1ETWA

The crystal structure of e. coli fis mutant g72d
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
77
Chain Sequence
DVLTVSKPLRDSVKQALKNYFAQLDVNDLYELVLAEVEQPLLDMVMQYTRDNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 28
structure length 77
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etwA00
1IRZA 1QVUA 2R0QC 1JUSA 3M4OJ 3S14J 2FQ4A 2L0KA 1ETQA 5FKLA 1JUPA 2JN6A 1TWGJ 1MBFA 2MSYA 3LSGA 3HGGA 4I6ZA 3SDGA 4AYBN 1RESA 2L7FP 1POGA 1ENHA 3HB9A 2M34A 5M5YJ 2LLKA 5M5WJ 2XSDC 1F36A 2ME0A 3ZQCA 2R92J 5E3LA 1K83J 4RDUA 3GTKJ 1WGXA 1H89C 5IYDJ 2CUEA 3D1NI 5IP6A 1SFOJ 3HDDA 4XRMA 1DU0A 3HBLA 2WV1A 4B3AA 1HDPA 4XIDA 1GT0C 4D7MA 3S17J 3BTCA 3H0GJ 4M3DA 5F0FA 3ZQHA 4IEJA 5F08A 2HOSA 4A3IJ 2G0EA 3IH3A 3GBGA 1IUFA 2XGDA 1MBGA 3NARA 1U9NA 2PMZN 3JRFA 2Y0SN 1IGNA 4JYKA 1B8IA 1CQTA 4A3GJ 2M9HA 1ORKA 2YS9A 1Y1VJ 4X6AJ 5C4XJ 1ETKA 4CYCA 3UKGA 2WAQN 1ITYA 4DYRA 5M3FJ 3TW6A 3IH2A 3F0CA 3HKZN 1XC5A 3CMYA 4BBSJ 3BTJA 1AKHB 4JX5A 1WCMJ 2DA7A 2Y31A 5FJ8J 1FTZA 3GTJJ 5EGOB 1NTCA 2X6OA 1U8BA 1EF4A 3BR5A 4I76A 2HXOA 2O8KA 1A5JA 1Z77A 4JP0A 2XB5A 2MGQA 3Q0WA 3C2BA 2AO9A 1MH4A 5F0HA 1RR7A 2X48A 2JA7J 3HGYA 3BG5A 2XPVA 3HM5A 4A69C 4QTRA 3S2HJ 2W48A 3HOWJ 2E1OA 4C3IJ 2VKEA 3OIOA 2I10A 3LSJA 2JA5J 3MKLA 3RZDJ 2HOAA 4A3BJ 1LFUP 5IPAA 3G1MA 3FK7A 2NVXJ 4XK4A 5IP7J 1ZTRA 4FE7A 2HDDA 1H8AC 1U9OA 1BW5A 2QF7A 4W1UA 1B8IB 3IV5A 2DMTA 1QVTA 3Q0VA 2R5YB 2LR8A 2COBA 4GFBA 5HODA 2K9SA 2TCTA 1HDDC 3BQZA 1GV2A 3FKIJ 2RAEA 4M3FA 2LKXA 1IG7A 1UMQA 3LNQA 2DMQA 3A03A 3FIWA 3GTOJ 3RZOJ 5EGOA 3HOVJ 5GP9A 2E19A 4J19A 1MBHA 3I4MJ 3CQZJ 1VF9A 1JKOC 4D7NA 2FX0A 1VI0A 5K7FA 2KT0A 1ETOA 3S1MJ 2L9RA 2L7MP 1TWFJ 1GDTA 3K7AJ 2R7ZJ 2KDZA 2NOGA 2EBIA 1HF0A 1JUMA 5EZHA 4AUXA 5GPCA 3B6CA 4M3GA 4B1RA 5IYBJ 3JREA 1R9TJ 2E2HJ 1IC8A 3JRHA 2LTPA 2E2IJ 4AC0A 2P81A 1JGGA 1I6HJ 2CQQA 1JT0A 3QPLA 1F43A 3BG9A 4Y7NJ 2LK2A 3CCYA 2H1KA 1X2NA 1RETA 1PUFB 1TC3C 1MSEC 2K9NA 1O4XA 4D5FA 5F04A 4Y52J 1ZR4A 3BTLA 5FKMA 5E3MA 1AU7A 2R5YA 2JA8J 1A6IA 2DMNA 1GVDA 1HOMA 3RQIA 5K7HA 4IHXA 3S1NJ 4BKXA 4ABZA 3SJMA 4B4CA 2K40A 2TRTA 2HXIA 3TW7A 1BL0A 2MW8A 2VI6A 3G1LA 4FE4A 3VPRA 2LP0A 4C3HJ 3S1RJ 4IHWA 5F0CA 3JRDA 3H3VK 2JMWA 2M2EA 2GLOA 5J1UA 3O8HA 5F27A 5FKKA 1APLC 3A01B 1IDYA 3BR3A 2VPRA 2JWTA 4BY1J 3LOCA 2EQRA 2E2JJ 2NS7A 5EF6A 4X1EA 2ECCA 3Q0UA 3HEFA 1IV6A 2IAIA 3JR9A 3NAUA 3OSGA 1JJ6C 2M0CA 1YRNB 2EZIA 4A3KJ 3TP0A 3JRGA 3GTLJ 5GPAA 2O9LA 2ME6A 1ETXA 2AHQA 3IH4A 1UHSA 1SANA 4UUTA 3GTQJ 2X9DA 4D5CA 1B72B 2DMPA 1P7IA 4G12A 2XRLA 1OCPA 1Y1WJ 5EEAA 1JT6A 2DMUA 5IOZA 3A02A 5FKNA 5J1YA 4C3JJ 1BA5A 2LY9A 1ZK8A 1ETYA 1PUFA 2HQ5A 3LSRA 1TWHJ 4XRSG 1I50J 2R5ZB 1W0TA 1JKQC 3BR0A 2NVTJ 1MBKA 2R93J 1FEXA 3SFIA 3QQAA 2DA6A 3BQYA 1AHDP 1HLVA 3S1QJ 3L1PA 3HOZJ 3B6AA 5EDNA 2CUFA 3PO2J 2WB1N 3QPSA 3MVPA 5E3NA 1LE8B 4JX4A 2IEKA 2M8GX 4MLOA 4QIWN 2Y9YA 2FD5A 2CU7A 2ELKA 3JRIA 3DEWA 3WHCA 3JRCA 2IBDA 5J1RA 1XG1A 1WH7A 1H88C 1WH5A 3S2DJ 1TWAJ 2HYJA 3DCFA 1WPKA 5IOYA 3A01A 2QCOA 5M5XJ 5EYRA 1OCTC 3MN2A 2DTZA 3W6VA 1MBJA 1D5YA 5DS9A 4MO7A 5M3MJ 3O8GA 4EEFG 5EG0B 2NS8A 3HOYJ 3RKQA 1MSFC 2CRGA 4A3MJ 1YRNA 2VUMJ 1ETVA 4V2GA 3BR6A 1JJ8C 3ZQLA 3ZQFA 1BW6A 2YU9J 1B72A 2B63J 4FCYA 2L7ZA 3GTPJ 4BXXJ 1FJLA 1Q1VA 1X2MA 1HCRA 4A3LJ 4A3DJ 9ANTA 3Q3SA 1ZQ3P 1G2HA 2R5ZA 1FTTA 5DTDA 4W97A 4RBOA 1W0UA 1WI3A 3TP3A 2D5VA 3M3YJ 1GUUA 5C44J 4DYCA 2XGEA 5EZGA 4C2MJ 1NK3P 4A3CJ 2YUSA 3G1OA 3CDLA 4FTHA 3BG3A 1LE8A 1IJWC 5K7ZA 1VFCA 3FK6A 3WHBA 2XGCA 4MIMA 4V2FA 2Y9ZA 2H8RA 5C3EJ 4A3FJ 4UUSB 2DJNA 3ZQIA 4A93J 1LFBA 2DA5A 4IHYA 3BR2A 2DA1A 2XPUA 4M3EA 3K2AA 4DZJA 2JK3A 5J3LA 1MH3A 2EH3A 3OSFA 1VNDA 2LFBA 4S0HB 3S15J 2ECBA 1RKTA 1UG2A 1OJLA 3BR1A 2O7OA 5EG0A 5F1JA 2DA3A 2K9QA 4FISA 1OFCX 2ID3A 5C4JJ 3JRAA 1JKRC 1FIAA 2EZHA 1QPIA 4DZPA 2CQXA 1E3OC 1JTXA 1I3QJ 2LVSA 3PM1A 4IHVA 5E3OA 1ZGWA 1K61A 2EZLA 4MFDA 5FLMJ 1JTYA 2DA2A 4NDLA 5JLWA 3ZOBA 3E7LA 2NVQJ 1ZR2A 3LSPA 1T56A 4BBRJ 1ZKGA 4DYQA 1QRYA 1RPWA 5FKOA 3TEDA 4A3JJ 1MNMC 5BNGA 1S7EA 3PO3J 4JX6A 2HOTA 1P7JA 2LD5A 4HNVA 2HI3A 1BJZA 2ZB9A 1GV5A 1JKPC 3HOUJ 2MG4A 4M6VA 3HOXJ 1T33A 2Y2ZA 2Y30A 4A3EJ 2CJJA 2FJ1A 1IDZA 2EZKA 5IP9J 5FLVA 3BTIA 2DA4A 3I4NJ 1U78A 4UUSA 1NK2P 1ETWA 2NVYJ 1MBEA 1FIPA 1Z0XA 4XRSA 4QSHA 3JRBA 1XS9A 2ID6A 3BT9A 2GM4A 5JLXA 1TWCJ 3OOUA 4DW6A 1X58A 2VKVA 2OF7A 3S16J 5IYCJ 3FISA 3ZQGA 3GTGJ 1DU6A 2XPWA 4BY7J 4M3BA 4XICA 3GTMJ 4CYCB 2GBYA 2N8GA 4LOCA 2DN0A 4L5EA 4MFEA 2OPTA 2XB0X 2JA6J 2JJ7A 1AKHA 1RKWA
chains in the Genus database with same CATH superfamily
4HG2A 1TLHB 2R0QC 3TKYA 3BC8A 2BOLA 4Z2YA 4MGRA 2IRFG 4IHTA 2FQ4A 2L0KA 2RDPA 2DCEA 2FA5A 1V3FA 2MSYA 1V5EA 3HZJA 2HYGD 3J7YJ 2D2WA 4I6ZA 2FSWA 3HXLA 2A61A 3HHHA 3CDIA 4PZJA 4RGXA 2R7UA 2L7FP 1BM9A 1GVJA 1POGA 4NNJA 3HB9A 3EETA 2M34A 5M5YJ 1W4MA 1F9NA 2PG4A 3E3VA 4LD5A 3T0YA 2RQPA 4GRIA 5GADJ 1D5VA 1Z7UA 1P6RA 2IA1A 5H6QA 2OQRA 2F4MB 4RLFA 3L09A 2IA0A 4IL6C 4XKCA 1H89C 5CQEA 1SFOJ 3HDDA 3L2RA 1DU0A 3F22A 1WJAA 5FFZA 3OYEA 3F8MA 4DIQA 4MNUA 4M3DA 4BQOA 2AXLA 4IEJA 3K1PA 2G0EA 1D0YA 2CQNA 1J5YA 1MBGA 2PMZN 3JRFA 1IGNA 2CV0A 3H35A 2NNYA 3QOEA 4F3QA 2HDWA 3P9KA 2FE3A 4PFPA 2G7UA 3FBIB 2LF7A 3I53A 1TT0A 3DPTA 2QLZA 3SEQA 3HSEA 6PAXA 5C4XJ 3CUQB 3K4MA 1F1ZA 2R3SA 3OS1A 3CCVI 3L2UA 4GCVA 1Z6RA 1ITYA 4EV0A 2H6BA 5M3FJ 2A5YB 2XF7A 1AKHB 3ABLH 1YIOA 3KZZA 2XV4S 5EGOB 2DOEA 2H09A 4I76A 5TRDA 2XAUA 2COMA 2O8KA 4UB6C 4II2A 2CW7A 2VXDA 3EUAA 1FP1D 2ZSIB 3NWTA 4P9UA 2KISA 1WWXA 1Z7LA 2JA7J 3BG5A 1WI9A 2LC2A 1T98A 3LSTA 2E71A 1BR1A 4XBFA 2FBKA 1ZRCA 3OYBA 3WU1B 1SAXA 3MWMA 5D5VB 2L54A 2A05A 1HKSA 2WTEA 2HOAA 5IPAA 2NVXJ 1J0RA 2KRHA 1VQPI 2VQHA 4OMZA 3MZHA 2OTLI 2VLAA 2A6TA 5DV5A 2QF7A 4G9YA 1RNLA 2YPRA 2QGUA 2QWWA 3WE2A 3IAM2 3ZRGA 1HSJA 2G9WA 2DMTA 1T6SA 3DWLE 2R4GA 3MEXA 3RTRA 1W5SA 1SD6A 4LLLA 3GO5A 4GFBA 1TP4A 3GF2A 1D1BA 2RAEA 2Y0SA 4M3FA 3K4KA 1W7PA 1UMQA 2KKOA 3FKJA 1DP7P 1BJAA 2DMQA 3GZ5A 3JSOA 2CFXA 1VQ4I 4UVBA 4B48A 1I1SA 1MBHA 3CQZJ 1YW8A 1ON2A 2OJED 1VF9A 2I8DA 4WXCA 3JTGA 3J7AY 2CS3A 3R6SA 2DO7A 1X1CA 1A04A 2M4KA 3DTEA 2OZUA 2JVHA 3Q5FA 1P2FA 3ZR8X 4V19K 3S1MJ 4BHBA 2VBYA 4XL9A 4U7DA 4I02A 2HR3A 4QLCU 2H27A 1WJ5A 3B6CA 4XR6A 4CZZA 3F23A 2ISZA 4ZC3A 5GTIC 5HS9A 2E34A 4JBAA 1Y0UA 5BMZA 4AC0A 2LY2A 1EH8A 4LB5A 2RREA 4A5MA 1TTYA 1I6HJ 4EATA 4XORA 2Q2EB 2QEXI 3BG9A 2VIXA 3MZ8A 3ERMA 4LITA 3VDXA 5HS8A 1OCRH 2FOWA 4E7IA 3GLXA 3LSKA 4Y7NJ 3BLYA 3JCUC 3ELKA 4G94A 3HL2A 3CCRI 1MSEC 2EJRA 1OR7C 1EKEA 5J8FA 3HTUA 4D5FA 3FXKA 4PSWA 2Z2SB 3W2WA 2R5YA 1R4NB 5KAFC 3DPUA 2JVGA 1GVDA 5ICCA 2W24A 2PX9A 3RQIA 3I0TA 4YFNF 3S3NA 4IHXA 2GZWA 4E7HA 3TBIA 1K7AA 1QBJA 2HDCA 5HDKA 4BXUA 5TGTA 3TW7A 3GZNB 1VQ6I 4ZZDA 3VPRA 1ZRFA 3DKXA 3A0BC 2DOAA 1S29A 5B3SH 3H3VK 1OYWA 1W7PD 1TNTA 1MDMA 1FWZA 3QAHA 5FKKA 5FB2A 4IHSA 2VPRA 3BR3A 2JWTA 3OYFA 1Y39A 4XNFA 3WTVC 2RV8A 5EF6A 1Y56A 4M73A 1R1UA 1IO2A 1AOYA 3OIPA 1NH3A 2P4WA 5FROA 4B43A 4A3KJ 3RKXA 3QP5A 1ETXA 3E0JB 4QPOA 1UHSA 3GTQJ 5DM6F 1BBYA 1YJ9I 1LFPA 1Y1WJ 2CV1A 4C30A 3HUGB 1Z6TA 2DMUA 4HX8A 3VSKA 2HS5A 4XSXF 1Z05A 5CPRB 3COAC 3TDZC 2LBFA 3H36A 3PQKA 2E1CA 3CP2A 4IF4A 4XLPF 3CJNA 4BEHA 3SQNA 1I50J 2Y0MA 5GAGJ 2PI0A 2EINH 5LGNA 2QBYB 3F6OA 1MBKA 2LMDA 1UG0A 3SFIA 1AHDP 4AIJA 1T8IA 4OWRB 3FMSA 3GUDA 1R5HA 2BXYA 2R7VA 1FSEA 2R7OA 3L1PA 4M9SA 1ULYA 2ZCWA 3B6AA 4NQWA 4AM3A 1ZELA 3MVPA 4EM0B 2VOPA 1X1DA 2PMZA 2Y9YA 2G7HA 1LEBA 4CYDA 2VE9A 1UB9A 1VTNC 5HLIA 3SZTA 4BACA 3S2DJ 1GLNA 2A69F 1U8RA 4LK1F 3IC7A 3RQ4A 3AAFA 2K9MA 4S04A 2VN2A 2DTZA 5DUIA 3W6VA 2AS5F 2F5VA 1OISA 3PNVA 3PL8A 5AIQA 4MO7A 2F2EA 1R22A 2P8TA 2HNHA 2NS8A 4EM2A 2P7CB 3HOYJ 3ERED 1YRNA 1ETVA 4Y13A 4V2GA 2L7KA 3BR6A 3BWGA 3F21A 1O3TA 1TW3A 2R7XA 2TDXA 5FO5A 3BPVA 3CCJI 3JW4A 2B63J 4ESFA 5K5OA 2J5OA 3AL0B 4RGRA 3ML6A 2OCEA 2L2OA 1IRGA 2E5NA 5ICGA 1X1BA 1R49A 3F8NA 2R5ZA 4W97A 3F8FA 3K4NA 1LVAA 3TDUC 4NC7A 2HZTA 2EIKH 3M3YJ 3FXUA 2DDAA 5GAHJ 1LPQA 4A3CJ 5BPDA 3G2BA 3G1OA 1KONA 5DUKA 2LH9A 4B3XA 2HEOA 2VB6A 4FTHA 3S32A 2E7WA 4V2FA 2H8RA 5ICFA 1R1TA 4UUSB 2DJNA 2HPMA 2EA2A 4DBRA 3KP7A 1ZLKA 1R23A 3VYRB 2XPUA 3IAS2 4LIUA 2XAQA 4LIVA 1PUEE 3AG3H 5L3BA 1XD7A 1QZYA 4KDPA 2WB1A 5H6RA 2M8EA 2IS6A 4WXHA 1UG2A 1TQIA 1X1AA 3BR1A 1M1EB 3VODA 2FRHA 2VL8A 1B59A 3D5SC 5F64A 3DKWA 4L5JA 1UELB 5C4JJ 2GIZA 3JRAA 4OAZA 3E1SA 4DZPA 2CQXA 5D4RA 1N78A 2VODA 4HF1A 2EZLA 2DJIA 4M74A 1HKTA 1ZG1A 3KP6A 5DCMA 3L00A 2ZC2A 2A5WA 1ZR2A 3H1CA 1X19A 3E5XA 2ZBKA 2HVQA 2KLOA 1X3UA 4HA8A 5FKOA 3IUOA 4A0XA 2H6CA 4CH7A 1V5GA 2H94A 1XSXA 3DKYA 1MNMC 4CCMA 3V8KA 2DDBA 3BJ6A 3HRSA 5HS7A 5A2QZ 2HOTA 5JVTA 4NBQA 1BJZA 2ZB9A 3P9CA 1JKPC 4HEA2 2MG4A 3FXRA 1AWCA 1FYKA 2KJCA 