1VF9A

Solution structure of human trf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
MEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Comparison between TRF2 and TRF1 of their telomeric DNA-bound structures and DNA-binding activities
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Telomeric repeat binding factor 2
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1vf9A00
1VNDA 4ABZA 3DEWA 1W0TA 3TW6A 4B3AA 3O8HA 2FQ4A 2HXOA 3PO2J 5M5XJ 1RPWA 4IEJA 4JX4A 4XK4A 2R5YB 3UKGA 2XRLA 1JTXA 3S1MJ 2CU7A 2RAEA 2DA1A 1VI0A 2NVQJ 1IGNA 3ZQFA 4UUSB 4FCYA 2JWTA 4IHVA 4DYQA 4C2MJ 5JLXA 5FKMA 5IP6A 2IBDA 3QQAA 1GUUA 1ZR4A 1GDTA 2DMTA 3LSPA 4IHWA 1RKWA 3ZQGA 2TRTA 5F0HA 2XPUA 3SDGA 1I6HJ 2JA5J 1NTCA 5FKKA 3MVPA 3JRDA 5C3EJ 3Q3SA 5K7HA 5FLMJ 1BL0A 2Y30A 3BG3A 3S14J 1RESA 4UUTA 2XB0X 5HODA 4A3MJ 4BXXJ 5E3MA 2GBYA 2ELKA 1O4XA 1GVDA 4I6ZA 1TC3C 3GTKJ 4RBOA 3BG9A 2M2EA 1PUFB 4D7MA 1AU7A 3HOYJ 2EBIA 1RKTA 1X2NA 1ETXA 2JMWA 3I4MJ 3JRAA 4M3GA 2Y9ZA 5IOZA 1GV5A 2GM4A 2E19A 2G0EA 3BR0A 5JLWA 2R5ZB 5FKLA 1JKOC 1SFOJ 2YS9A 3FKIJ 3QPSA 4IHYA 1ZK8A 4XICA 1Z77A 2CJJA 3I4NJ 3A01B 1JUPA 1ETKA 1P7JA 2YUSA 3CMYA 4Y52J 1ETYA 2DA6A 3LSRA 3RZDJ 3GTQJ 1XS9A 4DYRA 1QVTA 1FTZA 5E3NA 3HOVJ 3S1RJ 2Y2ZA 2R7ZJ 3BTCA 1BA5A 3HBLA 5FLVA 1EF4A 5DTDA 2IEKA 2W48A 1QVUA 4XRSG 2E2IJ 3VPRA 1T33A 2LFBA 2CQQA 3FISA 3HB9A 1BJZA 4A3JJ 3FK6A 3JRCA 4XRMA 4A3KJ 1JT6A 2DA2A 2ID3A 2L7FP 5F0FA 5C44J 5EF6A 3FK7A 3BG5A 4BKXA 1GV2A 2E2JJ 1R9TJ 2QCOA 1E3OC 2JA6J 1K83J 1LE8B 3RZOJ 3JRFA 5EDNA 1JKQC 3A02A 2IAIA 4QIWN 2WB1N 2HOTA 3S2HJ 3BR2A 1H89C 5IP7J 4Y7NJ 1VF9A 1WH5A 2DA7A 1MSFC 1JT0A 3JREA 2FX0A 4DW6A 4MLOA 5M3MJ 3GBGA 1JKPC 1MBHA 2L9RA 2MW8A 2ECBA 3O8GA 5EG0B 2HOSA 2LR8A 2JJ7A 2MGQA 5IYBJ 4CYCB 3S1NJ 2DMQA 2VI6A 5E3LA 4M3DA 5DS9A 3S2DJ 4G12A 1IV6A 3FIWA 2O9LA 1MH3A 1ENHA 2EZIA 4MIMA 2DA3A 2MSYA 1HCRA 1IG7A 3C2BA 5FJ8J 3LOCA 5EGOB 1B72B 1H8AC 2O8KA 3M3YJ 1ETOA 4IHXA 5J3LA 4A3BJ 1WCMJ 2DMUA 3BQZA 4FTHA 1ZTRA 2XPVA 3Q0WA 2LP0A 1TWAJ 4FISA 2LY9A 2DA4A 5J1UA 1ETQA 3ZQLA 1LFUP 2Y9YA 1VFCA 3ZQHA 2XGCA 3RKQA 2O7OA 3BTJA 2L7MP 1FTTA 1HDPA 3RQIA 3ZQIA 5F08A 5BNGA 2MG4A 4V2GA 4B4CA 4UUSA 3CCYA 3G1LA 3QPLA 2JA8J 4A3DJ 2K40A 4A93J 1Y1VJ 4MO7A 5F27A 4W1UA 3H0GJ 3IV5A 1IC8A 4JYKA 1IJWC 4XIDA 4DZJA 5IYCJ 3TP3A 1D5YA 2LK2A 4B1RA 1Y1WJ 1NK2P 2QF7A 1DU6A 5F0CA 3BTIA 1XG1A 2R93J 1K61A 1IDZA 2VKVA 2R5ZA 3LNQA 2DJNA 2N8GA 4A3EJ 5GP9A 1MBEA 1ZQ3P 1ETVA 2HI3A 4BY7J 5EYRA 1TWHJ 2DN0A 4C3IJ 5FKOA 2M0CA 1U8BA 3SFIA 3JRBA 1U9NA 3BT9A 2KT0A 3K2AA 3E7LA 5M3FJ 1YRNA 2VPRA 2H8RA 4JX6A 1T56A 3IH2A 2OF7A 4NDLA 3IH4A 3D1NI 2XPWA 4J19A 2ECCA 4M3EA 2AO9A 3CQZJ 3HM5A 1X2MA 5C4JJ 1MBJA 4L5EA 1FEXA 1B8IA 2EQRA 1JUMA 1JTYA 3B6CA 1H88C 3HOUJ 2DTZA 2HQ5A 1MH4A 3PM1A 4JX5A 4DZPA 3TEDA 1OFCX 1UHSA 1BW5A 4M3BA 2DA5A 3LSGA 1RETA 1MSEC 9ANTA 2R5YA 1SANA 2LTPA 2FD5A 3HOXJ 2EH3A 4A3CJ 1AKHA 5M5YJ 3GTOJ 3Q0VA 5EG0A 5C4XJ 5EZHA 2H1KA 1ETWA 5EGOA 1FJLA 1UMQA 5IP9J 2E2HJ 2TCTA 3HGYA 4HNVA 3GTJJ 1S7EA 2JN6A 4I76A 1WPKA 1ZGWA 3G1OA 3BQYA 3BR6A 5GPCA 3K7AJ 1JJ6C 3S1QJ 1IDYA 4X1EA 1GT0C 3M4OJ 3BR1A 5F1JA 4AYBN 1HDDC 1MBFA 1UG2A 3GTLJ 2L0KA 5IYDJ 3GTMJ 5E3OA 4D5CA 2FJ1A 2DMNA 1F36A 4FE4A 2ME6A 2WAQN 1FIAA 1JUSA 3OSGA 2NOGA 2ZB9A 2HDDA 5FKNA 2WV1A 3CDLA 4S0HB 5GPAA 4D5FA 1NK3P 3HOWJ 2EZHA 1OCPA 5EEAA 1OJLA 5K7FA 1LFBA 2M9HA 4RDUA 5IOYA 2LVSA 1AKHB 4BY1J 1QRYA 2OPTA 4A3FJ 3HGGA 3BR3A 1MNMC 3TW7A 2KDZA 1I50J 1U78A 1QPIA 2ID6A 5M5WJ 2K9QA 3OSFA 1HLVA 3BR5A 2EZKA 3JRIA 4C3JJ 3TP0A 3A01A 4BBRJ 2XSDC 1Z0XA 2EZLA 2HOAA 2HXIA 3S16J 1B8IB 3H3VK 1IRZA 4A3IJ 1JKRC 2X6OA 3HDDA 3G1MA 1HOMA 4QSHA 4A69C 3L1PA 2DMPA 1YRNB 2L7ZA 4AC0A 3IH3A 2HYJA 3ZQCA 1HF0A 1OCTC 3GTPJ 1POGA 1WGXA 3OIOA 1JGGA 1DU0A 1W0UA 2VUMJ 4QTRA 3HOZJ 2CUFA 1I3QJ 2NVXJ 2NVYJ 3JR9A 1B72A 3NARA 4M6VA 4DYCA 3W6VA 2CRGA 3PO3J 4D7NA 1AHDP 1TWGJ 2YU9J 4A3LJ 2JK3A 4FE7A 3A03A 3NAUA 3ZOBA 5J1YA 3MN2A 1A6IA 2LD5A 4V2FA 3HKZN 2NS7A 2NS8A 4AUXA 2AHQA 3Q0UA 1ITYA 1BW6A 2NVTJ 4W97A 4A3GJ 3OOUA 2PMZN 1FIPA 1CQTA 1PUFA 2R0QC 1APLC 3S17J 3SJMA 2JA7J 1ZKGA 3B6AA 4CYCA 5J1RA 2K9SA 2X48A 3DCFA 5EZGA 4EEFG 1MBGA 2Y31A 4BBSJ 1MBKA 3LSJA 1A5JA 2LKXA 4JP0A 4MFDA 4MFEA 2R92J 2XGDA 1F43A 2GLOA 2XB5A 3WHCA 5F04A 1WI3A 5IPAA 2ME0A 2I10A 2K9NA 1P7IA 5K7ZA 2X9DA 1Q1VA 4M3FA 1XC5A 1JJ8C 1G2HA 3JRGA 4C3HJ 4XRSA 1TWFJ 2M8GX 3WHBA 1U9OA 3GTGJ 4LOCA 2CQXA 1X58A 1WH7A 3HEFA 3BTLA 1TWCJ 1LE8A 2Y0SN 3S15J 4X6AJ 2M34A 1ZR2A 1ORKA 2VKEA 2CUEA 2D5VA 2COBA 1RR7A 2E1OA 2B63J 1IUFA 4GFBA 2LLKA 3F0CA 2P81A 3JRHA 3MKLA 2XGEA
chains in the Genus database with same CATH superfamily
4KISA 3OYGA 3SZGA 5J4VA 1YFHA 2FQ4A 2HXOA 3PO2J 1U3EM 4IEJA 1Z7LA 1IN5A 4AIJA 3UKGA 1JTXA 4DBRA 2CU7A 2DW4A 2RAEA 4II3A 1D8KA 4FASD 3OWTA 4BYYA 2D1VA 1IGNA 4UUSB 2VQGA 2E1CA 2VXZA 4BXUA 4AIKA 4G6DA 3K70D 3AG1H 2FA5A 1YX5A 5IP6A 2M45A 2IBDA 4P9UA 3KP2A 1ZELA 1FSHA 1LKXA 3QU3A 1TL8A 1ZLKA 5BPDA 4G7ZF 1DP7P 2DMTA 3LSPA 1S6LA 4LJZF 5LBQA 3FHZA 3OYMA 2JVHA 5F0HA 2KISA 4D0PA 1LDJA 3OYNA 4CCKA 3JRDA 2PI0A 2VKDA 4HW0A 2AQEA 1R58A 1X3WB 2BYVE 2MBFA 5E1WA 4E4HA 2CG4A 1SFUA 3ABMH 4ZYDA 1XN7A 2FQ3A 2BW3B 4I6ZA 4RAFA 3L2UA 5KVRA 1R4NB 5CVVA 4D7MA 4B43A 4G94A 2R7OA 3OYLA 1U6GA 1IXSB 1NH3A 3DBLB 1Z1DA 2EBIA 3PIOF 2KDOA 1XGNA 2Y0MA 4CO8A 3SEZA 3BR0A 4JBAA 4MHGA 2WV0A 2RNGA 2XKPA 4DNCA 2F5EA 3R0AA 2FBHA 2DDBA 1JKOC 2VKHA 5JHUA 2YX7A 3WG7H 3BC8A 4QWQA 3FKIJ 4CHUA 5AONA 3CD6I 4U0WA 4KNYA 1R5GA 2CUZA 1MDMA 1JUPA 1ETKA 4Y52J 2BEOA 3HJEA 1F9NA 2BHYA 3GTQJ 1XS9A 5HVQC 1R36A 2E36A 3FXRA 3BPVA 5E1ZB 3SZTA 5E3NA 3HOVJ 1J2XA 3HTUA 3T0YA 3HBLA 3ZN0A 4R79A 3G6EI 2OQGA 3ZR8X 3GEZA 1U5TC 3RDIA 2MYSA 2KRHA 2E2IJ 1T33A 3ZRGA 1Z91A 3HPGA 1BJZA 4A3JJ 3FXJA 3JRCA 1V4RA 2ZNYA 3G73A 4O3MA 2HR3A 3LQQA 5DM6F 5A2QZ 5EF6A 1EJ9A 4LG0A 2JSPA 3L7WA 5IT3A 4HQEA 1J75A 1E3OC 1D5VA 2JA6J 3JRFA 3F21A 2VLAA 2R7DA 1JKQC 4EM1A 4QIWN 2HDWA 2HOTA 3BR2A 1A36A 2EINH 5IP7J 1VQMI 2B7EA 4P55A 4AYBA 1FOWA 2LKSA 1MSFC 3DP7A 1QHGA 2L3DA 3CZ6A 4KICA 3ABUA 4MLOA 2ZJQF 5M3MJ 3KX2A 3G4SI 3O8GA 5EG0B 2HOSA 3IP4B 3MZYA 2DYSH 3K1MA 4PGGA 5D5UB 1FOYA 4NUBA 5FFZA 3K4LA 4CYCB 3K4CA 3GF2A 2VI6A 2E5ZA 3FIWA 2E1MC 2CW0F 1MJAA 1MH3A 3Q9VA 3IRRA 3OYKA 1RZ4A 2VASA 2EWNA 4YFXF 3DKYA 1XX5A 4Z6YA 2P5VA 2LG4A 3HUGB 4IQJA 3PFYA 3O2PE 4A2UA 2HDCA 3C2BA 5FJ8J 4EJUA 2CQ7A 3HHGA 2DO7A 3LOCA 4M6YA 4U88A 3IAS2 4LITA 3ZMDA 4YFKF 1H8AC 1O3TA 4IHXA 4A5NA 5F64A 1EH6A 2ZO4A 1ZTRA 2MLGA 3CUQB 4I01A 4E6KG 2XROA 3GFJA 4F7ZA 3EQLF 3KLOA 2VJIA 2LY9A 2DA4A 1P4WA 2F6CA 2EIKH 2K27A 3R61A 1LFUP 5L3CA 3DFGA 5CVUA 3OYDA 2DPUA 3ZQHA 2V1UA 2MC4A 4TV7A 1BC8C 2I8DA 1HDPA 3I5UA 2ZMEA 3KP7A 1BR2A 3CCYA 3G1LA 2HPIA 4HAMA 4A3DJ 2Q0OA 4A93J 3FDYA 4AIDA 1TT5B 1XGSA 3PNVA 4NBQA 1IC8A 1R22A 4XIDA 3V7CA 1O7FA 4A6EA 3TP3A 4H0EA 2CUJA 4NC6A 4B1RA 3CCRI 1HXDA 1R49A 4ZYAA 1XG1A 3CCQI 3DV8A 3L2QA 2PJPA 4AVZA 3VOEA 2IS1A 1U8RA 3COAC 1BIAA 3FMRA 4K2EA 5D6EA 3GX4X 4N9IA 2X1DA 4MNUA 4L18B 2HI3A 2K7LA 5JVTA 1DUXC 3LAPA 1TWHJ 3K10A 4C3IJ 3P5JA 4IQ4A 4II2A 1SMTA 5FKOA 2M0CA 1LVAA 5DD4A 3JRBA 3ECOA 4CCNA 3H92A 3IUOA 1Y0NA 4WXHA 3DTEA 1BN5A 3EYIA 3JSPA 3IH2A 4Q48A 2JRTA 2OF7A 3KIOA 3OYEA 3D1NI 2BXYA 4J19A 2V1DA 3JW4A 3CQZJ 1MJ9A 3LA7A 4Y3OA 4EGZA 3WODF 2UZKA 1DDNA 5C4JJ 1FMVA 2IGNA 3HL2A 5CYVA 1LVKA 3NRVA 1MMSA 3B6CA 3UNGC 3H5RA 1R71A 1YYVA 2YSRA 3DEUA 3F22A 3CCMI 1F4KA 1IF1A 2UWMA 1LEBA 2VC1A 1MMNA 3ONQA 3TL4X 4LMYA 3OL4A 2EFOA 1RR8C 2DA5A 1RETA 4AVPA 1WWXA 4LB6B 1LDKB 2FD5A 3HOXJ 4CCJA 4H4KC 2EH3A 4XRFA 5M5YJ 1S8NA 2RKHA 3MZHA 3NQOA 5E79C 5C4XJ 3CJNA 2H1LA 2PJRB 1MJBA 1UMQA 3MKYB 2HZDA 5FROA 2HU9A 4U0VA 2M8EA 4N4OB 2CYYA 1WQ2A 3DPUA 4LK1F 1SD5A 1ODDA 2X85A 3DXJF 2O61A 1LB2A 2J5OA 3S1QJ 2ZKZA 3M4OJ 5F1JA 4AYBN 3GTLJ 5IYDJ 1DPUA 3CC4I 4NC8A 5BQTA 2NS0A 2FJ1A 1T2KA 2Z9OA 1WJFA 3EUAA 3TBIA 1FIAA 1JUSA 3TOAA 5E20A 4BS9A 4LD5A 3CLOA 1IO2A 2HVQA 3V8KA 1NK3P 5GTHC 2LH9A 3P9CA 4LIVA 5D5XB 5K7FA 3H5NA 2M9HA 4RDUA 3KYCB 3L2VA 1HW2A 1AKHB 2L7KA 2Y75A 2BBYA 1QRYA 4RS8A 2OPTA 3G3ZA 3CCUI 5D8KB 1I50J 2JVGA 2WAFA 2XF6A 3CUQC 2HWVA 3KZIC 1FT9A 1XMKA 2K3FA 2LY2A 1LNWA 2ZSHB 1NG6A 3FHNA 1HLVA 2EZKA 2F4OB 4UVBA 2ZMEC 2W24A 1BR4A 5DYMA 3QP6A 3TP0A 2XSDC 3DPLC 2GZWA 2V6EA 4NHJA 2HOAA 3KZYA 3S16J 2HYGD 1YLFA 3MD2A 5L3EA 3FMQA 4XSXF 4MQ9F 1GHCA 3R60A 1HOMA 1MW7A 1WKMA 2OC6A 3ML6A 2O3FA 1V54H 2ZXIA 4RB0A 3RIRA 2DMPA 3M8JA 4A6DA 3PUBA 3HUGA 3ZQCA 1V3FA 3H36A 2CSOA 1GXQA 1ZLJA 3GTPJ 1POGA 3KLNA 5K5OA 1W0UA 2MD5A 2XV4S 2W4SA 2JUCA 3GCMA 2NYXA 4UB6C 3I0TA 5AIQA 3HOZJ 2CUFA 1I3QJ 1T39A 3QRFF 3AG4H 3DF8A 5HLHA 3E97A 4DYCA 1TWGJ 2QSFX 4X0GA 2KL4A 4LK0F 3ZOBA 2MFZA 2LD5A 1TQPA 4G6QA 5KAFC 2NS8A 1KGSA 