1VF9A

Solution structure of human trf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
MEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomeric repeat binding factor 2
publication title Comparison between TRF2 and TRF1 of their telomeric DNA-bound structures and DNA-binding activities
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1vf9A00
4IEJA 1IC8A 5F27A 2DA1A 1CQTA 5JLXA 3ZQHA 2ECBA 2HDDA 4D5CA 2R5YB 2MW8A 3LSGA 4J19A 3MN2A 4V2GA 2R5ZA 2EZHA 4EEFG 5M3MJ 1TWCJ 4XICA 1YRNB 4LOCA 1MBKA 2GLOA 1BA5A 2CUEA 3BG5A 1A6IA 4S0HB 2LLKA 2KT0A 1JJ6C 5IYDJ 4V2FA 3BR2A 1Q1VA 3HOZJ 1H8AC 5IYBJ 2B63J 1ORKA 2NVTJ 2PMZN 1UG2A 4XRSA 2M2EA 1LFUP 2XGDA 4NDLA 4XIDA 5C3EJ 3BT9A 1XC5A 4QIWN 1U9OA 2YU9J 3PO3J 5IYCJ 4X6AJ 2FQ4A 3D1NI 1Y1WJ 2LVSA 1FTTA 1AKHB 1MBJA 4FE7A 4I76A 4C3HJ 4RBOA 2L7MP 2CUFA 1GV2A 5FKLA 4A69C 1D5YA 3LSRA 1A5JA 4HNVA 3HGGA 3HEFA 3M3YJ 1XS9A 3W6VA 4RDUA 2LR8A 2XPWA 5F0FA 1IDYA 3SJMA 4DYRA 1ZQ3P 2L0KA 4DZPA 1HDDC 1G2HA 1TWHJ 1FIPA 2HYJA 3JRGA 3LOCA 4DZJA 1ETWA 3BG9A 4MO7A 2YS9A 5K7FA 1Y1VJ 3GTOJ 2Y2ZA 2VKEA 1VNDA 2FJ1A 2M9HA 1JKPC 1MNMC 3I4NJ 1I50J 2L9RA 1W0UA 4A3CJ 2JA7J 1JUMA 1ETQA 1OFCX 3SFIA 5EG0A 1BL0A 4JX5A 3QPLA 2RAEA 4MLOA 1ITYA 4M3FA 3ZQCA 4A3MJ 4D5FA 2K9NA 1ETXA 5EGOA 3Q3SA 1RKTA 3GTQJ 4DYQA 2MGQA 2IEKA 5EDNA 1EF4A 2HXIA 1AHDP 1JT0A 2LFBA 3CDLA 4W97A 4C3JJ 2E2HJ 2GBYA 2LD5A 1PUFB 1H88C 4A3EJ 1P7JA 5GP9A 2H1KA 1OJLA 2IBDA 2NS7A 1U78A 2DA4A 4X1EA 4A93J 2AO9A 2Y31A 3BR3A 3G1MA 2OPTA 5F08A 4A3JJ 5M5WJ 2WAQN 4MIMA 3S1RJ 3OSGA 1I3QJ 1IRZA 1VF9A 2X48A 4MFEA 1BW6A 5JLWA 3FK7A 1B72A 2FD5A 2XPVA 2DA6A 3IH3A 4B1RA 1FJLA 4UUSA 1R9TJ 5E3LA 2X9DA 3HOWJ 5J1YA 3FIWA 3RZDJ 1MBEA 2HOTA 2QF7A 3JR9A 3A01B 1BW5A 4A3KJ 1JTXA 3CCYA 1ZTRA 4XRSG 2JMWA 2DA3A 1WGXA 2JA6J 2LY9A 4DW6A 2ZB9A 3F0CA 1E3OC 2DMUA 2JJ7A 1YRNA 3Q0WA 1FTZA 1HCRA 2R93J 4A3GJ 4BY1J 1LE8B 3WHCA 1DU6A 1ZR2A 1FIAA 3BTLA 3ZQGA 2CJJA 5J1RA 2E2IJ 3HDDA 2I10A 3L1PA 3ZOBA 2D5VA 3S16J 1IDZA 2R0QC 3QPSA 4JX6A 1ZR4A 1LFBA 4IHVA 1MH4A 2K9SA 1MBFA 5FLVA 2VI6A 9ANTA 5K7ZA 3O8GA 1GDTA 2XRLA 3G1OA 5F1JA 1HF0A 1Z0XA 2DA7A 5F04A 2DMQA 2EZKA 4Y7NJ 2FX0A 1AKHA 2M34A 2H8RA 2DTZA 3BQZA 1RKWA 2O8KA 1JUSA 3S2DJ 4BKXA 2JN6A 3TP0A 1HDPA 4CYCB 5DS9A 3BR1A 5FKOA 4JYKA 5M5XJ 2R7ZJ 1OCTC 1U9NA 1WPKA 1BJZA 3NAUA 1HOMA 2HQ5A 3FK6A 3BR0A 2LTPA 2E19A 3Q0VA 2JA5J 3JRBA 3OSFA 3FKIJ 1DU0A 4BBSJ 1S7EA 2L7ZA 2Y30A 2ME0A 3BG3A 3S15J 4BBRJ 3GTPJ 1O4XA 5C4XJ 4DYCA 3S1QJ 2DMTA 4D7NA 3Q0UA 3S1MJ 2W48A 3SDGA 1B8IB 3BTJA 3FISA 3IH2A 1P7IA 3CMYA 3DCFA 3ZQLA 2YUSA 2HXOA 2K9QA 1RPWA 4XK4A 2DN0A 5J1UA 1K83J 1HLVA 5DTDA 5E3NA 1AU7A 1GV5A 5C4JJ 3PM1A 2E2JJ 2EZLA 5EEAA 2DMPA 4A3BJ 2ME6A 1PUFA 1JKRC 2R92J 5FLMJ 3QQAA 4W1UA 5IP7J 1GUUA 3TP3A 3ZQIA 1WH7A 1JGGA 4JP0A 2EQRA 3HBLA 1GVDA 4A3FJ 3LSJA 2LK2A 3K7AJ 3RZOJ 4AUXA 2EZIA 1X2NA 2DMNA 5FKMA 4C2MJ 2M0CA 4D7MA 1TC3C 4C3IJ 3K2AA 3MKLA 4FE4A 5E3OA 2LKXA 1JKOC 3S17J 5BNGA 2ELKA 1QVUA 2GM4A 5FKNA 3G1LA 1JTYA 1T33A 5GPCA 1SFOJ 4BY7J 3VPRA 1ZGWA 4G12A 2NVXJ 3GTMJ 1APLC 2ECCA 3A01A 4AC0A 5HODA 3NARA 3IH4A 1MSFC 4IHYA 1SANA 2R5YA 2Y9ZA 1UHSA 5F0CA 3HM5A 1MBHA 1ETYA 4UUSB 4A3IJ 2LP0A 2WB1N 3OIOA 4M3BA 3JREA 4QSHA 1IG7A 2K40A 4XRMA 2N8GA 3A02A 3TW6A 1ETVA 3GBGA 1MH3A 1LE8A 4L5EA 3BR5A 4FCYA 3I4MJ 4AYBN 3TW7A 2Y0SN 4ABZA 2DA5A 1F36A 3JRAA 3RQIA 3JRFA 2EH3A 1VFCA 5F0HA 4B4CA 2JA8J 2R5ZB 3GTKJ 1JJ8C 3JRCA 4I6ZA 1JKQC 3ZQFA 4FISA 2NVYJ 5K7HA 1TWAJ 3LNQA 4A3LJ 1VI0A 3C2BA 3MVPA 2JWTA 5E3MA 2ID6A 1RETA 2NVQJ 4M6VA 3CQZJ 3LSPA 2AHQA 2O7OA 3PO2J 2CQXA 1QPIA 3H0GJ 2DJNA 1QRYA 4CYCA 1MSEC 1UMQA 2NS8A 5IOZA 4Y52J 3B6CA 3JRDA 5J3LA 2VUMJ 1XG1A 3TEDA 3H3VK 1FEXA 1ZKGA 5IP9J 2OF7A 5EF6A 2XB5A 1U8BA 1W0TA 2Y9YA 3HB9A 1I6HJ 5IOYA 3DEWA 4UUTA 5M5YJ 3GTGJ 1JT6A 1MBGA 1TWGJ 1F43A 1H89C 3UKGA 1ZK8A 1IUFA 5EYRA 1RR7A 2COBA 4M3DA 5C44J 5EZHA 1B8IA 5FJ8J 1NTCA 5IPAA 3IV5A 4A3DJ 1RESA 1QVTA 2E1OA 1NK2P 2EBIA 2L7FP 2MSYA 1IJWC 3BQYA 2XSDC 4GFBA 1X2MA 2ID3A 2VKVA 1JUPA 3BR6A 5IP6A 3HOXJ 1WCMJ 2JK3A 2XB0X 4M3GA 3HOUJ 5EG0B 2DA2A 3BTIA 3JRHA 3RKQA 2TRTA 4QTRA 2XGCA 3GTJJ 1Z77A 2QCOA 3HOYJ 1X58A 1OCPA 1NK3P 5EGOB 4BXXJ 2M8GX 1WH5A 3S2HJ 2CU7A 2HOAA 1T56A 3HGYA 2O9LA 4B3AA 2CRGA 3OOUA 1GT0C 3BTCA 1POGA 3B6AA 2TCTA 5GPAA 5M3FJ 2MG4A 3O8HA 3GTLJ 1ENHA 4IHWA 3JRIA 2CQQA 2P81A 3A03A 4JX4A 1WI3A 2WV1A 1B72B 3HOVJ 2KDZA 3S14J 2XPUA 2HI3A 1K61A 5FKKA 3E7LA 5EZGA 3M4OJ 1ETKA 3S1NJ 3WHBA 2VPRA 2X6OA 2IAIA 1ETOA 2HOSA 2XGEA 4FTHA 2NOGA 1IGNA 4MFDA 4IHXA 2G0EA 1TWFJ 4M3EA 1IV6A 3HKZN
chains in the Genus database with same CATH superfamily
3GMEA 5JR3A 2DA1A 3F21A 4GO1A 3ZQHA 3K10A 5BOXA 1R1UA 3LSGA 2X1EA 3CTAA 2HTJA 1UAAA 5HS7A 4NQWB 2CUEA 2ICWG 1A6IA 1KONA 2LLKA 3S3NA 4L0ZB 2F5DA 2Z1DA 2HPMA 3WE2A 3ASOH 1Y8QB 1Q1VA 4MEXF 5IYBJ 2B63J 2K9MA 2Q8KA 3DPTA 2KISA 3D0SA 2XKOA 1KQ8A 5FLXK 2LF8A 4AU7A 3IC7A 2DDAA 3AKZA 1UG2A 2NVTJ 2NNNA 4WWCA 4KN7X 3I4PA 1LFUP 3D5SC 3HSEA 3ELKA 5DV5A 4JOMA 2BVLA 4NDLA 2XSJC 3K2ZA 1W5TA 4XIDA 3TBIA 5E1WA 1FSHA 4DBQA 4CSWA 2QZ8A 3PO3J 4BE2A 3I58A 5IYCJ 5ILVA 2KJCA 3CCQI 5TRDA 2LVSA 1FBQA 1IXRC 3S3OA 1X4OA 4C3HJ 2A68F 2ZBKA 1Z67A 4A69C 1D5YA 1W36C 4BH9A 4HNVA 2V26A 4EJUA 5E17F 3TO6A 2ZNZA 1Q1HA 2P6SA 3BZKA 2IGKA 5A2QK 2XPWA 2VJJA 3TDZC 2HKXA 1MMSA 3IL2A 4HA8A 5D4RA 2HYGD 1TWHJ 3HIFA 4XMYA 1D0YA 4IHTA 3BG9A 4AIDA 3MD2A 2YS9A 1WJFA 2ELHA 2VQLA 3E3VA 2Y2ZA 3VOEA 3ZPLA 2PJRA 4Z2YA 2M9HA 3CCMI 2QA4I 3I4NJ 4EV0A 1USSA 5HS8A 5D5UB 2ZJRF 3V8KA 1SVMA 1B59A 4P96A 1Z6TA 3I54A 3LA3A 4NNJA 1W0UA 1X3UA 3IUOA 3BCBA 2JA7J 1D5VA 5EG0A 1BL0A 4JX5A 2W82A 4BEHB 1ITYA 3Q9VA 3ZQCA 2WAQA 4A3MJ 1U3EM 2HTSA 1K6OA 4DYQA 2HXIA 3C1DA 1T2KA 4HX8A 4W97A 3OS1A 1XN7A 1YJNI 1TQIA 2E2HJ 4EM0B 2GWRA 3CCLI 4KITB 1PUFB 1H88C 5FO5A 4ZDPA 1P7JA 4A3EJ 3AG3H 4XLCA 4BAYA 5IT9Z 3GFJA 2DA4A 3DPLC 5DM6F 1I6XA 3BR3A 1RIOH 2IVMA 3RPQA 5F08A 2MC3A 3QPHA 4A3JJ 2WAQN 4MIMA 4M9XA 2R7FA 3AAFA 2FD5A 4XN3A 2DA6A 2A69F 2M7AA 3ZN1A 2OZ6A 2X9DA 5FFXA 2X0LA 5D6EA 3WTTC 3FIWA 1E3HA 1FOKA 3QOPA 2QF7A 2XVCA 3SQNA 4RGUA 2MH2A 2LY2A 3WTUC 3FXRA 2Y0SA 4IQ4A 1KQ0A 4XRSG 3A1YA 4PFPA 1WGXA 2DK5A 4C2UA 4EGYA 2HPIA 2E1CA 1O7LA 2ZB9A 3JAMZ 1P92A 1XGNA 3CJRB 3F0CA 1A36A 1D8KA 4ETSA 4HOBA 4A3GJ 3RKWA 1X1CA 3AFHA 4XN0A 1LDKB 2NS0A 4BQOA 2L01A 4C9YA 1QPMA 3GZNB 1MJBA 3D5LA 3ZQGA 1IN4A 2CJJA 5J1RA 1GLNA 4PUSA 5L3FA 3S16J 2R7VA 1HW1A 3BJOA 2X1CA 2EILH 3WTZA 4AM3A 1UJ8A 5D6FA 2VJ4A 4Y17A 3MCZA 1YITI 1WVRA 4PJMA 5BS6A 5IY5H 3MKYB 4A0XA 1F5TA 2V9VA 1FSEA 1SD6A 2L7KA 2VT2A 3V7CA 2O61A 1P4XA 5F1JA 2L5QA 3KP7A 4E7ZA 3DF8A 2CV2A 2DQLA 4A6EA 3QPTA 1RKWA 2VN2A 1JUSA 3S2DJ 4I02A 2EFQA 1T39A 4CYCB 1VQ7I 1USTA 5J47A 5FKOA 1CGPA 5HNHA 3R60A 1S6LA 3M07A 1BJZA 1HOMA 1HW5A 3TGNA 3BR0A 1TTYA 4E7LA 2LTPA 1G3TA 2HOEA 3JRBA 3FX3A 3OSFA 3L00A 4BBSJ 3J7YJ 4EM2A 4K2EA 1B9NA 2E1MB 2V6CA 4XLEA 4LG0B 3GTPJ 4DQ2A 4D0PA 1K4SA 5C4XJ 3M8EA 2ZFUA 2K86A 4JQFA 1KU7A 1HBXG 3WG9A 4BL0B 3BPXA 3SDGA 2BY0A 3BY6A 1BR1A 1J2XA 2A61A 3IH2A 3RIRA 1V3FA 1R5HA 1WJCA 2JSCA 4UVBA 2YUSA 4L5JA 5FROA 2E60A 2K9QA 1KZHA 4XK4A 2PJRB 2WBMA 1D1BA 3VB2A 1P4AA 1STZA 1TL8A 1G3WA 3ABUA 4I0BA 4CCKA 2V6EA 4N9HA 3PQJA 2E2JJ 1JI8A 3RPUA 3OMYA 1JGSA 1WFXA 2DMPA 3PNVA 2RVCA 4KDPA 1QZZA 3KYDB 3QQAA 4W1UA 4P55A 2F5CA 2EQRA 3GCMA 1GVDA 3JCUC 2LK2A 3CMMA 5FD6A 1WJ5A 2DMNA 1XGMA 2P6TA 2NAZA 2VLAA 2K5CA 3ECHA 3WTYC 4D7MA 2W57A 3K2AA 3MKLA 2ZJPF 4FE4A 2XF7A 1JKOC 1PP8F 3S17J 1E0EA 2A5WA 4EVIA 3MQ0A 5BNGA 1FMVA 3LSMA 1FX7A 4LJZF 1IRFA 3W2AA 4OWRB 5GPCA 1BIBA 3K1MA 4BY7J 2XROA 2HDCA 4HF2A 3HKZA 3COAC 3PUBA 1TQPA 5HODA 4OIRF 3CMAI 1BBYA 2HVSA 2P4WA 2QUFA 2QSFX 3H5NA 1UHSA 3CMEI 1VQ6I 3CCJI 1CF7B 1OCCH 2LYCA 3K9TA 1WJBA 2LP0A 2WB1N 3OY9A 3KP2A 4QSHA 2ESNA 2OD5A 4CCMA 2K40A 5CVRA 3TQNA 2ISYA 2X1DA 3PSFA 2UV1A 1ETVA 4GYIA 2LBFB 5B1AH 3BWGA 4ABZA 4Z6YA 2KMUA 3IAS2 3RQIA 4ZJZA 2PMZA 2DT5A 3GTKJ 2F48A 1J59A 1JJ8C 2R7WA 2K7LA 1OMIA 2KZVA 2WY7Q 1X1BA 4LIUA 1JE8A 2H1LA 1JKQC 3ZQFA 3S3MA 3BPVA 3OYKA 3N97A 3LAJA 1V55H 2EK5A 3DBHB 3N4MA 4ZH4F 5KAFC 2O5RA 1VI0A 3DQVC 5HNFA 4BACA 1PDNC 2AQEA 3MVPA 4PJ0C 4IL6C 2JWTA 2BY1A 3I53A 5JI6A 4KNYA 3KZIC 4RM2A 1SD5A 3KP3A 2JZYA 4U0WA 2F5FA 3X2QH 1G8XA 2HQAA 2AHQA 2W25A 1D8JA 3H0GJ 2DJNA 3CUOA 5GTHC 3F23A 5CVUA 4XRFA 1MSEC 2NS8A 1P6RA 1N77A 1K79A 3OYBA 3B6CA 3HHGA 2V4JC 3K4NA 3HRTA 3I55I 4KMFA 4KA4A 3TEDA 3V7RA 5GADJ 4QWQA 4JBAA 2VOOA 1AA7A 4RGSA 4EJWA 1Z3YA 1W0TA 2Y9YA 2ZMEC 1I6HJ 5IOYA 4DBRA 2VXDA 1LEBA 1UB9A 3GTGJ 2MD5A 1JT6A 1MBGA 4G8XA 1F43A 2HZTA 1Z1DA 3OYIA 3DFGA 1ZN2A 4KICA 3L2QA 3F9KA 4U0VA 2FBKA 3H9GA 3ONQA 4L9JA 3IKTA 2QSHX 2E1NA 3JTHA 2GAUA 2COBA 4ESFA 3QRFF 5EZHA 2RDPA 2BXYA 3OYDA 2OZUA 3CC2I 3DEUA 