1DU0A

Engrailed homeodomain q50a variant dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
AFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFANKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*TP*AP*C
publication title Exploring the role of glutamine 50 in the homeodomain-DNA interface: crystal structure of engrailed (Gln50 --> ala) complex at 2.0 A.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1du0A00
2N8GA 2EQRA 3HB9A 3HOVJ 1XC5A 3TW7A 2Y30A 5M5WJ 2FJ1A 1H88C 3BR6A 2ELKA 4A3CJ 1RKWA 4MFDA 1TC3C 4AC0A 2XSDC 4JX4A 3ZQHA 3GTJJ 4UUSB 4D5CA 5IYDJ 1B8IB 2HOAA 3GTGJ 1X58A 2JJ7A 3CCYA 5HODA 4XICA 1GV2A 2LVSA 4DYCA 1MBGA 3G1MA 2AHQA 2COBA 2EZKA 5E3OA 4XRSA 2I10A 2M8GX 1I6HJ 3BR5A 4C3JJ 1T33A 5C4JJ 5M5XJ 4GFBA 1ZR4A 4MIMA 1Z77A 2LP0A 2JMWA 2MSYA 3OIOA 1MSFC 5DS9A 3S2DJ 5EZHA 2L7ZA 3GTKJ 1ETVA 2JN6A 3BG5A 1VNDA 4M3BA 5GPAA 2NVQJ 3GTQJ 3S16J 3MN2A 1B72B 5FLVA 5E3LA 3HOZJ 1AHDP 5FKLA 4BXXJ 5F0FA 4C3IJ 3A01B 3QPLA 1K83J 4AYBN 2EZIA 5IYCJ 3TP3A 1ITYA 5F08A 1GUUA 1U9NA 1IUFA 4LOCA 1JUMA 4A3MJ 2GBYA 4A3KJ 2E1OA 1JTXA 3HGYA 1WI3A 1JKRC 2Y31A 3TW6A 2TCTA 1APLC 4JP0A 2E2IJ 3O8HA 3NAUA 1OJLA 4MLOA 2HOTA 3M4OJ 2Y2ZA 3BQYA 5EGOB 1Y1WJ 1RR7A 5J1RA 4JX6A 4HNVA 1WPKA 4M6VA 2IBDA 4MO7A 4L5EA 3RKQA 2HXOA 4A69C 2VKVA 1BJZA 5C3EJ 4ABZA 3GTPJ 1GVDA 4IEJA 3CDLA 1MBEA 1FIAA 4A3DJ 3JREA 5JLWA 2O8KA 3QPSA 2OPTA 2HI3A 4D7NA 3LSGA 5FKNA 2GM4A 1T56A 3CMYA 3UKGA 1FTZA 2R0QC 5FJ8J 2NS7A 3HGGA 1RESA 1P7IA 1UMQA 2XRLA 3W6VA 3I4NJ 2R5YB 2XPUA 3Q0VA 3G1OA 2AO9A 2CUFA 5EGOA 2XGEA 4S0HB 1JUSA 2Y9ZA 4BY7J 4JYKA 1PUFB 4BY1J 4IHVA 1F36A 1ETOA 2NOGA 2XPVA 2YU9J 4EEFG 3JRAA 4JX5A 4A3GJ 4DYQA 1JGGA 2LKXA 1MNMC 2TRTA 1BL0A 2H1KA 1ETKA 2EH3A 4V2GA 3PM1A 4M3EA 3PO2J 2DJNA 1IRZA 1TWCJ 1ZGWA 1SFOJ 4DYRA 2NVTJ 4DZPA 1E3OC 1RKTA 2B63J 4XIDA 1MBFA 1ETYA 4I76A 2JK3A 3JR9A 2DA7A 2D5VA 1XS9A 3JRDA 4M3GA 2DA6A 1JJ6C 2HQ5A 3ZQGA 3D1NI 3QQAA 3LSRA 1WCMJ 2K9SA 2WV1A 5EG0A 3MVPA 1U9OA 3LSJA 4B3AA 2ID6A 3Q0WA 2CQXA 1YRNB 2DN0A 3FK7A 1ZTRA 2ME6A 3TP0A 2ZB9A 3JRIA 3BTCA 3M3YJ 4CYCB 4QTRA 1WH5A 1JTYA 2QF7A 3HEFA 3JRFA 5M3FJ 3A02A 3BR1A 2VPRA 5F1JA 1POGA 1MSEC 1S7EA 3JRCA 2MW8A 2ME0A 2R93J 4UUSA 1FTTA 1AKHB 1B8IA 4Y52J 2DTZA 3WHBA 2CQQA 2VKEA 3H3VK 2K9NA 2RAEA 1JUPA 3RZOJ 4A3IJ 1A5JA 1G2HA 4I6ZA 2XGCA 2JA6J 3ZQIA 3DCFA 3LSPA 4M3DA 2W48A 5JLXA 2FX0A 3I4MJ 3JRGA 2LTPA 4DW6A 3S1MJ 3IH4A 2IEKA 1TWHJ 5K7HA 1LE8B 4BBRJ 1Q1VA 1GV5A 2MG4A 2KT0A 5IP6A 1H89C 3IH2A 5C4XJ 4IHYA 4FE4A 1RPWA 3A03A 1B72A 3H0GJ 1Z0XA 1JKPC 1K61A 2ID3A 1VFCA 2DA3A 2G0EA 3ZOBA 2CUEA 3GTLJ 3SFIA 3A01A 1MBKA 1WGXA 3S2HJ 3Q0UA 2XB5A 3BR0A 5BNGA 4FTHA 5K7FA 5C44J 5FKMA 5EYRA 4M3FA 3BTJA 5E3MA 3OOUA 1ENHA 3RZDJ 3S1NJ 3NARA 1GT0C 2CU7A 2M0CA 4B1RA 4XRMA 2X48A 3BTIA 2NS8A 1MH3A 1VI0A 2CJJA 3K2AA 2ECCA 1IGNA 1BA5A 2CRGA 3WHCA 3JRHA 2HXIA 1FJLA 3B6CA 4A3JJ 3OSGA 1ETQA 5IP7J 3C2BA 3S15J 5IOYA 1X2NA 1QRYA 3FK6A 1OFCX 4C2MJ 3JRBA 1HDDC 3O8GA 4J19A 2DA2A 1U78A 3HM5A 1IC8A 2M9HA 2KDZA 1HF0A 1DU0A 2P81A 1IV6A 3DEWA 3MKLA 3BG9A 2DA4A 5IPAA 3HKZN 2R5YA 5EDNA 1AU7A 2R7ZJ 3Q3SA 3E7LA 1DU6A 1QPIA 5K7ZA 1MH4A 4X1EA 3VPRA 2DA5A 2Y9YA 2XGDA 4A3BJ 3IV5A 4BKXA 1PUFA 3BTLA 2K40A 2L0KA 4RBOA 1UHSA 3HOWJ 1RETA 4BBSJ 1F43A 4NDLA 2VUMJ 5E3NA 2XPWA 1UG2A 1FEXA 1BW6A 3BQZA 3BR2A 2FD5A 2R5ZB 1FIPA 1ZQ3P 1H8AC 5J1UA 1EF4A 4A3LJ 4W97A 2H8RA 1IDYA 2IAIA 2X6OA 2YUSA 3HDDA 3BT9A 4W1UA 1R9TJ 3RQIA 4D7MA 2E2JJ 2NVYJ 2DMQA 4XK4A 2EZHA 4FISA 1WH7A 1OCPA 3TEDA 4D5FA 3GTOJ 3ZQLA 1BW5A 3FKIJ 4X6AJ 2M34A 1ORKA 3SJMA 2HDDA 1LFBA 2DMTA 1YRNA 2JA8J 2HYJA 2Y0SN 2R5ZA 2L9RA 2EZLA 4B4CA 1LFUP 1JT6A 2PMZN 4XRSG 5EEAA 4CYCA 4IHWA 1QVUA 1IJWC 3LNQA 3S17J 1JJ8C 3HOYJ 2DMUA 2L7MP 2XB0X 5FKOA 3CQZJ 3FIWA 3GTMJ 2OF7A 1IG7A 2YS9A 1AKHA 4RDUA 3S1QJ 1ZKGA 2LY9A 3B6AA 2O9LA 2X9DA 4A93J 5M3MJ 9ANTA 2LR8A 5FKKA 5M5YJ 5IOZA 1NK2P 2M2EA 1GDTA 1HOMA 4AUXA 2FQ4A 4G12A 1JKQC 1HDPA 1D5YA 3G1LA 2E19A 4MFEA 4V2FA 5F27A 5GPCA 1VF9A 1MBJA 4DZJA 1LE8A 1O4XA 1ZK8A 2O7OA 2WB1N 2LFBA 2LK2A 3S14J 3SDGA 3ZQCA 2EBIA 3F0CA 1W0TA 1HCRA 1NTCA 4FCYA 4UUTA 1OCTC 1JT0A 1NK3P 5EZGA 2GLOA 1U8BA 2DA1A 4A3FJ 3FISA 1MBHA 3HBLA 2NVXJ 1W0UA 3GBGA 4C3HJ 3OSFA 3HOXJ 2E2HJ 4FE7A 1SANA 1XG1A 2LD5A 3LOCA 5IP9J 5J1YA 1TWAJ 1TWGJ 3K7AJ 1HLVA 1I3QJ 1CQTA 2JA7J 5IYBJ 1ZR2A 1QVTA 3L1PA 5GP9A 5DTDA 1I50J 1X2MA 3PO3J 2QCOA 4IHXA 1ETXA 2L7FP 1P7JA 1A6IA 1ETWA 4Y7NJ 2JWTA 2JA5J 5F0CA 1TWFJ 2LLKA 5F04A 5F0HA 1JKOC 5FLMJ 3BR3A 2VI6A 2DMNA 4QIWN 4A3EJ 2MGQA 2R92J 1IDZA 2HOSA 4QSHA 2K9QA 3IH3A 5J3LA 5EF6A 2ECBA 2WAQN 3S1RJ 3HOUJ 5EG0B 3BG3A 1Y1VJ 2DMPA 3ZQFA
chains in the Genus database with same CATH superfamily
2H6CA 3PNYA 2VE9A 1O3RA 5HLIA 2DK5A 3HB9A 4PJLA 1KU2A 2YU3A 2HKOA 4R79A 1BI0A 2ELKA 3RDIA 3SFZA 4ZYEA 1UJ8A 1KGSA 1T0FA 2K4BA 1MMAA 2DW4A 3CMMA 3L00A 4XLNF 4FT8A 2LC2A 4AC0A 3GF2A 2CO5A 1ZRDA 1EA3A 5KVRA 3ZQHA 4UUSB 4L5IA 2E36A 3L2VA 4G6TB 1UHWA 2HOAA 2FEZA 1BI1A 3BY6A 1AWCA 2NNYA 3VFZA 5HODA 5HS7A 4XICA 2XKOA 2AHQA 3FHZA 2QKLB 3GFMA 3QU6A 4N9HA 4CA0A 1X19A 5D4SA 1X3WB 1Z3XA 3ONQA 4I98B 5M5XJ 1ZR4A 2LP0A 3OOPA 1FSEA 4QPQA 2VQGA 1L0OC 2L7ZA 3K6GA 3BG5A 2NVQJ 2JA2A 1BC8C 1ONVA 3S16J 2MBFA 3K4LA 1D8KA 3OR2C 1W5SA 3MN2A 3HRMA 2VB6A 3KEQA 3K70C 3HOZJ 2CG4A 1XN7A 2QQ8A 2VKHA 5FKLA 4BXXJ 4ZZLA 4HW0A 5F0FA 3LA7A 2J5PA 2EV0A 4XN0A 5FFZA 3SEZA 2AXLA 3OYIA 4Z2YA 2ESNA 3FXUA 4CCOA 5L3FA 3BP8A 4PGGA 3LFUA 2L02A 1LDKB 3D5LA 5ICFA 3CCVI 5D5XB 2RGVA 1MKMA 1U9NA 3TGNA 1IN4A 5TJJA 3K1MA 5HDKA 4KFCA 2MABA 2WA0A 1E3HA 1WRJA 3K10A 3WGGA 4A3KJ 2EFWA 5FLXK 2LREA 3LWFA 1FMVA 1W1WE 2Y31A 1FOXA 1UELB 3WODF 4II3A 4JP0A 3M8EA 4FHTA 2X6XA 1QGPA 2DYSH 2A61A 4MLOA 1E2XA 3TDZC 4C2UA 4ESJA 3SZGA 2DPUA 4EJUA 1WPKA 2IBDA 2R7FA 1SD5A 3R61A 4MO7A 4PFPA 4A2UA 2VODA 2VKVA 1BJZA 1SFUA 4ABZA 3GTPJ 5ICEA 4C9YA 4BS9A 4EM1A 1F4KA 4AVPA 2P8TA 2CMPA 2GIZA 5JLWA 1F5TA 3QPSA 5LD2C 3LSGA 2F5CA 2GM4A 3CMYA 1FTZA 4JK1X 1LFPA 3EUAA 2R0QC 5FJ8J 1RESA 1KA8A 3G1OA 5L3CA 3U21A 2JSCA 4CCLA 3DBRB 1QO0D 1R71A 1FZPB 2HDCA 3FM5A 2CGPA 1FP1D 3K69A 4PUSA 4L0YB 4OINF 3N97A 4ESFA 2MH9A 2XPVA 2ELHA 1Y56A 2LY1A 2YU9J 2KMUA 1XGOA 5E8IA 3LA3A 1Y8QB 1G8XA 1DQUA 2LKXA 3GW2A 4G9YA 3S3OA 1I6XA 2L4AA 4BNCA 5BOXA 2F48A 4V2GA 3ZQQA 3J7AY 3K1PA 3PO2J 4KMUX 1ZGWA 4CGZA 3JSPA 3WG7H 2AXTC 4DYRA 3WU1B 2NVTJ 4TV7A 1S7OA 4UV9A 4BDYA 4XIDA 3OWTA 4RM3A 1YJWI 1ETYA 4I76A 1HSTA 4RLFA 4M3GA 1OISA 2EIJH 4XQFA 4O5VA 1D0XA 1K4TA 3LSRA 2IRFG 5CVIA 2DFIA 3IC7A 4ESBA 2R7SA 4F7ZA 2W24A 1ZG1A 2XSJC 1YRNB 4M74A 2MD5A 2OBPA 4ZYGA 2KIQA 3GCMA 2W00A 1B9MA 3OYNA 2ZB9A 2BW3B 1H9GA 4HSRA 2R7QA 1UFMA 3M3YJ 4II2A 4QTRA 3K4MA 3JRFA 3HEFA 4B48A 2ZJRF 1YX5A 1RR8C 1X3UA 2QVOA 3A02A 3BR1A 4WCGA 2ME0A 2O6GE 4CHUA 3IL2A 2A3SA 1B8IA 3H3VK 4NUBA 1TT5B 3BJAA 3K4KA 4M73A 1A5JA 2PMUA 2XAGA 4BUPA 3SHFA 2JA6J 3H92A 4U0WA 1MIJA 5KHDA 3SQNA 3KETA 4KDPA 1ZGAA 4XORA 1G6NA 3DF8A 3QP5A 2PJRB 2FX0A 2LTPA 1FOYA 1D5VA 1HQCA 4XSZF 2ZC2A 3RKXA 4DW6A 5K7HA 1TNTA 3RYRA 3N05A 2KT0A 5IP6A 1H89C 3CUQC 5C4XJ 4FE4A 3H0GJ 3F3XA 1A31A 3RPUA 1WJAA 3J7ZI 2G0EA 2NXNB 2DI3A 2O0YA 2CUEA 3WGIA 3SFIA 1ODDA 2V26A 2YX7A 3H3ZA 3GX4X 1MBKA 2OTJI 4A6DA 3ZXSA 2I5UA 2V4JC 5BNGA 3EYIA 4RA2A 4BE2A 2JVGA 5K7FA 5FKMA 2PJRA 3L2WA 2PMZA 4HX8A 2OZUA 3CCJI 3H5NA 3VODA 4E7JA 1WFXA 3RZDJ 4HQMA 4XNFA 1U5TC 3PQKA 1MDMA 4EJOA 4MEXF 5EEHA 2CU7A 1Z6RA 1IN5A 2K3PA 2X48A 4ZDOA 1E3PA 3GFLA 2H8WA 1VI0A 3K2AA 3P5JA 1IGNA 3SXYA 1C0WA 1MMGA 2HEOA 1D1BA 1PP8F 3BWGA 4LGWA 3KP6A 2J5OA 4CYDA 3JRHA 1BA5A 4KYWA 1J7KA 2HXIA 4NQWB 2BBYA 1FJLA 4E7KA 1D0ZA 3KYLA 4WX9A 3B6CA 4LIVA 1ETQA 3C2BA 2B9SA 1I39A 1QRYA 1OFCX 4C2MJ 1XTAA 3JRBA 2DT5A 2M3AA 3DBLB 1X1PA 2M1BA 1GVJA 2M9HA 4XL9A 5A2QZ 3OYCA 1P6RA 2KIFA 3C7JA 1XSDA 2K7LA 3MKLA 5K5QA 3ZN0A 4J01A 1FYKA 3Q3SA 2HYGD 1QPIA 3OYKA 3ABTA 4X1EA 4N9IA 5J4VA 1UHMA 2XAFA 1BBYA 1DPUA 4M71A 5CLSA 3LQRA 4Y4RA 3U1DA 1TQPA 3LMMA 1PUFA 4N4OB 5J40A 3BTLA 3FXKA 2O61A 4KN4X 2R7XA 4PJMA 1LPQA 2H09A 4ZTFA 3ZMTA 1NHAA 4C30A 4BBSJ 2IA1A 2UV1A 5CQGA 2V9KA 1OCRH 3RQ4A 2XPWA 4CICA 2KKOA 3E6MA 4UVCA 4L5JA 3TMOA 5BQTA 4U0YA 3L2QA 1N77A 2OC6A 4GCVA 1TBXA 3QODA 5HNFA 3RJPA 2E71A 3PFIA 4DBRA 2NRAC 3FM3A 4A3LJ 3A1YA 4W97A 1O3QA 1SMTA 2IAIA 2X6OA 2YUSA 4F91B 2DPDA 5DUKA 3KPHA 4CSWA 1R9TJ 4MEYF 4IXAA 1OYYA 2NVYJ 1Y8RB 1GXPA 1P2FA 4Y13A 1WH7A 1OCPA 3TEDA 3E6BA 5FROA 3S93A 2HYJA 2Y0SN 2I8DA 2EZLA 1YIOA 2Y0MA 3CUQA 4DOZA 2CV2A 3CCLI 5E18F 1JI8A 2Z3YA 2HGCA 2LSOA 4L9JA 3FIWA 4XLPF 1B59A 3DBHB 5FD5A 3U1KA 3FXLA 1WJFA 2YS9A 4G7ZF 1AKHA 3S1QJ 2EFQA 4GYGA 3B6AA 3OYJA 4A93J 5M3MJ 9ANTA 2OJED 2W85A 3PSFA 3O3KA 5M5YJ 2ZJ2A 1Y0UA 1W7PB 3GZ5A 2XROA 2LKSA 5AIPA 3V7SA 2A6EF 2F5FA 2O03A 4AUXA 