1DU0A

Engrailed homeodomain q50a variant dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
AFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFANKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*TP*AP*C
publication title Exploring the role of glutamine 50 in the homeodomain-DNA interface: crystal structure of engrailed (Gln50 --> ala) complex at 2.0 A.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 20
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1du0A00
5FJ8J 3RQIA 5DS9A 1X2MA 4MFEA 2R5ZA 5J1YA 4C3HJ 1LE8B 4I76A 1UMQA 2JMWA 1OCTC 3SJMA 4RBOA 2R5YA 3HB9A 1W0TA 1ZR2A 2M8GX 2O8KA 1MH4A 1JKRC 5IOZA 5IP7J 3S14J 1QVUA 1T33A 3IV5A 2XB5A 1VNDA 2CQQA 4JX4A 2DN0A 4DYQA 2WB1N 4C3JJ 2HOAA 4AC0A 2E19A 3CCYA 5EZGA 2JA7J 1RKTA 3A01A 3A02A 3S1MJ 3O8GA 3PO2J 5F0HA 3S1QJ 1P7IA 2LFBA 1FIAA 1IG7A 3H0GJ 4QSHA 2VUMJ 1LFBA 2OPTA 3MVPA 1HF0A 3FK7A 2OF7A 4MLOA 5IYBJ 4B3AA 1FTZA 1H8AC 1TWGJ 2L0KA 5FLMJ 2K9NA 2PMZN 3HGYA 2R0QC 5M5YJ 4JX6A 4A3GJ 1T56A 1ETWA 3BR1A 3IH3A 5DTDA 2E2HJ 3NAUA 5EZHA 1BJZA 4QIWN 1ETOA 5F1JA 1B72A 3HOUJ 2R5ZB 2FX0A 1WPKA 4DZJA 3CDLA 2EQRA 2R92J 2DMNA 3F0CA 3TEDA 2NS8A 4D5FA 2JA8J 3LNQA 4M3FA 3QPLA 1AHDP 3K2AA 2LY9A 3HDDA 5IYDJ 2COBA 2GLOA 3E7LA 1E3OC 1JTYA 1AKHB 2CUFA 1NTCA 2LP0A 2Y2ZA 2Y31A 3TW6A 4LOCA 1H89C 3A01B 3S2HJ 2DMPA 3Q0UA 1AU7A 4A3BJ 3JRBA 3WHCA 1K61A 2N8GA 3G1OA 5E3OA 3HKZN 1ETKA 2Y30A 1BA5A 4A93J 4A3JJ 1U9OA 1RKWA 2YUSA 3HM5A 5F0FA 2ECCA 2NS7A 1B72B 1POGA 3NARA 5C4JJ 3H3VK 4C2MJ 4IEJA 3HEFA 1HDPA 2XPUA 1IRZA 1GV5A 2D5VA 5J3LA 3UKGA 3BG9A 2YS9A 3G1LA 2HOSA 4XICA 1SFOJ 3LSGA 1F43A 2ID6A 4B4CA 5EDNA 4X6AJ 4XRSG 4BKXA 4ABZA 2G0EA 4UUSA 1QVTA 5F04A 2E2JJ 1FEXA 3S15J 3S17J 1I6HJ 2GM4A 3BG3A 4AYBN 1GVDA 2QCOA 4A3KJ 3QQAA 3MN2A 2VKEA 1QRYA 3TW7A 3GTGJ 2FQ4A 1U78A 1CQTA 1MSEC 4V2FA 1JUPA 2ME0A 3L1PA 1JUMA 3GTKJ 2Y9ZA 3HOVJ 4A3LJ 1OCPA 2E2IJ 1UG2A 3Q0VA 4JP0A 3C2BA 1K83J 1JJ6C 1I3QJ 4C3IJ 1BL0A 1MH3A 1B8IA 2ID3A 3BR6A 1VF9A 3BTIA 1ZGWA 1TWFJ 3PO3J 1TWHJ 2MW8A 1APLC 2X48A 9ANTA 4M3GA 4MO7A 5FKNA 5M3FJ 1Y1WJ 2E1OA 3O8HA 5K7FA 4M6VA 4BBRJ 4MFDA 2ZB9A 3I4MJ 3OSFA 4UUSB 4D7NA 1VI0A 5FKKA 5K7HA 2KDZA 1XS9A 4G12A 3JRAA 3SDGA 4V2GA 1JKQC 3BR3A 1MSFC 2CJJA 2AO9A 5M3MJ 2LD5A 2DMUA 3M4OJ 1X2NA 3Q3SA 3GTJJ 3FK6A 2R93J 4Y7NJ 2EZIA 2XGDA 1Z0XA 4DYRA 1EF4A 2XGCA 3CMYA 3S1RJ 1WCMJ 3BQZA 1F36A 1LFUP 1FIPA 1GDTA 5IOYA 4A69C 3LSRA 1SANA 3OIOA 2EZLA 1W0UA 2R5YB 3LSJA 4FCYA 4A3IJ 3BQYA 2RAEA 1B8IB 1ZKGA 2W48A 1PUFA 1I50J 5EG0A 2TRTA 3GBGA 1DU6A 2XSDC 1Y1VJ 3HOZJ 3IH4A 3JRFA 4FTHA 1R9TJ 3JR9A 3LOCA 1MBHA 1IGNA 4FISA 2P81A 3BR0A 2AHQA 3MKLA 1DU0A 2LLKA 2ECBA 5EGOA 2XPWA 4D5CA 2ME6A 3OSGA 3BTJA 3TP0A 5J1RA 5IP6A 1RR7A 2X9DA 5M5XJ 5M5WJ 4XK4A 2K9SA 4DZPA 2MG4A 2FJ1A 3LSPA 2EZKA 2JA6J 1GUUA 1Q1VA 2K40A 2K9QA 5C4XJ 4L5EA 2JK3A 4XRMA 1ZTRA 4FE7A 2HXIA 1JUSA 1ETYA 3BTLA 3OOUA 5HODA 3BR5A 4FE4A 5C44J 1ITYA 1ETVA 4IHVA 1IDZA 2VKVA 4W97A 1IV6A 1WGXA 4JX5A 2EH3A 2HI3A 1PUFB 5EG0B 2DA1A 1A6IA 2GBYA 4CYCA 4UUTA 3I4NJ 4XIDA 1HOMA 1UHSA 1JT0A 1GT0C 2MGQA 1RESA 3ZQIA 2H1KA 1HLVA 3IH2A 3GTMJ 1IJWC 2DA7A 5EGOB 3G1MA 2VI6A 4D7MA 2LTPA 4XRSA 2YU9J 5BNGA 2CUEA 1MBEA 2NOGA 2CQXA 1MBJA 3JRGA 5IPAA 1IC8A 3HOXJ 1Z77A 2LKXA 5F27A 2L7MP 3M3YJ 5GP9A 1WH5A 2B63J 2JWTA 1XC5A 1FJLA 4HNVA 1ORKA 4A3DJ 1NK3P 2R7ZJ 2NVTJ 5C3EJ 2ELKA 2L9RA 2VPRA 1P7JA 2HOTA 5EYRA 2IAIA 3ZQGA 3D1NI 2Y0SN 4CYCB 3SFIA 2XRLA 4DW6A 2DMTA 2Y9YA 1XG1A 5FKOA 2MSYA 4A3FJ 2JJ7A 2WAQN 3ZOBA 3W6VA 3S2DJ 5IYCJ 1JKPC 3RZDJ 1IUFA 1GV2A 4JYKA 2CU7A 2HDDA 1AKHA 2M9HA 1WH7A 2M34A 4M3DA 4M3EA 2DA6A 1U8BA 2HQ5A 4BY7J 5EEAA 3GTOJ 5E3NA 2JN6A 5FKMA 1FTTA 1NK2P 1ZK8A 1JKOC 5JLWA 2XPVA 1OJLA 1RETA 3JRDA 3VPRA 3BG5A 1ZR4A 1WI3A 3B6AA 2IBDA 4EEFG 2HXOA 3Q0WA 4B1RA 1YRNA 4AUXA 2DTZA 2DA5A 2HYJA 1ENHA 2M2EA 5FKLA 4GFBA 1OFCX 2O9LA 3FISA 3HOYJ 1JTXA 3QPSA 2I10A 2FD5A 3HBLA 1A5JA 1O4XA 2XGEA 2KT0A 3WHBA 2LK2A 4NDLA 3K7AJ 2XB0X 4IHXA 3GTPJ 4I6ZA 1IDYA 2EZHA 5GPAA 1MBGA 3JREA 2NVQJ 1BW6A 1RPWA 1U9NA 5E3LA 3JRCA 1H88C 2JA5J 3RZOJ 4Y52J 2LR8A 4M3BA 1JJ8C 1G2HA 2DJNA 2IEKA 2DA2A 3ZQFA 5IP9J 1ETXA 1MBKA 2DA4A 5EF6A 1S7EA 3HGGA 1JT6A 3GTLJ 3ZQLA 1MNMC 3JRIA 2L7ZA 4RDUA 1QPIA 3A03A 3B6CA 2TCTA 3GTQJ 4BY1J 4IHWA 3JRHA 2DA3A 4DYCA 1LE8A 4IHYA 1X58A 2DMQA 1YRNB 4W1UA 4J19A 1BW5A 4A3MJ 1TWAJ 4BBSJ 5K7ZA 2X6OA 2NVYJ 4MIMA 2CRGA 3TP3A 4BXXJ 2O7OA 3ZQHA 3PM1A 2LVSA 5E3MA 1JGGA 1D5YA 1HCRA 1ZQ3P 5FLVA 3HOWJ 4A3EJ 3FIWA 2L7FP 5GPCA 2NVXJ 3ZQCA 3DEWA 1TWCJ 3DCFA 3S16J 2WV1A 3RKQA 1TC3C 2M0CA 4S0HB 3S1NJ 2H8RA 3BT9A 4QTRA 1MBFA 5J1UA 1ETQA 2QF7A 3BR2A 5JLXA 2EBIA 3CQZJ 5F08A 5F0CA 3FKIJ 4A3CJ 4X1EA 1VFCA 1HDDC 3BTCA
chains in the Genus database with same CATH superfamily
2RNGA 5FJ8J 1ZG1A 3ASNH 3H35A 4OIPF 1LE8B 3J81Z 1FZPB 2MC4A 1UMQA 2VL8A 3SJMA 4WX9A 3OS0A 3P7NA 5HDNA 2IW5A 4HDVA 2VOOA 2JSPA 2IS6A 4HNTA 1JKRC 3HKZA 2X4HA 4BHBA 1FPQA 5IOZA 2R7OA 5IP7J 1KU2A 1T33A 2NOJB 4UNOA 3BG7A 2R7XA 1H0MA 5CPRB 1MJBA 1GXQA 3J81K 4C3JJ 2E19A 2V26A 5EZGA 4LB5A 4U0VA 3A02A 4CH7A 1JI8A 2FOWA 3OWTA 3OY9A 3PO2J 1XMKA 4KN4X 5F0HA 3DU5A 3AG1H 3H0GJ 3M8JA 4IHTA 4CXFA 3RDIA 2W82A 3MAJA 3MVPA 1HF0A 3SZPA 4EJTA 2OF7A 5IYBJ 5LGUA 3ELKA 1FTZA 1H8AC 1VQ8I 1I5ZA 4TV7A 3IHUA 5FLMJ 2XAUA 3F6VA 2R7RA 4A3GJ 1ETWA 2LH9A 2K4BA 2E2HJ 1XTAA 3NAUA 4HYEA 1ON2A 2MH9A 4XNFA 2P5VA 5F1JA 1B72A 1W36D 2YPRA 5DM7F 3V42A 5LFAA 2VE8A 2EV6A 2JSCA 3CCRI 2RN7A 1OISA 1TLHB 3L7WA 2VBWA 3PSIA 4DZJA 1BC8C 1KGSA 2KKOA 5D6FA 4J01A 2PMHA 4F92B 2NNYA 3F22A 3R0JA 3PFYA 3I54A 3QPLA 3RPUD 3J7YJ 4YIIA 2FBHA 2GLOA 2E35A 2J5OA 3KP7A 4UV9A 3QPTA 4OMYA 2XRNA 3OV8A 1M1EB 2CUFA 4A2UA 1NTCA 2EFWA 1XN7A 5LEKA 2AS5F 1G3TA 3A01B 2DMPA 2O8XA 4DOZA 4RB3C 3JRBA 1K61A 4B48A 1B9NA 3K4KA 2BOLA 4EJVA 5GAHJ 3SDBA 3WTYC 1P92A 4IXAA 1QHGA 3H3UA 1YW7A 2DPDA 5EEHA 5E3OA 2ELHA 3U1KA 4G6DA 1TQIA 1XB4A 3VWBA 1Z3XA 4HEA2 3F72A 4IRIA 1RKWA 1UJ8A 2L01A 1V4RA 4BS9A 3OS2A 1JE8A 1KA8A 3FXMA 1KQ0A 5H2FC 5C4JJ 1Y0UA 2WY8Q 2V7FA 3HEFA 1HDPA 5B1AH 2VT3A 4LG0A 1IRZA 2KLOA 4NC7A 1QZYA 5J3LA 4A6EA 3UKGA 2A5WA 2Z33A 3LWFA 5HS7A 1SFOJ 2LF7A 1MMDA 2VC0A 2E1MC 4X6AJ 4XRSG 1Y56A 2G0EA 4UUSA 4LMYA 3CJQB 1I6HJ 4E7KA 1GVDA 3OYAA 4IO9F 3RPUA 2R7VA 1H9GA 1FSEA 4A3KJ 2ZMEA 5LBQA 1WHUA 3QQAA 5BQTA 2VXZA 2XV4S 2VKEA 3MN2A 1QRYA 3DKXA 5DEQA 1CQTA 3IKTA 1IN7A 2NYXA 4BEHB 2Y9ZA 2KL4A 2GOXB 2E2IJ 3F8NA 1UG2A 1R71A 5FD5A 5A2QZ 2V9PA 3F6OA 4C3IJ 1U2WA 3BPVA 4CCKA 1G3YA 5CVVA 2R7WA 1BL0A 2LNBA 4UY8I 2O5RA 2QYOA 5J8FA 2CSOA 1TT5B 3LSTA 1Z7UA 3KLNA 4UVCA 2XF5A 2MW8A 3T0YA 5B66C 1MDMB 3RTRA 1J5YA 3TO7A 1R36A 4M3GA 1YOVB 4MO7A 3LSKA 5A2QK 4Y17A 3O8HA 2BY2A 1YX5A 5DD8A 4FT8A 4M6VA 5E20A 4CZCA 1DPUA 2EIMH 1WJDA 3GEZA 4MFDA 3R4KA 2ZB9A 2ZFUA 3R6SA 3ZPLA 5JVTA 3BC8A 4M9XA 4D7NA 2KDZA 2JA2A 2XKPA 4G12A 3G3ZA 3K4JA 4IQJA 3E6MA 2X6XA 3NQOA 3A2KA 3C2HA 1F4KA 4V2GA 1EJ9A 2RQQA 4AVZA 1WQ2A 2DFEA 3LSIA 5M3MJ 1FOYA 1X2NA 4R1HA 4ZYHA 3FK6A 4N4OB 1UHWA 2XGDA 4MQ9F 2HQNA 3RPQA 2DFFA 2DBBA 3FF5A 1R5ID 2XGCA 4D0PA 4R8HA 3CMYA 4OMZA 5HLTA 1WCMJ 1GDTA 1F36A 1LFUP 1FIPA 2YX7A 1EH6A 5IOYA 3I0TA 1SANA 2D1HA 2DT7B 3EUHC 1V5GA 1HW1A 3KFWX 1LB2A 3HZJA 2PJPA 5JFRA 3JTHA 3LSJA 3DPTA 1XMXA 2GIZA 2KFDA 1PUFA 3F9KA 2TRTA 3GBGA 4RAGA 4FTHA 4Q48A 1ZYRF 2H1LA 2QSGX 1MBHA 1TT0A 2ZXHA 3M8FA 4IOAF 1DDNA 2DOEA 4EM1A 3X2QH 2UUZA 4ZDLA 4F91B 5EGOA 1VQ4I 5GTIC 4D5CA 2X6WA 4G94A 4B09A 3OSGA 5E1XA 3ZMVA 5M5XJ 2VKHA 5HLHA 2G9WA 1BJAA 5IY5H 1Z91A 1Q1VA 2XIGA 2K9QA 3ESWB 1N25A 3I53A 2JK3A 3C18A 3KZYA 1XD7A 2QQ9A 2JUCA 2ZXIA 2FXAA 3BTLA 2KP6A 2KRFA 3V8LA 4S05A 4N9IA 1DGWY 4YFXF 3CESA 4IHVA 4Y13A 2Z2SB 3VDXA 1O3QA 4NUBA 1IV6A 4JX5A 4ITVA 2EH3A 2F5CA 5EG0B 3E6DA 2GAUA 4PJ0C 4U88A 3I4NJ 1R1VA 2KHMA 1O7LA 1QNTA 1HOMA 2DOFA 1A35A 2OCCH 1RESA 5L3DA 1G6NA 3ZQIA 3FXKA 4FHTA 3IH2A 3K4MA 3L2WA 2HVRA 2FMYA 2XSJC 1YG2A 5DD4A 1JHHA 1V55H 2HYFA 2FBIA 3FDYA 3ABUA 4E6KG 2LTPA 4XRSA 2YU9J 5BNGA 2V1UA 4OU0A 2NOGA 2CQXA 1QBJA 1SFEA 3QODA 1MBJA 2P7VB 5IPAA 2IA0A 3OYIA 2IGKA 2JRTA 1T0FC 4M73A 3HOXJ 1IAWA 1Y39A 1QA6A 1P6RA 3ECHA 1Z77A 2L4AA 2UZKA 5KAFC 2O03A 3S8PA 1LNWA 3FXOA 2FE3A 2NVUB 4F3QA 4XQFA 2CS3A 1DGRM 2P5KA 3ZMDA 1EV7A 1FJLA 3HPGA 4A3DJ 1W5TA 1FNNA 3K4CA 1MIJA 2ELKA 4XONA 2L9RA 1WZ2A 1WWXA 3QWLA 4OAYA 2E36A 2F4IA 3RIRA 1T2KA 2PEXA 2Y0SN 4I0BA 2KQRA 4PJJA 5BPDA 3GFJA 4HAMA 2DMTA 1BIBA 3DKYA 3PNTA 3WG9A 2MSYA 4A3FJ 4CCLA 1X19A 1D1BA 2JJ7A 2WAQN 3KP2A 1YJNI 4L18B 2RVCA 3ABTA 1YQAA 1JKPC 4JYKA 4KICA 1NG7A 2W57A 4EMSA 2PMUA 4M3DA 2L7KA 4FX0A 3O6BB 3TOBA 2MH2A 4PSXA 2GIVA 3GTOJ 5FKMA 1FTTA 1NK2P 2CUJA 4WF2A 1IF1A 3J7ZI 3JRDA 1USTA 1ZH5A 1U5TB 2B7EA 3TO9A 1IRFA 2ZSHB 3Q0WA 4B1RA 4AIKA 3FMSA 4QWQA 1YRNA 3PSFA 2HPIA 