4XONA 3F72A 1QVTA 2E1OA 2FNAA 1Y0NA 2UWMA 4HEA2 3HRUA 2BE5F 1XSXA 2XSDC 1X2MA 2ID3A 3DWLE 4HLXA 2ZKZA 2L9SA 1JUPA 3QOEA 1NG6A 2NYXA 2JK3A 3ZMTA 2DJIA 4OAYA 4XL9A 4UUVA 4CA0A 2JTVA 2JRTA 3A2KA 1PJRA 1Z77A 2QCOA 3WE3A 2ZMEA 1OCPA 2K85A 4J00A 3MZYA 1ON1A 1WH5A 3ABLH 4YIRX 1YLFA 4XBFA 3FWEA 2M30A 1HKQA 4Y33A 5K5OA 2O9LA 2CRGA 3OOUA 2FMYA 1BC7C 1GT0C 3BTCA 5CPRB 1POGA 4YFKF 2TCTA 3EUAA 5GPAA 2MG4A 2QBYA 5JVGF 3RYRA 2E34A 2CQQA 2P81A 3CO7C 3HOVJ 2GA1A 2KDZA 2XPUA 1IN6A 2EA2A 5EZGA 1YIJI 1J7KA 3ZXSA 4NHJA 3L2UA 2RQPA 3ZMUA 1YI2I 2W84A 3O3KA 3R0AA 4M3EA 2VQGA 4EJOA 1XSDA 3CC7I 1IC8A 4O3MA 2OAZA 2COMA 5CVIA 3C7JA 1CQTA 2HR3A 2Y48A 2MW8A 5EEHA 3NWTA 3H0DA 3MWMA 2JSPA 4J19A 3VEPA 4V2GA 5ILSA 4N4NB 5M3MJ 3DKXA 1Z3XA 4L9NA 1TWCJ 1YRNB 2IS2A 1BR4A 3WGHA 3HOTA 2RN7A 3BG5A 3KZZA 3ZMDA 3MFKA 3K1PA 3BR2A 1R1TA 2GQQA 1ZG3A 4IKFA 1M1EB 1OR7C 1B1BA 1W1WE 2L9VA 4HZFA 3CO6C 3O6BB 2XHKA 4XLAA 3TOAA 2DXIA 2MLGA 4XRSA 1VQMI 2M2EA 1TW3A 2DTRA 1B6AA 3SFZA 2H27A 3AL0B 4LG3A 3BJ6A 3OR1C 3T1BA 3J80K 3LMMA 1HQCA 5C3EJ 2P8TA 3KYLA 1KU3A 1U9OA 1K78A 3CF2A 3ZP5A 3CUQB 3BJAA 4X6AJ 1NHAA 1Y1WJ 3O2PE 2VBWA 3E1SA 3BG7A 3QU3A 4I76A 3WG7H 4YFXF 2JA2A 2L7MP 4M6XA 3U1KA 1GV2A 5FKLA 3LSRA 3SHFA 1A5JA 3W2VA 4WX9A 3FM3A 3H9QA 1KYWA 4E7HA 3M3YJ 1FOWA 4EM1A 2OJED 1FOYA 2LR8A 5F0FA 2IPQX 4DYRA 2EB7A 1FC3A 5HOOA 3QP6A 3R0JA 2L0KA 1HDDC 2EFWA 3V8LA 4N4OB 3JRGA 4XR6A 4DZJA 1VTNC 2ZNYA 1XB4A 1OR7A 4P5OA 3FMSA 1SEUA 1MNDA 1Y1VJ 4R79A 3VSLA 4RMNA 1JKPC 1VQLI 2DCEA 2EWNA 1IXSB 2WTEA 3CCRI 4LK1F 1LDJA 1RRJA 3JSOA 4PSWA 4FASD 1C0WA 4Y15A 5E8IA 1ZGJA 1DP3A 1Z05A 4XKCA 4IXAA 4A3CJ 4CHUA 1JUMA 1N78A 3SFIA 4XSZF 3VDXA 3JAMK 1IN7A 2KIMA 4M3FA 1R71A 4D5FA 2BXZA 1A35A 1ETXA 5EGOA 3Q3SA 3GTQJ 1R36A 2FF4A 2MGQA 2IEKA 2HVRA 2VKDA 4RA2A 4RGXA 3GO5A 2H6CA 4G6TB 4HDVA 2LD5A 1EH6A 5GP9A 4L5IA 4LLGF 2IBDA 3GWZA 2WY8Q 3MZHA 2KFDA 2Q0OA 4A93J 1I1GA 4WXHA 1IAWA 4E7KA 2VKHA 1EV7A 3I59B 1IRZA 1VF9A 2X48A 2GIZA 4MFEA 3U2RA 3L2WA 2R7DA 2XPVA 3ZN0A 1XGSA 4BDYA 1SVLA 1FJLA 2M4GA 4IJAA 3M1EA 4UUSA 1TW2A 1MJ9A 5J1YA 4HDUA 3F6VA 1MBEA 1G3SA 1P2FA 2V1DA 2A07F 3LSTA 3MEXA 1OISA 3BLYA 3JR9A 4F91B 1VQ5I 2YU3A 3GX4X 5B3SH 3A01B 1MW7A 4AYBA 3ZQ7A 3GZ5A 5LGUA 3MKWB 3ZRGA 2JMWA 2NXNB 1PYVA 2PMUA 3OS0A 5LRSA 3LFUA 5LHHA 3WU0A 1XX5A 3L09A 2DMUA 2XF6A 2YPRA 1HCRA 1G59A 2OU2A 2WA0A 4BY1J 1IF1A 1K6YA 3LQRA 4PSXA 2P5LC 2A05A 3DKYA 1RR8C 2K3FA 2MA3A 2BW3A 5BPDA 3I5UA 3NEUA 2KHMA 4ZZDA 3WTXC 5LFAA 2Q1ZB 1X1PA 4U87A 1XD7A 4A2UA 2CYYA 2R0QC 3K4MA 4JX6A 3SDBA 2ZSIB 1HC8A 5AIQA 1Z91A 3P5JA 1FZPB 2D2WA 1QZEA 2K9SA 2VJIA 4F55A 1MBFA 3DTIA 4A12A 4M6YA 1DQUA 5D4SA 1PUEE 4KIBA 2DA7A 3CP8A 4UB8C 4CGZA 2EZKA 3I0TA 1AKHA 1HA8A 5CLSA 4KT6A 3BQZA 5J40A 3HJEA 2M8EA 1W7PB 2X6WA 1ZLJA 3PQKA 1HDPA 1P9QC 5FRMA 2BEOA 3BR1A 1EH7A 1XMKA 1MMNA 1E17A 1TT5B 3OYNA 5KHDA 2E35A 1OCTC 2R7ZJ 1U9NA 2LKSA 5CQEA 5TGTA 5ILUA 4UY8I 4LK0F 3CJNA 3QU6A 1Z9CA 2PG4A 2STWA 5ICEA 3Q0VA 5DUKA 2JA5J 1UHWA 2X51A 4LD5A 3VODA 1P4WA 1S7EA 1SFUA 4Q47A 4E7JA 4Y4RA 5L3EA 1D1AA 2ZXWH 3S15J 1SC7A 4BBRJ 3M9AA 3WU1B 3DBLB 1YS7A 2DT6A 2JVHA 3EDPA 2OQGA 2OA4A 3P9KA 4UNOA 2W48A 2M4KA 3DTEA 3BTJA 3FISA 5FGMA 2ELJA 1LPQA 3TL4X 4UHTA 2R7UA 1VZ0A 4D1QA 2DN0A 3V42A 4RS8A 3T5XA 5FFZA 4LLLA 1QHGA 1ZGAA 5HLTA 4A0YA 3CCUI 2I8DA 5EEAA 4NBQA 1EJ9A 4HF1A 1SMTA 2KIUA 1EKEA 2J5PA 1JKRC 5FLMJ 1FYMA 4OMZA 1WH7A 4GRIA 4JP0A 3HBLA 5D5VB 3VYUB 4A3FJ 1W5CC 3LSJA 5GAHJ 2WWYA 4ESJA 3RZOJ 3NWSA 2Q2EB 2EZIA 1X2NA 2V7FA 3ZMZA 4IF4A 4G7ZF 5B66C 2M0CA 1LFPA 1W5SA 1TC3C 4C3IJ 5BPIA 5D8KB 4M9ZA 4PZJA 2ZXHA 2FOKA 2ELKA 4EGZA 2GM4A 2W1OA 5FKNA 4R1HA 5HVQC 3J81Z 2FBIA 3K4LA 4WCGA 2CQ7A 3E97A 5H6RA 4FX0A 3CLOA 4CCNA 1BC8C 3GTMJ 1APLC 1GHCA 2Z9OA 2CMPA 3I9V2 1OLTA 4IHYA 2Y9ZA 3G4SI 4L18B 2VBYA 4UUSB 1MBHA 1ETYA 1SFEA 1IO2A 1UELB 3OIOA 3PFIA 4M3BA 2W4SA 3OIPA 2IT0A 1HKSA 2CV1A 2DAOA 3RKYA 2GZWA 3CP2A 3A02A 3H3UA 3TW6A 1OQYA 1MH3A 1LE8A 1KU2A 2EPFA 3TW7A 2Y0SN 3DP7A 2L2OA 1AOYA 4RGRA 5DD8A 2MBFA 5TISC 3ZMVA 3NRVA 4B4CA 3R6SA 2JVGA 3JRCA 3JTGA 2L02A 1S29A 3W2WA 4BS9A 2KKOA 1H9TA 4A0ZA 2NVYJ 4YG2F 1U8RA 1TWAJ 3LNQA 3TMOA 1J9IA 4A3LJ 4JK1X 4IHSA 1VQ9I 2OQRA 3FXMA 4LGWA 1S5LC 2EFOA 4XLHA 2FBHA 3LSPA 4LMYA 1OKRA 2CQXA 3OYJA 1LEAA 4PFOA 4G7HF 1QPIA 5K1YA 2C6YA 1QRYA 4H4KC 4PCQA 3HPHA 4I99C 4MTEA 2PEXA 1Z21A 2MD0A 5KVRA 1J09A 3JRDA 2RNJA 3DPUA 3VSKA 4QPQA 1IZ1A 3KE2A 1MMDA 3M1CA 1XCBA 3J7ZI 2VUMJ 1LUJB 5DCMA 4RDUA 2CSOA 2GXGA 5IP9J 2Z99A 3LWFA 1U8BA 5B1BH 5LD2C 3FHNA 2DW4A 3DEWA 1R4MB 5H20A 4UB6C 1WJEA 1XTAA 2F2EA 3LSKA 3C2GA 2HU9A 1LDDA 4WF2A 3G71I 4GDFA 2VASA 3UKGA 1R7JA 3HHHA 1G3YA 1ZK8A 1IUFA 2E36A 3KP6A 3KLOA 2FMLA 2O3FA 1RR7A 4M3DA 5LLQA 2DT7B 4RBOA 1B8IA 3HG9A 4KIFA 2RV8A 1NTCA 2O8XA 5IPAA 1V5EA 4A3DJ 4XKWA 2ZXIA 3PL8A 1KQ9A 2EBIA 2L7FP 2KJBA 4HBLA 3H3ZA 1QU3A 3EUHC 1F9NA 1L3LA 2MSYA 3FF5A 2Y69H 1IJWC 4OMYA 3HUGA 3ROUA 3FXLA 5D5WB 4IX7A 2P7VB 3DEEA 4S05A 3HTUA 3HOXJ 5IP6A 2MC4A 3REOA 5EEGA 1FP2A 4F52A 4BHBA 2VBZA 2DYSH 5EG0B 2DA2A 1S8NA 1X58A 1NK3P 2IA2A 1A31A 4S04A 4HRIA 2CU7A 3QYBA 1T56A 1TZLA 3GF2A 1ZLKA 3PJRA 1YIOA 3VFZA 5ICGA 2P5KA 5CKTA 5CQGA 4MNUA 2K3PA 3CD6I 4Y13A 1T38A 1MNEA 5A2QZ 1I1SA 2MLKA 2RKHA 3F22A 2LC2A 2QQAA 4JX4A 2F5VA 2WV1A 3OYGA 3KYCB 5BQTA 3BROA 2DDBA 5E8GA 3EUHA 3FXQA 1Y6IA 4NC8A 4AVPA 3M4OJ 3V4GA 2H09A 1U5TC 3S1NJ 2CFXA 4BNCA 2V79A 2XAGA 5GAGJ 4FTHA 2NOGA 3GLXA 1IGNA 2F4IA 3M7GA 1FYKA 4XQFA 1IV6A 3HTSB 1QNTA 3HKZN 4ZTFA 1YO5C 3RKXA 2BBYA 2V9KA 1ZAOA 5JLXA 1NG7A 3L2CA 4IRIA 4KN4X 1F4KA 1TQMA 4KUMA 3BP8A 1T8IA 1W4MA 1R1VA 2R5ZA 2M0MA 2EZHA 4EEFG 1HXDA 4XICA 1MBKA 1BA5A 4HV6A 1QZYA 3F8MA 2IGOA 2M7BA 3FMRA 4S0HB 3LSHA 4XLNF 4A6DA 2KT0A 2GIVA 4V2FA 1T6SA 2IA1A 3F6OA 4ON0A 1H8AC 1ACIA 3C3WA 4J01A 2AXLA 4L9VA 4XLFA 2WV0A 2DPDA 1ORKA 3CESA 2L9NA 2QENA 2BY2A 2PMZN 1R22A 1MGTA 2B7EA 3A0HC 3K4BA 2W7NA 5K5RA 2FU4A 2KDOA 1ZREA 1WJAA 1FOXA 3BT9A 1XC5A 2B0LA 1MZBA 4OIPF 4V19K 2MABA 5D8LB 2FQ4A 3D1NI 4BE1A 4GXOA 2CUFA 1X3ZB 1SD7A 5IT3A 2ETHA 3H36A 3SXYA 4B47A 1G4DA 3HGGA 4AIKA 3HEFA 3W6VA 2F5EA 3ESWB 3E6DA 5JVTA 4DZPA 5EJCA 5GAEJ 1FIPA 1H0MA 4LITA 3K4JA 4BQNA 1D1CA 2VPLA 1OYIA 3IWZA 2CQNA 4M73A 4HSTA 1WI9A 2W00A 2VKEA 4OU0A 5LGTA 1XSVA 4B48A 4ASNA 3WGGA 3FBIB 4PJJA 1RUOA 3VYRB 2DPUA 2CS3A 2PJPA 2YX7A 4ENNA 2R7XA 2J5OA 1YE9A 2XKPA 3DKWA 4Q5SF 4RAFA 1GXQA 3ASNH 1SFKA 4U7BA 5L3GA 3DTKA 4MTDA 3EYYA 1JT0A 2LFBA 4C3JJ 3OYEA 1BI1A 3B02A 4AWXB 5HDKA 1IUYA 4I7HA 5LHGA 1R5GA 5GTIC 3SZTA 3UR3C 4BHPA 2H1KA 2NS7A 1YX5A 2AO9A 3GUDA 2OPTA 5M5WJ 1O3TA 4PGGA 3LL7A 5JLWA 1BW6A 1B72A 4Q4ZF 4ZYGA 4F7ZA 4II3A 3IRRA 1BOBA 5AIPA 4B1RA 2R7TA 4IPAA 1QA6A 1R4NB 3H9JA 3S32A 5ED4A 3DU5A 3RZDJ 4UVCA 4IQJA 3QYFA 4ITVA 2DOFA 3FXOA 2UXXA 5E79C 1FWZA 2EV5A 2XDVA 1BIAA 3HOSA 1BW5A 3AG4H 3CCYA 2PMHA 3P9CA 1ZTRA 2DA3A 1LVKA 1KGSA 2EFPA 2JA6J 3BC8A 2MFZA 5H6QA 4DW6A 2BOLA 3J7AY 2XF5A 3W6KB 3Q0WA 4IOAF 1FTZA 4G6DA 1J0RA 3WHCA 1OCRH 1DU6A 5KNLA 4U0YA 1FMWA 1FIAA 2FOWA 3BTLA 4DNCA 3JSPA 2HS5A 2V1XA 3HDDA 1FBUA 1GVJA 4YRVA 3FHZA 3ZOBA 2D5VA 1IDZA 2XUBA 2UXNA 3T0YA 1V54H 2JUGA 4TV7A 5JHFA 1J5YA 4IHVA 2KRCA 1EH8A 1MH4A 4GYGA 1UHMA 1X19A 5FLVA 4BJ5C 4HPQA 9ANTA 1GDTA 1YFHA 3G1OA 3H92A 1HF0A 3EPZA 4L0YB 5F04A 2DMQA 3BOQA 1Y8RB 2XAUA 2FX0A 2KP6A 2M34A 2H8RA 4HYEA 5HDNA 2JN6A 5IT9K 2FQ3A 2ESHA 2Z5UA 4O5VA 3T8RA 3FKJA 2HVQA 3MZ8A 4AVZA 5M5XJ 1TT0A 2A5YB 3EETA 3IKVA 1WPKA 2GA2A 1IRGA 3CDIA 3LA2A 2HQ5A 3BG6A 2VBXA 3FK6A 2A6HF 2E19A 2CWEA 3FKIJ 2XC7A 1DU0A 4FQGA 3W6JB 1LNWA 1I27A 2L7ZA 2ZC2A 5FD5A 1NH3A 2Y30A 3J81K 2ME0A 2LKPA 2WC2A 3CJQB 4PGHA 4CH7A 1Y0UA 1O4XA 3I64A 4WXDA 1MKMA 4L9TA 3FMQA 3KIOA 2VOPA 1U2WA 2O03A 4XKVA 4DYCA 1QGPA 1FT9A 3CC4I 3S1MJ 3PUFA 2F4MB 3DCFA 4IVNA 4ZYDA 2DYRH 2ISZA 4CZZA 2HXOA 3KETA 1RPWA 2QKMB 4C30A 4ZYHA 2LNBA 5J1UA 2IP2A 1DUXC 2JRMA 3IRQA 3OYCA 5DTDA 5F1RA 1AU7A 1B9MA 1TP4A 2EZLA 3HZJA 3SZGA 2VJ5A 4MQ9F 1PUFA 3K1NA 3MKZA 1T98A 3OYFA 1GUUA 3ZQIA 1ZRCA 1DPRA 4M71A 2ZMEB 2E5NA 2K4JA 4BQQA 2Y0MA 3K7AJ 1DGRM 4Y3OA 1VQ8I 4AUXA 2HEOA 4C2MJ 1KU9A 5E1ZB 4QLCU 3A0BC 2KQRA 2OCEA 1XMAA 2RC4A 5E3OA 2LKXA 3ECOA 3KZYA 1I3AA 2GOMA 3G1LA 3GFIA 3K70D 5DEQA 1JTYA 1T33A 1X1DA 2R4GA 2WADA 5LEJA 2QBYB 1SFOJ 2V1UA 3OV8A 2VQCA 5KCMA 4G94A 1G6NA 2NVXJ 4FT8A 3LA7A 4NC7A 1TBXA 4AC0A 4HF0A 2FA5A 3H1CA 3OYMA 2DFHA 2IXSA 3IH4A 1MSFC 3M8FA 3E0JB 1SANA 2R5YA 1YQAA 3FDYA 4E70A 2F6CA 1SAUA 4A3IJ 4KJZA 1WSUA 3JREA 1K4TA 1DPUA 4EQQA 3E6MA 5AONA 3MAJA 2PBIA 2QVOA 3P9IA 2N8GA 4I0AA 4XLPF 5FB2A 1S72I 3CZ6A 4MEYF 4L5EA 4P1WA 1TLHB 3S8PA 4B09A 4U88A 3IAM2 4HQEA 4AYBN 4OINF 1ZELA 2VC1A 3JRAA 2VE8A 4EMSA 4ZTJA 1VFCA 4HAMA 5HS9A 5LGNA 2E1MC 4HSRA 3KX2A 2JA8J 3RSNA 