4A3L J;  1JUS A;  5IOY A;  4Y13 A;  2QVO A;  3CF2 A;  3LA7 A;  2CS3 A;  2HNH A;  4AYB N;  1JHF A;  4TV7 A;  2CV1 A;  3TW7 A;  1YW8 A;  3CCV I;  1ZYR F;  5FRO A;  1OR7 C;  3PSF A;  4RDU A;  1WVR A;  1ZGA A;  1QZZ A;  3DU6 A;  2KHM A;  2M45 A;  4G7O F;  3G2B A;  2R5Z B;  2R7F A;  2QZ8 A;  3NWS A;  3IP4 B;  5GAH J;  1EKE A;  4BKX A;  2X1D A;  4YIF A;  4BHC A;  5JHF A;  2R7S A;  3R4K A;  3W6V A;  2ICW G;  3EUH C;  1R5I D;  4EJW A;  3DBH B;  1K78 B;  2ZXI A;  2E1O A;  3QPS A;  3I53 A;  5GP9 A;  4DYR A;  3CZ6 A;  3OS0 A;  1WJE A;  5JHU A;  2EFQ A;  3OYH A;  2XB0 X;  3M8E A;  2OA4 A;  5HLI A;  1SAU A;  4M3G A;  1R5H A;  4P1W A;  2JZY A;  2JUG A;  3V8J A;  5AON A;  4UB8 C;  3DFG A;  2STT A;  3WE3 A;  2MA3 A;  4M3D A;  3B6A A;  2HZT A;  2Y2Z A;  5IP6 A;  3HUG B;  1T8I A;  3S2D J;  4BQN A;  5LGU A;  4CA0 A;  3KLO A;  3AFH A;  3TMO A;  2BHY A;  5E3N A;  2MBF A;  3A1Y A;  4U87 A;  1TWG J;  2H09 A;  4B47 A;  1G3T A;  5HOO A;  2LLK A;  2HOS A;  3RKQ A;  1VQO I;  1IN6 A;  3D5L A;  1SAN A;  3KZY A;  2XAU A;  2QSG X;  2IVM A;  1Z9C A;  3H36 A;  4A3K J;  3BR2 A;  4PFO A;  1YG2 A;  3KFW X;  4V2F A;  3E1S A;  3NWT A;  3M4O J;  4DZJ A;  2BYV E;  3ISP A;  3KE2 A;  4EGZ A;  2E7W A;  4Q5S F;  1TLH B;  4YEJ A;  3OIO A;  4ZYH A;  2WWY A;  1Y6I A;  5D5W B;  2HOE A;  3F6O A;  1TT5 B;  3C3W A;  5DD4 A;  4D0P A;  1MND A;  1SD4 A;  1LE8 B;  1XMX A;  1JI8 A;  1GLN A;  1SD5 A;  5TRD A;  2H94 A;  3P9C A;  1U78 A;  4XR6 A;  4FQG A;  4MFE A;  5JFR A;  2DOA A;  3GTO J;  1RPW A;  2P4W A;  3S14 J;  3PM1 A;  1JHH A;  5FKK A;  1VF9 A;  1Z1D A;  3MVP A;  2UZK A;  2EQR A;  1F36 A;  3PFI A;  5H20 A;  1B8I A;  1OCO H;  3MFK A;  1RI7 A;  1N25 A;  2WBM A;  4AC0 A;  3UNG C;  3K1P A;  2VB6 A;  3T8R A;  4Q4Z F;  1XGM A;  4X1E A;  4IHX A;  1FIP A;  2MLK A;  2FF4 A;  5K5R A;  2DT6 A;  3BOQ A;  1YRN B;  3ZMZ A;  3L2R A;  1DQU A;  3KP5 A;  4PJM A;  1QVT A;  4XKC A;  1E3H A;  2R7Q A;  1YW7 A;  4I0B A;  3A01 B;  4P9U A;  2CYY A;  2RN7 A;  2M8G X;  1BIA A;  5CJ9 A;  1P7I A;  3OYM A;  3RI4 A;  3KPH A;  2FQ3 A;  1ZN2 A;  4B43 A;  4N9I A;  3OL3 A;  4RB3 C;  3EYY A;  5CVU A;  1TWA J;  2V7F A;  1ZAO A;  1MNE A;  3BQZ A;  4BQO A;  2XB5 A;  4LIU A;  4N4O B;  4RLF A;  4KJZ A;  1T2K A;  2QF7 A;  4CHU A;  1LJ9 A;  3VYR B;  4P9F A;  1ETX A;  2DAO A;  3E97 A;  3TL4 X;  4AYB A;  3HPG A;  3GLL A;  3OYB A;  2R7T A;  2EB7 A;  4GO1 A;  2FML A;  4BBS J;  1FT9 A;  2E1N A;  1S3J A;  4A3B J;  3KET A;  3OOP A;  4PGG A;  4ENN A;  4HW0 A;  1IV6 A;  1P6R A;  3CC7 I;  4L0Z B;  1TQM A;  4XKW A;  1BIB A;  4QSH A;  2K9S A;  4IHV A;  2GAU A;  3IV5 A;  5B1A H;  2OTJ I;  2EBI A;  2V1U A;  1MMG A;  2H6C A;  2JMW A;  2A6H F;  2E71 A;  5DCM A;  5F1J A;  2E34 A;  2XVC A;  2ZJ2 A;  3JRD A;  1GDT A;  1S6L A;  2AHQ A;  2XPV A;  1FSH A;  2VAS A;  2V4J C;  2K9N A;  3KLN A;  2W1O A;  1MSF C;  4JOM A;  1HQC A;  3RZD J;  3OYK A;  4HV5 A;  3F8F A;  2X4H A;  2K27 A;  4XN3 A;  5HOD A;  1VQ8 I;  3C2B A;  4E7Z A;  2MD0 A;  3ZQL A;  2I10 A;  4OOI A;  2O03 A;  3MN2 A;  3Q9V A;  1V55 H;  2QEN A;  3GTJ J;  1XDU A;  2MC4 A;  3IHU A;  1A36 A;  4IHY A;  2VJJ A;  4PSW A;  2BOL A;  3S16 J;  4KIS A;  4FHT A;  2QQ8 A;  3Q0V A;  3TO7 A;  3RCO A;  2OV7 A;  4KN4 X;  3MKL A;  1HKQ A;  1GV5 A;  2BZT A;  1E0E A;  2V1D A;  4HEA 2;  1XX5 A;  4RLQ A;  1LQ1 A;  3R61 A;  2JSC A;  1UFM A;  2VBX A;  3I3L A;  3SYT A;  1R7J A;  1T95 A;  1PP7 U;  1RKT A;  5GAE J;  3HOS A;  4OWR B;  4ESF A;  4ZH4 F;  4IHW A;  1VQ5 I;  4HNV A;  5L3D A;  5IPA A;  1ETW A;  1W5C C;  1I5Z A;  4RM3 A;  3MZH A;  4JP0 A;  3B6C A;  3GFL A;  3NQO A;  2IRF G;  