1HDPA 5D5VB 5BPDA 1SEUA 2PG4A 4LJZF 5L3BA 1DUXC 1VQ7I 1XSXA 2E19A 2ESHA 1U5TA 3CJTB 1LE8A 2FMYA 2HNHA 1J2XA 2QKMB 5BPIA 2E1CA 2L01A 3S14J 4U0VA 2K85A 3SDGA 5JVTA 3CCQI 2XF7A 2RQQA 3ZQCA 4IPAA 4FCYA 3S3NA 1VQOI 1O3TA 1W7PA 4EJVA 4RB1A 3OS2A 1NK3P 1OKRA 4M9XA 1T38A 4A3FJ 1O57A 3FISA 4ZDLA 1QNTA 3I3LA 2QSGX 2HWVA 1XD7A 4EV0A 2XV4S 2GXBA 3HOXJ 2E2HJ 2ZMEB 3OYGA 4WF2A 5B5EC 1W5CC 1VZ0A 5J1YA 3CO7C 3S8PA 1TWAJ 2R7DA 4BEHB 5EJCA 1MJBA 4XLAA 2KJCA 1HLVA 5D4RA 2OCEA 1CQTA 4KA4A 3KE2A 1RC9A 1F1ZA 5DEQA 1TQIA 1BC7C 1ACIA 4B43A 1XGMA 3BPXA 4IHXA 3CMEI 4IQJA 2L7FP 4Y7NJ 1WJDA 1TWFJ 2BZTA 2HDWA 3F8MA 2G9WA 3MQ0A 4ZZDA 5HNHA 3A0BC 3HUGA 2OU2A 3AG3H 1YIJI 2HVSA 3I53A 1KU7A 4I0BA 2FOKA 3SDBA 1Z91A 1STZA 3IH3A 3S1RJ 3HOUJ 2VQCA 3BG3A 1UB9A 1Z6TA 1TW3A 5D8KB 3I5UA 2BXZA 3P9KA 3JCUC 4HX7A 2DO7A 1FWZA 1TTYA 3JTGA 1SVMA 3MZ8A 4G7OF 1XGNA 3DEUA 5B3SH 3X2QH 5KNLA 1TC3C 1ZH5A 2CUJA 4YFXF 2M7BA 5E79C 4D5CA 5IYDJ 2LOOA 1X58A 3KCCA 2JJ7A 1A36A 3VDXA 3GO5A 5F1RA 1T6SA 1MBGA 3G1MA 3GVAA 1OYIA 2COBA 2Y69H 4M9SA 2EZKA 2KDOA 1L3LA 3BR5A 2V7FA 3H9GA 4B09A 2NVUB 2OTLI 4Y33A 4MTDA 2JMWA 2MSYA 1QBJA 3S2DJ 2LKPA 3MKWB 4CCJA 3OIPA 4IRIA 4DIQA 5ILSA 1MMSA 2M4KA 2JN6A 4RAFA 1VNDA 1I3AA 2COMA 1LB2A 4HV6A 3E5XA 1B72B 1A35A 4Q48A 3OL4A 1AHDP 5LGTA 5HLHA 1SD4A 2E7WA 4C3IJ 1B9NA 3A01B 2MLGA 1J75A 2FXAA 4XRFA 1NG7A 3CP8A 5LHGA 3GFIA 3HC7A 2EZIA 4QWQA 5HVQC 1X3ZB 3TP3A 5DYMA 1X1BA 4N0BA 2Y48A 4ENJA 2X85A 4LOCA 1E0EA 4XLEA 3ERMA 3KZYA 5IT9Z 2IGOA 3L9FA 4KIBA 2D45A 1JTXA 2QZ8A 5JVGF 3TW6A 2LY2A 3HSEA 2TCTA 3D0SA 2UXXA 1SMYF 2E2IJ 2M8EA 3O8HA 5ICGA 4PJ0C 1K7AA 2KHMA 4RGRA 1E17A 2DU9A 2Y2ZA 3L2UA 2A07F 2K5CA 5EGOB 5J1RA 1BR1A 1R5ID 3OL3A 2HR3A 2DXIA 4PDKA 3CF2A 2HXOA 5C3EJ 2IA2A 2MH2A 2XAQA 4PGHA 2KIUA 3CCSI 3E6DA 4RS8A 4CUGA 1S72I 2MA3A 2O8KA 3F8FA 4S05A 2HI3A 2Q2EA 1YJNI 3DQVC 1XMAA 4Y3OA 5FKNA 1HA8A 3UKGA 3FMQA 2P5KA 1YTYA 2NS7A 1P7IA 4DQ2A 5IT3A 4UHTA 5LGNA 5DDGA 5CKTA 1U6GA 4OAYA 5EGOA 2CUFA 2XGEA 1WWXA 2E60A 5LLQA 4HNUA 5HDNA 5K5OA 3EQLF 4D1QA 3PIPF 1W36D 4JYKA 2EILH 4GGGA 1SD6A 3CLOA 2BY0A 2KIMA 2R3SA 2X4HA 3BG7A 4QPOA 4EM2A 4IHVA 1X4OA 3IRQA 4KUMA 1NG6A 3JRAA 4A3GJ 5LRRA 1FYLA 2ZSHB 1YW7A 4RAYA 2F5DA 1X1AA 2FNAA 1BL0A 2H1KA 2ZSIB 2V9PA 4EJTA 4Q47A 2CQKA 1PYVA 2UXNA 1Z9CA 3VSLA 1YHQI 1IRZA 1MZBA 1WHUA 3M1CA 2P0WA 4G6QA 5L3EA 2HZDA 5J8FA 4KMFA 4EMSA 2JPBA 1WSUA 2CUZA 3F6VA 1HBXG 3JR9A 2P6SA 3I54A 3HRSA 1GHCA 3G6EI 3D1NI 1YS6A 3ASNH 2WV1A 3IRRA 1QA6A 5EG0A 3MVPA 1U9OA 3LSJA 4ENKA 2FMLA 4B3AA 1YX3A 4BAYA 2DN0A 3FK7A 1ZLKA 2L2OA 3BLYA 2HTJA 4U88A 5FD6A 3O6BB 3SZPA 2B0LA 1LNWA 3CC7I 4IO9F 5DD4A 3T1BA 2LF8A 1DDNA 4HA8A 1MSEC 4O3MA 5F1JA 1R49A 2WAQA 3KLNA 1WI9A 3M7GA 4UUSA 4CO8A 3UNGC 1FTTA 4LG3A 1IW7F 5EEGA 2KQRA 2JUGA 3J80K 2K9NA 4WXDA 3GXOA 1X4PA 3HXLA 4A3IJ 2FBHA 2HFHA 4I6ZA 4E70A 1EKEA 3J81K 2VKDA 2ZXWH 2PBIA 4GXOA 3ZQIA 1A6QA 3FBNB 3LSPA 5CVRA 1KU3A 2W48A 2EB7A 4YFNF 3IH4A 2IEKA 1TWHJ 3QP6A 1GV5A 4K2EA 4LLNA 3I71A 4XLHA 4BHPA 2EIMH 2ZFUA 3A03A 1Z0XA 3EUKL 4UVBA 3ABKH 1JKPC 2JTVA 3DWLE 2AQEA 3ZOBA 3I58A 4HX4A 2LBFB 3DTEA 2KJBA 1FYMA 2Y0SA 4FTHA 3WTYC 3ABMH 5C44J 1UCRA 2DDBA 2W57A 4OIQF 3ABUA 1YYVA 3KEYA 4ASNA 3WTVC 2E7XA 3EUHC 3LSMA 5ICCA 1F9NA 4M3FA 4LD5A 2VPLA 3F6OA 2BYVE 1MJAA 3T8RA 3JAMZ 3GMEA 2IS4A 3V4GA 1Z7UA 1IN7A 2HQNA 3TDUC 2L7KA 3BTIA 3FMRA 3LSIA 3DEEA 2ECCA 3K4BA 5F64A 3W6KB 4GDFA 2DFEA 5J6XA 4AYBA 4RB3C 2CRGA 1BR4A 2KRCA 2W84A 4HPQA 4A3JJ 3OSGA 4OAZA 1K79A 5IOYA 1X2NA 5DCMB 3OYBA 2HQRA 3J7YJ 1R4NB 2M87A 1V4RA 3CCRI 1HDDC 3O8GA 2JQ7A 1SVLA 1U78A 3F8BA 3OR1C 2DAOA 4ZTJA 5BS6A 3HPHA 3AAFA 2KDZA 3GEZA 4B3XA 5B66C 1D3YA 1LEAA 5D5WB 1IV6A 2F6CA 2QYOA 3M8FA 4UB6C 4A0YA 5GTIC 1QHHD 2QWWA 4FASD 3CF5F 2DA4A 3BZ6A 3DPTA 2R7ZJ 4XOTA 3LAJA 5HDGA 4XN3A 1DU6A 2KFDA 5K7ZA 1MH4A 3CD6I 1LKXA 5CJ9A 2PEXA 2CW8A 2DA5A 5DCMA 1Z67A 3BPVA 1BIAA 3F22A 1LDJA 2L54A 2NS0A 4BKXA 3BDDA 3W2VA 2L0KA 2XF6A 4Z6YA 1R4MB 2STWA 4XKVA 4HLYA 4RBOA 1UHSA 4UNOA 1LDDA 1XGSA 2IVMA 1ZHFA 3ECOA 4EGYA 1R23A 2VT2A 5D6FA 2RREA 3EETA 2R5ZB 1FX7A 4XLFA 1H8AC 1EJ9A 1SVOA 2IW5A 2K3FA 1H9TA 3AG1H 5GTHC 5J1UA 1VQLI 5DUIA 3QU3A 2H8RA 3F23A 1ZELA 2XRNA 4XOPA 5K5RA 3QYEA 1S29A 1YJ9I 4KNYA 4D7MA 2AQFA 1KYZA 2EZHA 2ZJPF 2VJJA 4A0XA 1VQ9I 1WZ2A 4D5FA 3F21A 4HNTA 3ZQLA 1BW5A 3FKIJ 1ORKA 3SJMA 2HDDA 1LFBA 1DGWY 1YRNA 1VQ8I 5LEJA 3I64A 3OMYA 2R5ZA 1ON2A 2KRFA 1LVAA 2P4WA 2BW3A 2OQRA 3FZVA 4D9JA 4OIOF 2PN6A 3GLXA 4BJ6C 3ZPLA 1IJWC 2WBMA 3S17J 2BVMA 4KICA 2JT1A 3FX3A 3CQZJ 2XKPA 3QYFA 5BMZA 2ZNYA 3GTMJ 2OF7A 4IL6C 3R6SA 2Z99A 3EPZA 2LY9A 3S32A 4EVIA 1TP4A 2V1DA 5FKKA 5IOZA 2M2EA 1GDTA 1HOMA 5H6QA 3EUHA 1JKQC 1D5YA 2R7UA 5J8CA 5GPCA 3LSTA 1VF9A 3K0LA 3E0JB 2EK5A 1AOYA 3HPGA 3E5UA 1I1GA 1BM9A 3F9KA 1ZK8A 4WXHA 3VEPA 4Y17A 3D5RC 4AD9A 1VQ4I 2X6YA 3HZJA 1QZYA 2ACJA 3A2KA 1N78A 2DT6A 2QUFA 4ITVA 4PSWA 1WJ5A 3F0CA 1HCRA 2E1MB 3BROA 1OCTC 3ERED 2DLLA 5LBQA 1JE8A 2OQGA 2VJIA 2KP6A 3WU0A 3HL2A 3DPUA 1R36A 4C3HJ 1EV7A 4KIGA 4FE7A 4ENNA 4ZYAA 5LFAA 2JUCA 3PSIA 4YIRX 2L4MA 3REOA 3NRVA 2Q0OA 2TDXA 4E7SA 1TWGJ 1AA7A 1I3QJ 1WQ2A 2JA7J 1HXDA 2KRHA 3I59B 1ZR2A 3ZCOA 2BY2A 4KISA 2XAUA 1SAUA 3V7RA 1I50J 4NQWA 3CZ6A 1FP2A 3K4NA 1ETXA 2VJ5A 3DKXA 2PLYA 1A6IA 1ETWA 2GA1A 5JFRA 2LLKA 3PUBA 4AIDA 5F0HA 5FLMJ 2GXAA 2VI6A 3KEOA 3KZIC 2DMNA 4IQ4A 2MGQA 2Z16A 4LK0F 2QEXI 2F2EA 2YSRA 2W82A 5J3LA 5EF6A 1TW2A 2ECBA 4IX7A 1IXSB 5FB2A 2WAQN 1U8RA 3NWTA 3OYMA 1IN6A 3HHHA 1BJAA 3K4CA 2HVRA 2DMPA 4IF4A 2ZMEC 2JVHA 2O8XA 2FBKA 2LMDA 2ZNZA 1FPQA 1IF1A 2XASA 2QGUA 3OYFA 1XC5A 3TW7A 2Y30A 2D2WA 2STTA 4B8XA 2PFBA 3KZZA 3V42A 4NC7A 5FFXA 1I1SA 1EH7A 1RKWA 3BZKA 2GA2A 4MFDA 4BQAA 1RNLA 1YG2A 2CH0A 3GTJJ 2ZXJA 3ZMZA 3GTGJ 3BCBA 1J9IA 3CCYA 2KISA 1Z7LA 2QSFX 3I55I 4KT6A 2HOEA 4D0PA 1GV2A 3MZHA 2EINH 2RKHA 1MGTA 2I10A 1I6HJ 4C3JJ 1T33A 1G59A 5C4JJ 4GFBA 3TOAA 4MIMA 3KIOA 3OIOA 1P4AA 1YW8A 1XMXA 5JHUA 3OS0A 1ETVA 3GTKJ 1P4WA 1G4DA 4OMYA 5GPAA 4I09A 4BU2A 3FXQA 4KN7X 1YE9A 4ENMA 2CV1A 1USSA 2PI0A 1Y39A 2NYXA 1H0MA 2JRTA 4GO1A 3P9IA 2OCCH 1FSHA 3DP7A 1K83J 1ZN2A 4AYBN 3TO7A 2VC0A 1U2WA 2QA4I 2VT3A 2EV6A 2BGCA 2HKXA 4CCNA 5IY5H 4AIKA 2VBZA 1XSVA 1GUUA 1Y0NA 2BHZA 5E1WA 3RSNA 1IUFA 1KU9A 2X1DA 5J4YA 2E1NA 4IHSA 2H94A 1JUMA 2DFFA 4A3MJ 2ADUA 3IAM2 2QM3A 3KP7A 1B4AA 2ZXIA 3HJEA 2F4OB 2XDVA 3HGYA 1FOWA 3QOEA 2A69F 2IGNA 1HSJA 5CVJA 2ZXHA 2BHYA 2KLOA 3NAUA 3IAS2 2CWEA 4BL0B 2HOTA 3IP4B 2DK8A 1RR7A 1W4MA 4HNVA 1QPMA 5ERIA 2P7VB 1Q1HA 4UUVA 4L5EA 4FETA 1V3FA 4BXFA 2MC4A 3I9V2 3LSHA 4IEJA 1SFXA 3CDLA 1MBEA 3IKTA 4RB2C 1OPCA 3GFJA 3W2WA 2OPTA 3DFGA 2PMHA 4I2OA 5CQEA 1T56A 3LL7A 2VXZA 4MGRA 3MCZA 4RGSA 1JXSA 4KJZA 4HRIA 1UMQA 1SD7A 2GQQA 3W6VA 2R5YB 2W4SA 2XPUA 3I4PA 3Q0VA 2Z9OA 3E97A 2AO9A 4I99C 4S0HB 3JW4A 4BHBA 1IUYA 5HS8A 4AWXB 2XC7A 1JUSA 3MMYB 2Y9ZA 4BY7J 3GWZA 1JHHA 4UV8A 4HEA2 3ZMVA 1RI7A 1EH6A 4BY1J 1ETOA 2Q1ZB 3QWLA 2NOGA 2WB1A 4RAZA 1USTA 2RVCA 4DJAA 3TL4X 4P55A 2IXSA 2ZMEA 4EEFG 4CDGA 4X0GA 3PL8A 4JX5A 2EPFA 5ILVA 3F8CA 4BEHA 3I56I 1WJEA 2LH9A 3UR3C 3J7AO 2PJPA 1ETKA 3HSRA 2EH3A 3FXRA 3KLOA 3WE2A 4UXNA 2LNBA 4M3EA 2DJNA 2O3FA 1XB4A 4FX0A 1YW9A 1O3SA 4YELA 4L18B 2ELJA 1SFOJ 4BQOA 1BOBA 2RN7A 1E3OC 2B63J 1MBFA 3G71I 4LG0B 2D5VA 1V5GA 2DA7A 4M9ZA 2CQNA 3E6CC 4HDUA 4IOCF 2L9NA 3HHGA 4J00A 5JHFA 2ICWG 1DGRM 5D5UB 2EFOA 3ZQGA 4N4NB 3QQAA 2K9SA 4L9TA 4XR6A 2BE5F 2ID6A 2F5VA 1R7JA 1TT0A 4BJ5C 5GADJ 2IT0A 2CQXA 2V1XA 3S2WA 2CV0A 2K86A 5CVUA 3FBIB 1ZTRA 2ME6A 2R7VA 3OYAA 4HDVA 2HU9A 3BTCA 2MC3A 2HTSA 4CYCB 1OLTA 5M3FJ 1IXCA 4U87A 2RDPA 2QENA 1BOAA 4HLXA 2K9LA 3JRCA 2MW8A 1V55H 1P4XA 2BOLA 4FQGA 1SAXA 2D1HA 4BQNA 1OYWA 4Y52J 1QZEA 2DTZA 1T98A 2CQQA 3WTTC 4PK4A 3K9TA 2RAEA 1JUPA 3KP2A 3RZOJ 1G2HA 4CZCA 3ESWB 3G3ZA 1VQ5I 1YQAA 3ABLH 4BGDA 3N4MA 2MLKA 4A0ZA 2VBYA 3ELKA 4M3DA 5JLXA 3VB2A 2PX9A 4BDZA 2R7WA 3I4MJ 3JRGA 2DQLA 3S1MJ 5FO5A 1OCZH 2O5RA 3K70D 3RPQA 3ISPA 2CSOA 3G4SI 4BHCA 3FHNA 2FBIA 2WY7Q 3QOPA 1MNDA 2MG4A 2FOWA 5H6RA 5L3DA 3ZRGA 4B44A 5H2FC 4IHYA 1RPWA 3HYIA 3BJOA 1B72A 3OS1A 4YIIA 2ID3A 2K27A 4OU0A 3ZGKA 1K61A 3AL0B 2JZYA 1CF7B 3GTLJ 3V8KA 3A01A 1XCBA 2BY3A 1NH3A 4MQ9F 3Q0UA 4YFKF 2CFXA 2M45A 4F3QA 2CQ7A 3TOBA 1Z05A 4PZJA 4HF0A 2DODA 5JR3A 3B02A 3BOQA 2M4GA 2RV8A 4Q4ZF 1VQNI 3M1EA 2GAUA 3TO9A 4MQVA 1BN5A 2R7RA 2P5VA 3NARA 2IP2A 3MKZA 2M0CA 2W1OA 3GYHX 3RPUD 3CP2A 5J47A 4XRMA 4PJJA 1MH3A 4JBAA 2DBBA 1EH8A 3V8LA 4AVZA 1R6RA 4XSXF 3Q5FA 2WY8Q 1J0RA 3OYHA 4LK1F 4AU7A 4R1HA 4R8HA 2VQHA 1ERDA 5IP7J 3H36A 1PUEE 3S15J 1D1AA 3FK6A 1VQMI 1G3YA 5DD8A 4J19A 3AKZA 2OUMA 3CMAI 1Z3YA 3HM5A 1FBQA 1YITI 2CS3A 2BY1A 4EM0B 2DJIA 2Z2SB 1HF0A 1DU0A 3L2RA 2P81A 3ZN1A 3DEWA 4LB6B 2HZTA 5HLTA 3BG9A 