5E8GA

Crystal structure of the dna binding domain of human transcription factor fli1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
b'GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Friend leukemia integration 1 transcription factor
publication title Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e8gA00
3P7NA 1QPMA 2M30A 1BBYA 3CO7C 5BS6A 1XGSA 3L00A 1FP2A 1IXCA 3I58A 1OYWA 2AS5F 3T1BA 2V6CA 4EM0B 2ZMEB 1Z6TA 4A0XA 3ML6A 2UXNA 2W85A 3HSEA 4ESBA 3TDUC 2P7CB 2QQBA 1IW7F 2VBZA 2Z3YA 1IZ1A 3RPQA 2L01A 4CHUA 5ERIA 3TO6A 2RDPA 4Q47A 1EH6A 1MZBA 1ZN2A 2GAUA 2K02A 4K2EA 3HRTA 2NYXA 4AIKA 3RYPA 1KQ0A 3CUOA 2M45A 2HZTA 1ON1A 3DF8A 2OD5A 2VOOA 3J81Z 1W5TA 4BHCA 2QUFA 1SD7A 4AIHA 2PJPA 1KYZA 4G6DA 3G73A 3R0JA 2P8TA 1ZGAA 3R0AA 1P4AA 2PEXA 1B1BA 2IRFG 3I0TA 2EFPA 5TRDA 3LFKA 4M71A 3TDZC 3T8TA 4NHJA 2FQ3A 3WTWC 1I5ZA 2HOEA 4EJWA 2IT0A 3CUQB 3R6SA 4CYDA 3GUDA 4CO8A 2BBYA 3ULQB 2LKPA 1KU2A 1FYLA 4QLCU 1KU7A 2EA4A 2GXBA 4I09A 4AIJA 1DPRA 5CVJA 3IWZA 1FC3A 4KA4A 3JTHA 2IPQX 5ILUA 3GW2A 2HR3A 2W25A 4LD5A 3R61A 2VE8A 1FPQA 1I27A 3D5LA 1AWCA 3C7JA 5CVRA 1LEAA 4LMYA 1P6RA 3CTAA 1XMAA 3DP7A 2DAOA 1FYMA 3C3WA 1T0FA 2GA1A 3ABTA 1ZH5A 4QWQA 1OKRA 2XAJA 1U78A 2FBIA 3Q9VA 3RJPA 2LF7A 3QRFF 4EJUA 2P5VA 2YX7A 4UUVA 2R7FA 3K1NA 4E70A 4GXOA 3HHGA 1B9NA 2VBYA 3HRMA 3O2PE 2FMLA 5L3BA 4YIFA 5F6FA 4A6DA 3N97A 1OYYA 1SMTA 4UV9A 4RB2C 2XAQA 2MLGA 4EQQA 3GYHX 1UFMA 2J5OA 1ZAOA 3I59A 2L02A 4Z2YA 2A5YB 3F6OA 4UVBA 4HLYA 1IUYA 2DQLA 1EV7A 2E1CA 2CW0F 3J7AO 3M1EA 1ZLKA 2EFQA 2DBBA 1J9IA 2DO7A 4L9NA 4U7DA 3KEOA 3PFIA 3MZHA 2VONA 3SXYA 3QP6A 3FZVA 2FE3A 5K5OA 5L3CA 3ZMSA 2EA2A 3V7SA 2V1XA 5HDKA 1BJAA 3WTUC 4UHTA 5DDGA 3E6CC 3WTTC 3K69A 3ZP5A 2QYOA 4N9HA 2O0YA 3FX3A 4A12A 1ZGJA 1T6SA 2R7DA 1G3SA 3EYYA 5HVQC 2MC3A 1DPUA 2HTJA 3LAJA 3JTGA 4P96A 2EK5A 3ZQ7A 3HSRA 4LLLA 2QM3A 4WXCA 4HV6A 4RGRA 3F6VA 2BEOA 5DYMA 1H9TA 4R8HA 2TDXA 1QO0D 2A68F 1D8KA 2DK8A 2RNJA 4M6YA 2P6TA 3RDIA 2STTA 4M9SA 1XSDA 1YW8A 1R7JA 2HYGD 4DNCA 2O61A 2P5LC 2F5CA 5HDGA 1HKTA 4KNYA 1A04A 1WRJA 2FU4A 3GLXA 5FFXA 2K7LA 1MJ9A 1IRGA 3J80K 1IN7A 1XDSA 1S29A 1KA8A 1SD4A 1W7PA 2PBIA 1D8JA 2LDUA 1K78B 3E6BA 2DQRA 1B9MA 3BWGA 3D0SA 5CVUA 2HTSA 5D4SA 4EM2A 1XCBA 2FEZA 5D5VB 3KE2A 1DUXC 4IRIA 1XCVA 2Q0OA 4A0ZA 1AOYA 4TV7A 5LGTA 4O3MA 4ZYEA 3GFLA 4LB5A 2FBHA 1SFEA 5IT3A 3LQQA 4L9JA 1YIOA 3F22A 5LHHA 3K1MA 1FY7A 1Z6RA 4YIIA 1BOAA 1K7AA 3IL2A 5JR3A 2ZMEA 4CICA 3P9CA 4BNCA 4L9TA 1KYWA 1HQCA 4A0YA 3LA7A 4OIPF 1MDMA 3KCCA 4JQFA 2XIGA 3VEPA 3R4KA 1J0RA 1SFUA 3PQJA 1BIBA 4MTEA 5FFZA 1J75A 1J5YA 5CLSA 1QZZA 1R1TA 3HIFA 2L4AA 3ZN1A 1FOKA 2K86A 2RV8A 1SD5A 3BPVA 4R79A 4I0BA 5K1YA 1ULYA 3I53A 5JI6A 2MD5A 1TNSA 1Z05A 3ROUA 1J7KA 3FWEA 4CDGA 2DU9A 3COAC 5E18F 4OIOF 2A6HF 3KFWX 1MKMA 1KU9A 3WGIA 3NRVA 3MQ0A 3Q9SA 4U88A 4KN4X 5CVIA 1IN5A 4HV5A 4HX8A 1F5TA 2JT1A 4BHPA 2AXLA 1TW2A 3WGHA 3BZ6A 3KLOA 3KEQA 1O3SA 5LHGA 1TQMA 3P9KA 2GA2A 1RIOH 2HKOA 3WU1B 5D6EA 1WQ2A 4MQ9F 2OBPA 2R3SA 4HAMA 1W5SA 2QWWA 5E1WA 5DUIA 5D5UB 5LLQA 2LNBA 1KQ9A 3FM3A 3DEUA 1QNTA 2KJBA 4BHBA 2MBFA 4L5JA 2L4MA 4BYYA 1HW1A 4HOBA 3F8BA 4KMFA 2D1VA 1QGPA 3M8EA 4N0BA 1TNTA 2GXGA 1K6OA 2PMHA 2ZCWA 2XKOA 2VN2A 4U0VA 4LB6B 1YG2A 4ESFA 1FNNA 1MDMB 4I2OA 3I4PA 1H0MA 1XN7A 2FXAA 3GO5A 4U0WA 1GXPA 4HLXA 4UVCA 3BJ6A 3JW4A 2HWVA 2CO5A 3F8FA 3E5XA 1S7OA 1TQIA 3CO6C 2XUBA 2D2WA 3SZPA 2BGCA 2H27A 4MEYF 2G7HA 5LGNA 1JHFA 1FYKA 5BPDA 2RC4A 3QPHA 3KP3A 3VOEA 4N9IA 1HBXG 5FLXZ 4NQWA 1FT9A 5ICFA 2RN7A 1R1UA 2H09A 4HZFA 4ZZLA 2HS5A 3ZPLA 2MH9A 4XLNF 3ZMDA 1LEBA 2VXZA 3DQVC 2L54A 3IRQA 1LNWA 2ISYA 1LVAA 2FNPA 4PGGA 3KZZA 4WXDA 1X3UA 4KIBA 4RB3C 5HOOA 4NB5A 3P9IA 4UV8A 2OA4A 3FF5A 5H6RA 1ZHFA 1V3FA 2QLZA 2WTEA 4ETSA 2PG4A 4Y15A 5D4RA 1IAWA 3HOTA 2K27A 3H92A 3TQNA 1WKMA 3I64A 1XGMA 1YTYA 4ZH4F 3FHZA 3BROA 4MHGA 1R36A 4P5OA 3F3XA 3M9AA 4ENMA 1TBXA 3CJNA 3GEZA 3FMQA 5L3GA 4LK0F 2H6CA 4LFUA 2EWNA 5E8GA 1G3TA 3EUHA 2ISZA 3GFMA 3MZYA 3E3VA 4MGRA 1K79A 4IPAA 5HDNA 2FNAA 1U2WA 1ZG3A 4HQMA 1TQPA 3CLOA 1XD7A 2ESNA 4JK1X 4OIQF 1CGPA 2B0LA 2XV4S 5HLGA 4ZYGA 1YS7A 4FT8A 1FSHA 2A07F 3FXQA 1R58A 3V8LA 3LA3A 4EMSA 5JVTA 5K5RA 5DD8A 1KQ8A 5K5QA 5HLIA 1MD0A 2V1UA 2EJRA 2H94A 1IXRC 4G7OF 4YFKF 3JSOA 1SAXA 5A2QK 1SD6A 1K78A 1GXQA 3GX4X 1BI0A 4EJOA 1ZG5A 3EYIA 3OV8A 1Z91A 3EQLF 4O6JA 2EV6A 4EJVA 2FSWA 3I5UA 5D8LB 4Q48A 1MGTA 1LDDA 3MAJA 4R1HA 4MTDA 2ACJA 1F4KA 4MNUA 2O8XA 3ZMVA 2X4HA 2OQRA 1ZRFA 5BQTA 5BMZA 1S6LA 1WWXA 5LGUA 4M9ZA 1OPCA 3ERED 2P5KA 1YW7A 1KU3A 5HS7A 4HBLA 2K4BA 3I71A 3GFJA 1P4WA 1PDNC 1B6AA 5ICCA 4WF2A 3ECHA 2F5DA 2RQPA 2NRAC 4MEXF 2Q8KA 1HW5A 3ZN0A 3FXUA 2Z9OA 3LSTA 3KP6A 4IRGA 2A3SA 1RUOA 1U5TB 1FP1D 4ZZDA 2IJLA 2EFNA 1G6NA 2G7UA 4I7HA 1TW3A 2W24A 1EH7A 3QP5A 2EB7A 5FO5A 3V8JA 1E17A 3IKVA 4D0PA 2XAGA 3WODF 3WU0A 1IN6A 3JAMZ 2P7VB 3QPTA 3OOPA 4LGWA 3HHHA 4HDUA 4IJAA 1U3EM 3I54A 1XB4A 4OU0A 1BIAA 1CF7B 5L3FA 2ETHA 2XHKA 2EFOA 1MJAA 3LWFA 2KIUA 2Y75A 4LLGF 3DFGA 1O3RA 4RGSA 5E8IA 1PP8F 2KJCA 4PZJA 4F7ZA 3R60A 2KIFA 5HS9A 1PUEE 4BH9A 1I6XA 1HSJA 2STWA 5D5XB 1EH8A 5IT9K 1LDJA 3BJOA 1FSEA 3FM5A 3W6KB 1IXSB 2WC2A 5E17F 4S04A 3H3ZA 4OMYA 2XKPA 1U6GA 3BPXA 3GZ6A 5J8FA 3RKWA 3DV8A 3C1DA 3WTSC 2COMA 2P4WA 1FLIA 3FMSA 1ODDA 5FGMA 2MLKA 4XLPF 4LG0B 4M73A 4BQAA 3MWMA 3U2RA 2Z33A 4B8XA 2CQKA 2YPRA 4I02A 3F8MA 1XGNA 2NS0A 2O03A 4EGZA 1IN8A 5LRSA 3GZ5A 1BI1A 5AONA 3IWFA 1GVJA 4PCQA 5KK1A 4WCGA 2ESHA 2BV6A 4L18B 3TO7A 3WTVC 2V9VA 3KETA 4XSXF 1FBUA 4DQ2A 4YFNF 4KDPA 2FBKA 4LJZF 3GXOA 2GZWA 5JFRA 4WK8F 1OYIA 1R5GA 2L3DA 2HFHA 5KVRA 3T5XA 4LK1F 4HW0A 2OZUA 2YX4A 4KIFA 1ZARA 1FZPB 3U1DA 3ELKA 5FB2A 2QQ9A 1KGSA 5CVVA 2M5WA 3E6DA 2E1NA 2Y0MA 2YU3A 3WTZA 5E20A 2QBYB 2E7XA 4CZZA 3C18A 5J8CA 4EJTA 3O6BB 2WWYA 2RKHA 1U8RA 2ZBKA 4EGYA 2ELHA 2O6GE 1RZ4A 1S3JA 4MQVA 1HSTA 1WSUA 4IF4A 1IF1A 2BYVE 2V1DA 2IP2A 1L0OC 2CWEA 2OQGA 2F5FA 2ZXJA 4ENKA 2UWMA 1BN5A 2VOPA 4HA8A 3QAHA 5BOXA 2KKOA 2XRNA 4JBAA 1BC8C 1JHHA 5LRRA 2CG4A 2VT2A 1D3YA 1S8NA 1XGOA 2HYFA 4I01A 1G3WA 2CSOA 2ZO4A 3KP5A 3WE3A 4YFXF 1DP7P 2JPCA 3LQRA 2XAHA 2QVOA 5LEJA 3GF2A 1XDUA 2UZKA 4HF0A 4P9FA 1O3TA 2IA0A 1FX7A 4Y13A 1T2KA 2VODA 3HTSB 2C6YA 1HKQA 3GVAA 2HQNA 2CYYA 2IVMA 4M74A 1T98A 4G94A 3FXRA 3HTUA 1R22A 2EFWA 2XVCA 3NEUA 3LA2A 1QBJA 1Y0UA 1W4MA 4CXFA 1WI9A 3DXJF 5CYVA 1G3YA 2E7WA 2KIMA 1FBSA 5D5WB 5HS8A 3ABUA 1IN4A 4H0EA 4HX7A 1BM9A 3WE2A 2IA1A 1IRFA 3L09A 3W6JB 1B59A 3RYRA 2DW4A 3QU3A 1STZA 2KRFA 1J59A 2LSOA 2YR2A 3E97A 2ZNYA 3VODA 3RIRA 2Z99A 5L3EA 3WG9A 4EM1A 3RPUA 1QZYA 5EEHA 2M8EA 1HXDA 2JTVA 3ZMZA 1U5TC 5BPIA 2XAFA 2PLYA 4ENJA 5IT9Z 1ZRDA 4RB0A 1MJBA 2OU2A 3EDPA 3J80Z 3KZYA 4UXNA 4RGUA 2FOKA 1USSA 4L0YB 3IKTA 3MCZA 1U5TA 3K0LA 3N4MA 4KUMA 4I98B 3SQNA 5DEQA 4UNOA 3IHUA 1Z9CA 1ON2A 1G4DA 2DPDA 4A6EA 3ECOA 2JPBA 1USTA 3NQOA 5DUKA 1H9GA 5ILVA 4U7BA 1ZYRF 3F8NA 5ED4A 5AIPA 3HRSA 3HUGA 2G9WA 2MH2A 4GYIA 3BP8A 4G7ZF 1CF7A 1XSXA 1YO5C 1ZG1A 4KIGA 1UHWA 3AAFA 1BC7C 2NNNA 3SZTA 2HEOA 3HSFA 3KP4A 4L0ZB 3B73A 2FA5A 4AVPA 4S05A 1JE8A 4M6XA 5DD4A 3IC7A 4O5VA 4M9XA 4B09A 4WWCA 1JGSA 4IHSA 5F64A 4FHTA 2XGXA 4RB1A 4I0AA 2M87A 4G7HF 3E6MA 5DCMB 3KLNA 2DFIA 1GHCA 1RNLA 3KP7A 1O3QA 4RAYA 3WTXC 5LHIA 2M1BA 2LF8A 1YLFA 2EV5A 2JRTA 2VT3A 4AD9A 5L3DA 3F21A 1UCRA 4KT5C 4L5IA 5DV5A 2FRHA 2XASA 1P92A 1VTNC 3TGNA 1LB2A 2PI0A 3G3ZA 2IW5A 5EEGA 4YG2F 3CDHA 4LG0A 2BE5F 3DPLC 2IA2A 4ENNA 4FX0A 5DCFA 2D45A 4G8XA 1XSVA 3GFIA 4KN7X 1ZREA 4XSZF 4RAZA 4EVIA 1DDNA 2HKXA 3TO9A 3FMRA 4OOIA 4IVNA 4IRHA 5F1RA 1Z1DA 4L9VA 1E2XA 5ILSA 3BY6A 2GQQA 1B4AA 1QQIA 1R23A 2DK5A 2H6BA 1ONVA 4U0YA 4Q4ZF 5J6XA 2RGVA 1F9NA 4P55A 1RI7A 5H6QA 4LLNA 3DKWA 3RI4A 1C0WA 2A69F 3T0YA 5TJJA 3F23A 2P6SA 2QBYA 4FX4A 1YS6A 2YSRA 1P2FA 3H3UA 4HQEA 2QENA 2PQ8A 4XBFA 4HDVA 3RTRA 3BDDA 1O7LA 3U9GA 4CGZA 2VE9A 2J5PA 2OZ6A 4GGGA 5D6FA 2A61A 2FF4A 1BI2A 2HQRA 4RS8A 5E1ZB 1F1ZA 1JXSA 2GIVA 5HLHA 1OR7A 3ZMUA 3MFKA 1TLHB 4OMZA 3RKXA 3WGGA 2HDCA 3O3KA 3V4GA 1LQ1A 3QOPA 2WV0A 1XMKA 1J2XA 3V7CA 2JZYA 2OAZA 5ICEA 3J81K 5FLXK 3L7WA 4Y17A 4AWXB 2RVCA 1FBQA 2D1HA 3DPTA 3LAPA 1W7PD 4G9YA 1SFXA 3IRRA 1HW2A 1OMIA 5FD5A 1T39A 1REPC 1R00A 2DPUA 2DI3A 4A5MA 1V4RA 2VBXA 5H20A 1YQAA 2EV0A 4BXUA 4EV0A 2PN6A 3I59B 4ZYDA 1ZLJA 4IXAA 1S7AA 3VB2A 1I1GA 4HYEA 3S2WA 3JSPA 2ZFWA 2A6EF 2CGPA 5JHUA 2ADUA 1HKSA 3SHFA 1R1VA 2NNYA 2F2EA 4WX9A 2XROA 4PDKA 2K4JA 4XRFA 3ISPA 2ZKZA 4GO1A 1T38A 3F72A 2W57A 1NHAA 2PFBA 2VC1A 1RUNA 3SFZA 2NAZA 4A5NA 3L2CA 4BAYA 4ZYHA 5LEKA 2VBWA 3B02A 4OIRF 2O3FA 1P4XA 3K2ZA 3F8CA 4IHTA 1UHMA 2PMUA 2DTRA 3ZMTA 4RGXA 1D5VA 1YYVA 3K1PA 5CJ9A 2X0LA 1ZRCA 3HRUA 3E5QA 3L9FA 2DT5A 1Z7UA 3M7GA 1TTYA 1LJ9A 3RKYA 4A2UA 2VC0A 3TOBA 3V8KA 3PQKA 4HX4A 5A2QZ 1YFHA 4Q5SF 4HF2A 5E1XA 1Q1HA 4KICA 5AIQA 2HGCA 2ZJ2A 3TOAA 5LBQA 3CUQC 2F5EA 3E5UA 3MEXA 2V79A 1FWZA 4ON0A 4KFCA 2Z5UA 4PGHA 3BOQA 6PAXA 5D8KB 1R5HA 3EETA 2Y48A 1LDKB 4GCVA 2CFXA 2QZ8A 1I1SA 1O7FA 3CUQA 2DLLA 3GWZA 3K9TA 1SMYF 4HF1A 4KYWA 4P9UA 1L3LA 3BJAA 4G6QA 4ESJA 4ASNA 2GWRA 5ICGA 4M72A 3REOA 2QQAA 3KP2A 4OINF 3V7RA 3M8FA 1W7PB 2Q2EA 3T8RA 1BI3A 1O57A 1PP7U 4KMUX 4GYGA 3WTYC 1UB9A 4WXHA 5DCMA 2W84A 2FMYA 1YW9A 3TKYA 2MA3A 3QU6A 2JSCA 4UVAA 5FD6A 3Q5FA 2ZNZA 3HOSA 2UXXA 3JAMK 3HYIA 3VFZA
chains in the Genus database with same CATH superfamily
3P7NA 4FETA 1QPMA 4B47A 1VI0A 2M30A 1BBYA 3CO7C 5BS6A 3TW7A 2H1LA 2KL4A 3L2WA 1XGSA 5GPCA 3L00A 1FP2A 2R7UA 1IXCA 3I58A 1OYWA 2W7NA 2AS5F 4W1UA 1Q1VA 2EBIA 3T1BA 3MKZA 2V6CA 4EM0B 1RPWA 2ZMEB 1Z6TA 4A0XA 1LPQA 1JKQC 2LVSA 3ML6A 5E3LA 2UXNA 2W85A 1ZR2A 3HSEA 4PJJA 3TDUC 4ITVA 4ESBA 2P7CB 2QQBA 1IW7F 2VBZA 1T08B 2Z3YA 1IZ1A 3RPQA 2R4GA 2L01A 4CHUA 3I4NJ 2XSJC 5ERIA 3TO6A 2RDPA 3AG2H 4Q47A 4I76A 1EH6A 4NDLA 1MZBA 4FTHA 1ZN2A 2GAUA 3ABKH 2KZVA 3D5RC 2K02A 4K2EA 3HRTA 4FQGA 2LRDA 4JP0A 2LBFA 2NYXA 3LNQA 4AIKA 1VQNI 3FDYA 1Z0XA 4NC7A 1ACIA 3LOCA 3RYPA 3CF2A 1KQ0A 4G12A 1P7JA 3BG9A 3CUOA 4B48A 1R49A 2M45A 2IGNA 2NOGA 4JOMA 2HZTA 1ON1A 3DF8A 2MD0A 1Y8RB 2OD5A 1P9QC 2VOOA 3GMEA 3J81Z 1W5TA 4BHCA 2R0QC 2QUFA 5B3SH 1SD7A 2OV7A 4AIHA 2DODA 3PUFA 3I55I 2NVUB 1KYZA 5FKNA 2PJPA 4G6DA 3AFHA 1N25A 3G73A 1X1AA 1Y6IA 5IY5H 1NK3P 3R0JA 2LC2A 2GIZA 3DEWA 3ABMH 1YJ9I 2P8TA 1ZGAA 2X1EA 3R0AA 1MSFC 2LLKA 2BY2A 2M0CA 1P4AA 2JA7J 3CP8A 2PEXA 5FKOA 1B1BA 2IRFG 3K4BA 3I0TA 2MW8A 2EFPA 2OCCH 5TRDA 1HA8A 2GBYA 1XMXA 5EG0A 4YIRX 3QYBA 2WAFA 3LFKA 4M71A 3AG1H 4P1WA 3TDZC 3K4LA 1ZGWA 3HOZJ 4F55A 4A3GJ 3T8TA 4NHJA 2FQ3A 3WTWC 1Y1WJ 2M3AA 1B8IB 1I5ZA 2HOEA 2G0EA 4EJWA 2IT0A 3QPSA 3OYHA 3CUQB 3K4MA 3R6SA 5EEAA 4IHWA 4CYDA 2Y2ZA 3GUDA 2MSYA 1N75A 5JLXA 2O5RA 4NBQA 2BBYA 4CO8A 3KEYA 3ULQB 2PJRA 2LKPA 1KU2A 1FYLA 2F5VA 4QLCU 1KU7A 2PX9A 2EA4A 2GXBA 4I09A 2XB0X 4AIJA 4A3FJ 1DPRA 5CVJA 1T0FC 4C2UA 3IWZA 5E3NA 3BR2A 1FC3A 5C3EJ 4KA4A 3JTHA 1R4NB 2IPQX 3OL3A 2ID3A 1QVTA 3SEQA 4DYCA 2I10A 2LFBA 2NS8A 5ILUA 3GW2A 2HR3A 2W25A 2IAIA 3ZOBA 4LD5A 4DW6A 2ZC2A 3R61A 4HNTA 2VE8A 1FPQA 1I27A 3D5LA 1AWCA 3C7JA 5CVRA 4IKFA 1HDDC 1LEAA 4LMYA 2V7FA 5M5YJ 1P6RA 3FK7A 4LOCA 3CTAA 3ZQIA 1XMAA 2EILH 3DP7A 2DAOA 1FMVA 1FYMA 3C3WA 1T0FA 4UY8I 2X1DA 2GA1A 1R4MB 3ABTA 3NWTA 1NH3A 4KISA 2E34A 1IRZA 1ZH5A 1JUMA 2R7SA 4QWQA 1UG2A 1OKRA 3RZDJ 2XAJA 4A3EJ 1U78A 2FBIA 3W3CA 3Q9VA 3RJPA 3CJTB 2LF7A 3CCMI 2X9DA 3QRFF 4EJUA 2P5VA 2ZFUA 2YX7A 4UUVA 2R7FA 3IH4A 3H9GA 3K1NA 4E70A 4GXOA 3HHGA 2HDDA 3OS0A 2XDVA 1B9NA 2E2HJ 2VBYA 3JRIA 2ID6A 3HRMA 3O2PE 1WVRA 2FMLA 5L3BA 4YIFA 5F6FA 2W00A 4A6DA 3N97A 1OYYA 1W0UA 1SMTA 4UV9A 2P0WA 4OWRB 1ENHA 3OWTA 4RB2C 2A5WA 2XAQA 4J19A 5GTIC 1PUFB 2MLGA 2ZJRF 4EQQA 2WY8Q 1X3ZB 3GYHX 1AA7A 1UFMA 3PJRA 