2R7FA 2LY1A 2L4AA 2Y30A 4M71A 4YFKF 2XROA 1USSA 3IWFA 2PN6A 3UNGC 3F6VA 1X4OA 3GEZA 1X4PA 2MLGA 3DTKA 3OYKA 2HQRA 2V26A 1D0ZA 4BE0A 3TMOA 5DD8A 3QRFF 1KU2A 3K1MA 1NK2P 5KCMA 3CD6I 2ELHA 4QSHA 1B9MA 2M45A 1LEAA 1QHGA 3CCQI 2YX7A 4KJZA 2DK8A 2IS4A 1LNWA 2ID6A 2E36A 3VFZA 2W84A 3JAMK 4H0EA 3KIOA 1X58A 2JQ7A 3S16J 2BBYA 3FISA 3GTGJ 1DU6A 1BIBA 3UR3C 2V1DA 4XICA 2VPLA 3GTMJ 3KP5A 1BI2A 3DLAA 1EA3A 1QO0D 1U5TA 4AIDA 2JUGA 4OIRF 1XN7A 1W5TA 1RKWA 5B1BH 4BE1A 1WFXA 1IRZA 1JUSA 3LMMA 1MJAA 3S14J 2MC4A 5FKLA 2O5RA 4PK4A 1JUPA 4ITVA 4Q48A 4RGUA 4KN4X 3N97A 1TZLA 2KHMA 3G4SI 3WTWC 3IKVA 3HGGA 4I01A 3DTIA 2ZXWH 1NHAA 3SDGA 2FUG2 1RESA 4WXDA 1H0MA 1A31A 1UZCA 1S7AA 2L9NA 4E7LA 1ENHA 1R5ID 3A4CA 3F8BA 2BE5F 1J7KA 2EFQA 3OR1C 3PUFA 4M6YA 1XX5A 3PNTA 2DODA 5E79C 1SFEA 1WVRA 2IVMA 1ZGJA 1R1VA 2X4HA 4P96A 1ZAOA 5IYDJ 3D1NI 5IP6A 4RA2A 3ZN0A 1SD7A 4XRMA 3HBLA 1FNNA 4KN7X 2QQAA 4XIDA 3S17J 4D7MA 4BJTA 2FEZA 2HOSA 1OYIA 3BROA 4WF2A 4A3IJ 3IH3A 3GBGA 3K6GA 2XHKA 2Y0SN 2EB7A 2F48A 3LFUA 5D5XB 3ZMTA 4ESBA 1CQTA 1IXRC 1IN6A 1DPRA 3I59A 1RZ4A 3EUHA 5CJ9A 2NS0A 4P55A 1Y1VJ 4XMYA 1SVMA 4X6AJ 2IGKA 3RCOA 4BYYA 1FBQA 4PDKA 1VQ8I 4ON0A 2X6YA 3WU2C 2PQ8A 2DPUA 3TW6A 3KEYA 5FLXZ 5KVRA 3TGNA 4I99C 4JX5A 1WCMJ 3AKZA 2ZNZA 4E7ZA 1A35A 2QUFA 2X6OA 4PJMA 1U8BA 3HPGA 3TQNA 3CESA 2HXOA 5KK1A 4P9FA 1N25A 3CJTB 5D6FA 1O3RA 1OYYA 5E17F 4GYIA 2V4JC 3C2BA 5ILSA 3W2AA 4C9YA 4P1WA 4HX4A 5F0HA 1FY7A 1RR7A 1SMTA 4FX4A 1KYZA 3HGYA 5K5RA 5FLXK 3NRVA 4A69C 4QTRA 3S2HJ 2WV0A 5L3DA 3MCZA 1E3HA 3I56I 4NB5A 2CSOA 2I10A 3LSJA 2FNAA 2QA4I 4A3BJ 1FBSA 1RRJA 1LFUP 2KL4A 3FK7A 3RI4A 2B0LA 4XK4A 3C2HA 4IQ4A 1R4MB 4I09A 3GVAA 1GXQA 1SFUA 1LKXA 3FZVA 1U9OA 1FOKA 1MMDA 1T38A 5LRSA 3IV5A 4BH9A 1QVTA 2FOKA 3CUQA 1C0WA 1EJ9A 1ZG5A 2EIMH 2XIGA 2IJLA 3FWEA 3ABUA 3LQQA 4HX7A 5HODA 2TCTA 3DLLF 1GV2A 5TISC 2LKXA 3DFGA 3H9JA 2O8XA 2E1MC 2VJ5A 3LNQA 3MAJA 3A03A 3GTOJ 5EGOA 5D4SA 4JQFA 3E5QA 2E19A 5GAEJ 4J19A 1ZH5A 2GOXB 3BZ6A 5HLGA 2FQ3A 3GFIA 3REOA 1D1AA 2RNJA 3ZMDA 1BIAA 4XLCA 3WU0A 5J6XA 2F5EA 3MMYB 4IVNA 4D7NA 2FX0A 1DUXC 3RKYA 5K7FA 4O3MA 4PCQA 4EQQA 3QU3A 3IRQA 5D5WB 2R7ZJ 2LG4A 1KQ9A 2Y48A 2EBIA 2IS1A 1HF0A 2GOMA 2V1UA 4AUXA 2YSRA 1RUNA 4DNCA 4B1RA 3CLQA 1XGMA 5IYBJ 3HYIA 2E2HJ 2J5PA 4TV7A 3WODF 3JRHA 2LTPA 4MEXF 1T08B 2P81A 3M7GA 1PJRA 2KIFA 1JGGA 1O7FA 1LDKB 2M1BA 4PGGA 1F43A 1OQYA 3G71I 2LK2A 4M9ZA 2ACJA 1ACIA 4HLXA 1X2NA 4HQEA 3O3KA 3M9AA 4F93B 4GYGA 3CCSI 4BQNA 2XVCA 1O4XA 2XGXA 1BN5A 2KZGA 3H5NA 3LFKA 3BTLA 5FKMA 4YFXF 2KJBA 1R7JA 1XMAA 2KIMA 5EEGA 4MTEA 1G4DA 1S9HA 4IOAF 3ECOA 2OAZA 2CUZA 3S1NJ 2XAFA 5AIPA 4BKXA 4ABZA 3OY9A 2DT6A 4Y15A 2K40A 2TRTA 1V5FA 2HXIA 4B47A 2IGNA 3KCCA 1BL0A 1VQNI 2VT2A 2E1NA 4FE4A 2PLYA 3KZYA 1B6AA 2JRTA 2DK5A 3S2WA 1Y8QB 1T95A 5D8LB 2MBFA 3JRDA 4BDYA 3U21A 2DPDA 4IX7A 3OS0A 1KZHA 4MTDA 1APLC 2MC3A 1IDYA 2STTA 4X1EA 3G73A 1IV6A 4N4OB 3FXOA 4LB6B 4EGYA 3OSGA 1JJ6C 4YIFA 5E1XA 2I5UA 5CQGA 4HAMA 4BQQA 2M0CA 1T0FC 4ETSA 3BPXA 5GPAA 3DEUA 4D5CA 1B72B 2DMPA 3J7ZI 3L2VA 2KDOA 1W5CC 2W1OA 2HWVA 1YTYA 2NOJB 2Q2EA 2FU4A 1JT6A 4HRIA 3A02A 5FKNA 3BY6A 2IW5A 3HJEA 2ZMEB 4IRGA 4ENMA 2LY9A 1ZK8A 3IRRA 1OCCH 2EIJH 4KMFA 3LSRA 1H9TA 4XRSG 1W0TA 3BR0A 3ZPLA 2X6XA 1VQOI 1VZ0A 1UFMA 2DA6A 3W3CA 4L9JA 2EFWA 3WG9A 2R7TA 2HTSA 1SEUA 3L9FA 2ZXJA 2FBIA 4HNTA 2UZKA 5EDNA 3V8LA 2CUFA 2WB1N 3DPLC 4JX4A 3SYTA 1REPC 2X6WA 2IGMA 5HNFA 2DOFA 5FGMA 2CU7A 2ELKA 4IXAA 2HQNA 1YYVA 3RYRA 3I55I 5J1RA 2A07F 1U6GA 1XG1A 1UJ8A 2HYJA 3DCFA 1D8JA 3NWSA 1XDSA 2R7QA 4XM3A 3FX3A 2QCOA 5FFXA 5HLTA 3GW2A 1SD4A 1D5YA 1YJWI 5DS9A 1KQ8A 3O8GA 2HTJA 4N4NB 1MSFC 4A3MJ 2HVRA 4E7KA 3ZMSA 1JHHA 2CW8A 5H20A 1JJ8C 2ZFUA 5ICEA 2VBWA 2YU9J 4GXOA 2ISYA 2MH9A 2CGPA 3CC2I 3I5UA 1HA8A 5ILVA 2VXZA 3HUGA 3F3XA 4DJAA 3TOBA 4PJJA 5LHHA 1X2MA 2QVOA 1CGPA 2F6CA 1WKMA 4A3LJ 5E1ZB 4UVAA 4AVPA 1U3EM 1ZGAA 9ANTA 2Z99A 3H0DA 3R4KA 4L18B 2E5ZA 4BDZA 1K4TA 1FTTA 5DTDA 1OLTA 1ERDA 5DDGA 2V9PA 2P5LC 1W0UA 2QBYA 4YELA 1NG7A 2FBHA 4KFCA 2ETHA 2MD5A 1VQ7I 4DYCA 2LSOA 1FP2A 4C2MJ 3JSPA 3R0JA 2YUSA 5E18F 4HW0A 3GWZA 3FBNB 5K7ZA 3E6CC 3FK6A 4I2OA 5C3EJ 3PJRA 2DQLA 2QKLB 2Z5UA 4BL0B 1LFBA 1BI0A 1R58A 1LQ1A 2K4BA 3BZCA 3MKYB 2DA5A 4RB1A 4IHYA 2EPFA 2DA1A 4M3EA 2EWNA 2F4OB 3F9KA 4XOTA 1WJFA 2V7FA 3OWTA 4XKVA 5JVGF 1X1PA 4L9VA 1VNDA 2LFBA 4O6JA 4S0HB 2GIVA 4EJWA 1YW7A 3ZP5A 2NAZA 2XUBA 3CMMA 3LSIA 4FISA 1JKRC 1FIAA 1QPIA 3AFHA 4I98B 2VE8A 1E3OC 1JTXA 1KYWA 3DBHB 4LFUA 5E3OA 1ZGWA 3QU6A 4GGGA 1U5TC 2WA0A 3I3LA 3OL4A 5HDGA 2FNPA 4BJ5C 5FLMJ 1V55H 3WTXC 4UV9A 3ZOBA 5JR3A 5E8IA 2QQBA 3HIFA 3LSPA 1UHMA 1IW7F 1HSTA 1SVOA 2P6TA 5CKTA 3O6BB 1USTA 1ZKGA 5H2FC 4DYQA 5FRNA 1TNSA 1RPWA 1WJEA 2V6EA 1MMNA 4OIQF 3PIOF 4G7OF 2O61A 3K10A 3S93A 1S7EA 1P7JA 2LD5A 3CMAI 2XAJA 2HI3A 1GV5A 3HOUJ 2UWMA 3M8EA 4M6VA 1F5TA 3HOXJ 1IN5A 1T33A 4A3EJ 2XAGA 2D1HA 2PFBA 2JZYA 2OUMA 3WGIA 3CDHA 5FRMA 1STZA 1SAUA 1VQLI 4UUSA 5DYMA 2CYYA 2VC1A 2DYSH 2IA2A 3DV8A 1FIPA 4KMUX 2IS2A 3I58A 3K4JA 1X3ZB 2ZSHB 2M7AA 3WTSC 1ODDA 1I5ZA 1KA8A 3BT9A 1LB2A 3OOUA 4DW6A 4II3A 1YHQI 4ZYHA 3D5RC 2OF7A 3VSLA 2BHZA 1B9NA 4BY7J 4CUGA 2R7SA 2M30A 2ZXHA 5FD6A 2XF6A 3H9GA 4CYCB 1GXPA 1XCVA 2GBYA 3EUHC 4LOCA 3TO9A 3PUBA 4M72A 4MFEA 4LJZF 3OYNA 2JJ7A 4C2TA 2WAEA 3D5LA 3K70C 4A12A 3LSMA 1IF1A 1IRXA 1I39A 3OYGA 2W00A 4NC6A 3DU6A 1FLIA 1ETQA 2VQCA 1TWGJ 1MBFA 3LSGA 3J80Z 4XONA 2BY2A 3C2GA 2F5DA 2WAFA 4Q5SF 3CCMI 2HKXA 3ABMH 5LEKA 4UNOA 1I27A 5FD5A 2ZJRF 1G3WA 1XMXA 2LLKA 1FBUA 1IXCA 2X1DA 3HSRA 3CCUI 3ZQCA 2R92J 5E3LA 4ENJA 2ESHA 2UXNA 4MEYF 4XKWA 4QPQA 1WGXA 4EM1A 1G6NA 2GQQA 2CUEA 4Y33A 2QQ9A 3BZKA 4YEJA 3K4CA 2QZ8A 2VKHA 3KE2A 3S3OA 2VBXA 3J80K 4Y3OA 1XSDA 5HDNA 2Q1ZB 4E70A 4A2UA 5F0FA 5F08A 2VQGA 2F5FA 3M8FA 1RR8C 3HSFA 2XGDA 2Y69H 3OL3A 3NARA 5EEHA 2H1LA 3HRUA 1U9NA 2CWEA 2M7BA 1FZPB 2V79A 4JYKA 1RUOA 2JUCA 2XKPA 4PSXA 1B8IA 4A3GJ 2UV1A 5J40A 2M9HA 1XGNA 1ORKA 4RAZA 1Z67A 4ZDLA 3G3ZA 2R7WA 1ETKA 3UKGA 1K4SA 1MMGA 2W82A 1J75A 5LGTA 4F92B 5K1YA 4DYRA 1IN7A 3CUQC 3BCBA 3IH2A 3F0CA 2ZKZA 3CMYA 1XC5A 4FETA 2K9LA 4E7SA 5F1RA 4BBSJ 4Y17A 2OC6A 1FTZA 1TW2A 1DPUA 4GDFA 4OMYA 1SVLA 3C7JA 4G6TB 1EF4A 1XMKA 2ZFWA 3BR5A 4B09A 4CA0A 1LUJB 1T2KA 3GLLA 2A6HF 4XSZF 1A5JA 1AA7A 1Z77A 2L02A 2XSJC 5DD4A 3Q0WA 4KT6A 1EV7A 3J81K 3OYAA 2AO9A 3OYIA 2E7XA 2RC4A 4XLHA 4NHJA 3HHGA 1XPXA 3JAMZ 3FF5A 2HVSA 1R36A 1D0XA 4UB8C 1K6YA 3RPQA 2E1OA 4C3IJ 1E17A 5F6FA 5DM7F 4L9NA 4M6XA 2DBBA 1BC8C 2A68F 2IPQX 3RZDJ 4HV5A 3HOTA 3G1MA 4ENNA 4CHUA 3OYCA 5IP7J 2D1VA 5JI6A 4FHTA 3MKZA 3NEUA 2OD5A 1ZTRA 2FF4A 1ZARA 2JRMA 4IKFA 3OYMA 4U0VA 3I71A 3FXMA 1SFXA 1H8AC 3W2VA 5BS6A 4C2UA 3OMYA 2YR2A 4M9XA 1B8IB 2BY1A 4ZYDA 2GWRA 2LR8A 4HBLA 3CO7C 1K78B 4LG0B 3L2WA 1MIJA 4OIOF 2EV5A 2MYSA 3RPUA 4YIRX 3ZXSA 2OU2A 2STWA 2KFDA 4K2EA 3FXJA 1DGWY 1I1GA 2LYCA 2L9VA 5LRRA 3BG7A 3LA7A 1E3PA 4HPQA 4CDGA 2QSGX 3ROUA 1BOBA 1JKOC 4FASD 4KIBA 2WBMA 1QPMA 1Y6IA 2KT0A 4MQVA 1ETOA 2Z33A 1MKMA 3ASOH 3HKZA 3QWLA 3SEZA 1TWFJ 3CP8A 3K7AJ 4P5OA 4ZYAA 1I6XA 2KDZA 2NOGA 2OA4A 1JUMA 3WTYC 4D9JA 5EZHA 5L3CA 3BCAA 2V1XA 5GPCA 1VQKI 3MKWB 1ZG3A 3N4MA 2DFFA 2V9KA 4M3GA 1LDDA 2VC0A 1R9TJ 1BR2A 1IV8A 1MNEA 4HF0A 1EH6A 2L9SA 2CQQA 4WCGA 3RDIA 1S3JA 2DFHA 3CCYA 2OV7A 1KU3A 2P5KA 2H1KA 1DGRM 2F4IA 1RETA 1PUFB 5B5EC 1TC3C 4DBQA 5ILUA 2K9NA 3R60A 4N9HA 4UV8A 3RKWA 4Y52J 1ZR4A 3ZMUA 5E3MA 1K6OA 1AU7A 1FOYA 2JA8J 5KNLA 2BVMA 1A6IA 3AG4H 2DMNA 3K1NA 3CC7I 1HOMA 2OTJI 2DT5A 3ZQ7A 4CXFA 4BHPA 4PFOA 4NC8A 2GAUA 1DQUA 5GTHC 2MW8A 3T5XA 4U0YA 4G7ZF 1KGSA 1A6QA 1DDNA 2OBPA 1EH7A 2LP0A 3RYPA 3RPUD 1IN4A 3S1RJ 4IHWA 2NXNB 2CV2A 2JMWA 2GLOA 4HLYA 2ZNYA 3O8HA 3EQLF 4BHCA 5L3GA 3CJRB 3A01B 1PP7U 5J8CA 3IL2A 3LOCA 1L0OC 2EFOA 2PBIA 5EJCA 2NS7A 3OYDA 3PFYA 4FX0A 3JR9A 3F72A 3P7NA 4G8XA 1MMSA 4QWQA 2BVLA 3AG1H 5CVJA 3TP0A 3GTLJ 2O9LA 2LREA 4OINF 2AHQA 3IH4A 1SANA 4UUTA 4KYWA 3OR2C 1P7IA 4G12A 1FOWA 3QPHA 2RN7A 2XRLA 3ZMVA 3QYBA 2EA4A 2ELJA 2L5QA 2M3AA 3H92A 1SC7A 1TQPA 5E20A 3ZCOA 4HF2A 1FSHA 1TQMA 3VYUB 2K4JA 3WGGA 5IOZA 1TT5B 1VQ9I 2QYOA 3DU5A 5J1YA 1BA5A 4AD9A 4EJOA 2HQ5A 3KP2A 2O03A 1JKQC 1XSVA 2K7LA 3TL4X 2AXTC 1G3TA 2GXAA 3QQAA 4DOZA 3BQYA 1D3YA 2C6YA 2BY3A 3K4BA 1G3YA 3HOZJ 3DP7A 4HDUA 1WJBA 1XCBA 3BDDA 3PO2J 3QPSA 5LD2C 5ED4A 5E3NA 1LE8B 3FMQA 1HXDA 4MLOA 4BNCA 3HTSB 1O7LA 4KUMA 4WX9A 2ESNA 2P5VA 3JRCA 1PVEA 3E5UA 2HGCA 5B66C 4HYEA 3DQVC 1WH5A 1VQ5I 5CVRA 3M07A 1TWAJ 4RM3A 4IO9F 1WPKA 4XOPA 2LRDA 1YS7A 5M5XJ 2PJRB 1OCTC 3EUKL 2VJJA 3CF5F 3Q9SA 3VYTB 2BXZA 5M3MJ 3KP3A 4EEFG 5EG0B 2FXAA 1PDNC 5JHFA 5JFRA 3BP8A 4LLNA 1J9IA 3GFJA 1JI8A 3DEEA 1D8KA 3ZQLA 1FYMA 5AONA 2P0WA 1TL8A 1B72A 5BQTA 4CZCA 