1VF9A

Solution structure of human trf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
MEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomeric repeat binding factor 2
publication title Comparison between TRF2 and TRF1 of their telomeric DNA-bound structures and DNA-binding activities
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1vf9A00
2MG4A 4M3BA 4MO7A 2IAIA 4RBOA 4FISA 3ZQFA 4GFBA 2R5YB 5BNGA 5E3MA 1DU6A 2ECBA 3ZQCA 1FTZA 1LFUP 1JKRC 2JA5J 3HEFA 2HI3A 5FLMJ 1WH5A 2NS7A 4B4CA 1X58A 1XC5A 2O7OA 3A02A 1VI0A 3B6AA 3BT9A 2DMPA 2TCTA 5F27A 1MH3A 5FKNA 2LLKA 4XICA 1JUMA 2AHQA 1TC3C 3IV5A 4A3CJ 5DS9A 3HOVJ 1WCMJ 2LVSA 4LOCA 2CUEA 3JRBA 3E7LA 2OPTA 2XB0X 3Q3SA 2NVQJ 2XPUA 2DA4A 1UG2A 5M5WJ 4I6ZA 1XG1A 1QRYA 3CMYA 5EZHA 2Y2ZA 1K83J 3Q0UA 4IHYA 3Q0WA 5F0FA 4D7NA 3HOXJ 5F1JA 2K9QA 1H89C 3GTJJ 5M5XJ 4X6AJ 1HF0A 1P7JA 2EZKA 2L7ZA 3BQYA 3S14J 3LNQA 4D5FA 3BTJA 5J1YA 1MBJA 4XRSA 1HLVA 3HOWJ 3RZOJ 2D5VA 3NAUA 2E19A 4FTHA 4UUSB 4DZPA 2DTZA 3A01B 2R0QC 1TWFJ 4M3DA 1QVTA 1ZTRA 2HXOA 2QF7A 2H8RA 1U9NA 1D5YA 2VUMJ 3RZDJ 5FKMA 4A3MJ 3BTIA 3BR2A 3HM5A 3H3VK 5C3EJ 2CQQA 1ZGWA 4CYCA 2EZIA 2X48A 3G1OA 3JRFA 4AUXA 4W1UA 5E3OA 1RPWA 2DA7A 4A3LJ 1APLC 1DU0A 1I6HJ 5IPAA 4MIMA 2XRLA 4JX4A 3BG5A 1RETA 1TWHJ 3PO3J 5HODA 3TP3A 1JUSA 1MBHA 2N8GA 3MVPA 1LFBA 4BBSJ 3S17J 4M6VA 1MH4A 3HDDA 2LD5A 2NVTJ 3BR5A 2AO9A 1RESA 1ETVA 2LFBA 5K7FA 4UUTA 3RKQA 2I10A 1JKPC 2XGDA 3IH4A 5J3LA 5M3FJ 4DW6A 5K7HA 4A3JJ 4HNVA 1MSEC 3O8HA 4V2FA 5F0CA 2XGCA 1FIPA 1I50J 3IH2A 2O9LA 4G12A 2XSDC 3LOCA 1GUUA 2DN0A 2EZHA 3OOUA 2P81A 4L5EA 1OFCX 4XRMA 2GBYA 4RDUA 1AKHA 2EZLA 2ELKA 3K7AJ 4XK4A 3BR6A 1B72A 1X2NA 1Z77A 5EG0A 4A69C 4A3KJ 2EBIA 2LKXA 1A5JA 3GTKJ 1H8AC 4C3IJ 1WI3A 1VFCA 4D5CA 2M9HA 1PUFA 3LSJA 3GTPJ 1AHDP 5F0HA 4QTRA 3S2DJ 4Y52J 5IP6A 1Y1VJ 1ETYA 1BW6A 1RKWA 1GV2A 2XGEA 4IEJA 3JR9A 1JGGA 5J1RA 3HKZN 1O4XA 3TP0A 4V2GA 2DJNA 3F0CA 1ETWA 2VKEA 4Y7NJ 2GLOA 1WGXA 5E3LA 1HDDC 4DYQA 3FK6A 1NK3P 2XPVA 1MSFC 2ME6A 4MFDA 5K7ZA 2MSYA 2DMNA 4I76A 4JX6A 5M3MJ 4BKXA 1ZR4A 4S0HB 2JA7J 4ABZA 3S16J 4EEFG 1RR7A 4X1EA 2ID3A 4C2MJ 1T56A 4XIDA 5FJ8J 4IHWA 5FKOA 5M5YJ 4A3IJ 1JJ8C 2DA6A 2JA6J 2PMZN 2DMTA 2E2IJ 2IBDA 4IHVA 2WAQN 1NTCA 2FQ4A 2HQ5A 3OSGA 3I4MJ 1JTYA 4B3AA 3TEDA 1SANA 2K9SA 3HGGA 5DTDA 2VI6A 5GPCA 3JREA 3JRGA 2ZB9A 2HYJA 2Y9YA 3FKIJ 3HB9A 1IGNA 1ETXA 2CQXA 4M3GA 1HCRA 2YU9J 2HOTA 3CDLA 1U78A 1MBKA 3TW7A 1IDZA 2VPRA 3SFIA 2QCOA 3CCYA 4BXXJ 1ENHA 2DA3A 2K40A 2VKVA 2Y30A 2R5YA 4MLOA 1AKHB 3RQIA 4BY1J 1Z0XA 2CUFA 2O8KA 3UKGA 3BG9A 1RKTA 2LP0A 1CQTA 5E3NA 5IYBJ 5JLXA 1B8IA 3S2HJ 1JKOC 1U8BA 3S1MJ 3PO2J 2M34A 2E2JJ 2YUSA 1IJWC 1IDYA 1FJLA 3ZQLA 4DYRA 2CRGA 2B63J 3FISA 1PUFB 4BY7J 1R9TJ 2JK3A 4AC0A 1U9OA 3LSPA 1I3QJ 3CQZJ 1S7EA 1X2MA 4AYBN 4W97A 5JLWA 5IYCJ 1BW5A 3BTLA 1P7IA 3ZQGA 1K61A 2LR8A 3L1PA 3JRHA 3GTLJ 1A6IA 2GM4A 1OJLA 1HOMA 3SJMA 5C4XJ 1ORKA 3D1NI 2M2EA 4JYKA 1MBFA 2CJJA 2IEKA 2LK2A 1QVUA 4BBRJ 1FTTA 1W0UA 1F36A 2DA1A 1T33A 1VNDA 1JT6A 2DMUA 1NK2P 5FKLA 1SFOJ 5GP9A 4C3JJ 2JJ7A 3JRAA 1H88C 1GDTA 3S15J 2X9DA 2NOGA 2L9RA 5EGOA 2TRTA 3HOYJ 3HBLA 1UMQA 5IOZA 3LSRA 2L7FP 4D7MA 4C3HJ 1WH7A 3OSFA 3QPSA 1ZR2A 2R5ZA 4A3EJ 3GBGA 2YS9A 3JRDA 1Y1WJ 3JRIA 4A3GJ 1GVDA 1IRZA 1EF4A 4A93J 5IOYA 3C2BA 1MNMC 1TWCJ 3BR0A 2E1OA 2XB5A 1YRNA 1FIAA 4QIWN 2JN6A 1BL0A 2H1KA 1POGA 3O8GA 2ME0A 1TWAJ 3A03A 4CYCB 1BA5A 1JTXA 2L7MP 2NVYJ 1IV6A 1ITYA 3LSGA 2FX0A 3WHBA 5F08A 1B8IB 3M3YJ 3H0GJ 5FKKA 2LTPA 3JRCA 2R93J 3BR3A 1LE8A 1GV5A 3Q0VA 1E3OC 2MGQA 1ETOA 3ZOBA 1ZQ3P 2WB1N 3BG3A 1HDPA 3GTGJ 2CU7A 2OF7A 1TWGJ 4M3FA 2DA2A 2JMWA 2R7ZJ 1ZK8A 4A3BJ 2E2HJ 1OCPA 3GTMJ 3B6CA 2XPWA 5F04A 3ZQIA 5IP9J 3GTOJ 3S1RJ 5IP7J 2EQRA 2WV1A 2COBA 2ECCA 3G1MA 5IYDJ 3GTQJ 1FEXA 2HXIA 5EDNA 3SDGA 2KT0A 1VF9A 2L0KA 2MW8A 5EYRA 4B1RA 1GT0C 1B72B 3M4OJ 4JP0A 5EG0B 3OIOA 4FCYA 1IUFA 5C4JJ 3DEWA 5EEAA 4MFEA 5EGOB 3NARA 2W48A 1W0TA 1QPIA 1MBEA 4FE7A 3K2AA 1JT0A 3QQAA 1ZKGA 2R5ZB 3W6VA 4XRSG 1JJ6C 4FE4A 5J1UA 3G1LA 1JUPA 2NS8A 2M8GX 3TW6A 3I4NJ 2FD5A 1YRNB 2JA8J 4QSHA 3ZQHA 2RAEA 1G2HA 4M3EA 2M0CA 1ETQA 2JWTA 1UHSA 2R92J 2K9NA 4NDLA 5C44J 3DCFA 1WPKA 1F43A 5EZGA 2ID6A 3BTCA 3HOUJ 4IHXA 9ANTA 3MN2A 2DA5A 4A3FJ 5EF6A 3S1NJ 5GPAA 1JKQC 3MKLA 4UUSA 3A01A 2X6OA 2HOSA 4J19A 3FIWA 1LE8B 1BJZA 2Y9ZA 1XS9A 3BQZA 4A3DJ 2Y31A 2NVXJ 2DMQA 1Q1VA 2KDZA 4DYCA 2Y0SN 3HOZJ 3QPLA 3S1QJ 4DZJA 3HGYA 2HDDA 2LY9A 1AU7A 2HOAA 3PM1A 3FK7A 4JX5A 1OCTC 1ETKA 3VPRA 2G0EA 1IC8A 1IG7A 2FJ1A 2EH3A 3WHCA 3IH3A 1MBGA 5FLVA 3BR1A
chains in the Genus database with same CATH superfamily
4LG0A 1N25A 4IL6C 4XRFA 3S32A 2IAIA 1C0WA 2ZJ2A 4RS8A 4IQ4A 3QU3A 4GFBA 2R5YB 2HNHA 3HTUA 4LMYA 5BNGA 5JVTA 1DU6A 4CA0A 1QHHD 3IL2A 3PJRA 2Y75A 5HOOA 1JKRC 2JA5J 2DLLA 2NS7A 1FX7A 2DOFA 1MW7A 1X58A 5CLSA 1MJ9A 2O7OA 3A02A 5DM6F 1VI0A 1Q1HA 3BG6A 3KETA 3GXOA 1MH3A 5FKNA 3L2RA 5KAFC 1Z3XA 2VOOA 3IV5A 2V79A 3HOVJ 4U7BA 1G8XA 4XOTA 4BACA 3PUBA 2QZ8A 3LSMA 1J0RA 2OPTA 4EM0B 2E1MC 1U3EM 2X85A 4E7ZA 3CD6I 2XB0X 1E17A 3BJAA 2BE5F 1B6AA 1S72I 2QENA 1XG1A 2PMUA 1G59A 3L2VA 4RGXA 4QPOA 2VQCA 1J5YA 3DBRB 5LFAA 2X1CA 3TOBA 3CC4I 4NQWA 4BJ6C 2A61A 5F0FA 2H6BA 3ZQQA 1TNSA 3S3NA 5M5XJ 3FXLA 3TMOA 3R0AA 4CHUA 3BQYA 2V1UA 3L00A 4D5FA 3BTJA 1HLVA 4XRSA 4BXUA 2D5VA 3NAUA 5B5EC 4JK1X 2R0QC 3I0TA 2RVCA 4CDGA 1BOBA 4P5OA 1YIJI 1U9NA 3RZDJ 1YYVA 2QSFX 2CV0A 5HDNA 1YITI 1S3JA 3BTIA 4P55A 5C3EJ 4CYCA 3H92A 3ZRGA 2X48A 2MFZA 2FBIA 1VQKI 2STTA 3MD2A 3KP7A 4LLNA 2DO7A 5D4SA 1TQPA 4BE0A 2QQ8A 4MEYF 3RYPA 5JR3A 2XAGA 5IPAA 3SZGA 1UHMA 4LG0B 3E97A 4Y13A 1EH7A 5FFZA 1OCCH 2JPCA 3S3OA 1YQAA 3DV8A 5TGTA 3FXJA 1MBHA 3R61A 4ITVA 3MVPA 1DGWY 3U1KA 1MDMB 5GADJ 1LFBA 5EEGA 3WTVC 1SFUA 3KEQA 4EJTA 2PBIA 2BOLA 3E3VA 3GYHX 3HDDA 1OKRA 2NVTJ 4EATA 3WGIA 2HFHA 2AS5F 2AO9A 5BMZA 4CCJA 2STWA 1IXSB 3K70D 2XGDA 2DDBA 2IS4A 1YI2I 1X3UA 2EWNA 1TW2A 2OQRA 3ZMTA 4XLNF 2XGCA 2OTLI 1MJAA 1WJFA 3ZMVA 1GUUA 1AKHA 2LDUA 2P81A 3W3CA 3NQOA 2GBYA 4NQWB 3G6EI 2R3SA 3PQKA 5HLIA 1JI8A 2KJCA 4HNTA 4IJAA 3SEQA 1I5ZA 1OCRH 1VQ4I 3CJQB 2LKXA 3COAC 3DEEA 3A4CA 1QBJA 2QEXI 1VFCA 3FXOA 4L9VA 4C9YA 2R7XA 2M9HA 1AHDP 3MZYA 1QHGA 2NVUB 1Y1VJ 1ETYA 1RKWA 2PMZA 2EIKH 2FNPA 2Z5UA 3Q9VA 4P96A 2DFFA 3KZYA 2V9PA 2GXBA 2G9WA 2IGOA 3TP0A 4V2GA 2PEXA 1R5GA 1WQ2A 2MH2A 2OZ6A 4ZDPA 1NK3P 2RV8A 3VDXA 5E1ZB 5K7ZA 3P9IA 2FBKA 4JX6A 1ZR4A 1RR8C 2JA7J 1KYZA 4S0HB 4ABZA 5CJ9A 3FMSA 1D5VA 1HW2A 4PGGA 1R22A 3BPVA 3IUOA 1S7OA 3IAS2 4M72A 2HR3A 1WJEA 4XIDA 4EM2A 3GCMA 1G3YA 2BHYA 2ESNA 1Z1DA 2PMZN 2DMTA 3QU6A 1NTCA 5ILSA 2HQ5A 1IXCA 3I4MJ 5K1YA 2RREA 3FXQA 2AQFA 5GPCA 1S29A 3JREA 5LEKA 4BH9A 2HZDA 2HYJA 3IKTA 3E6MA 3FKIJ 4YEJA 2CQXA 3H9QA 3Q9SA 2HOTA 3MFKA 3F21A 4BUPA 1MBKA 1NG7A 2GA2A 2P4WA 3P5JA 3T0YA 1E2XA 4CSWA 3VFZA 2QCOA 3CCYA 4AYBA 4L9NA 2K40A 1KZHA 1WRJA 3GLXA 4R1HA 1I27A 1D8KA 3RQIA 1AKHB 4BY1J 4OWRB 4D1QA 3UKGA 1YFHA 2CUJA 2LP0A 4IX7A 2R7UA 4OAYA 4U88A 2O61A 3DPLC 2CG4A 2CWEA 4MQVA 2ZSIB 3BY6A 2VIXA 4BL0B 2YUSA 1IDYA 3ZQLA 3EUHC 3U2RA 3FWEA 3FISA 1S6LA 3BDDA 3TDZC 1P9QC 4OIPF 2B63J 4RB0A 1TL8A 4A2UA 2JK3A 1U9OA 1ZLJA 4E6KG 2XAFA 2XSJC 4BE1A 3CQZJ 4IKFA 2UXXA 1X2MA 2IA0A 4AYBN 4W97A 1U5TA 1D1AA 1USTA 4G8XA 5IYCJ 1BW5A 4PCQA 3ZQGA 2L9SA 4CGZA 5IT9Z 1WJCA 1KQ9A 1IV8A 4RMNA 3L1PA 2H27A 3JRHA 1HW5A 2ZCWA 1WI9A 2BXYA 2ETHA 4FT8A 4Q4ZF 2GM4A 1OJLA 1HOMA 1BI0A 1HKQA 1FNNA 5ED4A 5KNLA 2YSRA 3RSNA 1GXPA 3IWFA 1QVUA 3PUFA 1W0UA 3K2ZA 2KLOA 2OBPA 2DFHA 3IAM2 4XN0A 1AA7A 1JT6A 3PIPF 1NK2P 1SEUA 5FKLA 4AU7A 4CUGA 1LB2A 2KISA 4C3JJ 5H20A 1JHFA 2AQEA 3JRAA 3HTSB 2E35A 2C6YA 3PL8A 5ICCA 4KIFA 5EEHA 1BR1A 2YX4A 1UMQA 4ENMA 3IWZA 1ONVA 1Z91A 1XMKA 1S7AA 3H5RA 3CO7C 1ZR2A 1T95A 2YS9A 1TZLA 1Y1WJ 4KICA 4XONA 4A3GJ 3LSIA 4EMSA 3OL4A 3C2BA 3DTEA 1MNMC 2XB5A 1DP7P 1FIAA 3HZJA 3ZCOA 4KT5C 1FSHA 1RI7A 3A03A 1WSUA 1OLTA 1MNDA 3F8BA 5BS6A 2OCEA 1YX5A 1ITYA 1Y0NA 4S04A 5AIPA 5DUIA 2FX0A 3VYTB 3A1YA 3D5RC 5BQTA 4HDVA 1STZA 2PJPA 2A69F 3E6DA 5J47A 2X1EA 2GXAA 2QVOA 3KEOA 3NWTA 1IN5A 4BDYA 4L18B 1ETOA 1AOYA 4BDZA 5J8CA 2CU7A 4IXAA 5ICGA 2OF7A 5F1RA 2XVCA 1ZG3A 5E8IA 1XDSA 1P4WA 2FA5A 3LFUA 3I56I 2R7FA 1Y8QB 2E1CA 4HDUA 2OAZA 2LF8A 3B6CA 3EUAA 4XLPF 5IP9J 1YS7A 3ECHA 2WADA 3IKVA 1ZREA 5IP7J 2ICWG 2WV1A 3PIOF 2ZMEA 1IAWA 3GZNB 4IRGA 2L01A 2CV2A 2GAUA 3DBHB 3OOPA 4ESJA 3GTQJ 3OS2A 1YJNI 1TW3A 3ZN0A 2DYRH 3I59B 5E79C 1ZRFA 2DK5A 5EDNA 5E1WA 1VF9A 5FGMA 5E20A 4UVCA 4IRIA 1FMVA 3F8FA 2CW0F 3GFJA 4LIUA 3QYBA 5EG0B 3ZGKA 2ZFUA 4FCYA 4IOAF 3QYEA 1OCZH 3RQ4A 2K9LA 3OYIA 3HJEA 1NHAA 2O3FA 1DGRM 3KPHA 2R7SA 2W48A 1MBEA 1KU7A 1SD7A 4EJOA 1JHHA 4XKCA 3W6VA 2PLYA 3CTAA 4KISA 2WY8Q 5J1UA 3G1LA 1XX5A 4OAZA 