1ITYA 2FE3A 2NVTJ 4GRIA 4W97A 4Q47A 2XHKA 1IN7A 1V5GA 2VQLA 1Z3XA 2EJRA 4HQMA 3MCZA 1CQTA 4OIOF 4EJWA 2R0QC 1APLC 2A69F 2HQRA 4XONA 1OPCA 4HNUA 1PVEA 2GA2A 5CKTA 2A68F 3LFKA 3RKWA 1VTNC 1P4AA 1K4SA 2X48A 5EZGA 1FSEA 1MBGA 1HW1A 3LSTA 3K6GA 4BBSJ 4P1WA 2XAJA 1MBKA 1I6XA 2XAGA 3LSJA 2LKXA 1A35A 2F5DA 4MFEA 3CTAA 2R92J 3Q5FA 4IVNA 1F43A 5BOXA 1Y8QB 3M1CA 3ASNH 5DCMB 1TQMA 2E7WA 4PJMA 2ME0A 2I10A 3V7SA 2K9NA 1P7IA 1UHWA 5K7ZA 5DD8A 4M3FA 4OMYA 5ICCA 2O0YA 4L5JA 1XC5A 4MEXF 1BOAA 2R7QA 3PNTA 1TWFJ 3JTHA 2V1NA 3WGGA 3K4JA 3IRQA 1X58A 2JPCA 4BHPA 5CQEA 3BTLA 1E17A 1TWCJ 3S15J 1N78A 2M34A 5K5QA 3HKZA 1B59A 2V9PA 1S29A 3OL3A 2E34A 2MH9A 4U0YA 3OR2C 2E1OA 3CF2A 1IUFA 3HRMA 2GAUA 4GFBA 1LJ9A 2P81A 3IHUA 1SD6A 4CICA 3OYAA 3AL0C 5EEHA 3I9V2 1VNDA 4ABZA 1UJ8A 1T98A 1Z6RA 4FHTA 1FZPB 3ZN1A 5E8GA 3E6MA 2RNJA 3O8HA 2R7FA 3FXQA 1OYWA 5H20A 1GXPA 2XSJC 4U7DA 2LKPA 3VODA 2JTVA 2DA1A 4PSXA 2H6BA 2IJLA 1SVMA 1VI0A 3PSFA 1WVRA 3DLAA 2DK5A 3GO5A 4U7BA 2OA4A 3ZQ7A 4DYQA 4O6JA 3WTWC 5JLXA 2DQRA 4PZJA 3DWLE 4KT6A 4ESBA 3GFIA 3QQAA 1GDTA 1UFMA 1B4AA 2CS3A 4UUVA 3H1CA 4GO1A 1KYZA 2P0WA 2TRTA 3HSEA 2IRFG 2FEZA 2PFBA 2W85A 3SDGA 3V8LA 2JA5J 1NTCA 3OIPA 3RPUA 3CCJI 5K7HA 3QPTA 1OCCH 3BG3A 1QHHD 1YX3A 2XB0X 3HG9A 4WF2A 3M8EA 4IF4A 4BE2A 2ELKA 1GVDA 4DBQA 1TC3C 1OR7A 3BJ6A 4RBOA 2BY1A 2M2EA 3PSIA 2O8XA 3RPUD 1PUFB 1KU7A 3CESA 2WADA 1ZHFA 4JOMA 2DQLA 3OY9A 3PJRA 3HOYJ 4KYWA 2K02A 3KEQA 2ZMEB 1W1WE 1IRXA 3I4MJ 2DOFA 2DBBA 4M3GA 3H35A 1GV5A 2GM4A 2E19A 2M4KA 1VQ7I 1BR1A 2R5ZB 3GFMA 2VT2A 2HKXA 2IW5A 5HLGA 5FO5A 3I3LA 4OIQF 3L2RA 4B47A 1Z77A 4YG2F 1P7JA 3CMYA 2PMZA 1ON1A 4XORA 2R7UA 4IRGA 4XMYA 3KP6A 3SYTA 2R7ZJ 2R7XA 2XF7A 3BTCA 2QWWA 3QAHA 2EIMH 3ABKH 2L4AA 4IRIA 3KP3A 3K2ZA 5KHDA 3U2RA 5H2FC 1RUOA 3HRSA 4IJAA 1EF4A 1XCVA 1K6YA 4M9XA 4XRSG 2R7WA 1QPMA 2LFBA 3L9FA 5ILVA 3CDHA 3HRTA 2WTEA 1IRGA 3HB9A 4S05A 1CF7A 1XPXA 4A3KJ 5F0FA 2EPFA 5LGTA 2X4HA 5JFRA 3BG5A 3FK7A 4KIGA 4BKXA 4S04A 1IN6A 1GV2A 1V5FA 3QPHA 2E2JJ 1QU3A 2QCOA 5AIPA 5DEQA 3A02A 2KZGA 2WB1N 2JQ7A 2A6EF 1WJAA 1MMDA 1X1BA 1WH5A 2M1BA 1USSA 1JT0A 1T0FC 2RN7A 3F8BA 1OQYA 1QBJA 4IL6C 3ASOH 3GBGA 3PUFA 3WTTC 3GYHX 3F72A 2FXAA 2MW8A 1E0EA 3BZ6A 3NWTA 2TDXA 3I59A 1Z9CA 2M3AA 2EA4A 1Y56A 1R7JA 3QOPA 3TDUC 3T1BA 5IYBJ 4KN7X 4PGHA 1Y8RB 4MQVA 3RYPA 5E3LA 3K70C 4G12A 3ZMSA 5FLXZ 1IV6A 3GUDA 1HSTA 1A04A 3A2KA 2KIMA 4RLFA 3N97A 1D0YA 4Y4RA 1MDMB 2HTSA 4MIMA 3H3UA 5DCMA 5JR3A 1ON2A 1HCRA 5J40A 2QQBA 2VT3A 2A6TA 2MC3A 1B72B 4IXAA 2PN6A 4RA2A 1LFPA 5KNLA 2QUFA 3M3YJ 1OMIA 3RCOA 1KQ8A 2VQCA 4YRVA 3BQZA 4J01A 4FTHA 1PJRA 3KFWX 3K4BA 4DIQA 1N25A 2BV6A 1VZ0A 4EQQA 1UZCA 3RQ4A 2LF7A 2VC0A 4FISA 3W3CA 4XKBA 1ETQA 5J1UA 2WB1A 1ZG3A 3ZQLA 1EH8A 1HKQA 3HPHA 2PJRA 2XGCA 3RKQA 5LHHA 3ABTA 3C18A 5J8CA 3HOSA 3OYHA 3RQIA 4RB2C 5F08A 5BNGA 4V2GA 3J80K 4B4CA 3TOBA 2CFXA 1X1DA 3WTXC 2V26A 2GOMA 2X6WA 3OS1A 4W1UA 3H0GJ 3B02A 1H0MA 4Y13A 4WX9A 2QEXI 2UUZA 2A5WA 2QENA 4JYKA 4PJNA 3VFZA 4BEHB 4XSZF 3KETA 1D5YA 1L0OC 5CQGA 2HEOA 2LBFA 1NK2P 2EV0A 2NAZA 1YJ9I 5GAEJ 4ZDOA 2X6XA 1ACIA 3WTZA 2HTJA 5F0CA 3BTIA 1ZG5A 2ADUA 4QPQA 1DGRM 3RSNA 1S7OA 2R5ZA 2ZFUA 2VL8A 2DJNA 3ZXSA 1MGTA 5GP9A 1MBEA 3I58A 2YR2A 4BACA 2F4MB 5B1BH 1ETVA 1ZYRF 1L3LA 5EYRA 3UR3C 1U8BA 4ASNA 3ZMUA 1KQ0A 3BT9A 1U0JA 4YEJA 3P9KA 3E3VA 5ERIA 5H6QA 2DT6A 5DV5A 4OAYA 4XLFA 5B66C 3ULQB 2XPWA 2HPMA 3BY6A 5HDKA 1G8XA 2PMHA 1X2MA 3G71I 1MNEA 3S3NA 2EQRA 2FMYA 4C30A 4KIFA 1G59A 4CSWA 1JTYA 4FT8A 5LD2C 2F5FA 2L54A 3HOUJ 5L3BA 2OCEA 1PP8F 2OTLI 4BNCA 4EATA 3F6VA 1SFEA 1OFCX 2PMUA 3LAJA 1QA6A 3BG7A 2RV8A 3GZNB 3IKTA 3LSGA 4B48A 2QKLB 1YS7A 2R5YA 1SANA 5B1AH 3Q9SA 4UNOA 1BIBA 2ZJRF 4D9JA 5E18F 1AKHA 3L2WA 3F8MA 3IKVA 4BQOA 5EZHA 2RQQA 1ETWA 1BM9A 1WHUA 5EGOA 1YQAA 1S7AA 2E2HJ 5IT9Z 3HGYA 3V4GA 4ENNA 3JAMZ 4HLXA 2QM3A 3GTJJ 2VOOA 3DLLF 4I76A 1IV8A 2BY0A 4HX7A 3G1OA 3BR6A 3BOQA 1JJ6C 3K7AJ 3FBNB 4N9HA 3BR1A 3FWEA 3W2AA 1HDDC 1QQIA 1UG2A 4HSRA 2L0KA 3IAM2 1HW5A 1OYYA 3GTMJ 1F36A 2QSGX 2ME6A 1Q1HA 3IL2A 1VQLI 2Q1ZB 3OSGA 4BL0B 1SD4A 4XLCA 2ZB9A 1HQCA 2M5WA 4HSTA 4AIHA 2J5PA 4BJ5C 4F3QA 1KU3A 4S0HB 3MMYB 1B9NA 5F1RA 2XRNA 1PP7U 4FQGA 3DTIA 3AFHA 1OCPA 4L9JA 1OJLA 4I2OA 4HX4A 2HZTA 2LVSA 3GZ5A 5L3FA 1U5TB 1SFXA 4BY1J 5IT9K 1YS6A 3JTGA 3BR3A 1MNMC 4LG3A 2QYOA 2ID6A 2DLLA 3FZVA 1BI2A 3J7YJ 3BR5A 3A1YA 1T38A 3JRIA 1WJDA 3A01A 2OTJI 3CC7I 2WA0A 3AG3H 4RM2A 3W6JB 1Y0UA 3HSFA 2HXIA 3GLXA 3QYFA 5KCMA 1B8IB 3R6SA 4LIUA 4XKCA 4A3IJ 2CGPA 2PLYA 5DCFA 2MABA 2X6OA 3TO6A 3G1MA 4QSHA 3W2VA 2ISZA 1REPC 1YRNB 4XKVA 2IPQX 1IN4A 2EB7A 1KQ9A 5HNFA 2C6YA 2RGVA 1OCTC 2M7BA 2PG4A 4OU0A 2R7RA 3OIOA 1DU0A 3W2WA 2CV0A 2NVUB 1ZAOA 3DU5A 3I64A 1FP2A 1K79A 2NVYJ 2EILH 4ZDLA 4C9YA 1KONA 3DBHB 2HS5A 5D4SA 4M6VA 4V19K 1IUYA 1OR7C 4D7NA 3D5LA 1AHDP 2XAHA 4A3LJ 2JK3A 2E1MB 3NAUA 3TO7A 3U1DA 5JVGF 1OYIA 3MN2A 1A6IA 4XM3A 2NS7A 5CJ9A 1FP1D 3KE2A 3BPXA 2DOEA 3F9KA 5J6XA 4A3GJ 2RDPA 2DOAA 1DPRA 2PMZN 1R00A 1PUFA 2X51A 1S3JA 4ZTFA 3H9QA 2QZ8A 2XC7A 3FMSA 2XDVA 3B6AA 4CYCA 1YG2A 1VQKI 5J1RA 3CLQA 3DCFA 5B3SH 4BAYA 2Y31A 5CVRA 2IVMA 3SEQA 1D3YA 2AQFA 1UELB 2FOWA 5K1YA 5HS9A 2GLOA 2XB5A 5F04A 1WI3A 2WC2A 4ZZLA 1JGSA 4D1QA 1SD7A 3CJRB 2X9DA 1Q1VA 2I5UA 3QYEA 1CF7B 2BGCA 2NOJB 3VWBA 4XRSA 3OYBA 5LRRA 1ZGAA 1JE8A 4EMSA 2UV1A 4OINF 1IN8A 3A0BC 2XAQA 2A3SA 1ORKA 5TISC 3I54A 1LPQA 1Z05A 2K3PA 3KEOA 3LA2A 1V55H 2B63J 2F48A 4XLHA 3F0CA 1FOXA 2XUBA 3E6BA 3JRHA 5E17F 3WTVC 3DEWA 4OAZA 1W0TA 3TW6A 4HF0A 3KPHA 2E7XA 3WU2C 1VQNI 4DQ2A 1HBXG 1RPWA 4ZYGA 1VQOI 4JX4A 4XK4A 2R5YB 1B9MA 2XRLA 3S1MJ 2VONA 4UHTA 3ZQFA 4FCYA 2JWTA 3M9AA 4XQFA 4IHVA 2IP2A 3ZMZA 1FBSA 2WAQA 2V4JC 5FKMA 3RI4A 3PFIA 1GUUA 2E1NA 3F6OA 4BHCA 4PCQA 4HEA2 2IT0A 1AWCA 1MIJA 2JUGA 2VBZA 2P7CB 6PAXA 4LLLA 1VQ8I 5FB2A 1RKWA 2BVMA 2ZJPF 3FF5A 1KZHA 3QU6A 1QNTA 2Y69H 3MVPA 5FKKA 5L3GA 4ZTJA 2ZXJA 2O03A 1U5TA 1BL0A 1J09A 4KMUX 2Y30A 4KMFA 2R7SA 2IGMA 3P9IA 1JXSA 3H0DA 2M0MA 3SFZA 2JZYA 4UUTA 3W6KB 5HODA 4A3MJ 4C2UA 1YIJI 1ZARA 4E7LA 3FM3A 2H8WA 4UV9A 4XN3A 2PQ8A 2ESHA 3BG9A 1D0ZA 3E5QA 4A0ZA 4KDPA 4PJ0C 3I4PA 4AU7A 1EH7A 4XKWA 1R6RA 3J7ZI 2KPMA 1OCRH 2Z5UA 2VOPA 4OIPF 2Y9ZA 5IOZA 2R7TA 1FBUA 1FX7A 2KFDA 4XLEA 3IC7A 3QWLA 1T0FA 2VBYA 2PX9A 5FKLA 1R23A 1DGWY 2WY8Q 4RB1A 2XASA 4F91B 1WJ5A 3IWFA 2YS9A 1P2FA 1JHFA 1S72I 3QPSA 1P4XA 3D0SA 1ZK8A 2ELJA 2CJJA 2GA1A 4EJTA 3A01B 4F93B 5ILUA 4HLYA 4IX7A 1UHMA 2G7HA 3E5UA 1R1UA 2LC2A 3OV8A 5GTIC 1PDNC 4HYEA 1QVTA 2XAFA 1OCZH 3S1RJ 2Y2ZA 4PJJA 2L9SA 1NG7A 4LB5A 3CP2A 5FLVA 4WXDA 3RKXA 3JCUC 4PK4A 4RMNA 1TQIA 1WJBA 1XGOA 5FLXK 1X19A 4M71A 2VBXA 1FY7A 4M6XA 3VPRA 1E3HA 1P92A 1ZGJA 2CQQA 4BE1A 2L5QA 1RC9A 2KLOA 3DU6A 3FXUA 3FISA 1I5ZA 3FK6A 4PFPA 1TP4A 2Z16A 2XIGA 3EDPA 3U9GA 3BZCA 2L7FP 3VYRB 2Z3YA 2M7AA 5J47A 2HOEA 3GVAA 2OCCH 1YO5C 1OCOH 1BJAA 2OQRA 2Q2EB 3RZOJ 5EDNA 1RI7A 3B73A 1D1CA 2LREA 4IZZA 4G7HF 3S2HJ 3EUHA 1XTAA 2UXNA 1H89C 1R5ID 4XLAA 4Y7NJ 4ENMA 1VF9A 3MAJA 3KEYA 4E7IA 3M7GA 3JREA 4XR6A 5E1XA 3E5XA 5IY5H 4P9FA 1NHAA 4I0AA 2COMA 1KA8A 2H27A 2P7VB 2V9VA 5A2QK 3WTSC 3BJAA 2DDAA 3OIQA 5EEGA 2FMLA 3CUQA 5DM7F 4RB3C 4CXFA 2JJ7A 2MGQA 2X1CA 4YELA 5DS9A 4M3DA 2W84A 1KU2A 4HZFA 4ESFA 4E7SA 2O9LA 4ZYHA 2EZIA 1MNDA 2MSYA 1X4PA 2BW3A 1IG7A 1KYWA 4CCMA 1RRJA 5EGOB 1W5SA 4NB5A 2QQ9A 2O8KA 1W5CC 2L2OA 5J3LA 2G9WA 2OZ6A 3JSOA 4IO9F 1T95A 5D6FA 2KQRA 2XPVA 1ONVA 1R5HA 4EJVA 4KN4X 3MFKA 3EYYA 1LDDA 2FU4A 2VE8A 4B44A 1D1BA 2Y9YA 4ON0A 5L3DA 5TGTA 1VFCA 4OMZA 4P96A 3R0JA 2ICWG 4WWCA 1FTTA 2DFHA 2KRCA 3ZQIA 2HKOA 5CLSA 2MG4A 4UUSA 1WI9A 3REOA 3WE2A 2K40A 1Y1VJ 4MO7A 5F27A 4RGRA 2HVRA 2W57A 4FETA 1E3PA 4B8XA 2DFEA 4NQWB 5KK1A 2CMPA 1GVJA 4DZJA 4O5VA 2A05A 2DPDA 2XGXA 3PNYA 3FM5A 1Y1WJ 1YJNI 4Y17A 2IA1A 4L9VA 2CV2A 3WE3A 3M07A 4PDKA 1C0WA 1DU6A 2R93J 1EA3A 1X4OA 3I71A 4HV5A 1P9QC 2KIUA 3AL0B 1K78B 2VKVA 3CO7C 3RPQA 5ICGA 4UVAA 2N8GA 4JK1X 3O3KA 4A3EJ 1RUNA 4G8XA 1V5EA 4E70A 1UG0A 4KJZA 4EM2A 1D8JA 4XLNF 1FNNA 5J8FA 4BY7J 4B3XA 2E5NA 2AXLA 3SFIA 3CMAI 2GIVA 2QQAA 2NRAC 2KT0A 2YX4A 2HQAA 2FF4A 2P6SA 3E7LA 4I99C 4L9NA 5M3FJ 5TRDA 1SAXA 1F1ZA 4JX6A 2H8RA 1JI8A 1ZRCA 1O3SA 5LHIA 2DAOA 3VB2A 3FXKA 2AO9A 4HDVA 4YIIA 3HM5A 1YI2I 1MBJA 2ELHA 2K9MA 2P4WA 2PEXA 4FX0A 1B8IA 1JUMA 3G2BA 3CCLI 3F8NA 2K4BA 1H88C 4U87A 4QLCU 5ED4A 1DP3A 3DPTA 3FXOA 3DQVC 1MH4A 3PM1A 4JX5A 3C7JA 2GOXB 2VJJA 5LLQA 3OR1C 3TEDA 1UHSA 1STZA 4M3BA 3MKWB 1BW5A 1ERDA 2L9VA 2CQKA 1MSEC 3FKJA 9ANTA 2VJ4A 2QQ8A 2X6YA 3MKZA 1UCRA 1ZN2A 2W82A 1MMGA 2O5RA 2WY7Q 1QZEA 1YW9A 2H1KA 2ZNZA 2OAZA 1FJLA 1H9GA 1YW7A 2EIJH 2DJIA 3CJTB 3CMMA 5KAIC 4RAGA 5IP9J 5BPIA 1T8IA 2TCTA 4HNVA 4DGWB 1J7KA 1XSXA 4OWRB 2XVCA 