5E8GA

Crystal structure of the dna binding domain of human transcription factor fli1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Friend leukemia integration 1 transcription factor
publication title Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e8gA00
1XB4A 1HXDA 1IF1A 4U88A 2UXNA 1W4MA 1K78B 2PBIA 4LD5A 1FYKA 4L9NA 3DPTA 3HUGA 4EQQA 3SXYA 3GLXA 4BHBA 3WTSC 2QVOA 5CVVA 4XLPF 3F8NA 1CF7A 3NEUA 1HW5A 3Q9VA 3F22A 4ENNA 2CYYA 3HIFA 4A12A 1K6OA 3P9IA 4JBAA 4PCQA 3DF8A 3FZVA 4HF0A 3LAJA 5KVRA 1LDJA 4PDKA 5AONA 4KMUX 5D6EA 2E1CA 1J5YA 1L3LA 1MJAA 3QU3A 2K4BA 2K7LA 1IUYA 5L3FA 4O6JA 4S04A 2IP2A 1GXQA 3R61A 1HSJA 1KQ9A 2Y0MA 1GXPA 1XGSA 1I1GA 4KT5C 2BGCA 4P55A 2ISZA 2XHKA 3T8TA 2FOKA 4Z2YA 4M6YA 4UVCA 3G3ZA 3AAFA 3QAHA 4YG2F 3RDIA 4LB6B 2JSCA 4RB3C 1P4WA 1FNNA 1U5TB 4A2UA 3C18A 3KZYA 4FHTA 4ETSA 2FBIA 4UVAA 3TO6A 4G7HF 1QGPA 2HQNA 2O03A 1R1UA 5E8GA 4P9UA 4U0YA 1S8NA 3FMQA 2GQQA 1OR7A 1S7OA 1QNTA 5H6QA 4M74A 4IF4A 4UNOA 4FT8A 1MD0A 3M8FA 3WODF 3KE2A 1JHFA 3NRVA 4OOIA 4AD9A 3JSPA 3C7JA 1BI3A 3LA3A 1TTYA 5J8CA 5D5WB 4NHJA 4I0BA 3ROUA 4WXHA 2MA3A 4M9SA 3BZ6A 4RGSA 3ZMVA 2DAOA 2A68F 1RUNA 5LHIA 2D1VA 5FLXZ 1D5VA 2Z33A 5BMZA 2NRAC 4N9HA 4LFUA 4YIFA 2XAQA 2GXBA 3GFMA 2R7DA 2A07F 2F5FA 2ESNA 4HW0A 2ZFWA 5FO5A 2VONA 1XDUA 3RIRA 3CLOA 5KK1A 1ZYRF 1LEAA 1K7AA 3CO6C 5HDKA 1W5SA 1D3YA 2VN2A 1IN6A 1XCVA 4ON0A 4IVNA 1V3FA 3E6BA 4WX9A 2RC4A 3GFLA 4BH9A 5L3EA 3H92A 3GXOA 3MQ0A 2KIUA 4I01A 1OKRA 2Y48A 2BE5F 4HOBA 3L09A 4EM2A 2V6CA 3L2CA 3ZPLA 5E1XA 1R58A 1WWXA 2W85A 2ETHA 3NQOA 1IZ1A 5A2QZ 1U78A 3J80Z 3LQRA 1ZN2A 1W7PA 1YW8A 4CICA 3HTUA 4RB2C 5TRDA 2P6SA 4I98B 1WRJA 1QBJA 2P7VB 4KN7X 1U2WA 4WCGA 5FFXA 4GYGA 2IT0A 2OBPA 4EJVA 3JTGA 1B4AA 2E7XA 4HX8A 1O3SA 2JZYA 3MEXA 1DUXC 4AIKA 2P8TA 2O0YA 4A5NA 2VE8A 3WG9A 1FZPB 5D6FA 5ICEA 2MH2A 1H0MA 1RUOA 4I7HA 2ZMEB 1H9TA 2VODA 1USTA 5D4SA 1KU3A 4MTEA 4L9JA 3E6DA 5CYVA 4HBLA 5CVRA 4QLCU 4IJAA 1XN7A 3QOPA 2LF8A 2GXGA 1PP7U 4BHPA 2L4MA 4IXAA 4R79A 3LA7A 2PMUA 1WSUA 2LDUA 1YG2A 2VBXA 1YS7A 1AOYA 4L5JA 1P4AA 3T8RA 4HLXA 3W6JB 2VXZA 2J5OA 3VFZA 2W84A 1UCRA 3M9AA 3QPHA 4P96A 4M9XA 3KETA 2ZNZA 1KA8A 3M7GA 4TV7A 2FMYA 1BI1A 2DFIA 1WQ2A 3WGHA 2L02A 2P5KA 3ZP5A 1QZZA 1O57A 3V7CA 1IN5A 1SFXA 4RGUA 3KCCA 2HWVA 2ZO4A 4PZJA 4MEXF 3BWGA 2QLZA 3RPQA 2Z3YA 1JE8A 3HHGA 4JQFA 3HRUA 4G94A 4HLYA 3PFIA 4BHCA 1Z91A 5EEGA 3ELKA 3CO7C 3TQNA 5ICGA 4L18B 2NAZA 1T39A 3SHFA 4EMSA 1FC3A 3GFJA 3O3KA 5DUKA 4CYDA 2EB7A 4AWXB 2HEOA 1P4XA 2CQKA 5DCMA 3DPLC 6PAXA 2L3DA 2DO7A 3H3UA 4CDGA 1MJ9A 3V7RA 2GA1A 2XKOA 3R6SA 5DUIA 2H94A 1TQIA 3KLOA 3BJ6A 4I02A 4XSXF 1H9GA 2ZKZA 4CXFA 5LHGA 3WTYC 1CF7B 2D45A 5HS7A 4KDPA 1XGNA 3QPTA 1OYWA 1USSA 2VBZA 3BJAA 1IRFA 2CWEA 5LBQA 1JHHA 2FU4A 4N9IA 4KNYA 2XUBA 4RAYA 3ECHA 4I2OA 1FSEA 4I09A 4DNCA 3GEZA 1GVJA 3KP6A 1SFUA 1F9NA 2IVMA 2XAGA 3E6MA 1FYLA 1SMTA 2EFPA 3ECOA 1TQMA 3KEQA 5LGTA 1IN7A 4G9YA 3QP6A 2VBYA 3N97A 2XAJA 2K4JA 3F6VA 2V1DA 1ZG5A 2A61A 3KP3A 3T1BA 5DEQA 3ZMUA 2HOEA 1IXRC 1NHAA 2EFQA 5LEJA 3U1DA 2VT3A 1YYVA 2FQ3A 3G73A 4A6EA 3F8CA 4Y15A 1U8RA 2F5CA 4A0ZA 4HDUA 1TW2A 1I1SA 1ZG1A 3VODA 4G6QA 3J80K 1KQ0A 4L9VA 2XGXA 5F1RA 3HOSA 5BS6A 2V1XA 2HYGD 1ZLKA 4ZZLA 5CVUA 2JRTA 2NYXA 2DK5A 3LFKA 4ENMA 2K27A 3HSRA 2EFWA 3CDHA 5D4RA 2LSOA 2FBKA 3ERED 1LNWA 3FF5A 4KICA 2OAZA 3F8MA 1FY7A 1BC8C 5E18F 1JXSA 3F72A 3Q5FA 3KEOA 3P9KA 2ZJ2A 1ZLJA 3GFIA 4IHSA 3RYRA 1R1VA 3I59A 5FD6A 4XRFA 1R5GA 2V79A 3REOA 4ENJA 2DT5A 2HFHA 4ZZDA 2VT2A 3IWZA 2RKHA 1K79A 5HVQC 2IA1A 2DPDA 3OOPA 3V4GA 4GGGA 1L0OC 1O3QA 4M71A 3F21A 1B59A 2A69F 1KYZA 1WKMA 4UHTA 3KP2A 4LK0F 3SZPA 4FX0A 2DQRA 2OQRA 2DLLA 1G4DA 3RKWA 3HSFA 1HKSA 3DEUA 2Z9OA 4IRGA 3M1EA 4OMZA 4WXDA 4LG0B 1MGTA 3FMRA 3WTTC 1FBUA 1E17A 3GW2A 3RJPA 3I5UA 1U6GA 3DV8A 3GWZA 3C1DA 3F6OA 3U2RA 4ENKA 1TNSA 2XKPA 2KKOA 3R0JA 3TGNA 2QBYA 1VTNC 4I0AA 2IRFG 4LLNA 4IRHA 4A0YA 2ZBKA 4MHGA 5JHUA 5DDGA 3QU6A 3WE2A 3VEPA 5E1WA 1W7PB 5CVIA 1ZREA 3R60A 5HDGA 2UZKA 1XDSA 3EQLF 2PQ8A 2ELHA 1LQ1A 4O3MA 1BC7C 4AIHA 3E5XA 3CTAA 5D5XB 3GYHX 1LVAA 1YS6A 4Q48A 5K1YA 3TOBA 1YW9A 1G3YA 1BM9A 3MZHA 1UHMA 1J59A 4ZYGA 2Z5UA 5D8KB 1K78A 1HKTA 1R36A 2DW4A 3RTRA 3I4PA 3GZ6A 4WXCA 1A04A 3IC7A 4MNUA 2RQPA 4HF1A 1FX7A 1TQPA 3MWMA 3CUQC 2P7CB 4HAMA 3HRSA 2L01A 3I0TA 2YSRA 1ZH5A 2XAHA 5DD4A 2PN6A 3C3WA 4JK1X 1ZRFA 4XBFA 2Q8KA 5DCFA 2CSOA 1YO5C 5E1ZB 2W25A 2DQLA 1B9MA 2EA2A 5LGNA 3GUDA 2MD5A 2RVCA 3WTXC 5ILVA 3B02A 1J0RA 4NB5A 2W24A 1R1TA 1PDNC 2P5LC 3K1MA 3JTHA 1FOKA 5E8IA 5FGMA 2DK8A 1BI2A 5FFZA 4KN4X 4EJWA 5IT9K 5ED4A 3SFZA 2M5WA 2EWNA 2MLGA 2RV8A 1FP1D 3BP8A 2AS5F 2F5DA 1O7FA 2DI3A 1W5TA 3W6KB 3IKTA 4IHTA 3ML6A 5FB2A 1FPQA 4RB0A 2M30A 1P92A 1IRGA 3ZQ7A 1U5TA 3HYIA 3D5LA 4AVPA 4MQ9F 1SFEA 3HTSB 2UWMA 1F1ZA 3FWEA 5HS8A 1BOAA 4EGZA 4ESBA 2VOPA 3BPXA 4DQ2A 2ZCWA 3ULQB 4KUMA 2CG4A 3MFKA 4ZYEA 3H3ZA 2QZ8A 4KIGA 4G7OF 4AIJA 4R1HA 1XSDA 3BROA 4Y13A 2FF4A 2QQAA 4OINF 3GF2A 1T2KA 3K2ZA 5K5RA 2XROA 2P6TA 2FMLA 4B8XA 1XGOA 1G3WA 5H20A 1XMAA 3KP7A 5BOXA 2HS5A 4LK1F 1STZA 3R4KA 2BV6A 5JR3A 2RNJA 1PP8F 5AIPA 5HLHA 2D2WA 5ILUA 1X3UA 1S3JA 5BQTA 1KU2A 2WC2A 2ZXJA 5CJ9A 2PI0A 1Z05A 1RIOH 1QPMA 4LLLA 2VE9A 2ADUA 4YFNF 2Q0OA 5TJJA 3V8LA 1FT9A 3OV8A 3J7AO 2FXAA 3FMSA 3CUQA 2NNYA 2ACJA 1YFHA 1QZYA 2RDPA 3E5UA 5JVTA 1T6SA 2R3SA 4P9FA 1FP2A 4WF2A 4U0WA 4M72A 4RAZA 1DDNA 4HQEA 1MJBA 1V4RA 5ERIA 1O3RA 2W57A 4MGRA 1KU7A 5D8LB 4U7BA 2TDXA 3IHUA 4G8XA 3LA2A 5ICFA 1HBXG 4KIFA 4EGYA 1T0FA 2C6YA 3LWFA 4S05A 1CGPA 4CO8A 1J75A 3JW4A 2GIVA 3WU0A 4KFCA 2DPUA 1Z9CA 2LF7A 1S29A 5ILSA 2EFOA 2A5YB 4YFKF 2X0LA 4A5MA 3L00A 2ESHA 1ZRCA 2PFBA 3EYIA 2F5EA 3BDDA 2H6CA 5AIQA 4CGZA 2EV5A 3M8EA 2K02A 4ZYDA 1BN5A 1G3TA 4YFXF 2XV4S 1LDKB 2P4WA 4HZFA 1BIAA 1J9IA 2M45A 2ISYA 2PMHA 1UHWA 3KLNA 1F5TA 1EH6A 4HX4A 1I5ZA 2GA2A 2OD5A 3F8FA 3DXJF 2OU2A 1Z6RA 2G7UA 2M1BA 4HA8A 1C0WA 3HRMA 2GWRA 3DKWA 2B0LA 1FBQA 1JGSA 3TO7A 2OQGA 3SQNA 3FXRA 1IAWA 3I64A 2HYFA 3I53A 4ZH4F 2DU9A 4MTDA 2HKOA 4MQVA 1LJ9A 3EETA 3WTZA 5IT9Z 1SD5A 1TNTA 2J5PA 1YQAA 1O3TA 3DQVC 1FWZA 5L3GA 1DPRA 2VBWA 4FX4A 4ZYHA 3K0LA 1XCBA 3QP5A 2XASA 2FEZA 3GVAA 5BPIA 1Z7UA 3ZMTA 1RI7A 2MLKA 3T5XA 3WGGA 2KRFA 4L0YB 1R22A 1I27A 1SMYF 4HX7A 3FM5A 4EV0A 3IRRA 1ZAOA 4RGXA 4OIOF 3J81K 2GZWA 3CUOA 1D8JA 3S2WA 5E17F 2M87A 4GXOA 4XLNF 5DD8A 1IXCA 4KYWA 2NS0A 4HYEA 2BBYA 3Q9SA 4NQWA 5LHHA 5HS9A 1MKMA 1IN4A 3ZMDA 1G6NA 1BBYA 1KQ8A 4UXNA 3HRTA 5JI6A 3IWFA 2O8XA 2FBHA 2WWYA 1BIBA 1Y0UA 1R23A 3O2PE 4D0PA 4H0EA 4G6DA 3P7NA 2WV0A 3EUHA 3L9FA 3ISPA 1IN8A 2MBFA 3BOQA 3RYPA 5HLIA 1XGMA 2RN7A 3VOEA 2Z99A 2E7WA 4LMYA 1S7AA 4G7ZF 2DBBA 1OPCA 5LRSA 3DP7A 4Q47A 4UV9A 4Q5SF 4MEYF 3E97A 3BPVA 5HLGA 2LKPA 4LJZF 1U5TC 3KP5A 3PQJA 3FM3A 1B9NA 2PEXA 2L4AA 1U3EM 5LEKA 4Y17A 4HV6A 1ZARA 3I58A 1XSVA 2BEOA 1F4KA 3F8BA 1ON1A 1OYYA 2LNBA 2K86A 2YPRA 3F23A 2WTEA 2G7HA 2X4HA 1XSXA 4UV8A 3IRQA 1YTYA 1SD4A 1MDMA 2F2EA 2KIMA 5K5OA 1T38A 1Q1HA 3TKYA 2D1HA 5L3CA 1TW3A 2NNNA 3BY6A 4O5VA 3BJOA 4A0XA 5FD5A 4LLGF 1HQCA 3GZ5A 1ZRDA 5HOOA 5L3BA 2JPCA 1IXSB 3JSOA 2P5VA 1ONVA 4BQAA 1G3SA 5DYMA 5JFRA 1EH8A 4YIIA 4M6XA 2STTA 4PGGA 4HQMA 2AXLA 4KIBA 3HSEA 1FBSA 1HSTA 4EVIA 2EFNA 2QQ9A 1P2FA 3E5QA 2OZUA 4IRIA 5D5VB 3CJNA 1ZHFA 3T0YA 1QQIA 1GHCA 4UVBA 3TOAA 2STWA 4WK8F 1OMIA 3CUQB 4LGWA 3COAC 5D5UB 2A3SA 3WTVC 4L9TA 2GAUA 2FA5A 3VB2A 2RGVA 1WI9A 4UUVA 3JAMZ 1Z6TA 4E70A 1OYIA 5CLSA 2A6EF 3LSTA 1YIOA 3IL2A 4LG0A 3E6CC 4M73A 4QWQA 2KJCA 1UB9A 3ZMSA 4EJUA 2IJLA 1DP7P 2QENA 2KIFA 2PG4A 5ICCA 3D0SA 2CO5A 2HTSA 4EM0B 2OA4A 2IA0A 2HDCA 1KYWA 2JTVA 3FXQA 1ULYA 4BAYA 4CHUA 3MZYA 2IW5A 3FX3A 3J81Z 2DTRA 3EDPA 5DCMB 4KMFA 1FSHA 3MAJA 1HW1A 5EEHA 2CGPA 4IPAA 2M8EA 2QWWA 5L3DA 2IA2A 2CFXA 5H6RA 3O6BB 1BJAA 4KA4A 2UXXA 4EJOA 3FHZA 2YU3A 1I6XA 3KZZA 4BXUA 3DFGA 2FSWA 1LB2A 2XIGA 1S6LA 1W7PD 1RZ4A 2Q2EA 2HTJA 2XRNA 5BPDA 3KP4A 3WGIA 3WU1B 3RI4A 2YX4A 1T98A 4OIQF 2JPBA 3RKXA 4M9ZA 2VC0A 4GYIA 3R0AA 1MZBA 4U7DA 5J6XA 4RB1A 5E20A 4GCVA 5F64A 1D8KA 2EJRA 2KJBA 2V1UA 1XD7A 2BYVE 1DPUA 3WE3A 5CVJA 3IKVA 2YX7A 2R7FA 5K5QA 3ABUA 2FE3A 3KFWX 1TLHB 1ON2A 3SZTA 2G9WA 2ZNYA 4R8HA 1J7KA 3GX4X 2HZTA 3P9CA 3HOTA 2FNPA 5LLQA 1AWCA 3ZN0A 2MH9A 2HQRA 1P6RA 4EM1A 1E2XA 4ESFA 2V9VA 3I54A 3PQKA 2PLYA 2XVCA 4HF2A 4XSZF 1BI0A 3ABTA 2YR2A 4F7ZA 4EJTA 2PJPA 3ZN1A 1SD7A 1RNLA 2VOOA 1TBXA 2VC1A 1B1BA 1KGSA 4PGHA 4N0BA 1LEBA 4RGRA 2H27A 1HW2A 4CZZA 1R00A 3V7SA 3N4MA 3GO5A 4L5IA 1R5HA 3TDUC 1B6AA 2QQBA 3K1PA 4BNCA 1IW7F 4BYYA 3RKYA 2Y75A 3QRFF 2EV0A 1HKQA 5HDNA 2JT1A 4ASNA 3K1NA 4Q4ZF 3LQQA 3I59B 1QO0D 1J2XA 1EV7A 1FLIA 4LB5A 5J8FA 1UFMA 1Z1DA 4P5OA 2EK5A 2EA4A 2ZMEA 3HHHA 1REPC 3I71A 1ODDA 2L54A 2HR3A 5IT3A 3RPUA 4B09A 4HDVA 1O7LA 3WTWC 2E1NA 4OIRF 2OZ6A 2QYOA 1LDDA 5FLXK 3ZMZA 1ZG3A 2HKXA 4GO1A 4OIPF 3LAPA 2FRHA 4K2EA 4L0ZB 3JAMK 2CW0F 3TO9A 3U9GA 1EH7A 3L7WA 4A6DA 2QBYB 1PUEE 1XMKA 2QUFA 5DV5A 2H09A 2XAFA 2FNAA 5F6FA 4OMYA 1ZGAA 3K9TA 2H6BA 3WTUC 2EV6A 1SAXA 4OU0A 2QM3A 3EYYA 4WWCA 3K69A 2O6GE 1MDMB 1KU9A 1R7JA 4ESJA 2MC3A 1FYMA 2A6HF 1ZGJA 3F3XA 3B73A 5LRRA 3TDZC 5A2QK 4U0VA 2IPQX 1SD6A 2O3FA 2COMA 3E3VA 2O61A 4RS8A 1YLFA 3MCZA 3FXUA 2HGCA 4HV5A 3V8KA 1YW7A 5LGUA 3V8JA
chains in the Genus database with same CATH superfamily
1N77A 4XK4A 1XB4A 1HXDA 1IF1A 4U88A 4CYCA 2UXNA 1W4MA 4NC7A 1K78B 2PBIA 2OUMA 4LD5A 1FYKA 4L9NA 4XKBA 5J4YA 2DDBA 2WAFA 3DPTA 3HUGA 2YUSA 4BJ6C 3LL7A 3H0DA 4EQQA 3SXYA 3GLXA 4BHBA 3WTSC 2QVOA 2EBIA 5CVVA 1VQ6I 2VQCA 4XLPF 3F8NA 1CF7A 3ZQIA 3NEUA 1ZK8A 4IKFA 1HW5A 3Q9VA 1R5ID 3TEDA 3F22A 3KYCB 3KPHA 3BTIA 2R4GA 3CCQI 1Y8QB 1VQ4I 4ENNA 2JN6A 3HGGA 4DOZA 3O8GA 2CYYA 3SYTA 4JOMA 3HIFA 5IP9J 4HEA2 4A12A 5LD2C 3PNVA 4RA2A 1K6OA 3P9IA 1JUPA 4PSWA 2X1DA 4JBAA 4PCQA 4XICA 3DF8A 3FZVA 2IEKA 4HF0A 3LAJA 2VPRA 3PIOF 5KVRA 1LDJA 3KIOA 4PDKA 4CCJA 5AONA 4KMUX 1VI0A 1D0ZA 1J5YA 5D6EA 2E1CA 4XKCA 1L3LA 2R7XA 1MJAA 1S7EA 3QU3A 2F4MB 2K4BA 2K9SA 2ZB9A 1B8IA 1AA7A 2K7LA 2VKVA 3OYJA 1IUYA 5L3FA 4O6JA 4S04A 3IV5A 1W1WE 1YJNI 4QIWN 2IP2A 4XLFA 1GXQA 3R61A 1HSJA 3DEEA 1KQ9A 2X6OA 2Y0MA 1X2MA 5GP9A 1GXPA 1EF4A 1XX5A 4IZZA 1VQ7I 1VQPI 2HI3A 1XGSA 3HG9A 4CSWA 1I1GA 4KT5C 4A3MJ 2BGCA 3JREA 4P55A 1QA6A 3A0HC 1QHGA 4HNTA 2ISZA 2XHKA 3OYGA 1N75A 3T8TA 2FOKA 3TMOA 4Z2YA 3RQIA 3K6GA 2R92J 4M6YA 4X1EA 4UVCA 2VLAA 3G3ZA 3AAFA 3QAHA 4YG2F 3RDIA 1X3ZB 4LB6B 2JSCA 4RB3C 1P4WA 1FNNA 1VZ0A 2EZKA 1IDYA 1U5TB 2KZVA 2HXOA 4A2UA 5GAEJ 1FOYA 2O8KA 3LSIA 1QRYA 3OMYA 2X85A 2KP6A 1R4MB 3C18A 3KZYA 4FHTA 4ETSA 2FBIA 4FCYA 1K83J 3BCAA 4UVAA 3TO6A 4G7HF 1QGPA 2HQNA 2O03A 4XR6A 3K70C 1ETWA 1D1CA 3WU2C 1R1UA 5E8GA 4P9UA 1J09A 3E1SA 4U0YA 1S8NA 3ZQFA 4YRVA 2GM4A 1OLTA 2L7ZA 3FMQA 2GQQA 2LFBA 3H9QA 5EG0A 2WADA 3D5RC 1OR7A 1S7OA 4B43A 1QNTA 5H6QA 3JR9A 4M74A 4IF4A 4UNOA 3S1NJ 4E7HA 5GAHJ 1R4NB 2XGEA 3HKZN 4BY7J 1TC3C 1IRZA 1Y1VJ 4FT8A 1MD0A 2BVMA 3M8FA 3WODF 3Q0WA 3KE2A 1JHFA 3NRVA 5LFAA 1F36A 2A5WA 4ZTJA 4XIDA 2OCEA 4OOIA 3QODA 4UUSA 3Q3SA 3GTQJ 2Q2EB 1WH7A 4AD9A 3GLLA 1X1BA 3JSPA 3A1YA 4AM3A 3C7JA 4CCKA 1BI3A 3CZ6A 3LA3A 3ABLH 1VQMI 4F92B 1TTYA 5J8CA 1NK2P 1NG6A 5D5WB 4NHJA 4I0BA 3ROUA 2MABA 1CQTA 4WXHA 2MA3A 3LSGA 4M9SA 2XF7A 2CUZA 4DYCA 1ETYA 2JRMA 5FKMA 3BZ6A 1GV2A 4RGSA 4B44A 2ZSHB 3ZMVA 4AVZA 2DAOA 1ZR4A 3GTOJ 1TWHJ 2A68F 1RUNA 5LHIA 3OYBA 3IH4A 4G6TB 3AG2H 2D1VA 1U0JA 1A36A 2R7SA 2XGDA 5HODA 5FLXZ 1OCPA 1LE8B 1D5VA 1MBGA 4II2A 5JHFA 4PJ0C 2Z33A 5BMZA 2NRAC 2Z16A 2HQ5A 4N9HA 4J19A 2V4JC 2L7KA 4KT6A 2XAQA 4LFUA 4YIFA 2GXBA 3GFMA 1HCRA 2VKEA 4J01A 2R7DA 1EA3A 1RESA 5FLVA 2A07F 3DTEA 2F5FA 3TP3A 2ESNA 3EUKL 1AHDP 4HW0A 2ZFWA 5FO5A 2VONA 1XDUA 3FXOA 3RIRA 