2WAQN

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2waqN00
3QPLA 2NVYJ 3ZQGA 3LNQA 1DU0A 3S1RJ 4A3LJ 3SFIA 3JRHA 3LSGA 2IEKA 2LK2A 1NK3P 5C4JJ 1TWFJ 3NAUA 2EZIA 5FKMA 5C3EJ 4M3EA 4W1UA 2JA5J 2WV1A 3Q0WA 2ME6A 4X1EA 1W0TA 2YUSA 2XGDA 3SDGA 4XK4A 2ECBA 4A3IJ 1JKOC 1H88C 3IV5A 3FK7A 1G2HA 5BNGA 2FD5A 4S0HB 2E2IJ 2Y2ZA 3ZQFA 3S15J 1ENHA 5IPAA 3HOYJ 1WH7A 2XPUA 1B8IB 3BG3A 2DA3A 5DTDA 1JTYA 2DA2A 4UUSB 1ORKA 4JX4A 1GDTA 3JRIA 3O8GA 3G1LA 5E3MA 1JUSA 4IHVA 2DMQA 1Z77A 5GP9A 1WI3A 3A03A 3BR2A 1IC8A 1IGNA 3M3YJ 1IDYA 5F04A 3GTJJ 2DA6A 2K9SA 1ITYA 4BY1J 4XRSG 4CYCA 4A3MJ 3MN2A 1MSFC 2QF7A 1QVUA 1Z0XA 4XIDA 2TCTA 3IH4A 3HOZJ 4IHXA 4D5FA 2K9QA 1A6IA 2Y9ZA 2K40A 2L7FP 5EG0B 5IOYA 1R9TJ 2KDZA 3CCYA 1WH5A 2EH3A 2CQQA 2LLKA 2MGQA 1VF9A 2MG4A 4XRMA 5E3OA 3BR6A 1I50J 2JK3A 2XSDC 1BW6A 2XGEA 2LY9A 2OF7A 2YU9J 1S7EA 1MSEC 4RDUA 4FCYA 1A5JA 1U9NA 1JT6A 3PO2J 3HDDA 4GFBA 3B6CA 1WCMJ 2M8GX 3HGYA 5GPAA 2R5YA 4BBSJ 3S2DJ 3VPRA 2JA8J 5IYDJ 5FKKA 1FJLA 2JWTA 1D5YA 2ZB9A 1UG2A 1U8BA 1VI0A 1HF0A 2RAEA 2GBYA 4Y7NJ 4I6ZA 3GTLJ 2QCOA 1ETVA 5F08A 3IH3A 1GV2A 2NVTJ 4A3EJ 4A3GJ 5HODA 3GTOJ 3E7LA 1B72B 5EEAA 3L1PA 4DZPA 1X58A 1OFCX 2Y9YA 4B4CA 3ZQCA 4DYQA 1GT0C 2ECCA 2LP0A 1X2NA 1I6HJ 5M5YJ 3JRFA 3OSGA 2DMTA 3S1QJ 3PM1A 2LR8A 3ZQLA 5IP9J 2EZLA 2WB1N 3BQZA 1GVDA 3GBGA 1WGXA 2E2HJ 4JX6A 3BTCA 1HOMA 1FEXA 2X9DA 2GLOA 2XGCA 1TWCJ 4L5EA 1TC3C 1GUUA 1H89C 2R92J 5FKLA 4FE7A 3S1NJ 3HOUJ 1ETQA 1MH4A 1HLVA 2LKXA 3GTQJ 1TWGJ 1FIPA 5J3LA 2VI6A 4CYCB 3GTPJ 1XC5A 2H1KA 3TP0A 3G1OA 5F0FA 3CMYA 2I10A 4AC0A 3DCFA 1YRNA 3QQAA 2GM4A 2CQXA 1JKQC 1AU7A 1ZQ3P 1B72A 2LD5A 1ETXA 2DJNA 2HXIA 3TP3A 5IP6A 3F0CA 2O9LA 4G12A 1BA5A 5IYBJ 3S1MJ 4FISA 4A93J 1BJZA 2XPWA 4MLOA 1AKHB 1QPIA 2JJ7A 5EF6A 2DMUA 2MSYA 3I4MJ 2EQRA 4IHYA 2R5YB 3BR1A 1JUPA 5C44J 1IJWC 1MBJA 2EBIA 2X48A 3B6AA 4V2GA 1P7IA 2Y0SN 5IYCJ 4A3FJ 3HGGA 2D5VA 3HM5A 3LSPA 2CRGA 2VKEA 1RPWA 4AYBN 1MBGA 4LOCA 1PUFB 3M4OJ 1IDZA 3CQZJ 1O4XA 2HDDA 3WHCA 3JRAA 1BL0A 3QPSA 4UUTA 3JRCA 3HEFA 1JKPC 4M3BA 2O8KA 3H3VK 2ID3A 5C4XJ 2L9RA 1JKRC 3O8HA 1MNMC 3GTGJ 2M34A 4D5CA 2AHQA 3WHBA 2HXOA 1BW5A 3PO3J 1RESA 2DTZA 2YS9A 3H0GJ 4ABZA 5E3NA 1AKHA 1Q1VA 3TW6A 1OJLA 2JN6A 3HBLA 4BY7J 5K7ZA 1TWAJ 1LFBA 3TEDA 4QIWN 4NDLA 3FKIJ 2IAIA 4MFDA 3JREA 1TWHJ 2E2JJ 2H8RA 4MIMA 5FLMJ 5EZGA 1PUFA 3JRBA 1NTCA 1YRNB 5FLVA 4FTHA 2R5ZA 4RBOA 1LFUP 3BR0A 3BQYA 3BR5A 4A3JJ 5M3FJ 1IV6A 3BTIA 1UMQA 3MVPA 3Q0UA 5F0CA 5K7FA 4EEFG 2W48A 3I4NJ 5F1JA 2ME0A 4C2MJ 2HI3A 2VKVA 4A3DJ 4W97A 3BTJA 4Y52J 4QSHA 5EDNA 2L0KA 4I76A 3RQIA 1LE8B 1MBFA 3BT9A 3D1NI 2VUMJ 4M3DA 2K9NA 2NOGA 2DA5A 5J1UA 5J1RA 1K83J 1ZR4A 1IUFA 5F27A 1ZTRA 3GTKJ 2LTPA 2M9HA 2CUEA 2OPTA 1IG7A 1FTZA 2O7OA 3Q3SA 4FE4A 4D7NA 3BR3A 3JR9A 2NVXJ 3TW7A 2XRLA 2AO9A 3S14J 3FK6A 3HOXJ 2CU7A 4HNVA 5DS9A 3FISA 2IBDA 3RKQA 5E3LA 5M5WJ 4M3FA 2HQ5A 2R93J 1JGGA 2HOTA 5EZHA 3S2HJ 2L7ZA 5FJ8J 3JRGA 2MW8A 1JJ6C 1JT0A 2DA7A 1SANA 1CQTA 4DZJA 5M3MJ 2HYJA 1QRYA 3OIOA 3C2BA 2X6OA 2CJJA 1POGA 2NS7A 1AHDP 1OCTC 4AUXA 4J19A 3LSJA 4X6AJ 1LE8A 3SJMA 1DU6A 2FX0A 1T56A 1VNDA 2VPRA 1F36A 4MFEA 3RZOJ 2PMZN 3K2AA 2COBA 4DW6A 2FJ1A 3A01B 1HCRA 2M2EA 5IP7J 1JTXA 4XICA 3ZQIA 3OSFA 4MO7A 1W0UA 5FKOA 2M0CA 1ETOA 4IEJA 4DYCA 2N8GA 1U78A 5J1YA 1RKTA 3MKLA 2NS8A 1WPKA 2E1OA 2R5ZB 3HB9A 5EGOA 2Y30A 5F0HA 2FQ4A 3K7AJ 1U9OA 4V2FA 2HOSA 3BTLA 3RZDJ 1ZGWA 4M3GA 1ZR2A 1E3OC 2JA6J 2R7ZJ 2LFBA 4A69C 3BG9A 2P81A 1T33A 2KT0A 1RKWA 1K61A 1ETKA 2Y31A 4BBRJ 3BG5A 5IOZA 1ZKGA 4A3KJ 1HDDC 3A01A 3UKGA 2E19A 5GPCA 5M5XJ 2CUFA 3OOUA 2G0EA 2B63J 4C3JJ 4JYKA 2XPVA 1ZK8A 1ETYA 3W6VA 4C3HJ 3HOVJ 1XS9A 3HOWJ 4M6VA 2WAQN 4B1RA 3ZOBA 1B8IA 4UUSA 3A02A 5K7HA 2EZHA 4DYRA 1MBKA 5JLXA 1SFOJ 2JA7J 1FIAA 2EZKA 4D7MA 1X2MA 2DN0A 5EYRA 2XB0X 4A3CJ 4XRSA 1IRZA 3JRDA 2DMNA 2DA1A 1JUMA 1Y1VJ 1P7JA 4C3IJ 2LVSA 3Q0VA 2R0QC 2DMPA 1FTTA 3FIWA 5FKNA 4IHWA 2ID6A 4B3AA 1MH3A 4QTRA 4JP0A 3G1MA 1Y1WJ 4BKXA 1MBEA 9ANTA 3LOCA 2ELKA 1APLC 2NVQJ 1EF4A 5EG0A 3CDLA 1F43A 3S16J 4JX5A 3DEWA 2JMWA 3HKZN 3ZQHA 2TRTA 1VFCA 2XB5A 1QVTA 5JLWA 1RETA 3NARA 1UHSA 3S17J 4A3BJ 2HOAA 4BXXJ 1ETWA 1H8AC 2L7MP 1XG1A 3LSRA 1GV5A 1JJ8C 1NK2P 1OCPA 1MBHA 2DA4A 5EGOB 1HDPA 3GTMJ 1RR7A 1I3QJ 3IH2A
chains in the Genus database with same CATH superfamily
3HRSA 4LG3A 3QPLA 2VXDA 3DLLF 1Z3YA 3ECHA 2P0WA 5JR3A 4N0BA 1TQIA 5FGMA 2LK2A 4RB1A 2I8DA 1NK3P 1XCVA 4ZTJA 3UR3C 5HVQC 4G6DA 1USSA 3S8PA 4QPQA 3JW4A 2WV1A 2DOEA 4ENNA 5B5EC 5E1ZB 1G8XA 1TW2A 3IKVA 4ESJA 3J7AY 3DPUA 5FROA 3GVAA 3HOTA 2YUSA 4MTEA 2ZMEA 4RM3A 2OQRA 2FA5A 4A6EA 1IXRC 5B1BH 1F4KA 5D5WB 3S15J 3I5UA 4MEYF 3KZZA 1YW8A 1RI7A 2DA3A 3ZN0A 4GRIA 2FF4A 2A68F 2BVMA 3O8GA 1FP1D 1JUSA 4HLXA 3GWZA 4I01A 1Z77A 2A05A 5GP9A 1ZYRF 3GYHX 4ENKA 4G9YA 1F5TA 3M3YJ 3D0SA 3CDIA 2DA6A 1XGNA 2UXXA 2OCEA 3I55I 1ITYA 4GYGA 2PLYA 4KT5C 4CYCA 2EPFA 4A3MJ 5ILUA 3JSOA 2QF7A 2MH2A 2MFZA 3I3LA 3JTGA 1QVUA 1LUJB 2TCTA 4IHXA 2XKOA 4H0EA 1FBUA 2LY1A 2V79A 2KL4A 1PDNC 2L7FP 2OC6A 1R9TJ 1L0OC 2X1CA 3NWTA 1WH5A 3LAPA 4M73A 3C2GA 1ZHFA 3VYTB 4CUGA 1YO5C 3KP4A 4Q48A 3TQNA 3DV8A 4B44A 4XRMA 1L3LA 2EK5A 1SD4A 3KYCB 2A5WA 1MNEA 5KHDA 5LGUA 1SFXA 2XC7A 3GFIA 4DBRA 2LY9A 2XGEA 4LJZF 1TLHB 3E5UA 4HLYA 3ECOA 1W7PB 3DU5A 4RDUA 3RI4A 1A5JA 1JT6A 2VKDA 3K1MA 2YR2A 4BJ5C 4PUSA 4IRGA 5H2FC 4LLNA 3HXLA 3OWTA 3ZMTA 5FKKA 1OYYA 1FJLA 4XQFA 1O3RA 3QOEA 4A5MA 2PJRA 3FMQA 1U8BA 2GBYA 3DF8A 5E8IA 4I6ZA 3COAC 3GTLJ 2R4GA 2QCOA 2OQGA 2O61A 5F08A 3ZCOA 3V8KA 5JHUA 4KUMA 3SFZA 3GTOJ 3BWGA 1R1UA 2DW4A 3ONQA 4YFKF 2Z3YA 3E7LA 5JFRA 3E6BA 2CUZA 2M1BA 1B72B 4DZPA 2MABA 2Y9YA 4B4CA 2LC2A 2E7WA 1WRJA 1MMAA 2LP0A 1T8IA 1X2NA 1S8NA 4HRIA 5KAIC 4O3MA 2VC0A 1R5GA 1YE9A 1JHFA 2LBFA 3ABKH 2EZLA 3OYMA 2GIZA 3ZQLA 4NBQA 1XSDA 2ISZA 1X3UA 2RVCA 2UXNA 2JUGA 5HS7A 3BTCA 2HGCA 4NUBA 4EVIA 2QQBA 2E1CA 4HG2A 1TWCJ 4L5EA 3T0YA 3VYUB 4L9JA 1X4OA 4LB6B 3RKWA 1ETQA 2A3SA 1UFMA 1HLVA 2CSOA 3HSFA 1ZRFA 1G3YA 2VI6A 2V1NA 3JSPA 5J8FA 2V9VA 1BR4A 2EILH 2H1KA 1OCZH 2WY7Q 3TP0A 2EINH 3G1OA 3HG9A 1DQUA 3IP4B 4M74A 2I10A 4KDPA 1YRNA 4LG0B 3QQAA 3HRTA 1FYLA 1BI2A 3CO7C 4KNYA 4M9ZA 2QA4I 1RNLA 2YX7A 3GO5A 1AU7A 4GDFA 1XMAA 2FXAA 1JHHA 2DJNA 2HXIA 5AONA 3TP3A 4A0XA 3VYRB 3IC7A 3CCRI 3EUHA 3LSKA 4G12A 2HKOA 1BA5A 3H5AA 5J4YA 5D5XB 3U2RA 3FKJA 3S1MJ 4GCVA 1A36A 1LB2A 1UCRA 4KN7X 2DFFA 4BHBA 1TL8A 2VIXA 1AKHB 2FMYA 2JJ7A 4HF2A 3KX2A 1J75A 5DCMA 4HNUA 2EQRA 4IHYA 4A6DA 1C0WA 1JUPA 2CV2A 2P7VB 4PZJA 4V2GA 1P7IA 2FU4A 2IJLA 3S3OA 2D5VA 3HM5A 3IHUA 2CRGA 4U7BA 3VODA 4PCQA 3PNYA 4KT6A 2R7XA 1MBGA 2DOAA 2CMPA 1IDZA 3RJPA 1W36C 4EGZA 2V7FA 2XDVA 2W57A 5L3DA 3JRAA 3TKYA 4M3BA 3HHGA 5DUKA 3RKYA 2HEOA 2O8KA 2ICWG 3W3CA 3H3VK 4UXNA 4HDVA 4MGRA 2R7DA 5DM7F 4ANJA 2Y75A 5C4XJ 2DTRA 3S93A 4O6JA 1GHCA 1JKRC 1DGRM 2KHMA 5B3SH 1MNMC 3CP8A 2HKXA 4ZH4F 3GTGJ 1T38A 2DJIA 1HC8A 3GLLA 1UHMA 2CW8A 5E3NA 3LSHA 4M9SA 4Y4RA 2K7LA 2IA2A 5GAHJ 4P9UA 4BY7J 5K7ZA 4FETA 3QPTA 4OAYA 2E1NA 2E1MC 1IRFA 1MD0A 4NDLA 4BQQA 1XMXA 4LMYA 2P4WA 3SYTA 1XCBA 4CZZA 4HNTA 4IO9F 2H8RA 4NHJA 1M1EB 2KRFA 1QZYA 4ZZLA 2EV0A 3QOPA 1PUFA 1J09A 3KLNA 5E18F 3P9KA 5FLVA 1A6QA 1V54H 3BR5A 3ELKA 1IV6A 3HRMA 3Q0UA 4EEFG 3OYDA 3I59B 2W24A 4A3DJ 3D5SC 4W97A 1VQKI 3BTJA 4Y52J 2MD0A 2CQNA 1WJ5A 2L0KA 2J5OA 4IJAA 4QSHA 2F5DA 3BT9A 1BC7C 3M1CA 2UZKA 1DDNA 2K9NA 3L7WA 5DDGA 1B6AA 1ZTRA 2KKOA 2Z33A 3GTKJ 1BJAA 2LTPA 2DXIA 4BH9A 1BN5A 2OPTA 1FTZA 2O7OA 5GAGJ 4U0YA 2M45A 2L4MA 4GGGA 3ROUA 4A12A 4D7NA 4D9JA 1D1CA 2QLZA 5B66C 4XL9A 1LVAA 1J9IA 2ZNZA 1X1AA 3Q9SA 4I7HA 3TW7A 5LGTA 4HA8A 3S14J 2R7WA 4CA0A 3B02A 2CQ7A 4M6YA 3CJRB 1FP2A 1V55H 5E3LA 5M5WJ 4P9FA 1B9NA 4WWCA 1JGGA 3S2HJ 5EZHA 5LHIA 2CWEA 3LQRA 3N97A 3WGIA 1JT0A 4U7DA 3IL2A 4KISA 3WGGA 1SANA 4PFPA 4RB3C 1CQTA 2EIKH 2XF7A 3H9GA 3L00A 4B8XA 3REOA 1Y6IA 2W00A 1OYWA 2O03A 1S7AA 5CQEA 1SD7A 4AUXA 4X6AJ 1DU6A 1O7LA 1R58A 1T56A 1VNDA 1F36A 2Y48A 5L3FA 4OMYA 4LK1F 3GFMA 4CHUA 4IRHA 1R23A 1T08B 5TRDA 3DBHB 1KQ0A 2FOKA 3OYNA 2M2EA 4IRIA 4G7OF 3OYJA 4PJNA 2RKHA 3L2VA 5FKOA 2M0CA 1ETOA 4IEJA 1VQ6I 1TT5B 2ZCWA 1V5EA 2QQ8A 3W6JB 4NB5A 2N8GA 2LY2A 2WAFA 4DQ2A 5IT3A 2VC1A 2CW7A 3H92A 2M8EA 4ETSA 2EA4A 2NS8A 3CCSI 2Z2SB 4WX9A 1BOBA 3FMRA 4Y15A 5F1RA 5F0HA 1U9OA 1KU2A 2VQHA 3KP7A 2IS4A 4XLNF 2RGVA 1K4TA 4J00A 4HSRA 3H9JA 1S6LA 4IOAF 1UZCA 5D8LB 1AOYA 1J0RA 2R7ZJ 3RYRA 2K27A 3BG9A 5DYMA 1T33A 4YRVA 1Z1DA 1VQ7I 1KA8A 4PFOA 4XLPF 3F8BA 3ERED 4BBRJ 3BG5A 1ZREA 1HDDC 1IUYA 4A3KJ 4I0AA 3A01A 2MLGA 3HSRA 3UKGA 2E19A 5D6EA 5GPCA 5M5XJ 3OOUA 4F7ZA 3TGNA 2V6EA 2B63J 4ZYHA 2H6CA 1ZK8A 1LDJA 4IQJA 4C3HJ 2CQKA 1U5TC 2OUMA 3HOVJ 3MKWB 2WAQN 2VBYA 1LJ9A 