2P7CB

Solution structure of the bacillus licheniformis blai monomeric form in complex with the blap half-operator.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDESDYIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Strand 1 of Twelve base-pair DNA
publication title Conformational and thermodynamic changes of the repressor/DNA operator complex upon monomerization shed new light on regulation mechanisms of bacterial resistance against beta-lactam antibiotics.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p7cB00
2GXGA 2NNYA 1IZ1A 1KQ9A 3GFJA 1O57A 2DW4A 2JPBA 5E17F 2HYFA 4WX9A 4OIRF 6PAXA 3TQNA 4KT5C 5HOOA 2CFXA 4RB3C 2QZ8A 1P6RA 3V7CA 4HX7A 3LA2A 5DV5A 2ESNA 2P8TA 2P5VA 1CF7A 3O6BB 2V1DA 4H0EA 3TO7A 1XCBA 4ESFA 3E5XA 3MEXA 3FHZA 4A5NA 1R5HA 2DAOA 1ZLKA 4JQFA 3CUQB 4G9YA 2V1UA 4ON0A 2QVOA 3I59A 2ZKZA 3LWFA 1U5TB 4ZYGA 5BPIA 3GFLA 1P4WA 4LLLA 1J0RA 4A0ZA 3FWEA 2ACJA 1HKSA 1BIBA 1QPMA 3MCZA 2ETHA 1REPC 4MEYF 1MJ9A 5E20A 3RYPA 1FBUA 4M73A 3R0JA 1KYWA 5D4SA 2ZCWA 3BPVA 1XGSA 5D8LB 4HOBA 4ASNA 2HOEA 3HYIA 4DNCA 5HVQC 4EGYA 3HTSB 3KLOA 3LFKA 2HKXA 5J8CA 2W25A 2XAFA 3FZVA 3MFKA 2A6EF 4P55A 2IT0A 1K7AA 3KLNA 2VC0A 5FLXK 1L0OC 5CVIA 1Z05A 3HHHA 3ZMDA 4LLGF 2DU9A 5KVRA 4IF4A 1I5ZA 1MJAA 2H6BA 3BJOA 1HW1A 2Q2EA 2BV6A 4EGZA 4BH9A 1GXQA 3DFGA 1ZLJA 1IXSB 1KQ0A 1GXPA 1BN5A 2OQGA 4EJVA 4EJWA 4ESJA 2K02A 1H9GA 3V7RA 5BQTA 5H20A 4HF1A 4HF2A 4A6DA 1QNTA 4XLNF 2JRTA 3REOA 5LGUA 1R36A 2VBZA 1R1UA 2RV8A 2E7XA 2ESHA 3P7NA 4Q5SF 1KU9A 1FLIA 3WTYC 4OIPF 3Q5FA 1QZZA 5L3EA 4UVCA 1SMYF 2F5FA 2M5WA 3WODF 4BQAA 3N97A 2H27A 2RQPA 3HOSA 4OIQF 2DTRA 2P5KA 2IJLA 3E5UA 5CVUA 5HLIA 1FOKA 1IN6A 1R22A 2XAGA 2DPUA 4L9JA 3QPHA 1DUXC 2W85A 3MWMA 4KYWA 3C18A 2STTA 3P9IA 4ZZLA 4RB2C 4FX0A 2A69F 2RGVA 3QRFF 3G3ZA 2B0LA 3BP8A 3TO6A 1XSDA 1L3LA 3E6DA 1Z7UA 3MQ0A 1F4KA 3WTSC 3IRRA 4WXDA 3RIRA 5A2QZ 3CJNA 5IT3A 1ZRCA 3V4GA 4B8XA 4MNUA 1W5TA 4WXHA 2ZNZA 2DI3A 3ABTA 4LG0A 1F1ZA 2W57A 4K2EA 1FT9A 2PBIA 4YFKF 4NQWA 1USSA 3KEQA 3KCCA 2YPRA 3BWGA 1H0MA 1QBJA 3ULQB 2KKOA 1QQIA 3ZP5A 2ISYA 3DV8A 3RJPA 5LGTA 1O3TA 1BI0A 3FM3A 1B6AA 4RGSA 3QP5A 3RTRA 4ZYHA 2MLKA 2K86A 3K1PA 3F8FA 2XUBA 4R1HA 3ZN0A 2F2EA 3W6JB 1R58A 1B1BA 3FXQA 2DK5A 3F3XA 4LK1F 2QBYA 2FSWA 1XDSA 4WWCA 4JBAA 4OMYA 3QU3A 4UVBA 4L9TA 4ZYEA 4WF2A 1RIOH 2CYYA 4HX8A 2EV6A 5K1YA 4O3MA 4KIGA 4AVPA 1K78A 3GUDA 4U0VA 4RGRA 1K79A 2A6HF 3K69A 3W6KB 2LF7A 4FX4A 3K1NA 1JGSA 3SXYA 1G3YA 2ZJ2A 1XSXA 5HS7A 2EA4A 4UNOA 5CVRA 2FOKA 1GHCA 2HTSA 5LHGA 2NNNA 2OA4A 3HOTA 2XGXA 3WGIA 4I2OA 1O7LA 4KN7X 3J81Z 2EV5A 4LJZF 3E6BA 2VBXA 2D1VA 3CTAA 1P2FA 2VOOA 1B59A 3F6VA 2XKOA 5J8FA 4Q48A 2H6CA 1OYWA 4HDVA 2EWNA 4UUVA 2QQAA 4MQ9F 4CICA 1CF7B 1FSHA 2YR2A 3DP7A 4CYDA 3L09A 4M71A 5FD6A 2GWRA 4NB5A 2P6TA 3ZPLA 1ZGJA 2NYXA 2HZTA 1R5GA 4AIJA 4MGRA 1WWXA 5DYMA 2STWA 5H6RA 4LMYA 3JTGA 2IA0A 2AXLA 3I59B 4XBFA 3O3KA 2H09A 4Y15A 2PEXA 2F5CA 3L7WA 3IHUA 2E7WA 1J7KA 4WCGA 2Y48A 5LBQA 3SZPA 2ELHA 1R7JA 3F72A 3F8NA 3FX3A 1ONVA 1LB2A 4G7HF 4HLYA 2NS0A 4NHJA 5K5RA 5HDKA 3H3ZA 4O5VA 1H9TA 1KU7A 2Z5UA 2OZ6A 1T38A 2WWYA 1F5TA 1FYKA 2G7HA 4YIIA 4KIBA 3I58A 1UCRA 1YYVA 1UHMA 3B02A 3LSTA 4DQ2A 3GZ6A 1FYMA 3GEZA 1T0FA 2XV4S 5AIQA 2D2WA 4LFUA 1Z91A 1U2WA 2PG4A 2PQ8A 3U1DA 1MDMB 2FNAA 1P4AA 3E97A 2P7VB 3WU0A 4MQVA 5F64A 1LDKB 3R60A 5DCMA 1XB4A 5EEHA 5ICCA 3U9GA 2L4MA 1X3UA 5DCFA 2M87A 2HWVA 2UWMA 2ZNYA 3K9TA 3EYYA 3KP6A 1BI2A 5J6XA 2LSOA 2WV0A 5D5VB 2FBIA 5L3FA 4YG2F 2HGCA 1Y0UA 4FT8A 1JE8A 2FXAA 2IA1A 4A0YA 3LA7A 2HR3A 3H3UA 1FYLA 1ZG1A 2IVMA 2GQQA 2OQRA 3WTWC 4L5IA 1Z1DA 2L3DA 4M72A 1ZRFA 2M45A 1O3RA 3EDPA 3RI4A 1LNWA 2OD5A 3ML6A 2XAJA 4MTEA 1KU2A 2VT2A 3MZHA 3VEPA 2EA2A 1PP7U 2BYVE 4P96A 2RKHA 2FNPA 3V8JA 1FX7A 2UXXA 4LLNA 1ODDA 2EV0A 3Q9SA 4BHBA 1I1GA 3GLXA 1HSTA 2FQ3A 1R1VA 1RUNA 2DO7A 2O3FA 3GO5A 1QZYA 4U88A 3F23A 2CQKA 2RVCA 2QWWA 1SD5A 1MKMA 2EFPA 5CLSA 4LG0B 4U7BA 2P4WA 4EJTA 5IT9K 4L5JA 2A3SA 2XRNA 4AWXB 1ZARA 3I5UA 2CGPA 2BGCA 3JAMZ 1S7OA 3JSPA 4KA4A 2QQBA 5LRSA 3IKVA 4CHUA 4RGXA 4GCVA 3TOBA 3AAFA 4LB6B 3F21A 4BXUA 2JTVA 2ZMEA 4ESBA 2XASA 5DDGA 1V4RA 1YG2A 5L3DA 3L9FA 2DLLA 1OR7A 2XHKA 3M9AA 2A68F 5FO5A 1SD4A 2EFNA 1JHFA 1SFXA 5DUIA 1MD0A 3COAC 1USTA 5FLXZ 3VODA 1K6OA 1BI3A 4MHGA 4UHTA 2KIFA 4I98B 1S7AA 2XAHA 1BBYA 3ECOA 3ISPA 3DEUA 4I0AA 3J7AO 1ULYA 5ILVA 2PLYA 1J9IA 3IWFA 1FSEA 1Z6RA 1BC7C 4ZH4F 2HYGD 1XGMA 3RKXA 2MD5A 3R61A 3KFWX 3LA3A 4N9HA 4PGHA 1J75A 3TO9A 2L01A 3R4KA 4HV5A 2HDCA 1P4XA 3C3WA 1W4MA 5K5QA 4Z2YA 2QQ9A 3LAPA 1FZPB 3T1BA 2WTEA 3VB2A 4OU0A 1G3WA 5D8KB 3V8LA 1T6SA 2DQRA 3CUQA 1DDNA 2OU2A 4M9ZA 2M1BA 5A2QK 3BJAA 1OYYA 4D0PA 2EFWA 1IN8A 4IRGA 2PN6A 3TKYA 1I1SA 1O3SA 4EV0A 1U5TA 3ZMVA 2WC2A 3O2PE 3ZQ7A 1O3QA 2NAZA 2E1NA 2ZFWA 2QYOA 2YX4A 3FXUA 2EJRA 2VBWA 1IAWA 2FU4A 2RDPA 4AD9A 1AOYA 1LJ9A 1S29A 5BPDA 2GA2A 4EM0B 3WGGA 2Z33A 4I01A 2IP2A 2EK5A 1MZBA 3KE2A 2J5PA 2H94A 2G7UA 4RGUA 3F8BA 3C1DA 4G7OF 4Q47A 1Z9CA 2ZXJA 1G3TA 3M1EA 5BOXA 4BAYA 1SMTA 4ETSA 1XGOA 2FBKA 1W7PD 4A0XA 4ENMA 4HAMA 2O61A 1ZG5A 2VC1A 1DPUA 2O03A 3ERED 4RAZA 3HRSA 4Y13A 3J80Z 1B9NA 2V79A 4ZYDA 2EFQA 3I64A 2HKOA 5L3BA 3PQKA 4HDUA 1W7PB 3WE3A 3HIFA 3FM5A 5H6QA 4OIOF 3BJ6A 3DPTA 2JSCA 2IPQX 4KDPA 2HS5A 2BE5F 3KP7A 1SFEA 4PGGA 1LQ1A 1XMAA 2LF8A 1F9NA 1R1TA 2EB7A 4IVNA 1NHAA 3TGNA 1TTYA 2FF4A 5D5XB 2MA3A 2XKPA 3KZYA 4CGZA 4GGGA 1D5VA 4IRIA 1JXSA 4YIFA 3KP4A 1WKMA 1IF1A 2FMYA 5LEJA 1BIAA 5LHIA 1SFUA 2KJCA 5DCMB 1YQAA 3J81K 4A6EA 1YO5C 2J5OA 1A04A 5DD8A 1ZAOA 1SD7A 1U6GA 1EV7A 4P5OA 5JVTA 1YS6A 1T98A 3T0YA 5JR3A 3Q9VA 3D0SA 4IHTA 1EH7A 2LKPA 2MLGA 1HW5A 1E2XA 3V7SA 2VE9A 3DQVC 4M6YA 3BROA 4M9SA 1OKRA 4P9UA 4U0WA 1LVAA 4HQEA 4I7HA 3WGHA 5HS9A 1LEBA 2FA5A 1OMIA 1J59A 1Z6TA 4L9VA 4PCQA 3GW2A 2Z9OA 3WU1B 4A12A 2BBYA 1P92A 4EM1A 1XD7A 2QENA 1KGSA 3F22A 1KQ8A 4HZFA 1G6NA 1TW2A 2Z3YA 2DBBA 1U8RA 2CSOA 2XVCA 4I0BA 3DF8A 2UXNA 5ILUA 1E17A 1J2XA 2O6GE 2FMLA 2FE3A 2F5EA 3HRMA 2VT3A 1BC8C 3HSEA 3NEUA 2BEOA 4KNYA 3LQRA 4HF0A 3VFZA 3WTTC 2DPDA 1RNLA 3I71A 5FD5A 3GFIA 3L00A 3BZ6A 2HTJA 5ICFA 1ZYRF 1YLFA 2W24A 3D5LA 2JZYA 2QUFA 2X4HA 3K1MA 3QAHA 2IRFG 4R8HA 3ZMZA 2V1XA 5LLQA 3OOPA 2OAZA 2Z99A 2TDXA 2RN7A 3OV8A 3NQOA 4HA8A 2ZMEB 5LEKA 2PFBA 1TQIA 1IN7A 1RI7A 3RDIA 2A61A 1FBQA 5D5UB 5HDNA 3M8EA 4OINF 3GWZA 1TQPA 4AIHA 2M30A 4S05A 2UZKA 4HLXA 4N0BA 2ISZA 4Y17A 1UFMA 3KZZA 2NRAC 3KP2A 2DFIA 4P9FA 5L3CA 3P9KA 1YW7A 1ZGAA 3WTVC 3CLOA 3MAJA 2XROA 1XMKA 3WTZA 1YW8A 4CDGA 1EH6A 1AWCA 4HW0A 4B09A 4YFXF 5BS6A 1U78A 4WXCA 4KMUX 1IN5A 1Q1HA 2PI0A 4KFCA 4BYYA 4G6DA 2XAQA 3KP3A 2DT5A 5E1WA 3ZMUA 5D4RA 4L0ZB 3RKWA 2FBHA 5FB2A 3C7JA 3GX4X 2C6YA 4IHSA 4KICA 1IRGA 3WTUC 1FP2A 4HYEA 4G94A 4HQMA 3FXRA 3P9CA 3BY6A 5K5OA 3GZ5A 5DUKA 2MH9A 1J5YA 2KIMA 3JSOA 3WG9A 1IN4A 2LDUA 1WQ2A 2XIGA 3ZMTA 3BPXA 4R79A 4XLPF 3DXJF 3HUGA 2VOPA 2OBPA 4CO8A 2K7LA 1PUEE 1UHWA 3MZYA 4XSZF 2HFHA 4I09A 4KMFA 1D8JA 4EJOA 2DK8A 1XSVA 2D45A 3JAMK 4XSXF 5ED4A 1ZN2A 3M8FA 1IUYA 2IW5A 3U2RA 1KYZA 1B9MA 1HKQA 3WTXC 3LQQA 4XRFA 3HRTA 3JW4A 2OZUA 1HKTA 3IWZA 1DPRA 3KEOA 5D5WB 2ZO4A 1FY7A 5IT9Z 1JHHA 2QBYB 1TW3A 4S04A 3IRQA 1MDMA 3LAJA 4ENJA 2CWEA 2F5DA 3RPQA 3CUQC 2JPCA 4Q4ZF 2HEOA 1MGTA 2YX7A 3GXOA 2PJPA 5ILSA 4QWQA 2Q0OA 3HTUA 1KA8A 4G6QA 1U5TC 1SAXA 4EQQA 2KJBA 2O8XA 1K78B 3GYHX 2MH2A 3V8KA 3DPLC 1EH8A 2VXZA 5E1ZB 3ROUA 2HQRA 3GVAA 4MTDA 1BM9A 3H92A 3EQLF 3N4MA 1ON1A 1RUOA 2DQLA 4EJUA 2YSRA 5E8GA 3F6OA 5CJ9A 2GZWA 1G4DA 3WE2A 3T8RA 4ENNA 1STZA 2ADUA 3BOQA 1PDNC 3T5XA 3L2CA 4TV7A 2G9WA 4GXOA 5D6FA 2GXBA 1TBXA 5CYVA 4CXFA 4QLCU 2VONA 2ZBKA 2V9VA 1W5SA 3K2ZA 5E8IA 3HHGA 4N9IA 4BHPA 1HXDA 2E1CA 2R3SA 5E18F 2CW0F 3GF2A 2R7DA 1XGNA 1ON2A 4LD5A 5D6EA 5DEQA 5FFZA 1PP8F 5ICGA 2CG4A 5KK1A 2X0LA 3BDDA 1I27A 4RB0A 3F8MA 1QO0D 4KUMA 5CVJA 4GYGA 3TDUC 3I53A 3CUOA 1FP1D 5LGNA 3R6SA 1FC3A 3SZTA 4AIKA 4IJAA 3CO7C 1IW7F 1R23A 4G7ZF 3J80K 1WSUA 1LDDA 5F6FA 5TRDA 3E5QA 2PMHA 1O7FA 2QLZA 4PDKA 5TJJA 3F8CA 5E1XA 5L3GA 3FMSA 3RKYA 3I0TA 3PQJA 1V3FA 4OMZA 3IC7A 3JTHA 5DD4A 1G3SA 2KIUA 4BNCA 1XDUA 2QM3A 2L54A 3E6MA 2LNBA 4JK1X 1BOAA 4UXNA 3FMQA 4EMSA 3EUHA 2AS5F 3M7GA 5HLGA 1T2KA 4RB1A 3NRVA 3B73A 4FHTA 4A5MA 5F1RA 2FEZA 1TQMA 2MC3A 5JI6A 4EM2A 4MEXF 1YIOA 4LB5A 3K0LA 4LK0F 2R7FA 4L0YB 4WK8F 3I4PA 1TLHB 2VBYA 2KRFA 5AIPA 2EFOA 2P6SA 1D3YA 3HSRA 4IPAA 3ELKA 4UVAA 5CVVA 2GAUA 1U3EM 2CO5A 4L9NA 1WI9A 1OYIA 3VOEA 3SQNA 2VN2A 3IKTA 2FRHA 5BMZA 2K4BA 3QU6A 4U0YA 2K27A 4EVIA 3S2WA 1I6XA 2VODA 3TOAA 3KETA 1T39A 1XCVA 3ZMSA 4I02A 3SFZA 2HQNA 4M9XA 1BI1A 3RPUA 1UB9A 5ICEA 5ERIA 2L02A 4M6XA 1FWZA 3R0AA 4U7DA 4L18B 1BJAA 3TDZC 4IXAA 4OOIA 4IRHA 1HW2A 4GYIA 4PZJA 2M8EA 1TNSA 3CO6C 3DKWA 2V6CA 1YFHA 4KN4X 3SHFA 4M74A 1LEAA 3QPTA 5HDGA 1YW9A 3PFIA 3KP5A 1FBSA 4YFNF 3IL2A 3QP6A 1YTYA 3ABUA 2COMA 1GVJA 5AONA 5FGMA 5JHUA 2A5YB 1SD6A 1MJBA 1WRJA 3ECHA 4F7ZA 2D1HA 2GA1A 2O0YA 4RS8A 2GIVA 1DP7P 1ZREA 3QOPA 1CGPA 5FFXA 1B4AA 3CDHA 2YU3A 4HBLA 1HQCA 1R00A 1OPCA 2IA2A 1ZRDA 3ZN1A 1W7PA 4LGWA 2K4JA 1HBXG 5HS8A 1FPQA 1IRFA 1ZHFA 2L4AA 3T8TA 2W84A 1S6LA 5LRRA 1VTNC 1RZ4A 1HSJA 3GFMA 1QGPA 4HV6A 1YS7A 2VE8A 1ZG3A 2Y75A 3I54A 1FNNA 3HSFA 1S3JA 2JT1A 3RYRA 4BHCA 4CZZA 4ENKA 1C0WA 4RAYA 1S8NA 3E3VA 4O6JA 4UV9A 3FMRA 1TNTA 2A07F 3E6CC 1IXRC 2PMUA 1IXCA 2Q8KA 2P7CB 4E70A 2MBFA 1XN7A 3EETA 2P5LC 4A2UA 3G73A 1LDJA 1ZH5A 3FF5A 4ZZDA 4GO1A 5HLHA 2RC4A 4G8XA 4HX4A 3HRUA 1D8KA 1KU3A 2Y0MA 5EEGA 2RNJA 3EYIA 4UV8A 5LHHA 5JFRA 4KIFA
chains in the Genus database with same CATH superfamily
2GXGA 4DGWB 2NNYA 1IZ1A 4CZCA 1KQ9A 4ANJA 2Y2ZA 4FE4A 2PJRB 2O5RA 3GFJA 1O57A 2DW4A 2JPBA 5E17F 2HYFA 3A4CA 3KYDB 4WX9A 3QYEA 4OIRF 4B48A 6PAXA 3TQNA 4KT5C 5HOOA 2CFXA 4DW6A 4RB3C 2E35A 2EH3A 2QZ8A 4M3DA 2CV1A 4II2A 1P6RA 3V7CA 4HX7A 3LA2A 2L9NA 5DV5A 3BG5A 4J19A 2ESNA 3W6VA 2P8TA 5CPRB 5HNFA 2P5VA 1CF7A 3CMEI 3O6BB 2V1DA 3L2QA 2Z16A 3I4MJ 2IGNA 3DCFA 4V19K 4H0EA 1UZCA 2HI3A 2BW3B 1XCBA 3TO7A 5FKNA 1ZGWA 4ESFA 2H1LA 1BW6A 2IEKA 3E5XA 2VI6A 5CQGA 3MEXA 3FHZA 4A5NA 3TEDA 2XPUA 1V5FA 4DOZA 4IHXA 1ERDA 3HM5A 2F6CA 1N77A 1R5HA 2FOWA 2DAOA 3IH2A 1ZLKA 4JQFA 1IG7A 3DLAA 2HNHA 3CUQB 4G9YA 2R7XA 4PFPA 1X3WB 4A3DJ 2V1UA 3JRGA 2HDDA 4ON0A 2QVOA 3SDGA 3K70C 3I59A 2ZKZA 3LWFA 1U5TB 4ZYGA 5BPIA 3GFLA 1P4WA 3D5RC 4Y4RA 4LLLA 1J0RA 4A0ZA 2BHZA 3FWEA 1E3HA 2COBA 3DPUA 5DM7F 2O8KA 2ACJA 1HKSA 1BIBA 1QPMA 3MCZA 2ETHA 3D5SC 2LG4A 1REPC 1QA6A 4PFOA 4MEYF 1MJ9A 5E20A 2WA0A 3RYPA 1FBUA 4M73A 2OJED 3R0JA 1Z7LA 1KYWA 2DYRH 5D4SA 2ZCWA 5K7ZA 4X0GA 3JR9A 3ERMA 3CF2A 3BPVA 1XGSA 2L9SA 5LFAA 1A35A 4BJ5C 2KT0A 1TP4A 5D8LB 3X2QH 4F92B 4ZYAA 4HOBA 2ZJPF 3HBLA 2DA7A 1P7JA 1OCRH 4ASNA 2HOEA 3HYIA 4DNCA 5HVQC 4NBQA 4EGYA 3HTSB 3KLOA 5FLVA 3LFKA 2R92J 2HKXA 2CUFA 5J8CA 3BCBA 2OUMA 4XLEA 2W25A 3OYNA 3MKYB 1Z67A 1O4XA 2K9SA 2XAFA 3FZVA 5CQEA 3MFKA 4I6ZA 2PMZA 3OSGA 3VYSB 2M9HA 2A6EF 5FJ8J 2E34A 4P55A 5IPAA 5EF6A 3H36A 2IT0A 5EGOB 1X3ZB 1K7AA 3S15J 3ASNH 3KLNA 2CUZA 2VC0A 3GCMA 2CV2A 4BE0A 2IS2A 5FLXK 1L0OC 5CVIA 1Z05A 3HGGA 2X1EA 3J7ZI 3KEYA 3A0BC 2AO9A 3RKQA 3HOVJ 3HHHA 3OS0A 3ZMDA 4ZDLA 4LLGF 2BHYA 2DU9A 4MO7A 5KVRA 1Y39A 4BBSJ 2DA6A 4BGDA 4IF4A 1S5LC 1I5ZA 1MJAA 2H6BA 2E1MC 2Y69H 3BJOA 1HW1A 4BDYA 2Q2EA 2BV6A 2RQQA 4EGZA 4B43A 4BH9A 1GXQA 3DFGA 1ZLJA 3G4SI 1IXSB 2QQ8A 2B63J 1KQ0A 1GXPA 1BN5A 2OQGA 3OWTA 4XN3A 3E1SA 2XPWA 4EJVA 4EJWA 2X9DA 4ESJA 3FIWA 1LPQA 2K02A 3S93A 4DBRA 2GIZA 1H9GA 3HOWJ 3V7RA 5BQTA 5H20A 4HF1A 2NVUB 4NC6A 4HF2A 1WCMJ 4A6DA 1QNTA 2M34A 4XLNF 4XRSG 2JRTA 3REOA 5LGUA 3CC2I 1R36A 2VBZA 1M1EB 4DZJA 2W7NA 1R1UA 3PSIA 4QPQA 4HPQA 5EEAA 2RV8A 2V4JC 1P9QC 2E7XA 2ESHA 2YS9A 3P7NA 4A3EJ 4Q5SF 1VQ8I 1KU9A 1FLIA 3K4KA 4RLQA 3WTYC 4OIPF 2I5UA 3Q5FA 1QZZA 5L3EA 9ANTA 4UVCA 2DOFA 3SDBA 1SMYF 2W00A 2ECBA 2F5FA 2M5WA 3BZCA 3CJQB 1WI3A 4DZPA 3WODF 2DT7B 2FQ4A 1T08B 1WJBA 1BR1A 2E60A 4BQAA 3N97A 2GOMA 2H27A 2LTPA 1MH3A 2RQPA 4PSWA 2BOLA 3CLQA 1G8XA 3HOSA 4IKFA 4OIQF 3A1YA 2DTRA 2P5KA 2IJLA 3E5UA 5CVUA 5HLIA 1FOKA 1IN6A 3G1MA 1U8BA 1R22A 2XAGA 2DFFA 2CUJA 2DPUA 4L9JA 2I8DA 5E3LA 3JRAA 3QPHA 1A31A 4P1WA 3DEEA 1DUXC 2W85A 3MWMA 1TWCJ 2O7OA 1SAUA 2AQFA 1QVTA 1ACIA 3ZQHA 5IYBJ 3CJTB 3WHBA 1K4TA 4XRSA 4KYWA 2MYSA 3C18A 2STTA 3P9IA 3H9GA 3LMMA 2VXDA 4ZZLA 2BY1A 2KDZA 3H3VK 3IH3A 4RB2C 3EUHC 4FX0A 2A69F 2RGVA 3QRFF 3G3ZA 2L0KA 1JTYA 2B0LA 3H5AA 2EIKH 3L2WA 3IP4B 3BP8A 2F4OB 3TO6A 2LLKA 2M2EA 1XSDA 5C44J 5HODA 4E7SA 2EIMH 1L3LA 3E6DA 2VL8A 1VQ7I 1EJ9A 1Z7UA 3IAS2 4C3HJ 3MQ0A 1F4KA 3WTSC 3IRRA 3HZJA 3G6EI 4WXDA 3RIRA 5A2QZ 5FLMJ 3CD6I 2Z2SB 3CJNA 4GRIA 2L7ZA 5IT3A 3GMEA 1ZRCA 3V4GA 4B8XA 4MNUA 5KHDA 1U0JA 1GUUA 3FK7A 1W5TA 2OCCH 4WXHA 2ZNZA 2DI3A 3ABTA 4LG0A 1F1ZA 2W57A 4XIDA 3GTKJ 3MN2A 3OYLA 2HQAA 3FXMA 4K2EA 4DYQA 1FT9A 3EPZA 2PBIA 4YFKF 1NG6A 2QEXI 3CC4I 1R4NB 4NQWA 1USSA 3KEQA 3KCCA 2YPRA 3BWGA 3LSIA 1H0MA 1QBJA 3ULQB 2KKOA 2EPFA 5B1BH 1QQIA 3ZP5A 2ISYA 4C2MJ 3DV8A 4XLAA 2X6WA 3RJPA 3S3NA 4IOAF 5LGTA 4D9JA 1AKHB 3PSFA 2CH0A 1O3TA 1BI0A 3FM3A 1B6AA 3JRBA 1VNDA 4RGSA 3QP5A 3RTRA 4ZYHA 3F0CA 2MLKA 1WGXA 3CCLI 3ZQLA 2K86A 3K1PA 3S3OA 3F8FA 4IZZA 2XUBA 4R1HA 3ZN0A 2X85A 2D5VA 2F2EA 3TMOA 3W6JB 1R58A 1B1BA 3FXQA 2DK5A 3F3XA 4LK1F 2QBYA 2FSWA 2OV7A 1XDSA 4WWCA 4JBAA 2VKDA 4QTRA 4OMYA 4M3GA 3QU3A 1IC8A 3ZQQA 4CUGA 4UVBA 4L9TA 4E7ZA 4FTHA 1X1CA 3HOYJ 1LUJB 4ZYEA 3OYHA 3IH4A 1U9OA 4WF2A 1RIOH 2CYYA 4V2GA 4AC0A 3S8PA 3BR5A 4HX8A 1MNMC 3QPSA 2EV6A 3OYCA 3LOCA 5K1YA 4O3MA 3ZGKA 1UMQA 1FMVA 4KIGA 4AVPA 1K78A 3GUDA 1D0ZA 4U0VA 2EINH 4RGRA 2Q1ZB 1K79A 3DTKA 4BU2A 1I39A 2A6HF 3LSHA 3K69A 4FCYA 4NDLA 3W6KB 3OYGA 4E4HA 2WY8Q 2LF7A 3DU5A 2RNGA 4Y33A 4FX4A 3K1NA 3GZNB 1EF4A 1JGSA 3SXYA 1QHHD 1G3YA 2KL4A 2ZJ2A 5IP6A 1XSXA 2JWTA 2NOGA 4UB8C 5HS7A 2QA4I 2EA4A 1XC5A 2K9MA 1E3PA 3AG2H 3EUAA 4UNOA 1T95A 2ME0A 5HNHA 2F48A 3NAUA 5CVRA 3K10A 1FJLA 1GDTA 1BW5A 2FOKA 1GHCA 2HTSA 2CJJA 4RBOA 1XTAA 5LHGA 2DTZA 2NNNA 2X6OA 2OA4A 4PK4A 3HOTA 2LKXA 2XGXA 3WGIA 4I2OA 4PJNA 2WAQN 4S0HB 2ZFUA 1O7LA 4KN7X 3J81Z 3HC7A 3Q0VA 1K83J 5IYCJ 2EV5A 1YJ9I 1YIJI 4LJZF 3E6BA 1MSFC 2VBXA 2VPRA 5J1UA 2D1VA 4LG3A 3CTAA 1P2FA 2VOOA 4BKXA 3O8HA 1B59A 4A3GJ 3F6VA 1FOYA 2XKOA 5J8FA 4Q48A 2F4MB 2H6CA 4M3BA 2DMNA 1TL8A 1OYWA 1LE8A 4HDVA 2EWNA 3BTJA 4UUVA 2QQAA 2E5NA 4MQ9F 4CICA 3U1KA 2VQGA 4AUXA 1CF7B 4Z6YA 1FSHA 2YR2A 3DP7A 4CYDA 3GTGJ 3FDYA 3L09A 3MKZA 3ZCOA 4M71A 2M4GA 5FD6A 2GWRA 1NTCA 4NB5A 2P6TA 3MZ8A 1Z0XA 4NC7A 2QSGX 3ZPLA 1ZGJA 5J47A 3H1CA 2VJIA 1Z21A 1AU7A 2NYXA 2HZTA 1R5GA 4AIJA 4MGRA 1WWXA 2E2HJ 5DYMA 2HYJA 3AG3H 5H6RA 4LMYA 3JTGA 2STWA 4RDUA 2IA0A 2JA2A 2DFEA 3JRHA 3B6AA 1R5ID 2AXLA 1JUSA 2OPTA 4LIVA 3FXOA 3I59B 4XBFA 2NXNB 1MMGA 3O3KA 4BDZA 2H09A 4C9YA 4Y15A 1S72I 1OFCX 2PEXA 2EQRA 4MIMA 2Y9ZA 4ZTJA 2F5CA 1XPXA 3L7WA 3IHUA 3HUGB 2E7WA 4L5EA 3DBHB 1J7KA 4WCGA 4MFEA 2Y48A 1J09A 5LBQA 1B8IB 4JX5A 3SZPA 2ELHA 1R7JA 3F72A 3F8NA 3FX3A 1HA8A 3DU6A 3W2AA 1ZK8A 1ONVA 3HKZA 3U21A 4PUSA 5BNGA 1LB2A 5J40A 4G7HF 4HLYA 2NS0A 4NHJA 3H9QA 1AA7A 5K5RA 5HDKA 2WB1N 3CZ6A 3H3ZA 4O5VA 2KQRA 1H9TA 1KU7A 2Z5UA 4A93J 3K4LA 1JUPA 3MD2A 3OYAA 2OZ6A 1D1CA 1T38A 2WWYA 1F5TA 2P81A 4A3FJ 2EZLA 1FYKA 4CCLA 2G7HA 3KYLA 4YIIA 4KIBA 5E3OA 3O8GA 3A02A 3I58A 1MSEC 1UCRA 3ZQCA 3PJRA 1YYVA 4I76A 3S1NJ 1MIJA 2NVTJ 3L1PA 1UHMA 3B02A 3LSTA 3K70D 3A03A 3FKIJ 2Y0SN 4DQ2A 3GZ6A 4A3BJ 2K3PA 1FYMA 3GEZA 1T0FA 3SJMA 2XV4S 4PJJA 5AIQA 2V9PA 2QGUA 3ZOBA 4HNVA 4BQQA 2D2WA 4LFUA 1Z91A 1IV6A 1U2WA 2PG4A 2PQ8A 2R7SA 1VQLI 3U1DA 1ETYA 1MDMB 2FNAA 3L2VA 5M3MJ 1GT0C 1P4AA 1PVEA 3E97A 2BY2A 1Z3YA 1LKXA 2P7VB 3WU0A 1ENHA 4MQVA 5F64A 1LDKB 5GAEJ 4RA2A 3R60A 3FISA 5DCMA 1XB4A 4HNUA 1RR7A 4RAGA 2E2IJ 1CQTA 4LOCA 5FKMA 3GLLA 4B44A 1K6YA 5EEHA 5ICCA 3U9GA 2L4MA 3S1MJ 2JA8J 1X3UA 4F55A 2K9LA 4XN0A 5DCFA 2XC7A 2M87A 2HWVA 2EILH 4FE7A 2UWMA 2ZNYA 3K9TA 4X1EA 4E6KG 5DTDA 3EYYA 3NWTA 2KFDA 1OLTA 3KP6A 3UKGA 1BI2A 3LSPA 2ECCA 5FRNA 1PUFB 3PUBA 1N25A 5J6XA 2LSOA 1IRZA 3B6CA 2VKHA 2WV0A 4C3JJ 3CP8A 1QZEA 1GV2A 1HDDC 4HSRA 4G6TB 2N8GA 3J7AY 1QPIA 5D5VB 2E1OA 2CUEA 2FBIA 2K5CA 2M7AA 4YG2F 5L3FA 1W0TA 2HGCA 1Y0UA 2CW7A 4FT8A 1LFPA 3SZGA 4FASD 1JE8A 2FXAA 1HC8A 2IA1A 1HOMA 2DOAA 4A0YA 2WADA 3FK6A 4ZDOA 1PYVA 3LA7A 2HR3A 4XL9A 1FTTA 3H3UA 1FYLA 2A6TA 3LSKA 1W36C 1RESA 5EDNA 1ZG1A 2IVMA 2GQQA 3SYTA 3BT9A 4JX6A 2K85A 4J01A 1A6IA 2OQRA 1APLC 3WTWC 1SANA 4XONA 1X58A 2O9LA 4XRMA 3I56I 3JRIA 4GFBA 4L5IA 1Z1DA 2L3DA 3LL7A 4M72A 1ZRFA 2M45A 2W4SA 1O3RA 3EDPA 3OOUA 3BR3A 1IJWC 3OYFA 2AHQA 2HXOA 2V9KA 3RI4A 3FXKA 2LKSA 4JX4A 4BQNA 5IY5H 2OCEA 3L2RA 1LNWA 2E1MB 4AU7A 4HEA2 2OD5A 3ML6A 1V54H 5E79C 2XAJA 2ZMEC 4CCKA 4RMNA 4MTEA 1KU2A 3GTJJ 2VT2A 3K6GA 3MZHA 1MMAA 3VEPA 2EA2A 1PP7U 3K4MA 2BYVE 4P96A 2RKHA 5EG0A 5M3FJ 4XK4A 2FNPA 2LMDA 3V8JA 1FX7A 2V7FA 4AIDA 1TWGJ 2UXXA 3LFUA 4LLNA 2EZHA 4YIRX 3W2WA 2QSFX 1ODDA 2EV0A 2HQ5A 3Q9SA 1R4MB 4BHBA 2CQQA 1I1GA 3GLXA 2KHMA 1DU0A 4HNTA 2ELJA 1HSTA 2FQ3A 4KITB 3FBNB 2HOTA 1R1VA 4IHVA 3GTPJ 1RUNA 1X19A 1T33A 3FKJA 2DO7A 2O3FA 4JYKA 3GO5A 1QZYA 4U88A 3F23A 3DBLB 2CQKA 2RVCA 2QWWA 1SD5A 5GAHJ 2ZB9A 3TW6A 1MKMA 2M8GX 1YJWI 2EFPA 4W97A 5CLSA 1IO2A 4LG0B 4ZC3A 3BR1A 4U7BA 2P4WA 2LK2A 1YITI 4EJTA 5IT9K 4UUSA 2AQEA 4L5JA 2RREA 2A3SA 2XRNA 3CJRB 2KRHA 3HJEA 4XMYA 1ZARA 5FKOA 4AWXB 2ELKA 2LRDA 3I5UA 4BXFA 3TW7A 4NQWB 5B1AH 2H8RA 3OR2C 1X4PA 2CGPA 2BGCA 3MKLA 1FMWA 2QKMB 3JAMZ 1S7OA 3JSPA 1ETXA 2VIXA 2QQBA 1GLNA 4KA4A 1NH3A 3M4OJ 2FX0A 4XOTA 1G2HA 5LRSA 3IKVA 4CHUA 4RGXA 4GCVA 3DEWA 3TOBA 1XX5A 3I3LA 3AAFA 4LB6B 3F21A 2BXYA 4BXUA 2MABA 2JTVA 2ZMEA 4ESBA 3CP2A 2DODA 2XASA 2V6EA 4H4KC 5DDGA 1ZR2A 1V4RA 1FIPA 2LBFA 1YG2A 2JK3A 4M3FA 5L3DA 3L9FA 1VQ5I 1EA3A 2DLLA 1WPKA 1OR7A 2WAQA 2JUGA 1VQ4I 2XHKA 3M9AA 1YX3A 1W5CC 2A68F 2VASA 5FO5A 3HKZN 1SD4A 2W82A 3ZQIA 2EFNA 4LITA 1JHFA 1SFXA 5DUIA 1MD0A 3COAC 1USTA 5FLXZ 1QRYA 5GTIC 1MBEA 3KX2A 3V42A 3VODA 1RRJA 1K6OA 1BI3A 2R7QA 4MHGA 4UHTA 2KIFA 4I98B 3OYMA 1S7AA 3WHCA 1RKTA 2XAHA 1BBYA 4XNFA 3IUOA 4A3MJ 3ECOA 3ISPA 1X4OA 3DEUA 2QKLB 4I0AA 2VQLA 3AFHA 4NNJA 3BC8A 3J7AO 1ULYA 2X51A 5ILVA 2ZJRF 2PLYA 3NWSA 1JKRC 5GAGJ 1J9IA 3ABLH 3TBIA 1LFUP 3IWFA 4II3A 1DQUA 2LREA 2KMUA 1FSEA 4ZTFA 1Z6RA 3OR1C 4I99C 3CCJI 1BC7C 2IGKA 4ZH4F 3S2HJ 2HYGD 1D0YA 2R7OA 2L5QA 4BXXJ 3BCAA 1XGMA 3Q0WA 3RKXA 2MD5A 3R61A 2NS7A 3KFWX 3BTLA 3LA3A 4N9HA 3BZKA 4PGHA 1X2MA 1J75A 3TO9A 3K4CA 2L01A 3R4KA 3ZR8X 3LSJA 2HU9A 3PIPF 1OISA 2DJIA 2I10A 2L2OA 4HV5A 3RPUD 4YRVA 2HDCA 1P4XA 1VQ9I 3C3WA 4IHYA 1W4MA 4IQ4A 5K5QA 2VLAA 4Z2YA 1MBGA 3LSMA 1R71A 2QQ9A 1VZ0A 3LAPA 2NVYJ 1FZPB 5KCMA 3T1BA 2WTEA 2V1NA 4YEJA 2WAEA 3VB2A 1S7EA 4OAZA 1VF9A 4OU0A 1G3WA 1I3AA 4XM3A 5D8KB 5M5YJ 3V8LA 4CH7A 1T6SA 3WU2C 2DQRA 3CUQA 1DDNA 2Y31A 2OU2A 4M9ZA 1OCZH 3OYIA 2M1BA 5A2QK 4EATA 1YJNI 2NVQJ 1SVLA 1OYYA 3BJAA 2LY1A 4D0PA 2LR8A 3A01B 2EFWA 1IN8A 4IRGA 2PN6A 2DT6A 3BR6A 3TKYA 1O3SA 1JJ6C 1I1SA 4MFDA 4EV0A 1U5TA 3ZMVA 2WC2A 4IOCF 5EJCA 3O2PE 3ZQ7A 1POGA 2WB1A 1O3QA 2NAZA 3RSNA 2E1NA 2NVXJ 2ZFWA 2QYOA 2YX4A 3FXUA 2EJRA 5TGTA 4EEFG 2VBWA 4ZJZA 4RM2A 1IAWA 2FU4A 2RDPA 4AD9A 1AOYA 1LJ9A 2LYCA 1S29A 4NC8A 5BPDA 2MSYA 3C2GA 2GA2A 4EM0B 1WJ5A 3FHNA 3WGGA 2Z33A 2DXIA 3J7YJ 4ABZA 2Y0SA 4I01A 2IP2A 2EK5A 4F91B 1MZBA 1WZ2A 5FKKA 3KE2A 4DJAA 2J5PA 2VQCA 2H94A 2G7UA 1WH5A 4RGUA 4AVZA 3F8BA 1JGGA 3C1DA 4G7OF 4Q47A 3DKYA 4KISA 1Z9CA 2ZXJA 1G3TA 3M1EA 5BOXA 4DIQA 4BAYA 1SMTA 4ETSA 1XGOA 2L9RA 3E7LA 2FBKA 2F5VA 1W7PD 4A0XA 4ENMA 2ID6A 4HAMA 4PJ0C 2O61A 1ZG5A 2VC1A 1DPUA 2O03A 3VYRB 3ERED 2GM4A 4RAZA 3HRSA 1OCOH 4Y13A 3J80Z 1B9NA 2V79A 2M0CA 4ZYDA 1F43A 2EFQA 3I64A 1HCRA 4OWRB 2HKOA 5L3BA 3PQKA 4HDUA 1W7PB 3WE3A 2R7VA 3HIFA 1WJEA 4W1UA 3FM5A 2ICWG 5H6QA 4OIOF 3BJ6A 4C2TA 2F4IA 3ZRGA 3S32A 2MC4A 3DPTA 2JSCA 2IPQX 4KDPA 4JP0A 2HS5A 2BE5F 1F36A 3DKXA 2ZXWH 3KP7A 1SFEA 1B72B 4PGGA 1LQ1A 1XMAA 1KONA 2LF8A 1F9NA 1R1TA 4D5FA 1JUMA 3Q0UA 2CW8A 1I50J 4ITVA 4M3EA 4Y3OA 2EB7A 4F3QA 2HVQA 4IVNA 1NHAA 3TGNA 1TTYA 1NG7A 1MBHA 3F9KA 2VUMJ 2FF4A 2XB0X 5D5XB 5LD2C 2MA3A 2XKPA 3KZYA 2GOXB 3H5NA 3CCSI 4CGZA 2FUG2 4GGGA 1ETVA 2ZSIB 1D5VA 4IRIA 1JXSA 4YIFA 1XMXA 5IP7J 3KP4A 1WKMA 4KJZA 1IF1A 2FMYA 2HDWA 5LEJA 1BIAA 1W0UA 5LHIA 2EBIA 2JMWA 1JKPC 1SFUA 2KJCA 3DBRB 5DCMB 1YQAA 3J81K 1NK3P 4A6EA 1YO5C 2J5OA 2K40A 1A04A 5EZHA 5DD8A 5F0HA 1ZAOA 1SD7A 2JA6J 1U6GA 1EV7A 1S9HA 2H8WA 2IS4A 2BY0A 3QOEA 4P5OA 5JVTA 1T98A 1YS6A 3T0YA 5JR3A 3Q9VA 3D0SA 4IHTA 1I6HJ 1EH7A 2LKPA 2MLGA 3GTOJ 5F0CA 1HW5A 5F27A 1E2XA 3V7SA 3PO3J 1WJFA 1ETQA 2DMQA 2VE9A 3DQVC 4M6YA 2KZVA 3BROA 4BUPA 2Z1DA 4M9SA 3OS2A 1OKRA 4P9UA 2LH9A 5B66C 4U0WA 1LVAA 4HQEA 3IAM2 4I7HA 3WGHA 1UHSA 5HS9A 1LEBA 2FA5A 1OMIA 4KT6A 1P7IA 4PJMA 1J59A 3GTLJ 4BQOA 2MD0A 2IGMA 2XGDA 1Z6TA 1Y8QB 4L9VA 1JJ8C 4PCQA 2RAEA 2P0WA 1D5YA 3MMYB 4CA0A 2HXIA 2UUZA 3BTIA 5JLWA 3GW2A 2Z9OA 3WU1B 4A12A 1H89C 1T0FC 2BBYA 1P92A 5KAIC 1YOVB 5K7FA 4JOMA 3PIOF 3CCUI 2E2JJ 4EM1A 3S1RJ 1XD7A 2QENA 1KGSA 1VQ6I 3F22A 1KQ8A 4HZFA 1G6NA 1TW2A 2EZKA 3QYBA 2Z3YA 2DBBA 1U8RA 1TZLA 2CSOA 3GTQJ 1EKEA 3K7AJ 2XVCA 2XGCA 2DMPA 4I0BA 3DF8A 1K4SA 2GXAA 2KLOA 2UXNA 2DA2A 3L2UA 5ILUA 1E17A 1J2XA 2DFHA 1ZKGA 2O6GE 2FMLA 5JHFA 5IP9J 4BL0B 1VQOI 2JUCA 2FE3A 3BR0A 2F5EA 3HRMA 2VT3A 1W36D 2JRMA 5E3MA 1Y56A 1AKHA 1BC8C 1FEXA 3HSEA 3NEUA 2BEOA 4QIWN 2VKVA 4KNYA 3CMYA 3LQRA 4HF0A 4QSHA 3VFZA 3W2VA 2ZSHB 3OYDA 3WTTC 2DPDA 3LNQA 1RNLA 3I71A 2DA4A 5FD5A 3GFIA 3L00A 1HF0A 3BZ6A 1LFBA 2HTJA 3ASOH 5ICFA 1YRNA 1YLFA 1ZYRF 4LIUA 2W24A 3D5LA 2QCOA 4UUSB 2JZYA 1JKOC 3M1CA 2QUFA 2X4HA 3QODA 3K1MA 4XKCA 3QAHA 3JRFA 2IRFG 4R8HA 3ZMZA 2CS3A 2V1XA 2ID3A 5LLQA 1WVRA 3OOPA 2OAZA 1WHUA 1FOWA 2Z99A 3S2DJ 2TDXA 2RN7A 3OV8A 2YU9J 3NQOA 4HA8A 2R5ZA 2LVSA 2X1DA 2ZMEB 4UUTA 5LEKA 2PFBA 1TQIA 1IN7A 1RI7A 3RDIA 1Q1VA 2XDVA 2A61A 2CFOA 1FBQA 5D5UB 3CMAI 2QSHX 2Q2EB 4RM3A 5HDNA 3M8EA 3ONQA 3ZQGA 1FTZA 4XQFA 4AYBN 4N4NB 1RPWA 2HOAA 4OINF 3GWZA 2R7UA 3N05A 3I55I 3DLLF 1TQPA 4AIHA 4F52A 2M30A 2EIJH 4S05A 2UZKA 4HLXA 4N0BA 2ISZA 4XOPA 4Y17A 3PUFA 4CCOA 1UFMA 4G12A 2VJ5A 3KZZA 2CV0A 5FRMA 1Y1VJ 2NRAC 3KP2A 3RQIA 2DFIA 4P9FA 3H0DA 3JRCA 1JT6A 5L3CA 3P9KA 1YW7A 1ZGAA 3WTVC 3CLOA 2OF7A 3MAJA 2XROA 1XMKA 3WTZA 3VSKA 1YW8A 5JLXA 4CDGA 1EH6A 1AWCA 3LSRA 2AXTC 1VI0A 3ZQFA 1SVOA 4HW0A 1ZQ3P 4B09A 4YFXF 1FIAA 2X48A 3SEQA 3OYKA 5TISC 3GTMJ 5BS6A 1MH4A 1MBKA 3CC7I 3S17J 2ZXIA 3BTCA 1U78A 4WXCA 4KMUX 3HPHA 3G1OA 1IN5A 1Q1HA 2Y30A 2DYSH 1H8AC 2PI0A 4KFCA 4BYYA 1SC7A 3BG7A 4Y7NJ 4G6DA 2XAQA 3S14J 3RZOJ 3KP3A 2DT5A 5E1WA 4C2UA 3ZMUA 4D7NA 4DYRA 2JVHA 5D4RA 4RAFA 4L0ZB 4BJTA 4BACA 2VKEA 3RKWA 2FBHA 1UAAA 5FB2A 5IOZA 3C7JA 3QYFA 3GX4X 2C6YA 3OYEA 4IHSA 4KICA 3OIPA 3WTUC 1IRGA 1JI8A 1FP2A 1R49A 2KISA 4HYEA 4G94A 4XICA 3JRDA 4HQMA 3FXRA 2OC6A 5HLTA 1VQPI 3P9CA 3BY6A 5K5OA 4FISA 4E7IA 2JSPA 2R7WA 2E71A 3GZ5A 5DUKA 2MH9A 1J5YA 1ZELA 2L7KA 2KIMA 3C2BA 3JSOA 1OR7C 3WG9A 1IN4A 2LDUA 1WQ2A 2XIGA 3VPRA 3ZMTA 1MNDA 3BPXA 3QWLA 2HZDA 5J4YA 3PO2J 1NK2P 2MW8A 4R79A 4XLPF 1YHQI 1QU3A 3DXJF 2GLOA 3HUGA 2VOPA 4IEJA 2OBPA 2LY9A 4CO8A 2K7LA 4NUBA 1B8IA 1UHWA 3MZYA 1PUEE 2CMPA 1ORKA 4XSZF 2HFHA 2CQXA 2DA1A 4I09A 4KMFA 4QPOA 1D8JA 2E19A 3VYTB 4EJOA 2DK8A 1JT0A 4PSXA 1GVDA 2WY7Q 1XSVA 2D45A 3JAMK 2NOJB 4XSXF 4IHWA 1ZN2A 4XKBA 4BJ6C 2DN0A 5ED4A 3S3MA 3M8FA 5DM6F 4XORA 1IUYA 1T8IA 3G2BA 2LP0A 1OJLA 2IW5A 3U2RA 4B3AA 3DTEA 1KYZA 1W1WE 2LY2A 