1CF7A 4AD9A 2DI3A 4U0YA 3I58A 2ZXIA 2QQ9A 2P7VB 1RRJA 4HRIA 1FOYA 2H09A 1G2HA 2X0LA 3R4KA 1YX3A 4HOBA 1U8RA 5D8LB 4NDLA 5TRDA 1F43A 1WPKA 4ZDOA 3B73A 2Z2SB 1VQ9I 1BR2A 4EM1A 3CCQI 3V7RA 3QP6A 4EJWA 2W24A 3HRMA 4UUSA 3A01A 2ZJPF 2X6OA 1ZGAA 4J19A 2L54A 1ULYA 2COMA 2CV1A 1LEAA 2R7QA 2Y9ZA 2EIJH 4BNCA 2XF6A 1T0FA 3BQZA 3OS1A 1D0XA 4A3DJ 3R0JA 1Q1VA 3P9KA 1MMSA 4L5JA 5IT9K 3KYCB 3HOZJ 3HGYA 3M8FA 1VQ5I 2HDDA 3QOEA 2RN7A 3ML6A 4JX5A 3GZ5A 1W5TA 4AM3A 1G3WA 2LRDA 3K4CA 2M30A 2BW3A 2ZMEB 2VJIA 2V1DA 1UELB 2KZVA 4PJLA 4M3BA 1OYWA 2VT3A 3F8MA 3BLYA 3VODA 1Z21A 4WX9A 4O3MA 2GOMA 1N75A 5E3MA 2BVLA 3F8CA 4ASNA 2ECBA 3CCLI 1FT9A 3HEFA 2HI3A 1PJRA 4OIQF 1SAXA 4N4NB 1XC5A 2I5UA 5CQGA 3RKXA 4EV0A 3GFMA 3B6AA 2LREA 4XICA 4I0AA 5DS9A 1DDNA 3HXLA 1WCMJ 1ZAOA 4ZYAA 2LG4A 2A68F 3JRBA 3E7LA 4ZZDA 2VKHA 4D0PA 1XD7A 4KMUX 1LJ9A 3BJ6A 1V5GA 2DA4A 4I6ZA 2VPLA 1T6SA 2JUCA 3AFHA 3CMYA 4M73A 5EZHA 2HKOA 3I3LA 4YELA 2F5EA 5FLXZ 4UUVA 2CH0A 1BI2A 1R71A 1LQ1A 3BOQA 1MMGA 1Z3YA 3V8LA 3ZMDA 4KIBA 4XSZF 2O6GE 2BVMA 3L2UA 1TT0A 1OR7C 1P7JA 2EZKA 5B66C 1R5HA 5LD2C 4H4KC 4BQNA 3SFZA 1IF1A 3HOWJ 3TGNA 5B1AH 2FUG2 2LOOA 4UUSB 4DZPA 3A01B 3J7ZI 2XROA 1FBSA 3CDIA 2DDAA 3TO9A 4M3DA 2DK8A 2BHZA 3J81K 4ZH4F 1QVTA 4RB3C 3G73A 1IRGA 1Z67A 4HX8A 2H8RA 2ELHA 1D5YA 3S3MA 4ANJA 3LA7A 4I98B 5HDGA 3W2WA 3BR2A 3HM5A 4G6QA 1ZGWA 2EZIA 3C7JA 2QA4I 2W00A 3OYLA 4W1UA 5E3OA 1RPWA 4FQGA 2ELJA 3N97A 5CVRA 1APLC 1DU0A 2BW3B 1YOVB 1I6HJ 2XRLA 2EFPA 1J75A 4KFCA 3BG5A 1RETA 1R58A 2DPDA 3HRUA 1XDUA 3TP3A 3I71A 2QSHX 1ZLKA 2N8GA 3DPUA 4B09A 2EV6A 3KIOA 2OV7A 4XBFA 4BBSJ 2W7NA 3T8TA 4M71A 4F52A 4A12A 3QODA 1VZ0A 1YW7A 2XV4S 1RESA 2LFBA 4IHTA 5K7FA 1Y56A 2W1OA 4PFPA 5EJCA 1FYMA 3HSRA 2BV6A 2I10A 1JKPC 4GGGA 4LJZF 3VYRB 2G7UA 2EINH 3HKZA 4HX7A 4I99C 3OL3A 1FBUA 4A3JJ 4HNVA 2IGKA 1MSEC 1YIOA 1B9NA 3EETA 3O8HA 4Q47A 1SD4A 2XAJA 2YR2A 3OYDA 1FIPA 3HYIA 3K1PA 1I50J 2L4MA 5BOXA 4G12A 2XSDC 2VC1A 2DN0A 3LOCA 2M7AA 5LEJA 4IQJA 4XK4A 4IOCF 1BM9A 1B72A 1I3AA 2AXTC 3TQNA 4HSTA 2VBZA 2NS0A 5D5XB 1A5JA 2VBWA 3DU5A 2JQ7A 5FRMA 1H8AC 3GTKJ 4C3IJ 3QAHA 4D5CA 5J4VA 1BI1A 3O6BB 4B47A 5F0HA 1SFKA 4G7HF 5IP6A 3I5UA 5HS8A 2F5VA 1FOWA 3HKZN 1Y0UA 5LBQA 1B9MA 2WAQA 4PFOA 3PSFA 3CJTB 4R79A 5L3DA 3CCSI 4XKBA 1ETWA 2FRHA 2HOEA 2VKEA 4Y7NJ 2GLOA 3T1BA 2R7DA 1AWCA 4DYQA 3FK6A 1IO2A 2XPVA 1IN4A 1J2XA 4MFDA 2ME6A 2DODA 2MSYA 4P1WA 5TJJA 2DMNA 5M3MJ 1R1VA 3Q5FA 3L09A 5JFRA 1HA8A 4S05A 4EEFG 3OYEA 1RR7A 2FMYA 1T8IA 3H36A 2I8DA 2E5NA 4KN4X 5LGTA 4IHWA 3QPHA 5FKOA 4B43A 2UWMA 2JA6J 3D0SA 1TQIA 3KP5A 2GIZA 2CO5A 2WAQN 2V4JC 1VTNC 3OYFA 2K9SA 5DTDA 2F48A 2ZB9A 5D5UB 2Y9YA 2H94A 4MHGA 4G7ZF 2QM3A 1XCBA 1HCRA 3K1NA 2YU9J 1MKMA 3FZVA 2EFWA 3ERMA 3KE2A 1XPXA 4UV9A 1IDZA 2VPRA 2XF5A 2BBYA 3SFIA 1XGOA 2HVSA 4A0XA 2DA3A 3V8JA 1LVKA 2Y30A 4ZTJA 3ZR8X 3WU2C 4M6XA 1YW9A 2CUFA 5ICEA 4GYGA 2MYSA 2ESHA 3W6JB 1CQTA 1G4DA 5E3NA 3WTXC 3GO5A 2ZBKA 1X19A 1X4OA 3WGHA 5E18F 3PSIA 3RDIA 2VQLA 1U8BA 3PO2J 1Z6TA 2M34A 2DXIA 2E2JJ 2X51A 4NC6A 1X1PA 4DYRA 2CRGA 1WJAA 2EB7A 1VQPI 2QUFA 1D3YA 4BY7J 4AC0A 2IA2A 4CO8A 2A6TA 4WK8F 1FWZA 1FMWA 4NC7A 1S7EA 4B3XA 3H3UA 6PAXA 2O8XA 4HX4A 5JLWA 4M9XA 1TTYA 1QO0D 3BTLA 3S2WA 1K61A 2GXGA 1DPRA 1IXRC 2VT2A 5KK1A 2VOPA 3CUQC 3S93A 2EPFA 2MBFA 3CLQA 1E3HA 3SJMA 1ORKA 1Z7UA 3D1NI 2FU4A 2CJJA 1XTAA 2LK2A 2ISYA 1TBXA 1F36A 2RGVA 2PJRA 1VNDA 3GF2A 5AONA 1SFOJ 4YIIA 4XQFA 5ICFA 5DM7F 3MQ0A 4ESBA 1K4SA 3N4MA 4DBQA 5KVRA 4HA8A 1TNTA 1FP1D 5FD5A 2KIQA 1SC7A 1GDTA 2X9DA 5HLTA 3OY9A 3S15J 1D0YA 4F55A 1XGMA 3CC7I 1FYKA 2TRTA 4P9FA 2IS6A 2QBYA 2UXNA 4M9ZA 5IOZA 4BHBA 5GAHJ 3LSRA 4F91B 3F8NA 3JSOA 4HQMA 5J6XA 3SEZA 5D6EA 3OSFA 2ZNYA 4FASD 4IRHA 4A3EJ 3GBGA 1K6YA 2LSOA 3JRIA 3OYBA 1QZYA 4PK4A 1EF4A 3A0HC 3E1SA 4XKVA 4ZYDA 4GDFA 1IZ1A 2HTSA 3RPUD 1FC3A 1POGA 3O8GA 1MMAA 4CYCB 1RNLA 1KU2A 1JTXA 2L7MP 3H5AA 1ZG5A 2UV1A 1F4KA 2QQBA 1OCOH 2DTRA 4N9HA 4IPAA 2R7OA 2E60A 3AG2H 2KQRA 4L0ZB 1MJBA 3U21A 4KIGA 1R00A 1SFEA 2LTPA 2M8EA 3J7AY 4BQQA 1NG6A 1X3ZB 1GV5A 1E3OC 2MGQA 2X4HA 3ABMH 5LGUA 2DW4A 2QWWA 5JHUA 2H1LA 4UB8C 3SQNA 3KX2A 2K4JA 5B3SH 1WWXA 3DKXA 3K70C 2GZWA 5J40A 3S8PA 4QLCU 2ISZA 4L5IA 2J5PA 2IS2A 1SVMA 1OCPA 1J59A 3V8KA 3PFYA 2XPWA 5F04A 1J9IA 3GTOJ 4DOZA 2EQRA 1X1DA 2KMUA 2VBYA 2BY1A 2ECCA 3G1MA 5FD6A 4HV6A 4DJAA 2XAUA 5LRSA 1A35A 1DUXC 2PJRB 3DU6A 1BR4A 2HS5A 2ZSHB 3BZCA 4HEA2 2A07F 3TL4X 4MQ9F 3GX4X 3MCZA 2L0KA 2MW8A 4B1RA 3K4KA 3L2QA 2LKPA 2DQRA 3PNYA 3OIOA 1NH3A 1IUFA 1U0JA 2DJIA 5HVQC 3DEWA 2IRFG 5EEAA 4MFEA 2IS1A 2X6XA 3LSTA 1F1ZA 1UHWA 2QBYB 2QKLB 3UNGC 2K3FA 3I54A 1W0TA 1T38A 4FE7A 1QPIA 5CVUA 3QQAA 2WAFA 1JT0A 2VC0A 1YLFA 2FNAA 4FE4A 2E1NA 1BJAA 4RA2A 4RGRA 1IRXA 1Z05A 3LA3A 2NS8A 1E0EA 3TW6A 3I4NJ 4UVAA 2G7HA 1PVEA 4B44A 1JE8A 2BZTA 4HBLA 2MLKA 1ETQA 3QOPA 3CCJI 3R6SA 3H5NA 3HPHA 2HU9A 2OZUA 5C44J 3REOA 3RI4A 2LH9A 2IXSA 4AIDA 3MN2A 4A3FJ 1UJ8A 3MKLA 5HDKA 2CFXA 3DBLB 3EUKL 4EGZA 4ON0A 2XIGA 3FIWA 2JVGA 1XSDA 1QGPA 2Q1ZB 3EPZA 1FOKA 2PG4A 1SMTA 3W6KB 2Q2EA 2VASA 1L3LA 4BAYA 3A0BC 1KQ0A 2NVXJ 2DMQA 1T98A 2HWVA 2KDZA 1X3WB 3T8RA 3WODF 3QPLA 4YIFA 4DZJA 2P6TA 2LY9A 3RIRA 3WTZA 1OISA 3H3ZA 2D1HA 5KAIC 2D1VA 3PM1A 3FK7A 2XAHA 3O3KA 4BYYA 3GMEA 3VPRA 1IC8A 2ZFWA 2MC4A 1DP3A 4E7SA 3WHCA 4L0YB 3IH3A 1MBGA 1W1WE 3ZMSA 2KPMA 3OV8A 3BR1A 5HLGA 2XASA 4BJ5C 4RBOA 1O3QA 1SFXA 2ZXJA 4FISA 1HBXG 4V19K 2JSCA 1HC8A 3ONQA 5ILVA 3K9TA 2A05A 2K3PA 2Z3YA 5J8FA 1X1AA 2RC4A 1S5LC 5FLMJ 1WH5A 2ACJA 3CJNA 4NUBA 2CQKA 5L3CA 2F4OB 2MD5A 2PFBA 2HKXA 1VQMI 2M3AA 2V9VA 5JHFA 3BT9A 2DMPA 4N9IA 3BPXA 5F27A 2YPRA 2KRHA 2LLKA 1A04A 2AHQA 4A3CJ 2GOXB 2VE9A 3WTUC 4C2TA 2VODA 2CFOA 3F6OA 2EV0A 4LB5A 3DPTA 3Q3SA 1KU3A 3DTKA 2NVQJ 3E5QA 1REPC 2PI0A 3RPUA 2CW8A 2EFNA 1UG2A 1O3RA 2QGUA 1WJ5A 1U5TB 3CCMI 1QRYA 4X0GA 1I1GA 3EUHA 4NBQA 4Y15A 2A6HF 3MAJA 2Y2ZA 1K83J 3Q0UA 5JVGF 4IHYA 1U6GA 3GW2A 1D8JA 1ODDA 1P6RA 3ASNH 4D7NA 4KN7X 4E7JA 3HOXJ 2ZNZA 5A2QZ 3QP5A 3GTJJ 2K85A 1HF0A 2OJED 3KZZA 4WWCA 3S14J 3SYTA 1MMNA 3RZOJ 5J1YA 1KYWA 3AL0C 4FTHA 1IRFA 3A2KA 3F22A 3BP8A 1LVAA 2K86A 5TISC 1ZTRA 2HXOA 5H6RA 2E71A 2IGNA 3OIQA 2VUMJ 3WTYC 5FKMA 1MZBA 2P5LC 4A3MJ 2F2EA 2X6YA 2B9SA 1BC7C 3G1OA 3TO6A 3JRFA 3DEUA 1XGSA 2DOEA 1TP4A 4A3LJ 2FSWA 1A6QA 3OS0A 4MNUA 2M5WA 4N0BA 4KDPA 1ZARA 4CICA 4UXNA 2EV5A 4MIMA 3IRQA 2CGPA 4JX4A 1G3SA 1XCVA 5E17F 1TWHJ 3FHNA 4B8XA 3PO3J 5HODA 2A5YB 4HG2A 1JUSA 2VE8A 2JZYA 2KRCA 2ZJQF 4CCNA 1FZPB 2KHMA 1OMIA 3CZ6A 3S17J 4U0WA 4M6VA 1MH4A 2EFOA 3DTIA 2LD5A 1D1BA 2Z99A 3ABLH 3ECOA 1RUOA 1T2KA 2NNNA 5L3BA 2JPBA 1ETVA 2L9VA 4FETA 1LNWA 3VEPA 3V4GA 2IT0A 4PGHA 3IH4A 4HYEA 1Y6IA 5M3FJ 4AVZA 3M8EA 5K7HA 1WJDA 2EJRA 5CYVA 4H0EA 1PDNC 3M8JA 1ZHFA 4LK0F 4PSXA 3CESA 3IH2A 1YJWI 2O9LA 1R4NB 4PSWA 3W2VA 1F5TA 4L5EA 3OOUA 1OFCX 4XRMA 4PDKA 2RNJA 4FX4A 3PNTA 3K7AJ 4F93B 3TO7A 1X2NA 1Z77A 2DCEA 4LIVA 4PJJA 3K4NA 4A3KJ 2EBIA 2NOJB 3CMAI 2OU2A 3P9CA 1V3FA 2JTVA 5D5VB 3K1MA 4XLHA 4EGYA 3AAFA 3LSJA 4Y52J 4A0YA 1IN7A 2K02A 1BW6A 1GV2A 4IEJA 1JGGA 2DAOA 5J1RA 1ZRCA 1T08B 3DKWA 2P5VA 2XF7A 1W5CC 1YTYA 2YX7A 1O4XA 4RB1A 2LC2A 4A0ZA 3F0CA 2V26A 2E34A 2PX9A 1FSEA 1WGXA 3ZMZA 4LD5A 5E3LA 4PJMA 4WXHA 3HUGA 4RAGA 2ZJRF 2VJ5A 3ABTA 4I01A 4ENKA 2F4MB 3SXYA 4BKXA 3IRRA 3S16J 2GWRA 4HW0A 2M1BA 1ZELA 1R23A 2EILH 3G2BA 1CF7B 4X1EA 1R5ID 2ID3A 3WG7H 3PQJA 5ERIA 2BEOA 2L5QA 3CF2A 5DDGA 5FJ8J 2M4GA 4HF0A 5FFXA 4F7ZA 4YFXF 4A3IJ 1JJ8C 1GHCA 3ELKA 3IHUA 5L3GA 3OYHA 2W85A 5IY5H 1QPMA 1CGPA 3VWBA 2IBDA 3CLOA 3U9GA 3HOSA 2XHKA 2FQ4A 2D45A 1R6RA 3OSGA 4I2OA 4U7DA 3C2GA 1JTYA 3VSKA 4L9TA 3TEDA 1SANA 2CMPA 3HGGA 4OIOF 3WGGA 2VXZA 3ABUA 3CCVI 2XRNA 3K4JA 3CCEI 2MLGA 2ZXWH 2HVQA 4M3GA 1W7PA 2GIVA 4YIRX 1IW7F 2Q8KA 3CDLA 3HL2A 3LL7A 1U78A 3CMEI 1L0OC 3KP2A 2MD0A 5DD8A 1FP2A 2V6EA 2VKVA 2EA4A 2R5YA 2EK5A 2F5FA 1FOXA 2DQLA 2Y48A 3H9JA 1W36C 1Z0XA 4MTDA 1GLNA 3BG9A 1RKTA 5CVJA 3QPTA 1HQCA 5HS9A 3GVAA 2IVMA 5JLXA 3HHHA 3C3WA 1LEBA 2FXAA 5K5QA 4E4HA 1TT5B 4PJNA 1IJWC 1QQIA 3OR2C 2PQ8A 4IVNA 3P7NA 3WE3A 2P5KA 1LDJA 3OIPA 2P7CB 2V9KA 1YS6A 3H9GA 4TV7A 4IO9F 1RZ4A 2X6WA 4HNUA 3HOTA 2F5CA 1GXQA 2O03A 4K2EA 4PUSA 3L2CA 3ERED 2FOWA 2LR8A 2KP6A 5F64A 3GTLJ 2WA0A 3K4BA 1A6IA 3WTWC 1YHQI 4HAMA 2M2EA 2IA1A 4BBRJ 1FTTA 1ACIA 3LSHA 1V55H 2DA1A 2VBXA 1T33A 4LLGF 4XL9A 1K4TA 2DMUA 1KU9A 4ESFA 5FB2A 2JT1A 5GP9A 4BJTA 2JJ7A 2LY1A 3LQRA 3E6CC 4J01A 4A5NA 4A5MA 1H88C 3FM5A 5DEQA 1LKXA 3MMYB 2H6CA 2L9RA 5EGOA 2V6CA 1HW1A 2O5RA 3HBLA 1RC9A 2M0MA 3JAMZ 3LQQA 3KLOA 4C3HJ 4KYWA 1WH7A 3ESWB 4O5VA 5DUKA 3FBNB 2K5CA 3HSEA 3JRDA 1YE9A 4JQFA 5CVIA 2FQ3A 4HPQA 1D1CA 1GVDA 1OR7A 5IOYA 5FRNA 4YRVA 5E8GA 2E1OA 1LFPA 3M7GA 