1ETWA

The crystal structure of e. coli fis mutant g72d
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
77
Chain Sequence
DVLTVSKPLRDSVKQALKNYFAQLDVNDLYELVLAEVEQPLLDMVMQYTRDNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 28
structure length 77
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etwA00
1SANA 1FTTA 3PM1A 2HQ5A 4IEJA 5EZHA 1X2MA 4EEFG 1H88C 3HOUJ 2NVQJ 3QPSA 1QRYA 1FTZA 5FJ8J 2MSYA 3S1QJ 2YU9J 3JRBA 1BW6A 2R93J 3SJMA 9ANTA 2M2EA 2E2IJ 1MBEA 3B6CA 4MO7A 5M3FJ 2LD5A 4IHVA 3Q0WA 3RKQA 3QPLA 4J19A 4MFDA 3TP3A 1TC3C 5C44J 4XRSA 1NTCA 1ZTRA 1GV5A 2O9LA 1GV2A 1WCMJ 1YRNB 1JTYA 2XGEA 1ITYA 3JR9A 2IEKA 2JA5J 4I76A 1VFCA 5GPAA 3JRIA 2LY9A 4M6VA 4NDLA 3JRAA 3JRFA 2R7ZJ 1O4XA 3S16J 1JUMA 4M3EA 4A69C 1ETWA 2L0KA 3BQZA 5F04A 1ZK8A 4V2FA 3JRHA 1A5JA 2DN0A 3GTKJ 4CYCA 2VI6A 1FEXA 3FIWA 4QIWN 3LOCA 1PUFA 2OF7A 5FLMJ 2R0QC 3BQYA 1CQTA 5M5YJ 2CJJA 2JA6J 3OSFA 4BKXA 5E3MA 4JP0A 1ETQA 1F36A 4BY7J 2EZLA 3ZQHA 5C3EJ 4M3DA 3IH2A 1T33A 1FIPA 2W48A 1E3OC 3L1PA 2Y30A 3OIOA 3HGGA 3QQAA 4D5FA 1VF9A 1XC5A 3GTMJ 3HDDA 4A3JJ 5J3LA 3I4NJ 4UUSB 5F1JA 1T56A 3PO3J 3A01A 2Y31A 1ZQ3P 2E1OA 2PMZN 1B72A 5K7FA 4A3LJ 3S1MJ 2JMWA 1ENHA 5K7ZA 1JUPA 1IJWC 3HOYJ 1TWGJ 1JJ8C 2HYJA 2GM4A 4XICA 2LVSA 1RR7A 4W1UA 3LSPA 2LLKA 2LTPA 1JT6A 1LE8A 1IV6A 2K40A 2X48A 2CRGA 1QPIA 3G1OA 3OOUA 5M3MJ 4DYRA 4BBSJ 2ZB9A 5IPAA 2FX0A 2MGQA 3BR1A 1QVTA 3TW6A 1SFOJ 1K83J 3S1RJ 2M0CA 3DCFA 2E19A 2LFBA 3OSGA 3HKZN 4Y7NJ 2KT0A 1JTXA 3LSGA 1TWCJ 2HOAA 3F0CA 5IOYA 1JKQC 1GDTA 2K9NA 2YUSA 3BR3A 5DTDA 2ME6A 5F0HA 2XGCA 1IDYA 3GBGA 5EF6A 5FKMA 2R92J 2VPRA 5C4JJ 4JYKA 4AYBN 1ETVA 1JUSA 4LOCA 5GP9A 3BTJA 1HF0A 3ZQFA 1JT0A 1P7IA 5FLVA 5IYCJ 1BJZA 4GFBA 3G1MA 1JKRC 1HDPA 5EDNA 4L5EA 2I10A 3RZOJ 1DU0A 3PO2J 4DYQA 4BXXJ 1H8AC 3LSRA 2NVTJ 4JX5A 2LKXA 1MSEC 2X9DA 2DMQA 4S0HB 3HOXJ 2WV1A 3I4MJ 2EQRA 5IYBJ 2XPUA 4Y52J 1MSFC 4M3GA 5J1UA 3K7AJ 5EGOA 2ID3A 5M5WJ 3G1LA 3JRDA 4XIDA 4D7MA 3CCYA 2R5ZB 4MFEA 4A3GJ 5M5XJ 4JX4A 2JA7J 2ID6A 2EZIA 3K2AA 1TWHJ 1GVDA 4A3CJ 1HDDC 2NOGA 1MBKA 3CMYA 3RQIA 3B6AA 2XGDA 2O7OA 2HXIA 3MN2A 2DMTA 2XPVA 1RKTA 3IH4A 4M3FA 4B3AA 1XS9A 1RKWA 1U78A 1BL0A 2Y9YA 4C2MJ 3W6VA 4V2GA 2QCOA 1AKHB 3BTIA 2DA1A 2EBIA 2DJNA 3S14J 2R5YB 3M4OJ 1IG7A 3BG9A 2NVXJ 3FK7A 1WI3A 2MG4A 1HOMA 3MKLA 3SFIA 5GPCA 4A3KJ 1YRNA 4RBOA 2ME0A 4A93J 2FQ4A 4FE4A 1F43A 4BY1J 1LFBA 4FTHA 2IAIA 1I6HJ 5E3OA 4M3BA 3M3YJ 2EH3A 1IRZA 2MW8A 3E7LA 3VPRA 1ZR2A 3RZDJ 1MBGA 1JKPC 3JRGA 2DMUA 3LSJA 3O8GA 3NARA 1HLVA 2DA3A 2EZHA 1B8IB 2CQQA 3BG5A 1EF4A 3IH3A 1WPKA 2LP0A 1D5YA 1W0TA 4ABZA 2HI3A 4X6AJ 1BW5A 4MIMA 4XRMA 1ZR4A 5E3LA 1ETYA 3TEDA 1FJLA 3JREA 3Q0UA 2ECCA 1MBFA 1P7JA 4DYCA 5EG0A 2M8GX 1GT0C 1IDZA 3GTJJ 4A3MJ 2DA4A 2WB1N 3S15J 2Y0SN 1I3QJ 4UUTA 3UKGA 1POGA 4UUSA 3CDLA 2CQXA 2D5VA 2XB5A 2X6OA 2EZKA 2GLOA 2ELKA 1LFUP 5DS9A 1OCTC 2HOTA 3H3VK 2NVYJ 1QVUA 3NAUA 2AO9A 4DW6A 1HCRA 3Q0VA 2ECBA 4XRSG 4G12A 1U9NA 5IP7J 2N8GA 2LR8A 1GUUA 2XB0X 1NK3P 1OFCX 2DA7A 1JGGA 4C3HJ 2HXOA 2HDDA 5F27A 3WHBA 1I50J 3BT9A 1TWFJ 5IP6A 3S1NJ 4MLOA 4W97A 1W0UA 3BR6A 2LK2A 1OJLA 1NK2P 5F0FA 2VUMJ 4CYCB 3HBLA 3ZQIA 1WH7A 1VNDA 4BBRJ 1BA5A 2TCTA 4AUXA 1PUFB 3HEFA 3S17J 3FK6A 2E2JJ 4D5CA 2K9QA 4QTRA 5IOZA 4XK4A 1UHSA 5C4XJ 4C3IJ 3SDGA 1XG1A 3LNQA 2FJ1A 4JX6A 3TW7A 2DMPA 1OCPA 4IHWA 2KDZA 2JWTA 1ETKA 5BNGA 3HM5A 1Y1VJ 3GTOJ 5E3NA 4HNVA 2CUFA 5FKNA 4I6ZA 5IP9J 1MBHA 1ETOA 1ORKA 1Q1VA 1S7EA 3HOZJ 1A6IA 2M34A 1ZKGA 3CQZJ 1RETA 4FCYA 4DZPA 2IBDA 1MNMC 3HOWJ 1MBJA 4A3IJ 3IV5A 5EEAA 3ZQGA 2NS8A 3WHCA 1G2HA 3A01B 2L7FP 1Y1WJ 4IHYA 2L7ZA 4AC0A 3BG3A 3D1NI 2QF7A 1B72B 2DTZA 2JA8J 3O8HA 2RAEA 2OPTA 2JJ7A 2XPWA 2TRTA 1Z0XA 3HOVJ 2CU7A 3C2BA 2B63J 4C3JJ 4IHXA 2HOSA 3HB9A 2H8RA 1IC8A 1WH5A 1H89C 3GTPJ 1IUFA 4FISA 1LE8B 1UG2A 4X1EA 3BTLA 5JLXA 4RDUA 1RPWA 2R5ZA 3JRCA 2M9HA 5F0CA 2AHQA 2O8KA 1VI0A 4A3FJ 5EG0B 5F08A 3A03A 2WAQN 5FKOA 3BR2A 5FKKA 5EYRA 3S2DJ 4A3BJ 2L9RA 3GTGJ 2Y2ZA 4A3EJ 3ZQLA 3BR0A 1DU6A 1AKHA 5J1RA 1X58A 2G0EA 2FD5A 3BR5A 3ZOBA 1ZGWA 5K7HA 2R5YA 1R9TJ 5EZGA 1X2NA 1FIAA 2XSDC 2DA2A 2JK3A 2VKVA 1RESA 2GBYA 5JLWA 2E2HJ 3S2HJ 3MVPA 1AU7A 3A02A 5FKLA 4B4CA 1AHDP 1U9OA 3TP0A 3GTLJ 1MH4A 2L7MP 3Q3SA 1IGNA 2K9SA 3H0GJ 2XRLA 3DEWA 4A3DJ 3BTCA 3ZQCA 3GTQJ 3HGYA 1JKOC 4B1RA 1B8IA 4DZJA 1U8BA 1TWAJ 1UMQA 4QSHA 2YS9A 1ETXA 2DA5A 4D7NA 1MH3A 2P81A 3FISA 2Y9ZA 1JJ6C 1APLC 1WGXA 2CUEA 5IYDJ 2DA6A 5EGOB 1Z77A 3FKIJ 2JN6A 5HODA 1K61A 2H1KA 2COBA 2DMNA 2VKEA 4FE7A 5J1YA 2NS7A
chains in the Genus database with same CATH superfamily
2IS6A 2QGUA 3I55I 4H0EA 4A0ZA 4Y15A 5EEGA 3PM1A 4U7DA 2H27A 4ZYGA 2VT3A 2HQ5A 2LY2A 4IEJA 2ZMEC 4Y33A 4PFOA 4U0VA 2R7UA 2NNYA 1SFKA 1WJCA 2MFZA 3CCQI 4A0XA 3HOUJ 3J80Z 1ZH5A 1FTZA 1QRYA 4IRGA 1ACIA 5FJ8J 2MSYA 4OAZA 1H0MA 2YU9J 2W00A 1OMIA 1BW6A 1Z3XA 2UXNA 1Z91A 2E2IJ 4P55A 1OCCH 1HA8A 4CZZA 2E35A 5KAFC 4U0YA 3HPHA 3AG3H 5M3FJ 1FNNA 4RGSA 3Q0WA 2MH9A 2CFXA 5GTHC 5FB2A 3WTUC 5HDGA 4XRSA 2E7WA 1ZTRA 2O9LA 4N9HA 1WCMJ 4II3A 5D6EA 1T08B 2WBMA 4MGRA 2I5UA 1BR2A 1TNTA 4CSWA 3VOEA 2IT0A 1MD0A 3OYGA 1O4XA 3KZZA 2JTVA 3S16J 3GCMA 1OR7C 2G7HA 2ZJQF 3M7GA 4V2FA 5FGMA 3GTKJ 2E1MC 4GO1A 4CYCA 2FNAA 4QIWN 4Z2YA 2DYRH 2V4JC 2VBWA 1VQOI 3WTZA 2YR2A 5D6FA 2B0LA 1YLFA 1FSEA 5E20A 2R0QC 2OCCH 3DEEA 2BYVE 2CJJA 2JA6J 2DOEA 2GAUA 3K4JA 4R1HA 3IWFA 4ESBA 4BHBA 5E3MA 2JUGA 1LUJB 2ZJPF 3I59A 3MD2A 5C3EJ 3TL4X 1V5FA 3IH2A 3EUKL 4M9XA 1X1DA 4N9IA 2W4SA 2HOEA 1HW1A 4RAZA 3SDBA 3GTMJ 1RNLA 1MKMA 3A01A 4AVPA 5FROA 2E1OA 2ZJRF 3V7CA 2A5WA 3C3WA 4LIVA 1B72A 1OCRH 3JCUC 2QEXI 4ZDLA 4ENNA 1IJWC 2X6YA 4XICA 1AOYA 2MYSA 4RLQA 3CJNA 1K6OA 1WHUA 2K40A 2LKSA 3LMMA 3VSLA 5K5OA 3G1OA 3CD6I 1WSUA 2JZYA 3HZJA 2VQGA 1W36C 4KYWA 3DEUA 4QWQA 1ZELA 5LFAA 2BOLA 3WGHA 3OL3A 1XGOA 1TT5B 1BIAA 1YJNI 4KN7X 5IPAA 1KQ8A 2ZXJA 3QWLA 3JSOA 3FF5A 3TW6A 3OYLA 1SFOJ 1MMAA 1X1AA 2MH2A 2PG4A 3R6SA 3OSGA 3EPZA 3HKZN 3GYHX 5E79C 2HOAA 3CUQB 3GXOA 1JHHA 2PMUA 4RGRA 2GIVA 3GUDA 3T5XA 2K9NA 2DJIA 1UELB 2DO7A 2CWEA 2PLYA 5DTDA 2R92J 1ON1A 1WJDA 4DNCA 4EATA 5GP9A 1HF0A 1UB9A 1XMAA 2GQQA 4R8HA 3ZQFA 3CJRB 3KPHA 3FDYA 1P7IA 3D5RC 5IYCJ 5FLVA 2L02A 2PQ8A 3SEQA 1PVEA 3VB2A 3ZRGA 4J01A 2VB6A 1VQ8I 4GFBA 2ZFWA 1U5TB 2KIMA 3VYRB 1D3YA 1A31A 1XGSA 2K5CA 2LOOA 4YFXF 4RAFA 2ZCWA 3FX3A 4S0HB 2DAOA 4HOBA 2KIQA 3I4PA 5CQEA 1WJEA 1G3TA 3HHHA 3K1MA 3HJEA 3NWTA 2QVOA 2V9PA 2XPUA 1WI9A 3OYKA 5J8CA 3K4CA 5L3FA 3QP5A 5M5WJ 1YX3A 1S72I 3CCYA 2CV0A 3I56I 4AWXB 3M8EA 5M5XJ 1DP3A 4Y4RA 2JA7J 4EV0A 2Y0MA 3K2AA 1TWHJ 4QPQA 2NOGA 3DPTA 1MBKA 3GW2A 5H6RA 1KU3A 3B6AA 3PSFA 2HVRA 2HXIA 1S6LA 2XPVA 3IH4A 1TBXA 3A2KA 1T98A 2EFNA 3MWMA 2VQLA 2Y9YA 4E7JA 3VWBA 3BTIA 1FBUA 5E8IA 3KZYA 4YIFA 3CC2I 5F1RA 1RZ4A 1NH3A 1G4DA 3S14J 5DDGA 2B9SA 1IG7A 3RPUA 3FK7A 2L54A 2A07F 3ZMUA 3FWEA 1HOMA 3MKLA 3SFIA 1WWXA 3H0DA 2PMZA 2ZNZA 2LBFB 3AL0B 1YIOA 4FE4A 1FOKA 4BY1J 1D8KA 4XLPF 3K70C 4ZZDA 2R7FA 1I6HJ 3KLNA 5LHGA 1UG0A 3EUAA 3CF5F 1OPCA 2VJJA 1FY7A 5TRDA 4NBQA 1IRZA 3VPRA 1W7PD 1N77A 4E7KA 1MBGA 4L18B 4Q47A 1QBJA 1UCRA 3REOA 1DQUA 5DM7F 3JRGA 1BOAA 4EGYA 4MHGA 4QPOA 3NARA 3LSKA 3KZIC 1B8IB 1ZAOA 3DP7A 3WU0A 3OYAA 2QQAA 2VBYA 2IS4A 1TT0A 2LP0A 2HI3A 2KRFA 3RSNA 2R7QA 3BZ6A 1ETYA 4D9JA 3BPVA 5AONA 2CW0F 2ECCA 2DLLA 1MBFA 1P7JA 2JSPA 4ITVA 4DYCA 4YG2F 1GT0C 4P1WA 3T1BA 5HVQC 1VQ7I 2XF5A 2OBPA 2QSGX 3FM5A 1T6SA 2CQNA 3B02A 2E1NA 1MMDA 1T38A 1TLHB 2ADUA 2Y0SN 3KEYA 4KA4A 4AYBA 4U87A 3LAPA 1BM9A 3GZ6A 5H20A 2RNGA 4A6EA 1BC8C 2M4GA 2ZSHB 3ZMZA 2ELHA 3L9FA 5KVRA 1YQAA 5HLGA 3LWFA 4AU7A 1QVUA 2Z99A 1HCRA 3Q0VA 2AXTC 2X4HA 4BE1A 4CHUA 3VDXA 3U1KA 3G71I 2GIZA 1YJWI 2IS2A 4RAYA 2LR8A 4HSRA 1K6YA 4C30A 1KQ0A 4LMYA 2ZC2A 3DU6A 1JGGA 5D8LB 5F27A 3K4NA 2IJLA 1QA6A 4W97A 1FSHA 2YPRA 2W1OA 4E70A 4FETA 3N97A 2Q1ZB 5FO5A 3P9CA 2VOOA 1EH8A 4P9UA 2EV6A 4HF2A 4YIRX 2M30A 3FXKA 2ZXWH 3ZQIA 3GZ5A 5GTIC 4CCMA 3CUQA 3HOSA 3RPUD 1PUFB 1J2XA 4C2TA 4KMUX 4BJTA 4QTRA 1IN7A 5C4XJ 1C0WA 2F5VA 3TGNA 1MDMB 2KDZA 1OYWA 3F21A 3HM5A 3OYDA 2IRFG 2WAFA 1S7AA 1MNDA 4H4KC 3RKXA 1YITI 3FHZA 4I6ZA 2GZWA 1ZGJA 2AS5F 2K86A 1ORKA 1Q1VA 4FASD 3BY6A 4EQQA 2OTJI 1P4WA 3OS2A 2M34A 2IBDA 1FPQA 2ZJ2A 3FHNA 3FMQA 2DCEA 3DPUA 3GF2A 3IV5A 2K85A 1U5TA 5HDNA 2OAZA 2NS8A 3MEXA 2PBIA 1G2HA 4DBQA 4D0PA 1Y1WJ 3TOBA 4Q48A 4IHYA 4AC0A 3TQNA 2VXDA 3DWLE 3P9KA 3HSFA 5DCFA 2ZXHA 4E7LA 4S05A 2FQ3A 1FLIA 2Z5UA 4UUVA 4HF0A 3MZ8A 1Z0XA 2LDUA 3SEZA 2B63J 1OKRA 4IHXA 2UZKA 1A36A 2WADA 3HPGA 2CGPA 2H8RA 3GTPJ 4HX8A 2JUCA 1LE8B 2EIKH 2DFIA 3F8NA 4X1EA 3BTLA 3OYCA 4YFNF 2AHQA 2EPFA 3J80K 1IRXA 2NVUB 3SXYA 4I09A 1Z7UA 3E5QA 4A3FJ 1ZG5A 1VQ5I 2WAQN 5FKOA 1O3SA 1VQLI 3U9GA 5HOOA 3H5RA 4XLFA 