2WAQN

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2waqN00
3JRDA 3TW6A 1RETA 1G2HA 4DYRA 1MBFA 3S1NJ 3WHCA 2IBDA 1JT0A 3ZQGA 3I4NJ 3JRFA 2DN0A 1U78A 2JWTA 5J1YA 1I50J 3GTQJ 3BG3A 3ZQHA 4BY1J 3TW7A 1XS9A 1WPKA 5GP9A 1GT0C 2CUEA 2DA2A 1AKHB 2R7ZJ 5F27A 1AKHA 2H1KA 3HOYJ 5F04A 4DYCA 1XG1A 5IYBJ 5E3OA 1QVUA 1WI3A 2Y31A 1ETXA 3C2BA 4J19A 1WH7A 2LR8A 4JX4A 4XICA 3G1LA 1FTTA 1Z77A 5C4XJ 2ME0A 5IP9J 4C3JJ 1OCPA 1IDYA 4I76A 1WGXA 4JX5A 4HNVA 4DZJA 1ZR2A 3GBGA 3M3YJ 1GDTA 1VI0A 1Y1VJ 5E3LA 1IRZA 2CQQA 2DA3A 1W0UA 5HODA 2ECCA 1IGNA 3LOCA 4D7NA 1X58A 3A03A 2JA8J 3BT9A 2QF7A 5M5WJ 3SDGA 4S0HB 2RAEA 1S7EA 2GBYA 4C3IJ 4CYCB 1ORKA 4EEFG 4CYCA 2TRTA 1O4XA 2PMZN 5FKOA 2N8GA 4BXXJ 3GTKJ 1JJ8C 2EZKA 2M2EA 2HXOA 1TWHJ 4MLOA 3OOUA 3K7AJ 3S1MJ 2O8KA 4M3GA 1RESA 2YU9J 1FTZA 2X48A 3GTLJ 2ECBA 5GPAA 3HDDA 2AHQA 5M3FJ 5FKKA 4C2MJ 5K7FA 4XK4A 2E1OA 3IV5A 2HXIA 2VUMJ 5C3EJ 1JT6A 4XRSA 4M3FA 2EQRA 3OSFA 1MSFC 4A93J 4X6AJ 1ZKGA 2ZB9A 5FKNA 2HOTA 2JA5J 3LSPA 5F1JA 1OFCX 2XB0X 3BQYA 4UUTA 1Y1WJ 1WH5A 4M3DA 3ZQFA 2DA5A 3S16J 1GUUA 1JUSA 1OJLA 3GTMJ 1BJZA 3I4MJ 2YUSA 3HM5A 5M5XJ 3SFIA 2G0EA 1W0TA 1FJLA 4Y52J 1MBKA 2XPWA 3LSJA 1H8AC 4BKXA 1MH4A 2OPTA 2Y30A 2DA4A 2COBA 4D7MA 5DS9A 2AO9A 3B6AA 3NARA 2K9SA 2VKVA 3RKQA 2EZHA 4IEJA 1H88C 2DTZA 3PM1A 4A3JJ 2WAQN 1MBGA 1TWAJ 5F08A 1RPWA 2GLOA 2NVYJ 1ETKA 1JKOC 2DMNA 3BTLA 2DMPA 2MGQA 2Y2ZA 4NDLA 3JRIA 4A3FJ 2EZLA 2EZIA 2JN6A 2E2JJ 2X6OA 3HB9A 5J1RA 3JRCA 3H3VK 4W97A 2KDZA 3JRGA 4XIDA 1XC5A 2CUFA 2M34A 3FK6A 1IC8A 3BTCA 2HDDA 1I3QJ 5FKLA 1QVTA 2W48A 2XRLA 5K7HA 5JLXA 2DJNA 2LK2A 2DMTA 2QCOA 4A3BJ 3Q0WA 1ZQ3P 2K9NA 3JRBA 4V2FA 5C4JJ 2VKEA 2ID3A 2M8GX 3QQAA 3S1QJ 3O8GA 1AU7A 3A01A 3BQZA 5M5YJ 2R93J 1IDZA 5E3MA 5EZGA 4RBOA 3TEDA 1HLVA 1RKWA 1NTCA 3BG5A 3BR1A 2NVTJ 1ETOA 2M9HA 1JUPA 2DMUA 4D5FA 1QRYA 1TWGJ 3NAUA 4A3GJ 2TCTA 5EF6A 3JRHA 3IH4A 4B1RA 3ZOBA 1CQTA 1ETYA 2R92J 1ITYA 3S1RJ 4AC0A 2FD5A 3HOWJ 3BR2A 5DTDA 1POGA 3MN2A 1MSEC 1OCTC 3HOZJ 1JTXA 1UG2A 1SFOJ 1LE8B 2B63J 1LE8A 4X1EA 1GV5A 3M4OJ 1GVDA 1MBHA 5FLMJ 3HGYA 2FJ1A 3L1PA 3BR5A 5IPAA 1B72B 3IH3A 2R5YB 1HF0A 1B72A 1P7JA 5EZHA 2R5YA 1I6HJ 3GTOJ 2GM4A 1BL0A 4AYBN 4IHYA 1IJWC 2LY9A 3CCYA 3S2DJ 3HGGA 5IYCJ 4DZPA 4A3EJ 4QIWN 5IOYA 3DEWA 3WHBA 2E2HJ 2P81A 3QPSA 3ZQIA 1IUFA 2EH3A 4M3EA 4FCYA 2E19A 4A3MJ 2LTPA 1NK3P 3JREA 2LD5A 3GTJJ 1FIPA 5IYDJ 1R9TJ 1IV6A 1A5JA 5J3LA 2D5VA 5EDNA 5J1UA 1LFBA 2O9LA 2NOGA 1ZK8A 3F0CA 4JP0A 1FIAA 2L7FP 1A6IA 5IOZA 2L0KA 4JYKA 1MH3A 1MNMC 1B8IB 1LFUP 1F43A 1EF4A 1D5YA 4M6VA 1B8IA 3SJMA 5FJ8J 1BA5A 2XB5A 3HKZN 3RQIA 1ZR4A 4B4CA 3GTPJ 1AHDP 5FKMA 3ZQCA 3W6VA 5K7ZA 1HDPA 1T33A 3LSRA 2R5ZB 2XGCA 3FIWA 2R5ZA 1APLC 1JKQC 2XGEA 1JKPC 4FTHA 4Y7NJ 4M3BA 2LFBA 1ZGWA 2HOAA 4A3IJ 1E3OC 2VI6A 1PUFB 1Q1VA 1SANA 1PUFA 2ELKA 3G1MA 3FK7A 3IH2A 2LLKA 4A3KJ 4DW6A 1MBJA 2ID6A 1ETQA 2NVXJ 2Y9YA 3RZDJ 5IP6A 4BBRJ 5F0FA 1VF9A 3B6CA 2XPVA 3CMYA 3A01B 1X2MA 4A3LJ 4DYQA 1MBEA 2XPUA 2IEKA 5EGOB 2CRGA 3H0GJ 3TP3A 5EGOA 3UKGA 3GTGJ 1VFCA 3TP0A 3S14J 4FE7A 3A02A 4JX6A 4W1UA 2LVSA 3S2HJ 1JJ6C 4A3CJ 1HOMA 2JJ7A 1DU6A 4V2GA 2Y9ZA 1DU0A 2E2IJ 4L5EA 3PO2J 2JMWA 5F0CA 2MSYA 1YRNB 2DA7A 1JGGA 2KT0A 1YRNA 3S17J 3ZQLA 3OIOA 5EEAA 3FKIJ 3E7LA 1QPIA 3LNQA 5IP7J 2EBIA 5EYRA 1ETVA 4LOCA 2LP0A 2MG4A 2MW8A 3BG9A 4IHVA 2HI3A 1ETWA 2XSDC 1UHSA 2CJJA 1U9OA 3FISA 5F0HA 1UMQA 4QSHA 1TWCJ 2X9DA 4D5CA 1NK2P 2DMQA 1U9NA 1VNDA 4I6ZA 4AUXA 1P7IA 2NS7A 3K2AA 4G12A 3O8HA 4MIMA 1H89C 2LKXA 2CQXA 4QTRA 5GPCA 3VPRA 4MO7A 2CU7A 2NS8A 2WB1N 2YS9A 2R0QC 1ENHA 2DA1A 2JA6J 2K40A 2JA7J 2Y0SN 1BW6A 2FX0A 4A69C 3HOXJ 2HYJA 4IHXA 3BR3A 2OF7A 5EG0B 3HBLA 3JRAA 3RZOJ 2WV1A 5EG0A 3CQZJ 4IHWA 5FLVA 1BW5A 3HOUJ 9ANTA 4XRSG 2M0CA 4B3AA 4UUSB 3MVPA 1HDDC 4UUSA 4A3DJ 3JR9A 2FQ4A 3BTIA 3DCFA 5E3NA 2K9QA 4ABZA 3Q0UA 2HQ5A 1HCRA 1T56A 1RKTA 3HOVJ 2ME6A 3OSGA 3G1OA 4MFDA 4XRMA 3MKLA 4MFEA 1K61A 1JTYA 1U8BA 1F36A 2O7OA 5M3MJ 1TC3C 4FISA 4BBSJ 2DA6A 1FEXA 2L7ZA 1JKRC 3BR6A 2H8RA 4BY7J 1GV2A 4RDUA 1X2NA 5C44J 3BR0A 2NVQJ 1JUMA 1ZTRA 4GFBA 3BTJA 3QPLA 4FE4A 3D1NI 1K83J 2VPRA 1RR7A 2I10A 2JK3A 2XGDA 3CDLA 1Z0XA 2IAIA 4C3HJ 3S15J 5JLWA 3PO3J 2L9RA 3LSGA 1WCMJ 1IG7A 1TWFJ 2HOSA 3Q3SA 2L7MP 3Q0VA 5BNGA 3HEFA
chains in the Genus database with same CATH superfamily
3AFHA 4HV6A 3JRDA 4LLGF 4BQAA 3O3KA 3TW6A 1WJCA 1G2HA 2Y0MA 2Q1ZB 2EV5A 2CUZA 5CKTA 2JUCA 4C9YA 1YOVB 1XSDA 1T98A 3GWZA 2IBDA 2KIQA 1GVJA 2ZMEA 2DN0A 5J1YA 2HDWA 3BG3A 3ZQHA 2ETHA 4BE2A 1XS9A 3HRUA 3OYHA 1P92A 1ZELA 1FWZA 1GT0C 1N78A 4GGGA 2R7ZJ 3ZQ7A 3RDIA 3TO7A 3HOYJ 4CO8A 1MJAA 3I53A 3HSEA 5IYBJ 3BY6A 2Y31A 3C2GA 2Q0OA 2QLZA 2W24A 2LMDA 3KP4A 4RB0A 3KZZA 5CVIA 1J75A 1FSHA 4J19A 1IUYA 1IRXA 2IA1A 3N97A 2V1UA 3W2AA 2LR8A 4JX4A 2DFEA 4F91B 1FTTA 2P0WA 2R7FA 1VZ0A 2EFQA 2MD5A 2EIJH 4I76A 1R4NB 4JX5A 1ZR2A 4XLFA 4U0VA 3V4GA 1Y1VJ 1ONVA 1K78A 1U2WA 2CH0A 2I8DA 4D1QA 2BY1A 1ON2A 1Z7UA 1J5YA 1FBUA 3HSFA 3V7CA 3F22A 4I0BA 1IGNA 4D7NA 2IGNA 3KETA 4I02A 4Y17A 3WG9A 2OTLI 1X58A 2JA8J 1CF7A 2CW0F 1OYIA 1ACIA 2GBYA 4C3IJ 3O6BB 3SZGA 1XGOA 3DPTA 4HBLA 2LREA 1O4XA 5FKOA 3C2HA 1TNSA 3J80Z 1MMGA 1UELB 3WTSC 1L0OC 2EZKA 2HKOA 3FMRA 4U0WA 1KQ9A 3K7AJ 1BI0A 3F23A 2L01A 1BJAA 2QEXI 4HLXA 3FXLA 4WXCA 2ECBA 3HDDA 4C2MJ 4JOMA 4XK4A 1YO5C 5BPDA 3M8FA 3DKYA 3K4LA 1TT0A 1BR4A 3M1EA 3OSFA 2AXLA 4X6AJ 3KYCB 1ZKGA 2ZB9A 3CCRI 3F72A 3LSPA 2GWRA 2GIVA 5DD4A 2GOXB 4BAYA 1EKEA 3ZQFA 4OAZA 5KNLA 3S16J 4ZJZA 1GUUA 1JUSA 4BU2A 2PQ8A 4PJMA 5HLTA 4BE1A 1REPC 2QSHX 3GTMJ 1BJZA 5CVUA 2YUSA 3HM5A 4B8XA 5D5UB 3C18A 2G0EA 2F4MB 3KP5A 1Z91A 2IS1A 3BJOA 3GXOA 3FMSA 4ENJA 1LJ9A 5FLXK 2Y30A 2BHYA 1RUOA 4YG2F 2X6YA 2QSGX 2FA5A 2DDAA 3B6AA 3GUDA 5CQEA 2JSCA 1V5GA 4EMSA 3KP6A 2QVOA 4IEJA 3WGHA 2IA2A 3UNGC 2VJIA 4A3JJ 4S05A 2MLGA 2XAFA 4U7DA 2V9PA 4DGWB 1NHAA 3K2ZA 1MBGA 4Y15A 2Q2EB 1RPWA 3GZ6A 2FBKA 4G9YA 1ETKA 4IQJA 4Q47A 2E2JJ 2EZLA 1KYZA 2EA2A 3ZMVA 3JRCA 4EGZA 5J4VA 3H3VK 2KJCA 4XIDA 1XC5A 1KGSA 2CUFA 4E7LA 4F92B 2XGXA 3FDYA 2YX4A 4HQEA 4OIRF 1I3QJ 1QVTA 5K7HA 2UXXA 2QCOA 2IP2A 2M7AA 3Q0WA 4CCMA 1EJ9A 2BW3B 3E3VA 4AD9A 1LVAA 4UB8C 2A05A 3FXKA 4EM1A 4L0ZB 2Y69H 2OZUA 4BNCA 1HLVA 4G6DA 3TEDA 4HOBA 1RKWA 3TQNA 5GADJ 3BR1A 2LOOA 2JRTA 4MEXF 1ETOA 2M9HA 2V1NA 4FX4A 2R7UA 3CMMA 5GAEJ 1D8KA 2B9SA 5EF6A 4B1RA 2L9SA 4LLLA 4DBQA 1ETYA 2OU2A 1USSA 3S1RJ 2FD5A 3BR2A 4UVAA 1DQUA 3TL4X 5E1XA 4GDFA 4G7HF 4UVBA 2HYGD 2Y75A 1MSEC 1D0YA 2PMUA 3FXUA 2WADA 1LE8B 2C6YA 2FOWA 5A2QZ 2D45A 4X1EA 2V1DA 3HIFA 3EYYA 1W5TA 1KU7A 1BOBA 2ZJ2A 3G71I 5FROA 1XMXA 2QYOA 1B4AA 2FJ1A 2VOOA 1JGSA 2NNNA 2R7XA 3IKVA 2GAUA 1R1TA 4RB1A 3ESWB 1B72B 3LQQA 3R0JA 1HF0A 4E7JA 2R5YA 4Z6YA 3H5RA 5ICGA 1YS7A 4IHYA 2VT3A 1TZLA 4I7HA 1LKXA 4G6TB 3DEWA 2VJ5A 3V7RA 3QP6A 4A0ZA 3ZQIA 2Z9OA 3PSFA 2F4IA 5ICEA 2KMUA 1EH8A 2WTEA 3SZTA 4BJTA 3GTJJ 3QYBA 1U5TA 4E7SA 2E35A 1R9TJ 1GLNA 1A5JA 4ZDOA 2WAFA 3ROUA 3BCAA 2O9LA 1T38A 2L7FP 2ZJPF 1T6SA 4EATA 2EJRA 2DK8A 5IOZA 1MH3A 1FP1D 1LFUP 2XAJA 1S29A 4ZH4F 1GXQA 2IGOA 3CJTB 1X1BA 3IUOA 4IHTA 3RQIA 1ZR4A 2LYCA 2EB7A 2XVCA 5TJJA 2V7FA 5CVJA 2V1XA 5FKMA 5BQTA 1X4PA 3ZQCA 2LDUA 5K7ZA 1HDPA 1WJFA 3NWSA 5JVTA 5A2QK 1YX3A 2XKOA 3LSRA 2Q8KA 2R5ZB 4F93B 3W6KB 2KISA 2VIXA 4MNUA 4BXFA 4G7OF 1J7KA 4M73A 4Y7NJ 2O0YA 1TLHB 4M3BA 1FOWA 2LFBA 1KU9A 3KIOA 3V7SA 3IKTA 2H94A 4KDPA 1MKMA 1FMWA 5HS8A 3CJNA 3EPZA 2AXTC 2IA0A 2STWA 2QBYB 1PUFB 1S8NA 1Q1VA 1X3WB 3LSKA 4AYBA 3FWEA 2JRMA 3BJAA 3L2RA 4HV5A 1VQ8I 4DW6A 5E18F 3WTUC 4HNTA 5L3DA 4XOPA 2H8WA 2LKSA 3I59A 4ZDLA 3REOA 2CFXA 4BBRJ 3MAJA 2M3AA 2DPUA 1X2MA 1MBEA 4WXDA 4LD5A 3QU3A 4IPAA 1YLFA 4EV0A 1ON1A 3H0GJ 3TP3A 5LEJA 3PL8A 2ZXWH 5CYVA 4FE7A 2L3DA 1FX7A 4JX6A 4W1UA 3DWLE 3B73A 3GYHX 2JJ7A 4UNOA 1TQPA 3H9GA 3DKWA 4J01A 4B44A 2HDCA 2Y9ZA 2E2IJ 3FM5A 4ENKA 1RRJA 3I64A 2JMWA 5E8IA 2KKOA 2P7CB 3M8JA 4MEYF 2HVSA 3WODF 1IF1A 2VLAA 2XAGA 4IOAF 5B5EC 1QPIA 3RPUA 5IP7J 1R71A 1ETVA 3FXOA 2VE8A 1UCRA 1WVRA 2DYRH 2ZC2A 4IXAA 4WX9A 1FSEA 2XSDC 1O7FA 2A3SA 3IRQA 3QPTA 4QSHA 1TWCJ 2K86A 2QUFA 4AUXA 1P7IA 3KX2A 3MQ0A 4V19K 3K2AA 3I55I 3O8HA 4MIMA 2PJRA 2LKXA 3JTGA 2R4GA 3VPRA 2CU7A 4XKWA 2YS9A 1ZREA 2Z16A 4KNYA 2VQGA 2V9KA 3UR3C 1IV8A 2LRDA 2ELHA 4OINF 2JA7J 2B0LA 1BW6A 2FX0A 3QYFA 4PFPA 3HOXJ 3ASOH 2JA2A 5ICFA 1L3LA 5EG0B 3JRAA 2WV1A 2VPLA 3MZYA 3CQZJ 5AIPA 2BY3A 2DI3A 1BW5A 3HOUJ 3K4CA 4B3AA 3MVPA 1HDDC 4UUSA 4A3DJ 1PYVA 4UY8I 1KQ0A 5FRMA 3GZNB 1EH6A 1SVMA 3EUHC 4ABZA 2HNHA 3Q0UA 1HCRA 2HVQA 3S32A 5ERIA 1HW1A 4A12A 3MKLA 4MFEA 1U8BA 3GF2A 4RAGA 1W7PD 1HC8A 5M3MJ 4R79A 1SMTA 4PSXA 5ILVA 2DA6A 2DBBA 2RN7A 3AG3H 3Q9VA 3L00A 2DQRA 3SFZA 3WTZA 1LDJA 4XRFA 4RDUA 1GXPA 