4G6TB 3BCBA 3CMMA 1YRNA 2JN6A 5DV5A 2QLZA 3GWZA 2H1KA 2IGMA 2ME0A 1TWAJ 1BA5A 1VQ6I 4CCKA 1B1BA 4EJUA 3C2HA 4IHSA 2NVYJ 3DXJF 1IV6A 1BI3A 1MDMA 2IP2A 3WHBA 4XR6A 3OMYA 2DBBA 4HV5A 1V5FA 2B0LA 2OA4A 2V1XA 3G71I 1G3TA 1UAAA 4DBRA 3JRCA 5HNHA 2R93J 3BR3A 3X2QH 4GCVA 1XSXA 1SVLA 2H8WA 3Q0VA 4LGWA 1HXDA 2DFEA 4G9YA 3CCRI 2WB1N 3BG3A 1ON1A 3GTGJ 2RKHA 2R7RA 1DPUA 2YU3A 2A5WA 1UZCA 1TWGJ 3MZHA 2ZO4A 2LBFA 3NEUA 1JGSA 2DA2A 5JI6A 1IN8A 4BQOA 3SZTA 3KCCA 2CQNA 2E2HJ 3QYFA 3FXMA 2M87A 3K4MA 3S1RJ 5IT3A 2A3SA 2Z16A 2JVHA 2QQAA 4CZZA 3W2AA 2CQ7A 1EH8A 1ERDA 2FEZA 3ULQB 2COBA 3ASOH 3RJPA 4Y3OA 1RUNA 5IYDJ 2DFIA 2DPUA 5FLXK 3DP7A 4XOPA 3EYIA 4CCLA 2L3DA 2W82A 2X1DA 4LB6B 2KT0A 4KJZA 3GEZA 1MD0A 2VKDA 5EYRA 3I53A 1T39A 1B72B 3M4OJ 2QSGX 5GTIC 4QPQA 3DKYA 5C4JJ 5EGOB 3M07A 4XNFA 2DT7B 3NARA 4ZYGA 1EV7A 1W5SA 1TQMA 3T5XA 1ZRDA 4J00A 3C18A 1USSA 2DT5A 1JJ6C 2W25A 2HGCA 4BGDA 3JSPA 1H0MA 2L4AA 2HYGD 1BBYA 3N05A 2JSPA 1WVRA 1VQLI 2NNYA 1JUPA 1J09A 2M8GX 3GFLA 2FD5A 1YRNB 2JA8J 3DLLF 4UY8I 2Y0SA 3ZQHA 2O0YA 3MKYB 3FHZA 4UV8A 2FMLA 3SZPA 1SMYF 2XC7A 1UHSA 1WFXA 3V7CA 1X4PA 5EZGA 2ID6A 2HEOA 3HOUJ 2L7KA 1Y8RB 3TOAA 2KL4A 2NXNB 9ANTA 4WF2A 3WTTC 2DA5A 1KQ8A 3S1NJ 3BZKA 5GPAA 5AIQA 1JKQC 2J5OA 2HOSA 4CXFA 4C30A 1BJZA 3BG7A 2RNGA 2XAQA 3AG4H 5CPRB 2GA1A 4OU0A 2Y31A 2OC6A 2Z33A 1Z9CA 4GXOA 2KFDA 2VXDA 1ZYRF 3VYSB 4XM3A 2Y0SN 3SHFA 2LBFB 3BC8A 3FKJA 1ZG1A 2OUMA 1AU7A 5L3FA 4OMYA 2W57A 2HOAA 3HSFA 4G6DA 4LFUA 1HSTA 5CKTA 4F3QA 3GFIA 1OCTC 2G0EA 3PNVA 4HLXA 1IG7A 4DIQA 2EH3A 3CP8A 1WHUA 1O3SA 5FLVA 3BCAA 3HRTA 4WCGA 2MG4A 4WXDA 2W84A 2JRMA 3KLNA 4MO7A 1U5TC 4UHTA 1B59A 2KKOA 1FY7A 2KZGA 5DCMA 4UB6C 1PP8F 3O2PE 3ZQFA 2BGCA 3K6GA 3QWLA 4RGSA 3CCUI 3ZQCA 1LUJB 1FTZA 1LFUP 4Y17A 4B4CA 3LAPA 2VN2A 1N78A 1VQ8I 3VSLA 1HKSA 2DU9A 2TCTA 4II2A 3JAMK 4I7HA 5H6QA 1JUMA 1TC3C 3H1CA 4C2UA 4XLAA 1MNEA 1Z7LA 2LVSA 1R1UA 4LOCA 4AVPA 2CUEA 2KRFA 5ILUA 4NC8A 3FXKA 2XPUA 3M1CA 3DQVC 4P9UA 4MTEA 1ZN2A 1K78A 5M5WJ 2KIUA 3LFKA 1OPCA 3JTHA 1RIOH 3TBIA 3EQLF 5L3EA 2Z1DA 3RYRA 4NB5A 4ETSA 2K7LA 2R7TA 3Q0WA 4KMFA 4AIKA 2UZKA 4M74A 4YG2F 5F1JA 2K9QA 3OYKA 1H89C 1QNTA 2VJ4A 4X6AJ 1YW8A 2KDOA 3OR1C 4HZFA 2HPIA 2L7ZA 3KP3A 3CO6C 3F23A 3LNQA 2WWYA 1B4AA 4E7IA 1MBJA 3TDUC 2M7BA 2VLAA 3RCOA 3GZ6A 1D0ZA 2E19A 2DTZA 2E1MB 3KYDB 3VYUB 3CUQA 1UCRA 1TWFJ 1EA3A 3ZMUA 4FHTA 4E7KA 3HIFA 4BS9A 2LYCA 4IF4A 2QF7A 2BXZA 4QWQA 2AXLA 2HYFA 2Y69H 1GVJA 3L2WA 3WU0A 3H3VK 3M9AA 2CQQA 4GYIA 5LRRA 3D5LA 4AUXA 5HS7A 4HQEA 3CC2I 4BQAA 4HF2A 2VJJA 2DA7A 1ON2A 5DD4A 3HG9A 2IJLA 3FMRA 4Q5SF 4BHPA 4E70A 3KP6A 1OQYA 3J80Z 5DCMB 2ZC2A 3ZP5A 2XKOA 2LKSA 1ZGJA 2HQNA 1R1TA 1TLHB 4N4OB 2ZMEC 4PZJA 4ZDLA 3PFIA 3H0DA 4RGUA 2P8TA 2E5ZA 2V1NA 2RDPA 3BR5A 2BYVE 5FROA 3UR3C 3OYJA 4CZCA 2BY2A 3MWMA 4UUTA 3RKQA 3MZ8A 3DF8A 3I64A 4E7HA 2HDWA 2KIFA 5J3LA 1KA8A 3D5SC 1O7FA 3AG1H 4DW6A 2K27A 1M1EB 5FO5A 1K78B 3TKYA 3E0JB 1FLIA 4V2FA 3DFGA 5F0CA 1E3PA 3I59A 1O3TA 2EZHA 2MA3A 5J4YA 4RDUA 4OOIA 2EZLA 1XMAA 2ELKA 3J7AO 3BR6A 3K10A 5LGNA 5EG0A 4A69C 1H9TA 5LHIA 5BPDA 4GRIA 1G6NA 1P4XA 1WKMA 2ZXHA 3WTSC 4Y33A 1WI3A 2JA2A 1A36A 4KNYA 1PUFA 4MGRA 4BHCA 3J7YJ 3GTPJ 4QTRA 3S2DJ 4RAFA 2WBMA 4OMZA 2XGEA 5H2FC 3JR9A 1FYLA 4LK1F 3CUQB 3MKWB 4RB2C 2VONA 1QU3A 4XN3A 5D6FA 2OD5A 2XGXA 2DJNA 1I1SA 1K6OA 3V7SA 4U0VA 3OYAA 2EFQA 3HHGA 3KYLA 1HDDC 4PJ0C 1MSFC 1XGNA 1Y39A 2JRTA 4I76A 4ZTFA 2DT6A 2VB6A 2QYOA 3EYYA 4DNCA 4G94A 1T0FC 3L9FA 4U87A 1W7PD 1XB4A 4R8HA 2EA2A 3ROUA 3LA2A 3HC7A 3M1EA 4C2MJ 1T56A 1I6XA 1J7KA 5M5YJ 4GO1A 3FXUA 2DA6A 5DYMA 2E2IJ 1LPQA 3CJRB 4IHVA 2NRAC 2V7FA 3IC7A 2HQAA 3CF5F 5KHDA 3IP4B 3C1DA 1P92A 3J81Z 1BC8C 4B3AA 2JUGA 1VQ7I 2FE3A 1UG0A 4I0BA 2VI6A 3JRGA 1VQOI 1IGNA 3HB9A 4WXCA 1ETXA 1S9HA 3JCUC 5GAGJ 3OWTA 2E7WA 1XSVA 2Q2EB 2BY0A 4I09A 3TW7A 5LHGA 5D5WB 4AIJA 4E7LA 3NWSA 4HF1A 1LDKB 4D9JA 5D4RA 4BXXJ 1ENHA 2F4IA 2NAZA 2CSOA 2TDXA 3BROA 4MLOA 4BE2A 4ENNA 2M4KA 5CQEA 4L9JA 2O8KA 4NHJA 5K5OA 2NYXA 3RKYA 5B1BH 3DLAA 2D2WA 3CP2A 3FMQA 3FF5A 4KITB 5IYBJ 1V5EA 1B8IA 3S2HJ 1OYYA 1JKOC 3S1MJ 3JW4A 2WAEA 3E5UA 4G7OF 2ADUA 4XMYA 4OIRF 3KP4A 2QKMB 2FF4A 1FJLA 3KFWX 3K0LA 3WE2A 3JTGA 1BIAA 3OYMA 1PUFB 3QRFF 2ZKZA 1R9TJ 4XLFA 4UNOA 3LSPA 3HPGA 1I3QJ 4AIHA 4M9SA 1SVOA 3BJOA 1FPQA 1MGTA 4KA4A 1U2WA 2KJBA 2L9NA 3E6BA 1P7IA 2Z9OA 3AKZA 1KONA 3CDHA 5LHHA 1UB9A 2MH9A 1X1CA 2KIMA 2GQQA 4NNJA 5C4XJ 2IW5A 2XDVA 5K5RA 3J80K 1A31A 4JYKA 1MBFA 5DCFA 1HKTA 2IEKA 3K69A 3H35A 5KCMA 3V42A 3ZN1A 1YO5C 2FBHA 3R60A 3WG9A 5HLHA 2MC3A 2LMDA 1BN5A 3FM3A 4LLLA 4ZJZA 1R49A 4A6DA 4AWXB 4B48A 4BEHA 5BPIA 4CCMA 5GTHC 3G3ZA 1JXSA 1MIJA 2CW7A 4EQQA 2L2OA 1FBQA 2NOGA 4RM3A 2K4BA 1S8NA 2E7XA 2CYYA 5LLQA 3FXRA 3HOYJ 1X1BA 4ZYEA 3F3XA 2L7FP 4D7MA 4BXFA 1IUYA 2EIMH 4Z2YA 3QPSA 2R5ZA 2BY3A 1PP7U 2L02A 2P6SA 4RAYA 4YFKF 2OQGA 2VL8A 1EJ9A 1W36D 4IZZA 4XLEA 1BIBA 4BU2A 5GAEJ 1IRZA 3I55I 1O7LA 2Y0MA 4RM2A 5F6FA 4A93J 1TWCJ 3BR0A 4ZZLA 2XUBA 1F9NA 3LSKA 1Z6RA 4QIWN 3MKZA 1BL0A 3ISPA 4A6EA 2OTJI 4F92B 3B02A 1UFMA 4ZC3A 4EVIA 1YG2A 1VQNI 3LSGA 3DWLE 2F5DA 3U1DA 4KT6A 2RQQA 1EKEA 3RKWA 5F08A 4XLCA 1B8IB 3M3YJ 4I02A 1QZZA 3H0GJ 2K9MA 4Z6YA 3KZIC 1I39A 5FKKA 2VQGA 4FX0A 1MMDA 2R7WA 4CCOA 3ABKH 3SDBA 1BOAA 2WY7Q 1PUEE 1LE8A 1O57A 3EDPA 3ZOBA 1ZQ3P 1HSJA 2Q0OA 4JBAA 4M6YA 3ZXSA 1HDPA 2MABA 3HRSA 3VOEA 1IN6A 1SAUA 1SD5A 3F6VA 4M3FA 4XORA 2JMWA 2R7ZJ 3I9V2 1ZK8A 4UVBA 4A3BJ 4HSRA 3BZ6A 2A6EF 3GTMJ 1OYIA 3RTRA 3ZPLA 2HVRA 4RLFA 3ZQIA 4KUMA 1ZH5A 2LNBA 1R7JA 3OYNA 1KGSA 4YFNF 2M45A 1FEXA 2IPQX 3BWGA 4DQ2A 2HXIA 2OCCH 3SDGA 4CH7A 1R4MB 5A2QK 4O6JA 4BEHB 1GT0C 2PMHA 1V4RA 3LMMA 3RPQA 3GLLA 1W4MA 4JP0A 2UUZA 4XKWA 4RAZA 1QA6A 2VQHA 4CYDA 2CS3A 3LAJA 2P0WA 3K2AA 1ZKGA 2R5ZB 3OYGA 4XRSG 2RQPA 3I4PA 2WC2A 1P2FA 3AG3H 2HZTA 2HQRA 3CUOA 1WJBA 4RLQA 4HLYA 1DQUA 1V54H 3L7WA 5D8KB 4QSHA 2R7VA 4ENJA 2XKPA 1YJ9I 2HTJA 2RAEA 3HUGB 2R4GA 3AL0B 3E5XA 2LF7A 2M0CA 4M3EA 2HPMA 2JWTA 2LY2A 1QZEA 3F72A 2R92J 3FDYA 4LITA 2K9NA 2B7EA 1R36A 4LG3A 4EJVA 3DCFA 3G4SI 4MEXF 3BTCA 2HDCA 4IHXA 5HNFA 1XMXA 1XN7A 4OINF 5EF6A 2DYSH 4II3A 3MEXA 3VB2A 3ZQ7A 2FOKA 5CVVA 1N77A 2DOAA 2W4SA 4XSXF 3OYCA 3FX3A 1LE8B 2F6CA 3KEYA 4DGWB 1P4AA 3GUDA 1XS9A 3K4LA 4JOMA 2E36A 1PYVA 3LWFA 3F9KA 4DYCA 2PN6A 3S1QJ 1SD6A 2CUZA 4Y4RA 5E1XA 2WV0A 4Q48A 1K7AA 3FBIB 1EH6A 1W7PB 2WTEA 1LDDA 1ETKA 1H9GA 4ZYHA 1WZ2A 2WB1A 1K79A 2FJ1A 3NRVA 3WU1B
chains in the Genus database with same CATH topology
2MG4A 4M3BA 4MO7A 2IAIA 4RBOA 4FISA 3ZQFA 4GFBA 2R5YB 5BNGA 5E3MA 1DU6A 2ECBA 3ZQCA 1FTZA 1LFUP 1JKRC 2JA5J 3HEFA 2HI3A 5FLMJ 1WH5A 2NS7A 4B4CA 1X58A 1XC5A 2O7OA 3A02A 1VI0A 3B6AA 3BT9A 2DMPA 2TCTA 5F27A 1MH3A 5FKNA 2LLKA 4XICA 1JUMA 2AHQA 1TC3C 3IV5A 4A3CJ 5DS9A 3HOVJ 1WCMJ 2LVSA 4LOCA 2CUEA 3JRBA 3E7LA 2OPTA 2XB0X 3Q3SA 2NVQJ 2XPUA 2DA4A 1UG2A 5M5WJ 4I6ZA 1XG1A 1QRYA 3CMYA 5EZHA 2Y2ZA 1K83J 3Q0UA 4IHYA 3Q0WA 5F0FA 4D7NA 3HOXJ 5F1JA 2K9QA 1H89C 3GTJJ 5M5XJ 4X6AJ 1HF0A 1P7JA 2EZKA 2L7ZA 3BQYA 3S14J 3LNQA 4D5FA 3BTJA 5J1YA 1MBJA 4XRSA 1HLVA 3HOWJ 3RZOJ 2D5VA 3NAUA 2E19A 4FTHA 4UUSB 4DZPA 2DTZA 3A01B 2R0QC 1TWFJ 4M3DA 1QVTA 1ZTRA 2HXOA 2QF7A 2H8RA 1U9NA 1D5YA 2VUMJ 3RZDJ 5FKMA 4A3MJ 3BTIA 3BR2A 3HM5A 3H3VK 5C3EJ 2CQQA 1ZGWA 4CYCA 2EZIA 2X48A 3G1OA 3JRFA 4AUXA 4W1UA 5E3OA 1RPWA 2DA7A 4A3LJ 1APLC 1DU0A 1I6HJ 5IPAA 4MIMA 2XRLA 4JX4A 3BG5A 1RETA 1TWHJ 3PO3J 5HODA 3TP3A 1JUSA 1MBHA 2N8GA 3MVPA 1LFBA 4BBSJ 3S17J 4M6VA 1MH4A 3HDDA 2LD5A 2NVTJ 3BR5A 2AO9A 1RESA 1ETVA 2LFBA 5K7FA 4UUTA 3RKQA 2I10A 1JKPC 2XGDA 3IH4A 5J3LA 5M3FJ 4DW6A 5K7HA 4A3JJ 4HNVA 1MSEC 3O8HA 4V2FA 5F0CA 2XGCA 1FIPA 1I50J 3IH2A 2O9LA 4G12A 2XSDC 3LOCA 1GUUA 2DN0A 2EZHA 3OOUA 2P81A 4L5EA 1OFCX 4XRMA 2GBYA 4RDUA 1AKHA 2EZLA 2ELKA 3K7AJ 4XK4A 3BR6A 1B72A 1X2NA 1Z77A 5EG0A 4A69C 4A3KJ 2EBIA 2LKXA 1A5JA 3GTKJ 1H8AC 4C3IJ 1WI3A 1VFCA 4D5CA 2M9HA 1PUFA 3LSJA 3GTPJ 1AHDP 5F0HA 4QTRA 3S2DJ 4Y52J 5IP6A 1Y1VJ 1ETYA 1BW6A 1RKWA 1GV2A 2XGEA 4IEJA 3JR9A 1JGGA 5J1RA 3HKZN 1O4XA 3TP0A 4V2GA 2DJNA 3F0CA 1ETWA 2VKEA 4Y7NJ 2GLOA 1WGXA 5E3LA 1HDDC 4DYQA 3FK6A 1NK3P 2XPVA 1MSFC 2ME6A 4MFDA 5K7ZA 2MSYA 2DMNA 4I76A 4JX6A 5M3MJ 4BKXA 1ZR4A 4S0HB 2JA7J 4ABZA 3S16J 4EEFG 1RR7A 4X1EA 2ID3A 4C2MJ 1T56A 4XIDA 5FJ8J 4IHWA 5FKOA 5M5YJ 4A3IJ 1JJ8C 2DA6A 2JA6J 2PMZN 2DMTA 2E2IJ 2IBDA 4IHVA 2WAQN 1NTCA 2FQ4A 2HQ5A 3OSGA 3I4MJ 1JTYA 4B3AA 3TEDA 1SANA 2K9SA 3HGGA 5DTDA 2VI6A 5GPCA 3JREA 3JRGA 2ZB9A 2HYJA 2Y9YA 3FKIJ 3HB9A 1IGNA 1ETXA 2CQXA 4M3GA 1HCRA 2YU9J 2HOTA 3CDLA 1U78A 1MBKA 3TW7A 1IDZA 2VPRA 3SFIA 2QCOA 3CCYA 4BXXJ 1ENHA 2DA3A 2K40A 2VKVA 2Y30A 2R5YA 4MLOA 1AKHB 3RQIA 4BY1J 1Z0XA 2CUFA 2O8KA 3UKGA 3BG9A 1RKTA 2LP0A 1CQTA 