1DU0A

Engrailed homeodomain q50a variant dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
AFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFANKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*TP*AP*C
publication title Exploring the role of glutamine 50 in the homeodomain-DNA interface: crystal structure of engrailed (Gln50 --> ala) complex at 2.0 A.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 20
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1du0A00
2OF7A 5EYRA 1W0TA 4IHVA 4AUXA 3JRDA 4MLOA 2LK2A 1FEXA 1HLVA 1H88C 3ZQCA 1U78A 3ZQHA 4DZPA 3BG5A 2XGEA 2FQ4A 3BR2A 2EH3A 4B1RA 3WHBA 2DA7A 1ETYA 4M3GA 4C3JJ 3K2AA 5J1RA 4A3FJ 2R5ZA 1EF4A 1FIPA 2PMZN 2CJJA 2EZIA 4A3JJ 2R92J 1JTXA 2CUFA 1FTTA 5IOZA 3BG9A 1QVTA 2K9SA 3SFIA 4D7NA 5EGOA 2JA8J 4DYRA 1I3QJ 4J19A 3GTGJ 3G1OA 3NARA 5J3LA 3JRIA 1RR7A 3G1MA 2EQRA 1ETWA 1AU7A 4A3MJ 2HOSA 2DA6A 1JT6A 1P7IA 1VNDA 3ZOBA 3HGYA 4XRSA 1YRNA 4M6VA 2W48A 2ID6A 2DTZA 2DA2A 3I4NJ 5EDNA 3HM5A 4I76A 5EF6A 2LFBA 4C2MJ 1NTCA 2DMPA 2E2JJ 2DA4A 2NOGA 3DCFA 3I4MJ 4S0HB 3BQYA 3S2HJ 5DTDA 1MSEC 3PO3J 5GPAA 5F04A 2R0QC 1ETXA 3F0CA 3S1NJ 3B6CA 3O8HA 4CYCA 3GTQJ 2ID3A 5GPCA 2WAQN 1LE8B 5K7ZA 5E3OA 3CCYA 2R93J 3TP3A 4FCYA 1GUUA 2LVSA 1I6HJ 1WH7A 3TEDA 2D5VA 4QIWN 2HXOA 3ZQGA 3FIWA 5FLMJ 3IV5A 1HF0A 1JKQC 3JREA 3S1MJ 3GTJJ 1LFBA 3JR9A 2YU9J 5FKLA 2XRLA 4D5CA 3A01A 2AHQA 4XIDA 1IJWC 3GTLJ 5FKMA 2X48A 1MBKA 2R5ZB 3RKQA 2JA5J 2XSDC 4A3LJ 2GM4A 4FE7A 2Y31A 2Y2ZA 2E2HJ 3FKIJ 4W97A 5C4XJ 3A02A 2HOAA 1OJLA 1ZKGA 5EGOB 1RETA 2Y9YA 3Q0UA 1FIAA 1WI3A 2DA5A 1IDYA 1ITYA 1MBHA 2P81A 2QF7A 3OSGA 1MH4A 2LLKA 1FJLA 2LY9A 5JLWA 4DYCA 5F0CA 1JT0A 2ECCA 3L1PA 3OSFA 4UUSB 1JJ6C 4HNVA 1IRZA 1QVUA 4FTHA 1YRNB 4DW6A 1IUFA 3G1LA 4L5EA 2MW8A 2FJ1A 3OOUA 1Q1VA 3RQIA 2QCOA 3GTPJ 5GP9A 5IYBJ 1JTYA 4IHXA 4A93J 2ZB9A 3IH2A 2ELKA 3BTIA 2NVYJ 4A3DJ 4FE4A 2NVXJ 3SDGA 3D1NI 4M3BA 2LP0A 2M0CA 1H8AC 4A3BJ 3CDLA 1WGXA 2G0EA 1ETQA 1K83J 2DN0A 2XGDA 3E7LA 3ZQIA 4CYCB 2H8RA 1ETVA 1OCPA 5EZHA 1Y1VJ 4A69C 1MBEA 2IAIA 3A03A 1VF9A 4GFBA 1MH3A 1G2HA 3S2DJ 2JA6J 4NDLA 2VI6A 4A3KJ 2FX0A 1U9OA 3S1RJ 1IC8A 1A6IA 2M8GX 3LNQA 1Y1WJ 2YS9A 3MVPA 5C3EJ 3RZOJ 2EZHA 5IP6A 1AHDP 3HEFA 3A01B 2JN6A 1BW6A 4QTRA 9ANTA 3SJMA 4X6AJ 2X6OA 2L7MP 5BNGA 1VFCA 4UUSA 3JRCA 5J1UA 5M5YJ 1XS9A 4ABZA 2R5YB 3PM1A 4IHYA 1ETOA 2O9LA 5EG0A 1JKRC 2NS8A 4BKXA 4DZJA 1XC5A 2LKXA 2Y9ZA 3BTJA 1MBGA 3HOVJ 2LD5A 1ORKA 3OIOA 2L9RA 1UG2A 1K61A 1E3OC 3S15J 2EBIA 5E3MA 4MFEA 3BTCA 3JRBA 3BR5A 3JRAA 1ZQ3P 1HOMA 1JGGA 1RPWA 5K7HA 5IPAA 5K7FA 4XRMA 3QQAA 4B3AA 4EEFG 2MG4A 1PUFA 4X1EA 1HDDC 5F27A 1F36A 4IHWA 2E2IJ 3JRGA 4B4CA 3HOWJ 2JMWA 3GTOJ 1X58A 4MO7A 5DS9A 2ECBA 2JJ7A 2DMQA 1I50J 4AC0A 5F1JA 3GTKJ 4BBRJ 4RBOA 1UMQA 1JKPC 1ENHA 1GV2A 4M3DA 4IEJA 3WHCA 2HOTA 2K9NA 3BG3A 4A3IJ 1WH5A 2GLOA 3LOCA 4BY7J 1JUSA 3BR6A 2R5YA 2JA7J 2O7OA 4M3FA 2XPUA 3HDDA 3H0GJ 1D5YA 1MBFA 4Y7NJ 1BA5A 3ZQLA 3B6AA 2TRTA 1BW5A 2HXIA 2CU7A 1X2NA 1TWAJ 1CQTA 2NVTJ 2L7FP 2K40A 3HGGA 4BY1J 5FLVA 3GTMJ 2M34A 5EEAA 2ME6A 1TWCJ 2EZKA 3NAUA 5F0HA 1TWHJ 2XB5A 3CQZJ 2M2EA 1QPIA 2GBYA 2XB0X 4D7MA 2WV1A 5FKNA 1O4XA 4W1UA 5M3MJ 2N8GA 5FJ8J 2E1OA 1B8IA 2XPWA 4C3IJ 3DEWA 5EG0B 5M3FJ 1LFUP 3S16J 1Z0XA 1RESA 1U9NA 1Z77A 1XG1A 2JK3A 5C4JJ 3MKLA 1X2MA 2R7ZJ 5IOYA 4XICA 1DU6A 4JYKA 2CQXA 2FD5A 3H3VK 3K7AJ 2Y30A 2ME0A 3GBGA 2KDZA 1JKOC 1GDTA 2YUSA 1OCTC 3TW7A 5M5XJ 2VUMJ 5M5WJ 3BT9A 1DU0A 4A3EJ 1PUFB 1TWGJ 4QSHA 5J1YA 4DYQA 1APLC 4UUTA 1POGA 4JX6A 5IP7J 3S14J 4M3EA 3FK7A 3Q0WA 1AKHA 1MBJA 1OFCX 2X9DA 3S17J 4A3CJ 1WCMJ 1B72A 4XK4A 1W0UA 3BR1A 2M9HA 2WB1N 2CQQA 1U8BA 2VPRA 4BBSJ 1GT0C 2E19A 1MNMC 1GVDA 3VPRA 2DA1A 3LSGA 2AO9A 2LTPA 5EZGA 2VKEA 1ZR4A 5FKOA 3QPLA 5E3LA 2Y0SN 1WPKA 4C3HJ 2IBDA 3W6VA 3M3YJ 2DMTA 2COBA 3S1QJ 3FISA 1RKWA 1ZTRA 1IV6A 5HODA 2HDDA 3PO2J 3FK6A 4LOCA 1P7JA 2O8KA 2NVQJ 3IH3A 4MIMA 5JLXA 5E3NA 2MGQA 3TP0A 1NK3P 2JWTA 3HKZN 1H89C 4JX5A 2DMUA 2XPVA 2K9QA 1ZGWA 3ZQFA 1T56A 2XGCA 2B63J 1IGNA 1MSFC 2DJNA 2L0KA 4JP0A 1VI0A 4BXXJ 1JUPA 3Q0VA 1HCRA 2OPTA 4D5FA 1ETKA 3HOXJ 3UKGA 2RAEA 1B8IB 1UHSA 1R9TJ 1GV5A 1SFOJ 3LSJA 3Q3SA 2HYJA 4MFDA 3HOYJ 1IDZA 1SANA 2EZLA 2TCTA 2NS7A 3BR3A 4FISA 1ZK8A 3BTLA 5F0FA 3HOUJ 5IYDJ 2KT0A 2IEKA 4RDUA 5F08A 2CUEA 3MN2A 3BQZA 1HDPA 2L7ZA 1JUMA 5IP9J 5IYCJ 3CMYA 1QRYA 1TC3C 4V2FA 1BL0A 4JX4A 2CRGA 2DA3A 5FKKA 3LSRA 3JRHA 1JJ8C 3HOZJ 1F43A 4I6ZA 3QPSA 1AKHB 1T33A 3HB9A 3RZDJ 5C44J 1IG7A 1BJZA 2I10A 2HI3A 1TWFJ 1B72B 1S7EA 4A3GJ 3JRFA 3M4OJ 3BR0A 4G12A 3IH4A 3O8GA 3LSPA 4AYBN 1FTZA 4V2GA 3C2BA 3TW6A 1ZR2A 1RKTA 2VKVA 2LR8A 3HBLA 1A5JA 4XRSG 2HQ5A 2DMNA 1NK2P 2H1KA 1LE8A 2MSYA 4Y52J
chains in the Genus database with same CATH superfamily
2OF7A 4XORA 4IHVA 5BOXA 4A5NA 3JRDA 3MQ0A 2PMUA 2OTLI 2DCEA 3HRUA 1IXCA 4HZFA 4MLOA 2LK2A 4QPOA 2A5WA 4M72A 4PJLA 2L02A 3BG5A 1ZRCA 1SD4A 2FQ4A 4KN4X 3UNGC 5J4YA 3TL4X 3CO6C 1P6RA 4IL6C 4B1RA 2VPLA 1K6OA 3PJRA 2Q1ZB 4XN0A 2DA7A 5KAFC 1T95A 1MD0A 3OOPA 4ESFA 2QLZA 3KP4A 1FPQA 4OU0A 4PZJA 2L9VA 2PMZN 4Z2YA 2X85A 4U0YA 3ZGKA 2DOAA 4OAZA 1XN7A 3FM3A 5H6RA 2CS3A 3BG9A 4CCNA 3DPUA 4RAZA 3OS2A 4PGGA 4PK4A 5E1ZB 2JA8J 2V1NA 2DI3A 2DJIA 4LG3A 5FGMA 1I3QJ 2JPBA 3NEUA 2PLYA 3G1OA 5J3LA 2BHYA 2HOEA 2NYXA 3JRIA 1ETWA 5FB2A 1AU7A 3BWGA 2YX7A 3OS1A 4E7KA 2IGOA 2DA6A 1JT6A 2BHZA 2OD5A 1P7IA 3ZCOA 3ZOBA 5CVRA 4ZC3A 1YRNA 1EH8A 3I0TA 3MFKA 2EFNA 3PFIA 1O57A 3C2HA 2ID6A 3HRMA 4ZZLA 2V1UA 2ZMEB 3HM5A 4I76A 4HV6A 4AU7A 4BNCA 4RB2C 2R7UA 1Z7UA 1V5FA 3O6BB 1T08B 2E2JJ 3GFMA 1LDDA 4KYWA 3AL0B 1XX5A 2K9MA 1ON1A 2MH2A 4L5IA 4NC7A 3PNYA 5D5WB 4PFPA 2QSFX 1TZLA 3H5NA 3ROUA 3V4GA 1BIAA 1IN8A 4L18B 4FCYA 2EWNA 2LVSA 4U88A 3TEDA 2D5VA 2EINH 1MNDA 1WJBA 2JSCA 5CLSA 3V7RA 2ELJA 3ZQGA 1RUNA 2BYVE 3IV5A 5K5OA 4BDZA 1X1CA 4L0YB 2UXXA 3P5JA 3S1MJ 5AIPA 1I6XA 3F9KA 2XKPA 3CESA 3HOSA 2YU9J 3RIRA 4D5CA 3CTAA 5GAGJ 2VJJA 3DBLB 4I7HA 2P8TA 5FKMA 2GXAA 1TW3A 4Q48A 2XKOA 4BGDA 4A3LJ 4YFKF 2XSDC 2GM4A 4FE7A 1XSXA 2Y31A 5ILUA 3K70C 1RC9A 2P7VB 5JHUA 5C4XJ 2L54A 2E34A 3G6EI 3A02A 5L3EA 4ZTFA 2L3DA 4IRHA 3WG7H 3MD2A 2GAUA 4PJMA 1AWCA 3Q0UA 1FIAA 4RM3A 1HC8A 2KQRA 3F8BA 4R79A 4RMNA 1FT9A 5JI6A 2P81A 3FXOA 1L3LA 2LSOA 2LY9A 2WBMA 1D3YA 2ECCA 2NXNB 1D8JA 1ZGAA 2DFFA 1QVUA 3K69A 2M0MA 2R7FA 2V9PA 1YRNB 1EA3A 3E6BA 1IUFA 3HOTA 3VWBA 3G1LA 3IP4B 4GGGA 2BY3A 2MABA 4CCOA 1QO0D 1Q1VA 4PJ0C 2QCOA 4C9YA 3GTPJ 5GTHC 3IKTA 3E5QA 3TMOA 2WB1A 3GZNB 1KU9A 2DODA 1H0MA 3OYIA 4P9FA 3DTIA 3SDGA 2MBFA 1O3SA 1CGPA 1YJNI 1H8AC 3OIPA 4A3BJ 3CDLA 2K5CA 2M7BA 2E60A 1JXSA 5BPIA 1R5ID 5EZHA 2J5OA 4E7LA 2ESHA 1VF9A 1OYIA 3WTXC 4GFBA 3CCVI 2XF6A 1MJBA 4G6DA 3QRFF 4XLPF 2K27A 2VI6A 4YELA 2RV8A 2FSWA 4IRGA 2KIQA 1VZ0A 2FX0A 2KRCA 2XVCA 1F4KA 5D5XB 3PQKA 2AXLA 2P5KA 3S93A 2IVMA 1U5TC 3DV8A 5A2QZ 5BMZA 1T0FC 3I59A 3HEFA 5ERIA 4QTRA 3ZMZA 1WHUA 2RQPA 4QLCU 4EJTA 3LQQA 5BNGA 4UVAA 1VFCA 2HDCA 1QU3A 4FASD 5M5YJ 1XS9A 4LLGF 4ABZA 3PSIA 3G2BA 1O3RA 2W1OA 4NQWB 3I64A 1EV7A 2XAUA 3FDYA 5KAIC 3E5XA 3R61A 1FWZA 4G7OF 2QWWA 4ENKA 2IS4A 3DKWA 1I3AA 2KDOA 2JRTA 3OYBA 3EYIA 2I8DA 5BS6A 1XC5A 3W6JB 1MBGA 3PUFA 3CCEI 5JVGF 1DQUA 2VQHA 2D2WA 2DYRH 3VOEA 1ZQ3P 3WTUC 3ESWB 1HOMA 1ZAOA 1ZLKA 2BOLA 1RPWA 2IW5A 5HDGA 1IF1A 4ZJZA 4HEA2 2QSHX 3EYYA 3K6GA 2K4JA 2DK8A 1RUOA 2JZYA 1UCRA 3CJNA 3A1YA 2RDPA 4CCKA 3M8EA 5LRRA 5CPRB 4MO7A 1T38A 5CVUA 4AC0A 2NVUB 3DBRB 5F1JA 1FLIA 1FSHA 1UMQA 2XIGA 1GV2A 2A05A 2DT6A 3LOCA 3E97A 2HYFA 4LLNA 1JUSA 4ZYDA 3BCBA 3S3MA 2L9NA 3QU3A 2IJLA 2MA3A 2P6SA 3QPTA 3H0GJ 1R4NB 2FNAA 1D5YA 1MBFA 3REOA 4DIQA 2RKHA 2EFQA 2HZDA 3DEEA 2ZMEC 3ZN0A 3CUOA 3ZQLA 4G8XA 1BW5A 2M7AA 3HXLA 3I59B 2UXNA 3J81K 4HRIA 1X2NA 4NC8A 1P92A 1CQTA 3N4MA 2L7FP 3AL0C 4GO1A 4Y17A 5DM7F 3RJPA 2M3AA 2BW3B 2M34A 2ME6A 2QQ8A 2DDAA 5E18F 2P5VA 1XCVA 2E7XA 1K78B 2CW8A 2BXZA 3DPTA 5FJ8J 1FOKA 3DTKA 1SFKA 3GUDA 3WTZA 5GADJ 2XPWA 3DEWA 1MW7A 2X1EA 5DCMA 5LHHA 1MMSA 1RNLA 1G59A 4RGUA 1XG1A 3MKLA 2K02A 4CZZA 2CV0A 3LSMA 3OWTA 5IOYA 2CQXA 2FD5A 2Y0SA 1Q1HA 2QVOA 2LC2A 2Y30A 2FQ3A 1STZA 1YX5A 1Z21A 3GBGA 2A3SA 4L0ZB 3VDXA 2EK5A 4NNJA 2DDBA 4ZDOA 5E1XA 4RLQA 3K1MA 2X0LA 3BT9A 1E17A 1OYYA 2GWRA 2HPIA 1TT5B 4MEXF 4JX6A 4BACA 2GIVA 1FZPB 3S14J 2X51A 3FK7A 2HYGD 2X6YA 2VASA 1X1BA 5H20A 2G7HA 3FXMA 3MZ8A 4TV7A 4QWQA 3AKZA 3T1BA 3L9FA 3VSLA 2X9DA 3S17J 3TDUC 1ULYA 4IX7A 2KHMA 1P4AA 2PX9A 3BR1A 4UB6C 2CQQA 3QYEA 1GT0C 2E19A 1MNMC 1EJ9A 3VPRA 2ETHA 1BI2A 5HNFA 3ABKH 1UG0A 4NB5A 2Y0SN 1WPKA 3NWTA 3BOQA 5HLTA 3W6VA 3S1QJ 3SXYA 1SVOA 3KX2A 4HDUA 1NG7A 1ZTRA 1W7PA 3HUGA 5L3BA 1OCRH 3B02A 2NVQJ 2HEOA 2WC2A 3RTRA 3SQNA 4MTEA 4BQNA 2A6HF 2O61A 2LRDA 3G3ZA 3COAC 2H6CA 3RPUA 1H89C 1B6AA 4JX5A 4ENNA 