2XGXA 1RI7A 2JUCA 2A3SA 4CICA 5K7HA 1Y56A 2HQNA 1YS6A 2QKLB 1B4AA 1OCZH 3RDIA 1A6QA 2CO5A 1MIJA 2M5WA 5E3MA 4LLNA 2VONA 3KEYA 2E7WA 2VODA 1RETA 1X1AA 5L3BA 3HSRA 2LRDA 4M6VA 2RREA 1Z6RA 3R4KA 3P7NA 2O7OA 5LEKA 4OOIA 4CYDA 3WTVC 4CYCA 2K27A 4KFCA 2MH9A 2ZXJA 1UMQA 3WU2C 4HNUA 3WTWC 5IOZA 3RQ4A 1UG0A 1ZG1A 5J3LA 2O6GE 4Y52J 3SEQA 1K78B 1R6RA 1XG1A 4HQMA 3PIPF 4BHCA 3OL4A 3N05A 2TDXA 4YIFA 6PAXA 1V4RA 4E7IA 2I5UA 4IZZA 1RUNA 2FEZA 3QAHA 4UUTA 5M5YJ 4G7OF 3H5AA 4LG0A 3ISPA 2R7QA 3BDDA 2HYFA 3RYPA 2R7SA 5EYRA 1VQOI 4ZDLA 3AG1H 3ZGKA 3PFYA 3G73A 4KIGA 5JFRA 2IW5A 5C44J 4XM3A 3UNGC 1H9GA 4NUBA 4OAZA 1Z7LA 5FJ8J 3RPUD 2QWWA 3IV5A 2FNPA 1RESA 2FSWA 3RTRA 1D0ZA 1NK2P 2K9LA 2OUMA 2CFOA 2HQRA 3CJTB 5KK1A 1BI3A 3BR6A 3PNYA 1WCMJ 4FETA 1WRJA 2EA4A 4Q48A 3S2WA 4II2A 4CCLA 3VWBA 3HOUJ 1DP7P 1JXSA 3BTIA 1BOAA 1IXCA 3JRHA 3GTJJ 2ADUA 1QO0D 4F3QA 3HOYJ 1E2XA 3J80Z 3QYEA 2VT3A 5EGOB 2JPCA 2M8GX 2IA0A 4E4HA 3K70C 1LQ1A 1FPQA 1S3JA 1ON2A 3ULQB 4LB5A 1YJ9I 3F8CA 3K0LA 1MMAA 3KP5A 3KP4A 2OBPA 5L3CA 5CJ9A 4DJAA 1WZ2A 2OV7A 2XV4S 2V9PA 3ML6A 1IV8A 2LMDA 2VC0A 3BZCA 4U7DA 3K6GA 2DFIA 3ZCOA 1ENHA 4IHWA 1D0XA 3Q9SA 1TNTA 3HSFA 5K5QA 3U9GA 3ZQQA 3S14J 2HI3A 1K61A 5FKKA 2BY3A 4DOZA 2K02A 1CF7A 3E7LA 2BVMA 1R5ID 3F3XA 2ACJA 3ERMA 1ETKA 2OC6A 2R7OA 3WHBA 2IAIA 1ETOA 2HOSA 2OTLI 4M72A 4MGRA 3NQOA 4MFDA 3KCCA 1TWFJ 2LBFA 1Z7UA 4IEJA 1YOVB 4ZZLA 2IJLA 5F27A 4XSXF 1R49A 2HDDA 2ECBA 4D5CA 2R5YB 1WWXA 3MN2A 2GXAA 4LOCA 3K4KA 2GLOA 3E5UA 3H35A 4LFUA 1JHHA 3I3LA 3GXOA 1JJ6C 1L0OC 5IYDJ 2BW3B 1BM9A 3DLAA 3L9FA 3HOZJ 2E5ZA 2M3AA 1EA3A 2E71A 3LFKA 1ULYA 2EJRA 3E5QA 5DD4A 3ZR8X 2STTA 4OIOF 1O7FA 4CCOA 3ABTA 3HRSA 2DFEA 2BYVE 3FBNB 2R3SA 2XGDA 5HLIA 3TO9A 2CV0A 2H94A 1YG2A 2BHZA 2YR2A 4FHTA 4RM3A 4QIWN 4BXUA 2QSGX 3LSIA 2YU9J 3TO7A 2XAHA 1FTTA 1AKHB 1FP1D 2HZDA 1MBJA 1D3YA 4FE7A 2KZGA 2JPBA 4AIJA 2E7XA 4E6KG 1FNNA 1DGWY 5J4VA 2QQ9A 1RNLA 1XS9A 3TDUC 1TNSA 2CW7A 2EIMH 1IDYA 3SJMA 4I01A 1ZQ3P 3KEOA 1G2HA 1VQ4I 1BI0A 4PK4A 3C18A 2HYJA 5L3DA 3LOCA 1MJAA 2LOOA 1ETWA 4RB2C 1ZHFA 4MO7A 5F6FA 3FZVA 5K7FA 5TJJA 3CCVI 3GTOJ 2XAFA 1VNDA 2FJ1A 5E20A 2X4HA 1MNMC 2FRHA 1QQIA 2X6XA 4F92B 1ZG5A 3KFWX 1VQNI 1WQ2A 1FBSA 1I50J 2VB6A 2L9RA 4MQVA 3GFMA 1BN5A 1N75A 5FLXZ 4BYYA 4BGDA 1YTYA 2HFHA 4ZDOA 1IN8A 4NB5A 4I2OA 1ETQA 5CYVA 2W85A 1OFCX 3MMYB 4I09A 2HDWA 4MLOA 3QPLA 2RAEA 2XIGA 2ZSHB 2NOJB 2IGMA 2K9NA 3KPHA 5D5XB 1EF4A 1RKTA 5EDNA 3I71A 3U1DA 1YW7A 1AHDP 2DBBA 3CDLA 3CCEI 3BCAA 4UXNA 1YW8A 2AS5F 3G3ZA 2NNYA 2GBYA 1XDSA 1N25A 3OR2C 1OJLA 5JHUA 2V1NA 3CF5F 1U78A 3DU6A 2Z3YA 1S7AA 4X1EA 1U0JA 1YX3A 2Y31A 3G1MA 3K69A 4RAZA 2KIFA 3RCOA 4KYWA 1E3PA 3PNTA 3S1RJ 3OSGA 2DOAA 1I3QJ 1U6GA 1V5FA 2DODA 2H8WA 3FK7A 3OOPA 5E18F 2FE3A 1LKXA 3IH3A 2DFFA 4I98B 2WB1A 1R9TJ 5E3LA 3F8FA 2VXZA 2XAQA 2Z2SB 2R7RA 3AL0C 3LQQA 3HOWJ 4G6QA 1MDMA 4H0EA 3V7SA 2D1VA 3KEQA 2HOTA 2UZKA 4RAYA 4CUGA 2XRNA 3CUQC 3CCSI 3G6EI 5E1XA 4A3KJ 3HC7A 1JTXA 3IHUA 4BJ6C 2OTJI 2M45A 1BR2A 3VYTB 3OWTA 3U21A 4B3XA 2YX4A 2LY9A 3SYTA 2AXTC 2ZJ2A 3GFLA 4OIQF 1E3OC 1SMYF 4YIIA 2JJ7A 1OCOH 4N9IA 1REPC 2CG4A 2Y75A 1YRNA 3I56I 4WK8F 2R93J 4B43A 2CUJA 4M9SA 3JW4A 1S7OA 2CQKA 1O3QA 1LE8B 3DXJF 1W7PD 3D5RC 2BHYA 1ZR2A 1YHQI 1SAXA 2IS1A 4ENKA 1LB2A 2E2IJ 4PJNA 2QQ8A 2I10A 3F8NA 3L1PA 1A04A 2DI3A 2PX9A 4D9JA 3J7AO 2DK8A 3QPSA 4KMUX 1ZR4A 3KLNA 1O3RA 1LFBA 1T0FC 1I5ZA 4KT5C 1U5TA 1F1ZA 2QM3A 1O3SA 5J8CA 2A6TA 4M74A 4ZYAA 2VI6A 2EFNA 3GEZA 5K7ZA 3O8GA 3HL2A 2P5VA 2NRAC 2XRLA 4RLFA 2LG4A 3CUQA 1Z0XA 4Y7NJ 1RC9A 4HNTA 3F8BA 2QLZA 5DYMA 2DTZA 4ZC3A 2QEXI 2O8KA 4RB0A 1R00A 3ZMSA 4BKXA 3TP0A 4ENMA 1DDNA 3FXKA 5DS9A 2CH0A 4B44A 4JYKA 2PN6A 4CXFA 5J8FA 1QHHD 4X0GA 4C2TA 1HW2A 3RI4A 3NAUA 1X4PA 5DCMB 1UCRA 2F4OB 1XMXA 2K4BA 1HSTA 2EV6A 2QYOA 2WAEA 4MHGA 3GLLA 1K7AA 2FXAA 1PVEA 2KPMA 1IN5A 2O0YA 2LREA 5HLHA 5KAIC 2LH9A 3ERED 4UVAA 3TKYA 3BG3A 3GYHX 4FX4A 5FRNA 4ESBA 2PLYA 1UZCA 2BV6A 2KIQA 4GGGA 2BGCA 2EINH 4EJVA 3EUKL 4XORA 2PFBA 3FXUA 4HX4A 3S1QJ 1T0FA 2DMTA 1ODDA 1ERDA 1XGOA 2EIKH 4D7NA 3Q0UA 2KRHA 2VQHA 1FLIA 1B8IB 2EV0A 1P7IA 2G9WA 4UV8A 3CMYA 3ZQLA 3BZ6A 1AWCA 2P0WA 1ZH5A 4AD9A 3OYAA 3WODF 2LSOA 2X85A 2BZTA 1K83J 1BJAA 2L4AA 1HLVA 1V5GA 3L2VA 3L2RA 3HUGB 4G9YA 5E3NA 1GV5A 5C4JJ 3EQLF 3PM1A 5HDGA 2DOEA 4XOPA 4BU2A 5DUIA 4CO8A 4GCVA 4A3BJ 2ME6A 2CGPA 3Q5FA 3LAPA 2R92J 2QQBA 1J75A 4HW0A 5IP7J 5LHIA 1HSJA 3TP3A 4BE0A 3L7WA 1JGGA 2PI0A 4A5MA 4HV5A 3DV8A 4PJLA 2D45A 1IRXA 2VIXA 3PIOF 1YYVA 1I39A 5FKMA 3I59A 3FM5A 1SVOA 2UUZA 2WAFA 3HRMA 1T08B 3OYHA 3T8TA 2GOXB 1S9HA 1QVUA 5HLGA 3OS2A 2AQFA 4XKBA 3TOBA 5CVJA 4YELA 2KLOA 1HKTA 1O57A 4IRHA 3VPRA 2L4MA 5B5EC 2MYSA 1ZGWA 2RGVA 4AIHA 4G12A 2IRFG 4HG2A 2HKOA 1R58A 3E5XA 3PSIA 2ECCA 4HX7A 3A01A 2VL8A 4EJTA 3NARA 5DCFA 2HGCA 5F0CA 3IP4B 3H5RA 3HM5A 4ENJA 3M8JA 2EIJH 4N0BA 1IG7A 1MDMB 5F64A 2ZFWA 1JHFA 4XRMA 2Z33A 2B9SA 4NQWA 2IGNA 2QGUA 2CW0F 3FXJA 1FY7A 2CW8A 2G7HA 2L3DA 3GBGA 3HXLA 3K4CA 1OYWA 1MD0A 2M1BA 3BR5A 3VYSB 4FCYA 3I4MJ 3AG2H 2DA5A 1F36A 1IW7F 5J6XA 2DLLA 2HWVA 1ZRDA 3JRFA 2EH3A 3DBRB 5F0HA 3WTSC 2R5ZB 5DDGA 3OL3A 4I6ZA 4FISA 3GVAA 4IRGA 1Y39A 3C2BA 1WKMA 1R23A 4XOTA 3CDHA 3SEZA 2ID6A 1BI2A 2H6BA 2PQ8A 3A4CA 2KRFA 3QODA 2NVQJ 4RAGA 2LF7A 4HLYA 2XAJA 2NVUB 3CLQA 3OYLA 2IS6A 3CQZJ 3C2HA 4BQAA 2RQQA 1LJ9A 2JT1A 2A6EF 2HNHA 3PO2J 1W7PA 4LB6B 5BMZA 1T95A 4LIVA 1U5TB 5H2FC 4CCJA 2ZJQF 3RJPA 1XCVA 3H3VK 2GXBA 2D1HA 3R61A 1FEXA 3ABKH 4O6JA 1QBJA 1ZKGA 2OF7A 1ZYRF 5EF6A 2XB5A 3V8JA 1OPCA 3HB9A 1KYZA 4QPOA 4PDKA 2W24A 2YSRA 2ZCWA 1RZ4A 1ONVA 3S93A 1XDUA 1TWGJ 3E6CC 1H89C 1ZARA 4CDGA 2ZO4A 4DGWB 5ERIA 4BJTA 4IOCF 1PP7U 1XPXA 3DLLF 4RB3C 2Z16A 2DO7A 4EATA 4YFNF 1W36D 4YEJA 4BDZA 1MMGA 4ZYEA 1UFMA 5DM7F 5LRRA 1FYLA 2LDUA 3EYIA 4BEHA 4KISA 3G2BA 2L54A 2X6YA 1YW9A 4RLQA 3WGIA 1GXPA 5J4YA 4P9UA 3BQYA 1ZRFA 2JQ7A 1WJDA 4NC6A 4GFBA 2VKVA 2DU9A 1WHUA 2XB0X 4BUPA 4BXFA 2CUZA 4M3GA 2IS4A 2XASA 1SD4A 3RKQA 2TRTA 4QTRA 2XGCA 1VQKI 3E6BA 1OYYA 1KA8A 5LBQA 4BXXJ 3S2HJ 2Q2EA 3B73A 3GW2A 2HOAA 2M87A 4UV9A 1YJWI 3QP5A 3HGYA 2P7CB 4B3AA 2KL4A 4E7SA 2FUG2 3B6AA 1VQPI 5M3FJ 4ANJA 1LVAA 2LY1A 2OCCH 5ICCA 2G7UA 3O8HA 3OIQA 3GZ6A 5CVVA 4P9FA 3GTLJ 3HYIA 5ICFA 4B8XA 4F93B 3W3CA 3JRIA 4R8HA 3IWFA 4XNFA 3A03A 1WI3A 4A5NA 1B72B 1X3WB 4DIQA 2RNGA 4IO9F 1SFXA 3ABMH 3SZPA 3HPGA 4RB1A 2VPRA 2X6OA 3QWLA 4WXCA 2VE9A 2XGEA 4CZCA 2DQRA 4IHXA 2G0EA
chains in the Genus database with same CATH topology
4IEJA 1IC8A 5F27A 2DA1A 1CQTA 5JLXA 3ZQHA 2ECBA 2HDDA 4D5CA 2R5YB 2MW8A 3LSGA 4J19A 3MN2A 4V2GA 2R5ZA 2EZHA 4EEFG 5M3MJ 1TWCJ 4XICA 1YRNB 4LOCA 1MBKA 2GLOA 1BA5A 2CUEA 3BG5A 1A6IA 4S0HB 2LLKA 2KT0A 1JJ6C 5IYDJ 4V2FA 3BR2A 1Q1VA 3HOZJ 1H8AC 5IYBJ 2B63J 1ORKA 2NVTJ 2PMZN 1UG2A 4XRSA 2M2EA 1LFUP 2XGDA 4NDLA 4XIDA 5C3EJ 3BT9A 1XC5A 4QIWN 1U9OA 2YU9J 3PO3J 5IYCJ 4X6AJ 2FQ4A 3D1NI 1Y1WJ 2LVSA 1FTTA 1AKHB 1MBJA 4FE7A 4I76A 4C3HJ 4RBOA 2L7MP 2CUFA 1GV2A 5FKLA 4A69C 1D5YA 3LSRA 1A5JA 4HNVA 3HGGA 3HEFA 3M3YJ 1XS9A 3W6VA 4RDUA 2LR8A 2XPWA 5F0FA 1IDYA 3SJMA 4DYRA 1ZQ3P 2L0KA 4DZPA 1HDDC 1G2HA 1TWHJ 1FIPA 2HYJA 3JRGA 3LOCA 4DZJA 1ETWA 3BG9A 4MO7A 2YS9A 5K7FA 1Y1VJ 3GTOJ 2Y2ZA 2VKEA 1VNDA 2FJ1A 2M9HA 1JKPC 1MNMC 3I4NJ 1I50J 2L9RA 1W0UA 4A3CJ 2JA7J 1JUMA 1ETQA 1OFCX 3SFIA 5EG0A 1BL0A 4JX5A 3QPLA 2RAEA 4MLOA 1ITYA 4M3FA 3ZQCA 4A3MJ 4D5FA 2K9NA 1ETXA 5EGOA 3Q3SA 1RKTA 3GTQJ 4DYQA 2MGQA 2IEKA 5EDNA 1EF4A 2HXIA 1AHDP 1JT0A 2LFBA 3CDLA 4W97A 4C3JJ 2E2HJ 2GBYA 2LD5A 1PUFB 1H88C 4A3EJ 1P7JA 5GP9A 2H1KA 1OJLA 2IBDA 2NS7A 1U78A 2DA4A 4X1EA 4A93J 2AO9A 2Y31A 3BR3A 3G1MA 2OPTA 5F08A 4A3JJ 5M5WJ 2WAQN 4MIMA 3S1RJ 3OSGA 1I3QJ 1IRZA 1VF9A 2X48A 4MFEA 1BW6A 5JLWA 3FK7A 1B72A 2FD5A 2XPVA 2DA6A 3IH3A 4B1RA 1FJLA 4UUSA 1R9TJ 5E3LA 2X9DA 3HOWJ 5J1YA 3FIWA 3RZDJ 1MBEA 2HOTA 2QF7A 3JR9A 3A01B 1BW5A 4A3KJ 1JTXA 3CCYA 1ZTRA 4XRSG 2JMWA 2DA3A 1WGXA 2JA6J 2LY9A 4DW6A 2ZB9A 3F0CA 1E3OC 2DMUA 2JJ7A 1YRNA 3Q0WA 1FTZA 1HCRA 2R93J 4A3GJ 4BY1J 1LE8B 3WHCA 1DU6A 1ZR2A 1FIAA 3BTLA 3ZQGA 2CJJA 5J1RA 2E2IJ 3HDDA 2I10A 3L1PA 3ZOBA 2D5VA 3S16J 1IDZA 2R0QC 3QPSA 4JX6A 1ZR4A 1LFBA 4IHVA 1MH4A 2K9SA 1MBFA 5FLVA 2VI6A 9ANTA 5K7ZA 3O8GA 1GDTA 2XRLA 3G1OA 5F1JA 1HF0A 1Z0XA 2DA7A 5F04A 2DMQA 2EZKA 4Y7NJ 2FX0A 1AKHA 2M34A 2H8RA 2DTZA 3BQZA 1RKWA 2O8KA 1JUSA 3S2DJ 4BKXA 2JN6A 3TP0A 1HDPA 4CYCB 5DS9A 3BR1A 5FKOA 4JYKA 5M5XJ 2R7ZJ 1OCTC 1U9NA 1WPKA 1BJZA 3NAUA 1HOMA 2HQ5A 3FK6A 3BR0A 2LTPA 2E19A 3Q0VA 2JA5J 3JRBA 3OSFA 3FKIJ 1DU0A 4BBSJ 1S7EA 2L7ZA 2Y30A 2ME0A 3BG3A 3S15J 4BBRJ 3GTPJ 1O4XA 5C4XJ 4DYCA 3S1QJ 2DMTA 4D7NA 3Q0UA 3S1MJ 2W48A 3SDGA 1B8IB 3BTJA 3FISA 3IH2A 1P7IA 3CMYA 3DCFA 3ZQLA 2YUSA 2HXOA 2K9QA 1RPWA 