3ZR8X 5IPAA 3HKZN 5AIQA 1AU7A 1UG0A 2XUBA 2YX4A 3ECHA 1CGPA 3CLQA 3E7LA 4NHJA 2YPRA 2UUZA 2ZCWA 2VOOA 2P5LC 4WXCA 2XGDA 1S3JA 4A3BJ 2Z5UA 1B6AA 1D1CA 2K40A 3CO6C 2IGMA 3CC2I 4YRVA 1ZREA 3DXJF 4CZZA 2HS5A 3HOWJ 5ED4A 4EQQA 1F43A 5DV5A 2JPCA 5A2QK 2CW0F 2VUMJ 3VYTB 1FT9A 3F8NA 3HTUA 5B1AH 1UG2A 1FEXA 1BW6A 2LYCA 2HPMA 3BR2A 4E6KG 2FD5A 3H9QA 1YI2I 4XMYA 5D6EA 1FIPA 1N25A 5JI6A 2FE3A 3T0YA 1ZQ3P 2UZKA 3NWSA 5E20A 3OY9A 4UB8C 4KIFA 1EF4A 1B1BA 1SFKA 3H35A 4OOIA 4LMYA 4M6XA 4I01A 1IDYA 2NAZA 3C2HA 3VYSB 3HDDA 4A6EA 3QRFF 3BT9A 5E8GA 4W1UA 5KAFC 3RQIA 2QLZA 1FBUA 2VBWA 4XK4A 1RUNA 1RZ4A 3PUFA 1ZARA 1BR2A 2EFPA 4P1WA 3GTOJ 4X6AJ 1O7LA 2M34A 3LSKA 1D0YA 4CCKA 2EV5A 4HG2A 2JA8J 3GZ6A 2A5WA 2L9RA 1KQ8A 4EATA 2OA4A 2DT7B 4XRSG 3QYBA 1QVUA 3C3WA 4OMZA 3LNQA 3CC4I 1JJ8C 3HOYJ 2GZWA 2DMUA 2XAJA 1BIBA 1S5LC 2XB0X 5FKOA 2LDUA 2K4JA 1IG7A 2Z1DA 1TNSA 4RDUA 2O9LA 4DBQA 2OD5A 3RCOA 2EA2A 2Q8KA 1IRFA 3CCEI 2L3DA 2MD0A 2V1NA 4EGZA 1T8IA 3MKYB 3WE3A 1T39A 2BV6A 4BYYA 4A5NA 3WTUC 3G1LA 5GAHJ 2L5QA 3R4KA 4V2FA 5CPRB 3FDYA 3W3CA 2KL4A 1MBJA 1LEBA 4DZJA 3VOEA 1QHGA 3C18A 1UZCA 2FNPA 2O7OA 1RRJA 4IOAF 2WB1N 3B73A 3QPTA 1S8NA 3WU2C 2LFBA 3WTWC 1IN8A 1R58A 4H4KC 4L9NA 4HZFA 3LAPA 4HOBA 2EBIA 1BI2A 1LJ9A 3CJNA 4BJTA 1YLFA 2BVLA 3RKWA 2WWYA 2LBFA 3DTKA 5EZGA 3OV8A 2FU4A 3MFKA 2DA1A 2GLOA 4LIUA 3VYUB 2V6CA 3AFHA 3ZMUA 1QZZA 1XMKA 2VLAA 3H9JA 4HV5A 1W0UA 3ROUA 1W36C 2HYFA 2RNJA 1XG1A 2LD5A 1PDNC 2WADA 3LOCA 3T5XA 5IP9J 3CCMI 4B47A 1OR7C 4BE0A 3R0AA 5DM6F 2OZ6A 4NB5A 3BZCA 2M7AA 3TKYA 5IYBJ 4L9VA 1KYWA 3C1DA 1QVTA 3KP3A 1W7PD 4NC8A 2IPQX 4GRIA 1X2MA 2C6YA 1R22A 2FRHA 2QCOA 1KZHA 4NBQA 3KFWX 2E1MC 2JA5J 4BACA 3DTIA 1R1UA 5F04A 1JKOC 3W6JB 4LLGF 1IXRC 2R4GA 3L7WA 4QIWN 2A05A 4A3EJ 2YR2A 1ZRCA 6PAXA 3H3UA 5HS9A 3DKWA 1G3SA 1Y1VJ 2ETHA 2VOPA 2EA4A 2NOJB 4GYIA 1P92A 3RTRA 3HOTA 2E5NA 3ZMSA 4RGUA 2VBXA 1D8JA 1IZ1A 3HOSA 4A12A 2N8GA 1VQKI 4PSXA 2LG4A 2EQRA 4G8XA 3HOVJ 3H1CA 4LITA 4S04A 2FJ1A 4JOMA 5M5WJ 2LF7A 1H88C 3BR6A 4CCMA 4A3CJ 1ZRFA 1OCCH 2HVQA 1IV8A 2EIKH 4E4HA 2XSDC 4JX4A 3K2ZA 4RGXA 3PJRA 1KQ0A 2DQRA 2VJ4A 3QPHA 1B8IB 3VSKA 1WJCA 4F92B 2FQ3A 2V9VA 3NEUA 3ZP5A 3CDHA 2DTRA 1JHFA 2LVSA 4Q5SF 3FF5A 4DYCA 1VQ6I 3E3VA 2VIXA 3M9AA 5E3OA 4XRSA 1REPC 2M8GX 1ZGJA 1Z77A 1MSFC 5DS9A 1ZG3A 5F6FA 3FXJA 5EZHA 1WVRA 4MNUA 2ZKZA 4M3BA 3GTQJ 1XX5A 3ML6A 3K1NA 4RMNA 4XBFA 2ZJQF 3BCAA 5FLVA 3GLLA 5E3LA 5HLGA 4OWRB 2H6BA 2DDAA 4ANJA 1MNEA 3DPLC 4A5MA 3AG2H 2BEOA 5TGTA 3HTSB 3HSFA 3QPLA 1G3TA 3L09A 2ZFWA 5E1ZB 2IS6A 2ISYA 5IYCJ 1ITYA 1TLHB 1Z21A 5F08A 2DOAA 1MD0A 3M07A 4HYEA 2VN2A 2GBYA 4OIPF 2E1OA 1XCVA 3H0DA 1WI3A 2CW7A 1LVKA 1MDMB 1JKRC 5CYVA 2IA0A 1APLC 1Z1DA 2GXGA 3OYDA 1OJLA 3SEQA 2MYSA 3RIRA 4C2TA 3M4OJ 4HQEA 3BQYA 1Y1WJ 3ASOH 3GUDA 2W7NA 4JX6A 1FNNA 2IS2A 4E7HA 4M6VA 3DU6A 1R1VA 3RKQA 1ZG5A 1KONA 1XDSA 4A69C 1YO5C 2XHKA 3KX2A 1GLNA 2EWNA 1GVDA 1OR7A 1FMWA 1FIAA 4A3DJ 3JREA 2A6HF 3KP5A 3PQJA 1J09A 5IT9K 4D7NA 4IRGA 4XM3A 1R00A 2MFZA 4XONA 1XDUA 3HGGA 3I4NJ 2XRLA 1U3EM 2X51A 2DOEA 2ZBKA 2ZO4A 4CXFA 3MEXA 4M6YA 3C2GA 4XLCA 2EFNA 1X1CA 2RQPA 3V8JA 4UVAA 1S9HA 2E35A 3U9GA 1A04A 4EJWA 1R5HA 3HG9A 3QAHA 1PUFB 4G94A 2XVCA 4RM2A 3IKVA 1F36A 1K4SA 2VXDA 4ZH4F 3CCUI 2IS1A 1FOKA 4I0AA 3TQNA 3E5QA 4DYQA 5E17F 4YEJA 1JGGA 2DYRH 2OV7A 1R5GA 1MNMC 2TRTA 2K02A 4ZC3A 3JTHA 3O2PE 3OIQA 3I59A 3T8TA 2F4IA 4V19K 3PM1A 4IJAA 1TWCJ 3K4JA 3WTSC 1RUOA 2QSHX 4DZPA 1RKTA 2VONA 2WAFA 4ZYHA 2JK3A 4H0EA 1HKQA 1XS9A 3J80Z 1FY7A 4NNJA 3JRDA 4AM3A 2DA6A 1ULYA 1K6YA 1JJ6C 4RB0A 2HQ5A 1HKSA 3ULQB 1P9QC 3J81Z 4ETSA 1WCMJ 1LUJB 3KYDB 4ZDPA 4WWCA 2GOXB 1VTNC 3HKZA 4JQFA 3Q0WA 4BE1A 2GIVA 3LFKA 4M72A 3TP0A 1VQPI 2PQ8A 4IZZA 3OYLA 3JRIA 5FLXZ 3FXOA 2CYYA 3CUQB 1WH5A 1JTYA 2QF7A 4ON0A 5TISC 2V1UA 3F72A 2X1CA 1DP7P 2VPRA 1POGA 2R93J 1S7EA 1G3WA 4ZYDA 2CFOA 1AKHB 1RIOH 5CVVA 3WHBA 2VKEA 4HBLA 3LA2A 2G7HA 1S7AA 1ZYRF 4E7IA 1Y6IA 3PNVA 4G6DA 2XGCA 3KYCB 3FMSA 2XIGA 3DCFA 3RYPA 1K78B 1U5TB 3CESA 2DCEA 1S6LA 4HSTA 5TRDA 1OQYA 3U2RA 1LE8B 2A5YB 4BBRJ 1Q1VA 3FWEA 3IH2A 4QLCU 2EJRA 4YG2F 2XF5A 1VFCA 2DA3A 5DCFA 1M1EB 3COAC 2VE8A 4G7HF 3BC8A 3MZYA 3R60A 3R0JA 4O6JA 1DPRA 1IRGA 4DGWB 5LEKA 1WGXA 3S2HJ 5KCMA 2XB5A 3BR0A 4XKBA 5LHIA 1ZAOA 3CJRB 3A4CA 5AONA 1K78A 5GAGJ 2M0MA 5H20A 4KITB 3BG6A 5EYRA 3BTJA 3AG4H 4I7HA 5E3MA 3OOUA 1ENHA 2X6WA 3TBIA 2IGKA 2VC1A 3S1NJ 1IRXA 1GT0C 2R7OA 5LGUA 5K1YA 2P6TA 4P9FA 4B1RA 1TL8A 2NS8A 2CJJA 1QU3A 1HW2A 2Z33A 2NNNA 2R7TA 1X1DA 1BI3A 1TQMA 3BJ6A 4IRHA 5ILUA 3WHCA 3AL0C 3SYTA 2H27A 3MWMA 5LRSA 3Q9SA 1MW7A 2KPMA 5LHHA 1SC7A 2E34A 3HUGB 2A6TA 2DA2A 4E7ZA 3LQQA 3OYEA 1IC8A 1HC8A 1FLIA 1N75A 1HKTA 3SZTA 3EYYA 4IKFA 2JRMA 5GAEJ 1FC3A 2GOMA 1PVEA 2KZGA 3CTAA 3JAMK 2R5YA 5KAIC 5EDNA 4UY8I 2F4MB 4BH9A 2QQAA 2HPIA 1T95A 1YFHA 2E5ZA 3VPRA 3A0HC 4KT5C 3KP4A 2FSWA 3L2CA 2Y9YA 2IJLA 3HRTA 1O7FA 3I0TA 1TZLA 4MHGA 3E1SA 3IV5A 2LRDA 3W2AA 4DNCA 1QQIA 3PFYA 4LLLA 4P96A 3P9CA 1SFEA 3ZQ7A 3NQOA 3DLLF 1RETA 3DKYA 3P7NA 4NDLA 5E3NA 1FBSA 2RNGA 2QQBA 3BQZA 4F52A 3Q9VA 2L9SA 4AIJA 3DLAA 3TO6A 4U7DA 5FGMA 1MMDA 3M8JA 4L0ZB 2ISZA 1I5ZA 4LG0A 1T0FC 5B1BH 3HIFA 4NC6A 4IVNA 1XPXA 3IWFA 3ZQFA 2E2JJ 2DMQA 4FISA 3G2BA 4RLQA 2A68F 2FA5A 1T08B 3DU5A 3GZNB 1K6OA 4XKCA 2DMTA 2G7UA 3JSOA 3FXMA 2DOFA 1WKMA 2M5WA 2OAZA 3V7CA 4PJNA 4B4CA 1LFUP 1JT6A 4BXUA 3H5AA 4HF1A 2PMZN 5EEAA 4IHWA 4CYCA 4LFUA 1MMNA 1KQ9A 1V54H 2X0LA 3CUOA 2L7MP 3VWBA 3HRUA 4F55A 1MJ9A 2XGXA 3IUOA 1I27A 3G73A 4CH7A 1ZKGA 2GWRA 5KK1A 2KZVA 2BXYA 2X9DA 2LR8A 4YIFA 4P5OA 1OMIA 4WK8F 1NK2P 1GXQA 1U0JA 4ZJZA 2FQ4A 4G12A 1R1TA 1J59A 3IWZA 4XKWA 3CDIA 2K9MA 4MFEA 5F27A 2HQAA 3PNTA 5HOOA 1HW5A 5FRMA 1O4XA 4F93B 1DP3A 1YOVB 1LQ1A 2Q2EB 1ON1A 2UWMA 3S3MA 2JSPA 3FKJA 2LK2A 4PCQA 3IHUA 4P9UA 1W0TA 1PP7U 4BQQA 1IO2A 1NTCA 1YS7A 1CF7A 4UUTA 3EDPA 4I02A 4HAMA 1JT0A 3MAJA 4PFOA 2WAEA 2V79A 1HW1A 1U8BA 2AS5F 2RC4A 4HF2A 2X1EA 2Y75A 1UAAA 1MBHA 3HBLA 2NVXJ 3D5SC 3CJQB 3GBGA 3RI4A 2WTEA 4Y15A 3OSFA 5L3GA 4MTEA 1SANA 2L9VA 3WGHA 1V5EA 1OCOH 4LB5A 1V5FA 2QBYB 3RKYA 4AIHA 4FX4A 3K7AJ 2XAHA 3WG9A 2DFHA 3ZMDA 3L1PA 5GP9A 5DTDA 1PJRA 4OIRF 1W5TA 3PO3J 1WJBA 3MD2A 1J5YA 4RAGA 4IHTA 1P7JA 5FRNA 2JWTA 5F0CA 2WV0A 1T2KA 2P7CB 3PIOF 3BR3A 2VL8A 2D1VA 2V6EA 2R92J 5E1XA 1IDZA 3DV8A 2FUG2 1JGSA 2HOSA 5DM7F 2QBYA 2F5EA 4QSHA 2K9QA 2M30A 3WTZA 2VQLA 4E7LA 1IAWA 2B7EA 2QQ9A 5EG0B 3WTXC 2VASA 2W25A 5D8LB 1ZLJA 3H5RA 3VYRB 4U7BA 2WC2A 2FF4A 2H1LA
chains in the Genus database with same CATH topology
2N8GA 2EQRA 3HB9A 3HOVJ 1XC5A 3TW7A 2Y30A 5M5WJ 2FJ1A 1H88C 3BR6A 2ELKA 4A3CJ 1RKWA 4MFDA 1TC3C 4AC0A 2XSDC 4JX4A 3ZQHA 3GTJJ 4UUSB 4D5CA 5IYDJ 1B8IB 2HOAA 3GTGJ 1X58A 2JJ7A 3CCYA 5HODA 4XICA 1GV2A 2LVSA 4DYCA 1MBGA 3G1MA 2AHQA 2COBA 2EZKA 5E3OA 4XRSA 2I10A 2M8GX 1I6HJ 3BR5A 4C3JJ 1T33A 5C4JJ 5M5XJ 4GFBA 1ZR4A 4MIMA 1Z77A 2LP0A 2JMWA 2MSYA 3OIOA 1MSFC 5DS9A 3S2DJ 5EZHA 2L7ZA 3GTKJ 1ETVA 2JN6A 3BG5A 1VNDA 4M3BA 5GPAA 2NVQJ 3GTQJ 3S16J 3MN2A 1B72B 5FLVA 5E3LA 3HOZJ 1AHDP 5FKLA 4BXXJ 5F0FA 4C3IJ 3A01B 3QPLA 1K83J 4AYBN 2EZIA 5IYCJ 3TP3A 1ITYA 5F08A 1GUUA 1U9NA 1IUFA 4LOCA 1JUMA 4A3MJ 2GBYA 4A3KJ 2E1OA 1JTXA 3HGYA 1WI3A 1JKRC 2Y31A 3TW6A 2TCTA 1APLC 4JP0A 2E2IJ 3O8HA 3NAUA 1OJLA 4MLOA 2HOTA 3M4OJ 2Y2ZA 3BQYA 5EGOB 1Y1WJ 1RR7A 5J1RA 4JX6A 4HNVA 1WPKA 4M6VA 2IBDA 4MO7A 4L5EA 3RKQA 2HXOA 4A69C 2VKVA 1BJZA 5C3EJ 4ABZA 3GTPJ 1GVDA 4IEJA 3CDLA 1MBEA 1FIAA 4A3DJ 3JREA 5JLWA 2O8KA 3QPSA 2OPTA 2HI3A 4D7NA 3LSGA 5FKNA 2GM4A 1T56A 3CMYA 3UKGA 1FTZA 2R0QC 5FJ8J 2NS7A 3HGGA 1RESA 1P7IA 1UMQA 2XRLA 3W6VA 3I4NJ 2R5YB 2XPUA 3Q0VA 3G1OA 2AO9A 2CUFA 5EGOA 2XGEA 4S0HB 1JUSA 2Y9ZA 4BY7J 4JYKA 1PUFB 4BY1J 4IHVA 1F36A 1ETOA 2NOGA 2XPVA 2YU9J 4EEFG 3JRAA 4JX5A 4A3GJ 4DYQA 1JGGA 2LKXA 1MNMC 2TRTA 1BL0A 2H1KA 1ETKA 2EH3A 4V2GA 3PM1A 4M3EA 3PO2J 2DJNA 1IRZA 1TWCJ 1ZGWA 1SFOJ 4DYRA 2NVTJ 4DZPA 1E3OC 1RKTA 2B63J 4XIDA 1MBFA 1ETYA 4I76A 2JK3A 3JR9A 2DA7A 2D5VA 1XS9A 3JRDA 4M3GA 2DA6A 1JJ6C 2HQ5A 3ZQGA 3D1NI 3QQAA 3LSRA 1WCMJ 2K9SA 2WV1A 5EG0A 3MVPA 1U9OA 3LSJA 4B3AA 2ID6A 3Q0WA 2CQXA 1YRNB 2DN0A 3FK7A 1ZTRA 2ME6A 3TP0A 2ZB9A 3JRIA 3BTCA 3M3YJ 4CYCB 4QTRA 1WH5A 1JTYA 2QF7A 3HEFA 3JRFA 5M3FJ 3A02A 3BR1A 2VPRA 5F1JA 1POGA 1MSEC 1S7EA 3JRCA 2MW8A 2ME0A 2R93J 4UUSA 1FTTA 1AKHB 1B8IA 4Y52J 2DTZA 3WHBA 2CQQA 2VKEA 3H3VK 2K9NA 2RAEA 1JUPA 3RZOJ 4A3IJ 1A5JA 1G2HA 4I6ZA 2XGCA 2JA6J 3ZQIA 3DCFA 3LSPA 4M3DA 2W48A 5JLXA 2FX0A 3I4MJ 3JRGA 2LTPA 4DW6A 3S1MJ 3IH4A 2IEKA 1TWHJ 5K7HA 1LE8B 4BBRJ 1Q1VA 1GV5A 2MG4A 2KT0A 5IP6A 1H89C 3IH2A 5C4XJ 4IHYA 4FE4A 1RPWA 3A03A 1B72A 3H0GJ 1Z0XA 1JKPC 1K61A 2ID3A 1VFCA 2DA3A 2G0EA 3ZOBA 2CUEA 3GTLJ 3SFIA 3A01A 1MBKA 