3P5JA 3CLOA 5KK1A 4IL6C 1ZYRF 1LEAA 1K7AA 2Y69H 3CO6C 3HZJA 5HDKA 1LFUP 3K10A 1W5SA 1DU6A 1D3YA 2VN2A 2GLOA 4GRIA 1IN6A 1XCVA 4ON0A 2LD5A 2VJIA 1Y0NA 2CJJA 4IVNA 4XRSG 1V3FA 2KRCA 3E6BA 1SC7A 4OAZA 4WX9A 2RC4A 2BVLA 3GFLA 3ZRGA 4BH9A 3JRHA 5L3EA 3H92A 3GXOA 3MQ0A 2KIUA 1RC9A 3H3VK 4I01A 1OKRA 3L1PA 2Y48A 2BE5F 4HOBA 4MO7A 3MD2A 1H88C 3L09A 4CA0A 1GVDA 4EM2A 2V6CA 5GPAA 4UB6C 2DYSH 4BACA 3L2CA 3HDDA 3ZPLA 2JA6J 5E1XA 1R58A 3OOUA 1WWXA 2W85A 2ETHA 3NQOA 1BR1A 1IZ1A 1LUJB 5A2QZ 3J80Z 3AFHA 4B4CA 1U78A 1YX3A 4PSXA 3LQRA 2KDZA 1FMVA 1ZN2A 4ZC3A 2V26A 1W7PA 2ZFUA 1RRJA 1YW8A 3FDYA 3JRBA 4CICA 3S15J 4PFPA 3H0GJ 3HTUA 5F1JA 3G1LA 4RB2C 5TRDA 2P6SA 3OS0A 4I98B 4A3IJ 1WRJA 1QBJA 3GZNB 2P7VB 3RSNA 2R5ZA 1A31A 4KN7X 1U2WA 4WCGA 5FFXA 4GYGA 2IT0A 4H4KC 2OBPA 4EJVA 3JTGA 1B4AA 3CP8A 2E7XA 4I99C 4HX8A 2DFEA 1WGXA 2IGMA 1O3SA 1M1EB 2JZYA 3MEXA 3RQ4A 4A3BJ 4JX4A 1DUXC 1W36D 2K9LA 4AIKA 2P8TA 2O0YA 4A5NA 4EATA 2VE8A 3WG9A 3V42A 1NTCA 1FZPB 3HXLA 3DBHB 5D6FA 5ICEA 2MH2A 1H0MA 2EILH 5EZGA 3B6AA 5KCMA 1Z21A 1RUOA 4I7HA 2ZMEB 1H9TA 2VODA 1USTA 5E3OA 5D4SA 1KU3A 2XB5A 4V19K 2JUCA 4MTEA 1SAUA 4L9JA 3E6DA 4ZDOA 5CYVA 4X6AJ 3K7AJ 4HBLA 5CVRA 4QLCU 3AG3H 3UR3C 3CCYA 2XAUA 4IJAA 1XN7A 2MW8A 3QOPA 1MNMC 2LF8A 1SVMA 2GXGA 2YS9A 1PP7U 4BHPA 3K70D 1Z3XA 2L4MA 4IXAA 4R79A 5EYRA 2LKSA 3LA7A 2V9PA 3BTLA 2PMUA 5IP7J 2XC7A 3ONQA 1XTAA 1WSUA 2LDUA 2NVUB 1JGGA 1YG2A 4XORA 2X6WA 2VBXA 2M4KA 1YS7A 1AOYA 5EEAA 4L5JA 4BQQA 3TW6A 3VYSB 2DFHA 2O7OA 1P4AA 3T8RA 4HLXA 3W6JB 2VXZA 5GADJ 2JQ7A 2J5OA 2W84A 1UCRA 3EPZA 3M9AA 3QPHA 3BR3A 4M3FA 4M9XA 2WAQN 4P96A 5EDNA 3BG7A 3KETA 2ZNZA 1KA8A 3A03A 3M7GA 3HPGA 2NXNB 3CC7I 2BW3B 3OYLA 1XPXA 4OAYA 4TV7A 2K9QA 2FMYA 1BI1A 2DFIA 1WQ2A 3WGHA 2L02A 2P5KA 3JRGA 1POGA 3ZP5A 1IO2A 1QZZA 2VQHA 1O57A 1PVEA 3V7CA 2MC4A 1IN5A 1SFXA 3LMMA 4ANJA 4RGUA 3KCCA 1AU7A 2HWVA 2ZO4A 1APLC 4PZJA 4MEXF 3BWGA 4HSTA 2QLZA 2O9LA 4LIUA 3CMEI 1YRNA 3RPQA 2LMDA 2Z3YA 5CKTA 2EQRA 1JE8A 3HHGA 1ETQA 4JQFA 3HRUA 3UNGC 3FBIB 4G94A 1RETA 2DOAA 2UUZA 2VJJA 3PFIA 5J1UA 4HLYA 3S3OA 3M07A 2L9NA 4BHCA 1Z91A 5EEGA 3ELKA 4C3HJ 3CO7C 3TQNA 5ICGA 1Z0XA 1T56A 3OYMA 4L18B 2NAZA 1T39A 3SHFA 4EMSA 1RKWA 4M3BA 2DOFA 1FC3A 3GFJA 2MSYA 1MW7A 2OV7A 3O3KA 5DUKA 1R71A 4CYDA 2EB7A 4AWXB 1E3OC 3HB9A 4XLHA 1P4XA 2HEOA 3RKQA 4KISA 2B63J 3HOUJ 2CQKA 3X2QH 3CD6I 4DIQA 5FJ8J 5DCMA 3DPLC 4NQWB 6PAXA 2L3DA 4XLEA 1ETVA 2DO7A 2R7TA 3H3UA 1WFXA 2A6TA 4CDGA 3CCRI 1MJ9A 3DWLE 3CCLI 2K3FA 3V7RA 2GA1A 2IAIA 2XKOA 3R6SA 5DUIA 2H94A 2DA1A 1TQIA 1ZTRA 3K2AA 1WH5A 3KLOA 1ZQ3P 2DODA 3BJ6A 3HUGB 3Q0UA 4I02A 4XSXF 1H9GA 2IS2A 3CDLA 2VIXA 2ZKZA 4CXFA 1BR4A 5LHGA 3WTYC 3QWLA 1CF7B 3DTIA 3JRCA 1UAAA 2D45A 5HS7A 1V5GA 2IS1A 4KDPA 3OYKA 1XGNA 3K4BA 3QPTA 4LOCA 1OYWA 1USSA 3A4CA 2VBZA 3MKZA 3SDBA 4IO9F 4BDYA 2ELKA 3BJAA 3EUAA 5E3NA 2L9RA 2KZGA 1IRFA 2CWEA 3HC7A 1OCZH 2KRHA 5GTIC 1WJAA 2VL8A 4YELA 5LBQA 1JHHA 1QVUA 2M7AA 2FU4A 1VQKI 4N9IA 4KNYA 2DMNA 2XUBA 4RAYA 2KFDA 5IYCJ 3ECHA 1OISA 4I2OA 3OYHA 2Y0SA 1FSEA 4I09A 3PJRA 4IQ4A 4L5EA 1FTTA 3GEZA 4DNCA 1GVJA 3KP6A 4XONA 1MSFC 1SFUA 1F9NA 2R0QC 3HOVJ 3K4LA 2IVMA 5TGTA 1B8IB 2XAGA 1VQ8I 1KZHA 3QYBA 1K4TA 1TZLA 2R5YB 1I50J 3E6MA 4I6ZA 1FYLA 3OYCA 1TWFJ 4IHXA 3W2VA 2M34A 1SMTA 2ZXWH 1JUMA 4QPQA 1W5CC 3S1QJ 4D7MA 2EFPA 2QKMB 3ECOA 3HJEA 4BU2A 1TQMA 3KEQA 1HC8A 5LGTA 4F93B 1IN7A 4G9YA 1H89C 3QP6A 2VBYA 3N97A 4XQFA 2XAJA 2K4JA 3H5RA 3F6VA 1X4OA 3MMYB 2HYJA 4B3AA 2CV2A 2V1DA 1ZG5A 3CCEI 2A61A 3KP3A 3T1BA 3BG6A 3OYNA 4UY8I 5DEQA 3ZMUA 2HOEA 5K7FA 5IOYA 1IXRC 3AG4H 1NHAA 2EFQA 5LEJA 1TT5B 2B7EA 3U1DA 1IUFA 3ASOH 2VT3A 1YYVA 2FQ3A 4W1UA 2CFOA 2E1MB 4BE1A 3VWBA 4A3LJ 3G73A 2LY2A 2ELJA 3BG3A 3F8CA 4A6EA 4Y15A 1U8RA 2F5CA 4A0ZA 3H36A 4HDUA 3HL2A 1TW2A 3CF2A 1OR7C 1I1SA 3J7AY 4PJMA 1ZG1A 4JYKA 1MMNA 3VODA 4G6QA 3PO3J 3J80K 1KQ0A 2JVHA 2XGXA 4L9VA 5F1RA 3HOSA 1BA5A 5BS6A 1VFCA 2DXIA 4Y33A 2V1XA 4S0HB 2N8GA 2HYGD 3PFYA 1ZLKA 3QPLA 3AL0C 4AIDA 2HU9A 4ZZLA 1FTZA 4XN0A 5CVUA 1ZR2A 2JRTA 3CJRB 2BY2A 2NYXA 2DK5A 3LFKA 4ENMA 2MD0A 2K27A 2X1EA 3HSRA 1PJRA 2EFWA 3CDHA 5D4RA 2LSOA 2FBKA 3QYEA 3ERED 1OCTC 1LNWA 3FF5A 4KICA 2OAZA 3F8MA 3OY9A 1FY7A 2ECCA 1MNDA 2OCCH 2IGOA 1DGWY 2ZJRF 1X4PA 3BG9A 1BC8C 5E18F 2PJRA 1JXSA 3BTCA 2VKDA 3F72A 3Q5FA 1B72B 3KEOA 3P9KA 4RLQA 1JJ8C 5C4XJ 2DYRH 2ZJ2A 1ZLJA 2X51A 3GFIA 4IHSA 2L2OA 3RYRA 1R1VA 1S5LC 2LG4A 3I59A 5FD6A 2FX0A 4F91B 4XRFA 1R5GA 2V79A 3REOA 3S2HJ 4ENJA 2DT5A 2HFHA 3QYFA 1W0TA 3L2VA 2CW8A 4ZZDA 2AQFA 3PNYA 2VT2A 3IWZA 1UG0A 1MMGA 3S1RJ 1WI3A 4N4NB 2RKHA 1PYVA 1K79A 3CMAI 5HVQC 2IA1A 2DPDA 1IRXA 3OOPA 3V4GA 3LNQA 4GGGA 1OCOH 3CQZJ 1L0OC 3DCFA 1O3QA 4M71A 4BEHA 5E3MA 3F21A 1B59A 2A69F 1KYZA 4JP0A 4A3GJ 1WKMA 4UHTA 3KP2A 4LK0F 3SZPA 4FX0A 2DMPA 2DQRA 2OQRA 4NBQA 4ITVA 4D1QA 1UJ8A 2DLLA 1G4DA 3RKWA 2OTLI 3BR2A 1XG1A 2VQLA 3HSFA 4GDFA 1K4SA 1HKSA 2MGQA 2DDAA 1BR2A 3DEUA 2Z9OA 5IOZA 4IRGA 1V55H 3M1EA 4OMZA 1WJEA 4WXDA 4LG0B 1MGTA 1FOXA 2M0CA 3FMRA 3WTTC 3B6CA 3PUBA 1FBUA 1E17A 3GW2A 2Y2ZA 1DGRM 3C2BA 3RJPA 3DV8A 1U6GA 3GWZA 3I5UA 3LSMA 1Z77A 3C1DA 1W36C 3F6OA 3FK6A 3U2RA 2Z1DA 3IUOA 4ENKA 4IX7A 1TNSA 2ZJPF 1R6RA 4AU7A 3H9JA 4BUPA 2XKPA 3K4KA 3S3MA 2YU9J 2KKOA 3R0JA 3TGNA 5HNFA 1VTNC 2QBYA 3S3NA 4BBSJ 1D1AA 4XOTA 4I0AA 4JX6A 2IRFG 1TT0A 2PMZN 3I55I 4LLNA 4DW6A 3RCOA 4IRHA 4A0YA 2ZBKA 4MHGA 5JHUA 4M3DA 5DDGA 4BXXJ 3QU6A 3WE2A 3CP2A 4A3DJ 4G12A 3VEPA 1OFCX 5E1WA 1A6QA 5B3SH 1W7PB 5CVIA 5JLWA 4MIMA 3ZQLA 1ZREA 3OYEA 3R60A 1E0EA 5HDGA 2E1OA 3UKGA 2UZKA 1XDSA 3EQLF 4A69C 2PQ8A 2ELHA 4ZDLA 1ACIA 1LQ1A 4O3MA 3JRAA 2GOMA 1BC7C 3A02A 1T8IA 2VPLA 4M3GA 4Y4RA 4AIHA 5IYDJ 3I4MJ 5F08A 4XMYA 3E5XA 2HXIA 3CTAA 5D5XB 1N25A 3GYHX 2LY1A 1D0YA 4DYQA 3ZCOA 1R49A 1LVAA 1YS6A 2OC6A 2K3PA 4Q48A 5K1YA 3TOBA 1YW9A 3OYDA 4FETA 1G3YA 3BC8A 1BM9A 3MZHA 1UHMA 1QVTA 1IG7A 4XL9A 2Y31A 2DA4A 1J59A 3DBLB 2WB1N 4ZYGA 1JKRC 2Z5UA 5D8KB 2W00A 1K78A 9ANTA 1HKTA 1G2HA 5F0CA 1R36A 2DW4A 2WAEA 3RTRA 3I4PA 3GZ6A 4RM2A 4WXCA 2DA5A 1A04A 3JCUC 3HOZJ 4BE0A 3IC7A 4MNUA 4CZCA 1W0UA 2P0WA 4CCMA 2RQPA 1YE9A 5B1AH 4HF1A 1FX7A 1TQPA 2GOXB 3MWMA 2VB6A 3CUQC 4BS9A 3BT9A 2P7CB 4HAMA 3JRDA 2X1CA 3HRSA 4AYBN 2ID6A 2L01A 3S16J 4Y3OA 3I0TA 4DGWB 2VJ4A 2YSRA 3SDGA 5J47A 1E3PA 1ZH5A 2LR8A 1X1AA 2XAHA 1UELB 3S32A 5DD4A 2PN6A 3C3WA 4JK1X 1ZRFA 2R93J 4XBFA 2Q8KA 5DCFA 1U9OA 2CSOA 3LSKA 2LY9A 1YO5C 1T95A 2QQ8A 3HGYA 5KAFC 5E1ZB 2W25A 2DQLA 3L2QA 1B9MA 2M8GX 2EPFA 1GDTA 2EA2A 4RAGA 5LGNA 3GUDA 2MD5A 1Y39A 2W7NA 2RVCA 3WTXC 1T0FC 5ILVA 1FOWA 1OCRH 3B02A 3CJTB 2ZC2A 3DU5A 1J0RA 4NB5A 2W24A 1R1TA 2CUJA 3H5NA 1PDNC 3D1NI 2P5LC 1A35A 1EJ9A 5F04A 3K1MA 1RKTA 3JTHA 3PM1A 2JUGA 2MG4A 5F0FA 1FOKA 1LFBA 5E8IA 5FGMA 2DK8A 1Y6IA 1BI2A 2DT6A 5FFZA 4KN4X 4EJWA 4RMNA 2FOWA 4IHWA 3I9V2 5ED4A 5IT9K 3SFZA 2AHQA 2COBA 2M5WA 4DJAA 2EWNA 3VSLA 1HDPA 2MLGA 2E5ZA 4NC6A 3NWTA 5CQGA 3CCMI 1SANA 2RV8A 1FP1D 1S9HA 3BP8A 2AS5F 3OIOA 2F5DA 1O7FA 2CQ7A 4IHYA 2DI3A 1W5TA 5J40A 3W6KB 3IKTA 4IHTA 2BXYA 3L2UA 3ML6A 5FB2A 1FPQA 4RB0A 2M30A 3KX2A 1P92A 1IRGA 2HVQA 4A3KJ 3H35A 3ZQ7A 1U5TA 3HYIA 2K85A 2QSHX 2VQGA 3D5LA 3LSPA 4AVPA 4MQ9F 4OWRB 1SFEA 2E2IJ 5FKOA 3HTSB 2D5VA 2UWMA 1TWAJ 1F1ZA 1OJLA 4IOCF 2M9HA 4F55A 1MBEA 2V6EA 1MMAA 4ABZA 3FWEA 3OR2C 5HS8A 1BOAA 3BCBA 3JRFA 3FXLA 4EGZA 4ESBA 2VOPA 3BPXA 4DQ2A 4XN3A 2ZCWA 2JVGA 3PIPF 2E35A 3ULQB 2E71A 4KUMA 2CG4A 3MFKA 4DBRA 2LBFB 4ZYEA 1VF9A 1G8XA 3H3ZA 2QZ8A 4KIGA 4D5CA 3HKZA 1P7IA 4G7OF 3CC2I 1MMDA 4AIJA 5DTDA 4R1HA 1XSDA 3BROA 2EINH 3I3LA 4Y13A 2DJNA 2L7MP 1YIJI 2FF4A 2QQAA 2LK2A 2M0MA 3GF2A 4OINF 1T2KA 3K2ZA 3DU6A 4AUXA 5K5RA 3ZGKA 2XROA 2CV1A 4KJZA 2DA7A 2P6TA 1K6YA 3OIQA 2FMLA 2DA6A 4B8XA 1XGOA 1QHHD 4J00A 1G3WA 5H20A 2IS6A 1XMAA 2KQRA 2VI6A 4RAFA 2A05A 3KP7A 1YHQI 1VQLI 5BOXA 2HS5A 4LK1F 1N78A 1STZA 3R4KA 2BV6A 5JR3A 2AQEA 5F0HA 2RNJA 1PP8F 3HEFA 5AIPA 5HLHA 2D2WA 1SFOJ 3TP0A 3CCVI 5ILUA 2CW7A 1X3UA 2DMUA 2DMQA 1S3JA 3NWSA 1BJZA 4IEJA 2ME0A 5BQTA 1KU2A 1HLVA 1F43A 2WC2A 2ZXJA 1U9NA 5CJ9A 2PI0A 1Z05A 1K61A 1RIOH 1QPMA 4LLLA 2VE9A 2ADUA 1DU0A 4YFNF 2Q0OA 5TJJA 2HOAA 3V8LA 2CS3A 1FT9A 1LFPA 3OV8A 3J7AO 2L9VA 2FXAA 3FMSA 3CUQA 3BZCA 2NNYA 2CH0A 3FXMA 4BJ5C 2ACJA 1YFHA 2IGNA 3IH3A 1WJFA 2I5UA 4XKWA 1QZYA 2RDPA 2EZLA 3BQYA 3E5UA 5JVTA 4UUTA 1T6SA 2R3SA 4P9FA 1FP2A 1RR7A 5EGOB 1PUFB 4WF2A 5FKNA 4U0WA 1QPIA 4M72A 1UMQA 4RAZA 1DDNA 3L2WA 4HQEA 3W6VA 1MJBA 1V4RA 5ERIA 4E7ZA 2M3AA 2RREA 1O3RA 2W57A 4MGRA 5IPAA 3A2KA 1KU7A 5D8LB 4U7BA 2TDXA 2KPMA 3IHUA 2MFZA 2JMWA 4G8XA 3LA2A 5M5XJ 3ZQCA 2CU7A 2HZDA 5ICFA 4DZPA 2VKHA 1UZCA 3FXKA 1JKQC 3S14J 1HBXG 2XPWA 4KIFA 4EGYA 1T0FA 2C6YA 1ETXA 2NOJB 3LWFA 5CQEA 1U8BA 4S05A 5M5WJ 4FE4A 1CGPA 4CO8A 1J75A 2B9SA 3JW4A 2BZTA 2GIVA 1SVOA 3WU0A 4KFCA 3FK7A 5HLTA 1OQYA 2LTPA 1JT0A 2DPUA 2ID3A 3GMEA 1Z9CA 1SFKA 1EKEA 2LF7A 4RM3A 1S29A 5ILSA 3CMMA 3MVPA 1YJ9I 2EFOA 4E7KA 2JA2A 1LKXA 2A5YB 4YFKF 2X0LA 1HOMA 2NS7A 4A5MA 4XRMA 3L00A 2WV1A 4U87A 2ESHA 2R7ZJ 3H5AA 4PFOA 5GPCA 1ZRCA 4CYCB 3L2RA 3ZXSA 3CJQB 1NH3A 4XNFA 2PFBA 3EYIA 2F5EA 3QOEA 3BDDA 4B1RA 4A93J 2H6CA 5AIQA 2PJRB 4CGZA 2EV5A 3M8EA 2F4OB 2K02A 4ZYDA 1Y8RB 2KHMA 5DM6F 1BN5A 3GTGJ 4D7NA 1G3TA 4EEFG 1ZELA 4YFXF 2FD5A 2XV4S 2HPIA 1LDKB 2P4WA 4HZFA 1WZ2A 1Y1WJ 1BIAA 2I10A 2NVYJ 4E4HA 2GIZA 3KYLA 3GTKJ 3FHNA 3PSFA 1J9IA 2M45A 2ISYA 2PMHA 2O5RA 2Q1ZB 1UHWA 4C30A 1T08B 3KLNA 1F5TA 1EH6A 2HVSA 3PO2J 4C2MJ 4HX4A 2L5QA 4PJLA 5B66C 1I5ZA 2GA2A 2OD5A 3F8FA 3EUHC 2KIQA 3BTJA 4MFDA 3DXJF 2OU2A 2HOTA 3IAS2 1Z6RA 1ORKA 2G7UA 4QTRA 3CCJI 2M1BA 2Z2SB 4HA8A 2ZXIA 3WG7H 1C0WA 3HRMA 4C2TA 2E36A 2GWRA 1I39A 3DKWA 1FMWA 2DJIA 1P9QC 1VNDA 2B0LA 1X2NA 2R7UA 3OR1C 3DEWA 1HDDC 1FBQA 1JGSA 2LREA 4BGDA 3TO7A 5FKLA 2W4SA 3M4OJ 2EH3A 2OQGA 2HDDA 3S8PA 3SQNA 1QZEA 2ZXHA 3FXRA 3K4CA 3I56I 3VPRA 1IAWA 3OL4A 2E60A 1FIAA 3A01A 3I64A 2WAQA 2HYFA 3I53A 4DYRA 4QPOA 2F6CA 3HBLA 4ZYAA 3W3CA 4ZH4F 1MBHA 2DU9A 2OTJI 3MKLA 4MTDA 3JRIA 2HKOA 1IDZA 2QCOA 2CQQA 3E7LA 4MQVA 1LJ9A 3EETA 3WTZA 2VXDA 5IT9Z 1SD5A 1Q1VA 1TNTA 2J5PA 2W82A 1YQAA 2F5VA 4Y52J 3RPUD 1O3TA 3DQVC 1FWZA 3BLYA 5L3GA 1DPRA 3SEZA 4A3EJ 3ABKH 3VYUB 1AKHA 2GXAA 2VBWA 4FX4A 4ZYHA 3K0LA 4RDUA 2BHYA 3G71I 1V54H 3CDIA 1IJWC 4PUSA 1V5FA 1XCBA 3QP5A 2XASA 2CQNA 2FEZA 3GVAA 5BPIA 1BW6A 1Z7UA 3ZMTA 3GTJJ 1RI7A 2MLKA 3T5XA 1JJ6C 3WGGA 2DOEA 2KRFA 3QQAA 4ZDPA 4L0YB 4XM3A 1VQOI 1R22A 1I27A 1SMYF 4HX7A 1P7JA 3FM5A 3ASNH 4EV0A 3IRRA 1ZAOA 4RGXA 5EG0B 4OIOF 3J81K 2AO9A 2GZWA 3CUOA 4BE2A 2IXSA 4LITA 4MLOA 3GTPJ 3AG1H 2HQAA 1D8JA 4C9YA 1D5YA 3S2WA 5E17F 2TCTA 3M3YJ 2M87A 4GXOA 3C2HA 4XLNF 5DD8A 4N4OB 3I4NJ 1IXCA 5J4VA 2BHZA 4KYWA 2NS0A 4XRSA 1WVRA 3BR6A 2H8RA 1WHUA 4HYEA 3AL0B 3LSHA 2BBYA 4PJJA 3Q9SA 3WHCA 4NQWA 5LHHA 2HPMA 2BY1A 5HS9A 2CMPA 4UUSB 3OWTA 3MKYB 1NK3P 1MKMA 1IN4A 5JLXA 3ZMDA 1G6NA 3IH2A 1BBYA 1KQ8A 2F48A 4B47A 3C2GA 4UXNA 4CUGA 3HRTA 5JI6A 2XSDC 1JKPC 1BL0A 1MIJA 2PX9A 3IWFA 5FKKA 5M3MJ 3Q0VA 3DTKA 4XOPA 3OIPA 2WY8Q 1D1BA 2O8XA 2FBHA 2WWYA 1BIBA 4PJNA 3E0JB 2XPVA 3K4MA 1Y0UA 1R23A 4YEJA 3O2PE 3ZR8X 4D0PA 3CC4I 4H0EA 4G6DA 3P7NA 2WA0A 2HOSA 2WV0A 3FKIJ 3SFIA 3EUHA 1FIPA 3HOWJ 3L9FA 3ISPA 1IN8A 2MBFA 5J1RA 3J7ZI 3PSIA 3BR0A 3BOQA 3RYPA 1HF0A 3S93A 2KLOA 4C3IJ 5HLIA 4V2FA 1XGMA 2RN7A 2KDOA 2DTZA 2BXZA 2Z99A 2E7WA 3VOEA 2DCEA 3VYTB 2G0EA 4E7LA 2NVQJ 2R5YA 2CUFA 4LMYA 1S7AA 4G7ZF 2DBBA 1OPCA 4M6VA 4LG3A 5LRSA 3DP7A 4Q47A 2V1NA 4UV9A 4Q5SF 4MEYF 3E97A 2JA8J 1QU3A 3ERMA 2E2JJ 2IS4A 3BPVA 5HLGA 2DN0A 2LKPA 4BY1J 3WHBA 4LJZF 1U5TC 3KP5A 3HOYJ 3PQJA 4HG2A 3OYIA 3FM3A 1B9NA 2PEXA 3G2BA 2L4AA 1ENHA 1TL8A 1WCMJ 1U3EM 4A3CJ 5LEKA 4Y17A 3W2WA 4HV6A 