1VF9A

Solution structure of human trf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
MEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Telomeric repeat binding factor 2
publication title Comparison between TRF2 and TRF1 of their telomeric DNA-bound structures and DNA-binding activities
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1vf9A00
1IV6A 1MBKA 2LVSA 3GTGJ 5C44J 1E3OC 3S15J 1I6HJ 4JYKA 4W97A 4DZJA 4JP0A 2ZB9A 4IHXA 1GDTA 1WPKA 1H8AC 1LE8B 2DA7A 2VUMJ 3RZDJ 1X2MA 4D7NA 2ID6A 3ZQGA 1NK2P 2LFBA 9ANTA 1SANA 1D5YA 1IDZA 4V2GA 1IC8A 1LE8A 1W0TA 2R7ZJ 1W0UA 5F0FA 4IEJA 5EG0B 2YUSA 2HI3A 2XSDC 1JKPC 1Z77A 2XGEA 4X6AJ 1K83J 3LOCA 2IBDA 2GLOA 4A3FJ 3BG5A 1MH3A 5J1YA 1PUFB 2CU7A 1UMQA 5EG0A 2GM4A 3FIWA 1FJLA 3PM1A 3RKQA 1WH5A 1BA5A 3PO3J 2OPTA 2FD5A 3O8HA 3WHBA 2NS7A 3OSGA 2L7FP 2VI6A 1CQTA 2NVXJ 2R93J 1HDPA 3S1MJ 4A3GJ 3CQZJ 5C4XJ 2TCTA 2DMQA 2L0KA 4V2FA 1PUFA 3A03A 1T56A 2YU9J 3F0CA 1IGNA 3GTQJ 2XPWA 1ETOA 4J19A 1XC5A 3S1RJ 1MBEA 3JR9A 4S0HB 5IOYA 2EBIA 2ME0A 2X6OA 2I10A 1AHDP 1APLC 4A3MJ 2K9NA 3C2BA 3QPSA 4XK4A 2QF7A 3BTLA 4EEFG 5M5YJ 4AC0A 2Y2ZA 5E3LA 4JX6A 2DMUA 5IYDJ 2Y31A 1OCTC 1ORKA 3Q3SA 3CMYA 4FE7A 5EEAA 5DS9A 1LFUP 2JN6A 4DYQA 4FE4A 2MSYA 4MIMA 3B6CA 1RKTA 2MG4A 2JA6J 4DYRA 5HODA 5DTDA 1U9NA 2HXIA 5C3EJ 4BXXJ 1GUUA 3B6AA 3HBLA 5EZHA 1MH4A 2XB0X 4A3KJ 1HF0A 1UHSA 3BR2A 3K2AA 1P7JA 1H89C 4MLOA 1TWCJ 5EDNA 5EGOA 3OOUA 2GBYA 4AUXA 3TW6A 5F1JA 5EYRA 4M3EA 2H1KA 4BY7J 1QRYA 2H8RA 1X58A 2M8GX 5GP9A 2X48A 2FJ1A 1POGA 1JKOC 3GTOJ 2ELKA 2AO9A 5J1RA 2EZKA 3K7AJ 1A5JA 4A3CJ 2XPUA 2X9DA 1ZR2A 4XRMA 3TP0A 2L7ZA 3HOYJ 5J1UA 1F36A 4A3IJ 3Q0UA 1JJ6C 3MN2A 1HDDC 3W6VA 3SJMA 3RQIA 1JT6A 1FEXA 2M2EA 2NVYJ 1JT0A 4XRSG 4A3EJ 3GTKJ 3M3YJ 3MKLA 2DA6A 1U78A 2W48A 2E19A 1GT0C 3HOUJ 1JJ8C 2DMNA 2OF7A 3TEDA 3BTCA 3ZQLA 1RETA 1FIPA 2DTZA 2RAEA 1ZGWA 4G12A 4A93J 1Z0XA 1ETWA 3IH3A 3GTMJ 2DJNA 5F04A 1MBFA 2M0CA 2HDDA 2LD5A 5FKOA 3O8GA 4M3FA 4M3BA 1VFCA 5IPAA 4RBOA 2O8KA 2EZHA 1VI0A 2PMZN 2LR8A 2COBA 4DZPA 4IHWA 1WGXA 4IHYA 2CUEA 3UKGA 3A01B 5FKKA 3S1NJ 1OFCX 1I3QJ 3IH2A 3BTIA 4A3DJ 2ECCA 1MNMC 4UUTA 3IH4A 3JRDA 2AHQA 2HQ5A 2DMPA 3SFIA 4UUSB 1S7EA 3OSFA 1H88C 5GPCA 1ETYA 5M3FJ 4C3JJ 4A3BJ 2KT0A 2VKVA 3HGYA 3HGGA 1VNDA 3VPRA 1RPWA 2Y30A 5F08A 2TRTA 2WB1N 2R5ZB 3ZQHA 3QPLA 1XG1A 5K7HA 1T33A 2DMTA 1WI3A 4JX5A 4C3IJ 2E2JJ 3GTJJ 1TWGJ 1GVDA 4BBSJ 1B8IB 5GPAA 2FQ4A 3RZOJ 1ZK8A 3BR1A 1WCMJ 2HOSA 1HOMA 4QSHA 5E3NA 2R5ZA 1TWHJ 2ECBA 1IDYA 1IRZA 2L9RA 4B4CA 1ENHA 3S17J 3BQYA 2LY9A 3LSRA 3L1PA 1AU7A 3DCFA 5F27A 1ETXA 5FLMJ 4A3JJ 1JUPA 3I4MJ 2LP0A 1JTXA 5M5WJ 3Q0VA 2JJ7A 1Y1VJ 3S1QJ 2CJJA 4D5CA 4HNVA 3BG3A 1SFOJ 2K40A 3JRCA 1IUFA 1HCRA 1I50J 4BBRJ 3SDGA 3HKZN 3ZQCA 3IV5A 1NTCA 2E2IJ 2DA2A 1FIAA 3LSJA 1BW6A 1NK3P 3I4NJ 2L7MP 4XICA 5EF6A 4QIWN 1LFBA 2JMWA 5FJ8J 1TC3C 3BR0A 3HM5A 5BNGA 4MFEA 2NOGA 3LNQA 1RESA 1VF9A 2JA8J 4CYCB 3HOWJ 2Y9YA 1AKHB 3HOVJ 1Q1VA 3H3VK 2DA5A 4BKXA 2JWTA 1XS9A 3LSGA 1FTZA 2DA4A 1ETVA 1B72B 2D5VA 3HDDA 3FK6A 2E1OA 3ZQFA 2VKEA 1WH7A 2HOAA 3HEFA 5FKMA 2HXOA 5IP7J 5IP9J 4AYBN 4DYCA 5JLXA 2NVTJ 1JUMA 2DA3A 2K9QA 2LLKA 4A3LJ 3BR6A 3Q0WA 3S2DJ 5C4JJ 3S14J 3BT9A 2Y0SN 2E2HJ 2M9HA 4M6VA 5JLWA 2NVQJ 1QVTA 3TW7A 3JRIA 3OIOA 4A69C 3TP3A 4Y7NJ 1JGGA 1FTTA 2KDZA 4BY1J 1OCPA 2JK3A 5IP6A 3GBGA 1ZR4A 4DW6A 1ETKA 3JREA 4B3AA 2CQXA 2VPRA 3JRAA 2XB5A 4L5EA 2DN0A 1RR7A 2LK2A 1DU6A 4I6ZA 3DEWA 1UG2A 3BQZA 3G1MA 1BL0A 3M4OJ 4GFBA 3S16J 2JA7J 4B1RA 1QPIA 4X1EA 1MSEC 2QCOA 2B63J 1GV5A 2WV1A 3H0GJ 4W1UA 2P81A 4RDUA 1U9OA 4JX4A 2ME6A 5J3LA 2Y9ZA 3A01A 5E3OA 1JKRC 4IHVA 2JA5J 2WAQN 1BW5A 1Y1WJ 4MO7A 1YRNB 5FKLA 2MW8A 3MVPA 1EF4A 4UUSA 1MBJA 4ABZA 4FISA 2CQQA 1P7IA 3HOZJ 3FISA 3FK7A 1JTYA 1ZQ3P 4D7MA 1YRNA 5IOZA 2EH3A 1JUSA 2R92J 2EQRA 3LSPA 3JRBA 2CRGA 2O7OA 1BJZA 1JKQC 3HB9A 4QTRA 2NS8A 1B8IA 2XPVA 1IJWC 5K7FA 2O9LA 4FTHA 3S2HJ 1O4XA 5E3MA 2MGQA 5IYBJ 1R9TJ 3A02A 2M34A 2G0EA 1MSFC 1U8BA 2HOTA 1A6IA 2N8GA 1TWAJ 5M5XJ 4Y52J 3JRGA 2LKXA 3G1OA 4XIDA 3BTJA 1GV2A 1MBGA 1X2NA 1TWFJ 4C2MJ 5K7ZA 2IEKA 2ID3A 5IYCJ 3G1LA 2EZIA 2EZLA 1DU0A 2FX0A 1RKWA 3BR3A 3GTLJ 5F0HA 1OJLA 1QVUA 3E7LA 3WHCA 1MBHA 3ZOBA 2IAIA 5EGOB 2R0QC 2HYJA 3CDLA 2K9SA 2XRLA 4D5FA 4FCYA 4M3DA 1K61A 4LOCA 5FLVA 5EZGA 4XRSA 3NAUA 2CUFA 5M3MJ 3NARA 3BG9A 1ZKGA 3FKIJ 1HLVA 2XGCA 2LTPA 3QQAA 3HOXJ 3PO2J 4NDLA 3D1NI 2XGDA 2R5YB 5F0CA 3JRHA 5FKNA 3ZQIA 3GTPJ 1ZTRA 3JRFA 3CCYA 4C3HJ 1F43A 1G2HA 2DA1A 4CYCA 4I76A 4MFDA 1AKHA 4M3GA 1IG7A 2YS9A 1B72A 1ITYA 1ETQA 2R5YA 3BR5A
chains in the Genus database with same CATH superfamily
3HRMA 4MEYF 1MBKA 4QPOA 1E3OC 3EPZA 5FFXA 2VT3A 2Y48A 4IHXA 3OS1A 1HSTA 4D7NA 2DQLA 4FASD 3FHNA 2KMUA 1S3JA 4DNCA 2L4MA 4JK1X 2Q2EB 1Z7UA 3GZNB 2LFBA 2WAFA 1SANA 4D0PA 4KT6A 3H5NA 2R7SA 5D6EA 4KISA 1TT0A 1W0UA 1ZRCA 5LD2C 1LKXA 2F2EA 5IT3A 1FOXA 3KYDB 4PDKA 4D9JA 3OS2A 4IEJA 3H0DA 2ZMEB 2OZ6A 4PFPA 3CCUI 1Z77A 4I09A 1G8XA 3KZIC 3EUKL 5F64A 3LOCA 3HSFA 2NRAC 3DU6A 2W00A 2DOEA 3IC7A 5LHGA 3HRTA 3MKYB 3BCBA 4LLLA 5J1YA 3MAJA 1N78A 1UMQA 3FIWA 3RKQA 2E35A 2FRHA 3TDUC 2HTJA 2K3PA 2NS7A 4MQ9F 3WHBA 2L7FP 2VI6A 1MGTA 3F22A 2MH2A 3F8CA 1VQOI 4NC7A 3JAMZ 2DMQA 4AIKA 3RKYA 4BDZA 3HUGA 3VODA 2IJLA 5LFAA 1MIJA 4CUGA 4YFXF 2M7AA 4N9HA 4II2A 3O3KA 1S6LA 2P5VA 2RC4A 2X6OA 3U9GA 5FROA 1RI7A 3QPSA 4HBLA 4RMNA 3T1BA 4XK4A 5J47A 3L2QA 3KLOA 2VQCA 3E6BA 4FX0A 5J40A 2JSPA 4AC0A 5E3LA 1UFMA 4IRGA 3FXJA 3PSIA 1BI2A 1ORKA 5CPRB 3CMYA 4I2OA 1V4RA 4KFCA 2JN6A 2L54A 4G6QA 2KPMA 2MSYA 4ZYEA 2Z33A 2MG4A 2OA4A 2JA6J 3HG9A 4BYYA 4ZYGA 4Q4ZF 1P2FA 2J5PA 1WJEA 3ZMSA 1R49A 1GUUA 2VB6A 5EZHA 1REPC 1D0XA 2XB0X 1E3PA 1OYYA 4O6JA 3C3WA 1UHSA 2BW3A 4BHBA 3DBRB 3CO7C 4GXOA 3PQJA 1T38A 3K4MA 1F4KA 3ZMZA 1K4SA 4RGXA 1I5ZA 1OKRA 3FXQA 3H5AA 1QRYA 1PJRA 5AONA 2X48A 5HDNA 1XB4A 3P9CA 1BR4A 2ELKA 2V26A 1JKOC 2QBYB 3QPTA 2HOEA 1B9MA 1ZG1A 1HA8A 1A5JA 1QZEA 3W2VA 2XPUA 2X9DA 2FOKA 1X1AA 3CF5F 2OJED 2EV6A 1P6RA 2HKOA 2QZ8A 4Z6YA 3HOYJ 1TBXA 2QWWA 2V4JC 3Q0UA 2JVGA 3MN2A 1A35A 2HU9A 3W6VA 2XGXA 2K86A 4OAYA 1YW7A 2YR2A 3VYSB 2QBYA 4XRSG 3QP5A 4P9UA 4U7DA 1W5SA 5B1AH 4KIBA 1LDKB 2E19A 3HOUJ 1QA6A 1YX3A 1ZG3A 4L18B 4R79A 3ZQLA 3RYPA 2Q8KA 1RETA 3CDIA 1LB2A 2CV1A 3RYRA 2ZCWA 4A93J 3L2CA 3IH3A 4DQ2A 4U0VA 5K5QA 3WTVC 3GTMJ 5F04A 1MBFA 2QGUA 2LD5A 1X4PA 2Z16A 1U8RA 2ELHA 1USSA 2VQHA 2PMZN 3FKJA 4HX7A 4QPQA 3T8RA 2DO7A 4XLFA 1T95A 4IHYA 1SMTA 3VDXA 3H9QA 1J9IA 3CMAI 3QYEA 3QPHA 1PUEE 1OCZH 1FOYA 5FKKA 5HLGA 2XIGA 1LQ1A 3S1NJ 3IH2A 2ECCA 3K1NA 4ZTFA 4UUTA 1Z9CA 2X6XA 4OU0A 3U21A 1N77A 4OMZA 1ETYA 2LY2A 3LSIA 2YPRA 2I8DA 3K4BA 4A3BJ 2D2WA 2KT0A 5GAGJ 3TDZC 2RDPA 3HGGA 1VNDA 4K2EA 4XSXF 2D45A 1W7PA 2CYYA 3OY9A 2PJRA 3RKXA 4G6DA 4ZJZA 5H2FC 2WB1N 1GXQA 4XLNF 4RB3C 4HRIA 4ZDOA 5K7HA 1Y0NA 1R4MB 2DFHA 4C3IJ 4ZTJA 1IXRC 1D8KA 2DQRA 3GTJJ 2F6CA 1GVDA 1B8IB 4AVPA 1ZARA 1Z05A 5DUKA 2Y69H 3I53A 4OAZA 1WCMJ 3M9AA 3PFYA 4N0BA 5E79C 4YFKF 2IP2A 2UWMA 2CMPA 1HOMA 3N05A 4HSTA 5E3NA 4ENMA 3OYBA 1QHHD 2W1OA 1T6SA 2L9RA 1XGNA 3S17J 1ENHA 1U2WA 1IAWA 1BR1A 4YELA 2HQRA 1D1AA 2E7XA 3SXYA 2XASA 4A12A 3JSPA 1JUPA 3OYDA 2QQBA 4F3QA 5LBQA 3P7NA 3Q9SA 5TRDA 5E8IA 3AG3H 4Q5SF 5E8GA 3S1QJ 3BPXA 4XQFA 4Q47A 4BJ6C 1FSHA 3Q9VA 3CCQI 1SFOJ 3JRCA 5HS7A 4RAGA 3OYHA 1ZRFA 5FD6A 3WGIA 1TZLA 3SDGA 1K6OA 3HKZN 2DOFA 2HVSA 2E2IJ 1CGPA 1JGSA 2LH9A 1FIAA 3HXLA 4ENKA 3ZMTA 5K5OA 1NK3P 3I4NJ 2DXIA 3EDPA 1E17A 4QIWN 5K5RA 4F55A 2XAQA 5FJ8J 3TKYA 3CCJI 1VQKI 3ULQB 5F1RA 2QUFA 2WWYA 2A6EF 1SVLA 2P5KA 4RAZA 2A5WA 1EV7A 2NOGA 3SEQA 4BQNA 3LNQA 4BU2A 2VKHA 1J0RA 3RDIA 1I6XA 3HOWJ 3I64A 1Q1VA 1FYMA 2DA5A 4BKXA 4RM2A 2PMUA 4RGSA 1FTZA 1ETVA 2D5VA 5LGUA 3C2HA 2OZUA 3VFZA 2KIMA 1WH7A 4U0YA 2DW4A 1EJ9A 4F92B 4BAYA 3EUHC 4M9XA 3I0TA 1LVAA 4F91B 2E34A 2OCEA 4LITA 2HXOA 3M07A 3WTXC 3K70D 2LLKA 2K9QA 1D1CA 3Q0WA 1X1BA 4EATA 3S14J 3BT9A 2VN2A 2Y0SN 4BDYA 1W36D 4RLQA 3FHZA 2NVQJ 4YIIA 2K5CA 3NWSA 3LSKA 3GLXA 1ON1A 1IW7F 2CQ7A 5J6XA 4Y7NJ 2VOOA 2JT1A 1U3EM 1JGGA 1HKTA 4CZZA 3F21A 5IP6A 5D5WB 2ZNYA 2AQEA 4ZH4F 3GBGA 1ZR4A 3K70C 5A2QK 1BI0A 4U7BA 3JREA 2CQXA 4L5EA 2LK2A 3M8EA 3RSNA 4EGYA 2X0LA 3OYLA 1W36C 2FEZA 4LB6B 2VLAA 2L7KA 3M4OJ 1RR8C 2OQGA 2W57A 3OR1C 1K4TA 5ILUA 3DLLF 2B63J 2M87A 1GV5A 1P9QC 2MD0A 2WV1A 1SD4A 4EJTA 2RV8A 2WV0A 4RDUA 3RPUD 4LIVA 3IRQA 4XLHA 1S7OA 2VT2A 1JKRC 3DPTA 2WAQN 3CCSI 1BW5A 2LKPA 4PSXA 2MA3A 1YRNB 3E6DA 3BG6A 2BVMA 3R0JA 1MBJA 3TMOA 2FBHA 2M0MA 4FISA 3LAJA 4RB1A 4Z2YA 4PZJA 4L0ZB 2CQQA 1QZZA 2XUBA 1MNEA 4ZC3A 2XSJC 3HOZJ 1UCRA 3TOBA 4ZZDA 3LL7A 5TISC 2K02A 4OOIA 2NYXA 4D7MA 1YRNA 4Y4RA 2CSOA 2V79A 1JUSA 5IOZA 2EQRA 5DD4A 2DPUA 2R92J 3A0BC 1KU3A 3DEEA 4PJNA 