3MCZA 5CJ9A 2IVMA 1QO0D 5JHUA 3U2RA 4P5OA 4S04A 2L9RA 2P5VA 1UZCA 5KNLA 1Z9CA 2H1LA 4LG3A 2QQ8A 1ZN2A 4EM2A 3FXRA 3QOPA 3RQ4A 2QQ9A 2FD5A 1QZEA 2WB1A 3D5SC 3CCSI 1MMNA 1K79A 1O3RA 1R9TJ 2HZDA 1HC8A 3CF2A 1DGRM 1D8JA 2VKVA 2IGKA 5LEKA 2PJRA 5GAHJ 3CLOA 2IW5A 2LBFA 3HXLA 2E2HJ 2HVSA 3KP7A 2H94A 2CS3A 3MVPA 1AU7A 3T8RA 3RCOA 3DKWA 2XAHA 1HW5A 1AHDP 2F5EA 1U9OA 2VE8A 3GVAA 4XMYA 3PUFA 1OYYA 4HRIA 4YRVA 4IKFA 3R4KA 2VQCA 1WJFA 4E7ZA 2UXXA 3H0GJ 5AIQA 2GOXB 4KN4X 3G2BA 3N05A 2HQNA 2VLAA 2GXAA 3E3VA 1A04A 4B1RA 1B8IA 3S93A 1BI2A 3J81Z 2XSJC 2DK8A 4D7NA 2P81A 1JJ6C 1IF1A 2KRHA 2KPMA 4ZYDA 1WGXA 2CUEA 4CYDA 3KP2A 2DA6A 1QHGA 4I99C 1YJ9I 5J4YA 4KDPA 2DMNA 4FCYA 4ZZLA 2V6CA 3LSTA 3U21A 5LHHA 3QU3A 1FTTA 1IXCA 3ABKH 3IHUA 4MQVA 5DD4A 3ZN0A 1X2MA 4WX9A 3CJTB 1SD4A 2KISA 3WGGA 1HKTA 1HSTA 4MQ9F 3IL2A 9ANTA 2M2EA 3MKYB 5HDKA 4N4NB 2O3FA 2V1NA 4MFDA 1O3QA 2KJCA 2XKOA 1TC3C 1OCOH 2KIUA 2CW8A 4LLNA 4XNFA 2VBXA 3ESWB 1GV5A 3OR1C 5KK1A 1JTYA 2F4MB 4ZYEA 3JR9A 5HS9A 4UHTA 2H6CA 4MEXF 4I76A 1L0OC 4M6VA 4NHJA 3JRAA 5DYMA 3JRFA 3E6BA 5ILVA 4NQWB 2GXGA 1ETWA 5EEHA 1XGNA 2L0KA 3BQZA 5K1YA 1ZK8A 1A5JA 2QQBA 5DCMB 2WY7Q 1W36D 3WODF 2DXIA 2X1CA 1BJAA 3PNYA 3MKWB 2EB7A 1PUFA 4ENMA 3I9V2 3QODA 3RPQA 1VQKI 1S9HA 1LVKA 2DPDA 5LRSA 4KIFA 1SVLA 3F3XA 1MDMA 1Z6RA 3OSFA 1KU7A 4BKXA 4ZTJA 4NB5A 3PIOF 2VIXA 1P9QC 1TW3A 2VASA 4JP0A 5FFZA 2MC3A 3CDIA 2EZLA 1MGTA 1FIPA 2F6CA 2W48A 2EWNA 2Y30A 3Q5FA 3OIOA 4XSZF 3GLXA 3HGGA 3HTSB 1SFEA 1HBXG 3X2QH 5CPRB 3OL4A 4UUSB 3PSIA 4A5MA 2ICWG 5F1JA 3PO3J 1W1WE 2LKPA 1B6AA 4EJVA 4RGUA 3OYNA 3HSRA 4EGZA 3AFHA 1JUPA 4L9TA 3ZQQA 4UNOA 2ESNA 3I71A 2DYSH 4RB2C 1CGPA 1AWCA 3NQOA 4W1UA 3LSPA 1LE8A 3ABLH 1IV6A 2HVQA 2R3SA 2X48A 2YX7A 2GXBA 1ODDA 2K4BA 3OOUA 4LG0B 4XLAA 2IS1A 5M3MJ 4KT6A 3KP3A 3T0YA 5GAEJ 2QSFX 1YIJI 3QOEA 4BBSJ 2D1HA 3JAMZ 1IZ1A 4XM3A 1V3FA 2A6HF 4I98B 1QVTA 3S3MA 2R7TA 2XAGA 3K1NA 2XAJA 4GYIA 3MQ0A 3DCFA 2E19A 3O2PE 4P9FA 3OYFA 3GEZA 2LFBA 1Q1HA 3ABMH 4E7HA 1JTXA 3F6VA 4HNTA 4KMFA 3JW4A 5IOYA 4OIRF 5F6FA 2Z3YA 1IN4A 1K7AA 3P7NA 3ZQ7A 4BQAA 2UUZA 3KP6A 2XDVA 3E5UA 5F0HA 2XGCA 1YE9A 2HTJA 1ZLJA 1IDYA 3GBGA 2L2OA 2P8TA 5FKMA 1O7FA 5ILUA 5K5QA 2IGOA 3IRRA 1JUSA 1Z7LA 1IV8A 4AIDA 3BTJA 2P0WA 2P4WA 3PFIA 5J47A 1BN5A 4D1QA 3CC4I 2E34A 2EA2A 5BQTA 1G59A 2DOAA 3OV8A 1V5GA 2I10A 4PSWA 2O61A 2XAUA 4HDVA 1MMGA 1BBYA 4BXXJ 3ABTA 2X1EA 1H8AC 5TJJA 2NVTJ 3K70D 4ESJA 1MSEC 4CO8A 2J5OA 2J5PA 3BCBA 1N25A 2X9DA 1XDSA 5CYVA 1FYKA 1J75A 3I4MJ 4AIKA 4PSXA 4DQ2A 2HZTA 1R71A 2K3FA 4ZDPA 4G9YA 2F48A 4PDKA 3RKYA 2VN2A 2DFFA 4NC8A 1QNTA 2ID3A 2WC2A 1QPMA 3JRDA 4XIDA 4D7MA 1LDJA 1KU9A 4MFEA 4A3GJ 2V9KA 4JX4A 2MA3A 1MJAA 1EH7A 1V55H 4Y3OA 1GVDA 4BAYA 1IRGA 4RB3C 3K6GA 3WU2C 1IN8A 1BR4A 4ZYAA 1LKXA 1JHFA 2CH0A 3Q9VA 3K1PA 2DMTA 3M8FA 3OS0A 3SHFA 2Q8KA 4RMNA 1U5TC 1IN5A 3K10A 1REPC 4V2GA 1MW7A 2NOJB 2EBIA 3ERMA 3R0JA 2R5YB 1X1PA 3S32A 3IWZA 2QSHX 4JOMA 3Q9SA 3BROA 3F9KA 3RJPA 3ZMSA 3G4SI 3K9TA 4BDYA 2KHMA 5IT9Z 3S2WA 5JI6A 3QU6A 4II2A 3AAFA 4DBRA 4BU2A 1K4TA 2L9VA 4WXHA 4F91B 2CMPA 4BACA 4NQWA 1XPXA 3M3YJ 3D0SA 3LFKA 1ZR2A 1XDUA 1JKPC 5DCMA 3T8TA 2ACJA 2Z33A 1D0XA 1YW7A 1M1EB 1ULYA 3O8GA 3V8KA 1R23A 1XCVA 2BY2A 4RS8A 2E5ZA 4M74A 3PQKA 4QLCU 5KHDA 2CQQA 3BG5A 1EF4A 3IH3A 4IL6C 1A35A 1FT9A 1W0TA 4ABZA 1BW5A 4MIMA 4N4OB 4GDFA 2HYFA 3HKZA 2LH9A 1CF7B 1ZG1A 1PYVA 4L9VA 3UNGC 4OIQF 4FX0A 3GTJJ 3ABUA 1IDZA 1LEAA 3O3KA 3WU1B 2PI0A 3ECOA 1EJ9A 3OYMA 4A3MJ 2I8DA 3OYHA 3CMMA 3BC8A 4EMSA 1I3QJ 5ICEA 2EILH 2VKDA 4UUSA 4CICA 2IA2A 2XB5A 3GWZA 2RV8A 2X6OA 1F5TA 5DS9A 3S8PA 2XRNA 2MLKA 2STWA 2MC4A 5LGUA 3E6DA 3H3VK 1SVOA 2K3PA 3BDDA 3R61A 1ERDA 2HEOA 2GWRA 2MD5A 5FRMA 1Z3YA 3HRMA 4HA8A 2BEOA 4G12A 1U9NA 2QLZA 3IRQA 4LJZF 1GUUA 4B8XA 4HQMA 1OFCX 2HDDA 4G7OF 5E1ZB 2HXOA 2E1CA 4LG0A 1LEBA 2LSOA 1I5ZA 4E7SA 1I50J 3IKVA 2P5LC 4IRIA 3JTHA 5LEJA 1W0UA 3QAHA 3BR6A 1OCZH 2GA1A 4EJWA 4F55A 1RUOA 2VUMJ 3TDUC 3HBLA 1O3TA 4UY8I 3CMEI 1WH7A 2HKOA 4BBRJ 2MLGA 3V7RA 1SD7A 1VQNI 1BA5A 2P6SA 3VSKA 1KONA 2WAEA 3HEFA 3S17J 4I2OA 3L2UA 2E2JJ 4D5CA 1GVJA 1ZHFA 1PUEE 5IOZA 4XK4A 4C3IJ 1P4AA 2FJ1A 3TW7A 3CP2A 4XN3A 2JWTA 1ETKA 2HR3A 5BNGA 2OU2A 3H9GA 2AXLA 5D5XB 4KFCA 3IAS2 5E3NA 2CUFA 3H9QA 5IP9J 1ETOA 5D4SA 1A6IA 4YIIA 3GMEA 1RETA 3BJ6A 2P7VB 2O5RA 3PL8A 2RVCA 2LRDA 3WTTC 3QYBA 4A3IJ 2O8XA 4XRFA 3J81K 4BE0A 1RRJA 2K9LA 5EEAA 2IA1A 2ZBKA 1QZZA 3WHCA 1G3SA 4XOPA 3FMRA 4N0BA 3ZMTA 1PP8F 1D1CA 3EUHA 2FMLA 2M1BA 1R5ID 4KUMA 3D1NI 2LG4A 2JA8J 3O8HA 2RAEA 2OPTA 3L2WA 2XPWA 2CV2A 1ZYRF 3DBRB 4L0YB 4IO9F 3C2HA 4C3JJ 3CCUI 1Y0NA 3HB9A 1P2FA 4C2UA 2FF4A 1WH5A 4UV9A 4BJ5C 4CA0A 1IUFA 3FXJA 1KQ9A 3LSMA 5JFRA 5CQGA 1Z21A 4ON0A 5JLXA 2YSRA 2F5FA 3K4LA 3RKWA 4OOIA 3JRCA 1FYMA 3KEQA 5F0CA 4V19K 1R00A 3FXLA 2XAFA 2WY8Q 1H9GA 2X1DA 2YU3A 4F52A 4RLFA 1SD6A 1Y39A 2DFHA 1YOVB 5EG0B 5F08A 4XONA 1SFXA 2DDBA 2D45A 5FRNA 5ICGA 3RYPA 1DGWY 3OIQA 4I01A 2NAZA 1I3AA 3GTGJ 2V79A 2DFEA 3LA2A 1X4OA 2Y2ZA 4A3EJ 2WWYA 3BR0A 2P7CB 2PJPA 3K2ZA 1I27A 5J1RA 4L9JA 2IP2A 3ZOBA 2Y0SA 2JRTA 2MBFA 2X51A 5K7HA 3P9IA 1RUNA 2R5YA 2L9NA 1T39A 2BY0A 1FIAA 2VJ5A 3H36A 4CCNA 3DPLC 1I1GA 2OQRA 3ZMVA 3GX4X 5BMZA 1RESA 4LIUA 4A0YA 3PFYA 2E71A 2FOKA 1P92A 4U7BA 3OWTA 5HNFA 1EV7A 4HF1A 3IUOA 3LA3A 3QPTA 1STZA 2HS5A 5J4VA 4M72A 1IGNA 5AIPA 2K9SA 4HQEA 5ILSA 4BXUA 3O6BB 2XRLA 1GHCA 3DEWA 3GFJA 3H3UA 3G73A 2DT5A 1XB4A 3W6KB 4KIBA 4QSHA 2VXZA 3C18A 1ETXA 3H35A 3HL2A 2Y9ZA 3FISA 3KETA 4NNJA 3FXOA 1APLC 3S3OA 1V5EA 4ZTFA 4XLHA 4GCVA 3AG4H 4WXCA 1USSA 1CF7A 1RR8C 1R5GA 4OINF 3JTGA 1K61A 2COBA 2IPQX 2VKEA 3F72A 3K0LA 5J1YA 1JXSA 4PZJA 4NUBA 4IJAA 4LK1F 1MJBA 4PFPA 4BQOA 4ZJZA 1IXSB 4DGWB 1X3ZB 3VFZA 3FXQA 5EZHA 3W2WA 1HXDA 1PJRA 1FP1D 4EEFG 3TO9A 1H88C 4E4HA 1IXRC 2NVQJ 2DI3A 3QPSA 3S1QJ 4RM2A 3HIFA 2R93J 4CCJA 1MBEA 4BUPA 2CW7A 5LGTA 3RKQA 3QPLA 4J19A 2AQFA 3J7AY 3MMYB 3TP3A 5C44J 3ZXSA 3JAMK 2A3SA 1IO2A 2ZSIB 1GV2A 1YRNB 2WV0A 1XSXA 2XGEA 1GLNA 3ECHA 2JPBA 5K5RA 5GPAA 3H9JA 3JRIA 2LY9A 1W5TA 4NDLA 1F9NA 1D5VA 3C2GA 2R7ZJ 1PDNC 3ZCOA 2PN6A 4M3EA 3I58A 4A69C 3IP4B 3JRHA 5F04A 2QUFA 2BV6A 2DN0A 2BHYA 5CVJA 2W24A 2HTSA 1IW7F 2PFBA 4FQGA 4EJOA 3QP6A 1BC7C 3CESA 5B66C 2WAQA 2BVLA 2KL4A 1CQTA 3DV8A 5M5YJ 5FLXZ 3HRSA 4CXFA 4FT8A 5JR3A 4XKVA 5B3SH 3LQRA 1QU3A 2HU9A 5J40A 4BL0B 2VQHA 1EA3A 5ERIA 2LREA 2RC4A 1ETQA 1F36A 3BG6A 3ZQHA 2VE9A 3MZHA 1XTAA 2PEXA 4IQJA 2DDAA 2W85A 4IXAA 1E3OC 3L1PA 4B3XA 1SMTA 3CC7I 1T0FA 4RB1A 4D5FA 1VF9A 4BXFA 1FP2A 3OY9A 2VPLA 1HKSA 1QGPA 5E18F 5J3LA 3HDDA 3I4NJ 1BI1A 5H2FC 1ZLKA 3BJAA 2OCEA 1TL8A 4C9YA 2HYGD 1U3EM 1G6NA 4A3LJ 3S1MJ 2X0LA 2L4AA 5K7ZA 3R0AA 4F7ZA 6PAXA 3HOYJ 1KZHA 1JJ8C 2FA5A 2GM4A 2F4OB 1RR7A 5BOXA 2LLKA 1T2KA 2HPIA 4UVCA 1F4KA 1QPIA 3KE2A 3OYIA 4LGWA 1F1ZA 1IUYA 4HLYA 1U6GA 2KFDA 3E0JB 5L3EA 4DYRA 4HG2A 3QPHA 2E7XA 4M9ZA 3FM3A 2FX0A 2F5DA 3BR1A 3ONQA 2ISZA 1U8RA 1K83J 2M0CA 5L3DA 5J6XA 1LB2A 2BXZA 1UHMA 2V9VA 4LD5A 1XMKA 4Y7NJ 3V8JA 1B4AA 2DQRA 1JGSA 3LSGA 1TWCJ 3F0CA 2KMUA 3NEUA 5HS8A 1O7LA 3M07A 4HSTA 3DKYA 3GFLA 2GOMA 5B1BH 3SFZA 2LYCA 1B59A 3GFIA 1JKQC 4U0WA 2F4IA 4L5IA 1GDTA 5LD2C 1KU2A 3BZCA 4HX4A 3VYTB 1W5SA 3J7ZI 5IT9K 2KDOA 2EK5A 3COAC 2A6TA 2QZ8A 3WTVC 2RQQA 2VPRA 5C4JJ 4PJMA 4JYKA 1S5LC 1E0EA 4I7HA 1HSJA 4A2UA 1ETVA 3WTXC 1OLTA 2COMA 4LOCA 4HX7A 2XF6A 4HPQA 1R49A 2M0MA 1BJZA 1JKRC 1HDPA 4OMZA 4L5EA 5EDNA 4EM0B 3RZOJ 2OA4A 2H09A 3VODA 4HBLA 5HLIA 3EYIA 2EIMH 3L09A 1S7OA 2JT1A 1ZRCA 4YFKF 1Y0UA 5LRRA 5A2QZ 2LKXA 4UB6C 2KZVA 4XORA 3S3NA 2DMQA 2ISYA 3GLLA 2L3DA 4A6DA 4B09A 1E2XA 2CQKA 2A05A 2EQRA 2W84A 4XKWA 5IYBJ 4BJ6C 3F8BA 3KYLA 1AA7A 3OYEA 4RA2A 4RB0A 3K7AJ 1WFXA 2Y75A 2DT6A 3BLYA 2RNJA 3TBIA 3ZPLA 1NHAA 1XN7A 2E5NA 4BHCA 1DP7P 2K27A 3KEOA 3FBNB 4UVBA 2OZUA 3L00A 1B9NA 1E3HA 2JA2A 4A3CJ 1EKEA 1YO5C 1HDDC 3CMYA 1X3WB 3H5NA 2VJIA 3CCEI 2G7UA 3MN2A 5JVGF 3W2VA 1TW2A 4B3AA 1XS9A 1IRFA 2MABA 1BL0A 3DTIA 5CVRA 2QKLB 4IF4A 5KAIC 3W6VA 1R4NB 4ENJA 2R7XA 2CG4A 5DEQA 1J9IA 3BOQA 4CUGA 2XASA 1OQYA 3G6EI 5TGTA 2NVXJ 1I39A 4MEYF 2L9SA 3CLQA 2MG4A 2EFPA 4I0BA 1YRNA 4RBOA 4IOAF 2ME0A 1IN6A 2KQRA 1U2WA 4HDUA 3M8JA 1ZGAA 1LFBA 2IAIA 3QYFA 1FMWA 2STTA 2H6BA 1Y6IA 2GA2A 3F8FA 3E7LA 5JVTA 3RZDJ 1YTYA 1WZ2A 1Z67A 3ERED 2DOFA 3QRFF 4XSXF 5ICCA 3RI4A 1SEUA 1G3YA 3WTWC 2DMUA 1N78A 3KP5A 4FX4A 2OC6A 2Z2SB 3W2AA 1S8NA 2DA3A 3HTUA 4KJZA 1B9MA 2HDWA 2BW3B 3CJQB 4IZZA 1HQCA 1ON2A 4X6AJ 4XRMA 1W7PB 1ZR4A 1E3PA 4HEA2 4RM3A 4IHSA 3H1CA 3IKTA 1XCBA 2DT7B 1FJLA 3V7SA 1O57A 2M8GX 4UVAA 2JPCA 3EDPA 5D5VB 2LNBA 1XD7A 3L7WA 4WXDA 3VYUB 4XN0A 4ETSA 2DA4A 2KRCA 4L9NA 3FBIB 1ZREA 4UUTA 2QWWA 5DV5A 2CQXA 1KYWA 3ROUA 2X6XA 2ELKA 3WE3A 