5E8GA

Crystal structure of the dna binding domain of human transcription factor fli1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Friend leukemia integration 1 transcription factor
total genus 31
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e8gA00
1FY7A 3C7JA 4KICA 5LHHA 4CDGA 3KE2A 5KVRA 2O61A 3U2RA 5FO5A 1OYYA 1IRGA 3SFZA 2P5VA 3L2CA 4U7DA 1DPRA 1Z9CA 1TQMA 2P6TA 4YFNF 5D4SA 4WX9A 5ILVA 4NB5A 1OKRA 3GVAA 1SD5A 4RGUA 3WGGA 1S7OA 5HDNA 2EV0A 3ZP5A 4LB5A 4U0VA 3HYIA 1ULYA 3DPLC 4WF2A 4HF2A 6PAXA 3BDDA 4ETSA 2Z5UA 4EVIA 3RYRA 4R8HA 3RPUA 3HSFA 3O3KA 1I27A 1XN7A 5L3EA 4ENNA 1KQ0A 2DQLA 2W57A 4L9TA 3F6OA 1IF1A 3GFJA 1ZG1A 2F5CA 3F3XA 3KZYA 2OZUA 1GXQA 1XDSA 2Q8KA 4NQWA 1KU9A 5K5QA 4MTDA 2CGPA 2XAFA 5LHGA 4MEYF 1KGSA 2XRNA 5E1XA 5LRSA 2VBXA 2RVCA 2EK5A 2WV0A 1HKSA 1T6SA 2ZMEB 3KP3A 1LDDA 1BM9A 1JE8A 1UHWA 5D5WB 1MJ9A 3CDHA 4MNUA 5CVIA 3LWFA 3IKVA 4D0PA 3HTSB 2O3FA 2FEZA 4M71A 2P7CB 3OV8A 3HSRA 1LVAA 1FSEA 3E6DA 2Y75A 4UUVA 4O3MA 3M8EA 2FOKA 3RI4A 4ON0A 1ZRFA 2PMUA 1ON2A 1ZRDA 4ESFA 4AIKA 1SFUA 5FB2A 3E6CC 1IN7A 4LLNA 3IWFA 2W84A 2HDCA 3PQJA 3WE2A 1RUNA 1J5YA 1HKQA 3P7NA 1CF7A 5DD8A 2DPDA 1R1UA 3RKXA 4L5IA 5FD5A 2VBZA 2L4AA 3J81Z 4XLNF 3JTGA 1AOYA 3M7GA 5ICCA 1STZA 3ZN0A 4Q5SF 1E17A 2JSCA 1XGMA 5BOXA 1ZN2A 2MD5A 4ZYEA 2DPUA 3TO6A 3GFMA 2VN2A 2UWMA 2VT3A 4P55A 2IA1A 2J5OA 4CO8A 3K0LA 2ISZA 2HYFA 2XKPA 2X4HA 2E7XA 2TDXA 3ISPA 1F9NA 4AWXB 3V7SA 3G73A 4U7BA 2RQPA 2R7FA 3P9IA 3TQNA 1U2WA 1B59A 3EETA 5J8CA 5K5OA 2M8EA 5HLIA 1XMKA 5FLXK 1F5TA 5D4RA 2GIVA 1FPQA 5CVUA 1W7PB 1LJ9A 4F7ZA 2GA1A 1J7KA 2UXXA 3TOBA 2XAJA 1FYLA 3TO7A 1FP2A 1OYIA 3T0YA 1D8JA 1DDNA 4QLCU 5LGUA 3K2ZA 3ECOA 1BJAA 4KMUX 3DFGA 5AONA 2AS5F 1YFHA 3M8FA 2NYXA 5DYMA 2VONA 4BYYA 4FX4A 4LK1F 4A6DA 4XLPF 4EGYA 1ZRCA 2P5KA 3GX4X 2A6EF 1ON1A 1T98A 1IAWA 2JRTA 1RZ4A 1LDJA 2OQRA 2VOPA 1YIOA 4YIFA 1MGTA 3DP7A 5A2QZ 1QQIA 1JGSA 2O0YA 2G7UA 5J8FA 2IPQX 4UXNA 2YX4A 4HF1A 1G6NA 4Q4ZF 1DPUA 3QU6A 2EFPA 5BMZA 3FM3A 2YPRA 4Y13A 3LA7A 3IRQA 5IT9K 2XV4S 1UFMA 1BI2A 1RNLA 3MZYA 1TQPA 1JHHA 4CYDA 3V7RA 4KT5C 2ZXJA 5DCFA 1O3RA 3WTSC 1OPCA 2E1CA 1YW8A 3WTZA 1P4AA 4I2OA 2DK5A 4HAMA 2M30A 1G3SA 4R79A 5A2QK 1KU3A 2DI3A 2KJBA 2XVCA 2JTVA 3DEUA 1XGOA 2DK8A 1RUOA 4P5OA 4LB6B 4DQ2A 3DPTA 1G3YA 1EV7A 3K1NA 3W6JB 3J7AO 4OIPF 4HBLA 4EJWA 3HHHA 1FYKA 3Q9SA 5L3GA 1IXRC 2MC3A 2MBFA 2QVOA 4PGGA 3ABUA 1IRFA 3HUGA 1MDMA 3R0AA 5EEGA 2ZMEA 1J2XA 5HS7A 3S2WA 4EM2A 3QU3A 1SD6A 5D6EA 3N97A 1Z91A 2ZNZA 5AIPA 3TGNA 2XAGA 1QNTA 2LF8A 5E8IA 3BPVA 1W7PD 4HW0A 1BC8C 4MTEA 2HTJA 4S04A 5K5RA 2DT5A 5DEQA 4I0BA 3IHUA 1MJAA 3LSTA 3M9AA 1O3QA 3GYHX 2FF4A 3ZMSA 1LEAA 1BIAA 3MWMA 2O8XA 3GFIA 1HKTA 2LNBA 2KRFA 2HWVA 1X3UA 1ZARA 4G6DA 1LDKB 3F72A 1TW2A 3R4KA 1EH6A 3BROA 4LLLA 2F5DA 3C3WA 4KIBA 3WGHA 1T38A 3T8RA 2C6YA 5H6QA 2ZKZA 1P6RA 2HZTA 2GWRA 1S3JA 1OYWA 3E6BA 5DCMA 4UVCA 5DUIA 2A68F 3CUQA 1SFEA 4EJTA 3U9GA 2E7WA 4EJUA 2A61A 1FP1D 1D5VA 3RKYA 2FSWA 4A0ZA 1PDNC 1YS6A 4IHTA 4XSZF 1NHAA 4G6QA 4G8XA 4I01A 4O5VA 2VBWA 3HRSA 4BHCA 5ILSA 2ZCWA 3NEUA 4ZYHA 1B4AA 1FWZA 1J9IA 1C0WA 3FX3A 4BNCA 3SZPA 1GXPA 3KLOA 1ZH5A 2Z99A 3VFZA 2EFOA 3PQKA 5JFRA 3EDPA 1HW1A 4Y17A 4KDPA 1HQCA 1W7PA 3O2PE 3JSPA 5EEHA 3ZMZA 5ERIA 4E70A 4NHJA 5F6FA 2WTEA 1QPMA 3DXJF 3QPTA 1PP8F 1BI3A 4GO1A 3SZTA 1PP7U 4XRFA 4TV7A 2HS5A 2FA5A 5F1RA 2R3SA 2QYOA 3F21A 2FBHA 5FGMA 3KFWX 3K69A 1OMIA 1KU7A 1O7FA 5D5VB 1K6OA 5D5XB 2XIGA 2CSOA 3E5QA 5FFXA 3T5XA 4GCVA 4HV6A 1FX7A 4BAYA 1Z1DA 3KP5A 2JPBA 3JAMZ 2A6HF 5DD4A 2OA4A 3CLOA 3K9TA 1KYZA 5L3DA 2EV6A 3BP8A 3WTXC 3RIRA 1MD0A 4EJVA 3BPXA 3CUQB 1FBQA 3CUOA 2BEOA 3R0JA 5E17F 2VE9A 1R36A 1V3FA 2HTSA 3V8LA 2IRFG 4AVPA 1H9GA 2YSRA 2CYYA 3LQQA 3ECHA 2DO7A 3NQOA 2MH2A 1YW7A 2RGVA 1IUYA 1ZLJA 2PQ8A 4RGRA 3GFLA 3IKTA 4QWQA 2O6GE 4G7HF 1I6XA 4LLGF 1FC3A 2OQGA 3FXRA 4KN4X 4L18B 3E6MA 2B0LA 1BI1A 3GW2A 2Y0MA 5E1ZB 2DBBA 1ODDA 2KKOA 2GA2A 4A5NA 2OAZA 5F64A 5TJJA 1U78A 4MQVA 5BS6A 1R22A 2ISYA 2H6CA 4YG2F 2ZFWA 2QENA 3KCCA 1XB4A 3F8BA 3WTVC 4ENKA 3SQNA 1SD7A 3RPQA 2FNAA 4I7HA 1WQ2A 3FXUA 1I1GA 5HOOA 3JTHA 3N4MA 1J59A 4ESBA 3L9FA 4UV8A 4BHBA 2P7VB 4S05A 3HRTA 5ED4A 2EB7A 1G4DA 3Q9VA 2QLZA 1GHCA 3V8KA 1XCBA 2IA2A 2OBPA 1R58A 1W4MA 2V1DA 4OIRF 1MDMB 1S8NA 3VODA 4BHPA 3GZ6A 4LMYA 4EJOA 3QPHA 4U0YA 1FBSA 1EH7A 2QQ9A 3COAC 3FXQA 5ICEA 2BV6A 3ML6A 1H0MA 2HKXA 1FNNA 2HQRA 3LQRA 3RDIA 4JQFA 4UHTA 3F6VA 1USSA 2MH9A 2FBIA 4HX8A 1T0FA 5L3CA 2GZWA 2L4MA 2QQBA 4ENJA 3E97A 2YR2A 4N0BA 4OOIA 4M9XA 5HVQC 1QZYA 4L9VA 3W6KB 2ESNA 4RB3C 3DV8A 2W85A 2W25A 1IN6A 1QZZA 2DAOA 1BOAA 2COMA 4ASNA 3R60A 4M9ZA 1TTYA 3L7WA 3ZMTA 5LHIA 2PLYA 2VC1A 1CF7B 5LGTA 2P6SA 3EYYA 3KETA 3I64A 2ESHA 2G7HA 3Q5FA 1F1ZA 3WU0A 5HLHA 2K4BA 2FMYA 3QAHA 3VEPA 2XAHA 3IL2A 2PMHA 3ZMVA 5IT3A 2M5WA 3QOPA 1MZBA 2IW5A 3TKYA 4BQAA 3MAJA 1IZ1A 1UCRA 4FT8A 4P96A 4KFCA 1FT9A 2LKPA 3I53A 1KA8A 4IRIA 1WSUA 4HF0A 3J80K 4Q48A 3DF8A 1KYWA 3BJOA 1HSJA 4ZH4F 3V8JA 3KEOA 3KP2A 1WI9A 2K02A 1YQAA 3J81K 5ICFA 3U1DA 2A69F 4L0YB 1ZREA 1P4XA 1EH8A 3R61A 2MLGA 4H0EA 3KP7A 1XSDA 4CZZA 4IJAA 5DCMB 3RTRA 4GGGA 4IRHA 3WTYC 1R23A 2EV5A 2PBIA 4PGHA 2MA3A 5KK1A 4I02A 3MFKA 4B8XA 4WXDA 1CGPA 1HW5A 2X0LA 2OU2A 2GXBA 1REPC 4KMFA 1B1BA 1XSVA 3L00A 4JK1X 3ZN1A 4ESJA 4Y15A 3G3ZA 4KNYA 3BJ6A 2P8TA 3GEZA 3EQLF 1FBUA 2GXGA 3EYIA 3PFIA 4EM0B 2Q2EA 3M1EA 1Z6RA 4G7ZF 1U5TB 2RC4A 4O6JA 1B6AA 2J5PA 4L9NA 5FD6A 3ZQ7A 2IA0A 4FX0A 3FHZA 5L3FA 2Z9OA 2QWWA 3VB2A 1Z6TA 5D5UB 1J0RA 5DDGA 3GO5A 1LNWA 1PUEE 5E8GA 4FHTA 5HDGA 3FM5A 4A6EA 1LQ1A 2ELHA 1B9MA 2R7DA 4EGZA 1FZPB 2K7LA 4RB2C 3F8FA 1XDUA 2D1HA 3BY6A 1U3EM 4GYIA 4A0YA 3TDZC 2STWA 2GQQA 4M74A 2Q0OA 3P9CA 2EFQA 1ZAOA 1MKMA 1UHMA 3GF2A 4ZYGA 5CVRA 1KQ8A 2XUBA 4RGSA 2E1NA 4AD9A 3LA2A 2Z3YA 2VBYA 4UVAA 2KIFA 3C1DA 2D45A 2VOOA 3RKWA 3E5UA 3HTUA 2XHKA 1MJBA 1P92A 1Z05A 3KZZA 4WCGA 2V9VA 4HQEA 3OOPA 4IF4A 2JZYA 3O6BB 4HOBA 3D5LA 3I58A 1XSXA 4HYEA 4U88A 2VC0A 4EV0A 4KN7X 4RAZA 4ENMA 1IW7F 1YLFA 1GVJA 4XSXF 3I59B 3NRVA 3IWZA 3R6SA 3WTUC 4HLYA 1DP7P 3MZHA 1DUXC 4IRGA 5H20A 2HKOA 1RIOH 3F22A 1XGSA 1ZLKA 3ELKA 1L3LA 4ZZLA 1R5GA 3ZMUA 1YTYA 3GLXA 4RB0A 1JHFA 2QUFA 4B09A 1JXSA 2M87A 2DW4A 2FE3A 2G9WA 2HYGD 1WKMA 2KIUA 1Z7UA 5CLSA 3FMRA 4IXAA 1J75A 4HA8A 2D2WA 3GXOA 5ICGA 4LJZF 4LK0F 2P4WA 3I71A 3JAMK 2DU9A 4U0WA 4HX7A 2YX7A 3JSOA 4KUMA 4PCQA 5BPDA 5BQTA 2UXNA 2OD5A 1R7JA 3WE3A 1W5SA 2BE5F 3BOQA 3MCZA 4G9YA 1K78B 2NRAC 1LEBA 2QM3A 4HQMA 1P2FA 4HX4A 4LD5A 1ONVA 4R1HA 1BC7C 1I5ZA 1T2KA 4L9JA 4N9HA 4A5MA 1XMAA 3MQ0A 2KJCA 3F8NA 5D8LB 4HV5A 4HLXA 4OU0A 4CHUA 3EUHA 2OZ6A 2Z33A 1D8KA 4IVNA 2H09A 1A04A 5CJ9A 1R1VA 2FBKA 5H6RA 1R1TA 5E1WA 2K86A 4DNCA 3I59A 3QRFF 4G94A 2HQNA 1E2XA 2FQ3A 1G3WA 1FSHA 1K7AA 2XAQA 4MEXF 1B9NA 2BGCA 5LBQA 5HS9A 4K2EA 2KIMA 1FLIA 2L3DA 3HHGA 4KYWA 3T1BA 3GUDA 1P4WA 1Q1HA 2CQKA 1L0OC 2LF7A 2CFXA 1YYVA 2IT0A 3HOSA 4A2UA 4HDUA 2H6BA 1FYMA 1WWXA 2DTRA 1O3TA 5HLGA 4EQQA 2VXZA 5DUKA 4M9SA 2WWYA 2A07F 3FF5A 1YO5C 2CO5A 2PFBA 2HR3A 2AXLA 3F8CA 3B02A 1R00A 2EJRA 5BPIA 3CJNA 1QGPA 2ZJ2A 3BJAA 5TRDA 4L5JA 2EWNA 3K1PA 5J6XA 4OIOF 5FFZA 1U5TA 1O7LA 1QO0D 3WODF 1XCVA 1XD7A 3LAJA 2M45A 2ACJA 2RDPA 2K4JA 4UV9A 5LGNA 2O03A 4OMYA 1U8RA 5IT9Z 4G7OF 3CUQC 2FU4A 2V79A 4AIHA 1IXSB 1QBJA 2RV8A 1U6GA 2EA2A 2NNNA 2PN6A 2H27A 3QP6A 3I4PA 2P5LC 4Q47A 1HBXG 4OMZA 5LLQA 2F5FA 4YFKF 2M1BA 4P9FA 4RB1A 4A12A 4BH9A 5HDKA 1WRJA 2XASA 4PZJA 1K78A 2ADUA 3ERED 2STTA 2DQRA 2QBYA 4CICA 3JW4A 4N9IA 1XGNA 4IPAA 3FZVA 3I5UA 1USTA 2RN7A 2EA4A 3SXYA 2PG4A 4ZZDA 4GXOA 4CXFA 4IHSA 2HEOA 1T39A 5CVVA 2W24A 2ZBKA 5AIQA 3H3ZA 1ZHFA 2FRHA 2F2EA 1BN5A 1BBYA 3HRMA 3GZ5A 3H92A 3J80Z 3I54A 2CG4A 4MHGA 3SHFA 4I0AA 3RYPA 2NNYA 3B73A 3IC7A 5CYVA 1BIBA 3LAPA 3F8MA 1SD4A 2CW0F 3KP6A 2VODA 2A3SA 4KIFA 3RJPA 3P9KA 3D0SA 4OIQF 3CO6C 2IJLA 1YS7A 2ZO4A 1IN5A 2D1VA 1AWCA 5JVTA 2EFNA 2VT2A 2IP2A 5D8KB 1ZG5A 3KP4A 5JR3A 1ZGAA 1SMTA 3REOA 3CO7C 2FXAA 2H94A 1RI7A 1HW2A 1TLHB 4EM1A 2BYVE 2F5EA 1LB2A 2ZNYA 3E3VA 2EFWA 3CTAA 2MLKA 3C18A 5K1YA 3GWZA 4XBFA 2V1UA 2RNJA 1KQ9A 3E5XA 5ILUA 3BZ6A 2DFIA 1ZGJA 1TNTA 1SMYF 5CVJA 3WU1B 1I1SA 2UZKA 4YFXF 1W5TA 2FMLA 4RAYA 1BI0A 5HS8A 4LFUA 2PJPA 3L09A 2V6CA 4P9UA 1TBXA 2XROA 1S6LA 3I0TA 4KIGA 1HSTA 3KLNA 2YU3A 1TW3A 4I09A 4AIJA 3V4GA 3ZMDA 1VTNC 4M6XA 2GAUA 2HGCA 4LG0B 3WG9A 1U5TC 2IVMA 1OR7A 5E20A 3TO9A 1HXDA 3VOEA 3DQVC 1YG2A 4M72A 3QP5A 4WK8F 2PEXA 5L3BA 3ULQB 2ETHA 3FMSA 5JHUA 4KA4A 2L02A 2HOEA 3HOTA 3DKWA 2PI0A 1ZYRF 5DV5A 4RGXA 1UB9A 3WGIA 3KEQA 4RS8A 4HDVA 2XGXA 1TQIA 4YIIA 4WWCA 4CGZA 2JPCA 5LEJA 2QBYB 4MGRA 2FNPA 3AAFA 1Y0UA 1IN8A 2A5YB 3HRUA 2BBYA 4LGWA 5E18F 2K27A 4A0XA 1O3SA 3MEXA 4Z2YA 1YW9A 1IXCA 2LSOA 4I98B 1SFXA 1FOKA 1S7AA 2L01A 3FMQA 2VE8A 4JBAA 4HZFA 5LEKA 2QQAA 2V1XA 2CWEA 1G3TA 4BXUA 3BWGA 1R5HA 1K79A 2WC2A 2NAZA 5LRRA 3IRRA 2HFHA 1KU2A 3V7CA 3F23A 4WXHA 3ABTA 3TOAA 5FLXZ 4MQ9F 4UNOA 3LFKA 2QZ8A 1ZG3A 4OINF 3LA3A 4GYGA 3FWEA 4PDKA 3K1MA 1F4KA 3HIFA 4ZYDA 3TDUC 2XKOA 4UVBA 1IN4A 1O57A 1TNSA 2JT1A 3ZPLA 1S29A 2LDUA 4WXCA 5JI6A 4M73A 1H9TA 4LG0A 1SAXA 2RKHA 1V4RA 5D6FA 3ROUA 3H3UA 4EMSA 4L0ZB 2L54A 2NS0A 2Y48A 3HSEA 4M6YA 1D3YA 3WTTC 2DLLA 3WTWC 3T8TA
chains in the Genus database with same CATH superfamily
3BR1A 3PNTA 1A6QA 1FY7A 2XF5A 3MKYB 1X3ZB 4W97A 3EUAA 3C7JA 3AL0B 2IS2A 4KICA 5LHHA 4CDGA 3AKZA 2KZVA 3KE2A 5KVRA 4J19A 3HOZJ 2O61A 3U2RA 5FO5A 1OYYA 3IUOA 1IRGA 3SFZA 2P5VA 3L2CA 1GDTA 2CV1A 3LSIA 4XKBA 4ZC3A 4U7DA 1DPRA 4ZTFA 1Z9CA 3FKJA 1B72A 1TQMA 4G12A 2N8GA 3BR6A 1OJLA 1Y56A 2KT0A 3J7YJ 2P6TA 4YFNF 1AU7A 2Y31A 4MIMA 5D4SA 1R4MB 2K9LA 4WX9A 2M4KA 2TRTA 3PFYA 5ILVA 3QPSA 4NB5A 4BEHA 4F55A 1OKRA 3GVAA 2CW8A 4AM3A 4A3EJ 3PM1A 2HPMA 1SD5A 4RGUA 2E36A 2LKXA 1VNDA 3WGGA 1S7OA 5HDNA 5KNLA 1Y1VJ 2IGKA 2EV0A 3ZP5A 1I3QJ 4LB5A 4U0VA 1OLTA 3HYIA 2ELKA 1ULYA 1HC8A 2BHZA 3DPLC 4RM2A 1V5EA 4WF2A 1GT0C 4HF2A 6PAXA 3J7AY 3BDDA 4E7KA 3FK6A 4ETSA 1UAAA 4PJLA 2DMNA 2Z5UA 4BUPA 3JRHA 4EVIA 1ZELA 2XB5A 3RYRA 4R8HA 4FCYA 3DBLB 3RPUA 3OMYA 1V5FA 5B1BH 5IP9J 2VASA 3HSFA 1TWFJ 5EEAA 3O3KA 1I27A 4E7IA 1ZGWA 1XN7A 2KP6A 1MNMC 3PNVA 5L3EA 4ENNA 2DOFA 1KQ0A 2CUJA 2DQLA 4RLFA 1QVTA 1U9NA 3NWTA 1RR8C 4DOZA 1H8AC 1VQKI 3OWTA 2W57A 2X1DA 4L9TA 3F6OA 1H88C 1IF1A 3JREA 3GFJA 4NC8A 1YX5A 1ZG1A 1W36C 2F5CA 4V2FA 3F3XA 1WFXA 4CCNA 2IS4A 2NVTJ 3KZYA 2COBA 2LG4A 2L9VA 3DCFA 2OZUA 2WAQN 4F52A 1GXQA 1XDSA 4MLOA 3C2HA 4BKXA 2R7UA 2Q8KA 1X3WB 2XC7A 2DCEA 4NQWA 1KU9A 4XORA 5K5QA 3MKWB 4MTDA 4JYKA 3W2WA 2CGPA 2XAFA 5LHGA 2Y0SA 1BR1A 4MEYF 1KGSA 3E1SA 2XRNA 5E1XA 3GTPJ 5F27A 1XS9A 1WJCA 1RR7A 2VBXA 5LRSA 2RVCA 3BZKA 2EK5A 3GCMA 2XPVA 2WV0A 2ZXHA 1HKSA 1T6SA 3HJEA 2ZMEB 3KP3A 1LDDA 1QU3A 1BM9A 1JE8A 3OYAA 4FISA 4G6TB 3H9JA 1UHWA 2LK2A 1AKHA 5D5WB 1MJ9A 4LIUA 5C44J 3CDHA 3M07A 4MNUA 5CVIA 3LWFA 3IKVA 4XOPA 4D0PA 2Q1ZB 3HTSB 1IRZA 3ABMH 2O3FA 1NK3P 2JVHA 5IP6A 1JKRC 2FEZA 4M71A 1JI8A 2P7CB 1N75A 3MN2A 3QODA 3I3LA 3OV8A 2L9RA 1IG7A 3HSRA 5BNGA 1WJDA 1Y1WJ 1LVAA 1FSEA 3E6DA 2QSHX 2Y75A 4UUVA 1MNDA 3OYNA 1HF0A 4O3MA 3IV5A 3M8EA 2FUG2 1WH5A 2FOKA 4BDYA 3HM5A 3RI4A 4ON0A 2DJNA 3FXLA 1ZRFA 2R7ZJ 1RC9A 2F4MB 1EA3A 2PMUA 3Q0UA 1OCZH 1ON2A 1ZRDA 3OIQA 4ESFA 5IYDJ 4AIKA 2QCOA 3DWLE 1SFUA 5EF6A 3S15J 1IDYA 5FB2A 4ZJZA 5FJ8J 2K3FA 3E6CC 2R4GA 2WAEA 1IN7A 3O8HA 4LLNA 3IWFA 3OYFA 2W84A 2HDCA 4QTRA 3PQJA 3WE2A 1OISA 2M0MA 4Y3OA 1RUNA 1I3AA 1J5YA 1UMQA 3RPUD 2LC2A 1HKQA 2F4OB 3CCRI 3P7NA 1CF7A 2LYCA 2R7OA 5DD8A 1ETXA 1PJRA 2DPDA 3L1PA 2E1MC 1R1UA 3RKXA 4L5IA 5FD5A 2IGMA 2L4AA 2VBZA 4XLNF 3J81Z 2OC6A 3JTGA 3CCQI 3LSRA 2CH0A 1AOYA 3M7GA 5ICCA 1D5YA 1STZA 4FE7A 3ZN0A 