1WGXA 3S2HJ 3Q0UA 2XB5A 3BR0A 5BNGA 4FTHA 5K7FA 5C44J 5FKMA 5EYRA 4M3FA 3BTJA 5E3MA 3OOUA 1ENHA 3RZDJ 3S1NJ 3NARA 1GT0C 2CU7A 2M0CA 4B1RA 4XRMA 2X48A 3BTIA 2NS8A 1MH3A 1VI0A 2CJJA 3K2AA 2ECCA 1IGNA 1BA5A 2CRGA 3WHCA 3JRHA 2HXIA 1FJLA 3B6CA 4A3JJ 3OSGA 1ETQA 5IP7J 3C2BA 3S15J 5IOYA 1X2NA 1QRYA 3FK6A 1OFCX 4C2MJ 3JRBA 1HDDC 3O8GA 4J19A 2DA2A 1U78A 3HM5A 1IC8A 2M9HA 2KDZA 1HF0A 1DU0A 2P81A 1IV6A 3DEWA 3MKLA 3BG9A 2DA4A 5IPAA 3HKZN 2R5YA 5EDNA 1AU7A 2R7ZJ 3Q3SA 3E7LA 1DU6A 1QPIA 5K7ZA 1MH4A 4X1EA 3VPRA 2DA5A 2Y9YA 2XGDA 4A3BJ 3IV5A 4BKXA 1PUFA 3BTLA 2K40A 2L0KA 4RBOA 1UHSA 3HOWJ 1RETA 4BBSJ 1F43A 4NDLA 2VUMJ 5E3NA 2XPWA 1UG2A 1FEXA 1BW6A 3BQZA 3BR2A 2FD5A 2R5ZB 1FIPA 1ZQ3P 1H8AC 5J1UA 1EF4A 4A3LJ 4W97A 2H8RA 1IDYA 2IAIA 2X6OA 2YUSA 3HDDA 3BT9A 4W1UA 1R9TJ 3RQIA 4D7MA 2E2JJ 2NVYJ 2DMQA 4XK4A 2EZHA 4FISA 1WH7A 1OCPA 3TEDA 4D5FA 3GTOJ 3ZQLA 1BW5A 3FKIJ 4X6AJ 2M34A 1ORKA 3SJMA 2HDDA 1LFBA 2DMTA 1YRNA 2JA8J 2HYJA 2Y0SN 2R5ZA 2L9RA 2EZLA 4B4CA 1LFUP 1JT6A 2PMZN 4XRSG 5EEAA 4CYCA 4IHWA 1QVUA 1IJWC 3LNQA 3S17J 1JJ8C 3HOYJ 2DMUA 2L7MP 2XB0X 5FKOA 3CQZJ 3FIWA 3GTMJ 2OF7A 1IG7A 2YS9A 1AKHA 4RDUA 3S1QJ 1ZKGA 2LY9A 3B6AA 2O9LA 2X9DA 4A93J 5M3MJ 9ANTA 2LR8A 5FKKA 5M5YJ 5IOZA 1NK2P 2M2EA 1GDTA 1HOMA 4AUXA 2FQ4A 4G12A 1JKQC 1HDPA 1D5YA 3G1LA 2E19A 4MFEA 4V2FA 5F27A 5GPCA 1VF9A 1MBJA 4DZJA 1LE8A 1O4XA 1ZK8A 2O7OA 2WB1N 2LFBA 2LK2A 3S14J 3SDGA 3ZQCA 2EBIA 3F0CA 1W0TA 1HCRA 1NTCA 4FCYA 4UUTA 1OCTC 1JT0A 1NK3P 5EZGA 2GLOA 1U8BA 2DA1A 4A3FJ 3FISA 1MBHA 3HBLA 2NVXJ 1W0UA 3GBGA 4C3HJ 3OSFA 3HOXJ 2E2HJ 4FE7A 1SANA 1XG1A 2LD5A 3LOCA 5IP9J 5J1YA 1TWAJ 1TWGJ 3K7AJ 1HLVA 1I3QJ 1CQTA 2JA7J 5IYBJ 1ZR2A 1QVTA 3L1PA 5GP9A 5DTDA 1I50J 1X2MA 3PO3J 2QCOA 4IHXA 1ETXA 2L7FP 1P7JA 1A6IA 1ETWA 4Y7NJ 2JWTA 2JA5J 5F0CA 1TWFJ 2LLKA 5F04A 5F0HA 1JKOC 5FLMJ 3BR3A 2VI6A 2DMNA 4QIWN 4A3EJ 2MGQA 2R92J 1IDZA 2HOSA 4QSHA 2K9QA 3IH3A 5J3LA 5EF6A 2ECBA 2WAQN 3S1RJ 3HOUJ 5EG0B 3BG3A 1Y1VJ 2DMPA 3ZQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N8G A;  2EQR A;  3HB9 A;  3HOV J;  1XC5 A;  3TW7 A;  2Y30 A;  5M5W J;  2FJ1 A;  1H88 C;  3BR6 A;  2ELK A;  4A3C J;  1RKW A;  4MFD A;  1TC3 C;  4AC0 A;  2XSD C;  4JX4 A;  3ZQH A;  3GTJ J;  4UUS B;  4D5C A;  5IYD J;  1B8I B;  2HOA A;  3GTG J;  1X58 A;  2JJ7 A;  3CCY A;  5HOD A;  4XIC A;  1GV2 A;  2LVS A;  4DYC A;  1MBG A;  3G1M A;  2AHQ A;  2COB A;  2EZK A;  5E3O A;  4XRS A;  2I10 A;  2M8G X;  1I6H J;  3BR5 A;  4C3J J;  1T33 A;  5C4J J;  5M5X J;  4GFB A;  1ZR4 A;  4MIM A;  1Z77 A;  2LP0 A;  2JMW A;  2MSY A;  3OIO A;  1MSF C;  5DS9 A;  3S2D J;  5EZH A;  2L7Z A;  3GTK J;  1ETV A;  2JN6 A;  3BG5 A;  1VND A;  4M3B A;  5GPA A;  2NVQ J;  3GTQ J;  3S16 J;  3MN2 A;  1B72 B;  5FLV A;  5E3L A;  3HOZ J;  1AHD P;  5FKL A;  4BXX J;  5F0F A;  4C3I J;  3A01 B;  3QPL A;  1K83 J;  4AYB N;  2EZI A;  5IYC J;  3TP3 A;  1ITY A;  5F08 A;  1GUU A;  1U9N A;  1IUF A;  4LOC A;  1JUM A;  4A3M J;  2GBY A;  4A3K J;  2E1O A;  1JTX A;  3HGY A;  1WI3 A;  1JKR C;  2Y31 A;  3TW6 A;  2TCT A;  1APL C;  4JP0 A;  2E2I J;  3O8H A;  3NAU A;  1OJL A;  4MLO A;  2HOT A;  3M4O J;  2Y2Z A;  3BQY A;  5EGO B;  1Y1W J;  1RR7 A;  5J1R A;  4JX6 A;  4HNV A;  1WPK A;  4M6V A;  2IBD A;  4MO7 A;  4L5E A;  3RKQ A;  2HXO A;  4A69 C;  2VKV A;  1BJZ A;  5C3E J;  4ABZ A;  3GTP J;  1GVD A;  4IEJ A;  3CDL A;  1MBE A;  1FIA A;  4A3D J;  3JRE A;  5JLW A;  2O8K A;  3QPS A;  2OPT A;  2HI3 A;  4D7N A;  3LSG A;  5FKN A;  2GM4 A;  1T56 A;  3CMY A;  3UKG A;  1FTZ A;  2R0Q C;  5FJ8 J;  2NS7 A;  3HGG A;  1RES A;  1P7I A;  1UMQ A;  2XRL A;  3W6V A;  3I4N J;  2R5Y B;  2XPU A;  3Q0V A;  3G1O A;  2AO9 A;  2CUF A;  5EGO A;  2XGE A;  4S0H B;  1JUS A;  2Y9Z A;  4BY7 J;  4JYK A;  1PUF B;  4BY1 J;  4IHV A;  1F36 A;  1ETO A;  2NOG A;  2XPV A;  2YU9 J;  4EEF G;  3JRA A;  4JX5 A;  4A3G J;  4DYQ A;  1JGG A;  2LKX A;  1MNM C;  2TRT A;  1BL0 A;  2H1K A;  1ETK A;  2EH3 A;  4V2G A;  3PM1 A;  4M3E A;  3PO2 J;  2DJN A;  1IRZ A;  1TWC J;  1ZGW A;  1SFO J;  4DYR A;  2NVT J;  4DZP A;  1E3O C;  1RKT A;  2B63 J;  4XID A;  1MBF A;  1ETY A;  4I76 A;  2JK3 A;  3JR9 A;  2DA7 A;  2D5V A;  1XS9 A;  3JRD A;  4M3G A;  2DA6 A;  1JJ6 C;  2HQ5 A;  3ZQG A;  3D1N I;  3QQA A;  3LSR A;  1WCM J;  2K9S A;  2WV1 A;  5EG0 A;  3MVP A;  1U9O A;  3LSJ A;  4B3A A;  2ID6 A;  3Q0W A;  2CQX A;  1YRN B;  2DN0 A;  3FK7 A;  1ZTR A;  2ME6 A;  3TP0 A;  2ZB9 A;  3JRI A;  3BTC A;  3M3Y J;  4CYC B;  4QTR A;  1WH5 A;  1JTY A;  2QF7 A;  3HEF A;  3JRF A;  5M3F J;  3A02 A;  3BR1 A;  2VPR A;  5F1J A;  1POG A;  1MSE C;  1S7E A;  3JRC A;  2MW8 A;  2ME0 A;  2R93 J;  4UUS A;  1FTT A;  1AKH B;  1B8I A;  4Y52 J;  2DTZ A;  3WHB A;  2CQQ A;  2VKE A;  3H3V K;  2K9N A;  2RAE A;  1JUP A;  3RZO J;  4A3I J;  1A5J A;  1G2H A;  4I6Z A;  2XGC A;  2JA6 J;  3ZQI A;  3DCF A;  3LSP A;  4M3D A;  2W48 A;  5JLX A;  2FX0 A;  3I4M J;  3JRG A;  2LTP A;  4DW6 A;  3S1M J;  3IH4 A;  2IEK A;  1TWH J;  5K7H A;  1LE8 B;  4BBR J;  1Q1V A;  1GV5 A;  2MG4 A;  2KT0 A;  5IP6 A;  1H89 C;  3IH2 A;  5C4X J;  4IHY A;  4FE4 A;  1RPW A;  3A03 A;  1B72 A;  3H0G J;  1Z0X A;  1JKP C;  1K61 A;  2ID3 A;  1VFC A;  2DA3 A;  2G0E A;  3ZOB A;  2CUE A;  3GTL J;  3SFI A;  3A01 A;  1MBK A;  1WGX A;  3S2H J;  3Q0U A;  2XB5 A;  3BR0 A;  5BNG A;  4FTH A;  5K7F A;  5C44 J;  5FKM A;  5EYR A;  4M3F A;  3BTJ A;  5E3M A;  3OOU A;  1ENH A;  3RZD J;  3S1N J;  3NAR A;  1GT0 C;  2CU7 A;  2M0C A;  4B1R A;  4XRM A;  2X48 A;  3BTI A;  2NS8 A;  1MH3 A;  1VI0 A;  2CJJ A;  3K2A A;  2ECC A;  1IGN A;  1BA5 A;  2CRG A;  3WHC A;  3JRH A;  2HXI A;  1FJL A;  3B6C A;  4A3J J;  3OSG A;  1ETQ A;  5IP7 J;  3C2B A;  3S15 J;  5IOY A;  1X2N A;  1QRY A;  3FK6 A;  1OFC X;  4C2M J;  3JRB A;  1HDD C;  3O8G A;  4J19 A;  2DA2 A;  1U78 A;  3HM5 A;  1IC8 A;  2M9H A;  2KDZ A;  1HF0 A;  1DU0 A;  2P81 A;  1IV6 A;  3DEW A;  3MKL A;  3BG9 A;  2DA4 A;  5IPA A;  3HKZ N;  2R5Y A;  5EDN A;  1AU7 A;  2R7Z J;  3Q3S A;  3E7L A;  1DU6 A;  1QPI A;  5K7Z A;  1MH4 A;  4X1E A;  3VPR A;  2DA5 A;  2Y9Y A;  2XGD A;  4A3B J;  3IV5 A;  4BKX A;  1PUF A;  3BTL A;  2K40 A;  2L0K A;  4RBO A;  1UHS A;  3HOW J;  1RET A;  4BBS J;  1F43 A;  4NDL A;  2VUM J;  5E3N A;  2XPW A;  1UG2 A;  1FEX A;  1BW6 A;  3BQZ A;  3BR2 A;  2FD5 A;  2R5Z B;  1FIP A;  1ZQ3 P;  1H8A C;  5J1U A;  1EF4 A;  4A3L J;  4W97 A;  2H8R A;  1IDY A;  2IAI A;  2X6O A;  2YUS A;  3HDD A;  3BT9 A;  4W1U A;  1R9T J;  3RQI A;  4D7M A;  2E2J J;  2NVY J;  2DMQ A;  4XK4 A;  2EZH A;  4FIS A;  1WH7 A;  1OCP A;  3TED A;  4D5F A;  3GTO J;  3ZQL A;  1BW5 A;  3FKI J;  4X6A J;  2M34 A;  1ORK A;  3SJM A;  2HDD A;  1LFB A;  2DMT A;  1YRN A;  2JA8 J;  2HYJ A;  2Y0S N;  2R5Z A;  2L9R A;  2EZL A;  4B4C A;  1LFU P;  1JT6 A;  2PMZ N;  4XRS G;  5EEA A;  4CYC A;  4IHW A;  1QVU A;  1IJW C;  3LNQ A;  3S17 J;  1JJ8 C;  3HOY J;  2DMU A;  2L7M P;  2XB0 X;  5FKO A;  3CQZ J;  3FIW A;  3GTM J;  2OF7 A;  1IG7 A;  2YS9 A;  1AKH A;  4RDU A;  3S1Q J;  1ZKG A;  2LY9 A;  3B6A A;  2O9L A;  2X9D A;  4A93 J;  5M3M J;  9ANT A;  2LR8 A;  5FKK A;  5M5Y J;  5IOZ A;  1NK2 P;  2M2E A;  1GDT A;  1HOM A;  4AUX A;  2FQ4 A;  4G12 A;  1JKQ C;  1HDP A;  1D5Y A;  3G1L A;  2E19 A;  4MFE A;  4V2F A;  5F27 A;  5GPC A;  1VF9 A;  1MBJ A;  4DZJ A;  1LE8 A;  1O4X A;  1ZK8 A;  2O7O A;  2WB1 N;  2LFB A;  2LK2 A;  3S14 J;  3SDG A;  3ZQC A;  2EBI A;  3F0C A;  1W0T A;  1HCR A;  1NTC A;  4FCY A;  4UUT A;  1OCT C;  1JT0 A;  1NK3 P;  5EZG A;  2GLO A;  1U8B A;  2DA1 A;  4A3F J;  3FIS A;  1MBH A;  3HBL A;  2NVX J;  1W0U A;  3GBG A;  4C3H J;  3OSF A;  3HOX J;  2E2H J;  4FE7 A;  1SAN A;  1XG1 A;  2LD5 A;  3LOC A;  5IP9 J;  5J1Y A;  1TWA J;  1TWG J;  3K7A J;  1HLV A;  1I3Q J;  1CQT A;  2JA7 J;  5IYB J;  1ZR2 A;  1QVT A;  3L1P A;  5GP9 A;  5DTD A;  1I50 J;  1X2M A;  3PO3 J;  2QCO A;  4IHX A;  1ETX A;  2L7F P;  1P7J A;  1A6I A;  1ETW A;  4Y7N J;  2JWT A;  2JA5 J;  5F0C A;  1TWF J;  2LLK A;  5F04 A;  5F0H A;  1JKO C;  5FLM J;  3BR3 A;  2VI6 A;  2DMN A;  4QIW N;  4A3E J;  2MGQ A;  2R92 J;  1IDZ A;  2HOS A;  4QSH A;  2K9Q A;  3IH3 A;  5J3L A;  5EF6 A;  2ECB A;  2WAQ N;  3S1R J;  3HOU J;  5EG0 B;  3BG3 A;  1Y1V J;  2DMP A;  3ZQF A; 
#chains in the Genus database with same CATH topology