2PI0A 2XPVA 2K9QA 4KITB 1S8NA 2HQAA 3BZKA 1IGNA 4BXXJ 2DJNA 1VI0A 4AWXB 3Q0VA 2OPTA 2W84A 3UKGA 2RAEA 4B43A 4PGHA 2FEZA 2GQQA 1J7KA 5DCMB 1G3WA 2HKXA 5HVQC 4BQAA 3H36A 2AQEA 4MFDA 2NRAC 1TL8A 1XB4A 2NS7A 4DNCA 1X19A 1ZK8A 2ZCWA 5DD4A 3AG2H 2GZWA 3C1DA 5F0FA 4KUMA 5JR3A 3IRRA 3JCUC 4RDUA 3WGHA 2D1HA 1MGTA 4NBQA 2UUZA 2EFOA 2JT1A 2L7ZA 3M07A 3VYSB 1TC3C 1EKEA 1FSEA 1SMTA 2CWEA 4F92B 3LSRA 2BE5F 4A2UA 1OPCA 4DJAA 5TISC 2E1NA 2OJED 3CP8A 2BY1A 3TDZC 4EJWA 5D5UB 1HBXG 1DGWY 4RGSA 4ZTJA 3SZGA 1T33A 3CCSI 4IKFA 1IG7A 3QOEA 2HI3A 4LLLA 3OYHA 4GYGA 2ZFUA 1S7EA 4WXHA 1FYMA 5F6FA 1KYWA 3TOAA 4ZZDA 3ABLH 2MLGA 3M4OJ 1OISA 4YEJA 2V6CA 2QBYA 1FTZA 2UV1A 2VXZA 2VKHA 4V2GA 1MMGA 3GLXA 1SD5A 3FBIB 5DCFA 3T8RA 4AIHA 1VTNC 1W7PD 3Q5FA 4ITVA 2M30A 3WODF 4N9HA 4HQEA 1ZRDA 1W7PB 3HUGB 4XRSG 4BHCA 3A2KA 3QP6A 4BQOA 4WX9A 3RPUD 3J80Z 3C2GA 3K4LA 3ELKA 1U9OA 5ICEA 3QWLA 3F72A 1W0TA 1BR1A 3MMYB 2RREA 2KZGA 2W4SA 4BHBA 4JK1X 4B47A 3QAHA 3ZXSA 1Y6IA 2ZSHB 5FD6A 1H88C 1F5TA 2PN6A 4Y33A 3DEUA 3ZQHA 2LG4A 4GRIA 2O5RA 4ESBA 3KZZA 2HS5A 1QPMA 4I2OA 1J75A 3BROA 2PMHA 4HNTA 3WHBA 1I27A 3BCAA 4LK1F 4O3MA 3ABUA 4ZH4F 1ETYA 4RA2A 3R0AA 3LAJA 4EGZA 3C3WA 3FWEA 1K7AA 1N78A 2LNBA 1ODDA 2QQ9A 3ABTA 4YIRX 2CUFA 3WE2A 3Q9SA 5DDGA 3I58A 2OCEA 3WU1B 2LOOA 2PEXA 1QVTA 1U5TA 2K9SA 4KICA 1Z3XA 4XRFA 4DYRA 3CP2A 3ZMDA 1O7FA 4J19A 4I01A 3AFHA 2XF5A 3EUAA 3W6KB 1RR7A 3G1MA 3LSKA 1A04A 3HYIA 1QHHD 1HW2A 4CH7A 4XKBA 4CCJA 2G9WA 2F5VA 4UNOA 1D5VA 4M6XA 1WQ2A 2KP6A 3HGYA 5B5EC 5BPDA 3EDPA 2W48A 3CMMA 2EFPA 2Q8KA 3ZRGA 2XV4S 2LKSA 3CJRB 4CGZA 3KLNA 4C2MJ 2VBZA 1U3EM 4E6KG 1NTCA 2QBYB 4EQQA 2Y0MA 4S0HB 2CFXA 3S2HJ 3PO3J 1WSUA 5GPAA 4LIVA 5F04A 2R0QC 4UV8A 1HW1A 5DV5A 3S1NJ 2JVGA 1Z1DA 3B6CA 3ONQA 3FXLA 1SD7A 4KT5C 2DPDA 3GTQJ 1W1WE 3CCYA 3FXQA 1GHCA 4A6EA 4G7ZF 1GUUA 1I1GA 2A5YB 3GW2A 3FIWA 5ILSA 2ZXHA 5LD2C 1YFHA 4HSRA 4GXOA 1LFBA 2OAZA 4HV5A 1X1AA 5E8IA 2EA4A 3A01A 5ICCA 4XIDA 1IJWC 3FKJA 3GTLJ 4JQFA 1Y8RB 2X48A 3RKQA 1TBXA 3NQOA 2Y2ZA 3KZYA 2E2HJ 1ZLJA 1YOVB 2JRMA 4UVBA 3I4PA 2LREA 1LUJB 2HOAA 3E6CC 2V9KA 3KP7A 4KA4A 3E6DA 1F1ZA 1QGPA 1XTAA 3C18A 2Z33A 3K4JA 2HNHA 4EGYA 1MBHA 3OSGA 1N25A 5B1BH 2LLKA 3JSPA 4AVZA 3D5RC 5F0CA 3L1PA 1JT0A 1JJ6C 4UUSB 2VE8A 1A36A 3GCMA 1FNNA 4DW6A 1I5ZA 1G4DA 1XD7A 5LFAA 3CC4I 4L5EA 1P4XA 3QYBA 3OOUA 4UB8C 4AIKA 5GP9A 1IN4A 5IYBJ 3ZMUA 3FMSA 3CCMI 5CKTA 2ZB9A 3IH2A 3GZ6A 1KQ9A 4FE4A 5LGNA 4A5MA 3L2CA 2XAJA 1Y39A 2I5UA 5J8CA 4BH9A 2KKOA 2MC4A 4HYEA 1UHWA 2H8WA 2XGDA 3GXOA 3BPXA 5LLQA 1OCPA 3V8JA 4HF1A 3EUHA 1BM9A 3E6MA 1MBEA 3DBHB 4LB6B 4DBQA 1G2HA 3S2DJ 4CDGA 2JA6J 2ZXIA 2DQLA 2W82A 2HR3A 5JVTA 3S1RJ 3OYKA 5IT9K 3JW4A 5KCMA 1VQOI 3CZ6A 5AIQA 2YS9A 3MVPA 1T8IA 2V6EA 2V9VA 3F6OA 1OYWA 1IRXA 5IP6A 3A01B 3KYLA 2LBFA 1VQMI 2DFIA 4X6AJ 2L7MP 2K7LA 2G7UA 2F4OB 1PDNC 4LIUA 3PM1A 2VXDA 2XAHA 4HBLA 4ON0A 1J59A 1LVKA 3F6VA 1ETOA 3BLYA 1R58A 5EG0A 5LEJA 4B48A 2JVHA 2KJBA 2NS8A 3OYGA 3W2VA 3DU6A 2KISA 2LF7A 1WZ2A 1LFPA 2LD5A 1GVJA 2XAQA 1ORKA 1WJAA 4BJTA 2DO7A 3OIOA 3ERMA 5KNLA 1K61A 1E3OC 1UJ8A 1P9QC 2VC1A 3DF8A 4Y13A 1P4WA 5CJ9A 3G4SI 5E3MA 2IS6A 2A69F 2ICWG 1MJ9A 4UXNA 3V7CA 4G9YA 5K7HA 3FX3A 5K7FA 1ZYRF 5AONA 4B3AA 3OS0A 3LFKA 1ZG5A 4EEFG 1E0EA 2QKMB 1RIOH 2GOMA 1Y0NA 2TDXA 2F4IA 4X1EA 2M4KA 3TO6A 5CQEA 4B4CA 3WTTC 4ETSA 2L9SA 3FZVA 3GTOJ 4HX4A 2DMQA 4B3XA 4P1WA 3GTKJ 4BBRJ 2HOTA 4IEJA 3MKZA 1YIOA 2H1LA 3H35A 1XMKA 4CUGA 5CVIA 4BY7J 3MCZA 5DUKA 2P5LC 2YX4A 1BOAA 2RNJA 1MIJA 3BR6A 4NQWA 4PCQA 2ZSIB 3L2VA 2XPUA 4IOAF 2QZ8A 4CA0A 2ZNZA 3BJOA 4Y7NJ 1WJEA 3F8MA 4IVNA 1XMXA 5B3SH 1K4TA 2TRTA 2O3FA 3HL2A 2HXIA 4KJZA 2VONA 1A35A 2LBFB 2L2OA 3TO7A 4A6DA 5J4VA 3GTMJ 5EEAA 2IRFG 1TWCJ 2EZKA 2Q2EA 3CQZJ 4AIJA 2GBYA 2FBKA 3G71I 4R1HA 2K85A 4D7MA 2BEOA 2WV1A 5FKNA 2E1OA 5EG0B 1VQPI 4I98B 4JOMA 1LFUP 4KMUX 1Z0XA 1RESA 2DT7B 3K0LA 4G94A 1W36D 2ZC2A 1KONA 3GMEA 5C4JJ 4OINF 1DU6A 1QZZA 4XONA 4QPQA 1LNWA 4LG0A 1BIBA 5ICFA 2CQ7A 2RC4A 3DKXA 1JKOC 3R6SA 3GX4X 2O8XA 3CCUI 4I99C 1OCTC 1G8XA 5BQTA 2VUMJ 1AOYA 4EJVA 4XSXF 1QHGA 2P4WA 2DW4A 5J1YA 2HQNA 1Y56A 1ZG3A 4UUTA 1POGA 5IP7J 1VQKI 4HF0A 4M3EA 3Q0WA 3CF5F 4BE2A 1S3JA 1X4PA 1W5CC 3QPHA 1LDJA 2HZTA 1ZG1A 2FOKA 3SEZA 2BW3A 4XK4A 3LAPA 2WB1N 1SAUA 1BC7C 1FBSA 4BBSJ 1ON2A 2WAEA 1K78A 3DXJF 2BVLA 2VKEA 1ZR4A 3AG1H 5FKOA 3QPLA 1FY7A 1WKMA 3M9AA 4XLFA 3S8PA 3BC8A 4C3HJ 3L09A 3KE2A 4BU2A 3PIOF 1TTYA 1V3FA 1X3WB 2QGUA 3WGGA 1Y0UA 3DLLF 3F21A 3H3UA 1P7JA 4LFUA 2R7SA 3IH3A 2K9LA 3SHFA 3GWZA 1AA7A 3CCQI 3FXRA 3I55I 4BE0A 2Q2EB 2V79A 2ESNA 1EH6A 1D1CA 1P2FA 2E1MB 3LFUA 3ZQFA 1ZGWA 3VB2A 3WTVC 4JP0A 1HCRA 4D5FA 3HOXJ 5B66C 4C30A 5FO5A 1VQNI 3K4BA 4G6TB 1UHSA 4WCGA 2CW0F 2XSJC 1R9TJ 3SYTA 3TKYA 1GV5A 5ICGA 1SFOJ 2AS5F 5IT9Z 3H5AA 3Q3SA 4LJZF 3HOYJ 4RS8A 3GFJA 2LY2A 1SFUA 3JSOA 4BUPA 3J80K 3I53A 2O6GE 3M8JA 1FMWA 3BR3A 3S2WA 1IN6A 4LG0B 1FC3A 3SEQA 2IEKA 4RGXA 2CUEA 1ERDA 5F64A 4KIBA 2IGKA 2HVSA 3CMYA 2MD0A 3OR1C 2CGPA 1JJ8C 3HOZJ 4B09A 1Z05A 5JHFA 5EJCA 1I1SA 1FOWA 2KPMA 4OAYA 4E70A 1U8RA 3HB9A 2PJPA 3RZDJ 1SAXA 3C7JA 2I10A 3OR2C 3U9GA 1T2KA 4KMFA 5D8KB 1K6YA 1S6LA 4DGWB 2BXYA 2MC3A 3JRFA 2O03A 4IXAA 3BR0A 2Z2SB 5LRSA 5DYMA 2L01A 2R7QA 1PP7U 3TW6A 1E2XA 1ZR2A 4ENJA 3L2QA 1RKTA 1X1PA 3ECOA 2LR8A 4XOTA 4G6QA 4BAYA 1O7LA 4E7SA 1B1BA 3U2RA 3D5LA 3P9KA 1RI7A 4P55A 3I56I 2VQLA 2VT3A 5EYRA 3R4KA 1YW7A 3DPLC 4EM0B 1LB2A 2HDWA 1QA6A 5LBQA 3L7WA 1DGRM 4A0ZA 2WY7Q 1FEXA 1S29A 3ZQCA 1LVAA 3EUHC 1U78A 2W85A 4IZZA 3P9IA 2B0LA 2X4HA 2PQ8A 4DZPA 2XGEA 2XRNA 4H4KC 3BR2A 1D1BA 2EH3A 3W2AA 2M4GA 2EB7A 1RRJA 5J40A 3IL2A 4C3JJ 3K4NA 5J1RA 4A3FJ 2R5ZA 1EF4A 1KGSA 3J7AY 2CJJA 2EZIA 4A3JJ 4U7BA 2R92J 4FETA 1JTXA 5E79C 5L3CA 3WGIA 5IOZA 5IY5H 4D7NA 5EGOA 1IRFA 2XAFA 3GTGJ 2KZVA 1LKXA 3NARA 4XLAA 2CQNA 4GCVA 1WJCA 3M1EA 2Z3YA 3D5SC 5HOOA 4PFOA 2MLKA 2HOSA 3HG9A 1A6QA 3GO5A 2H27A 2IGNA 4XRSA 1YIJI 4P5OA 1X4OA 1MDMA 2WAFA 3T5XA 1W36C 3MAJA 2DA2A 3I71A 2QYOA 2JUCA 5EDNA 1S7OA 1D0XA 5HS7A 4PJNA 1H9TA 2LFBA 3RI4A 1IN7A 2DA4A 2NOGA 3DCFA 1E3HA 3BQYA 3RKYA 2K86A 5DTDA 1ZHFA 4IO9F 1ETXA 3F0CA 3EPZA 3VEPA 5FRNA 3HSEA 3O3KA 3QOPA 1SEUA 3E5UA 3HRTA 4LMYA 3HSRA 1Z3YA 1DPRA 5CQGA 2R7TA 2JA2A 3E1SA 1MJAA 2R93J 1OQYA 1I6HJ 1YYVA 2VQCA 1WH7A 2KFDA 4BE1A 2EA2A 4QIWN 4AVPA 2GA1A 2HXOA 3CMAI 1T6SA 2DPUA 1TT0A 4HOBA 4YIIA 2EJRA 4C2UA 1S5LC 2RGVA 1JKQC 1YJ9I 5KHDA 4M6YA 3K4CA 4JBAA 4B8XA 3U21A 2ZKZA 1Z6TA 3LMMA 1D0YA 2XRLA 3KP6A 3Q9VA 4OIRF 1S72I 5E8GA 2OUMA 2VJIA 3RSNA 1FBUA 1IAWA 1MMNA 1ZARA 2WA0A 3NWSA 2R5ZB 4F52A 2DU9A 3GLLA 1RZ4A 3FKIJ 4M73A 4A0YA 4W97A 2DLLA 3JTGA 3VODA 3SZPA 1FP1D 1B9NA 4CXFA 1W5TA 1LEAA 1ZKGA 2VBXA 4XLHA 2OC6A 4KIFA 3L2WA 5EGOB 1RETA 2OA4A 5J47A 2VOOA 2DFEA 5LGUA 1V5GA 2E1MC 4HSTA 2FA5A 4HW0A 3TOBA 1ITYA 2QF7A 1FJLA 1R71A 3IAS2 3AG4H 5JLWA 1J2XA 3OSFA 2R4GA 4HNVA 1U6GA 2GOXB 1IRZA 2DOEA 1R22A 4EJOA 1MDMB 3B73A 1WFXA 5HDKA 3RKWA 3EETA 1D0ZA 4EM1A 3LQRA 3CCLI 2A6TA 3TO9A 4LK0F 2Y48A 2QM3A 1QBJA 1XDSA 1WJ5A 2JQ7A 1X1DA 1FX7A 3L2UA 2NVYJ 4A3DJ 1LPQA 3GF2A 3M1CA 2NVXJ 3HTUA 2R7RA 3HSFA 4M3BA 2VE9A 4D1QA 1WGXA 2EPFA 2H8RA 3E7LA 4L9VA 4OMZA 2OTJI 4V19K 1ETVA 1I39A 3P7NA 1XGNA 1Y1VJ 2HGCA 4M71A 3F8CA 2IT0A 3OL3A 1YX3A 2JUGA 2RN7A 2R7VA 3TBIA 1USTA 2F5EA 1M1EB 4PSXA 2GA2A 3WU0A 3CMEI 3BP8A 1IC8A 2M1BA 2B9SA 1GXPA 2M8GX 3HRSA 2CG4A 3RKXA 2X6XA 5C3EJ 2EV0A 1AHDP 4XMYA 2JN6A 3HIFA 1BW6A 3V8KA 2W57A 2QQBA 3DP7A 2FF4A 2X6OA 3E3VA 4U87A 4UUSA 3K1PA 3JRCA 5J1UA 2Z1DA 3BJAA 2R5YB 2CQKA 1S7AA 2FNPA 4UY8I 3CDHA 2W7NA 3K9TA 3IKVA 3FMQA 2QUFA 1Z91A 2FE3A 1BOBA 4L5JA 1XMAA 3X2QH 4DZJA 2WWYA 3H9GA 4ZYEA 1DP7P 4U0VA 4XR6A 2CV1A 3HOVJ 4BDYA 2L9RA 4U0WA 4L9NA 1VQ5I 2OU2A 2HFHA 3MWMA 3F8FA 4FX4A 2KRFA 3MZYA 3BTCA 3JRBA 3JRAA 2HPMA 4Z6YA 5FRMA 4MEYF 2P6TA 1Z67A 4ANJA 4YRVA 3GYHX 1JGGA 3MEXA 5IPAA 3FXKA 3QQAA 2MD5A 4M74A 4Y3OA 2ZJQF 3FMRA 2MG4A 2F5DA 2CYYA 4AM3A 4XL9A 1HQCA 5F27A 1F36A 3PNVA 3V8LA 2E2IJ 3JRGA 4Y15A 2ISYA 1X58A 5DS9A 2ECBA 2ZJRF 2X6WA 2Y75A 1OR7A 2LMDA 1YITI 5FFZA 1C0WA 4RBOA 4AYBA 1JKPC 1ENHA 3HZJA 3HJEA 3WHCA 3DFGA 4EATA 2K9NA 3BG3A 1WH5A 2VKDA 3FHNA 4E7HA 4CICA 4EJUA 6PAXA 4NC6A 5TGTA 1L0OC 3GZ5A 3W3CA 4XKWA 2WY8Q 4M3FA 4OIOF 4DQ2A 1MZBA 3AG3H 1V5EA 3PUBA 2F2EA 2F48A 2FOWA 5K5QA 1R23A 1XSVA 1J0RA 1TNSA 4R8HA 1R5HA 2CU7A 1YTYA 3CLQA 1U0JA 2CUZA 1GXQA 4M9ZA 1TWAJ 1ZRFA 2NVTJ 3CUQA 2K40A 3KYCB 3PSFA 4BY1J 4EV0A 5FLVA 3ECHA 3KEQA 1YLFA 5F0HA 1XSDA 1TWHJ 1WJFA 2XB5A 5IT3A 1K4SA 4U7DA 3G73A 1HSTA 1B4AA 3JAMZ 3M8FA 3OYDA 1YI2I 2PMZA 4O5VA 5M3MJ 1V55H 2N8GA 3N97A 3WG9A 2PJRA 1JHHA 4C3IJ 5M3FJ 2ADUA 4XLEA 2F4MB 1LJ9A 5J6XA 1U9NA 4Q47A 3FXJA 2XC7A 2JK3A 1TQPA 2OBPA 3ZQ7A 4FQGA 2PBIA 5HNHA 2YU3A 