4L5IA 1X2NA 4ESBA 3VB2A 2QQBA 5CLSA 4PJNA 4GFBA 4ZYEA 3ZMUA 3WE2A 1S5LC 2X4HA 1H9TA 2VPRA 2I10A 2ELJA 3G4SI 3ABTA 3LQRA 4XN3A 5J8FA 2NNYA 2DFFA 1FPQA 2FQ3A 2IRFG 1XDSA 1FMVA 1TW2A 4II3A 4ZYAA 1TWFJ 3WTTC 3U1DA 5BNGA 3AG2H 2HPMA 2UXNA 2PI0A 5BPIA 2EIKH 2M1BA 4M6XA 4DYRA 4AM3A 1MBFA 3S1NJ 4JK1X 3ZXSA 4A6DA 4BJ5C 3I4NJ 2M30A 2L5QA 3LFUA 2UV1A 1BBYA 1PVEA 1Y56A 3TW7A 4BGDA 1UHWA 1BIAA 1E2XA 1FOKA 2CUEA 1AKHB 1HW2A 3CESA 3BG6A 3ELKA 2H1KA 2DQLA 3GO5A 5F04A 2RVCA 3OIQA 3U21A 4DYCA 2KDOA 2V4JC 5LD2C 2O8XA 1XG1A 3HTSB 1MMAA 2Z1DA 1QVUA 1ETXA 1DPRA 4P9FA 4XLAA 1D1CA 1T8IA 3I0TA 4CICA 1D0ZA 4F7ZA 1WH7A 2D1HA 1N75A 1MNEA 4KITB 4XKBA 4I01A 1KONA 5HS7A 1BN5A 2ME0A 1IDYA 4DZJA 4A5NA 2RKHA 4XM3A 4RGSA 3CP8A 1GDTA 5E3LA 4E7HA 3MD2A 2CQQA 4II2A 5LEKA 2QKLB 3DPUA 3J7AO 1XD7A 3LOCA 3DQVC 1DGRM 2FMYA 1YW9A 1IXRC 2HYFA 3HYIA 4IL6C 3FM3A 4YFXF 1S7EA 2EA4A 3SHFA 5J8CA 2LY1A 2EV6A 3ZRGA 4KA4A 2W25A 1SFEA 3KEQA 4ZDPA 3GTKJ 1JJ8C 2VBYA 2LH9A 2M2EA 2UZKA 1FNNA 3ZN0A 4ETSA 1QU3A 3OOUA 4YELA 2ESNA 2M87A 2DLLA 1OR7C 1TQMA 5K5OA 4WCGA 3OS0A 1ZH5A 4WWCA 4X0GA 3A0BC 5BMZA 2BXYA 3GTLJ 4L9TA 5GPAA 2X1EA 4RGUA 1MMDA 4N0BA 5HNFA 3BC8A 3IV5A 1LVKA 2NAZA 3SQNA 2KJBA 1YI2I 4E6KG 3BDDA 5DDGA 5FFXA 4A93J 1MSFC 3NQOA 5FKNA 2HOTA 2JA5J 2YR2A 2BHZA 4XBFA 1OFCX 2XB0X 1Y1WJ 1WH5A 3F9KA 4XSXF 5EEGA 4OAYA 3K6GA 3JSPA 1MW7A 2M5WA 4OIOF 2KIFA 3V8LA 3I71A 3OY9A 1OYWA 1OJLA 2DK5A 1R36A 4KT6A 5E1ZB 3I4MJ 3QYEA 2R7RA 4LG0B 2VT2A 2F5FA 3SFIA 3C3WA 3OYDA 1W0TA 1FJLA 3F6OA 2XPWA 2ZSHB 1ZARA 4PFOA 2OPTA 1W36C 4HX8A 2KLOA 3PSIA 2DA4A 3HHHA 2R7SA 1V54H 4L0YB 2AQEA 1OMIA 2PX9A 2VJ4A 3M8EA 2VKVA 3RKQA 1F9NA 4EM2A 2L02A 3FBNB 1Z3YA 1H88C 2K27A 4A2UA 2DTZA 3I4PA 3PM1A 2NRAC 3E6BA 2XAQA 2K9MA 2PMZA 3IC7A 4HX4A 2E5NA 4N9IA 3K70C 2Q2EA 4HF0A 2MC4A 5GTHC 3KFWX 2GLOA 3DLLF 2NVYJ 1JKOC 3BTLA 1ZRCA 2AQFA 3WE3A 3JRIA 2Y48A 4NDLA 1Z05A 4Q5SF 2X6OA 3R6SA 3DTKA 3JRGA 1MJ9A 3K4MA 1J2XA 2ZCWA 3S3MA 1IC8A 1OCRH 2CO5A 1R23A 1HXDA 1FZPB 3MKYB 3KP7A 4XL9A 5FKLA 3CMAI 1IRFA 2W48A 4R1HA 2BY0A 2DMTA 3QOEA 2CW7A 3DFGA 5KHDA 2QZ8A 2LBFB 3S2WA 2G9WA 4IZZA 4G94A 2VKEA 1HKSA 1G4DA 2BW3A 4IX7A 2PJPA 2HVRA 2M8GX 3S1QJ 4EGYA 4HEA2 2K4JA 3BJ6A 5D5WB 2BXZA 5M5YJ 3OYAA 1IDZA 2ZJQF 1NTCA 3CUQC 2X51A 3Q9SA 2KZGA 4AIDA 5AIQA 3ULQB 2HU9A 3OYKA 2NVTJ 4RM3A 3TDZC 1JUPA 4OIPF 2VN2A 2HKXA 1R5HA 1Y8QB 2V6EA 4A0YA 5J47A 1IRGA 1FLIA 2XKPA 2JSPA 4M9SA 4BACA 3AG4H 4OIQF 3L9FA 4H4KC 3PQJA 3NRVA 2L9NA 1T95A 4RLFA 1NG6A 3BPXA 2A5WA 1SVOA 2FOKA 2P8TA 4AC0A 2ESHA 3X2QH 5DTDA 1YTYA 1DDNA 1POGA 3MN2A 3KP2A 2RV8A 2K9LA 1OCTC 1IN7A 1JTXA 2FUG2 3J81Z 1UG2A 4XORA 3CZ6A 4ZZDA 5IT9Z 1VQ7I 1LE8A 2WY8Q 3CMEI 1GV5A 4PK4A 3TBIA 3M4OJ 1GVDA 2JUGA 3HGYA 3T1BA 4BUPA 3K4NA 5K5RA 3L1PA 1IAWA 3EQLF 2CG4A 1V3FA 3BR5A 1A36A 3ZMDA 2QKMB 2WWYA 1IN8A 4ZTJA 2K85A 3VEPA 2FRHA 3QU6A 3F21A 1B72A 5EZHA 4BXUA 3GTOJ 2GM4A 1R58A 1U6GA 4AYBN 1IJWC 2LY9A 1VQMI 4UXNA 3CCYA 2PMHA 1XCVA 4RLQA 3CCVI 2EFPA 5IYCJ 3S2DJ 2OUMA 2E36A 4A3EJ 4L5JA 1ZAOA 2XF5A 4QIWN 4ZYDA 2P81A 3CP2A 1IUFA 2EH3A 2YSRA 4KJZA 3L2WA 2ZFWA 1JE8A 1X1PA 3MZHA 5HDNA 3J7ZI 4A3MJ 5B66C 1QQIA 3LL7A 2JVHA 2BOLA 2OV7A 2V9VA 2D5VA 2WAEA 5J1UA 1AA7A 1TL8A 1G3YA 2WY7Q 3R0AA 4XR6A 1FIAA 3QODA 2E7WA 3FMQA 3MZ8A 3GVAA 3S3NA 3CTAA 2L0KA 4JYKA 4Q48A 2EK5A 3E6DA 3A4CA 1B8IB 4WF2A 2BY2A 3WU1B 5E20A 4J00A 2E34A 2K3FA 1MIJA 2XAUA 1Z1DA 4B4CA 2L2OA 3OR1C 2A6TA 1AHDP 5DYMA 3PUBA 4YRVA 2XV4S 1HW5A 3F8BA 3EETA 3J81K 3HPHA 4HX7A 4A6EA 3J80K 3G6EI 1YIOA 1T0FC 2R5ZA 1ZYRF 4KICA 1APLC 3TO6A 1JKPC 4D0PA 1H0MA 3LSHA 4O3MA 4E4HA 1QHGA 4LFUA 5EJCA 1ZGWA 1S9HA 1E3OC 3CCEI 3VOEA 3IAS2 2A6EF 2QBYA 1PUFA 3FZVA 3MEXA 3NEUA 2DT5A 3VYUB 2KL4A 3G1MA 3ZR8X 4B48A 1HKTA 4CDGA 1LFPA 5FD5A 2LLKA 2HQNA 3ONQA 1V55H 4NC8A 3CCSI 1ETQA 2Y9YA 5IP6A 3RPQA 5F0FA 2BV6A 2M7BA 1IZ1A 3B6CA 3W2WA 2EV0A 1DGWY 2CGPA 1A04A 5FB2A 5ED4A 2BVLA 2CQ7A 3OYLA 2E1NA 4I99C 1VQ6I 3D5SC 2CRGA 1I1SA 2BYVE 1LNWA 3EUHA 1RC9A 1JHFA 4P9UA 4OWRB 3S14J 1WJAA 1MMSA 4O6JA 3S2HJ 3V8JA 1WJBA 3TGNA 3KZYA 5TISC 4ON0A 3VWBA 2J5OA 4L5EA 4ZTFA 1N77A 1XMKA 3LSTA 1Z9CA 2KT0A 2MFZA 2VB6A 2VE9A 3ZGKA 3FHNA 3WTWC 2H09A 3CF2A 3FKIJ 3AL0C 4RB3C 4WK8F 1XSXA 2EBIA 3KZIC 1OKRA 1V5FA 5BS6A 4S04A 2HI3A 1ETWA 1U9OA 2CV0A 2X9DA 1KQ8A 4H0EA 4XOTA 1WRJA 3Q5FA 4G12A 4QTRA 1ZN2A 4HF2A 4BQQA 1K79A 2A61A 4RGXA 3E6CC 1YS6A 2EIMH 2DA1A 1VQKI 2JA6J 4N4OB 2K40A 5DCMA 3L2CA 1RIOH 5HOOA 3SYTA 2NVXJ 5AONA 3BR3A 4EJVA 1YJWI 5EG0A 3OIPA 4KIBA 3DEEA 5FLVA 3SZPA 1TW3A 4F52A 1WI9A 2L54A 1QO0D 9ANTA 2HZTA 1ODDA 4I09A 2ZKZA 4HAMA 4TV7A 2L7KA 3NWTA 4LG3A 3JR9A 2QENA 1XX5A 3DBLB 3ZCOA 3OOPA 5HNHA 1T56A 1RKTA 2PN6A 1SMYF 4CCLA 3G1OA 4MFDA 5LFAA 4XRMA 4XLCA 1RI7A 3LMMA 3W6JB 2VKDA 2ZO4A 1TC3C 3U1KA 4BBSJ 4PSWA 3OYNA 3E5QA 1A31A 5HDKA 1V4RA 1B6AA 4BQNA 1JKRC 2H8RA 3M1CA 5C44J 2GXBA 2IGMA 4DBRA 3BZKA 3QPLA 4FE4A 1ZG1A 4MTDA 1RR7A 3RKYA 2F5CA 3E5XA 3CD6I 3F3XA 4FX0A 1Z0XA 4BYYA 3GLXA 3H5AA 4HA8A 3PO3J 2LSOA 5FGMA 2L9RA 3D0SA 2Z5UA 3LSGA 4XSZF 4EJWA 1IG7A 2HOSA 3OWTA 4C30A 3Q0VA 1E3HA 3HEFA 5JR3A 2EFOA 2Y0SA 1SD7A 1XB4A 3IWFA 3OS2A 3G2BA 1HQCA 3WHCA 1W5CC 3OR2C 2UUZA 2RNGA 2VASA 3ZQGA 1U0JA 1WJEA 1OR7A 3ISPA 3RPUD 3JAMZ 1KYWA 2JWTA 3JRFA 1U78A 1I50J 3GTQJ 5LRRA 4BY1J 3PNVA 1QPMA 3SXYA 4LB5A 1X1AA 3B02A 4UHTA 1WPKA 3PQKA 2F5DA 3VSKA 5GP9A 2GA2A 1YG2A 2M0MA 3IHUA 1AKHA 1W5SA 1X3UA 2VBZA 3OYCA 5F64A 4E7KA 3HL2A 2ACJA 2GZWA 4KN7X 3CCJI 4YEJA 1XPXA 3MKWB 2W00A 5F1RA 5C4XJ 1ZGAA 5IP9J 4C3JJ 1OCPA 1P4WA 3BZ6A 3P9CA 5B3SH 5E1WA 2CQKA 2RDPA 3H3UA 3DF8A 1DUXC 1IRZA 2E1CA 3ZMTA 2DA3A 5HODA 3OS1A 2W85A 4AIHA 3HXLA 2ADUA 3HZJA 1I27A 3OV8A 3OL3A 3BT9A 2QF7A 1O57A 5DCMB 4S0HB 4A0XA 2RAEA 1I1GA 3I5UA 4CYCB 2DODA 4C2UA 2OCCH 1ORKA 1JXSA 1FT9A 4EEFG 1P2FA 2PMZN 3F8CA 2CV1A 3LSIA 3TO9A 3GEZA 1WQ2A 3H92A 2HXOA 1TWHJ 2R3SA 4MLOA 4U7BA 5L3EA 1Z3XA 5CQGA 3CC4I 3HPGA 5KCMA 2LC2A 3PIOF 2VQHA 4FETA 4WXHA 1FTZA 3ZPLA 2CQNA 3VSLA 3ZQQA 1ZRFA 5M3FJ 3ECOA 4ENMA 2E1OA 5JI6A 1QZZA 2W4SA 1F4KA 5K1YA 3V8KA 5C3EJ 2PG4A 4HSTA 2QM3A 4XRSA 4M3FA 4AIJA 4YIIA 1ZRDA 2JTVA 4L18B 4FQGA 5F1JA 4AU7A 5GAHJ 3HUGA 4UUTA 4DQ2A 1D8JA 1YX5A 1FC3A 2MABA 3BCBA 3DKXA 1VQ9I 2F48A 1Y0NA 4M3DA 3VDXA 2ZFUA 3OMYA 3CUQA 2LF8A 1LEAA 3RQ4A 1G59A 4RM2A 4EVIA 3HTUA 1G3SA 2XASA 1QZEA 2DOAA 1W1WE 2W7NA 2ZJRF 3QP5A 5M5XJ 3E6MA 1OQYA 4LG0A 4GCVA 4Y52J 5HVQC 2K7LA 1H8AC 3F6VA 4BKXA 1U8RA 2AS5F 2E1MC 2JPCA 3BP8A 1WKMA 1PP8F 4BJ6C 2COBA 4D7MA 1O7LA 5DS9A 5LRSA 4CCNA 1OPCA 2DCEA 5FO5A 5LBQA 1MGTA 2OTJI 2EZHA 2P6SA 4L9VA 1DP3A 3BOQA 1RZ4A 3LSMA 2WAQN 4M9ZA 4E70A 4HNUA 2L4AA 1TWAJ 3OYIA 4L9NA 5F08A 3QAHA 1XN7A 3I58A 2VJJA 2HOEA 3QRFF 4ZYHA 4HYEA 2DMPA 3K69A 2MGQA 4A3FJ 2EZIA 5HDGA 1PJRA 5J1RA 3HB9A 4W97A 2KDZA 1OCZH 4LK1F 3FK6A 2XC7A 3BTCA 5KAIC 1SEUA 2DDBA 3GZ5A 4FT8A 2MH2A 2DJNA 2LK2A 5JLXA 1B1BA 3VYTB 3H5NA 1ZQ3P 2W82A 1LEBA 2LBFA 4V2FA 2IW5A 4XQFA 1R49A 1BIBA 1KA8A 2PBIA 1ZHFA 3WTYC 3O8GA 3JTHA 3BQZA 3PIPF 1SAUA 2P5VA 3AKZA 2E71A 2R93J 5EZGA 3TMOA 5DUIA 4RBOA 1YQAA 2E7XA 3BG5A 1RUNA 1U5TC 1WJ5A 1NH3A 3W2VA 2B7EA 1NG7A 2JPBA 4MQ9F 3LWFA 4D5FA 3G73A 1TWGJ 3FXJA 1YYVA 3NAUA 2I5UA 3H0DA 3QPHA 3F8FA 4YIFA 3IH4A 1CQTA 3ZOBA 4L9JA 2NVUB 2VBXA 2P5LC 5LHHA 2R92J 4MHGA 5E17F 3AG1H 2HR3A 3FXRA 1VQ4I 1O3RA 1WJDA 3RI4A 5DUKA 4FASD 3R60A 3HOZJ 3ZMZA 5DV5A 4BHCA 2B63J 4KISA 1B59A 3CJRB 1T0FA 1LPQA 1BC7C 1MBHA 4CXFA 4N9HA 3HOSA 5D5VB 1K7AA 4HW0A 1MZBA 3P7NA 5H6RA 3HG9A 1IXSB 2HWVA 4CCJA 5IPAA 4Y33A 4BHBA 3IH3A 1SD6A 1P7JA 3L2UA 1DP7P 5BOXA 2DPDA 4M74A 4IRIA 1I6HJ 5HLIA 4BQOA 3HGGA 3LFKA 1EA3A 3EDPA 4DZPA 5IOYA 3CDHA 2IVMA 3WHBA 3EYIA 2E2HJ 3QPSA 3HUGB 3DP7A 3S93A 5FD6A 4FCYA 2QA4I 2E19A 4RAYA 4JBAA 2LTPA 5LLQA 1NK3P 3GMEA 3OYJA 3CUQB 3TOBA 2DU9A 3ERED 1FIPA 1R7JA 1Y8RB 2FSWA 3H36A 4U87A 4RB2C 2RGVA 1E17A 5EDNA 1LFBA 4M6YA 2NOGA 1XGSA 1E0EA 4IQ4A 2QQAA 1R1UA 1A6IA 2FEZA 5KK1A 1I39A 1S72I 3ABLH 2XROA 3E1SA 2HZDA 2X85A 5JFRA 2HS5A 2KP6A 2HEOA 1EF4A 1D5YA 4M6VA 3BWGA 1B8IA 3M07A 3FXQA 3GTPJ 2JT1A 2FE3A 5L3BA 4CH7A 1JHHA 1STZA 1WSUA 4NB5A 3GFMA 2Z99A 2MA3A 1T33A 1BI3A 3I9V2 2O5RA 4BDYA 2MYSA 3GFJA 2LG4A 2FBHA 3MWMA 1JKQC 1EV7A 2FXAA 4FTHA 3ML6A 5D4RA 2DYSH 3IL2A 4PGGA 2EINH 3M9AA 2HOAA 4A3IJ 1SAXA 3ABKH 2VI6A 2JQ7A 5K5QA 2F6CA 1G8XA 1W7PB 3HRMA 2R7TA 2ELKA 2KFDA 2IS2A 3CO7C 4IRGA 4A3KJ 2IXSA 1MBJA 4AWXB 1S3JA 1Z6RA 1R6RA 2QGUA 1WHUA 4P55A 4NNJA 1YITI 3BLYA 5CPRB 1VF9A 4LIUA 1X1DA 3C1DA 2XPVA 3CMYA 1UZCA 1X1CA 2W84A 2XPUA 2ZXIA 3ZMSA 2HGCA 4NHJA 5EGOB 2UWMA 2KIMA 3GTGJ 1WFXA 1VFCA 1BOAA 1HSJA 4Q4ZF 3A02A 4DIQA 1IN4A 2LVSA 3KLOA 3OYMA 4XONA 3K4BA 4V2GA 2DOEA 2KRCA 1DU0A 3HKZA 