1WJCA 1B9MA 4BS9A 3NARA 1HKQA 2OTJI 4J00A 3WTXC 3LQQA 2W1OA 3HGYA 1OCCH 4XRFA 3HRTA 3KPHA 3JW4A 2OZUA 1HKTA 3KZIC 1K61A 4XKVA 3IWZA 1XS9A 3A2KA 1D1AA 5F04A 1DPRA 3HOZJ 1TWAJ 3KEOA 5D5WB 4BEHA 3Q3SA 3S1QJ 2ZO4A 3HOXJ 1FY7A 5GPCA 5IT9Z 1IRXA 1JHHA 2FJ1A 2QBYB 5J3LA 4AM3A 1TW3A 2M7BA 5J1RA 4S04A 2WAFA 3IRQA 1MDMA 3LAJA 4ENJA 4CSWA 2CWEA 3G71I 2R5YA 1BOBA 2F5DA 3RPQA 1N78A 5FKLA 2K9NA 3CUQC 4HSTA 2JPCA 4Q4ZF 1BJZA 2HEOA 1MGTA 1WFXA 1BR2A 2YX7A 5B3SH 3GXOA 3OY9A 4E7LA 2PJPA 5ILSA 4QWQA 2FD5A 1X2NA 2Q0OA 3HTUA 4CYCA 1KA8A 4G6QA 1U5TC 4C30A 2BVMA 5KAFC 1VFCA 1SAXA 1Z3XA 1A36A 4EQQA 2XRLA 2KJBA 2UV1A 5IYDJ 3CCEI 2O8XA 2YUSA 3H0GJ 4IL6C 5FROA 3HDDA 4BE2A 1N75A 1Z77A 2M3AA 1K78B 3GYHX 1PUFA 2VJJA 1MMNA 2MH2A 3V8KA 3DPLC 3M3YJ 1EH8A 2VXZA 4ZDPA 5E1ZB 5GPAA 1D0XA 2PJRA 3ROUA 4DBQA 5B5EC 2HQRA 5C3EJ 3GVAA 3PM1A 1MBFA 1UELB 4MTDA 1BM9A 4FETA 2XB5A 3H92A 1DP3A 3VWBA 2VPLA 3EQLF 2LOOA 2KRCA 1BL0A 4BE1A 3N4MA 4BY1J 1ON1A 2BZTA 2DQLA 1RUOA 3BG9A 1ETOA 4EJUA 2YSRA 5E8GA 1JTXA 3MVPA 3F6OA 5CJ9A 3FBIB 2GZWA 3OYBA 3CDIA 3PFYA 1G4DA 3PNYA 3WE2A 3T8RA 4ENNA 1STZA 2ADUA 4YELA 3BOQA 4D1QA 1PDNC 4F93B 2BW3A 3T5XA 5C4JJ 3SFIA 3L2CA 2KZGA 3CCVI 4TV7A 1V55H 2G9WA 4GXOA 1BR4A 5D6FA 3ABKH 2HOSA 2GXBA 1TBXA 3PL8A 3QPLA 5CYVA 4CXFA 3EUKL 3RCOA 3BG6A 2E36A 4QLCU 2VONA 2XAUA 2W48A 1G59A 2X6YA 2ZBKA 2V9VA 2R4GA 2DA5A 4FQGA 1W5SA 2DMUA 3WG7H 5DS9A 2IXSA 1Y8RB 3K2ZA 5E3NA 5E8IA 3HHGA 3HPGA 1LVKA 4N9IA 4BHPA 1HXDA 2IBDA 3CCMI 1LE8B 2E1CA 2R3SA 5E18F 4XR6A 2CW0F 4XLCA 3GF2A 2XF6A 2HVSA 2R7DA 1XGNA 1ON2A 4LD5A 3OL4A 5D6EA 1IDZA 2VQHA 5DEQA 3ABMH 4DYCA 2XSDC 5FFZA 1PP8F 3PNVA 5ICGA 3OIQA 2CG4A 5KK1A 2X0LA 3BDDA 1RETA 3BQZA 1I27A 1DGRM 1I3QJ 4CCMA 4RB0A 1RC9A 1QVUA 3HXLA 4M6VA 4N4OB 2M0MA 3F8MA 1QO0D 4KUMA 1R6RA 5CVJA 3HB9A 2CQ7A 2CU7A 4GYGA 2DJNA 3TDUC 5H2FC 3I53A 3A0HC 2K3FA 3CUOA 1YI2I 1WH7A 1RKWA 2DOEA 1FP1D 5LGNA 3R6SA 1FC3A 3SZTA 4AIKA 2BXZA 4IJAA 5IOYA 3CO7C 1SEUA 1IW7F 1R23A 4G7ZF 5GP9A 2LFBA 1QHGA 3J80K 2JQ7A 1WSUA 2LC2A 4A3KJ 3OL3A 2R93J 1X1AA 1LDDA 2JA5J 1IGNA 2CRGA 2R7ZJ 5F6FA 5TRDA 2EZIA 3E5QA 3K2AA 2VB6A 3HEFA 5EZGA 4AYBA 2ME6A 2PMHA 1O7FA 2QLZA 4PDKA 5TJJA 5EGOA 3OSFA 3F8CA 1H88C 5E1XA 5L3GA 1Y6IA 4B47A 2WV1A 2A05A 1AHDP 4Y52J 3FMSA 4V2FA 1UG2A 3RKYA 3TP3A 3I0TA 2R0QC 3PQJA 1V3FA 1Y0NA 3I9V2 1JKQC 2XGEA 1ETKA 3CESA 3IC7A 3JTHA 4OMZA 2XSJC 5DD4A 1SVMA 1YE9A 4IQJA 4A3CJ 1G3SA 2KDOA 2KIUA 5K7HA 1OQYA 4BNCA 1MW7A 1XDUA 4D5CA 3I4NJ 2QM3A 2L54A 3E6MA 2LNBA 3G1LA 4JK1X 2JJ7A 4UB6C 1BOAA 3GBGA 4IX7A 1YRNB 1IDYA 4UXNA 3KIOA 3FMQA 1UJ8A 4EMSA 3EUHA 2AS5F 3M7GA 5HLGA 1T2KA 4RB1A 3AG1H 3NRVA 1TT5B 3B73A 1SFOJ 2KIQA 4FHTA 4A5MA 5F1RA 4XKWA 4RLFA 2FEZA 1TQMA 1X1BA 2MC3A 1A5JA 5JI6A 4E7KA 4EM2A 4MEXF 1YIOA 4LB5A 3K0LA 2Y9YA 3DTIA 2X6XA 4LK0F 3TP0A 1ETWA 2R7FA 4L0YB 2R5ZB 2DDBA 3I4PA 4WK8F 3AL0B 1TLHB 2VBYA 2KRFA 2MG4A 5AIPA 2EFOA 2P6SA 1UG0A 3CDLA 1D3YA 3HSRA 4IPAA 1SFKA 5F08A 1GV5A 2PMZN 1D1BA 3ELKA 3OMYA 2ZJQF 2XPVA 4UVAA 3BG3A 5CVVA 2CQNA 1MNEA 2GAUA 1U3EM 1MBJA 2CO5A 4X6AJ 1MMDA 4L9NA 3BQYA 1WI9A 1V5EA 1OYIA 1RR8C 3VOEA 2HPMA 3SQNA 1X1DA 4A69C 1YX5A 4U87A 2VN2A 3W3CA 3LSGA 2TCTA 2QF7A 3QQAA 3IKTA 2FRHA 5BMZA 2K4BA 2M4KA 4B4CA 2WBMA 3QU6A 4U0YA 2K27A 4EVIA 2L7FP 3CCQI 3S2WA 1I6XA 2VODA 1FOXA 3HOUJ 3TOAA 3KETA 1T39A 5EYRA 1XCVA 2X1CA 3ZMSA 3FXLA 2IAIA 2B9SA 2L7MP 2NS8A 1XG1A 4I02A 4XLFA 3SFZA 2MGQA 3H9JA 1MMSA 5KNLA 2HQNA 4M9XA 3CF5F 1BI1A 3RPUA 3KYCB 1UB9A 2L9VA 1TWFJ 4IO9F 4A3JJ 2ZC2A 5ICEA 4UY8I 2DMTA 2K9QA 5ERIA 2L02A 4M6XA 1FWZA 4E7JA 3AG4H 3R0AA 1OCPA 4U7DA 3ESWB 3A01A 4L18B 1BJAA 3CQZJ 3TDZC 1ZR4A 1X1PA 2DA3A 4IXAA 3K4NA 4OOIA 1DU6A 4IRHA 3VYUB 1HW2A 4GYIA 3HL2A 4PZJA 5J1YA 3H35A 2M8EA 2PX9A 1TNSA 3JREA 3CO6C 2R7RA 3DKWA 1IV8A 3D1NI 2V6CA 1KZHA 4XLHA 1YFHA 4KN4X 3SHFA 1U9NA 1V5GA 2G0EA 4M74A 3AL0C 2ZXHA 1LEAA 3QPTA 5HDGA 1YW9A 4CCNA 1R9TJ 3PFIA 3KP5A 1FBSA 3K4JA 5EG0B 2OTLI 4YFNF 5F0FA 3UNGC 3IL2A 3QP6A 3C2HA 1YTYA 3ABUA 1BA5A 1Y1WJ 2IS1A 2COMA 1GVJA 5AONA 4HRIA 5FGMA 5J4VA 5JHUA 2A5YB 1SD6A 3K4BA 1MJBA 1ZTRA 3ZXSA 1IUFA 1WRJA 2BY3A 2DCEA 3ECHA 4F7ZA 1WJAA 4B1RA 4E7HA 2D1HA 2GA1A 2O0YA 3M07A 2JVGA 4RS8A 2R7TA 4BY7J 1OCTC 2KP6A 2GIVA 1DP7P 1ZREA 3QOPA 3TL4X 2BVLA 5C4XJ 1CGPA 3OIOA 1TWHJ 5FFXA 1T56A 2XF7A 2E5ZA 3P5JA 1B4AA 3CDHA 3OS1A 2YU3A 3VDXA 4A3LJ 1HDPA 1HLVA 3CMMA 2XF5A 4HBLA 1HQCA 1R00A 1OPCA 1PJRA 2IA2A 1ZRDA 5CKTA 3S16J 3ZN1A 2HVRA 3VSLA 1TT0A 1W7PA 4LGWA 5JVGF 3M8JA 2K4JA 1HBXG 5HS8A 1VQNI 1ITYA 1E0EA 1FPQA 1IRFA 1ZHFA 1A6QA 2L4AA 3T8TA 2DDAA 3FXJA 1VQKI 2W84A 1S6LA 5LRRA 1VTNC 1RZ4A 2IS6A 2H1KA 3PNTA 1HSJA 3GFMA 1QGPA 4HV6A 1YS7A 2MFZA 2TRTA 1WJDA 3E0JB 2VE8A 1ZG3A 2Y75A 3BLYA 3SEZA 1B72A 4GDFA 3I54A 1FNNA 3HSFA 1S3JA 2V26A 2JT1A 3RYRA 4BHCA 4CZZA 4ENKA 1C0WA 4RAYA 1S8NA 3E3VA 2IGOA 4O6JA 4UV9A 2GBYA 3FMRA 4A3IJ 2B7EA 1TNTA 3RZDJ 4BBRJ 5F1JA 2A07F 3UR3C 4OAYA 3HG9A 4BEHB 3E6CC 4B3XA 1TC3C 1IXRC 2LBFB 3H5RA 2PMUA 3RQ4A 1IXCA 2Q8KA 2P7CB 4E70A 2LD5A 2MBFA 2HPIA 2A5WA 4C3IJ 4HG2A 4D7MA 2R5YB 2JA7J 1XN7A 3EETA 3CCRI 2P5LC 4A2UA 3G73A 1LDJA 4PJLA 2VJ4A 4CCJA 1ZH5A 2JN6A 3FF5A 3MKWB 4ZZDA 4GO1A 5HLHA 2RC4A 4G8XA 3AKZA 5GTHC 4HX4A 3IV5A 3BR2A 3HRUA 1D8KA 1KU3A 2Y0MA 2KPMA 5EEGA 4CYCB 3OYJA 5M5XJ 3JCUC 2RNJA 5GADJ 4MLOA 1VQMI 3EYIA 3CCYA 4UV8A 5LHHA 1E3OC 5JFRA 3DWLE 4KIFA 1DGWY 5M5WJ
chains in the Genus database with same CATH topology
2GXGA 2NNYA 1IZ1A 1KQ9A 3GFJA 1O57A 2DW4A 2JPBA 5E17F 2HYFA 4WX9A 4OIRF 6PAXA 3TQNA 4KT5C 5HOOA 2CFXA 4RB3C 2QZ8A 1P6RA 3V7CA 4HX7A 3LA2A 5DV5A 2ESNA 2P8TA 2P5VA 1CF7A 3O6BB 2V1DA 4H0EA 3TO7A 1XCBA 4ESFA 3E5XA 3MEXA 3FHZA 4A5NA 1R5HA 2DAOA 1ZLKA 4JQFA 3CUQB 4G9YA 2V1UA 4ON0A 2QVOA 3I59A 2ZKZA 3LWFA 1U5TB 4ZYGA 5BPIA 3GFLA 1P4WA 4LLLA 1J0RA 4A0ZA 3FWEA 2ACJA 1HKSA 1BIBA 1QPMA 3MCZA 2ETHA 1REPC 4MEYF 1MJ9A 5E20A 3RYPA 1FBUA 4M73A 3R0JA 1KYWA 5D4SA 2ZCWA 3BPVA 1XGSA 5D8LB 4HOBA 4ASNA 2HOEA 3HYIA 4DNCA 5HVQC 4EGYA 3HTSB 3KLOA 3LFKA 2HKXA 5J8CA 2W25A 2XAFA 3FZVA 3MFKA 2A6EF 4P55A 2IT0A 1K7AA 3KLNA 2VC0A 5FLXK 1L0OC 5CVIA 1Z05A 3HHHA 3ZMDA 4LLGF 2DU9A 5KVRA 4IF4A 1I5ZA 1MJAA 2H6BA 3BJOA 1HW1A 2Q2EA 2BV6A 4EGZA 4BH9A 1GXQA 3DFGA 1ZLJA 1IXSB 1KQ0A 1GXPA 1BN5A 2OQGA 4EJVA 4EJWA 4ESJA 2K02A 1H9GA 3V7RA 5BQTA 5H20A 4HF1A 4HF2A 4A6DA 1QNTA 4XLNF 2JRTA 3REOA 5LGUA 1R36A 2VBZA 1R1UA 2RV8A 2E7XA 2ESHA 3P7NA 4Q5SF 1KU9A 1FLIA 3WTYC 4OIPF 3Q5FA 1QZZA 5L3EA 4UVCA 1SMYF 2F5FA 2M5WA 3WODF 4BQAA 3N97A 2H27A 2RQPA 3HOSA 4OIQF 2DTRA 2P5KA 2IJLA 3E5UA 5CVUA 5HLIA 1FOKA 1IN6A 1R22A 2XAGA 2DPUA 4L9JA 3QPHA 1DUXC 2W85A 3MWMA 4KYWA 3C18A 2STTA 3P9IA 4ZZLA 4RB2C 4FX0A 2A69F 2RGVA 3QRFF 3G3ZA 2B0LA 3BP8A 3TO6A 1XSDA 1L3LA 3E6DA 1Z7UA 3MQ0A 1F4KA 3WTSC 3IRRA 4WXDA 3RIRA 5A2QZ 3CJNA 5IT3A 1ZRCA 3V4GA 4B8XA 4MNUA 1W5TA 4WXHA 2ZNZA 2DI3A 3ABTA 4LG0A 1F1ZA 2W57A 4K2EA 1FT9A 2PBIA 4YFKF 4NQWA 1USSA 3KEQA 3KCCA 2YPRA 3BWGA 1H0MA 1QBJA 3ULQB 2KKOA 1QQIA 3ZP5A 2ISYA 3DV8A 3RJPA 5LGTA 1O3TA 1BI0A 3FM3A 1B6AA 4RGSA 3QP5A 3RTRA 4ZYHA 2MLKA 2K86A 3K1PA 3F8FA 2XUBA 4R1HA 3ZN0A 2F2EA 3W6JB 1R58A 1B1BA 3FXQA 2DK5A 3F3XA 4LK1F 2QBYA 2FSWA 1XDSA 4WWCA 4JBAA 4OMYA 3QU3A 4UVBA 4L9TA 4ZYEA 4WF2A 1RIOH 2CYYA 4HX8A 2EV6A 5K1YA 4O3MA 4KIGA 4AVPA 1K78A 3GUDA 4U0VA 4RGRA 1K79A 2A6HF 3K69A 3W6KB 2LF7A 4FX4A 3K1NA 1JGSA 3SXYA 1G3YA 2ZJ2A 1XSXA 5HS7A 2EA4A 4UNOA 5CVRA 2FOKA 1GHCA 2HTSA 5LHGA 2NNNA 2OA4A 3HOTA 2XGXA 3WGIA 4I2OA 1O7LA 4KN7X 3J81Z 2EV5A 4LJZF 3E6BA 2VBXA 2D1VA 3CTAA 1P2FA 2VOOA 1B59A 3F6VA 2XKOA 5J8FA 4Q48A 2H6CA 1OYWA 4HDVA 2EWNA 4UUVA 2QQAA 4MQ9F 4CICA 1CF7B 1FSHA 2YR2A 3DP7A 4CYDA 3L09A 4M71A 5FD6A 2GWRA 4NB5A 2P6TA 3ZPLA 1ZGJA 2NYXA 2HZTA 1R5GA 4AIJA 4MGRA 1WWXA 5DYMA 2STWA 5H6RA 4LMYA 3JTGA 2IA0A 2AXLA 3I59B 4XBFA 3O3KA 2H09A 4Y15A 2PEXA 2F5CA 3L7WA 3IHUA 2E7WA 1J7KA 4WCGA 2Y48A 5LBQA 3SZPA 2ELHA 1R7JA 3F72A 3F8NA 3FX3A 1ONVA 1LB2A 4G7HF 4HLYA 2NS0A 4NHJA 5K5RA 5HDKA 3H3ZA 4O5VA 1H9TA 1KU7A 2Z5UA 2OZ6A 1T38A 2WWYA 1F5TA 1FYKA 2G7HA 4YIIA 4KIBA 3I58A 1UCRA 1YYVA 1UHMA 3B02A 3LSTA 4DQ2A 3GZ6A 1FYMA 3GEZA 1T0FA 2XV4S 5AIQA 2D2WA 4LFUA 1Z91A 1U2WA 2PG4A 2PQ8A 3U1DA 1MDMB 2FNAA 1P4AA 3E97A 2P7VB 3WU0A 4MQVA 5F64A 1LDKB 3R60A 5DCMA 1XB4A 5EEHA 5ICCA 3U9GA 2L4MA 1X3UA 5DCFA 2M87A 2HWVA 2UWMA 2ZNYA 3K9TA 3EYYA 3KP6A 1BI2A 5J6XA 2LSOA 2WV0A 5D5VB 2FBIA 5L3FA 4YG2F 2HGCA 1Y0UA 4FT8A 1JE8A 2FXAA 2IA1A 4A0YA 3LA7A 2HR3A 3H3UA 1FYLA 1ZG1A 2IVMA 2GQQA 2OQRA 3WTWC 4L5IA 1Z1DA 2L3DA 4M72A 1ZRFA 2M45A 1O3RA 3EDPA 3RI4A 1LNWA 2OD5A 3ML6A 2XAJA 4MTEA 1KU2A 2VT2A 3MZHA 3VEPA 2EA2A 1PP7U 2BYVE 4P96A 2RKHA 2FNPA 3V8JA 1FX7A 2UXXA 4LLNA 1ODDA 2EV0A 3Q9SA 4BHBA 1I1GA 3GLXA 1HSTA 2FQ3A 1R1VA 1RUNA 2DO7A 2O3FA 3GO5A 1QZYA 4U88A 3F23A 2CQKA 2RVCA 2QWWA 1SD5A 1MKMA 2EFPA 5CLSA 4LG0B 4U7BA 2P4WA 4EJTA 5IT9K 4L5JA 2A3SA 2XRNA 4AWXB 1ZARA 3I5UA 2CGPA 2BGCA 3JAMZ 1S7OA 3JSPA 4KA4A 2QQBA 5LRSA 3IKVA 4CHUA 4RGXA 4GCVA 3TOBA 3AAFA 4LB6B 3F21A 4BXUA 2JTVA 2ZMEA 4ESBA 2XASA 5DDGA 1V4RA 1YG2A 5L3DA 3L9FA 2DLLA 1OR7A 2XHKA 3M9AA 2A68F 5FO5A 1SD4A 2EFNA 1JHFA 1SFXA 5DUIA 1MD0A 3COAC 1USTA 5FLXZ 3VODA 1K6OA 1BI3A 4MHGA 4UHTA 2KIFA 4I98B 1S7AA 2XAHA 1BBYA 3ECOA 3ISPA 3DEUA 4I0AA 3J7AO 1ULYA 5ILVA 2PLYA 1J9IA 3IWFA 1FSEA 1Z6RA 1BC7C 4ZH4F 2HYGD 1XGMA 3RKXA 2MD5A 3R61A 3KFWX 3LA3A 4N9HA 4PGHA 1J75A 3TO9A 2L01A 3R4KA 4HV5A 2HDCA 1P4XA 3C3WA 1W4MA 5K5QA 4Z2YA 2QQ9A 3LAPA 1FZPB 3T1BA 2WTEA 3VB2A 4OU0A 1G3WA 5D8KB 3V8LA 1T6SA 2DQRA 3CUQA 1DDNA 2OU2A 4M9ZA 2M1BA 5A2QK 3BJAA 1OYYA 4D0PA 2EFWA 1IN8A 4IRGA 2PN6A 3TKYA 1I1SA 1O3SA 4EV0A 1U5TA 3ZMVA 2WC2A 3O2PE 3ZQ7A 1O3QA 2NAZA 2E1NA 2ZFWA 2QYOA 2YX4A 3FXUA 2EJRA 2VBWA 1IAWA 2FU4A 2RDPA 4AD9A 1AOYA 1LJ9A 1S29A 5BPDA 2GA2A 4EM0B 3WGGA 2Z33A 4I01A 2IP2A 2EK5A 1MZBA 3KE2A 2J5PA 2H94A 2G7UA 4RGUA 3F8BA 3C1DA 4G7OF 4Q47A 1Z9CA 2ZXJA 1G3TA 3M1EA 5BOXA 4BAYA 1SMTA 4ETSA 1XGOA 2FBKA 1W7PD 4A0XA 4ENMA 4HAMA 2O61A 1ZG5A 2VC1A 1DPUA 2O03A 3ERED 4RAZA 3HRSA 4Y13A 3J80Z 1B9NA 2V79A 4ZYDA 2EFQA 3I64A 2HKOA 5L3BA 3PQKA 4HDUA 1W7PB 3WE3A 3HIFA 3FM5A 5H6QA 4OIOF 3BJ6A 3DPTA 2JSCA 2IPQX 4KDPA 2HS5A 2BE5F 3KP7A 1SFEA 4PGGA 1LQ1A 1XMAA 2LF8A 1F9NA 1R1TA 2EB7A 4IVNA 1NHAA 3TGNA 1TTYA 2FF4A 5D5XB 2MA3A 2XKPA 3KZYA 4CGZA 4GGGA 1D5VA 4IRIA 1JXSA 4YIFA 3KP4A 1WKMA 1IF1A 2FMYA 5LEJA 1BIAA 5LHIA 1SFUA 2KJCA 5DCMB 1YQAA 3J81K 4A6EA 1YO5C 2J5OA 1A04A 5DD8A 1ZAOA 1SD7A 1U6GA 1EV7A 4P5OA 5JVTA 1YS6A 1T98A 3T0YA 5JR3A 3Q9VA 3D0SA 4IHTA 1EH7A 2LKPA 2MLGA 1HW5A 1E2XA 3V7SA 2VE9A 3DQVC 4M6YA 3BROA 4M9SA 1OKRA 4P9UA 4U0WA 1LVAA 4HQEA 4I7HA 3WGHA 5HS9A 1LEBA 2FA5A 1OMIA 1J59A 1Z6TA 4L9VA 4PCQA 3GW2A 2Z9OA 3WU1B 4A12A 2BBYA 1P92A 4EM1A 1XD7A 2QENA 1KGSA 3F22A 1KQ8A 4HZFA 1G6NA 1TW2A 2Z3YA 2DBBA 1U8RA 2CSOA 2XVCA 4I0BA 3DF8A 2UXNA 5ILUA 1E17A 1J2XA 2O6GE 2FMLA 2FE3A 2F5EA 3HRMA 2VT3A 1BC8C 3HSEA 3NEUA 2BEOA 4KNYA 3LQRA 4HF0A 3VFZA 3WTTC 2DPDA 1RNLA 3I71A 5FD5A 3GFIA 3L00A 3BZ6A 2HTJA 5ICFA 1ZYRF 1YLFA 2W24A 3D5LA 2JZYA 2QUFA 2X4HA 3K1MA 3QAHA 2IRFG 4R8HA 3ZMZA 2V1XA 5LLQA 3OOPA 2OAZA 2Z99A 2TDXA 2RN7A 3OV8A 3NQOA 4HA8A 2ZMEB 5LEKA 2PFBA 1TQIA 1IN7A 1RI7A 3RDIA 2A61A 1FBQA 5D5UB 5HDNA 3M8EA 4OINF 3GWZA 1TQPA 4AIHA 2M30A 4S05A 2UZKA 4HLXA 4N0BA 2ISZA 4Y17A 1UFMA 3KZZA 2NRAC 3KP2A 2DFIA 4P9FA 5L3CA 3P9KA 1YW7A 1ZGAA 3WTVC 3CLOA 3MAJA 2XROA 1XMKA 3WTZA 1YW8A 4CDGA 1EH6A 1AWCA 4HW0A 4B09A 4YFXF 5BS6A 1U78A 4WXCA 4KMUX 1IN5A 1Q1HA 2PI0A 4KFCA 4BYYA 4G6DA 2XAQA 3KP3A 2DT5A 5E1WA 3ZMUA 5D4RA 4L0ZB 3RKWA 2FBHA 5FB2A 3C7JA 3GX4X 2C6YA 4IHSA 4KICA 1IRGA 3WTUC 1FP2A 4HYEA 4G94A 4HQMA 3FXRA 3P9CA 3BY6A 5K5OA 3GZ5A 5DUKA 2MH9A 1J5YA 2KIMA 3JSOA 3WG9A 1IN4A 2LDUA 1WQ2A 2XIGA 