2MGQA

Structure of ceh37 homeodomain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
GPRKNRRERTTYSRQQLEILETLFNETQYPDVFARERVADQIRLQESRIQVWFKNRRAKYRLQEKQKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Homeobox protein ceh-37
publication title Structure of CEH37 Homeodomain
rcsb
source organism Caenorhabditis elegans
total genus 12
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2mgqA00
5E3NA 1CQTA 1BW6A 4A3FJ 1GT0C 1JTXA 2L9RA 1JKQC 1VNDA 2N8GA 2L7MP 4A3DJ 1GV2A 2Y31A 3TW6A 1RR7A 2EZKA 1TC3C 1F43A 1QVUA 2JA5J 4IHWA 2H1KA 4W97A 4M3GA 5FKOA 2DJNA 1JUSA 2GBYA 3HB9A 1GUUA 2CU7A 2FQ4A 1ZKGA 1P7JA 1GVDA 3DCFA 3PM1A 2HXIA 1RESA 1HOMA 5E3MA 4V2GA 2HOAA 2HYJA 3S2HJ 1RPWA 1JT6A 2I10A 2X6OA 1IJWC 5F04A 2JJ7A 1IGNA 1JUPA 2FJ1A 4BBSJ 2IAIA 4M3DA 2H8RA 5FKKA 2EZIA 1OFCX 3TP3A 2DTZA 2XGEA 5F08A 2D5VA 1MBJA 1ETWA 3GBGA 1VI0A 3SFIA 2M2EA 3OSFA 5EYRA 2CQXA 4FE7A 5J1RA 4QTRA 2JA7J 1Q1VA 2MGQA 2R5ZB 1SANA 5K7HA 1S7EA 2DMUA 4IHVA 3PO2J 3HKZN 1F36A 1P7IA 4JYKA 3BR6A 1U8BA 1GV5A 2DA2A 3S1NJ 1ORKA 3SDGA 1DU0A 1K83J 4DZJA 3BQYA 3K7AJ 3CMYA 2HDDA 3BQZA 4EEFG 1VF9A 5FKLA 5J1UA 4A3KJ 2R0QC 1X2NA 3C2BA 3ZQCA 4XK4A 2GLOA 1ZK8A 3FIWA 3RZDJ 2DA7A 5FLVA 1MBFA 3RKQA 5GPCA 3OIOA 4A3GJ 4AUXA 1G2HA 1TWGJ 4UUSA 1MBEA 3GTQJ 2YU9J 4AC0A 3ZQHA 1NK2P 5IP7J 4BY1J 4UUTA 2DA6A 1W0TA 1E3OC 2R7ZJ 3D1NI 1U9NA 5J1YA 4D7NA 1Y1VJ 3BR5A 4XICA 5IYCJ 2JK3A 3HOWJ 5IP9J 4BY7J 3E7LA 2R5YA 1XS9A 3FK6A 2ELKA 5FKNA 1JGGA 4B3AA 1NK3P 2DA4A 1ETYA 3BR1A 5FKMA 5M3MJ 5EG0A 1D5YA 1IDZA 2XGDA 3I4MJ 4FTHA 3BG3A 3JRDA 2HOSA 2HOTA 4RBOA 3S15J 4QSHA 3LSJA 1R9TJ 1HDPA 2E19A 1W0UA 3JRFA 3PO3J 3ZQIA 3QPLA 3JRBA 4A93J 3JRGA 2K9NA 1WPKA 2Y0SN 1MSFC 1ETXA 4A3JJ 4W1UA 2CRGA 3JRHA 3H0GJ 3OOUA 5M3FJ 5E3LA 4J19A 3GTLJ 2O7OA 2XPWA 2LKXA 1MH3A 1TWAJ 4RDUA 1MNMC 5C4XJ 2NVQJ 2EZLA 3HOXJ 4FE4A 3IH4A 4Y52J 1QPIA 1ETKA 3GTGJ 3ZQLA 5C4JJ 3HOZJ 3FISA 2IEKA 2NVXJ 3LOCA 1GDTA 5F27A 5IOYA 1WH5A 3B6CA 3BR2A 3BTCA 4JP0A 3TP0A 2VUMJ 1H89C 5C3EJ 1OCPA 1TWHJ 1NTCA 3IH3A 2KDZA 2ECCA 2K40A 1UMQA 3M3YJ 3OSGA 1AKHA 1Y1WJ 4C3HJ 1ZR4A 2LK2A 5IYDJ 2YS9A 3GTMJ 2TRTA 2HQ5A 1ETOA 3QPSA 3HOVJ 5IPAA 1LFUP 4M6VA 4IHYA 1FIAA 1IV6A 2AHQA 2AO9A 1O4XA 1AU7A 3LNQA 3ZQGA 3ZQFA 1IRZA 1BJZA 1IC8A 3S14J 1B72A 1QVTA 2DA3A 3JRCA 3BG5A 1WGXA 4UUSB 2LVSA 4HNVA 3BTIA 3O8GA 4M3BA 3FK7A 4BKXA 2FD5A 2DN0A 1FTTA 3Q0VA 3QQAA 2CUEA 3G1LA 4X6AJ 2WV1A 3CQZJ 4A69C 3TEDA 1UG2A 3HM5A 2E1OA 4D7MA 1RKWA 2P81A 3JREA 2R5YB 3BG9A 1OCTC 2Y2ZA 2E2IJ 2GM4A 5J3LA 2WB1N 1WCMJ 4BBRJ 1I6HJ 2LR8A 2PMZN 5EG0B 3A01A 4DYRA 3GTPJ 2X48A 4DZPA 2EQRA 5EGOA 4ABZA 2CQQA 4B4CA 5F1JA 4I76A 1FEXA 1ITYA 2CJJA 2G0EA 5DS9A 3JRAA 2NOGA 1U9OA 1H8AC 3Q0WA 3GTKJ 2XPVA 1ZR2A 2VKVA 1VFCA 3MVPA 3WHCA 1WH7A 5C44J 4CYCA 5DTDA 4L5EA 1SFOJ 4Y7NJ 3M4OJ 2VPRA 2IBDA 1Z0XA 1X2MA 1Z77A 2EH3A 2LP0A 3H3VK 1TWCJ 5FJ8J 3BR3A 2L0KA 2E2HJ 4XRSG 1ZGWA 3HOUJ 3S2DJ 2O9LA 4MO7A 4MIMA 4MFDA 4BXXJ 1ZQ3P 3BR0A 3BTLA 3NAUA 4A3EJ 1JUMA 2XRLA 3S1RJ 2X9DA 3B6AA 2R93J 3HGGA 2ZB9A 3JR9A 1JKPC 4C3IJ 2ID6A 2QF7A 4V2FA 5E3OA 1AKHB 1AHDP 2MG4A 1FJLA 4DYQA 3CDLA 4D5FA 3BTJA 5BNGA 3HBLA 5EDNA 1XC5A 2DMNA 1HCRA 1DU6A 2Y9YA 3G1MA 1LE8A 2K9SA 3HOYJ 1BW5A 4NDLA 5EF6A 1B8IA 1JJ8C 2YUSA 3DEWA 2NS7A 1HDDC 4AYBN 5JLWA 3HGYA 2Y9ZA 4IEJA 1YRNA 2QCOA 2JN6A 2DMQA 4B1RA 4FCYA 2NVTJ 1B72B 1MBHA 2L7ZA 3S1MJ 5JLXA 1K61A 1PUFA 2WAQN 2LY9A 3CCYA 1UHSA 4A3MJ 2DMPA 2ECBA 2L7FP 3FKIJ 2JWTA 4D5CA 3SJMA 3HEFA 5IYBJ 4MFEA 2XB5A 3LSPA 4C2MJ 3GTJJ 1BL0A 2K9QA 1MH4A 2ID3A 4C3JJ 2B63J 1A5JA 1U78A 1T56A 1JJ6C 3IH2A 4A3IJ 5K7FA 4JX5A 3I4NJ 3O8HA 2M34A 2FX0A 1OJLA 2XB0X 5GP9A 3A01B 3LSRA 3A02A 2XGCA 5EGOB 1QRYA 1FIPA 3A03A 4A3LJ 2EZHA 1IDYA 5F0HA 3BT9A 2LD5A 1JTYA 1T33A 2M0CA 2E2JJ 2XSDC 4GFBA 5K7ZA 3L1PA 1IG7A 3S1QJ 1APLC 3RZOJ 4I6ZA 1MBKA 5HODA 4X1EA 4CYCB 2TCTA 5GPAA 1LFBA 1X58A 3NARA 5EZHA 2NVYJ 4IHXA 4MLOA 3JRIA 1XG1A 5IOZA 1RETA 2LTPA 2KT0A 4FISA 5IP6A 4XRMA 1RKTA 5M5WJ 3K2AA 4M3FA 1IUFA 2LLKA 2JMWA 4XRSA 2VKEA 3Q0UA 2R92J 1EF4A 2CUFA 2Y30A 3RQIA 1ETQA 3UKGA 1HF0A 2R5ZA 2DMTA 2DA5A 9ANTA 2M9HA 2VI6A 2ME6A 1JKRC 3VPRA 1FTZA 4XIDA 3IV5A 4G12A 1I3QJ 1ETVA 5EZGA 3ZOBA 1A6IA 4DYCA 3HDDA 1LE8B 2MW8A 2EBIA 2ME0A 2HXOA 1B8IB 1MSEC 2W48A 4QIWN 1YRNB 4A3BJ 1JKOC 5F0FA 2O8KA 4JX4A 2M8GX 2NS8A 4DW6A 2COBA 2OPTA 1ENHA 3MN2A 2RAEA 1POGA 1PUFB 1TWFJ 5F0CA 3TW7A 4LOCA 1WI3A 3W6VA 5FLMJ 1I50J 3Q3SA 4M3EA 1ZTRA 2DA1A 5M5XJ 4S0HB 3MKLA 4A3CJ 1HLVA 3WHBA 2JA6J 3S17J 1BA5A 2MSYA 2HI3A 3G1OA 3S16J 1MBGA 3LSGA 2JA8J 1JT0A 5M5YJ 5EEAA 2OF7A 3GTOJ 1H88C 4JX6A 2LFBA 3F0CA 2XPUA
chains in the Genus database with same CATH superfamily
2L9RA 1FWZA 3IP4B 3E0JB 3BOQA 2L7MP 2RQQA 1ONVA 3HSEA 2Y31A 3LAPA 1FOYA 3K0LA 3TW6A 1RR7A 3C7JA 4BUPA 4C2UA 3ABMH 1MMGA 1VTNC 1OLTA 4UHTA 2KRCA 5FKOA 2A07F 2O61A 5EJCA 4HW0A 5IT9K 3ZMVA 2GBYA 3ONQA 2CU7A 2VKDA 2W82A 5LEKA 4L9VA 3F21A 3S3OA 3RQ4A 2CFOA 2DLLA 3BZCA 3MKZA 1MDMB 1RESA 2BVLA 2LOOA 1XGSA 2F5VA 4BEHB 4EATA 3C2HA 3S2HJ 1RPWA 1ZN2A 2I10A 2V26A 5DCFA 1IJWC 3MKYB 1D3YA 1G6NA 2FBIA 1HA8A 2JJ7A 5FRMA 1IGNA 2P4WA 2H94A 2H6CA 3ECHA 2EZIA 4BE0A 4CZZA 2DTZA 2ZMEA 1MBJA 1ETWA 3TO7A 1VI0A 3SFIA 2KLOA 2CQXA 4QTRA 2GIVA 3ZN1A 4S05A 2JA7J 3R61A 4YELA 2MGQA 4J01A 2KPMA 3TMOA 1F36A 4PSXA 3VB2A 4EJOA 3BR6A 3H9QA 3S1NJ 1K78A 4A6EA 1ORKA 3ASNH 4P1WA 2XAUA 1P4XA 3FXUA 3MEXA 1QZZA 3WE2A 3BQYA 3K7AJ 4BJ6C 1U6GA 1LUJB 2DPUA 3CUOA 1VF9A 2XASA 1B9MA 1X2NA 3C2BA 2JSCA 4M73A 5H2FC 4XK4A 1XD7A 1RI7A 1R7JA 3RZDJ 3FIWA 1RC9A 1OYWA 1ZREA 2JSPA 2LNBA 5H20A 3L2QA 1Z7UA 1G2HA 2VASA 1FPQA 2IA2A 2YU9J 1FY7A 4AC0A 3IWZA 3G4SI 4R1HA 4LG0A 3TO6A 2DBBA 4EV0A 3ZQHA 3BJOA 1IAWA 4XNFA 3CCJI 2DA6A 1P4WA 2GA1A 5DD8A 1E3OC 1WKMA 1JI8A 4ANJA 2NS0A 1U9NA 2VKHA 3VYRB 5ICEA 2EV0A 1DQUA 4AIKA 3W2AA 2A5YB 2DT7B 2DDBA 3CDHA 4L9NA 5IP9J 5FROA 2R5YA 1K7AA 4D1QA 4IZZA 1JGGA 1JGSA 3H9JA 1NG6A 4F7ZA 3KYDB 2P7VB 4EJUA 3EUHC 3KP6A 2ISYA 3BR1A 2FRHA 4PDKA 1IDZA 2IVMA 4GGGA 5ED4A 3BLYA 3WU2C 4Y13A 1SFKA 2FBKA 3BG3A 3JRDA 1QGPA 3BWGA 4XKCA 2LC2A 5CVIA 3MZ8A 5HVQC 2OCCH 4PJJA 1HDPA 1R9TJ 1OYYA 2X6WA 4AD9A 2Y0SN 2WY7Q 1SVOA 5TJJA 4EM2A 3OOUA 5B1AH 2B9SA 3H5NA 3JCUC 4XR6A 2ADUA 2Q2EB 3EYYA 1TWAJ 2FEZA 2P6SA 2OJED 4PUSA 1E0EA 5A2QK 2XC7A 1FSEA 2R7SA 3DKYA 3TDZC 4LLGF 1FMVA 2COMA 2QLZA 4A6DA 3Q9VA 1U5TA 3ZQLA 2PJPA 2M8EA 1B59A 1HSJA 5LGNA 1KU7A 1GDTA 2OD5A 1WH5A 3BR2A 3BTCA 2R7RA 1W4MA 1X3ZB 4JP0A 2R7FA 4OIOF 2H09A 1H89C 1NTCA 1I39A 3IH3A 2KDZA 2ECCA 4IQ4A 3FWEA 3M3YJ 3P9CA 5FO5A 4HYEA 4D9JA 1R4NB 3CJQB 1R00A 2YSRA 2EFQA 5LGTA 2XF6A 1YJNI 3QPSA 2VIXA 3E3VA 3O3KA 5IPAA 2D1VA 2KRFA 3OYDA 4IO9F 1SMYF 1LFUP 1FIAA 1IV6A 2CWEA 2JTVA 3LNQA 1SFXA 2XROA 1LEBA 1IRZA 2DFHA 1Z21A 1XX5A 1G3SA 3KYLA 3REOA 4UUSB 1HSTA 3NWTA 4BYYA 3E1SA 4M3BA 4CZCA 3FK7A 1OR7A 1FTTA 3Q0VA 1ZELA 5J8CA 2HTSA 2DOAA 3FKJA 3OYCA 4A69C 4F3QA 2A3SA 2EV5A 2IGMA 1LDDA 1E2XA 2ZSIB 2HQNA 1TQMA 3T8RA 1YW8A 1PJRA 2P81A 3JREA 4G6TB 2A68F 3CC4I 2QKLB 5DUKA 3NWSA 2E2IJ 2VQLA 2M4KA 5FB2A 3KETA 2K3PA 2L5QA 1I6HJ 1H9TA 2Y0SA 5KAFC 3S2WA 4M6YA 5D4SA 5EG0B 3A01A 3WG9A 4DJAA 2VT2A 2CQQA 3OR1C 3CCUI 2RQPA 4PSWA 3HUGA 4B4CA 3I59A 4A12A 4I76A 1ITYA 3DLLF 3I58A 3PQKA 2E34A 1DDNA 2H1LA 2YPRA 2NOGA 3ZRGA 2E35A 3K70D 2RNGA 5FGMA 3CF2A 3Q0WA 1D0ZA 1STZA 4G94A 4F52A 3GTKJ 1SAXA 3HXLA 4WK8F 1ZR2A 5HDGA 2VKVA 4ZDLA 3B73A 4LIVA 3MVPA 3WHCA 2F5FA 1TL8A 4CYCA 3L2VA 3CMEI 4L5EA 2VPRA 3ABTA 2F4OB 2F6CA 3M7GA 3DV8A 4XRFA 3K70C 2LYCA 3AL0C 1BOBA 1LB2A 2WA0A 4BDYA 2XAGA 2AS5F 4NUBA 3HOUJ 3S2DJ 2W57A 2O9LA 1EV7A 3CLQA 4MO7A 4MIMA 5FRNA 4O6JA 3T5XA 3BTLA 1MIJA 3NAUA 3CTAA 3F6OA 3IHUA 2XRLA 4CH7A 2X9DA 2VODA 2LY1A 1ZG5A 1BIAA 1JKPC 2XV4S 2BGCA 1J09A 2QF7A 2MABA 1FJLA 2QQ9A 3CDLA 3FXOA 3FXRA 1D1CA 1X4OA 2DMNA 4OAYA 3SDBA 4G6DA 3WGGA 1HBXG 3FZVA 3G1MA 1T38A 1CGPA 2P7CB 1YTYA 3JAMZ 1BR1A 1BW5A 3TDUC 4NDLA 5EF6A 1B8IA 1K79A 3RSNA 1YRNA 2Z9OA 2RV8A 1XPXA 4CGZA 2GQQA 4A0YA 3UNGC 5LLQA 3W6JB 3EYIA 1MBHA 3QOEA 5JLXA 2ZJQF 1K61A 1ZGJA 1FX7A 2WAQN 3SQNA 2F4MB 3FMRA 2ZJ2A 2PJRB 2JWTA 2L7KA 1W5CC 4ZYEA 3R0JA 1G3TA 3HEFA 2ESNA 1FYKA 3P5JA 4N0BA 3LSPA 1T39A 1BL0A 4HSTA 2CFXA 2RDPA 1MH4A 1X1BA 1KQ9A 2OAZA 1QA6A 1IXSB 1HW5A 5ERIA 2H8WA 1TBXA 1W1WE 2DCEA 1BN5A 2HFHA 2IGOA 2M30A 4AVPA 1U78A 2ZXIA 1ZH5A 1DP3A 3EUHA 4RB2C 3IAS2 4BJ5C 4CCKA 2OZ6A 3L00A 1XMXA 2FX0A 2VC0A 2G9WA 5GP9A 3ZGKA 1BI1A 3D5LA 1QRYA 1YOVB 1FIPA 2FOWA 1B1BA 4WXHA 2LD5A 1SAUA 4CSWA 5HLGA 4CDGA 3F8NA 4JK1X 5HS8A 4BHBA 2XSDC 3F22A 4GFBA 5CVVA 1MMSA 3O6BB 1APLC 1C0WA 2WY8Q 2VLAA 2X51A 4MQVA 3F8CA 1USTA 2FU4A 4O5VA 1S3JA 1S6LA 3M8FA 2EFNA 1YIOA 2GXAA 4ESFA 1U8RA 1ZRFA 2E1MC 2DOFA 3T8TA 4GYGA 5K5RA 2NVYJ 2KIUA 3SZGA 3VFZA 