3BQZA 4RAFA 4Q5SF 1A6IA 2ZFUA 3ZQFA 3LSKA 5FROA 4HSRA 1E17A 2JSCA 4IL6C 1XGMA 2MGQA 5BOXA 1ZN2A 2BY3A 2MD5A 1EJ9A 1S7EA 4ZYEA 1UJ8A 1YHQI 1ETYA 2DPUA 3TO6A 4BGDA 3GFMA 2VN2A 1K4SA 2UWMA 1RETA 2EINH 2VT3A 2IA1A 2J5OA 4P55A 3WHCA 4CO8A 4E4HA 5M3MJ 3K0LA 1ERDA 2ISZA 2HYFA 2XKPA 3MKZA 2X4HA 2E7XA 2TDXA 3ISPA 5F08A 4D5CA 2DT7B 1JGGA 2DTZA 3BR5A 1F9NA 3TL4X 3CLQA 4AWXB 2CRGA 3V7SA 3VPRA 4U7BA 2RQPA 1QZEA 3G73A 2R7FA 3P9IA 1BL0A 2DMQA 4A3JJ 2I8DA 3TQNA 1PUFB 1U2WA 1B59A 3EETA 5J8CA 4I76A 4D7NA 2JN6A 2KRCA 2DA3A 2E2HJ 3HOXJ 5K5OA 2M8EA 5HLIA 3G71I 2V9PA 3G6EI 4BXXJ 1XMKA 5FLXK 1F5TA 5D4RA 2GIVA 4IX7A 1FPQA 3C2GA 3ONQA 5CVUA 4FQGA 1W7PB 3VWBA 1N78A 1LJ9A 4A69C 4F7ZA 2GA1A 1J7KA 2UXXA 3TOBA 2VLAA 1S72I 1J09A 3OYBA 2PJRA 1JUPA 2LY1A 2XAJA 1FYLA 3TO7A 1FP2A 1OYIA 1HOMA 3GBGA 1ZKGA 3K4JA 1ENHA 3X2QH 3IAM2 1P7IA 3T0YA 9ANTA 1D8JA 1DDNA 2MC4A 4QLCU 5LGUA 3K2ZA 5FKNA 3NAUA 3S16J 2B63J 2R92J 3ECOA 2Y9YA 1BJAA 4KMUX 4HPQA 4XLEA 3DFGA 5AONA 2GBYA 2AS5F 2X6XA 5JVGF 3HL2A 1YFHA 3M8FA 2NYXA 5DYMA 2VONA 4BYYA 4FX4A 4LK1F 1MBFA 5DM6F 4A6DA 4XLPF 2GXAA 4EGYA 2XDVA 1ZRCA 2ZXIA 2WBMA 2P5KA 5E3MA 3SFIA 4RDUA 3GX4X 2A6EF 1ON1A 1T98A 1IAWA 2JRTA 1RZ4A 1LDJA 1WJEA 1CQTA 3F9KA 2OQRA 2VOPA 5J3LA 3G1MA 1YIOA 5DS9A 4YIFA 3CP8A 4PK4A 4BQQA 3DP7A 3F0CA 1MGTA 5A2QZ 2EZLA 1QQIA 1JGSA 1X58A 1E0EA 2O0YA 1XTAA 2DA1A 2G7UA 3ZQQA 5J8FA 2IPQX 4UXNA 4I99C 2YX4A 1GV5A 2QKMB 2Y30A 4HF1A 2VPLA 1G6NA 2LY9A 4BQNA 4E7HA 4Q4ZF 1U8BA 1DPUA 1MMDA 2O7OA 3QU6A 2EFPA 2FJ1A 3I56I 3FM3A 5BMZA 1VQ7I 4RMNA 2YPRA 4Y13A 3LA7A 3IRQA 1VI0A 5IT9K 2XV4S 1UFMA 1X4OA 1BI2A 1RNLA 2HI3A 3MZYA 1TQPA 3PNYA 1R4NB 1JHHA 4CYDA 1TC3C 3V7RA 4KT5C 3OS2A 5E79C 2XSJC 1IO2A 2ZXJA 4CSWA 5DCFA 1O3RA 3WTSC 1OPCA 2HU9A 2BY2A 2E1CA 1YW8A 3WTZA 1P4AA 1DQUA 3JRIA 4I2OA 3BQYA 2DK5A 2EIKH 4HAMA 2M30A 3OR2C 1G3SA 2ZSIB 4R79A 3S1QJ 5A2QK 1KU3A 2DI3A 2KJBA 4LITA 2XVCA 1NH3A 2P81A 2JTVA 3DEUA 2JVGA 1XGOA 5IPAA 2DK8A 3CCLI 1RUOA 5J40A 4P5OA 1Z0XA 4LB6B 4DQ2A 3DPTA 1G3YA 3BC8A 4Z6YA 1EV7A 3K1NA 3W6JB 5LFAA 3J7AO 4OIPF 2JSPA 4HBLA 5J1YA 2VKHA 3CJTB 4EJWA 3JRAA 3HHHA 1FYKA 2HXIA 4XMYA 1E3HA 2VQCA 2M7AA 3Q9SA 5L3GA 5B1AH 1IXRC 2MC3A 1LFPA 2MBFA 2QVOA 2VQGA 4HNVA 3QPLA 4E7JA 1SEUA 4PGGA 3ABUA 1IRFA 2I5UA 3HUGA 2L9SA 1MDMA 3R0AA 1DGRM 2R5ZA 2DFEA 4UB6C 5EEGA 1MMNA 1OCOH 1FIPA 4M3GA 4BY7J 4F3QA 2ZMEA 1J2XA 3PUFA 5HS7A 3S2WA 3QU3A 4EM2A 1SD6A 5D6EA 3N97A 3SZGA 1LPQA 4BY1J 5HLTA 1Z91A 2ZNZA 5AIPA 3TGNA 1KZHA 2XAGA 2IBDA 1S5LC 3I9V2 4C3IJ 1QNTA 2LF8A 5E8IA 3BPVA 3L2RA 4J01A 3DKYA 1W7PD 4HW0A 4CH7A 1BC8C 2W1OA 4MTEA 1PYVA 2HTJA 4S04A 3OR1C 4D7MA 5K5RA 4Y4RA 2DT5A 3GTMJ 4A3GJ 5DEQA 4I0BA 3IHUA 2VL8A 1MJAA 1OCRH 3LSTA 1W0UA 3M9AA 2OV7A 3LOCA 1O3QA 1D1CA 4PSWA 2FF4A 4XRSA 3GYHX 2R5YB 1W36D 4A3CJ 1VQOI 3ZMSA 3DTIA 4DZPA 1LEAA 4XKCA 1BIAA 3MWMA 3BT9A 5GAHJ 1FOXA 1ETOA 2O8XA 1JUSA 1GVDA 1X1PA 4XK4A 3GFIA 1JTXA 1HKTA 2VQLA 2LNBA 3PJRA 4XOTA 3L2WA 2V1NA 4B43A 1VQLI 2KRFA 3IH4A 2HWVA 2HVRA 3QQAA 3LNQA 1X3UA 1ZARA 4G6DA 5IP7J 2HOSA 1ZTRA 1LDKB 3CCSI 3A2KA 2R7QA 1HCRA 3F72A 5TGTA 1TW2A 3CCVI 3R4KA 4XL9A 3HEFA 1EH6A 3BROA 4LLLA 2F5DA 4BE2A 1Z77A 2GM4A 1AHDP 3C3WA 1BA5A 4KIBA 3WGHA 3MZ8A 1T38A 3T8RA 1JJ8C 2C6YA 2HQAA 5H6QA 2ZKZA 1P6RA 2XAUA 1Y6IA 2HZTA 3CCYA 4OAYA 2EZHA 2GWRA 1S3JA 1OYWA 2JMWA 2WA0A 4XICA 2FD5A 3BTIA 3E6BA 5DCMA 4UVCA 5DUIA 2A68F 2GOMA 4XRSG 3CUQA 2E2IJ 3ZQHA 1SFEA 4EJTA 3U9GA 2E7WA 2ZSHB 3K4BA 4EJUA 2A61A 1FP1D 1D5VA 3RKYA 4A3LJ 2FSWA 1QHGA 4A0ZA 1PDNC 1YS6A 4IHTA 4B4CA 4XSZF 1NHAA 1SVOA 4G6QA 4G8XA 4AC0A 3AG2H 2BY0A 4I01A 4O5VA 1R6RA 3CESA 2VBWA 3HRSA 4BHCA 5ILSA 2ZCWA 4ITVA 2LBFA 3NEUA 3S32A 4ZYHA 1B4AA 1JUMA 3LFUA 5EGOA 2W48A 3HPGA 1IC8A 1FWZA 5EZGA 3LSGA 4X0GA 3A03A 2A05A 2JUCA 3HBLA 1DP3A 1PUFA 1C0WA 1J9IA 3FX3A 4BNCA 4J00A 3CC7I 5JLWA 2GIZA 4L5EA 3SZPA 1GXPA 3HUGB 3KLOA 1ZH5A 2F48A 2Z99A 3VFZA 2EFOA 3PQKA 3A01B 5JFRA 3EDPA 1K61A 1HW1A 1MMSA 3CMEI 3CF5F 1P7JA 2F6CA 4Y17A 3IP4B 4KDPA 1HQCA 1W7PA 3O2PE 4V19K 2K9NA 4LIVA 3H5RA 2QEXI 5C4JJ 3D5SC 3JSPA 5EEHA 2XB0X 3ZMZA 1A35A 1JKOC 4XQFA 3OS0A 5ERIA 4IZZA 4E70A 2BZTA 2DA6A 3HOYJ 4NHJA 5F6FA 2BVLA 2WTEA 1QPMA 1UZCA 3DXJF 4GDFA 2CMPA 3QPTA 1PP8F 3OYGA 1BI3A 4CZCA 3BG6A 4GO1A 2R7RA 3E0JB 4PJ0C 1EKEA 3SZTA 1PP7U 2NS8A 3OS1A 4XRFA 4XLAA 1VQPI 1DGWY 4TV7A 2HS5A 3P5JA 2FA5A 5F1RA 4AUXA 1YJWI 1BJZA 2R3SA 2QYOA 2ELJA 3BR2A 3CC4I 3F21A 2FBHA 5FGMA 3KFWX 3K69A 2ME6A 2HZDA 1OMIA 4CUGA 2CQQA 1KU7A 3HGYA 1O7FA 5D5VB 1K6OA 5D5XB 2XIGA 2H1LA 3HOVJ 4IOCF 4IEJA 3HGGA 2CSOA 3E5QA 5FFXA 3K2AA 4YELA 3CZ6A 2DXIA 2XRLA 4DW6A 4DYRA 2KDOA 3T5XA 2AO9A 3A02A 4GCVA 4HV6A 2FOWA 1FX7A 4OWRB 4BAYA 2KIQA 1Z1DA 3GZNB 3KP5A 3OL4A 4E7SA 2JPBA 3KX2A 3JAMZ 2A6HF 2JA7J 5DD4A 2OA4A 2JQ7A 4XR6A 3CLOA 3K9TA 1MBEA 1O4XA 2R0QC 1KYZA 5L3DA 2EV6A 3AG4H 2K3PA 3BP8A 3WTXC 3RIRA 1MD0A 1BW6A 4EJVA 3BPXA 3ZQCA 3CUQB 1VFCA 2MYSA 1FBQA 3CUOA 1WZ2A 3MD2A 2BEOA 2I10A 3R0JA 5E17F 1F43A 2VE9A 1R36A 2DMPA 1LUJB 1V3FA 2HTSA 3V8LA 3AG1H 1R49A 2IEKA 3N05A 4AVPA 2IRFG 1H9GA 3L2UA 1VF9A 1IJWC 2YSRA 2CYYA 2DA5A 4KISA 3LQQA 4BACA 3ECHA 4V2GA 2DO7A 4M3BA 3NQOA 1XPXA 5IOYA 4BE1A 2WAFA 2MH2A 2EIMH 3ZR8X 1YW7A 3V42A 2RGVA 3JRDA 2L9NA 1ZLJA 2PQ8A 4RGRA 2L5QA 2UUZA 3GFLA 3IKTA 1IUYA 2OTJI 2M34A 2HVSA 4QWQA 2O6GE 1MBGA 4BJ6C 5E3OA 4PFOA 4G7HF 1I6XA 1TWGJ 3CCUI 3S8PA 3CF2A 3DKXA 1HLVA 1FC3A 2OQGA 4LLGF 3FXRA 4KN4X 4RLQA 4L18B 3E6MA 4II2A 2JRMA 2B0LA 1BI1A 4DBRA 3ZQGA 5F0CA 3TW6A 1G2HA 3GW2A 2Y0MA 5E1ZB 2DBBA 2PX9A 2M9HA 4A3MJ 3H9GA 1ODDA 2KKOA 2GA2A 2QSGX 4A5NA 2LFBA 1Q1VA 2OAZA 5F64A 3D1NI 5TJJA 4ZDLA 1U78A 2Z2SB 3HZJA 1B8IB 4I6ZA 4MQVA 5BS6A 1R22A 2CFOA 2LKSA 1H89C 2VPRA 2ISYA 2ZB9A 3BCAA 3ASNH 2H6CA 2R7SA 2P0WA 2ZFWA 4YG2F 2QENA 4H4KC 3W2VA 5KAIC 5F0FA 2MW8A 3KCCA 1TP4A 3U1KA 5HNFA 1XB4A 3F8BA 3GTKJ 1TWCJ 2CS3A 3WTVC 2CU7A 4ENKA 3VDXA 2VKVA 5DM7F 3PUBA 3SQNA 5FRNA 1SD7A 1WJAA 2X48A 4PFPA 2FNAA 3RPQA 2ZJQF 3BG3A 3OYKA 3O8GA 4I7HA 3GTLJ 1OFCX 1XG1A 1WQ2A 3CMMA 2L7FP 3FXUA 1I1GA 3FXOA 5HOOA 3JTHA 3N4MA 2NVXJ 1JJ6C 1J59A 4ESBA 3LL7A 4UUSA 1VQ9I 1RKWA 4BXFA 4FTHA 1LE8A 3L9FA 4UV8A 1VQ8I 3GTGJ 4BHBA 2P7VB 3CJRB 1NG7A 4S05A 2CUEA 3HRTA 1FMWA 3G1OA 5ED4A 1U0JA 2EB7A 1APLC 1G4DA 3DLAA 2OCCH 3OOUA 3Q9VA 2QLZA 1GHCA 2JA2A 3V8KA 3UR3C 1XCBA 2IA2A 2OBPA 1R58A 1RPWA 1W4MA 2V1DA 3DEWA 4OIRF 1MDMB 3G4SI 1S8NA 3H9QA 2OUMA 3VODA 3ERMA 4BHPA 3GZ6A 4C2MJ 2BVMA 2Q2EB 4LMYA 4EJOA 3QPHA 2WB1N 4U0YA 1FBSA 2ICWG 3SYTA 3IAS2 1ETKA 2M7BA 1EH7A 2QQ9A 3DTKA 3COAC 3K4LA 3S3MA 3FXQA 2R7WA 5ICEA 1X1AA 2BV6A 3ML6A 1H0MA 3OYMA 2HKXA 5K7FA 1FNNA 2KQRA 4DZJA 1TZLA 1FJLA 2HQRA 3LQRA 1OR7C 3RDIA 1BW5A 4JQFA 4UHTA 3F6VA 1USSA 2XF7A 2MH9A 1YITI 2FBIA 4HX8A 3EUKL 1VQ6I 1T0FA 3BG9A 5L3CA 1UHSA 2YU9J 2GZWA 1TL8A 2BW3A 2L4MA 2QQBA 5E3NA 1QA6A 1WJFA 1F36A 2R5YA 5GAGJ 4ENJA 3E97A 2YR2A 2KMUA 4N0BA 4PJMA 4OOIA 4BBRJ 4YEJA 4UB8C 4M9XA 4BJ5C 5HVQC 1QZYA 4L9VA 3W6KB 2ESNA 1Y8QB 3QYEA 3FK7A 4RB3C 1OQYA 3TEDA 3DV8A 2W85A 2W25A 1R71A 4IKFA 1IN6A 1QZZA 2DAOA 4XM3A 1BOAA 2COMA 2WAQA 4ASNA 3R60A 4M9ZA 2E5ZA 3CMAI 1TTYA 5FLVA 3L7WA 2V7FA 3TP0A 3ZMTA 5LHIA 2PLYA 1UG0A 2VC1A 1CF7B 2B9SA 1RRJA 5LGTA 2P6SA 3CCEI 3KYLA 3EYYA 3KETA 3I64A 2MABA 3M4OJ 2IS6A 2CQNA 2ESHA 2G7HA 3Q5FA 1B8IA 1F1ZA 1SVMA 3WU0A 5HLHA 2K4BA 3OYEA 2R7XA 2FMYA 1JKQC 3QAHA 2PMZA 2K40A 4A3KJ 2WY7Q 3VEPA 2XAHA 1HDPA 3IL2A 5KHDA 2PMHA 1ZR2A 2YUSA 5GP9A 1IDZA 2JA5J 5DTDA 3ZMVA 5IT3A 1YRNA 1RESA 2M5WA 3CP2A 2K9SA 2HDWA 3U21A 3QOPA 2LVSA 4B47A 3K10A 1MZBA 4A3IJ 4F91B 4M3FA 2MSYA 2IW5A 3W2AA 2JUGA 1V5GA 2CQ7A 3TKYA 1T0FC 3MAJA 4BQAA 1IZ1A 1UCRA 2KHMA 4FT8A 4P96A 3FHNA 4KFCA 2AQEA 1G59A 1ETVA 2CJJA 2NOGA 1FT9A 4N4OB 2LKPA 1WCMJ 3DU5A 2MD0A 4BBSJ 5J1UA 3I53A 3I4MJ 1D0YA 1KA8A 2W82A 2MFZA 3VYSB 4E6KG 4IRIA 2DMUA 1WSUA 4HF0A 2VUMJ 3J80K 4Q48A 4LOCA 2HPIA 3DF8A 2Y0SN 3RSNA 1WJBA 2R93J 2X51A 2DFFA 4ABZA 1KYWA 3BJOA 1BR2A 1HSJA 4ZH4F 3V8JA 2CV0A 5FLMJ 2A5WA 3KEOA 4CCLA 1A5JA 3KP2A 4B48A 1WI9A 2H8WA 2K02A 3VSLA 1YQAA 3J81K 5EJCA 3KYDB 5FKLA 5ICFA 3TP3A 3U1DA 2A69F 4L0YB 5GPCA 1ZREA 4NBQA 1P4XA 1EH8A 3R61A 2MLGA 1OCPA 2BXZA 4H0EA 3KP7A 4XNFA 2RREA 1D1AA 3BTJA 1XSDA 3KIOA 4CZZA 2WV1A 4IJAA 5DCMB 1GV2A 3MVPA 3RTRA 5J1RA 4GGGA 4IRHA 3WTYC 1R23A 2EV5A 2PBIA 2M4GA 4PGHA 2NVUB 2MA3A 5KK1A 4I02A 3MFKA 1PVEA 2WY8Q 4WXDA 4B8XA 4CCKA 3CCJI 1CGPA 1HW5A 4XLHA 1IUFA 2X0LA 2OU2A 2GXBA 1REPC 4M3DA 1B1BA 1XSVA 4KMFA 5GAEJ 3L00A 1MBHA 4JK1X 4ANJA 3ZN1A 4ESJA 4Y15A 3G3ZA 4KNYA 1T33A 3BJ6A 2LBFB 2P8TA 3IH3A 3GTOJ 2X1CA 3HG9A 3ZOBA 3GEZA 3EQLF 1FBUA 2GXGA 1T08B 3A0HC 3EYIA 1ETQA 3PFIA 4EM0B 2Q2EA 3GMEA 4JX4A 3M1EA 4U87A 1Z6RA 4G7ZF 3FXJA 3SEZA 4UUTA 1U5TB 4XONA 2XF6A 4RAGA 3L2QA 2RC4A 4O6JA 1ETWA 1B6AA 2J5PA 4L9NA 5C3EJ 5FD6A 3ZQ7A 2IA0A 1MH4A 4FX0A 3FHZA 2JK3A 1WJ5A 5L3FA 2K85A 2Z9OA 2QWWA 3FISA 1K83J 3VB2A 1WHUA 1Z6TA 2E60A 5D5UB 1J0RA 5DDGA 3GO5A 1LNWA 3OIOA 1QVUA 4FHTA 5E8GA 1PUEE 3EUHC 5KAFC 3KPHA 5HDGA 3WG7H 1T95A 3FM5A 4A6EA 5EG0A 1LQ1A 2M3AA 4FETA 2ELHA 3GTJJ 1B9MA 5B66C 1ZR4A 4NDLA 2PMZN 2DT6A 3K4MA 4JOMA 2R7DA 2H1KA 5K7ZA 3S1MJ 3FXKA 4EGZA 1FZPB 2K7LA 4RB2C 3F8FA 2NXNB 1FEXA 2X6OA 1XDUA 3ZCOA 3S1RJ 2QF7A 2D1HA 3BY6A 1U3EM 3ZQIA 4DIQA 3KYCB 4GYIA 3TDZC 4A0YA 2STWA 1G8XA 2GQQA 4M74A 2EQRA 2NVQJ 2Q0OA 2CUFA 3JR9A 2KZGA 3P9CA 2DOEA 5IYBJ 5B5EC 2EFQA 1ZAOA 1MKMA 1UHMA 3GF2A 3TW7A 3L2VA 4ZYGA 4IHVA 1MNEA 2IAIA 5CVRA 2R7TA 4X6AJ 3OYIA 1RKTA 1KQ8A 2XUBA 4RGSA 1VQMI 2E1NA 4AD9A 3LA2A 2Z3YA 2VBYA 4UVAA 2KIFA 3C1DA 2ZJPF 1W5CC 5HNHA 2D45A 2HOTA 2VOOA 3RKWA 1LVKA 5JHFA 1IV8A 3E5UA 3HTUA 4A3DJ 2VXDA 1MJBA 2XHKA 1P92A 2K9MA 1Z3XA 2E71A 1Z05A 4IHWA 1T8IA 2G0EA 4MFEA 3KZZA 2DDBA 3K70C 2MG4A 4WCGA 2V9VA 2ZC2A 5CQGA 4HQEA 3OOPA 3VYUB 2LR8A 4IF4A 3HPHA 5E3LA 2JZYA 3ZRGA 3O6BB 1POGA 1YX3A 3FXMA 4HOBA 3D5LA 4BJTA 3I58A 5EZHA 1Z7LA 1XSXA 4HYEA 4U88A 1FOYA 4JX6A 3BR3A 2LREA 2VC0A 2L2OA 4EV0A 4KN7X 3CCMI 4RA2A 1FTTA 4AIDA 3K7AJ 4RAZA 4ENMA 1IW7F 1TT5B 1ORKA 1YLFA 1GVJA 4CCOA 4XSXF 2HXOA 3ASOH 2EZIA 3E7LA 2ZJRF 3I59B 3NRVA 5FKMA 4C2UA 1AA7A 3QWLA 1MMAA 3IWZA 3S93A 3R6SA 3WTUC 2IS1A 4HLYA 1DP7P 2GLOA 2FX0A 2E1MB 3GLLA 1SFKA 1X1CA 3MZHA 4IRGA 5H20A 1DUXC 4XKVA 5C4XJ 2HKOA 5IYCJ 1RIOH 3F22A 1XGSA 2EBIA 1ZLKA 3ELKA 2PJRB 3ABKH 1L3LA 4ZZLA 1R5GA 3ZMUA 1YTYA 4HRIA 4NNJA 3GLXA 1XMXA 2LRDA 5EDNA 4RB0A 3DBRB 5LD2C 1JHFA 2QUFA 4B09A 2ZXWH 2LMDA 1D0XA 4N4NB 1JXSA 3NWSA 1N77A 5GTIC 1Z3YA 5J4YA 1NG6A 2Y69H 2HQ5A 2M87A 2DW4A 3K4CA 5EG0B 2FE3A 2G9WA 2HYGD 1WKMA 1S9HA 2KIUA 1Z7UA 2NS7A 2ECBA 3KZIC 5CLSA 4CA0A 3JRGA 3FMRA 2XPUA 4IXAA 1J75A 1WI3A 3S14J 4HA8A 2OCEA 2D2WA 3GXOA 1X2NA 5ICGA 4LJZF 4LK0F 4AU7A 2P4WA 4M6VA 3BR0A 3I71A 2RNGA 3JAMK 3H0DA 2DU9A 3DLLF 4U0WA 4HX7A 1K4TA 2YX7A 3JSOA 4KUMA 4KJZA 4PCQA 4UUSB 5BPDA 5BQTA 2UXNA 2YS9A 2OD5A 3S3OA 1R7JA 3WE3A 1W5SA 2EIJH 1MH3A 2BE5F 2EILH 3BOQA 4ZDOA 3MCZA 3BLYA 3TBIA 4IHXA 4G9YA 1K78B 2NRAC 2HVQA 2W7NA 1LEBA 3UKGA 3BCBA 2QM3A 4XN0A 4NQWB 4HQMA 3PIOF 5GADJ 1P2FA 3OL3A 3HDDA 1DU0A 2Z1DA 4HX4A 3G2BA 4LD5A 2IGNA 3TMOA 2E2JJ 1OCTC 3H1CA 2CQXA 2AHQA 5F0HA 4DJAA 1ONVA 4R1HA 3W3CA 1BC7C 4Y33A 1I5ZA 1T2KA 4L9JA 4N9HA 4AYBA 2DA2A 1YI2I 1VQ5I 3JRBA 1HA8A 3LSMA 1UG2A 2ZMEC 4A5MA 2M8GX 1XMAA 3MQ0A 2E5NA 2DYSH 2KJCA 3F8NA 3G1LA 4HV5A 4HLXA 5JLXA 5D8LB 3GTQJ 3H3VK 2R7VA 4HG2A 3HOWJ 4OU0A 4CHUA 3EUHA 2OJED 3LSJA 2KL4A 2OZ6A 2CUZA 4NC7A 4BL0B 1D8KA 2Z33A 4E7LA 4IVNA 2H09A 4KT6A 3BG5A 5H2FC 1A04A 5CJ9A 1R1VA 4PSXA 5CKTA 1YOVB 4JX5A 2FBKA 4GRIA 5H6RA 1R1TA 1WH7A 5E1WA 1JT6A 2K86A 4DNCA 1N25A 2V9KA 2KFDA 4F93B 1MMGA 3I59A 3ZGKA 3CDIA 3QRFF 2AXTC 1JKPC 4G94A 2F4IA 1LKXA 2HQNA 1E2XA 2FQ3A 1G3WA 3EPZA 