 2H6C A;  3PNY A;  2VE9 A;  1O3R A;  5HLI A;  2DK5 A;  3HB9 A;  4PJL A;  1KU2 A;  2YU3 A;  2HKO A;  4R79 A;  1BI0 A;  2ELK A;  3RDI A;  3SFZ A;  4ZYE A;  1UJ8 A;  1KGS A;  1T0F A;  2K4B A;  1MMA A;  2DW4 A;  3CMM A;  3L00 A;  4XLN F;  4FT8 A;  2LC2 A;  4AC0 A;  3GF2 A;  2CO5 A;  1ZRD A;  1EA3 A;  5KVR A;  3ZQH A;  4UUS B;  4L5I A;  2E36 A;  3L2V A;  4G6T B;  1UHW A;  2HOA A;  2FEZ A;  1BI1 A;  3BY6 A;  1AWC A;  2NNY A;  3VFZ A;  5HOD A;  5HS7 A;  4XIC A;  2XKO A;  2AHQ A;  3FHZ A;  2QKL B;  3GFM A;  3QU6 A;  4N9H A;  4CA0 A;  1X19 A;  5D4S A;  1X3W B;  1Z3X A;  3ONQ A;  4I98 B;  5M5X J;  1ZR4 A;  2LP0 A;  3OOP A;  1FSE A;  4QPQ A;  2VQG A;  1L0O C;  2L7Z A;  3K6G A;  3BG5 A;  2NVQ J;  2JA2 A;  1BC8 C;  1ONV A;  3S16 J;  2MBF A;  3K4L A;  1D8K A;  3OR2 C;  1W5S A;  3MN2 A;  3HRM A;  2VB6 A;  3KEQ A;  3K70 C;  3HOZ J;  2CG4 A;  1XN7 A;  2QQ8 A;  2VKH A;  5FKL A;  4BXX J;  4ZZL A;  4HW0 A;  5F0F A;  3LA7 A;  2J5P A;  2EV0 A;  4XN0 A;  5FFZ A;  3SEZ A;  2AXL A;  3OYI A;  4Z2Y A;  2ESN A;  3FXU A;  4CCO A;  5L3F A;  3BP8 A;  4PGG A;  3LFU A;  2L02 A;  1LDK B;  3D5L A;  5ICF A;  3CCV I;  5D5X B;  2RGV A;  1MKM A;  1U9N A;  3TGN A;  1IN4 A;  5TJJ A;  3K1M A;  5HDK A;  4KFC A;  2MAB A;  2WA0 A;  1E3H A;  1WRJ A;  3K10 A;  3WGG A;  4A3K J;  2EFW A;  5FLX K;  2LRE A;  3LWF A;  1FMV A;  1W1W E;  2Y31 A;  1FOX A;  1UEL B;  3WOD F;  4II3 A;  4JP0 A;  3M8E A;  4FHT A;  2X6X A;  1QGP A;  2DYS H;  2A61 A;  4MLO A;  1E2X A;  3TDZ C;  4C2U A;  4ESJ A;  3SZG A;  2DPU A;  4EJU A;  1WPK A;  2IBD A;  2R7F A;  1SD5 A;  3R61 A;  4MO7 A;  4PFP A;  4A2U A;  2VOD A;  2VKV A;  1BJZ A;  1SFU A;  4ABZ A;  3GTP J;  5ICE A;  4C9Y A;  4BS9 A;  4EM1 A;  1F4K A;  4AVP A;  2P8T A;  2CMP A;  2GIZ A;  5JLW A;  1F5T A;  3QPS A;  5LD2 C;  3LSG A;  2F5C A;  2GM4 A;  3CMY A;  1FTZ A;  4JK1 X;  1LFP A;  3EUA A;  2R0Q C;  5FJ8 J;  1RES A;  1KA8 A;  3G1O A;  5L3C A;  3U21 A;  2JSC A;  4CCL A;  3DBR B;  1QO0 D;  1R71 A;  1FZP B;  2HDC A;  3FM5 A;  2CGP A;  1FP1 D;  3K69 A;  4PUS A;  4L0Y B;  4OIN F;  3N97 A;  4ESF A;  2MH9 A;  2XPV A;  2ELH A;  1Y56 A;  2LY1 A;  2YU9 J;  2KMU A;  1XGO A;  5E8I A;  3LA3 A;  1Y8Q B;  1G8X A;  1DQU A;  2LKX A;  3GW2 A;  4G9Y A;  3S3O A;  1I6X A;  2L4A A;  4BNC A;  5BOX A;  2F48 A;  4V2G A;  3ZQQ A;  3J7A Y;  3K1P A;  3PO2 J;  4KMU X;  1ZGW A;  4CGZ A;  3JSP A;  3WG7 H;  2AXT C;  4DYR A;  3WU1 B;  2NVT J;  4TV7 A;  1S7O A;  4UV9 A;  4BDY A;  4XID A;  3OWT A;  4RM3 A;  1YJW I;  1ETY A;  4I76 A;  1HST A;  4RLF A;  4M3G A;  1OIS A;  2EIJ H;  4XQF A;  4O5V A;  1D0X A;  1K4T A;  3LSR A;  2IRF G;  5CVI A;  2DFI A;  3IC7 A;  4ESB A;  2R7S A;  4F7Z A;  2W24 A;  1ZG1 A;  2XSJ C;  1YRN B;  4M74 A;  2MD5 A;  2OBP A;  4ZYG A;  2KIQ A;  3GCM A;  2W00 A;  1B9M A;  3OYN A;  2ZB9 A;  2BW3 B;  1H9G A;  4HSR A;  2R7Q A;  1UFM A;  3M3Y J;  4II2 A;  4QTR A;  3K4M A;  3JRF A;  3HEF A;  4B48 A;  2ZJR F;  1YX5 A;  1RR8 C;  1X3U A;  2QVO A;  3A02 A;  3BR1 A;  4WCG A;  2ME0 A;  2O6G E;  4CHU A;  3IL2 A;  2A3S A;  1B8I A;  3H3V K;  4NUB A;  1TT5 B;  3BJA A;  3K4K A;  4M73 A;  1A5J A;  2PMU A;  2XAG A;  4BUP A;  3SHF A;  2JA6 J;  3H92 A;  4U0W A;  1MIJ A;  5KHD A;  3SQN A;  3KET A;  4KDP A;  1ZGA A;  4XOR A;  1G6N A;  3DF8 A;  3QP5 A;  2PJR B;  2FX0 A;  2LTP A;  1FOY A;  1D5V A;  1HQC A;  4XSZ F;  2ZC2 A;  3RKX A;  4DW6 A;  5K7H A;  1TNT A;  3RYR A;  3N05 A;  2KT0 A;  5IP6 A;  1H89 C;  3CUQ C;  5C4X J;  4FE4 A;  3H0G J;  3F3X A;  1A31 A;  3RPU A;  1WJA A;  3J7Z I;  2G0E A;  2NXN B;  2DI3 A;  2O0Y A;  2CUE A;  3WGI A;  3SFI A;  1ODD A;  2V26 A;  2YX7 A;  3H3Z A;  3GX4 X;  1MBK A;  2OTJ I;  4A6D A;  3ZXS A;  2I5U A;  2V4J C;  5BNG A;  3EYI A;  4RA2 A;  4BE2 A;  2JVG A;  5K7F A;  5FKM A;  2PJR A;  3L2W A;  2PMZ A;  4HX8 A;  2OZU A;  3CCJ I;  3H5N A;  3VOD A;  4E7J A;  1WFX A;  3RZD J;  4HQM A;  4XNF A;  1U5T C;  3PQK A;  1MDM A;  4EJO A;  4MEX F;  5EEH A;  2CU7 A;  1Z6R A;  1IN5 A;  2K3P A;  2X48 A;  4ZDO A;  1E3P A;  3GFL A;  2H8W A;  1VI0 A;  3K2A A;  3P5J A;  1IGN A;  3SXY A;  1C0W A;  1MMG A;  2HEO A;  1D1B A;  1PP8 F;  3BWG A;  4LGW A;  3KP6 A;  2J5O A;  4CYD A;  3JRH A;  1BA5 A;  4KYW A;  1J7K A;  2HXI A;  4NQW B;  2BBY A;  1FJL A;  4E7K A;  1D0Z A;  3KYL A;  4WX9 A;  3B6C A;  4LIV A;  1ETQ A;  3C2B A;  2B9S A;  1I39 A;  1QRY A;  1OFC X;  4C2M J;  1XTA A;  3JRB A;  2DT5 A;  2M3A A;  3DBL B;  1X1P A;  2M1B A;  1GVJ A;  2M9H A;  4XL9 A;  5A2Q Z;  3OYC A;  1P6R A;  2KIF A;  3C7J A;  1XSD A;  2K7L A;  3MKL A;  5K5Q A;  3ZN0 A;  4J01 A;  1FYK A;  3Q3S A;  2HYG D;  1QPI A;  3OYK A;  3ABT A;  4X1E A;  4N9I A;  5J4V A;  1UHM A;  2XAF A;  1BBY A;  1DPU A;  4M71 A;  5CLS A;  3LQR A;  4Y4R A;  3U1D A;  1TQP A;  3LMM A;  1PUF A;  4N4O B;  5J40 A;  3BTL A;  3FXK A;  2O61 A;  4KN4 X;  2R7X A;  4PJM A;  1LPQ A;  2H09 A;  4ZTF A;  3ZMT A;  1NHA A;  4C30 A;  4BBS J;  2IA1 A;  2UV1 A;  5CQG A;  2V9K A;  1OCR H;  3RQ4 A;  2XPW A;  4CIC A;  2KKO A;  3E6M A;  4UVC A;  4L5J A;  3TMO A;  5BQT A;  4U0Y A;  3L2Q A;  1N77 A;  2OC6 A;  4GCV A;  1TBX A;  3QOD A;  5HNF A;  3RJP A;  2E71 A;  3PFI A;  4DBR A;  2NRA C;  3FM3 A;  4A3L J;  3A1Y A;  4W97 A;  1O3Q A;  1SMT A;  2IAI A;  2X6O A;  2YUS A;  4F91 B;  2DPD A;  5DUK A;  3KPH A;  4CSW A;  1R9T J;  4MEY F;  4IXA A;  1OYY A;  2NVY J;  1Y8R B;  1GXP A;  1P2F A;  4Y13 A;  1WH7 A;  1OCP A;  3TED A;  3E6B A;  5FRO A;  3S93 A;  2HYJ A;  2Y0S N;  2I8D A;  2EZL A;  1YIO A;  2Y0M A;  3CUQ A;  4DOZ A;  2CV2 A;  3CCL I;  5E18 F;  1JI8 A;  2Z3Y A;  2HGC A;  2LSO A;  4L9J A;  3FIW A;  4XLP F;  1B59 A;  3DBH B;  5FD5 A;  3U1K A;  3FXL A;  1WJF A;  2YS9 A;  4G7Z F;  1AKH A;  3S1Q J;  2EFQ A;  4GYG A;  3B6A A;  3OYJ A;  4A93 J;  5M3M J;  9ANT A;  2OJE D;  2W85 A;  3PSF A;  3O3K A;  5M5Y J;  2ZJ2 A;  1Y0U A;  1W7P B;  3GZ5 A;  2XRO A;  2LKS A;  5AIP A;  3V7S A;  2A6E F;  2F5F A;  2O03 A;  4AUX A;  1HDP A;  5D5V B;  5BPD A;  1SEU A;  2PG4 A;  4LJZ F;  5L3B A;  1DUX C;  1VQ7 I;  1XSX A;  2E19 A;  2ESH A;  1U5T A;  3CJT B;  1LE8 A;  2FMY A;  2HNH A;  1J2X A;  2QKM B;  5BPI A;  2E1C A;  2L01 A;  3S14 J;  4U0V A;  2K85 A;  3SDG A;  5JVT A;  3CCQ I;  2XF7 A;  2RQQ A;  3ZQC A;  4IPA A;  4FCY A;  3S3N A;  1VQO I;  1O3T A;  1W7P A;  4EJV A;  4RB1 A;  3OS2 A;  1NK3 P;  1OKR A;  4M9X A;  1T38 A;  4A3F J;  1O57 A;  3FIS A;  4ZDL A;  1QNT A;  3I3L A;  2QSG X;  2HWV A;  1XD7 A;  4EV0 A;  2XV4 S;  2GXB A;  3HOX J;  2E2H J;  2ZME B;  3OYG A;  4WF2 A;  5B5E C;  1W5C C;  1VZ0 A;  5J1Y A;  3CO7 C;  3S8P A;  1TWA J;  2R7D A;  4BEH B;  5EJC A;  1MJB A;  4XLA A;  2KJC A;  1HLV A;  5D4R A;  2OCE A;  1CQT A;  4KA4 A;  3KE2 A;  1RC9 A;  1F1Z A;  5DEQ A;  1TQI A;  1BC7 C;  1ACI A;  4B43 A;  1XGM A;  3BPX A;  4IHX A;  3CME I;  4IQJ A;  2L7F P;  4Y7N J;  1WJD A;  1TWF J;  2BZT A;  2HDW A;  3F8M A;  2G9W A;  3MQ0 A;  4ZZD A;  5HNH A;  3A0B C;  3HUG A;  2OU2 A;  3AG3 H;  1YIJ I;  2HVS A;  3I53 A;  1KU7 A;  4I0B A;  2FOK A;  3SDB A;  1Z91 A;  1STZ A;  3IH3 A;  3S1R J;  3HOU J;  2VQC A;  3BG3 A;  1UB9 A;  1Z6T A;  1TW3 A;  5D8K B;  3I5U A;  2BXZ A;  3P9K A;  3JCU C;  4HX7 A;  2DO7 A;  1FWZ A;  1TTY A;  3JTG A;  1SVM A;  3MZ8 A;  4G7O F;  1XGN A;  3DEU A;  5B3S H;  3X2Q H;  5KNL A;  1TC3 C;  1ZH5 A;  2CUJ A;  4YFX F;  2M7B A;  5E79 C;  4D5C A;  5IYD J;  2LOO A;  1X58 A;  3KCC A;  2JJ7 A;  1A36 A;  3VDX A;  3GO5 A;  5F1R A;  1T6S A;  1MBG A;  3G1M A;  3GVA A;  1OYI A;  2COB A;  2Y69 H;  4M9S A;  2EZK A;  2KDO A;  1L3L A;  3BR5 A;  2V7F A;  3H9G A;  4B09 A;  2NVU B;  2OTL I;  4Y33 A;  4MTD A;  2JMW A;  2MSY A;  1QBJ A;  3S2D J;  2LKP A;  3MKW B;  4CCJ A;  3OIP A;  4IRI A;  4DIQ A;  5ILS A;  1MMS A;  2M4K A;  2JN6 A;  4RAF A;  1VND A;  1I3A A;  2COM A;  1LB2 A;  4HV6 A;  3E5X A;  1B72 B;  1A35 A;  4Q48 A;  3OL4 A;  1AHD P;  5LGT A;  5HLH A;  1SD4 A;  2E7W A;  4C3I J;  1B9N A;  3A01 B;  2MLG A;  1J75 A;  2FXA A;  4XRF A;  1NG7 A;  3CP8 A;  5LHG A;  3GFI A;  3HC7 A;  2EZI A;  4QWQ A;  5HVQ C;  1X3Z B;  3TP3 A;  5DYM A;  1X1B A;  4N0B A;  2Y48 A;  4ENJ A;  2X85 A;  4LOC A;  1E0E A;  4XLE A;  3ERM A;  3KZY A;  5IT9 Z;  2IGO A;  3L9F A;  4KIB A;  2D45 A;  1JTX A;  2QZ8 A;  5JVG F;  3TW6 A;  2LY2 A;  3HSE A;  2TCT A;  3D0S A;  2UXX A;  1SMY F;  2E2I J;  2M8E A;  3O8H A;  5ICG A;  4PJ0 C;  1K7A A;  2KHM A;  4RGR A;  1E17 A;  2DU9 A;  2Y2Z A;  3L2U A;  2A07 F;  2K5C A;  5EGO B;  5J1R A;  1BR1 A;  1R5I D;  3OL3 A;  2HR3 A;  2DXI A;  4PDK A;  3CF2 A;  2HXO A;  5C3E J;  2IA2 A;  2MH2 A;  2XAQ A;  4PGH A;  2KIU A;  3CCS I;  3E6D A;  4RS8 A;  4CUG A;  1S72 I;  2MA3 A;  2O8K A;  3F8F A;  4S05 A;  2HI3 A;  2Q2E A;  1YJN I;  3DQV C;  1XMA A;  4Y3O A;  5FKN A;  1HA8 A;  3UKG A;  3FMQ A;  2P5K A;  1YTY A;  2NS7 A;  1P7I A;  4DQ2 A;  5IT3 A;  4UHT A;  5LGN A;  5DDG A;  5CKT A;  1U6G A;  4OAY A;  5EGO A;  2CUF A;  2XGE A;  1WWX A;  2E60 