1VF9A

Solution structure of human trf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
MEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Comparison between TRF2 and TRF1 of their telomeric DNA-bound structures and DNA-binding activities
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Telomeric repeat binding factor 2
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1vf9A00
2EZKA 3LSGA 3S14J 4FCYA 2L7ZA 2HI3A 3TEDA 5E3LA 1NK3P 5K7FA 5F0HA 3PO2J 3NAUA 4Y52J 3BR2A 2JA6J 2I10A 2NVYJ 4BKXA 2XB5A 3LSPA 1YRNB 1D5YA 1FIPA 2LK2A 2ID6A 3BR1A 1CQTA 1S7EA 1Y1VJ 2AO9A 3BG9A 3FKIJ 2O8KA 5J1YA 3QPSA 5F1JA 3S17J 4JX6A 1JJ6C 1JKQC 3IV5A 4JX4A 1QPIA 2HDDA 1B72A 1TWGJ 1FTZA 1WH7A 1T33A 2M8GX 4X1EA 2OF7A 5K7ZA 2Y31A 1POGA 4A3BJ 3ZQGA 3GTLJ 3HOWJ 1VF9A 1MBEA 2DA5A 4JP0A 3HB9A 3OSFA 2LP0A 5FKOA 5FKLA 4V2GA 5IOYA 1AKHA 3S1NJ 2EH3A 4C3IJ 1ZTRA 2M0CA 1RESA 2LFBA 4BBRJ 2LKXA 2LR8A 1H88C 3SDGA 2JK3A 2EBIA 2TRTA 3QPLA 4XK4A 1I3QJ 3GTOJ 2M2EA 3G1MA 3DEWA 4W1UA 4AC0A 2K9QA 3CCYA 1VFCA 4RBOA 1B8IA 4A3IJ 3JREA 5F08A 5GPAA 3DCFA 4M3FA 4A3KJ 1ENHA 2WB1N 2E2IJ 1Z77A 2JWTA 1FTTA 3H0GJ 4QIWN 3GTGJ 1IDYA 3S2DJ 2AHQA 3JR9A 2X9DA 1UG2A 2LD5A 2E1OA 3TW6A 1B8IB 4QTRA 3TW7A 2NVQJ 1JKPC 3BT9A 3PO3J 3WHBA 3E7LA 1BA5A 3OSGA 2R5YA 4X6AJ 2XGEA 2O7OA 5EF6A 5GPCA 2X48A 2XPWA 3HOVJ 4FE4A 2NVXJ 2EQRA 3LSJA 1I50J 4UUTA 3HOXJ 3CMYA 3BR3A 5M5YJ 1MH3A 2EZLA 4BBSJ 1SANA 2G0EA 2D5VA 2CUEA 3OOUA 3BR6A 4UUSA 1X2NA 4M3EA 2ME6A 3TP3A 2MW8A 4B4CA 3JRIA 2FQ4A 1RR7A 1LE8B 3JRHA 3HDDA 3GTPJ 1JTYA 5IPAA 3ZOBA 5EG0A 5DTDA 4A69C 3MN2A 3UKGA 4XRSA 5K7HA 1Q1VA 1Z0XA 3S1RJ 5J1RA 2R5ZA 3I4MJ 3BR5A 4M3GA 3NARA 1P7JA 1GDTA 3HGGA 2VPRA 2FD5A 2TCTA 5E3OA 1LE8A 1U78A 3HEFA 1BJZA 2HOSA 1ETKA 3O8GA 3IH2A 1OCTC 5F04A 2LVSA 1ZKGA 5IP9J 5IP7J 2DA6A 1GT0C 2CQQA 2HYJA 4AUXA 3K7AJ 3OIOA 4DYCA 3M3YJ 2WAQN 2ID3A 1SFOJ 2R5ZB 1MBGA 1U8BA 2MSYA 3IH4A 5EZGA 5EYRA 1HLVA 3MVPA 4IHWA 3GBGA 4BY1J 5EEAA 4Y7NJ 5C3EJ 2H8RA 1EF4A 3SJMA 4BXXJ 1JT6A 5IYBJ 3GTMJ 3ZQCA 2P81A 1E3OC 1BL0A 2L0KA 5DS9A 3S1MJ 1RPWA 1IUFA 4A3EJ 2WV1A 4CYCA 4FTHA 2DA7A 3HGYA 2L7MP 1ZR2A 3ZQIA 5BNGA 2Y9ZA 4FE7A 3BTIA 3B6CA 4MLOA 2R7ZJ 1APLC 3JRDA 1ETVA 4DW6A 5GP9A 4D5FA 2EZIA 4JYKA 4C3HJ 2HXOA 5M5WJ 1FIAA 2XSDC 1U9NA 2YU9J 3CDLA 3I4NJ 1WH5A 2DA2A 4G12A 1UHSA 3WHCA 2NOGA 1RKTA 5J3LA 3RZDJ 3SFIA 1HDPA 2NS7A 4DZJA 4A93J 2DA1A 3Q0WA 2ECCA 2Y9YA 1K61A 1QVUA 2HOAA 1A6IA 2RAEA 1JUPA 5E3NA 1IG7A 2O9LA 3FK7A 3Q3SA 2L9RA 2CJJA 1R9TJ 3GTJJ 4UUSB 1HOMA 1JJ8C 1AHDP 3H3VK 4I6ZA 2R93J 1GV2A 1NTCA 2LTPA 1Y1WJ 2FJ1A 1JUSA 4A3FJ 4ABZA 2IAIA 4IHYA 1U9OA 2M34A 1OCPA 4DYRA 3JRBA 1B72B 2VKVA 1LFBA 3BTLA 2Y0SN 2R0QC 1BW5A 4NDLA 4C2MJ 3Q0VA 2YUSA 3BQYA 1IGNA 5M3FJ 1T56A 2QF7A 4BY7J 1LFUP 4JX5A 2DMTA 2JJ7A 5IOZA 4A3LJ 5IYCJ 1I6HJ 2DA4A 2ZB9A 4MFDA 2DTZA 4D7MA 1ETWA 4M3DA 1ETQA 2XGDA 4IEJA 5C4XJ 3BQZA 1G2HA 1UMQA 5M5XJ 1OJLA 3A01A 3G1LA 2DJNA 3BR0A 2IBDA 4XIDA 5EDNA 2GBYA 1P7IA 1RKWA 4LOCA 5C4JJ 2XGCA 1AKHB 2K40A 5F0FA 2DMPA 1H8AC 5F0CA 2B63J 1YRNA 3G1OA 1VNDA 4B3AA 1VI0A 1HDDC 2DN0A 1FJLA 5FLMJ 1ZGWA 1WI3A 2JMWA 2QCOA 5FLVA 4A3MJ 3FIWA 1OFCX 5IYDJ 5EZHA 3BTJA 4S0HB 2XB0X 2Y2ZA 1HF0A 4W97A 4XICA 5EGOB 1JUMA 3RQIA 3S16J 5F27A 1MSFC 1X58A 1ETXA 1FEXA 2OPTA 3ZQLA 4FISA 1O4XA 1ZK8A 1F36A 5E3MA 1GUUA 4XRSG 3JRGA 3HBLA 1MSEC 2NS8A 3RKQA 1X2MA 4GFBA 1IDZA 3ZQHA 2HOTA 3A03A 3W6VA 3FISA 2VUMJ 4D5CA 5JLXA 5EGOA 2HXIA 2JA7J 3QQAA 1JTXA 2K9SA 1XS9A 2COBA 1DU0A 3ZQFA 3MKLA 4AYBN 3LSRA 1QVTA 4MIMA 1MNMC 3S15J 4EEFG 1MBJA 2GM4A 1JKRC 2JA5J 1TWFJ 2PMZN 4B1RA 2DMQA 2GLOA 1XG1A 1H89C 4M6VA 2CQXA 2K9NA 2M9HA 2XRLA 5FKNA 1A5JA 1MH4A 3VPRA 1WGXA 2N8GA 1JGGA 3HOZJ 1IV6A 4M3BA 2ME0A 1IJWC 1JT0A 4A3CJ 1ITYA 2CRGA 2CU7A 1ETOA 1ORKA 4MO7A 2Y30A 1ETYA 1K83J 3JRAA 3LOCA 3TP0A 3D1NI 2KT0A 3CQZJ 5M3MJ 3HKZN 2E2JJ 2R5YB 3FK6A 4CYCB 2LLKA 2CUFA 5HODA 3PM1A 4RDUA 1TWCJ 1NK2P 1WPKA 2XPVA 3O8HA 2E19A 5FJ8J 4C3JJ 2IEKA 3S2HJ 2ELKA 2MGQA 2DMNA 2VI6A 4I76A 2JA8J 4HNVA 5EG0B 3HOUJ 4A3DJ 3LNQA 3RZOJ 1PUFA 2L7FP 3IH3A 5JLWA 3GTQJ 2VKEA 1WCMJ 4L5EA 1DU6A 1PUFB 5FKKA 2DA3A 3A02A 3HM5A 1F43A 3S1QJ 2DMUA 1BW6A 3BG3A 1AU7A 1MBFA 1W0TA 3BTCA 3Q0UA 1MBKA 5FKMA 2X6OA 4DYQA 2EZHA 1RETA 2XPUA 1TWAJ 2FX0A 4XRMA 2H1KA 4IHXA 4V2FA 1W0UA 1ZQ3P 1TC3C 4MFEA 4J19A 1MBHA 2JN6A 2E2HJ 4D7NA 1HCRA 1GVDA 4IHVA 3JRCA 2LY9A 3K2AA 1IC8A 5IP6A 2NVTJ 3M4OJ 1QRYA 3BG5A 2ECBA 9ANTA 3B6AA 2W48A 1JKOC 1ZR4A 1XC5A 3JRFA 2HQ5A 1GV5A 5C44J 4A3JJ 4DZPA 1IRZA 3HOYJ 5J1UA 2R92J 3GTKJ 3C2BA 2YS9A 2KDZA 3L1PA 3F0CA 4A3GJ 4QSHA 2MG4A 1TWHJ 3A01B
chains in the Genus database with same CATH superfamily
3LSGA 2L2OA 2V9VA 2L7ZA 3NQOA 2CSOA 4ENJA 1FT9A 3S14J 2ZNYA 4QWQA 3GUDA 3BG7A 1WQ2A 4JQFA 5K7FA 3M8FA 2R7XA 4KNYA 2I10A 2JA6J 4RAFA 1IXSB 4BKXA 3LSPA 2DFHA 3CMEI 1YRNB 1QZYA 1OYWA 2ID6A 1F5TA 3L09A 5LHHA 2BW3B 2KQRA 3DEEA 3GMEA 5J1YA 4JX6A 3HXLA 3IV5A 3F3XA 3I55I 4JX4A 1LJ9A 3ZMVA 3I9V2 4M9ZA 2L54A 2NXNB 1TWGJ 1WH7A 2M8GX 1DDNA 2F5EA 1VQ4I 3H9GA 1EA3A 3KYDB 4II2A 5BMZA 1YG2A 3PNTA 3HOWJ 4PJMA 2ZMEC 3WE3A 1USSA 2EV6A 2DA5A 2EJRA 3IAS2 2LBFA 3OSFA 2LP0A 1R6RA 5FKLA 4V2GA 3CZ6A 4A0YA 2EH3A 1S29A 4OIPF 1QU3A 4HSRA 1XB4A 3KYCB 2K27A 5GTHC 3KP2A 1ZTRA 2K85A 2ZBKA 1X3WB 2KFDA 2YU3A 3PUBA 4L9JA 2QZ8A 1J2XA 2YSRA 1BI3A 5L3EA 1XDUA 3DEWA 2FMYA 4W1UA 3H0DA 3ZMZA 4A3IJ 4PCQA 4XOPA 3BOQA 2H1LA 1OYIA 3ERED 3DCFA 2R7UA 2R7SA 2XSJC 3ZCOA 2M8EA 1FTTA 3L2VA 3H0GJ 1QQIA 2DI3A 2Z9OA 3JR9A 4M6XA 3TW6A 2D2WA 2M4GA 2ACJA 2XHKA 3TW7A 3ABUA 3WTYC 3WHBA 5GAHJ 3E7LA 3PUFA 1ZLJA 1BA5A 1IRFA 2OAZA 4X6AJ 2QM3A 2J5OA 4PJJA 4N4OB 3HOVJ 3CMMA 2E71A 1ZLKA 2EQRA 5ERIA 1ZARA 4XSZF 2LSOA 3EPZA 1X1BA 5H6QA 1NG6A 2DT6A 3ZQQA 4BBSJ 2G0EA 4F92B 2D1VA 5HDNA 2NRAC 2E35A 4RM2A 5KCMA 4B8XA 3J7YJ 2MW8A 2M4KA 4Y33A 3HRSA 1P4WA 1RR7A 1V5FA 3JRHA 3HDDA 1LEBA 4KUMA 4NQWB 1JTYA 5IPAA 1VQ6I 4ZC3A 2EIKH 4BQOA 4OIRF 1YW7A 1MMGA 2V7FA 4ZYEA 5J1RA 3AAFA 3I4MJ 3GX4X 1GDTA 5CKTA 4WXDA 5DCMB 2A07F 2VPRA 4P5OA 2TCTA 4OWRB 2RQPA 4RB3C 3SHFA 2XKPA 2HVQA 3IH2A 1OCTC 2VKDA 1OCZH 4EATA 2ZO4A 5IP9J 1S5LC 3WU0A 2H27A 5H6RA 4KIBA 2HYJA 3JSOA 3TKYA 4PK4A 4XKBA 2CGPA 2PBIA 4IKFA 2EB7A 1S8NA 1HLVA 2ZMEB 5HS7A 3C2GA 3CCMI 1WZ2A 5C3EJ 4M6YA 2IGKA 1TW3A 1JT6A 3GTMJ 4A2UA 2ZXHA 3A0HC 4Y4RA 2WB1A 3K4CA 3T5XA 3FF5A 4EJOA 2HZTA 4YIIA 4F7ZA 3HIFA 4BXUA 3GVAA 4FTHA 5FB2A 2DA7A 3HGYA 1HW1A 4UB8C 2L7MP 4M9SA 3GLXA 3ZQIA 1Q1HA 1SMTA 2HTJA 3BP8A 1IO2A 3J7AO 1MIJA 2R7ZJ 3S93A 1GVJA 4CZZA 3PL8A 3G3ZA 1N75A 1ETVA 1HBXG 3CCEI 2M1BA 2HVRA 2EPFA 2XF7A 5GP9A 5E18F 2BV6A 2L02A 3O3KA 4MTDA 1GXPA 4QLCU 2H09A 3WU2C 3OYGA 3RKXA 4G6DA 3ASOH 3I4NJ 1WH5A 3ZN1A 1SFXA 3B73A 4G12A 3KP3A 1OLTA 5KNLA 2VJIA 1WI9A 1ON2A 2NS7A 2ISYA 2PQ8A 1S7OA 2DA1A 1K4TA 2ECCA 4A93J 4RB0A 3K69A 4AIJA 3S3NA 1A6IA 2JA2A 4OIOF 3GZNB 5LEKA 2YX4A 2OTJI 4EGZA 2O9LA 2E7XA 4IXAA 5JI6A 3H36A 2VONA 2CJJA 1T39A 4RAGA 1R9TJ 1LEAA 2DYSH 3GWZA 4U0WA 3Q5FA 4K2EA 4RS8A 3M7GA 2J5PA 5IT9Z 2NS0A 4LIVA 3BJOA 3TO9A 1OCPA 2F5VA 2W82A 1B72B 4NUBA 3DBHB 1LFBA 1BW5A 2Y0SN 3DEUA 1WJ5A 2BEOA 4BH9A 1ZG5A 2F6CA 1I27A 2CH0A 2XV4S 4GGGA 3ZMDA 3Q0VA 4UVCA 3CMAI 1IGNA 2VOPA 4CZCA 1MDMB 2DTRA 2FNAA 2VBXA 2KRHA 2A3SA 1ZG3A 2IA0A 2X0LA 3HPHA 4F91B 1R58A 5ED4A 2FOWA 2GA1A 3IP4B 1DGWY 4LGWA 2DTZA 3W2VA 4D7MA 5LBQA 2O61A 1ETQA 4JOMA 5C4XJ 3ABTA 4AVPA 2ZJ2A 1UMQA 2VXZA 2P6TA 3U1KA 3AKZA 1OJLA 3A01A 4CCLA 1R1TA 1SFKA 2CUJA 5EDNA 3FMRA 1PJRA 1P7IA 4OAYA 3J81K 3MCZA 4IL6C 1W7PD 4CCNA 5C4JJ 1TQMA 5D6EA 3ONQA 4ZYDA 2B63J 4E7SA 3IL2A 4ZZDA 2P5KA 4IOCF 4G94A 1YE9A 3CCRI 1Z7UA 2HQNA 2QCOA 4E7HA 1OFCX 1R4NB 3BTJA 4E7ZA 2Y2ZA 4W97A 1RIOH 3DKWA 2Z1DA 3ELKA 3LAJA 4B48A 2QA4I 1ETXA 1Z7LA 2OPTA 4XL9A 1T8IA 4S05A 3I53A 2W24A 5LHIA 5DD4A 3TMOA 1KA8A 3DFGA 1VQ9I 5CQGA 2HPIA 3MWMA 1A36A 3PJRA 5H20A 1I6XA 2VJ4A 2NS8A 3RKQA 4GFBA 2VLAA 1IDZA 1PDNC 2VUMJ 3FISA 2F2EA 1RC9A 1ON1A 2OCCH 4RB1A 1XSVA 2HXIA 3E5QA 3LWFA 4DBRA 1UCRA 1JTXA 1D0ZA 3ZQFA 1V54H 4Y15A 4EJVA 2WWYA 2E1CA 2RQQA 1MMSA 4BL0B 1YJNI 4HNTA 1YYVA 2LOOA 1AA7A 1WKMA 2DU9A 2F48A 3W6KB 2ZMEA 4KIFA 2DLLA 3CDIA 1K6OA 3FX3A 4GO1A 3W2AA 4EJTA 4L18B 2KJCA 2X6WA 1TWFJ 2PMZN 1XD7A 2UXNA 2UUZA 4WX9A 5D4SA 3V8LA 4XN3A 3K4NA 3CC7I 1A5JA 5CYVA 3RPUD 1MH4A 2O8XA 5FGMA 2N8GA 3HJEA 1TLHB 1WFXA 3OOPA 2IA1A 1IV6A 2KRCA 3TO7A 2MLGA 4ZYAA 1O3QA 1IJWC 1HXDA 4BJ5C 3FDYA 4BGDA 1K83J 3ISPA 3LOCA 2KT0A 1O3RA 3HC7A 4CHUA 5KAFC 3ECHA 4M9XA 4PUSA 2R5YB 2E2JJ 4HRIA 2GOMA 5GADJ 1QHHD 2LLKA 3FM5A 4NC8A 3I56I 1W5CC 4O5VA 4RDUA 1FZPB 1WPKA 1N25A 3P9CA 2OQRA 2EFOA 3T0YA 3W2WA 3GTQJ 2MGQA 1IN8A 4KA4A 2VI6A 1U3EM 1Z05A 4I76A 2GIVA 3NWSA 2XKOA 4M74A 4A3DJ 2IT0A 1V5EA 3RZOJ 3HTSB 3IH3A 2HTSA 1ZAOA 