1LFUP 3E6CC 2GLOA 5IT3A 2CO5A 1YYVA 4ZH4F 3KCCA 4DW6A 2AO9A 2FE3A 4HNUA 2ECBA 5LBQA 4XRSG 2W57A 1A6QA 3MKZA 2L01A 5IP7J 2M3AA 4GGGA 5DUKA 2XB0X 4EJUA 4PJNA 2DA7A 2W7NA 4C3HJ 1SFUA 4G6DA 2FBHA 2XAQA 2BY3A 4XLNF 4Q5SF 1TWFJ 2V6EA 2BY1A 5CVIA 3F8CA 3HUGB 4XOTA 1XSDA 2LK2A 4MTDA 1OJLA 5F0FA 2ESHA 1XGMA 2WTEA 3CUQC 1VNDA 1ONVA 3CCLI 2OUMA 4L5JA 4U88A 4AUXA 4O5VA 3OMYA 2A5YB 4OIPF 3UR3C 3BZKA 4DJAA 2O03A 4AD9A 4AIHA 3SYTA 1P6RA 3F23A 4MNUA 1UHSA 3BWGA 2KIFA 3SDGA 2NYXA 3LNQA 2FRHA 3KFWX 2HQRA 4JX6A 2XGXA 4PJLA 3W3CA 1K78B 2FUG2 2VKHA 3BCAA 5LLQA 4M9SA 2Q2EB 4LFUA 1MBHA 3NRVA 2FU4A 1S7EA 4EJTA 3HOZJ 2DTRA 3CQZJ 4DZPA 2FBIA 2Z16A 3AKZA 3HOWJ 1YW8A 2V1DA 2Y48A 4XR6A 3ZQGA 3IAM2 2L7FP 4F92B 4WK8F 2QF7A 4HV5A 2VBZA 3H3ZA 1VQPI 2JJ7A 3RDIA 4EM1A 1TQMA 2L7KA 1D0YA 2CU7A 2R7OA 3C2BA 4LITA 1KGSA 2Z1DA 1MZBA 2D2WA 2H8WA 2JVGA 4HAMA 4HLXA 3TO6A 1R22A 1QZYA 2DU9A 3TKYA 2HOSA 1VQ9I 1H89C 2E36A 2A69F 2C6YA 1YW9A 2ZO4A 4G6TB 3L2QA 3CCMI 2HFHA 1RPWA 4XLEA 3SZPA 1FX7A 2M9HA 5EJCA 4ZYHA 4X0GA 4GYGA 1VI0A 4XL9A 3V42A 1L3LA 1UAAA 2G9WA 5ED4A 4IHTA 3A03A 2KKOA 4BS9A 3KIOA 3LQQA 2M5WA 2FSWA 4GRIA 4BYYA 3N4MA 5EYRA 4A3BJ 1T0FC 1R36A 1Y56A 3DU5A 1VTNC 1BI3A 3EYYA 2G0EA 3CTAA 1VQ6I 2QBYB 4KT5C 3B73A 4WCGA 2JRMA 4LLGF 2V7FA 5EZGA 1X2NA 2JK3A 1D1AA 1YS7A 2GBYA 3BP8A 5JLWA 2R7SA 2HQAA 3AL0C 2LMDA 4HZFA 4BEHB 4BGDA 3TMOA 3S2HJ 1X1BA 2ZMEB 3E6MA 3H92A 2XIGA 4JK1X 2V26A 1W5CC 1WJBA 4I02A 4E6KG 1MH4A 4OMYA 2L7MP 3Q3SA 3HYIA 2EIJH 5FLXK 5JHFA 2QENA 1ZRFA 4A3DJ 2LC2A 3BTCA 1YFHA 4Z6YA 3DKXA 1JKOC 2Y69H 4PJJA 2QM3A 2BW3A 2V1XA 2YS9A 1MH3A 3E5XA 3H5AA 2BXYA 1W7PA 5IYDJ 3OR2C 3F22A 4A5NA 5EGOB 2P5KA 1GXQA 4FE7A 2NS7A 2FXAA 4IPAA 1SANA 3A4CA 3DQVC 1YG2A 1I6XA 2E1MB 2BVMA 3M9AA 2L5QA 2RN7A 3KYDB 4ZDOA 3J7AO 2VT2A 1LFPA 2CUJA 3JRBA 2AQEA 2CFOA 3ZMDA 3SJMA 3TO7A 5L3CA 3CO7C 1G8XA 3ZGKA 4G7HF 3LL7A 3B6CA 4MO7A 2LD5A 4IHVA 3WTYC 3DLLF 2R4GA 4NC6A 3OS1A 1FZPB 2VJ4A 2DODA 1NTCA 1R58A 1H9TA 2XV4S 3PUBA 1ITYA 3I3LA 4KITB 2IEKA 2JA5J 4CZCA 4IVNA 1VFCA 5HLTA 2FNPA 3F8MA 3OIPA 4F93B 1JUMA 3HUGA 1V54H 4PUSA 2A61A 3QYEA 2RQPA 2VI6A 1FEXA 2VL8A 4HV6A 3FIWA 2X85A 1JE8A 5HLHA 3LOCA 1S29A 1R6RA 3DBHB 1FC3A 3U1DA 4IX7A 1MMSA 3PNVA 3VEPA 2OF7A 5FLMJ 2OD5A 2M7BA 4LLLA 1LQ1A 1NG6A 3BQYA 3LAJA 1U0JA 2ZNYA 4TV7A 1KA8A 3ZP5A 1K78A 2R7VA 3PNTA 4Y13A 5LGNA 3EQLF 5HNHA 3ZN1A 1TP4A 2VOPA 3M1EA 2Q2EA 4BY7J 2OZ6A 4M3DA 2PJRB 1N75A 3HHGA 4PJ0C 1T33A 2ZXIA 3WG9A 2L4MA 1VQMI 5A2QK 3QQAA 1WVRA 1T95A 4IQ4A 1XC5A 2EINH 4XKCA 3RYRA 4A3JJ 1LVAA 4ANJA 1T56A 2Y31A 2X6WA 1ZQ3P 1LNWA 2K9MA 2PMZN 3DFGA 3RIRA 5K7FA 4CH7A 2JMWA 1ENHA 5GAGJ 3HSEA 2NS0A 1TWGJ 4KNYA 4CCKA 2HYJA 1UFMA 1LDDA 4G8XA 2LVSA 1OYIA 2M7AA 3E97A 3G3ZA 2LTPA 1JT6A 2EFOA 3MZYA 4IRHA 2CRGA 4LK0F 1J7KA 1T8IA 2FEZA 2ELJA 3EETA 1X4PA 2EV0A 1V4RA 1Z1DA 4F3QA 2ZB9A 2KLOA 2MGQA 3A0HC 2R7DA 3PIPF 1WJAA 4PCQA 3S1RJ 1BR1A 1ZARA 1X1CA 1SMYF 4UXNA 3HRUA 4ASNA 5BPDA 2KT0A 3J7YJ 4OAYA 1UJ8A 2DK5A 2QBYA 4KISA 2YUSA 3BR3A 3CP8A 2ME6A 3MFKA 2OTLI 5EF6A 5D5WB 2IA0A 3ELKA 1R1VA 2NNNA 2CV1A 3OYJA 4AYBN 3GZNB 2VODA 2BE5F 4BEHA 4JQFA 3SQNA 1DUXC 5CLSA 1LPQA 2ZMEA 1XSVA 1JT0A 2VONA 3M1CA 3CZ6A 3PJRA 4P96A 1SVMA 3G1MA 1DU0A 3PO2J 4DYQA 4J00A 3JSPA 2FMYA 3DLAA 1W4MA 3LSRA 2CYYA 4E7IA 3FZVA 4JX5A 2IGMA 3HOXJ 2PMHA 3DBLB 2WV1A 2M45A 3WTSC 1FBQA 2HGCA 1YX5A 5D8KB 2JSCA 2PX9A 2K7LA 4YEJA 4BE2A 2RREA 3V8LA 2NXNB 4Y52J 1K4SA 1MSFC 3BPXA 2RKHA 4M3GA 5J1UA 4G6QA 2A6EF 3DXJF 4OU0A 3CO6C 2EJRA 1J0RA 5EGOA 2XROA 3G1LA 1PP7U 4CCLA 2R5ZB 3BJOA 1HKQA 3LA7A 1J59A 3GO5A 2ID6A 1OR7A 2EZIA 2ZFUA 5H6QA 2D1VA 1WJ5A 4IOCF 3RQIA 2UWMA 1Y8RB 2XGDA 2O7OA 2FBKA 2NRAC 3K4MA 1VZ0A 5GADJ 1RKTA 2W25A 4M3FA 1MNEA 1BOBA 1RKWA 1VQ4I 1MIJA 4CDGA 1U78A 4B47A 4G7ZF 4C2MJ 1E17A 1GXPA 2QCOA 2OQGA 3PQJA 1AKHB 4DOZA 4L0ZB 1WKMA 2DA1A 2CQ7A 1YI2I 2F5CA 2DJNA 3I5UA 3W6JB 3L2RA 1G3WA 4GXOA 1ZG3A 3DTKA 4ZC3A 5L3BA 3FMSA 1R1TA 3M4OJ 3BG9A 1WI3A 2K02A 4HW0A 4YELA 2JVHA 2IGNA 5GPCA 4A3KJ 1USTA 4A93J 3OOPA 2M4KA 1WQ2A 3CCJI 5FFXA 2FQ4A 1MJ9A 2KJBA 1F43A 5DM6F 4PK4A 4PGHA 4A12A 2OJED 1YS6A 3RTRA 5DUIA 1YHQI 2VC0A 4FTHA 5E3OA 4CCOA 4M3BA 5CKTA 1LJ9A 2EH3A 2KP6A 2MW8A 4DIQA 1Z6TA 5CVVA 4OIOF 5E1WA 4ESFA 2M87A 3WG7H 2BHZA 2K4JA 3CUOA 3LSJA 3LSHA 1HLVA 2EZHA 2LF8A 4BQQA 1JI8A 4MTEA 2QKMB 5DD8A 2MD0A 1WPKA 3C1DA 1D5YA 3L2CA 3CDHA 3OYBA 5E3LA 3TEDA 3ISPA 3JREA 3Q0UA 5EG0A 3K4BA 4AVZA 4I0AA 1FBSA 2OV7A 3BG7A 3VYSB 1X19A 5CVUA 4BH9A 3CMAI 4G94A 3SZTA 3LSIA 1OISA 2WB1N 5B1AH 3S15J 4UB8C 4R79A 4LB5A 3K69A 4M6XA 2W82A 1FOWA 3KYCB 3UKGA 1POGA 3CDLA 3KP4A 2D5VA 1SAXA 1SAUA 2EZKA 5E17F 3F6OA 1D1BA 2EFWA 1OCTC 2HOTA 1FWZA 3P5JA 2ETHA 2NVYJ 1J09A 5BS6A 4O6JA 3NAUA 5ICFA 5FD6A 3GFMA 1SC7A 2N8GA 1IAWA 3AG2H 3R60A 5D5UB 4ENKA 1NK3P 2KZGA 2Q0OA 5LHIA 4BDZA 1DDNA 4K2EA 5BPIA 3WHBA 3A1YA 2WA0A 1P4XA 1B1BA 3BT9A 3S1NJ 5IP6A 1R5HA 4MLOA 4RGXA 2EV5A 2YX4A 4AM3A 2FOWA 4BNCA 1NK2P 4CYCB 5HS7A 4NC7A 4XQFA 3D5LA 3ZR8X 4BHPA 1WRJA 3HOTA 4JBAA 3NWSA 4XBFA 2TCTA 3A0BC 4EVIA 4KIGA 3LFUA 3I64A 3FK6A 5F64A 2K9QA 3ML6A 1KYZA 1XG1A 5IY5H 2DMPA 1OCPA 4IHWA 5D4RA 1ZRDA 1FOXA 1EH6A 2XHKA 1Y1VJ 3AG1H 4B44A 3GTOJ 2HNHA 2BZTA 4HNVA 1X3UA 4M73A 5FKNA 1QHHD 2HWVA 3I59B 4WF2A 4CGZA 3WGIA 1DPRA 1R7JA 2B7EA 5B5EC 1RI7A 3DTEA 5FD5A 2LF7A 1ZKGA 1MNMC 1I1SA 3MAJA 2XUBA 2XF7A 2JQ7A 1MBJA 3HG9A 1R1UA 1XX5A 2M8EA 2DW4A 2DQLA 4Y17A 3E1SA 3A01B 3EUHC 3HRTA 4PGGA 2L7ZA 4M6YA 3BG3A 3FXMA 2O6GE 4RAGA 5E8GA 3I54A 3ULQB 3HC7A 1B72B 2DTZA 5L3GA 5TISC 2HDCA 2TRTA 5KCMA 3HOVJ 1FMVA 2LY1A 2HPMA 1SD5A 1IC8A 4UV8A 4FISA 4KICA 2E60A 3ASNH 1UG2A 2P6TA 4OWRB 1Y8QB 4RDUA 3I0TA 5E1XA 2XVCA 2R5ZA 2BGCA 2O8KA 1BIBA 4B48A 2O0YA 3ASOH 4XKBA 2EFQA 3BR2A 1RIOH 1TTYA 1XMXA 2RGVA 5FKKA 4BQNA 3S2DJ 1DPUA 2IXSA 3TOAA 1UHWA 2HKXA 3V4GA 2QA4I 3ZQLA 3K4KA 2Z9OA 1DU6A 1AKHA 3C7JA 1X58A 3BR5A 1J5YA 3KLOA 1TZLA 1ZGWA 2BBYA 1BI0A 2TDXA 1HW2A 3TDZC 2XSDC 2DA2A 2UV1A 4WWCA 1LDKB 2R7WA 1Z05A 1R4MB 2VC1A 1RC9A 3FKJA 3L2VA 3CCRI 4O3MA 1FOYA 3A02A 3WE2A 5FKLA 2DPUA 2CSOA 4LB6B 4XLCA 1TNSA 4B4CA 1QQIA 1S3JA 3TP0A 1TQIA 3GTLJ 2RDPA 3KX2A 3IC7A 2A68F 4B43A 1TQPA 3FXUA 2EA4A 3ZQCA 4M71A 2XKPA 4AIJA 4HYEA 3GTQJ 3HGYA 2F2EA 3I53A 4DZJA 1U8BA 1TWAJ 1UMQA 3SZGA 2DA5A 1FYLA 3CCVI 2CUZA 2V1UA 2DBBA 1D0ZA 2QYOA 4Q4ZF 2XC7A 2R7RA 3DF8A 1Z77A 3FKIJ 2JN6A 4FHTA 5J8FA 5HODA 2H1KA 2ZKZA 1NG7A
chains in the Genus database with same CATH topology
1SANA 1FTTA 3PM1A 2HQ5A 4IEJA 5EZHA 1X2MA 4EEFG 1H88C 3HOUJ 2NVQJ 3QPSA 1QRYA 1FTZA 5FJ8J 2MSYA 3S1QJ 2YU9J 3JRBA 1BW6A 2R93J 3SJMA 9ANTA 2M2EA 2E2IJ 1MBEA 3B6CA 4MO7A 5M3FJ 2LD5A 4IHVA 3Q0WA 3RKQA 3QPLA 4J19A 4MFDA 3TP3A 1TC3C 5C44J 4XRSA 1NTCA 1ZTRA 1GV5A 2O9LA 1GV2A 1WCMJ 1YRNB 1JTYA 2XGEA 1ITYA 3JR9A 2IEKA 2JA5J 4I76A 1VFCA 5GPAA 3JRIA 2LY9A 4M6VA 4NDLA 3JRAA 3JRFA 2R7ZJ 1O4XA 3S16J 1JUMA 4M3EA 4A69C 1ETWA 2L0KA 3BQZA 5F04A 1ZK8A 4V2FA 3JRHA 1A5JA 2DN0A 3GTKJ 4CYCA 2VI6A 1FEXA 3FIWA 4QIWN 3LOCA 1PUFA 2OF7A 5FLMJ 2R0QC 3BQYA 1CQTA 5M5YJ 2CJJA 2JA6J 3OSFA 4BKXA 5E3MA 4JP0A 1ETQA 1F36A 4BY7J 2EZLA 3ZQHA 5C3EJ 4M3DA 3IH2A 1T33A 1FIPA 2W48A 1E3OC 3L1PA 2Y30A 3OIOA 3HGGA 3QQAA 4D5FA 1VF9A 1XC5A 3GTMJ 3HDDA 4A3JJ 5J3LA 3I4NJ 4UUSB 5F1JA 1T56A 3PO3J 3A01A 2Y31A 1ZQ3P 2E1OA 2PMZN 1B72A 5K7FA 4A3LJ 3S1MJ 2JMWA 1ENHA 5K7ZA 1JUPA 1IJWC 3HOYJ 1TWGJ 1JJ8C 2HYJA 2GM4A 4XICA 2LVSA 1RR7A 4W1UA 3LSPA 2LLKA 2LTPA 1JT6A 1LE8A 1IV6A 2K40A 2X48A 2CRGA 1QPIA 3G1OA 3OOUA 5M3MJ 4DYRA 4BBSJ 2ZB9A 5IPAA 2FX0A 2MGQA 3BR1A 1QVTA 3TW6A 1SFOJ 1K83J 3S1RJ 2M0CA 3DCFA 2E19A 2LFBA 3OSGA 3HKZN 4Y7NJ 2KT0A 1JTXA 3LSGA 1TWCJ 2HOAA 3F0CA 5IOYA 1JKQC 1GDTA 2K9NA 2YUSA 3BR3A 5DTDA 2ME6A 5F0HA 2XGCA 1IDYA 3GBGA 5EF6A 5FKMA 2R92J 2VPRA 5C4JJ 4JYKA 4AYBN 1ETVA 1JUSA 4LOCA 5GP9A 3BTJA 1HF0A 3ZQFA 1JT0A 1P7IA 5FLVA 5IYCJ 1BJZA 4GFBA 3G1MA 1JKRC 1HDPA 5EDNA 4L5EA 2I10A 3RZOJ 1DU0A 3PO2J 4DYQA 4BXXJ 1H8AC 3LSRA 2NVTJ 4JX5A 2LKXA 1MSEC 2X9DA 2DMQA 4S0HB 3HOXJ 2WV1A 3I4MJ 2EQRA 5IYBJ 2XPUA 4Y52J 1MSFC 4M3GA 5J1UA 3K7AJ 5EGOA 2ID3A 5M5WJ 3G1LA 3JRDA 4XIDA 4D7MA 3CCYA 2R5ZB 4MFEA 4A3GJ 5M5XJ 4JX4A 2JA7J 2ID6A 2EZIA 3K2AA 1TWHJ 1GVDA 4A3CJ 1HDDC 2NOGA 1MBKA 3CMYA 3RQIA 3B6AA 2XGDA 2O7OA 2HXIA 3MN2A 2DMTA 2XPVA 1RKTA 3IH4A 4M3FA 4B3AA 1XS9A 1RKWA 1U78A 1BL0A 2Y9YA 4C2MJ 3W6VA 4V2GA 2QCOA 1AKHB 3BTIA 2DA1A 2EBIA 2DJNA 3S14J 2R5YB 3M4OJ 1IG7A 3BG9A 2NVXJ 3FK7A 1WI3A 2MG4A 1HOMA 3MKLA 3SFIA 5GPCA 4A3KJ 1YRNA 4RBOA 2ME0A 4A93J 2FQ4A 4FE4A 1F43A 4BY1J 1LFBA 4FTHA 2IAIA 1I6HJ 5E3OA 4M3BA 3M3YJ 2EH3A 1IRZA 2MW8A 3E7LA 3VPRA 1ZR2A 3RZDJ 1MBGA 1JKPC 3JRGA 2DMUA 3LSJA 3O8GA 3NARA 1HLVA 2DA3A 2EZHA 1B8IB 2CQQA 3BG5A 1EF4A 3IH3A 1WPKA 