2J5OA 1ZAOA 3I59A 3SDGA 5C4JJ 2L02A 4RLFA 2XF7A 4Z2YA 1W36C 1UELB 1E3OC 4BE2A 2A5YB 3F6OA 4UVBA 4HLYA 1IUYA 2DQLA 1VQ6I 1W0TA 1NTCA 1EV7A 4IO9F 4A69C 3OIPA 1W36D 2COBA 2E1CA 2CW0F 3MKWB 4RAFA 1VFCA 4IHXA 4ZJZA 3S2DJ 2M9HA 1IO2A 3H9QA 3J7AO 1OISA 3M1EA 3FXKA 1ZLKA 3IP4B 2EFQA 2DBBA 1J9IA 3ZQQA 4CCNA 2DO7A 1NK2P 2F4MB 4AYBA 4L9NA 4NQWB 4RLQA 4CYCA 3KEOA 4U7DA 3PFIA 3MZHA 2HU9A 4N4OB 2VONA 3SXYA 3QP6A 3FZVA 3LSHA 2LP0A 4GDFA 2FE3A 5K5OA 2K5CA 5L3CA 3ZMSA 4II3A 2A6TA 2AXTC 2EA2A 3V7SA 3H0DA 2V1XA 5HDKA 3SYTA 4CCLA 1BJAA 3WTUC 2WA0A 4UHTA 1H88C 5DDGA 1RETA 3E6CC 4XOTA 3WTTC 3RQIA 5EG0B 3K69A 3ZP5A 1RRJA 4BJ5C 2E2IJ 3OR2C 2GLOA 2QYOA 4N9HA 3D5SC 5E79C 2O0YA 1FIAA 3FX3A 5EDNA 4A12A 1ZGJA 1T6SA 3QYEA 2O9LA 2R7DA 1MMAA 1G3SA 3EYYA 1ETXA 3OOUA 5HVQC 2MC3A 4KITB 1DPUA 4II2A 2HTJA 3DPUA 3LAJA 2L7MP 5FJ8J 5FROA 3KPHA 5FKKA 2VJJA 3JTGA 1E3PA 2E1MC 2I8DA 4P96A 2EK5A 3CDIA 4CH7A 2HNHA 3ZQ7A 3HSRA 4LLLA 2QM3A 4WXCA 4HV6A 4RGRA 5JHFA 2NVTJ 2MFZA 2Y0SN 3F6VA 2BEOA 2VPRA 1MH4A 1N77A 4A3MJ 5DYMA 1YOVB 1JGGA 1H9TA 4CSWA 2L7FP 1T33A 3HM5A 4R8HA 2TDXA 1QO0D 3SJMA 2KFDA 2M2EA 2A68F 1D8KA 2MG4A 2DK8A 2RNJA 4LIUA 2RAEA 2P6TA 4M6YA 3OYFA 4HRIA 5KNLA 3GBGA 3L2QA 1I6HJ 2OTLI 1X3WB 3RDIA 2DDBA 1LUJB 2DOFA 2STTA 3BLYA 4M9SA 1XSDA 2QQ8A 2IS2A 3A03A 4RAGA 1YW8A 3ZQLA 4B1RA 1R7JA 3I56I 1TWHJ 2HYGD 3CMMA 3SZGA 4XLEA 4DNCA 2KHMA 2AO9A 2O61A 2P5LC 1Y8QB 4BE1A 2F5CA 5HDGA 4D5FA 2Y0SA 3VPRA 2F6CA 3S16J 1HKTA 3OS2A 4KNYA 1A04A 5H2FC 3JRFA 1WRJA 2FU4A 3GLXA 3KYDB 5FFXA 2K7LA 2N8GA 1U8BA 1MJ9A 1IRGA 3J80K 1IN7A 3ASNH 4YRVA 3E1SA 4Z6YA 1XDSA 1S29A 1KA8A 4IL6C 1SD4A 1JUPA 1W7PA 4N4NB 2PBIA 4S0HB 3MN2A 4M3FA 2K3FA 5EGOA 1D8JA 2LDUA 1TWFJ 2KRHA 1A5JA 3DU6A 1K78B 3E6BA 2DQRA 3PM1A 1B9MA 1SAUA 3BWGA 3D0SA 5CVUA 2HTSA 3G4SI 2IGMA 4PJNA 1BR2A 5D4SA 2MABA 3GTOJ 2GOXB 2AQFA 4IOCF 4EM2A 1XCBA 2FEZA 3NWSA 1YE9A 1YHQI 1JTYA 3BTIA 5D5VB 4PFOA 4BKXA 3KE2A 1ZTRA 1DUXC 4IRIA 2LK2A 2ZMEC 1XCVA 2Q0OA 4A0ZA 1AOYA 4BJTA 4TV7A 1G59A 5BNGA 5LGTA 4O3MA 1BR4A 2WB1A 5LD2C 4ZYEA 2QKLB 3GFLA 4LB5A 2BXYA 2R7XA 1ETQA 4XKBA 3HOVJ 4AIDA 2FBHA 3CJRB 5K7FA 3DLLF 1SFEA 2EPFA 3H5NA 5IT3A 2F4IA 2LKSA 3H35A 1YX5A 3LQQA 4L9JA 1TT5B 4V2FA 1YIOA 2FUG2 3F22A 5LHHA 4IOAF 3K1MA 3O8GA 1FY7A 1Z6RA 4YIIA 4F92B 1BA5A 1BOAA 3ABLH 3QWLA 1K7AA 3IL2A 2ME6A 5JR3A 2ZMEA 4CICA 3P9CA 4BNCA 4L9TA 2VKDA 1A35A 1KYWA 2QCOA 1HQCA 4A0YA 3LA7A 2L7KA 1RR8C 4OIPF 1MDMA 3JRHA 4OAZA 4C3IJ 3BZKA 3BG6A 4UUSB 2R7OA 3KCCA 4D9JA 4D1QA 2DA2A 4E7ZA 2Z2SB 1J09A 4JQFA 4LITA 2XIGA 4LIVA 3VEPA 2XPWA 3RKQA 3R4KA 1J0RA 5IPAA 1SFUA 1F36A 3PQJA 1BIBA 2VJ5A 4MTEA 2JN6A 5FFZA 2L9SA 3HOXJ 1MBKA 5E3MA 1J75A 1J5YA 1Y0NA 5CLSA 1QZZA 1R1TA 4DZPA 3HIFA 2R7TA 2L4AA 2XAUA 3LSPA 4E7JA 3TP3A 1UZCA 3ZN1A 1FOKA 2K86A 1VQPI 2CJJA 4RDUA 5CKTA 2LD5A 4QPQA 1MNEA 2RV8A 1SD5A 3BPVA 3DTEA 4R79A 3GTMJ 1ETKA 4I0BA 5GPAA 5K1YA 3AL0C 1ULYA 3I53A 3J7AY 5JI6A 2MD5A 1TNSA 1U0JA 1UMQA 1Z05A 3FK6A 3H1CA 3ZQGA 1MNMC 3ROUA 2HOSA 4PK4A 3JRCA 1J7KA 3FWEA 4CDGA 5GAEJ 2DU9A 3HXLA 3K4CA 3COAC 2E1MB 2BZTA 5E18F 3FBNB 4OIOF 2A6HF 1RC9A 1O4XA 4B3XA 2ZXWH 1MKMA 2NS7A 3KFWX 1B8IA 1JI8A 1KU9A 2BY0A 3WGIA 2KQRA 3W6VA 3S1RJ 3ZQHA 1AHDP 2XSDC 3NRVA 1QU3A 3MQ0A 3Q9SA 4U88A 3OYBA 4KN4X 5IOYA 3KYLA 5CVIA 3AKZA 1IN5A 2XRLA 5HLTA 4XRMA 4HV5A 4HX8A 1F5TA 1VQOI 2JT1A 4BHPA 2AXLA 2Y30A 4XRSG 2X6OA 3DLAA 4XN3A 4Y4RA 3CCEI 1WZ2A 3BG7A 1TW2A 3WGHA 3BZ6A 3IH2A 1U9OA 3KLOA 3KEQA 1O3SA 5LHGA 1TQMA 3P9KA 2GA2A 3NARA 1IDYA 1W1WE 2DJNA 1RIOH 2ZJPF 3OYGA 2HKOA 3KYCB 4MFDA 1FTZA 3WU1B 3BCAA 5D6EA 1WQ2A 4MQ9F 1UAAA 2OBPA 2R3SA 1N78A 2DDAA 2AQEA 1RKTA 1A6QA 1OCRH 4HAMA 3CCSI 3LMMA 2A05A 3BR0A 1SEUA 1W5SA 2DT6A 4E7SA 1BW5A 2DA5A 3HKZA 3MD2A 3V42A 5HNFA 2QWWA 4A3KJ 2JJ7A 5E1WA 3HZJA 5DUIA 5D5UB 5LLQA 2LNBA 4HPQA 5IYBJ 1WJAA 4ZDPA 3ZCOA 1KQ9A 2HXOA 3DEUA 3FM3A 3TP0A 5J1YA 1QNTA 2KJBA 4BHBA 2JWTA 2MBFA 4JX6A 4L5JA 2VIXA 3DKXA 2L4MA 3IV5A 2JVGA 3F0CA 4BYYA 1TC3C 1HW1A 4HOBA 3F8BA 4KMFA 3OSGA 2RNGA 4IQJA 2D1VA 1QGPA 1X4OA 1XX5A 2VASA 3IH3A 3M8EA 4N0BA 3E7LA 1TNTA 1ETOA 3HEFA 2GXGA 1K6OA 2PMHA 2DJIA 1JKPC 2ZCWA 4PUSA 2XKOA 1PUFA 2VN2A 4U0VA 2O8KA 4LB6B 1YG2A 4ESFA 1FNNA 3I3LA 3A02A 1MDMB 2DMPA 4I2OA 3I4PA 1H0MA 1XN7A 1LE8B 5F0HA 2FXAA 1YIJI 3GO5A 2HDWA 2BXZA 4U0WA 3DBHB 1GXPA 4HLXA 4UVCA 3BJ6A 3G2BA 4XL9A 3JW4A 3CQZJ 2HWVA 2CO5A 1X2MA 3F8FA 4XN0A 3E5XA 1S7OA 1TQIA 4Q4ZF 3CO6C 2XUBA 2D2WA 2BGCA 3SZPA 1FIPA 2H27A 2DFHA 4MEYF 4QIWN 4IX7A 2G7HA 4XLCA 4F3QA 5IOZA 5LGNA 1GT0C 1JHFA 1FYKA 5BPDA 3OMYA 2RC4A 2H8WA 3QPHA 1VQLI 2UV1A 3KP3A 3VOEA 4HNUA 4N9IA 1HBXG 2KIQA 3JREA 5DM7F 4NQWA 1FT9A 3OL4A 5FLXZ 5CQEA 5ICFA 2RN7A 1R1UA 2H09A 4HZFA 5IP6A 4ZZLA 2HS5A 3ZPLA 1F43A 3C2BA 1KONA 5J40A 3DKYA 2NVXJ 1OJLA 3VYTB 2DMTA 2MH9A 3OYAA 1HDPA 4XLNF 1SFOJ 3CF5F 3JRBA 5JVGF 1GV2A 3ZMDA 1XC5A 2CH0A 3OS1A 4PJLA 1LEBA 2VXZA 2BOLA 2L54A 3DQVC 2JVHA 3IRQA 2WADA 1LNWA 1WJCA 3CJQB 5K7ZA 2ISYA 1LVAA 2FNPA 4KJZA 4PGGA 3KZZA 4WXDA 1X3UA 4KIBA 4RB3C 5HOOA 3X2QH 2VUMJ 4NB5A 3P9IA 4UV8A 2OA4A 3FF5A 5H6RA 1S72I 1ZHFA 1TZLA 1V3FA 2QLZA 2WTEA 3FBIB 4ETSA 3W2WA 2PG4A 4Y15A 5D4RA 4QTRA 1IAWA 1MW7A 2JUCA 3L2RA 3HOTA 2K27A 1S7EA 3AL0B 3H92A 3TQNA 1WKMA 3EUHC 3I64A 1XGMA 4BXXJ 1YTYA 2K9SA 3OYCA 2O7OA 4ZH4F 3FHZA 3BROA 4EEFG 4XM3A 4MHGA 1IV8A 4B44A 1R36A 1IUFA 2HYJA 4P5OA 1IDZA 3F3XA 3PNYA 2HQ5A 3M9AA 4ENMA 1TBXA 3CJNA 3HGGA 1IG7A 3GEZA 3Q0UA 3FMQA 1OCZH 5L3GA 2DA4A 2DTZA 4LK0F 1ITYA 2H6CA 4LFUA 2LMDA 2EWNA 1VQ9I 5E8GA 2JSPA 1G3TA 3EUHA 2ISZA 3GTPJ 3GFMA 3MZYA 3E3VA 2XF5A 4MGRA 3WU2C 4BQQA 1K79A 3DWLE 1H89C 4IPAA 2JA2A 5HDNA 2FNAA 1U2WA 1ZG3A 3WHCA 4HQMA 1TQPA 3CLOA 1XD7A 2EINH 2IS4A 1E0EA 2ESNA 4JK1X 4OIQF 3OYKA 1CGPA 2B0LA 2CV1A 2XV4S 5HLGA 4ZYGA 3CCJI 1YS7A 4FT8A 4HG2A 4D7NA 1FSHA 2A07F 3K70C 1MH3A 5B66C 1HLVA 3FXQA 2E1OA 1R58A 3V8LA 3M8JA 4XKVA 3LA3A 2Y9YA 4YELA 2QA4I 1X1CA 3BC8A 3NAUA 1X1DA 4EMSA 5JVTA 5K5RA 5DD8A 1KQ8A 5K5QA 4ZDOA 5HLIA 3K70D 1MD0A 2L0KA 2V1UA 2DA6A 2WV1A 1WJEA 3JRAA 2EJRA 4FE7A 2H94A 2M4KA 1IXRC 1HF0A 4GFBA 2XPUA 5GADJ 4MO7A 4CZCA 4G7OF 4YFKF 3JSOA 1KZHA 1SAXA 5A2QK 2B63J 1SD6A 1K78A 1GXQA 1TP4A 1R6RA 3GX4X 3RQ4A 2M7AA 3CP2A 4AYBN 1BI0A 3J7YJ 4EJOA 1ZG5A 5IYDJ 3P5JA 3EYIA 2K9QA 2JRMA 3DTKA 3OV8A 1Z91A 3EQLF 4O6JA 3MZ8A 2EV6A 4EJVA 2FSWA 4H4KC 4Y52J 2K9LA 3I5UA 5F04A 3MVPA 5D8LB 4Q48A 1MGTA 1LDDA 1TWCJ 2LY9A 3MAJA 4R1HA 4XLFA 4MTDA 1YJNI 2ACJA 1F4KA 3FKJA 4MNUA 2O8XA 3BT9A 1K4TA 3ZMVA 2X4HA 4F52A 2X48A 2OQRA 3FHNA 1ZRFA 5BQTA 5BMZA 1S6LA 1WWXA 1G2HA 4DGWB 4M9ZA 5LGUA 1OPCA 3TMOA 3ERED 2P5KA 1BOBA 2CUJA 1YW7A 4RM2A 1KU3A 3M3YJ 5HS7A 4HBLA 2K4BA 5J1UA 3I71A 3GFJA 5FLVA 1IV6A 4BUPA 3MMYB 1P4WA 1PDNC 2BVLA 1GDTA 1B6AA 5ICCA 4WF2A 1WH7A 4DOZA 2BW3A 3ECHA 2F5DA 2RQPA 2KMUA 2NRAC 5J4VA 4MEXF 1NG6A 2Q8KA 1HW5A 4ANJA 5J4YA 2I5UA 3ZN0A 4RM3A 3PO2J 4UUSA 4JYKA 3S15J 2D5VA 1Y1VJ 4A3IJ 3FXUA 1WHUA 1LKXA 2GOMA 2Z9OA 2DMNA 3LSTA 2XF6A 3KP6A 3GTGJ 4IRGA 2A3SA 4XICA 1Z77A 4ZC3A 5IP9J 1U5TB 1RUOA 2HPIA 2ELKA 2X6WA 3K6GA 1FTTA 1Z21A 1TWAJ 3JR9A 5E3OA 4F93B 1FP1D 2OC6A 4ZZDA 1M1EB 5C4XJ 2IJLA 2HZDA 2EFNA 3AG4H 1G6NA 2G7UA 3UR3C 4I7HA 1TW3A 2W24A 1EH7A 3QP5A 3CESA 1QPIA 2EB7A 5FO5A 3GTJJ 3V8JA 1E17A 3IKVA 2LREA 2M7BA 3PL8A 5DM6F 4MLOA 4D0PA 2XAGA 3WODF 3WU0A 2OPTA 1IN6A 3RCOA 3JAMZ 2K85A 2P7VB 3QPTA 3HUGB 3OOPA 4E7LA 4LGWA 3HHHA 4HDUA 4IJAA 5FRMA 3MKLA 1U3EM 3I54A 4PSWA 2QF7A 1XB4A 4OU0A 1BIAA 1CF7B 1SC7A 2VJIA 5L3FA 2ETHA 2L5QA 2XHKA 2EFOA 5CQGA 1RESA 4DZJA 1MJAA 1QZEA 3LWFA 2EZKA 2KIUA 2Y75A 4MFEA 3QYFA 4LLGF 3DFGA 3LFUA 1O3RA 4RGSA 5E8IA 1PP8F 1V55H 2KJCA 4PZJA 3G71I 4F7ZA 1V5FA 1G8XA 3R60A 2KIFA 2CV2A 4IHVA 3BTLA 3CMEI 5HS9A 4RMNA 5JLWA 1E3HA 3CMYA 3OSFA 1PUEE 4BH9A 1Z3YA 3HBLA 1ZQ3P 1I6XA 4A3LJ 1WI3A 2R7WA 1HSJA 2STWA 4E6KG 5D5XB 1T8IA 2V4JC 1EH8A 1SVLA 5IT9K 3UKGA 2M34A 2OCEA 4J01A 1DU0A 1LDJA 3BJOA 3C2GA 1FSEA 3FM5A 2VQLA 1IXSB 3W6KB 2WC2A 2WB1N 5E17F 3S8PA 1YJWI 3TW6A 4G6TB 4S04A 3H3ZA 4OMYA 2KPMA 5EJCA 1OCTC 2XKPA 1U6GA 2M8GX 3H9JA 5EYRA 3BPXA 3QOEA 4BQNA 5J8FA 3PSIA 4OAYA 3GZ6A 1VQ4I 4RA2A 3RKWA 4JX4A 3DV8A 3C1DA 3RSNA 3WTSC 3CCUI 2COMA 2XGEA 2P4WA 2LKXA 3FMSA 3HDDA 1FLIA 1ODDA 2HI3A 3K4KA 3ZXSA 1Z67A 4BJ6C 3S3NA 5FGMA 2MLKA 4AC0A 3VWBA 3CCYA 4XLPF 5HODA 4LG0B 3ZGKA 4M73A 3IAM2 2FQ4A 4DJAA 4BQAA 3MWMA 1PJRA 4BY7J 5KAFC 3U2RA 2Z33A 4B8XA 3AG3H 2CQKA 2YPRA 4CCKA 4I02A 3PIPF 1AKHB 1FJLA 2LR8A 5C44J 3F8MA 1XGNA 3CMAI 3QQAA 2NS0A 3HOYJ 2VPLA 2O03A 4EGZA 2EZIA 1IN8A 5DTDA 5LRSA 3GZ5A 1BI1A 1S9HA 5AONA 3RZOJ 3IWFA 1HOMA 1GVJA 4PCQA 5KK1A 4WCGA 2ESHA 3OYLA 1UJ8A 2BV6A 3ZQCA 4L18B 3TO7A 3WTVC 2V9VA 3KETA 2K40A 2ZSHB 2DA1A 4A3BJ 2KLOA 3G1MA 2YUSA 4PJMA 4XSXF 1SVOA 4AVZA 3ESWB 1D0ZA 1FBUA 2K9MA 1DGWY 2BW3B 4DQ2A 4YFNF 1FOWA 2TRTA 1SANA 2HOAA 2LH9A 4NC6A 1EJ9A 4KDPA 3GTQJ 2FBKA 4LJZF 4I6ZA 1LE8A 3GXOA 2GZWA 5JFRA 1YITI 1VQ7I 4C9YA 3LSKA 4WK8F 2R5YA 3CC2I 3OY9A 1OYIA 1R5GA 3LSGA 2L3DA 2HFHA 2HOTA 1D5YA 5KVRA 2QEXI 4KT6A 3T5XA 2V9PA 3U1KA 2BY1A 4QSHA 4LK1F 4HW0A 2OZUA 3L2UA 2PMZN 1D1BA 3EPZA 4XONA 1BW6A 1MBHA 2JMWA 4BS9A 2R7RA 2YX4A 4KIFA 1ZARA 4BDZA 2VKEA 1FZPB 4XR6A 4A3DJ 3U1DA 1X4PA 3ELKA 5FB2A 1FMWA 2QQ9A 1VQMI 2DN0A 3H0GJ 1KGSA 3BCBA 5CVVA 2M5WA 3E6DA 2E1NA 2Y0MA 2YU3A 2YS9A 3WTZA 5E20A 2QBYB 2TCTA 2E7XA 1A36A 1MMGA 3A01B 4CZZA 3C18A 5J8CA 4XKCA 4EJTA 3O6BB 2RKHA 2WWYA 1U8RA 2ZBKA 4EGYA 3ZR8X 2ELHA 1WJDA 2O6GE 1V5GA 3CCLI 3S93A 1RZ4A 1S3JA 4MQVA 2R5ZA 1HSTA 1WSUA 2CQXA 3WHBA 3OYIA 4IF4A 1IF1A 2BYVE 2V1DA 3EUKL 5TGTA 2IP2A 1L0OC 2ELJA 3VYSB 2CWEA 2EQRA 2OQGA 2PMZA 1T95A 2F5FA 3CCVI 2ZXJA 3I4MJ 2ECCA 4ENKA 2CW7A 1BN5A 2UWMA 2VOPA 4HA8A 5GAGJ 2QGUA 1WGXA 3QAHA 2DCEA 1ORKA 2FD5A 5BOXA 2KKOA 2XRNA 3FXLA 1IRXA 4LG3A 1LVKA 4JBAA 3JCUC 4M3BA 5B5EC 2L2OA 1BC8C 1JHHA 5LRRA 2OUMA 2CG4A 2FX0A 2VT2A 1D3YA 4XLAA 4A3JJ 1S8NA 3EUAA 1XGOA 1POGA 1GVDA 2HYFA 3HKZN 4I01A 4B3AA 5KCMA 1VF9A 5FKMA 1G3WA 2CSOA 2H8RA 1I50J 2ZO4A 4M3GA 3KP5A 2E35A 3WE3A 4YFXF 1DP7P 2JPCA 1MBGA 3LQRA 2XAHA 5B1AH 4M6VA 1OFCX 2QVOA 1D0YA 5LEJA 3GF2A 1XDUA 2UZKA 4HF0A 5F27A 4P9FA 3VSLA 1O3TA 4YEJA 2E19A 4FASD 2CU7A 2IA0A 3LSMA 3FXJA 1FX7A 2CQNA 4PJ0C 2B7EA 2V26A 5M5XJ 4Y13A 1T2KA 2VODA 2L9NA 5KAIC 3HTSB 3GTKJ 2C6YA 4C2TA 1HKQA 3DBLB 3PIOF 3GVAA 2HQNA 2CYYA 2IVMA 4M74A 4BGDA 1T98A 4G94A 3FXRA 3HTUA 3Q0WA 1R22A 1RKWA 2EFWA 4AUXA 2XVCA 3NEUA 3LA2A 3FISA 1QBJA 1Y0UA 1W4MA 1XPXA 2R7QA 3LSRA 1DU6A 3VDXA 4CXFA 4ZTFA 1WI9A 3DXJF 2MYSA 3A2KA 5CYVA 1G3YA 2VQHA 3Q0VA 2E7WA 2KIMA 5M3FJ 2CUFA 1TWGJ 1MMDA 3A1YA 4BBSJ 5J47A 1K4SA 1FBSA 4NUBA 5D5WB 2DOAA 1JKRC 5HS8A 3BR1A 1EKEA 3PFYA 1B72A 3ABUA 1IN4A 3QPLA 4XRSA 4JX5A 4H0EA 2ICWG 4HX7A 2ZXHA 1BM9A 3WE2A 3FKIJ 3PO3J 3I9V2 2IA1A 1WH5A 4BL0B 1K61A 2K9NA 1IRFA 2R5YB 3L09A 4V19K 1HC8A 3W6JB 1B59A 3S3OA 2F48A 4X1EA 3ONQA 3RYRA 2RQQA 5LFAA 4RBOA 2CW8A 2IBDA 2DW4A 5EZHA 3QU3A 5HNHA 2MGQA 1STZA 2VI6A 2KRFA 3RPUD 1J59A 2NXNB 1QHGA 2LSOA 2WAQN 2YR2A 4UB8C 3E97A 2ZNYA 3L1PA 1XS9A 1D1AA 3VODA 2JK3A 3L2VA 3RIRA 1K6YA 2Z99A 5L3EA 1ETWA 3H5RA 3WG9A 4EM1A 3RPUA 1QZYA 1VQ8I 5CPRB 3S1MJ 1GUUA 5EEHA 4DBRA 2V6EA 2M8EA 1HXDA 3OYDA 2JTVA 3ZMZA 2X6YA 1U5TC 2OTJI 5BPIA 2XAFA 2PLYA 4ENJA 5IT9Z 2W48A 5J3LA 1YRNA 1ZRDA 2Z16A 3CCQI 1QA6A 5GTHC 2CUZA 4RB0A 1MJBA 2OU2A 1APLC 3F9KA 3EDPA 2R5ZB 3J80Z 3DEEA 1I3AA 3KZYA 1TT0A 3LL7A 4UXNA 1V54H 4BXFA 4RGUA 1QHHD 2FOKA 4IHYA 1USSA 1R5ID 4U87A 4L0YB 5FRNA 2DA3A 2DMUA 3IAS2 3IKTA 3MCZA 3BQZA 1U5TA 2CQQA 2WAQA 2CRGA 4HNVA 3K0LA 3N4MA 4KUMA 4I98B 2KP6A 2W1OA 3SQNA 3ZRGA 5DEQA 4UNOA 4ABZA 3IHUA 1LFBA 1Z9CA 1ON2A 1WJBA 1G4DA 3OIOA 1S5LC 4A6EA 4E4HA 5IP7J 2DPDA 3ECOA 1ZKGA 2X85A 2JPBA 1USTA 5F0FA 