2Y48A 5LGNA 2JN6A 2K9LA 4ZH4F 1WPKA 4C2TA 2BY2A 3BQYA 5GPCA 1IDYA 1GT0C 2OZUA 4BE0A 2B0LA 3DBRB 3VYTB 3QYBA 1Z6TA 3FX3A 2E60A 4MTDA 5E3OA 3LL7A 2K86A 4D5CA 3BP8A 3DKWA 2R3SA 2DMNA 3A4CA 4UB8C 4A5MA 3WU1B 1O3RA 2WBMA 3J7AY 2BZTA 2D1HA 2QVOA 2A61A 2ZJ2A 2HDDA 5B5EC 2LYCA 2WV1A 3CDLA 3PIPF 1XSDA 3CF5F 4IOAF 3HOWJ 2R4GA 3KP5A 2EZHA 3C1DA 3SDBA 3TKYA 5EEAA 1D0XA 1LFBA 2CWEA 1I3AA 4M74A 1MMAA 2MH2A 5IOYA 4IRHA 3ZGKA 2ISYA 3T8RA 3U21A 2EA2A 5LEJA 2QBYA 4HF2A 2IXSA 3HGGA 2P6TA 2KDZA 1J59A 1I39A 4UVCA 4BDYA 2A07F 3QP5A 4BXFA 1ZG1A 3S3OA 3OYJA 5F6FA 4BJTA 2RREA 2K9QA 1AOYA 3BCAA 4M9ZA 2M4GA 5CVIA 2F5CA 3BROA 3SHFA 1Z0XA 3H3VK 2VN2A 1TW2A 1SC7A 1FOKA 3LSHA 2CQNA 2K5CA 4GGGA 1W7PD 3P7NA 2DTRA 2ZSIB 4A69C 3L1PA 3U1KA 1FMWA 3ESWB 4N0BA 2HVSA 5LFAA 4L0ZB 4AC0A 2RVCA 4M73A 4DOZA 1Z67A 1Z3YA 2L01A 1JGGA 1R1TA 2VUMJ 3ABLH 4QTRA 4F92B 3GZ6A 3L2CA 5FD6A 2NVXJ 2GWRA 3JR9A 3NARA 3D5SC 2CRGA 3ZQQA 4GYGA 5GADJ 2HYFA 2KJBA 2YU3A 2B9SA 2YU9J 4FE7A 2JPBA 3A03A 5ICEA 4RAZA 5J1YA 1R1VA 4XOPA 3J81Z 4V2FA 3HKZN 5LGUA 2K85A 5FRMA 3N05A 3S2WA 3Q0UA 5BS6A 3DKXA 4E7KA 4CZCA 1SFKA 4CUGA 2NNNA 2L9NA 3OOUA 1ZRFA 4PFOA 3E0JB 1P6RA 1B1BA 1HSJA 1YHQI 2KIQA 3I59B 3TGNA 3SJMA 4YIRX 4EJOA 4NQWA 4OIRF 1ZKGA 3V42A 4E7JA 2OV7A 3OYIA 4EEFG 1J9IA 3BWGA 2NNYA 4HV6A 2E35A 1T08B 1A5JA 1PUEE 4KIBA 4ZC3A 2H94A 2DFIA 2M30A 4KFCA 3AKZA 2W7NA 1QGPA 4G7OF 2LMDA 4GYIA 3TQNA 4BUPA 3SXYA 4CH7A 5ILSA 2ZXHA 1G2HA 4M9SA 5JHFA 4C3HJ 3JRGA 4LLNA 1TNSA 3CMEI 2FUG2 4EM0B 3WHBA 5FGMA 3CCSI 3GLLA 1BI0A 1VQ5I 3CUOA 3MWMA 4LFUA 2KHMA 2CQXA 3C2HA 1YW8A 3HEFA 4CDGA 1XSVA 1W36C 4X6AJ 2Y0SN 1ZR2A 3GW2A 3S8PA 2VKEA 2CUEA 1G3WA 2COBA 1HKSA 1LEAA 3LSMA 1RR7A 4RM3A 2Q8KA 5EJCA 2QLZA 5HS7A 2V1XA 2XGEA 1HC8A 4ZDPA 1BI1A 2OD5A 3HHHA 2QGUA 2LNBA 4BEHA 4WCGA 4G6TB 4KT5C 2Q2EA 3ELKA 4B3AA 4Q5SF 5M5XJ 1W4MA 3GFLA 1SAUA 2ESNA 3BJOA 3TO9A 1W36D 2NVQJ 2Z1DA 4XOTA 3OYCA 4C2MJ 2XAUA 2GQQA 3BDDA 3N4MA 1ZR4A 2GXGA 3S93A 3EETA 2LBFB 4IHWA 4KITB 3H5AA 3ZQGA 2IA0A 3O6BB 2CV1A 4Y15A 2XPUA 3A0HC 2QA4I 1I6HJ 5GAHJ 3PQKA 2E71A 3ZMTA 3Q3SA 3K9TA 5FLMJ 2AXTC 2DCEA 5C3EJ 2VQHA 4OOIA 3S14J 1RESA 4HF1A 4BXXJ 1FYMA 4IKFA 4CCOA 2Y0SA 3I56I 3HRUA 1G6NA 5E3MA 2GBYA 1O4XA 1IZ1A 3GTKJ 2QKMB 1QO0D 1GLNA 4Q4ZF 3IWZA 3K1NA 4QPOA 5LEKA 2H09A 4A12A 3RKYA 1AU7A 2ETHA 1VQ4I 1X3UA 1T6SA 5H6RA 1PYVA 1RKTA 1M1EB 1X2NA 1E2XA 1ETXA 2JMWA 3FXLA 3V7RA 3JRAA 4I09A 2W25A 2G0EA 2KRFA 4GDFA 3GMEA 2V79A 3KCCA 5JLWA 3LFUA 2LDUA 4I7HA 2X0LA 3K4NA 4YIFA 2D2WA 1SFOJ 4IHYA 1FPQA 4XICA 2GXBA 2DFFA 2OUMA 3I4NJ 3I55I 2V6CA 2YUSA 4R1HA 5TJJA 3WGIA 1ETYA 2DA6A 3LSRA 5ICFA 3WG9A 3RZDJ 3M1EA 2VODA 2CW8A 3ZMVA 4DYRA 4ITVA 3SQNA 1O3QA 4HDUA 1XCBA 1FTZA 1WJEA 5DUIA 2JT1A 2LSOA 2GXAA 3HYIA 1LUJB 1BA5A 1KU9A 3F3XA 2ZC2A 3E1SA 1RIOH 2VIXA 5DTDA 2IEKA 1HA8A 1YITI 2BHZA 4BH9A 3K0LA 3NWSA 2W48A 3LMMA 1QVUA 4I0BA 4RGXA 1A31A 2EFPA 2RQPA 2JRMA 4E7ZA 2MD0A 1USTA 2HQNA 4BQQA 4XRMA 1CGPA 3QOEA 3CCEI 1JT6A 2DA2A 1I27A 2ID3A 4NC7A 4CCLA 2Z99A 5C44J 2BVLA 4ZZDA 5D5VB 4A0YA 3EUKL 1WZ2A 3E6DA 3ERMA 3QODA 1K6OA 2IS6A 1R9TJ 1K83J 1LE8B 4P5OA 2LOOA 2X1EA 3C2GA 2IAIA 1IXCA 1RNLA 3F23A 1I1SA 1BI3A 3PL8A 5GAGJ 2KJCA 2STWA 1YJWI 1N75A 3GWZA 4MTEA 2DA7A 2KIFA 1ZREA 2IGKA 2F4IA 4IOCF 2FX0A 3H3ZA 4DW6A 1JKPC 1A6QA 3PQJA 4F52A 2D45A 1MBHA 3EPZA 2L9RA 2JA2A 3KP4A 2ECBA 1J0RA 2BY3A 1EV7A 4HRIA 1FC3A 4CZZA 2LR8A 2DXIA 3S1NJ 3VDXA 1O57A 2DMQA 3S2DJ 1FYKA 4BGDA 1SEUA 2RC4A 3BG6A 1YIOA 1ENHA 1X1AA 3RTRA 2DA3A 4A0XA 3MQ0A 1WRJA 3DTKA 5LHGA 3HXLA 3HSRA 3VSKA 1MKMA 3VYUB 3RYRA 1ETOA 4A3BJ 1WCMJ 2DMUA 1OLTA 2VBWA 3EUHC 1W5TA 1X1PA 4PUSA 4L9TA 3LWFA 4UXNA 4XNFA 3J7AO 1IXRC 1YOVB 2LP0A 1TWAJ 3Q0WA 4EVIA 1VQPI 5D5WB 4IPAA 1YTYA 4BHBA 3WGHA 2O7OA 5J4YA 1X3ZB 3BTJA 2L7MP 4RAYA 2P5LC 2BE5F 4E7HA 4GCVA 3ZP5A 2CFOA 4FX4A 3SZPA 1WJCA 2V9KA 3QPLA 4HBLA 4Y33A 2JA8J 2FOKA 2KP6A 1Y6IA 3AAFA 2DT7B 3IV5A 1EKEA 1IJWC 1QZYA 5IYCJ 3L00A 3HOTA 1G3TA 2LK2A 3LSKA 2R7VA 1IRFA 2VE9A 2GIZA 4AWXB 1UB9A 2EV6A 2QF7A 3WTUC 2IA2A 2OBPA 3RJPA 1K61A 3L09A 3KZZA 4ZYEA 2EFWA 3CCVI 2FBKA 1IDZA 2ZCWA 3LNQA 2ACJA 2XF5A 4F55A 3GXOA 1Y39A 1B6AA 1ZQ3P 1SVLA 1XDUA 2H6CA 3OOPA 3MEXA 1G4DA 2DN0A 4AD9A 4EGYA 1U9NA 2HNHA 4KUMA 2EK5A 3M8FA 3K2AA 4ANJA 1YRNA 2VPRA 3HTSB 4XN0A 1T56A 1BC7C 3ECHA 4L0YB 4NDLA 3IH4A 2STTA 4YFNF 3AG2H 2WWYA 2ECCA 4M3EA 3FXMA 1G3SA 3F8CA 3T5XA 4HPQA 3NEUA 4L5EA 1FEXA 1U2WA 1XDSA 1LQ1A 4XL9A 1W7PB 3T8TA 1XB4A 2A5YB 4I02A 2DTZA 1ZH5A 4HNTA 4BU2A 2HQ5A 1SVOA 2IGOA 5CVJA 1FWZA 4DZPA 4I98B 4HOBA 3I53A 1J5YA 1N77A 4MEYF 2Z2SB 4B09A 3LA3A 2IS4A 2CH0A 3H9GA 1FLIA 4KA4A 2ZBKA 3K4KA 1BBYA 2DODA 3E6CC 2LTPA 2DI3A 2W1OA 1Z21A 4A3CJ 1MD0A 4RLQA 3HZJA 2M87A 3Q0VA 5EG0A 1VQ9I 3GTOJ 2QBYB 4J00A 4LLGF 2CW7A 1FYLA 4JQFA 1W7PA 2F5VA 5JI6A 4ZJZA 3VSLA 4CGZA 4ETSA 4RGUA 5D4RA 2IS2A 4XBFA 1S7EA 2KKOA 4CA0A 3MZ8A 1ZGWA 3K4MA 2LF8A 3WU0A 4X1EA 2DT5A 4DJAA 2K4JA 1K78A 3DEEA 3VYSB 4HG2A 3X2QH 3ZPLA 1MBFA 2BOLA 5CPRB 3K1PA 4L5IA 3CP8A 1BOBA 3BZKA 4FE4A 3KYDB 1S9HA 2WAQN 3ISPA 2PBIA 2NOGA 1I1GA 2G7UA 1FBQA 5HDNA 1IAWA 1XGMA 5FKNA 1TZLA 2KMUA 1ZRDA 1AA7A 3OS2A 1OISA 5GPAA 4D5FA 4CYDA 3K69A 4ESJA 2VXDA 5FD5A 1WFXA 2MA3A 2A6HF 4XLPF 3TDZC 4PSWA 3WTYC 1TBXA 4A3FJ 1TTYA 3TW7A 3F8FA 2FRHA 5LRSA 3J81K 1U78A 2FNPA 1SMYF 5M5WJ 1K4TA 1QPIA 2KZVA 2O6GE 1YE9A 1QZZA 1XD7A 2YPRA 3VEPA 4WK8F 3OS0A 3OSFA 2QSHX 5FRNA 1TT0A 3LSIA 1H9TA 3H9JA 4C3JJ 4BBRJ 1TLHB 2EZLA 2DK8A 4IHTA 4NNJA 1IRZA 4LGWA 3ERED 1Z7UA 4R8HA 1JKRC 3CJQB 3HDDA 2MLKA 2EFNA 2Z33A 3S3MA 5E8IA 3FBIB 2L7ZA 4UV8A 3OYFA 3IH3A 2HYJA 1HF0A 1DQUA 2FBIA 4HX8A 1F5TA 2ZXWH 1WGXA 2F2EA 4BJ6C 2DYRH 4HA8A 2HFHA 5K5RA 4AM3A 3BLYA 4UY8I 1B72A 2NXNB 3W6VA 1VQ6I 3PO3J 1XMAA 4LG0B 3HIFA 2FNAA 1TW3A 1ULYA 1WSUA 2OJED 4RGSA 4BDZA 3C3WA 4AUXA 2AHQA 2FSWA 1BW6A 4WXCA 1HKTA 2BXZA 1FIPA 4ENKA 2AS5F 3TMOA 2EV5A 3S17J 2V7FA 2JA7J 1G3YA 1IW7F 5BMZA 2DU9A 3LQRA 2VB6A 2HGCA 5HLIA 2ZFWA 3R4KA 2K9SA 1TNTA 3V8JA 2JSCA 2LRDA 1R4MB 3CC2I 1OKRA 4MGRA 4BQAA 4JP0A 4MFDA 3BCBA 3J80Z 1UAAA 2XGDA 2VPLA 2P8TA 5FFXA 3WHCA 4Z2YA 1D1AA 3ZCOA 1S5LC 5IPAA 4EV0A 2W00A 2L4MA 3JAMK 3ROUA 2XKOA 4BQNA 1MZBA 4N4NB 2P5KA 3KYLA 5HNHA 1JJ8C 2L02A 2CO5A 1O7LA 2M8GX 3S32A 1U9OA 3CDIA 3D5RC 4IHSA 3GTGJ 4PJLA 4LOCA 1WH7A 3CO6C 3OMYA 2VJ5A 2UXXA 1LE8A 4GXOA 5HS8A 5HLTA 1XMXA 4M72A 2D5VA 3HC7A 1JHHA 1K7AA 2EFQA 1X1CA 2OU2A 5DUKA 2LLKA 5HDGA 4G9YA 5DDGA 2LY1A 5D8LB 5HOOA 4ENJA 2WAEA 3MKLA
chains in the Genus database with same CATH topology
1VNDA 4ABZA 3DEWA 1W0TA 3TW6A 4B3AA 3O8HA 2FQ4A 2HXOA 3PO2J 5M5XJ 1RPWA 4IEJA 4JX4A 4XK4A 2R5YB 3UKGA 2XRLA 1JTXA 3S1MJ 2CU7A 2RAEA 2DA1A 1VI0A 2NVQJ 1IGNA 3ZQFA 4UUSB 4FCYA 2JWTA 4IHVA 4DYQA 4C2MJ 5JLXA 5FKMA 5IP6A 2IBDA 3QQAA 1GUUA 1ZR4A 1GDTA 2DMTA 3LSPA 4IHWA 1RKWA 3ZQGA 2TRTA 5F0HA 2XPUA 3SDGA 1I6HJ 2JA5J 1NTCA 5FKKA 3MVPA 3JRDA 5C3EJ 3Q3SA 5K7HA 5FLMJ 1BL0A 2Y30A 3BG3A 3S14J 1RESA 4UUTA 2XB0X 5HODA 4A3MJ 4BXXJ 5E3MA 2GBYA 2ELKA 1O4XA 1GVDA 4I6ZA 1TC3C 3GTKJ 4RBOA 3BG9A 2M2EA 1PUFB 4D7MA 1AU7A 3HOYJ 2EBIA 1RKTA 1X2NA 1ETXA 2JMWA 3I4MJ 3JRAA 4M3GA 2Y9ZA 5IOZA 1GV5A 2GM4A 2E19A 2G0EA 3BR0A 5JLWA 2R5ZB 5FKLA 1JKOC 1SFOJ 2YS9A 3FKIJ 3QPSA 4IHYA 1ZK8A 4XICA 1Z77A 2CJJA 3I4NJ 3A01B 1JUPA 1ETKA 1P7JA 2YUSA 3CMYA 4Y52J 1ETYA 2DA6A 3LSRA 3RZDJ 3GTQJ 1XS9A 4DYRA 1QVTA 1FTZA 5E3NA 3HOVJ 3S1RJ 2Y2ZA 2R7ZJ 3BTCA 1BA5A 3HBLA 5FLVA 1EF4A 5DTDA 2IEKA 2W48A 1QVUA 4XRSG 2E2IJ 3VPRA 1T33A 2LFBA 2CQQA 3FISA 3HB9A 1BJZA 4A3JJ 3FK6A 3JRCA 4XRMA 4A3KJ 1JT6A 2DA2A 2ID3A 2L7FP 5F0FA 5C44J 5EF6A 3FK7A 3BG5A 4BKXA 1GV2A 2E2JJ 1R9TJ 2QCOA 1E3OC 2JA6J 1K83J 1LE8B 3RZOJ 3JRFA 5EDNA 1JKQC 3A02A 2IAIA 4QIWN 2WB1N 2HOTA 3S2HJ 3BR2A 1H89C 5IP7J 4Y7NJ 1VF9A 1WH5A 2DA7A 1MSFC 1JT0A 3JREA 2FX0A 4DW6A 4MLOA 5M3MJ 3GBGA 1JKPC 1MBHA 2L9RA 2MW8A 2ECBA 3O8GA 5EG0B 2HOSA 2LR8A 2JJ7A 2MGQA 5IYBJ 4CYCB 3S1NJ 2DMQA 2VI6A 5E3LA 4M3DA 5DS9A 3S2DJ 4G12A 1IV6A 3FIWA 2O9LA 1MH3A 1ENHA 2EZIA 4MIMA 2DA3A 2MSYA 1HCRA 1IG7A 3C2BA 5FJ8J 3LOCA 5EGOB 1B72B 1H8AC 2O8KA 3M3YJ 1ETOA 4IHXA 5J3LA 4A3BJ 1WCMJ 2DMUA 3BQZA 4FTHA 1ZTRA 2XPVA 3Q0WA 2LP0A 1TWAJ 4FISA 2LY9A 2DA4A 5J1UA 1ETQA 3ZQLA 1LFUP 2Y9YA 1VFCA 3ZQHA 2XGCA 3RKQA 2O7OA 3BTJA 2L7MP 1FTTA 1HDPA 3RQIA 3ZQIA 5F08A 5BNGA 2MG4A 4V2GA 4B4CA 4UUSA 3CCYA 3G1LA 3QPLA 2JA8J 4A3DJ 2K40A 4A93J 1Y1VJ 4MO7A 5F27A 4W1UA 3H0GJ 3IV5A 1IC8A 4JYKA 1IJWC 4XIDA 4DZJA 5IYCJ 3TP3A 1D5YA 2LK2A 4B1RA 1Y1WJ 1NK2P 2QF7A 1DU6A 5F0CA 3BTIA 1XG1A 2R93J 1K61A 1IDZA 2VKVA 2R5ZA 3LNQA 2DJNA 2N8GA 4A3EJ 5GP9A 1MBEA 1ZQ3P 1ETVA 2HI3A 4BY7J 5EYRA 1TWHJ 2DN0A 4C3IJ 5FKOA 2M0CA 1U8BA 3SFIA 3JRBA 1U9NA 3BT9A 2KT0A 3K2AA 3E7LA 5M3FJ 1YRNA 2VPRA 2H8RA 4JX6A 1T56A 