2LP0A 1D5YA 1W0TA 4ABZA 2HI3A 4X6AJ 1BW5A 4MIMA 4XRMA 1ZR4A 5E3LA 1ETYA 3TEDA 1FJLA 3JREA 3Q0UA 2ECCA 1MBFA 1P7JA 4DYCA 5EG0A 2M8GX 1GT0C 1IDZA 3GTJJ 4A3MJ 2DA4A 2WB1N 3S15J 2Y0SN 1I3QJ 4UUTA 3UKGA 1POGA 4UUSA 3CDLA 2CQXA 2D5VA 2XB5A 2X6OA 2EZKA 2GLOA 2ELKA 1LFUP 5DS9A 1OCTC 2HOTA 3H3VK 2NVYJ 1QVUA 3NAUA 2AO9A 4DW6A 1HCRA 3Q0VA 2ECBA 4XRSG 4G12A 1U9NA 5IP7J 2N8GA 2LR8A 1GUUA 2XB0X 1NK3P 1OFCX 2DA7A 1JGGA 4C3HJ 2HXOA 2HDDA 5F27A 3WHBA 1I50J 3BT9A 1TWFJ 5IP6A 3S1NJ 4MLOA 4W97A 1W0UA 3BR6A 2LK2A 1OJLA 1NK2P 5F0FA 2VUMJ 4CYCB 3HBLA 3ZQIA 1WH7A 1VNDA 4BBRJ 1BA5A 2TCTA 4AUXA 1PUFB 3HEFA 3S17J 3FK6A 2E2JJ 4D5CA 2K9QA 4QTRA 5IOZA 4XK4A 1UHSA 5C4XJ 4C3IJ 3SDGA 1XG1A 3LNQA 2FJ1A 4JX6A 3TW7A 2DMPA 1OCPA 4IHWA 2KDZA 2JWTA 1ETKA 5BNGA 3HM5A 1Y1VJ 3GTOJ 5E3NA 4HNVA 2CUFA 5FKNA 4I6ZA 5IP9J 1MBHA 1ETOA 1ORKA 1Q1VA 1S7EA 3HOZJ 1A6IA 2M34A 1ZKGA 3CQZJ 1RETA 4FCYA 4DZPA 2IBDA 1MNMC 3HOWJ 1MBJA 4A3IJ 3IV5A 5EEAA 3ZQGA 2NS8A 3WHCA 1G2HA 3A01B 2L7FP 1Y1WJ 4IHYA 2L7ZA 4AC0A 3BG3A 3D1NI 2QF7A 1B72B 2DTZA 2JA8J 3O8HA 2RAEA 2OPTA 2JJ7A 2XPWA 2TRTA 1Z0XA 3HOVJ 2CU7A 3C2BA 2B63J 4C3JJ 4IHXA 2HOSA 3HB9A 2H8RA 1IC8A 1WH5A 1H89C 3GTPJ 1IUFA 4FISA 1LE8B 1UG2A 4X1EA 3BTLA 5JLXA 4RDUA 1RPWA 2R5ZA 3JRCA 2M9HA 5F0CA 2AHQA 2O8KA 1VI0A 4A3FJ 5EG0B 5F08A 3A03A 2WAQN 5FKOA 3BR2A 5FKKA 5EYRA 3S2DJ 4A3BJ 2L9RA 3GTGJ 2Y2ZA 4A3EJ 3ZQLA 3BR0A 1DU6A 1AKHA 5J1RA 1X58A 2G0EA 2FD5A 3BR5A 3ZOBA 1ZGWA 5K7HA 2R5YA 1R9TJ 5EZGA 1X2NA 1FIAA 2XSDC 2DA2A 2JK3A 2VKVA 1RESA 2GBYA 5JLWA 2E2HJ 3S2HJ 3MVPA 1AU7A 3A02A 5FKLA 4B4CA 1AHDP 1U9OA 3TP0A 3GTLJ 1MH4A 2L7MP 3Q3SA 1IGNA 2K9SA 3H0GJ 2XRLA 3DEWA 4A3DJ 3BTCA 3ZQCA 3GTQJ 3HGYA 1JKOC 4B1RA 1B8IA 4DZJA 1U8BA 1TWAJ 1UMQA 4QSHA 2YS9A 1ETXA 2DA5A 4D7NA 1MH3A 2P81A 3FISA 2Y9ZA 1JJ6C 1APLC 1WGXA 2CUEA 5IYDJ 2DA6A 5EGOB 1Z77A 3FKIJ 2JN6A 5HODA 1K61A 2H1KA 2COBA 2DMNA 2VKEA 4FE7A 5J1YA 2NS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAN A;  1FTT A;  3PM1 A;  2HQ5 A;  4IEJ A;  5EZH A;  1X2M A;  4EEF G;  1H88 C;  3HOU J;  2NVQ J;  3QPS A;  1QRY A;  1FTZ A;  5FJ8 J;  2MSY A;  3S1Q J;  2YU9 J;  3JRB A;  1BW6 A;  2R93 J;  3SJM A;  9ANT A;  2M2E A;  2E2I J;  1MBE A;  3B6C A;  4MO7 A;  5M3F J;  2LD5 A;  4IHV A;  3Q0W A;  3RKQ A;  3QPL A;  4J19 A;  4MFD A;  3TP3 A;  1TC3 C;  5C44 J;  4XRS A;  1NTC A;  1ZTR A;  1GV5 A;  2O9L A;  1GV2 A;  1WCM J;  1YRN B;  1JTY A;  2XGE A;  1ITY A;  3JR9 A;  2IEK A;  2JA5 J;  4I76 A;  1VFC A;  5GPA A;  3JRI A;  2LY9 A;  4M6V A;  4NDL A;  3JRA A;  3JRF A;  2R7Z J;  1O4X A;  3S16 J;  1JUM A;  4M3E A;  4A69 C;  1ETW A;  2L0K A;  3BQZ A;  5F04 A;  1ZK8 A;  4V2F A;  3JRH A;  1A5J A;  2DN0 A;  3GTK J;  4CYC A;  2VI6 A;  1FEX A;  3FIW A;  4QIW N;  3LOC A;  1PUF A;  2OF7 A;  5FLM J;  2R0Q C;  3BQY A;  1CQT A;  5M5Y J;  2CJJ A;  2JA6 J;  3OSF A;  4BKX A;  5E3M A;  4JP0 A;  1ETQ A;  1F36 A;  4BY7 J;  2EZL A;  3ZQH A;  5C3E J;  4M3D A;  3IH2 A;  1T33 A;  1FIP A;  2W48 A;  1E3O C;  3L1P A;  2Y30 A;  3OIO A;  3HGG A;  3QQA A;  4D5F A;  1VF9 A;  1XC5 A;  3GTM J;  3HDD A;  4A3J J;  5J3L A;  3I4N J;  4UUS B;  5F1J A;  1T56 A;  3PO3 J;  3A01 A;  2Y31 A;  1ZQ3 P;  2E1O A;  2PMZ N;  1B72 A;  5K7F A;  4A3L J;  3S1M J;  2JMW A;  1ENH A;  5K7Z A;  1JUP A;  1IJW C;  3HOY J;  1TWG J;  1JJ8 C;  2HYJ A;  2GM4 A;  4XIC A;  2LVS A;  1RR7 A;  4W1U A;  3LSP A;  2LLK A;  2LTP A;  1JT6 A;  1LE8 A;  1IV6 A;  2K40 A;  2X48 A;  2CRG A;  1QPI A;  3G1O A;  3OOU A;  5M3M J;  4DYR A;  4BBS J;  2ZB9 A;  5IPA A;  2FX0 A;  2MGQ A;  3BR1 A;  1QVT A;  3TW6 A;  1SFO J;  1K83 J;  3S1R J;  2M0C A;  3DCF A;  2E19 A;  2LFB A;  3OSG A;  3HKZ N;  4Y7N J;  2KT0 A;  1JTX A;  3LSG A;  1TWC J;  2HOA A;  3F0C A;  5IOY A;  1JKQ C;  1GDT A;  2K9N A;  2YUS A;  3BR3 A;  5DTD A;  2ME6 A;  5F0H A;  2XGC A;  1IDY A;  3GBG A;  5EF6 A;  5FKM A;  2R92 J;  2VPR A;  5C4J J;  4JYK A;  4AYB N;  1ETV A;  1JUS A;  4LOC A;  5GP9 A;  3BTJ A;  1HF0 A;  3ZQF A;  1JT0 A;  1P7I A;  5FLV A;  5IYC J;  1BJZ A;  4GFB A;  3G1M A;  1JKR C;  1HDP A;  5EDN A;  4L5E A;  2I10 A;  3RZO J;  1DU0 A;  3PO2 J;  4DYQ A;  4BXX J;  1H8A C;  3LSR A;  2NVT J;  4JX5 A;  2LKX A;  1MSE C;  2X9D A;  2DMQ A;  4S0H B;  3HOX J;  2WV1 A;  3I4M J;  2EQR A;  5IYB J;  2XPU A;  4Y52 J;  1MSF C;  4M3G A;  5J1U A;  3K7A J;  5EGO A;  2ID3 A;  5M5W J;  3G1L A;  3JRD A;  4XID A;  4D7M A;  3CCY A;  2R5Z B;  4MFE A;  4A3G J;  5M5X J;  4JX4 A;  2JA7 J;  2ID6 A;  2EZI A;  3K2A A;  1TWH J;  1GVD A;  4A3C J;  1HDD C;  2NOG A;  1MBK A;  3CMY A;  3RQI A;  3B6A A;  2XGD A;  2O7O A;  2HXI A;  3MN2 A;  2DMT A;  2XPV A;  1RKT A;  3IH4 A;  4M3F A;  4B3A A;  1XS9 A;  1RKW A;  1U78 A;  1BL0 A;  2Y9Y A;  4C2M J;  3W6V A;  4V2G A;  2QCO A;  1AKH B;  3BTI A;  2DA1 A;  2EBI A;  2DJN A;  3S14 J;  2R5Y B;  3M4O J;  1IG7 A;  3BG9 A;  2NVX J;  3FK7 A;  1WI3 A;  2MG4 A;  1HOM A;  3MKL A;  3SFI A;  5GPC A;  4A3K J;  1YRN A;  4RBO A;  2ME0 A;  4A93 J;  2FQ4 A;  4FE4 A;  1F43 A;  4BY1 J;  1LFB A;  4FTH A;  2IAI A;  1I6H J;  5E3O A;  4M3B A;  3M3Y J;  2EH3 A;  1IRZ A;  2MW8 A;  3E7L A;  3VPR A;  1ZR2 A;  3RZD J;  1MBG A;  1JKP C;  3JRG A;  2DMU A;  3LSJ A;  3O8G A;  3NAR A;  1HLV A;  2DA3 A;  2EZH A;  1B8I B;  2CQQ A;  3BG5 A;  1EF4 A;  3IH3 A;  1WPK A;  2LP0 A;  1D5Y A;  1W0T A;  4ABZ A;  2HI3 A;  4X6A J;  1BW5 A;  4MIM A;  4XRM A;  1ZR4 A;  5E3L A;  1ETY A;  3TED A;  1FJL A;  3JRE A;  3Q0U A;  2ECC A;  1MBF A;  1P7J A;  4DYC A;  5EG0 A;  2M8G X;  1GT0 C;  1IDZ A;  3GTJ J;  4A3M J;  2DA4 A;  2WB1 N;  3S15 J;  2Y0S N;  1I3Q J;  4UUT A;  3UKG A;  1POG A;  4UUS A;  3CDL A;  2CQX A;  2D5V A;  2XB5 A;  2X6O A;  2EZK A;  2GLO A;  2ELK A;  1LFU P;  5DS9 A;  1OCT C;  2HOT A;  3H3V K;  2NVY J;  1QVU A;  3NAU A;  2AO9 A;  4DW6 A;  1HCR A;  3Q0V A;  2ECB A;  4XRS G;  4G12 A;  1U9N A;  5IP7 J;  2N8G A;  2LR8 A;  1GUU A;  2XB0 X;  1NK3 P;  1OFC X;  2DA7 A;  1JGG A;  4C3H J;  2HXO A;  2HDD A;  5F27 A;  3WHB A;  1I50 J;  3BT9 A;  1TWF J;  5IP6 A;  3S1N J;  4MLO A;  4W97 A;  1W0U A;  3BR6 A;  2LK2 A;  1OJL A;  1NK2 P;  5F0F A;  2VUM J;  4CYC B;  3HBL A;  3ZQI A;  1WH7 A;  1VND A;  4BBR J;  1BA5 A;  2TCT A;  4AUX A;  1PUF B;  3HEF A;  3S17 J;  3FK6 A;  2E2J J;  4D5C A;  2K9Q A;  4QTR A;  5IOZ A;  4XK4 A;  1UHS A;  5C4X J;  4C3I J;  3SDG A;  1XG1 A;  3LNQ A;  2FJ1 A;  4JX6 A;  3TW7 A;  2DMP A;  1OCP A;  4IHW A;  2KDZ A;  2JWT A;  1ETK A;  5BNG A;  3HM5 A;  1Y1V J;  3GTO J;  5E3N A;  4HNV A;  2CUF A;  5FKN A;  4I6Z A;  5IP9 J;  1MBH A;  1ETO A;  1ORK A;  1Q1V A;  1S7E A;  3HOZ J;  1A6I A;  2M34 A;  1ZKG A;  3CQZ J;  1RET A;  4FCY A;  4DZP A;  2IBD A;  1MNM C;  3HOW J;  1MBJ A;  4A3I J;  3IV5 A;  5EEA A;  3ZQG A;  2NS8 A;  3WHC A;  1G2H A;  3A01 B;  2L7F P;  1Y1W J;  4IHY A;  2L7Z A;  4AC0 A;  3BG3 A;  3D1N I;  2QF7 A;  1B72 B;  2DTZ A;  2JA8 J;  3O8H A;  2RAE A;  2OPT A;  2JJ7 A;  2XPW A;  2TRT A;  1Z0X A;  3HOV J;  2CU7 A;  3C2B A;  2B63 J;  4C3J J;  4IHX A;  2HOS A;  3HB9 A;  2H8R A;  1IC8 A;  1WH5 A;  1H89 C;  3GTP J;  1IUF A;  4FIS A;  1LE8 B;  1UG2 A;  4X1E A;  3BTL A;  5JLX A;  4RDU A;  1RPW A;  2R5Z A;  3JRC A;  2M9H A;  5F0C A;  2AHQ A;  2O8K A;  1VI0 A;  4A3F J;  5EG0 B;  5F08 A;  3A03 A;  2WAQ N;  5FKO A;  3BR2 A;  5FKK A;  5EYR A;  3S2D J;  4A3B J;  2L9R A;  3GTG J;  2Y2Z A;  4A3E J;  3ZQL A;  3BR0 A;  1DU6 A;  1AKH A;  5J1R A;  1X58 A;  2G0E A;  2FD5 A;  3BR5 A;  3ZOB A;  1ZGW A;  5K7H A;  2R5Y A;  1R9T J;  5EZG A;  1X2N A;  1FIA A;  2XSD C;  2DA2 A;  2JK3 A;  2VKV A;  1RES A;  2GBY A;  5JLW A;  2E2H J;  3S2H J;  3MVP A;  1AU7 A;  3A02 A;  5FKL A;  4B4C A;  1AHD P;  1U9O A;  3TP0 A;  3GTL J;  1MH4 A;  2L7M P;  3Q3S A;  1IGN A;  2K9S A;  3H0G J;  2XRL A;  3DEW A;  4A3D J;  3BTC A;  3ZQC A;  3GTQ J;  3HGY A;  1JKO C;  4B1R A;  1B8I A;  4DZJ A;  1U8B A;  1TWA J;  1UMQ A;  4QSH A;  2YS9 A;  1ETX A;  2DA5 A;  4D7N A;  1MH3 A;  2P81 A;  3FIS A;  2Y9Z A;  1JJ6 C;  1APL C;  1WGX A;  2CUE A;  5IYD J;  2DA6 A;  5EGO B;  1Z77 A;  3FKI J;  2JN6 A;  5HOD A;  1K61 A;  2H1K A;  2COB A;  2DMN A;  2VKE A;  4FE7 A;  5J1Y A;  2NS7 A; 
#chains in the Genus database with same CATH topology