1FSHA 2M2EA 1K7AA 3M3YJ 3OYCA 1NTCA 4M3EA 2KPMA 4HNUA 2XAQA 4MEXF 2EPFA 1B9NA 2BGCA 5LBQA 1UELB 5HS9A 4K2EA 4XKWA 2KIMA 4E7ZA 1FLIA 2L3DA 3HHGA 4KYWA 4XIDA 3S2HJ 3T1BA 2JA6J 3GUDA 1QHHD 2A6TA 1P4WA 2V4JC 1Q1HA 2CQKA 1L0OC 2FQ4A 1DU6A 2LF7A 1MSFC 2CFXA 1YYVA 2DA7A 4XN3A 2IT0A 3HOSA 4HSTA 2DDAA 3UNGC 2EH3A 2EZKA 2XGDA 4NC6A 4A2UA 3K4KA 4HDUA 2VJ4A 2H6BA 1X1DA 1FYMA 1WWXA 2DTRA 2KLOA 1O3TA 2LLKA 4OAZA 5HLGA 4XLCA 4EQQA 2KISA 5M5WJ 2QGUA 1FTZA 1M1EB 2VXZA 5DUKA 4M9SA 2WWYA 4EEFG 2A07F 2F5VA 5M5YJ 3FF5A 3K70D 3J7ZI 1YO5C 2CO5A 4B1RA 2PFBA 2HR3A 2AXLA 3F8CA 2DJIA 2KRHA 1TWAJ 1MBJA 5EYRA 3B02A 1R00A 1SC7A 5HODA 3DBHB 2EJRA 5BPIA 2HDDA 3CJNA 1QGPA 4BDZA 1U9OA 2ZJ2A 3BJAA 2BY1A 3QYBA 5TRDA 4L5JA 1W1WE 4BEHB 1V54H 5J4VA 2EWNA 5B3SH 3K1PA 5J6XA 3RQ4A 3VSKA 2DYRH 4OIOF 5FFZA 4QPOA 4F92B 5IY5H 1U5TA 1O7LA 1QO0D 3B6CA 3OIPA 3WODF 1XCVA 1XD7A 2O9LA 3LAJA 1XX5A 2M45A 3A4CA 1EF4A 2ACJA 2DN0A 1MW7A 2RDPA 3D5RC 4Y7NJ 1X2MA 3H35A 3A0BC 2K4JA 4UV9A 3WU2C 2E35A 5LGNA 1BOBA 1T56A 4GFBA 2O03A 2L7ZA 2XGEA 4CYCA 2K9QA 4OMYA 1U8RA 5IT9Z 3RKQA 4G7OF 3CUQC 1R5ID 2FU4A 2V79A 4AIHA 4IHYA 1IXSB 3A1YA 1QBJA 2RV8A 4CCJA 4C2TA 4A93J 1U6GA 2LD5A 2EA2A 2NNNA 2PN6A 2QA4I 3K6GA 2H27A 3I4NJ 3QP6A 2LH9A 2O5RA 3I4PA 2P5LC 4Q47A 1HBXG 4OMZA 5LLQA 2F5FA 4YFKF 2M1BA 4P9FA 2ID6A 2E34A 4RB1A 4A12A 4LG3A 4HEA2 4BH9A 3H5AA 5HDKA 1WRJA 5IOZA 2VIXA 1JTYA 1WGXA 2XASA 4PZJA 1K78A 2ADUA 3ERED 2STTA 2DQRA 4DBQA 3H36A 2QBYA 4CICA 4QPQA 3JW4A 4N9IA 4RBOA 1XGNA 2VB6A 4IPAA 5EGOB 3CD6I 5TISC 3FZVA 3RZOJ 2LOOA 3I5UA 1USTA 2RN7A 2VKEA 2EA4A 3SXYA 2PG4A 4ZZDA 4GXOA 2IGOA 4CXFA 4IHSA 3HKZN 4YIRX 2HEOA 1T39A 3SDBA 1Y0NA 5CVVA 2W24A 3A01A 1W0TA 2ZBKA 3B6AA 3LMMA 5AIQA 3HB9A 3H3ZA 1ZHFA 2FRHA 2F2EA 4RM3A 2QSFX 4ZDPA 3KEYA 1BN5A 1BBYA 3HOUJ 1ZK8A 3GZ5A 3H92A 3HRMA 3J80Z 2Y9ZA 4C3HJ 3FBNB 3I54A 2CG4A 2L7KA 1YJNI 3JRCA 4MHGA 1KONA 2BW3B 3SHFA 4D5FA 2Z16A 3WHBA 3PSFA 4I0AA 3RYPA 1I6HJ 2NNYA 3B73A 2XPWA 2V26A 3IC7A 2D5VA 5CYVA 1BIBA 3LAPA 1GUUA 3F8MA 1SD4A 4BU2A 4BQOA 2CW0F 3KP6A 2VODA 2A3SA 4PJNA 1SFOJ 2HNHA 4KIFA 3RJPA 3P9KA 4D1QA 5M5XJ 3D0SA 4OIQF 2RQQA 4FE4A 3S17J 3PSIA 3CO6C 1FIAA 1I39A 1Z67A 2IJLA 1YS7A 2ZO4A 2WB1A 3ESWB 1VQ4I 1IN5A 2D1VA 2DODA 1AWCA 3PO3J 5JVTA 2EFNA 2VT2A 2B7EA 2IP2A 5D8KB 2QKLB 1ZG5A 2TCTA 4A3BJ 3KP4A 2BHYA 5FKKA 2VI6A 3OYLA 5JR3A 3H0GJ 3SJMA 1ZGAA 3FIWA 1E3PA 1SMTA 2JWTA 3REOA 3CO7C 1OCCH 2FXAA 1A36A 2H94A 2V6EA 3RQIA 1RI7A 2HOAA 3CJQB 1HW2A 1QRYA 2BXYA 3S2DJ 1TLHB 3NARA 4EM1A 2BYVE 2F5EA 1LB2A 3K4NA 1GLNA 2JA8J 1ACIA 2ZNYA 3BTLA 2X85A 3E3VA 3VYRB 2R5ZB 2EFWA 4QSHA 1E3OC 3CTAA 1LFBA 3OYDA 2MLKA 2OPTA 4CYCB 1MIJA 3C18A 5K1YA 3GWZA 4XBFA 1P9QC 4PJJA 2W00A 1YJ9I 2V1UA 1FOWA 2RNJA 4YRVA 3LSHA 1KQ9A 3E5XA 3JRFA 1SVLA 3DU6A 2KDZA 2CW7A 5ILUA 2NOJB 3BZ6A 2DFIA 4BE0A 4AYBN 3FKIJ 1ZGJA 5GTHC 1TNTA 1SMYF 5CVJA 1MSEC 3WU1B 2L0KA 2X1EA 1I1SA 2UZKA 3PIPF 2XGCA 4YFXF 3M8JA 4XRMA 1W5TA 2FMLA 1Y39A 4RAYA 1BI0A 5HS8A 1IGNA 4LFUA 4IQJA 3L09A 2PJPA 2L7MP 3BZCA 1BR4A 2V6CA 4P9UA 1TBXA 2XROA 2M0CA 4C30A 1S6LA 3I0TA 4JP0A 4KIGA 4XLFA 2H8RA 1HSTA 3KLNA 2YU3A 1ZQ3P 1B72B 1X4PA 1TW3A 4I09A 4DGWB 4AIJA 3V4GA 3CC2I 3ZMDA 2VJJA 1VTNC 3FBIB 4M6XA 2WADA 4NUBA 2GAUA 2HGCA 2NVYJ 4LG0B 3WG9A 5F1JA 3ABLH 1U5TC 1HDDC 4X1EA 1D0ZA 1Z21A 2IVMA 1QPIA 1OR7A 4IQ4A 3M1CA 2GOXB 2W4SA 5E20A 3TO9A 1SAUA 1HXDA 3VOEA 3FDYA 1LFUP 1AKHB 1FMVA 3DQVC 2VKDA 1YG2A 3ZXSA 2UV1A 4M72A 2VQHA 3QP5A 4WK8F 3Q0VA 2PEXA 2RAEA 5L3BA 1VQNI 3DTEA 3MKLA 3ULQB 2ETHA 3FMSA 5JHUA 4KA4A 4Y52J 1WVRA 5K7HA 2E19A 2L02A 2HOEA 3Q0WA 3HOTA 3DKWA 3PL8A 2PI0A 3JCUC 1ZYRF 5DV5A 1YIJI 3HC7A 4RGXA 3HKZA 3DPUA 2CV2A 4HNTA 1UB9A 3WGIA 4B3XA 3KEQA 4RS8A 1D1BA 4HDVA 2XGXA 4BS9A 1TQIA 4YIIA 4WWCA 4CGZA 2JPCA 5LEJA 2QBYB 4MGRA 4II3A 3BG7A 2OF7A 2FNPA 3OSFA 2HYJA 2LY2A 1WPKA 3OSGA 4ZTJA 4PUSA 5F04A 3AAFA 1Y0UA 5CPRB 1IN8A 3VYTB 1X1BA 2DOAA 2A5YB 3HRUA 4B3AA 2BBYA 3CQZJ 4P1WA 3I55I 3CDLA 4MFDA 4LGWA 4ZYAA 1A31A 5E18F 2O8KA 3OY9A 3CMYA 2K27A 1NK2P 3S3NA 4A0XA 1O3SA 3MEXA 4Z2YA 1YW9A 1IXCA 1V55H 4CCMA 2JJ7A 2LSOA 5FKOA 1IRXA 4I98B 4S0HB 1SFXA 4KITB 1FOKA 1MBKA 1S7AA 2L01A 3HXLA 3FMQA 2ECCA 2VE8A 1XC5A 1K6YA 3IH2A 4JBAA 1TT0A 2ID3A 3QYFA 4HZFA 5LEKA 1X19A 2QQAA 3W6VA 1YRNB 2V1XA 4W1UA 1R9TJ 3AG3H 2CWEA 1G3TA 2X6WA 3C2BA 4BXUA 2VJIA 2QQ8A 3BWGA 3RCOA 1R5HA 1K79A 2WC2A 2DFHA 2XSDC 3SDGA 2NAZA 2K5CA 5LRRA 3IRRA 2HFHA 2BOLA 1KU2A 3V7CA 3F23A 1JT0A 4WXHA 3ABTA 3TOAA 5FLXZ 2AQFA 2E1OA 4DYCA 1IV6A 4C3JJ 4MQ9F 4UNOA 3LFKA 2DMTA 2QZ8A 3QOEA 1ZG3A 4OINF 1VZ0A 3LA3A 4GYGA 5GPAA 3FWEA 1Y8RB 3K1MA 4PDKA 1F4KA 3HIFA 5FRMA 2X9DA 4ZYDA 3DEEA 3TDUC 2XKOA 1LE8B 4D9JA 4UVBA 1IN4A 3OYHA 3AFHA 4A3FJ 2ME0A 3MMYB 3ZQLA 1O57A 1TNSA 2JT1A 4DYQA 3ZPLA 1S29A 3H5NA 3AL0C 4IOAF 4IO9F 1I50J 2LDUA 4WXCA 5JI6A 3RZDJ 4M73A 4EATA 2LTPA 1H9TA 5CQEA 4LG0A 1YE9A 4C9YA 1SAXA 2OTLI 2RKHA 4MO7A 1V4RA 5D6FA 3Q3SA 3H3UA 3ROUA 4EMSA 3LSPA 3SEQA 5KCMA 3OYJA 4L0ZB 3BTCA 2VJ5A 2Y2ZA 3S1NJ 4QIWN 1TWHJ 2L54A 4FASD 2NS0A 4UY8I 2Y48A 3HSEA 4B44A 4M6YA 2X6YA 1D3YA 5J47A 3WTTC 2DLLA 3PO2J 3WTWC 2IXSA 3T8TA 1ITYA 2DA4A 1SANA 5M3FJ 4AVZA 2LP0A
chains in the Genus database with same CATH topology
1FY7A 3C7JA 4KICA 5LHHA 4CDGA 3KE2A 5KVRA 2O61A 3U2RA 5FO5A 1OYYA 1IRGA 3SFZA 2P5VA 3L2CA 4U7DA 1DPRA 1Z9CA 1TQMA 2P6TA 4YFNF 5D4SA 4WX9A 5ILVA 4NB5A 1OKRA 3GVAA 1SD5A 4RGUA 3WGGA 1S7OA 5HDNA 2EV0A 3ZP5A 4LB5A 4U0VA 3HYIA 1ULYA 3DPLC 4WF2A 4HF2A 6PAXA 3BDDA 4ETSA 2Z5UA 4EVIA 3RYRA 4R8HA 3RPUA 3HSFA 3O3KA 1I27A 1XN7A 5L3EA 4ENNA 1KQ0A 2DQLA 2W57A 4L9TA 3F6OA 1IF1A 3GFJA 1ZG1A 2F5CA 3F3XA 3KZYA 2OZUA 1GXQA 1XDSA 2Q8KA 4NQWA 1KU9A 5K5QA 4MTDA 2CGPA 2XAFA 5LHGA 4MEYF 1KGSA 2XRNA 5E1XA 5LRSA 2VBXA 2RVCA 2EK5A 2WV0A 1HKSA 1T6SA 2ZMEB 3KP3A 1LDDA 1BM9A 1JE8A 1UHWA 5D5WB 1MJ9A 3CDHA 4MNUA 5CVIA 3LWFA 3IKVA 4D0PA 3HTSB 2O3FA 2FEZA 4M71A 2P7CB 3OV8A 3HSRA 1LVAA 1FSEA 3E6DA 2Y75A 4UUVA 4O3MA 3M8EA 2FOKA 3RI4A 4ON0A 1ZRFA 2PMUA 1ON2A 1ZRDA 4ESFA 4AIKA 1SFUA 5FB2A 3E6CC 1IN7A 4LLNA 3IWFA 2W84A 2HDCA 3PQJA 3WE2A 1RUNA 1J5YA 1HKQA 3P7NA 1CF7A 5DD8A 2DPDA 1R1UA 3RKXA 4L5IA 5FD5A 2VBZA 2L4AA 3J81Z 4XLNF 3JTGA 1AOYA 3M7GA 5ICCA 1STZA 3ZN0A 4Q5SF 1E17A 2JSCA 1XGMA 5BOXA 1ZN2A 2MD5A 4ZYEA 2DPUA 3TO6A 3GFMA 2VN2A 2UWMA 2VT3A 4P55A 2IA1A 2J5OA 4CO8A 3K0LA 2ISZA 2HYFA 2XKPA 2X4HA 2E7XA 2TDXA 3ISPA 1F9NA 4AWXB 3V7SA 3G73A 4U7BA 2RQPA 2R7FA 3P9IA 3TQNA 1U2WA 1B59A 3EETA 5J8CA 5K5OA 2M8EA 5HLIA 1XMKA 5FLXK 1F5TA 5D4RA 2GIVA 1FPQA 5CVUA 1W7PB 1LJ9A 4F7ZA 2GA1A 1J7KA 2UXXA 3TOBA 2XAJA 1FYLA 3TO7A 1FP2A 1OYIA 3T0YA 1D8JA 1DDNA 4QLCU 5LGUA 3K2ZA 3ECOA 1BJAA 4KMUX 3DFGA 5AONA 2AS5F 1YFHA 3M8FA 2NYXA 5DYMA 2VONA 4BYYA 4FX4A 4LK1F 4A6DA 4XLPF 4EGYA 1ZRCA 2P5KA 3GX4X 2A6EF 1ON1A 1T98A 1IAWA 2JRTA 1RZ4A 1LDJA 2OQRA 2VOPA 1YIOA 4YIFA 1MGTA 3DP7A 5A2QZ 1QQIA 1JGSA 2O0YA 2G7UA 5J8FA 2IPQX 4UXNA 2YX4A 4HF1A 1G6NA 4Q4ZF 1DPUA 3QU6A 2EFPA 5BMZA 3FM3A 2YPRA 4Y13A 3LA7A 3IRQA 5IT9K 2XV4S 1UFMA 1BI2A 1RNLA 3MZYA 1TQPA 1JHHA 4CYDA 3V7RA 4KT5C 2ZXJA 5DCFA 1O3RA 3WTSC 1OPCA 2E1CA 1YW8A 3WTZA 1P4AA 4I2OA 2DK5A 4HAMA 2M30A 1G3SA 4R79A 5A2QK 1KU3A 2DI3A 2KJBA 2XVCA 2JTVA 3DEUA 1XGOA 2DK8A 1RUOA 4P5OA 4LB6B 4DQ2A 3DPTA 1G3YA 1EV7A 3K1NA 3W6JB 3J7AO 4OIPF 4HBLA 4EJWA 3HHHA 1FYKA 3Q9SA 5L3GA 1IXRC 2MC3A 2MBFA 2QVOA 4PGGA 3ABUA 1IRFA 3HUGA 1MDMA 3R0AA 5EEGA 2ZMEA 1J2XA 5HS7A 3S2WA 4EM2A 3QU3A 1SD6A 5D6EA 3N97A 1Z91A 2ZNZA 5AIPA 3TGNA 2XAGA 1QNTA 2LF8A 5E8IA 3BPVA 1W7PD 4HW0A 1BC8C 4MTEA 2HTJA 4S04A 5K5RA 2DT5A 5DEQA 4I0BA 3IHUA 1MJAA 3LSTA 3M9AA 1O3QA 3GYHX 2FF4A 3ZMSA 1LEAA 1BIAA 3MWMA 2O8XA 3GFIA 1HKTA 2LNBA 2KRFA 2HWVA 1X3UA 1ZARA 4G6DA 1LDKB 3F72A 1TW2A 3R4KA 1EH6A 3BROA 4LLLA 2F5DA 3C3WA 4KIBA 3WGHA 1T38A 3T8RA 2C6YA 5H6QA 2ZKZA 1P6RA 2HZTA 2GWRA 1S3JA 1OYWA 3E6BA 5DCMA 4UVCA 5DUIA 2A68F 3CUQA 1SFEA 4EJTA 3U9GA 2E7WA 4EJUA 2A61A 1FP1D 1D5VA 3RKYA 2FSWA 4A0ZA 1PDNC 1YS6A 4IHTA 4XSZF 1NHAA 4G6QA 4G8XA 4I01A 4O5VA 2VBWA 3HRSA 4BHCA 5ILSA 2ZCWA 3NEUA 4ZYHA 1B4AA 1FWZA 1J9IA 1C0WA 3FX3A 4BNCA 3SZPA 1GXPA 3KLOA 1ZH5A 2Z99A 3VFZA 2EFOA 3PQKA 5JFRA 3EDPA 1HW1A 4Y17A 4KDPA 1HQCA 1W7PA 3O2PE 3JSPA 5EEHA 3ZMZA 5ERIA 4E70A 4NHJA 5F6FA 2WTEA 1QPMA 3DXJF 3QPTA 1PP8F 1BI3A 4GO1A 3SZTA 1PP7U 4XRFA 4TV7A 2HS5A 2FA5A 5F1RA 2R3SA 2QYOA 3F21A 2FBHA 5FGMA 3KFWX 3K69A 1OMIA 1KU7A 1O7FA 5D5VB 1K6OA 5D5XB 2XIGA 2CSOA 3E5QA 5FFXA 3T5XA 4GCVA 4HV6A 1FX7A 4BAYA 1Z1DA 3KP5A 2JPBA 3JAMZ 2A6HF 5DD4A 2OA4A 3CLOA 3K9TA 1KYZA 5L3DA 2EV6A 3BP8A 3WTXC 3RIRA 1MD0A 4EJVA 3BPXA 3CUQB 1FBQA 3CUOA 2BEOA 3R0JA 5E17F 2VE9A 1R36A 1V3FA 2HTSA 3V8LA 2IRFG 4AVPA 1H9GA 2YSRA 2CYYA 3LQQA 3ECHA 2DO7A 3NQOA 2MH2A 1YW7A 2RGVA 1IUYA 1ZLJA 2PQ8A 4RGRA 3GFLA 3IKTA 4QWQA 2O6GE 4G7HF 1I6XA 4LLGF 1FC3A 2OQGA 3FXRA 4KN4X 4L18B 3E6MA 2B0LA 1BI1A 3GW2A 2Y0MA 5E1ZB 2DBBA 1ODDA 2KKOA 2GA2A 4A5NA 2OAZA 5F64A 5TJJA 1U78A 4MQVA 5BS6A 1R22A 2ISYA 2H6CA 4YG2F 2ZFWA 2QENA 3KCCA 1XB4A 3F8BA 3WTVC 4ENKA 3SQNA 1SD7A 3RPQA 2FNAA 4I7HA 1WQ2A 3FXUA 1I1GA 5HOOA 3JTHA 3N4MA 1J59A 4ESBA 3L9FA 4UV8A 4BHBA 2P7VB 4S05A 3HRTA 5ED4A 2EB7A 1G4DA 3Q9VA 2QLZA 1GHCA 3V8KA 1XCBA 2IA2A 2OBPA 1R58A 1W4MA 2V1DA 4OIRF 1MDMB 1S8NA 3VODA 4BHPA 3GZ6A 4LMYA 4EJOA 3QPHA 4U0YA 1FBSA 1EH7A 2QQ9A 3COAC 3FXQA 5ICEA 2BV6A 3ML6A 1H0MA 2HKXA 1FNNA 2HQRA 3LQRA 3RDIA 4JQFA 4UHTA 3F6VA 1USSA 2MH9A 2FBIA 4HX8A 1T0FA 5L3CA 2GZWA 2L4MA 2QQBA 4ENJA 3E97A 2YR2A 4N0BA 4OOIA 4M9XA 5HVQC 1QZYA 4L9VA 3W6KB 2ESNA 4RB3C 3DV8A 2W85A 2W25A 1IN6A 1QZZA 2DAOA 1BOAA 2COMA 4ASNA 3R60A 4M9ZA 1TTYA 3L7WA 3ZMTA 5LHIA 2PLYA 2VC1A 1CF7B 5LGTA 2P6SA 3EYYA 3KETA 3I64A 2ESHA 2G7HA 3Q5FA 1F1ZA 3WU0A 5HLHA 2K4BA 2FMYA 3QAHA 3VEPA 2XAHA 3IL2A 2PMHA 3ZMVA 5IT3A 2M5WA 3QOPA 1MZBA 2IW5A 3TKYA 4BQAA 3MAJA 1IZ1A 1UCRA 4FT8A 4P96A 4KFCA 1FT9A 2LKPA 3I53A 1KA8A 4IRIA 1WSUA 4HF0A 3J80K 4Q48A 3DF8A 1KYWA 3BJOA 1HSJA 4ZH4F 3V8JA 3KEOA 3KP2A 1WI9A 2K02A 1YQAA 3J81K 5ICFA 3U1DA 2A69F 4L0YB 1ZREA 1P4XA 1EH8A 3R61A 2MLGA 4H0EA 3KP7A 1XSDA 4CZZA 4IJAA 5DCMB 3RTRA 4GGGA 4IRHA 3WTYC 1R23A 2EV5A 2PBIA 4PGHA 2MA3A 5KK1A 4I02A 3MFKA 4B8XA 4WXDA 1CGPA 1HW5A 2X0LA 2OU2A 2GXBA 1REPC 4KMFA 1B1BA 1XSVA 3L00A 4JK1X 3ZN1A 4ESJA 4Y15A 3G3ZA 4KNYA 3BJ6A 2P8TA 3GEZA 3EQLF 1FBUA 2GXGA 3EYIA 3PFIA 4EM0B 2Q2EA 3M1EA 1Z6RA 4G7ZF 1U5TB 2RC4A 4O6JA 1B6AA 2J5PA 4L9NA 5FD6A 3ZQ7A 2IA0A 4FX0A 3FHZA 5L3FA 2Z9OA 2QWWA 3VB2A 1Z6TA 5D5UB 1J0RA 5DDGA 3GO5A 1LNWA 1PUEE 5E8GA 4FHTA 5HDGA 3FM5A 4A6EA 1LQ1A 2ELHA 1B9MA 2R7DA 4EGZA 1FZPB 2K7LA 4RB2C 3F8FA 1XDUA 2D1HA 3BY6A 1U3EM 4GYIA 4A0YA 3TDZC 2STWA 2GQQA 4M74A 2Q0OA 3P9CA 2EFQA 1ZAOA 1MKMA 1UHMA 3GF2A 4ZYGA 5CVRA 1KQ8A 2XUBA 4RGSA 2E1NA 4AD9A 3LA2A 2Z3YA 2VBYA 4UVAA 2KIFA 3C1DA 2D45A 2VOOA 3RKWA 3E5UA 3HTUA 2XHKA 1MJBA 1P92A 1Z05A 3KZZA 4WCGA 2V9VA 4HQEA 3OOPA 4IF4A 2JZYA 3O6BB 4HOBA 3D5LA 3I58A 1XSXA 4HYEA 4U88A 2VC0A 4EV0A 4KN7X 4RAZA 4ENMA 1IW7F 1YLFA 1GVJA 4XSXF 3I59B 3NRVA 3IWZA 3R6SA 3WTUC 4HLYA 1DP7P 3MZHA 1DUXC 4IRGA 5H20A 2HKOA 1RIOH 3F22A 1XGSA 1ZLKA 3ELKA 1L3LA 4ZZLA 1R5GA 3ZMUA 1YTYA 3GLXA 4RB0A 1JHFA 2QUFA 4B09A 1JXSA 2M87A 2DW4A 2FE3A 2G9WA 2HYGD 1WKMA 2KIUA 1Z7UA 5CLSA 3FMRA 4IXAA 1J75A 4HA8A 2D2WA 3GXOA 5ICGA 4LJZF 4LK0F 2P4WA 3I71A 3JAMK 2DU9A 4U0WA 4HX7A 2YX7A 3JSOA 4KUMA 4PCQA 5BPDA 5BQTA 2UXNA 2OD5A 1R7JA 3WE3A 1W5SA 2BE5F 3BOQA 3MCZA 4G9YA 1K78B 2NRAC 1LEBA 2QM3A 4HQMA 1P2FA 4HX4A 4LD5A 1ONVA 4R1HA 1BC7C 1I5ZA 1T2KA 4L9JA 4N9HA 4A5MA 1XMAA 3MQ0A 2KJCA 3F8NA 5D8LB 4HV5A 4HLXA 4OU0A 4CHUA 3EUHA 2OZ6A 2Z33A 1D8KA 4IVNA 2H09A 1A04A 5CJ9A 1R1VA 2FBKA 5H6RA 1R1TA 5E1WA 2K86A 4DNCA 3I59A 3QRFF 4G94A 2HQNA 