2DOFA 5F0CA 1YRNB 4M72A 1JGGA 2M45A 4CSWA 2M4GA 3P9KA 2WAQA 3RJPA 3OIOA 4XKCA 3VODA 3LNQA 5EYRA 5TGTA 1D3YA 4LOCA 2LP0A 2MG4A 2E60A 3GX4X 2A07F 1XSVA 2XF6A 4IHVA 3L2VA 2NYXA 2WA0A 2O6GE 4U0YA 1UMQA 3HJEA 5FLXZ 2NOJB 4D5CA 5DM7F 1NK2P 2OA4A 1YJNI 2F5EA 4OU0A 1WZ2A 2NS7A 3RYRA 5GPCA 4BDZA 4Y3OA 4ZC3A 3CLQA 2NS8A 2VODA 3CF5F 2R0QC 1O3SA 3DLAA 4IOCF 1LQ1A 3DEUA 2R7QA 5KVRA 3KEYA 2Y0SN 4A69C 4G7ZF 3G3ZA 1T08B 1ULYA 3D5LA 1Z6TA 2HYJA 4IHXA 3HBLA 4QPQA 5GTIC 1YW8A 1Y6IA 4IHWA 2P6TA 3IWZA 1O3QA 1K4SA 4XRSG 2M0CA 2XAHA 4JQFA 3W3CA 1ZLKA 1ZG3A 3FXMA 1QGPA 4HZFA 3BTIA 1FOYA 3DCFA 2K9QA 1XGNA 1HBXG 5IT3A 2IT0A 3HOVJ 2NS0A 4U88A 2ME6A 2X0LA 1XCBA 2XHKA 2P7VB 1LUJB 1K61A 3A2KA 1JTYA 3HSRA 1F36A 2OQRA 2R7DA 1YW7A 4BS9A 1PP7U 2VXZA 4IHSA 5JHUA 3AL0B 3CUOA 4FISA 2IGKA 1OISA 4NC6A 1FEXA 2L7ZA 3BR6A 3DBHB 1GV2A 2FNPA 1X3ZB 3EUAA 3R61A 3BR0A 5LHGA 2NVQJ 2XUBA 5IT9K 2GOMA 2WV0A 2X1CA 5CJ9A 1WWXA 3ERMA 3D1NI 1CGPA 2FBIA 4NQWB 4B43A 2JZYA 2XGDA 3CDLA 3F8NA 5DD8A 1O3TA 2A5YB 3S15J 1Z21A 5LGUA 4I98B 2DFHA 4BEHB 1MDMA 2WB1A 2ISZA 1WCMJ 3BZCA 3Q3SA 2GIZA 2L7MP 2VC0A 1ERDA 2EPFA 1OLTA 2RC4A 3T8TA 2CS3A 1I3AA 1IW7F 4I0AA 2RQQA 2DTRA 1RETA 3RTRA 4C2TA 4B09A 2ZMEB 3OYGA 1JT0A 4RMNA 1OCCH 3JCUC 4NUBA 3DPLC 3RKXA 5TRDA 2K02A 2RREA 5EEHA 3DBRB 2XDVA 4UV9A 4LK0F 1FYMA 4GO1A 2F5VA 2DA2A 1K6OA 5F27A 1X19A 2R7VA 1M1EB 2H6BA 3DV8A 4IKFA 1Z67A 3R4KA 2W1OA 3ZN1A 1VQNI 3MCZA 5E3OA 1WI3A 2MLKA 3VYRB 3C2BA 3RKWA 5D5XB 1BI1A 1N25A 2YU3A 1MD0A 3K4JA 4OOIA 5ILUA 4XICA 3G1LA 1XDUA 3DTEA 2G7HA 2HFHA 2O61A 1Z77A 4HG2A 2PFBA 2R7OA 2L9VA 1D1BA 2JVGA 3H35A 1RNLA 5HS9A 1WGXA 1P9QC 4HNVA 4UUVA 3GBGA 5J6XA 3M3YJ 1K78B 1VI0A 2FNAA 3KEOA 1Z7LA 1FP2A 4PJLA 2XIGA 1OCOH 4DJAA 1W0UA 4LLNA 2ECCA 3CCQI 4O5VA 2F4OB 2QQ8A 5B1BH 2DXIA 2VONA 3S3OA 3CCLI 3HHGA 3KPHA 3A03A 1CF7B 4KN4X 2CSOA 2YPRA 3VYSB 3SDGA 5M5WJ 4KMFA 1I5ZA 1UB9A 1XGMA 3JW4A 4CYCA 1BR2A 1UFMA 2TRTA 2O3FA 1MNDA 2N8GA 4BXXJ 2VOPA 1VQLI 4KIGA 3PJRA 5FRNA 4KFCA 3MMYB 2DO7A 1T39A 4EJOA 2PEXA 3E0JB 3F8MA 3WGIA 4IF4A 3WTVC 3S1MJ 3K1PA 2O8KA 4M3GA 1RESA 2OD5A 1SVLA 2ZMEC 2YU9J 3N4MA 1R22A 5LGNA 3K1MA 5L3FA 2BE5F 2Z33A 3M7GA 2X48A 3IRRA 3FBIB 1F5TA 1S7AA 2YX7A 1SFXA 2AHQA 4P5OA 5FKKA 4ASNA 2HQRA 5K7FA 2Z3YA 2HXIA 4RS8A 5CVRA 2VUMJ 1JT6A 3H9QA 5HLGA 2EQRA 2O03A 4Z2YA 2KHMA 2ZBKA 1VTNC 3BQYA 4CUGA 2P5KA 1ZGJA 3K4KA 2ZSIB 1IO2A 2DA5A 3WG7H 2VKHA 1G6NA 2BEOA 1K4TA 2V6CA 4KIFA 4BL0B 4HRIA 4QWQA 1FY7A 1USTA 2PLYA 2OAZA 5H2FC 1P6RA 2BZTA 5D6FA 4E7ZA 3K10A 3GW2A 4MQVA 1MBKA 3EUKL 3LSJA 3QWLA 1MH4A 4XLNF 4CHUA 4GYIA 2AO9A 3NARA 2K9SA 1R4MB 2MBFA 5IY5H 4ENNA 1MDMB 3P9IA 4I2OA 1D0XA 1AOYA 4XLEA 4UVCA 4AVPA 3WU0A 1SD5A 1B9NA 4F3QA 3J7YJ 1YE9A 3CO6C 1X4OA 2A6HF 2K4BA 4G8XA 2MD0A 2P4WA 2OZ6A 3ZP5A 1MJBA 1J09A 1XTAA 2LKPA 4Y4RA 1R5ID 3SEQA 4YIRX 4PJ0C 1LDDA 3S8PA 3KYDB 2DMNA 1T2KA 1RR8C 2LF7A 4LIVA 1J59A 2Y2ZA 6PAXA 4IRHA 2JN6A 5CVVA 4LB6B 4PDKA 3GCMA 4YFNF 1W36D 3DXJF 3FKJA 2H1LA 3I54A 4LITA 3IP4B 2M34A 3T5XA 5J4YA 1YIJI 1G3TA 2HDDA 1UG0A 4CZZA 1A6QA 2XRLA 3FHZA 2BBYA 2KPMA 4YFKF 3T0YA 2VC1A 4OMYA 4A3BJ 1V5EA 4HPQA 2K9NA 3HRTA 5D8LB 3JRBA 5C4JJ 2OCEA 2OC6A 3HRSA 4GYGA 2ID3A 1FBQA 4CYDA 2IS4A 4Y13A 4B3XA 3ABUA 3QQAA 1DPUA 3DU5A 3K70D 3A01A 1AU7A 1ZLJA 5F6FA 1UHMA 2E5ZA 2EWNA 5E3MA 1U3EM 2CW8A 4RGRA 5JVGF 2KZVA 4KYWA 2FU4A 2CYYA 2E1MB 2X6XA 3OYFA 2BGCA 1UAAA 2DMUA 2STTA 1B9MA 1QRYA 2QWWA 4KUMA 4A3GJ 4XKVA 4PCQA 4KMUX 5D4SA 2TCTA 3JRHA 2XF7A 4AVZA 4CCOA 3L2QA 1YJ9I 4UV8A 1HKQA 4HF1A 3MKZA 2K5CA 1EH7A 4LMYA 1FYLA 4CGZA 1ITYA 1Q1HA 3ASNH 3HOWJ 1QZYA 2GXGA 2RQPA 3PNTA 3OYEA 4K2EA 2HPIA 4DNCA 4OMZA 1R5GA 2KQRA 3BG7A 1SFOJ 3P5JA 5GAGJ 2V79A 1C0WA 3VFZA 1QNTA 5FLMJ 4IVNA 2DAOA 4LGWA 3ABMH 2X6WA 1XMAA 1W4MA 5KAFC 3CC2I 5HLHA 3JAMK 3RCOA 1G3WA 1FOXA 1TTYA 1SD4A 2KRFA 4UB6C 3RIRA 4B47A 3OYBA 1VQPI 4FHTA 4PJJA 1TNTA 2R5YB 3WGGA 3FX3A 3GFLA 2ZXHA 3KCCA 3PNYA 1BL0A 2LY2A 1S7OA 4EJUA 1P4XA 1R00A 2D1VA 2LNBA 2HQAA 5D6EA 4HDVA 3LA2A 1SFUA 4QPOA 2J5PA 3CC7I 4M3EA 4EQQA 5DM6F 3JREA 1FBSA 1U5TB 2LD5A 2CFOA 4XMYA 1SFKA 4F55A 5IYDJ 4G6QA 1IV6A 1LDKB 3BPVA 4BH9A 4CZCA 3CLOA 5J3LA 3LAJA 4HSRA 4XLPF 2OJED 4ZYGA 1ZK8A 3F0CA 3I3LA 4JP0A 4NBQA 4P96A 1FYKA 2QQ9A 2XRNA 4M9XA 4RAZA 2CUJA 2GA1A 2HTJA 2V26A 1MNMC 2FF4A 1F43A 2DW4A 3LAPA 2H6CA 4XNFA 3SJMA 5FJ8J 1S6LA 3MFKA 1BA5A 2XB5A 3HKZN 2DT6A 3PUFA 4R8HA 1KZHA 2GXAA 2G7UA 3RSNA 3BROA 3W6VA 4HDUA 3ECHA 3LA7A 2FMLA 3DTIA 1QHHD 3CDIA 2DFIA 4GRIA 3KE2A 3L09A 1GHCA 2CMPA 5L3CA 2XGCA 3FIWA 3PFIA 2IPQX 2XGEA 3HOTA 4LJZF 3TKYA 2EILH 3DU6A 2Z2SB 1K6YA 3J7AY 2R7WA 2OBPA 5H6QA 1YHQI 2WBMA 1SANA 2RNJA 4BE0A 4A5MA 1W7PA 4RAFA 2VXDA 3FK7A 3IH2A 5DCFA 3COAC 2ID6A 3I59B 2OQGA 3H9JA 4NC7A 1P4AA 1E3PA 2A69F 3RZDJ 4AIKA 1SC7A 4MGRA 1J9IA 5LGTA 4ANJA 4HLYA 3A01B 2ZNZA 4A3LJ 4DYQA 3K1NA 2IEKA 3SEZA 5E8GA 4P1WA 1YFHA 3V42A 3D5RC 5EGOA 3UKGA 2IS6A 1TBXA 2COMA 3OL4A 4KT5C 2ZNYA 3TP0A 1A35A 5JHFA 1BI2A 1JJ6C 1R1VA 3U2RA 4A3CJ 1HOMA 5E79C 5ILSA 2L4MA 3KP3A 1IN6A 3T8RA 5LHIA 2H27A 1DU6A 3C7JA 2CV2A 3PO2J 4DOZA 3WU2C 2DJIA 2MSYA 2DA7A 3TOAA 3CCMI 1YRNA 3ZQLA 3S17J 4ITVA 1BR1A 3K0LA 2EFWA 5EEAA 2ICWG 3H3ZA 3E7LA 3RYPA 2M8EA 1J0RA 1BM9A 2WC2A 1HA8A 4M71A 2CWEA 4XN0A 2MW8A 1QA6A 2ZXJA 5J40A 3GFIA 4PGHA 3BG9A 1Y0UA 1QBJA 2HTSA 1UHSA 2CJJA 3FISA 4PZJA 5F0HA 3AAFA 2DMQA 1U9NA 3QOPA 1VNDA 4I6ZA 4QLCU 1H9GA 2PJRB 3E5UA 1H89C 2CQXA 4HQMA 2X1DA 1KU3A 4MO7A 4E7IA 2M4KA 2WB1N 1ENHA 3U9GA 1TT5B 1PUEE 4BHPA 1I6XA 3A1YA 1F1ZA 2ISYA 1LB2A 3I56I 1UJ8A 3O2PE 1HSTA 2DT7B 2OF7A 5D8KB 3RZOJ 5L3GA 1AWCA 2K3PA 3N05A 4GXOA 1BC8C 4EM0B 5ICCA 1ZG5A 3TDUC 2VQCA 4RA2A 2GQQA 2D2WA 3E97A 4UUSB 3LA3A 4N4NB 3K9TA 2VL8A 3CCUI 2A68F 1TP4A 2FQ4A 3GLLA 4IJAA 1MMNA 1PDNC 3FF5A 5E3NA 1VQOI 4ESFA 2HQ5A 2VQLA 3OSGA 1IXCA 4CCKA 3A0HC 1D5VA 4MTEA 5DEQA 1JI8A 4EJTA 2EFNA 2NXNB 2O7OA 3L7WA 2TDXA 4XLHA 1TQIA 1OYYA 5FFZA 2IJLA 3IAM2 3JSOA 3WTXC 4BY7J 2KIUA 2MC3A 4PUSA 2VBWA 2MH9A 5H20A 4ZZLA 1IN5A 1JUMA 1ZTRA 2XSJC 3BTJA 4IO9F 4D9JA 4ESJA 1KU2A 3HC7A 1Y39A 2QSFX 1K83J 2F2EA 3PFYA 4NQWA 2JK3A 3KLNA 2IAIA 4C3HJ 3H1CA 3KYLA 5JLWA 1VQ5I 4CA0A 5B1AH 2KRHA 3SDBA 2BVMA 4BEHA 2W57A 3CJQB 1D1AA
chains in the Genus database with same CATH topology
3JRDA 3TW6A 1RETA 1G2HA 4DYRA 1MBFA 3S1NJ 3WHCA 2IBDA 1JT0A 3ZQGA 3I4NJ 3JRFA 2DN0A 1U78A 2JWTA 5J1YA 1I50J 3GTQJ 3BG3A 3ZQHA 4BY1J 3TW7A 1XS9A 1WPKA 5GP9A 1GT0C 2CUEA 2DA2A 1AKHB 2R7ZJ 5F27A 1AKHA 2H1KA 3HOYJ 5F04A 4DYCA 1XG1A 5IYBJ 5E3OA 1QVUA 1WI3A 2Y31A 1ETXA 3C2BA 4J19A 1WH7A 2LR8A 4JX4A 4XICA 3G1LA 1FTTA 1Z77A 5C4XJ 2ME0A 5IP9J 4C3JJ 1OCPA 1IDYA 4I76A 1WGXA 4JX5A 4HNVA 4DZJA 1ZR2A 3GBGA 3M3YJ 1GDTA 1VI0A 1Y1VJ 5E3LA 1IRZA 2CQQA 2DA3A 1W0UA 5HODA 2ECCA 1IGNA 3LOCA 4D7NA 1X58A 3A03A 2JA8J 3BT9A 2QF7A 5M5WJ 3SDGA 4S0HB 2RAEA 1S7EA 2GBYA 4C3IJ 4CYCB 1ORKA 4EEFG 4CYCA 2TRTA 1O4XA 2PMZN 5FKOA 2N8GA 4BXXJ 3GTKJ 1JJ8C 2EZKA 2M2EA 2HXOA 1TWHJ 4MLOA 3OOUA 3K7AJ 3S1MJ 2O8KA 4M3GA 1RESA 2YU9J 1FTZA 2X48A 3GTLJ 2ECBA 5GPAA 3HDDA 2AHQA 5M3FJ 5FKKA 4C2MJ 5K7FA 4XK4A 2E1OA 3IV5A 2HXIA 2VUMJ 5C3EJ 1JT6A 4XRSA 4M3FA 2EQRA 3OSFA 1MSFC 4A93J 4X6AJ 1ZKGA 2ZB9A 5FKNA 2HOTA 2JA5J 3LSPA 5F1JA 1OFCX 2XB0X 3BQYA 4UUTA 1Y1WJ 1WH5A 4M3DA 3ZQFA 2DA5A 3S16J 1GUUA 1JUSA 1OJLA 3GTMJ 1BJZA 3I4MJ 2YUSA 3HM5A 5M5XJ 3SFIA 2G0EA 1W0TA 1FJLA 4Y52J 1MBKA 2XPWA 3LSJA 1H8AC 4BKXA 1MH4A 2OPTA 2Y30A 2DA4A 2COBA 4D7MA 5DS9A 2AO9A 3B6AA 3NARA 2K9SA 2VKVA 3RKQA 2EZHA 4IEJA 1H88C 2DTZA 3PM1A 4A3JJ 2WAQN 1MBGA 1TWAJ 5F08A 1RPWA 2GLOA 2NVYJ 1ETKA 1JKOC 2DMNA 3BTLA 2DMPA 2MGQA 2Y2ZA 4NDLA 3JRIA 4A3FJ 2EZLA 2EZIA 2JN6A 2E2JJ 2X6OA 3HB9A 5J1RA 3JRCA 3H3VK 4W97A 2KDZA 3JRGA 4XIDA 1XC5A 2CUFA 2M34A 3FK6A 1IC8A 3BTCA 2HDDA 1I3QJ 5FKLA 1QVTA 2W48A 2XRLA 5K7HA 5JLXA 2DJNA 2LK2A 2DMTA 2QCOA 4A3BJ 3Q0WA 1ZQ3P 2K9NA 3JRBA 4V2FA 5C4JJ 2VKEA 2ID3A 2M8GX 3QQAA 3S1QJ 3O8GA 1AU7A 3A01A 3BQZA 5M5YJ 2R93J 1IDZA 5E3MA 5EZGA 4RBOA 3TEDA 1HLVA 1RKWA 1NTCA 3BG5A 3BR1A 2NVTJ 1ETOA 2M9HA 1JUPA 2DMUA 4D5FA 1QRYA 1TWGJ 3NAUA 4A3GJ 2TCTA 5EF6A 3JRHA 3IH4A 4B1RA 3ZOBA 1CQTA 1ETYA 2R92J 1ITYA 3S1RJ 4AC0A 2FD5A 3HOWJ 3BR2A 5DTDA 1POGA 3MN2A 1MSEC 1OCTC 3HOZJ 1JTXA 1UG2A 1SFOJ 1LE8B 2B63J 1LE8A 4X1EA 1GV5A 3M4OJ 1GVDA 1MBHA 5FLMJ 3HGYA 2FJ1A 3L1PA 3BR5A 5IPAA 1B72B 3IH3A 2R5YB 1HF0A 1B72A 1P7JA 5EZHA 2R5YA 1I6HJ 3GTOJ 2GM4A 1BL0A 4AYBN 4IHYA 1IJWC 2LY9A 3CCYA 3S2DJ 3HGGA 5IYCJ 4DZPA 4A3EJ 4QIWN 5IOYA 3DEWA 3WHBA 2E2HJ 2P81A 3QPSA 3ZQIA 1IUFA 2EH3A 4M3EA 4FCYA 2E19A 4A3MJ 2LTPA 1NK3P 3JREA 2LD5A 3GTJJ 1FIPA 5IYDJ 1R9TJ 1IV6A 1A5JA 5J3LA 2D5VA 5EDNA 5J1UA 1LFBA 2O9LA 2NOGA 1ZK8A 3F0CA 4JP0A 1FIAA 2L7FP 