3JRIA 5IOZA 1SC7A 1RETA 2KT0A 3I54A 1ZYRF 4I7HA 5M5WJ 1TZLA 1EH6A 5AIPA 1IUFA 2VBZA 2BY2A 1F5TA 2LLKA 5FLXZ 1IUYA 5DCMA 3HJEA 4XRSA 2NVUB 1WRJA 3X2QH 3E5XA 1IRGA 2CUFA 1LFPA 2R7QA 1V5FA 4U0WA 1ETQA 1LJ9A 2IPQX 1HF0A 2O03A 1QNTA 3BY6A 1F4KA 9ANTA 2M9HA 1J5YA 4L5JA 3KIOA 2VI6A 3S93A 3OS1A 3VPRA 2IGKA 1LEAA 2L3DA 2JPCA 3V8LA 3OYFA 2M87A 4G12A 2LKSA 4I99C 3ZOBA 2STTA 3WTTC 3G73A 1A35A 2WAQA 2MW8A 2V1NA 3HTUA 4OMYA 2HXOA 4KITB 4OU0A 3J7AO 3J81Z 3FHNA 4XLFA 3OS0A 1LKXA 3WTVC 1TQIA 3F9KA 2VN2A 2NS8A 4IHSA 2ZMEC 4RGSA 2HVQA 4HX4A 2OPTA 1ENHA 3MN2A 2RAEA 3OYLA 1PUFB 3BJ6A 3ZPLA 1UAAA 5IT9Z 2NXNB 4JOMA 1NHAA 2IJLA 3RTRA 2VOOA 5CLSA 3A2KA 4IOCF 3MKLA 1OKRA 5HLHA 4A3CJ 4HF0A 1QO0D 1MMNA 3WHBA 1PYVA 2JA6J 5IY5H 3GFIA 1K6YA 2HI3A 3FDYA 3F8BA 3S16J 1MBGA 3LSGA 2JA8J 1JT0A 4G7OF 3KEQA 1H88C 4XLCA 2P5VA 2ZNYA 4H4KC 1CQTA 1BW6A 3EUAA 1IN6A 4AVZA 3AL0B 4U7BA 3CJTB 1XSVA 4LGWA 2XSJC 1GV2A 5BPDA 2EZKA 3PNTA 1ZRDA 5JR3A 1HKSA 3CCMI 1QVUA 4IHWA 1VQ5I 1REPC 3W6KB 4XKWA 1TLHB 3LA7A 5HNHA 1B4AA 3IUOA 3GLLA 4A5MA 1A36A 1OCCH 2PMUA 2XHKA 2BXZA 3B02A 3VSKA 2WV0A 1YG2A 3HB9A 4GRIA 5EEHA 1GUUA 2FQ4A 2X1DA 2W24A 2QWWA 3TBIA 3GXOA 1XGNA 3KCCA 2V9KA 3KEYA 4XONA 5E3MA 1E17A 3ZQ7A 2DFEA 5FFXA 4KUMA 3QODA 2FUG2 2DOEA 2R7DA 3QYFA 5D5XB 1D8KA 1JUPA 4BBSJ 2X1CA 1OFCX 3DKXA 4GYIA 1FOXA 3TP3A 4E7JA 4OWRB 1VZ0A 2BY1A 3IKTA 1R49A 2Z1DA 1YE9A 2L02A 2M2EA 3LWFA 4MGRA 4N9HA 5EYRA 1R23A 3OSFA 2KZGA 4NQWB 3MKWB 1B6AA 2RNJA 1Q1VA 2R5ZB 1SANA 4N4OB 1S7EA 1P2FA 3PUBA 2M0MA 3HKZN 4IHVA 3PO2J 1BBYA 4DGWB 2C6YA 1A6QA 4CA0A 1GV5A 2XUBA 4UB6C 2DA2A 3DP7A 1U8BA 3QRFF 3K4NA 3KZYA 1NG7A 3SDGA 4CYDA 1K6OA 4DZJA 4G6QA 5LHHA 2OUMA 4YIFA 4RAYA 2HDDA 3TQNA 4HRIA 2IT0A 5J1UA 3N97A 1U5TC 3GF2A 3LQQA 4LK1F 2R0QC 3ZQCA 3J80K 1VQKI 3OL4A 4EGZA 1YJWI 3C3WA 1VQ6I 2FSWA 3FHZA 5GPCA 3RKQA 3H1CA 4WCGA 4A3GJ 2DODA 1R1VA 3DBRB 3E5QA 2CMPA 3RKYA 4LB5A 3GTQJ 1V55H 1HKQA 2KP6A 3V8KA 4BJTA 4RB3C 3DU6A 3KFWX 4BDZA 4XSXF 1NK2P 4BY1J 2HKXA 1R5ID 2EILH 3D1NI 3M1EA 5J1YA 2IS1A 4L9JA 3BR5A 2BW3A 3D5RC 4U88A 3V4GA 4YG2F 3JTHA 5D8KB 5JFRA 4BY7J 4Z2YA 2ELKA 5FKNA 3TOAA 1NK3P 3RI4A 2AXLA 4IX7A 2QBYB 2DA4A 2O5RA 2CQKA 1R5GA 2CW7A 4ITVA 2KRHA 4XKBA 2ELHA 5D6FA 3AG3H 5ILVA 2HOTA 2R7UA 4M72A 4RBOA 2BZTA 2RC4A 2EK5A 4BL0B 2DFIA 2E19A 1G8XA 3BPXA 3PO3J 3QPLA 3OYIA 1MSFC 4PFPA 2X85A 1XDUA 4A3JJ 2CRGA 2CUZA 3JRHA 1W7PA 5E3LA 3H35A 2TDXA 2O7OA 2XPWA 3M9AA 3LSMA 3IKVA 3KP5A 1HXDA 2OC6A 1MNMC 2NVQJ 2EZLA 2WTEA 3G71I 1IN8A 1BR4A 1QPIA 1FZPB 1ETKA 2M4GA 3ASOH 4TV7A 2D45A 2A6TA 2Z5UA 1TT0A 5C4JJ 2JRTA 3E5UA 5HDNA 1FOKA 3HOZJ 2VQHA 3HKZA 2KL4A 1D1AA 1L0OC 3H3ZA 5IOYA 2CV2A 2ZMEB 5DD4A 3TP0A 2ZFWA 3M8JA 1OCPA 2EJRA 5E18F 2EFPA 1UMQA 4CCMA 4BHCA 3J7AY 2DU9A 2X6XA 4C2TA 4LIUA 4OIRF 3H0DA 4C3HJ 1Y1WJ 1S5LC 2MA3A 3S32A 3F23A 1ZR4A 5LHIA 4XLPF 1K78B 4ASNA 3KYCB 4O3MA 2YS9A 3CP8A 2QGUA 2QYOA 3CCVI 3PSIA 1KONA 1K4SA 3L7WA 3CC2I 3F6VA 1ETOA 2F5DA 4R8HA 2ZXHA 4HV5A 2RREA 2YU3A 5DM6F 2EPFA 3WTUC 1O4XA 1E3PA 1AU7A 2X1EA 4E70A 4P5OA 1UELB 3V7CA 4KICA 2M1BA 4B09A 3OV8A 2K4JA 1IC8A 1G59A 1B72A 1QVTA 2DA3A 4KMUX 1WGXA 2NNYA 1DGRM 4YIIA 2HQRA 3BTIA 3O8GA 4ZC3A 2NNNA 4ENNA 1HW2A 1ON1A 2DN0A 4LG0B 1GHCA 3O2PE 2R7XA 2HVRA 5H6RA 2WV1A 2HKOA 3TEDA 1UG2A 2BVMA 4L0YB 3IL2A 3DLAA 4B8XA 4EQQA 1I1SA 5L3BA 2R5YB 3DTIA 5CPRB 2Y2ZA 1RZ4A 3EUKL 4B47A 2GM4A 4U7DA 1SVLA 1TNSA 2PMZN 1YFHA 3SFZA 5FD5A 3GTPJ 1D5VA 2X48A 1MJBA 1S8NA 2DFFA 2K4BA 5EGOA 1R1UA 2CH0A 2IGNA 2K7LA 2EFOA 2ETHA 2JUCA 3MCZA 2EIJH 3KZZA 4G8XA 3ZQQA 2P5KA 5J6XA 3QP6A 1U9OA 5E8IA 3GVAA 4BGDA 1H8AC 1Z6RA 4ZTJA 2W85A 5LHGA 4B3XA 5E20A 1VFCA 4IPAA 4LJZF 3BCAA 5LGUA 1UCRA 1IW7F 1SMTA 1HKTA 2W1OA 2E5NA 2IBDA 3CUQA 4M9SA 4RAGA 4XN0A 2HTJA 2HZDA 2VE8A 4U0YA 4ON0A 3SXYA 2VB6A 2A69F 5BPIA 4PGGA 1A31A 1U5TB 3WE3A 2Q1ZB 3PIPF 2EIKH 4E4HA 5CQGA 3A0HC 3DEEA 5K1YA 2B7EA 3BG6A 4Y17A 2I8DA 4XRSG 1ZGWA 5JHUA 2QUFA 3BG7A 1LVAA 3HYIA 1ZQ3P 2A5WA 3LSTA 5L3GA 2OQRA 3RPQA 4HZFA 2R93J 3B6AA 3KP3A 3GFJA 2BE5F 1I3AA 4RM2A 4V2FA 1HQCA 4HX8A 4Q4ZF 1AHDP 2M5WA 2KFDA 4KYWA 1Z7LA 1MJ9A 1IV8A 5HS7A 5EDNA 1QZEA 3C2GA 4HPQA 3S3NA 1IN7A 3DEUA 1AOYA 3G6EI 3LMMA 2Y9YA 3TGNA 1YJ9I 1LE8A 1JXSA 3VODA 2ZC2A 3TO9A 5D6EA 2EFWA 5J4YA 2DK5A 3DEWA 2NS7A 4I0AA 4FETA 2Y0MA 4AYBN 4ZTFA 1HDDC 1BM9A 2E60A 4IEJA 3P9KA 2HVSA 2JN6A 4NC8A 4DIQA 2DMQA 4B1RA 4FCYA 5IT3A 3WTXC 4FX4A 3L2RA 3FX3A 2L7ZA 3EPZA 4I02A 3S1MJ 1FBUA 1X1CA 2ECBA 1MMDA 4E7KA 3SJMA 1Y0UA 3DKWA 4HF1A 1IZ1A 2PMZA 4BU2A 3AKZA 3GTJJ 1ZRCA 1XGOA 4LFUA 1TQPA 3PSFA 1RRJA 1CF7A 2E1CA 3BJAA 1NH3A 1LQ1A 2MC4A 5JVGF 2DYSH 2MD0A 4A3IJ 1UZCA 5K7FA 3I4NJ 4HLYA 4IKFA 2E7XA 2XB0X 3A01B 4HF2A 3A02A 1T6SA 5L3DA 4WF2A 4RLQA 1TW2A 3TOBA 3HUGB 3I59B 2HPMA 1XSXA 4Q5SF 2Q0OA 5F0HA 3BT9A 1BC8C 2VJJA 3L9FA 2IRFG 2M0CA 2DW4A 2E1NA 3ZP5A 1N78A 5GADJ 4G7HF 2BY0A 2VJIA 3IWFA 4EJTA 3I9V2 4U0VA 4CYCB 4BS9A 2HEOA 2TCTA 4HSRA 5D5UB 4YIRX 4P96A 3G2BA 1X58A 2HU9A 1YX5A 2XVCA 3LAJA 4IHXA 3ISPA 4MQ9F 4RA2A 2Y75A 1VQ9I 1XG1A 3ERMA 5DM7F 2LTPA 3GFLA 4FISA 2VE9A 1MMAA 4NHJA 1RKTA 2WBMA 4UB8C 2M45A 6PAXA 2Z2SB 3HG9A 4M3FA 2UXXA 3PIOF 5GAEJ 3WG7H 1FNNA 2BXYA 1KQ8A 2BV6A 4OINF 5D5VB 1P6RA 3RQIA 3FXQA 4JQFA 3W2VA 3UKGA 2DMTA 2L54A 3EQLF 2JA2A 3K1MA 4AYBA 1SD6A 2JVHA 2ME6A 1TNTA 2NYXA 1ZG3A 1VQNI 5EZGA 4WX9A 5D4RA 2Z16A 4XN3A 4XLEA 1FOWA 2EBIA 2O0YA 1B8IB 1MSEC 4XL9A 2W4SA 1YRNB 3V7RA 4LD5A 5HNFA 1WI9A 2M8GX 4HQEA 2PEXA 4OAZA 3IC7A 1ZAOA 4B43A 4DW6A 1Y6IA 2RKHA 2CYYA 5B1BH 2JUGA 4ZYDA 4BQQA 5F0CA 2FBHA 3J7ZI 4UNOA 2OCEA 3TW7A 3C1DA 3W6VA 4II2A 3ZR8X 3I4PA 3ESWB 4HX7A 1I50J 2WWYA 3ECOA 2STWA 3Q3SA 4LG3A 4M3EA 1ZTRA 3OYHA 1D1BA 1UG0A 5HOOA 4HDVA 3S17J 3CJRB 3K1PA 3HHHA 1VQ7I 1OQYA 3G1OA 4DBRA 4IHTA 5M5YJ 2OF7A 1Y56A 4UVCA 2LFBA 3VOEA 1R36A 2FOKA 3F0CA 2M7AA 5E1WA 5L3FA 5E3NA 1JTXA 1VNDA 3A4CA 2W25A 4U87A 3QU6A 5K5OA 1TC3C 1F43A 2JA5J 2H1KA 1RR8C 3HIFA 3H5AA 3I0TA 4W97A 4ZH4F 3CMAI 1VQMI 3HRMA 4KA4A 2IP2A 2DPDA 5E17F 1ZLKA 3VDXA 1JUSA 1J75A 5HDKA 1X3WB 2VPLA 2KJBA 1ZKGA 2JVGA 3ROUA 5L3CA 5ILUA 2M7BA 2BYVE 3PM1A 1RNLA 2VC1A 2HXIA 2HGCA 2LREA 1W7PD 3RPUA 2K85A 2HOAA 1WVRA 5DEQA 1GXQA 3SEQA 2QENA 2X6OA 3KP7A 5E1XA 2PMHA 4EMSA 5F04A 4AU7A 3HL2A 1OYIA 2FJ1A 1LNWA 2GWRA 1TW3A 4M3DA 5FKKA 2XF5A 4LMYA 5DCMB 2PN6A 3HSRA 2XKOA 5F08A 2D5VA 4JBAA 4MHGA 3WODF 3GBGA 1UHMA 2IS2A 1FLIA 2D1HA 2K9LA 4X0GA 2HWVA 3H3UA 2DMUA 2MYSA 1R6RA 5LFAA 1P7IA 2J5OA 3WGHA 2X0LA 1LPQA 3L2UA 1UFMA 3H92A 4RLFA 5AONA 4YRVA 1BR2A 3MQ0A 2YX7A 1EH8A 1UB9A 4EEFG 4F55A 5K5QA 4ENKA 3JSPA 4NBQA 4A3KJ 3BCBA 1PDNC 2LF7A 1V54H 2HNHA 2E7WA 3ZMUA 2DJIA 3FXMA 2GLOA 2Z33A 2R7OA 2DA7A 3DU5A 3R6SA 2RVCA 1MBFA 3LA2A 2CSOA 4E7IA 3AG1H 1TWGJ 3ZMZA 3S3MA 4II3A 4LB6B 2W7NA 2LH9A 2ZFUA 3GW2A 3GZNB 4L0ZB 3CCRI 4UUTA 2JZYA 1VQPI 5ILSA 2JRMA 5BOXA 4XICA 2JK3A 5CQEA 3E7LA 2QZ8A 3SHFA 3WTWC 3FK6A 3CO7C 3ZXSA 2F4IA 4B3AA 5JVTA 2ZSHB 1ZG1A 1S9HA 3IRQA 1PVEA 3WGIA 4XKVA 1ZHFA 2BOLA 5D5WB 4KDPA 5FKMA 4Y15A 4FT8A 2PQ8A 3TL4X 3ZCOA 5M3MJ 1D5YA 2BBYA 1QPMA 2XGDA 3LQRA 3CD6I 4LITA 2ZNZA 1V3FA 2J5PA 3RKWA 1W0UA 3JRFA 4A93J 5GTIC 2DT6A 3JRGA 4BE2A 1WPKA 2WC2A 3F8MA 1YS7A 3VEPA 5TGTA 5M3FJ 3GTLJ 2LKXA 3DXJF 1BI2A 2EB7A 2HDCA 4P9UA 4RDUA 2K3FA 5C4XJ 4XQFA 3GYHX 3HOXJ 4I2OA 4E7SA 1IXRC 4Y52J 3U9GA 3RYRA 5E79C 1Z05A 4IRGA 3ZN0A 2HDWA 4XORA 3GTGJ 2ZJPF 3D5SC 2IEKA 2NVXJ 1R1TA 4XM3A 3MAJA 5F27A 2JPBA 3B6CA 4ZDPA 4HAMA 4M9XA 3CF5F 3VSLA 4S04A 3H9GA 2OTJI 3ABKH 2D2WA 4CHUA 3I53A 3LSKA 2VUMJ 5C3EJ 1W36C 1D0YA 1FT9A 1YI2I 2QQ8A 2R3SA 3RYPA 4DOZA 2QM3A 4EJVA 1KZHA 1L3LA 4M74A 1O3SA 3NEUA 4NC6A 5EEGA 5BMZA 3OSGA 1AKHA 1BIBA 2W00A 2XDVA 3K1NA 4KISA 1T95A 2GXGA 5IYDJ 3CUQC 2L4AA 3GTMJ 1OCOH 2KKOA 2TRTA 3PNVA 4PGHA 1XTAA 4RB0A 2PI0A 3DPLC 1PP8F 3CCLI 5AIQA 2LKPA 2XRNA 1WJFA 2K27A 3ML6A 2VL8A 2B0LA 3ZQGA 3ZQFA 2UWMA 1ULYA 3BG5A 1QQIA 3JSOA 2LVSA 4RGXA 4HNVA 2V1UA 4BNCA 2LSOA 4BKXA 2LRDA 4XBFA 1EH7A 1XDSA 2CUEA 3QQAA 1GVJA 1BJAA 4X6AJ 2WAEA 1R71A 3HSFA 2CW8A 1OPCA 1KU2A 1RKWA 3WTSC 4UY8I 3KP2A 4UUVA 2BW3B 1MKMA 2XAHA 4PZJA 5KVRA 2MLKA 3BG9A 4PCQA 4M6XA 1OCTC 3MD2A 2F5EA 3QWLA 2E5ZA 1D0XA 2O8XA 2LBFA 2LR8A 3ULQB 4AIHA 1W5SA 4DYRA 1YLFA 4DZPA 2EQRA 2K02A 4ENJA 5F1JA 3SYTA 5CYVA 1KA8A 1QHHD 2KIMA 2FA5A 2ZXJA 4HEA2 5DS9A 1EA3A 5A2QZ 1I5ZA 1O57A 4PJNA 2HR3A 1W7PB 1P9QC 2F48A 4MTEA 2CGPA 4QWQA 2HZTA 2E1MB 2OV7A 5C44J 1VQ4I 2L9NA 3M4OJ 2VQCA 4WWCA 1KQ0A 1Z0XA 3H5RA 2O3FA 3PQJA 5LRRA 4IOAF 2ESHA 3MWMA 1X2MA 3FM3A 2FE3A 4E7ZA 2EIMH 3M07A 5FJ8J 2IS4A 4P55A 3QOPA 2E2HJ 4AIDA 1T0FC 3PFYA 1O3TA 4E7LA 3T1BA 4J00A 2IA1A 4BXXJ 3DBLB 4A3EJ 1JUMA 3A1YA 1YS6A 4GDFA 3K4JA 1Y8QB 3BZKA 2JT1A 4EVIA 1T98A 4C3IJ 2ID6A 3P7NA 5E3OA 2V6EA 