4RB0A 3I59B 1YW9A 2RN7A 1FY7A 2MH9A 3HB9A 3WE3A 4LK0F 3VYRB 1IJWC 1IRXA 4FTHA 1O4XA 4ZDPA 3I3LA 3MQ0A 5IYBJ 3F23A 3A02A 2M34A 4UV8A 1U8BA 2LBFA 2UZKA 2EFOA 1SMYF 1R71A 2IXSA 4PJ0C 1YI2I 2JVHA 1OLTA 4Y52J 3COAC 5B1BH 4II3A 2DFFA 4OIQF 1ZH5A 4KMFA 4HZFA 5J4YA 3G1OA 4B47A 5JR3A 3P9KA 3BTJA 2E5ZA 2QQ8A 3J7YJ 2IW5A 1MBGA 1X2NA 4C2MJ 3HSRA 4Y3OA 3BP8A 3G1LA 5DCMB 2EZLA 1XSVA 3K4LA 3H3UA 1B6AA 1O57A 4FQGA 1MBHA 3DF8A 3VYTB 4XLEA 3CDLA 2Z99A 3KETA 2EFPA 4D5FA 1HW2A 1XGOA 4LOCA 1IRFA 5FLVA 2F4IA 4LD5A 5M3MJ 3C2GA 3GYHX 5ERIA 5DCMA 2M8EA 1ZKGA 1FYKA 3D0SA 2XGCA 2LTPA 1WI9A 1HC8A 3QQAA 4RAFA 4Y33A 3IRRA 3K2ZA 2M4GA 4BUPA 5CLSA 4N4OB 5FKNA 3EUHA 4MTEA 2CUZA 4HG2A 3F3XA 3CCVI 2LG4A 3V4GA 3HIFA 3W2AA 1F43A 1FSEA 2PI0A 3CJNA 3WTYC 4LFUA 5CVUA 2ICWG 4M3GA 1IG7A 3FXUA 3H9JA 1B72A 5TJJA 2A3SA 5D6FA 2IGNA 2YX4A 2DI3A 3GTGJ 1OYIA 1S8NA 1I6HJ 2A68F 3BZCA 4W97A 1DPUA 4JP0A 1STZA 5FFZA 1ACIA 1GDTA 2P7VB 5FGMA 3GFIA 2ZXJA 2DA7A 3RZDJ 2JZYA 3KIOA 2YU3A 1FZPB 1LPQA 3D5RC 2BGCA 3BJ6A 1H0MA 1O3TA 1B9NA 3ZQGA 1MMAA 2E1CA 5ILSA 4I0AA 9ANTA 1YG2A 1IDZA 1D5YA 1J59A 4B3XA 1SVOA 1BOBA 4XOTA 2H8WA 4EM2A 3ABKH 5LGTA 2FU4A 1W0TA 1NH3A 2R7ZJ 2EINH 3AG2H 1QNTA 1A36A 1JHFA 5HVQC 5KHDA 1QGPA 3VB2A 1DDNA 1X3UA 2BY1A 4N4NB 2YUSA 3HOTA 5J8CA 1O3SA 2VC0A 3PIOF 2QA4I 1JKPC 1OPCA 2VBXA 3JW4A 1UB9A 2V1NA 3MZHA 4OIOF 1X3ZB 2JPCA 3DU5A 3VOEA 2P6SA 3F6OA 4LG0B 5LRSA 5BOXA 2GLOA 2ETHA 3WE2A 3OYIA 3BG5A 2P4WA 2P8TA 4BXFA 4HLYA 1MKMA 3RPUA 2K9LA 3KZYA 1SD7A 5CVVA 3CCRI 3PO3J 2FD5A 3O8HA 5GAHJ 3OSGA 3OL4A 2VONA 4I98B 3QRFF 3H3ZA 1CQTA 2DAOA 2QVOA 2NVXJ 2X6YA 2NVUB 2XC7A 1UJ8A 4EJWA 2R93J 3MKWB 3OMYA 3S1MJ 4CZCA 4A3GJ 3LA3A 3RIRA 5C4XJ 3ZGKA 3J81Z 2TCTA 2L0KA 4V2FA 4I7HA 4HEA2 1MZBA 1T56A 3DBLB 5FRNA 3F0CA 3GTQJ 2XAUA 2XAHA 2XPWA 1IV8A 1XC5A 1WJBA 3WG7H 3HPHA 3S1RJ 4NB5A 1MBEA 2W7NA 3K4NA 4NNJA 3GO5A 3C18A 5EEGA 4ETSA 4F93B 4RM3A 4N9IA 4A3MJ 3BOQA 3ZQQA 4LG3A 3L09A 3LAPA 2FNPA 2F4OB 2BV6A 5DM7F 2M4KA 2IPQX 3BTLA 3CESA 5H6RA 5KCMA 1FBQA 5IYDJ 1HW5A 2DMUA 2WB1A 3P9IA 2VC1A 2RQPA 4WXCA 5IT9Z 2EFQA 3F8FA 1OCTC 3Q3SA 4FE7A 2PBIA 5EEAA 1J2XA 4P9FA 3G6EI 4DYQA 3RJPA 1AA7A 3S2WA 3B6CA 1RKTA 3I71A 4C30A 3EYIA 3J7AO 1VQLI 2R4GA 4E7JA 2HXIA 4G94A 3K69A 5CVRA 4HSRA 1HBXG 3WGGA 2EWNA 1MH4A 1PYVA 2PEXA 5HLIA 4G7ZF 1E2XA 3E5UA 1P7JA 1TWCJ 5EDNA 4RS8A 5EGOA 3EUAA 3OOUA 3G4SI 2ZNZA 4AUXA 3OYKA 4NUBA 5F1JA 2IA0A 5EYRA 4A0ZA 4BEHA 3GZ5A 1LJ9A 2ZSHB 4OWRB 5D5UB 3RCOA 3HRUA 3IAS2 2KKOA 2W4SA 2AO9A 5J1RA 5JVTA 2V6CA 1F9NA 1ZR2A 4XRMA 3IWZA 3TP0A 2L7ZA 4HF2A 2OD5A 5J1UA 1TLHB 1F36A 4A3IJ 2K3FA 1P4WA 3CP8A 2WTEA 3I5UA 1QO0D 3GUDA 2E60A 2FOWA 2E71A 1B1BA 1JT0A 1TW3A 4A3EJ 1ZLJA 5IY5H 3KP3A 3MKLA 2DA6A 4B8XA 1SC7A 2VKDA 2H6CA 1JJ8C 2DMNA 3DTIA 4HAMA 3BPVA 1U5TC 2HPMA 1T8IA 1FIPA 2RAEA 2IT0A 5LGNA 4AD9A 1ZGWA 4CHUA 4UVBA 4YIRX 3CMEI 2CFXA 4IL6C 1FNNA 1FX7A 2DJNA 4C9YA 4ESJA 3FXKA 3HOSA 4C2TA 1Z67A 3BC8A 5FKOA 3O8GA 3DKWA 4RBOA 3F9KA 2O8KA 2ZJRF 3DPLC 1KGSA 2GAUA 2LR8A 1TQMA 4FT8A 1PP7U 3K9TA 4DZPA 4IHWA 2Q2EA 1I1SA 2RKHA 5GTIC 1DGRM 1WGXA 1SFXA 1FWZA 3UKGA 1G3WA 4CCKA 1I3QJ 2HPIA 1EH6A 2DK5A 5CJ9A 4Q48A 1SAUA 3SFIA 4UUSB 1WKMA 1S7EA 2IGMA 2QM3A 2ZMEA 4JQFA 5M3FJ 4NQWB 1S29A 4RGRA 1Z7LA 4RB2C 2VKVA 1WWXA 2E1MB 2X1EA 1RPWA 2Y30A 3N97A 2GWRA 3V7SA 2KIFA 4DBRA 2TRTA 1X4OA 3QPLA 3L2WA 5FLXK 3JCUC 4ANJA 2LYCA 1T33A 2F5EA 2KHMA 4JX5A 2HTSA 1BN5A 5AIPA 1J09A 4BBSJ 5LEJA 3MKZA 4OIPF 3VYUB 1XGSA 4XONA 4HYEA 4MNUA 3S3NA 4XBFA 2ACJA 2HOSA 1SFUA 1L0OC 1TNTA 1IDYA 4KDPA 1U6GA 4WXHA 3BQYA 3WU1B 2B9SA 2WAQA 3DTKA 2E36A 1TP4A 4XSZF 1ETXA 5FLMJ 1FPQA 1USTA 4EQQA 3ERMA 2ELJA 2AQFA 3HJEA 4BS9A 4BE2A 3Q0VA 5B66C 3CLQA 2JJ7A 5E1XA 2CS3A 3ESWB 4G9YA 2STWA 4HNVA 2K40A 1HCRA 5CYVA 1XMAA 3S8PA 3IV5A 3MZ8A 3GFMA 4FX4A 2OBPA 1WJFA 4GCVA 2FBKA 2X6WA 2LC2A 2VOPA 4PJMA 4EM1A 2JMWA 3BROA 3OL3A 3T5XA 4IPAA 4AWXB 4GYIA 5BNGA 1QHGA 2HFHA 4MFEA 3EYYA 1KQ9A 1RESA 4HX4A 4EVIA 2KL4A 3TGNA 4CYCB 2Y9YA 3NRVA 1AKHB 3HOVJ 1D1BA 3H3VK 2JWTA 1X1DA 1U5TB 2DDAA 2DA4A 3RPQA 1SFEA 2BY2A 3HDDA 3FK6A 4YRVA 2BY3A 5TGTA 5DD8A 1Q1HA 3RI4A 3PUFA 2HOAA 4KN4X 5L3FA 3N4MA 4IZZA 2KRFA 3GZ6A 2NVTJ 3ZMUA 2DA3A 2WY7Q 5E18F 1KYZA 3AKZA 3ZR8X 2OUMA 3U1DA 4UXNA 4M6VA 3KP7A 5JLWA 1QVTA 3OYAA 4M74A 3HPGA 3TW7A 1YW8A 1KZHA 4JBAA 6PAXA 2VJ4A 2O03A 3NWTA 5ICGA 1Z6TA 5JFRA 2Q1ZB 2GQQA 4H0EA 2KDZA 4UV9A 2A5YB 3X2QH 1K6YA 4XLPF 3D5LA 3SZPA 2EJRA 3VSLA 4G6TB 1ULYA 2XB5A 3OR2C 4PJLA 1G3TA 2MYSA 2DN0A 2H27A 1VQ8I 3W6JB 1TQPA 2R7UA 3J81K 3H5RA 2R7TA 3BQZA 3DBHB 4BH9A 2EPFA 2DYRH 4B1RA 2JA7J 2COMA 2P81A 3DQVC 3GCMA 1U9OA 1R22A 1MNDA 2ME6A 4KITB 1R5HA 1MJBA 5J3LA 5JHFA 3E6MA 4FHTA 3DKYA 4IHVA 3KEYA 1S72I 2STTA 3PSFA 1R5ID 2AS5F 2MW8A 2ZXIA 2OU2A 3WU2C 4ON0A 5IT9K 5LRRA 2RGVA 3Q5FA 3J7AY 4CCMA 3R61A 1BM9A 3WTWC 4CICA 4NHJA 3OYJA 1P7IA 3PL8A 2GA2A 3FWEA 3OIQA 1JTYA 2LREA 4BNCA 3LSPA 3K4JA 3QOPA 1KYWA 1I1GA 3JRBA 1BJZA 2BYVE 1B8IA 3OOPA 3GFJA 2KIQA 2MGQA 2ZC2A 2NNYA 3G73A 1R9TJ 1HW1A 1FT9A 2QLZA 3LSMA 2Z3YA 3K10A 3OYCA 2HVRA 1MJAA 3BCAA 2K9MA 4NC6A 1ZHFA 1GHCA 4BJ5C 2DK8A 2DCEA 2Z1DA 3ML6A 2I5UA 3M1CA 5CVIA 5K7ZA 4HV6A 1BBYA 2EZIA 1DU0A 4HDVA 3PNVA 2O0YA 2EA2A 3GWZA 3BR3A 3GTLJ 2K4JA 1OJLA 1OMIA 1QVUA 1OISA 2GOMA 3NEUA 4IXAA 3WHCA 2IAIA 1XMXA 4U88A 2IA2A 1IZ1A 2K9SA 4TV7A 2QKLB 4B44A 2EB7A 4M3DA 1T39A 2LNBA 3L2VA 3NAUA 3NARA 4R8HA 4KUMA 1M1EB 5KNLA 1FP1D 2E1NA 3UNGC 2FQ3A 2XVCA 1O7LA 3HOXJ 4NDLA 3HYIA 3D1NI 3IP4B 4HPQA 4E4HA 1RC9A 2CW8A 3JRHA 1KU2A 5LHIA 3GTPJ 2BHYA 2ZXWH 1YJWI 3HL2A 3U1KA 4WWCA 4IQJA 1B4AA 3PQKA 2WBMA 2VODA 4XKWA 4CXFA 4M6YA 4MFDA 2OTJI 1IRGA 1SD5A 4KA4A 2CQNA 1YO5C 1ITYA 5DDGA 3CCEI 4BQOA 1DP7P 4D5CA 3LA7A 4IF4A 1IV6A 2G7UA 3F6VA 2LVSA 1UAAA 2JUCA 3WODF 1QBJA 3S15J 1XN7A 4JYKA 1G4DA 2R7DA 2ZB9A 1KQ8A 1R7JA 5D5VB 2R7QA 2G7HA 2F5FA 1LE8B 5B3SH 3KZZA 2PJPA 1LNWA 3WTUC 2ID6A 1RUOA 4P96A 4LB5A 1TTYA 2HQAA 1G59A 3JAMK 1VQMI 1Z21A 1SFKA 3ECHA 2ZXHA 2V1UA 3R60A 4V2GA 3V8JA 1LE8A 2LOOA 2EILH 5D8KB 2DFEA 5JI6A 1MMGA 2A61A 2QSFX 3FF5A 3W3CA 1T08B 5F0FA 5EG0B 2XHKA 2XSDC 3LSHA 2R7RA 3E5QA 2JUGA 2CO5A 2IBDA 4E7IA 1IF1A 1H9GA 1D0YA 3HSEA 4A3FJ 2VIXA 4A0XA 1D8JA 2ZJQF 5B5EC 2R7VA 2ZFUA 1MH3A 3EQLF 1QZYA 4GYGA 3QYFA 5EG0A 2VJIA 1WZ2A 3TO7A 3PM1A 1KQ0A 1WH5A 3KEQA 3WGHA 1YHQI 4BACA 2EK5A 4F52A 3OV8A 3FDYA 3V8KA 4I99C 4XN3A 1HDPA 5HNFA 3CQZJ 4YIFA 2VE8A 2UV1A 3ZQ7A 4OINF 1HKSA 5D8LB 3A03A 3OYMA 2YU9J 3ABUA 1IGNA 3H9GA 5FD5A 2C6YA 3F8BA 4J19A 2VBZA 4BE1A 2BHZA 5CQGA 1SVMA 2UUZA 4S0HB 2VBWA 5IOYA 3JR9A 1YOVB 1XPXA 4LIUA 2DFIA 2I10A 3I59A 1GXPA 1APLC 3L2UA 1R1VA 1XGMA 4MTDA 2VJJA 4M9ZA 2QF7A 3H35A 5M5YJ 4J00A 5HS8A 3KE2A 1WJCA 3CC7I 2FE3A 3KP2A 2Y2ZA 4JX6A 4HQEA 1EA3A 2Y31A 1TL8A 3V42A 4IKFA 2H1LA 4O3MA 4IRIA 1J5YA 1LFUP 4ESBA 5JVGF 2CV2A 5L3EA 4DYRA 2Z9OA 2NXNB 2GA1A 5DTDA 3H36A 4J01A 1JXSA 5C3EJ 4IQ4A 5F6FA 1YS6A 3HBLA 2V7FA 2MLGA 4LMYA 1HF0A 2B0LA 4BJTA 3BR2A 3K2AA 4I0BA 1H89C 3IHUA 4MLOA 1XCBA 4PFOA 5CQEA 2BE5F 1A6QA 2GBYA 3TW6A 5FO5A 3R6SA 2JRMA 2H1KA 2G9WA 1MDMB 2ESHA 2H8RA 4LLNA 2LRDA 1X58A 2M8GX 1FLIA 1R4NB 2FJ1A 1POGA 1DQUA 2AXTC 2W82A 2VQLA 1N75A 4XL9A 3I56I 1KA8A 3C7JA 2QENA 4HLXA 4HDUA 4A3CJ 1ZAOA 2M1BA 4M6XA 1AOYA 3BY6A 4Y13A 2QEXI 3L7WA 4Y17A 1SEUA 4HX8A 3BJAA 3QWLA 5BPDA 2KJBA 1MDMA 3FMQA 5HDKA 3SJMA 3K1PA 5HOOA 1JT6A 2HDWA 2KISA 1YQAA 1FEXA 2M2EA 3E6CC 2PG4A 2HEOA 3GTKJ 3M3YJ 4XRFA 1U78A 3DXJF 2BEOA 1ZN2A 1BC7C 2KQRA 2KZVA 2V9PA 2QSHX 1ONVA 2OF7A 3GW2A 3BTCA 3MZYA 2Z5UA 3DPUA 4ZDLA 1Y39A 1IN4A 1Z6RA 4CA0A 2M45A 4KN7X 3AG4H 2BXZA 3TO6A 1ETWA 2BY0A 2RREA 2M0CA 4U0WA 2DYSH 3WTTC 4M3BA 4M3FA 4WXDA 1FMWA 2EZHA 2L9VA 2ZKZA 1VI0A 2VBYA 2R7FA 5E1ZB 4GGGA 5EEHA 3S3OA 1F1ZA 4LGWA 1BC8C 2CUEA 4M9SA 3A01B 3CCLI 3SDBA 3ZCOA 5ICEA 5K1YA 3BTIA 5GTHC 1MNMC 3IH4A 5BS6A 2AHQA 1WRJA 2HQ5A 2DMPA 4OMYA 2L02A 3ABTA 1FYLA 2Y75A 1H88C 5ICCA 2RNJA 3CDHA 1ZGJA 5GPCA 3E97A 2DODA 3DWLE 3HGYA 2PMZA 2E7WA 3PNTA 1IN7A 5F08A 4LG0A 1YTYA 2KDOA 2R5ZB 2W84A 5L3DA 1ZG5A 2K85A 2DMTA 1WI3A 2R7XA 3QODA 1XX5A 1WJDA 1D5VA 2CGPA 1N25A 4ESFA 5GPAA 4XKCA 2E1MC 2A05A 3BJOA 2H09A 4QSHA 2R5ZA 4E7SA 1TWHJ 2K7LA 2ECBA 1CF7B 1IRZA 3AG1H 3ISPA 2WAEA 2QQAA 4B4CA 2V9KA 1S5LC 1IN5A 1O3RA 2HS5A 3LSRA 1S7AA 3L1PA 5DUIA 1AU7A 3CUQC 4QWQA 3ERED 2CV0A 4AIHA 2LP0A 2UXNA 1JTXA 2GIZA 2DBBA 3OYNA 1CF7A 2DOAA 4KT5C 4PJJA 1Y1VJ 3CTAA 4IOCF 4ENNA 1Z3XA 3BG3A 4XM3A 2F5DA 2OCCH 4BBRJ 2CUJA 1WJ5A 1L3LA 1OCRH 3ZQCA 4HA8A 1IUYA 3K4CA 2IGKA 4CDGA 1XSDA 3SZTA 3LQRA 3AL0C 1BW6A 2HYGD 4MGRA 3GVAA 2L7MP 3C1DA 4EJVA 1EKEA 2YX7A 3KX2A 4KICA 3BLYA 3W6KB 1IXSB 2PQ8A 4RGUA 4L0YB 4G8XA 4IO9F 2KRHA 3ROUA 4DOZA 5D4SA 1K78B 3BDDA 2Q0OA 3KP5A 1XS9A 4BE0A 