2MGQA

Structure of ceh37 homeodomain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
GPRKNRRERTTYSRQQLEILETLFNETQYPDVFARERVADQIRLQESRIQVWFKNRRAKYRLQEKQKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CEH37 Homeodomain
rcsb
source organism Caenorhabditis elegans
molecule tags Dna binding protein
molecule keywords Homeobox protein ceh-37
total genus 12
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2mgqA00
5IYCJ 1JUSA 4M3DA 1HLVA 1RKTA 2JWTA 2JN6A 3HBLA 1BL0A 3GTQJ 3BR1A 1E3OC 4A3LJ 2CQXA 4FE4A 1MSFC 4LOCA 4IHWA 5IOZA 2NVTJ 5EZGA 2CQQA 2JA8J 2ELKA 2DA2A 3O8GA 2HDDA 1F36A 3GTGJ 2AO9A 2E2JJ 1BA5A 4M3GA 2JA6J 5EGOA 2ME6A 1X2NA 5FLVA 4DZJA 1IC8A 3BQYA 1F43A 4XICA 3DCFA 2TRTA 2FD5A 1APLC 5EGOB 1FIPA 2WB1N 4HNVA 4C3HJ 5DS9A 3JRFA 4XRSG 1W0TA 3A03A 3NAUA 5GPCA 1MBKA 1WI3A 1Z0XA 2VKVA 2Y31A 5M5WJ 1AU7A 3BG9A 2QF7A 1AHDP 2MW8A 3F0CA 2JJ7A 4ABZA 2CUFA 3K7AJ 2LY9A 3H0GJ 2NS7A 2VUMJ 2OF7A 3PO2J 1P7IA 4G12A 1WPKA 1A6IA 1QRYA 3BG5A 3LNQA 4XIDA 3I4NJ 2N8GA 4RDUA 2ECBA 5GPAA 2CU7A 5K7HA 2CRGA 2M0CA 3O8HA 3TW7A 2IAIA 1JT6A 3M4OJ 1IDZA 2MG4A 5FJ8J 2GBYA 3A01A 3BR3A 5EEAA 5FLMJ 1I3QJ 5J1UA 2RAEA 4AC0A 3FKIJ 4D7MA 4J19A 2L0KA 2L7FP 2DA4A 1JTYA 2YU9J 4S0HB 2DMUA 3JRAA 3E7LA 3L1PA 3HOVJ 3BT9A 5E3OA 3HOUJ 3MKLA 1PUFB 3HOYJ 1SFOJ 3S1QJ 4UUSA 1NK2P 3CMYA 1I6HJ 3Q0WA 2HYJA 3SDGA 5K7ZA 1B8IA 5F08A 4V2GA 1FEXA 2R7ZJ 3TP0A 3RKQA 1H8AC 2ZB9A 3BR6A 1HF0A 2E19A 1HCRA 3SFIA 2EZHA 2O7OA 5EDNA 2K40A 2R5YB 3JREA 4B4CA 1DU6A 9ANTA 1Y1VJ 1JKRC 2YUSA 3WHBA 5M3MJ 3LSRA 2FQ4A 3HEFA 1LE8B 1FTZA 3H3VK 3A02A 2HQ5A 3TW6A 5HODA 5E3NA 3RZOJ 3PM1A 1D5YA 4X6AJ 3BR2A 4EEFG 1U78A 1YRNB 2DMQA 3HGYA 4C2MJ 2EZKA 1VFCA 1WCMJ 4A3JJ 3JRHA 5E3MA 1ORKA 4MIMA 3S2HJ 1TWAJ 5F0CA 2CJJA 3NARA 1TC3C 3Q0VA 2FJ1A 1ETYA 2LTPA 2H8RA 1VI0A 1FJLA 2E2IJ 4DYQA 2R5ZB 2M2EA 2AHQA 4NDLA 4RBOA 1JJ6C 2WAQN 4FTHA 1ITYA 2LK2A 3TEDA 2W48A 1JUPA 2DA1A 4FISA 4XRMA 2LP0A 4I76A 1QVTA 4QSHA 3GTJJ 4A93J 2WV1A 4DW6A 2I10A 1X2MA 3BR5A 4D7NA 3K2AA 4B1RA 5FKMA 2DA7A 1AKHB 5IP7J 3GBGA 1TWGJ 4A3KJ 3RZDJ 1YRNA 4JP0A 3OSGA 1EF4A 2EBIA 4MFEA 2NVYJ 4IHYA 3FIWA 1WH5A 1T33A 3ZQGA 1LE8A 5J1RA 1ETWA 5EG0A 4C3IJ 2LD5A 3RQIA 1B72A 1OCTC 3ZQIA 4M3BA 2K9QA 5F0FA 3BTCA 3HM5A 1MBFA 2D5VA 3C2BA 4UUTA 2VKEA 5EZHA 1RETA 2HI3A 3G1OA 5IP9J 4JX5A 1ZQ3P 5F27A 3FK6A 1VNDA 1TWFJ 4BBSJ 1LFBA 1P7JA 4CYCA 1SANA 1U8BA 2PMZN 2Y9ZA 4BY1J 3HKZN 4L5EA 5E3LA 4XRSA 2XPWA 2YS9A 3LSJA 1PUFA 4Y52J 1B72B 1O4XA 2XSDC 1NTCA 1ZTRA 2CUEA 2K9NA 1GUUA 1IUFA 3QQAA 3VPRA 3ZQCA 2VI6A 3S1NJ 2MGQA 1MBJA 2ID6A 2EQRA 3B6CA 4IEJA 5IYDJ 1TWHJ 1UMQA 3W6VA 1IV6A 3JRDA 4DYRA 1BW6A 2TCTA 1FTTA 2L9RA 3IH4A 2JK3A 3HOXJ 3BR0A 1MH3A 2COBA 5EG0B 2LFBA 4JYKA 1IGNA 5K7FA 4A3BJ 3PO3J 3CQZJ 1U9NA 3JRGA 2ME0A 3OSFA 2G0EA 5JLWA 3BTIA 1MBGA 3QPSA 1IJWC 1ENHA 3UKGA 1XS9A 1Z77A 2H1KA 3JRBA 3SJMA 4V2FA 4AUXA 1MSEC 2DN0A 2XB0X 1R9TJ 1JJ8C 2DA3A 3S15J 4M3FA 3ZQHA 1JKOC 3B6AA 2XRLA 5C4XJ 2EZIA 3M3YJ 3CDLA 2R0QC 3LSGA 2EH3A 1GVDA 4B3AA 4BBRJ 5M5XJ 1HDPA 1JGGA 1OFCX 2JMWA 3ZOBA 4A3FJ 4X1EA 3S1MJ 4A3DJ 2X9DA 1LFUP 1DU0A 1POGA 1BW5A 3HOZJ 5C3EJ 1XG1A 1OJLA 5FKLA 1UHSA 2MSYA 3Q3SA 1JKPC 3IH3A 2JA7J 2LR8A 2QCOA 1G2HA 1GDTA 1NK3P 3BQZA 1S7EA 4GFBA 2DJNA 2DTZA 3G1LA 1JTXA 1GT0C 4A3GJ 2EZLA 1GV5A 5EF6A 1Q1VA 5BNGA 2DMNA 2M9HA 2B63J 1FIAA 2JA5J 2E1OA 1IDYA 2O9LA 2R5YA 2DA6A 1I50J 1IRZA 3LOCA 2Y30A 2IEKA 2L7ZA 4BY7J 3D1NI 4A3EJ 1TWCJ 2M8GX 3S17J 3IH2A 3HOWJ 3CCYA 1ZR2A 1ETKA 4I6ZA 1HDDC 5M5YJ 2LKXA 1T56A 4A69C 3S1RJ 1WH7A 1H88C 1QVUA 2FX0A 4IHXA 4FCYA 4AYBN 1JKQC 3GTMJ 2Y9YA 1RR7A 1ETOA 2ID3A 5IOYA 3GTOJ 3OOUA 1ZKGA 3JRCA 2E2HJ 2L7MP 2XPUA 5FKNA 5FKKA 2R92J 4D5FA 3G1MA 1QPIA 2NVXJ 4W97A 4QIWN 3FK7A 1ZK8A 3IV5A 3WHCA 5F04A 1ZGWA 1X58A 4QTRA 1Y1WJ 4MLOA 2HOSA 3DEWA 4MFDA 1JT0A 3BTJA 5J1YA 4CYCB 3BG3A 2KT0A 3BTLA 4A3IJ 5M3FJ 1K61A 1RKWA 3ZQFA 4MO7A 4DZPA 2M34A 3GTKJ 4FE7A 5C44J 3HGGA 2Y2ZA 1ETXA 2DMTA 1OCPA 2R5ZA 4DYCA 2R93J 2GM4A 1IG7A 2NVQJ 4M3EA 3I4MJ 1ETQA 3MVPA 5F0HA 2VPRA 3QPLA 1XC5A 5FKOA 1GV2A 3FISA 2P81A 5EYRA 2Y0SN 3S14J 2HXOA 2ECCA 2OPTA 4JX4A 4XK4A 1MNMC 1U9OA 1JUMA 2DMPA 3JRIA 4D5CA 2NOGA 2X48A 4A3MJ 3Q0UA 1RESA 5F1JA 3HDDA 2HXIA 2K9SA 5GP9A 1ZR4A 4M6VA 3S2DJ 2KDZA 1H89C 3OIOA 5C4JJ 2X6OA 2XB5A 4W1UA 5DTDA 2HOAA 2LLKA 5IPAA 1ETVA 4UUSB 2XPVA 2HOTA 5JLXA 1CQTA 2GLOA 1MBHA 3S16J 3TP3A 5J3LA 3A01B 3MN2A 1UG2A 5IP6A 2O8KA 4JX6A 1A5JA 4BKXA 4IHVA 3JR9A 2XGCA 1HOMA 3ZQLA 2XGEA 2DA5A 1RPWA 1MH4A 2NS8A 3GTLJ 1AKHA 2LVSA 3GTPJ 3LSPA 4BXXJ 4A3CJ 1MBEA 1WGXA 1VF9A 4C3JJ 1BJZA 1K83J 2IBDA 2XGDA 1W0UA 5IYBJ 4Y7NJ 3HB9A 1B8IB
chains in the Genus database with same CATH superfamily
1JUSA 1ZGJA 3A0BC 4Y3OA 2YX4A 3M9AA 3M7GA 2JWTA 1VQ4I 1BL0A 3BR1A 5DUKA 4A3LJ 4CUGA 4DOZA 4L9NA 3B73A 4U0WA 2KIQA 4F55A 3KFWX 1HW2A 1XSVA 1MSFC 2OTJI 1LEBA 2CQQA 2JA8J 2A07F 1K78A 3CUOA 1F36A 4RS8A 4YELA 1VZ0A 3F8BA 2LYCA 4GDFA 2JA6J 2ZKZA 1J7KA 2K7LA 2ME6A 3OOPA 2HFHA 2L4MA 3LAJA 4CH7A 3MKYB 2GXBA 1IC8A 4OIQF 2F48A 3RDIA 1F43A 1R49A 4XICA 2CS3A 5E1ZB 4E7ZA 2EFNA 1I5ZA 2L9NA 4BJ6C 1VQNI 1K7AA 1W5CC 2WY8Q 1IF1A 5DS9A 1V5FA 1W0TA 3NAUA 5GPCA 1P4AA 2QZ8A 1Z0XA 2DO7A 1AU7A 2KIFA 2QQBA 3ZGKA 1XMXA 5B66C 1P9QC 2MABA 1IN5A 3NEUA 4MEYF 4ABZA 2LY9A 2VUMJ 1SFXA 4XOPA 2OF7A 1OCZH 1UZCA 3GF2A 1JE8A 4S04A 1QRYA 3EQLF 3I4NJ 5D5UB 3H9QA 4XLHA 5LD2C 1DGRM 2DYRH 3QOPA 4HQMA 3WTUC 3M4OJ 2W1OA 3VDXA 1IDZA 2LY2A 1A6QA 3CUQA 5FJ8J 3QWLA 4RAGA 2VQHA 2BEOA 5LRRA 2P6TA 5KNLA 3V8LA 3K4NA 2G7HA 3MZYA 4MTEA 4HLYA 5L3EA 3CP2A 2RAEA 1WJBA 2O0YA 5CYVA 3R6SA 4JQFA 4AC0A 2CO5A 4RGXA 2L0KA 5FD6A 3JRAA 1X1CA 2WWYA 4M72A 3BT9A 2F5VA 3MKLA 4M6XA 1PUFB 1UHMA 3CUQB 2LNBA 3K69A 4LG3A 2HYJA 4A0YA 5FFXA 2QSGX 1D0ZA 1B8IA 4KT5C 2V9VA 5F08A 4V2GA 1FEXA 2O03A 1LJ9A 3RKQA 1YW7A 3BR6A 1HF0A 1HCRA 2VKDA 4YIFA 1VQ9I 3E6BA 4ZDOA 1ACIA 4CXFA 4U87A 1WJFA 2CW7A 5DD4A 2ZCWA 3ULQB 9ANTA 4LIUA 1JKRC 4CGZA 2A5WA 2YUSA 4UY8I 4HOBA 3FXJA 3HEFA 4ZH4F 4A0ZA 3L2WA 1LE8B 3H3VK 2HPIA 3TW6A 1F1ZA 1H0MA 2Z2SB 1BIBA 1D5YA 1T39A 3I58A 2PX9A 4HYEA 1IW7F 1IN8A 2XKPA 5H6RA 4CA0A 1RR8C 2R7TA 2IGKA 1R71A 5FLXK 3K1PA 4PJNA 1R5HA 4PSWA 1DDNA 2MC3A 3HUGA 1IRXA 4M9XA 1SAUA 3OYFA 2LTPA 1HQCA 1VI0A 2E2IJ 2LSOA 5E1WA 3QP5A 4LB6B 2QEXI 4NDLA 1U5TC 2WAQN 4FTHA 1IZ1A 2LK2A 2W48A 1U5TB 1V3FA 2H8WA 3HPHA 4O3MA 1G3YA 1S7OA 5DM7F 2VE8A 3VYTB 4XRMA 2EA4A 2HVRA 4HNTA 3DEUA 1QVTA 3VWBA 2L2OA 4A93J 1V4RA 3DXJF 3FHNA 4D7NA 1R58A 3ZXSA 1XGMA 2X0LA 4LG0B 5FKMA 1AKHB 5K5QA 3CCSI 1VQOI 3WGHA 1FZPB 1YRNA 4RB0A 3SDBA 3OSGA 1F4KA 3CLQA 2EBIA 4IHYA 2WADA 4JBAA 3FIWA 3WU1B 4BNCA 3U1DA 3RQ4A 1T33A 4O5VA 2VBYA 2CH0A 2KHMA 4A5NA 2OA4A 3FMRA 3ZQIA 2JVGA 4NC6A 3BTCA 1MBFA 3C2BA 5E18F 2LF8A 1V54H 2DYSH 3BJOA 5EZHA 2XHKA 3NRVA 4L18B 2IPQX 3HRTA 4ENKA 4KISA 5E1XA 3WTTC 1VNDA 1OR7A 2FBHA 4KUMA 4BBSJ 1LFBA 1SANA 3R4KA 1Z7UA 1ZRCA 4P55A 1EKEA 2DK5A 4UXNA 2M3AA 1FOWA 2H6BA 1B72B 4A5MA 1BR1A 4PFOA 1IUFA 3FHZA 2C6YA 3T5XA 1Z3YA 3SEQA 4MTDA 2VT3A 4I02A 4A12A 3WGGA 4LLGF 4LD5A 3I5UA 4ZDLA 3TQNA 1MBJA 4CZZA 1W36D 3BG7A 5CKTA 5IYDJ 1IV6A 3AL0C 4RA2A 2BHZA 2JUGA 3P5JA 5CPRB 2JK3A 2JTVA 2VC1A 3BR0A 2BHYA 4FT8A 2LKPA 3HJEA 1RZ4A 2MH9A 4UUVA 3U9GA 2LFBA 1WZ2A 5K7FA 1VQ7I 3CQZJ 3CC7I 1YW8A 1ZAOA 1DUXC 4BDZA 2GZWA 3H5AA 2Z33A 4C2UA 4HF0A 1ENHA 3V8KA 2MLGA 4RGUA 2HTJA 4N0BA 1SFKA 3GZ5A 1MSEC 4Q5SF 4KNYA 2RDPA 1O7LA 5J6XA 2ZJPF 3O3KA 4IRIA 4K2EA 2OQRA 3HTUA 4IHSA 3KPHA 5IT9Z 3TOAA 3ZQHA 1JKOC 1O3RA 5C4XJ 2EZIA 2WA0A 3WG9A 1RC9A 2X85A 4LLNA 1L0OC 3LSGA 2EH3A 1QPMA 2BW3A 3ABTA 3MZ8A 4X1EA 2E7XA 2EJRA 4PJLA 3ZMDA 2KRCA 1BR2A 1WVRA 1FNNA 5ILSA 3HHGA 4A6EA 4Y33A 1YTYA 2A68F 4YRVA 4P9UA 2Z3YA 2MSYA 1RUNA 2EIKH 4LB5A 3IAS2 4F7ZA 2KJCA 3HRMA 1JKPC 3Q5FA 2AQFA 3L00A 4OU0A 1D8JA 3OYEA 1G2HA 1TNSA 1G3WA 4KICA 2QGUA 4GFBA 4O6JA 3LA3A 2R7RA 2A6EF 3L2VA 2CV2A 3GUDA 1JTXA 4H0EA 1B4AA 3ML6A 4PFPA 1BI0A 2X6XA 5D5WB 3HOTA 5K5OA 1FIAA 5B1BH 2JA5J 2HEOA 2V7FA 1IDYA 1B9MA 5CVVA 3TBIA 4LITA 4I0BA 2NYXA 2ESHA 2HKOA 2VQCA 3JAMZ 3ZP5A 4L0YB 1TWCJ 2OUMA 2M8GX 2OTLI 3REOA 3K0LA 1ZR2A 2Y69H 1JI8A 5M5YJ 2VIXA 4A69C 3EUHA 1UG0A 3S1RJ 2WB1A 1MMSA 2Q2EB 1H88C 1QVUA 4IHXA 1I3AA 1HKTA 2M30A 4FCYA 1R5ID 1LB2A 2Y9YA 1RR7A 1ETOA 1SVLA 2R7DA 3A0HC 3A4CA 1P92A 5IOYA 1T98A 4CDGA 1ZKGA 1D3YA 3CCUI 2O3FA 5D8KB 3U2RA 1QPIA 2QQAA 2EFOA 2V1NA 4HDVA 2DDAA 3WHCA 1O3QA 3BCBA 1X58A 4YIRX 4MLOA 2NAZA 5HDGA 4ZJZA 1DP3A 4AYBA 3WTYC 3DEWA 2AQEA 3FKJA 3DF8A 1JT0A 1J0RA 3QYBA 5J1YA 2V6EA 4BL0B 4CYCB 5FRNA 4XL9A 1EA3A 2DLLA 1HBXG 2CW8A 4RM3A 3ERMA 4C30A 1HSJA 4WXHA 2WV0A 3F22A 1SMYF 3BLYA 4DZPA 4RAYA 1RIOH 4PJMA 1OCRH 3HGGA 3LSTA 2DMTA 2NRAC 1EH6A 4XKWA 2QM3A 3TOBA 3FBIB 3E6DA 2XSJC 4II2A 3ZQQA 