5E8GA

Crystal structure of the dna binding domain of human transcription factor fli1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Friend leukemia integration 1 transcription factor
publication title Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e8gA00
2QQAA 3LA3A 2M5WA 2XHKA 4ZYDA 4WXCA 4QWQA 2OD5A 1TLHB 2F5DA 2RQPA 2FNAA 3P7NA 1D8KA 4FT8A 3E6MA 3HOSA 4FX4A 4M6YA 2XUBA 3F8BA 1TTYA 1R00A 1KA8A 2VBXA 5DD8A 4R1HA 4CDGA 5ICCA 1Z9CA 1F5TA 2ZNYA 1XMAA 2DFIA 5DUKA 3GUDA 1WI9A 2R7FA 4I98B 4LMYA 4WXHA 3IWFA 4A0ZA 4WF2A 5CVJA 2ZCWA 4U7DA 3FMRA 2MD5A 4Y17A 1ZH5A 3BJAA 2FOKA 4JK1X 2PG4A 5J8CA 2G7UA 5BPIA 3OOPA 1XB4A 2VT2A 2FMLA 1XGNA 3RJPA 1KGSA 4G7ZF 3GXOA 3DKWA 4M6XA 3I58A 4AVPA 5LEJA 3I54A 1I1SA 2IJLA 2MC3A 1S7OA 2GA2A 2HZTA 3E6CC 4LB6B 2UXNA 1FX7A 2B0LA 4HYEA 1HW2A 5F1RA 4B09A 1LQ1A 3RI4A 2DK8A 3TDZC 5D5WB 5H6RA 1UFMA 3PFIA 2P8TA 3RKWA 2XASA 4N0BA 3SXYA 3KP6A 3TKYA 1USTA 3I59A 2VC1A 3F8CA 1TBXA 3WTVC 2FNPA 5D6FA 3DP7A 2NYXA 3I64A 5E1WA 4UXNA 5F64A 4MGRA 5AIQA 2FA5A 1EV7A 1FSHA 3ZMSA 3HSRA 2P7VB 1U3EM 2RC4A 1K78A 1FYLA 4ON0A 3LA2A 3V7SA 4BHCA 1GVJA 1LJ9A 3LSTA 4PGHA 1T38A 2O61A 5AONA 3RYRA 4FX0A 3PQKA 1J2XA 2AS5F 4KYWA 2HQNA 3BOQA 3FMQA 5IT9Z 2ZJ2A 1PUEE 4A5NA 3MZHA 1KQ9A 2YX7A 4A0XA 4YFNF 1Z6TA 2EK5A 1R5HA 3HRMA 3KP4A 2EFPA 3K2ZA 2Z5UA 2MLGA 2ISZA 3CUOA 5K5RA 3HIFA 4ESJA 3H3UA 3WODF 5BMZA 1S8NA 2RDPA 4UVAA 2FMYA 2VODA 5CVUA 1F4KA 2Y75A 1IN7A 2D45A 2C6YA 3JAMZ 1QZYA 4BAYA 3SQNA 3TDUC 2HFHA 4KMUX 4OINF 2QZ8A 3ZN0A 2DLLA 4WK8F 5DV5A 2XRNA 5D4SA 2L4AA 4EJTA 2FQ3A 1WKMA 1O7LA 4IRIA 3K1PA 4ZYHA 3ELKA 2VBWA 5LGUA 2PI0A 2K7LA 3E5XA 4KDPA 4OMYA 2UWMA 3HTSB 1R58A 1ZAOA 2W85A 5FLXZ 5CVRA 3MFKA 2IPQX 5K1YA 2GA1A 3ZMVA 4LLLA 4CYDA 1PP7U 1KU7A 2ESNA 4RGXA 3G73A 1EH7A 1FBUA 4LK1F 1IW7F 2PLYA 3HRTA 2H6BA 3GO5A 1MDMA 4HF1A 5LGTA 1IUYA 1T98A 2G9WA 3KP7A 2RKHA 2MA3A 2FXAA 3EYYA 1MJ9A 5A2QZ 1IZ1A 3R6SA 1TW3A 3HRUA 2Z3YA 3IRRA 2MBFA 1R1UA 2LNBA 2GZWA 3GFLA 4L0YB 2EWNA 1J0RA 4MEXF 1K6OA 2FU4A 1O57A 2VC0A 1YIOA 3RDIA 4G7OF 4TV7A 5HDNA 1YG2A 2KIFA 1FWZA 2DT5A 3JTHA 1HSJA 1ZRCA 3E5QA 1CF7B 3QU6A 3HRSA 2QBYB 1BOAA 1MJBA 2VN2A 5D5XB 2WWYA 2FBHA 2K4JA 2K02A 4MTDA 2W24A 1BI3A 2P6TA 4JQFA 4EGYA 1MGTA 2KIMA 2MLKA 3R0JA 3DV8A 2DTRA 3ZMZA 3JAMK 1FZPB 1XDSA 1SD6A 4HQMA 1YLFA 3GLXA 5D5UB 1H9TA 1XCBA 2A68F 2JRTA 4OIPF 2OQGA 1XSVA 3IWZA 4I09A 4LB5A 2QQBA 2P7CB 2FF4A 2YSRA 1W7PB 4ASNA 4WCGA 3K1MA 5FLXK 3BP8A 5E1XA 1L3LA 5D6EA 2G7HA 1BC7C 3FM5A 3WGHA 2ADUA 3M8EA 4HOBA 4M74A 3WE3A 1YW8A 1W5SA 3D0SA 1P4XA 2LDUA 1IN4A 1D5VA 2CO5A 2XAJA 1KQ0A 4EJOA 4MHGA 3VODA 3RIRA 2XVCA 3FX3A 4G6QA 1XGMA 1I1GA 3RYPA 2FBIA 3WTZA 4G9YA 3U2RA 1BI0A 5A2QK 1F9NA 2EFOA 4OIQF 1SMYF 4XSXF 3J80Z 3P9IA 1U78A 1SFEA 2DW4A 1H9GA 2CGPA 5HS8A 4R79A 1IF1A 1KU2A 1KU3A 1ZYRF 4HF2A 1LNWA 4UUVA 2DU9A 5E18F 3HHHA 2P5LC 2TDXA 4BHBA 5DDGA 3CJNA 3R0AA 5HS9A 1Z6RA 2HQRA 4N9HA 1QGPA 3FWEA 1VTNC 2KKOA 1G4DA 2GXGA 5LRSA 5JVTA 1T39A 1ZRFA 4LD5A 2W84A 2VBZA 4ZYGA 4P9UA 2F5FA 4I0BA 1IXSB 4HDUA 3R61A 4P5OA 2J5OA 2HYGD 2ACJA 1F1ZA 4MEYF 3EDPA 4HX4A 3Q5FA 2JZYA 3QPTA 3CDHA 4ETSA 2DPUA 3FZVA 4M9ZA 2AXLA 1EH6A 2PMHA 3OV8A 5D5VB 2V1UA 3EUHA 2WTEA 4HA8A 3GWZA 5E1ZB 4Y15A 3E6BA 3CUQA 2HKXA 3F6VA 1R36A 4Q48A 3V8JA 1JE8A 2KJBA 3JTGA 4YIFA 1B4AA 3LWFA 3PQJA 1HQCA 1C0WA 3I0TA 5LGNA 2OBPA 2EFQA 4KIGA 3FXUA 3J80K 2D1HA 2K4BA 2UXXA 4YIIA 2V9VA 2XV4S 1I6XA 3IKVA 4ZYEA 3L7WA 4RGRA 2GQQA 2NNYA 4PCQA 5DUIA 2XAGA 3O6BB 4NQWA 1ZGJA 2BGCA 4I2OA 2Q8KA 4DQ2A 1J59A 4RB2C 3O3KA 1B59A 4KMFA 4Z2YA 1R7JA 4EM1A 3QOPA 3V8KA 3F3XA 3J7AO 3QAHA 4YG2F 1W5TA 2GIVA 5LRRA 3CTAA 4IXAA 5FO5A 1YQAA 1SD7A 1HXDA 5LHGA 4CXFA 4E70A 2F2EA 3P9KA 4KUMA 3BPXA 3DEUA 1ZG5A 5KVRA 5ICGA 1SD4A 3GEZA 3F8MA 3WE2A 1IXCA 2VXZA 2WC2A 2JTVA 4H0EA 4A6EA 4XSZF 4RAZA 1R5GA 4BXUA 3LQQA 4AIKA 2BV6A 3H3ZA 4N9IA 3F8FA 2QVOA 4XLNF 5ILSA 1G3TA 4EGZA 1U8RA 2EFNA 4A2UA 4FHTA 4MTEA 2O8XA 4U0WA 2IA2A 2W57A 4F7ZA 1J7KA 3NRVA 4S04A 3FF5A 5KK1A 1K79A 1YYVA 3WTTC 3K1NA 4HDVA 2GAUA 5HLIA 1ON2A 2HWVA 1UB9A 1Z7UA 4JBAA 4BNCA 2CSOA 2DI3A 3Q9VA 5D8LB 2EA2A 3L09A 1UHMA 2O3FA 1DUXC 3ISPA 1P4AA 3WG9A 1XD7A 2F5EA 1UHWA 3FM3A 3E5UA 4GXOA 2ELHA 1E17A 4EM2A 2XAHA 3LQRA 3M9AA 2D2WA 3BJOA 5FFZA 1DPRA 2FSWA 1H0MA 2YU3A 5IT3A 4IPAA 2VONA 2JPBA 3LFKA 2FE3A 3IL2A 1ZRDA 3B02A 3I59B 3SZTA 4Q4ZF 3IHUA 4EJVA 2STTA 2ZXJA 2HS5A 2Y48A 4M9XA 5DCFA 2P5KA 3I4PA 1AOYA 1D8JA 4ZZDA 3BZ6A 3ULQB 2NNNA 1K78B 2QLZA 2XKPA 2EV5A 5ILUA 1TQIA 3TQNA 2DQRA 4UV8A 2RGVA 2EJRA 2X4HA 3T1BA 4P9FA 2QUFA 1IXRC 1CGPA 1ZHFA 3L9FA 3F8NA 1QPMA 3C1DA 6PAXA 2E1NA 3ZMDA 4OIOF 2NAZA 5HDKA 4LG0A 4AIJA 3HSEA 1EH8A 3DQVC 2M1BA 1ZLKA 1OPCA 2EA4A 5DEQA 1KU9A 2X0LA 2QENA 3VOEA 3M8FA 1R1TA 2YX4A 1RUNA 4DNCA 1V4RA 5ICFA 3KZZA 2HTSA 3F72A 1LDKB 2OU2A 2ZMEA 2BBYA 1QZZA 1ZLJA 1GHCA 5J8FA 1WQ2A 3RPUA 5JHUA 5IT9K 2M45A 4O5VA 3U9GA 3K9TA 4P96A 3FXRA 1XCVA 5DCMA 1BIAA 4LGWA 1U5TB 1DP7P 4KNYA 4A0YA 3KETA 3E6DA 2V1XA 3MWMA 1R22A 2FEZA 2M30A 1ZGAA 1Q1HA 1P2FA 2ZFWA 2RN7A 4A12A 3KEQA 1MDMB 2PEXA 3B73A 2E1CA 2COMA 3LA7A 2XAQA 2MH9A 5LBQA 4GGGA 3C3WA 1ZG3A 2GXBA 3TGNA 4BYYA 5L3BA 5F6FA 3RKYA 3WU0A 1OYYA 4KN7X 3T0YA 1JXSA 2R3SA 2VT3A 3SHFA 4PDKA 1YTYA 2O03A 2MH2A 3ML6A 3WGIA 4EJUA 4NB5A 3DF8A 5ICEA 2Q2EA 1HW5A 4O3MA 1T2KA 4IVNA 3HSFA 4CHUA 3I71A 1U2WA 3HTUA 1SFXA 1U5TC 3L00A 1XSDA 3KLOA 4RAYA 3M7GA 3WTYC 1BJAA 2OAZA 1S7AA 4ENKA 1OYWA 1OKRA 3GFJA 3N4MA 3MCZA 2OZ6A 3IKTA 4OU0A 2BE5F 1ON1A 1GXPA 2DBBA 3FMSA 3LAPA 2JSCA 2W25A 1QQIA 4Y13A 3JW4A 4ZZLA 3P9CA 1XGSA 2QWWA 1IN5A 5K5QA 2DO7A 5DD4A 1XSXA 3ECOA 3GYHX 4UNOA 2ZKZA 1AWCA 3HUGA 4IHSA 4IHTA 5D8KB 1FOKA 1LEBA 5HLGA 4EJWA 1R1VA 3DFGA 1HBXG 1DPUA 2Q0OA 1YW7A 2A3SA 1JHHA 3R60A 2XKOA 1O3TA 2ISYA 3EETA 3ZMUA 1L0OC 1E2XA 3R4KA 3KEOA 4KT5C 4O6JA 1J75A 1BBYA 1XN7A 1HSTA 2ZO4A 1YO5C 3F21A 3KZYA 3S2WA 2O6GE 1O3QA 3JSOA 1ZREA 5LHHA 1FT9A 2IRFG 1BC8C 1R23A 5BPDA 1STZA 1LDDA 4HAMA 2A61A 5H20A 4BH9A 4KA4A 3GX4X 2A6HF 5BOXA 3REOA 2RVCA 1ZN2A 5CLSA 5HDGA 2CWEA 3IRQA 5E17F 3V7CA 1B1BA 4HLYA 3MQ0A 5L3EA 3CO6C 5CJ9A 4S05A 2Y0MA 3QP6A 2IT0A 5LEKA 2J5PA 2ZNZA 2LF7A 3RKXA 3WTSC 4KIFA 4LFUA 4L18B 2PMUA 2HGCA 5FD5A 2KRFA 2OA4A 4ENMA 4RB1A 2L3DA 1Z91A 2H94A 2DK5A 3ERED 2DPDA 4M9SA 1OR7A 2PN6A 2YPRA 4U0YA 3VB2A 5EEHA 2LSOA 4HX8A 2Z99A 4P55A 3K69A 2RNJA 4IF4A 4LJZF 2L54A 3TOAA 3O2PE 4EM0B 1I5ZA 1P4WA 1XGOA 1S3JA 1O3SA 2KIUA 2XROA 4LLNA 1FNNA 4A6DA 4Q5SF 3HYIA 3U1DA 1TNTA 1XDUA 3JSPA 3GFMA 1FLIA 1FP2A 3CUQB 3KCCA 2F5CA 1QBJA 4U0VA 1OMIA 3QRFF 3MEXA 2HR3A 1MZBA 5ED4A 4LLGF 4L9JA 1IN6A 4AD9A 1O7FA 3ABUA 1SD5A 2FBKA 1PP8F 5AIPA 3F6OA 3TOBA 3K0LA 5ERIA 3ZQ7A 4RB3C 3COAC 2CW0F 2VE8A 1FBQA 3GW2A 4XLPF 4QLCU 4M71A 3AAFA 4I01A 4KFCA 1ZG1A 2DAOA 1J5YA 3KP3A 2KJCA 4U88A 4L9VA 4Q47A 4WX9A 5CVIA 2JT1A 1ZARA 2CYYA 5K5OA 5DYMA 1G3WA 1Z1DA 4M72A 3ZPLA 5L3GA 1P6RA 3GVAA 4G94A 3T5XA 3CUQC 1BN5A 4M73A 1LB2A 1TQPA 5D4RA 4HZFA 1B9NA 3V4GA 3RPQA 3TO9A 1KYZA 3V8LA 4HBLA 2L02A 3GF2A 3EYIA 4MQ9F 4R8HA 1YFHA 3BPVA 2EV0A 4I0AA 4GO1A 2PBIA 1BI1A 3D5LA 2FRHA 3TO6A 1USSA 2OQRA 1S29A 5FFXA 2IVMA 4HV6A 3ECHA 3WTXC 1LVAA 2A6EF 1TNSA 2HTJA 4UV9A 4ZH4F 4GYGA 4PGGA 2BEOA 1G3YA 4KICA 3C18A 1T6SA 2A5YB 4UVBA 2NRAC 1FY7A 1IRGA 3HHGA 3W6JB 3ABTA 1SFUA 4EV0A 1B6AA 2R7DA 3I53A 3GFIA 4CZZA 2EV6A 2P5VA 1YW9A 4UHTA 4GYIA 3EQLF 3F23A 3C7JA 1XMKA 5ILVA 1FBSA 5HS7A 4LK0F 3WU1B 1KQ8A 4HQEA 1S6LA 5E8GA 4HLXA 4U7BA 5TRDA 5TJJA 1ONVA 1ULYA 1SMTA 4CGZA 1RUOA 3L2CA 1KYWA 1U5TA 1CF7A 2HDCA 2VBYA 4L5JA 3NQOA 1B9MA 2QBYA 5H6QA 1BIBA 1SAXA 3F22A 4I02A 2H6CA 4AWXB 2UZKA 4OMZA 5LHIA 2IA0A 1RNLA 2H27A 3GZ5A 1GXQA 3I5UA 3GZ6A 1X3UA 1O3RA 1W4MA 3SZPA 1A04A 2VOOA 4EMSA 3DXJF 2ESHA 3QU3A 4HX7A 4YFKF 2K86A 3WTWC 2P6SA 2CG4A 5J6XA 5FGMA 4IRGA 3BWGA 1HKQA 3DPLC 2Z33A 3VFZA 1J9IA 5L3CA 1W7PA 1MJAA 4RS8A 2IA1A 3QPHA 2P4WA 3T8RA 3N97A 3ZMTA 4OOIA 1MKMA 4G8XA 4A5MA 5HOOA 1DDNA 1G3SA 1NHAA 4XRFA 1HKTA 1FP1D 1FC3A 1I27A 1RI7A 4RGSA 4PZJA 3CLOA 4KIBA 3SFZA 3BY6A 3TO7A 3BJ6A 4ESFA 4LG0B 5EEGA 4RB0A 2CFXA 3WGGA 1D3YA 2XAFA 3MZYA 5HVQC 2HOEA 1TW2A 3ZP5A 1Z05A 2CQKA 1ODDA 4K2EA 1IRFA 4BQAA 2ETHA 2GWRA 4ENNA 4L0ZB 4ENJA 2PFBA 3KP2A 4IRHA 2Z9OA 4EQQA 1TQMA 3QP5A 2V79A 4OIRF 4G6DA 5FD6A 3ROUA 2ZMEB 2QQ9A 5FB2A 1UCRA 2OZUA 2IW5A 5BQTA 2LKPA 2K27A 1W7PD 4XBFA 2H09A 1WRJA 4NHJA 5JI6A 5DCMB 2V1DA 5HLHA 4G7HF 1BM9A 2RV8A 5LLQA 3RTRA 2ZBKA 1IAWA 1LEAA 2HKOA 2NS0A 2A69F 5BS6A 3J81Z 4I7HA 3G3ZA 3T8TA 2PQ8A 1OYIA 2E7XA 2QYOA 1QNTA 3FHZA 1IN8A 1LDJA 1JGSA 4WXDA 2L4MA 5E8IA 1JHFA 1PDNC 2IP2A 5JR3A 4L5IA 1FSEA 1FYKA 5CVVA 3KFWX 3VEPA 2M87A 4IJAA 1V3FA 4L9NA 2L01A 5L3DA 2VOPA 3KE2A 4EVIA 3E3VA 2E7WA 4MQVA 2STWA 5CYVA 4HV5A 2HYFA 4B8XA 4KN4X 2EB7A 4HF0A 1WSUA 4D0PA 2O0YA 2JPCA 5L3FA 2LF8A 2VE9A 3KP5A 4CICA 2V6CA 3HOTA 1Y0UA 3W6KB 1YS7A 1MD0A 3WTUC 5JFRA 2QM3A 1QO0D 2EFWA 3BDDA 1HKSA 4MNUA 3BROA 1WWXA 1G6NA 1YS6A 2DQLA 2M8EA 3KLNA 2WV0A 1HW1A 3NEUA 2YR2A 3M1EA 3MAJA 1BI2A 3V7RA 2A07F 2HEOA 1T0FA 3Q9SA 2D1VA 4UVCA 2BYVE 4YFXF 1FPQA 1RIOH 4GCVA 1U6GA 4ESBA 1P92A 3IC7A 3LAJA 1REPC 4BHPA 4L9TA 4HW0A 2PJPA 3FXQA 4AIHA 2XIGA 3H92A 4RGUA 1FYMA 3J81K 1RZ4A 3E97A 2XGXA 5E20A 4WWCA 4CO8A 3CO7C 1K7AA 3DPTA 3ZN1A
chains in the Genus database with same CATH superfamily
3PM1A 2QQAA 4BBRJ 1LFBA 3LA3A 2M5WA 4G12A 3ASNH 2XHKA 4ZYDA 4WXCA 4QWQA 2OD5A 3OL4A 4NC8A 1TLHB 1A5JA 2F5DA 2RQPA 3VPRA 2FNAA 3P7NA 4ZDLA 1BW5A 3H9JA 4Y7NJ 3CCUI 1D8KA 4FT8A 5M3MJ 1E3HA 3E6MA 2CRGA 5IP7J 3HOSA 4FX4A 4M6YA 1S72I 2XUBA 3F8BA 1TTYA 1R00A 1KA8A 2VBXA 3NWTA 4N4NB 5DD8A 4ZTJA 1R6RA 4R1HA 4CDGA 5ICCA 5JLXA 1Z9CA 1F5TA 2K3FA 1XMAA 2ZNYA 1VQNI 5DS9A 3FBIB 2DFIA 1NG7A 2DODA 5DUKA 1VQMI 3GUDA 3K4LA 2NS7A 2DOAA 5GPCA 1WI9A 2R7FA 3HZJA 4I98B 4LMYA 2VKDA 2E2IJ 2DFHA 4WXHA 3BQYA 3IWFA 3QYBA 4A0ZA 1E3OC 4WF2A 5CVJA 4XRMA 2ZCWA 2L7ZA 3FMRA 4U7DA 2MD5A 5M5WJ 3PO2J 3GMEA 3HL2A 1TC3C 5IYDJ 1OJLA 4Y17A 1U0JA 2M2EA 2QQ8A 3DTEA 1ZH5A 3BJAA 2FOKA 3PIPF 3BR6A 4JK1X 3J7AY 2PG4A 5K7HA 1H8AC 5J8CA 2G7UA 3QODA 3J7YJ 3OOPA 5BPIA 1XB4A 2VT2A 2FMLA 3KYLA 1XGNA 3RJPA 2ID6A 1KGSA 5GAHJ 1WH7A 5EF6A 4G7ZF 3GXOA 3DKWA 4M6XA 3I58A 4AVPA 3I56I 2AO9A 5LEJA 2VJIA 3I54A 4MFEA 4XLFA 4IEJA 1I1SA 2IJLA 3KX2A 2MC3A 1S7OA 1OCZH 3LNQA 1ERDA 2XGEA 4LIVA 1W36C 2UUZA 2ZJRF 3L2UA 2GA2A 2HZTA 3E6CC 2JVHA 4LB6B 3H3VK 1ZK8A 3LSGA 2L9VA 1RR8C 2UXNA 4DYRA 1FX7A 2B0LA 1Z77A 4HYEA 1HW2A 4PUSA 5F1RA 4B09A 1LQ1A 1WJCA 1MBGA 3RI4A 2DK8A 4NQWB 2BY1A 4RLFA 1FIPA 2HNHA 3TDZC 5D5WB 5H6RA 2JMWA 4MO7A 1UFMA 3PFIA 2P8TA 3RKWA 1B72B 2I5UA 2XASA 4N0BA 3SXYA 3KP6A 3DEEA 4X0GA 3EUHC 3TKYA 1SFKA 4A3MJ 1USTA 3JRAA 3I59A 2GBYA 2VC1A 3F8CA 2CV1A 1TBXA 3WTVC 2FNPA 4E7LA 5D6FA 1WH5A 2X1DA 3DP7A 2NYXA 3I64A 5E1WA 4C9YA 3OIOA 2VPRA 1WPKA 3PNYA 4UXNA 5F64A 2EIKH 4MGRA 4XL9A 5AIQA 2CUZA 3PO3J 2FA5A 3CMAI 1EV7A 1JUMA 1FSHA 3ZMSA 2O7OA 3HSRA 2HOTA 2P7VB 5FKMA 1U3EM 5EGOA 4MLOA 3LSPA 2RC4A 3WHBA 1K78A 4XLHA 1T95A 1FYLA 4ON0A 3LA2A 2LY9A 3V7SA 1ZELA 2EPFA 1I3QJ 3JR9A 4BHCA 1GVJA 1LJ9A 3LSTA 2Y0SN 4PGHA 1APLC 3KZIC 1T38A 5IP6A 3QYFA 1O4XA 1YITI 2O61A 4A3JJ 3ZQQA 5AONA 4F93B 3RYRA 4FX0A 2VQHA 2RNGA 3PQKA 3C2GA 5M5YJ 2Y9YA 1MBJA 3G4SI 1J2XA 4CCLA 2LREA 2AS5F 4KYWA 3SJMA 2EINH 2HQNA 3BOQA 1OR7C 3FMQA 5IYBJ 3DLLF 2R7WA 2HZDA 1VQ4I 1MBKA 2YUSA 2ZJ2A 1PUEE 4A5NA 3MZHA 1KQ9A 2LLKA 2YX7A 4A0XA 2ZFUA 4YFNF 1VZ0A 4CUGA 1Z6TA 2EK5A 2DMUA 1R5HA 1SVLA 4HG2A 3HRMA 3KP4A 2EFPA 5TGTA 3K2ZA 2QSGX 2Z5UA 2MLGA 2ISZA 1JT0A 2LC2A 2M7AA 5CQGA 3CUOA 5K5RA 2ZJQF 3HIFA 4ESJA 3H3UA 5J1YA 3WODF 5BMZA 3LMMA 1S8NA 4B44A 2RDPA 4UVAA 5HODA 2BW3B 2FMYA 2R0QC 3NARA 2VODA 3BTCA 4D7MA 1OFCX 3A2KA 5CVUA 4LOCA 