 2IS6 A;  2QGU A;  3I55 I;  4H0E A;  4A0Z A;  4Y15 A;  5EEG A;  3PM1 A;  4U7D A;  2H27 A;  4ZYG A;  2VT3 A;  2HQ5 A;  2LY2 A;  4IEJ A;  2ZME C;  4Y33 A;  4PFO A;  4U0V A;  2R7U A;  2NNY A;  1SFK A;  1WJC A;  2MFZ A;  3CCQ I;  4A0X A;  3HOU J;  3J80 Z;  1ZH5 A;  1FTZ A;  1QRY A;  4IRG A;  1ACI A;  5FJ8 J;  2MSY A;  4OAZ A;  1H0M A;  2YU9 J;  2W00 A;  1OMI A;  1BW6 A;  1Z3X A;  2UXN A;  1Z91 A;  2E2I J;  4P55 A;  1OCC H;  1HA8 A;  4CZZ A;  2E35 A;  5KAF C;  4U0Y A;  3HPH A;  3AG3 H;  5M3F J;  1FNN A;  4RGS A;  3Q0W A;  2MH9 A;  2CFX A;  5GTH C;  5FB2 A;  3WTU C;  5HDG A;  4XRS A;  2E7W A;  1ZTR A;  2O9L A;  4N9H A;  1WCM J;  4II3 A;  5D6E A;  1T08 B;  2WBM A;  4MGR A;  2I5U A;  1BR2 A;  1TNT A;  4CSW A;  3VOE A;  2IT0 A;  1MD0 A;  3OYG A;  1O4X A;  3KZZ A;  2JTV A;  3S16 J;  3GCM A;  1OR7 C;  2G7H A;  2ZJQ F;  3M7G A;  4V2F A;  5FGM A;  3GTK J;  2E1M C;  4GO1 A;  4CYC A;  2FNA A;  4QIW N;  4Z2Y A;  2DYR H;  2V4J C;  2VBW A;  1VQO I;  3WTZ A;  2YR2 A;  5D6F A;  2B0L A;  1YLF A;  1FSE A;  5E20 A;  2R0Q C;  2OCC H;  3DEE A;  2BYV E;  2CJJ A;  2JA6 J;  2DOE A;  2GAU A;  3K4J A;  4R1H A;  3IWF A;  4ESB A;  4BHB A;  5E3M A;  2JUG A;  1LUJ B;  2ZJP F;  3I59 A;  3MD2 A;  5C3E J;  3TL4 X;  1V5F A;  3IH2 A;  3EUK L;  4M9X A;  1X1D A;  4N9I A;  2W4S A;  2HOE A;  1HW1 A;  4RAZ A;  3SDB A;  3GTM J;  1RNL A;  1MKM A;  3A01 A;  4AVP A;  5FRO A;  2E1O A;  2ZJR F;  3V7C A;  2A5W A;  3C3W A;  4LIV A;  1B72 A;  1OCR H;  3JCU C;  2QEX I;  4ZDL A;  4ENN A;  1IJW C;  2X6Y A;  4XIC A;  1AOY A;  2MYS A;  4RLQ A;  3CJN A;  1K6O A;  1WHU A;  2K40 A;  2LKS A;  3LMM A;  3VSL A;  5K5O A;  3G1O A;  3CD6 I;  1WSU A;  2JZY A;  3HZJ A;  2VQG A;  1W36 C;  4KYW A;  3DEU A;  4QWQ A;  1ZEL A;  5LFA A;  2BOL A;  3WGH A;  3OL3 A;  1XGO A;  1TT5 B;  1BIA A;  1YJN I;  4KN7 X;  5IPA A;  1KQ8 A;  2ZXJ A;  3QWL A;  3JSO A;  3FF5 A;  3TW6 A;  3OYL A;  1SFO J;  1MMA A;  1X1A A;  2MH2 A;  2PG4 A;  3R6S A;  3OSG A;  3EPZ A;  3HKZ N;  3GYH X;  5E79 C;  2HOA A;  3CUQ B;  3GXO A;  1JHH A;  2PMU A;  4RGR A;  2GIV A;  3GUD A;  3T5X A;  2K9N A;  2DJI A;  1UEL B;  2DO7 A;  2CWE A;  2PLY A;  5DTD A;  2R92 J;  1ON1 A;  1WJD A;  4DNC A;  4EAT A;  5GP9 A;  1HF0 A;  1UB9 A;  1XMA A;  2GQQ A;  4R8H A;  3ZQF A;  3CJR B;  3KPH A;  3FDY A;  1P7I A;  3D5R C;  5IYC J;  5FLV A;  2L02 A;  2PQ8 A;  3SEQ A;  1PVE A;  3VB2 A;  3ZRG A;  4J01 A;  2VB6 A;  1VQ8 I;  4GFB A;  2ZFW A;  1U5T B;  2KIM A;  3VYR B;  1D3Y A;  1A31 A;  1XGS A;  2K5C A;  2LOO A;  4YFX F;  4RAF A;  2ZCW A;  3FX3 A;  4S0H B;  2DAO A;  4HOB A;  2KIQ A;  3I4P A;  5CQE A;  1WJE A;  1G3T A;  3HHH A;  3K1M A;  3HJE A;  3NWT A;  2QVO A;  2V9P A;  2XPU A;  1WI9 A;  3OYK A;  5J8C A;  3K4C A;  5L3F A;  3QP5 A;  5M5W J;  1YX3 A;  1S72 I;  3CCY A;  2CV0 A;  3I56 I;  4AWX B;  3M8E A;  5M5X J;  1DP3 A;  4Y4R A;  2JA7 J;  4EV0 A;  2Y0M A;  3K2A A;  1TWH J;  4QPQ A;  2NOG A;  3DPT A;  1MBK A;  3GW2 A;  5H6R A;  1KU3 A;  3B6A A;  3PSF A;  2HVR A;  2HXI A;  1S6L A;  2XPV A;  3IH4 A;  1TBX A;  3A2K A;  1T98 A;  2EFN A;  3MWM A;  2VQL A;  2Y9Y A;  4E7J A;  3VWB A;  3BTI A;  1FBU A;  5E8I A;  3KZY A;  4YIF A;  3CC2 I;  5F1R A;  1RZ4 A;  1NH3 A;  1G4D A;  3S14 J;  5DDG A;  2B9S A;  1IG7 A;  3RPU A;  3FK7 A;  2L54 A;  2A07 F;  3ZMU A;  3FWE A;  1HOM A;  3MKL A;  3SFI A;  1WWX A;  3H0D A;  2PMZ A;  2ZNZ A;  2LBF B;  3AL0 B;  1YIO A;  4FE4 A;  1FOK A;  4BY1 J;  1D8K A;  4XLP F;  3K70 C;  4ZZD A;  2R7F A;  1I6H J;  3KLN A;  5LHG A;  1UG0 A;  3EUA A;  3CF5 F;  1OPC A;  2VJJ A;  1FY7 A;  5TRD A;  4NBQ A;  1IRZ A;  3VPR A;  1W7P D;  1N77 A;  4E7K A;  1MBG A;  4L18 B;  4Q47 A;  1QBJ A;  1UCR A;  3REO A;  1DQU A;  5DM7 F;  3JRG A;  1BOA A;  4EGY A;  4MHG A;  4QPO A;  3NAR A;  3LSK A;  3KZI C;  1B8I B;  1ZAO A;  3DP7 A;  3WU0 A;  3OYA A;  2QQA A;  2VBY A;  2IS4 A;  1TT0 A;  2LP0 A;  2HI3 A;  2KRF A;  3RSN A;  2R7Q A;  3BZ6 A;  1ETY A;  4D9J A;  3BPV A;  5AON A;  2CW0 F;  2ECC A;  2DLL A;  1MBF A;  1P7J A;  2JSP A;  4ITV A;  4DYC A;  4YG2 F;  1GT0 C;  4P1W A;  3T1B A;  5HVQ C;  1VQ7 I;  2XF5 A;  2OBP A;  2QSG X;  3FM5 A;  1T6S A;  2CQN A;  3B02 A;  2E1N A;  1MMD A;  1T38 A;  1TLH B;  2ADU A;  2Y0S N;  3KEY A;  4KA4 A;  4AYB A;  4U87 A;  3LAP A;  1BM9 A;  3GZ6 A;  5H20 A;  2RNG A;  4A6E A;  1BC8 C;  2M4G A;  2ZSH B;  3ZMZ A;  2ELH A;  3L9F A;  5KVR A;  1YQA A;  5HLG A;  3LWF A;  4AU7 A;  1QVU A;  2Z99 A;  1HCR A;  3Q0V A;  2AXT C;  2X4H A;  4BE1 A;  4CHU A;  3VDX A;  3U1K A;  3G71 I;  2GIZ A;  1YJW I;  2IS2 A;  4RAY A;  2LR8 A;  4HSR A;  1K6Y A;  4C30 A;  1KQ0 A;  4LMY A;  2ZC2 A;  3DU6 A;  1JGG A;  5D8L B;  5F27 A;  3K4N A;  2IJL A;  1QA6 A;  4W97 A;  1FSH A;  2YPR A;  2W1O A;  4E70 A;  4FET A;  3N97 A;  2Q1Z B;  5FO5 A;  3P9C A;  2VOO A;  1EH8 A;  4P9U A;  2EV6 A;  4HF2 A;  4YIR X;  2M30 A;  3FXK A;  2ZXW H;  3ZQI A;  3GZ5 A;  5GTI C;  4CCM A;  3CUQ A;  3HOS A;  3RPU D;  1PUF B;  1J2X A;  4C2T A;  4KMU X;  4BJT A;  4QTR A;  1IN7 A;  5C4X J;  1C0W A;  2F5V A;  3TGN A;  1MDM B;  2KDZ A;  1OYW A;  3F21 A;  3HM5 A;  3OYD A;  2IRF G;  2WAF A;  1S7A A;  1MND A;  4H4K C;  3RKX A;  1YIT I;  3FHZ A;  4I6Z A;  2GZW A;  1ZGJ A;  2AS5 F;  2K86 A;  1ORK A;  1Q1V A;  4FAS D;  3BY6 A;  4EQQ A;  2OTJ I;  1P4W A;  3OS2 A;  2M34 A;  2IBD A;  1FPQ A;  2ZJ2 A;  3FHN A;  3FMQ A;  2DCE A;  3DPU A;  3GF2 A;  3IV5 A;  2K85 A;  1U5T A;  5HDN A;  2OAZ A;  2NS8 A;  3MEX A;  2PBI A;  1G2H A;  4DBQ A;  4D0P A;  1Y1W J;  3TOB A;  4Q48 A;  4IHY A;  4AC0 A;  3TQN A;  2VXD A;  3DWL E;  3P9K A;  3HSF A;  5DCF A;  2ZXH A;  4E7L A;  4S05 A;  2FQ3 A;  1FLI A;  2Z5U A;  4UUV A;  4HF0 A;  3MZ8 A;  1Z0X A;  2LDU A;  3SEZ A;  2B63 J;  1OKR A;  4IHX A;  2UZK A;  1A36 A;  2WAD A;  3HPG A;  2CGP A;  2H8R A;  3GTP J;  4HX8 A;  2JUC A;  1LE8 B;  2EIK H;  2DFI A;  3F8N A;  4X1E A;  3BTL A;  3OYC A;  4YFN F;  2AHQ A;  2EPF A;  3J80 K;  1IRX A;  2NVU B;  3SXY A;  4I09 A;  1Z7U A;  3E5Q A;  4A3F J;  1ZG5 A;  1VQ5 I;  2WAQ N;  5FKO A;  1O3S A;  1VQL I;  3U9G A;  5HOO A;  3H5R A;  4XLF A;  3MCZ A;  5CJ9 A;  2IVM A;  1QO0 D;  5JHU A;  3U2R A;  4P5O A;  4S04 A;  2L9R A;  2P5V A;  1UZC A;  5KNL A;  1Z9C A;  2H1L A;  4LG3 A;  2QQ8 A;  1ZN2 A;  4EM2 A;  3FXR A;  3QOP A;  3RQ4 A;  2QQ9 A;  2FD5 A;  1QZE A;  2WB1 A;  3D5S C;  3CCS I;  1MMN A;  1K79 A;  1O3R A;  1R9T J;  2HZD A;  1HC8 A;  3CF2 A;  1DGR M;  1D8J A;  2VKV A;  2IGK A;  5LEK A;  2PJR A;  5GAH J;  3CLO A;  2IW5 A;  2LBF A;  3HXL A;  2E2H J;  2HVS A;  3KP7 A;  2H94 A;  2CS3 A;  3MVP A;  1AU7 A;  3T8R A;  3RCO A;  3DKW A;  2XAH A;  1HW5 A;  1AHD P;  2F5E A;  1U9O A;  2VE8 A;  3GVA A;  4XMY A;  3PUF A;  1OYY A;  4HRI A;  4YRV A;  4IKF A;  3R4K A;  2VQC A;  1WJF A;  4E7Z A;  2UXX A;  3H0G J;  5AIQ A;  2GOX B;  4KN4 X;  3G2B A;  3N05 A;  2HQN A;  2VLA A;  2GXA A;  3E3V A;  1A04 A;  4B1R A;  1B8I A;  3S93 A;  1BI2 A;  3J81 Z;  2XSJ C;  2DK8 A;  4D7N A;  2P81 A;  1JJ6 C;  1IF1 A;  2KRH A;  2KPM A;  4ZYD A;  1WGX A;  2CUE A;  4CYD A;  3KP2 A;  2DA6 A;  1QHG A;  4I99 C;  1YJ9 I;  5J4Y A;  4KDP A;  2DMN A;  4FCY A;  4ZZL A;  2V6C A;  3LST A;  3U21 A;  5LHH A;  3QU3 A;  1FTT A;  1IXC A;  3ABK H;  3IHU A;  4MQV A;  5DD4 A;  3ZN0 A;  1X2M A;  4WX9 A;  3CJT B;  1SD4 A;  2KIS A;  3WGG A;  1HKT A;  1HST A;  4MQ9 F;  3IL2 A;  9ANT A;  2M2E A;  3MKY B;  5HDK A;  4N4N B;  2O3F A;  2V1N A;  4MFD A;  1O3Q A;  2KJC A;  2XKO A;  1TC3 C;  1OCO H;  2KIU A;  2CW8 A;  4LLN A;  4XNF A;  2VBX A;  3ESW B;  1GV5 A;  3OR1 C;  5KK1 A;  1JTY A;  2F4M B;  4ZYE A;  3JR9 A;  5HS9 A;  4UHT A;  2H6C A;  4MEX F;  4I76 A;  1L0O C;  4M6V A;  4NHJ A;  3JRA A;  5DYM A;  3JRF A;  3E6B A;  5ILV A;  4NQW B;  2GXG A;  1ETW A;  5EEH A;  1XGN A;  2L0K A;  3BQZ A;  5K1Y A;  1ZK8 A;  1A5J A;  2QQB A;  5DCM B;  2WY7 Q;  1W36 D;  3WOD F;  2DXI A;  2X1C A;  1BJA A;  3PNY A;  3MKW B;  2EB7 A;  1PUF A;  4ENM A;  3I9V 2;  3QOD A;  3RPQ A;  1VQK I;  1S9H A;  1LVK A;  2DPD A;  5LRS A;  4KIF A;  1SVL A;  3F3X A;  1MDM A;  1Z6R A;  3OSF A;  1KU7 A;  4BKX A;  4ZTJ A;  4NB5 A;  3PIO F;  2VIX A;  1P9Q C;  1TW3 A;  2VAS A;  4JP0 A;  5FFZ A;  2MC3 A;  3CDI A;  2EZL A;  1MGT A;  1FIP A;  2F6C A;  2W48 A;  2EWN A;  2Y30 A;  3Q5F A;  3OIO A;  4XSZ F;  3GLX A;  3HGG A;  3HTS B;  1SFE A;  1HBX G;  3X2Q H;  5CPR B;  3OL4 A;  4UUS B;  3PSI A;  4A5M A;  2ICW G;  5F1J A;  3PO3 J;  1W1W E;  2LKP A;  1B6A A;  4EJV A;  4RGU A;  3OYN A;  3HSR A;  4EGZ A;  3AFH A;  1JUP A;  4L9T A;  3ZQQ A;  4UNO A;  2ESN A;  3I71 A;  2DYS H;  4RB2 C;  1CGP A;  1AWC A;  3NQO A;  4W1U A;  3LSP A;  1LE8 A;  3ABL H;  1IV6 A;  2HVQ A;  2R3S A;  2X48 A;  2YX7 A;  2GXB A;  1ODD A;  2K4B A;  3OOU A;  4LG0 B;  4XLA A;  2IS1 A;  5M3M J;  4KT6 A;  3KP3 A;  3T0Y A;  5GAE J;  2QSF X;  1YIJ I;  3QOE A;  4BBS J;  2D1H A;  3JAM Z;  1IZ1 A;  4XM3 A;  1V3F A;  2A6H F;  4I98 B;  1QVT A;  3S3M A;  2R7T A;  2XAG A;  3K1N A;  2XAJ A;  4GYI