1ETWA

The crystal structure of e. coli fis mutant g72d
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
77
Chain Sequence
DVLTVSKPLRDSVKQALKNYFAQLDVNDLYELVLAEVEQPLLDMVMQYTRDNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 77
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etwA00
1SANA 2MW8A 2NS7A 4D5CA 3HEFA 1MH4A 2M8GX 3S1MJ 3HKZN 1F43A 4XRSA 2JA7J 1JT6A 3BTIA 4A3MJ 2DJNA 1JUSA 1MNMC 3S1NJ 2MSYA 1NK3P 3UKGA 5IP6A 2L0KA 2DA5A 3BQZA 3JR9A 1AKHB 2R5YB 2NVXJ 4DYCA 2EBIA 5F1JA 3L1PA 2E1OA 1WCMJ 2IEKA 2LY9A 2JA8J 5C3EJ 3Q3SA 4QSHA 2LK2A 4XK4A 3IH2A 4BBSJ 4BKXA 3BG5A 1B8IA 2IAIA 4B3AA 1MBGA 1HF0A 1Y1VJ 2CUFA 2Y2ZA 3H3VK 4D7NA 9ANTA 4ABZA 3HOWJ 1U9OA 3MN2A 1T33A 3JRAA 1E3OC 3C2BA 4AC0A 1HLVA 3GTOJ 2I10A 2R0QC 1PUFA 2LLKA 2CUEA 2OPTA 4FE4A 3O8HA 4A3CJ 2FJ1A 4UUTA 2DA1A 2JN6A 4C3IJ 4JX4A 1JKQC 3OSFA 2DN0A 1O4XA 1ENHA 3Q0VA 3LSGA 5C44J 4AUXA 2XB5A 1HOMA 1FIPA 1WGXA 2VPRA 3A03A 1BA5A 3LSRA 1TC3C 2W48A 3SDGA 2HOAA 2TCTA 2M34A 4M3BA 1ZR4A 1HDDC 3S16J 5IOZA 2AO9A 1IDZA 3MVPA 2K9QA 2VKEA 3GTLJ 4UUSA 2CRGA 3IH3A 2KT0A 3FIWA 2AHQA 4FTHA 1Z77A 1VFCA 1SFOJ 5FKMA 4DYRA 1QRYA 2HDDA 4EEFG 1GUUA 3ZQLA 1W0UA 1OCPA 2HOSA 4C3HJ 3PO3J 5EGOA 2XB0X 4M6VA 1IG7A 3S1RJ 3HBLA 2M2EA 1JKPC 1MSFC 1IV6A 1QVUA 1ZGWA 1RPWA 5C4JJ 3BR3A 4MIMA 2GBYA 2K9SA 4M3EA 4V2FA 5E3MA 2H8RA 3GTKJ 3NAUA 2EZHA 3CMYA 3JRFA 5FKNA 2JJ7A 3K2AA 1GDTA 4A3GJ 3Q0WA 3HGYA 3JREA 2XPVA 3H0GJ 5IP7J 3LNQA 1Y1WJ 1GV5A 2Y30A 5F04A 5F08A 3BR0A 1B8IB 2X48A 4BY7J 1JUMA 5F0FA 5EG0A 3BR6A 3FKIJ 4MFDA 2DA3A 1ZTRA 3WHCA 4RDUA 2L7MP 1TWFJ 1X2MA 1JTXA 1TWGJ 2O7OA 3S2DJ 2NS8A 4W97A 1EF4A 3LSPA 5IP9J 2FQ4A 5M3MJ 4JP0A 1PUFB 2XGDA 1WH5A 3M4OJ 2XGEA 2E2HJ 3S17J 5DTDA 1ORKA 1GV2A 3HB9A 3OSGA 3RZOJ 1IRZA 5F0HA 1FIAA 4X1EA 1LE8A 1WI3A 1JJ6C 4G12A 3OOUA 1NK2P 5IYCJ 4RBOA 2O9LA 1JT0A 3QPLA 1H88C 4FE7A 5M5WJ 2L7FP 5J1YA 4CYCA 5BNGA 3I4NJ 4X6AJ 2EZLA 1QPIA 2VKVA 2R5ZA 4DYQA 2R93J 4MFEA 3GTGJ 2E19A 1ETYA 5K7HA 5M3FJ 5FKKA 1XS9A 2TRTA 1IC8A 4UUSB 3JRGA 1U8BA 1FEXA 3CDLA 2HXOA 2YS9A 1A6IA 1ETVA 2DMNA 4DW6A 2HOTA 3BR1A 2R7ZJ 1QVTA 1ETQA 1RKWA 1K61A 2MG4A 5EZGA 2Y31A 3GTQJ 2EH3A 3BG9A 2DMPA 1MBFA 4FCYA 1IDYA 4HNVA 2ECCA 2NVYJ 2ZB9A 3LSJA 5E3NA 5EGOB 4QTRA 3IV5A 5IOYA 2B63J 3G1MA 3SFIA 2OF7A 5DS9A 2IBDA 3GTPJ 2X6OA 4AYBN 2KDZA 2K40A 4W1UA 1ETKA 2DMQA 2ID6A 1X2NA 1YRNA 3HOUJ 5HODA 3D1NI 4JYKA 3A01A 1B72A 4IHXA 1WPKA 2XPUA 3O8GA 3ZQHA 1JKOC 2VUMJ 1TWAJ 1W0TA 3ZQIA 2M9HA 2P81A 3WHBA 4A3KJ 2JWTA 3IH4A 1FTZA 1ZK8A 3G1OA 2E2IJ 2G0EA 5J1RA 5K7ZA 4J19A 3HOZJ 5IYDJ 5FJ8J 5GPCA 5EG0B 5M5YJ 3BTCA 2HI3A 3JRIA 3QQAA 4IHYA 1UMQA 5FLVA 4C2MJ 1BW6A 3FK6A 1U9NA 3VPRA 1APLC 2LP0A 1K83J 2LR8A 1IJWC 1ZR2A 3ZOBA 1MBHA 3LOCA 4A3BJ 1ITYA 1HDPA 3B6CA 1ETXA 1CQTA 1LE8B 2MGQA 4MO7A 1MBJA 2DA6A 1FJLA 1JTYA 1AU7A 5GP9A 3TW6A 1OFCX 4BBRJ 3F0CA 4NDLA 2R92J 2WAQN 5C4XJ 4A3IJ 2M0CA 3RKQA 2NVQJ 2ECBA 2YUSA 4CYCB 3BG3A 3BR5A 4B1RA 5EDNA 1JUPA 2R5ZB 1P7IA 3ZQFA 3NARA 5M5XJ 4IEJA 2NVTJ 3RZDJ 2HQ5A 2EZIA 2WV1A 1BJZA 2VI6A 2LVSA 1NTCA 3JRDA 4FISA 1S7EA 1MBKA 3CQZJ 3JRCA 1MH3A 2FX0A 1IGNA 3ZQCA 3QPSA 3TP3A 4A3EJ 3HOXJ 4JX6A 4BY1J 3MKLA 2DA2A 4A69C 1JJ8C 4XICA 1ETWA 2COBA 1MBEA 5EZHA 4IHVA 2DA7A 3BT9A 1ETOA 1MSEC 3HM5A 5F27A 1TWCJ 1ZKGA 2LTPA 4M3GA 2E2JJ 4LOCA 2RAEA 3JRBA 2DMTA 2JK3A 1YRNB 3A01B 1B72B 1VF9A 5JLXA 1XG1A 2D5VA 3S15J 1LFBA 2DTZA 2ID3A 3E7LA 5J3LA 2N8GA 1JGGA 3A02A 5F0CA 4I6ZA 1X58A 1BL0A 1D5YA 1TWHJ 2FD5A 2PMZN 2JMWA 4XRSG 4JX5A 5E3LA 3I4MJ 3S2HJ 2ME0A 2Y0SN 1I3QJ 4M3FA 4V2GA 4A3DJ 2XGCA 3SJMA 1A5JA 1POGA 2LFBA 2NOGA 3G1LA 1UG2A 2H1KA 3S14J 3PM1A 1GT0C 1I6HJ 1BW5A 2WB1N 1H89C 2XSDC 2LD5A 3GTJJ 1OJLA 1OCTC 3OIOA 2JA5J 1XC5A 3BR2A 1AKHA 2R5YA 1ZQ3P 3K7AJ 1GVDA 2LKXA 4L5EA 4A3LJ 2XPWA 1RESA 1VNDA 2X9DA 3HOVJ 2Y9YA 4Y7NJ 1P7JA 4Y52J 4C3JJ 1G2HA 3S1QJ 3FK7A 1DU6A 4DZPA 1Z0XA 2CQXA 2QCOA 4GFBA 3M3YJ 2ME6A 4I76A 4D7MA 1DU0A 1LFUP 3TP0A 4B4CA 4IHWA 3HOYJ 4D5FA 5FLMJ 5K7FA 2CQQA 3RQIA 3PO2J 4M3DA 2XRLA 1T56A 1H8AC 5FKOA 1U78A 4MLOA 5EYRA 3CCYA 1JKRC 2L9RA 5J1UA 1FTTA 5IYBJ 3BTLA 2QF7A 3BQYA 1RETA 5E3OA 4XIDA 3BTJA 1R9TJ 2HXIA 4A3FJ 2K9NA 2CU7A 2DMUA 1RR7A 1F36A 2HYJA 3GTMJ 4A93J 4XRMA 2JA6J 3DCFA 2GLOA 3DEWA 5GPAA 3TEDA 1Q1VA 1AHDP 3HGGA 3JRHA 4BXXJ 4A3JJ 5EF6A 1WH7A 2ELKA 2Y9ZA 3W6VA 1VI0A 5JLWA 5FKLA 3ZQGA 1I50J 3B6AA 1RKTA 4S0HB 3HDDA 2O8KA 1IUFA 1UHSA 3Q0UA 2YU9J 2CJJA 2DA4A 1HCRA 4DZJA 5IPAA 3GBGA 2EQRA 2EZKA 2GM4A 4QIWN 2L7ZA 5EEAA 3FISA 3TW7A
chains in the Genus database with same CATH superfamily
1SANA 2MW8A 2FBHA 2RQPA 4D5CA 2STTA 1EJ9A 3HEFA 2DT7B 2M8GX 2IPQX 3HKZN 2CSOA 3C2GA 1OYWA 1WJFA 2IVMA 4XRSA 1UAAA 1JT6A 3D5SC 4P55A 2ZMEA 2MD5A 1JUSA 1X1PA 2LNBA 1GXPA 5D5VB 5ICEA 2WBMA 1P4WA 4QPQA 5IP6A 4LK1F 1LVAA 3HHHA 2DA5A 5JI6A 1IUYA 3TOAA 2FBIA 3JR9A 3F22A 2QSFX 2R5YB 4O5VA 3PSIA 4DYCA 4YFNF 3H5NA 1H0MA 3IRRA 4HPQA 2IGKA 1S72I 2LF8A 3OY9A 1YJ9I 2K02A 1S8NA 1LVKA 3ZN0A 1HSTA 4BBSJ 1R1UA 3KYLA 3IAM2 1ZG3A 1BJAA 2QLZA 3BG5A 1KONA 4KT5C 2P8TA 3B73A 2Y2ZA 4D7NA 5J6XA 1BR1A 2Q0OA 3HOWJ 2P7CB 1T33A 2FQ3A 2EV0A 2P6SA 1K6YA 1YJNI 4AC0A 1IW7F 2XHKA 2LLKA 4XLEA 2E34A 4KYWA 1SEUA 4KNYA 4A3CJ 1QO0D 1YG2A 1IO2A 4UUTA 4E70A 1D1CA 1OYIA 3D5RC 4JX4A 1O4XA 3V7CA 1LNWA 5E17F 4IOCF 5C44J 4AUXA 2ETHA 2XB5A 1FIPA 1FSHA 2VPRA 3A2KA 2YR2A 4IO9F 1TC3C 3GLXA 4BE1A 4HA8A 2HOAA 2DK5A 2KIQA 2O03A 2Y0MA 4M3BA 4PSWA 2H6BA 2OTLI 1YW7A 2ZKZA 3MVPA 5D5UB 4UUSA 3BZCA 4DOZA 1Y39A 2RV8A 3VSKA 2HDCA 1IN8A 1WQ2A 3IH3A 2JPCA 3VWBA 3KLOA 4BU2A 1X1AA 4G6QA 1R5ID 3FIWA 4MQVA 1VTNC 4MTDA 2AQFA 1Z77A 3PJRA 3QPHA 5FKMA 3ZQQA 3J7AY 2V9PA 2JPBA 1I1GA 3KYCB 3H0DA 2H94A 4CHUA 4RB0A 1KQ9A 3L2VA 5L3GA 2FNAA 2TDXA 4M6VA 1IG7A 3CMMA 2NVUB 4ASNA 1SD4A 2K9MA 1IV6A 4OMZA 2ZMEB 4L5IA 4ZC3A 4ZYHA 2IS6A 2KZVA 3CC2I 3BZ6A 4PZJA 5E1XA 5CVVA 3GXOA 1FYKA 3ZMZA 1JI8A 5FKNA 2WC2A 1V55H 3VEPA 2W57A 3Q0WA 2DT5A 5DCMA 3H0GJ 4MTEA 4ANJA 2DOEA 1Y1WJ 1FZPB 5E1WA 2DI3A 1MD0A 5ERIA 3QODA 5F04A 1IRGA 1R5HA 4EATA 3GWZA 4E7SA 1E17A 1XGSA 3KPHA 5FO5A 1JUMA 2CO5A 5EG0A 3WHCA 2DA3A 1ZTRA 4RDUA 2L7MP 4LIVA 1L3LA 3S2DJ 4W97A 3P5JA 4ETSA 4F7ZA 3H9JA 1SAXA 2UXNA 3K4MA 3S17J 2L9NA 2GQQA 2KRCA 1EA3A 2QQBA 4AIKA 1O3RA 1C0WA 1QPMA 2K85A 2RVCA 4OIQF 4UXNA 3W6KB 5HS7A 1NK2P 1TT5B 4ZYDA 4RBOA 2Z16A 2DU9A 2O9LA 2DODA 1JT0A 3W2AA 3F21A 1Y8RB 4U88A 3DLLF 3BCBA 2ZJQF 3BJ6A 4EJWA 5M5WJ 1ON2A 4E7HA 1NH3A 1XX5A 4CYCA 3CJRB 1IN4A 3KLNA 3BZKA 2FNPA 3GLLA 2R7WA 3WGGA 4C30A 2L4MA 2VKVA 4PDKA 4F52A 5TRDA 2R93J 3RJPA 1B9NA 3GTGJ 3QU6A 2F5CA 1ETYA 3KP7A 3ECHA 3QU3A 2HQAA 2ZBKA 4G8XA 4M71A 2TRTA 4M9ZA 5FKKA 1IC8A 4G7OF 3ZMTA 4UUSB 1U8BA 1UHMA 2YSRA 1FEXA 2HXOA 3C7JA 1R1VA 1A6IA 4ENJA 1K79A 4DW6A 1Y0NA 3NWSA 4LD5A 1QVTA 3CJQB 1B6AA 1RKWA 2VN2A 2GWRA 1SVMA 3OYAA 4BUPA 2EFNA 3BG9A 4BE2A 3H5AA 5HLHA 2W85A 2ECCA 1G3YA 2ZB9A 3CTAA 1S7AA 2L5QA 4KIFA 5E3NA 4CSWA 2HWVA 3JW4A 3K4LA 1GXQA 4B43A 3FXOA 4DJAA 5DS9A 1D8KA 3I9V2 1KYZA 3COAC 2KDZA 1J59A 1Z21A 3WTYC 1MDMA 3CF2A 1STZA 2DMQA 2XDVA 3TO9A 1YRNA 1IAWA 5HODA 5A2QK 3D1NI 2VQCA 2A5YB 1B72A 1HKQA 1WPKA 1T98A 2LG4A 2M30A 2O8XA 3TKYA 4IHXA 4IQJA 5FLXK 1JKOC 3ERED 5GAHJ 4WX9A 2VJJA 3CCMI 4M6YA 1TWAJ 5DCMB 3W3CA 4FASD 2CFOA 4P9FA 2BY3A 2JWTA 1FTZA 2A5WA 1FX7A 4J19A 4BHBA 5DM7F 4PSXA 4AIJA 3ML6A 5D6FA 2RQQA 5EG0B 3BTCA 3AG3H 1QHHD 1MJAA 4OOIA 2Y0SA 1UMQA 2X6XA 3L2WA 4KITB 4C2MJ 1BW6A 1U9NA 4WCGA 3IKTA 1IJWC 2O5RA 2K3PA 3IL2A 1ZR2A 4I0AA 1ITYA 1HDPA 3B6CA 3ERMA 1RR8C 2V1XA 4PK4A 1ETXA 4WK8F 3OIQA 1FJLA 2W84A 3T5XA 1HW2A 3F0CA 2J5PA 3LSMA 3HSFA 2WAQN 2MBFA 5C4XJ 4M9XA 1KU7A 3E6DA 2NVQJ 1ZHFA 4F3QA 3Q9SA 3K1MA 4CYCB 4HLYA 4B1RA 4UV8A 4Y3OA 4N0BA 1O3TA 1U5TA 3ZQFA 4IEJA 5CKTA 1FBQA 1KGSA 1W36D 2CW7A 2XF6A 3JSPA 1ZH5A 3QP5A 4GGGA 4XLCA 2DQRA 3BWGA 2P5LC 3KP2A 3FM5A 2RN7A 4FISA 2VIXA 1S7EA 2VODA 2GIVA 2MLGA 1MKMA 2FX0A 1IGNA 3KP5A 2M5WA 5D4RA 1Q1HA 3QPSA 4Z6YA 4L9VA 3V8KA 5LRSA 3FXUA 1GVJA 2VBZA 1IXRC 4RS8A 3U9GA 2CV1A 4BY1J 2DA2A 1A31A 3VB2A 4A69C 1JJ8C 3GYHX 1ETWA 2KIFA 1MBEA 3L9FA 4ITVA 1V3FA 4L9JA 3F9KA 1OLTA 3HM5A 4IKFA 4M3GA 3K4JA 3OV8A 2E2JJ 1RZ4A 3S8PA 3L2RA 1Y56A 2DMTA 2B0LA 2OAZA 1MDMB 1TT0A 4XORA 3OR1C 1EKEA 1UHWA 3MCZA 5A2QZ 3AG4H 1YRNB 4UVCA 1FMWA 1UZCA 1B72B 5FLXZ 3E1SA 1D1BA 1LUJB 2DTZA 5JHUA 4LLLA 5HLIA 3HOTA 3CCEI 3WG7H 1P6RA 2P0WA 2HVSA 1TWHJ 2PMZN 3CCUI 1W7PD 5H6RA 1YX5A 5E3LA 3I4MJ 3VFZA 2LMDA 2XGCA 2HVRA 3MWMA 2NOGA 3BOQA 2EILH 2OZ6A 3EYIA 1R49A 3ROUA 2VLAA 1KYWA 3HKZA 5JVGF 2LD5A 1OJLA 1DPUA 4HYEA 3LQQA 1W4MA 2X1DA 4PFOA 4KN7X 2KPMA 4HSTA 2PJRA 3PNYA 1W5SA 3F8BA 2DXIA 3DKYA 5H20A 4L5EA 3ONQA 3WTUC 3PQKA 4KIGA 2EJRA 4JBAA 2X9DA 4A0ZA 1P7JA 4DQ2A 2HQNA 2IXSA 1MMAA 4LG0A 