2MG4A 5FLXK 4H0EA 2DDAA 4Q48A 4FASD 3HBLA 2OQGA 4RMNA 1UHWA 1XC5A 5J40A 2DYRH 1DU6A 1X4PA 4FX0A 4HG2A 2DO7A 1KYZA 2K9SA 4IL6C 2V1XA 2VT3A 1JJ8C 2V79A 3GLXA 1IRFA 3IRRA 2ACJA 3FBNB 5JLWA 3FMSA 1YW9A 1SD7A 3QPTA 4MEXF 5HLTA 1B72B 3DPUA 1AA7A 2GIZA 3GUDA 4UVBA 3L2CA 1N77A 2A05A 2LY9A 4A3MJ 1RIOH 2L7FP 3FKIJ 3J81K 1TT5B 1KU9A 2L9SA 1WJDA 4E6KG 1GXPA 5IYBJ 5JHFA 3GWZA 2P5LC 4MFEA 1ON2A 3OMYA 4C2MJ 5J4VA 1YITI 2K9QA 1T08B 5CKTA 1IO2A 4C3JJ 1QBJA 4HV6A 1XMKA 4OOIA 1YO5C 1OMIA 2FNPA 1EJ9A 3AAFA 1T56A 4ENMA 4RM3A 3IH2A 3MZHA 3OIQA 2L2OA 2M34A 2G7UA 2RGVA 4FHTA 1A04A 4XLHA 3KPHA 2LMDA 1FMWA 3ABUA 3GCMA 5EGOB 1YW7A 5TISC 3WTYC 1RUOA 3E6CC 3DF8A 3HC7A 3F3XA 3KE2A 3OYMA 1JHHA 4A2UA 4CCJA 4A3LJ 3GEZA 3W3CA 1JTYA 5BQTA 4HA8A 4UVAA 3CZ6A 1O3QA 3DWLE 2P0WA 2OBPA 3KZIC 2MBFA 3S1QJ 3LSIA 1YIJI 2JQ7A 1MBKA 5LRSA 5FD6A 5HODA 3LSHA 3PUFA 4OIPF 5DV5A 2IA0A 3CUQB 3NARA 2L01A 1J9IA 1MDMA 2KDOA 4MLOA 4BEHA 4HNUA 2DI3A 5CVJA 5HS9A 4XRMA 2K86A 1KYWA 5KCMA 3K2AA 3DPTA 4GCVA 2NRAC 2QSGX 3RPUD 2DXIA 1ZGAA 2KJCA 2Z3YA 1JE8A 2QSHX 2DAOA 3R0AA 3D0SA 4BQOA 1SFUA 3Q0UA 1WJ5A 1WQ2A 1EF4A 2Y30A 3PL8A 3OL3A 4ETSA 3ABLH 5ICGA 4D0PA 4B44A 1LDJA 3QU3A 4CCNA 4DNCA 1JKRC 1FTZA 3U21A 5H6QA 1XCBA 3LA3A 1I3QJ 3FXJA 3K4KA 3ELKA 3AG4H 3HDDA 3HRUA 1LE8B 1I1GA 3SEZA 2VJ4A 2W48A 4KN4X 3VYUB 4IJAA 4QIWN 1G3YA 3RKXA 2UUZA 3HZJA 1JKOC 2O8KA 2HQAA 2DTRA 3OY9A 3VWBA 1POGA 1TWFJ 4V19K 4LOCA 5KHDA 2VQGA 2QKMB 5FLMJ 2ELJA 3LFUA 3VYTB 2XAFA 3OR2C 5CVUA 2DA1A 4S0HB 3VYSB 2K5CA 1CF7B 1BA5A 4GXOA 3SZTA 4KN7X 1Y8RB 3L2WA 2O6GE 2FNAA 2MH2A 3K9TA 2FMLA 4ZYGA 4PK4A 1HW1A 2XPUA 4P9FA 4HOBA 1LDKB 2VXZA 3E6BA 1T2KA 4A3FJ 1FP2A 1GT0C 2A6HF 2HOEA 1JKQC 1H9GA 2N8GA 4M9ZA 1K4TA 4A3DJ 4BXFA 1QHGA 2ICWG 1V5EA 4DBQA 4M3GA 1FYMA 5CJ9A 1FC3A 4KJZA 4E7HA 2E36A 4C9YA 4XLAA 4BE1A 2DJNA 2Z99A 3I5UA 1P7JA 2Q2EA 4ZJZA 1GVDA 1MD0A 3NQOA 3DCFA 3OIPA 5JI6A 2CUJA 1DPRA 1HOMA 2MC3A 2Y69H 4V2GA 3RDIA 4ZDOA 2HYFA 3K4MA 2HYJA 1XSDA 4RAFA 2CO5A 1JT6A 1T0FA 2H27A 3V7SA 2IAIA 4XLNF 2H8RA 3DTEA 2QSFX 5E8GA 2GOXB 4OMZA 3HRTA 2XGEA 5J47A 1TP4A 2CV1A 4CICA 1I6XA 3EETA 2FXAA 4A0XA 2KMUA 1QU3A 1YYVA 2PFBA 4FE7A 5J1RA 2ZO4A 3IAM2 3GFMA 5K7HA 3I71A 3GO5A 4JYKA 4KNYA 2UZKA 5GAGJ 5LBQA 1DU0A 1K83J 1WHUA 2FQ3A 3BC8A 4I0BA 3FF5A 5F6FA 3CMYA 2LG4A 3BQZA 4MTDA 2FF4A 5FKLA 2NAZA 2CQ7A 2P6TA 3H36A 3BZ6A 4UXNA 1ZK8A 1O7LA 2HYGD 4AIJA 1W5TA 1XN7A 5FLVA 2OA4A 4I01A 3OIOA 4A0ZA 1DUXC 4YFNF 4AUXA 4UUSA 1MBEA 4MEYF 3HPGA 2V9PA 3CJNA 1Z1DA 1Z3YA 3DQVC 2GXBA 3ZMTA 1VQLI 3A0BC 1BOAA 5IP7J 3QPHA 1E3HA 1FBSA 2Q8KA 1W0TA 1F1ZA 2R7ZJ 5E1ZB 3HOSA 3GZ6A 2V9VA 4D7NA 1Y1VJ 2BY3A 1R58A 1RUNA 5J8FA 5IYCJ 3HOWJ 1X19A 1J7KA 1XS9A 4M71A 5B3SH 2QEXI 1SFEA 5ICCA 1ETYA 1OCRH 3V42A 2WAFA 3FMQA 2FMYA 5EG0A 2VONA 2MFZA 1J0RA 3U1KA 1VQOI 2OTLI 3I4MJ 4FTHA 4IRIA 3KEOA 3TKYA 4KT5C 2HOSA 1MZBA 1Y39A 3S15J 3WU1B 5DYMA 4QSHA 3LSJA 3F8FA 3K4CA 3ZQIA 3JRBA 4Y4RA 1O3RA 2K9NA 1ETXA 4W1UA 3FXKA 3H0GJ 1N25A 4J19A 1MH3A 1U2WA 1KU3A 2EA4A 4FE4A 3IH4A 4RS8A 4EJWA 1BI0A 3OS2A 1HC8A 1FBQA 5GAHJ 1H0MA 5ICFA 1J2XA 4RGRA 3CCSI 3I55I 3FM5A 4BACA 2MD5A 5GTHC 3CO6C 3FISA 3OYGA 4ZYAA 3LOCA 1D8JA 2QQBA 4UV8A 4I98B 3RJPA 2VBYA 4I09A 2GZWA 3AFHA 4IRHA 1P92A 2M3AA 3OYKA 4PJLA 3PFIA 3MZYA 1TWHJ 2V7FA 4KIGA 4QPQA 2ZKZA 4LLNA 3ERED 4CCOA 2K40A 1EKEA 3OYEA 2A61A 1IN5A 1DGWY 3GMEA 1MGTA 1N75A 1G4DA 5DDGA 2VOPA 3J80Z 2L9VA 2LK2A 3CCQI 3S8PA 2YX4A 4N9IA 5B5EC 4IQJA 2F5CA 2HQ5A 3BP8A 3LL7A 2ZCWA 4G9YA 3HOVJ 1J59A 3J7YJ 3N05A 1Z9CA 4M6VA 1B9NA 2CQNA 2DT5A 4IHYA 2AHQA 4A5NA 2DK8A 2AO9A 3ZMDA 2L4MA 4IXAA 2R7VA 2VXDA 3K4BA 2EINH 2CS3A 3EDPA 1BJZA 3PJRA 2IW5A 3S14J 4XMYA 1XGMA 2PLYA 3JRCA 2NOJB 4KFCA 3K6GA 3PNYA 2EWNA 2FD5A 2BHYA 1X1DA 4BHPA 2PJRA 3L09A 3RCOA 3G1LA 3HHGA 1PP7U 5KK1A 3M1CA 2V1DA 3CQZJ 3HM5A 2E1OA 3GZ5A 4D7MA 1YX3A 2WADA 4BAYA 5L3EA 1MJAA 2LF8A 2UXNA 3N4MA 5J3LA 1S29A 1IRXA 1WSUA 2WB1N 1WCMJ 4BBRJ 2MLGA 1X1PA 5F64A 4YFXF 1V5GA 4F93B 1SEUA 2VBXA 3CDIA 2CW0F 3FXLA 3CCEI 3Q5FA 3UR3C 3HPHA 4ABZA 4NNJA 1ERDA 1FEXA 1ZARA 1MW7A 2CJJA 3DFGA 2G0EA 4WXCA 3CMMA 1WFXA 3JRAA 1USSA 3FBIB 3NRVA 3KLNA 3QYBA 4BH9A 2XPVA 3KP4A 1QZYA 1WJCA 5D8LB 2DQRA 3OOPA 1Q1HA 4EGYA 1KGSA 3Q9SA 5BS6A 1WH7A 2G7HA 2R7TA 1VQ8I 5DTDA 1IN4A 2UV1A 1SFOJ 5KAIC 4Y7NJ 3G3ZA 1FP1D 3OWTA 4BQAA 3RIRA 1Z6TA 3K4LA 2BHZA 3HRSA 3OYNA 1U3EM 3MMYB 3SZPA 1Z77A 2PBIA 4PFOA 2EH3A 1IF1A 1WZ2A 2LP0A 3H3VK 1TWCJ 2DQLA 2PX9A 4HNTA 2P8TA 4BQNA 1S7AA 1V4RA 1P4AA 3BR3A 2L0KA 3JTGA 3W2WA 2QVOA 2XAJA 1R22A 4MFDA 2QQAA 3BR0A 2X6YA 4L5IA 4ZZDA 3S1RJ 1SD5A 3HGGA 2ZB9A 2H6BA 4N4NB 3JR9A 1BC7C 1AKHB 1M1EB 3QP5A 4AWXB 3BPVA 3V8JA 4DYQA 1W36D 3P9IA 4D5FA 2ZXWH 3BTJA 2KZVA 5BNGA 3HOTA 5KNLA 1FYLA 1HCRA 3K69A 3I56I 3DTKA 2MH9A 4B48A 2IXSA 3HOYJ 2BEOA 4FQGA 2K9MA 2EV6A 2YUSA 3HGYA 2Y9ZA 2GAUA 2QCOA 3M8EA 2CG4A 2NVTJ 3LFKA 3R60A 1R5HA 2AQEA 1Z67A 1XCVA 1Y0NA 2I5UA 3GX4X 1PUFA 3CCYA 1UHSA 4ZZLA 2IS6A 2DMPA 2XIGA 2LDUA 1YHQI 2GOMA 3T0YA 2XAQA 4MNUA 2WB1A 5FFZA 4D5CA 1U0JA 2XB5A 1IXCA 2OU2A 4ESJA 4UV9A 4XSZF 4CO8A 2ID3A 2B63J 4ESBA 1AWCA 2ZBKA 2KHMA 3COAC 1A5JA 4RGUA 1JJ6C 2V6CA 2AQFA 2XKPA 4JX5A 4KT6A 1X3UA 3O8HA 2LBFB 4L9TA 1OJLA 2X4HA 4CXFA 3JAMK 3LSRA 1WJBA 2XGCA 5B66C 4C30A 1XB4A 3OYJA 4QLCU 3OYAA 2XGXA 4HDUA 3A03A 3AG2H 1UJ8A 2EZHA 2OZUA 3I3LA 3MFKA 1IDYA 1WWXA 4CUGA 1ZLJA 3CC7I 3HTSB 1T33A 2E71A 3ZMSA 2QA4I 4R79A 4RB1A 2A6EF 2E2JJ 1ODDA 2AXTC 5K7ZA 3L1PA 1IG7A 3CLOA 2ZJRF 4GO1A 4NB5A 3RZOJ 4I6ZA 4KIFA 4X1EA 4G7ZF 5GPAA 4XOTA 1MNDA 1LFBA 1LVKA 3CP2A 2XF7A 5EZHA 4IVNA 1SD4A 5F1RA 1PUEE 4F92B 4PJMA 4YFKF 4KMFA 3BROA 5LD2C 4L18B 4ZYHA 3R4KA 5IP6A 1MNEA 3KX2A 4KIBA 2ISZA 2W84A 3I64A 4LLLA 2VBWA 1S7OA 3WTZA 2EA2A 2KISA 3F72A 4OIQF 5LEJA 2GA2A 1JHFA 2R7WA 2JMWA 3U2RA 5DUIA 1DP7P 2HPIA 2VKEA 4HBLA 1FSHA 4IF4A 1TTYA 4LK0F 2R4GA 3E6MA 1Z91A 4BXUA 1SVMA 4NQWA 5CVRA 2R5ZA 2DA5A 1X1AA 3QYEA 2RN7A 4NC7A 4WXDA 3WU0A 4HLXA 4XIDA 3IV5A 2CV0A 2HS5A 2V4JC 4Y3OA 3KLOA 1ETVA 4PJ0C 3DBHB 1A6IA 4DYCA 3CESA 1GLNA 1F9NA 2ME0A 1T8IA 4Q47A 3E97A 4K2EA 1ACIA 4YEJA 1DPUA 1XMAA 2YR2A 3C18A 1I27A 1WJAA 4A3BJ 5F0FA 4JX4A 1S72I 4HQMA 2COBA 1OISA 1BI3A 3K2ZA 3E6DA 1YQAA 1WJEA 2VJ5A 3BDDA 1WI3A 2PG4A 1OR7C 4Y33A 3K10A 2KQRA 2Y48A 2KIQA 3QAHA 5M5XJ 3U1DA 3JW4A 5TRDA 4XOPA 4DQ2A 1HLVA 4QPOA 4EM0B 5HLIA 2MSYA 4AM3A 4RAZA 4Z6YA 2KIFA 4CCLA 4EM1A 4F91B 1G3WA 2QBYA 1Z3XA 5EEAA 3OYBA 3GTOJ 1R4MB 2LY2A 2F2EA 4JX6A 1OCZH 2R92J 1O7FA
chains in the Genus database with same CATH topology
5E3NA 1CQTA 1BW6A 4A3FJ 1GT0C 1JTXA 2L9RA 1JKQC 1VNDA 2N8GA 2L7MP 4A3DJ 1GV2A 2Y31A 3TW6A 1RR7A 2EZKA 1TC3C 1F43A 1QVUA 2JA5J 4IHWA 2H1KA 4W97A 4M3GA 5FKOA 2DJNA 1JUSA 2GBYA 3HB9A 1GUUA 2CU7A 2FQ4A 1ZKGA 1P7JA 1GVDA 3DCFA 3PM1A 2HXIA 1RESA 1HOMA 5E3MA 4V2GA 2HOAA 2HYJA 3S2HJ 1RPWA 1JT6A 2I10A 2X6OA 1IJWC 5F04A 2JJ7A 1IGNA 1JUPA 2FJ1A 4BBSJ 2IAIA 4M3DA 2H8RA 5FKKA 2EZIA 1OFCX 3TP3A 2DTZA 2XGEA 5F08A 2D5VA 1MBJA 1ETWA 3GBGA 1VI0A 3SFIA 2M2EA 3OSFA 5EYRA 2CQXA 4FE7A 5J1RA 4QTRA 2JA7J 1Q1VA 2MGQA 2R5ZB 1SANA 5K7HA 1S7EA 2DMUA 4IHVA 3PO2J 3HKZN 1F36A 1P7IA 4JYKA 3BR6A 1U8BA 1GV5A 2DA2A 3S1NJ 1ORKA 3SDGA 1DU0A 1K83J 4DZJA 3BQYA 3K7AJ 3CMYA 2HDDA 3BQZA 4EEFG 1VF9A 5FKLA 5J1UA 4A3KJ 2R0QC 1X2NA 3C2BA 3ZQCA 4XK4A 2GLOA 1ZK8A 3FIWA 3RZDJ 2DA7A 5FLVA 1MBFA 3RKQA 5GPCA 3OIOA 4A3GJ 4AUXA 1G2HA 1TWGJ 4UUSA 1MBEA 3GTQJ 2YU9J 4AC0A 3ZQHA 1NK2P 5IP7J 4BY1J 4UUTA 2DA6A 1W0TA 1E3OC 2R7ZJ 3D1NI 1U9NA 5J1YA 4D7NA 1Y1VJ 3BR5A 4XICA 5IYCJ 2JK3A 3HOWJ 5IP9J 4BY7J 3E7LA 2R5YA 1XS9A 3FK6A 2ELKA 5FKNA 1JGGA 4B3AA 1NK3P 2DA4A 1ETYA 3BR1A 5FKMA 5M3MJ 5EG0A 1D5YA 1IDZA 2XGDA 3I4MJ 4FTHA 3BG3A 3JRDA 2HOSA 2HOTA 4RBOA 3S15J 4QSHA 3LSJA 1R9TJ 1HDPA 2E19A 1W0UA 3JRFA 3PO3J 3ZQIA 3QPLA 3JRBA 4A93J 3JRGA 2K9NA 1WPKA 2Y0SN 1MSFC 1ETXA 4A3JJ 4W1UA 2CRGA 3JRHA 3H0GJ 3OOUA 5M3FJ 5E3LA 4J19A 3GTLJ 2O7OA 2XPWA 2LKXA 1MH3A 1TWAJ 4RDUA 1MNMC 5C4XJ 2NVQJ 2EZLA 3HOXJ 4FE4A 3IH4A 4Y52J 1QPIA 1ETKA 3GTGJ 3ZQLA 5C4JJ 3HOZJ 3FISA 2IEKA 2NVXJ 3LOCA 1GDTA 5F27A 5IOYA 1WH5A 3B6CA 3BR2A 3BTCA 4JP0A 3TP0A 2VUMJ 1H89C 5C3EJ 1OCPA 1TWHJ 1NTCA 3IH3A 2KDZA 2ECCA 2K40A 1UMQA 3M3YJ 3OSGA 1AKHA 1Y1WJ 4C3HJ 1ZR4A 2LK2A 5IYDJ 2YS9A 3GTMJ 2TRTA 2HQ5A 1ETOA 3QPSA 3HOVJ 5IPAA 1LFUP 4M6VA 4IHYA 1FIAA 1IV6A 2AHQA 2AO9A 1O4XA 1AU7A 3LNQA 3ZQGA 3ZQFA 1IRZA 1BJZA 1IC8A 3S14J 1B72A 1QVTA 2DA3A 3JRCA 3BG5A 1WGXA 4UUSB 2LVSA 4HNVA 3BTIA 3O8GA 4M3BA 3FK7A 4BKXA 2FD5A 2DN0A 1FTTA 3Q0VA 3QQAA 2CUEA 3G1LA 4X6AJ 2WV1A 3CQZJ 4A69C 3TEDA 1UG2A 3HM5A 2E1OA 4D7MA 1RKWA 2P81A 3JREA 2R5YB 3BG9A 1OCTC 2Y2ZA 2E2IJ 2GM4A 5J3LA 2WB1N 1WCMJ 4BBRJ 1I6HJ 2LR8A 2PMZN 5EG0B 3A01A 4DYRA 3GTPJ 2X48A 4DZPA 2EQRA 5EGOA 