5JLWA 1B4AA 2DQLA 1WCMJ 1FYLA 2JPBA 2JZYA 2DA3A 2O5RA 1DPUA 3G73A 3GFLA 2RV8A 1D1CA 4YRVA 3IWFA 2KDOA 5B3SH 3RKWA 2B0LA 2PX9A 1MBKA 5FKMA 4DGWB 4DYQA 2XASA 2EZHA 3IKVA 1K79A 1RETA 1MJBA 1SC7A 1I1GA 3JTHA 4IHXA 1TL8A 1QA6A 3DBLB 1I3AA 2VC1A 1VTNC 2GIZA 4I01A 3I58A 4KJZA 1TNSA 1HCRA 3IC7A 1ZREA 1GVDA 3U21A 4ESJA 1MDMA 2DBBA 2IW5A 3ZMTA 4AYBA 1T38A 2LY9A 3K2AA 1SEUA 1X1CA 2DXIA 3M4OJ 1QRYA 3KFWX 2QGUA 1YHQI 3B6AA 4FX0A 3GFMA 1FNNA 1ZGAA 3HSFA 3JRFA 5C44J 4A3JJ 5J1UA 4KT6A 5GTIC 1QGPA 2YS9A 5TJJA 1J09A 3L1PA 3F0CA 2BZTA 2MG4A 3GZ6A 3KP5A 3NWTA 5D5WB 2GXAA 2X6XA 1XMXA 3KYLA 5E3LA 2QVOA 1KQ0A 3EYIA 3CESA 3RYPA 1VQPI 2KKOA 3PO2J 4Y52J 5KHDA 3FHNA 2XB5A 3JCUC 1D5YA 3OL3A 2XRNA 2LK2A 3BR1A 3OYAA 1S7EA 3BG6A 1Y1VJ 2AO9A 3S8PA 1ZH5A 3BG9A 3FKIJ 4AWXB 5F1JA 4BU2A 1UJ8A 2OU2A 4XN0A 2G9WA 1JKQC 1JJ6C 1MMAA 1MD0A 1B72A 1VQLI 3K70D 1G6NA 1LB2A 3A2KA 1OCCH 3QAHA 4X1EA 3KE2A 3OR1C 5K7ZA 4YFKF 2HU9A 1A31A 2B9SA 3ZQGA 3H5RA 2M0MA 1TNTA 2FSWA 1QZEA 2IGMA 4RB2C 4B09A 4JP0A 1IV8A 3HB9A 1JE8A 2QQ8A 5FKOA 1XMKA 2DFFA 2WADA 3OR2C 2CV0A 3S1NJ 2KIFA 2XAQA 4PSWA 4ZJZA 3LQRA 4C3IJ 2M0CA 2CV1A 2ADUA 4NB5A 2HDWA 3FXQA 4BBRJ 3M8JA 1R5HA 3SDGA 2TRTA 2EBIA 4DQ2A 4EM2A 3ESWB 1DP7P 1YS6A 2LRDA 3OYJA 4LFUA 3OYFA 1NH3A 4N0BA 1K78A 3CCLI 3UR3C 2K9QA 3CCYA 1VFCA 1F1ZA 5FLXZ 1B8IA 4BXFA 5HDKA 3HRMA 3LA7A 3RCOA 1I39A 3H5NA 2KIMA 4PDKA 5LGTA 1G4DA 4O3MA 3HUGA 2E2IJ 2MH9A 3F72A 3CDHA 4NC6A 1RR8C 4I7HA 4KT5C 3R4KA 1NG7A 2BW3A 4OAZA 5EEGA 4ZTJA 2HDCA 1B9MA 4DBQA 3OWTA 2P8TA 3MZHA 3FXLA 4NC7A 4LJZF 1ZHFA 1LVAA 2V26A 4G6QA 4PGGA 5CLSA 5L3DA 2IS2A 3BT9A 3CCVI 1E3PA 2L4AA 4I0AA 3OSGA 1B9NA 4MHGA 2NNYA 4MGRA 5DM7F 2R5YA 2DW4A 5J40A 3OYNA 3VOEA 1GXQA 1B59A 1P92A 1O57A 5HS9A 4UUTA 3CUQC 3LSTA 2PJRA 3A0BC 2Y48A 3DXJF 2IGOA 3S2WA 1YX3A 3DTKA 4IRGA 1X2NA 2LF7A 1U6GA 2ME6A 3TP3A 3VYRB 3K1NA 3GO5A 4B4CA 4F3QA 3RPQA 1LE8B 2ELJA 1QPMA 5LD2C 3CJQB 5EG0A 3WGIA 2CO5A 1TT0A 2FBHA 4A69C 3MN2A 4E6KG 2EV5A 4XRSA 4LIUA 1ZN2A 2CFOA 3S1RJ 1B1BA 3IKTA 2UV1A 5FRMA 4RMNA 4IOAF 4G9YA 4M3GA 3NARA 1P7JA 3K1PA 2BXZA 3E6BA 1LQ1A 1UFMA 1U5TB 2V79A 3W3CA 3WGHA 3RPUA 3HUGB 3VSLA 5JVGF 5L3GA 4N4NB 1BJZA 2VC0A 2MBFA 2HOSA 2HZDA 3O8GA 1XN7A 5TGTA 1SD7A 5F04A 1ZKGA 2L5QA 3KPHA 4LMYA 3PIOF 2DA6A 2CQQA 2QYOA 1W1WE 4DYCA 3M3YJ 1X4OA 1Z3XA 4WXCA 1XDSA 2R5ZB 1MBGA 2JSPA 1IUYA 1OQYA 5A2QK 3WTTC 3MEXA 3F8BA 3LSKA 4AVZA 3TDZC 3SJMA 2KIQA 3CO7C 4BXXJ 2E60A 3F21A 3QWLA 3F9KA 1E3OC 5DS9A 3CCSI 2D1HA 1MNDA 4PJLA 4OU0A 3LQQA 4HV6A 4KN7X 1IUFA 4CYCA 1JHFA 2VL8A 2Y9ZA 3HZJA 1PUEE 3GLLA 3BTIA 2XAJA 2QEXI 2BY0A 4BDZA 3Q9VA 4I2OA 3OMYA 5L3FA 3FXUA 2P6SA 2H94A 1T98A 5JVTA 2EZIA 2F5DA 3O6BB 2V4JC 4II3A 1FIAA 3HPGA 5LGNA 2JUCA 2YU9J 3AG4H 3FBNB 2W4SA 1G3TA 1O7LA 2KP6A 1XCBA 4HNUA 2G7UA 5FRNA 4RLFA 1UHSA 3WG7H 2NOGA 1VQKI 2Z16A 1RKTA 5J3LA 2DYRH 1SMYF 2R3SA 2W25A 2E5ZA 3SFIA 1XPXA 2OV7A 4B47A 2QLZA 5CVVA 3M1CA 3Q0WA 1A35A 2Y9YA 1JGSA 3SEZA 3IAM2 5E3NA 2RDPA 4FHTA 4F93B 3Q3SA 1UB9A 3WE2A 2L9RA 2H6CA 4G7HF 2K3FA 1W5TA 1M1EB 3GTJJ 3GYHX 1VQMI 3QYFA 3RTRA 4UUSB 4XKWA 6PAXA 3F8CA 1DQUA 1X3ZB 2A61A 1NTCA 1R4MB 2M7BA 2QSHX 2BOLA 3R6SA 4ABZA 2IAIA 2P7VB 4DOZA 4IHYA 3QYEA 4HSTA 2M34A 4GRIA 2LBFB 2JVHA 3BTLA 2IGNA 4XRFA 1YI2I 1DGRM 2MABA 4C2MJ 4CH7A 3X2QH 3GF2A 1OCOH 3L7WA 3AG2H 2DMTA 2JJ7A 4A3LJ 1U5TC 2MD5A 4L0ZB 4ANJA 1FOXA 1VZ0A 3CF2A 2V9KA 2ZB9A 5FROA 1WJCA 4XLCA 1YX5A 1ETWA 3FHZA 5E20A 2HOEA 2VQHA 3U1DA 2XC7A 5M5XJ 4XLEA 3BJ6A 4U88A 4E70A 2M3AA 3I59A 3G1LA 2IBDA 1MZBA 4CA0A 4XIDA 2H8WA 3RDIA 4LOCA 1SAUA 4BJ6C 2AXTC 2FMLA 3T1BA 3SYTA 5F0FA 1TW2A 4ITVA 5J8FA 3FKJA 4IF4A 3L2QA 1OCRH 1VNDA 1VI0A 2OBPA 2DN0A 1FJLA 5HLHA 4CDGA 1W5SA 5CVUA 2OUMA 1WI3A 4ZTFA 5FLVA 3MMYB 4HF0A 3WTUC 2ETHA 2HKXA 4A3MJ 5IYDJ 2DK8A 1BI2A 2XB0X 3DTEA 1HF0A 1T08B 4IHTA 4NHJA 5LHGA 4G7OF 4AIDA 3BPXA 1FC3A 2PMUA 4F52A 2IJLA 1D3YA 3WODF 1ZK8A 5F64A 2QKLB 3N05A 2IXSA 2QQ9A 2ZCWA 4XRSG 1XCVA 3HBLA 5JFRA 3R0JA 1MW7A 4M71A 2BE5F 2HOTA 2ZNZA 3PQJA 3M9AA 3BJAA 4HLXA 1UELB 4D5CA 2CQKA 5JLXA 5EGOA 1VQ8I 3SZTA 3CLOA 5GAEJ 3QQAA 2W85A 2LMDA 1XS9A 3BZKA 3SFZA 1O3SA 3E5UA 5D8LB 3LSRA 4CXFA 3FWEA 4ON0A 3TL4X 3K4MA 2ZJPF 2MFZA 4ESBA 5HDGA 3ABLH 1BN5A 4U7BA 1SD6A 2DJIA 4ZYHA 1MNMC 2VQGA 3J80K 2EIMH 1W36D 2OTLI 1DUXC 3WU1B 2GLOA 1XG1A 1XGOA 3QOEA 2CQXA 5FKNA 1W4MA 5JHFA 1S72I 3HHGA 3KZIC 4XBFA 1PP7U 3PSFA 3H5AA 4FT8A 5F1RA 2HQRA 2R7QA 4M3BA 2ME0A 4A3CJ 2CU7A 3OS2A 4EMSA 2ZSIB 2EFWA 4BE2A 4HW0A 5M3MJ 2K9MA 2GXGA 3PNYA 2O0YA 1LDDA 1J59A 1WHUA 2G7HA 1ZRFA 2BHYA 3T8TA 2P0WA 3FK6A 1BR2A 1XSXA 2CUFA 1ULYA 4LLLA 4RGUA 2PMHA 4PFOA 5HODA 1TWCJ 2LNBA 3O8HA 5FJ8J 2JSCA 4XMYA 4HDUA 4RGRA 4PSXA 2RN7A 2IVMA 3BCBA 1ACIA 3L2WA 4XLAA 2VE8A 4XLPF 3HG9A 3K0LA 3CD6I 4X0GA 3HOUJ 3EUKL 3TQNA 3LNQA 3BPVA 3A1YA 1I5ZA 2JPCA 2HKOA 1T0FC 3LSIA 3V8JA 2OD5A 1DU6A 3VSKA 1D1AA 2FA5A 5FKKA 1SVMA 3IHUA 3A02A 1F43A 1CGPA 3P7NA 1E17A 4D1QA 3H1CA 2FNPA 1MBFA 1UHWA 1MMNA 3VODA 4EJUA 1W0TA 1AU7A 1KQ8A 2HEOA 2K02A 1YW8A 4UHTA 1MJAA 1R1VA 2X6OA 4RAZA 4R79A 2P7CB 3D5RC 3H9JA 2XPUA 4WF2A 1X4PA 1JHHA 1UG0A 1TWAJ 2FX0A 3F8FA 4PFPA 5K5QA 3KLNA 1JXSA 2W57A 2TDXA 3E97A 3C2HA 3E5XA 4V2FA 3WTXC 3F8NA 2IS4A 2X4HA 5EJCA 4MFEA 1MBHA 4JBAA 1O3TA 4OIQF 2K4BA 3C18A 2E2HJ 1YFHA 1R5GA 3EQLF 2EINH 3WTSC 3IRQA 3PQKA 1UZCA 4IHVA 2X1CA 1SAXA 3DBRB 2HFHA 1F9NA 3DF8A 5L3CA 4IX7A 2NVTJ 5ILVA 2MC4A 5D4RA 1S6LA 2ECBA 9ANTA 1BJAA 2K7LA 5DCMA 1IN4A 5D6FA 1T95A 3RJPA 1IRZA 1P2FA 3C2BA 4CGZA 2Y0SA 2KDZA 4A3GJ 3L2UA 4AU7A 3RQ4A 3ZXSA 3A01B 4FCYA 3TOAA 2HI3A 3TEDA 4QPOA 2LDUA 4E7JA 3E1SA 3RKYA 4MEYF 5DV5A 5F0HA 1FLIA 1R5ID 2V1XA 4A0ZA 3BR2A 4BACA 2NVYJ 4M72A 4WXHA 1IW7F 4LLNA 1RUNA 1FIPA 3KEQA 2K3PA 4BE1A 1RZ4A 4HYEA 2BHZA 4IJAA 2HGCA 1YIJI 5CPRB 4EGYA 1R00A 2O8KA 5GAGJ 4HAMA 2F5CA 1YTYA 3QPSA 2LG4A 1SD5A 2PFBA 5IT3A 2QQAA 5FD5A 4BAYA 5BPIA 1A04A 1H9GA 4ZYGA 2COMA 1YJ9I 2X6YA 3ZMSA 1P4XA 1QPIA 2HR3A 3TDUC 1FTZA 3MZ8A 4Z2YA 4IZZA 2YR2A 3QODA 2PI0A 3GTLJ 2MLKA 2O6GE 2O3FA 3FXOA 1VF9A 5K5RA 1OR7C 4XLNF 1MBEA 1T2KA 3J80Z 2JTVA 2XAHA 3I59B 4KICA 4AIHA 3ZR8X 2LC2A 5IOYA 1AKHA 5D5UB 2ZXJA 3F6VA 2XDVA 3G6EI 4ESFA 4BHPA 3JAMZ 1FBQA 1IN6A 1Z67A 3C7JA 3OV8A 2ZKZA 3DPTA 3O2PE 2LKXA 2EWNA 3GTOJ 3QPLA 1IRGA 4PJ0C 3VYUB 3OIQA 2WV0A 1VQOI 3OYKA 3G1MA 3DV8A 3IUOA 1SVOA 3DPLC 2R7DA 5AONA 5F6FA 3QU3A 3FXMA 5GPAA 3DPUA 3LSMA 2RGVA 4A3KJ 4M3FA 2WB1N 1AWCA 2UZKA 2JRMA 1Y8QB 2VT3A 2XAUA 3K1MA 3LL7A 1Z77A 3MAJA 2JWTA 5B1BH 5IT9K 2DDBA 3GTGJ 3S2DJ 1J75A 3LFKA 2ZJQF 1RRJA 3VDXA 1SVLA 2X9DA 1OKRA 4JK1X 2LD5A 1B8IB 1ZRDA 4QTRA 2CUZA 4Q4ZF 4HBLA 2NVQJ 1KQ9A 1MKMA 3R0AA 1U8RA 3UNGC 2K9LA 2V6CA 1QO0D 5B5EC 3ZP5A 4NBQA 2QSFX 2YX7A 5EF6A 3Q9SA 5GPCA 2FQ3A 2X48A 2XPWA 3ZPLA 2L3DA 3KEYA 3ML6A 1R1UA 3HKZA 1IZ1A 1I50J 3CMYA 4BEHB 2VXDA 3BR3A 1FP2A 1MH3A 2A05A 2EZLA 1R7JA 2OCEA 4ZDLA 2D5VA 2CUEA 3HOTA 1XGMA 3OOUA 4UUSA 3EETA 4M3EA 3MFKA 4CICA 1IAWA 1S3JA 1FWZA 1D0YA 2X1EA 3M1EA 1QZZA 3ZOBA 1DPRA 3SZPA 3F8MA 3JSPA 4DJAA 2CG4A 3CCJI 2ESNA 4GDFA 2E1NA 4UB6C 1BIAA 1Q1VA 1Z0XA 3QP6A 5DD8A 2R7OA 1Y6IA 3MKWB 5D8KB 4ASNA 3F23A 3BR5A 3PIPF 4A0XA 1O7FA 3KZZA 3TO6A 2ZXIA 2W7NA 1JI8A 2FD5A 1YW9A 2JVGA 5E3OA 1LE8A 2E7WA 3HEFA 3T8RA 3WTWC 1ETKA 1XGNA 1LUJB 4MEXF 1ERDA 4P1WA 2WBMA 3K6GA 3M07A 1Z1DA 4IRHA 1V5GA 4A6EA 4F55A 5IP7J 4NNJA 1GT0C 2HVSA 1Y8RB 2F4IA 1YOVB 2BVMA 5FFXA 3GEZA 1SFOJ 1BOAA 3J7AY 5EZGA 3CP2A 5EYRA 4IHWA 1RI7A 4CUGA 4BY1J 5EEAA 5J8CA 2O03A 3U2RA 2A6EF 2LH9A 5HNFA 2P81A 3GZ5A 2L0KA 3PFIA 2QSGX 3S1MJ 1RPWA 2A68F 2DOEA 1LVKA 4GCVA 3MKZA 2Z2SB 5E8IA 3E0JB 2A5WA 2WV1A 2LF8A 1Y56A 3I3LA 3RSNA 2QBYA 3FXKA 3CCUI 2W00A 4ZDPA 2AQFA 3SEQA 2QQBA 4FE7A 5BS6A 4HV5A 1L0OC 2IPQX 3HSEA 1LFPA 2F5FA 1HKTA 2X51A 4WCGA 2H6BA 4DW6A 2L7KA 1G3WA 3H3ZA 1J9IA 1A6QA 2AXLA 2HXOA 2EFQA 2VBYA 4C3HJ 3EUHC 1EKEA 1E0EA 4WWCA 2DPUA 4XSXF 1U9NA 3S3MA 2FF4A 2JUGA 2STTA 2BYVE 1FPQA 3PFYA 3VYTB 2R7TA 1FOYA 2XGXA 3ABMH 2DFIA 1SD4A 3HSRA 1MMDA 1N77A 2KMUA 4P9FA 3OYIA 3MZYA 1K61A 2RNJA 2HOAA 5CQEA 2RAEA 1WRJA 3L00A 4G8XA 2DOAA 2NYXA 4U0YA 3FK7A 3BZ6A 2DT5A 2M7AA 3R60A 5E1ZB 4Y13A 2E1MB 1VQNI 2MD0A 1JJ8C 3H3VK 4I6ZA 4YFXF 1GV2A 2R93J 3MD2A 3V7CA 1JUSA 1KONA 4A3FJ 4UXNA 3HRUA 2Q2EA 2BXYA 5HLGA 2VPLA 2FOKA 3HRTA 5FD6A 2EA4A 2BY1A 4NDLA 3JW4A 3JTGA 2ZFWA 3BQYA 2QKMB 1LFUP 4OOIA 5LRRA 3OY9A 2HS5A 5DCFA 5IOZA 1D1BA 1E3HA 5J4YA 5FFZA 4IO9F 2EV0A 3A4CA 3QPHA 3OYLA 1LDKB 3E3VA 1WJEA 2EIJH 2BVLA 3BQZA 4EVIA 2BY2A 1Z6RA 2KISA 1IN5A 2DJNA 3KIOA 5TRDA 1K6YA 4HX7A 2GBYA 5LRSA 3P5JA 4KFCA 2A5YB 3S32A 2F4OB 2OQGA 1AKHB 3FBIB 2EFNA 2DMPA 3L2RA 3K2ZA 2WTEA 4RAYA 1MJ9A 4L9TA 1Z3YA 5BQTA 1X1AA 4B3AA 1HDDC 5FLMJ 1ZGWA 2PN6A 3OYBA 3FIWA 3OYCA 3DKYA 4CCOA 