4B48A 3EYYA 1LB2A 1YTYA 4XL9A 2ME6A 3I4PA 2BY1A 4I76A 3OYFA 3OR2C 2G7HA 4BAYA 4EVIA 1U5TB 2ZXWH 4GRIA 1T39A 4IHWA 3H3ZA 3PO2J 2CQQA 4U0VA 1RIOH 1T56A 2BVMA 1T95A 5FKOA 5EYRA 1XMXA 4HX4A 5GTHC 3CCYA 3OYKA 5J1UA 2Q2EA 5L3FA 5LEKA 1VQ5I 3I64A 3N97A 3FWEA 5E3OA 4XIDA 1R9TJ 4OIRF 5JVTA 4A5NA 4U7DA 2QZ8A 4JK1X 4E7IA 1B59A 3MAJA 5DCFA 1TTYA 1TW2A 3E6CC 4G6DA 1XSVA 1ONVA 4XR6A 2MH9A 1AHDP 3JRHA 4F55A 3FHZA 3CDIA 2DFIA 2E5ZA 3V8LA 4A3JJ 3RKWA 3AG1H 3FBIB 3CLOA 2DPUA 1ZGAA 1QZYA 3W6VA 2VC0A 4HLXA 3CCJI 1I50J 3ABLH 1RKTA 3B6AA 4S0HB 1X4PA 4H0EA 3HDDA 4CDGA 5ICGA 1IUFA 4IRGA 1BBYA 1UHSA 1WJ5A 3MEXA 2ELHA 2D1VA 2DA4A 2DDBA 3CP8A 1HCRA 4E6KG 4DZJA 2EQRA 2UWMA 1WRJA 1M1EB 2EZKA 3KZIC 2EWNA 2GM4A 1LDJA 2L7ZA 4QIWN 4RA2A 2OV7A 5DD8A 5EEAA 2K9LA 3SZTA 2I5UA 2L2OA 3R61A 1EH7A 2WTEA 3S1MJ 3AFHA 3SZPA 2M8EA 3BP8A 4EV0A 5BQTA 3BTIA 2FA5A 4A3MJ 3DV8A 3K9TA 3H1CA 1LQ1A 1MNMC 3S1NJ 2L0KA 3D5LA 1FOKA 4PUSA 2PJRB 2NVXJ 4NUBA 5H2FC 1XTAA 1S3JA 2ZSHB 3Q3SA 4QSHA 3KEYA 3V42A 3N4MA 2QKMB 3K6GA 1S29A 2XUBA 2VBXA 1B8IA 2IAIA 4P9UA 4QWQA 1U8RA 2XAUA 4LG0B 3LL7A 9ANTA 3WTXC 1I39A 3J80K 3MKYB 4IXAA 3DTIA 2LBFA 3DLAA 5CQGA 3OYEA 3CJNA 2I10A 4LB6B 4F91B 1Z6RA 2LRDA 2OPTA 2VQLA 4HG2A 5FD5A 4FE4A 1UELB 1ZRCA 2VOOA 5BS6A 2FJ1A 3HRTA 2JQ7A 4BE0A 4EJTA 2DA1A 4C3IJ 5E18F 2LY1A 2LKSA 5B5EC 2Q2EB 1KZHA 1X3WB 4RAFA 3NQOA 4CZZA 3I59A 1YJWI 2LF7A 5LGUA 1MIJA 2JVHA 1VQ8I 1BA5A 3TO7A 3HJEA 3F8CA 3PIPF 3CP2A 3GF2A 3H36A 3SDGA 4F93B 2TCTA 1ZREA 2M34A 4QLCU 1HDDC 2AO9A 3M7GA 2IRFG 2A61A 3UR3C 2P4WA 4O3MA 3ZMSA 5ICCA 3GO5A 2E1NA 2AHQA 4II3A 4FTHA 1VFCA 1N77A 1J9IA 2DO7A 2XAJA 4DYRA 4JOMA 5E20A 4EEFG 2EFPA 4UVBA 5EGOA 4UUVA 1UCRA 3HSEA 2XB0X 3LSTA 4YELA 4GDFA 4BL0B 2D2WA 3EUHC 1QVUA 1CGPA 1I1SA 3I53A 3C3WA 1Y6IA 2KIUA 1RPWA 2Z2SB 1XMAA 4MIMA 1G8XA 2K9SA 3KE2A 3GTKJ 2A6HF 3NAUA 4KMUX 3LFUA 4NHJA 2EV6A 4XM3A 3CMYA 1A36A 2V1NA 3WU1B 1LKXA 3QOEA 4IRHA 1T8IA 2IA0A 3MZHA 3T1BA 1YLFA 1GDTA 1S9HA 2KRHA 3JREA 2HS5A 2E5NA 4FETA 3LNQA 1E2XA 2NXNB 2WY7Q 1MMGA 2GXAA 1Z3YA 5F08A 1FWZA 3F23A 1B8IB 2X48A 1L0OC 1YX3A 5IT9K 2QYOA 4Y4RA 1BR4A 2ZXJA 3FKIJ 3OYDA 1VQ4I 3F6OA 4RM2A 4XKBA 4RGSA 3J80Z 1X2MA 2F5EA 5CVRA 1IZ1A 1JTXA 4N9IA 3RPUA 1VQLI 2LBFB 2MC4A 5DDGA 1EF4A 4P5OA 1IXSB 5IP9J 2OA4A 4JP0A 3TL4X 5M3MJ 5J8CA 1WH5A 4HAMA 3M4OJ 4IL6C 1QZZA 2EA4A 1ORKA 2DAOA 1MGTA 3DFGA 3KEQA 2ZNZA 2M4GA 1BI1A 1HC8A 5F0HA 1FIAA 4X1EA 1WI3A 4A0XA 1JJ6C 2E36A 3KP4A 4ENKA 3EUKL 1HXDA 5KVRA 1TQIA 4BXUA 4Q5SF 4EGYA 1IN7A 1H88C 3I59B 2CQ7A 1XGOA 2XVCA 4KT6A 4CH7A 2NNNA 3QOPA 2K4BA 1AOYA 5J1YA 4HBLA 2WAQA 5BNGA 4OINF 4X6AJ 3MKZA 4XMYA 2M7AA 2QSHX 3O2PE 5J4YA 3CO6C 2R5ZA 4MFEA 4XSZF 2W82A 5DYMA 1U3EM 2F5VA 3OL3A 3HIFA 2JRMA 2OQRA 1XS9A 3V7RA 1PP7U 1IXCA 1YIOA 2OJED 3JRGA 4HV6A 1IRFA 4AVZA 4UVAA 1YITI 1ETVA 2BHYA 2CQNA 1T0FA 1RRJA 1W36C 4BNCA 3VDXA 1KQ8A 1XGNA 3GZNB 2PFBA 1IV8A 1VQ9I 2DMPA 3HHGA 1N75A 1IDYA 3UNGC 1FOYA 1YI2I 3H9QA 3F8FA 2NVYJ 2OC6A 4YEJA 5EGOB 3GMEA 4CYDA 1J09A 2K7LA 2Z5UA 2HFHA 3G1MA 2HKOA 4IHSA 2A6EF 4ON0A 2IBDA 3GTPJ 4LIUA 1IRXA 4BS9A 3QPTA 4LJZF 1GLNA 2ZC2A 4X0GA 1KU9A 3ZQHA 5DUIA 3DEEA 3IHUA 2UZKA 4XN3A 3WHBA 2F4IA 2WA0A 4A3KJ 2F2EA 2DOFA 4CCOA 2G0EA 4BDZA 5K7ZA 2L01A 6PAXA 3HOZJ 2HZDA 3EETA 5IT9Z 1DPRA 1FYLA 3AL0B 2DFHA 3ZMDA 3KZYA 3GEZA 1I6XA 3KFWX 1XB4A 3CCVI 5FLVA 2COMA 2IA2A 5ILUA 2FF4A 1RI7A 3ZOBA 1MBHA 1F9NA 3LWFA 2X0LA 2VE8A 2R7OA 3A0BC 1CQTA 2MGQA 5EEGA 2L7KA 1MBJA 2XROA 3DPTA 1QHGA 1AU7A 1WKMA 1OFCX 3TW6A 1HW5A 2HGCA 2GA2A 1D5VA 3OYCA 3FKJA 2ECBA 2YUSA 2M3AA 3F3XA 1ERDA 1HKTA 2KFDA 2FOWA 3BR5A 2LKPA 2BHZA 2WWYA 4BJ5C 2R5ZB 2CMPA 4XLHA 4N9HA 2XKOA 5GAEJ 1TNTA 2FUG2 3E0JB 1G4DA 1TQMA 3FF5A 5TGTA 2DOAA 2HQ5A 2EIKH 4L5JA 2WV1A 1RUOA 1BJZA 1MW7A 4ESJA 4A2UA 5FD6A 3R0AA 1XSDA 1T38A 3VSLA 3JRCA 3CQZJ 3JCUC 2JUCA 1MH3A 2HOEA 3RKYA 1ON1A 3K4KA 4CCKA 3O6BB 5HNHA 2CW8A 4L9NA 3CO7C 1G6NA 4XLNF 4ZJZA 4HDUA 3PNVA 4JX6A 1DUXC 4S05A 2JRTA 3CCRI 3FXJA 4CCMA 2XAGA 3I58A 4H4KC 3OYIA 2OCCH 4IPAA 2R7TA 2HYGD 5J8FA 1ZKGA 2LTPA 2NAZA 2PG4A 1WJEA 2MD0A 3WU2C 4Y13A 3R6SA 3WTVC 1WSUA 2OCEA 1SD6A 4HF1A 3CD6I 1YIJI 4RM3A 3ESWB 3W2VA 3K4CA 2V1UA 1BI0A 5D5XB 2IP2A 1KU2A 1V5EA 1LDKB 2L3DA 2W7NA 5E1ZB 5BMZA 2D5VA 1XCVA 2VQHA 4WXCA 4BXFA 3E3VA 2ID3A 3J81K 3E7LA 2KLOA 5CPRB 2N8GA 1ZGJA 2EB7A 2FEZA 3OYJA 2VC1A 1X58A 3IUOA 3ZR8X 4I6ZA 2DW4A 5TJJA 4KUMA 1BC8C 2FD5A 2J5OA 3VOEA 1PDNC 3OS0A 2M4KA 3M8FA 3S2HJ 2ME0A 2O0YA 3KP3A 5KAFC 5HDNA 4IX7A 3CMAI 1EV7A 4FHTA 1UG2A 5AONA 3PM1A 3ASNH 3SHFA 1I6HJ 1SMYF 2KJCA 5AIQA 1R00A 2VL8A 5J4VA 3I54A 4Q48A 3OMYA 4NB5A 4XOTA 3GFIA 3K0LA 2F5FA 1R4NB 2NYXA 2HDWA 4AD9A 1ZQ3P 2XASA 2LKXA 3M8EA 5LEJA 4E7JA 4A3LJ 4BHCA 1A35A 3EQLF 4LLGF 3MD2A 2CFXA 3L2CA 1S7OA 4C3JJ 1T2KA 4Y52J 3QRFF 3DPUA 3FK7A 2X6WA 4DZPA 3A1YA 2X1EA 2CQXA 2V7FA 3LSHA 2Z99A 5FROA 4IQ4A 4ZZDA 3FMRA 2KMUA 4CA0A 3SEZA 3TQNA 1LFUP 2A05A 3HG9A 1GHCA 2UXXA 4ZH4F 3HPGA 3RQIA 3S93A 5K7FA 3GZ6A 4OIPF 3GUDA 3LSIA 2QEXI 4WWCA 3HUGA 2IGOA 4MLOA 4IRIA 1SFKA 2MC3A 1BC7C 1KU3A 4Y33A 3R60A 4KIBA 4ZDPA 5IYBJ 3BC8A 5KNLA 2QF7A 4XKWA 2D1HA 1XPXA 3TDUC 4ZDOA 1YW8A 1U2WA 5FFZA 1BM9A 4M74A 1WHUA 1X1DA 1RR7A 2ZJPF 4A93J 1AWCA 4XRMA 2JA6J 4Y17A 2GLOA 3DEWA 1Z91A 3WODF 3TEDA 1RC9A 5AIPA 1Q1VA 2H6CA 3FMSA 4BEHA 3FMQA 1J0RA 1LPQA 2VXDA 5EF6A 3T8TA 1FC3A 3K2ZA 1T6SA 4GXOA 4NQWA 4BQOA 5F64A 1UG0A 3I55I 2EFWA 2DJIA 3ZQGA 3NWTA 4B8XA 4BYYA 2DFEA 1X19A 2HTSA 2EA2A 3J81Z 1R7JA 3GBGA 1U5TC 2F5DA 1Y0UA 2MABA 2Q8KA 4A6DA 2JA5J 3TW7A 3HYIA 2NS7A 4YG2F 2PEXA 2XSJC 2W25A 1E3PA 1MH4A 3HSRA 4CGZA 2E1CA 2CW0F 3RKXA 3KZZA 4RMNA 2JA7J 2VASA 2DJNA 5B66C 4I02A 1X3UA 1WZ2A 2K5CA 2MSYA 1OCRH 3KX2A 3M8JA 5DEQA 1NK3P 3BJAA 3DKWA 2IGMA 5KK1A 3I56I 3BQZA 3G71I 1V4RA 1P9QC 2CH0A 3E5UA 1JGSA 1QBJA 1V5GA 3DTEA 2EBIA 1H9GA 2F4MB 4XLFA 5F1JA 2E1OA 3WGHA 4MEYF 3BLYA 1SFXA 3HRUA 3IH2A 3CESA 2X1CA 3EDPA 4BKXA 2ESHA 4NNJA 2VT2A 1YS7A 1DP7P 1DGWY 1MBGA 2M45A 3A0HC 1OYYA 2CUFA 3M9AA 3DBLB 4CICA 3CJTB 2LOOA 4I7HA 5F1RA 1U9OA 1YO5C 5DV5A 2BOLA 1E3OC 1IF1A 5LGTA 1LEBA 2DYSH 3BDDA 4GO1A 1FY7A 4YIRX 3K4BA 3JTGA 4EM2A 1FOXA 1S6LA 1BOBA 4DGWB 4ZDLA 3CC4I 2E1MC 3HUGB 2QM3A 2A68F 3F8MA 1D1AA 2JN6A 2IS4A 1FLIA 3G73A 1LEAA 1JKQC 2EINH 3GX4X 1ENHA 3DBRB 4A12A 3RYPA 3LSGA 5BPDA 3G4SI 2AQEA 1HOMA 1FYMA 1WGXA 2V79A 3U1KA 3U2RA 1O7FA 3A03A 1Z67A 1YFHA 5L3EA 2Z9OA 4PJMA 2E60A 3IC7A 2W48A 4KN4X 2VKHA 4ZYGA 4AVPA 4BEHB 2V9KA 1OR7C 1ZR4A 5E79C 3CF5F 4MHGA 3LAJA 2QSGX 1R5GA 1VQOI 4LITA 4NQWB 2VKEA 5EJCA 1D0XA 1WFXA 2CRGA 2GZWA 2X4HA 3WGIA 2CG4A 2RKHA 1YE9A 5DM6F 1HW1A 3OYNA 1SFOJ 3BY6A 1QQIA 4ZTJA 5KHDA 1JHHA 5FFXA 3R0JA 1GUUA 2HOSA 1D0ZA 4M6XA 1W0UA 1J5YA 2V4JC 1AA7A 4MQ9F 2Y69H 5HDKA 4E7LA 1Z3XA 1USTA 3S1RJ 4I09A 2VE9A 2M2EA 3PUFA 2OD5A 3SZGA 2F6CA 3SYTA 1JKPC 1DDNA 3QWLA 1MSFC 5TISC 4J01A 2XAHA 1ZGWA 2ZFUA 2HPIA 5C4JJ 2L4AA 3BR3A 2GBYA 3P9IA 3K1PA 4IVNA 4V2FA 5E3MA 3HL2A 3ZPLA 5CJ9A 3A4CA 4HSRA 2EZHA 4KICA 4EQQA 3OYGA 4OAZA 2BGCA 1CF7A 5J47A 2KISA 2L02A 5IP7J 2AXTC 1GV5A 1H9TA 2DCEA 3WE3A 4S04A 4YFXF 1G3TA 3BR0A 1DP3A 5K5RA 2Z33A 3CZ6A 3L09A 3HOSA 2NOJB 4LMYA 5F0FA 3PQJA 3PFYA 2LYCA 4BQAA 2VBWA 1UB9A 4B09A 2NS8A 2V1DA 4M72A 2VQGA 3VYUB 2EK5A 2XGDA 3GVAA 4QPOA 3BJOA 3K10A 2E2HJ 3WU0A 4AM3A 2VOPA 5DTDA 3R4KA 3BPVA 3HB9A 4NC8A 1BIAA 3CMEI 3RZOJ 2BV6A 3ZN1A 3GCMA 3OOUA 2LH9A 4N4NB 2RNGA 1MMNA 3DEUA 3CUQA 2P6TA 4I0BA 5ILVA 1FP2A 2BXZA 3OL4A 1W5CC 1UJ8A 4XQFA 2V6CA 3U21A 2EZLA 2FU4A 3KEOA 4DYQA 1VQ6I 2VPLA 4R79A 3CCSI 1QU3A 2E19A 5GTIC 2IS1A 3CCLI 1K6OA 2HYFA 2E7XA 4XONA 5M3FJ 1USSA 2PQ8A 3K69A 3LQRA 3WTTC 4FT8A 1MMSA 1FSEA 1R23A 1V54H 5CVIA 3MFKA 1ETQA 4ESBA 5EZGA 2Y31A 2ZXIA 3GTQJ 3H92A 5K1YA 2ELJA 4U87A 4IHTA 4B3XA 3CDHA 4FCYA 3T8RA 4QTRA 3IV5A 5IOYA 2B63J 3RPQA 3LSKA 4EGZA 3ASOH 3SFIA 2EFOA 4CUGA 4YIIA 2X6OA 1HBXG 4AYBN 3BG7A 1U6GA 2E7WA 5CLSA 2EV5A 2JZYA 2ID6A 4XLAA 3HOUJ 2EIJH 4LK0F 3DXJF 2XPUA 3E97A 4U7BA 3H9GA 2AS5F 1IN6A 3MKWB 3IP4B 3IWZA 3IKVA 3KIOA 4I99C 1CF7B 3L2UA 2WV0A 3ZQIA 2M9HA 5HDGA 3PUBA 4U0WA 3IH4A 3WTSC 3TOBA 3IRQA 2HKXA 2KQRA 3LFKA 4BGDA 1YQAA 4RGRA 4LG3A 1TNSA 5IYDJ 1D3YA 1K7AA 4KFCA 2H27A 3PFIA 4KMFA 5FRMA 4PJ0C 2Y48A 2GXBA 3OYBA 1WWXA 4IHYA 1Z1DA 3FXRA 5LD2C 4IF4A 2BE5F 1PVEA 1OCZH 4Q47A 3VPRA 3HRMA 5HS9A 4XLPF 1APLC 2RDPA 2LP0A 4G6TB 2LSOA 1K83J 3ZP5A 2VB6A 5HS8A 4BHPA 1LJ9A 3DTKA 3EUHA 4OIOF 1FNNA 4GCVA 2LC2A 1XSXA 3TBIA 3DU6A 4BBRJ 3LA3A 3CUQB 2R92J 1BR2A 3NRVA 1MJBA 2K3FA 2G7UA 4R1HA 5HNFA 3Q9VA 4PJLA 2CYYA 2CV2A 1YW9A 2JVGA 3H3UA 2RREA 3BG6A 3NARA 4GYGA 3T0YA 5M5XJ 2YX7A 3QP6A 2NVTJ 3S3MA 2ZXHA 3RZDJ 2QGUA 1E3HA 2WAEA 2EZIA 3P9CA 4E7ZA 2LVSA 1NTCA 3WTZA 3JRDA 5FRNA 3AL0C 1MBKA 