1N25A 2WB1N 2Y75A 1IN7A 1F4KA 1RETA 2D45A 5EG0A 4E6KG 4MFDA 1WJBA 2EIMH 2C6YA 1XG1A 3JAMZ 1QZYA 4BAYA 3CMYA 3SQNA 2HDWA 1K6YA 2HFHA 3TDUC 4KMUX 3CJTB 4OINF 4XLAA 4DGWB 2QZ8A 3ZN0A 2B9SA 2XPUA 2DLLA 2IGMA 2F4IA 4F91B 3VYSB 2XB5A 4WK8F 5DV5A 3S1NJ 3QWLA 2XRNA 2ZXWH 5D4SA 2L4AA 2R5ZB 4EJTA 2FQ3A 2L7KA 1JKOC 1WKMA 1O7LA 2AQEA 4IRIA 3K1PA 4XKWA 4ZYHA 1U8BA 3ELKA 2VBWA 5LGUA 1I6HJ 2PI0A 2K7LA 2X1CA 4DYCA 3E5XA 4KDPA 4OMYA 2B63J 2UWMA 3BG3A 2R7ZJ 1GVDA 3HTSB 3GTOJ 4J19A 1R58A 1ZAOA 4LG3A 3H5NA 2W85A 2WY8Q 5FLXZ 5CVRA 4DZPA 2IPQX 5K1YA 3MFKA 2LY2A 2GA1A 2HVQA 4LLLA 3ZMVA 4CYDA 2OJED 1PP7U 1KU7A 2ESNA 4RGXA 3G73A 1EH7A 1FBUA 1P7IA 4LK1F 4RM3A 1IW7F 2L2OA 2YS9A 2PLYA 1YRNB 3HRTA 2H6BA 3GO5A 1MDMA 1MMAA 2BVMA 1ETVA 2HI3A 5LGTA 4HF1A 1IUYA 2OTJI 3NAUA 2NVUB 3FKJA 2KQRA 4E7KA 1T98A 2MGQA 1FTTA 2CQQA 4DBQA 3Q0VA 2G9WA 3KP7A 2RKHA 2W82A 5KAFC 3UKGA 2EZIA 5E3OA 2IS4A 2MA3A 2FXAA 3EYYA 3ZXSA 1MJ9A 5A2QZ 2DA1A 4FASD 1IZ1A 1EKEA 4RMNA 2P0WA 4FCYA 5FLVA 2OC6A 3VYTB 4Z6YA 4XQFA 3R6SA 3OYKA 5F08A 3CP2A 5H2FC 4UUSA 1TW3A 3VYRB 3HRUA 5DTDA 3CZ6A 2Z3YA 3IRRA 2MBFA 1WJDA 4HNUA 3I4NJ 4C2UA 1R1UA 1Y8RB 4UB8C 4PJJA 3I55I 2LNBA 1HC8A 2GZWA 3GFLA 4L0YB 2EWNA 3PNTA 1X1CA 2DMQA 2E1MB 1J0RA 3S3OA 1MBFA 4MEXF 3B6AA 2DCEA 3ZR8X 2FU4A 2VIXA 2XF7A 2ZSIB 1K6OA 4FISA 4BU2A 4DIQA 4IKFA 4XKVA 1O57A 3BC8A 3G2BA 2VC0A 1YIOA 2K9SA 3RDIA 4G7OF 2WY7Q 4TV7A 3VYUB 5HDNA 1YG2A 3L2VA 2KIFA 1FWZA 2DT5A 3JTHA 4KT6A 3CMEI 2NVTJ 1HSJA 1ZRCA 3E5QA 5B66C 1CF7B 3QU6A 4OAYA 1G59A 3HRSA 2QBYB 5E79C 2RQQA 1BOAA 3TL4X 1MJBA 2VN2A 3BTJA 5D5XB 2XDVA 2WWYA 2FBHA 2K4JA 2VQLA 2K02A 4MTDA 2CQ7A 3ZQHA 1BL0A 2W24A 1BI3A 2P6TA 1M1EB 2DT7B 4JQFA 1MGTA 4EGYA 2KIMA 2MLKA 3R0JA 3DV8A 2DTRA 3ZMZA 3JAMK 1FZPB 1VQPI 1XDSA 1MMNA 1V54H 1SD6A 2OCEA 4HQMA 1D0YA 5IT9Z 1YLFA 2JA7J 3GLXA 3Q0UA 5KCMA 2CU7A 3OIPA 1W1WE 2CV2A 4M3GA 5D5UB 1H9TA 1XCBA 2A68F 2JRTA 1MBEA 3PIOF 4OIPF 4PFPA 2OQGA 4CH7A 1V55H 3BG5A 1XSVA 3IWZA 5B1AH 2K5CA 3CC2I 4I09A 4LB5A 2QQBA 2KL4A 4RAFA 2P7CB 2FF4A 3TBIA 4A3FJ 2YSRA 1W7PB 5E3LA 1SEUA 3HOUJ 4ASNA 5HNFA 4WCGA 4C30A 2RAEA 3LSMA 1LPQA 2P81A 4JX5A 2MD0A 2HXOA 1UMQA 3K1MA 5FLXK 4DBRA 2MFZA 3BP8A 1BR1A 1T33A 5E1XA 1L3LA 1TWCJ 5J3LA 5D6EA 1AKHB 2WV1A 2G7HA 1BC7C 2M34A 3FM5A 3WGHA 4RDUA 2ADUA 2LP0A 3M8EA 1Q1VA 4HOBA 4M74A 2Y31A 3SDBA 3WE3A 1YW8A 1W5SA 3D0SA 2CQNA 1P4XA 2LDUA 1IN4A 1D5VA 2CO5A 2XAJA 3CCLI 1KQ0A 2WAEA 4EJOA 4MHGA 3VODA 3A0BC 3RIRA 2R7TA 2XVCA 4P1WA 4DZJA 3FX3A 4G6QA 4XKBA 1XGMA 4IQJA 1I1GA 3JRBA 3RYPA 2FBIA 3WTZA 4G9YA 1X4OA 3U2RA 4RAGA 1BI0A 1FIAA 5A2QK 2XF5A 4XICA 1F9NA 4B3AA 1MMDA 2EFOA 1SMYF 2HOAA 2F4MB 4OIQF 2FQ4A 4XSXF 3RQIA 5KHDA 5FRNA 3J80Z 3P9IA 1RKWA 3PUFA 4Y4RA 1U78A 1SFEA 2DW4A 1H9GA 2IXSA 2CGPA 3AG2H 2PJRA 3L1PA 5HS8A 4R79A 3S3NA 1VQLI 4NUBA 2VKEA 1IF1A 3PUBA 1KU2A 1WZ2A 1UAAA 1KU3A 1ZYRF 3OL3A 4HF2A 3PSFA 1LNWA 4UUVA 1VF9A 2DU9A 4CZCA 3ZQIA 5E18F 1GT0C 3OOUA 3HHHA 2P5LC 2TDXA 4BHBA 5GADJ 3K70D 5F04A 1HLVA 3MKZA 3FXLA 3P5JA 5DDGA 3OS1A 4A3BJ 2M8GX 3CJNA 3G6EI 4HSTA 3R0AA 3GTGJ 3OYMA 5HS9A 4IX7A 1Z6RA 2HQRA 4NNJA 3IAS2 4N9HA 1QGPA 3FWEA 1VTNC 2KKOA 4HSRA 1G4DA 2GXGA 1JJ8C 3OYEA 5LRSA 2ZSHB 5JVTA 2O5RA 1T39A 3H0GJ 2LBFB 1ZRFA 4LD5A 2HQ5A 2HXIA 3BR0A 3I3LA 2W84A 3JRFA 2VBZA 4ZYGA 4P9UA 3S17J 2F5FA 3W2AA 3IH3A 5LFAA 4I0BA 3DEWA 1IXSB 4QSHA 5M5XJ 4CYCB 3IV5A 1RC9A 3O8GA 4HDUA 3R61A 4P5OA 4BE2A 2JUGA 2J5OA 3LSKA 2HYGD 2GIZA 3CCEI 4H4KC 2ACJA 1F1ZA 5GTIC 2W7NA 4MEYF 3EDPA 4HX4A 4PK4A 3Q5FA 1HCRA 2JZYA 1QVUA 3QPTA 4HEA2 3FK6A 3CDHA 3CESA 2JVGA 4LIUA 4N4OB 4ETSA 2DPUA 3FZVA 3LSIA 4M9ZA 3OYHA 2AXLA 2BXZA 3CJRB 3LOCA 5E3NA 1EH6A 2PMHA 4II3A 3AG1H 3OV8A 1TWGJ 3Q0WA 5D5VB 2EH3A 2FJ1A 2DA3A 3OWTA 2GOMA 3FXOA 2HVRA 2V1UA 4QTRA 3EUHA 3A01A 2WTEA 4HA8A 3GWZA 3E7LA 1Z0XA 1FMWA 5E1ZB 4Y3OA 2X6OA 5B3SH 5IOZA 2R7XA 4AU7A 3IUOA 4Y15A 3TW7A 2V4JC 3E6BA 1KZHA 1S7EA 3J7ZI 1X58A 4XM3A 3F0CA 3CUQA 1TWAJ 1OCTC 4AM3A 2HKXA 4IZZA 3F6VA 1R36A 4Q48A 1W0TA 3V8JA 1JE8A 1R5ID 2KJBA 3JTGA 1PVEA 5C44J 3LFUA 4YIFA 1B4AA 1A6QA 3LWFA 4IHVA 2ZJPF 1LVKA 3PQJA 2MABA 4PFOA 2BY2A 2WAQA 3JCUC 1HQCA 1C0WA 1Z7LA 3I0TA 4D7NA 3K4CA 5LGNA 2KRCA 4Y33A 2OBPA 5KAIC 4DOZA 2EFQA 4KIGA 1OQYA 3FXUA 3J80K 1D0XA 2D1HA 2K4BA 2UXXA 4YIIA 1WFXA 2V9VA 2ZB9A 1HDDC 2XV4S 2M0CA 2E34A 1I6XA 3LSRA 3IKVA 4A69C 4ZYEA 3HGYA 1POGA 5FROA 1R49A 3RZDJ 1VFCA 3L7WA 4RGRA 2GQQA 2NNYA 2BHZA 3G71I 4PCQA 5DUIA 3RKQA 3DU5A 1FTZA 3H5RA 2MSYA 2R5YA 4IHWA 4F55A 2XAGA 4BBSJ 2HQAA 3O6BB 4NQWA 1ZGJA 2BGCA 2IGOA 4I2OA 1I3AA 4EEFG 2EQRA 2Q8KA 4DQ2A 1J59A 2LMDA 4RB2C 1IC8A 3BZCA 2F48A 3O3KA 5CKTA 2F5VA 1B59A 4KMFA 2GOXB 4Z2YA 1R7JA 2IGNA 3QOPA 4EM1A 5K7ZA 3V8KA 3HBLA 1XX5A 3F3XA 2DDAA 3J7AO 4B47A 1VQKI 3QAHA 4YG2F 1TP4A 4Y52J 1W5TA 2GIVA 3LSJA 5LRRA 4AYBA 3ESWB 5IY5H 3CTAA 3TP0A 4IXAA 2KZVA 3D1NI 2VXDA 2X48A 5FO5A 4XORA 1YQAA 4A3IJ 2CUEA 3CP8A 1SD7A 2A6TA 1HXDA 5LHGA 4CXFA 4E70A 1AU7A 2F2EA 4A3EJ 3P9KA 5TISC 4B3XA 2O9LA 3JRGA 4KUMA 1PJRA 3BPXA 5GAEJ 4ANJA 2LR8A 3DEUA 3RZOJ 1ZG5A 5KVRA 5ICGA 1SD4A 4YIRX 3GEZA 1Z3XA 3F8MA 3WE2A 3E0JB 1IXCA 2V26A 1XTAA 2JTVA 1S9HA 2VXZA 2WC2A 4BEHB 4KISA 4H0EA 1HOMA 4A6EA 4XSZF 4RAZA 1R5GA 4BXUA 1RRJA 3LQQA 4AIKA 2BV6A 3H3ZA 4N9IA 4OAZA 3F8FA 2XGCA 2QVOA 1P7JA 4XLNF 1X1AA 5ILSA 1G3TA 4EGZA 1V5GA 3OR1C 1MH4A 4PJMA 1U8RA 2EFNA 5EZHA 3FKIJ 4A2UA 4IL6C 4D5FA 1JI8A 1JUSA 4FHTA 4MTEA 1OLTA 3RQ4A 3SDGA 1MSEC 2DYRH 2O8XA 5EDNA 3UNGC 4U0WA 2IA2A 2W57A 1T0FC 1J7KA 3DWLE 3NRVA 4F7ZA 4S04A 2BW3A 4BDYA 4BE0A 3FF5A 5KK1A 1ETOA 3DTKA 1K79A 1SC7A 3QPLA 3GTPJ 4IOAF 1YYVA 3WTTC 3K4BA 3K1NA 4HDVA 4FTHA 2LG4A 4ITVA 4M3FA 1YX3A 2GAUA 5EZGA 2ECCA 5HLIA 3ZOBA 2R7UA 1ON2A 3VSKA 1JGGA 1BOBA 3A02A 4ZJZA 1TWFJ 1I50J 2HWVA 3FHNA 4QPOA 1UB9A 1YJNI 1Z7UA 4JBAA 4BJ6C 1VQ9I 4BNCA 1HDPA 1QZEA 2ZXHA 2CSOA 3Q3SA 2DI3A 3Q9VA 4CSWA 3CCSI 2WBMA 3GTMJ 5D8LB 2BVLA 2EA2A 3DU6A 1BJZA 1IJWC 2M3AA 3L09A 1UHMA 1YX5A 2QEXI 1ZGWA 2O3FA 1DUXC 3ISPA 1P4AA 5B1BH 3WG9A 1XD7A 2F5EA 1LFUP 1UHWA 5IPAA 1LKXA 2R4GA 1MH3A 1X3WB 2DTZA 2WA0A 2GM4A 3FM3A 5J4YA 3E5UA 4GXOA 5C3EJ 1V5FA 2ELHA 1IDYA 2BXYA 1E17A 4EM2A 2XAHA 1DU0A 2CQXA 1DGWY 1TZLA 3LQRA 3M9AA 1X3ZB 2D2WA 2MC4A 2VJJA 3BJOA 3OYDA 5FFZA 1DPRA 2IS6A 3BG9A 2VI6A 2FSWA 1H0MA 2ECBA 2R7OA 2YU3A 3DBRB 5IT3A 4IPAA 3DLAA 2VONA 5J47A 2JPBA 2CJJA 3LFKA 1YRNA 1BR4A 2X6YA 2FE3A 3IL2A 1ZRDA 3HKZA 1Y8QB 3BR1A 4BXXJ 2KIQA 3B02A 3K10A 1GV5A 3I59B 2LVSA 3SZTA 4Q4ZF 3IHUA 4EJVA 4J00A 2ZXJA 2HS5A 2Y48A 3CDIA 4V2FA 2STTA 1FOXA 4M9XA 2DJIA 2Z16A 4BJ5C 1OCOH 4V2GA 2NVXJ 2I10A 1W5CC 2DT6A 1TWHJ 2DA5A 2E2JJ 2XSDC 4E7HA 2DA7A 5EGOB 5DCFA 2P5KA 3I4PA 1AOYA 1D8JA 4ZZDA 3KIOA 3BZ6A 3ULQB 1X2MA 2CW8A 2NNNA 1K78B 3JRHA 2IS2A 2QLZA 2XKPA 2W4SA 3OYLA 2EV5A 5ILUA 1LE8A 1TQIA 3TQNA 4GDFA 2IEKA 3DPUA 2VJ4A 2DQRA 4UV8A 2RGVA 3QQAA 2VJ5A 2EZKA 5FKKA 4XN3A 2EJRA 2LTPA 2V9PA 2X4HA 3T1BA 4P9FA 1D1BA 2QUFA 2DOFA 1IXRC 3HOVJ 3H5AA 3KYCB 1CGPA 1ZHFA 3L9FA 3F8NA 1QPMA 1K61A 3C1DA 1MIJA 3CLQA 1Y39A 4BQNA 3WU2C 6PAXA 3MKLA 2EZHA 2E1NA 3ZMDA 1HF0A 2NAZA 4OIOF 5F0FA 5HDKA 3FIWA 4LG0A 4AIJA 3HSEA 3BR3A 1EH8A 2XC7A 3DQVC 3OYBA 1YI2I 2M1BA 1ZLKA 4ZYAA 2KMUA 1OPCA 1ETKA 2EA4A 3H1CA 5DEQA 2GXAA 1KU9A 2TRTA 3N05A 2FD5A 2X0LA 2QENA 3VOEA 4IO9F 1FOYA 3M8FA 5EG0B 3M07A 3CCYA 1R1TA 4E7IA 2YX4A 1RUNA 4DNCA 1AA7A 1V4RA 2QCOA 4NDLA 5ICFA 1V5EA 3KZZA 1EJ9A 1YE9A 2HTSA 5CQEA 1Z21A 4JOMA 3F72A 2MG4A 1LDKB 2OU2A 4X1EA 2ZMEA 2BBYA 4BY7J 1QZZA 1ZLJA 4BY1J 1GHCA 2CFOA 5J8FA 1WQ2A 2XF6A 2ID3A 3RPUA 1YOVB 3S2DJ 3CMMA 2E5NA 5JHUA 1R4MB 5IT9K 2M45A 3ONQA 3QOEA 4O5VA 3U9GA 5J1UA 3CCMI 2WAQN 3M1CA 3K9TA 4P96A 3FXRA 4C2MJ 1EA3A 1XCVA 2IBDA 4M3EA 5DCMA 3A1YA 3GTLJ 1BIAA 4LGWA 5HNHA 3K7AJ 5GAGJ 1Z3YA 1U5TB 1OCPA 1MNMC 4GFBA 2VPLA 1ETXA 1JTYA 1DP7P 1IDZA 4KNYA 2LOOA 4A0YA 3KETA 3E6DA 2V1XA 1ZQ3P 3D5SC 3MWMA 1R22A 2FEZA 2M30A 1ZGAA 3H9GA 1Q1HA 1ACIA 1P2FA 3PSIA 2ZFWA 2RN7A 4A12A 5KNLA 2L9NA 2M7BA 4II2A 3KEQA 1MDMB 1IO2A 2PEXA 3B73A 2E1CA 2COMA 3LA7A 4ABZA 1FJLA 2XAQA 2MH9A 4A3DJ 5LBQA 2IGKA 4GGGA 3PNVA 3C3WA 1ZG3A 2HPIA 2GXBA 3TGNA 1ETYA 4BYYA 1NK2P 5L3BA 5F6FA 4BDZA 3RKYA 2K40A 3WU0A 2ZC2A 1FEXA 1OYYA 4KN7X 3T0YA 1G8XA 1JXSA 3OSFA 2R3SA 2VT3A 3SHFA 3KEYA 4PDKA 1YTYA 3JRIA 2O03A 4UUSB 2MH2A 3ML6A 3WGIA 4EJUA 3RSNA 4AYBN 4B4CA 4NB5A 3DF8A 3SEZA 5ICEA 2Q2EA 3AL0B 1HW5A 4O3MA 3MMYB 3CCJI 2AXTC 1T2KA 5JLWA 4IVNA 3HSFA 2MW8A 4CHUA 3OIQA 4BE1A 3BTLA 3I71A 1U2WA 3HTUA 1IV8A 3MD2A 1EF4A 2JA5J 1SFXA 1K4TA 2X6WA 1HA8A 1I39A 3CC4I 3PL8A 3RPUD 1XPXA 1H89C 4JX6A 1U5TC 1Y56A 3L00A 3OS0A 1XSDA 3KLOA 1NH3A 3M4OJ 4CCKA 3HOYJ 4RAYA 3M7GA 1Z67A 3WTYC 1BJAA 3JREA 2OAZA 4XOPA 1S7AA 3G1LA 4ENKA 1OYWA 1OKRA 2NVYJ 3GFJA 3N4MA 4XOTA 5DM6F 3MCZA 2OZ6A 1D1CA 2R7VA 3IKTA 2BOLA 4OU0A 2X51A 2BE5F 1ON1A 1GXPA 4CCMA 2DBBA 3FMSA 1ZTRA 3LAPA 3S1MJ 2JSCA 2EBIA 1PUFA 3OSGA 1VQ8I 3OYFA 2B7EA 2NS8A 2DOEA 4DYQA 2HU9A 3OYAA 2OUMA 2W25A 1QQIA 4Y13A 2JN6A 2JRMA 2DJNA 2KHMA 3D5RC 1JKPC 1UELB 1AHDP 3JW4A 4ZZLA 3P9CA 3OS2A 1XGSA 1B8IA 2A05A 2QWWA 3ZQFA 3AL0C 3FISA 3BR5A 1IN5A 3A03A 2DO7A 5DD4A 5K5QA 1XSXA 3ECOA 2W00A 1NTCA 3AKZA 3GYHX 1RR7A 4UNOA 2KDOA 4B48A 2ZKZA 1SVOA 1A6IA 5J4VA 4BJTA 1AWCA 4XMYA 3HUGA 4IHSA 4IHTA 1MBHA 5D8KB 1FOKA 1LEBA 5HLGA 4EJWA 1R1VA 3DFGA 5F0CA 1HBXG 4XKCA 2Q1ZB 2R7QA 3AFHA 4NC6A 4RA2A 4I76A 4MIMA 4D9JA 1SVMA 1DPUA 2Q0OA 5FLMJ 3IH4A 3W3CA 2L9SA 2XB0X 3EUAA 2R7SA 1YW7A 4PSWA 4BACA 1N75A 2A3SA 2HDDA 1JHHA 3R60A 2XKOA 1O3TA 2ISYA 3EETA 3DCFA 3ZMUA 1L0OC 1E2XA 3R4KA 3KEOA 4KT5C 4O6JA 2JJ7A 1J75A 2JWTA 2WAFA 3IP4B 1CQTA 2HYJA 3MVPA 1BBYA 1XN7A 1HSTA 4PJ0C 2ZO4A 3DBLB 1NK3P 1ORKA 4XLCA 1YO5C 3F21A 3KZYA 3S2WA 2F6CA 2O6GE 1O3QA 2W1OA 1X2NA 3JSOA 1ZREA 4BKXA 4AVZA 5LHHA 2EZLA 1F43A 1FT9A 2XGDA 2IRFG 1IUFA 4RM2A 1BC8C 1R23A 5BPDA 1STZA 1SAUA 1LDDA 3BG6A 1JKRC 4HAMA 2A61A 5H20A 1DP3A 2JQ7A 4BH9A 3HOZJ 4KA4A 3GX4X 2A6HF 1H88C 4X6AJ 5BOXA 2H1LA 3REOA 2K85A 3K70C 5EYRA 3ASOH 2VUMJ 1JKQC 2QF7A 2RVCA 3L2WA 1ZN2A 1UG0A 5CLSA 5HDGA 2CWEA 3A0HC 4C3IJ 3CF5F 3CJQB 2VQCA 2FX0A 3IRQA 2DA6A 5EEAA 2JA2A 3IAM2 3S3MA 3V7CA 5E17F 1B1BA 4HLYA 3MQ0A 5L3EA 3CO6C 2R7RA 4QIWN 5CJ9A 4S05A 5FKLA 2Y0MA 3QP6A 2L7FP 4HNVA 2IT0A 2VLAA 4BS9A 5GTHC 5LEKA 4BQQA 2J5PA 2ZNZA 2LF7A 3RKXA 3TP3A 2OTLI 2TCTA 4KIFA 4LFUA 3WTSC 1T56A 3OYJA 4B43A 4L18B 2PMUA 4B1RA 4BGDA 1G2HA 2HGCA 3BTIA 5FD5A 1Y1VJ 4M3BA 1Y0NA 2KRFA 2OA4A 1W0UA 4ENMA 4RB1A 2FOWA 3F9KA 5J1RA 2L3DA 1QHHD 2KDZA 2NOGA 1Z91A 2H94A 4IHXA 2DK5A 2KLOA 4CCJA 3ERED 4E7SA 3IH2A 1KONA 2A5WA 2QKMB 2DPDA 4M9SA 1OR7A 5F0HA 2PN6A 2YPRA 4U0YA 3VB2A 2VKHA 5EEHA 2LSOA 4HX8A 2LFBA 4U87A 4BEHA 1JJ6C 2Z99A 4P55A 3K69A 2M0MA 2BHYA 3HJEA 1W36D 3HG9A 3H9QA 1DGRM 1X1PA 4QPQA 5B5EC 1WVRA 2RNJA 4IF4A 2OV7A 2CUJA 1WGXA 4AIDA 2E5ZA 1B72A 4LJZF 4FETA 1RPWA 2L54A 3TOAA 1IG7A 2LRDA 3O2PE 4EM0B 1R9TJ 2V1NA 4YRVA 1I5ZA 1YJ9I 3E1SA 1UG2A 1P4WA 2IAIA 1XGOA 1IRZA 1S3JA 1J09A 2DA2A 2XAUA 3A01B 2F4OB 3ZQCA 1O3SA 4A3CJ 2KIUA 2XROA 4IQ4A 2HOSA 4LLNA 1FNNA 4A6DA 4M3DA 4Q5SF 3HYIA 3U1DA 2CV0A 1TNTA 1NG6A 3DKXA 4JX4A 1XDUA 4FE4A 1ITYA 3JSPA 3GFMA 4NC7A 2KZGA 1FLIA 3DKYA 1FP2A 3CUQB 1WCMJ 3KCCA 2F5CA 4XRSG 1QBJA 3ZCOA 4U0VA 1OMIA 3QRFF 3MEXA 2HR3A 1MZBA 5E3MA 3HM5A 5ED4A 4OWRB 3MKWB 5J40A 4M6VA 1WJ5A 4LLGF 4L9JA 1IN6A 4AD9A 2L5QA 2VKVA 4CCOA 1TT0A 1O7FA 2CMPA 2V6EA 3M8JA 5FKNA 1QU3A 3GBGA 2E36A 3CDLA 3ABUA 1SD5A 2FBKA 2DFEA 1PP8F 3ZQLA 5AIPA 3SYTA 3F6OA 3TOBA 4A93J 3K0LA 5ERIA 3ZQ7A 4RB3C 3COAC 4E7JA 1K83J 3MZ8A 2QKLB 2CW0F 4E4HA 3BZKA 2VE8A 4W1UA 2PMZA 2QSFX 3C2BA 3FXKA 2V9KA 4XLEA 1FBQA 1UZCA 3GW2A 4XLPF 4QLCU 2ELKA 4M71A 2R5YB 2Y2ZA 3AAFA 4I01A 4KFCA 4L5EA 1ZG1A 2DAOA 