1UELB 3HKZA 3T0YA 4A6DA 4AM3A 2Y0MA 3ZQFA 2E1OA 2LF8A 2OTLI 4BQAA 2W24A 3GEZA 4U87A 1R58A 1XSXA 5FB2A 5FKMA 2JQ7A 3IL2A 2H6BA 4AYBN 2PMHA 4DYCA 1JUMA 3QAHA 3F8MA 3CCMI 4A3LJ 3BR6A 1W5TA 1O3QA 3S2DJ 4UUVA 1HKQA 3ASNH 5C4JJ 2M9HA 3UR3C 4E7ZA 3K6GA 2P5LC 1HXDA 3HHGA 2R7OA 1P4AA 1P4XA 2K4BA 1FBUA 3JRIA 3OIOA 4A69C 2GIVA 3A4CA 3TP3A 5JHUA 3B02A 1A31A 4H4KC 1XD7A 3ZMDA 1E0EA 4BY1J 1OCPA 2IS6A 1X1PA 2VXDA 3V7RA 3FBNB 1U0JA 4DW6A 2VPLA 4PGGA 4ZYDA 3LA2A 3WG9A 3KYCB 3VSKA 1DU6A 4KYWA 4A0YA 3F72A 2JRTA 1DP3A 3U2RA 4I6ZA 4PSWA 1X3WB 3DEWA 3L2RA 1EH7A 1BL0A 3G1MA 4HOBA 1YFHA 2Y0SA 3I54A 3S16J 1UHWA 1QPIA 3KCCA 3NQOA 3G71I 2L9SA 3H0GJ 2GOXB 1V5GA 2XDVA 1YITI 1WVRA 4P1WA 4ITVA 4JX4A 2XAJA 3V8LA 3SYTA 1Y56A 5E3OA 2R3SA 2YSRA 3FM5A 1W7PD 3ONQA 1QQIA 2ZJPF 4L5JA 2JA5J 2F5VA 3PUBA 1G6NA 4E7LA 4MO7A 5FKLA 1PDNC 3MVPA 4UUSA 3GX4X 4ABZA 4NQWA 1ZYRF 3CUQB 2DJIA 1NHAA 2KIUA 2KJCA 3HUGB 4UVAA 3FISA 3J7ZI 2WY8Q 3RTRA 4DJAA 1ZQ3P 2EIJH 5A2QZ 4G7OF 2EH3A 2MD5A 2HR3A 2A6HF 2O7OA 1KONA 2CH0A 3FX3A 1VTNC 1JKQC 3DEUA 1E3HA 1IO2A 2NS8A 2XF6A 3CUQA 2XPVA 3K1MA 4BQQA 3BWGA 4QTRA 5K7FA 2O9LA 3S2HJ 4XOPA 2WC2A 4EMSA 1Z1DA 1DUXC 1V54H 2G0EA 4DIQA 3AL0B 2MBFA 2MLKA 4BHCA 2HOTA 2MC4A 3KP4A 1TWAJ 2MC3A 4E7KA 1FBSA 1R5GA 4B48A 2IS2A 2HDCA 3L9FA 2HQNA 2GZWA 4WF2A 3IUOA 1WJAA 1TWFJ 2R7WA 5GAEJ 2IS4A 2O3FA 1J7KA 2Z2SB 4GDFA 1UG0A 2IEKA 3FBIB 2LKSA 2ISYA 1EH8A 2BW3B 2FX0A 2NOJB 3KEOA 1YYVA 5BPIA 1VQNI 2MABA 3ZOBA 2DLLA 3JTGA 1YS7A 2VJ5A 3DLAA 5HDGA 4BHPA 2HYJA 2VASA 2XRLA 1BJAA 2WA0A 3M7GA 2DTRA 4HV5A 3PNYA 5EZGA 2W25A 3DFGA 1ZELA 4NBQA 4A6EA 3I58A 3T8TA 4R1HA 3BG9A 2VE9A 3FKIJ 1HSJA 4XN0A 1HLVA 1R00A 3ABMH 4E7HA 2NNNA 3DKXA 3ZRGA 5LEKA 2XGDA 1MW7A 2R5YB 5F0CA 2OAZA 3HC7A 3ZQIA 1JE8A 2GXBA 3JRFA 2IS1A 3E0JB 2FBIA 1G2HA 1TNSA 3KP6A 1XDUA 2BXYA 1VQ7I 2A07F 1KU9A 1OQYA 4CYCA 1AKHA 2EFNA 1U5TA 1K79A 4FETA 2IRFG 1ETQA 2FUG2 2KZGA 1I27A 2R5YA 1LEAA 1LEBA 5C44J 4LLGF 2D1HA 4CCLA 5CKTA 2VL8A 2XROA 4DZJA 1RIOH 2X4HA 5L3GA 2X51A 1WPKA 2L3DA 4AIJA 1H8AC 3H1CA 3DV8A 4CSWA 3MMYB 2VUMJ 1T0FC 3MD2A 3OWTA 3FXMA 3S3MA 1X2MA 3OYGA 1FOKA 2MFZA 3A1YA 2O6GE 3WTSC 2L01A 2DU9A 2BBYA 3M1EA 2UXXA 1NK2P 3I9V2 4S05A 1YJ9I 4WCGA 3V7CA 4KIGA 3G3ZA 3ZPLA 2QQ9A 2XF5A 1IC8A 4L9NA 1YIOA 1XMKA 3E3VA 4XORA 3E1SA 4G7HF 2JTVA 3CD6I 3P5JA 2ADUA 1TT5B 3O2PE 3KYLA 1B59A 3PFIA 2HI3A 5EJCA 2XGEA 2X1CA 3RKWA 1MMDA 4P5OA 4X6AJ 1BR2A 1K83J 3VWBA 2XAGA 1W7PB 3L00A 2HZTA 2PJRB 3S93A 2GXGA 4Y15A 1PUFB 2CU7A 2GM4A 3K4KA 1FJLA 3FM3A 1BA5A 2FXAA 2OPTA 4PGHA 2QSGX 1GLNA 4KJZA 3QU3A 4XKBA 1VQ6I 3ABLH 1MD0A 1OCOH 3RQ4A 4KIFA 2V1XA 1ON2A 1SD6A 1ERDA 2KLOA 4B43A 2OV7A 1YJNI 2DDBA 1Y8QB 3GFLA 4GRIA 2FMYA 1PUFA 3AAFA 3EETA 1C0WA 1T98A 2TDXA 1ETOA 2XV4S 2WADA 5CVJA 1UHMA 2X85A 5DV5A 3ZP5A 2CFOA 2P0WA 2EBIA 3O6BB 2ME0A 2LSOA 1AHDP 2J5OA 3MWMA 2K9NA 3C2BA 5E1WA 1Y0UA 1LDDA 2FF4A 4EEFG 2NAZA 2O8XA 3CJRB 3ZMVA 1V5FA 1S9HA 3CLOA 4EV0A 4YG2F 1D0ZA 5DS9A 3MCZA 4FE4A 4MIMA 3F8NA 3I4PA 1RUNA 3CC4I 5HODA 2JPBA 1U9NA 4C2UA 2V9VA 4BXXJ 1J75A 1P92A 3B6AA 4LK1F 1DGWY 2RVCA 3D5SC 3TL4X 2KFDA 4WK8F 4A3KJ 3FXLA 2QYOA 2ZFWA 4YFNF 1Y6IA 2F4MB 3SEZA 5E17F 1RNLA 2GXAA 4M3EA 4OIRF 4B09A 4BY7J 4CCOA 5ILVA 2EA4A 5GP9A 2CW7A 3GTOJ 2O5RA 4D1QA 2EZKA 3QYBA 1W1WE 3A2KA 3K7AJ 5DYMA 2IGOA 3BZKA 3ZXSA 1W5CC 3CZ6A 2FNAA 3CP2A 4A2UA 1JJ6C 1HDDC 4IHSA 3RQIA 4BXUA 1HQCA 2NVYJ 2XKPA 5GADJ 2OQRA 3CJQB 1Z3YA 2W48A 4ZYAA 1T0FA 4HQMA 5D5XB 1GT0C 2ZBKA 4UB6C 2A6TA 2HKXA 3HTSB 3TEDA 2PX9A 3OIPA 1R36A 2DTZA 5L3BA 4XLCA 2XF7A 4DBQA 4G12A 3E5XA 4BGDA 4S04A 2LMDA 1Z0XA 4IOAF 3HHHA 4EM0B 3J80Z 2ZJ2A 3ELKA 3SFZA 2HDDA 4XMYA 1VFCA 3FXOA 5IPAA 3FMRA 2ZSIB 2L4AA 4UY8I 3K0LA 2COBA 4RLFA 3ZN0A 1TQIA 3JTHA 3JSOA 2LF7A 4AYBA 5LHHA 4CGZA 3SZGA 1OFCX 2W85A 4A3DJ 3QOEA 3I55I 2ISZA 1MJ9A 4WX9A 3JRDA 3ECOA 3H92A 3OSFA 2V1DA 4C3JJ 1QPMA 5ED4A 1FOWA 1UZCA 4O5VA 2CW0F 4L9TA 3VPRA 3HZJA 3LQQA 4E6KG 3KPHA 3ZQHA 2M7BA 2HVQA 4PUSA 1XG1A 2M30A 4IRHA 5L3CA 1RRJA 1H9TA 2AXLA 1D3YA 3CJTB 4ENJA 2E2JJ 2EV0A 2A69F 4A5MA 5HLHA 1FP2A 3LWFA 1TWGJ 1LUJB 2FQ4A 5AIQA 5J4VA 3RZOJ 1ZK8A 3BR1A 2DT5A 5DCFA 1AWCA 4AU7A 4GO1A 4HNTA 2LBFB 1QU3A 1V3FA 4YEJA 1R1UA 2LY9A 2XRNA 4ZYHA 1I3AA 3DCFA 2F48A 4M73A 5F27A 3QP6A 4CCJA 2EV5A 4A3JJ 4UNOA 5J8FA 3I4MJ 5M5WJ 2DT7B 2L5QA 3TQNA 1NG6A 2LY1A 3TBIA 3R0AA 3KLNA 4F7ZA 1FMVA 3A0HC 2CJJA 3OYFA 3OS0A 4V19K 3CO6C 1OR7C 1IUFA 4PCQA 4PK4A 3MEXA 4NC8A 4IX7A 1I50J 5HNHA 5FLXZ 1NTCA 2VXZA 1Z91A 2DA2A 2QKMB 4KNYA 3WTZA 1BIAA 3LSJA 2DT6A 4RA2A 1Y8RB 4XICA 2IA1A 3R4KA 5EF6A 1LFBA 1TC3C 3DTEA 4HW0A 3BR0A 3HM5A 4DGWB 1X19A 1R23A 1ZREA 2KP6A 2PN6A 4CCNA 1VF9A 1W4MA 5FRMA 2JA8J 2D1VA 1IXCA 5BQTA 3M8FA 1ZGAA 3LSGA 4UHTA 1V5EA 1YX5A 2XKOA 1BI3A 1B72B 5DM6F 2EFWA 2V6EA 2VKEA 4XR6A 4QLCU 5KAIC 2HZDA 3HEFA 2BOLA 2FA5A 2NS0A 5IP7J 2CQKA 5IP9J 5JLXA 3S32A 4UVCA 3W2WA 2M3AA 4I01A 4BL0B 3HRSA 1XTAA 4A5NA 3AFHA 1JHHA 4E70A 2E2HJ 4CYDA 4JOMA 3FMSA 4EJOA 2HWVA 3CUOA 4CO8A 1VQ9I 3GF2A 2ESNA 1FTTA 5KK1A 2KRCA 3ASOH 4IJAA 1V55H 2JK3A 4XKVA 1F5TA 1XDSA 3PIPF 2E5NA 1WFXA 1ETKA 4MHGA 2M5WA 4B3AA 1DPRA 2VPRA 3JRAA 3LFUA 1I39A 3PJRA 1JI8A 1RR7A 1OCCH 3IKTA 1G3SA 1UG2A 3VEPA 1YLFA 4GFBA 1LDJA 3IWFA 4ASNA 4X1EA 1MSEC 2QCOA 2X1DA 2LDUA 2F5CA 3ZN1A 4W1UA 3GXOA 4CH7A 2PFBA 3CC2I 1MMNA 4MQVA 3MFKA 1A04A 2Y9ZA 3A01A 1KU7A 3M8JA 5KAFC 2BVLA 3GMEA 2BZTA 3SHFA 1VQ4I 3TO9A 2DPDA 2CG4A 2O61A 1Y1WJ 3IAM2 3G2BA 5D4RA 4X0GA 2P7CB 4IVNA 5KVRA 4M72A 5H20A 1EF4A 1X1CA 2JSCA 5H6QA 5HLTA 2JA2A 4LJZF 2HGCA 1BI1A 1BIBA 1RZ4A 3WU0A 2VQGA 4P55A 1WSUA 3GLLA 4EGZA 2ZMEC 3CF2A 5BMZA 3HTUA 3FK7A 3FXRA 3BZ6A 1XCVA 3KFWX 4HNUA 2CRGA 4I02A 1VQPI 3CMMA 3REOA 2K27A 4L9JA 3SQNA 1TW2A 1ZRDA 1BOAA 5E3MA 1OYWA 2EIMH 1YIJI 1MSFC 4HF1A 2RNGA 4XNFA 1ODDA 3DP7A 3IKVA 1A6IA 2N8GA 4XLAA 5E20A 5M5XJ 4ZZLA 1T2KA 4MEXF 1R6RA 3JRGA 2LKXA 1PVEA 4RAYA 1OR7A 2HYFA 1NG7A 4XIDA 2P6TA 2FMLA 1GV2A 3B73A 2XAFA 2HNHA 2ZO4A 3OYEA 1WHUA 2ID3A 5IYCJ 1PP8F 1VZ0A 1RKWA 1K7AA 5F0HA 3E7LA 2PLYA 3TOAA 2H94A 5EGOB 4KMUX 2R0QC 1YE9A 4EJUA 2CWEA 2FSWA 1SAXA 4FCYA 3QU6A 5ICFA 1K61A 4BEHB 4XRSA 1ZLKA 2B7EA 1LFPA 2CUFA 1IN8A 1R1TA 2L9NA 4AVZA 4L9VA 4HF0A 4UB8C 2OC6A 3PO2J 4L5IA 3J80K 1O7FA 4M71A 1FC3A 4AIDA 1ZTRA 3FZVA 3CCYA 4IHTA 4C3HJ 2DA1A 1K78A 1IN6A 4I76A 5LLQA 2IVMA 1WQ2A 3LSTA 3LMMA 2EIKH 3BG7A 2YS9A 1VQ5I 5HS9A 1LVKA 2L2OA 1MMSA 1G3YA 1GVJA 5DEQA 3BR5A 2RQQA 3LFKA
chains in the Genus database with same CATH topology
1IV6A 1MBKA 2LVSA 3GTGJ 5C44J 1E3OC 3S15J 1I6HJ 4JYKA 4W97A 4DZJA 4JP0A 2ZB9A 4IHXA 1GDTA 1WPKA 1H8AC 1LE8B 2DA7A 2VUMJ 3RZDJ 1X2MA 4D7NA 2ID6A 3ZQGA 1NK2P 2LFBA 9ANTA 1SANA 1D5YA 1IDZA 4V2GA 1IC8A 1LE8A 1W0TA 2R7ZJ 1W0UA 5F0FA 4IEJA 5EG0B 2YUSA 2HI3A 2XSDC 1JKPC 1Z77A 2XGEA 4X6AJ 1K83J 3LOCA 2IBDA 2GLOA 4A3FJ 3BG5A 1MH3A 5J1YA 1PUFB 2CU7A 1UMQA 5EG0A 2GM4A 3FIWA 1FJLA 3PM1A 3RKQA 1WH5A 1BA5A 3PO3J 2OPTA 2FD5A 3O8HA 3WHBA 2NS7A 3OSGA 2L7FP 2VI6A 1CQTA 2NVXJ 2R93J 1HDPA 3S1MJ 4A3GJ 3CQZJ 5C4XJ 2TCTA 2DMQA 2L0KA 4V2FA 1PUFA 3A03A 1T56A 2YU9J 3F0CA 1IGNA 3GTQJ 2XPWA 1ETOA 4J19A 1XC5A 3S1RJ 1MBEA 3JR9A 4S0HB 5IOYA 2EBIA 2ME0A 2X6OA 2I10A 1AHDP 1APLC 4A3MJ 2K9NA 3C2BA 3QPSA 4XK4A 2QF7A 3BTLA 4EEFG 5M5YJ 4AC0A 2Y2ZA 5E3LA 4JX6A 2DMUA 5IYDJ 2Y31A 1OCTC 1ORKA 3Q3SA 3CMYA 4FE7A 5EEAA 5DS9A 1LFUP 2JN6A 4DYQA 4FE4A 2MSYA 4MIMA 3B6CA 1RKTA 2MG4A 2JA6J 4DYRA 5HODA 5DTDA 1U9NA 2HXIA 5C3EJ 4BXXJ 1GUUA 3B6AA 3HBLA 5EZHA 1MH4A 2XB0X 4A3KJ 1HF0A 1UHSA 3BR2A 3K2AA 1P7JA 1H89C 4MLOA 1TWCJ 5EDNA 5EGOA 3OOUA 2GBYA 4AUXA 3TW6A 5F1JA 5EYRA 4M3EA 2H1KA 4BY7J 1QRYA 2H8RA 1X58A 2M8GX 5GP9A 2X48A 2FJ1A 1POGA 1JKOC 3GTOJ 2ELKA 2AO9A 5J1RA 2EZKA 3K7AJ 1A5JA 4A3CJ 2XPUA 2X9DA 1ZR2A 4XRMA 3TP0A 2L7ZA 3HOYJ 5J1UA 1F36A 4A3IJ 3Q0UA 1JJ6C 3MN2A 1HDDC 3W6VA 3SJMA 3RQIA 1JT6A 1FEXA 2M2EA 2NVYJ 1JT0A 4XRSG 4A3EJ 3GTKJ 3M3YJ 3MKLA 2DA6A 1U78A 2W48A 2E19A 1GT0C 3HOUJ 1JJ8C 2DMNA 2OF7A 3TEDA 3BTCA 3ZQLA 1RETA 1FIPA 2DTZA 2RAEA 1ZGWA 4G12A 4A93J 1Z0XA 1ETWA 3IH3A 3GTMJ 2DJNA 5F04A 1MBFA 2M0CA 2HDDA 2LD5A 5FKOA 3O8GA 4M3FA 4M3BA 1VFCA 5IPAA 4RBOA 2O8KA 2EZHA 1VI0A 2PMZN 2LR8A 2COBA 4DZPA 4IHWA 1WGXA 4IHYA 2CUEA 3UKGA 3A01B 5FKKA 3S1NJ 1OFCX 1I3QJ 3IH2A 3BTIA 4A3DJ 2ECCA 1MNMC 4UUTA 3IH4A 3JRDA 2AHQA 2HQ5A 2DMPA 3SFIA 4UUSB 1S7EA 3OSFA 1H88C 5GPCA 1ETYA 5M3FJ 4C3JJ 4A3BJ 2KT0A 2VKVA 3HGYA 3HGGA 1VNDA 3VPRA 1RPWA 2Y30A 5F08A 2TRTA 2WB1N 2R5ZB 3ZQHA 3QPLA 1XG1A 5K7HA 1T33A 2DMTA 1WI3A 4JX5A 4C3IJ 2E2JJ 3GTJJ 1TWGJ 1GVDA 4BBSJ 1B8IB 5GPAA 2FQ4A 3RZOJ 1ZK8A 3BR1A 1WCMJ 2HOSA 1HOMA 4QSHA 5E3NA 2R5ZA 1TWHJ 2ECBA 1IDYA 1IRZA 2L9RA 4B4CA 1ENHA 3S17J 3BQYA 2LY9A 3LSRA 3L1PA 1AU7A 3DCFA 5F27A 1ETXA 