1IRXA 4AUXA 2HVSA 2QZ8A 3ABLH 1QPMA 2DA5A 1SD4A 3WODF 1W1WE 2ZFWA 1T95A 1WJBA 4YEJA 4GFBA 1FLIA 2NRAC 2XAJA 3FISA 3FZVA 1XSDA 3J7AY 4HPQA 2FA5A 2KRHA 3QPSA 2I10A 2FD5A 1S72I 2KT0A 3WHBA 2LK2A 5LHIA 4A0YA 4IHXA 3J7AO 3KEYA 1OYYA 1HC8A 3Q9SA 3JREA 3GYHX 5E3LA 2JA5J 4OIQF 4M3BA 3PQKA 3BCBA 3FXRA 4YIRX 1UFMA 5IP9J 1ETXA 4ENMA 1BI2A 4BJ6C 1I3AA 2XDVA 3ABMH 1HBXG 4P55A 1N75A 2R7TA 4RDUA 1FYKA 3T8TA 3BLYA 1QPIA 4RB0A 3F21A 5FFXA 4RAFA 3ZMTA 1SAUA 2NS0A 4BY1J 3FXQA 3E97A 1WKMA 1ERDA 3L2CA 2LOOA 5D4SA 2XUBA 2ZXWH 1V5EA 1YS7A 5K1YA 1BW5A 4A3MJ 5DUIA 1MW7A 3ZQQA 4XKBA 2CRGA 3TP3A 5D5XB 4HX8A 2A3SA 3P9CA 3CCJI 2W24A 3O2PE 3EETA 3GFLA 5FLVA 2QKLB 2PI0A 1YJWI 5DYMA 5KHDA 2L7FP 3IC7A 2NVXJ 4NQWA 2D1VA 1TC3C 3LL7A 3FHZA 4RM2A 2M0CA 4S0HB 1DPRA 3E5UA 2XC7A 4WCGA 3BT9A 3V8JA 4C2UA 3GLXA 3GLLA 2PN6A 1S7OA 3A1YA 3L9FA 3GZ6A 3CQZJ 5HLGA 4LLNA 1R1UA 1RUNA 1Y6IA 2ZJRF 4BGDA 1VQMI 3BY6A 1XCBA 2ZCWA 2CV0A 4IHSA 1S29A 3RQIA 4U0WA 2V1XA 4L9NA 4OWRB 4B3XA 1FOXA 2R5ZA 4PFOA 4MHGA 4RA2A 5LHHA 3TDUC 4BYYA 3K70C 1R1TA 2R5YA 1MJAA 1V3FA 1W0TA 1VQPI 1ZR2A 2M8GX 3DPUA 1LVAA 1MZBA 3H9JA 4WWCA 2O8KA 3E5XA 1KYZA 3W6JB 4L9VA 2VBXA 4IQ4A 2XB5A 3V7CA 1VNDA 1SMTA 3G71I 4HX7A 2B0LA 4DYQA 4E7JA 2HOAA 3EUHA 3CCYA 4A5NA 1RKTA 3HTSB 2FOKA 3LA3A 1FP1D 4GRIA 1YLFA 4KA4A 1P7IA 2LFBA 2RGVA 3GZ5A 1FIAA 2VUMJ 4E7HA 2EIKH 1STZA 1L3LA 3M1CA 1IXRC 1YTYA 4ON0A 4MLOA 3U9GA 3WGHA 1EKEA 2CO5A 2K9NA 2PMZN 3D0SA 3KP6A 4XM3A 2R0QC 4ZTJA 4IOCF 5DTDA 2HTJA 3BR1A 2MBFA 1SD6A 1BJZA 2IGNA 2KMUA 2Q1ZB 2OZ6A 3QAHA 3JSPA 2M3AA 2TDXA 3SZGA 1R5HA 4CGZA 3NRVA 3HYIA 3VYUB 3OYGA 1SEUA 3HRMA 3FXUA 2CFOA 4B47A 4CCOA 2K3PA 4CZZA 3RKXA 2B9SA 3GWZA 4O5VA 4GYIA 2UWMA 3K2AA 1UZCA 3HDDA 3E7LA 4F55A 2VIXA 3J80Z 2AQEA 4PCQA 2LP0A 2Y2ZA 4G7OF 3F23A 3W3CA 3S2HJ 3KPHA 3OYFA 1LVKA 5JHFA 2XROA 2JRMA 2N8GA 2QM3A 4Z6YA 1F1ZA 3D5LA 3OYCA 1D8KA 3HKZN 3W2VA 2HQAA 3BJAA 4KN7X 3V8KA 1D1CA 3DEEA 1R7JA 1U8RA 3J80K 1E3PA 3S3MA 2FMLA 4A93J 3Q5FA 1U9OA 2Q0OA 1USSA 2QEXI 2A6TA 4KYWA 1TW2A 2PFBA 2OBPA 2HQRA 4EM2A 1B72B 2LDUA 3PIPF 2IS2A 1BN5A 4IEJA 1I1GA 5FRMA 4UVBA 1LDKB 4XSZF 2XPUA 3KP4A 2D5VA 1T0FA 2YS9A 1IO2A 1BI0A 1GLNA 1FOWA 4BKXA 2DFIA 4PGGA 1FP2A 3EUKL 1QVTA 2E2JJ 1FEXA 2QQ8A 4HV6A 3S15J 3IAM2 2P6SA 4NB5A 1E3HA 3RYRA 1RC9A 3KX2A 3PNVA 5DCFA 3OL4A 1T98A 1B4AA 3PUBA 4YG2F 3BDDA 1MNEA 1OLTA 2DXIA 4OOIA 1U78A 1JUPA 4ZTFA 3F8FA 4QLCU 5ICCA 2WC2A 3DBHB 4JP0A 4MEYF 5BMZA 2QBYA 4N4NB 1LKXA 1K83J 1H9TA 2VOPA 3CCLI 1I3QJ 1R23A 4UB8C 5FGMA 5ILSA 3WE2A 3DTEA 4ZYDA 1B8IA 4M9ZA 2IT0A 1DP7P 2X1CA 1VQ6I 3PIOF 1ZGWA 1TWFJ 4P9UA 3ZMUA 1YITI 1MMNA 2OD5A 2F5VA 1APLC 2Y75A 9ANTA 3I55I 2DTRA 2LMDA 2FQ3A 5DUKA 5M3FJ 1Y1WJ 1FOKA 2E1OA 3QOPA 2CGPA 2XAGA 5K7FA 4ZC3A 4B44A 4KIBA 3SEQA 3I4MJ 1D0ZA 4UUSB 5K7HA 2Y0MA 1IN6A 1IW7F 2A6EF 2GXBA 2W4SA 3SDGA 2MYSA 3BR3A 2H6CA 2CJJA 1GHCA 4BU2A 1MJ9A 2AO9A 2WAEA 2ZMEB 5HS8A 1GVJA 4C30A 3Q3SA 2RKHA 4L9TA 2MA3A 2DYSH 3HSRA 5CLSA 4DNCA 4LLGF 5LGTA 1X1BA 1EF4A 3S1RJ 3PFIA 4A69C 1LDDA 3LSRA 4IZZA 1Z9CA 4Y3OA 1HA8A 4LK0F 2VQLA 4KMUX 2VBZA 3WTSC 1W0UA 4FCYA 4O3MA 4D9JA 4LK1F 1B1BA 3AKZA 4EGZA 3OIPA 4IKFA 2VE9A 2KIMA 3HOZJ 1SC7A 3MCZA 1EH8A 3V7SA 4AIHA 3JR9A 5CVJA 2LRDA 5KVRA 2P81A 3K70D 1DU0A 2EB7A 1RI7A 2KZGA 2ECBA 4ZJZA 3W2WA 4PUSA 2R3SA 3QU6A 5K5OA 2OU2A 5DCMA 3BTJA 2K9MA 5J1RA 4XK4A 5HDKA 2OA4A 4CUGA 2CW0F 3U1DA 1YIOA 2FJ1A 3PUFA 3LSPA 2EZKA 2MD0A 2HPMA 5L3GA 5C4XJ 4KUMA 4U87A 4P96A 4NNJA 2M30A 2IA2A 4CO8A 2EWNA 4CICA 3SZTA 1JUSA 1ETYA 2DYRH 3OOUA 5HODA 3BR5A 3WTZA 2EFNA 2LC2A 4HNUA 1X4OA 1TL8A 4RMNA 1ETVA 3VYTB 1IDZA 2DLLA 2IPQX 2A07F 2Z16A 2IVMA 2MABA 2OAZA 2L5QA 1WGXA 1Z6RA 3CJRB 2HI3A 1PUFB 3OYNA 1A6IA 2M8EA 2MFZA 4CYCA 3ERED 4IX7A 5B1BH 2HTSA 3CZ6A 3AL0C 1UHSA 2MGQA 3BOQA 1C0WA 3RYPA 3CUOA 3AAFA 2H1KA 1HLVA 2DA7A 4ZYGA 1RZ4A 5IT3A 1MMAA 5EGOB 3U2RA 2AXLA 2DW4A 2VI6A 4D7MA 2OTLI 3VSKA 1X1CA 3ULQB 2JQ7A 2CMPA 3CF5F 2STWA 1VTNC 1EH7A 1ZRFA 3COAC 5E17F 1R4NB 1I1SA 4YFNF 4PSWA 1B6AA 2XF7A 3PL8A 2LKXA 3TGNA 3HOSA 2QKMB 3GW2A 2BY0A 1BOAA 1AOYA 1KONA 3E6CC 4BXFA 1WH5A 3TOAA 2B63J 1PP7U 3GXOA 5JHUA 4B43A 3R0AA 3OYBA 2R4GA 3DQVC 4M71A 1TP4A 2XAQA 2XVCA 4LB6B 1HXDA 4GCVA 3TKYA 4JOMA 3FXJA 5J4VA 4HRIA 3RCOA 2GXAA 1VQ9I 2HOTA 4XLFA 2VJ5A 2IP2A 3ZQGA 2DT5A 5D5WB 3SFZA 2XKOA 1UELB 2XRLA 2IS4A 3K2ZA 4DW6A 2Y9YA 5FKOA 1XG1A 4HF2A 3E5QA 1Y8QB 5IYCJ 1A04A 2CU7A 2M9HA 1VQNI 2WV0A 2DJIA 1G3SA 2E7WA 2ZSIB 3CCVI 3CD6I 1B59A 2DQLA 3IWZA 4BY7J 5EEAA 3CCSI 1ZELA 1ZARA 2BE5F 1ZK8A 1R58A 2F5DA 2UXNA 2XPVA 3CUQC 3HSEA 3Q9VA 5EJCA 5JLWA 3CO7C 1PUEE 1U0JA 1OJLA 3VPRA 1KU9A 3BG5A 1WI3A 1OKRA 2P0WA 2IJLA 1FBUA 3F8MA 1P2FA 4KFCA 2K27A 3K9TA 1YHQI 1SD7A 2DTZA 4KDPA 3G4SI 2K4JA 1XX5A 5AONA 4E4HA 4BE1A 2OJED 1OFCX 2F6CA 1X1AA 4KT6A 2X6YA 4BQAA 4I09A 3WGIA 5JVGF 5CJ9A 4XLHA 4PJNA 2P5LC 4NDLA 2XB0X 3GTPJ 2KIQA 2XF6A 4I6ZA 1WFXA 2LSOA 2KRCA 2EZHA 3RKWA 1MBGA 3DF8A 2NVQJ 4Y52J 1ZG3A 1H88C 3RZOJ 2VBYA 1PYVA 1HQCA 3CTAA 5CVUA 1DUXC 2EJRA 3D5SC 3SEZA 3DTKA 3LMMA 3TO6A 4WXHA 2VPLA 1QZEA 4BHCA 3M1EA 1JT6A 3H1CA 3GTLJ 5ICFA 3ZQLA 2W00A 1J7KA 2VONA 5CQGA 2EPFA 3W2AA 5KK1A 1YS6A 5LRRA 1XSVA 2WBMA 4DYCA 2DMQA 3S2WA 1YRNB 4W1UA 5DDGA 4J19A 1K6OA 4XL9A 4Q4ZF 2X6OA 5LEJA 5HVQC 2GA1A 2NVYJ 5TISC 1QQIA 4MIMA 5E1WA 4CHUA 2ISZA 3C3WA 5ED4A 4BXXJ 2QGUA 2GOMA 3K4LA 2VASA 1WRJA 1HCRA 3BJ6A 3K4NA 1OQYA 2P8TA 5ICEA 4LIVA 1NH3A 4YFKF 3I5UA 3DCFA 1AWCA 1TQMA 3AG2H 3MKWB 1Z05A 4UXNA 3VYRB 1OCCH 5GTHC 3S1NJ 5LGNA 2PLYA 2FUG2 2ISYA 2H8RA 1RIOH 4QTRA 1XSXA 1MBFA 1UCRA 5J1UA 1ETQA 1OCZH 3S3NA 4G7ZF 1P4WA 1SAXA 2EINH 2MLGA 4Q5SF 2HWVA 3IWFA 4I0AA 4X1EA 4EJWA 1HKSA 4RGRA 4ETSA 4XOTA 1HDDC 3TL4X 3CC4I 4C2TA 2ZKZA 2OV7A 4HOBA 3GMEA 4MFEA 2FU4A 5J1YA 4M6XA 2O6GE 2PJRA 1X1DA 4DBRA 4MTDA 4I76A 2JMWA 1K78A 1OCTC 1F5TA 2W84A 4RBOA 3EYIA 3HB9A 2R7DA 2VJJA 4NC6A 3HJEA 4HSRA 4RLQA 1KU3A 4LGWA 3IV5A 3S14J 1A36A 4ZDPA 4CCJA 2Y69H 1FC3A 3ABKH 2QQAA 3U21A 2DN0A 2ACJA 1GXPA 1Z1DA 4NQWB 2WB1N 4AC0A 2A61A 2JA7J 3GUDA 2EA2A 2F48A 3ZMSA 1FY7A 3S1MJ 3ZP5A 3QU3A 3O8GA 4BJ5C 5D5UB 3N05A 2VQCA 3ROUA 4XORA 1LFBA 3M9AA 1X3ZB 2WADA 1J59A 3RJPA 2OPTA 3QP5A 5D8LB 1I39A 2EFQA 3BG6A 1XMAA 4V19K 1IN8A 3HGYA 4N9HA 2A69F 3IH3A 5EZHA 2L2OA 4G7HF 2Q2EA 4I2OA 4AYBA 1LJ9A 2NAZA 4LITA 1ETOA 3GCMA 3P9KA 4QIWN 3HOUJ 2R5ZB 1ONVA 4BQNA 4CCNA 2E5ZA 2WWYA 3IP4B 1R4MB 2JPBA 1WPKA 2Z5UA 1YFHA 4ENKA 2EQRA 5L3BA 2W7NA 1D0YA 3I3LA 4MEXF 2R92J 3RSNA 2DMNA 1WVRA 2NS8A 3HG9A 4D5FA 3TEDA 4E7SA 3DBRB 2JA8J 3I59A 4PJMA 3LNQA 4M3FA 5J6XA 1MMSA 1AHDP 3KYDB 2YSRA 2WTEA 3PNYA 4RM3A 2COBA 4U7DA 5IYDJ 1E3OC 2ZBKA 4II2A 2V6EA 2BBYA 3M7GA 1AKHB 2L9SA 5FD6A 5FB2A 5D6EA 3LQRA 4LOCA 1AA7A 3DKWA 4DGWB 3Q0UA 1AU7A 4IRGA 4A3BJ 3I4PA 1YIJI 1W7PD 1YW8A 4HZFA 2G7UA 3G1OA 1BI3A 3KP5A 1KYWA 2WB1A 2ZNYA 3MMYB 4A12A 3S3OA 2ELJA 1ETKA 4G6QA 4NBQA 2RDPA 1HSJA 1BA5A 1ZRDA 2V9KA 3HXLA 3F8BA 2DOAA 2YUSA 3HM5A 5F0FA 4PGHA 1OMIA 3MWMA 3L2RA 4IPAA 3L2VA 4M9SA 5JR3A 1POGA 1S8NA 2D45A 3NARA 2VQGA 3M8EA 3H3VK 4C2MJ 1TTYA 3CMMA 2DI3A 3HSFA 4ENJA 4HQEA 2UXXA 2OCEA 3LA7A 4GYGA 4LJZF 1O7FA 2Z1DA 2QLZA 3BCAA 2K9LA 1F43A 3CCQI 1BIAA 5EDNA 3AG3H 1NG6A 2CUZA 2BW3A 3QYBA 4XSXF 5E1ZB 3SYTA 4FETA 4ZZDA 2E1NA 5ICGA 2XHKA 2WA0A 3EDPA 3I56I 3H3ZA 3FWEA 2BXZA 1LEBA 2K7LA 2CQKA 2QCOA 3MZHA 2E5NA 3EQLF 2LBFB 6PAXA 2VJIA 1DQUA 1R00A 3GTGJ 2FQ4A 2PX9A 4GXOA 3BZCA 1FWZA 2HFHA 4V2FA 3SHFA 3I64A 2M7BA 1JUMA 2MC3A 4HW0A 3L1PA 3H5NA 5H6QA 1U3EM 1VQOI 1W7PA 3LFUA 2W25A 5FLXZ 3C2BA 1CF7B 1OYIA 3RI4A 1JJ6C 3LAJA 1SFXA 1BC7C 1S6LA 1MH3A 2DO7A 3T5XA 1PDNC 1YW9A 2JPCA 3K0LA 2LYCA 3BTIA 2Z99A 3H5AA 2LKPA 3P9IA 3V4GA 3PO3J 5F6FA 3KYCB 2X1EA 4EQQA 3CUQA 3HUGA 3KEQA 2ESNA 4YRVA 4U7BA 2GA2A 4I02A 2BVMA 2HNHA 4RS8A 4U0YA 2HDWA 2C6YA 3OYEA 3CJNA 4ESJA 1UG0A 2ETHA 5LLQA 1XDSA 3OSFA 2V6CA 1XS9A 5FKKA 1HKTA 3JRAA 3DP7A 3S32A 4QPOA 4EJUA 3KCCA 1S3JA 1UHMA 3F3XA 3HL2A 1MSFC 4AIJA 1BR4A 4JBAA 2Z9OA 2QENA 2GXGA 2EZIA 1SFKA 3CCEI 1Z0XA 3O3KA 4DYRA 5J40A 4M72A 2DCEA 5E18F 3OYHA 2YU3A 3OYDA 3ISPA 2QBYB 2K02A 2ZO4A 3OIOA 2EZLA 2CV2A 3FM5A 2CYYA 1B9MA 3V7RA 1ZRCA 3BQYA 4BL0B 2RAEA 4ZDOA 1B8IB 2DAOA 2EA4A 2X51A 1IV8A 1DU6A 3QOEA 2XSDC 5IT9Z 2L02A 3JRFA 5HS9A 1R9TJ 3LOCA 4BE2A 2HKXA 3RKYA 4OINF 2E71A 5DM6F 2AHQA 3MKLA 3CCMI 1R49A 4L0ZB 1PJRA 1IZ1A 3IRRA 2LLKA 3E0JB 1VQ7I 1SD5A 4XRFA 3S93A 2EILH 3LQQA 3GVAA 3DPLC 3KZZA 2ME6A 2A68F 3ML6A 3WE3A 5IT9K 5IP6A 2X9DA 5M5WJ 2K9SA 4ZYAA 3OMYA 2DDAA 1GUUA 2K40A 3ECOA 5F1RA 1ZTRA 2OQRA 4BDYA 2F2EA 2HXIA 3BZ6A 3DV8A 2M45A 3GZNB 1YE9A 4FE4A 5C44J 5JI6A 1KZHA 3WGGA 1Z3YA 4NC8A 3L09A 2GQQA 2IGMA 3FMRA 5HDGA 1WSUA 4W97A 2EIJH 2HR3A 1PVEA 2BHYA 1HW2A 4XOPA 1BM9A 3R60A 2YX4A 3AG4H 2VKDA 