5E3NA 5IYBJ 5JLXA 1B8IA 3S2HJ 1JKOC 1U8BA 3S1MJ 3PO2J 2M34A 2E2JJ 2YUSA 1IJWC 1IDYA 1FJLA 3ZQLA 4DYRA 2CRGA 2B63J 3FISA 1PUFB 4BY7J 1R9TJ 2JK3A 4AC0A 1U9OA 3LSPA 1I3QJ 3CQZJ 1S7EA 1X2MA 4AYBN 4W97A 5JLWA 5IYCJ 1BW5A 3BTLA 1P7IA 3ZQGA 1K61A 2LR8A 3L1PA 3JRHA 3GTLJ 1A6IA 2GM4A 1OJLA 1HOMA 3SJMA 5C4XJ 1ORKA 3D1NI 2M2EA 4JYKA 1MBFA 2CJJA 2IEKA 2LK2A 1QVUA 4BBRJ 1FTTA 1W0UA 1F36A 2DA1A 1T33A 1VNDA 1JT6A 2DMUA 1NK2P 5FKLA 1SFOJ 5GP9A 4C3JJ 2JJ7A 3JRAA 1H88C 1GDTA 3S15J 2X9DA 2NOGA 2L9RA 5EGOA 2TRTA 3HOYJ 3HBLA 1UMQA 5IOZA 3LSRA 2L7FP 4D7MA 4C3HJ 1WH7A 3OSFA 3QPSA 1ZR2A 2R5ZA 4A3EJ 3GBGA 2YS9A 3JRDA 1Y1WJ 3JRIA 4A3GJ 1GVDA 1IRZA 1EF4A 4A93J 5IOYA 3C2BA 1MNMC 1TWCJ 3BR0A 2E1OA 2XB5A 1YRNA 1FIAA 4QIWN 2JN6A 1BL0A 2H1KA 1POGA 3O8GA 2ME0A 1TWAJ 3A03A 4CYCB 1BA5A 1JTXA 2L7MP 2NVYJ 1IV6A 1ITYA 3LSGA 2FX0A 3WHBA 5F08A 1B8IB 3M3YJ 3H0GJ 5FKKA 2LTPA 3JRCA 2R93J 3BR3A 1LE8A 1GV5A 3Q0VA 1E3OC 2MGQA 1ETOA 3ZOBA 1ZQ3P 2WB1N 3BG3A 1HDPA 3GTGJ 2CU7A 2OF7A 1TWGJ 4M3FA 2DA2A 2JMWA 2R7ZJ 1ZK8A 4A3BJ 2E2HJ 1OCPA 3GTMJ 3B6CA 2XPWA 5F04A 3ZQIA 5IP9J 3GTOJ 3S1RJ 5IP7J 2EQRA 2WV1A 2COBA 2ECCA 3G1MA 5IYDJ 3GTQJ 1FEXA 2HXIA 5EDNA 3SDGA 2KT0A 1VF9A 2L0KA 2MW8A 5EYRA 4B1RA 1GT0C 1B72B 3M4OJ 4JP0A 5EG0B 3OIOA 4FCYA 1IUFA 5C4JJ 3DEWA 5EEAA 4MFEA 5EGOB 3NARA 2W48A 1W0TA 1QPIA 1MBEA 4FE7A 3K2AA 1JT0A 3QQAA 1ZKGA 2R5ZB 3W6VA 4XRSG 1JJ6C 4FE4A 5J1UA 3G1LA 1JUPA 2NS8A 2M8GX 3TW6A 3I4NJ 2FD5A 1YRNB 2JA8J 4QSHA 3ZQHA 2RAEA 1G2HA 4M3EA 2M0CA 1ETQA 2JWTA 1UHSA 2R92J 2K9NA 4NDLA 5C44J 3DCFA 1WPKA 1F43A 5EZGA 2ID6A 3BTCA 3HOUJ 4IHXA 9ANTA 3MN2A 2DA5A 4A3FJ 5EF6A 3S1NJ 5GPAA 1JKQC 3MKLA 4UUSA 3A01A 2X6OA 2HOSA 4J19A 3FIWA 1LE8B 1BJZA 2Y9ZA 1XS9A 3BQZA 4A3DJ 2Y31A 2NVXJ 2DMQA 1Q1VA 2KDZA 4DYCA 2Y0SN 3HOZJ 3QPLA 3S1QJ 4DZJA 3HGYA 2HDDA 2LY9A 1AU7A 2HOAA 3PM1A 3FK7A 4JX5A 1OCTC 1ETKA 3VPRA 2G0EA 1IC8A 1IG7A 2FJ1A 2EH3A 3WHCA 3IH3A 1MBGA 5FLVA 3BR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MG4 A;  4M3B A;  4MO7 A;  2IAI A;  4RBO A;  4FIS A;  3ZQF A;  4GFB A;  2R5Y B;  5BNG A;  5E3M A;  1DU6 A;  2ECB A;  3ZQC A;  1FTZ A;  1LFU P;  1JKR C;  2JA5 J;  3HEF A;  2HI3 A;  5FLM J;  1WH5 A;  2NS7 A;  4B4C A;  1X58 A;  1XC5 A;  2O7O A;  3A02 A;  1VI0 A;  3B6A A;  3BT9 A;  2DMP A;  2TCT A;  5F27 A;  1MH3 A;  5FKN A;  2LLK A;  4XIC A;  1JUM A;  2AHQ A;  1TC3 C;  3IV5 A;  4A3C J;  5DS9 A;  3HOV J;  1WCM J;  2LVS A;  4LOC A;  2CUE A;  3JRB A;  3E7L A;  2OPT A;  2XB0 X;  3Q3S A;  2NVQ J;  2XPU A;  2DA4 A;  1UG2 A;  5M5W J;  4I6Z A;  1XG1 A;  1QRY A;  3CMY A;  5EZH A;  2Y2Z A;  1K83 J;  3Q0U A;  4IHY A;  3Q0W A;  5F0F A;  4D7N A;  3HOX J;  5F1J A;  2K9Q A;  1H89 C;  3GTJ J;  5M5X J;  4X6A J;  1HF0 A;  1P7J A;  2EZK A;  2L7Z A;  3BQY A;  3S14 J;  3LNQ A;  4D5F A;  3BTJ A;  5J1Y A;  1MBJ A;  4XRS A;  1HLV A;  3HOW J;  3RZO J;  2D5V A;  3NAU A;  2E19 A;  4FTH A;  4UUS B;  4DZP A;  2DTZ A;  3A01 B;  2R0Q C;  1TWF J;  4M3D A;  1QVT A;  1ZTR A;  2HXO A;  2QF7 A;  2H8R A;  1U9N A;  1D5Y A;  2VUM J;  3RZD J;  5FKM A;  4A3M J;  3BTI A;  3BR2 A;  3HM5 A;  3H3V K;  5C3E J;  2CQQ A;  1ZGW A;  4CYC A;  2EZI A;  2X48 A;  3G1O A;  3JRF A;  4AUX A;  4W1U A;  5E3O A;  1RPW A;  2DA7 A;  4A3L J;  1APL C;  1DU0 A;  1I6H J;  5IPA A;  4MIM A;  2XRL A;  4JX4 A;  3BG5 A;  1RET A;  1TWH J;  3PO3 J;  5HOD A;  3TP3 A;  1JUS A;  1MBH A;  2N8G A;  3MVP A;  1LFB A;  4BBS J;  3S17 J;  4M6V A;  1MH4 A;  3HDD A;  2LD5 A;  2NVT J;  3BR5 A;  2AO9 A;  1RES A;  1ETV A;  2LFB A;  5K7F A;  4UUT A;  3RKQ A;  2I10 A;  1JKP C;  2XGD A;  3IH4 A;  5J3L A;  5M3F J;  4DW6 A;  5K7H A;  4A3J J;  4HNV A;  1MSE C;  3O8H A;  4V2F A;  5F0C A;  2XGC A;  1FIP A;  1I50 J;  3IH2 A;  2O9L A;  4G12 A;  2XSD C;  3LOC A;  1GUU A;  2DN0 A;  2EZH A;  3OOU A;  2P81 A;  4L5E A;  1OFC X;  4XRM A;  2GBY A;  4RDU A;  1AKH A;  2EZL A;  2ELK A;  3K7A J;  4XK4 A;  3BR6 A;  1B72 A;  1X2N A;  1Z77 A;  5EG0 A;  4A69 C;  4A3K J;  2EBI A;  2LKX A;  1A5J A;  3GTK J;  1H8A C;  4C3I J;  1WI3 A;  1VFC A;  4D5C A;  2M9H A;  1PUF A;  3LSJ A;  3GTP J;  1AHD P;  5F0H A;  4QTR A;  3S2D J;  4Y52 J;  5IP6 A;  1Y1V J;  1ETY A;  1BW6 A;  1RKW A;  1GV2 A;  2XGE A;  4IEJ A;  3JR9 A;  1JGG A;  5J1R A;  3HKZ N;  1O4X A;  3TP0 A;  4V2G A;  2DJN A;  3F0C A;  1ETW A;  2VKE A;  4Y7N J;  2GLO A;  1WGX A;  5E3L A;  1HDD C;  4DYQ A;  3FK6 A;  1NK3 P;  2XPV A;  1MSF C;  2ME6 A;  4MFD A;  5K7Z A;  2MSY A;  2DMN A;  4I76 A;  4JX6 A;  5M3M J;  4BKX A;  1ZR4 A;  4S0H B;  2JA7 J;  4ABZ A;  3S16 J;  4EEF G;  1RR7 A;  4X1E A;  2ID3 A;  4C2M J;  1T56 A;  4XID A;  5FJ8 J;  4IHW A;  5FKO A;  5M5Y J;  4A3I J;  1JJ8 C;  2DA6 A;  2JA6 J;  2PMZ N;  2DMT A;  2E2I J;  2IBD A;  4IHV A;  2WAQ N;  1NTC A;  2FQ4 A;  2HQ5 A;  3OSG A;  3I4M J;  1JTY A;  4B3A A;  3TED A;  1SAN A;  2K9S A;  3HGG A;  5DTD A;  2VI6 A;  5GPC A;  3JRE A;  3JRG A;  2ZB9 A;  2HYJ A;  2Y9Y A;  3FKI J;  3HB9 A;  1IGN A;  1ETX A;  2CQX A;  4M3G A;  1HCR A;  2YU9 J;  2HOT A;  3CDL A;  1U78 A;  1MBK A;  3TW7 A;  1IDZ A;  2VPR A;  3SFI A;  2QCO A;  3CCY A;  4BXX J;  1ENH A;  2DA3 A;  2K40 A;  2VKV A;  2Y30 A;  2R5Y A;  4MLO A;  1AKH B;  3RQI A;  4BY1 J;  1Z0X A;  2CUF A;  2O8K A;  3UKG A;  3BG9 A;  1RKT A;  2LP0 A;  1CQT A;  5E3N A;  5IYB J;  5JLX A;  1B8I A;  3S2H J;  1JKO C;  1U8B A;  3S1M J;  3PO2 J;  2M34 A;  2E2J J;  2YUS A;  1IJW C;  1IDY A;  1FJL A;  3ZQL A;  4DYR A;  2CRG A;  2B63 J;  3FIS A;  1PUF B;  4BY7 J;  1R9T J;  2JK3 A;  4AC0 A;  1U9O A;  3LSP A;  1I3Q J;  3CQZ J;  1S7E A;  1X2M A;  4AYB N;  4W97 A;  5JLW A;  5IYC J;  1BW5 A;  3BTL A;  1P7I A;  3ZQG A;  1K61 A;  2LR8 A;  3L1P A;  3JRH A;  3GTL J;  1A6I A;  2GM4 A;  1OJL A;  1HOM A;  3SJM A;  5C4X J;  1ORK A;  3D1N I;  2M2E A;  4JYK A;  1MBF A;  2CJJ A;  2IEK A;  2LK2 A;  1QVU A;  4BBR J;  1FTT A;  1W0U A;  1F36 A;  2DA1 A;  1T33 A;  1VND A;  1JT6 A;  2DMU A;  1NK2 P;  5FKL A;  1SFO J;  5GP9 A;  4C3J J;  2JJ7 A;  3JRA A;  1H88 C;  1GDT A;  3S15 J;  2X9D A;  2NOG A;  2L9R A;  5EGO A;  2TRT A;  3HOY J;  3HBL A;  1UMQ A;  5IOZ A;  3LSR A;  2L7F P;  4D7M A;  4C3H J;  1WH7 A;  3OSF A;  3QPS A;  1ZR2 A;  2R5Z A;  4A3E J;  3GBG A;  2YS9 A;  3JRD A;  1Y1W J;  3JRI A;  4A3G J;  1GVD A;  1IRZ A;  1EF4 A;  4A93 J;  5IOY A;  3C2B A;  1MNM C;  1TWC J;  3BR0 A;  2E1O A;  2XB5 A;  1YRN A;  1FIA A;  4QIW N;  2JN6 A;  1BL0 A;  2H1K A;  1POG A;  3O8G A;  2ME0 A;  1TWA J;  3A03 A;  4CYC B;  1BA5 A;  1JTX A;  2L7M P;  2NVY J;  1IV6 A;  1ITY A;  3LSG A;  2FX0 A;  3WHB A;  5F08 A;  1B8I B;  3M3Y J;  3H0G J;  5FKK A;  2LTP A;  3JRC A;  2R93 J;  3BR3 A;  1LE8 A;  1GV5 A;  3Q0V A;  1E3O C;  2MGQ A;  1ETO A;  3ZOB A;  1ZQ3 P;  2WB1 N;  3BG3 A;  1HDP A;  3GTG J;  2CU7 A;  2OF7 A;  1TWG J;  4M3F A;  2DA2 A;  2JMW A;  2R7Z J;  1ZK8 A;  4A3B J;  2E2H J;  1OCP A;  3GTM J;  3B6C A;  2XPW A;  5F04 A;  3ZQI A;  5IP9 J;  3GTO J;  3S1R J;  5IP7 J;  2EQR A;  2WV1 A;  2COB A;  2ECC A;  3G1M A;  5IYD J;  3GTQ J;  1FEX A;  2HXI A;  5EDN A;  3SDG A;  2KT0 A;  1VF9 A;  2L0K A;  2MW8 A;  5EYR A;  4B1R A;  1GT0 C;  1B72 B;  3M4O J;  4JP0 A;  5EG0 B;  3OIO A;  4FCY A;  1IUF A;  5C4J J;  3DEW A;  5EEA A;  4MFE A;  5EGO B;  3NAR A;  2W48 A;  1W0T A;  1QPI A;  1MBE A;  4FE7 A;  3K2A A;  1JT0 A;  3QQA A;  1ZKG A;  2R5Z B;  3W6V A;  4XRS G;  1JJ6 C;  4FE4 A;  5J1U A;  3G1L A;  1JUP A;  2NS8 A;  2M8G X;  3TW6 A;  3I4N J;  2FD5 A;  1YRN B;  2JA8 J;  4QSH A;  3ZQH A;  2RAE A;  1G2H A;  4M3E A;  2M0C A;  1ETQ A;  2JWT A;  1UHS A;  2R92 J;  2K9N A;  4NDL A;  5C44 J;  3DCF A;  1WPK A;  1F43 A;  5EZG A;  2ID6 A;  3BTC A;  3HOU J;  4IHX A;  9ANT A;  3MN2 A;  2DA5 A;  4A3F J;  5EF6 A;  3S1N J;  5GPA A;  1JKQ C;  3MKL A;  4UUS A;  3A01 A;  2X6O A;  2HOS A;  4J19 A;  3FIW A;  1LE8 B;  1BJZ A;  2Y9Z A;  1XS9 A;  3BQZ A;  4A3D J;  2Y31 A;  2NVX J;  2DMQ A;  1Q1V A;  2KDZ A;  4DYC A;  2Y0S N;  3HOZ J;  3QPL A;  3S1Q J;  4DZJ A;  3HGY A;  2HDD A;  2LY9 A;  1AU7 A;  2HOA A;  3PM1 A;  3FK7 A;  4JX5 A;  1OCT C;  1ETK A;  3VPR A;  2G0E A;  1IC8 A;  1IG7 A;  2FJ1 A;  2EH3 A;  3WHC A;  3IH3 A;  1MBG A;  5FLV A;  3BR1 A; 
#chains in the Genus database with same CATH topology