2VBXA 3VDXA 4HEA2 3VB2A 3A02A 2A07F 3W2VA 1IRGA 4XSXF 3VEPA 3HPHA 3MMYB 3V7CA 1R49A 1MMDA 1VTNC 2ZJQF 2K9LA 3FM5A 1FOXA 3C18A 5BPDA 1Z7LA 2PMUA 1FIAA 2EZKA 3U21A 5ILSA 3O2PE 1VQ5I 4KYWA 1I27A 4Z2YA 1IN5A 1Y8QB 1HSJA 4I98B 3RQ4A 3CC7I 3HC7A 2LDUA 3TO9A 2BBYA 1ZG1A 2CFXA 1P4WA 3SHFA 4KN4X 3IRQA 4BQNA 3FX3A 1P6RA 4E7IA 3PFIA 1Y1WJ 1P4AA 2KMUA 3RPUD 4P5OA 1OCRH 2Z16A 1MBEA 9ANTA 1BOAA 2ELKA 2XHKA 3CUOA 5IY5H 3ESWB 2IGMA 3M8EA 1ZG3A 4F3QA 1J2XA 1RETA 2B0LA 3K9TA 2L9VA 2JPCA 2DT5A 3S17J 4A3BJ 4BXXJ 5FFZA 3OY9A 3WTTC 3FXMA 1B9MA 2D2WA 4ESFA 3LSRA 4I09A 1OCPA 1MBHA 1W7PA 5BOXA 1U8RA 1SVMA 1E3PA 4BHCA 1H0MA 1P2FA 2E34A 3FBIB 3F8NA 3OS1A 3D5RC 3ZQGA 2WTEA 4AU7A 1F9NA 1MZBA 1FLIA 3JRHA 5AIQA 2LYCA 3DTEA 4Y17A 3LSGA 3U1DA 1QQIA 5BPIA 3CUQC 2XAFA 4RGXA 3BJOA 1TWFJ 3NAUA 4O5VA 4II2A 2NNNA 5C3EJ 2QSFX 4M3EA 3FDYA 4W1UA 1Q1HA 4EM2A 1IF1A 4L0YB 4CDGA 4WXHA 4PSXA 4IXAA 1XSVA 3QODA 1FOWA 1AA7A 4I99C 2XGDA 1QO0D 4A3IJ 3K10A 4KJZA 1SD5A 3TBIA 5BNGA 2FD5A 2Y2ZA 3ZQFA 1ENHA 4AIKA 2ZXJA 1E2XA 2Q8KA 2E5ZA 1B8IB 3BG3A 2JVHA 4IOCF 1FZPB 1OMIA 3DP7A 5ERIA 1ORKA 5CYVA 2QQ9A 4JX4A 3SEQA 3JRIA 2M4KA 1QHGA 2IVMA 3KPHA 3MQ0A 3OYGA 4IHVA 1LDKB 1EKEA 4CCNA 4XLAA 4CCLA 1XX5A 4NC7A 2E5NA 3K4BA 2XAQA 1IGNA 4AM3A 2E71A 3CJQB 2WV0A 3I58A 4XRSG 5L3BA 1VQPI 4BY1J 2DI3A 2HZDA 3V8LA 2DK5A 2M3AA 1Z0XA 1XSXA 4LG0A 4XIDA 3IH4A 3HOZJ 2BGCA 3TO7A 4GO1A 1MDMA 4HZFA 1TZLA 6PAXA 2W25A 5F64A 2K9QA 2Y9ZA 2P6TA 3V8JA 1Y56A 2KDZA 4II3A 3V7SA 3GFJA 3FXQA 3HSEA 3M07A 4XLCA 2CQQA 1VQNI 1TW3A 2MGQA 1XPXA 1YJNI 1B1BA 3GF2A 3N05A 2JK3A 2XSDC 4Q47A 1ZRDA 4EJUA 2OF7A 4BUPA 3CLOA 3F6VA 2YU9J 2BW3A 2AQFA 4FCYA 2W1OA 2FNPA 3M9AA 3HGYA 4CSWA 2DU9A 2Y0SA 4GYIA 3S2DJ 3TL4X 4BBSJ 5IYDJ 1F1ZA 4IVNA 2F4OB 1UJ8A 2BY0A 2ZB9A 4AYBA 2HVRA 2X1DA 2HR3A 3GMEA 4Y7NJ 2BZTA 2VT2A 3FHZA 2CFOA 2DQRA 1GV2A 3RCOA 3OYHA 2XKPA 1QZZA 4IQ4A 1OFCX 4ZYEA 4X0GA 2QBYA 2NAZA 3BPXA 2X6YA 1WZ2A 2C6YA 3KZYA 1H9GA 4WXCA 4XLEA 4BXFA 3ZQCA 2O8XA 2ECCA 2CYYA 3OSGA 5DM6F 1BI3A 2PFBA 3BZCA 3L2QA 5EEGA 3IRRA 3AG3H 5IP9J 1X4PA 2WB1N 4ON0A 3BQZA 1GVDA 3G6EI 1WGXA 3PQJA 4G6TB 4B47A 3OS0A 5JHFA 1FEXA 4PJLA 2GLOA 2YSRA 2XGCA 3FZVA 1FBQA 1GUUA 1IXCA 1R6RA 1H89C 2AQEA 4LIUA 1XB4A 4BS9A 2VASA 1S72I 3S1NJ 3HOUJ 3I9V2 1SFEA 2BY3A 3E5QA 3AG4H 2Q1ZB 5FO5A 3RKXA 1TWGJ 1W1WE 1FIPA 1TP4A 3SDBA 3GTQJ 2E1MB 5L3EA 2F5EA 3GTPJ 1MIJA 2OZ6A 1XC5A 3KYDB 1Z7UA 3W6KB 4XNFA 2DO7A 4UHTA 1WI9A 5D4RA 1YW9A 1BBYA 4J01A 3I53A 2P5LC 1ZQ3P 2OA4A 2YX4A 2CW0F 4MQVA 2XAGA 2D1VA 3WTUC 2LREA 4UV8A 4LGWA 1YHQI 2A5YB 3OYFA 3PUBA 4BQAA 4FISA 4A93J 1X19A 3DLAA 3FM3A 2CV0A 1P4XA 4KMFA 2XPWA 2XIGA 4UVAA 3RYPA 5EF6A 5JVGF 2MSYA 4U0WA 1ERDA 2UUZA 5GTHC 3H5RA 3ZXSA 2R5YB 1SAXA 2DPUA 1MBJA 1IN6A 2EB7A 2WC2A 3FWEA 4F93B 2K5CA 2XRNA 1CGPA 4A3FJ 2B9SA 1IW7F 3EUAA 3L2UA 1G3WA 1R00A 3LSPA 1QA6A 1SEUA 3A0BC 4E70A 1FC3A 2R7VA 4XMYA 1O4XA 1FT9A 1P92A 2QKLB 3WHCA 5LLQA 1NG6A 2H09A 3FMSA 4YIFA 3ZMUA 4HF1A 1LVKA 1JKPC 4IL6C 1KZHA 3PUFA 4WXDA 2RDPA 2ID3A 2L02A 3WU2C 3P5JA 4JBAA 4E7LA 1ZRCA 2L9RA 4P1WA 3PQKA 5J40A 1UHWA 4PJMA 5EJCA 2KP6A 1X1DA 2YS9A 1Y0NA 4ABZA 4YIRX 3C3WA 2IT0A 2FUG2 3W2AA 4RGSA 1W4MA 3CMAI 2LNBA 3Q5FA 3CLQA 2JN6A 1LFBA 3KP5A 2ESHA 3DFGA 4QIWN 4XSZF 4MFDA 4KIGA 2RNGA 2WBMA 2E2JJ 3EETA 5FLMJ 3P9IA 1YTYA 5GADJ 2KDOA 5EZGA 2PQ8A 4RBOA 2QM3A 4A3JJ 3K2ZA 3BTIA 1Z67A 2KJCA 2ZJPF 5F0CA 1ZN2A 4KIFA 1V5GA 4C2MJ 1R4NB 1XDUA 2VKVA 4QWQA 2QKMB 5CVUA 2GQQA 1LE8B 1J7KA 3CF2A 5EDNA 1T95A 2FMLA 1ZLJA 1MBFA 2VBWA 2MH9A 2CV1A 3GX4X 3MCZA 2BE5F 3E97A 1IN7A 2CUJA 5F27A 3WG7H 2M9HA 2Q2EB 1HSTA 2CUEA 3B73A 1EH6A 1IN4A 5ICFA 4BE0A 1WJFA 1Z21A 3WTXC 2M30A 1RIOH 1WQ2A 4FE4A 2CH0A 3CESA 2V26A 5DV5A 1ON2A 4R1HA 3DQVC 5HLIA 2XRLA 1U5TB 2IGOA 3FK6A 2CU7A 5DS9A 1D0YA 3FISA 2HU9A 2IBDA 5CKTA 5BS6A 3RKQA 4M3FA 2HQ5A 4EATA 3M8JA 2F6CA 2HOTA 3CTAA 2ZSHB 1JJ6C 2EA2A 3K4LA 1XGSA 4Y33A 2FBKA 4KITB 5LRSA 3MZHA 1T2KA 5M3MJ 4ZTFA 4XORA 3VSLA 5B1AH 1TBXA 1ZGJA 5BQTA 4HV5A 2R7RA 4RLFA 4CCOA 1A31A 2KFDA 4OIOF 2CJJA 3VFZA 2NS7A 2DDBA 1WJDA 2ZXHA 4PK4A 1S29A 2FX0A 2VPRA 3SJMA 4MFEA 5L3GA 5AIPA 4FX4A 3RZOJ 3R6SA 2PMZN 3HOSA 2COBA 2ZBKA 3C2HA 5D5VB 1DP3A 4CO8A 3R60A 2QZ8A 4R8HA 3HKZA 3CO6C 2ZO4A 4XICA 2HTSA 2VL8A 4XN3A 2BY2A 4NQWA 3ERMA 1Z91A 2ESNA 1U78A 4M72A 1HKSA 3SQNA 3CCUI 1UAAA 3FXJA 5E17F 1XGMA 1J59A 1PP8F 2R5ZB 5CQGA 4XM3A 1MGTA 2E36A 1TTYA 3ZMDA 1E0EA 3FXKA 4PJ0C 3S32A 1GLNA 3GLXA 2OBPA 4M3GA 1HBXG 1PUEE 5HLHA 1ZR2A 2JA6J 2KLOA 1QU3A 2DCEA 1XMKA 2KIFA 2WY8Q 2HZTA 1RKWA 3JAMZ 2UV1A 1ETKA 4F91B 1W36D 3FXRA 5IOZA 3CUQB 2W4SA 4RGRA 4YELA 5E20A 2W84A 1WSUA 2G0EA 4C3JJ 3DPLC 3G2BA 3JAMK 2JA2A 3KIOA 3C7JA 1SVOA 3HOWJ 3BROA 4BJTA 4B1RA 4CCKA 2GOMA 1B8IA 2G9WA 1SVLA 2EZHA 4DYRA 2JQ7A 2P7CB 4A0YA 2JRTA 5JLXA 3TO6A 4L9NA 4NC8A 1X2MA 2JRMA 2XB0X 3CCQI 4A3CJ 1N25A 4XRSA 4KICA 3SXYA 4ZYGA 2AXTC 1ZLKA 2X51A 3BCAA 1QBJA 2FOWA 2DMNA 2DA1A 5JI6A 2EJRA 1Y1VJ 1SD6A 4AVPA 4C3IJ 3AKZA 2H1LA 3Q0VA 2R0QC 4E7HA 1FTTA 2W82A 4B43A 3L2CA 1YOVB 3G1MA 2STWA 2GA2A 2NVQJ 1YX3A 3WTVC 3CDLA 1PP7U 3S16J 2KIQA 4AD9A 2LKSA 4PGGA 2VJ5A 1T0FC 4XLHA 4E7ZA 1X1BA 2XSJC 1V4RA 3F9KA 1RC9A 1FSEA 3CC2I 4HQEA 3GZ5A 1T6SA 4ITVA 3E1SA 4TV7A 1ETWA 5J8CA 1SFUA 1H8AC 3LWFA 4BE1A 2R7SA 1ACIA 1XG1A 3OYAA 1GV5A 4OU0A 3CCLI 1JJ8C 1OR7A 4ASNA 3BJAA 4FQGA 4LIVA 2DA4A 3R61A 5EGOB 5J6XA 3EPZA 2F48A 1RR7A 5E1WA 3IH2A 2XF6A 4S04A 5CVJA 1K4SA 4ZDLA 4A3LJ 2BHYA 1DU0A 3S1RJ 3SFIA 2ZXWH 1R7JA 1EH7A 3LL7A 5BMZA 3AG1H 4ESBA 3EUKL 3L2RA 4DIQA 3R0JA 4KIBA 1SAUA 3IUOA 3T8TA 3CD6I 1O7FA 5H20A 4CCMA 2JA5J 2FBIA 2JPBA 3Q0WA 2ME6A 4X1EA 4P96A 3F8MA 3CC4I 2ELJA 2IGNA 3QU3A 4LK0F 4XK4A 3RSNA 3SDGA 2QQAA 2HDCA 1JKOC 1H88C 1FPQA 3V4GA 1Z9CA 4EV0A 3G73A 3IV5A 3FK7A 3KE2A 3QAHA 1G2HA 1BI1A 4BU2A 2V1XA 5TJJA 4D0PA 1WH7A 4G8XA 5DTDA 4B48A 1JTYA 2DA2A 3PL8A 4UUSB 5LD2C 2JSPA 1I6XA 1GDTA 4U87A 1NH3A 3ASNH 3G1LA 1STZA 1AWCA 4I0BA 3GFLA 4JOMA 4PGHA 1U6GA 2JSCA 3MFKA 4RB2C 1ZAOA 1WI3A 3BR2A 2ETHA 2HFHA 3O6BB 1SFKA 1IDYA 3DBLB 2HPIA 2XV4S 4UY8I 2LF7A 2BEOA 1KU7A 2PJRB 4MNUA 3ZN1A 1MSFC 3SZPA 4LITA 2FBHA 4EM1A 4L9TA 4XRFA 4OINF 5CVIA 2PJPA 2HDWA 1IO2A 1KYWA 2OAZA 2DYRH 4C30A 2L54A 1WJAA 5H6QA 2WA0A 1RR8C 2K40A 3CJTB 5D8KB 1EV7A 3KCCA 5IOYA 2BV6A 2EV6A 3PNVA 4YIIA 1KU9A 3H0DA 3L09A 5DUIA 2ISYA 4U88A 3W2WA 2DLLA 1I50J 3K1PA 1A04A 4S05A 1I1SA 3KETA 5J4VA 2P8TA 1BW6A 2LBFB 2X4HA 3X2QH 3OYCA 3TDUC 1BM9A 5CVRA 2VQLA 5LRRA 4UB8C 3PO2J 3LAJA 3B6CA 1S3JA 2R5YA 2XAHA 5GPAA 4FASD 4BYYA 4DJAA 4PJJA 4CCJA 2KPMA 2OJED 1D5YA 1UG2A 1ON1A 1HF0A 2PX9A 2BOLA 2XUBA 2ZXIA 1T98A 3NQOA 5LBQA 3MKYB 1ETVA 2D45A 4BNCA 2GWRA 3U9GA 2NVTJ 2ZNYA 1YIOA 3LFKA 4A3GJ 5HODA 2HQNA 3ULQB 5EEAA 4XOPA 3L1PA 3HUGB 2XASA 2CO5A 2IP2A 4B09A 2D1HA 3PJRA 4DYQA 1GT0C 1A35A 1I6HJ 5GAEJ 1MJ9A 5M5YJ 4LFUA 3DPTA 2MD5A 3PM1A 2LR8A 3HTSB 3ABTA 2DFEA 2H6BA 2DAOA 5FD5A 2EWNA 3J81Z 3GBGA 2I5UA 3AAFA 4JX6A 4WF2A 2X9DA 1X1CA 2RQQA 5DCMB 5HNFA 4EJTA 4DOZA 2R7UA 5LGNA 1B59A 2PBIA 4IX7A 2V4JC 1I3AA 4XOTA 3CMMA 3J81K 3H3ZA 3I54A 3HIFA 4KA4A 5J3LA 2RREA 3FXLA 3IKTA 3LSTA 4C2UA 2JVGA 4XBFA 2KZVA 1W5TA 3ZMVA 5HLTA 3VOEA 2WWYA 5F0FA 3ABUA 4AC0A 1O3TA 2EFWA 3UNGC 2GM4A 1U2WA 5ICGA 3BCBA 4BXUA 4XKBA 2P6SA 4XKVA 1B72A 2OD5A 2GZWA 4AVZA 5IP6A 3F0CA 1GXQA 2FQ3A 2O9LA 1U0JA 2CGPA 3IAS2 4EQQA 3CP2A 4AIJA 5CJ9A 3MAJA 5D6FA 1BJZA 2KRHA 4MLOA 5GTIC 2Q2EA 2DK8A 3K1NA 3OYBA 3ZP5A 3RTRA 1CF7B 1YYVA 4BDYA 4RAGA 3I4MJ 3FXOA 3BR1A 3WU1B 5CVVA 2EBIA 2X48A 4ZC3A 2P5VA 4M9XA 2VKEA 4HSTA 1RPWA 2PN6A 2DFIA 1PUFB 5DEQA 4OIRF 1IRXA 1UG0A 2ZMEC 2HDDA 4HF0A 2KIMA 3DXJF 3JRCA 1TNTA 3T8RA 3SZGA 2HYGD 3RPUA 2W85A 1RUOA 4EJWA 1YJ9I 2X6WA 4LD5A 3DBRB 1LFPA 2FNAA 2DODA 5F6FA 5FRMA 3MKZA 5K5RA 3QWLA 2VPLA 1HKQA 2PG4A 2M34A 4D5CA 1BW5A 3WHBA 3EDPA 2ZJ2A 3CDHA 3NRVA 2DTZA 4E7KA 3PO3J 1PJRA 2IS6A 4IZZA 1AKHA 1MMGA 1QNTA 1R5ID 1UELB 3TW6A 4HDUA 3GZNB 3F72A 1TWAJ 3TEDA 4LLLA 3E3VA 3HZJA 2IAIA 4PDKA 3JREA 1S5LC 4FHTA 2ACJA 3BZ6A 3OS2A 1MMNA 1ODDA 3KYLA 1OCOH 2GOXB 2V9PA 3A1YA 5D4SA 3F8FA 5K1YA 3JRBA 4DBQA 3ZMSA 2CS3A 2OV7A 4FTHA 2KIUA 2R5ZA 1D0ZA 1LFUP 3BR0A 3BQYA 2QSGX 4UB6C 2XVCA 3E0JB 5M3FJ 1FYMA 3MVPA 4CYDA 2L4AA 2L9NA 5CPRB 3GZ6A 3I4NJ 2OCCH 2ADUA 2HI3A 2ZFWA 3DEEA 2K86A 1MW7A 2DDAA 2VBZA 3V42A 4NC6A 2GXAA 4I76A 3RQIA 4IKFA 1TQMA 1B4AA 1U3EM 5D5UB 3D1NI 2VKHA 4M3DA 2VUMJ 3CUQA 2NOGA 2DA5A 5J1UA 1ZR4A 1LQ1A 3KZIC 4GXOA 3F8CA 4EJVA 4D1QA 4IHTA 3I64A 1HXDA 2VE9A 3Q3SA 3BG6A 2WAQA 3FXUA 4JQFA 4MHGA 2NRAC 3BR3A 2NVXJ 4HPQA 5DD8A 2DOFA 1JGSA 1K78B 2YU3A 2AS5F 4G7ZF 4HV6A 4CGZA 1ULYA 1FOKA 2L7ZA 1GXPA 2DQLA 3ZQ7A 4C2TA 4DZJA 3I59A 2F5FA 3S3NA 3AL0C 1P9QC 