1J5YA 1IGNA 3KP3A 2CW7A 1QRYA 2KJCA 4U88A 3DTIA 4L9VA 4E7ZA 4Q47A 1X19A 4WX9A 5CVIA 2JT1A 1ZARA 2CYYA 5K5OA 2JUCA 4DW6A 5DYMA 1QPIA 1G3WA 1Z1DA 4M72A 4FE7A 3ZPLA 2FUG2 4NBQA 1P6RA 5L3GA 2BY0A 3GVAA 4G94A 3T5XA 3HOWJ 1ZR2A 3CUQC 2ME0A 1BN5A 4M73A 1LB2A 1TQPA 1D5YA 2R5ZA 5D4RA 4HZFA 1B9NA 3V4GA 2XPVA 1OISA 1QHGA 1KYZA 3RPQA 3TO9A 4D5CA 3V8LA 2CUFA 1GLNA 2EIJH 3U1KA 2WADA 4J01A 4ZDPA 1FMVA 3BQZA 3GTQJ 4HBLA 2L02A 3GF2A 3GLLA 1GUUA 4XK4A 1WHUA 4MQ9F 3EYIA 4R8HA 1YFHA 3BPVA 1P9QC 2EV0A 3HEFA 2E71A 5K7FA 1LUJB 3AG4H 4I0AA 1VI0A 4GO1A 4YELA 4LITA 2PBIA 4A3LJ 3GTJJ 1BI1A 3D5LA 1SFOJ 4IOCF 3JRDA 4UY8I 3WHCA 2FRHA 3TO6A 1A35A 1USSA 2OQRA 1X4PA 3H35A 5BNGA 4KITB 3CQZJ 3K4NA 4AC0A 3BCBA 1S29A 5FFXA 2DXIA 2IVMA 4HV6A 3ECHA 3WTXC 1LVAA 2A6EF 2K9LA 1TNSA 2HTJA 4UV9A 4ZH4F 4GYGA 1XS9A 4PGGA 3HDDA 2BEOA 2LY1A 1G3YA 4KICA 3VSLA 3C18A 1T6SA 2DN0A 2A5YB 4UVBA 2NRAC 1FY7A 1ENHA 3BLYA 1IRGA 2PX9A 3SFIA 3HHGA 4YEJA 1TL8A 4IHYA 3W6JB 3S16J 3ABTA 1QA6A 2BY3A 1SFUA 4EV0A 1T8IA 1B6AA 2R7DA 3I53A 3S8PA 3GFIA 3HGGA 4F52A 4CZZA 2VB6A 2EV6A 2P5VA 1YW9A 4UHTA 1GDTA 2LKSA 4C3HJ 3CF2A 4GYIA 5C4XJ 3EQLF 3F23A 1ZKGA 1U9OA 3C7JA 1JT6A 1XMKA 3B6CA 5ILVA 4XIDA 1FBSA 5HS7A 4LK0F 3WU1B 1KQ8A 2V7FA 3W6VA 4HQEA 1Y6IA 1E3PA 1S6LA 2K9QA 5E8GA 3OYGA 5IP9J 4HLXA 3S93A 2GLOA 4U7BA 5TRDA 5TJJA 1ONVA 3C2HA 3CCRI 4C2TA 2KP6A 1ULYA 3HOXJ 1SMTA 3FDYA 4CGZA 1BR2A 2W48A 1RUOA 3L2CA 5JVGF 1KYWA 1U5TA 3RCOA 1CF7A 2HDCA 3VDXA 2VBYA 4L5JA 3NQOA 1B9MA 2QBYA 2BZTA 5H6QA 1BIBA 1PYVA 1SAXA 5FJ8J 5FRMA 3G1OA 3F22A 4ZDOA 3KPHA 2XRLA 4F3QA 4I02A 2H6CA 5IOYA 3ZGKA 4AWXB 2UZKA 4OMZA 5LHIA 2Y9ZA 2IA0A 4XRSA 4A3GJ 1RNLA 2H27A 2X1EA 3GZ5A 3S14J 2N8GA 1GXQA 3I5UA 3GZ6A 1N78A 1X3UA 3U21A 1O3RA 1W4MA 3SZPA 3L2RA 1A04A 2VOOA 4EMSA 2DYSH 3DXJF 1N77A 2ESHA 3CC7I 2Y69H 3NWSA 4S0HB 2LH9A 3QU3A 4HX7A 4YFKF 2K86A 3WTWC 4RBOA 2P6SA 2QGUA 1BA5A 2CG4A 9ANTA 4PSXA 5J6XA 5FGMA 4W97A 2NXNB 4IRGA 2X6XA 3MN2A 3BWGA 1HKQA 3DPLC 2Z33A 3VFZA 4V19K 1J9IA 5L3CA 1W7PA 4CCNA 2JSPA 1MJAA 4ZC3A 3V42A 5F1JA 1LE8B 4RS8A 2IA1A 3KYDB 3QPHA 3ABMH 3ZQGA 2P4WA 3VWBA 3ABKH 1AKHA 3CD6I 3T8RA 3N97A 3ZMTA 1VQ7I 4D1QA 4OOIA 1MKMA 4G8XA 4A5MA 5HOOA 1DDNA 1G3SA 1E0EA 1NHAA 4GRIA 4XRFA 1HKTA 4RLQA 1FP1D 1D0ZA 1FC3A 2M4KA 1I27A 1RI7A 3PFYA 5CPRB 3TEDA 2QA4I 4RGSA 4PZJA 3CLOA 4KIBA 2DMTA 3SFZA 3BY6A 3TO7A 3BJ6A 5C4JJ 2XSJC 4ESFA 4LG0B 2RREA 2X9DA 3SZGA 2JA8J 5EEGA 4RB0A 2H8WA 3LL7A 2CFXA 3WGGA 1D3YA 2Y30A 5JHFA 2XAFA 3ERMA 5HLTA 5DM7F 3MZYA 5HVQC 2HOEA 2L9RA 5IYCJ 2DDBA 1TW2A 1K4SA 3ZP5A 3FBNB 1Z05A 2CQKA 1ODDA 4K2EA 1IRFA 2K3PA 3FK7A 4AUXA 4BQAA 1VQ6I 2DMNA 2ETHA 2GWRA 4ENNA 4L0ZB 4ENJA 3W2WA 2PFBA 3HPGA 3KP2A 5GPAA 3CCQI 3I9V2 4G6TB 3OR2C 4IRHA 4UUTA 2Z9OA 4EQQA 1TQMA 2ICWG 3QP5A 1VQOI 2V79A 3BG7A 2XPWA 4OIRF 5FKOA 3A4CA 1MMGA 4G6DA 2KFDA 5FD6A 3L2QA 3ROUA 2ZMEB 3AG3H 2COBA 2QQ9A 5FB2A 1QVTA 2G0EA 3CCVI 2LKXA 1UCRA 3TMOA 3ZRGA 2OZUA 1UJ8A 4HPQA 1DU6A 2IW5A 5BQTA 2LKPA 2K27A 2VASA 1W7PD 3FXJA 4XBFA 2E1MC 1UHSA 2H09A 1WRJA 2KPMA 4NHJA 4DJAA 2M4GA 4BXFA 2ME6A 5JI6A 5M3FJ 5DCMB 3HPHA 1JTXA 1MW7A 3H0DA 3K4JA 4BL0B 2V1DA 3EUKL 5HLHA 3ABLH 1WJEA 4G7HF 3G1MA 1BM9A 2ELJA 4UB6C 2LBFA 2RV8A 4HNTA 2L0KA 2Y0SA 4JYKA 2M9HA 5LLQA 2I8DA 3RTRA 2ZXIA 2ZBKA 1IV6A 1LEAA 1LFPA 1IAWA 3GTKJ 1OCRH 1X1BA 2HKOA 2NS0A 2A69F 5BS6A 3J81Z 2VQGA 2VL8A 2PMZN 4I7HA 3G3ZA 2DFFA 3T8TA 3OYCA 2PQ8A 1OYIA 2E7XA 3OYNA 2QYOA 2AHQA 1QNTA 4CYCA 2CH0A 2E19A 2JA6J 2H8RA 1VNDA 3FHZA 4I99C 2QSHX 1IN8A 1LDJA 1MNEA 1JGSA 1T08B 4BUPA 2DMPA 2R93J 2E1OA 2L4MA 4WXDA 2OCCH 2K9MA 5E8IA 1JHFA 2LK2A 1PDNC 2IP2A 3QPSA 5JR3A 4FQGA 4L5IA 1FSEA 1RKTA 4XNFA 3DBHB 1FYKA 5CVVA 1S5LC 4KJZA 3KFWX 4CA0A 3SEQA 2CS3A 3VEPA 1R71A 1RESA 2M87A 4IJAA 1V3FA 2OPTA 2L01A 4L9NA 5L3DA 2Z1DA 2ZMEC 2VOPA 2WB1A 3KE2A 3WG7H 1GV2A 4EVIA 3E3VA 2Q2EB 4XN0A 1A31A 2HPMA 1JUPA 1YHQI 1XMXA 1D1AA 2E7WA 4MQVA 2STWA 5CYVA 4HV5A 2HYFA 3HC7A 1MNDA 1ETQA 4KN4X 2EB7A 4B8XA 3PJRA 4HF0A 1WSUA 5LD2C 4D0PA 2K9NA 2O0YA 3UR3C 2JPCA 5L3FA 2LF8A 2VE9A 3KP5A 2HVSA 1SANA 3K4KA 5F27A 3QYEA 1ETWA 4EATA 4F92B 4XR6A 2OF7A 4CICA 3M3YJ 3H36A 2E2HJ 2YU9J 2V6CA 4HRIA 1U9NA 4A3KJ 2IS1A 3HOTA 1Y0UA 3W6KB 1YS7A 3MKYB 1MD0A 3WTUC 1FOWA 1X1DA 2O8KA 3FXMA 1R4NB 1IRXA 1XC5A 3HKZN 4I6ZA 4ZTFA 1TT5B 2X85A 3I4MJ 4XONA 5JFRA 2QM3A 2DA4A 4JP0A 1QO0D 1F36A 3S2HJ 2LYCA 2EFWA 1BW6A 3HXLA 3TW6A 3BDDA 1OCCH 3O8HA 2E35A 4BQOA 3W2VA 1HKSA 4MNUA 3BROA 3K6GA 3X2QH 1WWXA 2Z2SB 3S1QJ 2NVQJ 1G6NA 2L7MP 1YS6A 1PUFB 3OYIA 2DQLA 2M8EA 2PJRB 3KLNA 1WJFA 1HW1A 2WV0A 3NEUA 2MYSA 2YR2A 3M1EA 3MAJA 1BI2A 1WJAA 3V7RA 2JK3A 5GP9A 1A36A 3S15J 3S32A 2A07F 1MMSA 4PJLA 2E60A 3K4MA 3BCAA 2HEOA 1B8IB 1VQ5I 3OMYA 1T0FA 2AQFA 3Q9SA 2D1VA 4UVCA 2D5VA 2BYVE 4YFXF 1FPQA 3K2AA 2KT0A 3BT9A 3S1RJ 1RIOH 2H1KA 4GCVA 1U6GA 3GZNB 1WI3A 4ESBA 3JRCA 1YIJI 1DQUA 1P92A 3HUGB 3IC7A 3LAJA 1REPC 4BHPA 1Y1WJ 5EJCA 3BR2A 4L9TA 4C3JJ 2KRHA 3GCMA 4HW0A 1ZR4A 2PJPA 3FXQA 2KISA 3EPZA 4AIHA 2XIGA 3H92A 4RGUA 2LD5A 1FYMA 3J81K 1RZ4A 3LSHA 3E97A 2XGXA 5E20A 4WWCA 4CO8A 2NOJB 2R92J 1MSFC 3CO7C 3HB9A 3OY9A 1K7AA 3DPTA 2EILH 1YJWI 2UV1A 3ZN1A 4PJNA
chains in the Genus database with same CATH topology
2QQAA 3LA3A 2M5WA 2XHKA 4ZYDA 4WXCA 4QWQA 2OD5A 1TLHB 2F5DA 2RQPA 2FNAA 3P7NA 1D8KA 4FT8A 3E6MA 3HOSA 4FX4A 4M6YA 2XUBA 3F8BA 1TTYA 1R00A 1KA8A 2VBXA 5DD8A 4R1HA 4CDGA 5ICCA 1Z9CA 1F5TA 2ZNYA 1XMAA 2DFIA 5DUKA 3GUDA 1WI9A 2R7FA 4I98B 4LMYA 4WXHA 3IWFA 4A0ZA 4WF2A 5CVJA 2ZCWA 4U7DA 3FMRA 2MD5A 4Y17A 1ZH5A 3BJAA 2FOKA 4JK1X 2PG4A 5J8CA 2G7UA 5BPIA 3OOPA 1XB4A 2VT2A 2FMLA 1XGNA 3RJPA 1KGSA 4G7ZF 3GXOA 3DKWA 4M6XA 3I58A 4AVPA 5LEJA 3I54A 1I1SA 2IJLA 2MC3A 1S7OA 2GA2A 2HZTA 3E6CC 4LB6B 2UXNA 1FX7A 2B0LA 4HYEA 1HW2A 5F1RA 4B09A 1LQ1A 3RI4A 2DK8A 3TDZC 5D5WB 5H6RA 1UFMA 3PFIA 2P8TA 3RKWA 2XASA 4N0BA 3SXYA 3KP6A 3TKYA 1USTA 3I59A 2VC1A 3F8CA 1TBXA 3WTVC 2FNPA 5D6FA 3DP7A 2NYXA 3I64A 5E1WA 4UXNA 5F64A 4MGRA 5AIQA 2FA5A 1EV7A 1FSHA 3ZMSA 3HSRA 2P7VB 1U3EM 2RC4A 1K78A 1FYLA 4ON0A 3LA2A 3V7SA 4BHCA 1GVJA 1LJ9A 3LSTA 4PGHA 1T38A 2O61A 5AONA 3RYRA 4FX0A 3PQKA 1J2XA 2AS5F 4KYWA 2HQNA 3BOQA 3FMQA 5IT9Z 2ZJ2A 1PUEE 4A5NA 3MZHA 1KQ9A 2YX7A 4A0XA 4YFNF 1Z6TA 2EK5A 1R5HA 3HRMA 3KP4A 2EFPA 3K2ZA 2Z5UA 2MLGA 2ISZA 3CUOA 5K5RA 3HIFA 4ESJA 3H3UA 3WODF 5BMZA 1S8NA 2RDPA 4UVAA 2FMYA 2VODA 5CVUA 1F4KA 2Y75A 1IN7A 2D45A 2C6YA 3JAMZ 1QZYA 4BAYA 3SQNA 3TDUC 2HFHA 4KMUX 4OINF 2QZ8A 3ZN0A 2DLLA 4WK8F 5DV5A 2XRNA 5D4SA 2L4AA 4EJTA 2FQ3A 1WKMA 1O7LA 4IRIA 3K1PA 4ZYHA 3ELKA 2VBWA 5LGUA 2PI0A 2K7LA 3E5XA 4KDPA 4OMYA 2UWMA 3HTSB 1R58A 1ZAOA 2W85A 5FLXZ 5CVRA 3MFKA 2IPQX 5K1YA 2GA1A 3ZMVA 4LLLA 4CYDA 1PP7U 1KU7A 2ESNA 4RGXA 3G73A 1EH7A 1FBUA 4LK1F 1IW7F 2PLYA 3HRTA 2H6BA 3GO5A 1MDMA 4HF1A 5LGTA 1IUYA 1T98A 2G9WA 3KP7A 2RKHA 2MA3A 2FXAA 3EYYA 1MJ9A 5A2QZ 1IZ1A 3R6SA 1TW3A 3HRUA 2Z3YA 3IRRA 2MBFA 1R1UA 2LNBA 2GZWA 3GFLA 4L0YB 2EWNA 1J0RA 4MEXF 1K6OA 2FU4A 1O57A 2VC0A 1YIOA 3RDIA 4G7OF 4TV7A 5HDNA 1YG2A 2KIFA 1FWZA 2DT5A 3JTHA 1HSJA 1ZRCA 3E5QA 1CF7B 3QU6A 3HRSA 2QBYB 1BOAA 1MJBA 2VN2A 5D5XB 2WWYA 2FBHA 2K4JA 2K02A 4MTDA 2W24A 1BI3A 2P6TA 4JQFA 4EGYA 1MGTA 2KIMA 2MLKA 3R0JA 3DV8A 2DTRA 3ZMZA 3JAMK 1FZPB 1XDSA 1SD6A 4HQMA 1YLFA 3GLXA 5D5UB 1H9TA 1XCBA 2A68F 2JRTA 4OIPF 2OQGA 1XSVA 3IWZA 4I09A 4LB5A 2QQBA 2P7CB 2FF4A 2YSRA 1W7PB 4ASNA 4WCGA 3K1MA 5FLXK 3BP8A 5E1XA 1L3LA 5D6EA 2G7HA 1BC7C 3FM5A 3WGHA 2ADUA 3M8EA 4HOBA 4M74A 3WE3A 1YW8A 1W5SA 3D0SA 1P4XA 2LDUA 1IN4A 1D5VA 2CO5A 2XAJA 1KQ0A 4EJOA 4MHGA 3VODA 3RIRA 2XVCA 3FX3A 4G6QA 1XGMA 1I1GA 3RYPA 2FBIA 3WTZA 4G9YA 3U2RA 1BI0A 5A2QK 1F9NA 2EFOA 4OIQF 1SMYF 4XSXF 3J80Z 3P9IA 1U78A 1SFEA 2DW4A 1H9GA 2CGPA 5HS8A 4R79A 1IF1A 1KU2A 1KU3A 1ZYRF 4HF2A 1LNWA 4UUVA 2DU9A 5E18F 3HHHA 2P5LC 2TDXA 4BHBA 5DDGA 3CJNA 3R0AA 5HS9A 1Z6RA 2HQRA 4N9HA 1QGPA 3FWEA 1VTNC 2KKOA 1G4DA 2GXGA 5LRSA 5JVTA 1T39A 1ZRFA 4LD5A 2W84A 2VBZA 4ZYGA 4P9UA 2F5FA 4I0BA 1IXSB 4HDUA 3R61A 4P5OA 2J5OA 2HYGD 2ACJA 1F1ZA 4MEYF 3EDPA 4HX4A 3Q5FA 2JZYA 3QPTA 3CDHA 4ETSA 2DPUA 3FZVA 4M9ZA 2AXLA 1EH6A 2PMHA 3OV8A 5D5VB 2V1UA 3EUHA 2WTEA 4HA8A 3GWZA 5E1ZB 4Y15A 3E6BA 3CUQA 2HKXA 3F6VA 1R36A 4Q48A 3V8JA 1JE8A 2KJBA 3JTGA 4YIFA 1B4AA 3LWFA 3PQJA 1HQCA 1C0WA 3I0TA 5LGNA 2OBPA 2EFQA 4KIGA 3FXUA 3J80K 2D1HA 2K4BA 2UXXA 4YIIA 2V9VA 2XV4S 1I6XA 3IKVA 4ZYEA 3L7WA 4RGRA 2GQQA 2NNYA 4PCQA 5DUIA 2XAGA 3O6BB 4NQWA 1ZGJA 2BGCA 4I2OA 2Q8KA 4DQ2A 1J59A 4RB2C 3O3KA 1B59A 4KMFA 4Z2YA 1R7JA 4EM1A 3QOPA 3V8KA 3F3XA 3J7AO 3QAHA 4YG2F 1W5TA 2GIVA 5LRRA 3CTAA 4IXAA 5FO5A 1YQAA 1SD7A 1HXDA 5LHGA 4CXFA 4E70A 2F2EA 3P9KA 4KUMA 3BPXA 3DEUA 1ZG5A 5KVRA 5ICGA 1SD4A 3GEZA 3F8MA 3WE2A 1IXCA 2VXZA 2WC2A 2JTVA 4H0EA 4A6EA 4XSZF 4RAZA 1R5GA 4BXUA 3LQQA 4AIKA 2BV6A 3H3ZA 4N9IA 3F8FA 2QVOA 4XLNF 5ILSA 1G3TA 4EGZA 1U8RA 2EFNA 4A2UA 4FHTA 4MTEA 2O8XA 4U0WA 2IA2A 2W57A 4F7ZA 1J7KA 3NRVA 4S04A 3FF5A 5KK1A 1K79A 1YYVA 3WTTC 3K1NA 4HDVA 2GAUA 5HLIA 1ON2A 2HWVA 1UB9A 1Z7UA 4JBAA 4BNCA 2CSOA 2DI3A 3Q9VA 5D8LB 2EA2A 3L09A 1UHMA 2O3FA 1DUXC 3ISPA 1P4AA 3WG9A 1XD7A 2F5EA 1UHWA 3FM3A 3E5UA 4GXOA 2ELHA 1E17A 4EM2A 2XAHA 3LQRA 3M9AA 2D2WA 3BJOA 5FFZA 1DPRA 2FSWA 1H0MA 2YU3A 5IT3A 4IPAA 2VONA 2JPBA 3LFKA 2FE3A 3IL2A 1ZRDA 3B02A 3I59B 3SZTA 4Q4ZF 3IHUA 4EJVA 2STTA 2ZXJA 2HS5A 2Y48A 4M9XA 5DCFA 2P5KA 3I4PA 1AOYA 1D8JA 4ZZDA 3BZ6A 3ULQB 2NNNA 1K78B 2QLZA 2XKPA 2EV5A 5ILUA 1TQIA 3TQNA 2DQRA 4UV8A 2RGVA 2EJRA 2X4HA 3T1BA 4P9FA 2QUFA 1IXRC 1CGPA 1ZHFA 3L9FA 3F8NA 1QPMA 3C1DA 6PAXA 2E1NA 3ZMDA 4OIOF 2NAZA 5HDKA 4LG0A 4AIJA 3HSEA 1EH8A 3DQVC 2M1BA 1ZLKA 1OPCA 2EA4A 5DEQA 1KU9A 2X0LA 2QENA 3VOEA 3M8FA 1R1TA 2YX4A 1RUNA 4DNCA 1V4RA 5ICFA 3KZZA 2HTSA 3F72A 1LDKB 2OU2A 2ZMEA 2BBYA 1QZZA 1ZLJA 1GHCA 5J8FA 1WQ2A 3RPUA 5JHUA 5IT9K 2M45A 4O5VA 3U9GA 3K9TA 4P96A 3FXRA 1XCVA 5DCMA 1BIAA 4LGWA 1U5TB 1DP7P 4KNYA 4A0YA 3KETA 3E6DA 2V1XA 3MWMA 1R22A 2FEZA 2M30A 1ZGAA 1Q1HA 1P2FA 2ZFWA 2RN7A 4A12A 3KEQA 1MDMB 2PEXA 3B73A 2E1CA 2COMA 3LA7A 2XAQA 2MH9A 5LBQA 4GGGA 3C3WA 1ZG3A 2GXBA 3TGNA 4BYYA 5L3BA 5F6FA 3RKYA 3WU0A 1OYYA 4KN7X 3T0YA 1JXSA 2R3SA 2VT3A 3SHFA 4PDKA 1YTYA 2O03A 2MH2A 3ML6A 3WGIA 4EJUA 4NB5A 3DF8A 5ICEA 2Q2EA 1HW5A 4O3MA 1T2KA 4IVNA 3HSFA 4CHUA 3I71A 1U2WA 3HTUA 1SFXA 1U5TC 3L00A 1XSDA 3KLOA 4RAYA 3M7GA 3WTYC 1BJAA 2OAZA 1S7AA 4ENKA 1OYWA 1OKRA 3GFJA 3N4MA 3MCZA 2OZ6A 3IKTA 4OU0A 2BE5F 1ON1A 1GXPA 2DBBA 3FMSA 3LAPA 2JSCA 2W25A 1QQIA 4Y13A 3JW4A 4ZZLA 3P9CA 1XGSA 2QWWA 1IN5A 5K5QA 2DO7A 5DD4A 1XSXA 3ECOA 3GYHX 4UNOA 2ZKZA 1AWCA 3HUGA 4IHSA 4IHTA 5D8KB 1FOKA 1LEBA 5HLGA 4EJWA 1R1VA 3DFGA 1HBXG 1DPUA 2Q0OA 1YW7A 2A3SA 1JHHA 3R60A 2XKOA 1O3TA 2ISYA 3EETA 3ZMUA 1L0OC 1E2XA 3R4KA 3KEOA 4KT5C 4O6JA 1J75A 1BBYA 1XN7A 1HSTA 2ZO4A 1YO5C 3F21A 3KZYA 3S2WA 2O6GE 1O3QA 3JSOA 1ZREA 5LHHA 1FT9A 2IRFG 1BC8C 1R23A 5BPDA 1STZA 1LDDA 4HAMA 2A61A 5H20A 4BH9A 4KA4A 3GX4X 2A6HF 5BOXA 3REOA 2RVCA 1ZN2A 5CLSA 5HDGA 2CWEA 3IRQA 5E17F 3V7CA 1B1BA 4HLYA 3MQ0A 5L3EA 3CO6C 5CJ9A 4S05A 2Y0MA 3QP6A 2IT0A 5LEKA 2J5PA 2ZNZA 2LF7A 3RKXA 3WTSC 4KIFA 4LFUA 4L18B 2PMUA 2HGCA 5FD5A 2KRFA 2OA4A 4ENMA 4RB1A 2L3DA 1Z91A 2H94A 2DK5A 3ERED 2DPDA 4M9SA 1OR7A 2PN6A 2YPRA 4U0YA 3VB2A 5EEHA 2LSOA 4HX8A 2Z99A 4P55A 3K69A 2RNJA 4IF4A 4LJZF 2L54A 3TOAA 3O2PE 4EM0B 1I5ZA 1P4WA 1XGOA 1S3JA 1O3SA 2KIUA 2XROA 4LLNA 1FNNA 4A6DA 4Q5SF 3HYIA 3U1DA 1TNTA 1XDUA 3JSPA 3GFMA 1FLIA 1FP2A 3CUQB 3KCCA 2F5CA 1QBJA 4U0VA 1OMIA 3QRFF 3MEXA 2HR3A 1MZBA 5ED4A 4LLGF 4L9JA 1IN6A 4AD9A 1O7FA 3ABUA 1SD5A 2FBKA 1PP8F 5AIPA 3F6OA 3TOBA 3K0LA 5ERIA 3ZQ7A 4RB3C 3COAC 2CW0F 2VE8A 1FBQA 3GW2A 4XLPF 4QLCU 4M71A 3AAFA 4I01A 