3IH2A 2OF7A 4NDLA 3IH4A 3D1NI 2XPWA 4J19A 2ECCA 4M3EA 2AO9A 3CQZJ 3HM5A 1X2MA 5C4JJ 1MBJA 4L5EA 1FEXA 1B8IA 2EQRA 1JUMA 1JTYA 3B6CA 1H88C 3HOUJ 2DTZA 2HQ5A 1MH4A 3PM1A 4JX5A 4DZPA 3TEDA 1OFCX 1UHSA 1BW5A 4M3BA 2DA5A 3LSGA 1RETA 1MSEC 9ANTA 2R5YA 1SANA 2LTPA 2FD5A 3HOXJ 2EH3A 4A3CJ 1AKHA 5M5YJ 3GTOJ 3Q0VA 5EG0A 5C4XJ 5EZHA 2H1KA 1ETWA 5EGOA 1FJLA 1UMQA 5IP9J 2E2HJ 2TCTA 3HGYA 4HNVA 3GTJJ 1S7EA 2JN6A 4I76A 1WPKA 1ZGWA 3G1OA 3BQYA 3BR6A 5GPCA 3K7AJ 1JJ6C 3S1QJ 1IDYA 4X1EA 1GT0C 3M4OJ 3BR1A 5F1JA 4AYBN 1HDDC 1MBFA 1UG2A 3GTLJ 2L0KA 5IYDJ 3GTMJ 5E3OA 4D5CA 2FJ1A 2DMNA 1F36A 4FE4A 2ME6A 2WAQN 1FIAA 1JUSA 3OSGA 2NOGA 2ZB9A 2HDDA 5FKNA 2WV1A 3CDLA 4S0HB 5GPAA 4D5FA 1NK3P 3HOWJ 2EZHA 1OCPA 5EEAA 1OJLA 5K7FA 1LFBA 2M9HA 4RDUA 5IOYA 2LVSA 1AKHB 4BY1J 1QRYA 2OPTA 4A3FJ 3HGGA 3BR3A 1MNMC 3TW7A 2KDZA 1I50J 1U78A 1QPIA 2ID6A 5M5WJ 2K9QA 3OSFA 1HLVA 3BR5A 2EZKA 3JRIA 4C3JJ 3TP0A 3A01A 4BBRJ 2XSDC 1Z0XA 2EZLA 2HOAA 2HXIA 3S16J 1B8IB 3H3VK 1IRZA 4A3IJ 1JKRC 2X6OA 3HDDA 3G1MA 1HOMA 4QSHA 4A69C 3L1PA 2DMPA 1YRNB 2L7ZA 4AC0A 3IH3A 2HYJA 3ZQCA 1HF0A 1OCTC 3GTPJ 1POGA 1WGXA 3OIOA 1JGGA 1DU0A 1W0UA 2VUMJ 4QTRA 3HOZJ 2CUFA 1I3QJ 2NVXJ 2NVYJ 3JR9A 1B72A 3NARA 4M6VA 4DYCA 3W6VA 2CRGA 3PO3J 4D7NA 1AHDP 1TWGJ 2YU9J 4A3LJ 2JK3A 4FE7A 3A03A 3NAUA 3ZOBA 5J1YA 3MN2A 1A6IA 2LD5A 4V2FA 3HKZN 2NS7A 2NS8A 4AUXA 2AHQA 3Q0UA 1ITYA 1BW6A 2NVTJ 4W97A 4A3GJ 3OOUA 2PMZN 1FIPA 1CQTA 1PUFA 2R0QC 1APLC 3S17J 3SJMA 2JA7J 1ZKGA 3B6AA 4CYCA 5J1RA 2K9SA 2X48A 3DCFA 5EZGA 4EEFG 1MBGA 2Y31A 4BBSJ 1MBKA 3LSJA 1A5JA 2LKXA 4JP0A 4MFDA 4MFEA 2R92J 2XGDA 1F43A 2GLOA 2XB5A 3WHCA 5F04A 1WI3A 5IPAA 2ME0A 2I10A 2K9NA 1P7IA 5K7ZA 2X9DA 1Q1VA 4M3FA 1XC5A 1JJ8C 1G2HA 3JRGA 4C3HJ 4XRSA 1TWFJ 2M8GX 3WHBA 1U9OA 3GTGJ 4LOCA 2CQXA 1X58A 1WH7A 3HEFA 3BTLA 1TWCJ 1LE8A 2Y0SN 3S15J 4X6AJ 2M34A 1ZR2A 1ORKA 2VKEA 2CUEA 2D5VA 2COBA 1RR7A 2E1OA 2B63J 1IUFA 4GFBA 2LLKA 3F0CA 2P81A 3JRHA 3MKLA 2XGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VND A;  4ABZ A;  3DEW A;  1W0T A;  3TW6 A;  4B3A A;  3O8H A;  2FQ4 A;  2HXO A;  3PO2 J;  5M5X J;  1RPW A;  4IEJ A;  4JX4 A;  4XK4 A;  2R5Y B;  3UKG A;  2XRL A;  1JTX A;  3S1M J;  2CU7 A;  2RAE A;  2DA1 A;  1VI0 A;  2NVQ J;  1IGN A;  3ZQF A;  4UUS B;  4FCY A;  2JWT A;  4IHV A;  4DYQ A;  4C2M J;  5JLX A;  5FKM A;  5IP6 A;  2IBD A;  3QQA A;  1GUU A;  1ZR4 A;  1GDT A;  2DMT A;  3LSP A;  4IHW A;  1RKW A;  3ZQG A;  2TRT A;  5F0H A;  2XPU A;  3SDG A;  1I6H J;  2JA5 J;  1NTC A;  5FKK A;  3MVP A;  3JRD A;  5C3E J;  3Q3S A;  5K7H A;  5FLM J;  1BL0 A;  2Y30 A;  3BG3 A;  3S14 J;  1RES A;  4UUT A;  2XB0 X;  5HOD A;  4A3M J;  4BXX J;  5E3M A;  2GBY A;  2ELK A;  1O4X A;  1GVD A;  4I6Z A;  1TC3 C;  3GTK J;  4RBO A;  3BG9 A;  2M2E A;  1PUF B;  4D7M A;  1AU7 A;  3HOY J;  2EBI A;  1RKT A;  1X2N A;  1ETX A;  2JMW A;  3I4M J;  3JRA A;  4M3G A;  2Y9Z A;  5IOZ A;  1GV5 A;  2GM4 A;  2E19 A;  2G0E A;  3BR0 A;  5JLW A;  2R5Z B;  5FKL A;  1JKO C;  1SFO J;  2YS9 A;  3FKI J;  3QPS A;  4IHY A;  1ZK8 A;  4XIC A;  1Z77 A;  2CJJ A;  3I4N J;  3A01 B;  1JUP A;  1ETK A;  1P7J A;  2YUS A;  3CMY A;  4Y52 J;  1ETY A;  2DA6 A;  3LSR A;  3RZD J;  3GTQ J;  1XS9 A;  4DYR A;  1QVT A;  1FTZ A;  5E3N A;  3HOV J;  3S1R J;  2Y2Z A;  2R7Z J;  3BTC A;  1BA5 A;  3HBL A;  5FLV A;  1EF4 A;  5DTD A;  2IEK A;  2W48 A;  1QVU A;  4XRS G;  2E2I J;  3VPR A;  1T33 A;  2LFB A;  2CQQ A;  3FIS A;  3HB9 A;  1BJZ A;  4A3J J;  3FK6 A;  3JRC A;  4XRM A;  4A3K J;  1JT6 A;  2DA2 A;  2ID3 A;  2L7F P;  5F0F A;  5C44 J;  5EF6 A;  3FK7 A;  3BG5 A;  4BKX A;  1GV2 A;  2E2J J;  1R9T J;  2QCO A;  1E3O C;  2JA6 J;  1K83 J;  1LE8 B;  3RZO J;  3JRF A;  5EDN A;  1JKQ C;  3A02 A;  2IAI A;  4QIW N;  2WB1 N;  2HOT A;  3S2H J;  3BR2 A;  1H89 C;  5IP7 J;  4Y7N J;  1VF9 A;  1WH5 A;  2DA7 A;  1MSF C;  1JT0 A;  3JRE A;  2FX0 A;  4DW6 A;  4MLO A;  5M3M J;  3GBG A;  1JKP C;  1MBH A;  2L9R A;  2MW8 A;  2ECB A;  3O8G A;  5EG0 B;  2HOS A;  2LR8 A;  2JJ7 A;  2MGQ A;  5IYB J;  4CYC B;  3S1N J;  2DMQ A;  2VI6 A;  5E3L A;  4M3D A;  5DS9 A;  3S2D J;  4G12 A;  1IV6 A;  3FIW A;  2O9L A;  1MH3 A;  1ENH A;  2EZI A;  4MIM A;  2DA3 A;  2MSY A;  1HCR A;  1IG7 A;  3C2B A;  5FJ8 J;  3LOC A;  5EGO B;  1B72 B;  1H8A C;  2O8K A;  3M3Y J;  1ETO A;  4IHX A;  5J3L A;  4A3B J;  1WCM J;  2DMU A;  3BQZ A;  4FTH A;  1ZTR A;  2XPV A;  3Q0W A;  2LP0 A;  1TWA J;  4FIS A;  2LY9 A;  2DA4 A;  5J1U A;  1ETQ A;  3ZQL A;  1LFU P;  2Y9Y A;  1VFC A;  3ZQH A;  2XGC A;  3RKQ A;  2O7O A;  3BTJ A;  2L7M P;  1FTT A;  1HDP A;  3RQI A;  3ZQI A;  5F08 A;  5BNG A;  2MG4 A;  4V2G A;  4B4C A;  4UUS A;  3CCY A;  3G1L A;  3QPL A;  2JA8 J;  4A3D J;  2K40 A;  4A93 J;  1Y1V J;  4MO7 A;  5F27 A;  4W1U A;  3H0G J;  3IV5 A;  1IC8 A;  4JYK A;  1IJW C;  4XID A;  4DZJ A;  5IYC J;  3TP3 A;  1D5Y A;  2LK2 A;  4B1R A;  1Y1W J;  1NK2 P;  2QF7 A;  1DU6 A;  5F0C A;  3BTI A;  1XG1 A;  2R93 J;  1K61 A;  1IDZ A;  2VKV A;  2R5Z A;  3LNQ A;  2DJN A;  2N8G A;  4A3E J;  5GP9 A;  1MBE A;  1ZQ3 P;  1ETV A;  2HI3 A;  4BY7 J;  5EYR A;  1TWH J;  2DN0 A;  4C3I J;  5FKO A;  2M0C A;  1U8B A;  3SFI A;  3JRB A;  1U9N A;  3BT9 A;  2KT0 A;  3K2A A;  3E7L A;  5M3F J;  1YRN A;  2VPR A;  2H8R A;  4JX6 A;  1T56 A;  3IH2 A;  2OF7 A;  4NDL A;  3IH4 A;  3D1N I;  2XPW A;  4J19 A;  2ECC A;  4M3E A;  2AO9 A;  3CQZ J;  3HM5 A;  1X2M A;  5C4J J;  1MBJ A;  4L5E A;  1FEX A;  1B8I A;  2EQR A;  1JUM A;  1JTY A;  3B6C A;  1H88 C;  3HOU J;  2DTZ A;  2HQ5 A;  1MH4 A;  3PM1 A;  4JX5 A;  4DZP A;  3TED A;  1OFC X;  1UHS A;  1BW5 A;  4M3B A;  2DA5 A;  3LSG A;  1RET A;  1MSE C;  9ANT A;  2R5Y A;  1SAN A;  2LTP A;  2FD5 A;  3HOX J;  2EH3 A;  4A3C J;  1AKH A;  5M5Y J;  3GTO J;  3Q0V A;  5EG0 A;  5C4X J;  5EZH A;  2H1K A;  1ETW A;  5EGO A;  1FJL A;  1UMQ A;  5IP9 J;  2E2H J;  2TCT A;  3HGY A;  4HNV A;  3GTJ J;  1S7E A;  2JN6 A;  4I76 A;  1WPK A;  1ZGW A;  3G1O A;  3BQY A;  3BR6 A;  5GPC A;  3K7A J;  1JJ6 C;  3S1Q J;  1IDY A;  4X1E A;  1GT0 C;  3M4O J;  3BR1 A;  5F1J A;  4AYB N;  1HDD C;  1MBF A;  1UG2 A;  3GTL J;  2L0K A;  5IYD J;  3GTM J;  5E3O A;  4D5C A;  2FJ1 A;  2DMN A;  1F36 A;  4FE4 A;  2ME6 A;  2WAQ N;  1FIA A;  1JUS A;  3OSG A;  2NOG A;  2ZB9 A;  2HDD A;  5FKN A;  2WV1 A;  3CDL A;  4S0H B;  5GPA A;  4D5F A;  1NK3 P;  3HOW J;  2EZH A;  1OCP A;  5EEA A;  1OJL A;  5K7F A;  1LFB A;  2M9H A;  4RDU A;  5IOY A;  2LVS A;  1AKH B;  4BY1 J;  1QRY A;  2OPT A;  4A3F J;  3HGG A;  3BR3 A;  1MNM C;  3TW7 A;  2KDZ A;  1I50 J;  1U78 A;  1QPI A;  2ID6 A;  5M5W J;  2K9Q A;  3OSF A;  1HLV A;  3BR5 A;  2EZK A;  3JRI A;  4C3J J;  3TP0 A;  3A01 A;  4BBR J;  2XSD C;  1Z0X A;  2EZL A;  2HOA A;  2HXI A;  3S16 J;  1B8I B;  3H3V K;  1IRZ A;  4A3I J;  1JKR C;  2X6O A;  3HDD A;  3G1M A;  1HOM A;  4QSH A;  4A69 C;  3L1P A;  2DMP A;  1YRN B;  2L7Z A;  4AC0 A;  3IH3 A;  2HYJ A;  3ZQC A;  1HF0 A;  1OCT C;  3GTP J;  1POG A;  1WGX A;  3OIO A;  1JGG A;  1DU0 A;  1W0U A;  2VUM J;  4QTR A;  3HOZ J;  2CUF A;  1I3Q J;  2NVX J;  2NVY J;  3JR9 A;  1B72 A;  3NAR A;  4M6V A;  4DYC A;  3W6V A;  2CRG A;  3PO3 J;  4D7N A;  1AHD P;  1TWG J;  2YU9 J;  4A3L J;  2JK3 A;  4FE7 A;  3A03 A;  3NAU A;  3ZOB A;  5J1Y A;  3MN2 A;  1A6I A;  2LD5 A;  4V2F A;  3HKZ N;  2NS7 A;  2NS8 A;  4AUX A;  2AHQ A;  3Q0U A;  1ITY A;  1BW6 A;  2NVT J;  4W97 A;  4A3G J;  3OOU A;  2PMZ N;  1FIP A;  1CQT A;  1PUF A;  2R0Q C;  1APL C;  3S17 J;  3SJM A;  2JA7 J;  1ZKG A;  3B6A A;  4CYC A;  5J1R A;  2K9S A;  2X48 A;  3DCF A;  5EZG A;  4EEF G;  1MBG A;  2Y31 A;  4BBS J;  1MBK A;  3LSJ A;  1A5J A;  2LKX A;  4JP0 A;  4MFD A;  4MFE A;  2R92 J;  2XGD A;  1F43 A;  2GLO A;  2XB5 A;  3WHC A;  5F04 A;  1WI3 A;  5IPA A;  2ME0 A;  2I10 A;  2K9N A;  1P7I A;  5K7Z A;  2X9D A;  1Q1V A;  4M3F A;  1XC5 A;  1JJ8 C;  1G2H A;  3JRG A;  4C3H J;  4XRS A;  1TWF J;  2M8G X;  3WHB A;  1U9O A;  3GTG J;  4LOC A;  2CQX A;  1X58 A;  1WH7 A;  3HEF A;  3BTL A;  1TWC J;  1LE8 A;  2Y0S N;  3S15 J;  4X6A J;  2M34 A;  1ZR2 A;  1ORK A;  2VKE A;  2CUE A;  2D5V A;  2COB A;  1RR7 A;  2E1O A;  2B63 J;  1IUF A;  4GFB A;  2LLK A;  3F0C A;  2P81 A;  3JRH A;  3MKL A;  2XGE A; 
#chains in the Genus database with same CATH topology