4XK4A 2DN0A 5J1UA 1K83J 1HLVA 5DTDA 5E3NA 1AU7A 1GV5A 5C4JJ 3PM1A 2E2JJ 2EZLA 5EEAA 2DMPA 4A3BJ 2ME6A 1PUFA 1JKRC 2R92J 5FLMJ 3QQAA 4W1UA 5IP7J 1GUUA 3TP3A 3ZQIA 1WH7A 1JGGA 4JP0A 2EQRA 3HBLA 1GVDA 4A3FJ 3LSJA 2LK2A 3K7AJ 3RZOJ 4AUXA 2EZIA 1X2NA 2DMNA 5FKMA 4C2MJ 2M0CA 4D7MA 1TC3C 4C3IJ 3K2AA 3MKLA 4FE4A 5E3OA 2LKXA 1JKOC 3S17J 5BNGA 2ELKA 1QVUA 2GM4A 5FKNA 3G1LA 1JTYA 1T33A 5GPCA 1SFOJ 4BY7J 3VPRA 1ZGWA 4G12A 2NVXJ 3GTMJ 1APLC 2ECCA 3A01A 4AC0A 5HODA 3NARA 3IH4A 1MSFC 4IHYA 1SANA 2R5YA 2Y9ZA 1UHSA 5F0CA 3HM5A 1MBHA 1ETYA 4UUSB 4A3IJ 2LP0A 2WB1N 3OIOA 4M3BA 3JREA 4QSHA 1IG7A 2K40A 4XRMA 2N8GA 3A02A 3TW6A 1ETVA 3GBGA 1MH3A 1LE8A 4L5EA 3BR5A 4FCYA 3I4MJ 4AYBN 3TW7A 2Y0SN 4ABZA 2DA5A 1F36A 3JRAA 3RQIA 3JRFA 2EH3A 1VFCA 5F0HA 4B4CA 2JA8J 2R5ZB 3GTKJ 1JJ8C 3JRCA 4I6ZA 1JKQC 3ZQFA 4FISA 2NVYJ 5K7HA 1TWAJ 3LNQA 4A3LJ 1VI0A 3C2BA 3MVPA 2JWTA 5E3MA 2ID6A 1RETA 2NVQJ 4M6VA 3CQZJ 3LSPA 2AHQA 2O7OA 3PO2J 2CQXA 1QPIA 3H0GJ 2DJNA 1QRYA 4CYCA 1MSEC 1UMQA 2NS8A 5IOZA 4Y52J 3B6CA 3JRDA 5J3LA 2VUMJ 1XG1A 3TEDA 3H3VK 1FEXA 1ZKGA 5IP9J 2OF7A 5EF6A 2XB5A 1U8BA 1W0TA 2Y9YA 3HB9A 1I6HJ 5IOYA 3DEWA 4UUTA 5M5YJ 3GTGJ 1JT6A 1MBGA 1TWGJ 1F43A 1H89C 3UKGA 1ZK8A 1IUFA 5EYRA 1RR7A 2COBA 4M3DA 5C44J 5EZHA 1B8IA 5FJ8J 1NTCA 5IPAA 3IV5A 4A3DJ 1RESA 1QVTA 2E1OA 1NK2P 2EBIA 2L7FP 2MSYA 1IJWC 3BQYA 2XSDC 4GFBA 1X2MA 2ID3A 2VKVA 1JUPA 3BR6A 5IP6A 3HOXJ 1WCMJ 2JK3A 2XB0X 4M3GA 3HOUJ 5EG0B 2DA2A 3BTIA 3JRHA 3RKQA 2TRTA 4QTRA 2XGCA 3GTJJ 1Z77A 2QCOA 3HOYJ 1X58A 1OCPA 1NK3P 5EGOB 4BXXJ 2M8GX 1WH5A 3S2HJ 2CU7A 2HOAA 1T56A 3HGYA 2O9LA 4B3AA 2CRGA 3OOUA 1GT0C 3BTCA 1POGA 3B6AA 2TCTA 5GPAA 5M3FJ 2MG4A 3O8HA 3GTLJ 1ENHA 4IHWA 3JRIA 2CQQA 2P81A 3A03A 4JX4A 1WI3A 2WV1A 1B72B 3HOVJ 2KDZA 3S14J 2XPUA 2HI3A 1K61A 5FKKA 3E7LA 5EZGA 3M4OJ 1ETKA 3S1NJ 3WHBA 2VPRA 2X6OA 2IAIA 1ETOA 2HOSA 2XGEA 4FTHA 2NOGA 1IGNA 4MFDA 4IHXA 2G0EA 1TWFJ 4M3EA 1IV6A 3HKZN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEJ A;  1IC8 A;  5F27 A;  2DA1 A;  1CQT A;  5JLX A;  3ZQH A;  2ECB A;  2HDD A;  4D5C A;  2R5Y B;  2MW8 A;  3LSG A;  4J19 A;  3MN2 A;  4V2G A;  2R5Z A;  2EZH A;  4EEF G;  5M3M J;  1TWC J;  4XIC A;  1YRN B;  4LOC A;  1MBK A;  2GLO A;  1BA5 A;  2CUE A;  3BG5 A;  1A6I A;  4S0H B;  2LLK A;  2KT0 A;  1JJ6 C;  5IYD J;  4V2F A;  3BR2 A;  1Q1V A;  3HOZ J;  1H8A C;  5IYB J;  2B63 J;  1ORK A;  2NVT J;  2PMZ N;  1UG2 A;  4XRS A;  2M2E A;  1LFU P;  2XGD A;  4NDL A;  4XID A;  5C3E J;  3BT9 A;  1XC5 A;  4QIW N;  1U9O A;  2YU9 J;  3PO3 J;  5IYC J;  4X6A J;  2FQ4 A;  3D1N I;  1Y1W J;  2LVS A;  1FTT A;  1AKH B;  1MBJ A;  4FE7 A;  4I76 A;  4C3H J;  4RBO A;  2L7M P;  2CUF A;  1GV2 A;  5FKL A;  4A69 C;  1D5Y A;  3LSR A;  1A5J A;  4HNV A;  3HGG A;  3HEF A;  3M3Y J;  1XS9 A;  3W6V A;  4RDU A;  2LR8 A;  2XPW A;  5F0F A;  1IDY A;  3SJM A;  4DYR A;  1ZQ3 P;  2L0K A;  4DZP A;  1HDD C;  1G2H A;  1TWH J;  1FIP A;  2HYJ A;  3JRG A;  3LOC A;  4DZJ A;  1ETW A;  3BG9 A;  4MO7 A;  2YS9 A;  5K7F A;  1Y1V J;  3GTO J;  2Y2Z A;  2VKE A;  1VND A;  2FJ1 A;  2M9H A;  1JKP C;  1MNM C;  3I4N J;  1I50 J;  2L9R A;  1W0U A;  4A3C J;  2JA7 J;  1JUM A;  1ETQ A;  1OFC X;  3SFI A;  5EG0 A;  1BL0 A;  4JX5 A;  3QPL A;  2RAE A;  4MLO A;  1ITY A;  4M3F A;  3ZQC A;  4A3M J;  4D5F A;  2K9N A;  1ETX A;  5EGO A;  3Q3S A;  1RKT A;  3GTQ J;  4DYQ A;  2MGQ A;  2IEK A;  5EDN A;  1EF4 A;  2HXI A;  1AHD P;  1JT0 A;  2LFB A;  3CDL A;  4W97 A;  4C3J J;  2E2H J;  2GBY A;  2LD5 A;  1PUF B;  1H88 C;  4A3E J;  1P7J A;  5GP9 A;  2H1K A;  1OJL A;  2IBD A;  2NS7 A;  1U78 A;  2DA4 A;  4X1E A;  4A93 J;  2AO9 A;  2Y31 A;  3BR3 A;  3G1M A;  2OPT A;  5F08 A;  4A3J J;  5M5W J;  2WAQ N;  4MIM A;  3S1R J;  3OSG A;  1I3Q J;  1IRZ A;  1VF9 A;  2X48 A;  4MFE A;  1BW6 A;  5JLW A;  3FK7 A;  1B72 A;  2FD5 A;  2XPV A;  2DA6 A;  3IH3 A;  4B1R A;  1FJL A;  4UUS A;  1R9T J;  5E3L A;  2X9D A;  3HOW J;  5J1Y A;  3FIW A;  3RZD J;  1MBE A;  2HOT A;  2QF7 A;  3JR9 A;  3A01 B;  1BW5 A;  4A3K J;  1JTX A;  3CCY A;  1ZTR A;  4XRS G;  2JMW A;  2DA3 A;  1WGX A;  2JA6 J;  2LY9 A;  4DW6 A;  2ZB9 A;  3F0C A;  1E3O C;  2DMU A;  2JJ7 A;  1YRN A;  3Q0W A;  1FTZ A;  1HCR A;  2R93 J;  4A3G J;  4BY1 J;  1LE8 B;  3WHC A;  1DU6 A;  1ZR2 A;  1FIA A;  3BTL A;  3ZQG A;  2CJJ A;  5J1R A;  2E2I J;  3HDD A;  2I10 A;  3L1P A;  3ZOB A;  2D5V A;  3S16 J;  1IDZ A;  2R0Q C;  3QPS A;  4JX6 A;  1ZR4 A;  1LFB A;  4IHV A;  1MH4 A;  2K9S A;  1MBF A;  5FLV A;  2VI6 A;  9ANT A;  5K7Z A;  3O8G A;  1GDT A;  2XRL A;  3G1O A;  5F1J A;  1HF0 A;  1Z0X A;  2DA7 A;  5F04 A;  2DMQ A;  2EZK A;  4Y7N J;  2FX0 A;  1AKH A;  2M34 A;  2H8R A;  2DTZ A;  3BQZ A;  1RKW A;  2O8K A;  1JUS A;  3S2D J;  4BKX A;  2JN6 A;  3TP0 A;  1HDP A;  4CYC B;  5DS9 A;  3BR1 A;  5FKO A;  4JYK A;  5M5X J;  2R7Z J;  1OCT C;  1U9N A;  1WPK A;  1BJZ A;  3NAU A;  1HOM A;  2HQ5 A;  3FK6 A;  3BR0 A;  2LTP A;  2E19 A;  3Q0V A;  2JA5 J;  3JRB A;  3OSF A;  3FKI J;  1DU0 A;  4BBS J;  1S7E A;  2L7Z A;  2Y30 A;  2ME0 A;  3BG3 A;  3S15 J;  4BBR J;  3GTP J;  1O4X A;  5C4X J;  4DYC A;  3S1Q J;  2DMT A;  4D7N A;  3Q0U A;  3S1M J;  2W48 A;  3SDG A;  1B8I B;  3BTJ A;  3FIS A;  3IH2 A;  1P7I A;  3CMY A;  3DCF A;  3ZQL A;  2YUS A;  2HXO A;  2K9Q A;  1RPW A;  4XK4 A;  2DN0 A;  5J1U A;  1K83 J;  1HLV A;  5DTD A;  5E3N A;  1AU7 A;  1GV5 A;  5C4J J;  3PM1 A;  2E2J J;  2EZL A;  5EEA A;  2DMP A;  4A3B J;  2ME6 A;  1PUF A;  1JKR C;  2R92 J;  5FLM J;  3QQA A;  4W1U A;  5IP7 J;  1GUU A;  3TP3 A;  3ZQI A;  1WH7 A;  1JGG A;  4JP0 A;  2EQR A;  3HBL A;  1GVD A;  4A3F J;  3LSJ A;  2LK2 A;  3K7A J;  3RZO J;  4AUX A;  2EZI A;  1X2N A;  2DMN A;  5FKM A;  4C2M J;  2M0C A;  4D7M A;  1TC3 C;  4C3I J;  3K2A A;  3MKL A;  4FE4 A;  5E3O A;  2LKX A;  1JKO C;  3S17 J;  5BNG A;  2ELK A;  1QVU A;  2GM4 A;  5FKN A;  3G1L A;  1JTY A;  1T33 A;  5GPC A;  1SFO J;  4BY7 J;  3VPR A;  1ZGW A;  4G12 A;  2NVX J;  3GTM J;  1APL C;  2ECC A;  3A01 A;  4AC0 A;  5HOD A;  3NAR A;  3IH4 A;  1MSF C;  4IHY A;  1SAN A;  2R5Y A;  2Y9Z A;  1UHS A;  5F0C A;  3HM5 A;  1MBH A;  1ETY A;  4UUS B;  4A3I J;  2LP0 A;  2WB1 N;  3OIO A;  4M3B A;  3JRE A;  4QSH A;  1IG7 A;  2K40 A;  4XRM A;  2N8G A;  3A02 A;  3TW6 A;  1ETV A;  3GBG A;  1MH3 A;  1LE8 A;  4L5E A;  3BR5 A;  4FCY A;  3I4M J;  4AYB N;  3TW7 A;  2Y0S N;  4ABZ A;  2DA5 A;  1F36 A;  3JRA A;  3RQI A;  3JRF A;  2EH3 A;  1VFC A;  5F0H A;  4B4C A;  2JA8 J;  2R5Z B;  3GTK J;  1JJ8 C;  3JRC A;  4I6Z A;  1JKQ C;  3ZQF A;  4FIS A;  2NVY J;  5K7H A;  1TWA J;  3LNQ A;  4A3L J;  1VI0 A;  3C2B A;  3MVP A;  2JWT A;  5E3M A;  2ID6 A;  1RET A;  2NVQ J;  4M6V A;  3CQZ J;  3LSP A;  2AHQ A;  2O7O A;  3PO2 J;  2CQX A;  1QPI A;  3H0G J;  2DJN A;  1QRY A;  4CYC A;  1MSE C;  1UMQ A;  2NS8 A;  5IOZ A;  4Y52 J;  3B6C A;  3JRD A;  5J3L A;  2VUM J;  1XG1 A;  3TED A;  3H3V K;  1FEX A;  1ZKG A;  5IP9 J;  2OF7 A;  5EF6 A;  2XB5 A;  1U8B A;  1W0T A;  2Y9Y A;  3HB9 A;  1I6H J;  5IOY A;  3DEW A;  4UUT A;  5M5Y J;  3GTG J;  1JT6 A;  1MBG A;  1TWG J;  1F43 A;  1H89 C;  3UKG A;  1ZK8 A;  1IUF A;  5EYR A;  1RR7 A;  2COB A;  4M3D A;  5C44 J;  5EZH A;  1B8I A;  5FJ8 J;  1NTC A;  5IPA A;  3IV5 A;  4A3D J;  1RES A;  1QVT A;  2E1O A;  1NK2 P;  2EBI A;  2L7F P;  2MSY A;  1IJW C;  3BQY A;  2XSD C;  4GFB A;  1X2M A;  2ID3 A;  2VKV A;  1JUP A;  3BR6 A;  5IP6 A;  3HOX J;  1WCM J;  2JK3 A;  2XB0 X;  4M3G A;  3HOU J;  5EG0 B;  2DA2 A;  3BTI A;  3JRH A;  3RKQ A;  2TRT A;  4QTR A;  2XGC A;  3GTJ J;  1Z77 A;  2QCO A;  3HOY J;  1X58 A;  1OCP A;  1NK3 P;  5EGO B;  4BXX J;  2M8G X;  1WH5 A;  3S2H J;  2CU7 A;  2HOA A;  1T56 A;  3HGY A;  2O9L A;  4B3A A;  2CRG A;  3OOU A;  1GT0 C;  3BTC A;  1POG A;  3B6A A;  2TCT A;  5GPA A;  5M3F J;  2MG4 A;  3O8H A;  3GTL J;  1ENH A;  4IHW A;  3JRI A;  2CQQ A;  2P81 A;  3A03 A;  4JX4 A;  1WI3 A;  2WV1 A;  1B72 B;  3HOV J;  2KDZ A;  3S14 J;  2XPU A;  2HI3 A;  1K61 A;  5FKK A;  3E7L A;  5EZG A;  3M4O J;  1ETK A;  3S1N J;  3WHB A;  2VPR A;  2X6O A;  2IAI A;  1ETO A;  2HOS A;  2XGE A;  4FTH A;  2NOG A;  1IGN A;  4MFD A;  4IHX A;  2G0E A;  1TWF J;  4M3E A;  1IV6 A;  3HKZ N; 
#chains in the Genus database with same CATH topology