A;  3MQ0 A;  3DCF A;  2E19 A;  3O2P E;  4P9F A;  3OYF A;  3GEZ A;  2LFB A;  1Q1H A;  3ABM H;  4E7H A;  1JTX A;  3F6V A;  4HNT A;  4KMF A;  3JW4 A;  5IOY A;  4OIR F;  5F6F A;  2Z3Y A;  1IN4 A;  1K7A A;  3P7N A;  3ZQ7 A;  4BQA A;  2UUZ A;  3KP6 A;  2XDV A;  3E5U A;  5F0H A;  2XGC A;  1YE9 A;  2HTJ A;  1ZLJ A;  1IDY A;  3GBG A;  2L2O A;  2P8T A;  5FKM A;  1O7F A;  5ILU A;  5K5Q A;  2IGO A;  3IRR A;  1JUS A;  1Z7L A;  1IV8 A;  4AID A;  3BTJ A;  2P0W A;  2P4W A;  3PFI A;  5J47 A;  1BN5 A;  4D1Q A;  3CC4 I;  2E34 A;  2EA2 A;  5BQT A;  1G59 A;  2DOA A;  3OV8 A;  1V5G A;  2I10 A;  4PSW A;  2O61 A;  2XAU A;  4HDV A;  1MMG A;  1BBY A;  4BXX J;  3ABT A;  2X1E A;  1H8A C;  5TJJ A;  2NVT J;  3K70 D;  4ESJ A;  1MSE C;  4CO8 A;  2J5O A;  2J5P A;  3BCB A;  1N25 A;  2X9D A;  1XDS A;  5CYV A;  1FYK A;  1J75 A;  3I4M J;  4AIK A;  4PSX A;  4DQ2 A;  2HZT A;  1R71 A;  2K3F A;  4ZDP A;  4G9Y A;  2F48 A;  4PDK A;  3RKY A;  2VN2 A;  2DFF A;  4NC8 A;  1QNT A;  2ID3 A;  2WC2 A;  1QPM A;  3JRD A;  4XID A;  4D7M A;  1LDJ A;  1KU9 A;  4MFE A;  4A3G J;  2V9K A;  4JX4 A;  2MA3 A;  1MJA A;  1EH7 A;  1V55 H;  4Y3O A;  1GVD A;  4BAY A;  1IRG A;  4RB3 C;  3K6G A;  3WU2 C;  1IN8 A;  1BR4 A;  4ZYA A;  1LKX A;  1JHF A;  2CH0 A;  3Q9V A;  3K1P A;  2DMT A;  3M8F A;  3OS0 A;  3SHF A;  2Q8K A;  4RMN A;  1U5T C;  1IN5 A;  3K10 A;  1REP C;  4V2G A;  1MW7 A;  2NOJ B;  2EBI A;  3ERM A;  3R0J A;  2R5Y B;  1X1P A;  3S32 A;  3IWZ A;  2QSH X;  4JOM A;  3Q9S A;  3BRO A;  3F9K A;  3RJP A;  3ZMS A;  3G4S I;  3K9T A;  4BDY A;  2KHM A;  5IT9 Z;  3S2W A;  5JI6 A;  3QU6 A;  4II2 A;  3AAF A;  4DBR A;  4BU2 A;  1K4T A;  2L9V A;  4WXH A;  4F91 B;  2CMP A;  4BAC A;  4NQW A;  1XPX A;  3M3Y J;  3D0S A;  3LFK A;  1ZR2 A;  1XDU A;  1JKP C;  5DCM A;  3T8T A;  2ACJ A;  2Z33 A;  1D0X A;  1YW7 A;  1M1E B;  1ULY A;  3O8G A;  3V8K A;  1R23 A;  1XCV A;  2BY2 A;  4RS8 A;  2E5Z A;  4M74 A;  3PQK A;  4QLC U;  5KHD A;  2CQQ A;  3BG5 A;  1EF4 A;  3IH3 A;  4IL6 C;  1A35 A;  1FT9 A;  1W0T A;  4ABZ A;  1BW5 A;  4MIM A;  4N4O B;  4GDF A;  2HYF A;  3HKZ A;  2LH9 A;  1CF7 B;  1ZG1 A;  1PYV A;  4L9V A;  3UNG C;  4OIQ F;  4FX0 A;  3GTJ J;  3ABU A;  1IDZ A;  1LEA A;  3O3K A;  3WU1 B;  2PI0 A;  3ECO A;  1EJ9 A;  3OYM A;  4A3M J;  2I8D A;  3OYH A;  3CMM A;  3BC8 A;  4EMS A;  1I3Q J;  5ICE A;  2EIL H;  2VKD A;  4UUS A;  4CIC A;  2IA2 A;  2XB5 A;  3GWZ A;  2RV8 A;  2X6O A;  1F5T A;  5DS9 A;  3S8P A;  2XRN A;  2MLK A;  2STW A;  2MC4 A;  5LGU A;  3E6D A;  3H3V K;  1SVO A;  2K3P A;  3BDD A;  3R61 A;  1ERD A;  2HEO A;  2GWR A;  2MD5 A;  5FRM A;  1Z3Y A;  3HRM A;  4HA8 A;  2BEO A;  4G12 A;  1U9N A;  2QLZ A;  3IRQ A;  4LJZ F;  1GUU A;  4B8X A;  4HQM A;  1OFC X;  2HDD A;  4G7O F;  5E1Z B;  2HXO A;  2E1C A;  4LG0 A;  1LEB A;  2LSO A;  1I5Z A;  4E7S A;  1I50 J;  3IKV A;  2P5L C;  4IRI A;  3JTH A;  5LEJ A;  1W0U A;  3QAH A;  3BR6 A;  1OCZ H;  2GA1 A;  4EJW A;  4F55 A;  1RUO A;  2VUM J;  3TDU C;  3HBL A;  1O3T A;  4UY8 I;  3CME I;  1WH7 A;  2HKO A;  4BBR J;  2MLG A;  3V7R A;  1SD7 A;  1VQN I;  1BA5 A;  2P6S A;  3VSK A;  1KON A;  2WAE A;  3HEF A;  3S17 J;  4I2O A;  3L2U A;  2E2J J;  4D5C A;  1GVJ A;  1ZHF A;  1PUE E;  5IOZ A;  4XK4 A;  4C3I J;  1P4A A;  2FJ1 A;  3TW7 A;  3CP2 A;  4XN3 A;  2JWT A;  1ETK A;  2HR3 A;  5BNG A;  2OU2 A;  3H9G A;  2AXL A;  5D5X B;  4KFC A;  3IAS 2;  5E3N A;  2CUF A;  3H9Q A;  5IP9 J;  1ETO A;  5D4S A;  1A6I A;  4YII A;  3GME A;  1RET A;  3BJ6 A;  2P7V B;  2O5R A;  3PL8 A;  2RVC A;  2LRD A;  3WTT C;  3QYB A;  4A3I J;  2O8X A;  4XRF A;  3J81 K;  4BE0 A;  1RRJ A;  2K9L A;  5EEA A;  2IA1 A;  2ZBK A;  1QZZ A;  3WHC A;  1G3S A;  4XOP A;  3FMR A;  4N0B A;  3ZMT A;  1PP8 F;  1D1C A;  3EUH A;  2FML A;  2M1B A;  1R5I D;  4KUM A;  3D1N I;  2LG4 A;  2JA8 J;  3O8H A;  2RAE A;  2OPT A;  3L2W A;  2XPW A;  2CV2 A;  1ZYR F;  3DBR B;  4L0Y B;  4IO9 F;  3C2H A;  4C3J J;  3CCU I;  1Y0N A;  3HB9 A;  1P2F A;  4C2U A;  2FF4 A;  1WH5 A;  4UV9 A;  4BJ5 C;  4CA0 A;  1IUF A;  3FXJ A;  1KQ9 A;  3LSM A;  5JFR A;  5CQG A;  1Z21 A;  4ON0 A;  5JLX A;  2YSR A;  2F5F A;  3K4L A;  3RKW A;  4OOI A;  3JRC A;  1FYM A;  3KEQ A;  5F0C A;  4V19 K;  1R00 A;  3FXL A;  2XAF A;  2WY8 Q;  1H9G A;  2X1D A;  2YU3 A;  4F52 A;  4RLF A;  1SD6 A;  1Y39 A;  2DFH A;  1YOV B;  5EG0 B;  5F08 A;  4XON A;  1SFX A;  2DDB A;  2D45 A;  5FRN A;  5ICG A;  3RYP A;  1DGW Y;  3OIQ A;  4I01 A;  2NAZ A;  1I3A A;  3GTG J;  2V79 A;  2DFE A;  3LA2 A;  1X4O A;  2Y2Z A;  4A3E J;  2WWY A;  3BR0 A;  2P7C B;  2PJP A;  3K2Z A;  1I27 A;  5J1R A;  4L9J A;  2IP2 A;  3ZOB A;  2Y0S A;  2JRT A;  2MBF A;  2X51 A;  5K7H A;  3P9I A;  1RUN A;  2R5Y A;  2L9N A;  1T39 A;  2BY0 A;  1FIA A;  2VJ5 A;  3H36 A;  4CCN A;  3DPL C;  1I1G A;  2OQR A;  3ZMV A;  3GX4 X;  5BMZ A;  1RES A;  4LIU A;  4A0Y A;  3PFY A;  2E71 A;  2FOK A;  1P92 A;  4U7B A;  3OWT A;  5HNF A;  1EV7 A;  4HF1 A;  3IUO A;  3LA3 A;  3QPT A;  1STZ A;  2HS5 A;  5J4V A;  4M72 A;  1IGN A;  5AIP A;  2K9S A;  4HQE A;  5ILS A;  4BXU A;  3O6B B;  2XRL A;  1GHC A;  3DEW A;  3GFJ A;  3H3U A;  3G73 A;  2DT5 A;  1XB4 A;  3W6K B;  4KIB A;  4QSH A;  2VXZ A;  3C18 A;  1ETX A;  3H35 A;  3HL2 A;  2Y9Z A;  3FIS A;  3KET A;  4NNJ A;  3FXO A;  1APL C;  3S3O A;  1V5E A;  4ZTF A;  4XLH A;  4GCV A;  3AG4 H;  4WXC A;  1USS A;  1CF7 A;  1RR8 C;  1R5G A;  4OIN F;  3JTG A;  1K61 A;  2COB A;  2IPQ X;  2VKE A;  3F72 A;  3K0L A;  5J1Y A;  1JXS A;  4PZJ A;  4NUB A;  4IJA A;  4LK1 F;  1MJB A;  4PFP A;  4BQO A;  4ZJZ A;  1IXS B;  4DGW B;  1X3Z B;  3VFZ A;  3FXQ A;  5EZH A;  3W2W A;  1HXD A;  1PJR A;  1FP1 D;  4EEF G;  3TO9 A;  1H88 C;  4E4H A;  1IXR C;  2NVQ J;  2DI3 A;  3QPS A;  3S1Q J;  4RM2 A;  3HIF A;  2R93 J;  4CCJ A;  1MBE A;  4BUP A;  2CW7 A;  5LGT A;  3RKQ A;  3QPL A;  4J19 A;  2AQF A;  3J7A Y;  3MMY B;  3TP3 A;  5C44 J;  3ZXS A;  3JAM K;  2A3S A;  1IO2 A;  2ZSI B;  1GV2 A;  1YRN B;  2WV0 A;  1XSX A;  2XGE A;  1GLN A;  3ECH A;  2JPB A;  5K5R A;  5GPA A;  3H9J A;  3JRI A;  2LY9 A;  1W5T A;  4NDL A;  1F9N A;  1D5V A;  3C2G A;  2R7Z J;  1PDN C;  3ZCO A;  2PN6 A;  4M3E A;  3I58 A;  4A69 C;  3IP4 B;  3JRH A;  5F04 A;  2QUF A;  2BV6 A;  2DN0 A;  2BHY A;  5CVJ A;  2W24 A;  2HTS A;  1IW7 F;  2PFB A;  4FQG A;  4EJO A;  3QP6 A;  1BC7 C;  3CES A;  5B66 C;  2WAQ A;  2BVL A;  2KL4 A;  1CQT A;  3DV8 A;  5M5Y J;  5FLX Z;  3HRS A;  4CXF A;  4FT8 A;  5JR3 A;  4XKV A;  5B3S H;  3LQR A;  1QU3 A;  2HU9 A;  5J40 A;  4BL0 B;  2VQH A;  1EA3 A;  5ERI A;  2LRE A;  2RC4 A;  1ETQ A;  1F36 A;  3BG6 A;  3ZQH A;  2VE9 A;  3MZH A;  1XTA A;  2PEX A;  4IQJ A;  2DDA A;  2W85 A;  4IXA A;  1E3O C;  3L1P A;  4B3X A;  1SMT A;  3CC7 I;  1T0F A;  4RB1 A;  4D5F A;  1VF9 A;  4BXF A;  1FP2 A;  3OY9 A;  2VPL A;  1HKS A;  1QGP A;  5E18 F;  5J3L A;  3HDD A;  3I4N J;  1BI1 A;  5H2F C;  1ZLK A;  3BJA A;  2OCE A;  1TL8 A;  4C9Y A;  2HYG D;  1U3E M;  1G6N A;  4A3L J;  3S1M J;  2X0L A;  2L4A A;  5K7Z A;  3R0A A;  4F7Z A;  6PAX A;  3HOY J;  1KZH A;  1JJ8 C;  2FA5 A;  2GM4 A;  2F4O B;  1RR7 A;  5BOX A;  2LLK A;  1T2K A;  2HPI A;  4UVC A;  1F4K A;  1QPI A;  3KE2 A;  3OYI A;  4LGW A;  1F1Z A;  1IUY A;  4HLY A;  1U6G A;  2KFD A;  3E0J B;  5L3E A;  4DYR A;  4HG2 A;  3QPH A;  2E7X A;  4M9Z A;  3FM3 A;  2FX0 A;  2F5D A;  3BR1 A;  3ONQ A;  2ISZ A;  1U8R A;  1K83 J;  2M0C A;  5L3D A;  5J6X A;  1LB2 A;  2BXZ A;  1UHM A;  2V9V A;  4LD5 A;  1XMK A;  4Y7N J;  3V8J A;  1B4A A;  2DQR A;  1JGS A;  3LSG A;  1TWC J;  3F0C A;  2KMU A;  3NEU A;  5HS8 A;  1O7L A;  3M07 A;  4HST A;  3DKY A;  3GFL A;  2GOM A;  5B1B H;  3SFZ A;  2LYC A;  1B59 A;  3GFI A;  1JKQ C;  4U0W A;  2F4I A;  4L5I A;  1GDT A;  5LD2 C;  1KU2 A;  3BZC A;  4HX4 A;  3VYT B;  1W5S A;  3J7Z I;  5IT9 K;  2KDO A;  2EK5 A;  3COA C;  2A6T A;  2QZ8 A;  3WTV C;  2RQQ A;  2VPR A;  5C4J J;  4PJM A;  4JYK A;  1S5L C;  1E0E A;  4I7H A;  1HSJ A;  4A2U A;  1ETV A;  3WTX C;  1OLT A;  2COM A;  4LOC A;  4HX7 A;  2XF6 A;  4HPQ A;  1R49 A;  2M0M A;  1BJZ A;  1JKR C;  1HDP A;  4OMZ A;  4L5E A;  5EDN A;  4EM0 B;  3RZO J;  2OA4 A;  2H09 A;  3VOD A;  4HBL A;  5HLI A;  3EYI A;  2EIM H;  3L09 A;  1S7O A;  2JT1 A;  1ZRC A;  4YFK F;  1Y0U A;  5LRR A;  5A2Q Z;  2LKX A;  4UB6 C;  2KZV A;  4XOR A;  3S3N A;  2DMQ A;  2ISY A;  3GLL A;  2L3D A;  4A6D A;  4B09 A;  1E2X A;  2CQK A;  2A05 A;  2EQR A;  2W84 A;  4XKW A;  5IYB J;  4BJ6 C;  3F8B A;  3KYL A;  1AA7 A;  3OYE A;  4RA2 A;  4RB0 A;  3K7A J;  1WFX A;  2Y75 A;  2DT6 A;  3BLY A;  2RNJ A;  3TBI A;  3ZPL A;  1NHA A;  1XN7 A;  