1F9NA 2FF4A 2DFEA 1XMKA 2L5QA 5F0HA 4E7HA 3H36A 3FISA 1QBJA 3WODF 4JX4A 4NC8A 3U1KA 1R6RA 1BA5A 4AU7A 2WAQA 4D5CA 2X48A 2DFFA 4A3MJ 5D4RA 3HDDA 3FXQA 3G6EI 4IRGA 5HLHA 3E1SA 3MAJA 2M87A 4BE0A 1HSTA 2HZTA 5HVQC 1ZRFA 2LLKA 1IN7A 2ISZA 4HW0A 2M0MA 5AIQA 1OKRA 1OCOH 2H6CA 4PSXA 5JLXA 4ESJA 3ECHA 2HOTA 1I27A 1R7JA 1CQTA 4HLXA 2X6YA 3LSIA 4BUPA 3AAFA 1TP4A 3BPXA 2HOEA 1Y56A 2F5CA 1KZHA 1JXSA 5J3LA 5K1YA 3FMSA 3MN2A 3K1MA 4IQJA 5IP6A 2BOLA 4FX4A 1A5JA 2A3SA 2M5WA 4BHCA 3K4CA 1K4TA 2UXXA 4BKXA 4IHVA 2XUBA 1YIJI 4NC7A 3KYDB 2A69F 1V5GA 2RNJA 1PDNC 2OD5A 4FETA 1HOMA 3OYBA 2ELJA 3ZQLA 2M7BA 3H5NA 4GXOA 3TDZC 2QBYB 4ANJA 4RMNA 1FLIA 2NS8A 4IHTA 3EDPA 3ONQA 3RPQA 3LSPA 4IOCF 3BDDA 3IKTA 1MBEA 3GLLA 4KMUX 2L3DA 2XGDA 2IBDA 3F72A 4Y7NJ 3HB9A 4HA8A 4IVNA 1B8IB 2E1CA 2PI0A 5IYCJ 3GZ6A 4M3DA 1HLVA 2KISA 2IRFG 3OYHA 3GZNB 1RKTA 2JN6A 3HBLA 4CO8A 1KA8A 4YG2F 2E1MB 4KJZA 2Q0OA 3VODA 2L01A 5E8IA 1FT9A 1WRJA 2CUJA 1SMTA 5EZGA 2LOOA 2E35A 2V6CA 4HSTA 4M9ZA 3ZCOA 2F5EA 2KJBA 2QVOA 3M8FA 2UZKA 2HQNA 4BDYA 2HDDA 1HW1A 4ITVA 4EJOA 3GTGJ 4GCVA 4EMSA 3OV8A 3K70C 1X2NA 4E7KA 2XF7A 1R1VA 3TGNA 3CP8A 1YYVA 2CWEA 2RC4A 2E60A 1LEAA 2ZJ2A 4I09A 4DZJA 2MFZA 3WTVC 3WTWC 3JSOA 4LLLA 1LPQA 3E97A 2FD5A 1APLC 2DW4A 5EGOB 2D45A 2WB1N 5LFAA 3CMAI 2IP2A 2O6GE 3KIOA 4R8HA 3JRFA 3A03A 5TISC 2VASA 5IY5H 1WI3A 3PNTA 2GXAA 4KIBA 4HX8A 2LC2A 3VYUB 5BQTA 3F0CA 3MCZA 2MD5A 1KU9A 3PO2J 3H0GJ 1Z91A 4DGWB 1P7IA 3CJNA 4G12A 3FXUA 4WWCA 3LNQA 1ZELA 3H35A 1N75A 5FROA 1HW5A 2P5KA 3HSFA 1XDSA 2UXNA 3CO6C 2M0CA 1IAWA 2W25A 3GMEA 3QPTA 3PNYA 3QU3A 3I64A 5A2QZ 3C7JA 2HZDA 3OIQA 1Q1HA 3DPUA 2GBYA 3GLXA 3A01A 3S2WA 3SFZA 3B02A 5LHGA 1YJWI 2JRMA 3KP7A 4PJJA 3IC7A 3VSKA 4ZZDA 3DTEA 1SVOA 1PJRA 3QOEA 2V1DA 2XROA 3LSKA 4J19A 1KU7A 1JTYA 5DDGA 3GCMA 4S0HB 2DMUA 3HOUJ 5IT9K 3KEOA 3RI4A 4AWXB 1MDMA 1NK2P 2EV5A 3CMYA 4IKFA 1I6HJ 1X1BA 2W84A 3Q0WA 2D1VA 3SDGA 3O2PE 4P1WA 4F52A 5K7ZA 2ZXJA 3CCVI 2R7ZJ 4EJTA 5LBQA 2ZB9A 2YU3A 3V8JA 2EILH 3H9GA 3JREA 2F6CA 3DU6A 2UUZA 3MKZA 1DU6A 4LMYA 5HLIA 5IT3A 2VOOA 2VKHA 4B43A 3A02A 2HQ5A 5E3NA 1ERDA 4P5OA 1K6YA 4ZYEA 2F5DA 3BR2A 4EEFG 2GOMA 4G8XA 1FWZA 3FDYA 5CQGA 3BY6A 4ZC3A 3HG9A 4KN4X 2V9KA 2M8EA 2XF6A 1Z7LA 1BN5A 1ORKA 1G59A 4B8XA 4MIMA 3CLOA 1JHFA 3D5SC 3F8CA 5LGUA 3TL4X 2IS4A 1KYWA 3CMEI 1ON2A 1R5GA 2GWRA 3TO7A 4A2UA 4EGYA 3IP4B 1XGSA 2M2EA 4RBOA 1JJ6C 1ITYA 2R7OA 3TEDA 3MKWB 2P7VB 4BH9A 2OAZA 2DA1A 4FISA 3CF2A 2LP0A 1XCBA 4QSHA 1KONA 2HNHA 3BCAA 1SEUA 4KA4A 1X2MA 1XDUA 4XOTA 5H20A 4B1RA 1YITI 1YS7A 1YOVB 2LH9A 3OYGA 2QKLB 3GBGA 3GWZA 4E70A 3LMMA 1R1UA 3OYJA 4OWRB 1Z21A 2KZGA 2WBMA 1BJAA 2IVMA 1LKXA 3RIRA 5J1RA 4RAFA 5EG0A 3SZTA 1BC8C 2F5FA 1P2FA 2ELHA 2VODA 1OCTC 2CV0A 3OL3A 5F0FA 2D5VA 1Y0NA 3GFMA 2K9LA 2ZO4A 2YSRA 5GAHJ 1R00A 1FBQA 1MNDA 1X3ZB 5FGMA 4JK1X 3KLOA 1XGOA 4CZCA 3QAHA 5DEQA 3V7CA 4BJ5C 3HC7A 3FK6A 1TWFJ 4BEHB 3F9KA 2DI3A 2Y75A 3H0DA 1U8BA 4BY1J 1OYYA 4IRHA 4L5EA 3I4PA 5E3LA 4XRSA 2KQRA 4G7OF 3I0TA 3IUOA 3KX2A 1FSHA 1YE9A 3EUKL 3ZMSA 1NTCA 2K27A 4WXDA 2VONA 3HRSA 3AKZA 4LJZF 2A61A 3S1NJ 2MGQA 1OR7C 4UB8C 1WI9A 2EQRA 3B6CA 4LK1F 4G6QA 5KVRA 1Z6RA 3KE2A 2JRTA 3PUFA 4DYRA 1BW6A 2ISYA 2GAUA 3IH4A 1ZARA 2XGXA 2Z1DA 3PSIA 3TDUC 4D1QA 3HOXJ 1MH3A 2COBA 5EG0B 1FYLA 2EA2A 3GW2A 3MD2A 4JYKA 3F8FA 4A3BJ 1U6GA 4HNUA 2VBXA 2D2WA 3G73A 3JRGA 1XSDA 1V5EA 3ECOA 1HKQA 1ZREA 3BTIA 4GRIA 1IJWC 4EVIA 3UKGA 2DPDA 5H2FC 1XS9A 3I71A 4V2FA 4AUXA 2VC0A 1T0FA 2DN0A 2VJ4A 2E5ZA 3OR2C 1T2KA 5FFZA 1MKMA 2VXDA 1R9TJ 1GXPA 3TO9A 1J09A 1KYZA 4M3FA 2WC2A 4PDKA 3LA2A 2XRLA 2V1XA 4BQQA 2VJJA 3BWGA 3I56I 3M3YJ 5HNFA 1YJ9I 2GXGA 3CDLA 2R0QC 1QZEA 4UVAA 3L2UA 1DQUA 1HDPA 1KU2A 2BW3B 3R0JA 2JMWA 1JGGA 2BGCA 1LFUP 2XASA 4UNOA 1NHAA 2A05A 1POGA 3F6OA 1U5TA 1BW5A 4E7SA 1O57A 2LRDA 1XG1A 1AOYA 1UHSA 3K10A 2IS2A 1S72I 1U8RA 3F3XA 3ABUA 4HRIA 3Q3SA 2A5YB 1YJNI 4CCOA 1PVEA 3DTKA 3GEZA 1X4PA 3H1CA 3I54A 5DCFA 5ILUA 4G6TB 2FBKA 3LWFA 3CF5F 2DCEA 1S7EA 2VBWA 3C2GA 3KYCB 3OYMA 3KEQA 2FOWA 2DJNA 3GX4X 3ZMUA 4A3GJ 2EZLA 3QODA 4AIHA 1MZBA 2W57A 5BNGA 1W7PB 4DIQA 4KITB 3K70D 2E1OA 5B5EC 1T0FC 2DA6A 2CFXA 1I50J 2DQLA 3HSEA 3LOCA 3RKYA 3TKYA 3E5XA 3C18A 3D1NI 4A3EJ 1G3SA 2XAGA 4ZYHA 1T08B 3S17J 4FQGA 3LAPA 3IH2A 1OYIA 1EH8A 3HOWJ 4XMYA 1HDDC 4I6ZA 4AIDA 1OQYA 1GXQA 2FOKA 1WH7A 4EGZA 3CJTB 2FX0A 1RI7A 1VQ8I 2EFQA 1W5TA 1J9IA 3HOSA 2Y0MA 4BJTA 4D9JA 3S93A 3EYIA 3GTOJ 3VB2A 5FD5A 4L0ZB 2R4GA 3JRCA 1G3TA 1C0WA 1QQIA 5FKKA 4Y13A 1ZGAA 4WCGA 1QNTA 5J4YA 2NVXJ 4QIWN 1YIOA 2WAFA 4HPQA 4G9YA 1R36A 3T0YA 1IRGA 2DT5A 1FX7A 2DFHA 4M74A 1Y1WJ 1Y8RB 2NVUB 3A1YA 3ZMTA 3VEPA 1SVMA 4YFXF 4WK8F 4AM3A 2P0WA 2CQNA 1XMAA 2E5NA 5A2QK 3OR1C 2XAJA 4B09A 4XLCA 1A36A 4A3IJ 5BS6A 4QPQA 1E17A 2XAFA 4XM3A 5CLSA 2VL8A 1ZN2A 3GTKJ 3RCOA 4FE7A 2LF7A 2XAHA 2Y2ZA 3GFLA 4DBQA 2LBFA 3SQNA 3L2QA 1OCPA 3P9CA 3EPZA 3UR3C 1IG7A 2JQ7A 5ED4A 1J75A 1EH7A 2RREA 4G94A 2E1MC 2JSPA 4CSWA 3PFIA 1Z67A 5CQEA 5DCMB 4HF1A 5L3BA 4AIJA 5J40A 1SD5A 1XC5A 1SFUA 1LUJB 2XDVA 1XN7A 2I8DA 3O6BB 4B3XA 1O3SA 3W2AA 2Y0SN 3C2HA 3ABMH 2OPTA 2EINH 4XK4A 5ICGA 3G3ZA 2DMPA 4DNCA 1XTAA 3JRIA 2AXTC 5L3CA 5HNHA 1X4OA 4OMYA 2XC7A 4D0PA 1QU3A 2HXIA 5GP9A 2KDOA 3Q9SA 4L5IA 3S2DJ 5HDKA 2BE5F 2XVCA 2KDZA 1H89C 1DPUA 2DAOA 2X6OA 4KDPA 2DPUA 1SFEA 3HKZA 4E7JA 1T6SA 1ZLJA 2GOXB 2HOAA 3DBLB 4PUSA 4UB6C 3BZCA 1ETVA 5LHIA 2PJRB 5CJ9A 4UUSB 1YG2A 2XPVA 2DT7B 4HV5A 1IV8A 3S16J 2Q2EA 4NQWA 3SZPA 3TP3A 3F23A 2HVSA 5D6EA 2BZTA 1QZYA 2NOJB 2O8KA 3A2KA 4B48A 3MEXA 1S9HA 2V26A 2VQGA 2YR2A 3I3LA 1BI1A 3RTRA 3DLLF 2XGEA 3T8TA 1TW2A 1XD7A 3IRQA 2DA5A 1MH4A 4MQ9F 1T8IA 4H4KC 4U7BA 2QA4I 2LVSA 2H09A 1WGXA 1VF9A 2E36A 1BJZA 4UV9A 1EV7A 2CQ7A 4WXCA 4UVCA 2RQPA 2HDWA 1U0JA 2Z99A 3DQVC 3GTQJ 4L9JA 2DXIA 1E3OC 4BXFA 5GTIC 4RLQA 1UCRA 2X51A 3K2ZA 4LOCA 4IHWA 4XSXF 1U3EM 1JHHA 2NVTJ 4ASNA 2NNYA 4BACA 2AXLA 2ELKA 2DA2A 2L02A 4UHTA 4XLNF 4HV6A 5TJJA 4XLEA 2E2JJ 3ZMVA 1X3UA 2OZ6A 1B1BA 5EGOA 2CW0F 4C2TA 4GGGA 2YPRA 2HTSA 5E20A 3DKXA 1R4MB 1KU3A 1OCCH 1BOAA 2TRTA 3DCFA 3CD6I 5KAIC 1FIPA 4XLFA 2I5UA 2H27A 2DJIA 4P96A 2JUCA 4C3HJ 4XRSG 2HQRA 2DOFA 1QGPA 4U7DA 5M5WJ 3BG9A 4U0YA 1J5YA 2M7AA 4HAMA 1QHHD 2EV0A 2J5PA 4Z6YA 1W36C 2R7SA 2JJ7A 3ZPLA 1LVKA 2NS7A 4EV0A 3NQOA 2D1HA 4ETSA 4G7ZF 3CJQB 1A6IA 1WPKA 3DU5A 4EM0B 2ZNYA 3FXKA 2IA0A 2DK8A 2HR3A 1HC8A 4RAZA 4BGDA 2OBPA 4XIDA 1K78B 5LGTA 3F6VA 5GPAA 5LEJA 2JPBA 4I98B 3DEEA 2VLAA 1PP7U 3HXLA 2CRGA 3LFKA 3TW7A 5K7HA 2IAIA 1JT6A 2HYFA 2RVCA 3QYFA 5J47A 3FMQA 1BR4A 2JPCA 3KP4A 3G2BA 5BMZA 2LBFB 2AS5F 3GVAA 5EEAA 1FP1D 2O5RA 5J1UA 3RPUD 4KMFA 4D7MA 2L7FP 2W85A 5E17F 2YU9J 4RM2A 3E7LA 3HOVJ 5E3OA 1YX3A 1NG7A 3CTAA 2RV8A 1SFOJ 3S1QJ 4UUSA 3FZVA 1R1TA 2OU2A 2P6SA 1TW3A 1X3WB 2JA2A 1LFPA 3M1CA 3EETA 2VB6A 3G71I 3AG1H 3N4MA 4AVPA 2A6TA 1E2XA 1XSXA 3CJRB 3H9JA 3RPUA 1X1PA 2EZHA 2K5CA 3R61A 2GQQA 2K40A 5EDNA 3GFIA 2E7WA 2FQ3A 2B0LA 2EIJH 2ZMEC 2W82A 4B4CA 1Y1VJ 1IXRC 3MWMA 2IA2A 2P4WA 1E3PA 3LSRA 2A6HF 3QYEA 4PK4A 1ZRDA 3BPVA 5HODA 3CCMI 3CZ6A 3RZOJ 2R7UA 2STTA 2BYVE 1D1CA 2STWA 3KP6A 1ON1A 1U78A 3HGYA 3HTSB 1FPQA 1N77A 1WCMJ 4A3JJ 3L9FA 4LIVA 1WFXA 2P7CB 4ZYDA 1TWAJ 2CJJA 5LEKA 4ZTFA 2IGMA 3SYTA 1TC3C 2FJ1A 3GYHX 2QWWA 2VXZA 1ETYA 4CICA 2R7XA 1RRJA 4Q48A 5ICCA 3NWSA 1FJLA 4CHUA 3K4LA 1OLTA 4A0XA 5B1AH 2OJED 2ZMEA 2PJRA 2K3PA 2O61A 4N4OB 2IS6A 3H3UA 1JUPA 2X6WA 1XPXA 1S7AA 3I59A 2FBIA 2L4AA 1WJDA 1W7PD 5GAEJ 4BHPA 3DTIA 1H9TA 4RB3C 3ZN1A 3ELKA 4DW6A 2I10A 2MD0A 3DBHB 3PNVA 2ZJQF 1K6OA 2VT2A 3SEZA 3VFZA 2DA7A 5IP7J 1CGPA 1LDKB 2FE3A 2XRNA 1TWGJ 5HS8A 5JHFA 3EYYA 4A3KJ 4GYGA 3S3MA 3RKXA 2QQ8A 1QZZA 1SC7A 1MJAA 2NVYJ 1TQIA 2KKOA 3PIPF 3COAC 3WE3A 3E3VA 3R60A 3ZQGA 4KN7X 4C3IJ 3M8JA 1Y39A 3FX3A 3HM5A 3V4GA 3KZZA 2FUG2 2IGNA 1G6NA 2HQAA 2QSFX 2VKEA 3OL4A 5GADJ 1TQMA 4EATA 5E8GA 1RETA 2HI3A 4II3A 3G1OA 5IP9J 1ZQ3P 4HBLA 1YW9A 2YX7A 1BOBA 1E3HA 2Y9ZA 1S5LC 2O8XA 3HKZN 4PJ0C 4XNFA 2Q8KA 4NBQA 2YS9A 3LSJA 3WG7H 4R79A 4Y52J 4RB2C 2CUEA 2FSWA 2CYYA 2K9NA 1GUUA 4BYYA 3BROA 3QQAA 3ZQCA 3N05A 2CSOA 4CCMA 2PQ8A 2DQRA 1KQ9A 4M71A 1YQAA 1UMQA 3C1DA 3JRDA 1P6RA 4OINF 3BG6A 5EEHA 5H6QA 1FTTA 3JAMK 1ZLKA 3PSFA 2M1BA 4EM2A 1IGNA 4IO9F 3M07A 3J81K 3OYNA 2HPMA 3OSFA 5E79C 3VYRB 2G0EA 3DV8A 5JLWA 1MBGA 3QPSA 4ZYGA 5GAGJ 2JZYA 3QU6A 3CO7C 1VQ6I 1E0EA 3VYSB 4RB1A 4I7HA 2Z16A 3B6AA 3KEYA 3RYRA 1MJBA 2EIMH 2BXYA 4RGRA 4NB5A 2KFDA 1GVDA 4B3AA 4KT6A 3OYDA 1ODDA 1VTNC 3K9TA 4A3FJ 6PAXA 2OZUA 2X9DA 4BQNA 2P5LC 1DU0A 4BS9A 4L9TA 5FB2A 3HOZJ 1BI3A 2HKXA 5C3EJ 1OJLA 1LVAA 3IAM2 3CCEI 2BVMA 4E4HA 4OIOF 4U0VA 1USSA 3S3OA 2MLKA 2LR8A 3K4BA 1TLHB 2VQLA 1V55H 2F4IA 3K4MA 4WF2A 1GDTA 4ESFA 4HZFA 3PFYA 2Y48A 5KCMA 