3N97 A;  4KFC A;  2JPC A;  2WY7 Q;  4HLX A;  2KZV A;  1D1A A;  2GOX B;  1OYI A;  3TO6 A;  5BQT A;  4A3G J;  3GTK J;  5B3S H;  2FBH A;  4I6Z A;  1B8I B;  3DXJ F;  3WTZ A;  2DCE A;  4XLE A;  3E3V A;  4U0V A;  5B5E C;  4OMZ A;  3DWL E;  2NVY J;  1YO5 C;  3CUQ B;  2OBP A;  2F2E A;  2XRL A;  3TED A;  3OL4 A;  2A3S A;  3PIP F;  2VC1 A;  1YIJ I;  3TW6 A;  1R1T A;  5J47 A;  4E6K G;  1Z6R A;  1R4N B;  3AL0 C;  4PJN A;  3TDZ C;  3FIW A;  1AHD P;  1SMY F;  1B9M A;  3ML6 A;  1LPQ A;  3QQA A;  1I1S A;  1S7A A;  1DP7 P;  1F9N A;  3HM5 A;  5EG0 A;  2LBF A;  2IS1 A;  2Q8K A;  1DDN A;  3HOZ J;  2JT1 A;  5EJC A;  4A3I J;  3RZO J;  1PJR A;  1Z7U A;  4L9N A;  5D6E A;  2W85 A;  3CJQ B;  3JRG A;  1F1Z A;  1G4D A;  1UG0 A;  3KP3 A;  4RB0 A;  1R4M B;  2IAI A;  2IP2 A;  3BJA A;  3IH3 A;  4F7Z A;  1IRZ A;  5D8L B;  1BL0 A;  3V4G A;  1VQ6 I;  2WAQ A;  5D6F A;  4MEX F;  2UXX A;  3REO A;  4CCL A;  1QNT A;  1DU6 A;  5D5X B;  3BR6 A;  2HU9 A;  5F0H A;  3A0H C;  1VTN C;  5F08 A;  3OYD A;  3BTL A;  1XSD A;  5H2F C;  1KU3 A;  3ZXS A;  2K4B A;  1IC8 A;  4A0X A;  3SFI A;  1S29 A;  4NQW B;  3A2K A;  2FOW A;  2A07 F;  2EZL A;  2XUB A;  1TWC J;  5DCM B;  2A6E F;  2FEZ A;  1D8J A;  1V3F A;  3LSP A;  5FB2 A;  3K4K A;  4XOT A;  3JRC A;  1D8K A;  1WH7 A;  1KYW A;  2F5V A;  2L5Q A;  3LWF A;  2XAQ A;  1RES A;  4XRF A;  2PEX A;  1ON2 A;  4XM3 A;  1DP3 A;  3ECO A;  1VQL I;  2IA0 A;  5M5Y J;  5LEJ A;  1IUY A;  3FXK A;  2Z33 A;  1LVA A;  2DA3 A;  4XON A;  4XOP A;  4ON0 A;  2A6T A;  3HTU A;  3WU2 C;  3L2W A;  3DEU A;  3KZI C;  3SXY A;  3HPH A;  1T39 A;  4UUT A;  1IG7 A;  3HOY J;  4M6Y A;  1K4T A;  4RGU A;  4HQE A;  2KRF A;  3VEP A;  3H9G A;  1N78 A;  4D5F A;  4BHP A;  3EQL F;  5M5X J;  3N05 A;  5F04 A;  3DLA A;  3BT9 A;  4BNC A;  3KEY A;  1IJW C;  2L9S A;  5J40 A;  4BY7 J;  2TCT A;  1G2H A;  2I5U A;  1O3R A;  1R5G A;  4XLC A;  4KIB A;  2VJI A;  3S2H J;  4U88 A;  4KIT B;  1MW7 A;  1G6N A;  2E35 A;  1REP C;  4M72 A;  4ZZD A;  2ELK A;  2GA2 A;  2XF7 A;  1ZHF A;  3OOU A;  3R6S A;  3BP8 A;  3BZ6 A;  4PSX A;  3FXQ A;  5J8F A;  1GUU A;  3OR1 C;  5DUK A;  2ZME A;  4HX7 A;  1BR4 A;  3BWG A;  2VKD A;  2Z1D A;  1MH3 A;  2EFN A;  3FIS A;  3FXL A;  3SEZ A;  5J8C A;  2Y0S N;  3CDH A;  3DLL F;  2JA5 J;  3ZMT A;  4RAG A;  2FBK A;  1X2M A;  2DQL A;  3LSM A;  5LEK A;  2K86 A;  3R0A A;  2JTV A;  2B63 J;  2MD5 A;  3H5A A;  1UAA A;  2AO9 A;  3FHZ A;  2IS6 A;  1YS7 A;  1RIO H;  3I55 I;  3PQJ A;  1YIO A;  2VKV A;  2VOO A;  4PUS A;  4WXH A;  1UHS A;  2VIX A;  4XN0 A;  2Y0M A;  5ILS A;  1IV8 A;  3K70 C;  2HVR A;  4IO9 F;  2CUE A;  1YFH A;  1TBX A;  3VWB A;  3BTJ A;  4N4N B;  3PNT A;  2NVQ J;  3KEO A;  4NC6 A;  3HOW J;  4LFU A;  1YS6 A;  2DDB A;  5ILU A;  4IL6 C;  3RPU D;  3TBI A;  5JVT A;  2LBF B;  5EG0 B;  3OS1 A;  2XRN A;  1WFX A;  1WI9 A;  3CQZ J;  3G1L A;  3H92 A;  2L7F P;  3MKW B;  1MJ9 A;  3H9Q A;  4B3X A;  2HKO A;  2PLY A;  1QA6 A;  2VPR A;  1SVL A;  2P5V A;  1Y8R B;  3FBN B;  2W4S A;  1R71 A;  1S5L C;  2EFP A;  2W48 A;  5L3F A;  1ZAR A;  2P81 A;  1D5Y A;  3PJR A;  2M30 A;  1ZRD A;  1AA7 A;  1SVO A;  2JA6 J;  3S1N J;  3G73 A;  2Q1Z B;  1LEB A;  1K6Y A;  1GHC A;  3QYF A;  3QRF F;  1BW6 A;  2L7K A;  3DPT A;  4H4K C;  1ZGW A;  2DPD A;  4DZP A;  4JQF A;  5LFA A;  2R7Z J;  5HS9 A;  1QBJ A;  1D0Y A;  4C3I J;  5FD5 A;  3A02 A;  1ETO A;  1BC7 C;  3K1M A;  4MO7 A;  3T0Y A;  3BCA A;  1MBJ A;  4D1Q A;  5J4V A;  5AIQ A;  1K78 A;  4ZJZ A;  1JJ8 C;  1A35 A;  3PUF A;  1LNW A;  1ZTR A;  3H9J A;  5B1B H;  1FMW A;  3KCC A;  5HLT A;  1IAW A;  1PP8 F;  2MG4 A;  1VQM I;  2HQN A;  1BN5 A;  5A2Q