3ZMTA 3BPXA 4R79A 4XLPF 3DXJF 3HUGA 2VOPA 2OBPA 4CO8A 2K7LA 1PUEE 1UHWA 3MZYA 4XSZF 2HFHA 4I09A 4KMFA 1D8JA 4EJOA 2DK8A 1XSVA 2D45A 3JAMK 4XSXF 5ED4A 1ZN2A 3M8FA 1IUYA 2IW5A 3U2RA 1KYZA 1B9MA 1HKQA 3WTXC 3LQQA 4XRFA 3HRTA 3JW4A 2OZUA 1HKTA 3IWZA 1DPRA 3KEOA 5D5WB 2ZO4A 1FY7A 5IT9Z 1JHHA 2QBYB 1TW3A 4S04A 3IRQA 1MDMA 3LAJA 4ENJA 2CWEA 2F5DA 3RPQA 3CUQC 2JPCA 4Q4ZF 2HEOA 1MGTA 2YX7A 3GXOA 2PJPA 5ILSA 4QWQA 2Q0OA 3HTUA 1KA8A 4G6QA 1U5TC 1SAXA 4EQQA 2KJBA 2O8XA 1K78B 3GYHX 2MH2A 3V8KA 3DPLC 1EH8A 2VXZA 5E1ZB 3ROUA 2HQRA 3GVAA 4MTDA 1BM9A 3H92A 3EQLF 3N4MA 1ON1A 1RUOA 2DQLA 4EJUA 2YSRA 5E8GA 3F6OA 5CJ9A 2GZWA 1G4DA 3WE2A 3T8RA 4ENNA 1STZA 2ADUA 3BOQA 1PDNC 3T5XA 3L2CA 4TV7A 2G9WA 4GXOA 5D6FA 2GXBA 1TBXA 5CYVA 4CXFA 4QLCU 2VONA 2ZBKA 2V9VA 1W5SA 3K2ZA 5E8IA 3HHGA 4N9IA 4BHPA 1HXDA 2E1CA 2R3SA 5E18F 2CW0F 3GF2A 2R7DA 1XGNA 1ON2A 4LD5A 5D6EA 5DEQA 5FFZA 1PP8F 5ICGA 2CG4A 5KK1A 2X0LA 3BDDA 1I27A 4RB0A 3F8MA 1QO0D 4KUMA 5CVJA 4GYGA 3TDUC 3I53A 3CUOA 1FP1D 5LGNA 3R6SA 1FC3A 3SZTA 4AIKA 4IJAA 3CO7C 1IW7F 1R23A 4G7ZF 3J80K 1WSUA 1LDDA 5F6FA 5TRDA 3E5QA 2PMHA 1O7FA 2QLZA 4PDKA 5TJJA 3F8CA 5E1XA 5L3GA 3FMSA 3RKYA 3I0TA 3PQJA 1V3FA 4OMZA 3IC7A 3JTHA 5DD4A 1G3SA 2KIUA 4BNCA 1XDUA 2QM3A 2L54A 3E6MA 2LNBA 4JK1X 1BOAA 4UXNA 3FMQA 4EMSA 3EUHA 2AS5F 3M7GA 5HLGA 1T2KA 4RB1A 3NRVA 3B73A 4FHTA 4A5MA 5F1RA 2FEZA 1TQMA 2MC3A 5JI6A 4EM2A 4MEXF 1YIOA 4LB5A 3K0LA 4LK0F 2R7FA 4L0YB 4WK8F 3I4PA 1TLHB 2VBYA 2KRFA 5AIPA 2EFOA 2P6SA 1D3YA 3HSRA 4IPAA 3ELKA 4UVAA 5CVVA 2GAUA 1U3EM 2CO5A 4L9NA 1WI9A 1OYIA 3VOEA 3SQNA 2VN2A 3IKTA 2FRHA 5BMZA 2K4BA 3QU6A 4U0YA 2K27A 4EVIA 3S2WA 1I6XA 2VODA 3TOAA 3KETA 1T39A 1XCVA 3ZMSA 4I02A 3SFZA 2HQNA 4M9XA 1BI1A 3RPUA 1UB9A 5ICEA 5ERIA 2L02A 4M6XA 1FWZA 3R0AA 4U7DA 4L18B 1BJAA 3TDZC 4IXAA 4OOIA 4IRHA 1HW2A 4GYIA 4PZJA 2M8EA 1TNSA 3CO6C 3DKWA 2V6CA 1YFHA 4KN4X 3SHFA 4M74A 1LEAA 3QPTA 5HDGA 1YW9A 3PFIA 3KP5A 1FBSA 4YFNF 3IL2A 3QP6A 1YTYA 3ABUA 2COMA 1GVJA 5AONA 5FGMA 5JHUA 2A5YB 1SD6A 1MJBA 1WRJA 3ECHA 4F7ZA 2D1HA 2GA1A 2O0YA 4RS8A 2GIVA 1DP7P 1ZREA 3QOPA 1CGPA 5FFXA 1B4AA 3CDHA 2YU3A 4HBLA 1HQCA 1R00A 1OPCA 2IA2A 1ZRDA 3ZN1A 1W7PA 4LGWA 2K4JA 1HBXG 5HS8A 1FPQA 1IRFA 1ZHFA 2L4AA 3T8TA 2W84A 1S6LA 5LRRA 1VTNC 1RZ4A 1HSJA 3GFMA 1QGPA 4HV6A 1YS7A 2VE8A 1ZG3A 2Y75A 3I54A 1FNNA 3HSFA 1S3JA 2JT1A 3RYRA 4BHCA 4CZZA 4ENKA 1C0WA 4RAYA 1S8NA 3E3VA 4O6JA 4UV9A 3FMRA 1TNTA 2A07F 3E6CC 1IXRC 2PMUA 1IXCA 2Q8KA 2P7CB 4E70A 2MBFA 1XN7A 3EETA 2P5LC 4A2UA 3G73A 1LDJA 1ZH5A 3FF5A 4ZZDA 4GO1A 5HLHA 2RC4A 4G8XA 4HX4A 3HRUA 1D8KA 1KU3A 2Y0MA 5EEGA 2RNJA 3EYIA 4UV8A 5LHHA 5JFRA 4KIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GXG A;  2NNY A;  1IZ1 A;  1KQ9 A;  3GFJ A;  1O57 A;  2DW4 A;  2JPB A;  5E17 F;  2HYF A;  4WX9 A;  4OIR F;  6PAX A;  3TQN A;  4KT5 C;  5HOO A;  2CFX A;  4RB3 C;  2QZ8 A;  1P6R A;  3V7C A;  4HX7 A;  3LA2 A;  5DV5 A;  2ESN A;  2P8T A;  2P5V A;  1CF7 A;  3O6B B;  2V1D A;  4H0E A;  3TO7 A;  1XCB A;  4ESF A;  3E5X A;  3MEX A;  3FHZ A;  4A5N A;  1R5H A;  2DAO A;  1ZLK A;  4JQF A;  3CUQ B;  4G9Y A;  2V1U A;  4ON0 A;  2QVO A;  3I59 A;  2ZKZ A;  3LWF A;  1U5T B;  4ZYG A;  5BPI A;  3GFL A;  1P4W A;  4LLL A;  1J0R A;  4A0Z A;  3FWE A;  2ACJ A;  1HKS A;  1BIB A;  1QPM A;  3MCZ A;  2ETH A;  1REP C;  4MEY F;  1MJ9 A;  5E20 A;  3RYP A;  1FBU A;  4M73 A;  3R0J A;  1KYW A;  5D4S A;  2ZCW A;  3BPV A;  1XGS A;  5D8L B;  4HOB A;  4ASN A;  2HOE A;  3HYI A;  4DNC A;  5HVQ C;  4EGY A;  3HTS B;  3KLO A;  3LFK A;  2HKX A;  5J8C A;  2W25 A;  2XAF A;  3FZV A;  3MFK A;  2A6E F;  4P55 A;  2IT0 A;  1K7A A;  3KLN A;  2VC0 A;  5FLX K;  1L0O C;  5CVI A;  1Z05 A;  3HHH A;  3ZMD A;  4LLG F;  2DU9 A;  5KVR A;  4IF4 A;  1I5Z A;  1MJA A;  2H6B A;  3BJO A;  1HW1 A;  2Q2E A;  2BV6 A;  4EGZ A;  4BH9 A;  1GXQ A;  3DFG A;  1ZLJ A;  1IXS B;  1KQ0 A;  1GXP A;  1BN5 A;  2OQG A;  4EJV A;  4EJW A;  4ESJ A;  2K02 A;  1H9G A;  3V7R A;  5BQT A;  5H20 A;  4HF1 A;  4HF2 A;  4A6D A;  1QNT A;  4XLN F;  2JRT A;  3REO A;  5LGU A;  1R36 A;  2VBZ A;  1R1U A;  2RV8 A;  2E7X A;  2ESH A;  3P7N A;  4Q5S F;  1KU9 A;  1FLI A;  3WTY C;  4OIP F;  3Q5F A;  1QZZ A;  5L3E A;  4UVC A;  1SMY F;  2F5F A;  2M5W A;  3WOD F;  4BQA A;  3N97 A;  2H27 A;  2RQP A;  3HOS A;  4OIQ F;  2DTR A;  2P5K A;  2IJL A;  3E5U A;  5CVU A;  5HLI A;  1FOK A;  1IN6 A;  1R22 A;  2XAG A;  2DPU A;  4L9J A;  3QPH A;  1DUX C;  2W85 A;  3MWM A;  4KYW A;  3C18 A;  2STT A;  3P9I A;  4ZZL A;  4RB2 C;  4FX0 A;  2A69 F;  2RGV A;  3QRF F;  3G3Z A;  2B0L A;  3BP8 A;  3TO6 A;  1XSD A;  1L3L A;  3E6D A;  1Z7U A;  3MQ0 A;  1F4K A;  3WTS C;  3IRR A;  4WXD A;  3RIR A;  5A2Q Z;  3CJN A;  5IT3 A;  1ZRC A;  3V4G A;  4B8X A;  4MNU A;  1W5T A;  4WXH A;  2ZNZ A;  2DI3 A;  3ABT A;  4LG0 A;  1F1Z A;  2W57 A;  4K2E A;  1FT9 A;  2PBI A;  4YFK F;  4NQW A;  1USS A;  3KEQ A;  3KCC A;  2YPR A;  3BWG A;  1H0M A;  1QBJ A;  3ULQ B;  2KKO A;  1QQI A;  3ZP5 A;  2ISY A;  3DV8 A;  3RJP A;  5LGT A;  1O3T A;  1BI0 A;  3FM3 A;  1B6A A;  4RGS A;  3QP5 A;  3RTR A;  4ZYH A;  2MLK A;  2K86 A;  3K1P A;  3F8F A;  2XUB A;  4R1H A;  3ZN0 A;  2F2E A;  3W6J B;  1R58 A;  1B1B A;  3FXQ A;  2DK5 A;  3F3X A;  4LK1 F;  2QBY A;  2FSW A;  1XDS A;  4WWC A;  4JBA A;  4OMY A;  3QU3 A;  4UVB A;  4L9T A;  4ZYE A;  4WF2 A;  1RIO H;  2CYY A;  4HX8 A;  2EV6 A;  5K1Y A;  4O3M A;  4KIG A;  4AVP A;  1K78 A;  3GUD A;  4U0V A;  4RGR A;  1K79 A;  2A6H F;  3K69 A;  3W6K B;  2LF7 A;  4FX4 A;  3K1N A;  1JGS A;  3SXY A;  1G3Y A;  2ZJ2 A;  1XSX A;  5HS7 A;  2EA4 A;  4UNO A;  5CVR A;  2FOK A;  1GHC A;  2HTS A;  5LHG A;  2NNN A;  2OA4 A;  3HOT A;  2XGX A;  3WGI A;  4I2O A;  1O7L A;  4KN7 X;  3J81 Z;  2EV5 A;  4LJZ F;  3E6B A;  2VBX A;  2D1V A;  3CTA A;  1P2F A;  2VOO A;  1B59 A;  3F6V A;  2XKO A;  5J8F A;  4Q48 A;  2H6C A;  1OYW A;  4HDV A;  2EWN A;  4UUV A;  2QQA A;  4MQ9 F;  4CIC A;  1CF7 B;  1FSH A;  2YR2 A;  3DP7 A;  4CYD A;  3L09 A;  4M71 A;  5FD6 A;  2GWR A;  4NB5 A;  2P6T A;  3ZPL A;  1ZGJ A;  2NYX A;  2HZT A;  1R5G A;  4AIJ A;  4MGR A;  1WWX A;  5DYM A;  2STW A;  5H6R A;  4LMY A;  3JTG A;  2IA0 A;  2AXL A;  3I59 B;  4XBF A;  3O3K A;  2H09 A;  4Y15 A;  2PEX A;  2F5C A;  3L7W A;  3IHU A;  2E7W A;  1J7K A;  4WCG A;  2Y48 A;  5LBQ A;  3SZP A;  2ELH A;  1R7J A;  3F72 A;  3F8N A;  3FX3 A;  1ONV A;  1LB2 A;  4G7H F;  4HLY A;  2NS0 A;  4NHJ A;  5K5R A;  5HDK A;  3H3Z A;  4O5V A;  1H9T A;  1KU7 A;  2Z5U A;  2OZ6 A;  1T38 A;  2WWY A;  1F5T A;  1FYK A;  2G7H A;  4YII A;  4KIB A;  3I58 A;  1UCR A;  1YYV A;  1UHM A;  3B02 A;  3LST A;  4DQ2 A;  3GZ6 A;  1FYM A;  3GEZ A;  1T0F A;  2XV4 S;  5AIQ A;  2D2W A;  4LFU A;  1Z91 A;  1U2W A;  2PG4 A;  2PQ8 A;  3U1D A;  1MDM B;  2FNA A;  1P4A A;  3E97 A;  2P7V B;  3WU0 A;  4MQV A;  5F64 A;  1LDK B;  3R60 A;  5DCM A;  1XB4 A;  5EEH A;  5ICC A;  3U9G A;  2L4M A;  1X3U A;  5DCF A;  2M87 A;  2HWV A;  2UWM A;  2ZNY A;  3K9T A;  3EYY A;  3KP6 A;  1BI2 A;  5J6X A;  2LSO A;  2WV0 A;  5D5V B;  2FBI A;  5L3F A;  4YG2 F;  2HGC A;  1Y0U A;  4FT8 A;  1JE8 A;  2FXA A;  2IA1 A;  4A0Y A;  3LA7 A;  2HR3 A;  3H3U A;  1FYL A;  1ZG1 A;  2IVM A;  2GQQ A;  2OQR A;  3WTW C;  4L5I A;  1Z1D A;  2L3D A;  4M72 A;  1ZRF A;  2M45 A;  1O3R A;  3EDP A;  3RI4 A;  1LNW A;  2OD5 A;  3ML6 A;  2XAJ A;  4MTE A;  1KU2 A;  2VT2 A;  3MZH A;  3VEP A;  2EA2 A;  1PP7 U;  2BYV E;  4P96 A;  2RKH A;  2FNP A;  3V8J A;  1FX7 A;  2UXX A;  4LLN A;  1ODD A;  2EV0 A;  3Q9S A;  4BHB A;  1I1G A;  3GLX A;  1HST A;  2FQ3 A;  1R1V A;  1RUN A;  2DO7 A;  2O3F A;  3GO5 A;  1QZY A;  4U88 A;  3F23 A;  2CQK A;  2RVC A;  2QWW A;  1SD5 A;  1MKM A;  2EFP A;  5CLS A;  4LG0 B;  4U7B A;  2P4W A;  4EJT A;  5IT9 K;  4L5J A;  2A3S A;  2XRN A;  4AWX B;  1ZAR A;  3I5U A;  2CGP A;  2BGC A;  3JAM Z;  1S7O A;  3JSP A;  4KA4 A;  2QQB A;  5LRS A;  3IKV A;  4CHU A;  4RGX A;  4GCV A;  3TOB A;  3AAF A;  4LB6 B;  3F21 A;  4BXU A;  2JTV A;  2ZME A;  4ESB A;  2XAS A;  5DDG A;  1V4R A;  1YG2 A;  5L3D A;  3L9F A;  2DLL A;  1OR7 A;  2XHK A;  3M9A A;  2A68 F;  5FO5 A;  1SD4 A;  2EFN A;  1JHF A;  1SFX A;  5DUI A;  1MD0 A;  3COA C;  1UST A;  5FLX Z;  3VOD A;  1K6O A;  1BI3 A;  4MHG A;  4UHT A;  2KIF A;  4I98 B;  1S7A A;  2XAH A;  1BBY A;  3ECO A;  3ISP A;  3DEU A;  4I0A A;  3J7A O;  1ULY A;  5ILV A;  2PLY A;  1J9I A;  3IWF A;  1FSE A;  1Z6R A;  1BC7 C;  4ZH4 F;  2HYG D;  1XGM A;  3RKX A;  2MD5 A;  3R61 A;  3KFW X;  3LA3 A;  4N9H A;  4PGH A;  1J75 A;  3TO9 A;  2L01 A;  3R4K A;  4HV5 A;  2HDC A;  1P4X A;  3C3W A;  1W4M A;  5K5Q A;  4Z2Y A;  2QQ9 A;  3LAP A;  1FZP B;  3T1B A;  2WTE A;  3VB2 A;  4OU0 A;  1G3W A;  5D8K B;  3V8L A;  1T6S A;  2DQR A;  3CUQ A;  1DDN A;  2OU2 A;  4M9Z A;  2M1B A;  5A2Q K;  3BJA A;  1OYY A;  4D0P A;  2EFW A;  1IN8 A;  4IRG A;  2PN6 A;  3TKY A;  1I1S A;  1O3S A;  4EV0 A;  1U5T A;  3ZMV A;  2WC2 A;  3O2P E;  3ZQ7 A;  1O3Q A;  2NAZ A;  2E1N A;  2ZFW A;  2QYO A;  2YX4 A;  3FXU A;  2EJR A;  2VBW A;  1IAW A;  2FU4 A;  2RDP A;  4AD9 A;  1AOY A;  1LJ9 A;  1S29 A;  5BPD A;  2GA2 A;  4EM0 B;  3WGG A;  2Z33 A;  4I01 A;  2IP2 A;  2EK5 A;  1MZB A;  3KE2 A;  2J5P A;  2H94 A;  2G7U A;  4RGU A;  3F8B A;  3C1D A;  4G7O F;  4Q47 A;  1Z9C A;  2ZXJ A;  1G3T A;  3M1E A;  5BOX A;  4BAY A;  1SMT A;  4ETS A;  1XGO A;  2FBK A;  1W7P D;  4A0X A;  4ENM A;  4HAM A;  2O61 A;  1ZG5 A;  2VC1 A;  1DPU A;  2O03 A;  3ERE D;  4RAZ A;  3HRS A;  4Y13 A;  3J80 Z;  1B9N A;  2V79 A;  4ZYD A;  2EFQ A;  3I64 A;  2HKO A;  5L3B A;  3PQK A;  4HDU A;  1W7P B;  3WE3 A;  3HIF A;  3FM5 A;  5H6Q A;  4OIO F;  3BJ6 A;  3DPT A;  2JSC A;  2IPQ X;  4KDP A;  2HS5 A;  2BE5 F;  3KP7 A;  1SFE A;  4PGG A;  1LQ1 A;  1XMA A;  2LF8 A;  1F9N A;  1R1T A;  2EB7 A;  4IVN A;  1NHA A;  3TGN A;  1TTY A;  2FF4 A;  5D5X B;  2MA3 A;  2XKP A;  3KZY A;  4CGZ A;  4GGG A;  1D5V A;  4IRI A;  1JXS A;  4YIF A;  3KP4 A;  1WKM A;  1IF1 A;  2FMY A;  5LEJ A;  1BIA A;  5LHI A;  1SFU A;  2KJC A;  5DCM B;  1YQA A;  3J81 K;  4A6E A;  1YO5 C;  2J5O A;  1A04 A;  5DD8 A;  1ZAO A;  1SD7 A;  1U6G A;  1EV7 A;  4P5O A;  5JVT A;  1YS6 A;  1T98 A;  3T0Y A;  5JR3 A;  3Q9V A;  3D0S A;  4IHT A;  1EH7 A;  2LKP A;  2MLG A;  1HW5 A;  1E2X A;  3V7S A;  2VE9 A;  3DQV C;  4M6Y A;  3BRO A;  4M9S A;  1OKR A;  4P9U A;  4U0W A;  1LVA A;  4HQE A;  4I7H A;  3WGH A;  5HS9 A;  1LEB A;  2FA5 A;  1OMI A;  1J59 A;  1Z6T A;  4L9V A;  4PCQ A;  3GW2 A;  2Z9O A;  3WU1 B;  4A12 A;  2BBY A;  1P92 A;  4EM1 A;  1XD7 A;  2QEN A;  1KGS A;  3F22 A;  1KQ8 A;  4HZF A;  1G6N A;  1TW2 A;  2Z3Y A;  2DBB A;  1U8R A;  2CSO A;  2XVC A;  4I0B A;  3DF8 A;  2UXN A;  5ILU A;  1E17 A;  1J2X A;  2O6G E;  2FML A;  2FE3 A;  2F5E A;  3HRM A;  2VT3 A;  1BC8 C;  3HSE A;  3NEU A;  2BEO A;  4KNY A;  3LQR A;  4HF0 A;  3VFZ A;  3WTT C;  2DPD A;  1RNL A;  3I71 A;  5FD5 A;  3GFI A;  3L00 A;  3BZ6 A;  2HTJ A;  5ICF A;  1ZYR F;  1YLF A;  2W24 A;  3D5L A;  2JZY A;  2QUF A;  2X4H A;  3K1M A;  3QAH A;  2IRF G;  4R8H A;  3ZMZ A;  2V1X A;  5LLQ A;  3OOP A;  2OAZ A;  2Z99 A;  2TDX A;  2RN7 A;  3OV8 A;  3NQO A;  4HA8 A;  2ZME B;  5LEK A;  2PFB A;  1TQI A;  1IN7 A;  1RI7 A;  3RDI A;  2A61 A;  1FBQ A;  5D5U B;  5HDN A;  3M8E A;  4OIN F;  3GWZ A;  1TQP A;  4AIH A;  2M30 A;  4S05 A;  2UZK A;  4HLX A;  4N0B A;  2ISZ A;  4Y17 A;  1UFM A;  3KZZ A;  2NRA C;  3KP2 A;  2DFI A;  4P9F A;  5L3C A;  3P9K A;  1YW7 A;  1ZGA A;  3WTV C;  3CLO A;  3MAJ A;  2XRO A;  1XMK A;  3WTZ A;  1YW8 A;  4CDG A;  1EH6 A;  1AWC A;  4HW0 A;  4B09 A;  4YFX F;  5BS6 A;  1U78 A;  4WXC