3DTIA 3KX2A 2P81A 4A3CJ 3NQOA 4FISA 3FXMA 4HEA2 4CCMA 5DUKA 1H9GA 5ILVA 4UUTA 4U7BA 1ZYRF 3F8NA 2IEKA 1VQKI 5ED4A 5AIPA 3HRSA 3HUGA 2G9WA 1ZELA 2ME0A 2BY3A 3G1LA 2L9VA 2MH2A 3DBRB 4XNFA 4GYIA 1YI2I 2WAEA 1MBJA 3BP8A 4G7ZF 1CF7A 1XSXA 1YO5C 1ZG1A 3GLLA 4KIGA 1UHWA 3AAFA 2VLAA 1BC7C 2DFEA 1WJFA 2NNNA 3SZTA 2HEOA 4XKWA 3HSFA 3KP4A 3LSJA 3HJEA 4L0ZB 4DIQA 2JA6J 3B73A 3HGYA 2FA5A 4AVPA 4S05A 4PFPA 1JE8A 4M6XA 5DD4A 3IC7A 3GCMA 4O5VA 3PUBA 4M9XA 1X1PA 4B09A 4WWCA 2L7ZA 1VNDA 4XOPA 2Q2EB 3TEDA 1JGSA 2KRCA 4IHSA 5EF6A 4AM3A 5F64A 2W82A 2ZJQF 4FHTA 2XGXA 4RB1A 2X1CA 2X6XA 4I0AA 2M87A 4G7HF 3E6MA 5DCMB 3KLNA 2DFIA 4IZZA 1GHCA 2EIKH 4BEHB 4Y7NJ 1RNLA 2KT0A 2QSGX 2E71A 3KP7A 3TBIA 2RREA 1O3QA 1BR1A 4RAYA 3WTXC 2VJ4A 5LHIA 2IS6A 4A93J 1X1BA 2M1BA 2LF8A 3W2VA 1YLFA 2EV5A 2JRTA 2VT3A 4AD9A 2ECBA 5L3DA 3F21A 1UCRA 3TL4X 4KT5C 1ZR4A 1GV5A 2ZB9A 4L5IA 4C30A 2XGDA 1B72B 5DV5A 2FRHA 2E5ZA 1P92A 2XASA 3BTCA 1VTNC 3TGNA 1LB2A 2DXIA 2PI0A 3G3ZA 4X0GA 2IW5A 5EEGA 1A6IA 3PNVA 4AU7A 3OYJA 2QKMB 1JTXA 4YG2F 1JT0A 2EH3A 4MIMA 2E60A 3A0HC 3CDHA 4LG0A 2BE5F 3DPLC 1WPKA 1LFPA 4NNJA 2IA2A 1P7IA 2EZHA 2XGCA 4ENNA 1VZ0A 4FX0A 1Y39A 1AKHA 2LG4A 5DCFA 2D45A 3OIQA 4IQ4A 1OQYA 4G8XA 1XSVA 5DS9A 3GFIA 3E0JB 2DMQA 4PSXA 2AHQA 4KN7X 1ZREA 1EA3A 1R71A 4C3HJ 1H8AC 4XSZF 3HOWJ 4RAZA 3S14J 4EVIA 1BJZA 3Q3SA 1DDNA 4E7IA 1TL8A 2HKXA 3TO9A 2LBFB 1YRNB 3FMRA 3K2AA 4OOIA 4IVNA 4IRHA 5F1RA 2HQAA 1Z1DA 4L9VA 4EATA 3U21A 1OCOH 2BHZA 1E2XA 5ILSA 3BY6A 2GQQA 1B4AA 3M07A 3M1CA 1QQIA 1R23A 2DK5A 2H6BA 1ONVA 2L9RA 3BQYA 2ZXIA 3BTJA 5EZGA 4D7MA 4U0YA 2CMPA 4E7KA 5J6XA 1RR7A 5KHDA 2DA7A 2RGVA 1F9NA 1QVUA 4P55A 4F91B 1MSEC 1RI7A 2M0MA 4BY1J 1CQTA 2VB6A 5H6QA 1OCPA 4LLNA 2JA8J 2E2JJ 3BR3A 3B6CA 3BR5A 3DKWA 3RI4A 5M5WJ 1C0WA 2GM4A 4ZYAA 1MMSA 1JT6A 4XORA 4HSRA 3OYEA 2NOJB 2V1NA 2VXDA 2A69F 2E36A 3T0YA 1UHSA 3GZNB 5TJJA 2P6SA 3F23A 2QBYA 2EIJH 2K3PA 2KISA 3A01A 4FX4A 1YS6A 3HC7A 3BZCA 2YSRA 1R9TJ 4C3JJ 1U9NA 1P2FA 3J7ZI 4BU2A 4L5EA 4XQFA 3H3UA 3VYRB 4UB6C 4HQEA 3W2AA 2PJRB 2QENA 1LFUP 2PQ8A 3K4NA 2M4GA 1ETYA 3HL2A 1MBFA 4XBFA 5M3MJ 1WJ5A 1DP3A 4XIDA 4HDVA 2KDOA 2VKVA 1OR7C 3CZ6A 3RTRA 3BDDA 1SFKA 4CUGA 1MBEA 3PNTA 1O7LA 3DCFA 3A0BC 3U9GA 4CGZA 2VE9A 2Y9ZA 2J5PA 2OZ6A 4GGGA 4V2GA 5D6FA 3A4CA 3CC4I 4I99C 1D0XA 2A61A 2FF4A 1BI2A 2CFOA 2HQRA 2EIMH 4RS8A 5E1ZB 1VQ5I 1F1ZA 1JXSA 2GIVA 5F1JA 5HLHA 1OR7A 4D5CA 4FCYA 3ZMUA 2DYSH 4DYQA 3MFKA 2QSHX 4ZTJA 1TLHB 4OMZA 3RKXA 3WGGA 2HDCA 3O3KA 5TISC 3V4GA 1LQ1A 3QOPA 1EF4A 1FOXA 1Z3XA 1XMKA 2WV0A 2Y31A 2LOOA 5B1BH 3VSKA 5K7HA 1J2XA 2HXIA 3K4JA 1X2NA 3V7CA 3ASOH 2JZYA 3HOUJ 2OAZA 5ICEA 3J81K 5FLXK 3SEZA 1V5EA 4Y3OA 3L7WA 2OF7A 4Y17A 4AWXB 2RVCA 4XMYA 2LYCA 1FBQA 2OJED 1XG1A 2D1HA 3DPTA 4DYRA 1W7PD 3LAPA 4G9YA 1SFXA 3BR6A 3HYIA 3OR1C 1ERDA 1MNDA 3IRRA 1QRYA 1HW2A 1OMIA 5FD5A 2H1KA 2XPVA 1T39A 2E5NA 1R00A 1REPC 2DPUA 2DI3A 3FIWA 3S17J 2WBMA 4A5MA 1FEXA 5FKLA 2KZGA 1K83J 1V4RA 2VBXA 4XLHA 4XK4A 4CCOA 5H20A 2R93J 1YQAA 2EV0A 2X51A 3BG3A 4M3EA 2ZSIB 4BXUA 4EV0A 2PN6A 3I59B 2Y69H 2CV0A 3CC7I 4ZYDA 1AU7A 1ZLJA 2YU9J 2HVQA 4IXAA 1S7AA 2DFFA 3VB2A 1I1GA 4CA0A 4HSTA 4HYEA 2IXSA 3S2WA 3JSPA 2HVSA 1ETVA 2ZFWA 2A6EF 2CGPA 2VQCA 5JHUA 3B6AA 2ADUA 2VQGA 1HKSA 3SHFA 5GP9A 1DGRM 1R1VA 2NNYA 2F2EA 3ERMA 4WX9A 1PYVA 1SVMA 4BE0A 2XROA 1T56A 4PDKA 2K4JA 2CUEA 4XRFA 3S1QJ 4M3DA 2Z1DA 2QSFX 3ISPA 2ZKZA 1WCMJ 1X58A 4GO1A 2JUGA 4CYCB 2XC7A 1T38A 3F72A 3G1OA 3S1NJ 4X6AJ 2HVRA 1OLTA 1NHAA 2PFBA 2VC1A 2W57A 4BQOA 2IGOA 3SFZA 1RUNA 3CCRI 3PSFA 2NAZA 3CDLA 4A5NA 2HPMA 1X19A 3ZQFA 2W4SA 4W97A 1ZK8A 3L2CA 4BAYA 4ZYHA 1DQUA 5LEKA 2VBWA 3B02A 4OIRF 2O3FA 3UNGC 4IEJA 2NVYJ 1MIJA 1YX3A 2KDZA 1P4XA 1GLNA 3K2ZA 3H36A 1JJ6C 3F8CA 4IHTA 1UHMA 2DYRH 2PMUA 4E7HA 2DTRA 3ZMTA 4CCJA 4RGXA 1D5VA 1YYVA 3K1PA 5CJ9A 2LY2A 3VYUB 3FXOA 2X0LA 1Y56A 1MMNA 1JUSA 4FE4A 1ZRCA 3HPHA 3HRUA 3IUOA 3E5QA 3L9FA 2DT5A 1Z7UA 3M7GA 1OCCH 3H5AA 1LJ9A 1TTYA 3RKYA 3SFIA 4A2UA 2VC0A 3TOBA 3V8KA 1NG7A 3PQKA 4HX4A 3C2HA 5A2QZ 2VL8A 1YFHA 1PVEA 4Q5SF 4HF2A 3K7AJ 4BDYA 5E1XA 9ANTA 1Q1HA 4NC8A 2XB5A 4KICA 5AIQA 3CLQA 2HGCA 2ZJ2A 2DT7B 4GRIA 4BACA 4B43A 4C2MJ 2JQ7A 3K10A 3HPGA 3TOAA 5GAHJ 5LBQA 3CUQC 4DBQA 3JRGA 3JRDA 3H3VK 2IS1A 2F5EA 3SDBA 1JJ8C 2Q1ZB 3E5UA 3MEXA 1XTAA 3CD6I 2V79A 1FWZA 3KIOA 1HCRA 4ON0A 2DOEA 2V9KA 3OYMA 4KFCA 2Z5UA 4PGHA 3BOQA 3GTLJ 6PAXA 5D8KB 1R5HA 2R92J 3EETA 2Y48A 1JKOC 3DU5A 4B4CA 1LDKB 3BG5A 4GCVA 2CFXA 2QZ8A 1I1SA 3M4OJ 1O7FA 3CUQA 2DLLA 5IYCJ 1IC8A 2R7ZJ 4QPOA 3GWZA 3K9TA 1SMYF 4HF1A 3QODA 1A31A 2CQ7A 4KYWA 4P9UA 2VKHA 1L3LA 3S2HJ 3BJAA 1IGNA 4G6QA 3HB9A 2F4OB 4ESJA 2UUZA 1I3QJ 4ASNA 4BBRJ 3G6EI 3O8HA 2GWRA 5ICGA 4M72A 3REOA 2QQAA 2IGKA 3KP2A 4OINF 2GXAA 3D1NI 2WY7Q 3V7RA 1I39A 3M8FA 2CS3A 3HG9A 5FLMJ 1W7PB 5EGOB 2Q2EA 2LY1A 1Z7LA 3T8RA 2JA5J 1BI3A 1O57A 1PP7U 4KMUX 2MC4A 2BHYA 1BL0A 4GYGA 3WTYC 4J00A 1UB9A 4WXHA 5DCMA 5F08A 4Y33A 4ZDLA 2W84A 2R7VA 2NVQJ 3S3MA 1FOYA 2FMYA 2FOWA 1YW9A 4BEHA 3TKYA 1W5CC 3MKYB 2BVMA 1D1CA 5J1RA 2MA3A 3QU6A 2B9SA 2JSCA 3N05A 1IJWC 4UVAA 5FD6A 3WG7H 3Q5FA 3LSIA 1WFXA 2EZLA 3OYNA 5F0CA 3KZIC 3S32A 2LTPA 2ZNZA 1UG0A 3HOSA 2UXXA 3JAMK 2FJ1A 3VFZA
chains in the Genus database with same CATH topology
3P7NA 1QPMA 2M30A 1BBYA 3CO7C 5BS6A 1XGSA 3L00A 1FP2A 1IXCA 3I58A 1OYWA 2AS5F 3T1BA 2V6CA 4EM0B 2ZMEB 1Z6TA 4A0XA 3ML6A 2UXNA 2W85A 3HSEA 4ESBA 3TDUC 2P7CB 2QQBA 1IW7F 2VBZA 2Z3YA 1IZ1A 3RPQA 2L01A 4CHUA 5ERIA 3TO6A 2RDPA 4Q47A 1EH6A 1MZBA 1ZN2A 2GAUA 2K02A 4K2EA 3HRTA 2NYXA 4AIKA 3RYPA 1KQ0A 3CUOA 2M45A 2HZTA 1ON1A 3DF8A 2OD5A 2VOOA 3J81Z 1W5TA 4BHCA 2QUFA 1SD7A 4AIHA 2PJPA 1KYZA 4G6DA 3G73A 3R0JA 2P8TA 1ZGAA 3R0AA 1P4AA 2PEXA 1B1BA 2IRFG 3I0TA 2EFPA 5TRDA 3LFKA 4M71A 3TDZC 3T8TA 4NHJA 2FQ3A 3WTWC 1I5ZA 2HOEA 4EJWA 2IT0A 3CUQB 3R6SA 4CYDA 3GUDA 4CO8A 2BBYA 3ULQB 2LKPA 1KU2A 1FYLA 4QLCU 1KU7A 2EA4A 2GXBA 4I09A 4AIJA 1DPRA 5CVJA 3IWZA 1FC3A 4KA4A 3JTHA 2IPQX 5ILUA 3GW2A 2HR3A 2W25A 4LD5A 3R61A 2VE8A 1FPQA 1I27A 3D5LA 1AWCA 3C7JA 5CVRA 1LEAA 4LMYA 1P6RA 3CTAA 1XMAA 3DP7A 2DAOA 1FYMA 3C3WA 1T0FA 2GA1A 3ABTA 1ZH5A 4QWQA 1OKRA 2XAJA 1U78A 2FBIA 3Q9VA 3RJPA 2LF7A 3QRFF 4EJUA 2P5VA 2YX7A 4UUVA 2R7FA 3K1NA 4E70A 4GXOA 3HHGA 1B9NA 2VBYA 3HRMA 3O2PE 2FMLA 5L3BA 4YIFA 5F6FA 4A6DA 3N97A 1OYYA 1SMTA 4UV9A 4RB2C 2XAQA 2MLGA 4EQQA 3GYHX 1UFMA 2J5OA 1ZAOA 3I59A 2L02A 4Z2YA 2A5YB 3F6OA 4UVBA 4HLYA 1IUYA 2DQLA 1EV7A 2E1CA 2CW0F 3J7AO 3M1EA 1ZLKA 2EFQA 2DBBA 1J9IA 2DO7A 4L9NA 4U7DA 3KEOA 3PFIA 3MZHA 2VONA 3SXYA 3QP6A 3FZVA 2FE3A 5K5OA 5L3CA 3ZMSA 2EA2A 3V7SA 2V1XA 5HDKA 1BJAA 3WTUC 4UHTA 5DDGA 3E6CC 3WTTC 3K69A 3ZP5A 2QYOA 4N9HA 2O0YA 3FX3A 4A12A 1ZGJA 1T6SA 2R7DA 1G3SA 3EYYA 5HVQC 2MC3A 1DPUA 2HTJA 3LAJA 3JTGA 4P96A 2EK5A 3ZQ7A 3HSRA 4LLLA 2QM3A 4WXCA 4HV6A 4RGRA 3F6VA 2BEOA 5DYMA 1H9TA 4R8HA 2TDXA 1QO0D 2A68F 1D8KA 2DK8A 2RNJA 4M6YA 2P6TA 3RDIA 2STTA 4M9SA 1XSDA 1YW8A 1R7JA 2HYGD 4DNCA 2O61A 2P5LC 2F5CA 5HDGA 1HKTA 4KNYA 1A04A 1WRJA 2FU4A 3GLXA 5FFXA 2K7LA 1MJ9A 1IRGA 3J80K 1IN7A 1XDSA 1S29A 1KA8A 1SD4A 1W7PA 2PBIA 1D8JA 2LDUA 1K78B 3E6BA 2DQRA 1B9MA 3BWGA 3D0SA 5CVUA 2HTSA 5D4SA 4EM2A 1XCBA 2FEZA 5D5VB 3KE2A 1DUXC 4IRIA 1XCVA 2Q0OA 4A0ZA 1AOYA 4TV7A 5LGTA 4O3MA 4ZYEA 3GFLA 4LB5A 2FBHA 1SFEA 5IT3A 3LQQA 4L9JA 1YIOA 3F22A 5LHHA 3K1MA 1FY7A 1Z6RA 4YIIA 1BOAA 1K7AA 3IL2A 5JR3A 2ZMEA 4CICA 3P9CA 4BNCA 4L9TA 1KYWA 1HQCA 4A0YA 3LA7A 4OIPF 1MDMA 3KCCA 4JQFA 2XIGA 3VEPA 3R4KA 1J0RA 1SFUA 3PQJA 1BIBA 4MTEA 5FFZA 1J75A 1J5YA 5CLSA 1QZZA 1R1TA 3HIFA 2L4AA 3ZN1A 1FOKA 2K86A 2RV8A 1SD5A 3BPVA 4R79A 4I0BA 5K1YA 1ULYA 3I53A 5JI6A 2MD5A 1TNSA 1Z05A 3ROUA 1J7KA 3FWEA 4CDGA 2DU9A 3COAC 5E18F 4OIOF 2A6HF 3KFWX 1MKMA 1KU9A 3WGIA 3NRVA 3MQ0A 3Q9SA 4U88A 4KN4X 5CVIA 1IN5A 4HV5A 4HX8A 1F5TA 2JT1A 4BHPA 2AXLA 1TW2A 3WGHA 3BZ6A 3KLOA 3KEQA 1O3SA 5LHGA 1TQMA 3P9KA 2GA2A 1RIOH 2HKOA 3WU1B 5D6EA 1WQ2A 4MQ9F 2OBPA 2R3SA 4HAMA 1W5SA 2QWWA 5E1WA 5DUIA 5D5UB 5LLQA 2LNBA 1KQ9A 3FM3A 3DEUA 1QNTA 2KJBA 4BHBA 2MBFA 4L5JA 2L4MA 4BYYA 1HW1A 4HOBA 3F8BA 4KMFA 2D1VA 1QGPA 3M8EA 4N0BA 1TNTA 2GXGA 1K6OA 2PMHA 2ZCWA 2XKOA 2VN2A 4U0VA 4LB6B 1YG2A 4ESFA 1FNNA 1MDMB 4I2OA 3I4PA 1H0MA 1XN7A 2FXAA 3GO5A 4U0WA 1GXPA 4HLXA 4UVCA 3BJ6A 3JW4A 2HWVA 2CO5A 3F8FA 3E5XA 1S7OA 1TQIA 3CO6C 2XUBA 2D2WA 3SZPA 2BGCA 2H27A 4MEYF 2G7HA 5LGNA 1JHFA 1FYKA 5BPDA 2RC4A 3QPHA 3KP3A 3VOEA 4N9IA 1HBXG 5FLXZ 4NQWA 1FT9A 5ICFA 2RN7A 1R1UA 2H09A 4HZFA 4ZZLA 2HS5A 3ZPLA 2MH9A 4XLNF 3ZMDA 1LEBA 2VXZA 3DQVC 2L54A 3IRQA 1LNWA 2ISYA 1LVAA 2FNPA 4PGGA 3KZZA 4WXDA 1X3UA 4KIBA 4RB3C 5HOOA 4NB5A 3P9IA 4UV8A 2OA4A 3FF5A 5H6RA 1ZHFA 1V3FA 2QLZA 2WTEA 4ETSA 2PG4A 4Y15A 5D4RA 1IAWA 3HOTA 2K27A 3H92A 3TQNA 1WKMA 3I64A 1XGMA 1YTYA 4ZH4F 3FHZA 3BROA 4MHGA 1R36A 4P5OA 3F3XA 3M9AA 4ENMA 1TBXA 3CJNA 3GEZA 3FMQA 5L3GA 4LK0F 2H6CA 4LFUA 2EWNA 5E8GA 1G3TA 3EUHA 2ISZA 3GFMA 3MZYA 3E3VA 4MGRA 1K79A 4IPAA 5HDNA 2FNAA 1U2WA 1ZG3A 4HQMA 1TQPA 3CLOA 1XD7A 2ESNA 4JK1X 4OIQF 1CGPA 2B0LA 2XV4S 5HLGA 4ZYGA 1YS7A 4FT8A 1FSHA 2A07F 3FXQA 1R58A 3V8LA 3LA3A 4EMSA 5JVTA 5K5RA 5DD8A 1KQ8A 5K5QA 5HLIA 1MD0A 2V1UA 2EJRA 2H94A 1IXRC 4G7OF 4YFKF 3JSOA 1SAXA 5A2QK 1SD6A 1K78A 1GXQA 3GX4X 1BI0A 4EJOA 1ZG5A 3EYIA 3OV8A 1Z91A 3EQLF 4O6JA 2EV6A 4EJVA 2FSWA 3I5UA 5D8LB 4Q48A 1MGTA 1LDDA 3MAJA 4R1HA 4MTDA 2ACJA 1F4KA 4MNUA 2O8XA 3ZMVA 2X4HA 2OQRA 1ZRFA 5BQTA 5BMZA 1S6LA 1WWXA 5LGUA 4M9ZA 1OPCA 3ERED 2P5KA 1YW7A 1KU3A 5HS7A 4HBLA 2K4BA 3I71A 3GFJA 1P4WA 1PDNC 1B6AA 5ICCA 4WF2A 3ECHA 2F5DA 2RQPA 2NRAC 4MEXF 2Q8KA 1HW5A 3ZN0A 3FXUA 2Z9OA 3LSTA 3KP6A 4IRGA 2A3SA 1RUOA 1U5TB 1FP1D 4ZZDA 2IJLA 2EFNA 1G6NA 2G7UA 4I7HA 1TW3A 2W24A 1EH7A 3QP5A 2EB7A 5FO5A 3V8JA 1E17A 3IKVA 4D0PA 2XAGA 3WODF 3WU0A 1IN6A 3JAMZ 2P7VB 3QPTA 3OOPA 4LGWA 3HHHA 4HDUA 4IJAA 1U3EM 3I54A 1XB4A 4OU0A 1BIAA 1CF7B 5L3FA 2ETHA 2XHKA 2EFOA 1MJAA 3LWFA 2KIUA 2Y75A 4LLGF 3DFGA 1O3RA 4RGSA 5E8IA 1PP8F 2KJCA 4PZJA 4F7ZA 3R60A 2KIFA 5HS9A 1PUEE 4BH9A 1I6XA 1HSJA 2STWA 5D5XB 1EH8A 5IT9K 1LDJA 3BJOA 1FSEA 3FM5A 3W6KB 1IXSB 2WC2A 5E17F 4S04A 3H3ZA 4OMYA 2XKPA 1U6GA 3BPXA 3GZ6A 5J8FA 3RKWA 3DV8A 3C1DA 3WTSC 2COMA 2P4WA 1FLIA 3FMSA 1ODDA 5FGMA 2MLKA 4XLPF 4LG0B 4M73A 4BQAA 3MWMA 3U2RA 2Z33A 4B8XA 2CQKA 2YPRA 4I02A 3F8MA 1XGNA 2NS0A 2O03A 4EGZA 1IN8A 5LRSA 3GZ5A 1BI1A 5AONA 3IWFA 1GVJA 4PCQA 5KK1A 4WCGA 2ESHA 2BV6A 4L18B 3TO7A 3WTVC 2V9VA 3KETA 4XSXF 1FBUA 4DQ2A 4YFNF 4KDPA 2FBKA 4LJZF 3GXOA 2GZWA 5JFRA 4WK8F 1OYIA 1R5GA 2L3DA 2HFHA 5KVRA 3T5XA 4LK1F 4HW0A 2OZUA 2YX4A 4KIFA 1ZARA 1FZPB 3U1DA 3ELKA 5FB2A 2QQ9A 1KGSA 5CVVA 2M5WA 3E6DA 2E1NA 2Y0MA 2YU3A 3WTZA 5E20A 2QBYB 2E7XA 4CZZA 3C18A 5J8CA 4EJTA 3O6BB 2WWYA 2RKHA 1U8RA 2ZBKA 4EGYA 2ELHA 2O6GE 1RZ4A 1S3JA 4MQVA 1HSTA 1WSUA 4IF4A 1IF1A 2BYVE 2V1DA 2IP2A 1L0OC 2CWEA 2OQGA 2F5FA 2ZXJA 4ENKA 2UWMA 1BN5A 2VOPA 4HA8A 3QAHA 5BOXA 2KKOA 2XRNA 4JBAA 1BC8C 1JHHA 5LRRA 2CG4A 2VT2A 1D3YA 1S8NA 1XGOA 2HYFA 4I01A 1G3WA 2CSOA 2ZO4A 3KP5A 3WE3A 4YFXF 1DP7P 2JPCA 3LQRA 2XAHA 2QVOA 5LEJA 3GF2A 1XDUA 2UZKA 4HF0A 4P9FA 1O3TA 2IA0A 1FX7A 4Y13A 1T2KA 2VODA 3HTSB 2C6YA 1HKQA 3GVAA 2HQNA 2CYYA 2IVMA 4M74A 1T98A 4G94A 3FXRA 3HTUA 1R22A 2EFWA 2XVCA 3NEUA 3LA2A 1QBJA 1Y0UA 1W4MA 4CXFA 1WI9A 3DXJF 5CYVA 1G3YA 2E7WA 2KIMA 1FBSA 5D5WB 5HS8A 3ABUA 1IN4A 4H0EA 4HX7A 1BM9A 3WE2A 2IA1A 1IRFA 3L09A 3W6JB 1B59A 3RYRA 2DW4A 3QU3A 1STZA 2KRFA 1J59A 2LSOA 2YR2A 3E97A 2ZNYA 3VODA 3RIRA 2Z99A 5L3EA 3WG9A 4EM1A 3RPUA 1QZYA 5EEHA 2M8EA 1HXDA 2JTVA 3ZMZA 1U5TC 5BPIA 2XAFA 2PLYA 4ENJA 5IT9Z 1ZRDA 4RB0A 1MJBA 2OU2A 3EDPA 3J80Z 3KZYA 4UXNA 4RGUA 2FOKA 1USSA 4L0YB 3IKTA 3MCZA 1U5TA 3K0LA 3N4MA 