1ZLJA 4DBQA 1HKQA 1X3UA 1XGOA 3LAPA 1JT0A 4AU7A 1O3TA 1HSTA 5L3CA 1G8XA 2VQHA 1BR1A 1FMVA 1XCVA 3M07A 4XBFA 3MKYB 1IJWC 2M0MA 3G1MA 3DTIA 2ZC2A 1J0RA 2CUEA 1JXSA 1MBEA 4Y15A 4Z2YA 2CH0A 2QWWA 1IC8A 2RC4A 1VQLI 3WTTC 2UV1A 3OL3A 2XGXA 3P5JA 2IRFG 2L7MP 2ZJ2A 4RGSA 3M3YJ 4G6TB 2PBIA 1ZLKA 4E70A 2DK8A 4RLFA 1ODDA 1XC5A 5L3FA 2ZJQF 4EJOA 3FX3A 1FBQA 1ORKA 1OR7C 2R7ZJ 1E2XA 5KNLA 2HZTA 4LG0B 5C3EJ 4BUPA 2O61A 1FX7A 3MEXA 3T1BA 1LFPA 4BQQA 4Q47A 4KITB 2A05A 5EYRA 2IAIA 3D1NI 4CYCB 2K5CA 1G3WA 3VOEA 5TJJA 5GAGJ 4AVPA 2FNPA 4XN0A 3H0DA 2DU9A 3BPXA 3S2DJ 1IUFA 1GV2A 3D5RC 3I71A 3KYLA 2DA6A 3MQ0A 5AIQA 3BJOA 3CP2A 1S9HA 2HQ5A 3DWLE 1W4MA 3C2GA 2JN6A 1JKOC 4IRHA 1ZG5A 1D5VA 1ZR4A 1YI2I 2RV8A 1TBXA 2HXOA 1F9NA 3I9V2 2KIFA 3KP3A 2CV1A 4I99C 2FF4A 2A6HF 2HYJA 3OYLA 1X1PA 1ENHA 2M2EA 5FKLA 3MD2A 2L9VA 3HC7A 4HF1A 2CW7A 2HZDA 3C7JA 2VT2A 3HOYJ 1WJAA 3HOTA 3EPZA 5D8KB 4JQFA 4Y33A 1LQ1A 2V1DA 1A5JA 5HLIA 2VJ4A 2MLKA 1O4XA 2XGEA 4EGYA 3CDHA 2VC1A 4G8XA 1KU7A 1FMWA 1P4XA 4A0ZA 1IDYA 5GPAA 3KETA 3FBNB 1YX3A 3JRCA 3MKZA 5ILVA 1I27A 1ULYA 1J75A 3NWTA 2LREA 2OZUA 4I98B 1T8IA 3E6BA 2DA2A 2O3FA 4JK1X 1IN4A 1T6SA 2JT1A 2DA4A 2ZNZA 1S7EA 5DV5A 2E7XA 3HGGA 3HPHA 4F52A 2X85A 5B3SH 1SMYF 2ZJPF 3JRIA 4F93B 2EV0A 2L7ZA 4BXUA 2BY3A 3A03A 3B6CA 2QUFA 4OAZA 3GTQJ 3JRHA 2DA3A 3DXJF 3K10A 1LE8A 1FT9A 3ASOH 5FFZA 1TWAJ 2RREA 1G4DA 5K7ZA 2XAFA 3K69A 5AIPA 2DPUA 2O7OA 2PQ8A 2CG4A 4KMFA 1WI9A 2QSHX 3B73A 3G6EI 1JGGA 5E3MA 1D5YA 4J00A 1ZQ3P 4BJTA 4A3EJ 3PQJA 1RUOA 4XLCA 3ZQCA 1TWCJ 2G7HA 1S7AA 3K1PA 3ZR8X 1X4PA 3RKQA 4HX4A 4ESFA 1KQ9A 1R5GA 2RNJA 1ZREA 3TMOA 2BGCA 3CLQA 1FYLA 2L4MA 4CCMA 1O3RA 2EBIA 2QQBA 4A3CJ 2WY7Q 1VFCA 2M87A 2JVHA 2OQGA 3LSMA 1HW5A 2DFHA 2NXNB 2ADUA 5DS9A 1X2MA 3ERMA 2R7SA 4UB6C 2W85A 5HOOA 4C3HJ 4E7ZA 4XKVA 3ZCOA 4XLNF 2VODA 3FHNA 3DLLF 1Z67A 2HGCA 1MH4A 3ZN1A 5H20A 4BDZA 2KZVA 4WK8F 2H6BA 1QVUA 1U5TC 4XR6A 2CQQA 2K86A 3CCUI 1XGSA 4JX4A 2D2WA 4P9FA 4GDFA 4A6DA 3N4MA 2H8WA 1I6XA 3UNGC 3A01A 3CMAI 3REOA 1X3WB 2DQRA 4HF0A 3S1QJ 2HYGD 2W1OA 3I58A 2OUMA 3OR1C 1IG7A 4QSHA 4UV8A 3GFIA 5CKTA 2X0LA 3WTVC 3FK7A 4B3AA 1TWGJ 2L0KA 4CYDA 3OYKA 3L2QA 2H27A 2HOEA 2MD5A 4JX6A 5M5YJ 2YR2A 3OYMA 2LKSA 1T56A 1YYVA 4PZJA 1LUJB 3QRFF 1ZGJA 2Q8KA 2V9VA 2R7FA 4O6JA 4UHTA 5E8IA 2FX0A 3L00A 4AM3A 1D1AA 2PJRB 3TDZC 2IXSA 2K3FA 3A4CA 3CDLA 1K78B 4NHJA 4XKWA 2OC6A 4MQVA 1REPC 3F0CA 2KJCA 3LSHA 1UB9A 1T38A 3WU2C 1A6QA 1ON1A 2LY9A 1MNDA 4IL6C 5J8CA 1JTYA 1K6YA 1ZHFA 4ANJA 1E17A 2L3DA 5FO5A 1J9IA 2I5UA 2WAFA 3AFHA 4RGUA 2J5PA 2M4KA 4EVIA 1V5FA 2Y31A 4PJLA 3TW6A 4ZZLA 1H89C 3BZKA 1SVOA 1WJFA 5K5QA 4E7LA 3JTGA 2E34A 1OCRH 3KE2A 3WHCA 1LEAA 2HDCA 2A5YB 1NHAA 2K85A 2Z3YA 1ACIA 1WJEA 3WTUC 4BEHA 1D3YA 4QPQA 2PG4A 1ZN2A 3K4BA 2Y30A 1OCOH 1SVLA 5LD2C 1XPXA 4XLPF 3IUOA 1O57A 4M74A 4A3JJ 3SXYA 3MFKA 4RAYA 2EV5A 2KISA 4UVAA 2ECCA 2NS7A 5E79C 4X0GA 2JVGA 2IS1A 2Q2EB 1QHHD 3DEUA 4HLYA 3ONQA 1TZLA 1P4AA 1MDMA 4P1WA 2EFOA 2IA1A 1GV5A 3HHGA 5F64A 3BG9A 4EATA 3FM3A 1IXCA 3G1LA 5ERIA 2E1CA 3QYFA 4XICA 3LSGA 2HOSA 2ID6A 3EYYA 4B4CA 3BWGA 5EEGA 3I59B 1ZGAA 3ZGKA 4XKCA 1QO0D 4HG2A 5HNHA 4ABZA 1YO5C 3CC7I 3CF2A 5F04A 3C1DA 1BBYA 3CJTB 2QSFX 3GF2A 5B5EC 4I7HA 2GM4A 3S17J 5GAEJ 3FXLA 3BG3A 4AYBN 2FSWA 1RR8C 1OR7A 1QU3A 4IVNA 3MZYA 3HTUA 4L5IA 3TW7A 3KEOA 2HKOA 2IGOA 1MSEC 3WTXC 2E1MB 3VSLA 3GTKJ 2ME0A 2M4GA 4E7IA 2H94A 5ILUA 3HOVJ 4A3LJ 1OCPA 1Z21A 3Q0VA 3OS1A 2XASA 4BACA 2HEOA 3AL0B 2QVOA 3SQNA 3W6KB 2ICWG 3IAS2 2OTJI 2ID3A 3BR6A 4CDGA 2DDBA 1VF9A 4ENNA 2RQPA 1TWHJ 1XDUA 2X48A 5E8GA 1K4SA 1CGPA 4HV5A 3DU6A 3T8RA 5FKNA 3H92A 2BYVE 3QP6A 4S04A 1IXSB 4BBRJ 4IJAA 1DP3A 2BW3B 3NEUA 1N77A 1D8JA 3DBLB 2CQNA 1VI0A 1IN5A 3ZMZA 3WU1B 1FYMA 3H5RA 1JKQC 2LD5A 2DMUA 3M4OJ 3WU0A 4PDKA 3TQNA 5J4YA 3GTJJ 4FX4A 2R93J 4Y7NJ 4H4KC 3WG7H 4LLLA 3VODA 1VZ0A 3A0BC 3BQZA 2AXTC 3PJRA 1JGSA 1W7PB 1QGPA 4OIOF 4PFPA 2R5YB 4A3IJ 1EA3A 2BEOA 4B8XA 4WXDA 3VYSB 1ZKGA 1Z6TA 2W48A 1I50J 2VXDA 5EG0A 1ZAOA 2M7AA 1MMGA 1Y1VJ 2L54A 3F8CA 3IH4A 5KAIC 4XLAA 1T39A 1MKMA 4II3A 3CUQB 3HUGB 1IGNA 4EM0B 2KPMA 4FISA 2DODA 3BR0A 4LG3A 4GO1A 3H9GA 3UR3C 2ESHA 1Y0NA 3KLOA 3BP8A 3A0HC 1BI1A 4HA8A 2XPWA 1BOBA 4DJAA 3TP0A 5D4RA 1RRJA 3KIOA 1RR7A 2EFPA 5H6RA 1TQPA 4DZPA 2MG4A 3L2UA 2H09A 5D5VB 1R22A 4BE0A 5CYVA 1MD0A 2EK5A 2CW8A 2JA6J 2Y0SA 2GZWA 4RB1A 3H36A 4L5EA 4XRMA 4BH9A 2CWEA 2X1DA 5CQEA 4FE7A 2KDOA 4MGRA 3ZQ7A 2L9NA 1OPCA 4XLEA 2WAQA 3WTWC 4RAZA 2XAHA 1ITYA 4L5JA 4KISA 1W5SA 1W5CC 4BAYA 3HRUA 2R7QA 2DT6A 2F4OB 2VKVA 2V4JC 3IL2A 1G59A 1U6GA 4LFUA 2DA1A 1K4TA 3FMQA 1VQ5I 2GBYA 3IKVA 4UUTA 4XIDA 3G2BA 3CLOA 2F5FA 1GT0C 4PK4A 5LHGA 5BOXA 2V79A 1QZZA 1FSHA 3DLAA 3QPHA 4KIFA 3JAMZ 2BZTA 4RGXA 3GTMJ 4AIDA 2LY2A 1A31A 2JZYA 4G9YA 2F4MB 2ZXJA 3LFKA 4XN3A 2HVQA 3JW4A 3OIQA 4F7ZA 4LIUA 3JRGA 1W36C 4L0YB 1U5TA 5F27A 3N97A 5TGTA 3JAMK 2O0YA 3BROA 4DIQA 1O3SA 4AWXB 3CC2I 4HDUA 1K79A 5K5RA 4KT5C 5GP9A 1N78A 3ZN0A 4YIFA 2JWTA 4D1QA 3CMEI 2KJBA 2P6TA 4FQGA 4H0EA 4N0BA 4HNVA 2P7CB 3K6GA 1NK3P 2NVTJ 2ZMEC 2KIUA 3K1NA 5FLXK 5TRDA 2VPRA 3H9QA 5BS6A 1LDJA 3OOPA 1WJCA 1P7JA 4A0XA 4GGGA 2M1BA 1MGTA 1RNLA 4CA0A 2HS5A 4AD9A 4ZYEA 1XGMA 2BY1A 3SFIA 2BXYA 4HBLA 3GX4X 1VQKI 2LF8A 3ZOBA 3W6VA 3FBIB 2LY1A 3RZDJ 3IRQA 4CSWA 2HDDA 1AKHA 2GWRA 1YJ9I 1WH7A 2M34A 4M3EA 2LG4A 1U8BA 3EUAA 1Q1HA 3QYEA 5E3NA 1TNTA 3VB2A 1E0EA 4A5MA 5HNFA 1T08B 2Y48A 1LPQA 1RETA 3OYJA 1J2XA 2V1NA 4I01A 4UUVA 5GADJ 3TBIA 2HU9A 3B6AA 2IBDA 3DFGA 3NWSA 2R7UA 4EEFG 2NNNA 2BHZA 3HRTA 4HLXA 5CVIA 3HIFA 1P9QC 2BV6A 4ESBA 4FASD 1PP8F 1V54H 3ZXSA 2QA4I 3VFZA 3E3VA 3E1SA 2JTVA 5LRSA 4LD5A 2O9LA 2E60A 1JTXA 1WJ5A 3HBLA 3ZRGA 1UAAA 4C9YA 3HHHA 3B02A 2JUGA 2FNAA 2VLAA 5FRNA 3K7AJ 1FBSA 2P4WA 3KZIC 4EV0A 1JHFA 1BW6A 1RPWA 1U9NA 4L9JA 4K2EA 3G73A 2F5EA 2LR8A 4HQMA 1JJ8C 1G2HA 2DJNA 4IF4A 2IEKA 4P5OA 3CP8A 3LA2A 2AQFA 2COMA 2M5WA 3VEPA 3ZQFA 4RB2C 1MBKA 5EF6A 5FROA 1KQ8A 2VN2A 3CDIA 2LBFA 1Y8RB 3FKJA 5L3EA 2FBKA 3K1MA 4BQOA 1MNMC 4XMYA 3JCUC 1SFUA 3CO6C 2TCTA 4IHWA 1L0OC 1R6RA 3GFMA 4IHYA 3RQ4A 1X58A 2I8DA 1BR2A 1CF7A 1SVMA 4KJZA 4DQ2A 1K7AA 1Z7LA 2CQ7A 4Y4RA 2STTA 4BBSJ 3MZ8A 4ZH4F 1IRGA 2FEZA 3JSOA 4HSTA 1IUYA 5CVRA 3OR2C 4YELA 4BNCA 4KIGA 4ASNA 3ZQHA 1J09A 3PM1A 2LVSA 5J47A 2PMZA 3HOWJ 3FIWA 5GPCA 3DEWA 4R79A 4OIRF 3S16J 2FRHA 2WV1A 1OYWA 1XGNA 5DCMB 2CFXA 5KCMA 4BHPA 3GO5A 4WXCA 2DK5A 4MTEA 2VB6A 3R61A 4MNUA 1TNSA 2QF7A 3BR2A 4KNYA 5JLXA 5BPIA 4M6YA 3HRSA 5F08A 1D0XA 5F0CA 2BVLA 3FKIJ 1TW3A 1S5LC 3BTCA
chains in the Genus database with same CATH topology
5FJ8J 3RQIA 5DS9A 1X2MA 4MFEA 2R5ZA 5J1YA 4C3HJ 1LE8B 4I76A 1UMQA 2JMWA 1OCTC 3SJMA 4RBOA 2R5YA 3HB9A 1W0TA 1ZR2A 2M8GX 2O8KA 1MH4A 1JKRC 5IOZA 5IP7J 3S14J 1QVUA 1T33A 3IV5A 2XB5A 1VNDA 2CQQA 4JX4A 2DN0A 4DYQA 2WB1N 4C3JJ 2HOAA 4AC0A 2E19A 3CCYA 5EZGA 2JA7J 1RKTA 3A01A 3A02A 3S1MJ 3O8GA 3PO2J 5F0HA 3S1QJ 1P7IA 2LFBA 1FIAA 1IG7A 3H0GJ 4QSHA 2VUMJ 1LFBA 2OPTA 3MVPA 1HF0A 3FK7A 2OF7A 4MLOA 5IYBJ 4B3AA 1FTZA 1H8AC 1TWGJ 2L0KA 5FLMJ 2K9NA 2PMZN 3HGYA 2R0QC 5M5YJ 4JX6A 4A3GJ 1T56A 1ETWA 3BR1A 3IH3A 5DTDA 2E2HJ 3NAUA 5EZHA 1BJZA 4QIWN 1ETOA 5F1JA 1B72A 3HOUJ 2R5ZB 2FX0A 1WPKA 4DZJA 3CDLA 2EQRA 2R92J 2DMNA 3F0CA 3TEDA 2NS8A 4D5FA 2JA8J 3LNQA 4M3FA 3QPLA 1AHDP 3K2AA 2LY9A 3HDDA 5IYDJ 2COBA 2GLOA 3E7LA 1E3OC 1JTYA 1AKHB 2CUFA 1NTCA 2LP0A 2Y2ZA 2Y31A 3TW6A 4LOCA 1H89C 3A01B 3S2HJ 2DMPA 3Q0UA 1AU7A 4A3BJ 3JRBA 3WHCA 1K61A 2N8GA 3G1OA 5E3OA 3HKZN 1ETKA 2Y30A 1BA5A 4A93J 4A3JJ 1U9OA 1RKWA 2YUSA 3HM5A 5F0FA 2ECCA 2NS7A 1B72B 1POGA 3NARA 5C4JJ 3H3VK 4C2MJ 4IEJA 3HEFA 1HDPA 2XPUA 1IRZA 1GV5A 2D5VA 5J3LA 3UKGA 3BG9A 2YS9A 3G1LA 2HOSA 4XICA 1SFOJ 3LSGA 1F43A 2ID6A 4B4CA 5EDNA 4X6AJ 4XRSG 4BKXA 4ABZA 2G0EA 4UUSA 1QVTA 5F04A 2E2JJ 1FEXA 3S15J 3S17J 1I6HJ 2GM4A 3BG3A 4AYBN 1GVDA 2QCOA 4A3KJ 3QQAA 3MN2A 2VKEA 1QRYA 3TW7A 3GTGJ 2FQ4A 1U78A 1CQTA 1MSEC 4V2FA 1JUPA 2ME0A 3L1PA 1JUMA 3GTKJ 2Y9ZA 3HOVJ 4A3LJ 1OCPA 2E2IJ 1UG2A 3Q0VA 4JP0A 3C2BA 1K83J 1JJ6C 1I3QJ 4C3IJ 1BL0A 1MH3A 1B8IA 2ID3A 3BR6A 1VF9A 3BTIA 1ZGWA 1TWFJ 3PO3J 1TWHJ 2MW8A 1APLC 2X48A 9ANTA 4M3GA 4MO7A 5FKNA 5M3FJ 1Y1WJ 2E1OA 3O8HA 5K7FA 4M6VA 4BBRJ 4MFDA 2ZB9A 3I4MJ 3OSFA 4UUSB 4D7NA 1VI0A 5FKKA 5K7HA 2KDZA 1XS9A 4G12A 3JRAA 3SDGA 4V2GA 1JKQC 3BR3A 1MSFC 2CJJA 2AO9A 5M3MJ 2LD5A 2DMUA 3M4OJ 1X2NA 3Q3SA 3GTJJ 3FK6A 2R93J 4Y7NJ 2EZIA 2XGDA 1Z0XA 4DYRA 1EF4A 2XGCA 3CMYA 3S1RJ 1WCMJ 3BQZA 1F36A 1LFUP 1FIPA 1GDTA 5IOYA 4A69C 3LSRA 1SANA 3OIOA 2EZLA 1W0UA 2R5YB 3LSJA 4FCYA 4A3IJ 3BQYA 2RAEA 1B8IB 1ZKGA 2W48A 1PUFA 1I50J 5EG0A 2TRTA 3GBGA 1DU6A 2XSDC 1Y1VJ 3HOZJ 3IH4A 3JRFA 4FTHA 1R9TJ 3JR9A 3LOCA 1MBHA 1IGNA 4FISA 2P81A 3BR0A 2AHQA 3MKLA 