4MNUA 1G3TA 2IA1A 1OCOH 3H3VK 5ED4A 1SFEA 3VSKA 2ME0A 4XNFA 1KU7A 2VN2A 1MNEA 3BY6A 1WJDA 1IXSB 4II2A 4ESJA 2YUSA 2RVCA 1GDTA 1R4MB 2A61A 1IW7F 1MMDA 2VIXA 3DWLE 5M5XJ 5M5WJ 5L3GA 1DU0A 3WE3A 4A3EJ 1ACIA 2EIKH 2VLAA 1FP2A 2ZFWA 3HKZA 3OMYA 1APLC 5J8FA 4I0AA 4L9JA 2WV0A 4F91B 1FBQA 5TRDA 2DFHA 1MBJA 4CYDA 4FX0A 1B59A 1IUYA 2FBHA 1OFCX 1S9HA 2IXSA 1WWXA 4ZDLA 3IRQA 4A3CJ 2STTA 4II3A 3RYPA 3F3XA 2DXIA 2M9HA 1BBYA 1U8BA 3NRVA 3LSTA 4BHPA 4KISA 1MMAA 5CVVA 5D5VB 2KIMA 2KJCA 2DA1A 5LHIA 1T98A 3P9CA 4IQJA 5FD5A 1BI0A 1H9GA 5E3LA 5TJJA 3GFLA 2E5NA 2IBDA 1BR2A 4WXCA 5GAEJ 2QEXI 3M3YJ 1WRJA 2DQRA 2HU9A 3BJ6A 1PP8F 3FISA 2E35A 1IV6A 2HDDA 4UUVA 1BI1A 5K1YA 1OMIA 3CUQB 2K3PA 2M45A 4BJ6C 5JLXA 3N05A 3TP0A 1NK3P 2JWTA 3HKZN 1BJAA 1MKMA 2V1DA 3DLAA 2VBYA 1XGOA 2HQRA 1BI3A 2B63J 2H94A 1YG2A 2L0KA 4ZDPA 5LGTA 5JFRA 1R49A 1JUPA 1YO5C 1NG6A 2IGMA 4NHJA 1ETKA 5E20A 2R7XA 3K4KA 2M8EA 2PJRB 2MYSA 3JTHA 2XHKA 1VQ8I 3LSJA 4KDPA 3LWFA 4N9IA 2HYJA 3WTSC 1CF7A 5HS9A 1IDZA 1VQ9I 2QKLB 5FLXK 1SANA 4EM2A 1KYZA 3TGNA 1DUXC 4N4NB 3H9JA 3K10A 3SFZA 4IHTA 3ABMH 1G6NA 5F08A 3U1DA 4OIPF 1QZYA 2HWVA 3BQZA 1FYKA 1HDPA 4PJJA 1JUMA 2IPQX 3I54A 3KP3A 4V2FA 2WADA 1R36A 4I02A 1BL0A 4JX4A 2CRGA 2DA3A 2D1VA 5F1RA 3J7ZI 2Z5UA 4HX8A 1F43A 3BG7A 4I6ZA 3QPSA 4H0EA 4F55A 3IWFA 5D8LB 3KYDB 4RLFA 2C6YA 3T8TA 1EH7A 3H1CA 3KPHA 2VB6A 2L4AA 4AIDA 1O3TA 2FRHA 2STWA 1ZN2A 4A3GJ 1UELB 5EEGA 3IUOA 1ZELA 3LA2A 4BL0B 2W25A 2DK5A 1R6RA 5B1AH 2IA0A 3O8GA 3W2WA 1YW8A 4OWRB 4CO8A 2KMUA 3C2BA 4KNYA 2LDUA 2VKVA 2FBIA 3LA3A 3T0YA 1A5JA 1SMYF 1TLHB 4HG2A 2HQ5A 2Z16A 4I0BA 2DMNA 1LE8A 2A68F 3H5RA 3IAM2 4RAFA 1KU3A 3PNTA 2CFOA 1Y8QB 4AUXA 2ZJPF 4CCMA 1SD6A 2YR2A 2W00A 3PQJA 5HS8A 3A0HC 1HLVA 3ISPA 4IPAA 1RR8C 3A0BC 5FROA 1D1AA 3HPGA 2FUG2 1DDNA 2IA2A 3OL4A 1CF7B 4M3GA 2QENA 3IC7A 3K2AA 1Z6RA 5H2FC 4RAYA 3I5UA 4CCLA 1FIPA 2EV5A 3OYMA 1X3UA 1SFXA 1X3ZB 4UV9A 1XCBA 3MKWB 1R1TA 1FTTA 4XSZF 4RB3C 2LKPA 3SFIA 3RYRA 4EVIA 3CCRI 4HAMA 2WAQA 3R0JA 4ZYAA 4BEHA 1VQLI 2EQRA 4GYIA 4A3MJ 1TW2A 2XAGA 1SVLA 1LEBA 2KL4A 4XM3A 1VNDA 1R1VA 2HTJA 2L7KA 3F22A 2VJ4A 3WU2C 3UR3C 5K5RA 2X1DA 4GDFA 2CH0A 4M6VA 1FMVA 3E0JB 3S3NA 3GEZA 2DTZA 1A31A 1G3YA 3I4NJ 1DP3A 5EF6A 2DTRA 2AQFA 1TNTA 4MQ9F 3L2RA 3OYCA 2D45A 2DMPA 4M9XA 1LQ1A 3RQ4A 4HQMA 3I4MJ 2JSPA 1MSEC 3RCOA 3U1KA 2E1CA 2BY2A 3ZQQA 3O8HA 1W4MA 3FBNB 1T39A 5LHGA 4CYCA 4ENMA 5D6EA 2ID3A 5GPCA 2WAQN 3DU5A 4KN7X 1LE8B 2BV6A 3OYEA 5K7ZA 4OMYA 5E3OA 4P9UA 3TP3A 1OR7C 3OIQA 5GAHJ 4A12A 4HF2A 1J09A 5FLMJ 1YS6A 1HF0A 3OV8A 2GXGA 4DBRA 3JREA 2A07F 3GTJJ 2NOJB 2ACJA 3CC2I 3JR9A 2ELHA 3KLOA 4HA8A 5E1WA 5FKLA 3FHZA 1NH3A 2AHQA 3BDDA 2ZBKA 1YHQI 4PDKA 3H92A 1MBKA 4HLXA 2VQGA 1Z7LA 2JA5J 1PUEE 2H09A 3GVAA 5D4SA 1TP4A 1KU2A 5DM6F 4BXFA 2E5ZA 2E71A 1VQ7I 1HW5A 2KIUA 4WF2A 3KEYA 3CUQC 5EEHA 3ZPLA 1OJLA 1V54H 3IWZA 3O2PE 1Z9CA 4ZYGA 2VT2A 4HDVA 2Y9YA 3L00A 2BVMA 2DA5A 1WI3A 2BZTA 2FU4A 4X0GA 1VQ4I 1IDYA 2XDVA 3QYFA 2Z99A 4BEHB 4Y4RA 4RGRA 2H6BA 3PFYA 3QU6A 1USSA 4LGWA 3ZN1A 4BXUA 1J5YA 1MH4A 4HPQA 4XN3A 4DYCA 5L3FA 4D9JA 1HKSA 3K4MA 5FLXZ 5HLHA 3I9V2 5E17F 4FTHA 1R5GA 3EQLF 2QSGX 2CW7A 4BJ5C 1PJRA 2XF7A 2Z9OA 4C2TA 5H6QA 2MW8A 2FJ1A 3CCJI 3RQIA 4RM2A 2GIZA 1JTYA 4CSWA 4IHXA 4A93J 5KK1A 3ZMSA 2ELKA 3BTIA 3ZR8X 1IN5A 1PVEA 3KP5A 1R00A 3D1NI 2LP0A 1V4RA 2M0CA 3CLOA 4MTDA 3LSHA 4B44A 1ZREA 1OCZH 1OLTA 2G0EA 1ETQA 1K83J 2DN0A 2MFZA 3ZQIA 4CYCB 2O0YA 1LDKB 3SDBA 4A69C 2IAIA 1D8KA 3A03A 1OCCH 1YW9A 1MH3A 3BPVA 2L5QA 4NDLA 3R60A 4YIFA 4IF4A 4UVCA 3OYFA 4A3KJ 4YFNF 3CJTB 1A6IA 1XPXA 1OKRA 3LNQA 1Y1WJ 2P0WA 2DAOA 2XROA 4XKCA 1KQ8A 4IRIA 3HPHA 2JPCA 2NAZA 3RZOJ 2EZHA 4BQQA 4YG2F 2KRHA 4S05A 1YJWI 4KT6A 4XOPA 2OZ6A 2J5PA 9ANTA 3SJMA 2DT5A 4J01A 2WTEA 2JTVA 2KIFA 2QA4I 4A0XA 3PIPF 1YQAA 2HKOA 4E7JA 2VBWA 3SZTA 4IHYA 1GLNA 2OQGA 4IJAA 4ZYHA 3KETA 1SC7A 3I3LA 2ISZA 1QQIA 2LF8A 2O9LA 2NS0A 1JKRC 4IQ4A 4BKXA 3LA7A 1R7JA 2LKXA 2Y9ZA 3BTJA 1HKTA 4KIGA 2LYCA 4I09A 2NNNA 1KA8A 3OY9A 1UG2A 2CV2A 3S15J 2EBIA 5D6FA 4MFEA 3VFZA 2OQRA 3BR5A 2IS2A 3JAMK 3OYNA 3A4CA 2GXBA 2ZO4A 1UAAA 4XRMA 2E36A 4UHTA 1UB9A 3CJQB 1KZHA 1FOXA 2HVQA 1B9MA 1KQ0A 4N0BA 4RB0A 4WK8F 1PUFA 1HDDC 4E4HA 1N77A 2XGXA 4IHSA 4IHWA 5ILVA 4BYYA 3HOWJ 2JMWA 1SVMA 2JJ7A 4P96A 2HVRA 2OCCH 1I50J 1NHAA 3IHUA 4M3DA 2HTSA 4A3IJ 2GLOA 4LD5A 4OOIA 2DBBA 1TQIA 3VYRB 3HTSB 2UZKA 2NNYA 1WI9A 1IZ1A 1N75A 3OYAA 2R5YA 2JA7J 2O7OA 3H9QA 2AXTC 4MGRA 2F5CA 4IOCF 3HDDA 2EIJH 2BGCA 4CZCA 2W24A 2VC0A 3RPQA 1J9IA 1BA5A 4LITA 3B6AA 2LH9A 4DOZA 4N4OB 2RNGA 3ZP5A 4O6JA 1HA8A 5HLGA 2EFWA 2FMLA 4E7ZA 2FXAA 4E7IA 3ASOH 4ASNA 3HGGA 1K79A 1O3QA 2R7WA 4FT8A 2VOPA 3NAUA 3CD6I 3WTYC 4FHTA 1WVRA 1UHMA 1QNTA 2M2EA 1QPIA 1TQMA 4XQFA 2XB0X 4XKVA 1O4XA 4CHUA 2OV7A 4HX7A 3DQVC 4W1UA 1R1UA 2BBYA 3VYTB 1B8IA 4WXDA 3HHHA 2KLOA 3S16J 2COMA 1Z77A 1QZEA 3S3OA 3HHGA 3FF5A 1X2MA 5DUIA 2R7ZJ 4XICA 3ML6A 4JYKA 3CO7C 4PSWA 3K7AJ 3H0DA 1FYLA 2EV6A 3WTWC 3MKYB 2YSRA 1HKQA 3ULQB 2KDZA 3VYUB 3KCCA 2MH9A 3LSIA 4RAGA 2FMYA 3TW7A 2YPRA 1YS7A 3KP2A 3S32A 3ZMVA 1UZCA 3RDIA 1TWGJ 4QSHA 1PUFB 3TQNA 1ONVA 5D4RA 4DYQA 1FOYA 3LL7A 3H3ZA 2F5FA 1AKHA 3BZ6A 2R3SA 3EUKL 2P7CB 1REPC 4RB1A 4M9SA 3J81Z 4NUBA 2X1CA 4F93B 5DD8A 1WCMJ 1ZH5A 2DYSH 1B72A 2VODA 3ERED 1W0UA 3F23A 3QODA 5CVJA 3V7SA 3BZCA 2VPRA 4YFXF 2M5WA 5GTIC 1VQ6I 2VL8A 1GVDA 3GFIA 1T0FA 1YE9A 3ZMTA 3PL8A 3LSGA 2AO9A 2LTPA 5EZGA 5L3DA 5HDNA 4OIQF 1JHFA 5DEQA 3K70D 1IXRC 3KEOA 4KFCA 2ZNYA 4Q5SF 1XGSA 2DMTA 2COBA 2Q0OA 1RKWA 3KZIC 5HODA 5KVRA 2K3FA 3PO2J 3FK6A 4LOCA 4F7ZA 4Q4ZF 1IO2A 1IRGA 1BN5A 2O8KA 2E7WA 4MIMA 3BG6A 5E3NA 3QP5A 2MGQA 2OZUA 2CMPA 2Y69H 2DMUA 2F6CA 2DOFA 1XGMA 1T56A 2XGCA 2CSOA 4WWCA 3K1NA 1G3SA 5LEKA 1MSFC 2CO5A 2UWMA 2XUBA 3FM5A 3OYLA 1B8IB 1U2WA 1HSJA 2V4JC 5HLIA 2A6EF 3OYJA 1HXDA 2EZLA 3DTEA 4J00A 2TCTA 2ZXJA 3HC7A 4EMSA 1BR4A 1JI8A 4FISA 3BTLA 2RQQA 4PUSA 3HOUJ 5IYDJ 2EILH 2KT0A 4AD9A 1ZGJA 2QQAA 3MN2A 4F3QA 1DPUA 1E3PA 4HLYA 2PFBA 2BY0A 3K2ZA 5IP9J 5IYCJ 1QRYA 1UFMA 4MQVA 4BS9A 2R7DA 3F8NA 4L9TA 5FKKA 5CYVA 3JRHA 3DKYA 3J7AO 4K2EA 4XBFA 2PG4A 1JE8A 2R7OA 1PYVA 2XASA 4XLNF 2V1XA 4XLCA 2V26A 1AKHB 1W5SA 5C44J 1BJZA 1BC8C 2LY1A 2VJ5A 2EIMH 3D0SA 2K4BA 5FFXA 1TWFJ 2ZJ2A 3AAFA 4D0PA 4G7HF 2ZXWH 1B72B 3ASNH 3CDIA 2B7EA 4MHGA 2ZMEA 1U5TB 3MZHA 4G12A 4LB5A 3IH4A 2M87A 2IS1A 2CUJA 4AYBN 3M7GA 1JGSA 3LSPA 5A2QK 1F9NA 1IV8A 3KFWX 1XDUA 2L4MA 3J7YJ 4S04A 3CC7I 3FXUA 3V42A 3HBLA 2V7FA 1NK2P 3KIOA 2H1KA 2IP2A 4HNUA 3CF2A 2MSYA 4Y52J
chains in the Genus database with same CATH topology
2OF7A 5EYRA 1W0TA 4IHVA 4AUXA 3JRDA 4MLOA 2LK2A 1FEXA 1HLVA 1H88C 3ZQCA 1U78A 3ZQHA 4DZPA 3BG5A 2XGEA 2FQ4A 3BR2A 2EH3A 4B1RA 3WHBA 2DA7A 1ETYA 4M3GA 4C3JJ 3K2AA 5J1RA 4A3FJ 2R5ZA 1EF4A 1FIPA 2PMZN 2CJJA 2EZIA 4A3JJ 2R92J 1JTXA 2CUFA 1FTTA 5IOZA 3BG9A 1QVTA 2K9SA 3SFIA 4D7NA 5EGOA 2JA8J 4DYRA 1I3QJ 4J19A 3GTGJ 3G1OA 3NARA 5J3LA 3JRIA 1RR7A 3G1MA 2EQRA 1ETWA 1AU7A 4A3MJ 2HOSA 2DA6A 1JT6A 1P7IA 1VNDA 3ZOBA 3HGYA 4XRSA 1YRNA 4M6VA 2W48A 2ID6A 2DTZA 2DA2A 3I4NJ 5EDNA 3HM5A 4I76A 5EF6A 2LFBA 4C2MJ 1NTCA 2DMPA 2E2JJ 2DA4A 2NOGA 3DCFA 3I4MJ 4S0HB 3BQYA 3S2HJ 5DTDA 1MSEC 3PO3J 5GPAA 5F04A 2R0QC 1ETXA 3F0CA 3S1NJ 3B6CA 3O8HA 4CYCA 3GTQJ 2ID3A 5GPCA 2WAQN 1LE8B 5K7ZA 5E3OA 3CCYA 2R93J 3TP3A 4FCYA 1GUUA 2LVSA 1I6HJ 1WH7A 3TEDA 2D5VA 4QIWN 2HXOA 3ZQGA 3FIWA 5FLMJ 3IV5A 1HF0A 1JKQC 3JREA 3S1MJ 3GTJJ 1LFBA 3JR9A 2YU9J 5FKLA 2XRLA 4D5CA 3A01A 2AHQA 4XIDA 1IJWC 3GTLJ 5FKMA 2X48A 1MBKA 2R5ZB 3RKQA 2JA5J 2XSDC 4A3LJ 2GM4A 4FE7A 2Y31A 2Y2ZA 2E2HJ 3FKIJ 4W97A 5C4XJ 3A02A 2HOAA 1OJLA 1ZKGA 5EGOB 1RETA 2Y9YA 3Q0UA 1FIAA 1WI3A 2DA5A 1IDYA 1ITYA 1MBHA 2P81A 2QF7A 3OSGA 1MH4A 2LLKA 1FJLA 2LY9A 5JLWA 4DYCA 5F0CA 1JT0A 2ECCA 3L1PA 3OSFA 4UUSB 1JJ6C 4HNVA 1IRZA 1QVUA 4FTHA 1YRNB 4DW6A 1IUFA 3G1LA 4L5EA 2MW8A 2FJ1A 3OOUA 1Q1VA 3RQIA 2QCOA 3GTPJ 5GP9A 5IYBJ 1JTYA 4IHXA 4A93J 2ZB9A 3IH2A 2ELKA 3BTIA 2NVYJ 4A3DJ 4FE4A 2NVXJ 3SDGA 3D1NI 4M3BA 2LP0A 2M0CA 1H8AC 4A3BJ 3CDLA 1WGXA 2G0EA 1ETQA 1K83J 2DN0A 2XGDA 3E7LA 3ZQIA 4CYCB 2H8RA 1ETVA 1OCPA 5EZHA 1Y1VJ 4A69C 1MBEA 2IAIA 3A03A 1VF9A 4GFBA 1MH3A 1G2HA 3S2DJ 2JA6J 4NDLA 2VI6A 4A3KJ 2FX0A 1U9OA 3S1RJ 1IC8A 1A6IA 2M8GX 3LNQA 1Y1WJ 2YS9A 3MVPA 5C3EJ 3RZOJ 2EZHA 5IP6A 1AHDP 3HEFA 3A01B 2JN6A 1BW6A 4QTRA 9ANTA 3SJMA 4X6AJ 2X6OA 2L7MP 5BNGA 1VFCA 4UUSA 3JRCA 5J1UA 5M5YJ 1XS9A 4ABZA 2R5YB 3PM1A 4IHYA 1ETOA 2O9LA 5EG0A 1JKRC 2NS8A 4BKXA 4DZJA 1XC5A 2LKXA 2Y9ZA 3BTJA 1MBGA 3HOVJ 2LD5A 1ORKA 3OIOA 2L9RA 1UG2A 1K61A 1E3OC 3S15J 2EBIA 5E3MA 4MFEA 3BTCA 3JRBA 3BR5A 3JRAA 1ZQ3P 1HOMA 1JGGA 1RPWA 5K7HA 5IPAA 5K7FA 4XRMA 3QQAA 4B3AA 4EEFG 2MG4A 1PUFA 4X1EA 1HDDC 5F27A 