2G9WA 4PJNA 3ABKH 4CZCA 1R4MB 3F8NA 2OZUA 4IOAF 2OTJI 2H8WA 1WJBA 2PI0A 2P5KA 1XDUA 2IGNA 2ZMEC 1MNEA 1X1CA 2MLKA 3W2WA 2VT3A 2MA3A 3GFMA 4I01A 1VQNI 3BT9A 1ETOA 1ZRFA 2YU3A 3SXYA 5F27A 1TWCJ 2NRAC 1BOAA 2R7FA 2RAEA 3JRBA 1B4AA 4BACA 1MMDA 2XC7A 3FHNA 1BI3A 3CCQI 5JLXA 3S15J 1QA6A 4V19K 1LFBA 1REPC 2DDAA 3HC7A 2ZNYA 3JTHA 2QENA 4K2EA 2OU2A 5F0CA 4OU0A 1BL0A 2FSWA 1SFUA 3LA2A 4HX8A 2ZJ2A 3ZQ7A 2BY2A 1D0YA 2JMWA 2XF5A 2LREA 3M1CA 2W00A 4XNFA 5D5WB 2NNYA 1ZG1A 4D0PA 1I3QJ 4M3FA 4V2GA 5ICFA 2WADA 3SJMA 1A5JA 1POGA 4BJTA 1N25A 3MZYA 2QQ8A 3S14J 2H1KA 1T0FC 1GT0C 1BW5A 2HQRA 2WB1N 1H89C 4PCQA 2XSDC 2GXGA 1XGMA 2XGXA 3GTJJ 1OCTC 1YS6A 2WY8Q 1ZELA 2CV0A 1I3AA 1XC5A 1MNDA 4G9YA 1AKHA 4G94A 3ZMVA 3K7AJ 4E7KA 2YPRA 1FBUA 1FOWA 1HKSA 2QUFA 4DBQA 1VNDA 1N78A 1SFEA 3HTSB 2Y9YA 4Y7NJ 5CYVA 4PGGA 2R7XA 3S1QJ 5L3DA 1Z0XA 2QCOA 4UY8I 2EFQA 1VQ7I 1XCBA 3M3YJ 1OKRA 1O3QA 2JT1A 3DWLE 2PMZA 4B47A 4D7MA 3PNTA 3KETA 5LHIA 4B4CA 4RB1A 4EJOA 2HVQA 2KDOA 4XSXF 3V8JA 5FLMJ 4KISA 2DQLA 2XRLA 3FM3A 1W7PA 3BCAA 1R36A 1VQKI 2X6YA 1U78A 3K1NA 2M0MA 2HZTA 3G6EI 1R58A 1QGPA 5GAGJ 1JKRC 2L9RA 1ZLKA 4R8HA 1LDDA 2BY0A 3IWFA 4EJVA 3KCCA 5D8LB 4LLNA 3JSOA 3G2BA 2PX9A 5CVJA 2HXIA 4UNOA 4DBRA 4A3FJ 2CU7A 2DMUA 4ZYAA 3S3OA 1XDSA 1J7KA 3REOA 4HQMA 5GPAA 4Z2YA 3DPLC 2CUJA 4BJ6C 1O7LA 4HNTA 1HQCA 1WVRA 4ESFA 1TL8A 5LBQA 3K70C 3TO6A 2ELKA 5HLTA 2Y9ZA 2HNHA 2GOMA 1FPQA 5JLWA 3MZ8A 4CCJA 5FKLA 2CWEA 1TP4A 4WF2A 4G7ZF 5DD4A 3E6MA 3ELKA 3OS2A 2QA4I 1EH6A 3Q0UA 2LY2A 2YU9J 3D0SA 3SQNA 4UHTA 2KIMA 4A6EA 1J75A 3FISA 2Q1ZB 4M9SA 1ZAOA 4KJZA 4RGUA 4TV7A 4RLFA 3RCOA 3FXKA 4ZZLA 1UFMA 4RAZA 3S3NA 1F43A 2QQAA 1YYVA 2ISZA 2IW5A 2KP6A 3KP6A 3TDZC 4B44A 3UKGA 3FZVA 1TZLA 2PLYA 1P4XA 4I2OA 5FGMA 1B9MA 4F92B 1AKHB 4HOBA 4ZYEA 2WAFA 3L1PA 2IEKA 1WCMJ 2QVOA 4BQQA 1SVLA 2LY9A 2JA8J 5C3EJ 4ENMA 3F72A 3I71A 2LK2A 4XK4A 5BPIA 1R71A 4P96A 1OPCA 3E5XA 1SD5A 4XOPA 2BVLA 2QKLB 4A5MA 4B3AA 2HR3A 1Y1VJ 3DQVC 3O3KA 1R1TA 1HF0A 5CQEA 1FT9A 3H3VK 4ABZA 3TGNA 2BZTA 2GOXB 3MN2A 3JRAA 2DLLA 3LA7A 2Z3YA 2MYSA 3C2BA 4MGRA 3OYMA 1HLVA 2IT0A 3GTOJ 3VODA 2R0QC 1P4AA 1OQYA 3C2HA 3QYBA 3SDBA 1ZARA 1PUFA 2CUEA 3HTUA 1OCOH 4PFPA 2R7VA 1W7PB 3O8HA 1Z6TA 2B9SA 1TQPA 1Y8QB 2BW3A 2MFZA 1G3WA 3LMMA 3HPHA 3OSFA 2DN0A 1W5TA 3Q0VA 1P92A 3AAFA 2ICWG 4AIDA 3VYSB 1F5TA 1NG6A 4MNUA 1WJAA 3V7SA 2M7BA 3TMOA 3LSRA 5ED4A 1ACIA 2QWWA 2W1OA 1OMIA 2CQKA 5DUKA 4EM1A 2L54A 2O6GE 3S16J 1S5LC 2DBBA 5IOZA 4HX7A 1IDZA 2GIZA 1SC7A 2K9QA 1X1BA 3GTLJ 1K4TA 3FXMA 4FX4A 2KZGA 2B7EA 4LFUA 4BDYA 4ENNA 3RPUD 2KT0A 4L0ZB 1XN7A 4G7HF 5H6QA 3J7ZI 2QBYA 2V26A 5D8KB 1QRYA 2ESNA 2HDDA 2BXYA 2XV4S 3ZQLA 1OCPA 2MH2A 4C3HJ 3AKZA 3PO3J 4A0YA 4HDVA 4RAGA 3HBLA 2VJ4A 1X3ZB 2ADUA 2IA1A 5J40A 5LLQA 2ZJRF 3OS1A 1ZYRF 4M3EA 1Z05A 3M1EA 4AYBA 3JRFA 2JSCA 2JJ7A 4OWRB 3K2AA 4A3GJ 1ZG5A 5JR3A 3HGYA 2RNJA 2XPVA 2H1LA 1QNTA 4AU7A 4CCLA 2Y30A 3GW2A 4UV9A 2VXZA 3K4NA 3ZRGA 3ABTA 4BY7J 2JA2A 3KYDB 4FX0A 1PUEE 2A07F 3BR6A 1WJCA 3BROA 4MFDA 4CCNA 1KQ0A 1BI2A 1BIBA 1TWFJ 1TWGJ 2O7OA 4U0YA 2XAQA 1K78A 2R3SA 1QZEA 4CO8A 3LSPA 3M07A 1PUFB 2FQ4A 4UB6C 1TW3A 4XBFA 2XGEA 2GAUA 1A6QA 5E8IA 1GV2A 4OAYA 1B1BA 4AIHA 3OSGA 2BW3B 1IRZA 1LE8A 5KAIC 2VJ5A 4RLQA 4G12A 4MEXF 4HNUA 5KCMA 5IYCJ 2XAFA 4L0YB 3QPLA 4Q4ZF 3GZ5A 4FE7A 3EPZA 5E8GA 4OMYA 1O3SA 3RTRA 3FX3A 5LHGA 2HTJA 2L7FP 4GYIA 1F1ZA 1I27A 3C18A 2BEOA 2E35A 3E5QA 3I4NJ 3RIRA 3PL8A 1QPIA 2DK8A 3WTWC 4FQGA 3OOPA 1PP8F 5K5OA 5K7HA 3I3LA 1SD7A 1RUNA 2K4JA 3P9KA 2KL4A 1G3SA 3CDLA 1DGRM 2I8DA 2M1BA 2YS9A 2STWA 3ZMUA 2DMNA 4DIQA 2HOTA 3BR1A 2R7ZJ 2O61A 3DU5A 4DNCA 1K61A 2MG4A 3FBNB 3QAHA 2QBYB 2EH3A 2F4OB 1OISA 4XN0A 4EJUA 1MBFA 4C2TA 2H09A 2IS2A 4HNVA 3PSFA 2C6YA 4ZTFA 4L9TA 2P7VB 2M87A 1VZ0A 3LSJA 1XMKA 3ZCOA 1MJ9A 2VJIA 5F6FA 2EPFA 4UB8C 1YHQI 2BBYA 3EUAA 2CUZA 2FMYA 2OF7A 4YFKF 3K70D 2HPMA 4EM0B 2KKOA 2ZO4A 2R7UA 1PJRA 2K40A 1J2XA 2PMHA 3AG2H 4W1UA 3U1DA 1KA8A 1ETKA 2GA1A 4JQFA 5HLGA 1X2NA 2JSPA 2CGPA 4JYKA 5B1BH 3A01A 1OR7A 4RGXA 3O8GA 1JE8A 3H5RA 2H8RA 3VYRB 3MQ0A 4N4OB 5HVQC 2VUMJ 2V6EA 1O57A 2FBKA 1W0TA 4D9JA 2HU9A 2P81A 2PN6A 3RYRA 1ZK8A 2NS0A 3DBHB 3ECOA 1P2FA 3FXLA 3G1OA 1FMVA 2E2IJ 2D45A 2UV1A 2RGVA 2Y75A 4P1WA 2XF7A 5J1RA 3W6JB 3LAPA 3CLQA 5FJ8J 5LGNA 5GPCA 5ILSA 5M5YJ 1HA8A 2HI3A 3ABUA 1ZN2A 3JRIA 3QQAA 4RAYA 4HQEA 2V9VA 1K78B 2YX4A 3FK6A 2L9VA 1ZRDA 4BQNA 2LR8A 2WB1A 1ULYA 1ODDA 1XD7A 2L9SA 3LOCA 4A3BJ 4AWXB 4KA4A 1LE8B 2R7DA 5IY5H 4MO7A 2DA6A 1FBSA 2W4SA 2CS3A 1JTYA 5LFAA 2ACJA 1PYVA 5GP9A 2FXAA 3ABMH 3I5UA 4NDLA 1OCCH 1W1WE 4A3IJ 2M0CA 3E6BA 3RKQA 1SVOA 3S2WA 1WI9A 5L3CA 4L18B 3BG3A 4Y15A 2DFFA 5EDNA 1JUPA 5EEHA 1MZBA 3FDYA 2R4GA 1P7IA 3ZXSA 3MMYB 2W24A 4I98B 1Z7UA 2VI6A 2PBIA 4WXDA 2O3FA 5B3SH 5LRRA 2JUGA 4XRFA 3SEQA 4NC7A 1R6RA 4XKVA 3JAMK 1HSJA 5BOXA 1I5ZA 2A6TA 2OQGA 3ZQCA 3TP3A 4A3EJ 2E1MB 3NEUA 3HOXJ 4HZFA 1R22A 2KHMA 3MKLA 5D6EA 1Z9CA 4XICA 2COBA 5EZHA 3IAS2 4IHVA 2VBYA 2DA7A 1FP1D 2DYRH 3DKXA 4C2UA 4E4HA 3HXLA 1MSEC 2AXLA 1Z7LA 4LOCA 3RQ4A 3ULQB 2RC4A 2QQ9A 3ISPA 3H35A 3S32A 2OUMA 3CUQC 1TLHB 2JK3A 4O6JA 3HZJA 4PGHA 5CVUA 2A69F 3A01B 1F4KA 1VF9A 1E0EA 1XG1A 4BH9A 3PIOF 3CUOA 1TBXA 1A04A 1WJDA 3BPXA 5JFRA 2LDUA 5J3LA 5D4SA 1JGGA 4HRIA 3A02A 2FRHA 1D5YA 3C1DA 5B1AH 4XRSG 2IJLA 4RB3C 4JX5A 2EIMH 4HF2A 2Y0SN 4A3DJ 2FMLA 4HF0A 1IN5A 2LFBA 3RDIA 2F48A 2K86A 3G1LA 4HV5A 1K4SA 2K27A 2DPDA 4J00A 2VKDA 3OIOA 3SFZA 1DQUA 2KJBA 3Q5FA 5FB2A 3BR2A 2R5YA 3OYLA 5LHHA 1GVDA 3V4GA 1BN5A 4IJAA 3VYTB 2XPWA 1RESA 4EMSA 5GADJ 3WE2A 2OBPA 3HOVJ 2R7SA 1NG7A 1G2HA 3FXQA 1DU6A 3J7YJ 1ZLJA 4GFBA 2ZFWA 2PMUA 3HRSA 2X85A 3G3ZA 4D1QA 3X2QH 4HW0A 4M73A 2R7RA 4YRVA 3TP0A 3HOYJ 1LFPA 1U0JA 2JTVA 4D5FA 2XRNA 4M3DA 1X4OA 5K5QA 4WXHA 1H8AC 4HEA2 4C9YA 2P5VA 2ZCWA 2ZSIB 2VONA 2FE3A 3I0TA 3F6VA 3JAMZ 2FOKA 3P7NA 3QYEA 1FTTA 1SAUA 3GFLA 4NC6A 3BTLA 2BYVE 3BQYA 1RETA 5L3BA 4IZZA 3BTJA 4XKCA 3CC7I 2K9NA 2E71A 4PJJA 2XKPA 2HYJA 1F36A 3GTMJ 2UUZA 3J7AO 3DCFA 5HOOA 1EH8A 3OYHA 4CXFA 2X51A 3HGGA 1RNLA 2ISYA 1NHAA 4RB2C 4KDPA 4BXXJ 1VQMI 3B02A 4II2A 2R7QA 1WH7A 3OIPA 1D8JA 4YIFA 1VI0A 2Z1DA 3RI4A 3WG9A 5JHFA 3OWTA 2PJPA 3L7WA 3QYFA 2HEOA 2O8KA 1V5FA 1JHFA 3N05A 2DT6A 1SMTA 3ZGKA 3RSNA 4LGWA 2CJJA 3DP7A 5IPAA 3DF8A 1YOVB 4NBQA 2KRFA 1T08B 3L00A 1VQPI 2DTRA 2XIGA 4LB5A 1G59A 1JXSA 3GFJA 3L2QA 1DU0A 2A3SA 5IT3A
chains in the Genus database with same CATH topology
1SANA 2MW8A 2NS7A 4D5CA 3HEFA 1MH4A 2M8GX 3S1MJ 3HKZN 1F43A 4XRSA 2JA7J 1JT6A 3BTIA 4A3MJ 2DJNA 1JUSA 1MNMC 3S1NJ 2MSYA 1NK3P 3UKGA 5IP6A 2L0KA 2DA5A 3BQZA 3JR9A 1AKHB 2R5YB 2NVXJ 4DYCA 2EBIA 5F1JA 3L1PA 2E1OA 1WCMJ 2IEKA 2LY9A 2JA8J 5C3EJ 3Q3SA 4QSHA 2LK2A 4XK4A 3IH2A 4BBSJ 4BKXA 3BG5A 1B8IA 2IAIA 4B3AA 1MBGA 1HF0A 1Y1VJ 2CUFA 2Y2ZA 3H3VK 4D7NA 9ANTA 4ABZA 3HOWJ 1U9OA 3MN2A 1T33A 3JRAA 1E3OC 3C2BA 4AC0A 1HLVA 3GTOJ 2I10A 2R0QC 1PUFA 2LLKA 2CUEA 2OPTA 4FE4A 3O8HA 4A3CJ 2FJ1A 4UUTA 2DA1A 2JN6A 4C3IJ 4JX4A 1JKQC 3OSFA 2DN0A 1O4XA 1ENHA 3Q0VA 3LSGA 5C44J 4AUXA 2XB5A 1HOMA 1FIPA 1WGXA 2VPRA 3A03A 1BA5A 3LSRA 1TC3C 2W48A 3SDGA 2HOAA 2TCTA 2M34A 4M3BA 1ZR4A 1HDDC 3S16J 5IOZA 2AO9A 1IDZA 3MVPA 2K9QA 2VKEA 3GTLJ 4UUSA 2CRGA 3IH3A 2KT0A 3FIWA 2AHQA 4FTHA 1Z77A 1VFCA 1SFOJ 5FKMA 4DYRA 1QRYA 2HDDA 4EEFG 1GUUA 3ZQLA 1W0UA 1OCPA 2HOSA 4C3HJ 3PO3J 5EGOA 2XB0X 4M6VA 1IG7A 3S1RJ 3HBLA 2M2EA 1JKPC 1MSFC 1IV6A 1QVUA 1ZGWA 1RPWA 5C4JJ 3BR3A 4MIMA 2GBYA 2K9SA 4M3EA 4V2FA 5E3MA 2H8RA 3GTKJ 3NAUA 2EZHA 3CMYA 3JRFA 5FKNA 2JJ7A 3K2AA 1GDTA 4A3GJ 3Q0WA 3HGYA 3JREA 2XPVA 3H0GJ 5IP7J 3LNQA 1Y1WJ 1GV5A 2Y30A 5F04A 5F08A 3BR0A 1B8IB 2X48A 4BY7J 1JUMA 5F0FA 5EG0A 3BR6A 3FKIJ 4MFDA 2DA3A 1ZTRA 3WHCA 4RDUA 2L7MP 1TWFJ 1X2MA 1JTXA 1TWGJ 2O7OA 3S2DJ 2NS8A 4W97A 1EF4A 3LSPA 5IP9J 2FQ4A 5M3MJ 4JP0A 1PUFB 2XGDA 1WH5A 3M4OJ 2XGEA 2E2HJ 3S17J 5DTDA 1ORKA 1GV2A 3HB9A 3OSGA 3RZOJ 1IRZA 5F0HA 1FIAA 4X1EA 1LE8A 1WI3A 1JJ6C 4G12A 3OOUA 1NK2P 5IYCJ 4RBOA 2O9LA 1JT0A 3QPLA 1H88C 4FE7A 5M5WJ 2L7FP 5J1YA 4CYCA 5BNGA 3I4NJ 4X6AJ 2EZLA 1QPIA 2VKVA 2R5ZA 4DYQA 2R93J 4MFEA 3GTGJ 2E19A 1ETYA 5K7HA 5M3FJ 5FKKA 1XS9A 2TRTA 1IC8A 4UUSB 3JRGA 1U8BA 1FEXA 3CDLA 2HXOA 2YS9A 1A6IA 1ETVA 2DMNA 4DW6A 2HOTA 3BR1A 2R7ZJ 1QVTA 1ETQA 1RKWA 1K61A 2MG4A 5EZGA 2Y31A 3GTQJ 2EH3A 3BG9A 2DMPA 1MBFA 4FCYA 1IDYA 4HNVA 2ECCA 2NVYJ 2ZB9A 3LSJA 5E3NA 5EGOB 4QTRA 3IV5A 5IOYA 2B63J 3G1MA 3SFIA 2OF7A 5DS9A 2IBDA 3GTPJ 2X6OA 4AYBN 2KDZA 2K40A 4W1UA 1ETKA 2DMQA 2ID6A 1X2NA 1YRNA 3HOUJ 5HODA 3D1NI 4JYKA 3A01A 1B72A 4IHXA 1WPKA 2XPUA 3O8GA 3ZQHA 1JKOC 2VUMJ 1TWAJ 1W0TA 3ZQIA 2M9HA 2P81A 3WHBA 4A3KJ 2JWTA 3IH4A 1FTZA 1ZK8A 3G1OA 2E2IJ 2G0EA 5J1RA 5K7ZA 4J19A 3HOZJ 5IYDJ 