3GZ6A 2MLKA 2L7ZA 4FCYA 2LNBA 3GTPJ 1CF7B 4EJUA 1R5GA 2K86A 2NVUB 3CCEI 1HCRA 2ZMEA 2CW0F 4ZJZA 4A3DJ 2HYFA 1F4KA 4I7HA 3AL0C 3K0LA 3FDYA 3M1EA 3CC4I 2K85A 3OYHA 1R6RA 1QA6A 5KAIC 4RBOA 2LOOA 2IXSA 1YLFA 1VQMI 2EK5A 4ESJA 3ISPA 3TP3A 4KICA 4DQ2A 4KITB 4HSRA 2D5VA 1JHFA 2VKDA 1ON1A 4FQGA 1O57A 2X85A 2MH2A 1SFKA 4I0BA 1HW2A 1LJ9A 1SD5A 4Q4ZF 2DTRA 1QZZA 1J2XA 3WHBA 4MIMA 2A3SA 3V42A 2Y9ZA 2KMUA 1YS6A 4BJ6C 2R7DA 3ZQIA 3GFLA 2DW4A 1P4AA 3K2AA 2DAOA 2JK3A 3KLOA 2NNNA 5J3LA 3KEOA 4ENKA 3H5RA 3ZN1A 4BQAA 1WJCA 1YITI 5E8GA 4XN0A 2XAHA 4PUSA 4ZYGA 5F1JA 2DA3A 2K02A 5DEQA 2VASA 4UUVA 1YX5A 1KU9A 3MD2A 2EZHA 4ASNA 1I3QJ 3H3ZA 4LLGF 2LVSA 3PM1A 4IHVA 4A6EA 1K61A 3VYSB 2YU3A 4KT5C 2Z3YA 3FHNA 3Q9VA 3QYEA 5JLWA 2VT3A 3CLOA 3TO7A 2NVQJ 2QM3A 2B7EA 3KYLA 4HQMA 4R79A 2LDUA 1P4XA 3A1YA 1MMAA 4BBRJ 3C18A 1FT9A 1P92A 1RC9A 3MFKA 4KA4A 3HRTA 4XKBA 1YFHA 2QENA 4U7BA 1A36A 1BC7C 3L7WA 2UUZA 4JK1X 3HC7A 4RAFA 1XGSA 4XLNF 3LAJA 1YIJI 1HQCA 2A6EF 2DFEA 2HZDA 1T39A 4XN3A 4NUBA 3V8JA 2RNGA 2CJJA 5ERIA 1J09A 2W7NA 3M8JA 2EZKA 4ZTJA 1W1WE 1PYVA 3T8RA 3ABTA 3K2ZA 2M0MA 1U78A 1ETWA 1YE9A 4CCLA 2NVYJ 1RIOH 1HW5A 3LA3A 4IJAA 4OU0A 1HW1A 4CCNA 4E6KG 4XRSA 2IT0A 1JXSA 4S05A 3KPHA 2KZVA 3PSIA 1XS9A 2KRFA 3GFMA 3KYCB 2AQFA 2DFIA 1ZREA 3KFWX 3SFZA 3EDPA 2XPWA 4D0PA 3I9V2 4PJ0C 4EMSA 3DF8A 3V4GA 4RB2C 2OZ6A 1AKHA 2N8GA 4I0AA 2DN0A 4U88A 4EVIA 2D45A 5IT9Z 3EYYA 3KLNA 4HSTA 1QVUA 4R1HA 3M4OJ 4XLAA 3AG2H 1OPCA 4DGWB 4IPAA 2FMLA 3VOEA 2JN6A 2KIUA 2B9SA 1QZEA 2M4GA 2ICWG 4AIHA 4AYBN 5CVUA 1I3AA 1Z3YA 1LDJA 2KPMA 2PMHA 2CMPA 2HU9A 2WY8Q 5M5WJ 3CUOA 2XSDC 1F36A 2ME0A 1Z9CA 5IT9K 3PNYA 4IRHA 2X1EA 2VONA 4AIKA 1K83J 4RDUA 1Y0NA 3WTUC 3GTKJ 2DYRH 5LLQA 5HNHA 4XRFA 2QSFX 2HQAA 2V1NA 3KEQA 3E6MA 1D1CA 1Z1DA 2WV1A 2XRNA 3VEPA 4B3AA 1HDPA 3ZQQA 1GT0C 4RB3C 3BTCA 3H0GJ 3ZQHA 2BV6A 1P9QC 4ZZLA 1W36D 4F91B 1ZLJA 2CQKA 1IN8A 3QYFA 1IUFA 2XF5A 1XDUA 3KZIC 4EJVA 3FXLA 1E0EA 2QKMB 4RLQA 4OIPF 5KHDA 2QQ8A 2KQRA 2CUJA 4YG2F 4LMYA 3SZPA 4UY8I 1WHUA 2PEXA 1XB4A 3X2QH 2YS9A 5D5UB 3I64A 4G7HF 1S6LA 2X0LA 3VWBA 4CYCA 1MJBA 3HG9A 3R61A 3QP6A 2WAQN 1S8NA 1OCZH 4CCKA 3ESWB 1Z3XA 1FYLA 3HKZN 5D8KB 5CYVA 3BTJA 1W7PB 2DA7A 1ZN2A 2Y31A 3LA2A 5FJ8J 1O3QA 4MHGA 4WK8F 4BAYA 3GTJJ 3PFIA 1NTCA 2LF8A 3A0HC 4U0WA 3T1BA 3U2RA 3MZYA 4BE2A 2GXBA 5K5QA 4JP0A 2XB5A 2MGQA 3G6EI 2KP6A 3W6KB 4R8HA 1IXSB 2KIQA 3V7CA 1MH4A 3I54A 2RVCA 5HVQC 1MNDA 2W4SA 4H4KC 2X48A 2VJIA 4BU2A 1B4AA 2XPVA 3K69A 3HM5A 4E7JA 2W25A 2MABA 2W48A 3HOWJ 3H5AA 2VOOA 4E4HA 4D1QA 2VKEA 2Z9OA 4FT8A 3OIOA 3DBRB 5D6EA 2JA5J 3MKLA 1YJNI 3KETA 2E60A 4L9TA 3ECHA 4HV6A 2XKOA 2DT7B 1WRJA 2VBZA 2CG4A 2PMUA 3IWZA 4FE7A 2H8WA 2HDDA 1BW5A 3FM3A 2CFOA 2NRAC 4W1UA 2DI3A 5E1WA 3Q0VA 4L0YB 3L2CA 2R5YB 1YW9A 3J7AO 3P5JA 2COBA 2E1MB 4RGSA 1ZRDA 2K9SA 3BJAA 4F7ZA 4XLFA 3DXJF 1HDDC 3BQZA 2W85A 3FKIJ 5IT3A 3RJPA 3CJQB 4RAYA 1IG7A 2BYVE 3K4LA 3FIWA 4L0ZB 3RZOJ 5CVVA 3HOVJ 5LEJA 2DU9A 5GP9A 1S72I 2V6CA 3I4MJ 4IZZA 4ZYEA 1MDMB 5L3FA 5CVIA 2O0YA 3IKTA 4CGZA 5HOOA 4CO8A 2O6GE 3ZMZA 1VI0A 3TO6A 1T0FA 4YIIA 2L9RA 3GXOA 2L7MP 4BXFA 2Z16A 1GDTA 2M5WA 4EGZA 3PQJA 3LL7A 3LAPA 2X1CA 4UVCA 3SHFA 4G6QA 1K79A 3NQOA 2HOEA 3JREA 4IOCF 1S5LC 3D0SA 1IC8A 1E2XA 1UHWA 2P6SA 3M1CA 2E2IJ 2JT1A 2FMYA 3U1KA 1JT0A 3QPLA 4LG3A 3E97A 2ZJPF 4J00A 4RS8A 3WE3A 4Y4RA 2LBFB 4KNYA 1HC8A 4LGWA 4BEHB 1IRFA 3N05A 5F04A 3TOAA 1P4WA 1YI2I 4ANJA 2ZO4A 2L3DA 3WG7H 1K78A 4LG0A 2ZJ2A 5K7HA 3J81Z 2EILH 3OOPA 4AU7A 4NQWB 4ZDOA 3SJMA 4B4CA 2XDVA 2XASA 1FMWA 2HPIA 2GA2A 2VI6A 1FMVA 3G1LA 4F52A 1YX3A 3RSNA 1JE8A 3O2PE 2JTVA 3GX4X 4C3HJ 3KP4A 5TJJA 4RMNA 5F0CA 3VB2A 2X51A 4U87A 2M2EA 2E35A 3E6BA 5J1UA 2Y75A 3GCMA 5F27A 1Q1HA 4XQFA 2EV6A 2JSPA 4BY1J 3B02A 2DQRA 2E2JJ 2EQRA 1FC3A 2ECCA 1G8XA 3Q0UA 3V7RA 3HEFA 1X3WB 2IAIA 4IQJA 2OCCH 1YOVB 4PGHA 5LBQA 3NAUA 1MZBA 1ZYRF 5L3EA 1YRNB 2EZIA 3U1DA 3QOPA 4B44A 3JRGA 3I4PA 3RIRA 3PSFA 2ME6A 3QPTA 4A5NA 2X9DA 2K5CA 1MD0A 2L01A 4AYBA 1OCPA 4G6DA 1MGTA 1U0JA 1GHCA 2KRCA 4KIFA 5EEAA 3DBLB 2IP2A 3R0AA 4Z6YA 1R00A 3EYIA 2K3FA 2BGCA 1FX7A 1MW7A 1OR7A 3A2KA 1OKRA 1DP3A 4C3JJ 4MQ9F 2EFPA 1ETYA 1PUFA 3HPHA 5J4VA 4OAYA 1TWHJ 2HKOA 2RKHA 2R5ZB 3OYLA 2BEOA 2ZMEC 2NVTJ 3GMEA 2JPBA 3S8PA 2R93J 1FEXA 3ASNH 5DCFA 4WWCA 2F5CA 1HLVA 1HKQA 3BOQA 4BUPA 4PJNA 2XC7A 3S1QJ 1IUYA 3OYJA 2CQ7A 3LQRA 4A0ZA 1HBXG 3C3WA 3K9TA 1O3SA 4ZH4F 2IEKA 2M8GX 3IP4B 4QIWN 3P9IA 5LFAA 1OCOH 3SXYA 2FD5A 3OIQA 3JRIA 3DEWA 3WHCA 1LVKA 2W57A 5LHGA 2IBDA 2P7VB 1G3SA 1WH7A 4GO1A 1H88C 4CCJA 5B1AH 5A2QK 3PIPF 4J01A 5BPIA 5IOYA 3A01A 3HRMA 4UXNA 4CCOA 1SMYF 3CMEI 1QU3A 2WAQA 4RAGA 2NYXA 5EYRA 2BHYA 2BW3A 2EV0A 3MN2A 1BR4A 4L5IA 4LK0F 1MBJA 2Z1DA 4HDVA 1WQ2A 4A6DA 1Y8RB 2OQGA 1XGOA 3RKQA 2VUMJ 2CRGA 1WZ2A 3WGHA 2WWYA 2Q8KA 1S7OA 4CICA 3C1DA 3ZQFA 1BW6A 1PP8F 3F8CA 3CO6C 1J59A 2HFHA 4HOBA 2M87A 1Z91A 4O5VA 1KU7A 3FHZA 2LKPA 2WADA 5DCMB 5HLHA 4BXXJ 2K3PA 1FJLA 4IRIA 1Q1VA 2WY7Q 4Q47A 3Q3SA 1ZQ3P 1G2HA 1WJDA 5LGUA 4CSWA 3MQ0A 4AVZA 3T8TA 2BZTA 1WI3A 3FXQA 3GYHX 2EFNA 1YO5C 4A0YA 2MFZA 3BJOA 1FOXA 1N75A 3CTAA 1GUUA 3ULQB 2RGVA 5LHIA 4HNUA 5C44J 3CF2A 3S3MA 5JHUA 2XGEA 5EZGA 1NK3P 3W6JB 3CDLA 3BG3A 1LE8A 1IJWC 1VFCA 3QODA 2XGCA 3U9GA 5CLSA 1L3LA 4A3FJ 1W36C 2JSCA 4A93J 2YX4A 4F55A 4YRVA 1N77A 4AWXB 4BGDA 3BR2A 4X0GA 4EJTA 4DZJA 1JGSA 1U2WA 4ZDPA 4B8XA 1UAAA 1MH3A 3FMRA 4XLEA 3BG6A 2PJRA 2EH3A 3OSFA 3SZGA 3S15J 1KQ0A 2WC2A 2ECBA 1RKTA 1OJLA 2LKSA 2CH0A 2O7OA 4N0BA 2BW3B 3SDBA 5EG0A 5BOXA 2R7RA 1BI3A 2MD0A 2K9QA 4ZTFA 1V54H 1OFCX 2ID3A 2PJPA 2MA3A 1U5TB 3E6DA 1QNTA 3ONQA 3WTZA 3LSHA 3EPZA 2DLLA 3B73A 4HZFA 4PJLA 4MFDA 2O3FA 1JTYA 2DXIA 3IHUA 2DA2A 4NDLA 1CF7A 3E7LA 3OS2A 1R71A 3LWFA 1ONVA 2L4MA 2JPCA 1G59A 4OOIA 2GA1A 1T56A 2ZXIA 1OMIA 4BS9A 1QRYA 1V4RA 2Q0OA 1QHHD 3H9QA 3TEDA 4JOMA 3JTHA 4A3JJ 5J47A 1YQAA 2RQQA 2ZJQF 2V9VA 1ZHFA 4N9IA 5BNGA 1BI1A 2VQLA 3PO3J 2UXXA 4JX6A 1WSUA 2QSHX 3ZGKA 1UCRA 1QQIA 4HNVA 1B1BA 2JA2A 4KIGA 2Y2ZA 1IZ1A 1Z21A 2FJ1A 1IAWA 2BY0A 4RB0A 3L2QA 1IDZA 2ADUA 2AQEA 5IP9J 5FLVA 3BTIA 2DA4A 1RI7A 3I4NJ 1YG2A 1MBEA 1Z0XA 3KYDB 1H9GA 1XTAA 3JRBA 1BOAA 3OV8A 5IY5H 1MJ9A 3HOSA 3CCLI 2GM4A 4RM2A 4KISA 5JLXA 1TWCJ 3I59B 2K27A 2VKVA 4UHTA 1FPQA 5IYCJ 3ABKH 3ZQGA 5J4YA 3WTTC 4M3BA 1NG6A 2VJ4A 1QGPA 3FM5A 3V7SA 2CO5A 1TBXA 3CZ6A 4L5EA 2GXGA 2OPTA 3K70D 2IGOA 2XB0X 3H3UA 2JA6J 3KX2A
chains in the Genus database with same CATH topology
1IRZA 1QVUA 2R0QC 1JUSA 3M4OJ 3S14J 2FQ4A 2L0KA 1ETQA 5FKLA 1JUPA 2JN6A 1TWGJ 1MBFA 2MSYA 3LSGA 3HGGA 4I6ZA 3SDGA 4AYBN 1RESA 2L7FP 1POGA 1ENHA 3HB9A 2M34A 5M5YJ 2LLKA 5M5WJ 2XSDC 1F36A 2ME0A 3ZQCA 2R92J 5E3LA 1K83J 4RDUA 3GTKJ 1WGXA 1H89C 5IYDJ 2CUEA 3D1NI 5IP6A 1SFOJ 3HDDA 4XRMA 1DU0A 3HBLA 2WV1A 4B3AA 1HDPA 4XIDA 1GT0C 4D7MA 3S17J 3BTCA 3H0GJ 4M3DA 5F0FA 3ZQHA 4IEJA 5F08A 2HOSA 4A3IJ 2G0EA 3IH3A 3GBGA 1IUFA 2XGDA 1MBGA 3NARA 1U9NA 2PMZN 3JRFA 2Y0SN 1IGNA 4JYKA 1B8IA 1CQTA 4A3GJ 2M9HA 1ORKA 2YS9A 1Y1VJ 4X6AJ 5C4XJ 1ETKA 4CYCA 3UKGA 2WAQN 1ITYA 4DYRA 5M3FJ 3TW6A 3IH2A 3F0CA 3HKZN 1XC5A 3CMYA 4BBSJ 3BTJA 1AKHB 4JX5A 1WCMJ 2DA7A 2Y31A 5FJ8J 1FTZA 3GTJJ 5EGOB 1NTCA 2X6OA 1U8BA 1EF4A 3BR5A 4I76A 2HXOA 2O8KA 1A5JA 1Z77A 4JP0A 2XB5A 2MGQA 3Q0WA 3C2BA 2AO9A 1MH4A 5F0HA 1RR7A 2X48A 2JA7J 3HGYA 3BG5A 2XPVA 3HM5A 4A69C 4QTRA 3S2HJ 2W48A 3HOWJ 2E1OA 4C3IJ 2VKEA 3OIOA 2I10A 3LSJA 2JA5J 3MKLA 3RZDJ 2HOAA 4A3BJ 1LFUP 5IPAA 3G1MA 3FK7A 2NVXJ 4XK4A 5IP7J 1ZTRA 4FE7A 2HDDA 1H8AC 1U9OA 1BW5A 2QF7A 4W1UA 1B8IB 3IV5A 2DMTA 1QVTA 3Q0VA 2R5YB 2LR8A 2COBA 4GFBA 5HODA 2K9SA 2TCTA 1HDDC 3BQZA 1GV2A 3FKIJ 2RAEA 4M3FA 2LKXA 1IG7A 1UMQA 3LNQA 2DMQA 3A03A 3FIWA 3GTOJ 3RZOJ 5EGOA 3HOVJ 5GP9A 2E19A 4J19A 1MBHA 3I4MJ 3CQZJ 1VF9A 1JKOC 4D7NA 2FX0A 1VI0A 5K7FA 2KT0A 1ETOA 3S1MJ 2L9RA 2L7MP 1TWFJ 1GDTA 3K7AJ 2R7ZJ 2KDZA 2NOGA 2EBIA 1HF0A 1JUMA 5EZHA 4AUXA 5GPCA 3B6CA 4M3GA 4B1RA 5IYBJ 3JREA 1R9TJ 2E2HJ 1IC8A 3JRHA 2LTPA 2E2IJ 4AC0A 2P81A 1JGGA 1I6HJ 2CQQA 1JT0A 3QPLA 1F43A 3BG9A 4Y7NJ 2LK2A 3CCYA 2H1KA 1X2NA 1RETA 1PUFB 1TC3C 1MSEC 2K9NA 1O4XA 4D5FA 5F04A 4Y52J 1ZR4A 3BTLA 5FKMA 5E3MA 1AU7A 2R5YA 2JA8J 1A6IA 2DMNA 1GVDA 1HOMA 3RQIA 5K7HA 4IHXA 3S1NJ 4BKXA 4ABZA 3SJMA 4B4CA 2K40A 2TRTA 2HXIA 3TW7A 1BL0A 2MW8A 2VI6A 3G1LA 4FE4A 3VPRA 2LP0A 4C3HJ 3S1RJ 4IHWA 5F0CA 3JRDA 3H3VK 2JMWA 2M2EA 2GLOA 5J1UA 3O8HA 5F27A 5FKKA 1APLC 3A01B 1IDYA 3BR3A 2VPRA 2JWTA 4BY1J 3LOCA 2EQRA 2E2JJ 2NS7A 5EF6A 4X1EA 2ECCA 3Q0UA 3HEFA 1IV6A 2IAIA 3JR9A 3NAUA 3OSGA 1JJ6C 2M0CA 1YRNB 2EZIA 4A3KJ 3TP0A 3JRGA 3GTLJ 5GPAA 2O9LA 2ME6A 1ETXA 2AHQA 3IH4A 1UHSA 1SANA 4UUTA 3GTQJ 2X9DA 4D5CA 1B72B 2DMPA 1P7IA 4G12A 2XRLA 1OCPA 1Y1WJ 5EEAA 1JT6A 