4KUMA 4I98B 3SQNA 5DEQA 4UNOA 3IHUA 1Z9CA 1ON2A 1G4DA 2DPDA 4A6EA 3ECOA 2JPBA 1USTA 3NQOA 5DUKA 1H9GA 5ILVA 4U7BA 1ZYRF 3F8NA 5ED4A 5AIPA 3HRSA 3HUGA 2G9WA 2MH2A 4GYIA 3BP8A 4G7ZF 1CF7A 1XSXA 1YO5C 1ZG1A 4KIGA 1UHWA 3AAFA 1BC7C 2NNNA 3SZTA 2HEOA 3HSFA 3KP4A 4L0ZB 3B73A 2FA5A 4AVPA 4S05A 1JE8A 4M6XA 5DD4A 3IC7A 4O5VA 4M9XA 4B09A 4WWCA 1JGSA 4IHSA 5F64A 4FHTA 2XGXA 4RB1A 4I0AA 2M87A 4G7HF 3E6MA 5DCMB 3KLNA 2DFIA 1GHCA 1RNLA 3KP7A 1O3QA 4RAYA 3WTXC 5LHIA 2M1BA 2LF8A 1YLFA 2EV5A 2JRTA 2VT3A 4AD9A 5L3DA 3F21A 1UCRA 4KT5C 4L5IA 5DV5A 2FRHA 2XASA 1P92A 1VTNC 3TGNA 1LB2A 2PI0A 3G3ZA 2IW5A 5EEGA 4YG2F 3CDHA 4LG0A 2BE5F 3DPLC 2IA2A 4ENNA 4FX0A 5DCFA 2D45A 4G8XA 1XSVA 3GFIA 4KN7X 1ZREA 4XSZF 4RAZA 4EVIA 1DDNA 2HKXA 3TO9A 3FMRA 4OOIA 4IVNA 4IRHA 5F1RA 1Z1DA 4L9VA 1E2XA 5ILSA 3BY6A 2GQQA 1B4AA 1QQIA 1R23A 2DK5A 2H6BA 1ONVA 4U0YA 4Q4ZF 5J6XA 2RGVA 1F9NA 4P55A 1RI7A 5H6QA 4LLNA 3DKWA 3RI4A 1C0WA 2A69F 3T0YA 5TJJA 3F23A 2P6SA 2QBYA 4FX4A 1YS6A 2YSRA 1P2FA 3H3UA 4HQEA 2QENA 2PQ8A 4XBFA 4HDVA 3RTRA 3BDDA 1O7LA 3U9GA 4CGZA 2VE9A 2J5PA 2OZ6A 4GGGA 5D6FA 2A61A 2FF4A 1BI2A 2HQRA 4RS8A 5E1ZB 1F1ZA 1JXSA 2GIVA 5HLHA 1OR7A 3ZMUA 3MFKA 1TLHB 4OMZA 3RKXA 3WGGA 2HDCA 3O3KA 3V4GA 1LQ1A 3QOPA 2WV0A 1XMKA 1J2XA 3V7CA 2JZYA 2OAZA 5ICEA 3J81K 5FLXK 3L7WA 4Y17A 4AWXB 2RVCA 1FBQA 2D1HA 3DPTA 3LAPA 1W7PD 4G9YA 1SFXA 3IRRA 1HW2A 1OMIA 5FD5A 1T39A 1REPC 1R00A 2DPUA 2DI3A 4A5MA 1V4RA 2VBXA 5H20A 1YQAA 2EV0A 4BXUA 4EV0A 2PN6A 3I59B 4ZYDA 1ZLJA 4IXAA 1S7AA 3VB2A 1I1GA 4HYEA 3S2WA 3JSPA 2ZFWA 2A6EF 2CGPA 5JHUA 2ADUA 1HKSA 3SHFA 1R1VA 2NNYA 2F2EA 4WX9A 2XROA 4PDKA 2K4JA 4XRFA 3ISPA 2ZKZA 4GO1A 1T38A 3F72A 2W57A 1NHAA 2PFBA 2VC1A 1RUNA 3SFZA 2NAZA 4A5NA 3L2CA 4BAYA 4ZYHA 5LEKA 2VBWA 3B02A 4OIRF 2O3FA 1P4XA 3K2ZA 3F8CA 4IHTA 1UHMA 2PMUA 2DTRA 3ZMTA 4RGXA 1D5VA 1YYVA 3K1PA 5CJ9A 2X0LA 1ZRCA 3HRUA 3E5QA 3L9FA 2DT5A 1Z7UA 3M7GA 1TTYA 1LJ9A 3RKYA 4A2UA 2VC0A 3TOBA 3V8KA 3PQKA 4HX4A 5A2QZ 1YFHA 4Q5SF 4HF2A 5E1XA 1Q1HA 4KICA 5AIQA 2HGCA 2ZJ2A 3TOAA 5LBQA 3CUQC 2F5EA 3E5UA 3MEXA 2V79A 1FWZA 4ON0A 4KFCA 2Z5UA 4PGHA 3BOQA 6PAXA 5D8KB 1R5HA 3EETA 2Y48A 1LDKB 4GCVA 2CFXA 2QZ8A 1I1SA 1O7FA 3CUQA 2DLLA 3GWZA 3K9TA 1SMYF 4HF1A 4KYWA 4P9UA 1L3LA 3BJAA 4G6QA 4ESJA 4ASNA 2GWRA 5ICGA 4M72A 3REOA 2QQAA 3KP2A 4OINF 3V7RA 3M8FA 1W7PB 2Q2EA 3T8RA 1BI3A 1O57A 1PP7U 4KMUX 4GYGA 3WTYC 1UB9A 4WXHA 5DCMA 2W84A 2FMYA 1YW9A 3TKYA 2MA3A 3QU6A 2JSCA 4UVAA 5FD6A 3Q5FA 2ZNZA 3HOSA 2UXXA 3JAMK 3HYIA 3VFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7N A;  1QPM A;  2M30 A;  1BBY A;  3CO7 C;  5BS6 A;  1XGS A;  3L00 A;  1FP2 A;  1IXC A;  3I58 A;  1OYW A;  2AS5 F;  3T1B A;  2V6C A;  4EM0 B;  2ZME B;  1Z6T A;  4A0X A;  3ML6 A;  2UXN A;  2W85 A;  3HSE A;  4ESB A;  3TDU C;  2P7C B;  2QQB A;  1IW7 F;  2VBZ A;  2Z3Y A;  1IZ1 A;  3RPQ A;  2L01 A;  4CHU A;  5ERI A;  3TO6 A;  2RDP A;  4Q47 A;  1EH6 A;  1MZB A;  1ZN2 A;  2GAU A;  2K02 A;  4K2E A;  3HRT A;  2NYX A;  4AIK A;  3RYP A;  1KQ0 A;  3CUO A;  2M45 A;  2HZT A;  1ON1 A;  3DF8 A;  2OD5 A;  2VOO A;  3J81 Z;  1W5T A;  4BHC A;  2QUF A;  1SD7 A;  4AIH A;  2PJP A;  1KYZ A;  4G6D A;  3G73 A;  3R0J A;  2P8T A;  1ZGA A;  3R0A A;  1P4A A;  2PEX A;  1B1B A;  2IRF G;  3I0T A;  2EFP A;  5TRD A;  3LFK A;  4M71 A;  3TDZ C;  3T8T A;  4NHJ A;  2FQ3 A;  3WTW C;  1I5Z A;  2HOE A;  4EJW A;  2IT0 A;  3CUQ B;  3R6S A;  4CYD A;  3GUD A;  4CO8 A;  2BBY A;  3ULQ B;  2LKP A;  1KU2 A;  1FYL A;  4QLC U;  1KU7 A;  2EA4 A;  2GXB A;  4I09 A;  4AIJ A;  1DPR A;  5CVJ A;  3IWZ A;  1FC3 A;  4KA4 A;  3JTH A;  2IPQ X;  5ILU A;  3GW2 A;  2HR3 A;  2W25 A;  4LD5 A;  3R61 A;  2VE8 A;  1FPQ A;  1I27 A;  3D5L A;  1AWC A;  3C7J A;  5CVR A;  1LEA A;  4LMY A;  1P6R A;  3CTA A;  1XMA A;  3DP7 A;  2DAO A;  1FYM A;  3C3W A;  1T0F A;  2GA1 A;  3ABT A;  1ZH5 A;  4QWQ A;  1OKR A;  2XAJ A;  1U78 A;  2FBI A;  3Q9V A;  3RJP A;  2LF7 A;  3QRF F;  4EJU A;  2P5V A;  2YX7 A;  4UUV A;  2R7F A;  3K1N A;  4E70 A;  4GXO A;  3HHG A;  1B9N A;  2VBY A;  3HRM A;  3O2P E;  2FML A;  5L3B A;  4YIF A;  5F6F A;  4A6D A;  3N97 A;  1OYY A;  1SMT A;  4UV9 A;  4RB2 C;  2XAQ A;  2MLG A;  4EQQ A;  3GYH X;  1UFM A;  2J5O A;  1ZAO A;  3I59 A;  2L02 A;  4Z2Y A;  2A5Y B;  3F6O A;  4UVB A;  4HLY A;  1IUY A;  2DQL A;  1EV7 A;  2E1C A;  2CW0 F;  3J7A O;  3M1E A;  1ZLK A;  2EFQ A;  2DBB A;  1J9I A;  2DO7 A;  4L9N A;  4U7D A;  3KEO A;  3PFI A;  3MZH A;  2VON A;  3SXY A;  3QP6 A;  3FZV A;  2FE3 A;  5K5O A;  5L3C A;  3ZMS A;  2EA2 A;  3V7S A;  2V1X A;  5HDK A;  1BJA A;  3WTU C;  4UHT A;  5DDG A;  3E6C C;  3WTT C;  3K69 A;  3ZP5 A;  2QYO A;  4N9H A;  2O0Y A;  3FX3 A;  4A12 A;  1ZGJ A;  1T6S A;  2R7D A;  1G3S A;  3EYY A;  5HVQ C;  2MC3 A;  1DPU A;  2HTJ A;  3LAJ A;  3JTG A;  4P96 A;  2EK5 A;  3ZQ7 A;  3HSR A;  4LLL A;  2QM3 A;  4WXC A;  4HV6 A;  4RGR A;  3F6V A;  2BEO A;  5DYM A;  1H9T A;  4R8H A;  2TDX A;  1QO0 D;  2A68 F;  1D8K A;  2DK8 A;  2RNJ A;  4M6Y A;  2P6T A;  3RDI A;  2STT A;  4M9S A;  1XSD A;  1YW8 A;  1R7J A;  2HYG D;  4DNC A;  2O61 A;  2P5L C;  2F5C A;  5HDG A;  1HKT A;  4KNY A;  1A04 A;  1WRJ A;  2FU4 A;  3GLX A;  5FFX A;  2K7L A;  1MJ9 A;  1IRG A;  3J80 K;  1IN7 A;  1XDS A;  1S29 A;  1KA8 A;  1SD4 A;  1W7P A;  2PBI A;  1D8J A;  2LDU A;  1K78 B;  3E6B A;  2DQR A;  1B9M A;  3BWG A;  3D0S A;  5CVU A;  2HTS A;  5D4S A;  4EM2 A;  1XCB A;  2FEZ A;  5D5V B;  3KE2 A;  1DUX C;  4IRI A;  1XCV A;  2Q0O A;  4A0Z A;  1AOY A;  4TV7 A;  5LGT A;  4O3M A;  4ZYE A;  3GFL A;  4LB5 A;  2FBH A;  1SFE A;  5IT3 A;  3LQQ A;  4L9J A;  1YIO A;  3F22 A;  5LHH A;  3K1M A;  1FY7 A;  1Z6R A;  4YII A;  1BOA A;  1K7A A;  3IL2 A;  5JR3 A;  2ZME A;  4CIC A;  3P9C A;  4BNC A;  4L9T A;  1KYW A;  1HQC A;  4A0Y A;  3LA7 A;  4OIP F;  1MDM A;  3KCC A;  4JQF A;  2XIG A;  3VEP A;  3R4K A;  1J0R A;  1SFU A;  3PQJ A;  1BIB A;  4MTE A;  5FFZ A;  1J75 A;  1J5Y A;  5CLS A;  1QZZ A;  1R1T A;  3HIF A;  2L4A A;  3ZN1 A;  1FOK A;  2K86 A;  2RV8 A;  1SD5 A;  3BPV A;  4R79 A;  4I0B A;  5K1Y A;  1ULY A;  3I53 A;  5JI6 A;  2MD5 A;  1TNS A;  1Z05 A;  3ROU A;  1J7K A;  3FWE A;  4CDG A;  2DU9 A;  3COA C;  5E18 F;  4OIO F;  2A6H F;  3KFW X;  1MKM A;  1KU9 A;  3WGI A;  3NRV A;  3MQ0 A;  3Q9S A;  4U88 A;  4KN4 X;  5CVI A;  1IN5 A;  4HV5 A;  4HX8 A;  1F5T A;  2JT1 A;  4BHP A;  2AXL A;  1TW2 A;  3WGH A;  3BZ6 A;  3KLO A;  3KEQ A;  1O3S A;  5LHG A;  1TQM A;  3P9K A;  2GA2 A;  1RIO H;  2HKO A;  3WU1 B;  5D6E A;  1WQ2 A;  4MQ9 F;  2OBP A;  2R3S A;  4HAM A;  1W5S A;  2QWW A;  5E1W A;  5DUI A;  5D5U B;  5LLQ A;  2LNB A;  1KQ9 A;  3FM3 A;  3DEU A;  1QNT A;  2KJB A;  4BHB A;  2MBF A;  4L5J A;  2L4M A;  4BYY A;  1HW1 A;  4HOB A;  3F8B A;  4KMF A;  2D1V A;  1QGP A;  3M8E A;  4N0B A;  1TNT A;  2GXG A;  1K6O A;  2PMH A;  2ZCW A;  2XKO A;  2VN2 A;  4U0V A;  4LB6 B;  1YG2 A;  4ESF A;  1FNN A;  1MDM B;  4I2O A;  3I4P A;  1H0M A;  1XN7 A;  2FXA A;  3GO5 A;  4U0W A;  1GXP A;  4HLX A;  4UVC A;  3BJ6 A;  3JW4 A;  2HWV A;  2CO5 A;  3F8F A;  3E5X A;  1S7O A;  1TQI A;  3CO6 C;  2XUB A;  2D2W A;  3SZP A;  2BGC A;  2H27 A;  4MEY F;  2G7H A;  5LGN A;  1JHF A;  1FYK A;  5BPD A;  2RC4 A;  3QPH A;  3KP3 A;  3VOE A;  4N9I A;  1HBX G;  5FLX Z;  4NQW A;  1FT9 A;  5ICF A;  2RN7 A;  1R1U A;  2H09 A;  4HZF A;  4ZZL A;  2HS5 A;  3ZPL A;  2MH9 A;  4XLN F;  3ZMD A;  1LEB A;  2VXZ A;  3DQV C;  2L54 A;  3IRQ A;  1LNW A;  2ISY A;  1LVA A;  2FNP A;  4PGG A;  3KZZ A;  4WXD A;  1X3U A;  4KIB A;  4RB3 C;  5HOO A;  4NB5 A;  3P9I A;  4UV8 A;  2OA4 A;  3FF5 A;  5H6R A;  1ZHF A;  1V3F A;  2QLZ A;  2WTE A;  4ETS A;  2PG4 A;  4Y15 A;  5D4R A;  1IAW A;  3HOT A;  2K27 A;  3H92 A;  3TQN A;  1WKM A;  3I64 A;  1XGM A;  1YTY A;  4ZH4 F;  3FHZ A;  3BRO A;  4MHG A;  1R36 A;  4P5O A;  3F3X A;  3M9A A;  4ENM A;  1TBX A;  3CJN A;  3GEZ A;  3FMQ A;  5L3G A;  4LK0 F;  2H6C A;  4LFU A;  2EWN A;  5E8G A;  1G3T A;  3EUH A;  2ISZ A;  3GFM A;  3MZY A;  3E3V A;  4MGR A;  1K79 A;  4IPA A;  5HDN A;  2FNA A;  1U2W A;  1ZG3 A;  4HQM A;  1TQP A;  3CLO A;  1XD7 A;  2ESN A;  4JK1 X;  4OIQ F;  1CGP A;  2B0L A;  2XV4 S;  5HLG A;  4ZYG A;  1YS7 A;  4FT8 A;  1FSH A;  2A07 F;  3FXQ A;  1R58 A;  3V8L A;  3LA3 A;  4EMS A;  5JVT A;  5K5R A;  5DD8 A;  1KQ8 A;  5K5Q A;  5HLI A;  1MD0 A;  2V1U A;  2EJR A;  2H94 A;  1IXR C;  4G7O F;  4YFK F;  3JSO A;  1SAX A;  5A2Q K;  1SD6 A;  1K78 A;  1GXQ A;  3GX4 X;  1BI0 A;  4EJO A;  1ZG5 A;  3EYI A;  3OV8 A;  1Z91 A;  3EQL F;  4O6J A;  2EV6 A;  4EJV A;  2FSW A;  3I5U A;  5D8L B;  4Q48 A;  1MGT A;  1LDD A;  3MAJ A;  4R1H A;  4MTD A;  2ACJ A;  1F4K A;  4MNU A;  2O8X A;  3ZMV A;  2X4H A;  2OQR A;  1ZRF A;  5BQT A;  5BMZ A;  1S6L A;  1WWX A;  5LGU A;  4M9Z A;  1OPC A;  3ERE D;  2P5K A;  1YW7 A;  1KU3 A;  5HS7 A;  4HBL A;  2K4B A;  3I71 A;  3GFJ A;  1P4W A;  1PDN C;  1B6A A;  5ICC A;  4WF2 A;  3ECH A;  2F5D A;  2RQP A;  2NRA C;  4MEX F;  2Q8K A;  1HW5 A;  3ZN0 A;  3FXU A;  2Z9O A;  3LST A;  3KP6 A;  4IRG A;  2A3S A;  1RUO A;  1U5T B;  1FP1 D;  4ZZD A;  2IJL A;  2EFN A;  1G6N A;  2G7U A;  4I7H A;  1TW3 A;  2W24 A;  1EH7 A;  3QP5 A;  2EB7 A;  5FO5 A;  3V8J A;  1E17 A;  3IKV A;  4D0P A;  2XAG A;  3WOD F;  3WU0 A;  1IN6 A;  3JAM Z;  2P7V B;  3QPT A;  3OOP A;  4LGW A;  3HHH A;  4HDU A;  4IJA A;  1U3E M;  3I54 A;  1XB4 A;  4OU0 A;  1BIA A;  1CF7 B;  5L3F A;  2ETH A;  2XHK A;  2EFO A;  1MJA A;  3LWF A;  2KIU A;  2Y75 A;  4LLG F;  3DFG A;  1O3R A;  4RGS A;  5E8I A;  1PP8 F;  2KJC A;  4PZJ A;  4F7Z A;  3R60 A;  2KIF A;  5HS9 A;  1PUE E;  4BH9 A;  1I6X A;  1HSJ A;  2STW A;  5D5X B;  1EH8 A;  5IT9 K;  1LDJ A;  3BJO A;  1FSE A;  3FM5 A;  3W6K B;  1IXS B;  2WC2 A;  5E17 F;  4S04 A;  3H3Z A;  4OMY A;  2XKP A;  1U6G A;  3BPX A;  3GZ6 A;  5J8F A;  3RKW A;  3DV8 A;  3C1D A;  3WTS C;  2COM A;  2P4W A;  1FLI A;  3FMS A;  1ODD A;  5FGM A;  2MLK A;  4XLP F;  4LG0 B;  4M73 A;  4BQA A;  3MWM A;  3U2R A;  2Z33 A;  4B8X A;  2CQK A;  2YPR A;  4I02 A;  3F8M A;  1XGN A;  2NS0 A;  2O03 A;  4EGZ A;  1IN8 A;  5LRS A;  3GZ5 A;  1BI1 A;  5AON A;  3IWF A;  1GVJ A;  4PCQ A;  5KK1 A;  4WCG A;  2ESH A;  2BV6 A;  4L18 B;  3TO7 A;  3WTV C;  2V9V A;  3KET A;  4XSX F;  1FBU A;  4DQ2 A;  4YFN F;  4KDP A;  2FBK A;  4LJZ F;  3GXO A;  2GZW A;  5JFR A;  4WK8 F;  1OYI A;  1R5G A;  2L3D A;  2HFH A;  5KVR A;  3T5X A;  4LK1 F;  4HW0 A;  2OZU A;  2YX4 A;  4KIF A;  1ZAR A;  1FZP B;  3U1D A;  3ELK A;  5FB2 A;  2QQ9 A;  1KGS A;  5CVV A;  2M5W A;  3E6D A;  2E1N A;  2Y0M A;  2YU3 A;  3WTZ A;  5E20 A;  2QBY B;  2E7X A;  4CZZ A;  3C18 A;  5J8C A;  4EJT A;  3O6B B;  2WWY A;  2RKH A;  1U8R A;  2ZBK A;  4EGY A;  2ELH A;  2O6G E;  1RZ4 A;  1S3J A;  4MQV A;  1HST A;  1WSU A;  4IF4 A;  1IF1 A;  2BYV E;  2V1D A;  2IP2 A;  1L0O C;  2CWE A;  2OQG A;  2F5F A;  2ZXJ A;  4ENK A;  2UWM A;  1BN5 A;  2VOP A;  4HA8 A;  3QAH A;  5BOX A;  2KKO A;  2XRN A;  4JBA A;  1BC8 C;  1JHH A;  5LRR A;  2CG4 A;  2VT2 A;  1D3Y A;  1S8N A;  1XGO A;  2HYF A;  4I01 A;  1G3W A;  2CSO A;  2ZO4 A;  3KP5 A;  3WE3 A;  4YFX F;  1DP7 P;  2JPC A;  3LQR A;  2XAH A;  2QVO A;  5LEJ A;  3GF2 A;  1XDU A;  2UZK A;  4HF0 A;  4P9F A;  1O3T A;  2IA0 A;  1FX7 A;  4Y13 A;  1T2K A;  2VOD A;  3HTS B;  2C6Y A;  1HKQ A;  3GVA A;  2HQN A;  2CYY A;  2IVM A;  4M74 A;  1T98 A;  4G94 A;  3FXR A;  3HTU A;  1R22 A;  2EFW A;  2XVC A;  3NEU A;  3LA2 A;  1QBJ A;  1Y0U A;  1W4M A;  4CXF A;  1WI9 A;  3DXJ F;  5CYV A;  1G3Y A;  2E7W A;  2KIM A;  1FBS A;  5D5W B;  5HS8 A;  3ABU A;  1IN4 A;  4H0E A;  