2X6OA 3C2BA 3T5XA 1AHDP 2E35A 3LSJA 2A6HF 2JZYA 1D0XA 1OKRA 5FB2A 4A5NA 1R36A 1BIAA 2M5WA 4OWRB 2A61A 5FRNA 1MKMA 3QP6A 1QHHD 3F23A 5K5OA 4DW6A 3A01B 1HCRA 1G3SA 5ICCA 2NYXA 3LA7A 3MZ8A 3K70C 1JTXA 2NS0A 3OSFA 1Z6TA 3KEQA 4DYCA 2IS2A 1V5FA 1O57A 3TOAA 1PVEA 4EM0B 4BQOA 2ZJRF 1SC7A 2HS5A 1VQLI 1ZH5A 1RKTA 3MKLA 5HS9A 2ELHA 4LB5A 4UVBA 1WPKA 3HTUA 2LSOA 3HB9A 5EGOA 1FNNA 2Y30A 2FQ4A 3K7AJ 4M6XA 3WTZA 2K85A 4ZYDA 3K70D 2A69F 2RN7A 2Q0OA 2YPRA 3KEOA 3EUHC 4N4NB 3RZDJ 2KISA 2LKPA 3WU0A 1Z05A 1D1BA 2H8WA 2FEZA 2LFBA 2BHZA 1VQOI 2KT0A 2VONA 1OLTA 1K61A 2Y31A 3PFYA 3A4CA 2X0LA 4RMNA 5HLGA 5JVTA 5FD6A 2CUFA 4LLGF 2R7TA 1KYZA 4JYKA 3KP6A 2HQRA 5FFXA 4NNJA 3RDIA 2EIMH 3WTYC 2EV5A 4E7SA 1LDDA 1XS9A 4EJOA 2VT3A 4M6VA 1LNWA 2HVQA 1VZ0A 2BXYA 4UUSA 5K7HA 2NXNB 1MBKA 1XD7A 4G6QA 2XGXA 2X1EA 5L3CA 4OIQF 4HBLA 1SFOJ 4HX7A 4D7MA 2RQPA 2DN0A 5EYRA 3OIQA 4YFXF 1IRZA 3JRDA 1GVJA 4BL0B 1FWZA 3U1KA 3G4SI 4MEXF 1UB9A 3E6CC 3BY6A 2HVSA 3KLOA 5EEHA 3N4MA 5ED4A 2LG4A 3I56I 2LVSA 2DMPA 3WE3A 3DKYA 5FKNA 4IHWA 2ID6A 2IRFG 4JP0A 4BKXA 2RNJA 3LOCA 2LRDA 1APLC 2NNYA 1F43A 2VQCA 2M0MA 4JX5A 5HOOA 3QRFF 2JTVA 3DEWA 2JMWA 3T1BA 1RZ4A 2TRTA 2XB5A 1QVTA 3ABLH 2CG4A 5LFAA 3ZRGA 4CH7A 3RIRA 3QYEA 2IXSA 3BP8A 2EFPA 4BEHB 1WFXA 2L7MP 5KCMA 2QUFA 3M7GA 5J47A 1W5SA 4E4HA 1T39A 1FOYA 1HDPA 2K02A 3GTMJ 1MJBA 3J7YJ 1JXSA 4B3XA 3J7AO 2ZFUA 3K4MA 3R0AA 3DTKA 2K4BA 2BY1A 4L5JA 1VQ8I 2NVYJ 3LNQA 5E8GA 1O3QA 4XONA 5LEKA 2GXBA 3CCVI 2IEKA 2KQRA 3GW2A 2HYFA 4EMSA 4JK1X 2HPMA 5C4JJ 3TMOA 2K9MA 2EZIA 2OZUA 5FKMA 5TGTA 3L9FA 5E79C 4I2OA 3DWLE 4AIDA 1MDMB 1XTAA 3OYKA 1W0TA 3MZYA 1OPCA 2KRCA 2Z5UA 3HUGA 3ABMH 3WTSC 3F3XA 3F21A 2ECBA 2MLKA 1E17A 2OU2A 4S0HB 2E2IJ 3ISPA 4CICA 1JE8A 5IPAA 3HOYJ 1PYVA 1QGPA 2XPUA 3GCMA 1OR7C 2WB1A 3KP3A 3E6MA 3DTIA 3OR2C 2O5RA 1TNSA 1I39A 5E3MA 2BW3B 4RAZA 3J80Z 2DMQA 2F2EA 4WCGA 1K79A 3BJ6A 3LFUA 3TDZC 4OIPF 5DCFA 3A03A 1SMTA 3G71I 1IC8A 2QSHX 3DU6A 5F04A 4WK8F 3GTJJ 1N77A 3P9CA 2K9SA 3FHNA 2VJJA 3J80K 2GIVA 3MN2A 1WJCA 2VE8A 3ZMZA 3LSMA 2W7NA 2OTJI 2JT1A 5ICEA 2VB6A 3HPGA 4D5FA 3LA3A 1A6IA 1LKXA 4HQMA 4OOIA 4Q4ZF 5EG0B 2LOOA 3CCYA 2QBYB 2EH3A 4P55A 3LSIA 2ZC2A 4N9HA 2J5PA 2H27A 3M8FA 4UNOA 2LLKA 3ZQQA 2QENA 1VF9A 2E60A 2IW5A 2MG4A 3OYEA 5E3OA 1BR1A 3BR6A 3FBNB 5KVRA 2VOPA 2COMA 4N9IA 2M7BA 1S7EA 1R4MB 1MSEC 3CCEI 4L0ZB 3Q9VA 1U9NA 1CF7A 3ZR8X 3HDDA 4GFBA 3ZGKA 1WCMJ 2M8GX 2XAUA 1QZEA 3VPRA 2JA8J 1HW1A 4HW0A 1D8JA 1YS6A 2JWTA 3OR1C 1VI0A 2L5QA 2X85A 2RAEA 3G3ZA 2IGKA 4Q5SF 5E1XA 5A2QZ 4KMUX 4EGYA 3IH3A 4A3EJ 2KZGA 3ML6A 1IXSB 2V1DA 3A2KA 1YJWI 2FRHA 1OCCH 1HKTA 4RB0A 2VN2A 3HYIA 1VQ4I 1X58A 3OIPA 2ZMEB 1N78A 2A6TA 5A2QK 4HYEA 3HJEA 4F55A 1BC8C 1JI8A 2LH9A 5FLXZ 1YQAA 4I02A 1I5ZA 3ASOH 3BOQA 1IN8A 3JRFA 3A0HC 2DMTA 3S1QJ 4RM2A 2VODA 4IF4A 3E5XA 4H4KC 4N4OB 4AWXB 1G4DA 2M87A 3K4CA 2E2HJ 5FLXK 2GAUA 2QVOA 2DFHA 3BZKA 1HOMA 4FT8A 1KONA 1LEAA 2M7AA 1R1VA 1TC3C 4U0VA 4XR6A 2DPDA 2R92J 5FKLA 4L9VA 4FE7A 1MH4A 3DEUA 2R3SA 2LKXA 1WKMA 4L5IA 4CXFA 2IA0A 4CYCB 1TQPA 3H3UA 5H6RA 2VQGA 3AFHA 1OYIA 3D5LA 2O6GE 1FSHA 3CMYA 3PIPF 3DCFA 2CQXA 2VXZA 1JKQC 1Y0UA 1RRJA 2R7FA 4HAMA 2LD5A 4ENJA 1FY7A 1ETXA 3AG2H 3V7RA 3IAM2 4YG2F 4R79A 3PNTA 2GXGA 1NG7A 5KK1A 2PI0A 5IYBJ 4A2UA 3K0LA 2MC4A 2M4GA 1ZARA 2VJ4A 3H35A 3F22A 4HX8A 1QPIA 3JCUC 4Y13A 2DMUA 1LPQA 3DKWA 1FX7A 3R4KA 1VQMI 5C44J 3HL2A 1IJWC 2QYOA 3OV8A 1WWXA 4RAFA 3B6AA 2F4IA 2Y0SN 5IYCJ 3I4PA 3HGGA 2V9KA 3F6OA 3WODF 1W7PD 3JTHA 4PSWA 4MTDA 4AYBN 1K78A 4LOCA 1O3SA 3M4OJ 1YG2A 4ZJZA 3CQZJ 4UUVA 4V19K 1FYKA 2O3FA 1BI0A 2STTA 2HTJA 4Y3OA 1BL0A 3LMMA 3QPSA 3VYSB 4UUTA 1EH8A 3HEFA 1Z3XA 3QP5A 2ZSIB 5LEJA 2L7KA 2K3PA 3K4NA 4FX0A 4BACA 3S3MA 2BXZA 2JUCA 2EFNA 2TDXA 1KQ9A 3O8HA 4DGWB 3AL0B 1MNDA 2PMZA 3VWBA 5KNLA 2AHQA 2HXOA 1R5HA 3CMEI 1RESA 5LHGA 3H0GJ 2RC4A 2MBFA 4BDZA 2MC3A 1Q1VA 4F92B 1K6OA 1BIBA 1IZ1A 1K6YA 1OJLA 2A6EF 3OL4A 3HBLA 2X6XA 3BDDA 3CCJI 4K2EA 5HDNA 3SZTA 5LHHA 3FKIJ 3J7ZI 2WADA 4ZDOA 1TWHJ 4MIMA 3VSKA 3LQQA 1T0FA 4E7JA 5KAFC 1QPMA 2VOOA 2QEXI 2LMDA 1NTCA 2NOJB 3OYIA 3WGHA 2F5CA 1YRNB 3EYIA 1HA8A 1SMYF 1YIJI 3HRUA 2H94A 4M71A 4AIHA 1UMQA 1Y39A 3GUDA 1D3YA 5K7FA 2F4MB 2W48A 1D1AA 3LA2A 1REPC 4G94A 2ME0A 1YX5A 5F1JA 4YFNF 3OYLA 1YI2I 1FBSA 1NHAA 3WG9A 3WE2A 2K4JA 2EFQA 1XGOA 3M1EA 3QU6A 1FMVA 1HQCA 2K3FA 4KFCA 1XDSA 4RLQA 2KJBA 4A0ZA 1WHUA 4Z6YA 1I1GA 3NEUA 1R1TA 4XN0A 1YFHA 1ZG5A 2HOEA 5HS8A 5J1RA 1K83J 1IUFA 1N75A 1Z6RA 3MEXA 3H5NA 1DUXC 2PEXA 1MJAA 1IG7A 1OQYA 1KGSA 1V3FA 2MA3A 1WVRA 2P5KA 4ENMA 4BJ6C 2EIJH 4ZZDA 4NQWB 3JR9A 1DGWY 4C9YA 4CZCA 2AO9A 2B7EA 4ZDPA 3HOXJ 2OTLI 2G7HA 4HNVA 1LEBA 1ONVA 3BC8A 3IWFA 1IV8A 5TISC 3BPVA 1X3WB 2L01A 2R93J 1ZELA 5FJ8J 3JRGA 2MW8A 3I0TA 2L3DA 3S2WA 4RS8A 2DA7A 1YLFA 2HYJA 1QRYA 2V6CA 2MYSA 3OIOA 1YS7A 4L18B 3K4KA 3QYBA 2Z99A 1POGA 1OCTC 1Y8RB 4QLCU 1J5YA 4J19A 1LE8A 1G6NA 4QPOA 3KEYA 3K4JA 3H9QA 2QGUA 3GEZA 2R7OA 3K2AA 3CCMI 1H9TA 5CLSA 2FJ1A 1BR2A 2BVLA 3PSIA 2L2OA 5IP7J 4F52A 3EQLF 1D8KA 2XROA 3ZQIA 1ZGAA 4MO7A 1W0UA 5DD4A 3O3KA 3PIOF 4BGDA 2FSWA 3L2WA 5J1YA 1HW2A 1FMWA 1U5TA 2IS1A 4RAYA 3SEZA 4BEHA 1KQ8A 2Z1DA 2E1OA 1S7OA 2UWMA 2FE3A 4G7HF 4BAYA 2HOSA 3H36A 2G7UA 4V2FA 1G59A 2O0YA 4OMZA 3RPQA 3BTLA 3MD2A 2Z9OA 3PSFA 1EJ9A 1XN7A 5HDGA 2AXLA 2GA1A 1ZGWA 1E3OC 4OAZA 2BYVE 1D5VA 4A69C 1W5CC 2P81A 2DT7B 3GXOA 4RGUA 3CF5F 1K7AA 5K5QA 4MQ9F 1ZKGA 1DPUA 2Y0MA 2QWWA 1YW7A 4ZYAA 2PMHA 1S9HA 4XKCA 3MWMA 1IAWA 2ZKZA 5ILVA 2XPVA 3H1CA 1ETYA 2XAJA 1R22A 3W6VA 2EFOA 3IWZA 1R71A 2HWVA 3HHHA 4HOBA 3NWSA 1E3HA 1DP7P 2WAEA 3QPHA 3CZ6A 3KFWX 3ZOBA 1DPRA 2IA1A 1OISA 4XLFA 2RV8A 3FF5A 3OL3A 4E6KG 3C1DA 5IT9Z 4YEJA 2Y69H 4DNCA 2JA7J 4HX4A 1WJEA 2V1UA 4UVCA 2R7QA 4IHSA 3ZPLA 1MMSA 3WTWC 3I71A 3E6DA 3QYFA 5IT9K 3TOBA 1RUNA 2DYSH 2F5VA 4IPAA 1USTA 1JUMA 2XF5A 1P7JA 2L9SA 3P7NA 3BG7A 2DT6A 4BE2A 3K69A 1WJBA 2IPQX 4BHPA 1HW5A 3FIWA 3EYYA 4B3AA 4QTRA 1MH3A 4RA2A 1TT0A 1VQ9I 1EF4A 5EG0A 3KP2A 1VFCA 3HKZN 3K6GA 3ZQHA 5HDKA 2HNHA 4UV9A 1G3TA 3NARA 5JLWA 2VJIA 1UHSA 2HQAA 3BLYA 2HOAA 3OOPA 1X3ZB 2DBBA 2E7XA 1EA3A 1YITI 1NK2P 5HNHA 2LF8A 2VLAA 3OMYA 1X1PA 1KU3A 4XKWA 3CJNA 3DKXA 1I3QJ 2NVUB
chains in the Genus database with same CATH topology
3QPLA 2NVYJ 3ZQGA 3LNQA 1DU0A 3S1RJ 4A3LJ 3SFIA 3JRHA 3LSGA 2IEKA 2LK2A 1NK3P 5C4JJ 1TWFJ 3NAUA 2EZIA 5FKMA 5C3EJ 4M3EA 4W1UA 2JA5J 2WV1A 3Q0WA 2ME6A 4X1EA 1W0TA 2YUSA 2XGDA 3SDGA 4XK4A 2ECBA 4A3IJ 1JKOC 1H88C 3IV5A 3FK7A 1G2HA 5BNGA 2FD5A 4S0HB 2E2IJ 2Y2ZA 3ZQFA 3S15J 1ENHA 5IPAA 3HOYJ 1WH7A 2XPUA 1B8IB 3BG3A 2DA3A 5DTDA 1JTYA 2DA2A 4UUSB 1ORKA 4JX4A 1GDTA 3JRIA 3O8GA 3G1LA 5E3MA 1JUSA 4IHVA 2DMQA 1Z77A 5GP9A 1WI3A 3A03A 3BR2A 1IC8A 1IGNA 3M3YJ 1IDYA 5F04A 3GTJJ 2DA6A 2K9SA 1ITYA 4BY1J 4XRSG 4CYCA 4A3MJ 3MN2A 1MSFC 2QF7A 1QVUA 1Z0XA 4XIDA 2TCTA 3IH4A 3HOZJ 4IHXA 4D5FA 2K9QA 1A6IA 2Y9ZA 2K40A 2L7FP 5EG0B 5IOYA 1R9TJ 2KDZA 3CCYA 1WH5A 2EH3A 2CQQA 2LLKA 2MGQA 1VF9A 2MG4A 4XRMA 5E3OA 3BR6A 1I50J 2JK3A 2XSDC 1BW6A 2XGEA 2LY9A 2OF7A 2YU9J 1S7EA 1MSEC 4RDUA 4FCYA 1A5JA 1U9NA 1JT6A 3PO2J 3HDDA 4GFBA 3B6CA 1WCMJ 2M8GX 3HGYA 5GPAA 2R5YA 4BBSJ 3S2DJ 3VPRA 2JA8J 5IYDJ 5FKKA 1FJLA 2JWTA 1D5YA 2ZB9A 1UG2A 1U8BA 1VI0A 1HF0A 2RAEA 2GBYA 4Y7NJ 4I6ZA 3GTLJ 2QCOA 1ETVA 5F08A 3IH3A 1GV2A 2NVTJ 4A3EJ 4A3GJ 5HODA 3GTOJ 3E7LA 1B72B 5EEAA 3L1PA 4DZPA 1X58A 1OFCX 2Y9YA 4B4CA 3ZQCA 4DYQA 1GT0C 2ECCA 2LP0A 1X2NA 1I6HJ 5M5YJ 3JRFA 3OSGA 2DMTA 3S1QJ 3PM1A 2LR8A 3ZQLA 5IP9J 2EZLA 2WB1N 3BQZA 1GVDA 3GBGA 1WGXA 2E2HJ 4JX6A 3BTCA 1HOMA 1FEXA 2X9DA 2GLOA 2XGCA 1TWCJ 4L5EA 1TC3C 1GUUA 1H89C 2R92J 5FKLA 4FE7A 3S1NJ 3HOUJ 1ETQA 1MH4A 1HLVA 2LKXA 3GTQJ 1TWGJ 1FIPA 5J3LA 2VI6A 4CYCB 3GTPJ 1XC5A 2H1KA 3TP0A 3G1OA 5F0FA 3CMYA 2I10A 4AC0A 3DCFA 1YRNA 3QQAA 2GM4A 2CQXA 1JKQC 1AU7A 1ZQ3P 1B72A 2LD5A 1ETXA 2DJNA 2HXIA 3TP3A 5IP6A 3F0CA 2O9LA 4G12A 1BA5A 5IYBJ 3S1MJ 4FISA 4A93J 1BJZA 2XPWA 4MLOA 1AKHB 1QPIA 2JJ7A 5EF6A 2DMUA 2MSYA 3I4MJ 2EQRA 4IHYA 2R5YB 3BR1A 1JUPA 5C44J 1IJWC 1MBJA 2EBIA 2X48A 3B6AA 4V2GA 1P7IA 2Y0SN 5IYCJ 4A3FJ 3HGGA 2D5VA 3HM5A 3LSPA 2CRGA 2VKEA 1RPWA 4AYBN 1MBGA 4LOCA 1PUFB 3M4OJ 1IDZA 3CQZJ 1O4XA 2HDDA 3WHCA 3JRAA 1BL0A 3QPSA 4UUTA 3JRCA 3HEFA 1JKPC 4M3BA 2O8KA 3H3VK 2ID3A 5C4XJ 2L9RA 1JKRC 3O8HA 1MNMC 3GTGJ 2M34A 4D5CA 2AHQA 3WHBA 2HXOA 1BW5A 3PO3J 1RESA 2DTZA 2YS9A 3H0GJ 4ABZA 5E3NA 1AKHA 1Q1VA 3TW6A 1OJLA 2JN6A 3HBLA 4BY7J 5K7ZA 1TWAJ 1LFBA 3TEDA 4QIWN 4NDLA 3FKIJ 2IAIA 4MFDA 3JREA 1TWHJ 2E2JJ 2H8RA 4MIMA 5FLMJ 5EZGA 1PUFA 3JRBA 1NTCA 1YRNB 5FLVA 4FTHA 2R5ZA 4RBOA 1LFUP 3BR0A 3BQYA 3BR5A 4A3JJ 5M3FJ 1IV6A 3BTIA 1UMQA 3MVPA 3Q0UA 5F0CA 5K7FA 4EEFG 