5FLMJ 4A3JJ 1JUPA 3I4MJ 2LP0A 1JTXA 5M5WJ 3Q0VA 2JJ7A 1Y1VJ 3S1QJ 2CJJA 4D5CA 4HNVA 3BG3A 1SFOJ 2K40A 3JRCA 1IUFA 1HCRA 1I50J 4BBRJ 3SDGA 3HKZN 3ZQCA 3IV5A 1NTCA 2E2IJ 2DA2A 1FIAA 3LSJA 1BW6A 1NK3P 3I4NJ 2L7MP 4XICA 5EF6A 4QIWN 1LFBA 2JMWA 5FJ8J 1TC3C 3BR0A 3HM5A 5BNGA 4MFEA 2NOGA 3LNQA 1RESA 1VF9A 2JA8J 4CYCB 3HOWJ 2Y9YA 1AKHB 3HOVJ 1Q1VA 3H3VK 2DA5A 4BKXA 2JWTA 1XS9A 3LSGA 1FTZA 2DA4A 1ETVA 1B72B 2D5VA 3HDDA 3FK6A 2E1OA 3ZQFA 2VKEA 1WH7A 2HOAA 3HEFA 5FKMA 2HXOA 5IP7J 5IP9J 4AYBN 4DYCA 5JLXA 2NVTJ 1JUMA 2DA3A 2K9QA 2LLKA 4A3LJ 3BR6A 3Q0WA 3S2DJ 5C4JJ 3S14J 3BT9A 2Y0SN 2E2HJ 2M9HA 4M6VA 5JLWA 2NVQJ 1QVTA 3TW7A 3JRIA 3OIOA 4A69C 3TP3A 4Y7NJ 1JGGA 1FTTA 2KDZA 4BY1J 1OCPA 2JK3A 5IP6A 3GBGA 1ZR4A 4DW6A 1ETKA 3JREA 4B3AA 2CQXA 2VPRA 3JRAA 2XB5A 4L5EA 2DN0A 1RR7A 2LK2A 1DU6A 4I6ZA 3DEWA 1UG2A 3BQZA 3G1MA 1BL0A 3M4OJ 4GFBA 3S16J 2JA7J 4B1RA 1QPIA 4X1EA 1MSEC 2QCOA 2B63J 1GV5A 2WV1A 3H0GJ 4W1UA 2P81A 4RDUA 1U9OA 4JX4A 2ME6A 5J3LA 2Y9ZA 3A01A 5E3OA 1JKRC 4IHVA 2JA5J 2WAQN 1BW5A 1Y1WJ 4MO7A 1YRNB 5FKLA 2MW8A 3MVPA 1EF4A 4UUSA 1MBJA 4ABZA 4FISA 2CQQA 1P7IA 3HOZJ 3FISA 3FK7A 1JTYA 1ZQ3P 4D7MA 1YRNA 5IOZA 2EH3A 1JUSA 2R92J 2EQRA 3LSPA 3JRBA 2CRGA 2O7OA 1BJZA 1JKQC 3HB9A 4QTRA 2NS8A 1B8IA 2XPVA 1IJWC 5K7FA 2O9LA 4FTHA 3S2HJ 1O4XA 5E3MA 2MGQA 5IYBJ 1R9TJ 3A02A 2M34A 2G0EA 1MSFC 1U8BA 2HOTA 1A6IA 2N8GA 1TWAJ 5M5XJ 4Y52J 3JRGA 2LKXA 3G1OA 4XIDA 3BTJA 1GV2A 1MBGA 1X2NA 1TWFJ 4C2MJ 5K7ZA 2IEKA 2ID3A 5IYCJ 3G1LA 2EZIA 2EZLA 1DU0A 2FX0A 1RKWA 3BR3A 3GTLJ 5F0HA 1OJLA 1QVUA 3E7LA 3WHCA 1MBHA 3ZOBA 2IAIA 5EGOB 2R0QC 2HYJA 3CDLA 2K9SA 2XRLA 4D5FA 4FCYA 4M3DA 1K61A 4LOCA 5FLVA 5EZGA 4XRSA 3NAUA 2CUFA 5M3MJ 3NARA 3BG9A 1ZKGA 3FKIJ 1HLVA 2XGCA 2LTPA 3QQAA 3HOXJ 3PO2J 4NDLA 3D1NI 2XGDA 2R5YB 5F0CA 3JRHA 5FKNA 3ZQIA 3GTPJ 1ZTRA 3JRFA 3CCYA 4C3HJ 1F43A 1G2HA 2DA1A 4CYCA 4I76A 4MFDA 1AKHA 4M3GA 1IG7A 2YS9A 1B72A 1ITYA 1ETQA 2R5YA 3BR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV6 A;  1MBK A;  2LVS A;  3GTG J;  5C44 J;  1E3O C;  3S15 J;  1I6H J;  4JYK A;  4W97 A;  4DZJ A;  4JP0 A;  2ZB9 A;  4IHX A;  1GDT A;  1WPK A;  1H8A C;  1LE8 B;  2DA7 A;  2VUM J;  3RZD J;  1X2M A;  4D7N A;  2ID6 A;  3ZQG A;  1NK2 P;  2LFB A;  9ANT A;  1SAN A;  1D5Y A;  1IDZ A;  4V2G A;  1IC8 A;  1LE8 A;  1W0T A;  2R7Z J;  1W0U A;  5F0F A;  4IEJ A;  5EG0 B;  2YUS A;  2HI3 A;  2XSD C;  1JKP C;  1Z77 A;  2XGE A;  4X6A J;  1K83 J;  3LOC A;  2IBD A;  2GLO A;  4A3F J;  3BG5 A;  1MH3 A;  5J1Y A;  1PUF B;  2CU7 A;  1UMQ A;  5EG0 A;  2GM4 A;  3FIW A;  1FJL A;  3PM1 A;  3RKQ A;  1WH5 A;  1BA5 A;  3PO3 J;  2OPT A;  2FD5 A;  3O8H A;  3WHB A;  2NS7 A;  3OSG A;  2L7F P;  2VI6 A;  1CQT A;  2NVX J;  2R93 J;  1HDP A;  3S1M J;  4A3G J;  3CQZ J;  5C4X J;  2TCT A;  2DMQ A;  2L0K A;  4V2F A;  1PUF A;  3A03 A;  1T56 A;  2YU9 J;  3F0C A;  1IGN A;  3GTQ J;  2XPW A;  1ETO A;  4J19 A;  1XC5 A;  3S1R J;  1MBE A;  3JR9 A;  4S0H B;  5IOY A;  2EBI A;  2ME0 A;  2X6O A;  2I10 A;  1AHD P;  1APL C;  4A3M J;  2K9N A;  3C2B A;  3QPS A;  4XK4 A;  2QF7 A;  3BTL A;  4EEF G;  5M5Y J;  4AC0 A;  2Y2Z A;  5E3L A;  4JX6 A;  2DMU A;  5IYD J;  2Y31 A;  1OCT C;  1ORK A;  3Q3S A;  3CMY A;  4FE7 A;  5EEA A;  5DS9 A;  1LFU P;  2JN6 A;  4DYQ A;  4FE4 A;  2MSY A;  4MIM A;  3B6C A;  1RKT A;  2MG4 A;  2JA6 J;  4DYR A;  5HOD A;  5DTD A;  1U9N A;  2HXI A;  5C3E J;  4BXX J;  1GUU A;  3B6A A;  3HBL A;  5EZH A;  1MH4 A;  2XB0 X;  4A3K J;  1HF0 A;  1UHS A;  3BR2 A;  3K2A A;  1P7J A;  1H89 C;  4MLO A;  1TWC J;  5EDN A;  5EGO A;  3OOU A;  2GBY A;  4AUX A;  3TW6 A;  5F1J A;  5EYR A;  4M3E A;  2H1K A;  4BY7 J;  1QRY A;  2H8R A;  1X58 A;  2M8G X;  5GP9 A;  2X48 A;  2FJ1 A;  1POG A;  1JKO C;  3GTO J;  2ELK A;  2AO9 A;  5J1R A;  2EZK A;  3K7A J;  1A5J A;  4A3C J;  2XPU A;  2X9D A;  1ZR2 A;  4XRM A;  3TP0 A;  2L7Z A;  3HOY J;  5J1U A;  1F36 A;  4A3I J;  3Q0U A;  1JJ6 C;  3MN2 A;  1HDD C;  3W6V A;  3SJM A;  3RQI A;  1JT6 A;  1FEX A;  2M2E A;  2NVY J;  1JT0 A;  4XRS G;  4A3E J;  3GTK J;  3M3Y J;  3MKL A;  2DA6 A;  1U78 A;  2W48 A;  2E19 A;  1GT0 C;  3HOU J;  1JJ8 C;  2DMN A;  2OF7 A;  3TED A;  3BTC A;  3ZQL A;  1RET A;  1FIP A;  2DTZ A;  2RAE A;  1ZGW A;  4G12 A;  4A93 J;  1Z0X A;  1ETW A;  3IH3 A;  3GTM J;  2DJN A;  5F04 A;  1MBF A;  2M0C A;  2HDD A;  2LD5 A;  5FKO A;  3O8G A;  4M3F A;  4M3B A;  1VFC A;  5IPA A;  4RBO A;  2O8K A;  2EZH A;  1VI0 A;  2PMZ N;  2LR8 A;  2COB A;  4DZP A;  4IHW A;  1WGX A;  4IHY A;  2CUE A;  3UKG A;  3A01 B;  5FKK A;  3S1N J;  1OFC X;  1I3Q J;  3IH2 A;  3BTI A;  4A3D J;  2ECC A;  1MNM C;  4UUT A;  3IH4 A;  3JRD A;  2AHQ A;  2HQ5 A;  2DMP A;  3SFI A;  4UUS B;  1S7E A;  3OSF A;  1H88 C;  5GPC A;  1ETY A;  5M3F J;  4C3J J;  4A3B J;  2KT0 A;  2VKV A;  3HGY A;  3HGG A;  1VND A;  3VPR A;  1RPW A;  2Y30 A;  5F08 A;  2TRT A;  2WB1 N;  2R5Z B;  3ZQH A;  3QPL A;  1XG1 A;  5K7H A;  1T33 A;  2DMT A;  1WI3 A;  4JX5 A;  4C3I J;  2E2J J;  3GTJ J;  1TWG J;  1GVD A;  4BBS J;  1B8I B;  5GPA A;  2FQ4 A;  3RZO J;  1ZK8 A;  3BR1 A;  1WCM J;  2HOS A;  1HOM A;  4QSH A;  5E3N A;  2R5Z A;  1TWH J;  2ECB A;  1IDY A;  1IRZ A;  2L9R A;  4B4C A;  1ENH A;  3S17 J;  3BQY A;  2LY9 A;  3LSR A;  3L1P A;  1AU7 A;  3DCF A;  5F27 A;  1ETX A;  5FLM J;  4A3J J;  1JUP A;  3I4M J;  2LP0 A;  1JTX A;  5M5W J;  3Q0V A;  2JJ7 A;  1Y1V J;  3S1Q J;  2CJJ A;  4D5C A;  4HNV A;  3BG3 A;  1SFO J;  2K40 A;  3JRC A;  1IUF A;  1HCR A;  1I50 J;  4BBR J;  3SDG A;  3HKZ N;  3ZQC A;  3IV5 A;  1NTC A;  2E2I J;  2DA2 A;  1FIA A;  3LSJ A;  1BW6 A;  1NK3 P;  3I4N J;  2L7M P;  4XIC A;  5EF6 A;  4QIW N;  1LFB A;  2JMW A;  5FJ8 J;  1TC3 C;  3BR0 A;  3HM5 A;  5BNG A;  4MFE A;  2NOG A;  3LNQ A;  1RES A;  1VF9 A;  2JA8 J;  4CYC B;  3HOW J;  2Y9Y A;  1AKH B;  3HOV J;  1Q1V A;  3H3V K;  2DA5 A;  4BKX A;  2JWT A;  1XS9 A;  3LSG A;  1FTZ A;  2DA4 A;  1ETV A;  1B72 B;  2D5V A;  3HDD A;  3FK6 A;  2E1O A;  3ZQF A;  2VKE A;  1WH7 A;  2HOA A;  3HEF A;  5FKM A;  2HXO A;  5IP7 J;  5IP9 J;  4AYB N;  4DYC A;  5JLX A;  2NVT J;  1JUM A;  2DA3 A;  2K9Q A;  2LLK A;  4A3L J;  3BR6 A;  3Q0W A;  3S2D J;  5C4J J;  3S14 J;  3BT9 A;  2Y0S N;  2E2H J;  2M9H A;  4M6V A;  5JLW A;  2NVQ J;  1QVT A;  3TW7 A;  3JRI A;  3OIO A;  4A69 C;  3TP3 A;  4Y7N J;  1JGG A;  1FTT A;  2KDZ A;  4BY1 J;  1OCP A;  2JK3 A;  5IP6 A;  3GBG A;  1ZR4 A;  4DW6 A;  1ETK A;  3JRE A;  4B3A A;  2CQX A;  2VPR A;  3JRA A;  2XB5 A;  4L5E A;  2DN0 A;  1RR7 A;  2LK2 A;  1DU6 A;  4I6Z A;  3DEW A;  1UG2 A;  3BQZ A;  3G1M A;  1BL0 A;  3M4O J;  4GFB A;  3S16 J;  2JA7 J;  4B1R A;  1QPI A;  4X1E A;  1MSE C;  2QCO A;  2B63 J;  1GV5 A;  2WV1 A;  3H0G J;  4W1U A;  2P81 A;  4RDU A;  1U9O A;  4JX4 A;  2ME6 A;  5J3L A;  2Y9Z A;  3A01 A;  5E3O A;  1JKR C;  4IHV A;  2JA5 J;  2WAQ N;  1BW5 A;  1Y1W J;  4MO7 A;  1YRN B;  5FKL A;  2MW8 A;  3MVP A;  1EF4 A;  4UUS A;  1MBJ A;  4ABZ A;  4FIS A;  2CQQ A;  1P7I A;  3HOZ J;  3FIS A;  3FK7 A;  1JTY A;  1ZQ3 P;  4D7M A;  1YRN A;  5IOZ A;  2EH3 A;  1JUS A;  2R92 J;  2EQR A;  3LSP A;  3JRB A;  2CRG A;  2O7O A;  1BJZ A;  1JKQ C;  3HB9 A;  4QTR A;  2NS8 A;  1B8I A;  2XPV A;  1IJW C;  5K7F A;  2O9L A;  4FTH A;  3S2H J;  1O4X A;  5E3M A;  2MGQ A;  5IYB J;  1R9T J;  3A02 A;  2M34 A;  2G0E A;  1MSF C;  1U8B A;  2HOT A;  1A6I A;  2N8G A;  1TWA J;  5M5X J;  4Y52 J;  3JRG A;  2LKX A;  3G1O A;  4XID A;  3BTJ A;  1GV2 A;  1MBG A;  1X2N A;  1TWF J;  4C2M J;  5K7Z A;  2IEK A;  2ID3 A;  5IYC J;  3G1L A;  2EZI A;  2EZL A;  1DU0 A;  2FX0 A;  1RKW A;  3BR3 A;  3GTL J;  5F0H A;  1OJL A;  1QVU A;  3E7L A;  3WHC A;  1MBH A;  3ZOB A;  2IAI A;  5EGO B;  2R0Q C;  2HYJ A;  3CDL A;  2K9S A;  2XRL A;  4D5F A;  4FCY A;  4M3D A;  1K61 A;  4LOC A;  5FLV A;  5EZG A;  4XRS A;  3NAU A;  2CUF A;  5M3M J;  3NAR A;  3BG9 A;  1ZKG A;  3FKI J;  1HLV A;  2XGC A;  2LTP A;  3QQA A;  3HOX J;  3PO2 J;  4NDL A;  3D1N I;  2XGD A;  2R5Y B;  5F0C A;  3JRH A;  5FKN A;  3ZQI A;  3GTP J;  1ZTR A;  3JRF A;  3CCY A;  4C3H J;  1F43 A;  1G2H A;  2DA1 A;  4CYC A;  4I76 A;  4MFD A;  1AKH A;  4M3G A;  1IG7 A;  2YS9 A;  1B72 A;  1ITY A;  1ETQ A;  2R5Y A;  3BR5 A; 
#chains in the Genus database with same CATH topology