4ABZA 2CQQA 4B4CA 5F1JA 4I76A 1FEXA 1ITYA 2CJJA 2G0EA 5DS9A 3JRAA 2NOGA 1U9OA 1H8AC 3Q0WA 3GTKJ 2XPVA 1ZR2A 2VKVA 1VFCA 3MVPA 3WHCA 1WH7A 5C44J 4CYCA 5DTDA 4L5EA 1SFOJ 4Y7NJ 3M4OJ 2VPRA 2IBDA 1Z0XA 1X2MA 1Z77A 2EH3A 2LP0A 3H3VK 1TWCJ 5FJ8J 3BR3A 2L0KA 2E2HJ 4XRSG 1ZGWA 3HOUJ 3S2DJ 2O9LA 4MO7A 4MIMA 4MFDA 4BXXJ 1ZQ3P 3BR0A 3BTLA 3NAUA 4A3EJ 1JUMA 2XRLA 3S1RJ 2X9DA 3B6AA 2R93J 3HGGA 2ZB9A 3JR9A 1JKPC 4C3IJ 2ID6A 2QF7A 4V2FA 5E3OA 1AKHB 1AHDP 2MG4A 1FJLA 4DYQA 3CDLA 4D5FA 3BTJA 5BNGA 3HBLA 5EDNA 1XC5A 2DMNA 1HCRA 1DU6A 2Y9YA 3G1MA 1LE8A 2K9SA 3HOYJ 1BW5A 4NDLA 5EF6A 1B8IA 1JJ8C 2YUSA 3DEWA 2NS7A 1HDDC 4AYBN 5JLWA 3HGYA 2Y9ZA 4IEJA 1YRNA 2QCOA 2JN6A 2DMQA 4B1RA 4FCYA 2NVTJ 1B72B 1MBHA 2L7ZA 3S1MJ 5JLXA 1K61A 1PUFA 2WAQN 2LY9A 3CCYA 1UHSA 4A3MJ 2DMPA 2ECBA 2L7FP 3FKIJ 2JWTA 4D5CA 3SJMA 3HEFA 5IYBJ 4MFEA 2XB5A 3LSPA 4C2MJ 3GTJJ 1BL0A 2K9QA 1MH4A 2ID3A 4C3JJ 2B63J 1A5JA 1U78A 1T56A 1JJ6C 3IH2A 4A3IJ 5K7FA 4JX5A 3I4NJ 3O8HA 2M34A 2FX0A 1OJLA 2XB0X 5GP9A 3A01B 3LSRA 3A02A 2XGCA 5EGOB 1QRYA 1FIPA 3A03A 4A3LJ 2EZHA 1IDYA 5F0HA 3BT9A 2LD5A 1JTYA 1T33A 2M0CA 2E2JJ 2XSDC 4GFBA 5K7ZA 3L1PA 1IG7A 3S1QJ 1APLC 3RZOJ 4I6ZA 1MBKA 5HODA 4X1EA 4CYCB 2TCTA 5GPAA 1LFBA 1X58A 3NARA 5EZHA 2NVYJ 4IHXA 4MLOA 3JRIA 1XG1A 5IOZA 1RETA 2LTPA 2KT0A 4FISA 5IP6A 4XRMA 1RKTA 5M5WJ 3K2AA 4M3FA 1IUFA 2LLKA 2JMWA 4XRSA 2VKEA 3Q0UA 2R92J 1EF4A 2CUFA 2Y30A 3RQIA 1ETQA 3UKGA 1HF0A 2R5ZA 2DMTA 2DA5A 9ANTA 2M9HA 2VI6A 2ME6A 1JKRC 3VPRA 1FTZA 4XIDA 3IV5A 4G12A 1I3QJ 1ETVA 5EZGA 3ZOBA 1A6IA 4DYCA 3HDDA 1LE8B 2MW8A 2EBIA 2ME0A 2HXOA 1B8IB 1MSEC 2W48A 4QIWN 1YRNB 4A3BJ 1JKOC 5F0FA 2O8KA 4JX4A 2M8GX 2NS8A 4DW6A 2COBA 2OPTA 1ENHA 3MN2A 2RAEA 1POGA 1PUFB 1TWFJ 5F0CA 3TW7A 4LOCA 1WI3A 3W6VA 5FLMJ 1I50J 3Q3SA 4M3EA 1ZTRA 2DA1A 5M5XJ 4S0HB 3MKLA 4A3CJ 1HLVA 3WHBA 2JA6J 3S17J 1BA5A 2MSYA 2HI3A 3G1OA 3S16J 1MBGA 3LSGA 2JA8J 1JT0A 5M5YJ 5EEAA 2OF7A 3GTOJ 1H88C 4JX6A 2LFBA 3F0CA 2XPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3N A;  1CQT A;  1BW6 A;  4A3F J;  1GT0 C;  1JTX A;  2L9R A;  1JKQ C;  1VND A;  2N8G A;  2L7M P;  4A3D J;  1GV2 A;  2Y31 A;  3TW6 A;  1RR7 A;  2EZK A;  1TC3 C;  1F43 A;  1QVU A;  2JA5 J;  4IHW A;  2H1K A;  4W97 A;  4M3G A;  5FKO A;  2DJN A;  1JUS A;  2GBY A;  3HB9 A;  1GUU A;  2CU7 A;  2FQ4 A;  1ZKG A;  1P7J A;  1GVD A;  3DCF A;  3PM1 A;  2HXI A;  1RES A;  1HOM A;  5E3M A;  4V2G A;  2HOA A;  2HYJ A;  3S2H J;  1RPW A;  1JT6 A;  2I10 A;  2X6O A;  1IJW C;  5F04 A;  2JJ7 A;  1IGN A;  1JUP A;  2FJ1 A;  4BBS J;  2IAI A;  4M3D A;  2H8R A;  5FKK A;  2EZI A;  1OFC X;  3TP3 A;  2DTZ A;  2XGE A;  5F08 A;  2D5V A;  1MBJ A;  1ETW A;  3GBG A;  1VI0 A;  3SFI A;  2M2E A;  3OSF A;  5EYR A;  2CQX A;  4FE7 A;  5J1R A;  4QTR A;  2JA7 J;  1Q1V A;  2MGQ A;  2R5Z B;  1SAN A;  5K7H A;  1S7E A;  2DMU A;  4IHV A;  3PO2 J;  3HKZ N;  1F36 A;  1P7I A;  4JYK A;  3BR6 A;  1U8B A;  1GV5 A;  2DA2 A;  3S1N J;  1ORK A;  3SDG A;  1DU0 A;  1K83 J;  4DZJ A;  3BQY A;  3K7A J;  3CMY A;  2HDD A;  3BQZ A;  4EEF G;  1VF9 A;  5FKL A;  5J1U A;  4A3K J;  2R0Q C;  1X2N A;  3C2B A;  3ZQC A;  4XK4 A;  2GLO A;  1ZK8 A;  3FIW A;  3RZD J;  2DA7 A;  5FLV A;  1MBF A;  3RKQ A;  5GPC A;  3OIO A;  4A3G J;  4AUX A;  1G2H A;  1TWG J;  4UUS A;  1MBE A;  3GTQ J;  2YU9 J;  4AC0 A;  3ZQH A;  1NK2 P;  5IP7 J;  4BY1 J;  4UUT A;  2DA6 A;  1W0T A;  1E3O C;  2R7Z J;  3D1N I;  1U9N A;  5J1Y A;  4D7N A;  1Y1V J;  3BR5 A;  4XIC A;  5IYC J;  2JK3 A;  3HOW J;  5IP9 J;  4BY7 J;  3E7L A;  2R5Y A;  1XS9 A;  3FK6 A;  2ELK A;  5FKN A;  1JGG A;  4B3A A;  1NK3 P;  2DA4 A;  1ETY A;  3BR1 A;  5FKM A;  5M3M J;  5EG0 A;  1D5Y A;  1IDZ A;  2XGD A;  3I4M J;  4FTH A;  3BG3 A;  3JRD A;  2HOS A;  2HOT A;  4RBO A;  3S15 J;  4QSH A;  3LSJ A;  1R9T J;  1HDP A;  2E19 A;  1W0U A;  3JRF A;  3PO3 J;  3ZQI A;  3QPL A;  3JRB A;  4A93 J;  3JRG A;  2K9N A;  1WPK A;  2Y0S N;  1MSF C;  1ETX A;  4A3J J;  4W1U A;  2CRG A;  3JRH A;  3H0G J;  3OOU A;  5M3F J;  5E3L A;  4J19 A;  3GTL J;  2O7O A;  2XPW A;  2LKX A;  1MH3 A;  1TWA J;  4RDU A;  1MNM C;  5C4X J;  2NVQ J;  2EZL A;  3HOX J;  4FE4 A;  3IH4 A;  4Y52 J;  1QPI A;  1ETK A;  3GTG J;  3ZQL A;  5C4J J;  3HOZ J;  3FIS A;  2IEK A;  2NVX J;  3LOC A;  1GDT A;  5F27 A;  5IOY A;  1WH5 A;  3B6C A;  3BR2 A;  3BTC A;  4JP0 A;  3TP0 A;  2VUM J;  1H89 C;  5C3E J;  1OCP A;  1TWH J;  1NTC A;  3IH3 A;  2KDZ A;  2ECC A;  2K40 A;  1UMQ A;  3M3Y J;  3OSG A;  1AKH A;  1Y1W J;  4C3H J;  1ZR4 A;  2LK2 A;  5IYD J;  2YS9 A;  3GTM J;  2TRT A;  2HQ5 A;  1ETO A;  3QPS A;  3HOV J;  5IPA A;  1LFU P;  4M6V A;  4IHY A;  1FIA A;  1IV6 A;  2AHQ A;  2AO9 A;  1O4X A;  1AU7 A;  3LNQ A;  3ZQG A;  3ZQF A;  1IRZ A;  1BJZ A;  1IC8 A;  3S14 J;  1B72 A;  1QVT A;  2DA3 A;  3JRC A;  3BG5 A;  1WGX A;  4UUS B;  2LVS A;  4HNV A;  3BTI A;  3O8G A;  4M3B A;  3FK7 A;  4BKX A;  2FD5 A;  2DN0 A;  1FTT A;  3Q0V A;  3QQA A;  2CUE A;  3G1L A;  4X6A J;  2WV1 A;  3CQZ J;  4A69 C;  3TED A;  1UG2 A;  3HM5 A;  2E1O A;  4D7M A;  1RKW A;  2P81 A;  3JRE A;  2R5Y B;  3BG9 A;  1OCT C;  2Y2Z A;  2E2I J;  2GM4 A;  5J3L A;  2WB1 N;  1WCM J;  4BBR J;  1I6H J;  2LR8 A;  2PMZ N;  5EG0 B;  3A01 A;  4DYR A;  3GTP J;  2X48 A;  4DZP A;  2EQR A;  5EGO A;  4ABZ A;  2CQQ A;  4B4C A;  5F1J A;  4I76 A;  1FEX A;  1ITY A;  2CJJ A;  2G0E A;  5DS9 A;  3JRA A;  2NOG A;  1U9O A;  1H8A C;  3Q0W A;  3GTK J;  2XPV A;  1ZR2 A;  2VKV A;  1VFC A;  3MVP A;  3WHC A;  1WH7 A;  5C44 J;  4CYC A;  5DTD A;  4L5E A;  1SFO J;  4Y7N J;  3M4O J;  2VPR A;  2IBD A;  1Z0X A;  1X2M A;  1Z77 A;  2EH3 A;  2LP0 A;  3H3V K;  1TWC J;  5FJ8 J;  3BR3 A;  2L0K A;  2E2H J;  4XRS G;  1ZGW A;  3HOU J;  3S2D J;  2O9L A;  4MO7 A;  4MIM A;  4MFD A;  4BXX J;  1ZQ3 P;  3BR0 A;  3BTL A;  3NAU A;  4A3E J;  1JUM A;  2XRL A;  3S1R J;  2X9D A;  3B6A A;  2R93 J;  3HGG A;  2ZB9 A;  3JR9 A;  1JKP C;  4C3I J;  2ID6 A;  2QF7 A;  4V2F A;  5E3O A;  1AKH B;  1AHD P;  2MG4 A;  1FJL A;  4DYQ A;  3CDL A;  4D5F A;  3BTJ A;  5BNG A;  3HBL A;  5EDN A;  1XC5 A;  2DMN A;  1HCR A;  1DU6 A;  2Y9Y A;  3G1M A;  1LE8 A;  2K9S A;  3HOY J;  1BW5 A;  4NDL A;  5EF6 A;  1B8I A;  1JJ8 C;  2YUS A;  3DEW A;  2NS7 A;  1HDD C;  4AYB N;  5JLW A;  3HGY A;  2Y9Z A;  4IEJ A;  1YRN A;  2QCO A;  2JN6 A;  2DMQ A;  4B1R A;  4FCY A;  2NVT J;  1B72 B;  1MBH A;  2L7Z A;  3S1M J;  5JLX A;  1K61 A;  1PUF A;  2WAQ N;  2LY9 A;  3CCY A;  1UHS A;  4A3M J;  2DMP A;  2ECB A;  2L7F P;  3FKI J;  2JWT A;  4D5C A;  3SJM A;  3HEF A;  5IYB J;  4MFE A;  2XB5 A;  3LSP A;  4C2M J;  3GTJ J;  1BL0 A;  2K9Q A;  1MH4 A;  2ID3 A;  4C3J J;  2B63 J;  1A5J A;  1U78 A;  1T56 A;  1JJ6 C;  3IH2 A;  4A3I J;  5K7F A;  4JX5 A;  3I4N J;  3O8H A;  2M34 A;  2FX0 A;  1OJL A;  2XB0 X;  5GP9 A;  3A01 B;  3LSR A;  3A02 A;  2XGC A;  5EGO B;  1QRY A;  1FIP A;  3A03 A;  4A3L J;  2EZH A;  1IDY A;  5F0H A;  3BT9 A;  2LD5 A;  1JTY A;  1T33 A;  2M0C A;  2E2J J;  2XSD C;  4GFB A;  5K7Z A;  3L1P A;  1IG7 A;  3S1Q J;  1APL C;  3RZO J;  4I6Z A;  1MBK A;  5HOD A;  4X1E A;  4CYC B;  2TCT A;  5GPA A;  1LFB A;  1X58 A;  3NAR A;  5EZH A;  2NVY J;  4IHX A;  4MLO A;  3JRI A;  1XG1 A;  5IOZ A;  1RET A;  2LTP A;  2KT0 A;  4FIS A;  5IP6 A;  4XRM A;  1RKT A;  5M5W J;  3K2A A;  4M3F A;  1IUF A;  2LLK A;  2JMW A;  4XRS A;  2VKE A;  3Q0U A;  2R92 J;  1EF4 A;  2CUF A;  2Y30 A;  3RQI A;  1ETQ A;  3UKG A;  1HF0 A;  2R5Z A;  2DMT A;  2DA5 A;  9ANT A;  2M9H A;  2VI6 A;  2ME6 A;  1JKR C;  3VPR A;  1FTZ A;  4XID A;  3IV5 A;  4G12 A;  1I3Q J;  1ETV A;  5EZG A;  3ZOB A;  1A6I A;  4DYC A;  3HDD A;  1LE8 B;  2MW8 A;  2EBI A;  2ME0 A;  2HXO A;  1B8I B;  1MSE C;  2W48 A;  4QIW N;  1YRN B;  4A3B J;  1JKO C;  5F0F A;  2O8K A;  4JX4 A;  2M8G X;  2NS8 A;  4DW6 A;  2COB A;  2OPT A;  1ENH A;  3MN2 A;  2RAE A;  1POG A;  1PUF B;  1TWF J;  5F0C A;  3TW7 A;  4LOC A;  1WI3 A;  3W6V A;  5FLM J;  1I50 J;  3Q3S A;  4M3E A;  1ZTR A;  2DA1 A;  5M5X J;  4S0H B;  3MKL A;  4A3C J;  1HLV A;  3WHB A;  2JA6 J;  3S17 J;  1BA5 A;  2MSY A;  2HI3 A;  3G1O A;  3S16 J;  1MBG A;  3LSG A;  2JA8 J;  1JT0 A;  5M5Y J;  5EEA A;  2OF7 A;  3GTO J;  1H88 C;  4JX6 A;  2LFB A;  3F0C A;  2XPU A; 
#chains in the Genus database with same CATH topology