1E2XA 2FQ3A 1G3WA 1FSHA 1K7AA 2XAQA 4MEXF 1B9NA 2BGCA 5LBQA 5HS9A 4K2EA 2KIMA 1FLIA 2L3DA 3HHGA 4KYWA 3T1BA 3GUDA 1P4WA 1Q1HA 2CQKA 1L0OC 2LF7A 2CFXA 1YYVA 2IT0A 3HOSA 4A2UA 4HDUA 2H6BA 1FYMA 1WWXA 2DTRA 1O3TA 5HLGA 4EQQA 2VXZA 5DUKA 4M9SA 2WWYA 2A07F 3FF5A 1YO5C 2CO5A 2PFBA 2HR3A 2AXLA 3F8CA 3B02A 1R00A 2EJRA 5BPIA 3CJNA 1QGPA 2ZJ2A 3BJAA 5TRDA 4L5JA 2EWNA 3K1PA 5J6XA 4OIOF 5FFZA 1U5TA 1O7LA 1QO0D 3WODF 1XCVA 1XD7A 3LAJA 2M45A 2ACJA 2RDPA 2K4JA 4UV9A 5LGNA 2O03A 4OMYA 1U8RA 5IT9Z 4G7OF 3CUQC 2FU4A 2V79A 4AIHA 1IXSB 1QBJA 2RV8A 1U6GA 2EA2A 2NNNA 2PN6A 2H27A 3QP6A 3I4PA 2P5LC 4Q47A 1HBXG 4OMZA 5LLQA 2F5FA 4YFKF 2M1BA 4P9FA 4RB1A 4A12A 4BH9A 5HDKA 1WRJA 2XASA 4PZJA 1K78A 2ADUA 3ERED 2STTA 2DQRA 2QBYA 4CICA 3JW4A 4N9IA 1XGNA 4IPAA 3FZVA 3I5UA 1USTA 2RN7A 2EA4A 3SXYA 2PG4A 4ZZDA 4GXOA 4CXFA 4IHSA 2HEOA 1T39A 5CVVA 2W24A 2ZBKA 5AIQA 3H3ZA 1ZHFA 2FRHA 2F2EA 1BN5A 1BBYA 3HRMA 3GZ5A 3H92A 3J80Z 3I54A 2CG4A 4MHGA 3SHFA 4I0AA 3RYPA 2NNYA 3B73A 3IC7A 5CYVA 1BIBA 3LAPA 3F8MA 1SD4A 2CW0F 3KP6A 2VODA 2A3SA 4KIFA 3RJPA 3P9KA 3D0SA 4OIQF 3CO6C 2IJLA 1YS7A 2ZO4A 1IN5A 2D1VA 1AWCA 5JVTA 2EFNA 2VT2A 2IP2A 5D8KB 1ZG5A 3KP4A 5JR3A 1ZGAA 1SMTA 3REOA 3CO7C 2FXAA 2H94A 1RI7A 1HW2A 1TLHB 4EM1A 2BYVE 2F5EA 1LB2A 2ZNYA 3E3VA 2EFWA 3CTAA 2MLKA 3C18A 5K1YA 3GWZA 4XBFA 2V1UA 2RNJA 1KQ9A 3E5XA 5ILUA 3BZ6A 2DFIA 1ZGJA 1TNTA 1SMYF 5CVJA 3WU1B 1I1SA 2UZKA 4YFXF 1W5TA 2FMLA 4RAYA 1BI0A 5HS8A 4LFUA 2PJPA 3L09A 2V6CA 4P9UA 1TBXA 2XROA 1S6LA 3I0TA 4KIGA 1HSTA 3KLNA 2YU3A 1TW3A 4I09A 4AIJA 3V4GA 3ZMDA 1VTNC 4M6XA 2GAUA 2HGCA 4LG0B 3WG9A 1U5TC 2IVMA 1OR7A 5E20A 3TO9A 1HXDA 3VOEA 3DQVC 1YG2A 4M72A 3QP5A 4WK8F 2PEXA 5L3BA 3ULQB 2ETHA 3FMSA 5JHUA 4KA4A 2L02A 2HOEA 3HOTA 3DKWA 2PI0A 1ZYRF 5DV5A 4RGXA 1UB9A 3WGIA 3KEQA 4RS8A 4HDVA 2XGXA 1TQIA 4YIIA 4WWCA 4CGZA 2JPCA 5LEJA 2QBYB 4MGRA 2FNPA 3AAFA 1Y0UA 1IN8A 2A5YB 3HRUA 2BBYA 4LGWA 5E18F 2K27A 4A0XA 1O3SA 3MEXA 4Z2YA 1YW9A 1IXCA 2LSOA 4I98B 1SFXA 1FOKA 1S7AA 2L01A 3FMQA 2VE8A 4JBAA 4HZFA 5LEKA 2QQAA 2V1XA 2CWEA 1G3TA 4BXUA 3BWGA 1R5HA 1K79A 2WC2A 2NAZA 5LRRA 3IRRA 2HFHA 1KU2A 3V7CA 3F23A 4WXHA 3ABTA 3TOAA 5FLXZ 4MQ9F 4UNOA 3LFKA 2QZ8A 1ZG3A 4OINF 3LA3A 4GYGA 3FWEA 4PDKA 3K1MA 1F4KA 3HIFA 4ZYDA 3TDUC 2XKOA 4UVBA 1IN4A 1O57A 1TNSA 2JT1A 3ZPLA 1S29A 2LDUA 4WXCA 5JI6A 4M73A 1H9TA 4LG0A 1SAXA 2RKHA 1V4RA 5D6FA 3ROUA 3H3UA 4EMSA 4L0ZB 2L54A 2NS0A 2Y48A 3HSEA 4M6YA 1D3YA 3WTTC 2DLLA 3WTWC 3T8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FY7 A;  3C7J A;  4KIC A;  5LHH A;  4CDG A;  3KE2 A;  5KVR A;  2O61 A;  3U2R A;  5FO5 A;  1OYY A;  1IRG A;  3SFZ A;  2P5V A;  3L2C A;  4U7D A;  1DPR A;  1Z9C A;  1TQM A;  2P6T A;  4YFN F;  5D4S A;  4WX9 A;  5ILV A;  4NB5 A;  1OKR A;  3GVA A;  1SD5 A;  4RGU A;  3WGG A;  1S7O A;  5HDN A;  2EV0 A;  3ZP5 A;  4LB5 A;  4U0V A;  3HYI A;  1ULY A;  3DPL C;  4WF2 A;  4HF2 A;  6PAX A;  3BDD A;  4ETS A;  2Z5U A;  4EVI A;  3RYR A;  4R8H A;  3RPU A;  3HSF A;  3O3K A;  1I27 A;  1XN7 A;  5L3E A;  4ENN A;  1KQ0 A;  2DQL A;  2W57 A;  4L9T A;  3F6O A;  1IF1 A;  3GFJ A;  1ZG1 A;  2F5C A;  3F3X A;  3KZY A;  2OZU A;  1GXQ A;  1XDS A;  2Q8K A;  4NQW A;  1KU9 A;  5K5Q A;  4MTD A;  2CGP A;  2XAF A;  5LHG A;  4MEY F;  1KGS A;  2XRN A;  5E1X A;  5LRS A;  2VBX A;  2RVC A;  2EK5 A;  2WV0 A;  1HKS A;  1T6S A;  2ZME B;  3KP3 A;  1LDD A;  1BM9 A;  1JE8 A;  1UHW A;  5D5W B;  1MJ9 A;  3CDH A;  4MNU A;  5CVI A;  3LWF A;  3IKV A;  4D0P A;  3HTS B;  2O3F A;  2FEZ A;  4M71 A;  2P7C B;  3OV8 A;  3HSR A;  1LVA A;  1FSE A;  3E6D A;  2Y75 A;  4UUV A;  4O3M A;  3M8E A;  2FOK A;  3RI4 A;  4ON0 A;  1ZRF A;  2PMU A;  1ON2 A;  1ZRD A;  4ESF A;  4AIK A;  1SFU A;  5FB2 A;  3E6C C;  1IN7 A;  4LLN A;  3IWF A;  2W84 A;  2HDC A;  3PQJ A;  3WE2 A;  1RUN A;  1J5Y A;  1HKQ A;  3P7N A;  1CF7 A;  5DD8 A;  2DPD A;  1R1U A;  3RKX A;  4L5I A;  5FD5 A;  2VBZ A;  2L4A A;  3J81 Z;  4XLN F;  3JTG A;  1AOY A;  3M7G A;  5ICC A;  1STZ A;  3ZN0 A;  4Q5S F;  1E17 A;  2JSC A;  1XGM A;  5BOX A;  1ZN2 A;  2MD5 A;  4ZYE A;  2DPU A;  3TO6 A;  3GFM A;  2VN2 A;  2UWM A;  2VT3 A;  4P55 A;  2IA1 A;  2J5O A;  4CO8 A;  3K0L A;  2ISZ A;  2HYF A;  2XKP A;  2X4H A;  2E7X A;  2TDX A;  3ISP A;  1F9N A;  4AWX B;  3V7S A;  3G73 A;  4U7B A;  2RQP A;  2R7F A;  3P9I A;  3TQN A;  1U2W A;  1B59 A;  3EET A;  5J8C A;  5K5O A;  2M8E A;  5HLI A;  1XMK A;  5FLX K;  1F5T A;  5D4R A;  2GIV A;  1FPQ A;  5CVU A;  1W7P B;  1LJ9 A;  4F7Z A;  2GA1 A;  1J7K A;  2UXX A;  3TOB A;  2XAJ A;  1FYL A;  3TO7 A;  1FP2 A;  1OYI A;  3T0Y A;  1D8J A;  1DDN A;  4QLC U;  5LGU A;  3K2Z A;  3ECO A;  1BJA A;  4KMU X;  3DFG A;  5AON A;  2AS5 F;  1YFH A;  3M8F A;  2NYX A;  5DYM A;  2VON A;  4BYY A;  4FX4 A;  4LK1 F;  4A6D A;  4XLP F;  4EGY A;  1ZRC A;  2P5K A;  3GX4 X;  2A6E F;  1ON1 A;  1T98 A;  1IAW A;  2JRT A;  1RZ4 A;  1LDJ A;  2OQR A;  2VOP A;  1YIO A;  4YIF A;  1MGT A;  3DP7 A;  5A2Q Z;  1QQI A;  1JGS A;  2O0Y A;  2G7U A;  5J8F A;  2IPQ X;  4UXN A;  2YX4 A;  4HF1 A;  1G6N A;  4Q4Z F;  1DPU A;  3QU6 A;  2EFP A;  5BMZ A;  3FM3 A;  2YPR A;  4Y13 A;  3LA7 A;  3IRQ A;  5IT9 K;  2XV4 S;  1UFM A;  1BI2 A;  1RNL A;  3MZY A;  1TQP A;  1JHH A;  4CYD A;  3V7R A;  4KT5 C;  2ZXJ A;  5DCF A;  1O3R A;  3WTS C;  1OPC A;  2E1C A;  1YW8 A;  3WTZ A;  1P4A A;  4I2O A;  2DK5 A;  4HAM A;  2M30 A;  1G3S A;  4R79 A;  5A2Q K;  1KU3 A;  2DI3 A;  2KJB A;  2XVC A;  2JTV A;  3DEU A;  1XGO A;  2DK8 A;  1RUO A;  4P5O A;  4LB6 B;  4DQ2 A;  3DPT A;  1G3Y A;  1EV7 A;  3K1N A;  3W6J B;  3J7A O;  4OIP F;  4HBL A;  4EJW A;  3HHH A;  1FYK A;  3Q9S A;  5L3G A;  1IXR C;  2MC3 A;  2MBF A;  2QVO A;  4PGG A;  3ABU A;  1IRF A;  3HUG A;  1MDM A;  3R0A A;  5EEG A;  2ZME A;  1J2X A;  5HS7 A;  3S2W A;  4EM2 A;  3QU3 A;  1SD6 A;  5D6E A;  3N97 A;  1Z91 A;  2ZNZ A;  5AIP A;  3TGN A;  2XAG A;  1QNT A;  2LF8 A;  5E8I A;  3BPV A;  1W7P D;  4HW0 A;  1BC8 C;  4MTE A;  2HTJ A;  4S04 A;  5K5R A;  2DT5 A;  5DEQ A;  4I0B A;  3IHU A;  1MJA A;  3LST A;  3M9A A;  1O3Q A;  3GYH X;  2FF4 A;  3ZMS A;  1LEA A;  1BIA A;  3MWM A;  2O8X A;  3GFI A;  1HKT A;  2LNB A;  2KRF A;  2HWV A;  1X3U A;  1ZAR A;  4G6D A;  1LDK B;  3F72 A;  1TW2 A;  3R4K A;  1EH6 A;  3BRO A;  4LLL A;  2F5D A;  3C3W A;  4KIB A;  3WGH A;  1T38 A;  3T8R A;  2C6Y A;  5H6Q A;  2ZKZ A;  1P6R A;  2HZT A;  2GWR A;  1S3J A;  1OYW A;  3E6B A;  5DCM A;  4UVC A;  5DUI A;  2A68 F;  3CUQ A;  1SFE A;  4EJT A;  3U9G A;  2E7W A;  4EJU A;  2A61 A;  1FP1 D;  1D5V A;  3RKY A;  2FSW A;  4A0Z A;  1PDN C;  1YS6 A;  4IHT A;  4XSZ F;  1NHA A;  4G6Q A;  4G8X A;  4I01 A;  4O5V A;  2VBW A;  3HRS A;  4BHC A;  5ILS A;  2ZCW A;  3NEU A;  4ZYH A;  1B4A A;  1FWZ A;  1J9I A;  1C0W A;  3FX3 A;  4BNC A;  3SZP A;  1GXP A;  3KLO A;  1ZH5 A;  2Z99 A;  3VFZ A;  2EFO A;  3PQK A;  5JFR A;  3EDP A;  1HW1 A;  4Y17 A;  4KDP A;  1HQC A;  1W7P A;  3O2P E;  3JSP A;  5EEH A;  3ZMZ A;  5ERI A;  4E70 A;  4NHJ A;  5F6F A;  2WTE A;  1QPM A;  3DXJ F;  3QPT A;  1PP8 F;  1BI3 A;  4GO1 A;  3SZT A;  1PP7 U;  4XRF A;  4TV7 A;  2HS5 A;  2FA5 A;  5F1R A;  2R3S A;  2QYO A;  3F21 A;  2FBH A;  5FGM A;  3KFW X;  3K69 A;  1OMI A;  1KU7 A;  1O7F A;  5D5V B;  1K6O A;  5D5X B;  2XIG A;  2CSO A;  3E5Q A;  5FFX A;  3T5X A;  4GCV A;  4HV6 A;  1FX7 A;  4BAY A;  1Z1D A;  3KP5 A;  2JPB A;  3JAM Z;  2A6H F;  5DD4 A;  2OA4 A;  3CLO A;  3K9T A;  1KYZ A;  5L3D A;  2EV6 A;  3BP8 A;  3WTX C;  3RIR A;  1MD0 A;  4EJV A;  3BPX A;  3CUQ B;  1FBQ A;  3CUO A;  2BEO A;  3R0J A;  5E17 F;  2VE9 A;  1R36 A;  1V3F A;  2HTS A;  3V8L A;  2IRF G;  4AVP A;  1H9G A;  2YSR A;  2CYY A;  3LQQ A;  3ECH A;  2DO7 A;  3NQO A;  2MH2 A;  1YW7 A;  2RGV A;  1IUY A;  1ZLJ A;  2PQ8 A;  4RGR A;  3GFL A;  3IKT A;  4QWQ A;  2O6G E;  4G7H F;  1I6X A;  4LLG F;  1FC3 A;  2OQG A;  3FXR A;  4KN4 X;  4L18 B;  3E6M A;  2B0L A;  1BI1 A;  3GW2 A;  2Y0M A;  5E1Z B;  2DBB A;  1ODD A;  2KKO A;  2GA2 A;  4A5N A;  2OAZ A;  5F64 A;  5TJJ A;  1U78 A;  4MQV A;  5BS6 A;  1R22 A;  2ISY A;  2H6C A;  4YG2 F;  2ZFW A;  2QEN A;  3KCC A;  1XB4 A;  3F8B A;  3WTV C;  4ENK A;  3SQN A;  1SD7 A;  3RPQ A;  2FNA A;  4I7H A;  1WQ2 A;  3FXU A;  1I1G A;  5HOO A;  3JTH A;  3N4M A;  1J59 A;  4ESB A;  3L9F A;  4UV8 A;  4BHB A;  2P7V B;  4S05 A;  3HRT A;  5ED4 A;  2EB7 A;  1G4D A;  3Q9V A;  2QLZ A;  1GHC A;  3V8K A;  1XCB A;  2IA2 A;  2OBP A;  1R58 A;  1W4M A;  2V1D A;  4OIR F;  1MDM B;  1S8N A;  3VOD A;  4BHP A;  3GZ6 A;  4LMY A;  4EJO A;  3QPH A;  4U0Y A;  1FBS A;  1EH7 A;  2QQ9 A;  3COA C;  3FXQ A;  5ICE A;  2BV6 A;  3ML6 A;  1H0M A;  2HKX A;  1FNN A;  2HQR A;  3LQR A;  3RDI A;  4JQF A;  4UHT A;  3F6V A;  1USS A;  2MH9 A;  2FBI A;  4HX8 A;  1T0F A;  5L3C A;  2GZW A;  2L4M A;  2QQB A;  4ENJ A;  3E97 A;  2YR2 A;  4N0B A;  4OOI A;  4M9X A;  5HVQ C;  1QZY A;  4L9V A;  3W6K B;  2ESN A;  4RB3 C;  3DV8 A;  2W85 A;  2W25 A;  1IN6 A;  1QZZ A;  2DAO A;  1BOA A;  2COM A;  4ASN A;  3R60 A;  4M9Z A;  1TTY A;  3L7W A;  3ZMT A;  5LHI A;  2PLY A;  2VC1 A;  1CF7 B;  5LGT A;  2P6S A;  3EYY A;  3KET A;  3I64 A;  2ESH A;  2G7H A;  3Q5F A;  1F1Z A;  3WU0 A;  5HLH A;  2K4B A;  2FMY A;  3QAH A;  3VEP A;  2XAH A;  3IL2 A;  2PMH A;  3ZMV A;  5IT3 A;  2M5W A;  3QOP A;  1MZB A;  2IW5 A;  3TKY A;  4BQA A;  3MAJ A;  1IZ1 A;  1UCR A;  4FT8 A;  4P96 A;  4KFC A;  1FT9 A;  2LKP A;  3I53 A;  1KA8 A;  4IRI A;  1WSU A;  4HF0 A;  3J80 K;  4Q48 A;  3DF8 A;  1KYW A;  3BJO A;  1HSJ A;  4ZH4 F;  3V8J A;  3KEO A;  3KP2 A;  1WI9 A;  2K02 A;  1YQA A;  3J81 K;  5ICF A;  3U1D A;  2A69 F;  4L0Y B;  1ZRE A;  1P4X A;  1EH8 A;  3R61 A;  2MLG A;  4H0E A;  3KP7 A;  1XSD A;  4CZZ A;  4IJA A;  5DCM B;  3RTR A;  4GGG A;  4IRH A;  3WTY C;  1R23 A;  2EV5 A;  2PBI A;  4PGH A;  2MA3 A;  5KK1 A;  4I02 A;  3MFK A;  4B8X A;  4WXD A;  1CGP A;  1HW5 A;  2X0L A;  2OU2 A;  2GXB A;  1REP C;  4KMF A;  1B1B A;  1XSV A;  3L00 A;  4JK1 X;  3ZN1 A;  4ESJ A;  4Y15 A;  3G3Z A;  4KNY A;  3BJ6 A;  2P8T A;  3GEZ A;  3EQL F;  1FBU A;  2GXG A;  3EYI A;  3PFI A;  4EM0 B;  2Q2E A;  3M1E A;  1Z6R A;  4G7Z F;  1U5T B;  2RC4 A;  4O6J A;  1B6A A;  2J5P A;  4L9N A;  5FD6 A;  3ZQ7 A;  2IA0 A;  4FX0 A;  3FHZ A;  5L3F A;  2Z9O A;  2QWW A;  3VB2 A;  1Z6T A;  5D5U B;  1J0R A;  5DDG A;  3GO5 A;  1LNW A;  1PUE E;  5E8G A;  4FHT A;  5HDG A;  3FM5 A;  4A6E A;  1LQ1 A;  2ELH A;  1B9M A;  2R7D A;  4EGZ A;  1FZP B;  2K7L A;  4RB2 C;  3F8F A;  1XDU A;  2D1H A;  3BY6 A;  1U3E M;  4GYI A;  4A0Y A;  3TDZ C;  2STW A;  2GQQ A;  4M74 A;  2Q0O A;  3P9C A;  2EFQ A;  1ZAO A;  1MKM A;  1UHM A;  3GF2 A;  4ZYG A;  5CVR A;  1KQ8 A;  2XUB A;  4RGS A;  2E1N A;  4AD9 A;  3LA2 A;  2Z3Y A;  2VBY A;  4UVA A;  2KIF A;  3C1D A;  2D45 A;  2VOO A;  3RKW A;  3E5U A;  3HTU A;  2XHK A;  1MJB A;  1P92 A;  1Z05 A;  3KZZ A;  4WCG A;  2V9V A;  4HQE A;  3OOP A;  4IF4 A;  2JZY A;  3O6B B;  4HOB A;  3D5L A;  3I58 A;  1XSX A;  4HYE A;  4U88 A;  2VC0 A;  4EV0 A;  4KN7 X;  4RAZ A;  4ENM A;  1IW7 F;  1YLF A;  1GVJ A;  4XSX F;  3I59 B;  3NRV A;  3IWZ A;  3R6S A;  3WTU C;  4HLY A;  1DP7 P;  3MZH A;  1DUX C;  4IRG A;  5H20 A;  2HKO A;  1RIO H;  3F22 A;  1XGS A;  1ZLK A;  3ELK A;  1L3L A;  4ZZL A;  1R5G A;  3ZMU A;  1YTY A;  3GLX A;  4RB0 A;  1JHF A;  2QUF A;  4B09 A;  1JXS A;  2M87 A;  2DW4 A;  2FE3 A;  2G9W A;  2HYG D;  1WKM A;  2KIU A;  1Z7U A;  5CLS A;  3FMR A;  4IXA A;  1J75 A;  4HA8 A;  2D2W A;  3GXO A;  5ICG A;  4LJZ F;  4LK0 F;  2P4W A;  3I71 A;  3JAM K;  2DU9 A;  4U0W A;  4HX7 A;  2YX7 A;  3JSO A;  