 3HRM A;  4MEY F;  1MBK A;  4QPO A;  1E3O C;  3EPZ A;  5FFX A;  2VT3 A;  2Y48 A;  4IHX A;  3OS1 A;  1HST A;  4D7N A;  2DQL A;  4FAS D;  3FHN A;  2KMU A;  1S3J A;  4DNC A;  2L4M A;  4JK1 X;  2Q2E B;  1Z7U A;  3GZN B;  2LFB A;  2WAF A;  1SAN A;  4D0P A;  4KT6 A;  3H5N A;  2R7S A;  5D6E A;  4KIS A;  1TT0 A;  1W0U A;  1ZRC A;  5LD2 C;  1LKX A;  2F2E A;  5IT3 A;  1FOX A;  3KYD B;  4PDK A;  4D9J A;  3OS2 A;  4IEJ A;  3H0D A;  2ZME B;  2OZ6 A;  4PFP A;  3CCU I;  1Z77 A;  4I09 A;  1G8X A;  3KZI C;  3EUK L;  5F64 A;  3LOC A;  3HSF A;  2NRA C;  3DU6 A;  2W00 A;  2DOE A;  3IC7 A;  5LHG A;  3HRT A;  3MKY B;  3BCB A;  4LLL A;  5J1Y A;  3MAJ A;  1N78 A;  1UMQ A;  3FIW A;  3RKQ A;  2E35 A;  2FRH A;  3TDU C;  2HTJ A;  2K3P A;  2NS7 A;  4MQ9 F;  3WHB A;  2L7F P;  2VI6 A;  1MGT A;  3F22 A;  2MH2 A;  3F8C A;  1VQO I;  4NC7 A;  3JAM Z;  2DMQ A;  4AIK A;  3RKY A;  4BDZ A;  3HUG A;  3VOD A;  2IJL A;  5LFA A;  1MIJ A;  4CUG A;  4YFX F;  2M7A A;  4N9H A;  4II2 A;  3O3K A;  1S6L A;  2P5V A;  2RC4 A;  2X6O A;  3U9G A;  5FRO A;  1RI7 A;  3QPS A;  4HBL A;  4RMN A;  3T1B A;  4XK4 A;  5J47 A;  3L2Q A;  3KLO A;  2VQC A;  3E6B A;  4FX0 A;  5J40 A;  2JSP A;  4AC0 A;  5E3L A;  1UFM A;  4IRG A;  3FXJ A;  3PSI A;  1BI2 A;  1ORK A;  5CPR B;  3CMY A;  4I2O A;  1V4R A;  4KFC A;  2JN6 A;  2L54 A;  4G6Q A;  2KPM A;  2MSY A;  4ZYE A;  2Z33 A;  2MG4 A;  2OA4 A;  2JA6 J;  3HG9 A;  4BYY A;  4ZYG A;  4Q4Z F;  1P2F A;  2J5P A;  1WJE A;  3ZMS A;  1R49 A;  1GUU A;  2VB6 A;  5EZH A;  1REP C;  1D0X A;  2XB0 X;  1E3P A;  1OYY A;  4O6J A;  3C3W A;  1UHS A;  2BW3 A;  4BHB A;  3DBR B;  3CO7 C;  4GXO A;  3PQJ A;  1T38 A;  3K4M A;  1F4K A;  3ZMZ A;  1K4S A;  4RGX A;  1I5Z A;  1OKR A;  3FXQ A;  3H5A A;  1QRY A;  1PJR A;  5AON A;  2X48 A;  5HDN A;  1XB4 A;  3P9C A;  1BR4 A;  2ELK A;  2V26 A;  1JKO C;  2QBY B;  3QPT A;  2HOE A;  1B9M A;  1ZG1 A;  1HA8 A;  1A5J A;  1QZE A;  3W2V A;  2XPU A;  2X9D A;  2FOK A;  1X1A A;  3CF5 F;  2OJE D;  2EV6 A;  1P6R A;  2HKO A;  2QZ8 A;  4Z6Y A;  3HOY J;  1TBX A;  2QWW A;  2V4J C;  3Q0U A;  2JVG A;  3MN2 A;  1A35 A;  2HU9 A;  3W6V A;  2XGX A;  2K86 A;  4OAY A;  1YW7 A;  2YR2 A;  3VYS B;  2QBY A;  4XRS G;  3QP5 A;  4P9U A;  4U7D A;  1W5S A;  5B1A H;  4KIB A;  1LDK B;  2E19 A;  3HOU J;  1QA6 A;  1YX3 A;  1ZG3 A;  4L18 B;  4R79 A;  3ZQL A;  3RYP A;  2Q8K A;  1RET A;  3CDI A;  1LB2 A;  2CV1 A;  3RYR A;  2ZCW A;  4A93 J;  3L2C A;  3IH3 A;  4DQ2 A;  4U0V A;  5K5Q A;  3WTV C;  3GTM J;  5F04 A;  1MBF A;  2QGU A;  2LD5 A;  1X4P A;  2Z16 A;  1U8R A;  2ELH A;  1USS A;  2VQH A;  2PMZ N;  3FKJ A;  4HX7 A;  4QPQ A;  3T8R A;  2DO7 A;  4XLF A;  1T95 A;  4IHY A;  1SMT A;  3VDX A;  3H9Q A;  1J9I A;  3CMA I;  3QYE A;  3QPH A;  1PUE E;  1OCZ H;  1FOY A;  5FKK A;  5HLG A;  2XIG A;  1LQ1 A;  3S1N J;  3IH2 A;  2ECC A;  3K1N A;  4ZTF A;  4UUT A;  1Z9C A;  2X6X A;  4OU0 A;  3U21 A;  1N77 A;  4OMZ A;  1ETY A;  2LY2 A;  3LSI A;  2YPR A;  2I8D A;  3K4B A;  4A3B J;  2D2W A;  2KT0 A;  5GAG J;  3TDZ C;  2RDP A;  3HGG A;  1VND A;  4K2E A;  4XSX F;  2D45 A;  1W7P A;  2CYY A;  3OY9 A;  2PJR A;  3RKX A;  4G6D A;  4ZJZ A;  5H2F C;  2WB1 N;  1GXQ A;  4XLN F;  4RB3 C;  4HRI A;  4ZDO A;  5K7H A;  1Y0N A;  1R4M B;  2DFH A;  4C3I J;  4ZTJ A;  1IXR C;  1D8K A;  2DQR A;  3GTJ J;  2F6C A;  1GVD A;  1B8I B;  4AVP A;  1ZAR A;  1Z05 A;  5DUK A;  2Y69 H;  3I53 A;  4OAZ A;  1WCM J;  3M9A A;  3PFY A;  4N0B A;  5E79 C;  4YFK F;  2IP2 A;  2UWM A;  2CMP A;  1HOM A;  3N05 A;  4HST A;  5E3N A;  4ENM A;  3OYB A;  1QHH D;  2W1O A;  1T6S A;  2L9R A;  1XGN A;  3S17 J;  1ENH A;  1U2W A;  1IAW A;  1BR1 A;  4YEL A;  2HQR A;  1D1A A;  2E7X A;  3SXY A;  2XAS A;  4A12 A;  3JSP A;  1JUP A;  3OYD A;  2QQB A;  4F3Q A;  5LBQ A;  3P7N A;  3Q9S A;  5TRD A;  5E8I A;  3AG3 H;  4Q5S F;  5E8G A;  3S1Q J;  3BPX A;  4XQF A;  4Q47 A;  4BJ6 C;  1FSH A;  3Q9V A;  3CCQ I;  1SFO J;  3JRC A;  5HS7 A;  4RAG A;  3OYH A;  1ZRF A;  5FD6 A;  3WGI A;  1TZL A;  3SDG A;  1K6O A;  3HKZ N;  2DOF A;  2HVS A;  2E2I J;  1CGP A;  1JGS A;  2LH9 A;  1FIA A;  3HXL A;  4ENK A;  3ZMT A;  5K5O A;  1NK3 P;  3I4N J;  2DXI A;  3EDP A;  1E17 A;  4QIW N;  5K5R A;  4F55 A;  2XAQ A;  5FJ8 J;  3TKY A;  3CCJ I;  1VQK I;  3ULQ B;  5F1R A;  2QUF A;  2WWY A;  2A6E F;  1SVL A;  2P5K A;  4RAZ A;  2A5W A;  1EV7 A;  2NOG A;  3SEQ A;  4BQN A;  3LNQ A;  4BU2 A;  2VKH A;  1J0R A;  3RDI A;  1I6X A;  3HOW J;  3I64 A;  1Q1V A;  1FYM A;  2DA5 A;  4BKX A;  4RM2 A;  2PMU A;  4RGS A;  1FTZ A;  1ETV A;  2D5V A;  5LGU A;  3C2H A;  2OZU A;  3VFZ A;  2KIM A;  1WH7 A;  4U0Y A;  2DW4 A;  1EJ9 A;  4F92 B;  4BAY A;  3EUH C;  4M9X A;  3I0T A;  1LVA A;  4F91 B;  2E34 A;  2OCE A;  4LIT A;  2HXO A;  3M07 A;  3WTX C;  3K70 D;  2LLK A;  2K9Q A;  1D1C A;  3Q0W A;  1X1B A;  4EAT A;  3S14 J;  3BT9 A;  2VN2 A;  2Y0S N;  4BDY A;  1W36 D;  4RLQ A;  3FHZ A;  2NVQ J;  4YII A;  2K5C A;  3NWS A;  3LSK A;  3GLX A;  1ON1 A;  1IW7 F;  2CQ7 A;  5J6X A;  4Y7N J;  2VOO A;  2JT1 A;  1U3E M;  1JGG A;  1HKT A;  4CZZ A;  3F21 A;  5IP6 A;  5D5W B;  2ZNY A;  2AQE A;  4ZH4 F;  3GBG A;  1ZR4 A;  3K70 C;  5A2Q K;  1BI0 A;  4U7B A;  3JRE A;  2CQX A;  4L5E A;  2LK2 A;  3M8E A;  3RSN A;  4EGY A;  2X0L A;  3OYL A;  1W36 C;  2FEZ A;  4LB6 B;  2VLA A;  2L7K A;  3M4O J;  1RR8 C;  2OQG A;  2W57 A;  3OR1 C;  1K4T A;  5ILU A;  3DLL F;  2B63 J;  2M87 A;  1GV5 A;  1P9Q C;  2MD0 A;  2WV1 A;  1SD4 A;  4EJT A;  2RV8 A;  2WV0 A;  4RDU A;  3RPU D;  4LIV A;  3IRQ A;  4XLH A;  1S7O A;  2VT2 A;  1JKR C;  3DPT A;  2WAQ N;  3CCS I;  1BW5 A;  2LKP A;  4PSX A;  2MA3 A;  1YRN B;  3E6D A;  3BG6 A;  2BVM A;  3R0J A;  1MBJ A;  3TMO A;  2FBH A;  2M0M A;  4FIS A;  3LAJ A;  4RB1 A;  4Z2Y A;  4PZJ A;  4L0Z B;  2CQQ A;  1QZZ A;  2XUB A;  1MNE A;  4ZC3 A;  2XSJ C;  3HOZ J;  1UCR A;  3TOB A;  4ZZD A;  3LL7 A;  5TIS C;  2K02 A;  4OOI A;  2NYX A;  4D7M A;  1YRN A;  4Y4R A;  2CSO A;  2V79 A;  1JUS A;  5IOZ A;  2EQR A;  5DD4 A;  2DPU A;  2R92 J;  3A0B C;  1KU3 A;  3DEE A;  4PJN A;  4RB0 A;  3I59 B;  1YW9 A;  2RN7 A;  1FY7 A;  2MH9 A;  3HB9 A;  3WE3 A;  4LK0 F;  3VYR B;  1IJW C;  1IRX A;  4FTH A;  1O4X A;  4ZDP A;  3I3L A;  3MQ0 A;  5IYB J;  3F23 A;  3A02 A;  2M34 A;  4UV8 A;  1U8B A;  2LBF A;  2UZK A;  2EFO A;  1SMY F;  1R71 A;  2IXS A;  4PJ0 C;  1YI2 I;  2JVH A;  1OLT A;  4Y52 J;  3COA C;  5B1B H;  4II3 A;  2DFF A;  4OIQ F;  1ZH5 A;  4KMF A;  4HZF A;  5J4Y A;  3G1O A;  4B47 A;  5JR3 A;  3P9K A;  3BTJ A;  2E5Z A;  2QQ8 A;  3J7Y J;  2IW5 A;  1MBG A;  1X2N A;  4C2M J;  3HSR A;  4Y3O A;  3BP8 A;  3G1L A;  5DCM B;  2EZL A;  1XSV A;  3K4L A;  3H3U A;  1B6A A;  1O57 A;  4FQG A;  1MBH A;  3DF8 A;  3VYT B;  4XLE A;  3CDL A;  2Z99 A;  3KET A;  2EFP A;  4D5F A;  1HW2 A;  1XGO A;  4LOC A;  1IRF A;  5FLV A;  2F4I A;  4LD5 A;  5M3M J;  3C2G A;  3GYH X;  5ERI A;  5DCM A;  2M8E A;  1ZKG A;  1FYK A;  3D0S A;  2XGC A;  2LTP A;  1WI9 A;  1HC8 A;  3QQA A;  4RAF A;  4Y33 A;  3IRR A;  3K2Z A;  2M4G A;  4BUP A;  5CLS A;  4N4O B;  5FKN A;  3EUH A;  4MTE A;  2CUZ A;  4HG2 A;  3F3X A;  3CCV I;  2LG4 A;  3V4G A;  3HIF A;  3W2A A;  1F43 A;  1FSE A;  2PI0 A;  3CJN A;  3WTY C;  4LFU A;  5CVU A;  2ICW G;  4M3G A;  1IG7 A;  3FXU A;  3H9J A;  1B72 A;  5TJJ A;  2A3S A;  5D6F A;  2IGN A;  2YX4 A;  2DI3 A;  3GTG J;  1OYI A;  1S8N A;  1I6H J;  2A68 F;  3BZC A;  4W97 A;  1DPU A;  4JP0 A;  1STZ A;  5FFZ A;  1ACI A;  1GDT A;  2P7V B;  5FGM A;  3GFI A;  2ZXJ A;  2DA7 A;  3RZD J;  2JZY A;  3KIO A;  2YU3 A;  1FZP B;  1LPQ A;  3D5R C;  2BGC A;  3BJ6 A;  1H0M A;  1O3T A;  1B9N A;  3ZQG A;  1MMA A;  2E1C A;  5ILS A;  4I0A A;  9ANT A;  1YG2 A;  1IDZ A;  1D5Y A;  1J59 A;  4B3X A;  1SVO A;  1BOB A;  4XOT A;  2H8W A;  4EM2 A;  3ABK H;  5LGT A;  2FU4 A;  1W0T A;  1NH3 A;  2R7Z J;  2EIN H;  3AG2 H;  1QNT A;  1A36 A;  1JHF A;  5HVQ C;  5KHD A;  1QGP A;  3VB2 A;  1DDN A;  1X3U A;  2BY1 A;  4N4N B;  2YUS A;  3HOT A;  5J8C A;  1O3S A;  2VC0 A;  3PIO F;  2QA4 I;  1JKP C;  1OPC A;  2VBX A;  3JW4 A;  1UB9 A;  2V1N A;  3MZH A;  4OIO F;  1X3Z B;  2JPC A;  3DU5 A;  3VOE A;  2P6S A;  3F6O A;  4LG0 B;  5LRS A;  5BOX A;  2GLO A;  2ETH A;  3WE2 A;  3OYI A;  3BG5 A;  2P4W A;  2P8T A;  4BXF A;  4HLY A;  1MKM A;  3RPU A;  2K9L A;  3KZY A;  1SD7 A;  5CVV A;  3CCR I;  3PO3 J;  2FD5 A;  3O8H A;  5GAH J;  3OSG A;  3OL4 A;  2VON A;  4I98 B;  3QRF F;  3H3Z A;  1CQT A;  2DAO A;  2QVO A;  2NVX J;  2X6Y A;  2NVU B;  2XC7 A;  1UJ8 A;  4EJW A;  2R93 J;  3MKW B;  3OMY A;  3S1M J;  4CZC A;  4A3G J;  3LA3 A;  3RIR A;  5C4X J;  3ZGK A;  3J81 Z;  2TCT A;  2L0K A;  4V2F A;  4I7H A;  4HEA 2;  1MZB A;  1T56 A;  3DBL B;  5FRN A;  3F0C A;  3GTQ J;  2XAU A;  2XAH A;  2XPW A;  1IV8 A;  1XC5 A;  1WJB A;  3WG7 H;  3HPH A;  3S1R J;  4NB5 A;  1MBE A;  2W7N A;  3K4N A;  4NNJ A;  3GO5 A;  3C18 A;  5EEG A;  4ETS A;  4F93 B;  4RM3 A;  4N9I A;  4A3M J;  3BOQ A;  3ZQQ A;  4LG3 A;  3L09 A;  3LAP A;  2FNP