1A6IA 5IOZA 2L0KA 4JYKA 1MH3A 1MNMC 1B8IB 1LFUP 1F43A 1EF4A 1D5YA 4M6VA 1B8IA 3SJMA 5FJ8J 1BA5A 2XB5A 3HKZN 3RQIA 1ZR4A 4B4CA 3GTPJ 1AHDP 5FKMA 3ZQCA 3W6VA 5K7ZA 1HDPA 1T33A 3LSRA 2R5ZB 2XGCA 3FIWA 2R5ZA 1APLC 1JKQC 2XGEA 1JKPC 4FTHA 4Y7NJ 4M3BA 2LFBA 1ZGWA 2HOAA 4A3IJ 1E3OC 2VI6A 1PUFB 1Q1VA 1SANA 1PUFA 2ELKA 3G1MA 3FK7A 3IH2A 2LLKA 4A3KJ 4DW6A 1MBJA 2ID6A 1ETQA 2NVXJ 2Y9YA 3RZDJ 5IP6A 4BBRJ 5F0FA 1VF9A 3B6CA 2XPVA 3CMYA 3A01B 1X2MA 4A3LJ 4DYQA 1MBEA 2XPUA 2IEKA 5EGOB 2CRGA 3H0GJ 3TP3A 5EGOA 3UKGA 3GTGJ 1VFCA 3TP0A 3S14J 4FE7A 3A02A 4JX6A 4W1UA 2LVSA 3S2HJ 1JJ6C 4A3CJ 1HOMA 2JJ7A 1DU6A 4V2GA 2Y9ZA 1DU0A 2E2IJ 4L5EA 3PO2J 2JMWA 5F0CA 2MSYA 1YRNB 2DA7A 1JGGA 2KT0A 1YRNA 3S17J 3ZQLA 3OIOA 5EEAA 3FKIJ 3E7LA 1QPIA 3LNQA 5IP7J 2EBIA 5EYRA 1ETVA 4LOCA 2LP0A 2MG4A 2MW8A 3BG9A 4IHVA 2HI3A 1ETWA 2XSDC 1UHSA 2CJJA 1U9OA 3FISA 5F0HA 1UMQA 4QSHA 1TWCJ 2X9DA 4D5CA 1NK2P 2DMQA 1U9NA 1VNDA 4I6ZA 4AUXA 1P7IA 2NS7A 3K2AA 4G12A 3O8HA 4MIMA 1H89C 2LKXA 2CQXA 4QTRA 5GPCA 3VPRA 4MO7A 2CU7A 2NS8A 2WB1N 2YS9A 2R0QC 1ENHA 2DA1A 2JA6J 2K40A 2JA7J 2Y0SN 1BW6A 2FX0A 4A69C 3HOXJ 2HYJA 4IHXA 3BR3A 2OF7A 5EG0B 3HBLA 3JRAA 3RZOJ 2WV1A 5EG0A 3CQZJ 4IHWA 5FLVA 1BW5A 3HOUJ 9ANTA 4XRSG 2M0CA 4B3AA 4UUSB 3MVPA 1HDDC 4UUSA 4A3DJ 3JR9A 2FQ4A 3BTIA 3DCFA 5E3NA 2K9QA 4ABZA 3Q0UA 2HQ5A 1HCRA 1T56A 1RKTA 3HOVJ 2ME6A 3OSGA 3G1OA 4MFDA 4XRMA 3MKLA 4MFEA 1K61A 1JTYA 1U8BA 1F36A 2O7OA 5M3MJ 1TC3C 4FISA 4BBSJ 2DA6A 1FEXA 2L7ZA 1JKRC 3BR6A 2H8RA 4BY7J 1GV2A 4RDUA 1X2NA 5C44J 3BR0A 2NVQJ 1JUMA 1ZTRA 4GFBA 3BTJA 3QPLA 4FE4A 3D1NI 1K83J 2VPRA 1RR7A 2I10A 2JK3A 2XGDA 3CDLA 1Z0XA 2IAIA 4C3HJ 3S15J 5JLWA 3PO3J 2L9RA 3LSGA 1WCMJ 1IG7A 1TWFJ 2HOSA 3Q3SA 2L7MP 3Q0VA 5BNGA 3HEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRD A;  3TW6 A;  1RET A;  1G2H A;  4DYR A;  1MBF A;  3S1N J;  3WHC A;  2IBD A;  1JT0 A;  3ZQG A;  3I4N J;  3JRF A;  2DN0 A;  1U78 A;  2JWT A;  5J1Y A;  1I50 J;  3GTQ J;  3BG3 A;  3ZQH A;  4BY1 J;  3TW7 A;  1XS9 A;  1WPK A;  5GP9 A;  1GT0 C;  2CUE A;  2DA2 A;  1AKH B;  2R7Z J;  5F27 A;  1AKH A;  2H1K A;  3HOY J;  5F04 A;  4DYC A;  1XG1 A;  5IYB J;  5E3O A;  1QVU A;  1WI3 A;  2Y31 A;  1ETX A;  3C2B A;  4J19 A;  1WH7 A;  2LR8 A;  4JX4 A;  4XIC A;  3G1L A;  1FTT A;  1Z77 A;  5C4X J;  2ME0 A;  5IP9 J;  4C3J J;  1OCP A;  1IDY A;  4I76 A;  1WGX A;  4JX5 A;  4HNV A;  4DZJ A;  1ZR2 A;  3GBG A;  3M3Y J;  1GDT A;  1VI0 A;  1Y1V J;  5E3L A;  1IRZ A;  2CQQ A;  2DA3 A;  1W0U A;  5HOD A;  2ECC A;  1IGN A;  3LOC A;  4D7N A;  1X58 A;  3A03 A;  2JA8 J;  3BT9 A;  2QF7 A;  5M5W J;  3SDG A;  4S0H B;  2RAE A;  1S7E A;  2GBY A;  4C3I J;  4CYC B;  1ORK A;  4EEF G;  4CYC A;  2TRT A;  1O4X A;  2PMZ N;  5FKO A;  2N8G A;  4BXX J;  3GTK J;  1JJ8 C;  2EZK A;  2M2E A;  2HXO A;  1TWH J;  4MLO A;  3OOU A;  3K7A J;  3S1M J;  2O8K A;  4M3G A;  1RES A;  2YU9 J;  1FTZ A;  2X48 A;  3GTL J;  2ECB A;  5GPA A;  3HDD A;  2AHQ A;  5M3F J;  5FKK A;  4C2M J;  5K7F A;  4XK4 A;  2E1O A;  3IV5 A;  2HXI A;  2VUM J;  5C3E J;  1JT6 A;  4XRS A;  4M3F A;  2EQR A;  3OSF A;  1MSF C;  4A93 J;  4X6A J;  1ZKG A;  2ZB9 A;  5FKN A;  2HOT A;  2JA5 J;  3LSP A;  5F1J A;  1OFC X;  2XB0 X;  3BQY A;  4UUT A;  1Y1W J;  1WH5 A;  4M3D A;  3ZQF A;  2DA5 A;  3S16 J;  1GUU A;  1JUS A;  1OJL A;  3GTM J;  1BJZ A;  3I4M J;  2YUS A;  3HM5 A;  5M5X J;  3SFI A;  2G0E A;  1W0T A;  1FJL A;  4Y52 J;  1MBK A;  2XPW A;  3LSJ A;  1H8A C;  4BKX A;  1MH4 A;  2OPT A;  2Y30 A;  2DA4 A;  2COB A;  4D7M A;  5DS9 A;  2AO9 A;  3B6A A;  3NAR A;  2K9S A;  2VKV A;  3RKQ A;  2EZH A;  4IEJ A;  1H88 C;  2DTZ A;  3PM1 A;  4A3J J;  2WAQ N;  1MBG A;  1TWA J;  5F08 A;  1RPW A;  2GLO A;  2NVY J;  1ETK A;  1JKO C;  2DMN A;  3BTL A;  2DMP A;  2MGQ A;  2Y2Z A;  4NDL A;  3JRI A;  4A3F J;  2EZL A;  2EZI A;  2JN6 A;  2E2J J;  2X6O A;  3HB9 A;  5J1R A;  3JRC A;  3H3V K;  4W97 A;  2KDZ A;  3JRG A;  4XID A;  1XC5 A;  2CUF A;  2M34 A;  3FK6 A;  1IC8 A;  3BTC A;  2HDD A;  1I3Q J;  5FKL A;  1QVT A;  2W48 A;  2XRL A;  5K7H A;  5JLX A;  2DJN A;  2LK2 A;  2DMT A;  2QCO A;  4A3B J;  3Q0W A;  1ZQ3 P;  2K9N A;  3JRB A;  4V2F A;  5C4J J;  2VKE A;  2ID3 A;  2M8G X;  3QQA A;  3S1Q J;  3O8G A;  1AU7 A;  3A01 A;  3BQZ A;  5M5Y J;  2R93 J;  1IDZ A;  5E3M A;  5EZG A;  4RBO A;  3TED A;  1HLV A;  1RKW A;  1NTC A;  3BG5 A;  3BR1 A;  2NVT J;  1ETO A;  2M9H A;  1JUP A;  2DMU A;  4D5F A;  1QRY A;  1TWG J;  3NAU A;  4A3G J;  2TCT A;  5EF6 A;  3JRH A;  3IH4 A;  4B1R A;  3ZOB A;  1CQT A;  1ETY A;  2R92 J;  1ITY A;  3S1R J;  4AC0 A;  2FD5 A;  3HOW J;  3BR2 A;  5DTD A;  1POG A;  3MN2 A;  1MSE C;  1OCT C;  3HOZ J;  1JTX A;  1UG2 A;  1SFO J;  1LE8 B;  2B63 J;  1LE8 A;  4X1E A;  1GV5 A;  3M4O J;  1GVD A;  1MBH A;  5FLM J;  3HGY A;  2FJ1 A;  3L1P A;  3BR5 A;  5IPA A;  1B72 B;  3IH3 A;  2R5Y B;  1HF0 A;  1B72 A;  1P7J A;  5EZH A;  2R5Y A;  1I6H J;  3GTO J;  2GM4 A;  1BL0 A;  4AYB N;  4IHY A;  1IJW C;  2LY9 A;  3CCY A;  3S2D J;  3HGG A;  5IYC J;  4DZP A;  4A3E J;  4QIW N;  5IOY A;  3DEW A;  3WHB A;  2E2H J;  2P81 A;  3QPS A;  3ZQI A;  1IUF A;  2EH3 A;  4M3E A;  4FCY A;  2E19 A;  4A3M J;  2LTP A;  1NK3 P;  3JRE A;  2LD5 A;  3GTJ J;  1FIP A;  5IYD J;  1R9T J;  1IV6 A;  1A5J A;  5J3L A;  2D5V A;  5EDN A;  5J1U A;  1LFB A;  2O9L A;  2NOG A;  1ZK8 A;  3F0C A;  4JP0 A;  1FIA A;  2L7F P;  1A6I A;  5IOZ A;  2L0K A;  4JYK A;  1MH3 A;  1MNM C;  1B8I B;  1LFU P;  1F43 A;  1EF4 A;  1D5Y A;  4M6V A;  1B8I A;  3SJM A;  5FJ8 J;  1BA5 A;  2XB5 A;  3HKZ N;  3RQI A;  1ZR4 A;  4B4C A;  3GTP J;  1AHD P;  5FKM A;  3ZQC A;  3W6V A;  5K7Z A;  1HDP A;  1T33 A;  3LSR A;  2R5Z B;  2XGC A;  3FIW A;  2R5Z A;  1APL C;  1JKQ C;  2XGE A;  1JKP C;  4FTH A;  4Y7N J;  4M3B A;  2LFB A;  1ZGW A;  2HOA A;  4A3I J;  1E3O C;  2VI6 A;  1PUF B;  1Q1V A;  1SAN A;  1PUF A;  2ELK A;  3G1M A;  3FK7 A;  3IH2 A;  2LLK A;  4A3K J;  4DW6 A;  1MBJ A;  2ID6 A;  1ETQ A;  2NVX J;  2Y9Y A;  3RZD J;  5IP6 A;  4BBR J;  5F0F A;  1VF9 A;  3B6C A;  2XPV A;  3CMY A;  3A01 B;  1X2M A;  4A3L J;  4DYQ A;  1MBE A;  2XPU A;  2IEK A;  5EGO B;  2CRG A;  3H0G J;  3TP3 A;  5EGO A;  3UKG A;  3GTG J;  1VFC A;  3TP0 A;  3S14 J;  4FE7 A;  3A02 A;  4JX6 A;  4W1U A;  2LVS A;  3S2H J;  1JJ6 C;  4A3C J;  1HOM A;  2JJ7 A;  1DU6 A;  4V2G A;  2Y9Z A;  1DU0 A;  2E2I J;  4L5E A;  3PO2 J;  2JMW A;  5F0C A;  2MSY A;  1YRN B;  2DA7 A;  1JGG A;  2KT0 A;  1YRN A;  3S17 J;  3ZQL A;  3OIO A;  5EEA A;  3FKI J;  3E7L A;  1QPI A;  3LNQ A;  5IP7 J;  2EBI A;  5EYR A;  1ETV A;  4LOC A;  2LP0 A;  2MG4 A;  2MW8 A;  3BG9 A;  4IHV A;  2HI3 A;  1ETW A;  2XSD C;  1UHS A;  2CJJ A;  1U9O A;  3FIS A;  5F0H A;  1UMQ A;  4QSH A;  1TWC J;  2X9D A;  4D5C A;  1NK2 P;  2DMQ A;  1U9N A;  1VND A;  4I6Z A;  4AUX A;  1P7I A;  2NS7 A;  3K2A A;  4G12 A;  3O8H A;  4MIM A;  1H89 C;  2LKX A;  2CQX A;  4QTR A;  5GPC A;  3VPR A;  4MO7 A;  2CU7 A;  2NS8 A;  2WB1 N;  2YS9 A;  2R0Q C;  1ENH A;  2DA1 A;  2JA6 J;  2K40 A;  2JA7 J;  2Y0S N;  1BW6 A;  2FX0 A;  4A69 C;  3HOX J;  2HYJ A;  4IHX A;  3BR3 A;  2OF7 A;  5EG0 B;  3HBL A;  3JRA A;  3RZO J;  2WV1 A;  5EG0 A;  3CQZ J;  4IHW A;  5FLV A;  1BW5 A;  3HOU J;  9ANT A;  4XRS G;  2M0C A;  4B3A A;  4UUS B;  3MVP A;  1HDD C;  4UUS A;  4A3D J;  3JR9 A;  2FQ4 A;  3BTI A;  3DCF A;  5E3N A;  2K9Q A;  4ABZ A;  3Q0U A;  2HQ5 A;  1HCR A;  1T56 A;  1RKT A;  3HOV J;  2ME6 A;  3OSG A;  3G1O A;  4MFD A;  4XRM A;  3MKL A;  4MFE A;  1K61 A;  1JTY A;  1U8B A;  1F36 A;  2O7O A;  5M3M J;  1TC3 C;  4FIS A;  4BBS J;  2DA6 A;  1FEX A;  2L7Z A;  1JKR C;  3BR6 A;  2H8R A;  4BY7 J;  1GV2 A;  4RDU A;  1X2N A;  5C44 J;  3BR0 A;  2NVQ J;  1JUM A;  1ZTR A;  4GFB A;  3BTJ A;  3QPL A;  4FE4 A;  3D1N I;  1K83 J;  2VPR A;  1RR7 A;  2I10 A;  2JK3 A;  2XGD A;  3CDL A;  1Z0X A;  2IAI A;  4C3H J;  3S15 J;  5JLW A;  3PO3 J;  2L9R A;  3LSG A;  1WCM J;  1IG7 A;  1TWF J;  2HOS A;  3Q3S A;  2L7M P;  3Q0V A;  5BNG A;  3HEF A; 
#chains in the Genus database with same CATH topology