 4LG0 A;  1N25 A;  4IL6 C;  4XRF A;  3S32 A;  2IAI A;  1C0W A;  2ZJ2 A;  4RS8 A;  4IQ4 A;  3QU3 A;  4GFB A;  2R5Y B;  2HNH A;  3HTU A;  4LMY A;  5BNG A;  5JVT A;  1DU6 A;  4CA0 A;  1QHH D;  3IL2 A;  3PJR A;  2Y75 A;  5HOO A;  1JKR C;  2JA5 J;  2DLL A;  2NS7 A;  1FX7 A;  2DOF A;  1MW7 A;  1X58 A;  5CLS A;  1MJ9 A;  2O7O A;  3A02 A;  5DM6 F;  1VI0 A;  1Q1H A;  3BG6 A;  3KET A;  3GXO A;  1MH3 A;  5FKN A;  3L2R A;  5KAF C;  1Z3X A;  2VOO A;  3IV5 A;  2V79 A;  3HOV J;  4U7B A;  1G8X A;  4XOT A;  4BAC A;  3PUB A;  2QZ8 A;  3LSM A;  1J0R A;  2OPT A;  4EM0 B;  2E1M C;  1U3E M;  2X85 A;  4E7Z A;  3CD6 I;  2XB0 X;  1E17 A;  3BJA A;  2BE5 F;  1B6A A;  1S72 I;  2QEN A;  1XG1 A;  2PMU A;  1G59 A;  3L2V A;  4RGX A;  4QPO A;  2VQC A;  1J5Y A;  3DBR B;  5LFA A;  2X1C A;  3TOB A;  3CC4 I;  4NQW A;  4BJ6 C;  2A61 A;  5F0F A;  2H6B A;  3ZQQ A;  1TNS A;  3S3N A;  5M5X J;  3FXL A;  3TMO A;  3R0A A;  4CHU A;  3BQY A;  2V1U A;  3L00 A;  4D5F A;  3BTJ A;  1HLV A;  4XRS A;  4BXU A;  2D5V A;  3NAU A;  5B5E C;  4JK1 X;  2R0Q C;  3I0T A;  2RVC A;  4CDG A;  1BOB A;  4P5O A;  1YIJ I;  1U9N A;  3RZD J;  1YYV A;  2QSF X;  2CV0 A;  5HDN A;  1YIT I;  1S3J A;  3BTI A;  4P55 A;  5C3E J;  4CYC A;  3H92 A;  3ZRG A;  2X48 A;  2MFZ A;  2FBI A;  1VQK I;  2STT A;  3MD2 A;  3KP7 A;  4LLN A;  2DO7 A;  5D4S A;  1TQP A;  4BE0 A;  2QQ8 A;  4MEY F;  3RYP A;  5JR3 A;  2XAG A;  5IPA A;  3SZG A;  1UHM A;  4LG0 B;  3E97 A;  4Y13 A;  1EH7 A;  5FFZ A;  1OCC H;  2JPC A;  3S3O A;  1YQA A;  3DV8 A;  5TGT A;  3FXJ A;  1MBH A;  3R61 A;  4ITV A;  3MVP A;  1DGW Y;  3U1K A;  1MDM B;  5GAD J;  1LFB A;  5EEG A;  3WTV C;  1SFU A;  3KEQ A;  4EJT A;  2PBI A;  2BOL A;  3E3V A;  3GYH X;  3HDD A;  1OKR A;  2NVT J;  4EAT A;  3WGI A;  2HFH A;  2AS5 F;  2AO9 A;  5BMZ A;  4CCJ A;  2STW A;  1IXS B;  3K70 D;  2XGD A;  2DDB A;  2IS4 A;  1YI2 I;  1X3U A;  2EWN A;  1TW2 A;  2OQR A;  3ZMT A;  4XLN F;  2XGC A;  2OTL I;  1MJA A;  1WJF A;  3ZMV A;  1GUU A;  1AKH A;  2LDU A;  2P81 A;  3W3C A;  3NQO A;  2GBY A;  4NQW B;  3G6E I;  2R3S A;  3PQK A;  5HLI A;  1JI8 A;  2KJC A;  4HNT A;  4IJA A;  3SEQ A;  1I5Z A;  1OCR H;  1VQ4 I;  3CJQ B;  2LKX A;  3COA C;  3DEE A;  3A4C A;  1QBJ A;  2QEX I;  1VFC A;  3FXO A;  4L9V A;  4C9Y A;  2R7X A;  2M9H A;  1AHD P;  3MZY A;  1QHG A;  2NVU B;  1Y1V J;  1ETY A;  1RKW A;  2PMZ A;  2EIK H;  2FNP A;  2Z5U A;  3Q9V A;  4P96 A;  2DFF A;  3KZY A;  2V9P A;  2GXB A;  2G9W A;  2IGO A;  3TP0 A;  4V2G A;  2PEX A;  1R5G A;  1WQ2 A;  2MH2 A;  2OZ6 A;  4ZDP A;  1NK3 P;  2RV8 A;  3VDX A;  5E1Z B;  5K7Z A;  3P9I A;  2FBK A;  4JX6 A;  1ZR4 A;  1RR8 C;  2JA7 J;  1KYZ A;  4S0H B;  4ABZ A;  5CJ9 A;  3FMS A;  1D5V A;  1HW2 A;  4PGG A;  1R22 A;  3BPV A;  3IUO A;  1S7O A;  3IAS 2;  4M72 A;  2HR3 A;  1WJE A;  4XID A;  4EM2 A;  3GCM A;  1G3Y A;  2BHY A;  2ESN A;  1Z1D A;  2PMZ N;  2DMT A;  3QU6 A;  1NTC A;  5ILS A;  2HQ5 A;  1IXC A;  3I4M J;  5K1Y A;  2RRE A;  3FXQ A;  2AQF A;  5GPC A;  1S29 A;  3JRE A;  5LEK A;  4BH9 A;  2HZD A;  2HYJ A;  3IKT A;  3E6M A;  3FKI J;  4YEJ A;  2CQX A;  3H9Q A;  3Q9S A;  2HOT A;  3MFK A;  3F21 A;  4BUP A;  1MBK A;  1NG7 A;  2GA2 A;  2P4W A;  3P5J A;  3T0Y A;  1E2X A;  4CSW A;  3VFZ A;  2QCO A;  3CCY A;  4AYB A;  4L9N A;  2K40 A;  1KZH A;  1WRJ A;  3GLX A;  4R1H A;  1I27 A;  1D8K A;  3RQI A;  1AKH B;  4BY1 J;  4OWR B;  4D1Q A;  3UKG A;  1YFH A;  2CUJ A;  2LP0 A;  4IX7 A;  2R7U A;  4OAY A;  4U88 A;  2O61 A;  3DPL C;  2CG4 A;  2CWE A;  4MQV A;  2ZSI B;  3BY6 A;  2VIX A;  4BL0 B;  2YUS A;  1IDY A;  3ZQL A;  3EUH C;  3U2R A;  3FWE A;  3FIS A;  1S6L A;  3BDD A;  3TDZ C;  1P9Q C;  4OIP F;  2B63 J;  4RB0 A;  1TL8 A;  4A2U A;  2JK3 A;  1U9O A;  1ZLJ A;  4E6K G;  2XAF A;  2XSJ C;  4BE1 A;  3CQZ J;  4IKF A;  2UXX A;  1X2M A;  2IA0 A;  4AYB N;  4W97 A;  1U5T A;  1D1A A;  1UST A;  4G8X A;  5IYC J;  1BW5 A;  4PCQ A;  3ZQG A;  2L9S A;  4CGZ A;  5IT9 Z;  1WJC A;  1KQ9 A;  1IV8 A;  4RMN A;  3L1P A;  2H27 A;  3JRH A;  1HW5 A;  2ZCW A;  1WI9 A;  2BXY A;  2ETH A;  4FT8 A;  4Q4Z F;  2GM4 A;  1OJL A;  1HOM A;  1BI0 A;  1HKQ A;  1FNN A;  5ED4 A;  5KNL A;  2YSR A;  3RSN A;  1GXP A;  3IWF A;  1QVU A;  3PUF A;  1W0U A;  3K2Z A;  2KLO A;  2OBP A;  2DFH A;  3IAM 2;  4XN0 A;  1AA7 A;  1JT6 A;  3PIP F;  1NK2 P;  1SEU A;  5FKL A;  4AU7 A;  4CUG A;  1LB2 A;  2KIS A;  4C3J J;  5H20 A;  1JHF A;  2AQE A;  3JRA A;  3HTS B;  2E35 A;  2C6Y A;  3PL8 A;  5ICC A;  4KIF A;  5EEH A;  1BR1 A;  2YX4 A;  1UMQ A;  4ENM A;  3IWZ A;  1ONV A;  1Z91 A;  1XMK A;  1S7A A;  3H5R A;  3CO7 C;  1ZR2 A;  1T95 A;  2YS9 A;  1TZL A;  1Y1W J;  4KIC A;  4XON A;  4A3G J;  3LSI A;  4EMS A;  3OL4 A;  3C2B A;  3DTE A;  1MNM C;  2XB5 A;  1DP7 P;  1FIA A;  3HZJ A;  3ZCO A;  4KT5 C;  1FSH A;  1RI7 A;  3A03 A;  1WSU A;  1OLT A;  1MND A;  3F8B A;  5BS6 A;  2OCE A;  1YX5 A;  1ITY A;  1Y0N A;  4S04 A;  5AIP A;  5DUI A;  2FX0 A;  3VYT B;  3A1Y A;  3D5R C;  5BQT A;  4HDV A;  1STZ A;  2PJP A;  2A69 F;  3E6D A;  5J47 A;  2X1E A;  2GXA A;  2QVO A;  3KEO A;  3NWT A;  1IN5 A;  4BDY A;  4L18 B;  1ETO A;  1AOY A;  4BDZ A;  5J8C A;  2CU7 A;  4IXA A;  5ICG A;  2OF7 A;  5F1R A;  2XVC A;  1ZG3 A;  5E8I A;  1XDS A;  1P4W A;  2FA5 A;  3LFU A;  3I56 I;  2R7F A;  1Y8Q B;  2E1C A;  4HDU A;  2OAZ A;  2LF8 A;  3B6C A;  3EUA A;  4XLP F;  5IP9 J;  1YS7 A;  3ECH A;  2WAD A;  3IKV A;  1ZRE A;  5IP7 J;  2ICW G;  2WV1 A;  3PIO F;  2ZME A;  1IAW A;  3GZN B;  4IRG A;  2L01 A;  2CV2 A;  2GAU A;  3DBH B;  3OOP A;  4ESJ A;  3GTQ J;  3OS2 A;  1YJN I;  1TW3 A;  3ZN0 A;  2DYR H;  3I59 B;  5E79 C;  1ZRF A;  2DK5 A;  5EDN A;  5E1W A;  1VF9 A;  5FGM A;  5E20 A;  4UVC A;  4IRI A;  1FMV A;  3F8F A;  2CW0 F;  3GFJ A;  4LIU A;  3QYB A;  5EG0 B;  3ZGK A;  2ZFU A;  4FCY A;  4IOA F;  3QYE A;  1OCZ H;  3RQ4 A;  2K9L A;  3OYI A;  3HJE A;  1NHA A;  2O3F A;  1DGR M;  3KPH A;  2R7S A;  2W48 A;  1MBE A;  1KU7 A;  1SD7 A;  4EJO A;  1JHH A;  4XKC A;  3W6V A;  2PLY A;  3CTA A;  4KIS A;  2WY8 Q;  5J1U A;  3G1L A;  1XX5 A;  4OAZ A;  1CF7 A;  4AD9 A;  2DI3 A;  4U0Y A;  3I58 A;  2ZXI A;  2QQ9 A;  2P7V B;  1RRJ A;  4HRI A;  1FOY A;  2H09 A;  1G2H A;  2X0L A;  3R4K A;  1YX3 A;  4HOB A;  1U8R A;  5D8L B;  4NDL A;  5TRD A;  1F43 A;  1WPK A;  4ZDO A;  3B73 A;  2Z2S B;  1VQ9 I;  1BR2 A;  4EM1 A;  3CCQ I;  3V7R A;  3QP6 A;  4EJW A;  2W24 A;  3HRM A;  4UUS A;  3A01 A;  2ZJP F;  2X6O A;  1ZGA A;  4J19 A;  2L54 A;  1ULY A;  2COM A;  2CV1 A;  1LEA A;  2R7Q A;  2Y9Z A;  2EIJ H;  4BNC A;  2XF6 A;  1T0F A;  3BQZ A;  3OS1 A;  1D0X A;  4A3D J;  3R0J A;  1Q1V A;  3P9K A;  1MMS A;  4L5J A;  5IT9 K;  3KYC B;  3HOZ J;  3HGY A;  3M8F A;  1VQ5 I;  2HDD A;  3QOE A;  2RN7 A;  3ML6 A;  4JX5 A;  3GZ5 A;  1W5T A;  4AM3 A;  1G3W A;  2LRD A;  3K4C A;  2M30 A;  2BW3 A;  2ZME B;  2VJI A;  2V1D A;  1UEL B;  2KZV A;  4PJL A;  4M3B A;  1OYW A;  2VT3 A;  3F8M A;  3BLY A;  3VOD A;  1Z21 A;  4WX9 A;  4O3M A;  2GOM A;  1N75 A;  5E3M A;  2BVL A;  3F8C A;  4ASN A;  2ECB A;  3CCL I;  1FT9 A;  3HEF A;  2HI3 A;  1PJR A;  4OIQ F;  1SAX A;  4N4N B;  1XC5 A;  2I5U A;  5CQG A;  3RKX A;  4EV0 A;  3GFM A;  3B6A A;  2LRE A;  4XIC A;  4I0A A;  5DS9 A;  1DDN A;  3HXL A;  1WCM J;  1ZAO A;  4ZYA A;  2LG4 A;  2A68 F;  3JRB A;  3E7L A;  4ZZD A;  2VKH A;  4D0P A;  1XD7 A;  4KMU X;  1LJ9 A;  3BJ6 A;  1V5G A;  2DA4 A;  4I6Z A;  2VPL A;  1T6S A;  2JUC A;  3AFH A;  3CMY A;  4M73 A;  5EZH A;  2HKO A;  3I3L A;  4YEL A;  2F5E A;  5FLX Z;  4UUV A;  2CH0 A;  1BI2 A;  1R71 A;  1LQ1 A;  3BOQ A;  1MMG A;  1Z3Y A;  3V8L A;  3ZMD A;  4KIB A;  4XSZ F;  2O6G E;  2BVM A;  3L2U A;  1TT0 A;  1OR7 C;  1P7J A;  2EZK A;  5B66 C;  1R5H A;  5LD2 C;  4H4K C;  4BQN A;  3SFZ A;  1IF1 A;  3HOW J;  3TGN A;  5B1A H;  2FUG 2;  2LOO A;  4UUS B;  4DZP A;  3A01 B;  3J7Z I;  2XRO A;  1FBS A;  3CDI A;  2DDA A;  3TO9 A;  4M3D A;  2DK8 A;  2BHZ A;  3J81 K;  4ZH4 F;  1QVT A;  4RB3 C;  3G73 A;  1IRG A;  1Z67 A;  4HX8 A;  2H8R A;  2ELH A;  1D5Y A;  3S3M A;  4ANJ A;  3LA7 A;  4I98 B;  5HDG A;  3W2W A;  3BR2 A;  3HM5 A;  4G6Q A;  1ZGW A;  2EZI A;  3C7J A;  2QA4 I;  2W00 A;  3OYL A;  4W1U A;  5E3O A;  1RPW A;  4FQG A;  2ELJ A;  3N97 A;  5CVR A;  1APL C;  1DU0 A;  2BW3 B;  1YOV B;  1I6H J;  2XRL A;  2EFP A;  1J75 A;  4KFC A;  3BG5 A;  1RET A;  1R58 A;  2DPD A;  3HRU A;  1XDU A;  3TP3 A;  3I71 A;  2QSH X;  1ZLK A;  2N8G A;  3DPU A;  4B09 A;  2EV6 A;  3KIO A;  2OV7 A;  4XBF A;  4BBS J;  2W7N A;  3T8T A;  4M71 A;  4F52 A;  4A12 A;  3QOD A;  1VZ0 A;  1YW7 A;  2XV4 S;  1RES A;  2LFB A;  4IHT A;  5K7F A;  1Y56 A;  2W1O A;  4PFP A;  5EJC A;  1FYM A;  3HSR A;  2BV6 A;  2I10 A;  1JKP C;  4GGG A;  4LJZ F;  3VYR B;  2G7U A;  2EIN H;  3HKZ A;  4HX7 A;  4I99 C;  3OL3 A;  1FBU A;  4A3J J;  4HNV A;  2IGK A;  1MSE C;  1YIO A;  1B9N A;  3EET A;  3O8H A;  4Q47 A;  1SD4 A;  2XAJ A;  2YR2 A;  3OYD A;  1FIP A;  3HYI A;  3K1P A;  1I50 J;  2L4M A;  5BOX A;  4G12 A;  2XSD