A;  2F4O B;  2BV6 A;  5DM7 F;  2M4K A;  2IPQ X;  3BTL A;  3CES A;  5H6R A;  5KCM A;  1FBQ A;  5IYD J;  1HW5 A;  2DMU A;  2WB1 A;  3P9I A;  2VC1 A;  2RQP A;  4WXC A;  5IT9 Z;  2EFQ A;  3F8F A;  1OCT C;  3Q3S A;  4FE7 A;  2PBI A;  5EEA A;  1J2X A;  4P9F A;  3G6E I;  4DYQ A;  3RJP A;  1AA7 A;  3S2W A;  3B6C A;  1RKT A;  3I71 A;  4C30 A;  3EYI A;  3J7A O;  1VQL I;  2R4G A;  4E7J A;  2HXI A;  4G94 A;  3K69 A;  5CVR A;  4HSR A;  1HBX G;  3WGG A;  2EWN A;  1MH4 A;  1PYV A;  2PEX A;  5HLI A;  4G7Z F;  1E2X A;  3E5U A;  1P7J A;  1TWC J;  5EDN A;  4RS8 A;  5EGO A;  3EUA A;  3OOU A;  3G4S I;  2ZNZ A;  4AUX A;  3OYK A;  4NUB A;  5F1J A;  2IA0 A;  5EYR A;  4A0Z A;  4BEH A;  3GZ5 A;  1LJ9 A;  2ZSH B;  4OWR B;  5D5U B;  3RCO A;  3HRU A;  3IAS 2;  2KKO A;  2W4S A;  2AO9 A;  5J1R A;  5JVT A;  2V6C A;  1F9N A;  1ZR2 A;  4XRM A;  3IWZ A;  3TP0 A;  2L7Z A;  4HF2 A;  2OD5 A;  5J1U A;  1TLH B;  1F36 A;  4A3I J;  2K3F A;  1P4W A;  3CP8 A;  2WTE A;  3I5U A;  1QO0 D;  3GUD A;  2E60 A;  2FOW A;  2E71 A;  1B1B A;  1JT0 A;  1TW3 A;  4A3E J;  1ZLJ A;  5IY5 H;  3KP3 A;  3MKL A;  2DA6 A;  4B8X A;  1SC7 A;  2VKD A;  2H6C A;  1JJ8 C;  2DMN A;  3DTI A;  4HAM A;  3BPV A;  1U5T C;  2HPM A;  1T8I A;  1FIP A;  2RAE A;  2IT0 A;  5LGN A;  4AD9 A;  1ZGW A;  4CHU A;  4UVB A;  4YIR X;  3CME I;  2CFX A;  4IL6 C;  1FNN A;  1FX7 A;  2DJN A;  4C9Y A;  4ESJ A;  3FXK A;  3HOS A;  4C2T A;  1Z67 A;  3BC8 A;  5FKO A;  3O8G A;  3DKW A;  4RBO A;  3F9K A;  2O8K A;  2ZJR F;  3DPL C;  1KGS A;  2GAU A;  2LR8 A;  1TQM A;  4FT8 A;  1PP7 U;  3K9T A;  4DZP A;  4IHW A;  2Q2E A;  1I1S A;  2RKH A;  5GTI C;  1DGR M;  1WGX A;  1SFX A;  1FWZ A;  3UKG A;  1G3W A;  4CCK A;  1I3Q J;  2HPI A;  1EH6 A;  2DK5 A;  5CJ9 A;  4Q48 A;  1SAU A;  3SFI A;  4UUS B;  1WKM A;  1S7E A;  2IGM A;  2QM3 A;  2ZME A;  4JQF A;  5M3F J;  4NQW B;  1S29 A;  4RGR A;  1Z7L A;  4RB2 C;  2VKV A;  1WWX A;  2E1M B;  2X1E A;  1RPW A;  2Y30 A;  3N97 A;  2GWR A;  3V7S A;  2KIF A;  4DBR A;  2TRT A;  1X4O A;  3QPL A;  3L2W A;  5FLX K;  3JCU C;  4ANJ A;  2LYC A;  1T33 A;  2F5E A;  2KHM A;  4JX5 A;  2HTS A;  1BN5 A;  5AIP A;  1J09 A;  4BBS J;  5LEJ A;  3MKZ A;  4OIP F;  3VYU B;  1XGS A;  4XON A;  4HYE A;  4MNU A;  3S3N A;  4XBF A;  2ACJ A;  2HOS A;  1SFU A;  1L0O C;  1TNT A;  1IDY A;  4KDP A;  1U6G A;  4WXH A;  3BQY A;  3WU1 B;  2B9S A;  2WAQ A;  3DTK A;  2E36 A;  1TP4 A;  4XSZ F;  1ETX A;  5FLM J;  1FPQ A;  1UST A;  4EQQ A;  3ERM A;  2ELJ A;  2AQF A;  3HJE A;  4BS9 A;  4BE2 A;  3Q0V A;  5B66 C;  3CLQ A;  2JJ7 A;  5E1X A;  2CS3 A;  3ESW B;  4G9Y A;  2STW A;  4HNV A;  2K40 A;  1HCR A;  5CYV A;  1XMA A;  3S8P A;  3IV5 A;  3MZ8 A;  3GFM A;  4FX4 A;  2OBP A;  1WJF A;  4GCV A;  2FBK A;  2X6W A;  2LC2 A;  2VOP A;  4PJM A;  4EM1 A;  2JMW A;  3BRO A;  3OL3 A;  3T5X A;  4IPA A;  4AWX B;  4GYI A;  5BNG A;  1QHG A;  2HFH A;  4MFE A;  3EYY A;  1KQ9 A;  1RES A;  4HX4 A;  4EVI A;  2KL4 A;  3TGN A;  4CYC B;  2Y9Y A;  3NRV A;  1AKH B;  3HOV J;  1D1B A;  3H3V K;  2JWT A;  1X1D A;  1U5T B;  2DDA A;  2DA4 A;  3RPQ A;  1SFE A;  2BY2 A;  3HDD A;  3FK6 A;  4YRV A;  2BY3 A;  5TGT A;  5DD8 A;  1Q1H A;  3RI4 A;  3PUF A;  2HOA A;  4KN4 X;  5L3F A;  3N4M A;  4IZZ A;  2KRF A;  3GZ6 A;  2NVT J;  3ZMU A;  2DA3 A;  2WY7 Q;  5E18 F;  1KYZ A;  3AKZ A;  3ZR8 X;  2OUM A;  3U1D A;  4UXN A;  4M6V A;  3KP7 A;  5JLW A;  1QVT A;  3OYA A;  4M74 A;  3HPG A;  3TW7 A;  1YW8 A;  1KZH A;  4JBA A;  6PAX A;  2VJ4 A;  2O03 A;  3NWT A;  5ICG A;  1Z6T A;  5JFR A;  2Q1Z B;  2GQQ A;  4H0E A;  2KDZ A;  4UV9 A;  2A5Y B;  3X2Q H;  1K6Y A;  4XLP F;  3D5L A;  3SZP A;  2EJR A;  3VSL A;  4G6T B;  1ULY A;  2XB5 A;  3OR2 C;  4PJL A;  1G3T A;  2MYS A;  2DN0 A;  2H27 A;  1VQ8 I;  3W6J B;  1TQP A;  2R7U A;  3J81 K;  3H5R A;  2R7T A;  3BQZ A;  3DBH B;  4BH9 A;  2EPF A;  2DYR H;  4B1R A;  2JA7 J;  2COM A;  2P81 A;  3DQV C;  3GCM A;  1U9O A;  1R22 A;  1MND A;  2ME6 A;  4KIT B;  1R5H A;  1MJB A;  5J3L A;  5JHF A;  3E6M A;  4FHT A;  3DKY A;  4IHV A;  3KEY A;  1S72 I;  2STT A;  3PSF A;  1R5I D;  2AS5 F;  2MW8 A;  2ZXI A;  2OU2 A;  3WU2 C;  4ON0 A;  5IT9 K;  5LRR A;  2RGV A;  3Q5F A;  3J7A Y;  4CCM A;  3R61 A;  1BM9 A;  3WTW C;  4CIC A;  4NHJ A;  3OYJ A;  1P7I A;  3PL8 A;  2GA2 A;  3FWE A;  3OIQ A;  1JTY A;  2LRE A;  4BNC A;  3LSP A;  3K4J A;  3QOP A;  1KYW A;  1I1G A;  3JRB A;  1BJZ A;  2BYV E;  1B8I A;  3OOP A;  3GFJ A;  2KIQ A;  2MGQ A;  2ZC2 A;  2NNY A;  3G73 A;  1R9T J;  1HW1 A;  1FT9 A;  2QLZ A;  3LSM A;  2Z3Y A;  3K10 A;  3OYC A;  2HVR A;  1MJA A;  3BCA A;  2K9M A;  4NC6 A;  1ZHF A;  1GHC A;  4BJ5 C;  2DK8 A;  2DCE A;  2Z1D A;  3ML6 A;  2I5U A;  3M1C A;  5CVI A;  5K7Z A;  4HV6 A;  1BBY A;  2EZI A;  1DU0 A;  4HDV A;  3PNV A;  2O0Y A;  2EA2 A;  3GWZ A;  3BR3 A;  3GTL J;  2K4J A;  1OJL A;  1OMI A;  1QVU A;  1OIS A;  2GOM A;  3NEU A;  4IXA A;  3WHC A;  2IAI A;  1XMX A;  4U88 A;  2IA2 A;  1IZ1 A;  2K9S A;  4TV7 A;  2QKL B;  4B44 A;  2EB7 A;  4M3D A;  1T39 A;  2LNB A;  3L2V A;  3NAU A;  3NAR A;  4R8H A;  4KUM A;  1M1E B;  5KNL A;  1FP1 D;  2E1N A;  3UNG C;  2FQ3 A;  2XVC A;  1O7L A;  3HOX J;  4NDL A;  3HYI A;  3D1N I;  3IP4 B;  4HPQ A;  4E4H A;  1RC9 A;  2CW8 A;  3JRH A;  1KU2 A;  5LHI A;  3GTP J;  2BHY A;  2ZXW H;  1YJW I;  3HL2 A;  3U1K A;  4WWC A;  4IQJ A;  1B4A A;  3PQK A;  2WBM A;  2VOD A;  4XKW A;  4CXF A;  4M6Y A;  4MFD A;  2OTJ I;  1IRG A;  1SD5 A;  4KA4 A;  2CQN A;  1YO5 C;  1ITY A;  5DDG A;  3CCE I;  4BQO A;  1DP7 P;  4D5C A;  3LA7 A;  4IF4 A;  1IV6 A;  2G7U A;  3F6V A;  2LVS A;  1UAA A;  2JUC A;  3WOD F;  1QBJ A;  3S15 J;  1XN7 A;  4JYK A;  1G4D A;  2R7D A;  2ZB9 A;  1KQ8 A;  1R7J A;  5D5V B;  2R7Q A;  2G7H A;  2F5F A;  1LE8 B;  5B3S H;  3KZZ A;  2PJP A;  1LNW A;  3WTU C;  2ID6 A;  1RUO A;  4P96 A;  4LB5 A;  1TTY A;  2HQA A;  1G59 A;  3JAM K;  1VQM I;  1Z21 A;  1SFK A;  3ECH A;  2ZXH A;  2V1U A;  3R60 A;  4V2G A;  3V8J A;  1LE8 A;  2LOO A;  2EIL H;  5D8K B;  2DFE A;  5JI6 A;  1MMG A;  2A61 A;  2QSF X;  3FF5 A;  3W3C A;  1T08 B;  5F0F A;  5EG0 B;  2XHK A;  2XSD C;  3LSH A;  2R7R A;  3E5Q A;  2JUG A;  2CO5 A;  2IBD A;  4E7I A;  1IF1 A;  1H9G A;  1D0Y A;  3HSE A;  4A3F J;  2VIX A;  4A0X A;  1D8J A;  2ZJQ F;  5B5E C;  2R7V A;  2ZFU A;  1MH3 A;  3EQL F;  1QZY A;  4GYG A;  3QYF A;  5EG0 A;  2VJI A;  1WZ2 A;  3TO7 A;  3PM1 A;  1KQ0 A;  1WH5 A;  3KEQ A;  3WGH A;  1YHQ I;  4BAC A;  2EK5 A;  4F52 A;  3OV8 A;  3FDY A;  3V8K A;  4I99 C;  4XN3 A;  1HDP A;  5HNF A;  3CQZ J;  4YIF A;  2VE8 A;  2UV1 A;  3ZQ7 A;  4OIN F;  1HKS A;  5D8L B;  3A03 A;  3OYM A;  2YU9 J;  3ABU A;  1IGN A;  3H9G A;  5FD5 A;  2C6Y A;  3F8B A;  4J19 A;  2VBZ A;  4BE1 A;  2BHZ A;  5CQG A;  1SVM A;  2UUZ A;  4S0H B;  2VBW A;  5IOY A;  3JR9 A;  1YOV B;  1XPX A;  4LIU A;  2DFI A;  2I10 A;  3I59 A;  1GXP A;  1APL C;  3L2U A;  1R1V A;  1XGM A;  4MTD A;  2VJJ A;  4M9Z A;  2QF7 A;  3H35 A;  5M5Y J;  4J00 A;  5HS8 A;  3KE2 A;  1WJC A;  3CC7 I;  2FE3 A;  3KP2 A;  2Y2Z A;  4JX6 A;  4HQE A;  1EA3 A;  2Y31 A;  1TL8 A;  3V42 A;  4IKF A;  2H1L A;  4O3M A;  4IRI A;  1J5Y A;  1LFU P;  4ESB A;  5JVG F;  2CV2 A;  5L3E A;  4DYR A;  2Z9O A;  2NXN B;  2GA1 A;  5DTD A;  3H36 A;  4J01 A;  1JXS A;  5C3E J;  4IQ4 A;  5F6F A;  1YS6 A;  3HBL A;  2V7F A;  2MLG A;  4LMY A;  1HF0 A;  2B0L A;  4BJT A;  3BR2 A;  3K2A A;  4I0B A;  1H89 C;  3IHU A;  4MLO A;  1XCB A;  4PFO A;  5CQE A;  2BE5 F;  1A6Q A;  2GBY A;  3TW6 A;  5FO5 A;  3R6S A;  2JRM A;  2H1K A;  2G9W A;  1MDM B;  2ESH A;  2H8R A;  4LLN A;  2LRD A;  1X58 A;  2M8G X;  1FLI A;  1R4N B;  2FJ1 A;  1POG A;  1DQU A;  2AXT C;  2W82 A;  2VQL A;  1N75 A;  4XL9 A;  3I56 I;  1KA8 A;  3C7J A;  2QEN A;  4HLX A;  4HDU A;  4A3C J;  1ZAO A;  2M1B A;  4M6X A;  1AOY A;  3BY6 A;  4Y13 A;  2QEX I;  3L7W A;  4Y17 A;  1SEU A;  4HX8 A;  3BJA A;  3QWL A;  5BPD A;  2KJB A;  1MDM A;  3FMQ A;  5HDK A;  3SJM A;  3K1P A;  5HOO A;  1JT6 A;  2HDW A;  2KIS A;  1YQA A;  1FEX A;  2M2E A;  3E6C C;  2PG4 A;  2HEO A;  3GTK J;  3M3Y J;  4XRF A;  1U78 A;  3DXJ F;  2BEO A;  1ZN2 A;  1BC7 C;  2KQR A;  2KZV A;  2V9P A;  2QSH X;  1ONV A;  2OF7 A;  3GW2 A;  3BTC A;  3MZY A;  2Z5U A;  3DPU A;  4ZDL A;  1Y39 A;  1IN4 A;  1Z6R A;  4CA0 A;  2M45 A;  4KN7 X;  3AG4 H;  2BXZ A;  3TO6 A;  1ETW A;  2BY0 A;  2RRE A;  2M0C A;  4U0W A;  2DYS H;  3WTT C;  4M3B A;  4M3F A;  4WXD A;  1FMW A;  2EZH A;  2L9V A;  2ZKZ A;  1VI0 A;  2VBY A;  2R7F A;  5E1Z B;  4GGG A;  5EEH A;  3S3O A;  1F1Z A;  4LGW A;  1BC8 C;  2CUE A;  4M9S A;  3A01 B;  3CCL I;  3SDB A;  3ZCO A;  