4KFCA 1ZG1A 2DAOA 1J5YA 3KP3A 2KJCA 4U88A 4L9VA 4Q47A 4WX9A 5CVIA 2JT1A 1ZARA 2CYYA 5K5OA 5DYMA 1G3WA 1Z1DA 4M72A 3ZPLA 5L3GA 1P6RA 3GVAA 4G94A 3T5XA 3CUQC 1BN5A 4M73A 1LB2A 1TQPA 5D4RA 4HZFA 1B9NA 3V4GA 3RPQA 3TO9A 1KYZA 3V8LA 4HBLA 2L02A 3GF2A 3EYIA 4MQ9F 4R8HA 1YFHA 3BPVA 2EV0A 4I0AA 4GO1A 2PBIA 1BI1A 3D5LA 2FRHA 3TO6A 1USSA 2OQRA 1S29A 5FFXA 2IVMA 4HV6A 3ECHA 3WTXC 1LVAA 2A6EF 1TNSA 2HTJA 4UV9A 4ZH4F 4GYGA 4PGGA 2BEOA 1G3YA 4KICA 3C18A 1T6SA 2A5YB 4UVBA 2NRAC 1FY7A 1IRGA 3HHGA 3W6JB 3ABTA 1SFUA 4EV0A 1B6AA 2R7DA 3I53A 3GFIA 4CZZA 2EV6A 2P5VA 1YW9A 4UHTA 4GYIA 3EQLF 3F23A 3C7JA 1XMKA 5ILVA 1FBSA 5HS7A 4LK0F 3WU1B 1KQ8A 4HQEA 1S6LA 5E8GA 4HLXA 4U7BA 5TRDA 5TJJA 1ONVA 1ULYA 1SMTA 4CGZA 1RUOA 3L2CA 1KYWA 1U5TA 1CF7A 2HDCA 2VBYA 4L5JA 3NQOA 1B9MA 2QBYA 5H6QA 1BIBA 1SAXA 3F22A 4I02A 2H6CA 4AWXB 2UZKA 4OMZA 5LHIA 2IA0A 1RNLA 2H27A 3GZ5A 1GXQA 3I5UA 3GZ6A 1X3UA 1O3RA 1W4MA 3SZPA 1A04A 2VOOA 4EMSA 3DXJF 2ESHA 3QU3A 4HX7A 4YFKF 2K86A 3WTWC 2P6SA 2CG4A 5J6XA 5FGMA 4IRGA 3BWGA 1HKQA 3DPLC 2Z33A 3VFZA 1J9IA 5L3CA 1W7PA 1MJAA 4RS8A 2IA1A 3QPHA 2P4WA 3T8RA 3N97A 3ZMTA 4OOIA 1MKMA 4G8XA 4A5MA 5HOOA 1DDNA 1G3SA 1NHAA 4XRFA 1HKTA 1FP1D 1FC3A 1I27A 1RI7A 4RGSA 4PZJA 3CLOA 4KIBA 3SFZA 3BY6A 3TO7A 3BJ6A 4ESFA 4LG0B 5EEGA 4RB0A 2CFXA 3WGGA 1D3YA 2XAFA 3MZYA 5HVQC 2HOEA 1TW2A 3ZP5A 1Z05A 2CQKA 1ODDA 4K2EA 1IRFA 4BQAA 2ETHA 2GWRA 4ENNA 4L0ZB 4ENJA 2PFBA 3KP2A 4IRHA 2Z9OA 4EQQA 1TQMA 3QP5A 2V79A 4OIRF 4G6DA 5FD6A 3ROUA 2ZMEB 2QQ9A 5FB2A 1UCRA 2OZUA 2IW5A 5BQTA 2LKPA 2K27A 1W7PD 4XBFA 2H09A 1WRJA 4NHJA 5JI6A 5DCMB 2V1DA 5HLHA 4G7HF 1BM9A 2RV8A 5LLQA 3RTRA 2ZBKA 1IAWA 1LEAA 2HKOA 2NS0A 2A69F 5BS6A 3J81Z 4I7HA 3G3ZA 3T8TA 2PQ8A 1OYIA 2E7XA 2QYOA 1QNTA 3FHZA 1IN8A 1LDJA 1JGSA 4WXDA 2L4MA 5E8IA 1JHFA 1PDNC 2IP2A 5JR3A 4L5IA 1FSEA 1FYKA 5CVVA 3KFWX 3VEPA 2M87A 4IJAA 1V3FA 4L9NA 2L01A 5L3DA 2VOPA 3KE2A 4EVIA 3E3VA 2E7WA 4MQVA 2STWA 5CYVA 4HV5A 2HYFA 4B8XA 4KN4X 2EB7A 4HF0A 1WSUA 4D0PA 2O0YA 2JPCA 5L3FA 2LF8A 2VE9A 3KP5A 4CICA 2V6CA 3HOTA 1Y0UA 3W6KB 1YS7A 1MD0A 3WTUC 5JFRA 2QM3A 1QO0D 2EFWA 3BDDA 1HKSA 4MNUA 3BROA 1WWXA 1G6NA 1YS6A 2DQLA 2M8EA 3KLNA 2WV0A 1HW1A 3NEUA 2YR2A 3M1EA 3MAJA 1BI2A 3V7RA 2A07F 2HEOA 1T0FA 3Q9SA 2D1VA 4UVCA 2BYVE 4YFXF 1FPQA 1RIOH 4GCVA 1U6GA 4ESBA 1P92A 3IC7A 3LAJA 1REPC 4BHPA 4L9TA 4HW0A 2PJPA 3FXQA 4AIHA 2XIGA 3H92A 4RGUA 1FYMA 3J81K 1RZ4A 3E97A 2XGXA 5E20A 4WWCA 4CO8A 3CO7C 1K7AA 3DPTA 3ZN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQA A;  3LA3 A;  2M5W A;  2XHK A;  4ZYD A;  4WXC A;  4QWQ A;  2OD5 A;  1TLH B;  2F5D A;  2RQP A;  2FNA A;  3P7N A;  1D8K A;  4FT8 A;  3E6M A;  3HOS A;  4FX4 A;  4M6Y A;  2XUB A;  3F8B A;  1TTY A;  1R00 A;  1KA8 A;  2VBX A;  5DD8 A;  4R1H A;  4CDG A;  5ICC A;  1Z9C A;  1F5T A;  2ZNY A;  1XMA A;  2DFI A;  5DUK A;  3GUD A;  1WI9 A;  2R7F A;  4I98 B;  4LMY A;  4WXH A;  3IWF A;  4A0Z A;  4WF2 A;  5CVJ A;  2ZCW A;  4U7D A;  3FMR A;  2MD5 A;  4Y17 A;  1ZH5 A;  3BJA A;  2FOK A;  4JK1 X;  2PG4 A;  5J8C A;  2G7U A;  5BPI A;  3OOP A;  1XB4 A;  2VT2 A;  2FML A;  1XGN A;  3RJP A;  1KGS A;  4G7Z F;  3GXO A;  3DKW A;  4M6X A;  3I58 A;  4AVP A;  5LEJ A;  3I54 A;  1I1S A;  2IJL A;  2MC3 A;  1S7O A;  2GA2 A;  2HZT A;  3E6C C;  4LB6 B;  2UXN A;  1FX7 A;  2B0L A;  4HYE A;  1HW2 A;  5F1R A;  4B09 A;  1LQ1 A;  3RI4 A;  2DK8 A;  3TDZ C;  5D5W B;  5H6R A;  1UFM A;  3PFI A;  2P8T A;  3RKW A;  2XAS A;  4N0B A;  3SXY A;  3KP6 A;  3TKY A;  1UST A;  3I59 A;  2VC1 A;  3F8C A;  1TBX A;  3WTV C;  2FNP A;  5D6F A;  3DP7 A;  2NYX A;  3I64 A;  5E1W A;  4UXN A;  5F64 A;  4MGR A;  5AIQ A;  2FA5 A;  1EV7 A;  1FSH A;  3ZMS A;  3HSR A;  2P7V B;  1U3E M;  2RC4 A;  1K78 A;  1FYL A;  4ON0 A;  3LA2 A;  3V7S A;  4BHC A;  1GVJ A;  1LJ9 A;  3LST A;  4PGH A;  1T38 A;  2O61 A;  5AON A;  3RYR A;  4FX0 A;  3PQK A;  1J2X A;  2AS5 F;  4KYW A;  2HQN A;  3BOQ A;  3FMQ A;  5IT9 Z;  2ZJ2 A;  1PUE E;  4A5N A;  3MZH A;  1KQ9 A;  2YX7 A;  4A0X A;  4YFN F;  1Z6T A;  2EK5 A;  1R5H A;  3HRM A;  3KP4 A;  2EFP A;  3K2Z A;  2Z5U A;  2MLG A;  2ISZ A;  3CUO A;  5K5R A;  3HIF A;  4ESJ A;  3H3U A;  3WOD F;  5BMZ A;  1S8N A;  2RDP A;  4UVA A;  2FMY A;  2VOD A;  5CVU A;  1F4K A;  2Y75 A;  1IN7 A;  2D45 A;  2C6Y A;  3JAM Z;  1QZY A;  4BAY A;  3SQN A;  3TDU C;  2HFH A;  4KMU X;  4OIN F;  2QZ8 A;  3ZN0 A;  2DLL A;  4WK8 F;  5DV5 A;  2XRN A;  5D4S A;  2L4A A;  4EJT A;  2FQ3 A;  1WKM A;  1O7L A;  4IRI A;  3K1P A;  4ZYH A;  3ELK A;  2VBW A;  5LGU A;  2PI0 A;  2K7L A;  3E5X A;  4KDP A;  4OMY A;  2UWM A;  3HTS B;  1R58 A;  1ZAO A;  2W85 A;  5FLX Z;  5CVR A;  3MFK A;  2IPQ X;  5K1Y A;  2GA1 A;  3ZMV A;  4LLL A;  4CYD A;  1PP7 U;  1KU7 A;  2ESN A;  4RGX A;  3G73 A;  1EH7 A;  1FBU A;  4LK1 F;  1IW7 F;  2PLY A;  3HRT A;  2H6B A;  3GO5 A;  1MDM A;  4HF1 A;  5LGT A;  1IUY A;  1T98 A;  2G9W A;  3KP7 A;  2RKH A;  2MA3 A;  2FXA A;  3EYY A;  1MJ9 A;  5A2Q Z;  1IZ1 A;  3R6S A;  1TW3 A;  3HRU A;  2Z3Y A;  3IRR A;  2MBF A;  1R1U A;  2LNB A;  2GZW A;  3GFL A;  4L0Y B;  2EWN A;  1J0R A;  4MEX F;  1K6O A;  2FU4 A;  1O57 A;  2VC0 A;  1YIO A;  3RDI A;  4G7O F;  4TV7 A;  5HDN A;  1YG2 A;  2KIF A;  1FWZ A;  2DT5 A;  3JTH A;  1HSJ A;  1ZRC A;  3E5Q A;  1CF7 B;  3QU6 A;  3HRS A;  2QBY B;  1BOA A;  1MJB A;  2VN2 A;  5D5X B;  2WWY A;  2FBH A;  2K4J A;  2K02 A;  4MTD A;  2W24 A;  1BI3 A;  2P6T A;  4JQF A;  4EGY A;  1MGT A;  2KIM A;  2MLK A;  3R0J A;  3DV8 A;  2DTR A;  3ZMZ A;  3JAM K;  1FZP B;  1XDS A;  1SD6 A;  4HQM A;  1YLF A;  3GLX A;  5D5U B;  1H9T A;  1XCB A;  2A68 F;  2JRT A;  4OIP F;  2OQG A;  1XSV A;  3IWZ A;  4I09 A;  4LB5 A;  2QQB A;  2P7C B;  2FF4 A;  2YSR A;  1W7P B;  4ASN A;  4WCG A;  3K1M A;  5FLX K;  3BP8 A;  5E1X A;  1L3L A;  5D6E A;  2G7H A;  1BC7 C;  3FM5 A;  3WGH A;  2ADU A;  3M8E A;  4HOB A;  4M74 A;  3WE3 A;  1YW8 A;  1W5S A;  3D0S A;  1P4X A;  2LDU A;  1IN4 A;  1D5V A;  2CO5 A;  2XAJ A;  1KQ0 A;  4EJO A;  4MHG A;  3VOD A;  3RIR A;  2XVC A;  3FX3 A;  4G6Q A;  1XGM A;  1I1G A;  3RYP A;  2FBI A;  3WTZ A;  4G9Y A;  3U2R A;  1BI0 A;  5A2Q K;  1F9N A;  2EFO A;  4OIQ F;  1SMY F;  4XSX F;  3J80 Z;  3P9I A;  1U78 A;  1SFE A;  2DW4 A;  1H9G A;  2CGP A;  5HS8 A;  4R79 A;  1IF1 A;  1KU2 A;  1KU3 A;  1ZYR F;  4HF2 A;  1LNW A;  4UUV A;  2DU9 A;  5E18 F;  3HHH A;  2P5L C;  2TDX A;  4BHB A;  5DDG A;  3CJN A;  3R0A A;  5HS9 A;  1Z6R A;  2HQR A;  4N9H A;  1QGP A;  3FWE A;  1VTN C;  2KKO A;  1G4D A;  2GXG A;  5LRS A;  5JVT A;  1T39 A;  1ZRF A;  4LD5 A;  2W84 A;  2VBZ A;  4ZYG A;  4P9U A;  2F5F A;  4I0B A;  1IXS B;  4HDU A;  3R61 A;  4P5O A;  2J5O A;  2HYG D;  2ACJ A;  1F1Z A;  4MEY F;  3EDP A;  4HX4 A;  3Q5F A;  2JZY A;  3QPT A;  3CDH A;  4ETS A;  2DPU A;  3FZV A;  4M9Z A;  2AXL A;  1EH6 A;  2PMH A;  3OV8 A;  5D5V B;  2V1U A;  3EUH A;  2WTE A;  4HA8 A;  3GWZ A;  5E1Z B;  4Y15 A;  3E6B A;  3CUQ A;  2HKX A;  3F6V A;  1R36 A;  4Q48 A;  3V8J A;  1JE8 A;  2KJB A;  3JTG A;  4YIF A;  1B4A A;  3LWF A;  3PQJ A;  1HQC A;  1C0W A;  3I0T A;  5LGN A;  2OBP A;  2EFQ A;  4KIG A;  3FXU A;  3J80 K;  2D1H A;  2K4B A;  2UXX A;  4YII A;  2V9V A;  2XV4 S;  1I6X A;  3IKV A;  4ZYE A;  3L7W A;  4RGR A;  2GQQ A;  2NNY A;  4PCQ A;  5DUI A;  2XAG A;  3O6B B;  4NQW A;  1ZGJ A;  2BGC A;  4I2O A;  2Q8K A;  4DQ2 A;  1J59 A;  4RB2 C;  3O3K A;  1B59 A;  4KMF A;  4Z2Y A;  1R7J A;  4EM1 A;  3QOP A;  3V8K A;  3F3X A;  3J7A O;  3QAH A;  4YG2 F;  1W5T A;  2GIV A;  5LRR A;  3CTA A;  4IXA A;  5FO5 A;  1YQA A;  1SD7 A;  1HXD A;  5LHG A;  4CXF A;  4E70 A;  2F2E A;  3P9K A;  4KUM A;  3BPX A;  3DEU A;  1ZG5 A;  5KVR A;  5ICG A;  1SD4 A;  3GEZ A;  3F8M A;  3WE2 A;  1IXC A;  2VXZ A;  2WC2 A;  2JTV A;  4H0E A;  4A6E A;  4XSZ F;  4RAZ A;  1R5G A;  4BXU A;  3LQQ A;  4AIK A;  2BV6 A;  3H3Z A;  4N9I A;  3F8F A;  2QVO A;  4XLN F;  5ILS A;  1G3T A;  4EGZ A;  1U8R A;  2EFN A;  4A2U A;  4FHT A;  4MTE A;  2O8X A;  4U0W A;  2IA2 A;  2W57 A;  4F7Z A;  1J7K A;  3NRV A;  4S04 A;  3FF5 A;  5KK1 A;  1K79 A;  1YYV A;  3WTT C;  3K1N A;  4HDV A;  2GAU A;  5HLI A;  1ON2 A;  2HWV A;  1UB9 A;  1Z7U A;  4JBA A;  4BNC A;  2CSO A;  2DI3 A;  3Q9V A;  5D8L B;  2EA2 A;  3L09 A;  1UHM A;  2O3F A;  1DUX C;  3ISP A;  1P4A A;  3WG9 A;  1XD7 A;  2F5E A;  1UHW A;  3FM3 A;  3E5U A;  4GXO A;  2ELH A;  1E17 A;  4EM2 A;  2XAH A;  3LQR A;  3M9A A;  2D2W A;  3BJO A;  5FFZ A;  1DPR A;  2FSW A;  1H0M A;  2YU3 A;  5IT3 A;  4IPA A;  2VON A;  2JPB A;  3LFK A;  2FE3 A;  3IL2 A;  1ZRD A;  3B02 A;  3I59 B;  3SZT A;  4Q4Z F;  3IHU A;  4EJV A;  2STT A;  2ZXJ A;  2HS5 A;  2Y48 A;  4M9X A;  5DCF A;  2P5K A;  3I4P A;  1AOY A;  1D8J A;  4ZZD A;  3BZ6 A;  3ULQ B;  2NNN A;  1K78 B;  2QLZ A;  2XKP A;  2EV5 A;  5ILU A;  1TQI A;  3TQN A;  2DQR A;  4UV8 A;  2RGV A;  2EJR A;  2X4H A;  3T1B A;  4P9F A;  2QUF A;  1IXR C;  1CGP A;  1ZHF A;  3L9F A;  3F8N A;  1QPM A;  3C1D A;  6PAX A;  2E1N A;  3ZMD A;  4OIO F;  2NAZ A;  5HDK A;  4LG0 A;  4AIJ A;  3HSE A;  1EH8 A;  3DQV C;  2M1B A;  1ZLK A;  1OPC A;  2EA4 A;  5DEQ A;  1KU9 A;  2X0L A;  2QEN A;  3VOE A;  3M8F A;  1R1T A;  2YX4 A;  1RUN A;  4DNC A;  1V4R A;  5ICF A;  3KZZ A;  2HTS A;  3F72 A;  1LDK B;  2OU2 A;  2ZME A;  2BBY A;  1QZZ A;  1ZLJ A;  1GHC A;  5J8F A;  1WQ2 A;  3RPU A;  5JHU A;  5IT9 K;  2M45 A;  4O5V A;  3U9G A;  3K9T A;  4P96 A;  3FXR A;  1XCV A;  5DCM A;  1BIA A;  4LGW A;  1U5T B;  1DP7 P;  4KNY A;  4A0Y A;  3KET A;  3E6D A;  2V1X A;  3MWM A;  1R22 A;  2FEZ A;  2M30 A;  1ZGA A;  1Q1H A;  1P2F A;  2ZFW A;  2RN7 A;  4A12 A;  3KEQ A;  1MDM B;  2PEX A;  3B73 A;  2E1C A;  2COM A;  3LA7 A;  2XAQ A;  2MH9 A;  5LBQ A;  4GGG A;  3C3W A;  1ZG3 A;  2GXB A;  3TGN A;  4BYY A;  5L3B A;  5F6F A;  3RKY A;  3WU0 A;  1OYY A;  4KN7 X;  3T0Y A;  1JXS A;  2R3S A;  2VT3 A;  3SHF A;  4PDK A;  1YTY A;  2O03 A;  2MH2 A;  3ML6 A;  3WGI A;  4EJU A;  4NB5 A;  3DF8 A;  5ICE A;  2Q2E A;  1HW5 A;  4O3M A;  1T2K A;  4IVN A;  3HSF A;  4CHU A;  3I71 A;  1U2W A;  3HTU A;  1SFX A;  1U5T C;  3L00 A;  1XSD A;  3KLO A;  4RAY A;  3M7G A;  3WTY C;  1BJA A;  2OAZ A;  1S7A A;  4ENK A;  1OYW A;  1OKR A;  3GFJ A;  3N4M A;  3MCZ A;  2OZ6 A;  3IKT A;  4OU0 A;  2BE5 F;  1ON1 A;  1GXP A;  2DBB A;  3FMS A;  3LAP A;  2JSC A;  2W25 A;  1QQI A;  4Y13 A;  3JW4 A;  4ZZL A;  3P9C A;  1XGS A;  2QWW A;  1IN5 A;  5K5Q A;  2DO7 A;  5DD4 A;  1XSX A;  3ECO A;  3GYH X;  4UNO A;  2ZKZ A;  1AWC A;  3HUG A;  4IHS A;  4IHT A;  5D8K B;  1FOK A;  1LEB A;  5HLG A;  4EJW A;  1R1V A;  3DFG A;  1HBX G;  1DPU A;  2Q0O A;  1YW7 A;  2A3S A;  1JHH A;  3R60 A;  2XKO A;  1O3T A;  2ISY A;  3EET A;  3ZMU A;  1L0O C;  1E2X A;  3R4K A;  3KEO A;  4KT5 C;  4O6J A;  1J75 A;  1BBY A;  1XN7 A;  1HST A;  2ZO4 A;  1YO5 C;  3F21 A;  3KZY A;  3S2W A;  2O6G E;  1O3Q A;  3JSO A;  1ZRE A;  5LHH A;  1FT9 A;  2IRF G;  1BC8 C;  1R23 A;  5BPD A;  1STZ A;  1LDD A;  4HAM A;  2A61 A;  5H20 A;  4BH9 A;  4KA4 A;  3GX4 X;  2A6H F;  5BOX A;  3REO A;  2RVC A;  1ZN2 A;  5CLS A;  5HDG A;  2CWE A;  3IRQ A;  5E17 F;  3V7C A;  1B1B A;  4HLY A;  3MQ0 A;  5L3E A;  3CO6 C;  5CJ9 A;  4S05 A;  2Y0M A;  3QP6 A;  2IT0 A;  5LEK A;  2J5P A;  2ZNZ A;  2LF7 A;  3RKX A;  3WTS C;  4KIF A;  4LFU A;  4L18 B;  2PMU A;  2HGC A;  5FD5 A;  2KRF A;  2OA4 A;  4ENM A;  4RB1 A;  2L3D A;  1Z91 A;  2H94 A;  2DK5 A;  3ERE D;  2DPD A;  4M9S A;  1OR7 A;  2PN6 A;  2YPR A;  4U0Y A;  3VB2 A;  5EEH A;  2LSO A;  4HX8 A;  2Z99 A;  4P55 A;  3K69 A;  2RNJ A;  4IF4 A;  4LJZ F;  2L54 A;  3TOA A;  3O2P E;  