4S0HB 5ILUA 2W84A 2KL4A 4XICA 1Y39A 2WC2A 2KRFA 1JUMA 3S3OA 3RQIA 2Q2EB 4L0YB 5F27A 1MSFC 1X58A 1FEXA 3ZQLA 5AIQA 3G71I 2XVCA 5B1AH 2CMPA 1F36A 2WA0A 2A69F 5E3MA 4BQQA 3KLOA 2CW0F 4CO8A 1IXCA 3H9QA 5E1XA 2GA2A 1V3FA 3GFIA 4HPQA 5D5VB 2FBIA 2K4JA 2FXAA 2EILH 2KIUA 1R22A 3ZQHA 3OYHA 3FXJA 4Q48A 2MH2A 3W6VA 2IS1A 4KISA 2V1DA 4EM0B 2JA7J 1FBSA 1KU2A 2WAFA 3E6CC 2K9SA 4AM3A 4OMZA 4L9NA 2V1UA 2K86A 5HNHA 1DP3A 1K7AA 3OS1A 1BOBA 2D45A 4LLGF 4L5IA 5D5XB 4I09A 2VKHA 2GM4A 5LLQA 3ZRGA 4CSWA 3VYSB 4MQVA 1HW5A 4ENNA 3CJNA 4M6VA 1FSHA 2VASA 4KDPA 4RGSA 3I64A 2K9NA 2XRLA 3AL0B 2ZJRF 1Z6TA 2ZSHB 3VPRA 3EUHA 1FMWA 4A12A 2E34A 1FY7A 3QU6A 4D9JA 1AOYA 1JT0A 4XQFA 1ITYA 1ETOA 1ORKA 5KVRA 4MO7A 1ETYA 3HYIA 3SZGA 3CQZJ 1K78B 4CCMA 4Q47A 3HKZN 3K10A 5ICEA 4S04A 1X1DA 1OPCA 1XTAA 2Y69H 4CYCB 3RI4A 1V4RA 3OYDA 1GLNA 4UNOA 2VN2A 1NK2P 3D5SC 3PM1A 2VODA 2XPVA 3TOBA 3COAC 3QPTA 2IRFG 2E19A 2RVCA 3FZVA 3ZGKA 2Q0OA 4C3JJ 2IEKA 1ZELA 2HYFA 1WJFA 1L3LA 2DMNA 5HS8A 3ROUA 2HQAA 3DU5A 4IQ4A 1R71A 3CC2I 2CYYA 5FLXK 4HNVA 2CS3A 2IP2A 4BNCA 2CFXA 1PUFA 2X1DA 4J01A 3G2BA 4I98B 2VKEA 4HOBA 1D0XA 5E1WA 2FRHA 4C9YA 4L5EA 1U0JA 2JT1A 4QPQA 5ICCA 3BC8A 2WAEA 2PJRB 2GOXB 1FYMA 2LREA 2DCEA 3AG3H 3DKXA 4FASD 1YJWI 3Q0UA 1KU7A 1Y0NA 2ZC2A 2NVUB 1YQAA 4XRMA 2XF6A 1W0UA 1XGSA 3TGNA 4IQJA 2JN6A 3REOA 2I5UA 3PSIA 2Z5UA 2CW7A 2DAOA 2HWVA 3M8EA 4U0VA 1TBXA 3HTUA 3DP7A 1U5TA 4KITB 1V55H 3B02A 4BJTA 5H2FC 1TQIA 3JRCA 3DLAA 4LD5A 4IHSA 3ULQB 3DLLF 5EEHA 3QYBA 4R1HA 2W48A 2LY2A 1XC5A 3MKYB 2STWA 1WJDA 2R92J 3GTKJ 3CF5F 3PNVA 4FQGA 4QSHA 5L3BA 4Q5SF 1H0MA 1TWHJ 2EZKA 2CQ7A 4P55A 4IPAA 3V7SA 5HLIA 1NK3P 2FU4A 2HYGD 3NAUA 1FMVA 3CJTB 4HZFA 3OS0A 1HSJA 2ICWG 2E36A 2VT2A 3OL4A 1CQTA 4P9UA 1TT5B 4LG0B 4P96A 4ETSA 2GXBA 1OR7A 3S17J 4XORA 2XAFA 2OJED 3J81Z 5AIPA 3N97A 4BYYA 1WWXA 2HDDA 1T33A 2B7EA 2OF7A 2Y31A 1POGA 4U87A 3OYEA 2MA3A 4A3BJ 3IRRA 3NRVA 3QOPA 4IRIA 1PP8F 4BHBA 2HPMA 4B3XA 3HHHA 3J7ZI 4OMYA 3BROA 4LK1F 4XOTA 1BR1A 3I71A 1WVRA 1HA8A 3L2CA 4UVAA 3N4MA 1C0WA 4Z6YA 3WG9A 3EUAA 4I0BA 2V6EA 5DEQA 2OA4A 2OZ6A 3SQNA 3R61A 4HX8A 1RESA 2LFBA 1ZRCA 4M73A 2M5WA 2LR8A 2QUFA 1H88C 2JK3A 3QP5A 4RA2A 4XK4A 3GXOA 1I3QJ 2M2EA 3F22A 2QBYB 4CCJA 4H0EA 1BR4A 2BY3A 4AC0A 1G8XA 1X3UA 4RBOA 1KU9A 5KAIC 3WTZA 1Z9CA 1R23A 4LG0A 3JREA 3I5UA 5F08A 1EH7A 4PZJA 1ENHA 2ELHA 1YO5C 3L9FA 4BHCA 4TV7A 1FOKA 1P4AA 4ENMA 1BC8C 2PEXA 2L4MA 1IDYA 4QIWN 5E8GA 2AHQA 5A2QZ 1UG2A 2CWEA 1USTA 5K5OA 2E1OA 3KETA 3U9GA 1J5YA 1KZHA 4E4HA 4YFNF 1SFUA 2F4MB 2VE9A 1JKPC 3PO3J 2L9VA 4YIFA 4FETA 1U2WA 2OC6A 4XLFA 1P9QC 2XGEA 2O7OA 5B66C 1Y0UA 1ONVA 2MYSA 4FE4A 4HQEA 2NVXJ 4BS9A 3LSJA 2CW8A 1ODDA 1H9TA 3HOXJ 4XONA 2ZFUA 5M5YJ 3KP7A 2WY7Q 3H3UA 4PGHA 1HKSA 1WJAA 3D5LA 1SANA 5HVQC 3BR6A 3BY6A 3RYRA 3F6OA 3JRIA 2FQ4A 1BIBA 3GW2A 1G3YA 5BOXA 3GTPJ 4XLHA 1UAAA 3LA2A 2P5LC 1TZLA 4EQQA 1OMIA 3VWBA 5DTDA 3DWLE 3K9TA 5DDGA 3UKGA 2VJJA 2QWWA 5JR3A 5K7HA 4L9VA 2R5ZA 5DM6F 2L9SA 4ENKA 1LKXA 1STZA 1HKQA 3ERMA 3HGGA 1EV7A 3LAPA 2LKSA 3CCQI 4BUPA 1VQ5I 3ASNH 1U78A 1D8JA 2XIGA 2LVSA 1FBUA 2VQCA 3FXRA 3KP4A 3P9KA 2IS6A 1LPQA 2DOFA 4AUXA 3K7AJ 3OIOA 3BZCA 1FSEA 5ICGA 2WAQN 5DUIA 1R49A 2ID3A 5CVIA 2W1OA 4E7LA 1U8BA 2MSYA 3IH4A 2KJBA 2BGCA 3CC4I 3MVPA 3GBGA 1J7KA 4Y7NJ 2H8RA 5HLTA 1EF4A 1Z21A 3V8KA 1FX7A 5IYBJ 2I8DA 3ZQCA 1BL0A 1S7AA 4ZH4F 4XR6A 2DPDA 3KX2A 3I4PA 4A3EJ 2RKHA 1BI1A 2VIXA 1R36A 4HQMA 2JQ7A 1MNEA 4G7ZF 1SFEA 3H92A 4FX4A 4RM3A 1ZR2A 1XSDA 3ZMUA 4PJNA 5BNGA 4ZZLA 2OZUA 3WTVC 3BDDA 5CJ9A 1K4SA 4A5NA 3B6CA 4MLOA 1APLC 1RNLA 4DIQA 4G6TB 3CUOA 3JRDA 1QBJA 1ZGJA 4V19K 2XROA 1J0RA 2KPMA 1HSTA 1X19A 2L01A 4D5FA 4JYKA 2ESHA 2XF5A 4KYWA 5M5WJ 2GWRA 2XSDC 3OIPA 1REPC 3CDLA 1KU3A 2DA2A 5CVJA 3WHCA 3ZQ7A 3QRFF 2XUBA 5LEJA 3RZDJ 2DO7A 1HDPA 4DZJA 3SDBA 4A5MA 3CUQB 1QVUA 2BBYA 5IY5H 1OYYA 4LITA 3E6MA 5BPDA 1JUPA 4HG2A 3LSHA 3BCAA 1IG7A 3GCMA 3VEPA 3K4JA 4XKCA 4DNCA 3E6DA 5LFAA 2HNHA 2KZGA 4Y17A 1HOMA 1AHDP 4UY8I 1KYZA 1P6RA 1T6SA 2LTPA 1B6AA 2RREA 1Y1WJ 2FJ1A 3BWGA 1G3SA 2UXXA 1U9OA 3JRBA 4DYRA 1ZYRF 4YIRX 4AIKA 4EJWA 2VKVA 2R0QC 2ISZA 4RGXA 1HQCA 1EH6A 4GYIA 2YUSA 2JRTA 2WY8Q 5TISC 3H35A 5M3FJ 1T56A 2QF7A 4BY7J 1OISA 2FUG2 4JX5A 2YPRA 5DUKA 5IYCJ 1IRXA 2PMZA 1IN7A 1YIOA 1BM9A 4H4KC 5DYMA 2P5VA 1XX5A 3C1DA 1I6HJ 2R4GA 2DA4A 4XKVA 1KYWA 4MFDA 4A6DA 5HOOA 3K4BA 4M3DA 2XGDA 4IEJA 4B44A 4EM1A 5K1YA 4CYDA 5KK1A 1G2HA 1BC7C 2A6TA 2E5NA 4BQNA 1TQPA 4HLYA 3BR0A 4UV8A 3LA3A 2DODA 1EH8A 2M30A 2AQEA 1RKWA 3AG1H 4CCKA 3DQVC 2XGCA 1IXRC 2Z3YA 4KN4X 5J4VA 2Z99A 3G4SI 4KMFA 2K40A 3CO6C 3FM3A 1S9HA 4KIGA 4LB6B 1H8AC 3I54A 4C2TA 5F0CA 1E2XA 3DTIA 4BE0A 1YRNA 3G1OA 1WSUA 3RIRA 4UV9A 1ZG1A 2GAUA 2Z33A 2UWMA 1T0FA 2M87A 4BQAA 2FEZA 4BEHA 2JMWA 1KGSA 4LG3A 3BLYA 2EK5A 3SXYA 4I99C 4C30A 5EZHA 2DK5A 2L9NA 4UUVA 3GFJA 1X1PA 1TP4A 2NAZA 3P9IA 5EGOB 1QNTA 3S16J 3KCCA 4C2UA 3EDPA 1XMAA 1YS7A 4J00A 3D0SA 4FISA 1O4XA 2DT7B 1GUUA 5LGUA 1G59A 4LK0F 3JRGA 1BBYA 2FBKA 3K70C 1MSEC 1X2MA 2XAGA 2P4WA 2Y75A 5ILSA 3A03A 1MGTA 3W6JB 1N78A 1LNWA 2COBA 1DU0A 2DDAA 3MKLA 1W7PB 2GQQA 4AYBN 2KZVA 2PJPA 2NNNA 1QVTA 4WK8F 4GYGA 4NQWA 4GXOA 1PYVA 4MTEA 4MIMA 2VBZA 3ECOA 3S15J 1HC8A 4EEFG 1F4KA 1MBJA 3FMQA 4HA8A 1JKRC 2JA5J 2VOOA 2Q1ZB 4B1RA 2DMQA 1FP1D 4YEJA 3TBIA 1H89C 2GZWA 1GHCA 2K5CA 2M9HA 3V7RA 1TTYA 3C3WA 3HOSA 1WGXA 1FYKA 2R7RA 5J47A 4KMUX 1JGGA 3AL0C 3HOZJ 2A6HF 1WJBA 4L5JA 4E7IA 1BI0A 4HDVA 2CRGA 4ZDOA 2CQNA 3WGGA 2Y30A 2VQLA 3VB2A 3JRAA 3TP0A 3D1NI 2EFPA 5E79C 2PG4A 1EJ9A 2R7VA 4HX4A 1D8KA 2EA2A 3I0TA 3DU6A 3V4GA 4IVNA 2KHMA 3K4LA 2ZXWH 1I1SA 2LKPA 3S2HJ 2ELKA 3JAMK 2LY1A 3FMSA 1VQ7I 2JA8J 2WAQA 2PLYA 2X85A 5EG0B 4U7DA 3ABKH 2FE3A 1LDJA 4N9HA 1W7PA 4N9IA 1CF7A 4E7KA 1W36C 2L7FP 4YELA 2V9PA 4XM3A 4AD9A 1IF1A 1PVEA 4MNUA 3LFUA 3EYYA 1PUFB 1Z91A 3ZN0A 1YLFA 3HM5A 2DQRA 3S1QJ 2DMUA 1BW6A 2Y0MA 4LB5A 3BG3A 2KLOA 4OINF 3BTCA 2LYCA 4I02A 1QHGA 3HL2A 5E17F 3AFHA 3IWZA 3KZYA 5FO5A 1YITI 2AS5F 4YG2F 2R7WA 3CLQA 3MQ0A 4BDYA 4D0PA 5J6XA 3CP8A 2C6YA 2H1KA 4EV0A 2QENA 1ZQ3P 4HF2A 4HF1A 3K4KA 2VJ5A 1NHAA 5ICFA 1RUOA 4XNFA 3KP6A 1TC3C 4J19A 2RNGA 2VBWA 3VFZA 4D7NA 4Y3OA 2NOJB 1D5VA 4MQ9F 2R7FA 2V1NA 3CTAA 2MC3A 4R8HA 4UVBA 2CV2A 1IC8A 5IP6A 5CVRA 3V42A 2Q8KA 3BG5A 3CUQA 2RC4A 3OYMA 2M45A 1CF7B 1FOWA 1JKOC 1ZR4A 3KEOA 4HEA2 2HQ5A 1GV5A 1UHMA 2DFEA 2VB6A 4DZPA 2E1MC 3HOYJ 4O6JA 4RLQA 4B43A 2IA2A 3CJRB 3LMMA 1HW2A 5JHUA 3NEUA
chains in the Genus database with same CATH topology
2EZKA 3LSGA 3S14J 4FCYA 2L7ZA 2HI3A 3TEDA 5E3LA 1NK3P 5K7FA 5F0HA 3PO2J 3NAUA 4Y52J 3BR2A 2JA6J 2I10A 2NVYJ 4BKXA 2XB5A 3LSPA 1YRNB 1D5YA 1FIPA 2LK2A 2ID6A 3BR1A 1CQTA 1S7EA 1Y1VJ 2AO9A 3BG9A 3FKIJ 2O8KA 5J1YA 3QPSA 5F1JA 3S17J 4JX6A 1JJ6C 1JKQC 3IV5A 4JX4A 1QPIA 2HDDA 1B72A 1TWGJ 1FTZA 1WH7A 1T33A 2M8GX 4X1EA 2OF7A 5K7ZA 2Y31A 1POGA 4A3BJ 3ZQGA 3GTLJ 3HOWJ 1VF9A 1MBEA 2DA5A 4JP0A 3HB9A 3OSFA 2LP0A 5FKOA 5FKLA 4V2GA 5IOYA 1AKHA 3S1NJ 2EH3A 4C3IJ 1ZTRA 2M0CA 1RESA 2LFBA 4BBRJ 2LKXA 2LR8A 1H88C 3SDGA 2JK3A 2EBIA 2TRTA 3QPLA 4XK4A 1I3QJ 3GTOJ 2M2EA 3G1MA 3DEWA 4W1UA 4AC0A 2K9QA 3CCYA 1VFCA 4RBOA 1B8IA 4A3IJ 3JREA 5F08A 5GPAA 3DCFA 4M3FA 4A3KJ 1ENHA 2WB1N 2E2IJ 1Z77A 2JWTA 1FTTA 3H0GJ 4QIWN 3GTGJ 1IDYA 3S2DJ 2AHQA 3JR9A 2X9DA 1UG2A 2LD5A 2E1OA 3TW6A 1B8IB 4QTRA 3TW7A 2NVQJ 1JKPC 3BT9A 3PO3J 3WHBA 3E7LA 1BA5A 3OSGA 2R5YA 4X6AJ 2XGEA 2O7OA 5EF6A 5GPCA 2X48A 2XPWA 3HOVJ 4FE4A 2NVXJ 2EQRA 3LSJA 1I50J 4UUTA 3HOXJ 3CMYA 3BR3A 5M5YJ 1MH3A 2EZLA 4BBSJ 1SANA 2G0EA 2D5VA 2CUEA 3OOUA 3BR6A 4UUSA 1X2NA 4M3EA 2ME6A 3TP3A 2MW8A 4B4CA 3JRIA 2FQ4A 1RR7A 1LE8B 3JRHA 3HDDA 3GTPJ 1JTYA 5IPAA 3ZOBA 5EG0A 5DTDA 4A69C 3MN2A 3UKGA 4XRSA 5K7HA 1Q1VA 1Z0XA 3S1RJ 5J1RA 2R5ZA 3I4MJ 3BR5A 4M3GA 3NARA 1P7JA 1GDTA 3HGGA 2VPRA 2FD5A 2TCTA 5E3OA 1LE8A 1U78A 3HEFA 1BJZA 2HOSA 1ETKA 3O8GA 3IH2A 1OCTC 5F04A 2LVSA 1ZKGA 5IP9J 5IP7J 2DA6A 1GT0C 2CQQA 2HYJA 4AUXA 3K7AJ 3OIOA 4DYCA 3M3YJ 2WAQN 2ID3A 1SFOJ 2R5ZB 1MBGA 1U8BA 2MSYA 3IH4A 5EZGA 5EYRA 1HLVA 3MVPA 4IHWA 3GBGA 4BY1J 5EEAA 4Y7NJ 5C3EJ 2H8RA 1EF4A 3SJMA 4BXXJ 1JT6A 5IYBJ 3GTMJ 3ZQCA 2P81A 1E3OC 1BL0A 2L0KA 5DS9A 3S1MJ 1RPWA 1IUFA 4A3EJ 2WV1A 4CYCA 4FTHA 2DA7A 3HGYA 2L7MP 1ZR2A 3ZQIA 5BNGA 2Y9ZA 4FE7A 3BTIA 3B6CA 4MLOA 2R7ZJ 1APLC 3JRDA 1ETVA 4DW6A 5GP9A 4D5FA 2EZIA 4JYKA 4C3HJ 2HXOA 5M5WJ 1FIAA 2XSDC 1U9NA 2YU9J 3CDLA 3I4NJ 1WH5A 2DA2A 4G12A 1UHSA 3WHCA 2NOGA 1RKTA 5J3LA 3RZDJ 3SFIA 1HDPA 2NS7A 4DZJA 4A93J 2DA1A 3Q0WA 2ECCA 2Y9YA 1K61A 1QVUA 2HOAA 1A6IA 2RAEA 1JUPA 5E3NA 1IG7A 2O9LA 3FK7A 3Q3SA 2L9RA 2CJJA 1R9TJ 3GTJJ 4UUSB 1HOMA 1JJ8C 1AHDP 3H3VK 4I6ZA 2R93J 1GV2A 1NTCA 2LTPA 1Y1WJ 2FJ1A 1JUSA 4A3FJ 4ABZA 2IAIA 