 4KIS A;  3OYG A;  3SZG A;  5J4V A;  1YFH A;  2FQ4 A;  2HXO A;  3PO2 J;  1U3E M;  4IEJ A;  1Z7L A;  1IN5 A;  4AIJ A;  3UKG A;  1JTX A;  4DBR A;  2CU7 A;  2DW4 A;  2RAE A;  4II3 A;  1D8K A;  4FAS D;  3OWT A;  4BYY A;  2D1V A;  1IGN A;  4UUS B;  2VQG A;  2E1C A;  2VXZ A;  4BXU A;  4AIK A;  4G6D A;  3K70 D;  3AG1 H;  2FA5 A;  1YX5 A;  5IP6 A;  2M45 A;  2IBD A;  4P9U A;  3KP2 A;  1ZEL A;  1FSH A;  1LKX A;  3QU3 A;  1TL8 A;  1ZLK A;  5BPD A;  4G7Z F;  1DP7 P;  2DMT A;  3LSP A;  1S6L A;  4LJZ F;  5LBQ A;  3FHZ A;  3OYM A;  2JVH A;  5F0H A;  2KIS A;  4D0P A;  1LDJ A;  3OYN A;  4CCK A;  3JRD A;  2PI0 A;  2VKD A;  4HW0 A;  2AQE A;  1R58 A;  1X3W B;  2BYV E;  2MBF A;  5E1W A;  4E4H A;  2CG4 A;  1SFU A;  3ABM H;  4ZYD A;  1XN7 A;  2FQ3 A;  2BW3 B;  4I6Z A;  4RAF A;  3L2U A;  5KVR A;  1R4N B;  5CVV A;  4D7M A;  4B43 A;  4G94 A;  2R7O A;  3OYL A;  1U6G A;  1IXS B;  1NH3 A;  3DBL B;  1Z1D A;  2EBI A;  3PIO F;  2KDO A;  1XGN A;  2Y0M A;  4CO8 A;  3SEZ A;  3BR0 A;  4JBA A;  4MHG A;  2WV0 A;  2RNG A;  2XKP A;  4DNC A;  2F5E A;  3R0A A;  2FBH A;  2DDB A;  1JKO C;  2VKH A;  5JHU A;  2YX7 A;  3WG7 H;  3BC8 A;  4QWQ A;  3FKI J;  4CHU A;  5AON A;  3CD6 I;  4U0W A;  4KNY A;  1R5G A;  2CUZ A;  1MDM A;  1JUP A;  1ETK A;  4Y52 J;  2BEO A;  3HJE A;  1F9N A;  2BHY A;  3GTQ J;  1XS9 A;  5HVQ C;  1R36 A;  2E36 A;  3FXR A;  3BPV A;  5E1Z B;  3SZT A;  5E3N A;  3HOV J;  1J2X A;  3HTU A;  3T0Y A;  3HBL A;  3ZN0 A;  4R79 A;  3G6E I;  2OQG A;  3ZR8 X;  3GEZ A;  1U5T C;  3RDI A;  2MYS A;  2KRH A;  2E2I J;  1T33 A;  3ZRG A;  1Z91 A;  3HPG A;  1BJZ A;  4A3J J;  3FXJ A;  3JRC A;  1V4R A;  2ZNY A;  3G73 A;  4O3M A;  2HR3 A;  3LQQ A;  5DM6 F;  5A2Q Z;  5EF6 A;  1EJ9 A;  4LG0 A;  2JSP A;  3L7W A;  5IT3 A;  4HQE A;  1J75 A;  1E3O C;  1D5V A;  2JA6 J;  3JRF A;  3F21 A;  2VLA A;  2R7D A;  1JKQ C;  4EM1 A;  4QIW N;  2HDW A;  2HOT A;  3BR2 A;  1A36 A;  2EIN H;  5IP7 J;  1VQM I;  2B7E A;  4P55 A;  4AYB A;  1FOW A;  2LKS A;  1MSF C;  3DP7 A;  1QHG A;  2L3D A;  3CZ6 A;  4KIC A;  3ABU A;  4MLO A;  2ZJQ F;  5M3M J;  3KX2 A;  3G4S I;  3O8G A;  5EG0 B;  2HOS A;  3IP4 B;  3MZY A;  2DYS H;  3K1M A;  4PGG A;  5D5U B;  1FOY A;  4NUB A;  5FFZ A;  3K4L A;  4CYC B;  3K4C A;  3GF2 A;  2VI6 A;  2E5Z A;  3FIW A;  2E1M C;  2CW0 F;  1MJA A;  1MH3 A;  3Q9V A;  3IRR A;  3OYK A;  1RZ4 A;  2VAS A;  2EWN A;  4YFX F;  3DKY A;  1XX5 A;  4Z6Y A;  2P5V A;  2LG4 A;  3HUG B;  4IQJ A;  3PFY A;  3O2P E;  4A2U A;  2HDC A;  3C2B A;  5FJ8 J;  4EJU A;  2CQ7 A;  3HHG A;  2DO7 A;  3LOC A;  4M6Y A;  4U88 A;  3IAS 2;  4LIT A;  3ZMD A;  4YFK F;  1H8A C;  1O3T A;  4IHX A;  4A5N A;  5F64 A;  1EH6 A;  2ZO4 A;  1ZTR A;  2MLG A;  3CUQ B;  4I01 A;  4E6K G;  2XRO A;  3GFJ A;  4F7Z A;  3EQL F;  3KLO A;  2VJI A;  2LY9 A;  2DA4 A;  1P4W A;  2F6C A;  2EIK H;  2K27 A;  3R61 A;  1LFU P;  5L3C A;  3DFG A;  5CVU A;  3OYD A;  2DPU A;  3ZQH A;  2V1U A;  2MC4 A;  4TV7 A;  1BC8 C;  2I8D A;  1HDP A;  3I5U A;  2ZME A;  3KP7 A;  1BR2 A;  3CCY A;  3G1L A;  2HPI A;  4HAM A;  4A3D J;  2Q0O A;  4A93 J;  3FDY A;  4AID A;  1TT5 B;  1XGS A;  3PNV A;  4NBQ A;  1IC8 A;  1R22 A;  4XID A;  3V7C A;  1O7F A;  4A6E A;  3TP3 A;  4H0E A;  2CUJ A;  4NC6 A;  4B1R A;  3CCR I;  1HXD A;  1R49 A;  4ZYA A;  1XG1 A;  3CCQ I;  3DV8 A;  3L2Q A;  2PJP A;  4AVZ A;  3VOE A;  2IS1 A;  1U8R A;  3COA C;  1BIA A;  3FMR A;  4K2E A;  5D6E A;  3GX4 X;  4N9I A;  2X1D A;  4MNU A;  4L18 B;  2HI3 A;  2K7L A;  5JVT A;  1DUX C;  3LAP A;  1TWH J;  3K10 A;  4C3I J;  3P5J A;  4IQ4 A;  4II2 A;  1SMT A;  5FKO A;  2M0C A;  1LVA A;  5DD4 A;  3JRB A;  3ECO A;  4CCN A;  3H92 A;  3IUO A;  1Y0N A;  4WXH A;  3DTE A;  1BN5 A;  3EYI A;  3JSP A;  3IH2 A;  4Q48 A;  2JRT A;  2OF7 A;  3KIO A;  3OYE A;  3D1N I;  2BXY A;  4J19 A;  2V1D A;  3JW4 A;  3CQZ J;  1MJ9 A;  3LA7 A;  4Y3O A;  4EGZ A;  3WOD F;  2UZK A;  1DDN A;  5C4J J;  1FMV A;  2IGN A;  3HL2 A;  5CYV A;  1LVK A;  3NRV A;  1MMS A;  3B6C A;  3UNG C;  3H5R A;  1R71 A;  1YYV A;  2YSR A;  3DEU A;  3F22 A;  3CCM I;  1F4K A;  1IF1 A;  2UWM A;  1LEB A;  2VC1 A;  1MMN A;  3ONQ A;  3TL4 X;  4LMY A;  3OL4 A;  2EFO A;  1RR8 C;  2DA5 A;  1RET A;  4AVP A;  1WWX A;  4LB6 B;  1LDK B;  2FD5 A;  3HOX J;  4CCJ A;  4H4K C;  2EH3 A;  4XRF A;  5M5Y J;  1S8N A;  2RKH A;  3MZH A;  3NQO A;  5E79 C;  5C4X J;  3CJN A;  2H1L A;  2PJR B;  1MJB A;  1UMQ A;  3MKY B;  2HZD A;  5FRO A;  2HU9 A;  4U0V A;  2M8E A;  4N4O B;  2CYY A;  1WQ2 A;  3DPU A;  4LK1 F;  1SD5 A;  1ODD A;  2X85 A;  3DXJ F;  2O61 A;  1LB2 A;  2J5O A;  3S1Q J;  2ZKZ A;  3M4O J;  5F1J A;  4AYB N;  3GTL J;  5IYD J;  1DPU A;  3CC4 I;  4NC8 A;  5BQT A;  2NS0 A;  2FJ1 A;  1T2K A;  2Z9O A;  1WJF A;  3EUA A;  3TBI A;  1FIA A;  1JUS A;  3TOA A;  5E20 A;  4BS9 A;  4LD5 A;  3CLO A;  1IO2 A;  2HVQ A;  3V8K A;  1NK3 P;  5GTH C;  2LH9 A;  3P9C A;  4LIV A;  5D5X B;  5K7F A;  3H5N A;  2M9H A;  4RDU A;  3KYC B;  3L2V A;  1HW2 A;  1AKH B;  2L7K A;  2Y75 A;  2BBY A;  1QRY A;  4RS8 A;  2OPT A;  3G3Z A;  3CCU I;  5D8K B;  1I50 J;  2JVG A;  2WAF A;  2XF6 A;  3CUQ C;  2HWV A;  3KZI C;  1FT9 A;  1XMK A;  2K3F A;  2LY2 A;  1LNW A;  2ZSH B;  1NG6 A;  3FHN A;  1HLV A;  2EZK A;  2F4O B;  4UVB A;  2ZME C;  2W24 A;  1BR4 A;  5DYM A;  3QP6 A;  3TP0 A;  2XSD C;  3DPL C;  2GZW A;  2V6E A;  4NHJ A;  2HOA A;  3KZY A;  3S16 J;  2HYG D;  1YLF A;  3MD2 A;  5L3E A;  3FMQ A;  4XSX F;  4MQ9 F;  1GHC A;  3R60 A;  1HOM A;  1MW7 A;  1WKM A;  2OC6 A;  3ML6 A;  2O3F A;  1V54 H;  2ZXI A;  4RB0 A;  3RIR A;  2DMP A;  3M8J A;  4A6D A;  3PUB A;  3HUG A;  3ZQC A;  1V3F A;  3H36 A;  2CSO A;  1GXQ A;  1ZLJ A;  3GTP J;  1POG A;  3KLN A;  5K5O A;  1W0U A;  2MD5 A;  2XV4 S;  2W4S A;  2JUC A;  3GCM A;  2NYX A;  4UB6 C;  3I0T A;  5AIQ A;  3HOZ J;  2CUF A;  1I3Q J;  1T39 A;  3QRF F;  3AG4 H;  3DF8 A;  5HLH A;  3E97 A;  4DYC A;  1TWG J;  2QSF X;  4X0G A;  2KL4 A;  4LK0 F;  3ZOB A;  2MFZ A;  2LD5 A;  1TQP A;  4G6Q A;  5KAF C;  2NS8 A;  1KGS A;  1ITY A;  2FE3 A;  2NVT J;  4GRI A;  4W97 A;  4Q47 A;  2XHK A;  1IN7 A;  1V5G A;  2VQL A;  1Z3X A;  2EJR A;  4HQM A;  3MCZ A;  1CQT A;  4OIO F;  4EJW A;  2R0Q C;  1APL C;  2A69 F;  2HQR A;  4XON A;  1OPC A;  4HNU A;  1PVE A;  2GA2 A;  5CKT A;  2A68 F;  3LFK A;  3RKW A;  1VTN C;  1P4A A;  1K4S A;  2X48 A;  5EZG A;  1FSE A;  1MBG A;  1HW1 A;  3LST A;  3K6G A;  4BBS J;  4P1W A;  2XAJ A;  1MBK A;  1I6X A;  2XAG A;  3LSJ A;  2LKX A;  1A35 A;  2F5D A;  4MFE A;  3CTA A;  2R92 J;  3Q5F A;  4IVN A;  1F43 A;  5BOX A;  1Y8Q B;  3M1C A;  3ASN H;  5DCM B;  1TQM A;  2E7W A;  4PJM A;  2ME0 A;  2I10 A;  3V7S A;  2K9N A;  1P7I A;  1UHW A;  5K7Z A;  5DD8 A;  4M3F A;  4OMY A;  5ICC A;  2O0Y A;  4L5J A;  1XC5 A;  4MEX F;  1BOA A;  2R7Q A;  3PNT A;  1TWF J;  3JTH A;  2V1N A;  3WGG A;  3K4J A;  3IRQ A;  1X58 A;  2JPC A;  4BHP A;  5CQE A;  3BTL A;  1E17 A;  1TWC J;  3S15 J;  1N78 A;  2M34 A;  5K5Q A;  3HKZ A;  1B59 A;  2V9P A;  1S29 A;  3OL3 A;  2E34 A;  2MH9 A;  4U0Y A;  3OR2 C;  2E1O A;  3CF2 A;  1IUF A;  3HRM A;  2GAU A;  4GFB A;  1LJ9 A;  2P81 A;  3IHU A;  1SD6 A;  4CIC A;  3OYA A;  3AL0 C;  5EEH A;  3I9V 2;  1VND A;  4ABZ A;  1UJ8 A;  1T98 A;  1Z6R A;  4FHT A;  1FZP B;  3ZN1 A;  5E8G A;  3E6M A;  2RNJ A;  3O8H A;  2R7F A;  3FXQ A;  1OYW A;  5H20 A;  1GXP A;  2XSJ C;  4U7D A;  2LKP A;  3VOD A;  2JTV A;  2DA1 A;  4PSX A;  2H6B A;  2IJL A;  1SVM A;  1VI0 A;  3PSF A;  1WVR A;  3DLA A;  2DK5 A;  3GO5 A;  4U7B A;  2OA4 A;  3ZQ7 A;  4DYQ A;  4O6J A;  3WTW C;  5JLX A;  2DQR A;  4PZJ A;  3DWL E;  4KT6 A;  4ESB A;  3GFI A;  3QQA A;  1GDT A;  1UFM A;  1B4A A;  2CS3 A;  4UUV A;  3H1C A;  4GO1 A;  1KYZ A;  2P0W A;  2TRT A;  3HSE A;  2IRF G;  2FEZ A;  2PFB A;  2W85 A;  3SDG A;  3V8L A;  2JA5 J;  1NTC A;  3OIP A;  3RPU A;  3CCJ I;  5K7H A;  3QPT A;  1OCC H;  3BG3 A;  1QHH D;  1YX3 A;  2XB0 X;  3HG9 A;  4WF2 A;  3M8E A;  4IF4 A;  4BE2 A;  2ELK A;  1GVD A;  4DBQ A;  1TC3 C;  1OR7 A;  3BJ6 A;  4RBO A;  2BY1 A;  2M2E A;  3PSI A;  2O8X A;  3RPU D;  1PUF B;  1KU7 A;  3CES A;  2WAD A;  1ZHF A;  4JOM A;  2DQL A;  3OY9 A;  3PJR A;  3HOY J;  4KYW A;  2K02 A;  3KEQ A;  2ZME B;  1W1W E;  1IRX A;  3I4M J;  2DOF A;  2DBB A;  4M3G A;  3H35 A;  1GV5 A;  2GM4 A;  2E19 A;  2M4K A;  1VQ7 I;  1BR1 A;  2R5Z B;  3GFM A;  2VT2 A;  2HKX A;  2IW5 A;  5HLG A;  5FO5 A;  3I3L A;  4OIQ F;  3L2R A;  4B47 A;  1Z77 A;  4YG2 F;  1P7J A;  3CMY A;  2PMZ A;  1ON1 A;  4XOR A;  2R7U A;  4IRG A;  4XMY A;  3KP6 A;  3SYT A;  2R7Z J;  2R7X A;  2XF7 A;  3BTC A;  2QWW A;  3QAH A;  2EIM H;  3ABK H;  2L4A A;  4IRI A;  3KP3 A;  3K2Z A;  5KHD A;  3U2R A;  5H2F C;  1RUO A;  3HRS A;  4IJA A;  1EF4 A;  1XCV A;  1K6Y A;  4M9X A;  4XRS G;  2R7W A;  1QPM A;  2LFB A;  3L9F A;  5ILV A;  3CDH A;  3HRT A;  2WTE A;  1IRG A;  3HB9 A;  4S05 A;  1CF7 A;  1XPX A;  4A3K J;  5F0F A;  2EPF A;  5LGT A;  2X4H A;  5JFR A;  3BG5 A;  3FK7 A;  4KIG A;  4BKX A;  