5FJ8J 5GPCA 5EG0B 5M5YJ 3BTCA 2HI3A 3JRIA 3QQAA 4IHYA 1UMQA 5FLVA 4C2MJ 1BW6A 3FK6A 1U9NA 3VPRA 1APLC 2LP0A 1K83J 2LR8A 1IJWC 1ZR2A 3ZOBA 1MBHA 3LOCA 4A3BJ 1ITYA 1HDPA 3B6CA 1ETXA 1CQTA 1LE8B 2MGQA 4MO7A 1MBJA 2DA6A 1FJLA 1JTYA 1AU7A 5GP9A 3TW6A 1OFCX 4BBRJ 3F0CA 4NDLA 2R92J 2WAQN 5C4XJ 4A3IJ 2M0CA 3RKQA 2NVQJ 2ECBA 2YUSA 4CYCB 3BG3A 3BR5A 4B1RA 5EDNA 1JUPA 2R5ZB 1P7IA 3ZQFA 3NARA 5M5XJ 4IEJA 2NVTJ 3RZDJ 2HQ5A 2EZIA 2WV1A 1BJZA 2VI6A 2LVSA 1NTCA 3JRDA 4FISA 1S7EA 1MBKA 3CQZJ 3JRCA 1MH3A 2FX0A 1IGNA 3ZQCA 3QPSA 3TP3A 4A3EJ 3HOXJ 4JX6A 4BY1J 3MKLA 2DA2A 4A69C 1JJ8C 4XICA 1ETWA 2COBA 1MBEA 5EZHA 4IHVA 2DA7A 3BT9A 1ETOA 1MSEC 3HM5A 5F27A 1TWCJ 1ZKGA 2LTPA 4M3GA 2E2JJ 4LOCA 2RAEA 3JRBA 2DMTA 2JK3A 1YRNB 3A01B 1B72B 1VF9A 5JLXA 1XG1A 2D5VA 3S15J 1LFBA 2DTZA 2ID3A 3E7LA 5J3LA 2N8GA 1JGGA 3A02A 5F0CA 4I6ZA 1X58A 1BL0A 1D5YA 1TWHJ 2FD5A 2PMZN 2JMWA 4XRSG 4JX5A 5E3LA 3I4MJ 3S2HJ 2ME0A 2Y0SN 1I3QJ 4M3FA 4V2GA 4A3DJ 2XGCA 3SJMA 1A5JA 1POGA 2LFBA 2NOGA 3G1LA 1UG2A 2H1KA 3S14J 3PM1A 1GT0C 1I6HJ 1BW5A 2WB1N 1H89C 2XSDC 2LD5A 3GTJJ 1OJLA 1OCTC 3OIOA 2JA5J 1XC5A 3BR2A 1AKHA 2R5YA 1ZQ3P 3K7AJ 1GVDA 2LKXA 4L5EA 4A3LJ 2XPWA 1RESA 1VNDA 2X9DA 3HOVJ 2Y9YA 4Y7NJ 1P7JA 4Y52J 4C3JJ 1G2HA 3S1QJ 3FK7A 1DU6A 4DZPA 1Z0XA 2CQXA 2QCOA 4GFBA 3M3YJ 2ME6A 4I76A 4D7MA 1DU0A 1LFUP 3TP0A 4B4CA 4IHWA 3HOYJ 4D5FA 5FLMJ 5K7FA 2CQQA 3RQIA 3PO2J 4M3DA 2XRLA 1T56A 1H8AC 5FKOA 1U78A 4MLOA 5EYRA 3CCYA 1JKRC 2L9RA 5J1UA 1FTTA 5IYBJ 3BTLA 2QF7A 3BQYA 1RETA 5E3OA 4XIDA 3BTJA 1R9TJ 2HXIA 4A3FJ 2K9NA 2CU7A 2DMUA 1RR7A 1F36A 2HYJA 3GTMJ 4A93J 4XRMA 2JA6J 3DCFA 2GLOA 3DEWA 5GPAA 3TEDA 1Q1VA 1AHDP 3HGGA 3JRHA 4BXXJ 4A3JJ 5EF6A 1WH7A 2ELKA 2Y9ZA 3W6VA 1VI0A 5JLWA 5FKLA 3ZQGA 1I50J 3B6AA 1RKTA 4S0HB 3HDDA 2O8KA 1IUFA 1UHSA 3Q0UA 2YU9J 2CJJA 2DA4A 1HCRA 4DZJA 5IPAA 3GBGA 2EQRA 2EZKA 2GM4A 4QIWN 2L7ZA 5EEAA 3FISA 3TW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAN A;  2MW8 A;  2NS7 A;  4D5C A;  3HEF A;  1MH4 A;  2M8G X;  3S1M J;  3HKZ N;  1F43 A;  4XRS A;  2JA7 J;  1JT6 A;  3BTI A;  4A3M J;  2DJN A;  1JUS A;  1MNM C;  3S1N J;  2MSY A;  1NK3 P;  3UKG A;  5IP6 A;  2L0K A;  2DA5 A;  3BQZ A;  3JR9 A;  1AKH B;  2R5Y B;  2NVX J;  4DYC A;  2EBI A;  5F1J A;  3L1P A;  2E1O A;  1WCM J;  2IEK A;  2LY9 A;  2JA8 J;  5C3E J;  3Q3S A;  4QSH A;  2LK2 A;  4XK4 A;  3IH2 A;  4BBS J;  4BKX A;  3BG5 A;  1B8I A;  2IAI A;  4B3A A;  1MBG A;  1HF0 A;  1Y1V J;  2CUF A;  2Y2Z A;  3H3V K;  4D7N A;  9ANT A;  4ABZ A;  3HOW J;  1U9O A;  3MN2 A;  1T33 A;  3JRA A;  1E3O C;  3C2B A;  4AC0 A;  1HLV A;  3GTO J;  2I10 A;  2R0Q C;  1PUF A;  2LLK A;  2CUE A;  2OPT A;  4FE4 A;  3O8H A;  4A3C J;  2FJ1 A;  4UUT A;  2DA1 A;  2JN6 A;  4C3I J;  4JX4 A;  1JKQ C;  3OSF A;  2DN0 A;  1O4X A;  1ENH A;  3Q0V A;  3LSG A;  5C44 J;  4AUX A;  2XB5 A;  1HOM A;  1FIP A;  1WGX A;  2VPR A;  3A03 A;  1BA5 A;  3LSR A;  1TC3 C;  2W48 A;  3SDG A;  2HOA A;  2TCT A;  2M34 A;  4M3B A;  1ZR4 A;  1HDD C;  3S16 J;  5IOZ A;  2AO9 A;  1IDZ A;  3MVP A;  2K9Q A;  2VKE A;  3GTL J;  4UUS A;  2CRG A;  3IH3 A;  2KT0 A;  3FIW A;  2AHQ A;  4FTH A;  1Z77 A;  1VFC A;  1SFO J;  5FKM A;  4DYR A;  1QRY A;  2HDD A;  4EEF G;  1GUU A;  3ZQL A;  1W0U A;  1OCP A;  2HOS A;  4C3H J;  3PO3 J;  5EGO A;  2XB0 X;  4M6V A;  1IG7 A;  3S1R J;  3HBL A;  2M2E A;  1JKP C;  1MSF C;  1IV6 A;  1QVU A;  1ZGW A;  1RPW A;  5C4J J;  3BR3 A;  4MIM A;  2GBY A;  2K9S A;  4M3E A;  4V2F A;  5E3M A;  2H8R A;  3GTK J;  3NAU A;  2EZH A;  3CMY A;  3JRF A;  5FKN A;  2JJ7 A;  3K2A A;  1GDT A;  4A3G J;  3Q0W A;  3HGY A;  3JRE A;  2XPV A;  3H0G J;  5IP7 J;  3LNQ A;  1Y1W J;  1GV5 A;  2Y30 A;  5F04 A;  5F08 A;  3BR0 A;  1B8I B;  2X48 A;  4BY7 J;  1JUM A;  5F0F A;  5EG0 A;  3BR6 A;  3FKI J;  4MFD A;  2DA3 A;  1ZTR A;  3WHC A;  4RDU A;  2L7M P;  1TWF J;  1X2M A;  1JTX A;  1TWG J;  2O7O A;  3S2D J;  2NS8 A;  4W97 A;  1EF4 A;  3LSP A;  5IP9 J;  2FQ4 A;  5M3M J;  4JP0 A;  1PUF B;  2XGD A;  1WH5 A;  3M4O J;  2XGE A;  2E2H J;  3S17 J;  5DTD A;  1ORK A;  1GV2 A;  3HB9 A;  3OSG A;  3RZO J;  1IRZ A;  5F0H A;  1FIA A;  4X1E A;  1LE8 A;  1WI3 A;  1JJ6 C;  4G12 A;  3OOU A;  1NK2 P;  5IYC J;  4RBO A;  2O9L A;  1JT0 A;  3QPL A;  1H88 C;  4FE7 A;  5M5W J;  2L7F P;  5J1Y A;  4CYC A;  5BNG A;  3I4N J;  4X6A J;  2EZL A;  1QPI A;  2VKV A;  2R5Z A;  4DYQ A;  2R93 J;  4MFE A;  3GTG J;  2E19 A;  1ETY A;  5K7H A;  5M3F J;  5FKK A;  1XS9 A;  2TRT A;  1IC8 A;  4UUS B;  3JRG A;  1U8B A;  1FEX A;  3CDL A;  2HXO A;  2YS9 A;  1A6I A;  1ETV A;  2DMN A;  4DW6 A;  2HOT A;  3BR1 A;  2R7Z J;  1QVT A;  1ETQ A;  1RKW A;  1K61 A;  2MG4 A;  5EZG A;  2Y31 A;  3GTQ J;  2EH3 A;  3BG9 A;  2DMP A;  1MBF A;  4FCY A;  1IDY A;  4HNV A;  2ECC A;  2NVY J;  2ZB9 A;  3LSJ A;  5E3N A;  5EGO B;  4QTR A;  3IV5 A;  5IOY A;  2B63 J;  3G1M A;  3SFI A;  2OF7 A;  5DS9 A;  2IBD A;  3GTP J;  2X6O A;  4AYB N;  2KDZ A;  2K40 A;  4W1U A;  1ETK A;  2DMQ A;  2ID6 A;  1X2N A;  1YRN A;  3HOU J;  5HOD A;  3D1N I;  4JYK A;  3A01 A;  1B72 A;  4IHX A;  1WPK A;  2XPU A;  3O8G A;  3ZQH A;  1JKO C;  2VUM J;  1TWA J;  1W0T A;  3ZQI A;  2M9H A;  2P81 A;  3WHB A;  4A3K J;  2JWT A;  3IH4 A;  1FTZ A;  1ZK8 A;  3G1O A;  2E2I J;  2G0E A;  5J1R A;  5K7Z A;  4J19 A;  3HOZ J;  5IYD J;  5FJ8 J;  5GPC A;  5EG0 B;  5M5Y J;  3BTC A;  2HI3 A;  3JRI A;  3QQA A;  4IHY A;  1UMQ A;  5FLV A;  4C2M J;  1BW6 A;  3FK6 A;  1U9N A;  3VPR A;  1APL C;  2LP0 A;  1K83 J;  2LR8 A;  1IJW C;  1ZR2 A;  3ZOB A;  1MBH A;  3LOC A;  4A3B J;  1ITY A;  1HDP A;  3B6C A;  1ETX A;  1CQT A;  1LE8 B;  2MGQ A;  4MO7 A;  1MBJ A;  2DA6 A;  1FJL A;  1JTY A;  1AU7 A;  5GP9 A;  3TW6 A;  1OFC X;  4BBR J;  3F0C A;  4NDL A;  2R92 J;  2WAQ N;  5C4X J;  4A3I J;  2M0C A;  3RKQ A;  2NVQ J;  2ECB A;  2YUS A;  4CYC B;  3BG3 A;  3BR5 A;  4B1R A;  5EDN A;  1JUP A;  2R5Z B;  1P7I A;  3ZQF A;  3NAR A;  5M5X J;  4IEJ A;  2NVT J;  3RZD J;  2HQ5 A;  2EZI A;  2WV1 A;  1BJZ A;  2VI6 A;  2LVS A;  1NTC A;  3JRD A;  4FIS A;  1S7E A;  1MBK A;  3CQZ J;  3JRC A;  1MH3 A;  2FX0 A;  1IGN A;  3ZQC A;  3QPS A;  3TP3 A;  4A3E J;  3HOX J;  4JX6 A;  4BY1 J;  3MKL A;  2DA2 A;  4A69 C;  1JJ8 C;  4XIC A;  1ETW A;  2COB A;  1MBE A;  5EZH A;  4IHV A;  2DA7 A;  3BT9 A;  1ETO A;  1MSE C;  3HM5 A;  5F27 A;  1TWC J;  1ZKG A;  2LTP A;  4M3G A;  2E2J J;  4LOC A;  2RAE A;  3JRB A;  2DMT A;  2JK3 A;  1YRN B;  3A01 B;  1B72 B;  1VF9 A;  5JLX A;  1XG1 A;  2D5V A;  3S15 J;  1LFB A;  2DTZ A;  2ID3 A;  3E7L A;  5J3L A;  2N8G A;  1JGG A;  3A02 A;  5F0C A;  4I6Z A;  1X58 A;  1BL0 A;  1D5Y A;  1TWH J;  2FD5 A;  2PMZ N;  2JMW A;  4XRS G;  4JX5 A;  5E3L A;  3I4M J;  3S2H J;  2ME0 A;  2Y0S N;  1I3Q J;  4M3F A;  4V2G A;  4A3D J;  2XGC A;  3SJM A;  1A5J A;  1POG A;  2LFB A;  2NOG A;  3G1L A;  1UG2 A;  2H1K A;  3S14 J;  3PM1 A;  1GT0 C;  1I6H J;  1BW5 A;  2WB1 N;  1H89 C;  2XSD C;  2LD5 A;  3GTJ J;  1OJL A;  1OCT C;  3OIO A;  2JA5 J;  1XC5 A;  3BR2 A;  1AKH A;  2R5Y A;  1ZQ3 P;  3K7A J;  1GVD A;  2LKX A;  4L5E A;  4A3L J;  2XPW A;  1RES A;  1VND A;  2X9D A;  3HOV J;  2Y9Y A;  4Y7N J;  1P7J A;  4Y52 J;  4C3J J;  1G2H A;  3S1Q J;  3FK7 A;  1DU6 A;  4DZP A;  1Z0X A;  2CQX A;  2QCO A;  4GFB A;  3M3Y J;  2ME6 A;  4I76 A;  4D7M A;  1DU0 A;  1LFU P;  3TP0 A;  4B4C A;  4IHW A;  3HOY J;  4D5F A;  5FLM J;  5K7F A;  2CQQ A;  3RQI A;  3PO2 J;  4M3D A;  2XRL A;  1T56 A;  1H8A C;  5FKO A;  1U78 A;  4MLO A;  5EYR A;  3CCY A;  1JKR C;  2L9R A;  5J1U A;  1FTT A;  5IYB J;  3BTL A;  2QF7 A;  3BQY A;  1RET A;  5E3O A;  4XID A;  3BTJ A;  1R9T J;  2HXI A;  4A3F J;  2K9N A;  2CU7 A;  2DMU A;  1RR7 A;  1F36 A;  2HYJ A;  3GTM J;  4A93 J;  4XRM A;  2JA6 J;  3DCF A;  2GLO A;  3DEW A;  5GPA A;  3TED A;  1Q1V A;  1AHD P;  3HGG A;  3JRH A;  4BXX J;  4A3J J;  5EF6 A;  1WH7 A;  2ELK A;  2Y9Z A;  3W6V A;  1VI0 A;  5JLW A;  5FKL A;  3ZQG A;  1I50 J;  3B6A A;  1RKT A;  4S0H B;  3HDD A;  2O8K A;  1IUF A;  1UHS A;  3Q0U A;  2YU9 J;  2CJJ A;  2DA4 A;  1HCR A;  4DZJ A;  5IPA A;  3GBG A;  2EQR A;  2EZK A;  2GM4 A;  4QIW N;  2L7Z A;  5EEA A;  3FIS A;  3TW7 A; 
#chains in the Genus database with same CATH topology