1F36A 4IHWA 2E2IJ 3JRGA 4B4CA 3HOWJ 2JMWA 3GTOJ 1X58A 4MO7A 5DS9A 2ECBA 2JJ7A 2DMQA 1I50J 4AC0A 5F1JA 3GTKJ 4BBRJ 4RBOA 1UMQA 1JKPC 1ENHA 1GV2A 4M3DA 4IEJA 3WHCA 2HOTA 2K9NA 3BG3A 4A3IJ 1WH5A 2GLOA 3LOCA 4BY7J 1JUSA 3BR6A 2R5YA 2JA7J 2O7OA 4M3FA 2XPUA 3HDDA 3H0GJ 1D5YA 1MBFA 4Y7NJ 1BA5A 3ZQLA 3B6AA 2TRTA 1BW5A 2HXIA 2CU7A 1X2NA 1TWAJ 1CQTA 2NVTJ 2L7FP 2K40A 3HGGA 4BY1J 5FLVA 3GTMJ 2M34A 5EEAA 2ME6A 1TWCJ 2EZKA 3NAUA 5F0HA 1TWHJ 2XB5A 3CQZJ 2M2EA 1QPIA 2GBYA 2XB0X 4D7MA 2WV1A 5FKNA 1O4XA 4W1UA 5M3MJ 2N8GA 5FJ8J 2E1OA 1B8IA 2XPWA 4C3IJ 3DEWA 5EG0B 5M3FJ 1LFUP 3S16J 1Z0XA 1RESA 1U9NA 1Z77A 1XG1A 2JK3A 5C4JJ 3MKLA 1X2MA 2R7ZJ 5IOYA 4XICA 1DU6A 4JYKA 2CQXA 2FD5A 3H3VK 3K7AJ 2Y30A 2ME0A 3GBGA 2KDZA 1JKOC 1GDTA 2YUSA 1OCTC 3TW7A 5M5XJ 2VUMJ 5M5WJ 3BT9A 1DU0A 4A3EJ 1PUFB 1TWGJ 4QSHA 5J1YA 4DYQA 1APLC 4UUTA 1POGA 4JX6A 5IP7J 3S14J 4M3EA 3FK7A 3Q0WA 1AKHA 1MBJA 1OFCX 2X9DA 3S17J 4A3CJ 1WCMJ 1B72A 4XK4A 1W0UA 3BR1A 2M9HA 2WB1N 2CQQA 1U8BA 2VPRA 4BBSJ 1GT0C 2E19A 1MNMC 1GVDA 3VPRA 2DA1A 3LSGA 2AO9A 2LTPA 5EZGA 2VKEA 1ZR4A 5FKOA 3QPLA 5E3LA 2Y0SN 1WPKA 4C3HJ 2IBDA 3W6VA 3M3YJ 2DMTA 2COBA 3S1QJ 3FISA 1RKWA 1ZTRA 1IV6A 5HODA 2HDDA 3PO2J 3FK6A 4LOCA 1P7JA 2O8KA 2NVQJ 3IH3A 4MIMA 5JLXA 5E3NA 2MGQA 3TP0A 1NK3P 2JWTA 3HKZN 1H89C 4JX5A 2DMUA 2XPVA 2K9QA 1ZGWA 3ZQFA 1T56A 2XGCA 2B63J 1IGNA 1MSFC 2DJNA 2L0KA 4JP0A 1VI0A 4BXXJ 1JUPA 3Q0VA 1HCRA 2OPTA 4D5FA 1ETKA 3HOXJ 3UKGA 2RAEA 1B8IB 1UHSA 1R9TJ 1GV5A 1SFOJ 3LSJA 3Q3SA 2HYJA 4MFDA 3HOYJ 1IDZA 1SANA 2EZLA 2TCTA 2NS7A 3BR3A 4FISA 1ZK8A 3BTLA 5F0FA 3HOUJ 5IYDJ 2KT0A 2IEKA 4RDUA 5F08A 2CUEA 3MN2A 3BQZA 1HDPA 2L7ZA 1JUMA 5IP9J 5IYCJ 3CMYA 1QRYA 1TC3C 4V2FA 1BL0A 4JX4A 2CRGA 2DA3A 5FKKA 3LSRA 3JRHA 1JJ8C 3HOZJ 1F43A 4I6ZA 3QPSA 1AKHB 1T33A 3HB9A 3RZDJ 5C44J 1IG7A 1BJZA 2I10A 2HI3A 1TWFJ 1B72B 1S7EA 4A3GJ 3JRFA 3M4OJ 3BR0A 4G12A 3IH4A 3O8GA 3LSPA 4AYBN 1FTZA 4V2GA 3C2BA 3TW6A 1ZR2A 1RKTA 2VKVA 2LR8A 3HBLA 1A5JA 4XRSG 2HQ5A 2DMNA 1NK2P 2H1KA 1LE8A 2MSYA 4Y52J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF7 A;  5EYR A;  1W0T A;  4IHV A;  4AUX A;  3JRD A;  4MLO A;  2LK2 A;  1FEX A;  1HLV A;  1H88 C;  3ZQC A;  1U78 A;  3ZQH A;  4DZP A;  3BG5 A;  2XGE A;  2FQ4 A;  3BR2 A;  2EH3 A;  4B1R A;  3WHB A;  2DA7 A;  1ETY A;  4M3G A;  4C3J J;  3K2A A;  5J1R A;  4A3F J;  2R5Z A;  1EF4 A;  1FIP A;  2PMZ N;  2CJJ A;  2EZI A;  4A3J J;  2R92 J;  1JTX A;  2CUF A;  1FTT A;  5IOZ A;  3BG9 A;  1QVT A;  2K9S A;  3SFI A;  4D7N A;  5EGO A;  2JA8 J;  4DYR A;  1I3Q J;  4J19 A;  3GTG J;  3G1O A;  3NAR A;  5J3L A;  3JRI A;  1RR7 A;  3G1M A;  2EQR A;  1ETW A;  1AU7 A;  4A3M J;  2HOS A;  2DA6 A;  1JT6 A;  1P7I A;  1VND A;  3ZOB A;  3HGY A;  4XRS A;  1YRN A;  4M6V A;  2W48 A;  2ID6 A;  2DTZ A;  2DA2 A;  3I4N J;  5EDN A;  3HM5 A;  4I76 A;  5EF6 A;  2LFB A;  4C2M J;  1NTC A;  2DMP A;  2E2J J;  2DA4 A;  2NOG A;  3DCF A;  3I4M J;  4S0H B;  3BQY A;  3S2H J;  5DTD A;  1MSE C;  3PO3 J;  5GPA A;  5F04 A;  2R0Q C;  1ETX A;  3F0C A;  3S1N J;  3B6C A;  3O8H A;  4CYC A;  3GTQ J;  2ID3 A;  5GPC A;  2WAQ N;  1LE8 B;  5K7Z A;  5E3O A;  3CCY A;  2R93 J;  3TP3 A;  4FCY A;  1GUU A;  2LVS A;  1I6H J;  1WH7 A;  3TED A;  2D5V A;  4QIW N;  2HXO A;  3ZQG A;  3FIW A;  5FLM J;  3IV5 A;  1HF0 A;  1JKQ C;  3JRE A;  3S1M J;  3GTJ J;  1LFB A;  3JR9 A;  2YU9 J;  5FKL A;  2XRL A;  4D5C A;  3A01 A;  2AHQ A;  4XID A;  1IJW C;  3GTL J;  5FKM A;  2X48 A;  1MBK A;  2R5Z B;  3RKQ A;  2JA5 J;  2XSD C;  4A3L J;  2GM4 A;  4FE7 A;  2Y31 A;  2Y2Z A;  2E2H J;  3FKI J;  4W97 A;  5C4X J;  3A02 A;  2HOA A;  1OJL A;  1ZKG A;  5EGO B;  1RET A;  2Y9Y A;  3Q0U A;  1FIA A;  1WI3 A;  2DA5 A;  1IDY A;  1ITY A;  1MBH A;  2P81 A;  2QF7 A;  3OSG A;  1MH4 A;  2LLK A;  1FJL A;  2LY9 A;  5JLW A;  4DYC A;  5F0C A;  1JT0 A;  2ECC A;  3L1P A;  3OSF A;  4UUS B;  1JJ6 C;  4HNV A;  1IRZ A;  1QVU A;  4FTH A;  1YRN B;  4DW6 A;  1IUF A;  3G1L A;  4L5E A;  2MW8 A;  2FJ1 A;  3OOU A;  1Q1V A;  3RQI A;  2QCO A;  3GTP J;  5GP9 A;  5IYB J;  1JTY A;  4IHX A;  4A93 J;  2ZB9 A;  3IH2 A;  2ELK A;  3BTI A;  2NVY J;  4A3D J;  4FE4 A;  2NVX J;  3SDG A;  3D1N I;  4M3B A;  2LP0 A;  2M0C A;  1H8A C;  4A3B J;  3CDL A;  1WGX A;  2G0E A;  1ETQ A;  1K83 J;  2DN0 A;  2XGD A;  3E7L A;  3ZQI A;  4CYC B;  2H8R A;  1ETV A;  1OCP A;  5EZH A;  1Y1V J;  4A69 C;  1MBE A;  2IAI A;  3A03 A;  1VF9 A;  4GFB A;  1MH3 A;  1G2H A;  3S2D J;  2JA6 J;  4NDL A;  2VI6 A;  4A3K J;  2FX0 A;  1U9O A;  3S1R J;  1IC8 A;  1A6I A;  2M8G X;  3LNQ A;  1Y1W J;  2YS9 A;  3MVP A;  5C3E J;  3RZO J;  2EZH A;  5IP6 A;  1AHD P;  3HEF A;  3A01 B;  2JN6 A;  1BW6 A;  4QTR A;  9ANT A;  3SJM A;  4X6A J;  2X6O A;  2L7M P;  5BNG A;  1VFC A;  4UUS A;  3JRC A;  5J1U A;  5M5Y J;  1XS9 A;  4ABZ A;  2R5Y B;  3PM1 A;  4IHY A;  1ETO A;  2O9L A;  5EG0 A;  1JKR C;  2NS8 A;  4BKX A;  4DZJ A;  1XC5 A;  2LKX A;  2Y9Z A;  3BTJ A;  1MBG A;  3HOV J;  2LD5 A;  1ORK A;  3OIO A;  2L9R A;  1UG2 A;  1K61 A;  1E3O C;  3S15 J;  2EBI A;  5E3M A;  4MFE A;  3BTC A;  3JRB A;  3BR5 A;  3JRA A;  1ZQ3 P;  1HOM A;  1JGG A;  1RPW A;  5K7H A;  5IPA A;  5K7F A;  4XRM A;  3QQA A;  4B3A A;  4EEF G;  2MG4 A;  1PUF A;  4X1E A;  1HDD C;  5F27 A;  1F36 A;  4IHW A;  2E2I J;  3JRG A;  4B4C A;  3HOW J;  2JMW A;  3GTO J;  1X58 A;  4MO7 A;  5DS9 A;  2ECB A;  2JJ7 A;  2DMQ A;  1I50 J;  4AC0 A;  5F1J A;  3GTK J;  4BBR J;  4RBO A;  1UMQ A;  1JKP C;  1ENH A;  1GV2 A;  4M3D A;  4IEJ A;  3WHC A;  2HOT A;  2K9N A;  3BG3 A;  4A3I J;  1WH5 A;  2GLO A;  3LOC A;  4BY7 J;  1JUS A;  3BR6 A;  2R5Y A;  2JA7 J;  2O7O A;  4M3F A;  2XPU A;  3HDD A;  3H0G J;  1D5Y A;  1MBF A;  4Y7N J;  1BA5 A;  3ZQL A;  3B6A A;  2TRT A;  1BW5 A;  2HXI A;  2CU7 A;  1X2N A;  1TWA J;  1CQT A;  2NVT J;  2L7F P;  2K40 A;  3HGG A;  4BY1 J;  5FLV A;  3GTM J;  2M34 A;  5EEA A;  2ME6 A;  1TWC J;  2EZK A;  3NAU A;  5F0H A;  1TWH J;  2XB5 A;  3CQZ J;  2M2E A;  1QPI A;  2GBY A;  2XB0 X;  4D7M A;  2WV1 A;  5FKN A;  1O4X A;  4W1U A;  5M3M J;  2N8G A;  5FJ8 J;  2E1O A;  1B8I A;  2XPW A;  4C3I J;  3DEW A;  5EG0 B;  5M3F J;  1LFU P;  3S16 J;  1Z0X A;  1RES A;  1U9N A;  1Z77 A;  1XG1 A;  2JK3 A;  5C4J J;  3MKL A;  1X2M A;  2R7Z J;  5IOY A;  4XIC A;  1DU6 A;  4JYK A;  2CQX A;  2FD5 A;  3H3V K;  3K7A J;  2Y30 A;  2ME0 A;  3GBG A;  2KDZ A;  1JKO C;  1GDT A;  2YUS A;  1OCT C;  3TW7 A;  5M5X J;  2VUM J;  5M5W J;  3BT9 A;  1DU0 A;  4A3E J;  1PUF B;  1TWG J;  4QSH A;  5J1Y A;  4DYQ A;  1APL C;  4UUT A;  1POG A;  4JX6 A;  5IP7 J;  3S14 J;  4M3E A;  3FK7 A;  3Q0W A;  1AKH A;  1MBJ A;  1OFC X;  2X9D A;  3S17 J;  4A3C J;  1WCM J;  1B72 A;  4XK4 A;  1W0U A;  3BR1 A;  2M9H A;  2WB1 N;  2CQQ A;  1U8B A;  2VPR A;  4BBS J;  1GT0 C;  2E19 A;  1MNM C;  1GVD A;  3VPR A;  2DA1 A;  3LSG A;  2AO9 A;  2LTP A;  5EZG A;  2VKE A;  1ZR4 A;  5FKO A;  3QPL A;  5E3L A;  2Y0S N;  1WPK A;  4C3H J;  2IBD A;  3W6V A;  3M3Y J;  2DMT A;  2COB A;  3S1Q J;  3FIS A;  1RKW A;  1ZTR A;  1IV6 A;  5HOD A;  2HDD A;  3PO2 J;  3FK6 A;  4LOC A;  1P7J A;  2O8K A;  2NVQ J;  3IH3 A;  4MIM A;  5JLX A;  5E3N A;  2MGQ A;  3TP0 A;  1NK3 P;  2JWT A;  3HKZ N;  1H89 C;  4JX5 A;  2DMU A;  2XPV A;  2K9Q A;  1ZGW A;  3ZQF A;  1T56 A;  2XGC A;  2B63 J;  1IGN A;  1MSF C;  2DJN A;  2L0K A;  4JP0 A;  1VI0 A;  4BXX J;  1JUP A;  3Q0V A;  1HCR A;  2OPT A;  4D5F A;  1ETK A;  3HOX J;  3UKG A;  2RAE A;  1B8I B;  1UHS A;  1R9T J;  1GV5 A;  1SFO J;  3LSJ A;  3Q3S A;  2HYJ A;  4MFD A;  3HOY J;  1IDZ A;  1SAN A;  2EZL A;  2TCT A;  2NS7 A;  3BR3 A;  4FIS A;  1ZK8 A;  3BTL A;  5F0F A;  3HOU J;  5IYD J;  2KT0 A;  2IEK A;  4RDU A;  5F08 A;  2CUE A;  3MN2 A;  3BQZ A;  1HDP A;  2L7Z A;  1JUM A;  5IP9 J;  5IYC J;  3CMY A;  1QRY A;  1TC3 C;  4V2F A;  1BL0 A;  4JX4 A;  2CRG A;  2DA3 A;  5FKK A;  3LSR A;  3JRH A;  1JJ8 C;  3HOZ J;  1F43 A;  4I6Z A;  3QPS A;  1AKH B;  1T33 A;  3HB9 A;  3RZD J;  5C44 J;  1IG7 A;  1BJZ A;  2I10 A;  2HI3 A;  1TWF J;  1B72 B;  1S7E A;  4A3G J;  3JRF A;  3M4O J;  3BR0 A;  4G12 A;  3IH4 A;  3O8G A;  3LSP A;  4AYB N;  1FTZ A;  4V2G A;  3C2B A;  3TW6 A;  1ZR2 A;  1RKT A;  2VKV A;  2LR8 A;  3HBL A;  1A5J A;  4XRS G;  2HQ5 A;  2DMN A;  1NK2 P;  2H1K A;  1LE8 A;  2MSY A;  4Y52 J; 
#chains in the Genus database with same CATH topology