2W48A 3I4NJ 5F1JA 2ME0A 4C2MJ 2HI3A 2VKVA 4A3DJ 4W97A 3BTJA 4Y52J 4QSHA 5EDNA 2L0KA 4I76A 3RQIA 1LE8B 1MBFA 3BT9A 3D1NI 2VUMJ 4M3DA 2K9NA 2NOGA 2DA5A 5J1UA 5J1RA 1K83J 1ZR4A 1IUFA 5F27A 1ZTRA 3GTKJ 2LTPA 2M9HA 2CUEA 2OPTA 1IG7A 1FTZA 2O7OA 3Q3SA 4FE4A 4D7NA 3BR3A 3JR9A 2NVXJ 3TW7A 2XRLA 2AO9A 3S14J 3FK6A 3HOXJ 2CU7A 4HNVA 5DS9A 3FISA 2IBDA 3RKQA 5E3LA 5M5WJ 4M3FA 2HQ5A 2R93J 1JGGA 2HOTA 5EZHA 3S2HJ 2L7ZA 5FJ8J 3JRGA 2MW8A 1JJ6C 1JT0A 2DA7A 1SANA 1CQTA 4DZJA 5M3MJ 2HYJA 1QRYA 3OIOA 3C2BA 2X6OA 2CJJA 1POGA 2NS7A 1AHDP 1OCTC 4AUXA 4J19A 3LSJA 4X6AJ 1LE8A 3SJMA 1DU6A 2FX0A 1T56A 1VNDA 2VPRA 1F36A 4MFEA 3RZOJ 2PMZN 3K2AA 2COBA 4DW6A 2FJ1A 3A01B 1HCRA 2M2EA 5IP7J 1JTXA 4XICA 3ZQIA 3OSFA 4MO7A 1W0UA 5FKOA 2M0CA 1ETOA 4IEJA 4DYCA 2N8GA 1U78A 5J1YA 1RKTA 3MKLA 2NS8A 1WPKA 2E1OA 2R5ZB 3HB9A 5EGOA 2Y30A 5F0HA 2FQ4A 3K7AJ 1U9OA 4V2FA 2HOSA 3BTLA 3RZDJ 1ZGWA 4M3GA 1ZR2A 1E3OC 2JA6J 2R7ZJ 2LFBA 4A69C 3BG9A 2P81A 1T33A 2KT0A 1RKWA 1K61A 1ETKA 2Y31A 4BBRJ 3BG5A 5IOZA 1ZKGA 4A3KJ 1HDDC 3A01A 3UKGA 2E19A 5GPCA 5M5XJ 2CUFA 3OOUA 2G0EA 2B63J 4C3JJ 4JYKA 2XPVA 1ZK8A 1ETYA 3W6VA 4C3HJ 3HOVJ 1XS9A 3HOWJ 4M6VA 2WAQN 4B1RA 3ZOBA 1B8IA 4UUSA 3A02A 5K7HA 2EZHA 4DYRA 1MBKA 5JLXA 1SFOJ 2JA7J 1FIAA 2EZKA 4D7MA 1X2MA 2DN0A 5EYRA 2XB0X 4A3CJ 4XRSA 1IRZA 3JRDA 2DMNA 2DA1A 1JUMA 1Y1VJ 1P7JA 4C3IJ 2LVSA 3Q0VA 2R0QC 2DMPA 1FTTA 3FIWA 5FKNA 4IHWA 2ID6A 4B3AA 1MH3A 4QTRA 4JP0A 3G1MA 1Y1WJ 4BKXA 1MBEA 9ANTA 3LOCA 2ELKA 1APLC 2NVQJ 1EF4A 5EG0A 3CDLA 1F43A 3S16J 4JX5A 3DEWA 2JMWA 3HKZN 3ZQHA 2TRTA 1VFCA 2XB5A 1QVTA 5JLWA 1RETA 3NARA 1UHSA 3S17J 4A3BJ 2HOAA 4BXXJ 1ETWA 1H8AC 2L7MP 1XG1A 3LSRA 1GV5A 1JJ8C 1NK2P 1OCPA 1MBHA 2DA4A 5EGOB 1HDPA 3GTMJ 1RR7A 1I3QJ 3IH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QPL A;  2NVY J;  3ZQG A;  3LNQ A;  1DU0 A;  3S1R J;  4A3L J;  3SFI A;  3JRH A;  3LSG A;  2IEK A;  2LK2 A;  1NK3 P;  5C4J J;  1TWF J;  3NAU A;  2EZI A;  5FKM A;  5C3E J;  4M3E A;  4W1U A;  2JA5 J;  2WV1 A;  3Q0W A;  2ME6 A;  4X1E A;  1W0T A;  2YUS A;  2XGD A;  3SDG A;  4XK4 A;  2ECB A;  4A3I J;  1JKO C;  1H88 C;  3IV5 A;  3FK7 A;  1G2H A;  5BNG A;  2FD5 A;  4S0H B;  2E2I J;  2Y2Z A;  3ZQF A;  3S15 J;  1ENH A;  5IPA A;  3HOY J;  1WH7 A;  2XPU A;  1B8I B;  3BG3 A;  2DA3 A;  5DTD A;  1JTY A;  2DA2 A;  4UUS B;  1ORK A;  4JX4 A;  1GDT A;  3JRI A;  3O8G A;  3G1L A;  5E3M A;  1JUS A;  4IHV A;  2DMQ A;  1Z77 A;  5GP9 A;  1WI3 A;  3A03 A;  3BR2 A;  1IC8 A;  1IGN A;  3M3Y J;  1IDY A;  5F04 A;  3GTJ J;  2DA6 A;  2K9S A;  1ITY A;  4BY1 J;  4XRS G;  4CYC A;  4A3M J;  3MN2 A;  1MSF C;  2QF7 A;  1QVU A;  1Z0X A;  4XID A;  2TCT A;  3IH4 A;  3HOZ J;  4IHX A;  4D5F A;  2K9Q A;  1A6I A;  2Y9Z A;  2K40 A;  2L7F P;  5EG0 B;  5IOY A;  1R9T J;  2KDZ A;  3CCY A;  1WH5 A;  2EH3 A;  2CQQ A;  2LLK A;  2MGQ A;  1VF9 A;  2MG4 A;  4XRM A;  5E3O A;  3BR6 A;  1I50 J;  2JK3 A;  2XSD C;  1BW6 A;  2XGE A;  2LY9 A;  2OF7 A;  2YU9 J;  1S7E A;  1MSE C;  4RDU A;  4FCY A;  1A5J A;  1U9N A;  1JT6 A;  3PO2 J;  3HDD A;  4GFB A;  3B6C A;  1WCM J;  2M8G X;  3HGY A;  5GPA A;  2R5Y A;  4BBS J;  3S2D J;  3VPR A;  2JA8 J;  5IYD J;  5FKK A;  1FJL A;  2JWT A;  1D5Y A;  2ZB9 A;  1UG2 A;  1U8B A;  1VI0 A;  1HF0 A;  2RAE A;  2GBY A;  4Y7N J;  4I6Z A;  3GTL J;  2QCO A;  1ETV A;  5F08 A;  3IH3 A;  1GV2 A;  2NVT J;  4A3E J;  4A3G J;  5HOD A;  3GTO J;  3E7L A;  1B72 B;  5EEA A;  3L1P A;  4DZP A;  1X58 A;  1OFC X;  2Y9Y A;  4B4C A;  3ZQC A;  4DYQ A;  1GT0 C;  2ECC A;  2LP0 A;  1X2N A;  1I6H J;  5M5Y J;  3JRF A;  3OSG A;  2DMT A;  3S1Q J;  3PM1 A;  2LR8 A;  3ZQL A;  5IP9 J;  2EZL A;  2WB1 N;  3BQZ A;  1GVD A;  3GBG A;  1WGX A;  2E2H J;  4JX6 A;  3BTC A;  1HOM A;  1FEX A;  2X9D A;  2GLO A;  2XGC A;  1TWC J;  4L5E A;  1TC3 C;  1GUU A;  1H89 C;  2R92 J;  5FKL A;  4FE7 A;  3S1N J;  3HOU J;  1ETQ A;  1MH4 A;  1HLV A;  2LKX A;  3GTQ J;  1TWG J;  1FIP A;  5J3L A;  2VI6 A;  4CYC B;  3GTP J;  1XC5 A;  2H1K A;  3TP0 A;  3G1O A;  5F0F A;  3CMY A;  2I10 A;  4AC0 A;  3DCF A;  1YRN A;  3QQA A;  2GM4 A;  2CQX A;  1JKQ C;  1AU7 A;  1ZQ3 P;  1B72 A;  2LD5 A;  1ETX A;  2DJN A;  2HXI A;  3TP3 A;  5IP6 A;  3F0C A;  2O9L A;  4G12 A;  1BA5 A;  5IYB J;  3S1M J;  4FIS A;  4A93 J;  1BJZ A;  2XPW A;  4MLO A;  1AKH B;  1QPI A;  2JJ7 A;  5EF6 A;  2DMU A;  2MSY A;  3I4M J;  2EQR A;  4IHY A;  2R5Y B;  3BR1 A;  1JUP A;  5C44 J;  1IJW C;  1MBJ A;  2EBI A;  2X48 A;  3B6A A;  4V2G A;  1P7I A;  2Y0S N;  5IYC J;  4A3F J;  3HGG A;  2D5V A;  3HM5 A;  3LSP A;  2CRG A;  2VKE A;  1RPW A;  4AYB N;  1MBG A;  4LOC A;  1PUF B;  3M4O J;  1IDZ A;  3CQZ J;  1O4X A;  2HDD A;  3WHC A;  3JRA A;  1BL0 A;  3QPS A;  4UUT A;  3JRC A;  3HEF A;  1JKP C;  4M3B A;  2O8K A;  3H3V K;  2ID3 A;  5C4X J;  2L9R A;  1JKR C;  3O8H A;  1MNM C;  3GTG J;  2M34 A;  4D5C A;  2AHQ A;  3WHB A;  2HXO A;  1BW5 A;  3PO3 J;  1RES A;  2DTZ A;  2YS9 A;  3H0G J;  4ABZ A;  5E3N A;  1AKH A;  1Q1V A;  3TW6 A;  1OJL A;  2JN6 A;  3HBL A;  4BY7 J;  5K7Z A;  1TWA J;  1LFB A;  3TED A;  4QIW N;  4NDL A;  3FKI J;  2IAI A;  4MFD A;  3JRE A;  1TWH J;  2E2J J;  2H8R A;  4MIM A;  5FLM J;  5EZG A;  1PUF A;  3JRB A;  1NTC A;  1YRN B;  5FLV A;  4FTH A;  2R5Z A;  4RBO A;  1LFU P;  3BR0 A;  3BQY A;  3BR5 A;  4A3J J;  5M3F J;  1IV6 A;  3BTI A;  1UMQ A;  3MVP A;  3Q0U A;  5F0C A;  5K7F A;  4EEF G;  2W48 A;  3I4N J;  5F1J A;  2ME0 A;  4C2M J;  2HI3 A;  2VKV A;  4A3D J;  4W97 A;  3BTJ A;  4Y52 J;  4QSH A;  5EDN A;  2L0K A;  4I76 A;  3RQI A;  1LE8 B;  1MBF A;  3BT9 A;  3D1N I;  2VUM J;  4M3D A;  2K9N A;  2NOG A;  2DA5 A;  5J1U A;  5J1R A;  1K83 J;  1ZR4 A;  1IUF A;  5F27 A;  1ZTR A;  3GTK J;  2LTP A;  2M9H A;  2CUE A;  2OPT A;  1IG7 A;  1FTZ A;  2O7O A;  3Q3S A;  4FE4 A;  4D7N A;  3BR3 A;  3JR9 A;  2NVX J;  3TW7 A;  2XRL A;  2AO9 A;  3S14 J;  3FK6 A;  3HOX J;  2CU7 A;  4HNV A;  5DS9 A;  3FIS A;  2IBD A;  3RKQ A;  5E3L A;  5M5W J;  4M3F A;  2HQ5 A;  2R93 J;  1JGG A;  2HOT A;  5EZH A;  3S2H J;  2L7Z A;  5FJ8 J;  3JRG A;  2MW8 A;  1JJ6 C;  1JT0 A;  2DA7 A;  1SAN A;  1CQT A;  4DZJ A;  5M3M J;  2HYJ A;  1QRY A;  3OIO A;  3C2B A;  2X6O A;  2CJJ A;  1POG A;  2NS7 A;  1AHD P;  1OCT C;  4AUX A;  4J19 A;  3LSJ A;  4X6A J;  1LE8 A;  3SJM A;  1DU6 A;  2FX0 A;  1T56 A;  1VND A;  2VPR A;  1F36 A;  4MFE A;  3RZO J;  2PMZ N;  3K2A A;  2COB A;  4DW6 A;  2FJ1 A;  3A01 B;  1HCR A;  2M2E A;  5IP7 J;  1JTX A;  4XIC A;  3ZQI A;  3OSF A;  4MO7 A;  1W0U A;  5FKO A;  2M0C A;  1ETO A;  4IEJ A;  4DYC A;  2N8G A;  1U78 A;  5J1Y A;  1RKT A;  3MKL A;  2NS8 A;  1WPK A;  2E1O A;  2R5Z B;  3HB9 A;  5EGO A;  2Y30 A;  5F0H A;  2FQ4 A;  3K7A J;  1U9O A;  4V2F A;  2HOS A;  3BTL A;  3RZD J;  1ZGW A;  4M3G A;  1ZR2 A;  1E3O C;  2JA6 J;  2R7Z J;  2LFB A;  4A69 C;  3BG9 A;  2P81 A;  1T33 A;  2KT0 A;  1RKW A;  1K61 A;  1ETK A;  2Y31 A;  4BBR J;  3BG5 A;  5IOZ A;  1ZKG A;  4A3K J;  1HDD C;  3A01 A;  3UKG A;  2E19 A;  5GPC A;  5M5X J;  2CUF A;  3OOU A;  2G0E A;  2B63 J;  4C3J J;  4JYK A;  2XPV A;  1ZK8 A;  1ETY A;  3W6V A;  4C3H J;  3HOV J;  1XS9 A;  3HOW J;  4M6V A;  2WAQ N;  4B1R A;  3ZOB A;  1B8I A;  4UUS A;  3A02 A;  5K7H A;  2EZH A;  4DYR A;  1MBK A;  5JLX A;  1SFO J;  2JA7 J;  1FIA A;  2EZK A;  4D7M A;  1X2M A;  2DN0 A;  5EYR A;  2XB0 X;  4A3C J;  4XRS A;  1IRZ A;  3JRD A;  2DMN A;  2DA1 A;  1JUM A;  1Y1V J;  1P7J A;  4C3I J;  2LVS A;  3Q0V A;  2R0Q C;  2DMP A;  1FTT A;  3FIW A;  5FKN A;  4IHW A;  2ID6 A;  4B3A A;  1MH3 A;  4QTR A;  4JP0 A;  3G1M A;  1Y1W J;  4BKX A;  1MBE A;  9ANT A;  3LOC A;  2ELK A;  1APL C;  2NVQ J;  1EF4 A;  5EG0 A;  3CDL A;  1F43 A;  3S16 J;  4JX5 A;  3DEW A;  2JMW A;  3HKZ N;  3ZQH A;  2TRT A;  1VFC A;  2XB5 A;  1QVT A;  5JLW A;  1RET A;  3NAR A;  1UHS A;  3S17 J;  4A3B J;  2HOA A;  4BXX J;  1ETW A;  1H8A C;  2L7M P;  1XG1 A;  3LSR A;  1GV5 A;  1JJ8 C;  1NK2 P;  1OCP A;  1MBH A;  2DA4 A;  5EGO B;  1HDP A;  3GTM J;  1RR7 A;  1I3Q J;  3IH2 A; 
#chains in the Genus database with same CATH topology