1DU0A 2LLKA 2ECBA 5EGOA 2XPWA 4D5CA 2ME6A 3OSGA 3BTJA 3TP0A 5J1RA 5IP6A 1RR7A 2X9DA 5M5XJ 5M5WJ 4XK4A 2K9SA 4DZPA 2MG4A 2FJ1A 3LSPA 2EZKA 2JA6J 1GUUA 1Q1VA 2K40A 2K9QA 5C4XJ 4L5EA 2JK3A 4XRMA 1ZTRA 4FE7A 2HXIA 1JUSA 1ETYA 3BTLA 3OOUA 5HODA 3BR5A 4FE4A 5C44J 1ITYA 1ETVA 4IHVA 1IDZA 2VKVA 4W97A 1IV6A 1WGXA 4JX5A 2EH3A 2HI3A 1PUFB 5EG0B 2DA1A 1A6IA 2GBYA 4CYCA 4UUTA 3I4NJ 4XIDA 1HOMA 1UHSA 1JT0A 1GT0C 2MGQA 1RESA 3ZQIA 2H1KA 1HLVA 3IH2A 3GTMJ 1IJWC 2DA7A 5EGOB 3G1MA 2VI6A 4D7MA 2LTPA 4XRSA 2YU9J 5BNGA 2CUEA 1MBEA 2NOGA 2CQXA 1MBJA 3JRGA 5IPAA 1IC8A 3HOXJ 1Z77A 2LKXA 5F27A 2L7MP 3M3YJ 5GP9A 1WH5A 2B63J 2JWTA 1XC5A 1FJLA 4HNVA 1ORKA 4A3DJ 1NK3P 2R7ZJ 2NVTJ 5C3EJ 2ELKA 2L9RA 2VPRA 1P7JA 2HOTA 5EYRA 2IAIA 3ZQGA 3D1NI 2Y0SN 4CYCB 3SFIA 2XRLA 4DW6A 2DMTA 2Y9YA 1XG1A 5FKOA 2MSYA 4A3FJ 2JJ7A 2WAQN 3ZOBA 3W6VA 3S2DJ 5IYCJ 1JKPC 3RZDJ 1IUFA 1GV2A 4JYKA 2CU7A 2HDDA 1AKHA 2M9HA 1WH7A 2M34A 4M3DA 4M3EA 2DA6A 1U8BA 2HQ5A 4BY7J 5EEAA 3GTOJ 5E3NA 2JN6A 5FKMA 1FTTA 1NK2P 1ZK8A 1JKOC 5JLWA 2XPVA 1OJLA 1RETA 3JRDA 3VPRA 3BG5A 1ZR4A 1WI3A 3B6AA 2IBDA 4EEFG 2HXOA 3Q0WA 4B1RA 1YRNA 4AUXA 2DTZA 2DA5A 2HYJA 1ENHA 2M2EA 5FKLA 4GFBA 1OFCX 2O9LA 3FISA 3HOYJ 1JTXA 3QPSA 2I10A 2FD5A 3HBLA 1A5JA 1O4XA 2XGEA 2KT0A 3WHBA 2LK2A 4NDLA 3K7AJ 2XB0X 4IHXA 3GTPJ 4I6ZA 1IDYA 2EZHA 5GPAA 1MBGA 3JREA 2NVQJ 1BW6A 1RPWA 1U9NA 5E3LA 3JRCA 1H88C 2JA5J 3RZOJ 4Y52J 2LR8A 4M3BA 1JJ8C 1G2HA 2DJNA 2IEKA 2DA2A 3ZQFA 5IP9J 1ETXA 1MBKA 2DA4A 5EF6A 1S7EA 3HGGA 1JT6A 3GTLJ 3ZQLA 1MNMC 3JRIA 2L7ZA 4RDUA 1QPIA 3A03A 3B6CA 2TCTA 3GTQJ 4BY1J 4IHWA 3JRHA 2DA3A 4DYCA 1LE8A 4IHYA 1X58A 2DMQA 1YRNB 4W1UA 4J19A 1BW5A 4A3MJ 1TWAJ 4BBSJ 5K7ZA 2X6OA 2NVYJ 4MIMA 2CRGA 3TP3A 4BXXJ 2O7OA 3ZQHA 3PM1A 2LVSA 5E3MA 1JGGA 1D5YA 1HCRA 1ZQ3P 5FLVA 3HOWJ 4A3EJ 3FIWA 2L7FP 5GPCA 2NVXJ 3ZQCA 3DEWA 1TWCJ 3DCFA 3S16J 2WV1A 3RKQA 1TC3C 2M0CA 4S0HB 3S1NJ 2H8RA 3BT9A 4QTRA 1MBFA 5J1UA 1ETQA 2QF7A 3BR2A 5JLXA 2EBIA 3CQZJ 5F08A 5F0CA 3FKIJ 4A3CJ 4X1EA 1VFCA 1HDDC 3BTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 J;  3RQI A;  5DS9 A;  1X2M A;  4MFE A;  2R5Z A;  5J1Y A;  4C3H J;  1LE8 B;  4I76 A;  1UMQ A;  2JMW A;  1OCT C;  3SJM A;  4RBO A;  2R5Y A;  3HB9 A;  1W0T A;  1ZR2 A;  2M8G X;  2O8K A;  1MH4 A;  1JKR C;  5IOZ A;  5IP7 J;  3S14 J;  1QVU A;  1T33 A;  3IV5 A;  2XB5 A;  1VND A;  2CQQ A;  4JX4 A;  2DN0 A;  4DYQ A;  2WB1 N;  4C3J J;  2HOA A;  4AC0 A;  2E19 A;  3CCY A;  5EZG A;  2JA7 J;  1RKT A;  3A01 A;  3A02 A;  3S1M J;  3O8G A;  3PO2 J;  5F0H A;  3S1Q J;  1P7I A;  2LFB A;  1FIA A;  1IG7 A;  3H0G J;  4QSH A;  2VUM J;  1LFB A;  2OPT A;  3MVP A;  1HF0 A;  3FK7 A;  2OF7 A;  4MLO A;  5IYB J;  4B3A A;  1FTZ A;  1H8A C;  1TWG J;  2L0K A;  5FLM J;  2K9N A;  2PMZ N;  3HGY A;  2R0Q C;  5M5Y J;  4JX6 A;  4A3G J;  1T56 A;  1ETW A;  3BR1 A;  3IH3 A;  5DTD A;  2E2H J;  3NAU A;  5EZH A;  1BJZ A;  4QIW N;  1ETO A;  5F1J A;  1B72 A;  3HOU J;  2R5Z B;  2FX0 A;  1WPK A;  4DZJ A;  3CDL A;  2EQR A;  2R92 J;  2DMN A;  3F0C A;  3TED A;  2NS8 A;  4D5F A;  2JA8 J;  3LNQ A;  4M3F A;  3QPL A;  1AHD P;  3K2A A;  2LY9 A;  3HDD A;  5IYD J;  2COB A;  2GLO A;  3E7L A;  1E3O C;  1JTY A;  1AKH B;  2CUF A;  1NTC A;  2LP0 A;  2Y2Z A;  2Y31 A;  3TW6 A;  4LOC A;  1H89 C;  3A01 B;  3S2H J;  2DMP A;  3Q0U A;  1AU7 A;  4A3B J;  3JRB A;  3WHC A;  1K61 A;  2N8G A;  3G1O A;  5E3O A;  3HKZ N;  1ETK A;  2Y30 A;  1BA5 A;  4A93 J;  4A3J J;  1U9O A;  1RKW A;  2YUS A;  3HM5 A;  5F0F A;  2ECC A;  2NS7 A;  1B72 B;  1POG A;  3NAR A;  5C4J J;  3H3V K;  4C2M J;  4IEJ A;  3HEF A;  1HDP A;  2XPU A;  1IRZ A;  1GV5 A;  2D5V A;  5J3L A;  3UKG A;  3BG9 A;  2YS9 A;  3G1L A;  2HOS A;  4XIC A;  1SFO J;  3LSG A;  1F43 A;  2ID6 A;  4B4C A;  5EDN A;  4X6A J;  4XRS G;  4BKX A;  4ABZ A;  2G0E A;  4UUS A;  1QVT A;  5F04 A;  2E2J J;  1FEX A;  3S15 J;  3S17 J;  1I6H J;  2GM4 A;  3BG3 A;  4AYB N;  1GVD A;  2QCO A;  4A3K J;  3QQA A;  3MN2 A;  2VKE A;  1QRY A;  3TW7 A;  3GTG J;  2FQ4 A;  1U78 A;  1CQT A;  1MSE C;  4V2F A;  1JUP A;  2ME0 A;  3L1P A;  1JUM A;  3GTK J;  2Y9Z A;  3HOV J;  4A3L J;  1OCP A;  2E2I J;  1UG2 A;  3Q0V A;  4JP0 A;  3C2B A;  1K83 J;  1JJ6 C;  1I3Q J;  4C3I J;  1BL0 A;  1MH3 A;  1B8I A;  2ID3 A;  3BR6 A;  1VF9 A;  3BTI A;  1ZGW A;  1TWF J;  3PO3 J;  1TWH J;  2MW8 A;  1APL C;  2X48 A;  9ANT A;  4M3G A;  4MO7 A;  5FKN A;  5M3F J;  1Y1W J;  2E1O A;  3O8H A;  5K7F A;  4M6V A;  4BBR J;  4MFD A;  2ZB9 A;  3I4M J;  3OSF A;  4UUS B;  4D7N A;  1VI0 A;  5FKK A;  5K7H A;  2KDZ A;  1XS9 A;  4G12 A;  3JRA A;  3SDG A;  4V2G A;  1JKQ C;  3BR3 A;  1MSF C;  2CJJ A;  2AO9 A;  5M3M J;  2LD5 A;  2DMU A;  3M4O J;  1X2N A;  3Q3S A;  3GTJ J;  3FK6 A;  2R93 J;  4Y7N J;  2EZI A;  2XGD A;  1Z0X A;  4DYR A;  1EF4 A;  2XGC A;  3CMY A;  3S1R J;  1WCM J;  3BQZ A;  1F36 A;  1LFU P;  1FIP A;  1GDT A;  5IOY A;  4A69 C;  3LSR A;  1SAN A;  3OIO A;  2EZL A;  1W0U A;  2R5Y B;  3LSJ A;  4FCY A;  4A3I J;  3BQY A;  2RAE A;  1B8I B;  1ZKG A;  2W48 A;  1PUF A;  1I50 J;  5EG0 A;  2TRT A;  3GBG A;  1DU6 A;  2XSD C;  1Y1V J;  3HOZ J;  3IH4 A;  3JRF A;  4FTH A;  1R9T J;  3JR9 A;  3LOC A;  1MBH A;  1IGN A;  4FIS A;  2P81 A;  3BR0 A;  2AHQ A;  3MKL A;  1DU0 A;  2LLK A;  2ECB A;  5EGO A;  2XPW A;  4D5C A;  2ME6 A;  3OSG A;  3BTJ A;  3TP0 A;  5J1R A;  5IP6 A;  1RR7 A;  2X9D A;  5M5X J;  5M5W J;  4XK4 A;  2K9S A;  4DZP A;  2MG4 A;  2FJ1 A;  3LSP A;  2EZK A;  2JA6 J;  1GUU A;  1Q1V A;  2K40 A;  2K9Q A;  5C4X J;  4L5E A;  2JK3 A;  4XRM A;  1ZTR A;  4FE7 A;  2HXI A;  1JUS A;  1ETY A;  3BTL A;  3OOU A;  5HOD A;  3BR5 A;  4FE4 A;  5C44 J;  1ITY A;  1ETV A;  4IHV A;  1IDZ A;  2VKV A;  4W97 A;  1IV6 A;  1WGX A;  4JX5 A;  2EH3 A;  2HI3 A;  1PUF B;  5EG0 B;  2DA1 A;  1A6I A;  2GBY A;  4CYC A;  4UUT A;  3I4N J;  4XID A;  1HOM A;  1UHS A;  1JT0 A;  1GT0 C;  2MGQ A;  1RES A;  3ZQI A;  2H1K A;  1HLV A;  3IH2 A;  3GTM J;  1IJW C;  2DA7 A;  5EGO B;  3G1M A;  2VI6 A;  4D7M A;  2LTP A;  4XRS A;  2YU9 J;  5BNG A;  2CUE A;  1MBE A;  2NOG A;  2CQX A;  1MBJ A;  3JRG A;  5IPA A;  1IC8 A;  3HOX J;  1Z77 A;  2LKX A;  5F27 A;  2L7M P;  3M3Y J;  5GP9 A;  1WH5 A;  2B63 J;  2JWT A;  1XC5 A;  1FJL A;  4HNV A;  1ORK A;  4A3D J;  1NK3 P;  2R7Z J;  2NVT J;  5C3E J;  2ELK A;  2L9R A;  2VPR A;  1P7J A;  2HOT A;  5EYR A;  2IAI A;  3ZQG A;  3D1N I;  2Y0S N;  4CYC B;  3SFI A;  2XRL A;  4DW6 A;  2DMT A;  2Y9Y A;  1XG1 A;  5FKO A;  2MSY A;  4A3F J;  2JJ7 A;  2WAQ N;  3ZOB A;  3W6V A;  3S2D J;  5IYC J;  1JKP C;  3RZD J;  1IUF A;  1GV2 A;  4JYK A;  2CU7 A;  2HDD A;  1AKH A;  2M9H A;  1WH7 A;  2M34 A;  4M3D A;  4M3E A;  2DA6 A;  1U8B A;  2HQ5 A;  4BY7 J;  5EEA A;  3GTO J;  5E3N A;  2JN6 A;  5FKM A;  1FTT A;  1NK2 P;  1ZK8 A;  1JKO C;  5JLW A;  2XPV A;  1OJL A;  1RET A;  3JRD A;  3VPR A;  3BG5 A;  1ZR4 A;  1WI3 A;  3B6A A;  2IBD A;  4EEF G;  2HXO A;  3Q0W A;  4B1R A;  1YRN A;  4AUX A;  2DTZ A;  2DA5 A;  2HYJ A;  1ENH A;  2M2E A;  5FKL A;  4GFB A;  1OFC X;  2O9L A;  3FIS A;  3HOY J;  1JTX A;  3QPS A;  2I10 A;  2FD5 A;  3HBL A;  1A5J A;  1O4X A;  2XGE A;  2KT0 A;  3WHB A;  2LK2 A;  4NDL A;  3K7A J;  2XB0 X;  4IHX A;  3GTP J;  4I6Z A;  1IDY A;  2EZH A;  5GPA A;  1MBG A;  3JRE A;  2NVQ J;  1BW6 A;  1RPW A;  1U9N A;  5E3L A;  3JRC A;  1H88 C;  2JA5 J;  3RZO J;  4Y52 J;  2LR8 A;  4M3B A;  1JJ8 C;  1G2H A;  2DJN A;  2IEK A;  2DA2 A;  3ZQF A;  5IP9 J;  1ETX A;  1MBK A;  2DA4 A;  5EF6 A;  1S7E A;  3HGG A;  1JT6 A;  3GTL J;  3ZQL A;  1MNM C;  3JRI A;  2L7Z A;  4RDU A;  1QPI A;  3A03 A;  3B6C A;  2TCT A;  3GTQ J;  4BY1 J;  4IHW A;  3JRH A;  2DA3 A;  4DYC A;  1LE8 A;  4IHY A;  1X58 A;  2DMQ A;  1YRN B;  4W1U A;  4J19 A;  1BW5 A;  4A3M J;  1TWA J;  4BBS J;  5K7Z A;  2X6O A;  2NVY J;  4MIM A;  2CRG A;  3TP3 A;  4BXX J;  2O7O A;  3ZQH A;  3PM1 A;  2LVS A;  5E3M A;  1JGG A;  1D5Y A;  1HCR A;  1ZQ3 P;  5FLV A;  3HOW J;  4A3E J;  3FIW A;  2L7F P;  5GPC A;  2NVX J;  3ZQC A;  3DEW A;  1TWC J;  3DCF A;  3S16 J;  2WV1 A;  3RKQ A;  1TC3 C;  2M0C A;  4S0H B;  3S1N J;  2H8R A;  3BT9 A;  4QTR A;  1MBF A;  5J1U A;  1ETQ A;  2QF7 A;  3BR2 A;  5JLX A;  2EBI A;  3CQZ J;  5F08 A;  5F0C A;  3FKI J;  4A3C J;  4X1E A;  1VFC A;  1HDD C;  3BTC A; 
#chains in the Genus database with same CATH topology
