3VB2A

Crystal structure of the reduced form of marr from e.coli
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
136
structure length
136
Chain Sequence
NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAISEQSHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Multiple antibiotic resistance protein marR
publication title The reduced form of MarR structure
rcsb
source organism Escherichia coli
total genus 46
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3vb2A00
1HQCA 4YFXF 2ELHA 2DI3A 2HOEA 2HTJA 5DUIA 3WTSC 3RPUA 2VBYA 1MJ9A 1J9IA 1Z91A 1RI7A 5FGMA 1HSTA 2M87A 4ZYDA 1LVAA 2A6HF 2D2WA 3ERED 1HW2A 4XBFA 4HBLA 4N9IA 4OOIA 2XAJA 2XKPA 2FA5A 2M45A 2XAFA 3HRMA 4PDKA 3V7CA 4OIRF 4LLGF 2EFQA 5ILUA 4G7OF 1FYKA 2P7CB 1QZYA 5DCMB 2Z3YA 2LSOA 4BHCA 1S3JA 2H6CA 5E1WA 3KEQA 1HW1A 1IW7F 3JTHA 3EUHA 4O5VA 4I7HA 1FSEA 3J80Z 4IRGA 1U5TA 3WTVC 3I0TA 3KZZA 3R0JA 5D4RA 4UHTA 4UV8A 1R1TA 4MQVA 1G3WA 4BQAA 1QBJA 2K02A 4KIFA 3WU0A 2WC2A 5AIQA 3QPTA 4LB6B 4N9HA 3DFGA 2XKOA 3BWGA 5D8LB 4EJOA 2M5WA 3K2ZA 1Z9CA 2QQBA 1SFXA 1D8KA 3C1DA 3WU1B 2YX4A 3HOTA 2R3SA 3JTGA 1O3SA 3I71A 2G9WA 4KIGA 2ADUA 4XLNF 1FSHA 1YO5C 3P9KA 4CO8A 1JHHA 3M8EA 2PEXA 2M8EA 1V3FA 2OD5A 3SFZA 2VXZA 1SMYF 1O3QA 4ZH4F 2DU9A 2HKOA 1A04A 1FP2A 2G7UA 2GZWA 1HKTA 2CG4A 2WTEA 4G7HF 5HS9A 1RUNA 1R5GA 5EEHA 2P6SA 1XGMA 3QU3A 4MTDA 1ON2A 3GYHX 2W25A 4B8XA 3C7JA 5JHUA 4Q48A 4RGSA 1BI1A 3EYYA 4E70A 4EGYA 3CO6C 1ONVA 3IWFA 3SZTA 1Z1DA 2O8XA 1BIAA 5FFZA 1WI9A 5CVJA 4HX8A 3HRUA 4UVAA 3ABUA 3KP2A 3O6BB 5DD8A 3KP4A 3GFJA 3HSRA 2QWWA 4OIPF 2HKXA 5BPIA 4LMYA 2STWA 2Z99A 4GGGA 3M9AA 3RDIA 4I01A 3NEUA 4G7ZF 2X0LA 3IL2A 2QZ8A 4LK1F 1S8NA 2O6GE 3MZYA 3JAMK 2A69F 3KEOA 4Y17A 4Q47A 5DV5A 3E5UA 1T0FA 4KT5C 2Q8KA 5CJ9A 4LLNA 3QP5A 3GZ6A 2L54A 4HLYA 3C18A 1PUEE 5JVTA 2VN2A 5E1ZB 2TDXA 5FB2A 1BC8C 3L9FA 5LGUA 4U88A 3L09A 4NQWA 2HQRA 2AS5F 4EV0A 4BXUA 2EA2A 3JW4A 3NQOA 4U7BA 2P8TA 3LWFA 2OQGA 3ECHA 4L5IA 2YSRA 3DKWA 2CYYA 2QM3A 2IA0A 1PDNC 4LK0F 3MZHA 3QP6A 4R8HA 2NNYA 4ZZLA 5D6FA 1OYYA 3I59A 2CW0F 3WODF 2MA3A 4Y15A 4G94A 1BI2A 2EFWA 2K7LA 5AIPA 3NRVA 2NNNA 2OU2A 1W5SA 1IF1A 2CFXA 3V8KA 5FLXK 2QBYA 1T98A 2ZKZA 3WE3A 3CUQC 3LA3A 1DP7P 4CZZA 2ESHA 2P6TA 3FXUA 4IF4A 3BOQA 2FQ3A 4ENNA 2RQPA 3GVAA 3FZVA 4LGWA 1R1UA 1FWZA 2QVOA 3HHHA 5TRDA 3TDZC 1F4KA 2FSWA 2ZMEA 3F8NA 2JPBA 4A6DA 1I1SA 2MBFA 4WXDA 1OYIA 3U1DA 2IA2A 1LEAA 4RB2C 3IRQA 1XGNA 1Z05A 2G7HA 3WGHA 2XAQA 4HZFA 2QQ9A 1ZG1A 3I4PA 2DPDA 5FD6A 2H6BA 2L4AA 3HRTA 3H3ZA 2Q0OA 5LRSA 4Y13A 5D5WB 2XRNA 1ZHFA 2PN6A 3VFZA 4ZYGA 1CF7A 1R1VA 1TW3A 2DAOA 5ED4A 3LA2A 1P4XA 2IP2A 2RNJA 2PMUA 5D5XB 4IVNA 2M1BA 1UFMA 3CDHA 2VT2A 3T1BA 1YTYA 2UWMA 2V79A 1SD6A 1ZG5A 2YU3A 1EV7A 4PCQA 5IT3A 4ENMA 3GLXA 4XSZF 4LLLA 2K4BA 3DPTA 2MH2A 1K79A 5F1RA 1YG2A 2CWEA 2IPQX 2A6EF 2HTSA 4RB3C 3K1PA 5HDGA 5IT9Z 4Q5SF 4CHUA 2J5PA 3E5QA 1W7PB 3IC7A 1RUOA 3KP5A 3HHGA 1K6OA 1USSA 2P4WA 3IHUA 2IW5A 2LF8A 5KVRA 3QRFF 1FBQA 5L3CA 1WRJA 4GO1A 3T8RA 2EFNA 1IXCA 1BIBA 1P4AA 1FY7A 1KQ9A 2D1HA 1WKMA 1J0RA 2WWYA 2UXXA 1XB4A 2KIUA 5JFRA 4CGZA 1HKQA 4EJTA 4KFCA 4KA4A 3TGNA 4KN4X 3TO7A 4HA8A 3JSPA 1HKSA 2YPRA 3GWZA 5FD5A 4IXAA 3L00A 3J80K 3T5XA 1GXPA 1R22A 3ZMDA 2YR2A 2KIFA 2MC3A 1KU9A 4DQ2A 1Z6RA 1F5TA 3MAJA 3K1MA 4P96A 4RGRA 4WX9A 1AOYA 2XVCA 4U0WA 1T39A 4FHTA 3HSFA 2J5OA 2E7WA 5J6XA 1UCRA 2GWRA 3ISPA 3BJOA 4M72A 1Z7UA 4I02A 5AONA 3EYIA 4LG0A 1V4RA 5BMZA 3P7NA 1J2XA 3E6CC 4NHJA 5D8KB 1W4MA 2HFHA 1LQ1A 3PQJA 1LEBA 3Q9SA 3FX3A 3KCCA 1U6GA 4IHTA 2JSCA 1YYVA 1JXSA 3SHFA 2VOPA 1H9TA 3RKXA 1FPQA 1BBYA 4XLPF 2HEOA 2VBWA 2FNPA 1S7AA 1E17A 5F6FA 2STTA 2XGXA 4M9XA 4RS8A 1GHCA 4FT8A 2BYVE 1RIOH 3CLOA 2QYOA 5K5RA 4DNCA 5E8GA 4H0EA 2VC1A 3ZPLA 4OINF 1UB9A 3F6OA 3CUQA 2VOOA 1I1GA 3BROA 2LDUA 4EVIA 1IAWA 5E1XA 2BBYA 2K86A 3K0LA 2XAGA 2JPCA 3TQNA 1K78A 3EQLF 3F8BA 1S7OA 3MQ0A 1REPC 5LHGA 1TLHB 2H09A 2RV8A 2V1UA 2A68F 1FP1D 2JZYA 2QLZA 4KICA 2ETHA 4LG0B 2EFOA 4A0XA 2HZTA 4B09A 2GXBA 2W84A 5D5VB 3EETA 3M1EA 2NAZA 3GUDA 1QQIA 4MHGA 3Q5FA 3QU6A 2E1NA 4M71A 4LD5A 1O3RA 1ZREA 2OZ6A 1XMAA 1ON1A 4RAYA 3F72A 2XV4S 1OR7A 4P55A 1PP7U 1MGTA 2HYGD 2IVMA 5CVIA 5K1YA 1ODDA 1TNTA 5JR3A 5CVUA 1J75A 1T38A 1U5TB 2KJBA 3FXQA 4A2UA 4N0BA 2R7DA 4BH9A 3V7SA 1OYWA 1YW9A 2OA4A 1OMIA 2FBIA 2QUFA 4IJAA 5DUKA 1U78A 1XSXA 4L0YB 2EA4A 1B9NA 2RKHA 1ZGAA 4TV7A 4IRIA 5LGTA 4D0PA 5H6QA 3R4KA 2NRAC 2VODA 4HX7A 1KQ0A 1J7KA 4EM1A 5DCFA 4F7ZA 3TO6A 3W6KB 3VEPA 3IWZA 4FX0A 5HLHA 1IUYA 3J81Z 2VE9A 2FRHA 1FBSA 2DK5A 1HXDA 1B1BA 4YG2F 5LRRA 2Q2EA 1DUXC 1P6RA 1SFUA 2GA1A 3GW2A 4A12A 4HF2A 1YQAA 2EV0A 3REOA 2A61A 2ISYA 2MD5A 1DPRA 1MKMA 1TNSA 3QAHA 2Y48A 3KP7A 3FXRA 1ZRFA 3RYRA 3DF8A 2DPUA 2HS5A 2Y75A 1Q1HA 4CYDA 1C0WA 2H94A 3MFKA 4AIJA 2XAHA 3M8FA 2EV5A 3Q9VA 1BI3A 3FF5A 1TW2A 3COAC 5FFXA 3HTSB 1NHAA 1W7PD 2BGCA 1XDUA 3PFIA 2W85A 2GIVA 3GXOA 2GAUA 3FWEA 2V1XA 3HIFA 5HVQC 4KNYA 5HS7A 3E3VA 3BPVA 4WF2A 2CSOA 5ILVA 1KQ8A 1KGSA 3F6VA 4M6YA 2P5VA 5H20A 1IN8A 5EEGA 4BHBA 4KN7X 4U7DA 2VBXA 3O2PE 4BAYA 4UVCA 4EQQA 2F5CA 5E18F 3F3XA 1IRGA 1KYZA 5K5QA 3T8TA 5IT9K 2DT5A 4G9YA 2EWNA 4OIOF 3HOSA 4HYEA 5DD4A 3JSOA 3ZP5A 1FBUA 5CLSA 4JK1X 1SD7A 2DO7A 2XROA 2PMHA 1I6XA 4BYYA 2LF7A 3FM5A 4R79A 2F5FA 1AWCA 2K27A 3ZN1A 3LA7A 2FMLA 3RI4A 1R36A 1BJAA 2COMA 2OBPA 1H9GA 1Z6TA 2HWVA 3R6SA 1FC3A 1YW7A 3WTXC 3DQVC 1FX7A 3I59B 3KE2A 5E17F 2H27A 5CVRA 3W6JB 5LHIA 1D5VA 2KIMA 2XIGA 4L9JA 4MTEA 1ZYRF 4YIFA 2FBKA 2L02A 5A2QZ 2QBYB 1O7FA 1W5TA 3MWMA 4PZJA 4R1HA 1IN5A 4HDVA 1TQMA 1ZN2A 2P5LC 1O3TA 2HQNA 1BC7C 2VONA 1K7AA 3WTUC 2L3DA 3FHZA 3FM3A 2QQAA 4YFKF 4EM2A 1B59A 2P5KA 1R58A 3KLNA 4HV6A 4GYIA 4GXOA 2ZMEB 3GEZA 4A6EA 4P5OA 1QPMA 4YFNF 5LBQA 4WXCA 5HDKA 2V6CA 1YS7A 4M6XA 2Y0MA 4LJZF 3LQRA 3U9GA 5ICCA 1IN6A 2XASA 1ZGJA 1D3YA 2MH9A 3R0AA 3G3ZA 4AVPA 1HW5A 4AIHA 3KP6A 1O7LA 4O6JA 5DCMA 5D6EA 1PP8F 2C6YA 4WWCA 4P9UA 5BPDA 2F5EA 1FYMA 5DYMA 3F8MA 4MGRA 1CF7B 1XN7A 3FMRA 1TQIA 3VODA 2O0YA 4KMUX 4L18B 3CTAA 1MJAA 3ML6A 1SD4A 4JBAA 2FMYA 3LAJA 2JTVA 2DBBA 4LFUA 1BI0A 3I64A 1R7JA 4ESBA 5ILSA 2ZXJA 5BQTA 5ICFA 3GZ5A 5E8IA 1LJ9A 1YS6A 5F64A 4U0YA 1XGOA 5HOOA 2VBZA 2JT1A 4MNUA 2HYFA 3TO9A 1SFEA 1G3YA 1IRFA 4UV9A 1I27A 2ISZA 3MEXA 1DDNA 2PLYA 5L3EA 3BZ6A 3ECOA 3P9CA 1YW8A 3P9IA 1J59A 3F21A 1ZAOA 3L7WA 2XHKA 2Z5UA 5LGNA 4ENKA 4KDPA 1TBXA 1ZARA 5K5OA 1TTYA 3I58A 1LDDA 4ON0A 3D5LA 1T2KA 1EH7A 3HRSA 3RTRA 1FOKA 4XRFA 3RPQA 3K69A 2EV6A 3ZMUA 1WWXA 1U3EM 2DLLA 2P7VB 3DPLC 4PGGA 4KIBA 1LDJA 1MZBA 2F5DA 1Y0UA 4A5NA 1LNWA 2O3FA 1OKRA 3E5XA 1ZLJA 2BV6A 4KUMA 3ZMTA 3WTWC 2MLKA 4AIKA 4UXNA 5L3BA 2IT0A 1SD5A 3I53A 3B02A 3U2RA 4EJUA 3N4MA 1P92A 4KYWA 4HW0A 6PAXA 2B0LA 2V1DA 4HAMA 4HV5A 4M9SA 2RC4A 2EK5A 4GYGA 3BPXA 5CVVA 1BOAA 3HSEA 2RGVA 5HLIA 5DEQA 2M30A 2D1VA 3G73A 1JGSA 3R60A 3LQQA 4S04A 2ZBKA 4ESFA 5ICGA 2KJCA 3F23A 4K2EA 1FZPB 4O3MA 2RDPA 3H92A 5ERIA 1UHMA 4OMZA 3C3WA 4G8XA 4EJVA 1HBXG 3WTZA 3OOPA 5D4SA 2GXGA 4RGXA 2BEOA 5L3DA 4OIQF 3HYIA 3J81K 4WCGA 1OPCA 3LAPA 3V4GA 3HTUA 2LKPA 1P4WA 2W57A 3B73A 1VTNC 2K4JA 2FXAA 5J8CA 3E6MA 1YLFA 3GFIA 2A07F 4ESJA 4I2OA 2BE5F 4L9NA 2PJPA 3SZPA 1ZRDA 1ZRCA 4BHPA 5E20A 4A5MA 4BNCA 1R23A 1FYLA 4NB5A 3ULQB 2ZCWA 5HS8A 4ASNA 2GQQA 3CUQB 3KP3A 2ACJA 3I54A 3QOPA 1XGSA 2L4MA 2DQLA 1O57A 4L9VA 4U0VA 2VC0A 2Z9OA 2O61A 1KU3A 1K78B 1G6NA 1EH6A 4LB5A 1R00A 1FNNA 4I0AA 3ZMVA 1FLIA 1RZ4A 1MDMA 4UUVA 2W24A 3DXJF 1ULYA 1YFHA 5BS6A 3F22A 1E2XA 4HQEA 1G4DA 3RIRA 3I5UA 1XCBA 1IN7A 5H6RA 4L5JA 3V8JA 4IHSA 5ICEA 1F1ZA 4JQFA 4G6DA 4EMSA 2FNAA 2PBIA 1QNTA 4HF1A 4UNOA 1IXSB 2ZO4A 5LHHA 3R61A 2DFIA 3ZN0A 1H0MA 1HSJA 4MQ9F 2ZJ2A 4FX4A 1LB2A 2CGPA 2EJRA 3K1NA 4EGZA 4MEYF 5J8FA 2RVCA 