 2L9R A;  1FWZ A;  3IP4 B;  3E0J B;  3BOQ A;  2L7M P;  2RQQ A;  1ONV A;  3HSE A;  2Y31 A;  3LAP A;  1FOY A;  3K0L A;  3TW6 A;  1RR7 A;  3C7J A;  4BUP A;  4C2U A;  3ABM H;  1MMG A;  1VTN C;  1OLT A;  4UHT A;  2KRC A;  5FKO A;  2A07 F;  2O61 A;  5EJC A;  4HW0 A;  5IT9 K;  3ZMV A;  2GBY A;  3ONQ A;  2CU7 A;  2VKD A;  2W82 A;  5LEK A;  4L9V A;  3F21 A;  3S3O A;  3RQ4 A;  2CFO A;  2DLL A;  3BZC A;  3MKZ A;  1MDM B;  1RES A;  2BVL A;  2LOO A;  1XGS A;  2F5V A;  4BEH B;  4EAT A;  3C2H A;  3S2H J;  1RPW A;  1ZN2 A;  2I10 A;  2V26 A;  5DCF A;  1IJW C;  3MKY B;  1D3Y A;  1G6N A;  2FBI A;  1HA8 A;  2JJ7 A;  5FRM A;  1IGN A;  2P4W A;  2H94 A;  2H6C A;  3ECH A;  2EZI A;  4BE0 A;  4CZZ A;  2DTZ A;  2ZME A;  1MBJ A;  1ETW A;  3TO7 A;  1VI0 A;  3SFI A;  2KLO A;  2CQX A;  4QTR A;  2GIV A;  3ZN1 A;  4S05 A;  2JA7 J;  3R61 A;  4YEL A;  2MGQ A;  4J01 A;  2KPM A;  3TMO A;  1F36 A;  4PSX A;  3VB2 A;  4EJO A;  3BR6 A;  3H9Q A;  3S1N J;  1K78 A;  4A6E A;  1ORK A;  3ASN H;  4P1W A;  2XAU A;  1P4X A;  3FXU A;  3MEX A;  1QZZ A;  3WE2 A;  3BQY A;  3K7A J;  4BJ6 C;  1U6G A;  1LUJ B;  2DPU A;  3CUO A;  1VF9 A;  2XAS A;  1B9M A;  1X2N A;  3C2B A;  2JSC A;  4M73 A;  5H2F C;  4XK4 A;  1XD7 A;  1RI7 A;  1R7J A;  3RZD J;  3FIW A;  1RC9 A;  1OYW A;  1ZRE A;  2JSP A;  2LNB A;  5H20 A;  3L2Q A;  1Z7U A;  1G2H A;  2VAS A;  1FPQ A;  2IA2 A;  2YU9 J;  1FY7 A;  4AC0 A;  3IWZ A;  3G4S I;  4R1H A;  4LG0 A;  3TO6 A;  2DBB A;  4EV0 A;  3ZQH A;  3BJO A;  1IAW A;  4XNF A;  3CCJ I;  2DA6 A;  1P4W A;  2GA1 A;  5DD8 A;  1E3O C;  1WKM A;  1JI8 A;  4ANJ A;  2NS0 A;  1U9N A;  2VKH A;  3VYR B;  5ICE A;  2EV0 A;  1DQU A;  4AIK A;  3W2A A;  2A5Y B;  2DT7 B;  2DDB A;  3CDH A;  4L9N A;  5IP9 J;  5FRO A;  2R5Y A;  1K7A A;  4D1Q A;  4IZZ A;  1JGG A;  1JGS A;  3H9J A;  1NG6 A;  4F7Z A;  3KYD B;  2P7V B;  4EJU A;  3EUH C;  3KP6 A;  2ISY A;  3BR1 A;  2FRH A;  4PDK A;  1IDZ A;  2IVM A;  4GGG A;  5ED4 A;  3BLY A;  3WU2 C;  4Y13 A;  1SFK A;  2FBK A;  3BG3 A;  3JRD A;  1QGP A;  3BWG A;  4XKC A;  2LC2 A;  5CVI A;  3MZ8 A;  5HVQ C;  2OCC H;  4PJJ A;  1HDP A;  1R9T J;  1OYY A;  2X6W A;  4AD9 A;  2Y0S N;  2WY7 Q;  1SVO A;  5TJJ A;  4EM2 A;  3OOU A;  5B1A H;  2B9S A;  3H5N A;  3JCU C;  4XR6 A;  2ADU A;  2Q2E B;  3EYY A;  1TWA J;  2FEZ A;  2P6S A;  2OJE D;  4PUS A;  1E0E A;  5A2Q K;  2XC7 A;  1FSE A;  2R7S A;  3DKY A;  3TDZ C;  4LLG F;  1FMV A;  2COM A;  2QLZ A;  4A6D A;  3Q9V A;  1U5T A;  3ZQL A;  2PJP A;  2M8E A;  1B59 A;  1HSJ A;  5LGN A;  1KU7 A;  1GDT A;  2OD5 A;  1WH5 A;  3BR2 A;  3BTC A;  2R7R A;  1W4M A;  1X3Z B;  4JP0 A;  2R7F A;  4OIO F;  2H09 A;  1H89 C;  1NTC A;  1I39 A;  3IH3 A;  2KDZ A;  2ECC A;  4IQ4 A;  3FWE A;  3M3Y J;  3P9C A;  5FO5 A;  4HYE A;  4D9J A;  1R4N B;  3CJQ B;  1R00 A;  2YSR A;  2EFQ A;  5LGT A;  2XF6 A;  1YJN I;  3QPS A;  2VIX A;  3E3V A;  3O3K A;  5IPA A;  2D1V A;  2KRF A;  3OYD A;  4IO9 F;  1SMY F;  1LFU P;  1FIA A;  1IV6 A;  2CWE A;  2JTV A;  3LNQ A;  1SFX A;  2XRO A;  1LEB A;  1IRZ A;  2DFH A;  1Z21 A;  1XX5 A;  1G3S A;  3KYL A;  3REO A;  4UUS B;  1HST A;  3NWT A;  4BYY A;  3E1S A;  4M3B A;  4CZC A;  3FK7 A;  1OR7 A;  1FTT A;  3Q0V A;  1ZEL A;  5J8C A;  2HTS A;  2DOA A;  3FKJ A;  3OYC A;  4A69 C;  4F3Q A;  2A3S A;  2EV5 A;  2IGM A;  1LDD A;  1E2X A;  2ZSI B;  2HQN A;  1TQM A;  3T8R A;  1YW8 A;  1PJR A;  2P81 A;  3JRE A;  4G6T B;  2A68 F;  3CC4 I;  2QKL B;  5DUK A;  3NWS A;  2E2I J;  2VQL A;  2M4K A;  5FB2 A;  3KET A;  2K3P A;  2L5Q A;  1I6H J;  1H9T A;  2Y0S A;  5KAF C;  3S2W A;  4M6Y A;  5D4S A;  5EG0 B;  3A01 A;  3WG9 A;  4DJA A;  2VT2 A;  2CQQ A;  3OR1 C;  3CCU I;  2RQP A;  4PSW A;  3HUG A;  4B4C A;  3I59 A;  4A12 A;  4I76 A;  1ITY A;  3DLL F;  3I58 A;  3PQK A;  2E34 A;  1DDN A;  2H1L A;  2YPR A;  2NOG A;  3ZRG A;  2E35 A;  3K70 D;  2RNG A;  5FGM A;  3CF2 A;  3Q0W A;  1D0Z A;  1STZ A;  4G94 A;  4F52 A;  3GTK J;  1SAX A;  3HXL A;  4WK8 F;  1ZR2 A;  5HDG A;  2VKV A;  4ZDL A;  3B73 A;  4LIV A;  3MVP A;  3WHC A;  2F5F A;  1TL8 A;  4CYC A;  3L2V A;  3CME I;  4L5E A;  2VPR A;  3ABT A;  2F4O B;  2F6C A;  3M7G A;  3DV8 A;  4XRF A;  3K70 C;  2LYC A;  3AL0 C;  1BOB A;  1LB2 A;  2WA0 A;  4BDY A;  2XAG A;  2AS5 F;  4NUB A;  3HOU J;  3S2D J;  2W57 A;  2O9L A;  1EV7 A;  3CLQ A;  4MO7 A;  4MIM A;  5FRN A;  4O6J A;  3T5X A;  3BTL A;  1MIJ A;  3NAU A;  3CTA A;  3F6O A;  3IHU A;  2XRL A;  4CH7 A;  2X9D A;  2VOD A;  2LY1 A;  1ZG5 A;  1BIA A;  1JKP C;  2XV4 S;  2BGC A;  1J09 A;  2QF7 A;  2MAB A;  1FJL A;  2QQ9 A;  3CDL A;  3FXO A;  3FXR A;  1D1C A;  1X4O A;  2DMN A;  4OAY A;  3SDB A;  4G6D A;  3WGG A;  1HBX G;  3FZV A;  3G1M A;  1T38 A;  1CGP A;  2P7C B;  1YTY A;  3JAM Z;  1BR1 A;  1BW5 A;  3TDU C;  4NDL A;  5EF6 A;  1B8I A;  1K79 A;  3RSN A;  1YRN A;  2Z9O A;  2RV8 A;  1XPX A;  4CGZ A;  2GQQ A;  4A0Y A;  3UNG C;  5LLQ A;  3W6J B;  3EYI A;  1MBH A;  3QOE A;  5JLX A;  2ZJQ F;  1K61 A;  1ZGJ A;  1FX7 A;  2WAQ N;  3SQN A;  2F4M B;  3FMR A;  2ZJ2 A;  2PJR B;  2JWT A;  2L7K A;  1W5C C;  4ZYE A;  3R0J A;  1G3T A;  3HEF A;  2ESN A;  1FYK A;  3P5J A;  4N0B A;  3LSP A;  1T39 A;  1BL0 A;  4HST A;  2CFX A;  2RDP A;  1MH4 A;  1X1B A;  1KQ9 A;  2OAZ A;  1QA6 A;  1IXS B;  1HW5 A;  5ERI A;  2H8W A;  1TBX A;  1W1W E;  2DCE A;  1BN5 A;  2HFH A;  2IGO A;  2M30 A;  4AVP A;  1U78 A;  2ZXI A;  1ZH5 A;  1DP3 A;  3EUH A;  4RB2 C;  3IAS 2;  4BJ5 C;  4CCK A;  2OZ6 A;  3L00 A;  1XMX A;  2FX0 A;  2VC0 A;  2G9W A;  5GP9 A;  3ZGK A;  1BI1 A;  3D5L A;  1QRY A;  1YOV B;  1FIP A;  2FOW A;  1B1B A;  4WXH A;  2LD5 A;  1SAU A;  4CSW A;  5HLG A;  4CDG A;  3F8N A;  4JK1 X;  5HS8 A;  4BHB A;  2XSD C;  3F22 A;  4GFB A;  5CVV A;  1MMS A;  3O6B B;  1APL C;  1C0W A;  2WY8 Q;  2VLA A;  2X51 A;  4MQV A;  3F8C A;  1UST A;  2FU4 A;  4O5V A;  1S3J A;  1S6L A;  3M8F A;  2EFN A;  1YIO A;  2GXA A;  4ESF A;  1U8R A;  1ZRF A;  2E1M C;  2DOF A;  3T8T A;  4GYG A;  5K5R A;  2NVY J;  2KIU A;  3SZG A;  3VFZ A;  3JRI A;  5IOZ A;  1SC7 A;  1RET A;  2KT0 A;  3I54 A;  1ZYR F;  4I7H A;  5M5W J;  1TZL A;  1EH6 A;  5AIP A;  1IUF A;  2VBZ A;  2BY2 A;  1F5T A;  2LLK A;  5FLX Z;  1IUY A;  5DCM A;  3HJE A;  4XRS A;  2NVU B;  1WRJ A;  3X2Q H;  3E5X A;  1IRG A;  2CUF A;  1LFP A;  2R7Q A;  1V5F A;  4U0W A;  1ETQ A;  1LJ9 A;  2IPQ X;  1HF0 A;  2O03 A;  1QNT A;  3BY6 A;  1F4K A;  9ANT A;  2M9H A;  1J5Y A;  4L5J A;  3KIO A;  2VI6 A;  3S93 A;  3OS1 A;  3VPR A;  2IGK A;  1LEA A;  2L3D A;  2JPC A;  3V8L A;  3OYF A;  2M87 A;  4G12 A;  2LKS A;  4I99 C;  3ZOB A;  2STT A;  3WTT C;  3G73 A;  1A35 A;  2WAQ A;  2MW8 A;  2V1N A;  3HTU A;  4OMY A;  2HXO A;  4KIT B;  4OU0 A;  3J7A O;  3J81 Z;  3FHN A;  4XLF A;  3OS0 A;  1LKX A;  3WTV C;  1TQI A;  3F9K A;  2VN2 A;  2NS8 A;  4IHS A;  2ZME C;  4RGS A;  2HVQ A;  4HX4 A;  2OPT A;  1ENH A;  3MN2 A;  2RAE A;  3OYL A;  1PUF B;  3BJ6 A;  3ZPL A;  1UAA A;  5IT9 Z;  2NXN B;  4JOM A;  1NHA A;  2IJL A;  3RTR A;  2VOO A;  5CLS A;  3A2K A;  4IOC F;  3MKL A;  1OKR A;  5HLH A;  4A3C J;  4HF0 A;  1QO0 D;  1MMN A;  3WHB A;  1PYV A;  2JA6 J;  5IY5 H;  3GFI A;  1K6Y A;  2HI3 A;  3FDY A;  3F8B A;  3S16 J;  1MBG A;  3LSG A;  2JA8 J;  1JT0 A;  4G7O F;  3KEQ A;  1H88 C;  4XLC A;  2P5V A;  2ZNY A;  4H4K C;  1CQT A;  1BW6 A;  3EUA A;  1IN6 A;  4AVZ A;  3AL0 B;  4U7B A;  3CJT B;  1XSV A;  4LGW A;  2XSJ C;  1GV2 A;  5BPD A;  2EZK A;  3PNT A;  1ZRD A;  5JR3 A;  1HKS A;  3CCM I;  1QVU A;  4IHW A;  1VQ5 I;  1REP C;  3W6K B;  4XKW A;  1TLH B;  3LA7 A;  5HNH A;  1B4A A;  3IUO A;  3GLL A;  4A5M A;  1A36 A;  1OCC H;  2PMU A;  2XHK A;  2BXZ A;  3B02 A;  3VSK A;  2WV0 A;  1YG2 A;  3HB9 A;  4GRI A;  5EEH A;  1GUU A;  2FQ4 A;  2X1D A;  2W24 A;  2QWW A;  3TBI A;  3GXO A;  1XGN A;  3KCC A;  2V9K A;  3KEY A;  4XON A;  5E3M A;  1E17 A;  3ZQ7 A;  2DFE A;  5FFX A;  4KUM A;  3QOD A;  2FUG 2;  2DOE A;  2R7D A;  3QYF A;  5D5X B;  1D8K A;  1JUP A;  4BBS J;  2X1C A;  1OFC X;  3DKX A;  4GYI A;  1FOX A;  3TP3 A;  4E7J A;  4OWR B;  1VZ0 A;  2BY1 A;  3IKT A;  1R49 A;  2Z1D A;  1YE9 A;  2L02 A;  2M2E A;  3LWF A;  4MGR A;  4N9H A;  5EYR A;  1R23 A;  3OSF A;  2KZG A;  4NQW B;  3MKW B;  1B6A A;  2RNJ A;  1Q1V A;  2R5Z B;  1SAN A;  4N4O B;  1S7E A;  1P2F A;  3PUB A;  2M0M A;  3HKZ N;  4IHV A;  3PO2 J;  1BBY A;  4DGW B;  2C6Y A;  1A6Q A;  4CA0 A;  1GV5 A;  2XUB A;  4UB6 C;  2DA2 A;  3DP7 A;  1U8B A;  3QRF F;  3K4N A;  3KZY A;  1NG7 A;  3SDG A;  4CYD A;  1K6O A;  4DZJ A;  4G6Q A;  5LHH A;  2OUM A;  4YIF A;  4RAY A;  2HDD A;  3TQN A;  4HRI A;  2IT0 A;  5J1U A;  3N97 A;  1U5T C;  3GF2 A;  3LQQ A;  4LK1 F;  2R0Q C;  3ZQC A;  3J80 K;  1VQK I;  3OL4 A;  4EGZ A;  1YJW I;  3C3W A;  1VQ6 I;  2FSW A;  3FHZ A;  5GPC A;  3RKQ A;  3H1C A;  4WCG A;  4A3G J;  2DOD A;  1R1V A;  3DBR B;  3E5Q A;  2CMP A;  3RKY A;  4LB5 A;  3GTQ J;  1V55 H;  1HKQ A;  2KP6 A;  3V8K A;  4BJT A;  4RB3 C;  3DU6 A;  3KFW X;  4BDZ A;  4XSX F;  1NK2 