2MGQA

Structure of ceh37 homeodomain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
GPRKNRRERTTYSRQQLEILETLFNETQYPDVFARERVADQIRLQESRIQVWFKNRRAKYRLQEKQKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein ceh-37
publication title Structure of CEH37 Homeodomain
rcsb
source organism Caenorhabditis elegans
molecule tags Dna binding protein
total genus 12
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2mgqA00
2TCTA 2O7OA 4AUXA 3TP3A 2XGEA 5EYRA 1D5YA 3BR6A 2R5ZA 3OSFA 2L9RA 4QIWN 2ZB9A 1JTXA 2XPVA 1HCRA 4A3GJ 1ORKA 1RESA 5DTDA 1OFCX 1X2NA 4QTRA 2FQ4A 1AKHB 1B72A 5JLXA 2VUMJ 1T56A 2EZKA 3IV5A 1JT6A 1OCTC 2CQXA 1UG2A 5K7HA 5IYDJ 5C3EJ 4XRSA 2DMTA 1JTYA 1BL0A 2HOAA 1FIAA 1ZKGA 2XPUA 2KT0A 2XRLA 4J19A 1VFCA 2G0EA 5IYBJ 5F04A 4S0HB 1TWHJ 5E3LA 2GM4A 4DW6A 5M3MJ 1JUPA 3S1QJ 4A3CJ 4HNVA 2H8RA 4A93J 4W97A 1HOMA 5C4JJ 1MBHA 2COBA 1FEXA 1RKWA 5FKLA 4AC0A 5EDNA 3BR5A 4D5FA 3BT9A 2WV1A 1P7JA 3G1LA 2N8GA 4G12A 4XK4A 1SANA 3S1RJ 1XS9A 4DZJA 2ELKA 3QQAA 2O8KA 2QCOA 4ABZA 4D5CA 3GTOJ 5IP9J 4B1RA 2IEKA 1ZR2A 2NVTJ 3HGGA 1MBJA 2LR8A 4DYRA 1U8BA 2HQ5A 1GV5A 3HB9A 3A01B 3LSRA 2IBDA 1HDDC 3S14J 1JKOC 1GT0C 2M9HA 1R9TJ 1IC8A 1X2MA 2W48A 3HEFA 4XICA 5F1JA 4MIMA 1A5JA 4A3IJ 2HXIA 5E3MA 4A3BJ 1NTCA 2DA5A 2X9DA 1I6HJ 3G1MA 2E2HJ 1U78A 4NDLA 2ME6A 3ZQHA 1GV2A 2H1KA 3JREA 3CQZJ 2QF7A 2DJNA 2LFBA 1ETOA 3MVPA 2XGDA 5IOZA 1A6IA 4M3FA 1AKHA 4GFBA 9ANTA 1SFOJ 1BW6A 1ITYA 3BTIA 5J3LA 3OOUA 1P7IA 5FKMA 2CU7A 3HOVJ 3JR9A 1JUSA 4IHVA 1E3OC 4V2FA 1QVUA 4B3AA 1W0UA 3HOYJ 3BTJA 2LD5A 3IH4A 4IHYA 5GP9A 2DA4A 1POGA 1MBGA 1K61A 4A3LJ 5C4XJ 1ETKA 2DA2A 4BXXJ 2DMPA 4DZPA 1NK2P 3I4NJ 2K9NA 2HYJA 3FK7A 1OCPA 1RPWA 5F0HA 4FISA 4FCYA 2HDDA 2M34A 4JX5A 3JRHA 3HOUJ 3QPLA 5IP7J 2CQQA 2E2JJ 1BW5A 1K83J 4D7NA 5FKOA 3S2HJ 1F36A 4BKXA 3GTMJ 2LK2A 2EH3A 2XGCA 2TRTA 3S17J 2YUSA 5HODA 5DS9A 1FJLA 2I10A 4D7MA 3JRAA 2DTZA 3JRGA 2ECBA 5GPCA 3I4MJ 4MFEA 3PO2J 3BG3A 1RR7A 1H88C 3LSJA 3A01A 5IP6A 4EEFG 1JKPC 1HDPA 3W6VA 1G2HA 1S7EA 2R0QC 4M3DA 3PO3J 4M3EA 1IGNA 2K40A 1WCMJ 1FIPA 2AO9A 2HXOA 1Z77A 4DYCA 1YRNB 2R93J 2CUFA 2Y9YA 2HOTA 3O8GA 4I76A 2XB5A 1W0TA 1JUMA 5J1YA 1LE8B 3HOZJ 4BBSJ 4MFDA 1MBKA 1JJ6C 3DEWA 1FTTA 4M3GA 5EG0B 1MH4A 2IAIA 4JX4A 3HGYA 5GPAA 3TP0A 2WAQN 1BA5A 2LLKA 2FX0A 1QPIA 1ETVA 4JX6A 5EZGA 3ZQCA 1HLVA 4AYBN 4B4CA 5K7FA 3BR2A 1VNDA 1F43A 2ECCA 4A3EJ 4DYQA 2DMNA 3BQYA 4JP0A 3FKIJ 2JN6A 1MSFC 2GBYA 4C2MJ 1X58A 4JYKA 4A3FJ 3VPRA 2JA8J 4C3IJ 3BG9A 2Y0SN 5IPAA 1VF9A 3S1NJ 3IH3A 5J1UA 3UKGA 2YU9J 2X6OA 5FKNA 3LSPA 1ZQ3P 1PUFB 2CJJA 2AHQA 3BR0A 2R92J 1O4XA 2DA7A 4W1UA 1MBEA 3HKZN 4A3KJ 3JRFA 3BR3A 3FK6A 2MW8A 3FIWA 1GVDA 3TW7A 1JKQC 2JA7J 1XC5A 1JJ8C 3WHBA 2R7ZJ 1WH5A 2CUEA 2DN0A 1YRNA 2JA6J 2XB0X 2E2IJ 4A3MJ 3Q3SA 5FJ8J 1LE8A 4A3DJ 2JWTA 5EGOB 1ZK8A 2R5YB 3S15J 3NARA 3HDDA 3CDLA 4M6VA 1IJWC 2DMQA 3F0CA 2GLOA 1IUFA 2VKEA 3HM5A 1RKTA 1ETYA 3K2AA 4V2GA 5IOYA 1MSEC 4X6AJ 5F27A 2FD5A 2VPRA 2CRGA 5M5XJ 2LY9A 5EEAA 4BY1J 3GTLJ 3M4OJ 2M0CA 3Q0UA 3QPSA 2VI6A 1DU0A 1IDZA 2L7MP 2RAEA 1LFUP 2D5VA 2JMWA 4IEJA 3GTKJ 3GTGJ 1VI0A 2ID3A 2OF7A 2ID6A 3MKLA 3D1NI 2Y9ZA 3A03A 1Q1VA 1IRZA 3GTQJ 1BJZA 3H0GJ 1U9NA 4A3JJ 4MO7A 5K7ZA 3C2BA 2HI3A 2LTPA 5BNGA 3BTLA 2XSDC 4UUSB 3SJMA 1AU7A 2EBIA 4FTHA 5FLVA 2E1OA 4IHXA 3HOWJ 1ZTRA 2MGQA 3SFIA 1MH3A 1PUFA 1B8IB 2L0KA 5EF6A 1ETWA 1TWGJ 1QVTA 2FJ1A 3BR1A 3E7LA 4L5EA 2YS9A 1Y1VJ 4FE7A 1EF4A 3K7AJ 1APLC 2L7FP 4CYCB 3L1PA 2M2EA 4BBRJ 3S16J 4XRSG 2EZLA 3ZOBA 3Q0VA 3ZQIA 1IDYA 2K9SA 2X48A 4RDUA 5M5YJ 3ZQGA 2LVSA 1Y1WJ 3RKQA 3LOCA 3OIOA 1HF0A 3RZDJ 2O9LA 2JK3A 5EGOA 2EZIA 2DA6A 2R5YA 1CQTA 1H89C 2Y2ZA 1JKRC 2JA5J 3HOXJ 4C3HJ 1MBFA 1JT0A 1ZR4A 5F0FA 2Y31A 1IV6A 2ME0A 1TWCJ 2EQRA 1WGXA 1OJLA 3JRIA 1AHDP 2NS8A 4IHWA 4UUTA 5FLMJ 2LP0A 3B6AA 3PM1A 4LOCA 4MLOA 2KDZA 1T33A 3TW6A 1WI3A 3RZOJ 1FTZA 2K9QA 3G1OA 3JRBA 1NK3P 2HOSA 3OSGA 2DA3A 2B63J 1GDTA 3M3YJ 1TWFJ 3S2DJ 3H3VK 2R5ZB 2NOGA 3BG5A 3DCFA 2PMZN 4UUSA 2L7ZA 4BY7J 4XRMA 2OPTA 3GTPJ 1I3QJ 1DU6A 1ENHA 1B8IA 1B72B 3CMYA 1Z0XA 5JLWA 5IYCJ 2NVXJ 2DMUA 1XG1A 2MG4A 5E3OA 1I50J 3S1MJ 4M3BA 1WPKA 1UMQA 1JGGA 2LKXA 3IH2A 4Y52J 3WHCA 2NVQJ 5EG0A 4CYCA 5M5WJ 3LSGA 3O8HA 2EZHA 2NVYJ 3JRCA 1WH7A 3RQIA 3SDGA 5EZHA 1U9OA 4RBOA 3BTCA 3A02A 4QSHA 2DA1A 1ZGWA 3FISA 3GTJJ 3ZQLA 2XPWA 1H8AC 3GBGA 4X1EA 3BQZA 2VKVA 2MSYA 3JRDA 1ETXA 1GUUA 1ETQA 2WB1N 5F08A 5M3FJ 4XIDA 1TWAJ 4C3JJ 5C44J 3TEDA 2M8GX 5F0CA 2JJ7A 2P81A 1QRYA 3LNQA 2E19A 5J1RA 1RETA 2Y30A 4FE4A 5E3NA 3NAUA 1LFBA 3Q0WA 3HBLA 4A69C 4I6ZA 5FKKA 3B6CA 1MNMC 3MN2A 1TC3C 2NS7A 3CCYA 4Y7NJ 1IG7A 1UHSA 3ZQFA
chains in the Genus database with same CATH superfamily
2OJED 4BQAA 2PLYA 1OYYA 4BQOA 3PFIA 1M1EB 2GIVA 3FMRA 4IJAA 2R5ZA 4F3QA 2XAGA 3OSFA 5D5WB 2ZB9A 1FOXA 3BJOA 4A3GJ 1GVJA 1U8RA 2Q8KA 3CF5F 4HA8A 4M73A 1FT9A 4L5JA 3OR1C 5JLXA 4J00A 3CZ6A 3AG3H 3OYHA 4A5NA 5HVQC 1MMGA 2CQXA 4ZH4F 3LFUA 5K7HA 3BZCA 5C3EJ 4XRSA 2DMTA 1MIJA 3TL4X 3TMOA 3AAFA 2HPMA 2KT0A 4RAFA 5BS6A 1MMDA 2IW5A 5IYBJ 1XCBA 5D4SA 2HOEA 2KKOA 1B9MA 2GQQA 2KQRA 2K02A 5M3MJ 4C9YA 2EINH 3EUHA 4JOMA 4LK1F 3S1QJ 2H8RA 2HKOA 4A93J 1BC8C 2I5UA 4HOBA 2J5PA 1HOMA 1IXCA 4MEYF 2VJJA 3EPZA 3WODF 2F5VA 1BR4A 3BR5A 2KJCA 4CDGA 1WJBA 2DCEA 4D0PA 1VQPI 5CVIA 4XK4A 4YIIA 2K4JA 1XS9A 4DZJA 2Z2SB 3KYLA 2QYOA 4LG0B 2IEKA 3HGGA 1MBJA 2QA4I 1MJBA 1QO0D 4DYRA 2HQ5A 5TISC 1GV5A 5ICCA 3L2QA 2UZKA 1U8BA 3TDUC 5JI6A 3G3ZA 1DPUA 2BGCA 3OYKA 2M9HA 1FMWA 5LGTA 1X2MA 4LLNA 1QU3A 4AYBA 2RV8A 4A3BJ 1J59A 2RNJA 2VC0A 1I6HJ 4ZDLA 2WC2A 3ULQB 3LSTA 2WAEA 3TGNA 4NDLA 1BC7C 1S6LA 2R3SA 2W4SA 1FBQA 4YFKF 3JREA 1ZARA 3BWGA 2XROA 2E7WA 2LFBA 5B5EC 3FHZA 1A6IA 2AXTC 1R23A 4LJZF 9ANTA 4OWRB 2LG4A 1SFOJ 3ZN1A 3BCBA 2DPUA 2V1NA 2FOWA 1P7IA 4P5OA 3JR9A 4V2FA 4PJLA 4B3AA 1ZREA 4PJMA 5D4RA 1GLNA 3BTJA 2LD5A 4RB3C 2DA4A 1KONA 3GX4X 1MBGA 2WADA 4A3LJ 3HRUA 4BXXJ 1FZPB 2LNBA 4ESFA 4OMYA 4HEA2 1XPXA 2H6CA 2K9NA 5KCMA 2ZSHB 3KE2A 3TO6A 1HW5A 2XGXA 1RPWA 4RGSA 4FCYA 1PJRA 3D5SC 1MJ9A 3HTUA 3VYSB 2CQQA 4N9HA 3HYIA 2V1DA 2E2JJ 4U87A 2MYSA 5FKOA 3SEQA 3S2HJ 4BKXA 2VBZA 2KL4A 3GTMJ 2YSRA 2CYYA 5GAGJ 1VQ7I 2GXAA 2KHMA 3S2WA 5L3FA 3BZKA 2R7VA 2YUSA 1EKEA 2DTZA 3JRGA 2EK5A 2FE3A 1YITI 2EIJH 4PFOA 4ZYEA 4IO9F 2FOKA 4HAMA 4EEFG 3WU1B 4XMYA 3GXOA 2JTVA 1FIPA 3VDXA 3OYFA 1LEAA 3WGGA 4DYCA 2M0MA 2L9NA 2HOTA 3ONQA 5DUKA 3E6DA 1X1BA 3P7NA 4F93B 3HRSA 1SD7A 3PQJA 3OS1A 1WJFA 1G8XA 1ODDA 4BBSJ 2P6SA 3AG1H 4MFDA 1KQ0A 2BHYA 5BPIA 1R1TA 5EG0B 3KEQA 4HSTA 2BHZA 4UV9A 2ZXIA 2P4WA 5GPAA 2XDVA 4HNUA 2E1CA 2WAQN 2LLKA 4N4OB 4BDZA 4XLPF 1J75A 4JX6A 3M7GA 2EILH 2H8WA 3E5QA 4UVCA 3BR2A 3ECOA 3BPVA 4EQQA 1XB4A 1YX3A 2X6XA 2QUFA 1DUXC 2EA4A 4EV0A 2NNYA 1RR8C 4H0EA 2DMNA 3GLLA 4BE0A 2VQLA 3FKIJ 1TNSA 4XSXF 2R7WA 4CO8A 3K2ZA 1HW2A 3JTGA 4PJJA 2F5FA 3CD6I 5FD5A 4CA0A 4CCLA 4C3IJ 3BG9A 2K27A 3K4KA 5IPAA 5B66C 3RYPA 1YJWI 2H94A 3S1NJ 2W82A 3JTHA 4DNCA 3UKGA 2X6OA 4HG2A 3JW4A 2ETHA 2OU2A 3CMAI 3F8FA 3JAMZ 2X1EA 3KYCB 4KT5C 2F4IA 2WAFA 1T08B 4ETSA 2R7SA 2R92J 3CO7C 2M4KA 1W36C 4CSWA 2L9VA 5HLHA 1V5EA 1T2KA 1UAAA 2LY2A 3FK6A 1WI9A 4G94A 3FIWA 1JKQC 4HQEA 3LSIA 4A6DA 4WK8F 5FFZA 1FOYA 1KYWA 1YRNA 3RYRA 4L18B 1T38A 2PQ8A 2F5CA 3Q3SA 5FJ8J 2JSPA 1LE8A 4A3DJ 3KZYA 1EV7A 4UY8I 2R5YB 1ZK8A 3S15J 4M6VA 2DMQA 2GLOA 2LH9A 4NQWB 1ZGAA 1VQLI 4ENJA 4R8HA 3ERMA 5F64A 5IOYA 3CUOA 3ZPLA 1MNDA 4RMNA 2GA1A 3A0BC 2ZMEC 3MZ8A 2LF7A 1KGSA 2VI6A 2XASA 3MD2A 2RAEA 3MCZA 1R71A 2JMWA 2E1MC 1VI0A 2OF7A 1LDDA 2PG4A 4PGGA 1UCRA 3PQKA 5JVTA 1IRZA 2ESNA 2L4MA 2O5RA 3DTIA 3C2BA 3ISPA 1TBXA 1SFKA 1SFXA 3MKWB 2LTPA 3U9GA 1Q1HA 5FLXZ 1KQ9A 3H5AA 2YX4A 2XAFA 4E7ZA 2EBIA 4FTHA 5FLVA 3HOWJ 4IHXA 3AL0B 1MH3A 3GZNB 4M6XA 4QPOA 2BW3B 3QODA 5EF6A 1B8IB 1ETWA 4XN0A 2V9KA 2ZJ2A 1YI2I 4FQGA 1QVTA 4XR6A 2CWEA 3OIQA 1Y1VJ 1MMNA 3LFKA 1RUOA 1VQ5I 2QSGX 4BEHA 3G73A 2DO7A 3PUFA 1MW7A 5L3GA 3Q0VA 3KEYA 1BBYA 2KIFA 2XF5A 4RB0A 3KZZA 2F4OB 2O3FA 3H5NA 2QVOA 3K1NA 2EV0A 4KNYA 3UR3C 3UNGC 3RI4A 2WY8Q 1J0RA 1SFEA 2DA6A 4HSRA 1CQTA 1X3WB 3HOXJ 3A4CA 2DOAA 3RTRA 1JE8A 1MBFA 1TP4A 3PIPF 1JT0A 2NS0A 1HW1A 3QOPA 2Z16A 4LG3A 4B09A 1LFPA 1BIBA 4IRHA 2DBBA 2EQRA 2LKSA 3D5LA 4E7KA 3F72A 4KUMA 3FX3A 3HOTA 2DT6A 4IHWA 3ELKA 4WCGA 5FLMJ 3K69A 3I59B 5ERIA 2ZCWA 4LIUA 4KICA 4CCNA 1BI3A 4LOCA 3LMMA 3TW6A 1YLFA 4UVAA 2OV7A 3H9QA 3AKZA 2HOSA 1W7PB 2IA1A 1IN7A 3JSPA 4KA4A 2FUG2 3GF2A 4CCJA 2NOGA 3BG5A 2VE8A 3OL4A 4AIDA 3B73A 4BS9A 2PMZN 2O61A 5EEGA 3HUGB 2KRCA 3E6MA 3GTPJ 1DU6A 2ZMEB 2ZNZA 4RGXA 4IOAF 1S7OA 3VYUB 2RN7A 4WXHA 1XGOA 2WTEA 1R1VA 1PP7U 3CMYA 1SD5A 3H9GA 4KITB 1IN6A 2P7CB 1IF1A 4LB6B 1T0FA 1FP2A 1Y56A 3I9V2 2JPBA 1SMYF 4U7BA 1UMQA 3L2CA 2LKXA 4Z6YA 2D2WA 