4IHYA 1U9OA 2M34A 1OCPA 4DYRA 3JRBA 1B72B 2VKVA 1LFBA 3BTLA 2Y0SN 2R0QC 1BW5A 4NDLA 4C2MJ 3Q0VA 2YUSA 3BQYA 1IGNA 5M3FJ 1T56A 2QF7A 4BY7J 1LFUP 4JX5A 2DMTA 2JJ7A 5IOZA 4A3LJ 5IYCJ 1I6HJ 2DA4A 2ZB9A 4MFDA 2DTZA 4D7MA 1ETWA 4M3DA 1ETQA 2XGDA 4IEJA 5C4XJ 3BQZA 1G2HA 1UMQA 5M5XJ 1OJLA 3A01A 3G1LA 2DJNA 3BR0A 2IBDA 4XIDA 5EDNA 2GBYA 1P7IA 1RKWA 4LOCA 5C4JJ 2XGCA 1AKHB 2K40A 5F0FA 2DMPA 1H8AC 5F0CA 2B63J 1YRNA 3G1OA 1VNDA 4B3AA 1VI0A 1HDDC 2DN0A 1FJLA 5FLMJ 1ZGWA 1WI3A 2JMWA 2QCOA 5FLVA 4A3MJ 3FIWA 1OFCX 5IYDJ 5EZHA 3BTJA 4S0HB 2XB0X 2Y2ZA 1HF0A 4W97A 4XICA 5EGOB 1JUMA 3RQIA 3S16J 5F27A 1MSFC 1X58A 1ETXA 1FEXA 2OPTA 3ZQLA 4FISA 1O4XA 1ZK8A 1F36A 5E3MA 1GUUA 4XRSG 3JRGA 3HBLA 1MSEC 2NS8A 3RKQA 1X2MA 4GFBA 1IDZA 3ZQHA 2HOTA 3A03A 3W6VA 3FISA 2VUMJ 4D5CA 5JLXA 5EGOA 2HXIA 2JA7J 3QQAA 1JTXA 2K9SA 1XS9A 2COBA 1DU0A 3ZQFA 3MKLA 4AYBN 3LSRA 1QVTA 4MIMA 1MNMC 3S15J 4EEFG 1MBJA 2GM4A 1JKRC 2JA5J 1TWFJ 2PMZN 4B1RA 2DMQA 2GLOA 1XG1A 1H89C 4M6VA 2CQXA 2K9NA 2M9HA 2XRLA 5FKNA 1A5JA 1MH4A 3VPRA 1WGXA 2N8GA 1JGGA 3HOZJ 1IV6A 4M3BA 2ME0A 1IJWC 1JT0A 4A3CJ 1ITYA 2CRGA 2CU7A 1ETOA 1ORKA 4MO7A 2Y30A 1ETYA 1K83J 3JRAA 3LOCA 3TP0A 3D1NI 2KT0A 3CQZJ 5M3MJ 3HKZN 2E2JJ 2R5YB 3FK6A 4CYCB 2LLKA 2CUFA 5HODA 3PM1A 4RDUA 1TWCJ 1NK2P 1WPKA 2XPVA 3O8HA 2E19A 5FJ8J 4C3JJ 2IEKA 3S2HJ 2ELKA 2MGQA 2DMNA 2VI6A 4I76A 2JA8J 4HNVA 5EG0B 3HOUJ 4A3DJ 3LNQA 3RZOJ 1PUFA 2L7FP 3IH3A 5JLWA 3GTQJ 2VKEA 1WCMJ 4L5EA 1DU6A 1PUFB 5FKKA 2DA3A 3A02A 3HM5A 1F43A 3S1QJ 2DMUA 1BW6A 3BG3A 1AU7A 1MBFA 1W0TA 3BTCA 3Q0UA 1MBKA 5FKMA 2X6OA 4DYQA 2EZHA 1RETA 2XPUA 1TWAJ 2FX0A 4XRMA 2H1KA 4IHXA 4V2FA 1W0UA 1ZQ3P 1TC3C 4MFEA 4J19A 1MBHA 2JN6A 2E2HJ 4D7NA 1HCRA 1GVDA 4IHVA 3JRCA 2LY9A 3K2AA 1IC8A 5IP6A 2NVTJ 3M4OJ 1QRYA 3BG5A 2ECBA 9ANTA 3B6AA 2W48A 1JKOC 1ZR4A 1XC5A 3JRFA 2HQ5A 1GV5A 5C44J 4A3JJ 4DZPA 1IRZA 3HOYJ 5J1UA 2R92J 3GTKJ 3C2BA 2YS9A 2KDZA 3L1PA 3F0CA 4A3GJ 4QSHA 2MG4A 1TWHJ 3A01B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZK A;  3LSG A;  3S14 J;  4FCY A;  2L7Z A;  2HI3 A;  3TED A;  5E3L A;  1NK3 P;  5K7F A;  5F0H A;  3PO2 J;  3NAU A;  4Y52 J;  3BR2 A;  2JA6 J;  2I10 A;  2NVY J;  4BKX A;  2XB5 A;  3LSP A;  1YRN B;  1D5Y A;  1FIP A;  2LK2 A;  2ID6 A;  3BR1 A;  1CQT A;  1S7E A;  1Y1V J;  2AO9 A;  3BG9 A;  3FKI J;  2O8K A;  5J1Y A;  3QPS A;  5F1J A;  3S17 J;  4JX6 A;  1JJ6 C;  1JKQ C;  3IV5 A;  4JX4 A;  1QPI A;  2HDD A;  1B72 A;  1TWG J;  1FTZ A;  1WH7 A;  1T33 A;  2M8G X;  4X1E A;  2OF7 A;  5K7Z A;  2Y31 A;  1POG A;  4A3B J;  3ZQG A;  3GTL J;  3HOW J;  1VF9 A;  1MBE A;  2DA5 A;  4JP0 A;  3HB9 A;  3OSF A;  2LP0 A;  5FKO A;  5FKL A;  4V2G A;  5IOY A;  1AKH A;  3S1N J;  2EH3 A;  4C3I J;  1ZTR A;  2M0C A;  1RES A;  2LFB A;  4BBR J;  2LKX A;  2LR8 A;  1H88 C;  3SDG A;  2JK3 A;  2EBI A;  2TRT A;  3QPL A;  4XK4 A;  1I3Q J;  3GTO J;  2M2E A;  3G1M A;  3DEW A;  4W1U A;  4AC0 A;  2K9Q A;  3CCY A;  1VFC A;  4RBO A;  1B8I A;  4A3I J;  3JRE A;  5F08 A;  5GPA A;  3DCF A;  4M3F A;  4A3K J;  1ENH A;  2WB1 N;  2E2I J;  1Z77 A;  2JWT A;  1FTT A;  3H0G J;  4QIW N;  3GTG J;  1IDY A;  3S2D J;  2AHQ A;  3JR9 A;  2X9D A;  1UG2 A;  2LD5 A;  2E1O A;  3TW6 A;  1B8I B;  4QTR A;  3TW7 A;  2NVQ J;  1JKP C;  3BT9 A;  3PO3 J;  3WHB A;  3E7L A;  1BA5 A;  3OSG A;  2R5Y A;  4X6A J;  2XGE A;  2O7O A;  5EF6 A;  5GPC A;  2X48 A;  2XPW A;  3HOV J;  4FE4 A;  2NVX J;  2EQR A;  3LSJ A;  1I50 J;  4UUT A;  3HOX J;  3CMY A;  3BR3 A;  5M5Y J;  1MH3 A;  2EZL A;  4BBS J;  1SAN A;  2G0E A;  2D5V A;  2CUE A;  3OOU A;  3BR6 A;  4UUS A;  1X2N A;  4M3E A;  2ME6 A;  3TP3 A;  2MW8 A;  4B4C A;  3JRI A;  2FQ4 A;  1RR7 A;  1LE8 B;  3JRH A;  3HDD A;  3GTP J;  1JTY A;  5IPA A;  3ZOB A;  5EG0 A;  5DTD A;  4A69 C;  3MN2 A;  3UKG A;  4XRS A;  5K7H A;  1Q1V A;  1Z0X A;  3S1R J;  5J1R A;  2R5Z A;  3I4M J;  3BR5 A;  4M3G A;  3NAR A;  1P7J A;  1GDT A;  3HGG A;  2VPR A;  2FD5 A;  2TCT A;  5E3O A;  1LE8 A;  1U78 A;  3HEF A;  1BJZ A;  2HOS A;  1ETK A;  3O8G A;  3IH2 A;  1OCT C;  5F04 A;  2LVS A;  1ZKG A;  5IP9 J;  5IP7 J;  2DA6 A;  1GT0 C;  2CQQ A;  2HYJ A;  4AUX A;  3K7A J;  3OIO A;  4DYC A;  3M3Y J;  2WAQ N;  2ID3 A;  1SFO J;  2R5Z B;  1MBG A;  1U8B A;  2MSY A;  3IH4 A;  5EZG A;  5EYR A;  1HLV A;  3MVP A;  4IHW A;  3GBG A;  4BY1 J;  5EEA A;  4Y7N J;  5C3E J;  2H8R A;  1EF4 A;  3SJM A;  4BXX J;  1JT6 A;  5IYB J;  3GTM J;  3ZQC A;  2P81 A;  1E3O C;  1BL0 A;  2L0K A;  5DS9 A;  3S1M J;  1RPW A;  1IUF A;  4A3E J;  2WV1 A;  4CYC A;  4FTH A;  2DA7 A;  3HGY A;  2L7M P;  1ZR2 A;  3ZQI A;  5BNG A;  2Y9Z A;  4FE7 A;  3BTI A;  3B6C A;  4MLO A;  2R7Z J;  1APL C;  3JRD A;  1ETV A;  4DW6 A;  5GP9 A;  4D5F A;  2EZI A;  4JYK A;  4C3H J;  2HXO A;  5M5W J;  1FIA A;  2XSD C;  1U9N A;  2YU9 J;  3CDL A;  3I4N J;  1WH5 A;  2DA2 A;  4G12 A;  1UHS A;  3WHC A;  2NOG A;  1RKT A;  5J3L A;  3RZD J;  3SFI A;  1HDP A;  2NS7 A;  4DZJ A;  4A93 J;  2DA1 A;  3Q0W A;  2ECC A;  2Y9Y A;  1K61 A;  1QVU A;  2HOA A;  1A6I A;  2RAE A;  1JUP A;  5E3N A;  1IG7 A;  2O9L A;  3FK7 A;  3Q3S A;  2L9R A;  2CJJ A;  1R9T J;  3GTJ J;  4UUS B;  1HOM A;  1JJ8 C;  1AHD P;  3H3V K;  4I6Z A;  2R93 J;  1GV2 A;  1NTC A;  2LTP A;  1Y1W J;  2FJ1 A;  1JUS A;  4A3F J;  4ABZ A;  2IAI A;  4IHY A;  1U9O A;  2M34 A;  1OCP A;  4DYR A;  3JRB A;  1B72 B;  2VKV A;  1LFB A;  3BTL A;  2Y0S N;  2R0Q C;  1BW5 A;  4NDL A;  4C2M J;  3Q0V A;  2YUS A;  3BQY A;  1IGN A;  5M3F J;  1T56 A;  2QF7 A;  4BY7 J;  1LFU P;  4JX5 A;  2DMT A;  2JJ7 A;  5IOZ A;  4A3L J;  5IYC J;  1I6H J;  2DA4 A;  2ZB9 A;  4MFD A;  2DTZ A;  4D7M A;  1ETW A;  4M3D A;  1ETQ A;  2XGD A;  4IEJ A;  5C4X J;  3BQZ A;  1G2H A;  1UMQ A;  5M5X J;  1OJL A;  3A01 A;  3G1L A;  2DJN A;  3BR0 A;  2IBD A;  4XID A;  5EDN A;  2GBY A;  1P7I A;  1RKW A;  4LOC A;  5C4J J;  2XGC A;  1AKH B;  2K40 A;  5F0F A;  2DMP A;  1H8A C;  5F0C A;  2B63 J;  1YRN A;  3G1O A;  1VND A;  4B3A A;  1VI0 A;  1HDD C;  2DN0 A;  1FJL A;  5FLM J;  1ZGW A;  1WI3 A;  2JMW A;  2QCO A;  5FLV A;  4A3M J;  3FIW A;  1OFC X;  5IYD J;  5EZH A;  3BTJ A;  4S0H B;  2XB0 X;  2Y2Z A;  1HF0 A;  4W97 A;  4XIC A;  5EGO B;  1JUM A;  3RQI A;  3S16 J;  5F27 A;  1MSF C;  1X58 A;  1ETX A;  1FEX A;  2OPT A;  3ZQL A;  4FIS A;  1O4X A;  1ZK8 A;  1F36 A;  5E3M A;  1GUU A;  4XRS G;  3JRG A;  3HBL A;  1MSE C;  2NS8 A;  3RKQ A;  1X2M A;  4GFB A;  1IDZ A;  3ZQH A;  2HOT A;  3A03 A;  3W6V A;  3FIS A;  2VUM J;  4D5C A;  5JLX A;  5EGO A;  2HXI A;  2JA7 J;  3QQA A;  1JTX A;  2K9S A;  1XS9 A;  2COB A;  1DU0 A;  3ZQF A;  3MKL A;  4AYB N;  3LSR A;  1QVT A;  4MIM A;  1MNM C;  3S15 J;  4EEF G;  1MBJ A;  2GM4 A;  1JKR C;  2JA5 J;  1TWF J;  2PMZ N;  4B1R A;  2DMQ A;  2GLO A;  1XG1 A;  1H89 C;  4M6V A;  2CQX A;  2K9N A;  2M9H A;  2XRL A;  5FKN A;  1A5J A;  1MH4 A;  3VPR A;  1WGX A;  2N8G A;  1JGG A;  3HOZ J;  1IV6 A;  4M3B A;  2ME0 A;  1IJW C;  1JT0 A;  4A3C J;  1ITY A;  2CRG A;  2CU7 A;  1ETO A;  1ORK A;  4MO7 A;  2Y30 A;  1ETY A;  1K83 J;  3JRA A;  3LOC A;  3TP0 A;  3D1N I;  2KT0 A;  3CQZ J;  5M3M J;  3HKZ N;  2E2J J;  2R5Y B;  3FK6 A;  4CYC B;  2LLK A;  2CUF A;  5HOD A;  3PM1 A;  4RDU A;  1TWC J;  1NK2 P;  1WPK A;  2XPV A;  3O8H A;  2E19 A;  5FJ8 J;  4C3J J;  2IEK A;  3S2H J;  2ELK A;  2MGQ A;  2DMN A;  2VI6 A;  4I76 A;  2JA8 J;  4HNV A;  5EG0 B;  3HOU J;  4A3D J;  3LNQ A;  3RZO J;  1PUF A;  2L7F P;  3IH3 A;  5JLW A;  3GTQ J;  2VKE A;  1WCM J;  4L5E A;  1DU6 A;  1PUF B;  5FKK A;  2DA3 A;  3A02 A;  3HM5 A;  1F43 A;  3S1Q J;  2DMU A;  1BW6 A;  3BG3 A;  1AU7 A;  1MBF A;  1W0T A;  3BTC A;  3Q0U A;  1MBK A;  5FKM A;  2X6O A;  4DYQ A;  2EZH A;  1RET A;  2XPU A;  1TWA J;  2FX0 A;  4XRM A;  2H1K A;  4IHX A;  4V2F A;  1W0U A;  1ZQ3 P;  1TC3 C;  4MFE A;  4J19 A;  1MBH A;  2JN6 A;  2E2H J;  4D7N A;  1HCR A;  1GVD A;  4IHV A;  3JRC A;  2LY9 A;  3K2A A;  1IC8 A;  5IP6 A;  2NVT J;  3M4O J;  1QRY A;  3BG5 A;  2ECB A;  9ANT A;  3B6A A;  2W48 A;  1JKO C;  1ZR4 A;  1XC5 A;  3JRF A;  2HQ5 A;  1GV5 A;  5C44 J;  4A3J J;  4DZP A;  1IRZ A;  3HOY J;  5J1U A;  2R92 J;  3GTK J;  3C2B A;  2YS9 A;  2KDZ A;  3L1P A;  3F0C A;  4A3G J;  4QSH A;  2MG4 A;  1TWH J;  3A01 B; 
#chains in the Genus database with same CATH topology