1MBKA 2QSGX 1ZARA 3I58A 1UG2A 2ME6A 5E79C 1XSVA 2M4GA 1MH3A 1JUSA 2BEOA 2KL4A 1F4KA 1DQUA 1JT6A 3BQZA 3F8BA 1ZGWA 2Y9YA 1ON1A 3CLQA 2R7VA 1OYYA 2LNBA 2K86A 3MKWB 5C44J 2KT0A 2V7FA 2YPRA 4I76A 3F23A 2WTEA 1TP4A 1WJBA 2QEXI 2G7HA 2CUEA 5M3FJ 3AKZA 2X4HA 1XSXA 4UV8A 3IRQA 2JK3A 1YTYA 1SD4A 2X48A 1MDMA 2H1KA 2R5ZB 2F2EA 3GCMA 2KIMA 5KAIC 5K5OA 1T38A 1BOBA 4D9JA 1Q1HA 2P81A 3TKYA 2D1HA 3M8JA 4UB8C 3CMYA 1RR8C 3BG5A 5L3CA 1TW3A 1A6IA 3MN2A 2NNNA 2E2HJ 3BY6A 4A3FJ 2JA7J 2UV1A 1VQNI 4IOAF 1IV6A 5CPRB 3DLAA 4O5VA 3BJOA 3DKXA 4A0XA 3SZGA 2X6YA 2EZHA 2X9DA 3M1CA 1HQCA 4LLGF 5FD5A 2K5CA 3GZ5A 1ZRDA 3O8HA 3PL8A 5HOOA 5EF6A 2RAEA 5L3BA 3OS2A 2JPCA 2NVTJ 4E6KG 1X58A 1IXSB 3JSOA 2P5VA 1ONVA 2TRTA 1I3AA 4BQAA 1G3SA 5DYMA 3U21A 5HNHA 2JA5J 4IHVA 5JFRA 1EH8A 2DMTA 4YIIA 4M6XA 4HRIA 2H1LA 5EZHA 1B72A 3U1KA 2W48A 4NUBA 5IYBJ 2STTA 2FQ4A 4PGGA 2DA2A 4HQMA 2NS8A 2AXLA 4KIBA 1IV8A 2WBMA 4BBRJ 3HSEA 2JSPA 4Y7NJ 1FBSA 1WJDA 4DZJA 2QF7A 1HSTA 2WY7Q 3G1OA 4EVIA 4XLCA 4HPQA 2EFNA 2QQ9A 5TISC 2KMUA 4FASD 1P2FA 4MFEA 3DBRB 3E5QA 2OZUA 4NDLA 3LSRA 4IRIA 5D5VB 3CJNA 2GBYA 2IBDA 1VQ5I 1ZHFA 3T0YA 3CCSI 1YX5A 4DBQA 1QQIA 1GHCA 4UVBA 3TOAA 2STWA 4WK8F 3BZKA 2OJED 4NNJA 1Z3YA 1OMIA 2R7RA 3S2DJ 3CUQB 4LGWA 2M2EA 3COAC 5D5UB 2L0KA 3LOCA 2A3SA 3ZOBA 1NG7A 3WTVC 4L9TA 2GAUA 5C4JJ 2FA5A 3VB2A 4B3XA 1YOVB 2RGVA 3KEYA 3J7YJ 1WI9A 4UUVA 3JAMZ 3F0CA 1Z6TA 5FLMJ 3PUFA 4E70A 4V2GA 1OYIA 5CLSA 2A6EF 3LSTA 1TWGJ 2QA4I 1YIOA 3IL2A 4LG0A 2QKLB 3E6CC 4M73A 4QWQA 1A5JA 2KJCA 1UB9A 4P1WA 5J3LA 1MH4A 3ZMSA 1YRNB 4EJUA 2IJLA 3H9GA 5K7HA 3OS1A 1DP7P 1T33A 2QENA 2I8DA 4M3EA 2KIFA 2PG4A 1RPWA 4ZJZA 5ICCA 1GUUA 3D0SA 1JTYA 2CO5A 2LRDA 2R7QA 2HTSA 1X1DA 4HNVA 2VJ5A 2PMZA 3KZIC 4EM0B 2OA4A 2IA0A 5BNGA 4LIVA 2HDCA 1KYWA 2OF7A 3VFZA 1XMXA 4W97A 3W2AA 2JTVA 3FXQA 4A3JJ 1JTXA 1ULYA 4BAYA 4CHUA 3MZYA 2IW5A 3FX3A 3J81Z 2DTRA 3EDPA 4FQGA 3KYDB 2M7BA 5DCMB 4KMFA 1LPQA 2HVRA 4F52A 2HNHA 4F3QA 1FSHA 2LH9A 1MBFA 1G59A 2BY3A 3MAJA 1WJCA 3DLLF 4KITB 3HM5A 3G6EI 1HW1A 2FJ1A 5EEHA 4ZTFA 1IC8A 4IPAA 2CGPA 2E5NA 2M8EA 5IP6A 2IGKA 2AXTC 2QWWA 5L3DA 4BJTA 4E7SA 2IA2A 2CFXA 5H6RA 3NARA 3ESWB 5BPDA 4C3JJ 3O6BB 2ZMEC 1BJAA 3G1MA 2L9SA 4KA4A 2UXXA 4EJOA 2Y9ZA 1MMSA 1ETKA 2WB1A 3FHZA 2YU3A 1I6XA 5GTHC 3KZZA 4BXUA 3DFGA 2FSWA 1LB2A 2XIGA 4AC0A 1S6LA 1W7PD 1RZ4A 2XPUA 4QSHA 1X3WB 2Q2EA 2HTJA 2XRNA 4YIRX 3FISA 2E34A 3KP4A 4E7IA 3WGIA 4BKXA 4BXFA 1V5EA 3WU1B 2E19A 3RI4A 1I3QJ 5KHDA 3VYRB 4B48A 1ZKGA 3HPHA 1TWCJ 2CRGA 2K9MA 1GLNA 2LP0A 2H8WA 2YX4A 3A0BC 1T98A 1WJ5A 3ABMH 4OIQF 2BOLA 2JPBA 3RKXA 3K4JA 4JX5A 3GTMJ 4M9ZA 1SVLA 3LFUA 4AYBA 2Y0SN 2VC0A 2XF5A 4GYIA 3R0AA 1MZBA 3BR1A 4U7DA 5F27A 5J6XA 4RB1A 5E20A 4GCVA 5F64A 5DM7F 2DA3A 1D8KA 2EJRA 3QPSA 2XSJC 1O4XA 2KJBA 4IQJA 1X1CA 1LE8A 3GTLJ 2V1UA 1XD7A 2BYVE 2VUMJ 1DPUA 1S72I 3WE3A 4X0GA 3G4SI 3A01B 3IAM2 5JVGF 2LOOA 5CVJA 3IKVA 2YX7A 1X1PA 2LYCA 4FE7A 2R7FA 5K5QA 3ABUA 2FE3A 3KFWX 2F4IA 1TLHB 4CCLA 4D5FA 3N05A 1KONA 1ON2A 1DP3A 3SZTA 2G9WA 4CCOA 1Z67A 2ZNYA 2CQXA 4R8HA 2ICWG 1J7KA 3IP4B 3GX4X 2HZTA 3P9CA 2X6XA 3HOTA 2FNPA 5LLQA 1AWCA 3ZN0A 5DS9A 1AKHB 5J1YA 2MH9A 1GV5A 2HQRA 5H2FC 1ETOA 1P6RA 2K9NA 4EM1A 2JJ7A 4BQOA 3FKJA 1E2XA 3OSFA 4ESFA 1HA8A 1WPKA 2EIMH 2K40A 2V9VA 2QGUA 3I54A 3PQKA 2PLYA 5M5YJ 2RQQA 2XVCA 1JKOC 4HF2A 4GFBA 4XSZF 3TBIA 3FXJA 1BI0A 3ABTA 2YR2A 4F7ZA 1IGNA 4EJTA 4HSRA 5B1BH 2PJPA 3ZN1A 1UHSA 2Y30A 1SD7A 1RNLA 2VOOA 4RBOA 1TBXA 1YI2I 2VC1A 3S1MJ 1Z7LA 4FISA 1B1BA 1E3HA 2KISA 1KGSA 4PGHA 3TW7A 4N0BA 3SJMA 1LEBA 4RGRA 5EJCA 2HDWA 3H1CA 2LKXA 2H27A 2ECBA 1HW2A 4CZZA 2XGCA 5C3EJ 1R00A 3V7SA 3N4MA 5K7ZA 2EIKH 2OPTA 1VQ9I 3GO5A 4L5IA 5FROA 1R5HA 3K4NA 3TDUC 1B6AA 2QQBA 4RLFA 2BY0A 3K1PA 2RNGA 4BNCA 1IW7F 4BYYA 3GBGA 3RKYA 2Y75A 3QRFF 5FRNA 4HNUA 2EV0A 2DT7B 1HKQA 5HDNA 4BL0B 2JT1A 4ASNA 1XS9A 3K1NA 2EIJH 4Q4ZF 2CV0A 3LQQA 3OL3A 3I59B 1QO0D 1ERDA 1JI8A 2VASA 1J2XA 1Y56A 1EV7A 2QSFX 1FLIA 3CESA 4LB5A 5KNLA 5J8FA 2LBFA 3CCUI 1GT0C 5FRMA 4CH7A 2DFFA 1UFMA 1Z1DA 2V9KA 4P5OA 2EK5A 3D5SC 2EA4A 2ZMEA 3HHHA 4BEHB 4NC8A 1REPC 3I71A 1ODDA 5GAGJ 3ZQHA 2L54A 4CCNA 2HR3A 5IT3A 2MYSA 3MZ8A 3VDXA 3RZOJ 3RPUA 4B09A 2R7WA 4HDVA 1I6HJ 4E7JA 3FIWA 3FBNB 1O7LA 4XLAA 3WTWC 2E1NA 2ZJQF 4OIRF 2OZ6A 2QYOA 5E3LA 2FUG2 2EZIA 1LDDA 2W1OA 5FLXK 3DKYA 1MBJA 3ZMZA 3OYFA 2LC2A 1ZG3A 2HKXA 4GO1A 2NVXJ 4OIPF 3LAPA 1MNEA 2FRHA 3S17J 3LSJA 3TL4X 3ZQQA 4K2EA 4L0ZB 1D0XA 3JAMK 1H8AC 2CW0F 3TO9A 3U9GA 1EH7A 4II3A 2BW3A 1BW5A 2R7OA 1MSEC 2E1MC 3L7WA 3F9KA 4A6DA 3BR5A 2QBYB 1PUEE 1XMKA 2QUFA 1FJLA 5EGOA 1PUFA 1YITI 5DV5A 2H09A 3NAUA 2XAFA 2FNAA 5F6FA 2ZSIB 1LVKA 4OMYA 4BDZA 1ZGAA 2XF6A 3K9TA 3ZQGA 3OSGA 4C2UA 1YJWI 1ITYA 2H6BA 3RZDJ 3WTUC 2EV6A 1SAXA 1SEUA 4OU0A 2QM3A 3SEQA 5B5EC 2L7FP 3EYYA 3HOXJ 4WWCA 3K69A 2O6GE 4FTHA 1MDMB 3VSKA 1KU9A 1OCCH 1R7JA 4ESJA 1R9TJ 2XDVA 2MC3A 1FYMA 2A6HF 1ZGJA 3DPUA 3F3XA 3B73A 5LRRA 3TDZC 3CF5F 2JWTA 5A2QK 4U0VA 2IPQX 1SD6A 2NOGA 2O3FA 2COMA 3E3VA 3OYAA 2XB0X 2O61A 4RS8A 4XKVA 1YLFA 2LVSA 1X19A 2XRLA 3MCZA 3FXUA 4BQNA 2HGCA 4HV5A 1FEXA 4PK4A 5IY5H 4Z6YA 2LLKA 3V8KA 1YW7A 3PNTA 5LGUA 1XC5A 3V8JA
chains in the Genus database with same CATH topology
1XB4A 1HXDA 1IF1A 4U88A 2UXNA 1W4MA 1K78B 2PBIA 4LD5A 1FYKA 4L9NA 3DPTA 3HUGA 4EQQA 3SXYA 3GLXA 4BHBA 3WTSC 2QVOA 5CVVA 4XLPF 3F8NA 1CF7A 3NEUA 1HW5A 3Q9VA 3F22A 4ENNA 2CYYA 3HIFA 4A12A 1K6OA 3P9IA 4JBAA 4PCQA 3DF8A 3FZVA 4HF0A 3LAJA 5KVRA 1LDJA 4PDKA 5AONA 4KMUX 5D6EA 2E1CA 1J5YA 1L3LA 1MJAA 3QU3A 2K4BA 2K7LA 1IUYA 5L3FA 4O6JA 4S04A 2IP2A 1GXQA 3R61A 1HSJA 1KQ9A 2Y0MA 1GXPA 1XGSA 1I1GA 4KT5C 2BGCA 4P55A 2ISZA 2XHKA 3T8TA 2FOKA 4Z2YA 4M6YA 4UVCA 3G3ZA 3AAFA 3QAHA 4YG2F 3RDIA 4LB6B 2JSCA 4RB3C 1P4WA 1FNNA 1U5TB 4A2UA 3C18A 3KZYA 4FHTA 4ETSA 2FBIA 4UVAA 3TO6A 4G7HF 1QGPA 2HQNA 2O03A 1R1UA 5E8GA 4P9UA 4U0YA 1S8NA 3FMQA 2GQQA 1OR7A 1S7OA 1QNTA 5H6QA 4M74A 4IF4A 4UNOA 4FT8A 1MD0A 3M8FA 3WODF 3KE2A 1JHFA 3NRVA 4OOIA 4AD9A 3JSPA 3C7JA 1BI3A 3LA3A 1TTYA 5J8CA 5D5WB 4NHJA 4I0BA 3ROUA 4WXHA 2MA3A 4M9SA 3BZ6A 4RGSA 3ZMVA 2DAOA 2A68F 1RUNA 5LHIA 2D1VA 5FLXZ 1D5VA 2Z33A 5BMZA 2NRAC 4N9HA 4LFUA 4YIFA 2XAQA 2GXBA 3GFMA 2R7DA 2A07F 2F5FA 2ESNA 4HW0A 2ZFWA 5FO5A 2VONA 1XDUA 3RIRA 3CLOA 5KK1A 1ZYRF 1LEAA 1K7AA 3CO6C 5HDKA 1W5SA 1D3YA 2VN2A 1IN6A 1XCVA 4ON0A 4IVNA 1V3FA 3E6BA 4WX9A 2RC4A 3GFLA 4BH9A 5L3EA 3H92A 3GXOA 3MQ0A 2KIUA 4I01A 1OKRA 2Y48A 2BE5F 4HOBA 3L09A 4EM2A 2V6CA 3L2CA 3ZPLA 5E1XA 1R58A 1WWXA 2W85A 2ETHA 3NQOA 1IZ1A 5A2QZ 1U78A 3J80Z 3LQRA 1ZN2A 1W7PA 1YW8A 4CICA 3HTUA 4RB2C 5TRDA 2P6SA 4I98B 1WRJA 1QBJA 2P7VB 4KN7X 1U2WA 4WCGA 5FFXA 4GYGA 2IT0A 2OBPA 4EJVA 3JTGA 1B4AA 2E7XA 4HX8A 1O3SA 2JZYA 3MEXA 1DUXC 4AIKA 2P8TA 2O0YA 4A5NA 2VE8A 3WG9A 1FZPB 5D6FA 5ICEA 2MH2A 1H0MA 1RUOA 4I7HA 2ZMEB 1H9TA 2VODA 1USTA 5D4SA 1KU3A 4MTEA 4L9JA 3E6DA 5CYVA 4HBLA 5CVRA 4QLCU 4IJAA 1XN7A 3QOPA 2LF8A 2GXGA 1PP7U 4BHPA 2L4MA 4IXAA 4R79A 3LA7A 2PMUA 1WSUA 2LDUA 1YG2A 2VBXA 1YS7A 1AOYA 4L5JA 1P4AA 3T8RA 4HLXA 3W6JB 2VXZA 2J5OA 3VFZA 2W84A 1UCRA 3M9AA 3QPHA 4P96A 4M9XA 3KETA 2ZNZA 1KA8A 3M7GA 4TV7A 2FMYA 1BI1A 2DFIA 1WQ2A 3WGHA 2L02A 2P5KA 3ZP5A 1QZZA 1O57A 3V7CA 1IN5A 1SFXA 4RGUA 3KCCA 2HWVA 2ZO4A 4PZJA 4MEXF 3BWGA 2QLZA 3RPQA 2Z3YA 1JE8A 3HHGA 4JQFA 3HRUA 4G94A 4HLYA 3PFIA 4BHCA 1Z91A 5EEGA 3ELKA 3CO7C 3TQNA 5ICGA 4L18B 2NAZA 1T39A 3SHFA 4EMSA 1FC3A 3GFJA 3O3KA 5DUKA 4CYDA 2EB7A 4AWXB 2HEOA 1P4XA 2CQKA 5DCMA 3DPLC 6PAXA 2L3DA 2DO7A 3H3UA 4CDGA 1MJ9A 3V7RA 2GA1A 2XKOA 3R6SA 5DUIA 2H94A 1TQIA 3KLOA 3BJ6A 4I02A 4XSXF 1H9GA 2ZKZA 4CXFA 5LHGA 3WTYC 1CF7B 2D45A 5HS7A 4KDPA 1XGNA 3QPTA 1OYWA 1USSA 2VBZA 3BJAA 1IRFA 2CWEA 5LBQA 1JHHA 2FU4A 4N9IA 4KNYA 2XUBA 4RAYA 3ECHA 4I2OA 1FSEA 4I09A 4DNCA 3GEZA 1GVJA 3KP6A 1SFUA 1F9NA 2IVMA 2XAGA 3E6MA 1FYLA 1SMTA 2EFPA 3ECOA 1TQMA 3KEQA 5LGTA 1IN7A 4G9YA 3QP6A 2VBYA 3N97A 2XAJA 2K4JA 3F6VA 2V1DA 1ZG5A 2A61A 3KP3A 3T1BA 5DEQA 3ZMUA 2HOEA 1IXRC 1NHAA 2EFQA 5LEJA 3U1DA 2VT3A 1YYVA 2FQ3A 3G73A 4A6EA 3F8CA 4Y15A 1U8RA 2F5CA 4A0ZA 4HDUA 1TW2A 1I1SA 1ZG1A 3VODA 4G6QA 3J80K 1KQ0A 4L9VA 2XGXA 5F1RA 3HOSA 5BS6A 2V1XA 2HYGD 1ZLKA 4ZZLA 5CVUA 2JRTA 2NYXA 2DK5A 3LFKA 4ENMA 2K27A 3HSRA 2EFWA 3CDHA 5D4RA 2LSOA 2FBKA 3ERED 1LNWA 3FF5A 4KICA 2OAZA 3F8MA 1FY7A 1BC8C 5E18F 1JXSA 3F72A 3Q5FA 3KEOA 3P9KA 2ZJ2A 1ZLJA 3GFIA 4IHSA 3RYRA 1R1VA 3I59A 5FD6A 4XRFA 1R5GA 2V79A 3REOA 4ENJA 2DT5A 2HFHA 4ZZDA 2VT2A 3IWZA 2RKHA 1K79A 5HVQC 2IA1A 2DPDA 3OOPA 3V4GA 4GGGA 1L0OC 1O3QA 4M71A 3F21A 1B59A 2A69F 1KYZA 1WKMA 4UHTA 3KP2A 4LK0F 3SZPA 4FX0A 2DQRA 2OQRA 2DLLA 1G4DA 3RKWA 3HSFA 1HKSA 3DEUA 2Z9OA 4IRGA 3M1EA 4OMZA 4WXDA 4LG0B 1MGTA 3FMRA 3WTTC 1FBUA 1E17A 3GW2A 3RJPA 3I5UA 1U6GA 3DV8A 3GWZA 3C1DA 3F6OA 3U2RA 4ENKA 1TNSA 2XKPA 2KKOA 3R0JA 3TGNA 2QBYA 1VTNC 4I0AA 2IRFG 4LLNA 4IRHA 4A0YA 2ZBKA 4MHGA 5JHUA 5DDGA 3QU6A 3WE2A 3VEPA 5E1WA 1W7PB 5CVIA 1ZREA 3R60A 5HDGA 2UZKA 1XDSA 3EQLF 2PQ8A 2ELHA 1LQ1A 4O3MA 1BC7C 4AIHA 3E5XA 3CTAA 5D5XB 3GYHX 1LVAA 1YS6A 4Q48A 5K1YA 3TOBA 1YW9A 1G3YA 1BM9A 3MZHA 1UHMA 1J59A 4ZYGA 2Z5UA 5D8KB 1K78A 1HKTA 1R36A 2DW4A 3RTRA 3I4PA 3GZ6A 4WXCA 1A04A 3IC7A 4MNUA 2RQPA 4HF1A 1FX7A 1TQPA 3MWMA 3CUQC 2P7CB 4HAMA 3HRSA 2L01A 3I0TA 2YSRA 1ZH5A 2XAHA 5DD4A 2PN6A 3C3WA 4JK1X 1ZRFA 4XBFA 2Q8KA 5DCFA 2CSOA 1YO5C 5E1ZB 2W25A 2DQLA 1B9MA 2EA2A 5LGNA 3GUDA 2MD5A 2RVCA 3WTXC 5ILVA 3B02A 1J0RA 4NB5A 2W24A 1R1TA 1PDNC 2P5LC 3K1MA 3JTHA 1FOKA 5E8IA 5FGMA 2DK8A 1BI2A 5FFZA 4KN4X 4EJWA 5IT9K 5ED4A 3SFZA 2M5WA 2EWNA 2MLGA 2RV8A 1FP1D 3BP8A 2AS5F 2F5DA 1O7FA 2DI3A 1W5TA 3W6KB 3IKTA 4IHTA 3ML6A 5FB2A 1FPQA 4RB0A 2M30A 1P92A 1IRGA 3ZQ7A 1U5TA 3HYIA 3D5LA 4AVPA 4MQ9F 1SFEA 3HTSB 2UWMA 1F1ZA 3FWEA 5HS8A 1BOAA 4EGZA 4ESBA 2VOPA 3BPXA 4DQ2A 2ZCWA 3ULQB 4KUMA 2CG4A 3MFKA 4ZYEA 3H3ZA 2QZ8A 4KIGA 4G7OF 4AIJA 4R1HA 1XSDA 3BROA 4Y13A 2FF4A 2QQAA 4OINF 3GF2A 1T2KA 3K2ZA 5K5RA 2XROA 2P6TA 2FMLA 4B8XA 1XGOA 1G3WA 5H20A 1XMAA 3KP7A 5BOXA 2HS5A 4LK1F 1STZA 3R4KA 2BV6A 5JR3A 2RNJA 1PP8F 5AIPA 5HLHA 2D2WA 5ILUA 1X3UA 1S3JA 5BQTA 1KU2A 2WC2A 2ZXJA 5CJ9A 2PI0A 1Z05A 1RIOH 1QPMA 4LLLA 2VE9A 2ADUA 4YFNF 2Q0OA 5TJJA 3V8LA 1FT9A 3OV8A 3J7AO 2FXAA 3FMSA 3CUQA 2NNYA 2ACJA 1YFHA 1QZYA 2RDPA 3E5UA 5JVTA 1T6SA 2R3SA 4P9FA 1FP2A 4WF2A 4U0WA 4M72A 4RAZA 1DDNA 4HQEA 1MJBA 1V4RA 5ERIA 1O3RA 2W57A 4MGRA 1KU7A 5D8LB 4U7BA 2TDXA 3IHUA 4G8XA 3LA2A 5ICFA 1HBXG 4KIFA 4EGYA 1T0FA 2C6YA 3LWFA 4S05A 1CGPA 4CO8A 1J75A 3JW4A 2GIVA 3WU0A 4KFCA 2DPUA 1Z9CA 2LF7A 1S29A 5ILSA 2EFOA 2A5YB 4YFKF 2X0LA 4A5MA 3L00A 2ESHA 1ZRCA 2PFBA 3EYIA 2F5EA 3BDDA 2H6CA 5AIQA 4CGZA 2EV5A 3M8EA 2K02A 4ZYDA 1BN5A 1G3TA 4YFXF 2XV4S 1LDKB 2P4WA 4HZFA 1BIAA 1J9IA 2M45A 2ISYA 2PMHA 1UHWA 3KLNA 1F5TA 1EH6A 4HX4A 1I5ZA 2GA2A 2OD5A 3F8FA 3DXJF 2OU2A 1Z6RA 2G7UA 2M1BA 4HA8A 1C0WA 3HRMA 2GWRA 3DKWA 2B0LA 1FBQA 1JGSA 3TO7A 2OQGA 3SQNA 3FXRA 1IAWA 3I64A 2HYFA 3I53A 4ZH4F 2DU9A 4MTDA 2HKOA 4MQVA 1LJ9A 3EETA 3WTZA 5IT9Z 1SD5A 1TNTA 2J5PA 1YQAA 1O3TA 3DQVC 1FWZA 5L3GA 1DPRA 2VBWA 4FX4A 4ZYHA 3K0LA 1XCBA 3QP5A 2XASA 2FEZA 3GVAA 5BPIA 1Z7UA 3ZMTA 1RI7A 2MLKA 3T5XA 3WGGA 2KRFA 4L0YB 1R22A 1I27A 1SMYF 4HX7A 3FM5A 4EV0A 3IRRA 1ZAOA 4RGXA 4OIOF 3J81K 2GZWA 3CUOA 1D8JA 3S2WA 5E17F 2M87A 4GXOA 4XLNF 5DD8A 1IXCA 4KYWA 2NS0A 4HYEA 2BBYA 3Q9SA 4NQWA 5LHHA 5HS9A 1MKMA 1IN4A 3ZMDA 1G6NA 1BBYA 1KQ8A 4UXNA 3HRTA 5JI6A 3IWFA 2O8XA 2FBHA 2WWYA 1BIBA 1Y0UA 1R23A 3O2PE 4D0PA 4H0EA 4G6DA 3P7NA 2WV0A 3EUHA 3L9FA 3ISPA 1IN8A 2MBFA 3BOQA 3RYPA 5HLIA 1XGMA 2RN7A 3VOEA 2Z99A 2E7WA 4LMYA 1S7AA 4G7ZF 2DBBA 1OPCA 5LRSA 3DP7A 4Q47A 4UV9A 4Q5SF 4MEYF 3E97A 3BPVA 5HLGA 2LKPA 4LJZF 