 2RNG A;  5FJ8 J;  1ZG1 A;  3ASN H;  3H35 A;  4OIP F;  1LE8 B;  3J81 Z;  1FZP B;  2MC4 A;  1UMQ A;  2VL8 A;  3SJM A;  4WX9 A;  3OS0 A;  3P7N A;  5HDN A;  2IW5 A;  4HDV A;  2VOO A;  2JSP A;  2IS6 A;  4HNT A;  1JKR C;  3HKZ A;  2X4H A;  4BHB A;  1FPQ A;  5IOZ A;  2R7O A;  5IP7 J;  1KU2 A;  1T33 A;  2NOJ B;  4UNO A;  3BG7 A;  2R7X A;  1H0M A;  5CPR B;  1MJB A;  1GXQ A;  3J81 K;  4C3J J;  2E19 A;  2V26 A;  5EZG A;  4LB5 A;  4U0V A;  3A02 A;  4CH7 A;  1JI8 A;  2FOW A;  3OWT A;  3OY9 A;  3PO2 J;  1XMK A;  4KN4 X;  5F0H A;  3DU5 A;  3AG1 H;  3H0G J;  3M8J A;  4IHT A;  4CXF A;  3RDI A;  2W82 A;  3MAJ A;  3MVP A;  1HF0 A;  3SZP A;  4EJT A;  2OF7 A;  5IYB J;  5LGU A;  3ELK A;  1FTZ A;  1H8A C;  1VQ8 I;  1I5Z A;  4TV7 A;  3IHU A;  5FLM J;  2XAU A;  3F6V A;  2R7R A;  4A3G J;  1ETW A;  2LH9 A;  2K4B A;  2E2H J;  1XTA A;  3NAU A;  4HYE A;  1ON2 A;  2MH9 A;  4XNF A;  2P5V A;  5F1J A;  1B72 A;  1W36 D;  2YPR A;  5DM7 F;  3V42 A;  5LFA A;  2VE8 A;  2EV6 A;  2JSC A;  3CCR I;  2RN7 A;  1OIS A;  1TLH B;  3L7W A;  2VBW A;  3PSI A;  4DZJ A;  1BC8 C;  1KGS A;  2KKO A;  5D6F A;  4J01 A;  2PMH A;  4F92 B;  2NNY A;  3F22 A;  3R0J A;  3PFY A;  3I54 A;  3QPL A;  3RPU D;  3J7Y J;  4YII A;  2FBH A;  2GLO A;  2E35 A;  2J5O A;  3KP7 A;  4UV9 A;  3QPT A;  4OMY A;  2XRN A;  3OV8 A;  1M1E B;  2CUF A;  4A2U A;  1NTC A;  2EFW A;  1XN7 A;  5LEK A;  2AS5 F;  1G3T A;  3A01 B;  2DMP A;  2O8X A;  4DOZ A;  4RB3 C;  3JRB A;  1K61 A;  4B48 A;  1B9N A;  3K4K A;  2BOL A;  4EJV A;  5GAH J;  3SDB A;  3WTY C;  1P92 A;  4IXA A;  1QHG A;  3H3U A;  1YW7 A;  2DPD A;  5EEH A;  5E3O A;  2ELH A;  3U1K A;  4G6D A;  1TQI A;  1XB4 A;  3VWB A;  1Z3X A;  4HEA 2;  3F72 A;  4IRI A;  1RKW A;  1UJ8 A;  2L01 A;  1V4R A;  4BS9 A;  3OS2 A;  1JE8 A;  1KA8 A;  3FXM A;  1KQ0 A;  5H2F C;  5C4J J;  1Y0U A;  2WY8 Q;  2V7F A;  3HEF A;  1HDP A;  5B1A H;  2VT3 A;  4LG0 A;  1IRZ A;  2KLO A;  4NC7 A;  1QZY A;  5J3L A;  4A6E A;  3UKG A;  2A5W A;  2Z33 A;  3LWF A;  5HS7 A;  1SFO J;  2LF7 A;  1MMD A;  2VC0 A;  2E1M C;  4X6A J;  4XRS G;  1Y56 A;  2G0E A;  4UUS A;  4LMY A;  3CJQ B;  1I6H J;  4E7K A;  1GVD A;  3OYA A;  4IO9 F;  3RPU A;  2R7V A;  1H9G A;  1FSE A;  4A3K J;  2ZME A;  5LBQ A;  1WHU A;  3QQA A;  5BQT A;  2VXZ A;  2XV4 S;  2VKE A;  3MN2 A;  1QRY A;  3DKX A;  5DEQ A;  1CQT A;  3IKT A;  1IN7 A;  2NYX A;  4BEH B;  2Y9Z A;  2KL4 A;  2GOX B;  2E2I J;  3F8N A;  1UG2 A;  1R71 A;  5FD5 A;  5A2Q Z;  2V9P A;  3F6O A;  4C3I J;  1U2W A;  3BPV A;  4CCK A;  1G3Y A;  5CVV A;  2R7W A;  1BL0 A;  2LNB A;  4UY8 I;  2O5R A;  2QYO A;  5J8F A;  2CSO A;  1TT5 B;  3LST A;  1Z7U A;  3KLN A;  4UVC A;  2XF5 A;  2MW8 A;  3T0Y A;  5B66 C;  1MDM B;  3RTR A;  1J5Y A;  3TO7 A;  1R36 A;  4M3G A;  1YOV B;  4MO7 A;  3LSK A;  5A2Q K;  4Y17 A;  3O8H A;  2BY2 A;  1YX5 A;  5DD8 A;  4FT8 A;  4M6V A;  5E20 A;  4CZC A;  1DPU A;  2EIM H;  1WJD A;  3GEZ A;  4MFD A;  3R4K A;  2ZB9 A;  2ZFU A;  3R6S A;  3ZPL A;  5JVT A;  3BC8 A;  4M9X A;  4D7N A;  2KDZ A;  2JA2 A;  2XKP A;  4G12 A;  3G3Z A;  3K4J A;  4IQJ A;  3E6M A;  2X6X A;  3NQO A;  3A2K A;  3C2H A;  1F4K A;  4V2G A;  1EJ9 A;  2RQQ A;  4AVZ A;  1WQ2 A;  2DFE A;  3LSI A;  5M3M J;  1FOY A;  1X2N A;  4R1H A;  4ZYH A;  3FK6 A;  4N4O B;  1UHW A;  2XGD A;  4MQ9 F;  2HQN A;  3RPQ A;  2DFF A;  2DBB A;  3FF5 A;  1R5I D;  2XGC A;  4D0P A;  4R8H A;  3CMY A;  4OMZ A;  5HLT A;  1WCM J;  1GDT A;  1F36 A;  1LFU P;  1FIP A;  2YX7 A;  1EH6 A;  5IOY A;  3I0T A;  1SAN A;  2D1H A;  2DT7 B;  3EUH C;  1V5G A;  1HW1 A;  3KFW X;  1LB2 A;  3HZJ A;  2PJP A;  5JFR A;  3JTH A;  3LSJ A;  3DPT A;  1XMX A;  2GIZ A;  2KFD A;  1PUF A;  3F9K A;  2TRT A;  3GBG A;  4RAG A;  4FTH A;  4Q48 A;  1ZYR F;  2H1L A;  2QSG X;  1MBH A;  1TT0 A;  2ZXH A;  3M8F A;  4IOA F;  1DDN A;  2DOE A;  4EM1 A;  3X2Q H;  2UUZ A;  4ZDL A;  4F91 B;  5EGO A;  1VQ4 I;  5GTI C;  4D5C A;  2X6W A;  4G94 A;  4B09 A;  3OSG A;  5E1X A;  3ZMV A;  5M5X J;  2VKH A;  5HLH A;  2G9W A;  1BJA A;  5IY5 H;  1Z91 A;  1Q1V A;  2XIG A;  2K9Q A;  3ESW B;  1N25 A;  3I53 A;  2JK3 A;  3C18 A;  3KZY A;  1XD7 A;  2QQ9 A;  2JUC A;  2ZXI A;  2FXA A;  3BTL A;  2KP6 A;  2KRF A;  3V8L A;  4S05 A;  4N9I A;  1DGW Y;  4YFX F;  3CES A;  4IHV A;  4Y13 A;  2Z2S B;  3VDX A;  1O3Q A;  4NUB A;  1IV6 A;  4JX5 A;  4ITV A;  2EH3 A;  2F5C A;  5EG0 B;  3E6D A;  2GAU A;  4PJ0 C;  4U88 A;  3I4N J;  1R1V A;  2KHM A;  1O7L A;  1QNT A;  1HOM A;  2DOF A;  1A35 A;  2OCC H;  1RES A;  5L3D A;  1G6N A;  3ZQI A;  3FXK A;  4FHT A;  3IH2 A;  3K4M A;  3L2W A;  2HVR A;  2FMY A;  2XSJ C;  1YG2 A;  5DD4 A;  1JHH A;  1V55 H;  2HYF A;  2FBI A;  3FDY A;  3ABU A;  4E6K G;  2LTP A;  4XRS A;  2YU9 J;  5BNG A;  2V1U A;  4OU0 A;  2NOG A;  2CQX A;  1QBJ A;  1SFE A;  3QOD A;  1MBJ A;  2P7V B;  5IPA A;  2IA0 A;  3OYI A;  2IGK A;  2JRT A;  1T0F C;  4M73 A;  3HOX J;  1IAW A;  1Y39 A;  1QA6 A;  1P6R A;  3ECH A;  1Z77 A;  2L4A A;  2UZK A;  5KAF C;  2O03 A;  3S8P A;  1LNW A;  3FXO A;  2FE3 A;  2NVU B;  4F3Q A;  4XQF A;  2CS3 A;  1DGR M;  2P5K A;  3ZMD A;  1EV7 A;  1FJL A;  3HPG A;  4A3D J;  1W5T A;  1FNN A;  3K4C A;  1MIJ A;  2ELK A;  4XON A;  2L9R A;  1WZ2 A;  1WWX A;  3QWL A;  4OAY A;  2E36 A;  2F4I A;  3RIR A;  1T2K A;  2PEX A;  2Y0S N;  4I0B A;  2KQR A;  4PJJ A;  5BPD A;  3GFJ A;  4HAM A;  2DMT A;  1BIB A;  3DKY A;  3PNT A;  3WG9 A;  2MSY A;  4A3F J;  4CCL A;  1X19 A;  1D1B A;  2JJ7 A;  2WAQ N;  3KP2 A;  1YJN I;  4L18 B;  2RVC A;  3ABT A;  1YQA A;  1JKP C;  4JYK A;  4KIC A;  1NG7 A;  2W57 A;  4EMS A;  2PMU A;  4M3D A;  2L7K A;  4FX0 A;  3O6B B;  3TOB A;  2MH2 A;  4PSX A;  2GIV A;  3GTO J;  5FKM A;  1FTT A;  1NK2 P;  2CUJ A;  4WF2 A;  1IF1 A;  3J7Z I;  3JRD A;  1UST A;  1ZH5 A;  1U5T B;  2B7E A;  3TO9 A;  1IRF A;  2ZSH B;  3Q0W A;  4B1R A;  4AIK A;  3FMS A;  4QWQ A;  1YRN A;  3PSF A;  2HPI A;  1IRX A;  4AUX A;  2HVS A;  2QZ8 A;  3ABL H;  1QPM A;  2DA5 A;  1SD4 A;  3WOD F;  1W1W E;  2ZFW A;  1T95 A;  1WJB A;  4YEJ A;  4GFB A;  1FLI A;  2NRA C;  2XAJ A;  3FIS A;  3FZV A;  1XSD A;  3J7A Y;  4HPQ A;  2FA5 A;  2KRH A;  3QPS A;  2I10 A;  2FD5 A;  1S72 I;  2KT0 A;  3WHB A;  2LK2 A;  5LHI A;  4A0Y A;  4IHX A;  3J7A O;  3KEY A;  1OYY A;  1HC8 A;  3Q9S A;  3JRE A;  3GYH X;  5E3L A;  2JA5 J;  4OIQ F;  4M3B A;  3PQK A;  3BCB A;  3FXR A;  4YIR X;  1UFM A;  5IP9 J;  1ETX A;  4ENM A;  1BI2 A;  4BJ6 C;  1I3A A;  2XDV A;  3ABM H;  1HBX G;  4P55 A;  1N75 A;  2R7T A;  4RDU A;  1FYK A;  3T8T A;  3BLY A;  1QPI A;  4RB0 A;  3F21 A;  5FFX A;  4RAF A;  3ZMT A;  1SAU A;  2NS0 A;  4BY1 J;  3FXQ A;  3E97 A;  1WKM A;  1ERD A;  3L2C A;  2LOO A;  5D4S A;  2XUB A;  2ZXW H;  1V5E A;  1YS7 A;  5K1Y A;  1BW5 A;  4A3M J;  5DUI A;  1MW7 A;  3ZQQ A;  4XKB A;  2CRG A;  3TP3 A;  5D5X B;  4HX8 A;  2A3S A;  3P9C A;  3CCJ I;  2W24 A;  3O2P E;  3EET A;  3GFL A;  5FLV A;  2QKL B;  2PI0 A;  1YJW I;  5DYM A;  5KHD A;  2L7F P;  3IC7 A;  2NVX J;  4NQW A;  2D1V A;  1TC3 C;  3LL7 A;  3FHZ A;  4RM2 A;  2M0C A;  4S0H B;  1DPR A;  3E5U A;  2XC7 A;  4WCG A;  3BT9 A;  3V8J A;  4C2U A;  3GLX A;  3GLL A;  2PN6 A;  1S7O A;  3A1Y A;  3L9F A;  3GZ6 A;  3CQZ J;  5HLG A;  4LLN A;  1R1U A;  1RUN A;  1Y6I A;  2ZJR F;  4BGD A;  1VQM I;  3BY6 A;  1XCB A;  2ZCW A;  2CV0 A;  4IHS A;  1S29 A;  3RQI A;  4U0W A;  2V1X A;  4L9N A;  4OWR B;  4B3X A;  1FOX A;  2R5Z A;  4PFO A;  4MHG A;  4RA2 A;  5LHH A;  3TDU C;  4BYY A;  3K70 C;  1R1T A;  2R5Y A;  1MJA A;  1V3F A;  1W0T A;  1VQP I;  1ZR2 A;  2M8G X;  3DPU A;  1LVA A;  1MZB A;  3H9J A;  4WWC A;  2O8K A;  3E5X A;  1KYZ A;  3W6J B;  4L9V A;  2VBX A;  4IQ4 A;  2XB5 A;  3V7C A;  1VND A;  1SMT A;  3G71 I;  4HX7 A;  2B0L A;  4DYQ A;  4E7J A;  2HOA A;  3EUH A;  3CCY A;  4A5N A;  1RKT A;  3HTS B;  2FOK A;  3LA3 A;  1FP1 D;  4GRI A;  1YLF A;  4KA4 A;  1P7I A;  2LFB A;  2RGV A;  3GZ5 A;  1FIA A;  2VUM J;  4E7H A;  2EIK H;  1STZ A;  1L3L A;  3M1C A;  1IXR C;  1YTY A;  4ON0 A;  4MLO A;  3U9G A;  3WGH A;  1EKE A;  2CO5 A;  2K9N A;  2PMZ N;  3D0S A;  3KP6 A;  4XM3 A;  2R0Q C;  4ZTJ A;  4IOC F;  5DTD A;  2HTJ A;  3BR1 A;  2MBF A;  1SD6 A;  1BJZ A;  2IGN A;  2KMU A;  2Q1Z B;  2OZ6 A;  3QAH A;  3JSP A;  2M3A A;  2TDX A;  3SZG A;  1R5H A;  4CGZ A;  3NRV A;  3HYI A;  3VYU B;  3OYG A;  1SEU A;  3HRM A;  3FXU A;  2CFO A;  4B47 A;  4CCO A;  2K3P A;  4CZZ A;  3RKX A;  2B9S A;  3GWZ A;  4O5V A;  4GYI A;  2UWM A;  3K2A A;  1UZC A;  3HDD A;  3E7L A;  4F55 A;  2VIX A;  3J80 Z;  2AQE A;  4PCQ A;  2LP0 A;  2Y2Z A;  4G7O F;  3F23 A;  3W3C A;  3S2H J;  3KPH A;  3OYF A;  1LVK A;  5JHF A;  2XRO A;  2JRM A;  2N8G A;  2QM3 A;  4Z6Y A;  1F1Z A;  3D5L A;  3OYC A;  1D8K A;  3HKZ N;  3W2V A;  2HQA A;  3BJA A;  4KN7 X;  3V8K A;  1D1C A;  3DEE A;  1R7J A;  1U8R A;  3J80 K;  1E3P A;  3S3M A;  2FML A;  4A93 J;  3Q5F A;  1U9O A;  2Q0O A;  1USS A;  2QEX I;  2A6T A;  4KYW A;  1TW2 A;  2PFB A;  2OBP