 3LSG A;  2L2O A;  2V9V A;  2L7Z A;  3NQO A;  2CSO A;  4ENJ A;  1FT9 A;  3S14 J;  2ZNY A;  4QWQ A;  3GUD A;  3BG7 A;  1WQ2 A;  4JQF A;  5K7F A;  3M8F A;  2R7X A;  4KNY A;  2I10 A;  2JA6 J;  4RAF A;  1IXS B;  4BKX A;  3LSP A;  2DFH A;  3CME I;  1YRN B;  1QZY A;  1OYW A;  2ID6 A;  1F5T A;  3L09 A;  5LHH A;  2BW3 B;  2KQR A;  3DEE A;  3GME A;  5J1Y A;  4JX6 A;  3HXL A;  3IV5 A;  3F3X A;  3I55 I;  4JX4 A;  1LJ9 A;  3ZMV A;  3I9V 2;  4M9Z A;  2L54 A;  2NXN B;  1TWG J;  1WH7 A;  2M8G X;  1DDN A;  2F5E A;  1VQ4 I;  3H9G A;  1EA3 A;  3KYD B;  4II2 A;  5BMZ A;  1YG2 A;  3PNT A;  3HOW J;  4PJM A;  2ZME C;  3WE3 A;  1USS A;  2EV6 A;  2DA5 A;  2EJR A;  3IAS 2;  2LBF A;  3OSF A;  2LP0 A;  1R6R A;  5FKL A;  4V2G A;  3CZ6 A;  4A0Y A;  2EH3 A;  1S29 A;  4OIP F;  1QU3 A;  4HSR A;  1XB4 A;  3KYC B;  2K27 A;  5GTH C;  3KP2 A;  1ZTR A;  2K85 A;  2ZBK A;  1X3W B;  2KFD A;  2YU3 A;  3PUB A;  4L9J A;  2QZ8 A;  1J2X A;  2YSR A;  1BI3 A;  5L3E A;  1XDU A;  3DEW A;  2FMY A;  4W1U A;  3H0D A;  3ZMZ A;  4A3I J;  4PCQ A;  4XOP A;  3BOQ A;  2H1L A;  1OYI A;  3ERE D;  3DCF A;  2R7U A;  2R7S A;  2XSJ C;  3ZCO A;  2M8E A;  1FTT A;  3L2V A;  3H0G J;  1QQI A;  2DI3 A;  2Z9O A;  3JR9 A;  4M6X A;  3TW6 A;  2D2W A;  2M4G A;  2ACJ A;  2XHK A;  3TW7 A;  3ABU A;  3WTY C;  3WHB A;  5GAH J;  3E7L A;  3PUF A;  1ZLJ A;  1BA5 A;  1IRF A;  2OAZ A;  4X6A J;  2QM3 A;  2J5O A;  4PJJ A;  4N4O B;  3HOV J;  3CMM A;  2E71 A;  1ZLK A;  2EQR A;  5ERI A;  1ZAR A;  4XSZ F;  2LSO A;  3EPZ A;  1X1B A;  5H6Q A;  1NG6 A;  2DT6 A;  3ZQQ A;  4BBS J;  2G0E A;  4F92 B;  2D1V A;  5HDN A;  2NRA C;  2E35 A;  4RM2 A;  5KCM A;  4B8X A;  3J7Y J;  2MW8 A;  2M4K A;  4Y33 A;  3HRS A;  1P4W A;  1RR7 A;  1V5F A;  3JRH A;  3HDD A;  1LEB A;  4KUM A;  4NQW B;  1JTY A;  5IPA A;  1VQ6 I;  4ZC3 A;  2EIK H;  4BQO A;  4OIR F;  1YW7 A;  1MMG A;  2V7F A;  4ZYE A;  5J1R A;  3AAF A;  3I4M J;  3GX4 X;  1GDT A;  5CKT A;  4WXD A;  5DCM B;  2A07 F;  2VPR A;  4P5O A;  2TCT A;  4OWR B;  2RQP A;  4RB3 C;  3SHF A;  2XKP A;  2HVQ A;  3IH2 A;  1OCT C;  2VKD A;  1OCZ H;  4EAT A;  2ZO4 A;  5IP9 J;  1S5L C;  3WU0 A;  2H27 A;  5H6R A;  4KIB A;  2HYJ A;  3JSO A;  3TKY A;  4PK4 A;  4XKB A;  2CGP A;  2PBI A;  4IKF A;  2EB7 A;  1S8N A;  1HLV A;  2ZME B;  5HS7 A;  3C2G A;  3CCM I;  1WZ2 A;  5C3E J;  4M6Y A;  2IGK A;  1TW3 A;  1JT6 A;  3GTM J;  4A2U A;  2ZXH A;  3A0H C;  4Y4R A;  2WB1 A;  3K4C A;  3T5X A;  3FF5 A;  4EJO A;  2HZT A;  4YII A;  4F7Z A;  3HIF A;  4BXU A;  3GVA A;  4FTH A;  5FB2 A;  2DA7 A;  3HGY A;  1HW1 A;  4UB8 C;  2L7M P;  4M9S A;  3GLX A;  3ZQI A;  1Q1H A;  1SMT A;  2HTJ A;  3BP8 A;  1IO2 A;  3J7A O;  1MIJ A;  2R7Z J;  3S93 A;  1GVJ A;  4CZZ A;  3PL8 A;  3G3Z A;  1N75 A;  1ETV A;  1HBX G;  3CCE I;  2M1B A;  2HVR A;  2EPF A;  2XF7 A;  5GP9 A;  5E18 F;  2BV6 A;  2L02 A;  3O3K A;  4MTD A;  1GXP A;  4QLC U;  2H09 A;  3WU2 C;  3OYG A;  3RKX A;  4G6D A;  3ASO H;  3I4N J;  1WH5 A;  3ZN1 A;  1SFX A;  3B73 A;  4G12 A;  3KP3 A;  1OLT A;  5KNL A;  2VJI A;  1WI9 A;  1ON2 A;  2NS7 A;  2ISY A;  2PQ8 A;  1S7O A;  2DA1 A;  1K4T A;  2ECC A;  4A93 J;  4RB0 A;  3K69 A;  4AIJ A;  3S3N A;  1A6I A;  2JA2 A;  4OIO F;  3GZN B;  5LEK A;  2YX4 A;  2OTJ I;  4EGZ A;  2O9L A;  2E7X A;  4IXA A;  5JI6 A;  3H36 A;  2VON A;  2CJJ A;  1T39 A;  4RAG A;  1R9T J;  1LEA A;  2DYS H;  3GWZ A;  4U0W A;  3Q5F A;  4K2E A;  4RS8 A;  3M7G A;  2J5P A;  5IT9 Z;  2NS0 A;  4LIV A;  3BJO A;  3TO9 A;  1OCP A;  2F5V A;  2W82 A;  1B72 B;  4NUB A;  3DBH B;  1LFB A;  1BW5 A;  2Y0S N;  3DEU A;  1WJ5 A;  2BEO A;  4BH9 A;  1ZG5 A;  2F6C A;  1I27 A;  2CH0 A;  2XV4 S;  4GGG A;  3ZMD A;  3Q0V A;  4UVC A;  3CMA I;  1IGN A;  2VOP A;  4CZC A;  1MDM B;  2DTR A;  2FNA A;  2VBX A;  2KRH A;  2A3S A;  1ZG3 A;  2IA0 A;  2X0L A;  3HPH A;  4F91 B;  1R58 A;  5ED4 A;  2FOW A;  2GA1 A;  3IP4 B;  1DGW Y;  4LGW A;  2DTZ A;  3W2V A;  4D7M A;  5LBQ A;  2O61 A;  1ETQ A;  4JOM A;  5C4X J;  3ABT A;  4AVP A;  2ZJ2 A;  1UMQ A;  2VXZ A;  2P6T A;  3U1K A;  3AKZ A;  1OJL A;  3A01 A;  4CCL A;  1R1T A;  1SFK A;  2CUJ A;  5EDN A;  3FMR A;  1PJR A;  1P7I A;  4OAY A;  3J81 K;  3MCZ A;  4IL6 C;  1W7P D;  4CCN A;  5C4J J;  1TQM A;  5D6E A;  3ONQ A;  4ZYD A;  2B63 J;  4E7S A;  3IL2 A;  4ZZD A;  2P5K A;  4IOC F;  4G94 A;  1YE9 A;  3CCR I;  1Z7U A;  2HQN A;  2QCO A;  4E7H A;  1OFC X;  1R4N B;  3BTJ A;  4E7Z A;  2Y2Z A;  4W97 A;  1RIO H;  3DKW A;  2Z1D A;  3ELK A;  3LAJ A;  4B48 A;  2QA4 I;  1ETX A;  1Z7L A;  2OPT A;  4XL9 A;  1T8I A;  4S05 A;  3I53 A;  2W24 A;  5LHI A;  5DD4 A;  3TMO A;  1KA8 A;  3DFG A;  1VQ9 I;  5CQG A;  2HPI A;  3MWM A;  1A36 A;  3PJR A;  5H20 A;  1I6X A;  2VJ4 A;  2NS8 A;  3RKQ A;  4GFB A;  2VLA A;  1IDZ A;  1PDN C;  2VUM J;  3FIS A;  2F2E A;  1RC9 A;  1ON1 A;  2OCC H;  4RB1 A;  1XSV A;  2HXI A;  3E5Q A;  3LWF A;  4DBR A;  1UCR A;  1JTX A;  1D0Z A;  3ZQF A;  1V54 H;  4Y15 A;  4EJV A;  2WWY A;  2E1C A;  2RQQ A;  1MMS A;  4BL0 B;  1YJN I;  4HNT A;  1YYV A;  2LOO A;  1AA7 A;  1WKM A;  2DU9 A;  2F48 A;  3W6K B;  2ZME A;  4KIF A;  2DLL A;  3CDI A;  1K6O A;  3FX3 A;  4GO1 A;  3W2A A;  4EJT A;  4L18 B;  2KJC A;  2X6W A;  1TWF J;  2PMZ N;  1XD7 A;  2UXN A;  2UUZ A;  4WX9 A;  5D4S A;  3V8L A;  4XN3 A;  3K4N A;  3CC7 I;  1A5J A;  5CYV A;  3RPU D;  1MH4 A;  2O8X A;  5FGM A;  2N8G A;  3HJE A;  1TLH B;  1WFX A;  3OOP A;  2IA1 A;  1IV6 A;  2KRC A;  3TO7 A;  2MLG A;  4ZYA A;  1O3Q A;  1IJW C;  1HXD A;  4BJ5 C;  3FDY A;  4BGD A;  1K83 J;  3ISP A;  3LOC A;  2KT0 A;  1O3R A;  3HC7 A;  4CHU A;  5KAF C;  3ECH A;  4M9X A;  4PUS A;  2R5Y B;  2E2J J;  4HRI A;  2GOM A;  5GAD J;  1QHH D;  2LLK A;  3FM5 A;  4NC8 A;  3I56 I;  1W5C C;  4O5V A;  4RDU A;  1FZP B;  1WPK A;  1N25 A;  3P9C A;  2OQR A;  2EFO A;  3T0Y A;  3W2W A;  3GTQ J;  2MGQ A;  1IN8 A;  4KA4 A;  2VI6 A;  1U3E M;  1Z05 A;  4I76 A;  2GIV A;  3NWS A;  2XKO A;  4M74 A;  4A3D J;  2IT0 A;  1V5E A;  3RZO J;  3HTS B;  3IH3 A;  2HTS A;  1ZAO A;  5JLW A;  1B4A A;  2DQL A;  1WCM J;  1FYL A;  2JPB A;  2JZY A;  2DA3 A;  2O5R A;  1DPU A;  3G73 A;  3GFL A;  2RV8 A;  1D1C A;  4YRV A;  3IWF A;  2KDO A;  5B3S H;  3RKW A;  2B0L A;  2PX9 A;  1MBK A;  5FKM A;  4DGW B;  4DYQ A;  2XAS A;  2EZH A;  3IKV A;  1K79 A;  1RET A;  1MJB A;  1SC7 A;  1I1G A;  3JTH A;  4IHX A;  1TL8 A;  1QA6 A;  3DBL B;  1I3A A;  2VC1 A;  1VTN C;  2GIZ A;  4I01 A;  3I58 A;  4KJZ A;  1TNS A;  1HCR A;  3IC7 A;  1ZRE A;  1GVD A;  3U21 A;  4ESJ A;  1MDM A;  2DBB A;  2IW5 A;  3ZMT A;  4AYB A;  1T38 A;  2LY9 A;  3K2A A;  1SEU A;  1X1C A;  2DXI A;  3M4O J;  1QRY A;  3KFW X;  2QGU A;  1YHQ I;  3B6A A;  4FX0 A;  3GFM A;  1FNN A;  1ZGA A;  3HSF A;  3JRF A;  5C44 J;  4A3J J;  5J1U A;  4KT6 A;  5GTI C;  1QGP A;  2YS9 A;  5TJJ A;  1J09 A;  3L1P A;  3F0C A;  2BZT A;  2MG4 A;  3GZ6 A;  3KP5 A;  3NWT A;  5D5W B;  2GXA A;  2X6X A;  1XMX A;  3KYL A;  5E3L A;  2QVO A;  1KQ0 A;  3EYI A;  3CES A;  3RYP A;  1VQP I;  2KKO A;  3PO2 J;  4Y52 J;  5KHD A;  3FHN A;  2XB5 A;  3JCU C;  1D5Y A;  3OL3 A;  2XRN A;  2LK2 A;  3BR1 A;  3OYA A;  1S7E A;  3BG6 A;  1Y1V J;  2AO9 A;  3S8P A;  1ZH5 A;  3BG9 A;  3FKI J;  4AWX B;  5F1J A;  4BU2 A;  1UJ8 A;  2OU2 A;  4XN0 A;  2G9W A;  1JKQ C;  1JJ6 C;  1MMA A;  1MD0 A;  1B72 A;  1VQL I;  3K70 D;  1G6N A;  1LB2 A;  3A2K A;  1OCC H;  3QAH A;  4X1E A;  3KE2 A;  3OR1 C;  5K7Z A;  4YFK F;  2HU9 A;  1A31 A;  2B9S A;  3ZQG A;  3H5R A;  2M0M A;  1TNT A;  2FSW A;  1QZE A;  2IGM A;  4RB2 C;  4B09 A;  4JP0 A;  1IV8 A;  3HB9 A;  1JE8 A;  2QQ8 A;  5FKO A;  1XMK A;  2DFF A;  2WAD A;  3OR2 C;  2CV0 A;  3S1N J;  2KIF A;  2XAQ A;  4PSW A;  4ZJZ A;  3LQR A;  4C3I J;  2M0C A;  2CV1 A;  2ADU A;  4NB5 A;  2HDW A;  3FXQ A;  4BBR J;  3M8J A;  1R5H A;  3SDG A;  2TRT A;  2EBI A;  4DQ2 A;  4EM2 A;  3ESW B;  1DP7 P;  1YS6 A;  2LRD A;  3OYJ A;  4LFU A;  3OYF A;  1NH3 A;  4N0B A;  1K78 A;  3CCL I;  3UR3 C;  2K9Q A;  3CCY A;  1VFC A;  1F1Z A;  5FLX Z;  1B8I A;  4BXF A;  5HDK A;  3HRM A;  3LA7 A;  3RCO A;  1I39 A;  3H5N A;  2KIM A;  4PDK A;  5LGT A;  1G4D A;  4O3M A;  3HUG A;  2E2I J;  2MH9 A;  3F72 A;  3CDH A;  4NC6 A;  1RR8 C;  4I7H A;  4KT5 C;  3R4K A;  1NG7 A;  2BW3 A;  4OAZ A;  5EEG A;  4ZTJ A;  2HDC A;  1B9M A;  4DBQ A;  3OWT A;  2P8T A;  3MZH A;  3FXL A;  4NC7 A;  4LJZ F;  1ZHF A;  1LVA A;  2V26 A;  4G6Q A;  4PGG A;  5CLS A;  5L3D A;  2IS2 A;  3BT9 A;  3CCV I;  1E3P A;  2L4A A;  4I0A A;  3OSG A;  1B9N A;  4MHG A;  2NNY A;  4MGR A;  5DM7 F;  2R5Y A;  2DW4 A;  5J40 A;  3OYN A;  3VOE A;  1GXQ A;  1B59 A;  1P92 A;  1O57 A;  5HS9 A;  4UUT A;  3CUQ C;  3LST A;  2PJR A;  3A0B C;  2Y48 A;  3DXJ F;  2IGO A;  3S2W A;  1YX3 A;  3DTK A;  4IRG A;  1X2N A;  2LF7 A;  1U6G A;  2ME6 A;  3TP3 A;  3VYR B;  3K1N A;  3GO5 A;  4B4C A;  4F3Q A;  3RPQ A;  1LE8 B;  2ELJ A;  1QPM A;  5LD2 C;  3CJQ B;  5EG0 A;  3WGI A;  2CO5 A;  1TT0 A;  2FBH A;  4A69 C;  3MN2 A;  4E6K G;  2EV5 A;  