3WGIA 3KZYA 4HQMA 2HDCA 2OQRA 2F2EA 2MLGA 2E1CA 1KYWA 2CQKA 1U8RA 4QWQA 3BJ6A 1J5YA 1DPUA 3IKTA 5HDNA 4IRHA 3E6BA 4PGHA 1SAXA 4M74A 3VOEA 3WTYC 1KU7A 1XSDA 2DQRA 2IA1A 4HOBA 5L3GA 1G3SA 2L01A 4RB0A 2OAZA 4QLCU 3WE2A 3WG9A 2QENA 1U5TC 2X4HA 3JAMZ 1XD7A 1ZG3A 1XSVA 4CICA 5L3FA 5A2QK 4WXHA 1GXQA 2PFBA 3CJNA 3BY6A 2PI0A 4YIIA 2NS0A 1MDMB 1R5HA 3H3UA 3HUGA 1S6LA 4HX4A 3IRRA 3DP7A 1W7PA 3BP8A 2RN7A 3FMSA 2PQ8A 5FO5A 2CO5A 3DEUA 3ROUA 3V7RA 4EM0B 3ABTA 3BJAA 3M7GA 4P9FA 3SQNA 2Z33A 3TOAA 1BM9A 4ENJA 1USTA 5LEKA 4L9TA 3ZMZA 2FBHA 5BOXA 1FT9A 3E6DA 1LDKB 4Q4ZF 4S05A 3O3KA 1QZZA 4CXFA 2KRFA 5HLGA 4ZZDA 1QO0D 4KMFA 1MD0A 1XCVA 4EJWA 4HLXA 3MCZA 4Z2YA 4HDUA 1L0OC 3WTTC 1B6AA 3RJPA 4ZYHA 2VE8A 3KLOA 3V8LA 4M73A 4XSXF 4I09A 2FEZA 1TQPA 5FLXZ 2EB7A 4G6QA 4IPAA 1X3UA 1B4AA 3ZQ7A 1D8JA 1IN4A 3RYPA 2NYXA 2JRTA 3VB2A 1MJBA 5D5UB 3QPHA 3GFMA 3PQKA 3TKYA 1YIOA 2WV0A 3EDPA 1WSUA 3FMQA 5DDGA 1XDSA 3TDUC 3GFLA 3KETA 2EFPA 1IZ1A 2A5YB 4AWXB 3ZMSA 5JI6A 5TJJA 2DK8A 2IJLA 3TOBA 3J7AO 3RKYA 1S29A 2ZNYA 1I5ZA 2KKOA 1SMTA 1IXRC 4ETSA 2VT3A 4UVBA 2R7FA 3GF2A 4AD9A 3GO5A 1F9NA 1RNLA 2XUBA 1ZH5A 4RB1A 3D0SA 1GVJA 4OMYA 1UHWA 4RGUA 2FU4A 4M9ZA 4GCVA 3T0YA 2GA2A 2UZKA 3CO7C 3GX4X 2ZFWA 3LSTA 1BN5A 1STZA 3E97A 5KK1A 2ESNA 3ELKA 4L0ZB 4MEXF 2ZNZA 3KFWX 4OU0A 2YX7A 1EH8A 3SXYA 3F8CA 3IKVA 1KA8A 1XMKA 4I98B 1L3LA 2AXLA 3DV8A 1JHFA 4A0YA 2DW4A 2A3SA 2E7XA 5CYVA 1CGPA 1U2WA 3F8FA 1T6SA 3N97A 2UXNA 3BDDA 2FF4A 2FE3A 1B9MA 2DTRA 4ZYEA 1G3TA 5LLQA 2IRFG 3OV8A 3WGGA 3S2WA 4CDGA 1QGPA 4WK8F 1WQ2A 2HGCA 3LFKA 2LNBA 2FOKA 1ZLKA 4RAZA 2V9VA 3AAFA 3K9TA 4HF0A 3CUOA 2PG4A 2HR3A 4I0BA 3RKWA 5LEJA 4A0ZA 2O03A 3L2CA 2D45A 1JE8A 1KU2A 2OZUA 1P2FA
chains in the Genus database with same CATH superfamily
1HQCA 4YFXF 4A3CJ 2ELHA 1WJEA 3H36A 1HF0A 3OYCA 2ZC2A 2DI3A 2HOEA 1TWFJ 2HTJA 1V5FA 2CW8A 2CS3A 5DUIA 5E3MA 2R7ZJ 1Y8RB 3WTSC 3RPUA 4F92B 2VBYA 3S17J 2E2IJ 1MJ9A 1J9IA 1Z91A 1RI7A 2UUZA 5FGMA 5B1AH 1HSTA 2M87A 4QPQA 3S93A 4ZYDA 1ZKGA 2DA1A 1LVAA 2A6HF 2D2WA 3ERED 1HW2A 4XBFA 4HBLA 4N9IA 4OOIA 5J1RA 2XAJA 2OC6A 2LR8A 2XKPA 3G4SI 1X19A 2M3AA 2ZJPF 4OAZA 3I4MJ 2FA5A 2M45A 2XAFA 3HRMA 4PDKA 3V7CA 4OIRF 2ZXHA 4LLGF 2EFQA 5ILUA 4G7OF 1FYKA 1BR4A 2ZMEC 2P7CB 2XAUA 4UB8C 3GTKJ 1QZYA 5DCMB 1WVRA 2Z3YA 2LSOA 3BR0A 4GFBA 4BHCA 4XOPA 1S3JA 3BR2A 2RAEA 3OIOA 2DMTA 4I6ZA 4BKXA 4HG2A 3GTGJ 1TL8A 2H6CA 5LD2C 5E1WA 3KEQA 1HW1A 2Y0SN 4UUSA 1IW7F 3L2WA 3QYFA 3JTHA 3EUHA 1W36C 2EIKH 4O5VA 4I7HA 1FSEA 3J80Z 4IRGA 1GVDA 1U5TA 3WTVC 3I0TA 3KZZA 2X51A 3CMMA 3ZOBA 1I3AA 2OPTA 3C2BA 3R0JA 5D4RA 1DGRM 4UHTA 4UV8A 1T08B 4BY7J 1ETKA 2CV0A 1R1TA 3OR1C 4RBOA 1VQOI 1OCOH 4MQVA 3S3MA 4PJNA 1G3WA 2HI3A 4BQAA 3K7AJ 1QBJA 3IH3A 5FLMJ 2K02A 4KIFA 3DTEA 2GXAA 3L2UA 5FLVA 3WU0A 3W2WA 1UG2A 2BY3A 2M9HA 2WC2A 1X1BA 5AIQA 1JKPC 3QPTA 2DFFA 4LB6B 4N9HA 3DFGA 2K9NA 2XKOA 3BWGA 1QA6A 3AFHA 5D8LB 4EJOA 2M5WA 4DYQA 3K2ZA 5EG0B 1Z9CA 2QQBA 1SFXA 1D8KA 1ETOA 1VQLI 2Z2SB 3C1DA 2EQRA 3WU1B 2YX4A 3OYDA 3HOTA 2R3SA 3M3YJ 5FKOA 3JTGA 2JK3A 1O3SA 3I71A 1S9HA 2GOXB 3PJRA 2G9WA 4KIGA 4MO7A 2ADUA 4BACA 5FRMA 1PJRA 3M1CA 4XLNF 1A31A 1FSHA 1FIAA 1YO5C 3MN2A 3P9KA 4CO8A 1JHHA 3M8EA 3ONQA 4II2A 2PEXA 2M8EA 1V3FA 2OD5A 3BG9A 3SFZA 4X6AJ 1R9TJ 3CCJI 2VXZA 5IP9J 1SMYF 1O3QA 4ZH4F 2DU9A 2HKOA 1A04A 1FP2A 2G7UA 2GZWA 2HQAA 1HKTA 4PUSA 5FKMA 2LY1A 4M3BA 2NXNB 4XOTA 2CG4A 2WTEA 5EEAA 3NWTA 2PX9A 5FKLA 4G7HF 5HS9A 1RUNA 4FASD 4H4KC 2VI6A 1R5GA 5EEHA 2P6SA 3NAUA 1LPQA 1XGMA 3QPSA 1R6RA 2V4JC 1NK3P 3GTLJ 3QU3A 4MTDA 1ON2A 3GYHX 2W25A 1X1PA 4B8XA 3C7JA 1HC8A 3OYIA 1YRNB 5JHUA 4Q48A 3PIPF 4RGSA 1BI1A 3HOUJ 3EYYA 1X4OA 4L5EA 3HOYJ 3J7YJ 3MZ8A 4IHYA 4E70A 4EGYA 3OYHA 3CO6C 1ONVA 3IWFA 3SZTA 1Z1DA 4A3BJ 2O8XA 1RR8C 2B63J 1BIAA 2JJ7A 5FFZA 1ORKA 3CDIA 1WI9A 1VQ8I 5CVJA 4HX8A 3HRUA 4UVAA 2OTJI 4ZDOA 2M4GA 3ABUA 2YU9J 3KP2A 3O6BB 2X48A 4UUSB 1IV6A 5DD8A 3KP4A 4PJ0C 3NWSA 5F27A 3VDXA 2O5RA 3CJQB 4D5CA 4B47A 3GFJA 3HSRA 2QWWA 2ICWG 4OIPF 1BR2A 2HKXA 3TW6A 5BPIA 1LE8B 2O9LA 1YI2I 4LMYA 5IYCJ 2PJRA 2NOJB 2JVGA 3D5RC 2STWA 4DZJA 2Z99A 4GGGA 2F5VA 2R7VA 2GBYA 4X0GA 2EZHA 2HPIA 3BTCA 4YELA 4F52A 2HVQA 2NS8A 3E1SA 2OCEA 3M9AA 1Z3YA 3RDIA 3HOXJ 4I01A 3NEUA 2MG4A 4G7ZF 3LL7A 2X0LA 3IL2A 4NNJA 2QZ8A 5J4VA 4LK1F 2DJNA 1S8NA 2BXZA 5CQGA 3S1NJ 2O6GE 3MZYA 3JAMK 2A69F 3DKXA 2R7XA 1BW5A 3KEOA 4Y17A 4Q47A 2VQCA 3BZCA 2XRLA 5DV5A 2H1KA 3E5UA 1T0FA 1N77A 4KT5C 2Q8KA 1BL0A 2DDBA 5CJ9A 1VZ0A 2L7ZA 1YJNI 2HQ5A 4LLNA 2MABA 3QP5A 2I5UA 5DTDA 5LFAA 3GZ6A 2L54A 4HSRA 4HLYA 1MW7A 3C18A 3PO2J 4XQFA 1PUEE 5GAHJ 5JVTA 5GTIC 2L9RA 2VN2A 5E1ZB 2TDXA 3LSIA 3FKJA 5FB2A 1BC8C 2HZDA 2DA3A 3L9FA 2V9KA 5LGUA 3UR3C 1JT0A 4U88A 2ME0A 3L09A 4NQWA 3AL0C 5IYBJ 2HQRA 3A01B 4A3JJ 2AS5F 1Y56A 4DJAA 4EV0A 4BXUA 2EA2A 1XS9A 2LMDA 3M4OJ 4EATA 3JW4A 5B5EC 3NQOA 4HSTA 4U7BA 4XIDA 3VPRA 1VF9A 4BDZA 2P8TA 3LWFA 1RR7A 2OQGA 3E7LA 3ECHA 4L5IA 2YSRA 3DKWA 2QKMB 2CYYA 3BG3A 3DBLB 2QM3A 2IA0A 1PDNC 2BVMA 4LK0F 3MZHA 2OTLI 3QP6A 4R8HA 2NNYA 4ZZLA 3FXKA 3G1LA 3SDBA 5EGOB 5D6FA 4BL0B 1OYYA 3I59A 4J01A 2CW0F 3FXOA 5GADJ 2X1EA 3WODF 3DPUA 2MA3A 4Y15A 4NC7A 1HA8A 3CJTB 4HPQA 1RKWA 4J19A 1FEXA 4G94A 1BI2A 2EFWA 1B8IA 1T56A 4RLFA 2K7LA 5AIPA 3ZQQA 2IS1A 4RDUA 2IBDA 3NRVA 2NNNA 2OU2A 1W5SA 1V55H 2CFXA 1IF1A 4E7SA 1MSEC 1JJ8C 1QVTA 2OF7A 3V8KA 5FLXK 2K9QA 2QBYA 4G12A 1T98A 2ZKZA 4I99C 1K61A 3GTQJ 3MKZA 3WE3A 3CUQC 3LA3A 4D1QA 1SC7A 1DP7P 4CZZA 2E71A 1W36D 2ESHA 2G0EA 2P6TA 1XG1A 3FXUA 4IF4A 1N78A 1MMSA 3SEQA 2V9PA 2LY9A 3BOQA 1IO2A 2FQ3A 4A3EJ 2KMUA 3SZGA 2RQPA 4ENNA 2KP6A 3GVAA 3FZVA 3K4LA 2CV2A 4LGWA 1R1UA 1OCTC 1FWZA 2QVOA 1VNDA 1U0JA 3HHHA 5TRDA 5C4JJ 4XKCA 1H89C 3TDZC 1F4KA 5C4XJ 2FSWA 2ZMEA 3HG9A 3DLLF 3F8NA 3HJEA 5F0CA 2JPBA 4A6DA 1VFCA 1I1SA 2MBFA 4WXDA 3HPGA 1XMXA 4LOCA 1OYIA 3IAS2 3U1DA 4BE1A 1TZLA 2IA2A 1LEAA 2EPFA 4RB2C 3IRQA 1XGNA 1Z05A 2G7HA 3WGHA 2XAQA 4HZFA 2QQ9A 3SEZA 1ZG1A 3I4PA 2DPDA 3ASNH 5FD6A 3BQZA 2K5CA 2H6BA 1JT6A 2L4AA 4KITB 3HRTA 4PFPA 4HEA2 1ZGWA 3H3ZA 2NS7A 2Q0OA 5LRSA 4NQWB 4Y13A 1IC8A 5D5WB 2XRNA 2IEKA 2JQ7A 1JJ6C 1D1BA 1ZHFA 2PN6A 3VFZA 4M3DA 4ZYGA 4XL9A 4E7KA 1CF7A 2LLKA 3D5SC 4BJ5C 1R1VA 4BJTA 1TW3A 3JRDA 1OCZH 3DU6A 5EYRA 1G8XA 3D1NI 2DAOA 1TC3C 5ED4A 3LA2A 1ITYA 1P4XA 2IP2A 2RNJA 4KT6A 2PMUA 5D5XB 2VB6A 4S0HB 4IVNA 1EKEA 3H5RA 4UB6C 2M1BA 1JI8A 1UFMA 1X4PA 3ZGKA 3CDHA 2VT2A 4NBQA 3CP8A 5IOYA 3T1BA 1MMGA 4FE4A 1Y6IA 4E6KG 1YTYA 2UWMA 2V79A 1Z0XA 3LSJA 4UY8I 3I55I 1SD6A 2W1OA 1ZG5A 1OR7C 2YU3A 1EV7A 2EH3A 3BLYA 4IKFA 4PCQA 1U8BA 1I39A 2H1LA 5IT3A 3DEWA 5C44J 4ENMA 3GLXA 4XSZF 4LLLA 2K4BA 2DA7A 2VQGA 2ZJRF 3H9GA 5IYDJ 3DPTA 2MH2A 1K79A 5F1RA 3HKZN 3ZQHA 1YG2A 2CWEA 2IPQX 2A6EF 5HLTA 2B9SA 1K6YA 2HTSA 2TCTA 2ECCA 2L9SA 4RB3C 1OFCX 3DBRB 2EIJH 3ZRGA 1HOMA 3K1PA 3KEYA 2VJIA 4QIWN 2B7EA 5HDGA 2EZIA 3DLAA 3KZIC 3HUGB 5HODA 5HNHA 5IT9Z 4Q5SF 2MSYA 2J5PA 4CHUA 1BR1A 4HNUA 3E5QA 1W7PB 3KPHA 3OS0A 3IC7A 2CMPA 4GRIA 1RUOA 3KP5A 3HHGA 1K6OA 4IOAF 2I10A 1USSA 2VIXA 2P4WA 3IHUA 4Y7NJ 3H1CA 3ESWB 2IW5A 2LF8A 2DA2A 5KVRA 3QRFF 1JKRC 1FTZA 1UZCA 1FBQA 3IAM2 1WRJA 5L3CA 2CU7A 4N4NB 4GO1A 3X2QH 3H9QA 3RQIA 3BR6A 3DTIA 2OCCH 1VQ4I 3T8RA 3O8GA 3HDDA 4AYBN 3DU5A 3BZKA 3CCRI 3IH4A 2EFNA 1Y1VJ 3CCQI 1IXCA 1NH3A 2QSGX 3AG3H 1BIBA 4CA0A 4ABZA 4RA2A 2E60A 1MMAA 1P4AA 1M1EB 1FY7A 1KQ9A 2JA7J 5HNFA 3L2RA 3HEFA 2D1HA 5E3LA 1AA7A 1WKMA 1J0RA 3LSMA 3E0JB 2WWYA 2UXXA 1XB4A 2IGNA 2KIUA 5JFRA 4CGZA 1HKQA 3CESA 4EJTA 2WAEA 3EPZA 4KFCA 2IS4A 3PO3J 4KA4A 1EA3A 4PSWA 3TGNA 4KN4X 1ZTRA 3TO7A 5M5YJ 2GM4A 4HA8A 2IAIA 4CCMA 5KNLA 3JSPA 1HKSA 2V7FA 2YPRA 4BJ6C 1LFUP 2DA6A 1WJBA 3GWZA 5J1YA 5FD5A 4IXAA 3DCFA 3K2AA 5JHFA 3L00A 2KZVA 