A;  2HQR A;  4EM2 A;  1B72 B;  2LDU A;  3PIP F;  2IS2 A;  1BN5 A;  4IEJ A;  1I1G A;  5FRM A;  4UVB A;  1LDK B;  4XSZ F;  2XPU A;  3KP4 A;  2D5V A;  1T0F A;  2YS9 A;  1IO2 A;  1BI0 A;  1GLN A;  1FOW A;  4BKX A;  2DFI A;  4PGG A;  1FP2 A;  3EUK L;  1QVT A;  2E2J J;  1FEX A;  2QQ8 A;  4HV6 A;  3S15 J;  3IAM 2;  2P6S A;  4NB5 A;  1E3H A;  3RYR A;  1RC9 A;  3KX2 A;  3PNV A;  5DCF A;  3OL4 A;  1T98 A;  1B4A A;  3PUB A;  4YG2 F;  3BDD A;  1MNE A;  1OLT A;  2DXI A;  4OOI A;  1U78 A;  1JUP A;  4ZTF A;  3F8F A;  4QLC U;  5ICC A;  2WC2 A;  3DBH B;  4JP0 A;  4MEY F;  5BMZ A;  2QBY A;  4N4N B;  1LKX A;  1K83 J;  1H9T A;  2VOP A;  3CCL I;  1I3Q J;  1R23 A;  4UB8 C;  5FGM A;  5ILS A;  3WE2 A;  3DTE A;  4ZYD A;  1B8I A;  4M9Z A;  2IT0 A;  1DP7 P;  2X1C A;  1VQ6 I;  3PIO F;  1ZGW A;  1TWF J;  4P9U A;  3ZMU A;  1YIT I;  1MMN A;  2OD5 A;  2F5V A;  1APL C;  2Y75 A;  9ANT A;  3I55 I;  2DTR A;  2LMD A;  2FQ3 A;  5DUK A;  5M3F J;  1Y1W J;  1FOK A;  2E1O A;  3QOP A;  2CGP A;  2XAG A;  5K7F A;  4ZC3 A;  4B44 A;  4KIB A;  3SEQ A;  3I4M J;  1D0Z A;  4UUS B;  5K7H A;  2Y0M A;  1IN6 A;  1IW7 F;  2A6E F;  2GXB A;  2W4S A;  3SDG A;  2MYS A;  3BR3 A;  2H6C A;  2CJJ A;  1GHC A;  4BU2 A;  1MJ9 A;  2AO9 A;  2WAE A;  2ZME B;  5HS8 A;  1GVJ A;  4C30 A;  3Q3S A;  2RKH A;  4L9T A;  2MA3 A;  2DYS H;  3HSR A;  5CLS A;  4DNC A;  4LLG F;  5LGT A;  1X1B A;  1EF4 A;  3S1R J;  3PFI A;  4A69 C;  1LDD A;  3LSR A;  4IZZ A;  1Z9C A;  4Y3O A;  1HA8 A;  4LK0 F;  2VQL A;  4KMU X;  2VBZ A;  3WTS C;  1W0U A;  4FCY A;  4O3M A;  4D9J A;  4LK1 F;  1B1B A;  3AKZ A;  4EGZ A;  3OIP A;  4IKF A;  2VE9 A;  2KIM A;  3HOZ J;  1SC7 A;  3MCZ A;  1EH8 A;  3V7S A;  4AIH A;  3JR9 A;  5CVJ A;  2LRD A;  5KVR A;  2P81 A;  3K70 D;  1DU0 A;  2EB7 A;  1RI7 A;  2KZG A;  2ECB A;  4ZJZ A;  3W2W A;  4PUS A;  2R3S A;  3QU6 A;  5K5O A;  2OU2 A;  5DCM A;  3BTJ A;  2K9M A;  5J1R A;  4XK4 A;  5HDK A;  2OA4 A;  4CUG A;  2CW0 F;  3U1D A;  1YIO A;  2FJ1 A;  3PUF A;  3LSP A;  2EZK A;  2MD0 A;  2HPM A;  5L3G A;  5C4X J;  4KUM A;  4U87 A;  4P96 A;  4NNJ A;  2M30 A;  2IA2 A;  4CO8 A;  2EWN A;  4CIC A;  3SZT A;  1JUS A;  1ETY A;  2DYR H;  3OOU A;  5HOD A;  3BR5 A;  3WTZ A;  2EFN A;  2LC2 A;  4HNU A;  1X4O A;  1TL8 A;  4RMN A;  1ETV A;  3VYT B;  1IDZ A;  2DLL A;  2IPQ X;  2A07 F;  2Z16 A;  2IVM A;  2MAB A;  2OAZ A;  2L5Q A;  1WGX A;  1Z6R A;  3CJR B;  2HI3 A;  1PUF B;  3OYN A;  1A6I A;  2M8E A;  2MFZ A;  4CYC A;  3ERE D;  4IX7 A;  5B1B H;  2HTS A;  3CZ6 A;  3AL0 C;  1UHS A;  2MGQ A;  3BOQ A;  1C0W A;  3RYP A;  3CUO A;  3AAF A;  2H1K A;  1HLV A;  2DA7 A;  4ZYG A;  1RZ4 A;  5IT3 A;  1MMA A;  5EGO B;  3U2R A;  2AXL A;  2DW4 A;  2VI6 A;  4D7M A;  2OTL I;  3VSK A;  1X1C A;  3ULQ B;  2JQ7 A;  2CMP A;  3CF5 F;  2STW A;  1VTN C;  1EH7 A;  1ZRF A;  3COA C;  5E17 F;  1R4N B;  1I1S A;  4YFN F;  4PSW A;  1B6A A;  2XF7 A;  3PL8 A;  2LKX A;  3TGN A;  3HOS A;  2QKM B;  3GW2 A;  2BY0 A;  1BOA A;  1AOY A;  1KON A;  3E6C C;  4BXF A;  1WH5 A;  3TOA A;  2B63 J;  1PP7 U;  3GXO A;  5JHU A;  4B43 A;  3R0A A;  3OYB A;  2R4G A;  3DQV C;  4M71 A;  1TP4 A;  2XAQ A;  2XVC A;  4LB6 B;  1HXD A;  4GCV A;  3TKY A;  4JOM A;  3FXJ A;  5J4V A;  4HRI A;  3RCO A;  2GXA A;  1VQ9 I;  2HOT A;  4XLF A;  2VJ5 A;  2IP2 A;  3ZQG A;  2DT5 A;  5D5W B;  3SFZ A;  2XKO A;  1UEL B;  2XRL A;  2IS4 A;  3K2Z A;  4DW6 A;  2Y9Y A;  5FKO A;  1XG1 A;  4HF2 A;  3E5Q A;  1Y8Q B;  5IYC J;  1A04 A;  2CU7 A;  2M9H A;  1VQN I;  2WV0 A;  2DJI A;  1G3S A;  2E7W A;  2ZSI B;  3CCV I;  3CD6 I;  1B59 A;  2DQL A;  3IWZ A;  4BY7 J;  5EEA A;  3CCS I;  1ZEL A;  1ZAR A;  2BE5 F;  1ZK8 A;  1R58 A;  2F5D A;  2UXN A;  2XPV A;  3CUQ C;  3HSE A;  3Q9V A;  5EJC A;  5JLW A;  3CO7 C;  1PUE E;  1U0J A;  1OJL A;  3VPR A;  1KU9 A;  3BG5 A;  1WI3 A;  1OKR A;  2P0W A;  2IJL A;  1FBU A;  3F8M A;  1P2F A;  4KFC A;  2K27 A;  3K9T A;  1YHQ I;  1SD7 A;  2DTZ A;  4KDP A;  3G4S I;  2K4J A;  1XX5 A;  5AON A;  4E4H A;  4BE1 A;  2OJE D;  1OFC X;  2F6C A;  1X1A A;  4KT6 A;  2X6Y A;  4BQA A;  4I09 A;  3WGI A;  5JVG F;  5CJ9 A;  4XLH A;  4PJN A;  2P5L C;  4NDL A;  2XB0 X;  3GTP J;  2KIQ A;  2XF6 A;  4I6Z A;  1WFX A;  2LSO A;  2KRC A;  2EZH A;  3RKW A;  1MBG A;  3DF8 A;  2NVQ J;  4Y52 J;  1ZG3 A;  1H88 C;  3RZO J;  2VBY A;  1PYV A;  1HQC A;  3CTA A;  5CVU A;  1DUX C;  2EJR A;  3D5S C;  3SEZ A;  3DTK A;  3LMM A;  3TO6 A;  4WXH A;  2VPL A;  1QZE A;  4BHC A;  3M1E A;  1JT6 A;  3H1C A;  3GTL J;  5ICF A;  3ZQL A;  2W00 A;  1J7K A;  2VON A;  5CQG A;  2EPF A;  3W2A A;  5KK1 A;  1YS6 A;  5LRR A;  1XSV A;  2WBM A;  4DYC A;  2DMQ A;  3S2W A;  1YRN B;  4W1U A;  5DDG A;  4J19 A;  1K6O A;  4XL9 A;  4Q4Z F;  2X6O A;  5LEJ A;  5HVQ C;  2GA1 A;  2NVY J;  5TIS C;  1QQI A;  4MIM A;  5E1W A;  4CHU A;  2ISZ A;  3C3W A;  5ED4 A;  4BXX J;  2QGU A;  2GOM A;  3K4L A;  2VAS A;  1WRJ A;  1HCR A;  3BJ6 A;  3K4N A;  1OQY A;  2P8T A;  5ICE A;  4LIV A;  1NH3 A;  4YFK F;  3I5U A;  3DCF A;  1AWC A;  1TQM A;  3AG2 H;  3MKW B;  1Z05 A;  4UXN A;  3VYR B;  1OCC H;  5GTH C;  3S1N J;  5LGN A;  2PLY A;  2FUG 2;  2ISY A;  2H8R A;  1RIO H;  4QTR A;  1XSX A;  1MBF A;  1UCR A;  5J1U A;  1ETQ A;  1OCZ H;  3S3N A;  4G7Z F;  1P4W A;  1SAX A;  2EIN H;  2MLG A;  4Q5S F;  2HWV A;  3IWF A;  4I0A A;  4X1E A;  4EJW A;  1HKS A;  4RGR A;  4ETS A;  4XOT A;  1HDD C;  3TL4 X;  3CC4 I;  4C2T A;  2ZKZ A;  2OV7 A;  4HOB A;  3GME A;  4MFE A;  2FU4 A;  5J1Y A;  4M6X A;  2O6G E;  2PJR A;  1X1D A;  4DBR A;  4MTD A;  4I76 A;  2JMW A;  1K78 A;  1OCT C;  1F5T A;  2W84 A;  4RBO A;  3EYI A;  3HB9 A;  2R7D A;  2VJJ A;  4NC6 A;  3HJE A;  4HSR A;  4RLQ A;  1KU3 A;  4LGW A;  3IV5 A;  3S14 J;  1A36 A;  4ZDP A;  4CCJ A;  2Y69 H;  1FC3 A;  3ABK H;  2QQA A;  3U21 A;  2DN0 A;  2ACJ A;  1GXP A;  1Z1D A;  4NQW B;  2WB1 N;  4AC0 A;  2A61 A;  2JA7 J;  3GUD A;  2EA2 A;  2F48 A;  3ZMS A;  1FY7 A;  3S1M J;  3ZP5 A;  3QU3 A;  3O8G A;  4BJ5 C;  5D5U B;  3N05 A;  2VQC A;  3ROU A;  4XOR A;  1LFB A;  3M9A A;  1X3Z B;  2WAD A;  1J59 A;  3RJP A;  2OPT A;  3QP5 A;  5D8L B;  1I39 A;  2EFQ A;  3BG6 A;  1XMA A;  4V19 K;  1IN8 A;  3HGY A;  4N9H A;  2A69 F;  3IH3 A;  5EZH A;  2L2O A;  4G7H F;  2Q2E A;  4I2O A;  4AYB A;  1LJ9 A;  2NAZ A;  4LIT A;  1ETO A;  3GCM A;  3P9K A;  4QIW N;  3HOU J;  2R5Z B;  1ONV A;  4BQN A;  4CCN A;  2E5Z A;  2WWY A;  3IP4 B;  1R4M B;  2JPB A;  1WPK A;  2Z5U A;  1YFH A;  4ENK A;  2EQR A;  5L3B A;  2W7N A;  1D0Y A;  3I3L A;  4MEX F;  2R92 J;  3RSN A;  2DMN A;  1WVR A;  2NS8 A;  3HG9 A;  4D5F A;  3TED A;  4E7S A;  3DBR B;  2JA8 J;  3I59 A;  4PJM A;  3LNQ A;  4M3F A;  5J6X A;  1MMS A;  1AHD P;  3KYD B;  2YSR A;  2WTE A;  3PNY A;  4RM3 A;  2COB A;  4U7D A;  5IYD J;  1E3O C;  2ZBK A;  4II2 A;  2V6E A;  2BBY A;  3M7G A;  1AKH B;  2L9S A;  5FD6 A;  5FB2 A;  5D6E A;  3LQR A;  4LOC A;  1AA7 A;  3DKW A;  4DGW B;  3Q0U A;  1AU7 A;  4IRG A;  4A3B J;  3I4P A;  1YIJ I;  1W7P D;  1YW8 A;  4HZF A;  2G7U A;  3G1O A;  1BI3 A;  3KP5 A;  1KYW A;  2WB1 A;  2ZNY A;  3MMY B;  4A12 A;  3S3O A;  2ELJ A;  1ETK A;  4G6Q A;  4NBQ A;  2RDP A;  1HSJ A;  1BA5 A;  1ZRD A;  2V9K A;  3HXL A;  3F8B A;  2DOA A;  2YUS A;  3HM5 A;  5F0F A;  4PGH A;  1OMI A;  3MWM A;  3L2R A;  4IPA A;  3L2V A;  4M9S A;  5JR3 A;  1POG A;  1S8N A;  2D45 A;  3NAR A;  2VQG A;  3M8E A;  3H3V K;  4C2M J;  1TTY A;  3CMM A;  2DI3 A;  3HSF A;  4ENJ A;  4HQE A;  2UXX A;  2OCE A;  3LA7 A;  4GYG A;  4LJZ F;  1O7F A;  2Z1D A;  2QLZ A;  3BCA A;  2K9L A;  1F43 A;  3CCQ I;  1BIA A;  5EDN A;  3AG3 H;  1NG6 A;  2CUZ A;  2BW3 A;  3QYB A;  4XSX F;  5E1Z B;  3SYT A;  4FET A;  4ZZD A;  2E1N A;  5ICG A;  2XHK A;  2WA0 A;  3EDP A;  3I56 I;  3H3Z A;  3FWE A;  2BXZ A;  1LEB A;  2K7L A;  2CQK A;  2QCO A;  3MZH A;  2E5N A;  3EQL F;  2LBF B;  6PAX A;  2VJI A;  1DQU A;  1R00 A;  3GTG J;  2FQ4 A;  2PX9 A;  4GXO A;  3BZC A;  1FWZ A;  2HFH A;  4V2F A;  3SHF A;  3I64 A;  2M7B A;  1JUM A;  2MC3 A;  4HW0 A;  3L1P A;  3H5N A;  5H6Q A;  1U3E M;  1VQO I;  1W7P A;  3LFU A;  2W25 A;  5FLX Z;  3C2B A;  1CF7 B;  1OYI A;  3RI4 A;  1JJ6 C;  3LAJ A;  1SFX A;  1BC7 C;  1S6L A;  1MH3 A;  2DO7 A;  3T5X A;  1PDN C;  1YW9 A;  2JPC A;  3K0L A;  2LYC A;  3BTI A;  2Z99 A;  3H5A A;  2LKP A;  3P9I A;  3V4G A;  3PO3 J;  5F6F A;  3KYC B;  2X1E A;  4EQQ A;  3CUQ A;  3HUG A;  3KEQ A;  2ESN A;  4YRV A;  4U7B A;  2GA2 A;  4I02 A;  2BVM A;  2HNH A;  4RS8 A;  4U0Y A;  2HDW A;  2C6Y A;  3OYE A;  3CJN A;  4ESJ A;  1UG0 A;  2ETH A;  5LLQ A;  1XDS A;  3OSF A;  2V6C A;  1XS9 A;  5FKK A;  1HKT A;  3JRA A;  3DP7 A;  3S32 