 3AFH A;  4HV6 A;  3JRD A;  4LLG F;  4BQA A;  3O3K A;  3TW6 A;  1WJC A;  1G2H A;  2Y0M A;  2Q1Z B;  2EV5 A;  2CUZ A;  5CKT A;  2JUC A;  4C9Y A;  1YOV B;  1XSD A;  1T98 A;  3GWZ A;  2IBD A;  2KIQ A;  1GVJ A;  2ZME A;  2DN0 A;  5J1Y A;  2HDW A;  3BG3 A;  3ZQH A;  2ETH A;  4BE2 A;  1XS9 A;  3HRU A;  3OYH A;  1P92 A;  1ZEL A;  1FWZ A;  1GT0 C;  1N78 A;  4GGG A;  2R7Z J;  3ZQ7 A;  3RDI A;  3TO7 A;  3HOY J;  4CO8 A;  1MJA A;  3I53 A;  3HSE A;  5IYB J;  3BY6 A;  2Y31 A;  3C2G A;  2Q0O A;  2QLZ A;  2W24 A;  2LMD A;  3KP4 A;  4RB0 A;  3KZZ A;  5CVI A;  1J75 A;  1FSH A;  4J19 A;  1IUY A;  1IRX A;  2IA1 A;  3N97 A;  2V1U A;  3W2A A;  2LR8 A;  4JX4 A;  2DFE A;  4F91 B;  1FTT A;  2P0W A;  2R7F A;  1VZ0 A;  2EFQ A;  2MD5 A;  2EIJ H;  4I76 A;  1R4N B;  4JX5 A;  1ZR2 A;  4XLF A;  4U0V A;  3V4G A;  1Y1V J;  1ONV A;  1K78 A;  1U2W A;  2CH0 A;  2I8D A;  4D1Q A;  2BY1 A;  1ON2 A;  1Z7U A;  1J5Y A;  1FBU A;  3HSF A;  3V7C A;  3F22 A;  4I0B A;  1IGN A;  4D7N A;  2IGN A;  3KET A;  4I02 A;  4Y17 A;  3WG9 A;  2OTL I;  1X58 A;  2JA8 J;  1CF7 A;  2CW0 F;  1OYI A;  1ACI A;  2GBY A;  4C3I J;  3O6B B;  3SZG A;  1XGO A;  3DPT A;  4HBL A;  2LRE A;  1O4X A;  5FKO A;  3C2H A;  1TNS A;  3J80 Z;  1MMG A;  1UEL B;  3WTS C;  1L0O C;  2EZK A;  2HKO A;  3FMR A;  4U0W A;  1KQ9 A;  3K7A J;  1BI0 A;  3F23 A;  2L01 A;  1BJA A;  2QEX I;  4HLX A;  3FXL A;  4WXC A;  2ECB A;  3HDD A;  4C2M J;  4JOM A;  4XK4 A;  1YO5 C;  5BPD A;  3M8F A;  3DKY A;  3K4L A;  1TT0 A;  1BR4 A;  3M1E A;  3OSF A;  2AXL A;  4X6A J;  3KYC B;  1ZKG A;  2ZB9 A;  3CCR I;  3F72 A;  3LSP A;  2GWR A;  2GIV A;  5DD4 A;  2GOX B;  4BAY A;  1EKE A;  3ZQF A;  4OAZ A;  5KNL A;  3S16 J;  4ZJZ A;  1GUU A;  1JUS A;  4BU2 A;  2PQ8 A;  4PJM A;  5HLT A;  4BE1 A;  1REP C;  2QSH X;  3GTM J;  1BJZ A;  5CVU A;  2YUS A;  3HM5 A;  4B8X A;  5D5U B;  3C18 A;  2G0E A;  2F4M B;  3KP5 A;  1Z91 A;  2IS1 A;  3BJO A;  3GXO A;  3FMS A;  4ENJ A;  1LJ9 A;  5FLX K;  2Y30 A;  2BHY A;  1RUO A;  4YG2 F;  2X6Y A;  2QSG X;  2FA5 A;  2DDA A;  3B6A A;  3GUD A;  5CQE A;  2JSC A;  1V5G A;  4EMS A;  3KP6 A;  2QVO A;  4IEJ A;  3WGH A;  2IA2 A;  3UNG C;  2VJI A;  4A3J J;  4S05 A;  2MLG A;  2XAF A;  4U7D A;  2V9P A;  4DGW B;  1NHA A;  3K2Z A;  1MBG A;  4Y15 A;  2Q2E B;  1RPW A;  3GZ6 A;  2FBK A;  4G9Y A;  1ETK A;  4IQJ A;  4Q47 A;  2E2J J;  2EZL A;  1KYZ A;  2EA2 A;  3ZMV A;  3JRC A;  4EGZ A;  5J4V A;  3H3V K;  2KJC A;  4XID A;  1XC5 A;  1KGS A;  2CUF A;  4E7L A;  4F92 B;  2XGX A;  3FDY A;  2YX4 A;  4HQE A;  4OIR F;  1I3Q J;  1QVT A;  5K7H A;  2UXX A;  2QCO A;  2IP2 A;  2M7A A;  3Q0W A;  4CCM A;  1EJ9 A;  2BW3 B;  3E3V A;  4AD9 A;  1LVA A;  4UB8 C;  2A05 A;  3FXK A;  4EM1 A;  4L0Z B;  2Y69 H;  2OZU A;  4BNC A;  1HLV A;  4G6D A;  3TED A;  4HOB A;  1RKW A;  3TQN A;  5GAD J;  3BR1 A;  2LOO A;  2JRT A;  4MEX F;  1ETO A;  2M9H A;  2V1N A;  4FX4 A;  2R7U A;  3CMM A;  5GAE J;  1D8K A;  2B9S A;  5EF6 A;  4B1R A;  2L9S A;  4LLL A;  4DBQ A;  1ETY A;  2OU2 A;  1USS A;  3S1R J;  2FD5 A;  3BR2 A;  4UVA A;  1DQU A;  3TL4 X;  5E1X A;  4GDF A;  4G7H F;  4UVB A;  2HYG D;  2Y75 A;  1MSE C;  1D0Y A;  2PMU A;  3FXU A;  2WAD A;  1LE8 B;  2C6Y A;  2FOW A;  5A2Q Z;  2D45 A;  4X1E A;  2V1D A;  3HIF A;  3EYY A;  1W5T A;  1KU7 A;  1BOB A;  2ZJ2 A;  3G71 I;  5FRO A;  1XMX A;  2QYO A;  1B4A A;  2FJ1 A;  2VOO A;  1JGS A;  2NNN A;  2R7X A;  3IKV A;  2GAU A;  1R1T A;  4RB1 A;  3ESW B;  1B72 B;  3LQQ A;  3R0J A;  1HF0 A;  4E7J A;  2R5Y A;  4Z6Y A;  3H5R A;  5ICG A;  1YS7 A;  4IHY A;  2VT3 A;  1TZL A;  4I7H A;  1LKX A;  4G6T B;  3DEW A;  2VJ5 A;  3V7R A;  3QP6 A;  4A0Z A;  3ZQI A;  2Z9O A;  3PSF A;  2F4I A;  5ICE A;  2KMU A;  1EH8 A;  2WTE A;  3SZT A;  4BJT A;  3GTJ J;  3QYB A;  1U5T A;  4E7S A;  2E35 A;  1R9T J;  1GLN A;  1A5J A;  4ZDO A;  2WAF A;  3ROU A;  3BCA A;  2O9L A;  1T38 A;  2L7F P;  2ZJP F;  1T6S A;  4EAT A;  2EJR A;  2DK8 A;  5IOZ A;  1MH3 A;  1FP1 D;  1LFU P;  2XAJ A;  1S29 A;  4ZH4 F;  1GXQ A;  2IGO A;  3CJT B;  1X1B A;  3IUO A;  4IHT A;  3RQI A;  1ZR4 A;  2LYC A;  2EB7 A;  2XVC A;  5TJJ A;  2V7F A;  5CVJ A;  2V1X A;  5FKM A;  5BQT A;  1X4P A;  3ZQC A;  2LDU A;  5K7Z A;  1HDP A;  1WJF A;  3NWS A;  5JVT A;  5A2Q K;  1YX3 A;  2XKO A;  3LSR A;  2Q8K A;  2R5Z B;  4F93 B;  3W6K B;  2KIS A;  2VIX A;  4MNU A;  4BXF A;  4G7O F;  1J7K A;  4M73 A;  4Y7N J;  2O0Y A;  1TLH B;  4M3B A;  1FOW A;  2LFB A;  1KU9 A;  3KIO A;  3V7S A;  3IKT A;  2H94 A;  4KDP A;  1MKM A;  1FMW A;  5HS8 A;  3CJN A;  3EPZ A;  2AXT C;  2IA0 A;  2STW A;  2QBY B;  1PUF B;  1S8N A;  1Q1V A;  1X3W B;  3LSK A;  4AYB A;  3FWE A;  2JRM A;  3BJA A;  3L2R A;  4HV5 A;  1VQ8 I;  4DW6 A;  5E18 F;  3WTU C;  4HNT A;  5L3D A;  4XOP A;  2H8W A;  2LKS A;  3I59 A;  4ZDL A;  3REO A;  2CFX A;  4BBR J;  3MAJ A;  2M3A A;  2DPU A;  1X2M A;  1MBE A;  4WXD A;  4LD5 A;  3QU3 A;  4IPA A;  1YLF A;  4EV0 A;  1ON1 A;  3H0G J;  3TP3 A;  5LEJ A;  3PL8 A;  2ZXW H;  5CYV A;  4FE7 A;  2L3D A;  1FX7 A;  4JX6 A;  4W1U A;  3DWL E;  3B73 A;  3GYH X;  2JJ7 A;  4UNO A;  1TQP A;  3H9G A;  3DKW A;  4J01 A;  4B44 A;  2HDC A;  2Y9Z A;  2E2I J;  3FM5 A;  4ENK A;  1RRJ A;  3I64 A;  2JMW A;  5E8I A;  2KKO A;  2P7C B;  3M8J A;  4MEY F;  2HVS A;  3WOD F;  1IF1 A;  2VLA A;  2XAG A;  4IOA F;  5B5E C;  1QPI A;  3RPU A;  5IP7 J;  1R71 A;  1ETV A;  3FXO A;  2VE8 A;  1UCR A;  1WVR A;  2DYR H;  2ZC2 A;  4IXA A;  4WX9 A;  1FSE A;  2XSD C;  1O7F A;  2A3S A;  3IRQ A;  3QPT A;  4QSH A;  1TWC J;  2K86 A;  2QUF A;  4AUX A;  1P7I A;  3KX2 A;  3MQ0 A;  4V19 K;  3K2A A;  3I55 I;  3O8H A;  4MIM A;  2PJR A;  2LKX A;  3JTG A;  2R4G A;  3VPR A;  2CU7 A;  4XKW A;  2YS9 A;  1ZRE A;  2Z16 A;  4KNY A;  2VQG A;  2V9K A;  3UR3 C;  1IV8 A;  2LRD A;  2ELH A;  4OIN F;  2JA7 J;  2B0L A;  1BW6 A;  2FX0 A;  3QYF A;  4PFP A;  3HOX J;  3ASO H;  2JA2 A;  5ICF A;  1L3L A;  5EG0 B;  3JRA A;  2WV1 A;  2VPL A;  3MZY A;  3CQZ J;  5AIP A;  2BY3 A;  2DI3 A;  1BW5 A;  3HOU J;  3K4C A;  4B3A A;  3MVP A;  1HDD C;  4UUS A;  4A3D J;  1PYV A;  4UY8 I;  1KQ0 A;  5FRM A;  3GZN B;  1EH6 A;  1SVM A;  3EUH C;  4ABZ A;  2HNH A;  3Q0U A;  1HCR A;  2HVQ A;  3S32 A;  5ERI A;  1HW1 A;  4A12 A;  3MKL A;  4MFE A;  1U8B A;  3GF2 A;  4RAG A;  1W7P D;  1HC8 A;  5M3M J;  4R79 A;  1SMT A;  4PSX A;  5ILV A;  2DA6 A;  2DBB A;  2RN7 A;  3AG3 H;  3Q9V A;  3L00 A;  2DQR A;  3SFZ A;  3WTZ A;  1LDJ A;  4XRF A;  4RDU A;  1GXP A;  4L5I A;  1X2N A;  4ESB A;  3VB2 A;  2QQB A;  5CLS A;  4PJN A;  4GFB A;  4ZYE A;  3ZMU A;  3WE2 A;  1S5L C;  2X4H A;  1H9T A;  2VPR A;  2I10 A;  2ELJ A;  3G4S I;  3ABT A;  3LQR A;  4XN3 A;  5J8F A;  2NNY A;  2DFF A;  1FPQ A;  2FQ3 A;  2IRF G;  1XDS A;  1FMV A;  1TW2 A;  4II3 A;  4ZYA A;  1TWF J;  3WTT C;  3U1D A;  5BNG A;  3AG2 H;  2HPM A;  2UXN A;  2PI0 A;  5BPI A;  2EIK H;  2M1B A;  4M6X A;  4DYR A;  4AM3 A;  1MBF A;  3S1N J;  4JK1 X;  3ZXS A;  4A6D A;  4BJ5 C;  3I4N J;  2M30 A;  2L5Q A;  3LFU A;  2UV1 A;  1BBY A;  1PVE A;  1Y56 A;  3TW7 A;  4BGD A;  1UHW A;  1BIA A;  1E2X A;  1FOK A;  2CUE A;  1AKH B;  1HW2 A;  3CES A;  3BG6 A;  3ELK A;  2H1K A;  2DQL A;  3GO5 A;  5F04 A;  2RVC A;  3OIQ A;  3U21 A;  4DYC A;  2KDO A;  2V4J C;  5LD2 C;  2O8X A;  1XG1 A;  3HTS B;  1MMA A;  2Z1D A;  1QVU A;  1ETX A;  1DPR A;  4P9F A;  4XLA A;  1D1C A;  1T8I A;  3I0T A;  4CIC A;  1D0Z A;  4F7Z A;  1WH7 A;  2D1H A;  1N75 A;  1MNE A;  4KIT B;  4XKB A;  4I01 A;  1KON A;  5HS7 A;  1BN5 A;  2ME0 A;  1IDY A;  4DZJ A;  4A5N A;  2RKH A;  4XM3 A;  4RGS A;  3CP8 A;  1GDT A;  5E3L A;  4E7H A;  3MD2 A;  2CQQ A;  4II2 A;  5LEK A;  2QKL B;  3DPU A;  3J7A O;  1XD7 A;  3LOC A;  3DQV C;  1DGR M;  2FMY A;  1YW9 A;  1IXR C;  2HYF A;  3HYI A;  4IL6 C;  3FM3 A;  4YFX F;  1S7E A;  2EA4 A;  3SHF A;  5J8C A;  2LY1 A;  2EV6 A;  3ZRG A;  4KA4 A;  2W25 A;  1SFE A;  3KEQ A;  4ZDP A;  3GTK J;  1JJ8 C;  2VBY A;  2LH9 A;  2M2E A;  2UZK A;  1FNN A;  3ZN0 A;  4ETS A;  1QU3 A;  3OOU A;  4YEL A;  2ESN A;  2M87 A;  2DLL A;  1OR7 C;  1TQM A;  5K5O A;  4WCG A;  3OS0 A;  1ZH5 A;  4WWC A;  4X0G A;  3A0B C;  5BMZ A;  2BXY A;  3GTL J;  4L9T A;  5GPA A;  2X1E A;  4RGU A;  1MMD A;  4N0B A;  5HNF A;  3BC8 A;  3IV5 A;  1LVK A;  2NAZ A;  3SQN A;  2KJB A;  1YI2 I;  4E6K G;  3BDD A;  5DDG A;  5FFX A;  4A93 J;  1MSF C;  3NQO A;  5FKN A;  2HOT A;  2JA5 J;  2YR2 A;  2BHZ A;  4XBF A;  1OFC X;  2XB0 X;  1Y1W J;  1WH5 A;  3F9K A;  4XSX F;  5EEG A;  4OAY A;  3K6G A;  3JSP A;  1MW7 A;  2M5W A;  4OIO F;  2KIF A;  3V8L A;  3I71 A;  3OY9 A;  1OYW A;  1OJL A;  2DK5 A;  1R36 A;  4KT6 A;  5E1Z B;  3I4M J;  3QYE A;  2R7R A;  4LG0 B;  2VT2 A;  2F5F A;  3SFI A;  3C3W A;  3OYD A;  1W0T A;  1FJL A;  3F6O A;  2XPW A;  2ZSH B;  1ZAR A;  4PFO A;  2OPT A;  1W36 C;  4HX8 A;  2KLO A;  3PSI A;  2DA4 A;  3HHH A;  2R7S A;  1V54 H;  4L0Y B;  2AQE A;  1OMI A;  2PX9 A;  2VJ4 A;  3M8E A;  2VKV A;  3RKQ A;  1F9N A;  4EM2 A;  2L02 A;  3FBN B;  1Z3Y A;  1H88 C;  2K27 A;  4A2U A;  2DTZ A;  3I4P A;  3PM1 A;  2NRA C;  3E6B A;  2XAQ A;  2K9M A;  2PMZ A;  3IC7 