4XRS A;  4LIU A;  1ZN2 A;  2CFO A;  3S1R J;  1B1B A;  3IKT A;  2UV1 A;  5FRM A;  4RMN A;  4IOA F;  4G9Y A;  4M3G A;  3NAR A;  1P7J A;  3K1P A;  2BXZ A;  3E6B A;  1LQ1 A;  1UFM A;  1U5T B;  2V79 A;  3W3C A;  3WGH A;  3RPU A;  3HUG B;  3VSL A;  5JVG F;  5L3G A;  4N4N B;  1BJZ A;  2VC0 A;  2MBF A;  2HOS A;  2HZD A;  3O8G A;  1XN7 A;  5TGT A;  1SD7 A;  5F04 A;  1ZKG A;  2L5Q A;  3KPH A;  4LMY A;  3PIO F;  2DA6 A;  2CQQ A;  2QYO A;  1W1W E;  4DYC A;  3M3Y J;  1X4O A;  1Z3X A;  4WXC A;  1XDS A;  2R5Z B;  1MBG A;  2JSP A;  1IUY A;  1OQY A;  5A2Q K;  3WTT C;  3MEX A;  3F8B A;  3LSK A;  4AVZ A;  3TDZ C;  3SJM A;  2KIQ A;  3CO7 C;  4BXX J;  2E60 A;  3F21 A;  3QWL A;  3F9K A;  1E3O C;  5DS9 A;  3CCS I;  2D1H A;  1MND A;  4PJL A;  4OU0 A;  3LQQ A;  4HV6 A;  4KN7 X;  1IUF A;  4CYC A;  1JHF A;  2VL8 A;  2Y9Z A;  3HZJ A;  1PUE E;  3GLL A;  3BTI A;  2XAJ A;  2QEX I;  2BY0 A;  4BDZ A;  3Q9V A;  4I2O A;  3OMY A;  5L3F A;  3FXU A;  2P6S A;  2H94 A;  1T98 A;  5JVT A;  2EZI A;  2F5D A;  3O6B B;  2V4J C;  4II3 A;  1FIA A;  3HPG A;  5LGN A;  2JUC A;  2YU9 J;  3AG4 H;  3FBN B;  2W4S A;  1G3T A;  1O7L A;  2KP6 A;  1XCB A;  4HNU A;  2G7U A;  5FRN A;  4RLF A;  1UHS A;  3WG7 H;  2NOG A;  1VQK I;  2Z16 A;  1RKT A;  5J3L A;  2DYR H;  1SMY F;  2R3S A;  2W25 A;  2E5Z A;  3SFI A;  1XPX A;  2OV7 A;  4B47 A;  2QLZ A;  5CVV A;  3M1C A;  3Q0W A;  1A35 A;  2Y9Y A;  1JGS A;  3SEZ A;  3IAM 2;  5E3N A;  2RDP A;  4FHT A;  4F93 B;  3Q3S A;  1UB9 A;  3WE2 A;  2L9R A;  2H6C A;  4G7H F;  2K3F A;  1W5T A;  1M1E B;  3GTJ J;  3GYH X;  1VQM I;  3QYF A;  3RTR A;  4UUS B;  4XKW A;  6PAX A;  3F8C A;  1DQU A;  1X3Z B;  2A61 A;  1NTC A;  1R4M B;  2M7B A;  2QSH X;  2BOL A;  3R6S A;  4ABZ A;  2IAI A;  2P7V B;  4DOZ A;  4IHY A;  3QYE A;  4HST A;  2M34 A;  4GRI A;  2LBF B;  2JVH A;  3BTL A;  2IGN A;  4XRF A;  1YI2 I;  1DGR M;  2MAB A;  4C2M J;  4CH7 A;  3X2Q H;  3GF2 A;  1OCO H;  3L7W A;  3AG2 H;  2DMT A;  2JJ7 A;  4A3L J;  1U5T C;  2MD5 A;  4L0Z B;  4ANJ A;  1FOX A;  1VZ0 A;  3CF2 A;  2V9K A;  2ZB9 A;  5FRO A;  1WJC A;  4XLC A;  1YX5 A;  1ETW A;  3FHZ A;  5E20 A;  2HOE A;  2VQH A;  3U1D A;  2XC7 A;  5M5X J;  4XLE A;  3BJ6 A;  4U88 A;  4E70 A;  2M3A A;  3I59 A;  3G1L A;  2IBD A;  1MZB A;  4CA0 A;  4XID A;  2H8W A;  3RDI A;  4LOC A;  1SAU A;  4BJ6 C;  2AXT C;  2FML A;  3T1B A;  3SYT A;  5F0F A;  1TW2 A;  4ITV A;  5J8F A;  3FKJ A;  4IF4 A;  3L2Q A;  1OCR H;  1VND A;  1VI0 A;  2OBP A;  2DN0 A;  1FJL A;  5HLH A;  4CDG A;  1W5S A;  5CVU A;  2OUM A;  1WI3 A;  4ZTF A;  5FLV A;  3MMY B;  4HF0 A;  3WTU C;  2ETH A;  2HKX A;  4A3M J;  5IYD J;  2DK8 A;  1BI2 A;  2XB0 X;  3DTE A;  1HF0 A;  1T08 B;  4IHT A;  4NHJ A;  5LHG A;  4G7O F;  4AID A;  3BPX A;  1FC3 A;  2PMU A;  4F52 A;  2IJL A;  1D3Y A;  3WOD F;  1ZK8 A;  5F64 A;  2QKL B;  3N05 A;  2IXS A;  2QQ9 A;  2ZCW A;  4XRS G;  1XCV A;  3HBL A;  5JFR A;  3R0J A;  1MW7 A;  4M71 A;  2BE5 F;  2HOT A;  2ZNZ A;  3PQJ A;  3M9A A;  3BJA A;  4HLX A;  1UEL B;  4D5C A;  2CQK A;  5JLX A;  5EGO A;  1VQ8 I;  3SZT A;  3CLO A;  5GAE J;  3QQA A;  2W85 A;  2LMD A;  1XS9 A;  3BZK A;  3SFZ A;  1O3S A;  3E5U A;  5D8L B;  3LSR A;  4CXF A;  3FWE A;  4ON0 A;  3TL4 X;  3K4M A;  2ZJP F;  2MFZ A;  4ESB A;  5HDG A;  3ABL H;  1BN5 A;  4U7B A;  1SD6 A;  2DJI A;  4ZYH A;  1MNM C;  2VQG A;  3J80 K;  2EIM H;  1W36 D;  2OTL I;  1DUX C;  3WU1 B;  2GLO A;  1XG1 A;  1XGO A;  3QOE A;  2CQX A;  5FKN A;  1W4M A;  5JHF A;  1S72 I;  3HHG A;  3KZI C;  4XBF A;  1PP7 U;  3PSF A;  3H5A A;  4FT8 A;  5F1R A;  2HQR A;  2R7Q A;  4M3B A;  2ME0 A;  4A3C J;  2CU7 A;  3OS2 A;  4EMS A;  2ZSI B;  2EFW A;  4BE2 A;  4HW0 A;  5M3M J;  2K9M A;  2GXG A;  3PNY A;  2O0Y A;  1LDD A;  1J59 A;  1WHU A;  2G7H A;  1ZRF A;  2BHY A;  3T8T A;  2P0W A;  3FK6 A;  1BR2 A;  1XSX A;  2CUF A;  1ULY A;  4LLL A;  4RGU A;  2PMH A;  4PFO A;  5HOD A;  1TWC J;  2LNB A;  3O8H A;  5FJ8 J;  2JSC A;  4XMY A;  4HDU A;  4RGR A;  4PSX A;  2RN7 A;  2IVM A;  3BCB A;  1ACI A;  3L2W A;  4XLA A;  2VE8 A;  4XLP F;  3HG9 A;  3K0L A;  3CD6 I;  4X0G A;  3HOU J;  3EUK L;  3TQN A;  3LNQ A;  3BPV A;  3A1Y A;  1I5Z A;  2JPC A;  2HKO A;  1T0F C;  3LSI A;  3V8J A;  2OD5 A;  1DU6 A;  3VSK A;  1D1A A;  2FA5 A;  5FKK A;  1SVM A;  3IHU A;  3A02 A;  1F43 A;  1CGP A;  3P7N A;  1E17 A;  4D1Q A;  3H1C A;  2FNP A;  1MBF A;  1UHW A;  1MMN A;  3VOD A;  4EJU A;  1W0T A;  1AU7 A;  1KQ8 A;  2HEO A;  2K02 A;  1YW8 A;  4UHT A;  1MJA A;  1R1V A;  2X6O A;  4RAZ A;  4R79 A;  2P7C B;  3D5R C;  3H9J A;  2XPU A;  4WF2 A;  1X4P A;  1JHH A;  1UG0 A;  1TWA J;  2FX0 A;  3F8F A;  4PFP A;  5K5Q A;  3KLN A;  1JXS A;  2W57 A;  2TDX A;  3E97 A;  3C2H A;  3E5X A;  4V2F A;  3WTX C;  3F8N A;  2IS4 A;  2X4H A;  5EJC A;  4MFE A;  1MBH A;  4JBA A;  1O3T A;  4OIQ F;  2K4B A;  3C18 A;  2E2H J;  1YFH A;  1R5G A;  3EQL F;  2EIN H;  3WTS C;  3IRQ A;  3PQK A;  1UZC A;  4IHV A;  2X1C A;  1SAX A;  3DBR B;  2HFH A;  1F9N A;  3DF8 A;  5L3C A;  4IX7 A;  2NVT J;  5ILV A;  2MC4 A;  5D4R A;  1S6L A;  2ECB A;  9ANT A;  1BJA A;  2K7L A;  5DCM A;  1IN4 A;  5D6F A;  1T95 A;  3RJP A;  1IRZ A;  1P2F A;  3C2B A;  4CGZ A;  2Y0S A;  2KDZ A;  4A3G J;  3L2U A;  4AU7 A;  3RQ4 A;  3ZXS A;  3A01 B;  4FCY A;  3TOA A;  2HI3 A;  3TED A;  4QPO A;  2LDU A;  4E7J A;  3E1S A;  3RKY A;  4MEY F;  5DV5 A;  5F0H A;  1FLI A;  1R5I D;  2V1X A;  4A0Z A;  3BR2 A;  4BAC A;  2NVY J;  4M72 A;  4WXH A;  1IW7 F;  4LLN A;  1RUN A;  1FIP A;  3KEQ A;  2K3P A;  4BE1 A;  1RZ4 A;  4HYE A;  2BHZ A;  4IJA A;  2HGC A;  1YIJ I;  5CPR B;  4EGY A;  1R00 A;  2O8K A;  5GAG J;  4HAM A;  2F5C A;  1YTY A;  3QPS A;  2LG4 A;  1SD5 A;  2PFB A;  5IT3 A;  2QQA A;  5FD5 A;  4BAY A;  5BPI A;  1A04 A;  1H9G A;  4ZYG A;  2COM A;  1YJ9 I;  2X6Y A;  3ZMS A;  1P4X A;  1QPI A;  2HR3 A;  3TDU C;  1FTZ A;  3MZ8 A;  4Z2Y A;  4IZZ A;  2YR2 A;  3QOD A;  2PI0 A;  3GTL J;  2MLK A;  2O6G E;  2O3F A;  3FXO A;  1VF9 A;  5K5R A;  1OR7 C;  4XLN F;  1MBE A;  1T2K A;  3J80 Z;  2JTV A;  2XAH A;  3I59 B;  4KIC A;  4AIH A;  3ZR8 X;  2LC2 A;  5IOY A;  1AKH A;  5D5U B;  2ZXJ A;  3F6V A;  2XDV A;  3G6E I;  4ESF A;  4BHP A;  3JAM Z;  1FBQ A;  1IN6 A;  1Z67 A;  3C7J A;  3OV8 A;  2ZKZ A;  3DPT A;  3O2P E;  2LKX A;  2EWN A;  3GTO J;  3QPL A;  1IRG A;  4PJ0 C;  3VYU B;  3OIQ A;  2WV0 A;  1VQO I;  3OYK A;  3G1M A;  3DV8 A;  3IUO A;  1SVO A;  3DPL C;  2R7D A;  5AON A;  5F6F A;  3QU3 A;  3FXM A;  5GPA A;  3DPU A;  3LSM A;  2RGV A;  4A3K J;  4M3F A;  2WB1 N;  1AWC A;  2UZK A;  2JRM A;  1Y8Q B;  2VT3 A;  2XAU A;  3K1M A;  3LL7 A;  1Z77 A;  3MAJ A;  2JWT A;  5B1B H;  5IT9 K;  2DDB A;  3GTG J;  3S2D J;  1J75 A;  3LFK A;  2ZJQ F;  1RRJ A;  3VDX A;  1SVL A;  2X9D A;  1OKR A;  4JK1 X;  2LD5 A;  1B8I B;  1ZRD A;  4QTR A;  2CUZ A;  4Q4Z F;  4HBL A;  2NVQ J;  1KQ9 A;  1MKM A;  3R0A A;  1U8R A;  3UNG C;  2K9L A;  2V6C A;  1QO0 D;  5B5E C;  3ZP5 A;  4NBQ A;  2QSF X;  2YX7 A;  5EF6 A;  3Q9S A;  5GPC A;  2FQ3 A;  2X48 A;  2XPW A;  3ZPL A;  2L3D A;  3KEY A;  3ML6 A;  1R1U A;  3HKZ A;  1IZ1 A;  1I50 J;  3CMY A;  4BEH B;  2VXD A;  3BR3 A;  1FP2 A;  1MH3 A;  2A05 A;  2EZL A;  1R7J A;  2OCE A;  4ZDL A;  2D5V A;  2CUE A;  3HOT A;  1XGM A;  3OOU A;  4UUS A;  3EET A;  4M3E A;  3MFK A;  4CIC A;  1IAW A;  1S3J A;  1FWZ A;  1D0Y A;  2X1E A;  3M1E A;  1QZZ A;  3ZOB A;  1DPR A;  3SZP A;  3F8M A;  3JSP A;  4DJA A;  2CG4 A;  3CCJ I;  2ESN A;  4GDF A;  2E1N A;  4UB6 C;  1BIA A;  1Q1V A;  1Z0X A;  3QP6 A;  5DD8 A;  2R7O A;  1Y6I A;  3MKW B;  5D8K B;  4ASN A;  3F23 A;  3BR5 A;  3PIP F;  4A0X A;  1O7F A;  3KZZ A;  3TO6 A;  2ZXI A;  2W7N A;  1JI8 A;  2FD5 A;  1YW9 A;  2JVG A;  5E3O A;  1LE8 A;  2E7W A;  3HEF A;  3T8R A;  3WTW C;  1ETK A;  1XGN A;  1LUJ B;  4MEX F;  1ERD A;  4P1W A;  2WBM A;  3K6G A;  3M07 A;  1Z1D A;  4IRH A;  1V5G A;  4A6E A;  4F55 A;  5IP7 J;  4NNJ A;  1GT0 C;  2HVS A;  1Y8R B;  2F4I A;  1YOV B;  2BVM A;  5FFX A;  3GEZ A;  1SFO J;  1BOA A;  3J7A Y;  5EZG A;  3CP2 A;  5EYR A;  4IHW A;  1RI7 A;  4CUG A;  4BY1 J;  5EEA A;  5J8C A;  2O03 A;  3U2R A;  2A6E F;  2LH9 A;  5HNF A;  2P81 A;  3GZ5 A;  2L0K A;  3PFI A;  2QSG X;  3S1M J;  1RPW A;  2A68 F;  2DOE A;  1LVK A;  4GCV A;  3MKZ A;  2Z2S B;  5E8I A;  3E0J B;  2A5W A;  2WV1 A;  2LF8 A;  1Y56 A;  3I3L A;  3RSN A;  2QBY A;  3FXK A;  3CCU I;  2W00 A;  4ZDP A;  2AQF A;  3SEQ A;  2QQB A;  4FE7 A;  5BS6 A;  4HV5 A;  1L0O C;  2IPQ X;  3HSE A;  1LFP A;  2F5F A;  1HKT A;  2X51 A;  4WCG A;  2H6B A;  4DW6 A;  2L7K A;  1G3W A;  3H3Z A;  1J9I A;  1A6Q A;  2AXL A;  2HXO A;  