1SVMA 3A1YA 3J80K 3T5XA 1GXPA 2AXTC 1R22A 3ZMDA 2YR2A 2KIFA 3IH2A 3PNTA 5EDNA 2MC3A 3OYGA 1KU9A 4F55A 3HZJA 4DQ2A 4BQOA 3RZDJ 1Z6RA 1F5TA 4DYRA 4CCKA 3MAJA 3K1MA 2W82A 4P96A 4HRIA 4C3HJ 4CSWA 5CKTA 3H9JA 4RGRA 4WX9A 4NUBA 1AOYA 2XVCA 4U0WA 1T39A 2DMQA 3P5JA 2VKVA 4FHTA 3HSFA 2J5OA 1TT0A 3WG7H 2E7WA 2VKDA 5J6XA 1UCRA 1IV8A 2GWRA 4ZYAA 4JYKA 3PIOF 3ISPA 3BJOA 4M72A 1Z7UA 4I02A 5AONA 3EYIA 2Y31A 4LG0A 1V4RA 1R71A 5BMZA 1Z3XA 3P7NA 1J2XA 3JRGA 3E6CC 4NHJA 4KJZA 5D8KB 1W4MA 2HFHA 2O8KA 5J1UA 2DOEA 1LQ1A 4CCJA 4HNVA 2BVLA 3PQJA 2LREA 4XM3A 2K3PA 5FJ8J 1LEBA 3I56I 3Q9SA 2JA5J 1D0ZA 3FX3A 2QSHX 3KCCA 1LKXA 1U6GA 4IHTA 1WJAA 5M5XJ 2JSCA 1YYVA 1JXSA 3SHFA 2VOPA 1N25A 2K85A 2LBFB 5J3LA 1H9TA 3RKXA 3GBGA 1FPQA 3BTIA 3FISA 1BBYA 4XLPF 3OYLA 3M07A 2HEOA 2WAQN 2VBWA 4PSXA 5DM7F 1JKQC 1AHDP 2FNPA 2XF6A 2XB5A 1S7AA 1E17A 3QOEA 1MBKA 4N4OB 3TMOA 1VQ7I 2MW8A 5F6FA 2STTA 3OIPA 2XGXA 2ZXIA 4M9XA 2ELJA 3JRFA 1DU0A 3ABMH 4RS8A 2L2OA 1GHCA 4FT8A 2BYVE 4M3FA 1RIOH 4BEHA 3CLOA 1UJ8A 5GPAA 1X1CA 2QYOA 3OS2A 1AKHA 5K5RA 4DNCA 2FX0A 5E8GA 4YIRX 4H0EA 1CQTA 2XPWA 2ZFUA 2R4GA 2VC1A 3LSRA 3N05A 3ZPLA 2DT6A 2BHZA 4OINF 1UB9A 3F6OA 4CCOA 4IEJA 3CUQA 4XNFA 2F4IA 1V54H 3O8HA 4IL6C 2HYJA 2VOOA 1I1GA 2D5VA 1VQ9I 3BROA 2LDUA 2ECBA 4EVIA 3JCUC 2HVRA 1IAWA 1RKTA 1Z21A 5E1XA 2BBYA 2K86A 3K0LA 2IS2A 2XAGA 2JPCA 4A69C 2OV7A 3TQNA 3ZQGA 2L5QA 2K3FA 1K78A 3EQLF 4IHVA 5IOZA 4A3GJ 1D1AA 3M8JA 3F8BA 4XKWA 1S7OA 3MQ0A 1YJWI 2I8DA 4NDLA 1BW6A 4FISA 2XF5A 1REPC 1FOYA 1VQ5I 5LHGA 1TLHB 5M3MJ 3RCOA 2H09A 4PJJA 2RV8A 3H0GJ 2R7OA 2V1UA 2A68F 1UAAA 1FP1D 2Z1DA 4DBRA 2JZYA 2LC2A 2QLZA 4KICA 2MYSA 4DGWB 2XPVA 2L7KA 3B6CA 1E3PA 3Q0UA 3CMAI 2ETHA 4LG0B 1IG7A 2E35A 2KLOA 4C9YA 2EFOA 1LUJB 2KHMA 1JUMA 1D1CA 1SANA 2LKXA 4A0XA 2HZTA 1X2MA 4B09A 3SJMA 2CQQA 4QPOA 2GXBA 1MBGA 2HOTA 2DOFA 2W84A 1K4SA 5D5VB 3EETA 4IQJA 5F08A 3M1EA 4E7HA 2NAZA 3GUDA 2DTZA 2AQFA 1QQIA 2WAQA 4BGDA 5EF6A 4LG3A 4MHGA 3Q5FA 4HNTA 3QU6A 1QHHD 2E1NA 4M71A 4B43A 4LD5A 3S15J 1O3RA 1ZREA 2FUG2 2W7NA 2OZ6A 1XMAA 1P7JA 1ON1A 4RAYA 3G1MA 2E2HJ 1QHGA 3F72A 1FMWA 1ZK8A 1ACIA 2XV4S 1OR7A 2Y0SA 4P55A 2FJ1A 1PP7U 1MGTA 1R49A 4B44A 4DOZA 2HYGD 2IVMA 5CVIA 3SYTA 1V5GA 1NG6A 3CMYA 5FRNA 3LMMA 2CFOA 1ODDA 1TNTA 5JR3A 5K1YA 3FBNB 5CVUA 1GT0C 2L7MP 1AKHB 1J75A 1T38A 2M34A 1U5TB 2KJBA 2VLAA 2VL8A 3FXQA 4A2UA 4N0BA 2R7DA 4BH9A 4OAYA 2LFBA 3V7SA 1OYWA 1YW9A 3BG7A 4KISA 2OA4A 1X1DA 2JN6A 1MBFA 1OMIA 1WJDA 2FBIA 2QUFA 4IJAA 5DUKA 1U78A 2BZTA 3HM5A 3LFUA 1XSXA 4L0YB 4XLAA 3GTOJ 1ETVA 1PVEA 1A6QA 2YUSA 2EA4A 1QVUA 1B9NA 2RKHA 1ZGAA 4TV7A 2X1CA 3DTKA 4IRIA 3K70D 5H6QA 4D0PA 5LGTA 1MNDA 3R4KA 2NRAC 2VODA 4HX7A 1KQ0A 1QPIA 3QYBA 1J7KA 4EM1A 5DCFA 4F7ZA 4FCYA 2R92J 1UELB 4XLCA 3TO6A 3W6KB 1VQ6I 1X1AA 4RLQA 3VEPA 3IWZA 3S14J 5FKNA 3C2GA 4AU7A 3A02A 4BBRJ 5K7ZA 3IV5A 4FX0A 2BW3A 4BXFA 2HOSA 4RAFA 1Y39A 3HC7A 2X6YA 2VJJA 4CYCA 1PUFA 1MH4A 3FXLA 5HLHA 3GTPJ 2WY7Q 1IUYA 3J81Z 2XPUA 1K83J 2DFHA 3BTLA 2VE9A 2FRHA 1FBSA 2KDZA 1IDYA 4A3MJ 2V1NA 1JTYA 3HOVJ 4ITVA 2CW7A 3GLLA 4X1EA 1TT5B 1R4NB 2DK5A 1HXDA 3I4NJ 4P1WA 2IS6A 5C3EJ 3L1PA 2EILH 1B1BA 4D5FA 3OSFA 3OYNA 4QSHA 4Y4RA 4YG2F 3CMEI 5LRRA 2ME6A 2Q2EA 2RNGA 2NVXJ 1DUXC 1P6RA 2BY2A 1SFUA 1ZR4A 4BQNA 3G71I 2GA1A 2VASA 3AG1H 3GW2A 4A12A 2IXSA 3IP4B 1DP3A 4HF2A 1YQAA 2E1OA 2E5ZA 2GIZA 2EV0A 3REOA 1ERDA 2A61A 2ISYA 2MD5A 1DPRA 1MKMA 1TNSA 4XR6A 3QAHA 4CZCA 2Y48A 3KP7A 3FXRA 1ZRFA 3RYRA 2KRCA 3DF8A 1UG0A 2DPUA 5EZGA 2HS5A 2DXIA 1Z77A 2Y75A 1Q1HA 3S3NA 4CYDA 5K7FA 1C0WA 2H94A 3MFKA 4XN3A 4AIJA 2E1MB 2XAHA 3HOWJ 2DMUA 4J00A 3M8FA 4V2GA 1E3HA 1WJCA 2EV5A 2NVUB 1ENHA 3Q9VA 4BE2A 1BI3A 1S5LC 3FF5A 2JWTA 1TW2A 3S1MJ 3COAC 1NTCA 4II3A 3HXLA 1BOBA 5FFXA 3HTSB 2P81A 1SVOA 1NHAA 2R5ZA 1W7PD 4OWRB 2BGCA 1XDUA 3PFIA 2W85A 3PNYA 2PJRB 2GIVA 2CV1A 3TP3A 3GXOA 2GAUA 3FWEA 2V1XA 2WB1N 3HIFA 2Q1ZB 2MFZA 1JKOC 5HVQC 1VQPI 1QZEA 4KNYA 5HS7A 1UMQA 1WCMJ 5JLWA 2AQEA 3E3VA 3BPVA 1T8IA 1XTAA 4WF2A 5B3SH 1KONA 2CSOA 5ILVA 1KQ8A 3S16J 1KGSA 2HNHA 3F6VA 2DA5A 4C2UA 4ZC3A 4M6YA 2P5VA 2W00A 5H20A 4Y33A 2ZJQF 1P7IA 2X6OA 3JRAA 4RM2A 1IN8A 2DN0A 1YX5A 5EEGA 4BHBA 3DKYA 3K4JA 4KN7X 1E0EA 4XICA 2XC7A 1Z67A 4U7DA 1ETYA 3MKYB 1A6IA 4M3GA 2VBXA 3O2PE 3PUBA 4M3EA 4BAYA 4PJMA 1VQKI 4UVCA 2JVHA 2F5CA 4EQQA 5E18F 3OS1A 3F3XA 1IRGA 1KYZA 5K5QA 3T8TA 4B4CA 2DT5A 4G9YA 5IT9K 4V2FA 2EWNA 2LTPA 4OIOF 4C3JJ 3HOSA 1A35A 2DDAA 3KIOA 1HLVA 4HYEA 5DD4A 4E4HA 4LIVA 2ZB9A 4B3XA 5K7HA 3LNQA 3JSOA 3ZP5A 2O7OA 1FBUA 3RKQA 5CLSA 3FHNA 4JK1X 1SD7A 2DO7A 2XROA 1G59A 1FMVA 2PMHA 1I6XA 4BYYA 3CQZJ 2LF7A 1SVLA 3FM5A 4R79A 2F5FA 1AWCA 2K27A 3HGGA 2EIMH 3CP2A 3LA7A 1TP4A 3ZN1A 2FMLA 3NARA 2TRTA 3RI4A 1R36A 5E79C 2LYCA 1BJAA 2COMA 1I3QJ 2OBPA 5F0HA 1H9GA 1WI3A 1Z6TA 2XGEA 3K4MA 3J7ZI 2GLOA 2HWVA 3R6SA 3UNGC 2R93J 1FC3A 1YW7A 5BNGA 4CUGA 1WHUA 1Z7LA 3WTXC 4BQQA 3MKWB 3DQVC 1FX7A 2V26A 2QCOA 4RAGA 3I59B 3DEEA 4FQGA 3KE2A 4MFEA 4U87A 5E17F 2H27A 5CVRA 3W6JB 4BDYA 3GTMJ 5LHIA 1B8IB 2LKSA 2LY2A 1MBEA 5F1JA 1D5VA 3I3LA 2MC4A 2CJJA 2WV1A 1IUFA 2KIMA 2DYRH 2CUZA 3VSLA 1YOVB 2XIGA 1XPXA 4L9JA 1POGA 2IGMA 1ZYRF 4MTEA 3W6VA 4YIFA 3HB9A 4XONA 4A3DJ 5F0FA 2FBKA 1JGGA 2L02A 5A2QZ 2QBYB 4ZTFA 2KPMA 1O7FA 1W5TA 1FOXA 2WB1A 2XF7A 2E1MC 1I6HJ 5GTHC 3MWMA 4PZJA 4R1HA 1IN5A 5J40A 4HDVA 3MD2A 3S32A 4LIUA 3SDGA 3ZQIA 2LG4A 1F43A 1Y0NA 1TQMA 2CQ7A 4MIMA 1RPWA 1ZN2A 2P5LC 1O3TA 2HQNA 1BC7C 2VONA 2M7AA 3L2QA 1K7AA 3WTUC 2L3DA 1U9OA 3FHZA 3W2AA 3FM3A 4XKBA 2QQAA 4YFKF 5E3NA 4EM2A 5KAFC 5TISC 2JSPA 1B59A 3HBLA 4D7MA 3J7AY 2P5KA 1R58A 3KLNA 4HV6A 4GYIA 4GXOA 2ZMEB 3GEZA 4A6EA 4P5OA 1QPMA 5IPAA 2N8GA 4YFNF 5LBQA 2Z16A 4WXCA 2OUMA 5HDKA 2VXDA 2V6CA 2L7FP 1Y8QB 1YS7A 2X6XA 2Y0MA 4LJZF 2KFDA 3LQRA 4M6XA 1OCRH 2KT0A 3ZCOA 3U9GA 5ICCA 1BJZA 1A5JA 2QKLB 1IN6A 3A2KA 2VKHA 2XASA 2CRGA 1YITI 3FK6A 1ZGJA 3H35A 4RMNA 3CC2I 1D3YA 2MH9A 3R0AA 3G3ZA 2PMZN 4ZJZA 3VWBA 1X2NA 4AVPA 2A5WA 3CCLI 1HW5A 5EJCA 4AIHA 3CCSI 3FXJA 3KP6A 1O7LA 4O6JA 5DCMA 5D6EA 1PP8F 1T0FC 2C6YA 3K70C 1IGNA 3BR1A 2XSJC 4WWCA 4P9UA 5BPDA 3WU2C 2A6TA 3JREA 2NOGA 2F5EA 3EUAA 4IOCF 1FYMA 3OYFA 5DYMA 3F8MA 2EZLA 1D5YA 4MGRA 1CF7B 1XN7A 3FMRA 2LP0A 1TQIA 3VODA 1WH5A 2COBA 2O0YA 2Y9ZA 4KMUX 4ZDLA 4L18B 4AVZA 3CTAA 2XSDC 4D9JA 1MJAA 3ML6A 1SD4A 4JBAA 4E7JA 2FMYA 3LAJA 1X3WB 2JTVA 4A3FJ 1HDDC 3CCUI 2DBBA 4LFUA 1BI0A 3I64A 1R7JA 2E34A 2BHYA 1XX5A 2CUFA 1MMNA 2E5NA 4IO9F 4ESBA 5ILSA 3OYMA 1Q1VA 2ZXJA 5BQTA 2LD5A 2JA6J 1OQYA 3RPUD 2X9DA 2FQ4A 3IUOA 5ICFA 3GZ5A 5E8IA 2QQ8A 1LJ9A 1YS6A 5F64A 3HKZA 5EG0A 4U0YA 1GLNA 1SEUA 1XGOA 3TP0A 2BY1A 5HOOA 2JA8J 3OR2C 2VBZA 1RESA 2JT1A 4MNUA 2R0QC 4E7LA 2HYFA 1ETQA 3TO9A 1EF4A 2KIQA 1SFEA 1G3YA 4XKVA 4Y52J 3CC4I 4CH7A 3W3CA 1IRFA 3BT9A 4UV9A 1I27A 2ISZA 3MEXA 4C2MJ 3ZQCA 3DWLE 1DDNA 2PLYA 5L3EA 3BZ6A 3ECOA 3P9CA 1YW8A 9ANTA 4Y3OA 3P9IA 1APLC 1J59A 3F21A 1V5EA 3WHBA 1ZAOA 3L7WA 2XHKA 2Z5UA 5LGNA 4ENKA 3OSGA 4KDPA 1SAUA 1TBXA 4BUPA 1ZARA 5K5OA 1TTYA 3I58A 1LDDA 3S1RJ 2Y9YA 1NK2P 2FOWA 3K6GA 4ON0A 3D5LA 1T2KA 4MFDA 1EH7A 3HRSA 3RTRA 3FKIJ 4XRMA 2E2JJ 1AU7A 1FOKA 4XRSG 2WBMA 4XRFA 2LH9A 3RPQA 3K69A 3ZQFA 2EV6A 2KQRA 4Z6YA 3ZMUA 1WWXA 1TWGJ 1A36A 4AYBA 1U3EM 2DLLA 2P7VB 3DPLC 3LOCA 2EBIA 2VPRA 3CJRB 2PMZA 5DM6F 2JUGA 4F3QA 3FIWA 4D7NA 1MMDA 4A93J 4BU2A 4PGGA 4KIBA 1YRNA 2XDVA 2KDOA 1LDJA 4G6TB 1MZBA 3OYKA 3PUFA 2F5DA 5FKKA 1Y0UA 1X58A 4A5NA 1LNWA 2O3FA 2R7UA 4IZZA 2VJ5A 1OKRA 3E5XA 2VQHA 1ZLJA 2BV6A 4KUMA 3ZMTA 3WTWC 2MLKA 3OL3A 4AIKA 1TWHJ 4UXNA 5L3BA 2IT0A 2LK2A 1SD5A 2BXYA 3PSIA 3ABKH 3I53A 3B02A 3U2RA 4XN0A 4MLOA 1MSFC 4EJUA 3N4MA 1P92A 4KYWA 1E3OC 3JRHA 4HW0A 6PAXA 2B0LA 2V1DA 1T33A 3BCBA 4HAMA 2P0WA 4HV5A 2E19A 