A;  4HX4 A;  2E5N A;  4N9I A;  3K70 C;  2Q2E A;  4HF0 A;  2MC4 A;  5GTH C;  3KFW X;  2GLO A;  3DLL F;  2NVY J;  1JKO C;  3BTL A;  1ZRC A;  2AQF A;  3WE3 A;  3JRI A;  2Y48 A;  4NDL A;  1Z05 A;  4Q5S F;  2X6O A;  3R6S A;  3DTK A;  3JRG A;  1MJ9 A;  3K4M A;  1J2X A;  2ZCW A;  3S3M A;  1IC8 A;  1OCR H;  2CO5 A;  1R23 A;  1HXD A;  1FZP B;  3MKY B;  3KP7 A;  4XL9 A;  5FKL A;  3CMA I;  1IRF A;  2W48 A;  4R1H A;  2BY0 A;  2DMT A;  3QOE A;  2CW7 A;  3DFG A;  5KHD A;  2QZ8 A;  2LBF B;  3S2W A;  2G9W A;  4IZZ A;  4G94 A;  2VKE A;  1HKS A;  1G4D A;  2BW3 A;  4IX7 A;  2PJP A;  2HVR A;  2M8G X;  3S1Q J;  4EGY A;  4HEA 2;  2K4J A;  3BJ6 A;  5D5W B;  2BXZ A;  5M5Y J;  3OYA A;  1IDZ A;  2ZJQ F;  1NTC A;  3CUQ C;  2X51 A;  3Q9S A;  2KZG A;  4AID A;  5AIQ A;  3ULQ B;  2HU9 A;  3OYK A;  2NVT J;  4RM3 A;  3TDZ C;  1JUP A;  4OIP F;  2VN2 A;  2HKX A;  1R5H A;  1Y8Q B;  2V6E A;  4A0Y A;  5J47 A;  1IRG A;  1FLI A;  2XKP A;  2JSP A;  4M9S A;  4BAC A;  3AG4 H;  4OIQ F;  3L9F A;  4H4K C;  3PQJ A;  3NRV A;  2L9N A;  1T95 A;  4RLF A;  1NG6 A;  3BPX A;  2A5W A;  1SVO A;  2FOK A;  2P8T A;  4AC0 A;  2ESH A;  3X2Q H;  5DTD A;  1YTY A;  1DDN A;  1POG A;  3MN2 A;  3KP2 A;  2RV8 A;  2K9L A;  1OCT C;  1IN7 A;  1JTX A;  2FUG 2;  3J81 Z;  1UG2 A;  4XOR A;  3CZ6 A;  4ZZD A;  5IT9 Z;  1VQ7 I;  1LE8 A;  2WY8 Q;  3CME I;  1GV5 A;  4PK4 A;  3TBI A;  3M4O J;  1GVD A;  2JUG A;  3HGY A;  3T1B A;  4BUP A;  3K4N A;  5K5R A;  3L1P A;  1IAW A;  3EQL F;  2CG4 A;  1V3F A;  3BR5 A;  1A36 A;  3ZMD A;  2QKM B;  2WWY A;  1IN8 A;  4ZTJ A;  2K85 A;  3VEP A;  2FRH A;  3QU6 A;  3F21 A;  1B72 A;  5EZH A;  4BXU A;  3GTO J;  2GM4 A;  1R58 A;  1U6G A;  4AYB N;  1IJW C;  2LY9 A;  1VQM I;  4UXN A;  3CCY A;  2PMH A;  1XCV A;  4RLQ A;  3CCV I;  2EFP A;  5IYC J;  3S2D J;  2OUM A;  2E36 A;  4A3E J;  4L5J A;  1ZAO A;  2XF5 A;  4QIW N;  4ZYD A;  2P81 A;  3CP2 A;  1IUF A;  2EH3 A;  2YSR A;  4KJZ A;  3L2W A;  2ZFW A;  1JE8 A;  1X1P A;  3MZH A;  5HDN A;  3J7Z I;  4A3M J;  5B66 C;  1QQI A;  3LL7 A;  2JVH A;  2BOL A;  2OV7 A;  2V9V A;  2D5V A;  2WAE A;  5J1U A;  1AA7 A;  1TL8 A;  1G3Y A;  2WY7 Q;  3R0A A;  4XR6 A;  1FIA A;  3QOD A;  2E7W A;  3FMQ A;  3MZ8 A;  3GVA A;  3S3N A;  3CTA A;  2L0K A;  4JYK A;  4Q48 A;  2EK5 A;  3E6D A;  3A4C A;  1B8I B;  4WF2 A;  2BY2 A;  3WU1 B;  5E20 A;  4J00 A;  2E34 A;  2K3F A;  1MIJ A;  2XAU A;  1Z1D A;  4B4C A;  2L2O A;  3OR1 C;  2A6T A;  1AHD P;  5DYM A;  3PUB A;  4YRV A;  2XV4 S;  1HW5 A;  3F8B A;  3EET A;  3J81 K;  3HPH A;  4HX7 A;  4A6E A;  3J80 K;  3G6E I;  1YIO A;  1T0F C;  2R5Z A;  1ZYR F;  4KIC A;  1APL C;  3TO6 A;  1JKP C;  4D0P A;  1H0M A;  3LSH A;  4O3M A;  4E4H A;  1QHG A;  4LFU A;  5EJC A;  1ZGW A;  1S9H A;  1E3O C;  3CCE I;  3VOE A;  3IAS 2;  2A6E F;  2QBY A;  1PUF A;  3FZV A;  3MEX A;  3NEU A;  2DT5 A;  3VYU B;  2KL4 A;  3G1M A;  3ZR8 X;  4B48 A;  1HKT A;  4CDG A;  1LFP A;  5FD5 A;  2LLK A;  2HQN A;  3ONQ A;  1V55 H;  4NC8 A;  3CCS I;  1ETQ A;  2Y9Y A;  5IP6 A;  3RPQ A;  5F0F A;  2BV6 A;  2M7B A;  1IZ1 A;  3B6C A;  3W2W A;  2EV0 A;  1DGW Y;  2CGP A;  1A04 A;  5FB2 A;  5ED4 A;  2BVL A;  2CQ7 A;  3OYL A;  2E1N A;  4I99 C;  1VQ6 I;  3D5S C;  2CRG A;  1I1S A;  2BYV E;  1LNW A;  3EUH A;  1RC9 A;  1JHF A;  4P9U A;  4OWR B;  3S14 J;  1WJA A;  1MMS A;  4O6J A;  3S2H J;  3V8J A;  1WJB A;  3TGN A;  3KZY A;  5TIS C;  4ON0 A;  3VWB A;  2J5O A;  4L5E A;  4ZTF A;  1N77 A;  1XMK A;  3LST A;  1Z9C A;  2KT0 A;  2MFZ A;  2VB6 A;  2VE9 A;  3ZGK A;  3FHN A;  3WTW C;  2H09 A;  3CF2 A;  3FKI J;  3AL0 C;  4RB3 C;  4WK8 F;  1XSX A;  2EBI A;  3KZI C;  1OKR A;  1V5F A;  5BS6 A;  4S04 A;  2HI3 A;  1ETW A;  1U9O A;  2CV0 A;  2X9D A;  1KQ8 A;  4H0E A;  4XOT A;  1WRJ A;  3Q5F A;  4G12 A;  4QTR A;  1ZN2 A;  4HF2 A;  4BQQ A;  1K79 A;  2A61 A;  4RGX A;  3E6C C;  1YS6 A;  2EIM H;  2DA1 A;  1VQK I;  2JA6 J;  4N4O B;  2K40 A;  5DCM A;  3L2C A;  1RIO H;  5HOO A;  3SYT A;  2NVX J;  5AON A;  3BR3 A;  4EJV A;  1YJW I;  5EG0 A;  3OIP A;  4KIB A;  3DEE A;  5FLV A;  3SZP A;  1TW3 A;  4F52 A;  1WI9 A;  2L54 A;  1QO0 D;  9ANT A;  2HZT A;  1ODD A;  4I09 A;  2ZKZ A;  4HAM A;  4TV7 A;  2L7K A;  3NWT A;  4LG3 A;  3JR9 A;  2QEN A;  1XX5 A;  3DBL B;  3ZCO A;  3OOP A;  5HNH A;  1T56 A;  1RKT A;  2PN6 A;  1SMY F;  4CCL A;  3G1O A;  4MFD A;  5LFA A;  4XRM A;  4XLC A;  1RI7 A;  3LMM A;  3W6J B;  2VKD A;  2ZO4 A;  1TC3 C;  3U1K A;  4BBS J;  4PSW A;  3OYN A;  3E5Q A;  1A31 A;  5HDK A;  1V4R A;  1B6A A;  4BQN A;  1JKR C;  2H8R A;  3M1C A;  5C44 J;  2GXB A;  2IGM A;  4DBR A;  3BZK A;  3QPL A;  4FE4 A;  1ZG1 A;  4MTD A;  1RR7 A;  3RKY A;  2F5C A;  3E5X A;  3CD6 I;  3F3X A;  4FX0 A;  1Z0X A;  4BYY A;  3GLX A;  3H5A A;  4HA8 A;  3PO3 J;  2LSO A;  5FGM A;  2L9R A;  3D0S A;  2Z5U A;  3LSG A;  4XSZ F;  4EJW A;  1IG7 A;  2HOS A;  3OWT A;  4C30 A;  3Q0V A;  1E3H A;  3HEF A;  5JR3 A;  2EFO A;  2Y0S A;  1SD7 A;  1XB4 A;  3IWF A;  3OS2 A;  3G2B A;  1HQC A;  3WHC A;  1W5C C;  3OR2 C;  2UUZ A;  2RNG A;  2VAS A;  3ZQG A;  1U0J A;  1WJE A;  1OR7 A;  3ISP A;  3RPU D;  3JAM Z;  1KYW A;  2JWT A;  3JRF A;  1U78 A;  1I50 J;  3GTQ J;  5LRR A;  4BY1 J;  3PNV A;  1QPM A;  3SXY A;  4LB5 A;  1X1A A;  3B02 A;  4UHT A;  1WPK A;  3PQK A;  2F5D A;  3VSK A;  5GP9 A;  2GA2 A;  1YG2 A;  2M0M A;  3IHU A;  1AKH A;  1W5S A;  1X3U A;  2VBZ A;  3OYC A;  5F64 A;  4E7K A;  3HL2 A;  2ACJ A;  2GZW A;  4KN7 X;  3CCJ I;  4YEJ A;  1XPX A;  3MKW B;  2W00 A;  5F1R A;  5C4X J;  1ZGA A;  5IP9 J;  4C3J J;  1OCP A;  1P4W A;  3BZ6 A;  3P9C A;  5B3S H;  5E1W A;  2CQK A;  2RDP A;  3H3U A;  3DF8 A;  1DUX C;  1IRZ A;  2E1C A;  3ZMT A;  2DA3 A;  5HOD A;  3OS1 A;  2W85 A;  4AIH A;  3HXL A;  2ADU A;  3HZJ A;  1I27 A;  3OV8 A;  3OL3 A;  3BT9 A;  2QF7 A;  1O57 A;  5DCM B;  4S0H B;  4A0X A;  2RAE A;  1I1G A;  3I5U A;  4CYC B;  2DOD A;  4C2U A;  2OCC H;  1ORK A;  1JXS A;  1FT9 A;  4EEF G;  1P2F A;  2PMZ N;  3F8C A;  2CV1 A;  3LSI A;  3TO9 A;  3GEZ A;  1WQ2 A;  3H92 A;  2HXO A;  1TWH J;  2R3S A;  4MLO A;  4U7B A;  5L3E A;  1Z3X A;  5CQG A;  3CC4 I;  3HPG A;  5KCM A;  2LC2 A;  3PIO F;  2VQH A;  4FET A;  4WXH A;  1FTZ A;  3ZPL A;  2CQN A;  3VSL A;  3ZQQ A;  1ZRF A;  5M3F J;  3ECO A;  4ENM A;  2E1O A;  5JI6 A;  1QZZ A;  2W4S A;  1F4K A;  5K1Y A;  3V8K A;  5C3E J;  2PG4 A;  4HST A;  2QM3 A;  4XRS A;  4M3F A;  4AIJ A;  4YII A;  1ZRD A;  2JTV A;  4L18 B;  4FQG A;  5F1J A;  4AU7 A;  5GAH J;  3HUG A;  4UUT A;  4DQ2 A;  1D8J A;  1YX5 A;  1FC3 A;  2MAB A;  3BCB A;  3DKX A;  1VQ9 I;  2F48 A;  1Y0N A;  4M3D A;  3VDX A;  2ZFU A;  3OMY A;  3CUQ A;  2LF8 A;  1LEA A;  3RQ4 A;  1G59 A;  4RM2 A;  4EVI A;  3HTU A;  1G3S A;  2XAS A;  1QZE A;  2DOA A;  1W1W E;  2W7N A;  2ZJR F;  3QP5 A;  5M5X J;  3E6M A;  1OQY A;  4LG0 A;  4GCV A;  4Y52 J;  5HVQ C;  2K7L A;  1H8A C;  3F6V A;  4BKX A;  1U8R A;  2AS5 F;  2E1M C;  2JPC A;  3BP8 A;  1WKM A;  1PP8 F;  4BJ6 C;  2COB A;  4D7M A;  1O7L A;  5DS9 A;  5LRS A;  4CCN A;  1OPC A;  2DCE A;  5FO5 A;  5LBQ A;  1MGT A;  2OTJ I;  2EZH A;  2P6S A;  4L9V A;  1DP3 A;  3BOQ A;  1RZ4 A;  3LSM A;  2WAQ N;  4M9Z A;  4E70 A;  4HNU A;  2L4A A;  1TWA J;  3OYI A;  4L9N A;  5F08 A;  3QAH A;  1XN7 A;  3I58 A;  2VJJ A;  2HOE A;  3QRF F;  4ZYH A;  4HYE A;  2DMP A;  3K69 A;  2MGQ A;  4A3F J;  2EZI A;  5HDG A;  1PJR A;  5J1R A;  3HB9 A;  4W97 A;  2KDZ A;  1OCZ H;  4LK1 F;  3FK6 A;  2XC7 A;  3BTC A;  5KAI C;  1SEU A;  2DDB A;  3GZ5 A;  4FT8 A;  2MH2 A;  2DJN A;  2LK2 A;  5JLX A;  1B1B A;  3VYT B;  3H5N A;  1ZQ3 P;  2W82 A;  1LEB A;  2LBF A;  4V2F A;  2IW5 A;  4XQF A;  1R49 A;  1BIB A;  1KA8 A;  2PBI A;  1ZHF A;  3WTY C;  3O8G A;  3JTH A;  3BQZ A;  3PIP F;  1SAU A;  2P5V A;  3AKZ A;  2E71 A;  2R93 J;  5EZG A;  3TMO A;  5DUI A;  4RBO A;  1YQA A;  2E7X A;  3BG5 A;  1RUN A;  1U5T C;  1WJ5 A;  1NH3 A;  3W2V A;  2B7E A;  1NG7 A;  2JPB A;  4MQ9 F;  3LWF A;  4D5F A;  3G73 A;  1TWG J;  3FXJ A;  1YYV A;  3NAU A;  2I5U A;  3H0D A;  3QPH A;  3F8F A;  4YIF A;  3IH4 A;  1CQT A;  3ZOB A;  4L9J A;  2NVU B;  2VBX A;  2P5L C;  5LHH A;  2R92 J;  4MHG A;  5E17 F;  3AG1 H;  2HR3 A;  3FXR A;  1VQ4 I;  1O3R A;  1WJD A;  3RI4 A;  5DUK A;  4FAS D;  3R60 A;  3HOZ J;  3ZMZ A;  5DV5 A;  4BHC A;  2B63 J;  4KIS A;  1B59 A;  3CJR B;  1T0F A;  1LPQ A;  1BC7 C;  1MBH A;  4CXF A;  4N9H A;  3HOS A;  5D5V B;  1K7A A;  4HW0 A;  1MZB A;  3P7N A;  5H6R A;  3HG9 A;  1IXS B;  2HWV A;  4CCJ A;  5IPA A;  4Y33 A;  4BHB A;  3IH3 A;  1SD6 A;  1P7J A;  3L2U A;  1DP7 P;  5BOX A;  2DPD A;  