 3GME A;  5JR3 A;  2DA1 A;  3F21 A;  4GO1 A;  3ZQH A;  3K10 A;  5BOX A;  1R1U A;  3LSG A;  2X1E A;  3CTA A;  2HTJ A;  1UAA A;  5HS7 A;  4NQW B;  2CUE A;  2ICW G;  1A6I A;  1KON A;  2LLK A;  3S3N A;  4L0Z B;  2F5D A;  2Z1D A;  2HPM A;  3WE2 A;  3ASO H;  1Y8Q B;  1Q1V A;  4MEX F;  5IYB J;  2B63 J;  2K9M A;  2Q8K A;  3DPT A;  2KIS A;  3D0S A;  2XKO A;  1KQ8 A;  5FLX K;  2LF8 A;  4AU7 A;  3IC7 A;  2DDA A;  3AKZ A;  1UG2 A;  2NVT J;  2NNN A;  4WWC A;  4KN7 X;  3I4P A;  1LFU P;  3D5S C;  3HSE A;  3ELK A;  5DV5 A;  4JOM A;  2BVL A;  4NDL A;  2XSJ C;  3K2Z A;  1W5T A;  4XID A;  3TBI A;  5E1W A;  1FSH A;  4DBQ A;  4CSW A;  2QZ8 A;  3PO3 J;  4BE2 A;  3I58 A;  5IYC J;  5ILV A;  2KJC A;  3CCQ I;  5TRD A;  2LVS A;  1FBQ A;  1IXR C;  3S3O A;  1X4O A;  4C3H J;  2A68 F;  2ZBK A;  1Z67 A;  4A69 C;  1D5Y A;  1W36 C;  4BH9 A;  4HNV A;  2V26 A;  4EJU A;  5E17 F;  3TO6 A;  2ZNZ A;  1Q1H A;  2P6S A;  3BZK A;  2IGK A;  5A2Q K;  2XPW A;  2VJJ A;  3TDZ C;  2HKX A;  1MMS A;  3IL2 A;  4HA8 A;  5D4R A;  2HYG D;  1TWH J;  3HIF A;  4XMY A;  1D0Y A;  4IHT A;  3BG9 A;  4AID A;  3MD2 A;  2YS9 A;  1WJF A;  2ELH A;  2VQL A;  3E3V A;  2Y2Z A;  3VOE A;  3ZPL A;  2PJR A;  4Z2Y A;  2M9H A;  3CCM I;  2QA4 I;  3I4N J;  4EV0 A;  1USS A;  5HS8 A;  5D5U B;  2ZJR F;  3V8K A;  1SVM A;  1B59 A;  4P96 A;  1Z6T A;  3I54 A;  3LA3 A;  4NNJ A;  1W0U A;  1X3U A;  3IUO A;  3BCB A;  2JA7 J;  1D5V A;  5EG0 A;  1BL0 A;  4JX5 A;  2W82 A;  4BEH B;  1ITY A;  3Q9V A;  3ZQC A;  2WAQ A;  4A3M J;  1U3E M;  2HTS A;  1K6O A;  4DYQ A;  2HXI A;  3C1D A;  1T2K A;  4HX8 A;  4W97 A;  3OS1 A;  1XN7 A;  1YJN I;  1TQI A;  2E2H J;  4EM0 B;  2GWR A;  3CCL I;  4KIT B;  1PUF B;  1H88 C;  5FO5 A;  4ZDP A;  1P7J A;  4A3E J;  3AG3 H;  4XLC A;  4BAY A;  5IT9 Z;  3GFJ A;  2DA4 A;  3DPL C;  5DM6 F;  1I6X A;  3BR3 A;  1RIO H;  2IVM A;  3RPQ A;  5F08 A;  2MC3 A;  3QPH A;  4A3J J;  2WAQ N;  4MIM A;  4M9X A;  2R7F A;  3AAF A;  2FD5 A;  4XN3 A;  2DA6 A;  2A69 F;  2M7A A;  3ZN1 A;  2OZ6 A;  2X9D A;  5FFX A;  2X0L A;  5D6E A;  3WTT C;  3FIW A;  1E3H A;  1FOK A;  3QOP A;  2QF7 A;  2XVC A;  3SQN A;  4RGU A;  2MH2 A;  2LY2 A;  3WTU C;  3FXR A;  2Y0S A;  4IQ4 A;  1KQ0 A;  4XRS G;  3A1Y A;  4PFP A;  1WGX A;  2DK5 A;  4C2U A;  4EGY A;  2HPI A;  2E1C A;  1O7L A;  2ZB9 A;  3JAM Z;  1P92 A;  1XGN A;  3CJR B;  3F0C A;  1A36 A;  1D8K A;  4ETS A;  4HOB A;  4A3G J;  3RKW A;  1X1C A;  3AFH A;  4XN0 A;  1LDK B;  2NS0 A;  4BQO A;  2L01 A;  4C9Y A;  1QPM A;  3GZN B;  1MJB A;  3D5L A;  3ZQG A;  1IN4 A;  2CJJ A;  5J1R A;  1GLN A;  4PUS A;  5L3F A;  3S16 J;  2R7V A;  1HW1 A;  3BJO A;  2X1C A;  2EIL H;  3WTZ A;  4AM3 A;  1UJ8 A;  5D6F A;  2VJ4 A;  4Y17 A;  3MCZ A;  1YIT I;  1WVR A;  4PJM A;  5BS6 A;  5IY5 H;  3MKY B;  4A0X A;  1F5T A;  2V9V A;  1FSE A;  1SD6 A;  2L7K A;  2VT2 A;  3V7C A;  2O61 A;  1P4X A;  5F1J A;  2L5Q A;  3KP7 A;  4E7Z A;  3DF8 A;  2CV2 A;  2DQL A;  4A6E A;  3QPT A;  1RKW A;  2VN2 A;  1JUS A;  3S2D J;  4I02 A;  2EFQ A;  1T39 A;  4CYC B;  1VQ7 I;  1UST A;  5J47 A;  5FKO A;  1CGP A;  5HNH A;  3R60 A;  1S6L A;  3M07 A;  1BJZ A;  1HOM A;  1HW5 A;  3TGN A;  3BR0 A;  1TTY A;  4E7L A;  2LTP A;  1G3T A;  2HOE A;  3JRB A;  3FX3 A;  3OSF A;  3L00 A;  4BBS J;  3J7Y J;  4EM2 A;  4K2E A;  1B9N A;  2E1M B;  2V6C A;  4XLE A;  4LG0 B;  3GTP J;  4DQ2 A;  4D0P A;  1K4S A;  5C4X J;  3M8E A;  2ZFU A;  2K86 A;  4JQF A;  1KU7 A;  1HBX G;  3WG9 A;  4BL0 B;  3BPX A;  3SDG A;  2BY0 A;  3BY6 A;  1BR1 A;  1J2X A;  2A61 A;  3IH2 A;  3RIR A;  1V3F A;  1R5H A;  1WJC A;  2JSC A;  4UVB A;  2YUS A;  4L5J A;  5FRO A;  2E60 A;  2K9Q A;  1KZH A;  4XK4 A;  2PJR B;  2WBM A;  1D1B A;  3VB2 A;  1P4A A;  1STZ A;  1TL8 A;  1G3W A;  3ABU A;  4I0B A;  4CCK A;  2V6E A;  4N9H A;  3PQJ A;  2E2J J;  1JI8 A;  3RPU A;  3OMY A;  1JGS A;  1WFX A;  2DMP A;  3PNV A;  2RVC A;  4KDP A;  1QZZ A;  3KYD B;  3QQA A;  4W1U A;  4P55 A;  2F5C A;  2EQR A;  3GCM A;  1GVD A;  3JCU C;  2LK2 A;  3CMM A;  5FD6 A;  1WJ5 A;  2DMN A;  1XGM A;  2P6T A;  2NAZ A;  2VLA A;  2K5C A;  3ECH A;  3WTY C;  4D7M A;  2W57 A;  3K2A A;  3MKL A;  2ZJP F;  4FE4 A;  2XF7 A;  1JKO C;  1PP8 F;  3S17 J;  1E0E A;  2A5W A;  4EVI A;  3MQ0 A;  5BNG A;  1FMV A;  3LSM A;  1FX7 A;  4LJZ F;  1IRF A;  3W2A A;  4OWR B;  5GPC A;  1BIB A;  3K1M A;  4BY7 J;  2XRO A;  2HDC A;  4HF2 A;  3HKZ A;  3COA C;  3PUB A;  1TQP A;  5HOD A;  4OIR F;  3CMA I;  1BBY A;  2HVS A;  2P4W A;  2QUF A;  2QSF X;  3H5N A;  1UHS A;  3CME I;  1VQ6 I;  3CCJ I;  1CF7 B;  1OCC H;  2LYC A;  3K9T A;  1WJB A;  2LP0 A;  2WB1 N;  3OY9 A;  3KP2 A;  4QSH A;  2ESN A;  2OD5 A;  4CCM A;  2K40 A;  5CVR A;  3TQN A;  2ISY A;  2X1D A;  3PSF A;  2UV1 A;  1ETV A;  4GYI A;  2LBF B;  5B1A H;  3BWG A;  4ABZ A;  4Z6Y A;  2KMU A;  3IAS 2;  3RQI A;  4ZJZ A;  2PMZ A;  2DT5 A;  3GTK J;  2F48 A;  1J59 A;  1JJ8 C;  2R7W A;  2K7L A;  1OMI A;  2KZV A;  2WY7 Q;  1X1B A;  4LIU A;  1JE8 A;  2H1L A;  1JKQ C;  3ZQF A;  3S3M A;  3BPV A;  3OYK A;  3N97 A;  3LAJ A;  1V55 H;  2EK5 A;  3DBH B;  3N4M A;  4ZH4 F;  5KAF C;  2O5R A;  1VI0 A;  3DQV C;  5HNF A;  4BAC A;  1PDN C;  2AQE A;  3MVP A;  4PJ0 C;  4IL6 C;  2JWT A;  2BY1 A;  3I53 A;  5JI6 A;  4KNY A;  3KZI C;  4RM2 A;  1SD5 A;  3KP3 A;  2JZY A;  4U0W A;  2F5F A;  3X2Q H;  1G8X A;  2HQA A;  2AHQ A;  2W25 A;  1D8J A;  3H0G J;  2DJN A;  3CUO A;  5GTH C;  3F23 A;  5CVU A;  4XRF A;  1MSE C;  2NS8 A;  1P6R A;  1N77 A;  1K79 A;  3OYB A;  3B6C A;  3HHG A;  2V4J C;  3K4N A;  3HRT A;  3I55 I;  4KMF A;  4KA4 A;  3TED A;  3V7R A;  5GAD J;  4QWQ A;  4JBA A;  2VOO A;  1AA7 A;  4RGS A;  4EJW A;  1Z3Y A;  1W0T A;  2Y9Y A;  2ZME C;  1I6H J;  5IOY A;  4DBR A;  2VXD A;  1LEB A;  1UB9 A;  3GTG J;  2MD5 A;  1JT6 A;  1MBG A;  4G8X A;  1F43 A;  2HZT A;  1Z1D A;  3OYI A;  3DFG A;  1ZN2 A;  4KIC A;  3L2Q A;  3F9K A;  4U0V A;  2FBK A;  3H9G A;  3ONQ A;  4L9J A;  3IKT A;  2QSH X;  2E1N A;  3JTH A;  2GAU A;  2COB A;  4ESF A;  3QRF F;  5EZH A;  2RDP A;  2BXY A;  3OYD A;  2OZU A;  3CC2 I;  3DEU A;  4XON A;  3F72 A;  1QVT A;  2E1O A;  2FNA A;  1Y0N A;  2UWM A;  4HEA 2;  3HRU A;  2BE5 F;  1XSX A;  2XSD C;  1X2M A;  2ID3 A;  3DWL E;  4HLX A;  2ZKZ A;  2L9S A;  1JUP A;  3QOE A;  1NG6 A;  2NYX A;  2JK3 A;  3ZMT A;  2DJI A;  4OAY A;  4XL9 A;  4UUV A;  4CA0 A;  2JTV A;  2JRT A;  3A2K A;  1PJR A;  1Z77 A;  2QCO A;  3WE3 A;  2ZME A;  1OCP A;  2K85 A;  4J00 A;  3MZY A;  1ON1 A;  1WH5 A;  3ABL H;  4YIR X;  1YLF A;  4XBF A;  3FWE A;  2M30 A;  1HKQ A;  4Y33 A;  5K5O A;  2O9L A;  2CRG A;  3OOU A;  2FMY A;  1BC7 C;  1GT0 C;  3BTC A;  5CPR B;  1POG A;  4YFK F;  2TCT A;  3EUA A;  5GPA A;  2MG4 A;  2QBY A;  5JVG F;  3RYR A;  2E34 A;  2CQQ A;  2P81 A;  3CO7 C;  3HOV J;  2GA1 A;  2KDZ A;  2XPU A;  1IN6 A;  2EA2 A;  5EZG A;  1YIJ I;  1J7K A;  3ZXS A;  4NHJ A;  3L2U A;  2RQP A;  3ZMU A;  1YI2 I;  2W84 A;  3O3K A;  3R0A A;  4M3E A;  2VQG A;  4EJO A;  1XSD A;  3CC7 I;  1IC8 A;  4O3M A;  2OAZ A;  2COM A;  5CVI A;  3C7J A;  1CQT A;  2HR3 A;  2Y48 A;  2MW8 A;  5EEH A;  3NWT A;  3H0D A;  3MWM A;  2JSP A;  4J19 A;  3VEP A;  4V2G A;  5ILS A;  4N4N B;  5M3M J;  3DKX A;  1Z3X A;  4L9N A;  1TWC J;  1YRN B;  2IS2 A;  1BR4 A;  3WGH A;  3HOT A;  2RN7 A;  3BG5 A;  3KZZ A;  3ZMD A;  3MFK A;  3K1P A;  3BR2 A;  1R1T A;  2GQQ A;  1ZG3 A;  4IKF A;  1M1E B;  1OR7 C;  1B1B A;  1W1W E;  2L9V A;  4HZF A;  3CO6 C;  3O6B B;  2XHK A;  4XLA A;  3TOA A;  2DXI A;  2MLG A;  4XRS A;  1VQM I;  2M2E A;  1TW3 A;  2DTR A;  1B6A A;  3SFZ A;  2H27 A;  3AL0 B;  4LG3 A;  3BJ6 A;  3OR1 C;  3T1B A;  3J80 K;  3LMM A;  1HQC A;  5C3E J;  2P8T A;  3KYL A;  1KU3 A;  1U9O A;  1K78 A;  3CF2 A;  3ZP5 A;  3CUQ B;  3BJA A;  4X6A J;  1NHA A;  1Y1W J;  3O2P E;  2VBW A;  3E1S A;  3BG7 A;  3QU3 A;  4I76 A;  3WG7 H;  4YFX F;  2JA2 A;  2L7M P;  4M6X A;  3U1K A;  1GV2 A;  5FKL A;  3LSR A;  3SHF A;  1A5J A;  3W2V A;  4WX9 A;  3FM3 A;  3H9Q A;  1KYW A;  4E7H A;  3M3Y J;  1FOW A;  4EM1 A;  2OJE D;  1FOY A;  2LR8 A;  5F0F A;  2IPQ X;  4DYR A;  2EB7 A;  1FC3 A;  5HOO A;  3QP6 A;  3R0J A;  2L0K A;  1HDD C;  2EFW A;  3V8L A;  4N4O B;  3JRG A;  4XR6 A;  4DZJ A;  1VTN C;  2ZNY A;  1XB4 A;  1OR7 A;  4P5O A;  3FMS A;  1SEU A;  1MND A;  1Y1V J;  4R79 A;  3VSL A;  4RMN A;  1JKP C;  1VQL I;  2DCE A;  2EWN A;  1IXS B;  2WTE A;  3CCR I;  4LK1 F;  1LDJ A;  1RRJ A;  3JSO A;  4PSW A;  4FAS D;  1C0W A;  4Y15 A;  5E8I A;  1ZGJ A;  1DP3 A;  1Z05 A;  4XKC A;  4IXA A;  4A3C J;  4CHU A;  1JUM A;  1N78 A;  3SFI A;  4XSZ F;  3VDX A;  3JAM K;  1IN7 A;  2KIM A;  4M3F A;  1R71 A;  4D5F A;  2BXZ A;  1A35 A;  1ETX A;  5EGO A;  3Q3S A;  3GTQ J;  1R36 A;  2FF4 A;  2MGQ A;  2IEK A;  2HVR A;  2VKD A;  4RA2 A;  4RGX A;  3GO5 A;  2H6C A;  4G6T B;  4HDV A;  2LD5 A;  1EH6 A;  5GP9 A;  4L5I A;  4LLG F;  2IBD A;  3GWZ A;  2WY8 Q;  3MZH A;  2KFD A;  2Q0O A;  4A93 J;  1I1G A;  4WXH A;  1IAW A;  4E7K A;  2VKH A;  1EV7 A;  3I59 B;  1IRZ A;  1VF9 A;  2X48 A;  2GIZ A;  4MFE A;  3U2R A;  3L2W A;  2R7D A;  2XPV A;  3ZN0 A;  1XGS A;  4BDY A;  1SVL A;  1FJL A;  2M4G A;  4IJA A;  3M1E A;  4UUS A;  1TW2 A;  1MJ9 A;  5J1Y A;  4HDU A;  3F6V A;  1MBE A;  1G3S A;  1P2F A;  2V1D A;  2A07 F;  3LST A;  3MEX A;  1OIS A;  3BLY A;  3JR9 A;  4F91 B;  1VQ5 I;  2YU3 A;  3GX4 X;  5B3S H;  3A01 B;  1MW7 A;  4AYB A;  3ZQ7 A;  3GZ5 A;  5LGU A;  3MKW B;  3ZRG A;  2JMW A;  2NXN B;  1PYV A;  2PMU A;  3OS0 A;  5LRS A;  3LFU A;  5LHH A;  3WU0 A;  1XX5 A;  3L09 A;  2DMU A;  2XF6 A;  2YPR A;  1HCR A;  1G59 A;  2OU2 A;  2WA0 A;  4BY1 J;  1IF1 A;  1K6Y A;  3LQR A;  4PSX A;  2P5L C;  2A05 A;  3DKY A;  1RR8 C;  2K3F A;  2MA3 A;  2BW3 A;  5BPD A;  3I5U A;  3NEU A;  2KHM A;  4ZZD A;  3WTX C;  5LFA A;  2Q1Z B;  1X1P A;  4U87 A;  1XD7 A;  4A2U A;  2CYY A;  2R0Q C;  3K4M A;  4JX6 A;  3SDB A;  2ZSI B;  1HC8 A;  5AIQ A;  1Z91 A;  3P5J A;  1FZP B;  2D2W A;  1QZE A;  2K9S A;  2VJI A;  4F55 A;  1MBF A;  3DTI A;  4A12 A;  4M6Y A;  1DQU A;  5D4S A;  1PUE E;  4KIB A;  2DA7 A;  3CP8 A;  4UB8 C;  4CGZ A;  2EZK A;  3I0T A;  1AKH A;  1HA8 A;  5CLS A;  4KT6 A;  3BQZ A;  5J40 A;  3HJE A;  2M8E A;  1W7P B;  2X6W A;  1ZLJ A;  3PQK A;  1HDP A;  1P9Q C;  5FRM A;  2BEO A;  3BR1 A;  1EH7 A;  1XMK A;  1MMN A;  1E17 A;  1TT5 B;  3OYN A;  5KHD A;  2E35 A;  1OCT C;  2R7Z J;  1U9N A;  2LKS A;  5CQE A;  5TGT A;  5ILU A;  4UY8 I;  4LK0 F;  3CJN A;  3QU6 A;  1Z9C A;  2PG4 A;  2STW A;  5ICE A;  3Q0V A;  5DUK A;  2JA5 J;  1UHW A;  2X51 A;  4LD5 A;  3VOD A;  1P4W A;  1S7E A;  1SFU A;  4Q47 A;  4E7J A;  4Y4R A;  5L3E A;  1D1A A;  2ZXW H;  3S15 J;  1SC7 A;  4BBR J;  3M9A A;  3WU1 B;  3DBL B;  1YS7 A;  2DT6 A;  2JVH A;  3EDP A;  2OQG A;  2OA4 A;  3P9K A;  4UNO A;  2W48 A;  2M4K A;  3DTE A;  3BTJ A;  3FIS A;  5FGM A;  2ELJ A;  1LPQ A;  3TL4 X;  4UHT A;  2R7U A;  1VZ0 A;  4D1Q A;  2DN0 A;  3V42 A;  4RS8 A;  3T5X A;  5FFZ A;  4LLL A;  1QHG A;  1ZGA A;  5HLT A;  4A0Y A;  3CCU I;  2I8D A;  5EEA A;  4NBQ A;  1EJ9 A;  4HF1 A;  1SMT A;  2KIU A;  1EKE A;  2J5P A;  1JKR C;  5FLM J;  1FYM A;  4OMZ A;  1WH7 A;  4GRI A;  4JP0 A;  3HBL A;  5D5V B;  3VYU B;  4A3F J;  1W5C C;  3LSJ A;  5GAH J;  2WWY A;  4ESJ A;  3RZO J;  3NWS A;  2Q2E B;  2EZI A;  1X2N A;  2V7F A;  3ZMZ A;  4IF4 A;  4G7Z F;  5B66 C;  2M0C A;  1LFP A;  1W5S A;  1TC3 C;  4C3I J;  5BPI A;  5D8K B;  4M9Z A;  4PZJ A;  2ZXH A;  2FOK A;  2ELK A;  4EGZ A;  2GM4 A;  2W1O A;  5FKN A;  4R1H A;  5HVQ C;  3J81 Z;  2FBI A;  3K4L A;  4WCG A;  2CQ7 A;  3E97 A;  5H6R A;  4FX0 A;  3CLO A;  4CCN A;  1BC8 C;  3GTM J;  1APL C;  1GHC A;  2Z9O A;  2CMP A;  3I9V 2;  1OLT A;  4IHY A;  2Y9Z A;  3G4S I;  4L18 B;  2VBY A;  4UUS B;  1MBH A;  1ETY A;  1SFE A;  1IO2 A;  1UEL B;  3OIO A;  3PFI A;  4M3B A;  2W4S A;  3OIP A;  2IT0 A;  1HKS A;  2CV1 A;  2DAO A;  3RKY A;  2GZW A;  3CP2 A;  3A02 A;  3H3U A;  3TW6 A;  1OQY A;  1MH3 A;  1LE8 A;  1KU2 A;  2EPF A;  3TW7 A;  2Y0S N;  3DP7 A;  2L2O A;  1AOY A;  4RGR A;  5DD8 A;  2MBF A;  5TIS C;  3ZMV A;  3NRV A;  4B4C A;  3R6S A;  2JVG A;  3JRC A;  3JTG A;  2L02 A;  1S29 A;  3W2W A;  4BS9 A;  2KKO A;  1H9T A;  4A0Z A;  2NVY J;  4YG2 F;  1U8R A;  1TWA J;  3LNQ A;  3TMO A;  1J9I A;  4A3L J;  4JK1 X;  4IHS A;  1VQ9 I;  2OQR A;  3FXM A;  4LGW A;  1S5L C;  2EFO A;  4XLH A;  2FBH A;  3LSP A;  4LMY A;  1OKR A;  2CQX A;  3OYJ A;  1LEA A;  4PFO A;  4G7H F;  1QPI A;  5K1Y A;  2C6Y A;  1QRY A;  4H4K C;  4PCQ A;  3HPH A;  4I99 C;  4MTE A;  2PEX A;  1Z21 A;  2MD0 A;  5KVR A;  1J09 A;  3JRD A;  2RNJ A;  3DPU A;  3VSK A;  4QPQ A;  1IZ1 A;  3KE2 A;  1MMD A;  3M1C A;  1XCB A;  3J7Z I;  2VUM J;  1LUJ B;  5DCM A;  4RDU A;  2CSO A;  2GXG A;  5IP9 J;  2Z99 A;  3LWF A;  1U8B A;  5B1B H;  5LD2 C;  3FHN A;  2DW4 A;  3DEW A;  1R4M B;  5H20 A;  4UB6 C;  1WJE A;  1XTA A;  2F2E A;  3LSK A;  3C2G A;  2HU9 A;  1LDD A;  4WF2 A;  3G71 I;  4GDF A;  2VAS A;  3UKG A;  1R7J A;  3HHH A;  1G3Y A;  1ZK8 A;  1IUF A;  2E36 A;  3KP6 A;  3KLO A;  2FML A;  2O3F A;  1RR7 A;  4M3D A;  5LLQ A;  2DT7 B;  4RBO A;  1B8I A;  3HG9 A;  4KIF A;  2RV8 A;  1NTC A;  2O8X A;  5IPA A;  1V5E A;  4A3D J;  4XKW A;  2ZXI A;  3PL8 A;  1KQ9 A;  2EBI A;  2L7F P;  2KJB A;  4HBL A;  3H3Z A;  1QU3 A;  3EUH C;  1F9N A;  1L3L A;  2MSY A;  3FF5 A;  2Y69 H;  1IJW C;  4OMY A;  3HUG A;  3ROU A;  3FXL A;  5D5W B;  4IX7 A;  2P7V B;  3DEE A;  4S05 A;  3HTU A;  3HOX J;  5IP6 A;  2MC4 A;  3REO A;  5EEG A;  1FP2 A;  4F52 A;  4BHB A;  2VBZ A;  2DYS H;  5EG0 B;  2DA2 A;  1S8N A;  1X58 A;  1NK3 P;  2IA2 A;  1A31 A;  4S04 A;  4HRI A;  2CU7 A;  3QYB A;  1T56 A;  1TZL A;  3GF2 A;  1ZLK A;  3PJR A;  1YIO A;  3VFZ A;  5ICG A;  2P5K A;  5CKT A;  5CQG A;  4MNU A;  2K3P A;  3CD6 I;  4Y13 A;  1T38 A;  1MNE A;  5A2Q Z;  1I1S A;  2MLK A;  2RKH A;  3F22 A;  2LC2 A;  2QQA A;  4JX4 A;  2F5V A;  2WV1 A;  3OYG A;  3KYC B;  5BQT A;  3BRO A;  2DDB A;  5E8G A;  3EUH A;  3FXQ A;  1Y6I A;  4NC8 A;  4AVP A;  3M4O J;  3V4G A;  2H09 A;  1U5T C;  3S1N J;  2CFX A;  4BNC A;  2V79 A;  2XAG A;  5GAG J;  4FTH A;  2NOG A;  3GLX A;  1IGN A;  2F4I A;  3M7G A;  1FYK A;  4XQF A;  1IV6 A;  3HTS B;  1QNT A;  3HKZ N;  4ZTF A;  1YO5 C;  3RKX A;  2BBY A;  2V9K A;  1ZAO A;  5JLX A;  1NG7 A;  3L2C A;  4IRI A;  4KN4 X;  1F4K A;  1TQM A;  4KUM A;  3BP8 A;  1T8I A;  1W4M A;  1R1V A;  2R5Z A;  2M0M A;  2EZH A;  4EEF G;  1HXD A;  4XIC A;  1MBK A;  1BA5 A;  4HV6 A;  1QZY A;  3F8M A;  2IGO A;  2M7B A;  3FMR A;  4S0H B;  3LSH A;  4XLN F;  4A6D A;  2KT0 A;  2GIV A;  4V2F A;  1T6S A;  2IA1 A;  3F6O A;  4ON0 A;  1H8A C;  1ACI A;  3C3W A;  4J01 A;  2AXL A;  4L9V A;  4XLF A;  2WV0 A;  2DPD A;  1ORK A;  3CES A;  2L9N A;  2QEN A;  2BY2 A;  2PMZ N;  1R22 A;  1MGT A;  2B7E A;  3A0H C;  3K4B A;  2W7N A;  5K5R A;  2FU4 A;  2KDO A;  1ZRE A;  1WJA A;  1FOX A;  3BT9 A;  1XC5 A;  2B0L A;  1MZB A;  4OIP F;  4V19 K;  2MAB A;  5D8L B;  2FQ4 A;  3D1N I;  4BE1 A;  4GXO A;  2CUF A;  1X3Z B;  1SD7 A;  5IT3 A;  2ETH A;  3H36 A;  3SXY A;  4B47 A;  1G4D A;  3HGG A;  4AIK A;  3HEF A;  3W6V A;  2F5E A;  3ESW B;  3E6D A;  5JVT A;  4DZP A;  5EJC A;  5GAE J;  1FIP A;  1H0M A;  4LIT A;  3K4J A;  4BQN A;  1D1C A;  2VPL A;  1OYI A;  3IWZ A;  2CQN A;  4M73 A;  4HST A;  1WI9 A;  2W00 A;  2VKE A;  4OU0 A;  5LGT A;  1XSV A;  4B48 A;  4ASN A;  3WGG A;  3FBI B;  4PJJ A;  1RUO A;  3VYR B;  2DPU A;  2CS3 A;  2PJP A;  2YX7 A;  4ENN A;  2R7X A;  2J5O A;  1YE9 A;  2XKP A;  3DKW A;  4Q5S F;  4RAF A;  1GXQ A;  3ASN H;  1SFK A;  4U7B A;  5L3G A;  3DTK A;  4MTD A;  3EYY A;  1JT0 A;  2LFB A;  4C3J J;  3OYE A;  1BI1 A;  3B02 A;  4AWX B;  5HDK A;  1IUY A;  4I7H A;  5LHG A;  1R5G A;  5GTI C;  3SZT A;  3UR3 C;  4BHP A;  2H1K A;  2NS7 A;  1YX5 A;  2AO9 A;  3GUD A;  2OPT A;  5M5W J;  1O3T A;  4PGG A;  3LL7 A;  5JLW A;  1BW6 A;  1B72 A;  4Q4Z F;  4ZYG A;  4F7Z A;  4II3 A;  3IRR A;  1BOB A;  5AIP A;  4B1R A;  2R7T A;  4IPA A;  1QA6 A;  1R4N B;  3H9J A;  3S32 A;  5ED4 A;  3DU5 A;  3RZD J;  4UVC A;  4IQJ A;  3QYF A;  4ITV A;  2DOF A;  3FXO A;  2UXX A;  5E79 C;  1FWZ A;  2EV5 A;  2XDV A;  1BIA A;  3HOS A;  1BW5 A;  3AG4 H;  3CCY A;  2PMH A;  3P9C A;  1ZTR A;  2DA3 A;  1LVK A;  1KGS A;  2EFP A;  2JA6 J;  3BC8 A;  2MFZ A;  5H6Q A;  4DW6 A;  2BOL A;  3J7A Y;  2XF5 A;  3W6K B;  3Q0W A;  4IOA F;  1FTZ A;  4G6D A;  1J0R A;  3WHC A;  1OCR H;  1DU6 A;  5KNL A;  4U0Y A;  1FMW A;  1FIA A;  2FOW A;  3BTL A;  4DNC A;  3JSP A;  2HS5 A;  2V1X A;  3HDD A;  1FBU A;  1GVJ A;  4YRV A;  3FHZ A;  3ZOB A;  2D5V A;  1IDZ A;  2XUB A;  2UXN A;  3T0Y A;  1V54 H;  2JUG A;  4TV7 A;  5JHF A;  1J5Y A;  4IHV A;  2KRC A;  1EH8 A;  1MH4 A;  4GYG A;  1UHM A;  1X19 A;  5FLV A;  4BJ5 C;  4HPQ A;  9ANT A;  1GDT A;  1YFH A;  3G1O A;  3H92 A;  1HF0 A;  3EPZ A;  4L0Y B;  5F04 A;  2DMQ A;  3BOQ A;  1Y8R B;  2XAU A;  2FX0 A;  2KP6 A;  2M34 A;  2H8R A;  4HYE A;  5HDN A;  2JN6 A;  5IT9 K;  2FQ3 A;  2ESH A;  2Z5U A;  4O5V A;  3T8R A;  3FKJ A;  2HVQ A;  3MZ8 A;  4AVZ A;  5M5X J;  1TT0 A;  2A5Y B;  3EET A;  3IKV A;  1WPK A;  2GA2 A;  1IRG A;  3CDI A;  3LA2 A;  2HQ5 A;  3BG6 A;  2VBX A;  3FK6 A;  2A6H F;  2E19 A;  2CWE A;  3FKI J;  2XC7 A;  1DU0 A;  4FQG A;  3W6J B;  1LNW A;  1I27 A;  2L7Z A;  2ZC2 A;  5FD5 A;  1NH3 A;  2Y30 A;  3J81 K;  2ME0 A;  2LKP A;  2WC2 A;  3CJQ B;  4PGH A;  4CH7 A;  1Y0U A;  1O4X A;  3I64 A;  4WXD A;  1MKM A;  4L9T A;  3FMQ A;  3KIO A;  2VOP A;  1U2W A;  2O03 A;  4XKV A;  4DYC A;  1QGP A;  1FT9 A;  3CC4 I;  3S1M J;  3PUF A;  2F4M B;  3DCF A;  4IVN A;  4ZYD A;  2DYR H;  2ISZ A;  