1U5TC 3KP5A 3PQJA 3FM3A 1B9NA 2PEXA 2L4AA 1U3EM 5LEKA 4Y17A 4HV6A 1ZARA 3I58A 1XSVA 2BEOA 1F4KA 3F8BA 1ON1A 1OYYA 2LNBA 2K86A 2YPRA 3F23A 2WTEA 2G7HA 2X4HA 1XSXA 4UV8A 3IRQA 1YTYA 1SD4A 1MDMA 2F2EA 2KIMA 5K5OA 1T38A 1Q1HA 3TKYA 2D1HA 5L3CA 1TW3A 2NNNA 3BY6A 4O5VA 3BJOA 4A0XA 5FD5A 4LLGF 1HQCA 3GZ5A 1ZRDA 5HOOA 5L3BA 2JPCA 1IXSB 3JSOA 2P5VA 1ONVA 4BQAA 1G3SA 5DYMA 5JFRA 1EH8A 4YIIA 4M6XA 2STTA 4PGGA 4HQMA 2AXLA 4KIBA 3HSEA 1FBSA 1HSTA 4EVIA 2EFNA 2QQ9A 1P2FA 3E5QA 2OZUA 4IRIA 5D5VB 3CJNA 1ZHFA 3T0YA 1QQIA 1GHCA 4UVBA 3TOAA 2STWA 4WK8F 1OMIA 3CUQB 4LGWA 3COAC 5D5UB 2A3SA 3WTVC 4L9TA 2GAUA 2FA5A 3VB2A 2RGVA 1WI9A 4UUVA 3JAMZ 1Z6TA 4E70A 1OYIA 5CLSA 2A6EF 3LSTA 1YIOA 3IL2A 4LG0A 3E6CC 4M73A 4QWQA 2KJCA 1UB9A 3ZMSA 4EJUA 2IJLA 1DP7P 2QENA 2KIFA 2PG4A 5ICCA 3D0SA 2CO5A 2HTSA 4EM0B 2OA4A 2IA0A 2HDCA 1KYWA 2JTVA 3FXQA 1ULYA 4BAYA 4CHUA 3MZYA 2IW5A 3FX3A 3J81Z 2DTRA 3EDPA 5DCMB 4KMFA 1FSHA 3MAJA 1HW1A 5EEHA 2CGPA 4IPAA 2M8EA 2QWWA 5L3DA 2IA2A 2CFXA 5H6RA 3O6BB 1BJAA 4KA4A 2UXXA 4EJOA 3FHZA 2YU3A 1I6XA 3KZZA 4BXUA 3DFGA 2FSWA 1LB2A 2XIGA 1S6LA 1W7PD 1RZ4A 2Q2EA 2HTJA 2XRNA 5BPDA 3KP4A 3WGIA 3WU1B 3RI4A 2YX4A 1T98A 4OIQF 2JPBA 3RKXA 4M9ZA 2VC0A 4GYIA 3R0AA 1MZBA 4U7DA 5J6XA 4RB1A 5E20A 4GCVA 5F64A 1D8KA 2EJRA 2KJBA 2V1UA 1XD7A 2BYVE 1DPUA 3WE3A 5CVJA 3IKVA 2YX7A 2R7FA 5K5QA 3ABUA 2FE3A 3KFWX 1TLHB 1ON2A 3SZTA 2G9WA 2ZNYA 4R8HA 1J7KA 3GX4X 2HZTA 3P9CA 3HOTA 2FNPA 5LLQA 1AWCA 3ZN0A 2MH9A 2HQRA 1P6RA 4EM1A 1E2XA 4ESFA 2V9VA 3I54A 3PQKA 2PLYA 2XVCA 4HF2A 4XSZF 1BI0A 3ABTA 2YR2A 4F7ZA 4EJTA 2PJPA 3ZN1A 1SD7A 1RNLA 2VOOA 1TBXA 2VC1A 1B1BA 1KGSA 4PGHA 4N0BA 1LEBA 4RGRA 2H27A 1HW2A 4CZZA 1R00A 3V7SA 3N4MA 3GO5A 4L5IA 1R5HA 3TDUC 1B6AA 2QQBA 3K1PA 4BNCA 1IW7F 4BYYA 3RKYA 2Y75A 3QRFF 2EV0A 1HKQA 5HDNA 2JT1A 4ASNA 3K1NA 4Q4ZF 3LQQA 3I59B 1QO0D 1J2XA 1EV7A 1FLIA 4LB5A 5J8FA 1UFMA 1Z1DA 4P5OA 2EK5A 2EA4A 2ZMEA 3HHHA 1REPC 3I71A 1ODDA 2L54A 2HR3A 5IT3A 3RPUA 4B09A 4HDVA 1O7LA 3WTWC 2E1NA 4OIRF 2OZ6A 2QYOA 1LDDA 5FLXK 3ZMZA 1ZG3A 2HKXA 4GO1A 4OIPF 3LAPA 2FRHA 4K2EA 4L0ZB 3JAMK 2CW0F 3TO9A 3U9GA 1EH7A 3L7WA 4A6DA 2QBYB 1PUEE 1XMKA 2QUFA 5DV5A 2H09A 2XAFA 2FNAA 5F6FA 4OMYA 1ZGAA 3K9TA 2H6BA 3WTUC 2EV6A 1SAXA 4OU0A 2QM3A 3EYYA 4WWCA 3K69A 2O6GE 1MDMB 1KU9A 1R7JA 4ESJA 2MC3A 1FYMA 2A6HF 1ZGJA 3F3XA 3B73A 5LRRA 3TDZC 5A2QK 4U0VA 2IPQX 1SD6A 2O3FA 2COMA 3E3VA 2O61A 4RS8A 1YLFA 3MCZA 3FXUA 2HGCA 4HV5A 3V8KA 1YW7A 5LGUA 3V8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XB4 A;  1HXD A;  1IF1 A;  4U88 A;  2UXN A;  1W4M A;  1K78 B;  2PBI A;  4LD5 A;  1FYK A;  4L9N A;  3DPT A;  3HUG A;  4EQQ A;  3SXY A;  3GLX A;  4BHB A;  3WTS C;  2QVO A;  5CVV A;  4XLP F;  3F8N A;  1CF7 A;  3NEU A;  1HW5 A;  3Q9V A;  3F22 A;  4ENN A;  2CYY A;  3HIF A;  4A12 A;  1K6O A;  3P9I A;  4JBA A;  4PCQ A;  3DF8 A;  3FZV A;  4HF0 A;  3LAJ A;  5KVR A;  1LDJ A;  4PDK A;  5AON A;  4KMU X;  5D6E A;  2E1C A;  1J5Y A;  1L3L A;  1MJA A;  3QU3 A;  2K4B A;  2K7L A;  1IUY A;  5L3F A;  4O6J A;  4S04 A;  2IP2 A;  1GXQ A;  3R61 A;  1HSJ A;  1KQ9 A;  2Y0M A;  1GXP A;  1XGS A;  1I1G A;  4KT5 C;  2BGC A;  4P55 A;  2ISZ A;  2XHK A;  3T8T A;  2FOK A;  4Z2Y A;  4M6Y A;  4UVC A;  3G3Z A;  3AAF A;  3QAH A;  4YG2 F;  3RDI A;  4LB6 B;  2JSC A;  4RB3 C;  1P4W A;  1FNN A;  1U5T B;  4A2U A;  3C18 A;  3KZY A;  4FHT A;  4ETS A;  2FBI A;  4UVA A;  3TO6 A;  4G7H F;  1QGP A;  2HQN A;  2O03 A;  1R1U A;  5E8G A;  4P9U A;  4U0Y A;  1S8N A;  3FMQ A;  2GQQ A;  1OR7 A;  1S7O A;  1QNT A;  5H6Q A;  4M74 A;  4IF4 A;  4UNO A;  4FT8 A;  1MD0 A;  3M8F A;  3WOD F;  3KE2 A;  1JHF A;  3NRV A;  4OOI A;  4AD9 A;  3JSP A;  3C7J A;  1BI3 A;  3LA3 A;  1TTY A;  5J8C A;  5D5W B;  4NHJ A;  4I0B A;  3ROU A;  4WXH A;  2MA3 A;  4M9S A;  3BZ6 A;  4RGS A;  3ZMV A;  2DAO A;  2A68 F;  1RUN A;  5LHI A;  2D1V A;  5FLX Z;  1D5V A;  2Z33 A;  5BMZ A;  2NRA C;  4N9H A;  4LFU A;  4YIF A;  2XAQ A;  2GXB A;  3GFM A;  2R7D A;  2A07 F;  2F5F A;  2ESN A;  4HW0 A;  2ZFW A;  5FO5 A;  2VON A;  1XDU A;  3RIR A;  3CLO A;  5KK1 A;  1ZYR F;  1LEA A;  1K7A A;  3CO6 C;  5HDK A;  1W5S A;  1D3Y A;  2VN2 A;  1IN6 A;  1XCV A;  4ON0 A;  4IVN A;  1V3F A;  3E6B A;  4WX9 A;  2RC4 A;  3GFL A;  4BH9 A;  5L3E A;  3H92 A;  3GXO A;  3MQ0 A;  2KIU A;  4I01 A;  1OKR A;  2Y48 A;  2BE5 F;  4HOB A;  3L09 A;  4EM2 A;  2V6C A;  3L2C A;  3ZPL A;  5E1X A;  1R58 A;  1WWX A;  2W85 A;  2ETH A;  3NQO A;  1IZ1 A;  5A2Q Z;  1U78 A;  3J80 Z;  3LQR A;  1ZN2 A;  1W7P A;  1YW8 A;  4CIC A;  3HTU A;  4RB2 C;  5TRD A;  2P6S A;  4I98 B;  1WRJ A;  1QBJ A;  2P7V B;  4KN7 X;  1U2W A;  4WCG A;  5FFX A;  4GYG A;  2IT0 A;  2OBP A;  4EJV A;  3JTG A;  1B4A A;  2E7X A;  4HX8 A;  1O3S A;  2JZY A;  3MEX A;  1DUX C;  4AIK A;  2P8T A;  2O0Y A;  4A5N A;  2VE8 A;  3WG9 A;  1FZP B;  5D6F A;  5ICE A;  2MH2 A;  1H0M A;  1RUO A;  4I7H A;  2ZME B;  1H9T A;  2VOD A;  1UST A;  5D4S A;  1KU3 A;  4MTE A;  4L9J A;  3E6D A;  5CYV A;  4HBL A;  5CVR A;  4QLC U;  4IJA A;  1XN7 A;  3QOP A;  2LF8 A;  2GXG A;  1PP7 U;  4BHP A;  2L4M A;  4IXA A;  4R79 A;  3LA7 A;  2PMU A;  1WSU A;  2LDU A;  1YG2 A;  2VBX A;  1YS7 A;  1AOY A;  4L5J A;  1P4A A;  3T8R A;  4HLX A;  3W6J B;  2VXZ A;  2J5O A;  3VFZ A;  2W84 A;  1UCR A;  3M9A A;  3QPH A;  4P96 A;  4M9X A;  3KET A;  2ZNZ A;  1KA8 A;  3M7G A;  4TV7 A;  2FMY A;  1BI1 A;  2DFI A;  1WQ2 A;  3WGH A;  2L02 A;  2P5K A;  3ZP5 A;  1QZZ A;  1O57 A;  3V7C A;  1IN5 A;  1SFX A;  4RGU A;  3KCC A;  2HWV A;  2ZO4 A;  4PZJ A;  4MEX F;  3BWG A;  2QLZ A;  3RPQ A;  2Z3Y A;  1JE8 A;  3HHG A;  4JQF A;  3HRU A;  4G94 A;  4HLY A;  3PFI A;  4BHC A;  1Z91 A;  5EEG A;  3ELK A;  3CO7 C;  3TQN A;  5ICG A;  4L18 B;  2NAZ A;  1T39 A;  3SHF A;  4EMS A;  1FC3 A;  3GFJ A;  3O3K A;  5DUK A;  4CYD A;  2EB7 A;  4AWX B;  2HEO A;  1P4X A;  2CQK A;  5DCM A;  3DPL C;  6PAX A;  2L3D A;  2DO7 A;  3H3U A;  4CDG A;  1MJ9 A;  3V7R A;  2GA1 A;  2XKO A;  3R6S A;  5DUI A;  2H94 A;  1TQI A;  3KLO A;  3BJ6 A;  4I02 A;  4XSX F;  1H9G A;  2ZKZ A;  4CXF A;  5LHG A;  3WTY C;  1CF7 B;  2D45 A;  5HS7 A;  4KDP A;  1XGN A;  3QPT A;  1OYW A;  1USS A;  2VBZ A;  3BJA A;  1IRF A;  2CWE A;  5LBQ A;  1JHH A;  2FU4 A;  4N9I A;  4KNY A;  2XUB A;  4RAY A;  3ECH A;  4I2O A;  1FSE A;  4I09 A;  4DNC A;  3GEZ A;  1GVJ A;  3KP6 A;  1SFU A;  1F9N A;  2IVM A;  2XAG A;  3E6M A;  1FYL A;  1SMT A;  2EFP A;  3ECO A;  1TQM A;  3KEQ A;  5LGT A;  1IN7 A;  4G9Y A;  3QP6 A;  2VBY A;  3N97 A;  2XAJ A;  2K4J A;  3F6V A;  2V1D A;  1ZG5 A;  2A61 A;  3KP3 A;  3T1B A;  5DEQ A;  3ZMU A;  2HOE A;  1IXR C;  1NHA A;  2EFQ A;  5LEJ A;  3U1D A;  2VT3 A;  1YYV A;  2FQ3 A;  3G73 A;  4A6E A;  3F8C A;  4Y15 A;  1U8R A;  2F5C A;  4A0Z A;  4HDU A;  1TW2 A;  1I1S A;  1ZG1 A;  3VOD A;  4G6Q A;  3J80 K;  1KQ0 A;  4L9V A;  2XGX A;  5F1R A;  3HOS A;  5BS6 A;  2V1X A;  2HYG D;  1ZLK A;  4ZZL A;  5CVU A;  2JRT A;  2NYX A;  2DK5 A;  3LFK A;  4ENM A;  2K27 A;  3HSR A;  2EFW A;  3CDH A;  5D4R A;  2LSO A;  2FBK A;  3ERE D;  1LNW A;  3FF5 A;  4KIC A;  2OAZ A;  3F8M A;  1FY7 A;  1BC8 C;  5E18 F;  1JXS A;  3F72 A;  3Q5F A;  3KEO A;  3P9K A;  2ZJ2 A;  1ZLJ A;  3GFI A;  4IHS A;  3RYR A;  1R1V A;  3I59 A;  5FD6 A;  4XRF A;  1R5G A;  2V79 A;  3REO A;  4ENJ A;  2DT5 A;  2HFH A;  4ZZD A;  2VT2 A;  3IWZ A;  2RKH A;  1K79 A;  5HVQ C;  2IA1 A;  2DPD A;  3OOP A;  3V4G A;  4GGG A;  1L0O C;  1O3Q A;  4M71 A;  3F21 A;  1B59 A;  2A69 F;  1KYZ A;  1WKM A;  4UHT A;  3KP2 A;  4LK0 F;  3SZP A;  4FX0 A;  2DQR A;  2OQR A;  2DLL A;  1G4D A;  3RKW A;  3HSF A;  1HKS A;  3DEU A;  2Z9O A;  4IRG A;  3M1E A;  4OMZ A;  4WXD A;  4LG0 B;  1MGT A;  3FMR A;  3WTT C;  1FBU A;  1E17 A;  3GW2 A;  3RJP A;  3I5U A;  1U6G A;  3DV8 A;  3GWZ A;  3C1D A;  3F6O A;  3U2R A;  4ENK A;  1TNS A;  2XKP A;  2KKO A;  3R0J A;  3TGN A;  2QBY A;  1VTN C;  4I0A A;  2IRF G;  4LLN A;  4IRH A;  4A0Y A;  2ZBK A;  4MHG A;  5JHU A;  5DDG A;  3QU6 A;  3WE2 A;  3VEP A;  5E1W A;  1W7P B;  5CVI A;  1ZRE A;  3R60 A;  5HDG A;  2UZK A;  1XDS A;  3EQL F;  2PQ8 A;  2ELH A;  1LQ1 A;  4O3M A;  1BC7 C;  4AIH A;  3E5X A;  3CTA A;  5D5X B;  3GYH X;  1LVA A;  1YS6 A;  4Q48 A;  5K1Y A;  3TOB A;  1YW9 A;  1G3Y A;  1BM9 A;  3MZH A;  1UHM A;  1J59 A;  4ZYG A;  2Z5U A;  5D8K B;  1K78 A;  1HKT A;  1R36 A;  2DW4 A;  3RTR A;  3I4P A;  3GZ6 A;  4WXC A;  1A04 A;  3IC7 A;  4MNU A;  2RQP A;  4HF1 A;  1FX7 A;  1TQP A;  3MWM A;  3CUQ C;  2P7C B;  4HAM A;  3HRS A;  2L01 A;  3I0T A;  2YSR A;  1ZH5 A;  2XAH A;  5DD4 A;  2PN6 A;  3C3W A;  4JK1 X;  1ZRF A;  4XBF A;  2Q8K A;  5DCF A;  2CSO A;  1YO5 C;  5E1Z B;  2W25 A;  2DQL A;  1B9M A;  2EA2 A;  5LGN A;  3GUD A;  2MD5 A;  2RVC A;  3WTX C;  5ILV A;  3B02 A;  1J0R A;  4NB5 A;  2W24 A;  1R1T A;  1PDN C;  2P5L C;  3K1M A;  3JTH A;  1FOK A;  5E8I A;  5FGM A;  2DK8 A;  1BI2 A;  5FFZ A;  4KN4 X;  4EJW A;  5IT9 K;  5ED4 A;  3SFZ A;  2M5W A;  2EWN A;  2MLG A;  2RV8 A;  1FP1 D;  3BP8 A;  2AS5 F;  2F5D A;  1O7F A;  2DI3 A;  1W5T A;  3W6K B;  3IKT A;  4IHT A;  3ML6 A;  5FB2 A;  1FPQ A;  4RB0 A;  2M30 A;  1P92 A;  1IRG A;  3ZQ7 A;  1U5T A;  3HYI A;  3D5L A;  4AVP A;  4MQ9 F;  1SFE A;  3HTS B;  2UWM A;  1F1Z A;  3FWE A;  5HS8 A;  1BOA A;  4EGZ A;  4ESB A;  2VOP A;  3BPX A;  4DQ2 A;  2ZCW A;  3ULQ B;  4KUM A;  2CG4 A;  3MFK A;  4ZYE A;  3H3Z A;  2QZ8 A;  4KIG A;  4G7O F;  4AIJ A;  4R1H A;  1XSD A;  3BRO A;  4Y13 A;  2FF4 A;  2QQA A;  4OIN F;  3GF2 A;  1T2K A;  3K2Z A;  5K5R A;  2XRO A;  2P6T A;  2FML A;  4B8X A;  1XGO A;  1G3W A;  5H20 A;  1XMA A;  3KP7 A;  5BOX A;  2HS5 A;  4LK1 F;  1STZ A;  3R4K A;  2BV6 A;  5JR3 A;  2RNJ A;  1PP8 F;  5AIP A;  5HLH A;  2D2W A;  5ILU A;  1X3U A;  1S3J A;  5BQT A;  1KU2 A;  2WC2 A;  2ZXJ A;  5CJ9 A;  2PI0 A;  1Z05 A;  1RIO H;  1QPM A;  4LLL A;  2VE9 A;  2ADU A;  4YFN F;  2Q0O A;  5TJJ A;  3V8L A;  1FT9 A;  3OV8 A;  3J7A O;  2FXA A;  3FMS A;  3CUQ A;  2NNY A;  2ACJ A;  1YFH A;  1QZY A;  2RDP A;  3E5U A;  5JVT A;  1T6S A;  2R3S A;  4P9F A;  1FP2 A;  4WF2 A;  4U0W A;  4M72 A;  4RAZ A;  1DDN A;  4HQE A;  1MJB A;  1V4R A;  5ERI A;  1O3R A;  2W57 A;  4MGR A;  1KU7 A;  5D8L B;  4U7B A;  2TDX A;  3IHU A;  4G8X A;  3LA2 A;  5ICF A;  1HBX G;  4KIF A;  4EGY A;  1T0F A;  2C6Y A;  3LWF A;  4S05 A;  1CGP A;  4CO8 A;  1J75 A;  3JW4 A;  2GIV A;  3WU0 A;  4KFC A;  2DPU A;  1Z9C A;  2LF7 A;  1S29 A;  5ILS A;  2EFO A;  2A5Y B;  4YFK F;  2X0L A;  4A5M A;  3L00 A;  2ESH A;  1ZRC A;  2PFB A;  3EYI A;  2F5E A;  3BDD A;  2H6C A;  5AIQ A;  4CGZ A;  2EV5 A;  3M8E A;  2K02 A;  4ZYD A;  1BN5 A;  1G3T A;  4YFX F;  2XV4 S;  1LDK B;  2P4W A;  4HZF A;  1BIA A;  1J9I A;  2M45 A;  2ISY A;  2PMH A;  1UHW A;  3KLN A;  1F5T A;  1EH6 A;  4HX4 A;  1I5Z A;  2GA2 A;  2OD5 A;  3F8F A;  3DXJ F;  2OU2 A;  1Z6R A;  2G7U A;  2M1B A;  4HA8 A;  1C0W A;  3HRM A;  2GWR A;  3DKW A;  2B0L A;  1FBQ A;  1JGS A;  3TO7 A;  2OQG A;  3SQN A;  3FXR A;  1IAW A;  3I64 A;  2HYF A;  3I53 A;  4ZH4 F;  2DU9 A;  4MTD A;  2HKO A;  4MQV A;  1LJ9 A;  3EET A;  3WTZ A;  5IT9 Z;  1SD5 A;  1TNT A;  2J5P A;  1YQA A;  1O3T A;  3DQV C;  1FWZ A;  5L3G A;  1DPR A;  2VBW A;  4FX4 A;  4ZYH A;  3K0L A;  1XCB A;  3QP5 A;  2XAS A;  2FEZ A;  3GVA A;  5BPI A;  1Z7U A;  3ZMT A;  1RI7 A;  2MLK A;  3T5X A;  3WGG A;  2KRF A;  4L0Y B;  1R22 A;  1I27 A;  1SMY F;  4HX7 A;  3FM5 A;  4EV0 A;  3IRR A;  1ZAO A;  4RGX A;  4OIO F;  3J81 K;  2GZW A;  3CUO A;  1D8J A;  3S2W A;  5E17 F;  2M87 A;  4GXO A;  4XLN F;  5DD8 A;  1IXC A;  4KYW A;  2NS0 A;  