4EM0 B;  1I5Z A;  1P4W A;  1XGO A;  1S3J A;  1O3S A;  2KIU A;  2XRO A;  4LLN A;  1FNN A;  4A6D A;  4Q5S F;  3HYI A;  3U1D A;  1TNT A;  1XDU A;  3JSP A;  3GFM A;  1FLI A;  1FP2 A;  3CUQ B;  3KCC A;  2F5C A;  1QBJ A;  4U0V A;  1OMI A;  3QRF F;  3MEX A;  2HR3 A;  1MZB A;  5ED4 A;  4LLG F;  4L9J A;  1IN6 A;  4AD9 A;  1O7F A;  3ABU A;  1SD5 A;  2FBK A;  1PP8 F;  5AIP A;  3F6O A;  3TOB A;  3K0L A;  5ERI A;  3ZQ7 A;  4RB3 C;  3COA C;  2CW0 F;  2VE8 A;  1FBQ A;  3GW2 A;  4XLP F;  4QLC U;  4M71 A;  3AAF A;  4I01 A;  4KFC A;  1ZG1 A;  2DAO A;  1J5Y A;  3KP3 A;  2KJC A;  4U88 A;  4L9V A;  4Q47 A;  4WX9 A;  5CVI A;  2JT1 A;  1ZAR A;  2CYY A;  5K5O A;  5DYM A;  1G3W A;  1Z1D A;  4M72 A;  3ZPL A;  5L3G A;  1P6R A;  3GVA A;  4G94 A;  3T5X A;  3CUQ C;  1BN5 A;  4M73 A;  1LB2 A;  1TQP A;  5D4R A;  4HZF A;  1B9N A;  3V4G A;  3RPQ A;  3TO9 A;  1KYZ A;  3V8L A;  4HBL A;  2L02 A;  3GF2 A;  3EYI A;  4MQ9 F;  4R8H A;  1YFH A;  3BPV A;  2EV0 A;  4I0A A;  4GO1 A;  2PBI A;  1BI1 A;  3D5L A;  2FRH A;  3TO6 A;  1USS A;  2OQR A;  1S29 A;  5FFX A;  2IVM A;  4HV6 A;  3ECH A;  3WTX C;  1LVA A;  2A6E F;  1TNS A;  2HTJ A;  4UV9 A;  4ZH4 F;  4GYG A;  4PGG A;  2BEO A;  1G3Y A;  4KIC A;  3C18 A;  1T6S A;  2A5Y B;  4UVB A;  2NRA C;  1FY7 A;  1IRG A;  3HHG A;  3W6J B;  3ABT A;  1SFU A;  4EV0 A;  1B6A A;  2R7D A;  3I53 A;  3GFI A;  4CZZ A;  2EV6 A;  2P5V A;  1YW9 A;  4UHT A;  4GYI A;  3EQL F;  3F23 A;  3C7J A;  1XMK A;  5ILV A;  1FBS A;  5HS7 A;  4LK0 F;  3WU1 B;  1KQ8 A;  4HQE A;  1S6L A;  5E8G A;  4HLX A;  4U7B A;  5TRD A;  5TJJ A;  1ONV A;  1ULY A;  1SMT A;  4CGZ A;  1RUO A;  3L2C A;  1KYW A;  1U5T A;  1CF7 A;  2HDC A;  2VBY A;  4L5J A;  3NQO A;  1B9M A;  2QBY A;  5H6Q A;  1BIB A;  1SAX A;  3F22 A;  4I02 A;  2H6C A;  4AWX B;  2UZK A;  4OMZ A;  5LHI A;  2IA0 A;  1RNL A;  2H27 A;  3GZ5 A;  1GXQ A;  3I5U A;  3GZ6 A;  1X3U A;  1O3R A;  1W4M A;  3SZP A;  1A04 A;  2VOO A;  4EMS A;  3DXJ F;  2ESH A;  3QU3 A;  4HX7 A;  4YFK F;  2K86 A;  3WTW C;  2P6S A;  2CG4 A;  5J6X A;  5FGM A;  4IRG A;  3BWG A;  1HKQ A;  3DPL C;  2Z33 A;  3VFZ A;  1J9I A;  5L3C A;  1W7P A;  1MJA A;  4RS8 A;  2IA1 A;  3QPH A;  2P4W A;  3T8R A;  3N97 A;  3ZMT A;  4OOI A;  1MKM A;  4G8X A;  4A5M A;  5HOO A;  1DDN A;  1G3S A;  1NHA A;  4XRF A;  1HKT A;  1FP1 D;  1FC3 A;  1I27 A;  1RI7 A;  4RGS A;  4PZJ A;  3CLO A;  4KIB A;  3SFZ A;  3BY6 A;  3TO7 A;  3BJ6 A;  4ESF A;  4LG0 B;  5EEG A;  4RB0 A;  2CFX A;  3WGG A;  1D3Y A;  2XAF A;  3MZY A;  5HVQ C;  2HOE A;  1TW2 A;  3ZP5 A;  1Z05 A;  2CQK A;  1ODD A;  4K2E A;  1IRF A;  4BQA A;  2ETH A;  2GWR A;  4ENN A;  4L0Z B;  4ENJ A;  2PFB A;  3KP2 A;  4IRH A;  2Z9O A;  4EQQ A;  1TQM A;  3QP5 A;  2V79 A;  4OIR F;  4G6D A;  5FD6 A;  3ROU A;  2ZME B;  2QQ9 A;  5FB2 A;  1UCR A;  2OZU A;  2IW5 A;  5BQT A;  2LKP A;  2K27 A;  1W7P D;  4XBF A;  2H09 A;  1WRJ A;  4NHJ A;  5JI6 A;  5DCM B;  2V1D A;  5HLH A;  4G7H F;  1BM9 A;  2RV8 A;  5LLQ A;  3RTR A;  2ZBK A;  1IAW A;  1LEA A;  2HKO A;  2NS0 A;  2A69 F;  5BS6 A;  3J81 Z;  4I7H A;  3G3Z A;  3T8T A;  2PQ8 A;  1OYI A;  2E7X A;  2QYO A;  1QNT A;  3FHZ A;  1IN8 A;  1LDJ A;  1JGS A;  4WXD A;  2L4M A;  5E8I A;  1JHF A;  1PDN C;  2IP2 A;  5JR3 A;  4L5I A;  1FSE A;  1FYK A;  5CVV A;  3KFW X;  3VEP A;  2M87 A;  4IJA A;  1V3F A;  4L9N A;  2L01 A;  5L3D A;  2VOP A;  3KE2 A;  4EVI A;  3E3V A;  2E7W A;  4MQV A;  2STW A;  5CYV A;  4HV5 A;  2HYF A;  4B8X A;  4KN4 X;  2EB7 A;  4HF0 A;  1WSU A;  4D0P A;  2O0Y A;  2JPC A;  5L3F A;  2LF8 A;  2VE9 A;  3KP5 A;  4CIC A;  2V6C A;  3HOT A;  1Y0U A;  3W6K B;  1YS7 A;  1MD0 A;  3WTU C;  5JFR A;  2QM3 A;  1QO0 D;  2EFW A;  3BDD A;  1HKS A;  4MNU A;  3BRO A;  1WWX A;  1G6N A;  1YS6 A;  2DQL A;  2M8E A;  3KLN A;  2WV0 A;  1HW1 A;  3NEU A;  2YR2 A;  3M1E A;  3MAJ A;  1BI2 A;  3V7R A;  2A07 F;  2HEO A;  1T0F A;  3Q9S A;  2D1V A;  4UVC A;  2BYV E;  4YFX F;  1FPQ A;  1RIO H;  4GCV A;  1U6G A;  4ESB A;  1P92 A;  3IC7 A;  3LAJ A;  1REP C;  4BHP A;  4L9T A;  4HW0 A;  2PJP A;  3FXQ A;  4AIH A;  2XIG A;  3H92 A;  4RGU A;  1FYM A;  3J81 K;  1RZ4 A;  3E97 A;  2XGX A;  5E20 A;  4WWC A;  4CO8 A;  3CO7 C;  1K7A A;  3DPT A;  3ZN1 A; 
#chains in the Genus database with same CATH topology
 3PM1 A;  2QQA A;  4BBR J;  1LFB A;  3LA3 A;  2M5W A;  4G12 A;  3ASN H;  2XHK A;  4ZYD A;  4WXC A;  4QWQ A;  2OD5 A;  3OL4 A;  4NC8 A;  1TLH B;  1A5J A;  2F5D A;  2RQP A;  3VPR A;  2FNA A;  3P7N A;  4ZDL A;  1BW5 A;  3H9J A;  4Y7N J;  3CCU I;  1D8K A;  4FT8 A;  5M3M J;  1E3H A;  3E6M A;  2CRG A;  5IP7 J;  3HOS A;  4FX4 A;  4M6Y A;  1S72 I;  2XUB A;  3F8B A;  1TTY A;  1R00 A;  1KA8 A;  2VBX A;  3NWT A;  4N4N B;  5DD8 A;  4ZTJ A;  1R6R A;  4R1H A;  4CDG A;  5ICC A;  5JLX A;  1Z9C A;  1F5T A;  2K3F A;  1XMA A;  2ZNY A;  1VQN I;  5DS9 A;  3FBI B;  2DFI A;  1NG7 A;  2DOD A;  5DUK A;  1VQM I;  3GUD A;  3K4L A;  2NS7 A;  2DOA A;  5GPC A;  1WI9 A;  2R7F A;  3HZJ A;  4I98 B;  4LMY A;  2VKD A;  2E2I J;  2DFH A;  4WXH A;  3BQY A;  3IWF A;  3QYB A;  4A0Z A;  1E3O C;  4WF2 A;  5CVJ A;  4XRM A;  2ZCW A;  2L7Z A;  3FMR A;  4U7D A;  2MD5 A;  5M5W J;  3PO2 J;  3GME A;  3HL2 A;  1TC3 C;  5IYD J;  1OJL A;  4Y17 A;  1U0J A;  2M2E A;  2QQ8 A;  3DTE A;  1ZH5 A;  3BJA A;  2FOK A;  3PIP F;  3BR6 A;  4JK1 X;  3J7A Y;  2PG4 A;  5K7H A;  1H8A C;  5J8C A;  2G7U A;  3QOD A;  3J7Y J;  3OOP A;  5BPI A;  1XB4 A;  2VT2 A;  2FML A;  3KYL A;  1XGN A;  3RJP A;  2ID6 A;  1KGS A;  5GAH J;  1WH7 A;  5EF6 A;  4G7Z F;  3GXO A;  3DKW A;  4M6X A;  3I58 A;  4AVP A;  3I56 I;  2AO9 A;  5LEJ A;  2VJI A;  3I54 A;  4MFE A;  4XLF A;  4IEJ A;  1I1S A;  2IJL A;  3KX2 A;  2MC3 A;  1S7O A;  1OCZ H;  3LNQ A;  1ERD A;  2XGE A;  4LIV A;  1W36 C;  2UUZ A;  2ZJR F;  3L2U A;  2GA2 A;  2HZT A;  3E6C C;  2JVH A;  4LB6 B;  3H3V K;  1ZK8 A;  3LSG A;  2L9V A;  1RR8 C;  2UXN A;  4DYR A;  1FX7 A;  2B0L A;  1Z77 A;  4HYE A;  1HW2 A;  4PUS A;  5F1R A;  4B09 A;  1LQ1 A;  1WJC A;  1MBG A;  3RI4 A;  2DK8 A;  4NQW B;  2BY1 A;  4RLF A;  1FIP A;  2HNH A;  3TDZ C;  5D5W B;  5H6R A;  2JMW A;  4MO7 A;  1UFM A;  3PFI A;  2P8T A;  3RKW A;  1B72 B;  2I5U A;  2XAS A;  4N0B A;  3SXY A;  3KP6 A;  3DEE A;  4X0G A;  3EUH C;  3TKY A;  1SFK A;  4A3M J;  1UST A;  3JRA A;  3I59 A;  2GBY A;  2VC1 A;  3F8C A;  2CV1 A;  1TBX A;  3WTV C;  2FNP A;  4E7L A;  5D6F A;  1WH5 A;  2X1D A;  3DP7 A;  2NYX A;  3I64 A;  5E1W A;  4C9Y A;  3OIO A;  2VPR A;  1WPK A;  3PNY A;  4UXN A;  5F64 A;  2EIK H;  4MGR A;  4XL9 A;  5AIQ A;  2CUZ A;  3PO3 J;  2FA5 A;  3CMA I;  1EV7 A;  1JUM A;  1FSH A;  3ZMS A;  2O7O A;  3HSR A;  2HOT A;  2P7V B;  5FKM A;  1U3E M;  5EGO A;  4MLO A;  3LSP A;  2RC4 A;  3WHB A;  1K78 A;  4XLH A;  1T95 A;  1FYL A;  4ON0 A;  3LA2 A;  2LY9 A;  3V7S A;  1ZEL A;  2EPF A;  1I3Q J;  3JR9 A;  4BHC A;  1GVJ A;  1LJ9 A;  3LST A;  2Y0S N;  4PGH A;  1APL C;  3KZI C;  1T38 A;  5IP6 A;  3QYF A;  1O4X A;  1YIT I;  2O61 A;  4A3J J;  3ZQQ A;  5AON A;  4F93 B;  3RYR A;  4FX0 A;  2VQH A;  2RNG A;  3PQK A;  3C2G A;  5M5Y J;  2Y9Y A;  1MBJ A;  3G4S I;  1J2X A;  4CCL A;  2LRE A;  2AS5 F;  4KYW A;  3SJM A;  2EIN H;  2HQN A;  3BOQ A;  1OR7 C;  3FMQ A;  5IYB J;  3DLL F;  2R7W A;  2HZD A;  1VQ4 I;  1MBK A;  2YUS A;  2ZJ2 A;  1PUE E;  4A5N A;  3MZH A;  1KQ9 A;  2LLK A;  2YX7 A;  4A0X A;  2ZFU A;  4YFN F;  1VZ0 A;  4CUG A;  1Z6T A;  2EK5 A;  2DMU A;  1R5H A;  1SVL A;  4HG2 A;  3HRM A;  3KP4 A;  2EFP A;  5TGT A;  3K2Z A;  2QSG X;  2Z5U A;  2MLG A;  2ISZ A;  1JT0 A;  2LC2 A;  2M7A A;  5CQG A;  3CUO A;  5K5R A;  2ZJQ F;  3HIF A;  4ESJ A;  3H3U A;  5J1Y A;  3WOD F;  5BMZ A;  3LMM A;  1S8N A;  4B44 A;  2RDP A;  4UVA A;  5HOD A;  2BW3 B;  2FMY A;  2R0Q C;  3NAR A;  2VOD A;  3BTC A;  4D7M A;  1OFC X;  3A2K A;  5CVU A;  4LOC A;  1N25 A;  2WB1 N;  2Y75 A;  1IN7 A;  1F4K A;  1RET A;  2D45 A;  5EG0 A;  4E6K G;  4MFD A;  1WJB A;  2EIM H;  2C6Y A;  1XG1 A;  3JAM Z;  1QZY A;  4BAY A;  3CMY A;  3SQN A;  2HDW A;  1K6Y A;  2HFH A;  3TDU C;  4KMU X;  3CJT B;  4OIN F;  4XLA A;  4DGW B;  2QZ8 A;  3ZN0 A;  2B9S A;  2XPU A;  2DLL A;  2IGM A;  2F4I A;  4F91 B;  3VYS B;  2XB5 A;  4WK8 F;  5DV5 A;  3S1N J;  3QWL A;  2XRN A;  2ZXW H;  5D4S A;  2L4A A;  2R5Z B;  4EJT A;  2FQ3 A;  2L7K A;  1JKO C;  1WKM A;  1O7L A;  2AQE A;  4IRI A;  3K1P A;  4XKW A;  4ZYH A;  1U8B A;  3ELK A;  2VBW A;  5LGU A;  1I6H J;  2PI0 A;  2K7L A;  2X1C A;  4DYC A;  3E5X A;  4KDP A;  4OMY A;  2B63 J;  2UWM A;  3BG3 A;  2R7Z J;  1GVD A;  3HTS B;  3GTO J;  4J19 A;  1R58 A;  1ZAO A;  4LG3 A;  3H5N A;  2W85 A;  2WY8 Q;  5FLX Z;  5CVR A;  4DZP A;  2IPQ X;  5K1Y A;  3MFK A;  2LY2 A;  2GA1 A;  2HVQ A;  4LLL A;  3ZMV A;  4CYD A;  2OJE D;  1PP7 U;  1KU7 A;  2ESN A;  4RGX A;  3G73 A;  1EH7 A;  1FBU A;  1P7I A;  4LK1 F;  4RM3 A;  1IW7 F;  2L2O A;  2YS9 A;  2PLY A;  1YRN B;  3HRT A;  2H6B A;  3GO5 A;  1MDM A;  1MMA A;  2BVM A;  1ETV A;  2HI3 A;  5LGT A;  4HF1 A;  1IUY A;  2OTJ I;  3NAU A;  2NVU B;  3FKJ A;  2KQR A;  4E7K A;  1T98 A;  2MGQ A;  1FTT A;  2CQQ A;  4DBQ A;  3Q0V A;  2G9W A;  3KP7 A;  2RKH A;  2W82 A;  5KAF C;  3UKG A;  2EZI A;  5E3O A;  2IS4 A;  2MA3 A;  2FXA A;  3EYY A;  3ZXS A;  1MJ9 A;  5A2Q Z;  2DA1 A;  4FAS D;  1IZ1 A;  1EKE A;  4RMN A;  2P0W A;  4FCY A;  5FLV A;  2OC6 A;  3VYT B;  4Z6Y A;  4XQF A;  3R6S A;  3OYK A;  5F08 A;  3CP2 A;  5H2F C;  4UUS A;  1TW3 A;  3VYR B;  3HRU A;  5DTD A;  3CZ6 A;  2Z3Y A;  3IRR A;  2MBF A;  1WJD A;  4HNU A;  3I4N J;  4C2U A;  1R1U A;  1Y8R B;  4UB8 C;  4PJJ A;  3I55 I;  2LNB A;  1HC8 A;  2GZW A;  3GFL A;  4L0Y B;  2EWN A;  3PNT A;  1X1C A;  2DMQ A;  2E1M B;  1J0R A;  3S3O A;  1MBF A;  4MEX F;  3B6A A;  2DCE A;  3ZR8 X;  2FU4 A;  2VIX A;  2XF7 A;  2ZSI B;  1K6O A;  4FIS A;  4BU2 A;  4DIQ A;  4IKF A;  4XKV A;  1O57 A;  3BC8 A;  3G2B A;  2VC0 A;  1YIO A;  2K9S A;  3RDI A;  4G7O F;  2WY7 Q;  4TV7 A;  3VYU B;  5HDN A;  1YG2 A;  3L2V A;  2KIF A;  1FWZ A;  2DT5 A;  3JTH A;  4KT6 A;  3CME I;  2NVT J;  1HSJ A;  1ZRC A;  3E5Q A;  5B66 C;  1CF7 B;  3QU6 A;  4OAY A;  1G59 A;  3HRS A;  2QBY B;  5E79 C;  2RQQ A;  1BOA A;  3TL4 X;  1MJB A;  2VN2 A;  3BTJ A;  5D5X B;  2XDV A;  2WWY A;  2FBH A;  2K4J A;  2VQL A;  2K02 A;  4MTD A;  2CQ7 A;  3ZQH A;  1BL0 A;  2W24 A;  1BI3 A;  2P6T A;  1M1E B;  2DT7 B;  4JQF A;  1MGT A;  4EGY A;  2KIM A;  2MLK A;  3R0J A;  3DV8 A;  2DTR A;  3ZMZ A;  3JAM K;  1FZP B;  1VQP I;  1XDS A;  1MMN A;  1V54 H;  1SD6 A;  2OCE A;  4HQM A;  1D0Y A;  5IT9 Z;  1YLF A;  2JA7 J;  3GLX A;  3Q0U A;  5KCM A;  2CU7 A;  3OIP A;  1W1W E;  2CV2 A;  4M3G A;  5D5U B;  1H9T A;  1XCB A;  2A68 F;  2JRT A;  1MBE A;  3PIO F;  4OIP F;  4PFP A;  2OQG A;  4CH7 A;  1V55 H;  3BG5 A;  1XSV A;  3IWZ A;  5B1A H;  2K5C A;  3CC2 I;  4I09 A;  4LB5 A;  2QQB A;  2KL4 A;  4RAF A;  2P7C B;  2FF4 A;  3TBI A;  4A3F J;  2YSR A;  1W7P B;  5E3L A;  1SEU A;  3HOU J;  4ASN A;  5HNF A;  4WCG A;  4C30 A;  2RAE A;  3LSM A;  1LPQ A;  2P81 A;  4JX5 A;  2MD0 A;  2HXO A;  1UMQ A;  3K1M A;  5FLX K;  4DBR A;  2MFZ A;  3BP8 A;  1BR1 A;  1T33 A;  5E1X A;  1L3L A;  1TWC J;  5J3L A;  5D6E A;  1AKH B;  2WV1 A;  2G7H A;  1BC7 C;  2M34 A;  3FM5 A;  3WGH A;  4RDU A;  2ADU A;  2LP0 A;  3M8E A;  1Q1V A;  4HOB A;  4M74 A;  2Y31 A;  3SDB A;  3WE3 A;  1YW8 A;  1W5S A;  3D0S A;  2CQN A;  1P4X A;  2LDU A;  1IN4 A;  1D5V A;  2CO5 A;  2XAJ A;  3CCL I;  1KQ0 A;  2WAE A;  4EJO A;  4MHG A;  3VOD A;  3A0B C;  3RIR A;  2R7T A;  2XVC A;  4P1W A;  4DZJ A;  3FX3 A;  