4M9SA 1NG7A 3OOUA 2RC4A 2EK5A 5E3OA 1LE8A 4PK4A 3BG5A 3FXMA 4GYGA 4B1RA 3BPXA 5CVVA 3U21A 1BOAA 2DA4A 3HSEA 2K40A 4QTRA 1HCRA 2ID6A 2JRMA 1R5ID 2R7QA 2RGVA 5HLIA 5DEQA 2M30A 2D1VA 3AG2H 3G73A 1JGSA 3I9V2 3LQQA 3R60A 1XC5A 3VSKA 4S04A 4ANJA 4C2TA 1P9QC 3S2HJ 2ZBKA 4ESFA 5ICGA 3LSHA 2KJCA 3HL2A 3F23A 4K2EA 1FZPB 4O3MA 3JR9A 2VKEA 2RDPA 3H92A 5ERIA 1UHMA 1WJFA 3G1OA 3LSKA 2NVTJ 3PM1A 1F36A 4OMZA 3C3WA 1RRJA 4G8XA 4EJVA 3AL0B 2YS9A 2DYSH 1HBXG 3OIQA 4DW6A 3WTZA 3OOPA 5D4SA 4JOMA 2R7RA 2GXGA 4RGXA 1ZQ3P 1DU6A 2WAFA 2BEOA 5L3DA 2HOAA 3TEDA 4OIQF 3HYIA 1WH7A 3J81K 2MD0A 1HDPA 4B3AA 4WCGA 1OPCA 2UV1A 2JA2A 4IX7A 4E7ZA 3CDLA 3HPHA 3LAPA 3K4NA 4XLEA 3HTUA 3V4GA 2LKPA 1MH3A 1P4WA 3A01A 1FJLA 2W57A 3B73A 1VTNC 1LFBA 2K4JA 1BA5A 2L9VA 2R7WA 4M6VA 3Q3SA 2FXAA 2XGDA 3SFIA 5JVGF 5J8CA 3E6MA 1MBHA 1YLFA 4XLFA 3GFIA 4AIDA 2A07F 4BBSJ 3DBHB 4ESJA 4I2OA 2BE5F 4ZTJA 2M4KA 4L9NA 5B66C 2PJPA 3SZPA 1ZRDA 1ZRCA 2MGQA 3S8PA 1D0YA 4FETA 4BHPA 5E20A 3BCAA 4BEHB 4A5MA 2V6EA 4BNCA 1R23A 1FYLA 2RREA 4NB5A 1ZR2A 3ULQB 3FBIB 3G6EI 2ZCWA 5M3FJ 5HS8A 2HU9A 3CC7I 4ASNA 3PSFA 5EGOA 4XRSA 1FOWA 2GQQA 5CPRB 1RETA 3CF5F 1J09A 3CUQB 3KP3A 2ACJA 3I54A 3QOPA 3Q0WA 1XGSA 2R5YA 4ZDPA 2Y30A 3QPLA 2L4MA 3QODA 2AO9A 2DMPA 2OJED 2DQLA 4UUTA 4C30A 2F6CA 1OJLA 3H0DA 1O57A 4L9VA 4U0VA 2VC0A 3MVPA 4RM3A 1H8AC 1W0TA 2Z9OA 2O61A 3JRIA 2XB0X 1KU3A 1X3ZB 1VQNI 1OCCH 5GAGJ 1K78B 2X1DA 1G6NA 1EH6A 4LB5A 1R00A 2DOAA 2LVSA 4A3KJ 1FNNA 4I0AA 3ZMVA 1FLIA 1RZ4A 1MDMA 3WHCA 4UUVA 2W24A 3DXJF 3VYUB 5J47A 1ULYA 3RSNA 1YFHA 1MNMC 5BS6A 2BOLA 1DQUA 3GZNB 2KZGA 3GTJJ 3F22A 1E2XA 4HQEA 3JRBA 3RIRA 1G4DA 2DT7B 3VYTB 3I5UA 1XCBA 4PJLA 1IN7A 5H6RA 3S3OA 4L5JA 3BQYA 5B1BH 3V8JA 2ZSHB 4B48A 4EEFG 1SFOJ 4IHSA 5ICEA 1F1ZA 4JQFA 2E36A 4G6DA 2HDWA 2QSFX 3A03A 4EMSA 2DJIA 3OYBA 2FNAA 4DIQA 3V42A 4BY1J 2PBIA 1QNTA 2DCEA 4HF1A 2DFEA 4UNOA 1IXSB 2ZO4A 5LHHA 1MNEA 3R61A 2NVQJ 1G2HA 2KISA 2ZSIB 3TL4X 4PFOA 2DFIA 2QF7A 2HXIA 4GDFA 3ZN0A 1H0MA 1HSJA 4JP0A 1LVKA 4MQ9F 2ZJ2A 3OYEA 4FX4A 1LB2A 2CGPA 5EZHA 2EJRA 3K1NA 3KYLA 2EZKA 3CCYA 4EGZA 4MEYF 5JLXA 5J8FA 2RVCA 1VI0A 4CCNA 3CD6I 4AC0A 3WGIA 3KZYA 4FTHA 1IDZA 1K4TA 4BS9A 4HQMA 2HDCA 2OQRA 2WADA 3GCMA 2F2EA 2MLGA 1JTXA 2E1CA 4IQ4A 1KYWA 2CQKA 3GMEA 3PL8A 4QWQA 1U8RA 2K9MA 3BJ6A 1J5YA 1DPUA 3IKTA 5HDNA 2QA4I 2JUCA 4IRHA 3E6BA 1LFPA 1IJWC 4PGHA 1SAXA 4M74A 3VOEA 3WTYC 1KU7A 1ETXA 1XSDA 3G2BA 2DQRA 5GPCA 2IA1A 2RQQA 3QYEA 2R5YB 4HOBA 5L3GA 5TGTA 1G3SA 3HOZJ 2L01A 1GDTA 3RZOJ 4JX4A 5KCMA 3TBIA 4RB0A 2HDDA 2OAZA 4LITA 2NVYJ 4QLCU 2BY0A 4CCLA 3WE2A 3WG9A 3QQAA 3EUHC 2CQXA 1YHQI 5J4YA 4YEJA 1YE9A 1WGXA 1UHSA 2QENA 1U5TC 2KL4A 2X4HA 3JAMZ 1XD7A 1ZG3A 3BC8A 1XSVA 4CICA 5L3FA 2W48A 5A2QK 1S7EA 4WXHA 2XGCA 1GXQA 4XORA 3ZR8X 1N75A 2F48A 3OMYA 2PFBA 1DGWY 3BY6A 3CJNA 3H5AA 5DS9A 2PI0A 5KHDA 1GUUA 3ZXSA 4YIIA 4E7IA 2BW3B 4JX6A 3CCEI 1FTTA 2HVSA 2NS0A 1MDMB 3KYCB 4XK4A 1R5HA 3AKZA 1YX3A 3H3UA 3HUGA 1S6LA 4HX4A 4CYCB 1PUFB 5M5WJ 3BR5A 5CQEA 3DP7A 3VYRB 3IRRA 3K10A 1GV2A 5F04A 1W7PA 3BP8A 3CZ6A 3W2VA 2RN7A 4IHWA 3FMSA 5H2FC 2K9LA 1W5CC 2PQ8A 3Q0VA 5FO5A 1SFKA 2CO5A 3DEUA 3ROUA 3F9KA 3V7RA 4EM0B 3BJAA 3ABTA 3KYDB 1JUSA 3M7GA 4P9FA 1OISA 2Q2EB 1YIJI 4BXXJ 3SQNA 1EJ9A 1WJ5A 2Z33A 3TOAA 2H8WA 3OYJA 1BM9A 3A4CA 4ENJA 4A3LJ 1USTA 5LEKA 4L9TA 4BE0A 3ZMZA 2QEXI 3JRCA 2FBHA 3OY9A 1IRXA 5BOXA 1FT9A 3E6DA 1LDKB 4Q4ZF 4S05A 3O3KA 1QZZA 4CXFA 1W0UA 2KRFA 5HLGA 3OYAA 4ZZDA 2FD5A 1QO0D 4KMFA 1MD0A 1XCVA 3ABLH 3FK7A 3HGYA 4DYCA 1T95A 1B72A 4EJWA 4HLXA 4NC8A 2A05A 2AHQA 2H8RA 3MCZA 4Z2YA 2X6WA 3K4KA 2HXOA 4HDUA 1L0OC 3WTTC 2GOMA 1B6AA 2HPMA 3CF2A 3RJPA 4ZYHA 3A0HC 2VE8A 1OCPA 3KLOA 3V8LA 4M73A 4XSXF 3FDYA 4I09A 2FEZA 1TQPA 5FLXZ 2EB7A 3MKLA 1GV5A 4G6QA 1FIPA 4IPAA 1X3UA 1B4AA 3ZQ7A 1D0XA 3K4BA 1D8JA 1IN4A 3RYPA 3KX2A 3OL4A 2X85A 2NYXA 2JRTA 3VB2A 1MJBA 2ID3A 1U9NA 3L2VA 2R5ZB 1YJ9I 1VQMI 5D5UB 3QPHA 4AUXA 3GFMA 3PQKA 4XLHA 3TKYA 2L0KA 1RC9A 1YIOA 2WV0A 3EDPA 1H88C 1PYVA 1WFXA 1WSUA 4C3IJ 3FMQA 5DDGA 4AM3A 2M0CA 2VUMJ 1XDSA 3TDUC 3RQ4A 3CLQA 3GFLA 3C2HA 3KETA 1I50J 1S72I 2EFPA 2QGUA 3MMYB 1IZ1A 2A5YB 4AWXB 3ZMSA 5JI6A 3H5NA 2ZXWH 1W1WE 1O4XA 5TJJA 1R4MB 2CUJA 2DK8A 2IJLA 3TOBA 2Y69H 3J7AO 3RKYA 4XMYA 1S29A 2IGKA 5GAEJ 3BTJA 4W97A 2ZNYA 1I5ZA 2KKOA 1SMTA 1WZ2A 1IXRC 2W4SA 4ETSA 3S2DJ 2VT3A 4UVBA 2R7FA 3GF2A 5FROA 4AD9A 3GO5A 1TWAJ 3H3VK 1KZHA 1F9NA 1RNLA 2XUBA 1ZH5A 4RB1A 3D0SA 4JX5A 3K4CA 1GVJA 4OMYA 1UHWA 2R7TA 4NC6A 3UKGA 2LBFA 2M0MA 4RGUA 2IGOA 1MBJA 2FU4A 3CCVI 4M9ZA 4GCVA 3T0YA 2GA2A 2UZKA 3CO7C 4YRVA 1MIJA 3GX4X 2ELKA 2LOOA 2ZFWA 3LSTA 1BN5A 4I76A 2VJ4A 4F93B 4V19K 2CUEA 3BR3A 1STZA 3ASOH 3E97A 2F4OB 5KK1A 2ESNA 3ELKA 4L0ZB 4MEXF 1ZELA 2ZNZA 3KFWX 2DODA 2Y2ZA 4DBQA 2CQNA 4OU0A 5KAIC 2YX7A 1EH8A 3SXYA 3PNVA 3F8CA 3PFYA 3IKVA 1JUPA 1KA8A 1XMKA 2WY8Q 4I98B 2K9SA 1L3LA 3QWLA 3F0CA 2L9NA 3EUKL 1OLTA 2AXLA 3DV8A 2M2EA 2M8GX 1JHFA 3LSGA 1Y1WJ 5IP7J 4A0YA 4IHXA 2DW4A 3ZQLA 2A3SA 2CH0A 2F4MB 1B72B 2E7XA 5CYVA 3B6AA 4DZPA 3A0BC 1CGPA 3TW7A 1U2WA 3F8FA 4F91B 2VPLA 1T6SA 2WA0A 3LSPA 1TWCJ 3N97A 5IY5H 2M7BA 3OWTA 1QRYA 2UXNA 4W1UA 2DMNA 2FF4A 3BDDA 2EINH 2FE3A 3CCMI 1B9MA 2DTRA 4FE7A 4ZYEA 1G3TA 5LLQA 5GP9A 2IRFG 3OV8A 2JMWA 2R7SA 3WGGA 3S2WA 2VQLA 1ETWA 4CDGA 1QGPA 4WK8F 1WQ2A 3AG4H 2HGCA 3BG6A 3LFKA 2LNBA 2FOKA 3U1KA 3VYSB 1ZLKA 4RAZA 4A3IJ 2V9VA 3AAFA 3K9TA 3S1QJ 1QU3A 1IRZA 2KRHA 4HF0A 3CUOA 2PG4A 2HR3A 3ERMA 4I0BA 2LRDA 3RKWA 5LEJA 4A0ZA 2O03A 5IP6A 3L2CA 2D45A 1JE8A 1WPKA 1KU2A 2OZUA 1P2FA
chains in the Genus database with same CATH topology
1HQCA 4YFXF 2ELHA 2DI3A 2HOEA 2HTJA 5DUIA 3WTSC 3RPUA 2VBYA 1MJ9A 1J9IA 1Z91A 1RI7A 5FGMA 1HSTA 2M87A 4ZYDA 1LVAA 2A6HF 2D2WA 3ERED 1HW2A 4XBFA 4HBLA 4N9IA 4OOIA 2XAJA 2XKPA 2FA5A 2M45A 2XAFA 3HRMA 4PDKA 3V7CA 4OIRF 4LLGF 2EFQA 5ILUA 4G7OF 1FYKA 2P7CB 1QZYA 5DCMB 2Z3YA 2LSOA 4BHCA 1S3JA 2H6CA 5E1WA 3KEQA 1HW1A 1IW7F 3JTHA 3EUHA 4O5VA 4I7HA 1FSEA 3J80Z 4IRGA 1U5TA 3WTVC 3I0TA 3KZZA 3R0JA 5D4RA 4UHTA 4UV8A 1R1TA 4MQVA 1G3WA 4BQAA 1QBJA 2K02A 4KIFA 3WU0A 2WC2A 5AIQA 3QPTA 4LB6B 4N9HA 3DFGA 2XKOA 3BWGA 5D8LB 4EJOA 2M5WA 3K2ZA 1Z9CA 2QQBA 1SFXA 1D8KA 3C1DA 3WU1B 2YX4A 3HOTA 2R3SA 3JTGA 1O3SA 3I71A 2G9WA 4KIGA 2ADUA 4XLNF 1FSHA 1YO5C 3P9KA 4CO8A 1JHHA 3M8EA 2PEXA 2M8EA 1V3FA 2OD5A 3SFZA 2VXZA 1SMYF 1O3QA 4ZH4F 2DU9A 2HKOA 1A04A 1FP2A 2G7UA 2GZWA 1HKTA 2CG4A 2WTEA 4G7HF 5HS9A 1RUNA 1R5GA 5EEHA 2P6SA 1XGMA 3QU3A 4MTDA 1ON2A 3GYHX 2W25A 4B8XA 3C7JA 5JHUA 4Q48A 4RGSA 1BI1A 3EYYA 4E70A 4EGYA 3CO6C 1ONVA 3IWFA 3SZTA 1Z1DA 2O8XA 1BIAA 5FFZA 1WI9A 5CVJA 4HX8A 3HRUA 4UVAA 3ABUA 3KP2A 3O6BB 5DD8A 3KP4A 3GFJA 3HSRA 2QWWA 4OIPF 2HKXA 5BPIA 4LMYA 2STWA 2Z99A 4GGGA 3M9AA 3RDIA 4I01A 3NEUA 4G7ZF 2X0LA 3IL2A 2QZ8A 4LK1F 1S8NA 2O6GE 3MZYA 3JAMK 2A69F 3KEOA 4Y17A 4Q47A 5DV5A 3E5UA 1T0FA 4KT5C 2Q8KA 5CJ9A 4LLNA 3QP5A 3GZ6A 2L54A 4HLYA 3C18A 1PUEE 5JVTA 2VN2A 5E1ZB 2TDXA 5FB2A 1BC8C 3L9FA 5LGUA 4U88A 3L09A 4NQWA 2HQRA 2AS5F 4EV0A 4BXUA 2EA2A 3JW4A 3NQOA 4U7BA 2P8TA 3LWFA 2OQGA 3ECHA 4L5IA 2YSRA 3DKWA 2CYYA 2QM3A 2IA0A 1PDNC 4LK0F 3MZHA 3QP6A 4R8HA 2NNYA 4ZZLA 5D6FA 1OYYA 3I59A 2CW0F 3WODF 2MA3A 4Y15A 4G94A 1BI2A 2EFWA 2K7LA 5AIPA 3NRVA 2NNNA 2OU2A 1W5SA 1IF1A 2CFXA 3V8KA 5FLXK 2QBYA 1T98A 2ZKZA 3WE3A 3CUQC 3LA3A 1DP7P 4CZZA 2ESHA 2P6TA 3FXUA 4IF4A 3BOQA 2FQ3A 4ENNA 2RQPA 3GVAA 3FZVA 4LGWA 1R1UA 1FWZA 2QVOA 3HHHA 5TRDA 3TDZC 1F4KA 2FSWA 2ZMEA 3F8NA 2JPBA 4A6DA 1I1SA 2MBFA 4WXDA 1OYIA 3U1DA 2IA2A 1LEAA 4RB2C 3IRQA 1XGNA 1Z05A 2G7HA 3WGHA 2XAQA 4HZFA 2QQ9A 1ZG1A 3I4PA 2DPDA 5FD6A 2H6BA 2L4AA 3HRTA 3H3ZA 2Q0OA 5LRSA 4Y13A 5D5WB 2XRNA 1ZHFA 2PN6A 3VFZA 4ZYGA 1CF7A 1R1VA 1TW3A 2DAOA 5ED4A 