4HYE A;  2BBY A;  3Q9S A;  4NQW A;  5LHH A;  5HS9 A;  1MKM A;  1IN4 A;  3ZMD A;  1G6N A;  1BBY A;  1KQ8 A;  4UXN A;  3HRT A;  5JI6 A;  3IWF A;  2O8X A;  2FBH A;  2WWY A;  1BIB A;  1Y0U A;  1R23 A;  3O2P E;  4D0P A;  4H0E A;  4G6D A;  3P7N A;  2WV0 A;  3EUH A;  3L9F A;  3ISP A;  1IN8 A;  2MBF A;  3BOQ A;  3RYP A;  5HLI A;  1XGM A;  2RN7 A;  3VOE A;  2Z99 A;  2E7W A;  4LMY A;  1S7A A;  4G7Z F;  2DBB A;  1OPC A;  5LRS A;  3DP7 A;  4Q47 A;  4UV9 A;  4Q5S F;  4MEY F;  3E97 A;  3BPV A;  5HLG A;  2LKP A;  4LJZ F;  1U5T C;  3KP5 A;  3PQJ A;  3FM3 A;  1B9N A;  2PEX A;  2L4A A;  1U3E M;  5LEK A;  4Y17 A;  4HV6 A;  1ZAR A;  3I58 A;  1XSV A;  2BEO A;  1F4K A;  3F8B A;  1ON1 A;  1OYY A;  2LNB A;  2K86 A;  2YPR A;  3F23 A;  2WTE A;  2G7H A;  2X4H A;  1XSX A;  4UV8 A;  3IRQ A;  1YTY A;  1SD4 A;  1MDM A;  2F2E A;  2KIM A;  5K5O A;  1T38 A;  1Q1H A;  3TKY A;  2D1H A;  5L3C A;  1TW3 A;  2NNN A;  3BY6 A;  4O5V A;  3BJO A;  4A0X A;  5FD5 A;  4LLG F;  1HQC A;  3GZ5 A;  1ZRD A;  5HOO A;  5L3B A;  2JPC A;  1IXS B;  3JSO A;  2P5V A;  1ONV A;  4BQA A;  1G3S A;  5DYM A;  5JFR A;  1EH8 A;  4YII A;  4M6X A;  2STT A;  4PGG A;  4HQM A;  2AXL A;  4KIB A;  3HSE A;  1FBS A;  1HST A;  4EVI A;  2EFN A;  2QQ9 A;  1P2F A;  3E5Q A;  2OZU A;  4IRI A;  5D5V B;  3CJN A;  1ZHF A;  3T0Y A;  1QQI A;  1GHC A;  4UVB A;  3TOA A;  2STW A;  4WK8 F;  1OMI A;  3CUQ B;  4LGW A;  3COA C;  5D5U B;  2A3S A;  3WTV C;  4L9T A;  2GAU A;  2FA5 A;  3VB2 A;  2RGV A;  1WI9 A;  4UUV A;  3JAM Z;  1Z6T A;  4E70 A;  1OYI A;  5CLS A;  2A6E F;  3LST A;  1YIO A;  3IL2 A;  4LG0 A;  3E6C C;  4M73 A;  4QWQ A;  2KJC A;  1UB9 A;  3ZMS A;  4EJU A;  2IJL A;  1DP7 P;  2QEN A;  2KIF A;  2PG4 A;  5ICC A;  3D0S A;  2CO5 A;  2HTS A;  4EM0 B;  2OA4 A;  2IA0 A;  2HDC A;  1KYW A;  2JTV A;  3FXQ A;  1ULY A;  4BAY A;  4CHU A;  3MZY A;  2IW5 A;  3FX3 A;  3J81 Z;  2DTR A;  3EDP A;  5DCM B;  4KMF A;  1FSH A;  3MAJ A;  1HW1 A;  5EEH A;  2CGP A;  4IPA A;  2M8E A;  2QWW A;  5L3D A;  2IA2 A;  2CFX A;  5H6R A;  3O6B B;  1BJA A;  4KA4 A;  2UXX A;  4EJO A;  3FHZ A;  2YU3 A;  1I6X A;  3KZZ A;  4BXU A;  3DFG A;  2FSW A;  1LB2 A;  2XIG A;  1S6L A;  1W7P D;  1RZ4 A;  2Q2E A;  2HTJ A;  2XRN A;  5BPD A;  3KP4 A;  3WGI A;  3WU1 B;  3RI4 A;  2YX4 A;  1T98 A;  4OIQ F;  2JPB A;  3RKX A;  4M9Z A;  2VC0 A;  4GYI A;  3R0A A;  1MZB A;  4U7D A;  5J6X A;  4RB1 A;  5E20 A;  4GCV A;  5F64 A;  1D8K A;  2EJR A;  2KJB A;  2V1U A;  1XD7 A;  2BYV E;  1DPU A;  3WE3 A;  5CVJ A;  3IKV A;  2YX7 A;  2R7F A;  5K5Q A;  3ABU A;  2FE3 A;  3KFW X;  1TLH B;  1ON2 A;  3SZT A;  2G9W A;  2ZNY A;  4R8H A;  1J7K A;  3GX4 X;  2HZT A;  3P9C A;  3HOT A;  2FNP A;  5LLQ A;  1AWC A;  3ZN0 A;  2MH9 A;  2HQR A;  1P6R A;  4EM1 A;  1E2X A;  4ESF A;  2V9V A;  3I54 A;  3PQK A;  2PLY A;  2XVC A;  4HF2 A;  4XSZ F;  1BI0 A;  3ABT A;  2YR2 A;  4F7Z A;  4EJT A;  2PJP A;  3ZN1 A;  1SD7 A;  1RNL A;  2VOO A;  1TBX A;  2VC1 A;  1B1B A;  1KGS A;  4PGH A;  4N0B A;  1LEB A;  4RGR A;  2H27 A;  1HW2 A;  4CZZ A;  1R00 A;  3V7S A;  3N4M A;  3GO5 A;  4L5I A;  1R5H A;  3TDU C;  1B6A A;  2QQB A;  3K1P A;  4BNC A;  1IW7 F;  4BYY A;  3RKY A;  2Y75 A;  3QRF F;  2EV0 A;  1HKQ A;  5HDN A;  2JT1 A;  4ASN A;  3K1N A;  4Q4Z F;  3LQQ A;  3I59 B;  1QO0 D;  1J2X A;  1EV7 A;  1FLI A;  4LB5 A;  5J8F A;  1UFM A;  1Z1D A;  4P5O A;  2EK5 A;  2EA4 A;  2ZME A;  3HHH A;  1REP C;  3I71 A;  1ODD A;  2L54 A;  2HR3 A;  5IT3 A;  3RPU A;  4B09 A;  4HDV A;  1O7L A;  3WTW C;  2E1N A;  4OIR F;  2OZ6 A;  2QYO A;  1LDD A;  5FLX K;  3ZMZ A;  1ZG3 A;  2HKX A;  4GO1 A;  4OIP F;  3LAP A;  2FRH A;  4K2E A;  4L0Z B;  3JAM K;  2CW0 F;  3TO9 A;  3U9G A;  1EH7 A;  3L7W A;  4A6D A;  2QBY B;  1PUE E;  1XMK A;  2QUF A;  5DV5 A;  2H09 A;  2XAF A;  2FNA A;  5F6F A;  4OMY A;  1ZGA A;  3K9T A;  2H6B A;  3WTU C;  2EV6 A;  1SAX A;  4OU0 A;  2QM3 A;  3EYY A;  4WWC A;  3K69 A;  2O6G E;  1MDM B;  1KU9 A;  1R7J A;  4ESJ A;  2MC3 A;  1FYM A;  2A6H F;  1ZGJ A;  3F3X A;  3B73 A;  5LRR A;  3TDZ C;  5A2Q K;  4U0V A;  2IPQ X;  1SD6 A;  2O3F A;  2COM A;  3E3V A;  2O61 A;  4RS8 A;  1YLF A;  3MCZ A;  3FXU A;  2HGC A;  4HV5 A;  3V8K A;  1YW7 A;  5LGU A;  3V8J A; 
#chains in the Genus database with same CATH topology
 1N77 A;  4XK4 A;  1XB4 A;  1HXD A;  1IF1 A;  4U88 A;  4CYC A;  2UXN A;  1W4M A;  4NC7 A;  1K78 B;  2PBI A;  2OUM A;  4LD5 A;  1FYK A;  4L9N A;  4XKB A;  5J4Y A;  2DDB A;  2WAF A;  3DPT A;  3HUG A;  2YUS A;  4BJ6 C;  3LL7 A;  3H0D A;  4EQQ A;  3SXY A;  3GLX A;  4BHB A;  3WTS C;  2QVO A;  2EBI A;  5CVV A;  1VQ6 I;  2VQC A;  4XLP F;  3F8N A;  1CF7 A;  3ZQI A;  3NEU A;  1ZK8 A;  4IKF A;  1HW5 A;  3Q9V A;  1R5I D;  3TED A;  3F22 A;  3KYC B;  3KPH A;  3BTI A;  2R4G A;  3CCQ I;  1Y8Q B;  1VQ4 I;  4ENN A;  2JN6 A;  3HGG A;  4DOZ A;  3O8G A;  2CYY A;  3SYT A;  4JOM A;  3HIF A;  5IP9 J;  4HEA 2;  4A12 A;  5LD2 C;  3PNV A;  4RA2 A;  1K6O A;  3P9I A;  1JUP A;  4PSW A;  2X1D A;  4JBA A;  4PCQ A;  4XIC A;  3DF8 A;  3FZV A;  2IEK A;  4HF0 A;  3LAJ A;  2VPR A;  3PIO F;  5KVR A;  1LDJ A;  3KIO A;  4PDK A;  4CCJ A;  5AON A;  4KMU X;  1VI0 A;  1D0Z A;  1J5Y A;  5D6E A;  2E1C A;  4XKC A;  1L3L A;  2R7X A;  1MJA A;  1S7E A;  3QU3 A;  2F4M B;  2K4B A;  2K9S A;  2ZB9 A;  1B8I A;  1AA7 A;  2K7L A;  2VKV A;  3OYJ A;  1IUY A;  5L3F A;  4O6J A;  4S04 A;  3IV5 A;  1W1W E;  1YJN I;  4QIW N;  2IP2 A;  4XLF A;  1GXQ A;  3R61 A;  1HSJ A;  3DEE A;  1KQ9 A;  2X6O A;  2Y0M A;  1X2M A;  5GP9 A;  1GXP A;  1EF4 A;  1XX5 A;  4IZZ A;  1VQ7 I;  1VQP I;  2HI3 A;  1XGS A;  3HG9 A;  4CSW A;  1I1G A;  4KT5 C;  4A3M J;  2BGC A;  3JRE A;  4P55 A;  1QA6 A;  3A0H C;  1QHG A;  4HNT A;  2ISZ A;  2XHK A;  3OYG A;  1N75 A;  3T8T A;  2FOK A;  3TMO A;  4Z2Y A;  3RQI A;  3K6G A;  2R92 J;  4M6Y A;  4X1E A;  4UVC A;  2VLA A;  3G3Z A;  3AAF A;  3QAH A;  4YG2 F;  3RDI A;  1X3Z B;  4LB6 B;  2JSC A;  4RB3 C;  1P4W A;  1FNN A;  1VZ0 A;  2EZK A;  1IDY A;  1U5T B;  2KZV A;  2HXO A;  4A2U A;  5GAE J;  1FOY A;  2O8K A;  3LSI A;  1QRY A;  3OMY A;  2X85 A;  2KP6 A;  1R4M B;  3C18 A;  3KZY A;  4FHT A;  4ETS A;  2FBI A;  4FCY A;  1K83 J;  3BCA A;  4UVA A;  3TO6 A;  4G7H F;  1QGP A;  2HQN A;  2O03 A;  4XR6 A;  3K70 C;  1ETW A;  1D1C A;  3WU2 C;  1R1U A;  5E8G A;  4P9U A;  1J09 A;  3E1S A;  4U0Y A;  1S8N A;  3ZQF A;  4YRV A;  2GM4 A;  1OLT A;  2L7Z A;  3FMQ A;  2GQQ A;  2LFB A;  3H9Q A;  5EG0 A;  2WAD A;  3D5R C;  1OR7 A;  1S7O A;  4B43 A;  1QNT A;  5H6Q A;  3JR9 A;  4M74 A;  4IF4 A;  4UNO A;  3S1N J;  4E7H A;  5GAH J;  1R4N B;  2XGE A;  3HKZ N;  4BY7 J;  1TC3 C;  1IRZ A;  1Y1V J;  4FT8 A;  1MD0 A;  2BVM A;  3M8F A;  3WOD F;  3Q0W A;  3KE2 A;  1JHF A;  3NRV A;  5LFA A;  1F36 A;  2A5W A;  4ZTJ A;  4XID A;  2OCE A;  4OOI A;  3QOD A;  4UUS A;  3Q3S A;  3GTQ J;  2Q2E B;  1WH7 A;  4AD9 A;  3GLL A;  1X1B A;  3JSP A;  3A1Y A;  4AM3 A;  3C7J A;  4CCK A;  1BI3 A;  3CZ6 A;  3LA3 A;  3ABL H;  1VQM I;  4F92 B;  1TTY A;  5J8C A;  1NK2 P;  1NG6 A;  5D5W B;  4NHJ A;  4I0B A;  3ROU A;  2MAB A;  1CQT A;  4WXH A;  2MA3 A;  3LSG A;  4M9S A;  2XF7 A;  2CUZ A;  4DYC A;  1ETY A;  2JRM A;  5FKM A;  3BZ6 A;  1GV2 A;  4RGS A;  4B44 A;  2ZSH B;  3ZMV A;  4AVZ A;  2DAO A;  1ZR4 A;  3GTO J;  1TWH J;  2A68 F;  1RUN A;  5LHI A;  3OYB A;  3IH4 A;  4G6T B;  3AG2 H;  2D1V A;  1U0J A;  1A36 A;  2R7S A;  2XGD A;  5HOD A;  5FLX Z;  1OCP A;  1LE8 B;  1D5V A;  1MBG A;  4II2 A;  5JHF A;  4PJ0 C;  2Z33 A;  5BMZ A;  2NRA C;  2Z16 A;  2HQ5 A;  4N9H A;  4J19 A;  2V4J C;  2L7K A;  4KT6 A;  2XAQ A;  4LFU A;  4YIF A;  2GXB A;  3GFM A;  1HCR A;  2VKE A;  4J01 A;  2R7D A;  1EA3 A;  1RES A;  5FLV A;  2A07 F;  3DTE A;  2F5F A;  3TP3 A;  2ESN A;  3EUK L;  1AHD P;  4HW0 A;  2ZFW A;  5FO5 A;  2VON A;  1XDU A;  3FXO A;  3RIR A;  3P5J A;  3CLO A;  5KK1 A;  4IL6 C;  1ZYR F;  1LEA A;  1K7A A;  2Y69 H;  3CO6 C;  3HZJ A;  5HDK A;  1LFU P;  3K10 A;  1W5S A;  1DU6 A;  1D3Y A;  2VN2 A;  2GLO A;  4GRI A;  1IN6 A;  1XCV A;  4ON0 A;  2LD5 A;  2VJI A;  1Y0N A;  2CJJ A;  4IVN A;  4XRS G;  1V3F A;  2KRC A;  3E6B A;  1SC7 A;  4OAZ A;  4WX9 A;  2RC4 A;  2BVL A;  3GFL A;  3ZRG A;  4BH9 A;  3JRH A;  5L3E A;  3H92 A;  3GXO A;  3MQ0 A;  2KIU A;  1RC9 A;  3H3V K;  4I01 A;  1OKR A;  3L1P A;  2Y48 A;  2BE5 F;  4HOB A;  4MO7 A;  3MD2 A;  1H88 C;  3L09 A;  4CA0 A;  1GVD A;  4EM2 A;  2V6C A;  5GPA A;  4UB6 C;  2DYS H;  4BAC A;  3L2C A;  3HDD A;  3ZPL A;  2JA6 J;  5E1X A;  1R58 A;  3OOU A;  1WWX A;  2W85 A;  2ETH A;  3NQO A;  1BR1 A;  1IZ1 A;  1LUJ B;  5A2Q Z;  3J80 Z;  3AFH A;  4B4C A;  1U78 A;  1YX3 A;  4PSX A;  3LQR A;  2KDZ A;  1FMV A;  1ZN2 A;  4ZC3 A;  2V26 A;  1W7P A;  2ZFU A;  1RRJ A;  1YW8 A;  3FDY A;  3JRB A;  4CIC A;  3S15 J;  4PFP A;  3H0G J;  3HTU A;  5F1J A;  3G1L A;  4RB2 C;  5TRD A;  2P6S A;  3OS0 A;  4I98 B;  4A3I J;  1WRJ A;  1QBJ A;  3GZN B;  2P7V B;  3RSN A;  2R5Z A;  1A31 A;  4KN7 X;  1U2W A;  4WCG A;  5FFX A;  4GYG A;  2IT0 A;  4H4K C;  2OBP A;  4EJV A;  3JTG A;  1B4A A;  3CP8 A;  2E7X A;  4I99 C;  4HX8 A;  2DFE A;  1WGX A;  2IGM A;  1O3S A;  1M1E B;  2JZY A;  3MEX A;  3RQ4 A;  4A3B J;  4JX4 A;  1DUX C;  1W36 D;  2K9L A;  4AIK A;  2P8T A;  2O0Y A;  4A5N A;  4EAT A;  2VE8 A;  3WG9 A;  3V42 A;  1NTC A;  1FZP B;  3HXL A;  3DBH B;  5D6F A;  5ICE A;  2MH2 A;  1H0M A;  2EIL H;  5EZG A;  3B6A A;  5KCM A;  1Z21 A;  1RUO A;  4I7H A;  2ZME B;  1H9T A;  2VOD A;  1UST A;  5E3O A;  5D4S A;  1KU3 A;  2XB5 A;  4V19 K;  2JUC A;  4MTE A;  1SAU A;  4L9J A;  3E6D A;  4ZDO A;  5CYV A;  4X6A J;  3K7A J;  4HBL A;  5CVR A;  4QLC U;  3AG3 H;  3UR3 C;  3CCY A;  2XAU A;  4IJA A;  1XN7 A;  2MW8 A;  3QOP A;  1MNM C;  2LF8 A;  1SVM A;  2GXG A;  2YS9 A;  1PP7 U;  4BHP A;  3K70 D;  1Z3X A;  2L4M A;  4IXA A;  4R79 A;  5EYR A;  2LKS A;  3LA7 A;  2V9P A;  3BTL A;  2PMU A;  5IP7 J;  2XC7 A;  3ONQ A;  1XTA A;  1WSU A;  2LDU A;  2NVU B;  1JGG A;  1YG2 A;  4XOR A;  2X6W A;  2VBX A;  2M4K A;  1YS7 A;  1AOY A;  5EEA A;  4L5J A;  4BQQ A;  3TW6 A;  3VYS B;  2DFH A;  2O7O A;  1P4A A;  3T8R A;  4HLX A;  3W6J B;  2VXZ A;  5GAD J;  2JQ7 A;  2J5O A;  2W84 A;  1UCR A;  3EPZ A;  3M9A A;  3QPH A;  3BR3 A;  4M3F A;  4M9X A;  2WAQ N;  4P96 A;  5EDN A;  3BG7 A;  3KET A;  2ZNZ A;  1KA8 A;  3A03 A;  3M7G A;  3HPG A;  2NXN B;  3CC7 I;  2BW3 B;  3OYL A;  1XPX A;  4OAY A;  4TV7 A;  2K9Q A;  2FMY A;  1BI1 A;  2DFI A;  1WQ2 A;  3WGH A;  2L02 A;  2P5K A;  3JRG A;  1POG A;  3ZP5 A;  1IO2 A;  1QZZ A;  2VQH A;  1O57 A;  1PVE A;  3V7C A;  2MC4 A;  1IN5 A;  1SFX A;  3LMM A;  4ANJ A;  4RGU A;  3KCC A;  1AU7 A;  2HWV A;  2ZO4 A;  1APL C;  4PZJ A;  4MEX F;  3BWG A;  4HST A;  2QLZ A;  2O9L A;  4LIU A;  3CME I;  1YRN A;  3RPQ A;  2LMD A;  2Z3Y A;  5CKT A;  2EQR A;  1JE8 A;  3HHG A;  1ETQ A;  4JQF A;  3HRU A;  3UNG C;  3FBI B;  4G94 A;  1RET A;  2DOA A;  2UUZ A;  2VJJ A;  3PFI A;  5J1U A;  4HLY A;  3S3O A;  3M07 A;  2L9N A;  4BHC A;  1Z91 A;  5EEG A;  3ELK A;  4C3H J;  3CO7 C;  3TQN A;  5ICG A;  1Z0X A;  1T56 A;  3OYM A;  4L18 B;  2NAZ A;  1T39 A;  3SHF A;  4EMS A;  1RKW A;  4M3B A;  2DOF A;  1FC3 A;  3GFJ A;  2MSY A;  1MW7 A;  2OV7 A;  3O3K A;  5DUK A;  1R71 A;  4CYD A;  2EB7 A;  4AWX B;  1E3O C;  3HB9 A;  4XLH A;  1P4X A;  2HEO A;  3RKQ A;  4KIS A;  2B63 J;  3HOU J;  2CQK A;  3X2Q H;  3CD6 I;  4DIQ A;  5FJ8 J;  5DCM A;  3DPL C;  4NQW B;  6PAX A;  2L3D A;  4XLE A;  1ETV A;  2DO7 A;  2R7T A;  3H3U A;  1WFX A;  2A6T A;  4CDG A;  3CCR I;  1MJ9 A;  3DWL E;  3CCL I;  