2DMUA 5IOZA 3A02A 5FKNA 5J1YA 4C3JJ 1BA5A 2LY9A 1ZK8A 1ETYA 1PUFA 2HQ5A 3LSRA 1TWHJ 4XRSG 1I50J 2R5ZB 1W0TA 1JKQC 3BR0A 2NVTJ 1MBKA 2R93J 1FEXA 3SFIA 3QQAA 2DA6A 3BQYA 1AHDP 1HLVA 3S1QJ 3L1PA 3HOZJ 3B6AA 5EDNA 2CUFA 3PO2J 2WB1N 3QPSA 3MVPA 5E3NA 1LE8B 4JX4A 2IEKA 2M8GX 4MLOA 4QIWN 2Y9YA 2FD5A 2CU7A 2ELKA 3JRIA 3DEWA 3WHCA 3JRCA 2IBDA 5J1RA 1XG1A 1WH7A 1H88C 1WH5A 3S2DJ 1TWAJ 2HYJA 3DCFA 1WPKA 5IOYA 3A01A 2QCOA 5M5XJ 5EYRA 1OCTC 3MN2A 2DTZA 3W6VA 1MBJA 1D5YA 5DS9A 4MO7A 5M3MJ 3O8GA 4EEFG 5EG0B 2NS8A 3HOYJ 3RKQA 1MSFC 2CRGA 4A3MJ 1YRNA 2VUMJ 1ETVA 4V2GA 3BR6A 1JJ8C 3ZQLA 3ZQFA 1BW6A 2YU9J 1B72A 2B63J 4FCYA 2L7ZA 3GTPJ 4BXXJ 1FJLA 1Q1VA 1X2MA 1HCRA 4A3LJ 4A3DJ 9ANTA 3Q3SA 1ZQ3P 1G2HA 2R5ZA 1FTTA 5DTDA 4W97A 4RBOA 1W0UA 1WI3A 3TP3A 2D5VA 3M3YJ 1GUUA 5C44J 4DYCA 2XGEA 5EZGA 4C2MJ 1NK3P 4A3CJ 2YUSA 3G1OA 3CDLA 4FTHA 3BG3A 1LE8A 1IJWC 5K7ZA 1VFCA 3FK6A 3WHBA 2XGCA 4MIMA 4V2FA 2Y9ZA 2H8RA 5C3EJ 4A3FJ 4UUSB 2DJNA 3ZQIA 4A93J 1LFBA 2DA5A 4IHYA 3BR2A 2DA1A 2XPUA 4M3EA 3K2AA 4DZJA 2JK3A 5J3LA 1MH3A 2EH3A 3OSFA 1VNDA 2LFBA 4S0HB 3S15J 2ECBA 1RKTA 1UG2A 1OJLA 3BR1A 2O7OA 5EG0A 5F1JA 2DA3A 2K9QA 4FISA 1OFCX 2ID3A 5C4JJ 3JRAA 1JKRC 1FIAA 2EZHA 1QPIA 4DZPA 2CQXA 1E3OC 1JTXA 1I3QJ 2LVSA 3PM1A 4IHVA 5E3OA 1ZGWA 1K61A 2EZLA 4MFDA 5FLMJ 1JTYA 2DA2A 4NDLA 5JLWA 3ZOBA 3E7LA 2NVQJ 1ZR2A 3LSPA 1T56A 4BBRJ 1ZKGA 4DYQA 1QRYA 1RPWA 5FKOA 3TEDA 4A3JJ 1MNMC 5BNGA 1S7EA 3PO3J 4JX6A 2HOTA 1P7JA 2LD5A 4HNVA 2HI3A 1BJZA 2ZB9A 1GV5A 1JKPC 3HOUJ 2MG4A 4M6VA 3HOXJ 1T33A 2Y2ZA 2Y30A 4A3EJ 2CJJA 2FJ1A 1IDZA 2EZKA 5IP9J 5FLVA 3BTIA 2DA4A 3I4NJ 1U78A 4UUSA 1NK2P 1ETWA 2NVYJ 1MBEA 1FIPA 1Z0XA 4XRSA 4QSHA 3JRBA 1XS9A 2ID6A 3BT9A 2GM4A 5JLXA 1TWCJ 3OOUA 4DW6A 1X58A 2VKVA 2OF7A 3S16J 5IYCJ 3FISA 3ZQGA 3GTGJ 1DU6A 2XPWA 4BY7J 4M3BA 4XICA 3GTMJ 4CYCB 2GBYA 2N8GA 4LOCA 2DN0A 4L5EA 4MFEA 2OPTA 2XB0X 2JA6J 2JJ7A 1AKHA 1RKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRZ A;  1QVU A;  2R0Q C;  1JUS A;  3M4O J;  3S14 J;  2FQ4 A;  2L0K A;  1ETQ A;  5FKL A;  1JUP A;  2JN6 A;  1TWG J;  1MBF A;  2MSY A;  3LSG A;  3HGG A;  4I6Z A;  3SDG A;  4AYB N;  1RES A;  2L7F P;  1POG A;  1ENH A;  3HB9 A;  2M34 A;  5M5Y J;  2LLK A;  5M5W J;  2XSD C;  1F36 A;  2ME0 A;  3ZQC A;  2R92 J;  5E3L A;  1K83 J;  4RDU A;  3GTK J;  1WGX A;  1H89 C;  5IYD J;  2CUE A;  3D1N I;  5IP6 A;  1SFO J;  3HDD A;  4XRM A;  1DU0 A;  3HBL A;  2WV1 A;  4B3A A;  1HDP A;  4XID A;  1GT0 C;  4D7M A;  3S17 J;  3BTC A;  3H0G J;  4M3D A;  5F0F A;  3ZQH A;  4IEJ A;  5F08 A;  2HOS A;  4A3I J;  2G0E A;  3IH3 A;  3GBG A;  1IUF A;  2XGD A;  1MBG A;  3NAR A;  1U9N A;  2PMZ N;  3JRF A;  2Y0S N;  1IGN A;  4JYK A;  1B8I A;  1CQT A;  4A3G J;  2M9H A;  1ORK A;  2YS9 A;  1Y1V J;  4X6A J;  5C4X J;  1ETK A;  4CYC A;  3UKG A;  2WAQ N;  1ITY A;  4DYR A;  5M3F J;  3TW6 A;  3IH2 A;  3F0C A;  3HKZ N;  1XC5 A;  3CMY A;  4BBS J;  3BTJ A;  1AKH B;  4JX5 A;  1WCM J;  2DA7 A;  2Y31 A;  5FJ8 J;  1FTZ A;  3GTJ J;  5EGO B;  1NTC A;  2X6O A;  1U8B A;  1EF4 A;  3BR5 A;  4I76 A;  2HXO A;  2O8K A;  1A5J A;  1Z77 A;  4JP0 A;  2XB5 A;  2MGQ A;  3Q0W A;  3C2B A;  2AO9 A;  1MH4 A;  5F0H A;  1RR7 A;  2X48 A;  2JA7 J;  3HGY A;  3BG5 A;  2XPV A;  3HM5 A;  4A69 C;  4QTR A;  3S2H J;  2W48 A;  3HOW J;  2E1O A;  4C3I J;  2VKE A;  3OIO A;  2I10 A;  3LSJ A;  2JA5 J;  3MKL A;  3RZD J;  2HOA A;  4A3B J;  1LFU P;  5IPA A;  3G1M A;  3FK7 A;  2NVX J;  4XK4 A;  5IP7 J;  1ZTR A;  4FE7 A;  2HDD A;  1H8A C;  1U9O A;  1BW5 A;  2QF7 A;  4W1U A;  1B8I B;  3IV5 A;  2DMT A;  1QVT A;  3Q0V A;  2R5Y B;  2LR8 A;  2COB A;  4GFB A;  5HOD A;  2K9S A;  2TCT A;  1HDD C;  3BQZ A;  1GV2 A;  3FKI J;  2RAE A;  4M3F A;  2LKX A;  1IG7 A;  1UMQ A;  3LNQ A;  2DMQ A;  3A03 A;  3FIW A;  3GTO J;  3RZO J;  5EGO A;  3HOV J;  5GP9 A;  2E19 A;  4J19 A;  1MBH A;  3I4M J;  3CQZ J;  1VF9 A;  1JKO C;  4D7N A;  2FX0 A;  1VI0 A;  5K7F A;  2KT0 A;  1ETO A;  3S1M J;  2L9R A;  2L7M P;  1TWF J;  1GDT A;  3K7A J;  2R7Z J;  2KDZ A;  2NOG A;  2EBI A;  1HF0 A;  1JUM A;  5EZH A;  4AUX A;  5GPC A;  3B6C A;  4M3G A;  4B1R A;  5IYB J;  3JRE A;  1R9T J;  2E2H J;  1IC8 A;  3JRH A;  2LTP A;  2E2I J;  4AC0 A;  2P81 A;  1JGG A;  1I6H J;  2CQQ A;  1JT0 A;  3QPL A;  1F43 A;  3BG9 A;  4Y7N J;  2LK2 A;  3CCY A;  2H1K A;  1X2N A;  1RET A;  1PUF B;  1TC3 C;  1MSE C;  2K9N A;  1O4X A;  4D5F A;  5F04 A;  4Y52 J;  1ZR4 A;  3BTL A;  5FKM A;  5E3M A;  1AU7 A;  2R5Y A;  2JA8 J;  1A6I A;  2DMN A;  1GVD A;  1HOM A;  3RQI A;  5K7H A;  4IHX A;  3S1N J;  4BKX A;  4ABZ A;  3SJM A;  4B4C A;  2K40 A;  2TRT A;  2HXI A;  3TW7 A;  1BL0 A;  2MW8 A;  2VI6 A;  3G1L A;  4FE4 A;  3VPR A;  2LP0 A;  4C3H J;  3S1R J;  4IHW A;  5F0C A;  3JRD A;  3H3V K;  2JMW A;  2M2E A;  2GLO A;  5J1U A;  3O8H A;  5F27 A;  5FKK A;  1APL C;  3A01 B;  1IDY A;  3BR3 A;  2VPR A;  2JWT A;  4BY1 J;  3LOC A;  2EQR A;  2E2J J;  2NS7 A;  5EF6 A;  4X1E A;  2ECC A;  3Q0U A;  3HEF A;  1IV6 A;  2IAI A;  3JR9 A;  3NAU A;  3OSG A;  1JJ6 C;  2M0C A;  1YRN B;  2EZI A;  4A3K J;  3TP0 A;  3JRG A;  3GTL J;  5GPA A;  2O9L A;  2ME6 A;  1ETX A;  2AHQ A;  3IH4 A;  1UHS A;  1SAN A;  4UUT A;  3GTQ J;  2X9D A;  4D5C A;  1B72 B;  2DMP A;  1P7I A;  4G12 A;  2XRL A;  1OCP A;  1Y1W J;  5EEA A;  1JT6 A;  2DMU A;  5IOZ A;  3A02 A;  5FKN A;  5J1Y A;  4C3J J;  1BA5 A;  2LY9 A;  1ZK8 A;  1ETY A;  1PUF A;  2HQ5 A;  3LSR A;  1TWH J;  4XRS G;  1I50 J;  2R5Z B;  1W0T A;  1JKQ C;  3BR0 A;  2NVT J;  1MBK A;  2R93 J;  1FEX A;  3SFI A;  3QQA A;  2DA6 A;  3BQY A;  1AHD P;  1HLV A;  3S1Q J;  3L1P A;  3HOZ J;  3B6A A;  5EDN A;  2CUF A;  3PO2 J;  2WB1 N;  3QPS A;  3MVP A;  5E3N A;  1LE8 B;  4JX4 A;  2IEK A;  2M8G X;  4MLO A;  4QIW N;  2Y9Y A;  2FD5 A;  2CU7 A;  2ELK A;  3JRI A;  3DEW A;  3WHC A;  3JRC A;  2IBD A;  5J1R A;  1XG1 A;  1WH7 A;  1H88 C;  1WH5 A;  3S2D J;  1TWA J;  2HYJ A;  3DCF A;  1WPK A;  5IOY A;  3A01 A;  2QCO A;  5M5X J;  5EYR A;  1OCT C;  3MN2 A;  2DTZ A;  3W6V A;  1MBJ A;  1D5Y A;  5DS9 A;  4MO7 A;  5M3M J;  3O8G A;  4EEF G;  5EG0 B;  2NS8 A;  3HOY J;  3RKQ A;  1MSF C;  2CRG A;  4A3M J;  1YRN A;  2VUM J;  1ETV A;  4V2G A;  3BR6 A;  1JJ8 C;  3ZQL A;  3ZQF A;  1BW6 A;  2YU9 J;  1B72 A;  2B63 J;  4FCY A;  2L7Z A;  3GTP J;  4BXX J;  1FJL A;  1Q1V A;  1X2M A;  1HCR A;  4A3L J;  4A3D J;  9ANT A;  3Q3S A;  1ZQ3 P;  1G2H A;  2R5Z A;  1FTT A;  5DTD A;  4W97 A;  4RBO A;  1W0U A;  1WI3 A;  3TP3 A;  2D5V A;  3M3Y J;  1GUU A;  5C44 J;  4DYC A;  2XGE A;  5EZG A;  4C2M J;  1NK3 P;  4A3C J;  2YUS A;  3G1O A;  3CDL A;  4FTH A;  3BG3 A;  1LE8 A;  1IJW C;  5K7Z A;  1VFC A;  3FK6 A;  3WHB A;  2XGC A;  4MIM A;  4V2F A;  2Y9Z A;  2H8R A;  5C3E J;  4A3F J;  4UUS B;  2DJN A;  3ZQI A;  4A93 J;  1LFB A;  2DA5 A;  4IHY A;  3BR2 A;  2DA1 A;  2XPU A;  4M3E A;  3K2A A;  4DZJ A;  2JK3 A;  5J3L A;  1MH3 A;  2EH3 A;  3OSF A;  1VND A;  2LFB A;  4S0H B;  3S15 J;  2ECB A;  1RKT A;  1UG2 A;  1OJL A;  3BR1 A;  2O7O A;  5EG0 A;  5F1J A;  2DA3 A;  2K9Q A;  4FIS A;  1OFC X;  2ID3 A;  5C4J J;  3JRA A;  1JKR C;  1FIA A;  2EZH A;  1QPI A;  4DZP A;  2CQX A;  1E3O C;  1JTX A;  1I3Q J;  2LVS A;  3PM1 A;  4IHV A;  5E3O A;  1ZGW A;  1K61 A;  2EZL A;  4MFD A;  5FLM J;  1JTY A;  2DA2 A;  4NDL A;  5JLW A;  3ZOB A;  3E7L A;  2NVQ J;  1ZR2 A;  3LSP A;  1T56 A;  4BBR J;  1ZKG A;  4DYQ A;  1QRY A;  1RPW A;  5FKO A;  3TED A;  4A3J J;  1MNM C;  5BNG A;  1S7E A;  3PO3 J;  4JX6 A;  2HOT A;  1P7J A;  2LD5 A;  4HNV A;  2HI3 A;  1BJZ A;  2ZB9 A;  1GV5 A;  1JKP C;  3HOU J;  2MG4 A;  4M6V A;  3HOX J;  1T33 A;  2Y2Z A;  2Y30 A;  4A3E J;  2CJJ A;  2FJ1 A;  1IDZ A;  2EZK A;  5IP9 J;  5FLV A;  3BTI A;  2DA4 A;  3I4N J;  1U78 A;  4UUS A;  1NK2 P;  1ETW A;  2NVY J;  1MBE A;  1FIP A;  1Z0X A;  4XRS A;  4QSH A;  3JRB A;  1XS9 A;  2ID6 A;  3BT9 A;  2GM4 A;  5JLX A;  1TWC J;  3OOU A;  4DW6 A;  1X58 A;  2VKV A;  2OF7 A;  3S16 J;  5IYC J;  3FIS A;  3ZQG A;  3GTG J;  1DU6 A;  2XPW A;  4BY7 J;  4M3B A;  4XIC A;  3GTM J;  4CYC B;  2GBY A;  2N8G A;  4LOC A;  2DN0 A;  4L5E A;  4MFE A;  2OPT A;  2XB0 X;  2JA6 J;  2JJ7 A;  1AKH A;  1RKW A; 
#chains in the Genus database with same CATH topology