5ICE A;  5K1Y A;  3BTI A;  5GTH C;  1MNM C;  3IH4 A;  5BS6 A;  2AHQ A;  1WRJ A;  2HQ5 A;  2DMP A;  4OMY A;  2L02 A;  3ABT A;  1FYL A;  2Y75 A;  1H88 C;  5ICC A;  2RNJ A;  3CDH A;  1ZGJ A;  5GPC A;  3E97 A;  2DOD A;  3DWL E;  3HGY A;  2PMZ A;  2E7W A;  3PNT A;  1IN7 A;  5F08 A;  4LG0 A;  1YTY A;  2KDO A;  2R5Z B;  2W84 A;  5L3D A;  1ZG5 A;  2K85 A;  2DMT A;  1WI3 A;  2R7X A;  3QOD A;  1XX5 A;  1WJD A;  1D5V A;  2CGP A;  1N25 A;  4ESF A;  5GPA A;  4XKC A;  2E1M C;  2A05 A;  3BJO A;  2H09 A;  4QSH A;  2R5Z A;  4E7S A;  1TWH J;  2K7L A;  2ECB A;  1CF7 B;  1IRZ A;  3AG1 H;  3ISP A;  2WAE A;  2QQA A;  4B4C A;  2V9K A;  1S5L C;  1IN5 A;  1O3R A;  2HS5 A;  3LSR A;  1S7A A;  3L1P A;  5DUI A;  1AU7 A;  3CUQ C;  4QWQ A;  3ERE D;  2CV0 A;  4AIH A;  2LP0 A;  2UXN A;  1JTX A;  2GIZ A;  2DBB A;  3OYN A;  1CF7 A;  2DOA A;  4KT5 C;  4PJJ A;  1Y1V J;  3CTA A;  4IOC F;  4ENN A;  1Z3X A;  3BG3 A;  4XM3 A;  2F5D A;  2OCC H;  4BBR J;  2CUJ A;  1WJ5 A;  1L3L A;  1OCR H;  3ZQC A;  4HA8 A;  1IUY A;  3K4C A;  2IGK A;  4CDG A;  1XSD A;  3SZT A;  3LQR A;  3AL0 C;  1BW6 A;  2HYG D;  4MGR A;  3GVA A;  2L7M P;  3C1D A;  4EJV A;  1EKE A;  2YX7 A;  3KX2 A;  4KIC A;  3BLY A;  3W6K B;  1IXS B;  2PQ8 A;  4RGU A;  4L0Y B;  4G8X A;  4IO9 F;  2KRH A;  3ROU A;  4DOZ A;  5D4S A;  1K78 B;  3BDD A;  2Q0O A;  3KP5 A;  1XS9 A;  4BE0 A;  1UEL B;  3HKZ A;  3T0Y A;  4A6D A;  4AM3 A;  2Y0M A;  3ZQF A;  2E1O A;  2LF8 A;  2OTL I;  4BQA A;  2W24 A;  3GEZ A;  4U87 A;  1R58 A;  1XSX A;  5FB2 A;  5FKM A;  2JQ7 A;  3IL2 A;  2H6B A;  4AYB N;  2PMH A;  4DYC A;  1JUM A;  3QAH A;  3F8M A;  3CCM I;  4A3L J;  3BR6 A;  1W5T A;  1O3Q A;  3S2D J;  4UUV A;  1HKQ A;  3ASN H;  5C4J J;  2M9H A;  3UR3 C;  4E7Z A;  3K6G A;  2P5L C;  1HXD A;  3HHG A;  2R7O A;  1P4A A;  1P4X A;  2K4B A;  1FBU A;  3JRI A;  3OIO A;  4A69 C;  2GIV A;  3A4C A;  3TP3 A;  5JHU A;  3B02 A;  1A31 A;  4H4K C;  1XD7 A;  3ZMD A;  1E0E A;  4BY1 J;  1OCP A;  2IS6 A;  1X1P A;  2VXD A;  3V7R A;  3FBN B;  1U0J A;  4DW6 A;  2VPL A;  4PGG A;  4ZYD A;  3LA2 A;  3WG9 A;  3KYC B;  3VSK A;  1DU6 A;  4KYW A;  4A0Y A;  3F72 A;  2JRT A;  1DP3 A;  3U2R A;  4I6Z A;  4PSW A;  1X3W B;  3DEW A;  3L2R A;  1EH7 A;  1BL0 A;  3G1M A;  4HOB A;  1YFH A;  2Y0S A;  3I54 A;  3S16 J;  1UHW A;  1QPI A;  3KCC A;  3NQO A;  3G71 I;  2L9S A;  3H0G J;  2GOX B;  1V5G A;  2XDV A;  1YIT I;  1WVR A;  4P1W A;  4ITV A;  4JX4 A;  2XAJ A;  3V8L A;  3SYT A;  1Y56 A;  5E3O A;  2R3S A;  2YSR A;  3FM5 A;  1W7P D;  3ONQ A;  1QQI A;  2ZJP F;  4L5J A;  2JA5 J;  2F5V A;  3PUB A;  1G6N A;  4E7L A;  4MO7 A;  5FKL A;  1PDN C;  3MVP A;  4UUS A;  3GX4 X;  4ABZ A;  4NQW A;  1ZYR F;  3CUQ B;  2DJI A;  1NHA A;  2KIU A;  2KJC A;  3HUG B;  4UVA A;  3FIS A;  3J7Z I;  2WY8 Q;  3RTR A;  4DJA A;  1ZQ3 P;  2EIJ H;  5A2Q Z;  4G7O F;  2EH3 A;  2MD5 A;  2HR3 A;  2A6H F;  2O7O A;  1KON A;  2CH0 A;  3FX3 A;  1VTN C;  1JKQ C;  3DEU A;  1E3H A;  1IO2 A;  2NS8 A;  2XF6 A;  3CUQ A;  2XPV A;  3K1M A;  4BQQ A;  3BWG A;  4QTR A;  5K7F A;  2O9L A;  3S2H J;  4XOP A;  2WC2 A;  4EMS A;  1Z1D A;  1DUX C;  1V54 H;  2G0E A;  4DIQ A;  3AL0 B;  2MBF A;  2MLK A;  4BHC A;  2HOT A;  2MC4 A;  3KP4 A;  1TWA J;  2MC3 A;  4E7K A;  1FBS A;  1R5G A;  4B48 A;  2IS2 A;  2HDC A;  3L9F A;  2HQN A;  2GZW A;  4WF2 A;  3IUO A;  1WJA A;  1TWF J;  2R7W A;  5GAE J;  2IS4 A;  2O3F A;  1J7K A;  2Z2S B;  4GDF A;  1UG0 A;  2IEK A;  3FBI B;  2LKS A;  2ISY A;  1EH8 A;  2BW3 B;  2FX0 A;  2NOJ B;  3KEO A;  1YYV A;  5BPI A;  1VQN I;  2MAB A;  3ZOB A;  2DLL A;  3JTG A;  1YS7 A;  2VJ5 A;  3DLA A;  5HDG A;  4BHP A;  2HYJ A;  2VAS A;  2XRL A;  1BJA A;  2WA0 A;  3M7G A;  2DTR A;  4HV5 A;  3PNY A;  5EZG A;  2W25 A;  3DFG A;  1ZEL A;  4NBQ A;  4A6E A;  3I58 A;  3T8T A;  4R1H A;  3BG9 A;  2VE9 A;  3FKI J;  1HSJ A;  4XN0 A;  1HLV A;  1R00 A;  3ABM H;  4E7H A;  2NNN A;  3DKX A;  3ZRG A;  5LEK A;  2XGD A;  1MW7 A;  2R5Y B;  5F0C A;  2OAZ A;  3HC7 A;  3ZQI A;  1JE8 A;  2GXB A;  3JRF A;  2IS1 A;  3E0J B;  2FBI A;  1G2H A;  1TNS A;  3KP6 A;  1XDU A;  2BXY A;  1VQ7 I;  2A07 F;  1KU9 A;  1OQY A;  4CYC A;  1AKH A;  2EFN A;  1U5T A;  1K79 A;  4FET A;  2IRF G;  1ETQ A;  2FUG 2;  2KZG A;  1I27 A;  2R5Y A;  1LEA A;  1LEB A;  5C44 J;  4LLG F;  2D1H A;  4CCL A;  5CKT A;  2VL8 A;  2XRO A;  4DZJ A;  1RIO H;  2X4H A;  5L3G A;  2X51 A;  1WPK A;  2L3D A;  4AIJ A;  1H8A C;  3H1C A;  3DV8 A;  4CSW A;  3MMY B;  2VUM J;  1T0F C;  3MD2 A;  3OWT A;  3FXM A;  3S3M A;  1X2M A;  3OYG A;  1FOK A;  2MFZ A;  3A1Y A;  2O6G E;  3WTS C;  2L01 A;  2DU9 A;  2BBY A;  3M1E A;  2UXX A;  1NK2 P;  3I9V 2;  4S05 A;  1YJ9 I;  4WCG A;  3V7C A;  4KIG A;  3G3Z A;  3ZPL A;  2QQ9 A;  2XF5 A;  1IC8 A;  4L9N A;  1YIO A;  1XMK A;  3E3V A;  4XOR A;  3E1S A;  4G7H F;  2JTV A;  3CD6 I;  3P5J A;  2ADU A;  1TT5 B;  3O2P E;  3KYL A;  1B59 A;  3PFI A;  2HI3 A;  5EJC A;  2XGE A;  2X1C A;  3RKW A;  1MMD A;  4P5O A;  4X6A J;  1BR2 A;  1K83 J;  3VWB A;  2XAG A;  1W7P B;  3L00 A;  2HZT A;  2PJR B;  3S93 A;  2GXG A;  4Y15 A;  1PUF B;  2CU7 A;  2GM4 A;  3K4K A;  1FJL A;  3FM3 A;  1BA5 A;  2FXA A;  2OPT A;  4PGH A;  2QSG X;  1GLN A;  4KJZ A;  3QU3 A;  4XKB A;  1VQ6 I;  3ABL H;  1MD0 A;  1OCO H;  3RQ4 A;  4KIF A;  2V1X A;  1ON2 A;  1SD6 A;  1ERD A;  2KLO A;  4B43 A;  2OV7 A;  1YJN I;  2DDB A;  1Y8Q B;  3GFL A;  4GRI A;  2FMY A;  1PUF A;  3AAF A;  3EET A;  1C0W A;  1T98 A;  2TDX A;  1ETO A;  2XV4 S;  2WAD A;  5CVJ A;  1UHM A;  2X85 A;  5DV5 A;  3ZP5 A;  2CFO A;  2P0W A;  2EBI A;  3O6B B;  2ME0 A;  2LSO A;  1AHD P;  2J5O A;  3MWM A;  2K9N A;  3C2B A;  5E1W A;  1Y0U A;  1LDD A;  2FF4 A;  4EEF G;  2NAZ A;  2O8X A;  3CJR B;  3ZMV A;  1V5F A;  1S9H A;  3CLO A;  4EV0 A;  4YG2 F;  1D0Z A;  5DS9 A;  3MCZ A;  4FE4 A;  4MIM A;  3F8N A;  3I4P A;  1RUN A;  3CC4 I;  5HOD A;  2JPB A;  1U9N A;  4C2U A;  2V9V A;  4BXX J;  1J75 A;  1P92 A;  3B6A A;  4LK1 F;  1DGW Y;  2RVC A;  3D5S C;  3TL4 X;  2KFD A;  4WK8 F;  4A3K J;  3FXL A;  2QYO A;  2ZFW A;  4YFN F;  1Y6I A;  2F4M B;  3SEZ A;  5E17 F;  1RNL A;  2GXA A;  4M3E A;  4OIR F;  4B09 A;  4BY7 J;  4CCO A;  5ILV A;  2EA4 A;  5GP9 A;  2CW7 A;  3GTO J;  2O5R A;  4D1Q A;  2EZK A;  3QYB A;  1W1W E;  3A2K A;  3K7A J;  5DYM A;  2IGO A;  3BZK A;  3ZXS A;  1W5C C;  3CZ6 A;  2FNA A;  3CP2 A;  4A2U A;  1JJ6 C;  1HDD C;  4IHS A;  3RQI A;  4BXU A;  1HQC A;  2NVY J;  2XKP A;  5GAD J;  2OQR A;  3CJQ B;  1Z3Y A;  2W48 A;  4ZYA A;  1T0F A;  4HQM A;  5D5X B;  1GT0 C;  2ZBK A;  4UB6 C;  2A6T A;  2HKX A;  3HTS B;  3TED A;  2PX9 A;  3OIP A;  1R36 A;  2DTZ A;  5L3B A;  4XLC A;  2XF7 A;  4DBQ A;  4G12 A;  3E5X A;  4BGD A;  4S04 A;  2LMD A;  1Z0X A;  4IOA F;  3HHH A;  4EM0 B;  3J80 Z;  2ZJ2 A;  3ELK A;  3SFZ A;  2HDD A;  4XMY A;  1VFC A;  3FXO A;  5IPA A;  3FMR A;  2ZSI B;  2L4A A;  4UY8 I;  3K0L A;  2COB A;  4RLF A;  3ZN0 A;  1TQI A;  3JTH A;  3JSO A;  2LF7 A;  4AYB A;  5LHH A;  4CGZ A;  3SZG A;  1OFC X;  2W85 A;  4A3D J;  3QOE A;  3I55 I;  2ISZ A;  1MJ9 A;  4WX9 A;  3JRD A;  3ECO A;  3H92 A;  3OSF A;  2V1D A;  4C3J J;  1QPM A;  5ED4 A;  1FOW A;  1UZC A;  4O5V A;  2CW0 F;  4L9T A;  3VPR A;  3HZJ A;  3LQQ A;  4E6K G;  3KPH A;  3ZQH A;  2M7B A;  2HVQ A;  4PUS A;  1XG1 A;  2M30 A;  4IRH A;  5L3C A;  1RRJ A;  1H9T A;  2AXL A;  1D3Y A;  3CJT B;  4ENJ A;  2E2J J;  2EV0 A;  2A69 F;  4A5M A;  5HLH A;  1FP2 A;  3LWF A;  1TWG J;  1LUJ B;  2FQ4 A;  5AIQ A;  5J4V A;  3RZO J;  1ZK8 A;  3BR1 A;  2DT5 A;  5DCF A;  1AWC A;  4AU7 A;  4GO1 A;  4HNT A;  2LBF B;  1QU3 A;  1V3F A;  4YEJ A;  1R1U A;  2LY9 A;  2XRN A;  4ZYH A;  1I3A A;  3DCF A;  2F48 A;  4M73 A;  5F27 A;  3QP6 A;  4CCJ A;  2EV5 A;  4A3J J;  4UNO A;  5J8F A;  3I4M J;  5M5W J;  2DT7 B;  2L5Q A;  3TQN A;  1NG6 A;  2LY1 A;  3TBI A;  3R0A A;  3KLN A;  4F7Z A;  1FMV A;  3A0H C;  2CJJ A;  3OYF A;  3OS0 A;  4V19 K;  3CO6 C;  1OR7 C;  1IUF A;  4PCQ A;  4PK4 A;  3MEX A;  4NC8 A;  4IX7 A;  1I50 J;  5HNH A;  5FLX Z;  1NTC A;  2VXZ A;  1Z91 A;  2DA2 A;  2QKM B;  4KNY A;  3WTZ A;  1BIA A;  3LSJ A;  2DT6 A;  4RA2 A;  1Y8R B;  4XIC A;  2IA1 A;  3R4K A;  5EF6 A;  1LFB A;  1TC3 C;  3DTE A;  4HW0 A;  3BR0 A;  3HM5 A;  4DGW B;  1X19 A;  1R23 A;  1ZRE A;  2KP6 A;  2PN6 A;  4CCN A;  1VF9 A;  1W4M A;  5FRM A;  2JA8 J;  2D1V A;  1IXC A;  5BQT A;  3M8F A;  1ZGA A;  3LSG A;  4UHT A;  1V5E A;  1YX5 A;  2XKO A;  1BI3 A;  1B72 B;  5DM6 F;  2EFW A;  2V6E A;  2VKE A;  4XR6 A;  4QLC U;  5KAI C;  2HZD A;  3HEF A;  2BOL A;  2FA5 A;  2NS0 A;  5IP7 J;  2CQK A;  5IP9 J;  5JLX A;  3S32 A;  4UVC