4HX7 A;  1BM9 A;  3WE2 A;  2IA1 A;  1IRF A;  3L09 A;  3W6J B;  1B59 A;  3RYR A;  2DW4 A;  3QU3 A;  1STZ A;  2KRF A;  1J59 A;  2LSO A;  2YR2 A;  3E97 A;  2ZNY A;  3VOD A;  3RIR A;  2Z99 A;  5L3E A;  3WG9 A;  4EM1 A;  3RPU A;  1QZY A;  5EEH A;  2M8E A;  1HXD A;  2JTV A;  3ZMZ A;  1U5T C;  5BPI A;  2XAF A;  2PLY A;  4ENJ A;  5IT9 Z;  1ZRD A;  4RB0 A;  1MJB A;  2OU2 A;  3EDP A;  3J80 Z;  3KZY A;  4UXN A;  4RGU A;  2FOK A;  1USS A;  4L0Y B;  3IKT A;  3MCZ A;  1U5T A;  3K0L A;  3N4M A;  4KUM A;  4I98 B;  3SQN A;  5DEQ A;  4UNO A;  3IHU A;  1Z9C A;  1ON2 A;  1G4D A;  2DPD A;  4A6E A;  3ECO A;  2JPB A;  1UST A;  3NQO A;  5DUK A;  1H9G A;  5ILV A;  4U7B A;  1ZYR F;  3F8N A;  5ED4 A;  5AIP A;  3HRS A;  3HUG A;  2G9W A;  2MH2 A;  4GYI A;  3BP8 A;  4G7Z F;  1CF7 A;  1XSX A;  1YO5 C;  1ZG1 A;  4KIG A;  1UHW A;  3AAF A;  1BC7 C;  2NNN A;  3SZT A;  2HEO A;  3HSF A;  3KP4 A;  4L0Z B;  3B73 A;  2FA5 A;  4AVP A;  4S05 A;  1JE8 A;  4M6X A;  5DD4 A;  3IC7 A;  4O5V A;  4M9X A;  4B09 A;  4WWC A;  1JGS A;  4IHS A;  5F64 A;  4FHT A;  2XGX A;  4RB1 A;  4I0A A;  2M87 A;  4G7H F;  3E6M A;  5DCM B;  3KLN A;  2DFI A;  1GHC A;  1RNL A;  3KP7 A;  1O3Q A;  4RAY A;  3WTX C;  5LHI A;  2M1B A;  2LF8 A;  1YLF A;  2EV5 A;  2JRT A;  2VT3 A;  4AD9 A;  5L3D A;  3F21 A;  1UCR A;  4KT5 C;  4L5I A;  5DV5 A;  2FRH A;  2XAS A;  1P92 A;  1VTN C;  3TGN A;  1LB2 A;  2PI0 A;  3G3Z A;  2IW5 A;  5EEG A;  4YG2 F;  3CDH A;  4LG0 A;  2BE5 F;  3DPL C;  2IA2 A;  4ENN A;  4FX0 A;  5DCF A;  2D45 A;  4G8X A;  1XSV A;  3GFI A;  4KN7 X;  1ZRE A;  4XSZ F;  4RAZ A;  4EVI A;  1DDN A;  2HKX A;  3TO9 A;  3FMR A;  4OOI A;  4IVN A;  4IRH A;  5F1R A;  1Z1D A;  4L9V A;  1E2X A;  5ILS A;  3BY6 A;  2GQQ A;  1B4A A;  1QQI A;  1R23 A;  2DK5 A;  2H6B A;  1ONV A;  4U0Y A;  4Q4Z F;  5J6X A;  2RGV A;  1F9N A;  4P55 A;  1RI7 A;  5H6Q A;  4LLN A;  3DKW A;  3RI4 A;  1C0W A;  2A69 F;  3T0Y A;  5TJJ A;  3F23 A;  2P6S A;  2QBY A;  4FX4 A;  1YS6 A;  2YSR A;  1P2F A;  3H3U A;  4HQE A;  2QEN A;  2PQ8 A;  4XBF A;  4HDV A;  3RTR A;  3BDD A;  1O7L A;  3U9G A;  4CGZ A;  2VE9 A;  2J5P A;  2OZ6 A;  4GGG A;  5D6F A;  2A61 A;  2FF4 A;  1BI2 A;  2HQR A;  4RS8 A;  5E1Z B;  1F1Z A;  1JXS A;  2GIV A;  5HLH A;  1OR7 A;  3ZMU A;  3MFK A;  1TLH B;  4OMZ A;  3RKX A;  3WGG A;  2HDC A;  3O3K A;  3V4G A;  1LQ1 A;  3QOP A;  2WV0 A;  1XMK A;  1J2X A;  3V7C A;  2JZY A;  2OAZ A;  5ICE A;  3J81 K;  5FLX K;  3L7W A;  4Y17 A;  4AWX B;  2RVC A;  1FBQ A;  2D1H A;  3DPT A;  3LAP A;  1W7P D;  4G9Y A;  1SFX A;  3IRR A;  1HW2 A;  1OMI A;  5FD5 A;  1T39 A;  1REP C;  1R00 A;  2DPU A;  2DI3 A;  4A5M A;  1V4R A;  2VBX A;  5H20 A;  1YQA A;  2EV0 A;  4BXU A;  4EV0 A;  2PN6 A;  3I59 B;  4ZYD A;  1ZLJ A;  4IXA A;  1S7A A;  3VB2 A;  1I1G A;  4HYE A;  3S2W A;  3JSP A;  2ZFW A;  2A6E F;  2CGP A;  5JHU A;  2ADU A;  1HKS A;  3SHF A;  1R1V A;  2NNY A;  2F2E A;  4WX9 A;  2XRO A;  4PDK A;  2K4J A;  4XRF A;  3ISP A;  2ZKZ A;  4GO1 A;  1T38 A;  3F72 A;  2W57 A;  1NHA A;  2PFB A;  2VC1 A;  1RUN A;  3SFZ A;  2NAZ A;  4A5N A;  3L2C A;  4BAY A;  4ZYH A;  5LEK A;  2VBW A;  3B02 A;  4OIR F;  2O3F A;  1P4X A;  3K2Z A;  3F8C A;  4IHT A;  1UHM A;  2PMU A;  2DTR A;  3ZMT A;  4RGX A;  1D5V A;  1YYV A;  3K1P A;  5CJ9 A;  2X0L A;  1ZRC A;  3HRU A;  3E5Q A;  3L9F A;  2DT5 A;  1Z7U A;  3M7G A;  1TTY A;  1LJ9 A;  3RKY A;  4A2U A;  2VC0 A;  3TOB A;  3V8K A;  3PQK A;  4HX4 A;  5A2Q Z;  1YFH A;  4Q5S F;  4HF2 A;  5E1X A;  1Q1H A;  4KIC A;  5AIQ A;  2HGC A;  2ZJ2 A;  3TOA A;  5LBQ A;  3CUQ C;  2F5E A;  3E5U A;  3MEX A;  2V79 A;  1FWZ A;  4ON0 A;  4KFC A;  2Z5U A;  4PGH A;  3BOQ A;  6PAX A;  5D8K B;  1R5H A;  3EET A;  2Y48 A;  1LDK B;  4GCV A;  2CFX A;  2QZ8 A;  1I1S A;  1O7F A;  3CUQ A;  2DLL A;  3GWZ A;  3K9T A;  1SMY F;  4HF1 A;  4KYW A;  4P9U A;  1L3L A;  3BJA A;  4G6Q A;  4ESJ A;  4ASN A;  2GWR A;  5ICG A;  4M72 A;  3REO A;  2QQA A;  3KP2 A;  4OIN F;  3V7R A;  3M8F A;  1W7P B;  2Q2E A;  3T8R A;  1BI3 A;  1O57 A;  1PP7 U;  4KMU X;  4GYG A;  3WTY C;  1UB9 A;  4WXH A;  5DCM A;  2W84 A;  2FMY A;  1YW9 A;  3TKY A;  2MA3 A;  3QU6 A;  2JSC A;  4UVA A;  5FD6 A;  3Q5F A;  2ZNZ A;  3HOS A;  2UXX A;  3JAM K;  3HYI A;  3VFZ A; 
#chains in the Genus database with same CATH topology
 3P7N A;  4FET A;  1QPM A;  4B47 A;  1VI0 A;  2M30 A;  1BBY A;  3CO7 C;  5BS6 A;  3TW7 A;  2H1L A;  2KL4 A;  3L2W A;  1XGS A;  5GPC A;  3L00 A;  1FP2 A;  2R7U A;  1IXC A;  3I58 A;  1OYW A;  2W7N A;  2AS5 F;  4W1U A;  1Q1V A;  2EBI A;  3T1B A;  3MKZ A;  2V6C A;  4EM0 B;  1RPW A;  2ZME B;  1Z6T A;  4A0X A;  1LPQ A;  1JKQ C;  2LVS A;  3ML6 A;  5E3L A;  2UXN A;  2W85 A;  1ZR2 A;  3HSE A;  4PJJ A;  3TDU C;  4ITV A;  4ESB A;  2P7C B;  2QQB A;  1IW7 F;  2VBZ A;  1T08 B;  2Z3Y A;  1IZ1 A;  3RPQ A;  2R4G A;  2L01 A;  4CHU A;  3I4N J;  2XSJ C;  5ERI A;  3TO6 A;  2RDP A;  3AG2 H;  4Q47 A;  4I76 A;  1EH6 A;  4NDL A;  1MZB A;  4FTH A;  1ZN2 A;  2GAU A;  3ABK H;  2KZV A;  3D5R C;  2K02 A;  4K2E A;  3HRT A;  4FQG A;  2LRD A;  4JP0 A;  2LBF A;  2NYX A;  3LNQ A;  4AIK A;  1VQN I;  3FDY A;  1Z0X A;  4NC7 A;  1ACI A;  3LOC A;  3RYP A;  3CF2 A;  1KQ0 A;  4G12 A;  1P7J A;  3BG9 A;  3CUO A;  4B48 A;  1R49 A;  2M45 A;  2IGN A;  2NOG A;  4JOM A;  2HZT A;  1ON1 A;  3DF8 A;  2MD0 A;  1Y8R B;  2OD5 A;  1P9Q C;  2VOO A;  3GME A;  3J81 Z;  1W5T A;  4BHC A;  2R0Q C;  2QUF A;  5B3S H;  1SD7 A;  2OV7 A;  4AIH A;  2DOD A;  3PUF A;  3I55 I;  2NVU B;  1KYZ A;  5FKN A;  2PJP A;  4G6D A;  3AFH A;  1N25 A;  3G73 A;  1X1A A;  1Y6I A;  5IY5 H;  1NK3 P;  3R0J A;  2LC2 A;  2GIZ A;  3DEW A;  3ABM H;  1YJ9 I;  2P8T A;  1ZGA A;  2X1E A;  3R0A A;  1MSF C;  2LLK A;  2BY2 A;  2M0C A;  1P4A A;  2JA7 J;  3CP8 A;  2PEX A;  5FKO A;  1B1B A;  2IRF G;  3K4B A;  3I0T A;  2MW8 A;  2EFP A;  2OCC H;  5TRD A;  1HA8 A;  2GBY A;  1XMX A;  5EG0 A;  4YIR X;  3QYB A;  2WAF A;  3LFK A;  4M71 A;  3AG1 H;  4P1W A;  3TDZ C;  3K4L A;  1ZGW A;  3HOZ J;  4F55 A;  4A3G J;  3T8T A;  4NHJ A;  2FQ3 A;  3WTW C;  1Y1W J;  2M3A A;  1B8I B;  1I5Z A;  2HOE A;  2G0E A;  4EJW A;  2IT0 A;  3QPS A;  3OYH A;  3CUQ B;  3K4M A;  3R6S A;  5EEA A;  4IHW A;  4CYD A;  2Y2Z A;  3GUD A;  2MSY A;  1N75 A;  5JLX A;  2O5R A;  4NBQ A;  2BBY A;  4CO8 A;  3KEY A;  3ULQ B;  2PJR A;  2LKP A;  1KU2 A;  1FYL A;  2F5V A;  4QLC U;  1KU7 A;  2PX9 A;  2EA4 A;  2GXB A;  4I09 A;  2XB0 X;  4AIJ A;  4A3F J;  1DPR A;  5CVJ A;  1T0F C;  4C2U A;  3IWZ A;  5E3N A;  3BR2 A;  1FC3 A;  5C3E J;  4KA4 A;  3JTH A;  1R4N B;  2IPQ X;  3OL3 A;  2ID3 A;  1QVT A;  3SEQ A;  4DYC A;  2I10 A;  2LFB A;  2NS8 A;  5ILU A;  3GW2 A;  2HR3 A;  2W25 A;  2IAI A;  3ZOB A;  4LD5 A;  4DW6 A;  2ZC2 A;  3R61 A;  4HNT A;  2VE8 A;  1FPQ A;  1I27 A;  3D5L A;  1AWC A;  3C7J A;  5CVR A;  4IKF A;  1HDD C;  1LEA A;  4LMY A;  2V7F A;  5M5Y J;  1P6R A;  3FK7 A;  4LOC A;  3CTA A;  3ZQI A;  1XMA A;  2EIL H;  3DP7 A;  2DAO A;  1FMV A;  1FYM A;  3C3W A;  1T0F A;  4UY8 I;  2X1D A;  2GA1 A;  1R4M B;  3ABT A;  3NWT A;  1NH3 A;  4KIS A;  2E34 A;  1IRZ A;  1ZH5 A;  1JUM A;  2R7S A;  4QWQ A;  1UG2 A;  1OKR A;  3RZD J;  2XAJ A;  4A3E J;  1U78 A;  2FBI A;  3W3C A;  3Q9V A;  3RJP A;  3CJT B;  2LF7 A;  3CCM I;  2X9D A;  3QRF F;  4EJU A;  2P5V A;  2ZFU A;  2YX7 A;  4UUV A;  2R7F A;  3IH4 A;  3H9G A;  3K1N A;  4E70 A;  4GXO A;  3HHG A;  2HDD A;  3OS0 A;  2XDV A;  1B9N A;  2E2H J;  2VBY A;  3JRI A;  2ID6 A;  3HRM A;  3O2P E;  1WVR A;  2FML A;  5L3B A;  4YIF A;  5F6F A;  2W00 A;  4A6D A;  3N97 A;  1OYY A;  1W0U A;  1SMT A;  4UV9 A;  2P0W A;  4OWR B;  1ENH A;  3OWT A;  4RB2 C;  2A5W A;  2XAQ A;  4J19 A;  5GTI C;  1PUF B;  2MLG A;  2ZJR F;  4EQQ A;  2WY8 Q;  1X3Z B;  3GYH X;  1AA7 A;  1UFM A;  3PJR A;  2J5O A;  1ZAO A;  3I59 A;  3SDG A;  5C4J J;  2L02 A;  4RLF A;  2XF7 A;  4Z2Y A;  1W36 C;  1UEL B;  1E3O C;  4BE2 A;  2A5Y B;  3F6O A;  4UVB A;  4HLY A;  1IUY A;  2DQL A;  1VQ6 I;  1W0T A;  1NTC A;  1EV7 A;  4IO9 F;  4A69 C;  3OIP A;  1W36 D;  2COB A;  2E1C A;  2CW0 F;  3MKW B;  4RAF A;  1VFC A;  4IHX A;  4ZJZ A;  3S2D J;  2M9H A;  1IO2 A;  3H9Q A;  3J7A O;  1OIS A;  3M1E A;  3FXK A;  1ZLK A;  3IP4 B;  2EFQ A;  2DBB A;  1J9I A;  3ZQQ A;  4CCN A;  2DO7 A;  1NK2 P;  2F4M B;  4AYB A;  4L9N A;  4NQW B;  4RLQ A;  4CYC A;  3KEO A;  4U7D A;  3PFI A;  3MZH A;  2HU9 A;  4N4O B;  2VON A;  3SXY A;  3QP6 A;  3FZV A;  3LSH A;  2LP0 A;  4GDF A;  2FE3 A;  5K5O A;  2K5C A;  5L3C A;  3ZMS A;  4II3 A;  2A6T A;  2AXT C;  2EA2 A;  3V7S A;  3H0D A;  2V1X A;  5HDK A;  3SYT A;  4CCL A;  1BJA A;  3WTU C;  2WA0 A;  4UHT A;  1H88 C;  5DDG A;  1RET A;  3E6C C;  4XOT A;  3WTT C;  3RQI A;  5EG0 B;  3K69 A;  3ZP5 A;  1RRJ A;  4BJ5 C;  2E2I J;  3OR2 C;  2GLO A;  2QYO A;  4N9H A;  3D5S C;  5E79 C;  2O0Y A;  1FIA A;  3FX3 A;  5EDN A;  4A12 A;  1ZGJ A;  1T6S A;  3QYE A;  2O9L A;  2R7D A;  1MMA A;  1G3S A;  3EYY A;  1ETX A;  3OOU A;  5HVQ C;  2MC3 A;  4KIT B;  1DPU A;  4II2 A;  2HTJ A;  3DPU A;  3LAJ A;  2L7M P;  5FJ8 J;  5FRO A;  3KPH A;  5FKK A;  2VJJ A;  3JTG A;  1E3P A;  2E1M C;  2I8D A;  4P96 A;  2EK5 A;  3CDI A;  4CH7 A;  2HNH A;  3ZQ7 A;  3HSR A;  4LLL A;  2QM3 A;  4WXC A;  4HV6 A;  4RGR A;  5JHF A;  2NVT J;  2MFZ A;  2Y0S N;  3F6V A;  2BEO A;  2VPR A;  1MH4 A;  1N77 A;  4A3M J;  5DYM A;  1YOV B;  1JGG A;  1H9T A;  4CSW A;  2L7F P;  1T33 A;  3HM5 A;  4R8H A;  2TDX A;  1QO0 D;  3SJM A;  2KFD A;  2M2E A;  2A68 F;  1D8K A;  2MG4 A;  2DK8 A;  2RNJ A;  4LIU A;  2RAE A;  2P6T A;  4M6Y A;  3OYF A;  4HRI A;  5KNL A;  3GBG A;  3L2Q A;  1I6H J;  2OTL I;  1X3W B;  3RDI A;  2DDB A;  1LUJ B;  2DOF A;  2STT A;  3BLY A;  4M9S A;  1XSD A;  2QQ8 A;  2IS2 A;  3A03 A;  4RAG A;  1YW8 A;  3ZQL A;  4B1R A;  1R7J A;  3I56 I;  1TWH J;  2HYG D;  3CMM A;  3SZG A;  4XLE A;  4DNC A;  2KHM A;  2AO9 A;  2O61 A;  2P5L C;  1Y8Q B;  4BE1 A;  2F5C A;  5HDG A;  4D5F A;  2Y0S A;  3VPR A;  2F6C A;  3S16 J;  1HKT A;  3OS2 A;  4KNY A;  1A04 A;  5H2F C;  3JRF A;  1WRJ A;  2FU4 A;  3GLX A;  3KYD B;  5FFX A;  2K7L A;  2N8G A;  1U8B A;  1MJ9 A;  1IRG A;  3J80 K;  1IN7 A;  3ASN H;  4YRV A;  3E1S A;  4Z6Y A;  1XDS A;  1S29 A;  1KA8 A;  4IL6 C;  1SD4 A;  1JUP A;  1W7P A;  4N4N B;  2PBI A;  4S0H B;  3MN2 A;  4M3F A;  2K3F A;  5EGO A;  1D8J A;  2LDU A;  1TWF J;  2KRH A;  1A5J A;  3DU6 A;  1K78 B;  3E6B A;  2DQR A;  3PM1 A;  1B9M A;  1SAU A;  3BWG A;  3D0S A;  5CVU A;  2HTS A;  3G4S I;  2IGM A;  4PJN A;  1BR2 A;  5D4S A;  2MAB A;  3GTO J;  2GOX B;  2AQF A;  4IOC F;  4EM2 A;  1XCB A;  2FEZ A;  3NWS A;  1YE9 A;  1YHQ I;  1JTY A;  3BTI A;  5D5V B;  4PFO A;  4BKX A;  3KE2 A;  1ZTR A;  1DUX C;  4IRI A;  2LK2 A;  2ZME C;  1XCV A;  2Q0O A;  4A0Z A;  1AOY A;  4BJT A;  4TV7 A;  1G59 A;  5BNG A;  5LGT A;  4O3M A;  1BR4 A;  2WB1 A;  5LD2 C;  4ZYE A;  2QKL B;  3GFL A;  4LB5 A;  2BXY A;  2R7X A;  1ETQ A;  4XKB A;  3HOV J;  4AID A;  2FBH A;  3CJR B;  5K7F A;  3DLL F;  1SFE A;  2EPF A;  3H5N A;  5IT3 A;  2F4I A;  2LKS A;  3H35 A;  1YX5 A;  3LQQ A;  4L9J A;  1TT5 B;  4V2F A;  1YIO A;  2FUG 2;  3F22 A;  5LHH A;  4IOA F;  3K1M A;  3O8G A;  1FY7 A;  1Z6R A;  4YII A;  4F92 B;  1BA5 A;  1BOA A;  3ABL H;  3QWL A;  1K7A A;  3IL2 A;  2ME6 A;  5JR3 A;  2ZME A;  4CIC A;  3P9C A;  4BNC A;  4L9T A;  2VKD A;  1A35 A;  1KYW A;  2QCO A;  1HQC A;  4A0Y A;  3LA7 A;  2L7K A;  1RR8 C;  4OIP F;  1MDM A;  3JRH A;  4OAZ A;  4C3I J;  3BZK A;  3BG6 A;  4UUS B;  2R7O A;  3KCC A;  4D9J A;  4D1Q A;  2DA2 A;  4E7Z A;  2Z2S B;  1J09 