4S04 A;  1IN6 A;  1GV2 A;  1V5F A;  3QPH A;  2E2J J;  1QU3 A;  2QCO A;  5AIP A;  5DEQ A;  3A02 A;  2KZG A;  2WB1 N;  2JQ7 A;  2A6E F;  1WJA A;  1MMD A;  1X1B A;  1WH5 A;  2M1B A;  1USS A;  1JT0 A;  1T0F C;  2RN7 A;  3F8B A;  1OQY A;  1QBJ A;  4IL6 C;  3ASO H;  3GBG A;  3PUF A;  3WTT C;  3GYH X;  3F72 A;  2FXA A;  2MW8 A;  1E0E A;  3BZ6 A;  3NWT A;  2TDX A;  3I59 A;  1Z9C A;  2M3A A;  2EA4 A;  1Y56 A;  1R7J A;  3QOP A;  3TDU C;  3T1B A;  5IYB J;  4KN7 X;  4PGH A;  1Y8R B;  4MQV A;  3RYP A;  5E3L A;  3K70 C;  4G12 A;  3ZMS A;  5FLX Z;  1IV6 A;  3GUD A;  1HST A;  1A04 A;  3A2K A;  2KIM A;  4RLF A;  3N97 A;  1D0Y A;  4Y4R A;  1MDM B;  2HTS A;  4MIM A;  3H3U A;  5DCM A;  5JR3 A;  1ON2 A;  1HCR A;  5J40 A;  2QQB A;  2VT3 A;  2A6T A;  2MC3 A;  1B72 B;  4IXA A;  2PN6 A;  4RA2 A;  1LFP A;  5KNL A;  2QUF A;  3M3Y J;  1OMI A;  3RCO A;  1KQ8 A;  2VQC A;  4YRV A;  3BQZ A;  4J01 A;  4FTH A;  1PJR A;  3KFW X;  3K4B A;  4DIQ A;  1N25 A;  2BV6 A;  1VZ0 A;  4EQQ A;  1UZC A;  3RQ4 A;  2LF7 A;  2VC0 A;  4FIS A;  3W3C A;  4XKB A;  1ETQ A;  5J1U A;  2WB1 A;  1ZG3 A;  3ZQL A;  1EH8 A;  1HKQ A;  3HPH A;  2PJR A;  2XGC A;  3RKQ A;  5LHH A;  3ABT A;  3C18 A;  5J8C A;  3HOS A;  3OYH A;  3RQI A;  4RB2 C;  5F08 A;  5BNG A;  4V2G A;  3J80 K;  4B4C A;  3TOB A;  2CFX A;  1X1D A;  3WTX C;  2V26 A;  2GOM A;  2X6W A;  3OS1 A;  4W1U A;  3H0G J;  3B02 A;  1H0M A;  4Y13 A;  4WX9 A;  2QEX I;  2UUZ A;  2A5W A;  2QEN A;  4JYK A;  4PJN A;  3VFZ A;  4BEH B;  4XSZ F;  3KET A;  1D5Y A;  1L0O C;  5CQG A;  2HEO A;  2LBF A;  1NK2 P;  2EV0 A;  2NAZ A;  1YJ9 I;  5GAE J;  4ZDO A;  2X6X A;  1ACI A;  3WTZ A;  2HTJ A;  5F0C A;  3BTI A;  1ZG5 A;  2ADU A;  4QPQ A;  1DGR M;  3RSN A;  1S7O A;  2R5Z A;  2ZFU A;  2VL8 A;  2DJN A;  3ZXS A;  1MGT A;  5GP9 A;  1MBE A;  3I58 A;  2YR2 A;  4BAC A;  2F4M B;  5B1B H;  1ETV A;  1ZYR F;  1L3L A;  5EYR A;  3UR3 C;  1U8B A;  4ASN A;  3ZMU A;  1KQ0 A;  3BT9 A;  1U0J A;  4YEJ A;  3P9K A;  3E3V A;  5ERI A;  5H6Q A;  2DT6 A;  5DV5 A;  4OAY A;  4XLF A;  5B66 C;  3ULQ B;  2XPW A;  2HPM A;  3BY6 A;  5HDK A;  1G8X A;  2PMH A;  1X2M A;  3G71 I;  1MNE A;  3S3N A;  2EQR A;  2FMY A;  4C30 A;  4KIF A;  1G59 A;  4CSW A;  1JTY A;  4FT8 A;  5LD2 C;  2F5F A;  2L54 A;  3HOU J;  5L3B A;  2OCE A;  1PP8 F;  2OTL I;  4BNC A;  4EAT A;  3F6V A;  1SFE A;  1OFC X;  2PMU A;  3LAJ A;  1QA6 A;  3BG7 A;  2RV8 A;  3GZN B;  3IKT A;  3LSG A;  4B48 A;  2QKL B;  1YS7 A;  2R5Y A;  1SAN A;  5B1A H;  3Q9S A;  4UNO A;  1BIB A;  2ZJR F;  4D9J A;  5E18 F;  1AKH A;  3L2W A;  3F8M A;  3IKV A;  4BQO A;  5EZH A;  2RQQ A;  1ETW A;  1BM9 A;  1WHU A;  5EGO A;  1YQA A;  1S7A A;  2E2H J;  5IT9 Z;  3HGY A;  3V4G A;  4ENN A;  3JAM Z;  4HLX A;  2QM3 A;  3GTJ J;  2VOO A;  3DLL F;  4I76 A;  1IV8 A;  2BY0 A;  4HX7 A;  3G1O A;  3BR6 A;  3BOQ A;  1JJ6 C;  3K7A J;  3FBN B;  4N9H A;  3BR1 A;  3FWE A;  3W2A A;  1HDD C;  1QQI A;  1UG2 A;  4HSR A;  2L0K A;  3IAM 2;  1HW5 A;  1OYY A;  3GTM J;  1F36 A;  2QSG X;  2ME6 A;  1Q1H A;  3IL2 A;  1VQL I;  2Q1Z B;  3OSG A;  4BL0 B;  1SD4 A;  4XLC A;  2ZB9 A;  1HQC A;  2M5W A;  4HST A;  4AIH A;  2J5P A;  4BJ5 C;  4F3Q A;  1KU3 A;  4S0H B;  3MMY B;  1B9N A;  5F1R A;  2XRN A;  1PP7 U;  4FQG A;  3DTI A;  3AFH A;  1OCP A;  4L9J A;  1OJL A;  4I2O A;  4HX4 A;  2HZT A;  2LVS A;  3GZ5 A;  5L3F A;  1U5T B;  1SFX A;  4BY1 J;  5IT9 K;  1YS6 A;  3JTG A;  3BR3 A;  1MNM C;  4LG3 A;  2QYO A;  2ID6 A;  2DLL A;  3FZV A;  1BI2 A;  3J7Y J;  3BR5 A;  3A1Y A;  1T38 A;  3JRI A;  1WJD A;  3A01 A;  2OTJ I;  3CC7 I;  2WA0 A;  3AG3 H;  4RM2 A;  3W6J B;  1Y0U A;  3HSF A;  2HXI A;  3GLX A;  3QYF A;  5KCM A;  1B8I B;  3R6S A;  4LIU A;  4XKC A;  4A3I J;  2CGP A;  2PLY A;  5DCF A;  2MAB A;  2X6O A;  3TO6 A;  3G1M A;  4QSH A;  3W2V A;  2ISZ A;  1REP C;  1YRN B;  4XKV A;  2IPQ X;  1IN4 A;  2EB7 A;  1KQ9 A;  5HNF A;  2C6Y A;  2RGV A;  1OCT C;  2M7B A;  2PG4 A;  4OU0 A;  2R7R A;  3OIO A;  1DU0 A;  3W2W A;  2CV0 A;  2NVU B;  1ZAO A;  3DU5 A;  3I64 A;  1FP2 A;  1K79 A;  2NVY J;  2EIL H;  4ZDL A;  4C9Y A;  1KON A;  3DBH B;  2HS5 A;  5D4S A;  4M6V A;  4V19 K;  1IUY A;  1OR7 C;  4D7N A;  3D5L A;  1AHD P;  2XAH A;  4A3L J;  2JK3 A;  2E1M B;  3NAU A;  3TO7 A;  3U1D A;  5JVG F;  1OYI A;  3MN2 A;  1A6I A;  4XM3 A;  2NS7 A;  5CJ9 A;  1FP1 D;  3KE2 A;  3BPX A;  2DOE A;  3F9K A;  5J6X A;  4A3G J;  2RDP A;  2DOA A;  1DPR A;  2PMZ N;  1R00 A;  1PUF A;  2X51 A;  1S3J A;  4ZTF A;  3H9Q A;  2QZ8 A;  2XC7 A;  3FMS A;  2XDV A;  3B6A A;  4CYC A;  1YG2 A;  1VQK I;  5J1R A;  3CLQ A;  3DCF A;  5B3S H;  4BAY A;  2Y31 A;  5CVR A;  2IVM A;  3SEQ A;  1D3Y A;  2AQF A;  1UEL B;  2FOW A;  5K1Y A;  5HS9 A;  2GLO A;  2XB5 A;  5F04 A;  1WI3 A;  2WC2 A;  4ZZL A;  1JGS A;  4D1Q A;  1SD7 A;  3CJR B;  2X9D A;  1Q1V A;  2I5U A;  3QYE A;  1CF7 B;  2BGC A;  2NOJ B;  3VWB A;  4XRS A;  3OYB A;  5LRR A;  1ZGA A;  1JE8 A;  4EMS A;  2UV1 A;  4OIN F;  1IN8 A;  3A0B C;  2XAQ A;  2A3S A;  1ORK A;  5TIS C;  3I54 A;  1LPQ A;  1Z05 A;  2K3P A;  3KEO A;  3LA2 A;  1V55 H;  2B63 J;  2F48 A;  4XLH A;  3F0C A;  1FOX A;  2XUB A;  3E6B A;  3JRH A;  5E17 F;  3WTV C;  3DEW A;  4OAZ A;  1W0T A;  3TW6 A;  4HF0 A;  3KPH A;  2E7X A;  3WU2 C;  1VQN I;  4DQ2 A;  1HBX G;  1RPW A;  4ZYG A;  1VQO I;  4JX4 A;  4XK4 A;  2R5Y B;  1B9M A;  2XRL A;  3S1M J;  2VON A;  4UHT A;  3ZQF A;  4FCY A;  2JWT A;  3M9A A;  4XQF A;  4IHV A;  2IP2 A;  3ZMZ A;  1FBS A;  2WAQ A;  2V4J C;  5FKM A;  3RI4 A;  3PFI A;  1GUU A;  2E1N A;  3F6O A;  4BHC A;  4PCQ A;  4HEA 2;  2IT0 A;  1AWC A;  1MIJ A;  2JUG A;  2VBZ A;  2P7C B;  6PAX A;  4LLL A;  1VQ8 I;  5FB2 A;  1RKW A;  2BVM A;  2ZJP F;  3FF5 A;  1KZH A;  3QU6 A;  1QNT A;  2Y69 H;  3MVP A;  5FKK A;  5L3G A;  4ZTJ A;  2ZXJ A;  2O03 A;  1U5T A;  1BL0 A;  1J09 A;  4KMU X;  2Y30 A;  4KMF A;  2R7S A;  2IGM A;  3P9I A;  1JXS A;  3H0D A;  2M0M A;  3SFZ A;  2JZY A;  4UUT A;  3W6K B;  5HOD A;  4A3M J;  4C2U A;  1YIJ I;  1ZAR A;  4E7L A;  3FM3 A;  2H8W A;  4UV9 A;  4XN3 A;  2PQ8 A;  2ESH A;  3BG9 A;  1D0Z A;  3E5Q A;  4A0Z A;  4KDP A;  4PJ0 C;  3I4P A;  4AU7 A;  1EH7 A;  4XKW A;  1R6R A;  3J7Z I;  2KPM A;  1OCR H;  2Z5U A;  2VOP A;  4OIP F;  2Y9Z A;  5IOZ A;  2R7T A;  1FBU A;  1FX7 A;  2KFD A;  4XLE A;  3IC7 A;  3QWL A;  1T0F A;  2VBY A;  2PX9 A;  5FKL A;  1R23 A;  1DGW Y;  2WY8 Q;  4RB1 A;  2XAS A;  4F91 B;  1WJ5 A;  3IWF A;  2YS9 A;  1P2F A;  1JHF A;  1S72 I;  3QPS A;  1P4X A;  3D0S A;  1ZK8 A;  2ELJ A;  2CJJ A;  2GA1 A;  4EJT A;  3A01 B;  4F93 B;  5ILU A;  4HLY A;  4IX7 A;  1UHM A;  2G7H A;  3E5U A;  1R1U A;  2LC2 A;  3OV8 A;  5GTI C;  1PDN C;  4HYE A;  1QVT A;  2XAF A;  1OCZ H;  3S1R J;  2Y2Z A;  4PJJ A;  2L9S A;  1NG7 A;  4LB5 A;  3CP2 A;  5FLV A;  4WXD A;  3RKX A;  3JCU C;  4PK4 A;  4RMN A;  1TQI A;  1WJB A;  1XGO A;  5FLX K;  1X19 A;  4M71 A;  2VBX A;  1FY7 A;  4M6X A;  3VPR A;  1E3H A;  1P92 A;  1ZGJ A;  2CQQ A;  4BE1 A;  2L5Q A;  1RC9 A;  2KLO A;  3DU6 A;  3FXU A;  3FIS A;  1I5Z A;  3FK6 A;  4PFP A;  1TP4 A;  2Z16 A;  2XIG A;  3EDP A;  3U9G A;  3BZC A;  2L7F P;  3VYR B;  2Z3Y A;  2M7A A;  5J47 A;  2HOE A;  3GVA A;  2OCC H;  1YO5 C;  1OCO H;  1BJA A;  2OQR A;  2Q2E B;  3RZO J;  5EDN A;  1RI7 A;  3B73 A;  1D1C A;  2LRE A;  4IZZ A;  4G7H F;  3S2H J;  3EUH A;  1XTA A;  2UXN A;  1H89 C;  1R5I D;  4XLA A;  4Y7N J;  4ENM A;  1VF9 A;  3MAJ A;  3KEY A;  4E7I A;  3M7G A;  3JRE A;  4XR6 A;  5E1X A;  3E5X A;  5IY5 H;  4P9F A;  1NHA A;  4I0A A;  2COM A;  1KA8 A;  2H27 A;  2P7V B;  2V9V A;  5A2Q K;  3WTS C;  3BJA A;  2DDA A;  3OIQ A;  5EEG A;  2FML A;  3CUQ A;  5DM7 F;  4RB3 C;  4CXF A;  2JJ7 A;  2MGQ A;  2X1C A;  4YEL A;  5DS9 A;  4M3D A;  2W84 A;  1KU2 A;  4HZF A;  4ESF A;  4E7S A;  2O9L A;  4ZYH A;  2EZI A;  1MND A;  2MSY A;  1X4P A;  2BW3 A;  1IG7 A;  1KYW A;  4CCM A;  1RRJ A;  5EGO B;  1W5S A;  4NB5 A;  2QQ9 A;  2O8K A;  1W5C C;  2L2O A;  5J3L A;  2G9W A;  2OZ6 A;  3JSO A;  4IO9 F;  1T95 A;  5D6F A;  2KQR A;  2XPV A;  1ONV A;  1R5H A;  4EJV A;  4KN4 X;  3MFK A;  3EYY A;  1LDD A;  2FU4 A;  2VE8 A;  4B44 A;  1D1B A;  2Y9Y A;  4ON0 A;  5L3D A;  5TGT A;  1VFC A;  4OMZ A;  4P96 A;  3R0J A;  2ICW G;  4WWC A;  1FTT A;  2DFH A;  2KRC A;  3ZQI A;  2HKO A;  5CLS A;  2MG4 A;  4UUS A;  1WI9 A;  3REO A;  3WE2 A;  2K40 A;  1Y1V J;  4MO7 A;  5F27 A;  4RGR A;  2HVR A;  2W57 A;  4FET A;  1E3P A;  4B8X A;  2DFE A;  4NQW B;  5KK1 A;  2CMP A;  1GVJ A;  4DZJ A;  4O5V A;  2A05 A;  2DPD A;  2XGX A;  3PNY A;  3FM5 A;  1Y1W J;  1YJN I;  4Y17 A;  2IA1 A;  4L9V A;  2CV2 A;  3WE3 A;  