 3HRS A;  4LG3 A;  3QPL A;  2VXD A;  3DLL F;  1Z3Y A;  3ECH A;  2P0W A;  5JR3 A;  4N0B A;  1TQI A;  5FGM A;  2LK2 A;  4RB1 A;  2I8D A;  1NK3 P;  1XCV A;  4ZTJ A;  3UR3 C;  5HVQ C;  4G6D A;  1USS A;  3S8P A;  4QPQ A;  3JW4 A;  2WV1 A;  2DOE A;  4ENN A;  5B5E C;  5E1Z B;  1G8X A;  1TW2 A;  3IKV A;  4ESJ A;  3J7A Y;  3DPU A;  5FRO A;  3GVA A;  3HOT A;  2YUS A;  4MTE A;  2ZME A;  4RM3 A;  2OQR A;  2FA5 A;  4A6E A;  1IXR C;  5B1B H;  1F4K A;  5D5W B;  3S15 J;  3I5U A;  4MEY F;  3KZZ A;  1YW8 A;  1RI7 A;  2DA3 A;  3ZN0 A;  4GRI A;  2FF4 A;  2A68 F;  2BVM A;  3O8G A;  1FP1 D;  1JUS A;  4HLX A;  3GWZ A;  4I01 A;  1Z77 A;  2A05 A;  5GP9 A;  1ZYR F;  3GYH X;  4ENK A;  4G9Y A;  1F5T A;  3M3Y J;  3D0S A;  3CDI A;  2DA6 A;  1XGN A;  2UXX A;  2OCE A;  3I55 I;  1ITY A;  4GYG A;  2PLY A;  4KT5 C;  4CYC A;  2EPF A;  4A3M J;  5ILU A;  3JSO A;  2QF7 A;  2MH2 A;  2MFZ A;  3I3L A;  3JTG A;  1QVU A;  1LUJ B;  2TCT A;  4IHX A;  2XKO A;  4H0E A;  1FBU A;  2LY1 A;  2V79 A;  2KL4 A;  1PDN C;  2L7F P;  2OC6 A;  1R9T J;  1L0O C;  2X1C A;  3NWT A;  1WH5 A;  3LAP A;  4M73 A;  3C2G A;  1ZHF A;  3VYT B;  4CUG A;  1YO5 C;  3KP4 A;  4Q48 A;  3TQN A;  3DV8 A;  4B44 A;  4XRM A;  1L3L A;  2EK5 A;  1SD4 A;  3KYC B;  2A5W A;  1MNE A;  5KHD A;  5LGU A;  1SFX A;  2XC7 A;  3GFI A;  4DBR A;  2LY9 A;  2XGE A;  4LJZ F;  1TLH B;  3E5U A;  4HLY A;  3ECO A;  1W7P B;  3DU5 A;  4RDU A;  3RI4 A;  1A5J A;  1JT6 A;  2VKD A;  3K1M A;  2YR2 A;  4BJ5 C;  4PUS A;  4IRG A;  5H2F C;  4LLN A;  3HXL A;  3OWT A;  3ZMT A;  5FKK A;  1OYY A;  1FJL A;  4XQF A;  1O3R A;  3QOE A;  4A5M A;  2PJR A;  3FMQ A;  1U8B A;  2GBY A;  3DF8 A;  5E8I A;  4I6Z A;  3COA C;  3GTL J;  2R4G A;  2QCO A;  2OQG A;  2O61 A;  5F08 A;  3ZCO A;  3V8K A;  5JHU A;  4KUM A;  3SFZ A;  3GTO J;  3BWG A;  1R1U A;  2DW4 A;  3ONQ A;  4YFK F;  2Z3Y A;  3E7L A;  5JFR A;  3E6B A;  2CUZ A;  2M1B A;  1B72 B;  4DZP A;  2MAB A;  2Y9Y A;  4B4C A;  2LC2 A;  2E7W A;  1WRJ A;  1MMA A;  2LP0 A;  1T8I A;  1X2N A;  1S8N A;  4HRI A;  5KAI C;  4O3M A;  2VC0 A;  1R5G A;  1YE9 A;  1JHF A;  2LBF A;  3ABK H;  2EZL A;  3OYM A;  2GIZ A;  3ZQL A;  4NBQ A;  1XSD A;  2ISZ A;  1X3U A;  2RVC A;  2UXN A;  2JUG A;  5HS7 A;  3BTC A;  2HGC A;  4NUB A;  4EVI A;  2QQB A;  2E1C A;  4HG2 A;  1TWC J;  4L5E A;  3T0Y A;  3VYU B;  4L9J A;  1X4O A;  4LB6 B;  3RKW A;  1ETQ A;  2A3S A;  1UFM A;  1HLV A;  2CSO A;  3HSF A;  1ZRF A;  1G3Y A;  2VI6 A;  2V1N A;  3JSP A;  5J8F A;  2V9V A;  1BR4 A;  2EIL H;  2H1K A;  1OCZ H;  2WY7 Q;  3TP0 A;  2EIN H;  3G1O A;  3HG9 A;  1DQU A;  3IP4 B;  4M74 A;  2I10 A;  4KDP A;  1YRN A;  4LG0 B;  3QQA A;  3HRT A;  1FYL A;  1BI2 A;  3CO7 C;  4KNY A;  4M9Z A;  2QA4 I;  1RNL A;  2YX7 A;  3GO5 A;  1AU7 A;  4GDF A;  1XMA A;  2FXA A;  1JHH A;  2DJN A;  2HXI A;  5AON A;  3TP3 A;  4A0X A;  3VYR B;  3IC7 A;  3CCR I;  3EUH A;  3LSK A;  4G12 A;  2HKO A;  1BA5 A;  3H5A A;  5J4Y A;  5D5X B;  3U2R A;  3FKJ A;  3S1M J;  4GCV A;  1A36 A;  1LB2 A;  1UCR A;  4KN7 X;  2DFF A;  4BHB A;  1TL8 A;  2VIX A;  1AKH B;  2FMY A;  2JJ7 A;  4HF2 A;  3KX2 A;  1J75 A;  5DCM A;  4HNU A;  2EQR A;  4IHY A;  4A6D A;  1C0W A;  1JUP A;  2CV2 A;  2P7V B;  4PZJ A;  4V2G A;  1P7I A;  2FU4 A;  2IJL A;  3S3O A;  2D5V A;  3HM5 A;  3IHU A;  2CRG A;  4U7B A;  3VOD A;  4PCQ A;  3PNY A;  4KT6 A;  2R7X A;  1MBG A;  2DOA A;  2CMP A;  1IDZ A;  3RJP A;  1W36 C;  4EGZ A;  2V7F A;  2XDV A;  2W57 A;  5L3D A;  3JRA A;  3TKY A;  4M3B A;  3HHG A;  5DUK A;  3RKY A;  2HEO A;  2O8K A;  2ICW G;  3W3C A;  3H3V K;  4UXN A;  4HDV A;  4MGR A;  2R7D A;  5DM7 F;  4ANJ A;  2Y75 A;  5C4X J;  2DTR A;  3S93 A;  4O6J A;  1GHC A;  1JKR C;  1DGR M;  2KHM A;  5B3S H;  1MNM C;  3CP8 A;  2HKX A;  4ZH4 F;  3GTG J;  1T38 A;  2DJI A;  1HC8 A;  3GLL A;  1UHM A;  2CW8 A;  5E3N A;  3LSH A;  4M9S A;  4Y4R A;  2K7L A;  2IA2 A;  5GAH J;  4P9U A;  4BY7 J;  5K7Z A;  4FET A;  3QPT A;  4OAY A;  2E1N A;  2E1M C;  1IRF A;  1MD0 A;  4NDL A;  4BQQ A;  1XMX A;  4LMY A;  2P4W A;  3SYT A;  1XCB A;  4CZZ A;  4HNT A;  4IO9 F;  2H8R A;  4NHJ A;  1M1E B;  2KRF A;  1QZY A;  4ZZL A;  2EV0 A;  3QOP A;  1PUF A;  1J09 A;  3KLN A;  5E18 F;  3P9K A;  5FLV A;  1A6Q A;  1V54 H;  3BR5 A;  3ELK A;  1IV6 A;  3HRM A;  3Q0U A;  4EEF G;  3OYD A;  3I59 B;  2W24 A;  4A3D J;  3D5S C;  4W97 A;  1VQK I;  3BTJ A;  4Y52 J;  2MD0 A;  2CQN A;  1WJ5 A;  2L0K A;  2J5O A;  4IJA A;  4QSH A;  2F5D A;  3BT9 A;  1BC7 C;  3M1C A;  2UZK A;  1DDN A;  2K9N A;  3L7W A;  5DDG A;  1B6A A;  1ZTR A;  2KKO A;  2Z33 A;  3GTK J;  1BJA A;  2LTP A;  2DXI A;  4BH9 A;  1BN5 A;  2OPT A;  1FTZ A;  2O7O A;  5GAG J;  4U0Y A;  2M45 A;  2L4M A;  4GGG A;  3ROU A;  4A12 A;  4D7N A;  4D9J A;  1D1C A;  2QLZ A;  5B66 C;  4XL9 A;  1LVA A;  1J9I A;  2ZNZ A;  1X1A A;  3Q9S A;  4I7H A;  3TW7 A;  5LGT A;  4HA8 A;  3S14 J;  2R7W A;  4CA0 A;  3B02 A;  2CQ7 A;  4M6Y A;  3CJR B;  1FP2 A;  1V55 H;  5E3L A;  5M5W J;  4P9F A;  1B9N A;  4WWC A;  1JGG A;  3S2H J;  5EZH A;  5LHI A;  2CWE A;  3LQR A;  3N97 A;  3WGI A;  1JT0 A;  4U7D A;  3IL2 A;  4KIS A;  3WGG A;  1SAN A;  4PFP A;  4RB3 C;  1CQT A;  2EIK H;  2XF7 A;  3H9G A;  3L00 A;  4B8X A;  3REO A;  1Y6I A;  2W00 A;  1OYW A;  2O03 A;  1S7A A;  5CQE A;  1SD7 A;  4AUX A;  4X6A J;  1DU6 A;  1O7L A;  1R58 A;  1T56 A;  1VND A;  1F36 A;  2Y48 A;  5L3F A;  4OMY A;  4LK1 F;  3GFM A;  4CHU A;  4IRH A;  1R23 A;  1T08 B;  5TRD A;  3DBH B;  1KQ0 A;  2FOK A;  3OYN A;  2M2E A;  4IRI A;  4G7O F;  3OYJ A;  4PJN A;  2RKH A;  3L2V A;  5FKO A;  2M0C A;  1ETO A;  4IEJ A;  1VQ6 I;  1TT5 B;  2ZCW A;  1V5E A;  2QQ8 A;  3W6J B;  4NB5 A;  2N8G A;  2LY2 A;  2WAF A;  4DQ2 A;  5IT3 A;  2VC1 A;  2CW7 A;  3H92 A;  2M8E A;  4ETS A;  2EA4 A;  2NS8 A;  3CCS I;  2Z2S B;  4WX9 A;  1BOB A;  3FMR A;  4Y15 A;  5F1R A;  5F0H A;  1U9O A;  1KU2 A;  2VQH A;  3KP7 A;  2IS4 A;  4XLN F;  2RGV A;  1K4T A;  4J00 A;  4HSR A;  3H9J A;  1S6L A;  4IOA F;  1UZC A;  5D8L B;  1AOY A;  1J0R A;  2R7Z J;  3RYR A;  2K27 A;  3BG9 A;  5DYM A;  1T33 A;  4YRV A;  1Z1D A;  1VQ7 I;  1KA8 A;  4PFO A;  4XLP F;  3F8B A;  3ERE D;  4BBR J;  3BG5 A;  1ZRE A;  1HDD C;  1IUY A;  4A3K J;  4I0A A;  3A01 A;  2MLG A;  3HSR A;  3UKG A;  2E19 A;  5D6E A;  5GPC A;  5M5X J;  3OOU A;  4F7Z A;  3TGN A;  2V6E A;  2B63 J;  4ZYH A;  2H6C A;  1ZK8 A;  1LDJ A;  4IQJ A;  4C3H J;  2CQK A;  1U5T C;  2OUM A;  3HOV J;  3MKW B;  2WAQ N;  2VBY A;  1LJ9 A;  2VBX A;  3VDX A;  4HEA 2;  3VB2 A;  3A02 A;  2A07 F;  3W2V A;  1IRG A;  4XSX F;  3VEP A;  3HPH A;  3MMY B;  3V7C A;  1R49 A;  1MMD A;  1VTN C;  2ZJQ F;  2K9L A;  3FM5 A;  1FOX A;  3C18 A;  5BPD A;  1Z7L A;  2PMU A;  1FIA A;  2EZK A;  3U21 A;  5ILS A;  3O2P E;  1VQ5 I;  4KYW A;  1I27 A;  4Z2Y A;  1IN5 A;  1Y8Q B;  1HSJ A;  4I98 B;  3RQ4 A;  3CC7 I;  3HC7 A;  2LDU A;  3TO9 A;  2BBY A;  1ZG1 A;  2CFX A;  1P4W A;  3SHF A;  4KN4 X;  3IRQ A;  4BQN A;  3FX3 A;  1P6R A;  4E7I A;  3PFI A;  1Y1W J;  1P4A A;  2KMU A;  3RPU D;  4P5O A;  1OCR H;  2Z16 A;  1MBE A;  9ANT A;  1BOA A;  2ELK A;  2XHK A;  3CUO A;  5IY5 H;  3ESW B;  2IGM A;  3M8E A;  1ZG3 A;  4F3Q A;  1J2X A;  1RET A;  2B0L A;  3K9T A;  2L9V A;  2JPC A;  2DT5 A;  3S17 J;  4A3B J;  4BXX J;  5FFZ A;  3OY9 A;  3WTT C;  3FXM A;  1B9M A;  2D2W A;  4ESF A;  3LSR A;  4I09 A;  1OCP A;  1MBH A;  1W7P A;  5BOX A;  1U8R A;  1SVM A;  1E3P A;  4BHC A;  1H0M A;  1P2F A;  2E34 A;  3FBI B;  3F8N A;  3OS1 A;  3D5R C;  3ZQG A;  2WTE A;  4AU7 A;  1F9N A;  1MZB A;  1FLI A;  3JRH A;  5AIQ A;  2LYC A;  3DTE A;  4Y17 A;  3LSG A;  3U1D A;  1QQI A;  5BPI A;  3CUQ C;  2XAF A;  4RGX A;  3BJO A;  1TWF J;  3NAU A;  4O5V A;  4II2 A;  2NNN A;  5C3E J;  2QSF X;  4M3E A;  3FDY A;  4W1U A;  1Q1H A;  4EM2 A;  1IF1 A;  4L0Y B;  4CDG A;  4WXH A;  4PSX A;  4IXA A;  1XSV A;  3QOD A;  1FOW A;  1AA7 A;  4I99 C;  2XGD A;  1QO0 D;  4A3I J;  3K10 A;  4KJZ A;  1SD5 A;  3TBI A;  5BNG A;  2FD5 A;  2Y2Z A;  3ZQF A;  1ENH A;  4AIK A;  2ZXJ A;  1E2X A;  2Q8K A;  2E5Z A;  1B8I B;  3BG3 A;  2JVH A;  4IOC F;  1FZP B;  1OMI A;  3DP7 A;  5ERI A;  1ORK A;  5CYV A;  2QQ9 A;  4JX4 A;  3SEQ A;  3JRI A;  2M4K A;  1QHG A;  2IVM A;  3KPH A;  3MQ0 A;  3OYG A;  4IHV A;  1LDK B;  1EKE A;  4CCN A;  4XLA A;  4CCL A;  1XX5 A;  4NC7 A;  2E5N A;  3K4B A;  2XAQ A;  1IGN A;  4AM3 A;  2E71 A;  3CJQ B;  2WV0 A;  3I58 A;  4XRS G;  5L3B A;  1VQP I;  4BY1 J;  2DI3 A;  2HZD A;  3V8L A;  2DK5 A;  2M3A A;  1Z0X A;  1XSX A;  4LG0 A;  4XID A;  3IH4 A;  3HOZ J;  2BGC A;  3TO7 A;  4GO1 A;  1MDM A;  4HZF A;  1TZL A;  6PAX A;  2W25 A;  5F64 A;  2K9Q A;  2Y9Z A;  2P6T A;  3V8J A;  1Y56 A;  2KDZ A;  4II3 A;  3V7S A;  3GFJ A;  3FXQ A;  3HSE A;  3M07 A;  4XLC A;  2CQQ A;  1VQN I;  1TW3 A;  2MGQ A;  1XPX A;  1YJN I;  1B1B A;  3GF2 A;  3N05 A;  2JK3 A;  2XSD C;  4Q47 A;  1ZRD A;  4EJU A;  2OF7 A;  4BUP A;  3CLO A;  3F6V A;  2YU9 J;  2BW3 A;  2AQF A;  4FCY A;  2W1O A;  2FNP A;  3M9A A;  3HGY A;  4CSW A;  2DU9 A;  2Y0S A;  4GYI A;  3S2D J;  3TL4 X;  4BBS J;  5IYD J;  1F1Z A;  4IVN A;  2F4O B;  1UJ8 