2KDOA 3WTZA 5CKTA 4XOPA 2DOEA 4CYCA 1R22A 3LSGA 1E3HA 1XMAA 5HLTA 1DQUA 3O8HA 4A2UA 3BC8A 3I0TA 3O6BB 3V8KA 3S3NA 1BR1A 3SDGA 3CP2A 1YE9A 3X2QH 3GTJJ 3CCUI 3BQZA 2EIMH 3K4JA 3L9FA 1L0OC 4YEJA 5LHIA 2VKVA 4B47A 1YHQI 4IKFA 1GUUA 1ETQA 1FX7A 4RGUA 1TWAJ 5L3BA 4E7LA 4C3JJ 1FP1D 3P9IA 4P96A 3IAS2 2M8GX 3OWTA 4RLFA 3CC4I 1HA8A 4G7OF 3LNQA 4BXUA 4FE4A 5E17F 5H20A 3P5JA 3WTSC 2L01A 1OQYA 1LFBA 1TLHB 3Q0WA 3PNTA 4YG2F 2HZDA 1WFXA 1NG7A 4C30A 4I0AA 1TT0A 1G3SA 4KMUX 2EFWA 1TNTA 4IXAA 2RKHA 4Y7NJ 4IRIA 5CQEA 1ULYA 3QOEA 2ZBKA 4B8XA 3WE2A 3OYGA 1MDMA 2DDAA 4U0VA 2ZJQF 3TP3A 4B48A 1D5VA 1FBSA 2YR2A 3H1CA 3T8RA 1S8NA 4HLYA 3F3XA 5LEKA 4QIWN 3DEUA 3WTTC 1JTXA 3HRTA 1QQIA 1X4OA 3GEZA 3M9AA 2HKXA 4EM1A 4EJUA 4AM3A 3H3ZA 1W36D 1ORKA 3ESWB 1HSJA 4XLNF 2BYVE 1OFCX 3CCRI 3N97A 2FQ4A 1V3FA 1B72A 1PVEA 4HV6A 2VUMJ 1XN7A 2M7BA 1LDJA 1QGPA 1JT6A 4FX4A 2YX7A 4NC7A 5K5OA 4MEXF 3JAMK 1K6YA 2E5NA 1RC9A 2DAOA 4HDVA 4ESBA 1HSTA 1FIAA 1J2XA 3F23A 3S32A 3OYLA 2CQNA 3REOA 4FETA 1E17A 1W7PD 2KFDA 4RB1A 3GFIA 3D5RC 1FPQA 3OYEA 4KISA 2CV1A 5E3LA 1XCVA 2Y48A 1ZRDA 2WA0A 4HNVA 2A3SA 3PUBA 1L3LA 5C4JJ 4MQVA 3F8BA 4H4KC 3BCAA 1Z7UA 1IAWA 3NWSA 2FMYA 1A36A 3GZ5A 5FKLA 5EDNA 2OZUA 1UZCA 4XLEA 4D5FA 3BT9A 1KYZA 1EH7A 1Y6IA 4AIJA 3K70C 3J7AO 2ELKA 3LQRA 5D6EA 5LD2C 2VXZA 4HF0A 2QCOA 2NVTJ 2BXYA 1K6OA 2L9SA 4CCKA 1G4DA 1PYVA 3A01B 2A05A 3CJQB 3PJRA 1HDDC 2V6CA 2A61A 3S14J 4CZZA 1GT0C 4NC6A 1FYKA 1KU7A 2IP2A 3VOEA 3BG6A 5HNHA 1IC8A 1QA6A 1ZLKA 3OYBA 3HEFA 4XICA 3RPQA 5F1JA 3DTEA 4MIMA 4FT8A 1FYMA 4OU0A 4OINF 2QSHX 1PP8F 3W2VA 2X51A 1SC7A 2DA5A 5HS7A 5ILUA 3G1MA 5ILVA 1YJ9I 1Y8RB 2QBYB 2V9PA 1U78A 3LAJA 2ME6A 2DTRA 2RNGA 3ZQHA 4OIRF 3BZ6A 2CW7A 3CQZJ 2XAUA 2QF7A 3IC7A 3C3WA 1IV8A 3EETA 3I5UA 4AIKA 3MKYB 4M71A 2DJIA 1UELB 2RDPA 4GFBA 2EV6A 2QEXI 3ZP5A 3HHGA 5J3LA 3FBNB 2F48A 5FKMA 2Z99A 4IHVA 5K5QA 3L2WA 2Q2EA 1QVUA 3KCCA 3HZJA 1W0UA 1O3TA 2R7RA 1UFMA 4IPAA 4IHYA 4PUSA 5GP9A 1STZA 3COAC 1K61A 1ETKA 2VJ4A 4DZPA 1C0WA 3M8EA 1F1ZA 2XIGA 4B44A 3HKZA 3I4NJ 1WSUA 2DFEA 2H6BA 3LWFA 3HPGA 1ERDA 5LBQA 1OCPA 3IWZA 1ZG3A 2M34A 3U2RA 1P92A 3HOUJ 2GOMA 2ZXHA 3DKWA 3ZQ7A 2CGPA 5FRMA 1X1DA 1R5GA 5E18F 1K83J 4A5MA 4D7NA 1F36A 1LDKB 2F4MB 3EUKL 3VEPA 1YJNI 5J4YA 1VQ4I 5HODA 1N25A 3FXJA 3JRAA 4OIQF 2IGNA 4UNOA 2EJRA 2OC6A 3I4MJ 4CCOA 1P4AA 4MFEA 1R4NB 4ZC3A 1W1WE 1NG6A 4BE2A 3PO2J 5LGNA 3IKTA 1FSEA 1RR7A 4IQ4A 3LSJA 3SQNA 5IP6A 4E7HA 5FGMA 1JKPC 1A04A 1HDPA 1S7EA 2O8XA 2R0QC 3M1EA 3PO3J 4XRFA 2R93J 1YIJI 1IZ1A 4I76A 3E5UA 3QP6A 5E79C 1W0TA 2V4JC 1H9TA 1JUMA 1IW7F 2DLLA 3MQ0A 3HOZJ 4RLQA 2OA4A 4MQ9F 2X4HA 1R36A 1P2FA 2FRHA 4XSZF 2DI3A 3R0AA 3ZMSA 3DEWA 1KU3A 1OR7A 1FTTA 3TOAA 2IAIA 4UB8C 4EGYA 3HGYA 2Y0MA 4Z2YA 2H1LA 3DPUA 3VSKA 4YIRX 1U5TC 1QPIA 1MZBA 3PFYA 5LRRA 4I98B 3RPUD 3QRFF 5EZGA 3ZQCA 3HSEA 1TQPA 3I55I 5HDGA 1LNWA 4F92B 1F43A 4A3EJ 4ZZDA 4O3MA 3CDHA 3CMMA 3KX2A 1U6GA 3KP7A 5CPRB 1X3UA 4UUVA 2ACJA 5CLSA 1MSFC 4HLXA 2CUZA 5E1WA 3ABLH 3RKWA 3U1KA 4A3FJ 3VWBA 3VPRA 5HDNA 3I56I 2VODA 5LEJA 1VF9A 3IH3A 5J1UA 2COMA 1OMIA 2JZYA 1USSA 3ML6A 4R79A 4Q5SF 3LSPA 1WHUA 3LSMA 4LLLA 4AWXB 4U7DA 3F6VA 1PUFB 1YW7A 3K4LA 2CJJA 3ZMDA 1WRJA 1TTYA 4OIOF 3HPHA 3FF5A 2B7EA 1MBEA 1R5ID 3HC7A 4CHUA 5LRSA 1RRJA 2H09A 2CFXA 1VQ6I 3BR3A 2R7QA 5KHDA 3C2HA 3EYYA 2JQ7A 1O57A 2JA7J 1I5ZA 1XC5A 3PNYA 1UG0A 4YRVA 5DYMA 4LD5A 1WH5A 2DN0A 1SAXA 2V6EA 3ZN0A 4GDFA 2E2IJ 1LQ1A 1OLTA 2ADUA 4A3MJ 5D8KB 1P4XA 4YELA 1QPMA 5EGOB 3L2UA 1GXQA 3JSOA 5H2FC 3E6BA 4IRGA 3HDDA 2ZFUA 4L9NA 4ANJA 2W00A 1RKTA 1V54H 1JGSA 1Z7LA 3FXOA 5ICFA 2C6YA 5F27A 3DKYA 3I71A 5M5XJ 2LY9A 3M4OJ 4KMFA 2TDXA 1DU0A 1OISA 2DOFA 4O6JA 2B0LA 2DYRH 2IS1A 1NH3A 2Z3YA 3LSKA 4I09A 5KK1A 2ZJRF 2Y9ZA 1LVKA 5DUIA 5LHGA 3GTQJ 1U9NA 4A3JJ 4MO7A 3PSIA 5JHFA 1RUNA 3U1DA 3M8FA 2F5DA 2E35A 1HKTA 3BY6A 5FRNA 1IXSB 3RIRA 4UUSB 2STWA 1U5TB 4UV8A 3SJMA 3K70D 2PJRB 1AU7A 4RAGA 1D8KA 2IS6A 2MGQA 2HQNA 3J81K 2DFHA 2NAZA 4CGZA 2LDUA 3RSNA 2L2OA 3U21A 1J7KA 3CESA 3HSRA 2KIUA 3I53A 4XOTA 3E7LA 4L5EA 4N4NB 3KLNA 2RGVA 3KP4A 3MKZA 3K7AJ 2HDWA 2CS3A 2WB1A 1APLC 2EFOA 4TV7A 5LLQA 4KT6A 4BDYA 5KAIC 2ZNYA 3F8CA 1R58A 4GO1A 3ZQGA 3AL0C 2LYCA 4HV5A 1SEUA 1Y1WJ 3K4BA 3H35A 4ZTFA 2X6YA 1HF0A 3RZDJ 1HKQA 3W3CA 2VKDA 2BE5F 2R5YA 2EZIA 5IYDJ 2ZXJA 5AIPA 2L5QA 2VQCA 4ZZLA 1VQ8I 3M07A 4NQWA 1X19A 2Y31A 2ME0A 3E1SA 1VQKI 2LF8A 2QKMB 5LFAA 3FHNA 1ACIA 3KP6A 1W4MA 1OJLA 1UHMA 2X6WA 3L00A 1YX5A 2NS8A 2GXBA 4UUTA 4ZTJA 1R49A 3CJNA 1Z05A 3PM1A 1XDUA 4L9VA 2BV6A 1RIOH 1T33A 3LSHA 1K78B 1TW2A 3GFMA 2MC4A 1WI3A 5AONA 1H0MA 1NK3P 3G1OA 2NVUB 1X1PA 3IWFA 1X3ZB 3H3VK 3MAJA 4Q48A 2VJ5A 3EUAA 2H27A 3VSLA 5L3DA 3IKVA 5CJ9A 1SD4A 2RC4A 1I27A 3W6JB 3ABKH 5D5VB 3RQ4A 5D6FA 2BEOA 3D0SA 5DCFA 5H6RA 1Z6TA 3C18A 4BL0B 2BW3A 1B8IA 4C2UA 5HLGA 5JLWA 1VZ0A 2DMUA 3FBIB 1XG1A 4ZYGA 5E3OA 1I50J 2QSFX 3CC2I 2JUGA 4KDPA 3MZYA 1UB9A 3VODA 4Y52J 1OCZH 3CUQB 2NVQJ 3NWTA 1O7FA 2JRMA 2HPIA 3R61A 2HTSA 1FSHA 1NHAA 1G3YA 3JRCA 3DWLE 3R6SA 1WH7A 3V8JA 4XORA 3OS0A 5EZHA 2G7UA 3I58A 4XM3A 3HSFA 3I4PA 3A02A 1XSXA 4QSHA 3EQLF 5D8LB 1FYLA 3GVAA 3GW2A 1TW3A 1CF7B 3H36A 2D1HA 3BLYA 1X4PA 4LITA 3G4SI 3SDBA 4XIDA 1K7AA 2E36A 2PBIA 2P81A 1BJAA 5KNLA 1B4AA 5DEQA 1RETA 4MNUA 3CCJI 2P5LC 5E3NA 2KZVA 1RZ4A 4K2EA 2AQFA 3I59A 4S05A 1XD7A 4AVZA 2QZ8A 1O7LA 4B3XA 1D1AA 2A6HF 2QQBA 3B6CA 4LK0F 4XLCA 2M7AA 4YFNF 3CCYA 2LSOA 2IGKA 3J7YJ 1YS6A 3SHFA 1W7PA 1MKMA 1IG7A 2OBPA 4BH9A 2DK8A 4Q4ZF 4PSXA 5EYRA 2VKHA 1D5YA 1Y39A 3IL2A 4LIVA 4IX7A 3OYNA 4EM2A 2XPVA 2JVGA 1ZHFA 4P1WA 1HBXG 2M45A 3F8MA 3HUGA 4KIBA 5DTDA 2HEOA 2ZMEA 1X2NA 2GIZA 3GFJA 1W5CC 1G59A 1AKHB 3CTAA 5DD4A 1T8IA 1T56A 2MFZA 2ZC2A 2OQRA 3AG2H 1ZH5A 2MBFA 1UG2A 2CV2A 5ICEA 1XMKA 2GWRA 3L7WA 4Y17A 4QPQA 1DDNA 3CJRB 4CXFA 1ON2A 3S3OA 2D1VA 1BL0A 4BJTA 4IL6C 3O3KA 1ZLJA 2UV1A 1ZKGA 2XPUA 4J19A 1VFCA 3F21A 4G6TB 2VBYA 2L02A 3QAHA 4GYIA 4M74A 5F04A 4S0HB 1TWHJ 2GM4A 6PAXA 2QLZA 2F2EA 4RAYA 4KYWA 4A3CJ 4WWCA 2QQAA 2MC3A 1K4SA 1V55H 4G8XA 3C1DA 5CVUA 1XSDA 1FEXA 4XLAA 5DCMB 2K5CA 4AC0A 4XQFA 2W7NA 2LREA 1P7JA 4Y15A 1Z6RA 1I1GA 3G1LA 4BJ5C 4G12A 3T8TA 3B02A 2IGMA 1SANA 2R4GA 3TKYA 3S1RJ 3DTKA 5F1RA 3Q5FA 1V4RA 2O8KA 4ABZA 4D5CA 5IP9J 4I0BA 4B1RA 4WX9A 5EEHA 1FOWA 2K3FA 4HX4A 5CQGA 4ON0A 3LSRA 3CLOA 2IBDA 2K85A 5KAFC 2E60A 5J8FA 2CW8A 2D45A 2FBHA 4NNJA 2MLGA 2W48A 1DGWY 4M9SA 1DGRM 3WGIA 1A5JA 1JI8A 4XN3A 4A3IJ 5E3MA 2VL8A 1NTCA 2X9DA 2L4AA 4RA2A 4AVPA 1XMXA 5J6XA 1KA8A 5L3EA 2DFFA 2ZSIB 2KP6A 1IUYA 2CQ7A 3H5RA 4Y3OA 4OAZA 2WV0A 5EJCA 4F91B 4IHTA 4I99C 2DJNA 2UXNA 1ETOA 3MVPA 1OYWA 4UXNA 4MGRA 2X1DA 1BW6A 1ITYA 3LL7A 2UWMA 3WG9A 2CU7A 3HOVJ 5JHUA 1JUSA 2OD5A 4EMSA 2A5YB 5TGTA 4L5IA 3HOYJ 3K1PA 3O2PE 4BU2A 2EPFA 1MMAA 5C4XJ 3BP8A 4PSWA 5FB2A 1WKMA 3ERED 2HYJA 2MH2A 4HDUA 3FK7A 4BQNA 4FISA 2HDDA 3JRHA 1UJ8A 2EFQA 3QPLA 3IRRA 3TOBA 4F7ZA 1BIAA 4KJZA 3AG4H 1T6SA 3BDDA 2KISA 2QENA 3F22A 1B6AA 2Z33A 2EH3A 4IVNA 2VC1A 2XGCA 2TRTA 5HNFA 4KN7X 5DS9A 1FJLA 2I10A 3VYRB 2MD5A 4DJAA 2ECBA 4HQMA 5GPCA 2DU9A 4EJVA 3BG3A 4Y13A 3KLOA 4BQQA 3GO5A 3QYEA 2DT7B 3KETA 3A01A 3OYAA 3W6VA 1G2HA 2F6CA 1P9QC 2A6EF 4MTDA 4U0YA 4M3EA 4GGGA 1IGNA 1FY7A 2VOOA 1WCMJ 1YYVA 2AO9A 4CUGA 2HXOA 3DQVC 3OIPA 2CV0A 2GXGA 3O8GA 4JK1X 4MTEA 3H9JA 4ZYAA 2R7OA 2XB5A 5FO5A 2VN2A 3KP3A 4IZZA 3DPTA 2LBFB 3GUDA 4GRIA 5KVRA 2QBYA 5TJJA 4GYGA 4M3GA 1USTA 5DM6F 1MH4A 4JX4A 2KRFA 1N77A 3J81Z 2W57A 4PJNA 2BXZA 4HZFA 2LY1A 4G7ZF 1ETVA 3QU3A 3G71I 3ZMVA 1N75A 4AYBN 4L9JA 3DU6A 3FMQA 4M9XA 1IN8A 1MGTA 2MD0A 5A2QZ 2ECCA 4CYDA 4DYQA 3OR2C 3BQYA 4M6YA 2DPDA 3DPLC 2JN6A 1S29A 3H0DA 4C2MJ 2EIKH 4IF4A 4JYKA 2EB7A 2XSJC 3OYJA 2VOPA 3CLQA 4HX8A 2PFBA 1U3EM 1TQMA 4II2A 1LVAA 4Y33A 3ASNH 2W24A 2BY0A 3L2VA 1X1CA 2DDBA 2YU3A 4M72A 4I02A 1SVMA 2FU4A 1FWZA 4XKWA 3BR0A 5ILSA 5E20A 1Z91A 3MZHA 1O4XA 2NNNA 2DA7A 4IOCF 1GHCA 3I3LA 3T1BA 2A07F 4OOIA 2PMUA 3PL8A 4W1UA 4XNFA 3CCQI 1YO5C 3K1MA 2KIQA 2W1OA 1R6RA 2GZWA 2Z9OA 2MW8A 3QPHA 5JR3A 5J8CA 2MA3A 2K4BA 5D5UB 4DOZA 2V7FA 1BI0A 1JJ8C 3FM3A 3WHBA 2R7ZJ 4G7HF 1S3JA 4WXCA 1WJAA 2CUEA 2Y0SA 4V19K 2JA6J 4FX0A 3SZPA 3QYFA 2PEXA 3QYBA 2KMUA 3TO7A 2YPRA 2VASA 4WXDA 1OCRH 2HQAA 3Q9VA 3P9KA 4DGWB 3NARA 4XKVA 3CDLA 2FA5A 1QBJA 3F0CA 2IGOA 3CP8A 1LPQA 3FXQA 3I64A 5E1ZB 2IT0A 1X1AA 1Z67A 2QQ8A 3K4NA 3K2AA 1O3RA 2RQPA 4V2GA 3S8PA 1MSEC 2BOLA 2HWVA 4ESJA 2FD5A 2VPRA 1T95A 2CRGA 5EEAA 4BY1J 1BN5A 4S04A 3GTLJ 1YG2A 2M0CA 2PMZA 3Q0UA 4GXOA 4PGHA 5GTHC 5E8GA 2L7MP 1LFUP 2D5VA 4IQJA 1IDZA 1V5FA 4E6KG 4IEJA 3GTKJ 3SXYA 2XVCA 2ID6A 4F55A 2E7XA 1AOYA 1FNNA 3A03A 1BJZA 4ZYDA 1VTNC 2OZ6A 3CCMI 5K7ZA 3A0HC 2VJIA 3J7AY 1MNEA 3HIFA 3FXRA 1YQAA 4ENMA 4EJTA 