4CZZ A;  2HXO A;  3KET A;  1RPW A;  2QKM B;  4C30 A;  4ZYH A;  2LNB A;  5J1U A;  2IP2 A;  1DUX C;  2JRM A;  3IRQ A;  3OYC A;  5DTD A;  5F1R A;  1AU7 A;  1B9M A;  1TP4 A;  2EZL A;  3HZJ A;  3SZG A;  2VJ5 A;  4MQ9 F;  1PUF A;  3K1N A;  3MKZ A;  1T98 A;  3OYF A;  1GUU A;  3ZQI A;  1ZRC A;  1DPR A;  4M71 A;  2ZME B;  2E5N A;  2K4J A;  4BQQ A;  2Y0M A;  3K7A J;  1DGR M;  4Y3O A;  1VQ8 I;  4AUX A;  2HEO A;  4C2M J;  1KU9 A;  5E1Z B;  4QLC U;  3A0B C;  2KQR A;  2OCE A;  1XMA A;  2RC4 A;  5E3O A;  2LKX A;  3ECO A;  3KZY A;  1I3A A;  2GOM A;  3G1L A;  3GFI A;  3K70 D;  5DEQ A;  1JTY A;  1T33 A;  1X1D A;  2R4G A;  2WAD A;  5LEJ A;  2QBY B;  1SFO J;  2V1U A;  3OV8 A;  2VQC A;  5KCM A;  4G94 A;  1G6N A;  2NVX J;  4FT8 A;  3LA7 A;  4NC7 A;  1TBX A;  4AC0 A;  4HF0 A;  2FA5 A;  3H1C A;  3OYM A;  2DFH A;  2IXS A;  3IH4 A;  1MSF C;  3M8F A;  3E0J B;  1SAN A;  2R5Y A;  1YQA A;  3FDY A;  4E70 A;  2F6C A;  1SAU A;  4A3I J;  4KJZ A;  1WSU A;  3JRE A;  1K4T A;  1DPU A;  4EQQ A;  3E6M A;  5AON A;  3MAJ A;  2PBI A;  2QVO A;  3P9I A;  2N8G A;  4I0A A;  4XLP F;  5FB2 A;  1S72 I;  3CZ6 A;  4MEY F;  4L5E A;  4P1W A;  1TLH B;  3S8P A;  4B09 A;  4U88 A;  3IAM 2;  4HQE A;  4AYB N;  4OIN F;  1ZEL A;  2VC1 A;  3JRA A;  2VE8 A;  4EMS A;  4ZTJ A;  1VFC A;  4HAM A;  5HS9 A;  5LGN A;  2E1M C;  4HSR A;  3KX2 A;  2JA8 J;  3RSN A;  2XGX A;  1RI7 A;  2JUC A;  2A3S A;  4CIC A;  5K7H A;  1Y56 A;  2HQN A;  1YS6 A;  2QKL B;  1B4A A;  1OCZ H;  3RDI A;  1A6Q A;  2CO5 A;  1MIJ A;  2M5W A;  5E3M A;  4LLN A;  2VON A;  3KEY A;  2E7W A;  2VOD A;  1RET A;  1X1A A;  5L3B A;  3HSR A;  2LRD A;  4M6V A;  2RRE A;  1Z6R A;  3R4K A;  3P7N A;  2O7O A;  5LEK A;  4OOI A;  4CYD A;  3WTV C;  4CYC A;  2K27 A;  4KFC A;  2MH9 A;  2ZXJ A;  1UMQ A;  3WU2 C;  4HNU A;  3WTW C;  5IOZ A;  3RQ4 A;  1UG0 A;  1ZG1 A;  5J3L A;  2O6G E;  4Y52 J;  3SEQ A;  1K78 B;  1R6R A;  1XG1 A;  4HQM A;  3PIP F;  4BHC A;  3OL4 A;  3N05 A;  2TDX A;  4YIF A;  6PAX A;  1V4R A;  4E7I A;  2I5U A;  4IZZ A;  1RUN A;  2FEZ A;  3QAH A;  4UUT A;  5M5Y J;  4G7O F;  3H5A A;  4LG0 A;  3ISP A;  2R7Q A;  3BDD A;  2HYF A;  3RYP A;  2R7S A;  5EYR A;  1VQO I;  4ZDL A;  3AG1 H;  3ZGK A;  3PFY A;  3G73 A;  4KIG A;  5JFR A;  2IW5 A;  5C44 J;  4XM3 A;  3UNG C;  1H9G A;  4NUB A;  4OAZ A;  1Z7L A;  5FJ8 J;  3RPU D;  2QWW A;  3IV5 A;  2FNP A;  1RES A;  2FSW A;  3RTR A;  1D0Z A;  1NK2 P;  2K9L A;  2OUM A;  2CFO A;  2HQR A;  3CJT B;  5KK1 A;  1BI3 A;  3BR6 A;  3PNY A;  1WCM J;  4FET A;  1WRJ A;  2EA4 A;  4Q48 A;  3S2W A;  4II2 A;  4CCL A;  3VWB A;  3HOU J;  1DP7 P;  1JXS A;  3BTI A;  1BOA A;  1IXC A;  3JRH A;  3GTJ J;  2ADU A;  1QO0 D;  4F3Q A;  3HOY J;  1E2X A;  3J80 Z;  3QYE A;  2VT3 A;  5EGO B;  2JPC A;  2M8G X;  2IA0 A;  4E4H A;  3K70 C;  1LQ1 A;  1FPQ A;  1S3J A;  1ON2 A;  3ULQ B;  4LB5 A;  1YJ9 I;  3F8C A;  3K0L A;  1MMA A;  3KP5 A;  3KP4 A;  2OBP A;  5L3C A;  5CJ9 A;  4DJA A;  1WZ2 A;  2OV7 A;  2XV4 S;  2V9P A;  3ML6 A;  1IV8 A;  2LMD A;  2VC0 A;  3BZC A;  4U7D A;  3K6G A;  2DFI A;  3ZCO A;  1ENH A;  4IHW A;  1D0X A;  3Q9S A;  1TNT A;  3HSF A;  5K5Q A;  3U9G A;  3ZQQ A;  3S14 J;  2HI3 A;  1K61 A;  5FKK A;  2BY3 A;  4DOZ A;  2K02 A;  1CF7 A;  3E7L A;  2BVM A;  1R5I D;  3F3X A;  2ACJ A;  3ERM A;  1ETK A;  2OC6 A;  2R7O A;  3WHB A;  2IAI A;  1ETO A;  2HOS A;  2OTL I;  4M72 A;  4MGR A;  3NQO A;  4MFD A;  3KCC A;  1TWF J;  2LBF A;  1Z7U A;  4IEJ A;  1YOV B;  4ZZL A;  2IJL A;  5F27 A;  4XSX F;  1R49 A;  2HDD A;  2ECB A;  4D5C A;  2R5Y B;  1WWX A;  3MN2 A;  2GXA A;  4LOC A;  3K4K A;  2GLO A;  3E5U A;  3H35 A;  4LFU A;  1JHH A;  3I3L A;  3GXO A;  1JJ6 C;  1L0O C;  5IYD J;  2BW3 B;  1BM9 A;  3DLA A;  3L9F A;  3HOZ J;  2E5Z A;  2M3A A;  1EA3 A;  2E71 A;  3LFK A;  1ULY A;  2EJR A;  3E5Q A;  5DD4 A;  3ZR8 X;  2STT A;  4OIO F;  1O7F A;  4CCO A;  3ABT A;  3HRS A;  2DFE A;  2BYV E;  3FBN B;  2R3S A;  2XGD A;  5HLI A;  3TO9 A;  2CV0 A;  2H94 A;  1YG2 A;  2BHZ A;  2YR2 A;  4FHT A;  4RM3 A;  4QIW N;  4BXU A;  2QSG X;  3LSI A;  2YU9 J;  3TO7 A;  2XAH A;  1FTT A;  1AKH B;  1FP1 D;  2HZD A;  1MBJ A;  1D3Y A;  4FE7 A;  2KZG A;  2JPB A;  4AIJ A;  2E7X A;  4E6K G;  1FNN A;  1DGW Y;  5J4V A;  2QQ9 A;  1RNL A;  1XS9 A;  3TDU C;  1TNS A;  2CW7 A;  2EIM H;  1IDY A;  3SJM A;  4I01 A;  1ZQ3 P;  3KEO A;  1G2H A;  1VQ4 I;  1BI0 A;  4PK4 A;  3C18 A;  2HYJ A;  5L3D A;  3LOC A;  1MJA A;  2LOO A;  1ETW A;  4RB2 C;  1ZHF A;  4MO7 A;  5F6F A;  3FZV A;  5K7F A;  5TJJ A;  3CCV I;  3GTO J;  2XAF A;  1VND A;  2FJ1 A;  5E20 A;  2X4H A;  1MNM C;  2FRH A;  1QQI A;  2X6X A;  4F92 B;  1ZG5 A;  3KFW X;  1VQN I;  1WQ2 A;  1FBS A;  1I50 J;  2VB6 A;  2L9R A;  4MQV A;  3GFM A;  1BN5 A;  1N75 A;  5FLX Z;  4BYY A;  4BGD A;  1YTY A;  2HFH A;  4ZDO A;  1IN8 A;  4NB5 A;  4I2O A;  1ETQ A;  5CYV A;  2W85 A;  1OFC X;  3MMY B;  4I09 A;  2HDW A;  4MLO A;  3QPL A;  2RAE A;  2XIG A;  2ZSH B;  2NOJ B;  2IGM A;  2K9N A;  3KPH A;  5D5X B;  1EF4 A;  1RKT A;  5EDN A;  3I71 A;  3U1D A;  1YW7 A;  1AHD P;  2DBB A;  3CDL A;  3CCE I;  3BCA A;  4UXN A;  1YW8 A;  2AS5 F;  3G3Z A;  2NNY A;  2GBY A;  1XDS A;  1N25 A;  3OR2 C;  1OJL A;  5JHU A;  2V1N A;  3CF5 F;  1U78 A;  3DU6 A;  2Z3Y A;  1S7A A;  4X1E A;  1U0J A;  1YX3 A;  2Y31 A;  3G1M A;  3K69 A;  4RAZ A;  2KIF A;  3RCO A;  4KYW A;  1E3P A;  3PNT A;  3S1R J;  3OSG A;  2DOA A;  1I3Q J;  1U6G A;  1V5F A;  2DOD A;  2H8W A;  3FK7 A;  3OOP A;  5E18 F;  2FE3 A;  1LKX A;  3IH3 A;  2DFF A;  4I98 B;  2WB1 A;  1R9T J;  5E3L A;  3F8F A;  2VXZ A;  2XAQ A;  2Z2S B;  2R7R A;  3AL0 C;  3LQQ A;  3HOW J;  4G6Q A;  1MDM A;  4H0E A;  3V7S A;  2D1V A;  3KEQ A;  2HOT A;  2UZK A;  4RAY A;  4CUG A;  2XRN A;  3CUQ C;  3CCS I;  3G6E I;  5E1X A;  4A3K J;  3HC7 A;  1JTX A;  3IHU A;  4BJ6 C;  2OTJ I;  2M45 A;  1BR2 A;  3VYT B;  3OWT A;  3U21 A;  4B3X A;  2YX4 A;  2LY9 A;  3SYT A;  2AXT C;  2ZJ2 A;  3GFL A;  4OIQ F;  1E3O C;  1SMY F;  4YII A;  2JJ7 A;  1OCO H;  4N9I A;  1REP C;  2CG4 A;  2Y75 A;  1YRN A;  3I56 I;  4WK8 F;  2R93 J;  4B43 A;  2CUJ A;  4M9S A;  3JW4 A;  1S7O A;  2CQK A;  1O3Q A;  1LE8 B;  3DXJ F;  1W7P D;  3D5R C;  2BHY A;  1ZR2 A;  1YHQ I;  1SAX A;  2IS1 A;  4ENK A;  1LB2 A;  2E2I J;  4PJN A;  2QQ8 A;  2I10 A;  3F8N A;  3L1P A;  1A04 A;  2DI3 A;  2PX9 A;  4D9J A;  3J7A O;  2DK8 A;  3QPS A;  4KMU X;  1ZR4 A;  3KLN A;  1O3R A;  1LFB A;  1T0F C;  1I5Z A;  4KT5 C;  1U5T A;  1F1Z A;  2QM3 A;  1O3S A;  5J8C A;  2A6T A;  4M74 A;  4ZYA A;  2VI6 A;  2EFN A;  3GEZ A;  5K7Z A;  3O8G A;  3HL2 A;  2P5V A;  2NRA C;  2XRL A;  4RLF A;  2LG4 A;  3CUQ A;  1Z0X A;  4Y7N J;  1RC9 A;  4HNT A;  3F8B A;  2QLZ A;  5DYM A;  2DTZ A;  4ZC3 A;  2QEX I;  2O8K A;  4RB0 A;  1R00 A;  3ZMS A;  4BKX A;  3TP0 A;  4ENM A;  1DDN A;  3FXK A;  5DS9 A;  2CH0 A;  4B44 A;  4JYK A;  2PN6 A;  4CXF A;  5J8F A;  1QHH D;  4X0G A;  4C2T A;  1HW2 A;  3RI4 A;  3NAU A;  1X4P A;  5DCM B;  1UCR A;  2F4O B;  1XMX A;  2K4B A;  1HST A;  2EV6 A;  2QYO A;  2WAE A;  4MHG A;  3GLL A;  1K7A A;  2FXA A;  1PVE A;  2KPM A;  1IN5 A;  2O0Y A;  2LRE A;  5HLH A;  5KAI C;  2LH9 A;  3ERE D;  4UVA A;  3TKY A;  3BG3 A;  3GYH X;  4FX4 A;  5FRN A;  4ESB A;  2PLY A;  1UZC A;  2BV6 A;  2KIQ A;  4GGG A;  2BGC A;  2EIN H;  4EJV A;  3EUK L;  4XOR A;  2PFB A;  3FXU A;  4HX4 A;  3S1Q J;  1T0F A;  2DMT A;  1ODD A;  1ERD A;  1XGO A;  2EIK H;  4D7N A;  3Q0U A;  2KRH A;  2VQH A;  1FLI A;  1B8I B;  2EV0 A;  1P7I A;  2G9W A;  4UV8 A;  3CMY A;  3ZQL A;  3BZ6 A;  1AWC A;  2P0W A;  1ZH5 A;  4AD9 A;  3OYA A;  3WOD F;  2LSO A;  2X85 A;  2BZT A;  1K83 J;  1BJA A;  2L4A A;  1HLV A;  1V5G A;  3L2V A;  3L2R A;  3HUG B;  4G9Y A;  5E3N A;  1GV5 A;  5C4J J;  3EQL F;  3PM1 A;  5HDG A;  2DOE A;  4XOP A;  4BU2 A;  5DUI A;  4CO8 A;  4GCV A;  4A3B J;  2ME6 A;  2CGP A;  3Q5F A;  3LAP A;  2R92 J;  2QQB A;  1J75 A;  4HW0 A;  5IP7 J;  5LHI A;  1HSJ A;  3TP3 A;  4BE0 A;  3L7W A;  1JGG A;  2PI0 A;  4A5M A;  4HV5 A;  3DV8 A;  4PJL A;  2D45 A;  1IRX A;  2VIX A;  3PIO F;  1YYV A;  1I39 A;  5FKM A;  3I59 A;  3FM5 A;  1SVO A;  2UUZ A;  2WAF A;  3HRM A;  1T08 B;  3OYH A;  3T8T A;  2GOX B;  1S9H A;  1QVU A;  5HLG A;  3OS2 A;  2AQF A;  4XKB A;  3TOB A;  5CVJ A;  4YEL A;  2KLO A;  1HKT A;  1O57 A;  4IRH A;  3VPR A;  2L4M A;  5B5E C;  2MYS A;  1ZGW A;  2RGV A;  4AIH A;  4G12 A;  2IRF G;  4HG2 A;  2HKO A;  1R58 A;  3E5X A;  3PSI A;  2ECC A;  4HX7 A;  3A01 A;  2VL8 A;  4EJT A;  3NAR A;  5DCF A;  2HGC A;  5F0C A;  3IP4 B;  3H5R A;  3HM5 A;  4ENJ A;  3M8J A;  2EIJ H;  4N0B A;  1IG7 A;  1MDM