Z;  1SD6 A;  1A6I A;  3FM3 A;  4E7H A;  3CMA I;  2CQK A;  5GTH C;  4JBA A;  2CFX A;  3MD2 A;  1B1B A;  1W7P A;  1OKR A;  2Y9Z A;  3FHN A;  4RB2 C;  3F8M A;  1FEX A;  2WB1 N;  3KX2 A;  1HST A;  1TW2 A;  5K1Y A;  3ZQG A;  4A5N A;  2VT2 A;  1HLV A;  4IXA A;  4CYC A;  3G4S I;  1IF1 A;  4IEJ A;  4BAC A;  1BOA A;  3VSK A;  4ZDL A;  2F4M B;  1W1W E;  2M7B A;  1KU7 A;  1EH8 A;  1OCT C;  3RYR A;  3OY9 A;  3QAH A;  2PJR A;  2A61 A;  4DNC A;  4HX4 A;  2MGQ A;  2DFH A;  4MTE A;  3MAJ A;  2KIM A;  2E60 A;  2DU9 A;  3SZP A;  4Y17 A;  2EV6 A;  3FXJ A;  2YUS A;  1HC8 A;  1I50 J;  1WJC A;  2K9Q A;  1JT0 A;  5C3E J;  1BJA A;  4A93 J;  2M2E A;  4LIV A;  1LE8 A;  2JA7 J;  1FIA A;  2VXZ A;  3HRT A;  3IUO A;  3HEF A;  2M4K A;  4FX4 A;  2ZME B;  3ABM H;  3WU0 A;  2DMN A;  4ZC3 A;  1B59 A;  4CO8 A;  4HA8 A;  1QHH D;  1WHU A;  3CUO A;  2FXA A;  2E5N A;  2IW5 A;  3M3Y J;  4E7K A;  3C1D A;  3K69 A;  4ITV A;  3U1K A;  1DPU A;  2GIV A;  1XMK A;  3I71 A;  1VFC A;  1HW1 A;  5M5W J;  1YRN A;  2L4A A;  4M6V A;  5LHG A;  5LGT A;  4PGH A;  4CCJ A;  2PG4 A;  3FK6 A;  5ED4 A;  3DBL B;  3F6V A;  4O5V A;  1YX5 A;  4YII A;  3H0D A;  1SD7 A;  2LY1 A;  3JRF A;  2F5E A;  5AIP A;  2KKO A;  1WI3 A;  2EIM H;  2MAB A;  2E36 A;  1ULY A;  3HG9 A;  1Z05 A;  3WGI A;  3OIQ A;  1FPQ A;  2FQ4 A;  5HDG A;  4B1R A;  3GME A;  5JR3 A;  3CCY A;  2R5Y B;  1FTZ A;  2LVS A;  2PN6 A;  3I56 I;  2A68 F;  2R93 J;  1DUX C;  3L2U A;  3HYI A;  3HGY A;  2Q2E B;  3DQV C;  1YI2 I;  1Y39 A;  5K5Q A;  4EJV A;  1ZG5 A;  2DDA A;  4ZYD A;  3PNY A;  1DU0 A;  4RGS A;  1QZY A;  2EZH A;  3HKZ A;  1JTX A;  4HZF A;  4UVC A;  2DBB A;  4F55 A;  4DIQ A;  3QU3 A;  3H1C A;  4N0B A;  3LQQ A;  2E1M B;  3FMQ A;  1WSU A;  2YU3 A;  3HOT A;  2DW4 A;  5CQG A;  5HLG A;  3J7Z I;  3CTA A;  1J09 A;  4FAS D;  1AWC A;  2RRE A;  2VPL A;  1IRX A;  5FD6 A;  2DMP A;  3ASO H;  4MTD A;  5A2Q K;  3QPL A;  2LH9 A;  4YEL A;  2HVS A;  4L9J A;  1O3T A;  2LP0 A;  2P0W A;  1J7K A;  3BR3 A;  3QYB A;  3MWM A;  3C7J A;  2L54 A;  2WV0 A;  3HIF A;  2LYC A;  4R8H A;  5M3F J;  3S1Q J;  5DTD A;  1B4A A;  5GPC A;  1GV2 A;  1GT0 C;  4KIC A;  4CZZ A;  5FLX Z;  3GTG J;  2E2H J;  2PMU A;  4I76 A;  1DGR M;  1IN7 A;  5TJJ A;  3CMY A;  3V8L A;  2FNA A;  2C6Y A;  2O7O A;  1OLT A;  2GQQ A;  1SFK A;  3ABK H;  2NVT J;  3BJ6 A;  4AM3 A;  3L1P A;  2ZJR F;  4E70 A;  1W7P B;  3HDD A;  1I3A A;  3COA C;  4AIJ A;  3K9T A;  1RET A;  3JRI A;  3F8B A;  3MKY B;  3L2C A;  3JRH A;  3AAF A;  2GXB A;  1VND A;  1Z21 A;  2OQG A;  5H6Q A;  3RYP A;  4LGW A;  1XGO A;  1RRJ A;  4AD9 A;  4CYC B;  1TTY A;  3J81 Z;  3PNV A;  1KQ9 A;  4F93 B;  3WE2 A;  4AU7 A;  5EEA A;  3DTK A;  4ZDO A;  4IOC F;  2D45 A;  1B6A A;  4HF0 A;  5HDN A;  2PJR B;  3CP8 A;  1ZRF A;  2BY0 A;  2F48 A;  2K5C A;  3E5U A;  4ENM A;  2CWE A;  1W0T A;  2H8R A;  3TOA A;  9ANT A;  3RPU A;  2WAD A;  3K4C A;  4I2O A;  3I0T A;  3TQN A;  2A05 A;  1VQ4 I;  1U0J A;  2JQ7 A;  4RB1 A;  2IGO A;  4LIT A;  2P5L C;  1LFP A;  2X51 A;  5FKN A;  5CLS A;  3FMR A;  5D4S A;  2VOD A;  5H6R A;  4HLY A;  1X4P A;  2CU7 A;  2Z5U A;  3GVA A;  5CVI A;  2Y31 A;  3VPR A;  1BA5 A;  1O3Q A;  1VQP I;  3PFY A;  1ZR2 A;  1Z6T A;  3ZMD A;  2D5V A;  4KIG A;  3RSN A;  4FET A;  3CF5 F;  4GFB A;  3ABL H;  1MMS A;  1Y56 A;  3HSE A;  3QPH A;  4HF2 A;  4PJL A;  4HYE A;  2EV5 A;  3F72 A;  2DK5 A;  4WCG A;  2PQ8 A;  2NVX J;  3CO6 C;  1BR1 A;  2J5P A;  3CUQ A;  2AQF A;  3QOP A;  3BG3 A;  4H0E A;  4UVB A;  2ZBK A;  2D1H A;  3F23 A;  1NG7 A;  1JGS A;  3LL7 A;  5LRR A;  4L5I A;  3AG1 H;  1ZR4 A;  3OYC A;  4HQM A;  4GXO A;  2CRG A;  2XSJ C;  2PX9 A;  2XF5 A;  5FLM J;  4L5E A;  3LAJ A;  4PJ0 C;  3SZG A;  5CYV A;  1OYW A;  4YIR X;  4C3H J;  1RKW A;  1PYV A;  1QGP A;  2P8T A;  3DF8 A;  3L2V A;  3HL2 A;  2R4G A;  2WA0 A;  3X2Q H;  1KU9 A;  1KYZ A;  5KNL A;  6PAX A;  4LB5 A;  1UZC A;  1BI1 A;  2DFF A;  5IYD J;  2NS0 A;  3ELK A;  4IF4 A;  3CUQ C;  2FX0 A;  3D0S A;  3BZK A;  2ACJ A;  1RNL A;  2XRO A;  2WY8 Q;  1FP2 A;  4IQ4 A;  1IN4 A;  3BPV A;  2G7H A;  4FE7 A;  2IT0 A;  1PVE A;  4JX6 A;  5EZH A;  4XLP F;  3CCM I;  4ZYE A;  1YE9 A;  2LK2 A;  1L3L A;  2X1C A;  1AOY A;  3J7Y J;  5FLX K;  3K4N A;  3TP3 A;  1IW7 F;  2STW A;  1XGS A;  1Z3Y A;  1I1G A;  2ECB A;  3P9K A;  4HNT A;  2YX4 A;  4O3M A;  4XKV A;  5E3L A;  1O57 A;  3BR0 A;  3L9F A;  3H5R A;  4LLG F;  4NQW A;  4ESJ A;  2KIF A;  4YFN F;  1W0U A;  1D0X A;  4XOR A;  5F0C A;  3W6J B;  4E7L A;  4EJO A;  4BAY A;  1IGN A;  1S7E A;  3K4J A;  3Q3S A;  3F0C A;  2E5Z A;  4CDG A;  2F4I A;  4XLF A;  1XN7 A;  4CUG A;  2EFO A;  4CYD A;  2QSH X;  3A03 A;  4A3D J;  2ZXW H;  2VL8 A;  1FX7 A;  5D8K B;  2UUZ A;  2RNJ A;  1JKQ C;  4OIQ F;  2EIJ H;  3F9K A;  3J81 K;  3JRE A;  3S3O A;  3KP4 A;  4X0G A;  1Y0N A;  2BEO A;  4GRI A;  3WTU C;  4HDV A;  1UG2 A;  1K61 A;  2RC4 A;  5DYM A;  1T0F A;  2V6E A;  5E1Z B;  1MMD A;  1TQP A;  5E17 F;  1A6Q A;  2LNB A;  5F6F A;  1T38 A;  1TL8 A;  3DCF A;  2BW3 A;  2KIS A;  3CDL A;  2LF8 A;  3IH4 A;  2K40 A;  3W3C A;  4FCY A;  4FTH A;  1UJ8 A;  1U8B A;  3NAU A;  4UV9 A;  1I6H J;  3VOE A;  2UWM A;  4BJT A;  2L9V A;  2FBI A;  2XKO A;  3GFM A;  3RJP A;  5FGM A;  4B48 A;  2R7D A;  1VQN I;  1BR2 A;  1FBU A;  2X6Y A;  3FZV A;  3QWL A;  1EV7 A;  3PL8 A;  3OYF A;  2HQA A;  2P6T A;  2OZU A;  1QVU A;  2RNG A;  1QQI A;  2HFH A;  1O3S A;  3G1O A;  5LHI A;  5CQE A;  4A69 C;  1T0F C;  3LSI A;  1X3W B;  3AG4 H;  2GBY A;  2W24 A;  5J1U A;  3GZN B;  4AIK A;  1VQ9 I;  4CGZ A;  2MYS A;  5JI6 A;  4YRV A;  2MH2 A;  1SEU A;  2XDV A;  1U2W A;  1XMA A;  2NS8 A;  3BPX A;  1QHG A;  3BG6 A;  3FDY A;  3E0J B;  5KVR A;  4BE0 A;  1FJL A;  4IRH A;  2CUF A;  3TO9 A;  5FLV A;  4M9Z A;  3GXO A;  3OYG A;  1R58 A;  1O7F A;  2V1X A;  1JGG A;  3Q0W A;  2ME6 A;  2F5D A;  1ITY A;  1MMN A;  1FYL A;  2V26 A;  2GXA A;  2JUC A;  4MLO A;  2E2I J;  2BY1 A;  1J59 A;  5DV5 A;  1JE8 A;  3B02 A;  1XCB A;  4Y52 J;  1MSE C;  5JVG F;  3WG7 H;  1D3Y A;  1EA3 A;  1W36 D;  1X3Z B;  1QO0 D;  1RR8 C;  1FOK A;  4Q48 A;  2LD5 A;  1VQ7 I;  1Y1V J;  2XGE A;  3HZJ A;  1TWF J;  3KP7 A;  3GW2 A;  5BS6 A;  2MLG A;  2JA8 J;  3S1M J;  2WV1 A;  1LDK B;  2VT3 A;  4RMN A;  1S8N A;  1X1C A;  3K6G A;  3O8H A;  3HSR A;  3SFZ A;  1P9Q C;  5E3M A;  3G3Z A;  4E4H A;  2DPU A;  1YJN I;  4Z6Y A;  4EJT A;  3SHF A;  1KZH A;  1ZK8 A;  5C4J J;  2EJR A;  1MBH A;  1NTC A;  4EEF G;  2LKX A;  3ZN0 A;  4UY8 I;  2K9M A;  1JUP A;  1TNT A;  4EQQ A;  5EDN A;  3ZQ7 A;  4M9S A;  2QLZ A;  3S15 J;  3QYE A;  3E6M A;  5KAF C;  4BDY A;  3J7A Y;  2M87 A;  4LK1 F;  4W1U A;  3HRS A;  1HA8 A;  2FRH A;  1RUN A;  2VQL A;  1SC7 A;  4G6Q A;  3M1E A;  2IGK A;  2QCO A;  2WAF A;  4A2U A;  3EET A;  4ENJ A;  1R1U A;  4Z2Y A;  4BGD A;  2VE8 A;  2V9P A;  3LSK A;  3RKW A;  5E3O A;  2R0Q C;  2F5F A;  1BOB A;  1G3W A;  2Y30 A;  3JRA A;  4IKF A;  1ETQ A;  2MW8 A;  1T98 A;  1IDY A;  4JX4 A;  1DPR A;  4EAT A;  1MJA A;  1USS A;  2X1E A;  4S0H B;  5HLH A;  1OCR H;  1FNN A;  2KZG A;  1QU3 A;  3S32 A;  5IT3 A;  2XAH A;  4NDL A;  2Y48 A;  4E7S A;  2OCE A;  5K7F A;  5ILV A;  1H88 C;  3RQ4 A;  3LNQ A;  2FJ1 A;  3JAM Z;  4EMS A;  3ONQ A;  1XDS A;  3GZ6 A;  2VUM J;  4Y7N J;  1GVD A;  3BTC A;  4MQ9 F;  4XK4 A;  