4ZYHA 1S9HA 4B43A 2NOJB 3BG7A 1E2XA 4LG0A 2BBYA 3T5XA 4UVBA 3EUHC 3IHUA 4YIFA 1HKSA 3SFIA 4O5VA 1PUFA 2OCCH 1S5LC 2L0KA 2EV5A 3DFGA 3ZMTA 1TWGJ 2QKLB 2WBMA 2EA2A 2F5EA 2FEZA 3FKJA 3BR1A 2IXSA 4L9TA 3E5XA 3FM5A 1Z1DA 1P4WA 3OYCA 4QWQA 1QZYA 5B1BH 3H92A 2IVMA 4I2OA 1EF4A 3HOSA 1N78A 3L1PA 2KJBA 3S16J 3EYIA 4G6QA 3ZOBA 1Y0NA 1WJEA 3CCVI 1DP7P 4P9FA 3ZQIA 1IDYA 2KLOA 1DPRA 4HRIA 4RDUA 2WWYA 5M5YJ 3DKXA 1HC8A 4OIPF 5CYVA 1JHFA 4DQ2A 2HFHA 1UHWA 5J47A 4EATA 3F9KA 2DFIA 2O9LA 2JK3A 2R7FA 2Q2EB 5EGOA 2JA5J 1H89C 2HR3A 3KYDB 1ZR4A 5F0FA 3GYHX 2KIMA 1IV6A 4BGDA 5ED4A 4I7HA 2HVRA 3V7SA 1MD0A 4R1HA 5AIQA 3A2KA 4F52A 1B1BA 2M4GA 4RGRA 2BVLA 3DU5A 5DD8A 5ICGA 3TQNA 3FXLA 3FWEA 4E7JA 3CJTB 4BUPA 2K3PA 3KIOA 1OCCH 1SFUA 2OTLI 3HRMA 3RZOJ 1IRGA 1GXPA 3JRBA 3W2AA 1B9NA 1SAUA 3G2BA 2OAZA 3OSGA 2DA3A 3M3YJ 3S2DJ 1BM9A 1TWFJ 2M87A 2R5ZB 4G9YA 1JHHA 1QHHD 3OYDA 3SZGA 4A6EA 3DCFA 4UUSA 1U5TA 4BY7J 2PJRA 4XRMA 1I3QJ 1Z21A 1BR2A 2CFOA 1ENHA 4X0GA 4KFCA 2DYSH 2XF7A 5IYCJ 5B1AH 1WJ5A 1D1BA 4N0BA 3SEZA 2K7LA 2XHKA 2MG4A 2V79A 3K9TA 4PK4A 3BOQA 2XAQA 1YOVB 2KRHA 3NEUA 3GZ6A 5DM7F 3PIOF 5TRDA 1IN5A 3IH2A 3WHCA 2XF6A 2M5WA 2DXIA 5EG0A 5M5WJ 3TDZC 1S72I 3NRVA 2VPLA 2EZHA 2NVYJ 4ZDPA 2FNPA 2NYXA 3RQIA 1ZGJA 2FBIA 4EJOA 5GAHJ 1ZG5A 1D0XA 3E97A 4XL9A 4U0WA 1U9OA 4RBOA 2VBXA 2W25A 3BTCA 5BMZA 2JT1A 2P5VA 3FISA 3SFZA 3N4MA 3ZQLA 2QQ9A 2XPWA 4XLFA 3V7RA 3DLLF 1ETXA 5F08A 5M3FJ 3WTYC 5F0CA 3V8LA 2JJ7A 5E8IA 2XV4S 4CCMA 1ON1A 1QRYA 3CUQC 2E19A 2HZTA 4I01A 3W6KB 4PZJA 3CCEI 4HX7A 2ZXWH 2CMPA 1TQIA 1WZ2A 1XGSA 4I6ZA 2VLAA 1D0ZA 2VONA 2VT2A 1K78A 1MNMC 3MN2A 1FC3A 2HYGD 2NS7A 3OS2A 4XKBA 4A0YA 2VQHA 2OTJI 3TO9A 3LA7A 2WY7Q 3ABMH 1S7AA 2Y75A 3BROA 2V1UA 2CSOA 2TCTA 1IN4A 2O7OA 3WE3A 4AUXA 5IT9K 2XGEA 4XKCA 2P6TA 3BR6A 5LHHA 5A2QK 3KEOA 3PNVA 5D5XB 2L9RA 3GWZA 1HQCA 1HCRA 3LA3A 3AFHA 2ZJPF 4GCVA 3JCUC 1G3TA 2E5ZA 1G6NA 2R7XA 1RESA 3GCMA 4Q47A 2E71A 4QTRA 2AS5F 2RREA 1U2WA 2PN6A 4MHGA 4EGZA 3ABUA 2EZKA 1Z3YA 3IV5A 3WG7H 1OCTC 3CF2A 4C2TA 1Y8QB 1ZG1A 3W2WA 3SYTA 2UXXA 1JTYA 2HOAA 1F5TA 3FXUA 3CUQA 2XRLA 3V42A 2MH9A 2HU9A 2IA0A 4BE1A 3CC7I 4CZCA 2G0EA 4CH7A 5HDKA 1ZRFA 3E0JB 2K9LA 5IY5H 3CO6C 4DW6A 3J80K 1JUPA 5JVGF 1D0YA 2PI0A 4U88A 4W97A 1KZHA 1CF7A 1MBHA 2IJLA 3IUOA 2XUBA 2BVMA 2COBA 4DIQA 2A6TA 4HNTA 4HF2A 1RKWA 2EFPA 5FFXA 2OCEA 2JSCA 2WV1A 1SMTA 3FXKA 5E1XA 2N8GA 1IXRC 3R60A 1XTAA 2ISZA 2DQLA 2L3DA 4P9UA 4HPQA 3QQAA 1IRFA 3OYMA 3GTOJ 4PFPA 1ZR2A 2LR8A 2GOXB 3HB9A 3RCOA 2Y69H 2MLKA 1A35A 2FSWA 3ZR8X 1WWXA 1JKOC 1R9TJ 4P55A 2RVCA 4M9ZA 2PJPA 3S3MA 5HS8A 1D8JA 3HL2A 3PSFA 2P8TA 2HXIA 4JBAA 3L09A 2O6GE 5K5RA 4L0YB 4RS8A 3WTWC 2XAHA 4A0XA 2E2HJ 1GV2A 2H1KA 1J9IA 3KPHA 2PMHA 4BHBA 5GTIC 2XGDA 4RM2A 5IOZA 4M3FA 4ZJZA 1AKHA 3WU2C 4NC8A 1A31A 1TT5B 2QM3A 3BTIA 3OOPA 3OOUA 3K10A 1BI1A 2M30A 3BJ6A 4A0ZA 1LKXA 2BZTA 1E3OC 3R0JA 4LFUA 3VFZA 5K1YA 1ZAOA 1BI2A 2FMLA 1H9GA 2JA2A 3M8JA 3IH4A 4KIGA 4NBQA 2XAJA 1POGA 3QU6A 2DA2A 3DF8A 2DMPA 2M3AA 5DV5A 3M1CA 2ZKZA 1NK2P 1VQ9I 1Z3XA 2A68F 1J5YA 4YFXF 2VE9A 2FBKA 5F0HA 3MWMA 2RQQA 2XKPA 4JX5A 3T0YA 4II3A 3KP2A 5IP7J 1DP3A 4XLHA 4BHPA 1BW5A 5DCMA 2UUZA 3DLAA 2LK2A 3S93A 2EWNA 1E0EA 2NXNB 3K4CA 1SVOA 1HXDA 1OPCA 3QWLA 3J7ZI 3S17J 4ENNA 4D7MA 5IT3A 3KP5A 1VQOI 2CUJA 3C7JA 3GLXA 1H88C 3ECHA 2ISYA 2HTJA 4M3DA 2OUMA 2K9MA 3LAPA 2K40A 4XBFA 1Z77A 1YRNB 2CUFA 2Y9YA 1D1CA 1D3YA 2VB6A 2W85A 1R5HA 1WJCA 4G6DA 5J1YA 1LE8B 4NHJA 3CCSI 1I39A 2G9WA 1MBKA 1R7JA 2LRDA 1JJ6C 1XSVA 1PUEE 1QNTA 4LMYA 3K0LA 2A5WA 2HS5A 4FHTA 3RKYA 3TP0A 4PJ0C 4A12A 1BA5A 2FX0A 2CG4A 4NUBA 3CDIA 1HLVA 3R4KA 4B4CA 5K7FA 5CVJA 3RJPA 2LOOA 2L54A 1T39A 4BJ6C 1KU9A 1VNDA 1VQMI 4JQFA 4KN4X 4L0ZB 1FLIA 1LEBA 3SZTA 1T0FC 2JRTA 4JP0A 3KFWX 1BOAA 1ZYRF 4D1QA 2GBYA 1X58A 3DEEA 2Z5UA 4EVIA 2JA8J 1T98A 2AQEA 2Y0SN 1WVRA 2HQRA 2A69F 2HVQA 3FDYA 2QWWA 2YU9J 3WTVC 2HNHA 5CVVA 2HYFA 2PX9A 5FKNA 3V7CA 2X0LA 1ZQ3P 2WAQA 4AU7A 2AHQA 5B3SH 5JFRA 5GAEJ 2KZGA 3ZQQA 3DBRB 2QGUA 2O0YA 2MABA 4LB5A 3HKZN 2V1XA 4A3KJ 3JRFA 2FF4A 1J09A 2W84A 3NQOA 1LB2A 5HS9A 1QZZA 2JPCA 4BEHB 1GVDA 3TW7A 3ZGKA 4CICA 4EJWA 3N05A 3OMYA 4BHCA 3HJEA 3DV8A 2HVSA 4UHTA 3H3UA 1R4MB 4HYEA 2E1MB 2X1CA 2XB0X 2DK5A 3ZXSA 4AIHA 2IRFG 1F9NA 2DW4A 2VT3A 1I1SA 1KQ8A 2ICWG 2P7VB 4XONA 2JWTA 5L3CA 2LBFA 1REPC 1YIOA 3L2RA 3ZMUA 1IJWC 3F8NA 5HOOA 2P0WA 1IUFA 2ELJA 2VKEA 2ZFWA 2FNAA 3HM5A 1E3PA 5GADJ 1ETYA 4LLGF 3MMYB 2XC7A 1Y0UA 3DBLB 4HW0A 4X6AJ 2LMDA 1P6RA 2KPMA 2JUCA 5J40A 2AXLA 2ESHA 2FQ3A 3QPSA 1ONVA 2ZO4A 2DT5A 3DBHB 2EFNA 1QZEA 1G3WA 2BY1A 2BY3A 3MFKA 1F4KA 2O03A 3GTGJ 4AD9A 2ID3A 4HBLA 3MKLA 3D1NI 3ZRGA 1Q1VA 3LA2A 3H0GJ 1EJ9A 2E1NA 4BYYA 3RPUA 2HI3A 3RKXA 4DBQA 4BACA 2DODA 1VQNI 1LJ9A 2BY2A 2Q0OA 1EH6A 3Q9SA 2XRNA 5BNGA 4QLCU 3BTLA 1IO2A 2XSDC 5BQTA 1OYIA 3EDPA 3DXJF 2E1OA 4OAYA 1ZTRA 1O3SA 1FBUA 5CVRA 1R00A 1W5TA 2LC2A 1AWCA 3MEXA 3HHHA 2VBWA 2FJ1A 1YW9A 3ABTA 3ROUA 4E70A 3KZIC 5F6FA 1FMVA 2I8DA 1EH8A 2YS9A 3TBIA 4FE7A 2R7DA 1AA7A 2L7KA 2L7FP 4CYCB 1W5SA 2NRAC 4HF1A 2OQGA 2M2EA 1ZN2A 4BBRJ 4XRSG 2EZLA 3A1YA 3IP4B 1EA3A 2IA2A 2Q1ZB 2K9SA 2X48A 2VIXA 1SD6A 1I3AA 3C2GA 4PCQA 2LVSA 3RKQA 5IT9Z 3LOCA 4N9IA 1K4TA 3OIOA 1ZRCA 2HGCA 2FXAA 3IRQA 1RNLA 1JXSA 4Y4RA 2R7TA 1I6XA 4RM3A 2Y2ZA 1JKRC 4C3HJ 4IHSA 3HTSB 4E7IA 2ELHA 3WU0A 1TWCJ 4UB6C 3GFLA 3ZMZA 1WGXA 5H6QA 3LQQA 1OCOH 3JRIA 1AHDP 3FZVA 3WTUC 2GA2A 2IS4A 2R7UA 1IRXA 3WGHA 1MMSA 2IPQX 2IS2A 1WJDA 4KIFA 2LP0A 5LGUA 3B6AA 2STTA 3K6GA 2K86A 4MLOA 2KDZA 4WF2A 1FTZA 3DP7A 2GAUA 2K9QA 1XDSA 4EM0B 1MDMB 2B63J 1PDNC 1QHGA 1O3QA 1GDTA 3QPTA 2B9SA 1LUJB 1RI7A 3K4MA 3J80Z 4BAYA 1YW8A 1B59A 1Z9CA 4OMZA 2L7ZA 3HG9A 3GMEA 4ENKA 2LKPA 3E3VA 3WTXC 2OPTA 3CMEI 1XGMA 1MJAA 1R1UA 1YTYA 1B72B 4D9JA 1Z0XA 3CCLI 2NVXJ 2VQGA 2CH0A 1BOBA 2V26A 3OY9A 3VB2A 1A6QA 3BPXA 1TZLA 2Z1DA 3OL3A 3S1MJ 1YS7A 4M3BA 3F6OA 4E7SA 1KU2A 1WPKA 2E34A 1TL8A 1JGGA 1CGPA 4J01A 4ZDOA 1XGNA 4RAZA 3BJAA 3FMSA 4ITVA 4LGWA 5BPDA 3QP5A 3VYTB 4BXFA 2V9VA 1OKRA 5FLXK 4DBRA 2X85A 3P9CA 1ZELA 3RDIA 3E6CC 1YFHA 2G7HA 2DA1A 1ZGWA 5DDGA 2J5OA 2CO5A 1SVLA 1H8AC 2P5KA 1V5GA 2CW0F 3GBGA 3OV8A 4X1EA 3ZCOA 3OYIA 3G6EI 2MSYA 4BNCA 3JRDA 5FROA 2WB1N 2JVHA 2DQRA 3I54A 4E4HA 5C44J 3TEDA 4NB5A 2VXDA 4ASNA 2M8EA 1U0JA 1K79A 2HDCA 4FASD 1OR7C 5FD6A 4RB2C 5J1RA 4PDKA 2Y30A 1FOKA 2M1BA 3NAUA 3IAM2 3FXMA 3HXLA 2XKOA 3HBLA 5HLIA 4A69C 3ASOH 1WQ2A 5FKKA 5J4VA 1XX5A 1TC3C 2CQKA 5BOXA 3V4GA 1UHSA 3ZQFA
chains in the Genus database with same CATH topology
2TCTA 2O7OA 4AUXA 3TP3A 2XGEA 5EYRA 1D5YA 3BR6A 2R5ZA 3OSFA 2L9RA 4QIWN 2ZB9A 1JTXA 2XPVA 1HCRA 4A3GJ 1ORKA 1RESA 5DTDA 1OFCX 1X2NA 4QTRA 2FQ4A 1AKHB 1B72A 5JLXA 2VUMJ 1T56A 2EZKA 3IV5A 1JT6A 1OCTC 2CQXA 1UG2A 5K7HA 5IYDJ 5C3EJ 4XRSA 2DMTA 1JTYA 1BL0A 2HOAA 1FIAA 1ZKGA 2XPUA 2KT0A 2XRLA 4J19A 1VFCA 2G0EA 5IYBJ 5F04A 4S0HB 1TWHJ 5E3LA 2GM4A 4DW6A 5M3MJ 1JUPA 3S1QJ 4A3CJ 4HNVA 2H8RA 4A93J 4W97A 1HOMA 5C4JJ 1MBHA 2COBA 1FEXA 1RKWA 5FKLA 4AC0A 5EDNA 3BR5A 4D5FA 3BT9A 2WV1A 1P7JA 3G1LA 2N8GA 4G12A 4XK4A 1SANA 3S1RJ 1XS9A 4DZJA 2ELKA 3QQAA 2O8KA 2QCOA 4ABZA 4D5CA 3GTOJ 5IP9J 4B1RA 2IEKA 1ZR2A 2NVTJ 3HGGA 1MBJA 2LR8A 4DYRA 1U8BA 2HQ5A 1GV5A 3HB9A 3A01B 3LSRA 2IBDA 1HDDC 3S14J 1JKOC 1GT0C 2M9HA 1R9TJ 1IC8A 1X2MA 2W48A 3HEFA 4XICA 5F1JA 4MIMA 1A5JA 4A3IJ 2HXIA 5E3MA 4A3BJ 1NTCA 2DA5A 2X9DA 1I6HJ 3G1MA 2E2HJ 1U78A 4NDLA 2ME6A 3ZQHA 1GV2A 2H1KA 3JREA 3CQZJ 2QF7A 2DJNA 2LFBA 1ETOA 3MVPA 2XGDA 5IOZA 1A6IA 4M3FA 1AKHA 4GFBA 9ANTA 1SFOJ 1BW6A 1ITYA 3BTIA 5J3LA 3OOUA 1P7IA 5FKMA 2CU7A 3HOVJ 3JR9A 1JUSA 4IHVA 1E3OC 4V2FA 1QVUA 4B3AA 1W0UA 3HOYJ 3BTJA 2LD5A 3IH4A 4IHYA 5GP9A 2DA4A 1POGA 1MBGA 1K61A 4A3LJ 5C4XJ 1ETKA 2DA2A 4BXXJ 2DMPA 4DZPA 1NK2P 3I4NJ 2K9NA 2HYJA 3FK7A 1OCPA 1RPWA 5F0HA 4FISA 4FCYA 2HDDA 2M34A 4JX5A 3JRHA 3HOUJ 3QPLA 5IP7J 2CQQA 2E2JJ 1BW5A 1K83J 4D7NA 5FKOA 3S2HJ 1F36A 4BKXA 3GTMJ 2LK2A 2EH3A 2XGCA 2TRTA 3S17J 2YUSA 5HODA 5DS9A 1FJLA 2I10A 4D7MA 3JRAA 2DTZA 3JRGA 2ECBA 5GPCA 3I4MJ 4MFEA 3PO2J 3BG3A 1RR7A 1H88C 3LSJA 3A01A 5IP6A 4EEFG 1JKPC 1HDPA 3W6VA 1G2HA 1S7EA 2R0QC 4M3DA 3PO3J 4M3EA 1IGNA 2K40A 1WCMJ 1FIPA 2AO9A 2HXOA 1Z77A 4DYCA 1YRNB 2R93J 2CUFA 2Y9YA 2HOTA 3O8GA 4I76A 2XB5A 1W0TA 1JUMA 5J1YA 1LE8B 3HOZJ 4BBSJ 4MFDA 1MBKA 1JJ6C 3DEWA 1FTTA 4M3GA 5EG0B 1MH4A 2IAIA 4JX4A 3HGYA 5GPAA 3TP0A 2WAQN 1BA5A 2LLKA 2FX0A 1QPIA 1ETVA 4JX6A 5EZGA 3ZQCA 1HLVA 4AYBN 4B4CA 5K7FA 3BR2A 1VNDA 1F43A 2ECCA 4A3EJ 4DYQA 2DMNA 3BQYA 4JP0A 3FKIJ 2JN6A 1MSFC 2GBYA 4C2MJ 1X58A 4JYKA 4A3FJ 3VPRA 2JA8J 4C3IJ 3BG9A 2Y0SN 5IPAA 1VF9A 3S1NJ 3IH3A 5J1UA 3UKGA 2YU9J 2X6OA 5FKNA 3LSPA 1ZQ3P 1PUFB 2CJJA 2AHQA 3BR0A 2R92J 1O4XA 2DA7A 4W1UA 