3M07 A;  4PDK A;  1C0W A;  1DU6 A;  2R93 J;  1EA3 A;  1X4O A;  3I71 A;  4HV5 A;  1P9Q C;  2KIU A;  3AL0 B;  1K78 B;  2VKV A;  3CO7 C;  3RPQ A;  5ICG A;  4UVA A;  2N8G A;  4JK1 X;  3O3K A;  4A3E J;  1RUN A;  4G8X A;  1V5E A;  4E70 A;  1UG0 A;  4KJZ A;  4EM2 A;  1D8J A;  4XLN F;  1FNN A;  5J8F A;  4BY7 J;  4B3X A;  2E5N A;  2AXL A;  3SFI A;  3CMA I;  2GIV A;  2QQA A;  2NRA C;  2KT0 A;  2YX4 A;  2HQA A;  2FF4 A;  2P6S A;  3E7L A;  4I99 C;  4L9N A;  5M3F J;  5TRD A;  1SAX A;  1F1Z A;  4JX6 A;  2H8R A;  1JI8 A;  1ZRC A;  1O3S A;  5LHI A;  2DAO A;  3VB2 A;  3FXK A;  2AO9 A;  4HDV A;  4YII A;  3HM5 A;  1YI2 I;  1MBJ A;  2ELH A;  2K9M A;  2P4W A;  2PEX A;  4FX0 A;  1B8I A;  1JUM A;  3G2B A;  3CCL I;  3F8N A;  2K4B A;  1H88 C;  4U87 A;  4QLC U;  5ED4 A;  1DP3 A;  3DPT A;  3FXO A;  3DQV C;  1MH4 A;  3PM1 A;  4JX5 A;  3C7J A;  2GOX B;  2VJJ A;  5LLQ A;  3OR1 C;  3TED A;  1UHS A;  1STZ A;  4M3B A;  3MKW B;  1BW5 A;  1ERD A;  2L9V A;  2CQK A;  1MSE C;  3FKJ A;  9ANT A;  2VJ4 A;  2QQ8 A;  2X6Y A;  3MKZ A;  1UCR A;  1ZN2 A;  2W82 A;  1MMG A;  2O5R A;  2WY7 Q;  1QZE A;  1YW9 A;  2H1K A;  2ZNZ A;  2OAZ A;  1FJL A;  1H9G A;  1YW7 A;  2EIJ H;  2DJI A;  3CJT B;  3CMM A;  5KAI C;  4RAG A;  5IP9 J;  5BPI A;  1T8I A;  2TCT A;  4HNV A;  4DGW B;  1J7K A;  1XSX A;  4OWR B;  2XVC A;  2Y48 A;  5LGN A;  2JN6 A;  2K9L A;  4ZH4 F;  1WPK A;  4C2T A;  2BY2 A;  3BQY A;  5GPC A;  1IDY A;  1GT0 C;  2OZU A;  4BE0 A;  2B0L A;  3DBR B;  3VYT B;  3QYB A;  1Z6T A;  3FX3 A;  2E60 A;  4MTD A;  5E3O A;  3LL7 A;  2K86 A;  4D5C A;  3BP8 A;  3DKW A;  2R3S A;  2DMN A;  3A4C A;  4UB8 C;  4A5M A;  3WU1 B;  1O3R A;  2WBM A;  3J7A Y;  2BZT A;  2D1H A;  2QVO A;  2A61 A;  2ZJ2 A;  2HDD A;  5B5E C;  2LYC A;  2WV1 A;  3CDL A;  3PIP F;  1XSD A;  3CF5 F;  4IOA F;  3HOW J;  2R4G A;  3KP5 A;  2EZH A;  3C1D A;  3SDB A;  3TKY A;  5EEA A;  1D0X A;  1LFB A;  2CWE A;  1I3A A;  4M74 A;  1MMA A;  2MH2 A;  5IOY A;  4IRH A;  3ZGK A;  2ISY A;  3T8R A;  3U21 A;  2EA2 A;  5LEJ A;  2QBY A;  4HF2 A;  2IXS A;  3HGG A;  2P6T A;  2KDZ A;  1J59 A;  1I39 A;  4UVC A;  4BDY A;  2A07 F;  3QP5 A;  4BXF A;  1ZG1 A;  3S3O A;  3OYJ A;  5F6F A;  4BJT A;  2RRE A;  2K9Q A;  1AOY A;  3BCA A;  4M9Z A;  2M4G A;  5CVI A;  2F5C A;  3BRO A;  3SHF A;  1Z0X A;  3H3V K;  2VN2 A;  1TW2 A;  1SC7 A;  1FOK A;  3LSH A;  2CQN A;  2K5C A;  4GGG A;  1W7P D;  3P7N A;  2DTR A;  2ZSI B;  4A69 C;  3L1P A;  3U1K A;  1FMW A;  3ESW B;  4N0B A;  2HVS A;  5LFA A;  4L0Z B;  4AC0 A;  2RVC A;  4M73 A;  4DOZ A;  1Z67 A;  1Z3Y A;  2L01 A;  1JGG A;  1R1T A;  2VUM J;  3ABL H;  4QTR A;  4F92 B;  3GZ6 A;  3L2C A;  5FD6 A;  2NVX J;  2GWR A;  3JR9 A;  3NAR A;  3D5S C;  2CRG A;  3ZQQ A;  4GYG A;  5GAD J;  2HYF A;  2KJB A;  2YU3 A;  2B9S A;  2YU9 J;  4FE7 A;  2JPB A;  3A03 A;  5ICE A;  4RAZ A;  5J1Y A;  1R1V A;  4XOP A;  3J81 Z;  4V2F A;  3HKZ N;  5LGU A;  2K85 A;  5FRM A;  3N05 A;  3S2W A;  3Q0U A;  5BS6 A;  3DKX A;  4E7K A;  4CZC A;  1SFK A;  4CUG A;  2NNN A;  2L9N A;  3OOU A;  1ZRF A;  4PFO A;  3E0J B;  1P6R A;  1B1B A;  1HSJ A;  1YHQ I;  2KIQ A;  3I59 B;  3TGN A;  3SJM A;  4YIR X;  4EJO A;  4NQW A;  4OIR F;  1ZKG A;  3V42 A;  4E7J A;  2OV7 A;  3OYI A;  4EEF G;  1J9I A;  3BWG A;  2NNY A;  4HV6 A;  2E35 A;  1T08 B;  1A5J A;  1PUE E;  4KIB A;  4ZC3 A;  2H94 A;  2DFI A;  2M30 A;  4KFC A;  3AKZ A;  2W7N A;  1QGP A;  4G7O F;  2LMD A;  4GYI A;  3TQN A;  4BUP A;  3SXY A;  4CH7 A;  5ILS A;  2ZXH A;  1G2H A;  4M9S A;  5JHF A;  4C3H J;  3JRG A;  4LLN A;  1TNS A;  3CME I;  2FUG 2;  4EM0 B;  3WHB A;  5FGM A;  3CCS I;  3GLL A;  1BI0 A;  1VQ5 I;  3CUO A;  3MWM A;  4LFU A;  2KHM A;  2CQX A;  3C2H A;  1YW8 A;  3HEF A;  4CDG A;  1XSV A;  1W36 C;  4X6A J;  2Y0S N;  1ZR2 A;  3GW2 A;  3S8P A;  2VKE A;  2CUE A;  1G3W A;  2COB A;  1HKS A;  1LEA A;  3LSM A;  1RR7 A;  4RM3 A;  2Q8K A;  5EJC A;  2QLZ A;  5HS7 A;  2V1X A;  2XGE A;  1HC8 A;  4ZDP A;  1BI1 A;  2OD5 A;  3HHH A;  2QGU A;  2LNB A;  4BEH A;  4WCG A;  4G6T B;  4KT5 C;  2Q2E A;  3ELK A;  4B3A A;  4Q5S F;  5M5X J;  1W4M A;  3GFL A;  1SAU A;  2ESN A;  3BJO A;  3TO9 A;  1W36 D;  2NVQ J;  2Z1D A;  4XOT A;  3OYC A;  4C2M J;  2XAU A;  2GQQ A;  3BDD A;  3N4M A;  1ZR4 A;  2GXG A;  3S93 A;  3EET A;  2LBF B;  4IHW A;  4KIT B;  3H5A A;  3ZQG A;  2IA0 A;  3O6B B;  2CV1 A;  4Y15 A;  2XPU A;  3A0H C;  2QA4 I;  1I6H J;  5GAH J;  3PQK A;  2E71 A;  3ZMT A;  3Q3S A;  3K9T A;  5FLM J;  2AXT C;  2DCE A;  5C3E J;  2VQH A;  4OOI A;  3S14 J;  1RES A;  4HF1 A;  4BXX J;  1FYM A;  4IKF A;  4CCO A;  2Y0S A;  3I56 I;  3HRU A;  1G6N A;  5E3M A;  2GBY A;  1O4X A;  1IZ1 A;  3GTK J;  2QKM B;  1QO0 D;  1GLN A;  4Q4Z F;  3IWZ A;  3K1N A;  4QPO A;  5LEK A;  2H09 A;  4A12 A;  3RKY A;  1AU7 A;  2ETH A;  1VQ4 I;  1X3U A;  1T6S A;  5H6R A;  1PYV A;  1RKT A;  1M1E B;  1X2N A;  1E2X A;  1ETX A;  2JMW A;  3FXL A;  3V7R A;  3JRA A;  4I09 A;  2W25 A;  2G0E A;  2KRF A;  4GDF A;  3GME A;  2V79 A;  3KCC A;  5JLW A;  3LFU A;  2LDU A;  4I7H A;  2X0L A;  3K4N A;  4YIF A;  2D2W A;  1SFO J;  4IHY A;  1FPQ A;  4XIC A;  2GXB A;  2DFF A;  2OUM A;  3I4N J;  3I55 I;  2V6C A;  2YUS A;  4R1H A;  5TJJ A;  3WGI A;  1ETY A;  2DA6 A;  3LSR A;  5ICF A;  3WG9 A;  3RZD J;  3M1E A;  2VOD A;  2CW8 A;  3ZMV A;  4DYR A;  4ITV A;  3SQN A;  1O3Q A;  4HDU A;  1XCB A;  1FTZ A;  1WJE A;  5DUI A;  2JT1 A;  2LSO A;  2GXA A;  3HYI A;  1LUJ B;  1BA5 A;  1KU9 A;  3F3X A;  2ZC2 A;  3E1S A;  1RIO H;  2VIX A;  5DTD A;  2IEK A;  1HA8 A;  1YIT I;  2BHZ A;  4BH9 A;  3K0L A;  3NWS A;  2W48 A;  3LMM A;  1QVU A;  4I0B A;  4RGX A;  1A31 A;  2EFP A;  2RQP A;  2JRM A;  4E7Z A;  2MD0 A;  1UST A;  2HQN A;  4BQQ A;  4XRM A;  1CGP A;  3QOE A;  3CCE I;  1JT6 A;  2DA2 A;  1I27 A;  2ID3 A;  4NC7 A;  4CCL A;  2Z99 A;  5C44 J;  2BVL A;  4ZZD A;  5D5V B;  4A0Y A;  3EUK L;  1WZ2 A;  3E6D A;  3ERM A;  3QOD A;  1K6O A;  2IS6 A;  1R9T J;  1K83 J;  1LE8 B;  4P5O A;  2LOO A;  2X1E A;  3C2G A;  2IAI A;  1IXC A;  1RNL A;  3F23 A;  1I1S A;  1BI3 A;  3PL8 A;  5GAG J;  2KJC A;  2STW A;  1YJW I;  1N75 A;  3GWZ A;  4MTE A;  2DA7 A;  2KIF A;  1ZRE A;  2IGK A;  2F4I A;  4IOC F;  2FX0 A;  3H3Z A;  4DW6 A;  1JKP C;  1A6Q A;  3PQJ A;  4F52 A;  2D45 A;  1MBH A;  3EPZ A;  2L9R A;  2JA2 A;  3KP4 A;  2ECB A;  1J0R A;  2BY3 A;  1EV7 A;  4HRI A;  1FC3 A;  4CZZ A;  2LR8 A;  2DXI A;  3S1N J;  3VDX A;  1O57 A;  2DMQ A;  3S2D J;  1FYK A;  4BGD A;  1SEU A;  2RC4 A;  3BG6 A;  1YIO A;  1ENH A;  1X1A A;  3RTR A;  2DA3 A;  4A0X A;  3MQ0 A;  1WRJ A;  3DTK A;  5LHG A;  3HXL A;  3HSR A;  3VSK A;  1MKM A;  3VYU B;  3RYR A;  1ETO A;  4A3B J;  1WCM J;  2DMU A;  1OLT A;  2VBW A;  3EUH C;  1W5T A;  1X1P A;  4PUS A;  4L9T A;  3LWF A;  4UXN A;  4XNF A;  3J7A O;  1IXR C;  1YOV B;  2LP0 A;  1TWA J;  3Q0W A;  4EVI A;  1VQP I;  5D5W B;  4IPA A;  1YTY A;  4BHB A;  3WGH A;  2O7O A;  5J4Y A;  1X3Z B;  3BTJ A;  2L7M P;  4RAY A;  2P5L C;  2BE5 F;  4E7H A;  4GCV A;  3ZP5 A;  2CFO A;  4FX4 A;  3SZP A;  1WJC A;  2V9K A;  3QPL A;  4HBL A;  4Y33 A;  2JA8 J;  2FOK A;  2KP6 A;  1Y6I A;  3AAF A;  2DT7 B;  3IV5 A;  1EKE A;  1IJW C;  1QZY A;  5IYC J;  3L00 A;  3HOT A;  1G3T A;  2LK2 A;  3LSK A;  2R7V A;  1IRF A;  2VE9 A;  2GIZ A;  4AWX B;  1UB9 A;  2EV6 A;  2QF7 A;  3WTU C;  2IA2 A;  2OBP A;  3RJP A;  1K61 A;  3L09 A;  3KZZ A;  4ZYE A;  2EFW A;  3CCV I;  2FBK A;  1IDZ A;  2ZCW A;  3LNQ A;  2ACJ A;  2XF5 A;  4F55 A;  3GXO A;  1Y39 A;  1B6A A;  1ZQ3 P;  1SVL A;  1XDU A;  2H6C A;  3OOP A;  3MEX A;  1G4D A;  2DN0 A;  4AD9 A;  4EGY A;  1U9N A;  2HNH A;  4KUM A;  2EK5 A;  3M8F A;  3K2A A;  4ANJ A;  1YRN A;  2VPR A;  3HTS B;  4XN0 A;  1T56 A;  1BC7 C;  3ECH A;  4L0Y B;  4NDL A;  3IH4 A;  2STT A;  4YFN F;  3AG2 H;  2WWY A;  2ECC A;  4M3E A;  3FXM A;  1G3S A;  3F8C A;  3T5X A;  4HPQ A;  3NEU A;  4L5E A;  1FEX A;  1U2W A;  1XDS A;  1LQ1 A;  4XL9 A;  1W7P B;  3T8T A;  1XB4 A;  2A5Y B;  4I02 A;  2DTZ A;  1ZH5 A;  4HNT A;  4BU2 A;  2HQ5 A;  1SVO A;  2IGO A;  5CVJ A;  1FWZ A;  4DZP A;  4I98 B;  4HOB A;  3I53 A;  1J5Y A;  1N77 A;  4MEY F;  2Z2S B;  4B09 A;  3LA3 A;  2IS4 A;  2CH0 A;  3H9G A;  1FLI A;  4KA4 A;  2ZBK A;  3K4K A;  1BBY A;  2DOD A;  3E6C C;  2LTP A;  2DI3 A;  2W1O A;  1Z21 A;  4A3C J;  1MD0 A;  4RLQ A;  3HZJ A;  2M87 A;  3Q0V A;  5EG0 A;  1VQ9 I;  3GTO J;  2QBY B;  4J00 A;  4LLG F;  2CW7 A;  1FYL A;  4JQF A;  1W7P A;  2F5V A;  5JI6 A;  4ZJZ A;  3VSL A;  4CGZ A;  4ETS A;  4RGU A;  5D4R A;  2IS2 A;  4XBF A;  1S7E A;  2KKO A;  4CA0 A;  3MZ8 A;  1ZGW A;  3K4M A;  2LF8 A;  3WU0 A;  