A;  2BY0 A;  2ZB9 A;  4AYB A;  2HVR A;  2X1D A;  2HR3 A;  3GME A;  4Y7N J;  2BZT A;  2VT2 A;  3FHZ A;  2CFO A;  2DQR A;  1GV2 A;  3RCO A;  3OYH A;  2XKP A;  1QZZ A;  4IQ4 A;  1OFC X;  4ZYE A;  4X0G A;  2QBY A;  2NAZ A;  3BPX A;  2X6Y A;  1WZ2 A;  2C6Y A;  3KZY A;  1H9G A;  4WXC A;  4XLE A;  4BXF A;  3ZQC A;  2O8X A;  2ECC A;  2CYY A;  3OSG A;  5DM6 F;  1BI3 A;  2PFB A;  3BZC A;  3L2Q A;  5EEG A;  3IRR A;  3AG3 H;  5IP9 J;  1X4P A;  2WB1 N;  4ON0 A;  3BQZ A;  1GVD A;  3G6E I;  1WGX A;  3PQJ A;  4G6T B;  4B47 A;  3OS0 A;  5JHF A;  1FEX A;  4PJL A;  2GLO A;  2YSR A;  2XGC A;  3FZV A;  1FBQ A;  1GUU A;  1IXC A;  1R6R A;  1H89 C;  2AQE A;  4LIU A;  1XB4 A;  4BS9 A;  2VAS A;  1S72 I;  3S1N J;  3HOU J;  3I9V 2;  1SFE A;  2BY3 A;  3E5Q A;  3AG4 H;  2Q1Z B;  5FO5 A;  3RKX A;  1TWG J;  1W1W E;  1FIP A;  1TP4 A;  3SDB A;  3GTQ J;  2E1M B;  5L3E A;  2F5E A;  3GTP J;  1MIJ A;  2OZ6 A;  1XC5 A;  3KYD B;  1Z7U A;  3W6K B;  4XNF A;  2DO7 A;  4UHT A;  1WI9 A;  5D4R A;  1YW9 A;  1BBY A;  4J01 A;  3I53 A;  2P5L C;  1ZQ3 P;  2OA4 A;  2YX4 A;  2CW0 F;  4MQV A;  2XAG A;  2D1V A;  3WTU C;  2LRE A;  4UV8 A;  4LGW A;  1YHQ I;  2A5Y B;  3OYF A;  3PUB A;  4BQA A;  4FIS A;  4A93 J;  1X19 A;  3DLA A;  3FM3 A;  2CV0 A;  1P4X A;  4KMF A;  2XPW A;  2XIG A;  4UVA A;  3RYP A;  5EF6 A;  5JVG F;  2MSY A;  4U0W A;  1ERD A;  2UUZ A;  5GTH C;  3H5R A;  3ZXS A;  2R5Y B;  1SAX A;  2DPU A;  1MBJ A;  1IN6 A;  2EB7 A;  2WC2 A;  3FWE A;  4F93 B;  2K5C A;  2XRN A;  1CGP A;  4A3F J;  2B9S A;  1IW7 F;  3EUA A;  3L2U A;  1G3W A;  1R00 A;  3LSP A;  1QA6 A;  1SEU A;  3A0B C;  4E70 A;  1FC3 A;  2R7V A;  4XMY A;  1O4X A;  1FT9 A;  1P92 A;  2QKL B;  3WHC A;  5LLQ A;  1NG6 A;  2H09 A;  3FMS A;  4YIF A;  3ZMU A;  4HF1 A;  1LVK A;  1JKP C;  4IL6 C;  1KZH A;  3PUF A;  4WXD A;  2RDP A;  2ID3 A;  2L02 A;  3WU2 C;  3P5J A;  4JBA A;  4E7L A;  1ZRC A;  2L9R A;  4P1W A;  3PQK A;  5J40 A;  1UHW A;  4PJM A;  5EJC A;  2KP6 A;  1X1D A;  2YS9 A;  1Y0N A;  4ABZ A;  4YIR X;  3C3W A;  2IT0 A;  2FUG 2;  3W2A A;  4RGS A;  1W4M A;  3CMA I;  2LNB A;  3Q5F A;  3CLQ A;  2JN6 A;  1LFB A;  3KP5 A;  2ESH A;  3DFG A;  4QIW N;  4XSZ F;  4MFD A;  4KIG A;  2RNG A;  2WBM A;  2E2J J;  3EET A;  5FLM J;  3P9I A;  1YTY A;  5GAD J;  2KDO A;  5EZG A;  2PQ8 A;  4RBO A;  2QM3 A;  4A3J J;  3K2Z A;  3BTI A;  1Z67 A;  2KJC A;  2ZJP F;  5F0C A;  1ZN2 A;  4KIF A;  1V5G A;  4C2M J;  1R4N B;  1XDU A;  2VKV A;  4QWQ A;  2QKM B;  5CVU A;  2GQQ A;  1LE8 B;  1J7K A;  3CF2 A;  5EDN A;  1T95 A;  2FML A;  1ZLJ A;  1MBF A;  2VBW A;  2MH9 A;  2CV1 A;  3GX4 X;  3MCZ A;  2BE5 F;  3E97 A;  1IN7 A;  2CUJ A;  5F27 A;  3WG7 H;  2M9H A;  2Q2E B;  1HST A;  2CUE A;  3B73 A;  1EH6 A;  1IN4 A;  5ICF A;  4BE0 A;  1WJF A;  1Z21 A;  3WTX C;  2M30 A;  1RIO H;  1WQ2 A;  4FE4 A;  2CH0 A;  3CES A;  2V26 A;  5DV5 A;  1ON2 A;  4R1H A;  3DQV C;  5HLI A;  2XRL A;  1U5T B;  2IGO A;  3FK6 A;  2CU7 A;  5DS9 A;  1D0Y A;  3FIS A;  2HU9 A;  2IBD A;  5CKT A;  5BS6 A;  3RKQ A;  4M3F A;  2HQ5 A;  4EAT A;  3M8J A;  2F6C A;  2HOT A;  3CTA A;  2ZSH B;  1JJ6 C;  2EA2 A;  3K4L A;  1XGS A;  4Y33 A;  2FBK A;  4KIT B;  5LRS A;  3MZH A;  1T2K A;  5M3M J;  4ZTF A;  4XOR A;  3VSL A;  5B1A H;  1TBX A;  1ZGJ A;  5BQT A;  4HV5 A;  2R7R A;  4RLF A;  4CCO A;  1A31 A;  2KFD A;  4OIO F;  2CJJ A;  3VFZ A;  2NS7 A;  2DDB A;  1WJD A;  2ZXH A;  4PK4 A;  1S29 A;  2FX0 A;  2VPR A;  3SJM A;  4MFE A;  5L3G A;  5AIP A;  4FX4 A;  3RZO J;  3R6S A;  2PMZ N;  3HOS A;  2COB A;  2ZBK A;  3C2H A;  5D5V B;  1DP3 A;  4CO8 A;  3R60 A;  2QZ8 A;  4R8H A;  3HKZ A;  3CO6 C;  2ZO4 A;  4XIC A;  2HTS A;  2VL8 A;  4XN3 A;  2BY2 A;  4NQW A;  3ERM A;  1Z91 A;  2ESN A;  1U78 A;  4M72 A;  1HKS A;  3SQN A;  3CCU I;  1UAA A;  3FXJ A;  5E17 F;  1XGM A;  1J59 A;  1PP8 F;  2R5Z B;  5CQG A;  4XM3 A;  1MGT A;  2E36 A;  1TTY A;  3ZMD A;  1E0E A;  3FXK A;  4PJ0 C;  3S32 A;  1GLN A;  3GLX A;  2OBP A;  4M3G A;  1HBX G;  1PUE E;  5HLH A;  1ZR2 A;  2JA6 J;  2KLO A;  1QU3 A;  2DCE A;  1XMK A;  2KIF A;  2WY8 Q;  2HZT A;  1RKW A;  3JAM Z;  2UV1 A;  1ETK A;  4F91 B;  1W36 D;  3FXR A;  5IOZ A;  3CUQ B;  2W4S A;  4RGR A;  4YEL A;  5E20 A;  2W84 A;  1WSU A;  2G0E A;  4C3J J;  3DPL C;  3G2B A;  3JAM K;  2JA2 A;  3KIO A;  3C7J A;  1SVO A;  3HOW J;  3BRO A;  4BJT A;  4B1R A;  4CCK A;  2GOM A;  1B8I A;  2G9W A;  1SVL A;  2EZH A;  4DYR A;  2JQ7 A;  2P7C B;  4A0Y A;  2JRT A;  5JLX A;  3TO6 A;  4L9N A;  4NC8 A;  1X2M A;  2JRM A;  2XB0 X;  3CCQ I;  4A3C J;  1N25 A;  4XRS A;  4KIC A;  3SXY A;  4ZYG A;  2AXT C;  1ZLK A;  2X51 A;  3BCA A;  1QBJ A;  2FOW A;  2DMN A;  2DA1 A;  5JI6 A;  2EJR A;  1Y1V J;  1SD6 A;  4AVP A;  4C3I J;  3AKZ A;  2H1L A;  3Q0V A;  2R0Q C;  4E7H A;  1FTT A;  2W82 A;  4B43 A;  3L2C A;  1YOV B;  3G1M A;  2STW A;  2GA2 A;  2NVQ J;  1YX3 A;  3WTV C;  3CDL A;  1PP7 U;  3S16 J;  2KIQ A;  4AD9 A;  2LKS A;  4PGG A;  2VJ5 A;  1T0F C;  4XLH A;  4E7Z A;  1X1B A;  2XSJ C;  1V4R A;  3F9K A;  1RC9 A;  1FSE A;  3CC2 I;  4HQE A;  3GZ5 A;  1T6S A;  4ITV A;  3E1S A;  4TV7 A;  1ETW A;  5J8C A;  1SFU A;  1H8A C;  3LWF A;  4BE1 A;  2R7S A;  1ACI A;  1XG1 A;  3OYA A;  1GV5 A;  4OU0 A;  3CCL I;  1JJ8 C;  1OR7 A;  4ASN A;  3BJA A;  4FQG A;  4LIV A;  2DA4 A;  3R61 A;  5EGO B;  5J6X A;  3EPZ A;  2F48 A;  1RR7 A;  5E1W A;  3IH2 A;  2XF6 A;  4S04 A;  5CVJ A;  1K4S A;  4ZDL A;  4A3L J;  2BHY A;  1DU0 A;  3S1R J;  3SFI A;  2ZXW H;  1R7J A;  1EH7 A;  3LL7 A;  5BMZ A;  3AG1 H;  4ESB A;  3EUK L;  3L2R A;  4DIQ A;  3R0J A;  4KIB A;  1SAU A;  3IUO A;  3T8T A;  3CD6 I;  1O7F A;  5H20 A;  4CCM A;  2JA5 J;  2FBI A;  2JPB A;  3Q0W A;  2ME6 A;  4X1E A;  4P96 A;  3F8M A;  3CC4 I;  2ELJ A;  2IGN A;  3QU3 A;  4LK0 F;  4XK4 A;  3RSN A;  3SDG A;  2QQA A;  2HDC A;  1JKO C;  1H88 C;  1FPQ A;  3V4G A;  1Z9C A;  4EV0 A;  3G73 A;  3IV5 A;  3FK7 A;  3KE2 A;  3QAH A;  1G2H A;  1BI1 A;  4BU2 A;  2V1X A;  5TJJ A;  4D0P A;  1WH7 A;  4G8X A;  5DTD A;  4B48 A;  1JTY A;  2DA2 A;  3PL8 A;  4UUS B;  5LD2 C;  2JSP A;  1I6X A;  1GDT A;  4U87 A;  1NH3 A;  3ASN H;  3G1L A;  1STZ A;  1AWC A;  4I0B A;  3GFL A;  4JOM A;  4PGH A;  1U6G A;  2JSC A;  3MFK A;  4RB2 C;  1ZAO A;  1WI3 A;  3BR2 A;  2ETH A;  2HFH A;  3O6B B;  1SFK A;  1IDY A;  3DBL B;  2HPI A;  2XV4 S;  4UY8 I;  2LF7 A;  2BEO A;  1KU7 A;  2PJR B;  4MNU A;  3ZN1 A;  1MSF C;  3SZP A;  4LIT A;  2FBH A;  4EM1 A;  4L9T A;  4XRF A;  4OIN F;  5CVI A;  2PJP A;  2HDW A;  1IO2 A;  1KYW A;  2OAZ A;  2DYR H;  4C30 A;  2L54 A;  1WJA A;  5H6Q A;  2WA0 A;  1RR8 C;  2K40 A;  3CJT B;  5D8K B;  1EV7 A;  3KCC A;  5IOY A;  2BV6 A;  2EV6 A;  3PNV A;  4YII A;  1KU9 A;  3H0D A;  3L09 A;  5DUI A;  2ISY A;  4U88 A;  3W2W A;  2DLL A;  1I50 J;  3K1P A;  1A04 A;  4S05 A;  1I1S A;  3KET A;  5J4V A;  2P8T A;  1BW6 A;  2LBF B;  2X4H A;  3X2Q H;  3OYC A;  3TDU C;  1BM9 A;  5CVR A;  2VQL A;  5LRR A;  4UB8 C;  3PO2 J;  3LAJ A;  3B6C A;  1S3J A;  2R5Y A;  2XAH A;  5GPA A;  4FAS D;  4BYY A;  4DJA A;  4PJJ A;  4CCJ A;  2KPM A;  2OJE D;  1D5Y A;  1UG2 A;  1ON1 A;  1HF0 A;  2PX9 A;  2BOL A;  2XUB A;  2ZXI A;  1T98 A;  3NQO A;  5LBQ A;  3MKY B;  1ETV A;  2D45 A;  4BNC A;  2GWR A;  3U9G A;  2NVT J;  2ZNY A;  1YIO A;  3LFK A;  4A3G J;  5HOD A;  2HQN A;  3ULQ B;  5EEA A;  4XOP A;  3L1P A;  3HUG B;  2XAS A;  2CO5 A;  2IP2 A;  4B09 A;  2D1H A;  3PJR A;  4DYQ A;  1GT0 C;  1A35 A;  1I6H J;  5GAE J;  1MJ9 A;  5M5Y J;  4LFU A;  3DPT A;  2MD5 A;  3PM1 A;  2LR8 A;  3HTS B;  3ABT A;  2DFE A;  2H6B A;  2DAO A;  5FD5 A;  2EWN A;  3J81 Z;  3GBG A;  2I5U A;  3AAF A;  4JX6 A;  4WF2 A;  2X9D A;  1X1C A;  2RQQ A;  5DCM B;  5HNF A;  4EJT A;  4DOZ A;  2R7U A;  5LGN A;  1B59 A;  2PBI A;  4IX7 A;  2V4J C;  1I3A A;  4XOT A;  3CMM A;  3J81 K;  3H3Z A;  3I54 A;  3HIF A;  4KA4 A;  5J3L A;  2RRE A;  3FXL A;  3IKT A;  3LST A;  4C2U A;  2JVG A;  4XBF A;  2KZV A;  1W5T A;  3ZMV A;  5HLT A;  3VOE A;  2WWY A;  5F0F A;  3ABU A;  4AC0 A;  1O3T A;  2EFW A;  3UNG C;  2GM4 A;  1U2W A;  5ICG A;  3BCB A;  4BXU A;  4XKB A;  2P6S A;  4XKV A;  1B72 A;  2OD5 A;  2GZW A;  4AVZ A;  5IP6 A;  3F0C A;  1GXQ A;  2FQ3 A;  2O9L A;  1U0J A;  2CGP A;  3IAS 2;  4EQQ A;  3CP2 A;  4AIJ A;  5CJ9 A;  3MAJ A;  5D6F A;  1BJZ A;  2KRH A;  4MLO A;  5GTI C;  2Q2E A;  2DK8 A;  3K1N A;  3OYB A;  3ZP5 A;  3RTR A;  1CF7 B;  1YYV A;  4BDY A;  4RAG A;  3I4M J;  3FXO A;  3BR1 A;  3WU1 B;  5CVV A;  2EBI A;  2X48 A;  4ZC3 A;  2P5V A;  4M9X A;  2VKE A;  4HST A;  1RPW A;  2PN6 A;  2DFI A;  1PUF B;  