2K3F A;  3V7R A;  2GA1 A;  2IAI A;  2XKO A;  3R6S A;  5DUI A;  2H94 A;  2DA1 A;  1TQI A;  1ZTR A;  3K2A A;  1WH5 A;  3KLO A;  1ZQ3 P;  2DOD A;  3BJ6 A;  3HUG B;  3Q0U A;  4I02 A;  4XSX F;  1H9G A;  2IS2 A;  3CDL A;  2VIX A;  2ZKZ A;  4CXF A;  1BR4 A;  5LHG A;  3WTY C;  3QWL A;  1CF7 B;  3DTI A;  3JRC A;  1UAA A;  2D45 A;  5HS7 A;  1V5G A;  2IS1 A;  4KDP A;  3OYK A;  1XGN A;  3K4B A;  3QPT A;  4LOC A;  1OYW A;  1USS A;  3A4C A;  2VBZ A;  3MKZ A;  3SDB A;  4IO9 F;  4BDY A;  2ELK A;  3BJA A;  3EUA A;  5E3N A;  2L9R A;  2KZG A;  1IRF A;  2CWE A;  3HC7 A;  1OCZ H;  2KRH A;  5GTI C;  1WJA A;  2VL8 A;  4YEL A;  5LBQ A;  1JHH A;  1QVU A;  2M7A A;  2FU4 A;  1VQK I;  4N9I A;  4KNY A;  2DMN A;  2XUB A;  4RAY A;  2KFD A;  5IYC J;  3ECH A;  1OIS A;  4I2O A;  3OYH A;  2Y0S A;  1FSE A;  4I09 A;  3PJR A;  4IQ4 A;  4L5E A;  1FTT A;  3GEZ A;  4DNC A;  1GVJ A;  3KP6 A;  4XON A;  1MSF C;  1SFU A;  1F9N A;  2R0Q C;  3HOV J;  3K4L A;  2IVM A;  5TGT A;  1B8I B;  2XAG A;  1VQ8 I;  1KZH A;  3QYB A;  1K4T A;  1TZL A;  2R5Y B;  1I50 J;  3E6M A;  4I6Z A;  1FYL A;  3OYC A;  1TWF J;  4IHX A;  3W2V A;  2M34 A;  1SMT A;  2ZXW H;  1JUM A;  4QPQ A;  1W5C C;  3S1Q J;  4D7M A;  2EFP A;  2QKM B;  3ECO A;  3HJE A;  4BU2 A;  1TQM A;  3KEQ A;  1HC8 A;  5LGT A;  4F93 B;  1IN7 A;  4G9Y A;  1H89 C;  3QP6 A;  2VBY A;  3N97 A;  4XQF A;  2XAJ A;  2K4J A;  3H5R A;  3F6V A;  1X4O A;  3MMY B;  2HYJ A;  4B3A A;  2CV2 A;  2V1D A;  1ZG5 A;  3CCE I;  2A61 A;  3KP3 A;  3T1B A;  3BG6 A;  3OYN A;  4UY8 I;  5DEQ A;  3ZMU A;  2HOE A;  5K7F A;  5IOY A;  1IXR C;  3AG4 H;  1NHA A;  2EFQ A;  5LEJ A;  1TT5 B;  2B7E A;  3U1D A;  1IUF A;  3ASO H;  2VT3 A;  1YYV A;  2FQ3 A;  4W1U A;  2CFO A;  2E1M B;  4BE1 A;  3VWB A;  4A3L J;  3G73 A;  2LY2 A;  2ELJ A;  3BG3 A;  3F8C A;  4A6E A;  4Y15 A;  1U8R A;  2F5C A;  4A0Z A;  3H36 A;  4HDU A;  3HL2 A;  1TW2 A;  3CF2 A;  1OR7 C;  1I1S A;  3J7A Y;  4PJM A;  1ZG1 A;  4JYK A;  1MMN A;  3VOD A;  4G6Q A;  3PO3 J;  3J80 K;  1KQ0 A;  2JVH A;  2XGX A;  4L9V A;  5F1R A;  3HOS A;  1BA5 A;  5BS6 A;  1VFC A;  2DXI A;  4Y33 A;  2V1X A;  4S0H B;  2N8G A;  2HYG D;  3PFY A;  1ZLK A;  3QPL A;  3AL0 C;  4AID A;  2HU9 A;  4ZZL A;  1FTZ A;  4XN0 A;  5CVU A;  1ZR2 A;  2JRT A;  3CJR B;  2BY2 A;  2NYX A;  2DK5 A;  3LFK A;  4ENM A;  2MD0 A;  2K27 A;  2X1E A;  3HSR A;  1PJR A;  2EFW A;  3CDH A;  5D4R A;  2LSO A;  2FBK A;  3QYE A;  3ERE D;  1OCT C;  1LNW A;  3FF5 A;  4KIC A;  2OAZ A;  3F8M A;  3OY9 A;  1FY7 A;  2ECC A;  1MND A;  2OCC H;  2IGO A;  1DGW Y;  2ZJR F;  1X4P A;  3BG9 A;  1BC8 C;  5E18 F;  2PJR A;  1JXS A;  3BTC A;  2VKD A;  3F72 A;  3Q5F A;  1B72 B;  3KEO A;  3P9K A;  4RLQ A;  1JJ8 C;  5C4X J;  2DYR H;  2ZJ2 A;  1ZLJ A;  2X51 A;  3GFI A;  4IHS A;  2L2O A;  3RYR A;  1R1V A;  1S5L C;  2LG4 A;  3I59 A;  5FD6 A;  2FX0 A;  4F91 B;  4XRF A;  1R5G A;  2V79 A;  3REO A;  3S2H J;  4ENJ A;  2DT5 A;  2HFH A;  3QYF A;  1W0T A;  3L2V A;  2CW8 A;  4ZZD A;  2AQF A;  3PNY A;  2VT2 A;  3IWZ A;  1UG0 A;  1MMG A;  3S1R J;  1WI3 A;  4N4N B;  2RKH A;  1PYV A;  1K79 A;  3CMA I;  5HVQ C;  2IA1 A;  2DPD A;  1IRX A;  3OOP A;  3V4G A;  3LNQ A;  4GGG A;  1OCO H;  3CQZ J;  1L0O C;  3DCF A;  1O3Q A;  4M71 A;  4BEH A;  5E3M A;  3F21 A;  1B59 A;  2A69 F;  1KYZ A;  4JP0 A;  4A3G J;  1WKM A;  4UHT A;  3KP2 A;  4LK0 F;  3SZP A;  4FX0 A;  2DMP A;  2DQR A;  2OQR A;  4NBQ A;  4ITV A;  4D1Q A;  1UJ8 A;  2DLL A;  1G4D A;  3RKW A;  2OTL I;  3BR2 A;  1XG1 A;  2VQL A;  3HSF A;  4GDF A;  1K4S A;  1HKS A;  2MGQ A;  2DDA A;  1BR2 A;  3DEU A;  2Z9O A;  5IOZ A;  4IRG A;  1V55 H;  3M1E A;  4OMZ A;  1WJE A;  4WXD A;  4LG0 B;  1MGT A;  1FOX A;  2M0C A;  3FMR A;  3WTT C;  3B6C A;  3PUB A;  1FBU A;  1E17 A;  3GW2 A;  2Y2Z A;  1DGR M;  3C2B A;  3RJP A;  3DV8 A;  1U6G A;  3GWZ A;  3I5U A;  3LSM A;  1Z77 A;  3C1D A;  1W36 C;  3F6O A;  3FK6 A;  3U2R A;  2Z1D A;  3IUO A;  4ENK A;  4IX7 A;  1TNS A;  2ZJP F;  1R6R A;  4AU7 A;  3H9J A;  4BUP A;  2XKP A;  3K4K A;  3S3M A;  2YU9 J;  2KKO A;  3R0J A;  3TGN A;  5HNF A;  1VTN C;  2QBY A;  3S3N A;  4BBS J;  1D1A A;  4XOT A;  4I0A A;  4JX6 A;  2IRF G;  1TT0 A;  2PMZ N;  3I55 I;  4LLN A;  4DW6 A;  3RCO A;  4IRH A;  4A0Y A;  2ZBK A;  4MHG A;  5JHU A;  4M3D A;  5DDG A;  4BXX J;  3QU6 A;  3WE2 A;  3CP2 A;  4A3D J;  4G12 A;  3VEP A;  1OFC X;  5E1W A;  1A6Q A;  5B3S H;  1W7P B;  5CVI A;  5JLW A;  4MIM A;  3ZQL A;  1ZRE A;  3OYE A;  3R60 A;  1E0E A;  5HDG A;  2E1O A;  3UKG A;  2UZK A;  1XDS A;  3EQL F;  4A69 C;  2PQ8 A;  2ELH A;  4ZDL A;  1ACI A;  1LQ1 A;  4O3M A;  3JRA A;  2GOM A;  1BC7 C;  3A02 A;  1T8I A;  2VPL A;  4M3G A;  4Y4R A;  4AIH A;  5IYD J;  3I4M J;  5F08 A;  4XMY A;  3E5X A;  2HXI A;  3CTA A;  5D5X B;  1N25 A;  3GYH X;  2LY1 A;  1D0Y A;  4DYQ A;  3ZCO A;  1R49 A;  1LVA A;  1YS6 A;  2OC6 A;  2K3P A;  4Q48 A;  5K1Y A;  3TOB A;  1YW9 A;  3OYD A;  4FET A;  1G3Y A;  3BC8 A;  1BM9 A;  3MZH A;  1UHM A;  1QVT A;  1IG7 A;  4XL9 A;  2Y31 A;  2DA4 A;  1J59 A;  3DBL B;  2WB1 N;  4ZYG A;  1JKR C;  2Z5U A;  5D8K B;  2W00 A;  1K78 A;  9ANT A;  1HKT A;  1G2H A;  5F0C A;  1R36 A;  2DW4 A;  2WAE A;  3RTR A;  3I4P A;  3GZ6 A;  4RM2 A;  4WXC A;  2DA5 A;  1A04 A;  3JCU C;  3HOZ J;  4BE0 A;  3IC7 A;  4MNU A;  4CZC A;  1W0U A;  2P0W A;  4CCM A;  2RQP A;  1YE9 A;  5B1A H;  4HF1 A;  1FX7 A;  1TQP A;  2GOX B;  3MWM A;  2VB6 A;  3CUQ C;  4BS9 A;  3BT9 A;  2P7C B;  4HAM A;  3JRD A;  2X1C A;  3HRS A;  4AYB N;  2ID6 A;  2L01 A;  3S16 J;  4Y3O A;  3I0T A;  4DGW B;  2VJ4 A;  2YSR A;  3SDG A;  5J47 A;  1E3P A;  1ZH5 A;  2LR8 A;  1X1A A;  2XAH A;  1UEL B;  3S32 A;  5DD4 A;  2PN6 A;  3C3W A;  4JK1 X;  1ZRF A;  2R93 J;  4XBF A;  2Q8K A;  5DCF A;  1U9O A;  2CSO A;  3LSK A;  2LY9 A;  1YO5 C;  1T95 A;  2QQ8 A;  3HGY A;  5KAF C;  5E1Z B;  2W25 A;  2DQL A;  3L2Q A;  1B9M A;  2M8G X;  2EPF A;  1GDT A;  2EA2 A;  4RAG A;  5LGN A;  3GUD A;  2MD5 A;  1Y39 A;  2W7N A;  2RVC A;  3WTX C;  1T0F C;  5ILV A;  1FOW A;  1OCR H;  3B02 A;  3CJT B;  2ZC2 A;  3DU5 A;  1J0R A;  4NB5 A;  2W24 A;  1R1T A;  2CUJ A;  3H5N A;  1PDN C;  3D1N I;  2P5L C;  1A35 A;  1EJ9 A;  5F04 A;  3K1M A;  1RKT A;  3JTH A;  3PM1 A;  2JUG A;  2MG4 A;  5F0F A;  1FOK A;  1LFB A;  5E8I A;  5FGM A;  2DK8 A;  1Y6I A;  1BI2 A;  2DT6 A;  5FFZ A;  4KN4 X;  4EJW A;  4RMN A;  2FOW A;  4IHW A;  3I9V 2;  5ED4 A;  5IT9 K;  3SFZ A;  2AHQ A;  2COB A;  2M5W A;  4DJA A;  2EWN A;  3VSL A;  1HDP A;  2MLG A;  2E5Z A;  4NC6 A;  3NWT A;  5CQG A;  3CCM I;  1SAN A;  2RV8 A;  1FP1 D;  1S9H A;  3BP8 A;  2AS5 F;  3OIO A;  2F5D A;  1O7F A;  2CQ7 A;  4IHY A;  2DI3 A;  1W5T A;  5J40 A;  3W6K B;  3IKT A;  4IHT A;  2BXY A;  3L2U A;  3ML6 A;  5FB2 A;  1FPQ A;  4RB0 A;  2M30 A;  3KX2 A;  1P92 A;  1IRG A;  2HVQ A;  4A3K J;  3H35 A;  3ZQ7 A;  1U5T A;  3HYI A;  2K85 A;  2QSH X;  2VQG A;  3D5L A;  3LSP A;  4AVP A;  4MQ9 F;  4OWR B;  1SFE A;  2E2I J;  5FKO A;  3HTS B;  2D5V A;  2UWM A;  1TWA J;  1F1Z A;  1OJL A;  4IOC F;  2M9H A;  4F55 A;  1MBE A;  2V6E A;  1MMA A;  4ABZ A;  3FWE A;  3OR2 C;  5HS8 A;  1BOA A;  3BCB A;  3JRF A;  3FXL A;  4EGZ A;  4ESB A;  2VOP A;  3BPX A;  4DQ2 A;  4XN3 A;  2ZCW A;  2JVG A;  3PIP F;  2E35 A;  3ULQ B;  2E71 A;  4KUM A;  2CG4 A;  3MFK A;  4DBR A;  2LBF B;  4ZYE A;  1VF9 A;  1G8X A;  3H3Z A;  2QZ8 A;  4KIG A;  4D5C A;  3HKZ A;  1P7I A;  4G7O F;  3CC2 I;  1MMD A;  4AIJ A;  5DTD A;  4R1H A;  1XSD A;  3BRO A;  2EIN H;  3I3L A;  4Y13 A;  2DJN A;  2L7M P;  1YIJ I;  2FF4 A;  2QQA A;  2LK2 A;  2M0M A;  3GF2 A;  4OIN F;  1T2K A;  3K2Z A;  3DU6 A;  4AUX A;  5K5R A;  3ZGK A;  2XRO A;  2CV1 A;  4KJZ A;  2DA7 A;  2P6T A;  1K6Y A;  3OIQ A;  2FML A;  2DA6 A;  4B8X A;  1XGO A;  1QHH D;  4J00 A;  1G3W A;  5H20 A;  2IS6 A;  1XMA A;  2KQR A;  2VI6 A;  4RAF A;  2A05 A;  3KP7 A;  1YHQ I;  1VQL I;  5BOX A;  2HS5 A;  4LK1 F;  1N78 A;  1STZ A;  3R4K A;  2BV6 A;  5JR3 A;  2AQE A;  5F0H A;  2RNJ A;  1PP8 F;  3HEF A;  5AIP A;  5HLH A;  2D2W A;  1SFO J;  3TP0 A;  3CCV I;  5ILU A;  2CW7 A;  1X3U A;  2DMU A;  2DMQ A;  1S3J A;  3NWS A;  1BJZ A;  4IEJ A;  2ME0 A;  5BQT A;  1KU2 A;  1HLV A;  1F43 A;  2WC2 A;  2ZXJ A;  1U9N A;  5CJ9 A;  2PI0 A;  1Z05 A;  1K61 A;  1RIO H;  1QPM A;  4LLL A;  2VE9 A;  2ADU A;  1DU0 A;  4YFN F;  2Q0O A;  5TJJ A;  2HOA A;  3V8L A;  2CS3 A;  1FT9 A;  1LFP A;  3OV8 A;  3J7A O;  2L9V A;  2FXA A;  3FMS A;  3CUQ A;  3BZC A;  2NNY A;  2CH0 A;  3FXM A;  4BJ5 C;  2ACJ A;  1YFH A;  2IGN A;  3IH3 A;  1WJF A;  2I5U A;  4XKW A;  1QZY A;  2RDP A;  2EZL A;  3BQY A;  3E5U A;  5JVT A;  4UUT A;  1T6S A;  2R3S A;  4P9F A;  1FP2 A;  1RR7 A;  5EGO B;  1PUF B;  4WF2 A;  5FKN A;  4U0W A;  1QPI A;  4M72 A;  1UMQ A;  4RAZ A;  1DDN A;  3L2W A;  4HQE A;  3W6V A;  1MJB A;  1V4R A;  5ERI A;  4E7Z A;  2M3A A;  2RRE A;  1O3R A;  2W57 A;  4MGR A;  5IPA A;  3A2K A;  1KU7 A;  5D8L B;  4U7B A;  2TDX A;  2KPM A;  3IHU A;  2MFZ A;  2JMW A;  4G8X A;  3LA2 A;  5M5X J;  3ZQC A;  2CU7 A;  2HZD A;  5ICF A;  4DZP A;  2VKH A;  1UZC A;  3FXK A;  1JKQ C;  3S14 J;  1HBX G;  2XPW A;  4KIF A;  4EGY A;  1T0F A;  2C6Y A;  1ETX A;  2NOJ B;  3LWF A;  5CQE A;  1U8B A;  4S05 A;  5M5W J;  4FE4 A;  1CGP A;  4CO8 A;  1J75 A;  2B9S A;  3JW4 A;  2BZT A;  2GIV A;  1SVO A;  3WU0 A;  4KFC A;  3FK7 A;  5HLT A;  1OQY A;  2LTP A;  1JT0 A;  2DPU A;  2ID3 A;  3GME A;  1Z9C A;  1SFK A;  1EKE A;  2LF7 A;  4RM3 A;  1S29 A;  5ILS A;  3CMM A;  3MVP A;  1YJ9 I;  2EFO A;  4E7K A;  2JA2 A;  1LKX A;  2A5Y B;  4YFK F;  2X0L A;  1HOM A;  2NS7 A;  4A5M A;  4XRM A;  3L00 A;  2WV1 A;  4U87 A;  2ESH A;  2R7Z J;  3H5A A;  4PFO A;  5GPC A;  1ZRC A;  4CYC B;  3L2R A;  3ZXS A;  3CJQ B;  1NH3 A;  4XNF A;  2PFB A;  3EYI A;  2F5E A;  3QOE A;  3BDD A;  4B1R A;  4A93 J;  2H6C A;  5AIQ A;  2PJR B;  4CGZ A;  2EV5 A;  3M8E A;  2F4O B;  2K02 A;  4ZYD A;  1Y8R B;  2KHM A;  5DM6 F;  1BN5 A;  3GTG J;  4D7N A;  1G3T A;  4EEF G;  1ZEL A;  4YFX F;  2FD5 A;  2XV4 S;  2HPI A;  1LDK B;  2P4W A;  4HZF A;  1WZ2 A;  1Y1W J;  1BIA A;  2I10 A;  2NVY J;  4E4H A;  2GIZ A;  3KYL A;  3GTK J;  3FHN A;  3PSF A;  1J9I A;  2M45 A;  2ISY A;  2PMH A;  2O5R A;  2Q1Z B;  1UHW A;  4C30 A;  1T08 B;  3KLN A;  1F5T A;  1EH6 A;  2HVS A;  3PO2 J;  4C2M J;  4HX4 A;  2L5Q A;  4PJL A;  5B66 C;  1I5Z A;  2GA2 A;  2OD5 A;  3F8F A;  3EUH C;  2KIQ A;  3BTJ A;  4MFD A;  3DXJ F;  2OU2 A;  2HOT A;  3IAS 2;  1Z6R A;  1ORK A;  2G7U A;  4QTR A;  3CCJ I;  2M1B A;  2Z2S B;  4HA8 A;  2ZXI A;  3WG7 H;  1C0W A;  3HRM A;  4C2T A;  2E36 A;  2GWR A;  1I39 A;  3DKW A;  1FMW A;  2DJI A;  1P9Q C;  1VND A;  2B0L A;  1X2N A;  2R7U A;  3OR1 C;  3DEW A;  1HDD C;  1FBQ A;  1JGS A;  2LRE A;  4BGD A;  3TO7 A;  5FKL A;  2W4S A;  3M4O J;  2EH3 A;  2OQG A;  2HDD A;  3S8P A;  3SQN A;  1QZE A;  2ZXH A;  3FXR A;  3K4C A;  3I56 I;  3VPR A;  1IAW A;  3OL4 A;  2E60 A;  1FIA A;  3A01 A;  3I64 A;  2WAQ A;  2HYF A;  3I53 A;  4DYR A;  4QPO A;  2F6C A;  3HBL A;  4ZYA A;  3W3C A;  4ZH4 F;  1MBH A;  2DU9 A;  2OTJ I;  3MKL A;  4MTD A;  3JRI A;  2HKO A;  1IDZ A;  2QCO A;  2CQQ A;  3E7L A;  4MQV A;  1LJ9 A;  3EET A;  3WTZ A;  2VXD A;  5IT9 Z;  1SD5 A;  1Q1V A;  1TNT A;  2J5P A;  2W82 A;  1YQA A;  2F5V A;  4Y52 J;  3RPU D;  1O3T A;  3DQV C;  1FWZ A;  3BLY A;  5L3G A;  1DPR A;  3SEZ A;  4A3E J;  3ABK H;  3VYU B;  1AKH A;  2GXA A;  2VBW A;  4FX4 A;  4ZYH A;  3K0L A;  4RDU A;  2BHY A;  3G71 I;  1V54 H;  3CDI A;  1IJW C;  4PUS A;  1V5F A;  1XCB A;  3QP5 A;  2XAS A;  2CQN A;  