C;  2VC1 A;  2DN0 A;  3LOC A;  2M7A A;  5LEJ A;  4IQJ A;  4XK4 A;  4IOC F;  1BM9 A;  1B72 A;  1I3A A;  2AXT C;  3TQN A;  4HST A;  2VBZ A;  2NS0 A;  5D5X B;  1A5J A;  2VBW A;  3DU5 A;  2JQ7 A;  5FRM A;  1H8A C;  3GTK J;  4C3I J;  3QAH A;  4D5C A;  5J4V A;  1BI1 A;  3O6B B;  4B47 A;  5F0H A;  1SFK A;  4G7H F;  5IP6 A;  3I5U A;  5HS8 A;  2F5V A;  1FOW A;  3HKZ N;  1Y0U A;  5LBQ A;  1B9M A;  2WAQ A;  4PFO A;  3PSF A;  3CJT B;  4R79 A;  5L3D A;  3CCS I;  4XKB A;  1ETW A;  2FRH A;  2HOE A;  2VKE A;  4Y7N J;  2GLO A;  3T1B A;  2R7D A;  1AWC A;  4DYQ A;  3FK6 A;  1IO2 A;  2XPV A;  1IN4 A;  1J2X A;  4MFD A;  2ME6 A;  2DOD A;  2MSY A;  4P1W A;  5TJJ A;  2DMN A;  5M3M J;  1R1V A;  3Q5F A;  3L09 A;  5JFR A;  1HA8 A;  4S05 A;  4EEF G;  3OYE A;  1RR7 A;  2FMY A;  1T8I A;  3H36 A;  2I8D A;  2E5N A;  4KN4 X;  5LGT A;  4IHW A;  3QPH A;  5FKO A;  4B43 A;  2UWM A;  2JA6 J;  3D0S A;  1TQI A;  3KP5 A;  2GIZ A;  2CO5 A;  2WAQ N;  2V4J C;  1VTN C;  3OYF A;  2K9S A;  5DTD A;  2F48 A;  2ZB9 A;  5D5U B;  2Y9Y A;  2H94 A;  4MHG A;  4G7Z F;  2QM3 A;  1XCB A;  1HCR A;  3K1N A;  2YU9 J;  1MKM A;  3FZV A;  2EFW A;  3ERM A;  3KE2 A;  1XPX A;  4UV9 A;  1IDZ A;  2VPR A;  2XF5 A;  2BBY A;  3SFI A;  1XGO A;  2HVS A;  4A0X A;  2DA3 A;  3V8J A;  1LVK A;  2Y30 A;  4ZTJ A;  3ZR8 X;  3WU2 C;  4M6X A;  1YW9 A;  2CUF A;  5ICE A;  4GYG A;  2MYS A;  2ESH A;  3W6J B;  1CQT A;  1G4D A;  5E3N A;  3WTX C;  3GO5 A;  2ZBK A;  1X19 A;  1X4O A;  3WGH A;  5E18 F;  3PSI A;  3RDI A;  2VQL A;  1U8B A;  3PO2 J;  1Z6T A;  2M34 A;  2DXI A;  2E2J J;  2X51 A;  4NC6 A;  1X1P A;  4DYR A;  2CRG A;  1WJA A;  2EB7 A;  1VQP I;  2QUF A;  1D3Y A;  4BY7 J;  4AC0 A;  2IA2 A;  4CO8 A;  2A6T A;  4WK8 F;  1FWZ A;  1FMW A;  4NC7 A;  1S7E A;  4B3X A;  3H3U A;  6PAX A;  2O8X A;  4HX4 A;  5JLW A;  4M9X A;  1TTY A;  1QO0 D;  3BTL A;  3S2W A;  1K61 A;  2GXG A;  1DPR A;  1IXR C;  2VT2 A;  5KK1 A;  2VOP A;  3CUQ C;  3S93 A;  2EPF A;  2MBF A;  3CLQ A;  1E3H A;  3SJM A;  1ORK A;  1Z7U A;  3D1N I;  2FU4 A;  2CJJ A;  1XTA A;  2LK2 A;  2ISY A;  1TBX A;  1F36 A;  2RGV A;  2PJR A;  1VND A;  3GF2 A;  5AON A;  1SFO J;  4YII A;  4XQF A;  5ICF A;  5DM7 F;  3MQ0 A;  4ESB A;  1K4S A;  3N4M A;  4DBQ A;  5KVR A;  4HA8 A;  1TNT A;  1FP1 D;  5FD5 A;  2KIQ A;  1SC7 A;  1GDT A;  2X9D A;  5HLT A;  3OY9 A;  3S15 J;  1D0Y A;  4F55 A;  1XGM A;  3CC7 I;  1FYK A;  2TRT A;  4P9F A;  2IS6 A;  2QBY A;  2UXN A;  4M9Z A;  5IOZ A;  4BHB A;  5GAH J;  3LSR A;  4F91 B;  3F8N A;  3JSO A;  4HQM A;  5J6X A;  3SEZ A;  5D6E A;  3OSF A;  2ZNY A;  4FAS D;  4IRH A;  4A3E J;  3GBG A;  1K6Y A;  2LSO A;  3JRI A;  3OYB A;  1QZY A;  4PK4 A;  1EF4 A;  3A0H C;  3E1S A;  4XKV A;  4ZYD A;  4GDF A;  1IZ1 A;  2HTS A;  3RPU D;  1FC3 A;  1POG A;  3O8G A;  1MMA A;  4CYC B;  1RNL A;  1KU2 A;  1JTX A;  2L7M P;  3H5A A;  1ZG5 A;  2UV1 A;  1F4K A;  2QQB A;  1OCO H;  2DTR A;  4N9H A;  4IPA A;  2R7O A;  2E60 A;  3AG2 H;  2KQR A;  4L0Z B;  1MJB A;  3U21 A;  4KIG A;  1R00 A;  1SFE A;  2LTP A;  2M8E A;  3J7A Y;  4BQQ A;  1NG6 A;  1X3Z B;  1GV5 A;  1E3O C;  2MGQ A;  2X4H A;  3ABM H;  5LGU A;  2DW4 A;  2QWW A;  5JHU A;  2H1L A;  4UB8 C;  3SQN A;  3KX2 A;  2K4J A;  5B3S H;  1WWX A;  3DKX A;  3K70 C;  2GZW A;  5J40 A;  3S8P A;  4QLC U;  2ISZ A;  4L5I A;  2J5P A;  2IS2 A;  1SVM A;  1OCP A;  1J59 A;  3V8K A;  3PFY A;  2XPW A;  5F04 A;  1J9I A;  3GTO J;  4DOZ A;  2EQR A;  1X1D A;  2KMU A;  2VBY A;  2BY1 A;  2ECC A;  3G1M A;  5FD6 A;  4HV6 A;  4DJA A;  2XAU A;  5LRS A;  1A35 A;  1DUX C;  2PJR B;  3DU6 A;  1BR4 A;  2HS5 A;  2ZSH B;  3BZC A;  4HEA 2;  2A07 F;  3TL4 X;  4MQ9 F;  3GX4 X;  3MCZ A;  2L0K A;  2MW8 A;  4B1R A;  3K4K A;  3L2Q A;  2LKP A;  2DQR A;  3PNY A;  3OIO A;  1NH3 A;  1IUF A;  1U0J A;  2DJI A;  5HVQ C;  3DEW A;  2IRF G;  5EEA A;  4MFE A;  2IS1 A;  2X6X A;  3LST A;  1F1Z A;  1UHW A;  2QBY B;  2QKL B;  3UNG C;  2K3F A;  3I54 A;  1W0T A;  1T38 A;  4FE7 A;  1QPI A;  5CVU A;  3QQA A;  2WAF A;  1JT0 A;  2VC0 A;  1YLF A;  2FNA A;  4FE4 A;  2E1N A;  1BJA A;  4RA2 A;  4RGR A;  1IRX A;  1Z05 A;  3LA3 A;  2NS8 A;  1E0E A;  3TW6 A;  3I4N J;  4UVA A;  2G7H A;  1PVE A;  4B44 A;  1JE8 A;  2BZT A;  4HBL A;  2MLK A;  1ETQ A;  3QOP A;  3CCJ I;  3R6S A;  3H5N A;  3HPH A;  2HU9 A;  2OZU A;  5C44 J;  3REO A;  3RI4 A;  2LH9 A;  2IXS A;  4AID A;  3MN2 A;  4A3F J;  1UJ8 A;  3MKL A;  5HDK A;  2CFX A;  3DBL B;  3EUK L;  4EGZ A;  4ON0 A;  2XIG A;  3FIW A;  2JVG A;  1XSD A;  1QGP A;  2Q1Z B;  3EPZ A;  1FOK A;  2PG4 A;  1SMT A;  3W6K B;  2Q2E A;  2VAS A;  1L3L A;  4BAY A;  3A0B C;  1KQ0 A;  2NVX J;  2DMQ A;  1T98 A;  2HWV A;  2KDZ A;  1X3W B;  3T8R A;  3WOD F;  3QPL A;  4YIF A;  4DZJ A;  2P6T A;  2LY9 A;  3RIR A;  3WTZ A;  1OIS A;  3H3Z A;  2D1H A;  5KAI C;  2D1V A;  3PM1 A;  3FK7 A;  2XAH A;  3O3K A;  4BYY A;  3GME A;  3VPR A;  1IC8 A;  2ZFW A;  2MC4 A;  1DP3 A;  4E7S A;  3WHC A;  4L0Y B;  3IH3 A;  1MBG A;  1W1W E;  3ZMS A;  2KPM A;  3OV8 A;  3BR1 A;  5HLG A;  2XAS A;  4BJ5 C;  4RBO A;  1O3Q A;  1SFX A;  2ZXJ A;  4FIS A;  1HBX G;  4V19 K;  2JSC A;  1HC8 A;  3ONQ A;  5ILV A;  3K9T A;  2A05 A;  2K3P A;  2Z3Y A;  5J8F A;  1X1A A;  2RC4 A;  1S5L C;  5FLM J;  1WH5 A;  2ACJ A;  3CJN A;  4NUB A;  2CQK A;  5L3C A;  2F4O B;  2MD5 A;  2PFB A;  2HKX A;  1VQM I;  2M3A A;  2V9V A;  5JHF A;  3BT9 A;  2DMP A;  4N9I A;  3BPX A;  5F27 A;  2YPR A;  2KRH A;  2LLK A;  1A04 A;  2AHQ A;  4A3C J;  2GOX B;  2VE9 A;  3WTU C;  4C2T A;  2VOD A;  2CFO A;  3F6O A;  2EV0 A;  4LB5 A;  3DPT A;  3Q3S A;  1KU3 A;  3DTK A;  2NVQ J;  3E5Q A;  1REP C;  2PI0 A;  3RPU A;  2CW8 A;  2EFN A;  1UG2 A;  1O3R A;  2QGU A;  1WJ5 A;  1U5T B;  3CCM I;  1QRY A;  4X0G A;  1I1G A;  3EUH A;  4NBQ A;  4Y15 A;  2A6H F;  3MAJ A;  2Y2Z A;  1K83 J;  3Q0U A;  5JVG F;  4IHY A;  1U6G A;  3GW2 A;  1D8J A;  1ODD A;  1P6R A;  3ASN H;  4D7N A;  4KN7 X;  4E7J A;  3HOX J;  2ZNZ A;  5A2Q Z;  3QP5 A;  3GTJ J;  2K85 A;  1HF0 A;  2OJE D;  3KZZ A;  4WWC A;  3S14 J;  3SYT A;  1MMN A;  3RZO J;  5J1Y A;  1KYW A;  3AL0 C;  4FTH A;  1IRF A;  3A2K A;  3F22 A;  3BP8 A;  1LVA A;  2K86 A;  5TIS C;  1ZTR A;  2HXO A;  5H6R A;  2E71 A;  2IGN A;  3OIQ A;  2VUM J;  3WTY C;  5FKM A;  1MZB A;  2P5L C;  4A3M J;  2F2E A;  2X6Y A;  2B9S A;  1BC7 C;  3G1O A;  3TO6 A;  3JRF A;  3DEU A;  1XGS A;  2DOE A;  1TP4 A;  4A3L J;  2FSW A;  1A6Q A;  3OS0 A;  4MNU A;  2M5W A;  4N0B A;  4KDP A;  1ZAR A;  4CIC A;  4UXN A;  2EV5 A;  4MIM A;  3IRQ A;  2CGP A;  4JX4 A;  1G3S A;  1XCV A;  5E17 F;  1TWH J;  3FHN A;  4B8X A;  3PO3 J;  5HOD A;  2A5Y B;  4HG2 A;  1JUS A;  2VE8 A;  2JZY A;  2KRC A;  2ZJQ F;  4CCN A;  1FZP B;  2KHM A;  1OMI A;  3CZ6 A;  3S17 J;  4U0W A;  4M6V A;  1MH4 A;  2EFO A;  3DTI A;  2LD5 A;  1D1B A;  2Z99 A;  3ABL H;  3ECO A;  1RUO A;  1T2K A;  2NNN A;  5L3B A;  2JPB A;  1ETV A;  2L9V A;  4FET A;  1LNW A;  3VEP A;  3V4G A;  2IT0 A;  4PGH A;  3IH4 A;  4HYE A;  1Y6I A;  5M3F J;  4AVZ A;  3M8E A;  5K7H A;  1WJD A;  2EJR A;  5CYV A;  4H0E A;  1PDN C;  3M8J A;  1ZHF A;  4LK0 F;  4PSX A;  3CES A;  3IH2 A;  1YJW I;  2O9L A;  1R4N B;  4PSW A;  3W2V A;  1F5T A;  4L5E A;  3OOU A;  1OFC X;  4XRM A;  4PDK A;  2RNJ A;  4FX4 A;  3PNT A;  3K7A J;  4F93 B;  3TO7 A;  1X2N A;  1Z77 A;  2DCE A;  4LIV A;  4PJJ A;  3K4N A;  4A3K J;  2EBI A;  2NOJ B;  3CMA I;  2OU2 A;  3P9C A;  1V3F A;  2JTV A;  5D5V B;  3K1M A;  4XLH A;  4EGY A;  3AAF A;  3LSJ A;  4Y52 J;  4A0Y A;  1IN7 A;  2K02 A;  1BW6 A;  1GV2 A;  4IEJ A;  1JGG A;  2DAO A;  5J1R A;  1ZRC A;  1T08 B;  3DKW A;  2P5V A;  2XF7 A;  1W5C C;  1YTY A;  2YX7 A;  1O4X A;  4RB1 A;  2LC2 A;  4A0Z A;  3F0C A;  2V26 A;  2E34 A;  2PX9 A;  1FSE A;  1WGX A;  3ZMZ A;  4LD5 A;  5E3L A;  4PJM A;  4WXH A;  3HUG A;  4RAG A;  2ZJR F;  2VJ5 A;  3ABT A;  4I01 A;  4ENK A;  2F4M B;  3SXY A;  4BKX A;  3IRR A;  3S16 J;  2GWR A;  4HW0 A;  2M1B A;  1ZEL A;  1R23 A;  2EIL H;  3G2B A;  1CF7 B;  4X1E A;  1R5I D;  2ID3 A;  3WG7 H;  3PQJ A;  5ERI A;  2BEO A;  2L5Q A;  3CF2 A;  5DDG A;  5FJ8 J;  2M4G A;  4HF0 A;  5FFX A;  4F7Z A;  4YFX F;  4A3I J;  1JJ8 C;  1GHC A;  3ELK A;  3IHU A;  5L3G A;  3OYH A;  2W85 A;  5IY5 H;  1QPM A;  1CGP A;  3VWB A;  2IBD A;  3CLO A;  3U9G A;  3HOS A;  2XHK A;  2FQ4 A;  2D45 A;  1R6R A;  3OSG A;  4I2O A;  4U7D A;  3C2G A;  1JTY A;  3VSK A;  4L9T A;  3TED A;  1SAN A;  2CMP A;  3HGG A;  4OIO F;  3WGG A;  2VXZ A;  3ABU A;  3CCV I;  2XRN A;  3K4J A;  3CCE I;  2MLG A;  2ZXW H;  2HVQ A;  4M3G A;  1W7P A;  2GIV A;  4YIR X;  1IW7 F;  2Q8K A;  3CDL A;  3HL2 A;  