 1SAN A;  2MW8 A;  2FBH A;  2RQP A;  4D5C A;  2STT A;  1EJ9 A;  3HEF A;  2DT7 B;  2M8G X;  2IPQ X;  3HKZ N;  2CSO A;  3C2G A;  1OYW A;  1WJF A;  2IVM A;  4XRS A;  1UAA A;  1JT6 A;  3D5S C;  4P55 A;  2ZME A;  2MD5 A;  1JUS A;  1X1P A;  2LNB A;  1GXP A;  5D5V B;  5ICE A;  2WBM A;  1P4W A;  4QPQ A;  5IP6 A;  4LK1 F;  1LVA A;  3HHH A;  2DA5 A;  5JI6 A;  1IUY A;  3TOA A;  2FBI A;  3JR9 A;  3F22 A;  2QSF X;  2R5Y B;  4O5V A;  3PSI A;  4DYC A;  4YFN F;  3H5N A;  1H0M A;  3IRR A;  4HPQ A;  2IGK A;  1S72 I;  2LF8 A;  3OY9 A;  1YJ9 I;  2K02 A;  1S8N A;  1LVK A;  3ZN0 A;  1HST A;  4BBS J;  1R1U A;  3KYL A;  3IAM 2;  1ZG3 A;  1BJA A;  2QLZ A;  3BG5 A;  1KON A;  4KT5 C;  2P8T A;  3B73 A;  2Y2Z A;  4D7N A;  5J6X A;  1BR1 A;  2Q0O A;  3HOW J;  2P7C B;  1T33 A;  2FQ3 A;  2EV0 A;  2P6S A;  1K6Y A;  1YJN I;  4AC0 A;  1IW7 F;  2XHK A;  2LLK A;  4XLE A;  2E34 A;  4KYW A;  1SEU A;  4KNY A;  4A3C J;  1QO0 D;  1YG2 A;  1IO2 A;  4UUT A;  4E70 A;  1D1C A;  1OYI A;  3D5R C;  4JX4 A;  1O4X A;  3V7C A;  1LNW A;  5E17 F;  4IOC F;  5C44 J;  4AUX A;  2ETH A;  2XB5 A;  1FIP A;  1FSH A;  2VPR A;  3A2K A;  2YR2 A;  4IO9 F;  1TC3 C;  3GLX A;  4BE1 A;  4HA8 A;  2HOA A;  2DK5 A;  2KIQ A;  2O03 A;  2Y0M A;  4M3B A;  4PSW A;  2H6B A;  2OTL I;  1YW7 A;  2ZKZ A;  3MVP A;  5D5U B;  4UUS A;  3BZC A;  4DOZ A;  1Y39 A;  2RV8 A;  3VSK A;  2HDC A;  1IN8 A;  1WQ2 A;  3IH3 A;  2JPC A;  3VWB A;  3KLO A;  4BU2 A;  1X1A A;  4G6Q A;  1R5I D;  3FIW A;  4MQV A;  1VTN C;  4MTD A;  2AQF A;  1Z77 A;  3PJR A;  3QPH A;  5FKM A;  3ZQQ A;  3J7A Y;  2V9P A;  2JPB A;  1I1G A;  3KYC B;  3H0D A;  2H94 A;  4CHU A;  4RB0 A;  1KQ9 A;  3L2V A;  5L3G A;  2FNA A;  2TDX A;  4M6V A;  1IG7 A;  3CMM A;  2NVU B;  4ASN A;  1SD4 A;  2K9M A;  1IV6 A;  4OMZ A;  2ZME B;  4L5I A;  4ZC3 A;  4ZYH A;  2IS6 A;  2KZV A;  3CC2 I;  3BZ6 A;  4PZJ A;  5E1X A;  5CVV A;  3GXO A;  1FYK A;  3ZMZ A;  1JI8 A;  5FKN A;  2WC2 A;  1V55 H;  3VEP A;  2W57 A;  3Q0W A;  2DT5 A;  5DCM A;  3H0G J;  4MTE A;  4ANJ A;  2DOE A;  1Y1W J;  1FZP B;  5E1W A;  2DI3 A;  1MD0 A;  5ERI A;  3QOD A;  5F04 A;  1IRG A;  1R5H A;  4EAT A;  3GWZ A;  4E7S A;  1E17 A;  1XGS A;  3KPH A;  5FO5 A;  1JUM A;  2CO5 A;  5EG0 A;  3WHC A;  2DA3 A;  1ZTR A;  4RDU A;  2L7M P;  4LIV A;  1L3L A;  3S2D J;  4W97 A;  3P5J A;  4ETS A;  4F7Z A;  3H9J A;  1SAX A;  2UXN A;  3K4M A;  3S17 J;  2L9N A;  2GQQ A;  2KRC A;  1EA3 A;  2QQB A;  4AIK A;  1O3R A;  1C0W A;  1QPM A;  2K85 A;  2RVC A;  4OIQ F;  4UXN A;  3W6K B;  5HS7 A;  1NK2 P;  1TT5 B;  4ZYD A;  4RBO A;  2Z16 A;  2DU9 A;  2O9L A;  2DOD A;  1JT0 A;  3W2A A;  3F21 A;  1Y8R B;  4U88 A;  3DLL F;  3BCB A;  2ZJQ F;  3BJ6 A;  4EJW A;  5M5W J;  1ON2 A;  4E7H A;  1NH3 A;  1XX5 A;  4CYC A;  3CJR B;  1IN4 A;  3KLN A;  3BZK A;  2FNP A;  3GLL A;  2R7W A;  3WGG A;  4C30 A;  2L4M A;  2VKV A;  4PDK A;  4F52 A;  5TRD A;  2R93 J;  3RJP A;  1B9N A;  3GTG J;  3QU6 A;  2F5C A;  1ETY A;  3KP7 A;  3ECH A;  3QU3 A;  2HQA A;  2ZBK A;  4G8X A;  4M71 A;  2TRT A;  4M9Z A;  5FKK A;  1IC8 A;  4G7O F;  3ZMT A;  4UUS B;  1U8B A;  1UHM A;  2YSR A;  1FEX A;  2HXO A;  3C7J A;  1R1V A;  1A6I A;  4ENJ A;  1K79 A;  4DW6 A;  1Y0N A;  3NWS A;  4LD5 A;  1QVT A;  3CJQ B;  1B6A A;  1RKW A;  2VN2 A;  2GWR A;  1SVM A;  3OYA A;  4BUP A;  2EFN A;  3BG9 A;  4BE2 A;  3H5A A;  5HLH A;  2W85 A;  2ECC A;  1G3Y A;  2ZB9 A;  3CTA A;  1S7A A;  2L5Q A;  4KIF A;  5E3N A;  4CSW A;  2HWV A;  3JW4 A;  3K4L A;  1GXQ A;  4B43 A;  3FXO A;  4DJA A;  5DS9 A;  1D8K A;  3I9V 2;  1KYZ A;  3COA C;  2KDZ A;  1J59 A;  1Z21 A;  3WTY C;  1MDM A;  3CF2 A;  1STZ A;  2DMQ A;  2XDV A;  3TO9 A;  1YRN A;  1IAW A;  5HOD A;  5A2Q K;  3D1N I;  2VQC A;  2A5Y B;  1B72 A;  1HKQ A;  1WPK A;  1T98 A;  2LG4 A;  2M30 A;  2O8X A;  3TKY A;  4IHX A;  4IQJ A;  5FLX K;  1JKO C;  3ERE D;  5GAH J;  4WX9 A;  2VJJ A;  3CCM I;  4M6Y A;  1TWA J;  5DCM B;  3W3C A;  4FAS D;  2CFO A;  4P9F A;  2BY3 A;  2JWT A;  1FTZ A;  2A5W A;  1FX7 A;  4J19 A;  4BHB A;  5DM7 F;  4PSX A;  4AIJ A;  3ML6 A;  5D6F A;  2RQQ A;  5EG0 B;  3BTC A;  3AG3 H;  1QHH D;  1MJA A;  4OOI A;  2Y0S A;  1UMQ A;  2X6X A;  3L2W A;  4KIT B;  4C2M J;  1BW6 A;  1U9N A;  4WCG A;  3IKT A;  1IJW C;  2O5R A;  2K3P A;  3IL2 A;  1ZR2 A;  4I0A A;  1ITY A;  1HDP A;  3B6C A;  3ERM A;  1RR8 C;  2V1X A;  4PK4 A;  1ETX A;  4WK8 F;  3OIQ A;  1FJL A;  2W84 A;  3T5X A;  1HW2 A;  3F0C A;  2J5P A;  3LSM A;  3HSF A;  2WAQ N;  2MBF A;  5C4X J;  4M9X A;  1KU7 A;  3E6D A;  2NVQ J;  1ZHF A;  4F3Q A;  3Q9S A;  3K1M A;  4CYC B;  4HLY A;  4B1R A;  4UV8 A;  4Y3O A;  4N0B A;  1O3T A;  1U5T A;  3ZQF A;  4IEJ A;  5CKT A;  1FBQ A;  1KGS A;  1W36 D;  2CW7 A;  2XF6 A;  3JSP A;  1ZH5 A;  3QP5 A;  4GGG A;  4XLC A;  2DQR A;  3BWG A;  2P5L C;  3KP2 A;  3FM5 A;  2RN7 A;  4FIS A;  2VIX A;  1S7E A;  2VOD A;  2GIV A;  2MLG A;  1MKM A;  2FX0 A;  1IGN A;  3KP5 A;  2M5W A;  5D4R A;  1Q1H A;  3QPS A;  4Z6Y A;  4L9V A;  3V8K A;  5LRS A;  3FXU A;  1GVJ A;  2VBZ A;  1IXR C;  4RS8 A;  3U9G A;  2CV1 A;  4BY1 J;  2DA2 A;  1A31 A;  3VB2 A;  4A69 C;  1JJ8 C;  3GYH X;  1ETW A;  2KIF A;  1MBE A;  3L9F A;  4ITV A;  1V3F A;  4L9J A;  3F9K A;  1OLT A;  3HM5 A;  4IKF A;  4M3G A;  3K4J A;  3OV8 A;  2E2J J;  1RZ4 A;  3S8P A;  3L2R A;  1Y56 A;  2DMT A;  2B0L A;  2OAZ A;  1MDM B;  1TT0 A;  4XOR A;  3OR1 C;  1EKE A;  1UHW A;  3MCZ A;  5A2Q Z;  3AG4 H;  1YRN B;  4UVC A;  1FMW A;  1UZC A;  1B72 B;  5FLX Z;  3E1S A;  1D1B A;  1LUJ B;  2DTZ A;  5JHU A;  4LLL A;  5HLI A;  3HOT A;  3CCE I;  3WG7 H;  1P6R A;  2P0W A;  2HVS A;  1TWH J;  2PMZ N;  3CCU I;  1W7P D;  5H6R A;  1YX5 A;  5E3L A;  3I4M J;  3VFZ A;  2LMD A;  2XGC A;  2HVR A;  3MWM A;  2NOG A;  3BOQ A;  2EIL H;  2OZ6 A;  3EYI A;  1R49 A;  3ROU A;  2VLA A;  1KYW A;  3HKZ A;  5JVG F;  2LD5 A;  1OJL A;  1DPU A;  4HYE A;  3LQQ A;  1W4M A;  2X1D A;  4PFO A;  4KN7 X;  2KPM A;  4HST A;  2PJR A;  3PNY A;  1W5S A;  3F8B A;  2DXI A;  3DKY A;  5H20 A;  4L5E A;  3ONQ A;  3WTU C;  3PQK A;  4KIG A;  2EJR A;  4JBA A;  2X9D A;  4A0Z A;  1P7J A;  4DQ2 A;  2HQN A;  2IXS A;  1MMA A;  4LG0 A;  4B48 A;  3EYY A;  1LB2 A;  1YTY A;  4XL9 A;  2ME6 A;  3I4P A;  2BY1 A;  4I76 A;  3OYF A;  3OR2 C;  2G7H A;  4BAY A;  4EVI A;  1U5T B;  2ZXW H;  4GRI A;  1T39 A;  4IHW A;  3H3Z A;  3PO2 J;  2CQQ A;  4U0V A;  1RIO H;  1T56 A;  2BVM A;  1T95 A;  5FKO A;  5EYR A;  1XMX A;  4HX4 A;  5GTH C;  3CCY A;  3OYK A;  5J1U A;  2Q2E A;  5L3F A;  5LEK A;  1VQ5 I;  3I64 A;  3N97 A;  3FWE A;  5E3O A;  4XID A;  1R9T J;  4OIR F;  5JVT A;  4A5N A;  4U7D A;  2QZ8 A;  4JK1 X;  4E7I A;  1B59 A;  3MAJ A;  5DCF A;  1TTY A;  1TW2 A;  3E6C C;  4G6D A;  1XSV A;  1ONV A;  4XR6 A;  2MH9 A;  1AHD P;  3JRH A;  4F55 A;  3FHZ A;  3CDI A;  2DFI A;  2E5Z A;  3V8L A;  4A3J J;  3RKW A;  3AG1 H;  3FBI B;  3CLO A;  2DPU A;  1ZGA A;  1QZY A;  3W6V A;  2VC0 A;  4HLX A;  3CCJ I;  1I50 J;  3ABL H;  1RKT A;  3B6A A;  4S0H B;  1X4P A;  4H0E A;  3HDD A;  4CDG A;  5ICG A;  1IUF A;  4IRG A;  1BBY A;  1UHS A;  1WJ5 A;  3MEX A;  2ELH A;  2D1V A;  2DA4 A;  2DDB A;  3CP8 A;  1HCR A;  4E6K G;  4DZJ A;  2EQR A;  2UWM A;  1WRJ A;  1M1E B;  2EZK A;  3KZI C;  2EWN A;  2GM4 A;  1LDJ A;  2L7Z A;  4QIW N;  4RA2 A;  2OV7 A;  5DD8 A;  5EEA A;  2K9L A;  3SZT A;  2I5U A;  2L2O A;  3R61 A;  1EH7 A;  2WTE A;  3S1M J;  3AFH A;  3SZP A;  2M8E A;  3BP8 A;  4EV0 A;  5BQT A;  3BTI A;  2FA5 A;  4A3M J;  3DV8 A;  3K9T A;  3H1C A;  1LQ1 A;  1MNM C;  3S1N J;  2L0K A;  3D5L A;  1FOK A;  4PUS A;  2PJR B;  2NVX J;  4NUB A;  5H2F C;  1XTA A;  1S3J A;  2ZSH B;  3Q3S A;  4QSH A;  3KEY A;  3V42 A;  3N4M A;  2QKM B;  3K6G A;  1S29 A;  2XUB A;  2VBX A;  1B8I A;  2IAI A;  4P9U A;  4QWQ A;  1U8R A;  2XAU A;  4LG0 B;  3LL7 A;  9ANT A;  3WTX C;  1I39 A;  3J80 K;  3MKY B;  4IXA A;  3DTI A;  2LBF A;  3DLA A;  5CQG A;  3OYE A;  3CJN A;  2I10 A;  4LB6 B;  4F91 B;  1Z6R A;  2LRD A;  2OPT A;  2VQL A;  4HG2 A;  5FD5 A;  4FE4 A;  1UEL B;  1ZRC A;  2VOO A;  5BS6 A;  2FJ1 A;  3HRT A;  2JQ7 A;  4BE0 A;  4EJT A;  2DA1 A;  4C3I J;  5E18 F;  2LY1 A;  2LKS A;  5B5E C;  2Q2E B;  1KZH A;  1X3W B;  4RAF A;  3NQO A;  4CZZ A;  3I59 A;  1YJW I;  2LF7 A;  5LGU A;  1MIJ A;  2JVH A;  1VQ8 I;  1BA5 A;  3TO7 A;  3HJE A;  3F8C A;  3PIP F;  3CP2 A;  3GF2 A;  3H36 A;  3SDG A;  4F93 B;  2TCT A;  1ZRE A;  2M34 A;  4QLC U;  1HDD C;  2AO9 A;  3M7G A;  2IRF G;  2A61 A;  3UR3 C;  2P4W A;  4O3M A;  3ZMS A;  5ICC A;  3GO5 A;  2E1N A;  2AHQ A;  4II3 A;  4FTH A;  1VFC A;  1N77 A;  1J9I A;  2DO7 A;  2XAJ A;  4DYR A;  4JOM A;  5E20 A;  4EEF G;  2EFP A;  4UVB A;  5EGO A;  4UUV A;  1UCR A;  3HSE A;  2XB0 X;  3LST A;  4YEL A;  4GDF A;  4BL0 B;  2D2W A;  3EUH C;  1QVU A;  1CGP A;  1I1S A;  3I53 A;  3C3W A;  1Y6I A;  2KIU A;  1RPW A;  2Z2S B;  1XMA A;  4MIM A;  1G8X A;  2K9S A;  3KE2 A;  3GTK J;  2A6H F;  3NAU A;  4KMU X;  3LFU A;  4NHJ A;  2EV6 A;  4XM3 A;  3CMY A;  1A36 A;  2V1N A;  3WU1 B;  1LKX A;  