4M74 A;  4IRI A;  1I6H J;  5HLI A;  4BQO A;  3HGG A;  3LFK A;  1EA3 A;  3EDP A;  4DZP A;  5IOY A;  3CDH A;  2IVM A;  3WHB A;  3EYI A;  2E2H J;  3QPS A;  3HUG B;  3DP7 A;  3S93 A;  5FD6 A;  4FCY A;  2QA4 I;  2E19 A;  4RAY A;  4JBA A;  2LTP A;  5LLQ A;  1NK3 P;  3GME A;  3OYJ A;  3CUQ B;  3TOB A;  2DU9 A;  3ERE D;  1FIP A;  1R7J A;  1Y8R B;  2FSW A;  3H36 A;  4U87 A;  4RB2 C;  2RGV A;  1E17 A;  5EDN A;  1LFB A;  4M6Y A;  2NOG A;  1XGS A;  1E0E A;  4IQ4 A;  2QQA A;  1R1U A;  1A6I A;  2FEZ A;  5KK1 A;  1I39 A;  1S72 I;  3ABL H;  2XRO A;  3E1S A;  2HZD A;  2X85 A;  5JFR A;  2HS5 A;  2KP6 A;  2HEO A;  1EF4 A;  1D5Y A;  4M6V A;  3BWG A;  1B8I A;  3M07 A;  3FXQ A;  3GTP J;  2JT1 A;  2FE3 A;  5L3B A;  4CH7 A;  1JHH A;  1STZ A;  1WSU A;  4NB5 A;  3GFM A;  2Z99 A;  2MA3 A;  1T33 A;  1BI3 A;  3I9V 2;  2O5R A;  4BDY A;  2MYS A;  3GFJ A;  2LG4 A;  2FBH A;  3MWM A;  1JKQ C;  1EV7 A;  2FXA A;  4FTH A;  3ML6 A;  5D4R A;  2DYS H;  3IL2 A;  4PGG A;  2EIN H;  3M9A A;  2HOA A;  4A3I J;  1SAX A;  3ABK H;  2VI6 A;  2JQ7 A;  5K5Q A;  2F6C A;  1G8X A;  1W7P B;  3HRM A;  2R7T A;  2ELK A;  2KFD A;  2IS2 A;  3CO7 C;  4IRG A;  4A3K J;  2IXS A;  1MBJ A;  4AWX B;  1S3J A;  1Z6R A;  1R6R A;  2QGU A;  1WHU A;  4P55 A;  4NNJ A;  1YIT I;  3BLY A;  5CPR B;  1VF9 A;  4LIU A;  1X1D A;  3C1D A;  2XPV A;  3CMY A;  1UZC A;  1X1C A;  2W84 A;  2XPU A;  2ZXI A;  3ZMS A;  2HGC A;  4NHJ A;  5EGO B;  2UWM A;  2KIM A;  3GTG J;  1WFX A;  1VFC A;  1BOA A;  1HSJ A;  4Q4Z F;  3A02 A;  4DIQ A;  1IN4 A;  2LVS A;  3KLO A;  3OYM A;  4XON A;  3K4B A;  4V2G A;  2DOE A;  2KRC A;  1DU0 A;  3HKZ A;  2DOF A;  5F0C A;  1YRN B;  4M72 A;  1JGG A;  2M45 A;  4CSW A;  2M4G A;  3P9K A;  2WAQ A;  3RJP A;  3OIO A;  4XKC A;  3VOD A;  3LNQ A;  5EYR A;  5TGT A;  1D3Y A;  4LOC A;  2LP0 A;  2MG4 A;  2E60 A;  3GX4 X;  2A07 F;  1XSV A;  2XF6 A;  4IHV A;  3L2V A;  2NYX A;  2WA0 A;  2O6G E;  4U0Y A;  1UMQ A;  3HJE A;  5FLX Z;  2NOJ B;  4D5C A;  5DM7 F;  1NK2 P;  2OA4 A;  1YJN I;  2F5E A;  4OU0 A;  1WZ2 A;  2NS7 A;  3RYR A;  5GPC A;  4BDZ A;  4Y3O A;  4ZC3 A;  3CLQ A;  2NS8 A;  2VOD A;  3CF5 F;  2R0Q C;  1O3S A;  3DLA A;  4IOC F;  1LQ1 A;  3DEU A;  2R7Q A;  5KVR A;  3KEY A;  2Y0S N;  4A69 C;  4G7Z F;  3G3Z A;  1T08 B;  1ULY A;  3D5L A;  1Z6T A;  2HYJ A;  4IHX A;  3HBL A;  4QPQ A;  5GTI C;  1YW8 A;  1Y6I A;  4IHW A;  2P6T A;  3IWZ A;  1O3Q A;  1K4S A;  4XRS G;  2M0C A;  2XAH A;  4JQF A;  3W3C A;  1ZLK A;  1ZG3 A;  3FXM A;  1QGP A;  4HZF A;  3BTI A;  1FOY A;  3DCF A;  2K9Q A;  1XGN A;  1HBX G;  5IT3 A;  2IT0 A;  3HOV J;  2NS0 A;  4U88 A;  2ME6 A;  2X0L A;  1XCB A;  2XHK A;  2P7V B;  1LUJ B;  1K61 A;  3A2K A;  1JTY A;  3HSR A;  1F36 A;  2OQR A;  2R7D A;  1YW7 A;  4BS9 A;  1PP7 U;  2VXZ A;  4IHS A;  5JHU A;  3AL0 B;  3CUO A;  4FIS A;  2IGK A;  1OIS A;  4NC6 A;  1FEX A;  2L7Z A;  3BR6 A;  3DBH B;  1GV2 A;  2FNP A;  1X3Z B;  3EUA A;  3R61 A;  3BR0 A;  5LHG A;  2NVQ J;  2XUB A;  5IT9 K;  2GOM A;  2WV0 A;  2X1C A;  5CJ9 A;  1WWX A;  3ERM A;  3D1N I;  1CGP A;  2FBI A;  4NQW B;  4B43 A;  2JZY A;  2XGD A;  3CDL A;  3F8N A;  5DD8 A;  1O3T A;  2A5Y B;  3S15 J;  1Z21 A;  5LGU A;  4I98 B;  2DFH A;  4BEH B;  1MDM A;  2WB1 A;  2ISZ A;  1WCM J;  3BZC A;  3Q3S A;  2GIZ A;  2L7M P;  2VC0 A;  1ERD A;  2EPF A;  1OLT A;  2RC4 A;  3T8T A;  2CS3 A;  1I3A A;  1IW7 F;  4I0A A;  2RQQ A;  2DTR A;  1RET A;  3RTR A;  4C2T A;  4B09 A;  2ZME B;  3OYG A;  1JT0 A;  4RMN A;  1OCC H;  3JCU C;  4NUB A;  3DPL C;  3RKX A;  5TRD A;  2K02 A;  2RRE A;  5EEH A;  3DBR B;  2XDV A;  4UV9 A;  4LK0 F;  1FYM A;  4GO1 A;  2F5V A;  2DA2 A;  1K6O A;  5F27 A;  1X19 A;  2R7V A;  1M1E B;  2H6B A;  3DV8 A;  4IKF A;  1Z67 A;  3R4K A;  2W1O A;  3ZN1 A;  1VQN I;  3MCZ A;  5E3O A;  1WI3 A;  2MLK A;  3VYR B;  3C2B A;  3RKW A;  5D5X B;  1BI1 A;  1N25 A;  2YU3 A;  1MD0 A;  3K4J A;  4OOI A;  5ILU A;  4XIC A;  3G1L A;  1XDU A;  3DTE A;  2G7H A;  2HFH A;  2O61 A;  1Z77 A;  4HG2 A;  2PFB A;  2R7O A;  2L9V A;  1D1B A;  2JVG A;  3H35 A;  1RNL A;  5HS9 A;  1WGX A;  1P9Q C;  4HNV A;  4UUV A;  3GBG A;  5J6X A;  3M3Y J;  1K78 B;  1VI0 A;  2FNA A;  3KEO A;  1Z7L A;  1FP2 A;  4PJL A;  2XIG A;  1OCO H;  4DJA A;  1W0U A;  4LLN A;  2ECC A;  3CCQ I;  4O5V A;  2F4O B;  2QQ8 A;  5B1B H;  2DXI A;  2VON A;  3S3O A;  3CCL I;  3HHG A;  3KPH A;  3A03 A;  1CF7 B;  4KN4 X;  2CSO A;  2YPR A;  3VYS B;  3SDG A;  5M5W J;  4KMF A;  1I5Z A;  1UB9 A;  1XGM A;  3JW4 A;  4CYC A;  1BR2 A;  1UFM A;  2TRT A;  2O3F A;  1MND A;  2N8G A;  4BXX J;  2VOP A;  1VQL I;  4KIG A;  3PJR A;  5FRN A;  4KFC A;  3MMY B;  2DO7 A;  1T39 A;  4EJO A;  2PEX A;  3E0J B;  3F8M A;  3WGI A;  4IF4 A;  3WTV C;  3S1M J;  3K1P A;  2O8K A;  4M3G A;  1RES A;  2OD5 A;  1SVL A;  2ZME C;  2YU9 J;  3N4M A;  1R22 A;  5LGN A;  3K1M A;  5L3F A;  2BE5 F;  2Z33 A;  3M7G A;  2X48 A;  3IRR A;  3FBI B;  1F5T A;  1S7A A;  2YX7 A;  1SFX A;  2AHQ A;  4P5O A;  5FKK A;  4ASN A;  2HQR A;  5K7F A;  2Z3Y A;  2HXI A;  4RS8 A;  5CVR A;  2VUM J;  1JT6 A;  3H9Q A;  5HLG A;  2EQR A;  2O03 A;  4Z2Y A;  2KHM A;  2ZBK A;  1VTN C;  3BQY A;  4CUG A;  2P5K A;  1ZGJ A;  3K4K A;  2ZSI B;  1IO2 A;  2DA5 A;  3WG7 H;  2VKH A;  1G6N A;  2BEO A;  1K4T A;  2V6C A;  4KIF A;  4BL0 B;  4HRI A;  4QWQ A;  1FY7 A;  1UST A;  2PLY A;  2OAZ A;  5H2F C;  1P6R A;  2BZT A;  5D6F A;  4E7Z A;  3K10 A;  3GW2 A;  4MQV A;  1MBK A;  3EUK L;  3LSJ A;  3QWL A;  1MH4 A;  4XLN F;  4CHU A;  4GYI A;  2AO9 A;  3NAR A;  2K9S A;  1R4M B;  2MBF A;  5IY5 H;  4ENN A;  1MDM B;  3P9I A;  4I2O A;  1D0X A;  1AOY A;  4XLE A;  4UVC A;  4AVP A;  3WU0 A;  1SD5 A;  1B9N A;  4F3Q A;  3J7Y J;  1YE9 A;  3CO6 C;  1X4O A;  2A6H F;  2K4B A;  4G8X A;  2MD0 A;  2P4W A;  2OZ6 A;  3ZP5 A;  1MJB A;  1J09 A;  1XTA A;  2LKP A;  4Y4R A;  1R5I D;  3SEQ A;  4YIR X;  4PJ0 C;  1LDD A;  3S8P A;  3KYD B;  2DMN A;  1T2K A;  1RR8 C;  2LF7 A;  4LIV A;  1J59 A;  2Y2Z A;  6PAX A;  4IRH A;  2JN6 A;  5CVV A;  4LB6 B;  4PDK A;  3GCM A;  4YFN F;  1W36 D;  3DXJ F;  3FKJ A;  2H1L A;  3I54 A;  4LIT A;  3IP4 B;  2M34 A;  3T5X A;  5J4Y A;  1YIJ I;  1G3T A;  2HDD A;  1UG0 A;  4CZZ A;  1A6Q A;  2XRL A;  3FHZ A;  2BBY A;  2KPM A;  4YFK F;  3T0Y A;  2VC1 A;  4OMY A;  4A3B J;  1V5E A;  4HPQ A;  2K9N A;  3HRT A;  5D8L B;  3JRB A;  5C4J J;  2OCE A;  2OC6 A;  3HRS A;  4GYG A;  2ID3 A;  1FBQ A;  4CYD A;  2IS4 A;  4Y13 A;  4B3X A;  3ABU A;  3QQA A;  1DPU A;  3DU5 A;  3K70 D;  3A01 A;  1AU7 A;  1ZLJ A;  5F6F A;  1UHM A;  2E5Z A;  2EWN A;  5E3M A;  1U3E M;  2CW8 A;  4RGR A;  5JVG F;  2KZV A;  4KYW A;  2FU4 A;  2CYY A;  2E1M B;  2X6X A;  3OYF A;  2BGC A;  1UAA A;  2DMU A;  2STT A;  1B9M A;  1QRY A;  2QWW A;  4KUM A;  4A3G J;  4XKV A;  4PCQ A;  4KMU X;  5D4S A;  2TCT A;  3JRH A;  2XF7 A;  4AVZ A;  4CCO A;  3L2Q A;  1YJ9 I;  4UV8 A;  1HKQ A;  4HF1 A;  3MKZ A;  2K5C A;  1EH7 A;  4LMY A;  1FYL A;  4CGZ A;  1ITY A;  1Q1H A;  3ASN H;  3HOW J;  1QZY A;  2GXG A;  2RQP A;  3PNT A;  3OYE A;  4K2E A;  2HPI A;  4DNC A;  4OMZ A;  1R5G A;  2KQR A;  3BG7 A;  1SFO J;  3P5J A;  5GAG J;  2V79 A;  1C0W A;  3VFZ A;  1QNT A;  5FLM J;  4IVN A;  2DAO A;  4LGW A;  3ABM H;  2X6W A;  1XMA A;  1W4M A;  5KAF C;  3CC2 I;  5HLH A;  3JAM K;  3RCO A;  1G3W A;  1FOX A;  1TTY A;  1SD4 A;  2KRF A;  4UB6 C;  3RIR A;  4B47 A;  3OYB A;  1VQP I;  4FHT A;  4PJJ A;  1TNT A;  2R5Y B;  3WGG A;  3FX3 A;  3GFL A;  2ZXH A;  3KCC A;  3PNY A;  1BL0 A;  2LY2 A;  1S7O A;  4EJU A;  1P4X A;  1R00 A;  2D1V A;  2LNB A;  2HQA A;  5D6E A;  4HDV A;  3LA2 A;  1SFU A;  4QPO A;  2J5P A;  3CC7 I;  4M3E A;  4EQQ A;  5DM6 F;  3JRE A;  1FBS A;  1U5T B;  2LD5 A;  2CFO A;  4XMY A;  1SFK A;  4F55 A;  5IYD J;  4G6Q A;  1IV6 A;  1LDK B;  3BPV A;  4BH9 A;  4CZC A;  3CLO A;  5J3L A;  3LAJ A;  4HSR A;  4XLP F;  2OJE D;  4ZYG A;  1ZK8 A;  3F0C A;  3I3L A;  4JP0 A;  4NBQ A;  4P96 A;  1FYK A;  2QQ9 A;  2XRN A;  4M9X A;  4RAZ A;  2CUJ A;  2GA1 A;  2HTJ A;  2V26 A;  1MNM C;  2FF4 A;  1F43 A;  2DW4 A;  3LAP A;  2H6C A;  4XNF A;  3SJM A;  5FJ8 J;  1S6L A;  3MFK A;  1BA5 A;  2XB5 A;  3HKZ N;  2DT6 A;  3PUF A;  4R8H A;  1KZH A;  2GXA A;  2G7U A;  3RSN A;  3BRO A;  3W6V A;  4HDU A;  3ECH A;  3LA7 A;  2FML A;  3DTI A;  1QHH D;  3CDI A;  2DFI A;  4GRI A;  3KE2 A;  3L09 A;  1GHC A;  2CMP A;  5L3C A;  2XGC A;  3FIW A;  3PFI A;  2IPQ X;  2XGE A;  3HOT A;  4LJZ F;  3TKY A;  2EIL H;  3DU6 A;  2Z2S B;  1K6Y A;  3J7A Y;  2R7W A;  2OBP A;  5H6Q A;  1YHQ I;  2WBM A;  1SAN A;  2RNJ A;  4BE0 A;  4A5M A;  1W7P