 2OF7 A;  4XOR A;  4IHV A;  5BOX A;  4A5N A;  3JRD A;  3MQ0 A;  2PMU A;  2OTL I;  2DCE A;  3HRU A;  1IXC A;  4HZF A;  4MLO A;  2LK2 A;  4QPO A;  2A5W A;  4M72 A;  4PJL A;  2L02 A;  3BG5 A;  1ZRC A;  1SD4 A;  2FQ4 A;  4KN4 X;  3UNG C;  5J4Y A;  3TL4 X;  3CO6 C;  1P6R A;  4IL6 C;  4B1R A;  2VPL A;  1K6O A;  3PJR A;  2Q1Z B;  4XN0 A;  2DA7 A;  5KAF C;  1T95 A;  1MD0 A;  3OOP A;  4ESF A;  2QLZ A;  3KP4 A;  1FPQ A;  4OU0 A;  4PZJ A;  2L9V A;  2PMZ N;  4Z2Y A;  2X85 A;  4U0Y A;  3ZGK A;  2DOA A;  4OAZ A;  1XN7 A;  3FM3 A;  5H6R A;  2CS3 A;  3BG9 A;  4CCN A;  3DPU A;  4RAZ A;  3OS2 A;  4PGG A;  4PK4 A;  5E1Z B;  2JA8 J;  2V1N A;  2DI3 A;  2DJI A;  4LG3 A;  5FGM A;  1I3Q J;  2JPB A;  3NEU A;  2PLY A;  3G1O A;  5J3L A;  2BHY A;  2HOE A;  2NYX A;  3JRI A;  1ETW A;  5FB2 A;  1AU7 A;  3BWG A;  2YX7 A;  3OS1 A;  4E7K A;  2IGO A;  2DA6 A;  1JT6 A;  2BHZ A;  2OD5 A;  1P7I A;  3ZCO A;  3ZOB A;  5CVR A;  4ZC3 A;  1YRN A;  1EH8 A;  3I0T A;  3MFK A;  2EFN A;  3PFI A;  1O57 A;  3C2H A;  2ID6 A;  3HRM A;  4ZZL A;  2V1U A;  2ZME B;  3HM5 A;  4I76 A;  4HV6 A;  4AU7 A;  4BNC A;  4RB2 C;  2R7U A;  1Z7U A;  1V5F A;  3O6B B;  1T08 B;  2E2J J;  3GFM A;  1LDD A;  4KYW A;  3AL0 B;  1XX5 A;  2K9M A;  1ON1 A;  2MH2 A;  4L5I A;  4NC7 A;  3PNY A;  5D5W B;  4PFP A;  2QSF X;  1TZL A;  3H5N A;  3ROU A;  3V4G A;  1BIA A;  1IN8 A;  4L18 B;  4FCY A;  2EWN A;  2LVS A;  4U88 A;  3TED A;  2D5V A;  2EIN H;  1MND A;  1WJB A;  2JSC A;  5CLS A;  3V7R A;  2ELJ A;  3ZQG A;  1RUN A;  2BYV E;  3IV5 A;  5K5O A;  4BDZ A;  1X1C A;  4L0Y B;  2UXX A;  3P5J A;  3S1M J;  5AIP A;  1I6X A;  3F9K A;  2XKP A;  3CES A;  3HOS A;  2YU9 J;  3RIR A;  4D5C A;  3CTA A;  5GAG J;  2VJJ A;  3DBL B;  4I7H A;  2P8T A;  5FKM A;  2GXA A;  1TW3 A;  4Q48 A;  2XKO A;  4BGD A;  4A3L J;  4YFK F;  2XSD C;  2GM4 A;  4FE7 A;  1XSX A;  2Y31 A;  5ILU A;  3K70 C;  1RC9 A;  2P7V B;  5JHU A;  5C4X J;  2L54 A;  2E34 A;  3G6E I;  3A02 A;  5L3E A;  4ZTF A;  2L3D A;  4IRH A;  3WG7 H;  3MD2 A;  2GAU A;  4PJM A;  1AWC A;  3Q0U A;  1FIA A;  4RM3 A;  1HC8 A;  2KQR A;  3F8B A;  4R79 A;  4RMN A;  1FT9 A;  5JI6 A;  2P81 A;  3FXO A;  1L3L A;  2LSO A;  2LY9 A;  2WBM A;  1D3Y A;  2ECC A;  2NXN B;  1D8J A;  1ZGA A;  2DFF A;  1QVU A;  3K69 A;  2M0M A;  2R7F A;  2V9P A;  1YRN B;  1EA3 A;  3E6B A;  1IUF A;  3HOT A;  3VWB A;  3G1L A;  3IP4 B;  4GGG A;  2BY3 A;  2MAB A;  4CCO A;  1QO0 D;  1Q1V A;  4PJ0 C;  2QCO A;  4C9Y A;  3GTP J;  5GTH C;  3IKT A;  3E5Q A;  3TMO A;  2WB1 A;  3GZN B;  1KU9 A;  2DOD A;  1H0M A;  3OYI A;  4P9F A;  3DTI A;  3SDG A;  2MBF A;  1O3S A;  1CGP A;  1YJN I;  1H8A C;  3OIP A;  4A3B J;  3CDL A;  2K5C A;  2M7B A;  2E60 A;  1JXS A;  5BPI A;  1R5I D;  5EZH A;  2J5O A;  4E7L A;  2ESH A;  1VF9 A;  1OYI A;  3WTX C;  4GFB A;  3CCV I;  2XF6 A;  1MJB A;  4G6D A;  3QRF F;  4XLP F;  2K27 A;  2VI6 A;  4YEL A;  2RV8 A;  2FSW A;  4IRG A;  2KIQ A;  1VZ0 A;  2FX0 A;  2KRC A;  2XVC A;  1F4K A;  5D5X B;  3PQK A;  2AXL A;  2P5K A;  3S93 A;  2IVM A;  1U5T C;  3DV8 A;  5A2Q Z;  5BMZ A;  1T0F C;  3I59 A;  3HEF A;  5ERI A;  4QTR A;  3ZMZ A;  1WHU A;  2RQP A;  4QLC U;  4EJT A;  3LQQ A;  5BNG A;  4UVA A;  1VFC A;  2HDC A;  1QU3 A;  4FAS D;  5M5Y J;  1XS9 A;  4LLG F;  4ABZ A;  3PSI A;  3G2B A;  1O3R A;  2W1O A;  4NQW B;  3I64 A;  1EV7 A;  2XAU A;  3FDY A;  5KAI C;  3E5X A;  3R61 A;  1FWZ A;  4G7O F;  2QWW A;  4ENK A;  2IS4 A;  3DKW A;  1I3A A;  2KDO A;  2JRT A;  3OYB A;  3EYI A;  2I8D A;  5BS6 A;  1XC5 A;  3W6J B;  1MBG A;  3PUF A;  3CCE I;  5JVG F;  1DQU A;  2VQH A;  2D2W A;  2DYR H;  3VOE A;  1ZQ3 P;  3WTU C;  3ESW B;  1HOM A;  1ZAO A;  1ZLK A;  2BOL A;  1RPW A;  2IW5 A;  5HDG A;  1IF1 A;  4ZJZ A;  4HEA 2;  2QSH X;  3EYY A;  3K6G A;  2K4J A;  2DK8 A;  1RUO A;  2JZY A;  1UCR A;  3CJN A;  3A1Y A;  2RDP A;  4CCK A;  3M8E A;  5LRR A;  5CPR B;  4MO7 A;  1T38 A;  5CVU A;  4AC0 A;  2NVU B;  3DBR B;  5F1J A;  1FLI A;  1FSH A;  1UMQ A;  2XIG A;  1GV2 A;  2A05 A;  2DT6 A;  3LOC A;  3E97 A;  2HYF A;  4LLN A;  1JUS A;  4ZYD A;  3BCB A;  3S3M A;  2L9N A;  3QU3 A;  2IJL A;  2MA3 A;  2P6S A;  3QPT A;  3H0G J;  1R4N B;  2FNA A;  1D5Y A;  1MBF A;  3REO A;  4DIQ A;  2RKH A;  2EFQ A;  2HZD A;  3DEE A;  2ZME C;  3ZN0 A;  3CUO A;  3ZQL A;  4G8X A;  1BW5 A;  2M7A A;  3HXL A;  3I59 B;  2UXN A;  3J81 K;  4HRI A;  1X2N A;  4NC8 A;  1P92 A;  1CQT A;  3N4M A;  2L7F P;  3AL0 C;  4GO1 A;  4Y17 A;  5DM7 F;  3RJP A;  2M3A A;  2BW3 B;  2M34 A;  2ME6 A;  2QQ8 A;  2DDA A;  5E18 F;  2P5V A;  1XCV A;  2E7X A;  1K78 B;  2CW8 A;  2BXZ A;  3DPT A;  5FJ8 J;  1FOK A;  3DTK A;  1SFK A;  3GUD A;  3WTZ A;  5GAD J;  2XPW A;  3DEW A;  1MW7 A;  2X1E A;  5DCM A;  5LHH A;  1MMS A;  1RNL A;  1G59 A;  4RGU A;  1XG1 A;  3MKL A;  2K02 A;  4CZZ A;  2CV0 A;  3LSM A;  3OWT A;  5IOY A;  2CQX A;  2FD5 A;  2Y0S A;  1Q1H A;  2QVO A;  2LC2 A;  2Y30 A;  2FQ3 A;  1STZ A;  1YX5 A;  1Z21 A;  3GBG A;  2A3S A;  4L0Z B;  3VDX A;  2EK5 A;  4NNJ A;  2DDB A;  4ZDO A;  5E1X A;  4RLQ A;  3K1M A;  2X0L A;  3BT9 A;  1E17 A;  1OYY A;  2GWR A;  2HPI A;  1TT5 B;  4MEX F;  4JX6 A;  4BAC A;  2GIV A;  1FZP B;  3S14 J;  2X51 A;  3FK7 A;  2HYG D;  2X6Y A;  2VAS A;  1X1B A;  5H20 A;  2G7H A;  3FXM A;  3MZ8 A;  4TV7 A;  4QWQ A;  3AKZ A;  3T1B A;  3L9F A;  3VSL A;  2X9D A;  3S17 J;  3TDU C;  1ULY A;  4IX7 A;  2KHM A;  1P4A A;  2PX9 A;  3BR1 A;  4UB6 C;  2CQQ A;  3QYE A;  1GT0 C;  2E19 A;  1MNM C;  1EJ9 A;  3VPR A;  2ETH A;  1BI2 A;  5HNF A;  3ABK H;  1UG0 A;  4NB5 A;  2Y0S N;  1WPK A;  3NWT A;  3BOQ A;  5HLT A;  3W6V A;  3S1Q J;  3SXY A;  1SVO A;  3KX2 A;  4HDU A;  1NG7 A;  1ZTR A;  1W7P A;  3HUG A;  5L3B A;  1OCR H;  3B02 A;  2NVQ J;  2HEO A;  2WC2 A;  3RTR A;  3SQN A;  4MTE A;  4BQN A;  2A6H F;  2O61 A;  2LRD A;  3G3Z A;  3COA C;  2H6C A;  3RPU A;  1H89 C;  1B6A A;  4JX5 A;  4ENN A;  2PI0 A;  2XPV A;  2K9Q A;  4KIT B;  1S8N A;  2HQA A;  3BZK A;  1IGN A;  4BXX J;  2DJN A;  1VI0 A;  4AWX B;  3Q0V A;  2OPT A;  2W84 A;  3UKG A;  2RAE A;  4B43 A;  4PGH A;  2FEZ A;  2GQQ A;  1J7K A;  5DCM B;  1G3W A;  2HKX A;  5HVQ C;  4BQA A;  3H36 A;  2AQE A;  4MFD A;  2NRA C;  1TL8 A;  1XB4 A;  2NS7 A;  4DNC A;  1X19 A;  1ZK8 A;  2ZCW A;  5DD4 A;  3AG2 H;  2GZW A;  3C1D A;  5F0F A;  4KUM A;  5JR3 A;  3IRR A;  3JCU C;  4RDU A;  3WGH A;  2D1H A;  1MGT A;  4NBQ A;  2UUZ A;  2EFO A;  2JT1 A;  2L7Z A;  3M07 A;  3VYS B;  1TC3 C;  1EKE A;  1FSE A;  1SMT A;  2CWE A;  4F92 B;  3LSR A;  2BE5 F;  4A2U A;  1OPC A;  4DJA A;  5TIS C;  2E1N A;  2OJE D;  3CP8 A;  2BY1 A;  3TDZ C;  4EJW A;  5D5U B;  1HBX G;  1DGW Y;  4RGS A;  4ZTJ A;  3SZG A;  1T33 A;  3CCS I;  4IKF A;  1IG7 A;  3QOE A;  2HI3 A;  4LLL A;  3OYH A;  4GYG A;  2ZFU A;  1S7E A;  4WXH A;  1FYM A;  5F6F A;  1KYW A;  3TOA A;  4ZZD A;  3ABL H;  2MLG A;  3M4O J;  1OIS A;  4YEJ A;  2V6C A;  2QBY A;  1FTZ A;  2UV1 A;  2VXZ A;  2VKH A;  4V2G A;  1MMG A;  3GLX A;  1SD5 A;  3FBI B;  5DCF A;  3T8R A;  4AIH A;  1VTN C;  1W7P D;  3Q5F A;  4ITV A;  2M30 A;  3WOD F;  4N9H A;  4HQE A;  1ZRD A;  1W7P B;  3HUG B;  4XRS G;  4BHC A;  3A2K A;  3QP6 A;  4BQO A;  4WX9 A;  3RPU D;  3J80 Z;  3C2G A;  3K4L A;  3ELK A;  1U9O A;  5ICE A;  3QWL A;  3F72 A;  1W0T A;  1BR1 A;  3MMY B;  2RRE A;  2KZG A;  2W4S A;  4BHB A;  4JK1 X;  4B47 A;  3QAH A;  3ZXS A;  1Y6I A;  2ZSH B;  5FD6 A;  1H88 C;  1F5T A;  2PN6 A;  4Y33 A;  3DEU A;  3ZQH A;  2LG4 A;  4GRI A;  2O5R A;  4ESB A;  3KZZ A;  2HS5 A;  1QPM A;  4I2O A;  1J75 A;  3BRO A;  2PMH A;  4HNT A;  3WHB A;  1I27 A;  3BCA A;  4LK1 F;  4O3M A;  3ABU A;  4ZH4 F;  1ETY A;  4RA2 A;  3R0A A;  3LAJ A;  4EGZ A;  3C3W A;  3FWE A;  1K7A A;  1N78 A;  2LNB A;  1ODD A;  2QQ9 A;  3ABT A;  4YIR X;  2CUF A;  3WE2 A;  3Q9S A;  5DDG A;  3I58 A;  2OCE A;  3WU1 B;  2LOO A;  2PEX A;  1QVT A;  1U5T A;  2K9S A;  4KIC A;  1Z3X A;  4XRF A;  4DYR A;  3CP2 A;  3ZMD A;  1O7F A;  4J19 A;  4I01 A;  3AFH A;  2XF5 A;  3EUA A;  3W6K B;  1RR7 A;  3G1M A;  3LSK A;  1A04 A;  3HYI A;  1QHH D;  1HW2 A;  4CH7 A;  4XKB A;  4CCJ A;  2G9W A;  2F5V A;  4UNO A;  1D5V A;  4M6X A;  1WQ2 A;  2KP6 A;  3HGY A;  5B5E C;  5BPD A;  3EDP A;  2W48 A;  3CMM A;  2EFP A;  2Q8K A;  3ZRG A;  2XV4 S;  2LKS A;  3CJR B;  4CGZ A;  3KLN A;  4C2M J;  2VBZ A;  1U3E M;  4E6K G;  1NTC A;  2QBY B;  4EQQ A;  2Y0M A;  4S0H B;  2CFX A;  3S2H J;  3PO3 J;  1WSU A;  5GPA A;  4LIV A;  5F04 A;  2R0Q C;  4UV8 A;  1HW1 A;  5DV5 A;  3S1N J;  2JVG A;  1Z1D A;  3B6C A;  3ONQ A;  3FXL A;  1SD7 A;  4KT5 C;  2DPD A;  3GTQ J;  1W1W E;  3CCY A;  3FXQ A;  1GHC A;  4A6E A;  4G7Z F;  1GUU A;  1I1G A;  2A5Y B;  3GW2 A;  3FIW A;  5ILS A;  2ZXH A;  5LD2 C;  1YFH A;  4HSR A;  4GXO A;  1LFB A;  2OAZ A;  4HV5 A;  1X1A A;  5E8I A;  2EA4 A;  3A01 A;  5ICC A;  4XID A;  1IJW C;  3FKJ A;  3GTL J;  4JQF A;  1Y8R B;  2X48 A;  3RKQ A;  1TBX A;  3NQO A;  2Y2Z A;  3KZY A;  2E2H J;  1ZLJ A;  1YOV B;  2JRM A;  4UVB A;  3I4P A;  2LRE A;  1LUJ B;  2HOA A;  3E6C C;  2V9K A;  3KP7 A;  4KA4 A;  3E6D A;  1F1Z A;  1QGP A;  1XTA A;  3C18 A;  2Z33 A;  3K4J A;  2HNH A;  4EGY A;  1MBH A;  3OSG A;  1N25 A;  5B1B H;  2LLK A;  3JSP A;  4AVZ A;  3D5R C;  5F0C A;  3L1P A;  1JT0 A;  1JJ6 C;  4UUS B;  2VE8 A;  1A36 A;  3GCM A;  1FNN A;  4DW6 A;  1I5Z A;  1G4D A;  1XD7 A;  5LFA A;  3CC4 I;  4L5E A;  1P4X A;  3QYB A;  3OOU A;  4UB8 C;  4AIK A;  5GP9 A;  1IN4 A;  5IYB J;  3ZMU A;  3FMS A;  3CCM I;  5CKT A;  2ZB9 A;  3IH2 A;  3GZ6 A;  1KQ9 A;  4FE4 A;  5LGN A;  4A5M A;  3L2C A;  2XAJ A;  1Y39 A;  2I5U A;  5J8C A;  4BH9 A;  2KKO A;  2MC4 A;  4HYE A;  1UHW A;  2H8W A;  2XGD A;  3GXO A;  3BPX A;  5LLQ A;  1OCP A;  3V8J A;  4HF1 A;  3EUH A;  1BM9 A;  3E6M A;  1MBE A;  3DBH B;  4LB6 B;  4DBQ A;  1G2H A;  3S2D J;  4CDG A;  2JA6 J;  2ZXI A;  2DQL A;  2W82 A;  2HR3 A;  5JVT A;  3S1R J;  3OYK A;  5IT9 K;  3JW4 A;  5KCM A;  1VQO I;  3CZ6 A;  5AIQ A;  2YS9 A;  3MVP A;  1T8I A;  2V6E A;  2V9V A;  3F6O A;  1OYW A;  1IRX A;  5IP6 A;  3A01 B;  3KYL A;  2LBF A;  1VQM I;  2DFI A;  4X6A J;  2L7M P;  2K7L A;  2G7U A;  2F4O B;  1PDN C;  4LIU A;  3PM1 A;  2VXD A;  2XAH A;  4HBL A;  4ON0 A;  1J59 A;  1LVK A;  3F6V A;  1ETO A;  3BLY A;  1R58 A;  5EG0 A;  5LEJ A;  4B48 A;  2JVH A;  2KJB A;  2NS8 A;  3OYG A;  3W2V A;  3DU6 A;  2KIS A;  2LF7 A;  1WZ2 A;  1LFP A;  2LD5 A;  1GVJ A;  2XAQ A;  1ORK A;  1WJA A;  4BJT A;  2DO7 A;  3OIO A;  3ERM A;  5KNL A;  1K61 A;  1E3O C;  1UJ8 A;  1P9Q C;  2VC1 A;  3DF8 A;  4Y13 A;  1P4W A;  5CJ9 A;  3G4S I;  5E3M A;  2IS6 A;  2A69 F;  2ICW G;  1MJ9 A;  4UXN A;  3V7C A;  4G9Y A;  5K7H A;  3FX3 A;  5K7F A;  1ZYR F;  5AON A;  4B3A A;  3OS0 A;  3LFK A;  1ZG5 A;  4EEF G;  1E0E A;  2QKM B;  1RIO H;  2GOM A;  1Y0N A;  2TDX A;  2F4I A;  4X1E A;  2M4K A;  3TO6 A;  5CQE A;  4B4C A;  3WTT C;  4ETS A;  2L9S A;  3FZV A;  3GTO J;  4HX4 A;  2DMQ A;  4B3X A;  4P1W A;  3GTK J;  4BBR J;  2HOT A;  4IEJ A;  3MKZ A;  1YIO A;  2H1L A;  3H35 A;  1XMK A;  4CUG A;  5CVI A;  4BY7 J;  3MCZ A;  5DUK A;  2P5L C;  2YX4 A;  1BOA A;  2RNJ A;  1MIJ A;  3BR6 A;  4NQW A;  4PCQ A;  2ZSI B;  3L2V A;  2XPU A;  4IOA F;  2QZ8 A;  4CA0 A;  2ZNZ A;  3BJO A;  4Y7N J;  1WJE A;  3F8M A;  4IVN A;  1XMX A;  5B3S H;  1K4T A;  2TRT A;  2O3F A;  3HL2 A;  2HXI A;  4KJZ A;  2VON A;  1A35 A;  2LBF B;  2L2O A;  3TO7 A;  4A6D A;  5J4V A;  3GTM J;  5EEA A;  2IRF G;  1TWC J;  2EZK A;  2Q2E A;  3CQZ J;  4AIJ A;  2GBY A;  2FBK A;  3G71 I;  4R1H A;  2K85 A;  4D7M A;  2BEO A;  2WV1 A;  5FKN A;  2E1O A;  5EG0 B;  1VQP I;  4I98 B;  4JOM A;  1LFU P;  4KMU X;  1Z0X A;  1RES A;  2DT7 B;  3K0L A;  4G94 A;  1W36 D;  2ZC2 A;  1KON A;  3GME A;  5C4J J;  4OIN F;  1DU6 A;  1QZZ A;  4XON A;  4QPQ A;  1LNW A;  4LG0 A;  1BIB A;  5ICF A;  2CQ7 A;  2RC4 A;  3DKX A;  1JKO C;  3R6S A;  3GX4 X;  2O8X A;  3CCU I;  4I99 C;  1OCT C;  1G8X A;  5BQT A;  2VUM J;  1AOY A;  4EJV A;  4XSX F;  1QHG A;  2P4W A;  2DW4 A;  5J1Y A;  2HQN A;  1Y56 A;  1ZG3 A;  4UUT A;  1POG A;  5IP7 J;  1VQK I;  4HF0 A;  4M3E A;  3Q0W A;  3CF5 F;  4BE2 A;  1S3J A;  1X4P A;  1W5C C;  3QPH A;  1LDJ A;  2HZT A;  1ZG1 A;  2FOK A;  3SEZ A;  2BW3 A;  4XK4 A;  3LAP A;  2WB1 N;  1SAU A;  1BC7 C;  1FBS A;  4BBS J;  1ON2 A;  2WAE A;  1K78 A;  3DXJ F;  2BVL A;  2VKE A;  1ZR4 A;  3AG1 H;  5FKO A;  3QPL A;  1FY7 A;  1WKM A;  3M9A A;  4XLF A;  3S8P A;  3BC8 A;  4C3H J;  3L09 A;  3KE2 A;  4BU2 A;  3PIO F;  1TTY A;  1V3F A;  1X3W B;  2QGU A;  3WGG A;  1Y0U A;  3DLL F;  3F21 A;  3H3U A;  1P7J A;  4LFU A;  2R7S A;  3IH3 A;  2K9L A;  3SHF A;  3GWZ A;  1AA7 A;  3CCQ I;  3FXR A;  3I55 I;  4BE0 A;  2Q2E B;  2V79 A;  2ESN A;  1EH6 A;  1D1C A;  1P2F A;  2E1M B;  3LFU A;  3ZQF A;  1ZGW A;  3VB2 A;  3WTV C;  4JP0 A;  1HCR A;  4D5F A;  3HOX J;  5B66 C;  4C30 A;  5FO5 A;  1VQN I;  3K4B A;  4G6T B;  1UHS A;  4WCG A;  2CW0 F;  2XSJ C;  1R9T J;  3SYT A;  3TKY A;  1GV5 A;  5ICG A;  1SFO J;  2AS5 F;  5IT9 Z;  3H5A A;  3Q3S A;  4LJZ F;  3HOY J;  4RS8 A;  3GFJ A;  2LY2 A;  1SFU A;  3JSO A;  4BUP A;  3J80 K;  3I53 A;  2O6G E;  3M8J A;  1FMW A;  3BR3 A;  3S2W A;  1IN6 A;  4LG0 B;  1FC3 A;  3SEQ A;  2IEK A;  4RGX A;  2CUE A;  1ERD A;  5F64 A;  4KIB A;  2IGK A;  2HVS A;  3CMY A;  2MD0 A;  3OR1 C;  2CGP A;  1JJ8 C;  3HOZ J;  4B09 A;  1Z05 A;  5JHF A;  5EJC A;  1I1S A;  1FOW A;  2KPM A;  4OAY A;  4E70 A;  1U8R A;  3HB9 A;  2PJP A;  3RZD J;  1SAX A;  3C7J A;  2I10 A;  3OR2 C;  3U9G A;  1T2K A;  4KMF A;  5D8K B;  1K6Y A;  1S6L A;  4DGW B;  2BXY A;  2MC3 A;  3JRF A;  2O03 A;  4IXA A;  3BR0 A;  2Z2S B;  5LRS A;  5DYM A;  2L01 A;  2R7Q A;  1PP7 U;  3TW6 A;  1E2X A;  1ZR2 A;  4ENJ A;  3L2Q A;  1RKT A;  1X1P A;  3ECO A;  2LR8 A;  4XOT A;  4G6Q A;  4BAY A;  1O7L A;  4E7S A;  1B1B A;  3U2R A;  3D5L A;  3P9K A;  1RI7 A;  4P55 A;  3I56 I;  2VQL A;  2VT3 A;  5EYR A;  3R4K A;  1YW7 A;  3DPL C;  4EM0 B;  1LB2 A;  2HDW A;  1QA6 A;  5LBQ A;  3L7W A;  1DGR M;  4A0Z A;  2WY7 Q;  1FEX A;  1S29 A;  3ZQC A;  1LVA A;  3EUH C;  1U78 A;  2W85 A;  4IZZ A;  3P9I A;  2B0L A;  2X4H A;  2PQ8 A;  4DZP A;  2XGE A;  2XRN A;  4H4K C;  3BR2 A;  1D1B A;  2EH3 A;  3W2A A;  2M4G A;  2EB7 A;  1RRJ A;  5J40 A;  3IL2 A;  4C3J J;  3K4N A;  5J1R A;  4A3F J;  2R5Z A;  1EF4 A;  1KGS A;  3J7A Y;  2CJJ A;  2EZI A;  4A3J J;  4U7B A;  2R92 J;  4FET A;  1JTX A;  5E79 C;  5L3C A;  3WGI A;  5IOZ A;  5IY5 H;  4D7N A;  5EGO A;  1IRF A;  2XAF A;  3GTG J;  2KZV A;  1LKX A;  3NAR A;  4XLA A;  2CQN A;  4GCV A;  1WJC A;  3M1E A;  2Z3Y A;  3D5S C;  5HOO A;  4PFO A;  2MLK A;  2HOS A;  3HG9 A;  1A6Q A;  3GO5 A;  2H27 A;  2IGN A;  4XRS A;  1YIJ I;  4P5O A;  1X4O A;  1MDM A;  2WAF A;  3T5X A;  1W36 C;  3MAJ A;  2DA2 A;  3I71 A;  2QYO A;  2JUC A;  5EDN A;  1S7O A;  1D0X A;  5HS7 A;  4PJN A;  1H9T A;  2LFB A;  3RI4 A;  1IN7 A;  2DA4 A;  2NOG A;  3DCF A;  1E3H A;  3BQY A;  3RKY A;  2K86 A;  5DTD A;  1ZHF A;  4IO9 F;  1ETX A;  3F0C A;  3EPZ A;  3VEP A;  5FRN A;  3HSE A;  3O3K A;  3QOP A;  1SEU A;  3E5U A;  3HRT A;  4LMY A;  3HSR A;  1Z3Y A;  1DPR A;  5CQG A;  2R7T A;  2JA2 A;  3E1S A;  1MJA A;  2R93 J;  1OQY A;  1I6H J;  1YYV A;  2VQC A;  1WH7 A;  2KFD A;  4BE1 A;  2EA2 A;  4QIW N;  4AVP A;  2GA1 A;  2HXO A;  3CMA I;  1T6S A;  2DPU A;  1TT0 A;  4HOB A;  4YII A;  2EJR A;  4C2U A;  1S5L C;  2RGV A;  1JKQ C;  1YJ9 I;  5KHD A;  4M6Y A;  3K4C A;  4JBA A;  4B8X A;  3U21 A;  2ZKZ A;  1Z6T A;  3LMM A;  1D0Y A;  2XRL A;  3KP6 A;  3Q9V A;  4OIR F;  1S72 I;  5E8G A;  2OUM A;  2VJI A;  3RSN A;  1FBU A;  1IAW A;  1MMN A;  1ZAR A;  2WA0 A;  3NWS A;  2R5Z B;  4F52 A;  2DU9 A;  3GLL A;  1RZ4 A;  3FKI J;  4M73 A;  4A0Y A;  4W97 A;  2DLL A;  3JTG A;  3VOD A;  3SZP A;  1FP1 D;  1B9N A;  4CXF A;  1W5T A;  1LEA A;  1ZKG A;  2VBX A;  4XLH A;  2OC6 A;  4KIF A;  3L2W A;  5EGO B;  1RET A;  2OA4 A;  5J47 A;  2VOO A;  2DFE A;  5LGU A;  1V5G A;  2E1M C;  4HST A;  2FA5 A;  4HW0 A;  3TOB A;  1ITY A;  2QF7 A;  1FJL A;  1R71 A;  3IAS 2;  3AG4 H;  5JLW A;  1J2X A;  3OSF A;  2R4G A;  4HNV A;  1U6G A;  2GOX B;  1IRZ A;  2DOE A;  1R22 A;  4EJO A;  1MDM B;  3B73 A;  1WFX A;  5HDK A;  3RKW A;  3EET A;  1D0Z A;  4EM1 A;  3LQR A;  3CCL I;  2A6T A;  3TO9 A;  4LK0 F;  2Y48 A;  2QM3 A;  1QBJ A;  1XDS A;  1WJ5 A;  2JQ7 A;  1X1D A;  1FX7 A;  3L2U A;  2NVY J;  4A3D J;  1LPQ A;  3GF2 A;  3M1C A;  2NVX J;  3HTU A;  2R7R A;  3HSF A;  4M3B A;  2VE9 A;  4D1Q A;  1WGX A;  2EPF A;  2H8R A;  3E7L A;  4L9V A;  4OMZ A;  2OTJ I;  4V19 K;  1ETV A;  1I39 A;  3P7N A;  1XGN A;  1Y1V J;  2HGC A;  4M71 A;  3F8C A;  2IT0 A;  3OL3 A;  1YX3 A;  2JUG A;  2RN7 A;  2R7V A;  3TBI A;  1UST A;  2F5E A;  1M1E B;  4PSX A;  2GA2 A;  3WU0 A;  3CME I;  3BP8 A;  1IC8 A;  2M1B A;  2B9S A;  1GXP A;  2M8G X;  3HRS A;  2CG4 A;  3RKX A;  2X6X A;  5C3E J;  2EV0 A;  1AHD P;  4XMY A;  2JN6 A;  3HIF A;  1BW6 A;  3V8K A;  2W57 A;  2QQB A;  3DP7 A;  2FF4 A;  2X6O A;  3E3V A;  4U87 A;  4UUS A;  3K1P A;  3JRC A;  5J1U A;  2Z1D A;  3BJA A;  2R5Y B;  2CQK A;  1S7A A;  2FNP A;  4UY8 I;  3CDH A;  2W7N A;  3K9T A;  3IKV A;  3FMQ A;  2QUF A;  1Z91 A;  2FE3 A;  1BOB A;  4L5J A;  1XMA A;  3X2Q H;  4DZJ A;  2WWY A;  3H9G A;  4ZYE A;  1DP7 P;  4U0V A;  4XR6 A;  2CV1 A;  3HOV J;  4BDY A;  2L9R A;  4U0W A;  4L9N A;  1VQ5 I;  2OU2 A;  2HFH A;  3MWM A;  3F8F A;  4FX4 A;  2KRF A;  3MZY A;  3BTC A;  3JRB A;  3JRA A;  2HPM A;  4Z6Y A;  5FRM A;  4MEY F;  2P6T A;  1Z67 A;  4ANJ A;  4YRV A;  3GYH X;  1JGG A;  3MEX A;  5IPA A;  3FXK A;  3QQA A;  2MD5 A;  4M74 