P;  4BY1 J;  2HKX A;  1R5I D;  2EIL H;  3D1N I;  3M1E A;  5J1Y A;  2IS1 A;  4L9J A;  3BR5 A;  2BW3 A;  3D5R C;  4U88 A;  3V4G A;  4YG2 F;  3JTH A;  5D8K B;  5JFR A;  4BY7 J;  4Z2Y A;  2ELK A;  5FKN A;  3TOA A;  1NK3 P;  3RI4 A;  2AXL A;  4IX7 A;  2QBY B;  2DA4 A;  2O5R A;  2CQK A;  1R5G A;  2CW7 A;  4ITV A;  2KRH A;  4XKB A;  2ELH A;  5D6F A;  3AG3 H;  5ILV A;  2HOT A;  2R7U A;  4M72 A;  4RBO A;  2BZT A;  2RC4 A;  2EK5 A;  4BL0 B;  2DFI A;  2E19 A;  1G8X A;  3BPX A;  3PO3 J;  3QPL A;  3OYI A;  1MSF C;  4PFP A;  2X85 A;  1XDU A;  4A3J J;  2CRG A;  2CUZ A;  3JRH A;  1W7P A;  5E3L A;  3H35 A;  2TDX A;  2O7O A;  2XPW A;  3M9A A;  3LSM A;  3IKV A;  3KP5 A;  1HXD A;  2OC6 A;  1MNM C;  2NVQ J;  2EZL A;  2WTE A;  3G71 I;  1IN8 A;  1BR4 A;  1QPI A;  1FZP B;  1ETK A;  2M4G A;  3ASO H;  4TV7 A;  2D45 A;  2A6T A;  2Z5U A;  1TT0 A;  5C4J J;  2JRT A;  3E5U A;  5HDN A;  1FOK A;  3HOZ J;  2VQH A;  3HKZ A;  2KL4 A;  1D1A A;  1L0O C;  3H3Z A;  5IOY A;  2CV2 A;  2ZME B;  5DD4 A;  3TP0 A;  2ZFW A;  3M8J A;  1OCP A;  2EJR A;  5E18 F;  2EFP A;  1UMQ A;  4CCM A;  4BHC A;  3J7A Y;  2DU9 A;  2X6X A;  4C2T A;  4LIU A;  4OIR F;  3H0D A;  4C3H J;  1Y1W J;  1S5L C;  2MA3 A;  3S32 A;  3F23 A;  1ZR4 A;  5LHI A;  4XLP F;  1K78 B;  4ASN A;  3KYC B;  4O3M A;  2YS9 A;  3CP8 A;  2QGU A;  2QYO A;  3CCV I;  3PSI A;  1KON A;  1K4S A;  3L7W A;  3CC2 I;  3F6V A;  1ETO A;  2F5D A;  4R8H A;  2ZXH A;  4HV5 A;  2RRE A;  2YU3 A;  5DM6 F;  2EPF A;  3WTU C;  1O4X A;  1E3P A;  1AU7 A;  2X1E A;  4E70 A;  4P5O A;  1UEL B;  3V7C A;  4KIC A;  2M1B A;  4B09 A;  3OV8 A;  2K4J A;  1IC8 A;  1G59 A;  1B72 A;  1QVT A;  2DA3 A;  4KMU X;  1WGX A;  2NNY A;  1DGR M;  4YII A;  2HQR A;  3BTI A;  3O8G A;  4ZC3 A;  2NNN A;  4ENN A;  1HW2 A;  1ON1 A;  2DN0 A;  4LG0 B;  1GHC A;  3O2P E;  2R7X A;  2HVR A;  5H6R A;  2WV1 A;  2HKO A;  3TED A;  1UG2 A;  2BVM A;  4L0Y B;  3IL2 A;  3DLA A;  4B8X A;  4EQQ A;  1I1S A;  5L3B A;  2R5Y B;  3DTI A;  5CPR B;  2Y2Z A;  1RZ4 A;  3EUK L;  4B47 A;  2GM4 A;  4U7D A;  1SVL A;  1TNS A;  2PMZ N;  1YFH A;  3SFZ A;  5FD5 A;  3GTP J;  1D5V A;  2X48 A;  1MJB A;  1S8N A;  2DFF A;  2K4B A;  5EGO A;  1R1U A;  2CH0 A;  2IGN A;  2K7L A;  2EFO A;  2ETH A;  2JUC A;  3MCZ A;  2EIJ H;  3KZZ A;  4G8X A;  3ZQQ A;  2P5K A;  5J6X A;  3QP6 A;  1U9O A;  5E8I A;  3GVA A;  4BGD A;  1H8A C;  1Z6R A;  4ZTJ A;  2W85 A;  5LHG A;  4B3X A;  5E20 A;  1VFC A;  4IPA A;  4LJZ F;  3BCA A;  5LGU A;  1UCR A;  1IW7 F;  1SMT A;  1HKT A;  2W1O A;  2E5N A;  2IBD A;  3CUQ A;  4M9S A;  4RAG A;  4XN0 A;  2HTJ A;  2HZD A;  2VE8 A;  4U0Y A;  4ON0 A;  3SXY A;  2VB6 A;  2A69 F;  5BPI A;  4PGG A;  1A31 A;  1U5T B;  3WE3 A;  2Q1Z B;  3PIP F;  2EIK H;  4E4H A;  5CQG A;  3A0H C;  3DEE A;  5K1Y A;  2B7E A;  3BG6 A;  4Y17 A;  2I8D A;  4XRS G;  1ZGW A;  5JHU A;  2QUF A;  3BG7 A;  1LVA A;  3HYI A;  1ZQ3 P;  2A5W A;  3LST A;  5L3G A;  2OQR A;  3RPQ A;  4HZF A;  2R93 J;  3B6A A;  3KP3 A;  3GFJ A;  2BE5 F;  1I3A A;  4RM2 A;  4V2F A;  1HQC A;  4HX8 A;  4Q4Z F;  1AHD P;  2M5W A;  2KFD A;  4KYW A;  1Z7L A;  1MJ9 A;  1IV8 A;  5HS7 A;  5EDN A;  1QZE A;  3C2G A;  4HPQ A;  3S3N A;  1IN7 A;  3DEU A;  1AOY A;  3G6E I;  3LMM A;  2Y9Y A;  3TGN A;  1YJ9 I;  1LE8 A;  1JXS A;  3VOD A;  2ZC2 A;  3TO9 A;  5D6E A;  2EFW A;  5J4Y A;  2DK5 A;  3DEW A;  2NS7 A;  4I0A A;  4FET A;  2Y0M A;  4AYB N;  4ZTF A;  1HDD C;  1BM9 A;  2E60 A;  4IEJ A;  3P9K A;  2HVS A;  2JN6 A;  4NC8 A;  4DIQ A;  2DMQ A;  4B1R A;  4FCY A;  5IT3 A;  3WTX C;  4FX4 A;  3L2R A;  3FX3 A;  2L7Z A;  3EPZ A;  4I02 A;  3S1M J;  1FBU A;  1X1C A;  2ECB A;  1MMD A;  4E7K A;  3SJM A;  1Y0U A;  3DKW A;  4HF1 A;  1IZ1 A;  2PMZ A;  4BU2 A;  3AKZ A;  3GTJ J;  1ZRC A;  1XGO A;  4LFU A;  1TQP A;  3PSF A;  1RRJ A;  1CF7 A;  2E1C A;  3BJA A;  1NH3 A;  1LQ1 A;  2MC4 A;  5JVG F;  2DYS H;  2MD0 A;  4A3I J;  1UZC A;  5K7F A;  3I4N J;  4HLY A;  4IKF A;  2E7X A;  2XB0 X;  3A01 B;  4HF2 A;  3A02 A;  1T6S A;  5L3D A;  4WF2 A;  4RLQ A;  1TW2 A;  3TOB A;  3HUG B;  3I59 B;  2HPM A;  1XSX A;  4Q5S F;  2Q0O A;  5F0H A;  3BT9 A;  1BC8 C;  2VJJ A;  3L9F A;  2IRF G;  2M0C A;  2DW4 A;  2E1N A;  3ZP5 A;  1N78 A;  5GAD J;  4G7H F;  2BY0 A;  2VJI A;  3IWF A;  4EJT A;  3I9V 2;  4U0V A;  4CYC B;  4BS9 A;  2HEO A;  2TCT A;  4HSR A;  5D5U B;  4YIR X;  4P96 A;  3G2B A;  1X58 A;  2HU9 A;  1YX5 A;  2XVC A;  3LAJ A;  4IHX A;  3ISP A;  4MQ9 F;  4RA2 A;  2Y75 A;  1VQ9 I;  1XG1 A;  3ERM A;  5DM7 F;  2LTP A;  3GFL A;  4FIS A;  2VE9 A;  1MMA A;  4NHJ A;  1RKT A;  2WBM A;  4UB8 C;  2M45 A;  6PAX A;  2Z2S B;  3HG9 A;  4M3F A;  2UXX A;  3PIO F;  5GAE J;  3WG7 H;  1FNN A;  2BXY A;  1KQ8 A;  2BV6 A;  4OIN F;  5D5V B;  1P6R A;  3RQI A;  3FXQ A;  4JQF A;  3W2V A;  3UKG A;  2DMT A;  2L54 A;  3EQL F;  2JA2 A;  3K1M A;  4AYB A;  1SD6 A;  2JVH A;  2ME6 A;  1TNT A;  2NYX A;  1ZG3 A;  1VQN I;  5EZG A;  4WX9 A;  5D4R A;  2Z16 A;  4XN3 A;  4XLE A;  1FOW A;  2EBI A;  2O0Y A;  1B8I B;  1MSE C;  4XL9 A;  2W4S A;  1YRN B;  3V7R A;  4LD5 A;  5HNF A;  1WI9 A;  2M8G X;  4HQE A;  2PEX A;  4OAZ A;  3IC7 A;  1ZAO A;  4B43 A;  4DW6 A;  1Y6I A;  2RKH A;  2CYY A;  5B1B H;  2JUG A;  4ZYD A;  4BQQ A;  5F0C A;  2FBH A;  3J7Z I;  4UNO A;  2OCE A;  3TW7 A;  3C1D A;  3W6V A;  4II2 A;  3ZR8 X;  3I4P A;  3ESW B;  4HX7 A;  1I50 J;  2WWY A;  3ECO A;  2STW A;  3Q3S A;  4LG3 A;  4M3E A;  1ZTR A;  3OYH A;  1D1B A;  1UG0 A;  5HOO A;  4HDV A;  3S17 J;  3CJR B;  3K1P A;  3HHH A;  1VQ7 I;  1OQY A;  3G1O A;  4DBR A;  4IHT A;  5M5Y J;  2OF7 A;  1Y56 A;  4UVC A;  2LFB A;  3VOE A;  1R36 A;  2FOK A;  3F0C A;  2M7A A;  5E1W A;  5L3F A;  5E3N A;  1JTX A;  1VND A;  3A4C A;  2W25 A;  4U87 A;  3QU6 A;  5K5O A;  1TC3 C;  1F43 A;  2JA5 J;  2H1K A;  1RR8 C;  3HIF A;  3H5A A;  3I0T A;  4W97 A;  4ZH4 F;  3CMA I;  1VQM I;  3HRM A;  4KA4 A;  2IP2 A;  2DPD A;  5E17 F;  1ZLK A;  3VDX A;  1JUS A;  1J75 A;  5HDK A;  1X3W B;  2VPL A;  2KJB A;  1ZKG A;  2JVG A;  3ROU A;  5L3C A;  5ILU A;  2M7B A;  2BYV E;  3PM1 A;  1RNL A;  2VC1 A;  2HXI A;  2HGC A;  2LRE A;  1W7P D;  3RPU A;  2K85 A;  2HOA A;  1WVR A;  5DEQ A;  1GXQ A;  3SEQ A;  2QEN A;  2X6O A;  3KP7 A;  5E1X A;  2PMH A;  4EMS A;  5F04 A;  4AU7 A;  3HL2 A;  1OYI A;  2FJ1 A;  1LNW A;  2GWR A;  1TW3 A;  4M3D A;  5FKK A;  2XF5 A;  4LMY A;  5DCM B;  2PN6 A;  3HSR A;  2XKO A;  5F08 A;  2D5V A;  4JBA A;  4MHG A;  3WOD F;  3GBG A;  1UHM A;  2IS2 A;  1FLI A;  2D1H A;  2K9L A;  4X0G A;  2HWV A;  3H3U A;  2DMU A;  2MYS A;  1R6R A;  5LFA A;  1P7I A;  2J5O A;  3WGH A;  2X0L A;  1LPQ A;  3L2U A;  1UFM A;  3H92 A;  4RLF A;  5AON A;  4YRV A;  1BR2 A;  3MQ0 A;  2YX7 A;  1EH8 A;  1UB9 A;  4EEF G;  4F55 A;  5K5Q A;  4ENK A;  3JSP A;  4NBQ A;  4A3K J;  3BCB A;  1PDN C;  2LF7 A;  1V54 H;  2HNH A;  2E7W A;  3ZMU A;  2DJI A;  3FXM A;  2GLO A;  2Z33 A;  2R7O A;  2DA7 A;  3DU5 A;  3R6S A;  2RVC A;  1MBF A;  3LA2 A;  2CSO A;  4E7I A;  3AG1 H;  1TWG J;  3ZMZ A;  3S3M A;  4II3 A;  4LB6 B;  2W7N A;  2LH9 A;  2ZFU A;  3GW2 A;  3GZN B;  4L0Z B;  3CCR I;  4UUT A;  2JZY A;  1VQP I;  5ILS A;  2JRM A;  5BOX A;  4XIC A;  2JK3 A;  5CQE A;  3E7L A;  2QZ8 A;  3SHF A;  3WTW C;  3FK6 A;  3CO7 C;  3ZXS A;  2F4I A;  4B3A A;  5JVT A;  2ZSH B;  1ZG1 A;  1S9H A;  3IRQ A;  1PVE A;  3WGI A;  4XKV A;  1ZHF A;  2BOL A;  5D5W B;  4KDP A;  5FKM A;  4Y15 A;  4FT8 A;  2PQ8 A;  3TL4 X;  3ZCO A;  5M3M J;  1D5Y A;  2BBY A;  1QPM A;  2XGD A;  3LQR A;  3CD6 I;  4LIT A;  2ZNZ A;  1V3F A;  2J5P A;  3RKW A;  1W0U A;  3JRF A;  4A93 J;  5GTI C;  2DT6 A;  3JRG A;  4BE2 A;  1WPK A;  2WC2 A;  3F8M A;  1YS7 A;  3VEP A;  5TGT A;  5M3F J;  3GTL J;  2LKX A;  3DXJ F;  1BI2 A;  2EB7 A;  2HDC A;  4P9U A;  4RDU A;  2K3F A;  5C4X J;  4XQF A;  3GYH X;  3HOX J;  4I2O A;  4E7S A;  1IXR C;  4Y52 J;  3U9G A;  3RYR A;  5E79 C;  1Z05 A;  4IRG A;  3ZN0 A;  2HDW A;  4XOR A;  3GTG J;  2ZJP F;  3D5S C;  2IEK A;  2NVX J;  1R1T A;  4XM3 A;  3MAJ A;  5F27 A;  2JPB A;  3B6C A;  4ZDP A;  4HAM A;  4M9X A;  3CF5 F;  3VSL A;  4S04 A;  3H9G A;  2OTJ I;  3ABK H;  2D2W A;  4CHU A;  3I53 A;  3LSK A;  2VUM J;  5C3E J;  1W36 C;  1D0Y A;  1FT9 A;  1YI2 I;  2QQ8 A;  2R3S A;  3RYP A;  4DOZ A;  2QM3 A;  4EJV A;  1KZH A;  1L3L A;  4M74 A;  1O3S A;  3NEU A;  4NC6 A;  5EEG A;  5BMZ A;  3OSG A;  1AKH A;  1BIB A;  2W00 A;  2XDV A;  3K1N A;  4KIS A;  1T95 A;  2GXG A;  5IYD J;  3CUQ C;  2L4A A;  3GTM J;  1OCO H;  2KKO A;  2TRT A;  3PNV A;  4PGH A;  1XTA A;  4RB0 A;  2PI0 A;  3DPL C;  1PP8 F;  3CCL I;  5AIQ A;  2LKP A;  2XRN A;  1WJF A;  2K27 