4KUM A;  4PCQ A;  5BPD A;  5BQT A;  2UXN A;  2OD5 A;  1R7J A;  3WE3 A;  1W5S A;  2BE5 F;  3BOQ A;  3MCZ A;  4G9Y A;  1K78 B;  2NRA C;  1LEB A;  2QM3 A;  4HQM A;  1P2F A;  4HX4 A;  4LD5 A;  1ONV A;  4R1H A;  1BC7 C;  1I5Z A;  1T2K A;  4L9J A;  4N9H A;  4A5M A;  1XMA A;  3MQ0 A;  2KJC A;  3F8N A;  5D8L B;  4HV5 A;  4HLX A;  4OU0 A;  4CHU A;  3EUH A;  2OZ6 A;  2Z33 A;  1D8K A;  4IVN A;  2H09 A;  1A04 A;  5CJ9 A;  1R1V A;  2FBK A;  5H6R A;  1R1T A;  5E1W A;  2K86 A;  4DNC A;  3I59 A;  3QRF F;  4G94 A;  2HQN A;  1E2X A;  2FQ3 A;  1G3W A;  1FSH A;  1K7A A;  2XAQ A;  4MEX F;  1B9N A;  2BGC A;  5LBQ A;  5HS9 A;  4K2E A;  2KIM A;  1FLI A;  2L3D A;  3HHG A;  4KYW A;  3T1B A;  3GUD A;  1P4W A;  1Q1H A;  2CQK A;  1L0O C;  2LF7 A;  2CFX A;  1YYV A;  2IT0 A;  3HOS A;  4A2U A;  4HDU A;  2H6B A;  1FYM A;  1WWX A;  2DTR A;  1O3T A;  5HLG A;  4EQQ A;  2VXZ A;  5DUK A;  4M9S A;  2WWY A;  2A07 F;  3FF5 A;  1YO5 C;  2CO5 A;  2PFB A;  2HR3 A;  2AXL A;  3F8C A;  3B02 A;  1R00 A;  2EJR A;  5BPI A;  3CJN A;  1QGP A;  2ZJ2 A;  3BJA A;  5TRD A;  4L5J A;  2EWN A;  3K1P A;  5J6X A;  4OIO F;  5FFZ A;  1U5T A;  1O7L A;  1QO0 D;  3WOD F;  1XCV A;  1XD7 A;  3LAJ A;  2M45 A;  2ACJ A;  2RDP A;  2K4J A;  4UV9 A;  5LGN A;  2O03 A;  4OMY A;  1U8R A;  5IT9 Z;  4G7O F;  3CUQ C;  2FU4 A;  2V79 A;  4AIH A;  1IXS B;  1QBJ A;  2RV8 A;  1U6G A;  2EA2 A;  2NNN A;  2PN6 A;  2H27 A;  3QP6 A;  3I4P A;  2P5L C;  4Q47 A;  1HBX G;  4OMZ A;  5LLQ A;  2F5F A;  4YFK F;  2M1B A;  4P9F A;  4RB1 A;  4A12 A;  4BH9 A;  5HDK A;  1WRJ A;  2XAS A;  4PZJ A;  1K78 A;  2ADU A;  3ERE D;  2STT A;  2DQR A;  2QBY A;  4CIC A;  3JW4 A;  4N9I A;  1XGN A;  4IPA A;  3FZV A;  3I5U A;  1UST A;  2RN7 A;  2EA4 A;  3SXY A;  2PG4 A;  4ZZD A;  4GXO A;  4CXF A;  4IHS A;  2HEO A;  1T39 A;  5CVV A;  2W24 A;  2ZBK A;  5AIQ A;  3H3Z A;  1ZHF A;  2FRH A;  2F2E A;  1BN5 A;  1BBY A;  3HRM A;  3GZ5 A;  3H92 A;  3J80 Z;  3I54 A;  2CG4 A;  4MHG A;  3SHF A;  4I0A A;  3RYP A;  2NNY A;  3B73 A;  3IC7 A;  5CYV A;  1BIB A;  3LAP A;  3F8M A;  1SD4 A;  2CW0 F;  3KP6 A;  2VOD A;  2A3S A;  4KIF A;  3RJP A;  3P9K A;  3D0S A;  4OIQ F;  3CO6 C;  2IJL A;  1YS7 A;  2ZO4 A;  1IN5 A;  2D1V A;  1AWC A;  5JVT A;  2EFN A;  2VT2 A;  2IP2 A;  5D8K B;  1ZG5 A;  3KP4 A;  5JR3 A;  1ZGA A;  1SMT A;  3REO A;  3CO7 C;  2FXA A;  2H94 A;  1RI7 A;  1HW2 A;  1TLH B;  4EM1 A;  2BYV E;  2F5E A;  1LB2 A;  2ZNY A;  3E3V A;  2EFW A;  3CTA A;  2MLK A;  3C18 A;  5K1Y A;  3GWZ A;  4XBF A;  2V1U A;  2RNJ A;  1KQ9 A;  3E5X A;  5ILU A;  3BZ6 A;  2DFI A;  1ZGJ A;  1TNT A;  1SMY F;  5CVJ A;  3WU1 B;  1I1S A;  2UZK A;  4YFX F;  1W5T A;  2FML A;  4RAY A;  1BI0 A;  5HS8 A;  4LFU A;  2PJP A;  3L09 A;  2V6C A;  4P9U A;  1TBX A;  2XRO A;  1S6L A;  3I0T A;  4KIG A;  1HST A;  3KLN A;  2YU3 A;  1TW3 A;  4I09 A;  4AIJ A;  3V4G A;  3ZMD A;  1VTN C;  4M6X A;  2GAU A;  2HGC A;  4LG0 B;  3WG9 A;  1U5T C;  2IVM A;  1OR7 A;  5E20 A;  3TO9 A;  1HXD A;  3VOE A;  3DQV C;  1YG2 A;  4M72 A;  3QP5 A;  4WK8 F;  2PEX A;  5L3B A;  3ULQ B;  2ETH A;  3FMS A;  5JHU A;  4KA4 A;  2L02 A;  2HOE A;  3HOT A;  3DKW A;  2PI0 A;  1ZYR F;  5DV5 A;  4RGX A;  1UB9 A;  3WGI A;  3KEQ A;  4RS8 A;  4HDV A;  2XGX A;  1TQI A;  4YII A;  4WWC A;  4CGZ A;  2JPC A;  5LEJ A;  2QBY B;  4MGR A;  2FNP A;  3AAF A;  1Y0U A;  1IN8 A;  2A5Y B;  3HRU A;  2BBY A;  4LGW A;  5E18 F;  2K27 A;  4A0X A;  1O3S A;  3MEX A;  4Z2Y A;  1YW9 A;  1IXC A;  2LSO A;  4I98 B;  1SFX A;  1FOK A;  1S7A A;  2L01 A;  3FMQ A;  2VE8 A;  4JBA A;  4HZF A;  5LEK A;  2QQA A;  2V1X A;  2CWE A;  1G3T A;  4BXU A;  3BWG A;  1R5H A;  1K79 A;  2WC2 A;  2NAZ A;  5LRR A;  3IRR A;  2HFH A;  1KU2 A;  3V7C A;  3F23 A;  4WXH A;  3ABT A;  3TOA A;  5FLX Z;  4MQ9 F;  4UNO A;  3LFK A;  2QZ8 A;  1ZG3 A;  4OIN F;  3LA3 A;  4GYG A;  3FWE A;  4PDK A;  3K1M A;  1F4K A;  3HIF A;  4ZYD A;  3TDU C;  2XKO A;  4UVB A;  1IN4 A;  1O57 A;  1TNS A;  2JT1 A;  3ZPL A;  1S29 A;  2LDU A;  4WXC A;  5JI6 A;  4M73 A;  1H9T A;  4LG0 A;  1SAX A;  2RKH A;  1V4R A;  5D6F A;  3ROU A;  3H3U A;  4EMS A;  4L0Z B;  2L54 A;  2NS0 A;  2Y48 A;  3HSE A;  4M6Y A;  1D3Y A;  3WTT C;  2DLL A;  3WTW C;  3T8T A; 
#chains in the Genus database with same CATH topology
 3BR1 A;  3PNT A;  1A6Q A;  1FY7 A;  2XF5 A;  3MKY B;  1X3Z B;  4W97 A;  3EUA A;  3C7J A;  3AL0 B;  2IS2 A;  4KIC A;  5LHH A;  4CDG A;  3AKZ A;  2KZV A;  3KE2 A;  5KVR A;  4J19 A;  3HOZ J;  2O61 A;  3U2R A;  5FO5 A;  1OYY A;  3IUO A;  1IRG A;  3SFZ A;  2P5V A;  3L2C A;  1GDT A;  2CV1 A;  3LSI A;  4XKB A;  4ZC3 A;  4U7D A;  1DPR A;  4ZTF A;  1Z9C A;  3FKJ A;  1B72 A;  1TQM A;  4G12 A;  2N8G A;  3BR6 A;  1OJL A;  1Y56 A;  2KT0 A;  3J7Y J;  2P6T A;  4YFN F;  1AU7 A;  2Y31 A;  4MIM A;  5D4S A;  1R4M B;  2K9L A;  4WX9 A;  2M4K A;  2TRT A;  3PFY A;  5ILV A;  3QPS A;  4NB5 A;  4BEH A;  4F55 A;  1OKR A;  3GVA A;  2CW8 A;  4AM3 A;  4A3E J;  3PM1 A;  2HPM A;  1SD5 A;  4RGU A;  2E36 A;  2LKX A;  1VND A;  3WGG A;  1S7O A;  5HDN A;  5KNL A;  1Y1V J;  2IGK A;  2EV0 A;  3ZP5 A;  1I3Q J;  4LB5 A;  4U0V A;  1OLT A;  3HYI A;  2ELK A;  1ULY A;  1HC8 A;  2BHZ A;  3DPL C;  4RM2 A;  1V5E A;  4WF2 A;  1GT0 C;  4HF2 A;  6PAX A;  3J7A Y;  3BDD A;  4E7K A;  3FK6 A;  4ETS A;  1UAA A;  4PJL A;  2DMN A;  2Z5U A;  4BUP A;  3JRH A;  4EVI A;  1ZEL A;  2XB5 A;  3RYR A;  4R8H A;  4FCY A;  3DBL B;  3RPU A;  3OMY A;  1V5F A;  5B1B H;  5IP9 J;  2VAS A;  3HSF A;  1TWF J;  5EEA A;  3O3K A;  1I27 A;  4E7I A;  1ZGW A;  1XN7 A;  2KP6 A;  1MNM C;  3PNV A;  5L3E A;  4ENN A;  2DOF A;  1KQ0 A;  2CUJ A;  2DQL A;  4RLF A;  1QVT A;  1U9N A;  3NWT A;  1RR8 C;  4DOZ A;  1H8A C;  1VQK I;  3OWT A;  2W57 A;  2X1D A;  4L9T A;  3F6O A;  1H88 C;  1IF1 A;  3JRE A;  3GFJ A;  4NC8 A;  1YX5 A;  1ZG1 A;  1W36 C;  2F5C A;  4V2F A;  3F3X A;  1WFX A;  4CCN A;  2IS4 A;  2NVT J;  3KZY A;  2COB A;  2LG4 A;  2L9V A;  3DCF A;  2OZU A;  2WAQ N;  4F52 A;  1GXQ A;  1XDS A;  4MLO A;  3C2H A;  4BKX A;  2R7U A;  2Q8K A;  1X3W B;  2XC7 A;  2DCE A;  4NQW A;  1KU9 A;  4XOR A;  5K5Q A;  3MKW B;  4MTD A;  4JYK A;  3W2W A;  2CGP A;  2XAF A;  5LHG A;  2Y0S A;  1BR1 A;  4MEY F;  1KGS A;  3E1S A;  2XRN A;  5E1X A;  3GTP J;  5F27 A;  1XS9 A;  1WJC A;  1RR7 A;  2VBX A;  5LRS A;  2RVC A;  3BZK A;  2EK5 A;  3GCM A;  2XPV A;  2WV0 A;  2ZXH A;  1HKS A;  1T6S A;  3HJE A;  2ZME B;  3KP3 A;  1LDD A;  1QU3 A;  1BM9 A;  1JE8 A;  3OYA A;  4FIS A;  4G6T B;  3H9J A;  1UHW A;  2LK2 A;  1AKH A;  5D5W B;  1MJ9 A;  4LIU A;  5C44 J;  3CDH A;  3M07 A;  4MNU A;  5CVI A;  3LWF A;  3IKV A;  4XOP A;  4D0P A;  2Q1Z B;  3HTS B;  1IRZ A;  3ABM H;  2O3F A;  1NK3 P;  2JVH A;  5IP6 A;  1JKR C;  2FEZ A;  4M71 A;  1JI8 A;  2P7C B;  1N75 A;  3MN2 A;  3QOD A;  3I3L A;  3OV8 A;  2L9R A;  1IG7 A;  3HSR A;  5BNG A;  1WJD A;  1Y1W J;  1LVA A;  1FSE A;  3E6D A;  2QSH X;  2Y75 A;  4UUV A;  1MND A;  3OYN A;  1HF0 A;  4O3M A;  3IV5 A;  3M8E A;  2FUG 2;  1WH5 A;  2FOK A;  4BDY A;  3HM5 A;  3RI4 A;  4ON0 A;  2DJN A;  3FXL A;  1ZRF A;  2R7Z J;  1RC9 A;  2F4M B;  1EA3 A;  2PMU A;  3Q0U A;  1OCZ H;  1ON2 A;  1ZRD A;  3OIQ A;  4ESF A;  5IYD J;  4AIK A;  2QCO A;  3DWL E;  1SFU A;  5EF6 A;  3S15 J;  1IDY A;  5FB2 A;  4ZJZ A;  5FJ8 J;  2K3F A;  3E6C C;  2R4G A;  2WAE A;  1IN7 A;  3O8H A;  4LLN A;  3IWF A;  3OYF A;  2W84 A;  2HDC A;  4QTR A;  3PQJ A;  3WE2 A;  1OIS A;  2M0M A;  4Y3O A;  1RUN A;  1I3A A;  1J5Y A;  1UMQ A;  3RPU D;  2LC2 A;  1HKQ A;  2F4O B;  3CCR I;  3P7N A;  1CF7 A;  2LYC A;  2R7O A;  5DD8 A;  1ETX A;  1PJR A;  2DPD A;  3L1P A;  2E1M C;  1R1U A;  3RKX A;  4L5I A;  5FD5 A;  2IGM A;  2L4A A;  2VBZ A;  4XLN F;  3J81 Z;  2OC6 A;  3JTG A;  3CCQ I;  3LSR A;  2CH0 A;  1AOY A;  3M7G A;  5ICC A;  1D5Y A;  1STZ A;  4FE7 A;  3ZN0 A;  3BQZ A;  4RAF A;  4Q5S F;  1A6I A;  2ZFU A;  3ZQF A;  3LSK A;  5FRO A;  4HSR A;  1E17 A;  2JSC A;  4IL6 C;  1XGM A;  2MGQ A;  5BOX A;  1ZN2 A;  2BY3 A;  2MD5 A;  1EJ9 A;  1S7E A;  4ZYE A;  1UJ8 A;  1YHQ I;  1ETY A;  2DPU A;  3TO6 A;  4BGD A;  3GFM A;  2VN2 A;  1K4S A;  2UWM A;  1RET A;  2EIN H;  2VT3 A;  2IA1 A;  2J5O A;  4P55 A;  3WHC A;  4CO8 A;  4E4H A;  5M3M J;  3K0L A;  1ERD A;  2ISZ A;  2HYF A;  2XKP A;  3MKZ A;  2X4H A;  2E7X A;  2TDX A;  3ISP A;  5F08 A;  4D5C A;  2DT7 B;  1JGG A;  2DTZ A;  3BR5 A;  1F9N A;  3TL4 X;  3CLQ A;  4AWX B;  2CRG A;  3V7S A;  3VPR A;  4U7B A;  2RQP A;  1QZE A;  3G73 A;  2R7F A;  3P9I A;  1BL0 A;  2DMQ A;  4A3J J;  2I8D A;  3TQN A;  1PUF B;  1U2W A;  1B59 A;  3EET A;  5J8C A;  4I76 A;  4D7N A;  2JN6 A;  2KRC A;  2DA3 A;  2E2H J;  3HOX J;  5K5O A;  2M8E A;  5HLI A;  3G71 I;  2V9P A;  3G6E I;  4BXX J;  1XMK A;  5FLX K;  1F5T A;  5D4R A;  2GIV A;  4IX7 A;  1FPQ A;  3C2G A;  3ONQ A;  5CVU A;  4FQG A;  1W7P B;  3VWB A;  1N78 A;  1LJ9 A;  4A69 C;  4F7Z A;  2GA1 A;  1J7K A;  2UXX A;  3TOB A;  2VLA A;  1S72 I;  1J09 A;  3OYB A;  2PJR A;  1JUP A;  2LY1 A;  2XAJ A;  1FYL A;  3TO7 A;  1FP2 A;  1OYI A;  1HOM A;  3GBG A;  1ZKG A;  3K4J A;  1ENH A;  3X2Q H;  3IAM 2;  1P7I A;  3T0Y A;  9ANT A;  1D8J A;  1DDN A;  2MC4 A;  4QLC U;  5LGU A;  3K2Z A;  5FKN A;  3NAU A;  3S16 J;  2B63 J;  2R92 J;  3ECO A;  2Y9Y A;  1BJA A;  4KMU X;  4HPQ A;  4XLE A;  3DFG A;  5AON A;  2GBY A;  2AS5 F;  2X6X A;  5JVG F;  3HL2 A;  1YFH A;  3M8F A;  2NYX A;  5DYM A;  2VON A;  4BYY A;  4FX4 A;  4LK1 F;  1MBF A;  5DM6 F;  4A6D A;  4XLP F;  2GXA A;  4EGY A;  2XDV A;  1ZRC A;  2ZXI A;  2WBM A;  2P5K A;  5E3M A;  3SFI A;  4RDU A;  3GX4 X;  2A6E F;  1ON1 A;  1T98 A;  1IAW A;  2JRT A;  1RZ4 A;  1LDJ A;  1WJE A;  1CQT A;  3F9K A;  2OQR A;  2VOP A;  5J3L A;  3G1M A;  1YIO A;  5DS9 A;  4YIF A;  3CP8 A;  4PK4 A;  4BQQ A;  3DP7 A;  3F0C A;  1MGT A;  5A2Q Z;  2EZL A;  1QQI A;  1JGS A;  1X58 A;  1E0E A;  2O0Y A;  1XTA A;  2DA1 A;  2G7U A;  3ZQQ A;  5J8F A;  2IPQ X;  4UXN A;  4I99 C;  2YX4 A;  1GV5 A;  2QKM B;  2Y30 A;  4HF1 A;  2VPL A;  1G6N A;  2LY9 A;  4BQN A;  4E7H A;  4Q4Z F;  1U8B A;  1DPU A;  1MMD A;  2O7O A;  3QU6 A;  2EFP A;  2FJ1 A;  3I56 I;  3FM3 A;  5BMZ A;  1VQ7 I;  4RMN A;  2YPR A;  4Y13 A;  3LA7 A;  3IRQ A;  1VI0 A;  5IT9 K;  2XV4 S;  1UFM A;  1X4O A;  1BI2 A;  1RNL A;  2HI3 A;  3MZY A;  1TQP A;  3PNY A;  1R4N B;  1JHH A;  4CYD A;  1TC3 C;  3V7R A;  4KT5 C;  3OS2 A;  5E79 C;  2XSJ C;  1IO2 A;  2ZXJ A;  4CSW A;  5DCF A;  1O3R A;  3WTS C;  1OPC A;  2HU9 A;  2BY2 A;  2E1C A;  1YW8 A;  3WTZ A;  1P4A A;  1DQU A;  3JRI A;  4I2O A;  3BQY A;  2DK5 A;  2EIK H;  4HAM A;  2M30 A;  3OR2 C;  1G3S A;  2ZSI B;  4R79 A;  3S1Q J;  5A2Q K;  1KU3 A;  2DI3 A;  2KJB A;  4LIT A;  2XVC A;  1NH3 A;  2P81 A;  2JTV A;  3DEU A;  2JVG A;  1XGO A;  5IPA A;  2DK8 A;  3CCL I;  1RUO A;  5J40 A;  4P5O A;  1Z0X A;  4LB6 B;  4DQ2 A;  3DPT A;  1G3Y A;  3BC8 A;  4Z6Y A;  1EV7 A;  3K1N A;  3W6J B;  5LFA A;  3J7A O;  4OIP F;  2JSP A;  4HBL A;  5J1Y A;  2VKH A;  3CJT B;  4EJW A;  3JRA A;  3HHH A;  1FYK A;  2HXI A;  4XMY A;  1E3H A;  2VQC A;  2M7A A;  3Q9S A;  5L3G A;  5B1A H;  1IXR C;  2MC3 A;  1LFP A;  2MBF A;  2QVO A;  2VQG A;  4HNV A;  3QPL A;  4E7J A;  1SEU A;  4PGG A;  3ABU A;  1IRF A;  2I5U A;  3HUG A;  2L9S A;  1MDM A;  3R0A A;  1DGR M;  2R5Z A;  2DFE A;  4UB6 C;  5EEG A;  1MMN A;  1OCO H;  1FIP A;  4M3G A;  4BY7 J;  4F3Q A;  2ZME A;  1J2X A;  3PUF A;  5HS7 A;  3S2W A;  3QU3 A;  4EM2 A;  1SD6 A;  5D6E A;  3N97 A;  3SZG A;  1LPQ A;  4BY1 J;  5HLT A;  1Z91 A;  2ZNZ A;  5AIP A;  3TGN A;  1KZH A;  2XAG A;  