3KZYA 2DTZA 1GT0C 1MD0A 3J7ZI 1GV5A 1Q1VA 3PUBA 2DMNA 3TO6A 2M9HA 2HWVA 2FA5A 4ZZLA 5J4VA 3RKWA 2RNGA 2O9LA 3JTGA 4HSRA 3ERED 3V7RA 1IRZA 4YFKF 2WTEA 2XAUA 2PEXA 1YHQI 2Y30A 4E6KG 2IEKA 2KP6A 2K4JA 5CVIA 3OS0A 2H94A 5BPDA 2G9WA 1TQPA 2KL4A 1D0XA 1FC3A 1MMNA 1G4DA 3AG2H 3OS2A 5BOXA 2LKXA 1T56A 1DPRA 1BIAA 3AFHA 5KHDA 4AYBN 3BZKA 3ABKH 2DTRA 2ID3A 4XN3A 2FNAA 3V42A 1SD4A 2XPUA 2QUFA 4OOIA 2R92J 3KYLA 2P5VA 4E7LA 4KIGA 3G1MA 4L5JA 4G7HF 3FXOA 4XBFA 3FK7A 2K4BA 3IV5A 1S29A 3BJ6A 1ZGWA 2B9SA 2HOSA 3JTHA 3L7WA 2ZSHB 4P9FA 4Q47A 4J01A 3T1BA 2IJLA 3ZRGA 2KZVA 5DD8A 2W7NA 4MFDA 3RSNA 3BTJA 1XX5A 2DU9A 4IPAA 2BY1A 4BEHA 5ICFA 3BG3A 1I6XA 2KT0A 1DP7P 5AIPA 3J81Z 2NS0A 4B47A 3KP3A 1OMIA 2QKMB 2VJ5A 2EB7A 4X0GA 3S3NA 1KQ8A 1TL8A 4S05A 2VE9A 2M34A 1MMAA 5B3SH 3DLAA 5C44J 1ETXA 4MNUA 3OS1A 2RKHA 3OWTA 5BPIA 1X1DA 5FRMA 1QHGA 2R93J 3KP5A 2V79A 3RYPA 1X1AA 2OQGA 1TZLA 4M3EA 5F6FA 4M73A 2E71A 1ETQA 3HYIA 3HUGB 4MHGA 2K3FA 3KP2A 5LLQA 1FMVA 4B44A 4EJVA 5FKOA 1GV2A 2W4SA 4IZZA 2H1LA 2P81A 2VOPA 2OCEA 1T38A 2HXOA 2ECCA 2P8TA 2V9PA 1U9OA 3PIOF 5HS7A 2E1NA 1JUMA 2XIGA 3J7AY 2NOGA 5CVUA 2EV6A 5F1JA 1K4SA 2PG4A 2K9SA 1ZR4A 4R1HA 3OIOA 3WU0A 2CGPA 5FLXZ 3WU2C 2PMZA 4YEJA 2QBYA 2Z9OA 4Y15A 1A35A 4W1UA 4BE1A 5DTDA 5DYMA 1K79A 4OIPF 2MA3A 4EQQA 5IPAA 3MFKA 2BY0A 3N97A 4E7IA 2IA1A 1LDJA 1PYVA 3J80Z 1F5TA 2FMLA 4ZYAA 1Z9CA 2KIUA 3E6MA 2FXAA 1SD6A 4XLPF 4ZDPA 4FASD 1IXSB 2L54A 1T95A 4FHTA 4XN0A 1UB9A 1UG2A 4M6YA 4UVBA 4JX6A 5TGTA 3R0AA 4DJAA 3VSLA 3JR9A 1P4WA 2IGOA 4XKCA 4ZTJA 1SAXA 2QSHX 1WSUA 4U88A 4UV8A 1RPWA 4ESBA 1W4MA 1R4NB 3GTLJ 1I1SA 1Z6TA 4NNJA 2ZNZA 5ERIA 4A3CJ 4PCQA 4C3JJ 4BHBA 1K83J 5IYBJ 4L9VA 1WJ5A 4NQWB 3L2CA 2RN7A 4Q4ZF 3MQ0A 3EUAA 3I53A 2R7VA 2CQXA 3D5RC 4YIIA 4FE4A 3HPGA 1FOYA 5IOZA 4MGRA 2WAEA 3O8GA 2KPMA 2FMYA 3OMYA 2EFWA 1Y0UA 2AO9A 5CVJA 4OIRF 4M3GA 2CQKA 4A6DA 4XKVA 1ULYA 2ZFWA 3HSRA 3KETA 3BP8A 4HX7A 5FLVA 2COMA 3UNGC 1D8KA 4PZJA 3BQYA 1YI2I 3CC4I 2ADUA 2KRFA 1GVJA 3CCJI 3CCQI 1LQ1A 1TNTA 1D0YA 2DOAA 2V1UA 5HLTA 1GLNA 1CF7B 5DCMA 4HNVA 4IOAF 2GIZA 4BAYA 2R3SA 2ICWG 2PFBA 4KIFA 1CF7A 1MBKA 5D4SA 2VKVA 2Y31A 3BJAA 1IO2A 4CCNA 4BE2A 2QF7A 2KMUA 1AHDP 2MW8A 1A04A 2CUFA 2ZMEB 3K7AJ 5TRDA 4QWQA 2EK5A 4I0AA 3DKYA 2DT6A 4Z2YA 3BG5A 3IHUA 2N8GA 3DPLC 4OAYA 4DBRA 2ECBA 2CFOA 4RDUA 1MW7A 2BBYA 2CU7A 3DFGA 2VN2A 3SZGA 3WGIA 1O7FA 4ENMA 3O8HA 5GTHC 5HOOA 1VQPI 4F93B 2MG4A 3P7NA 1RUOA 2ZSIB 3KLNA 2EWNA 2BXZA 4YFNF 3WTZA 5LHHA 3FM3A 3FM5A 3ZN0A 3I55I 3BR3A 2CG4A 3W2VA 2LDUA 1M1EB 5FLMJ 1I3QJ 1XCVA 5AONA 4IQ4A 2HYGD 1TTYA 1WJEA 3FKIJ 4XSZF 1STZA 2DA4A 2JSCA 2FRHA 2XKOA 3L1PA 1MGTA 3GXOA 3PQKA 3HOYJ 5J8FA 2ZC2A 1HA8A 1ZG3A 1OISA 5CVRA 3WTXC 4QLCU 1I39A 2ETHA 4PGGA 2PJPA 3EUHC 1I1GA 2XF5A 2RQQA 1FYKA 2RGVA 2UV1A 1J59A 3TP0A 1H8AC 1MMDA 5ILVA 4EJUA 2E19A 1FOXA 3SFIA 2O7OA 3DWLE 3ZQ7A 2R5YB 3FWEA 3E5UA 2OC6A 4BQAA 2KIMA 3E5QA 1IN4A 3WHBA 4HEA2 5M3MJ 1FTZA 2FQ4A 3F8MA 3SXYA 3DKWA 4V19K 3CUQC 2FU4A 2MBFA 3PM1A 1MDMB 1REPC 2VBZA 5HLGA 4X6AJ 2X1DA 1YRNB 1UAAA 2PLYA 1IXCA 3AL0B 2R7QA 4IJAA 1FYMA 2DMQA 4C2MJ 2BY3A 2EZKA 1VFCA 5LRSA 1WJAA 5E3MA 3JRHA 1VQLI 1BBYA 3S2HJ 5F0CA 2K85A 2ZXWH 4CCLA 2ACJA 2HDCA 3PQJA 3NARA 3Q0VA 4G6DA 1USTA 1N78A 2H8RA 5DUIA 2R7WA 4DYQA 1KQ0A 1MIJA 2R5ZB 1VQMI 4N9IA 3OYKA 2AHQA 4CCKA 2ZJRF 3HZJA 1LNWA 5JVGF 1ZH5A 4ENNA 1ZYRF 4NUBA 4JOMA 2OCCH 2X1CA 4I76A 3GTJJ 1H9GA 2WV1A 4Y4RA 4GO1A 3IKVA 3K1NA 3HL2A 3BR5A 3K2AA 1Z05A 2HU9A 4RLFA 1TBXA 1YX5A 2B7EA 3OIPA 1OPCA 2PBIA 4AVZA 3IWFA 1VQKI 3RZDJ 2X1EA 4XKBA 2JT1A 4JP0A 3DP7A 1L3LA 1EF4A 4MFEA 4LFUA 3I9V2 3E0JB 4ON0A 1O3TA 2DBBA 3CMMA 4IXAA 1WH5A 1P4XA 5JR3A 1Y6IA 2QLZA 1WJCA 1LE8A 1ETWA 3KZIC 2LD5A 3RQIA 4GYIA 2MH2A 1B72A 3KCCA 4M3BA 2K9QA 2EPFA 3HHHA 5KAFC 1ZG5A 1XB4A 5L3GA 2EFPA 2GA1A 2F2EA 4UUTA 1B59A 1UHWA 3L2RA 1IUYA 2Q1ZB 2IS1A 3FXMA 2K9MA 1D1AA 3X2QH 4XR6A 3LL7A 1WHUA 3QPHA 4JX5A 2DOEA 1ZG1A 5F27A 3D0SA 3S8PA 3ZMZA 3AG4H 1P7JA 4CYCA 3HRUA 2PMZN 5KK1A 4EM1A 1B9NA 1R23A 4HDUA 2XPWA 3SHFA 4EJWA 2R7FA 3FXLA 1PUFA 5JFRA 3OY9A 3P9IA 1O4XA 2XSDC 3ABLH 1ZTRA 5F64A 1SD7A 1JGSA 3VPRA 3ASNH 2VI6A 4XORA 2PMHA 3JSPA 2ID6A 5EJCA 1R22A 2G7UA 1FBUA 4HG2A 1J2XA 1MJ9A 1TWHJ 1YS6A 2V4JC 4IEJA 3W6VA 4MEXF 2BVLA 2BY2A 3CC2I 3G4SI 2TCTA 1BC7C 3H3ZA 2L9RA 2LMDA 3K4KA 2JVHA 2IW5A 1GHCA 3PO3J 1AWCA 4IX7A 1U9NA 1QA6A 4DQ2A 2ME0A 5D8LB 3H92A 3J7AO 3OYLA 1S6LA 3Q9VA 1EJ9A 1Z77A 1BI2A 2H1KA 3JRBA 3SJMA 4PGHA 3MMYB 2DFIA 1W7PA 4C9YA 2XB0X 2L9VA 3U21A 2LKSA 1JJ8C 5JHUA 2DA3A 3S15J 4CYDA 5FO5A 2ZXIA 4CCJA 3H5RA 2J5OA 5HS9A 2NXNB 1Y8QB 3M1EA 4HQEA 5M5XJ 4BBRJ 5L3FA 3S1MJ 1OFCX 3ZOBA 3MZHA 5HDNA 4A3DJ 1MNEA 2F4OB 3OYCA 4ENJA 1D1BA 3S32A 5D5XB 4M9SA 5FKLA 3GO5A 5EEGA 3TMOA 3D5LA 2XAQA 2FEZA 3K6GA 3QP6A 4XLAA 3IH3A 2JA7J 4LG0A 2QCOA 4IL6C 2E34A 3FBNB 1Z3XA 1UJ8A 2HVQA 2W00A 1NK3P 3LQRA 1KGSA 3BQZA 3LA7A 5ICEA 5F1RA 1A31A 1D5VA 1UFMA 3F8NA 3W6KB 1Z1DA 3G1LA 3LSMA 1VQ5I 1FSEA 3CCLI 3AG3H 2ZBKA 1ONVA 3P9KA 1HKSA 5EF6A 4I99C 2MYSA 2B63J 2DDBA 2R5YA 3WTSC 5JI6A 3LFUA 2IT0A 4QPOA 1PP8F 2L7ZA 1NG6A 4BY7J 3CESA 1XGNA 1TT5B 2PN6A 2LY1A 3BC8A 3OYAA 2CMPA 1FMWA 2CUZA 3CCYA 1ETKA 2WY7Q 5LGNA 2VPLA 3ESWB 2BV6A 1QO0D 2IXSA 2Z5UA 4AD9A 2F4MB 1AA7A 1JKQC 1NH3A 3IWZA 1IRFA 5D6FA 3QRFF 3GTMJ 1FOKA 4F92B 3K4JA 4J00A 3IL2A 3OOUA 4OAZA 2E2HJ 2L7MP 5FKNA 4D5FA 2DODA 2QENA 3W3CA 2NNNA 4W97A 3E6CC 1ZK8A 2K02A 5F04A 1DGWY 3ASOH 3J7YJ 4QTRA 2L7KA 3T8RA 3HIFA 1YLFA 3M8EA 2GA2A 4N4NB 4N9HA 1S8NA 2CV1A 3FXRA 2VJIA 1U2WA 3W2WA 2X4HA 3WE2A 1FP2A 1X19A 4HF2A 4XRFA 3BTLA 3C3WA 5K5RA 3BZ6A 2ZFUA 4IF4A 2QQ9A 5M3FJ 1K61A 1RKWA 1WQ2A 2TDXA 3ZQFA 4MO7A 1IN6A 1RNLA 2L9SA 2KRHA 3L09A 1TT0A 3J80K 1W5SA 5JVTA 2K86A 3V7SA 3I59B 4HX4A 1WKMA 2PMUA 4LGWA 4DYCA 4WX9A 2R5ZA 2KLOA 2OV7A 2GM4A 1PUEE 2NVQJ 3PJRA 3ROUA 3JW4A 4F3QA 1S3JA 3I4MJ 3MVPA 4TV7A 3IRRA 2VPRA 2MC4A 3QPLA 4BQOA 3VOEA 5EYRA 5J8CA 3CDIA 1WWXA 4OMZA 3S14J 1MNMC 3BOQA 2M4KA 1ZHFA 4F91B 2ZXHA 2HS5A 4LK0F 2XV4S 1OYWA 4Y17A 3Q0UA 1RESA 1W1WE 5L3DA 4M6VA 3ZR8X 5C4JJ 5D5VB 1UELB 2FNPA 4I01A 5DV5A 2XB5A 4XQFA 3PL8A 1YFHA 1N25A 4KFCA 1HXDA 2W24A 2QYOA 2Y0SA 2LREA 2M4GA 4I2OA 2LG4A 3ISPA 4MQVA 2GLOA 1MBHA 1FBSA 1LDDA 4NHJA 1MMGA 3A01B 4BU2A 3LQQA 3JCUC 1B6AA 3DBRB 2M45A 3RJPA 2UWMA 4BXUA 3FF5A 2HGCA 2XGCA 1FY7A 2ESNA 3GFJA 3OYIA 2GIVA 3DPTA 3F21A 4AIKA 4KYWA 1AKHA 4BXXJ 3GTPJ 1G8XA 4XONA 3CCRI 1YO5C 3LSHA 4RGSA 3NWTA 4FX0A 1BM9A 3CDHA 1W0UA 5DM6F 3W6JB
chains in the Genus database with same CATH topology
5IYCJ 1JUSA 4M3DA 1HLVA 1RKTA 2JWTA 2JN6A 3HBLA 1BL0A 3GTQJ 3BR1A 1E3OC 4A3LJ 2CQXA 4FE4A 1MSFC 4LOCA 4IHWA 5IOZA 2NVTJ 5EZGA 2CQQA 2JA8J 2ELKA 2DA2A 3O8GA 2HDDA 1F36A 3GTGJ 2AO9A 2E2JJ 1BA5A 4M3GA 2JA6J 5EGOA 2ME6A 1X2NA 5FLVA 4DZJA 1IC8A 3BQYA 1F43A 4XICA 3DCFA 2TRTA 2FD5A 1APLC 5EGOB 1FIPA 2WB1N 4HNVA 4C3HJ 5DS9A 3JRFA 4XRSG 1W0TA 3A03A 3NAUA 5GPCA 1MBKA 1WI3A 1Z0XA 2VKVA 2Y31A 5M5WJ 1AU7A 3BG9A 2QF7A 1AHDP 2MW8A 3F0CA 2JJ7A 4ABZA 2CUFA 3K7AJ 2LY9A 3H0GJ 2NS7A 2VUMJ 2OF7A 3PO2J 1P7IA 4G12A 1WPKA 1A6IA 1QRYA 3BG5A 3LNQA 4XIDA 3I4NJ 2N8GA 4RDUA 2ECBA 5GPAA 2CU7A 5K7HA 2CRGA 2M0CA 3O8HA 3TW7A 2IAIA 1JT6A 3M4OJ 1IDZA 2MG4A 5FJ8J 2GBYA 3A01A 3BR3A 5EEAA 5FLMJ 1I3QJ 5J1UA 2RAEA 4AC0A 3FKIJ 4D7MA 4J19A 2L0KA 2L7FP 2DA4A 1JTYA 2YU9J 4S0HB 2DMUA 3JRAA 3E7LA 3L1PA 3HOVJ 3BT9A 5E3OA 3HOUJ 3MKLA 1PUFB 3HOYJ 1SFOJ 3S1QJ 4UUSA 1NK2P 3CMYA 1I6HJ 3Q0WA 2HYJA 3SDGA 5K7ZA 1B8IA 5F08A 4V2GA 1FEXA 2R7ZJ 3TP0A 3RKQA 1H8AC 2ZB9A 3BR6A 1HF0A 2E19A 1HCRA 3SFIA 2EZHA 2O7OA 5EDNA 2K40A 2R5YB 3JREA 4B4CA 1DU6A 9ANTA 1Y1VJ 1JKRC 2YUSA 3WHBA 5M3MJ 3LSRA 2FQ4A 3HEFA 1LE8B 1FTZA 3H3VK 3A02A 2HQ5A 3TW6A 5HODA 5E3NA 3RZOJ 3PM1A 1D5YA 4X6AJ 3BR2A 4EEFG 1U78A 1YRNB 2DMQA 3HGYA 4C2MJ 2EZKA 1VFCA 1WCMJ 4A3JJ 3JRHA 5E3MA 1ORKA 4MIMA 3S2HJ 1TWAJ 5F0CA 2CJJA 3NARA 1TC3C 3Q0VA 2FJ1A 1ETYA 2LTPA 2H8RA 1VI0A 1FJLA 2E2IJ 4DYQA 2R5ZB 2M2EA 2AHQA 4NDLA 4RBOA 1JJ6C 2WAQN 4FTHA 1ITYA 2LK2A 3TEDA 2W48A 1JUPA 2DA1A 4FISA 4XRMA 2LP0A 4I76A 1QVTA 4QSHA 3GTJJ 4A93J 2WV1A 4DW6A 2I10A 1X2MA 3BR5A 4D7NA 3K2AA 4B1RA 5FKMA 2DA7A 1AKHB 5IP7J 3GBGA 1TWGJ 4A3KJ 3RZDJ 1YRNA 4JP0A 3OSGA 1EF4A 2EBIA 4MFEA 2NVYJ 4IHYA 3FIWA 1WH5A 1T33A 3ZQGA 1LE8A 5J1RA 1ETWA 5EG0A 4C3IJ 2LD5A 3RQIA 1B72A 1OCTC 3ZQIA 4M3BA 2K9QA 5F0FA 3BTCA 3HM5A 1MBFA 2D5VA 3C2BA 4UUTA 2VKEA 5EZHA 1RETA 2HI3A 3G1OA 5IP9J 4JX5A 1ZQ3P 5F27A 3FK6A 1VNDA 1TWFJ 4BBSJ 1LFBA 1P7JA 4CYCA 1SANA 1U8BA 2PMZN 2Y9ZA 4BY1J 3HKZN 4L5EA 5E3LA 4XRSA 2XPWA 2YS9A 3LSJA 1PUFA 4Y52J 1B72B 1O4XA 2XSDC 1NTCA 1ZTRA 2CUEA 2K9NA 1GUUA 1IUFA 3QQAA 3VPRA 3ZQCA 2VI6A 3S1NJ 2MGQA 1MBJA 2ID6A 2EQRA 3B6CA 4IEJA 5IYDJ 1TWHJ 1UMQA 3W6VA 