A;  5LLQ A;  4HNU A;  5HDN A;  5K5O A;  3EQL F;  4D1Q A;  3PIP F;  1W36 D;  4JYK A;  2EIL H;  4GGG A;  1SD6 A;  3CLO A;  2BY0 A;  2KIM A;  2R3S A;  2X4H A;  3BG7 A;  4QPO A;  4EM2 A;  4IHV A;  1X4O A;  3IRQ A;  4KUM A;  1NG6 A;  3JRA A;  4A3G J;  5LRR A;  1FYL A;  2ZSH B;  1YW7 A;  4RAY A;  2F5D A;  1X1A A;  2FNA A;  1BL0 A;  2H1K A;  2ZSI B;  2V9P A;  4EJT A;  4Q47 A;  2CQK A;  1PYV A;  2UXN A;  1Z9C A;  3VSL A;  1YHQ I;  1IRZ A;  1MZB A;  1WHU A;  3M1C A;  2P0W A;  4G6Q A;  5L3E A;  2HZD A;  5J8F A;  4KMF A;  4EMS A;  2JPB A;  1WSU A;  2CUZ A;  3F6V A;  1HBX G;  3JR9 A;  2P6S A;  3I54 A;  3HRS A;  1GHC A;  3G6E I;  3D1N I;  1YS6 A;  3ASN H;  2WV1 A;  3IRR A;  1QA6 A;  5EG0 A;  3MVP A;  1U9O A;  3LSJ A;  4ENK A;  2FML A;  4B3A A;  1YX3 A;  4BAY A;  2DN0 A;  3FK7 A;  1ZLK A;  2L2O A;  3BLY A;  2HTJ A;  4U88 A;  5FD6 A;  3O6B B;  3SZP A;  2B0L A;  1LNW A;  3CC7 I;  4IO9 F;  5DD4 A;  3T1B A;  2LF8 A;  1DDN A;  4HA8 A;  1MSE C;  4O3M A;  5F1J A;  1R49 A;  2WAQ A;  3KLN A;  1WI9 A;  3M7G A;  4UUS A;  4CO8 A;  3UNG C;  1FTT A;  4LG3 A;  1IW7 F;  5EEG A;  2KQR A;  2JUG A;  3J80 K;  2K9N A;  4WXD A;  3GXO A;  1X4P A;  3HXL A;  4A3I J;  2FBH A;  2HFH A;  4I6Z A;  4E70 A;  1EKE A;  3J81 K;  2VKD A;  2ZXW H;  2PBI A;  4GXO A;  3ZQI A;  1A6Q A;  3FBN B;  3LSP A;  5CVR A;  1KU3 A;  2W48 A;  2EB7 A;  4YFN F;  3IH4 A;  2IEK A;  1TWH J;  3QP6 A;  1GV5 A;  4K2E A;  4LLN A;  3I71 A;  4XLH A;  4BHP A;  2EIM H;  2ZFU A;  3A03 A;  1Z0X A;  3EUK L;  4UVB A;  3ABK H;  1JKP C;  2JTV A;  3DWL E;  2AQE A;  3ZOB A;  3I58 A;  4HX4 A;  2LBF B;  3DTE A;  2KJB A;  1FYM A;  2Y0S A;  4FTH A;  3WTY C;  3ABM H;  5C44 J;  1UCR A;  2DDB A;  2W57 A;  4OIQ F;  3ABU A;  1YYV A;  3KEY A;  4ASN A;  3WTV C;  2E7X A;  3EUH C;  3LSM A;  5ICC A;  1F9N A;  4M3F A;  4LD5 A;  2VPL A;  3F6O A;  2BYV E;  1MJA A;  3T8R A;  3JAM Z;  3GME A;  2IS4 A;  3V4G A;  1Z7U A;  1IN7 A;  2HQN A;  3TDU C;  2L7K A;  3BTI A;  3FMR A;  3LSI A;  3DEE A;  2ECC A;  3K4B A;  5F64 A;  3W6K B;  4GDF A;  2DFE A;  5J6X A;  4AYB A;  4RB3 C;  2CRG A;  1BR4 A;  2KRC A;  2W84 A;  4HPQ A;  4A3J J;  3OSG A;  4OAZ A;  1K79 A;  5IOY A;  1X2N A;  5DCM B;  3OYB A;  2HQR A;  3J7Y J;  1R4N B;  2M87 A;  1V4R A;  3CCR I;  1HDD C;  3O8G A;  2JQ7 A;  1SVL A;  1U78 A;  3F8B A;  3OR1 C;  2DAO A;  4ZTJ A;  5BS6 A;  3HPH A;  3AAF A;  2KDZ A;  3GEZ A;  4B3X A;  5B66 C;  1D3Y A;  1LEA A;  5D5W B;  1IV6 A;  2F6C A;  2QYO A;  3M8F A;  4UB6 C;  4A0Y A;  5GTI C;  1QHH D;  2QWW A;  4FAS D;  3CF5 F;  2DA4 A;  3BZ6 A;  3DPT A;  2R7Z J;  4XOT A;  3LAJ A;  5HDG A;  4XN3 A;  1DU6 A;  2KFD A;  5K7Z A;  1MH4 A;  3CD6 I;  1LKX A;  5CJ9 A;  2PEX A;  2CW8 A;  2DA5 A;  5DCM A;  1Z67 A;  3BPV A;  1BIA A;  3F22 A;  1LDJ A;  2L54 A;  2NS0 A;  4BKX A;  3BDD A;  3W2V A;  2L0K A;  2XF6 A;  4Z6Y A;  1R4M B;  2STW A;  4XKV A;  4HLY A;  4RBO A;  1UHS A;  4UNO A;  1LDD A;  1XGS A;  2IVM A;  1ZHF A;  3ECO A;  4EGY A;  1R23 A;  2VT2 A;  5D6F A;  2RRE A;  3EET A;  2R5Z B;  1FX7 A;  4XLF A;  1H8A C;  1EJ9 A;  1SVO A;  2IW5 A;  2K3F A;  1H9T A;  3AG1 H;  5GTH C;  5J1U A;  1VQL I;  5DUI A;  3QU3 A;  2H8R A;  3F23 A;  1ZEL A;  2XRN A;  4XOP A;  5K5R A;  3QYE A;  1S29 A;  1YJ9 I;  4KNY A;  4D7M A;  2AQF A;  1KYZ A;  2EZH A;  2ZJP F;  2VJJ A;  4A0X A;  1VQ9 I;  1WZ2 A;  4D5F A;  3F21 A;  4HNT A;  3ZQL A;  1BW5 A;  3FKI J;  1ORK A;  3SJM A;  2HDD A;  1LFB A;  1DGW Y;  1YRN A;  1VQ8 I;  5LEJ A;  3I64 A;  3OMY A;  2R5Z A;  1ON2 A;  2KRF A;  1LVA A;  2P4W A;  2BW3 A;  2OQR A;  3FZV A;  4D9J A;  4OIO F;  2PN6 A;  3GLX A;  4BJ6 C;  3ZPL A;  1IJW C;  2WBM A;  3S17 J;  2BVM A;  4KIC A;  2JT1 A;  3FX3 A;  3CQZ J;  2XKP A;  3QYF A;  5BMZ A;  2ZNY A;  3GTM J;  2OF7 A;  4IL6 C;  3R6S A;  2Z99 A;  3EPZ A;  2LY9 A;  3S32 A;  4EVI A;  1TP4 A;  2V1D A;  5FKK A;  5IOZ A;  2M2E A;  1GDT A;  1HOM A;  5H6Q A;  3EUH A;  1JKQ C;  1D5Y A;  2R7U A;  5J8C A;  5GPC A;  3LST A;  1VF9 A;  3K0L A;  3E0J B;  2EK5 A;  1AOY A;  3HPG A;  3E5U A;  1I1G A;  1BM9 A;  3F9K A;  1ZK8 A;  4WXH A;  3VEP A;  4Y17 A;  3D5R C;  4AD9 A;  1VQ4 I;  2X6Y A;  3HZJ A;  1QZY A;  2ACJ A;  3A2K A;  1N78 A;  2DT6 A;  2QUF A;  4ITV A;  4PSW A;  1WJ5 A;  3F0C A;  1HCR A;  2E1M B;  3BRO A;  1OCT C;  3ERE D;  2DLL A;  5LBQ A;  1JE8 A;  2OQG A;  2VJI A;  2KP6 A;  3WU0 A;  3HL2 A;  3DPU A;  1R36 A;  4C3H J;  1EV7 A;  4KIG A;  4FE7 A;  4ENN A;  4ZYA A;  5LFA A;  2JUC A;  3PSI A;  4YIR X;  2L4M A;  3REO A;  3NRV A;  2Q0O A;  2TDX A;  4E7S A;  1TWG J;  1AA7 A;  1I3Q J;  1WQ2 A;  2JA7 J;  1HXD A;  2KRH A;  3I59 B;  1ZR2 A;  3ZCO A;  2BY2 A;  4KIS A;  2XAU A;  1SAU A;  3V7R A;  1I50 J;  4NQW A;  3CZ6 A;  1FP2 A;  3K4N A;  1ETX A;  2VJ5 A;  3DKX A;  2PLY A;  1A6I A;  1ETW A;  2GA1 A;  5JFR A;  2LLK A;  3PUB A;  4AID A;  5F0H A;  5FLM J;  2GXA A;  2VI6 A;  3KEO A;  3KZI C;  2DMN A;  4IQ4 A;  2MGQ A;  2Z16 A;  4LK0 F;  2QEX I;  2F2E A;  2YSR A;  2W82 A;  5J3L A;  5EF6 A;  1TW2 A;  2ECB A;  4IX7 A;  1IXS B;  5FB2 A;  2WAQ N;  1U8R A;  3NWT A;  3OYM A;  1IN6 A;  3HHH A;  1BJA A;  3K4C A;  2HVR A;  2DMP A;  4IF4 A;  2ZME C;  2JVH A;  2O8X A;  2FBK A;  2LMD A;  2ZNZ A;  1FPQ A;  1IF1 A;  2XAS A;  2QGU A;  3OYF A;  1XC5 A;  3TW7 A;  2Y30 A;  2D2W A;  2STT A;  4B8X A;  2PFB A;  3KZZ A;  3V42 A;  4NC7 A;  5FFX A;  1I1S A;  1EH7 A;  1RKW A;  3BZK A;  2GA2 A;  4MFD A;  4BQA A;  1RNL A;  1YG2 A;  2CH0 A;  3GTJ J;  2ZXJ A;  3ZMZ A;  3GTG J;  3BCB A;  1J9I A;  3CCY A;  2KIS A;  1Z7L A;  2QSF X;  3I55 I;  4KT6 A;  2HOE A;  4D0P A;  1GV2 A;  3MZH A;  2EIN H;  2RKH A;  1MGT A;  2I10 A;  1I6H J;  4C3J J;  1T33 A;  1G59 A;  5C4J J;  4GFB A;  3TOA A;  4MIM A;  3KIO A;  3OIO A;  1P4A A;  1YW8 A;  1XMX A;  5JHU A;  3OS0 A;  1ETV A;  3GTK J;  1P4W A;  1G4D A;  4OMY A;  5GPA A;  4I09 A;  4BU2 A;  3FXQ A;  4KN7 X;  1YE9 A;  4ENM A;  2CV1 A;  1USS A;  2PI0 A;  1Y39 A;  2NYX A;  1H0M A;  2JRT A;  4GO1 A;  3P9I A;  2OCC H;  1FSH A;  3DP7 A;  1K83 J;  1ZN2 A;  4AYB N;  3TO7 A;  2VC0 A;  1U2W A;  2QA4 I;  2VT3 A;  2EV6 A;  2BGC A;  2HKX A;  4CCN A;  5IY5 H;  4AIK A;  2VBZ A;  1XSV A;  1GUU A;  1Y0N A;  2BHZ A;  5E1W A;  3RSN A;  1IUF A;  1KU9 A;  2X1D A;  5J4Y A;  2E1N A;  4IHS A;  2H94 A;  1JUM A;  2DFF A;  4A3M J;  2ADU A;  3IAM 2;  2QM3 A;  3KP7 A;  1B4A A;  2ZXI A;  3HJE A;  2F4O B;  2XDV A;  3HGY A;  1FOW A;  3QOE A;  2A69 F;  2IGN A;  1HSJ A;  5CVJ A;  2ZXH A;  2BHY A;  2KLO A;  3NAU A;  3IAS 2;  2CWE A;  4BL0 B;  2HOT A;  3IP4 B;  2DK8 A;  1RR7 A;  1W4M A;  4HNV A;  1QPM A;  5ERI A;  2P7V B;  1Q1H A;  4UUV A;  4L5E A;  4FET A;  1V3F A;  4BXF A;  2MC4 A;  3I9V 2;  3LSH A;  4IEJ A;  1SFX A;  3CDL A;  1MBE A;  3IKT A;  4RB2 C;  1OPC A;  3GFJ A;  3W2W A;  2OPT A;  3DFG A;  2PMH A;  4I2O A;  5CQE A;  1T56 A;  3LL7 A;  2VXZ A;  4MGR A;  3MCZ A;  4RGS A;  1JXS A;  4KJZ A;  4HRI A;  1UMQ A;  1SD7 A;  2GQQ A;  3W6V A;  2R5Y B;  2W4S A;  2XPU A;  3I4P A;  3Q0V A;  2Z9O A;  3E97 A;  2AO9 A;  4I99 C;  4S0H B;  3JW4 A;  4BHB A;  1IUY A;  5HS8 A;  4AWX B;  2XC7 A;  1JUS A;  3MMY B;  2Y9Z A;  4BY7 J;  3GWZ A;  1JHH A;  4UV8 A;  4HEA 2;  3ZMV A;  1RI7 A;  1EH6 A;  4BY1 J;  1ETO A;  2Q1Z B;  3QWL A;  2NOG A;  2WB1 A;  4RAZ A;  1UST A;  2RVC A;  4DJA A;  3TL4 X;  4P55 A;  2IXS A;  2ZME A;  4EEF G;  4CDG A;  4X0G A;  3PL8 A;  4JX5 A;  2EPF A;  5ILV A;  3F8C A;  4BEH A;  3I56 I;  1WJE A;  2LH9 A;  3UR3 C;  3J7A O;  2PJP A;  1ETK A;  3HSR A;  2EH3 A;  3FXR A;  3KLO A;  3WE2 A;  4UXN A;  2LNB A;  4M3E A;  2DJN A;  2O3F A;  1XB4 A;  4FX0 A;  1YW9 A;  1O3S A;  4YEL A;  4L18 B;  2ELJ A;  1SFO J;  4BQO A;  1BOB A;  2RN7 A;  1E3O C;  2B63 J;  1MBF A;  3G71 I;  4LG0 B;  2D5V A;  1V5G A;  2DA7 A;  4M9Z A;  2CQN A;  3E6C C;  4HDU A;  4IOC F;  2L9N A;  3HHG A;  4J00 A;  5JHF A;  2ICW G;  1DGR M;  5D5U B;  2EFO A;  3ZQG A;  4N4N B;  3QQA A;  2K9S A;  4L9T A;  4XR6 A;  2BE5 F;  2ID6 A;  2F5V A;  1R7J A;  1TT0 A;  4BJ5 C;  5GAD J;  2IT0 A;  2CQX A;  2V1X A;  3S2W A;  2CV0 A;  2K86 A;  5CVU A;  3FBI B;  1ZTR A;  2ME6 A;  2R7V A;  3OYA A;  4HDV A;  2HU9 A;  3BTC A;  2MC3 A;  2HTS A;  4CYC B;  1OLT A;  5M3F J;  1IXC A;  4U87 A;  2RDP A;  2QEN A;  1BOA A;  4HLX A;  2K9L A;  3JRC A;  2MW8 A;  1V55 H;  1P4X A;  2BOL A;  4FQG A;  1SAX A;  2D1H A;  4BQN A;  1OYW A;  4Y52 J;  1QZE A;  2DTZ A;  1T98 A;  2CQQ A;  3WTT C;  4PK4 A;  3K9T A;  2RAE A;  1JUP A;  3KP2 A;  3RZO J;  1G2H A;  4CZC A;  3ESW B;  3G3Z A;  1VQ5 I;  1YQA A;  3ABL H;  4BGD A;  3N4M A;  2MLK A;  4A0Z A;  2VBY A;  3ELK A;  