5C44 J;  1R1V A;  2A69 F;  3QOE A;  4A5M A;  3E5Q A;  3OYL A;  3I59 A;  1XPX A;  5GPA A;  3BG5 A;  3QOD A;  4HNU A;  2OUM A;  2ESH A;  2BV6 A;  2H27 A;  3GBG A;  4YFX F;  4QWQ A;  3LSJ A;  3P5J A;  4F91 B;  2OCC H;  3ABT A;  1R00 A;  2LY2 A;  3E6D A;  3ZQQ A;  5LHH A;  1Q1V A;  4ANJ A;  2ID3 A;  5HS7 A;  4L18 B;  2DMT A;  2NYX A;  1UCR A;  2QSF X;  3WGG A;  2PMH A;  2OQR A;  4NHJ A;  2M0M A;  1XCV A;  3GTL J;  4A3E J;  5J1R A;  1YIT I;  4BE2 A;  1H8A C;  3KZZ A;  1LDD A;  2BW3 B;  2JN6 A;  3IAM 2;  2F6C A;  4BJ5 C;  1N77 A;  1V5E A;  4XNF A;  1KQ0 A;  4RAY A;  3L7W A;  3ZQF A;  2QEX I;  1ZRE A;  3M1C A;  2EFW A;  2P7C B;  3B73 A;  2EIN H;  3LA3 A;  2CV0 A;  2NNN A;  4HRI A;  5J4Y A;  3GTM J;  2YR2 A;  3RDI A;  2LFB A;  1LKX A;  3S1R J;  4LJZ F;  1AU7 A;  1P4X A;  4XSZ F;  3H3U A;  2FMY A;  1FBS A;  2AS5 F;  1Y1W J;  3H0G J;  3HOX J;  3RIR A;  1XSX A;  3CD6 I;  3LMM A;  1R9T J;  3VFZ A;  4UHT A;  5J6X A;  1ZG3 A;  2CUJ A;  1NHA A;  1XD7 A;  3S8P A;  5DCF A;  1BM9 A;  4D5C A;  2HZD A;  2Z99 A;  5ERI A;  1FLI A;  3LAP A;  5BNG A;  2DOE A;  1MH4 A;  3S93 A;  5IP7 J;  1SFU A;  2EWN A;  4G7H F;  2X0L A;  4V2G A;  1OFC X;  2PMZ N;  2IPQ X;  1TQI A;  1B9N A;  2GIZ A;  2K7L A;  4DQ2 A;  4CCO A;  5EEH A;  3HOU J;  2Z2S B;  1YLF A;  2EZI A;  5EYR A;  2EK5 A;  1D1B A;  5IYB J;  4C30 A;  2L7M P;  1I6X A;  3FXR A;  4M9X A;  1IRF A;  2E1C A;  1X1A A;  4Y33 A;  1U6G A;  3BY6 A;  2TDX A;  2XPW A;  3LQR A;  4L5J A;  2Y9Y A;  4ZZL A;  3BG9 A;  2R7V A;  3SDG A;  4DOZ A;  1ZGJ A;  2ZME C;  1GXQ A;  3LFK A;  4BH9 A;  4ASN A;  2IEK A;  2D1V A;  2EA4 A;  3DPL C;  2R5Y A;  5CVR A;  2JRM A;  4G8X A;  3JR9 A;  1BI2 A;  3BDD A;  1UB9 A;  4G94 A;  4I09 A;  2Q2E A;  3GWZ A;  3BLY A;  1QPI A;  2XAJ A;  1MD0 A;  5E20 A;  1HOM A;  1MBG A;  3O8G A;  2ZNY A;  3VB2 A;  2L4M A;  1MDM A;  4WK8 F;  1FOY A;  3V42 A;  3WTT C;  4CCK A;  3KYD B;  1U3E M;  2DK8 A;  4MQV A;  2VOP A;  2JPB A;  2XF6 A;  5FO5 A;  3NRV A;  4WWC A;  4UVA A;  2KP6 A;  5CVJ A;  1J9I A;  3JAM K;  4I01 A;  4LOC A;  1Q1H A;  3WGH A;  3JTG A;  4GDF A;  4QLC U;  2LC2 A;  2NS7 A;  3CMM A;  3HHG A;  2ZO4 A;  2ZFU A;  2G0E A;  3M9A A;  4M73 A;  3WHC A;  2R3S A;  2R92 J;  4B44 A;  1R36 A;  3U1D A;  2ADU A;  5EF6 A;  2ETH A;  5L3C A;  2M34 A;  1IZ1 A;  1P2F A;  3UR3 C;  3K1N A;  3MQ0 A;  2HI3 A;  4L9V A;  3R0J A;  4QPO A;  5BMZ A;  3S3N A;  1STZ A;  1UMQ A;  1K83 J;  2E1M C;  3IAS 2;  2KL4 A;  4HF1 A;  1RR7 A;  1WWX A;  3I59 B;  2JA2 A;  2NOG A;  2KDZ A;  2AXT C;  1W4M A;  1IXS B;  2CW0 F;  2HXI A;  1HKT A;  4ABZ A;  1Y0U A;  2BVL A;  1Z91 A;  1MIJ A;  2MH9 A;  2XHK A;  3ZMV A;  2YPR A;  3DPU A;  4M3E A;  5IP9 J;  2HYF A;  2JVG A;  4BS9 A;  2Y69 H;  4M74 A;  1W5S A;  5ICE A;  4NB5 A;  4A0Y A;  4ENK A;  2YU9 J;  1OYY A;  5L3G A;  2EPF A;  2VKH A;  1G3S A;  1YTY A;  1JKP C;  5GAG J;  1ON1 A;  2Z16 A;  3OYJ A;  2VLA A;  1UEL B;  5CPR B;  1CGP A;  3ROU A;  1NG6 A;  2VJ5 A;  2DA5 A;  4U7D A;  4EVI A;  2CH0 A;  3TOB A;  4YG2 F;  4PZJ A;  1U5T A;  3O3K A;  1OCZ H;  4HOB A;  2CW8 A;  5F0F A;  2X6W A;  3HSF A;  2ZJQ F;  3HGG A;  2MFZ A;  4B3A A;  1IXC A;  4XSX F;  2DFE A;  2ZB9 A;  2EIK H;  2V79 A;  3D5R C;  3EUK L;  4RGR A;  1HSJ A;  2X85 A;  2Y0S A;  2I8D A;  1YW9 A;  3BTI A;  1HBX G;  3MEX A;  3WHB A;  4R79 A;  3I5U A;  1JUM A;  4X6A J;  2B0L A;  5ICF A;  3OSG A;  2EH3 A;  3M8F A;  2O3F A;  1GVJ A;  2YSR A;  4O6J A;  1QZE A;  2MC3 A;  2BY2 A;  2EZK A;  3VYT B;  1MBE A;  4CIC A;  1KGS A;  1E3P A;  4M6X A;  3DKW A;  4XQF A;  2HDW A;  2NVU B;  4F3Q A;  1SFE A;  5JLX A;  1IUF A;  3HRU A;  