1IV6A 3JRDA 4DYRA 1BW6A 2TCTA 1FTTA 2L9RA 3IH4A 2JK3A 3HOXJ 3BR0A 1MH3A 2COBA 5EG0B 2LFBA 4JYKA 1IGNA 5K7FA 4A3BJ 3PO3J 3CQZJ 1U9NA 3JRGA 2ME0A 3OSFA 2G0EA 5JLWA 3BTIA 1MBGA 3QPSA 1IJWC 1ENHA 3UKGA 1XS9A 1Z77A 2H1KA 3JRBA 3SJMA 4V2FA 4AUXA 1MSEC 2DN0A 2XB0X 1R9TJ 1JJ8C 2DA3A 3S15J 4M3FA 3ZQHA 1JKOC 3B6AA 2XRLA 5C4XJ 2EZIA 3M3YJ 3CDLA 2R0QC 3LSGA 2EH3A 1GVDA 4B3AA 4BBRJ 5M5XJ 1HDPA 1JGGA 1OFCX 2JMWA 3ZOBA 4A3FJ 4X1EA 3S1MJ 4A3DJ 2X9DA 1LFUP 1DU0A 1POGA 1BW5A 3HOZJ 5C3EJ 1XG1A 1OJLA 5FKLA 1UHSA 2MSYA 3Q3SA 1JKPC 3IH3A 2JA7J 2LR8A 2QCOA 1G2HA 1GDTA 1NK3P 3BQZA 1S7EA 4GFBA 2DJNA 2DTZA 3G1LA 1JTXA 1GT0C 4A3GJ 2EZLA 1GV5A 5EF6A 1Q1VA 5BNGA 2DMNA 2M9HA 2B63J 1FIAA 2JA5J 2E1OA 1IDYA 2O9LA 2R5YA 2DA6A 1I50J 1IRZA 3LOCA 2Y30A 2IEKA 2L7ZA 4BY7J 3D1NI 4A3EJ 1TWCJ 2M8GX 3S17J 3IH2A 3HOWJ 3CCYA 1ZR2A 1ETKA 4I6ZA 1HDDC 5M5YJ 2LKXA 1T56A 4A69C 3S1RJ 1WH7A 1H88C 1QVUA 2FX0A 4IHXA 4FCYA 4AYBN 1JKQC 3GTMJ 2Y9YA 1RR7A 1ETOA 2ID3A 5IOYA 3GTOJ 3OOUA 1ZKGA 3JRCA 2E2HJ 2L7MP 2XPUA 5FKNA 5FKKA 2R92J 4D5FA 3G1MA 1QPIA 2NVXJ 4W97A 4QIWN 3FK7A 1ZK8A 3IV5A 3WHCA 5F04A 1ZGWA 1X58A 4QTRA 1Y1WJ 4MLOA 2HOSA 3DEWA 4MFDA 1JT0A 3BTJA 5J1YA 4CYCB 3BG3A 2KT0A 3BTLA 4A3IJ 5M3FJ 1K61A 1RKWA 3ZQFA 4MO7A 4DZPA 2M34A 3GTKJ 4FE7A 5C44J 3HGGA 2Y2ZA 1ETXA 2DMTA 1OCPA 2R5ZA 4DYCA 2R93J 2GM4A 1IG7A 2NVQJ 4M3EA 3I4MJ 1ETQA 3MVPA 5F0HA 2VPRA 3QPLA 1XC5A 5FKOA 1GV2A 3FISA 2P81A 5EYRA 2Y0SN 3S14J 2HXOA 2ECCA 2OPTA 4JX4A 4XK4A 1MNMC 1U9OA 1JUMA 2DMPA 3JRIA 4D5CA 2NOGA 2X48A 4A3MJ 3Q0UA 1RESA 5F1JA 3HDDA 2HXIA 2K9SA 5GP9A 1ZR4A 4M6VA 3S2DJ 2KDZA 1H89C 3OIOA 5C4JJ 2X6OA 2XB5A 4W1UA 5DTDA 2HOAA 2LLKA 5IPAA 1ETVA 4UUSB 2XPVA 2HOTA 5JLXA 1CQTA 2GLOA 1MBHA 3S16J 3TP3A 5J3LA 3A01B 3MN2A 1UG2A 5IP6A 2O8KA 4JX6A 1A5JA 4BKXA 4IHVA 3JR9A 2XGCA 1HOMA 3ZQLA 2XGEA 2DA5A 1RPWA 1MH4A 2NS8A 3GTLJ 1AKHA 2LVSA 3GTPJ 3LSPA 4BXXJ 4A3CJ 1MBEA 1WGXA 1VF9A 4C3JJ 1BJZA 1K83J 2IBDA 2XGDA 1W0UA 5IYBJ 4Y7NJ 3HB9A 1B8IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC J;  1JUS A;  4M3D A;  1HLV A;  1RKT A;  2JWT A;  2JN6 A;  3HBL A;  1BL0 A;  3GTQ J;  3BR1 A;  1E3O C;  4A3L J;  2CQX A;  4FE4 A;  1MSF C;  4LOC A;  4IHW A;  5IOZ A;  2NVT J;  5EZG A;  2CQQ A;  2JA8 J;  2ELK A;  2DA2 A;  3O8G A;  2HDD A;  1F36 A;  3GTG J;  2AO9 A;  2E2J J;  1BA5 A;  4M3G A;  2JA6 J;  5EGO A;  2ME6 A;  1X2N A;  5FLV A;  4DZJ A;  1IC8 A;  3BQY A;  1F43 A;  4XIC A;  3DCF A;  2TRT A;  2FD5 A;  1APL C;  5EGO B;  1FIP A;  2WB1 N;  4HNV A;  4C3H J;  5DS9 A;  3JRF A;  4XRS G;  1W0T A;  3A03 A;  3NAU A;  5GPC A;  1MBK A;  1WI3 A;  1Z0X A;  2VKV A;  2Y31 A;  5M5W J;  1AU7 A;  3BG9 A;  2QF7 A;  1AHD P;  2MW8 A;  3F0C A;  2JJ7 A;  4ABZ A;  2CUF A;  3K7A J;  2LY9 A;  3H0G J;  2NS7 A;  2VUM J;  2OF7 A;  3PO2 J;  1P7I A;  4G12 A;  1WPK A;  1A6I A;  1QRY A;  3BG5 A;  3LNQ A;  4XID A;  3I4N J;  2N8G A;  4RDU A;  2ECB A;  5GPA A;  2CU7 A;  5K7H A;  2CRG A;  2M0C A;  3O8H A;  3TW7 A;  2IAI A;  1JT6 A;  3M4O J;  1IDZ A;  2MG4 A;  5FJ8 J;  2GBY A;  3A01 A;  3BR3 A;  5EEA A;  5FLM J;  1I3Q J;  5J1U A;  2RAE A;  4AC0 A;  3FKI J;  4D7M A;  4J19 A;  2L0K A;  2L7F P;  2DA4 A;  1JTY A;  2YU9 J;  4S0H B;  2DMU A;  3JRA A;  3E7L A;  3L1P A;  3HOV J;  3BT9 A;  5E3O A;  3HOU J;  3MKL A;  1PUF B;  3HOY J;  1SFO J;  3S1Q J;  4UUS A;  1NK2 P;  3CMY A;  1I6H J;  3Q0W A;  2HYJ A;  3SDG A;  5K7Z A;  1B8I A;  5F08 A;  4V2G A;  1FEX A;  2R7Z J;  3TP0 A;  3RKQ A;  1H8A C;  2ZB9 A;  3BR6 A;  1HF0 A;  2E19 A;  1HCR A;  3SFI A;  2EZH A;  2O7O A;  5EDN A;  2K40 A;  2R5Y B;  3JRE A;  4B4C A;  1DU6 A;  9ANT A;  1Y1V J;  1JKR C;  2YUS A;  3WHB A;  5M3M J;  3LSR A;  2FQ4 A;  3HEF A;  1LE8 B;  1FTZ A;  3H3V K;  3A02 A;  2HQ5 A;  3TW6 A;  5HOD A;  5E3N A;  3RZO J;  3PM1 A;  1D5Y A;  4X6A J;  3BR2 A;  4EEF G;  1U78 A;  1YRN B;  2DMQ A;  3HGY A;  4C2M J;  2EZK A;  1VFC A;  1WCM J;  4A3J J;  3JRH A;  5E3M A;  1ORK A;  4MIM A;  3S2H J;  1TWA J;  5F0C A;  2CJJ A;  3NAR A;  1TC3 C;  3Q0V A;  2FJ1 A;  1ETY A;  2LTP A;  2H8R A;  1VI0 A;  1FJL A;  2E2I J;  4DYQ A;  2R5Z B;  2M2E A;  2AHQ A;  4NDL A;  4RBO A;  1JJ6 C;  2WAQ N;  4FTH A;  1ITY A;  2LK2 A;  3TED A;  2W48 A;  1JUP A;  2DA1 A;  4FIS A;  4XRM A;  2LP0 A;  4I76 A;  1QVT A;  4QSH A;  3GTJ J;  4A93 J;  2WV1 A;  4DW6 A;  2I10 A;  1X2M A;  3BR5 A;  4D7N A;  3K2A A;  4B1R A;  5FKM A;  2DA7 A;  1AKH B;  5IP7 J;  3GBG A;  1TWG J;  4A3K J;  3RZD J;  1YRN A;  4JP0 A;  3OSG A;  1EF4 A;  2EBI A;  4MFE A;  2NVY J;  4IHY A;  3FIW A;  1WH5 A;  1T33 A;  3ZQG A;  1LE8 A;  5J1R A;  1ETW A;  5EG0 A;  4C3I J;  2LD5 A;  3RQI A;  1B72 A;  1OCT C;  3ZQI A;  4M3B A;  2K9Q A;  5F0F A;  3BTC A;  3HM5 A;  1MBF A;  2D5V A;  3C2B A;  4UUT A;  2VKE A;  5EZH A;  1RET A;  2HI3 A;  3G1O A;  5IP9 J;  4JX5 A;  1ZQ3 P;  5F27 A;  3FK6 A;  1VND A;  1TWF J;  4BBS J;  1LFB A;  1P7J A;  4CYC A;  1SAN A;  1U8B A;  2PMZ N;  2Y9Z A;  4BY1 J;  3HKZ N;  4L5E A;  5E3L A;  4XRS A;  2XPW A;  2YS9 A;  3LSJ A;  1PUF A;  4Y52 J;  1B72 B;  1O4X A;  2XSD C;  1NTC A;  1ZTR A;  2CUE A;  2K9N A;  1GUU A;  1IUF A;  3QQA A;  3VPR A;  3ZQC A;  2VI6 A;  3S1N J;  2MGQ A;  1MBJ A;  2ID6 A;  2EQR A;  3B6C A;  4IEJ A;  5IYD J;  1TWH J;  1UMQ A;  3W6V A;  1IV6 A;  3JRD A;  4DYR A;  1BW6 A;  2TCT A;  1FTT A;  2L9R A;  3IH4 A;  2JK3 A;  3HOX J;  3BR0 A;  1MH3 A;  2COB A;  5EG0 B;  2LFB A;  4JYK A;  1IGN A;  5K7F A;  4A3B J;  3PO3 J;  3CQZ J;  1U9N A;  3JRG A;  2ME0 A;  3OSF A;  2G0E A;  5JLW A;  3BTI A;  1MBG A;  3QPS A;  1IJW C;  1ENH A;  3UKG A;  1XS9 A;  1Z77 A;  2H1K A;  3JRB A;  3SJM A;  4V2F A;  4AUX A;  1MSE C;  2DN0 A;  2XB0 X;  1R9T J;  1JJ8 C;  2DA3 A;  3S15 J;  4M3F A;  3ZQH A;  1JKO C;  3B6A A;  2XRL A;  5C4X J;  2EZI A;  3M3Y J;  3CDL A;  2R0Q C;  3LSG A;  2EH3 A;  1GVD A;  4B3A A;  4BBR J;  5M5X J;  1HDP A;  1JGG A;  1OFC X;  2JMW A;  3ZOB A;  4A3F J;  4X1E A;  3S1M J;  4A3D J;  2X9D A;  1LFU P;  1DU0 A;  1POG A;  1BW5 A;  3HOZ J;  5C3E J;  1XG1 A;  1OJL A;  5FKL A;  1UHS A;  2MSY A;  3Q3S A;  1JKP C;  3IH3 A;  2JA7 J;  2LR8 A;  2QCO A;  1G2H A;  1GDT A;  1NK3 P;  3BQZ A;  1S7E A;  4GFB A;  2DJN A;  2DTZ A;  3G1L A;  1JTX A;  1GT0 C;  4A3G J;  2EZL A;  1GV5 A;  5EF6 A;  1Q1V A;  5BNG A;  2DMN A;  2M9H A;  2B63 J;  1FIA A;  2JA5 J;  2E1O A;  1IDY A;  2O9L A;  2R5Y A;  2DA6 A;  1I50 J;  1IRZ A;  3LOC A;  2Y30 A;  2IEK A;  2L7Z A;  4BY7 J;  3D1N I;  4A3E J;  1TWC J;  2M8G X;  3S17 J;  3IH2 A;  3HOW J;  3CCY A;  1ZR2 A;  1ETK A;  4I6Z A;  1HDD C;  5M5Y J;  2LKX A;  1T56 A;  4A69 C;  3S1R J;  1WH7 A;  1H88 C;  1QVU A;  2FX0 A;  4IHX A;  4FCY A;  4AYB N;  1JKQ C;  3GTM J;  2Y9Y A;  1RR7 A;  1ETO A;  2ID3 A;  5IOY A;  3GTO J;  3OOU A;  1ZKG A;  3JRC A;  2E2H J;  2L7M P;  2XPU A;  5FKN A;  5FKK A;  2R92 J;  4D5F A;  3G1M A;  1QPI A;  2NVX J;  4W97 A;  4QIW N;  3FK7 A;  1ZK8 A;  3IV5 A;  3WHC A;  5F04 A;  1ZGW A;  1X58 A;  4QTR A;  1Y1W J;  4MLO A;  2HOS A;  3DEW A;  4MFD A;  1JT0 A;  3BTJ A;  5J1Y A;  4CYC B;  3BG3 A;  2KT0 A;  3BTL A;  4A3I J;  5M3F J;  1K61 A;  1RKW A;  3ZQF A;  4MO7 A;  4DZP A;  2M34 A;  3GTK J;  4FE7 A;  5C44 J;  3HGG A;  2Y2Z A;  1ETX A;  2DMT A;  1OCP A;  2R5Z A;  4DYC A;  2R93 J;  2GM4 A;  1IG7 A;  2NVQ J;  4M3E A;  3I4M J;  1ETQ A;  3MVP A;  5F0H A;  2VPR A;  3QPL A;  1XC5 A;  5FKO A;  1GV2 A;  3FIS A;  2P81 A;  5EYR A;  2Y0S N;  3S14 J;  2HXO A;  2ECC A;  2OPT A;  4JX4 A;  4XK4 A;  1MNM C;  1U9O A;  1JUM A;  2DMP A;  3JRI A;  4D5C A;  2NOG A;  2X48 A;  4A3M J;  3Q0U A;  1RES A;  5F1J A;  3HDD A;  2HXI A;  2K9S A;  5GP9 A;  1ZR4 A;  4M6V A;  3S2D J;  2KDZ A;  1H89 C;  3OIO A;  5C4J J;  2X6O A;  2XB5 A;  4W1U A;  5DTD A;  2HOA A;  2LLK A;  5IPA A;  1ETV A;  4UUS B;  2XPV A;  2HOT A;  5JLX A;  1CQT A;  2GLO A;  1MBH A;  3S16 J;  3TP3 A;  5J3L A;  3A01 B;  3MN2 A;  1UG2 A;  5IP6 A;  2O8K A;  4JX6 A;  1A5J A;  4BKX A;  4IHV A;  3JR9 A;  2XGC A;  1HOM A;  3ZQL A;  2XGE A;  2DA5 A;  1RPW A;  1MH4 A;  2NS8 A;  3GTL J;  1AKH A;  2LVS A;  3GTP J;  3LSP A;  4BXX J;  4A3C J;  1MBE A;  1WGX A;  1VF9 A;  4C3J J;  1BJZ A;  1K83 J;  2IBD A;  2XGD A;  1W0U A;  5IYB J;  4Y7N J;  3HB9 A;  1B8I B; 
#chains in the Genus database with same CATH topology