3QOE A;  4IRH A;  1T8I A;  2IA0 A;  3MZH A;  3T1B A;  1YLF A;  1GDT A;  1S9H A;  2KRH A;  3JRE A;  2HS5 A;  2E5N A;  4FET A;  3LNQ A;  1E2X A;  2NXN B;  2WY7 Q;  1MMG A;  2GXA A;  1Z3Y A;  5F08 A;  1FWZ A;  3F23 A;  1B8I B;  2X48 A;  1L0O C;  1YX3 A;  5IT9 K;  2QYO A;  4Y4R A;  1BR4 A;  2ZXJ A;  3FKI J;  3OYD A;  1VQ4 I;  3F6O A;  4RM2 A;  4XKB A;  4RGS A;  3J80 Z;  1X2M A;  2F5E A;  5CVR A;  1IZ1 A;  1JTX A;  4N9I A;  3RPU A;  1VQL I;  2LBF B;  2MC4 A;  5DDG A;  1EF4 A;  4P5O A;  1IXS B;  5IP9 J;  2OA4 A;  4JP0 A;  3TL4 X;  5M3M J;  5J8C A;  1WH5 A;  4HAM A;  3M4O J;  4IL6 C;  1QZZ A;  2EA4 A;  1ORK A;  2DAO A;  1MGT A;  3DFG A;  3KEQ A;  2ZNZ A;  2M4G A;  1BI1 A;  1HC8 A;  5F0H A;  1FIA A;  4X1E A;  1WI3 A;  4A0X A;  1JJ6 C;  2E36 A;  3KP4 A;  4ENK A;  3EUK L;  1HXD A;  5KVR A;  1TQI A;  4BXU A;  4Q5S F;  4EGY A;  1IN7 A;  1H88 C;  3I59 B;  2CQ7 A;  1XGO A;  2XVC A;  4KT6 A;  4CH7 A;  2NNN A;  3QOP A;  2K4B A;  1AOY A;  5J1Y A;  4HBL A;  2WAQ A;  5BNG A;  4OIN F;  4X6A J;  3MKZ A;  4XMY A;  2M7A A;  2QSH X;  3O2P E;  5J4Y A;  3CO6 C;  2R5Z A;  4MFE A;  4XSZ F;  2W82 A;  5DYM A;  1U3E M;  2F5V A;  3OL3 A;  3HIF A;  2JRM A;  2OQR A;  1XS9 A;  3V7R A;  1PP7 U;  1IXC A;  1YIO A;  2OJE D;  3JRG A;  4HV6 A;  1IRF A;  4AVZ A;  4UVA A;  1YIT I;  1ETV A;  2BHY A;  2CQN A;  1T0F A;  1RRJ A;  1W36 C;  4BNC A;  3VDX A;  1KQ8 A;  1XGN A;  3GZN B;  2PFB A;  1IV8 A;  1VQ9 I;  2DMP A;  3HHG A;  1N75 A;  1IDY A;  3UNG C;  1FOY A;  1YI2 I;  3H9Q A;  3F8F A;  2NVY J;  2OC6 A;  4YEJ A;  5EGO B;  3GME A;  4CYD A;  1J09 A;  2K7L A;  2Z5U A;  2HFH A;  3G1M A;  2HKO A;  4IHS A;  2A6E F;  4ON0 A;  2IBD A;  3GTP J;  4LIU A;  1IRX A;  4BS9 A;  3QPT A;  4LJZ F;  1GLN A;  2ZC2 A;  4X0G A;  1KU9 A;  3ZQH A;  5DUI A;  3DEE A;  3IHU A;  2UZK A;  4XN3 A;  3WHB A;  2F4I A;  2WA0 A;  4A3K J;  2F2E A;  2DOF A;  4CCO A;  2G0E A;  4BDZ A;  5K7Z A;  2L01 A;  6PAX A;  3HOZ J;  2HZD A;  3EET A;  5IT9 Z;  1DPR A;  1FYL A;  3AL0 B;  2DFH A;  3ZMD A;  3KZY A;  3GEZ A;  1I6X A;  3KFW X;  1XB4 A;  3CCV I;  5FLV A;  2COM A;  2IA2 A;  5ILU A;  2FF4 A;  1RI7 A;  3ZOB A;  1MBH A;  1F9N A;  3LWF A;  2X0L A;  2VE8 A;  2R7O A;  3A0B C;  1CQT A;  2MGQ A;  5EEG A;  2L7K A;  1MBJ A;  2XRO A;  3DPT A;  1QHG A;  1AU7 A;  1WKM A;  1OFC X;  3TW6 A;  1HW5 A;  2HGC A;  2GA2 A;  1D5V A;  3OYC A;  3FKJ A;  2ECB A;  2YUS A;  2M3A A;  3F3X A;  1ERD A;  1HKT A;  2KFD A;  2FOW A;  3BR5 A;  2LKP A;  2BHZ A;  2WWY A;  4BJ5 C;  2R5Z B;  2CMP A;  4XLH A;  4N9H A;  2XKO A;  5GAE J;  1TNT A;  2FUG 2;  3E0J B;  1G4D A;  1TQM A;  3FF5 A;  5TGT A;  2DOA A;  2HQ5 A;  2EIK H;  4L5J A;  2WV1 A;  1RUO A;  1BJZ A;  1MW7 A;  4ESJ A;  4A2U A;  5FD6 A;  3R0A A;  1XSD A;  1T38 A;  3VSL A;  3JRC A;  3CQZ J;  3JCU C;  2JUC A;  1MH3 A;  2HOE A;  3RKY A;  1ON1 A;  3K4K A;  4CCK A;  3O6B B;  5HNH A;  2CW8 A;  4L9N A;  3CO7 C;  1G6N A;  4XLN F;  4ZJZ A;  4HDU A;  3PNV A;  4JX6 A;  1DUX C;  4S05 A;  2JRT A;  3CCR I;  3FXJ A;  4CCM A;  2XAG A;  3I58 A;  4H4K C;  3OYI A;  2OCC H;  4IPA A;  2R7T A;  2HYG D;  5J8F A;  1ZKG A;  2LTP A;  2NAZ A;  2PG4 A;  1WJE A;  2MD0 A;  3WU2 C;  4Y13 A;  3R6S A;  3WTV C;  1WSU A;  2OCE A;  1SD6 A;  4HF1 A;  3CD6 I;  1YIJ I;  4RM3 A;  3ESW B;  3W2V A;  3K4C A;  2V1U A;  1BI0 A;  5D5X B;  2IP2 A;  1KU2 A;  1V5E A;  1LDK B;  2L3D A;  2W7N A;  5E1Z B;  5BMZ A;  2D5V A;  1XCV A;  2VQH A;  4WXC A;  4BXF A;  3E3V A;  2ID3 A;  3J81 K;  3E7L A;  2KLO A;  5CPR B;  2N8G A;  1ZGJ A;  2EB7 A;  2FEZ A;  3OYJ A;  2VC1 A;  1X58 A;  3IUO A;  3ZR8 X;  4I6Z A;  2DW4 A;  5TJJ A;  4KUM A;  1BC8 C;  2FD5 A;  2J5O A;  3VOE A;  1PDN C;  3OS0 A;  2M4K A;  3M8F A;  3S2H J;  2ME0 A;  2O0Y A;  3KP3 A;  5KAF C;  5HDN A;  4IX7 A;  3CMA I;  1EV7 A;  4FHT A;  1UG2 A;  5AON A;  3PM1 A;  3ASN H;  3SHF A;  1I6H J;  1SMY F;  2KJC A;  5AIQ A;  1R00 A;  2VL8 A;  5J4V A;  3I54 A;  4Q48 A;  3OMY A;  4NB5 A;  4XOT A;  3GFI A;  3K0L A;  2F5F A;  1R4N B;  2NYX A;  2HDW A;  4AD9 A;  1ZQ3 P;  2XAS A;  2LKX A;  3M8E A;  5LEJ A;  4E7J A;  4A3L J;  4BHC A;  1A35 A;  3EQL F;  4LLG F;  3MD2 A;  2CFX A;  3L2C A;  1S7O A;  4C3J J;  1T2K A;  4Y52 J;  3QRF F;  3DPU A;  3FK7 A;  2X6W A;  4DZP A;  3A1Y A;  2X1E A;  2CQX A;  2V7F A;  3LSH A;  2Z99 A;  5FRO A;  4IQ4 A;  4ZZD A;  3FMR A;  2KMU A;  4CA0 A;  3SEZ A;  3TQN A;  1LFU P;  2A05 A;  3HG9 A;  1GHC A;  2UXX A;  4ZH4 F;  3HPG A;  3RQI A;  3S93 A;  5K7F A;  3GZ6 A;  4OIP F;  3GUD A;  3LSI A;  2QEX I;  4WWC A;  3HUG A;  2IGO A;  4MLO A;  4IRI A;  1SFK A;  2MC3 A;  1BC7 C;  1KU3 A;  4Y33 A;  3R60 A;  4KIB A;  4ZDP A;  5IYB J;  3BC8 A;  5KNL A;  2QF7 A;  4XKW A;  2D1H A;  1XPX A;  3TDU C;  4ZDO A;  1YW8 A;  1U2W A;  5FFZ A;  1BM9 A;  4M74 A;  1WHU A;  1X1D A;  1RR7 A;  2ZJP F;  4A93 J;  1AWC A;  4XRM A;  2JA6 J;  4Y17 A;  2GLO A;  3DEW A;  1Z91 A;  3WOD F;  3TED A;  1RC9 A;  5AIP A;  1Q1V A;  2H6C A;  3FMS A;  4BEH A;  3FMQ A;  1J0R A;  1LPQ A;  2VXD A;  5EF6 A;  3T8T A;  1FC3 A;  3K2Z A;  1T6S A;  4GXO A;  4NQW A;  4BQO A;  5F64 A;  1UG0 A;  3I55 I;  2EFW A;  2DJI A;  3ZQG A;  3NWT A;  4B8X A;  4BYY A;  2DFE A;  1X19 A;  2HTS A;  2EA2 A;  3J81 Z;  1R7J A;  3GBG A;  1U5T C;  2F5D A;  1Y0U A;  2MAB A;  2Q8K A;  4A6D A;  2JA5 J;  3TW7 A;  3HYI A;  2NS7 A;  4YG2 F;  2PEX A;  2XSJ C;  2W25 A;  1E3P A;  1MH4 A;  3HSR A;  4CGZ A;  2E1C A;  2CW0 F;  3RKX A;  3KZZ A;  4RMN A;  2JA7 J;  2VAS A;  2DJN A;  5B66 C;  4I02 A;  1X3U A;  1WZ2 A;  2K5C A;  2MSY A;  1OCR H;  3KX2 A;  3M8J A;  5DEQ A;  1NK3 P;  3BJA A;  3DKW A;  2IGM A;  5KK1 A;  3I56 I;  3BQZ A;  3G71 I;  1V4R A;  1P9Q C;  2CH0 A;  3E5U A;  1JGS A;  1QBJ A;  1V5G A;  3DTE A;  2EBI A;  1H9G A;  2F4M B;  4XLF A;  5F1J A;  2E1O A;  3WGH A;  4MEY F;  3BLY A;  1SFX A;  3HRU A;  3IH2 A;  3CES A;  2X1C A;  3EDP A;  4BKX A;  2ESH A;  4NNJ A;  2VT2 A;  1YS7 A;  1DP7 P;  1DGW Y;  1MBG A;  2M45 A;  3A0H C;  1OYY A;  2CUF A;  3M9A A;  3DBL B;  4CIC A;  3CJT B;  2LOO A;  4I7H A;  5F1R A;  1U9O A;  1YO5 C;  5DV5 A;  2BOL A;  1E3O C;  1IF1 A;  5LGT A;  1LEB A;  2DYS H;  3BDD A;  4GO1 A;  1FY7 A;  4YIR X;  3K4B A;  3JTG A;  4EM2 A;  1FOX A;  1S6L A;  1BOB A;  4DGW B;  4ZDL A;  3CC4 I;  2E1M C;  3HUG B;  2QM3 A;  2A68 F;  3F8M A;  1D1A A;  2JN6 A;  2IS4 A;  1FLI A;  3G73 A;  1LEA A;  1JKQ C;  2EIN H;  3GX4 X;  1ENH A;  3DBR B;  4A12 A;  3RYP A;  3LSG A;  5BPD A;  3G4S I;  2AQE A;  1HOM A;  1FYM A;  1WGX A;  2V79 A;  3U1K A;  3U2R A;  1O7F A;  3A03 A;  1Z67 A;  1YFH A;  5L3E A;  2Z9O A;  4PJM A;  2E60 A;  3IC7 A;  2W48 A;  4KN4 X;  2VKH A;  4ZYG A;  4AVP A;  4BEH B;  2V9K A;  1OR7 C;  1ZR4 A;  5E79 C;  3CF5 F;  4MHG A;  3LAJ A;  2QSG X;  1R5G A;  1VQO I;  4LIT A;  4NQW B;  2VKE A;  5EJC A;  1D0X A;  1WFX A;  2CRG A;  2GZW A;  2X4H A;  3WGI A;  2CG4 A;  2RKH A;  1YE9 A;  5DM6 F;  1HW1 A;  3OYN A;  1SFO J;  3BY6 A;  1QQI A;  4ZTJ A;  5KHD A;  1JHH A;  5FFX A;  3R0J A;  1GUU A;  2HOS A;  1D0Z A;  4M6X A;  1W0U A;  1J5Y A;  2V4J C;  1AA7 A;  4MQ9 F;  2Y69 H;  5HDK A;  4E7L A;  1Z3X A;  1UST A;  3S1R J;  4I09 A;  2VE9 A;  2M2E A;  3PUF A;  2OD5 A;  3SZG A;  2F6C A;  3SYT A;  1JKP C;  1DDN A;  3QWL A;  1MSF C;  5TIS C;  4J01 A;  2XAH A;  1ZGW A;  2ZFU A;  2HPI A;  5C4J J;  2L4A A;  3BR3 A;  2GBY A;  3P9I A;  3K1P A;  4IVN A;  4V2F A;  5E3M A;  3HL2 A;  3ZPL A;  5CJ9 A;  3A4C A;  4HSR A;  2EZH A;  4KIC A;  4EQQ A;  3OYG A;  4OAZ A;  2BGC A;  1CF7 A;  5J47 A;  2KIS A;  2L02 A;  5IP7 J;  2AXT C;  1GV5 A;  1H9T A;  2DCE A;  3WE3 A;  4S04 A;  4YFX F;  1G3T A;  3BR0 A;  1DP3 A;  5K5R A;  2Z33 A;  3CZ6 A;  3L09 A;  3HOS A;  2NOJ B;  4LMY A;  5F0F A;  3PQJ A;  3PFY A;  2LYC A;  4BQA A;  2VBW A;  1UB9 A;  4B09 A;  2NS8 A;  2V1D A;  4M72 A;  2VQG A;  3VYU B;  2EK5 A;  2XGD A;  3GVA A;  4QPO A;  3BJO A;  3K10 A;  2E2H J;  3WU0 A;  4AM3 A;  2VOP A;  5DTD A;  3R4K A;  3BPV A;  3HB9 A;  4NC8 A;  1BIA A;  3CME I;  3RZO J;  2BV6 A;  3ZN1 A;  3GCM A;  3OOU A;  2LH9 A;  4N4N B;  2RNG A;  1MMN A;  3DEU A;  3CUQ A;  2P6T A;  4I0B A;  5ILV A;  1FP2 A;  2BXZ A;  3OL4 A;  1W5C C;  1UJ8 A;  4XQF A;  2V6C A;  3U21 A;  2EZL A;  2FU4 A;  3KEO A;  4DYQ A;  1VQ6 I;  2VPL A;  4R79 A;  3CCS I;  1QU3 A;  2E19 A;  5GTI C;  2IS1 A;  3CCL I;  1K6O A;  2HYF A;  2E7X A;  4XON A;  5M3F J;  1USS A;  2PQ8 A;  3K69 A;  3LQR A;  3WTT C;  4FT8 A;  1MMS A;  1FSE A;  1R23 A;  1V54 H;  5CVI A;  3MFK A;  1ETQ A;  4ESB A;  5EZG A;  2Y31 A;  2ZXI A;  3GTQ J;  3H92 A;  5K1Y A;  2ELJ A;  4U87 A;  4IHT