 4HG2 A;  1TLH B;  2R0Q C;  3TKY A;  3BC8 A;  2BOL A;  4Z2Y A;  4MGR A;  2IRF G;  4IHT A;  2FQ4 A;  2L0K A;  2RDP A;  2DCE A;  2FA5 A;  1V3F A;  2MSY A;  1V5E A;  3HZJ A;  2HYG D;  3J7Y J;  2D2W A;  4I6Z A;  2FSW A;  3HXL A;  2A61 A;  3HHH A;  3CDI A;  4PZJ A;  4RGX A;  2R7U A;  2L7F P;  1BM9 A;  1GVJ A;  1POG A;  4NNJ A;  3HB9 A;  3EET A;  2M34 A;  5M5Y J;  1W4M A;  1F9N A;  2PG4 A;  3E3V A;  4LD5 A;  3T0Y A;  2RQP A;  4GRI A;  5GAD J;  1D5V A;  1Z7U A;  1P6R A;  2IA1 A;  5H6Q A;  2OQR A;  2F4M B;  4RLF A;  3L09 A;  2IA0 A;  4IL6 C;  4XKC A;  1H89 C;  5CQE A;  1SFO J;  3HDD A;  3L2R A;  1DU0 A;  3F22 A;  1WJA A;  5FFZ A;  3OYE A;  3F8M A;  4DIQ A;  4MNU A;  4M3D A;  4BQO A;  2AXL A;  4IEJ A;  3K1P A;  2G0E A;  1D0Y A;  2CQN A;  1J5Y A;  1MBG A;  2PMZ N;  3JRF A;  1IGN A;  2CV0 A;  3H35 A;  2NNY A;  3QOE A;  4F3Q A;  2HDW A;  3P9K A;  2FE3 A;  4PFP A;  2G7U A;  3FBI B;  2LF7 A;  3I53 A;  1TT0 A;  3DPT A;  2QLZ A;  3SEQ A;  3HSE A;  6PAX A;  5C4X J;  3CUQ B;  3K4M A;  1F1Z A;  2R3S A;  3OS1 A;  3CCV I;  3L2U A;  4GCV A;  1Z6R A;  1ITY A;  4EV0 A;  2H6B A;  5M3F J;  2A5Y B;  2XF7 A;  1AKH B;  3ABL H;  1YIO A;  3KZZ A;  2XV4 S;  5EGO B;  2DOE A;  2H09 A;  4I76 A;  5TRD A;  2XAU A;  2COM A;  2O8K A;  4UB6 C;  4II2 A;  2CW7 A;  2VXD A;  3EUA A;  1FP1 D;  2ZSI B;  3NWT A;  4P9U A;  2KIS A;  1WWX A;  1Z7L A;  2JA7 J;  3BG5 A;  1WI9 A;  2LC2 A;  1T98 A;  3LST A;  2E71 A;  1BR1 A;  4XBF A;  2FBK A;  1ZRC A;  3OYB A;  3WU1 B;  1SAX A;  3MWM A;  5D5V B;  2L54 A;  2A05 A;  1HKS A;  2WTE A;  2HOA A;  5IPA A;  2NVX J;  1J0R A;  2KRH A;  1VQP I;  2VQH A;  4OMZ A;  3MZH A;  2OTL I;  2VLA A;  2A6T A;  5DV5 A;  2QF7 A;  4G9Y A;  1RNL A;  2YPR A;  2QGU A;  2QWW A;  3WE2 A;  3IAM 2;  3ZRG A;  1HSJ A;  2G9W A;  2DMT A;  1T6S A;  3DWL E;  2R4G A;  3MEX A;  3RTR A;  1W5S A;  1SD6 A;  4LLL A;  3GO5 A;  4GFB A;  1TP4 A;  3GF2 A;  1D1B A;  2RAE A;  2Y0S A;  4M3F A;  3K4K A;  1W7P A;  1UMQ A;  2KKO A;  3FKJ A;  1DP7 P;  1BJA A;  2DMQ A;  3GZ5 A;  3JSO A;  2CFX A;  1VQ4 I;  4UVB A;  4B48 A;  1I1S A;  1MBH A;  3CQZ J;  1YW8 A;  1ON2 A;  2OJE D;  1VF9 A;  2I8D A;  4WXC A;  3JTG A;  3J7A Y;  2CS3 A;  3R6S A;  2DO7 A;  1X1C A;  1A04 A;  2M4K A;  3DTE A;  2OZU A;  2JVH A;  3Q5F A;  1P2F A;  3ZR8 X;  4V19 K;  3S1M J;  4BHB A;  2VBY A;  4XL9 A;  4U7D A;  4I02 A;  2HR3 A;  4QLC U;  2H27 A;  1WJ5 A;  3B6C A;  4XR6 A;  4CZZ A;  3F23 A;  2ISZ A;  4ZC3 A;  5GTI C;  5HS9 A;  2E34 A;  4JBA A;  1Y0U A;  5BMZ A;  4AC0 A;  2LY2 A;  1EH8 A;  4LB5 A;  2RRE A;  4A5M A;  1TTY A;  1I6H J;  4EAT A;  4XOR A;  2Q2E B;  2QEX I;  3BG9 A;  2VIX A;  3MZ8 A;  3ERM A;  4LIT A;  3VDX A;  5HS8 A;  1OCR H;  2FOW A;  4E7I A;  3GLX A;  3LSK A;  4Y7N J;  3BLY A;  3JCU C;  3ELK A;  4G94 A;  3HL2 A;  3CCR I;  1MSE C;  2EJR A;  1OR7 C;  1EKE A;  5J8F A;  3HTU A;  4D5F A;  3FXK A;  4PSW A;  2Z2S B;  3W2W A;  2R5Y A;  1R4N B;  5KAF C;  3DPU A;  2JVG A;  1GVD A;  5ICC A;  2W24 A;  2PX9 A;  3RQI A;  3I0T A;  4YFN F;  3S3N A;  4IHX A;  2GZW A;  4E7H A;  3TBI A;  1K7A A;  1QBJ A;  2HDC A;  5HDK A;  4BXU A;  5TGT A;  3TW7 A;  3GZN B;  1VQ6 I;  4ZZD A;  3VPR A;  1ZRF A;  3DKX A;  3A0B C;  2DOA A;  1S29 A;  5B3S H;  3H3V K;  1OYW A;  1W7P D;  1TNT A;  1MDM A;  1FWZ A;  3QAH A;  5FKK A;  5FB2 A;  4IHS A;  2VPR A;  3BR3 A;  2JWT A;  3OYF A;  1Y39 A;  4XNF A;  3WTV C;  2RV8 A;  5EF6 A;  1Y56 A;  4M73 A;  1R1U A;  1IO2 A;  1AOY A;  3OIP A;  1NH3 A;  2P4W A;  5FRO A;  4B43 A;  4A3K J;  3RKX A;  3QP5 A;  1ETX A;  3E0J B;  4QPO A;  1UHS A;  3GTQ J;  5DM6 F;  1BBY A;  1YJ9 I;  1LFP A;  1Y1W J;  2CV1 A;  4C30 A;  3HUG B;  1Z6T A;  2DMU A;  4HX8 A;  3VSK A;  2HS5 A;  4XSX F;  1Z05 A;  5CPR B;  3COA C;  3TDZ C;  2LBF A;  3H36 A;  3PQK A;  2E1C A;  3CP2 A;  4IF4 A;  4XLP F;  3CJN A;  4BEH A;  3SQN A;  1I50 J;  2Y0M A;  5GAG J;  2PI0 A;  2EIN H;  5LGN A;  2QBY B;  3F6O A;  1MBK A;  2LMD A;  1UG0 A;  3SFI A;  1AHD P;  4AIJ A;  1T8I A;  4OWR B;  3FMS A;  3GUD A;  1R5H A;  2BXY A;  2R7V A;  1FSE A;  2R7O A;  3L1P A;  4M9S A;  1ULY A;  2ZCW A;  3B6A A;  4NQW A;  4AM3 A;  1ZEL A;  3MVP A;  4EM0 B;  2VOP A;  1X1D A;  2PMZ A;  2Y9Y A;  2G7H A;  1LEB A;  4CYD A;  2VE9 A;  1UB9 A;  1VTN C;  5HLI A;  3SZT A;  4BAC A;  3S2D J;  1GLN A;  2A69 F;  1U8R A;  4LK1 F;  3IC7 A;  3RQ4 A;  3AAF A;  2K9M A;  4S04 A;  2VN2 A;  2DTZ A;  5DUI A;  3W6V A;  2AS5 F;  2F5V A;  1OIS A;  3PNV A;  3PL8 A;  5AIQ A;  4MO7 A;  2F2E A;  1R22 A;  2P8T A;  2HNH A;  2NS8 A;  4EM2 A;  2P7C B;  3HOY J;  3ERE D;  1YRN A;  1ETV A;  4Y13 A;  4V2G A;  2L7K A;  3BR6 A;  3BWG A;  3F21 A;  1O3T A;  1TW3 A;  2R7X A;  2TDX A;  5FO5 A;  3BPV A;  3CCJ I;  3JW4 A;  2B63 J;  4ESF A;  5K5O A;  2J5O A;  3AL0 B;  4RGR A;  3ML6 A;  2OCE A;  2L2O A;  1IRG A;  2E5N A;  5ICG A;  1X1B A;  1R49 A;  3F8N A;  2R5Z A;  4W97 A;  3F8F A;  3K4N A;  1LVA A;  3TDU C;  4NC7 A;  2HZT A;  2EIK H;  3M3Y J;  3FXU A;  2DDA A;  5GAH J;  1LPQ A;  4A3C J;  5BPD A;  3G2B A;  3G1O A;  1KON A;  5DUK A;  2LH9 A;  4B3X A;  2HEO A;  2VB6 A;  4FTH A;  3S32 A;  2E7W A;  4V2F A;  2H8R A;  5ICF A;  1R1T A;  4UUS B;  2DJN A;  2HPM A;  2EA2 A;  4DBR A;  3KP7 A;  1ZLK A;  1R23 A;  3VYR B;  2XPU A;  3IAS 2;  4LIU A;  2XAQ A;  4LIV A;  1PUE E;  3AG3 H;  5L3B A;  1XD7 A;  1QZY A;  4KDP A;  2WB1 A;  5H6R A;  2M8E A;  2IS6 A;  4WXH A;  1UG2 A;  1TQI A;  1X1A A;  3BR1 A;  1M1E B;  3VOD A;  2FRH A;  2VL8 A;  1B59 A;  3D5S C;  5F64 A;  3DKW A;  4L5J A;  1UEL B;  5C4J J;  2GIZ A;  3JRA A;  4OAZ A;  3E1S A;  4DZP A;  2CQX A;  5D4R A;  1N78 A;  2VOD A;  4HF1 A;  2EZL A;  2DJI A;  4M74 A;  1HKT A;  1ZG1 A;  3KP6 A;  5DCM A;  3L00 A;  2ZC2 A;  2A5W A;  1ZR2 A;  3H1C A;  1X19 A;  3E5X A;  2ZBK A;  2HVQ A;  2KLO A;  1X3U A;  4HA8 A;  5FKO A;  3IUO A;  4A0X A;  2H6C A;  4CH7 A;  1V5G A;  2H94 A;  1XSX A;  3DKY A;  1MNM C;  4CCM A;  3V8K A;  2DDB A;  3BJ6 A;  3HRS A;  5HS7 A;  5A2Q Z;  2HOT A;  5JVT A;  4NBQ A;  1BJZ A;  2ZB9 A;  3P9C A;  1JKP C;  4HEA 2;  2MG4 A;  3FXR A;  1AWC A;  1FYK A;  2KJC A;  2R7F A;  2LY1 A;  2L4A A;  2Y30 A;  4M71 A;  4YFK F;  2XRO A;  1USS A;  3IWF A;  2PN6 A;  3UNG C;  3F6V A;  1X4O A;  3GEZ A;  1X4P A;  2MLG A;  3DTK A;  3OYK A;  2HQR A;  2V26 A;  1D0Z A;  4BE0 A;  3TMO A;  5DD8 A;  3QRF F;  1KU2 A;  3K1M A;  1NK2 P;  5KCM A;  3CD6 I;  2ELH A;  4QSH A;  1B9M A;  2M45 A;  1LEA A;  1QHG A;  3CCQ I;  2YX7 A;  4KJZ A;  2DK8 A;  2IS4 A;  1LNW A;  2ID6 A;  2E36 A;  3VFZ A;  2W84 A;  3JAM K;  4H0E A;  3KIO A;  1X58 A;  2JQ7 A;  3S16 J;  2BBY A;  3FIS A;  3GTG J;  1DU6 A;  1BIB A;  3UR3 C;  2V1D A;  4XIC A;  2VPL A;  3GTM J;  3KP5 A;  1BI2 A;  3DLA A;  1EA3 A;  1QO0 D;  1U5T A;  4AID A;  2JUG A;  4OIR F;  1XN7 A;  1W5T A;  1RKW A;  5B1B H;  4BE1 A;  1WFX A;  1IRZ A;  1JUS A;  3LMM A;  1MJA A;  3S14 J;  2MC4 A;  5FKL A;  2O5R A;  4PK4 A;  1JUP A;  4ITV A;  4Q48 A;  4RGU A;  4KN4 X;  3N97 A;  1TZL A;  2KHM A;  3G4S I;  3WTW C;  3IKV A;  3HGG A;  4I01 A;  3DTI A;  2ZXW H;  1NHA A;  3SDG A;  2FUG 2;  1RES A;  4WXD A;  1H0M A;  1A31 A;  1UZC A;  1S7A A;  2L9N A;  4E7L A;  1ENH A;  1R5I D;  3A4C A;  3F8B A;  2BE5 F;  1J7K A;  2EFQ A;  3OR1 C;  3PUF A;  4M6Y A;  1XX5 A;  3PNT A;  2DOD A;  5E79 C;  1SFE A;  1WVR A;  2IVM A;  1ZGJ A;  1R1V A;  2X4H A;  4P96 A;  1ZAO A;  5IYD J;  3D1N I;  5IP6 A;  4RA2 A;  3ZN0 A;  1SD7 A;  4XRM A;  3HBL A;  1FNN A;  4KN7 X;  2QQA A;  4XID A;  3S17 J;  4D7M A;  4BJT A;  2FEZ A;  2HOS A;  1OYI A;  3BRO A;  4WF2 A;  4A3I J;  3IH3 A;  3GBG A;  3K6G A;  2XHK A;  2Y0S N;  2EB7 A;  2F48 A;  3LFU A;  5D5X B;  3ZMT A;  4ESB A;  1CQT A;  1IXR C;  1IN6 A;  1DPR A;  3I59 A;  1RZ4 A;  3EUH A;  5CJ9 A;  2NS0 A;  4P55 A;  1Y1V J;  4XMY A;  1SVM A;  4X6A J;  2IGK A;  3RCO A;  4BYY A;  1FBQ A;  4PDK A;  1VQ8 I;  4ON0 A;  2X6Y A;  3WU2 C;  2PQ8 A;  2DPU A;  3TW6 A;  3KEY A;  5FLX Z;  5KVR A;  3TGN A;  4I99 C;  4JX5 A;  1WCM J;  3AKZ A;  2ZNZ A;  4E7Z A;  1A35 A;  2QUF A;  2X6O A;  4PJM A;  1U8B A;  3HPG A;  3TQN A;  3CES A;  2HXO A;  5KK1 A;  4P9F A;  1N25 A;  3CJT B;  5D6F A;  1O3R A;  1OYY A;  5E17 F;  4GYI A;  2V4J C;  3C2B A;  5ILS A;  3W2A A;  4C9Y A;  4P1W A;  4HX4 A;  5F0H A;  1FY7 A;  1RR7 A;  1SMT A;  4FX4 A;  1KYZ A;  3HGY A;  5K5R A;  5FLX K;  3NRV A;  4A69 C;  4QTR A;  3S2H J;  2WV0 A;  5L3D A;  3MCZ A;  1E3H A;  3I56 I;  4NB5 A;  2CSO A;  2I10 A;  3LSJ A;  2FNA A;  2QA4 I;  4A3B J;  1FBS A;  1RRJ A;  1LFU P;  2KL4 A;  3FK7 A;  3RI4 A;  2B0L A;  4XK4 A;  3C2H A;  4IQ4 A;  1R4M B;  4I09 A;  3GVA A;  1GXQ A;  1SFU A;  1LKX A;  3FZV A;  1U9O A;  1FOK A;  1MMD A;  1T38 A;  5LRS A;  3IV5 A;  4BH9 A;  1QVT A;  2FOK A;  3CUQ A;  1C0W A;  1EJ9 A;  1ZG5 A;  2EIM H;  2XIG A;  2IJL A;  3FWE A;  3ABU A;  3LQQ A;  4HX7 A;  5HOD A;  2TCT A;  3DLL F;  1GV2 A;  5TIS C;  2LKX A;  3DFG A;  3H9J A;  2O8X A;  2E1M C;  2VJ5 A;  3LNQ A;  3MAJ A;  3A03 A;  3GTO J;  5EGO