2FEZ A;  3GVA A;  5BPI A;  1BW6 A;  1Z7U A;  3ZMT A;  3GTJ J;  1RI7 A;  2MLK A;  3T5X A;  1JJ6 C;  3WGG A;  2DOE A;  2KRF A;  3QQA A;  4ZDP A;  4L0Y B;  4XM3 A;  1VQO I;  1R22 A;  1I27 A;  1SMY F;  4HX7 A;  1P7J A;  3FM5 A;  3ASN H;  4EV0 A;  3IRR A;  1ZAO A;  4RGX A;  5EG0 B;  4OIO F;  3J81 K;  2AO9 A;  2GZW A;  3CUO A;  4BE2 A;  2IXS A;  4LIT A;  4MLO A;  3GTP J;  3AG1 H;  2HQA A;  1D8J A;  4C9Y A;  1D5Y A;  3S2W A;  5E17 F;  2TCT A;  3M3Y J;  2M87 A;  4GXO A;  3C2H A;  4XLN F;  5DD8 A;  4N4O B;  3I4N J;  1IXC A;  5J4V A;  2BHZ A;  4KYW A;  2NS0 A;  4XRS A;  1WVR A;  3BR6 A;  2H8R A;  1WHU A;  4HYE A;  3AL0 B;  3LSH A;  2BBY A;  4PJJ A;  3Q9S A;  3WHC A;  4NQW A;  5LHH A;  2HPM A;  2BY1 A;  5HS9 A;  2CMP A;  4UUS B;  3OWT A;  3MKY B;  1NK3 P;  1MKM A;  1IN4 A;  5JLX A;  3ZMD A;  1G6N A;  3IH2 A;  1BBY A;  1KQ8 A;  2F48 A;  4B47 A;  3C2G A;  4UXN A;  4CUG A;  3HRT A;  5JI6 A;  2XSD C;  1JKP C;  1BL0 A;  1MIJ A;  2PX9 A;  3IWF A;  5FKK A;  5M3M J;  3Q0V A;  3DTK A;  4XOP A;  3OIP A;  2WY8 Q;  1D1B A;  2O8X A;  2FBH A;  2WWY A;  1BIB A;  4PJN A;  3E0J B;  2XPV A;  3K4M A;  1Y0U A;  1R23 A;  4YEJ A;  3O2P E;  3ZR8 X;  4D0P A;  3CC4 I;  4H0E A;  4G6D A;  3P7N A;  2WA0 A;  2HOS A;  2WV0 A;  3FKI J;  3SFI A;  3EUH A;  1FIP A;  3HOW J;  3L9F A;  3ISP A;  1IN8 A;  2MBF A;  5J1R A;  3J7Z I;  3PSI A;  3BR0 A;  3BOQ A;  3RYP A;  1HF0 A;  3S93 A;  2KLO A;  4C3I J;  5HLI A;  4V2F A;  1XGM A;  2RN7 A;  2KDO A;  2DTZ A;  2BXZ A;  2Z99 A;  2E7W A;  3VOE A;  2DCE A;  3VYT B;  2G0E A;  4E7L A;  2NVQ J;  2R5Y A;  2CUF A;  4LMY A;  1S7A A;  4G7Z F;  2DBB A;  1OPC A;  4M6V A;  4LG3 A;  5LRS A;  3DP7 A;  4Q47 A;  2V1N A;  4UV9 A;  4Q5S F;  4MEY F;  3E97 A;  2JA8 J;  1QU3 A;  3ERM A;  2E2J J;  2IS4 A;  3BPV A;  5HLG A;  2DN0 A;  2LKP A;  4BY1 J;  3WHB A;  4LJZ F;  1U5T C;  3KP5 A;  3HOY J;  3PQJ A;  4HG2 A;  3OYI A;  3FM3 A;  1B9N A;  2PEX A;  3G2B A;  2L4A A;  1ENH A;  1TL8 A;  1WCM J;  1U3E M;  4A3C J;  5LEK A;  4Y17 A;  3W2W A;  4HV6 A;  1MBK A;  2QSG X;  1ZAR A;  3I58 A;  1UG2 A;  2ME6 A;  5E79 C;  1XSV A;  2M4G A;  1MH3 A;  1JUS A;  2BEO A;  2KL4 A;  1F4K A;  1DQU A;  1JT6 A;  3BQZ A;  3F8B A;  1ZGW A;  2Y9Y A;  1ON1 A;  3CLQ A;  2R7V A;  1OYY A;  2LNB A;  2K86 A;  3MKW B;  5C44 J;  2KT0 A;  2V7F A;  2YPR A;  4I76 A;  3F23 A;  2WTE A;  1TP4 A;  1WJB A;  2QEX I;  2G7H A;  2CUE A;  5M3F J;  3AKZ A;  2X4H A;  1XSX A;  4UV8 A;  3IRQ A;  2JK3 A;  1YTY A;  1SD4 A;  2X48 A;  1MDM A;  2H1K A;  2R5Z B;  2F2E A;  3GCM A;  2KIM A;  5KAI C;  5K5O A;  1T38 A;  1BOB A;  4D9J A;  1Q1H A;  2P81 A;  3TKY A;  2D1H A;  3M8J A;  4UB8 C;  3CMY A;  1RR8 C;  3BG5 A;  5L3C A;  1TW3 A;  1A6I A;  3MN2 A;  2NNN A;  2E2H J;  3BY6 A;  4A3F J;  2JA7 J;  2UV1 A;  1VQN I;  4IOA F;  1IV6 A;  5CPR B;  3DLA A;  4O5V A;  3BJO A;  3DKX A;  4A0X A;  3SZG A;  2X6Y A;  2EZH A;  2X9D A;  3M1C A;  1HQC A;  4LLG F;  5FD5 A;  2K5C A;  3GZ5 A;  1ZRD A;  3O8H A;  3PL8 A;  5HOO A;  5EF6 A;  2RAE A;  5L3B A;  3OS2 A;  2JPC A;  2NVT J;  4E6K G;  1X58 A;  1IXS B;  3JSO A;  2P5V A;  1ONV A;  2TRT A;  1I3A A;  4BQA A;  1G3S A;  5DYM A;  3U21 A;  5HNH A;  2JA5 J;  4IHV A;  5JFR A;  1EH8 A;  2DMT A;  4YII A;  4M6X A;  4HRI A;  2H1L A;  5EZH A;  1B72 A;  3U1K A;  2W48 A;  4NUB A;  5IYB J;  2STT A;  2FQ4 A;  4PGG A;  2DA2 A;  4HQM A;  2NS8 A;  2AXL A;  4KIB A;  1IV8 A;  2WBM A;  4BBR J;  3HSE A;  2JSP A;  4Y7N J;  1FBS A;  1WJD A;  4DZJ A;  2QF7 A;  1HST A;  2WY7 Q;  3G1O A;  4EVI A;  4XLC A;  4HPQ A;  2EFN A;  2QQ9 A;  5TIS C;  2KMU A;  4FAS D;  1P2F A;  4MFE A;  3DBR B;  3E5Q A;  2OZU A;  4NDL A;  3LSR A;  4IRI A;  5D5V B;  3CJN A;  2GBY A;  2IBD A;  1VQ5 I;  1ZHF A;  3T0Y A;  3CCS I;  1YX5 A;  4DBQ A;  1QQI A;  1GHC A;  4UVB A;  3TOA A;  2STW A;  4WK8 F;  3BZK A;  2OJE D;  4NNJ A;  1Z3Y A;  1OMI A;  2R7R A;  3S2D J;  3CUQ B;  4LGW A;  2M2E A;  3COA C;  5D5U B;  2L0K A;  3LOC A;  2A3S A;  3ZOB A;  1NG7 A;  3WTV C;  4L9T A;  2GAU A;  5C4J J;  2FA5 A;  3VB2 A;  4B3X A;  1YOV B;  2RGV A;  3KEY A;  3J7Y J;  1WI9 A;  4UUV A;  3JAM Z;  3F0C A;  1Z6T A;  5FLM J;  3PUF A;  4E70 A;  4V2G A;  1OYI A;  5CLS A;  2A6E F;  3LST A;  1TWG J;  2QA4 I;  1YIO A;  3IL2 A;  4LG0 A;  2QKL B;  3E6C C;  4M73 A;  4QWQ A;  1A5J A;  2KJC A;  1UB9 A;  4P1W A;  5J3L A;  1MH4 A;  3ZMS A;  1YRN B;  4EJU A;  2IJL A;  3H9G A;  5K7H A;  3OS1 A;  1DP7 P;  1T33 A;  2QEN A;  2I8D A;  4M3E A;  2KIF A;  2PG4 A;  1RPW A;  4ZJZ A;  5ICC A;  1GUU A;  3D0S A;  1JTY A;  2CO5 A;  2LRD A;  2R7Q A;  2HTS A;  1X1D A;  4HNV A;  2VJ5 A;  2PMZ A;  3KZI C;  4EM0 B;  2OA4 A;  2IA0 A;  5BNG A;  4LIV A;  2HDC A;  1KYW A;  2OF7 A;  3VFZ A;  1XMX A;  4W97 A;  3W2A A;  2JTV A;  3FXQ A;  4A3J J;  1JTX A;  1ULY A;  4BAY A;  4CHU A;  3MZY A;  2IW5 A;  3FX3 A;  3J81 Z;  2DTR A;  3EDP A;  4FQG A;  3KYD B;  2M7B A;  5DCM B;  4KMF A;  1LPQ A;  2HVR A;  4F52 A;  2HNH A;  4F3Q A;  1FSH A;  2LH9 A;  1MBF A;  1G59 A;  2BY3 A;  3MAJ A;  1WJC A;  3DLL F;  4KIT B;  3HM5 A;  3G6E I;  1HW1 A;  2FJ1 A;  5EEH A;  4ZTF A;  1IC8 A;  4IPA A;  2CGP A;  2E5N A;  2M8E A;  5IP6 A;  2IGK A;  2AXT C;  2QWW A;  5L3D A;  4BJT A;  4E7S A;  2IA2 A;  2CFX A;  5H6R A;  3NAR A;  3ESW B;  5BPD A;  4C3J J;  3O6B B;  2ZME C;  1BJA A;  3G1M A;  2L9S A;  4KA4 A;  2UXX A;  4EJO A;  2Y9Z A;  1MMS A;  1ETK A;  2WB1 A;  3FHZ A;  2YU3 A;  1I6X A;  5GTH C;  3KZZ A;  4BXU A;  3DFG A;  2FSW A;  1LB2 A;  2XIG A;  4AC0 A;  1S6L A;  1W7P D;  1RZ4 A;  2XPU A;  4QSH A;  1X3W B;  2Q2E A;  2HTJ A;  2XRN A;  4YIR X;  3FIS A;  2E34 A;  3KP4 A;  4E7I A;  3WGI A;  4BKX A;  4BXF A;  1V5E A;  3WU1 B;  2E19 A;  3RI4 A;  1I3Q J;  5KHD A;  3VYR B;  4B48 A;  1ZKG A;  3HPH A;  1TWC J;  2CRG A;  2K9M A;  1GLN A;  2LP0 A;  2H8W A;  2YX4 A;  3A0B C;  1T98 A;  1WJ5 A;  3ABM H;  4OIQ F;  2BOL A;  2JPB A;  3RKX A;  3K4J A;  4JX5 A;  3GTM J;  4M9Z A;  1SVL A;  3LFU A;  4AYB A;  2Y0S N;  2VC0 A;  2XF5 A;  4GYI A;  3R0A A;  1MZB A;  3BR1 A;  4U7D A;  5F27 A;  5J6X A;  4RB1 A;  5E20 A;  4GCV A;  5F64 A;  5DM7 F;  2DA3 A;  1D8K A;  2EJR A;  3QPS A;  2XSJ C;  1O4X A;  2KJB A;  4IQJ A;  1X1C A;  1LE8 A;  3GTL J;  2V1U A;  1XD7 A;  2BYV E;  2VUM J;  1DPU A;  1S72 I;  3WE3 A;  4X0G A;  3G4S I;  3A01 B;  3IAM 2;  5JVG F;  2LOO A;  5CVJ A;  3IKV A;  2YX7 A;  1X1P A;  2LYC A;  4FE7 A;  2R7F A;  5K5Q A;  3ABU A;  2FE3 A;  3KFW X;  2F4I A;  1TLH B;  4CCL A;  4D5F A;  3N05 A;  1KON A;  1ON2 A;  1DP3 A;  3SZT A;  2G9W A;  4CCO A;  1Z67 A;  2ZNY A;  2CQX A;  4R8H A;  2ICW G;  1J7K A;  3IP4 B;  3GX4 X;  2HZT A;  3P9C A;  2X6X A;  3HOT A;  2FNP A;  5LLQ A;  1AWC A;  3ZN0 A;  5DS9 A;  1AKH B;  5J1Y A;  2MH9 A;  1GV5 A;  2HQR A;  5H2F C;  1ETO A;  1P6R A;  2K9N A;  4EM1 A;  2JJ7 A;  4BQO A;  3FKJ A;  1E2X A;  3OSF A;  4ESF A;  1HA8 A;  1WPK A;  2EIM H;  2K40 A;  2V9V A;  2QGU A;  3I54 A;  3PQK A;  2PLY A;  5M5Y J;  2RQQ A;  2XVC A;  1JKO C;  4HF2 A;  4GFB A;  4XSZ F;  3TBI A;  3FXJ A;  1BI0 A;  3ABT A;  2YR2 A;  4F7Z A;  1IGN A;  4EJT A;  4HSR A;  5B1B H;  2PJP A;  3ZN1 A;  1UHS A;  2Y30 A;  1SD7 A;  1RNL A;  2VOO A;  4RBO A;  1TBX A;  1YI2 I;  2VC1 A;  3S1M J;  1Z7L A;  4FIS A;  1B1B A;  1E3H A;  2KIS A;  1KGS A;  4PGH A;  3TW7 A;  4N0B A;  3SJM A;  1LEB A;  4RGR A;  5EJC A;  2HDW A;  3H1C A;  2LKX A;  2H27 A;  2ECB A;  1HW2 A;  4CZZ A;  2XGC A;  5C3E J;  1R00 A;  3V7S A;  3N4M A;  5K7Z A;  2EIK H;  2OPT A;  1VQ9 I;  3GO5 A;  4L5I A;  5FRO A;  1R5H A;  3K4N A;  3TDU C;  1B6A A;  2QQB A;  4RLF A;  2BY0 A;  3K1P A;  2RNG A;  4BNC A;  1IW7 F;  4BYY A;  3GBG A;  3RKY A;  2Y75 A;  3QRF F;  5FRN A;  4HNU A;  2EV0 A;  2DT7 B;  1HKQ A;  5HDN A;  4BL0 B;  2JT1 A;  4ASN A;  1XS9 A;  3K1N A;  2EIJ H;  4Q4Z F;  2CV0 A;  3LQQ A;  3OL3 A;  3I59 B;  1QO0 D;  1ERD A;  1JI8 A;  2VAS A;  1J2X A;  1Y56 A;  1EV7 A;  2QSF X;  1FLI A;  3CES A;  4LB5 A;  5KNL A;  5J8F A;  2LBF A;  3CCU I;  1GT0 C;  5FRM A;  4CH7 A;  2DFF A;  1UFM A;  1Z1D A;  2V9K A;  4P5O A;  2EK5 A;  3D5S C;  2EA4 A;  2ZME A;  3HHH A;  4BEH B;  4NC8 A;  1REP C;  3I71 A;  1ODD A;  5GAG J;  3ZQH A;  2L54 A;  4CCN A;  2HR3 A;  5IT3 A;  2MYS A;  3MZ8 A;  3VDX A;  3RZO J;  3RPU A;  4B09 A;  2R7W A;  4HDV A;  1I6H J;  4E7J A;  3FIW A;  3FBN B;  1O7L A;  4XLA A;  3WTW C;  2E1N A;  2ZJQ F;  4OIR F;  2OZ6 A;  2QYO A;  5E3L A;  2FUG 2;  2EZI A;  1LDD A;  2W1O A;  5FLX K;  3DKY A;  1MBJ A;  3ZMZ A;  3OYF A;  2LC2 A;  1ZG3 A;  2HKX A;  4GO1 A;  2NVX J;  4OIP F;  3LAP A;  1MNE A;  2FRH A;  3S17 J;  3LSJ A;  3TL4 X;  3ZQQ A;  4K2E A;  4L0Z B;  1D0X A;  3JAM K;  1H8A C;  2CW0 F;  3TO9 A;  3U9G A;  1EH7 A;  4II3 A;  2BW3 A;  1BW5 A;  2R7O A;  1MSE C;  2E1M C;  3L7W A;  3F9K A;  4A6D A;  3BR5 A;  2QBY B;  1PUE E;  1XMK A;  2QUF A;  1FJL A;  5EGO A;  1PUF A;  1YIT I;  5DV5 A;  2H09 A;  3NAU A;  2XAF A;  2FNA A;  5F6F A;  2ZSI B;  1LVK A;  4OMY A;  4BDZ A;  1ZGA A;  2XF6 A;  3K9T A;  3ZQG A;  3OSG A;  4C2U A;  1YJW I;  1ITY A;  2H6B A;  3RZD J;  3WTU C;  2EV6 A;  1SAX A;  1SEU A;  4OU0 A;  2QM3 A;  3SEQ A;  5B5E C;  2L7F P;  3EYY A;  3HOX J;  4WWC A;  3K69 A;  2O6G E;  4FTH A;  1MDM B;  3VSK A;  1KU9 A;  1OCC H;  1R7J A;  4ESJ A;  1R9T J;  2XDV A;  2MC3 A;  1FYM A;  2A6H F;  1ZGJ A;  3DPU A;  3F3X A;  3B73 A;  5LRR A;  3TDZ C;  3CF5 F;  2JWT A;  5A2Q K;  4U0V A;  2IPQ X;  1SD6 A;  2NOG A;  2O3F A;  2COM A;  3E3V A;  3OYA A;  2XB0 X;  2O61 A;  4RS8 A;  4XKV A;  1YLF A;  2LVS A;  1X19 A;  2XRL A;  3MCZ A;  3FXU A;  4BQN A;  2HGC A;  4HV5 A;  1FEX A;  4PK4 A;  5IY5 H;  4Z6Y A;  2LLK A;  3V8K A;  1YW7 A;  3PNT A;  5LGU A;  1XC5 A;  3V8J A; 
#chains in the Genus database with same CATH homology
 1XB4 A;  1HXD A;  1IF1 A;  4U88 A;  2UXN A;  1W4M A;  1K78 B;  2PBI A;  4LD5 A;  1FYK A;  4L9N A;  3DPT A;  3HUG A;  4EQQ A;  3SXY A;  3GLX A;  4BHB A;  3WTS C;  2QVO A;  5CVV A;  4XLP F;  3F8N A;  1CF7 A;  3NEU A;  1HW5 A;  3Q9V A;  3F22 A;  4ENN A;  2CYY A;  3HIF A;  4A12 A;  1K6O A;  3P9I A;  4JBA A;  4PCQ A;  3DF8 A;  3FZV A;  4HF0 A;  3LAJ A;  5KVR A;  1LDJ A;  4PDK A;  5AON A;  4KMU X;  5D6E A;  2E1C A;  1J5Y A;  1L3L A;  1MJA A;  3QU3 A;  2K4B A;  2K7L A;  1IUY A;  5L3F A;  4O6J A;  4S04 A;  2IP2 A;  1GXQ A;  3R61 A;  1HSJ A;  1KQ9 A;  2Y0M A;  1GXP A;  1XGS A;  1I1G A;  4KT5 C;  2BGC A;  4P55 A;  2ISZ A;  2XHK A;  3T8T A;  2FOK A;  4Z2Y A;  4M6Y A;  4UVC A;  3G3Z A;  3AAF A;  3QAH A;  4YG2 F;  3RDI A;  4LB6 B;  2JSC A;  4RB3 C;  1P4W A;  1FNN A;  1U5T B;  4A2U A;  3C18 A;  3KZY A;  4FHT A;  4ETS A;  2FBI A;  4UVA A;  3TO6 A;  4G7H F;  1QGP A;  2HQN A;  2O03 A;  1R1U A;  5E8G A;  4P9U A;  4U0Y A;  1S8N A;  3FMQ A;  2GQQ A;  1OR7 A;  1S7O A;  1QNT A;  5H6Q A;  4M74 A;  4IF4 A;  4UNO A;  4FT8 A;  1MD0 A;  3M8F A;  3WOD F;  3KE2 A;  1JHF A;  3NRV A;  4OOI A;  4AD9 A;  3JSP A;  3C7J A;  1BI3 A;  3LA3 A;  1TTY A;  5J8C A;  5D5W B;  4NHJ A;  4I0B A;  3ROU A;  4WXH A;  2MA3 A;  4M9S A;  3BZ6 A;  4RGS A;  3ZMV A;  2DAO A;  2A68 F;  1RUN A;  5LHI A;  2D1V A;  5FLX Z;  1D5V A;  2Z33 A;  5BMZ A;  2NRA C;  4N9H A;  4LFU A;  4YIF A;  2XAQ A;  2GXB A;  3GFM A;  2R7D A;  2A07 F;  2F5F A;  2ESN A;  4HW0 A;  2ZFW A;  5FO5 A;  2VON A;  1XDU A;  3RIR A;  3CLO A;  5KK1 A;  1ZYR F;  1LEA A;  1K7A A;  3CO6 C;  5HDK A;  1W5S A;  1D3Y A;  2VN2 A;  1IN6 A;  1XCV A;  4ON0 A;  4IVN A;  1V3F A;  3E6B A;  4WX9 A;  2RC4 A;  3GFL A;  4BH9 A;  5L3E A;  3H92 A;  3GXO A;  3MQ0 