1MBEA 3HKZN 4A3KJ 3JRFA 3BR3A 3FK6A 2MW8A 3FIWA 1GVDA 3TW7A 1JKQC 2JA7J 1XC5A 1JJ8C 3WHBA 2R7ZJ 1WH5A 2CUEA 2DN0A 1YRNA 2JA6J 2XB0X 2E2IJ 4A3MJ 3Q3SA 5FJ8J 1LE8A 4A3DJ 2JWTA 5EGOB 1ZK8A 2R5YB 3S15J 3NARA 3HDDA 3CDLA 4M6VA 1IJWC 2DMQA 3F0CA 2GLOA 1IUFA 2VKEA 3HM5A 1RKTA 1ETYA 3K2AA 4V2GA 5IOYA 1MSEC 4X6AJ 5F27A 2FD5A 2VPRA 2CRGA 5M5XJ 2LY9A 5EEAA 4BY1J 3GTLJ 3M4OJ 2M0CA 3Q0UA 3QPSA 2VI6A 1DU0A 1IDZA 2L7MP 2RAEA 1LFUP 2D5VA 2JMWA 4IEJA 3GTKJ 3GTGJ 1VI0A 2ID3A 2OF7A 2ID6A 3MKLA 3D1NI 2Y9ZA 3A03A 1Q1VA 1IRZA 3GTQJ 1BJZA 3H0GJ 1U9NA 4A3JJ 4MO7A 5K7ZA 3C2BA 2HI3A 2LTPA 5BNGA 3BTLA 2XSDC 4UUSB 3SJMA 1AU7A 2EBIA 4FTHA 5FLVA 2E1OA 4IHXA 3HOWJ 1ZTRA 2MGQA 3SFIA 1MH3A 1PUFA 1B8IB 2L0KA 5EF6A 1ETWA 1TWGJ 1QVTA 2FJ1A 3BR1A 3E7LA 4L5EA 2YS9A 1Y1VJ 4FE7A 1EF4A 3K7AJ 1APLC 2L7FP 4CYCB 3L1PA 2M2EA 4BBRJ 3S16J 4XRSG 2EZLA 3ZOBA 3Q0VA 3ZQIA 1IDYA 2K9SA 2X48A 4RDUA 5M5YJ 3ZQGA 2LVSA 1Y1WJ 3RKQA 3LOCA 3OIOA 1HF0A 3RZDJ 2O9LA 2JK3A 5EGOA 2EZIA 2DA6A 2R5YA 1CQTA 1H89C 2Y2ZA 1JKRC 2JA5J 3HOXJ 4C3HJ 1MBFA 1JT0A 1ZR4A 5F0FA 2Y31A 1IV6A 2ME0A 1TWCJ 2EQRA 1WGXA 1OJLA 3JRIA 1AHDP 2NS8A 4IHWA 4UUTA 5FLMJ 2LP0A 3B6AA 3PM1A 4LOCA 4MLOA 2KDZA 1T33A 3TW6A 1WI3A 3RZOJ 1FTZA 2K9QA 3G1OA 3JRBA 1NK3P 2HOSA 3OSGA 2DA3A 2B63J 1GDTA 3M3YJ 1TWFJ 3S2DJ 3H3VK 2R5ZB 2NOGA 3BG5A 3DCFA 2PMZN 4UUSA 2L7ZA 4BY7J 4XRMA 2OPTA 3GTPJ 1I3QJ 1DU6A 1ENHA 1B8IA 1B72B 3CMYA 1Z0XA 5JLWA 5IYCJ 2NVXJ 2DMUA 1XG1A 2MG4A 5E3OA 1I50J 3S1MJ 4M3BA 1WPKA 1UMQA 1JGGA 2LKXA 3IH2A 4Y52J 3WHCA 2NVQJ 5EG0A 4CYCA 5M5WJ 3LSGA 3O8HA 2EZHA 2NVYJ 3JRCA 1WH7A 3RQIA 3SDGA 5EZHA 1U9OA 4RBOA 3BTCA 3A02A 4QSHA 2DA1A 1ZGWA 3FISA 3GTJJ 3ZQLA 2XPWA 1H8AC 3GBGA 4X1EA 3BQZA 2VKVA 2MSYA 3JRDA 1ETXA 1GUUA 1ETQA 2WB1N 5F08A 5M3FJ 4XIDA 1TWAJ 4C3JJ 5C44J 3TEDA 2M8GX 5F0CA 2JJ7A 2P81A 1QRYA 3LNQA 2E19A 5J1RA 1RETA 2Y30A 4FE4A 5E3NA 3NAUA 1LFBA 3Q0WA 3HBLA 4A69C 4I6ZA 5FKKA 3B6CA 1MNMC 3MN2A 1TC3C 2NS7A 3CCYA 4Y7NJ 1IG7A 1UHSA 3ZQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TCT A;  2O7O A;  4AUX A;  3TP3 A;  2XGE A;  5EYR A;  1D5Y A;  3BR6 A;  2R5Z A;  3OSF A;  2L9R A;  4QIW N;  2ZB9 A;  1JTX A;  2XPV A;  1HCR A;  4A3G J;  1ORK A;  1RES A;  5DTD A;  1OFC X;  1X2N A;  4QTR A;  2FQ4 A;  1AKH B;  1B72 A;  5JLX A;  2VUM J;  1T56 A;  2EZK A;  3IV5 A;  1JT6 A;  1OCT C;  2CQX A;  1UG2 A;  5K7H A;  5IYD J;  5C3E J;  4XRS A;  2DMT A;  1JTY A;  1BL0 A;  2HOA A;  1FIA A;  1ZKG A;  2XPU A;  2KT0 A;  2XRL A;  4J19 A;  1VFC A;  2G0E A;  5IYB J;  5F04 A;  4S0H B;  1TWH J;  5E3L A;  2GM4 A;  4DW6 A;  5M3M J;  1JUP A;  3S1Q J;  4A3C J;  4HNV A;  2H8R A;  4A93 J;  4W97 A;  1HOM A;  5C4J J;  1MBH A;  2COB A;  1FEX A;  1RKW A;  5FKL A;  4AC0 A;  5EDN A;  3BR5 A;  4D5F A;  3BT9 A;  2WV1 A;  1P7J A;  3G1L A;  2N8G A;  4G12 A;  4XK4 A;  1SAN A;  3S1R J;  1XS9 A;  4DZJ A;  2ELK A;  3QQA A;  2O8K A;  2QCO A;  4ABZ A;  4D5C A;  3GTO J;  5IP9 J;  4B1R A;  2IEK A;  1ZR2 A;  2NVT J;  3HGG A;  1MBJ A;  2LR8 A;  4DYR A;  1U8B A;  2HQ5 A;  1GV5 A;  3HB9 A;  3A01 B;  3LSR A;  2IBD A;  1HDD C;  3S14 J;  1JKO C;  1GT0 C;  2M9H A;  1R9T J;  1IC8 A;  1X2M A;  2W48 A;  3HEF A;  4XIC A;  5F1J A;  4MIM A;  1A5J A;  4A3I J;  2HXI A;  5E3M A;  4A3B J;  1NTC A;  2DA5 A;  2X9D A;  1I6H J;  3G1M A;  2E2H J;  1U78 A;  4NDL A;  2ME6 A;  3ZQH A;  1GV2 A;  2H1K A;  3JRE A;  3CQZ J;  2QF7 A;  2DJN A;  2LFB A;  1ETO A;  3MVP A;  2XGD A;  5IOZ A;  1A6I A;  4M3F A;  1AKH A;  4GFB A;  9ANT A;  1SFO J;  1BW6 A;  1ITY A;  3BTI A;  5J3L A;  3OOU A;  1P7I A;  5FKM A;  2CU7 A;  3HOV J;  3JR9 A;  1JUS A;  4IHV A;  1E3O C;  4V2F A;  1QVU A;  4B3A A;  1W0U A;  3HOY J;  3BTJ A;  2LD5 A;  3IH4 A;  4IHY A;  5GP9 A;  2DA4 A;  1POG A;  1MBG A;  1K61 A;  4A3L J;  5C4X J;  1ETK A;  2DA2 A;  4BXX J;  2DMP A;  4DZP A;  1NK2 P;  3I4N J;  2K9N A;  2HYJ A;  3FK7 A;  1OCP A;  1RPW A;  5F0H A;  4FIS A;  4FCY A;  2HDD A;  2M34 A;  4JX5 A;  3JRH A;  3HOU J;  3QPL A;  5IP7 J;  2CQQ A;  2E2J J;  1BW5 A;  1K83 J;  4D7N A;  5FKO A;  3S2H J;  1F36 A;  4BKX A;  3GTM J;  2LK2 A;  2EH3 A;  2XGC A;  2TRT A;  3S17 J;  2YUS A;  5HOD A;  5DS9 A;  1FJL A;  2I10 A;  4D7M A;  3JRA A;  2DTZ A;  3JRG A;  2ECB A;  5GPC A;  3I4M J;  4MFE A;  3PO2 J;  3BG3 A;  1RR7 A;  1H88 C;  3LSJ A;  3A01 A;  5IP6 A;  4EEF G;  1JKP C;  1HDP A;  3W6V A;  1G2H A;  1S7E A;  2R0Q C;  4M3D A;  3PO3 J;  4M3E A;  1IGN A;  2K40 A;  1WCM J;  1FIP A;  2AO9 A;  2HXO A;  1Z77 A;  4DYC A;  1YRN B;  2R93 J;  2CUF A;  2Y9Y A;  2HOT A;  3O8G A;  4I76 A;  2XB5 A;  1W0T A;  1JUM A;  5J1Y A;  1LE8 B;  3HOZ J;  4BBS J;  4MFD A;  1MBK A;  1JJ6 C;  3DEW A;  1FTT A;  4M3G A;  5EG0 B;  1MH4 A;  2IAI A;  4JX4 A;  3HGY A;  5GPA A;  3TP0 A;  2WAQ N;  1BA5 A;  2LLK A;  2FX0 A;  1QPI A;  1ETV A;  4JX6 A;  5EZG A;  3ZQC A;  1HLV A;  4AYB N;  4B4C A;  5K7F A;  3BR2 A;  1VND A;  1F43 A;  2ECC A;  4A3E J;  4DYQ A;  2DMN A;  3BQY A;  4JP0 A;  3FKI J;  2JN6 A;  1MSF C;  2GBY A;  4C2M J;  1X58 A;  4JYK A;  4A3F J;  3VPR A;  2JA8 J;  4C3I J;  3BG9 A;  2Y0S N;  5IPA A;  1VF9 A;  3S1N J;  3IH3 A;  5J1U A;  3UKG A;  2YU9 J;  2X6O A;  5FKN A;  3LSP A;  1ZQ3 P;  1PUF B;  2CJJ A;  2AHQ A;  3BR0 A;  2R92 J;  1O4X A;  2DA7 A;  4W1U A;  1MBE A;  3HKZ N;  4A3K J;  3JRF A;  3BR3 A;  3FK6 A;  2MW8 A;  3FIW A;  1GVD A;  3TW7 A;  1JKQ C;  2JA7 J;  1XC5 A;  1JJ8 C;  3WHB A;  2R7Z J;  1WH5 A;  2CUE A;  2DN0 A;  1YRN A;  2JA6 J;  2XB0 X;  2E2I J;  4A3M J;  3Q3S A;  5FJ8 J;  1LE8 A;  4A3D J;  2JWT A;  5EGO B;  1ZK8 A;  2R5Y B;  3S15 J;  3NAR A;  3HDD A;  3CDL A;  4M6V A;  1IJW C;  2DMQ A;  3F0C A;  2GLO A;  1IUF A;  2VKE A;  3HM5 A;  1RKT A;  1ETY A;  3K2A A;  4V2G A;  5IOY A;  1MSE C;  4X6A J;  5F27 A;  2FD5 A;  2VPR A;  2CRG A;  5M5X J;  2LY9 A;  5EEA A;  4BY1 J;  3GTL J;  3M4O J;  2M0C A;  3Q0U A;  3QPS A;  2VI6 A;  1DU0 A;  1IDZ A;  2L7M P;  2RAE A;  1LFU P;  2D5V A;  2JMW A;  4IEJ A;  3GTK J;  3GTG J;  1VI0 A;  2ID3 A;  2OF7 A;  2ID6 A;  3MKL A;  3D1N I;  2Y9Z A;  3A03 A;  1Q1V A;  1IRZ A;  3GTQ J;  1BJZ A;  3H0G J;  1U9N A;  4A3J J;  4MO7 A;  5K7Z A;  3C2B A;  2HI3 A;  2LTP A;  5BNG A;  3BTL A;  2XSD C;  4UUS B;  3SJM A;  1AU7 A;  2EBI A;  4FTH A;  5FLV A;  2E1O A;  4IHX A;  3HOW J;  1ZTR A;  2MGQ A;  3SFI A;  1MH3 A;  1PUF A;  1B8I B;  2L0K A;  5EF6 A;  1ETW A;  1TWG J;  1QVT A;  2FJ1 A;  3BR1 A;  3E7L A;  4L5E A;  2YS9 A;  1Y1V J;  4FE7 A;  1EF4 A;  3K7A J;  1APL C;  2L7F P;  4CYC B;  3L1P A;  2M2E A;  4BBR J;  3S16 J;  4XRS G;  2EZL A;  3ZOB A;  3Q0V A;  3ZQI A;  1IDY A;  2K9S A;  2X48 A;  4RDU A;  5M5Y J;  3ZQG A;  2LVS A;  1Y1W J;  3RKQ A;  3LOC A;  3OIO A;  1HF0 A;  3RZD J;  2O9L A;  2JK3 A;  5EGO A;  2EZI A;  2DA6 A;  2R5Y A;  1CQT A;  1H89 C;  2Y2Z A;  1JKR C;  2JA5 J;  3HOX J;  4C3H J;  1MBF A;  1JT0 A;  1ZR4 A;  5F0F A;  2Y31 A;  1IV6 A;  2ME0 A;  1TWC J;  2EQR A;  1WGX A;  1OJL A;  3JRI A;  1AHD P;  2NS8 A;  4IHW A;  4UUT A;  5FLM J;  2LP0 A;  3B6A A;  3PM1 A;  4LOC A;  4MLO A;  2KDZ A;  1T33 A;  3TW6 A;  1WI3 A;  3RZO J;  1FTZ A;  2K9Q A;  3G1O A;  3JRB A;  1NK3 P;  2HOS A;  3OSG A;  2DA3 A;  2B63 J;  1GDT A;  3M3Y J;  1TWF J;  3S2D J;  3H3V K;  2R5Z B;  2NOG A;  3BG5 A;  3DCF A;  2PMZ N;  4UUS A;  2L7Z A;  4BY7 J;  4XRM A;  2OPT A;  3GTP J;  1I3Q J;  1DU6 A;  1ENH A;  1B8I A;  1B72 B;  3CMY A;  1Z0X A;  5JLW A;  5IYC J;  2NVX J;  2DMU A;  1XG1 A;  2MG4 A;  5E3O A;  1I50 J;  3S1M J;  4M3B A;  1WPK A;  1UMQ A;  1JGG A;  2LKX A;  3IH2 A;  4Y52 J;  3WHC A;  2NVQ J;  5EG0 A;  4CYC A;  5M5W J;  3LSG A;  3O8H A;  2EZH A;  2NVY J;  3JRC A;  1WH7 A;  3RQI A;  3SDG A;  5EZH A;  1U9O A;  4RBO A;  3BTC A;  3A02 A;  4QSH A;  2DA1 A;  1ZGW A;  3FIS A;  3GTJ J;  3ZQL A;  2XPW A;  1H8A C;  3GBG A;  4X1E A;  3BQZ A;  2VKV A;  2MSY A;  3JRD A;  1ETX A;  1GUU A;  1ETQ A;  2WB1 N;  5F08 A;  5M3F J;  4XID A;  1TWA J;  4C3J J;  5C44 J;  3TED A;  2M8G X;  5F0C A;  2JJ7 A;  2P81 A;  1QRY A;  3LNQ A;  2E19 A;  5J1R A;  1RET A;  2Y30 A;  4FE4 A;  5E3N A;  3NAU A;  1LFB A;  3Q0W A;  3HBL A;  4A69 C;  4I6Z A;  5FKK A;  3B6C A;  1MNM C;  3MN2 A;  1TC3 C;  2NS7 A;  3CCY A;  4Y7N J;  1IG7 A;  1UHS A;  3ZQF A; 
#chains in the Genus database with same CATH topology