A;  3ML6 A;  2VL8 A;  2B0L A;  3ZQG A;  3ZQF A;  2UWM A;  1ULY A;  3BG5 A;  1QQI A;  3JSO A;  2LVS A;  4RGX A;  4HNV A;  2V1U A;  4BNC A;  2LSO A;  4BKX A;  2LRD A;  4XBF A;  1EH7 A;  1XDS A;  2CUE A;  3QQA A;  1GVJ A;  1BJA A;  4X6A J;  2WAE A;  1R71 A;  3HSF A;  2CW8 A;  1OPC A;  1KU2 A;  1RKW A;  3WTS C;  4UY8 I;  3KP2 A;  4UUV A;  2BW3 B;  1MKM A;  2XAH A;  4PZJ A;  5KVR A;  2MLK A;  3BG9 A;  4PCQ A;  4M6X A;  1OCT C;  3MD2 A;  2F5E A;  3QWL A;  2E5Z A;  1D0X A;  2O8X A;  2LBF A;  2LR8 A;  3ULQ B;  4AIH A;  1W5S A;  4DYR A;  1YLF A;  4DZP A;  2EQR A;  2K02 A;  4ENJ A;  5F1J A;  3SYT A;  5CYV A;  1KA8 A;  1QHH D;  2KIM A;  2FA5 A;  2ZXJ A;  4HEA 2;  5DS9 A;  1EA3 A;  5A2Q Z;  1I5Z A;  1O57 A;  4PJN A;  2HR3 A;  1W7P B;  1P9Q C;  2F48 A;  4MTE A;  2CGP A;  4QWQ A;  2HZT A;  2E1M B;  2OV7 A;  5C44 J;  1VQ4 I;  2L9N A;  3M4O J;  2VQC A;  4WWC A;  1KQ0 A;  1Z0X A;  3H5R A;  2O3F A;  3PQJ A;  5LRR A;  4IOA F;  2ESH A;  3MWM A;  1X2M A;  3FM3 A;  2FE3 A;  4E7Z A;  2EIM H;  3M07 A;  5FJ8 J;  2IS4 A;  4P55 A;  3QOP A;  2E2H J;  4AID A;  1T0F C;  3PFY A;  1O3T A;  4E7L A;  3T1B A;  4J00 A;  2IA1 A;  4BXX J;  3DBL B;  4A3E J;  1JUM A;  3A1Y A;  1YS6 A;  4GDF A;  3K4J A;  1Y8Q B;  3BZK A;  2JT1 A;  4EVI A;  1T98 A;  4C3I J;  2ID6 A;  3P7N A;  5E3O A;  2V6E A;  2MG4 A;  5FLX K;  4H0E A;  2DDA A;  4Q48 A;  4FAS D;  3HBL A;  2OQG A;  4RMN A;  1UHW A;  1XC5 A;  5J40 A;  2DYR H;  1DU6 A;  1X4P A;  4FX0 A;  4HG2 A;  2DO7 A;  1KYZ A;  2K9S A;  4IL6 C;  2V1X A;  2VT3 A;  1JJ8 C;  2V79 A;  3GLX A;  1IRF A;  3IRR A;  2ACJ A;  3FBN B;  5JLW A;  3FMS A;  1YW9 A;  1SD7 A;  3QPT A;  4MEX F;  5HLT A;  1B72 B;  3DPU A;  1AA7 A;  2GIZ A;  3GUD A;  4UVB A;  3L2C A;  1N77 A;  2A05 A;  2LY9 A;  4A3M J;  1RIO H;  2L7F P;  3FKI J;  3J81 K;  1TT5 B;  1KU9 A;  2L9S A;  1WJD A;  4E6K G;  1GXP A;  5IYB J;  5JHF A;  3GWZ A;  2P5L C;  4MFE A;  1ON2 A;  3OMY A;  4C2M J;  5J4V A;  1YIT I;  2K9Q A;  1T08 B;  5CKT A;  1IO2 A;  4C3J J;  1QBJ A;  4HV6 A;  1XMK A;  4OOI A;  1YO5 C;  1OMI A;  2FNP A;  1EJ9 A;  3AAF A;  1T56 A;  4ENM A;  4RM3 A;  3IH2 A;  3MZH A;  3OIQ A;  2L2O A;  2M34 A;  2G7U A;  2RGV A;  4FHT A;  1A04 A;  4XLH A;  3KPH A;  2LMD A;  1FMW A;  3ABU A;  3GCM A;  5EGO B;  1YW7 A;  5TIS C;  3WTY C;  1RUO A;  3E6C C;  3DF8 A;  3HC7 A;  3F3X A;  3KE2 A;  3OYM A;  1JHH A;  4A2U A;  4CCJ A;  4A3L J;  3GEZ A;  3W3C A;  1JTY A;  5BQT A;  4HA8 A;  4UVA A;  3CZ6 A;  1O3Q A;  3DWL E;  2P0W A;  2OBP A;  3KZI C;  2MBF A;  3S1Q J;  3LSI A;  1YIJ I;  2JQ7 A;  1MBK A;  5LRS A;  5FD6 A;  5HOD A;  3LSH A;  3PUF A;  4OIP F;  5DV5 A;  2IA0 A;  3CUQ B;  3NAR A;  2L01 A;  1J9I A;  1MDM A;  2KDO A;  4MLO A;  4BEH A;  4HNU A;  2DI3 A;  5CVJ A;  5HS9 A;  4XRM A;  2K86 A;  1KYW A;  5KCM A;  3K2A A;  3DPT A;  4GCV A;  2NRA C;  2QSG X;  3RPU D;  2DXI A;  1ZGA A;  2KJC A;  2Z3Y A;  1JE8 A;  2QSH X;  2DAO A;  3R0A A;  3D0S A;  4BQO A;  1SFU A;  3Q0U A;  1WJ5 A;  1WQ2 A;  1EF4 A;  2Y30 A;  3PL8 A;  3OL3 A;  4ETS A;  3ABL H;  5ICG A;  4D0P A;  4B44 A;  1LDJ A;  3QU3 A;  4CCN A;  4DNC A;  1JKR C;  1FTZ A;  3U21 A;  5H6Q A;  1XCB A;  3LA3 A;  1I3Q J;  3FXJ A;  3K4K A;  3ELK A;  3AG4 H;  3HDD A;  3HRU A;  1LE8 B;  1I1G A;  3SEZ A;  2VJ4 A;  2W48 A;  4KN4 X;  3VYU B;  4IJA A;  4QIW N;  1G3Y A;  3RKX A;  2UUZ A;  3HZJ A;  1JKO C;  2O8K A;  2HQA A;  2DTR A;  3OY9 A;  3VWB A;  1POG A;  1TWF J;  4V19 K;  4LOC A;  5KHD A;  2VQG A;  2QKM B;  5FLM J;  2ELJ A;  3LFU A;  3VYT B;  2XAF A;  3OR2 C;  5CVU A;  2DA1 A;  4S0H B;  3VYS B;  2K5C A;  1CF7 B;  1BA5 A;  4GXO A;  3SZT A;  4KN7 X;  1Y8R B;  3L2W A;  2O6G E;  2FNA A;  2MH2 A;  3K9T A;  2FML A;  4ZYG A;  4PK4 A;  1HW1 A;  2XPU A;  4P9F A;  4HOB A;  1LDK B;  2VXZ A;  3E6B A;  1T2K A;  4A3F J;  1FP2 A;  1GT0 C;  2A6H F;  2HOE A;  1JKQ C;  1H9G A;  2N8G A;  4M9Z A;  1K4T A;  4A3D J;  4BXF A;  1QHG A;  2ICW G;  1V5E A;  4DBQ A;  4M3G A;  1FYM A;  5CJ9 A;  1FC3 A;  4KJZ A;  4E7H A;  2E36 A;  4C9Y A;  4XLA A;  4BE1 A;  2DJN A;  2Z99 A;  3I5U A;  1P7J A;  2Q2E A;  4ZJZ A;  1GVD A;  1MD0 A;  3NQO A;  3DCF A;  3OIP A;  5JI6 A;  2CUJ A;  1DPR A;  1HOM A;  2MC3 A;  2Y69 H;  4V2G A;  3RDI A;  4ZDO A;  2HYF A;  3K4M A;  2HYJ A;  1XSD A;  4RAF A;  2CO5 A;  1JT6 A;  1T0F A;  2H27 A;  3V7S A;  2IAI A;  4XLN F;  2H8R A;  3DTE A;  2QSF X;  5E8G A;  2GOX B;  4OMZ A;  3HRT A;  2XGE A;  5J47 A;  1TP4 A;  2CV1 A;  4CIC A;  1I6X A;  3EET A;  2FXA A;  4A0X A;  2KMU A;  1QU3 A;  1YYV A;  2PFB A;  4FE7 A;  5J1R A;  2ZO4 A;  3IAM 2;  3GFM A;  5K7H A;  3I71 A;  3GO5 A;  4JYK A;  4KNY A;  2UZK A;  5GAG J;  5LBQ A;  1DU0 A;  1K83 J;  1WHU A;  2FQ3 A;  3BC8 A;  4I0B A;  3FF5 A;  5F6F A;  3CMY A;  2LG4 A;  3BQZ A;  4MTD A;  2FF4 A;  5FKL A;  2NAZ A;  2CQ7 A;  2P6T A;  3H36 A;  3BZ6 A;  4UXN A;  1ZK8 A;  1O7L A;  2HYG D;  4AIJ A;  1W5T A;  1XN7 A;  5FLV A;  2OA4 A;  4I01 A;  3OIO A;  4A0Z A;  1DUX C;  4YFN F;  4AUX A;  4UUS A;  1MBE A;  4MEY F;  3HPG A;  2V9P A;  3CJN A;  1Z1D A;  1Z3Y A;  3DQV C;  2GXB A;  3ZMT A;  1VQL I;  3A0B C;  1BOA A;  5IP7 J;  3QPH A;  1E3H A;  1FBS A;  2Q8K A;  1W0T A;  1F1Z A;  2R7Z J;  5E1Z B;  3HOS A;  3GZ6 A;  2V9V A;  4D7N A;  1Y1V J;  2BY3 A;  1R58 A;  1RUN A;  5J8F A;  5IYC J;  3HOW J;  1X19 A;  1J7K A;  1XS9 A;  4M71 A;  5B3S H;  2QEX I;  1SFE A;  5ICC A;  1ETY A;  1OCR H;  3V42 A;  2WAF A;  3FMQ A;  2FMY A;  5EG0 A;  2VON A;  2MFZ A;  1J0R A;  3U1K A;  1VQO I;  2OTL I;  3I4M J;  4FTH A;  4IRI A;  3KEO A;  3TKY A;  4KT5 C;  2HOS A;  1MZB A;  1Y39 A;  3S15 J;  3WU1 B;  5DYM A;  4QSH A;  3LSJ A;  3F8F A;  3K4C A;  3ZQI A;  3JRB A;  4Y4R A;  1O3R A;  2K9N A;  1ETX A;  4W1U A;  3FXK A;  3H0G J;  1N25 A;  4J19 A;  1MH3 A;  1U2W A;  1KU3 A;  2EA4 A;  4FE4 A;  3IH4 A;  4RS8 A;  4EJW A;  1BI0 A;  3OS2 A;  1HC8 A;  1FBQ A;  5GAH J;  1H0M A;  5ICF A;  1J2X A;  4RGR A;  3CCS I;  3I55 I;  3FM5 A;  4BAC A;  2MD5 A;  5GTH C;  3CO6 C;  3FIS A;  3OYG A;  4ZYA A;  3LOC A;  1D8J A;  2QQB A;  4UV8 A;  4I98 B;  3RJP A;  2VBY A;  4I09 A;  2GZW A;  3AFH A;  4IRH A;  1P92 A;  2M3A A;  3OYK A;  4PJL A;  3PFI A;  3MZY A;  1TWH J;  2V7F A;  4KIG A;  4QPQ A;  2ZKZ A;  4LLN A;  3ERE D;  4CCO A;  2K40 A;  1EKE A;  3OYE A;  2A61 A;  1IN5 A;  1DGW Y;  3GME A;  1MGT A;  1N75 A;  1G4D A;  5DDG A;  2VOP A;  3J80 Z;  2L9V A;  2LK2 A;  3CCQ I;  3S8P A;  2YX4 A;  4N9I A;  5B5E C;  4IQJ A;  2F5C A;  2HQ5 A;  3BP8 A;  3LL7 A;  2ZCW A;  4G9Y A;  3HOV J;  1J59 A;  3J7Y J;  3N05 A;  1Z9C A;  4M6V A;  1B9N A;  2CQN A;  2DT5 A;  4IHY A;  2AHQ A;  4A5N A;  2DK8 A;  2AO9 A;  3ZMD A;  2L4M A;  4IXA A;  2R7V A;  2VXD A;  3K4B A;  2EIN H;  2CS3 A;  3EDP A;  1BJZ A;  3PJR A;  2IW5 A;  3S14 J;  4XMY A;  1XGM A;  2PLY A;  3JRC A;  2NOJ B;  4KFC A;  3K6G A;  3PNY A;  2EWN A;  2FD5 A;  2BHY A;  1X1D A;  4BHP A;  2PJR A;  3L09 A;  3RCO A;  3G1L A;  3HHG A;  1PP7 U;  5KK1 A;  3M1C A;  2V1D A;  3CQZ J;  3HM5 A;  2E1O A;  3GZ5 A;  4D7M A;  1YX3 A;  2WAD A;  4BAY A;  5L3E A;  1MJA A;  2LF8 A;  2UXN A;  3N4M A;  5J3L A;  1S29 A;  1IRX A;  1WSU A;  2WB1 N;  1WCM J;  4BBR J;  2MLG A;  1X1P A;  5F64 A;  4YFX F;  1V5G A;  4F93 B;  1SEU A;  2VBX A;  3CDI A;  2CW0 F;  3FXL A;  3CCE I;  3Q5F A;  3UR3 C;  3HPH A;  4ABZ A;  4NNJ A;  1ERD A;  1FEX A;  1ZAR A;  1MW7 A;  2CJJ A;  3DFG A;  2G0E A;  4WXC A;  3CMM A;  1WFX A;  3JRA A;  1USS A;  3FBI B;  3NRV A;  3KLN A;  3QYB A;  4BH9 A;  2XPV A;  3KP4 A;  1QZY A;  1WJC A;  5D8L B;  2DQR A;  3OOP A;  1Q1H A;  4EGY A;  1KGS A;  3Q9S A;  5BS6 A;  1WH7 A;  2G7H A;  2R7T A;  1VQ8 I;  5DTD A;  1IN4 A;  2UV1 A;  1SFO J;  5KAI C;  4Y7N J;  3G3Z A;  1FP1 D;  3OWT A;  4BQA A;  3RIR A;  1Z6T A;  3K4L A;  2BHZ A;  3HRS A;  3OYN A;  1U3E M;  3MMY B;  3SZP A;  1Z77 A;  2PBI A;  4PFO A;  2EH3 A;  1IF1 A;  1WZ2 A;  2LP0 A;  3H3V K;  1TWC J;  2DQL A;  2PX9 A;  4HNT A;  2P8T A;  4BQN A;  1S7A A;  1V4R A;  1P4A A;  3BR3 A;  2L0K A;  3JTG A;  3W2W A;  2QVO A;  2XAJ A;  1R22 A;  4MFD A;  2QQA A;  3BR0 A;  2X6Y A;  4L5I A;  4ZZD A;  3S1R J;  1SD5 A;  3HGG A;  2ZB9 A;  2H6B A;  4N4N B;  3JR9 A;  1BC7 C;  1AKH B;  1M1E B;  3QP5 A;  4AWX B;  3BPV A;  3V8J A;  4DYQ A;  1W36 D;  3P9I A;  4D5F A;  2ZXW H;  3BTJ A;  2KZV A;  5BNG A;  3HOT A;  5KNL A;  1FYL A;  1HCR A;  3K69 A;  3I56 I;  3DTK A;  2MH9 A;  4B48 A;  2IXS A;  3HOY J;  2BEO A;  4FQG A;  2K9M A;  2EV6 A;  2YUS A;  3HGY A;  2Y9Z A;  2GAU A;  2QCO A;  3M8E A;  2CG4 A;  2NVT J;  3LFK A;  3R60 A;  1R5H A;  2AQE A;  1Z67 A;  1XCV A;  1Y0N