2DO7 A;  4P96 A;  3E7L A;  4LMY A;  3L2Q A;  4XRS G;  2CV2 A;  2DXI A;  2HWV A;  4G6T B;  2ZCW A;  1BI3 A;  2RKH A;  2KPM A;  5FFZ A;  5TGT A;  1F5T A;  5M3M J;  1IXR C;  3IWF A;  4NNJ A;  1VZ0 A;  1TNS A;  3T1B A;  4KIF A;  4Y4R A;  3PO3 J;  1YYV A;  2RDP A;  1JT6 A;  3K4L A;  1OQY A;  3D1N I;  3OMY A;  2CJJ A;  1PUE E;  4XLA A;  2CQX A;  3PIO F;  1P4A A;  2K85 A;  2VI6 A;  2KJB A;  2COB A;  3HB9 A;  5HNF A;  5K7H A;  2W25 A;  2LKS A;  3ZOB A;  3S2W A;  1K4S A;  1MBF A;  2CQN A;  1YJ9 I;  3FXU A;  4BEH B;  4GGG A;  1J0R A;  2ESN A;  3FX3 A;  4CXF A;  2O8K A;  4BQA A;  5DUI A;  3C18 A;  2FOK A;  4DYC A;  2ISY A;  3MMY B;  1N75 A;  3TDU C;  2HEO A;  4KYW A;  5FJ8 J;  3BR5 A;  4DGW B;  2V9K A;  4QPQ A;  4MNU A;  2Z3Y A;  3BG7 A;  2VC0 A;  1MDM B;  4KNY A;  2VON A;  3CDI A;  3TKY A;  2GLO A;  4CCM A;  2ELJ A;  2N8G A;  2L3D A;  1D1C A;  5F1R A;  3P9I A;  1OR7 A;  1P7J A;  2DA6 A;  3ZMS A;  1X1B A;  2DT5 A;  5IOZ A;  1FZP B;  5BOX A;  1FP1 D;  4QIW N;  4J01 A;  3KEQ A;  5BPI A;  4CH7 A;  1LUJ B;  4OAZ A;  4IX7 A;  2DQR A;  1R22 A;  4G6D A;  5B66 C;  4P5O A;  3EUH A;  2CW7 A;  2QWW A;  1A5J A;  4U0W A;  2IS4 A;  4LLL A;  4MGR A;  5ICC A;  3GYH X;  1D5V A;  1P4W A;  2HKX A;  2BE5 F;  1R6R A;  3IKV A;  1ZRC A;  1UHM A;  2PBI A;  2WB1 A;  2HQR A;  3LST A;  4B4C A;  2LR8 A;  3I64 A;  2BBY A;  1KU2 A;  2B7E A;  2L7Z A;  2NRA C;  5JLW A;  2JK3 A;  3VSL A;  5FRM A;  2ZKZ A;  5HDK A;  2A5W A;  1S72 I;  1NH3 A;  4NC8 A;  2KRC A;  1FMV A;  1D0Z A;  2NOJ B;  3HC7 A;  1WJB A;  1MNM C;  1H9G A;  2VE9 A;  4C3J J;  3JCU C;  1LEA A;  4BXF A;  4GYI A;  2VQG A;  3CES A;  1LDJ A;  1FY7 A;  2KIQ A;  4KN7 X;  4ZTJ A;  4Y15 A;  3GFI A;  3GCM A;  2B9S A;  5EGO A;  1H89 C;  1KQ8 A;  1OCP A;  3JSP A;  4JK1 X;  1U5T B;  3MCZ A;  4XLN F;  4AWX B;  5IY5 H;  3ZN1 A;  2O5R A;  3QU6 A;  3ZGK A;  5DDG A;  4N9H A;  1I3Q J;  2DJI A;  1L0O C;  2O9L A;  1H0M A;  2KIU A;  3IWZ A;  2R7W A;  2HDD A;  1AKH A;  5LD2 C;  1FC3 A;  1TWH J;  1WQ2 A;  2XPU A;  4OIR F;  4KA4 A;  3DTI A;  2HXO A;  2LOO A;  5E8I A;  2DI3 A;  4UNO A;  1XGN A;  2HYJ A;  2DMQ A;  2BY3 A;  3OYI A;  2LY9 A;  2RQP A;  3LFU A;  4C2M J;  2JVH A;  1T56 A;  4F92 B;  4DJA A;  2AQE A;  5IT9 Z;  3W6K B;  4M3F A;  2UXN A;  4AID A;  4CCN A;  4BXX J;  3A0B C;  3ECH A;  4BXU A;  1WJF A;  3ESW B;  2EIL H;  1X3U A;  1FSE A;  5KHD A;  1FBQ A;  2Q0O A;  3VYU B;  3F8N A;  1ERD A;  3OYA A;  1WPK A;  4HDU A;  3CCR I;  2VBZ A;  1JTY A;  3HJE A;  4LD5 A;  4XID A;  2V9V A;  1TC3 C;  2YX7 A;  2DA4 A;  2EV0 A;  2R7X A;  2K4J A;  3I4N J;  4HAM A;  3F21 A;  1XSV A;  3SEQ A;  5LGN A;  1F43 A;  1MZB A;  3K0L A;  3OWT A;  1V54 H;  2FA5 A;  2X48 A;  3ZQI A;  3HRM A;  3M07 A;  1TP4 A;  3C2H A;  4EM0 B;  2WAE A;  1X58 A;  2P7V B;  4KT6 A;  2DA2 A;  3CJN A;  2ZXH A;  2CG4 A;  4OIN F;  4ZDP A;  3PO2 J;  3MZ8 A;  1K6O A;  2JRT A;  2XIG A;  1JJ6 C;  5E79 C;  3HBL A;  4XKB A;  5D5V B;  1OMI A;  4ZTF A;  4W97 A;  5GTI C;  3E6C C;  2XAF A;  1WKM A;  3Q9S A;  3OV8 A;  3RPQ A;  2H1L A;  5KCM A;  3ASN H;  5BPD A;  1MMA A;  2HR3 A;  4UB6 C;  4ETS A;  3IH2 A;  3BQY A;  2G9W A;  4M3B A;  3MZY A;  5CVV A;  3IL2 A;  3SJM A;  1SFX A;  1T6S A;  4AUX A;  3IKT A;  1WJA A;  3CCQ I;  2GXG A;  3K70 D;  3OSF A;  4IZZ A;  1KON A;  2V1N A;  1J5Y A;  1ZG1 A;  3CME I;  3OR2 C;  4A3F J;  4UUV A;  1ZEL A;  2P5K A;  1T08 B;  2H6B A;  2O8X A;  3NAR A;  1WCM J;  5GAD J;  4G9Y A;  5E8G A;  1JKR C;  2DFI A;  4BL0 B;  2HDC A;  1DGW Y;  3WTW C;  4KMF A;  2HS5 A;  4HBL A;  1EJ9 A;  3UKG A;  2LRD A;  4EGY A;  2CUZ A;  3SQN A;  3E5X A;  3R60 A;  