A;  4QPO A;  4EJU A;  3KCC A;  1S3J A;  1UHM A;  3F3X A;  3HL2 A;  1MSF C;  4AIJ A;  1BR4 A;  4JBA A;  2Z9O A;  2QEN A;  2GXG A;  2EZI A;  1SFK A;  3CCE I;  1Z0X A;  3O3K A;  4DYR A;  5J40 A;  4M72 A;  2DCE A;  5E18 F;  3OYH A;  2YU3 A;  3OYD A;  3ISP A;  2QBY B;  2K02 A;  2ZO4 A;  3OIO A;  2EZL A;  2CV2 A;  3FM5 A;  2CYY A;  1B9M A;  3V7R A;  1ZRC A;  3BQY A;  4BL0 B;  2RAE A;  4ZDO A;  1B8I B;  2DAO A;  2EA4 A;  2X51 A;  1IV8 A;  1DU6 A;  3QOE A;  2XSD C;  5IT9 Z;  2L02 A;  3JRF A;  5HS9 A;  1R9T J;  3LOC A;  4BE2 A;  2HKX A;  3RKY A;  4OIN F;  2E71 A;  5DM6 F;  2AHQ A;  3MKL A;  3CCM I;  1R49 A;  4L0Z B;  1PJR A;  1IZ1 A;  3IRR A;  2LLK A;  3E0J B;  1VQ7 I;  1SD5 A;  4XRF A;  3S93 A;  2EIL H;  3LQQ A;  3GVA A;  3DPL C;  3KZZ A;  2ME6 A;  2A68 F;  3ML6 A;  3WE3 A;  5IT9 K;  5IP6 A;  2X9D A;  5M5W J;  2K9S A;  4ZYA A;  3OMY A;  2DDA A;  1GUU A;  2K40 A;  3ECO A;  5F1R A;  1ZTR A;  2OQR A;  4BDY A;  2F2E A;  2HXI A;  3BZ6 A;  3DV8 A;  2M45 A;  3GZN B;  1YE9 A;  4FE4 A;  5C44 J;  5JI6 A;  1KZH A;  3WGG A;  1Z3Y A;  4NC8 A;  3L09 A;  2GQQ A;  2IGM A;  3FMR A;  5HDG A;  1WSU A;  4W97 A;  2EIJ H;  2HR3 A;  1PVE A;  2BHY A;  1HW2 A;  4XOP A;  1BM9 A;  3R60 A;  2YX4 A;  3AG4 H;  2VKD A;  1ZLJ A;  4DBQ A;  1HKQ A;  1X3U A;  1XGO A;  3LAP A;  1JT0 A;  4AU7 A;  1O3T A;  1HST A;  5L3C A;  1G8X A;  2VQH A;  1BR1 A;  1FMV A;  1XCV A;  3M07 A;  4XBF A;  3MKY B;  1IJW C;  2M0M A;  3G1M A;  3DTI A;  2ZC2 A;  1J0R A;  2CUE A;  1JXS A;  1MBE A;  4Y15 A;  4Z2Y A;  2CH0 A;  2QWW A;  1IC8 A;  2RC4 A;  1VQL I;  3WTT C;  2UV1 A;  3OL3 A;  2XGX A;  3P5J A;  2IRF G;  2L7M P;  2ZJ2 A;  4RGS A;  3M3Y J;  4G6T B;  2PBI A;  1ZLK A;  4E70 A;  2DK8 A;  4RLF A;  1ODD A;  1XC5 A;  5L3F A;  2ZJQ F;  4EJO A;  3FX3 A;  1FBQ A;  1ORK A;  1OR7 C;  2R7Z J;  1E2X A;  5KNL A;  2HZT A;  4LG0 B;  5C3E J;  4BUP A;  2O61 A;  1FX7 A;  3MEX A;  3T1B A;  1LFP A;  4BQQ A;  4Q47 A;  4KIT B;  2A05 A;  5EYR A;  2IAI A;  3D1N I;  4CYC B;  2K5C A;  1G3W A;  3VOE A;  5TJJ A;  5GAG J;  4AVP A;  2FNP A;  4XN0 A;  3H0D A;  2DU9 A;  3BPX A;  3S2D J;  1IUF A;  1GV2 A;  3D5R C;  3I71 A;  3KYL A;  2DA6 A;  3MQ0 A;  5AIQ A;  3BJO A;  3CP2 A;  1S9H A;  2HQ5 A;  3DWL E;  1W4M A;  3C2G A;  2JN6 A;  1JKO C;  4IRH A;  1ZG5 A;  1D5V A;  1ZR4 A;  1YI2 I;  2RV8 A;  1TBX A;  2HXO A;  1F9N A;  3I9V 2;  2KIF A;  3KP3 A;  2CV1 A;  4I99 C;  2FF4 A;  2A6H F;  2HYJ A;  3OYL A;  1X1P A;  1ENH A;  2M2E A;  5FKL A;  3MD2 A;  2L9V A;  3HC7 A;  4HF1 A;  2CW7 A;  2HZD A;  3C7J A;  2VT2 A;  3HOY J;  1WJA A;  3HOT A;  3EPZ A;  5D8K B;  4JQF A;  4Y33 A;  1LQ1 A;  2V1D A;  1A5J A;  5HLI A;  2VJ4 A;  2MLK A;  1O4X A;  2XGE A;  4EGY A;  3CDH A;  2VC1 A;  4G8X A;  1KU7 A;  1FMW A;  1P4X A;  4A0Z A;  1IDY A;  5GPA A;  3KET A;  3FBN B;  1YX3 A;  3JRC A;  3MKZ A;  5ILV A;  1I27 A;  1ULY A;  1J75 A;  3NWT A;  2LRE A;  2OZU A;  4I98 B;  1T8I A;  3E6B A;  2DA2 A;  2O3F A;  4JK1 X;  1IN4 A;  1T6S A;  2JT1 A;  2DA4 A;  2ZNZ A;  1S7E A;  5DV5 A;  2E7X A;  3HGG A;  3HPH A;  4F52 A;  2X85 A;  5B3S H;  1SMY F;  2ZJP F;  3JRI A;  4F93 B;  2EV0 A;  2L7Z A;  4BXU A;  2BY3 A;  3A03 A;  3B6C A;  2QUF A;  4OAZ A;  3GTQ J;  3JRH A;  2DA3 A;  3DXJ F;  3K10 A;  1LE8 A;  1FT9 A;  3ASO H;  5FFZ A;  1TWA J;  2RRE A;  1G4D A;  5K7Z A;  2XAF A;  3K69 A;  5AIP A;  2DPU A;  2O7O A;  2PQ8 A;  2CG4 A;  4KMF A;  1WI9 A;  2QSH X;  3B73 A;  3G6E I;  1JGG A;  5E3M A;  1D5Y A;  4J00 A;  1ZQ3 P;  4BJT A;  4A3E J;  3PQJ A;  1RUO A;  4XLC A;  3ZQC A;  1TWC J;  2G7H A;  1S7A A;  3K1P A;  3ZR8 X;  1X4P A;  3RKQ A;  4HX4 A;  4ESF A;  1KQ9 A;  1R5G A;  2RNJ A;  1ZRE A;  3TMO A;  2BGC A;  3CLQ A;  1FYL A;  2L4M A;  4CCM A;  1O3R A;  2EBI A;  2QQB A;  4A3C J;  2WY7 Q;  1VFC A;  2M87 A;  2JVH A;  2OQG A;  3LSM A;  1HW5 A;  2DFH A;  2NXN B;  2ADU A;  5DS9 A;  1X2M A;  3ERM A;  2R7S A;  4UB6 C;  2W85 A;  5HOO A;  4C3H J;  4E7Z A;  4XKV A;  3ZCO A;  4XLN F;  2VOD A;  3FHN A;  3DLL F;  1Z67 A;  2HGC A;  1MH4 A;  3ZN1 A;  5H20 A;  4BDZ A;  2KZV A;  4WK8 F;  2H6B A;  1QVU A;  1U5T C;  4XR6 A;  2CQQ A;  2K86 A;  3CCU I;  1XGS A;  4JX4 A;  2D2W A;  4P9F A;  4GDF A;  4A6D A;  3N4M A;  2H8W A;  1I6X A;  3UNG C;  3A01 A;  3CMA I;  3REO A;  1X3W B;  2DQR A;  4HF0 A;  3S1Q J;  2HYG D;  2W1O A;  3I58 A;  2OUM A;  3OR1 C;  1IG7 A;  4QSH A;  4UV8 A;  3GFI A;  5CKT A;  2X0L A;  3WTV C;  3FK7 A;  4B3A A;  1TWG J;  2L0K A;  4CYD A;  3OYK A;  3L2Q A;  2H27 A;  2HOE A;  2MD5 A;  4JX6 A;  5M5Y J;  2YR2 A;  3OYM A;  2LKS A;  1T56 A;  1YYV A;  4PZJ A;  1LUJ B;  3QRF F;  1ZGJ A;  2Q8K A;  2V9V A;  2R7F A;  4O6J A;  4UHT A;  5E8I A;  2FX0 A;  3L00 A;  4AM3 A;  1D1A A;  2PJR B;  3TDZ C;  2IXS A;  2K3F A;  3A4C A;  3CDL A;  1K78 B;  4NHJ A;  4XKW A;  2OC6 A;  4MQV A;  1REP C;  3F0C A;  2KJC A;  3LSH A;  1UB9 A;  1T38 A;  3WU2 C;  1A6Q A;  1ON1 A;  2LY9 A;  1MND A;  4IL6 C;  5J8C A;  1JTY A;  1K6Y A;  1ZHF A;  4ANJ A;  1E17 A;  2L3D A;  5FO5 A;  1J9I A;  2I5U A;  2WAF A;  3AFH A;  4RGU A;  2J5P A;  2M4K A;  4EVI A;  1V5F A;  2Y31 A;  4PJL A;  3TW6 A;  4ZZL A;  1H89 C;  3BZK A;  1SVO A;  1WJF A;  5K5Q A;  4E7L A;  3JTG A;  2E34 A;  1OCR H;  3KE2 A;  3WHC A;  1LEA A;  2HDC A;  2A5Y B;  1NHA A;  2K85 A;  2Z3Y A;  1ACI A;  1WJE A;  3WTU C;  4BEH A;  1D3Y A;  4QPQ A;  2PG4 A;  1ZN2 A;  3K4B A;  2Y30 A;  1OCO H;  1SVL A;  5LD2 C;  1XPX A;  4XLP F;  3IUO A;  1O57 A;  4M74 A;  4A3J J;  3SXY A;  3MFK A;  4RAY A;  2EV5 A;  2KIS A;  4UVA A;  2ECC A;  2NS7 A;  5E79 C;  4X0G A;  2JVG A;  2IS1 A;  2Q2E B;  1QHH D;  3DEU A;  4HLY A;  3ONQ A;  1TZL A;  1P4A A;  1MDM A;  4P1W A;  2EFO A;  2IA1 A;  1GV5 A;  3HHG A;  5F64 A;  3BG9 A;  4EAT A;  3FM3 A;  1IXC A;  3G1L A;  5ERI A;  2E1C A;  3QYF A;  4XIC A;  3LSG A;  2HOS A;  2ID6 A;  3EYY A;  4B4C A;  3BWG A;  5EEG A;  3I59 B;  1ZGA A;  3ZGK A;  4XKC A;  1QO0 D;  4HG2 A;  5HNH A;  4ABZ A;  1YO5 C;  3CC7 I;  3CF2 A;  5F04 A;  3C1D A;  1BBY A;  3CJT B;  2QSF X;  3GF2 A;  5B5E C;  4I7H A;  2GM4 A;  3S17 J;  5GAE J;  3FXL A;  3BG3 A;  4AYB N;  2FSW A;  1RR8 C;  1OR7 A;  1QU3 A;  4IVN A;  3MZY A;  3HTU A;  4L5I A;  3TW7 A;  3KEO A;  2HKO A;  2IGO A;  1MSE C;  3WTX C;  2E1M B;  3VSL A;  3GTK J;  2ME0 A;  2M4G A;  4E7I A;  2H94 A;  5ILU A;  3HOV J;  4A3L J;  1OCP A;  1Z21 A;  3Q0V A;  3OS1 A;  2XAS A;  4BAC A;  2HEO A;  3AL0 B;  2QVO A;  3SQN A;  3W6K B;  2ICW G;  3IAS 2;  2OTJ I;  2ID3 A;  3BR6 A;  4CDG A;  2DDB A;  1VF9 A;  4ENN A;  2RQP A;  1TWH J;  1XDU A;  2X48 A;  5E8G A;  1K4S A;  1CGP A;  4HV5 A;  3DU6 A;  3T8R A;  5FKN A;  3H92 A;  2BYV E;  3QP6 A;  4S04 A;  1IXS B;  4BBR J;  4IJA A;  1DP3 A;  2BW3 B;  3NEU A;  1N77 A;  1D8J A;  3DBL B;  2CQN A;  1VI0 A;  1IN5 A;  3ZMZ A;  3WU1 B;  1FYM A;  3H5R A;  1JKQ C;  2LD5 A;  2DMU A;  3M4O J;  3WU0 A;  4PDK A;  3TQN A;  5J4Y A;  3GTJ J;  4FX4 A;  2R93 J;  4Y7N J;  4H4K C;  3WG7 H;  4LLL A;  3VOD A;  1VZ0 A;  3A0B C;  3BQZ A;  2AXT C;  3PJR A;  1JGS A;  1W7P B;  1QGP A;  4OIO F;  4PFP A;  2R5Y B;  4A3I J;  1EA3 A;  2BEO A;  4B8X A;  4WXD A;  3VYS B;  1ZKG A;  1Z6T A;  2W48 A;  1I50 J;  2VXD A;  5EG0 A;  1ZAO A;  2M7A A;  1MMG A;  1Y1V J;  2L54 A;  3F8C A;  3IH4 A;  5KAI C;  4XLA A;  1T39 A;  1MKM A;  4II3 A;  3CUQ B;  3HUG B;  1IGN A;  4EM0 B;  2KPM A;  4FIS A;  2DOD A;  3BR0 A;  4LG3 A;  4GO1 A;  3H9G A;  3UR3 C;  2ESH A;  1Y0N A;  3KLO A;  3BP8 A;  3A0H C;  1BI1 A;  4HA8 A;  2XPW A;  1BOB A;  4DJA A;  3TP0 A;  5D4R A;  1RRJ A;  3KIO A;  1RR7 A;  2EFP A;  5H6R A;  1TQP A;  4DZP A;  2MG4 A;  3L2U A;  2H09 A;  5D5V B;  1R22 A;  4BE0 A;  5CYV A;  1MD0 A;  2EK5 A;  2CW8 A;  2JA6 J;  2Y0S A;  2GZW A;  4RB1 A;  3H36 A;  4L5E A;  4XRM A;  4BH9 A;  2CWE A;  2X1D A;  5CQE A;  4FE7 A;  2KDO A;  4MGR A;  3ZQ7 A;  2L9N A;  1OPC A;  4XLE A;  2WAQ A;  3WTW C;  4RAZ A;  2XAH A;  1ITY A;  4L5J A;  4KIS A;  1W5S A;  1W5C C;  4BAY A;  3HRU A;  2R7Q A;  2DT6 A;  2F4O B;  2VKV A;  2V4J C;  3IL2 A;  1G59 A;  1U6G A;  4LFU A;  2DA1 A;  1K4T A;  3FMQ A;  1VQ5 I;  2GBY A;  3IKV A;  4UUT A;  4XID A;  3G2B A;  3CLO A;  2F5F A;  1GT0 C;  4PK4 A;  5LHG A;  5BOX A;  2V79 A;  1QZZ A;  1FSH A;  3DLA A;  3QPH A;  4KIF A;  3JAM Z;  2BZT A;  4RGX A;  3GTM J;  4AID A;  2LY2 A;  1A31 A;  2JZY A;  4G9Y A;  2F4M B;  2ZXJ A;  3LFK A;  4XN3 A;  2HVQ A;  3JW4 A;  3OIQ A;  4F7Z A;  4LIU A;  3JRG A;  1W36 C;  4L0Y B;  1U5T A;  5F27 A;  3N97 A;  5TGT A;  3JAM K;  2O0Y A;  3BRO A;  4DIQ A;  1O3S A;  4AWX B;  3CC2 I;  4HDU A;  1K79 A;  5K5R A;  4KT5 C;  5GP9 A;  1N78 