 2OJE D;  4BQA A;  2PLY A;  1OYY A;  4BQO A;  3PFI A;  1M1E B;  2GIV A;  3FMR A;  4IJA A;  2R5Z A;  4F3Q A;  2XAG A;  3OSF A;  5D5W B;  2ZB9 A;  1FOX A;  3BJO A;  4A3G J;  1GVJ A;  1U8R A;  2Q8K A;  3CF5 F;  4HA8 A;  4M73 A;  1FT9 A;  4L5J A;  3OR1 C;  5JLX A;  4J00 A;  3CZ6 A;  3AG3 H;  3OYH A;  4A5N A;  5HVQ C;  1MMG A;  2CQX A;  4ZH4 F;  3LFU A;  5K7H A;  3BZC A;  5C3E J;  4XRS A;  2DMT A;  1MIJ A;  3TL4 X;  3TMO A;  3AAF A;  2HPM A;  2KT0 A;  4RAF A;  5BS6 A;  1MMD A;  2IW5 A;  5IYB J;  1XCB A;  5D4S A;  2HOE A;  2KKO A;  1B9M A;  2GQQ A;  2KQR A;  2K02 A;  5M3M J;  4C9Y A;  2EIN H;  3EUH A;  4JOM A;  4LK1 F;  3S1Q J;  2H8R A;  2HKO A;  4A93 J;  1BC8 C;  2I5U A;  4HOB A;  2J5P A;  1HOM A;  1IXC A;  4MEY F;  2VJJ A;  3EPZ A;  3WOD F;  2F5V A;  1BR4 A;  3BR5 A;  2KJC A;  4CDG A;  1WJB A;  2DCE A;  4D0P A;  1VQP I;  5CVI A;  4XK4 A;  4YII A;  2K4J A;  1XS9 A;  4DZJ A;  2Z2S B;  3KYL A;  2QYO A;  4LG0 B;  2IEK A;  3HGG A;  1MBJ A;  2QA4 I;  1MJB A;  1QO0 D;  4DYR A;  2HQ5 A;  5TIS C;  1GV5 A;  5ICC A;  3L2Q A;  2UZK A;  1U8B A;  3TDU C;  5JI6 A;  3G3Z A;  1DPU A;  2BGC A;  3OYK A;  2M9H A;  1FMW A;  5LGT A;  1X2M A;  4LLN A;  1QU3 A;  4AYB A;  2RV8 A;  4A3B J;  1J59 A;  2RNJ A;  2VC0 A;  1I6H J;  4ZDL A;  2WC2 A;  3ULQ B;  3LST A;  2WAE A;  3TGN A;  4NDL A;  1BC7 C;  1S6L A;  2R3S A;  2W4S A;  1FBQ A;  4YFK F;  3JRE A;  1ZAR A;  3BWG A;  2XRO A;  2E7W A;  2LFB A;  5B5E C;  3FHZ A;  1A6I A;  2AXT C;  1R23 A;  4LJZ F;  9ANT A;  4OWR B;  2LG4 A;  1SFO J;  3ZN1 A;  3BCB A;  2DPU A;  2V1N A;  2FOW A;  1P7I A;  4P5O A;  3JR9 A;  4V2F A;  4PJL A;  4B3A A;  1ZRE A;  4PJM A;  5D4R A;  1GLN A;  3BTJ A;  2LD5 A;  4RB3 C;  2DA4 A;  1KON A;  3GX4 X;  1MBG A;  2WAD A;  4A3L J;  3HRU A;  4BXX J;  1FZP B;  2LNB A;  4ESF A;  4OMY A;  4HEA 2;  1XPX A;  2H6C A;  2K9N A;  5KCM A;  2ZSH B;  3KE2 A;  3TO6 A;  1HW5 A;  2XGX A;  1RPW A;  4RGS A;  4FCY A;  1PJR A;  3D5S C;  1MJ9 A;  3HTU A;  3VYS B;  2CQQ A;  4N9H A;  3HYI A;  2V1D A;  2E2J J;  4U87 A;  2MYS A;  5FKO A;  3SEQ A;  3S2H J;  4BKX A;  2VBZ A;  2KL4 A;  3GTM J;  2YSR A;  2CYY A;  5GAG J;  1VQ7 I;  2GXA A;  2KHM A;  3S2W A;  5L3F A;  3BZK A;  2R7V A;  2YUS A;  1EKE A;  2DTZ A;  3JRG A;  2EK5 A;  2FE3 A;  1YIT I;  2EIJ H;  4PFO A;  4ZYE A;  4IO9 F;  2FOK A;  4HAM A;  4EEF G;  3WU1 B;  4XMY A;  3GXO A;  2JTV A;  1FIP A;  3VDX A;  3OYF A;  1LEA A;  3WGG A;  4DYC A;  2M0M A;  2L9N A;  2HOT A;  3ONQ A;  5DUK A;  3E6D A;  1X1B A;  3P7N A;  4F93 B;  3HRS A;  1SD7 A;  3PQJ A;  3OS1 A;  1WJF A;  1G8X A;  1ODD A;  4BBS J;  2P6S A;  3AG1 H;  4MFD A;  1KQ0 A;  2BHY A;  5BPI A;  1R1T A;  5EG0 B;  3KEQ A;  4HST A;  2BHZ A;  4UV9 A;  2ZXI A;  2P4W A;  5GPA A;  2XDV A;  4HNU A;  2E1C A;  2WAQ N;  2LLK A;  4N4O B;  4BDZ A;  4XLP F;  1J75 A;  4JX6 A;  3M7G A;  2EIL H;  2H8W A;  3E5Q A;  4UVC A;  3BR2 A;  3ECO A;  3BPV A;  4EQQ A;  1XB4 A;  1YX3 A;  2X6X A;  2QUF A;  1DUX C;  2EA4 A;  4EV0 A;  2NNY A;  1RR8 C;  4H0E A;  2DMN A;  3GLL A;  4BE0 A;  2VQL A;  3FKI J;  1TNS A;  4XSX F;  2R7W A;  4CO8 A;  3K2Z A;  1HW2 A;  3JTG A;  4PJJ A;  2F5F A;  3CD6 I;  5FD5 A;  4CA0 A;  4CCL A;  4C3I J;  3BG9 A;  2K27 A;  3K4K A;  5IPA A;  5B66 C;  3RYP A;  1YJW I;  2H94 A;  3S1N J;  2W82 A;  3JTH A;  4DNC A;  3UKG A;  2X6O A;  4HG2 A;  3JW4 A;  2ETH A;  2OU2 A;  3CMA I;  3F8F A;  3JAM Z;  2X1E A;  3KYC B;  4KT5 C;  2F4I A;  2WAF A;  1T08 B;  4ETS A;  2R7S A;  2R92 J;  3CO7 C;  2M4K A;  1W36 C;  4CSW A;  2L9V A;  5HLH A;  1V5E A;  1T2K A;  1UAA A;  2LY2 A;  3FK6 A;  1WI9 A;  4G94 A;  3FIW A;  1JKQ C;  4HQE A;  3LSI A;  4A6D A;  4WK8 F;  5FFZ A;  1FOY A;  1KYW A;  1YRN A;  3RYR A;  4L18 B;  1T38 A;  2PQ8 A;  2F5C A;  3Q3S A;  5FJ8 J;  2JSP A;  1LE8 A;  4A3D J;  3KZY A;  1EV7 A;  4UY8 I;  2R5Y B;  1ZK8 A;  3S15 J;  4M6V A;  2DMQ A;  2GLO A;  2LH9 A;  4NQW B;  1ZGA A;  1VQL I;  4ENJ A;  4R8H A;  3ERM A;  5F64 A;  5IOY A;  3CUO A;  3ZPL A;  1MND A;  4RMN A;  2GA1 A;  3A0B C;  2ZME C;  3MZ8 A;  2LF7 A;  1KGS A;  2VI6 A;  2XAS A;  3MD2 A;  2RAE A;  3MCZ A;  1R71 A;  2JMW A;  2E1M C;  1VI0 A;  2OF7 A;  1LDD A;  2PG4 A;  4PGG A;  1UCR A;  3PQK A;  5JVT A;  1IRZ A;  2ESN A;  2L4M A;  2O5R A;  3DTI A;  3C2B A;  3ISP A;  1TBX A;  1SFK A;  1SFX A;  3MKW B;  2LTP A;  3U9G A;  1Q1H A;  5FLX Z;  1KQ9 A;  3H5A A;  2YX4 A;  2XAF A;  4E7Z A;  2EBI A;  4FTH A;  5FLV A;  3HOW J;  4IHX A;  3AL0 B;  1MH3 A;  3GZN B;  4M6X A;  4QPO A;  2BW3 B;  3QOD A;  5EF6 A;  1B8I B;  1ETW A;  4XN0 A;  2V9K A;  2ZJ2 A;  1YI2 I;  4FQG A;  1QVT A;  4XR6 A;  2CWE A;  3OIQ A;  1Y1V J;  1MMN A;  3LFK A;  1RUO A;  1VQ5 I;  2QSG X;  4BEH A;  3G73 A;  2DO7 A;  3PUF A;  1MW7 A;  5L3G A;  3Q0V A;  3KEY A;  1BBY A;  2KIF A;  2XF5 A;  4RB0 A;  3KZZ A;  2F4O B;  2O3F A;  3H5N A;  2QVO A;  3K1N A;  2EV0 A;  4KNY A;  3UR3 C;  3UNG C;  3RI4 A;  2WY8 Q;  1J0R A;  1SFE A;  2DA6 A;  4HSR A;  1CQT A;  1X3W B;  3HOX J;  3A4C A;  2DOA A;  3RTR A;  1JE8 A;  1MBF A;  1TP4 A;  3PIP F;  1JT0 A;  2NS0 A;  1HW1 A;  3QOP A;  2Z16 A;  4LG3 A;  4B09 A;  1LFP A;  1BIB A;  4IRH A;  2DBB A;  2EQR A;  2LKS A;  3D5L A;  4E7K A;  3F72 A;  4KUM A;  3FX3 A;  3HOT A;  2DT6 A;  4IHW A;  3ELK A;  4WCG A;  5FLM J;  3K69 A;  3I59 B;  5ERI A;  2ZCW A;  4LIU A;  4KIC A;  4CCN A;  1BI3 A;  4LOC A;  3LMM A;  3TW6 A;  1YLF A;  4UVA A;  2OV7 A;  3H9Q A;  3AKZ A;  2HOS A;  1W7P B;  2IA1 A;  1IN7 A;  3JSP A;  4KA4 A;  2FUG 2;  3GF2 A;  4CCJ A;  2NOG A;  3BG5 A;  2VE8 A;  3OL4 A;  4AID A;  3B73 A;  4BS9 A;  2PMZ N;  2O61 A;  5EEG A;  3HUG B;  2KRC A;  3E6M A;  3GTP J;  1DU6 A;  2ZME B;  2ZNZ A;  4RGX A;  4IOA F;  1S7O A;  3VYU B;  2RN7 A;  4WXH A;  1XGO A;  2WTE A;  1R1V A;  1PP7 U;  3CMY A;  1SD5 A;  3H9G A;  4KIT B;  1IN6 A;  2P7C B;  1IF1 A;  4LB6 B;  1T0F A;  1FP2 A;  1Y56 A;  3I9V 2;  2JPB A;  1SMY F;  4U7B A;  1UMQ A;  3L2C A;  2LKX A;  4Z6Y A;  2D2W A;  2KDO A;  3WTZ A;  5CKT A;  4XOP A;  2DOE A;  4CYC A;  1R22 A;  3LSG A;  1E3H A;  1XMA A;  5HLT A;  1DQU A;  3O8H A;  4A2U A;  3BC8 A;  3I0T A;  3O6B B;  3V8K A;  3S3N A;  1BR1 A;  3SDG A;  3CP2 A;  1YE9 A;  3X2Q H;  3GTJ J;  3CCU I;  3BQZ A;  2EIM H;  3K4J A;  3L9F A;  1L0O C;  4YEJ A;  5LHI A;  2VKV A;  4B47 A;  1YHQ I;  4IKF A;  1GUU A;  1ETQ A;  1FX7 A;  4RGU A;  1TWA J;  5L3B A;  4E7L A;  4C3J J;  1FP1 D;  3P9I A;  4P96 A;  3IAS 2;  2M8G X;  3OWT A;  4RLF A;  3CC4 I;  1HA8 A;  4G7O F;  3LNQ A;  4BXU A;  4FE4 A;  5E17 F;  5H20 A;  3P5J A;  3WTS C;  2L01 A;  1OQY A;  1LFB A;  1TLH B;  3Q0W A;  3PNT A;  4YG2 F;  2HZD A;  1WFX A;  1NG7 A;  4C30 A;  4I0A A;  1TT0 A;  1G3S A;  4KMU X;  2EFW A;  1TNT A;  4IXA A;  2RKH A;  4Y7N J;  4IRI A;  5CQE A;  1ULY A;  3QOE A;  2ZBK A;  4B8X A;  3WE2 A;  3OYG A;  1MDM A;  2DDA A;  4U0V A;  2ZJQ F;  3TP3 A;  4B48 A;  1D5V A;  1FBS A;  2YR2 A;  3H1C A;  3T8R A;  1S8N A;  4HLY A;  3F3X A;  5LEK A;  4QIW N;  3DEU A;  3WTT C;  1JTX A;  3HRT A;  1QQI A;  1X4O A;  3GEZ A;  3M9A A;  2HKX A;  4EM1 A;  4EJU A;  4AM3 A;  3H3Z A;  1W36 D;  1ORK A;  3ESW B;  1HSJ A;  4XLN F;  2BYV E;  1OFC X;  3CCR I;  3N97 A;  2FQ4 A;  1V3F A;  1B72 A;  1PVE A;  4HV6 A;  2VUM J;  1XN7 A;  2M7B A;  1LDJ A;  1QGP A;  1JT6 A;  4FX4 A;  2YX7 A;  4NC7 A;  5K5O A;  4MEX F;  3JAM K;  1K6Y A;  2E5N A;  1RC9 A;  2DAO A;  4HDV A;  4ESB A;  1HST A;  1FIA A;  1J2X A;  3F23 A;  3S32 A;  3OYL A;  2CQN A;  3REO A;  4FET A;  1E17 A;  1W7P D;  2KFD A;  4RB1 A;  3GFI A;  3D5R C;  1FPQ A;  3OYE A;  4KIS A;  2CV1 A;  5E3L A;  1XCV A;  2Y48 A;  1ZRD A;  2WA0 A;  4HNV A;  2A3S A;  3PUB A;  1L3L A;  5C4J J;  4MQV A;  3F8B A;  4H4K C;  3BCA A;  1Z7U A;  1IAW A;  3NWS A;  2FMY A;  1A36 A;  3GZ5 A;  5FKL A;  5EDN A;  2OZU A;  1UZC A;  4XLE A;  4D5F A;  3BT9 A;  1KYZ A;  1EH7 A;  1Y6I A;  4AIJ A;  3K70 C;  3J7A O;  2ELK A;  3LQR A;  5D6E A;  5LD2 C;  2VXZ A;  4HF0 A;  2QCO A;  2NVT J;  2BXY A;  1K6O A;  2L9S A;  4CCK A;  1G4D A;  1PYV A;  3A01 B;  2A05 A;  3CJQ B;  3PJR A;  1HDD C;  2V6C A;  2A61 A;  3S14 J;  4CZZ A;  1GT0 C;  4NC6 A;  1FYK A;  1KU7 A;  2IP2 A;  3VOE A;  3BG6 A;  5HNH A;  1IC8 A;  1QA6 A;  1ZLK A;  3OYB A;  3HEF A;  4XIC A;  3RPQ A;  5F1J A;  3DTE A;  4MIM A;  4FT8 A;  1FYM A;  4OU0 A;  4OIN F;  2QSH X;  1PP8 F;  3W2V A;  2X51 A;  1SC7 A;  2DA5 A;  5HS7 A;  5ILU A;  3G1M A;  5ILV A;  1YJ9 I;  1Y8R B;  2QBY B;  2V9P A;  1U78 A;  3LAJ A;  2ME6 A;  2DTR A;  2RNG A;  3ZQH A;  4OIR F;  3BZ6 A;  2CW7 A;  3CQZ J;  2XAU A;  2QF7 A;  3IC7 A;  3C3W A;  1IV8 A;  3EET A;  3I5U A;  4AIK A;  3MKY B;  4M71 A;  2DJI A;  1UEL B;  2RDP A;  4GFB A;  2EV6 A;  2QEX I;  3ZP5 A;  3HHG A;  5J3L A;  3FBN B;  2F48 A;  5FKM A;  2Z99 A;  4IHV A;  5K5Q A;  3L2W A;  2Q2E A;  1QVU A;  3KCC A;  3HZJ A;  1W0U A;  1O3T A;  2R7R A;  1UFM A;  4IPA A;  4IHY A;  4PUS A;  5GP9 A;  1STZ A;  3COA C;  1K61 A;  1ETK A;  2VJ4 A;  