2IBD A;  1S5L C;  3I9V 2;  4C3I J;  1QNT A;  2LF8 A;  5E8I A;  3BPV A;  3L2R A;  4J01 A;  3DKY A;  1W7P D;  4HW0 A;  4CH7 A;  1BC8 C;  2W1O A;  4MTE A;  1PYV A;  2HTJ A;  4S04 A;  3OR1 C;  4D7M A;  5K5R A;  4Y4R A;  2DT5 A;  3GTM J;  4A3G J;  5DEQ A;  4I0B A;  3IHU A;  2VL8 A;  1MJA A;  1OCR H;  3LST A;  1W0U A;  3M9A A;  2OV7 A;  3LOC A;  1O3Q A;  1D1C A;  4PSW A;  2FF4 A;  4XRS A;  3GYH X;  2R5Y B;  1W36 D;  4A3C J;  1VQO I;  3ZMS A;  3DTI A;  4DZP A;  1LEA A;  4XKC A;  1BIA A;  3MWM A;  3BT9 A;  5GAH J;  1FOX A;  1ETO A;  2O8X A;  1JUS A;  1GVD A;  1X1P A;  4XK4 A;  3GFI A;  1JTX A;  1HKT A;  2VQL A;  2LNB A;  3PJR A;  4XOT A;  3L2W A;  2V1N A;  4B43 A;  1VQL I;  2KRF A;  3IH4 A;  2HWV A;  2HVR A;  3QQA A;  3LNQ A;  1X3U A;  1ZAR A;  4G6D A;  5IP7 J;  2HOS A;  1ZTR A;  1LDK B;  3CCS I;  3A2K A;  2R7Q A;  1HCR A;  3F72 A;  5TGT A;  1TW2 A;  3CCV I;  3R4K A;  4XL9 A;  3HEF A;  1EH6 A;  3BRO A;  4LLL A;  2F5D A;  4BE2 A;  1Z77 A;  2GM4 A;  1AHD P;  3C3W A;  1BA5 A;  4KIB A;  3WGH A;  3MZ8 A;  1T38 A;  3T8R A;  1JJ8 C;  2C6Y A;  2HQA A;  5H6Q A;  2ZKZ A;  1P6R A;  2XAU A;  1Y6I A;  2HZT A;  3CCY A;  4OAY A;  2EZH A;  2GWR A;  1S3J A;  1OYW A;  2JMW A;  2WA0 A;  4XIC A;  2FD5 A;  3BTI A;  3E6B A;  5DCM A;  4UVC A;  5DUI A;  2A68 F;  2GOM A;  4XRS G;  3CUQ A;  2E2I J;  3ZQH A;  1SFE A;  4EJT A;  3U9G A;  2E7W A;  2ZSH B;  3K4B A;  4EJU A;  2A61 A;  1FP1 D;  1D5V A;  3RKY A;  4A3L J;  2FSW A;  1QHG A;  4A0Z A;  1PDN C;  1YS6 A;  4IHT A;  4B4C A;  4XSZ F;  1NHA A;  1SVO A;  4G6Q A;  4G8X A;  4AC0 A;  3AG2 H;  2BY0 A;  4I01 A;  4O5V A;  1R6R A;  3CES A;  2VBW A;  3HRS A;  4BHC A;  5ILS A;  2ZCW A;  4ITV A;  2LBF A;  3NEU A;  3S32 A;  4ZYH A;  1B4A A;  1JUM A;  3LFU A;  5EGO A;  2W48 A;  3HPG A;  1IC8 A;  1FWZ A;  5EZG A;  3LSG A;  4X0G A;  3A03 A;  2A05 A;  2JUC A;  3HBL A;  1DP3 A;  1PUF A;  1C0W A;  1J9I A;  3FX3 A;  4BNC A;  4J00 A;  3CC7 I;  5JLW A;  2GIZ A;  4L5E A;  3SZP A;  1GXP A;  3HUG B;  3KLO A;  1ZH5 A;  2F48 A;  2Z99 A;  3VFZ A;  2EFO A;  3PQK A;  3A01 B;  5JFR A;  3EDP A;  1K61 A;  1HW1 A;  1MMS A;  3CME I;  3CF5 F;  1P7J A;  2F6C A;  4Y17 A;  3IP4 B;  4KDP A;  1HQC A;  1W7P A;  3O2P E;  4V19 K;  2K9N A;  4LIV A;  3H5R A;  2QEX I;  5C4J J;  3D5S C;  3JSP A;  5EEH A;  2XB0 X;  3ZMZ A;  1A35 A;  1JKO C;  4XQF A;  3OS0 A;  5ERI A;  4IZZ A;  4E70 A;  2BZT A;  2DA6 A;  3HOY J;  4NHJ A;  5F6F A;  2BVL A;  2WTE A;  1QPM A;  1UZC A;  3DXJ F;  4GDF A;  2CMP A;  3QPT A;  1PP8 F;  3OYG A;  1BI3 A;  4CZC A;  3BG6 A;  4GO1 A;  2R7R A;  3E0J B;  4PJ0 C;  1EKE A;  3SZT A;  1PP7 U;  2NS8 A;  3OS1 A;  4XRF A;  4XLA A;  1VQP I;  1DGW Y;  4TV7 A;  2HS5 A;  3P5J A;  2FA5 A;  5F1R A;  4AUX A;  1YJW I;  1BJZ A;  2R3S A;  2QYO A;  2ELJ A;  3BR2 A;  3CC4 I;  3F21 A;  2FBH A;  5FGM A;  3KFW X;  3K69 A;  2ME6 A;  2HZD A;  1OMI A;  4CUG A;  2CQQ A;  1KU7 A;  3HGY A;  1O7F A;  5D5V B;  1K6O A;  5D5X B;  2XIG A;  2H1L A;  3HOV J;  4IOC F;  4IEJ A;  3HGG A;  2CSO A;  3E5Q A;  5FFX A;  3K2A A;  4YEL A;  3CZ6 A;  2DXI A;  2XRL A;  4DW6 A;  4DYR A;  2KDO A;  3T5X A;  2AO9 A;  3A02 A;  4GCV A;  4HV6 A;  2FOW A;  1FX7 A;  4OWR B;  4BAY A;  2KIQ A;  1Z1D A;  3GZN B;  3KP5 A;  3OL4 A;  4E7S A;  2JPB A;  3KX2 A;  3JAM Z;  2A6H F;  2JA7 J;  5DD4 A;  2OA4 A;  2JQ7 A;  4XR6 A;  3CLO A;  3K9T A;  1MBE A;  1O4X A;  2R0Q C;  1KYZ A;  5L3D A;  2EV6 A;  3AG4 H;  2K3P A;  3BP8 A;  3WTX C;  3RIR A;  1MD0 A;  1BW6 A;  4EJV A;  3BPX A;  3ZQC A;  3CUQ B;  1VFC A;  2MYS A;  1FBQ A;  3CUO A;  1WZ2 A;  3MD2 A;  2BEO A;  2I10 A;  3R0J A;  5E17 F;  1F43 A;  2VE9 A;  1R36 A;  2DMP A;  1LUJ B;  1V3F A;  2HTS A;  3V8L A;  3AG1 H;  1R49 A;  2IEK A;  3N05 A;  4AVP A;  2IRF G;  1H9G A;  3L2U A;  1VF9 A;  1IJW C;  2YSR A;  2CYY A;  2DA5 A;  4KIS A;  3LQQ A;  4BAC A;  3ECH A;  4V2G A;  2DO7 A;  4M3B A;  3NQO A;  1XPX A;  5IOY A;  4BE1 A;  2WAF A;  2MH2 A;  2EIM H;  3ZR8 X;  1YW7 A;  3V42 A;  2RGV A;  3JRD A;  2L9N A;  1ZLJ A;  2PQ8 A;  4RGR A;  2L5Q A;  2UUZ A;  3GFL A;  3IKT A;  1IUY A;  2OTJ I;  2M34 A;  2HVS A;  4QWQ A;  2O6G E;  1MBG A;  4BJ6 C;  5E3O A;  4PFO A;  4G7H F;  1I6X A;  1TWG J;  3CCU I;  3S8P A;  3CF2 A;  3DKX A;  1HLV A;  1FC3 A;  2OQG A;  4LLG F;  3FXR A;  4KN4 X;  4RLQ A;  4L18 B;  3E6M A;  4II2 A;  2JRM A;  2B0L A;  1BI1 A;  4DBR A;  3ZQG A;  5F0C A;  3TW6 A;  1G2H A;  3GW2 A;  2Y0M A;  5E1Z B;  2DBB A;  2PX9 A;  2M9H A;  4A3M J;  3H9G A;  1ODD A;  2KKO A;  2GA2 A;  2QSG X;  4A5N A;  2LFB A;  1Q1V A;  2OAZ A;  5F64 A;  3D1N I;  5TJJ A;  4ZDL A;  1U78 A;  2Z2S B;  3HZJ A;  1B8I B;  4I6Z A;  4MQV A;  5BS6 A;  1R22 A;  2CFO A;  2LKS A;  1H89 C;  2VPR A;  2ISY A;  2ZB9 A;  3BCA A;  3ASN H;  2H6C A;  2R7S A;  2P0W A;  2ZFW A;  4YG2 F;  2QEN A;  4H4K C;  3W2V A;  5KAI C;  5F0F A;  2MW8 A;  3KCC A;  1TP4 A;  3U1K A;  5HNF A;  1XB4 A;  3F8B A;  3GTK J;  1TWC J;  2CS3 A;  3WTV C;  2CU7 A;  4ENK A;  3VDX A;  2VKV A;  5DM7 F;  3PUB A;  3SQN A;  5FRN A;  1SD7 A;  1WJA A;  2X48 A;  4PFP A;  2FNA A;  3RPQ A;  2ZJQ F;  3BG3 A;  3OYK A;  3O8G A;  4I7H A;  3GTL J;  1OFC X;  1XG1 A;  1WQ2 A;  3CMM A;  2L7F P;  3FXU A;  1I1G A;  3FXO A;  5HOO A;  3JTH A;  3N4M A;  2NVX J;  1JJ6 C;  1J59 A;  4ESB A;  3LL7 A;  4UUS A;  1VQ9 I;  1RKW A;  4BXF A;  4FTH A;  1LE8 A;  3L9F A;  4UV8 A;  1VQ8 I;  3GTG J;  4BHB A;  2P7V B;  3CJR B;  1NG7 A;  4S05 A;  2CUE A;  3HRT A;  1FMW A;  3G1O A;  5ED4 A;  1U0J A;  2EB7 A;  1APL C;  1G4D A;  3DLA A;  2OCC H;  3OOU A;  3Q9V A;  2QLZ A;  1GHC A;  2JA2 A;  3V8K A;  3UR3 C;  1XCB A;  2IA2 A;  2OBP A;  1R58 A;  1RPW A;  1W4M A;  2V1D A;  3DEW A;  4OIR F;  1MDM B;  3G4S I;  1S8N A;  3H9Q A;  2OUM A;  3VOD A;  3ERM A;  4BHP A;  3GZ6 A;  4C2M J;  2BVM A;  2Q2E B;  4LMY A;  4EJO A;  3QPH A;  2WB1 N;  4U0Y A;  1FBS A;  2ICW G;  3SYT A;  3IAS 2;  1ETK A;  2M7B A;  1EH7 A;  2QQ9 A;  3DTK A;  3COA C;  3K4L A;  3S3M A;  3FXQ A;  2R7W A;  5ICE A;  1X1A A;  2BV6 A;  3ML6 A;  1H0M A;  3OYM A;  2HKX A;  5K7F A;  1FNN A;  2KQR A;  4DZJ A;  1TZL A;  1FJL A;  2HQR A;  3LQR A;  1OR7 C;  3RDI A;  1BW5 A;  4JQF A;  4UHT A;  3F6V A;  1USS A;  2XF7 A;  2MH9 A;  1YIT I;  2FBI A;  4HX8 A;  3EUK L;  1VQ6 I;  1T0F A;  3BG9 A;  5L3C A;  1UHS A;  2YU9 J;  2GZW A;  1TL8 A;  2BW3 A;  2L4M A;  2QQB A;  5E3N A;  1QA6 A;  1WJF A;  1F36 A;  2R5Y A;  5GAG J;  4ENJ A;  3E97 A;  2YR2 A;  2KMU A;  4N0B A;  4PJM A;  4OOI A;  4BBR J;  4YEJ A;  4UB8 C;  4M9X A;  4BJ5 C;  5HVQ C;  1QZY A;  4L9V A;  3W6K B;  2ESN A;  1Y8Q B;  3QYE A;  3FK7 A;  4RB3 C;  1OQY A;  3TED A;  3DV8 A;  2W85 A;  2W25 A;  1R71 A;  4IKF A;  1IN6 A;  1QZZ A;  2DAO A;  4XM3 A;  1BOA A;  2COM A;  2WAQ A;  4ASN A;  3R60 A;  4M9Z A;  2E5Z A;  3CMA I;  1TTY A;  5FLV A;  3L7W A;  2V7F A;  3TP0 A;  3ZMT A;  5LHI A;  2PLY A;  1UG0 A;  2VC1 A;  1CF7 B;  2B9S A;  1RRJ A;  5LGT A;  2P6S A;  3CCE I;  3KYL A;  3EYY A;  3KET A;  3I64 A;  2MAB A;  3M4O J;  2IS6 A;  2CQN A;  2ESH A;  2G7H A;  3Q5F A;  1B8I A;  1F1Z A;  1SVM A;  3WU0 A;  5HLH A;  2K4B A;  3OYE A;  2R7X A;  2FMY A;  1JKQ C;  3QAH A;  2PMZ A;  2K40 A;  4A3K J;  2WY7 Q;  3VEP A;  2XAH A;  1HDP A;  3IL2 A;  5KHD A;  2PMH A;  1ZR2 A;  2YUS A;  5GP9 A;  1IDZ A;  2JA5 J;  5DTD A;  3ZMV A;  5IT3 A;  1YRN A;  1RES A;  2M5W A;  3CP2 A;  2K9S A;  2HDW A;  3U21 A;  3QOP A;  2LVS A;  4B47 A;  3K10 A;  1MZB A;  4A3I J;  4F91 B;  4M3F A;  2MSY A;  2IW5 A;  3W2A A;  2JUG A;  1V5G A;  2CQ7 A;  3TKY A;  1T0F C;  3MAJ A;  4BQA A;  1IZ1 A;  1UCR A;  2KHM A;  4FT8 A;  4P96 A;  3FHN A;  4KFC A;  2AQE A;  1G59 A;  1ETV A;  2CJJ A;  2NOG A;  1FT9 A;  4N4O B;  2LKP A;  1WCM J;  3DU5 A;  2MD0 A;  4BBS J;  5J1U A;  3I53 A;  3I4M J;  1D0Y A;  1KA8 A;  2W82 A;  2MFZ A;  3VYS B;  4E6K G;  4IRI A;  2DMU A;  1WSU A;  4HF0 A;  2VUM J;  3J80 K;  4Q48 A;  4LOC A;  2HPI A;  3DF8 A;  2Y0S N;  3RSN A;  1WJB A;  2R93 J;  2X51 A;  2DFF A;  4ABZ A;  1KYW A;  3BJO A;  1BR2 A;  1HSJ A;  4ZH4 F;  3V8J A;  2CV0 A;  5FLM J;  2A5W A;  3KEO A;  4CCL A;  1A5J A;  3KP2 A;  4B48 A;  1WI9 A;  2H8W A;  2K02 A;  3VSL A;  1YQA A;  3J81 K;  5EJC A;  3KYD B;  5FKL A;  5ICF A;  3TP3 A;  3U1D A;  2A69 F;  4L0Y B;  5GPC A;  1ZRE A;  4NBQ A;  1P4X A;  1EH8 A;  3R61 A;  2MLG A;  1OCP A;  2BXZ A;  4H0E A;  3KP7 A;  4XNF A;  2RRE A;  1D1A A;  3BTJ A;  1XSD A;  3KIO A;  4CZZ A;  2WV1 A;  4IJA A;  5DCM B;  1GV2 A;  3MVP A;  3RTR A;  5J1R A;  4GGG A;  4IRH A;  3WTY C;  1R23 A;  2EV5 A;  2PBI A;  2M4G A;  4PGH A;  2NVU B;  2MA3 A;  5KK1 A;  4I02 A;  3MFK A;  1PVE A;  2WY8 Q;  4WXD A;  4B8X A;  4CCK A;  3CCJ I;  1CGP A;  1HW5 A;  4XLH A;  1IUF A;  2X0L A;  2OU2 A;  2GXB A;  1REP C;  4M3D A;  1B1B A;  1XSV A;  4KMF A;  5GAE J;  3L00 A;  1MBH A;  4JK1 X;  4ANJ A;  3ZN1 A;  4ESJ A;  4Y15 A;  3G3Z A;  4KNY A;  1T33 A;  3BJ6 A;  2LBF B;  2P8T A;  3IH3 A;  3GTO J;  2X1C A;  3HG9 A;  3ZOB A;  3GEZ A;  3EQL F;  1FBU A;  2GXG A;  1T08 B;  3A0H C;  3EYI A;  1ETQ A;  3PFI A;  4EM0 B;  2Q2E A;  3GME A;  4JX4 A;  3M1E A;  4U87 A;  1Z6R A;  4G7Z F;  3FXJ A;  3SEZ A;  4UUT A;  1U5T B;  4XON A;  2XF6 A;  4RAG A;  3L2Q A;  2RC4 A;  4O6J A;  1ETW A;  1B6A A;  2J5P A;  4L9N A;  5C3E J;  5FD6 A;  3ZQ7 A;  2IA0 A;  1MH4 A;  4FX0 A;  3FHZ A;  2JK3 A;  1WJ5 A;  5L3F A;  2K85 A;  2Z9O A;  2QWW A;  3FIS A;  1K83 J;  3VB2 A;  1WHU A;  1Z6T A;  2E60 A;  5D5U B;  1J0R A;  5DDG A;  3GO5 A;  1LNW A;  3OIO A;  1QVU A;  4FHT A;  5E8G A;  1PUE E;  3EUH C;  5KAF C;  3KPH A;  5HDG A;  3WG7 H;  1T95 A;  3FM5 A;  4A6E A;  5EG0 A;  1LQ1 A;  2M3A A;  4FET A;  2ELH A;  3GTJ J;  1B9M A;  5B66 C;  1ZR4 A;  4NDL A;  2PMZ N;  2DT6 A;  3K4M A;  4JOM A;  2R7D A;  2H1K A;  5K7Z A;  3S1M J;  3FXK A;  4EGZ A;  1FZP B;  2K7L A;  4RB2 C;  3F8F A;  2NXN B;  1FEX A;  2X6O A;  1XDU A;  3ZCO A;  3S1R J;  2QF7 A;  2D1H A;  3BY6 A;  1U3E M;  3ZQI A;  4DIQ A;  3KYC B;  4GYI A;  3TDZ C;  4A0Y A;  2STW A;  1G8X A;  2GQQ A;  4M74 A;  2EQR A;  2NVQ J;  2Q0O A;  2CUF A;  3JR9 A;  2KZG A;  3P9C A;  2DOE A;  5IYB J;  5B5E C;  2EFQ A;  1ZAO A;  1MKM A;  1UHM A;  3GF2 A;  3TW7 A;  3L2V A;  4ZYG A;  4IHV A;  1MNE A;  2IAI A;  5CVR A;  2R7T A;  4X6A J;  3OYI A;  1RKT A;  1KQ8 A;  2XUB A;  4RGS A;  1VQM I;  2E1N A;  4AD9 A;  3LA2 A;  2Z3Y A;  2VBY A;  4UVA A;  2KIF A;  3C1D A;  2ZJP F;  1W5C C;  5HNH A;  2D45 A;  2HOT A;  2VOO A;  3RKW A;  1LVK A;  5JHF A;  1IV8 A;  3E5U A;  3HTU A;  4A3D J;  2VXD A;  1MJB A;  2XHK A;  1P92 A;  2K9M A;  1Z3X A;  2E71 A;  1Z05 A;  4IHW A;  1T8I A;  2G0E A;  4MFE A;  3KZZ A;  2DDB A;  3K70 C;  2MG4 A;  4WCG A;  2V9V A;  2ZC2 A;  5CQG A;  4HQE A;  3OOP A;  3VYU B;  2LR8 A;  4IF4 A;  3HPH A;  5E3L A;  2JZY A;  3ZRG A;  3O6B B;  1POG A;  1YX3 A;  3FXM A;  4HOB A;  3D5L A;  4BJT A;  3I58 A;  5EZH A;  1Z7L A;  1XSX A;  4HYE A;  4U88 A;  1FOY A;  4JX6 A;  3BR3 A;  2LRE A;  2VC0 A;  2L2O A;  4EV0 A;  4KN7 X;  3CCM I;  4RA2 A;  1FTT A;  4AID A;  3K7A J;  4RAZ A;  4ENM A;  1IW7 F;  1TT5 B;  1ORK A;  1YLF A;  1GVJ A;  4CCO A;  4XSX F;  2HXO A;  3ASO H;  2EZI A;  3E7L A;  2ZJR F;  3I59 B;  3NRV A;  5FKM A;  4C2U A;  1AA7 A;  3QWL A;  1MMA A;  3IWZ A;  3S93 A;  3R6S A;  3WTU C;  2IS1 A;  4HLY A;  1DP7 P;  2GLO A;  2FX0 A;  2E1M B;  3GLL A;  1SFK A;  1X1C A;  3MZH A;  4IRG A;  5H20 A;  1DUX C;  4XKV A;  5C4X J;  2HKO A;  5IYC J;  1RIO H;  3F22 A;  1XGS A;  2EBI A;  1ZLK A;  3ELK A;  2PJR B;  3ABK H;  1L3L A;  4ZZL A;  