3LL7 A;  1U78 A;  3CME I;  1L0O C;  3KP2 A;  2MD0 A;  5DD8 A;  1FP2 A;  2V6E A;  2VKV A;  2EA4 A;  2R5Y A;  2EK5 A;  2F5F A;  1FOX A;  2DQL A;  2Y48 A;  3H9J A;  1W36 C;  1Z0X A;  4MTD A;  1GLN A;  3BG9 A;  1RKT A;  5CVJ A;  3QPT A;  1HQC A;  5HS9 A;  3GVA A;  2IVM A;  5JLX A;  3HHH A;  3C3W A;  1LEB A;  2FXA A;  5K5Q A;  4E4H A;  1TT5 B;  4PJN A;  1IJW C;  1QQI A;  3OR2 C;  2PQ8 A;  4IVN A;  3P7N A;  3WE3 A;  2P5K A;  1LDJ A;  3OIP A;  2P7C B;  2V9K A;  1YS6 A;  3H9G A;  4TV7 A;  4IO9 F;  1RZ4 A;  2X6W A;  4HNU A;  3HOT A;  2F5C A;  1GXQ A;  2O03 A;  4K2E A;  4PUS A;  3L2C A;  3ERE D;  2FOW A;  2LR8 A;  2KP6 A;  5F64 A;  3GTL J;  2WA0 A;  3K4B A;  1A6I A;  3WTW C;  1YHQ I;  4HAM A;  2M2E A;  2IA1 A;  4BBR J;  1FTT A;  1ACI A;  3LSH A;  1V55 H;  2DA1 A;  2VBX A;  1T33 A;  4LLG F;  4XL9 A;  1K4T A;  2DMU A;  1KU9 A;  4ESF A;  5FB2 A;  2JT1 A;  5GP9 A;  4BJT A;  2JJ7 A;  2LY1 A;  3LQR A;  3E6C C;  4J01 A;  4A5N A;  4A5M A;  1H88 C;  3FM5 A;  5DEQ A;  1LKX A;  3MMY B;  2H6C A;  2L9R A;  5EGO A;  2V6C A;  1HW1 A;  2O5R A;  3HBL A;  1RC9 A;  2M0M A;  3JAM Z;  3LQQ A;  3KLO A;  4C3H J;  4KYW A;  1WH7 A;  3ESW B;  4O5V A;  5DUK A;  3FBN B;  2K5C A;  3HSE A;  3JRD A;  1YE9 A;  4JQF A;  5CVI A;  2FQ3 A;  4HPQ A;  1D1C A;  1GVD A;  1OR7 A;  5IOY A;  5FRN A;  4YRV A;  5E8G A;  2E1O A;  1LFP A;  3M7G A;  4G6T B;  3BCB A;  3CMM A;  1YRN A;  2JN6 A;  5DV5 A;  2QLZ A;  3GWZ A;  2H1K A;  2IGM A;  2ME0 A;  1TWA J;  1BA5 A;  1VQ6 I;  4CCK A;  1B1B A;  4EJU A;  3C2H A;  4IHS A;  2NVY J;  3DXJ F;  1IV6 A;  1BI3 A;  1MDM A;  2IP2 A;  3WHB A;  4XR6 A;  3OMY A;  2DBB A;  4HV5 A;  1V5F A;  2B0L A;  2OA4 A;  2V1X A;  3G71 I;  1G3T A;  1UAA A;  4DBR A;  3JRC A;  5HNH A;  2R93 J;  3BR3 A;  3X2Q H;  4GCV A;  1XSX A;  1SVL A;  2H8W A;  3Q0V A;  4LGW A;  1HXD A;  2DFE A;  4G9Y A;  3CCR I;  2WB1 N;  3BG3 A;  1ON1 A;  3GTG J;  2RKH A;  2R7R A;  1DPU A;  2YU3 A;  2A5W A;  1UZC A;  1TWG J;  3MZH A;  2ZO4 A;  2LBF A;  3NEU A;  1JGS A;  2DA2 A;  5JI6 A;  1IN8 A;  4BQO A;  3SZT A;  3KCC A;  2CQN A;  2E2H J;  3QYF A;  3FXM A;  2M87 A;  3K4M A;  3S1R J;  5IT3 A;  2A3S A;  2Z16 A;  2JVH A;  2QQA A;  4CZZ A;  3W2A A;  2CQ7 A;  1EH8 A;  1ERD A;  2FEZ A;  3ULQ B;  2COB A;  3ASO H;  3RJP A;  4Y3O A;  1RUN A;  5IYD J;  2DFI A;  2DPU A;  5FLX K;  3DP7 A;  4XOP A;  3EYI A;  4CCL A;  2L3D A;  2W82 A;  2X1D A;  4LB6 B;  2KT0 A;  4KJZ A;  3GEZ A;  1MD0 A;  2VKD A;  5EYR A;  3I53 A;  1T39 A;  1B72 B;  3M4O J;  2QSG X;  5GTI C;  4QPQ A;  3DKY A;  5C4J J;  5EGO B;  3M07 A;  4XNF A;  2DT7 B;  3NAR A;  4ZYG A;  1EV7 A;  1W5S A;  1TQM A;  3T5X A;  1ZRD A;  4J00 A;  3C18 A;  1USS A;  2DT5 A;  1JJ6 C;  2W25 A;  2HGC A;  4BGD A;  3JSP A;  1H0M A;  2L4A A;  2HYG D;  1BBY A;  3N05 A;  2JSP A;  1WVR A;  1VQL I;  2NNY A;  1JUP A;  1J09 A;  2M8G X;  3GFL A;  2FD5 A;  1YRN B;  2JA8 J;  3DLL F;  4UY8 I;  2Y0S A;  3ZQH A;  2O0Y A;  3MKY B;  3FHZ A;  4UV8 A;  2FML A;  3SZP A;  1SMY F;  2XC7 A;  1UHS A;  1WFX A;  3V7C A;  1X4P A;  5EZG A;  2ID6 A;  2HEO A;  3HOU J;  2L7K A;  1Y8R B;  3TOA A;  2KL4 A;  2NXN B;  9ANT A;  4WF2 A;  3WTT C;  2DA5 A;  1KQ8 A;  3S1N J;  3BZK A;  5GPA A;  5AIQ A;  1JKQ C;  2J5O A;  2HOS A;  4CXF A;  4C30 A;  1BJZ A;  3BG7 A;  2RNG A;  2XAQ A;  3AG4 H;  5CPR B;  2GA1 A;  4OU0 A;  2Y31 A;  2OC6 A;  2Z33 A;  1Z9C A;  4GXO A;  2KFD A;  2VXD A;  1ZYR F;  3VYS B;  4XM3 A;  2Y0S N;  3SHF A;  2LBF B;  3BC8 A;  3FKJ A;  1ZG1 A;  2OUM A;  1AU7 A;  5L3F A;  4OMY A;  2W57 A;  2HOA A;  3HSF A;  4G6D A;  4LFU A;  1HST A;  5CKT A;  4F3Q A;  3GFI A;  1OCT C;  2G0E A;  3PNV A;  4HLX A;  1IG7 A;  4DIQ A;  2EH3 A;  3CP8 A;  1WHU A;  1O3S A;  5FLV A;  3BCA A;  3HRT A;  4WCG A;  2MG4 A;  4WXD A;  2W84 A;  2JRM A;  3KLN A;  4MO7 A;  1U5T C;  4UHT A;  1B59 A;  2KKO A;  1FY7 A;  2KZG A;  5DCM A;  4UB6 C;  1PP8 F;  3O2P E;  3ZQF A;  2BGC A;  3K6G A;  3QWL A;  4RGS A;  3CCU I;  3ZQC A;  1LUJ B;  1FTZ A;  1LFU P;  4Y17 A;  4B4C A;  3LAP A;  2VN2 A;  1N78 A;  1VQ8 I;  3VSL A;  1HKS A;  2DU9 A;  2TCT A;  4II2 A;  3JAM K;  4I7H A;  5H6Q A;  1JUM A;  1TC3 C;  3H1C A;  4C2U A;  4XLA A;  1MNE A;  1Z7L A;  2LVS A;  1R1U A;  4LOC A;  4AVP A;  2CUE A;  2KRF A;  5ILU A;  4NC8 A;  3FXK A;  2XPU A;  3M1C A;  3DQV C;  4P9U A;  4MTE A;  1ZN2 A;  1K78 A;  5M5W J;  2KIU A;  3LFK A;  1OPC A;  3JTH A;  1RIO H;  3TBI A;  3EQL F;  5L3E A;  2Z1D A;  3RYR A;  4NB5 A;  4ETS A;  2K7L A;  2R7T A;  3Q0W A;  4KMF A;  4AIK A;  2UZK A;  4M74 A;  4YG2 F;  5F1J A;  2K9Q A;  3OYK A;  1H89 C;  1QNT A;  2VJ4 A;  4X6A J;  1YW8 A;  2KDO A;  3OR1 C;  4HZF A;  2HPI A;  2L7Z A;  3KP3 A;  3CO6 C;  3F23 A;  3LNQ A;  2WWY A;  1B4A A;  4E7I A;  1MBJ A;  3TDU C;  2M7B A;  2VLA A;  3RCO A;  3GZ6 A;  1D0Z A;  2E19 A;  2DTZ A;  2E1M B;  3KYD B;  3VYU B;  3CUQ A;  1UCR A;  1TWF J;  1EA3 A;  3ZMU A;  4FHT A;  4E7K A;  3HIF A;  4BS9 A;  2LYC A;  4IF4 A;  2QF7 A;  2BXZ A;  4QWQ A;  2AXL A;  2HYF A;  2Y69 H;  1GVJ A;  3L2W A;  3WU0 A;  3H3V K;  3M9A A;  2CQQ A;  4GYI A;  5LRR A;  3D5L A;  4AUX A;  5HS7 A;  4HQE A;  3CC2 I;  4BQA A;  4HF2 A;  2VJJ A;  2DA7 A;  1ON2 A;  5DD4 A;  3HG9 A;  2IJL A;  3FMR A;  4Q5S F;  4BHP A;  4E70 A;  3KP6 A;  1OQY A;  3J80 Z;  5DCM B;  2ZC2 A;  3ZP5 A;  2XKO A;  2LKS A;  1ZGJ A;  2HQN A;  1R1T A;  1TLH B;  4N4O B;  2ZME C;  4PZJ A;  4ZDL A;  3PFI A;  3H0D A;  4RGU A;  2P8T A;  2E5Z A;  2V1N A;  2RDP A;  3BR5 A;  2BYV E;  5FRO A;  3UR3 C;  3OYJ A;  4CZC A;  2BY2 A;  3MWM A;  4UUT A;  3RKQ A;  3MZ8 A;  3DF8 A;  3I64 A;  4E7H A;  2HDW A;  2KIF A;  5J3L A;  1KA8 A;  3D5S C;  1O7F A;  3AG1 H;  4DW6 A;  2K27 A;  1M1E B;  5FO5 A;  1K78 B;  3TKY A;  3E0J B;  1FLI A;  4V2F A;  3DFG A;  5F0C A;  1E3P A;  3I59 A;  1O3T A;  2EZH A;  2MA3 A;  5J4Y A;  4RDU A;  4OOI A;  2EZL A;  1XMA A;  2ELK A;  3J7A O;  3BR6 A;  3K10 A;  5LGN A;  5EG0 A;  4A69 C;  1H9T A;  5LHI A;  5BPD A;  4GRI A;  1G6N A;  1P4X A;  1WKM A;  2ZXH A;  3WTS C;  4Y33 A;  1WI3 A;  2JA2 A;  1A36 A;  4KNY A;  1PUF A;  4MGR A;  4BHC A;  3J7Y J;  3GTP J;  4QTR A;  3S2D J;  4RAF A;  2WBM A;  4OMZ A;  2XGE A;  5H2F C;  3JR9 A;  1FYL A;  4LK1 F;  3CUQ B;  3MKW B;  4RB2 C;  2VON A;  1QU3 A;  4XN3 A;  5D6F A;  2OD5 A;  2XGX A;  2DJN A;  1I1S A;  1K6O A;  3V7S A;  4U0V A;  3OYA A;  2EFQ A;  3HHG A;  3KYL A;  1HDD C;  4PJ0 C;  1MSF C;  1XGN A;  1Y39 A;  2JRT A;  4I76 A;  4ZTF A;  2DT6 A;  2VB6 A;  2QYO A;  3EYY A;  4DNC A;  4G94 A;  1T0F C;  3L9F A;  4U87 A;  1W7P D;  1XB4 A;  4R8H A;  2EA2 A;  3ROU A;  3LA2 A;  3HC7 A;  3M1E A;  4C2M J;  1T56 A;  1I6X A;  1J7K A;  5M5Y J;  4GO1 A;  3FXU A;  2DA6 A;  5DYM A;  2E2I J;  1LPQ A;  3CJR B;  4IHV A;  2NRA C;  2V7F A;  3IC7 A;  2HQA A;  3CF5 F;  5KHD A;  3IP4 B;  3C1D A;  1P92 A;  3J81 Z;  1BC8 C;  4B3A A;  2JUG A;  1VQ7 I;  2FE3 A;  1UG0 A;  4I0B A;  2VI6 A;  3JRG A;  1VQO I;  1IGN A;  3HB9 A;  4WXC A;  1ETX A;  1S9H A;  3JCU C;  5GAG J;  3OWT A;  2E7W A;  1XSV A;  2Q2E B;  2BY0 A;  4I09 A;  3TW7 A;  5LHG A;  5D5W B;  4AIJ A;  4E7L A;  3NWS A;  4HF1 A;  1LDK B;  4D9J A;  5D4R A;  4BXX J;  1ENH A;  2F4I A;  2NAZ A;  2CSO A;  2TDX A;  3BRO A;  4MLO A;  4BE2 A;  4ENN A;  2M4K A;  5CQE A;  4L9J A;  2O8K A;  4NHJ A;  5K5O A;  2NYX A;  3RKY A;  5B1B H;  3DLA A;  2D2W A;  3CP2 A;  3FMQ A;  3FF5 A;  4KIT B;  5IYB J;  1V5E A;  1B8I A;  3S2H J;  1OYY A;  1JKO C;  3S1M J;  3JW4 A;  2WAE A;  3E5U A;  4G7O F;  2ADU A;  4XMY A;  4OIR F;  3KP4 A;  2QKM B;  2FF4 A;  1FJL A;  3KFW X;  3K0L A;  3WE2 A;  3JTG A;  1BIA A;  3OYM A;  1PUF B;  3QRF F;  2ZKZ A;  1R9T J;  4XLF A;  4UNO A;  3LSP A;  3HPG A;  1I3Q J;  4AIH A;  4M9S A;  1SVO A;  3BJO A;  1FPQ A;  1MGT A;  4KA4 A;  1U2W A;  2KJB A;  2L9N A;  3E6B A;  1P7I A;  2Z9O A;  3AKZ A;  1KON A;  3CDH A;  5LHH A;  1UB9 A;  2MH9 A;  1X1C A;  2KIM A;  2GQQ A;  4NNJ A;  5C4X J;  2IW5 A;  2XDV A;  5K5R A;  3J80 K;  1A31 A;  4JYK A;  1MBF A;  5DCF A;  1HKT A;  2IEK A;  3K69 A;  3H35 A;  5KCM A;  3V42 A;  3ZN1 A;  1YO5 C;  2FBH A;  3R60 A;  3WG9 A;  5HLH A;  2MC3 A;  2LMD A;  1BN5 A;  3FM3 A;  4LLL A;  4ZJZ A;  1R49 A;  4A6D A;  4AWX B;  4B48 A;  4BEH A;  5BPI A;  4CCM A;  5GTH C;  3G3Z A;  1JXS A;  1MIJ A;  2CW7 A;  4EQQ A;  2L2O A;  1FBQ A;  2NOG A;  4RM3 A;  2K4B A;  1S8N A;  2E7X A;  2CYY A;  5LLQ A;  3FXR A;  3HOY J;  1X1B A;  4ZYE A;  3F3X A;  2L7F P;  4D7M A;  4BXF A;  1IUY A;  2EIM H;  4Z2Y A;  3QPS A;  2R5Z A;  2BY3 A;  1PP7 U;  2L02 A;  2P6S A;  4RAY A;  4YFK F;  2OQG A;  2VL8 A;  1EJ9 A;  1W36 