A;  4KMU X;  1IN5 A;  1Q1H A;  2PI0 A;  4KFC A;  4BYY A;  4G6D A;  2XAQ A;  3KP3 A;  2DT5 A;  5E1W A;  3ZMU A;  5D4R A;  4L0Z B;  3RKW A;  2FBH A;  5FB2 A;  3C7J A;  3GX4 X;  2C6Y A;  4IHS A;  4KIC A;  1IRG A;  3WTU C;  1FP2 A;  4HYE A;  4G94 A;  4HQM A;  3FXR A;  3P9C A;  3BY6 A;  5K5O A;  3GZ5 A;  5DUK A;  2MH9 A;  1J5Y A;  2KIM A;  3JSO A;  3WG9 A;  1IN4 A;  2LDU A;  1WQ2 A;  2XIG A;  3ZMT A;  3BPX A;  4R79 A;  4XLP F;  3DXJ F;  3HUG A;  2VOP A;  2OBP A;  4CO8 A;  2K7L A;  1PUE E;  1UHW A;  3MZY A;  4XSZ F;  2HFH A;  4I09 A;  4KMF A;  1D8J A;  4EJO A;  2DK8 A;  1XSV A;  2D45 A;  3JAM K;  4XSX F;  5ED4 A;  1ZN2 A;  3M8F A;  1IUY A;  2IW5 A;  3U2R A;  1KYZ A;  1B9M A;  1HKQ A;  3WTX C;  3LQQ A;  4XRF A;  3HRT A;  3JW4 A;  2OZU A;  1HKT A;  3IWZ A;  1DPR A;  3KEO A;  5D5W B;  2ZO4 A;  1FY7 A;  5IT9 Z;  1JHH A;  2QBY B;  1TW3 A;  4S04 A;  3IRQ A;  1MDM A;  3LAJ A;  4ENJ A;  2CWE A;  2F5D A;  3RPQ A;  3CUQ C;  2JPC A;  4Q4Z F;  2HEO A;  1MGT A;  2YX7 A;  3GXO A;  2PJP A;  5ILS A;  4QWQ A;  2Q0O A;  3HTU A;  1KA8 A;  4G6Q A;  1U5T C;  1SAX A;  4EQQ A;  2KJB A;  2O8X A;  1K78 B;  3GYH X;  2MH2 A;  3V8K A;  3DPL C;  1EH8 A;  2VXZ A;  5E1Z B;  3ROU A;  2HQR A;  3GVA A;  4MTD A;  1BM9 A;  3H92 A;  3EQL F;  3N4M A;  1ON1 A;  1RUO A;  2DQL A;  4EJU A;  2YSR A;  5E8G A;  3F6O A;  5CJ9 A;  2GZW A;  1G4D A;  3WE2 A;  3T8R A;  4ENN A;  1STZ A;  2ADU A;  3BOQ A;  1PDN C;  3T5X A;  3L2C A;  4TV7 A;  2G9W A;  4GXO A;  5D6F A;  2GXB A;  1TBX A;  5CYV A;  4CXF A;  4QLC U;  2VON A;  2ZBK A;  2V9V A;  1W5S A;  3K2Z A;  5E8I A;  3HHG A;  4N9I A;  4BHP A;  1HXD A;  2E1C A;  2R3S A;  5E18 F;  2CW0 F;  3GF2 A;  2R7D A;  1XGN A;  1ON2 A;  4LD5 A;  5D6E A;  5DEQ A;  5FFZ A;  1PP8 F;  5ICG A;  2CG4 A;  5KK1 A;  2X0L A;  3BDD A;  1I27 A;  4RB0 A;  3F8M A;  1QO0 D;  4KUM A;  5CVJ A;  4GYG A;  3TDU C;  3I53 A;  3CUO A;  1FP1 D;  5LGN A;  3R6S A;  1FC3 A;  3SZT A;  4AIK A;  4IJA A;  3CO7 C;  1IW7 F;  1R23 A;  4G7Z F;  3J80 K;  1WSU A;  1LDD A;  5F6F A;  5TRD A;  3E5Q A;  2PMH A;  1O7F A;  2QLZ A;  4PDK A;  5TJJ A;  3F8C A;  5E1X A;  5L3G A;  3FMS A;  3RKY A;  3I0T A;  3PQJ A;  1V3F A;  4OMZ A;  3IC7 A;  3JTH A;  5DD4 A;  1G3S A;  2KIU A;  4BNC A;  1XDU A;  2QM3 A;  2L54 A;  3E6M A;  2LNB A;  4JK1 X;  1BOA A;  4UXN A;  3FMQ A;  4EMS A;  3EUH A;  2AS5 F;  3M7G A;  5HLG A;  1T2K A;  4RB1 A;  3NRV A;  3B73 A;  4FHT A;  4A5M A;  5F1R A;  2FEZ A;  1TQM A;  2MC3 A;  5JI6 A;  4EM2 A;  4MEX F;  1YIO A;  4LB5 A;  3K0L A;  4LK0 F;  2R7F A;  4L0Y B;  4WK8 F;  3I4P A;  1TLH B;  2VBY A;  2KRF A;  5AIP A;  2EFO A;  2P6S A;  1D3Y A;  3HSR A;  4IPA A;  3ELK A;  4UVA A;  5CVV A;  2GAU A;  1U3E M;  2CO5 A;  4L9N A;  1WI9 A;  1OYI A;  3VOE A;  3SQN A;  2VN2 A;  3IKT A;  2FRH A;  5BMZ A;  2K4B A;  3QU6 A;  4U0Y A;  2K27 A;  4EVI A;  3S2W A;  1I6X A;  2VOD A;  3TOA A;  3KET A;  1T39 A;  1XCV A;  3ZMS A;  4I02 A;  3SFZ A;  2HQN A;  4M9X A;  1BI1 A;  3RPU A;  1UB9 A;  5ICE A;  5ERI A;  2L02 A;  4M6X A;  1FWZ A;  3R0A A;  4U7D A;  4L18 B;  1BJA A;  3TDZ C;  4IXA A;  4OOI A;  4IRH A;  1HW2 A;  4GYI A;  4PZJ A;  2M8E A;  1TNS A;  3CO6 C;  3DKW A;  2V6C A;  1YFH A;  4KN4 X;  3SHF A;  4M74 A;  1LEA A;  3QPT A;  5HDG A;  1YW9 A;  3PFI A;  3KP5 A;  1FBS A;  4YFN F;  3IL2 A;  3QP6 A;  1YTY A;  3ABU A;  2COM A;  1GVJ A;  5AON A;  5FGM A;  5JHU A;  2A5Y B;  1SD6 A;  1MJB A;  1WRJ A;  3ECH A;  4F7Z A;  2D1H A;  2GA1 A;  2O0Y A;  4RS8 A;  2GIV A;  1DP7 P;  1ZRE A;  3QOP A;  1CGP A;  5FFX A;  1B4A A;  3CDH A;  2YU3 A;  4HBL A;  1HQC A;  1R00 A;  1OPC A;  2IA2 A;  1ZRD A;  3ZN1 A;  1W7P A;  4LGW A;  2K4J A;  1HBX G;  5HS8 A;  1FPQ A;  1IRF A;  1ZHF A;  2L4A A;  3T8T A;  2W84 A;  1S6L A;  5LRR A;  1VTN C;  1RZ4 A;  1HSJ A;  3GFM A;  1QGP A;  4HV6 A;  1YS7 A;  2VE8 A;  1ZG3 A;  2Y75 A;  3I54 A;  1FNN A;  3HSF A;  1S3J A;  2JT1 A;  3RYR A;  4BHC A;  4CZZ A;  4ENK A;  1C0W A;  4RAY A;  1S8N A;  3E3V A;  4O6J A;  4UV9 A;  3FMR A;  1TNT A;  2A07 F;  3E6C C;  1IXR C;  2PMU A;  1IXC A;  2Q8K A;  2P7C B;  4E70 A;  2MBF A;  1XN7 A;  3EET A;  2P5L C;  4A2U A;  3G73 A;  1LDJ A;  1ZH5 A;  3FF5 A;  4ZZD A;  4GO1 A;  5HLH A;  2RC4 A;  4G8X A;  4HX4 A;  3HRU A;  1D8K A;  1KU3 A;  2Y0M A;  5EEG A;  2RNJ A;  3EYI A;  4UV8 A;  5LHH A;  5JFR A;  4KIF A; 
#chains in the Genus database with same CATH topology
 2GXG A;  4DGW B;  2NNY A;  1IZ1 A;  4CZC A;  1KQ9 A;  4ANJ A;  2Y2Z A;  4FE4 A;  2PJR B;  2O5R A;  3GFJ A;  1O57 A;  2DW4 A;  2JPB A;  5E17 F;  2HYF A;  3A4C A;  3KYD B;  4WX9 A;  3QYE A;  4OIR F;  4B48 A;  6PAX A;  3TQN A;  4KT5 C;  5HOO A;  2CFX A;  4DW6 A;  4RB3 C;  2E35 A;  2EH3 A;  2QZ8 A;  4M3D A;  2CV1 A;  4II2 A;  1P6R A;  3V7C A;  4HX7 A;  3LA2 A;  2L9N A;  5DV5 A;  3BG5 A;  4J19 A;  2ESN A;  3W6V A;  2P8T A;  5CPR B;  5HNF A;  2P5V A;  1CF7 A;  3CME I;  3O6B B;  2V1D A;  3L2Q A;  2Z16 A;  3I4M J;  2IGN A;  3DCF A;  4V19 K;  4H0E A;  1UZC A;  2HI3 A;  2BW3 B;  1XCB A;  3TO7 A;  5FKN A;  1ZGW A;  4ESF A;  2H1L A;  1BW6 A;  2IEK A;  3E5X A;  2VI6 A;  5CQG A;  3MEX A;  3FHZ A;  4A5N A;  3TED A;  2XPU A;  1V5F A;  4DOZ A;  4IHX A;  1ERD A;  3HM5 A;  2F6C A;  1N77 A;  1R5H A;  2FOW A;  2DAO A;  3IH2 A;  1ZLK A;  4JQF A;  1IG7 A;  3DLA A;  2HNH A;  3CUQ B;  4G9Y A;  2R7X A;  4PFP A;  1X3W B;  4A3D J;  2V1U A;  3JRG A;  2HDD A;  4ON0 A;  2QVO A;  3SDG A;  3K70 C;  3I59 A;  2ZKZ A;  3LWF A;  1U5T B;  4ZYG A;  5BPI A;  3GFL A;  1P4W A;  3D5R C;  4Y4R A;  4LLL A;  1J0R A;  4A0Z A;  2BHZ A;  3FWE A;  1E3H A;  2COB A;  3DPU A;  5DM7 F;  2O8K A;  2ACJ A;  1HKS A;  1BIB A;  1QPM A;  3MCZ A;  2ETH A;  3D5S C;  2LG4 A;  1REP C;  1QA6 A;  4PFO A;  4MEY F;  1MJ9 A;  5E20 A;  2WA0 A;  3RYP A;  1FBU A;  4M73 A;  2OJE D;  3R0J A;  1Z7L A;  1KYW A;  2DYR H;  5D4S A;  2ZCW A;  5K7Z A;  4X0G A;  3JR9 A;  3ERM A;  3CF2 A;  3BPV A;  1XGS A;  2L9S A;  5LFA A;  1A35 A;  4BJ5 C;  2KT0 A;  1TP4 A;  5D8L B;  3X2Q H;  4F92 B;  4ZYA A;  4HOB A;  2ZJP F;  3HBL A;  2DA7 A;  1P7J A;  1OCR H;  4ASN A;  2HOE A;  3HYI A;  4DNC A;  5HVQ C;  4NBQ A;  4EGY A;  3HTS B;  3KLO A;  5FLV A;  3LFK A;  2R92 J;  2HKX A;  2CUF A;  5J8C A;  3BCB A;  2OUM A;  4XLE A;  2W25 A;  3OYN A;  3MKY B;  1Z67 A;  1O4X A;  2K9S A;  2XAF A;  3FZV A;  5CQE A;  3MFK A;  4I6Z A;  2PMZ A;  3OSG A;  3VYS B;  2M9H A;  2A6E F;  5FJ8 J;  2E34 A;  4P55 A;  5IPA A;  5EF6 A;  3H36 A;  2IT0 A;  5EGO B;  1X3Z B;  1K7A A;  3S15 J;  3ASN H;  3KLN A;  2CUZ A;  2VC0 A;  3GCM A;  2CV2 A;  4BE0 A;  2IS2 A;  5FLX K;  1L0O C;  5CVI A;  1Z05 A;  3HGG A;  2X1E A;  3J7Z I;  3KEY A;  3A0B C;  2AO9 A;  3RKQ A;  3HOV J;  3HHH A;  3OS0 A;  3ZMD A;  4ZDL A;  4LLG F;  2BHY A;  2DU9 A;  4MO7 A;  5KVR A;  1Y39 A;  4BBS J;  2DA6 A;  4BGD A;  4IF4 A;  1S5L C;  1I5Z A;  1MJA A;  2H6B A;  2E1M C;  2Y69 H;  3BJO A;  1HW1 A;  4BDY A;  2Q2E A;  2BV6 A;  2RQQ A;  4EGZ A;  4B43 A;  4BH9 A;  1GXQ A;  3DFG A;  1ZLJ A;  3G4S I;  1IXS B;  2QQ8 A;  2B63 J;  1KQ0 A;  1GXP A;  1BN5 A;  2OQG A;  3OWT A;  4XN3 A;  3E1S A;  2XPW A;  4EJV A;  4EJW A;  2X9D A;  4ESJ A;  3FIW A;  1LPQ A;  2K02 A;  3S93 A;  4DBR A;  2GIZ A;  1H9G A;  3HOW J;  3V7R A;  5BQT A;  5H20 A;  4HF1 A;  2NVU B;  4NC6 A;  4HF2 A;  1WCM J;  4A6D A;  1QNT A;  2M34 A;  4XLN F;  4XRS G;  2JRT A;  3REO A;  5LGU A;  3CC2 I;  1R36 A;  2VBZ A;  1M1E B;  4DZJ A;  2W7N A;  1R1U A;  3PSI A;  4QPQ A;  4HPQ A;  5EEA A;  2RV8 A;  2V4J C;  1P9Q C;  2E7X A;  2ESH A;  2YS9 A;  3P7N A;  4A3E J;  4Q5S F;  1VQ8 I;  1KU9 A;  1FLI A;  3K4K A;  4RLQ A;  3WTY C;  4OIP F;  2I5U A;  3Q5F A;  1QZZ A;  5L3E A;  9ANT A;  4UVC A;  2DOF A;  3SDB A;  1SMY F;  2W00 A;  2ECB A;  2F5F A;  2M5W A;  3BZC A;  3CJQ B;  1WI3 A;  4DZP A;  3WOD F;  2DT7 B;  2FQ4 A;  1T08 B;  1WJB A;  1BR1 A;  2E60 A;  4BQA A;  3N97 A;  2GOM A;  2H27 A;  2LTP A;  1MH3 A;  2RQP A;  4PSW A;  2BOL A;  3CLQ A;  1G8X A;  3HOS A;  4IKF A;  4OIQ F;  3A1Y A;  2DTR A;  2P5K A;  2IJL A;  3E5U A;  5CVU A;  5HLI A;  1FOK A;  1IN6 A;  3G1M A;  1U8B A;  1R22 A;  2XAG A;  2DFF A;  2CUJ A;  2DPU A;  4L9J A;  2I8D A;  5E3L A;  3JRA A;  3QPH A;  1A31 A;  4P1W A;  3DEE A;  1DUX C;  2W85 A;  3MWM A;  1TWC J;  2O7O A;  1SAU A;  2AQF A;  1QVT A;  1ACI A;  3ZQH A;  5IYB J;  3CJT B;  3WHB A;  1K4T A;  4XRS A;  4KYW A;  2MYS A;  3C18 A;  2STT A;  3P9I A;  3H9G A;  3LMM A;  2VXD A;  4ZZL A;  2BY1 A;  2KDZ A;  3H3V K;  3IH3 A;  4RB2 C;  3EUH C;  4FX0 A;  2A69 F;  2RGV A;  3QRF F;  3G3Z A;  2L0K A;  1JTY A;  2B0L A;  3H5A A;  2EIK H;  3L2W A;  3IP4 B;  3BP8 A;  2F4O B;  3TO6 A;  2LLK A;  2M2E A;  1XSD A;  5C44 J;  5HOD A;  4E7S A;  2EIM H;  1L3L A;  3E6D A;  2VL8 A;  1VQ7 I;  1EJ9 A;  1Z7U A;  3IAS 2;  4C3H J;  3MQ0 A;  1F4K A;  3WTS C;  3IRR A;  3HZJ A;  3G6E I;  4WXD A;  3RIR A;  5A2Q Z;  5FLM J;  3CD6 I;  2Z2S B;  3CJN A;  4GRI A;  2L7Z A;  5IT3 A;  3GME A;  1ZRC A;  3V4G A;  4B8X A;  4MNU A;  5KHD A;  1U0J A;  1GUU A;  3FK7 A;  1W5T A;  2OCC H;  4WXH A;  2ZNZ A;  2DI3 A;  3ABT A;  4LG0 A;  1F1Z A;  2W57 A;  4XID A;  3GTK J;  3MN2 A;  3OYL A;  2HQA A;  3FXM A;  4K2E A;  4DYQ A;  1FT9 A;  3EPZ A;  2PBI A;  4YFK F;  1NG6 A;  2QEX I;  3CC4 I;  1R4N B;  4NQW A;  1USS A;  3KEQ A;  3KCC A;  2YPR A;  3BWG A;  3LSI A;  1H0M A;  1QBJ A;  3ULQ B;  2KKO A;  2EPF A;  5B1B H;  1QQI A;  3ZP5 A;  2ISY A;  4C2M J;  3DV8 A;  4XLA A;  2X6W A;  3RJP A;  3S3N A;  4IOA F;  5LGT A;  4D9J A;  1AKH B;  3PSF A;  2CH0 A;  1O3T A;  1BI0 A;  3FM3 A;  1B6A A;  3JRB A;  1VND A;  4RGS A;  3QP5 A;  3RTR A;  4ZYH A;  3F0C A;  2MLK A;  1WGX A;  3CCL I;  3ZQL A;  2K86 A;  3K1P A;  3S3O A;  3F8F A;  4IZZ A;  2XUB A;  4R1H A;  3ZN0 A;  2X85 A;  2D5V A;  2F2E A;  3TMO A;  3W6J B;  1R58 A;  1B1B A;  3FXQ A;  2DK5 A;  3F3X A;  4LK1 F;  2QBY A;  2FSW A;  2OV7 A;  1XDS A;  4WWC A;  4JBA A;  2VKD A;  4QTR A;  4OMY A;  4M3G A;  3QU3 A;  1IC8 A;  3ZQQ A;  4CUG A;  4UVB A;  4L9T A;  4E7Z A;  4FTH A;  1X1C A;  3HOY J;  1LUJ B;  4ZYE A;  3OYH A;  3IH4 A;  1U9O A;  4WF2 A;  1RIO H;  2CYY A;  4V2G A;  4AC0 A;  3S8P A;  3BR5 A;  4HX8 A;  1MNM C;  3QPS A;  2EV6 A;  3OYC A;  3LOC A;  5K1Y A;  4O3M A;  3ZGK A;  1UMQ A;  1FMV A;  4KIG A;  4AVP A;  1K78 A;  3GUD A;  1D0Z A;  4U0V A;  2EIN H;  4RGR A;  2Q1Z B;  1K79 A;  3DTK A;  4BU2 A;  1I39 A;  2A6H F;  3LSH A;  3K69 A;  4FCY A;  4NDL A;  3W6K B;  3OYG A;  4E4H A;  2WY8 Q;  2LF7 A;  3DU5 A;  2RNG A;  4Y33 A;  4FX4 A;  3K1N A;  3GZN B;  1EF4 A;  1JGS A;  3SXY A;  1QHH D;  1G3Y A;  2KL4 A;  2ZJ2 A;  5IP6 A;  1XSX A;  2JWT A;  2NOG A;  4UB8 C;  5HS7 A;  2QA4 I;  2EA4 A;  1XC5 A;  2K9M A;  1E3P A;  3AG2 H;  3EUA A;  4UNO A;  1T95 A;  2ME0 A;  5HNH A;  2F48 A;  3NAU A;  5CVR A;  3K10 A;  1FJL A;  1GDT A;  1BW5 A;  2FOK A;  1GHC A;  2HTS A;  2CJJ A;  4RBO A;  1XTA A;  5LHG A;  2DTZ A;  2NNN A;  2X6O A;  2OA4 A;  4PK4 A;  3HOT A;  2LKX A;  2XGX A;  3WGI A;  4I2O A;  4PJN A;  2WAQ N;  4S0H B;  2ZFU A;  1O7L A;  4KN7 X;  3J81 Z;  3HC7 A;  3Q0V A;  1K83 J;  5IYC J;  2EV5 A;  1YJ9 I;  1YIJ I;  4LJZ F;  3E6B A;  1MSF C;  2VBX A;  2VPR A;  5J1U A;  2D1V A;  4LG3 A;  3CTA A;  1P2F A;  2VOO A;  4BKX A;  3O8H A;  1B59 A;  4A3G J;  3F6V A;  1FOY A;  2XKO A;  5J8F A;  4Q48 A;  2F4M B;  2H6C A;  4M3B A;  2DMN A;  1TL8 A;  1OYW A;  1LE8 A;  4HDV A;  2EWN A;  3BTJ A;  4UUV A;  2QQA A;  2E5N A;  4MQ9 F;  4CIC A;  3U1K A;  2VQG A;  4AUX A;  1CF7 B;  4Z6Y A;  1FSH A;  2YR2 A;  3DP7 A;  4CYD A;  3GTG J;  3FDY A;  