1R5G A;  3ZMU A;  1YTY A;  4HRI A;  4NNJ A;  3GLX A;  1XMX A;  2LRD A;  5EDN A;  4RB0 A;  3DBR B;  5LD2 C;  1JHF A;  2QUF A;  4B09 A;  2ZXW H;  2LMD A;  1D0X A;  4N4N B;  1JXS A;  3NWS A;  1N77 A;  5GTI C;  1Z3Y A;  5J4Y A;  1NG6 A;  2Y69 H;  2HQ5 A;  2M87 A;  2DW4 A;  3K4C A;  5EG0 B;  2FE3 A;  2G9W A;  2HYG D;  1WKM A;  1S9H A;  2KIU A;  1Z7U A;  2NS7 A;  2ECB A;  3KZI C;  5CLS A;  4CA0 A;  3JRG A;  3FMR A;  2XPU A;  4IXA A;  1J75 A;  1WI3 A;  3S14 J;  4HA8 A;  2OCE A;  2D2W A;  3GXO A;  1X2N A;  5ICG A;  4LJZ F;  4LK0 F;  4AU7 A;  2P4W A;  4M6V A;  3BR0 A;  3I71 A;  2RNG A;  3JAM K;  3H0D A;  2DU9 A;  3DLL F;  4U0W A;  4HX7 A;  1K4T A;  2YX7 A;  3JSO A;  4KUM A;  4KJZ A;  4PCQ A;  4UUS B;  5BPD A;  5BQT A;  2UXN A;  2YS9 A;  2OD5 A;  3S3O A;  1R7J A;  3WE3 A;  1W5S A;  2EIJ H;  1MH3 A;  2BE5 F;  2EIL H;  3BOQ A;  4ZDO A;  3MCZ A;  3BLY A;  3TBI A;  4IHX A;  4G9Y A;  1K78 B;  2NRA C;  2HVQ A;  2W7N A;  1LEB A;  3UKG A;  3BCB A;  2QM3 A;  4XN0 A;  4NQW B;  4HQM A;  3PIO F;  5GAD J;  1P2F A;  3OL3 A;  3HDD A;  1DU0 A;  2Z1D A;  4HX4 A;  3G2B A;  4LD5 A;  2IGN A;  3TMO A;  2E2J J;  1OCT C;  3H1C A;  2CQX A;  2AHQ A;  5F0H A;  4DJA A;  1ONV A;  4R1H A;  3W3C A;  1BC7 C;  4Y33 A;  1I5Z A;  1T2K A;  4L9J A;  4N9H A;  4AYB A;  2DA2 A;  1YI2 I;  1VQ5 I;  3JRB A;  1HA8 A;  3LSM A;  1UG2 A;  2ZME C;  4A5M A;  2M8G X;  1XMA A;  3MQ0 A;  2E5N A;  2DYS H;  2KJC A;  3F8N A;  3G1L A;  4HV5 A;  4HLX A;  5JLX A;  5D8L B;  3GTQ J;  3H3V K;  2R7V A;  4HG2 A;  3HOW J;  4OU0 A;  4CHU A;  3EUH A;  2OJE D;  3LSJ A;  2KL4 A;  2OZ6 A;  2CUZ A;  4NC7 A;  4BL0 B;  1D8K A;  2Z33 A;  4E7L A;  4IVN A;  2H09 A;  4KT6 A;  3BG5 A;  5H2F C;  1A04 A;  5CJ9 A;  1R1V A;  4PSX A;  5CKT A;  1YOV B;  4JX5 A;  2FBK A;  4GRI A;  5H6R A;  1R1T A;  1WH7 A;  5E1W A;  1JT6 A;  2K86 A;  4DNC A;  1N25 A;  2V9K A;  2KFD A;  4F93 B;  1MMG A;  3I59 A;  3ZGK A;  3CDI A;  3QRF F;  2AXT C;  1JKP C;  4G94 A;  2F4I A;  1LKX A;  2HQN A;  1E2X A;  2FQ3 A;  1G3W A;  3EPZ A;  1FSH A;  2M2E A;  1K7A A;  3M3Y J;  3OYC A;  1NTC A;  4M3E A;  2KPM A;  4HNU A;  2XAQ A;  4MEX F;  2EPF A;  1B9N A;  2BGC A;  5LBQ A;  1UEL B;  5HS9 A;  4K2E A;  4XKW A;  2KIM A;  4E7Z A;  1FLI A;  2L3D A;  3HHG A;  4KYW A;  4XID A;  3S2H J;  3T1B A;  2JA6 J;  3GUD A;  1QHH D;  2A6T A;  1P4W A;  2V4J C;  1Q1H A;  2CQK A;  1L0O C;  2FQ4 A;  1DU6 A;  2LF7 A;  1MSF C;  2CFX A;  1YYV A;  2DA7 A;  4XN3 A;  2IT0 A;  3HOS A;  4HST A;  2DDA A;  3UNG C;  2EH3 A;  2EZK A;  2XGD A;  4NC6 A;  4A2U A;  3K4K A;  4HDU A;  2VJ4 A;  2H6B A;  1X1D A;  1FYM A;  1WWX A;  2DTR A;  2KLO A;  1O3T A;  2LLK A;  4OAZ A;  5HLG A;  4XLC A;  4EQQ A;  2KIS A;  5M5W J;  2QGU A;  1FTZ A;  1M1E B;  2VXZ A;  5DUK A;  4M9S A;  2WWY A;  4EEF G;  2A07 F;  2F5V A;  5M5Y J;  3FF5 A;  3K70 D;  3J7Z I;  1YO5 C;  2CO5 A;  4B1R A;  2PFB A;  2HR3 A;  2AXL A;  3F8C A;  2DJI A;  2KRH A;  1TWA J;  1MBJ A;  5EYR A;  3B02 A;  1R00 A;  1SC7 A;  5HOD A;  3DBH B;  2EJR A;  5BPI A;  2HDD A;  3CJN A;  1QGP A;  4BDZ A;  1U9O A;  2ZJ2 A;  3BJA A;  2BY1 A;  3QYB A;  5TRD A;  4L5J A;  1W1W E;  4BEH B;  1V54 H;  5J4V A;  2EWN A;  5B3S H;  3K1P A;  5J6X A;  3RQ4 A;  3VSK A;  2DYR H;  4OIO F;  5FFZ A;  4QPO A;  4F92 B;  5IY5 H;  1U5T A;  1O7L A;  1QO0 D;  3B6C A;  3OIP A;  3WOD F;  1XCV A;  1XD7 A;  2O9L A;  3LAJ A;  1XX5 A;  2M45 A;  3A4C A;  1EF4 A;  2ACJ A;  2DN0 A;  1MW7 A;  2RDP A;  3D5R C;  4Y7N J;  1X2M A;  3H35 A;  3A0B C;  2K4J A;  4UV9 A;  3WU2 C;  2E35 A;  5LGN A;  1BOB A;  1T56 A;  4GFB A;  2O03 A;  2L7Z A;  2XGE A;  4CYC A;  2K9Q A;  4OMY A;  1U8R A;  5IT9 Z;  3RKQ A;  4G7O F;  3CUQ C;  1R5I D;  2FU4 A;  2V79 A;  4AIH A;  4IHY A;  1IXS B;  3A1Y A;  1QBJ A;  2RV8 A;  4CCJ A;  4C2T A;  4A93 J;  1U6G A;  2LD5 A;  2EA2 A;  2NNN A;  2PN6 A;  2QA4 I;  3K6G A;  2H27 A;  3I4N J;  3QP6 A;  2LH9 A;  2O5R A;  3I4P A;  2P5L C;  4Q47 A;  1HBX G;  4OMZ A;  5LLQ A;  2F5F A;  4YFK F;  2M1B A;  4P9F A;  2ID6 A;  2E34 A;  4RB1 A;  4A12 A;  4LG3 A;  4HEA 2;  4BH9 A;  3H5A A;  5HDK A;  1WRJ A;  5IOZ A;  2VIX A;  1JTY A;  1WGX A;  2XAS A;  4PZJ A;  1K78 A;  2ADU A;  3ERE D;  2STT A;  2DQR A;  4DBQ A;  3H36 A;  2QBY A;  4CIC A;  4QPQ A;  3JW4 A;  4N9I A;  4RBO A;  1XGN A;  2VB6 A;  4IPA A;  5EGO B;  3CD6 I;  5TIS C;  3FZV A;  3RZO J;  2LOO A;  3I5U A;  1UST A;  2RN7 A;  2VKE A;  2EA4 A;  3SXY A;  2PG4 A;  4ZZD A;  4GXO A;  2IGO A;  4CXF A;  4IHS A;  3HKZ N;  4YIR X;  2HEO A;  1T39 A;  3SDB A;  1Y0N A;  5CVV A;  2W24 A;  3A01 A;  1W0T A;  2ZBK A;  3B6A A;  3LMM A;  5AIQ A;  3HB9 A;  3H3Z A;  1ZHF A;  2FRH A;  2F2E A;  4RM3 A;  2QSF X;  4ZDP A;  3KEY A;  1BN5 A;  1BBY A;  3HOU J;  1ZK8 A;  3GZ5 A;  3H92 A;  3HRM A;  3J80 Z;  2Y9Z A;  4C3H J;  3FBN B;  3I54 A;  2CG4 A;  2L7K A;  1YJN I;  3JRC A;  4MHG A;  1KON A;  2BW3 B;  3SHF A;  4D5F A;  2Z16 A;  3WHB A;  3PSF A;  4I0A A;  3RYP A;  1I6H J;  2NNY A;  3B73 A;  2XPW A;  2V26 A;  3IC7 A;  2D5V A;  5CYV A;  1BIB A;  3LAP A;  1GUU A;  3F8M A;  1SD4 A;  4BU2 A;  4BQO A;  2CW0 F;  3KP6 A;  2VOD A;  2A3S A;  4PJN A;  1SFO J;  2HNH A;  4KIF A;  3RJP A;  3P9K A;  4D1Q A;  5M5X J;  3D0S A;  4OIQ F;  2RQQ A;  4FE4 A;  3S17 J;  3PSI A;  3CO6 C;  1FIA A;  1I39 A;  1Z67 A;  2IJL A;  1YS7 A;  2ZO4 A;  2WB1 A;  3ESW B;  1VQ4 I;  1IN5 A;  2D1V A;  2DOD A;  1AWC A;  3PO3 J;  5JVT A;  2EFN A;  2VT2 A;  2B7E A;  2IP2 A;  5D8K B;  2QKL B;  1ZG5 A;  2TCT A;  4A3B J;  3KP4 A;  2BHY A;  5FKK A;  2VI6 A;  3OYL A;  5JR3 A;  3H0G J;  3SJM A;  1ZGA A;  3FIW A;  1E3P A;  1SMT A;  2JWT A;  3REO A;  3CO7 C;  1OCC H;  2FXA A;  1A36 A;  2H94 A;  2V6E A;  3RQI A;  1RI7 A;  2HOA A;  3CJQ B;  1HW2 A;  1QRY A;  2BXY A;  3S2D J;  1TLH B;  3NAR A;  4EM1 A;  2BYV E;  2F5E A;  1LB2 A;  3K4N A;  1GLN A;  2JA8 J;  1ACI A;  2ZNY A;  3BTL A;  2X85 A;  3E3V A;  3VYR B;  2R5Z B;  2EFW A;  4QSH A;  1E3O C;  3CTA A;  1LFB A;  3OYD A;  2MLK A;  2OPT A;  4CYC B;  1MIJ A;  3C18 A;  5K1Y A;  3GWZ A;  4XBF A;  1P9Q C;  4PJJ A;  2W00 A;  1YJ9 I;  2V1U A;  1FOW A;  2RNJ A;  4YRV A;  3LSH A;  1KQ9 A;  3E5X A;  3JRF A;  1SVL A;  3DU6 A;  2KDZ A;  2CW7 A;  5ILU A;  2NOJ B;  3BZ6 A;  2DFI A;  4BE0 A;  4AYB N;  3FKI J;  1ZGJ A;  5GTH C;  1TNT A;  1SMY F;  5CVJ A;  1MSE C;  3WU1 B;  2L0K A;  2X1E A;  1I1S A;  2UZK A;  3PIP F;  2XGC A;  4YFX F;  3M8J A;  4XRM A;  1W5T A;  2FML A;  1Y39 A;  4RAY A;  1BI0 A;  5HS8 A;  1IGN A;  4LFU A;  4IQJ A;  3L09 A;  2PJP A;  2L7M P;  3BZC A;  1BR4 A;  2V6C A;  4P9U A;  1TBX A;  2XRO A;  2M0C A;  4C30 A;  1S6L A;  3I0T A;  4JP0 A;  4KIG A;  4XLF A;  2H8R A;  1HST A;  3KLN A;  2YU3 A;  1ZQ3 P;  1B72 B;  1X4P A;  1TW3 A;  4I09 A;  4DGW B;  4AIJ A;  3V4G A;  3CC2 I;  3ZMD A;  2VJJ A;  1VTN C;  3FBI B;  4M6X A;  2WAD A;  4NUB A;  2GAU A;  2HGC A;  2NVY J;  4LG0 B;  3WG9 A;  5F1J A;  3ABL H;  1U5T C;  1HDD C;  4X1E A;  1D0Z A;  1Z21 A;  2IVM A;  1QPI A;  1OR7 A;  4IQ4 A;  3M1C A;  2GOX B;  2W4S A;  5E20 A;  3TO9 A;  1SAU A;  1HXD A;  3VOE A;  3FDY A;  1LFU P;  1AKH B;  1FMV A;  3DQV C;  2VKD A;  1YG2 A;  3ZXS A;  2UV1 A;  4M72 A;  2VQH A;  3QP5 A;  4WK8 F;  3Q0V A;  2PEX A;  2RAE A;  5L3B A;  1VQN I;  3DTE A;  3MKL A;  3ULQ B;  2ETH A;  3FMS A;  5JHU A;  4KA4 A;  4Y52 J;  1WVR A;  5K7H A;  2E19 A;  2L02 A;  2HOE A;  3Q0W A;  3HOT A;  3DKW A;  3PL8 A;  2PI0 A;  3JCU C;  1ZYR F;  5DV5 A;  1YIJ I;  3HC7 A;  4RGX A;  3HKZ A;  3DPU A;  2CV2 A;  4HNT A;  1UB9 A;  3WGI A;  4B3X A;  3KEQ A;  4RS8 A;  1D1B A;  4HDV A;  2XGX A;  4BS9 A;  1TQI A;  4YII A;  4WWC A;  4CGZ A;  2JPC A;  5LEJ A;  2QBY B;  4MGR A;  4II3 A;  3BG7 A;  2OF7 A;  2FNP A;  3OSF A;  2HYJ A;  2LY2 A;  1WPK A;  3OSG A;  4ZTJ A;  4PUS A;  5F04 A;  3AAF A;  1Y0U A;  5CPR B;  1IN8 A;  3VYT B;  1X1B A;  2DOA A;  2A5Y B;  3HRU A;  4B3A A;  2BBY A;  3CQZ J;  4P1W A;  3I55 I;  3CDL A;  4MFD A;  4LGW A;  4ZYA A;  1A31 A;  5E18 F;  2O8K A;  3OY9 A;  3CMY A;  2K27 A;  1NK2 P;  3S3N A;  4A0X A;  1O3S A;  3MEX A;  4Z2Y A;  1YW9 A;  1IXC A;  1V55 H;  4CCM A;  2JJ7 A;  2LSO A;  5FKO A;  1IRX A;  4I98 B;  4S0H B;  1SFX A;  4KIT B;  1FOK A;  1MBK A;  1S7A A;  2L01 A;  3HXL A;  3FMQ A;  2ECC A;  2VE8 A;  1XC5 A;  1K6Y A;  3IH2 A;  4JBA A;  1TT0 A;  2ID3 A;  3QYF A;  4HZF A;  5LEK A;  1X19 A;  2QQA A;  3W6V A;  1YRN B;  2V1X A;  4W1U A;  1R9T J;  3AG3 H;  2CWE A;  1G3T A;  2X6W A;  3C2B A;  4BXU A;  2VJI A;  2QQ8 A;  3BWG A;  3RCO A;  1R5H A;  1K79 A;  2WC2 A;  2DFH A;  2XSD C;  3SDG A;  2NAZ A;  2K5C A;  5LRR A;  3IRR A;  2HFH A;  2BOL A;  1KU2 A;  3V7C A;  3F23 A;  1JT0 A;  4WXH A;  3ABT A;  3TOA A;  5FLX Z;  2AQF A;  2E1O A;  4DYC A;  1IV6 A;  4C3J J;  4MQ9 F;  4UNO A;  3LFK A;  2DMT A;  2QZ8 A;  3QOE A;  1ZG3 A;  4OIN F;  1VZ0 A;  3LA3 A;  4GYG A;  5GPA A;  3FWE A;  1Y8R B;  3K1M A;  4PDK A;  1F4K A;  3HIF A;  5FRM A;  2X9D A;  4ZYD A;  3DEE A;  3TDU C;  2XKO A;  1LE8 B;  4D9J A;  4UVB A;  1IN4 A;  3OYH A;  3AFH A;  4A3F J;  2ME0 A;  3MMY B;  3ZQL A;  1O57 A;  1TNS A;  2JT1 A;  4DYQ A;  3ZPL A;  1S29 A;  3H5N A;  3AL0 C;  4IOA F;  4IO9 F;  1I50 J;  2LDU A;  4WXC A;  5JI6 A;  3RZD J;  4M73 A;  4EAT A;  2LTP A;  1H9T A;  5CQE A;  4LG0 A;  1YE9 A;  4C9Y A;  1SAX A;  2OTL I;  2RKH A;  4MO7 A;  1V4R A;  5D6F A;  3Q3S A;  3H3U A;  3ROU A;  4EMS A;  3LSP A;  3SEQ A;  5KCM A;  3OYJ A;  4L0Z B;  3BTC A;  2VJ5 A;  2Y2Z A;  3S1N J;  4QIW N;  1TWH J;  2L54 A;  4FAS D;  2NS0 A;  4UY8 I;  2Y48 A;  3HSE A;  4B44 A;  4M6Y A;  2X6Y A;  1D3Y A;  5J47 A;  3WTT C;  2DLL A;  3PO2 J;  3WTW C;  2IXS A;  3T8T A;  1ITY A;  2DA4 A;  1SAN A;  5M3F J;  4AVZ A;  2LP0 A; 
#chains in the Genus database with same CATH homology
 1FY7 A;  3C7J A;  4KIC A;  5LHH A;  4CDG A;  3KE2 A;  5KVR A;  2O61 A;  3U2R A;  5FO5 A;  1OYY A;  1IRG A;  3SFZ A;  2P5V A;  3L2C A;  4U7D A;  1DPR A;  1Z9C A;  1TQM A;  2P6T A;  4YFN F;  5D4S A;  4WX9 A;  5ILV A;  4NB5 A;  1OKR A;  3GVA A;  1SD5 A;  4RGU A;  3WGG A;  1S7O A;  5HDN A;  2EV0 A;  3ZP5 A;  4LB5 A;  4U0V A;  3HYI A;  1ULY A;  3DPL C;  4WF2 A;  4HF2 A;  6PAX A;  3BDD A;  4ETS A;  2Z5U A;  4EVI A;  3RYR A;  4R8H A;  3RPU A;  3HSF A;  3O3K A;  1I27 A;  1XN7 A;  5L3E A;  4ENN A;  1KQ0 A;  2DQL A;  2W57 A;  4L9T A;  3F6O A;  1IF1 A;  3GFJ A;  1ZG1 A;  2F5C A;  3F3X A;  3KZY A;  2OZU A;  1GXQ A;  1XDS A;  2Q8K A;  4NQW A;  1KU9 A;  5K5Q A;  4MTD A;  2CGP A;  2XAF A;  5LHG A;  4MEY F;  1KGS A;  2XRN A;  5E1X A;  5LRS A;  2VBX A;  2RVC A;  2EK5 A;  2WV0 A;  1HKS A;  1T6S A;  2ZME B;  3KP3 A;  1LDD A;  1BM9 A;  1JE8 A;  1UHW A;  5D5W B;  1MJ9 A;  3CDH A;  4MNU A;  5CVI A;  3LWF A;  3IKV A;  4D0P A;  3HTS B;  2O3F A;  2FEZ A;  4M71 A;  2P7C B;  3OV8 A;  3HSR A;  1LVA A;  1FSE A;  3E6D A;  2Y75 A;  4UUV A;  4O3M A;  3M8E A;  2FOK A;  3RI4 A;  4ON0 A;  1ZRF A;  2PMU A;  1ON2 A;  1ZRD A;  4ESF A;  4AIK A;  1SFU A;  5FB2 A;  3E6C C;  1IN7 A;  4LLN A;  3IWF A;  2W84 A;  2HDC A;  3PQJ A;  3WE2 A;  1RUN A;  1J5Y A;  1HKQ A;  3P7N A;  1CF7 A;  5DD8 A;  2DPD A;  1R1U A;  3RKX A;  4L5I A;  5FD5 A;  2VBZ A;  2L4A A;  3J81 Z;  4XLN F;  3JTG A;  1AOY A;  3M7G A;  5ICC A;  1STZ A;  3ZN0 A;  4Q5S F;  1E17 A;  2JSC A;  1XGM A;  5BOX A;  1ZN2 A;  2MD5 A;  4ZYE A;  2DPU A;  3TO6 A;  3GFM A;  2VN2 A;  2UWM A;  2VT3 A;  4P55 A;  2IA1 A;  2J5O A;  4CO8 A;  3K0L A;  2ISZ A;  2HYF A;  2XKP A;  2X4H A;  2E7X A;  2TDX A;  3ISP A;  1F9N A;  4AWX B;  3V7S A;  3G73 A;  4U7B