4DZP A;  1C0W A;  3M8E A;  1F1Z A;  2XIG A;  4B44 A;  3HKZ A;  3I4N J;  1WSU A;  2DFE A;  2H6B A;  3LWF A;  3HPG A;  1ERD A;  5LBQ A;  1OCP A;  3IWZ A;  1ZG3 A;  2M34 A;  3U2R A;  1P92 A;  3HOU J;  2GOM A;  2ZXH A;  3DKW A;  3ZQ7 A;  2CGP A;  5FRM A;  1X1D A;  1R5G A;  5E18 F;  1K83 J;  4A5M A;  4D7N A;  1F36 A;  1LDK B;  2F4M B;  3EUK L;  3VEP A;  1YJN I;  5J4Y A;  1VQ4 I;  5HOD A;  1N25 A;  3FXJ A;  3JRA A;  4OIQ F;  2IGN A;  4UNO A;  2EJR A;  2OC6 A;  3I4M J;  4CCO A;  1P4A A;  4MFE A;  1R4N B;  4ZC3 A;  1W1W E;  1NG6 A;  4BE2 A;  3PO2 J;  5LGN A;  3IKT A;  1FSE A;  1RR7 A;  4IQ4 A;  3LSJ A;  3SQN A;  5IP6 A;  4E7H A;  5FGM A;  1JKP C;  1A04 A;  1HDP A;  1S7E A;  2O8X A;  2R0Q C;  3M1E A;  3PO3 J;  4XRF A;  2R93 J;  1YIJ I;  1IZ1 A;  4I76 A;  3E5U A;  3QP6 A;  5E79 C;  1W0T A;  2V4J C;  1H9T A;  1JUM A;  1IW7 F;  2DLL A;  3MQ0 A;  3HOZ J;  4RLQ A;  2OA4 A;  4MQ9 F;  2X4H A;  1R36 A;  1P2F A;  2FRH A;  4XSZ F;  2DI3 A;  3R0A A;  3ZMS A;  3DEW A;  1KU3 A;  1OR7 A;  1FTT A;  3TOA A;  2IAI A;  4UB8 C;  4EGY A;  3HGY A;  2Y0M A;  4Z2Y A;  2H1L A;  3DPU A;  3VSK A;  4YIR X;  1U5T C;  1QPI A;  1MZB A;  3PFY A;  5LRR A;  4I98 B;  3RPU D;  3QRF F;  5EZG A;  3ZQC A;  3HSE A;  1TQP A;  3I55 I;  5HDG A;  1LNW A;  4F92 B;  1F43 A;  4A3E J;  4ZZD A;  4O3M A;  3CDH A;  3CMM A;  3KX2 A;  1U6G A;  3KP7 A;  5CPR B;  1X3U A;  4UUV A;  2ACJ A;  5CLS A;  1MSF C;  4HLX A;  2CUZ A;  5E1W A;  3ABL H;  3RKW A;  3U1K A;  4A3F J;  3VWB A;  3VPR A;  5HDN A;  3I56 I;  2VOD A;  5LEJ A;  1VF9 A;  3IH3 A;  5J1U A;  2COM A;  1OMI A;  2JZY A;  1USS A;  3ML6 A;  4R79 A;  4Q5S F;  3LSP A;  1WHU A;  3LSM A;  4LLL A;  4AWX B;  4U7D A;  3F6V A;  1PUF B;  1YW7 A;  3K4L A;  2CJJ A;  3ZMD A;  1WRJ A;  1TTY A;  4OIO F;  3HPH A;  3FF5 A;  2B7E A;  1MBE A;  1R5I D;  3HC7 A;  4CHU A;  5LRS A;  1RRJ A;  2H09 A;  2CFX A;  1VQ6 I;  3BR3 A;  2R7Q A;  5KHD A;  3C2H A;  3EYY A;  2JQ7 A;  1O57 A;  2JA7 J;  1I5Z A;  1XC5 A;  3PNY A;  1UG0 A;  4YRV A;  5DYM A;  4LD5 A;  1WH5 A;  2DN0 A;  1SAX A;  2V6E A;  3ZN0 A;  4GDF A;  2E2I J;  1LQ1 A;  1OLT A;  2ADU A;  4A3M J;  5D8K B;  1P4X A;  4YEL A;  1QPM A;  5EGO B;  3L2U A;  1GXQ A;  3JSO A;  5H2F C;  3E6B A;  4IRG A;  3HDD A;  2ZFU A;  4L9N A;  4ANJ A;  2W00 A;  1RKT A;  1V54 H;  1JGS A;  1Z7L A;  3FXO A;  5ICF A;  2C6Y A;  5F27 A;  3DKY A;  3I71 A;  5M5X J;  2LY9 A;  3M4O J;  4KMF A;  2TDX A;  1DU0 A;  1OIS A;  2DOF A;  4O6J A;  2B0L A;  2DYR H;  2IS1 A;  1NH3 A;  2Z3Y A;  3LSK A;  4I09 A;  5KK1 A;  2ZJR F;  2Y9Z A;  1LVK A;  5DUI A;  5LHG A;  3GTQ J;  1U9N A;  4A3J J;  4MO7 A;  3PSI A;  5JHF A;  1RUN A;  3U1D A;  3M8F A;  2F5D A;  2E35 A;  1HKT A;  3BY6 A;  5FRN A;  1IXS B;  3RIR A;  4UUS B;  2STW A;  1U5T B;  4UV8 A;  3SJM A;  3K70 D;  2PJR B;  1AU7 A;  4RAG A;  1D8K A;  2IS6 A;  2MGQ A;  2HQN A;  3J81 K;  2DFH A;  2NAZ A;  4CGZ A;  2LDU A;  3RSN A;  2L2O A;  3U21 A;  1J7K A;  3CES A;  3HSR A;  2KIU A;  3I53 A;  4XOT A;  3E7L A;  4L5E A;  4N4N B;  3KLN A;  2RGV A;  3KP4 A;  3MKZ A;  3K7A J;  2HDW A;  2CS3 A;  2WB1 A;  1APL C;  2EFO A;  4TV7 A;  5LLQ A;  4KT6 A;  4BDY A;  5KAI C;  2ZNY A;  3F8C A;  1R58 A;  4GO1 A;  3ZQG A;  3AL0 C;  2LYC A;  4HV5 A;  1SEU A;  1Y1W J;  3K4B A;  3H35 A;  4ZTF A;  2X6Y A;  1HF0 A;  3RZD J;  1HKQ A;  3W3C A;  2VKD A;  2BE5 F;  2R5Y A;  2EZI A;  5IYD J;  2ZXJ A;  5AIP A;  2L5Q A;  2VQC A;  4ZZL A;  1VQ8 I;  3M07 A;  4NQW A;  1X19 A;  2Y31 A;  2ME0 A;  3E1S A;  1VQK I;  2LF8 A;  2QKM B;  5LFA A;  3FHN A;  1ACI A;  3KP6 A;  1W4M A;  1OJL A;  1UHM A;  2X6W A;  3L00 A;  1YX5 A;  2NS8 A;  2GXB A;  4UUT A;  4ZTJ A;  1R49 A;  3CJN A;  1Z05 A;  3PM1 A;  1XDU A;  4L9V A;  2BV6 A;  1RIO H;  1T33 A;  3LSH A;  1K78 B;  1TW2 A;  3GFM A;  2MC4 A;  1WI3 A;  5AON A;  1H0M A;  1NK3 P;  3G1O A;  2NVU B;  1X1P A;  3IWF A;  1X3Z B;  3H3V K;  3MAJ A;  4Q48 A;  2VJ5 A;  3EUA A;  2H27 A;  3VSL A;  5L3D A;  3IKV A;  5CJ9 A;  1SD4 A;  2RC4 A;  1I27 A;  3W6J B;  3ABK H;  5D5V B;  3RQ4 A;  5D6F A;  2BEO A;  3D0S A;  5DCF A;  5H6R A;  1Z6T A;  3C18 A;  4BL0 B;  2BW3 A;  1B8I A;  4C2U A;  5HLG A;  5JLW A;  1VZ0 A;  2DMU A;  3FBI B;  1XG1 A;  4ZYG A;  5E3O A;  1I50 J;  2QSF X;  3CC2 I;  2JUG A;  4KDP A;  3MZY A;  1UB9 A;  3VOD A;  4Y52 J;  1OCZ H;  3CUQ B;  2NVQ J;  3NWT A;  1O7F A;  2JRM A;  2HPI A;  3R61 A;  2HTS A;  1FSH A;  1NHA A;  1G3Y A;  3JRC A;  3DWL E;  3R6S A;  1WH7 A;  3V8J A;  4XOR A;  3OS0 A;  5EZH A;  2G7U A;  3I58 A;  4XM3 A;  3HSF A;  3I4P A;  3A02 A;  1XSX A;  4QSH A;  3EQL F;  5D8L B;  1FYL A;  3GVA A;  3GW2 A;  1TW3 A;  1CF7 B;  3H36 A;  2D1H A;  3BLY A;  1X4P A;  4LIT A;  3G4S I;  3SDB A;  4XID A;  1K7A A;  2E36 A;  2PBI A;  2P81 A;  1BJA A;  5KNL A;  1B4A A;  5DEQ A;  1RET A;  4MNU A;  3CCJ I;  2P5L C;  5E3N A;  2KZV A;  1RZ4 A;  4K2E A;  2AQF A;  3I59 A;  4S05 A;  1XD7 A;  4AVZ A;  2QZ8 A;  1O7L A;  4B3X A;  1D1A A;  2A6H F;  2QQB A;  3B6C A;  4LK0 F;  4XLC A;  2M7A A;  4YFN F;  3CCY A;  2LSO A;  2IGK A;  3J7Y J;  1YS6 A;  3SHF A;  1W7P A;  1MKM A;  1IG7 A;  2OBP A;  4BH9 A;  2DK8 A;  4Q4Z F;  4PSX A;  5EYR A;  2VKH A;  1D5Y A;  1Y39 A;  3IL2 A;  4LIV A;  4IX7 A;  3OYN A;  4EM2 A;  2XPV A;  2JVG A;  1ZHF A;  4P1W A;  1HBX G;  2M45 A;  3F8M A;  3HUG A;  4KIB A;  5DTD A;  2HEO A;  2ZME A;  1X2N A;  2GIZ A;  3GFJ A;  1W5C C;  1G59 A;  1AKH B;  3CTA A;  5DD4 A;  1T8I A;  1T56 A;  2MFZ A;  2ZC2 A;  2OQR A;  3AG2 H;  1ZH5 A;  2MBF A;  1UG2 A;  2CV2 A;  5ICE A;  1XMK A;  2GWR A;  3L7W A;  4Y17 A;  4QPQ A;  1DDN A;  3CJR B;  4CXF A;  1ON2 A;  3S3O A;  2D1V A;  1BL0 A;  4BJT A;  4IL6 C;  3O3K A;  1ZLJ A;  2UV1 A;  1ZKG A;  2XPU A;  4J19 A;  1VFC A;  3F21 A;  4G6T B;  2VBY A;  2L02 A;  3QAH A;  4GYI A;  4M74 A;  5F04 A;  4S0H B;  1TWH J;  2GM4 A;  6PAX A;  2QLZ A;  2F2E A;  4RAY A;  4KYW A;  4A3C J;  4WWC A;  2QQA A;  2MC3 A;  1K4S A;  1V55 H;  4G8X A;  3C1D A;  5CVU A;  1XSD A;  1FEX A;  4XLA A;  5DCM B;  2K5C A;  4AC0 A;  4XQF A;  2W7N A;  2LRE A;  1P7J A;  4Y15 A;  1Z6R A;  1I1G A;  3G1L A;  4BJ5 C;  4G12 A;  3T8T A;  3B02 A;  2IGM A;  1SAN A;  2R4G A;  3TKY A;  3S1R J;  3DTK A;  5F1R A;  3Q5F A;  1V4R A;  2O8K A;  4ABZ A;  4D5C A;  5IP9 J;  4I0B A;  4B1R A;  4WX9 A;  5EEH A;  1FOW A;  2K3F A;  4HX4 A;  5CQG A;  4ON0 A;  3LSR A;  3CLO A;  2IBD A;  2K85 A;  5KAF C;  2E60 A;  5J8F A;  2CW8 A;  2D45 A;  2FBH A;  4NNJ A;  2MLG A;  2W48 A;  1DGW Y;  4M9S A;  1DGR M;  3WGI A;  1A5J A;  1JI8 A;  4XN3 A;  4A3I J;  5E3M A;  2VL8 A;  1NTC A;  2X9D A;  2L4A A;  4RA2 A;  4AVP A;  1XMX A;  5J6X A;  1KA8 A;  5L3E A;  2DFF A;  2ZSI B;  2KP6 A;  1IUY A;  2CQ7 A;  3H5R A;  4Y3O A;  4OAZ A;  2WV0 A;  5EJC A;  4F91 B;  4IHT A;  4I99 C;  2DJN A;  2UXN A;  1ETO A;  3MVP A;  1OYW A;  4UXN A;  4MGR A;  2X1D A;  1BW6 A;  1ITY A;  3LL7 A;  2UWM A;  3WG9 A;  2CU7 A;  3HOV J;  5JHU A;  1JUS A;  2OD5 A;  4EMS A;  2A5Y B;  5TGT A;  4L5I A;  3HOY J;  3K1P A;  3O2P E;  4BU2 A;  2EPF A;  1MMA A;  5C4X J;  3BP8 A;  4PSW A;  5FB2 A;  1WKM A;  3ERE D;  2HYJ A;  2MH2 A;  4HDU A;  3FK7 A;  4BQN A;  4FIS A;  2HDD A;  3JRH A;  1UJ8 A;  2EFQ A;  3QPL A;  3IRR A;  3TOB A;  4F7Z A;  1BIA A;  4KJZ A;  3AG4 H;  1T6S A;  3BDD A;  2KIS A;  2QEN A;  3F22 A;  1B6A A;  2Z33 A;  2EH3 A;  4IVN A;  2VC1 A;  2XGC A;  2TRT A;  5HNF A;  4KN7 X;  5DS9 A;  1FJL A;  2I10 A;  3VYR B;  2MD5 A;  4DJA A;  2ECB A;  4HQM A;  5GPC A;  2DU9 A;  4EJV A;  3BG3 A;  4Y13 A;  3KLO A;  4BQQ A;  3GO5 A;  3QYE A;  2DT7 B;  3KET A;  3A01 A;  3OYA A;  3W6V A;  1G2H A;  2F6C A;  1P9Q C;  2A6E F;  4MTD A;  4U0Y A;  4M3E A;  4GGG A;  1IGN A;  1FY7 A;  2VOO A;  1WCM J;  1YYV A;  2AO9 A;  4CUG A;  2HXO A;  3DQV C;  3OIP A;  2CV0 A;  2GXG A;  3O8G A;  4JK1 X;  4MTE A;  3H9J A;  4ZYA A;  2R7O A;  2XB5 A;  5FO5 A;  2VN2 A;  3KP3 A;  4IZZ A;  3DPT A;  2LBF B;  3GUD A;  4GRI A;  5KVR A;  2QBY A;  5TJJ A;  4GYG A;  4M3G A;  1UST A;  5DM6 F;  1MH4 A;  4JX4 A;  2KRF A;  1N77 A;  3J81 Z;  2W57 A;  4PJN A;  2BXZ A;  4HZF A;  2LY1 A;  4G7Z F;  1ETV A;  3QU3 A;  3G71 I;  3ZMV A;  1N75 A;  4AYB N;  4L9J A;  3DU6 A;  3FMQ A;  4M9X A;  1IN8 A;  1MGT A;  2MD0 A;  5A2Q Z;  2ECC A;  4CYD A;  4DYQ A;  3OR2 C;  3BQY A;  4M6Y A;  2DPD A;  3DPL C;  2JN6 A;  1S29 A;  3H0D A;  4C2M J;  2EIK H;  4IF4 A;  4JYK A;  2EB7 A;  2XSJ C;  3OYJ A;  2VOP A;  3CLQ A;  4HX8 A;  2PFB A;  1U3E M;  1TQM A;  4II2 A;  1LVA A;  4Y33 A;  3ASN H;  2W24 A;  2BY0 A;  3L2V A;  1X1C A;  2DDB A;  2YU3 A;  4M72 A;  4I02 A;  1SVM A;  2FU4 A;  