3LA2A 1P4XA 2IP2A 2RNJA 2PMUA 5D5XB 4IVNA 2M1BA 1UFMA 3CDHA 2VT2A 3T1BA 1YTYA 2UWMA 2V79A 1SD6A 1ZG5A 2YU3A 1EV7A 4PCQA 5IT3A 4ENMA 3GLXA 4XSZF 4LLLA 2K4BA 3DPTA 2MH2A 1K79A 5F1RA 1YG2A 2CWEA 2IPQX 2A6EF 2HTSA 4RB3C 3K1PA 5HDGA 5IT9Z 4Q5SF 4CHUA 2J5PA 3E5QA 1W7PB 3IC7A 1RUOA 3KP5A 3HHGA 1K6OA 1USSA 2P4WA 3IHUA 2IW5A 2LF8A 5KVRA 3QRFF 1FBQA 5L3CA 1WRJA 4GO1A 3T8RA 2EFNA 1IXCA 1BIBA 1P4AA 1FY7A 1KQ9A 2D1HA 1WKMA 1J0RA 2WWYA 2UXXA 1XB4A 2KIUA 5JFRA 4CGZA 1HKQA 4EJTA 4KFCA 4KA4A 3TGNA 4KN4X 3TO7A 4HA8A 3JSPA 1HKSA 2YPRA 3GWZA 5FD5A 4IXAA 3L00A 3J80K 3T5XA 1GXPA 1R22A 3ZMDA 2YR2A 2KIFA 2MC3A 1KU9A 4DQ2A 1Z6RA 1F5TA 3MAJA 3K1MA 4P96A 4RGRA 4WX9A 1AOYA 2XVCA 4U0WA 1T39A 4FHTA 3HSFA 2J5OA 2E7WA 5J6XA 1UCRA 2GWRA 3ISPA 3BJOA 4M72A 1Z7UA 4I02A 5AONA 3EYIA 4LG0A 1V4RA 5BMZA 3P7NA 1J2XA 3E6CC 4NHJA 5D8KB 1W4MA 2HFHA 1LQ1A 3PQJA 1LEBA 3Q9SA 3FX3A 3KCCA 1U6GA 4IHTA 2JSCA 1YYVA 1JXSA 3SHFA 2VOPA 1H9TA 3RKXA 1FPQA 1BBYA 4XLPF 2HEOA 2VBWA 2FNPA 1S7AA 1E17A 5F6FA 2STTA 2XGXA 4M9XA 4RS8A 1GHCA 4FT8A 2BYVE 1RIOH 3CLOA 2QYOA 5K5RA 4DNCA 5E8GA 4H0EA 2VC1A 3ZPLA 4OINF 1UB9A 3F6OA 3CUQA 2VOOA 1I1GA 3BROA 2LDUA 4EVIA 1IAWA 5E1XA 2BBYA 2K86A 3K0LA 2XAGA 2JPCA 3TQNA 1K78A 3EQLF 3F8BA 1S7OA 3MQ0A 1REPC 5LHGA 1TLHB 2H09A 2RV8A 2V1UA 2A68F 1FP1D 2JZYA 2QLZA 4KICA 2ETHA 4LG0B 2EFOA 4A0XA 2HZTA 4B09A 2GXBA 2W84A 5D5VB 3EETA 3M1EA 2NAZA 3GUDA 1QQIA 4MHGA 3Q5FA 3QU6A 2E1NA 4M71A 4LD5A 1O3RA 1ZREA 2OZ6A 1XMAA 1ON1A 4RAYA 3F72A 2XV4S 1OR7A 4P55A 1PP7U 1MGTA 2HYGD 2IVMA 5CVIA 5K1YA 1ODDA 1TNTA 5JR3A 5CVUA 1J75A 1T38A 1U5TB 2KJBA 3FXQA 4A2UA 4N0BA 2R7DA 4BH9A 3V7SA 1OYWA 1YW9A 2OA4A 1OMIA 2FBIA 2QUFA 4IJAA 5DUKA 1U78A 1XSXA 4L0YB 2EA4A 1B9NA 2RKHA 1ZGAA 4TV7A 4IRIA 5LGTA 4D0PA 5H6QA 3R4KA 2NRAC 2VODA 4HX7A 1KQ0A 1J7KA 4EM1A 5DCFA 4F7ZA 3TO6A 3W6KB 3VEPA 3IWZA 4FX0A 5HLHA 1IUYA 3J81Z 2VE9A 2FRHA 1FBSA 2DK5A 1HXDA 1B1BA 4YG2F 5LRRA 2Q2EA 1DUXC 1P6RA 1SFUA 2GA1A 3GW2A 4A12A 4HF2A 1YQAA 2EV0A 3REOA 2A61A 2ISYA 2MD5A 1DPRA 1MKMA 1TNSA 3QAHA 2Y48A 3KP7A 3FXRA 1ZRFA 3RYRA 3DF8A 2DPUA 2HS5A 2Y75A 1Q1HA 4CYDA 1C0WA 2H94A 3MFKA 4AIJA 2XAHA 3M8FA 2EV5A 3Q9VA 1BI3A 3FF5A 1TW2A 3COAC 5FFXA 3HTSB 1NHAA 1W7PD 2BGCA 1XDUA 3PFIA 2W85A 2GIVA 3GXOA 2GAUA 3FWEA 2V1XA 3HIFA 5HVQC 4KNYA 5HS7A 3E3VA 3BPVA 4WF2A 2CSOA 5ILVA 1KQ8A 1KGSA 3F6VA 4M6YA 2P5VA 5H20A 1IN8A 5EEGA 4BHBA 4KN7X 4U7DA 2VBXA 3O2PE 4BAYA 4UVCA 4EQQA 2F5CA 5E18F 3F3XA 1IRGA 1KYZA 5K5QA 3T8TA 5IT9K 2DT5A 4G9YA 2EWNA 4OIOF 3HOSA 4HYEA 5DD4A 3JSOA 3ZP5A 1FBUA 5CLSA 4JK1X 1SD7A 2DO7A 2XROA 2PMHA 1I6XA 4BYYA 2LF7A 3FM5A 4R79A 2F5FA 1AWCA 2K27A 3ZN1A 3LA7A 2FMLA 3RI4A 1R36A 1BJAA 2COMA 2OBPA 1H9GA 1Z6TA 2HWVA 3R6SA 1FC3A 1YW7A 3WTXC 3DQVC 1FX7A 3I59B 3KE2A 5E17F 2H27A 5CVRA 3W6JB 5LHIA 1D5VA 2KIMA 2XIGA 4L9JA 4MTEA 1ZYRF 4YIFA 2FBKA 2L02A 5A2QZ 2QBYB 1O7FA 1W5TA 3MWMA 4PZJA 4R1HA 1IN5A 4HDVA 1TQMA 1ZN2A 2P5LC 1O3TA 2HQNA 1BC7C 2VONA 1K7AA 3WTUC 2L3DA 3FHZA 3FM3A 2QQAA 4YFKF 4EM2A 1B59A 2P5KA 1R58A 3KLNA 4HV6A 4GYIA 4GXOA 2ZMEB 3GEZA 4A6EA 4P5OA 1QPMA 4YFNF 5LBQA 4WXCA 5HDKA 2V6CA 1YS7A 4M6XA 2Y0MA 4LJZF 3LQRA 3U9GA 5ICCA 1IN6A 2XASA 1ZGJA 1D3YA 2MH9A 3R0AA 3G3ZA 4AVPA 1HW5A 4AIHA 3KP6A 1O7LA 4O6JA 5DCMA 5D6EA 1PP8F 2C6YA 4WWCA 4P9UA 5BPDA 2F5EA 1FYMA 5DYMA 3F8MA 4MGRA 1CF7B 1XN7A 3FMRA 1TQIA 3VODA 2O0YA 4KMUX 4L18B 3CTAA 1MJAA 3ML6A 1SD4A 4JBAA 2FMYA 3LAJA 2JTVA 2DBBA 4LFUA 1BI0A 3I64A 1R7JA 4ESBA 5ILSA 2ZXJA 5BQTA 5ICFA 3GZ5A 5E8IA 1LJ9A 1YS6A 5F64A 4U0YA 1XGOA 5HOOA 2VBZA 2JT1A 4MNUA 2HYFA 3TO9A 1SFEA 1G3YA 1IRFA 4UV9A 1I27A 2ISZA 3MEXA 1DDNA 2PLYA 5L3EA 3BZ6A 3ECOA 3P9CA 1YW8A 3P9IA 1J59A 3F21A 1ZAOA 3L7WA 2XHKA 2Z5UA 5LGNA 4ENKA 4KDPA 1TBXA 1ZARA 5K5OA 1TTYA 3I58A 1LDDA 4ON0A 3D5LA 1T2KA 1EH7A 3HRSA 3RTRA 1FOKA 4XRFA 3RPQA 3K69A 2EV6A 3ZMUA 1WWXA 1U3EM 2DLLA 2P7VB 3DPLC 4PGGA 4KIBA 1LDJA 1MZBA 2F5DA 1Y0UA 4A5NA 1LNWA 2O3FA 1OKRA 3E5XA 1ZLJA 2BV6A 4KUMA 3ZMTA 3WTWC 2MLKA 4AIKA 4UXNA 5L3BA 2IT0A 1SD5A 3I53A 3B02A 3U2RA 4EJUA 3N4MA 1P92A 4KYWA 4HW0A 6PAXA 2B0LA 2V1DA 4HAMA 4HV5A 4M9SA 2RC4A 2EK5A 4GYGA 3BPXA 5CVVA 1BOAA 3HSEA 2RGVA 5HLIA 5DEQA 2M30A 2D1VA 3G73A 1JGSA 3R60A 3LQQA 4S04A 2ZBKA 4ESFA 5ICGA 2KJCA 3F23A 4K2EA 1FZPB 4O3MA 2RDPA 3H92A 5ERIA 1UHMA 4OMZA 3C3WA 4G8XA 4EJVA 1HBXG 3WTZA 3OOPA 5D4SA 2GXGA 4RGXA 2BEOA 5L3DA 4OIQF 3HYIA 3J81K 4WCGA 1OPCA 3LAPA 3V4GA 3HTUA 2LKPA 1P4WA 2W57A 3B73A 1VTNC 2K4JA 2FXAA 5J8CA 3E6MA 1YLFA 3GFIA 2A07F 4ESJA 4I2OA 2BE5F 4L9NA 2PJPA 3SZPA 1ZRDA 1ZRCA 4BHPA 5E20A 4A5MA 4BNCA 1R23A 1FYLA 4NB5A 3ULQB 2ZCWA 5HS8A 4ASNA 2GQQA 3CUQB 3KP3A 2ACJA 3I54A 3QOPA 1XGSA 2L4MA 2DQLA 1O57A 4L9VA 4U0VA 2VC0A 2Z9OA 2O61A 1KU3A 1K78B 1G6NA 1EH6A 4LB5A 1R00A 1FNNA 4I0AA 3ZMVA 1FLIA 1RZ4A 1MDMA 4UUVA 2W24A 3DXJF 1ULYA 1YFHA 5BS6A 3F22A 1E2XA 4HQEA 1G4DA 3RIRA 3I5UA 1XCBA 1IN7A 5H6RA 4L5JA 3V8JA 4IHSA 5ICEA 1F1ZA 4JQFA 4G6DA 4EMSA 2FNAA 2PBIA 1QNTA 4HF1A 4UNOA 1IXSB 2ZO4A 5LHHA 3R61A 2DFIA 3ZN0A 1H0MA 1HSJA 4MQ9F 2ZJ2A 4FX4A 1LB2A 2CGPA 2EJRA 3K1NA 4EGZA 4MEYF 5J8FA 2RVCA 3WGIA 3KZYA 4HQMA 2HDCA 2OQRA 2F2EA 2MLGA 2E1CA 1KYWA 2CQKA 1U8RA 4QWQA 3BJ6A 1J5YA 1DPUA 3IKTA 5HDNA 4IRHA 3E6BA 4PGHA 1SAXA 4M74A 3VOEA 3WTYC 1KU7A 1XSDA 2DQRA 2IA1A 4HOBA 5L3GA 1G3SA 2L01A 4RB0A 2OAZA 4QLCU 3WE2A 3WG9A 2QENA 1U5TC 2X4HA 3JAMZ 1XD7A 1ZG3A 1XSVA 4CICA 5L3FA 5A2QK 4WXHA 1GXQA 2PFBA 3CJNA 3BY6A 2PI0A 4YIIA 2NS0A 1MDMB 1R5HA 3H3UA 3HUGA 1S6LA 4HX4A 3IRRA 3DP7A 1W7PA 3BP8A 2RN7A 3FMSA 2PQ8A 5FO5A 2CO5A 3DEUA 3ROUA 3V7RA 4EM0B 3ABTA 3BJAA 3M7GA 4P9FA 3SQNA 2Z33A 3TOAA 1BM9A 4ENJA 1USTA 5LEKA 4L9TA 3ZMZA 2FBHA 5BOXA 1FT9A 3E6DA 1LDKB 4Q4ZF 4S05A 3O3KA 1QZZA 4CXFA 2KRFA 5HLGA 4ZZDA 1QO0D 4KMFA 1MD0A 1XCVA 4EJWA 4HLXA 3MCZA 4Z2YA 4HDUA 1L0OC 3WTTC 1B6AA 3RJPA 4ZYHA 2VE8A 3KLOA 3V8LA 4M73A 4XSXF 4I09A 2FEZA 1TQPA 5FLXZ 2EB7A 4G6QA 4IPAA 1X3UA 1B4AA 3ZQ7A 1D8JA 1IN4A 3RYPA 2NYXA 2JRTA 3VB2A 1MJBA 5D5UB 3QPHA 3GFMA 3PQKA 3TKYA 1YIOA 2WV0A 3EDPA 1WSUA 3FMQA 5DDGA 1XDSA 3TDUC 3GFLA 3KETA 2EFPA 1IZ1A 2A5YB 4AWXB 3ZMSA 5JI6A 5TJJA 2DK8A 2IJLA 3TOBA 3J7AO 3RKYA 1S29A 2ZNYA 1I5ZA 2KKOA 1SMTA 1IXRC 4ETSA 2VT3A 4UVBA 2R7FA 3GF2A 4AD9A 3GO5A 1F9NA 1RNLA 2XUBA 1ZH5A 4RB1A 3D0SA 1GVJA 4OMYA 1UHWA 4RGUA 2FU4A 4M9ZA 4GCVA 3T0YA 2GA2A 2UZKA 3CO7C 3GX4X 2ZFWA 3LSTA 1BN5A 1STZA 3E97A 5KK1A 2ESNA 3ELKA 4L0ZB 4MEXF 2ZNZA 3KFWX 4OU0A 2YX7A 1EH8A 3SXYA 3F8CA 3IKVA 1KA8A 1XMKA 4I98B 1L3LA 2AXLA 3DV8A 1JHFA 4A0YA 2DW4A 2A3SA 2E7XA 5CYVA 1CGPA 1U2WA 3F8FA 1T6SA 3N97A 2UXNA 3BDDA 2FF4A 2FE3A 1B9MA 2DTRA 4ZYEA 1G3TA 5LLQA 2IRFG 3OV8A 3WGGA 3S2WA 4CDGA 1QGPA 4WK8F 1WQ2A 2HGCA 3LFKA 2LNBA 2FOKA 1ZLKA 4RAZA 2V9VA 3AAFA 3K9TA 4HF0A 3CUOA 2PG4A 2HR3A 4I0BA 3RKWA 5LEJA 4A0ZA 2O03A 3L2CA 2D45A 1JE8A 1KU2A 2OZUA 1P2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQC A;  4YFX F;  2ELH A;  2DI3 A;  2HOE A;  2HTJ A;  5DUI A;  3WTS C;  3RPU A;  2VBY A;  1MJ9 A;  1J9I A;  1Z91 A;  1RI7 A;  5FGM A;  1HST A;  2M87 A;  4ZYD A;  1LVA A;  2A6H F;  2D2W A;  3ERE D;  1HW2 A;  4XBF A;  4HBL A;  4N9I A;  4OOI A;  2XAJ A;  2XKP A;  2FA5 A;  2M45 A;  2XAF A;  3HRM A;  4PDK A;  3V7C A;  4OIR F;  4LLG F;  2EFQ A;  5ILU A;  4G7O F;  1FYK A;  2P7C B;  1QZY A;  5DCM B;  2Z3Y A;  2LSO A;  4BHC A;  1S3J A;  2H6C A;  5E1W A;  3KEQ A;  1HW1 A;  1IW7 F;  3JTH A;  3EUH A;  4O5V A;  4I7H A;  1FSE A;  3J80 Z;  4IRG A;  1U5T A;  3WTV C;  3I0T A;  3KZZ A;  3R0J A;  5D4R A;  4UHT A;  4UV8 A;  1R1T A;  4MQV A;  1G3W A;  4BQA A;  1QBJ A;  2K02 A;  4KIF A;  3WU0 A;  2WC2 A;  5AIQ A;  3QPT A;  4LB6 B;  4N9H A;  3DFG A;  2XKO A;  3BWG A;  5D8L B;  4EJO A;  2M5W A;  3K2Z A;  1Z9C A;  2QQB A;  1SFX A;  1D8K A;  3C1D A;  3WU1 B;  2YX4 A;  3HOT A;  2R3S A;  3JTG A;  1O3S A;  3I71 A;  2G9W A;  4KIG A;  2ADU A;  4XLN F;  1FSH A;  1YO5 C;  3P9K A;  4CO8 A;  1JHH A;  3M8E A;  2PEX A;  2M8E A;  1V3F A;  2OD5 A;  3SFZ A;  2VXZ A;  1SMY F;  1O3Q A;  4ZH4 F;  2DU9 A;  2HKO A;  1A04 A;  1FP2 A;  2G7U A;  2GZW A;  1HKT A;  2CG4 A;  2WTE A;  4G7H F;  5HS9 A;  1RUN A;  1R5G A;  5EEH A;  2P6S A;  1XGM A;  3QU3 A;  4MTD A;  1ON2 A;  3GYH X;  2W25 A;  4B8X A;  3C7J A;  5JHU A;  4Q48 A;  4RGS A;  1BI1 A;  3EYY A;  4E70 A;  4EGY A;  3CO6 C;  1ONV A;  3IWF A;  3SZT A;  1Z1D A;  2O8X A;  1BIA A;  5FFZ A;  1WI9 A;  5CVJ A;  4HX8 A;  3HRU A;  4UVA A;  3ABU A;  3KP2 A;  3O6B B;  5DD8 A;  3KP4 A;  3GFJ A;  3HSR A;  2QWW A;  4OIP F;  2HKX A;  5BPI A;  4LMY A;  2STW A;  2Z99 A;  4GGG A;  3M9A A;  3RDI A;  4I01 A;  3NEU A;  4G7Z F;  2X0L A;  3IL2 A;  2QZ8 A;  4LK1 F;  1S8N A;  2O6G E;  3MZY A;  3JAM K;  2A69 F;  3KEO A;  4Y17 A;  4Q47 A;  5DV5 A;  3E5U A;  1T0F A;  4KT5 C;  2Q8K A;  5CJ9 A;  4LLN A;  3QP5 A;  3GZ6 A;  2L54 A;  4HLY A;  3C18 A;  1PUE E;  5JVT A;  2VN2 A;  5E1Z B;  2TDX A;  5FB2 A;  1BC8 C;  3L9F A;  5LGU A;  4U88 A;  3L09 A;  4NQW A;  2HQR A;  2AS5 F;  4EV0 A;  4BXU A;  2EA2 A;  3JW4 A;  3NQO A;  4U7B A;  2P8T A;  3LWF A;  2OQG A;  3ECH A;  4L5I A;  2YSR A;  3DKW A;  2CYY A;  2QM3 A;  2IA0 A;  1PDN C;  4LK0 F;  3MZH A;  3QP6 A;  4R8H A;  2NNY A;  4ZZL A;  5D6F A;  1OYY A;  3I59 A;  2CW0 F;  3WOD F;  2MA3 A;  4Y15 A;  4G94 A;  1BI2 A;  2EFW A;  2K7L A;  5AIP A;  3NRV A;  2NNN A;  2OU2 A;  1W5S A;  1IF1 A;  2CFX A;  3V8K A;  5FLX K;  2QBY A;  1T98 A;  2ZKZ A;  3WE3 A;  3CUQ C;  3LA3 A;  1DP7 P;  4CZZ A;  2ESH A;  2P6T A;  3FXU A;  4IF4 A;  3BOQ A;  2FQ3 A;  4ENN A;  2RQP A;  3GVA A;  3FZV A;  4LGW A;  1R1U A;  1FWZ A;  2QVO A;  3HHH A;  5TRD A;  3TDZ C;  1F4K A;  2FSW A;  2ZME A;  3F8N A;  2JPB A;  4A6D A;  1I1S A;  2MBF A;  4WXD A;  1OYI A;  3U1D A;  2IA2 A;  1LEA A;  4RB2 C;  3IRQ A;  1XGN A;  1Z05 A;  2G7H A;  3WGH A;  2XAQ A;  4HZF A;  2QQ9 A;  1ZG1 A;  3I4P A;  2DPD A;  5FD6 A;  2H6B A;  2L4A A;  3HRT A;  3H3Z A;  2Q0O A;  5LRS A;  4Y13 A;  5D5W B;  2XRN A;  1ZHF A;  2PN6 A;  3VFZ A;  4ZYG A;  1CF7 A;  1R1V A;  1TW3 A;  2DAO A;  5ED4 A;  3LA2 A;  1P4X A;  2IP2 A;  2RNJ A;  2PMU A;  5D5X B;  4IVN A;  2M1B A;  1UFM A;  3CDH A;  2VT2 A;  3T1B A;  1YTY A;  2UWM A;  2V79 A;  1SD6 A;  1ZG5 A;  2YU3 A;  1EV7 A;  4PCQ A;  5IT3 A;  4ENM A;  3GLX A;  4XSZ F;  4LLL A;  2K4B A;  3DPT A;  2MH2 A;  1K79 A;  5F1R A;  1YG2 A;  2CWE A;  2IPQ X;  2A6E F;  2HTS A;  4RB3 C;  3K1P A;  5HDG A;  5IT9 Z;  4Q5S F;  4CHU A;  2J5P A;  3E5Q A;  1W7P B;  3IC7 A;  1RUO A;  3KP5 A;  3HHG A;  1K6O A;  1USS A;  2P4W A;  3IHU A;  2IW5 A;  2LF8 A;  5KVR A;  3QRF F;  1FBQ A;  5L3C A;  1WRJ A;  4GO1 A;  3T8R A;  2EFN A;  1IXC A;  1BIB A;  1P4A A;  1FY7 A;  1KQ9 A;  2D1H A;  1WKM A;  1J0R A;  2WWY A;  2UXX A;  1XB4 A;  2KIU A;  5JFR A;  4CGZ A;  1HKQ A;  4EJT A;  4KFC A;  4KA4 A;  3TGN A;  4KN4 X;  3TO7 A;  4HA8 A;  3JSP A;  1HKS A;  2YPR A;  3GWZ A;  5FD5 A;  4IXA A;  3L00 A;  3J80 K;  3T5X A;  1GXP A;  1R22 A;  3ZMD A;  2YR2 A;  2KIF A;  2MC3 A;  1KU9 A;  4DQ2 A;  1Z6R A;  1F5T A;  3MAJ A;  3K1M A;  4P96 A;  4RGR A;  4WX9 A;  1AOY A;  2XVC A;  4U0W A;  1T39 A;  4FHT A;  3HSF A;  2J5O A;  2E7W A;  5J6X A;  1UCR A;  2GWR A;  3ISP A;  3BJO A;  4M72 A;  1Z7U A;  4I02 A;  5AON A;  3EYI A;  4LG0 A;  1V4R A;  5BMZ A;  3P7N A;  1J2X A;  3E6C C;  4NHJ A;  5D8K B;  1W4M A;  2HFH A;  1LQ1 A;  3PQJ A;  1LEB A;  3Q9S A;  3FX3 A;  3KCC A;  1U6G A;  4IHT A;  2JSC A;  1YYV A;  1JXS A;  3SHF A;  2VOP A;  1H9T A;  3RKX A;  1FPQ A;  1BBY A;  4XLP F;  2HEO A;  2VBW A;  2FNP A;  1S7A A;  1E17 A;  5F6F A;  2STT A;  2XGX A;  4M9X A;  4RS8 A;  1GHC A;  4FT8 A;  2BYV E;  1RIO H;  3CLO A;  2QYO A;  5K5R A;  4DNC A;  5E8G A;  4H0E A;  2VC1 A;  3ZPL A;  4OIN F;  1UB9 A;  3F6O A;  3CUQ A;  2VOO A;  1I1G A;  3BRO A;  2LDU A;  4EVI A;  1IAW A;  5E1X A;  2BBY A;  2K86 A;  3K0L A;  2XAG A;  2JPC A;  3TQN A;  1K78 A;  3EQL F;  3F8B A;  1S7O A;  3MQ0 A;  1REP C;  5LHG A;  1TLH B;  2H09 A;  2RV8 A;  2V1U A;  2A68 F;  1FP1 D;  2JZY A;  2QLZ A;  4KIC A;  2ETH A;  4LG0 B;  2EFO A;  4A0X A;  2HZT A;  4B09 A;  2GXB A;  2W84 A;  5D5V B;  3EET A;  3M1E A;  2NAZ A;  3GUD A;  1QQI A;  4MHG A;  3Q5F A;  3QU6 A;  2E1N A;  4M71 A;  4LD5 A;  1O3R A;  1ZRE A;  2OZ6 A;  1XMA A;  1ON1 A;  4RAY A;  3F72 A;  2XV4 S;  1OR7 A;  4P55 A;  1PP7 U;  1MGT A;  2HYG D;  2IVM A;  5CVI A;  5K1Y A;  1ODD A;  1TNT A;  5JR3 A;  5CVU A;  1J75 A;  1T38 A;  1U5T B;  2KJB A;  3FXQ A;  4A2U A;  4N0B A;  2R7D A;  4BH9 A;  3V7S A;  1OYW A;  1YW9 A;  2OA4 A;  1OMI A;  2FBI A;  2QUF A;  4IJA A;  5DUK A;  1U78 A;  1XSX A;  4L0Y B;  2EA4 A;  1B9N A;  2RKH A;  1ZGA A;  4TV7 A;  4IRI A;  5LGT A;  4D0P A;  5H6Q A;  3R4K A;  2NRA C;  2VOD A;  4HX7 A;  1KQ0 A;  1J7K A;  4EM1 A;  5DCF A;  4F7Z A;  3TO6 A;  3W6K B;  3VEP A;  3IWZ A;  4FX0 A;  5HLH A;  1IUY A;  3J81 Z;  2VE9 A;  2FRH A;  1FBS A;  2DK5 A;  1HXD A;  1B1B A;  4YG2 F;  5LRR A;  2Q2E A;  1DUX C;  1P6R A;  1SFU A;  2GA1 A;  3GW2 A;  4A12 A;  4HF2 A;  1YQA A;  2EV0 A;  3REO A;  2A61 A;  2ISY A;  2MD5 A;  1DPR A;  1MKM A;  1TNS A;  3QAH A;  2Y48 A;  3KP7 A;  3FXR A;  1ZRF A;  3RYR A;  3DF8 A;  2DPU A;  2HS5 A;  2Y75 A;  1Q1H A;  4CYD A;  1C0W A;  2H94 A;  3MFK A;  4AIJ A;  2XAH A;  3M8F A;  2EV5 A;  3Q9V A;  1BI3 A;  3FF5 A;  1TW2 A;  3COA C;  5FFX A;  3HTS B;  1NHA A;  1W7P D;  2BGC A;  1XDU A;  3PFI A;  2W85 A;  2GIV A;  3GXO A;  2GAU A;  3FWE A;  2V1X A;  3HIF A;  5HVQ C;  4KNY A;  5HS7 A;  3E3V A;  3BPV A;  4WF2 A;  2CSO A;  5ILV A;  1KQ8 A;  1KGS A;  3F6V A;  4M6Y A;  2P5V A;  5H20 A;  1IN8 A;  5EEG A;  4BHB A;  4KN7 X;  4U7D A;  2VBX A;  3O2P E;  4BAY A;  4UVC A;  4EQQ A;  2F5C A;  5E18 F;  3F3X A;  1IRG A;  1KYZ A;  5K5Q A;  3T8T A;  5IT9 K;  2DT5 A;  4G9Y A;  2EWN A;  4OIO F;  3HOS A;  4HYE A;  5DD4 A;  3JSO A;  3ZP5 A;  1FBU A;  5CLS A;  4JK1 X;  1SD7 A;  2DO7 A;  2XRO A;  2PMH A;  1I6X A;  4BYY A;  2LF7 A;  3FM5 A;  4R79 A;  2F5F A;  1AWC A;  2K27 A;  3ZN1 A;  3LA7 A;  2FML A;  3RI4 A;  1R36 A;  1BJA A;  2COM A;  2OBP A;  1H9G A;  1Z6T A;  2HWV A;  3R6S A;  1FC3 A;  1YW7 A;  3WTX C;  3DQV C;  1FX7 A;  3I59 B;  3KE2 A;  5E17 F;  2H27 A;  5CVR A;  3W6J B;  5LHI A;  1D5V A;  2KIM A;  2XIG A;  4L9J A;  4MTE A;  1ZYR F;  4YIF A;  2FBK A;  2L02 A;  5A2Q Z;  2QBY B;  1O7F A;  1W5T A;  3MWM A;  4PZJ A;  4R1H A;  1IN5 A;  4HDV A;  1TQM A;  1ZN2 A;  2P5L C;  1O3T A;  2HQN A;  1BC7 C;  2VON A;  1K7A A;  3WTU C;  2L3D A;  3FHZ A;  3FM3 A;  2QQA A;  4YFK F;  4EM2 A;  1B59 A;  2P5K A;  1R58 A;  3KLN A;  4HV6 A;  4GYI A;  4GXO A;  2ZME B;  3GEZ A;  4A6E A;  4P5O A;  1QPM A;  4YFN F;  5LBQ A;  4WXC A;  5HDK A;  2V6C A;  1YS7 A;  4M6X A;  2Y0M A;  4LJZ F;  3LQR A;  3U9G A;  5ICC A;  1IN6 A;  2XAS A;  1ZGJ A;  1D3Y A;  2MH9 A;  3R0A A;  3G3Z A;  4AVP A;  1HW5 A;  4AIH A;  3KP6 A;  1O7L A;  4O6J A;  5DCM A;  5D6E A;  1PP8 F;  2C6Y A;  4WWC A;  4P9U A;  5BPD A;  2F5E A;  1FYM A;  5DYM A;  3F8M A;  4MGR A;  1CF7 B;  1XN7 A;  3FMR A;  1TQI A;  3VOD A;  2O0Y A;  4KMU X;  4L18 B;  3CTA A;  1MJA A;  3ML6 A;  1SD4 A;  4JBA A;  2FMY A;  3LAJ A;  2JTV A;  2DBB A;  4LFU A;  1BI0 A;  3I64 A;  1R7J A;  4ESB A;  5ILS A;  2ZXJ A;  5BQT A;  5ICF A;  3GZ5 A;  5E8I A;  1LJ9 A;  1YS6 A;  5F64 A;  4U0Y A;  1XGO A;  5HOO A;  2VBZ A;  2JT1 A;  4MNU A;  2HYF A;  3TO9 A;  1SFE A;  1G3Y A;  1IRF A;  4UV9 A;  