A;  4B3X A;  3CDH A;  4FCY A;  3T8R A;  4QTR A;  3IV5 A;  5IOY A;  2B63 J;  3RPQ A;  3LSK A;  4EGZ A;  3ASO H;  3SFI A;  2EFO A;  4CUG A;  4YII A;  2X6O A;  1HBX G;  4AYB N;  3BG7 A;  1U6G A;  2E7W A;  5CLS A;  2EV5 A;  2JZY A;  2ID6 A;  4XLA A;  3HOU J;  2EIJ H;  4LK0 F;  3DXJ F;  2XPU A;  3E97 A;  4U7B A;  3H9G A;  2AS5 F;  1IN6 A;  3MKW B;  3IP4 B;  3IWZ A;  3IKV A;  3KIO A;  4I99 C;  1CF7 B;  3L2U A;  2WV0 A;  3ZQI A;  2M9H A;  5HDG A;  3PUB A;  4U0W A;  3IH4 A;  3WTS C;  3TOB A;  3IRQ A;  2HKX A;  2KQR A;  3LFK A;  4BGD A;  1YQA A;  4RGR A;  4LG3 A;  1TNS A;  5IYD J;  1D3Y A;  1K7A A;  4KFC A;  2H27 A;  3PFI A;  4KMF A;  5FRM A;  4PJ0 C;  2Y48 A;  2GXB A;  3OYB A;  1WWX A;  4IHY A;  1Z1D A;  3FXR A;  5LD2 C;  4IF4 A;  2BE5 F;  1PVE A;  1OCZ H;  4Q47 A;  3VPR A;  3HRM A;  5HS9 A;  4XLP F;  1APL C;  2RDP A;  2LP0 A;  4G6T B;  2LSO A;  1K83 J;  3ZP5 A;  2VB6 A;  5HS8 A;  4BHP A;  1LJ9 A;  3DTK A;  3EUH A;  4OIO F;  1FNN A;  4GCV A;  2LC2 A;  1XSX A;  3TBI A;  3DU6 A;  4BBR J;  3LA3 A;  3CUQ B;  2R92 J;  1BR2 A;  3NRV A;  1MJB A;  2K3F A;  2G7U A;  4R1H A;  5HNF A;  3Q9V A;  4PJL A;  2CYY A;  2CV2 A;  1YW9 A;  2JVG A;  3H3U A;  2RRE A;  3BG6 A;  3NAR A;  4GYG A;  3T0Y A;  5M5X J;  2YX7 A;  3QP6 A;  2NVT J;  3S3M A;  2ZXH A;  3RZD J;  2QGU A;  1E3H A;  2WAE A;  2EZI A;  3P9C A;  4E7Z A;  2LVS A;  1NTC A;  3WTZ A;  3JRD A;  5FRN A;  3AL0 C;  1MBK A;  2G9W A;  4PJN A;  3ABK H;  4CZC A;  1R4M B;  3F8N A;  2OZU A;  4IOA F;  2OTJ I;  2H8W A;  1WJB A;  2PI0 A;  2P5K A;  1XDU A;  2IGN A;  2ZME C;  1MNE A;  1X1C A;  2MLK A;  3W2W A;  2VT3 A;  2MA3 A;  3GFM A;  4I01 A;  1VQN I;  3BT9 A;  1ETO A;  1ZRF A;  2YU3 A;  3SXY A;  5F27 A;  1TWC J;  2NRA C;  1BOA A;  2R7F A;  2RAE A;  3JRB A;  1B4A A;  4BAC A;  1MMD A;  2XC7 A;  3FHN A;  1BI3 A;  3CCQ I;  5JLX A;  3S15 J;  1QA6 A;  4V19 K;  1LFB A;  1REP C;  2DDA A;  3HC7 A;  2ZNY A;  3JTH A;  2QEN A;  4K2E A;  2OU2 A;  5F0C A;  4OU0 A;  1BL0 A;  2FSW A;  1SFU A;  3LA2 A;  4HX8 A;  2ZJ2 A;  3ZQ7 A;  2BY2 A;  1D0Y A;  2JMW A;  2XF5 A;  2LRE A;  3M1C A;  2W00 A;  4XNF A;  5D5W B;  2NNY A;  1ZG1 A;  4D0P A;  1I3Q J;  4M3F A;  4V2G A;  5ICF A;  2WAD A;  3SJM A;  1A5J A;  1POG A;  4BJT A;  1N25 A;  3MZY A;  2QQ8 A;  3S14 J;  2H1K A;  1T0F C;  1GT0 C;  1BW5 A;  2HQR A;  2WB1 N;  1H89 C;  4PCQ A;  2XSD C;  2GXG A;  1XGM A;  2XGX A;  3GTJ J;  1OCT C;  1YS6 A;  2WY8 Q;  1ZEL A;  2CV0 A;  1I3A A;  1XC5 A;  1MND A;  4G9Y A;  1AKH A;  4G94 A;  3ZMV A;  3K7A J;  4E7K A;  2YPR A;  1FBU A;  1FOW A;  1HKS A;  2QUF A;  4DBQ A;  1VND A;  1N78 A;  1SFE A;  3HTS B;  2Y9Y A;  4Y7N J;  5CYV A;  4PGG A;  2R7X A;  3S1Q J;  5L3D A;  1Z0X A;  2QCO A;  4UY8 I;  2EFQ A;  1VQ7 I;  1XCB A;  3M3Y J;  1OKR A;  1O3Q A;  2JT1 A;  3DWL E;  2PMZ A;  4B47 A;  4D7M A;  3PNT A;  3KET A;  5LHI A;  4B4C A;  4RB1 A;  4EJO A;  2HVQ A;  2KDO A;  4XSX F;  3V8J A;  5FLM J;  4KIS A;  2DQL A;  2XRL A;  3FM3 A;  1W7P A;  3BCA A;  1R36 A;  1VQK I;  2X6Y A;  1U78 A;  3K1N A;  2M0M A;  2HZT A;  3G6E I;  1R58 A;  1QGP A;  5GAG J;  1JKR C;  2L9R A;  1ZLK A;  4R8H A;  1LDD A;  2BY0 A;  3IWF A;  4EJV A;  3KCC A;  5D8L B;  4LLN A;  3JSO A;  3G2B A;  2PX9 A;  5CVJ A;  2HXI A;  4UNO A;  4DBR A;  4A3F J;  2CU7 A;  2DMU A;  4ZYA A;  3S3O A;  1XDS A;  1J7K A;  3REO A;  4HQM A;  5GPA A;  4Z2Y A;  3DPL C;  2CUJ A;  4BJ6 C;  1O7L A;  4HNT A;  1HQC A;  1WVR A;  4ESF A;  1TL8 A;  5LBQ A;  3K70 C;  3TO6 A;  2ELK A;  5HLT A;  2Y9Z A;  2HNH A;  2GOM A;  1FPQ A;  5JLW A;  3MZ8 A;  4CCJ A;  5FKL A;  2CWE A;  1TP4 A;  4WF2 A;  4G7Z F;  5DD4 A;  3E6M A;  3ELK A;  3OS2 A;  2QA4 I;  1EH6 A;  3Q0U A;  2LY2 A;  2YU9 J;  3D0S A;  3SQN A;  4UHT A;  2KIM A;  4A6E A;  1J75 A;  3FIS A;  2Q1Z B;  4M9S A;  1ZAO A;  4KJZ A;  4RGU A;  4TV7 A;  4RLF A;  3RCO A;  3FXK A;  4ZZL A;  1UFM A;  4RAZ A;  3S3N A;  1F43 A;  2QQA A;  1YYV A;  2ISZ A;  2IW5 A;  2KP6 A;  3KP6 A;  3TDZ C;  4B44 A;  3UKG A;  3FZV A;  1TZL A;  2PLY A;  1P4X A;  4I2O A;  5FGM A;  1B9M A;  4F92 B;  1AKH B;  4HOB A;  4ZYE A;  2WAF A;  3L1P A;  2IEK A;  1WCM J;  2QVO A;  4BQQ A;  1SVL A;  2LY9 A;  2JA8 J;  5C3E J;  4ENM A;  3F72 A;  3I71 A;  2LK2 A;  4XK4 A;  5BPI A;  1R71 A;  4P96 A;  1OPC A;  3E5X A;  1SD5 A;  4XOP A;  2BVL A;  2QKL B;  4A5M A;  4B3A A;  2HR3 A;  1Y1V J;  3DQV C;  3O3K A;  1R1T A;  1HF0 A;  5CQE A;  1FT9 A;  3H3V K;  4ABZ A;  3TGN A;  2BZT A;  2GOX B;  3MN2 A;  3JRA A;  2DLL A;  3LA7 A;  2Z3Y A;  2MYS A;  3C2B A;  4MGR A;  3OYM A;  1HLV A;  2IT0 A;  3GTO J;  3VOD A;  2R0Q C;  1P4A A;  1OQY A;  3C2H A;  3QYB A;  3SDB A;  1ZAR A;  1PUF A;  2CUE A;  3HTU A;  1OCO H;  4PFP A;  2R7V A;  1W7P B;  3O8H A;  1Z6T A;  2B9S A;  1TQP A;  1Y8Q B;  2BW3 A;  2MFZ A;  1G3W A;  3LMM A;  3HPH A;  3OSF A;  2DN0 A;  1W5T A;  3Q0V A;  1P92 A;  3AAF A;  2ICW G;  4AID A;  3VYS B;  1F5T A;  1NG6 A;  4MNU A;  1WJA A;  3V7S A;  2M7B A;  3TMO A;  3LSR A;  5ED4 A;  1ACI A;  2QWW A;  2W1O A;  1OMI A;  2CQK A;  5DUK A;  4EM1 A;  2L54 A;  2O6G E;  3S16 J;  1S5L C;  2DBB A;  5IOZ A;  4HX7 A;  1IDZ A;  2GIZ A;  1SC7 A;  2K9Q A;  1X1B A;  3GTL J;  1K4T A;  3FXM A;  4FX4 A;  2KZG A;  2B7E A;  4LFU A;  4BDY A;  4ENN A;  3RPU D;  2KT0 A;  4L0Z B;  1XN7 A;  4G7H F;  5H6Q A;  3J7Z I;  2QBY A;  2V26 A;  5D8K B;  1QRY A;  2ESN A;  2HDD A;  2BXY A;  2XV4 S;  3ZQL A;  1OCP A;  2MH2 A;  4C3H J;  3AKZ A;  3PO3 J;  4A0Y A;  4HDV A;  4RAG A;  3HBL A;  2VJ4 A;  1X3Z B;  2ADU A;  2IA1 A;  5J40 A;  5LLQ A;  2ZJR F;  3OS1 A;  1ZYR F;  4M3E A;  1Z05 A;  3M1E A;  4AYB A;  3JRF A;  2JSC A;  2JJ7 A;  4OWR B;  3K2A A;  4A3G J;  1ZG5 A;  5JR3 A;  3HGY A;  2RNJ A;  2XPV A;  2H1L A;  1QNT A;  4AU7 A;  4CCL A;  2Y30 A;  3GW2 A;  4UV9 A;  2VXZ A;  3K4N A;  3ZRG A;  3ABT A;  4BY7 J;  2JA2 A;  3KYD B;  4FX0 A;  1PUE E;  2A07 F;  3BR6 A;  1WJC A;  3BRO A;  4MFD A;  4CCN A;  1KQ0 A;  1BI2 A;  1BIB A;  1TWF J;  1TWG J;  2O7O A;  4U0Y A;  2XAQ A;  1K78 A;  2R3S A;  1QZE A;  4CO8 A;  3LSP A;  3M07 A;  1PUF B;  2FQ4 A;  4UB6 C;  1TW3 A;  4XBF A;  2XGE A;  2GAU A;  1A6Q A;  5E8I A;  1GV2 A;  4OAY A;  1B1B A;  4AIH A;  3OSG A;  2BW3 B;  1IRZ A;  1LE8 A;  5KAI C;  2VJ5 A;  4RLQ A;  4G12 A;  4MEX F;  4HNU A;  5KCM A;  5IYC J;  2XAF A;  4L0Y B;  3QPL A;  4Q4Z F;  3GZ5 A;  4FE7 A;  3EPZ A;  5E8G A;  4OMY A;  1O3S A;  3RTR A;  3FX3 A;  5LHG A;  2HTJ A;  2L7F P;  4GYI A;  1F1Z A;  1I27 A;  3C18 A;  2BEO A;  2E35 A;  3E5Q A;  3I4N J;  3RIR A;  3PL8 A;  1QPI A;  2DK8 A;  3WTW C;  4FQG A;  3OOP A;  1PP8 F;  5K5O A;  5K7H A;  3I3L A;  1SD7 A;  1RUN A;  2K4J A;  3P9K A;  2KL4 A;  1G3S A;  3CDL A;  1DGR M;  2I8D A;  2M1B A;  2YS9 A;  2STW A;  3ZMU A;  2DMN A;  4DIQ A;  2HOT A;  3BR1 A;  2R7Z J;  2O61 A;  3DU5 A;  4DNC A;  1K61 A;  2MG4 A;  3FBN B;  3QAH A;  2QBY B;  2EH3 A;  2F4O B;  1OIS A;  4XN0 A;  4EJU A;  1MBF A;  4C2T A;  2H09 A;  2IS2 A;  4HNV A;  3PSF A;  2C6Y A;  4ZTF A;  4L9T A;  2P7V B;  2M87 A;  1VZ0 A;  3LSJ A;  1XMK A;  3ZCO A;  1MJ9 A;  2VJI A;  5F6F A;  2EPF A;  4UB8 C;  1YHQ I;  2BBY A;  3EUA A;  2CUZ A;  2FMY A;  2OF7 A;  4YFK F;  3K70 D;  2HPM A;  4EM0 B;  2KKO A;  2ZO4 A;  2R7U A;  1PJR A;  2K40 A;  1J2X A;  2PMH A;  3AG2 H;  4W1U A;  3U1D A;  1KA8 A;  1ETK A;  2GA1 A;  4JQF A;  5HLG A;  1X2N A;  2JSP A;  2CGP A;  4JYK A;  5B1B H;  3A01 A;  1OR7 A;  4RGX A;  3O8G A;  1JE8 A;  3H5R A;  2H8R A;  3VYR B;  3MQ0 A;  4N4O B;  5HVQ C;  2VUM J;  2V6E A;  1O57 A;  2FBK A;  1W0T A;  4D9J A;  2HU9 A;  2P81 A;  2PN6 A;  3RYR A;  1ZK8 A;  2NS0 A;  3DBH B;  3ECO A;  1P2F A;  3FXL A;  3G1O A;  1FMV A;  2E2I J;  2D45 A;  2UV1 A;  2RGV A;  2Y75 A;  4P1W A;  2XF7 A;  5J1R A;  3W6J B;  3LAP A;  3CLQ A;  5FJ8 J;  5LGN A;  5GPC A;  5ILS A;  5M5Y J;  1HA8 A;  2HI3 A;  3ABU A;  1ZN2 A;  3JRI A;  3QQA A;  4RAY A;  4HQE A;  2V9V A;  1K78 B;  2YX4 A;  3FK6 A;  2L9V A;  1ZRD A;  4BQN A;  2LR8 A;  2WB1 A;  1ULY A;  1ODD A;  1XD7 A;  2L9S A;  3LOC A;  4A3B J;  4AWX B;  4KA4 A;  1LE8 B;  2R7D A;  5IY5 H;  4MO7 A;  2DA6 A;  1FBS A;  2W4S A;  2CS3 A;  1JTY A;  5LFA A;  2ACJ A;  1PYV A;  5GP9 A;  2FXA A;  3ABM H;  3I5U A;  4NDL A;  1OCC H;  1W1W E;  4A3I J;  2M0C A;  3E6B A;  3RKQ A;  1SVO A;  3S2W A;  1WI9 A;  5L3C A;  4L18 B;  3BG3 A;  4Y15 A;  2DFF A;  5EDN A;  1JUP A;  5EEH A;  1MZB A;  3FDY A;  2R4G A;  1P7I A;  3ZXS A;  3MMY B;  2W24 A;  4I98 B;  1Z7U A;  2VI6 A;  2PBI A;  4WXD A;  2O3F A;  5B3S H;  5LRR A;  2JUG A;  4XRF A;  3SEQ A;  4NC7 A;  1R6R A;  4XKV A;  3JAM K;  