A;  2I5U A;  3GX4 X;  1PUF A;  3CCY A;  1UHS A;  4ZZL A;  2IS6 A;  2DMP A;  2XIG A;  2LDU A;  1YHQ I;  2GOM A;  3T0Y A;  2XAQ A;  4MNU A;  2WB1 A;  5FFZ A;  4D5C A;  1U0J A;  2XB5 A;  1IXC A;  2OU2 A;  4ESJ A;  4UV9 A;  4XSZ F;  4CO8 A;  2ID3 A;  2B63 J;  4ESB A;  1AWC A;  2ZBK A;  2KHM A;  3COA C;  1A5J A;  4RGU A;  1JJ6 C;  2V6C A;  2AQF A;  2XKP A;  4JX5 A;  4KT6 A;  1X3U A;  3O8H A;  2LBF B;  4L9T A;  1OJL A;  2X4H A;  4CXF A;  3JAM K;  3LSR A;  1WJB A;  2XGC A;  5B66 C;  4C30 A;  1XB4 A;  3OYJ A;  4QLC U;  3OYA A;  2XGX A;  4HDU A;  3A03 A;  3AG2 H;  1UJ8 A;  2EZH A;  2OZU A;  3I3L A;  3MFK A;  1IDY A;  1WWX A;  4CUG A;  1ZLJ A;  3CC7 I;  3HTS B;  1T33 A;  2E71 A;  3ZMS A;  2QA4 I;  4R79 A;  4RB1 A;  2A6E F;  2E2J J;  1ODD A;  2AXT C;  5K7Z A;  3L1P A;  1IG7 A;  3CLO A;  2ZJR F;  4GO1 A;  4NB5 A;  3RZO J;  4I6Z A;  4KIF A;  4X1E A;  4G7Z F;  5GPA A;  4XOT A;  1MND A;  1LFB A;  1LVK A;  3CP2 A;  2XF7 A;  5EZH A;  4IVN A;  1SD4 A;  5F1R A;  1PUE E;  4F92 B;  4PJM A;  4YFK F;  4KMF A;  3BRO A;  5LD2 C;  4L18 B;  4ZYH A;  3R4K A;  5IP6 A;  1MNE A;  3KX2 A;  4KIB A;  2ISZ A;  2W84 A;  3I64 A;  4LLL A;  2VBW A;  1S7O A;  3WTZ A;  2EA2 A;  2KIS A;  3F72 A;  4OIQ F;  5LEJ A;  2GA2 A;  1JHF A;  2R7W A;  2JMW A;  3U2R A;  5DUI A;  1DP7 P;  2HPI A;  2VKE A;  4HBL A;  1FSH A;  4IF4 A;  1TTY A;  4LK0 F;  2R4G A;  3E6M A;  1Z91 A;  4BXU A;  1SVM A;  4NQW A;  5CVR A;  2R5Z A;  2DA5 A;  1X1A A;  3QYE A;  2RN7 A;  4NC7 A;  4WXD A;  3WU0 A;  4HLX A;  4XID A;  3IV5 A;  2CV0 A;  2HS5 A;  2V4J C;  4Y3O A;  3KLO A;  1ETV A;  4PJ0 C;  3DBH B;  1A6I A;  4DYC A;  3CES A;  1GLN A;  1F9N A;  2ME0 A;  1T8I A;  4Q47 A;  3E97 A;  4K2E A;  1ACI A;  4YEJ A;  1DPU A;  1XMA A;  2YR2 A;  3C18 A;  1I27 A;  1WJA A;  4A3B J;  5F0F A;  4JX4 A;  1S72 I;  4HQM A;  2COB A;  1OIS A;  1BI3 A;  3K2Z A;  3E6D A;  1YQA A;  1WJE A;  2VJ5 A;  3BDD A;  1WI3 A;  2PG4 A;  1OR7 C;  4Y33 A;  3K10 A;  2KQR A;  2Y48 A;  2KIQ A;  3QAH A;  5M5X J;  3U1D A;  3JW4 A;  5TRD A;  4XOP A;  4DQ2 A;  1HLV A;  4QPO A;  4EM0 B;  5HLI A;  2MSY A;  4AM3 A;  4RAZ A;  4Z6Y A;  2KIF A;  4CCL A;  4EM1 A;  4F91 B;  1G3W A;  2QBY A;  1Z3X A;  5EEA A;  3OYB A;  3GTO J;  1R4M B;  2LY2 A;  2F2E A;  4JX6 A;  1OCZ H;  2R92 J;  1O7F A; 
#chains in the Genus database with same CATH homology
 5E3N A;  1CQT A;  1BW6 A;  4A3F J;  1GT0 C;  1JTX A;  2L9R A;  1JKQ C;  1VND A;  2N8G A;  2L7M P;  4A3D J;  1GV2 A;  2Y31 A;  3TW6 A;  1RR7 A;  2EZK A;  1TC3 C;  1F43 A;  1QVU A;  2JA5 J;  4IHW A;  2H1K A;  4W97 A;  4M3G A;  5FKO A;  2DJN A;  1JUS A;  2GBY A;  3HB9 A;  1GUU A;  2CU7 A;  2FQ4 A;  1ZKG A;  1P7J A;  1GVD A;  3DCF A;  3PM1 A;  2HXI A;  1RES A;  1HOM A;  5E3M A;  4V2G A;  2HOA A;  2HYJ A;  3S2H J;  1RPW A;  1JT6 A;  2I10 A;  2X6O A;  1IJW C;  5F04 A;  2JJ7 A;  1IGN A;  1JUP A;  2FJ1 A;  4BBS J;  2IAI A;  4M3D A;  2H8R A;  5FKK A;  2EZI A;  1OFC X;  3TP3 A;  2DTZ A;  2XGE A;  5F08 A;  2D5V A;  1MBJ A;  1ETW A;  3GBG A;  1VI0 A;  3SFI A;  2M2E A;  3OSF A;  5EYR A;  2CQX A;  4FE7 A;  5J1R A;  4QTR A;  2JA7 J;  1Q1V A;  2MGQ A;  2R5Z B;  1SAN A;  5K7H A;  1S7E A;  2DMU A;  4IHV A;  3PO2 J;  3HKZ N;  1F36 A;  1P7I A;  4JYK A;  3BR6 A;  1U8B A;  1GV5 A;  2DA2 A;  3S1N J;  1ORK A;  3SDG A;  1DU0 A;  1K83 J;  4DZJ A;  3BQY A;  3K7A J;  3CMY A;  2HDD A;  3BQZ A;  4EEF G;  1VF9 A;  5FKL A;  5J1U A;  4A3K J;  2R0Q C;  1X2N A;  3C2B A;  3ZQC A;  4XK4 A;  2GLO A;  1ZK8 A;  3FIW A;  3RZD J;  2DA7 A;  5FLV A;  1MBF A;  3RKQ A;  5GPC A;  3OIO A;  4A3G J;  4AUX A;  1G2H A;  1TWG J;  4UUS A;  1MBE A;  3GTQ J;  2YU9 J;  4AC0 A;  3ZQH A;  1NK2 P;  5IP7 J;  4BY1 J;  4UUT A;  2DA6 A;  1W0T A;  1E3O C;  2R7Z J;  3D1N I;  1U9N A;  5J1Y A;  4D7N A;  1Y1V J;  3BR5 A;  4XIC A;  5IYC J;  2JK3 A;  3HOW J;  5IP9 J;  4BY7 J;  3E7L A;  2R5Y A;  1XS9 A;  3FK6 A;  2ELK A;  5FKN A;  1JGG A;  4B3A A;  1NK3 P;  2DA4 A;  1ETY A;  3BR1 A;  5FKM A;  5M3M J;  5EG0 A;  1D5Y A;  1IDZ A;  2XGD A;  3I4M J;  4FTH A;  3BG3 A;  3JRD A;  2HOS A;  2HOT A;  4RBO A;  3S15 J;  4QSH A;  3LSJ A;  1R9T J;  1HDP A;  2E19 A;  1W0U A;  3JRF A;  3PO3 J;  3ZQI A;  3QPL A;  3JRB A;  4A93 J;  3JRG A;  2K9N A;  1WPK A;  2Y0S N;  1MSF C;  1ETX A;  4A3J J;  4W1U A;  2CRG A;  3JRH A;  3H0G J;  3OOU A;  5M3F J;  5E3L A;  4J19 A;  3GTL J;  2O7O A;  2XPW A;  2LKX A;  1MH3 A;  1TWA J;  4RDU A;  1MNM C;  5C4X J;  2NVQ J;  2EZL A;  3HOX J;  4FE4 A;  3IH4 A;  4Y52 J;  1QPI A;  1ETK A;  3GTG J;  3ZQL A;  5C4J J;  3HOZ J;  3FIS A;  2IEK A;  2NVX J;  3LOC A;  1GDT A;  5F27 A;  5IOY A;  1WH5 A;  3B6C A;  3BR2 A;  3BTC A;  4JP0 A;  3TP0 A;  2VUM J;  1H89 C;  5C3E J;  1OCP A;  1TWH J;  1NTC A;  3IH3 A;  2KDZ A;  2ECC A;  2K40 A;  1UMQ A;  3M3Y J;  3OSG A;  1AKH A;  1Y1W J;  4C3H J;  1ZR4 A;  2LK2 A;  5IYD J;  2YS9 A;  3GTM J;  2TRT A;  2HQ5 A;  1ETO A;  3QPS A;  3HOV J;  5IPA A;  1LFU P;  4M6V A;  4IHY A;  1FIA A;  1IV6 A;  2AHQ A;  2AO9 A;  1O4X A;  1AU7 A;  3LNQ A;  3ZQG A;  3ZQF A;  1IRZ A;  1BJZ A;  1IC8 A;  3S14 J;  1B72 A;  1QVT A;  2DA3 A;  3JRC A;  3BG5 A;  1WGX A;  4UUS B;  2LVS A;  4HNV A;  3BTI A;  3O8G A;  4M3B A;  3FK7 A;  4BKX A;  2FD5 A;  2DN0 A;  1FTT A;  3Q0V A;  3QQA A;  2CUE A;  3G1L A;  4X6A J;  2WV1 A;  3CQZ J;  4A69 C;  3TED A;  1UG2 A;  3HM5 A;  2E1O A;  4D7M A;  1RKW A;  2P81 A;  3JRE A;  2R5Y B;  3BG9 A;  1OCT C;  2Y2Z A;  2E2I J;  2GM4 A;  5J3L A;  2WB1 N;  1WCM J;  4BBR J;  1I6H J;  2LR8 A;  2PMZ N;  5EG0 B;  3A01 A;  4DYR A;  3GTP J;  2X48 A;  4DZP A;  2EQR A;  5EGO A;  4ABZ A;  2CQQ A;  4B4C A;  5F1J A;  4I76 A;  1FEX A;  1ITY A;  2CJJ A;  2G0E A;  5DS9 A;  3JRA A;  2NOG A;  1U9O A;  1H8A C;  3Q0W A;  3GTK J;  2XPV A;  1ZR2 A;  2VKV A;  1VFC A;  3MVP A;  3WHC A;  1WH7 A;  5C44 J;  4CYC A;  5DTD A;  4L5E A;  1SFO J;  4Y7N J;  3M4O J;  2VPR A;  2IBD A;  1Z0X A;  1X2M A;  1Z77 A;  2EH3 A;  2LP0 A;  3H3V K;  1TWC J;  5FJ8 J;  3BR3 A;  2L0K A;  2E2H J;  4XRS G;  1ZGW A;  3HOU J;  3S2D J;  2O9L A;  4MO7 A;  4MIM A;  4MFD A;  4BXX J;  1ZQ3 P;  3BR0 A;  3BTL A;  3NAU A;  4A3E J;  1JUM A;  2XRL A;  3S1R J;  2X9D A;  3B6A A;  2R93 J;  3HGG A;  2ZB9 A;  3JR9 A;  1JKP C;  4C3I J;  2ID6 A;  2QF7 A;  4V2F A;  5E3O A;  1AKH B;  1AHD P;  2MG4 A;  1FJL A;  4DYQ A;  3CDL A;  4D5F A;  3BTJ A;  5BNG A;  3HBL A;  5EDN A;  1XC5 A;  2DMN A;  1HCR A;  1DU6 A;  2Y9Y A;  3G1M A;  1LE8 A;  2K9S A;  3HOY J;  1BW5 A;  4NDL A;  5EF6 A;  1B8I A;  1JJ8 C;  2YUS A;  3DEW A;  2NS7 A;  1HDD C;  4AYB N;  5JLW A;  3HGY A;  2Y9Z A;  4IEJ A;  1YRN A;  2QCO A;  2JN6 A;  2DMQ A;  4B1R A;  4FCY A;  2NVT J;  1B72 B;  1MBH A;  2L7Z A;  3S1M J;  5JLX A;  1K61 A;  1PUF A;  2WAQ N;  2LY9 A;  3CCY A;  1UHS A;  4A3M J;  2DMP A;  2ECB A;  2L7F P;  3FKI J;  2JWT A;  4D5C A;  3SJM A;  3HEF A;  5IYB J;  4MFE A;  2XB5 A;  3LSP A;  4C2M J;  3GTJ J;  1BL0 A;  2K9Q A;  1MH4 A;  2ID3 A;  4C3J J;  2B63 J;  1A5J A;  1U78 A;  1T56 A;  1JJ6 C;  3IH2 A;  4A3I J;  5K7F A;  4JX5 A;  3I4N J;  3O8H A;  2M34 A;  2FX0 A;  1OJL A;  2XB0 X;  5GP9 A;  3A01 B;  3LSR A;  3A02 A;  2XGC A;  5EGO B;  1QRY A;  1FIP A;  3A03 A;  4A3L J;  2EZH A;  1IDY A;  5F0H A;  3BT9 A;  2LD5 A;  1JTY A;  1T33 A;  2M0C A;  2E2J J;  2XSD C;  4GFB A;  5K7Z A;  3L1P A;  1IG7 A;  3S1Q J;  1APL C;  3RZO J;  4I6Z A;  1MBK A;  5HOD A;  4X1E A;  4CYC B;  2TCT A;  5GPA A;  1LFB A;  1X58 A;  3NAR A;  5EZH A;  2NVY J;  4IHX A;  4MLO A;  3JRI A;  1XG1 A;  5IOZ A;  1RET A;  2LTP A;  2KT0 A;  4FIS A;  5IP6 A;  4XRM A;  1RKT A;  5M5W J;  3K2A A;  4M3F A;  1IUF A;  2LLK A;  2JMW A;  4XRS A;  2VKE A;  3Q0U A;  2R92 J;  1EF4 A;  2CUF A;  2Y30 A;  3RQI A;  1ETQ A;  3UKG A;  1HF0 A;  2R5Z A;  2DMT A;  2DA5 A;  9ANT A;  2M9H A;  2VI6 A;  2ME6 A;  1JKR C;  3VPR A;  1FTZ A;  4XID A;  3IV5 A;  4G12 A;  1I3Q J;  1ETV A;  5EZG A;  3ZOB A;  1A6I A;  4DYC A;  3HDD A;  1LE8 B;  2MW8 A;  2EBI A;  2ME0 A;  2HXO A;  1B8I B;  1MSE C;  2W48 A;  4QIW N;  1YRN B;  4A3B J;  1JKO C;  5F0F A;  2O8K A;  4JX4 A;  2M8G X;  2NS8 A;  4DW6 A;  2COB A;  2OPT A;  1ENH A;  3MN2 A;  2RAE A;  1POG A;  1PUF B;  1TWF J;  5F0C A;  3TW7 A;  4LOC A;  1WI3 A;  3W6V A;  5FLM J;  1I50 J;  3Q3S A;  4M3E A;  1ZTR A;  2DA1 A;  5M5X J;  4S0H B;  3MKL A;  4A3C J;  1HLV A;  3WHB A;  2JA6 J;  3S17 J;  1BA5 A;  2MSY A;  2HI3 A;  3G1O A;  3S16 J;  1MBG A;  3LSG A;  2JA8 J;  1JT0 A;  5M5Y J;  5EEA A;  2OF7 A;  3GTO J;  1H88 C;  4JX6 A;  2LFB A;  3F0C A;  2XPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...