1I27 A;  2ISZ A;  3MEX A;  1DDN A;  2PLY A;  5L3E A;  3BZ6 A;  3ECO A;  3P9C A;  1YW8 A;  3P9I A;  1J59 A;  3F21 A;  1ZAO A;  3L7W A;  2XHK A;  2Z5U A;  5LGN A;  4ENK A;  4KDP A;  1TBX A;  1ZAR A;  5K5O A;  1TTY A;  3I58 A;  1LDD A;  4ON0 A;  3D5L A;  1T2K A;  1EH7 A;  3HRS A;  3RTR A;  1FOK A;  4XRF A;  3RPQ A;  3K69 A;  2EV6 A;  3ZMU A;  1WWX A;  1U3E M;  2DLL A;  2P7V B;  3DPL C;  4PGG A;  4KIB A;  1LDJ A;  1MZB A;  2F5D A;  1Y0U A;  4A5N A;  1LNW A;  2O3F A;  1OKR A;  3E5X A;  1ZLJ A;  2BV6 A;  4KUM A;  3ZMT A;  3WTW C;  2MLK A;  4AIK A;  4UXN A;  5L3B A;  2IT0 A;  1SD5 A;  3I53 A;  3B02 A;  3U2R A;  4EJU A;  3N4M A;  1P92 A;  4KYW A;  4HW0 A;  6PAX A;  2B0L A;  2V1D A;  4HAM A;  4HV5 A;  4M9S A;  2RC4 A;  2EK5 A;  4GYG A;  3BPX A;  5CVV A;  1BOA A;  3HSE A;  2RGV A;  5HLI A;  5DEQ A;  2M30 A;  2D1V A;  3G73 A;  1JGS A;  3R60 A;  3LQQ A;  4S04 A;  2ZBK A;  4ESF A;  5ICG A;  2KJC A;  3F23 A;  4K2E A;  1FZP B;  4O3M A;  2RDP A;  3H92 A;  5ERI A;  1UHM A;  4OMZ A;  3C3W A;  4G8X A;  4EJV A;  1HBX G;  3WTZ A;  3OOP A;  5D4S A;  2GXG A;  4RGX A;  2BEO A;  5L3D A;  4OIQ F;  3HYI A;  3J81 K;  4WCG A;  1OPC A;  3LAP A;  3V4G A;  3HTU A;  2LKP A;  1P4W A;  2W57 A;  3B73 A;  1VTN C;  2K4J A;  2FXA A;  5J8C A;  3E6M A;  1YLF A;  3GFI A;  2A07 F;  4ESJ A;  4I2O A;  2BE5 F;  4L9N A;  2PJP A;  3SZP A;  1ZRD A;  1ZRC A;  4BHP A;  5E20 A;  4A5M A;  4BNC A;  1R23 A;  1FYL A;  4NB5 A;  3ULQ B;  2ZCW A;  5HS8 A;  4ASN A;  2GQQ A;  3CUQ B;  3KP3 A;  2ACJ A;  3I54 A;  3QOP A;  1XGS A;  2L4M A;  2DQL A;  1O57 A;  4L9V A;  4U0V A;  2VC0 A;  2Z9O A;  2O61 A;  1KU3 A;  1K78 B;  1G6N A;  1EH6 A;  4LB5 A;  1R00 A;  1FNN A;  4I0A A;  3ZMV A;  1FLI A;  1RZ4 A;  1MDM A;  4UUV A;  2W24 A;  3DXJ F;  1ULY A;  1YFH A;  5BS6 A;  3F22 A;  1E2X A;  4HQE A;  1G4D A;  3RIR A;  3I5U A;  1XCB A;  1IN7 A;  5H6R A;  4L5J A;  3V8J A;  4IHS A;  5ICE A;  1F1Z A;  4JQF A;  4G6D A;  4EMS A;  2FNA A;  2PBI A;  1QNT A;  4HF1 A;  4UNO A;  1IXS B;  2ZO4 A;  5LHH A;  3R61 A;  2DFI A;  3ZN0 A;  1H0M A;  1HSJ A;  4MQ9 F;  2ZJ2 A;  4FX4 A;  1LB2 A;  2CGP A;  2EJR A;  3K1N A;  4EGZ A;  4MEY F;  5J8F A;  2RVC A;  3WGI A;  3KZY A;  4HQM A;  2HDC A;  2OQR A;  2F2E A;  2MLG A;  2E1C A;  1KYW A;  2CQK A;  1U8R A;  4QWQ A;  3BJ6 A;  1J5Y A;  1DPU A;  3IKT A;  5HDN A;  4IRH A;  3E6B A;  4PGH A;  1SAX A;  4M74 A;  3VOE A;  3WTY C;  1KU7 A;  1XSD A;  2DQR A;  2IA1 A;  4HOB A;  5L3G A;  1G3S A;  2L01 A;  4RB0 A;  2OAZ A;  4QLC U;  3WE2 A;  3WG9 A;  2QEN A;  1U5T C;  2X4H A;  3JAM Z;  1XD7 A;  1ZG3 A;  1XSV A;  4CIC A;  5L3F A;  5A2Q K;  4WXH A;  1GXQ A;  2PFB A;  3CJN A;  3BY6 A;  2PI0 A;  4YII A;  2NS0 A;  1MDM B;  1R5H A;  3H3U A;  3HUG A;  1S6L A;  4HX4 A;  3IRR A;  3DP7 A;  1W7P A;  3BP8 A;  2RN7 A;  3FMS A;  2PQ8 A;  5FO5 A;  2CO5 A;  3DEU A;  3ROU A;  3V7R A;  4EM0 B;  3ABT A;  3BJA A;  3M7G A;  4P9F A;  3SQN A;  2Z33 A;  3TOA A;  1BM9 A;  4ENJ A;  1UST A;  5LEK A;  4L9T A;  3ZMZ A;  2FBH A;  5BOX A;  1FT9 A;  3E6D A;  1LDK B;  4Q4Z F;  4S05 A;  3O3K A;  1QZZ A;  4CXF A;  2KRF A;  5HLG A;  4ZZD A;  1QO0 D;  4KMF A;  1MD0 A;  1XCV A;  4EJW A;  4HLX A;  3MCZ A;  4Z2Y A;  4HDU A;  1L0O C;  3WTT C;  1B6A A;  3RJP A;  4ZYH A;  2VE8 A;  3KLO A;  3V8L A;  4M73 A;  4XSX F;  4I09 A;  2FEZ A;  1TQP A;  5FLX Z;  2EB7 A;  4G6Q A;  4IPA A;  1X3U A;  1B4A A;  3ZQ7 A;  1D8J A;  1IN4 A;  3RYP A;  2NYX A;  2JRT A;  3VB2 A;  1MJB A;  5D5U B;  3QPH A;  3GFM A;  3PQK A;  3TKY A;  1YIO A;  2WV0 A;  3EDP A;  1WSU A;  3FMQ A;  5DDG A;  1XDS A;  3TDU C;  3GFL A;  3KET A;  2EFP A;  1IZ1 A;  2A5Y B;  4AWX B;  3ZMS A;  5JI6 A;  5TJJ A;  2DK8 A;  2IJL A;  3TOB A;  3J7A O;  3RKY A;  1S29 A;  2ZNY A;  1I5Z A;  2KKO A;  1SMT A;  1IXR C;  4ETS A;  2VT3 A;  4UVB A;  2R7F A;  3GF2 A;  4AD9 A;  3GO5 A;  1F9N A;  1RNL A;  2XUB A;  1ZH5 A;  4RB1 A;  3D0S A;  1GVJ A;  4OMY A;  1UHW A;  4RGU A;  2FU4 A;  4M9Z A;  4GCV A;  3T0Y A;  2GA2 A;  2UZK A;  3CO7 C;  3GX4 X;  2ZFW A;  3LST A;  1BN5 A;  1STZ A;  3E97 A;  5KK1 A;  2ESN A;  3ELK A;  4L0Z B;  4MEX F;  2ZNZ A;  3KFW X;  4OU0 A;  2YX7 A;  1EH8 A;  3SXY A;  3F8C A;  3IKV A;  1KA8 A;  1XMK A;  4I98 B;  1L3L A;  2AXL A;  3DV8 A;  1JHF A;  4A0Y A;  2DW4 A;  2A3S A;  2E7X A;  5CYV A;  1CGP A;  1U2W A;  3F8F A;  1T6S A;  3N97 A;  2UXN A;  3BDD A;  2FF4 A;  2FE3 A;  1B9M A;  2DTR A;  4ZYE A;  1G3T A;  5LLQ A;  2IRF G;  3OV8 A;  3WGG A;  3S2W A;  4CDG A;  1QGP A;  4WK8 F;  1WQ2 A;  2HGC A;  3LFK A;  2LNB A;  2FOK A;  1ZLK A;  4RAZ A;  2V9V A;  3AAF A;  3K9T A;  4HF0 A;  3CUO A;  2PG4 A;  2HR3 A;  4I0B A;  3RKW A;  5LEJ A;  4A0Z A;  2O03 A;  3L2C A;  2D45 A;  1JE8 A;  1KU2 A;  2OZU A;  1P2F A; 
#chains in the Genus database with same CATH topology
 1HQC A;  4YFX F;  4A3C J;  2ELH A;  1WJE A;  3H36 A;  1HF0 A;  3OYC A;  2ZC2 A;  2DI3 A;  2HOE A;  1TWF J;  2HTJ A;  1V5F A;  2CW8 A;  2CS3 A;  5DUI A;  5E3M A;  2R7Z J;  1Y8R B;  3WTS C;  3RPU A;  4F92 B;  2VBY A;  3S17 J;  2E2I J;  1MJ9 A;  1J9I A;  1Z91 A;  1RI7 A;  2UUZ A;  5FGM A;  5B1A H;  1HST A;  2M87 A;  4QPQ A;  3S93 A;  4ZYD A;  1ZKG A;  2DA1 A;  1LVA A;  2A6H F;  2D2W A;  3ERE D;  1HW2 A;  4XBF A;  4HBL A;  4N9I A;  4OOI A;  5J1R A;  2XAJ A;  2OC6 A;  2LR8 A;  2XKP A;  3G4S I;  1X19 A;  2M3A A;  2ZJP F;  4OAZ A;  3I4M J;  2FA5 A;  2M45 A;  2XAF A;  3HRM A;  4PDK A;  3V7C A;  4OIR F;  2ZXH A;  4LLG F;  2EFQ A;  5ILU A;  4G7O F;  1FYK A;  1BR4 A;  2ZME C;  2P7C B;  2XAU A;  4UB8 C;  3GTK J;  1QZY A;  5DCM B;  1WVR A;  2Z3Y A;  2LSO A;  3BR0 A;  4GFB A;  4BHC A;  4XOP A;  1S3J A;  3BR2 A;  2RAE A;  3OIO A;  2DMT A;  4I6Z A;  4BKX A;  4HG2 A;  3GTG J;  1TL8 A;  2H6C A;  5LD2 C;  5E1W A;  3KEQ A;  1HW1 A;  2Y0S N;  4UUS A;  1IW7 F;  3L2W A;  3QYF A;  3JTH A;  3EUH A;  1W36 C;  2EIK H;  4O5V A;  4I7H A;  1FSE A;  3J80 Z;  4IRG A;  1GVD A;  1U5T A;  3WTV C;  3I0T A;  3KZZ A;  2X51 A;  3CMM A;  3ZOB A;  1I3A A;  2OPT A;  3C2B A;  3R0J A;  5D4R A;  1DGR M;  4UHT A;  4UV8 A;  1T08 B;  4BY7 J;  1ETK A;  2CV0 A;  1R1T A;  3OR1 C;  4RBO A;  1VQO I;  1OCO H;  4MQV A;  3S3M A;  4PJN A;  1G3W A;  2HI3 A;  4BQA A;  3K7A J;  1QBJ A;  3IH3 A;  5FLM J;  2K02 A;  4KIF A;  3DTE A;  2GXA A;  3L2U A;  5FLV A;  3WU0 A;  3W2W A;  1UG2 A;  2BY3 A;  2M9H A;  2WC2 A;  1X1B A;  5AIQ A;  1JKP C;  3QPT A;  2DFF A;  4LB6 B;  4N9H A;  3DFG A;  2K9N A;  2XKO A;  3BWG A;  1QA6 A;  3AFH A;  5D8L B;  4EJO A;  2M5W A;  4DYQ A;  3K2Z A;  5EG0 B;  1Z9C A;  2QQB A;  1SFX A;  1D8K A;  1ETO A;  1VQL I;  2Z2S B;  3C1D A;  2EQR A;  3WU1 B;  2YX4 A;  3OYD A;  3HOT A;  2R3S A;  3M3Y J;  5FKO A;  3JTG A;  2JK3 A;  1O3S A;  3I71 A;  1S9H A;  2GOX B;  3PJR A;  2G9W A;  4KIG A;  4MO7 A;  2ADU A;  4BAC A;  5FRM A;  1PJR A;  3M1C A;  4XLN F;  1A31 A;  1FSH A;  1FIA A;  1YO5 C;  3MN2 A;  3P9K A;  4CO8 A;  1JHH A;  3M8E A;  3ONQ A;  4II2 A;  2PEX A;  2M8E A;  1V3F A;  2OD5 A;  3BG9 A;  3SFZ A;  4X6A J;  1R9T J;  3CCJ I;  2VXZ A;  5IP9 J;  1SMY F;  1O3Q A;  4ZH4 F;  2DU9 A;  2HKO A;  1A04 A;  1FP2 A;  2G7U A;  2GZW A;  2HQA A;  1HKT A;  4PUS A;  5FKM A;  2LY1 A;  4M3B A;  2NXN B;  4XOT A;  2CG4 A;  2WTE A;  5EEA A;  3NWT A;  2PX9 A;  5FKL A;  4G7H F;  5HS9 A;  1RUN A;  4FAS D;  4H4K C;  2VI6 A;  1R5G A;  5EEH A;  2P6S A;  3NAU A;  1LPQ A;  1XGM A;  3QPS A;  1R6R A;  2V4J C;  1NK3 P;  3GTL J;  3QU3 A;  4MTD A;  1ON2 A;  3GYH X;  2W25 A;  1X1P A;  4B8X A;  3C7J A;  1HC8 A;  3OYI A;  1YRN B;  5JHU A;  4Q48 A;  3PIP F;  4RGS A;  1BI1 A;  3HOU J;  3EYY A;  1X4O A;  4L5E A;  3HOY