4G6Q A;  4XKB A;  1XGM A;  4IQJ A;  1I1G A;  3JRB A;  3RYP A;  2FBI A;  3WTZ A;  4G9Y A;  1X4O A;  3U2R A;  4RAG A;  1BI0 A;  1FIA A;  5A2Q K;  2XF5 A;  4XIC A;  1F9N A;  4B3A A;  1MMD A;  2EFO A;  1SMY F;  2HOA A;  2F4M B;  4OIQ F;  2FQ4 A;  4XSX F;  3RQI A;  5KHD A;  5FRN A;  3J80 Z;  3P9I A;  1RKW A;  3PUF A;  4Y4R A;  1U78 A;  1SFE A;  2DW4 A;  1H9G A;  2IXS A;  2CGP A;  3AG2 H;  2PJR A;  3L1P A;  5HS8 A;  4R79 A;  3S3N A;  1VQL I;  4NUB A;  2VKE A;  1IF1 A;  3PUB A;  1KU2 A;  1WZ2 A;  1UAA A;  1KU3 A;  1ZYR F;  3OL3 A;  4HF2 A;  3PSF A;  1LNW A;  4UUV A;  1VF9 A;  2DU9 A;  4CZC A;  3ZQI A;  5E18 F;  1GT0 C;  3OOU A;  3HHH A;  2P5L C;  2TDX A;  4BHB A;  5GAD J;  3K70 D;  5F04 A;  1HLV A;  3MKZ A;  3FXL A;  3P5J A;  5DDG A;  3OS1 A;  4A3B J;  2M8G X;  3CJN A;  3G6E I;  4HST A;  3R0A A;  3GTG J;  3OYM A;  5HS9 A;  4IX7 A;  1Z6R A;  2HQR A;  4NNJ A;  3IAS 2;  4N9H A;  1QGP A;  3FWE A;  1VTN C;  2KKO A;  4HSR A;  1G4D A;  2GXG A;  1JJ8 C;  3OYE A;  5LRS A;  2ZSH B;  5JVT A;  2O5R A;  1T39 A;  3H0G J;  2LBF B;  1ZRF A;  4LD5 A;  2HQ5 A;  2HXI A;  3BR0 A;  3I3L A;  2W84 A;  3JRF A;  2VBZ A;  4ZYG A;  4P9U A;  3S17 J;  2F5F A;  3W2A A;  3IH3 A;  5LFA A;  4I0B A;  3DEW A;  1IXS B;  4QSH A;  5M5X J;  4CYC B;  3IV5 A;  1RC9 A;  3O8G A;  4HDU A;  3R61 A;  4P5O A;  4BE2 A;  2JUG A;  2J5O A;  3LSK A;  2HYG D;  2GIZ A;  3CCE I;  4H4K C;  2ACJ A;  1F1Z A;  5GTI C;  2W7N A;  4MEY F;  3EDP A;  4HX4 A;  4PK4 A;  3Q5F A;  1HCR A;  2JZY A;  1QVU A;  3QPT A;  4HEA 2;  3FK6 A;  3CDH A;  3CES A;  2JVG A;  4LIU A;  4N4O B;  4ETS A;  2DPU A;  3FZV A;  3LSI A;  4M9Z A;  3OYH A;  2AXL A;  2BXZ A;  3CJR B;  3LOC A;  5E3N A;  1EH6 A;  2PMH A;  4II3 A;  3AG1 H;  3OV8 A;  1TWG J;  3Q0W A;  5D5V B;  2EH3 A;  2FJ1 A;  2DA3 A;  3OWT A;  2GOM A;  3FXO A;  2HVR A;  2V1U A;  4QTR A;  3EUH A;  3A01 A;  2WTE A;  4HA8 A;  3GWZ A;  3E7L A;  1Z0X A;  1FMW A;  5E1Z B;  4Y3O A;  2X6O A;  5B3S H;  5IOZ A;  2R7X A;  4AU7 A;  3IUO A;  4Y15 A;  3TW7 A;  2V4J C;  3E6B A;  1KZH A;  1S7E A;  3J7Z I;  1X58 A;  4XM3 A;  3F0C A;  3CUQ A;  1TWA J;  1OCT C;  4AM3 A;  2HKX A;  4IZZ A;  3F6V A;  1R36 A;  4Q48 A;  1W0T A;  3V8J A;  1JE8 A;  1R5I D;  2KJB A;  3JTG A;  1PVE A;  5C44 J;  3LFU A;  4YIF A;  1B4A A;  1A6Q A;  3LWF A;  4IHV A;  2ZJP F;  1LVK A;  3PQJ A;  2MAB A;  4PFO A;  2BY2 A;  2WAQ A;  3JCU C;  1HQC A;  1C0W A;  1Z7L A;  3I0T A;  4D7N A;  3K4C A;  5LGN A;  2KRC A;  4Y33 A;  2OBP A;  5KAI C;  4DOZ A;  2EFQ A;  4KIG A;  1OQY A;  3FXU A;  3J80 K;  1D0X A;  2D1H A;  2K4B A;  2UXX A;  4YII A;  1WFX A;  2V9V A;  2ZB9 A;  1HDD C;  2XV4 S;  2M0C A;  2E34 A;  1I6X A;  3LSR A;  3IKV A;  4A69 C;  4ZYE A;  3HGY A;  1POG A;  5FRO A;  1R49 A;  3RZD J;  1VFC A;  3L7W A;  4RGR A;  2GQQ A;  2NNY A;  2BHZ A;  3G71 I;  4PCQ A;  5DUI A;  3RKQ A;  3DU5 A;  1FTZ A;  3H5R A;  2MSY A;  2R5Y A;  4IHW A;  4F55 A;  2XAG A;  4BBS J;  2HQA A;  3O6B B;  4NQW A;  1ZGJ A;  2BGC A;  2IGO A;  4I2O A;  1I3A A;  4EEF G;  2EQR A;  2Q8K A;  4DQ2 A;  1J59 A;  2LMD A;  4RB2 C;  1IC8 A;  3BZC A;  2F48 A;  3O3K A;  5CKT A;  2F5V A;  1B59 A;  4KMF A;  2GOX B;  4Z2Y A;  1R7J A;  2IGN A;  3QOP A;  4EM1 A;  5K7Z A;  3V8K A;  3HBL A;  1XX5 A;  3F3X A;  2DDA A;  3J7A O;  4B47 A;  1VQK I;  3QAH A;  4YG2 F;  1TP4 A;  4Y52 J;  1W5T A;  2GIV A;  3LSJ A;  5LRR A;  4AYB A;  3ESW B;  5IY5 H;  3CTA A;  3TP0 A;  4IXA A;  2KZV A;  3D1N I;  2VXD A;  2X48 A;  5FO5 A;  4XOR A;  1YQA A;  4A3I J;  2CUE A;  3CP8 A;  1SD7 A;  2A6T A;  1HXD A;  5LHG A;  4CXF A;  4E70 A;  1AU7 A;  2F2E A;  4A3E J;  3P9K A;  5TIS C;  4B3X A;  2O9L A;  3JRG A;  4KUM A;  1PJR A;  3BPX A;  5GAE J;  4ANJ A;  2LR8 A;  3DEU A;  3RZO J;  1ZG5 A;  5KVR A;  5ICG A;  1SD4 A;  4YIR X;  3GEZ A;  1Z3X A;  3F8M A;  3WE2 A;  3E0J B;  1IXC A;  2V26 A;  1XTA A;  2JTV A;  1S9H A;  2VXZ A;  2WC2 A;  4BEH B;  4KIS A;  4H0E A;  1HOM A;  4A6E A;  4XSZ F;  4RAZ A;  1R5G A;  4BXU A;  1RRJ A;  3LQQ A;  4AIK A;  2BV6 A;  3H3Z A;  4N9I A;  4OAZ A;  3F8F A;  2XGC A;  2QVO A;  1P7J A;  4XLN F;  1X1A A;  5ILS A;  1G3T A;  4EGZ A;  1V5G A;  3OR1 C;  1MH4 A;  4PJM A;  1U8R A;  2EFN A;  5EZH A;  3FKI J;  4A2U A;  4IL6 C;  4D5F A;  1JI8 A;  1JUS A;  4FHT A;  4MTE A;  1OLT A;  3RQ4 A;  3SDG A;  1MSE C;  2DYR H;  2O8X A;  5EDN A;  3UNG C;  4U0W A;  2IA2 A;  2W57 A;  1T0F C;  1J7K A;  3DWL E;  3NRV A;  4F7Z A;  4S04 A;  2BW3 A;  4BDY A;  4BE0 A;  3FF5 A;  5KK1 A;  1ETO A;  3DTK A;  1K79 A;  1SC7 A;  3QPL A;  3GTP J;  4IOA F;  1YYV A;  3WTT C;  3K4B A;  3K1N A;  4HDV A;  4FTH A;  2LG4 A;  4ITV A;  4M3F A;  1YX3 A;  2GAU A;  5EZG A;  2ECC A;  5HLI A;  3ZOB A;  2R7U A;  1ON2 A;  3VSK A;  1JGG A;  1BOB A;  3A02 A;  4ZJZ A;  1TWF J;  1I50 J;  2HWV A;  3FHN A;  4QPO A;  1UB9 A;  1YJN I;  1Z7U A;  4JBA A;  4BJ6 C;  1VQ9 I;  4BNC A;  1HDP A;  1QZE A;  2ZXH A;  2CSO A;  3Q3S A;  2DI3 A;  3Q9V A;  4CSW A;  3CCS I;  2WBM A;  3GTM J;  5D8L B;  2BVL A;  2EA2 A;  3DU6 A;  1BJZ A;  1IJW C;  2M3A A;  3L09 A;  1UHM A;  1YX5 A;  2QEX I;  1ZGW A;  2O3F A;  1DUX C;  3ISP A;  1P4A A;  5B1B H;  3WG9 A;  1XD7 A;  2F5E A;  1LFU P;  1UHW A;  5IPA A;  1LKX A;  2R4G A;  1MH3 A;  1X3W B;  2DTZ A;  2WA0 A;  2GM4 A;  3FM3 A;  5J4Y A;  3E5U A;  4GXO A;  5C3E J;  1V5F A;  2ELH A;  1IDY A;  2BXY A;  1E17 A;  4EM2 A;  2XAH A;  1DU0 A;  2CQX A;  1DGW Y;  1TZL A;  3LQR A;  3M9A A;  1X3Z B;  2D2W A;  2MC4 A;  2VJJ A;  3BJO A;  3OYD A;  5FFZ A;  1DPR A;  2IS6 A;  3BG9 A;  2VI6 A;  2FSW A;  1H0M A;  2ECB A;  2R7O A;  2YU3 A;  3DBR B;  5IT3 A;  4IPA A;  3DLA A;  2VON A;  5J47 A;  2JPB A;  2CJJ A;  3LFK A;  1YRN A;  1BR4 A;  2X6Y A;  2FE3 A;  3IL2 A;  1ZRD A;  3HKZ A;  1Y8Q B;  3BR1 A;  4BXX J;  2KIQ A;  3B02 A;  3K10 A;  1GV5 A;  3I59 B;  2LVS A;  3SZT A;  4Q4Z F;  3IHU A;  4EJV A;  4J00 A;  2ZXJ A;  2HS5 A;  2Y48 A;  3CDI A;  4V2F A;  2STT A;  1FOX A;  4M9X A;  2DJI A;  2Z16 A;  4BJ5 C;  1OCO H;  4V2G A;  2NVX J;  2I10 A;  1W5C C;  2DT6 A;  1TWH J;  2DA5 A;  2E2J J;  2XSD C;  4E7H A;  2DA7 A;  5EGO B;  5DCF A;  2P5K A;  3I4P A;  1AOY A;  1D8J A;  4ZZD A;  3KIO A;  3BZ6 A;  3ULQ B;  1X2M A;  2CW8 A;  2NNN A;  1K78 B;  3JRH A;  2IS2 A;  2QLZ A;  2XKP A;  2W4S A;  3OYL A;  2EV5 A;  5ILU A;  1LE8 A;  1TQI A;  3TQN A;  4GDF A;  2IEK A;  3DPU A;  2VJ4 A;  2DQR A;  4UV8 A;  2RGV A;  3QQA A;  2VJ5 A;  2EZK A;  5FKK A;  4XN3 A;  2EJR A;  2LTP A;  2V9P A;  2X4H A;  3T1B A;  4P9F A;  1D1B A;  2QUF A;  2DOF A;  1IXR C;  3HOV J;  3H5A A;  3KYC B;  1CGP A;  1ZHF A;  3L9F A;  3F8N A;  1QPM A;  1K61 A;  3C1D A;  1MIJ A;  3CLQ A;  1Y39 A;  4BQN A;  3WU2 C;  6PAX A;  3MKL A;  2EZH A;  2E1N A;  3ZMD A;  1HF0 A;  2NAZ A;  4OIO F;  5F0F A;  5HDK A;  3FIW A;  4LG0 A;  4AIJ A;  3HSE A;  3BR3 A;  1EH8 A;  2XC7 A;  3DQV C;  3OYB A;  1YI2 I;  2M1B A;  1ZLK A;  4ZYA A;  2KMU A;  1OPC A;  1ETK A;  2EA4 A;  3H1C A;  5DEQ A;  2GXA A;  1KU9 A;  2TRT A;  3N05 A;  2FD5 A;  2X0L A;  2QEN A;  3VOE A;  4IO9 F;  1FOY A;  3M8F A;  5EG0 B;  3M07 A;  3CCY A;  1R1T A;  4E7I A;  2YX4 A;  1RUN A;  4DNC A;  1AA7 A;  1V4R A;  2QCO A;  4NDL A;  5ICF A;  1V5E A;  3KZZ A;  1EJ9 A;  1YE9 A;  2HTS A;  5CQE A;  1Z21 A;  4JOM A;  3F72 A;  2MG4 A;  1LDK B;  2OU2 A;  4X1E A;  2ZME A;  2BBY A;  4BY7 J;  1QZZ A;  1ZLJ A;  4BY1 J;  1GHC A;  2CFO A;  5J8F A;  1WQ2 A;  2XF6 A;  2ID3 A;  3RPU A;  1YOV B;  3S2D J;  3CMM A;  2E5N A;  5JHU A;  1R4M B;  5IT9 K;  2M45 A;  3ONQ A;  3QOE A;  4O5V A;  3U9G A;  5J1U A;  3CCM I;  2WAQ N;  3M1C A;  3K9T A;  4P96 A;  3FXR A;  4C2M J;  1EA3 A;  1XCV A;  2IBD A;  4M3E A;  5DCM A;  3A1Y A;  3GTL J;  1BIA A;  4LGW A;  5HNH A;  3K7A J;  5GAG J;  1Z3Y A;  1U5T B;  1OCP A;  1MNM C;  4GFB A;  2VPL A;  1ETX A;  1JTY A;  1DP7 P;  1IDZ A;  4KNY A;  2LOO A;  4A0Y A;  3KET A;  3E6D A;  2V1X A;  1ZQ3 P;  3D5S C;  3MWM A;  1R22 A;  2FEZ A;  2M30 A;  1ZGA A;  3H9G A;  1Q1H A;  1ACI A;  1P2F A;  3PSI A;  2ZFW A;  2RN7 A;  4A12 A;  5KNL A;  2L9N A;  2M7B A;  4II2 A;  3KEQ A;  1MDM B;  1IO2 A;  2PEX A;  3B73 A;  2E1C A;  2COM A;  3LA7 A;  4ABZ A;  1FJL A;  2XAQ A;  2MH9 A;  4A3D J;  5LBQ A;  2IGK A;  4GGG A;  3PNV A;  3C3W A;  1ZG3 A;  2HPI A;  2GXB A;  3TGN A;  1ETY A;  4BYY A;  1NK2 P;  5L3B A;  5F6F A;  4BDZ A;  3RKY A;  2K40 A;  3WU0 A;  2ZC2 A;  1FEX A;  1OYY A;  4KN7 X;  3T0Y A;  1G8X A;  1JXS A;  3OSF A;  2R3S A;  2VT3 A;  3SHF A;  3KEY A;  4PDK A;  1YTY A;  3JRI A;  2O03 A;  4UUS B;  2MH2 A;  3ML6 A;  3WGI A;  4EJU A;  3RSN A;  4AYB N;  4B4C A;  4NB5 A;  3DF8 A;  3SEZ A;  5ICE A;  2Q2E A;  3AL0 B;  1HW5 A;  4O3M A;  3MMY B;  3CCJ I;  2AXT C;  1T2K A;  5JLW A;  4IVN A;  3HSF A;  2MW8 A;  4CHU A;  3OIQ A;  4BE1 A;  3BTL A;  3I71 A;  1U2W A;  3HTU A;  1IV8 A;  3MD2 A;  1EF4 A;  2JA5 J;  1SFX A;  1K4T A;  2X6W A;  1HA8 A;  1I39 A;  3CC4 I;  3PL8 A;  3RPU D;  1XPX A;  1H89 C;  4JX6 A;  1U5T C;  1Y56 A;  3L00 A;  3OS0 A;  1XSD A;  3KLO A;  1NH3 A;  3M4O J;  4CCK A;  3HOY J;  4RAY A;  3M7G A;  1Z67 A;  3WTY C;  1BJA A;  3JRE A;  2OAZ A;  4XOP A;  1S7A A;  3G1L A;  4ENK A;  1OYW A;  1OKR A;  2NVY J;  3GFJ A;  3N4M A;  4XOT A;  5DM6 F;  3MCZ A;  2OZ6 A;  1D1C A;  2R7V A;  3IKT A;  2BOL A;  4OU0 A;  2X51 A;  2BE5 F;  1ON1 A;  1GXP A;  4CCM A;  2DBB A;  3FMS A;  1ZTR A;  3LAP A;  3S1M J;  2JSC A;  2EBI A;  1PUF A;  3OSG A;  1VQ8 I;  3OYF A;  2B7E A;  2NS8 A;  2DOE A;  4DYQ A;  2HU9 A;  3OYA A;  2OUM A;  2W25 A;  1QQI A;  4Y13 A;  2JN6 A;  2JRM A;  2DJN A;  2KHM A;  3D5R C;  1JKP C;  1UEL B;  1AHD P;  3JW4 A;  4ZZL A;  3P9C A;  3OS2 A;  1XGS A;  1B8I A;  2A05 A;  2QWW A;  3ZQF A;  3AL0 C;  3FIS A;  3BR5 A;  1IN5 A;  3A03 A;  2DO7 A;  5DD4 A;  5K5Q A;  1XSX A;  3ECO A;  2W00 A;  1NTC A;  3AKZ A;  3GYH X;  1RR7 A;  4UNO A;  2KDO A;  4B48 A;  2ZKZ A;  1SVO A;  1A6I A;  5J4V A;  4BJT A;  1AWC A;  4XMY A;  3HUG A;  4IHS A;  4IHT A;  1MBH A;  5D8K B;  1FOK A;  1LEB A;  5HLG A;  4EJW A;  1R1V A;  3DFG A;  5F0C A;  1HBX G;  4XKC A;  2Q1Z B;  2R7Q A;  3AFH A;  4NC6 A;  4RA2 A;  4I76 A;  4MIM A;  4D9J A;  1SVM A;  1DPU A;  2Q0O A;  5FLM J;  3IH4 A;  3W3C A;  2L9S A;  2XB0 X;  3EUA A;  2R7S A;  1YW7 A;  4PSW A;  4BAC A;  1N75 A;  2A3S A;  2HDD A;  1JHH A;  3R60 A;  2XKO A;  1O3T A;  2ISY A;  3EET A;  3DCF A;  3ZMU A;  1L0O C;  1E2X A;  3R4K A;  3KEO A;  4KT5 C;  4O6J A;  2JJ7 A;  1J75 A;  2JWT A;  2WAF A;  3IP4 B;  1CQT A;  2HYJ A;  3MVP A;  1BBY A;  1XN7 A;  1HST A;  4PJ0 C;  2ZO4 A;  3DBL B;  1NK3 P;  1ORK A;  4XLC A;  1YO5 C;  3F21 A;  3KZY A;  3S2W A;  2F6C A;  2O6G E;  1O3Q A;  2W1O A;  1X2N A;  3JSO A;  1ZRE A;  4BKX A;  4AVZ A;  5LHH A;  2EZL A;  1F43 A;  1FT9 A;  2XGD A;  2IRF G;  1IUF A;  4RM2 A;  1BC8 C;  1R23 A;  5BPD A;  1STZ A;  1SAU A;  1LDD A;  3BG6 A;  1JKR C;  4HAM A;  2A61 A;  5H20 A;  1DP3 A;  2JQ7 A;  4BH9 A;  3HOZ J;  4KA4 A;  3GX4 X;  2A6H F;  1H88 C;  4X6A J;  5BOX A;  2H1L A;  3REO A;  2K85 A;  3K70 C;  5EYR A;  3ASO H;  2VUM J;  1JKQ C;  2QF7 A;  2RVC A;  3L2W A;  1ZN2 A;  1UG0 A;  5CLS A;  5HDG A;  2CWE A;  3A0H C;  4C3I J;  3CF5 F;  3CJQ B;  2VQC A;  2FX0 A;  3IRQ A;  2DA6 A;  5EEA A;  2JA2 A;  3IAM 2;  3S3M A;  3V7C A;  5E17 F;  1B1B A;  4HLY A;  3MQ0 A;  5L3E A;  3CO6 C;  2R7R A;  4QIW N;  5CJ9 A;  4S05 A;  5FKL A;  2Y0M A;  3QP6 A;  2L7F P;  4HNV A;  2IT0 A;  2VLA A;  4BS9 A;  5GTH C;  5LEK A;  4BQQ A;  2J5P A;  2ZNZ A;  2LF7 A;  3RKX A;  3TP3 A;  2OTL I;  2TCT A;  4KIF A;  