4M3D A;  5JLX A;  3VB2 A;  2PX9 A;  4BDZ A;  2R7W A;  3I4M J;  3JRG A;  2DQL A;  3S1M J;  5FO5 A;  1OCZ H;  2O5R A;  3K70 D;  3RPQ A;  3ISP A;  2CSO A;  3G4S I;  4BHC A;  3FHN A;  2FBI A;  2WY7 Q;  3QOP A;  1MND A;  2MG4 A;  2FOW A;  5H6R A;  5L3D A;  3ZRG A;  4B44 A;  5H2F C;  4IHY A;  1RPW A;  3HYI A;  3BJO A;  1B72 A;  3OS1 A;  4YII A;  2ID3 A;  2K27 A;  4OU0 A;  3ZGK A;  1K61 A;  3AL0 B;  2JZY A;  1CF7 B;  3GTL J;  3V8K A;  3A01 A;  1XCB A;  2BY3 A;  1NH3 A;  4MQ9 F;  3Q0U A;  4YFK F;  2CFX A;  2M45 A;  4F3Q A;  2CQ7 A;  3TOB A;  1Z05 A;  4PZJ A;  4HF0 A;  2DOD A;  5JR3 A;  3B02 A;  3BOQ A;  2M4G A;  2RV8 A;  4Q4Z F;  1VQN I;  3M1E A;  2GAU A;  3TO9 A;  4MQV A;  1BN5 A;  2R7R A;  2P5V A;  3NAR A;  2IP2 A;  3MKZ A;  2M0C A;  2W1O A;  3GYH X;  3RPU D;  3CP2 A;  5J47 A;  4XRM A;  4PJJ A;  1MH3 A;  4JBA A;  2DBB A;  1EH8 A;  3V8L A;  4AVZ A;  1R6R A;  4XSX F;  3Q5F A;  2WY8 Q;  1J0R A;  3OYH A;  4LK1 F;  4AU7 A;  4R1H A;  4R8H A;  2VQH A;  1ERD A;  5IP7 J;  3H36 A;  1PUE E;  3S15 J;  1D1A A;  3FK6 A;  1VQM I;  1G3Y A;  5DD8 A;  4J19 A;  3AKZ A;  2OUM A;  3CMA I;  1Z3Y A;  3HM5 A;  1FBQ A;  1YIT I;  2CS3 A;  2BY1 A;  4EM0 B;  2DJI A;  2Z2S B;  1HF0 A;  1DU0 A;  3L2R A;  2P81 A;  3ZN1 A;  3DEW A;  4LB6 B;  2HZT A;  5HLT A;  3BG9 A;  3ZR8 X;  5IPA A;  3HKZ N;  5AIQ A;  1AU7 A;  1UG0 A;  2XUB A;  2YX4 A;  3ECH A;  1CGP A;  3CLQ A;  3E7L A;  4NHJ A;  2YPR A;  2UUZ A;  2ZCW A;  2VOO A;  2P5L C;  4WXC A;  2XGD A;  1S3J A;  4A3B J;  2Z5U A;  1B6A A;  1D1C A;  2K40 A;  3CO6 C;  2IGM A;  3CC2 I;  4YRV A;  1ZRE A;  3DXJ F;  4CZZ A;  2HS5 A;  3HOW J;  5ED4 A;  4EQQ A;  1F43 A;  5DV5 A;  2JPC A;  5A2Q K;  2CW0 F;  2VUM J;  3VYT B;  1FT9 A;  3F8N A;  3HTU A;  5B1A H;  1UG2 A;  1FEX A;  1BW6 A;  2LYC A;  2HPM A;  3BR2 A;  4E6K G;  2FD5 A;  3H9Q A;  1YI2 I;  4XMY A;  5D6E A;  1FIP A;  1N25 A;  5JI6 A;  2FE3 A;  3T0Y A;  1ZQ3 P;  2UZK A;  3NWS A;  5E20 A;  3OY9 A;  4UB8 C;  4KIF A;  1EF4 A;  1B1B A;  1SFK A;  3H35 A;  4OOI A;  4LMY A;  4M6X A;  4I01 A;  1IDY A;  2NAZ A;  3C2H A;  3VYS B;  3HDD A;  4A6E A;  3QRF F;  3BT9 A;  5E8G A;  4W1U A;  5KAF C;  3RQI A;  2QLZ A;  1FBU A;  2VBW A;  4XK4 A;  1RUN A;  1RZ4 A;  3PUF A;  1ZAR A;  1BR2 A;  2EFP A;  4P1W A;  3GTO J;  4X6A J;  1O7L A;  2M34 A;  3LSK A;  1D0Y A;  4CCK A;  2EV5 A;  4HG2 A;  2JA8 J;  3GZ6 A;  2A5W A;  2L9R A;  1KQ8 A;  4EAT A;  2OA4 A;  2DT7 B;  4XRS G;  3QYB A;  1QVU A;  3C3W A;  4OMZ A;  3LNQ A;  3CC4 I;  1JJ8 C;  3HOY J;  2GZW A;  2DMU A;  2XAJ A;  1BIB A;  1S5L C;  2XB0 X;  5FKO A;  2LDU A;  2K4J A;  1IG7 A;  2Z1D A;  1TNS A;  4RDU A;  2O9L A;  4DBQ A;  2OD5 A;  3RCO A;  2EA2 A;  2Q8K A;  1IRF A;  3CCE I;  2L3D A;  2MD0 A;  2V1N A;  4EGZ A;  1T8I A;  3MKY B;  3WE3 A;  1T39 A;  2BV6 A;  4BYY A;  4A5N A;  3WTU C;  3G1L A;  5GAH J;  2L5Q A;  3R4K A;  4V2F A;  5CPR B;  3FDY A;  3W3C A;  2KL4 A;  1MBJ A;  1LEB A;  4DZJ A;  3VOE A;  1QHG A;  3C18 A;  1UZC A;  2FNP A;  2O7O A;  1RRJ A;  4IOA F;  2WB1 N;  3B73 A;  3QPT A;  1S8N A;  3WU2 C;  2LFB A;  3WTW C;  1IN8 A;  1R58 A;  4H4K C;  4L9N A;  4HZF A;  3LAP A;  4HOB A;  2EBI A;  1BI2 A;  1LJ9 A;  3CJN A;  4BJT A;  1YLF A;  2BVL A;  3RKW A;  2WWY A;  2LBF A;  3DTK A;  5EZG A;  3OV8 A;  2FU4 A;  3MFK A;  2DA1 A;  2GLO A;  4LIU A;  3VYU B;  2V6C A;  3AFH A;  3ZMU A;  1QZZ A;  1XMK A;  2VLA A;  3H9J A;  4HV5 A;  1W0U A;  3ROU A;  1W36 C;  2HYF A;  2RNJ A;  1XG1 A;  2LD5 A;  1PDN C;  2WAD A;  3LOC A;  3T5X A;  5IP9 J;  3CCM I;  4B47 A;  1OR7 C;  4BE0 A;  3R0A A;  5DM6 F;  2OZ6 A;  4NB5 A;  3BZC A;  2M7A A;  3TKY A;  5IYB J;  4L9V A;  1KYW A;  3C1D A;  1QVT A;  3KP3 A;  1W7P D;  4NC8 A;  2IPQ X;  4GRI A;  1X2M A;  2C6Y A;  1R22 A;  2FRH A;  2QCO A;  1KZH A;  4NBQ A;  3KFW X;  2E1M C;  2JA5 J;  4BAC A;  3DTI A;  1R1U A;  5F04 A;  1JKO C;  3W6J B;  4LLG F;  1IXR C;  2R4G A;  3L7W A;  4QIW N;  2A05 A;  4A3E J;  2YR2 A;  1ZRC A;  6PAX A;  3H3U A;  5HS9 A;  3DKW A;  1G3S A;  1Y1V J;  2ETH A;  2VOP A;  2EA4 A;  2NOJ B;  4GYI A;  1P92 A;  3RTR A;  3HOT A;  2E5N A;  3ZMS A;  4RGU A;  2VBX A;  1D8J A;  1IZ1 A;  3HOS A;  4A12 A;  2N8G A;  1VQK I;  4PSX A;  2LG4 A;  2EQR A;  4G8X A;  3HOV J;  3H1C A;  4LIT A;  4S04 A;  2FJ1 A;  4JOM A;  5M5W J;  2LF7 A;  1H88 C;  3BR6 A;  4CCM A;  4A3C J;  1ZRF A;  1OCC H;  2HVQ A;  1IV8 A;  2EIK H;  4E4H A;  2XSD C;  4JX4 A;  3K2Z A;  4RGX A;  3PJR A;  1KQ0 A;  2DQR A;  2VJ4 A;  3QPH A;  1B8I B;  3VSK A;  1WJC A;  4F92 B;  2FQ3 A;  2V9V A;  3NEU A;  3ZP5 A;  3CDH A;  2DTR A;  1JHF A;  2LVS A;  4Q5S F;  3FF5 A;  4DYC A;  1VQ6 I;  3E3V A;  2VIX A;  3M9A A;  5E3O A;  4XRS A;  1REP C;  2M8G X;  1ZGJ A;  1Z77 A;  1MSF C;  5DS9 A;  1ZG3 A;  5F6F A;  3FXJ A;  5EZH A;  1WVR A;  4MNU A;  2ZKZ A;  4M3B A;  3GTQ J;  1XX5 A;  3ML6 A;  3K1N A;  4RMN A;  4XBF A;  2ZJQ F;  3BCA A;  5FLV A;  3GLL A;  5E3L A;  5HLG A;  4OWR B;  2H6B A;  2DDA A;  4ANJ A;  1MNE A;  3DPL C;  4A5M A;  3AG2 H;  2BEO A;  5TGT A;  3HTS B;  3HSF A;  3QPL A;  1G3T A;  3L09 A;  2ZFW A;  5E1Z B;  2IS6 A;  2ISY A;  5IYC J;  1ITY A;  1TLH B;  1Z21 A;  5F08 A;  2DOA A;  1MD0 A;  3M07 A;  4HYE A;  2VN2 A;  2GBY A;  4OIP F;  2E1O A;  1XCV A;  3H0D A;  1WI3 A;  2CW7 A;  1LVK A;  1MDM B;  1JKR C;  5CYV A;  2IA0 A;  1APL C;  1Z1D A;  2GXG A;  3OYD A;  1OJL A;  3SEQ A;  2MYS A;  3RIR A;  4C2T A;  3M4O J;  4HQE A;  3BQY A;  1Y1W J;  3ASO H;  3GUD A;  2W7N A;  4JX6 A;  1FNN A;  2IS2 A;  4E7H A;  4M6V A;  3DU6 A;  1R1V A;  3RKQ A;  1ZG5 A;  1KON A;  1XDS A;  4A69 C;  1YO5 C;  2XHK A;  3KX2 A;  1GLN A;  2EWN A;  1GVD A;  1OR7 A;  1FMW A;  1FIA A;  4A3D J;  3JRE A;  2A6H F;  3KP5 A;  3PQJ A;  1J09 A;  5IT9 K;  4D7N A;  4IRG A;  4XM3 A;  1R00 A;  2MFZ A;  4XON A;  1XDU A;  3HGG A;  3I4N J;  2XRL A;  1U3E M;  2X51 A;  2DOE A;  2ZBK A;  2ZO4 A;  4CXF A;  3MEX A;  4M6Y A;  3C2G A;  4XLC A;  2EFN A;  1X1C A;  2RQP A;  3V8J A;  4UVA A;  1S9H A;  2E35 A;  3U9G A;  1A04 A;  4EJW A;  1R5H A;  3HG9 A;  3QAH A;  1PUF B;  4G94 A;  2XVC A;  4RM2 A;  3IKV A;  1F36 A;  1K4S A;  2VXD A;  4ZH4 F;  3CCU I;  2IS1 A;  1FOK A;  4I0A A;  3TQN A;  3E5Q A;  4DYQ A;  5E17 F;  4YEJ A;  1JGG A;  2DYR H;  2OV7 A;  1R5G A;  1MNM C;  2TRT A;  2K02 A;  4ZC3 A;  3JTH A;  3O2P E;  3OIQ A;  3I59 A;  3T8T A;  2F4I A;  4V19 K;  3PM1 A;  4IJA A;  1TWC J;  3K4J A;  3WTS C;  1RUO A;  2QSH X;  4DZP A;  1RKT A;  2VON A;  2WAF A;  4ZYH A;  2JK3 A;  4H0E A;  1HKQ A;  1XS9 A;  3J80 Z;  1FY7 A;  4NNJ A;  3JRD A;  4AM3 A;  2DA6 A;  1ULY A;  1K6Y A;  1JJ6 C;  4RB0 A;  2HQ5 A;  1HKS A;  3ULQ B;  1P9Q C;  3J81 Z;  4ETS A;  1WCM J;  1LUJ B;  3KYD B;  4ZDP A;  4WWC A;  2GOX B;  1VTN C;  3HKZ A;  4JQF A;  3Q0W A;  4BE1 A;  2GIV A;  3LFK A;  4M72 A;  3TP0 A;  1VQP I;  2PQ8 A;  4IZZ A;  3OYL A;  3JRI A;  5FLX Z;  3FXO A;  2CYY A;  3CUQ B;  1WH5 A;  1JTY A;  2QF7 A;  4ON0 A;  5TIS C;  2V1U A;  3F72 A;  2X1C A;  1DP7 P;  2VPR A;  1POG A;  2R93 J;  1S7E A;  1G3W A;  4ZYD A;  2CFO A;  1AKH B;  1RIO H;  5CVV A;  3WHB A;  2VKE A;  4HBL A;  3LA2 A;  2G7H A;  1S7A A;  1ZYR F;  4E7I A;  1Y6I A;  3PNV A;  4G6D A;  2XGC A;  3KYC B;  3FMS A;  2XIG A;  3DCF A;  3RYP A;  1K78 B;  1U5T B;  3CES A;  2DCE A;  1S6L A;  4HST A;  5TRD A;  1OQY A;  3U2R A;  1LE8 B;  2A5Y B;  4BBR J;  1Q1V A;  3FWE A;  3IH2 A;  4QLC U;  2EJR A;  4YG2 F;  2XF5 A;  1VFC A;  2DA3 A;  5DCF A;  1M1E B;  3COA C;  2VE8 A;  4G7H F;  3BC8 A;  3MZY A;  3R60 A;  3R0J A;  4O6J A;  1DPR A;  1IRG A;  4DGW B;  5LEK A;  1WGX A;  3S2H J;  5KCM A;  2XB5 A;  3BR0 A;  4XKB A;  5LHI A;  1ZAO A;  3CJR B;  3A4C A;  5AON A;  1K78 A;  5GAG J;  2M0M A;  5H20 A;  4KIT B;  3BG6 A;  5EYR A;  3BTJ A;  3AG4 H;  4I7H A;  5E3M A;  3OOU A;  1ENH A;  2X6W A;  3TBI A;  2IGK A;  2VC1 A;  3S1N J;  1IRX A;  1GT0 C;  2R7O A;  5LGU A;  5K1Y A;  2P6T A;  4P9F A;  4B1R A;  1TL8 A;  2NS8 A;  2CJJ A;  1QU3 A;  1HW2 A;  2Z33 A;  2NNN A;  2R7T A;  1X1D A;  1BI3 A;  1TQM A;  3BJ6 A;  4IRH A;  5ILU A;  3WHC A;  3AL0 C;  3SYT A;  2H27 A;  3MWM A;  5LRS A;  3Q9S A;  1MW7 A;  2KPM A;  5LHH A;  1SC7 A;  2E34 A;  3HUG B;  2A6T A;  2DA2 A;  4E7Z A;  3LQQ A;  3OYE A;  1IC8 A;  1HC8 A;  1FLI A;  1N75 A;  1HKT A;  3SZT A;  3EYY A;  4IKF A;  2JRM A;  5GAE J;  1FC3 A;  2GOM A;  1PVE A;  2KZG A;  3CTA A;  3JAM K;  2R5Y A;  5KAI C;  5EDN A;  4UY8 I;  2F4M B;  4BH9 A;  2QQA A;  2HPI A;  1T95 A;  1YFH A;  2E5Z A;  3VPR A;  3A0H C;  4KT5 C;  3KP4 A;  2FSW A;  3L2C A;  2Y9Y A;  2IJL A;  3HRT A;  1O7F A;  3I0T A;  1TZL A;  4MHG A;  3E1S