A;  2KIU A;  4I01 A;  1OKR A;  2Y48 A;  2BE5 F;  4HOB A;  3L09 A;  4EM2 A;  2V6C A;  3L2C A;  3ZPL A;  5E1X A;  1R58 A;  1WWX A;  2W85 A;  2ETH A;  3NQO A;  1IZ1 A;  5A2Q Z;  1U78 A;  3J80 Z;  3LQR A;  1ZN2 A;  1W7P A;  1YW8 A;  4CIC A;  3HTU A;  4RB2 C;  5TRD A;  2P6S A;  4I98 B;  1WRJ A;  1QBJ A;  2P7V B;  4KN7 X;  1U2W A;  4WCG A;  5FFX A;  4GYG A;  2IT0 A;  2OBP A;  4EJV A;  3JTG A;  1B4A A;  2E7X A;  4HX8 A;  1O3S A;  2JZY A;  3MEX A;  1DUX C;  4AIK A;  2P8T A;  2O0Y A;  4A5N A;  2VE8 A;  3WG9 A;  1FZP B;  5D6F A;  5ICE A;  2MH2 A;  1H0M A;  1RUO A;  4I7H A;  2ZME B;  1H9T A;  2VOD A;  1UST A;  5D4S A;  1KU3 A;  4MTE A;  4L9J A;  3E6D A;  5CYV A;  4HBL A;  5CVR A;  4QLC U;  4IJA A;  1XN7 A;  3QOP A;  2LF8 A;  2GXG A;  1PP7 U;  4BHP A;  2L4M A;  4IXA A;  4R79 A;  3LA7 A;  2PMU A;  1WSU A;  2LDU A;  1YG2 A;  2VBX A;  1YS7 A;  1AOY A;  4L5J A;  1P4A A;  3T8R A;  4HLX A;  3W6J B;  2VXZ A;  2J5O A;  3VFZ A;  2W84 A;  1UCR A;  3M9A A;  3QPH A;  4P96 A;  4M9X A;  3KET A;  2ZNZ A;  1KA8 A;  3M7G A;  4TV7 A;  2FMY A;  1BI1 A;  2DFI A;  1WQ2 A;  3WGH A;  2L02 A;  2P5K A;  3ZP5 A;  1QZZ A;  1O57 A;  3V7C A;  1IN5 A;  1SFX A;  4RGU A;  3KCC A;  2HWV A;  2ZO4 A;  4PZJ A;  4MEX F;  3BWG A;  2QLZ A;  3RPQ A;  2Z3Y A;  1JE8 A;  3HHG A;  4JQF A;  3HRU A;  4G94 A;  4HLY A;  3PFI A;  4BHC A;  1Z91 A;  5EEG A;  3ELK A;  3CO7 C;  3TQN A;  5ICG A;  4L18 B;  2NAZ A;  1T39 A;  3SHF A;  4EMS A;  1FC3 A;  3GFJ A;  3O3K A;  5DUK A;  4CYD A;  2EB7 A;  4AWX B;  2HEO A;  1P4X A;  2CQK A;  5DCM A;  3DPL C;  6PAX A;  2L3D A;  2DO7 A;  3H3U A;  4CDG A;  1MJ9 A;  3V7R A;  2GA1 A;  2XKO A;  3R6S A;  5DUI A;  2H94 A;  1TQI A;  3KLO A;  3BJ6 A;  4I02 A;  4XSX F;  1H9G A;  2ZKZ A;  4CXF A;  5LHG A;  3WTY C;  1CF7 B;  2D45 A;  5HS7 A;  4KDP A;  1XGN A;  3QPT A;  1OYW A;  1USS A;  2VBZ A;  3BJA A;  1IRF A;  2CWE A;  5LBQ A;  1JHH A;  2FU4 A;  4N9I A;  4KNY A;  2XUB A;  4RAY A;  3ECH A;  4I2O A;  1FSE A;  4I09 A;  4DNC A;  3GEZ A;  1GVJ A;  3KP6 A;  1SFU A;  1F9N A;  2IVM A;  2XAG A;  3E6M A;  1FYL A;  1SMT A;  2EFP A;  3ECO A;  1TQM A;  3KEQ A;  5LGT A;  1IN7 A;  4G9Y A;  3QP6 A;  2VBY A;  3N97 A;  2XAJ A;  2K4J A;  3F6V A;  2V1D A;  1ZG5 A;  2A61 A;  3KP3 A;  3T1B A;  5DEQ A;  3ZMU A;  2HOE A;  1IXR C;  1NHA A;  2EFQ A;  5LEJ A;  3U1D A;  2VT3 A;  1YYV A;  2FQ3 A;  3G73 A;  4A6E A;  3F8C A;  4Y15 A;  1U8R A;  2F5C A;  4A0Z A;  4HDU A;  1TW2 A;  1I1S A;  1ZG1 A;  3VOD A;  4G6Q A;  3J80 K;  1KQ0 A;  4L9V A;  2XGX A;  5F1R A;  3HOS A;  5BS6 A;  2V1X A;  2HYG D;  1ZLK A;  4ZZL A;  5CVU A;  2JRT A;  2NYX A;  2DK5 A;  3LFK A;  4ENM A;  2K27 A;  3HSR A;  2EFW A;  3CDH A;  5D4R A;  2LSO A;  2FBK A;  3ERE D;  1LNW A;  3FF5 A;  4KIC A;  2OAZ A;  3F8M A;  1FY7 A;  1BC8 C;  5E18 F;  1JXS A;  3F72 A;  3Q5F A;  3KEO A;  3P9K A;  2ZJ2 A;  1ZLJ A;  3GFI A;  4IHS A;  3RYR A;  1R1V A;  3I59 A;  5FD6 A;  4XRF A;  1R5G A;  2V79 A;  3REO A;  4ENJ A;  2DT5 A;  2HFH A;  4ZZD A;  2VT2 A;  3IWZ A;  2RKH A;  1K79 A;  5HVQ C;  2IA1 A;  2DPD A;  3OOP A;  3V4G A;  4GGG A;  1L0O C;  1O3Q A;  4M71 A;  3F21 A;  1B59 A;  2A69 F;  1KYZ A;  1WKM A;  4UHT A;  3KP2 A;  4LK0 F;  3SZP A;  4FX0 A;  2DQR A;  2OQR A;  2DLL A;  1G4D A;  3RKW A;  3HSF A;  1HKS A;  3DEU A;  2Z9O A;  4IRG A;  3M1E A;  4OMZ A;  4WXD A;  4LG0 B;  1MGT A;  3FMR A;  3WTT C;  1FBU A;  1E17 A;  3GW2 A;  3RJP A;  3I5U A;  1U6G A;  3DV8 A;  3GWZ A;  3C1D A;  3F6O A;  3U2R A;  4ENK A;  1TNS A;  2XKP A;  2KKO A;  3R0J A;  3TGN A;  2QBY A;  1VTN C;  4I0A A;  2IRF G;  4LLN A;  4IRH A;  4A0Y A;  2ZBK A;  4MHG A;  5JHU A;  5DDG A;  3QU6 A;  3WE2 A;  3VEP A;  5E1W A;  1W7P B;  5CVI A;  1ZRE A;  3R60 A;  5HDG A;  2UZK A;  1XDS A;  3EQL F;  2PQ8 A;  2ELH A;  1LQ1 A;  4O3M A;  1BC7 C;  4AIH A;  3E5X A;  3CTA A;  5D5X B;  3GYH X;  1LVA A;  1YS6 A;  4Q48 A;  5K1Y A;  3TOB A;  1YW9 A;  1G3Y A;  1BM9 A;  3MZH A;  1UHM A;  1J59 A;  4ZYG A;  2Z5U A;  5D8K B;  1K78 A;  1HKT A;  1R36 A;  2DW4 A;  3RTR A;  3I4P A;  3GZ6 A;  4WXC A;  1A04 A;  3IC7 A;  4MNU A;  2RQP A;  4HF1 A;  1FX7 A;  1TQP A;  3MWM A;  3CUQ C;  2P7C B;  4HAM A;  3HRS A;  2L01 A;  3I0T A;  2YSR A;  1ZH5 A;  2XAH A;  5DD4 A;  2PN6 A;  3C3W A;  4JK1 X;  1ZRF A;  4XBF A;  2Q8K A;  5DCF A;  2CSO A;  1YO5 C;  5E1Z B;  2W25 A;  2DQL A;  1B9M A;  2EA2 A;  5LGN A;  3GUD A;  2MD5 A;  2RVC A;  3WTX C;  5ILV A;  3B02 A;  1J0R A;  4NB5 A;  2W24 A;  1R1T A;  1PDN C;  2P5L C;  3K1M A;  3JTH A;  1FOK A;  5E8I A;  5FGM A;  2DK8 A;  1BI2 A;  5FFZ A;  4KN4 X;  4EJW A;  5IT9 K;  5ED4 A;  3SFZ A;  2M5W A;  2EWN A;  2MLG A;  2RV8 A;  1FP1 D;  3BP8 A;  2AS5 F;  2F5D A;  1O7F A;  2DI3 A;  1W5T A;  3W6K B;  3IKT A;  4IHT A;  3ML6 A;  5FB2 A;  1FPQ A;  4RB0 A;  2M30 A;  1P92 A;  1IRG A;  3ZQ7 A;  1U5T A;  3HYI A;  3D5L A;  4AVP A;  4MQ9 F;  1SFE A;  3HTS B;  2UWM A;  1F1Z A;  3FWE A;  5HS8 A;  1BOA A;  4EGZ A;  4ESB A;  2VOP A;  3BPX A;  4DQ2 A;  2ZCW A;  3ULQ B;  4KUM A;  2CG4 A;  3MFK A;  4ZYE A;  3H3Z A;  2QZ8 A;  4KIG A;  4G7O F;  4AIJ A;  4R1H A;  1XSD A;  3BRO A;  4Y13 A;  2FF4 A;  2QQA A;  4OIN F;  3GF2 A;  1T2K A;  3K2Z A;  5K5R A;  2XRO A;  2P6T A;  2FML A;  4B8X A;  1XGO A;  1G3W A;  5H20 A;  1XMA A;  3KP7 A;  5BOX A;  2HS5 A;  4LK1 F;  1STZ A;  3R4K A;  2BV6 A;  5JR3 A;  2RNJ A;  1PP8 F;  5AIP A;  5HLH A;  2D2W A;  5ILU A;  1X3U A;  1S3J A;  5BQT A;  1KU2 A;  2WC2 A;  2ZXJ A;  5CJ9 A;  2PI0 A;  1Z05 A;  1RIO H;  1QPM A;  4LLL A;  2VE9 A;  2ADU A;  4YFN F;  2Q0O A;  5TJJ A;  3V8L A;  1FT9 A;  3OV8 A;  3J7A O;  2FXA A;  3FMS A;  3CUQ A;  2NNY A;  2ACJ A;  1YFH A;  1QZY A;  2RDP A;  3E5U A;  5JVT A;  1T6S A;  2R3S A;  4P9F A;  1FP2 A;  4WF2 A;  4U0W A;  4M72 A;  4RAZ A;  1DDN A;  4HQE A;  1MJB A;  1V4R A;  5ERI A;  1O3R A;  2W57 A;  4MGR A;  1KU7 A;  5D8L B;  4U7B A;  2TDX A;  3IHU A;  4G8X A;  3LA2 A;  5ICF A;  1HBX G;  4KIF A;  4EGY A;  1T0F A;  2C6Y A;  3LWF A;  4S05 A;  1CGP A;  4CO8 A;  1J75 A;  3JW4 A;  2GIV A;  3WU0 A;  4KFC A;  2DPU A;  1Z9C A;  2LF7 A;  1S29 A;  5ILS A;  2EFO A;  2A5Y B;  4YFK F;  2X0L A;  4A5M A;  3L00 A;  2ESH A;  1ZRC A;  2PFB A;  3EYI A;  2F5E A;  3BDD A;  2H6C A;  5AIQ A;  4CGZ A;  2EV5 A;  3M8E A;  2K02 A;  4ZYD A;  1BN5 A;  1G3T A;  4YFX F;  2XV4 S;  1LDK B;  2P4W A;  4HZF A;  1BIA A;  1J9I A;  2M45 A;  2ISY A;  2PMH A;  1UHW A;  3KLN A;  1F5T A;  1EH6 A;  4HX4 A;  1I5Z A;  2GA2 A;  2OD5 A;  3F8F A;  3DXJ F;  2OU2 A;  1Z6R A;  2G7U A;  2M1B A;  4HA8 A;  1C0W A;  3HRM A;  2GWR A;  3DKW A;  2B0L A;  1FBQ A;  1JGS A;  3TO7 A;  2OQG A;  3SQN A;  3FXR A;  1IAW A;  3I64 A;  2HYF A;  3I53 A;  4ZH4 F;  2DU9 A;  4MTD A;  2HKO A;  4MQV A;  1LJ9 A;  3EET A;  3WTZ A;  5IT9 Z;  1SD5 A;  1TNT A;  2J5P A;  1YQA A;  1O3T A;  3DQV C;  1FWZ A;  5L3G A;  1DPR A;  2VBW A;  4FX4 A;  4ZYH A;  3K0L A;  1XCB A;  3QP5 A;  2XAS A;  2FEZ A;  3GVA A;  5BPI A;  1Z7U A;  3ZMT A;  1RI7 A;  2MLK A;  3T5X A;  3WGG A;  2KRF A;  4L0Y B;  1R22 A;  1I27 A;  1SMY F;  4HX7 A;  3FM5 A;  4EV0 A;  3IRR A;  1ZAO A;  4RGX A;  4OIO F;  3J81 K;  2GZW A;  3CUO A;  1D8J A;  3S2W A;  5E17 F;  2M87 A;  4GXO A;  4XLN F;  5DD8 A;  1IXC A;  4KYW A;  2NS0 A;  4HYE A;  2BBY A;  3Q9S A;  4NQW A;  5LHH A;  5HS9 A;  1MKM A;  1IN4 A;  3ZMD A;  1G6N A;  1BBY A;  1KQ8 A;  4UXN A;  3HRT A;  5JI6 A;  3IWF A;  2O8X A;  2FBH A;  2WWY A;  1BIB A;  1Y0U A;  1R23 A;  3O2P E;  4D0P A;  4H0E A;  4G6D A;  3P7N A;  2WV0 A;  3EUH A;  3L9F A;  3ISP A;  1IN8 A;  2MBF A;  3BOQ A;  3RYP A;  5HLI A;  1XGM A;  2RN7 A;  3VOE A;  2Z99 A;  2E7W A;  4LMY A;  1S7A A;  4G7Z F;  2DBB A;  1OPC A;  5LRS A;  3DP7 A;  4Q47 A;  4UV9 A;  4Q5S F;  4MEY F;  3E97 A;  3BPV A;  5HLG A;  2LKP A;  4LJZ F;  1U5T C;  3KP5 A;  3PQJ A;  3FM3 A;  1B9N A;  2PEX A;  2L4A A;  1U3E M;  5LEK A;  4Y17 A;  4HV6 A;  1ZAR A;  3I58 A;  1XSV A;  2BEO A;  1F4K A;  3F8B A;  1ON1 A;  1OYY A;  2LNB A;  2K86 A;  2YPR A;  3F23 A;  2WTE A;  2G7H A;  2X4H A;  1XSX A;  4UV8 A;  3IRQ A;  1YTY A;  1SD4 A;  1MDM A;  2F2E A;  2KIM A;  5K5O A;  1T38 A;  1Q1H A;  3TKY A;  2D1H A;  5L3C A;  1TW3 A;  2NNN A;  3BY6 A;  4O5V A;  3BJO A;  4A0X A;  5FD5 A;  4LLG F;  1HQC A;  3GZ5 A;  1ZRD A;  5HOO A;  5L3B A;  2JPC A;  1IXS B;  3JSO A;  2P5V A;  1ONV A;  4BQA A;  1G3S A;  5DYM A;  5JFR A;  1EH8 A;  4YII A;  4M6X A;  2STT A;  4PGG A;  4HQM A;  2AXL A;  4KIB A;  3HSE A;  1FBS A;  1HST A;  4EVI A;  2EFN A;  2QQ9 A;  1P2F A;  3E5Q A;  2OZU A;  4IRI A;  5D5V B;  3CJN A;  1ZHF A;  3T0Y A;  1QQI A;  1GHC A;  4UVB A;  3TOA A;  2STW A;  4WK8 F;  1OMI A;  3CUQ B;  4LGW A;  3COA C;  5D5U B;  2A3S A;  3WTV C;  4L9T A;  2GAU A;  2FA5 A;  3VB2 A;  2RGV A;  1WI9 A;  4UUV A;  3JAM Z;  1Z6T A;  4E70 A;  1OYI A;  5CLS A;  2A6E F;  3LST A;  1YIO A;  3IL2 A;  4LG0 A;  3E6C C;  4M73 A;  4QWQ A;  2KJC A;  1UB9 A;  3ZMS A;  4EJU A;  2IJL A;  1DP7 P;  2QEN A;  2KIF A;  2PG4 A;  5ICC A;  3D0S A;  2CO5 A;  2HTS A;  4EM0 B;  2OA4 A;  2IA0 A;  2HDC A;  1KYW A;  2JTV A;  3FXQ A;  1ULY A;  4BAY A;  4CHU A;  3MZY A;  2IW5 A;  3FX3 A;  3J81 Z;  2DTR A;  3EDP A;  5DCM B;  4KMF A;  1FSH A;  3MAJ A;  1HW1 A;  5EEH A;  2CGP A;  4IPA A;  2M8E A;  2QWW A;  5L3D A;  2IA2 A;  2CFX A;  5H6R A;  3O6B B;  1BJA A;  4KA4 A;  2UXX A;  4EJO A;  3FHZ A;  2YU3 A;  1I6X A;  3KZZ A;  4BXU A;  3DFG A;  2FSW A;  1LB2 A;  2XIG A;  1S6L A;  1W7P D;  1RZ4 A;  2Q2E A;  2HTJ A;  2XRN A;  5BPD A;  3KP4 A;  3WGI A;  3WU1 B;  3RI4 A;  2YX4 A;  1T98 A;  4OIQ F;  2JPB A;  3RKX A;  4M9Z A;  2VC0 A;  4GYI A;  3R0A A;  1MZB A;  4U7D A;  5J6X A;  4RB1 A;  5E20 A;  4GCV A;  5F64 A;  1D8K A;  2EJR A;  2KJB A;  2V1U A;  1XD7 A;  2BYV E;  1DPU A;  3WE3 A;  5CVJ A;  3IKV A;  2YX7 A;  2R7F A;  5K5Q A;  3ABU A;  2FE3 A;  3KFW X;  1TLH B;  1ON2 A;  3SZT A;  2G9W A;  2ZNY A;  4R8H A;  1J7K A;  3GX4 X;  2HZT A;  3P9C A;  3HOT A;  2FNP A;  5LLQ A;  1AWC A;  3ZN0 A;  2MH9 A;  2HQR A;  1P6R A;  4EM1 A;  1E2X A;  4ESF A;  2V9V A;  3I54 A;  3PQK A;  2PLY A;  2XVC A;  4HF2 A;  4XSZ F;  1BI0 A;  3ABT A;  2YR2 A;  4F7Z A;  4EJT A;  2PJP A;  3ZN1 A;  1SD7 A;  1RNL A;  2VOO A;  1TBX A;  2VC1 A;  1B1B A;  1KGS A;  4PGH A;  4N0B A;  1LEB A;  4RGR A;  2H27 A;  1HW2 A;  4CZZ A;  1R00 A;  3V7S A;  3N4M A;  3GO5 A;  4L5I A;  1R5H A;  3TDU C;  1B6A A;  2QQB A;  3K1P A;  4BNC A;  1IW7 F;  4BYY A;  3RKY A;  2Y75 A;  3QRF F;  2EV0 A;  1HKQ A;  5HDN A;  2JT1 A;  4ASN A;  3K1N A;  4Q4Z F;  3LQQ A;  3I59 B;  1QO0 D;  1J2X A;  1EV7 A;  1FLI A;  4LB5 A;  5J8F A;  1UFM A;  1Z1D A;  4P5O A;  2EK5 A;  2EA4 A;  2ZME A;  3HHH A;  1REP C;  3I71 A;  1ODD A;  2L54 A;  2HR3 A;  5IT3 A;  3RPU A;  4B09 A;  4HDV A;  1O7L A;  3WTW C;  2E1N A;  4OIR F;  2OZ6 A;  2QYO A;  1LDD A;  5FLX K;  3ZMZ A;  1ZG3 A;  2HKX A;  4GO1 A;  4OIP F;  3LAP A;  2FRH A;  4K2E A;  4L0Z B;  3JAM K;  2CW0 F;  3TO9 A;  3U9G A;  1EH7 A;  3L7W A;  4A6D A;  2QBY B;  1PUE E;  1XMK A;  2QUF A;  5DV5 A;  2H09 A;  2XAF A;  2FNA A;  5F6F A;  4OMY A;  1ZGA A;  3K9T A;  2H6B A;  3WTU C;  2EV6 A;  1SAX A;  4OU0 A;  2QM3 A;  3EYY A;  4WWC A;  3K69 A;  2O6G E;  1MDM B;  1KU9 A;  1R7J A;  4ESJ A;  2MC3 A;  1FYM A;  2A6H F;  1ZGJ A;  3F3X A;  3B73 A;  5LRR A;  3TDZ C;  5A2Q K;  4U0V A;  2IPQ X;  1SD6 A;  2O3F A;  2COM A;  3E3V A;  2O61 A;  4RS8 A;  1YLF A;  3MCZ A;  3FXU A;  2HGC A;  4HV5 A;  3V8K A;  1YW7 A;  5LGU A;  3V8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...