1HSJ A;  5BOX A;  1I5Z A;  2A6T A;  2OQG A;  3ZQC A;  3TP3 A;  4A3E J;  2E1M B;  3NEU A;  3HOX J;  4HZF A;  1R22 A;  2KHM A;  3MKL A;  5D6E A;  1Z9C A;  4XIC A;  2COB A;  5EZH A;  3IAS 2;  4IHV A;  2VBY A;  2DA7 A;  1FP1 D;  2DYR H;  3DKX A;  4C2U A;  4E4H A;  3HXL A;  1MSE C;  2AXL A;  1Z7L A;  4LOC A;  3RQ4 A;  3ULQ B;  2RC4 A;  2QQ9 A;  3ISP A;  3H35 A;  3S32 A;  2OUM A;  3CUQ C;  1TLH B;  2JK3 A;  4O6J A;  3HZJ A;  4PGH A;  5CVU A;  2A69 F;  3A01 B;  1F4K A;  1VF9 A;  1E0E A;  1XG1 A;  4BH9 A;  3PIO F;  3CUO A;  1TBX A;  1A04 A;  1WJD A;  3BPX A;  5JFR A;  2LDU A;  5J3L A;  5D4S A;  1JGG A;  4HRI A;  3A02 A;  2FRH A;  1D5Y A;  3C1D A;  5B1A H;  4XRS G;  2IJL A;  4RB3 C;  4JX5 A;  2EIM H;  4HF2 A;  2Y0S N;  4A3D J;  2FML A;  4HF0 A;  1IN5 A;  2LFB A;  3RDI A;  2F48 A;  2K86 A;  3G1L A;  4HV5 A;  1K4S A;  2K27 A;  2DPD A;  4J00 A;  2VKD A;  3OIO A;  3SFZ A;  1DQU A;  2KJB A;  3Q5F A;  5FB2 A;  3BR2 A;  2R5Y A;  3OYL A;  5LHH A;  1GVD A;  3V4G A;  1BN5 A;  4IJA A;  3VYT B;  2XPW A;  1RES A;  4EMS A;  5GAD J;  3WE2 A;  2OBP A;  3HOV J;  2R7S A;  1NG7 A;  1G2H A;  3FXQ A;  1DU6 A;  3J7Y J;  1ZLJ A;  4GFB A;  2ZFW A;  2PMU A;  3HRS A;  2X85 A;  3G3Z A;  4D1Q A;  3X2Q H;  4HW0 A;  4M73 A;  2R7R A;  4YRV A;  3TP0 A;  3HOY J;  1LFP A;  1U0J A;  2JTV A;  4D5F A;  2XRN A;  4M3D A;  1X4O A;  5K5Q A;  4WXH A;  1H8A C;  4HEA 2;  4C9Y A;  2P5V A;  2ZCW A;  2ZSI B;  2VON A;  2FE3 A;  3I0T A;  3F6V A;  3JAM Z;  2FOK A;  3P7N A;  3QYE A;  1FTT A;  1SAU A;  3GFL A;  4NC6 A;  3BTL A;  2BYV E;  3BQY A;  1RET A;  5L3B A;  4IZZ A;  3BTJ A;  4XKC A;  3CC7 I;  2K9N A;  2E71 A;  4PJJ A;  2XKP A;  2HYJ A;  1F36 A;  3GTM J;  2UUZ A;  3J7A O;  3DCF A;  5HOO A;  1EH8 A;  3OYH A;  4CXF A;  2X51 A;  3HGG A;  1RNL A;  2ISY A;  1NHA A;  4RB2 C;  4KDP A;  4BXX J;  1VQM I;  3B02 A;  4II2 A;  2R7Q A;  1WH7 A;  3OIP A;  1D8J A;  4YIF A;  1VI0 A;  2Z1D A;  3RI4 A;  3WG9 A;  5JHF A;  3OWT A;  2PJP A;  3L7W A;  3QYF A;  2HEO A;  2O8K A;  1V5F A;  1JHF A;  3N05 A;  2DT6 A;  1SMT A;  3ZGK A;  3RSN A;  4LGW A;  2CJJ A;  3DP7 A;  5IPA A;  3DF8 A;  1YOV B;  4NBQ A;  2KRF A;  1T08 B;  3L00 A;  1VQP I;  2DTR A;  2XIG A;  4LB5 A;  1G59 A;  1JXS A;  3GFJ A;  3L2Q A;  1DU0 A;  2A3S A;  5IT3 A; 
#chains in the Genus database with same CATH homology
 1SAN A;  2MW8 A;  2NS7 A;  4D5C A;  3HEF A;  1MH4 A;  2M8G X;  3S1M J;  3HKZ N;  1F43 A;  4XRS A;  2JA7 J;  1JT6 A;  3BTI A;  4A3M J;  2DJN A;  1JUS A;  1MNM C;  3S1N J;  2MSY A;  1NK3 P;  3UKG A;  5IP6 A;  2L0K A;  2DA5 A;  3BQZ A;  3JR9 A;  1AKH B;  2R5Y B;  2NVX J;  4DYC A;  2EBI A;  5F1J A;  3L1P A;  2E1O A;  1WCM J;  2IEK A;  2LY9 A;  2JA8 J;  5C3E J;  3Q3S A;  4QSH A;  2LK2 A;  4XK4 A;  3IH2 A;  4BBS J;  4BKX A;  3BG5 A;  1B8I A;  2IAI A;  4B3A A;  1MBG A;  1HF0 A;  1Y1V J;  2CUF A;  2Y2Z A;  3H3V K;  4D7N A;  9ANT A;  4ABZ A;  3HOW J;  1U9O A;  3MN2 A;  1T33 A;  3JRA A;  1E3O C;  3C2B A;  4AC0 A;  1HLV A;  3GTO J;  2I10 A;  2R0Q C;  1PUF A;  2LLK A;  2CUE A;  2OPT A;  4FE4 A;  3O8H A;  4A3C J;  2FJ1 A;  4UUT A;  2DA1 A;  2JN6 A;  4C3I J;  4JX4 A;  1JKQ C;  3OSF A;  2DN0 A;  1O4X A;  1ENH A;  3Q0V A;  3LSG A;  5C44 J;  4AUX A;  2XB5 A;  1HOM A;  1FIP A;  1WGX A;  2VPR A;  3A03 A;  1BA5 A;  3LSR A;  1TC3 C;  2W48 A;  3SDG A;  2HOA A;  2TCT A;  2M34 A;  4M3B A;  1ZR4 A;  1HDD C;  3S16 J;  5IOZ A;  2AO9 A;  1IDZ A;  3MVP A;  2K9Q A;  2VKE A;  3GTL J;  4UUS A;  2CRG A;  3IH3 A;  2KT0 A;  3FIW A;  2AHQ A;  4FTH A;  1Z77 A;  1VFC A;  1SFO J;  5FKM A;  4DYR A;  1QRY A;  2HDD A;  4EEF G;  1GUU A;  3ZQL A;  1W0U A;  1OCP A;  2HOS A;  4C3H J;  3PO3 J;  5EGO A;  2XB0 X;  4M6V A;  1IG7 A;  3S1R J;  3HBL A;  2M2E A;  1JKP C;  1MSF C;  1IV6 A;  1QVU A;  1ZGW A;  1RPW A;  5C4J J;  3BR3 A;  4MIM A;  2GBY A;  2K9S A;  4M3E A;  4V2F A;  5E3M A;  2H8R A;  3GTK J;  3NAU A;  2EZH A;  3CMY A;  3JRF A;  5FKN A;  2JJ7 A;  3K2A A;  1GDT A;  4A3G J;  3Q0W A;  3HGY A;  3JRE A;  2XPV A;  3H0G J;  5IP7 J;  3LNQ A;  1Y1W J;  1GV5 A;  2Y30 A;  5F04 A;  5F08 A;  3BR0 A;  1B8I B;  2X48 A;  4BY7 J;  1JUM A;  5F0F A;  5EG0 A;  3BR6 A;  3FKI J;  4MFD A;  2DA3 A;  1ZTR A;  3WHC A;  4RDU A;  2L7M P;  1TWF J;  1X2M A;  1JTX A;  1TWG J;  2O7O A;  3S2D J;  2NS8 A;  4W97 A;  1EF4 A;  3LSP A;  5IP9 J;  2FQ4 A;  5M3M J;  4JP0 A;  1PUF B;  2XGD A;  1WH5 A;  3M4O J;  2XGE A;  2E2H J;  3S17 J;  5DTD A;  1ORK A;  1GV2 A;  3HB9 A;  3OSG A;  3RZO J;  1IRZ A;  5F0H A;  1FIA A;  4X1E A;  1LE8 A;  1WI3 A;  1JJ6 C;  4G12 A;  3OOU A;  1NK2 P;  5IYC J;  4RBO A;  2O9L A;  1JT0 A;  3QPL A;  1H88 C;  4FE7 A;  5M5W J;  2L7F P;  5J1Y A;  4CYC A;  5BNG A;  3I4N J;  4X6A J;  2EZL A;  1QPI A;  2VKV A;  2R5Z A;  4DYQ A;  2R93 J;  4MFE A;  3GTG J;  2E19 A;  1ETY A;  5K7H A;  5M3F J;  5FKK A;  1XS9 A;  2TRT A;  1IC8 A;  4UUS B;  3JRG A;  1U8B A;  1FEX A;  3CDL A;  2HXO A;  2YS9 A;  1A6I A;  1ETV A;  2DMN A;  4DW6 A;  2HOT A;  3BR1 A;  2R7Z J;  1QVT A;  1ETQ A;  1RKW A;  1K61 A;  2MG4 A;  5EZG A;  2Y31 A;  3GTQ J;  2EH3 A;  3BG9 A;  2DMP A;  1MBF A;  4FCY A;  1IDY A;  4HNV A;  2ECC A;  2NVY J;  2ZB9 A;  3LSJ A;  5E3N A;  5EGO B;  4QTR A;  3IV5 A;  5IOY A;  2B63 J;  3G1M A;  3SFI A;  2OF7 A;  5DS9 A;  2IBD A;  3GTP J;  2X6O A;  4AYB N;  2KDZ A;  2K40 A;  4W1U A;  1ETK A;  2DMQ A;  2ID6 A;  1X2N A;  1YRN A;  3HOU J;  5HOD A;  3D1N I;  4JYK A;  3A01 A;  1B72 A;  4IHX A;  1WPK A;  2XPU A;  3O8G A;  3ZQH A;  1JKO C;  2VUM J;  1TWA J;  1W0T A;  3ZQI A;  2M9H A;  2P81 A;  3WHB A;  4A3K J;  2JWT A;  3IH4 A;  1FTZ A;  1ZK8 A;  3G1O A;  2E2I J;  2G0E A;  5J1R A;  5K7Z A;  4J19 A;  3HOZ J;  5IYD J;  5FJ8 J;  5GPC A;  5EG0 B;  5M5Y J;  3BTC A;  2HI3 A;  3JRI A;  3QQA A;  4IHY A;  1UMQ A;  5FLV A;  4C2M J;  1BW6 A;  3FK6 A;  1U9N A;  3VPR A;  1APL C;  2LP0 A;  1K83 J;  2LR8 A;  1IJW C;  1ZR2 A;  3ZOB A;  1MBH A;  3LOC A;  4A3B J;  1ITY A;  1HDP A;  3B6C A;  1ETX A;  1CQT A;  1LE8 B;  2MGQ A;  4MO7 A;  1MBJ A;  2DA6 A;  1FJL A;  1JTY A;  1AU7 A;  5GP9 A;  3TW6 A;  1OFC X;  4BBR J;  3F0C A;  4NDL A;  2R92 J;  2WAQ N;  5C4X J;  4A3I J;  2M0C A;  3RKQ A;  2NVQ J;  2ECB A;  2YUS A;  4CYC B;  3BG3 A;  3BR5 A;  4B1R A;  5EDN A;  1JUP A;  2R5Z B;  1P7I A;  3ZQF A;  3NAR A;  5M5X J;  4IEJ A;  2NVT J;  3RZD J;  2HQ5 A;  2EZI A;  2WV1 A;  1BJZ A;  2VI6 A;  2LVS A;  1NTC A;  3JRD A;  4FIS A;  1S7E A;  1MBK A;  3CQZ J;  3JRC A;  1MH3 A;  2FX0 A;  1IGN A;  3ZQC A;  3QPS A;  3TP3 A;  4A3E J;  3HOX J;  4JX6 A;  4BY1 J;  3MKL A;  2DA2 A;  4A69 C;  1JJ8 C;  4XIC A;  1ETW A;  2COB A;  1MBE A;  5EZH A;  4IHV A;  2DA7 A;  3BT9 A;  1ETO A;  1MSE C;  3HM5 A;  5F27 A;  1TWC J;  1ZKG A;  2LTP A;  4M3G A;  2E2J J;  4LOC A;  2RAE A;  3JRB A;  2DMT A;  2JK3 A;  1YRN B;  3A01 B;  1B72 B;  1VF9 A;  5JLX A;  1XG1 A;  2D5V A;  3S15 J;  1LFB A;  2DTZ A;  2ID3 A;  3E7L A;  5J3L A;  2N8G A;  1JGG A;  3A02 A;  5F0C A;  4I6Z A;  1X58 A;  1BL0 A;  1D5Y A;  1TWH J;  2FD5 A;  2PMZ N;  2JMW A;  4XRS G;  4JX5 A;  5E3L A;  3I4M J;  3S2H J;  2ME0 A;  2Y0S N;  1I3Q J;  4M3F A;  4V2G A;  4A3D J;  2XGC A;  3SJM A;  1A5J A;  1POG A;  2LFB A;  2NOG A;  3G1L A;  1UG2 A;  2H1K A;  3S14 J;  3PM1 A;  1GT0 C;  1I6H J;  1BW5 A;  2WB1 N;  1H89 C;  2XSD C;  2LD5 A;  3GTJ J;  1OJL A;  1OCT C;  3OIO A;  2JA5 J;  1XC5 A;  3BR2 A;  1AKH A;  2R5Y A;  1ZQ3 P;  3K7A J;  1GVD A;  2LKX A;  4L5E A;  4A3L J;  2XPW A;  1RES A;  1VND A;  2X9D A;  3HOV J;  2Y9Y A;  4Y7N J;  1P7J A;  4Y52 J;  4C3J J;  1G2H A;  3S1Q J;  3FK7 A;  1DU6 A;  4DZP A;  1Z0X A;  2CQX A;  2QCO A;  4GFB A;  3M3Y J;  2ME6 A;  4I76 A;  4D7M A;  1DU0 A;  1LFU P;  3TP0 A;  4B4C A;  4IHW A;  3HOY J;  4D5F A;  5FLM J;  5K7F A;  2CQQ A;  3RQI A;  3PO2 J;  4M3D A;  2XRL A;  1T56 A;  1H8A C;  5FKO A;  1U78 A;  4MLO A;  5EYR A;  3CCY A;  1JKR C;  2L9R A;  5J1U A;  1FTT A;  5IYB J;  3BTL A;  2QF7 A;  3BQY A;  1RET A;  5E3O A;  4XID A;  3BTJ A;  1R9T J;  2HXI A;  4A3F J;  2K9N A;  2CU7 A;  2DMU A;  1RR7 A;  1F36 A;  2HYJ A;  3GTM J;  4A93 J;  4XRM A;  2JA6 J;  3DCF A;  2GLO A;  3DEW A;  5GPA A;  3TED A;  1Q1V A;  1AHD P;  3HGG A;  3JRH A;  4BXX J;  4A3J J;  5EF6 A;  1WH7 A;  2ELK A;  2Y9Z A;  3W6V A;  1VI0 A;  5JLW A;  5FKL A;  3ZQG A;  1I50 J;  3B6A A;  1RKT A;  4S0H B;  3HDD A;  2O8K A;  1IUF A;  1UHS A;  3Q0U A;  2YU9 J;  2CJJ A;  2DA4 A;  1HCR A;  4DZJ A;  5IPA A;  3GBG A;  2EQR A;  2EZK A;  2GM4 A;  4QIW N;  2L7Z A;  5EEA A;  3FIS A;  3TW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...