 1JUS A;  1ZGJ A;  3A0B C;  4Y3O A;  2YX4 A;  3M9A A;  3M7G A;  2JWT A;  1VQ4 I;  1BL0 A;  3BR1 A;  5DUK A;  4A3L J;  4CUG A;  4DOZ A;  4L9N A;  3B73 A;  4U0W A;  2KIQ A;  4F55 A;  3KFW X;  1HW2 A;  1XSV A;  1MSF C;  2OTJ I;  1LEB A;  2CQQ A;  2JA8 J;  2A07 F;  1K78 A;  3CUO A;  1F36 A;  4RS8 A;  4YEL A;  1VZ0 A;  3F8B A;  2LYC A;  4GDF A;  2JA6 J;  2ZKZ A;  1J7K A;  2K7L A;  2ME6 A;  3OOP A;  2HFH A;  2L4M A;  3LAJ A;  4CH7 A;  3MKY B;  2GXB A;  1IC8 A;  4OIQ F;  2F48 A;  3RDI A;  1F43 A;  1R49 A;  4XIC A;  2CS3 A;  5E1Z B;  4E7Z A;  2EFN A;  1I5Z A;  2L9N A;  4BJ6 C;  1VQN I;  1K7A A;  1W5C C;  2WY8 Q;  1IF1 A;  5DS9 A;  1V5F A;  1W0T A;  3NAU A;  5GPC A;  1P4A A;  2QZ8 A;  1Z0X A;  2DO7 A;  1AU7 A;  2KIF A;  2QQB A;  3ZGK A;  1XMX A;  5B66 C;  1P9Q C;  2MAB A;  1IN5 A;  3NEU A;  4MEY F;  4ABZ A;  2LY9 A;  2VUM J;  1SFX A;  4XOP A;  2OF7 A;  1OCZ H;  1UZC A;  3GF2 A;  1JE8 A;  4S04 A;  1QRY A;  3EQL F;  3I4N J;  5D5U B;  3H9Q A;  4XLH A;  5LD2 C;  1DGR M;  2DYR H;  3QOP A;  4HQM A;  3WTU C;  3M4O J;  2W1O A;  3VDX A;  1IDZ A;  2LY2 A;  1A6Q A;  3CUQ A;  5FJ8 J;  3QWL A;  4RAG A;  2VQH A;  2BEO A;  5LRR A;  2P6T A;  5KNL A;  3V8L A;  3K4N A;  2G7H A;  3MZY A;  4MTE A;  4HLY A;  5L3E A;  3CP2 A;  2RAE A;  1WJB A;  2O0Y A;  5CYV A;  3R6S A;  4JQF A;  4AC0 A;  2CO5 A;  4RGX A;  2L0K A;  5FD6 A;  3JRA A;  1X1C A;  2WWY A;  4M72 A;  3BT9 A;  2F5V A;  3MKL A;  4M6X A;  1PUF B;  1UHM A;  3CUQ B;  2LNB A;  3K69 A;  4LG3 A;  2HYJ A;  4A0Y A;  5FFX A;  2QSG X;  1D0Z A;  1B8I A;  4KT5 C;  2V9V A;  5F08 A;  4V2G A;  1FEX A;  2O03 A;  1LJ9 A;  3RKQ A;  1YW7 A;  3BR6 A;  1HF0 A;  1HCR A;  2VKD A;  4YIF A;  1VQ9 I;  3E6B A;  4ZDO A;  1ACI A;  4CXF A;  4U87 A;  1WJF A;  2CW7 A;  5DD4 A;  2ZCW A;  3ULQ B;  9ANT A;  4LIU A;  1JKR C;  4CGZ A;  2A5W A;  2YUS A;  4UY8 I;  4HOB A;  3FXJ A;  3HEF A;  4ZH4 F;  4A0Z A;  3L2W A;  1LE8 B;  3H3V K;  2HPI A;  3TW6 A;  1F1Z A;  1H0M A;  2Z2S B;  1BIB A;  1D5Y A;  1T39 A;  3I58 A;  2PX9 A;  4HYE A;  1IW7 F;  1IN8 A;  2XKP A;  5H6R A;  4CA0 A;  1RR8 C;  2R7T A;  2IGK A;  1R71 A;  5FLX K;  3K1P A;  4PJN A;  1R5H A;  4PSW A;  1DDN A;  2MC3 A;  3HUG A;  1IRX A;  4M9X A;  1SAU A;  3OYF A;  2LTP A;  1HQC A;  1VI0 A;  2E2I J;  2LSO A;  5E1W A;  3QP5 A;  4LB6 B;  2QEX I;  4NDL A;  1U5T C;  2WAQ N;  4FTH A;  1IZ1 A;  2LK2 A;  2W48 A;  1U5T B;  1V3F A;  2H8W A;  3HPH A;  4O3M A;  1G3Y A;  1S7O A;  5DM7 F;  2VE8 A;  3VYT B;  4XRM A;  2EA4 A;  2HVR A;  4HNT A;  3DEU A;  1QVT A;  3VWB A;  2L2O A;  4A93 J;  1V4R A;  3DXJ F;  3FHN A;  4D7N A;  1R58 A;  3ZXS A;  1XGM A;  2X0L A;  4LG0 B;  5FKM A;  1AKH B;  5K5Q A;  3CCS I;  1VQO I;  3WGH A;  1FZP B;  1YRN A;  4RB0 A;  3SDB A;  3OSG A;  1F4K A;  3CLQ A;  2EBI A;  4IHY A;  2WAD A;  4JBA A;  3FIW A;  3WU1 B;  4BNC A;  3U1D A;  3RQ4 A;  1T33 A;  4O5V A;  2VBY A;  2CH0 A;  2KHM A;  4A5N A;  2OA4 A;  3FMR A;  3ZQI A;  2JVG A;  4NC6 A;  3BTC A;  1MBF A;  3C2B A;  5E18 F;  2LF8 A;  1V54 H;  2DYS H;  3BJO A;  5EZH A;  2XHK A;  3NRV A;  4L18 B;  2IPQ X;  3HRT A;  4ENK A;  4KIS A;  5E1X A;  3WTT C;  1VND A;  1OR7 A;  2FBH A;  4KUM A;  4BBS J;  1LFB A;  1SAN A;  3R4K A;  1Z7U A;  1ZRC A;  4P55 A;  1EKE A;  2DK5 A;  4UXN A;  2M3A A;  1FOW A;  2H6B A;  1B72 B;  4A5M A;  1BR1 A;  4PFO A;  1IUF A;  3FHZ A;  2C6Y A;  3T5X A;  1Z3Y A;  3SEQ A;  4MTD A;  2VT3 A;  4I02 A;  4A12 A;  3WGG A;  4LLG F;  4LD5 A;  3I5U A;  4ZDL A;  3TQN A;  1MBJ A;  4CZZ A;  1W36 D;  3BG7 A;  5CKT A;  5IYD J;  1IV6 A;  3AL0 C;  4RA2 A;  2BHZ A;  2JUG A;  3P5J A;  5CPR B;  2JK3 A;  2JTV A;  2VC1 A;  3BR0 A;  2BHY A;  4FT8 A;  2LKP A;  3HJE A;  1RZ4 A;  2MH9 A;  4UUV A;  3U9G A;  2LFB A;  1WZ2 A;  5K7F A;  1VQ7 I;  3CQZ J;  3CC7 I;  1YW8 A;  1ZAO A;  1DUX C;  4BDZ A;  2GZW A;  3H5A A;  2Z33 A;  4C2U A;  4HF0 A;  1ENH A;  3V8K A;  2MLG A;  4RGU A;  2HTJ A;  4N0B A;  1SFK A;  3GZ5 A;  1MSE C;  4Q5S F;  4KNY A;  2RDP A;  1O7L A;  5J6X A;  2ZJP F;  3O3K A;  4IRI A;  4K2E A;  2OQR A;  3HTU A;  4IHS A;  3KPH A;  5IT9 Z;  3TOA A;  3ZQH A;  1JKO C;  1O3R A;  5C4X J;  2EZI A;  2WA0 A;  3WG9 A;  1RC9 A;  2X85 A;  4LLN A;  1L0O C;  3LSG A;  2EH3 A;  1QPM A;  2BW3 A;  3ABT A;  3MZ8 A;  4X1E A;  2E7X A;  2EJR A;  4PJL A;  3ZMD A;  2KRC A;  1BR2 A;  1WVR A;  1FNN A;  5ILS A;  3HHG A;  4A6E A;  4Y33 A;  1YTY A;  2A68 F;  4YRV A;  4P9U A;  2Z3Y A;  2MSY A;  1RUN A;  2EIK H;  4LB5 A;  3IAS 2;  4F7Z A;  2KJC A;  3HRM A;  1JKP C;  3Q5F A;  2AQF A;  3L00 A;  4OU0 A;  1D8J A;  3OYE A;  1G2H A;  1TNS A;  1G3W A;  4KIC A;  2QGU A;  4GFB A;  4O6J A;  3LA3 A;  2R7R A;  2A6E F;  3L2V A;  2CV2 A;  3GUD A;  1JTX A;  4H0E A;  1B4A A;  3ML6 A;  4PFP A;  1BI0 A;  2X6X A;  5D5W B;  3HOT A;  5K5O A;  1FIA A;  5B1B H;  2JA5 J;  2HEO A;  2V7F A;  1IDY A;  1B9M A;  5CVV A;  3TBI A;  4LIT A;  4I0B A;  2NYX A;  2ESH A;  2HKO A;  2VQC A;  3JAM Z;  3ZP5 A;  4L0Y B;  1TWC J;  2OUM A;  2M8G X;  2OTL I;  3REO A;  3K0L A;  1ZR2 A;  2Y69 H;  1JI8 A;  5M5Y J;  2VIX A;  4A69 C;  3EUH A;  1UG0 A;  3S1R J;  2WB1 A;  1MMS A;  2Q2E B;  1H88 C;  1QVU A;  4IHX A;  1I3A A;  1HKT A;  2M30 A;  4FCY A;  1R5I D;  1LB2 A;  2Y9Y A;  1RR7 A;  1ETO A;  1SVL A;  2R7D A;  3A0H C;  3A4C A;  1P92 A;  5IOY A;  1T98 A;  4CDG A;  1ZKG A;  1D3Y A;  3CCU I;  2O3F A;  5D8K B;  3U2R A;  1QPI A;  2QQA A;  2EFO A;  2V1N A;  4HDV A;  2DDA A;  3WHC A;  1O3Q A;  3BCB A;  1X58 A;  4YIR X;  4MLO A;  2NAZ A;  5HDG A;  4ZJZ A;  1DP3 A;  4AYB A;  3WTY C;  3DEW A;  2AQE A;  3FKJ A;  3DF8 A;  1JT0 A;  1J0R A;  3QYB A;  5J1Y A;  2V6E A;  4BL0 B;  4CYC B;  5FRN A;  4XL9 A;  1EA3 A;  2DLL A;  1HBX G;  2CW8 A;  4RM3 A;  3ERM A;  4C30 A;  1HSJ A;  4WXH A;  2WV0 A;  3F22 A;  1SMY F;  3BLY A;  4DZP A;  4RAY A;  1RIO H;  4PJM A;  1OCR H;  3HGG A;  3LST A;  2DMT A;  2NRA C;  1EH6 A;  4XKW A;  2QM3 A;  3TOB A;  3FBI B;  3E6D A;  2XSJ C;  4II2 A;  3ZQQ A;  1F9N A;  2FF4 A;  2DFE A;  1XMK A;  2L5Q A;  5F0H A;  4E7H A;  3H36 A;  3FIS A;  1QBJ A;  3WOD F;  4JX4 A;  4NC8 A;  3U1K A;  1R6R A;  1BA5 A;  4AU7 A;  2WAQ A;  4D5C A;  2X48 A;  2DFF A;  4A3M J;  5D4R A;  3HDD A;  3FXQ A;  3G6E I;  4IRG A;  5HLH A;  3E1S A;  3MAJ A;  2M87 A;  4BE0 A;  1HST A;  2HZT A;  5HVQ C;  1ZRF A;  2LLK A;  1IN7 A;  2ISZ A;  4HW0 A;  2M0M A;  5AIQ A;  1OKR A;  1OCO H;  2H6C A;  4PSX A;  5JLX A;  4ESJ A;  3ECH A;  2HOT A;  1I27 A;  1R7J A;  1CQT A;  4HLX A;  2X6Y A;  3LSI A;  4BUP A;  3AAF A;  1TP4 A;  3BPX A;  2HOE A;  1Y56 A;  2F5C A;  1KZH A;  1JXS A;  5J3L A;  5K1Y A;  3FMS A;  3MN2 A;  3K1M A;  4IQJ A;  5IP6 A;  2BOL A;  4FX4 A;  1A5J A;  2A3S A;  2M5W A;  4BHC A;  3K4C A;  1K4T A;  2UXX A;  4BKX A;  4IHV A;  2XUB A;  1YIJ I;  4NC7 A;  3KYD B;  2A69 F;  1V5G A;  2RNJ A;  1PDN C;  2OD5 A;  4FET A;  1HOM A;  3OYB A;  2ELJ A;  3ZQL A;  2M7B A;  3H5N A;  4GXO A;  3TDZ C;  2QBY B;  4ANJ A;  4RMN A;  1FLI A;  2NS8 A;  4IHT A;  3EDP A;  3ONQ A;  3RPQ A;  3LSP A;  4IOC F;  3BDD A;  3IKT A;  1MBE A;  3GLL A;  4KMU X;  2L3D A;  2XGD A;  2IBD A;  3F72 A;  4Y7N J;  3HB9 A;  4HA8 A;  4IVN A;  1B8I B;  2E1C A;  2PI0 A;  5IYC J;  3GZ6 A;  4M3D A;  1HLV A;  2KIS A;  2IRF G;  3OYH A;  3GZN B;  1RKT A;  2JN6 A;  3HBL A;  4CO8 A;  1KA8 A;  4YG2 F;  2E1M B;  4KJZ A;  2Q0O A;  3VOD A;  2L01 A;  5E8I A;  1FT9 A;  1WRJ A;  2CUJ A;  1SMT A;  5EZG A;  2LOO A;  2E35 A;  2V6C A;  4HST A;  4M9Z A;  3ZCO A;  2F5E A;  2KJB A;  2QVO A;  3M8F A;  2UZK A;  2HQN A;  4BDY A;  2HDD A;  1HW1 A;  4ITV A;  4EJO A;  3GTG J;  4GCV A;  4EMS A;  3OV8 A;  3K70 C;  1X2N A;  4E7K A;  2XF7 A;  1R1V A;  3TGN A;  3CP8 A;  1YYV A;  2CWE A;  2RC4 A;  2E60 A;  1LEA A;  2ZJ2 A;  4I09 A;  4DZJ A;  2MFZ A;  3WTV C;  3WTW C;  3JSO A;  4LLL A;  1LPQ A;  3E97 A;  2FD5 A;  1APL C;  2DW4 A;  5EGO B;  2D45 A;  2WB1 N;  5LFA A;  3CMA I;  2IP2 A;  2O6G E;  3KIO A;  4R8H A;  3JRF A;  3A03 A;  5TIS C;  2VAS A;  5IY5 H;  1WI3 A;  3PNT A;  2GXA A;  4KIB A;  4HX8 A;  2LC2 A;  3VYU B;  5BQT A;  3F0C A;  3MCZ A;  2MD5 A;  1KU9 A;  3PO2 J;  3H0G J;  1Z91 A;  4DGW B;  1P7I A;  3CJN A;  4G12 A;  3FXU A;  4WWC A;  3LNQ A;  1ZEL A;  3H35 A;  1N75 A;  5FRO A;  1HW5 A;  2P5K A;  3HSF A;  1XDS A;  2UXN A;  3CO6 C;  2M0C A;  1IAW A;  2W25 A;  3GME A;  3QPT A;  3PNY A;  3QU3 A;  3I64 A;  5A2Q Z;  3C7J A;  2HZD A;  3OIQ A;  1Q1H A;  3DPU A;  2GBY A;  3GLX A;  3A01 A;  3S2W A;  3SFZ A;  3B02 A;  5LHG A;  1YJW I;  2JRM A;  3KP7 A;  4PJJ A;  3IC7 A;  3VSK A;  4ZZD A;  3DTE A;  1SVO A;  1PJR A;  3QOE A;  2V1D A;  2XRO A;  3LSK A;  4J19 A;  1KU7 A;  1JTY A;  5DDG A;  3GCM A;  4S0H B;  2DMU A;  3HOU J;  5IT9 K;  3KEO A;  3RI4 A;  4AWX B;  1MDM A;  1NK2 P;  2EV5 A;  3CMY A;  4IKF A;  1I6H J;  1X1B A;  2W84 A;  3Q0W A;  2D1V A;  3SDG A;  3O2P E;  4P1W A;  4F52 A;  5K7Z A;  2ZXJ A;  3CCV I;  2R7Z J;  4EJT A;  5LBQ A;  2ZB9 A;  2YU3 A;  3V8J A;  