1FWZ A;  4XKW A;  3BR0 A;  5ILS A;  5E20 A;  1Z91 A;  3MZH A;  1O4X A;  2NNN A;  2DA7 A;  4IOC F;  1GHC A;  3I3L A;  3T1B A;  2A07 F;  4OOI A;  2PMU A;  3PL8 A;  4W1U A;  4XNF A;  3CCQ I;  1YO5 C;  3K1M A;  2KIQ A;  2W1O A;  1R6R A;  2GZW A;  2Z9O A;  2MW8 A;  3QPH A;  5JR3 A;  5J8C A;  2MA3 A;  2K4B A;  5D5U B;  4DOZ A;  2V7F A;  1BI0 A;  1JJ8 C;  3FM3 A;  3WHB A;  2R7Z J;  4G7H F;  1S3J A;  4WXC A;  1WJA A;  2CUE A;  2Y0S A;  4V19 K;  2JA6 J;  4FX0 A;  3SZP A;  3QYF A;  2PEX A;  3QYB A;  2KMU A;  3TO7 A;  2YPR A;  2VAS A;  4WXD A;  1OCR H;  2HQA A;  3Q9V A;  3P9K A;  4DGW B;  3NAR A;  4XKV A;  3CDL A;  2FA5 A;  1QBJ A;  3F0C A;  2IGO A;  3CP8 A;  1LPQ A;  3FXQ A;  3I64 A;  5E1Z B;  2IT0 A;  1X1A A;  1Z67 A;  2QQ8 A;  3K4N A;  3K2A A;  1O3R A;  2RQP A;  4V2G A;  3S8P A;  1MSE C;  2BOL A;  2HWV A;  4ESJ A;  2FD5 A;  2VPR A;  1T95 A;  2CRG A;  5EEA A;  4BY1 J;  1BN5 A;  4S04 A;  3GTL J;  1YG2 A;  2M0C A;  2PMZ A;  3Q0U A;  4GXO A;  4PGH A;  5GTH C;  5E8G A;  2L7M P;  1LFU P;  2D5V A;  4IQJ A;  1IDZ A;  1V5F A;  4E6K G;  4IEJ A;  3GTK J;  3SXY A;  2XVC A;  2ID6 A;  4F55 A;  2E7X A;  1AOY A;  1FNN A;  3A03 A;  1BJZ A;  4ZYD A;  1VTN C;  2OZ6 A;  3CCM I;  5K7Z A;  3A0H C;  2VJI A;  3J7A Y;  1MNE A;  3HIF A;  3FXR A;  1YQA A;  4ENM A;  4EJT A;  4ZYH A;  1S9H A;  4B43 A;  2NOJ B;  3BG7 A;  1E2X A;  4LG0 A;  2BBY A;  3T5X A;  4UVB A;  3EUH C;  3IHU A;  4YIF A;  1HKS A;  3SFI A;  4O5V A;  1PUF A;  2OCC H;  1S5L C;  2L0K A;  2EV5 A;  3DFG A;  3ZMT A;  1TWG J;  2QKL B;  2WBM A;  2EA2 A;  2F5E A;  2FEZ A;  3FKJ A;  3BR1 A;  2IXS A;  4L9T A;  3E5X A;  3FM5 A;  1Z1D A;  1P4W A;  3OYC A;  4QWQ A;  1QZY A;  5B1B H;  3H92 A;  2IVM A;  4I2O A;  1EF4 A;  3HOS A;  1N78 A;  3L1P A;  2KJB A;  3S16 J;  3EYI A;  4G6Q A;  3ZOB A;  1Y0N A;  1WJE A;  3CCV I;  1DP7 P;  4P9F A;  3ZQI A;  1IDY A;  2KLO A;  1DPR A;  4HRI A;  4RDU A;  2WWY A;  5M5Y J;  3DKX A;  1HC8 A;  4OIP F;  5CYV A;  1JHF A;  4DQ2 A;  2HFH A;  1UHW A;  5J47 A;  4EAT A;  3F9K A;  2DFI A;  2O9L A;  2JK3 A;  2R7F A;  2Q2E B;  5EGO A;  2JA5 J;  1H89 C;  2HR3 A;  3KYD B;  1ZR4 A;  5F0F A;  3GYH X;  2KIM A;  1IV6 A;  4BGD A;  5ED4 A;  4I7H A;  2HVR A;  3V7S A;  1MD0 A;  4R1H A;  5AIQ A;  3A2K A;  4F52 A;  1B1B A;  2M4G A;  4RGR A;  2BVL A;  3DU5 A;  5DD8 A;  5ICG A;  3TQN A;  3FXL A;  3FWE A;  4E7J A;  3CJT B;  4BUP A;  2K3P A;  3KIO A;  1OCC H;  1SFU A;  2OTL I;  3HRM A;  3RZO J;  1IRG A;  1GXP A;  3JRB A;  3W2A A;  1B9N A;  1SAU A;  3G2B A;  2OAZ A;  3OSG A;  2DA3 A;  3M3Y J;  3S2D J;  1BM9 A;  1TWF J;  2M87 A;  2R5Z B;  4G9Y A;  1JHH A;  1QHH D;  3OYD A;  3SZG A;  4A6E A;  3DCF A;  4UUS A;  1U5T A;  4BY7 J;  2PJR A;  4XRM A;  1I3Q J;  1Z21 A;  1BR2 A;  2CFO A;  1ENH A;  4X0G A;  4KFC A;  2DYS H;  2XF7 A;  5IYC J;  5B1A H;  1WJ5 A;  1D1B A;  4N0B A;  3SEZ A;  2K7L A;  2XHK A;  2MG4 A;  2V79 A;  3K9T A;  4PK4 A;  3BOQ A;  2XAQ A;  1YOV B;  2KRH A;  3NEU A;  3GZ6 A;  5DM7 F;  3PIO F;  5TRD A;  1IN5 A;  3IH2 A;  3WHC A;  2XF6 A;  2M5W A;  2DXI A;  5EG0 A;  5M5W J;  3TDZ C;  1S72 I;  3NRV A;  2VPL A;  2EZH A;  2NVY J;  4ZDP A;  2FNP A;  2NYX A;  3RQI A;  1ZGJ A;  2FBI A;  4EJO A;  5GAH J;  1ZG5 A;  1D0X A;  3E97 A;  4XL9 A;  4U0W A;  1U9O A;  4RBO A;  2VBX A;  2W25 A;  3BTC A;  5BMZ A;  2JT1 A;  2P5V A;  3FIS A;  3SFZ A;  3N4M A;  3ZQL A;  2QQ9 A;  2XPW A;  4XLF A;  3V7R A;  3DLL F;  1ETX A;  5F08 A;  5M3F J;  3WTY C;  5F0C A;  3V8L A;  2JJ7 A;  5E8I A;  2XV4 S;  4CCM A;  1ON1 A;  1QRY A;  3CUQ C;  2E19 A;  2HZT A;  4I01 A;  3W6K B;  4PZJ A;  3CCE I;  4HX7 A;  2ZXW H;  2CMP A;  1TQI A;  1WZ2 A;  1XGS A;  4I6Z A;  2VLA A;  1D0Z A;  2VON A;  2VT2 A;  1K78 A;  1MNM C;  3MN2 A;  1FC3 A;  2HYG D;  2NS7 A;  3OS2 A;  4XKB A;  4A0Y A;  2VQH A;  2OTJ I;  3TO9 A;  3LA7 A;  2WY7 Q;  3ABM H;  1S7A A;  2Y75 A;  3BRO A;  2V1U A;  2CSO A;  2TCT A;  1IN4 A;  2O7O A;  3WE3 A;  4AUX A;  5IT9 K;  2XGE A;  4XKC A;  2P6T A;  3BR6 A;  5LHH A;  5A2Q K;  3KEO A;  3PNV A;  5D5X B;  2L9R A;  3GWZ A;  1HQC A;  1HCR A;  3LA3 A;  3AFH A;  2ZJP F;  4GCV A;  3JCU C;  1G3T A;  2E5Z A;  1G6N A;  2R7X A;  1RES A;  3GCM A;  4Q47 A;  2E71 A;  4QTR A;  2AS5 F;  2RRE A;  1U2W A;  2PN6 A;  4MHG A;  4EGZ A;  3ABU A;  2EZK A;  1Z3Y A;  3IV5 A;  3WG7 H;  1OCT C;  3CF2 A;  4C2T A;  1Y8Q B;  1ZG1 A;  3W2W A;  3SYT A;  2UXX A;  1JTY A;  2HOA A;  1F5T A;  3FXU A;  3CUQ A;  2XRL A;  3V42 A;  2MH9 A;  2HU9 A;  2IA0 A;  4BE1 A;  3CC7 I;  4CZC A;  2G0E A;  4CH7 A;  5HDK A;  1ZRF A;  3E0J B;  2K9L A;  5IY5 H;  3CO6 C;  4DW6 A;  3J80 K;  1JUP A;  5JVG F;  1D0Y A;  2PI0 A;  4U88 A;  4W97 A;  1KZH A;  1CF7 A;  1MBH A;  2IJL A;  3IUO A;  2XUB A;  2BVM A;  2COB A;  4DIQ A;  2A6T A;  4HNT A;  4HF2 A;  1RKW A;  2EFP A;  5FFX A;  2OCE A;  2JSC A;  2WV1 A;  1SMT A;  3FXK A;  5E1X A;  2N8G A;  1IXR C;  3R60 A;  1XTA A;  2ISZ A;  2DQL A;  2L3D A;  4P9U A;  4HPQ A;  3QQA A;  1IRF A;  3OYM A;  3GTO J;  4PFP A;  1ZR2 A;  2LR8 A;  2GOX B;  3HB9 A;  3RCO A;  2Y69 H;  2MLK A;  1A35 A;  2FSW A;  3ZR8 X;  1WWX A;  1JKO C;  1R9T J;  4P55 A;  2RVC A;  4M9Z A;  2PJP A;  3S3M A;  5HS8 A;  1D8J A;  3HL2 A;  3PSF A;  2P8T A;  2HXI A;  4JBA A;  3L09 A;  2O6G E;  5K5R A;  4L0Y B;  4RS8 A;  3WTW C;  2XAH A;  4A0X A;  2E2H J;  1GV2 A;  2H1K A;  1J9I A;  3KPH A;  2PMH A;  4BHB A;  5GTI C;  2XGD A;  4RM2 A;  5IOZ A;  4M3F A;  4ZJZ A;  1AKH A;  3WU2 C;  4NC8 A;  1A31 A;  1TT5 B;  2QM3 A;  3BTI A;  3OOP A;  3OOU A;  3K10 A;  1BI1 A;  2M30 A;  3BJ6 A;  4A0Z A;  1LKX A;  2BZT A;  1E3O C;  3R0J A;  4LFU A;  3VFZ A;  5K1Y A;  1ZAO A;  1BI2 A;  2FML A;  1H9G A;  2JA2 A;  3M8J A;  3IH4 A;  4KIG A;  4NBQ A;  2XAJ A;  1POG A;  3QU6 A;  2DA2 A;  3DF8 A;  2DMP A;  2M3A A;  5DV5 A;  3M1C A;  2ZKZ A;  1NK2 P;  1VQ9 I;  1Z3X A;  2A68 F;  1J5Y A;  4YFX F;  2VE9 A;  2FBK A;  5F0H A;  3MWM A;  2RQQ A;  2XKP A;  4JX5 A;  3T0Y A;  4II3 A;  3KP2 A;  5IP7 J;  1DP3 A;  4XLH A;  4BHP A;  1BW5 A;  5DCM A;  2UUZ A;  3DLA A;  2LK2 A;  3S93 A;  2EWN A;  1E0E A;  2NXN B;  3K4C A;  1SVO A;  1HXD A;  1OPC A;  3QWL A;  3J7Z I;  3S17 J;  4ENN A;  4D7M A;  5IT3 A;  3KP5 A;  1VQO I;  2CUJ A;  3C7J A;  3GLX A;  1H88 C;  3ECH A;  2ISY A;  2HTJ A;  4M3D A;  2OUM A;  2K9M A;  3LAP A;  2K40 A;  4XBF A;  1Z77 A;  1YRN B;  2CUF A;  2Y9Y A;  1D1C A;  1D3Y A;  2VB6 A;  2W85 A;  1R5H A;  1WJC A;  4G6D A;  5J1Y A;  1LE8 B;  4NHJ A;  3CCS I;  1I39 A;  2G9W A;  1MBK A;  1R7J A;  2LRD A;  1JJ6 C;  1XSV A;  1PUE E;  1QNT A;  4LMY A;  3K0L A;  2A5W A;  2HS5 A;  4FHT A;  3RKY A;  3TP0 A;  4PJ0 C;  4A12 A;  1BA5 A;  2FX0 A;  2CG4 A;  4NUB A;  3CDI A;  1HLV A;  3R4K A;  4B4C A;  5K7F A;  5CVJ A;  3RJP A;  2LOO A;  2L54 A;  1T39 A;  4BJ6 C;  1KU9 A;  1VND A;  1VQM I;  4JQF A;  4KN4 X;  4L0Z B;  1FLI A;  1LEB A;  3SZT A;  1T0F C;  2JRT A;  4JP0 A;  3KFW X;  1BOA A;  1ZYR F;  4D1Q A;  2GBY A;  1X58 A;  3DEE A;  2Z5U A;  4EVI A;  2JA8 J;  1T98 A;  2AQE A;  2Y0S N;  1WVR A;  2HQR A;  2A69 F;  2HVQ A;  3FDY A;  2QWW A;  2YU9 J;  3WTV C;  2HNH A;  5CVV A;  2HYF A;  2PX9 A;  5FKN A;  3V7C A;  2X0L A;  1ZQ3 P;  2WAQ A;  4AU7 A;  2AHQ A;  5B3S H;  5JFR A;  5GAE J;  2KZG A;  3ZQQ A;  3DBR B;  2QGU A;  2O0Y A;  2MAB A;  4LB5 A;  3HKZ N;  2V1X A;  4A3K J;  3JRF A;  2FF4 A;  1J09 A;  2W84 A;  3NQO A;  1LB2 A;  5HS9 A;  1QZZ A;  2JPC A;  4BEH B;  1GVD A;  3TW7 A;  3ZGK A;  4CIC A;  4EJW A;  3N05 A;  3OMY A;  4BHC A;  3HJE A;  3DV8 A;  2HVS A;  4UHT A;  3H3U A;  1R4M B;  4HYE A;  2E1M B;  2X1C A;  2XB0 X;  2DK5 A;  3ZXS A;  4AIH A;  2IRF G;  1F9N A;  2DW4 A;  2VT3 A;  1I1S A;  1KQ8 A;  2ICW G;  2P7V B;  4XON A;  2JWT A;  5L3C A;  2LBF A;  1REP C;  1YIO A;  3L2R A;  3ZMU A;  1IJW C;  3F8N A;  5HOO A;  2P0W A;  1IUF A;  2ELJ A;  2VKE A;  2ZFW A;  2FNA A;  3HM5 A;  1E3P A;  5GAD J;  1ETY A;  4LLG F;  3MMY B;  2XC7 A;  1Y0U A;  3DBL B;  4HW0 A;  4X6A J;  2LMD A;  1P6R A;  2KPM A;  2JUC A;  5J40 A;  2AXL A;  2ESH A;  2FQ3 A;  3QPS A;  1ONV A;  2ZO4 A;  2DT5 A;  3DBH B;  2EFN A;  1QZE A;  1G3W A;  2BY1 A;  2BY3 A;  3MFK A;  1F4K A;  2O03 A;  3GTG J;  4AD9 A;  2ID3 A;  4HBL A;  3MKL A;  3D1N I;  3ZRG A;  1Q1V A;  3LA2 A;  3H0G J;  1EJ9 A;  2E1N A;  4BYY A;  3RPU A;  2HI3 A;  3RKX A;  4DBQ A;  4BAC A;  2DOD A;  1VQN I;  1LJ9 A;  2BY2 A;  2Q0O A;  1EH6 A;  3Q9S A;  2XRN A;  5BNG A;  4QLC U;  3BTL A;  1IO2 A;  2XSD C;  5BQT A;  1OYI A;  3EDP A;  3DXJ F;  2E1O A;  4OAY A;  1ZTR A;  1O3S A;  1FBU A;  5CVR A;  1R00 A;  1W5T A;  2LC2 A;  1AWC A;  3MEX A;  3HHH