A;  4RAF A;  2VXD A;  3FK7 A;  3IH2 A;  5DCF A;  3COA C;  2ID6 A;  3I59 B;  2OQG A;  3H9J A;  4NC7 A;  1P4A A;  1E3P A;  2A69 F;  3RZD J;  4AIK A;  1SC7 A;  4MGR A;  1J9I A;  5LGT A;  4ANJ A;  4HLY A;  3A01 B;  2ZNZ A;  4A3L J;  4DYQ A;  3K1N A;  2IEK A;  3SEZ A;  5E8G A;  4P1W A;  1YFH A;  3V42 A;  3D5R C;  5EGO A;  3UKG A;  2IS6 A;  1TBX A;  2COM A;  3OL4 A;  4KT5 C;  2ZNY A;  3TP0 A;  1A35 A;  5JHF A;  1BI2 A;  1JJ6 C;  1R1V A;  3U2R A;  4A3C J;  1HOM A;  5E79 C;  5ILS A;  2L4M A;  3KP3 A;  1IN6 A;  3T8R A;  5LHI A;  2H27 A;  1DU6 A;  3C7J A;  2CV2 A;  3PO2 J;  4DOZ A;  3WU2 C;  2DJI A;  2MSY A;  2DA7 A;  3TOA A;  3CCM I;  1YRN A;  3ZQL A;  3S17 J;  4ITV A;  1BR1 A;  3K0L A;  2EFW A;  5EEA A;  2ICW G;  3H3Z A;  3E7L A;  3RYP A;  2M8E A;  1J0R A;  1BM9 A;  2WC2 A;  1HA8 A;  4M71 A;  2CWE A;  4XN0 A;  2MW8 A;  1QA6 A;  2ZXJ A;  5J40 A;  3GFI A;  4PGH A;  3BG9 A;  1Y0U A;  1QBJ A;  2HTS A;  1UHS A;  2CJJ A;  3FIS A;  4PZJ A;  5F0H A;  3AAF A;  2DMQ A;  1U9N A;  3QOP A;  1VND A;  4I6Z A;  4QLC U;  1H9G A;  2PJR B;  3E5U A;  1H89 C;  2CQX A;  4HQM A;  2X1D A;  1KU3 A;  4MO7 A;  4E7I A;  2M4K A;  2WB1 N;  1ENH A;  3U9G A;  1TT5 B;  1PUE E;  4BHP A;  1I6X A;  3A1Y A;  1F1Z A;  2ISY A;  1LB2 A;  3I56 I;  1UJ8 A;  3O2P E;  1HST A;  2DT7 B;  2OF7 A;  5D8K B;  3RZO J;  5L3G A;  1AWC A;  2K3P A;  3N05 A;  4GXO A;  1BC8 C;  4EM0 B;  5ICC A;  1ZG5 A;  3TDU C;  2VQC A;  4RA2 A;  2GQQ A;  2D2W A;  3E97 A;  4UUS B;  3LA3 A;  4N4N B;  3K9T A;  2VL8 A;  3CCU I;  2A68 F;  1TP4 A;  2FQ4 A;  3GLL A;  4IJA A;  1MMN A;  1PDN C;  3FF5 A;  5E3N A;  1VQO I;  4ESF A;  2HQ5 A;  2VQL A;  3OSG A;  1IXC A;  4CCK A;  3A0H C;  1D5V A;  4MTE A;  5DEQ A;  1JI8 A;  4EJT A;  2EFN A;  2NXN B;  2O7O A;  3L7W A;  2TDX A;  4XLH A;  1TQI A;  1OYY A;  5FFZ A;  2IJL A;  3IAM 2;  3JSO A;  3WTX C;  4BY7 J;  2KIU A;  2MC3 A;  4PUS A;  2VBW A;  2MH9 A;  5H20 A;  4ZZL A;  1IN5 A;  1JUM A;  1ZTR A;  2XSJ C;  3BTJ A;  4IO9 F;  4D9J A;  4ESJ A;  1KU2 A;  3HC7 A;  1Y39 A;  2QSF X;  1K83 J;  2F2E A;  3PFY A;  4NQW A;  2JK3 A;  3KLN A;  2IAI A;  4C3H J;  3H1C A;  3KYL A;  5JLW A;  1VQ5 I;  4CA0 A;  5B1A H;  2KRH A;  3SDB A;  2BVM A;  4BEH A;  2W57 A;  3CJQ B;  1D1A A; 
#chains in the Genus database with same CATH homology
 3JRD A;  3TW6 A;  1RET A;  1G2H A;  4DYR A;  1MBF A;  3S1N J;  3WHC A;  2IBD A;  1JT0 A;  3ZQG A;  3I4N J;  3JRF A;  2DN0 A;  1U78 A;  2JWT A;  5J1Y A;  1I50 J;  3GTQ J;  3BG3 A;  3ZQH A;  4BY1 J;  3TW7 A;  1XS9 A;  1WPK A;  5GP9 A;  1GT0 C;  2CUE A;  2DA2 A;  1AKH B;  2R7Z J;  5F27 A;  1AKH A;  2H1K A;  3HOY J;  5F04 A;  4DYC A;  1XG1 A;  5IYB J;  5E3O A;  1QVU A;  1WI3 A;  2Y31 A;  1ETX A;  3C2B A;  4J19 A;  1WH7 A;  2LR8 A;  4JX4 A;  4XIC A;  3G1L A;  1FTT A;  1Z77 A;  5C4X J;  2ME0 A;  5IP9 J;  4C3J J;  1OCP A;  1IDY A;  4I76 A;  1WGX A;  4JX5 A;  4HNV A;  4DZJ A;  1ZR2 A;  3GBG A;  3M3Y J;  1GDT A;  1VI0 A;  1Y1V J;  5E3L A;  1IRZ A;  2CQQ A;  2DA3 A;  1W0U A;  5HOD A;  2ECC A;  1IGN A;  3LOC A;  4D7N A;  1X58 A;  3A03 A;  2JA8 J;  3BT9 A;  2QF7 A;  5M5W J;  3SDG A;  4S0H B;  2RAE A;  1S7E A;  2GBY A;  4C3I J;  4CYC B;  1ORK A;  4EEF G;  4CYC A;  2TRT A;  1O4X A;  2PMZ N;  5FKO A;  2N8G A;  4BXX J;  3GTK J;  1JJ8 C;  2EZK A;  2M2E A;  2HXO A;  1TWH J;  4MLO A;  3OOU A;  3K7A J;  3S1M J;  2O8K A;  4M3G A;  1RES A;  2YU9 J;  1FTZ A;  2X48 A;  3GTL J;  2ECB A;  5GPA A;  3HDD A;  2AHQ A;  5M3F J;  5FKK A;  4C2M J;  5K7F A;  4XK4 A;  2E1O A;  3IV5 A;  2HXI A;  2VUM J;  5C3E J;  1JT6 A;  4XRS A;  4M3F A;  2EQR A;  3OSF A;  1MSF C;  4A93 J;  4X6A J;  1ZKG A;  2ZB9 A;  5FKN A;  2HOT A;  2JA5 J;  3LSP A;  5F1J A;  1OFC X;  2XB0 X;  3BQY A;  4UUT A;  1Y1W J;  1WH5 A;  4M3D A;  3ZQF A;  2DA5 A;  3S16 J;  1GUU A;  1JUS A;  1OJL A;  3GTM J;  1BJZ A;  3I4M J;  2YUS A;  3HM5 A;  5M5X J;  3SFI A;  2G0E A;  1W0T A;  1FJL A;  4Y52 J;  1MBK A;  2XPW A;  3LSJ A;  1H8A C;  4BKX A;  1MH4 A;  2OPT A;  2Y30 A;  2DA4 A;  2COB A;  4D7M A;  5DS9 A;  2AO9 A;  3B6A A;  3NAR A;  2K9S A;  2VKV A;  3RKQ A;  2EZH A;  4IEJ A;  1H88 C;  2DTZ A;  3PM1 A;  4A3J J;  2WAQ N;  1MBG A;  1TWA J;  5F08 A;  1RPW A;  2GLO A;  2NVY J;  1ETK A;  1JKO C;  2DMN A;  3BTL A;  2DMP A;  2MGQ A;  2Y2Z A;  4NDL A;  3JRI A;  4A3F J;  2EZL A;  2EZI A;  2JN6 A;  2E2J J;  2X6O A;  3HB9 A;  5J1R A;  3JRC A;  3H3V K;  4W97 A;  2KDZ A;  3JRG A;  4XID A;  1XC5 A;  2CUF A;  2M34 A;  3FK6 A;  1IC8 A;  3BTC A;  2HDD A;  1I3Q J;  5FKL A;  1QVT A;  2W48 A;  2XRL A;  5K7H A;  5JLX A;  2DJN A;  2LK2 A;  2DMT A;  2QCO A;  4A3B J;  3Q0W A;  1ZQ3 P;  2K9N A;  3JRB A;  4V2F A;  5C4J J;  2VKE A;  2ID3 A;  2M8G X;  3QQA A;  3S1Q J;  3O8G A;  1AU7 A;  3A01 A;  3BQZ A;  5M5Y J;  2R93 J;  1IDZ A;  5E3M A;  5EZG A;  4RBO A;  3TED A;  1HLV A;  1RKW A;  1NTC A;  3BG5 A;  3BR1 A;  2NVT J;  1ETO A;  2M9H A;  1JUP A;  2DMU A;  4D5F A;  1QRY A;  1TWG J;  3NAU A;  4A3G J;  2TCT A;  5EF6 A;  3JRH A;  3IH4 A;  4B1R A;  3ZOB A;  1CQT A;  1ETY A;  2R92 J;  1ITY A;  3S1R J;  4AC0 A;  2FD5 A;  3HOW J;  3BR2 A;  5DTD A;  1POG A;  3MN2 A;  1MSE C;  1OCT C;  3HOZ J;  1JTX A;  1UG2 A;  1SFO J;  1LE8 B;  2B63 J;  1LE8 A;  4X1E A;  1GV5 A;  3M4O J;  1GVD A;  1MBH A;  5FLM J;  3HGY A;  2FJ1 A;  3L1P A;  3BR5 A;  5IPA A;  1B72 B;  3IH3 A;  2R5Y B;  1HF0 A;  1B72 A;  1P7J A;  5EZH A;  2R5Y A;  1I6H J;  3GTO J;  2GM4 A;  1BL0 A;  4AYB N;  4IHY A;  1IJW C;  2LY9 A;  3CCY A;  3S2D J;  3HGG A;  5IYC J;  4DZP A;  4A3E J;  4QIW N;  5IOY A;  3DEW A;  3WHB A;  2E2H J;  2P81 A;  3QPS A;  3ZQI A;  1IUF A;  2EH3 A;  4M3E A;  4FCY A;  2E19 A;  4A3M J;  2LTP A;  1NK3 P;  3JRE A;  2LD5 A;  3GTJ J;  1FIP A;  5IYD J;  1R9T J;  1IV6 A;  1A5J A;  5J3L A;  2D5V A;  5EDN A;  5J1U A;  1LFB A;  2O9L A;  2NOG A;  1ZK8 A;  3F0C A;  4JP0 A;  1FIA A;  2L7F P;  1A6I A;  5IOZ A;  2L0K A;  4JYK A;  1MH3 A;  1MNM C;  1B8I B;  1LFU P;  1F43 A;  1EF4 A;  1D5Y A;  4M6V A;  1B8I A;  3SJM A;  5FJ8 J;  1BA5 A;  2XB5 A;  3HKZ N;  3RQI A;  1ZR4 A;  4B4C A;  3GTP J;  1AHD P;  5FKM A;  3ZQC A;  3W6V A;  5K7Z A;  1HDP A;  1T33 A;  3LSR A;  2R5Z B;  2XGC A;  3FIW A;  2R5Z A;  1APL C;  1JKQ C;  2XGE A;  1JKP C;  4FTH A;  4Y7N J;  4M3B A;  2LFB A;  1ZGW A;  2HOA A;  4A3I J;  1E3O C;  2VI6 A;  1PUF B;  1Q1V A;  1SAN A;  1PUF A;  2ELK A;  3G1M A;  3FK7 A;  3IH2 A;  2LLK A;  4A3K J;  4DW6 A;  1MBJ A;  2ID6 A;  1ETQ A;  2NVX J;  2Y9Y A;  3RZD J;  5IP6 A;  4BBR J;  5F0F A;  1VF9 A;  3B6C A;  2XPV A;  3CMY A;  3A01 B;  1X2M A;  4A3L J;  4DYQ A;  1MBE A;  2XPU A;  2IEK A;  5EGO B;  2CRG A;  3H0G J;  3TP3 A;  5EGO A;  3UKG A;  3GTG J;  1VFC A;  3TP0 A;  3S14 J;  4FE7 A;  3A02 A;  4JX6 A;  4W1U A;  2LVS A;  3S2H J;  1JJ6 C;  4A3C J;  1HOM A;  2JJ7 A;  1DU6 A;  4V2G A;  2Y9Z A;  1DU0 A;  2E2I J;  4L5E A;  3PO2 J;  2JMW A;  5F0C A;  2MSY A;  1YRN B;  2DA7 A;  1JGG A;  2KT0 A;  1YRN A;  3S17 J;  3ZQL A;  3OIO A;  5EEA A;  3FKI J;  3E7L A;  1QPI A;  3LNQ A;  5IP7 J;  2EBI A;  5EYR A;  1ETV A;  4LOC A;  2LP0 A;  2MG4 A;  2MW8 A;  3BG9 A;  4IHV A;  2HI3 A;  1ETW A;  2XSD C;  1UHS A;  2CJJ A;  1U9O A;  3FIS A;  5F0H A;  1UMQ A;  4QSH A;  1TWC J;  2X9D A;  4D5C A;  1NK2 P;  2DMQ A;  1U9N A;  1VND A;  4I6Z A;  4AUX A;  1P7I A;  2NS7 A;  3K2A A;  4G12 A;  3O8H A;  4MIM A;  1H89 C;  2LKX A;  2CQX A;  4QTR A;  5GPC A;  3VPR A;  4MO7 A;  2CU7 A;  2NS8 A;  2WB1 N;  2YS9 A;  2R0Q C;  1ENH A;  2DA1 A;  2JA6 J;  2K40 A;  2JA7 J;  2Y0S N;  1BW6 A;  2FX0 A;  4A69 C;  3HOX J;  2HYJ A;  4IHX A;  3BR3 A;  2OF7 A;  5EG0 B;  3HBL A;  3JRA A;  3RZO J;  2WV1 A;  5EG0 A;  3CQZ J;  4IHW A;  5FLV A;  1BW5 A;  3HOU J;  9ANT A;  4XRS G;  2M0C A;  4B3A A;  4UUS B;  3MVP A;  1HDD C;  4UUS A;  4A3D J;  3JR9 A;  2FQ4 A;  3BTI A;  3DCF A;  5E3N A;  2K9Q A;  4ABZ A;  3Q0U A;  2HQ5 A;  1HCR A;  1T56 A;  1RKT A;  3HOV J;  2ME6 A;  3OSG A;  3G1O A;  4MFD A;  4XRM A;  3MKL A;  4MFE A;  1K61 A;  1JTY A;  1U8B A;  1F36 A;  2O7O A;  5M3M J;  1TC3 C;  4FIS A;  4BBS J;  2DA6 A;  1FEX A;  2L7Z A;  1JKR C;  3BR6 A;  2H8R A;  4BY7 J;  1GV2 A;  4RDU A;  1X2N A;  5C44 J;  3BR0 A;  2NVQ J;  1JUM A;  1ZTR A;  4GFB A;  3BTJ A;  3QPL A;  4FE4 A;  3D1N I;  1K83 J;  2VPR A;  1RR7 A;  2I10 A;  2JK3 A;  2XGD A;  3CDL A;  1Z0X A;  2IAI A;  4C3H J;  3S15 J;  5JLW A;  3PO3 J;  2L9R A;  3LSG A;  1WCM J;  1IG7 A;  1TWF J;  2HOS A;  3Q3S A;  2L7M P;  3Q0V A;  5BNG A;  3HEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...