2E5N A;  4BHC A;  1DP7 P;  2K27 A;  3KEO A;  3FBN B;  4UVB A;  2OZU A;  3L00 A;  1B9N A;  1E3H A;  2JA2 A;  4A3C J;  1EKE A;  1YO5 C;  1HDD C;  3CMY A;  1X3W B;  3H5N A;  2VJI A;  3CCE I;  2G7U A;  3MN2 A;  5JVG F;  3W2V A;  1TW2 A;  4B3A A;  1XS9 A;  1IRF A;  2MAB A;  1BL0 A;  3DTI A;  5CVR A;  2QKL B;  4IF4 A;  5KAI C;  3W6V A;  1R4N B;  4ENJ A;  2R7X A;  2CG4 A;  5DEQ A;  1J9I A;  3BOQ A;  4CUG A;  2XAS A;  1OQY A;  3G6E I;  5TGT A;  2NVX J;  1I39 A;  4MEY F;  2L9S A;  3CLQ A;  2MG4 A;  2EFP A;  4I0B A;  1YRN A;  4RBO A;  4IOA F;  2ME0 A;  1IN6 A;  2KQR A;  1U2W A;  4HDU A;  3M8J A;  1ZGA A;  1LFB A;  2IAI A;  3QYF A;  1FMW A;  2STT A;  2H6B A;  1Y6I A;  2GA2 A;  3F8F A;  3E7L A;  5JVT A;  3RZD J;  1YTY A;  1WZ2 A;  1Z67 A;  3ERE D;  2DOF A;  3QRF F;  4XSX F;  5ICC A;  3RI4 A;  1SEU A;  1G3Y A;  3WTW C;  2DMU A;  1N78 A;  3KP5 A;  4FX4 A;  2OC6 A;  2Z2S B;  3W2A A;  1S8N A;  2DA3 A;  3HTU A;  4KJZ A;  1B9M A;  2HDW A;  2BW3 B;  3CJQ B;  4IZZ A;  1HQC A;  1ON2 A;  4X6A J;  4XRM A;  1W7P B;  1ZR4 A;  1E3P A;  4HEA 2;  4RM3 A;  4IHS A;  3H1C A;  3IKT A;  1XCB A;  2DT7 B;  1FJL A;  3V7S A;  1O57 A;  2M8G X;  4UVA A;  2JPC A;  3EDP A;  5D5V B;  2LNB A;  1XD7 A;  3L7W A;  4WXD A;  3VYU B;  4XN0 A;  4ETS A;  2DA4 A;  2KRC A;  4L9N A;  3FBI B;  1ZRE A;  4UUT A;  2QWW A;  5DV5 A;  2CQX A;  1KYW A;  3ROU A;  2X6X A;  2ELK A;  3WE3 A;  1LFU P;  3E6C C;  2GLO A;  5IT3 A;  2CO5 A;  1YYV A;  4ZH4 F;  3KCC A;  4DW6 A;  2AO9 A;  2FE3 A;  4HNU A;  2ECB A;  5LBQ A;  4XRS G;  2W57 A;  1A6Q A;  3MKZ A;  2L01 A;  5IP7 J;  2M3A A;  4GGG A;  5DUK A;  2XB0 X;  4EJU A;  4PJN A;  2DA7 A;  2W7N A;  4C3H J;  1SFU A;  4G6D A;  2FBH A;  2XAQ A;  2BY3 A;  4XLN F;  4Q5S F;  1TWF J;  2V6E A;  2BY1 A;  5CVI A;  3F8C A;  3HUG B;  4XOT A;  1XSD A;  2LK2 A;  4MTD A;  1OJL A;  5F0F A;  2ESH A;  1XGM A;  2WTE A;  3CUQ C;  1VND A;  1ONV A;  3CCL I;  2OUM A;  4L5J A;  4U88 A;  4AUX A;  4O5V A;  3OMY A;  2A5Y B;  4OIP F;  3UR3 C;  3BZK A;  4DJA A;  2O03 A;  4AD9 A;  4AIH A;  3SYT A;  1P6R A;  3F23 A;  4MNU A;  1UHS A;  3BWG A;  2KIF A;  3SDG A;  2NYX A;  3LNQ A;  2FRH A;  3KFW X;  2HQR A;  4JX6 A;  2XGX A;  4PJL A;  3W3C A;  1K78 B;  2FUG 2;  2VKH A;  3BCA A;  5LLQ A;  4M9S A;  2Q2E B;  4LFU A;  1MBH A;  3NRV A;  2FU4 A;  1S7E A;  4EJT A;  3HOZ J;  2DTR A;  3CQZ J;  4DZP A;  2FBI A;  2Z16 A;  3AKZ A;  3HOW J;  1YW8 A;  2V1D A;  2Y48 A;  4XR6 A;  3ZQG A;  3IAM 2;  2L7F P;  4F92 B;  4WK8 F;  2QF7 A;  4HV5 A;  2VBZ A;  3H3Z A;  1VQP I;  2JJ7 A;  3RDI A;  4EM1 A;  1TQM A;  2L7K A;  1D0Y A;  2CU7 A;  2R7O A;  3C2B A;  4LIT A;  1KGS A;  2Z1D A;  1MZB A;  2D2W A;  2H8W A;  2JVG A;  4HAM A;  4HLX A;  3TO6 A;  1R22 A;  1QZY A;  2DU9 A;  3TKY A;  2HOS A;  1VQ9 I;  1H89 C;  2E36 A;  2A69 F;  2C6Y A;  1YW9 A;  2ZO4 A;  4G6T B;  3L2Q A;  3CCM I;  2HFH A;  1RPW A;  4XLE A;  3SZP A;  1FX7 A;  2M9H A;  5EJC A;  4ZYH A;  4X0G A;  4GYG A;  1VI0 A;  4XL9 A;  3V42 A;  1L3L A;  1UAA A;  2G9W A;  5ED4 A;  4IHT A;  3A03 A;  2KKO A;  4BS9 A;  3KIO A;  3LQQ A;  2M5W A;  2FSW A;  4GRI A;  4BYY A;  3N4M A;  5EYR A;  4A3B J;  1T0F C;  1R36 A;  1Y56 A;  3DU5 A;  1VTN C;  1BI3 A;  3EYY A;  2G0E A;  3CTA A;  1VQ6 I;  2QBY B;  4KT5 C;  3B73 A;  4WCG A;  2JRM A;  4LLG F;  2V7F A;  5EZG A;  1X2N A;  2JK3 A;  1D1A A;  1YS7 A;  2GBY A;  3BP8 A;  5JLW A;  2R7S A;  2HQA A;  3AL0 C;  2LMD A;  4HZF A;  4BEH B;  4BGD A;  3TMO A;  3S2H J;  1X1B A;  2ZME B;  3E6M A;  3H92 A;  2XIG A;  4JK1 X;  2V26 A;  1W5C C;  1WJB A;  4I02 A;  4E6K G;  1MH4 A;  4OMY A;  2L7M P;  3Q3S A;  3HYI A;  2EIJ H;  5FLX K;  5JHF A;  2QEN A;  1ZRF A;  4A3D J;  2LC2 A;  3BTC A;  1YFH A;  4Z6Y A;  3DKX A;  1JKO C;  2Y69 H;  4PJJ A;  2QM3 A;  2BW3 A;  2V1X A;  2YS9 A;  1MH3 A;  3E5X A;  3H5A A;  2BXY A;  1W7P A;  5IYD J;  3OR2 C;  3F22 A;  4A5N A;  5EGO B;  2P5K A;  1GXQ A;  4FE7 A;  2NS7 A;  2FXA A;  4IPA A;  1SAN A;  3A4C A;  3DQV C;  1YG2 A;  1I6X A;  2E1M B;  2BVM A;  3M9A A;  2L5Q A;  2RN7 A;  3KYD B;  4ZDO A;  3J7A O;  2VT2 A;  1LFP A;  2CUJ A;  3JRB A;  2AQE A;  2CFO A;  3ZMD A;  3SJM A;  3TO7 A;  5L3C A;  3CO7 C;  1G8X A;  3ZGK A;  4G7H F;  3LL7 A;  3B6C A;  4MO7 A;  2LD5 A;  4IHV A;  3WTY C;  3DLL F;  2R4G A;  4NC6 A;  3OS1 A;  1FZP B;  2VJ4 A;  2DOD A;  1NTC A;  1R58 A;  1H9T A;  2XV4 S;  3PUB A;  1ITY A;  3I3L A;  4KIT B;  2IEK A;  2JA5 J;  4CZC A;  4IVN A;  1VFC A;  5HLT A;  2FNP A;  3F8M A;  3OIP A;  4F93 B;  1JUM A;  3HUG A;  1V54 H;  4PUS A;  2A61 A;  3QYE A;  2RQP A;  2VI6 A;  1FEX A;  2VL8 A;  4HV6 A;  3FIW A;  2X85 A;  1JE8 A;  5HLH A;  3LOC A;  1S29 A;  1R6R A;  3DBH B;  1FC3 A;  3U1D A;  4IX7 A;  1MMS A;  3PNV A;  3VEP A;  2OF7 A;  5FLM J;  2OD5 A;  2M7B A;  4LLL A;  1LQ1 A;  1NG6 A;  3BQY A;  3LAJ A;  1U0J A;  2ZNY A;  4TV7 A;  1KA8 A;  3ZP5 A;  1K78 A;  2R7V A;  3PNT A;  4Y13 A;  5LGN A;  3EQL F;  5HNH A;  3ZN1 A;  1TP4 A;  2VOP A;  3M1E A;  2Q2E A;  4BY7 J;  2OZ6 A;  4M3D A;  2PJR B;  1N75 A;  3HHG A;  4PJ0 C;  1T33 A;  2ZXI A;  3WG9 A;  2L4M A;  1VQM I;  5A2Q K;  3QQA A;  1WVR A;  1T95 A;  4IQ4 A;  1XC5 A;  2EIN H;  4XKC A;  3RYR A;  4A3J J;  1LVA A;  4ANJ A;  1T56 A;  2Y31 A;  2X6W A;  1ZQ3 P;  1LNW A;  2K9M A;  2PMZ N;  3DFG A;  3RIR A;  5K7F A;  4CH7 A;  2JMW A;  1ENH A;  5GAG J;  3HSE A;  2NS0 A;  1TWG J;  4KNY A;  4CCK A;  2HYJ A;  1UFM A;  1LDD A;  4G8X A;  2LVS A;  1OYI A;  2M7A A;  3E97 A;  3G3Z A;  2LTP A;  1JT6 A;  2EFO A;  3MZY A;  4IRH A;  2CRG A;  4LK0 F;  1J7K A;  1T8I A;  2FEZ A;  2ELJ A;  3EET A;  1X4P A;  2EV0 A;  1V4R A;  1Z1D A;  4F3Q A;  2ZB9 A;  2KLO A;  2MGQ A;  3A0H C;  2R7D A;  3PIP F;  1WJA A;  4PCQ A;  3S1R J;  1BR1 A;  1ZAR A;  1X1C A;  1SMY F;  4UXN A;  3HRU A;  4ASN A;  5BPD A;  2KT0 A;  3J7Y J;  4OAY A;  1UJ8 A;  2DK5 A;  2QBY A;  4KIS A;  2YUS A;  3BR3 A;  3CP8 A;  2ME6 A;  3MFK A;  2OTL I;  5EF6 A;  5D5W B;  2IA0 A;  3ELK A;  1R1V A;  2NNN A;  2CV1 A;  3OYJ A;  4AYB N;  3GZN B;  2VOD A;  2BE5 F;  4BEH A;  4JQF A;  3SQN A;  1DUX C;  5CLS A;  1LPQ A;  2ZME A;  1XSV A;  1JT0 A;  2VON A;  3M1C A;  3CZ6 A;  3PJR A;  4P96 A;  1SVM A;  3G1M A;  1DU0 A;  3PO2 J;  4DYQ A;  4J00 A;  3JSP A;  2FMY A;  3DLA A;  1W4M A;  3LSR A;  2CYY A;  4E7I A;  3FZV A;  4JX5 A;  2IGM A;  3HOX J;  2PMH A;  3DBL B;  2WV1 A;  2M45 A;  3WTS C;  1FBQ A;  2HGC A;  1YX5 A;  5D8K B;  2JSC A;  2PX9 A;  2K7L A;  4YEJ A;  4BE2 A;  2RRE A;  3V8L A;  2NXN B;  4Y52 J;  1K4S A;  1MSF C;  3BPX A;  2RKH A;  4M3G A;  5J1U A;  4G6Q A;  2A6E F;  3DXJ F;  4OU0 A;  3CO6 C;  2EJR A;  1J0R A;  5EGO A;  2XRO A;  3G1L A;  1PP7 U;  4CCL A;  2R5Z B;  3BJO A;  1HKQ A;  3LA7 A;  1J59 A;  3GO5 A;  2ID6 A;  1OR7 A;  2EZI A;  2ZFU A;  5H6Q A;  2D1V A;  1WJ5 A;  4IOC F;  3RQI A;  2UWM A;  1Y8R B;  2XGD A;  2O7O A;  2FBK A;  2NRA C;  3K4M A;  1VZ0 A;  5GAD J;  1RKT A;  2W25 A;  4M3F A;  1MNE A;  1BOB A;  1RKW A;  1VQ4 I;  1MIJ A;  4CDG A;  1U78 A;  4B47 A;  4G7Z F;  4C2M J;  1E17 A;  1GXP A;  2QCO A;  2OQG A;  3PQJ A;  1AKH B;  4DOZ A;  4L0Z B;  1WKM A;  2DA1 A;  2CQ7 A;  1YI2 I;  2F5C A;  2DJN A;  3I5U A;  3W6J B;  3L2R A;  1G3W A;  4GXO A;  1ZG3 A;  3DTK A;  4ZC3 A;  5L3B A;  3FMS A;  1R1T A;  3M4O J;  3BG9 A;  1WI3 A;  2K02 A;  4HW0 A;  4YEL A;  2JVH A;  2IGN A;  5GPC A;  4A3K J;  1UST A;  4A93 J;  3OOP A;  2M4K A;  1WQ2 A;  3CCJ I;  5FFX A;  2FQ4 A;  1MJ9 A;  2KJB A;  1F43 A;  5DM6 F;  4PK4 A;  4PGH A;  4A12 A;  2OJE D;  1YS6 A;  3RTR A;  5DUI A;  1YHQ I;  2VC0 A;  4FTH A;  5E3O A;  4CCO A;  4M3B A;  5CKT A;  1LJ9 A;  2EH3 A;  2KP6 A;  2MW8 A;  4DIQ A;  1Z6T A;  5CVV A;  4OIO F;  5E1W A;  4ESF A;  2M87 A;  3WG7 H;  2BHZ A;  2K4J A;  3CUO A;  3LSJ A;  3LSH A;  1HLV A;  2EZH A;  2LF8 A;  4BQQ A;  1JI8 A;  4MTE A;  2QKM B;  5DD8 A;  2MD0 A;  1WPK A;  3C1D A;  1D5Y A;  3L2C A;  3CDH A;  3OYB A;  5E3L A;  3TED A;  3ISP A;  3JRE A;  3Q0U A;  5EG0 A;  3K4B A;  4AVZ A;  4I0A A;  1FBS A;  2OV7 A;  3BG7 A;  3VYS B;  1X19 A;  5CVU A;  4BH9 A;  3CMA I;  4G94 A;  3SZT A;  3LSI A;  1OIS A;  2WB1 N;  5B1A H;  3S15 J;  4UB8 C;  4R79 A;  4LB5 A;  3K69 A;  4M6X A;  2W82 A;  1FOW A;  3KYC B;  3UKG A;  1POG A;  3CDL A;  3KP4 A;  2D5V A;  1SAX A;  1SAU A;  2EZK A;  5E17 F;  3F6O A;  1D1B A;  2EFW A;  1OCT C;  2HOT A;  1FWZ A;  3P5J A;  2ETH A;  2NVY J;  1J09 A;  5BS6 A;  4O6J A;  3NAU A;  5ICF A;  5FD6 A;  3GFM A;  1SC7 A;  2N8G A;  1IAW A;  3AG2 H;  3R60 A;  5D5U B;  4ENK A;  1NK3 P;  2KZG A;  2Q0O A;  5LHI A;  4BDZ A;  1DDN A;  4K2E A;  5BPI A;  