4LFU A;  3WTS C;  1T56 A;  3OYJ A;  4B43 A;  4L18 B;  2PMU A;  4B1R A;  4BGD A;  1G2H A;  2HGC A;  3BTI A;  5FD5 A;  1Y1V J;  4M3B A;  1Y0N A;  2KRF A;  2OA4 A;  1W0U A;  4ENM A;  4RB1 A;  2FOW A;  3F9K A;  5J1R A;  2L3D A;  1QHH D;  2KDZ A;  2NOG A;  1Z91 A;  2H94 A;  4IHX A;  2DK5 A;  2KLO A;  4CCJ A;  3ERE D;  4E7S A;  3IH2 A;  1KON A;  2A5W A;  2QKM B;  2DPD A;  4M9S A;  1OR7 A;  5F0H A;  2PN6 A;  2YPR A;  4U0Y A;  3VB2 A;  2VKH A;  5EEH A;  2LSO A;  4HX8 A;  2LFB A;  4U87 A;  4BEH A;  1JJ6 C;  2Z99 A;  4P55 A;  3K69 A;  2M0M A;  2BHY A;  3HJE A;  1W36 D;  3HG9 A;  3H9Q A;  1DGR M;  1X1P A;  4QPQ A;  5B5E C;  1WVR A;  2RNJ A;  4IF4 A;  2OV7 A;  2CUJ A;  1WGX A;  4AID A;  2E5Z A;  1B72 A;  4LJZ F;  4FET A;  1RPW A;  2L54 A;  3TOA A;  1IG7 A;  2LRD A;  3O2P E;  4EM0 B;  1R9T J;  2V1N A;  4YRV A;  1I5Z A;  1YJ9 I;  3E1S A;  1UG2 A;  1P4W A;  2IAI A;  1XGO A;  1IRZ A;  1S3J A;  1J09 A;  2DA2 A;  2XAU A;  3A01 B;  2F4O B;  3ZQC A;  1O3S A;  4A3C J;  2KIU A;  2XRO A;  4IQ4 A;  2HOS A;  4LLN A;  1FNN A;  4A6D A;  4M3D A;  4Q5S F;  3HYI A;  3U1D A;  2CV0 A;  1TNT A;  1NG6 A;  3DKX A;  4JX4 A;  1XDU A;  4FE4 A;  1ITY A;  3JSP A;  3GFM A;  4NC7 A;  2KZG A;  1FLI A;  3DKY A;  1FP2 A;  3CUQ B;  1WCM J;  3KCC A;  2F5C A;  4XRS G;  1QBJ A;  3ZCO A;  4U0V A;  1OMI A;  3QRF F;  3MEX A;  2HR3 A;  1MZB A;  5E3M A;  3HM5 A;  5ED4 A;  4OWR B;  3MKW B;  5J40 A;  4M6V A;  1WJ5 A;  4LLG F;  4L9J A;  1IN6 A;  4AD9 A;  2L5Q A;  2VKV A;  4CCO A;  1TT0 A;  1O7F A;  2CMP A;  2V6E A;  3M8J A;  5FKN A;  1QU3 A;  3GBG A;  2E36 A;  3CDL A;  3ABU A;  1SD5 A;  2FBK A;  2DFE A;  1PP8 F;  3ZQL A;  5AIP A;  3SYT A;  3F6O A;  3TOB A;  4A93 J;  3K0L A;  5ERI A;  3ZQ7 A;  4RB3 C;  3COA C;  4E7J A;  1K83 J;  3MZ8 A;  2QKL B;  2CW0 F;  4E4H A;  3BZK A;  2VE8 A;  4W1U A;  2PMZ A;  2QSF X;  3C2B A;  3FXK A;  2V9K A;  4XLE A;  1FBQ A;  1UZC A;  3GW2 A;  4XLP F;  4QLC U;  2ELK A;  4M71 A;  2R5Y B;  2Y2Z A;  3AAF A;  4I01 A;  4KFC A;  4L5E A;  1ZG1 A;  2DAO A;  1J5Y A;  1IGN A;  3KP3 A;  2CW7 A;  1QRY A;  2KJC A;  4U88 A;  3DTI A;  4L9V A;  4E7Z A;  4Q47 A;  1X19 A;  4WX9 A;  5CVI A;  2JT1 A;  1ZAR A;  2CYY A;  5K5O A;  2JUC A;  4DW6 A;  5DYM A;  1QPI A;  1G3W A;  1Z1D A;  4M72 A;  4FE7 A;  3ZPL A;  2FUG 2;  4NBQ A;  1P6R A;  5L3G A;  2BY0 A;  3GVA A;  4G94 A;  3T5X A;  3HOW J;  1ZR2 A;  3CUQ C;  2ME0 A;  1BN5 A;  4M73 A;  1LB2 A;  1TQP A;  1D5Y A;  2R5Z A;  5D4R A;  4HZF A;  1B9N A;  3V4G A;  2XPV A;  1OIS A;  1QHG A;  1KYZ A;  3RPQ A;  3TO9 A;  4D5C A;  3V8L A;  2CUF A;  1GLN A;  2EIJ H;  3U1K A;  2WAD A;  4J01 A;  4ZDP A;  1FMV A;  3BQZ A;  3GTQ J;  4HBL A;  2L02 A;  3GF2 A;  3GLL A;  1GUU A;  4XK4 A;  1WHU A;  4MQ9 F;  3EYI A;  4R8H A;  1YFH A;  3BPV A;  1P9Q C;  2EV0 A;  3HEF A;  2E71 A;  5K7F A;  1LUJ B;  3AG4 H;  4I0A A;  1VI0 A;  4GO1 A;  4YEL A;  4LIT A;  2PBI A;  4A3L J;  3GTJ J;  1BI1 A;  3D5L A;  1SFO J;  4IOC F;  3JRD A;  4UY8 I;  3WHC A;  2FRH A;  3TO6 A;  1A35 A;  1USS A;  2OQR A;  1X4P A;  3H35 A;  5BNG A;  4KIT B;  3CQZ J;  3K4N A;  4AC0 A;  3BCB A;  1S29 A;  5FFX A;  2DXI A;  2IVM A;  4HV6 A;  3ECH A;  3WTX C;  1LVA A;  2A6E F;  2K9L A;  1TNS A;  2HTJ A;  4UV9 A;  4ZH4 F;  4GYG A;  1XS9 A;  4PGG A;  3HDD A;  2BEO A;  2LY1 A;  1G3Y A;  4KIC A;  3VSL A;  3C18 A;  1T6S A;  2DN0 A;  2A5Y B;  4UVB A;  2NRA C;  1FY7 A;  1ENH A;  3BLY A;  1IRG A;  2PX9 A;  3SFI A;  3HHG A;  4YEJ A;  1TL8 A;  4IHY A;  3W6J B;  3S16 J;  3ABT A;  1QA6 A;  2BY3 A;  1SFU A;  4EV0 A;  1T8I A;  1B6A A;  2R7D A;  3I53 A;  3S8P A;  3GFI A;  3HGG A;  4F52 A;  4CZZ A;  2VB6 A;  2EV6 A;  2P5V A;  1YW9 A;  4UHT A;  1GDT A;  2LKS A;  4C3H J;  3CF2 A;  4GYI A;  5C4X J;  3EQL F;  3F23 A;  1ZKG A;  1U9O A;  3C7J A;  1JT6 A;  1XMK A;  3B6C A;  5ILV A;  4XID A;  1FBS A;  5HS7 A;  4LK0 F;  3WU1 B;  1KQ8 A;  2V7F A;  3W6V A;  4HQE A;  1Y6I A;  1E3P A;  1S6L A;  2K9Q A;  5E8G A;  3OYG A;  5IP9 J;  4HLX A;  3S93 A;  2GLO A;  4U7B A;  5TRD A;  5TJJ A;  1ONV A;  3C2H A;  3CCR I;  4C2T A;  2KP6 A;  1ULY A;  3HOX J;  1SMT A;  3FDY A;  4CGZ A;  1BR2 A;  2W48 A;  1RUO A;  3L2C A;  5JVG F;  1KYW A;  1U5T A;  3RCO A;  1CF7 A;  2HDC A;  3VDX A;  2VBY A;  4L5J A;  3NQO A;  1B9M A;  2QBY A;  2BZT A;  5H6Q A;  1BIB A;  1PYV A;  1SAX A;  5FJ8 J;  5FRM A;  3G1O A;  3F22 A;  4ZDO A;  3KPH A;  2XRL A;  4F3Q A;  4I02 A;  2H6C A;  5IOY A;  3ZGK A;  4AWX B;  2UZK A;  4OMZ A;  5LHI A;  2Y9Z A;  2IA0 A;  4XRS A;  4A3G J;  1RNL A;  2H27 A;  2X1E A;  3GZ5 A;  3S14 J;  2N8G A;  1GXQ A;  3I5U A;  3GZ6 A;  1N78 A;  1X3U A;  3U21 A;  1O3R A;  1W4M A;  3SZP A;  3L2R A;  1A04 A;  2VOO A;  4EMS A;  2DYS H;  3DXJ F;  1N77 A;  2ESH A;  3CC7 I;  2Y69 H;  3NWS A;  4S0H B;  2LH9 A;  3QU3 A;  4HX7 A;  4YFK F;  2K86 A;  3WTW C;  4RBO A;  2P6S A;  2QGU A;  1BA5 A;  2CG4 A;  9ANT A;  4PSX A;  5J6X A;  5FGM A;  4W97 A;  2NXN B;  4IRG A;  2X6X A;  3MN2 A;  3BWG A;  1HKQ A;  3DPL C;  2Z33 A;  3VFZ A;  4V19 K;  1J9I A;  5L3C A;  1W7P A;  4CCN A;  2JSP A;  1MJA A;  4ZC3 A;  3V42 A;  5F1J A;  1LE8 B;  4RS8 A;  2IA1 A;  3KYD B;  3QPH A;  3ABM H;  3ZQG A;  2P4W A;  3VWB A;  3ABK H;  1AKH A;  3CD6 I;  3T8R A;  3N97 A;  3ZMT A;  1VQ7 I;  4D1Q A;  4OOI A;  1MKM A;  4G8X A;  4A5M A;  5HOO A;  1DDN A;  1G3S A;  1E0E A;  1NHA A;  4GRI A;  4XRF A;  1HKT A;  4RLQ A;  1FP1 D;  1D0Z A;  1FC3 A;  2M4K A;  1I27 A;  1RI7 A;  3PFY A;  5CPR B;  3TED A;  2QA4 I;  4RGS A;  4PZJ A;  3CLO A;  4KIB A;  2DMT A;  3SFZ A;  3BY6 A;  3TO7 A;  3BJ6 A;  5C4J J;  2XSJ C;  4ESF A;  4LG0 B;  2RRE A;  2X9D A;  3SZG A;  2JA8 J;  5EEG A;  4RB0 A;  2H8W A;  3LL7 A;  2CFX A;  3WGG A;  1D3Y A;  2Y30 A;  5JHF A;  2XAF A;  3ERM A;  5HLT A;  5DM7 F;  3MZY A;  5HVQ C;  2HOE A;  2L9R A;  5IYC J;  2DDB A;  1TW2 A;  1K4S A;  3ZP5 A;  3FBN B;  1Z05 A;  2CQK A;  1ODD A;  4K2E A;  1IRF A;  2K3P A;  3FK7 A;  4AUX A;  4BQA A;  1VQ6 I;  2DMN A;  2ETH A;  2GWR A;  4ENN A;  4L0Z B;  4ENJ A;  3W2W A;  2PFB A;  3HPG A;  3KP2 A;  5GPA A;  3CCQ I;  3I9V 2;  4G6T B;  3OR2 C;  4IRH A;  4UUT A;  2Z9O A;  4EQQ A;  1TQM A;  2ICW G;  3QP5 A;  1VQO I;  2V79 A;  3BG7 A;  2XPW A;  4OIR F;  5FKO A;  3A4C A;  1MMG A;  4G6D A;  2KFD A;  5FD6 A;  3L2Q A;  3ROU A;  2ZME B;  3AG3 H;  2COB A;  2QQ9 A;  5FB2 A;  1QVT A;  2G0E A;  3CCV I;  2LKX A;  1UCR A;  3TMO A;  3ZRG A;  2OZU A;  1UJ8 A;  4HPQ A;  1DU6 A;  2IW5 A;  5BQT A;  2LKP A;  2K27 A;  2VAS A;  1W7P D;  3FXJ A;  4XBF A;  2E1M C;  1UHS A;  2H09 A;  1WRJ A;  2KPM A;  4NHJ A;  4DJA A;  2M4G A;  4BXF A;  2ME6 A;  5JI6 A;  5M3F J;  5DCM B;  3HPH A;  1JTX A;  1MW7 A;  3H0D A;  3K4J A;  4BL0 B;  2V1D A;  3EUK L;  5HLH A;  3ABL H;  1WJE A;  4G7H F;  3G1M A;  1BM9 A;  2ELJ A;  4UB6 C;  2LBF A;  2RV8 A;  4HNT A;  2L0K A;  2Y0S A;  4JYK A;  2M9H A;  5LLQ A;  2I8D A;  3RTR A;  2ZXI A;  2ZBK A;  1IV6 A;  1LEA A;  1LFP A;  1IAW A;  3GTK J;  1OCR H;  1X1B A;  2HKO A;  2NS0 A;  2A69 F;  5BS6 A;  3J81 Z;  2VQG A;  2VL8 A;  2PMZ N;  4I7H A;  3G3Z A;  2DFF A;  3T8T A;  3OYC A;  2PQ8 A;  1OYI A;  2E7X A;  3OYN A;  2QYO A;  2AHQ A;  1QNT A;  4CYC A;  2CH0 A;  2E19 A;  2JA6 J;  2H8R A;  1VND A;  3FHZ A;  4I99 C;  2QSH X;  1IN8 A;  1LDJ A;  1MNE A;  1JGS A;  1T08 B;  4BUP A;  2DMP A;  2R93 J;  2E1O A;  2L4M A;  4WXD A;  2OCC H;  2K9M A;  5E8I A;  1JHF A;  2LK2 A;  1PDN C;  2IP2 A;  3QPS A;  5JR3 A;  4FQG A;  4L5I A;  1FSE A;  1RKT A;  4XNF A;  3DBH B;  1FYK A;  5CVV A;  1S5L C;  4KJZ A;  3KFW X;  4CA0 A;  3SEQ A;  2CS3 A;  3VEP A;  1R71 A;  1RES A;  2M87 A;  4IJA A;  1V3F A;  2OPT A;  2L01 A;  4L9N A;  5L3D A;  2Z1D A;  2ZME C;  2VOP A;  2WB1 A;  3KE2 A;  3WG7 H;  1GV2 A;  4EVI A;  3E3V A;  2Q2E B;  4XN0 A;  1A31 A;  2HPM A;  1JUP A;  1YHQ I;  1XMX A;  1D1A A;  2E7W A;  4MQV A;  2STW A;  5CYV A;  4HV5 A;  2HYF A;  3HC7 A;  1MND A;  1ETQ A;  4KN4 X;  2EB7 A;  4B8X A;  3PJR A;  4HF0 A;  1WSU A;  5LD2 C;  4D0P A;  2K9N A;  2O0Y A;  3UR3 C;  2JPC A;  5L3F A;  2LF8 A;  2VE9 A;  3KP5 A;  2HVS A;  1SAN A;  3K4K A;  5F27 A;  3QYE A;  1ETW A;  4EAT A;  4F92 B;  4XR6 A;  2OF7 A;  4CIC A;  3M3Y J;  3H36 A;  2E2H J;  2YU9 J;  2V6C A;  4HRI A;  1U9N A;  4A3K J;  2IS1 A;  3HOT A;  1Y0U A;  3W6K B;  1YS7 A;  3MKY B;  1MD0 A;  3WTU C;  1FOW A;  1X1D A;  2O8K A;  3FXM A;  1R4N B;  1IRX A;  1XC5 A;  3HKZ N;  4I6Z A;  4ZTF A;  1TT5 B;  2X85 A;  3I4M J;  4XON A;  5JFR A;  2QM3 A;  2DA4 A;  4JP0 A;  1QO0 D;  1F36 A;  3S2H J;  2LYC A;  2EFW A;  1BW6 A;  3HXL A;  3TW6 A;  3BDD A;  1OCC H;  3O8H A;  2E35 A;  4BQO A;  3W2V A;  1HKS A;  4MNU A;  3BRO A;  3K6G A;  3X2Q H;  1WWX A;  2Z2S B;  3S1Q J;  2NVQ J;  1G6N A;  2L7M P;  1YS6 A;  1PUF B;  3OYI A;  2DQL A;  2M8E A;  2PJR B;  3KLN A;  1WJF A;  1HW1 A;  2WV0 A;  3NEU A;  2MYS A;  2YR2 A;  3M1E A;  3MAJ A;  1BI2 A;  1WJA A;  3V7R A;  2JK3 A;  5GP9 A;  1A36 A;  3S15 J;  3S32 A;  2A07 F;  1MMS A;  4PJL A;  2E60 A;  3K4M A;  3BCA A;  2HEO A;  1B8I B;  1VQ5 I;  3OMY A;  1T0F A;  2AQF A;  3Q9S A;  2D1V A;  4UVC A;  2D5V A;  2BYV E;  4YFX F;  1FPQ A;  3K2A A;  2KT0 A;  3BT9 A;  3S1R J;  1RIO H;  2H1K A;  4GCV A;  1U6G A;  3GZN B;  1WI3 A;  4ESB A;  3JRC A;  1YIJ I;  1DQU A;  1P92 A;  3HUG B;  3IC7 A;  3LAJ A;  1REP C;  4BHP A;  1Y1W J;  5EJC A;  3BR2 A;  4L9T A;  4C3J J;  2KRH A;  3GCM A;  4HW0 A;  1ZR4 A;  2PJP A;  3FXQ A;  2KIS A;  3EPZ A;  4AIH A;  2XIG A;  3H92 A;  4RGU A;  2LD5 A;  1FYM A;  3J81 K;  1RZ4 A;  3LSH A;  3E97 A;  2XGX A;  5E20 A;  4WWC A;  4CO8 A;  2NOJ B;  2R92 J;  1MSF C;  3CO7 C;  3HB9 A;  3OY9 A;  1K7A A;  3DPT A;  2EIL H;  1YJW I;  2UV1 A;  3ZN1 A;  4PJN A; 
#chains in the Genus database with same CATH homology
 2QQA A;  3LA3 A;  2M5W A;  2XHK A;  4ZYD A;  4WXC A;  4QWQ A;  2OD5 A;  1TLH B;  2F5D A;  2RQP A;  2FNA A;  3P7N A;  1D8K A;  4FT8 A;  3E6M A;  3HOS A;  4FX4 A;  4M6Y A;  2XUB A;  3F8B A;  1TTY A;  1R00 A;  1KA8 A;  2VBX A;  5DD8 A;  4R1H A;  4CDG A;  5ICC A;  1Z9C A;  1F5T A;  2ZNY A;  1XMA A;  2DFI A;  5DUK A;  3GUD A;  1WI9 A;  2R7F A;  4I98 B;  4LMY A;  4WXH A;  3IWF A;  4A0Z A;  4WF2 A;  5CVJ A;  2ZCW A;  4U7D A;  3FMR A;  2MD5 A;  4Y17 A;  1ZH5 A;  3BJA A;  2FOK A;  4JK1 X;  2PG4 A;  5J8C A;  2G7U A;  5BPI A;  3OOP A;  1XB4 A;  2VT2 A;  2FML A;  1XGN A;  3RJP A;  1KGS A;  4G7Z F;  3GXO A;  3DKW A;  4M6X A;  3I58 A;  4AVP A;  5LEJ A;  3I54 A;  1I1S A;  2IJL A;  2MC3 A;  1S7O A;  2GA2 A;  2HZT A;  3E6C C;  4LB6 B;  2UXN A;  1FX7 A;  2B0L A;  4HYE A;  1HW2 A;  5F1R A;  4B09 A;  1LQ1 A;  3RI4 A;  2DK8 A;  3TDZ C;  5D5W B;  5H6R A;  1UFM A;  3PFI A;  2P8T A;  3RKW A;  2XAS A;  4N0B A;  3SXY A;  3KP6 A;  3TKY A;  1UST A;  3I59 A;  2VC1 A;  3F8C A;  1TBX A;  3WTV C;  2FNP A;  5D6F A;  3DP7 A;  2NYX A;  3I64 A;  5E1W A;  4UXN A;  5F64 A;  4MGR A;  5AIQ A;  2FA5 A;  1EV7 A;  1FSH A;  3ZMS A;  3HSR A;  2P7V B;  1U3E M;  2RC4 A;  1K78 A;  1FYL A;  4ON0 A;  3LA2 A;  3V7S A;  4BHC A;  1GVJ A;  1LJ9 A;  3LST A;  4PGH A;  1T38 A;  2O61 A;  5AON A;  3RYR A;  4FX0 A;  3PQK A;  1J2X A;  2AS5 F;  4KYW A;  2HQN A;  3BOQ A;  3FMQ A;  5IT9 Z;  2ZJ2 A;  1PUE E;  4A5N A;  3MZH A;  1KQ9 A;  2YX7 A;  4A0X A;  4YFN F;  1Z6T A;  2EK5 A;  1R5H A;  3HRM A;  3KP4 A;  2EFP A;  3K2Z A;  2Z5U A;  2MLG A;  2ISZ A;  3CUO A;  5K5R A;  3HIF A;  4ESJ A;  3H3U A;  3WOD F;  5BMZ A;  1S8N A;  2RDP A;  4UVA A;  2FMY A;  2VOD A;  5CVU A;  1F4K A;  2Y75 A;  1IN7 A;  2D45 A;  2C6Y A;  3JAM