A;  3W2W A;  2M3A A;  4I01 A;  4BL0 B;  3HRS A;  1XTA A;  4A5N A;  3AFH A;  1JHH A;  4E70 A;  2E2H J;  4CYD A;  4JOM A;  3FMS A;  4EJO A;  2HWV A;  3CUO A;  4CO8 A;  1VQ9 I;  3GF2 A;  2ESN A;  1FTT A;  5KK1 A;  2KRC A;  3ASO H;  4IJA A;  1V55 H;  2JK3 A;  4XKV A;  1F5T A;  1XDS A;  3PIP F;  2E5N A;  1WFX A;  1ETK A;  4MHG A;  2M5W A;  4B3A A;  1DPR A;  2VPR A;  3JRA A;  3LFU A;  1I39 A;  3PJR A;  1JI8 A;  1RR7 A;  1OCC H;  3IKT A;  1G3S A;  1UG2 A;  3VEP A;  1YLF A;  4GFB A;  1LDJ A;  3IWF A;  4ASN A;  4X1E A;  1MSE C;  2QCO A;  2X1D A;  2LDU A;  2F5C A;  3ZN1 A;  4W1U A;  3GXO A;  4CH7 A;  2PFB A;  3CC2 I;  1MMN A;  4MQV A;  3MFK A;  1A04 A;  2Y9Z A;  3A01 A;  1KU7 A;  3M8J A;  5KAF C;  2BVL A;  3GME A;  2BZT A;  3SHF A;  1VQ4 I;  3TO9 A;  2DPD A;  2CG4 A;  2O61 A;  1Y1W J;  3IAM 2;  3G2B A;  5D4R A;  4X0G A;  2P7C B;  4IVN A;  5KVR A;  4M72 A;  5H20 A;  1EF4 A;  1X1C A;  2JSC A;  5H6Q A;  5HLT A;  2JA2 A;  4LJZ F;  2HGC A;  1BI1 A;  1BIB A;  1RZ4 A;  3WU0 A;  2VQG A;  4P55 A;  1WSU A;  3GLL A;  4EGZ A;  2ZME C;  3CF2 A;  5BMZ A;  3HTU A;  3FK7 A;  3FXR A;  3BZ6 A;  1XCV A;  3KFW X;  4HNU A;  2CRG A;  4I02 A;  1VQP I;  3CMM A;  3REO A;  2K27 A;  4L9J A;  3SQN A;  1TW2 A;  1ZRD A;  1BOA A;  5E3M A;  1OYW A;  2EIM H;  1YIJ I;  1MSF C;  4HF1 A;  2RNG A;  4XNF A;  1ODD A;  3DP7 A;  3IKV A;  1A6I A;  2N8G A;  4XLA A;  5E20 A;  5M5X J;  4ZZL A;  1T2K A;  4MEX F;  1R6R A;  3JRG A;  2LKX A;  1PVE A;  4RAY A;  1OR7 A;  2HYF A;  1NG7 A;  4XID A;  2P6T A;  2FML A;  1GV2 A;  3B73 A;  2XAF A;  2HNH A;  2ZO4 A;  3OYE A;  1WHU A;  2ID3 A;  5IYC J;  1PP8 F;  1VZ0 A;  1RKW A;  1K7A A;  5F0H A;  3E7L A;  2PLY A;  3TOA A;  2H94 A;  5EGO B;  4KMU X;  2R0Q C;  1YE9 A;  4EJU A;  2CWE A;  2FSW A;  1SAX A;  4FCY A;  3QU6 A;  5ICF A;  1K61 A;  4BEH B;  4XRS A;  1ZLK A;  2B7E A;  1LFP A;  2CUF A;  1IN8 A;  1R1T A;  2L9N A;  4AVZ A;  4L9V A;  4HF0 A;  4UB8 C;  2OC6 A;  3PO2 J;  4L5I A;  3J80 K;  1O7F A;  4M71 A;  1FC3 A;  4AID A;  1ZTR A;  3FZV A;  3CCY A;  4IHT A;  4C3H J;  2DA1 A;  1K78 A;  1IN6 A;  4I76 A;  5LLQ A;  2IVM A;  1WQ2 A;  3LST A;  3LMM A;  2EIK H;  3BG7 A;  2YS9 A;  1VQ5 I;  5HS9 A;  1LVK A;  2L2O A;  1MMS A;  1G3Y A;  1GVJ A;  5DEQ A;  3BR5 A;  2RQQ A;  3LFK A; 
#chains in the Genus database with same CATH homology
 1IV6 A;  1MBK A;  2LVS A;  3GTG J;  5C44 J;  1E3O C;  3S15 J;  1I6H J;  4JYK A;  4W97 A;  4DZJ A;  4JP0 A;  2ZB9 A;  4IHX A;  1GDT A;  1WPK A;  1H8A C;  1LE8 B;  2DA7 A;  2VUM J;  3RZD J;  1X2M A;  4D7N A;  2ID6 A;  3ZQG A;  1NK2 P;  2LFB A;  9ANT A;  1SAN A;  1D5Y A;  1IDZ A;  4V2G A;  1IC8 A;  1LE8 A;  1W0T A;  2R7Z J;  1W0U A;  5F0F A;  4IEJ A;  5EG0 B;  2YUS A;  2HI3 A;  2XSD C;  1JKP C;  1Z77 A;  2XGE A;  4X6A J;  1K83 J;  3LOC A;  2IBD A;  2GLO A;  4A3F J;  3BG5 A;  1MH3 A;  5J1Y A;  1PUF B;  2CU7 A;  1UMQ A;  5EG0 A;  2GM4 A;  3FIW A;  1FJL A;  3PM1 A;  3RKQ A;  1WH5 A;  1BA5 A;  3PO3 J;  2OPT A;  2FD5 A;  3O8H A;  3WHB A;  2NS7 A;  3OSG A;  2L7F P;  2VI6 A;  1CQT A;  2NVX J;  2R93 J;  1HDP A;  3S1M J;  4A3G J;  3CQZ J;  5C4X J;  2TCT A;  2DMQ A;  2L0K A;  4V2F A;  1PUF A;  3A03 A;  1T56 A;  2YU9 J;  3F0C A;  1IGN A;  3GTQ J;  2XPW A;  1ETO A;  4J19 A;  1XC5 A;  3S1R J;  1MBE A;  3JR9 A;  4S0H B;  5IOY A;  2EBI A;  2ME0 A;  2X6O A;  2I10 A;  1AHD P;  1APL C;  4A3M J;  2K9N A;  3C2B A;  3QPS A;  4XK4 A;  2QF7 A;  3BTL A;  4EEF G;  5M5Y J;  4AC0 A;  2Y2Z A;  5E3L A;  4JX6 A;  2DMU A;  5IYD J;  2Y31 A;  1OCT C;  1ORK A;  3Q3S A;  3CMY A;  4FE7 A;  5EEA A;  5DS9 A;  1LFU P;  2JN6 A;  4DYQ A;  4FE4 A;  2MSY A;  4MIM A;  3B6C A;  1RKT A;  2MG4 A;  2JA6 J;  4DYR A;  5HOD A;  5DTD A;  1U9N A;  2HXI A;  5C3E J;  4BXX J;  1GUU A;  3B6A A;  3HBL A;  5EZH A;  1MH4 A;  2XB0 X;  4A3K J;  1HF0 A;  1UHS A;  3BR2 A;  3K2A A;  1P7J A;  1H89 C;  4MLO A;  1TWC J;  5EDN A;  5EGO A;  3OOU A;  2GBY A;  4AUX A;  3TW6 A;  5F1J A;  5EYR A;  4M3E A;  2H1K A;  4BY7 J;  1QRY A;  2H8R A;  1X58 A;  2M8G X;  5GP9 A;  2X48 A;  2FJ1 A;  1POG A;  1JKO C;  3GTO J;  2ELK A;  2AO9 A;  5J1R A;  2EZK A;  3K7A J;  1A5J A;  4A3C J;  2XPU A;  2X9D A;  1ZR2 A;  4XRM A;  3TP0 A;  2L7Z A;  3HOY J;  5J1U A;  1F36 A;  4A3I J;  3Q0U A;  1JJ6 C;  3MN2 A;  1HDD C;  3W6V A;  3SJM A;  3RQI A;  1JT6 A;  1FEX A;  2M2E A;  2NVY J;  1JT0 A;  4XRS G;  4A3E J;  3GTK J;  3M3Y J;  3MKL A;  2DA6 A;  1U78 A;  2W48 A;  2E19 A;  1GT0 C;  3HOU J;  1JJ8 C;  2DMN A;  2OF7 A;  3TED A;  3BTC A;  3ZQL A;  1RET A;  1FIP A;  2DTZ A;  2RAE A;  1ZGW A;  4G12 A;  4A93 J;  1Z0X A;  1ETW A;  3IH3 A;  3GTM J;  2DJN A;  5F04 A;  1MBF A;  2M0C A;  2HDD A;  2LD5 A;  5FKO A;  3O8G A;  4M3F A;  4M3B A;  1VFC A;  5IPA A;  4RBO A;  2O8K A;  2EZH A;  1VI0 A;  2PMZ N;  2LR8 A;  2COB A;  4DZP A;  4IHW A;  1WGX A;  4IHY A;  2CUE A;  3UKG A;  3A01 B;  5FKK A;  3S1N J;  1OFC X;  1I3Q J;  3IH2 A;  3BTI A;  4A3D J;  2ECC A;  1MNM C;  4UUT A;  3IH4 A;  3JRD A;  2AHQ A;  2HQ5 A;  2DMP A;  3SFI A;  4UUS B;  1S7E A;  3OSF A;  1H88 C;  5GPC A;  1ETY A;  5M3F J;  4C3J J;  4A3B J;  2KT0 A;  2VKV A;  3HGY A;  3HGG A;  1VND A;  3VPR A;  1RPW A;  2Y30 A;  5F08 A;  2TRT A;  2WB1 N;  2R5Z B;  3ZQH A;  3QPL A;  1XG1 A;  5K7H A;  1T33 A;  2DMT A;  1WI3 A;  4JX5 A;  4C3I J;  2E2J J;  3GTJ J;  1TWG J;  1GVD A;  4BBS J;  1B8I B;  5GPA A;  2FQ4 A;  3RZO J;  1ZK8 A;  3BR1 A;  1WCM J;  2HOS A;  1HOM A;  4QSH A;  5E3N A;  2R5Z A;  1TWH J;  2ECB A;  1IDY A;  1IRZ A;  2L9R A;  4B4C A;  1ENH A;  3S17 J;  3BQY A;  2LY9 A;  3LSR A;  3L1P A;  1AU7 A;  3DCF A;  5F27 A;  1ETX A;  5FLM J;  4A3J J;  1JUP A;  3I4M J;  2LP0 A;  1JTX A;  5M5W J;  3Q0V A;  2JJ7 A;  1Y1V J;  3S1Q J;  2CJJ A;  4D5C A;  4HNV A;  3BG3 A;  1SFO J;  2K40 A;  3JRC A;  1IUF A;  1HCR A;  1I50 J;  4BBR J;  3SDG A;  3HKZ N;  3ZQC A;  3IV5 A;  1NTC A;  2E2I J;  2DA2 A;  1FIA A;  3LSJ A;  1BW6 A;  1NK3 P;  3I4N J;  2L7M P;  4XIC A;  5EF6 A;  4QIW N;  1LFB A;  2JMW A;  5FJ8 J;  1TC3 C;  3BR0 A;  3HM5 A;  5BNG A;  4MFE A;  2NOG A;  3LNQ A;  1RES A;  1VF9 A;  2JA8 J;  4CYC B;  3HOW J;  2Y9Y A;  1AKH B;  3HOV J;  1Q1V A;  3H3V K;  2DA5 A;  4BKX A;  2JWT A;  1XS9 A;  3LSG A;  1FTZ A;  2DA4 A;  1ETV A;  1B72 B;  2D5V A;  3HDD A;  3FK6 A;  2E1O A;  3ZQF A;  2VKE A;  1WH7 A;  2HOA A;  3HEF A;  5FKM A;  2HXO A;  5IP7 J;  5IP9 J;  4AYB N;  4DYC A;  5JLX A;  2NVT J;  1JUM A;  2DA3 A;  2K9Q A;  2LLK A;  4A3L J;  3BR6 A;  3Q0W A;  3S2D J;  5C4J J;  3S14 J;  3BT9 A;  2Y0S N;  2E2H J;  2M9H A;  4M6V A;  5JLW A;  2NVQ J;  1QVT A;  3TW7 A;  3JRI A;  3OIO A;  4A69 C;  3TP3 A;  4Y7N J;  1JGG A;  1FTT A;  2KDZ A;  4BY1 J;  1OCP A;  2JK3 A;  5IP6 A;  3GBG A;  1ZR4 A;  4DW6 A;  1ETK A;  3JRE A;  4B3A A;  2CQX A;  2VPR A;  3JRA A;  2XB5 A;  4L5E A;  2DN0 A;  1RR7 A;  2LK2 A;  1DU6 A;  4I6Z A;  3DEW A;  1UG2 A;  3BQZ A;  3G1M A;  1BL0 A;  3M4O J;  4GFB A;  3S16 J;  2JA7 J;  4B1R A;  1QPI A;  4X1E A;  1MSE C;  2QCO A;  2B63 J;  1GV5 A;  2WV1 A;  3H0G J;  4W1U A;  2P81 A;  4RDU A;  1U9O A;  4JX4 A;  2ME6 A;  5J3L A;  2Y9Z A;  3A01 A;  5E3O A;  1JKR C;  4IHV A;  2JA5 J;  2WAQ N;  1BW5 A;  1Y1W J;  4MO7 A;  1YRN B;  5FKL A;  2MW8 A;  3MVP A;  1EF4 A;  4UUS A;  1MBJ A;  4ABZ A;  4FIS A;  2CQQ A;  1P7I A;  3HOZ J;  3FIS A;  3FK7 A;  1JTY A;  1ZQ3 P;  4D7M A;  1YRN A;  5IOZ A;  2EH3 A;  1JUS A;  2R92 J;  2EQR A;  3LSP A;  3JRB A;  2CRG A;  2O7O A;  1BJZ A;  1JKQ C;  3HB9 A;  4QTR A;  2NS8 A;  1B8I A;  2XPV A;  1IJW C;  5K7F A;  2O9L A;  4FTH A;  3S2H J;  1O4X A;  5E3M A;  2MGQ A;  5IYB J;  1R9T J;  3A02 A;  2M34 A;  2G0E A;  1MSF C;  1U8B A;  2HOT A;  1A6I A;  2N8G A;  1TWA J;  5M5X J;  4Y52 J;  3JRG A;  2LKX A;  3G1O A;  4XID A;  3BTJ A;  1GV2 A;  1MBG A;  1X2N A;  1TWF J;  4C2M J;  5K7Z A;  2IEK A;  2ID3 A;  5IYC J;  3G1L A;  2EZI A;  2EZL A;  1DU0 A;  2FX0 A;  1RKW A;  3BR3 A;  3GTL J;  5F0H A;  1OJL A;  1QVU A;  3E7L A;  3WHC A;  1MBH A;  3ZOB A;  2IAI A;  5EGO B;  2R0Q C;  2HYJ A;  3CDL A;  2K9S A;  2XRL A;  4D5F A;  4FCY A;  4M3D A;  1K61 A;  4LOC A;  5FLV A;  5EZG A;  4XRS A;  3NAU A;  2CUF A;  5M3M J;  3NAR A;  3BG9 A;  1ZKG A;  3FKI J;  1HLV A;  2XGC A;  2LTP A;  3QQA A;  3HOX J;  3PO2 J;  4NDL A;  3D1N I;  2XGD A;  2R5Y B;  5F0C A;  3JRH A;  5FKN A;  3ZQI A;  3GTP J;  1ZTR A;  3JRF A;  3CCY A;  4C3H J;  1F43 A;  1G2H A;  2DA1 A;  4CYC A;  4I76 A;  4MFD A;  1AKH A;  4M3G A;  1IG7 A;  2YS9 A;  1B72 A;  1ITY A;  1ETQ A;  2R5Y A;  3BR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...