2EFQ A;  2VBY A;  4C3H J;  3EUH C;  1EKE A;  1E0E A;  4WWC A;  2DPU A;  4XSX F;  1U9N A;  3S3M A;  2FF4 A;  2JUG A;  2STT A;  2BYV E;  1FPQ A;  3PFY A;  3VYT B;  2R7T A;  1FOY A;  2XGX A;  3ABM H;  2DFI A;  1SD4 A;  3HSR A;  1MMD A;  1N77 A;  2KMU A;  4P9F A;  3OYI A;  3MZY A;  1K61 A;  2RNJ A;  2HOA A;  5CQE A;  2RAE A;  1WRJ A;  3L00 A;  4G8X A;  2DOA A;  2NYX A;  4U0Y A;  3FK7 A;  3BZ6 A;  2DT5 A;  2M7A A;  3R60 A;  5E1Z B;  4Y13 A;  2E1M B;  1VQN I;  2MD0 A;  1JJ8 C;  3H3V K;  4I6Z A;  4YFX F;  1GV2 A;  2R93 J;  3MD2 A;  3V7C A;  1JUS A;  1KON A;  4A3F J;  4UXN A;  3HRU A;  2Q2E A;  2BXY A;  5HLG A;  2VPL A;  2FOK A;  3HRT A;  5FD6 A;  2EA4 A;  2BY1 A;  4NDL A;  3JW4 A;  3JTG A;  2ZFW A;  3BQY A;  2QKM B;  1LFU P;  4OOI A;  5LRR A;  3OY9 A;  2HS5 A;  5DCF A;  5IOZ A;  1D1B A;  1E3H A;  5J4Y A;  5FFZ A;  4IO9 F;  2EV0 A;  3A4C A;  3QPH A;  3OYL A;  1LDK B;  3E3V A;  1WJE A;  2EIJ H;  2BVL A;  3BQZ A;  4EVI A;  2BY2 A;  1Z6R A;  2KIS A;  1IN5 A;  2DJN A;  3KIO A;  5TRD A;  1K6Y A;  4HX7 A;  2GBY A;  5LRS A;  3P5J A;  4KFC A;  2A5Y B;  3S32 A;  2F4O B;  2OQG A;  1AKH B;  3FBI B;  2EFN A;  2DMP A;  3L2R A;  3K2Z A;  2WTE A;  4RAY A;  1MJ9 A;  4L9T A;  1Z3Y A;  5BQT A;  1X1A A;  4B3A A;  1HDD C;  5FLM J;  1ZGW A;  2PN6 A;  3OYB A;  3FIW A;  3OYC A;  3DKY A;  4CCO A;  4S0H B;  5ILU A;  2W84 A;  2KL4 A;  4XIC A;  1Y39 A;  2WC2 A;  2KRF A;  1JUM A;  3S3O A;  3RQI A;  2Q2E B;  4L0Y B;  5F27 A;  1MSF C;  1X58 A;  1FEX A;  3ZQL A;  5AIQ A;  3G71 I;  2XVC A;  5B1A H;  2CMP A;  1F36 A;  2WA0 A;  2A69 F;  5E3M A;  4BQQ A;  3KLO A;  2CW0 F;  4CO8 A;  1IXC A;  3H9Q A;  5E1X A;  2GA2 A;  1V3F A;  3GFI A;  4HPQ A;  5D5V B;  2FBI A;  2K4J A;  2FXA A;  2EIL H;  2KIU A;  1R22 A;  3ZQH A;  3OYH A;  3FXJ A;  4Q48 A;  2MH2 A;  3W6V A;  2IS1 A;  4KIS A;  2V1D A;  4EM0 B;  2JA7 J;  1FBS A;  1KU2 A;  2WAF A;  3E6C C;  2K9S A;  4AM3 A;  4OMZ A;  4L9N A;  2V1U A;  2K86 A;  5HNH A;  1DP3 A;  1K7A A;  3OS1 A;  1BOB A;  2D45 A;  4LLG F;  4L5I A;  5D5X B;  4I09 A;  2VKH A;  2GM4 A;  5LLQ A;  3ZRG A;  4CSW A;  3VYS B;  4MQV A;  1HW5 A;  4ENN A;  3CJN A;  4M6V A;  1FSH A;  2VAS A;  4KDP A;  4RGS A;  3I64 A;  2K9N A;  2XRL A;  3AL0 B;  2ZJR F;  1Z6T A;  2ZSH B;  3VPR A;  3EUH A;  1FMW A;  4A12 A;  2E34 A;  1FY7 A;  3QU6 A;  4D9J A;  1AOY A;  1JT0 A;  4XQF A;  1ITY A;  1ETO A;  1ORK A;  5KVR A;  4MO7 A;  1ETY A;  3HYI A;  3SZG A;  3CQZ J;  1K78 B;  4CCM A;  4Q47 A;  3HKZ N;  3K10 A;  5ICE A;  4S04 A;  1X1D A;  1OPC A;  1XTA A;  2Y69 H;  4CYC B;  3RI4 A;  1V4R A;  3OYD A;  1GLN A;  4UNO A;  2VN2 A;  1NK2 P;  3D5S C;  3PM1 A;  2VOD A;  2XPV A;  3TOB A;  3COA C;  3QPT A;  2IRF G;  2E19 A;  2RVC A;  3FZV A;  3ZGK A;  2Q0O A;  4C3J J;  2IEK A;  1ZEL A;  2HYF A;  1WJF A;  1L3L A;  2DMN A;  5HS8 A;  3ROU A;  2HQA A;  3DU5 A;  4IQ4 A;  1R71 A;  3CC2 I;  2CYY A;  5FLX K;  4HNV A;  2CS3 A;  2IP2 A;  4BNC A;  2CFX A;  1PUF A;  2X1D A;  4J01 A;  3G2B A;  4I98 B;  2VKE A;  4HOB A;  1D0X A;  5E1W A;  2FRH A;  4C9Y A;  4L5E A;  1U0J A;  2JT1 A;  4QPQ A;  5ICC A;  3BC8 A;  2WAE A;  2PJR B;  2GOX B;  1FYM A;  2LRE A;  2DCE A;  3AG3 H;  3DKX A;  4FAS D;  1YJW I;  3Q0U A;  1KU7 A;  1Y0N A;  2ZC2 A;  2NVU B;  1YQA A;  4XRM A;  2XF6 A;  1W0U A;  1XGS A;  3TGN A;  4IQJ A;  2JN6 A;  3REO A;  2I5U A;  3PSI A;  2Z5U A;  2CW7 A;  2DAO A;  2HWV A;  3M8E A;  4U0V A;  1TBX A;  3HTU A;  3DP7 A;  1U5T A;  4KIT B;  1V55 H;  3B02 A;  4BJT A;  5H2F C;  1TQI A;  3JRC A;  3DLA A;  4LD5 A;  4IHS A;  3ULQ B;  3DLL F;  5EEH A;  3QYB A;  4R1H A;  2W48 A;  2LY2 A;  1XC5 A;  3MKY B;  2STW A;  1WJD A;  2R92 J;  3GTK J;  3CF5 F;  3PNV A;  4FQG A;  4QSH A;  5L3B A;  4Q5S F;  1H0M A;  1TWH J;  2EZK A;  2CQ7 A;  4P55 A;  4IPA A;  3V7S A;  5HLI A;  1NK3 P;  2FU4 A;  2HYG D;  3NAU A;  1FMV A;  3CJT B;  4HZF A;  3OS0 A;  1HSJ A;  2ICW G;  2E36 A;  2VT2 A;  3OL4 A;  1CQT A;  4P9U A;  1TT5 B;  4LG0 B;  4P96 A;  4ETS A;  2GXB A;  1OR7 A;  3S17 J;  4XOR A;  2XAF A;  2OJE D;  3J81 Z;  5AIP A;  3N97 A;  4BYY A;  1WWX A;  2HDD A;  1T33 A;  2B7E A;  2OF7 A;  2Y31 A;  1POG A;  4U87 A;  3OYE A;  2MA3 A;  4A3B J;  3IRR A;  3NRV A;  3QOP A;  4IRI A;  1PP8 F;  4BHB A;  2HPM A;  4B3X A;  3HHH A;  3J7Z I;  4OMY A;  3BRO A;  4LK1 F;  4XOT A;  1BR1 A;  3I71 A;  1WVR A;  1HA8 A;  3L2C A;  4UVA A;  3N4M A;  1C0W A;  4Z6Y A;  3WG9 A;  3EUA A;  4I0B A;  2V6E A;  5DEQ A;  2OA4 A;  2OZ6 A;  3SQN A;  3R61 A;  4HX8 A;  1RES A;  2LFB A;  1ZRC A;  4M73 A;  2M5W A;  2LR8 A;  2QUF A;  1H88 C;  2JK3 A;  3QP5 A;  4RA2 A;  4XK4 A;  3GXO A;  1I3Q J;  2M2E A;  3F22 A;  2QBY B;  4CCJ A;  4H0E A;  1BR4 A;  2BY3 A;  4AC0 A;  1G8X A;  1X3U A;  4RBO A;  1KU9 A;  5KAI C;  3WTZ A;  1Z9C A;  1R23 A;  4LG0 A;  3JRE A;  3I5U A;  5F08 A;  1EH7 A;  4PZJ A;  1ENH A;  2ELH A;  1YO5 C;  3L9F A;  4BHC A;  4TV7 A;  1FOK A;  1P4A A;  4ENM A;  1BC8 C;  2PEX A;  2L4M A;  1IDY A;  4QIW N;  5E8G A;  2AHQ A;  5A2Q Z;  1UG2 A;  2CWE A;  1UST A;  5K5O A;  2E1O A;  3KET A;  3U9G A;  1J5Y A;  1KZH A;  4E4H A;  4YFN F;  1SFU A;  2F4M B;  2VE9 A;  1JKP C;  3PO3 J;  2L9V A;  4YIF A;  4FET A;  1U2W A;  2OC6 A;  4XLF A;  1P9Q C;  2XGE A;  2O7O A;  5B66 C;  1Y0U A;  1ONV A;  2MYS A;  4FE4 A;  4HQE A;  2NVX J;  4BS9 A;  3LSJ A;  2CW8 A;  1ODD A;  1H9T A;  3HOX J;  4XON A;  2ZFU A;  5M5Y J;  3KP7 A;  2WY7 Q;  3H3U A;  4PGH A;  1HKS A;  1WJA A;  3D5L A;  1SAN A;  5HVQ C;  3BR6 A;  3BY6 A;  3RYR A;  3F6O A;  3JRI A;  2FQ4 A;  1BIB A;  3GW2 A;  1G3Y A;  5BOX A;  3GTP J;  4XLH A;  1UAA A;  3LA2 A;  2P5L C;  1TZL A;  4EQQ A;  1OMI A;  3VWB A;  5DTD A;  3DWL E;  3K9T A;  5DDG A;  3UKG A;  2VJJ A;  2QWW A;  5JR3 A;  5K7H A;  4L9V A;  2R5Z A;  5DM6 F;  2L9S A;  4ENK A;  1LKX A;  1STZ A;  1HKQ A;  3ERM A;  3HGG A;  1EV7 A;  3LAP A;  2LKS A;  3CCQ I;  4BUP A;  1VQ5 I;  3ASN H;  1U78 A;  1D8J A;  2XIG A;  2LVS A;  1FBU A;  2VQC A;  3FXR A;  3KP4 A;  3P9K A;  2IS6 A;  1LPQ A;  2DOF A;  4AUX A;  3K7A J;  3OIO A;  3BZC A;  1FSE A;  5ICG A;  2WAQ N;  5DUI A;  1R49 A;  2ID3 A;  5CVI A;  2W1O A;  4E7L A;  1U8B A;  2MSY A;  3IH4 A;  2KJB A;  2BGC A;  3CC4 I;  3MVP A;  3GBG A;  1J7K A;  4Y7N J;  2H8R A;  5HLT A;  1EF4 A;  1Z21 A;  3V8K A;  1FX7 A;  5IYB J;  2I8D A;  3ZQC A;  1BL0 A;  1S7A A;  4ZH4 F;  4XR6 A;  2DPD A;  3KX2 A;  3I4P A;  4A3E J;  2RKH A;  1BI1 A;  2VIX A;  1R36 A;  4HQM A;  2JQ7 A;  1MNE A;  4G7Z F;  1SFE A;  3H92 A;  4FX4 A;  4RM3 A;  1ZR2 A;  1XSD A;  3ZMU A;  4PJN A;  5BNG A;  4ZZL A;  2OZU A;  3WTV C;  3BDD A;  5CJ9 A;  1K4S A;  4A5N A;  3B6C A;  4MLO A;  1APL C;  1RNL A;  4DIQ A;  4G6T B;  3CUO A;  3JRD A;  1QBJ A;  1ZGJ A;  4V19 K;  2XRO A;  1J0R A;  2KPM A;  1HST A;  1X19 A;  2L01 A;  4D5F A;  4JYK A;  2ESH A;  2XF5 A;  4KYW A;  5M5W J;  2GWR A;  2XSD C;  3OIP A;  1REP C;  3CDL A;  1KU3 A;  2DA2 A;  5CVJ A;  3WHC A;  3ZQ7 A;  3QRF F;  2XUB A;  5LEJ A;  3RZD J;  2DO7 A;  1HDP A;  4DZJ A;  3SDB A;  4A5M A;  3CUQ B;  1QVU A;  2BBY A;  5IY5 H;  1OYY A;  4LIT A;  3E6M A;  5BPD A;  1JUP A;  4HG2 A;  3LSH A;  3BCA A;  1IG7 A;  3GCM A;  3VEP A;  3K4J A;  4XKC A;  4DNC A;  3E6D A;  5LFA A;  2HNH A;  2KZG A;  4Y17 A;  1HOM A;  1AHD P;  4UY8 I;  1KYZ A;  1P6R A;  1T6S A;  2LTP A;  1B6A A;  2RRE A;  1Y1W J;  2FJ1 A;  3BWG A;  1G3S A;  2UXX A;  1U9O A;  3JRB A;  4DYR A;  1ZYR F;  4YIR X;  4AIK A;  4EJW A;  2VKV A;  2R0Q C;  2ISZ A;  4RGX A;  1HQC A;  1EH6 A;  4GYI A;  2YUS A;  2JRT A;  2WY8 Q;  5TIS C;  3H35 A;  5M3F J;  1T56 A;  2QF7 A;  4BY7 J;  1OIS A;  2FUG 2;  4JX5 A;  2YPR A;  5DUK A;  5IYC J;  1IRX A;  2PMZ A;  1IN7 A;  1YIO A;  1BM9 A;  4H4K C;  5DYM A;  2P5V A;  1XX5 A;  3C1D A;  1I6H J;  2R4G A;  2DA4 A;  4XKV A;  1KYW A;  4MFD A;  4A6D A;  5HOO A;  3K4B A;  4M3D A;  2XGD A;  4IEJ A;  4B44 A;  4EM1 A;  5K1Y A;  4CYD A;  5KK1 A;  1G2H A;  1BC7 C;  2A6T A;  2E5N A;  4BQN A;  1TQP A;  4HLY A;  3BR0 A;  4UV8 A;  3LA3 A;  2DOD A;  1EH8 A;  2M30 A;  2AQE A;  1RKW A;  3AG1 H;  4CCK A;  3DQV C;  2XGC A;  1IXR C;  2Z3Y A;  4KN4 X;  5J4V A;  2Z99 A;  3G4S I;  4KMF A;  2K40 A;  3CO6 C;  3FM3 A;  1S9H A;  4KIG A;  4LB6 B;  1H8A C;  3I54 A;  4C2T A;  5F0C A;  1E2X A;  3DTI A;  4BE0 A;  1YRN A;  3G1O A;  1WSU A;  3RIR A;  4UV9 A;  1ZG1 A;  2GAU A;  2Z33 A;  2UWM A;  1T0F A;  2M87 A;  4BQA A;  2FEZ A;  4BEH A;  2JMW A;  1KGS A;  4LG3 A;  3BLY A;  2EK5 A;  3SXY A;  4I99 C;  4C30 A;  5EZH A;  2DK5 A;  2L9N A;  4UUV A;  3GFJ A;  1X1P A;  1TP4 A;  2NAZ A;  3P9I A;  5EGO B;  1QNT A;  3S16 J;  