A;  4JQF A;  4LIT A;  2XIG A;  4LIV A;  3VEP A;  2XPW A;  3RKQ A;  3R4K A;  1J0R A;  5IPA A;  1SFU A;  1F36 A;  3PQJ A;  1BIB A;  2VJ5 A;  4MTE A;  2JN6 A;  5FFZ A;  2L9S A;  3HOX J;  1MBK A;  5E3M A;  1J75 A;  1J5Y A;  1Y0N A;  5CLS A;  1QZZ A;  1R1T A;  4DZP A;  3HIF A;  2R7T A;  2L4A A;  2XAU A;  3LSP A;  4E7J A;  3TP3 A;  1UZC A;  3ZN1 A;  1FOK A;  2K86 A;  1VQP I;  2CJJ A;  4RDU A;  5CKT A;  2LD5 A;  4QPQ A;  1MNE A;  2RV8 A;  1SD5 A;  3BPV A;  3DTE A;  4R79 A;  3GTM J;  1ETK A;  4I0B A;  5GPA A;  5K1Y A;  3AL0 C;  1ULY A;  3I53 A;  3J7A Y;  5JI6 A;  2MD5 A;  1TNS A;  1U0J A;  1UMQ A;  1Z05 A;  3FK6 A;  3H1C A;  3ZQG A;  1MNM C;  3ROU A;  2HOS A;  4PK4 A;  3JRC A;  1J7K A;  3FWE A;  4CDG A;  5GAE J;  2DU9 A;  3HXL A;  3K4C A;  3COA C;  2E1M B;  2BZT A;  5E18 F;  3FBN B;  4OIO F;  2A6H F;  1RC9 A;  1O4X A;  4B3X A;  2ZXW H;  1MKM A;  2NS7 A;  3KFW X;  1B8I A;  1JI8 A;  1KU9 A;  2BY0 A;  3WGI A;  2KQR A;  3W6V A;  3S1R J;  3ZQH A;  1AHD P;  2XSD C;  3NRV A;  1QU3 A;  3MQ0 A;  3Q9S A;  4U88 A;  3OYB A;  4KN4 X;  5IOY A;  3KYL A;  5CVI A;  3AKZ A;  1IN5 A;  2XRL A;  5HLT A;  4XRM A;  4HV5 A;  4HX8 A;  1F5T A;  1VQO I;  2JT1 A;  4BHP A;  2AXL A;  2Y30 A;  4XRS G;  2X6O A;  3DLA A;  4XN3 A;  4Y4R A;  3CCE I;  1WZ2 A;  3BG7 A;  1TW2 A;  3WGH A;  3BZ6 A;  3IH2 A;  1U9O A;  3KLO A;  3KEQ A;  1O3S A;  5LHG A;  1TQM A;  3P9K A;  2GA2 A;  3NAR A;  1IDY A;  1W1W E;  2DJN A;  1RIO H;  2ZJP F;  3OYG A;  2HKO A;  3KYC B;  4MFD A;  1FTZ A;  3WU1 B;  3BCA A;  5D6E A;  1WQ2 A;  4MQ9 F;  1UAA A;  2OBP A;  2R3S A;  1N78 A;  2DDA A;  2AQE A;  1RKT A;  1A6Q A;  1OCR H;  4HAM A;  3CCS I;  3LMM A;  2A05 A;  3BR0 A;  1SEU A;  1W5S A;  2DT6 A;  4E7S A;  1BW5 A;  2DA5 A;  3HKZ A;  3MD2 A;  3V42 A;  5HNF A;  2QWW A;  4A3K J;  2JJ7 A;  5E1W A;  3HZJ A;  5DUI A;  5D5U B;  5LLQ A;  2LNB A;  4HPQ A;  5IYB J;  1WJA A;  4ZDP A;  3ZCO A;  1KQ9 A;  2HXO A;  3DEU A;  3FM3 A;  3TP0 A;  5J1Y A;  1QNT A;  2KJB A;  4BHB A;  2JWT A;  2MBF A;  4JX6 A;  4L5J A;  2VIX A;  3DKX A;  2L4M A;  3IV5 A;  2JVG A;  3F0C A;  4BYY A;  1TC3 C;  1HW1 A;  4HOB A;  3F8B A;  4KMF A;  3OSG A;  2RNG A;  4IQJ A;  2D1V A;  1QGP A;  1X4O A;  1XX5 A;  2VAS A;  3IH3 A;  3M8E A;  4N0B A;  3E7L A;  1TNT A;  1ETO A;  3HEF A;  2GXG A;  1K6O A;  2PMH A;  2DJI A;  1JKP C;  2ZCW A;  4PUS A;  2XKO A;  1PUF A;  2VN2 A;  4U0V A;  2O8K A;  4LB6 B;  1YG2 A;  4ESF A;  1FNN A;  3I3L A;  3A02 A;  1MDM B;  2DMP A;  4I2O A;  3I4P A;  1H0M A;  1XN7 A;  1LE8 B;  5F0H A;  2FXA A;  1YIJ I;  3GO5 A;  2HDW A;  2BXZ A;  4U0W A;  3DBH B;  1GXP A;  4HLX A;  4UVC A;  3BJ6 A;  3G2B A;  4XL9 A;  3JW4 A;  3CQZ J;  2HWV A;  2CO5 A;  1X2M A;  3F8F A;  4XN0 A;  3E5X A;  1S7O A;  1TQI A;  4Q4Z F;  3CO6 C;  2XUB A;  2D2W A;  2BGC A;  3SZP A;  1FIP A;  2H27 A;  2DFH A;  4MEY F;  4QIW N;  4IX7 A;  2G7H A;  4XLC A;  4F3Q A;  5IOZ A;  5LGN A;  1GT0 C;  1JHF A;  1FYK A;  5BPD A;  3OMY A;  2RC4 A;  2H8W A;  3QPH A;  1VQL I;  2UV1 A;  3KP3 A;  3VOE A;  4HNU A;  4N9I A;  1HBX G;  2KIQ A;  3JRE A;  5DM7 F;  4NQW A;  1FT9 A;  3OL4 A;  5FLX Z;  5CQE A;  5ICF A;  2RN7 A;  1R1U A;  2H09 A;  4HZF A;  5IP6 A;  4ZZL A;  2HS5 A;  3ZPL A;  1F43 A;  3C2B A;  1KON A;  5J40 A;  3DKY A;  2NVX J;  1OJL A;  3VYT B;  2DMT A;  2MH9 A;  3OYA A;  1HDP A;  4XLN F;  1SFO J;  3CF5 F;  3JRB A;  5JVG F;  1GV2 A;  3ZMD A;  1XC5 A;  2CH0 A;  3OS1 A;  4PJL A;  1LEB A;  2VXZ A;  2BOL A;  2L54 A;  3DQV C;  2JVH A;  3IRQ A;  2WAD A;  1LNW A;  1WJC A;  3CJQ B;  5K7Z A;  2ISY A;  1LVA A;  2FNP A;  4KJZ A;  4PGG A;  3KZZ A;  4WXD A;  1X3U A;  4KIB A;  4RB3 C;  5HOO A;  3X2Q H;  2VUM J;  4NB5 A;  3P9I A;  4UV8 A;  2OA4 A;  3FF5 A;  5H6R A;  1S72 I;  1ZHF A;  1TZL A;  1V3F A;  2QLZ A;  2WTE A;  3FBI B;  4ETS A;  3W2W A;  2PG4 A;  4Y15 A;  5D4R A;  4QTR A;  1IAW A;  1MW7 A;  2JUC A;  3L2R A;  3HOT A;  2K27 A;  1S7E A;  3AL0 B;  3H92 A;  3TQN A;  1WKM A;  3EUH C;  3I64 A;  1XGM A;  4BXX J;  1YTY A;  2K9S A;  3OYC A;  2O7O A;  4ZH4 F;  3FHZ A;  3BRO A;  4EEF G;  4XM3 A;  4MHG A;  1IV8 A;  4B44 A;  1R36 A;  1IUF A;  2HYJ A;  4P5O A;  1IDZ A;  3F3X A;  3PNY A;  2HQ5 A;  3M9A A;  4ENM A;  1TBX A;  3CJN A;  3HGG A;  1IG7 A;  3GEZ A;  3Q0U A;  3FMQ A;  1OCZ H;  5L3G A;  2DA4 A;  2DTZ A;  4LK0 F;  1ITY A;  2H6C A;  4LFU A;  2LMD A;  2EWN A;  1VQ9 I;  5E8G A;  2JSP A;  1G3T A;  3EUH A;  2ISZ A;  3GTP J;  3GFM A;  3MZY A;  3E3V A;  2XF5 A;  4MGR A;  3WU2 C;  4BQQ A;  1K79 A;  3DWL E;  1H89 C;  4IPA A;  2JA2 A;  5HDN A;  2FNA A;  1U2W A;  1ZG3 A;  3WHC A;  4HQM A;  1TQP A;  3CLO A;  1XD7 A;  2EIN H;  2IS4 A;  1E0E A;  2ESN A;  4JK1 X;  4OIQ F;  3OYK A;  1CGP A;  2B0L A;  2CV1 A;  2XV4 S;  5HLG A;  4ZYG A;  3CCJ I;  1YS7 A;  4FT8 A;  4HG2 A;  4D7N A;  1FSH A;  2A07 F;  3K70 C;  1MH3 A;  5B66 C;  1HLV A;  3FXQ A;  2E1O A;  1R58 A;  3V8L A;  3M8J A;  4XKV A;  3LA3 A;  2Y9Y A;  4YEL A;  2QA4 I;  1X1C A;  3BC8 A;  3NAU A;  1X1D A;  4EMS A;  5JVT A;  5K5R A;  5DD8 A;  1KQ8 A;  5K5Q A;  4ZDO A;  5HLI A;  3K70 D;  1MD0 A;  2L0K A;  2V1U A;  2DA6 A;  2WV1 A;  1WJE A;  3JRA A;  2EJR A;  4FE7 A;  2H94 A;  2M4K A;  1IXR C;  1HF0 A;  4GFB A;  2XPU A;  5GAD J;  4MO7 A;  4CZC A;  4G7O F;  4YFK F;  3JSO A;  1KZH A;  1SAX A;  5A2Q K;  2B63 J;  1SD6 A;  1K78 A;  1GXQ A;  1TP4 A;  1R6R A;  3GX4 X;  3RQ4 A;  2M7A A;  3CP2 A;  4AYB N;  1BI0 A;  3J7Y J;  4EJO A;  1ZG5 A;  5IYD J;  3P5J A;  3EYI A;  2K9Q A;  2JRM A;  3DTK A;  3OV8 A;  1Z91 A;  3EQL F;  4O6J A;  3MZ8 A;  2EV6 A;  4EJV A;  2FSW A;  4H4K C;  4Y52 J;  2K9L A;  3I5U A;  5F04 A;  3MVP A;  5D8L B;  4Q48 A;  1MGT A;  1LDD A;  1TWC J;  2LY9 A;  3MAJ A;  4R1H A;  4XLF A;  4MTD A;  1YJN I;  2ACJ A;  1F4K A;  3FKJ A;  4MNU A;  2O8X A;  3BT9 A;  1K4T A;  3ZMV A;  2X4H A;  4F52 A;  2X48 A;  2OQR A;  3FHN A;  1ZRF A;  5BQT A;  5BMZ A;  1S6L A;  1WWX A;  1G2H A;  4DGW B;  4M9Z A;  5LGU A;  1OPC A;  3TMO A;  3ERE D;  2P5K A;  1BOB A;  2CUJ A;  1YW7 A;  4RM2 A;  1KU3 A;  3M3Y J;  5HS7 A;  4HBL A;  2K4B A;  5J1U A;  3I71 A;  3GFJ A;  5FLV A;  1IV6 A;  4BUP A;  3MMY B;  1P4W A;  1PDN C;  2BVL A;  1GDT A;  1B6A A;  5ICC A;  4WF2 A;  1WH7 A;  4DOZ A;  2BW3 A;  3ECH A;  2F5D A;  2RQP A;  2KMU A;  2NRA C;  5J4V A;  4MEX F;  1NG6 A;  2Q8K A;  1HW5 A;  4ANJ A;  5J4Y A;  2I5U A;  3ZN0 A;  4RM3 A;  3PO2 J;  4UUS A;  4JYK A;  3S15 J;  2D5V A;  1Y1V J;  4A3I J;  3FXU A;  1WHU A;  1LKX A;  2GOM A;  2Z9O A;  2DMN A;  3LST A;  2XF6 A;  3KP6 A;  3GTG J;  4IRG A;  2A3S A;  4XIC A;  1Z77 A;  4ZC3 A;  5IP9 J;  1U5T B;  1RUO A;  2HPI A;  2ELK A;  2X6W A;  3K6G A;  1FTT A;  1Z21 A;  1TWA J;  3JR9 A;  5E3O A;  4F93 B;  1FP1 D;  2OC6 A;  4ZZD A;  1M1E B;  5C4X J;  2IJL A;  2HZD A;  2EFN A;  3AG4 H;  1G6N A;  2G7U A;  3UR3 C;  4I7H A;  1TW3 A;  2W24 A;  1EH7 A;  3QP5 A;  3CES A;  1QPI A;  2EB7 A;  5FO5 A;  3GTJ J;  3V8J A;  1E17 A;  3IKV A;  2LRE A;  2M7B A;  3PL8 A;  5DM6 F;  4MLO A;  4D0P A;  2XAG A;  3WOD F;  3WU0 A;  2OPT A;  1IN6 A;  3RCO A;  3JAM Z;  2K85 A;  2P7V B;  3QPT A;  3HUG B;  3OOP A;  4E7L A;  4LGW A;  3HHH A;  4HDU A;  4IJA A;  5FRM A;  3MKL A;  1U3E M;  3I54 A;  4PSW A;  2QF7 A;  1XB4 A;  4OU0 A;  1BIA A;  1CF7 B;  1SC7 A;  2VJI A;  5L3F A;  2ETH A;  2L5Q A;  2XHK A;  2EFO A;  5CQG A;  1RES A;  4DZJ A;  1MJA A;  1QZE A;  3LWF A;  2EZK A;  2KIU A;  2Y75 A;  4MFE A;  3QYF A;  4LLG F;  3DFG A;  3LFU A;  1O3R A;  4RGS A;  5E8I A;  1PP8 F;  1V55 H;  2KJC A;  4PZJ A;  3G71 I;  4F7Z A;  1V5F A;  1G8X A;  3R60 A;  2KIF A;  2CV2 A;  4IHV A;  3BTL A;  3CME I;  5HS9 A;  4RMN A;  5JLW A;  1E3H A;  3CMY A;  3OSF A;  1PUE E;  4BH9 A;  1Z3Y A;  3HBL A;  1ZQ3 P;  1I6X A;  4A3L J;  1WI3 A;  2R7W A;  1HSJ A;  2STW A;  4E6K G;  5D5X B;  1T8I A;  2V4J C;  1EH8 A;  1SVL A;  5IT9 K;  3UKG A;  2M34 A;  2OCE A;  4J01 A;  1DU0 A;  1LDJ A;  3BJO A;  3C2G A;  1FSE A;  3FM5 A;  2VQL A;  1IXS B;  3W6K B;  2WC2 A;  2WB1 N;  5E17 F;  3S8P A;  1YJW I;  3TW6 A;  4G6T B;  4S04 A;  3H3Z A;  4OMY A;  2KPM A;  5EJC A;  1OCT C;  2XKP A;  1U6G A;  2M8G X;  3H9J A;  5EYR A;  3BPX A;  3QOE A;  4BQN A;  5J8F A;  3PSI A;  4OAY A;  3GZ6 A;  1VQ4 I;  4RA2 A;  3RKW A;  4JX4 A;  3DV8 A;  3C1D A;  3RSN A;  3WTS C;  3CCU I;  2COM A;  2XGE A;  2P4W A;  2LKX A;  3FMS A;  3HDD A;  1FLI A;  1ODD A;  2HI3 A;  3K4K A;  3ZXS A;  1Z67 A;  4BJ6 C;  3S3N A;  5FGM A;  2MLK A;  4AC0 A;  3VWB A;  3CCY A;  4XLP F;  5HOD A;  4LG0 B;  3ZGK A;  4M73 A;  3IAM 2;  2FQ4 A;  4DJA A;  4BQA A;  3MWM A;  1PJR A;  4BY7 J;  5KAF C;  3U2R A;  2Z33 A;  4B8X A;  3AG3 H;  2CQK A;  2YPR A;  4CCK A;  4I02 A;  3PIP F;  1AKH B;  1FJL A;  2LR8 A;  5C44 J;  3F8M A;  1XGN A;  3CMA I;  3QQA A;  2NS0 A;  3HOY J;  2VPL A;  2O03 A;  4EGZ A;  2EZI A;  1IN8 A;  5DTD A;  5LRS A;  3GZ5 A;  1BI1 A;  1S9H A;  5AON A;  3RZO J;  3IWF A;  1HOM A;  1GVJ A;  4PCQ A;  5KK1 A;  4WCG A;  2ESH A;  3OYL A;  1UJ8 A;  2BV6 A;  3ZQC A;  4L18 B;  3TO7 A;  3WTV C;  2V9V A;  3KET A;  2K40 A;  2ZSH B;  2DA1 A;  4A3B J;  2KLO A;  3G1M A;  2YUS A;  4PJM A;  4XSX F;  1SVO A;  4AVZ A;  3ESW B;  1D0Z A;  1FBU A;  2K9M A;  1DGW Y;  2BW3 B;  4DQ2 A;  4YFN F;  1FOW A;  2TRT A;  1SAN A;  2HOA A;  2LH9 A;  4NC6 A;  1EJ9 A;  4KDP A;  3GTQ J;  2FBK A;  4LJZ F;  4I6Z A;  1LE8 A;  3GXO A;  2GZW A;  5JFR A;  1YIT I;  1VQ7 I;  4C9Y A;  3LSK A;  4WK8 F;  2R5Y A;  3CC2 I;  3OY9 A;  1OYI A;  1R5G A;  3LSG A;  2L3D A;  2HFH A;  2HOT A;  1D5Y A;  5KVR A;  2QEX I;  4KT6 A;  3T5X A;  2V9P A;  3U1K A;  2BY1 A;  4QSH A;  4LK1 F;  4HW0 A;  2OZU A;  3L2U A;  2PMZ N;  1D1B A;  3EPZ A;  4XON A;  1BW6 A;  1MBH A;  2JMW A;  4BS9 A;  2R7R A;  2YX4 A;  4KIF A;  1ZAR A;  4BDZ A;  2VKE A;  1FZP B;  4XR6 A;  4A3D J;  3U1D A;  1X4P A;  3ELK A;  5FB2 A;  1FMW A;  2QQ9 A;  1VQM I;  2DN0 A;  3H0G J;  1KGS A;  3BCB A;  5CVV A;  2M5W A;  3E6D A;  2E1N A;  2Y0M A;  2YU3 A;  2YS9 A;  3WTZ A;  5E20 A;  2QBY B;  2TCT A;  2E7X A;  1A36 A;  1MMG A;  3A01 B;  4CZZ A;  3C18 A;  5J8C A;  4XKC A;  4EJT A;  3O6B B;  2RKH A;  2WWY A;  1U8R A;  2ZBK A;  4EGY A;  3ZR8 X;  2ELH A;  1WJD A;  2O6G E;  1V5G A;  3CCL I;  3S93 A;  1RZ4 A;  1S3J A;  4MQV A;  2R5Z A;  1HST A;  1WSU A;  2CQX A;  3WHB A;  3OYI A;  4IF4 A;  1IF1 A;  2BYV E;  2V1D A;  3EUK L;  5TGT A;  2IP2 A;  1L0O C;  2ELJ A;  3VYS B;  2CWE A;  2EQR A;  2OQG A;  2PMZ A;  1T95 A;  2F5F A;  3CCV I;  2ZXJ A;  3I4M J;  2ECC A;  4ENK A;  2CW7 A;  1BN5 A;  2UWM A;  2VOP A;  4HA8 A;  5GAG J;  2QGU A;  1WGX A;  3QAH A;  2DCE A;  1ORK A;  2FD5 A;  5BOX A;  2KKO A;  2XRN A;  3FXL A;  1IRX A;  4LG3 A;  1LVK A;  4JBA A;  3JCU C;  4M3B A;  5B5E C;  2L2O A;  1BC8 C;  1JHH A;  5LRR A;  2OUM A;  2CG4 A;  2FX0 A;  2VT2 A;  1D3Y A;  4XLA A;  4A3J J;  1S8N A;  3EUA A;  1XGO A;  1POG A;  1GVD A;  2HYF A;  3HKZ N;  4I01 A;  4B3A A;  5KCM A;  1VF9 A;  5FKM A;  1G3W A;  2CSO A;  2H8R A;  1I50 J;  2ZO4 A;  4M3G A;  3KP5 A;  2E35 A;  3WE3 A;  4YFX F;  1DP7 P;  2JPC A;  1MBG A;  3LQR A;  2XAH A;  5B1A H;  4M6V A;  1OFC X;  2QVO A;  1D0Y A;  5LEJ A;  3GF2 A;  1XDU A;  2UZK A;  4HF0 A;  5F27 A;  4P9F A;  3VSL A;  1O3T A;  4YEJ A;  2E19 A;  4FAS D;  2CU7 A;  2IA0 A;  3LSM A;  3FXJ A;  1FX7 A;  2CQN A;  4PJ0 C;  2B7E A;  2V26 A;  5M5X J;  4Y13 A;  1T2K A;  2VOD A;  2L9N A;  5KAI C;  3HTS B;  3GTK J;  2C6Y A;  4C2T A;  1HKQ A;  3DBL B;  3PIO F;  3GVA A;  2HQN A;  2CYY A;  2IVM A;  4M74 A;  4BGD A;  1T98 A;  4G94 A;  3FXR A;  3HTU