5DEQ A;  4OIR F;  1IRX A;  1UG0 A;  2ZME C;  2HDD A;  4HF0 A;  2KIM A;  3DXJ F;  3JRC A;  1TNT A;  3T8R A;  3SZG A;  2HYG D;  3RPU A;  2W85 A;  1RUO A;  4EJW A;  1YJ9 I;  2X6W A;  4LD5 A;  3DBR B;  1LFP A;  2FNA A;  2DOD A;  5F6F A;  5FRM A;  3MKZ A;  5K5R A;  3QWL A;  2VPL A;  1HKQ A;  2PG4 A;  2M34 A;  4D5C A;  1BW5 A;  3WHB A;  3EDP A;  2ZJ2 A;  3CDH A;  3NRV A;  2DTZ A;  4E7K A;  3PO3 J;  1PJR A;  2IS6 A;  4IZZ A;  1AKH A;  1MMG A;  1QNT A;  1R5I D;  1UEL B;  3TW6 A;  4HDU A;  3GZN B;  3F72 A;  1TWA J;  3TED A;  4LLL A;  3E3V A;  3HZJ A;  2IAI A;  4PDK A;  3JRE A;  1S5L C;  4FHT A;  2ACJ A;  3BZ6 A;  3OS2 A;  1MMN A;  1ODD A;  3KYL A;  1OCO H;  2GOX B;  2V9P A;  3A1Y A;  5D4S A;  3F8F A;  5K1Y A;  3JRB A;  4DBQ A;  3ZMS A;  2CS3 A;  2OV7 A;  4FTH A;  2KIU A;  2R5Z A;  1D0Z A;  1LFU P;  3BR0 A;  3BQY A;  2QSG X;  4UB6 C;  2XVC A;  3E0J B;  5M3F J;  1FYM A;  3MVP A;  4CYD A;  2L4A A;  2L9N A;  5CPR B;  3GZ6 A;  3I4N J;  2OCC H;  2ADU A;  2HI3 A;  2ZFW A;  3DEE A;  2K86 A;  1MW7 A;  2DDA A;  2VBZ A;  3V42 A;  4NC6 A;  2GXA A;  4I76 A;  3RQI A;  4IKF A;  1TQM A;  1B4A A;  1U3E M;  5D5U B;  3D1N I;  2VKH A;  4M3D A;  2VUM J;  3CUQ A;  2NOG A;  2DA5 A;  5J1U A;  1ZR4 A;  1LQ1 A;  3KZI C;  4GXO A;  3F8C A;  4EJV A;  4D1Q A;  4IHT A;  3I64 A;  1HXD A;  2VE9 A;  3Q3S A;  3BG6 A;  2WAQ A;  3FXU A;  4JQF A;  4MHG A;  2NRA C;  3BR3 A;  2NVX J;  4HPQ A;  5DD8 A;  2DOF A;  1JGS A;  1K78 B;  2YU3 A;  2AS5 F;  4G7Z F;  4HV6 A;  4CGZ A;  1ULY A;  1FOK A;  2L7Z A;  1GXP A;  2DQL A;  3ZQ7 A;  4C2T A;  4DZJ A;  3I59 A;  2F5F A;  3S3N A;  3AL0 C;  1P9Q C;  2X6O A;  3C2B A;  3T5X A;  1AHD P;  2E35 A;  3LSJ A;  2A6H F;  2JZY A;  1D0X A;  1OKR A;  5FB2 A;  4A5N A;  1R36 A;  1BIA A;  2M5W A;  4OWR B;  2A61 A;  5FRN A;  1MKM A;  3QP6 A;  1QHH D;  3F23 A;  5K5O A;  4DW6 A;  3A01 B;  1HCR A;  1G3S A;  5ICC A;  2NYX A;  3LA7 A;  3MZ8 A;  3K70 C;  1JTX A;  2NS0 A;  3OSF A;  1Z6T A;  3KEQ A;  4DYC A;  2IS2 A;  1V5F A;  1O57 A;  3TOA A;  1PVE A;  4EM0 B;  4BQO A;  2ZJR F;  1SC7 A;  2HS5 A;  1VQL I;  1ZH5 A;  1RKT A;  3MKL A;  5HS9 A;  2ELH A;  4LB5 A;  4UVB A;  1WPK A;  3HTU A;  2LSO A;  3HB9 A;  5EGO A;  1FNN A;  2Y30 A;  2FQ4 A;  3K7A J;  4M6X A;  3WTZ A;  2K85 A;  4ZYD A;  3K70 D;  2A69 F;  2RN7 A;  2Q0O A;  2YPR A;  3KEO A;  3EUH C;  4N4N B;  3RZD J;  2KIS A;  2LKP A;  3WU0 A;  1Z05 A;  1D1B A;  2H8W A;  2FEZ A;  2LFB A;  2BHZ A;  1VQO I;  2KT0 A;  2VON A;  1OLT A;  1K61 A;  2Y31 A;  3PFY A;  3A4C A;  2X0L A;  4RMN A;  5HLG A;  5JVT A;  5FD6 A;  2CUF A;  4LLG F;  2R7T A;  1KYZ A;  4JYK A;  3KP6 A;  2HQR A;  5FFX A;  4NNJ A;  3RDI A;  2EIM H;  3WTY C;  2EV5 A;  4E7S A;  1LDD A;  1XS9 A;  4EJO A;  2VT3 A;  4M6V A;  1LNW A;  2HVQ A;  1VZ0 A;  2BXY A;  4UUS A;  5K7H A;  2NXN B;  1MBK A;  1XD7 A;  4G6Q A;  2XGX A;  2X1E A;  5L3C A;  4OIQ F;  4HBL A;  1SFO J;  4HX7 A;  4D7M A;  2RQP A;  2DN0 A;  5EYR A;  3OIQ A;  4YFX F;  1IRZ A;  3JRD A;  1GVJ A;  4BL0 B;  1FWZ A;  3U1K A;  3G4S I;  4MEX F;  1UB9 A;  3E6C C;  3BY6 A;  2HVS A;  3KLO A;  5EEH A;  3N4M A;  5ED4 A;  2LG4 A;  3I56 I;  2LVS A;  2DMP A;  3WE3 A;  3DKY A;  5FKN A;  4IHW A;  2ID6 A;  2IRF G;  4JP0 A;  4BKX A;  2RNJ A;  3LOC A;  2LRD A;  1APL C;  2NNY A;  1F43 A;  2VQC A;  2M0M A;  4JX5 A;  5HOO A;  3QRF F;  2JTV A;  3DEW A;  2JMW A;  3T1B A;  1RZ4 A;  2TRT A;  2XB5 A;  1QVT A;  3ABL H;  2CG4 A;  5LFA A;  3ZRG A;  4CH7 A;  3RIR A;  3QYE A;  2IXS A;  3BP8 A;  2EFP A;  4BEH B;  1WFX A;  2L7M P;  5KCM A;  2QUF A;  3M7G A;  5J47 A;  1W5S A;  4E4H A;  1T39 A;  1FOY A;  1HDP A;  2K02 A;  3GTM J;  1MJB A;  3J7Y J;  1JXS A;  4B3X A;  3J7A O;  2ZFU A;  3K4M A;  3R0A A;  3DTK A;  2K4B A;  2BY1 A;  4L5J A;  1VQ8 I;  2NVY J;  3LNQ A;  5E8G A;  1O3Q A;  4XON A;  5LEK A;  2GXB A;  3CCV I;  2IEK A;  2KQR A;  3GW2 A;  2HYF A;  4EMS A;  4JK1 X;  2HPM A;  5C4J J;  3TMO A;  2K9M A;  2EZI A;  2OZU A;  5FKM A;  5TGT A;  3L9F A;  5E79 C;  4I2O A;  3DWL E;  4AID A;  1MDM B;  1XTA A;  3OYK A;  1W0T A;  3MZY A;  1OPC A;  2KRC A;  2Z5U A;  3HUG A;  3ABM H;  3WTS C;  3F3X A;  3F21 A;  2ECB A;  2MLK A;  1E17 A;  2OU2 A;  4S0H B;  2E2I J;  3ISP A;  4CIC A;  1JE8 A;  5IPA A;  3HOY J;  1PYV A;  1QGP A;  2XPU A;  3GCM A;  1OR7 C;  2WB1 A;  3KP3 A;  3E6M A;  3DTI A;  3OR2 C;  2O5R A;  1TNS A;  1I39 A;  5E3M A;  2BW3 B;  4RAZ A;  3J80 Z;  2DMQ A;  2F2E A;  4WCG A;  1K79 A;  3BJ6 A;  3LFU A;  3TDZ C;  4OIP F;  5DCF A;  3A03 A;  1SMT A;  3G71 I;  1IC8 A;  2QSH X;  3DU6 A;  5F04 A;  4WK8 F;  3GTJ J;  1N77 A;  3P9C A;  2K9S A;  3FHN A;  2VJJ A;  3J80 K;  2GIV A;  3MN2 A;  1WJC A;  2VE8 A;  3ZMZ A;  3LSM A;  2W7N A;  2OTJ I;  2JT1 A;  5ICE A;  2VB6 A;  3HPG A;  4D5F A;  3LA3 A;  1A6I A;  1LKX A;  4HQM A;  4OOI A;  4Q4Z F;  5EG0 B;  2LOO A;  3CCY A;  2QBY B;  2EH3 A;  4P55 A;  3LSI A;  2ZC2 A;  4N9H A;  2J5P A;  2H27 A;  3M8F A;  4UNO A;  2LLK A;  3ZQQ A;  2QEN A;  1VF9 A;  2E60 A;  2IW5 A;  2MG4 A;  3OYE A;  5E3O A;  1BR1 A;  3BR6 A;  3FBN B;  5KVR A;  2VOP A;  2COM A;  4N9I A;  2M7B A;  1S7E A;  1R4M B;  1MSE C;  3CCE I;  4L0Z B;  3Q9V A;  1U9N A;  1CF7 A;  3ZR8 X;  3HDD A;  4GFB A;  3ZGK A;  1WCM J;  2M8G X;  2XAU A;  1QZE A;  3VPR A;  2JA8 J;  1HW1 A;  4HW0 A;  1D8J A;  1YS6 A;  2JWT A;  3OR1 C;  1VI0 A;  2L5Q A;  2X85 A;  2RAE A;  3G3Z A;  2IGK A;  4Q5S F;  5E1X A;  5A2Q Z;  4KMU X;  4EGY A;  3IH3 A;  4A3E J;  2KZG A;  3ML6 A;  1IXS B;  2V1D A;  3A2K A;  1YJW I;  2FRH A;  1OCC H;  1HKT A;  4RB0 A;  2VN2 A;  3HYI A;  1VQ4 I;  1X58 A;  3OIP A;  2ZME B;  1N78 A;  2A6T A;  5A2Q K;  4HYE A;  3HJE A;  4F55 A;  1BC8 C;  1JI8 A;  2LH9 A;  5FLX Z;  1YQA A;  4I02 A;  1I5Z A;  3ASO H;  3BOQ A;  1IN8 A;  3JRF A;  3A0H C;  2DMT A;  3S1Q J;  4RM2 A;  2VOD A;  4IF4 A;  3E5X A;  4H4K C;  4N4O B;  4AWX B;  1G4D A;  2M87 A;  3K4C A;  2E2H J;  5FLX K;  2GAU A;  2QVO A;  2DFH A;  3BZK A;  1HOM A;  4FT8 A;  1KON A;  1LEA A;  2M7A A;  1R1V A;  1TC3 C;  4U0V A;  4XR6 A;  2DPD A;  2R92 J;  5FKL A;  4L9V A;  4FE7 A;  1MH4 A;  3DEU A;  2R3S A;  2LKX A;  1WKM A;  4L5I A;  4CXF A;  2IA0 A;  4CYC B;  1TQP A;  3H3U A;  5H6R A;  2VQG A;  3AFH A;  1OYI A;  3D5L A;  2O6G E;  1FSH A;  3CMY A;  3PIP F;  3DCF A;  2CQX A;  2VXZ A;  1JKQ C;  1Y0U A;  1RRJ A;  2R7F A;  4HAM A;  2LD5 A;  4ENJ A;  1FY7 A;  1ETX A;  3AG2 H;  3V7R A;  3IAM 2;  4YG2 F;  4R79 A;  3PNT A;  2GXG A;  1NG7 A;  5KK1 A;  2PI0 A;  5IYB J;  4A2U A;  3K0L A;  2MC4 A;  2M4G A;  1ZAR A;  2VJ4 A;  3H35 A;  3F22 A;  4HX8 A;  1QPI A;  3JCU C;  4Y13 A;  2DMU A;  1LPQ A;  3DKW A;  1FX7 A;  3R4K A;  1VQM I;  5C44 J;  3HL2 A;  1IJW C;  2QYO A;  3OV8 A;  1WWX A;  4RAF A;  3B6A A;  2F4I A;  2Y0S N;  5IYC J;  3I4P A;  3HGG A;  2V9K A;  3F6O A;  3WOD F;  1W7P D;  3JTH A;  4PSW A;  4MTD A;  4AYB N;  1K78 A;  4LOC A;  1O3S A;  3M4O J;  1YG2 A;  4ZJZ A;  3CQZ J;  4UUV A;  4V19 K;  1FYK A;  2O3F A;  1BI0 A;  2STT A;  2HTJ A;  4Y3O A;  1BL0 A;  3LMM A;  3QPS A;  3VYS B;  4UUT A;  1EH8 A;  3HEF A;  1Z3X A;  3QP5 A;  2ZSI B;  5LEJ A;  2L7K A;  2K3P A;  3K4N A;  4FX0 A;  4BAC A;  3S3M A;  2BXZ A;  2JUC A;  2EFN A;  2TDX A;  1KQ9 A;  3O8H A;  4DGW B;  3AL0 B;  1MND A;  2PMZ A;  3VWB A;  5KNL A;  2AHQ A;  2HXO A;  1R5H A;  3CME I;  1RES A;  5LHG A;  3H0G J;  2RC4 A;  2MBF A;  4BDZ A;  2MC3 A;  1Q1V A;  4F92 B;  1K6O A;  1BIB A;  1IZ1 A;  1K6Y A;  1OJL A;  2A6E F;  3OL4 A;  3HBL A;  2X6X A;  3BDD A;  3CCJ I;  4K2E A;  5HDN A;  3SZT A;  5LHH A;  3FKI J;  3J7Z I;  2WAD A;  4ZDO A;  1TWH J;  4MIM A;  3VSK A;  3LQQ A;  1T0F A;  4E7J A;  5KAF C;  1QPM A;  2VOO A;  2QEX I;  2LMD A;  1NTC A;  2NOJ B;  3OYI A;  3WGH A;  2F5C A;  1YRN B;  3EYI A;  1HA8 A;  1SMY F;  1YIJ I;  3HRU A;  2H94 A;  4M71 A;  4AIH A;  1UMQ A;  1Y39 A;  3GUD A;  1D3Y A;  5K7F A;  2F4M B;  2W48 A;  1D1A A;  3LA2 A;  1REP C;  4G94 A;  2ME0 A;  1YX5 A;  5F1J A;  4YFN F;  3OYL A;  1YI2 I;  1FBS A;  1NHA A;  3WG9 A;  3WE2 A;  2K4J A;  2EFQ A;  1XGO A;  3M1E A;  3QU6 A;  1FMV A;  1HQC A;  2K3F A;  4KFC A;  1XDS A;  4RLQ A;  2KJB A;  4A0Z A;  1WHU A;  4Z6Y A;  1I1G A;  3NEU A;  1R1T A;  4XN0 A;  1YFH A;  1ZG5 A;  2HOE A;  5HS8 A;  5J1R A;  1K83 J;  1IUF A;  1N75 A;  1Z6R A;  3MEX A;  3H5N A;  1DUX C;  2PEX A;  1MJA A;  1IG7 A;  1OQY A;  1KGS A;  1V3F A;  2MA3 A;  1WVR A;  2P5K A;  4ENM A;  4BJ6 C;  2EIJ H;  4ZZD A;  4NQW B;  3JR9 A;  1DGW Y;  4C9Y A;  4CZC A;  2AO9 A;  2B7E A;  4ZDP A;  3HOX J;  2OTL I;  2G7H A;  4HNV A;  1LEB