2EIL H;  3H9G A;  3JRE A;  2F6C A;  3DU6 A;  2UUZ A;  3MKZ A;  1DU6 A;  4LMY A;  5HLI A;  5IT3 A;  2VOO A;  2VKH A;  4B43 A;  3A02 A;  2HQ5 A;  5E3N A;  1ERD A;  4P5O A;  1K6Y A;  4ZYE A;  2F5D A;  3BR2 A;  4EEF G;  2GOM A;  4G8X A;  1FWZ A;  3FDY A;  5CQG A;  3BY6 A;  4ZC3 A;  3HG9 A;  4KN4 X;  2V9K A;  2M8E A;  2XF6 A;  1Z7L A;  1BN5 A;  1ORK A;  1G59 A;  4B8X A;  4MIM A;  3CLO A;  1JHF A;  3D5S C;  3F8C A;  5LGU A;  3TL4 X;  2IS4 A;  1KYW A;  3CME I;  1ON2 A;  1R5G A;  2GWR A;  3TO7 A;  4A2U A;  4EGY A;  3IP4 B;  1XGS A;  2M2E A;  4RBO A;  1JJ6 C;  1ITY A;  2R7O A;  3TED A;  3MKW B;  2P7V B;  4BH9 A;  2OAZ A;  2DA1 A;  4FIS A;  3CF2 A;  2LP0 A;  1XCB A;  4QSH A;  1KON A;  2HNH A;  3BCA A;  1SEU A;  4KA4 A;  1X2M A;  1XDU A;  4XOT A;  5H20 A;  4B1R A;  1YIT I;  1YS7 A;  1YOV B;  2LH9 A;  3OYG A;  2QKL B;  3GBG A;  3GWZ A;  4E70 A;  3LMM A;  1R1U A;  3OYJ A;  4OWR B;  1Z21 A;  2KZG A;  2WBM A;  1BJA A;  2IVM A;  1LKX A;  3RIR A;  5J1R A;  4RAF A;  5EG0 A;  3SZT A;  1BC8 C;  2F5F A;  1P2F A;  2ELH A;  2VOD A;  1OCT C;  2CV0 A;  3OL3 A;  5F0F A;  2D5V A;  1Y0N A;  3GFM A;  2K9L A;  2ZO4 A;  2YSR A;  5GAH J;  1R00 A;  1FBQ A;  1MND A;  1X3Z B;  5FGM A;  4JK1 X;  3KLO A;  1XGO A;  4CZC A;  3QAH A;  5DEQ A;  3V7C A;  4BJ5 C;  3HC7 A;  3FK6 A;  1TWF J;  4BEH B;  3F9K A;  2DI3 A;  2Y75 A;  3H0D A;  1U8B A;  4BY1 J;  1OYY A;  4IRH A;  4L5E A;  3I4P A;  5E3L A;  4XRS A;  2KQR A;  4G7O F;  3I0T A;  3IUO A;  3KX2 A;  1FSH A;  1YE9 A;  3EUK L;  3ZMS A;  1NTC A;  2K27 A;  4WXD A;  2VON A;  3HRS A;  3AKZ A;  4LJZ F;  2A61 A;  3S1N J;  2MGQ A;  1OR7 C;  4UB8 C;  1WI9 A;  2EQR A;  3B6C A;  4LK1 F;  4G6Q A;  5KVR A;  1Z6R A;  3KE2 A;  2JRT A;  3PUF A;  4DYR A;  1BW6 A;  2ISY A;  2GAU A;  3IH4 A;  1ZAR A;  2XGX A;  2Z1D A;  3PSI A;  3TDU C;  4D1Q A;  3HOX J;  1MH3 A;  2COB A;  5EG0 B;  1FYL A;  2EA2 A;  3GW2 A;  3MD2 A;  4JYK A;  3F8F A;  4A3B J;  1U6G A;  4HNU A;  2VBX A;  2D2W A;  3G73 A;  3JRG A;  1XSD A;  1V5E A;  3ECO A;  1HKQ A;  1ZRE A;  3BTI A;  4GRI A;  1IJW C;  4EVI A;  3UKG A;  2DPD A;  5H2F C;  1XS9 A;  3I71 A;  4V2F A;  4AUX A;  2VC0 A;  1T0F A;  2DN0 A;  2VJ4 A;  2E5Z A;  3OR2 C;  1T2K A;  5FFZ A;  1MKM A;  2VXD A;  1R9T J;  1GXP A;  3TO9 A;  1J09 A;  1KYZ A;  4M3F A;  2WC2 A;  4PDK A;  3LA2 A;  2XRL A;  2V1X A;  4BQQ A;  2VJJ A;  3BWG A;  3I56 I;  3M3Y J;  5HNF A;  1YJ9 I;  2GXG A;  3CDL A;  2R0Q C;  1QZE A;  4UVA A;  3L2U A;  1DQU A;  1HDP A;  1KU2 A;  2BW3 B;  3R0J A;  2JMW A;  1JGG A;  2BGC A;  1LFU P;  2XAS A;  4UNO A;  1NHA A;  2A05 A;  1POG A;  3F6O A;  1U5T A;  1BW5 A;  4E7S A;  1O57 A;  2LRD A;  1XG1 A;  1AOY A;  1UHS A;  3K10 A;  2IS2 A;  1S72 I;  1U8R A;  3F3X A;  3ABU A;  4HRI A;  3Q3S A;  2A5Y B;  1YJN I;  4CCO A;  1PVE A;  3DTK A;  3GEZ A;  1X4P A;  3H1C A;  3I54 A;  5DCF A;  5ILU A;  4G6T B;  2FBK A;  3LWF A;  3CF5 F;  2DCE A;  1S7E A;  2VBW A;  3C2G A;  3KYC B;  3OYM A;  3KEQ A;  2FOW A;  2DJN A;  3GX4 X;  3ZMU A;  4A3G J;  2EZL A;  3QOD A;  4AIH A;  1MZB A;  2W57 A;  5BNG A;  1W7P B;  4DIQ A;  4KIT B;  3K70 D;  2E1O A;  5B5E C;  1T0F C;  2DA6 A;  2CFX A;  1I50 J;  2DQL A;  3HSE A;  3LOC A;  3RKY A;  3TKY A;  3E5X A;  3C18 A;  3D1N I;  4A3E J;  1G3S A;  2XAG A;  4ZYH A;  1T08 B;  3S17 J;  4FQG A;  3LAP A;  3IH2 A;  1OYI A;  1EH8 A;  3HOW J;  4XMY A;  1HDD C;  4I6Z A;  4AID A;  1OQY A;  1GXQ A;  2FOK A;  1WH7 A;  4EGZ A;  3CJT B;  2FX0 A;  1RI7 A;  1VQ8 I;  2EFQ A;  1W5T A;  1J9I A;  3HOS A;  2Y0M A;  4BJT A;  4D9J A;  3S93 A;  3EYI A;  3GTO J;  3VB2 A;  5FD5 A;  4L0Z B;  2R4G A;  3JRC A;  1G3T A;  1C0W A;  1QQI A;  5FKK A;  4Y13 A;  1ZGA A;  4WCG A;  1QNT A;  5J4Y A;  2NVX J;  4QIW N;  1YIO A;  2WAF A;  4HPQ A;  4G9Y A;  1R36 A;  3T0Y A;  1IRG A;  2DT5 A;  1FX7 A;  2DFH A;  4M74 A;  1Y1W J;  1Y8R B;  2NVU B;  3A1Y A;  3ZMT A;  3VEP A;  1SVM A;  4YFX F;  4WK8 F;  4AM3 A;  2P0W A;  2CQN A;  1XMA A;  2E5N A;  5A2Q K;  3OR1 C;  2XAJ A;  4B09 A;  4XLC A;  1A36 A;  4A3I J;  5BS6 A;  4QPQ A;  1E17 A;  2XAF A;  4XM3 A;  5CLS A;  2VL8 A;  1ZN2 A;  3GTK J;  3RCO A;  4FE7 A;  2LF7 A;  2XAH A;  2Y2Z A;  3GFL A;  4DBQ A;  2LBF A;  3SQN A;  3L2Q A;  1OCP A;  3P9C A;  3EPZ A;  3UR3 C;  1IG7 A;  2JQ7 A;  5ED4 A;  1J75 A;  1EH7 A;  2RRE A;  4G94 A;  2E1M C;  2JSP A;  4CSW A;  3PFI A;  1Z67 A;  5CQE A;  5DCM B;  4HF1 A;  5L3B A;  4AIJ A;  5J40 A;  1SD5 A;  1XC5 A;  1SFU A;  1LUJ B;  2XDV A;  1XN7 A;  2I8D A;  3O6B B;  4B3X A;  1O3S A;  3W2A A;  2Y0S N;  3C2H A;  3ABM H;  2OPT A;  2EIN H;  4XK4 A;  5ICG A;  3G3Z A;  2DMP A;  4DNC A;  1XTA A;  3JRI A;  2AXT C;  5L3C A;  5HNH A;  1X4O A;  4OMY A;  2XC7 A;  4D0P A;  1QU3 A;  2HXI A;  5GP9 A;  2KDO A;  3Q9S A;  4L5I A;  3S2D J;  5HDK A;  2BE5 F;  2XVC A;  2KDZ A;  1H89 C;  1DPU A;  2DAO A;  2X6O A;  4KDP A;  2DPU A;  1SFE A;  3HKZ A;  4E7J A;  1T6S A;  1ZLJ A;  2GOX B;  2HOA A;  3DBL B;  4PUS A;  4UB6 C;  3BZC A;  1ETV A;  5LHI A;  2PJR B;  5CJ9 A;  4UUS B;  1YG2 A;  2XPV A;  2DT7 B;  4HV5 A;  1IV8 A;  3S16 J;  2Q2E A;  4NQW A;  3SZP A;  3TP3 A;  3F23 A;  2HVS A;  5D6E A;  2BZT A;  1QZY A;  2NOJ B;  2O8K A;  3A2K A;  4B48 A;  3MEX A;  1S9H A;  2V26 A;  2VQG A;  2YR2 A;  3I3L A;  1BI1 A;  3RTR A;  3DLL F;  2XGE A;  3T8T A;  1TW2 A;  1XD7 A;  3IRQ A;  2DA5 A;  1MH4 A;  4MQ9 F;  1T8I A;  4H4K C;  4U7B A;  2QA4 I;  2LVS A;  2H09 A;  1WGX A;  1VF9 A;  2E36 A;  1BJZ A;  4UV9 A;  1EV7 A;  2CQ7 A;  4WXC A;  4UVC A;  2RQP A;  2HDW A;  1U0J A;  2Z99 A;  3DQV C;  3GTQ J;  4L9J A;  2DXI A;  1E3O C;  4BXF A;  5GTI C;  4RLQ A;  1UCR A;  2X51 A;  3K2Z A;  4LOC A;  4IHW A;  4XSX F;  1U3E M;  1JHH A;  2NVT J;  4ASN A;  2NNY A;  4BAC A;  2AXL A;  2ELK A;  2DA2 A;  2L02 A;  4UHT A;  4XLN F;  4HV6 A;  5TJJ A;  4XLE A;  2E2J J;  3ZMV A;  1X3U A;  2OZ6 A;  1B1B A;  5EGO A;  2CW0 F;  4C2T A;  4GGG A;  2YPR A;  2HTS A;  5E20 A;  3DKX A;  1R4M B;  1KU3 A;  1OCC H;  1BOA A;  2TRT A;  3DCF A;  3CD6 I;  5KAI C;  1FIP A;  4XLF A;  2I5U A;  2H27 A;  2DJI A;  4P96 A;  2JUC A;  4C3H J;  4XRS G;  2HQR A;  2DOF A;  1QGP A;  4U7D A;  5M5W J;  3BG9 A;  4U0Y A;  1J5Y A;  2M7A A;  4HAM A;  1QHH D;  2EV0 A;  2J5P A;  4Z6Y A;  1W36 C;  2R7S A;  2JJ7 A;  3ZPL A;  1LVK A;  2NS7 A;  4EV0 A;  3NQO A;  2D1H A;  4ETS A;  4G7Z F;  3CJQ B;  1A6I A;  1WPK A;  3DU5 A;  4EM0 B;  2ZNY A;  3FXK A;  2IA0 A;  2DK8 A;  2HR3 A;  1HC8 A;  4RAZ A;  4BGD A;  2OBP A;  4XID A;  1K78 B;  5LGT A;  3F6V A;  5GPA A;  5LEJ A;  2JPB A;  4I98 B;  3DEE A;  2VLA A;  1PP7 U;  3HXL A;  2CRG A;  3LFK A;  3TW7 A;  5K7H A;  2IAI A;  1JT6 A;  2HYF A;  2RVC A;  3QYF A;  5J47 A;  3FMQ A;  1BR4 A;  2JPC A;  3KP4 A;  3G2B A;  5BMZ A;  2LBF B;  2AS5 F;  3GVA A;  5EEA A;  1FP1 D;  2O5R A;  5J1U A;  3RPU D;  4KMF A;  4D7M A;  2L7F P;  2W85 A;  5E17 F;  2YU9 J;  4RM2 A;  3E7L A;  3HOV J;  5E3O A;  1YX3 A;  1NG7 A;  3CTA A;  2RV8 A;  1SFO J;  3S1Q J;  4UUS A;  3FZV A;  1R1T A;  2OU2 A;  2P6S A;  1TW3 A;  1X3W B;  2JA2 A;  1LFP A;  3M1C A;  3EET A;  2VB6 A;  3G71 I;  3AG1 H;  3N4M A;  4AVP A;  2A6T A;  1E2X A;  1XSX A;  3CJR B;  3H9J A;  3RPU A;  1X1P A;  2EZH A;  2K5C A;  3R61 A;  2GQQ A;  2K40 A;  5EDN A;  3GFI A;  2E7W A;  2FQ3 A;  2B0L A;  2EIJ H;  2ZME C;  2W82 A;  4B4C A;  1Y1V J;  1IXR C;  3MWM A;  2IA2 A;  2P4W A;  1E3P A;  3LSR A;  2A6H F;  3QYE A;  4PK4 A;  1ZRD A;  3BPV A;  5HOD A;  3CCM I;  3CZ6 A;  3RZO J;  2R7U A;  2STT A;  2BYV E;  1D1C A;  2STW A;  3KP6 A;  1ON1 A;  1U78 A;  3HGY A;  3HTS B;  1FPQ A;  1N77 A;  1WCM J;  4A3J J;  3L9F A;  4LIV A;  1WFX A;  2P7C B;  4ZYD A;  1TWA J;  2CJJ A;  5LEK A;  4ZTF A;  2IGM A;  3SYT A;  1TC3 C;  2FJ1 A;  3GYH X;  2QWW A;  2VXZ A;  1ETY A;  4CIC A;  2R7X A;  1RRJ A;  4Q48 A;  5ICC A;  3NWS A;  1FJL A;  4CHU A;  3K4L A;  1OLT A;  4A0X A;  5B1A H;  2OJE D;  2ZME A;  2PJR A;  2K3P A;  2O61 A;  4N4O B;  2IS6 A;  3H3U A;  1JUP A;  2X6W A;  1XPX A;  1S7A A;  3I59 A;  2FBI A;  2L4A A;  1WJD A;  1W7P D;  5GAE J;  4BHP A;  3DTI A;  1H9T A;  4RB3 C;  3ZN1 A;  3ELK A;  4DW6 A;  2I10 A;  2MD0 A;  3DBH B;  3PNV A;  2ZJQ F;  1K6O A;  2VT2 A;  3SEZ A;  3VFZ A;  2DA7 A;  5IP7 J;  1CGP A;  1LDK B;  2FE3 A;  2XRN A;  1TWG J;  5HS8 A;  5JHF A;  3EYY A;  4A3K J;  4GYG A;  3S3M A;  3RKX A;  2QQ8 A;  1QZZ A;  1SC7 A;  1MJA A;  2NVY J;  1TQI A;  2KKO A;  3PIP F;  3COA C;  3WE3 A;  3E3V A;  3R60 A;  3ZQG A;  4KN7 X;  4C3I J;  3M8J A;  1Y39 A;  3FX3 A;  3HM5 A;  3V4G A;  3KZZ A;  2FUG 2;  2IGN A;  1G6N A;  2HQA A;  2QSF X;  2VKE A;  3OL4 A;  