A;  5D4S A;  4JQF A;  3E5Q A;  2E19 A;  5GAE J;  4J19 A;  1ZH5 A;  2GOX B;  3BZ6 A;  5HLG A;  2FQ3 A;  3GFI A;  3REO A;  1D1A A;  2RNJ A;  3ZMD A;  1BIA A;  4XLC A;  3WU0 A;  5J6X A;  2F5E A;  3MMY B;  4IVN A;  4D7N A;  2FX0 A;  1DUX C;  3RKY A;  5K7F A;  4O3M A;  4PCQ A;  4EQQ A;  3QU3 A;  3IRQ A;  5D5W B;  2R7Z J;  2LG4 A;  1KQ9 A;  2Y48 A;  2EBI A;  2IS1 A;  1HF0 A;  2GOM A;  2V1U A;  4AUX A;  2YSR A;  1RUN A;  4DNC A;  4B1R A;  3CLQ A;  1XGM A;  5IYB J;  3HYI A;  2E2H J;  2J5P A;  4TV7 A;  3WOD F;  3JRH A;  2LTP A;  4MEX F;  1T08 B;  2P81 A;  3M7G A;  1PJR A;  2KIF A;  1JGG A;  1O7F A;  1LDK B;  2M1B A;  4PGG A;  1F43 A;  1OQY A;  3G71 I;  2LK2 A;  4M9Z A;  2ACJ A;  1ACI A;  4HLX A;  1X2N A;  4HQE A;  3O3K A;  3M9A A;  4F93 B;  4GYG A;  3CCS I;  4BQN A;  2XVC A;  1O4X A;  2XGX A;  1BN5 A;  2KZG A;  3H5N A;  3LFK A;  3BTL A;  5FKM A;  4YFX F;  2KJB A;  1R7J A;  1XMA A;  2KIM A;  5EEG A;  4MTE A;  1G4D A;  1S9H A;  4IOA F;  3ECO A;  2OAZ A;  2CUZ A;  3S1N J;  2XAF A;  5AIP A;  4BKX A;  4ABZ A;  3OY9 A;  2DT6 A;  4Y15 A;  2K40 A;  2TRT A;  1V5F A;  2HXI A;  4B47 A;  2IGN A;  3KCC A;  1BL0 A;  1VQN I;  2VT2 A;  2E1N A;  4FE4 A;  2PLY A;  3KZY A;  1B6A A;  2JRT A;  2DK5 A;  3S2W A;  1Y8Q B;  1T95 A;  5D8L B;  2MBF A;  3JRD A;  4BDY A;  3U21 A;  2DPD A;  4IX7 A;  3OS0 A;  1KZH A;  4MTD A;  1APL C;  2MC3 A;  1IDY A;  2STT A;  4X1E A;  3G73 A;  1IV6 A;  4N4O B;  3FXO A;  4LB6 B;  4EGY A;  3OSG A;  1JJ6 C;  4YIF A;  5E1X A;  2I5U A;  5CQG A;  4HAM A;  4BQQ A;  2M0C A;  1T0F C;  4ETS A;  3BPX A;  5GPA A;  3DEU A;  4D5C A;  1B72 B;  2DMP A;  3J7Z I;  3L2V A;  2KDO A;  1W5C C;  2W1O A;  2HWV A;  1YTY A;  2NOJ B;  2Q2E A;  2FU4 A;  1JT6 A;  4HRI A;  3A02 A;  5FKN A;  3BY6 A;  2IW5 A;  3HJE A;  2ZME B;  4IRG A;  4ENM A;  2LY9 A;  1ZK8 A;  3IRR A;  1OCC H;  2EIJ H;  4KMF A;  3LSR A;  1H9T A;  4XRS G;  1W0T A;  3BR0 A;  3ZPL A;  2X6X A;  1VQO I;  1VZ0 A;  1UFM A;  2DA6 A;  3W3C A;  4L9J A;  2EFW A;  3WG9 A;  2R7T A;  2HTS A;  1SEU A;  3L9F A;  2ZXJ A;  2FBI A;  4HNT A;  2UZK A;  5EDN A;  3V8L A;  2CUF A;  2WB1 N;  3DPL C;  4JX4 A;  3SYT A;  1REP C;  2X6W A;  2IGM A;  5HNF A;  2DOF A;  5FGM A;  2CU7 A;  2ELK A;  4IXA A;  2HQN A;  1YYV A;  3RYR A;  3I55 I;  5J1R A;  2A07 F;  1U6G A;  1XG1 A;  1UJ8 A;  2HYJ A;  3DCF A;  1D8J A;  3NWS A;  1XDS A;  2R7Q A;  4XM3 A;  3FX3 A;  2QCO A;  5FFX A;  5HLT A;  3GW2 A;  1SD4 A;  1D5Y A;  1YJW I;  5DS9 A;  1KQ8 A;  3O8G A;  2HTJ A;  4N4N B;  1MSF C;  4A3M J;  2HVR A;  4E7K A;  3ZMS A;  1JHH A;  2CW8 A;  5H20 A;  1JJ8 C;  2ZFU A;  5ICE A;  2VBW A;  2YU9 J;  4GXO A;  2ISY A;  2MH9 A;  2CGP A;  3CC2 I;  3I5U A;  1HA8 A;  5ILV A;  2VXZ A;  3HUG A;  3F3X A;  4DJA A;  3TOB A;  4PJJ A;  5LHH A;  1X2M A;  2QVO A;  1CGP A;  2F6C A;  1WKM A;  4A3L J;  5E1Z B;  4UVA A;  4AVP A;  1U3E M;  1ZGA A;  9ANT A;  2Z99 A;  3H0D A;  3R4K A;  4L18 B;  2E5Z A;  4BDZ A;  1K4T A;  1FTT A;  5DTD A;  1OLT A;  1ERD A;  5DDG A;  2V9P A;  2P5L C;  1W0U A;  2QBY A;  4YEL A;  1NG7 A;  2FBH A;  4KFC A;  2ETH A;  2MD5 A;  1VQ7 I;  4DYC A;  2LSO A;  1FP2 A;  4C2M J;  3JSP A;  3R0J A;  2YUS A;  5E18 F;  4HW0 A;  3GWZ A;  3FBN B;  5K7Z A;  3E6C C;  3FK6 A;  4I2O A;  5C3E J;  3PJR A;  2DQL A;  2QKL B;  2Z5U A;  4BL0 B;  1LFB A;  1BI0 A;  1R58 A;  1LQ1 A;  2K4B A;  3BZC A;  3MKY B;  2DA5 A;  4RB1 A;  4IHY A;  2EPF A;  2DA1 A;  4M3E A;  2EWN A;  2F4O B;  3F9K A;  4XOT A;  1WJF A;  2V7F A;  3OWT A;  4XKV A;  5JVG F;  1X1P A;  4L9V A;  1VND A;  2LFB A;  4O6J A;  4S0H B;  2GIV A;  4EJW A;  1YW7 A;  3ZP5 A;  2NAZ A;  2XUB A;  3CMM A;  3LSI A;  4FIS A;  1JKR C;  1FIA A;  1QPI A;  3AFH A;  4I98 B;  2VE8 A;  1E3O C;  1JTX A;  1KYW A;  3DBH B;  4LFU A;  5E3O A;  1ZGW A;  3QU6 A;  4GGG A;  1U5T C;  2WA0 A;  3I3L A;  3OL4 A;  5HDG A;  2FNP A;  4BJ5 C;  5FLM J;  1V55 H;  3WTX C;  4UV9 A;  3ZOB A;  5JR3 A;  5E8I A;  2QQB A;  3HIF A;  3LSP A;  1UHM A;  1IW7 F;  1HST A;  1SVO A;  2P6T A;  5CKT A;  3O6B B;  1UST A;  1ZKG A;  5H2F C;  4DYQ A;  5FRN A;  1TNS A;  1RPW A;  1WJE A;  2V6E A;  1MMN A;  4OIQ F;  3PIO F;  4G7O F;  2O61 A;  3K10 A;  3S93 A;  1S7E A;  1P7J A;  2LD5 A;  3CMA I;  2XAJ A;  2HI3 A;  1GV5 A;  3HOU J;  2UWM A;  3M8E A;  4M6V A;  1F5T A;  3HOX J;  1IN5 A;  1T33 A;  4A3E J;  2XAG A;  2D1H A;  2PFB A;  2JZY A;  2OUM A;  3WGI A;  3CDH A;  5FRM A;  1STZ A;  1SAU A;  1VQL I;  4UUS A;  5DYM A;  2CYY A;  2VC1 A;  2DYS H;  2IA2 A;  3DV8 A;  1FIP A;  4KMU X;  2IS2 A;  3I58 A;  3K4J A;  1X3Z B;  2ZSH B;  2M7A A;  3WTS C;  1ODD A;  1I5Z A;  1KA8 A;  3BT9 A;  1LB2 A;  3OOU A;  4DW6 A;  4II3 A;  1YHQ I;  4ZYH A;  3D5R C;  2OF7 A;  3VSL A;  2BHZ A;  1B9N A;  4BY7 J;  4CUG A;  2R7S A;  2M30 A;  2ZXH A;  5FD6 A;  2XF6 A;  3H9G A;  4CYC B;  1GXP A;  1XCV A;  2GBY A;  3EUH C;  4LOC A;  3TO9 A;  3PUB A;  4M72 A;  4MFE A;  4LJZ F;  3OYN A;  2JJ7 A;  4C2T A;  2WAE A;  3D5L A;  3K70 C;  4A12 A;  3LSM A;  1IF1 A;  1IRX A;  1I39 A;  3OYG A;  2W00 A;  4NC6 A;  3DU6 A;  1FLI A;  1ETQ A;  2VQC A;  1TWG J;  1MBF A;  3LSG A;  3J80 Z;  4XON A;  2BY2 A;  3C2G A;  2F5D A;  2WAF A;  4Q5S F;  3CCM I;  2HKX A;  3ABM H;  5LEK A;  4UNO A;  1I27 A;  5FD5 A;  2ZJR F;  1G3W A;  1XMX A;  2LLK A;  1FBU A;  1IXC A;  2X1D A;  3HSR A;  3CCU I;  3ZQC A;  2R92 J;  5E3L A;  4ENJ A;  2ESH A;  2UXN A;  4MEY F;  4XKW A;  4QPQ A;  1WGX A;  4EM1 A;  1G6N A;  2GQQ A;  2CUE A;  4Y33 A;  2QQ9 A;  3BZK A;  4YEJ A;  3K4C A;  2QZ8 A;  2VKH A;  3KE2 A;  3S3O A;  2VBX A;  3J80 K;  4Y3O A;  1XSD A;  5HDN A;  2Q1Z B;  4E70 A;  4A2U A;  5F0F A;  5F08 A;  2VQG A;  2F5F A;  3M8F A;  1RR8 C;  3HSF A;  2XGD A;  2Y69 H;  3OL3 A;  3NAR A;  5EEH A;  2H1L A;  3HRU A;  1U9N A;  2CWE A;  2M7B A;  1FZP B;  2V79 A;  4JYK A;  1RUO A;  2JUC A;  2XKP A;  4PSX A;  1B8I A;  4A3G J;  2UV1 A;  5J40 A;  2M9H A;  1XGN A;  1ORK A;  4RAZ A;  1Z67 A;  4ZDL A;  3G3Z A;  2R7W A;  1ETK A;  3UKG A;  1K4S A;  1MMG A;  2W82 A;  1J75 A;  5LGT A;  4F92 B;  5K1Y A;  4DYR A;  1IN7 A;  3CUQ C;  3BCB A;  3IH2 A;  3F0C A;  2ZKZ A;  3CMY A;  1XC5 A;  4FET A;  2K9L A;  4E7S A;  5F1R A;  4BBS J;  4Y17 A;  2OC6 A;  1FTZ A;  1TW2 A;  1DPU A;  4GDF A;  4OMY A;  1SVL A;  3C7J A;  4G6T B;  1EF4 A;  1XMK A;  2ZFW A;  3BR5 A;  4B09 A;  4CA0 A;  1LUJ B;  1T2K A;  3GLL A;  2A6H F;  4XSZ F;  1A5J A;  1AA7 A;  1Z77 A;  2L02 A;  2XSJ C;  5DD4 A;  3Q0W A;  4KT6 A;  1EV7 A;  3J81 K;  3OYA A;  2AO9 A;  3OYI A;  2E7X A;  2RC4 A;  4XLH A;  4NHJ A;  3HHG A;  1XPX A;  3JAM Z;  3FF5 A;  2HVS A;  1R36 A;  1D0X A;  4UB8 C;  1K6Y A;  3RPQ A;  2E1O A;  4C3I J;  1E17 A;  5F6F A;  5DM7 F;  4L9N A;  4M6X A;  2DBB A;  1BC8 C;  2A68 F;  2IPQ X;  3RZD J;  4HV5 A;  3HOT A;  3G1M A;  4ENN A;  4CHU A;  3OYC A;  5IP7 J;  2D1V A;  5JI6 A;  4FHT A;  3MKZ A;  3NEU A;  2OD5 A;  1ZTR A;  2FF4 A;  1ZAR A;  2JRM A;  4IKF A;  3OYM A;  4U0V A;  3I71 A;  3FXM A;  1SFX A;  1H8A C;  3W2V A;  5BS6 A;  4C2U A;  3OMY A;  2YR2 A;  4M9X A;  1B8I B;  2BY1 A;  4ZYD A;  2GWR A;  2LR8 A;  4HBL A;  3CO7 C;  1K78 B;  4LG0 B;  3L2W A;  1MIJ A;  4OIO F;  2EV5 A;  2MYS A;  3RPU A;  4YIR X;  3ZXS A;  2OU2 A;  2STW A;  2KFD A;  4K2E A;  3FXJ A;  1DGW Y;  1I1G A;  2LYC A;  2L9V A;  5LRR A;  3BG7 A;  3LA7 A;  1E3P A;  4HPQ A;  4CDG A;  2QSG X;  3ROU A;  1BOB A;  1JKO C;  4FAS D;  4KIB A;  2WBM A;  1QPM A;  1Y6I A;  2KT0 A;  4MQV A;  1ETO A;  2Z33 A;  1MKM A;  3ASO H;  3HKZ A;  3QWL A;  3SEZ A;  1TWF J;  3CP8 A;  3K7A J;  4P5O A;  4ZYA A;  1I6X A;  2KDZ A;  2NOG A;  2OA4 A;  1JUM A;  3WTY C;  4D9J A;  5EZH A;  5L3C A;  3BCA A;  2V1X A;  5GPC A;  1VQK I;  3MKW B;  1ZG3 A;  3N4M A;  2DFF A;  2V9K A;  4M3G A;  1LDD A;  2VC0 A;  1R9T J;  1BR2 A;  1IV8 A;  1MNE A;  4HF0 A;  1EH6 A;  2L9S A;  2CQQ A;  4WCG A;  3RDI A;  1S3J A;  2DFH A;  3CCY A;  2OV7 A;  1KU3 A;  2P5K A;  2H1K A;  1DGR M;  2F4I A;  1RET A;  1PUF B;  5B5E C;  1TC3 C;  4DBQ A;  5ILU A;  2K9N A;  3R60 A;  4N9H A;  4UV8 A;  3RKW A;  4Y52 J;  1ZR4 A;  3ZMU A;  5E3M A;  1K6O A;  1AU7 A;  1FOY A;  2JA8 J;  5KNL A;  2BVM A;  1A6I A;  3AG4 H;  2DMN A;  3K1N A;  3CC7 I;  1HOM A;  2OTJ I;  2DT5 A;  3ZQ7 A;  4CXF A;  4BHP A;  4PFO A;  4NC8 A;  2GAU A;  1DQU A;  5GTH C;  2MW8 A;  3T5X A;  4U0Y A;  4G7Z F;  1KGS A;  1A6Q A;  1DDN A;  2OBP A;  1EH7 A;  2LP0 A;  3RYP A;  3RPU D;  1IN4 A;  3S1R J;  4IHW A;  2NXN B;  2CV2 A;  2JMW A;  2GLO A;  4HLY A;  2ZNY A;  3O8H A;  3EQL F;  4BHC A;  5L3G A;  3CJR B;  3A01 B;  1PP7 U;  5J8C A;  3IL2 A;  3LOC A;  