A;  2RQP A;  2R7F A;  3P9I A;  3TQN A;  1U2W A;  1B59 A;  3EET A;  5J8C A;  5K5O A;  2M8E A;  5HLI A;  1XMK A;  5FLX K;  1F5T A;  5D4R A;  2GIV A;  1FPQ A;  5CVU A;  1W7P B;  1LJ9 A;  4F7Z A;  2GA1 A;  1J7K A;  2UXX A;  3TOB A;  2XAJ A;  1FYL A;  3TO7 A;  1FP2 A;  1OYI A;  3T0Y A;  1D8J A;  1DDN A;  4QLC U;  5LGU A;  3K2Z A;  3ECO A;  1BJA A;  4KMU X;  3DFG A;  5AON A;  2AS5 F;  1YFH A;  3M8F A;  2NYX A;  5DYM A;  2VON A;  4BYY A;  4FX4 A;  4LK1 F;  4A6D A;  4XLP F;  4EGY A;  1ZRC A;  2P5K A;  3GX4 X;  2A6E F;  1ON1 A;  1T98 A;  1IAW A;  2JRT A;  1RZ4 A;  1LDJ A;  2OQR A;  2VOP A;  1YIO A;  4YIF A;  1MGT A;  3DP7 A;  5A2Q Z;  1QQI A;  1JGS A;  2O0Y A;  2G7U A;  5J8F A;  2IPQ X;  4UXN A;  2YX4 A;  4HF1 A;  1G6N A;  4Q4Z F;  1DPU A;  3QU6 A;  2EFP A;  5BMZ A;  3FM3 A;  2YPR A;  4Y13 A;  3LA7 A;  3IRQ A;  5IT9 K;  2XV4 S;  1UFM A;  1BI2 A;  1RNL A;  3MZY A;  1TQP A;  1JHH A;  4CYD A;  3V7R A;  4KT5 C;  2ZXJ A;  5DCF A;  1O3R A;  3WTS C;  1OPC A;  2E1C A;  1YW8 A;  3WTZ A;  1P4A A;  4I2O A;  2DK5 A;  4HAM A;  2M30 A;  1G3S A;  4R79 A;  5A2Q K;  1KU3 A;  2DI3 A;  2KJB A;  2XVC A;  2JTV A;  3DEU A;  1XGO A;  2DK8 A;  1RUO A;  4P5O A;  4LB6 B;  4DQ2 A;  3DPT A;  1G3Y A;  1EV7 A;  3K1N A;  3W6J B;  3J7A O;  4OIP F;  4HBL A;  4EJW A;  3HHH A;  1FYK A;  3Q9S A;  5L3G A;  1IXR C;  2MC3 A;  2MBF A;  2QVO A;  4PGG A;  3ABU A;  1IRF A;  3HUG A;  1MDM A;  3R0A A;  5EEG A;  2ZME A;  1J2X A;  5HS7 A;  3S2W A;  4EM2 A;  3QU3 A;  1SD6 A;  5D6E A;  3N97 A;  1Z91 A;  2ZNZ A;  5AIP A;  3TGN A;  2XAG A;  1QNT A;  2LF8 A;  5E8I A;  3BPV A;  1W7P D;  4HW0 A;  1BC8 C;  4MTE A;  2HTJ A;  4S04 A;  5K5R A;  2DT5 A;  5DEQ A;  4I0B A;  3IHU A;  1MJA A;  3LST A;  3M9A A;  1O3Q A;  3GYH X;  2FF4 A;  3ZMS A;  1LEA A;  1BIA A;  3MWM A;  2O8X A;  3GFI A;  1HKT A;  2LNB A;  2KRF A;  2HWV A;  1X3U A;  1ZAR A;  4G6D A;  1LDK B;  3F72 A;  1TW2 A;  3R4K A;  1EH6 A;  3BRO A;  4LLL A;  2F5D A;  3C3W A;  4KIB A;  3WGH A;  1T38 A;  3T8R A;  2C6Y A;  5H6Q A;  2ZKZ A;  1P6R A;  2HZT A;  2GWR A;  1S3J A;  1OYW A;  3E6B A;  5DCM A;  4UVC A;  5DUI A;  2A68 F;  3CUQ A;  1SFE A;  4EJT A;  3U9G A;  2E7W A;  4EJU A;  2A61 A;  1FP1 D;  1D5V A;  3RKY A;  2FSW A;  4A0Z A;  1PDN C;  1YS6 A;  4IHT A;  4XSZ F;  1NHA A;  4G6Q A;  4G8X A;  4I01 A;  4O5V A;  2VBW A;  3HRS A;  4BHC A;  5ILS A;  2ZCW A;  3NEU A;  4ZYH A;  1B4A A;  1FWZ A;  1J9I A;  1C0W A;  3FX3 A;  4BNC A;  3SZP A;  1GXP A;  3KLO A;  1ZH5 A;  2Z99 A;  3VFZ A;  2EFO A;  3PQK A;  5JFR A;  3EDP A;  1HW1 A;  4Y17 A;  4KDP A;  1HQC A;  1W7P A;  3O2P E;  3JSP A;  5EEH A;  3ZMZ A;  5ERI A;  4E70 A;  4NHJ A;  5F6F A;  2WTE A;  1QPM A;  3DXJ F;  3QPT A;  1PP8 F;  1BI3 A;  4GO1 A;  3SZT A;  1PP7 U;  4XRF A;  4TV7 A;  2HS5 A;  2FA5 A;  5F1R A;  2R3S A;  2QYO A;  3F21 A;  2FBH A;  5FGM A;  3KFW X;  3K69 A;  1OMI A;  1KU7 A;  1O7F A;  5D5V B;  1K6O A;  5D5X B;  2XIG A;  2CSO A;  3E5Q A;  5FFX A;  3T5X A;  4GCV A;  4HV6 A;  1FX7 A;  4BAY A;  1Z1D A;  3KP5 A;  2JPB A;  3JAM Z;  2A6H F;  5DD4 A;  2OA4 A;  3CLO A;  3K9T A;  1KYZ A;  5L3D A;  2EV6 A;  3BP8 A;  3WTX C;  3RIR A;  1MD0 A;  4EJV A;  3BPX A;  3CUQ B;  1FBQ A;  3CUO A;  2BEO A;  3R0J A;  5E17 F;  2VE9 A;  1R36 A;  1V3F A;  2HTS A;  3V8L A;  2IRF G;  4AVP A;  1H9G A;  2YSR A;  2CYY A;  3LQQ A;  3ECH A;  2DO7 A;  3NQO A;  2MH2 A;  1YW7 A;  2RGV A;  1IUY A;  1ZLJ A;  2PQ8 A;  4RGR A;  3GFL A;  3IKT A;  4QWQ A;  2O6G E;  4G7H F;  1I6X A;  4LLG F;  1FC3 A;  2OQG A;  3FXR A;  4KN4 X;  4L18 B;  3E6M A;  2B0L A;  1BI1 A;  3GW2 A;  2Y0M A;  5E1Z B;  2DBB A;  1ODD A;  2KKO A;  2GA2 A;  4A5N A;  2OAZ A;  5F64 A;  5TJJ A;  1U78 A;  4MQV A;  5BS6 A;  1R22 A;  2ISY A;  2H6C A;  4YG2 F;  2ZFW A;  2QEN A;  3KCC A;  1XB4 A;  3F8B A;  3WTV C;  4ENK A;  3SQN A;  1SD7 A;  3RPQ A;  2FNA A;  4I7H A;  1WQ2 A;  3FXU A;  1I1G A;  5HOO A;  3JTH A;  3N4M A;  1J59 A;  4ESB A;  3L9F A;  4UV8 A;  4BHB A;  2P7V B;  4S05 A;  3HRT A;  5ED4 A;  2EB7 A;  1G4D A;  3Q9V A;  2QLZ A;  1GHC A;  3V8K A;  1XCB A;  2IA2 A;  2OBP A;  1R58 A;  1W4M A;  2V1D A;  4OIR F;  1MDM B;  1S8N A;  3VOD A;  4BHP A;  3GZ6 A;  4LMY A;  4EJO A;  3QPH A;  4U0Y A;  1FBS A;  1EH7 A;  2QQ9 A;  3COA C;  3FXQ A;  5ICE A;  2BV6 A;  3ML6 A;  1H0M A;  2HKX A;  1FNN A;  2HQR A;  3LQR A;  3RDI A;  4JQF A;  4UHT A;  3F6V A;  1USS A;  2MH9 A;  2FBI A;  4HX8 A;  1T0F A;  5L3C A;  2GZW A;  2L4M A;  2QQB A;  4ENJ A;  3E97 A;  2YR2 A;  4N0B A;  4OOI A;  4M9X A;  5HVQ C;  1QZY A;  4L9V A;  3W6K B;  2ESN A;  4RB3 C;  3DV8 A;  2W85 A;  2W25 A;  1IN6 A;  1QZZ A;  2DAO A;  1BOA A;  2COM A;  4ASN A;  3R60 A;  4M9Z A;  1TTY A;  3L7W A;  3ZMT A;  5LHI A;  2PLY A;  2VC1 A;  1CF7 B;  5LGT A;  2P6S A;  3EYY A;  3KET A;  3I64 A;  2ESH A;  2G7H A;  3Q5F A;  1F1Z A;  3WU0 A;  5HLH A;  2K4B A;  2FMY A;  3QAH A;  3VEP A;  2XAH A;  3IL2 A;  2PMH A;  3ZMV A;  5IT3 A;  2M5W A;  3QOP A;  1MZB A;  2IW5 A;  3TKY A;  4BQA A;  3MAJ A;  1IZ1 A;  1UCR A;  4FT8 A;  4P96 A;  4KFC A;  1FT9 A;  2LKP A;  3I53 A;  1KA8 A;  4IRI A;  1WSU A;  4HF0 A;  3J80 K;  4Q48 A;  3DF8 A;  1KYW A;  3BJO A;  1HSJ A;  4ZH4 F;  3V8J A;  3KEO A;  3KP2 A;  1WI9 A;  2K02 A;  1YQA A;  3J81 K;  5ICF A;  3U1D A;  2A69 F;  4L0Y B;  1ZRE A;  1P4X A;  1EH8 A;  3R61 A;  2MLG A;  4H0E A;  3KP7 A;  1XSD A;  4CZZ A;  4IJA A;  5DCM B;  3RTR A;  4GGG A;  4IRH A;  3WTY C;  1R23 A;  2EV5 A;  2PBI A;  4PGH A;  2MA3 A;  5KK1 A;  4I02 A;  3MFK A;  4B8X A;  4WXD A;  1CGP A;  1HW5 A;  2X0L A;  2OU2 A;  2GXB A;  1REP C;  4KMF A;  1B1B A;  1XSV A;  3L00 A;  4JK1 X;  3ZN1 A;  4ESJ A;  4Y15 A;  3G3Z A;  4KNY A;  3BJ6 A;  2P8T A;  3GEZ A;  3EQL F;  1FBU A;  2GXG A;  3EYI A;  3PFI A;  4EM0 B;  2Q2E A;  3M1E A;  1Z6R A;  4G7Z F;  1U5T B;  2RC4 A;  4O6J A;  1B6A A;  2J5P A;  4L9N A;  5FD6 A;  3ZQ7 A;  2IA0 A;  4FX0 A;  3FHZ A;  5L3F A;  2Z9O A;  2QWW A;  3VB2 A;  1Z6T A;  5D5U B;  1J0R A;  5DDG A;  3GO5 A;  1LNW A;  1PUE E;  5E8G A;  4FHT A;  5HDG A;  3FM5 A;  4A6E A;  1LQ1 A;  2ELH A;  1B9M A;  2R7D A;  4EGZ A;  1FZP B;  2K7L A;  4RB2 C;  3F8F A;  1XDU A;  2D1H A;  3BY6 A;  1U3E M;  4GYI A;  4A0Y A;  3TDZ C;  2STW A;  2GQQ A;  4M74 A;  2Q0O A;  3P9C A;  2EFQ A;  1ZAO A;  1MKM A;  1UHM A;  3GF2 A;  4ZYG A;  5CVR A;  1KQ8 A;  2XUB A;  4RGS A;  2E1N A;  4AD9 A;  3LA2 A;  2Z3Y A;  2VBY A;  4UVA A;  2KIF A;  3C1D A;  2D45 A;  2VOO A;  3RKW A;  3E5U A;  3HTU A;  2XHK A;  1MJB A;  1P92 A;  1Z05 A;  3KZZ A;  4WCG A;  2V9V A;  4HQE A;  3OOP A;  4IF4 A;  2JZY A;  3O6B B;  4HOB A;  3D5L A;  3I58 A;  1XSX A;  4HYE A;  4U88 A;  2VC0 A;  4EV0 A;  4KN7 X;  4RAZ A;  4ENM A;  1IW7 F;  1YLF A;  1GVJ A;  4XSX F;  3I59 B;  3NRV A;  3IWZ A;  3R6S A;  3WTU C;  4HLY A;  1DP7 P;  3MZH A;  1DUX C;  4IRG A;  5H20 A;  2HKO A;  1RIO H;  3F22 A;  1XGS A;  1ZLK A;  3ELK A;  1L3L A;  4ZZL A;  1R5G A;  3ZMU A;  1YTY A;  3GLX A;  4RB0 A;  1JHF A;  2QUF A;  4B09 A;  1JXS A;  2M87 A;  2DW4 A;  2FE3 A;  2G9W A;  2HYG D;  1WKM A;  2KIU A;  1Z7U A;  5CLS A;  3FMR A;  4IXA A;  1J75 A;  4HA8 A;  2D2W A;  3GXO A;  5ICG A;  4LJZ F;  4LK0 F;  2P4W A;  3I71 A;  3JAM K;  2DU9 A;  4U0W A;  4HX7 A;  2YX7 A;  3JSO A;  4KUM A;  4PCQ A;  5BPD A;  5BQT A;  2UXN A;  2OD5 A;  1R7J A;  3WE3 A;  1W5S A;  2BE5 F;  3BOQ A;  3MCZ A;  4G9Y A;  1K78 B;  2NRA C;  1LEB A;  2QM3 A;  4HQM A;  1P2F A;  4HX4 A;  4LD5 A;  1ONV A;  4R1H A;  1BC7 C;  1I5Z A;  1T2K A;  4L9J A;  4N9H A;  4A5M A;  1XMA A;  3MQ0 A;  2KJC A;  3F8N A;  5D8L B;  4HV5 A;  4HLX A;  4OU0 A;  4CHU A;  3EUH A;  2OZ6 A;  2Z33 A;  1D8K A;  4IVN A;  2H09 A;  1A04 A;  5CJ9 A;  1R1V A;  2FBK A;  5H6R A;  1R1T A;  5E1W A;  2K86 A;  4DNC A;  3I59 A;  3QRF F;  4G94 A;  2HQN A;  1E2X A;  2FQ3 A;  1G3W A;  1FSH A;  1K7A A;  2XAQ A;  4MEX F;  1B9N A;  2BGC A;  5LBQ A;  5HS9 A;  4K2E A;  2KIM A;  1FLI A;  2L3D A;  3HHG A;  4KYW A;  3T1B A;  3GUD A;  1P4W A;  1Q1H A;  2CQK A;  1L0O C;  2LF7 A;  2CFX A;  1YYV A;  2IT0 A;  3HOS A;  4A2U A;  4HDU A;  2H6B A;  1FYM A;  1WWX A;  2DTR A;  1O3T A;  5HLG A;  4EQQ A;  2VXZ A;  5DUK A;  4M9S A;  2WWY A;  2A07 F;  3FF5 A;  1YO5 C;  2CO5 A;  2PFB A;  2HR3 A;  2AXL A;  3F8C A;  3B02 A;  1R00 A;  2EJR A;  5BPI A;  3CJN A;  1QGP A;  2ZJ2 A;  3BJA A;  5TRD A;  4L5J A;  2EWN A;  3K1P A;  5J6X A;  4OIO F;  5FFZ A;  1U5T A;  1O7L A;  1QO0 D;  3WOD F;  1XCV A;  1XD7 A;  3LAJ A;  2M45 A;  2ACJ A;  2RDP A;  2K4J A;  4UV9 A;  5LGN A;  2O03 A;  4OMY A;  1U8R A;  5IT9 Z;  4G7O F;  3CUQ C;  2FU4 A;  2V79 A;  4AIH A;  1IXS B;  1QBJ A;  2RV8 A;  1U6G A;  2EA2 A;  2NNN A;  2PN6 A;  2H27 A;  3QP6 A;  3I4P A;  2P5L C;  4Q47 A;  1HBX G;  4OMZ A;  5LLQ A;  2F5F A;  4YFK F;  2M1B A;  4P9F A;  4RB1 A;  4A12 A;  4BH9 A;  5HDK A;  1WRJ A;  2XAS A;  4PZJ A;  1K78 A;  2ADU A;  3ERE D;  2STT A;  2DQR A;  2QBY A;  4CIC A;  3JW4 A;  4N9I A;  1XGN A;  4IPA A;  3FZV A;  3I5U A;  1UST A;  2RN7 A;  2EA4 A;  3SXY A;  2PG4 A;  4ZZD A;  4GXO A;  4CXF A;  4IHS A;  2HEO A;  1T39 A;  5CVV A;  2W24 A;  2ZBK A;  5AIQ A;  3H3Z A;  1ZHF A;  2FRH A;  2F2E A;  1BN5 A;  1BBY A;  3HRM A;  3GZ5 A;  3H92 A;  3J80 Z;  3I54 A;  2CG4 A;  4MHG A;  3SHF A;  4I0A A;  3RYP A;  2NNY A;  3B73 A;  3IC7 A;  5CYV A;  1BIB A;  3LAP A;  3F8M A;  1SD4 A;  2CW0 F;  3KP6 A;  2VOD A;  2A3S A;  4KIF A;  3RJP A;  3P9K A;  3D0S A;  4OIQ F;  3CO6 C;  2IJL A;  1YS7 A;  2ZO4 A;  1IN5 A;  2D1V A;  1AWC A;  5JVT A;  2EFN A;  2VT2 A;  2IP2 A;  5D8K B;  1ZG5 A;  3KP4 A;  5JR3 A;  1ZGA A;  1SMT A;  3REO A;  3CO7 C;  2FXA A;  2H94 A;  1RI7 A;  1HW2 A;  1TLH B;  4EM1 A;  2BYV E;  2F5E A;  1LB2 A;  2ZNY A;  3E3V A;  2EFW A;  3CTA A;  2MLK A;  3C18 A;  5K1Y A;  3GWZ A;  4XBF A;  2V1U A;  2RNJ A;  1KQ9 A;  3E5X A;  5ILU A;  3BZ6 A;  2DFI A;  1ZGJ A;  1TNT A;  1SMY F;  5CVJ A;  3WU1 B;  1I1S A;  2UZK A;  4YFX F;  1W5T A;  2FML A;  4RAY A;  1BI0 A;  5HS8 A;  4LFU A;  2PJP A;  3L09 A;  2V6C A;  4P9U A;  1TBX A;  2XRO A;  1S6L A;  3I0T A;  4KIG A;  1HST A;  3KLN A;  2YU3 A;  1TW3 A;  4I09 A;  4AIJ A;  3V4G A;  3ZMD A;  1VTN C;  4M6X A;  2GAU A;  2HGC A;  4LG0 B;  3WG9 A;  1U5T C;  2IVM A;  1OR7 A;  5E20 A;  3TO9 A;  1HXD A;  3VOE A;  3DQV C;  1YG2 A;  4M72 A;  3QP5 A;  4WK8 F;  2PEX A;  5L3B A;  3ULQ B;  2ETH A;  3FMS A;  5JHU A;  4KA4 A;  2L02 A;  2HOE A;  3HOT A;  3DKW A;  2PI0 A;  1ZYR F;  5DV5 A;  4RGX A;  1UB9 A;  3WGI A;  3KEQ A;  4RS8 A;  4HDV A;  2XGX A;  1TQI A;  4YII A;  4WWC A;  4CGZ A;  2JPC A;  5LEJ A;  2QBY B;  4MGR A;  2FNP A;  3AAF A;  1Y0U A;  1IN8 A;  2A5Y B;  3HRU A;  2BBY A;  4LGW A;  5E18 F;  2K27 A;  4A0X A;  1O3S A;  3MEX A;  4Z2Y A;  1YW9 A;  1IXC A;  2LSO A;  4I98 B;  1SFX A;  1FOK A;  1S7A A;  2L01 A;  3FMQ A;  2VE8 A;  4JBA A;  4HZF A;  5LEK A;  2QQA A;  2V1X A;  2CWE A;  1G3T A;  4BXU A;  3BWG A;  1R5H A;  1K79 A;  2WC2 A;  2NAZ A;  5LRR A;  3IRR A;  2HFH A;  1KU2 A;  3V7C A;  3F23 A;  4WXH A;  3ABT A;  3TOA A;  5FLX Z;  4MQ9 F;  4UNO A;  3LFK A;  2QZ8 A;  1ZG3 A;  4OIN F;  3LA3 A;  4GYG A;  3FWE A;  4PDK A;  3K1M A;  1F4K A;  3HIF A;  4ZYD A;  3TDU C;  2XKO A;  4UVB A;  1IN4 A;  1O57 A;  1TNS A;  2JT1 A;  3ZPL A;  1S29 A;  2LDU A;  4WXC A;  5JI6 A;  4M73 A;  1H9T A;  4LG0 A;  1SAX A;  2RKH A;  1V4R A;  5D6F A;  3ROU A;  3H3U A;  4EMS A;  4L0Z B;  2L54 A;  2NS0 A;  2Y48 A;  3HSE A;  4M6Y A;  1D3Y A;  3WTT C;  2DLL A;  3WTW C;  3T8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...