3KCC A;  4C2U A;  3EDP A;  1XMA A;  1YS7 A;  4J00 A;  3D0S A;  4FIS A;  1O4X A;  2DT7 B;  1GUU A;  5LGU A;  1G59 A;  4LK0 F;  3JRG A;  1BBY A;  2FBK A;  3K70 C;  1MSE C;  1X2M A;  2XAG A;  2P4W A;  2Y75 A;  5ILS A;  3A03 A;  1MGT A;  3W6J B;  1N78 A;  1LNW A;  2COB A;  1DU0 A;  2DDA A;  3MKL A;  1W7P B;  2GQQ A;  4AYB N;  2KZV A;  2PJP A;  2NNN A;  1QVT A;  4WK8 F;  4GYG A;  4NQW A;  4GXO A;  1PYV A;  4MTE A;  4MIM A;  2VBZ A;  3ECO A;  3S15 J;  1HC8 A;  4EEF G;  1F4K A;  1MBJ A;  3FMQ A;  4HA8 A;  1JKR C;  2JA5 J;  2VOO A;  2Q1Z B;  4B1R A;  2DMQ A;  1FP1 D;  4YEJ A;  3TBI A;  1H89 C;  2GZW A;  1GHC A;  2K5C A;  2M9H A;  3V7R A;  1TTY A;  3C3W A;  3HOS A;  1WGX A;  1FYK A;  2R7R A;  5J47 A;  4KMU X;  1JGG A;  3AL0 C;  3HOZ J;  2A6H F;  1WJB A;  4L5J A;  4E7I A;  1BI0 A;  4HDV A;  2CRG A;  4ZDO A;  2CQN A;  3WGG A;  2Y30 A;  2VQL A;  3VB2 A;  3JRA A;  3TP0 A;  3D1N I;  2EFP A;  5E79 C;  2PG4 A;  1EJ9 A;  2R7V A;  4HX4 A;  1D8K A;  2EA2 A;  3I0T A;  3DU6 A;  3V4G A;  4IVN A;  2KHM A;  3K4L A;  2ZXW H;  1I1S A;  2LKP A;  3S2H J;  2ELK A;  3JAM K;  2LY1 A;  3FMS A;  1VQ7 I;  2JA8 J;  2WAQ A;  2PLY A;  2X85 A;  5EG0 B;  4U7D A;  3ABK H;  2FE3 A;  1LDJ A;  4N9H A;  1W7P A;  4N9I A;  1CF7 A;  4E7K A;  1W36 C;  2L7F P;  4YEL A;  2V9P A;  4XM3 A;  4AD9 A;  1IF1 A;  1PVE A;  4MNU A;  3LFU A;  3EYY A;  1PUF B;  1Z91 A;  3ZN0 A;  1YLF A;  3HM5 A;  2DQR A;  3S1Q J;  2DMU A;  1BW6 A;  2Y0M A;  4LB5 A;  3BG3 A;  2KLO A;  4OIN F;  3BTC A;  2LYC A;  4I02 A;  1QHG A;  3HL2 A;  5E17 F;  3AFH A;  3IWZ A;  3KZY A;  5FO5 A;  1YIT I;  2AS5 F;  4YG2 F;  2R7W A;  3CLQ A;  3MQ0 A;  4BDY A;  4D0P A;  5J6X A;  3CP8 A;  2C6Y A;  2H1K A;  4EV0 A;  2QEN A;  1ZQ3 P;  4HF2 A;  4HF1 A;  3K4K A;  2VJ5 A;  1NHA A;  5ICF A;  1RUO A;  4XNF A;  3KP6 A;  1TC3 C;  4J19 A;  2RNG A;  2VBW A;  3VFZ A;  4D7N A;  4Y3O A;  2NOJ B;  1D5V A;  4MQ9 F;  2R7F A;  2V1N A;  3CTA A;  2MC3 A;  4R8H A;  4UVB A;  2CV2 A;  1IC8 A;  5IP6 A;  5CVR A;  3V42 A;  2Q8K A;  3BG5 A;  3CUQ A;  2RC4 A;  3OYM A;  2M45 A;  1CF7 B;  1FOW A;  1JKO C;  1ZR4 A;  3KEO A;  4HEA 2;  2HQ5 A;  1GV5 A;  1UHM A;  2DFE A;  2VB6 A;  4DZP A;  2E1M C;  3HOY J;  4O6J A;  4RLQ A;  4B43 A;  2IA2 A;  3CJR B;  3LMM A;  1HW2 A;  5JHU A;  3NEU A; 
#chains in the Genus database with same CATH homology
 2EZK A;  3LSG A;  3S14 J;  4FCY A;  2L7Z A;  2HI3 A;  3TED A;  5E3L A;  1NK3 P;  5K7F A;  5F0H A;  3PO2 J;  3NAU A;  4Y52 J;  3BR2 A;  2JA6 J;  2I10 A;  2NVY J;  4BKX A;  2XB5 A;  3LSP A;  1YRN B;  1D5Y A;  1FIP A;  2LK2 A;  2ID6 A;  3BR1 A;  1CQT A;  1S7E A;  1Y1V J;  2AO9 A;  3BG9 A;  3FKI J;  2O8K A;  5J1Y A;  3QPS A;  5F1J A;  3S17 J;  4JX6 A;  1JJ6 C;  1JKQ C;  3IV5 A;  4JX4 A;  1QPI A;  2HDD A;  1B72 A;  1TWG J;  1FTZ A;  1WH7 A;  1T33 A;  2M8G X;  4X1E A;  2OF7 A;  5K7Z A;  2Y31 A;  1POG A;  4A3B J;  3ZQG A;  3GTL J;  3HOW J;  1VF9 A;  1MBE A;  2DA5 A;  4JP0 A;  3HB9 A;  3OSF A;  2LP0 A;  5FKO A;  5FKL A;  4V2G A;  5IOY A;  1AKH A;  3S1N J;  2EH3 A;  4C3I J;  1ZTR A;  2M0C A;  1RES A;  2LFB A;  4BBR J;  2LKX A;  2LR8 A;  1H88 C;  3SDG A;  2JK3 A;  2EBI A;  2TRT A;  3QPL A;  4XK4 A;  1I3Q J;  3GTO J;  2M2E A;  3G1M A;  3DEW A;  4W1U A;  4AC0 A;  2K9Q A;  3CCY A;  1VFC A;  4RBO A;  1B8I A;  4A3I J;  3JRE A;  5F08 A;  5GPA A;  3DCF A;  4M3F A;  4A3K J;  1ENH A;  2WB1 N;  2E2I J;  1Z77 A;  2JWT A;  1FTT A;  3H0G J;  4QIW N;  3GTG J;  1IDY A;  3S2D J;  2AHQ A;  3JR9 A;  2X9D A;  1UG2 A;  2LD5 A;  2E1O A;  3TW6 A;  1B8I B;  4QTR A;  3TW7 A;  2NVQ J;  1JKP C;  3BT9 A;  3PO3 J;  3WHB A;  3E7L A;  1BA5 A;  3OSG A;  2R5Y A;  4X6A J;  2XGE A;  2O7O A;  5EF6 A;  5GPC A;  2X48 A;  2XPW A;  3HOV J;  4FE4 A;  2NVX J;  2EQR A;  3LSJ A;  1I50 J;  4UUT A;  3HOX J;  3CMY A;  3BR3 A;  5M5Y J;  1MH3 A;  2EZL A;  4BBS J;  1SAN A;  2G0E A;  2D5V A;  2CUE A;  3OOU A;  3BR6 A;  4UUS A;  1X2N A;  4M3E A;  2ME6 A;  3TP3 A;  2MW8 A;  4B4C A;  3JRI A;  2FQ4 A;  1RR7 A;  1LE8 B;  3JRH A;  3HDD A;  3GTP J;  1JTY A;  5IPA A;  3ZOB A;  5EG0 A;  5DTD A;  4A69 C;  3MN2 A;  3UKG A;  4XRS A;  5K7H A;  1Q1V A;  1Z0X A;  3S1R J;  5J1R A;  2R5Z A;  3I4M J;  3BR5 A;  4M3G A;  3NAR A;  1P7J A;  1GDT A;  3HGG A;  2VPR A;  2FD5 A;  2TCT A;  5E3O A;  1LE8 A;  1U78 A;  3HEF A;  1BJZ A;  2HOS A;  1ETK A;  3O8G A;  3IH2 A;  1OCT C;  5F04 A;  2LVS A;  1ZKG A;  5IP9 J;  5IP7 J;  2DA6 A;  1GT0 C;  2CQQ A;  2HYJ A;  4AUX A;  3K7A J;  3OIO A;  4DYC A;  3M3Y J;  2WAQ N;  2ID3 A;  1SFO J;  2R5Z B;  1MBG A;  1U8B A;  2MSY A;  3IH4 A;  5EZG A;  5EYR A;  1HLV A;  3MVP A;  4IHW A;  3GBG A;  4BY1 J;  5EEA A;  4Y7N J;  5C3E J;  2H8R A;  1EF4 A;  3SJM A;  4BXX J;  1JT6 A;  5IYB J;  3GTM J;  3ZQC A;  2P81 A;  1E3O C;  1BL0 A;  2L0K A;  5DS9 A;  3S1M J;  1RPW A;  1IUF A;  4A3E J;  2WV1 A;  4CYC A;  4FTH A;  2DA7 A;  3HGY A;  2L7M P;  1ZR2 A;  3ZQI A;  5BNG A;  2Y9Z A;  4FE7 A;  3BTI A;  3B6C A;  4MLO A;  2R7Z J;  1APL C;  3JRD A;  1ETV A;  4DW6 A;  5GP9 A;  4D5F A;  2EZI A;  4JYK A;  4C3H J;  2HXO A;  5M5W J;  1FIA A;  2XSD C;  1U9N A;  2YU9 J;  3CDL A;  3I4N J;  1WH5 A;  2DA2 A;  4G12 A;  1UHS A;  3WHC A;  2NOG A;  1RKT A;  5J3L A;  3RZD J;  3SFI A;  1HDP A;  2NS7 A;  4DZJ A;  4A93 J;  2DA1 A;  3Q0W A;  2ECC A;  2Y9Y A;  1K61 A;  1QVU A;  2HOA A;  1A6I A;  2RAE A;  1JUP A;  5E3N A;  1IG7 A;  2O9L A;  3FK7 A;  3Q3S A;  2L9R A;  2CJJ A;  1R9T J;  3GTJ J;  4UUS B;  1HOM A;  1JJ8 C;  1AHD P;  3H3V K;  4I6Z A;  2R93 J;  1GV2 A;  1NTC A;  2LTP A;  1Y1W J;  2FJ1 A;  1JUS A;  4A3F J;  4ABZ A;  2IAI A;  4IHY A;  1U9O A;  2M34 A;  1OCP A;  4DYR A;  3JRB A;  1B72 B;  2VKV A;  1LFB A;  3BTL A;  2Y0S N;  2R0Q C;  1BW5 A;  4NDL A;  4C2M J;  3Q0V A;  2YUS A;  3BQY A;  1IGN A;  5M3F J;  1T56 A;  2QF7 A;  4BY7 J;  1LFU P;  4JX5 A;  2DMT A;  2JJ7 A;  5IOZ A;  4A3L J;  5IYC J;  1I6H J;  2DA4 A;  2ZB9 A;  4MFD A;  2DTZ A;  4D7M A;  1ETW A;  4M3D A;  1ETQ A;  2XGD A;  4IEJ A;  5C4X J;  3BQZ A;  1G2H A;  1UMQ A;  5M5X J;  1OJL A;  3A01 A;  3G1L A;  2DJN A;  3BR0 A;  2IBD A;  4XID A;  5EDN A;  2GBY A;  1P7I A;  1RKW A;  4LOC A;  5C4J J;  2XGC A;  1AKH B;  2K40 A;  5F0F A;  2DMP A;  1H8A C;  5F0C A;  2B63 J;  1YRN A;  3G1O A;  1VND A;  4B3A A;  1VI0 A;  1HDD C;  2DN0 A;  1FJL A;  5FLM J;  1ZGW A;  1WI3 A;  2JMW A;  2QCO A;  5FLV A;  4A3M J;  3FIW A;  1OFC X;  5IYD J;  5EZH A;  3BTJ A;  4S0H B;  2XB0 X;  2Y2Z A;  1HF0 A;  4W97 A;  4XIC A;  5EGO B;  1JUM A;  3RQI A;  3S16 J;  5F27 A;  1MSF C;  1X58 A;  1ETX A;  1FEX A;  2OPT A;  3ZQL A;  4FIS A;  1O4X A;  1ZK8 A;  1F36 A;  5E3M A;  1GUU A;  4XRS G;  3JRG A;  3HBL A;  1MSE C;  2NS8 A;  3RKQ A;  1X2M A;  4GFB A;  1IDZ A;  3ZQH A;  2HOT A;  3A03 A;  3W6V A;  3FIS A;  2VUM J;  4D5C A;  5JLX A;  5EGO A;  2HXI A;  2JA7 J;  3QQA A;  1JTX A;  2K9S A;  1XS9 A;  2COB A;  1DU0 A;  3ZQF A;  3MKL A;  4AYB N;  3LSR A;  1QVT A;  4MIM A;  1MNM C;  3S15 J;  4EEF G;  1MBJ A;  2GM4 A;  1JKR C;  2JA5 J;  1TWF J;  2PMZ N;  4B1R A;  2DMQ A;  2GLO A;  1XG1 A;  1H89 C;  4M6V A;  2CQX A;  2K9N A;  2M9H A;  2XRL A;  5FKN A;  1A5J A;  1MH4 A;  3VPR A;  1WGX A;  2N8G A;  1JGG A;  3HOZ J;  1IV6 A;  4M3B A;  2ME0 A;  1IJW C;  1JT0 A;  4A3C J;  1ITY A;  2CRG A;  2CU7 A;  1ETO A;  1ORK A;  4MO7 A;  2Y30 A;  1ETY A;  1K83 J;  3JRA A;  3LOC A;  3TP0 A;  3D1N I;  2KT0 A;  3CQZ J;  5M3M J;  3HKZ N;  2E2J J;  2R5Y B;  3FK6 A;  4CYC B;  2LLK A;  2CUF A;  5HOD A;  3PM1 A;  4RDU A;  1TWC J;  1NK2 P;  1WPK A;  2XPV A;  3O8H A;  2E19 A;  5FJ8 J;  4C3J J;  2IEK A;  3S2H J;  2ELK A;  2MGQ A;  2DMN A;  2VI6 A;  4I76 A;  2JA8 J;  4HNV A;  5EG0 B;  3HOU J;  4A3D J;  3LNQ A;  3RZO J;  1PUF A;  2L7F P;  3IH3 A;  5JLW A;  3GTQ J;  2VKE A;  1WCM J;  4L5E A;  1DU6 A;  1PUF B;  5FKK A;  2DA3 A;  3A02 A;  3HM5 A;  1F43 A;  3S1Q J;  2DMU A;  1BW6 A;  3BG3 A;  1AU7 A;  1MBF A;  1W0T A;  3BTC A;  3Q0U A;  1MBK A;  5FKM A;  2X6O A;  4DYQ A;  2EZH A;  1RET A;  2XPU A;  1TWA J;  2FX0 A;  4XRM A;  2H1K A;  4IHX A;  4V2F A;  1W0U A;  1ZQ3 P;  1TC3 C;  4MFE A;  4J19 A;  1MBH A;  2JN6 A;  2E2H J;  4D7N A;  1HCR A;  1GVD A;  4IHV A;  3JRC A;  2LY9 A;  3K2A A;  1IC8 A;  5IP6 A;  2NVT J;  3M4O J;  1QRY A;  3BG5 A;  2ECB A;  9ANT A;  3B6A A;  2W48 A;  1JKO C;  1ZR4 A;  1XC5 A;  3JRF A;  2HQ5 A;  1GV5 A;  5C44 J;  4A3J J;  4DZP A;  1IRZ A;  3HOY J;  5J1U A;  2R92 J;  3GTK J;  3C2B A;  2YS9 A;  2KDZ A;  3L1P A;  3F0C A;  4A3G J;  4QSH A;  2MG4 A;  1TWH J;  3A01 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...