D;  4IZZ A;  4XLE A;  1BIB A;  4BU2 A;  5GAE J;  1IRZ A;  3I55 I;  1O7L A;  2Y0M A;  4RM2 A;  5F6F A;  4A93 J;  1TWC J;  3BR0 A;  4ZZL A;  2XUB A;  1F9N A;  3LSK A;  1Z6R A;  4QIW N;  3MKZ A;  1BL0 A;  3ISP A;  4A6E A;  2OTJ I;  4F92 B;  3B02 A;  1UFM A;  4ZC3 A;  4EVI A;  1YG2 A;  1VQN I;  3LSG A;  3DWL E;  2F5D A;  3U1D A;  4KT6 A;  2RQQ A;  1EKE A;  3RKW A;  5F08 A;  4XLC A;  1B8I B;  3M3Y J;  4I02 A;  1QZZ A;  3H0G J;  2K9M A;  4Z6Y A;  3KZI C;  1I39 A;  5FKK A;  2VQG A;  4FX0 A;  1MMD A;  2R7W A;  4CCO A;  3ABK H;  3SDB A;  1BOA A;  2WY7 Q;  1PUE E;  1LE8 A;  1O57 A;  3EDP A;  3ZOB A;  1ZQ3 P;  1HSJ A;  2Q0O A;  4JBA A;  4M6Y A;  3ZXS A;  1HDP A;  2MAB A;  3HRS A;  3VOE A;  1IN6 A;  1SAU A;  1SD5 A;  3F6V A;  4M3F A;  4XOR A;  2JMW A;  2R7Z J;  3I9V 2;  1ZK8 A;  4UVB A;  4A3B J;  4HSR A;  3BZ6 A;  2A6E F;  3GTM J;  1OYI A;  3RTR A;  3ZPL A;  2HVR A;  4RLF A;  3ZQI A;  4KUM A;  1ZH5 A;  2LNB A;  1R7J A;  3OYN A;  1KGS A;  4YFN F;  2M45 A;  1FEX A;  2IPQ X;  3BWG A;  4DQ2 A;  2HXI A;  2OCC H;  3SDG A;  4CH7 A;  1R4M B;  5A2Q K;  4O6J A;  4BEH B;  1GT0 C;  2PMH A;  1V4R A;  3LMM A;  3RPQ A;  3GLL A;  1W4M A;  4JP0 A;  2UUZ A;  4XKW A;  4RAZ A;  1QA6 A;  2VQH A;  4CYD A;  2CS3 A;  3LAJ A;  2P0W A;  3K2A A;  1ZKG A;  2R5Z B;  3OYG A;  4XRS G;  2RQP A;  3I4P A;  2WC2 A;  1P2F A;  3AG3 H;  2HZT A;  2HQR A;  3CUO A;  1WJB A;  4RLQ A;  4HLY A;  1DQU A;  1V54 H;  3L7W A;  5D8K B;  4QSH A;  2R7V A;  4ENJ A;  2XKP A;  1YJ9 I;  2HTJ A;  2RAE A;  3HUG B;  2R4G A;  3AL0 B;  3E5X A;  2LF7 A;  2M0C A;  4M3E A;  2HPM A;  2JWT A;  2LY2 A;  1QZE A;  3F72 A;  2R92 J;  3FDY A;  4LIT A;  2K9N A;  2B7E A;  1R36 A;  4LG3 A;  4EJV A;  3DCF A;  3G4S I;  4MEX F;  3BTC A;  2HDC A;  4IHX A;  5HNF A;  1XMX A;  1XN7 A;  4OIN F;  5EF6 A;  2DYS H;  4II3 A;  3MEX A;  3VB2 A;  3ZQ7 A;  2FOK A;  5CVV A;  1N77 A;  2DOA A;  2W4S A;  4XSX F;  3OYC A;  3FX3 A;  1LE8 B;  2F6C A;  3KEY A;  4DGW B;  1P4A A;  3GUD A;  1XS9 A;  3K4L A;  4JOM A;  2E36 A;  1PYV A;  3LWF A;  3F9K A;  4DYC A;  2PN6 A;  3S1Q J;  1SD6 A;  2CUZ A;  4Y4R A;  5E1X A;  2WV0 A;  4Q48 A;  1K7A A;  3FBI B;  1EH6 A;  1W7P B;  2WTE A;  1LDD A;  1ETK A;  1H9G A;  4ZYH A;  1WZ2 A;  2WB1 A;  1K79 A;  2FJ1 A;  3NRV A;  3WU1 B; 
#chains in the Genus database with same CATH homology
 2MG4 A;  4M3B A;  4MO7 A;  2IAI A;  4RBO A;  4FIS A;  3ZQF A;  4GFB A;  2R5Y B;  5BNG A;  5E3M A;  1DU6 A;  2ECB A;  3ZQC A;  1FTZ A;  1LFU P;  1JKR C;  2JA5 J;  3HEF A;  2HI3 A;  5FLM J;  1WH5 A;  2NS7 A;  4B4C A;  1X58 A;  1XC5 A;  2O7O A;  3A02 A;  1VI0 A;  3B6A A;  3BT9 A;  2DMP A;  2TCT A;  5F27 A;  1MH3 A;  5FKN A;  2LLK A;  4XIC A;  1JUM A;  2AHQ A;  1TC3 C;  3IV5 A;  4A3C J;  5DS9 A;  3HOV J;  1WCM J;  2LVS A;  4LOC A;  2CUE A;  3JRB A;  3E7L A;  2OPT A;  2XB0 X;  3Q3S A;  2NVQ J;  2XPU A;  2DA4 A;  1UG2 A;  5M5W J;  4I6Z A;  1XG1 A;  1QRY A;  3CMY A;  5EZH A;  2Y2Z A;  1K83 J;  3Q0U A;  4IHY A;  3Q0W A;  5F0F A;  4D7N A;  3HOX J;  5F1J A;  2K9Q A;  1H89 C;  3GTJ J;  5M5X J;  4X6A J;  1HF0 A;  1P7J A;  2EZK A;  2L7Z A;  3BQY A;  3S14 J;  3LNQ A;  4D5F A;  3BTJ A;  5J1Y A;  1MBJ A;  4XRS A;  1HLV A;  3HOW J;  3RZO J;  2D5V A;  3NAU A;  2E19 A;  4FTH A;  4UUS B;  4DZP A;  2DTZ A;  3A01 B;  2R0Q C;  1TWF J;  4M3D A;  1QVT A;  1ZTR A;  2HXO A;  2QF7 A;  2H8R A;  1U9N A;  1D5Y A;  2VUM J;  3RZD J;  5FKM A;  4A3M J;  3BTI A;  3BR2 A;  3HM5 A;  3H3V K;  5C3E J;  2CQQ A;  1ZGW A;  4CYC A;  2EZI A;  2X48 A;  3G1O A;  3JRF A;  4AUX A;  4W1U A;  5E3O A;  1RPW A;  2DA7 A;  4A3L J;  1APL C;  1DU0 A;  1I6H J;  5IPA A;  4MIM A;  2XRL A;  4JX4 A;  3BG5 A;  1RET A;  1TWH J;  3PO3 J;  5HOD A;  3TP3 A;  1JUS A;  1MBH A;  2N8G A;  3MVP A;  1LFB A;  4BBS J;  3S17 J;  4M6V A;  1MH4 A;  3HDD A;  2LD5 A;  2NVT J;  3BR5 A;  2AO9 A;  1RES A;  1ETV A;  2LFB A;  5K7F A;  4UUT A;  3RKQ A;  2I10 A;  1JKP C;  2XGD A;  3IH4 A;  5J3L A;  5M3F J;  4DW6 A;  5K7H A;  4A3J J;  4HNV A;  1MSE C;  3O8H A;  4V2F A;  5F0C A;  2XGC A;  1FIP A;  1I50 J;  3IH2 A;  2O9L A;  4G12 A;  2XSD C;  3LOC A;  1GUU A;  2DN0 A;  2EZH A;  3OOU A;  2P81 A;  4L5E A;  1OFC X;  4XRM A;  2GBY A;  4RDU A;  1AKH A;  2EZL A;  2ELK A;  3K7A J;  4XK4 A;  3BR6 A;  1B72 A;  1X2N A;  1Z77 A;  5EG0 A;  4A69 C;  4A3K J;  2EBI A;  2LKX A;  1A5J A;  3GTK J;  1H8A C;  4C3I J;  1WI3 A;  1VFC A;  4D5C A;  2M9H A;  1PUF A;  3LSJ A;  3GTP J;  1AHD P;  5F0H A;  4QTR A;  3S2D J;  4Y52 J;  5IP6 A;  1Y1V J;  1ETY A;  1BW6 A;  1RKW A;  1GV2 A;  2XGE A;  4IEJ A;  3JR9 A;  1JGG A;  5J1R A;  3HKZ N;  1O4X A;  3TP0 A;  4V2G A;  2DJN A;  3F0C A;  1ETW A;  2VKE A;  4Y7N J;  2GLO A;  1WGX A;  5E3L A;  1HDD C;  4DYQ A;  3FK6 A;  1NK3 P;  2XPV A;  1MSF C;  2ME6 A;  4MFD A;  5K7Z A;  2MSY A;  2DMN A;  4I76 A;  4JX6 A;  5M3M J;  4BKX A;  1ZR4 A;  4S0H B;  2JA7 J;  4ABZ A;  3S16 J;  4EEF G;  1RR7 A;  4X1E A;  2ID3 A;  4C2M J;  1T56 A;  4XID A;  5FJ8 J;  4IHW A;  5FKO A;  5M5Y J;  4A3I J;  1JJ8 C;  2DA6 A;  2JA6 J;  2PMZ N;  2DMT A;  2E2I J;  2IBD A;  4IHV A;  2WAQ N;  1NTC A;  2FQ4 A;  2HQ5 A;  3OSG A;  3I4M J;  1JTY A;  4B3A A;  3TED A;  1SAN A;  2K9S A;  3HGG A;  5DTD A;  2VI6 A;  5GPC A;  3JRE A;  3JRG A;  2ZB9 A;  2HYJ A;  2Y9Y A;  3FKI J;  3HB9 A;  1IGN A;  1ETX A;  2CQX A;  4M3G A;  1HCR A;  2YU9 J;  2HOT A;  3CDL A;  1U78 A;  1MBK A;  3TW7 A;  1IDZ A;  2VPR A;  3SFI A;  2QCO A;  3CCY A;  4BXX J;  1ENH A;  2DA3 A;  2K40 A;  2VKV A;  2Y30 A;  2R5Y A;  4MLO A;  1AKH B;  3RQI A;  4BY1 J;  1Z0X A;  2CUF A;  2O8K A;  3UKG A;  3BG9 A;  1RKT A;  2LP0 A;  1CQT A;  5E3N A;  5IYB J;  5JLX A;  1B8I A;  3S2H J;  1JKO C;  1U8B A;  3S1M J;  3PO2 J;  2M34 A;  2E2J J;  2YUS A;  1IJW C;  1IDY A;  1FJL A;  3ZQL A;  4DYR A;  2CRG A;  2B63 J;  3FIS A;  1PUF B;  4BY7 J;  1R9T J;  2JK3 A;  4AC0 A;  1U9O A;  3LSP A;  1I3Q J;  3CQZ J;  1S7E A;  1X2M A;  4AYB N;  4W97 A;  5JLW A;  5IYC J;  1BW5 A;  3BTL A;  1P7I A;  3ZQG A;  1K61 A;  2LR8 A;  3L1P A;  3JRH A;  3GTL J;  1A6I A;  2GM4 A;  1OJL A;  1HOM A;  3SJM A;  5C4X J;  1ORK A;  3D1N I;  2M2E A;  4JYK A;  1MBF A;  2CJJ A;  2IEK A;  2LK2 A;  1QVU A;  4BBR J;  1FTT A;  1W0U A;  1F36 A;  2DA1 A;  1T33 A;  1VND A;  1JT6 A;  2DMU A;  1NK2 P;  5FKL A;  1SFO J;  5GP9 A;  4C3J J;  2JJ7 A;  3JRA A;  1H88 C;  1GDT A;  3S15 J;  2X9D A;  2NOG A;  2L9R A;  5EGO A;  2TRT A;  3HOY J;  3HBL A;  1UMQ A;  5IOZ A;  3LSR A;  2L7F P;  4D7M A;  4C3H J;  1WH7 A;  3OSF A;  3QPS A;  1ZR2 A;  2R5Z A;  4A3E J;  3GBG A;  2YS9 A;  3JRD A;  1Y1W J;  3JRI A;  4A3G J;  1GVD A;  1IRZ A;  1EF4 A;  4A93 J;  5IOY A;  3C2B A;  1MNM C;  1TWC J;  3BR0 A;  2E1O A;  2XB5 A;  1YRN A;  1FIA A;  4QIW N;  2JN6 A;  1BL0 A;  2H1K A;  1POG A;  3O8G A;  2ME0 A;  1TWA J;  3A03 A;  4CYC B;  1BA5 A;  1JTX A;  2L7M P;  2NVY J;  1IV6 A;  1ITY A;  3LSG A;  2FX0 A;  3WHB A;  5F08 A;  1B8I B;  3M3Y J;  3H0G J;  5FKK A;  2LTP A;  3JRC A;  2R93 J;  3BR3 A;  1LE8 A;  1GV5 A;  3Q0V A;  1E3O C;  2MGQ A;  1ETO A;  3ZOB A;  1ZQ3 P;  2WB1 N;  3BG3 A;  1HDP A;  3GTG J;  2CU7 A;  2OF7 A;  1TWG J;  4M3F A;  2DA2 A;  2JMW A;  2R7Z J;  1ZK8 A;  4A3B J;  2E2H J;  1OCP A;  3GTM J;  3B6C A;  2XPW A;  5F04 A;  3ZQI A;  5IP9 J;  3GTO J;  3S1R J;  5IP7 J;  2EQR A;  2WV1 A;  2COB A;  2ECC A;  3G1M A;  5IYD J;  3GTQ J;  1FEX A;  2HXI A;  5EDN A;  3SDG A;  2KT0 A;  1VF9 A;  2L0K A;  2MW8 A;  5EYR A;  4B1R A;  1GT0 C;  1B72 B;  3M4O J;  4JP0 A;  5EG0 B;  3OIO A;  4FCY A;  1IUF A;  5C4J J;  3DEW A;  5EEA A;  4MFE A;  5EGO B;  3NAR A;  2W48 A;  1W0T A;  1QPI A;  1MBE A;  4FE7 A;  3K2A A;  1JT0 A;  3QQA A;  1ZKG A;  2R5Z B;  3W6V A;  4XRS G;  1JJ6 C;  4FE4 A;  5J1U A;  3G1L A;  1JUP A;  2NS8 A;  2M8G X;  3TW6 A;  3I4N J;  2FD5 A;  1YRN B;  2JA8 J;  4QSH A;  3ZQH A;  2RAE A;  1G2H A;  4M3E A;  2M0C A;  1ETQ A;  2JWT A;  1UHS A;  2R92 J;  2K9N A;  4NDL A;  5C44 J;  3DCF A;  1WPK A;  1F43 A;  5EZG A;  2ID6 A;  3BTC A;  3HOU J;  4IHX A;  9ANT A;  3MN2 A;  2DA5 A;  4A3F J;  5EF6 A;  3S1N J;  5GPA A;  1JKQ C;  3MKL A;  4UUS A;  3A01 A;  2X6O A;  2HOS A;  4J19 A;  3FIW A;  1LE8 B;  1BJZ A;  2Y9Z A;  1XS9 A;  3BQZ A;  4A3D J;  2Y31 A;  2NVX J;  2DMQ A;  1Q1V A;  2KDZ A;  4DYC A;  2Y0S N;  3HOZ J;  3QPL A;  3S1Q J;  4DZJ A;  3HGY A;  2HDD A;  2LY9 A;  1AU7 A;  2HOA A;  3PM1 A;  3FK7 A;  4JX5 A;  1OCT C;  1ETK A;  3VPR A;  2G0E A;  1IC8 A;  1IG7 A;  2FJ1 A;  2EH3 A;  3WHC A;  3IH3 A;  1MBG A;  5FLV A;  3BR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...