3J80 Z;  3ZQC A;  3GTQ J;  2TRT A;  3H3Z A;  2WAQ N;  1ETK A;  2DTR A;  1IO2 A;  4K2E A;  1G8X A;  5KAI C;  2D2W A;  1OCC H;  3O6B B;  4IHT A;  1OPC A;  2AXL A;  4NUB A;  1E2X A;  3ZP5 A;  4I02 A;  3LOC A;  4RGX A;  3RTR A;  2E19 A;  2M3A A;  4XRM A;  5FRN A;  3GFJ A;  3I4M J;  2K9L A;  4WXC A;  5C4X J;  4AVP A;  2BXY A;  2QYO A;  1Z7L A;  4KT5 C;  2L0K A;  2O61 A;  3CCL I;  1ENH A;  4HST A;  2HVQ A;  1Z67 A;  5EGO B;  2ZNZ A;  3EUA A;  1HW2 A;  1A31 A;  4JYK A;  1BJZ A;  3JTH A;  1B72 A;  3L09 A;  2FD5 A;  1HW5 A;  2VXD A;  5J3L A;  2QKL B;  5IT9 K;  2Y75 A;  2DLL A;  2KFD A;  3WTX C;  1HF0 A;  3HOV J;  2DT7 B;  2M7A A;  2KLO A;  2R7U A;  4AVZ A;  4EJU A;  1E3O C;  4HV6 A;  4BJ6 C;  1X1P A;  1IDZ A;  4PDK A;  1AKH B;  1X2N A;  2XKP A;  2HQ5 A;  3I58 A;  1Z3X A;  1MBK A;  4BUP A;  4C2U A;  2ISZ A;  1E17 A;  1RZ4 A;  2PJP A;  1HXD A;  5IYC J;  3U2R A;  4ZYA A;  3HXL A;  1JKO C;  2BVM A;  1WJ5 A;  4V19 K;  4G12 A;  5DM7 F;  1MJB A;  2F5C A; 
#chains in the Genus database with same CATH homology
 5BNG A;  1MH4 A;  1CQT A;  3HEF A;  3FK7 A;  5IP7 J;  1Z0X A;  1LE8 B;  4V2G A;  1OFC X;  4J19 A;  2PMZ N;  2DMN A;  5F27 A;  1U78 A;  4MFE A;  3JRB A;  3GTO J;  1RPW A;  3HOU J;  3M3Y J;  3S14 J;  3PM1 A;  2EZI A;  5EYR A;  5FKK A;  1VF9 A;  3MVP A;  5IYB J;  2EQR A;  1F36 A;  2L7M P;  1VFC A;  1B8I A;  5M5W J;  1YRN A;  4M6V A;  4AC0 A;  4A3M J;  2XGC A;  3FK6 A;  2XPW A;  2Y9Y A;  4X1E A;  4IHX A;  1FIP A;  2X6O A;  3BG9 A;  3SDG A;  1YRN B;  2DMU A;  1HCR A;  2IEK A;  1QVT A;  3JRF A;  1WI3 A;  1LFB A;  3A01 B;  2R5Y A;  3JR9 A;  1LFU P;  2XGD A;  1VI0 A;  2M8G X;  2FQ4 A;  4B1R A;  1P7I A;  1QPI A;  3CCY A;  2R5Y B;  1FTZ A;  2LVS A;  1HOM A;  2R93 J;  1MBG A;  3O8G A;  1TWA J;  3HGY A;  4FE4 A;  5FKO A;  2M9H A;  3GTP J;  3BQZ A;  2XB5 A;  2QF7 A;  1DU0 A;  1ETX A;  2EZH A;  1NK2 P;  1JTX A;  1XG1 A;  2XSD C;  1XC5 A;  4LOC A;  4BBS J;  2ME0 A;  2NS7 A;  4A3B J;  1ZQ3 P;  2G0E A;  2JJ7 A;  1IV6 A;  2VKE A;  4UUS A;  3WHC A;  2R92 J;  2JA7 J;  4QSH A;  2DMP A;  2DTZ A;  2K9S A;  4IHV A;  3QPL A;  5EF6 A;  2M34 A;  3IV5 A;  2LP0 A;  3BR3 A;  2EBI A;  2HI3 A;  5J1Y A;  1UMQ A;  1K83 J;  2JMW A;  5M3F J;  3S1Q J;  5DTD A;  5GPC A;  1RR7 A;  1GV2 A;  5F1J A;  1GT0 C;  3GTG J;  2NOG A;  3JRD A;  2KDZ A;  1GDT A;  2AHQ A;  2HXI A;  2XPV A;  2OPT A;  4ABZ A;  2E2H J;  4I76 A;  2K9N A;  1MSF C;  3CMY A;  3RZD J;  1T33 A;  2O7O A;  2ID6 A;  5HOD A;  4M3E A;  5IP9 J;  2NVT J;  2CQQ A;  3C2B A;  3L1P A;  3ZQL A;  3HDD A;  2I10 A;  2YU9 J;  3MN2 A;  2IBD A;  1RET A;  3JRI A;  4BY1 J;  1JKP C;  3GTJ J;  3JRH A;  1FTT A;  1VND A;  4IHY A;  3H3V K;  2RAE A;  4CYC B;  2DA5 A;  3S16 J;  1POG A;  5EEA A;  1B72 B;  1APL C;  4MFD A;  3Q0V A;  5F0F A;  3MKL A;  1Z77 A;  3HGG A;  1GV5 A;  4B3A A;  2L9R A;  2ZB9 A;  1U9N A;  1W0T A;  2H8R A;  3BTI A;  2YS9 A;  1RKT A;  9ANT A;  3WHB A;  4X6A J;  1JUM A;  3OSG A;  2EH3 A;  3DEW A;  4IHW A;  2EZK A;  4HNV A;  5IPA A;  5FKN A;  1ETW A;  3FKI J;  1MBE A;  2CU7 A;  1BA5 A;  2Y31 A;  3VPR A;  4JP0 A;  3B6C A;  5JLX A;  1IUF A;  3TP0 A;  1ZR2 A;  3E7L A;  4XRS G;  3K7A J;  2D5V A;  4GFB A;  4A3G J;  5M3M J;  1ORK A;  3GTK J;  2NVX J;  4I6Z A;  3PO3 J;  1B8I B;  1JT6 A;  3BG3 A;  4A3J J;  1ETV A;  3D1N I;  2CJJ A;  3S17 J;  2NVY J;  2CQX A;  3BR1 A;  1HDP A;  2VI6 A;  1ZR4 A;  1U9O A;  2XRL A;  3TED A;  3HB9 A;  2COB A;  2CRG A;  5FLM J;  2DJN A;  4L5E A;  5K7H A;  4BBR J;  3TW6 A;  1WH5 A;  3G1M A;  3ZOB A;  1MBF A;  2O8K A;  4C3H J;  3FIW A;  1AHD P;  1RKW A;  5FKM A;  3LSR A;  3QQA A;  4DYC