A;  4Y3O A;  2ZJQ F;  3FMR A;  2MG4 A;  2F5D A;  2CYY A;  4AM3 A;  4XL9 A;  1HQC A;  5F27 A;  1F36 A;  3PNV A;  3V8L A;  2E2I J;  3JRG A;  4Y15 A;  2ISY A;  1X58 A;  5DS9 A;  2ECB A;  2ZJR F;  2X6W A;  2Y75 A;  1OR7 A;  2LMD A;  1YIT I;  5FFZ A;  1C0W A;  4RBO A;  4AYB A;  1JKP C;  1ENH A;  3HZJ A;  3HJE A;  3WHC A;  3DFG A;  4EAT A;  2K9N A;  3BG3 A;  1WH5 A;  2VKD A;  3FHN A;  4E7H A;  4CIC A;  4EJU A;  6PAX A;  4NC6 A;  5TGT A;  1L0O C;  3GZ5 A;  3W3C A;  4XKW A;  2WY8 Q;  4M3F A;  4OIO F;  4DQ2 A;  1MZB A;  3AG3 H;  1V5E A;  3PUB A;  2F2E A;  2F48 A;  2FOW A;  5K5Q A;  1R23 A;  1XSV A;  1J0R A;  1TNS A;  4R8H A;  1R5H A;  2CU7 A;  1YTY A;  3CLQ A;  1U0J A;  2CUZ A;  1GXQ A;  4M9Z A;  1TWA J;  1ZRF A;  2NVT J;  3CUQ A;  2K40 A;  3KYC B;  3PSF A;  4BY1 J;  4EV0 A;  5FLV A;  3ECH A;  3KEQ A;  1YLF A;  5F0H A;  1XSD A;  1TWH J;  1WJF A;  2XB5 A;  5IT3 A;  1K4S A;  4U7D A;  3G73 A;  1HST A;  1B4A A;  3JAM Z;  3M8F A;  3OYD A;  1YI2 I;  2PMZ A;  4O5V A;  5M3M J;  1V55 H;  2N8G A;  3N97 A;  3WG9 A;  2PJR A;  1JHH A;  4C3I J;  5M3F J;  2ADU A;  4XLE A;  2F4M B;  1LJ9 A;  5J6X A;  1U9N A;  4Q47 A;  3FXJ A;  2XC7 A;  2JK3 A;  1TQP A;  2OBP A;  3ZQ7 A;  4FQG A;  2PBI A;  5HNH A;  2YU3 A;  4MNU A;  1G3T A;  2IA1 A;  1OCO H;  3H3V K;  5ED4 A;  1SFE A;  3VSK A;  2ME0 A;  4XNF A;  1KU7 A;  2VN2 A;  1MNE A;  3BY6 A;  1WJD A;  1IXS B;  4II2 A;  4ESJ A;  2YUS A;  2RVC A;  1GDT A;  1R4M B;  2A61 A;  1IW7 F;  1MMD A;  2VIX A;  3DWL E;  5M5X J;  5M5W J;  5L3G A;  1DU0 A;  3WE3 A;  4A3E J;  1ACI A;  2EIK H;  2VLA A;  1FP2 A;  2ZFW A;  3HKZ A;  3OMY A;  1APL C;  5J8F A;  4I0A A;  4L9J A;  2WV0 A;  4F91 B;  1FBQ A;  5TRD A;  2DFH A;  1MBJ A;  4CYD A;  4FX0 A;  1B59 A;  1IUY A;  2FBH A;  1OFC X;  1S9H A;  2IXS A;  1WWX A;  4ZDL A;  3IRQ A;  4A3C J;  2STT A;  4II3 A;  3RYP A;  3F3X A;  2DXI A;  2M9H A;  1BBY A;  1U8B A;  3NRV A;  3LST A;  4BHP A;  4KIS A;  1MMA A;  5CVV A;  5D5V B;  2KIM A;  2KJC A;  2DA1 A;  5LHI A;  1T98 A;  3P9C A;  4IQJ A;  5FD5 A;  1BI0 A;  1H9G A;  5E3L A;  5TJJ A;  3GFL A;  2E5N A;  2IBD A;  1BR2 A;  4WXC A;  5GAE J;  2QEX I;  3M3Y J;  1WRJ A;  2DQR A;  2HU9 A;  3BJ6 A;  1PP8 F;  3FIS A;  2E35 A;  1IV6 A;  2HDD A;  4UUV A;  1BI1 A;  5K1Y A;  1OMI A;  3CUQ B;  2K3P A;  2M45 A;  4BJ6 C;  5JLX A;  3N05 A;  3TP0 A;  1NK3 P;  2JWT A;  3HKZ N;  1BJA A;  1MKM A;  2V1D A;  3DLA A;  2VBY A;  1XGO A;  2HQR A;  1BI3 A;  2B63 J;  2H94 A;  1YG2 A;  2L0K A;  4ZDP A;  5LGT A;  5JFR A;  1R49 A;  1JUP A;  1YO5 C;  1NG6 A;  2IGM A;  4NHJ A;  1ETK A;  5E20 A;  2R7X A;  3K4K A;  2M8E A;  2PJR B;  2MYS A;  3JTH A;  2XHK A;  1VQ8 I;  3LSJ A;  4KDP A;  3LWF A;  4N9I A;  2HYJ A;  3WTS C;  1CF7 A;  5HS9 A;  1IDZ A;  1VQ9 I;  2QKL B;  5FLX K;  1SAN A;  4EM2 A;  1KYZ A;  3TGN A;  1DUX C;  4N4N B;  3H9J A;  3K10 A;  3SFZ A;  4IHT A;  3ABM H;  1G6N A;  5F08 A;  3U1D A;  4OIP F;  1QZY A;  2HWV A;  3BQZ A;  1FYK A;  1HDP A;  4PJJ A;  1JUM A;  2IPQ X;  3I54 A;  3KP3 A;  4V2F A;  2WAD A;  1R36 A;  4I02 A;  1BL0 A;  4JX4 A;  2CRG A;  2DA3 A;  2D1V A;  5F1R A;  3J7Z I;  2Z5U A;  4HX8 A;  1F43 A;  3BG7 A;  4I6Z A;  3QPS A;  4H0E A;  4F55 A;  3IWF A;  5D8L B;  3KYD B;  4RLF A;  2C6Y A;  3T8T A;  1EH7 A;  3H1C A;  3KPH A;  2VB6 A;  2L4A A;  4AID A;  1O3T A;  2FRH A;  2STW A;  1ZN2 A;  4A3G J;  1UEL B;  5EEG A;  3IUO A;  1ZEL A;  3LA2 A;  4BL0 B;  2W25 A;  2DK5 A;  1R6R A;  5B1A H;  2IA0 A;  3O8G A;  3W2W A;  1YW8 A;  4OWR B;  4CO8 A;  2KMU A;  3C2B A;  4KNY A;  2LDU A;  2VKV A;  2FBI A;  3LA3 A;  3T0Y A;  1A5J A;  1SMY F;  1TLH B;  4HG2 A;  2HQ5 A;  2Z16 A;  4I0B A;  2DMN A;  1LE8 A;  2A68 F;  3H5R A;  3IAM 2;  4RAF A;  1KU3 A;  3PNT A;  2CFO A;  1Y8Q B;  4AUX A;  2ZJP F;  4CCM A;  1SD6 A;  2YR2 A;  2W00 A;  3PQJ A;  5HS8 A;  3A0H C;  1HLV A;  3ISP A;  4IPA A;  1RR8 C;  3A0B C;  5FRO A;  1D1A A;  3HPG A;  2FUG 2;  1DDN A;  2IA2 A;  3OL4 A;  1CF7 B;  4M3G A;  2QEN A;  3IC7 A;  3K2A A;  1Z6R A;  5H2F C;  4RAY A;  3I5U A;  4CCL A;  1FIP A;  2EV5 A;  3OYM A;  1X3U A;  1SFX A;  1X3Z B;  4UV9 A;  1XCB A;  3MKW B;  1R1T A;  1FTT A;  4XSZ F;  4RB3 C;  2LKP A;  3SFI A;  3RYR A;  4EVI A;  3CCR I;  4HAM A;  2WAQ A;  3R0J A;  4ZYA A;  4BEH A;  1VQL I;  2EQR A;  4GYI A;  4A3M J;  1TW2 A;  2XAG A;  1SVL A;  1LEB A;  2KL4 A;  4XM3 A;  1VND A;  1R1V A;  2HTJ A;  2L7K A;  3F22 A;  2VJ4 A;  3WU2 C;  3UR3 C;  5K5R A;  2X1D A;  4GDF A;  2CH0 A;  4M6V A;  1FMV A;  3E0J B;  3S3N A;  3GEZ A;  2DTZ A;  1A31 A;  1G3Y A;  3I4N J;  1DP3 A;  5EF6 A;  2DTR A;  2AQF A;  1TNT A;  4MQ9 F;  3L2R A;  3OYC A;  2D45 A;  2DMP A;  4M9X A;  1LQ1 A;  3RQ4 A;  4HQM A;  3I4M J;  2JSP A;  1MSE C;  3RCO A;  3U1K A;  2E1C A;  2BY2 A;  3ZQQ A;  3O8H A;  1W4M A;  3FBN B;  1T39 A;  5LHG A;  4CYC A;  4ENM A;  5D6E A;  2ID3 A;  5GPC A;  2WAQ N;  3DU5 A;  4KN7 X;  1LE8 B;  2BV6 A;  3OYE A;  5K7Z A;  4OMY A;  5E3O A;  4P9U A;  3TP3 A;  1OR7 C;  3OIQ A;  5GAH J;  4A12 A;  4HF2 A;  1J09 A;  5FLM J;  1YS6 A;  1HF0 A;  3OV8 A;  2GXG A;  4DBR A;  3JRE A;  2A07 F;  3GTJ J;  2NOJ B;  2ACJ A;  3CC2 I;  3JR9 A;  2ELH A;  3KLO A;  4HA8 A;  5E1W A;  5FKL A;  3FHZ A;  1NH3 A;  2AHQ A;  3BDD A;  2ZBK A;  1YHQ I;  4PDK A;  3H92 A;  1MBK A;  4HLX A;  2VQG A;  1Z7L A;  2JA5 J;  1PUE E;  2H09 A;  3GVA A;  5D4S A;  1TP4 A;  1KU2 A;  5DM6 F;  4BXF A;  2E5Z A;  2E71 A;  1VQ7 I;  1HW5 A;  2KIU A;  4WF2 A;  3KEY A;  3CUQ C;  5EEH A;  3ZPL A;  1OJL A;  1V54 H;  3IWZ A;  3O2P E;  1Z9C A;  4ZYG A;  2VT2 A;  4HDV A;  2Y9Y A;  3L00 A;  2BVM A;  2DA5 A;  1WI3 A;  2BZT A;  2FU4 A;  4X0G A;  1VQ4 I;  1IDY A;  2XDV A;  3QYF A;  2Z99 A;  4BEH B;  4Y4R A;  4RGR A;  2H6B A;  3PFY A;  3QU6 A;  1USS A;  4LGW A;  3ZN1 A;  4BXU A;  1J5Y A;  1MH4 A;  4HPQ A;  4XN3 A;  4DYC A;  5L3F A;  4D9J A;  1HKS A;  3K4M A;  5FLX Z;  5HLH A;  3I9V 2;  5E17 F;  4FTH A;  1R5G A;  3EQL F;  2QSG X;  2CW7 A;  4BJ5 C;  1PJR A;  2XF7 A;  2Z9O A;  4C2T A;  5H6Q A;  2MW8 A;  2FJ1 A;  3CCJ I;  3RQI A;  4RM2 A;  2GIZ A;  1JTY A;  4CSW A;  4IHX A;  4A93 J;  5KK1 A;  3ZMS A;  2ELK A;  3BTI A;  3ZR8 X;  1IN5 A;  1PVE A;  3KP5 A;  1R00 A;  3D1N I;  2LP0 A;  1V4R A;  2M0C A;  3CLO A;  4MTD A;  3LSH A;  4B44 A;  1ZRE A;  1OCZ H;  1OLT A;  2G0E A;  1ETQ A;  1K83 J;  2DN0 A;  2MFZ A;  3ZQI A;  4CYC B;  2O0Y A;  1LDK B;  3SDB A;  4A69 C;  2IAI A;  1D8K A;  3A03 A;  1OCC H;  1YW9 A;  1MH3 A;  3BPV A;  2L5Q A;  4NDL A;  3R60 A;  4YIF A;  4IF4 A;  4UVC A;  3OYF A;  4A3K J;  4YFN F;  3CJT B;  1A6I A;  1XPX A;  1OKR A;  3LNQ A;  1Y1W J;  2P0W A;  2DAO A;  2XRO A;  4XKC A;  1KQ8 A;  4IRI A;  3HPH A;  2JPC A;  2NAZ A;  3RZO J;  2EZH A;  4BQQ A;  4YG2 F;  2KRH A;  4S05 A;  1YJW I;  4KT6 A;  4XOP A;  2OZ6 A;  2J5P A;  9ANT A;  3SJM A;  2DT5 A;  4J01 A;  2WTE A;  2JTV A;  2KIF A;  2QA4 I;  4A0X A;  3PIP F;  1YQA A;  2HKO A;  4E7J A;  2VBW A;  3SZT A;  4IHY A;  1GLN A;  2OQG A;  4IJA A;  4ZYH A;  3KET A;  1SC7 A;  3I3L A;  2ISZ A;  1QQI A;  2LF8 A;  2O9L A;  2NS0 A;  1JKR C;  4IQ4 A;  4BKX A;  3LA7 A;  1R7J A;  2LKX A;  2Y9Z A;  3BTJ A;  1HKT A;  4KIG A;  2LYC A;  4I09 A;  2NNN A;  1KA8 A;  3OY9 A;  1UG2 A;  2CV2 A;  3S15 J;  2EBI A;  5D6F A;  4MFE A;  3VFZ A;  2OQR A;  3BR5 A;  2IS2 A;  3JAM K;  3OYN A;  3A4C A;  2GXB A;  2ZO4 A;  1UAA A;  4XRM A;  2E36 A;  4UHT A;  1UB9 A;  3CJQ B;  1KZH A;  1FOX A;  2HVQ A;  1B9M A;  1KQ0 A;  4N0B A;  4RB0 A;  4WK8 F;  1PUF A;  1HDD C;  4E4H A;  1N77 A;  2XGX A;  4IHS A;  4IHW A;  5ILV A;  4BYY A;  3HOW J;  2JMW A;  1SVM A;  2JJ7 A;  4P96 A;  2HVR A;  2OCC H;  1I50 J;  1NHA A;  3IHU A;  4M3D A;  2HTS A;  4A3I J;  2GLO A;  4LD5 A;  4OOI A;  2DBB A;  1TQI A;  3VYR B;  3HTS B;  2UZK A;  2NNY A;  1WI9 A;  1IZ1 A;  1N75 A;  3OYA A;  2R5Y A;  2JA7 J;  2O7O A;  3H9Q A;  2AXT C;  4MGR A;  2F5C A;  4IOC F;  3HDD A;  2EIJ H;  2BGC A;  4CZC A;  2W24 A;  2VC0 A;  3RPQ A;  1J9I A;  1BA5 A;  4LIT A;  3B6A A;  2LH9 A;  4DOZ A;  4N4O B;  2RNG A;  3ZP5 A;  4O6J A;  1HA8 A;  5HLG A;  2EFW A;  2FML A;  4E7Z A;  2FXA A;  4E7I A;  3ASO H;  4ASN A;  3HGG A;  1K79 A;  1O3Q A;  2R7W A;  4FT8 A;  2VOP A;  3NAU A;  3CD6 I;  3WTY C;  4FHT A;  1WVR A;  1UHM A;  1QNT A;  2M2E A;  1QPI A;  1TQM A;  4XQF A;  2XB0 X;  4XKV A;  1O4X A;  4CHU A;  2OV7 A;  4HX7 A;  3DQV C;  4W1U A;  1R1U A;  2BBY A;  3VYT B;  1B8I A;  4WXD A;  3HHH A;  2KLO A;  3S16 J;  2COM A;  1Z77 A;  1QZE A;  3S3O A;  3HHG A;  3FF5 A;  1X2M A;  5DUI A;  2R7Z J;  4XIC A;  3ML6 A;  4JYK A;  3CO7 C;  4PSW A;  3K7A J;  3H0D A;  1FYL