3L09 A;  3MKZ A;  3ZCO A;  4M71 A;  2M4G A;  5FD6 A;  2GWR A;  1NTC A;  4NB5 A;  2P6T A;  3MZ8 A;  1Z0X A;  4NC7 A;  2QSG X;  3ZPL A;  1ZGJ A;  5J47 A;  3H1C A;  2VJI A;  1Z21 A;  1AU7 A;  2NYX A;  2HZT A;  1R5G A;  4AIJ A;  4MGR A;  1WWX A;  2E2H J;  5DYM A;  2HYJ A;  3AG3 H;  5H6R A;  4LMY A;  3JTG A;  2STW A;  4RDU A;  2IA0 A;  2JA2 A;  2DFE A;  3JRH A;  3B6A A;  1R5I D;  2AXL A;  1JUS A;  2OPT A;  4LIV A;  3FXO A;  3I59 B;  4XBF A;  2NXN B;  1MMG A;  3O3K A;  4BDZ A;  2H09 A;  4C9Y A;  4Y15 A;  1S72 I;  1OFC X;  2PEX A;  2EQR A;  4MIM A;  2Y9Z A;  4ZTJ A;  2F5C A;  1XPX A;  3L7W A;  3IHU A;  3HUG B;  2E7W A;  4L5E A;  3DBH B;  1J7K A;  4WCG A;  4MFE A;  2Y48 A;  1J09 A;  5LBQ A;  1B8I B;  4JX5 A;  3SZP A;  2ELH A;  1R7J A;  3F72 A;  3F8N A;  3FX3 A;  1HA8 A;  3DU6 A;  3W2A A;  1ZK8 A;  1ONV A;  3HKZ A;  3U21 A;  4PUS A;  5BNG A;  1LB2 A;  5J40 A;  4G7H F;  4HLY A;  2NS0 A;  4NHJ A;  3H9Q A;  1AA7 A;  5K5R A;  5HDK A;  2WB1 N;  3CZ6 A;  3H3Z A;  4O5V A;  2KQR A;  1H9T A;  1KU7 A;  2Z5U A;  4A93 J;  3K4L A;  1JUP A;  3MD2 A;  3OYA A;  2OZ6 A;  1D1C A;  1T38 A;  2WWY A;  1F5T A;  2P81 A;  4A3F J;  2EZL A;  1FYK A;  4CCL A;  2G7H A;  3KYL A;  4YII A;  4KIB A;  5E3O A;  3O8G A;  3A02 A;  3I58 A;  1MSE C;  1UCR A;  3ZQC A;  3PJR A;  1YYV A;  4I76 A;  3S1N J;  1MIJ A;  2NVT J;  3L1P A;  1UHM A;  3B02 A;  3LST A;  3K70 D;  3A03 A;  3FKI J;  2Y0S N;  4DQ2 A;  3GZ6 A;  4A3B J;  2K3P A;  1FYM A;  3GEZ A;  1T0F A;  3SJM A;  2XV4 S;  4PJJ A;  5AIQ A;  2V9P A;  2QGU A;  3ZOB A;  4HNV A;  4BQQ A;  2D2W A;  4LFU A;  1Z91 A;  1IV6 A;  1U2W A;  2PG4 A;  2PQ8 A;  2R7S A;  1VQL I;  3U1D A;  1ETY A;  1MDM B;  2FNA A;  3L2V A;  5M3M J;  1GT0 C;  1P4A A;  1PVE A;  3E97 A;  2BY2 A;  1Z3Y A;  1LKX A;  2P7V B;  3WU0 A;  1ENH A;  4MQV A;  5F64 A;  1LDK B;  5GAE J;  4RA2 A;  3R60 A;  3FIS A;  5DCM A;  1XB4 A;  4HNU A;  1RR7 A;  4RAG A;  2E2I J;  1CQT A;  4LOC A;  5FKM A;  3GLL A;  4B44 A;  1K6Y A;  5EEH A;  5ICC A;  3U9G A;  2L4M A;  3S1M J;  2JA8 J;  1X3U A;  4F55 A;  2K9L A;  4XN0 A;  5DCF A;  2XC7 A;  2M87 A;  2HWV A;  2EIL H;  4FE7 A;  2UWM A;  2ZNY A;  3K9T A;  4X1E A;  4E6K G;  5DTD A;  3EYY A;  3NWT A;  2KFD A;  1OLT A;  3KP6 A;  3UKG A;  1BI2 A;  3LSP A;  2ECC A;  5FRN A;  1PUF B;  3PUB A;  1N25 A;  5J6X A;  2LSO A;  1IRZ A;  3B6C A;  2VKH A;  2WV0 A;  4C3J J;  3CP8 A;  1QZE A;  1GV2 A;  1HDD C;  4HSR A;  4G6T B;  2N8G A;  3J7A Y;  1QPI A;  5D5V B;  2E1O A;  2CUE A;  2FBI A;  2K5C A;  2M7A A;  4YG2 F;  5L3F A;  1W0T A;  2HGC A;  1Y0U A;  2CW7 A;  4FT8 A;  1LFP A;  3SZG A;  4FAS D;  1JE8 A;  2FXA A;  1HC8 A;  2IA1 A;  1HOM A;  2DOA A;  4A0Y A;  2WAD A;  3FK6 A;  4ZDO A;  1PYV A;  3LA7 A;  2HR3 A;  4XL9 A;  1FTT A;  3H3U A;  1FYL A;  2A6T A;  3LSK A;  1W36 C;  1RES A;  5EDN A;  1ZG1 A;  2IVM A;  2GQQ A;  3SYT A;  3BT9 A;  4JX6 A;  2K85 A;  4J01 A;  1A6I A;  2OQR A;  1APL C;  3WTW C;  1SAN A;  4XON A;  1X58 A;  2O9L A;  4XRM A;  3I56 I;  3JRI A;  4GFB A;  4L5I A;  1Z1D A;  2L3D A;  3LL7 A;  4M72 A;  1ZRF A;  2M45 A;  2W4S A;  1O3R A;  3EDP A;  3OOU A;  3BR3 A;  1IJW C;  3OYF A;  2AHQ A;  2HXO A;  2V9K A;  3RI4 A;  3FXK A;  2LKS A;  4JX4 A;  4BQN A;  5IY5 H;  2OCE A;  3L2R A;  1LNW A;  2E1M B;  4AU7 A;  4HEA 2;  2OD5 A;  3ML6 A;  1V54 H;  5E79 C;  2XAJ A;  2ZME C;  4CCK A;  4RMN A;  4MTE A;  1KU2 A;  3GTJ J;  2VT2 A;  3K6G A;  3MZH A;  1MMA A;  3VEP A;  2EA2 A;  1PP7 U;  3K4M A;  2BYV E;  4P96 A;  2RKH A;  5EG0 A;  5M3F J;  4XK4 A;  2FNP A;  2LMD A;  3V8J A;  1FX7 A;  2V7F A;  4AID A;  1TWG J;  2UXX A;  3LFU A;  4LLN A;  2EZH A;  4YIR X;  3W2W A;  2QSF X;  1ODD A;  2EV0 A;  2HQ5 A;  3Q9S A;  1R4M B;  4BHB A;  2CQQ A;  1I1G A;  3GLX A;  2KHM A;  1DU0 A;  4HNT A;  2ELJ A;  1HST A;  2FQ3 A;  4KIT B;  3FBN B;  2HOT A;  1R1V A;  4IHV A;  3GTP J;  1RUN A;  1X19 A;  1T33 A;  3FKJ A;  2DO7 A;  2O3F A;  4JYK A;  3GO5 A;  1QZY A;  4U88 A;  3F23 A;  3DBL B;  2CQK A;  2RVC A;  2QWW A;  1SD5 A;  5GAH J;  2ZB9 A;  3TW6 A;  1MKM A;  2M8G X;  1YJW I;  2EFP A;  4W97 A;  5CLS A;  1IO2 A;  4LG0 B;  4ZC3 A;  3BR1 A;  4U7B A;  2P4W A;  2LK2 A;  1YIT I;  4EJT A;  5IT9 K;  4UUS A;  2AQE A;  4L5J A;  2RRE A;  2A3S A;  2XRN A;  3CJR B;  2KRH A;  3HJE A;  4XMY A;  1ZAR A;  5FKO A;  4AWX B;  2ELK A;  2LRD A;  3I5U A;  4BXF A;  3TW7 A;  4NQW B;  5B1A H;  2H8R A;  3OR2 C;  1X4P A;  2CGP A;  2BGC A;  3MKL A;  1FMW A;  2QKM B;  3JAM Z;  1S7O A;  3JSP A;  1ETX A;  2VIX A;  2QQB A;  1GLN A;  4KA4 A;  1NH3 A;  3M4O J;  2FX0 A;  4XOT A;  1G2H A;  5LRS A;  3IKV A;  4CHU A;  4RGX A;  4GCV A;  3DEW A;  3TOB A;  1XX5 A;  3I3L A;  3AAF A;  4LB6 B;  3F21 A;  2BXY A;  4BXU A;  2MAB A;  2JTV A;  2ZME A;  4ESB A;  3CP2 A;  2DOD A;  2XAS A;  2V6E A;  4H4K C;  5DDG A;  1ZR2 A;  1V4R A;  1FIP A;  2LBF A;  1YG2 A;  2JK3 A;  4M3F A;  5L3D A;  3L9F A;  1VQ5 I;  1EA3 A;  2DLL A;  1WPK A;  1OR7 A;  2WAQ A;  2JUG A;  1VQ4 I;  2XHK A;  3M9A A;  1YX3 A;  1W5C C;  2A68 F;  2VAS A;  5FO5 A;  3HKZ N;  1SD4 A;  2W82 A;  3ZQI A;  2EFN A;  4LIT A;  1JHF A;  1SFX A;  5DUI A;  1MD0 A;  3COA C;  1UST A;  5FLX Z;  1QRY A;  5GTI C;  1MBE A;  3KX2 A;  3V42 A;  3VOD A;  1RRJ A;  1K6O A;  1BI3 A;  2R7Q A;  4MHG A;  4UHT A;  2KIF A;  4I98 B;  3OYM A;  1S7A A;  3WHC A;  1RKT A;  2XAH A;  1BBY A;  4XNF A;  3IUO A;  4A3M J;  3ECO A;  3ISP A;  1X4O A;  3DEU A;  2QKL B;  4I0A A;  2VQL A;  3AFH A;  4NNJ A;  3BC8 A;  3J7A O;  1ULY A;  2X51 A;  5ILV A;  2ZJR F;  2PLY A;  3NWS A;  1JKR C;  5GAG J;  1J9I A;  3ABL H;  3TBI A;  1LFU P;  3IWF A;  4II3 A;  1DQU A;  2LRE A;  2KMU A;  1FSE A;  4ZTF A;  1Z6R A;  3OR1 C;  4I99 C;  3CCJ I;  1BC7 C;  2IGK A;  4ZH4 F;  3S2H J;  2HYG D;  1D0Y A;  2R7O A;  2L5Q A;  4BXX J;  3BCA A;  1XGM A;  3Q0W A;  3RKX A;  2MD5 A;  3R61 A;  2NS7 A;  3KFW X;  3BTL A;  3LA3 A;  4N9H A;  3BZK A;  4PGH A;  1X2M A;  1J75 A;  3TO9 A;  3K4C A;  2L01 A;  3R4K A;  3ZR8 X;  3LSJ A;  2HU9 A;  3PIP F;  1OIS A;  2DJI A;  2I10 A;  2L2O A;  4HV5 A;  3RPU D;  4YRV A;  2HDC A;  1P4X A;  1VQ9 I;  3C3W A;  4IHY A;  1W4M A;  4IQ4 A;  5K5Q A;  2VLA A;  4Z2Y A;  1MBG A;  3LSM A;  1R71 A;  2QQ9 A;  1VZ0 A;  3LAP A;  2NVY J;  1FZP B;  5KCM A;  3T1B A;  2WTE A;  2V1N A;  4YEJ A;  2WAE A;  3VB2 A;  1S7E A;  4OAZ A;  1VF9 A;  4OU0 A;  1G3W A;  1I3A A;  4XM3 A;  5D8K B;  5M5Y J;  3V8L A;  4CH7 A;  1T6S A;  3WU2 C;  2DQR A;  3CUQ A;  1DDN A;  2Y31 A;  2OU2 A;  4M9Z A;  1OCZ H;  3OYI A;  2M1B A;  5A2Q K;  4EAT A;  1YJN I;  2NVQ J;  1SVL A;  1OYY A;  3BJA A;  2LY1 A;  4D0P A;  2LR8 A;  3A01 B;  2EFW A;  1IN8 A;  4IRG A;  2PN6 A;  2DT6 A;  3BR6 A;  3TKY A;  1O3S A;  1JJ6 C;  1I1S A;  4MFD A;  4EV0 A;  1U5T A;  3ZMV A;  2WC2 A;  4IOC F;  5EJC A;  3O2P E;  3ZQ7 A;  1POG A;  2WB1 A;  1O3Q A;  2NAZ A;  3RSN A;  2E1N A;  2NVX J;  2ZFW A;  2QYO A;  2YX4 A;  3FXU A;  2EJR A;  5TGT A;  4EEF G;  2VBW A;  4ZJZ A;  4RM2 A;  1IAW A;  2FU4 A;  2RDP A;  4AD9 A;  1AOY A;  1LJ9 A;  2LYC A;  1S29 A;  4NC8 A;  5BPD A;  2MSY A;  3C2G A;  2GA2 A;  4EM0 B;  1WJ5 A;  3FHN A;  3WGG A;  2Z33 A;  2DXI A;  3J7Y J;  4ABZ A;  2Y0S A;  4I01 A;  2IP2 A;  2EK5 A;  4F91 B;  1MZB A;  1WZ2 A;  5FKK A;  3KE2 A;  4DJA A;  2J5P A;  2VQC A;  2H94 A;  2G7U A;  1WH5 A;  4RGU A;  4AVZ A;  3F8B A;  1JGG A;  3C1D A;  4G7O F;  4Q47 A;  3DKY A;  4KIS A;  1Z9C A;  2ZXJ A;  1G3T A;  3M1E A;  5BOX A;  4DIQ A;  4BAY A;  1SMT A;  4ETS A;  1XGO A;  2L9R A;  3E7L A;  2FBK A;  2F5V A;  1W7P D;  4A0X A;  4ENM A;  2ID6 A;  4HAM A;  4PJ0 C;  2O61 A;  1ZG5 A;  2VC1 A;  1DPU A;  2O03 A;  3VYR B;  3ERE D;  2GM4 A;  4RAZ A;  3HRS A;  1OCO H;  4Y13 A;  3J80 Z;  1B9N A;  2V79 A;  2M0C A;  4ZYD A;  1F43 A;  2EFQ A;  3I64 A;  1HCR A;  4OWR B;  2HKO A;  5L3B A;  3PQK A;  4HDU A;  1W7P B;  3WE3 A;  2R7V A;  3HIF A;  1WJE A;  4W1U A;  3FM5 A;  2ICW G;  5H6Q A;  4OIO F;  3BJ6 A;  4C2T A;  2F4I A;  3ZRG A;  3S32 A;  2MC4 A;  3DPT A;  2JSC A;  2IPQ X;  4KDP A;  4JP0 A;  2HS5 A;  2BE5 F;  1F36 A;  3DKX A;  2ZXW H;  3KP7 A;  1SFE A;  1B72 B;  4PGG A;  1LQ1 A;  1XMA A;  1KON A;  2LF8 A;  1F9N A;  1R1T A;  4D5F A;  1JUM A;  3Q0U A;  2CW8 A;  1I50 J;  4ITV A;  4M3E A;  4Y3O A;  2EB7 A;  4F3Q A;  2HVQ A;  4IVN A;  1NHA A;  3TGN A;  1TTY A;  1NG7 A;  1MBH A;  3F9K A;  2VUM J;  2FF4 A;  2XB0 X;  5D5X B;  5LD2 C;  2MA3 A;  2XKP A;  3KZY A;  2GOX B;  3H5N A;  3CCS I;  4CGZ A;  2FUG 2;  4GGG A;  1ETV A;  2ZSI B;  1D5V A;  4IRI A;  1JXS A;  4YIF A;  1XMX A;  5IP7 J;  3KP4 A;  1WKM A;  4KJZ A;  1IF1 A;  2FMY A;  2HDW A;  5LEJ A;  1BIA A;  1W0U A;  5LHI A;  2EBI A;  2JMW A;  1JKP C;  1SFU A;  2KJC A;  3DBR B;  5DCM B;  1YQA A;  3J81 K;  1NK3 P;  4A6E A;  1YO5 C;  2J5O A;  2K40 A;  1A04 A;  5EZH A;  5DD8 A;  5F0H A;  1ZAO A;  1SD7 A;  2JA6 J;  1U6G A;  1EV7 A;  1S9H A;  2H8W A;  2IS4 A;  2BY0 A;  3QOE A;  4P5O A;  5JVT A;  1T98 A;  1YS6 A;  3T0Y A;  5JR3 A;  3Q9V A;  3D0S A;  4IHT A;  1I6H J;  1EH7 A;  2LKP A;  2MLG A;  3GTO J;  5F0C A;  1HW5 A;  5F27 A;  1E2X A;  3V7S A;  3PO3 J;  1WJF A;  1ETQ A;  2DMQ A;  2VE9 A;  3DQV C;  4M6Y A;  2KZV A;  3BRO A;  4BUP A;  2Z1D A;  4M9S A;  3OS2 A;  1OKR A;  4P9U A;  2LH9 A;  5B66 C;  4U0W A;  1LVA A;  4HQE A;  3IAM 2;  4I7H A;  3WGH A;  1UHS A;  5HS9 A;  1LEB A;  2FA5 A;  1OMI A;  4KT6 A;  1P7I A;  4PJM A;  1J59 A;  3GTL J;  4BQO A;  2MD0 A;  2IGM A;  2XGD A;  1Z6T A;  1Y8Q B;  4L9V A;  1JJ8 C;  4PCQ A;  2RAE A;  2P0W A;  1D5Y A;  3MMY B;  4CA0 A;  2HXI A;  2UUZ A;  3BTI A;  5JLW A;  3GW2 A;  2Z9O A;  3WU1 B;  4A12 A;  1H89 C;  1T0F C;  2BBY A;  1P92 A;  5KAI C;  1YOV B;  5K7F A;  4JOM A;  3PIO F;  3CCU I;  2E2J J;  4EM1 A;  3S1R J;  1XD7 A;  2QEN A;  1KGS A;  1VQ6 I;  3F22 A;  1KQ8 A;  4HZF A;  1G6N A;  1TW2 A;  2EZK A;  3QYB A;  2Z3Y A;  2DBB A;  1U8R A;  1TZL A;  2CSO A;  3GTQ J;  1EKE A;  3K7A J;  2XVC A;  2XGC A;  2DMP A;  4I0B A;  3DF8 A;  1K4S A;  2GXA A;  2KLO A;  2UXN A;  2DA2 A;  3L2U A;  5ILU A;  1E17 A;  1J2X A;  2DFH A;  1ZKG A;  2O6G E;  2FML A;  5JHF A;  5IP9 J;  4BL0 B;  1VQO I;  2JUC A;  2FE3 A;  3BR0 A;  2F5E A;  3HRM A;  2VT3 A;  1W36 D;  2JRM A;  5E3M A;  1Y56 A;  1AKH A;  1BC8 C;  1FEX A;  3HSE A;  3NEU A;  2BEO A;  4QIW N;  2VKV A;  4KNY A;  3CMY A;  3LQR A;  4HF0 A;  4QSH A;  3VFZ A;  3W2V A;  2ZSH B;  3OYD A;  3WTT C;  2DPD A;  3LNQ A;  1RNL A;  3I71 A;  2DA4 A;  5FD5 A;  3GFI A;  3L00 A;  1HF0 A;  3BZ6 A;  1LFB A;  2HTJ A;  3ASO H;  5ICF A;  1YRN A;  1YLF A;  1ZYR F;  4LIU A;  2W24 A;  3D5L A;  2QCO A;  4UUS B;  2JZY A;  1JKO C;  3M1C A;  2QUF A;  2X4H A;  3QOD A;  3K1M A;  4XKC A;  3QAH A;  3JRF A;  2IRF G;  4R8H A;  3ZMZ A;  2CS3 A;  2V1X A;  2ID3 A;  5LLQ A;  1WVR A;  3OOP A;  2OAZ A;  1WHU A;  1FOW A;  2Z99 A;  3S2D J;  2TDX A;  2RN7 A;  3OV8 A;  2YU9 J;  3NQO A;  4HA8 A;  2R5Z A;  2LVS A;  2X1D A;  2ZME B;  4UUT A;  5LEK A;  2PFB A;  1TQI A;  1IN7 A;  1RI7 A;  3RDI A;  1Q1V A;  2XDV A;  2A61 A;  2CFO A;  1FBQ A;  5D5U B;  3CMA I;  2QSH X;  2Q2E B;  4RM3 A;  5HDN A;  3M8E A;  3ONQ A;  3ZQG A;  1FTZ A;  4XQF A;  4AYB N;  4N4N B;  1RPW A;  2HOA A;  4OIN F;  3GWZ A;  2R7U A;  3N05 A;  3I55 I;  3DLL F;  1TQP A;  4AIH A;  4F52 A;  2M30 A;  2EIJ H;  4S05 A;  2UZK A;  4HLX A;  4N0B A;  2ISZ A;  4XOP A;  4Y17 A;  3PUF A;  4CCO A;  1UFM A;  4G12 A;  2VJ5 A;  3KZZ A;  2CV0 A;  5FRM A;  1Y1V J;  2NRA C;  3KP2 A;  3RQI A;  2DFI A;  4P9F A;  3H0D A;  3JRC A;  1JT6 A;  5L3C A;  3P9K A;  1YW7 A;  1ZGA A;  3WTV C;  3CLO