A;  3HM5 A;  5EG0 A;  5FJ8 J;  3BR5 A;  4XIC A;  5IYD J;  3HOZ J;  4A3I J;  3RZO J;  1PUF A;  1HDD C;  2FX0 A;  4A3C J;  2GLO A;  3JRG A;  2N8G A;  1EF4 A;  1P7J A;  2IAI A;  4FE7 A;  2DA6 A;  5IOZ A;  3IH3 A;  1IRZ A;  4JX6 A;  1BL0 A;  5EZH A;  4QIW N;  2KT0 A;  2LK2 A;  3TP3 A;  1O4X A;  4UUS B;  2ECB A;  5E3L A;  1DU6 A;  1A5J A;  3BR6 A;  3BR0 A;  5F0H A;  5F08 A;  1W0U A;  3BTL A;  3HKZ N;  5F0C A;  1IGN A;  1IC8 A;  1S7E A;  3Q3S A;  3SFI A;  3F0C A;  2R5Z A;  4FIS A;  2EZL A;  1TWC J;  4B4C A;  2LR8 A;  3LSP A;  2L7Z A;  3RQI A;  1LE8 A;  5JLW A;  3A03 A;  4A3D J;  2JK3 A;  5FKL A;  3JRC A;  1WH7 A;  1JKQ C;  3JRE A;  1RES A;  4D7N A;  1BW5 A;  1MNM C;  1UG2 A;  4C3J J;  4MIM A;  4XRS A;  1K61 A;  5M5Y J;  3Q0U A;  2DA3 A;  2HOA A;  3DCF A;  3CDL A;  4QTR A;  4RBO A;  4UUT A;  2M0C A;  2ECC A;  1IG7 A;  3HOY J;  4FCY A;  3IH4 A;  2K40 A;  5EGO A;  4FTH A;  1H89 C;  1U8B A;  3NAU A;  1OCP A;  1I6H J;  4D5F A;  2H1K A;  1I3Q J;  3LSG A;  5K7Z A;  5M5X J;  5F04 A;  2O9L A;  1ZKG A;  1QVU A;  3BT9 A;  4DW6 A;  1NK3 P;  1IJW C;  2HDD A;  4BY7 J;  2TCT A;  3G1O A;  1AKH A;  1G2H A;  4A69 C;  1TWH J;  2XPU A;  2HXO A;  3S2H J;  1SFO J;  2GBY A;  5J1U A;  2HYJ A;  2DMQ A;  2LY9 A;  3ZQH A;  4DYQ A;  4C2M J;  1T56 A;  2ELK A;  4JX5 A;  3OOU A;  4M3F A;  2NS8 A;  2DA7 A;  1FJL A;  4BXX J;  1GUU A;  2CUF A;  5FLV A;  1MH3 A;  3FIS A;  2Y0S N;  1JGG A;  3Q0W A;  2ME6 A;  2JA5 J;  1ITY A;  2DA1 A;  1WPK A;  2HOT A;  2OF7 A;  1X2M A;  1JTY A;  4XID A;  4MLO A;  2E2I J;  1OJL A;  1TC3 C;  2B63 J;  2DA4 A;  2LTP A;  2AO9 A;  3I4N J;  1MSE C;  4Y52 J;  2X9D A;  2MSY A;  2VKV A;  1F43 A;  1UHS A;  1ETY A;  1XS9 A;  2X48 A;  2LD5 A;  3ZQI A;  1Y1V J;  2CUE A;  2XGE A;  1TWF J;  2DN0 A;  4D7M A;  3BTJ A;  1X58 A;  2DA2 A;  2JA8 J;  3S1M J;  2WV1 A;  5DS9 A;  5E3O A;  3O8H A;  5E3M A;  3PO2 J;  3A01 A;  2NVQ J;  3HOW J;  2GM4 A;  2E2J J;  1ZK8 A;  1JJ6 C;  5C4J J;  3HBL A;  5EG0 B;  1MBH A;  1NTC A;  3CQZ J;  4EEF G;  2LKX A;  3G1L A;  4W97 A;  2L7F P;  1PUF B;  1JUP A;  3K2A A;  5EDN A;  3IH2 A;  3BQY A;  3S15 J;  4M3B A;  2VPR A;  3SJM A;  4AUX A;  1QRY A;  1WGX A;  2W48 A;  3OSF A;  4W1U A;  2P81 A;  1D5Y A;  4A3F J;  2JA6 J;  2QCO A;  3S1N J;  5EZG A;  2JWT A;  3NAR A;  2R0Q C;  4A3L J;  1WCM J;  1BW6 A;  1JUS A;  5IOY A;  1JKR C;  2Y30 A;  3JRA A;  1ETQ A;  2MW8 A;  1ZGW A;  4DZP A;  1IDY A;  4JX4 A;  4AYB N;  2R7Z J;  3TW7 A;  4S0H B;  4C3I J;  3UKG A;  4RDU A;  4NDL A;  3A02 A;  5K7F A;  1ETO A;  1H88 C;  3LNQ A;  4MO7 A;  2FJ1 A;  2R5Z B;  3ZQC A;  1MBJ A;  2VUM J;  4Y7N J;  1GVD A;  2TRT A;  3BTC A;  4XK4 A;  5C44 J;  3GTQ J;  4BKX A;  1JJ8 C;  2WAQ N;  1ETK A;  5GPA A;  1ZTR A;  3BG5 A;  3W6V A;  2MG4 A;  3GBG A;  3LSJ A;  1A6I A;  2E1O A;  3QPS A;  5GP9 A;  4DYR A;  3LOC A;  1Q1V A;  2E19 A;  2ID3 A;  4XRM A;  2DMT A;  2XB0 X;  3I4M J;  2Y9Z A;  4M3G A;  3GTL J;  5C4X J;  4A3E J;  2WB1 N;  5J1R A;  1H8A C;  1FEX A;  2L0K A;  4M3D A;  2JN6 A;  1ENH A;  3B6A A;  5EGO B;  3ZQG A;  1HLV A;  4JYK A;  2Y2Z A;  5IP6 A;  4CYC A;  1BJZ A;  3S2D J;  3ZQF A;  1B72 A;  4IEJ A;  2FD5 A;  5E3N A;  3GTM J;  1TWG J;  1OCT C;  2LFB A;  5J3L A;  2HOS A;  2LLK A;  3S1R J;  1HF0 A;  1AU7 A;  3HOV J;  3RKQ A;  1SAN A;  2MGQ A;  1E3O C;  1Y1W J;  3H0G J;  4A3K J;  3HOX J;  1AKH B;  1X2N A;  1IDZ A;  2HQ5 A;  3BR2 A;  4V2F A;  1MBK A;  1R9T J;  3M4O J;  4DZJ A;  2YUS A;  1I50 J;  2K9Q A;  1JT0 A;  5C3E J;  5IYC J;  4D5C A;  1JKO C;  4A93 J;  2M2E A;  4G12 A;  1FIA A;  3OIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...