B;  5F64 A;  2ZFW A;  1JHF A;  4XRM A;  2Z33 A;  2B9S A;  4NQW A;  2IGN A;  2QGU A;  2CW0 F;  3FXJ A;  1FY7 A;  2CW8 A;  2G7H A;  2L3D A;  3GBG A;  3HXL A;  3K4C A;  1OYW A;  1MD0 A;  2M1B A;  3BR5 A;  3VYS B;  4FCY A;  3I4M J;  3AG2 H;  2DA5 A;  1F36 A;  1IW7 F;  5J6X A;  2DLL A;  2HWV A;  1ZRD A;  3JRF A;  2EH3 A;  3DBR B;  5F0H A;  3WTS C;  2R5Z B;  5DDG A;  3OL3 A;  4I6Z A;  4FIS A;  3GVA A;  4IRG A;  1Y39 A;  3C2B A;  1WKM A;  1R23 A;  4XOT A;  3CDH A;  3SEZ A;  2ID6 A;  1BI2 A;  2H6B A;  2PQ8 A;  3A4C A;  2KRF A;  3QOD A;  2NVQ J;  4RAG A;  2LF7 A;  4HLY A;  2XAJ A;  2NVU B;  3CLQ A;  3OYL A;  2IS6 A;  3CQZ J;  3C2H A;  4BQA A;  2RQQ A;  1LJ9 A;  2JT1 A;  2A6E F;  2HNH A;  3PO2 J;  1W7P A;  4LB6 B;  5BMZ A;  1T95 A;  4LIV A;  1U5T B;  5H2F C;  4CCJ A;  2ZJQ F;  3RJP A;  1XCV A;  3H3V K;  2GXB A;  2D1H A;  3R61 A;  1FEX A;  3ABK H;  4O6J A;  1QBJ A;  1ZKG A;  2OF7 A;  1ZYR F;  5EF6 A;  2XB5 A;  3V8J A;  1OPC A;  3HB9 A;  1KYZ A;  4QPO A;  4PDK A;  2W24 A;  2YSR A;  2ZCW A;  1RZ4 A;  1ONV A;  3S93 A;  1XDU A;  1TWG J;  3E6C C;  1H89 C;  1ZAR A;  4CDG A;  2ZO4 A;  4DGW B;  5ERI A;  4BJT A;  4IOC F;  1PP7 U;  1XPX A;  3DLL F;  4RB3 C;  2Z16 A;  2DO7 A;  4EAT A;  4YFN F;  1W36 D;  4YEJ A;  4BDZ A;  1MMG A;  4ZYE A;  1UFM A;  5DM7 F;  5LRR A;  1FYL A;  2LDU A;  3EYI A;  4BEH A;  4KIS A;  3G2B A;  2L54 A;  2X6Y A;  1YW9 A;  4RLQ A;  3WGI A;  1GXP A;  5J4Y A;  4P9U A;  3BQY A;  1ZRF A;  2JQ7 A;  1WJD A;  4NC6 A;  4GFB A;  2VKV A;  2DU9 A;  1WHU A;  2XB0 X;  4BUP A;  4BXF A;  2CUZ A;  4M3G A;  2IS4 A;  2XAS A;  1SD4 A;  3RKQ A;  2TRT A;  4QTR A;  2XGC A;  1VQK I;  3E6B A;  1OYY A;  1KA8 A;  5LBQ A;  4BXX J;  3S2H J;  2Q2E A;  3B73 A;  3GW2 A;  2HOA A;  2M87 A;  4UV9 A;  1YJW I;  3QP5 A;  3HGY A;  2P7C B;  4B3A A;  2KL4 A;  4E7S A;  2FUG 2;  3B6A A;  1VQP I;  5M3F J;  4ANJ A;  1LVA A;  2LY1 A;  2OCC H;  5ICC A;  2G7U A;  3O8H A;  3OIQ A;  3GZ6 A;  5CVV A;  4P9F A;  3GTL J;  3HYI A;  5ICF A;  4B8X A;  4F93 B;  3W3C A;  3JRI A;  4R8H A;  3IWF A;  4XNF A;  3A03 A;  1WI3 A;  4A5N A;  1B72 B;  1X3W B;  4DIQ A;  2RNG A;  4IO9 F;  1SFX A;  3ABM H;  3SZP A;  3HPG A;  4RB1 A;  2VPR A;  2X6O A;  3QWL A;  4WXC A;  2VE9 A;  2XGE A;  4CZC A;  2DQR A;  4IHX A;  2G0E A; 
#chains in the Genus database with same CATH homology
 4IEJ A;  1IC8 A;  5F27 A;  2DA1 A;  1CQT A;  5JLX A;  3ZQH A;  2ECB A;  2HDD A;  4D5C A;  2R5Y B;  2MW8 A;  3LSG A;  4J19 A;  3MN2 A;  4V2G A;  2R5Z A;  2EZH A;  4EEF G;  5M3M J;  1TWC J;  4XIC A;  1YRN B;  4LOC A;  1MBK A;  2GLO A;  1BA5 A;  2CUE A;  3BG5 A;  1A6I A;  4S0H B;  2LLK A;  2KT0 A;  1JJ6 C;  5IYD J;  4V2F A;  3BR2 A;  1Q1V A;  3HOZ J;  1H8A C;  5IYB J;  2B63 J;  1ORK A;  2NVT J;  2PMZ N;  1UG2 A;  4XRS A;  2M2E A;  1LFU P;  2XGD A;  4NDL A;  4XID A;  5C3E J;  3BT9 A;  1XC5 A;  4QIW N;  1U9O A;  2YU9 J;  3PO3 J;  5IYC J;  4X6A J;  2FQ4 A;  3D1N I;  1Y1W J;  2LVS A;  1FTT A;  1AKH B;  1MBJ A;  4FE7 A;  4I76 A;  4C3H J;  4RBO A;  2L7M P;  2CUF A;  1GV2 A;  5FKL A;  4A69 C;  1D5Y A;  3LSR A;  1A5J A;  4HNV A;  3HGG A;  3HEF A;  3M3Y J;  1XS9 A;  3W6V A;  4RDU A;  2LR8 A;  2XPW A;  5F0F A;  1IDY A;  3SJM A;  4DYR A;  1ZQ3 P;  2L0K A;  4DZP A;  1HDD C;  1G2H A;  1TWH J;  1FIP A;  2HYJ A;  3JRG A;  3LOC A;  4DZJ A;  1ETW A;  3BG9 A;  4MO7 A;  2YS9 A;  5K7F A;  1Y1V J;  3GTO J;  2Y2Z A;  2VKE A;  1VND A;  2FJ1 A;  2M9H A;  1JKP C;  1MNM C;  3I4N J;  1I50 J;  2L9R A;  1W0U A;  4A3C J;  2JA7 J;  1JUM A;  1ETQ A;  1OFC X;  3SFI A;  5EG0 A;  1BL0 A;  4JX5 A;  3QPL A;  2RAE A;  4MLO A;  1ITY A;  4M3F A;  3ZQC A;  4A3M J;  4D5F A;  2K9N A;  1ETX A;  5EGO A;  3Q3S A;  1RKT A;  3GTQ J;  4DYQ A;  2MGQ A;  2IEK A;  5EDN A;  1EF4 A;  2HXI A;  1AHD P;  1JT0 A;  2LFB A;  3CDL A;  4W97 A;  4C3J J;  2E2H J;  2GBY A;  2LD5 A;  1PUF B;  1H88 C;  4A3E J;  1P7J A;  5GP9 A;  2H1K A;  1OJL A;  2IBD A;  2NS7 A;  1U78 A;  2DA4 A;  4X1E A;  4A93 J;  2AO9 A;  2Y31 A;  3BR3 A;  3G1M A;  2OPT A;  5F08 A;  4A3J J;  5M5W J;  2WAQ N;  4MIM A;  3S1R J;  3OSG A;  1I3Q J;  1IRZ A;  1VF9 A;  2X48 A;  4MFE A;  1BW6 A;  5JLW A;  3FK7 A;  1B72 A;  2FD5 A;  2XPV A;  2DA6 A;  3IH3 A;  4B1R A;  1FJL A;  4UUS A;  1R9T J;  5E3L A;  2X9D A;  3HOW J;  5J1Y A;  3FIW A;  3RZD J;  1MBE A;  2HOT A;  2QF7 A;  3JR9 A;  3A01 B;  1BW5 A;  4A3K J;  1JTX A;  3CCY A;  1ZTR A;  4XRS G;  2JMW A;  2DA3 A;  1WGX A;  2JA6 J;  2LY9 A;  4DW6 A;  2ZB9 A;  3F0C A;  1E3O C;  2DMU A;  2JJ7 A;  1YRN A;  3Q0W A;  1FTZ A;  1HCR A;  2R93 J;  4A3G J;  4BY1 J;  1LE8 B;  3WHC A;  1DU6 A;  1ZR2 A;  1FIA A;  3BTL A;  3ZQG A;  2CJJ A;  5J1R A;  2E2I J;  3HDD A;  2I10 A;  3L1P A;  3ZOB A;  2D5V A;  3S16 J;  1IDZ A;  2R0Q C;  3QPS A;  4JX6 A;  1ZR4 A;  1LFB A;  4IHV A;  1MH4 A;  2K9S A;  1MBF A;  5FLV A;  2VI6 A;  9ANT A;  5K7Z A;  3O8G A;  1GDT A;  2XRL A;  3G1O A;  5F1J A;  1HF0 A;  1Z0X A;  2DA7 A;  5F04 A;  2DMQ A;  2EZK A;  4Y7N J;  2FX0 A;  1AKH A;  2M34 A;  2H8R A;  2DTZ A;  3BQZ A;  1RKW A;  2O8K A;  1JUS A;  3S2D J;  4BKX A;  2JN6 A;  3TP0 A;  1HDP A;  4CYC B;  5DS9 A;  3BR1 A;  5FKO A;  4JYK A;  5M5X J;  2R7Z J;  1OCT C;  1U9N A;  1WPK A;  1BJZ A;  3NAU A;  1HOM A;  2HQ5 A;  3FK6 A;  3BR0 A;  2LTP A;  2E19 A;  3Q0V A;  2JA5 J;  3JRB A;  3OSF A;  3FKI J;  1DU0 A;  4BBS J;  1S7E A;  2L7Z A;  2Y30 A;  2ME0 A;  3BG3 A;  3S15 J;  4BBR J;  3GTP J;  1O4X A;  5C4X J;  4DYC A;  3S1Q J;  2DMT A;  4D7N A;  3Q0U A;  3S1M J;  2W48 A;  3SDG A;  1B8I B;  3BTJ A;  3FIS A;  3IH2 A;  1P7I A;  3CMY A;  3DCF A;  3ZQL A;  2YUS A;  2HXO A;  2K9Q A;  1RPW A;  4XK4 A;  2DN0 A;  5J1U A;  1K83 J;  1HLV A;  5DTD A;  5E3N A;  1AU7 A;  1GV5 A;  5C4J J;  3PM1 A;  2E2J J;  2EZL A;  5EEA A;  2DMP A;  4A3B J;  2ME6 A;  1PUF A;  1JKR C;  2R92 J;  5FLM J;  3QQA A;  4W1U A;  5IP7 J;  1GUU A;  3TP3 A;  3ZQI A;  1WH7 A;  1JGG A;  4JP0 A;  2EQR A;  3HBL A;  1GVD A;  4A3F J;  3LSJ A;  2LK2 A;  3K7A J;  3RZO J;  4AUX A;  2EZI A;  1X2N A;  2DMN A;  5FKM A;  4C2M J;  2M0C A;  4D7M A;  1TC3 C;  4C3I J;  3K2A A;  3MKL A;  4FE4 A;  5E3O A;  2LKX A;  1JKO C;  3S17 J;  5BNG A;  2ELK A;  1QVU A;  2GM4 A;  5FKN A;  3G1L A;  1JTY A;  1T33 A;  5GPC A;  1SFO J;  4BY7 J;  3VPR A;  1ZGW A;  4G12 A;  2NVX J;  3GTM J;  1APL C;  2ECC A;  3A01 A;  4AC0 A;  5HOD A;  3NAR A;  3IH4 A;  1MSF C;  4IHY A;  1SAN A;  2R5Y A;  2Y9Z A;  1UHS A;  5F0C A;  3HM5 A;  1MBH A;  1ETY A;  4UUS B;  4A3I J;  2LP0 A;  2WB1 N;  3OIO A;  4M3B A;  3JRE A;  4QSH A;  1IG7 A;  2K40 A;  4XRM A;  2N8G A;  3A02 A;  3TW6 A;  1ETV A;  3GBG A;  1MH3 A;  1LE8 A;  4L5E A;  3BR5 A;  4FCY A;  3I4M J;  4AYB N;  3TW7 A;  2Y0S N;  4ABZ A;  2DA5 A;  1F36 A;  3JRA A;  3RQI A;  3JRF A;  2EH3 A;  1VFC A;  5F0H A;  4B4C A;  2JA8 J;  2R5Z B;  3GTK J;  1JJ8 C;  3JRC A;  4I6Z A;  1JKQ C;  3ZQF A;  4FIS A;  2NVY J;  5K7H A;  1TWA J;  3LNQ A;  4A3L J;  1VI0 A;  3C2B A;  3MVP A;  2JWT A;  5E3M A;  2ID6 A;  1RET A;  2NVQ J;  4M6V A;  3CQZ J;  3LSP A;  2AHQ A;  2O7O A;  3PO2 J;  2CQX A;  1QPI A;  3H0G J;  2DJN A;  1QRY A;  4CYC A;  1MSE C;  1UMQ A;  2NS8 A;  5IOZ A;  4Y52 J;  3B6C A;  3JRD A;  5J3L A;  2VUM J;  1XG1 A;  3TED A;  3H3V K;  1FEX A;  1ZKG A;  5IP9 J;  2OF7 A;  5EF6 A;  2XB5 A;  1U8B A;  1W0T A;  2Y9Y A;  3HB9 A;  1I6H J;  5IOY A;  3DEW A;  4UUT A;  5M5Y J;  3GTG J;  1JT6 A;  1MBG A;  1TWG J;  1F43 A;  1H89 C;  3UKG A;  1ZK8 A;  1IUF A;  5EYR A;  1RR7 A;  2COB A;  4M3D A;  5C44 J;  5EZH A;  1B8I A;  5FJ8 J;  1NTC A;  5IPA A;  3IV5 A;  4A3D J;  1RES A;  1QVT A;  2E1O A;  1NK2 P;  2EBI A;  2L7F P;  2MSY A;  1IJW C;  3BQY A;  2XSD C;  4GFB A;  1X2M A;  2ID3 A;  2VKV A;  1JUP A;  3BR6 A;  5IP6 A;  3HOX J;  1WCM J;  2JK3 A;  2XB0 X;  4M3G A;  3HOU J;  5EG0 B;  2DA2 A;  3BTI A;  3JRH A;  3RKQ A;  2TRT A;  4QTR A;  2XGC A;  3GTJ J;  1Z77 A;  2QCO A;  3HOY J;  1X58 A;  1OCP A;  1NK3 P;  5EGO B;  4BXX J;  2M8G X;  1WH5 A;  3S2H J;  2CU7 A;  2HOA A;  1T56 A;  3HGY A;  2O9L A;  4B3A A;  2CRG A;  3OOU A;  1GT0 C;  3BTC A;  1POG A;  3B6A A;  2TCT A;  5GPA A;  5M3F J;  2MG4 A;  3O8H A;  3GTL J;  1ENH A;  4IHW A;  3JRI A;  2CQQ A;  2P81 A;  3A03 A;  4JX4 A;  1WI3 A;  2WV1 A;  1B72 B;  3HOV J;  2KDZ A;  3S14 J;  2XPU A;  2HI3 A;  1K61 A;  5FKK A;  3E7L A;  5EZG A;  3M4O J;  1ETK A;  3S1N J;  3WHB A;  2VPR A;  2X6O A;  2IAI A;  1ETO A;  2HOS A;  2XGE A;  4FTH A;  2NOG A;  1IGN A;  4MFD A;  4IHX A;  2G0E A;  1TWF J;  4M3E A;  1IV6 A;  3HKZ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...