A;  1ONV A;  3BC8 A;  3IWF A;  1IV8 A;  5TIS C;  3BPV A;  1X3W B;  2L01 A;  2R93 J;  1ZEL A;  5FJ8 J;  3JRG A;  2MW8 A;  3I0T A;  2L3D A;  3S2W A;  4RS8 A;  2DA7 A;  1YLF A;  2HYJ A;  1QRY A;  2V6C A;  2MYS A;  3OIO A;  1YS7 A;  4L18 B;  3K4K A;  3QYB A;  2Z99 A;  1POG A;  1OCT C;  1Y8R B;  4QLC U;  1J5Y A;  4J19 A;  1LE8 A;  1G6N A;  4QPO A;  3KEY A;  3K4J A;  3H9Q A;  2QGU A;  3GEZ A;  2R7O A;  3K2A A;  3CCM I;  1H9T A;  5CLS A;  2FJ1 A;  1BR2 A;  2BVL A;  3PSI A;  2L2O A;  5IP7 J;  4F52 A;  3EQL F;  1D8K A;  2XRO A;  3ZQI A;  1ZGA A;  4MO7 A;  1W0U A;  5DD4 A;  3O3K A;  3PIO F;  4BGD A;  2FSW A;  3L2W A;  5J1Y A;  1HW2 A;  1FMW A;  1U5T A;  2IS1 A;  4RAY A;  3SEZ A;  4BEH A;  1KQ8 A;  2Z1D A;  2E1O A;  1S7O A;  2UWM A;  2FE3 A;  4G7H F;  4BAY A;  2HOS A;  3H36 A;  2G7U A;  4V2F A;  1G59 A;  2O0Y A;  4OMZ A;  3RPQ A;  3BTL A;  3MD2 A;  2Z9O A;  3PSF A;  1EJ9 A;  1XN7 A;  5HDG A;  2AXL A;  2GA1 A;  1ZGW A;  1E3O C;  4OAZ A;  2BYV E;  1D5V A;  4A69 C;  1W5C C;  2P81 A;  2DT7 B;  3GXO A;  4RGU A;  3CF5 F;  1K7A A;  5K5Q A;  4MQ9 F;  1ZKG A;  1DPU A;  2Y0M A;  2QWW A;  1YW7 A;  4ZYA A;  2PMH A;  1S9H A;  4XKC A;  3MWM A;  1IAW A;  2ZKZ A;  5ILV A;  2XPV A;  3H1C A;  1ETY A;  2XAJ A;  1R22 A;  3W6V A;  2EFO A;  3IWZ A;  1R71 A;  2HWV A;  3HHH A;  4HOB A;  3NWS A;  1E3H A;  1DP7 P;  2WAE A;  3QPH A;  3CZ6 A;  3KFW X;  3ZOB A;  1DPR A;  2IA1 A;  1OIS A;  4XLF A;  2RV8 A;  3FF5 A;  3OL3 A;  4E6K G;  3C1D A;  5IT9 Z;  4YEJ A;  2Y69 H;  4DNC A;  2JA7 J;  4HX4 A;  1WJE A;  2V1U A;  4UVC A;  2R7Q A;  4IHS A;  3ZPL A;  1MMS A;  3WTW C;  3I71 A;  3E6D A;  3QYF A;  5IT9 K;  3TOB A;  1RUN A;  2DYS H;  2F5V A;  4IPA A;  1UST A;  1JUM A;  2XF5 A;  1P7J A;  2L9S A;  3P7N A;  3BG7 A;  2DT6 A;  4BE2 A;  3K69 A;  1WJB A;  2IPQ X;  4BHP A;  1HW5 A;  3FIW A;  3EYY A;  4B3A A;  4QTR A;  1MH3 A;  4RA2 A;  1TT0 A;  1VQ9 I;  1EF4 A;  5EG0 A;  3KP2 A;  1VFC A;  3HKZ N;  3K6G A;  3ZQH A;  5HDK A;  2HNH A;  4UV9 A;  1G3T A;  3NAR A;  5JLW A;  2VJI A;  1UHS A;  2HQA A;  3BLY A;  2HOA A;  3OOP A;  1X3Z B;  2DBB A;  2E7X A;  1EA3 A;  1YIT I;  1NK2 P;  5HNH A;  2LF8 A;  2VLA A;  3OMY A;  1X1P A;  1KU3 A;  4XKW A;  3CJN A;  3DKX A;  1I3Q J;  2NVU B; 
#chains in the Genus database with same CATH homology
 3QPL A;  2NVY J;  3ZQG A;  3LNQ A;  1DU0 A;  3S1R J;  4A3L J;  3SFI A;  3JRH A;  3LSG A;  2IEK A;  2LK2 A;  1NK3 P;  5C4J J;  1TWF J;  3NAU A;  2EZI A;  5FKM A;  5C3E J;  4M3E A;  4W1U A;  2JA5 J;  2WV1 A;  3Q0W A;  2ME6 A;  4X1E A;  1W0T A;  2YUS A;  2XGD A;  3SDG A;  4XK4 A;  2ECB A;  4A3I J;  1JKO C;  1H88 C;  3IV5 A;  3FK7 A;  1G2H A;  5BNG A;  2FD5 A;  4S0H B;  2E2I J;  2Y2Z A;  3ZQF A;  3S15 J;  1ENH A;  5IPA A;  3HOY J;  1WH7 A;  2XPU A;  1B8I B;  3BG3 A;  2DA3 A;  5DTD A;  1JTY A;  2DA2 A;  4UUS B;  1ORK A;  4JX4 A;  1GDT A;  3JRI A;  3O8G A;  3G1L A;  5E3M A;  1JUS A;  4IHV A;  2DMQ A;  1Z77 A;  5GP9 A;  1WI3 A;  3A03 A;  3BR2 A;  1IC8 A;  1IGN A;  3M3Y J;  1IDY A;  5F04 A;  3GTJ J;  2DA6 A;  2K9S A;  1ITY A;  4BY1 J;  4XRS G;  4CYC A;  4A3M J;  3MN2 A;  1MSF C;  2QF7 A;  1QVU A;  1Z0X A;  4XID A;  2TCT A;  3IH4 A;  3HOZ J;  4IHX A;  4D5F A;  2K9Q A;  1A6I A;  2Y9Z A;  2K40 A;  2L7F P;  5EG0 B;  5IOY A;  1R9T J;  2KDZ A;  3CCY A;  1WH5 A;  2EH3 A;  2CQQ A;  2LLK A;  2MGQ A;  1VF9 A;  2MG4 A;  4XRM A;  5E3O A;  3BR6 A;  1I50 J;  2JK3 A;  2XSD C;  1BW6 A;  2XGE A;  2LY9 A;  2OF7 A;  2YU9 J;  1S7E A;  1MSE C;  4RDU A;  4FCY A;  1A5J A;  1U9N A;  1JT6 A;  3PO2 J;  3HDD A;  4GFB A;  3B6C A;  1WCM J;  2M8G X;  3HGY A;  5GPA A;  2R5Y A;  4BBS J;  3S2D J;  3VPR A;  2JA8 J;  5IYD J;  5FKK A;  1FJL A;  2JWT A;  1D5Y A;  2ZB9 A;  1UG2 A;  1U8B A;  1VI0 A;  1HF0 A;  2RAE A;  2GBY A;  4Y7N J;  4I6Z A;  3GTL J;  2QCO A;  1ETV A;  5F08 A;  3IH3 A;  1GV2 A;  2NVT J;  4A3E J;  4A3G J;  5HOD A;  3GTO J;  3E7L A;  1B72 B;  5EEA A;  3L1P A;  4DZP A;  1X58 A;  1OFC X;  2Y9Y A;  4B4C A;  3ZQC A;  4DYQ A;  1GT0 C;  2ECC A;  2LP0 A;  1X2N A;  1I6H J;  5M5Y J;  3JRF A;  3OSG A;  2DMT A;  3S1Q J;  3PM1 A;  2LR8 A;  3ZQL A;  5IP9 J;  2EZL A;  2WB1 N;  3BQZ A;  1GVD A;  3GBG A;  1WGX A;  2E2H J;  4JX6 A;  3BTC A;  1HOM A;  1FEX A;  2X9D A;  2GLO A;  2XGC A;  1TWC J;  4L5E A;  1TC3 C;  1GUU A;  1H89 C;  2R92 J;  5FKL A;  4FE7 A;  3S1N J;  3HOU J;  1ETQ A;  1MH4 A;  1HLV A;  2LKX A;  3GTQ J;  1TWG J;  1FIP A;  5J3L A;  2VI6 A;  4CYC B;  3GTP J;  1XC5 A;  2H1K A;  3TP0 A;  3G1O A;  5F0F A;  3CMY A;  2I10 A;  4AC0 A;  3DCF A;  1YRN A;  3QQA A;  2GM4 A;  2CQX A;  1JKQ C;  1AU7 A;  1ZQ3 P;  1B72 A;  2LD5 A;  1ETX A;  2DJN A;  2HXI A;  3TP3 A;  5IP6 A;  3F0C A;  2O9L A;  4G12 A;  1BA5 A;  5IYB J;  3S1M J;  4FIS A;  4A93 J;  1BJZ A;  2XPW A;  4MLO A;  1AKH B;  1QPI A;  2JJ7 A;  5EF6 A;  2DMU A;  2MSY A;  3I4M J;  2EQR A;  4IHY A;  2R5Y B;  3BR1 A;  1JUP A;  5C44 J;  1IJW C;  1MBJ A;  2EBI A;  2X48 A;  3B6A A;  4V2G A;  1P7I A;  2Y0S N;  5IYC J;  4A3F J;  3HGG A;  2D5V A;  3HM5 A;  3LSP A;  2CRG A;  2VKE A;  1RPW A;  4AYB N;  1MBG A;  4LOC A;  1PUF B;  3M4O J;  1IDZ A;  3CQZ J;  1O4X A;  2HDD A;  3WHC A;  3JRA A;  1BL0 A;  3QPS A;  4UUT A;  3JRC A;  3HEF A;  1JKP C;  4M3B A;  2O8K A;  3H3V K;  2ID3 A;  5C4X J;  2L9R A;  1JKR C;  3O8H A;  1MNM C;  3GTG J;  2M34 A;  4D5C A;  2AHQ A;  3WHB A;  2HXO A;  1BW5 A;  3PO3 J;  1RES A;  2DTZ A;  2YS9 A;  3H0G J;  4ABZ A;  5E3N A;  1AKH A;  1Q1V A;  3TW6 A;  1OJL A;  2JN6 A;  3HBL A;  4BY7 J;  5K7Z A;  1TWA J;  1LFB A;  3TED A;  4QIW N;  4NDL A;  3FKI J;  2IAI A;  4MFD A;  3JRE A;  1TWH J;  2E2J J;  2H8R A;  4MIM A;  5FLM J;  5EZG A;  1PUF A;  3JRB A;  1NTC A;  1YRN B;  5FLV A;  4FTH A;  2R5Z A;  4RBO A;  1LFU P;  3BR0 A;  3BQY A;  3BR5 A;  4A3J J;  5M3F J;  1IV6 A;  3BTI A;  1UMQ A;  3MVP A;  3Q0U A;  5F0C A;  5K7F A;  4EEF G;  2W48 A;  3I4N J;  5F1J A;  2ME0 A;  4C2M J;  2HI3 A;  2VKV A;  4A3D J;  4W97 A;  3BTJ A;  4Y52 J;  4QSH A;  5EDN A;  2L0K A;  4I76 A;  3RQI A;  1LE8 B;  1MBF A;  3BT9 A;  3D1N I;  2VUM J;  4M3D A;  2K9N A;  2NOG A;  2DA5 A;  5J1U A;  5J1R A;  1K83 J;  1ZR4 A;  1IUF A;  5F27 A;  1ZTR A;  3GTK J;  2LTP A;  2M9H A;  2CUE A;  2OPT A;  1IG7 A;  1FTZ A;  2O7O A;  3Q3S A;  4FE4 A;  4D7N A;  3BR3 A;  3JR9 A;  2NVX J;  3TW7 A;  2XRL A;  2AO9 A;  3S14 J;  3FK6 A;  3HOX J;  2CU7 A;  4HNV A;  5DS9 A;  3FIS A;  2IBD A;  3RKQ A;  5E3L A;  5M5W J;  4M3F A;  2HQ5 A;  2R93 J;  1JGG A;  2HOT A;  5EZH A;  3S2H J;  2L7Z A;  5FJ8 J;  3JRG A;  2MW8 A;  1JJ6 C;  1JT0 A;  2DA7 A;  1SAN A;  1CQT A;  4DZJ A;  5M3M J;  2HYJ A;  1QRY A;  3OIO A;  3C2B A;  2X6O A;  2CJJ A;  1POG A;  2NS7 A;  1AHD P;  1OCT C;  4AUX A;  4J19 A;  3LSJ A;  4X6A J;  1LE8 A;  3SJM A;  1DU6 A;  2FX0 A;  1T56 A;  1VND A;  2VPR A;  1F36 A;  4MFE A;  3RZO J;  2PMZ N;  3K2A A;  2COB A;  4DW6 A;  2FJ1 A;  3A01 B;  1HCR A;  2M2E A;  5IP7 J;  1JTX A;  4XIC A;  3ZQI A;  3OSF A;  4MO7 A;  1W0U A;  5FKO A;  2M0C A;  1ETO A;  4IEJ A;  4DYC A;  2N8G A;  1U78 A;  5J1Y A;  1RKT A;  3MKL A;  2NS8 A;  1WPK A;  2E1O A;  2R5Z B;  3HB9 A;  5EGO A;  2Y30 A;  5F0H A;  2FQ4 A;  3K7A J;  1U9O A;  4V2F A;  2HOS A;  3BTL A;  3RZD J;  1ZGW A;  4M3G A;  1ZR2 A;  1E3O C;  2JA6 J;  2R7Z J;  2LFB A;  4A69 C;  3BG9 A;  2P81 A;  1T33 A;  2KT0 A;  1RKW A;  1K61 A;  1ETK A;  2Y31 A;  4BBR J;  3BG5 A;  5IOZ A;  1ZKG A;  4A3K J;  1HDD C;  3A01 A;  3UKG A;  2E19 A;  5GPC A;  5M5X J;  2CUF A;  3OOU A;  2G0E A;  2B63 J;  4C3J J;  4JYK A;  2XPV A;  1ZK8 A;  1ETY A;  3W6V A;  4C3H J;  3HOV J;  1XS9 A;  3HOW J;  4M6V A;  2WAQ N;  4B1R A;  3ZOB A;  1B8I A;  4UUS A;  3A02 A;  5K7H A;  2EZH A;  4DYR A;  1MBK A;  5JLX A;  1SFO J;  2JA7 J;  1FIA A;  2EZK A;  4D7M A;  1X2M A;  2DN0 A;  5EYR A;  2XB0 X;  4A3C J;  4XRS A;  1IRZ A;  3JRD A;  2DMN A;  2DA1 A;  1JUM A;  1Y1V J;  1P7J A;  4C3I J;  2LVS A;  3Q0V A;  2R0Q C;  2DMP A;  1FTT A;  3FIW A;  5FKN A;  4IHW A;  2ID6 A;  4B3A A;  1MH3 A;  4QTR A;  4JP0 A;  3G1M A;  1Y1W J;  4BKX A;  1MBE A;  9ANT A;  3LOC A;  2ELK A;  1APL C;  2NVQ J;  1EF4 A;  5EG0 A;  3CDL A;  1F43 A;  3S16 J;  4JX5 A;  3DEW A;  2JMW A;  3HKZ N;  3ZQH A;  2TRT A;  1VFC A;  2XB5 A;  1QVT A;  5JLW A;  1RET A;  3NAR A;  1UHS A;  3S17 J;  4A3B J;  2HOA A;  4BXX J;  1ETW A;  1H8A C;  2L7M P;  1XG1 A;  3LSR A;  1GV5 A;  1JJ8 C;  1NK2 P;  1OCP A;  1MBH A;  2DA4 A;  5EGO B;  1HDP A;  3GTM J;  1RR7 A;  1I3Q J;  3IH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...