A;  2OF7 A;  3MAJ A;  2XRO A;  1XMK A;  3WTZ A;  3VSK A;  1YW8 A;  5JLX A;  4CDG A;  1EH6 A;  1AWC A;  3LSR A;  2AXT C;  1VI0 A;  3ZQF A;  1SVO A;  4HW0 A;  1ZQ3 P;  4B09 A;  4YFX F;  1FIA A;  2X48 A;  3SEQ A;  3OYK A;  5TIS C;  3GTM J;  5BS6 A;  1MH4 A;  1MBK A;  3CC7 I;  3S17 J;  2ZXI A;  3BTC A;  1U78 A;  4WXC A;  4KMU X;  3HPH A;  3G1O A;  1IN5 A;  1Q1H A;  2Y30 A;  2DYS H;  1H8A C;  2PI0 A;  4KFC A;  4BYY A;  1SC7 A;  3BG7 A;  4Y7N J;  4G6D A;  2XAQ A;  3S14 J;  3RZO J;  3KP3 A;  2DT5 A;  5E1W A;  4C2U A;  3ZMU A;  4D7N A;  4DYR A;  2JVH A;  5D4R A;  4RAF A;  4L0Z B;  4BJT A;  4BAC A;  2VKE A;  3RKW A;  2FBH A;  1UAA A;  5FB2 A;  5IOZ A;  3C7J A;  3QYF A;  3GX4 X;  2C6Y A;  3OYE A;  4IHS A;  4KIC A;  3OIP A;  3WTU C;  1IRG A;  1JI8 A;  1FP2 A;  1R49 A;  2KIS A;  4HYE A;  4G94 A;  4XIC A;  3JRD A;  4HQM A;  3FXR A;  2OC6 A;  5HLT A;  1VQP I;  3P9C A;  3BY6 A;  5K5O A;  4FIS A;  4E7I A;  2JSP A;  2R7W A;  2E71 A;  3GZ5 A;  5DUK A;  2MH9 A;  1J5Y A;  1ZEL A;  2L7K A;  2KIM A;  3C2B A;  3JSO A;  1OR7 C;  3WG9 A;  1IN4 A;  2LDU A;  1WQ2 A;  2XIG A;  3VPR A;  3ZMT A;  1MND A;  3BPX A;  3QWL A;  2HZD A;  5J4Y A;  3PO2 J;  1NK2 P;  2MW8 A;  4R79 A;  4XLP F;  1YHQ I;  1QU3 A;  3DXJ F;  2GLO A;  3HUG A;  2VOP A;  4IEJ A;  2OBP A;  2LY9 A;  4CO8 A;  2K7L A;  4NUB A;  1B8I A;  1UHW A;  3MZY A;  1PUE E;  2CMP A;  1ORK A;  4XSZ F;  2HFH A;  2CQX A;  2DA1 A;  4I09 A;  4KMF A;  4QPO A;  1D8J A;  2E19 A;  3VYT B;  4EJO A;  2DK8 A;  1JT0 A;  4PSX A;  1GVD A;  2WY7 Q;  1XSV A;  2D45 A;  3JAM K;  2NOJ B;  4XSX F;  4IHW A;  1ZN2 A;  4XKB A;  4BJ6 C;  2DN0 A;  5ED4 A;  3S3M A;  3M8F A;  5DM6 F;  4XOR A;  1IUY A;  1T8I A;  3G2B A;  2LP0 A;  1OJL A;  2IW5 A;  3U2R A;  4B3A A;  3DTE A;  1KYZ A;  1W1W E;  2LY2 A;  1WJC A;  1B9M A;  4BS9 A;  3NAR A;  1HKQ A;  2OTJ I;  4J00 A;  3WTX C;  3LQQ A;  2W1O A;  3HGY A;  1OCC H;  4XRF A;  3HRT A;  3KPH A;  3JW4 A;  2OZU A;  1HKT A;  3KZI C;  1K61 A;  4XKV A;  3IWZ A;  1XS9 A;  3A2K A;  1D1A A;  5F04 A;  1DPR A;  3HOZ J;  1TWA J;  3KEO A;  5D5W B;  4BEH A;  3Q3S A;  3S1Q J;  2ZO4 A;  3HOX J;  1FY7 A;  5GPC A;  5IT9 Z;  1IRX A;  1JHH A;  2FJ1 A;  2QBY B;  5J3L A;  4AM3 A;  1TW3 A;  2M7B A;  5J1R A;  4S04 A;  2WAF A;  3IRQ A;  1MDM A;  3LAJ A;  4ENJ A;  4CSW A;  2CWE A;  3G71 I;  2R5Y A;  1BOB A;  2F5D A;  3RPQ A;  1N78 A;  5FKL A;  2K9N A;  3CUQ C;  4HST A;  2JPC A;  4Q4Z F;  1BJZ A;  2HEO A;  1MGT A;  1WFX A;  1BR2 A;  2YX7 A;  5B3S H;  3GXO A;  3OY9 A;  4E7L A;  2PJP A;  5ILS A;  4QWQ A;  2FD5 A;  1X2N A;  2Q0O A;  3HTU A;  4CYC A;  1KA8 A;  4G6Q A;  1U5T C;  4C30 A;  2BVM A;  5KAF C;  1VFC A;  1SAX A;  1Z3X A;  1A36 A;  4EQQ A;  2XRL A;  2KJB A;  2UV1 A;  5IYD J;  3CCE I;  2O8X A;  2YUS A;  3H0G J;  4IL6 C;  5FRO A;  3HDD A;  4BE2 A;  1N75 A;  1Z77 A;  2M3A A;  1K78 B;  3GYH X;  1PUF A;  2VJJ A;  1MMN A;  2MH2 A;  3V8K A;  3DPL C;  3M3Y J;  1EH8 A;  2VXZ A;  4ZDP A;  5E1Z B;  5GPA A;  1D0X A;  2PJR A;  3ROU A;  4DBQ A;  5B5E C;  2HQR A;  5C3E J;  3GVA A;  3PM1 A;  1MBF A;  1UEL B;  4MTD A;  1BM9 A;  4FET A;  2XB5 A;  3H92 A;  1DP3 A;  3VWB A;  2VPL A;  3EQL F;  2LOO A;  2KRC A;  1BL0 A;  4BE1 A;  3N4M A;  4BY1 J;  1ON1 A;  2BZT A;  2DQL A;  1RUO A;  3BG9 A;  1ETO A;  4EJU A;  2YSR A;  5E8G A;  1JTX A;  3MVP A;  3F6O A;  5CJ9 A;  3FBI B;  2GZW A;  3OYB A;  3CDI A;  3PFY A;  1G4D A;  3PNY A;  3WE2 A;  3T8R A;  4ENN A;  1STZ A;  2ADU A;  4YEL A;  3BOQ A;  4D1Q A;  1PDN C;  4F93 B;  2BW3 A;  3T5X A;  5C4J J;  3SFI A;  3L2C A;  2KZG A;  3CCV I;  4TV7 A;  1V55 H;  2G9W A;  4GXO A;  1BR4 A;  5D6F A;  3ABK H;  2HOS A;  2GXB A;  1TBX A;  3PL8 A;  3QPL A;  5CYV A;  4CXF A;  3EUK L;  3RCO A;  3BG6 A;  2E36 A;  4QLC U;  2VON A;  2XAU A;  2W48 A;  1G59 A;  2X6Y A;  2ZBK A;  2V9V A;  2R4G A;  2DA5 A;  4FQG A;  1W5S A;  2DMU A;  3WG7 H;  5DS9 A;  2IXS A;  1Y8R B;  3K2Z A;  5E3N A;  5E8I A;  3HHG A;  3HPG A;  1LVK A;  4N9I A;  4BHP A;  1HXD A;  2IBD A;  3CCM I;  1LE8 B;  2E1C A;  2R3S A;  5E18 F;  4XR6 A;  2CW0 F;  4XLC A;  3GF2 A;  2XF6 A;  2HVS A;  2R7D A;  1XGN A;  1ON2 A;  4LD5 A;  3OL4 A;  5D6E A;  1IDZ A;  2VQH A;  5DEQ A;  3ABM H;  4DYC A;  2XSD C;  5FFZ A;  1PP8 F;  3PNV A;  5ICG A;  3OIQ A;  2CG4 A;  5KK1 A;  2X0L A;  3BDD A;  1RET A;  3BQZ A;  1I27 A;  1DGR M;  1I3Q J;  4CCM A;  4RB0 A;  1RC9 A;  1QVU A;  3HXL A;  4M6V A;  4N4O B;  2M0M A;  3F8M A;  1QO0 D;  4KUM A;  1R6R A;  5CVJ A;  3HB9 A;  2CQ7 A;  2CU7 A;  4GYG A;  2DJN A;  3TDU C;  5H2F C;  3I53 A;  3A0H C;  2K3F A;  3CUO A;  1YI2 I;  1WH7 A;  1RKW A;  2DOE A;  1FP1 D;  5LGN A;  3R6S A;  1FC3 A;  3SZT A;  4AIK A;  2BXZ A;  4IJA A;  5IOY A;  3CO7 C;  1SEU A;  1IW7 F;  1R23 A;  4G7Z F;  5GP9 A;  2LFB A;  1QHG A;  3J80 K;  2JQ7 A;  1WSU A;  2LC2 A;  4A3K J;  3OL3 A;  2R93 J;  1X1A A;  1LDD A;  2JA5 J;  1IGN A;  2CRG A;  2R7Z J;  5F6F A;  5TRD A;  2EZI A;  3E5Q A;  3K2A A;  2VB6 A;  3HEF A;  5EZG A;  4AYB A;  2ME6 A;  2PMH A;  1O7F A;  2QLZ A;  4PDK A;  5TJJ A;  5EGO A;  3OSF A;  3F8C A;  1H88 C;  5E1X A;  5L3G A;  1Y6I A;  4B47 A;  2WV1 A;  2A05 A;  1AHD P;  4Y52 J;  3FMS A;  4V2F A;  1UG2 A;  3RKY A;  3TP3 A;  3I0T A;  2R0Q C;  3PQJ A;  1V3F A;  1Y0N A;  3I9V 2;  1JKQ C;  2XGE A;  1ETK A;  3CES A;  3IC7 A;  3JTH A;  4OMZ A;  2XSJ C;  5DD4 A;  1SVM A;  1YE9 A;  4IQJ A;  4A3C J;  1G3S A;  2KDO A;  2KIU A;  5K7H A;  1OQY A;  4BNC A;  1MW7 A;  1XDU A;  4D5C A;  3I4N J;  2QM3 A;  2L54 A;  3E6M A;  2LNB A;  3G1L A;  4JK1 X;  2JJ7 A;  4UB6 C;  1BOA A;  3GBG A;  4IX7 A;  1YRN B;  1IDY A;  4UXN A;  3KIO A;  3FMQ A;  1UJ8 A;  4EMS A;  3EUH A;  2AS5 F;  3M7G A;  5HLG A;  1T2K A;  4RB1 A;  3AG1 H;  3NRV A;  1TT5 B;  3B73 A;  1SFO J;  2KIQ A;  4FHT A;  4A5M A;  5F1R A;  4XKW A;  4RLF A;  2FEZ A;  1TQM A;  1X1B A;  2MC3 A;  1A5J A;  5JI6 A;  4E7K A;  4EM2 A;  4MEX F;  1YIO A;  4LB5 A;  3K0L A;  2Y9Y A;  3DTI A;  2X6X A;  4LK0 F;  3TP0 A;  1ETW A;  2R7F A;  4L0Y B;  2R5Z B;  2DDB A;  3I4P A;  4WK8 F;  3AL0 B;  1TLH B;  2VBY A;  2KRF A;  2MG4 A;  5AIP A;  2EFO A;  2P6S A;  1UG0 A;  3CDL A;  1D3Y A;  3HSR A;  4IPA A;  1SFK A;  5F08 A;  1GV5 A;  2PMZ N;  1D1B A;  3ELK A;  3OMY A;  2ZJQ F;  2XPV A;  4UVA A;  3BG3 A;  5CVV A;  2CQN A;  1MNE A;  2GAU A;  1U3E M;  1MBJ A;  2CO5 A;  4X6A J;  1MMD A;  4L9N A;  3BQY A;  1WI9 A;  1V5E A;  1OYI A;  1RR8 C;  3VOE A;  2HPM A;  3SQN A;  1X1D A;  4A69 C;  1YX5 A;  4U87 A;  2VN2 A;  3W3C A;  3LSG A;  2TCT A;  2QF7 A;  3QQA A;  3IKT A;  2FRH A;  5BMZ A;  2K4B A;  2M4K A;  4B4C A;  2WBM A;  3QU6 A;  4U0Y A;  2K27 A;  4EVI A;  2L7F P;  3CCQ I;  3S2W A;  1I6X A;  2VOD A;  1FOX A;  3HOU J;  3TOA A;  3KET A;  1T39 A;  5EYR A;  1XCV A;  2X1C A;  3ZMS A;  3FXL A;  2IAI A;  2B9S A;  2L7M P;  2NS8 A;  1XG1 A;  4I02 A;  4XLF A;  3SFZ A;  2MGQ A;  3H9J A;  1MMS A;  5KNL A;  2HQN A;  4M9X A;  3CF5 F;  1BI1 A;  3RPU A;  3KYC B;  1UB9 A;  2L9V A;  1TWF J;  4IO9 F;  4A3J J;  2ZC2 A;  5ICE A;  4UY8 I;  2DMT A;  2K9Q A;  5ERI A;  2L02 A;  4M6X A;  1FWZ A;  4E7J A;  3AG4 H;  3R0A A;  1OCP A;  4U7D A;  3ESW B;  3A01 A;  4L18 B;  1BJA A;  3CQZ J;  3TDZ C;  1ZR4 A;  1X1P A;  2DA3 A;  4IXA A;  3K4N A;  4OOI A;  1DU6 A;  4IRH A;  3VYU B;  1HW2 A;  4GYI A;  3HL2 A;  4PZJ A;  5J1Y A;  3H35 A;  2M8E A;  2PX9 A;  1TNS A;  3JRE A;  3CO6 C;  2R7R A;  3DKW A;  1IV8 A;  3D1N I;  2V6C A;  1KZH A;  4XLH A;  1YFH A;  4KN4 X;  3SHF A;  1U9N A;  1V5G A;  2G0E A;  4M74 A;  3AL0 C;  2ZXH A;  1LEA A;  3QPT A;  5HDG A;  1YW9 A;  4CCN A;  1R9T J;  3PFI A;  3KP5 A;  1FBS A;  3K4J A;  5EG0 B;  2OTL I;  4YFN F;  5F0F A;  3UNG C;  3IL2 A;  3QP6 A;  3C2H A;  1YTY A;  3ABU A;  1BA5 A;  1Y1W J;  2IS1 A;  2COM A;  1GVJ A;  5AON A;  4HRI A;  5FGM A;  5J4V A;  5JHU A;  2A5Y B;  1SD6 A;  3K4B A;  1MJB A;  1ZTR A;  3ZXS A;  1IUF A;  1WRJ A;  2BY3 A;  2DCE A;  3ECH A;  4F7Z A;  1WJA A;  4B1R A;  4E7H A;  2D1H A;  2GA1 A;  2O0Y A;  3M07 A;  2JVG A;  4RS8 A;  2R7T A;  4BY7 J;  1OCT C;  2KP6 A;  2GIV A;  1DP7 P;  1ZRE A;  3QOP A;  3TL4 X;  2BVL A;  5C4X J;  1CGP A;  3OIO A;  1TWH J;  5FFX A;  1T56 A;  2XF7 A;  2E5Z A;  3P5J A;  1B4A A;  3CDH A;  3OS1 A;  2YU3 A;  3VDX A;  4A3L J;  1HDP A;  1HLV A;  3CMM A;  2XF5 A;  4HBL A;  1HQC A;  1R00 A;  1OPC A;  1PJR A;  2IA2 A;  1ZRD A;  5CKT A;  3S16 J;  3ZN1 A;  2HVR A;  3VSL A;  1TT0 A;  1W7P A;  4LGW A;  5JVG F;  3M8J A;  2K4J A;  1HBX G;  5HS8 A;  1VQN I;  1ITY A;  1E0E A;  1FPQ A;  1IRF A;  1ZHF A;  1A6Q A;  2L4A A;  3T8T A;  2DDA A;  3FXJ A;  1VQK I;  2W84 A;  1S6L A;  5LRR A;  1VTN C;  1RZ4 A;  2IS6 A;  2H1K A;  3PNT A;  1HSJ A;  3GFM A;  1QGP A;  4HV6 A;  1YS7 A;  2MFZ A;  2TRT A;  1WJD A;  3E0J B;  2VE8 A;  1ZG3 A;  2Y75 A;  3BLY A;  3SEZ A;  1B72 A;  4GDF A;  3I54 A;  1FNN A;  3HSF A;  1S3J A;  2V26 A;  2JT1 A;  3RYR A;  4BHC A;  4CZZ A;  4ENK A;  1C0W A;  4RAY A;  1S8N A;  3E3V A;  2IGO A;  4O6J A;  4UV9 A;  2GBY A;  3FMR A;  4A3I J;  2B7E A;  1TNT A;  3RZD J;  4BBR J;  5F1J A;  2A07 F;  3UR3 C;  4OAY A;  3HG9 A;  4BEH B;  3E6C C;  4B3X A;  1TC3 C;  1IXR C;  2LBF B;  3H5R A;  2PMU A;  3RQ4 A;  1IXC A;  2Q8K A;  2P7C B;  4E70 A;  2LD5 A;  2MBF A;  2HPI A;  2A5W A;  4C3I J;  4HG2 A;  4D7M A;  2R5Y B;  2JA7 J;  1XN7 A;  3EET A;  3CCR I;  2P5L C;  4A2U A;  3G73 A;  1LDJ A;  4PJL A;  2VJ4 A;  4CCJ A;  1ZH5 A;  2JN6 A;  3FF5 A;  3MKW B;  4ZZD A;  4GO1 A;  5HLH A;  2RC4 A;  4G8X A;  3AKZ A;  5GTH C;  4HX4 A;  3IV5 A;  3BR2 A;  3HRU A;  1D8K A;  1KU3 A;  2Y0M A;  2KPM A;  5EEG A;  4CYC B;  3OYJ A;  5M5X J;  3JCU C;  2RNJ A;  5GAD J;  4MLO A;  1VQM I;  3EYI A;  3CCY A;  4UV8 A;  5LHH A;  1E3O C;  5JFR A;  3DWL E;  4KIF A;  1DGW Y;  5M5W J; 
#chains in the Genus database with same CATH homology