A;  3ZN0 A;  4YIF A;  2JWT A;  4D1Q A;  3CME I;  2KJB A;  2P6T A;  4FQG A;  4H0E A;  4N0B A;  4HNV A;  2P7C B;  3K6G A;  1NK3 P;  2NVT J;  2ZME C;  2KIU A;  3K1N A;  5FLX K;  5TRD A;  2VPR A;  3H9Q A;  5BS6 A;  1LDJ A;  3OOP A;  1WJC A;  1P7J A;  4A0X A;  4GGG A;  2M1B A;  1MGT A;  1RNL A;  4CA0 A;  2HS5 A;  4AD9 A;  4ZYE A;  1XGM A;  2BY1 A;  3SFI A;  2BXY A;  4HBL A;  3GX4 X;  1VQK I;  2LF8 A;  3ZOB A;  3W6V A;  3FBI B;  2LY1 A;  3RZD J;  3IRQ A;  4CSW A;  2HDD A;  1AKH A;  2GWR A;  1YJ9 I;  1WH7 A;  2M34 A;  4M3E A;  2LG4 A;  1U8B A;  3EUA A;  1Q1H A;  3QYE A;  5E3N A;  1TNT A;  3VB2 A;  1E0E A;  4A5M A;  5HNF A;  1T08 B;  2Y48 A;  1LPQ A;  1RET A;  3OYJ A;  1J2X A;  2V1N A;  4I01 A;  4UUV A;  5GAD J;  3TBI A;  2HU9 A;  3B6A A;  2IBD A;  3DFG A;  3NWS A;  2R7U A;  4EEF G;  2NNN A;  2BHZ A;  3HRT A;  4HLX A;  5CVI A;  3HIF A;  1P9Q C;  2BV6 A;  4ESB A;  4FAS D;  1PP8 F;  1V54 H;  3ZXS A;  2QA4 I;  3VFZ A;  3E3V A;  3E1S A;  2JTV A;  5LRS A;  4LD5 A;  2O9L A;  2E60 A;  1JTX A;  1WJ5 A;  3HBL A;  3ZRG A;  1UAA A;  4C9Y A;  3HHH A;  3B02 A;  2JUG A;  2FNA A;  2VLA A;  5FRN A;  3K7A J;  1FBS A;  2P4W A;  3KZI C;  4EV0 A;  1JHF A;  1BW6 A;  1RPW A;  1U9N A;  4L9J A;  4K2E A;  3G73 A;  2F5E A;  2LR8 A;  4HQM A;  1JJ8 C;  1G2H A;  2DJN A;  4IF4 A;  2IEK A;  4P5O A;  3CP8 A;  3LA2 A;  2AQF A;  2COM A;  2M5W A;  3VEP A;  3ZQF A;  4RB2 C;  1MBK A;  5EF6 A;  5FRO A;  1KQ8 A;  2VN2 A;  3CDI A;  2LBF A;  1Y8R B;  3FKJ A;  5L3E A;  2FBK A;  3K1M A;  4BQO A;  1MNM C;  4XMY A;  3JCU C;  1SFU A;  3CO6 C;  2TCT A;  4IHW A;  1L0O C;  1R6R A;  3GFM A;  4IHY A;  3RQ4 A;  1X58 A;  2I8D A;  1BR2 A;  1CF7 A;  1SVM A;  4KJZ A;  4DQ2 A;  1K7A A;  1Z7L A;  2CQ7 A;  4Y4R A;  2STT A;  4BBS J;  3MZ8 A;  4ZH4 F;  1IRG A;  2FEZ A;  3JSO A;  4HST A;  1IUY A;  5CVR A;  3OR2 C;  4YEL A;  4BNC A;  4KIG A;  4ASN A;  3ZQH A;  1J09 A;  3PM1 A;  2LVS A;  5J47 A;  2PMZ A;  3HOW J;  3FIW A;  5GPC A;  3DEW A;  4R79 A;  4OIR F;  3S16 J;  2FRH A;  2WV1 A;  1OYW A;  1XGN A;  5DCM B;  2CFX A;  5KCM A;  4BHP A;  3GO5 A;  4WXC A;  2DK5 A;  4MTE A;  2VB6 A;  3R61 A;  4MNU A;  1TNS A;  2QF7 A;  3BR2 A;  4KNY A;  5JLX A;  5BPI A;  4M6Y A;  3HRS A;  5F08 A;  1D0X A;  5F0C A;  2BVL A;  3FKI J;  1TW3 A;  1S5L C;  3BTC A; 
#chains in the Genus database with same CATH homology
 5FJ8 J;  3RQI A;  5DS9 A;  1X2M A;  4MFE A;  2R5Z A;  5J1Y A;  4C3H J;  1LE8 B;  4I76 A;  1UMQ A;  2JMW A;  1OCT C;  3SJM A;  4RBO A;  2R5Y A;  3HB9 A;  1W0T A;  1ZR2 A;  2M8G X;  2O8K A;  1MH4 A;  1JKR C;  5IOZ A;  5IP7 J;  3S14 J;  1QVU A;  1T33 A;  3IV5 A;  2XB5 A;  1VND A;  2CQQ A;  4JX4 A;  2DN0 A;  4DYQ A;  2WB1 N;  4C3J J;  2HOA A;  4AC0 A;  2E19 A;  3CCY A;  5EZG A;  2JA7 J;  1RKT A;  3A01 A;  3A02 A;  3S1M J;  3O8G A;  3PO2 J;  5F0H A;  3S1Q J;  1P7I A;  2LFB A;  1FIA A;  1IG7 A;  3H0G J;  4QSH A;  2VUM J;  1LFB A;  2OPT A;  3MVP A;  1HF0 A;  3FK7 A;  2OF7 A;  4MLO A;  5IYB J;  4B3A A;  1FTZ A;  1H8A C;  1TWG J;  2L0K A;  5FLM J;  2K9N A;  2PMZ N;  3HGY A;  2R0Q C;  5M5Y J;  4JX6 A;  4A3G J;  1T56 A;  1ETW A;  3BR1 A;  3IH3 A;  5DTD A;  2E2H J;  3NAU A;  5EZH A;  1BJZ A;  4QIW N;  1ETO A;  5F1J A;  1B72 A;  3HOU J;  2R5Z B;  2FX0 A;  1WPK A;  4DZJ A;  3CDL A;  2EQR A;  2R92 J;  2DMN A;  3F0C A;  3TED A;  2NS8 A;  4D5F A;  2JA8 J;  3LNQ A;  4M3F A;  3QPL A;  1AHD P;  3K2A A;  2LY9 A;  3HDD A;  5IYD J;  2COB A;  2GLO A;  3E7L A;  1E3O C;  1JTY A;  1AKH B;  2CUF A;  1NTC A;  2LP0 A;  2Y2Z A;  2Y31 A;  3TW6 A;  4LOC A;  1H89 C;  3A01 B;  3S2H J;  2DMP A;  3Q0U A;  1AU7 A;  4A3B J;  3JRB A;  3WHC A;  1K61 A;  2N8G A;  3G1O A;  5E3O A;  3HKZ N;  1ETK A;  2Y30 A;  1BA5 A;  4A93 J;  4A3J J;  1U9O A;  1RKW A;  2YUS A;  3HM5 A;  5F0F A;  2ECC A;  2NS7 A;  1B72 B;  1POG A;  3NAR A;  5C4J J;  3H3V K;  4C2M J;  4IEJ A;  3HEF A;  1HDP A;  2XPU A;  1IRZ A;  1GV5 A;  2D5V A;  5J3L A;  3UKG A;  3BG9 A;  2YS9 A;  3G1L A;  2HOS A;  4XIC A;  1SFO J;  3LSG A;  1F43 A;  2ID6 A;  4B4C A;  5EDN A;  4X6A J;  4XRS G;  4BKX A;  4ABZ A;  2G0E A;  4UUS A;  1QVT A;  5F04 A;  2E2J J;  1FEX A;  3S15 J;  3S17 J;  1I6H J;  2GM4 A;  3BG3 A;  4AYB N;  1GVD A;  2QCO A;  4A3K J;  3QQA A;  3MN2 A;  2VKE A;  1QRY A;  3TW7 A;  3GTG J;  2FQ4 A;  1U78 A;  1CQT A;  1MSE C;  4V2F A;  1JUP A;  2ME0 A;  3L1P A;  1JUM A;  3GTK J;  2Y9Z A;  3HOV J;  4A3L J;  1OCP A;  2E2I J;  1UG2 A;  3Q0V A;  4JP0 A;  3C2B A;  1K83 J;  1JJ6 C;  1I3Q J;  4C3I J;  1BL0 A;  1MH3 A;  1B8I A;  2ID3 A;  3BR6 A;  1VF9 A;  3BTI A;  1ZGW A;  1TWF J;  3PO3 J;  1TWH J;  2MW8 A;  1APL C;  2X48 A;  9ANT A;  4M3G A;  4MO7 A;  5FKN A;  5M3F J;  1Y1W J;  2E1O A;  3O8H A;  5K7F A;  4M6V A;  4BBR J;  4MFD A;  2ZB9 A;  3I4M J;  3OSF A;  4UUS B;  4D7N A;  1VI0 A;  5FKK A;  5K7H A;  2KDZ A;  1XS9 A;  4G12 A;  3JRA A;  3SDG A;  4V2G A;  1JKQ C;  3BR3 A;  1MSF C;  2CJJ A;  2AO9 A;  5M3M J;  2LD5 A;  2DMU A;  3M4O J;  1X2N A;  3Q3S A;  3GTJ J;  3FK6 A;  2R93 J;  4Y7N J;  2EZI A;  2XGD A;  1Z0X A;  4DYR A;  1EF4 A;  2XGC A;  3CMY A;  3S1R J;  1WCM J;  3BQZ A;  1F36 A;  1LFU P;  1FIP A;  1GDT A;  5IOY A;  4A69 C;  3LSR A;  1SAN A;  3OIO A;  2EZL A;  1W0U A;  2R5Y B;  3LSJ A;  4FCY A;  4A3I J;  3BQY A;  2RAE A;  1B8I B;  1ZKG A;  2W48 A;  1PUF A;  1I50 J;  5EG0 A;  2TRT A;  3GBG A;  1DU6 A;  2XSD C;  1Y1V J;  3HOZ J;  3IH4 A;  3JRF A;  4FTH A;  1R9T J;  3JR9 A;  3LOC A;  1MBH A;  1IGN A;  4FIS A;  2P81 A;  3BR0 A;  2AHQ A;  3MKL A;  1DU0 A;  2LLK A;  2ECB A;  5EGO A;  2XPW A;  4D5C A;  2ME6 A;  3OSG A;  3BTJ A;  3TP0 A;  5J1R A;  5IP6 A;  1RR7 A;  2X9D A;  5M5X J;  5M5W J;  4XK4 A;  2K9S A;  4DZP A;  2MG4 A;  2FJ1 A;  3LSP A;  2EZK A;  2JA6 J;  1GUU A;  1Q1V A;  2K40 A;  2K9Q A;  5C4X J;  4L5E A;  2JK3 A;  4XRM A;  1ZTR A;  4FE7 A;  2HXI A;  1JUS A;  1ETY A;  3BTL A;  3OOU A;  5HOD A;  3BR5 A;  4FE4 A;  5C44 J;  1ITY A;  1ETV A;  4IHV A;  1IDZ A;  2VKV A;  4W97 A;  1IV6 A;  1WGX A;  4JX5 A;  2EH3 A;  2HI3 A;  1PUF B;  5EG0 B;  2DA1 A;  1A6I A;  2GBY A;  4CYC A;  4UUT A;  3I4N J;  4XID A;  1HOM A;  1UHS A;  1JT0 A;  1GT0 C;  2MGQ A;  1RES A;  3ZQI A;  2H1K A;  1HLV A;  3IH2 A;  3GTM J;  1IJW C;  2DA7 A;  5EGO B;  3G1M A;  2VI6 A;  4D7M A;  2LTP A;  4XRS A;  2YU9 J;  5BNG A;  2CUE A;  1MBE A;  2NOG A;  2CQX A;  1MBJ A;  3JRG A;  5IPA A;  1IC8 A;  3HOX J;  1Z77 A;  2LKX A;  5F27 A;  2L7M P;  3M3Y J;  5GP9 A;  1WH5 A;  2B63 J;  2JWT A;  1XC5 A;  1FJL A;  4HNV A;  1ORK A;  4A3D J;  1NK3 P;  2R7Z J;  2NVT J;  5C3E J;  2ELK A;  2L9R A;  2VPR A;  1P7J A;  2HOT A;  5EYR A;  2IAI A;  3ZQG A;  3D1N I;  2Y0S N;  4CYC B;  3SFI A;  2XRL A;  4DW6 A;  2DMT A;  2Y9Y A;  1XG1 A;  5FKO A;  2MSY A;  4A3F J;  2JJ7 A;  2WAQ N;  3ZOB A;  3W6V A;  3S2D J;  5IYC J;  1JKP C;  3RZD J;  1IUF A;  1GV2 A;  4JYK A;  2CU7 A;  2HDD A;  1AKH A;  2M9H A;  1WH7 A;  2M34 A;  4M3D A;  4M3E A;  2DA6 A;  1U8B A;  2HQ5 A;  4BY7 J;  5EEA A;  3GTO J;  5E3N A;  2JN6 A;  5FKM A;  1FTT A;  1NK2 P;  1ZK8 A;  1JKO C;  5JLW A;  2XPV A;  1OJL A;  1RET A;  3JRD A;  3VPR A;  3BG5 A;  1ZR4 A;  1WI3 A;  3B6A A;  2IBD A;  4EEF G;  2HXO A;  3Q0W A;  4B1R A;  1YRN A;  4AUX A;  2DTZ A;  2DA5 A;  2HYJ A;  1ENH A;  2M2E A;  5FKL A;  4GFB A;  1OFC X;  2O9L A;  3FIS A;  3HOY J;  1JTX A;  3QPS A;  2I10 A;  2FD5 A;  3HBL A;  1A5J A;  1O4X A;  2XGE A;  2KT0 A;  3WHB A;  2LK2 A;  4NDL A;  3K7A J;  2XB0 X;  4IHX A;  3GTP J;  4I6Z A;  1IDY A;  2EZH A;  5GPA A;  1MBG A;  3JRE A;  2NVQ J;  1BW6 A;  1RPW A;  1U9N A;  5E3L A;  3JRC A;  1H88 C;  2JA5 J;  3RZO J;  4Y52 J;  2LR8 A;  4M3B A;  1JJ8 C;  1G2H A;  2DJN A;  2IEK A;  2DA2 A;  3ZQF A;  5IP9 J;  1ETX A;  1MBK A;  2DA4 A;  5EF6 A;  1S7E A;  3HGG A;  1JT6 A;  3GTL J;  3ZQL A;  1MNM C;  3JRI A;  2L7Z A;  4RDU A;  1QPI A;  3A03 A;  3B6C A;  2TCT A;  3GTQ J;  4BY1 J;  4IHW A;  3JRH A;  2DA3 A;  4DYC A;  1LE8 A;  4IHY A;  1X58 A;  2DMQ A;  1YRN B;  4W1U A;  4J19 A;  1BW5 A;  4A3M J;  1TWA J;  4BBS J;  5K7Z A;  2X6O A;  2NVY J;  4MIM A;  2CRG A;  3TP3 A;  4BXX J;  2O7O A;  3ZQH A;  3PM1 A;  2LVS A;  5E3M A;  1JGG A;  1D5Y A;  1HCR A;  1ZQ3 P;  5FLV A;  3HOW J;  4A3E J;  3FIW A;  2L7F P;  5GPC A;  2NVX J;  3ZQC A;  3DEW A;  1TWC J;  3DCF A;  3S16 J;  2WV1 A;  3RKQ A;  1TC3 C;  2M0C A;  4S0H B;  3S1N J;  2H8R A;  3BT9 A;  4QTR A;  1MBF A;  5J1U A;  1ETQ A;  2QF7 A;  3BR2 A;  5JLX A;  2EBI A;  3CQZ J;  5F08 A;  5F0C A;  3FKI J;  4A3C J;  4X1E A;  1VFC A;  1HDD C;  3BTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...