A;  2EV6 A;  3WTW C;  3MKY B;  2YSR A;  1HKQ A;  3ULQ B;  2KDZ A;  3VYU B;  3KCC A;  2MH9 A;  3LSI A;  4RAG A;  2FMY A;  3TW7 A;  2YPR A;  1YS7 A;  3KP2 A;  3S32 A;  3ZMV A;  1UZC A;  3RDI A;  1TWG J;  4QSH A;  1PUF B;  3TQN A;  1ONV A;  5D4R A;  4DYQ A;  1FOY A;  3LL7 A;  3H3Z A;  2F5F A;  1AKH A;  3BZ6 A;  2R3S A;  3EUK L;  2P7C B;  1REP C;  4RB1 A;  4M9S A;  3J81 Z;  4NUB A;  2X1C A;  4F93 B;  5DD8 A;  1WCM J;  1ZH5 A;  2DYS H;  1B72 A;  2VOD A;  3ERE D;  1W0U A;  3F23 A;  3QOD A;  5CVJ A;  3V7S A;  3BZC A;  2VPR A;  4YFX F;  2M5W A;  5GTI C;  1VQ6 I;  2VL8 A;  1GVD A;  3GFI A;  1T0F A;  1YE9 A;  3ZMT A;  3PL8 A;  3LSG A;  2AO9 A;  2LTP A;  5EZG A;  5L3D A;  5HDN A;  4OIQ F;  1JHF A;  5DEQ A;  3K70 D;  1IXR C;  3KEO A;  4KFC A;  2ZNY A;  4Q5S F;  1XGS A;  2DMT A;  2COB A;  2Q0O A;  1RKW A;  3KZI C;  5HOD A;  5KVR A;  2K3F A;  3PO2 J;  3FK6 A;  4LOC A;  4F7Z A;  4Q4Z F;  1IO2 A;  1IRG A;  1BN5 A;  2O8K A;  2E7W A;  4MIM A;  3BG6 A;  5E3N A;  3QP5 A;  2MGQ A;  2OZU A;  2CMP A;  2Y69 H;  2DMU A;  2F6C A;  2DOF A;  1XGM A;  1T56 A;  2XGC A;  2CSO A;  4WWC A;  3K1N A;  1G3S A;  5LEK A;  1MSF C;  2CO5 A;  2UWM A;  2XUB A;  3FM5 A;  3OYL A;  1B8I B;  1U2W A;  1HSJ A;  2V4J C;  5HLI A;  2A6E F;  3OYJ A;  1HXD A;  2EZL A;  3DTE A;  4J00 A;  2TCT A;  2ZXJ A;  3HC7 A;  4EMS A;  1BR4 A;  1JI8 A;  4FIS A;  3BTL A;  2RQQ A;  4PUS A;  3HOU J;  5IYD J;  2EIL H;  2KT0 A;  4AD9 A;  1ZGJ A;  2QQA A;  3MN2 A;  4F3Q A;  1DPU A;  1E3P A;  4HLY A;  2PFB A;  2BY0 A;  3K2Z A;  5IP9 J;  5IYC J;  1QRY A;  1UFM A;  4MQV A;  4BS9 A;  2R7D A;  3F8N A;  4L9T A;  5FKK A;  5CYV A;  3JRH A;  3DKY A;  3J7A O;  4K2E A;  4XBF A;  2PG4 A;  1JE8 A;  2R7O A;  1PYV A;  2XAS A;  4XLN F;  2V1X A;  4XLC A;  2V26 A;  1AKH B;  1W5S A;  5C44 J;  1BJZ A;  1BC8 C;  2LY1 A;  2VJ5 A;  2EIM H;  3D0S A;  2K4B A;  5FFX A;  1TWF J;  2ZJ2 A;  3AAF A;  4D0P A;  4G7H F;  2ZXW H;  1B72 B;  3ASN H;  3CDI A;  2B7E A;  4MHG A;  2ZME A;  1U5T B;  3MZH A;  4G12 A;  4LB5 A;  3IH4 A;  2M87 A;  2IS1 A;  2CUJ A;  4AYB N;  3M7G A;  1JGS A;  3LSP A;  5A2Q K;  1F9N A;  1IV8 A;  3KFW X;  1XDU A;  2L4M A;  3J7Y J;  4S04 A;  3CC7 I;  3FXU A;  3V42 A;  3HBL A;  2V7F A;  1NK2 P;  3KIO A;  2H1K A;  2IP2 A;  4HNU A;  3CF2 A;  2MSY A;  4Y52 J; 
#chains in the Genus database with same CATH homology
 2OF7 A;  5EYR A;  1W0T A;  4IHV A;  4AUX A;  3JRD A;  4MLO A;  2LK2 A;  1FEX A;  1HLV A;  1H88 C;  3ZQC A;  1U78 A;  3ZQH A;  4DZP A;  3BG5 A;  2XGE A;  2FQ4 A;  3BR2 A;  2EH3 A;  4B1R A;  3WHB A;  2DA7 A;  1ETY A;  4M3G A;  4C3J J;  3K2A A;  5J1R A;  4A3F J;  2R5Z A;  1EF4 A;  1FIP A;  2PMZ N;  2CJJ A;  2EZI A;  4A3J J;  2R92 J;  1JTX A;  2CUF A;  1FTT A;  5IOZ A;  3BG9 A;  1QVT A;  2K9S A;  3SFI A;  4D7N A;  5EGO A;  2JA8 J;  4DYR A;  1I3Q J;  4J19 A;  3GTG J;  3G1O A;  3NAR A;  5J3L A;  3JRI A;  1RR7 A;  3G1M A;  2EQR A;  1ETW A;  1AU7 A;  4A3M J;  2HOS A;  2DA6 A;  1JT6 A;  1P7I A;  1VND A;  3ZOB A;  3HGY A;  4XRS A;  1YRN A;  4M6V A;  2W48 A;  2ID6 A;  2DTZ A;  2DA2 A;  3I4N J;  5EDN A;  3HM5 A;  4I76 A;  5EF6 A;  2LFB A;  4C2M J;  1NTC A;  2DMP A;  2E2J J;  2DA4 A;  2NOG A;  3DCF A;  3I4M J;  4S0H B;  3BQY A;  3S2H J;  5DTD A;  1MSE C;  3PO3 J;  5GPA A;  5F04 A;  2R0Q C;  1ETX A;  3F0C A;  3S1N J;  3B6C A;  3O8H A;  4CYC A;  3GTQ J;  2ID3 A;  5GPC A;  2WAQ N;  1LE8 B;  5K7Z A;  5E3O A;  3CCY A;  2R93 J;  3TP3 A;  4FCY A;  1GUU A;  2LVS A;  1I6H J;  1WH7 A;  3TED A;  2D5V A;  4QIW N;  2HXO A;  3ZQG A;  3FIW A;  5FLM J;  3IV5 A;  1HF0 A;  1JKQ C;  3JRE A;  3S1M J;  3GTJ J;  1LFB A;  3JR9 A;  2YU9 J;  5FKL A;  2XRL A;  4D5C A;  3A01 A;  2AHQ A;  4XID A;  1IJW C;  3GTL J;  5FKM A;  2X48 A;  1MBK A;  2R5Z B;  3RKQ A;  2JA5 J;  2XSD C;  4A3L J;  2GM4 A;  4FE7 A;  2Y31 A;  2Y2Z A;  2E2H J;  3FKI J;  4W97 A;  5C4X J;  3A02 A;  2HOA A;  1OJL A;  1ZKG A;  5EGO B;  1RET A;  2Y9Y A;  3Q0U A;  1FIA A;  1WI3 A;  2DA5 A;  1IDY A;  1ITY A;  1MBH A;  2P81 A;  2QF7 A;  3OSG A;  1MH4 A;  2LLK A;  1FJL A;  2LY9 A;  5JLW A;  4DYC A;  5F0C A;  1JT0 A;  2ECC A;  3L1P A;  3OSF A;  4UUS B;  1JJ6 C;  4HNV A;  1IRZ A;  1QVU A;  4FTH A;  1YRN B;  4DW6 A;  1IUF A;  3G1L A;  4L5E A;  2MW8 A;  2FJ1 A;  3OOU A;  1Q1V A;  3RQI A;  2QCO A;  3GTP J;  5GP9 A;  5IYB J;  1JTY A;  4IHX A;  4A93 J;  2ZB9 A;  3IH2 A;  2ELK A;  3BTI A;  2NVY J;  4A3D J;  4FE4 A;  2NVX J;  3SDG A;  3D1N I;  4M3B A;  2LP0 A;  2M0C A;  1H8A C;  4A3B J;  3CDL A;  1WGX A;  2G0E A;  1ETQ A;  1K83 J;  2DN0 A;  2XGD A;  3E7L A;  3ZQI A;  4CYC B;  2H8R A;  1ETV A;  1OCP A;  5EZH A;  1Y1V J;  4A69 C;  1MBE A;  2IAI A;  3A03 A;  1VF9 A;  4GFB A;  1MH3 A;  1G2H A;  3S2D J;  2JA6 J;  4NDL A;  2VI6 A;  4A3K J;  2FX0 A;  1U9O A;  3S1R J;  1IC8 A;  1A6I A;  2M8G X;  3LNQ A;  1Y1W J;  2YS9 A;  3MVP A;  5C3E J;  3RZO J;  2EZH A;  5IP6 A;  1AHD P;  3HEF A;  3A01 B;  2JN6 A;  1BW6 A;  4QTR A;  9ANT A;  3SJM A;  4X6A J;  2X6O A;  2L7M P;  5BNG A;  1VFC A;  4UUS A;  3JRC A;  5J1U A;  5M5Y J;  1XS9 A;  4ABZ A;  2R5Y B;  3PM1 A;  4IHY A;  1ETO A;  2O9L A;  5EG0 A;  1JKR C;  2NS8 A;  4BKX A;  4DZJ A;  1XC5 A;  2LKX A;  2Y9Z A;  3BTJ A;  1MBG A;  3HOV J;  2LD5 A;  1ORK A;  3OIO A;  2L9R A;  1UG2 A;  1K61 A;  1E3O C;  3S15 J;  2EBI A;  5E3M A;  4MFE A;  3BTC A;  3JRB A;  3BR5 A;  3JRA A;  1ZQ3 P;  1HOM A;  1JGG A;  1RPW A;  5K7H A;  5IPA A;  5K7F A;  4XRM A;  3QQA A;  4B3A A;  4EEF G;  2MG4 A;  1PUF A;  4X1E A;  1HDD C;  5F27 A;  1F36 A;  4IHW A;  2E2I J;  3JRG A;  4B4C A;  3HOW J;  2JMW A;  3GTO J;  1X58 A;  4MO7 A;  5DS9 A;  2ECB A;  2JJ7 A;  2DMQ A;  1I50 J;  4AC0 A;  5F1J A;  3GTK J;  4BBR J;  4RBO A;  1UMQ A;  1JKP C;  1ENH A;  1GV2 A;  4M3D A;  4IEJ A;  3WHC A;  2HOT A;  2K9N A;  3BG3 A;  4A3I J;  1WH5 A;  2GLO A;  3LOC A;  4BY7 J;  1JUS A;  3BR6 A;  2R5Y A;  2JA7 J;  2O7O A;  4M3F A;  2XPU A;  3HDD A;  3H0G J;  1D5Y A;  1MBF A;  4Y7N J;  1BA5 A;  3ZQL A;  3B6A A;  2TRT A;  1BW5 A;  2HXI A;  2CU7 A;  1X2N A;  1TWA J;  1CQT A;  2NVT J;  2L7F P;  2K40 A;  3HGG A;  4BY1 J;  5FLV A;  3GTM J;  2M34 A;  5EEA A;  2ME6 A;  1TWC J;  2EZK A;  3NAU A;  5F0H A;  1TWH J;  2XB5 A;  3CQZ J;  2M2E A;  1QPI A;  2GBY A;  2XB0 X;  4D7M A;  2WV1 A;  5FKN A;  1O4X A;  4W1U A;  5M3M J;  2N8G A;  5FJ8 J;  2E1O A;  1B8I A;  2XPW A;  4C3I J;  3DEW A;  5EG0 B;  5M3F J;  1LFU P;  3S16 J;  1Z0X A;  1RES A;  1U9N A;  1Z77 A;  1XG1 A;  2JK3 A;  5C4J J;  3MKL A;  1X2M A;  2R7Z J;  5IOY A;  4XIC A;  1DU6 A;  4JYK A;  2CQX A;  2FD5 A;  3H3V K;  3K7A J;  2Y30 A;  2ME0 A;  3GBG A;  2KDZ A;  1JKO C;  1GDT A;  2YUS A;  1OCT C;  3TW7 A;  5M5X J;  2VUM J;  5M5W J;  3BT9 A;  1DU0 A;  4A3E J;  1PUF B;  1TWG J;  4QSH A;  5J1Y A;  4DYQ A;  1APL C;  4UUT A;  1POG A;  4JX6 A;  5IP7 J;  3S14 J;  4M3E A;  3FK7 A;  3Q0W A;  1AKH A;  1MBJ A;  1OFC X;  2X9D A;  3S17 J;  4A3C J;  1WCM J;  1B72 A;  4XK4 A;  1W0U A;  3BR1 A;  2M9H A;  2WB1 N;  2CQQ A;  1U8B A;  2VPR A;  4BBS J;  1GT0 C;  2E19 A;  1MNM C;  1GVD A;  3VPR A;  2DA1 A;  3LSG A;  2AO9 A;  2LTP A;  5EZG A;  2VKE A;  1ZR4 A;  5FKO A;  3QPL A;  5E3L A;  2Y0S N;  1WPK A;  4C3H J;  2IBD A;  3W6V A;  3M3Y J;  2DMT A;  2COB A;  3S1Q J;  3FIS A;  1RKW A;  1ZTR A;  1IV6 A;  5HOD A;  2HDD A;  3PO2 J;  3FK6 A;  4LOC A;  1P7J A;  2O8K A;  2NVQ J;  3IH3 A;  4MIM A;  5JLX A;  5E3N A;  2MGQ A;  3TP0 A;  1NK3 P;  2JWT A;  3HKZ N;  1H89 C;  4JX5 A;  2DMU A;  2XPV A;  2K9Q A;  1ZGW A;  3ZQF A;  1T56 A;  2XGC A;  2B63 J;  1IGN A;  1MSF C;  2DJN A;  2L0K A;  4JP0 A;  1VI0 A;  4BXX J;  1JUP A;  3Q0V A;  1HCR A;  2OPT A;  4D5F A;  1ETK A;  3HOX J;  3UKG A;  2RAE A;  1B8I B;  1UHS A;  1R9T J;  1GV5 A;  1SFO J;  3LSJ A;  3Q3S A;  2HYJ A;  4MFD A;  3HOY J;  1IDZ A;  1SAN A;  2EZL A;  2TCT A;  2NS7 A;  3BR3 A;  4FIS A;  1ZK8 A;  3BTL A;  5F0F A;  3HOU J;  5IYD J;  2KT0 A;  2IEK A;  4RDU A;  5F08 A;  2CUE A;  3MN2 A;  3BQZ A;  1HDP A;  2L7Z A;  1JUM A;  5IP9 J;  5IYC J;  3CMY A;  1QRY A;  1TC3 C;  4V2F A;  1BL0 A;  4JX4 A;  2CRG A;  2DA3 A;  5FKK A;  3LSR A;  3JRH A;  1JJ8 C;  3HOZ J;  1F43 A;  4I6Z A;  3QPS A;  1AKH B;  1T33 A;  3HB9 A;  3RZD J;  5C44 J;  1IG7 A;  1BJZ A;  2I10 A;  2HI3 A;  1TWF J;  1B72 B;  1S7E A;  4A3G J;  3JRF A;  3M4O J;  3BR0 A;  4G12 A;  3IH4 A;  3O8G A;  3LSP A;  4AYB N;  1FTZ A;  4V2G A;  3C2B A;  3TW6 A;  1ZR2 A;  1RKT A;  2VKV A;  2LR8 A;  3HBL A;  1A5J A;  4XRS G;  2HQ5 A;  2DMN A;  1NK2 P;  2H1K A;  1LE8 A;  2MSY A;  4Y52 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...