A;  3IV5 A;  2LRD A;  3W2A A;  4DNC A;  1QQI A;  3PFY A;  4LLL A;  4P96 A;  3P9C A;  1SFE A;  3ZQ7 A;  3NQO A;  3DLL F;  1RET A;  3DKY A;  3P7N A;  4NDL A;  5E3N A;  1FBS A;  2RNG A;  2QQB A;  3BQZ A;  4F52 A;  3Q9V A;  2L9S A;  4AIJ A;  3DLA A;  3TO6 A;  4U7D A;  5FGM A;  1MMD A;  3M8J A;  4L0Z B;  2ISZ A;  1I5Z A;  4LG0 A;  1T0F C;  5B1B H;  3HIF A;  4NC6 A;  4IVN A;  1XPX A;  3IWF A;  3ZQF A;  2E2J J;  2DMQ A;  4FIS A;  3G2B A;  4RLQ A;  2A68 F;  2FA5 A;  1T08 B;  3DU5 A;  3GZN B;  1K6O A;  4XKC A;  2DMT A;  2G7U A;  3JSO A;  3FXM A;  2DOF A;  1WKM A;  2M5W A;  2OAZ A;  3V7C A;  4PJN A;  4B4C A;  1LFU P;  1JT6 A;  4BXU A;  3H5A A;  4HF1 A;  2PMZ N;  5EEA A;  4IHW A;  4CYC A;  4LFU A;  1MMN A;  1KQ9 A;  1V54 H;  2X0L A;  3CUO A;  2L7M P;  3VWB A;  3HRU A;  4F55 A;  1MJ9 A;  2XGX A;  3IUO A;  1I27 A;  3G73 A;  4CH7 A;  1ZKG A;  2GWR A;  5KK1 A;  2KZV A;  2BXY A;  2X9D A;  2LR8 A;  4YIF A;  4P5O A;  1OMI A;  4WK8 F;  1NK2 P;  1GXQ A;  1U0J A;  4ZJZ A;  2FQ4 A;  4G12 A;  1R1T A;  1J59 A;  3IWZ A;  4XKW A;  3CDI A;  2K9M A;  4MFE A;  5F27 A;  2HQA A;  3PNT A;  5HOO A;  1HW5 A;  5FRM A;  1O4X A;  4F93 B;  1DP3 A;  1YOV B;  1LQ1 A;  2Q2E B;  1ON1 A;  2UWM A;  3S3M A;  2JSP A;  3FKJ A;  2LK2 A;  4PCQ A;  3IHU A;  4P9U A;  1W0T A;  1PP7 U;  4BQQ A;  1IO2 A;  1NTC A;  1YS7 A;  1CF7 A;  4UUT A;  3EDP A;  4I02 A;  4HAM A;  1JT0 A;  3MAJ A;  4PFO A;  2WAE A;  2V79 A;  1HW1 A;  1U8B A;  2AS5 F;  2RC4 A;  4HF2 A;  2X1E A;  2Y75 A;  1UAA A;  1MBH A;  3HBL A;  2NVX J;  3D5S C;  3CJQ B;  3GBG A;  3RI4 A;  2WTE A;  4Y15 A;  3OSF A;  5L3G A;  4MTE A;  1SAN A;  2L9V A;  3WGH A;  1V5E A;  1OCO H;  4LB5 A;  1V5F A;  2QBY B;  3RKY A;  4AIH A;  4FX4 A;  3K7A J;  2XAH A;  3WG9 A;  2DFH A;  3ZMD A;  3L1P A;  5GP9 A;  5DTD A;  1PJR A;  4OIR F;  1W5T A;  3PO3 J;  1WJB A;  3MD2 A;  1J5Y A;  4RAG A;  4IHT A;  1P7J A;  5FRN A;  2JWT A;  5F0C A;  2WV0 A;  1T2K A;  2P7C B;  3PIO F;  3BR3 A;  2VL8 A;  2D1V A;  2V6E A;  2R92 J;  5E1X A;  1IDZ A;  3DV8 A;  2FUG 2;  1JGS A;  2HOS A;  5DM7 F;  2QBY A;  2F5E A;  4QSH A;  2K9Q A;  2M30 A;  3WTZ A;  2VQL A;  4E7L A;  1IAW A;  2B7E A;  2QQ9 A;  5EG0 B;  3WTX C;  2VAS A;  2W25 A;  5D8L B;  1ZLJ A;  3H5R A;  3VYR B;  4U7B A;  2WC2 A;  2FF4 A;  2H1L A; 
#chains in the Genus database with same CATH homology
 2N8G A;  2EQR A;  3HB9 A;  3HOV J;  1XC5 A;  3TW7 A;  2Y30 A;  5M5W J;  2FJ1 A;  1H88 C;  3BR6 A;  2ELK A;  4A3C J;  1RKW A;  4MFD A;  1TC3 C;  4AC0 A;  2XSD C;  4JX4 A;  3ZQH A;  3GTJ J;  4UUS B;  4D5C A;  5IYD J;  1B8I B;  2HOA A;  3GTG J;  1X58 A;  2JJ7 A;  3CCY A;  5HOD A;  4XIC A;  1GV2 A;  2LVS A;  4DYC A;  1MBG A;  3G1M A;  2AHQ A;  2COB A;  2EZK A;  5E3O A;  4XRS A;  2I10 A;  2M8G X;  1I6H J;  3BR5 A;  4C3J J;  1T33 A;  5C4J J;  5M5X J;  4GFB A;  1ZR4 A;  4MIM A;  1Z77 A;  2LP0 A;  2JMW A;  2MSY A;  3OIO A;  1MSF C;  5DS9 A;  3S2D J;  5EZH A;  2L7Z A;  3GTK J;  1ETV A;  2JN6 A;  3BG5 A;  1VND A;  4M3B A;  5GPA A;  2NVQ J;  3GTQ J;  3S16 J;  3MN2 A;  1B72 B;  5FLV A;  5E3L A;  3HOZ J;  1AHD P;  5FKL A;  4BXX J;  5F0F A;  4C3I J;  3A01 B;  3QPL A;  1K83 J;  4AYB N;  2EZI A;  5IYC J;  3TP3 A;  1ITY A;  5F08 A;  1GUU A;  1U9N A;  1IUF A;  4LOC A;  1JUM A;  4A3M J;  2GBY A;  4A3K J;  2E1O A;  1JTX A;  3HGY A;  1WI3 A;  1JKR C;  2Y31 A;  3TW6 A;  2TCT A;  1APL C;  4JP0 A;  2E2I J;  3O8H A;  3NAU A;  1OJL A;  4MLO A;  2HOT A;  3M4O J;  2Y2Z A;  3BQY A;  5EGO B;  1Y1W J;  1RR7 A;  5J1R A;  4JX6 A;  4HNV A;  1WPK A;  4M6V A;  2IBD A;  4MO7 A;  4L5E A;  3RKQ A;  2HXO A;  4A69 C;  2VKV A;  1BJZ A;  5C3E J;  4ABZ A;  3GTP J;  1GVD A;  4IEJ A;  3CDL A;  1MBE A;  1FIA A;  4A3D J;  3JRE A;  5JLW A;  2O8K A;  3QPS A;  2OPT A;  2HI3 A;  4D7N A;  3LSG A;  5FKN A;  2GM4 A;  1T56 A;  3CMY A;  3UKG A;  1FTZ A;  2R0Q C;  5FJ8 J;  2NS7 A;  3HGG A;  1RES A;  1P7I A;  1UMQ A;  2XRL A;  3W6V A;  3I4N J;  2R5Y B;  2XPU A;  3Q0V A;  3G1O A;  2AO9 A;  2CUF A;  5EGO A;  2XGE A;  4S0H B;  1JUS A;  2Y9Z A;  4BY7 J;  4JYK A;  1PUF B;  4BY1 J;  4IHV A;  1F36 A;  1ETO A;  2NOG A;  2XPV A;  2YU9 J;  4EEF G;  3JRA A;  4JX5 A;  4A3G J;  4DYQ A;  1JGG A;  2LKX A;  1MNM C;  2TRT A;  1BL0 A;  2H1K A;  1ETK A;  2EH3 A;  4V2G A;  3PM1 A;  4M3E A;  3PO2 J;  2DJN A;  1IRZ A;  1TWC J;  1ZGW A;  1SFO J;  4DYR A;  2NVT J;  4DZP A;  1E3O C;  1RKT A;  2B63 J;  4XID A;  1MBF A;  1ETY A;  4I76 A;  2JK3 A;  3JR9 A;  2DA7 A;  2D5V A;  1XS9 A;  3JRD A;  4M3G A;  2DA6 A;  1JJ6 C;  2HQ5 A;  3ZQG A;  3D1N I;  3QQA A;  3LSR A;  1WCM J;  2K9S A;  2WV1 A;  5EG0 A;  3MVP A;  1U9O A;  3LSJ A;  4B3A A;  2ID6 A;  3Q0W A;  2CQX A;  1YRN B;  2DN0 A;  3FK7 A;  1ZTR A;  2ME6 A;  3TP0 A;  2ZB9 A;  3JRI A;  3BTC A;  3M3Y J;  4CYC B;  4QTR A;  1WH5 A;  1JTY A;  2QF7 A;  3HEF A;  3JRF A;  5M3F J;  3A02 A;  3BR1 A;  2VPR A;  5F1J A;  1POG A;  1MSE C;  1S7E A;  3JRC A;  2MW8 A;  2ME0 A;  2R93 J;  4UUS A;  1FTT A;  1AKH B;  1B8I A;  4Y52 J;  2DTZ A;  3WHB A;  2CQQ A;  2VKE A;  3H3V K;  2K9N A;  2RAE A;  1JUP A;  3RZO J;  4A3I J;  1A5J A;  1G2H A;  4I6Z A;  2XGC A;  2JA6 J;  3ZQI A;  3DCF A;  3LSP A;  4M3D A;  2W48 A;  5JLX A;  2FX0 A;  3I4M J;  3JRG A;  2LTP A;  4DW6 A;  3S1M J;  3IH4 A;  2IEK A;  1TWH J;  5K7H A;  1LE8 B;  4BBR J;  1Q1V A;  1GV5 A;  2MG4 A;  2KT0 A;  5IP6 A;  1H89 C;  3IH2 A;  5C4X J;  4IHY A;  4FE4 A;  1RPW A;  3A03 A;  1B72 A;  3H0G J;  1Z0X A;  1JKP C;  1K61 A;  2ID3 A;  1VFC A;  2DA3 A;  2G0E A;  3ZOB A;  2CUE A;  3GTL J;  3SFI A;  3A01 A;  1MBK A;  1WGX A;  3S2H J;  3Q0U A;  2XB5 A;  3BR0 A;  5BNG A;  4FTH A;  5K7F A;  5C44 J;  5FKM A;  5EYR A;  4M3F A;  3BTJ A;  5E3M A;  3OOU A;  1ENH A;  3RZD J;  3S1N J;  3NAR A;  1GT0 C;  2CU7 A;  2M0C A;  4B1R A;  4XRM A;  2X48 A;  3BTI A;  2NS8 A;  1MH3 A;  1VI0 A;  2CJJ A;  3K2A A;  2ECC A;  1IGN A;  1BA5 A;  2CRG A;  3WHC A;  3JRH A;  2HXI A;  1FJL A;  3B6C A;  4A3J J;  3OSG A;  1ETQ A;  5IP7 J;  3C2B A;  3S15 J;  5IOY A;  1X2N A;  1QRY A;  3FK6 A;  1OFC X;  4C2M J;  3JRB A;  1HDD C;  3O8G A;  4J19 A;  2DA2 A;  1U78 A;  3HM5 A;  1IC8 A;  2M9H A;  2KDZ A;  1HF0 A;  1DU0 A;  2P81 A;  1IV6 A;  3DEW A;  3MKL A;  3BG9 A;  2DA4 A;  5IPA A;  3HKZ N;  2R5Y A;  5EDN A;  1AU7 A;  2R7Z J;  3Q3S A;  3E7L A;  1DU6 A;  1QPI A;  5K7Z A;  1MH4 A;  4X1E A;  3VPR A;  2DA5 A;  2Y9Y A;  2XGD A;  4A3B J;  3IV5 A;  4BKX A;  1PUF A;  3BTL A;  2K40 A;  2L0K A;  4RBO A;  1UHS A;  3HOW J;  1RET A;  4BBS J;  1F43 A;  4NDL A;  2VUM J;  5E3N A;  2XPW A;  1UG2 A;  1FEX A;  1BW6 A;  3BQZ A;  3BR2 A;  2FD5 A;  2R5Z B;  1FIP A;  1ZQ3 P;  1H8A C;  5J1U A;  1EF4 A;  4A3L J;  4W97 A;  2H8R A;  1IDY A;  2IAI A;  2X6O A;  2YUS A;  3HDD A;  3BT9 A;  4W1U A;  1R9T J;  3RQI A;  4D7M A;  2E2J J;  2NVY J;  2DMQ A;  4XK4 A;  2EZH A;  4FIS A;  1WH7 A;  1OCP A;  3TED A;  4D5F A;  3GTO J;  3ZQL A;  1BW5 A;  3FKI J;  4X6A J;  2M34 A;  1ORK A;  3SJM A;  2HDD A;  1LFB A;  2DMT A;  1YRN A;  2JA8 J;  2HYJ A;  2Y0S N;  2R5Z A;  2L9R A;  2EZL A;  4B4C A;  1LFU P;  1JT6 A;  2PMZ N;  4XRS G;  5EEA A;  4CYC A;  4IHW A;  1QVU A;  1IJW C;  3LNQ A;  3S17 J;  1JJ8 C;  3HOY J;  2DMU A;  2L7M P;  2XB0 X;  5FKO A;  3CQZ J;  3FIW A;  3GTM J;  2OF7 A;  1IG7 A;  2YS9 A;  1AKH A;  4RDU A;  3S1Q J;  1ZKG A;  2LY9 A;  3B6A A;  2O9L A;  2X9D A;  4A93 J;  5M3M J;  9ANT A;  2LR8 A;  5FKK A;  5M5Y J;  5IOZ A;  1NK2 P;  2M2E A;  1GDT A;  1HOM A;  4AUX A;  2FQ4 A;  4G12 A;  1JKQ C;  1HDP A;  1D5Y A;  3G1L A;  2E19 A;  4MFE A;  4V2F A;  5F27 A;  5GPC A;  1VF9 A;  1MBJ A;  4DZJ A;  1LE8 A;  1O4X A;  1ZK8 A;  2O7O A;  2WB1 N;  2LFB A;  2LK2 A;  3S14 J;  3SDG A;  3ZQC A;  2EBI A;  3F0C A;  1W0T A;  1HCR A;  1NTC A;  4FCY A;  4UUT A;  1OCT C;  1JT0 A;  1NK3 P;  5EZG A;  2GLO A;  1U8B A;  2DA1 A;  4A3F J;  3FIS A;  1MBH A;  3HBL A;  2NVX J;  1W0U A;  3GBG A;  4C3H J;  3OSF A;  3HOX J;  2E2H J;  4FE7 A;  1SAN A;  1XG1 A;  2LD5 A;  3LOC A;  5IP9 J;  5J1Y A;  1TWA J;  1TWG J;  3K7A J;  1HLV A;  1I3Q J;  1CQT A;  2JA7 J;  5IYB J;  1ZR2 A;  1QVT A;  3L1P A;  5GP9 A;  5DTD A;  1I50 J;  1X2M A;  3PO3 J;  2QCO A;  4IHX A;  1ETX A;  2L7F P;  1P7J A;  1A6I A;  1ETW A;  4Y7N J;  2JWT A;  2JA5 J;  5F0C A;  1TWF J;  2LLK A;  5F04 A;  5F0H A;  1JKO C;  5FLM J;  3BR3 A;  2VI6 A;  2DMN A;  4QIW N;  4A3E J;  2MGQ A;  2R92 J;  1IDZ A;  2HOS A;  4QSH A;  2K9Q A;  3IH3 A;  5J3L A;  5EF6 A;  2ECB A;  2WAQ N;  3S1R J;  3HOU J;  5EG0 B;  3BG3 A;  1Y1V J;  2DMP A;  3ZQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...