A;  2VBW A;  2FJ1 A;  1YW9 A;  3ABT A;  3ROU A;  4E70 A;  3KZI C;  5F6F A;  1FMV A;  2I8D A;  1EH8 A;  2YS9 A;  3TBI A;  4FE7 A;  2R7D A;  1AA7 A;  2L7K A;  2L7F P;  4CYC B;  1W5S A;  2NRA C;  4HF1 A;  2OQG A;  2M2E A;  1ZN2 A;  4BBR J;  4XRS G;  2EZL A;  3A1Y A;  3IP4 B;  1EA3 A;  2IA2 A;  2Q1Z B;  2K9S A;  2X48 A;  2VIX A;  1SD6 A;  1I3A A;  3C2G A;  4PCQ A;  2LVS A;  3RKQ A;  5IT9 Z;  3LOC A;  4N9I A;  1K4T A;  3OIO A;  1ZRC A;  2HGC A;  2FXA A;  3IRQ A;  1RNL A;  1JXS A;  4Y4R A;  2R7T A;  1I6X A;  4RM3 A;  2Y2Z A;  1JKR C;  4C3H J;  4IHS A;  3HTS B;  4E7I A;  2ELH A;  3WU0 A;  1TWC J;  4UB6 C;  3GFL A;  3ZMZ A;  1WGX A;  5H6Q A;  3LQQ A;  1OCO H;  3JRI A;  1AHD P;  3FZV A;  3WTU C;  2GA2 A;  2IS4 A;  2R7U A;  1IRX A;  3WGH A;  1MMS A;  2IPQ X;  2IS2 A;  1WJD A;  4KIF A;  2LP0 A;  5LGU A;  3B6A A;  2STT A;  3K6G A;  2K86 A;  4MLO A;  2KDZ A;  4WF2 A;  1FTZ A;  3DP7 A;  2GAU A;  2K9Q A;  1XDS A;  4EM0 B;  1MDM B;  2B63 J;  1PDN C;  1QHG A;  1O3Q A;  1GDT A;  3QPT A;  2B9S A;  1LUJ B;  1RI7 A;  3K4M A;  3J80 Z;  4BAY A;  1YW8 A;  1B59 A;  1Z9C A;  4OMZ A;  2L7Z A;  3HG9 A;  3GME A;  4ENK A;  2LKP A;  3E3V A;  3WTX C;  2OPT A;  3CME I;  1XGM A;  1MJA A;  1R1U A;  1YTY A;  1B72 B;  4D9J A;  1Z0X A;  3CCL I;  2NVX J;  2VQG A;  2CH0 A;  1BOB A;  2V26 A;  3OY9 A;  3VB2 A;  1A6Q A;  3BPX A;  1TZL A;  2Z1D A;  3OL3 A;  3S1M J;  1YS7 A;  4M3B A;  3F6O A;  4E7S A;  1KU2 A;  1WPK A;  2E34 A;  1TL8 A;  1JGG A;  1CGP A;  4J01 A;  4ZDO A;  1XGN A;  4RAZ A;  3BJA A;  3FMS A;  4ITV A;  4LGW A;  5BPD A;  3QP5 A;  3VYT B;  4BXF A;  2V9V A;  1OKR A;  5FLX K;  4DBR A;  2X85 A;  3P9C A;  1ZEL A;  3RDI A;  3E6C C;  1YFH A;  2G7H A;  2DA1 A;  1ZGW A;  5DDG A;  2J5O A;  2CO5 A;  1SVL A;  1H8A C;  2P5K A;  1V5G A;  2CW0 F;  3GBG A;  3OV8 A;  4X1E A;  3ZCO A;  3OYI A;  3G6E I;  2MSY A;  4BNC A;  3JRD A;  5FRO A;  2WB1 N;  2JVH A;  2DQR A;  3I54 A;  4E4H A;  5C44 J;  3TED A;  4NB5 A;  2VXD A;  4ASN A;  2M8E A;  1U0J A;  1K79 A;  2HDC A;  4FAS D;  1OR7 C;  5FD6 A;  4RB2 C;  5J1R A;  4PDK A;  2Y30 A;  1FOK A;  2M1B A;  3NAU A;  3IAM 2;  3FXM A;  3HXL A;  2XKO A;  3HBL A;  5HLI A;  4A69 C;  3ASO H;  1WQ2 A;  5FKK A;  5J4V A;  1XX5 A;  1TC3 C;  2CQK A;  5BOX A;  3V4G A;  1UHS A;  3ZQF A; 
#chains in the Genus database with same CATH homology
 2TCT A;  2O7O A;  4AUX A;  3TP3 A;  2XGE A;  5EYR A;  1D5Y A;  3BR6 A;  2R5Z A;  3OSF A;  2L9R A;  4QIW N;  2ZB9 A;  1JTX A;  2XPV A;  1HCR A;  4A3G J;  1ORK A;  1RES A;  5DTD A;  1OFC X;  1X2N A;  4QTR A;  2FQ4 A;  1AKH B;  1B72 A;  5JLX A;  2VUM J;  1T56 A;  2EZK A;  3IV5 A;  1JT6 A;  1OCT C;  2CQX A;  1UG2 A;  5K7H A;  5IYD J;  5C3E J;  4XRS A;  2DMT A;  1JTY A;  1BL0 A;  2HOA A;  1FIA A;  1ZKG A;  2XPU A;  2KT0 A;  2XRL A;  4J19 A;  1VFC A;  2G0E A;  5IYB J;  5F04 A;  4S0H B;  1TWH J;  5E3L A;  2GM4 A;  4DW6 A;  5M3M J;  1JUP A;  3S1Q J;  4A3C J;  4HNV A;  2H8R A;  4A93 J;  4W97 A;  1HOM A;  5C4J J;  1MBH A;  2COB A;  1FEX A;  1RKW A;  5FKL A;  4AC0 A;  5EDN A;  3BR5 A;  4D5F A;  3BT9 A;  2WV1 A;  1P7J A;  3G1L A;  2N8G A;  4G12 A;  4XK4 A;  1SAN A;  3S1R J;  1XS9 A;  4DZJ A;  2ELK A;  3QQA A;  2O8K A;  2QCO A;  4ABZ A;  4D5C A;  3GTO J;  5IP9 J;  4B1R A;  2IEK A;  1ZR2 A;  2NVT J;  3HGG A;  1MBJ A;  2LR8 A;  4DYR A;  1U8B A;  2HQ5 A;  1GV5 A;  3HB9 A;  3A01 B;  3LSR A;  2IBD A;  1HDD C;  3S14 J;  1JKO C;  1GT0 C;  2M9H A;  1R9T J;  1IC8 A;  1X2M A;  2W48 A;  3HEF A;  4XIC A;  5F1J A;  4MIM A;  1A5J A;  4A3I J;  2HXI A;  5E3M A;  4A3B J;  1NTC A;  2DA5 A;  2X9D A;  1I6H J;  3G1M A;  2E2H J;  1U78 A;  4NDL A;  2ME6 A;  3ZQH A;  1GV2 A;  2H1K A;  3JRE A;  3CQZ J;  2QF7 A;  2DJN A;  2LFB A;  1ETO A;  3MVP A;  2XGD A;  5IOZ A;  1A6I A;  4M3F A;  1AKH A;  4GFB A;  9ANT A;  1SFO J;  1BW6 A;  1ITY A;  3BTI A;  5J3L A;  3OOU A;  1P7I A;  5FKM A;  2CU7 A;  3HOV J;  3JR9 A;  1JUS A;  4IHV A;  1E3O C;  4V2F A;  1QVU A;  4B3A A;  1W0U A;  3HOY J;  3BTJ A;  2LD5 A;  3IH4 A;  4IHY A;  5GP9 A;  2DA4 A;  1POG A;  1MBG A;  1K61 A;  4A3L J;  5C4X J;  1ETK A;  2DA2 A;  4BXX J;  2DMP A;  4DZP A;  1NK2 P;  3I4N J;  2K9N A;  2HYJ A;  3FK7 A;  1OCP A;  1RPW A;  5F0H A;  4FIS A;  4FCY A;  2HDD A;  2M34 A;  4JX5 A;  3JRH A;  3HOU J;  3QPL A;  5IP7 J;  2CQQ A;  2E2J J;  1BW5 A;  1K83 J;  4D7N A;  5FKO A;  3S2H J;  1F36 A;  4BKX A;  3GTM J;  2LK2 A;  2EH3 A;  2XGC A;  2TRT A;  3S17 J;  2YUS A;  5HOD A;  5DS9 A;  1FJL A;  2I10 A;  4D7M A;  3JRA A;  2DTZ A;  3JRG A;  2ECB A;  5GPC A;  3I4M J;  4MFE A;  3PO2 J;  3BG3 A;  1RR7 A;  1H88 C;  3LSJ A;  3A01 A;  5IP6 A;  4EEF G;  1JKP C;  1HDP A;  3W6V A;  1G2H A;  1S7E A;  2R0Q C;  4M3D A;  3PO3 J;  4M3E A;  1IGN A;  2K40 A;  1WCM J;  1FIP A;  2AO9 A;  2HXO A;  1Z77 A;  4DYC A;  1YRN B;  2R93 J;  2CUF A;  2Y9Y A;  2HOT A;  3O8G A;  4I76 A;  2XB5 A;  1W0T A;  1JUM A;  5J1Y A;  1LE8 B;  3HOZ J;  4BBS J;  4MFD A;  1MBK A;  1JJ6 C;  3DEW A;  1FTT A;  4M3G A;  5EG0 B;  1MH4 A;  2IAI A;  4JX4 A;  3HGY A;  5GPA A;  3TP0 A;  2WAQ N;  1BA5 A;  2LLK A;  2FX0 A;  1QPI A;  1ETV A;  4JX6 A;  5EZG A;  3ZQC A;  1HLV A;  4AYB N;  4B4C A;  5K7F A;  3BR2 A;  1VND A;  1F43 A;  2ECC A;  4A3E J;  4DYQ A;  2DMN A;  3BQY A;  4JP0 A;  3FKI J;  2JN6 A;  1MSF C;  2GBY A;  4C2M J;  1X58 A;  4JYK A;  4A3F J;  3VPR A;  2JA8 J;  4C3I J;  3BG9 A;  2Y0S N;  5IPA A;  1VF9 A;  3S1N J;  3IH3 A;  5J1U A;  3UKG A;  2YU9 J;  2X6O A;  5FKN A;  3LSP A;  1ZQ3 P;  1PUF B;  2CJJ A;  2AHQ A;  3BR0 A;  2R92 J;  1O4X A;  2DA7 A;  4W1U A;  1MBE A;  3HKZ N;  4A3K J;  3JRF A;  3BR3 A;  3FK6 A;  2MW8 A;  3FIW A;  1GVD A;  3TW7 A;  1JKQ C;  2JA7 J;  1XC5 A;  1JJ8 C;  3WHB A;  2R7Z J;  1WH5 A;  2CUE A;  2DN0 A;  1YRN A;  2JA6 J;  2XB0 X;  2E2I J;  4A3M J;  3Q3S A;  5FJ8 J;  1LE8 A;  4A3D J;  2JWT A;  5EGO B;  1ZK8 A;  2R5Y B;  3S15 J;  3NAR A;  3HDD A;  3CDL A;  4M6V A;  1IJW C;  2DMQ A;  3F0C A;  2GLO A;  1IUF A;  2VKE A;  3HM5 A;  1RKT A;  1ETY A;  3K2A A;  4V2G A;  5IOY A;  1MSE C;  4X6A J;  5F27 A;  2FD5 A;  2VPR A;  2CRG A;  5M5X J;  2LY9 A;  5EEA A;  4BY1 J;  3GTL J;  3M4O J;  2M0C A;  3Q0U A;  3QPS A;  2VI6 A;  1DU0 A;  1IDZ A;  2L7M P;  2RAE A;  1LFU P;  2D5V A;  2JMW A;  4IEJ A;  3GTK J;  3GTG J;  1VI0 A;  2ID3 A;  2OF7 A;  2ID6 A;  3MKL A;  3D1N I;  2Y9Z A;  3A03 A;  1Q1V A;  1IRZ A;  3GTQ J;  1BJZ A;  3H0G J;  1U9N A;  4A3J J;  4MO7 A;  5K7Z A;  3C2B A;  2HI3 A;  2LTP A;  5BNG A;  3BTL A;  2XSD C;  4UUS B;  3SJM A;  1AU7 A;  2EBI A;  4FTH A;  5FLV A;  2E1O A;  4IHX A;  3HOW J;  1ZTR A;  2MGQ A;  3SFI A;  1MH3 A;  1PUF A;  1B8I B;  2L0K A;  5EF6 A;  1ETW A;  1TWG J;  1QVT A;  2FJ1 A;  3BR1 A;  3E7L A;  4L5E A;  2YS9 A;  1Y1V J;  4FE7 A;  1EF4 A;  3K7A J;  1APL C;  2L7F P;  4CYC B;  3L1P A;  2M2E A;  4BBR J;  3S16 J;  4XRS G;  2EZL A;  3ZOB A;  3Q0V A;  3ZQI A;  1IDY A;  2K9S A;  2X48 A;  4RDU A;  5M5Y J;  3ZQG A;  2LVS A;  1Y1W J;  3RKQ A;  3LOC A;  3OIO A;  1HF0 A;  3RZD J;  2O9L A;  2JK3 A;  5EGO A;  2EZI A;  2DA6 A;  2R5Y A;  1CQT A;  1H89 C;  2Y2Z A;  1JKR C;  2JA5 J;  3HOX J;  4C3H J;  1MBF A;  1JT0 A;  1ZR4 A;  5F0F A;  2Y31 A;  1IV6 A;  2ME0 A;  1TWC J;  2EQR A;  1WGX A;  1OJL A;  3JRI A;  1AHD P;  2NS8 A;  4IHW A;  4UUT A;  5FLM J;  2LP0 A;  3B6A A;  3PM1 A;  4LOC A;  4MLO A;  2KDZ A;  1T33 A;  3TW6 A;  1WI3 A;  3RZO J;  1FTZ A;  2K9Q A;  3G1O A;  3JRB A;  1NK3 P;  2HOS A;  3OSG A;  2DA3 A;  2B63 J;  1GDT A;  3M3Y J;  1TWF J;  3S2D J;  3H3V K;  2R5Z B;  2NOG A;  3BG5 A;  3DCF A;  2PMZ N;  4UUS A;  2L7Z A;  4BY7 J;  4XRM A;  2OPT A;  3GTP J;  1I3Q J;  1DU6 A;  1ENH A;  1B8I A;  1B72 B;  3CMY A;  1Z0X A;  5JLW A;  5IYC J;  2NVX J;  2DMU A;  1XG1 A;  2MG4 A;  5E3O A;  1I50 J;  3S1M J;  4M3B A;  1WPK A;  1UMQ A;  1JGG A;  2LKX A;  3IH2 A;  4Y52 J;  3WHC A;  2NVQ J;  5EG0 A;  4CYC A;  5M5W J;  3LSG A;  3O8H A;  2EZH A;  2NVY J;  3JRC A;  1WH7 A;  3RQI A;  3SDG A;  5EZH A;  1U9O A;  4RBO A;  3BTC A;  3A02 A;  4QSH A;  2DA1 A;  1ZGW A;  3FIS A;  3GTJ J;  3ZQL A;  2XPW A;  1H8A C;  3GBG A;  4X1E A;  3BQZ A;  2VKV A;  2MSY A;  3JRD A;  1ETX A;  1GUU A;  1ETQ A;  2WB1 N;  5F08 A;  5M3F J;  4XID A;  1TWA J;  4C3J J;  5C44 J;  3TED A;  2M8G X;  5F0C A;  2JJ7 A;  2P81 A;  1QRY A;  3LNQ A;  2E19 A;  5J1R A;  1RET A;  2Y30 A;  4FE4 A;  5E3N A;  3NAU A;  1LFB A;  3Q0W A;  3HBL A;  4A69 C;  4I6Z A;  5FKK A;  3B6C A;  1MNM C;  3MN2 A;  1TC3 C;  2NS7 A;  3CCY A;  4Y7N J;  1IG7 A;  1UHS A;  3ZQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...