A;  3Q0W A;  1R22 A;  1RKW A;  2EFW A;  4AUX A;  2XVC A;  3NEU A;  3LA2 A;  3FIS A;  1QBJ A;  1Y0U A;  1W4M A;  1XPX A;  2R7Q A;  3LSR A;  1DU6 A;  3VDX A;  4CXF A;  4ZTF A;  1WI9 A;  3DXJ F;  2MYS A;  3A2K A;  5CYV A;  1G3Y A;  2VQH A;  3Q0V A;  2E7W A;  2KIM A;  5M3F J;  2CUF A;  1TWG J;  1MMD A;  3A1Y A;  4BBS J;  5J47 A;  1K4S A;  1FBS A;  4NUB A;  5D5W B;  2DOA A;  1JKR C;  5HS8 A;  3BR1 A;  1EKE A;  3PFY A;  1B72 A;  3ABU A;  1IN4 A;  3QPL A;  4XRS A;  4JX5 A;  4H0E A;  2ICW G;  4HX7 A;  2ZXH A;  1BM9 A;  3WE2 A;  3FKI J;  3PO3 J;  3I9V 2;  2IA1 A;  1WH5 A;  4BL0 B;  1K61 A;  2K9N A;  1IRF A;  2R5Y B;  3L09 A;  4V19 K;  1HC8 A;  3W6J B;  1B59 A;  3S3O A;  2F48 A;  4X1E A;  3ONQ A;  3RYR A;  2RQQ A;  5LFA A;  4RBO A;  2CW8 A;  2IBD A;  2DW4 A;  5EZH A;  3QU3 A;  5HNH A;  2MGQ A;  1STZ A;  2VI6 A;  2KRF A;  3RPU D;  1J59 A;  2NXN B;  1QHG A;  2LSO A;  2WAQ N;  2YR2 A;  4UB8 C;  3E97 A;  2ZNY A;  3L1P A;  1XS9 A;  1D1A A;  3VOD A;  2JK3 A;  3L2V A;  3RIR A;  1K6Y A;  2Z99 A;  5L3E A;  1ETW A;  3H5R A;  3WG9 A;  4EM1 A;  3RPU A;  1QZY A;  1VQ8 I;  5CPR B;  3S1M J;  1GUU A;  5EEH A;  4DBR A;  2V6E A;  2M8E A;  1HXD A;  3OYD A;  2JTV A;  3ZMZ A;  2X6Y A;  1U5T C;  2OTJ I;  5BPI A;  2XAF A;  2PLY A;  4ENJ A;  5IT9 Z;  2W48 A;  5J3L A;  1YRN A;  1ZRD A;  2Z16 A;  3CCQ I;  1QA6 A;  5GTH C;  2CUZ A;  4RB0 A;  1MJB A;  2OU2 A;  1APL C;  3F9K A;  3EDP A;  2R5Z B;  3J80 Z;  3DEE A;  1I3A A;  3KZY A;  1TT0 A;  3LL7 A;  4UXN A;  1V54 H;  4BXF A;  4RGU A;  1QHH D;  2FOK A;  4IHY A;  1USS A;  1R5I D;  4U87 A;  4L0Y B;  5FRN A;  2DA3 A;  2DMU A;  3IAS 2;  3IKT A;  3MCZ A;  3BQZ A;  1U5T A;  2CQQ A;  2WAQ A;  2CRG A;  4HNV A;  3K0L A;  3N4M A;  4KUM A;  4I98 B;  2KP6 A;  2W1O A;  3SQN A;  3ZRG A;  5DEQ A;  4UNO A;  4ABZ A;  3IHU A;  1LFB A;  1Z9C A;  1ON2 A;  1WJB A;  1G4D A;  3OIO A;  1S5L C;  4A6E A;  4E4H A;  5IP7 J;  2DPD A;  3ECO A;  1ZKG A;  2X85 A;  2JPB A;  1UST A;  5F0F A;  3DTI A;  3KX2 A;  2P81 A;  4A3C J;  3NQO A;  4FIS A;  3FXM A;  4HEA 2;  4CCM A;  5DUK A;  1H9G A;  5ILV A;  4UUT A;  4U7B A;  1ZYR F;  3F8N A;  2IEK A;  1VQK I;  5ED4 A;  5AIP A;  3HRS A;  3HUG A;  2G9W A;  1ZEL A;  2ME0 A;  2BY3 A;  3G1L A;  2L9V A;  2MH2 A;  3DBR B;  4XNF A;  4GYI A;  1YI2 I;  2WAE A;  1MBJ A;  3BP8 A;  4G7Z F;  1CF7 A;  1XSX A;  1YO5 C;  1ZG1 A;  3GLL A;  4KIG A;  1UHW A;  3AAF A;  2VLA A;  1BC7 C;  2DFE A;  1WJF A;  2NNN A;  3SZT A;  2HEO A;  4XKW A;  3HSF A;  3KP4 A;  3LSJ A;  3HJE A;  4L0Z B;  4DIQ A;  2JA6 J;  3B73 A;  3HGY A;  2FA5 A;  4AVP A;  4S05 A;  4PFP A;  1JE8 A;  4M6X A;  5DD4 A;  3IC7 A;  3GCM A;  4O5V A;  3PUB A;  4M9X A;  1X1P A;  4B09 A;  4WWC A;  2L7Z A;  1VND A;  4XOP A;  2Q2E B;  3TED A;  1JGS A;  2KRC A;  4IHS A;  5EF6 A;  4AM3 A;  5F64 A;  2W82 A;  2ZJQ F;  4FHT A;  2XGX A;  4RB1 A;  2X1C A;  2X6X A;  4I0A A;  2M87 A;  4G7H F;  3E6M A;  5DCM B;  3KLN A;  2DFI A;  4IZZ A;  1GHC A;  2EIK H;  4BEH B;  4Y7N J;  1RNL A;  2KT0 A;  2QSG X;  2E71 A;  3KP7 A;  3TBI A;  2RRE A;  1O3Q A;  1BR1 A;  4RAY A;  3WTX C;  2VJ4 A;  5LHI A;  2IS6 A;  4A93 J;  1X1B A;  2M1B A;  2LF8 A;  3W2V A;  1YLF A;  2EV5 A;  2JRT A;  2VT3 A;  4AD9 A;  2ECB A;  5L3D A;  3F21 A;  1UCR A;  3TL4 X;  4KT5 C;  1ZR4 A;  1GV5 A;  2ZB9 A;  4L5I A;  4C30 A;  2XGD A;  1B72 B;  5DV5 A;  2FRH A;  2E5Z A;  1P92 A;  2XAS A;  3BTC A;  1VTN C;  3TGN A;  1LB2 A;  2DXI A;  2PI0 A;  3G3Z A;  4X0G A;  2IW5 A;  5EEG A;  1A6I A;  3PNV A;  4AU7 A;  3OYJ A;  2QKM B;  1JTX A;  4YG2 F;  1JT0 A;  2EH3 A;  4MIM A;  2E60 A;  3A0H C;  3CDH A;  4LG0 A;  2BE5 F;  3DPL C;  1WPK A;  1LFP A;  4NNJ A;  2IA2 A;  1P7I A;  2EZH A;  2XGC A;  4ENN A;  1VZ0 A;  4FX0 A;  1Y39 A;  1AKH A;  2LG4 A;  5DCF A;  2D45 A;  3OIQ A;  4IQ4 A;  1OQY A;  4G8X A;  1XSV A;  5DS9 A;  3GFI A;  3E0J B;  2DMQ A;  4PSX A;  2AHQ A;  4KN7 X;  1ZRE A;  1EA3 A;  1R71 A;  4C3H J;  1H8A C;  4XSZ F;  3HOW J;  4RAZ A;  3S14 J;  4EVI A;  1BJZ A;  3Q3S A;  1DDN A;  4E7I A;  1TL8 A;  2HKX A;  3TO9 A;  2LBF B;  1YRN B;  3FMR A;  3K2A A;  4OOI A;  4IVN A;  4IRH A;  5F1R A;  2HQA A;  1Z1D A;  4L9V A;  4EAT A;  3U21 A;  1OCO H;  2BHZ A;  1E2X A;  5ILS A;  3BY6 A;  2GQQ A;  1B4A A;  3M07 A;  3M1C A;  1QQI A;  1R23 A;  2DK5 A;  2H6B A;  1ONV A;  2L9R A;  3BQY A;  2ZXI A;  3BTJ A;  5EZG A;  4D7M A;  4U0Y A;  2CMP A;  4E7K A;  5J6X A;  1RR7 A;  5KHD A;  2DA7 A;  2RGV A;  1F9N A;  1QVU A;  4P55 A;  4F91 B;  1MSE C;  1RI7 A;  2M0M A;  4BY1 J;  1CQT A;  2VB6 A;  5H6Q A;  1OCP A;  4LLN A;  2JA8 J;  2E2J J;  3BR3 A;  3B6C A;  3BR5 A;  3DKW A;  3RI4 A;  5M5W J;  1C0W A;  2GM4 A;  4ZYA A;  1MMS A;  1JT6 A;  4XOR A;  4HSR A;  3OYE A;  2NOJ B;  2V1N A;  2VXD A;  2A69 F;  2E36 A;  3T0Y A;  1UHS A;  3GZN B;  5TJJ A;  2P6S A;  3F23 A;  2QBY A;  2EIJ H;  2K3P A;  2KIS A;  3A01 A;  4FX4 A;  1YS6 A;  3HC7 A;  3BZC A;  2YSR A;  1R9T J;  4C3J J;  1U9N A;  1P2F A;  3J7Z I;  4BU2 A;  4L5E A;  4XQF A;  3H3U A;  3VYR B;  4UB6 C;  4HQE A;  3W2A A;  2PJR B;  2QEN A;  1LFU P;  2PQ8 A;  3K4N A;  2M4G A;  1ETY A;  3HL2 A;  1MBF A;  4XBF A;  5M3M J;  1WJ5 A;  1DP3 A;  4XID A;  4HDV A;  2KDO A;  2VKV A;  1OR7 C;  3CZ6 A;  3RTR A;  3BDD A;  1SFK A;  4CUG A;  1MBE A;  3PNT A;  1O7L A;  3DCF A;  3A0B C;  3U9G A;  4CGZ A;  2VE9 A;  2Y9Z A;  2J5P A;  2OZ6 A;  4GGG A;  4V2G A;  5D6F A;  3A4C A;  3CC4 I;  4I99 C;  1D0X A;  2A61 A;  2FF4 A;  1BI2 A;  2CFO A;  2HQR A;  2EIM H;  4RS8 A;  5E1Z B;  1VQ5 I;  1F1Z A;  1JXS A;  2GIV A;  5F1J A;  5HLH A;  1OR7 A;  4D5C A;  4FCY A;  3ZMU A;  2DYS H;  4DYQ A;  3MFK A;  2QSH X;  4ZTJ A;  1TLH B;  4OMZ A;  3RKX A;  3WGG A;  2HDC A;  3O3K A;  5TIS C;  3V4G A;  1LQ1 A;  3QOP A;  1EF4 A;  1FOX A;  1Z3X A;  1XMK A;  2WV0 A;  2Y31 A;  2LOO A;  5B1B H;  3VSK A;  5K7H A;  1J2X A;  2HXI A;  3K4J A;  1X2N A;  3V7C A;  3ASO H;  2JZY A;  3HOU J;  2OAZ A;  5ICE A;  3J81 K;  5FLX K;  3SEZ A;  1V5E A;  4Y3O A;  3L7W A;  2OF7 A;  4Y17 A;  4AWX B;  2RVC A;  4XMY A;  2LYC A;  1FBQ A;  2OJE D;  1XG1 A;  2D1H A;  3DPT A;  4DYR A;  1W7P D;  3LAP A;  4G9Y A;  1SFX A;  3BR6 A;  3HYI A;  3OR1 C;  1ERD A;  1MND A;  3IRR A;  1QRY A;  1HW2 A;  1OMI A;  5FD5 A;  2H1K A;  2XPV A;  1T39 A;  2E5N A;  1R00 A;  1REP C;  2DPU A;  2DI3 A;  3FIW A;  3S17 J;  2WBM A;  4A5M A;  1FEX A;  5FKL A;  2KZG A;  1K83 J;  1V4R A;  2VBX A;  4XLH A;  4XK4 A;  4CCO A;  5H20 A;  2R93 J;  1YQA A;  2EV0 A;  2X51 A;  3BG3 A;  4M3E A;  2ZSI B;  4BXU A;  4EV0 A;  2PN6 A;  3I59 B;  2Y69 H;  2CV0 A;  3CC7 I;  4ZYD A;  1AU7 A;  1ZLJ A;  2YU9 J;  2HVQ A;  4IXA A;  1S7A A;  2DFF A;  3VB2 A;  1I1G A;  4CA0 A;  4HST A;  4HYE A;  2IXS A;  3S2W A;  3JSP A;  2HVS A;  1ETV A;  2ZFW A;  2A6E F;  2CGP A;  2VQC A;  5JHU A;  3B6A A;  2ADU A;  2VQG A;  1HKS A;  3SHF A;  5GP9 A;  1DGR M;  1R1V A;  2NNY A;  2F2E A;  3ERM A;  4WX9 A;  1PYV A;  1SVM A;  4BE0 A;  2XRO A;  1T56 A;  4PDK A;  2K4J A;  2CUE A;  4XRF A;  3S1Q J;  4M3D A;  2Z1D A;  2QSF X;  3ISP A;  2ZKZ A;  1WCM J;  1X58 A;  4GO1 A;  2JUG A;  4CYC B;  2XC7 A;  1T38 A;  3F72 A;  3G1O A;  3S1N J;  4X6A J;  2HVR A;  1OLT A;  1NHA A;  2PFB A;  2VC1 A;  2W57 A;  4BQO A;  2IGO A;  3SFZ A;  1RUN A;  3CCR I;  3PSF A;  2NAZ A;  3CDL A;  4A5N A;  2HPM A;  1X19 A;  3ZQF A;  2W4S A;  4W97 A;  1ZK8 A;  3L2C A;  4BAY A;  4ZYH A;  1DQU A;  5LEK A;  2VBW A;  3B02 A;  4OIR F;  2O3F A;  3UNG C;  4IEJ A;  2NVY J;  1MIJ A;  1YX3 A;  2KDZ A;  1P4X A;  1GLN A;  3K2Z A;  3H36 A;  1JJ6 C;  3F8C A;  4IHT A;  1UHM A;  2DYR H;  2PMU A;  4E7H A;  2DTR A;  3ZMT A;  4CCJ A;  4RGX A;  1D5V A;  1YYV A;  3K1P A;  5CJ9 A;  2LY2 A;  3VYU B;  3FXO A;  2X0L A;  1Y56 A;  1MMN A;  1JUS A;  4FE4 A;  1ZRC A;  3HPH A;  3HRU A;  3IUO A;  3E5Q A;  3L9F A;  2DT5 A;  1Z7U A;  3M7G A;  1OCC H;  3H5A A;  1LJ9 A;  1TTY A;  3RKY A;  3SFI A;  4A2U A;  2VC0 A;  3TOB A;  3V8K A;  1NG7 A;  3PQK A;  4HX4 A;  3C2H A;  5A2Q Z;  2VL8 A;  1YFH A;  1PVE A;  4Q5S F;  4HF2 A;  3K7A J;  4BDY A;  5E1X A;  9ANT A;  1Q1H A;  4NC8 A;  2XB5 A;  4KIC A;  5AIQ A;  3CLQ A;  2HGC A;  2ZJ2 A;  2DT7 B;  4GRI A;  4BAC A;  4B43 A;  4C2M J;  2JQ7 A;  3K10 A;  3HPG A;  3TOA A;  5GAH J;  5LBQ A;  3CUQ C;  4DBQ A;  3JRG A;  3JRD A;  3H3V K;  2IS1 A;  2F5E A;  3SDB A;  1JJ8 C;  2Q1Z B;  3E5U A;  3MEX A;  1XTA A;  3CD6 I;  2V79 A;  1FWZ A;  3KIO A;  1HCR A;  4ON0 A;  2DOE A;  2V9K A;  3OYM A;  4KFC A;  2Z5U A;  4PGH A;  3BOQ A;  3GTL J;  6PAX A;  5D8K B;  1R5H A;  2R92 J;  3EET A;  2Y48 A;  1JKO C;  3DU5 A;  4B4C A;  1LDK B;  3BG5 A;  4GCV A;  2CFX A;  2QZ8 A;  1I1S A;  3M4O J;  1O7F A;  3CUQ A;  2DLL A;  5IYC J;  1IC8 A;  2R7Z J;  4QPO A;  3GWZ A;  3K9T A;  1SMY F;  4HF1 A;  3QOD A;  1A31 A;  2CQ7 A;  4KYW A;  4P9U A;  2VKH A;  1L3L A;  3S2H J;  3BJA A;  1IGN A;  4G6Q A;  3HB9 A;  2F4O B;  4ESJ A;  2UUZ A;  1I3Q J;  4ASN A;  4BBR J;  3G6E I;  3O8H A;  2GWR A;  5ICG A;  4M72 A;  3REO A;  2QQA A;  2IGK A;  3KP2 A;  4OIN F;  2GXA A;  3D1N I;  2WY7 Q;  3V7R A;  1I39 A;  3M8F A;  2CS3 A;  3HG9 A;  5FLM J;  1W7P B;  5EGO B;  2Q2E A;  2LY1 A;  1Z7L A;  3T8R A;  2JA5 J;  1BI3 A;  1O57 A;  1PP7 U;  4KMU X;  2MC4 A;  2BHY A;  1BL0 A;  4GYG A;  3WTY C;  4J00 A;  1UB9 A;  4WXH A;  5DCM A;  5F08 A;  4Y33 A;  4ZDL A;  2W84 A;  2R7V A;  2NVQ J;  3S3M A;  1FOY A;  2FMY A;  2FOW A;  1YW9 A;  4BEH A;  3TKY A;  1W5C C;  3MKY B;  2BVM A;  1D1C A;  5J1R A;  2MA3 A;  3QU6 A;  2B9S A;  2JSC A;  3N05 A;  1IJW C;  4UVA A;  5FD6 A;  3WG7 H;  3Q5F A;  3LSI A;  1WFX A;  2EZL A;  3OYN A;  5F0C A;  3KZI C;  3S32 A;  2LTP A;  2ZNZ A;  1UG0 A;  3HOS A;  2UXX A;  3JAM K;  2FJ1 A;  3VFZ A; 
#chains in the Genus database with same CATH homology
 3P7N A;  1QPM A;  2M30 A;  1BBY A;  3CO7 C;  5BS6 A;  1XGS A;  3L00 A;  1FP2 A;  1IXC A;  3I58 A;  1OYW A;  2AS5 F;  3T1B A;  2V6C A;  4EM0 B;  2ZME B;  1Z6T A;  4A0X A;  3ML6 A;  2UXN A;  2W85 A;  3HSE A;  4ESB A;  3TDU C;  2P7C B;  2QQB A;  1IW7 F;  2VBZ A;  2Z3Y A;  1IZ1 A;  3RPQ A;  2L01 A;  4CHU A;  5ERI A;  3TO6 A;  2RDP A;  4Q47 A;  1EH6 A;  1MZB A;  1ZN2 A;  2GAU A;  2K02 A;  4K2E A;  3HRT A;  2NYX A;  4AIK A;  3RYP A;  1KQ0 A;  3CUO A;  2M45 A;  2HZT A;  1ON1 A;  3DF8 A;  2OD5 A;  2VOO A;  3J81 Z;  1W5T A;  4BHC A;  2QUF A;  1SD7 A;  4AIH A;  2PJP A;  1KYZ A;  4G6D A;  3G73 A;  3R0J A;  2P8T A;  1ZGA A;  3R0A A;  1P4A A;  2PEX A;  1B1B A;  2IRF G;  3I0T A;  2EFP A;  5TRD A;  3LFK A;  4M71 A;  3TDZ C;  3T8T A;  4NHJ A;  2FQ3 A;  3WTW C;  1I5Z A;  2HOE A;  4EJW A;  2IT0 A;  3CUQ B;  3R6S A;  4CYD A;  3GUD A;  4CO8 A;  2BBY A;  3ULQ B;  2LKP A;  1KU2 A;  1FYL A;  4QLC U;  1KU7 A;  2EA4 A;  2GXB A;  4I09 A;  4AIJ A;  1DPR A;  5CVJ A;  3IWZ A;  1FC3 A;  4KA4 A;  3JTH A;  2IPQ X;  5ILU A;  3GW2 A;  2HR3 A;  2W25 A;  4LD5 A;  3R61 A;  2VE8 A;  1FPQ A;  1I27 A;  3D5L A;  1AWC A;  3C7J A;  5CVR A;  1LEA A;  4LMY A;  1P6R A;  3CTA A;  1XMA A;  3DP7 A;  2DAO A;  1FYM A;  3C3W A;  1T0F A;  2GA1 A;  3ABT A;  1ZH5 A;  4QWQ A;  1OKR A;  2XAJ A;  1U78 A;  2FBI A;  3Q9V A;  3RJP A;  2LF7 A;  3QRF F;  4EJU A;  2P5V A;  2YX7 A;  4UUV A;  2R7F A;  3K1N A;  4E70 A;  4GXO A;  3HHG A;  1B9N A;  2VBY A;  3HRM A;  3O2P E;  2FML A;  5L3B A;  4YIF A;  5F6F A;  4A6D A;  3N97 A;  1OYY A;  1SMT A;  4UV9 A;  4RB2 C;  2XAQ A;  2MLG A;  4EQQ A;  3GYH X;  1UFM A;  2J5O A;  1ZAO A;  3I59 A;  2L02 A;  4Z2Y A;  2A5Y B;  3F6O A;  4UVB A;  4HLY A;  1IUY A;  2DQL A;  1EV7 A;  