4X1E A;  2DT5 A;  4DJA A;  2K4J A;  1K78 A;  3DEE A;  3VYS B;  4HG2 A;  3X2Q H;  3ZPL A;  1MBF A;  2BOL A;  5CPR B;  3K1P A;  4L5I A;  3CP8 A;  1BOB A;  3BZK A;  4FE4 A;  3KYD B;  1S9H A;  2WAQ N;  3ISP A;  2PBI A;  2NOG A;  1I1G A;  2G7U A;  1FBQ A;  5HDN A;  1IAW A;  1XGM A;  5FKN A;  1TZL A;  2KMU A;  1ZRD A;  1AA7 A;  3OS2 A;  1OIS A;  5GPA A;  4D5F A;  4CYD A;  3K69 A;  4ESJ A;  2VXD A;  5FD5 A;  1WFX A;  2MA3 A;  2A6H F;  4XLP F;  3TDZ C;  4PSW A;  3WTY C;  1TBX A;  4A3F J;  1TTY A;  3TW7 A;  3F8F A;  2FRH A;  5LRS A;  3J81 K;  1U78 A;  2FNP A;  1SMY F;  5M5W J;  1K4T A;  1QPI A;  2KZV A;  2O6G E;  1YE9 A;  1QZZ A;  1XD7 A;  2YPR A;  3VEP A;  4WK8 F;  3OS0 A;  3OSF A;  2QSH X;  5FRN A;  1TT0 A;  3LSI A;  1H9T A;  3H9J A;  4C3J J;  4BBR J;  1TLH B;  2EZL A;  2DK8 A;  4IHT A;  4NNJ A;  1IRZ A;  4LGW A;  3ERE D;  1Z7U A;  4R8H A;  1JKR C;  3CJQ B;  3HDD A;  2MLK A;  2EFN A;  2Z33 A;  3S3M A;  5E8I A;  3FBI B;  2L7Z A;  4UV8 A;  3OYF A;  3IH3 A;  2HYJ A;  1HF0 A;  1DQU A;  2FBI A;  4HX8 A;  1F5T A;  2ZXW H;  1WGX A;  2F2E A;  4BJ6 C;  2DYR H;  4HA8 A;  2HFH A;  5K5R A;  4AM3 A;  3BLY A;  4UY8 I;  1B72 A;  2NXN B;  3W6V A;  1VQ6 I;  3PO3 J;  1XMA A;  4LG0 B;  3HIF A;  2FNA A;  1TW3 A;  1ULY A;  1WSU A;  2OJE D;  4RGS A;  4BDZ A;  3C3W A;  4AUX A;  2AHQ A;  2FSW A;  1BW6 A;  4WXC A;  1HKT A;  2BXZ A;  1FIP A;  4ENK A;  2AS5 F;  3TMO A;  2EV5 A;  3S17 J;  2V7F A;  2JA7 J;  1G3Y A;  1IW7 F;  5BMZ A;  2DU9 A;  3LQR A;  2VB6 A;  2HGC A;  5HLI A;  2ZFW A;  3R4K A;  2K9S A;  1TNT A;  3V8J A;  2JSC A;  2LRD A;  1R4M B;  3CC2 I;  1OKR A;  4MGR A;  4BQA A;  4JP0 A;  4MFD A;  3BCB A;  3J80 Z;  1UAA A;  2XGD A;  2VPL A;  2P8T A;  5FFX A;  3WHC A;  4Z2Y A;  1D1A A;  3ZCO A;  1S5L C;  5IPA A;  4EV0 A;  2W00 A;  2L4M A;  3JAM K;  3ROU A;  2XKO A;  4BQN A;  1MZB A;  4N4N B;  2P5K A;  3KYL A;  5HNH A;  1JJ8 C;  2L02 A;  2CO5 A;  1O7L A;  2M8G X;  3S32 A;  1U9O A;  3CDI A;  3D5R C;  4IHS A;  3GTG J;  4PJL A;  4LOC A;  1WH7 A;  3CO6 C;  3OMY A;  2VJ5 A;  2UXX A;  1LE8 A;  4GXO A;  5HS8 A;  5HLT A;  1XMX A;  4M72 A;  2D5V A;  3HC7 A;  1JHH A;  1K7A A;  2EFQ A;  1X1C A;  2OU2 A;  5DUK A;  2LLK A;  5HDG A;  4G9Y A;  5DDG A;  2LY1 A;  5D8L B;  5HOO A;  4ENJ A;  2WAE A;  3MKL A; 
#chains in the Genus database with same CATH homology
 1VND A;  4ABZ A;  3DEW A;  1W0T A;  3TW6 A;  4B3A A;  3O8H A;  2FQ4 A;  2HXO A;  3PO2 J;  5M5X J;  1RPW A;  4IEJ A;  4JX4 A;  4XK4 A;  2R5Y B;  3UKG A;  2XRL A;  1JTX A;  3S1M J;  2CU7 A;  2RAE A;  2DA1 A;  1VI0 A;  2NVQ J;  1IGN A;  3ZQF A;  4UUS B;  4FCY A;  2JWT A;  4IHV A;  4DYQ A;  4C2M J;  5JLX A;  5FKM A;  5IP6 A;  2IBD A;  3QQA A;  1GUU A;  1ZR4 A;  1GDT A;  2DMT A;  3LSP A;  4IHW A;  1RKW A;  3ZQG A;  2TRT A;  5F0H A;  2XPU A;  3SDG A;  1I6H J;  2JA5 J;  1NTC A;  5FKK A;  3MVP A;  3JRD A;  5C3E J;  3Q3S A;  5K7H A;  5FLM J;  1BL0 A;  2Y30 A;  3BG3 A;  3S14 J;  1RES A;  4UUT A;  2XB0 X;  5HOD A;  4A3M J;  4BXX J;  5E3M A;  2GBY A;  2ELK A;  1O4X A;  1GVD A;  4I6Z A;  1TC3 C;  3GTK J;  4RBO A;  3BG9 A;  2M2E A;  1PUF B;  4D7M A;  1AU7 A;  3HOY J;  2EBI A;  1RKT A;  1X2N A;  1ETX A;  2JMW A;  3I4M J;  3JRA A;  4M3G A;  2Y9Z A;  5IOZ A;  1GV5 A;  2GM4 A;  2E19 A;  2G0E A;  3BR0 A;  5JLW A;  2R5Z B;  5FKL A;  1JKO C;  1SFO J;  2YS9 A;  3FKI J;  3QPS A;  4IHY A;  1ZK8 A;  4XIC A;  1Z77 A;  2CJJ A;  3I4N J;  3A01 B;  1JUP A;  1ETK A;  1P7J A;  2YUS A;  3CMY A;  4Y52 J;  1ETY A;  2DA6 A;  3LSR A;  3RZD J;  3GTQ J;  1XS9 A;  4DYR A;  1QVT A;  1FTZ A;  5E3N A;  3HOV J;  3S1R J;  2Y2Z A;  2R7Z J;  3BTC A;  1BA5 A;  3HBL A;  5FLV A;  1EF4 A;  5DTD A;  2IEK A;  2W48 A;  1QVU A;  4XRS G;  2E2I J;  3VPR A;  1T33 A;  2LFB A;  2CQQ A;  3FIS A;  3HB9 A;  1BJZ A;  4A3J J;  3FK6 A;  3JRC A;  4XRM A;  4A3K J;  1JT6 A;  2DA2 A;  2ID3 A;  2L7F P;  5F0F A;  5C44 J;  5EF6 A;  3FK7 A;  3BG5 A;  4BKX A;  1GV2 A;  2E2J J;  1R9T J;  2QCO A;  1E3O C;  2JA6 J;  1K83 J;  1LE8 B;  3RZO J;  3JRF A;  5EDN A;  1JKQ C;  3A02 A;  2IAI A;  4QIW N;  2WB1 N;  2HOT A;  3S2H J;  3BR2 A;  1H89 C;  5IP7 J;  4Y7N J;  1VF9 A;  1WH5 A;  2DA7 A;  1MSF C;  1JT0 A;  3JRE A;  2FX0 A;  4DW6 A;  4MLO A;  5M3M J;  3GBG A;  1JKP C;  1MBH A;  2L9R A;  2MW8 A;  2ECB A;  3O8G A;  5EG0 B;  2HOS A;  2LR8 A;  2JJ7 A;  2MGQ A;  5IYB J;  4CYC B;  3S1N J;  2DMQ A;  2VI6 A;  5E3L A;  4M3D A;  5DS9 A;  3S2D J;  4G12 A;  1IV6 A;  3FIW A;  2O9L A;  1MH3 A;  1ENH A;  2EZI A;  4MIM A;  2DA3 A;  2MSY A;  1HCR A;  1IG7 A;  3C2B A;  5FJ8 J;  3LOC A;  5EGO B;  1B72 B;  1H8A C;  2O8K A;  3M3Y J;  1ETO A;  4IHX A;  5J3L A;  4A3B J;  1WCM J;  2DMU A;  3BQZ A;  4FTH A;  1ZTR A;  2XPV A;  3Q0W A;  2LP0 A;  1TWA J;  4FIS A;  2LY9 A;  2DA4 A;  5J1U A;  1ETQ A;  3ZQL A;  1LFU P;  2Y9Y A;  1VFC A;  3ZQH A;  2XGC A;  3RKQ A;  2O7O A;  3BTJ A;  2L7M P;  1FTT A;  1HDP A;  3RQI A;  3ZQI A;  5F08 A;  5BNG A;  2MG4 A;  4V2G A;  4B4C A;  4UUS A;  3CCY A;  3G1L A;  3QPL A;  2JA8 J;  4A3D J;  2K40 A;  4A93 J;  1Y1V J;  4MO7 A;  5F27 A;  4W1U A;  3H0G J;  3IV5 A;  1IC8 A;  4JYK A;  1IJW C;  4XID A;  4DZJ A;  5IYC J;  3TP3 A;  1D5Y A;  2LK2 A;  4B1R A;  1Y1W J;  1NK2 P;  2QF7 A;  1DU6 A;  5F0C A;  3BTI A;  1XG1 A;  2R93 J;  1K61 A;  1IDZ A;  2VKV A;  2R5Z A;  3LNQ A;  2DJN A;  2N8G A;  4A3E J;  5GP9 A;  1MBE A;  1ZQ3 P;  1ETV A;  2HI3 A;  4BY7 J;  5EYR A;  1TWH J;  2DN0 A;  4C3I J;  5FKO A;  2M0C A;  1U8B A;  3SFI A;  3JRB A;  1U9N A;  3BT9 A;  2KT0 A;  3K2A A;  3E7L A;  5M3F J;  1YRN A;  2VPR A;  2H8R A;  4JX6 A;  1T56 A;  3IH2 A;  2OF7 A;  4NDL A;  3IH4 A;  3D1N I;  2XPW A;  4J19 A;  2ECC A;  4M3E A;  2AO9 A;  3CQZ J;  3HM5 A;  1X2M A;  5C4J J;  1MBJ A;  4L5E A;  1FEX A;  1B8I A;  2EQR A;  1JUM A;  1JTY A;  3B6C A;  1H88 C;  3HOU J;  2DTZ A;  2HQ5 A;  1MH4 A;  3PM1 A;  4JX5 A;  4DZP A;  3TED A;  1OFC X;  1UHS A;  1BW5 A;  4M3B A;  2DA5 A;  3LSG A;  1RET A;  1MSE C;  9ANT A;  2R5Y A;  1SAN A;  2LTP A;  2FD5 A;  3HOX J;  2EH3 A;  4A3C J;  1AKH A;  5M5Y J;  3GTO J;  3Q0V A;  5EG0 A;  5C4X J;  5EZH A;  2H1K A;  1ETW A;  5EGO A;  1FJL A;  1UMQ A;  5IP9 J;  2E2H J;  2TCT A;  3HGY A;  4HNV A;  3GTJ J;  1S7E A;  2JN6 A;  4I76 A;  1WPK A;  1ZGW A;  3G1O A;  3BQY A;  3BR6 A;  5GPC A;  3K7A J;  1JJ6 C;  3S1Q J;  1IDY A;  4X1E A;  1GT0 C;  3M4O J;  3BR1 A;  5F1J A;  4AYB N;  1HDD C;  1MBF A;  1UG2 A;  3GTL J;  2L0K A;  5IYD J;  3GTM J;  5E3O A;  4D5C A;  2FJ1 A;  2DMN A;  1F36 A;  4FE4 A;  2ME6 A;  2WAQ N;  1FIA A;  1JUS A;  3OSG A;  2NOG A;  2ZB9 A;  2HDD A;  5FKN A;  2WV1 A;  3CDL A;  4S0H B;  5GPA A;  4D5F A;  1NK3 P;  3HOW J;  2EZH A;  1OCP A;  5EEA A;  1OJL A;  5K7F A;  1LFB A;  2M9H A;  4RDU A;  5IOY A;  2LVS A;  1AKH B;  4BY1 J;  1QRY A;  2OPT A;  4A3F J;  3HGG A;  3BR3 A;  1MNM C;  3TW7 A;  2KDZ A;  1I50 J;  1U78 A;  1QPI A;  2ID6 A;  5M5W J;  2K9Q A;  3OSF A;  1HLV A;  3BR5 A;  2EZK A;  3JRI A;  4C3J J;  3TP0 A;  3A01 A;  4BBR J;  2XSD C;  1Z0X A;  2EZL A;  2HOA A;  2HXI A;  3S16 J;  1B8I B;  3H3V K;  1IRZ A;  4A3I J;  1JKR C;  2X6O A;  3HDD A;  3G1M A;  1HOM A;  4QSH A;  4A69 C;  3L1P A;  2DMP A;  1YRN B;  2L7Z A;  4AC0 A;  3IH3 A;  2HYJ A;  3ZQC A;  1HF0 A;  1OCT C;  3GTP J;  1POG A;  1WGX A;  3OIO A;  1JGG A;  1DU0 A;  1W0U A;  2VUM J;  4QTR A;  3HOZ J;  2CUF A;  1I3Q J;  2NVX J;  2NVY J;  3JR9 A;  1B72 A;  3NAR A;  4M6V A;  4DYC A;  3W6V A;  2CRG A;  3PO3 J;  4D7N A;  1AHD P;  1TWG J;  2YU9 J;  4A3L J;  2JK3 A;  4FE7 A;  3A03 A;  3NAU A;  3ZOB A;  5J1Y A;  3MN2 A;  1A6I A;  2LD5 A;  4V2F A;  3HKZ N;  2NS7 A;  2NS8 A;  4AUX A;  2AHQ A;  3Q0U A;  1ITY A;  1BW6 A;  2NVT J;  4W97 A;  4A3G J;  3OOU A;  2PMZ N;  1FIP A;  1CQT A;  1PUF A;  2R0Q C;  1APL C;  3S17 J;  3SJM A;  2JA7 J;  1ZKG A;  3B6A A;  4CYC A;  5J1R A;  2K9S A;  2X48 A;  3DCF A;  5EZG A;  4EEF G;  1MBG A;  2Y31 A;  4BBS J;  1MBK A;  3LSJ A;  1A5J A;  2LKX A;  4JP0 A;  4MFD A;  4MFE A;  2R92 J;  2XGD A;  1F43 A;  2GLO A;  2XB5 A;  3WHC A;  5F04 A;  1WI3 A;  5IPA A;  2ME0 A;  2I10 A;  2K9N A;  1P7I A;  5K7Z A;  2X9D A;  1Q1V A;  4M3F A;  1XC5 A;  1JJ8 C;  1G2H A;  3JRG A;  4C3H J;  4XRS A;  1TWF J;  2M8G X;  3WHB A;  1U9O A;  3GTG J;  4LOC A;  2CQX A;  1X58 A;  1WH7 A;  3HEF A;  3BTL A;  1TWC J;  1LE8 A;  2Y0S N;  3S15 J;  4X6A J;  2M34 A;  1ZR2 A;  1ORK A;  2VKE A;  2CUE A;  2D5V A;  2COB A;  1RR7 A;  2E1O A;  2B63 J;  1IUF A;  4GFB A;  2LLK A;  3F0C A;  2P81 A;  3JRH A;  3MKL A;  2XGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...