1L0O C;  2EFO A;  2PBI A;  5EJC A;  2NS7 A;  3OYD A;  3PFY A;  4FX0 A;  3JR9 A;  3F72 A;  3P7N A;  4G8X A;  1MMS A;  4QWQ A;  2BVL A;  3AG1 H;  5CVJ A;  3TP0 A;  3GTL J;  2O9L A;  2LRE A;  4OIN F;  2AHQ A;  3IH4 A;  1SAN A;  4UUT A;  4KYW A;  3OR2 C;  1P7I A;  4G12 A;  1FOW A;  3QPH A;  2RN7 A;  2XRL A;  3ZMV A;  3QYB A;  2EA4 A;  2ELJ A;  2L5Q A;  2M3A A;  3H92 A;  1SC7 A;  1TQP A;  5E20 A;  3ZCO A;  4HF2 A;  1FSH A;  1TQM A;  3VYU B;  2K4J A;  3WGG A;  5IOZ A;  1TT5 B;  1VQ9 I;  2QYO A;  3DU5 A;  5J1Y A;  1BA5 A;  4AD9 A;  4EJO A;  2HQ5 A;  3KP2 A;  2O03 A;  1JKQ C;  1XSV A;  2K7L A;  3TL4 X;  2AXT C;  1G3T A;  2GXA A;  3QQA A;  4DOZ A;  3BQY A;  1D3Y A;  2C6Y A;  2BY3 A;  3K4B A;  1G3Y A;  3HOZ J;  3DP7 A;  4HDU A;  1WJB A;  1XCB A;  3BDD A;  3PO2 J;  3QPS A;  5LD2 C;  5ED4 A;  5E3N A;  1LE8 B;  3FMQ A;  1HXD A;  4MLO A;  4BNC A;  3HTS B;  1O7L A;  4KUM A;  4WX9 A;  2ESN A;  2P5V A;  3JRC A;  1PVE A;  3E5U A;  2HGC A;  5B66 C;  4HYE A;  3DQV C;  1WH5 A;  1VQ5 I;  5CVR A;  3M07 A;  1TWA J;  4RM3 A;  4IO9 F;  1WPK A;  4XOP A;  2LRD A;  1YS7 A;  5M5X J;  2PJR B;  1OCT C;  3EUK L;  2VJJ A;  3CF5 F;  3Q9S A;  3VYT B;  2BXZ A;  5M3M J;  3KP3 A;  4EEF G;  5EG0 B;  2FXA A;  1PDN C;  5JHF A;  5JFR A;  3BP8 A;  4LLN A;  1J9I A;  3GFJ A;  1JI8 A;  3DEE A;  1D8K A;  3ZQL A;  1FYM A;  5AON A;  2P0W A;  1TL8 A;  1B72 A;  5BQT A;  4CZC A;  3GZ6 A;  2MLK A;  2L7Z A;  4FCY A;  2LNB A;  3GTP J;  1CF7 B;  4EJU A;  1R5G A;  2K86 A;  2NVU B;  3CCE I;  1HCR A;  2ZME A;  2CW0 F;  4ZJZ A;  4A3D J;  2HYF A;  1F4K A;  4I7H A;  3AL0 C;  3K0L A;  3FDY A;  3M1E A;  3CC4 I;  2K85 A;  3OYH A;  1R6R A;  1QA6 A;  5KAI C;  4RBO A;  2LOO A;  2IXS A;  1YLF A;  1VQM I;  2EK5 A;  4ESJ A;  3ISP A;  3TP3 A;  4KIC A;  4DQ2 A;  4KIT B;  4HSR A;  2D5V A;  1JHF A;  2VKD A;  1ON1 A;  4FQG A;  1O57 A;  2X85 A;  2MH2 A;  1SFK A;  4I0B A;  1HW2 A;  1LJ9 A;  1SD5 A;  4Q4Z F;  2DTR A;  1QZZ A;  1J2X A;  3WHB A;  4MIM A;  2A3S A;  3V42 A;  2Y9Z A;  2KMU A;  1YS6 A;  4BJ6 C;  2R7D A;  3ZQI A;  3GFL A;  2DW4 A;  1P4A A;  3K2A A;  2DAO A;  2JK3 A;  3KLO A;  2NNN A;  5J3L A;  3KEO A;  4ENK A;  3H5R A;  3ZN1 A;  4BQA A;  1WJC A;  1YIT I;  5E8G A;  4XN0 A;  2XAH A;  4PUS A;  4ZYG A;  5F1J A;  2DA3 A;  2K02 A;  5DEQ A;  2VAS A;  4UUV A;  1YX5 A;  1KU9 A;  3MD2 A;  2EZH A;  4ASN A;  1I3Q J;  3H3Z A;  4LLG F;  2LVS A;  3PM1 A;  4IHV A;  4A6E A;  1K61 A;  3VYS B;  2YU3 A;  4KT5 C;  2Z3Y A;  3FHN A;  3Q9V A;  3QYE A;  5JLW A;  2VT3 A;  3CLO A;  3TO7 A;  2NVQ J;  2QM3 A;  2B7E A;  3KYL A;  4HQM A;  4R79 A;  2LDU A;  1P4X A;  3A1Y A;  1MMA A;  4BBR J;  3C18 A;  1FT9 A;  1P92 A;  1RC9 A;  3MFK A;  4KA4 A;  3HRT A;  4XKB A;  1YFH A;  2QEN A;  4U7B A;  1A36 A;  1BC7 C;  3L7W A;  2UUZ A;  4JK1 X;  3HC7 A;  4RAF A;  1XGS A;  4XLN F;  3LAJ A;  1YIJ I;  1HQC A;  2A6E F;  2DFE A;  2HZD A;  1T39 A;  4XN3 A;  4NUB A;  3V8J A;  2RNG A;  2CJJ A;  5ERI A;  1J09 A;  2W7N A;  3M8J A;  2EZK A;  4ZTJ A;  1W1W E;  1PYV A;  3T8R A;  3ABT A;  3K2Z A;  2M0M A;  1U78 A;  1ETW A;  1YE9 A;  4CCL A;  2NVY J;  1RIO H;  1HW5 A;  3LA3 A;  4IJA A;  4OU0 A;  1HW1 A;  4CCN A;  4E6K G;  4XRS A;  2IT0 A;  1JXS A;  4S05 A;  3KPH A;  2KZV A;  3PSI A;  1XS9 A;  2KRF A;  3GFM A;  3KYC B;  2AQF A;  2DFI A;  1ZRE A;  3KFW X;  3SFZ A;  3EDP A;  2XPW A;  4D0P A;  3I9V 2;  4PJ0 C;  4EMS A;  3DF8 A;  3V4G A;  4RB2 C;  2OZ6 A;  1AKH A;  2N8G A;  4I0A A;  2DN0 A;  4U88 A;  4EVI A;  2D45 A;  5IT9 Z;  3EYY A;  3KLN A;  4HST A;  1QVU A;  4R1H A;  3M4O J;  4XLA A;  3AG2 H;  1OPC A;  4DGW B;  4IPA A;  2FML A;  3VOE A;  2JN6 A;  2KIU A;  2B9S A;  1QZE A;  2M4G A;  2ICW G;  4AIH A;  4AYB N;  5CVU A;  1I3A A;  1Z3Y A;  1LDJ A;  2KPM A;  2PMH A;  2CMP A;  2HU9 A;  2WY8 Q;  5M5W J;  3CUO A;  2XSD C;  1F36 A;  2ME0 A;  1Z9C A;  5IT9 K;  3PNY A;  4IRH A;  2X1E A;  2VON A;  4AIK A;  1K83 J;  4RDU A;  1Y0N A;  3WTU C;  3GTK J;  2DYR H;  5LLQ A;  5HNH A;  4XRF A;  2QSF X;  2HQA A;  2V1N A;  3KEQ A;  3E6M A;  1D1C A;  1Z1D A;  2WV1 A;  2XRN A;  3VEP A;  4B3A A;  1HDP A;  3ZQQ A;  1GT0 C;  4RB3 C;  3BTC A;  3H0G J;  3ZQH A;  2BV6 A;  1P9Q C;  4ZZL A;  1W36 D;  4F91 B;  1ZLJ A;  2CQK A;  1IN8 A;  3QYF A;  1IUF A;  2XF5 A;  1XDU A;  3KZI C;  4EJV A;  3FXL A;  1E0E A;  2QKM B;  4RLQ A;  4OIP F;  5KHD A;  2QQ8 A;  2KQR A;  2CUJ A;  4YG2 F;  4LMY A;  3SZP A;  4UY8 I;  1WHU A;  2PEX A;  1XB4 A;  3X2Q H;  2YS9 A;  5D5U B;  3I64 A;  4G7H F;  1S6L A;  2X0L A;  3VWB A;  4CYC A;  1MJB A;  3HG9 A;  3R61 A;  3QP6 A;  2WAQ N;  1S8N A;  1OCZ H;  4CCK A;  3ESW B;  1Z3X A;  1FYL A;  3HKZ N;  5D8K B;  5CYV A;  3BTJ A;  1W7P B;  2DA7 A;  1ZN2 A;  2Y31 A;  3LA2 A;  5FJ8 J;  1O3Q A;  4MHG A;  4WK8 F;  4BAY A;  3GTJ J;  3PFI A;  1NTC A;  2LF8 A;  3A0H C;  4U0W A;  3T1B A;  3U2R A;  3MZY A;  4BE2 A;  2GXB A;  5K5Q A;  4JP0 A;  2XB5 A;  2MGQ A;  3G6E I;  2KP6 A;  3W6K B;  4R8H A;  1IXS B;  2KIQ A;  3V7C A;  1MH4 A;  3I54 A;  2RVC A;  5HVQ C;  1MND A;  2W4S A;  4H4K C;  2X48 A;  2VJI A;  4BU2 A;  1B4A A;  2XPV A;  3K69 A;  3HM5 A;  4E7J A;  2W25 A;  2MAB A;  2W48 A;  3HOW J;  3H5A A;  2VOO A;  4E4H A;  4D1Q A;  2VKE A;  2Z9O A;  4FT8 A;  3OIO A;  3DBR B;  5D6E A;  2JA5 J;  3MKL A;  1YJN I;  3KET A;  2E60 A;  4L9T A;  3ECH A;  4HV6 A;  2XKO A;  2DT7 B;  1WRJ A;  2VBZ A;  2CG4 A;  2PMU A;  3IWZ A;  4FE7 A;  2H8W A;  2HDD A;  1BW5 A;  3FM3 A;  2CFO A;  2NRA C;  4W1U A;  2DI3 A;  5E1W A;  3Q0V A;  4L0Y B;  3L2C A;  2R5Y B;  1YW9 A;  3J7A O;  3P5J A;  2COB A;  2E1M B;  4RGS A;  1ZRD A;  2K9S A;  3BJA A;  4F7Z A;  4XLF A;  3DXJ F;  1HDD C;  3BQZ A;  2W85 A;  3FKI J;  5IT3 A;  3RJP A;  3CJQ B;  4RAY A;  1IG7 A;  2BYV E;  3K4L A;  3FIW A;  4L0Z B;  3RZO J;  5CVV A;  3HOV J;  5LEJ A;  2DU9 A;  5GP9 A;  1S72 I;  2V6C A;  3I4M J;  4IZZ A;  4ZYE A;  1MDM B;  5L3F A;  5CVI A;  2O0Y A;  3IKT A;  4CGZ A;  5HOO A;  4CO8 A;  2O6G E;  3ZMZ A;  1VI0 A;  3TO6 A;  1T0F A;  4YII A;  2L9R A;  3GXO A;  2L7M P;  4BXF A;  2Z16 A;  1GDT A;  2M5W A;  4EGZ A;  3PQJ A;  3LL7 A;  3LAP A;  2X1C A;  4UVC A;  3SHF A;  4G6Q A;  1K79 A;  3NQO A;  2HOE A;  3JRE A;  4IOC F;  1S5L C;  3D0S A;  1IC8 A;  1E2X A;  1UHW A;  2P6S A;  3M1C A;  2E2I J;  2JT1 A;  2FMY A;  3U1K A;  1JT0 A;  3QPL A;  4LG3 A;  3E97 A;  2ZJP F;  4J00 A;  4RS8 A;  3WE3 A;  4Y4R A;  2LBF B;  4KNY A;  1HC8 A;  4LGW A;  4BEH B;  1IRF A;  3N05 A;  5F04 A;  3TOA A;  1P4W A;  1YI2 I;  4ANJ A;  2ZO4 A;  2L3D A;  3WG7 H;  1K78 A;  4LG0 A;  2ZJ2 A;  5K7H A;  3J81 Z;  2EIL H;  3OOP A;  4AU7 A;  4NQW B;  4ZDO A;  3SJM A;  4B4C A;  2XDV A;  2XAS A;  1FMW A;  2HPI A;  2GA2 A;  2VI6 A;  1FMV A;  3G1L A;  4F52 A;  1YX3 A;  3RSN A;  1JE8 A;  3O2P E;  2JTV A;  3GX4 X;  4C3H J;  3KP4 A;  5TJJ A;  4RMN A;  5F0C A;  3VB2 A;  2X51 A;  4U87 A;  2M2E A;  2E35 A;  3E6B A;  5J1U A;  2Y75 A;  3GCM A;  5F27 A;  1Q1H A;  4XQF A;  2EV6 A;  2JSP A;  4BY1 J;  3B02 A;  2DQR A;  2E2J J;  2EQR A;  1FC3 A;  2ECC A;  1G8X A;  3Q0U A;  3V7R A;  3HEF A;  1X3W B;  2IAI A;  4IQJ A;  2OCC H;  1YOV B;  4PGH A;  5LBQ A;  3NAU A;  1MZB A;  1ZYR F;  5L3E A;  1YRN B;  2EZI A;  3U1D A;  3QOP A;  4B44 A;  3JRG A;  3I4P A;  3RIR A;  3PSF A;  2ME6 A;  3QPT A;  4A5N A;  2X9D A;  2K5C A;  1MD0 A;  2L01 A;  4AYB A;  1OCP A;  4G6D A;  1MGT A;  1U0J A;  1GHC A;  2KRC A;  4KIF A;  5EEA A;  3DBL B;  2IP2 A;  3R0A A;  4Z6Y A;  1R00 A;  3EYI A;  2K3F A;  2BGC A;  1FX7 A;  1MW7 A;  1OR7 A;  3A2K A;  1OKR A;  1DP3 A;  4C3J J;  4MQ9 F;  2EFP A;  1ETY A;  1PUF A;  3HPH A;  5J4V A;  4OAY A;  1TWH J;  2HKO A;  2RKH A;  2R5Z B;  3OYL A;  2BEO A;  2ZME C;  2NVT J;  3GME A;  2JPB A;  3S8P A;  2R93 J;  1FEX A;  3ASN H;  5DCF A;  4WWC A;  2F5C A;  1HLV A;  1HKQ A;  3BOQ A;  4BUP A;  4PJN A;  2XC7 A;  3S1Q J;  1IUY A;  3OYJ A;  2CQ7 A;  3LQR A;  4A0Z A;  1HBX G;  3C3W A;  3K9T A;  1O3S A;  4ZH4 F;  2IEK A;  2M8G X;  3IP4 B;  4QIW N;  3P9I A;  5LFA A;  1OCO H;  3SXY A;  2FD5 A;  3OIQ A;  3JRI A;  3DEW A;  3WHC A;  1LVK A;  2W57 A;  5LHG A;  2IBD A;  2P7V B;  1G3S A;  1WH7 A;  4GO1 A;  1H88 C;  4CCJ A;  5B1A H;  5A2Q K;  3PIP F;  4J01 A;  5BPI A;  5IOY A;  3A01 A;  3HRM A;  4UXN A;  4CCO A;  1SMY F;  3CME I;  1QU3 A;  2WAQ A;  4RAG A;  2NYX A;  5EYR A;  2BHY A;  2BW3 A;  2EV0 A;  3MN2 A;  1BR4 A;  4L5I A;  4LK0 F;  1MBJ A;  2Z1D A;  4HDV A;  1WQ2 A;  4A6D A;  1Y8R B;  2OQG A;  1XGO A;  3RKQ A;  2VUM J;  2CRG A;  1WZ2 A;  3WGH A;  2WWY A;  2Q8K A;  1S7O A;  4CIC A;  3C1D A;  3ZQF A;  1BW6 A;  1PP8 F;  