5GAD J;  1TQM A;  4EAT A;  5E8G A;  1RET A;  2HI3 A;  4II3 A;  3G1O A;  5IP9 J;  1ZQ3 P;  4HBL A;  1YW9 A;  2YX7 A;  1BOB A;  1E3H A;  2Y9Z A;  1S5L C;  2O8X A;  3HKZ N;  4PJ0 C;  4XNF A;  2Q8K A;  4NBQ A;  2YS9 A;  3LSJ A;  3WG7 H;  4R79 A;  4Y52 J;  4RB2 C;  2CUE A;  2FSW A;  2CYY A;  2K9N A;  1GUU A;  4BYY A;  3BRO A;  3QQA A;  3ZQC A;  3N05 A;  2CSO A;  4CCM A;  2PQ8 A;  2DQR A;  1KQ9 A;  4M71 A;  1YQA A;  1UMQ A;  3C1D A;  3JRD A;  1P6R A;  4OIN F;  3BG6 A;  5EEH A;  5H6Q A;  1FTT A;  3JAM K;  1ZLK A;  3PSF A;  2M1B A;  4EM2 A;  1IGN A;  4IO9 F;  3M07 A;  3J81 K;  3OYN A;  2HPM A;  3OSF A;  5E79 C;  3VYR B;  2G0E A;  3DV8 A;  5JLW A;  1MBG A;  3QPS A;  4ZYG A;  5GAG J;  2JZY A;  3QU6 A;  3CO7 C;  1VQ6 I;  1E0E A;  3VYS B;  4RB1 A;  4I7H A;  2Z16 A;  3B6A A;  3KEY A;  3RYR A;  1MJB A;  2EIM H;  2BXY A;  4RGR A;  4NB5 A;  2KFD A;  1GVD A;  4B3A A;  4KT6 A;  3OYD A;  1ODD A;  1VTN C;  3K9T A;  4A3F J;  6PAX A;  2OZU A;  2X9D A;  4BQN A;  2P5L C;  1DU0 A;  4BS9 A;  4L9T A;  5FB2 A;  3HOZ J;  1BI3 A;  2HKX A;  5C3E J;  1OJL A;  1LVA A;  3IAM 2;  3CCE I;  2BVM A;  4E4H A;  4OIO F;  4U0V A;  1USS A;  3S3O A;  2MLK A;  2LR8 A;  3K4B A;  1TLH B;  2VQL A;  1V55 H;  2F4I A;  3K4M A;  4WF2 A;  1GDT A;  4ESF A;  4HZF A;  3PFY A;  2Y48 A;  5KCM A;  3KZY A;  2DTZ A;  1GT0 C;  1MD0 A;  3J7Z I;  1GV5 A;  1Q1V A;  3PUB A;  2DMN A;  3TO6 A;  2M9H A;  2HWV A;  2FA5 A;  4ZZL A;  5J4V A;  3RKW A;  2RNG A;  2O9L A;  3JTG A;  4HSR A;  3ERE D;  3V7R A;  1IRZ A;  4YFK F;  2WTE A;  2XAU A;  2PEX A;  1YHQ I;  2Y30 A;  4E6K G;  2IEK A;  2KP6 A;  2K4J A;  5CVI A;  3OS0 A;  2H94 A;  5BPD A;  2G9W A;  1TQP A;  2KL4 A;  1D0X A;  1FC3 A;  1MMN A;  1G4D A;  3AG2 H;  3OS2 A;  5BOX A;  2LKX A;  1T56 A;  1DPR A;  1BIA A;  3AFH A;  5KHD A;  4AYB N;  3BZK A;  3ABK H;  2DTR A;  2ID3 A;  4XN3 A;  2FNA A;  3V42 A;  1SD4 A;  2XPU A;  2QUF A;  4OOI A;  2R92 J;  3KYL A;  2P5V A;  4E7L A;  4KIG A;  3G1M A;  4L5J A;  4G7H F;  3FXO A;  4XBF A;  3FK7 A;  2K4B A;  3IV5 A;  1S29 A;  3BJ6 A;  1ZGW A;  2B9S A;  2HOS A;  3JTH A;  3L7W A;  2ZSH B;  4P9F A;  4Q47 A;  4J01 A;  3T1B A;  2IJL A;  3ZRG A;  2KZV A;  5DD8 A;  2W7N A;  4MFD A;  3RSN A;  3BTJ A;  1XX5 A;  2DU9 A;  4IPA A;  2BY1 A;  4BEH A;  5ICF A;  3BG3 A;  1I6X A;  2KT0 A;  1DP7 P;  5AIP A;  3J81 Z;  2NS0 A;  4B47 A;  3KP3 A;  1OMI A;  2QKM B;  2VJ5 A;  2EB7 A;  4X0G A;  3S3N A;  1KQ8 A;  1TL8 A;  4S05 A;  2VE9 A;  2M34 A;  1MMA A;  5B3S H;  3DLA A;  5C44 J;  1ETX A;  4MNU A;  3OS1 A;  2RKH A;  3OWT A;  5BPI A;  1X1D A;  5FRM A;  1QHG A;  2R93 J;  3KP5 A;  2V79 A;  3RYP A;  1X1A A;  2OQG A;  1TZL A;  4M3E A;  5F6F A;  4M73 A;  2E71 A;  1ETQ A;  3HYI A;  3HUG B;  4MHG A;  2K3F A;  3KP2 A;  5LLQ A;  1FMV A;  4B44 A;  4EJV A;  5FKO A;  1GV2 A;  2W4S A;  4IZZ A;  2H1L A;  2P81 A;  2VOP A;  2OCE A;  1T38 A;  2HXO A;  2ECC A;  2P8T A;  2V9P A;  1U9O A;  3PIO F;  5HS7 A;  2E1N A;  1JUM A;  2XIG A;  3J7A Y;  2NOG A;  5CVU A;  2EV6 A;  5F1J A;  1K4S A;  2PG4 A;  2K9S A;  1ZR4 A;  4R1H A;  3OIO A;  3WU0 A;  2CGP A;  5FLX Z;  3WU2 C;  2PMZ A;  4YEJ A;  2QBY A;  2Z9O A;  4Y15 A;  1A35 A;  4W1U A;  4BE1 A;  5DTD A;  5DYM A;  1K79 A;  4OIP F;  2MA3 A;  4EQQ A;  5IPA A;  3MFK A;  2BY0 A;  3N97 A;  4E7I A;  2IA1 A;  1LDJ A;  1PYV A;  3J80 Z;  1F5T A;  2FML A;  4ZYA A;  1Z9C A;  2KIU A;  3E6M A;  2FXA A;  1SD6 A;  4XLP F;  4ZDP A;  4FAS D;  1IXS B;  2L54 A;  1T95 A;  4FHT A;  4XN0 A;  1UB9 A;  1UG2 A;  4M6Y A;  4UVB A;  4JX6 A;  5TGT A;  3R0A A;  4DJA A;  3VSL A;  3JR9 A;  1P4W A;  2IGO A;  4XKC A;  4ZTJ A;  1SAX A;  2QSH X;  1WSU A;  4U88 A;  4UV8 A;  1RPW A;  4ESB A;  1W4M A;  1R4N B;  3GTL J;  1I1S A;  1Z6T A;  4NNJ A;  2ZNZ A;  5ERI A;  4A3C J;  4PCQ A;  4C3J J;  4BHB A;  1K83 J;  5IYB J;  4L9V A;  1WJ5 A;  4NQW B;  3L2C A;  2RN7 A;  4Q4Z F;  3MQ0 A;  3EUA A;  3I53 A;  2R7V A;  2CQX A;  3D5R C;  4YII A;  4FE4 A;  3HPG A;  1FOY A;  5IOZ A;  4MGR A;  2WAE A;  3O8G A;  2KPM A;  2FMY A;  3OMY A;  2EFW A;  1Y0U A;  2AO9 A;  5CVJ A;  4OIR F;  4M3G A;  2CQK A;  4A6D A;  4XKV A;  1ULY A;  2ZFW A;  3HSR A;  3KET A;  3BP8 A;  4HX7 A;  5FLV A;  2COM A;  3UNG C;  1D8K A;  4PZJ A;  3BQY A;  1YI2 I;  3CC4 I;  2ADU A;  2KRF A;  1GVJ A;  3CCJ I;  3CCQ I;  1LQ1 A;  1TNT A;  1D0Y A;  2DOA A;  2V1U A;  5HLT A;  1GLN A;  1CF7 B;  5DCM A;  4HNV A;  4IOA F;  2GIZ A;  4BAY A;  2R3S A;  2ICW G;  2PFB A;  4KIF A;  1CF7 A;  1MBK A;  5D4S A;  2VKV A;  2Y31 A;  3BJA A;  1IO2 A;  4CCN A;  4BE2 A;  2QF7 A;  2KMU A;  1AHD P;  2MW8 A;  1A04 A;  2CUF A;  2ZME B;  3K7A J;  5TRD A;  4QWQ A;  2EK5 A;  4I0A A;  3DKY A;  2DT6 A;  4Z2Y A;  3BG5 A;  3IHU A;  2N8G A;  3DPL C;  4OAY A;  4DBR A;  2ECB A;  2CFO A;  4RDU A;  1MW7 A;  2BBY A;  2CU7 A;  3DFG A;  2VN2 A;  3SZG A;  3WGI A;  1O7F A;  4ENM A;  3O8H A;  5GTH C;  5HOO A;  1VQP I;  4F93 B;  2MG4 A;  3P7N A;  1RUO A;  2ZSI B;  3KLN A;  2EWN A;  2BXZ A;  4YFN F;  3WTZ A;  5LHH A;  3FM3 A;  3FM5 A;  3ZN0 A;  3I55 I;  3BR3 A;  2CG4 A;  3W2V A;  2LDU A;  1M1E B;  5FLM J;  1I3Q J;  1XCV A;  5AON A;  4IQ4 A;  2HYG D;  1TTY A;  1WJE A;  3FKI J;  4XSZ F;  1STZ A;  2DA4 A;  2JSC A;  2FRH A;  2XKO A;  3L1P A;  1MGT A;  3GXO A;  3PQK A;  3HOY J;  5J8F A;  2ZC2 A;  1HA8 A;  1ZG3 A;  1OIS A;  5CVR A;  3WTX C;  4QLC U;  1I39 A;  2ETH A;  4PGG A;  2PJP A;  3EUH C;  1I1G A;  2XF5 A;  2RQQ A;  1FYK A;  2RGV A;  2UV1 A;  1J59 A;  3TP0 A;  1H8A C;  1MMD A;  5ILV A;  4EJU A;  2E19 A;  1FOX A;  3SFI A;  2O7O A;  3DWL E;  3ZQ7 A;  2R5Y B;  3FWE A;  3E5U A;  2OC6 A;  4BQA A;  2KIM A;  3E5Q A;  1IN4 A;  3WHB A;  4HEA 2;  5M3M J;  1FTZ A;  2FQ4 A;  3F8M A;  3SXY A;  3DKW A;  4V19 K;  3CUQ C;  2FU4 A;  2MBF A;  3PM1 A;  1MDM B;  1REP C;  2VBZ A;  5HLG A;  4X6A J;  2X1D A;  1YRN B;  1UAA A;  2PLY A;  1IXC A;  3AL0 B;  2R7Q A;  4IJA A;  1FYM A;  2DMQ A;  4C2M J;  2BY3 A;  2EZK A;  1VFC A;  5LRS A;  1WJA A;  5E3M A;  3JRH A;  1VQL I;  1BBY A;  3S2H J;  5F0C A;  2K85 A;  2ZXW H;  4CCL A;  2ACJ A;  2HDC A;  3PQJ A;  3NAR A;  3Q0V A;  4G6D A;  1UST A;  1N78 A;  2H8R A;  5DUI A;  2R7W A;  4DYQ A;  1KQ0 A;  1MIJ A;  2R5Z B;  1VQM I;  4N9I A;  3OYK A;  2AHQ A;  4CCK A;  2ZJR F;  3HZJ A;  1LNW A;  5JVG F;  1ZH5 A;  4ENN A;  1ZYR F;  4NUB A;  4JOM A;  2OCC H;  2X1C A;  4I76 A;  3GTJ J;  1H9G A;  2WV1 A;  4Y4R A;  4GO1 A;  3IKV A;  3K1N A;  3HL2 A;  3BR5 A;  3K2A A;  1Z05 A;  2HU9 A;  4RLF A;  1TBX A;  1YX5 A;  2B7E A;  3OIP A;  1OPC A;  2PBI A;  4AVZ A;  3IWF A;  1VQK I;  3RZD J;  2X1E A;  4XKB A;  2JT1 A;  4JP0 A;  3DP7 A;  1L3L A;  1EF4 A;  4MFE A;  4LFU A;  3I9V 2;  3E0J B;  4ON0 A;  1O3T A;  2DBB A;  3CMM A;  4IXA A;  1WH5 A;  1P4X A;  5JR3 A;  1Y6I A;  2QLZ A;  1WJC A;  1LE8 A;  1ETW A;  3KZI C;  2LD5 A;  3RQI A;  4GYI A;  2MH2 A;  1B72 A;  3KCC A;  4M3B A;  2K9Q A;  2EPF A;  3HHH A;  5KAF C;  1ZG5 A;  1XB4 A;  5L3G A;  2EFP A;  2GA1 A;  2F2E A;  4UUT A;  1B59 A;  1UHW A;  3L2R A;  1IUY A;  2Q1Z B;  2IS1 A;  3FXM A;  2K9M A;  1D1A A;  3X2Q H;  4XR6 A;  3LL7 A;  1WHU A;  3QPH A;  4JX5 A;  2DOE A;  1ZG1 A;  5F27 A;  3D0S A;  3S8P A;  3ZMZ A;  3AG4 H;  1P7J A;  4CYC A;  3HRU A;  2PMZ N;  5KK1 A;  4EM1 A;  1B9N A;  1R23 A;  4HDU A;  2XPW A;  3SHF A;  4EJW A;  2R7F A;  3FXL A;  1PUF A;  5JFR A;  3OY9 A;  3P9I A;  1O4X A;  2XSD C;  3ABL H;  1ZTR A;  5F64 A;  1SD7 A;  1JGS A;  3VPR A;  3ASN H;  2VI6 A;  4XOR A;  2PMH A;  3JSP A;  2ID6 A;  5EJC A;  1R22 A;  2G7U A;  1FBU A;  4HG2 A;  1J2X A;  1MJ9 A;  1TWH J;  1YS6 A;  2V4J C;  4IEJ A;  3W6V A;  4MEX F;  2BVL A;  2BY2 A;  3CC2 I;  3G4S I;  2TCT A;  1BC7 C;  3H3Z A;  2L9R A;  2LMD A;  3K4K A;  2JVH A;  2IW5 A;  1GHC A;  3PO3 J;  1AWC A;  4IX7 A;  1U9N A;  1QA6 A;  4DQ2 A;  2ME0 A;  5D8L B;  3H92 A;  3J7A O;  3OYL A;  1S6L A;  3Q9V A;  1EJ9 A;  1Z77 A;  1BI2 A;  2H1K A;  3JRB A;  3SJM A;  4PGH A;  3MMY B;  2DFI A;  1W7P A;  4C9Y A;  2XB0 X;  2L9V A;  3U21 A;  2LKS A;  1JJ8 C;  5JHU A;  2DA3 A;  3S15 J;  4CYD A;  5FO5 A;  2ZXI A;  4CCJ A;  3H5R A;  2J5O A;  5HS9 A;  2NXN B;  1Y8Q B;  3M1E A;  4HQE A;  5M5X J;  4BBR J;  5L3F A;  3S1M J;  1OFC X;  3ZOB A;  3MZH A;  5HDN A;  4A3D J;  1MNE A;  2F4O B;  3OYC A;  4ENJ A;  1D1B A;  3S32 A;  5D5X B;  4M9S A;  5FKL A;  3GO5 A;  5EEG A;  3TMO A;  3D5L A;  2XAQ A;  2FEZ A;  3K6G A;  3QP6 A;  4XLA A;  3IH3 A;  2JA7 J;  4LG0 A;  2QCO A;  4IL6 C;  2E34 A;  3FBN B;  1Z3X A;  1UJ8 A;  2HVQ A;  2W00 A;  1NK3 P;  3LQR A;  1KGS A;  3BQZ A;  3LA7 A;  5ICE A;  5F1R A;  1A31 A;  1D5V