 2GXG A;  2NNY A;  1IZ1 A;  1KQ9 A;  3GFJ A;  1O57 A;  2DW4 A;  2JPB A;  5E17 F;  2HYF A;  4WX9 A;  4OIR F;  6PAX A;  3TQN A;  4KT5 C;  5HOO A;  2CFX A;  4RB3 C;  2QZ8 A;  1P6R A;  3V7C A;  4HX7 A;  3LA2 A;  5DV5 A;  2ESN A;  2P8T A;  2P5V A;  1CF7 A;  3O6B B;  2V1D A;  4H0E A;  3TO7 A;  1XCB A;  4ESF A;  3E5X A;  3MEX A;  3FHZ A;  4A5N A;  1R5H A;  2DAO A;  1ZLK A;  4JQF A;  3CUQ B;  4G9Y A;  2V1U A;  4ON0 A;  2QVO A;  3I59 A;  2ZKZ A;  3LWF A;  1U5T B;  4ZYG A;  5BPI A;  3GFL A;  1P4W A;  4LLL A;  1J0R A;  4A0Z A;  3FWE A;  2ACJ A;  1HKS A;  1BIB A;  1QPM A;  3MCZ A;  2ETH A;  1REP C;  4MEY F;  1MJ9 A;  5E20 A;  3RYP A;  1FBU A;  4M73 A;  3R0J A;  1KYW A;  5D4S A;  2ZCW A;  3BPV A;  1XGS A;  5D8L B;  4HOB A;  4ASN A;  2HOE A;  3HYI A;  4DNC A;  5HVQ C;  4EGY A;  3HTS B;  3KLO A;  3LFK A;  2HKX A;  5J8C A;  2W25 A;  2XAF A;  3FZV A;  3MFK A;  2A6E F;  4P55 A;  2IT0 A;  1K7A A;  3KLN A;  2VC0 A;  5FLX K;  1L0O C;  5CVI A;  1Z05 A;  3HHH A;  3ZMD A;  4LLG F;  2DU9 A;  5KVR A;  4IF4 A;  1I5Z A;  1MJA A;  2H6B A;  3BJO A;  1HW1 A;  2Q2E A;  2BV6 A;  4EGZ A;  4BH9 A;  1GXQ A;  3DFG A;  1ZLJ A;  1IXS B;  1KQ0 A;  1GXP A;  1BN5 A;  2OQG A;  4EJV A;  4EJW A;  4ESJ A;  2K02 A;  1H9G A;  3V7R A;  5BQT A;  5H20 A;  4HF1 A;  4HF2 A;  4A6D A;  1QNT A;  4XLN F;  2JRT A;  3REO A;  5LGU A;  1R36 A;  2VBZ A;  1R1U A;  2RV8 A;  2E7X A;  2ESH A;  3P7N A;  4Q5S F;  1KU9 A;  1FLI A;  3WTY C;  4OIP F;  3Q5F A;  1QZZ A;  5L3E A;  4UVC A;  1SMY F;  2F5F A;  2M5W A;  3WOD F;  4BQA A;  3N97 A;  2H27 A;  2RQP A;  3HOS A;  4OIQ F;  2DTR A;  2P5K A;  2IJL A;  3E5U A;  5CVU A;  5HLI A;  1FOK A;  1IN6 A;  1R22 A;  2XAG A;  2DPU A;  4L9J A;  3QPH A;  1DUX C;  2W85 A;  3MWM A;  4KYW A;  3C18 A;  2STT A;  3P9I A;  4ZZL A;  4RB2 C;  4FX0 A;  2A69 F;  2RGV A;  3QRF F;  3G3Z A;  2B0L A;  3BP8 A;  3TO6 A;  1XSD A;  1L3L A;  3E6D A;  1Z7U A;  3MQ0 A;  1F4K A;  3WTS C;  3IRR A;  4WXD A;  3RIR A;  5A2Q Z;  3CJN A;  5IT3 A;  1ZRC A;  3V4G A;  4B8X A;  4MNU A;  1W5T A;  4WXH A;  2ZNZ A;  2DI3 A;  3ABT A;  4LG0 A;  1F1Z A;  2W57 A;  4K2E A;  1FT9 A;  2PBI A;  4YFK F;  4NQW A;  1USS A;  3KEQ A;  3KCC A;  2YPR A;  3BWG A;  1H0M A;  1QBJ A;  3ULQ B;  2KKO A;  1QQI A;  3ZP5 A;  2ISY A;  3DV8 A;  3RJP A;  5LGT A;  1O3T A;  1BI0 A;  3FM3 A;  1B6A A;  4RGS A;  3QP5 A;  3RTR A;  4ZYH A;  2MLK A;  2K86 A;  3K1P A;  3F8F A;  2XUB A;  4R1H A;  3ZN0 A;  2F2E A;  3W6J B;  1R58 A;  1B1B A;  3FXQ A;  2DK5 A;  3F3X A;  4LK1 F;  2QBY A;  2FSW A;  1XDS A;  4WWC A;  4JBA A;  4OMY A;  3QU3 A;  4UVB A;  4L9T A;  4ZYE A;  4WF2 A;  1RIO H;  2CYY A;  4HX8 A;  2EV6 A;  5K1Y A;  4O3M A;  4KIG A;  4AVP A;  1K78 A;  3GUD A;  4U0V A;  4RGR A;  1K79 A;  2A6H F;  3K69 A;  3W6K B;  2LF7 A;  4FX4 A;  3K1N A;  1JGS A;  3SXY A;  1G3Y A;  2ZJ2 A;  1XSX A;  5HS7 A;  2EA4 A;  4UNO A;  5CVR A;  2FOK A;  1GHC A;  2HTS A;  5LHG A;  2NNN A;  2OA4 A;  3HOT A;  2XGX A;  3WGI A;  4I2O A;  1O7L A;  4KN7 X;  3J81 Z;  2EV5 A;  4LJZ F;  3E6B A;  2VBX A;  2D1V A;  3CTA A;  1P2F A;  2VOO A;  1B59 A;  3F6V A;  2XKO A;  5J8F A;  4Q48 A;  2H6C A;  1OYW A;  4HDV A;  2EWN A;  4UUV A;  2QQA A;  4MQ9 F;  4CIC A;  1CF7 B;  1FSH A;  2YR2 A;  3DP7 A;  4CYD A;  3L09 A;  4M71 A;  5FD6 A;  2GWR A;  4NB5 A;  2P6T A;  3ZPL A;  1ZGJ A;  2NYX A;  2HZT A;  1R5G A;  4AIJ A;  4MGR A;  1WWX A;  5DYM A;  2STW A;  5H6R A;  4LMY A;  3JTG A;  2IA0 A;  2AXL A;  3I59 B;  4XBF A;  3O3K A;  2H09 A;  4Y15 A;  2PEX A;  2F5C A;  3L7W A;  3IHU A;  2E7W A;  1J7K A;  4WCG A;  2Y48 A;  5LBQ A;  3SZP A;  2ELH A;  1R7J A;  3F72 A;  3F8N A;  3FX3 A;  1ONV A;  1LB2 A;  4G7H F;  4HLY A;  2NS0 A;  4NHJ A;  5K5R A;  5HDK A;  3H3Z A;  4O5V A;  1H9T A;  1KU7 A;  2Z5U A;  2OZ6 A;  1T38 A;  2WWY A;  1F5T A;  1FYK A;  2G7H A;  4YII A;  4KIB A;  3I58 A;  1UCR A;  1YYV A;  1UHM A;  3B02 A;  3LST A;  4DQ2 A;  3GZ6 A;  1FYM A;  3GEZ A;  1T0F A;  2XV4 S;  5AIQ A;  2D2W A;  4LFU A;  1Z91 A;  1U2W A;  2PG4 A;  2PQ8 A;  3U1D A;  1MDM B;  2FNA A;  1P4A A;  3E97 A;  2P7V B;  3WU0 A;  4MQV A;  5F64 A;  1LDK B;  3R60 A;  5DCM A;  1XB4 A;  5EEH A;  5ICC A;  3U9G A;  2L4M A;  1X3U A;  5DCF A;  2M87 A;  2HWV A;  2UWM A;  2ZNY A;  3K9T A;  3EYY A;  3KP6 A;  1BI2 A;  5J6X A;  2LSO A;  2WV0 A;  5D5V B;  2FBI A;  5L3F A;  4YG2 F;  2HGC A;  1Y0U A;  4FT8 A;  1JE8 A;  2FXA A;  2IA1 A;  4A0Y A;  3LA7 A;  2HR3 A;  3H3U A;  1FYL A;  1ZG1 A;  2IVM A;  2GQQ A;  2OQR A;  3WTW C;  4L5I A;  1Z1D A;  2L3D A;  4M72 A;  1ZRF A;  2M45 A;  1O3R A;  3EDP A;  3RI4 A;  1LNW A;  2OD5 A;  3ML6 A;  2XAJ A;  4MTE A;  1KU2 A;  2VT2 A;  3MZH A;  3VEP A;  2EA2 A;  1PP7 U;  2BYV E;  4P96 A;  2RKH A;  2FNP A;  3V8J A;  1FX7 A;  2UXX A;  4LLN A;  1ODD A;  2EV0 A;  3Q9S A;  4BHB A;  1I1G A;  3GLX A;  1HST A;  2FQ3 A;  1R1V A;  1RUN A;  2DO7 A;  2O3F A;  3GO5 A;  1QZY A;  4U88 A;  3F23 A;  2CQK A;  2RVC A;  2QWW A;  1SD5 A;  1MKM A;  2EFP A;  5CLS A;  4LG0 B;  4U7B A;  2P4W A;  4EJT A;  5IT9 K;  4L5J A;  2A3S A;  2XRN A;  4AWX B;  1ZAR A;  3I5U A;  2CGP A;  2BGC A;  3JAM Z;  1S7O A;  3JSP A;  4KA4 A;  2QQB A;  5LRS A;  3IKV A;  4CHU A;  4RGX A;  4GCV A;  3TOB A;  3AAF A;  4LB6 B;  3F21 A;  4BXU A;  2JTV A;  2ZME A;  4ESB A;  2XAS A;  5DDG A;  1V4R A;  1YG2 A;  5L3D A;  3L9F A;  2DLL A;  1OR7 A;  2XHK A;  3M9A A;  2A68 F;  5FO5 A;  1SD4 A;  2EFN A;  1JHF A;  1SFX A;  5DUI A;  1MD0 A;  3COA C;  1UST A;  5FLX Z;  3VOD A;  1K6O A;  1BI3 A;  4MHG A;  4UHT A;  2KIF A;  4I98 B;  1S7A A;  2XAH A;  1BBY A;  3ECO A;  3ISP A;  3DEU A;  4I0A A;  3J7A O;  1ULY A;  5ILV A;  2PLY A;  1J9I A;  3IWF A;  1FSE A;  1Z6R A;  1BC7 C;  4ZH4 F;  2HYG D;  1XGM A;  3RKX A;  2MD5 A;  3R61 A;  3KFW X;  3LA3 A;  4N9H A;  4PGH A;  1J75 A;  3TO9 A;  2L01 A;  3R4K A;  4HV5 A;  2HDC A;  1P4X A;  3C3W A;  1W4M A;  5K5Q A;  4Z2Y A;  2QQ9 A;  3LAP A;  1FZP B;  3T1B A;  2WTE A;  3VB2 A;  4OU0 A;  1G3W A;  5D8K B;  3V8L A;  1T6S A;  2DQR A;  3CUQ A;  1DDN A;  2OU2 A;  4M9Z A;  2M1B A;  5A2Q K;  3BJA A;  1OYY A;  4D0P A;  2EFW A;  1IN8 A;  4IRG A;  2PN6 A;  3TKY A;  1I1S A;  1O3S A;  4EV0 A;  1U5T A;  3ZMV A;  2WC2 A;  3O2P E;  3ZQ7 A;  1O3Q A;  2NAZ A;  2E1N A;  2ZFW A;  2QYO A;  2YX4 A;  3FXU A;  2EJR A;  2VBW A;  1IAW A;  2FU4 A;  2RDP A;  4AD9 A;  1AOY A;  1LJ9 A;  1S29 A;  5BPD A;  2GA2 A;  4EM0 B;  3WGG A;  2Z33 A;  4I01 A;  2IP2 A;  2EK5 A;  1MZB A;  3KE2 A;  2J5P A;  2H94 A;  2G7U A;  4RGU A;  3F8B A;  3C1D A;  4G7O F;  4Q47 A;  1Z9C A;  2ZXJ A;  1G3T A;  3M1E A;  5BOX A;  4BAY A;  1SMT A;  4ETS A;  1XGO A;  2FBK A;  1W7P D;  4A0X A;  4ENM A;  4HAM A;  2O61 A;  1ZG5 A;  2VC1 A;  1DPU A;  2O03 A;  3ERE D;  4RAZ A;  3HRS A;  4Y13 A;  3J80 Z;  1B9N A;  2V79 A;  4ZYD A;  2EFQ A;  3I64 A;  2HKO A;  5L3B A;  3PQK A;  4HDU A;  1W7P B;  3WE3 A;  3HIF A;  3FM5 A;  5H6Q A;  4OIO F;  3BJ6 A;  3DPT A;  2JSC A;  2IPQ X;  4KDP A;  2HS5 A;  2BE5 F;  3KP7 A;  1SFE A;  4PGG A;  1LQ1 A;  1XMA A;  2LF8 A;  1F9N A;  1R1T A;  2EB7 A;  4IVN A;  1NHA A;  3TGN A;  1TTY A;  2FF4 A;  5D5X B;  2MA3 A;  2XKP A;  3KZY A;  4CGZ A;  4GGG A;  1D5V A;  4IRI A;  1JXS A;  4YIF A;  3KP4 A;  1WKM A;  1IF1 A;  2FMY A;  5LEJ A;  1BIA A;  5LHI A;  1SFU A;  2KJC A;  5DCM B;  1YQA A;  3J81 K;  4A6E A;  1YO5 C;  2J5O A;  1A04 A;  5DD8 A;  1ZAO A;  1SD7 A;  1U6G A;  1EV7 A;  4P5O A;  5JVT A;  1YS6 A;  1T98 A;  3T0Y A;  5JR3 A;  3Q9V A;  3D0S A;  4IHT A;  1EH7 A;  2LKP A;  2MLG A;  1HW5 A;  1E2X A;  3V7S A;  2VE9 A;  3DQV C;  4M6Y A;  3BRO A;  4M9S A;  1OKR A;  4P9U A;  4U0W A;  1LVA A;  4HQE A;  4I7H A;  3WGH A;  5HS9 A;  1LEB A;  2FA5 A;  1OMI A;  1J59 A;  1Z6T A;  4L9V A;  4PCQ A;  3GW2 A;  2Z9O A;  3WU1 B;  4A12 A;  2BBY A;  1P92 A;  4EM1 A;  1XD7 A;  2QEN A;  1KGS A;  3F22 A;  1KQ8 A;  4HZF A;  1G6N A;  1TW2 A;  2Z3Y A;  2DBB A;  1U8R A;  2CSO A;  2XVC A;  4I0B A;  3DF8 A;  2UXN A;  5ILU A;  1E17 A;  1J2X A;  2O6G E;  2FML A;  2FE3 A;  2F5E A;  3HRM A;  2VT3 A;  1BC8 C;  3HSE A;  3NEU A;  2BEO A;  4KNY A;  3LQR A;  4HF0 A;  3VFZ A;  3WTT C;  2DPD A;  1RNL A;  3I71 A;  5FD5 A;  3GFI A;  3L00 A;  3BZ6 A;  2HTJ A;  5ICF A;  1ZYR F;  1YLF A;  2W24 A;  3D5L A;  2JZY A;  2QUF A;  2X4H A;  3K1M A;  3QAH A;  2IRF G;  4R8H A;  3ZMZ A;  2V1X A;  5LLQ A;  3OOP A;  2OAZ A;  2Z99 A;  2TDX A;  2RN7 A;  3OV8 A;  3NQO A;  4HA8 A;  2ZME B;  5LEK A;  2PFB A;  1TQI A;  1IN7 A;  1RI7 A;  3RDI A;  2A61 A;  1FBQ A;  5D5U B;  5HDN A;  3M8E A;  4OIN F;  3GWZ A;  1TQP A;  4AIH A;  2M30 A;  4S05 A;  2UZK A;  4HLX A;  4N0B A;  2ISZ A;  4Y17 A;  1UFM A;  3KZZ A;  2NRA C;  3KP2 A;  2DFI A;  4P9F A;  5L3C A;  3P9K A;  1YW7 A;  1ZGA A;  3WTV C;  3CLO A;  3MAJ A;  2XRO A;  1XMK A;  3WTZ A;  1YW8 A;  4CDG A;  1EH6 A;  1AWC A;  4HW0 A;  4B09 A;  4YFX F;  5BS6 A;  1U78 A;  4WXC A;  4KMU X;  1IN5 A;  1Q1H A;  2PI0 A;  4KFC A;  4BYY A;  4G6D A;  2XAQ A;  3KP3 A;  2DT5 A;  5E1W A;  3ZMU A;  5D4R A;  4L0Z B;  3RKW A;  2FBH A;  5FB2 A;  3C7J A;  3GX4 X;  2C6Y A;  4IHS A;  4KIC A;  1IRG A;  3WTU C;  1FP2 A;  4HYE A;  4G94 A;  4HQM A;  3FXR A;  3P9C A;  3BY6 A;  5K5O A;  3GZ5 A;  5DUK A;  2MH9 A;  1J5Y A;  2KIM A;  3JSO A;  3WG9 A;  1IN4 A;  2LDU A;  1WQ2 A;  2XIG A;  3ZMT A;  3BPX A;  4R79 A;  4XLP F;  3DXJ F;  3HUG A;  2VOP A;  2OBP A;  4CO8 A;  2K7L A;  1PUE E;  1UHW A;  3MZY A;  4XSZ F;  2HFH A;  4I09 A;  4KMF A;  1D8J A;  4EJO A;  2DK8 A;  1XSV A;  2D45 A;  3JAM K;  4XSX F;  5ED4 A;  1ZN2 A;  3M8F A;  1IUY A;  2IW5 A;  3U2R A;  1KYZ A;  1B9M A;  1HKQ A;  3WTX C;  3LQQ A;  4XRF A;  3HRT A;  3JW4 A;  2OZU A;  1HKT A;  3IWZ A;  1DPR A;  3KEO A;  5D5W B;  2ZO4 A;  1FY7 A;  5IT9 Z;  1JHH A;  2QBY B;  1TW3 A;  4S04 A;  3IRQ A;  1MDM A;  3LAJ A;  4ENJ A;  2CWE A;  2F5D A;  3RPQ A;  3CUQ C;  2JPC A;  4Q4Z F;  2HEO A;  1MGT A;  2YX7 A;  3GXO A;  2PJP A;  5ILS A;  4QWQ A;  2Q0O A;  3HTU A;  1KA8 A;  4G6Q A;  1U5T C;  1SAX A;  4EQQ A;  2KJB A;  2O8X A;  1K78 B;  3GYH X;  2MH2 A;  3V8K A;  3DPL C;  1EH8 A;  2VXZ A;  5E1Z B;  3ROU A;  2HQR A;  3GVA A;  4MTD A;  1BM9 A;  3H92 A;  3EQL F;  3N4M A;  1ON1 A;  1RUO A;  2DQL A;  4EJU A;  2YSR A;  5E8G A;  3F6O A;  5CJ9 A;  2GZW A;  1G4D A;  3WE2 A;  3T8R A;  4ENN A;  1STZ A;  2ADU A;  3BOQ A;  1PDN C;  3T5X A;  3L2C A;  4TV7 A;  2G9W A;  4GXO A;  5D6F A;  2GXB A;  1TBX A;  5CYV A;  4CXF A;  4QLC U;  2VON A;  2ZBK A;  2V9V A;  1W5S A;  3K2Z A;  5E8I A;  3HHG A;  4N9I A;  4BHP A;  1HXD A;  2E1C A;  2R3S A;  5E18 F;  2CW0 F;  3GF2 A;  2R7D A;  1XGN A;  1ON2 A;  4LD5 A;  5D6E A;  5DEQ A;  5FFZ A;  1PP8 F;  5ICG A;  2CG4 A;  5KK1 A;  2X0L A;  3BDD A;  1I27 A;  4RB0 A;  3F8M A;  1QO0 D;  4KUM A;  5CVJ A;  4GYG A;  3TDU C;  3I53 A;  3CUO A;  1FP1 D;  5LGN A;  3R6S A;  1FC3 A;  3SZT A;  4AIK A;  4IJA A;  3CO7 C;  1IW7 F;  1R23 A;  4G7Z F;  3J80 K;  1WSU A;  1LDD A;  5F6F A;  5TRD A;  3E5Q A;  2PMH A;  1O7F A;  2QLZ A;  4PDK A;  5TJJ A;  3F8C A;  5E1X A;  5L3G A;  3FMS A;  3RKY A;  3I0T A;  3PQJ A;  1V3F A;  4OMZ A;  3IC7 A;  3JTH A;  5DD4 A;  1G3S A;  2KIU A;  4BNC A;  1XDU A;  2QM3 A;  2L54 A;  3E6M A;  2LNB A;  4JK1 X;  1BOA A;  4UXN A;  3FMQ A;  4EMS A;  3EUH A;  2AS5 F;  3M7G A;  5HLG A;  1T2K A;  4RB1 A;  3NRV A;  3B73 A;  4FHT A;  4A5M A;  5F1R A;  2FEZ A;  1TQM A;  2MC3 A;  5JI6 A;  4EM2 A;  4MEX F;  1YIO A;  4LB5 A;  3K0L A;  4LK0 F;  2R7F A;  4L0Y B;  4WK8 F;  3I4P A;  1TLH B;  2VBY A;  2KRF A;  5AIP A;  2EFO A;  2P6S A;  1D3Y A;  3HSR A;  4IPA A;  3ELK A;  4UVA A;  5CVV A;  2GAU A;  1U3E M;  2CO5 A;  4L9N A;  1WI9 A;  1OYI A;  3VOE A;  3SQN A;  2VN2 A;  3IKT A;  2FRH A;  5BMZ A;  2K4B A;  3QU6 A;  4U0Y A;  2K27 A;  4EVI A;  3S2W A;  1I6X A;  2VOD A;  3TOA A;  3KET A;  1T39 A;  1XCV A;  3ZMS A;  4I02 A;  3SFZ A;  2HQN A;  4M9X A;  1BI1 A;  3RPU A;  1UB9 A;  5ICE A;  5ERI A;  2L02 A;  4M6X A;  1FWZ A;  3R0A A;  4U7D A;  4L18 B;  1BJA A;  3TDZ C;  4IXA A;  4OOI A;  4IRH A;  1HW2 A;  4GYI A;  4PZJ A;  2M8E A;  1TNS A;  3CO6 C;  3DKW A;  2V6C A;  1YFH A;  4KN4 X;  3SHF A;  4M74 A;  1LEA A;  3QPT A;  5HDG A;  1YW9 A;  3PFI A;  3KP5 A;  1FBS A;  4YFN F;  3IL2 A;  3QP6 A;  1YTY A;  3ABU A;  2COM A;  1GVJ A;  5AON A;  5FGM A;  5JHU A;  2A5Y B;  1SD6 A;  1MJB A;  1WRJ A;  3ECH A;  4F7Z A;  2D1H A;  2GA1 A;  2O0Y A;  4RS8 A;  2GIV A;  1DP7 P;  1ZRE A;  3QOP A;  1CGP A;  5FFX A;  1B4A A;  3CDH A;  2YU3 A;  4HBL A;  1HQC A;  1R00 A;  1OPC A;  2IA2 A;  1ZRD A;  3ZN1 A;  1W7P A;  4LGW A;  2K4J A;  1HBX G;  5HS8 A;  1FPQ A;  1IRF A;  1ZHF A;  2L4A A;  3T8T A;  2W84 A;  1S6L A;  5LRR A;  1VTN C;  1RZ4 A;  1HSJ A;  3GFM A;  1QGP A;  4HV6 A;  1YS7 A;  2VE8 A;  1ZG3 A;  2Y75 A;  3I54 A;  1FNN A;  3HSF A;  1S3J A;  2JT1 A;  3RYR A;  4BHC A;  4CZZ A;  4ENK A;  1C0W A;  4RAY A;  1S8N A;  3E3V A;  4O6J A;  4UV9 A;  3FMR A;  1TNT A;  2A07 F;  3E6C C;  1IXR C;  2PMU A;  1IXC A;  2Q8K A;  2P7C B;  4E70 A;  2MBF A;  1XN7 A;  3EET A;  2P5L C;  4A2U A;  3G73 A;  1LDJ A;  1ZH5 A;  3FF5 A;  4ZZD A;  4GO1 A;  5HLH A;  2RC4 A;  4G8X A;  4HX4 A;  3HRU A;  1D8K A;  1KU3 A;  2Y0M A;  5EEG A;  2RNJ A;  3EYI A;  4UV8 A;  5LHH A;  5JFR A;  4KIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...