Z;  1QZY A;  4BAY A;  3SQN A;  3TDU C;  2HFH A;  4KMU X;  4OIN F;  2QZ8 A;  3ZN0 A;  2DLL A;  4WK8 F;  5DV5 A;  2XRN A;  5D4S A;  2L4A A;  4EJT A;  2FQ3 A;  1WKM A;  1O7L A;  4IRI A;  3K1P A;  4ZYH A;  3ELK A;  2VBW A;  5LGU A;  2PI0 A;  2K7L A;  3E5X A;  4KDP A;  4OMY A;  2UWM A;  3HTS B;  1R58 A;  1ZAO A;  2W85 A;  5FLX Z;  5CVR A;  3MFK A;  2IPQ X;  5K1Y A;  2GA1 A;  3ZMV A;  4LLL A;  4CYD A;  1PP7 U;  1KU7 A;  2ESN A;  4RGX A;  3G73 A;  1EH7 A;  1FBU A;  4LK1 F;  1IW7 F;  2PLY A;  3HRT A;  2H6B A;  3GO5 A;  1MDM A;  4HF1 A;  5LGT A;  1IUY A;  1T98 A;  2G9W A;  3KP7 A;  2RKH A;  2MA3 A;  2FXA A;  3EYY A;  1MJ9 A;  5A2Q Z;  1IZ1 A;  3R6S A;  1TW3 A;  3HRU A;  2Z3Y A;  3IRR A;  2MBF A;  1R1U A;  2LNB A;  2GZW A;  3GFL A;  4L0Y B;  2EWN A;  1J0R A;  4MEX F;  1K6O A;  2FU4 A;  1O57 A;  2VC0 A;  1YIO A;  3RDI A;  4G7O F;  4TV7 A;  5HDN A;  1YG2 A;  2KIF A;  1FWZ A;  2DT5 A;  3JTH A;  1HSJ A;  1ZRC A;  3E5Q A;  1CF7 B;  3QU6 A;  3HRS A;  2QBY B;  1BOA A;  1MJB A;  2VN2 A;  5D5X B;  2WWY A;  2FBH A;  2K4J A;  2K02 A;  4MTD A;  2W24 A;  1BI3 A;  2P6T A;  4JQF A;  4EGY A;  1MGT A;  2KIM A;  2MLK A;  3R0J A;  3DV8 A;  2DTR A;  3ZMZ A;  3JAM K;  1FZP B;  1XDS A;  1SD6 A;  4HQM A;  1YLF A;  3GLX A;  5D5U B;  1H9T A;  1XCB A;  2A68 F;  2JRT A;  4OIP F;  2OQG A;  1XSV A;  3IWZ A;  4I09 A;  4LB5 A;  2QQB A;  2P7C B;  2FF4 A;  2YSR A;  1W7P B;  4ASN A;  4WCG A;  3K1M A;  5FLX K;  3BP8 A;  5E1X A;  1L3L A;  5D6E A;  2G7H A;  1BC7 C;  3FM5 A;  3WGH A;  2ADU A;  3M8E A;  4HOB A;  4M74 A;  3WE3 A;  1YW8 A;  1W5S A;  3D0S A;  1P4X A;  2LDU A;  1IN4 A;  1D5V A;  2CO5 A;  2XAJ A;  1KQ0 A;  4EJO A;  4MHG A;  3VOD A;  3RIR A;  2XVC A;  3FX3 A;  4G6Q A;  1XGM A;  1I1G A;  3RYP A;  2FBI A;  3WTZ A;  4G9Y A;  3U2R A;  1BI0 A;  5A2Q K;  1F9N A;  2EFO A;  4OIQ F;  1SMY F;  4XSX F;  3J80 Z;  3P9I A;  1U78 A;  1SFE A;  2DW4 A;  1H9G A;  2CGP A;  5HS8 A;  4R79 A;  1IF1 A;  1KU2 A;  1KU3 A;  1ZYR F;  4HF2 A;  1LNW A;  4UUV A;  2DU9 A;  5E18 F;  3HHH A;  2P5L C;  2TDX A;  4BHB A;  5DDG A;  3CJN A;  3R0A A;  5HS9 A;  1Z6R A;  2HQR A;  4N9H A;  1QGP A;  3FWE A;  1VTN C;  2KKO A;  1G4D A;  2GXG A;  5LRS A;  5JVT A;  1T39 A;  1ZRF A;  4LD5 A;  2W84 A;  2VBZ A;  4ZYG A;  4P9U A;  2F5F A;  4I0B A;  1IXS B;  4HDU A;  3R61 A;  4P5O A;  2J5O A;  2HYG D;  2ACJ A;  1F1Z A;  4MEY F;  3EDP A;  4HX4 A;  3Q5F A;  2JZY A;  3QPT A;  3CDH A;  4ETS A;  2DPU A;  3FZV A;  4M9Z A;  2AXL A;  1EH6 A;  2PMH A;  3OV8 A;  5D5V B;  2V1U A;  3EUH A;  2WTE A;  4HA8 A;  3GWZ A;  5E1Z B;  4Y15 A;  3E6B A;  3CUQ A;  2HKX A;  3F6V A;  1R36 A;  4Q48 A;  3V8J A;  1JE8 A;  2KJB A;  3JTG A;  4YIF A;  1B4A A;  3LWF A;  3PQJ A;  1HQC A;  1C0W A;  3I0T A;  5LGN A;  2OBP A;  2EFQ A;  4KIG A;  3FXU A;  3J80 K;  2D1H A;  2K4B A;  2UXX A;  4YII A;  2V9V A;  2XV4 S;  1I6X A;  3IKV A;  4ZYE A;  3L7W A;  4RGR A;  2GQQ A;  2NNY A;  4PCQ A;  5DUI A;  2XAG A;  3O6B B;  4NQW A;  1ZGJ A;  2BGC A;  4I2O A;  2Q8K A;  4DQ2 A;  1J59 A;  4RB2 C;  3O3K A;  1B59 A;  4KMF A;  4Z2Y A;  1R7J A;  4EM1 A;  3QOP A;  3V8K A;  3F3X A;  3J7A O;  3QAH A;  4YG2 F;  1W5T A;  2GIV A;  5LRR A;  3CTA A;  4IXA A;  5FO5 A;  1YQA A;  1SD7 A;  1HXD A;  5LHG A;  4CXF A;  4E70 A;  2F2E A;  3P9K A;  4KUM A;  3BPX A;  3DEU A;  1ZG5 A;  5KVR A;  5ICG A;  1SD4 A;  3GEZ A;  3F8M A;  3WE2 A;  1IXC A;  2VXZ A;  2WC2 A;  2JTV A;  4H0E A;  4A6E A;  4XSZ F;  4RAZ A;  1R5G A;  4BXU A;  3LQQ A;  4AIK A;  2BV6 A;  3H3Z A;  4N9I A;  3F8F A;  2QVO A;  4XLN F;  5ILS A;  1G3T A;  4EGZ A;  1U8R A;  2EFN A;  4A2U A;  4FHT A;  4MTE A;  2O8X A;  4U0W A;  2IA2 A;  2W57 A;  4F7Z A;  1J7K A;  3NRV A;  4S04 A;  3FF5 A;  5KK1 A;  1K79 A;  1YYV A;  3WTT C;  3K1N A;  4HDV A;  2GAU A;  5HLI A;  1ON2 A;  2HWV A;  1UB9 A;  1Z7U A;  4JBA A;  4BNC A;  2CSO A;  2DI3 A;  3Q9V A;  5D8L B;  2EA2 A;  3L09 A;  1UHM A;  2O3F A;  1DUX C;  3ISP A;  1P4A A;  3WG9 A;  1XD7 A;  2F5E A;  1UHW A;  3FM3 A;  3E5U A;  4GXO A;  2ELH A;  1E17 A;  4EM2 A;  2XAH A;  3LQR A;  3M9A A;  2D2W A;  3BJO A;  5FFZ A;  1DPR A;  2FSW A;  1H0M A;  2YU3 A;  5IT3 A;  4IPA A;  2VON A;  2JPB A;  3LFK A;  2FE3 A;  3IL2 A;  1ZRD A;  3B02 A;  3I59 B;  3SZT A;  4Q4Z F;  3IHU A;  4EJV A;  2STT A;  2ZXJ A;  2HS5 A;  2Y48 A;  4M9X A;  5DCF A;  2P5K A;  3I4P A;  1AOY A;  1D8J A;  4ZZD A;  3BZ6 A;  3ULQ B;  2NNN A;  1K78 B;  2QLZ A;  2XKP A;  2EV5 A;  5ILU A;  1TQI A;  3TQN A;  2DQR A;  4UV8 A;  2RGV A;  2EJR A;  2X4H A;  3T1B A;  4P9F A;  2QUF A;  1IXR C;  1CGP A;  1ZHF A;  3L9F A;  3F8N A;  1QPM A;  3C1D A;  6PAX A;  2E1N A;  3ZMD A;  4OIO F;  2NAZ A;  5HDK A;  4LG0 A;  4AIJ A;  3HSE A;  1EH8 A;  3DQV C;  2M1B A;  1ZLK A;  1OPC A;  2EA4 A;  5DEQ A;  1KU9 A;  2X0L A;  2QEN A;  3VOE A;  3M8F A;  1R1T A;  2YX4 A;  1RUN A;  4DNC A;  1V4R A;  5ICF A;  3KZZ A;  2HTS A;  3F72 A;  1LDK B;  2OU2 A;  2ZME A;  2BBY A;  1QZZ A;  1ZLJ A;  1GHC A;  5J8F A;  1WQ2 A;  3RPU A;  5JHU A;  5IT9 K;  2M45 A;  4O5V A;  3U9G A;  3K9T A;  4P96 A;  3FXR A;  1XCV A;  5DCM A;  1BIA A;  4LGW A;  1U5T B;  1DP7 P;  4KNY A;  4A0Y A;  3KET A;  3E6D A;  2V1X A;  3MWM A;  1R22 A;  2FEZ A;  2M30 A;  1ZGA A;  1Q1H A;  1P2F A;  2ZFW A;  2RN7 A;  4A12 A;  3KEQ A;  1MDM B;  2PEX A;  3B73 A;  2E1C A;  2COM A;  3LA7 A;  2XAQ A;  2MH9 A;  5LBQ A;  4GGG A;  3C3W A;  1ZG3 A;  2GXB A;  3TGN A;  4BYY A;  5L3B A;  5F6F A;  3RKY A;  3WU0 A;  1OYY A;  4KN7 X;  3T0Y A;  1JXS A;  2R3S A;  2VT3 A;  3SHF A;  4PDK A;  1YTY A;  2O03 A;  2MH2 A;  3ML6 A;  3WGI A;  4EJU A;  4NB5 A;  3DF8 A;  5ICE A;  2Q2E A;  1HW5 A;  4O3M A;  1T2K A;  4IVN A;  3HSF A;  4CHU A;  3I71 A;  1U2W A;  3HTU A;  1SFX A;  1U5T C;  3L00 A;  1XSD A;  3KLO A;  4RAY A;  3M7G A;  3WTY C;  1BJA A;  2OAZ A;  1S7A A;  4ENK A;  1OYW A;  1OKR A;  3GFJ A;  3N4M A;  3MCZ A;  2OZ6 A;  3IKT A;  4OU0 A;  2BE5 F;  1ON1 A;  1GXP A;  2DBB A;  3FMS A;  3LAP A;  2JSC A;  2W25 A;  1QQI A;  4Y13 A;  3JW4 A;  4ZZL A;  3P9C A;  1XGS A;  2QWW A;  1IN5 A;  5K5Q A;  2DO7 A;  5DD4 A;  1XSX A;  3ECO A;  3GYH X;  4UNO A;  2ZKZ A;  1AWC A;  3HUG A;  4IHS A;  4IHT A;  5D8K B;  1FOK A;  1LEB A;  5HLG A;  4EJW A;  1R1V A;  3DFG A;  1HBX G;  1DPU A;  2Q0O A;  1YW7 A;  2A3S A;  1JHH A;  3R60 A;  2XKO A;  1O3T A;  2ISY A;  3EET A;  3ZMU A;  1L0O C;  1E2X A;  3R4K A;  3KEO A;  4KT5 C;  4O6J A;  1J75 A;  1BBY A;  1XN7 A;  1HST A;  2ZO4 A;  1YO5 C;  3F21 A;  3KZY A;  3S2W A;  2O6G E;  1O3Q A;  3JSO A;  1ZRE A;  5LHH A;  1FT9 A;  2IRF G;  1BC8 C;  1R23 A;  5BPD A;  1STZ A;  1LDD A;  4HAM A;  2A61 A;  5H20 A;  4BH9 A;  4KA4 A;  3GX4 X;  2A6H F;  5BOX A;  3REO A;  2RVC A;  1ZN2 A;  5CLS A;  5HDG A;  2CWE A;  3IRQ A;  5E17 F;  3V7C A;  1B1B A;  4HLY A;  3MQ0 A;  5L3E A;  3CO6 C;  5CJ9 A;  4S05 A;  2Y0M A;  3QP6 A;  2IT0 A;  5LEK A;  2J5P A;  2ZNZ A;  2LF7 A;  3RKX A;  3WTS C;  4KIF A;  4LFU A;  4L18 B;  2PMU A;  2HGC A;  5FD5 A;  2KRF A;  2OA4 A;  4ENM A;  4RB1 A;  2L3D A;  1Z91 A;  2H94 A;  2DK5 A;  3ERE D;  2DPD A;  4M9S A;  1OR7 A;  2PN6 A;  2YPR A;  4U0Y A;  3VB2 A;  5EEH A;  2LSO A;  4HX8 A;  2Z99 A;  4P55 A;  3K69 A;  2RNJ A;  4IF4 A;  4LJZ F;  2L54 A;  3TOA A;  3O2P E;  4EM0 B;  1I5Z A;  1P4W A;  1XGO A;  1S3J A;  1O3S A;  2KIU A;  2XRO A;  4LLN A;  1FNN A;  4A6D A;  4Q5S F;  3HYI A;  3U1D A;  1TNT A;  1XDU A;  3JSP A;  3GFM A;  1FLI A;  1FP2 A;  3CUQ B;  3KCC A;  2F5C A;  1QBJ A;  4U0V A;  1OMI A;  3QRF F;  3MEX A;  2HR3 A;  1MZB A;  5ED4 A;  4LLG F;  4L9J A;  1IN6 A;  4AD9 A;  1O7F A;  3ABU A;  1SD5 A;  2FBK A;  1PP8 F;  5AIP A;  3F6O A;  3TOB A;  3K0L A;  5ERI A;  3ZQ7 A;  4RB3 C;  3COA C;  2CW0 F;  2VE8 A;  1FBQ A;  3GW2 A;  4XLP F;  4QLC U;  4M71 A;  3AAF A;  4I01 A;  4KFC A;  1ZG1 A;  2DAO A;  1J5Y A;  3KP3 A;  2KJC A;  4U88 A;  4L9V A;  4Q47 A;  4WX9 A;  5CVI A;  2JT1 A;  1ZAR A;  2CYY A;  5K5O A;  5DYM A;  1G3W A;  1Z1D A;  4M72 A;  3ZPL A;  5L3G A;  1P6R A;  3GVA A;  4G94 A;  3T5X A;  3CUQ C;  1BN5 A;  4M73 A;  1LB2 A;  1TQP A;  5D4R A;  4HZF A;  1B9N A;  3V4G A;  3RPQ A;  3TO9 A;  1KYZ A;  3V8L A;  4HBL A;  2L02 A;  3GF2 A;  3EYI A;  4MQ9 F;  4R8H A;  1YFH A;  3BPV A;  2EV0 A;  4I0A A;  4GO1 A;  2PBI A;  1BI1 A;  3D5L A;  2FRH A;  3TO6 A;  1USS A;  2OQR A;  1S29 A;  5FFX A;  2IVM A;  4HV6 A;  3ECH A;  3WTX C;  1LVA A;  2A6E F;  1TNS A;  2HTJ A;  4UV9 A;  4ZH4 F;  4GYG A;  4PGG A;  2BEO A;  1G3Y A;  4KIC A;  3C18 A;  1T6S A;  2A5Y B;  4UVB A;  2NRA C;  1FY7 A;  1IRG A;  3HHG A;  3W6J B;  3ABT A;  1SFU A;  4EV0 A;  1B6A A;  2R7D A;  3I53 A;  3GFI A;  4CZZ A;  2EV6 A;  2P5V A;  1YW9 A;  4UHT A;  4GYI A;  3EQL F;  3F23 A;  3C7J A;  1XMK A;  5ILV A;  1FBS A;  5HS7 A;  4LK0 F;  3WU1 B;  1KQ8 A;  4HQE A;  1S6L A;  5E8G A;  4HLX A;  4U7B A;  5TRD A;  5TJJ A;  1ONV A;  1ULY A;  1SMT A;  4CGZ A;  1RUO A;  3L2C A;  1KYW A;  1U5T A;  1CF7 A;  2HDC A;  2VBY A;  4L5J A;  3NQO A;  1B9M A;  2QBY A;  5H6Q A;  1BIB A;  1SAX A;  3F22 A;  4I02 A;  2H6C A;  4AWX B;  2UZK A;  4OMZ A;  5LHI A;  2IA0 A;  1RNL A;  2H27 A;  3GZ5 A;  1GXQ A;  3I5U A;  3GZ6 A;  1X3U A;  1O3R A;  1W4M A;  3SZP A;  1A04 A;  2VOO A;  4EMS A;  3DXJ F;  2ESH A;  3QU3 A;  4HX7 A;  4YFK F;  2K86 A;  3WTW C;  2P6S A;  2CG4 A;  5J6X A;  5FGM A;  4IRG A;  3BWG A;  1HKQ A;  3DPL C;  2Z33 A;  3VFZ A;  1J9I A;  5L3C A;  1W7P A;  1MJA A;  4RS8 A;  2IA1 A;  3QPH A;  2P4W A;  3T8R A;  3N97 A;  3ZMT A;  4OOI A;  1MKM A;  4G8X A;  4A5M A;  5HOO A;  1DDN A;  1G3S A;  1NHA A;  4XRF A;  1HKT A;  1FP1 D;  1FC3 A;  1I27 A;  1RI7 A;  4RGS A;  4PZJ A;  3CLO A;  4KIB A;  3SFZ A;  3BY6 A;  3TO7 A;  3BJ6 A;  4ESF A;  4LG0 B;  5EEG A;  4RB0 A;  2CFX A;  3WGG A;  1D3Y A;  2XAF A;  3MZY A;  5HVQ C;  2HOE A;  1TW2 A;  3ZP5 A;  1Z05 A;  2CQK A;  1ODD A;  4K2E A;  1IRF A;  4BQA A;  2ETH A;  2GWR A;  4ENN A;  4L0Z B;  4ENJ A;  2PFB A;  3KP2 A;  4IRH A;  2Z9O A;  4EQQ A;  1TQM A;  3QP5 A;  2V79 A;  4OIR F;  4G6D A;  5FD6 A;  3ROU A;  2ZME B;  2QQ9 A;  5FB2 A;  1UCR A;  2OZU A;  2IW5 A;  5BQT A;  2LKP A;  2K27 A;  1W7P D;  4XBF A;  2H09 A;  1WRJ A;  4NHJ A;  5JI6 A;  5DCM B;  2V1D A;  5HLH A;  4G7H F;  1BM9 A;  2RV8 A;  5LLQ A;  3RTR A;  2ZBK A;  1IAW A;  1LEA A;  2HKO A;  2NS0 A;  2A69 F;  5BS6 A;  3J81 Z;  4I7H A;  3G3Z A;  3T8T A;  2PQ8 A;  1OYI A;  2E7X A;  2QYO A;  1QNT A;  3FHZ A;  1IN8 A;  1LDJ A;  1JGS A;  4WXD A;  2L4M A;  5E8I A;  1JHF A;  1PDN C;  2IP2 A;  5JR3 A;  4L5I A;  1FSE A;  1FYK A;  5CVV A;  3KFW X;  3VEP A;  2M87 A;  4IJA A;  1V3F A;  4L9N A;  2L01 A;  5L3D A;  2VOP A;  3KE2 A;  4EVI A;  3E3V A;  2E7W A;  4MQV A;  2STW A;  5CYV A;  4HV5 A;  2HYF A;  4B8X A;  4KN4 X;  2EB7 A;  4HF0 A;  1WSU A;  4D0P A;  2O0Y A;  2JPC A;  5L3F A;  2LF8 A;  2VE9 A;  3KP5 A;  4CIC A;  2V6C A;  3HOT A;  1Y0U A;  3W6K B;  1YS7 A;  1MD0 A;  3WTU C;  5JFR A;  2QM3 A;  1QO0 D;  2EFW A;  3BDD A;  1HKS A;  4MNU A;  3BRO A;  1WWX A;  1G6N A;  1YS6 A;  2DQL A;  2M8E A;  3KLN A;  2WV0 A;  1HW1 A;  3NEU A;  2YR2 A;  3M1E A;  3MAJ A;  1BI2 A;  3V7R A;  2A07 F;  2HEO A;  1T0F A;  3Q9S A;  2D1V A;  4UVC A;  2BYV E;  4YFX F;  1FPQ A;  1RIO H;  4GCV A;  1U6G A;  4ESB A;  1P92 A;  3IC7 A;  3LAJ A;  1REP C;  4BHP A;  4L9T A;  4HW0 A;  2PJP A;  3FXQ A;  4AIH A;  2XIG A;  3H92 A;  4RGU A;  1FYM A;  3J81 K;  1RZ4 A;  3E97 A;  2XGX A;  5E20 A;  4WWC A;  4CO8 A;  3CO7 C;  1K7A A;  3DPT A;  3ZN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...