3F8C A;  3CO6 C;  1J59 A;  2HFH A;  4HOB A;  2M87 A;  1Z91 A;  4O5V A;  1KU7 A;  3FHZ A;  2LKP A;  2WAD A;  5DCM B;  5HLH A;  4BXX J;  2K3P A;  1FJL A;  4IRI A;  1Q1V A;  2WY7 Q;  4Q47 A;  3Q3S A;  1ZQ3 P;  1G2H A;  1WJD A;  5LGU A;  4CSW A;  3MQ0 A;  4AVZ A;  3T8T A;  2BZT A;  1WI3 A;  3FXQ A;  3GYH X;  2EFN A;  1YO5 C;  4A0Y A;  2MFZ A;  3BJO A;  1FOX A;  1N75 A;  3CTA A;  1GUU A;  3ULQ B;  2RGV A;  5LHI A;  4HNU A;  5C44 J;  3CF2 A;  3S3M A;  5JHU A;  2XGE A;  5EZG A;  1NK3 P;  3W6J B;  3CDL A;  3BG3 A;  1LE8 A;  1IJW C;  1VFC A;  3QOD A;  2XGC A;  3U9G A;  5CLS A;  1L3L A;  4A3F J;  1W36 C;  2JSC A;  4A93 J;  2YX4 A;  4F55 A;  4YRV A;  1N77 A;  4AWX B;  4BGD A;  3BR2 A;  4X0G A;  4EJT A;  4DZJ A;  1JGS A;  1U2W A;  4ZDP A;  4B8X A;  1UAA A;  1MH3 A;  3FMR A;  4XLE A;  3BG6 A;  2PJR A;  2EH3 A;  3OSF A;  3SZG A;  3S15 J;  1KQ0 A;  2WC2 A;  2ECB A;  1RKT A;  1OJL A;  2LKS A;  2CH0 A;  2O7O A;  4N0B A;  2BW3 B;  3SDB A;  5EG0 A;  5BOX A;  2R7R A;  1BI3 A;  2MD0 A;  2K9Q A;  4ZTF A;  1V54 H;  1OFC X;  2ID3 A;  2PJP A;  2MA3 A;  1U5T B;  3E6D A;  1QNT A;  3ONQ A;  3WTZ A;  3LSH A;  3EPZ A;  2DLL A;  3B73 A;  4HZF A;  4PJL A;  4MFD A;  2O3F A;  1JTY A;  2DXI A;  3IHU A;  2DA2 A;  4NDL A;  1CF7 A;  3E7L A;  3OS2 A;  1R71 A;  3LWF A;  1ONV A;  2L4M A;  2JPC A;  1G59 A;  4OOI A;  2GA1 A;  1T56 A;  2ZXI A;  1OMI A;  4BS9 A;  1QRY A;  1V4R A;  2Q0O A;  1QHH D;  3H9Q A;  3TED A;  4JOM A;  3JTH A;  4A3J J;  5J47 A;  1YQA A;  2RQQ A;  2ZJQ F;  2V9V A;  1ZHF A;  4N9I A;  5BNG A;  1BI1 A;  2VQL A;  3PO3 J;  2UXX A;  4JX6 A;  1WSU A;  2QSH X;  3ZGK A;  1UCR A;  1QQI A;  4HNV A;  1B1B A;  2JA2 A;  4KIG A;  2Y2Z A;  1IZ1 A;  1Z21 A;  2FJ1 A;  1IAW A;  2BY0 A;  4RB0 A;  3L2Q A;  1IDZ A;  2ADU A;  2AQE A;  5IP9 J;  5FLV A;  3BTI A;  2DA4 A;  1RI7 A;  3I4N J;  1YG2 A;  1MBE A;  1Z0X A;  3KYD B;  1H9G A;  1XTA A;  3JRB A;  1BOA A;  3OV8 A;  5IY5 H;  1MJ9 A;  3HOS A;  3CCL I;  2GM4 A;  4RM2 A;  4KIS A;  5JLX A;  1TWC J;  3I59 B;  2K27 A;  2VKV A;  4UHT A;  1FPQ A;  5IYC J;  3ABK H;  3ZQG A;  5J4Y A;  3WTT C;  4M3B A;  1NG6 A;  2VJ4 A;  1QGP A;  3FM5 A;  3V7S A;  2CO5 A;  1TBX A;  3CZ6 A;  4L5E A;  2GXG A;  2OPT A;  3K70 D;  2IGO A;  2XB0 X;  3H3U A;  2JA6 J;  3KX2 A; 
#chains in the Genus database with same CATH homology
 1IRZ A;  1QVU A;  2R0Q C;  1JUS A;  3M4O J;  3S14 J;  2FQ4 A;  2L0K A;  1ETQ A;  5FKL A;  1JUP A;  2JN6 A;  1TWG J;  1MBF A;  2MSY A;  3LSG A;  3HGG A;  4I6Z A;  3SDG A;  4AYB N;  1RES A;  2L7F P;  1POG A;  1ENH A;  3HB9 A;  2M34 A;  5M5Y J;  2LLK A;  5M5W J;  2XSD C;  1F36 A;  2ME0 A;  3ZQC A;  2R92 J;  5E3L A;  1K83 J;  4RDU A;  3GTK J;  1WGX A;  1H89 C;  5IYD J;  2CUE A;  3D1N I;  5IP6 A;  1SFO J;  3HDD A;  4XRM A;  1DU0 A;  3HBL A;  2WV1 A;  4B3A A;  1HDP A;  4XID A;  1GT0 C;  4D7M A;  3S17 J;  3BTC A;  3H0G J;  4M3D A;  5F0F A;  3ZQH A;  4IEJ A;  5F08 A;  2HOS A;  4A3I J;  2G0E A;  3IH3 A;  3GBG A;  1IUF A;  2XGD A;  1MBG A;  3NAR A;  1U9N A;  2PMZ N;  3JRF A;  2Y0S N;  1IGN A;  4JYK A;  1B8I A;  1CQT A;  4A3G J;  2M9H A;  1ORK A;  2YS9 A;  1Y1V J;  4X6A J;  5C4X J;  1ETK A;  4CYC A;  3UKG A;  2WAQ N;  1ITY A;  4DYR A;  5M3F J;  3TW6 A;  3IH2 A;  3F0C A;  3HKZ N;  1XC5 A;  3CMY A;  4BBS J;  3BTJ A;  1AKH B;  4JX5 A;  1WCM J;  2DA7 A;  2Y31 A;  5FJ8 J;  1FTZ A;  3GTJ J;  5EGO B;  1NTC A;  2X6O A;  1U8B A;  1EF4 A;  3BR5 A;  4I76 A;  2HXO A;  2O8K A;  1A5J A;  1Z77 A;  4JP0 A;  2XB5 A;  2MGQ A;  3Q0W A;  3C2B A;  2AO9 A;  1MH4 A;  5F0H A;  1RR7 A;  2X48 A;  2JA7 J;  3HGY A;  3BG5 A;  2XPV A;  3HM5 A;  4A69 C;  4QTR A;  3S2H J;  2W48 A;  3HOW J;  2E1O A;  4C3I J;  2VKE A;  3OIO A;  2I10 A;  3LSJ A;  2JA5 J;  3MKL A;  3RZD J;  2HOA A;  4A3B J;  1LFU P;  5IPA A;  3G1M A;  3FK7 A;  2NVX J;  4XK4 A;  5IP7 J;  1ZTR A;  4FE7 A;  2HDD A;  1H8A C;  1U9O A;  1BW5 A;  2QF7 A;  4W1U A;  1B8I B;  3IV5 A;  2DMT A;  1QVT A;  3Q0V A;  2R5Y B;  2LR8 A;  2COB A;  4GFB A;  5HOD A;  2K9S A;  2TCT A;  1HDD C;  3BQZ A;  1GV2 A;  3FKI J;  2RAE A;  4M3F A;  2LKX A;  1IG7 A;  1UMQ A;  3LNQ A;  2DMQ A;  3A03 A;  3FIW A;  3GTO J;  3RZO J;  5EGO A;  3HOV J;  5GP9 A;  2E19 A;  4J19 A;  1MBH A;  3I4M J;  3CQZ J;  1VF9 A;  1JKO C;  4D7N A;  2FX0 A;  1VI0 A;  5K7F A;  2KT0 A;  1ETO A;  3S1M J;  2L9R A;  2L7M P;  1TWF J;  1GDT A;  3K7A J;  2R7Z J;  2KDZ A;  2NOG A;  2EBI A;  1HF0 A;  1JUM A;  5EZH A;  4AUX A;  5GPC A;  3B6C A;  4M3G A;  4B1R A;  5IYB J;  3JRE A;  1R9T J;  2E2H J;  1IC8 A;  3JRH A;  2LTP A;  2E2I J;  4AC0 A;  2P81 A;  1JGG A;  1I6H J;  2CQQ A;  1JT0 A;  3QPL A;  1F43 A;  3BG9 A;  4Y7N J;  2LK2 A;  3CCY A;  2H1K A;  1X2N A;  1RET A;  1PUF B;  1TC3 C;  1MSE C;  2K9N A;  1O4X A;  4D5F A;  5F04 A;  4Y52 J;  1ZR4 A;  3BTL A;  5FKM A;  5E3M A;  1AU7 A;  2R5Y A;  2JA8 J;  1A6I A;  2DMN A;  1GVD A;  1HOM A;  3RQI A;  5K7H A;  4IHX A;  3S1N J;  4BKX A;  4ABZ A;  3SJM A;  4B4C A;  2K40 A;  2TRT A;  2HXI A;  3TW7 A;  1BL0 A;  2MW8 A;  2VI6 A;  3G1L A;  4FE4 A;  3VPR A;  2LP0 A;  4C3H J;  3S1R J;  4IHW A;  5F0C A;  3JRD A;  3H3V K;  2JMW A;  2M2E A;  2GLO A;  5J1U A;  3O8H A;  5F27 A;  5FKK A;  1APL C;  3A01 B;  1IDY A;  3BR3 A;  2VPR A;  2JWT A;  4BY1 J;  3LOC A;  2EQR A;  2E2J J;  2NS7 A;  5EF6 A;  4X1E A;  2ECC A;  3Q0U A;  3HEF A;  1IV6 A;  2IAI A;  3JR9 A;  3NAU A;  3OSG A;  1JJ6 C;  2M0C A;  1YRN B;  2EZI A;  4A3K J;  3TP0 A;  3JRG A;  3GTL J;  5GPA A;  2O9L A;  2ME6 A;  1ETX A;  2AHQ A;  3IH4 A;  1UHS A;  1SAN A;  4UUT A;  3GTQ J;  2X9D A;  4D5C A;  1B72 B;  2DMP A;  1P7I A;  4G12 A;  2XRL A;  1OCP A;  1Y1W J;  5EEA A;  1JT6 A;  2DMU A;  5IOZ A;  3A02 A;  5FKN A;  5J1Y A;  4C3J J;  1BA5 A;  2LY9 A;  1ZK8 A;  1ETY A;  1PUF A;  2HQ5 A;  3LSR A;  1TWH J;  4XRS G;  1I50 J;  2R5Z B;  1W0T A;  1JKQ C;  3BR0 A;  2NVT J;  1MBK A;  2R93 J;  1FEX A;  3SFI A;  3QQA A;  2DA6 A;  3BQY A;  1AHD P;  1HLV A;  3S1Q J;  3L1P A;  3HOZ J;  3B6A A;  5EDN A;  2CUF A;  3PO2 J;  2WB1 N;  3QPS A;  3MVP A;  5E3N A;  1LE8 B;  4JX4 A;  2IEK A;  2M8G X;  4MLO A;  4QIW N;  2Y9Y A;  2FD5 A;  2CU7 A;  2ELK A;  3JRI A;  3DEW A;  3WHC A;  3JRC A;  2IBD A;  5J1R A;  1XG1 A;  1WH7 A;  1H88 C;  1WH5 A;  3S2D J;  1TWA J;  2HYJ A;  3DCF A;  1WPK A;  5IOY A;  3A01 A;  2QCO A;  5M5X J;  5EYR A;  1OCT C;  3MN2 A;  2DTZ A;  3W6V A;  1MBJ A;  1D5Y A;  5DS9 A;  4MO7 A;  5M3M J;  3O8G A;  4EEF G;  5EG0 B;  2NS8 A;  3HOY J;  3RKQ A;  1MSF C;  2CRG A;  4A3M J;  1YRN A;  2VUM J;  1ETV A;  4V2G A;  3BR6 A;  1JJ8 C;  3ZQL A;  3ZQF A;  1BW6 A;  2YU9 J;  1B72 A;  2B63 J;  4FCY A;  2L7Z A;  3GTP J;  4BXX J;  1FJL A;  1Q1V A;  1X2M A;  1HCR A;  4A3L J;  4A3D J;  9ANT A;  3Q3S A;  1ZQ3 P;  1G2H A;  2R5Z A;  1FTT A;  5DTD A;  4W97 A;  4RBO A;  1W0U A;  1WI3 A;  3TP3 A;  2D5V A;  3M3Y J;  1GUU A;  5C44 J;  4DYC A;  2XGE A;  5EZG A;  4C2M J;  1NK3 P;  4A3C J;  2YUS A;  3G1O A;  3CDL A;  4FTH A;  3BG3 A;  1LE8 A;  1IJW C;  5K7Z A;  1VFC A;  3FK6 A;  3WHB A;  2XGC A;  4MIM A;  4V2F A;  2Y9Z A;  2H8R A;  5C3E J;  4A3F J;  4UUS B;  2DJN A;  3ZQI A;  4A93 J;  1LFB A;  2DA5 A;  4IHY A;  3BR2 A;  2DA1 A;  2XPU A;  4M3E A;  3K2A A;  4DZJ A;  2JK3 A;  5J3L A;  1MH3 A;  2EH3 A;  3OSF A;  1VND A;  2LFB A;  4S0H B;  3S15 J;  2ECB A;  1RKT A;  1UG2 A;  1OJL A;  3BR1 A;  2O7O A;  5EG0 A;  5F1J A;  2DA3 A;  2K9Q A;  4FIS A;  1OFC X;  2ID3 A;  5C4J J;  3JRA A;  1JKR C;  1FIA A;  2EZH A;  1QPI A;  4DZP A;  2CQX A;  1E3O C;  1JTX A;  1I3Q J;  2LVS A;  3PM1 A;  4IHV A;  5E3O A;  1ZGW A;  1K61 A;  2EZL A;  4MFD A;  5FLM J;  1JTY A;  2DA2 A;  4NDL A;  5JLW A;  3ZOB A;  3E7L A;  2NVQ J;  1ZR2 A;  3LSP A;  1T56 A;  4BBR J;  1ZKG A;  4DYQ A;  1QRY A;  1RPW A;  5FKO A;  3TED A;  4A3J J;  1MNM C;  5BNG A;  1S7E A;  3PO3 J;  4JX6 A;  2HOT A;  1P7J A;  2LD5 A;  4HNV A;  2HI3 A;  1BJZ A;  2ZB9 A;  1GV5 A;  1JKP C;  3HOU J;  2MG4 A;  4M6V A;  3HOX J;  1T33 A;  2Y2Z A;  2Y30 A;  4A3E J;  2CJJ A;  2FJ1 A;  1IDZ A;  2EZK A;  5IP9 J;  5FLV A;  3BTI A;  2DA4 A;  3I4N J;  1U78 A;  4UUS A;  1NK2 P;  1ETW A;  2NVY J;  1MBE A;  1FIP A;  1Z0X A;  4XRS A;  4QSH A;  3JRB A;  1XS9 A;  2ID6 A;  3BT9 A;  2GM4 A;  5JLX A;  1TWC J;  3OOU A;  4DW6 A;  1X58 A;  2VKV A;  2OF7 A;  3S16 J;  5IYC J;  3FIS A;  3ZQG A;  3GTG J;  1DU6 A;  2XPW A;  4BY7 J;  4M3B A;  4XIC A;  3GTM J;  4CYC B;  2GBY A;  2N8G A;  4LOC A;  2DN0 A;  4L5E A;  4MFE A;  2OPT A;  2XB0 X;  2JA6 J;  2JJ7 A;  1AKH A;  1RKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...