A;  1UFM A;  3F8N A;  3W6K B;  1Z1D A;  3G1L A;  3LSM A;  1VQ5 I;  1FSE A;  3CCL I;  3AG3 H;  2ZBK A;  1ONV A;  3P9K A;  1HKS A;  5EF6 A;  4I99 C;  2MYS A;  2B63 J;  2DDB A;  2R5Y A;  3WTS C;  5JI6 A;  3LFU A;  2IT0 A;  4QPO A;  1PP8 F;  2L7Z A;  1NG6 A;  4BY7 J;  3CES A;  1XGN A;  1TT5 B;  2PN6 A;  2LY1 A;  3BC8 A;  3OYA A;  2CMP A;  1FMW A;  2CUZ A;  3CCY A;  1ETK A;  2WY7 Q;  5LGN A;  2VPL A;  3ESW B;  2BV6 A;  1QO0 D;  2IXS A;  2Z5U A;  4AD9 A;  2F4M B;  1AA7 A;  1JKQ C;  1NH3 A;  3IWZ A;  1IRF A;  5D6F A;  3QRF F;  3GTM J;  1FOK A;  4F92 B;  3K4J A;  4J00 A;  3IL2 A;  3OOU A;  4OAZ A;  2E2H J;  2L7M P;  5FKN A;  4D5F A;  2DOD A;  2QEN A;  3W3C A;  2NNN A;  4W97 A;  3E6C C;  1ZK8 A;  2K02 A;  5F04 A;  1DGW Y;  3ASO H;  3J7Y J;  4QTR A;  2L7K A;  3T8R A;  3HIF A;  1YLF A;  3M8E A;  2GA2 A;  4N4N B;  4N9H A;  1S8N A;  2CV1 A;  3FXR A;  2VJI A;  1U2W A;  3W2W A;  2X4H A;  3WE2 A;  1FP2 A;  1X19 A;  4HF2 A;  4XRF A;  3BTL A;  3C3W A;  5K5R A;  3BZ6 A;  2ZFU A;  4IF4 A;  2QQ9 A;  5M3F J;  1K61 A;  1RKW A;  1WQ2 A;  2TDX A;  3ZQF A;  4MO7 A;  1IN6 A;  1RNL A;  2L9S A;  2KRH A;  3L09 A;  1TT0 A;  3J80 K;  1W5S A;  5JVT A;  2K86 A;  3V7S A;  3I59 B;  4HX4 A;  1WKM A;  2PMU A;  4LGW A;  4DYC A;  4WX9 A;  2R5Z A;  2KLO A;  2OV7 A;  2GM4 A;  1PUE E;  2NVQ J;  3PJR A;  3ROU A;  3JW4 A;  4F3Q A;  1S3J A;  3I4M J;  3MVP A;  4TV7 A;  3IRR A;  2VPR A;  2MC4 A;  3QPL A;  4BQO A;  3VOE A;  5EYR A;  5J8C A;  3CDI A;  1WWX A;  4OMZ A;  3S14 J;  1MNM C;  3BOQ A;  2M4K A;  1ZHF A;  4F91 B;  2ZXH A;  2HS5 A;  4LK0 F;  2XV4 S;  1OYW A;  4Y17 A;  3Q0U A;  1RES A;  1W1W E;  5L3D A;  4M6V A;  3ZR8 X;  5C4J J;  5D5V B;  1UEL B;  2FNP A;  4I01 A;  5DV5 A;  2XB5 A;  4XQF A;  3PL8 A;  1YFH A;  1N25 A;  4KFC A;  1HXD A;  2W24 A;  2QYO A;  2Y0S A;  2LRE A;  2M4G A;  4I2O A;  2LG4 A;  3ISP A;  4MQV A;  2GLO A;  1MBH A;  1FBS A;  1LDD A;  4NHJ A;  1MMG A;  3A01 B;  4BU2 A;  3LQQ A;  3JCU C;  1B6A A;  3DBR B;  2M45 A;  3RJP A;  2UWM A;  4BXU A;  3FF5 A;  2HGC A;  2XGC A;  1FY7 A;  2ESN A;  3GFJ A;  3OYI A;  2GIV A;  3DPT A;  3F21 A;  4AIK A;  4KYW A;  1AKH A;  4BXX J;  3GTP J;  1G8X A;  4XON A;  3CCR I;  1YO5 C;  3LSH A;  4RGS A;  3NWT A;  4FX0 A;  1BM9 A;  3CDH A;  1W0U A;  5DM6 F;  3W6J B; 
#chains in the Genus database with same CATH homology
 5IYC J;  1JUS A;  4M3D A;  1HLV A;  1RKT A;  2JWT A;  2JN6 A;  3HBL A;  1BL0 A;  3GTQ J;  3BR1 A;  1E3O C;  4A3L J;  2CQX A;  4FE4 A;  1MSF C;  4LOC A;  4IHW A;  5IOZ A;  2NVT J;  5EZG A;  2CQQ A;  2JA8 J;  2ELK A;  2DA2 A;  3O8G A;  2HDD A;  1F36 A;  3GTG J;  2AO9 A;  2E2J J;  1BA5 A;  4M3G A;  2JA6 J;  5EGO A;  2ME6 A;  1X2N A;  5FLV A;  4DZJ A;  1IC8 A;  3BQY A;  1F43 A;  4XIC A;  3DCF A;  2TRT A;  2FD5 A;  1APL C;  5EGO B;  1FIP A;  2WB1 N;  4HNV A;  4C3H J;  5DS9 A;  3JRF A;  4XRS G;  1W0T A;  3A03 A;  3NAU A;  5GPC A;  1MBK A;  1WI3 A;  1Z0X A;  2VKV A;  2Y31 A;  5M5W J;  1AU7 A;  3BG9 A;  2QF7 A;  1AHD P;  2MW8 A;  3F0C A;  2JJ7 A;  4ABZ A;  2CUF A;  3K7A J;  2LY9 A;  3H0G J;  2NS7 A;  2VUM J;  2OF7 A;  3PO2 J;  1P7I A;  4G12 A;  1WPK A;  1A6I A;  1QRY A;  3BG5 A;  3LNQ A;  4XID A;  3I4N J;  2N8G A;  4RDU A;  2ECB A;  5GPA A;  2CU7 A;  5K7H A;  2CRG A;  2M0C A;  3O8H A;  3TW7 A;  2IAI A;  1JT6 A;  3M4O J;  1IDZ A;  2MG4 A;  5FJ8 J;  2GBY A;  3A01 A;  3BR3 A;  5EEA A;  5FLM J;  1I3Q J;  5J1U A;  2RAE A;  4AC0 A;  3FKI J;  4D7M A;  4J19 A;  2L0K A;  2L7F P;  2DA4 A;  1JTY A;  2YU9 J;  4S0H B;  2DMU A;  3JRA A;  3E7L A;  3L1P A;  3HOV J;  3BT9 A;  5E3O A;  3HOU J;  3MKL A;  1PUF B;  3HOY J;  1SFO J;  3S1Q J;  4UUS A;  1NK2 P;  3CMY A;  1I6H J;  3Q0W A;  2HYJ A;  3SDG A;  5K7Z A;  1B8I A;  5F08 A;  4V2G A;  1FEX A;  2R7Z J;  3TP0 A;  3RKQ A;  1H8A C;  2ZB9 A;  3BR6 A;  1HF0 A;  2E19 A;  1HCR A;  3SFI A;  2EZH A;  2O7O A;  5EDN A;  2K40 A;  2R5Y B;  3JRE A;  4B4C A;  1DU6 A;  9ANT A;  1Y1V J;  1JKR C;  2YUS A;  3WHB A;  5M3M J;  3LSR A;  2FQ4 A;  3HEF A;  1LE8 B;  1FTZ A;  3H3V K;  3A02 A;  2HQ5 A;  3TW6 A;  5HOD A;  5E3N A;  3RZO J;  3PM1 A;  1D5Y A;  4X6A J;  3BR2 A;  4EEF G;  1U78 A;  1YRN B;  2DMQ A;  3HGY A;  4C2M J;  2EZK A;  1VFC A;  1WCM J;  4A3J J;  3JRH A;  5E3M A;  1ORK A;  4MIM A;  3S2H J;  1TWA J;  5F0C A;  2CJJ A;  3NAR A;  1TC3 C;  3Q0V A;  2FJ1 A;  1ETY A;  2LTP A;  2H8R A;  1VI0 A;  1FJL A;  2E2I J;  4DYQ A;  2R5Z B;  2M2E A;  2AHQ A;  4NDL A;  4RBO A;  1JJ6 C;  2WAQ N;  4FTH A;  1ITY A;  2LK2 A;  3TED A;  2W48 A;  1JUP A;  2DA1 A;  4FIS A;  4XRM A;  2LP0 A;  4I76 A;  1QVT A;  4QSH A;  3GTJ J;  4A93 J;  2WV1 A;  4DW6 A;  2I10 A;  1X2M A;  3BR5 A;  4D7N A;  3K2A A;  4B1R A;  5FKM A;  2DA7 A;  1AKH B;  5IP7 J;  3GBG A;  1TWG J;  4A3K J;  3RZD J;  1YRN A;  4JP0 A;  3OSG A;  1EF4 A;  2EBI A;  4MFE A;  2NVY J;  4IHY A;  3FIW A;  1WH5 A;  1T33 A;  3ZQG A;  1LE8 A;  5J1R A;  1ETW A;  5EG0 A;  4C3I J;  2LD5 A;  3RQI A;  1B72 A;  1OCT C;  3ZQI A;  4M3B A;  2K9Q A;  5F0F A;  3BTC A;  3HM5 A;  1MBF A;  2D5V A;  3C2B A;  4UUT A;  2VKE A;  5EZH A;  1RET A;  2HI3 A;  3G1O A;  5IP9 J;  4JX5 A;  1ZQ3 P;  5F27 A;  3FK6 A;  1VND A;  1TWF J;  4BBS J;  1LFB A;  1P7J A;  4CYC A;  1SAN A;  1U8B A;  2PMZ N;  2Y9Z A;  4BY1 J;  3HKZ N;  4L5E A;  5E3L A;  4XRS A;  2XPW A;  2YS9 A;  3LSJ A;  1PUF A;  4Y52 J;  1B72 B;  1O4X A;  2XSD C;  1NTC A;  1ZTR A;  2CUE A;  2K9N A;  1GUU A;  1IUF A;  3QQA A;  3VPR A;  3ZQC A;  2VI6 A;  3S1N J;  2MGQ A;  1MBJ A;  2ID6 A;  2EQR A;  3B6C A;  4IEJ A;  5IYD J;  1TWH J;  1UMQ A;  3W6V A;  1IV6 A;  3JRD A;  4DYR A;  1BW6 A;  2TCT A;  1FTT A;  2L9R A;  3IH4 A;  2JK3 A;  3HOX J;  3BR0 A;  1MH3 A;  2COB A;  5EG0 B;  2LFB A;  4JYK A;  1IGN A;  5K7F A;  4A3B J;  3PO3 J;  3CQZ J;  1U9N A;  3JRG A;  2ME0 A;  3OSF A;  2G0E A;  5JLW A;  3BTI A;  1MBG A;  3QPS A;  1IJW C;  1ENH A;  3UKG A;  1XS9 A;  1Z77 A;  2H1K A;  3JRB A;  3SJM A;  4V2F A;  4AUX A;  1MSE C;  2DN0 A;  2XB0 X;  1R9T J;  1JJ8 C;  2DA3 A;  3S15 J;  4M3F A;  3ZQH A;  1JKO C;  3B6A A;  2XRL A;  5C4X J;  2EZI A;  3M3Y J;  3CDL A;  2R0Q C;  3LSG A;  2EH3 A;  1GVD A;  4B3A A;  4BBR J;  5M5X J;  1HDP A;  1JGG A;  1OFC X;  2JMW A;  3ZOB A;  4A3F J;  4X1E A;  3S1M J;  4A3D J;  2X9D A;  1LFU P;  1DU0 A;  1POG A;  1BW5 A;  3HOZ J;  5C3E J;  1XG1 A;  1OJL A;  5FKL A;  1UHS A;  2MSY A;  3Q3S A;  1JKP C;  3IH3 A;  2JA7 J;  2LR8 A;  2QCO A;  1G2H A;  1GDT A;  1NK3 P;  3BQZ A;  1S7E A;  4GFB A;  2DJN A;  2DTZ A;  3G1L A;  1JTX A;  1GT0 C;  4A3G J;  2EZL A;  1GV5 A;  5EF6 A;  1Q1V A;  5BNG A;  2DMN A;  2M9H A;  2B63 J;  1FIA A;  2JA5 J;  2E1O A;  1IDY A;  2O9L A;  2R5Y A;  2DA6 A;  1I50 J;  1IRZ A;  3LOC A;  2Y30 A;  2IEK A;  2L7Z A;  4BY7 J;  3D1N I;  4A3E J;  1TWC J;  2M8G X;  3S17 J;  3IH2 A;  3HOW J;  3CCY A;  1ZR2 A;  1ETK A;  4I6Z A;  1HDD C;  5M5Y J;  2LKX A;  1T56 A;  4A69 C;  3S1R J;  1WH7 A;  1H88 C;  1QVU A;  2FX0 A;  4IHX A;  4FCY A;  4AYB N;  1JKQ C;  3GTM J;  2Y9Y A;  1RR7 A;  1ETO A;  2ID3 A;  5IOY A;  3GTO J;  3OOU A;  1ZKG A;  3JRC A;  2E2H J;  2L7M P;  2XPU A;  5FKN A;  5FKK A;  2R92 J;  4D5F A;  3G1M A;  1QPI A;  2NVX J;  4W97 A;  4QIW N;  3FK7 A;  1ZK8 A;  3IV5 A;  3WHC A;  5F04 A;  1ZGW A;  1X58 A;  4QTR A;  1Y1W J;  4MLO A;  2HOS A;  3DEW A;  4MFD A;  1JT0 A;  3BTJ A;  5J1Y A;  4CYC B;  3BG3 A;  2KT0 A;  3BTL A;  4A3I J;  5M3F J;  1K61 A;  1RKW A;  3ZQF A;  4MO7 A;  4DZP A;  2M34 A;  3GTK J;  4FE7 A;  5C44 J;  3HGG A;  2Y2Z A;  1ETX A;  2DMT A;  1OCP A;  2R5Z A;  4DYC A;  2R93 J;  2GM4 A;  1IG7 A;  2NVQ J;  4M3E A;  3I4M J;  1ETQ A;  3MVP A;  5F0H A;  2VPR A;  3QPL A;  1XC5 A;  5FKO A;  1GV2 A;  3FIS A;  2P81 A;  5EYR A;  2Y0S N;  3S14 J;  2HXO A;  2ECC A;  2OPT A;  4JX4 A;  4XK4 A;  1MNM C;  1U9O A;  1JUM A;  2DMP A;  3JRI A;  4D5C A;  2NOG A;  2X48 A;  4A3M J;  3Q0U A;  1RES A;  5F1J A;  3HDD A;  2HXI A;  2K9S A;  5GP9 A;  1ZR4 A;  4M6V A;  3S2D J;  2KDZ A;  1H89 C;  3OIO A;  5C4J J;  2X6O A;  2XB5 A;  4W1U A;  5DTD A;  2HOA A;  2LLK A;  5IPA A;  1ETV A;  4UUS B;  2XPV A;  2HOT A;  5JLX A;  1CQT A;  2GLO A;  1MBH A;  3S16 J;  3TP3 A;  5J3L A;  3A01 B;  3MN2 A;  1UG2 A;  5IP6 A;  2O8K A;  4JX6 A;  1A5J A;  4BKX A;  4IHV A;  3JR9 A;  2XGC A;  1HOM A;  3ZQL A;  2XGE A;  2DA5 A;  1RPW A;  1MH4 A;  2NS8 A;  3GTL J;  1AKH A;  2LVS A;  3GTP J;  3LSP A;  4BXX J;  4A3C J;  1MBE A;  1WGX A;  1VF9 A;  4C3J J;  1BJZ A;  1K83 J;  2IBD A;  2XGD A;  1W0U A;  5IYB J;  4Y7N J;  3HB9 A;  1B8I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...