3WHB A;  3A1Y A;  2WA0 A;  1P4X A;  1B1B A;  3BT9 A;  3S1N J;  5IP6 A;  1R5H A;  4MLO A;  4RGX A;  2EV5 A;  2YX4 A;  4AM3 A;  2FOW A;  4BNC A;  1NK2 P;  4CYC B;  5HS7 A;  4NC7 A;  4XQF A;  3D5L A;  3ZR8 X;  4BHP A;  1WRJ A;  3HOT A;  4JBA A;  3NWS A;  4XBF A;  2TCT A;  3A0B C;  4EVI A;  4KIG A;  3LFU A;  3I64 A;  3FK6 A;  5F64 A;  2K9Q A;  3ML6 A;  1KYZ A;  1XG1 A;  5IY5 H;  2DMP A;  1OCP A;  4IHW A;  5D4R A;  1ZRD A;  1FOX A;  1EH6 A;  2XHK A;  1Y1V J;  3AG1 H;  4B44 A;  3GTO J;  2HNH A;  2BZT A;  4HNV A;  1X3U A;  4M73 A;  5FKN A;  1QHH D;  2HWV A;  3I59 B;  4WF2 A;  4CGZ A;  3WGI A;  1DPR A;  1R7J A;  2B7E A;  5B5E C;  1RI7 A;  3DTE A;  5FD5 A;  2LF7 A;  1ZKG A;  1MNM C;  1I1S A;  3MAJ A;  2XUB A;  2XF7 A;  2JQ7 A;  1MBJ A;  3HG9 A;  1R1U A;  1XX5 A;  2M8E A;  2DW4 A;  2DQL A;  4Y17 A;  3E1S A;  3A01 B;  3EUH C;  3HRT A;  4PGG A;  2L7Z A;  4M6Y A;  3BG3 A;  3FXM A;  2O6G E;  4RAG A;  5E8G A;  3I54 A;  3ULQ B;  3HC7 A;  1B72 B;  2DTZ A;  5L3G A;  5TIS C;  2HDC A;  2TRT A;  5KCM A;  3HOV J;  1FMV A;  2LY1 A;  2HPM A;  1SD5 A;  1IC8 A;  4UV8 A;  4FIS A;  4KIC A;  2E60 A;  3ASN H;  1UG2 A;  2P6T A;  4OWR B;  1Y8Q B;  4RDU A;  3I0T A;  5E1X A;  2XVC A;  2R5Z A;  2BGC A;  2O8K A;  1BIB A;  4B48 A;  2O0Y A;  3ASO H;  4XKB A;  2EFQ A;  3BR2 A;  1RIO H;  1TTY A;  1XMX A;  2RGV A;  5FKK A;  4BQN A;  3S2D J;  1DPU A;  2IXS A;  3TOA A;  1UHW A;  2HKX A;  3V4G A;  2QA4 I;  3ZQL A;  3K4K A;  2Z9O A;  1DU6 A;  1AKH A;  3C7J A;  1X58 A;  3BR5 A;  1J5Y A;  3KLO A;  1TZL A;  1ZGW A;  2BBY A;  1BI0 A;  2TDX A;  1HW2 A;  3TDZ C;  2XSD C;  2DA2 A;  2UV1 A;  4WWC A;  1LDK B;  2R7W A;  1Z05 A;  1R4M B;  2VC1 A;  1RC9 A;  3FKJ A;  3L2V A;  3CCR I;  4O3M A;  1FOY A;  3A02 A;  3WE2 A;  5FKL A;  2DPU A;  2CSO A;  4LB6 B;  4XLC A;  1TNS A;  4B4C A;  1QQI A;  1S3J A;  3TP0 A;  1TQI A;  3GTL J;  2RDP A;  3KX2 A;  3IC7 A;  2A68 F;  4B43 A;  1TQP A;  3FXU A;  2EA4 A;  3ZQC A;  4M71 A;  2XKP A;  4AIJ A;  4HYE A;  3GTQ J;  3HGY A;  2F2E A;  3I53 A;  4DZJ A;  1U8B A;  1TWA J;  1UMQ A;  3SZG A;  2DA5 A;  1FYL A;  3CCV I;  2CUZ A;  2V1U A;  2DBB A;  1D0Z A;  2QYO A;  4Q4Z F;  2XC7 A;  2R7R A;  3DF8 A;  1Z77 A;  3FKI J;  2JN6 A;  4FHT A;  5J8F A;  5HOD A;  2H1K A;  2ZKZ A;  1NG7 A; 
#chains in the Genus database with same CATH homology
 1SAN A;  1FTT A;  3PM1 A;  2HQ5 A;  4IEJ A;  5EZH A;  1X2M A;  4EEF G;  1H88 C;  3HOU J;  2NVQ J;  3QPS A;  1QRY A;  1FTZ A;  5FJ8 J;  2MSY A;  3S1Q J;  2YU9 J;  3JRB A;  1BW6 A;  2R93 J;  3SJM A;  9ANT A;  2M2E A;  2E2I J;  1MBE A;  3B6C A;  4MO7 A;  5M3F J;  2LD5 A;  4IHV A;  3Q0W A;  3RKQ A;  3QPL A;  4J19 A;  4MFD A;  3TP3 A;  1TC3 C;  5C44 J;  4XRS A;  1NTC A;  1ZTR A;  1GV5 A;  2O9L A;  1GV2 A;  1WCM J;  1YRN B;  1JTY A;  2XGE A;  1ITY A;  3JR9 A;  2IEK A;  2JA5 J;  4I76 A;  1VFC A;  5GPA A;  3JRI A;  2LY9 A;  4M6V A;  4NDL A;  3JRA A;  3JRF A;  2R7Z J;  1O4X A;  3S16 J;  1JUM A;  4M3E A;  4A69 C;  1ETW A;  2L0K A;  3BQZ A;  5F04 A;  1ZK8 A;  4V2F A;  3JRH A;  1A5J A;  2DN0 A;  3GTK J;  4CYC A;  2VI6 A;  1FEX A;  3FIW A;  4QIW N;  3LOC A;  1PUF A;  2OF7 A;  5FLM J;  2R0Q C;  3BQY A;  1CQT A;  5M5Y J;  2CJJ A;  2JA6 J;  3OSF A;  4BKX A;  5E3M A;  4JP0 A;  1ETQ A;  1F36 A;  4BY7 J;  2EZL A;  3ZQH A;  5C3E J;  4M3D A;  3IH2 A;  1T33 A;  1FIP A;  2W48 A;  1E3O C;  3L1P A;  2Y30 A;  3OIO A;  3HGG A;  3QQA A;  4D5F A;  1VF9 A;  1XC5 A;  3GTM J;  3HDD A;  4A3J J;  5J3L A;  3I4N J;  4UUS B;  5F1J A;  1T56 A;  3PO3 J;  3A01 A;  2Y31 A;  1ZQ3 P;  2E1O A;  2PMZ N;  1B72 A;  5K7F A;  4A3L J;  3S1M J;  2JMW A;  1ENH A;  5K7Z A;  1JUP A;  1IJW C;  3HOY J;  1TWG J;  1JJ8 C;  2HYJ A;  2GM4 A;  4XIC A;  2LVS A;  1RR7 A;  4W1U A;  3LSP A;  2LLK A;  2LTP A;  1JT6 A;  1LE8 A;  1IV6 A;  2K40 A;  2X48 A;  2CRG A;  1QPI A;  3G1O A;  3OOU A;  5M3M J;  4DYR A;  4BBS J;  2ZB9 A;  5IPA A;  2FX0 A;  2MGQ A;  3BR1 A;  1QVT A;  3TW6 A;  1SFO J;  1K83 J;  3S1R J;  2M0C A;  3DCF A;  2E19 A;  2LFB A;  3OSG A;  3HKZ N;  4Y7N J;  2KT0 A;  1JTX A;  3LSG A;  1TWC J;  2HOA A;  3F0C A;  5IOY A;  1JKQ C;  1GDT A;  2K9N A;  2YUS A;  3BR3 A;  5DTD A;  2ME6 A;  5F0H A;  2XGC A;  1IDY A;  3GBG A;  5EF6 A;  5FKM A;  2R92 J;  2VPR A;  5C4J J;  4JYK A;  4AYB N;  1ETV A;  1JUS A;  4LOC A;  5GP9 A;  3BTJ A;  1HF0 A;  3ZQF A;  1JT0 A;  1P7I A;  5FLV A;  5IYC J;  1BJZ A;  4GFB A;  3G1M A;  1JKR C;  1HDP A;  5EDN A;  4L5E A;  2I10 A;  3RZO J;  1DU0 A;  3PO2 J;  4DYQ A;  4BXX J;  1H8A C;  3LSR A;  2NVT J;  4JX5 A;  2LKX A;  1MSE C;  2X9D A;  2DMQ A;  4S0H B;  3HOX J;  2WV1 A;  3I4M J;  2EQR A;  5IYB J;  2XPU A;  4Y52 J;  1MSF C;  4M3G A;  5J1U A;  3K7A J;  5EGO A;  2ID3 A;  5M5W J;  3G1L A;  3JRD A;  4XID A;  4D7M A;  3CCY A;  2R5Z B;  4MFE A;  4A3G J;  5M5X J;  4JX4 A;  2JA7 J;  2ID6 A;  2EZI A;  3K2A A;  1TWH J;  1GVD A;  4A3C J;  1HDD C;  2NOG A;  1MBK A;  3CMY A;  3RQI A;  3B6A A;  2XGD A;  2O7O A;  2HXI A;  3MN2 A;  2DMT A;  2XPV A;  1RKT A;  3IH4 A;  4M3F A;  4B3A A;  1XS9 A;  1RKW A;  1U78 A;  1BL0 A;  2Y9Y A;  4C2M J;  3W6V A;  4V2G A;  2QCO A;  1AKH B;  3BTI A;  2DA1 A;  2EBI A;  2DJN A;  3S14 J;  2R5Y B;  3M4O J;  1IG7 A;  3BG9 A;  2NVX J;  3FK7 A;  1WI3 A;  2MG4 A;  1HOM A;  3MKL A;  3SFI A;  5GPC A;  4A3K J;  1YRN A;  4RBO A;  2ME0 A;  4A93 J;  2FQ4 A;  4FE4 A;  1F43 A;  4BY1 J;  1LFB A;  4FTH A;  2IAI A;  1I6H J;  5E3O A;  4M3B A;  3M3Y J;  2EH3 A;  1IRZ A;  2MW8 A;  3E7L A;  3VPR A;  1ZR2 A;  3RZD J;  1MBG A;  1JKP C;  3JRG A;  2DMU A;  3LSJ A;  3O8G A;  3NAR A;  1HLV A;  2DA3 A;  2EZH A;  1B8I B;  2CQQ A;  3BG5 A;  1EF4 A;  3IH3 A;  1WPK A;  2LP0 A;  1D5Y A;  1W0T A;  4ABZ A;  2HI3 A;  4X6A J;  1BW5 A;  4MIM A;  4XRM A;  1ZR4 A;  5E3L A;  1ETY A;  3TED A;  1FJL A;  3JRE A;  3Q0U A;  2ECC A;  1MBF A;  1P7J A;  4DYC A;  5EG0 A;  2M8G X;  1GT0 C;  1IDZ A;  3GTJ J;  4A3M J;  2DA4 A;  2WB1 N;  3S15 J;  2Y0S N;  1I3Q J;  4UUT A;  3UKG A;  1POG A;  4UUS A;  3CDL A;  2CQX A;  2D5V A;  2XB5 A;  2X6O A;  2EZK A;  2GLO A;  2ELK A;  1LFU P;  5DS9 A;  1OCT C;  2HOT A;  3H3V K;  2NVY J;  1QVU A;  3NAU A;  2AO9 A;  4DW6 A;  1HCR A;  3Q0V A;  2ECB A;  4XRS G;  4G12 A;  1U9N A;  5IP7 J;  2N8G A;  2LR8 A;  1GUU A;  2XB0 X;  1NK3 P;  1OFC X;  2DA7 A;  1JGG A;  4C3H J;  2HXO A;  2HDD A;  5F27 A;  3WHB A;  1I50 J;  3BT9 A;  1TWF J;  5IP6 A;  3S1N J;  4MLO A;  4W97 A;  1W0U A;  3BR6 A;  2LK2 A;  1OJL A;  1NK2 P;  5F0F A;  2VUM J;  4CYC B;  3HBL A;  3ZQI A;  1WH7 A;  1VND A;  4BBR J;  1BA5 A;  2TCT A;  4AUX A;  1PUF B;  3HEF A;  3S17 J;  3FK6 A;  2E2J J;  4D5C A;  2K9Q A;  4QTR A;  5IOZ A;  4XK4 A;  1UHS A;  5C4X J;  4C3I J;  3SDG A;  1XG1 A;  3LNQ A;  2FJ1 A;  4JX6 A;  3TW7 A;  2DMP A;  1OCP A;  4IHW A;  2KDZ A;  2JWT A;  1ETK A;  5BNG A;  3HM5 A;  1Y1V J;  3GTO J;  5E3N A;  4HNV A;  2CUF A;  5FKN A;  4I6Z A;  5IP9 J;  1MBH A;  1ETO A;  1ORK A;  1Q1V A;  1S7E A;  3HOZ J;  1A6I A;  2M34 A;  1ZKG A;  3CQZ J;  1RET A;  4FCY A;  4DZP A;  2IBD A;  1MNM C;  3HOW J;  1MBJ A;  4A3I J;  3IV5 A;  5EEA A;  3ZQG A;  2NS8 A;  3WHC A;  1G2H A;  3A01 B;  2L7F P;  1Y1W J;  4IHY A;  2L7Z A;  4AC0 A;  3BG3 A;  3D1N I;  2QF7 A;  1B72 B;  2DTZ A;  2JA8 J;  3O8H A;  2RAE A;  2OPT A;  2JJ7 A;  2XPW A;  2TRT A;  1Z0X A;  3HOV J;  2CU7 A;  3C2B A;  2B63 J;  4C3J J;  4IHX A;  2HOS A;  3HB9 A;  2H8R A;  1IC8 A;  1WH5 A;  1H89 C;  3GTP J;  1IUF A;  4FIS A;  1LE8 B;  1UG2 A;  4X1E A;  3BTL A;  5JLX A;  4RDU A;  1RPW A;  2R5Z A;  3JRC A;  2M9H A;  5F0C A;  2AHQ A;  2O8K A;  1VI0 A;  4A3F J;  5EG0 B;  5F08 A;  3A03 A;  2WAQ N;  5FKO A;  3BR2 A;  5FKK A;  5EYR A;  3S2D J;  4A3B J;  2L9R A;  3GTG J;  2Y2Z A;  4A3E J;  3ZQL A;  3BR0 A;  1DU6 A;  1AKH A;  5J1R A;  1X58 A;  2G0E A;  2FD5 A;  3BR5 A;  3ZOB A;  1ZGW A;  5K7H A;  2R5Y A;  1R9T J;  5EZG A;  1X2N A;  1FIA A;  2XSD C;  2DA2 A;  2JK3 A;  2VKV A;  1RES A;  2GBY A;  5JLW A;  2E2H J;  3S2H J;  3MVP A;  1AU7 A;  3A02 A;  5FKL A;  4B4C A;  1AHD P;  1U9O A;  3TP0 A;  3GTL J;  1MH4 A;  2L7M P;  3Q3S A;  1IGN A;  2K9S A;  3H0G J;  2XRL A;  3DEW A;  4A3D J;  3BTC A;  3ZQC A;  3GTQ J;  3HGY A;  1JKO C;  4B1R A;  1B8I A;  4DZJ A;  1U8B A;  1TWA J;  1UMQ A;  4QSH A;  2YS9 A;  1ETX A;  2DA5 A;  4D7N A;  1MH3 A;  2P81 A;  3FIS A;  2Y9Z A;  1JJ6 C;  1APL C;  1WGX A;  2CUE A;  5IYD J;  2DA6 A;  5EGO B;  1Z77 A;  3FKI J;  2JN6 A;  5HOD A;  1K61 A;  2H1K A;  2COB A;  2DMN A;  2VKE A;  4FE7 A;  5J1Y A;  2NS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...