2E1C A;  2CW0 F;  3J7A O;  3M1E A;  1ZLK A;  2EFQ A;  2DBB A;  1J9I A;  2DO7 A;  4L9N A;  4U7D A;  3KEO A;  3PFI A;  3MZH A;  2VON A;  3SXY A;  3QP6 A;  3FZV A;  2FE3 A;  5K5O A;  5L3C A;  3ZMS A;  2EA2 A;  3V7S A;  2V1X A;  5HDK A;  1BJA A;  3WTU C;  4UHT A;  5DDG A;  3E6C C;  3WTT C;  3K69 A;  3ZP5 A;  2QYO A;  4N9H A;  2O0Y A;  3FX3 A;  4A12 A;  1ZGJ A;  1T6S A;  2R7D A;  1G3S A;  3EYY A;  5HVQ C;  2MC3 A;  1DPU A;  2HTJ A;  3LAJ A;  3JTG A;  4P96 A;  2EK5 A;  3ZQ7 A;  3HSR A;  4LLL A;  2QM3 A;  4WXC A;  4HV6 A;  4RGR A;  3F6V A;  2BEO A;  5DYM A;  1H9T A;  4R8H A;  2TDX A;  1QO0 D;  2A68 F;  1D8K A;  2DK8 A;  2RNJ A;  4M6Y A;  2P6T A;  3RDI A;  2STT A;  4M9S A;  1XSD A;  1YW8 A;  1R7J A;  2HYG D;  4DNC A;  2O61 A;  2P5L C;  2F5C A;  5HDG A;  1HKT A;  4KNY A;  1A04 A;  1WRJ A;  2FU4 A;  3GLX A;  5FFX A;  2K7L A;  1MJ9 A;  1IRG A;  3J80 K;  1IN7 A;  1XDS A;  1S29 A;  1KA8 A;  1SD4 A;  1W7P A;  2PBI A;  1D8J A;  2LDU A;  1K78 B;  3E6B A;  2DQR A;  1B9M A;  3BWG A;  3D0S A;  5CVU A;  2HTS A;  5D4S A;  4EM2 A;  1XCB A;  2FEZ A;  5D5V B;  3KE2 A;  1DUX C;  4IRI A;  1XCV A;  2Q0O A;  4A0Z A;  1AOY A;  4TV7 A;  5LGT A;  4O3M A;  4ZYE A;  3GFL A;  4LB5 A;  2FBH A;  1SFE A;  5IT3 A;  3LQQ A;  4L9J A;  1YIO A;  3F22 A;  5LHH A;  3K1M A;  1FY7 A;  1Z6R A;  4YII A;  1BOA A;  1K7A A;  3IL2 A;  5JR3 A;  2ZME A;  4CIC A;  3P9C A;  4BNC A;  4L9T A;  1KYW A;  1HQC A;  4A0Y A;  3LA7 A;  4OIP F;  1MDM A;  3KCC A;  4JQF A;  2XIG A;  3VEP A;  3R4K A;  1J0R A;  1SFU A;  3PQJ A;  1BIB A;  4MTE A;  5FFZ A;  1J75 A;  1J5Y A;  5CLS A;  1QZZ A;  1R1T A;  3HIF A;  2L4A A;  3ZN1 A;  1FOK A;  2K86 A;  2RV8 A;  1SD5 A;  3BPV A;  4R79 A;  4I0B A;  5K1Y A;  1ULY A;  3I53 A;  5JI6 A;  2MD5 A;  1TNS A;  1Z05 A;  3ROU A;  1J7K A;  3FWE A;  4CDG A;  2DU9 A;  3COA C;  5E18 F;  4OIO F;  2A6H F;  3KFW X;  1MKM A;  1KU9 A;  3WGI A;  3NRV A;  3MQ0 A;  3Q9S A;  4U88 A;  4KN4 X;  5CVI A;  1IN5 A;  4HV5 A;  4HX8 A;  1F5T A;  2JT1 A;  4BHP A;  2AXL A;  1TW2 A;  3WGH A;  3BZ6 A;  3KLO A;  3KEQ A;  1O3S A;  5LHG A;  1TQM A;  3P9K A;  2GA2 A;  1RIO H;  2HKO A;  3WU1 B;  5D6E A;  1WQ2 A;  4MQ9 F;  2OBP A;  2R3S A;  4HAM A;  1W5S A;  2QWW A;  5E1W A;  5DUI A;  5D5U B;  5LLQ A;  2LNB A;  1KQ9 A;  3FM3 A;  3DEU A;  1QNT A;  2KJB A;  4BHB A;  2MBF A;  4L5J A;  2L4M A;  4BYY A;  1HW1 A;  4HOB A;  3F8B A;  4KMF A;  2D1V A;  1QGP A;  3M8E A;  4N0B A;  1TNT A;  2GXG A;  1K6O A;  2PMH A;  2ZCW A;  2XKO A;  2VN2 A;  4U0V A;  4LB6 B;  1YG2 A;  4ESF A;  1FNN A;  1MDM B;  4I2O A;  3I4P A;  1H0M A;  1XN7 A;  2FXA A;  3GO5 A;  4U0W A;  1GXP A;  4HLX A;  4UVC A;  3BJ6 A;  3JW4 A;  2HWV A;  2CO5 A;  3F8F A;  3E5X A;  1S7O A;  1TQI A;  3CO6 C;  2XUB A;  2D2W A;  3SZP A;  2BGC A;  2H27 A;  4MEY F;  2G7H A;  5LGN A;  1JHF A;  1FYK A;  5BPD A;  2RC4 A;  3QPH A;  3KP3 A;  3VOE A;  4N9I A;  1HBX G;  5FLX Z;  4NQW A;  1FT9 A;  5ICF A;  2RN7 A;  1R1U A;  2H09 A;  4HZF A;  4ZZL A;  2HS5 A;  3ZPL A;  2MH9 A;  4XLN F;  3ZMD A;  1LEB A;  2VXZ A;  3DQV C;  2L54 A;  3IRQ A;  1LNW A;  2ISY A;  1LVA A;  2FNP A;  4PGG A;  3KZZ A;  4WXD A;  1X3U A;  4KIB A;  4RB3 C;  5HOO A;  4NB5 A;  3P9I A;  4UV8 A;  2OA4 A;  3FF5 A;  5H6R A;  1ZHF A;  1V3F A;  2QLZ A;  2WTE A;  4ETS A;  2PG4 A;  4Y15 A;  5D4R A;  1IAW A;  3HOT A;  2K27 A;  3H92 A;  3TQN A;  1WKM A;  3I64 A;  1XGM A;  1YTY A;  4ZH4 F;  3FHZ A;  3BRO A;  4MHG A;  1R36 A;  4P5O A;  3F3X A;  3M9A A;  4ENM A;  1TBX A;  3CJN A;  3GEZ A;  3FMQ A;  5L3G A;  4LK0 F;  2H6C A;  4LFU A;  2EWN A;  5E8G A;  1G3T A;  3EUH A;  2ISZ A;  3GFM A;  3MZY A;  3E3V A;  4MGR A;  1K79 A;  4IPA A;  5HDN A;  2FNA A;  1U2W A;  1ZG3 A;  4HQM A;  1TQP A;  3CLO A;  1XD7 A;  2ESN A;  4JK1 X;  4OIQ F;  1CGP A;  2B0L A;  2XV4 S;  5HLG A;  4ZYG A;  1YS7 A;  4FT8 A;  1FSH A;  2A07 F;  3FXQ A;  1R58 A;  3V8L A;  3LA3 A;  4EMS A;  5JVT A;  5K5R A;  5DD8 A;  1KQ8 A;  5K5Q A;  5HLI A;  1MD0 A;  2V1U A;  2EJR A;  2H94 A;  1IXR C;  4G7O F;  4YFK F;  3JSO A;  1SAX A;  5A2Q K;  1SD6 A;  1K78 A;  1GXQ A;  3GX4 X;  1BI0 A;  4EJO A;  1ZG5 A;  3EYI A;  3OV8 A;  1Z91 A;  3EQL F;  4O6J A;  2EV6 A;  4EJV A;  2FSW A;  3I5U A;  5D8L B;  4Q48 A;  1MGT A;  1LDD A;  3MAJ A;  4R1H A;  4MTD A;  2ACJ A;  1F4K A;  4MNU A;  2O8X A;  3ZMV A;  2X4H A;  2OQR A;  1ZRF A;  5BQT A;  5BMZ A;  1S6L A;  1WWX A;  5LGU A;  4M9Z A;  1OPC A;  3ERE D;  2P5K A;  1YW7 A;  1KU3 A;  5HS7 A;  4HBL A;  2K4B A;  3I71 A;  3GFJ A;  1P4W A;  1PDN C;  1B6A A;  5ICC A;  4WF2 A;  3ECH A;  2F5D A;  2RQP A;  2NRA C;  4MEX F;  2Q8K A;  1HW5 A;  3ZN0 A;  3FXU A;  2Z9O A;  3LST A;  3KP6 A;  4IRG A;  2A3S A;  1RUO A;  1U5T B;  1FP1 D;  4ZZD A;  2IJL A;  2EFN A;  1G6N A;  2G7U A;  4I7H A;  1TW3 A;  2W24 A;  1EH7 A;  3QP5 A;  2EB7 A;  5FO5 A;  3V8J A;  1E17 A;  3IKV A;  4D0P A;  2XAG A;  3WOD F;  3WU0 A;  1IN6 A;  3JAM Z;  2P7V B;  3QPT A;  3OOP A;  4LGW A;  3HHH A;  4HDU A;  4IJA A;  1U3E M;  3I54 A;  1XB4 A;  4OU0 A;  1BIA A;  1CF7 B;  5L3F A;  2ETH A;  2XHK A;  2EFO A;  1MJA A;  3LWF A;  2KIU A;  2Y75 A;  4LLG F;  3DFG A;  1O3R A;  4RGS A;  5E8I A;  1PP8 F;  2KJC A;  4PZJ A;  4F7Z A;  3R60 A;  2KIF A;  5HS9 A;  1PUE E;  4BH9 A;  1I6X A;  1HSJ A;  2STW A;  5D5X B;  1EH8 A;  5IT9 K;  1LDJ A;  3BJO A;  1FSE A;  3FM5 A;  3W6K B;  1IXS B;  2WC2 A;  5E17 F;  4S04 A;  3H3Z A;  4OMY A;  2XKP A;  1U6G A;  3BPX A;  3GZ6 A;  5J8F A;  3RKW A;  3DV8 A;  3C1D A;  3WTS C;  2COM A;  2P4W A;  1FLI A;  3FMS A;  1ODD A;  5FGM A;  2MLK A;  4XLP F;  4LG0 B;  4M73 A;  4BQA A;  3MWM A;  3U2R A;  2Z33 A;  4B8X A;  2CQK A;  2YPR A;  4I02 A;  3F8M A;  1XGN A;  2NS0 A;  2O03 A;  4EGZ A;  1IN8 A;  5LRS A;  3GZ5 A;  1BI1 A;  5AON A;  3IWF A;  1GVJ A;  4PCQ A;  5KK1 A;  4WCG A;  2ESH A;  2BV6 A;  4L18 B;  3TO7 A;  3WTV C;  2V9V A;  3KET A;  4XSX F;  1FBU A;  4DQ2 A;  4YFN F;  4KDP A;  2FBK A;  4LJZ F;  3GXO A;  2GZW A;  5JFR A;  4WK8 F;  1OYI A;  1R5G A;  2L3D A;  2HFH A;  5KVR A;  3T5X A;  4LK1 F;  4HW0 A;  2OZU A;  2YX4 A;  4KIF A;  1ZAR A;  1FZP B;  3U1D A;  3ELK A;  5FB2 A;  2QQ9 A;  1KGS A;  5CVV A;  2M5W A;  3E6D A;  2E1N A;  2Y0M A;  2YU3 A;  3WTZ A;  5E20 A;  2QBY B;  2E7X A;  4CZZ A;  3C18 A;  5J8C A;  4EJT A;  3O6B B;  2WWY A;  2RKH A;  1U8R A;  2ZBK A;  4EGY A;  2ELH A;  2O6G E;  1RZ4 A;  1S3J A;  4MQV A;  1HST A;  1WSU A;  4IF4 A;  1IF1 A;  2BYV E;  2V1D A;  2IP2 A;  1L0O C;  2CWE A;  2OQG A;  2F5F A;  2ZXJ A;  4ENK A;  2UWM A;  1BN5 A;  2VOP A;  4HA8 A;  3QAH A;  5BOX A;  2KKO A;  2XRN A;  4JBA A;  1BC8 C;  1JHH A;  5LRR A;  2CG4 A;  2VT2 A;  1D3Y A;  1S8N A;  1XGO A;  2HYF A;  4I01 A;  1G3W A;  2CSO A;  2ZO4 A;  3KP5 A;  3WE3 A;  4YFX F;  1DP7 P;  2JPC A;  3LQR A;  2XAH A;  2QVO A;  5LEJ A;  3GF2 A;  1XDU A;  2UZK A;  4HF0 A;  4P9F A;  1O3T A;  2IA0 A;  1FX7 A;  4Y13 A;  1T2K A;  2VOD A;  3HTS B;  2C6Y A;  1HKQ A;  3GVA A;  2HQN A;  2CYY A;  2IVM A;  4M74 A;  1T98 A;  4G94 A;  3FXR A;  3HTU A;  1R22 A;  2EFW A;  2XVC A;  3NEU A;  3LA2 A;  1QBJ A;  1Y0U A;  1W4M A;  4CXF A;  1WI9 A;  3DXJ F;  5CYV A;  1G3Y A;  2E7W A;  2KIM A;  1FBS A;  5D5W B;  5HS8 A;  3ABU A;  1IN4 A;  4H0E A;  4HX7 A;  1BM9 A;  3WE2 A;  2IA1 A;  1IRF A;  3L09 A;  3W6J B;  1B59 A;  3RYR A;  2DW4 A;  3QU3 A;  1STZ A;  2KRF A;  1J59 A;  2LSO A;  2YR2 A;  3E97 A;  2ZNY A;  3VOD A;  3RIR A;  2Z99 A;  5L3E A;  3WG9 A;  4EM1 A;  3RPU A;  1QZY A;  5EEH A;  2M8E A;  1HXD A;  2JTV A;  3ZMZ A;  1U5T C;  5BPI A;  2XAF A;  2PLY A;  4ENJ A;  5IT9 Z;  1ZRD A;  4RB0 A;  1MJB A;  2OU2 A;  3EDP A;  3J80 Z;  3KZY A;  4UXN A;  4RGU A;  2FOK A;  1USS A;  4L0Y B;  3IKT A;  3MCZ A;  1U5T A;  3K0L A;  3N4M A;  4KUM A;  4I98 B;  3SQN A;  5DEQ A;  4UNO A;  3IHU A;  1Z9C A;  1ON2 A;  1G4D A;  2DPD A;  4A6E A;  3ECO A;  2JPB A;  1UST A;  3NQO A;  5DUK A;  1H9G A;  5ILV A;  4U7B A;  1ZYR F;  3F8N A;  5ED4 A;  5AIP A;  3HRS A;  3HUG A;  2G9W A;  2MH2 A;  4GYI A;  3BP8 A;  4G7Z F;  1CF7 A;  1XSX A;  1YO5 C;  1ZG1 A;  4KIG A;  1UHW A;  3AAF A;  1BC7 C;  2NNN A;  3SZT A;  2HEO A;  3HSF A;  3KP4 A;  4L0Z B;  3B73 A;  2FA5 A;  4AVP A;  4S05 A;  1JE8 A;  4M6X A;  5DD4 A;  3IC7 A;  4O5V A;  4M9X A;  4B09 A;  4WWC A;  1JGS A;  4IHS A;  5F64 A;  4FHT A;  2XGX A;  4RB1 A;  4I0A A;  2M87 A;  4G7H F;  3E6M A;  5DCM B;  3KLN A;  2DFI A;  1GHC A;  1RNL A;  3KP7 A;  1O3Q A;  4RAY A;  3WTX C;  5LHI A;  2M1B A;  2LF8 A;  1YLF A;  2EV5 A;  2JRT A;  2VT3 A;  4AD9 A;  5L3D A;  3F21 A;  1UCR A;  4KT5 C;  4L5I A;  5DV5 A;  2FRH A;  2XAS A;  1P92 A;  1VTN C;  3TGN A;  1LB2 A;  2PI0 A;  3G3Z A;  2IW5 A;  5EEG A;  4YG2 F;  3CDH A;  4LG0 A;  2BE5 F;  3DPL C;  2IA2 A;  4ENN A;  4FX0 A;  5DCF A;  2D45 A;  4G8X A;  1XSV A;  3GFI A;  4KN7 X;  1ZRE A;  4XSZ F;  4RAZ A;  4EVI A;  1DDN A;  2HKX A;  3TO9 A;  3FMR A;  4OOI A;  4IVN A;  4IRH A;  5F1R A;  1Z1D A;  4L9V A;  1E2X A;  5ILS A;  3BY6 A;  2GQQ A;  1B4A A;  1QQI A;  1R23 A;  2DK5 A;  2H6B A;  1ONV A;  4U0Y A;  4Q4Z F;  5J6X A;  2RGV A;  1F9N A;  4P55 A;  1RI7 A;  5H6Q A;  4LLN A;  3DKW A;  3RI4 A;  1C0W A;  2A69 F;  3T0Y A;  5TJJ A;  3F23 A;  2P6S A;  2QBY A;  4FX4 A;  1YS6 A;  2YSR A;  1P2F A;  3H3U A;  4HQE A;  2QEN A;  2PQ8 A;  4XBF A;  4HDV A;  3RTR A;  3BDD A;  1O7L A;  3U9G A;  4CGZ A;  2VE9 A;  2J5P A;  2OZ6 A;  4GGG A;  5D6F A;  2A61 A;  2FF4 A;  1BI2 A;  2HQR A;  4RS8 A;  5E1Z B;  1F1Z A;  1JXS A;  2GIV A;  5HLH A;  1OR7 A;  3ZMU A;  3MFK A;  1TLH B;  4OMZ A;  3RKX A;  3WGG A;  2HDC A;  3O3K A;  3V4G A;  1LQ1 A;  3QOP A;  2WV0 A;  1XMK A;  1J2X A;  3V7C A;  2JZY A;  2OAZ A;  5ICE A;  3J81 K;  5FLX K;  3L7W A;  4Y17 A;  4AWX B;  2RVC A;  1FBQ A;  2D1H A;  3DPT A;  3LAP A;  1W7P D;  4G9Y A;  1SFX A;  3IRR A;  1HW2 A;  1OMI A;  5FD5 A;  1T39 A;  1REP C;  1R00 A;  2DPU A;  2DI3 A;  4A5M A;  1V4R A;  2VBX A;  5H20 A;  1YQA A;  2EV0 A;  4BXU A;  4EV0 A;  2PN6 A;  3I59 B;  4ZYD A;  1ZLJ A;  4IXA A;  1S7A A;  3VB2 A;  1I1G A;  4HYE A;  3S2W A;  3JSP A;  2ZFW A;  2A6E F;  2CGP A;  5JHU A;  2ADU A;  1HKS A;  3SHF A;  1R1V A;  2NNY A;  2F2E A;  4WX9 A;  2XRO A;  4PDK A;  2K4J A;  4XRF A;  3ISP A;  2ZKZ A;  4GO1 A;  1T38 A;  3F72 A;  2W57 A;  1NHA A;  2PFB A;  2VC1 A;  1RUN A;  3SFZ A;  2NAZ A;  4A5N A;  3L2C A;  4BAY A;  4ZYH A;  5LEK A;  2VBW A;  3B02 A;  4OIR F;  2O3F A;  1P4X A;  3K2Z A;  3F8C A;  4IHT A;  1UHM A;  2PMU A;  2DTR A;  3ZMT A;  4RGX A;  1D5V A;  1YYV A;  3K1P A;  5CJ9 A;  2X0L A;  1ZRC A;  3HRU A;  3E5Q A;  3L9F A;  2DT5 A;  1Z7U A;  3M7G A;  1TTY A;  1LJ9 A;  3RKY A;  4A2U A;  2VC0 A;  3TOB A;  3V8K A;  3PQK A;  4HX4 A;  5A2Q Z;  1YFH A;  4Q5S F;  4HF2 A;  5E1X A;  1Q1H A;  4KIC A;  5AIQ A;  2HGC A;  2ZJ2 A;  3TOA A;  5LBQ A;  3CUQ C;  2F5E A;  3E5U A;  3MEX A;  2V79 A;  1FWZ A;  4ON0 A;  4KFC A;  2Z5U A;  4PGH A;  3BOQ A;  6PAX A;  5D8K B;  1R5H A;  3EET A;  2Y48 A;  1LDK B;  4GCV A;  2CFX A;  2QZ8 A;  1I1S A;  1O7F A;  3CUQ A;  2DLL A;  3GWZ A;  3K9T A;  1SMY F;  4HF1 A;  4KYW A;  4P9U A;  1L3L A;  3BJA A;  4G6Q A;  4ESJ A;  4ASN A;  2GWR A;  5ICG A;  4M72 A;  3REO A;  2QQA A;  3KP2 A;  4OIN F;  3V7R A;  3M8F A;  1W7P B;  2Q2E A;  3T8R A;  1BI3 A;  1O57 A;  1PP7 U;  4KMU X;  4GYG A;  3WTY C;  1UB9 A;  4WXH A;  5DCM A;  2W84 A;  2FMY A;  1YW9 A;  3TKY A;  2MA3 A;  3QU6 A;  2JSC A;  4UVA A;  5FD6 A;  3Q5F A;  2ZNZ A;  3HOS A;  2UXX A;  3JAM K;  3HYI A;  3VFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...