J;  3J7Y J;  3MZ8 A;  4IHY A;  4E70 A;  4EGY A;  3OYH A;  3CO6 C;  1ONV A;  3IWF A;  3SZT A;  1Z1D A;  4A3B J;  2O8X A;  1RR8 C;  2B63 J;  1BIA A;  2JJ7 A;  5FFZ A;  1ORK A;  3CDI A;  1WI9 A;  1VQ8 I;  5CVJ A;  4HX8 A;  3HRU A;  4UVA A;  2OTJ I;  4ZDO A;  2M4G A;  3ABU A;  2YU9 J;  3KP2 A;  3O6B B;  2X48 A;  4UUS B;  1IV6 A;  5DD8 A;  3KP4 A;  4PJ0 C;  3NWS A;  5F27 A;  3VDX A;  2O5R A;  3CJQ B;  4D5C A;  4B47 A;  3GFJ A;  3HSR A;  2QWW A;  2ICW G;  4OIP F;  1BR2 A;  2HKX A;  3TW6 A;  5BPI A;  1LE8 B;  2O9L A;  1YI2 I;  4LMY A;  5IYC J;  2PJR A;  2NOJ B;  2JVG A;  3D5R C;  2STW A;  4DZJ A;  2Z99 A;  4GGG A;  2F5V A;  2R7V A;  2GBY A;  4X0G A;  2EZH A;  2HPI A;  3BTC A;  4YEL A;  4F52 A;  2HVQ A;  2NS8 A;  3E1S A;  2OCE A;  3M9A A;  1Z3Y A;  3RDI A;  3HOX J;  4I01 A;  3NEU A;  2MG4 A;  4G7Z F;  3LL7 A;  2X0L A;  3IL2 A;  4NNJ A;  2QZ8 A;  5J4V A;  4LK1 F;  2DJN A;  1S8N A;  2BXZ A;  5CQG A;  3S1N J;  2O6G E;  3MZY A;  3JAM K;  2A69 F;  3DKX A;  2R7X A;  1BW5 A;  3KEO A;  4Y17 A;  4Q47 A;  2VQC A;  3BZC A;  2XRL A;  5DV5 A;  2H1K A;  3E5U A;  1T0F A;  1N77 A;  4KT5 C;  2Q8K A;  1BL0 A;  2DDB A;  5CJ9 A;  1VZ0 A;  2L7Z A;  1YJN I;  2HQ5 A;  4LLN A;  2MAB A;  3QP5 A;  2I5U A;  5DTD A;  5LFA A;  3GZ6 A;  2L54 A;  4HSR A;  4HLY A;  1MW7 A;  3C18 A;  3PO2 J;  4XQF A;  1PUE E;  5GAH J;  5JVT A;  5GTI C;  2L9R A;  2VN2 A;  5E1Z B;  2TDX A;  3LSI A;  3FKJ A;  5FB2 A;  1BC8 C;  2HZD A;  2DA3 A;  3L9F A;  2V9K A;  5LGU A;  3UR3 C;  1JT0 A;  4U88 A;  2ME0 A;  3L09 A;  4NQW A;  3AL0 C;  5IYB J;  2HQR A;  3A01 B;  4A3J J;  2AS5 F;  1Y56 A;  4DJA A;  4EV0 A;  4BXU A;  2EA2 A;  1XS9 A;  2LMD A;  3M4O J;  4EAT A;  3JW4 A;  5B5E C;  3NQO A;  4HST A;  4U7B A;  4XID A;  3VPR A;  1VF9 A;  4BDZ A;  2P8T A;  3LWF A;  1RR7 A;  2OQG A;  3E7L A;  3ECH A;  4L5I A;  2YSR A;  3DKW A;  2QKM B;  2CYY A;  3BG3 A;  3DBL B;  2QM3 A;  2IA0 A;  1PDN C;  2BVM A;  4LK0 F;  3MZH A;  2OTL I;  3QP6 A;  4R8H A;  2NNY A;  4ZZL A;  3FXK A;  3G1L A;  3SDB A;  5EGO B;  5D6F A;  4BL0 B;  1OYY A;  3I59 A;  4J01 A;  2CW0 F;  3FXO A;  5GAD J;  2X1E A;  3WOD F;  3DPU A;  2MA3 A;  4Y15 A;  4NC7 A;  1HA8 A;  3CJT B;  4HPQ A;  1RKW A;  4J19 A;  1FEX A;  4G94 A;  1BI2 A;  2EFW A;  1B8I A;  1T56 A;  4RLF A;  2K7L A;  5AIP A;  3ZQQ A;  2IS1 A;  4RDU A;  2IBD A;  3NRV A;  2NNN A;  2OU2 A;  1W5S A;  1V55 H;  2CFX A;  1IF1 A;  4E7S A;  1MSE C;  1JJ8 C;  1QVT A;  2OF7 A;  3V8K A;  5FLX K;  2K9Q A;  2QBY A;  4G12 A;  1T98 A;  2ZKZ A;  4I99 C;  1K61 A;  3GTQ J;  3MKZ A;  3WE3 A;  3CUQ C;  3LA3 A;  4D1Q A;  1SC7 A;  1DP7 P;  4CZZ A;  2E71 A;  1W36 D;  2ESH A;  2G0E A;  2P6T A;  1XG1 A;  3FXU A;  4IF4 A;  1N78 A;  1MMS A;  3SEQ A;  2V9P A;  2LY9 A;  3BOQ A;  1IO2 A;  2FQ3 A;  4A3E J;  2KMU A;  3SZG A;  2RQP A;  4ENN A;  2KP6 A;  3GVA A;  3FZV A;  3K4L A;  2CV2 A;  4LGW A;  1R1U A;  1OCT C;  1FWZ A;  2QVO A;  1VND A;  1U0J A;  3HHH A;  5TRD A;  5C4J J;  4XKC A;  1H89 C;  3TDZ C;  1F4K A;  5C4X J;  2FSW A;  2ZME A;  3HG9 A;  3DLL F;  3F8N A;  3HJE A;  5F0C A;  2JPB A;  4A6D A;  1VFC A;  1I1S A;  2MBF A;  4WXD A;  3HPG A;  1XMX A;  4LOC A;  1OYI A;  3IAS 2;  3U1D A;  4BE1 A;  1TZL A;  2IA2 A;  1LEA A;  2EPF A;  4RB2 C;  3IRQ A;  1XGN A;  1Z05 A;  2G7H A;  3WGH A;  2XAQ A;  4HZF A;  2QQ9 A;  3SEZ A;  1ZG1 A;  3I4P A;  2DPD A;  3ASN H;  5FD6 A;  3BQZ A;  2K5C A;  2H6B A;  1JT6 A;  2L4A A;  4KIT B;  3HRT A;  4PFP A;  4HEA 2;  1ZGW A;  3H3Z A;  2NS7 A;  2Q0O A;  5LRS A;  4NQW B;  4Y13 A;  1IC8 A;  5D5W B;  2XRN A;  2IEK A;  2JQ7 A;  1JJ6 C;  1D1B A;  1ZHF A;  2PN6 A;  3VFZ A;  4M3D A;  4ZYG A;  4XL9 A;  4E7K A;  1CF7 A;  2LLK A;  3D5S C;  4BJ5 C;  1R1V A;  4BJT A;  1TW3 A;  3JRD A;  1OCZ H;  3DU6 A;  5EYR A;  1G8X A;  3D1N I;  2DAO A;  1TC3 C;  5ED4 A;  3LA2 A;  1ITY A;  1P4X A;  2IP2 A;  2RNJ A;  4KT6 A;  2PMU A;  5D5X B;  2VB6 A;  4S0H B;  4IVN A;  1EKE A;  3H5R A;  4UB6 C;  2M1B A;  1JI8 A;  1UFM A;  1X4P A;  3ZGK A;  3CDH A;  2VT2 A;  4NBQ A;  3CP8 A;  5IOY A;  3T1B A;  1MMG A;  4FE4 A;  1Y6I A;  4E6K G;  1YTY A;  2UWM A;  2V79 A;  1Z0X A;  3LSJ A;  4UY8 I;  3I55 I;  1SD6 A;  2W1O A;  1ZG5 A;  1OR7 C;  2YU3 A;  1EV7 A;  2EH3 A;  3BLY A;  4IKF A;  4PCQ A;  1U8B A;  1I39 A;  2H1L A;  5IT3 A;  3DEW A;  5C44 J;  4ENM A;  3GLX A;  4XSZ F;  4LLL A;  2K4B A;  2DA7 A;  2VQG A;  2ZJR F;  3H9G A;  5IYD J;  3DPT A;  2MH2 A;  1K79 A;  5F1R A;  3HKZ N;  3ZQH A;  1YG2 A;  2CWE A;  2IPQ X;  2A6E F;  5HLT A;  2B9S A;  1K6Y A;  2HTS A;  2TCT A;  2ECC A;  2L9S A;  4RB3 C;  1OFC X;  3DBR B;  2EIJ H;  3ZRG A;  1HOM A;  3K1P A;  3KEY A;  2VJI A;  4QIW N;  2B7E A;  5HDG A;  2EZI A;  3DLA A;  3KZI C;  3HUG B;  5HOD A;  5HNH A;  5IT9 Z;  4Q5S F;  2MSY A;  2J5P A;  4CHU A;  1BR1 A;  4HNU A;  3E5Q A;  1W7P B;  3KPH A;  3OS0 A;  3IC7 A;  2CMP A;  4GRI A;  1RUO A;  3KP5 A;  3HHG A;  1K6O A;  4IOA F;  2I10 A;  1USS A;  2VIX A;  2P4W A;  3IHU A;  4Y7N J;  3H1C A;  3ESW B;  2IW5 A;  2LF8 A;  2DA2 A;  5KVR A;  3QRF F;  1JKR C;  1FTZ A;  1UZC A;  1FBQ A;  3IAM 2;  1WRJ A;  5L3C A;  2CU7 A;  4N4N B;  4GO1 A;  3X2Q H;  3H9Q A;  3RQI A;  3BR6 A;  3DTI A;  2OCC H;  1VQ4 I;  3T8R A;  3O8G A;  3HDD A;  4AYB N;  3DU5 A;  3BZK A;  3CCR I;  3IH4 A;  2EFN A;  1Y1V J;  3CCQ I;  1IXC A;  1NH3 A;  2QSG X;  3AG3 H;  1BIB A;  4CA0 A;  4ABZ A;  4RA2 A;  2E60 A;  1MMA A;  1P4A A;  1M1E B;  1FY7 A;  1KQ9 A;  2JA7 J;  5HNF A;  3L2R A;  3HEF A;  2D1H A;  5E3L A;  1AA7 A;  1WKM A;  1J0R A;  3LSM A;  3E0J B;  2WWY A;  2UXX A;  1XB4 A;  2IGN A;  2KIU A;  5JFR A;  4CGZ A;  1HKQ A;  3CES A;  4EJT A;  2WAE A;  3EPZ A;  4KFC A;  2IS4 A;  3PO3 J;  4KA4 A;  1EA3 A;  4PSW A;  3TGN A;  4KN4 X;  1ZTR A;  3TO7 A;  5M5Y J;  2GM4 A;  4HA8 A;  2IAI A;  4CCM A;  5KNL A;  3JSP A;  1HKS A;  2V7F A;  2YPR A;  4BJ6 C;  1LFU P;  2DA6 A;  1WJB A;  3GWZ A;  5J1Y A;  5FD5 A;  4IXA A;  3DCF A;  3K2A A;  5JHF A;  3L00 A;  2KZV A;  1SVM A;  3A1Y A;  3J80 K;  3T5X A;  1GXP A;  2AXT C;  1R22 A;  3ZMD A;  2YR2 A;  2KIF A;  3IH2 A;  3PNT A;  5EDN A;  2MC3 A;  3OYG A;  1KU9 A;  4F55 A;  3HZJ A;  4DQ2 A;  4BQO A;  3RZD J;  1Z6R A;  1F5T A;  4DYR A;  4CCK A;  3MAJ A;  3K1M A;  2W82 A;  4P96 A;  4HRI A;  4C3H J;  4CSW A;  5CKT A;  3H9J A;  4RGR A;  4WX9 A;  4NUB A;  1AOY A;  2XVC A;  4U0W A;  1T39 A;  2DMQ A;  3P5J A;  2VKV A;  4FHT A;  3HSF A;  2J5O A;  1TT0 A;  3WG7 H;  2E7W A;  2VKD A;  5J6X A;  1UCR A;  1IV8 A;  2GWR A;  4ZYA A;  4JYK A;  3PIO F;  3ISP A;  3BJO A;  4M72 A;  1Z7U A;  4I02 A;  5AON A;  3EYI A;  2Y31 A;  4LG0 A;  1V4R A;  1R71 A;  5BMZ A;  1Z3X A;  3P7N A;  1J2X A;  3JRG A;  3E6C C;  4NHJ A;  4KJZ A;  5D8K B;  1W4M A;  2HFH A;  2O8K A;  5J1U A;  2DOE A;  1LQ1 A;  4CCJ A;  4HNV A;  2BVL A;  3PQJ A;  2LRE A;  4XM3 A;  2K3P A;  5FJ8 J;  1LEB A;  3I56 I;  3Q9S A;  2JA5 J;  1D0Z A;  3FX3 A;  2QSH X;  3KCC A;  1LKX A;  1U6G A;  4IHT A;  1WJA A;  5M5X J;  2JSC A;  1YYV A;  1JXS A;  3SHF A;  2VOP A;  1N25 A;  2K85 A;  2LBF B;  5J3L A;  1H9T A;  3RKX A;  3GBG A;  1FPQ A;  3BTI A;  3FIS A;  1BBY A;  4XLP F;  3OYL A;  3M07 A;  2HEO A;  2WAQ N;  2VBW A;  4PSX A;  5DM7 F;  1JKQ C;  1AHD P;  2FNP A;  2XF6 A;  2XB5 A;  1S7A A;  1E17 A;  3QOE A;  1MBK A;  4N4O B;  3TMO A;  1VQ7 I;  2MW8 A;  5F6F A;  2STT A;  3OIP A;  2XGX A;  2ZXI A;  4M9X A;  2ELJ A;  3JRF A;  1DU0 A;  3ABM H;  4RS8 A;  2L2O A;  1GHC A;  4FT8 A;  2BYV E;  4M3F A;  1RIO H;  4BEH A;  3CLO A;  1UJ8 A;  5GPA A;  1X1C A;  2QYO A;  3OS2 A;  1AKH A;  5K5R A;  4DNC A;  2FX0 A;  5E8G A;  4YIR X;  4H0E A;  1CQT A;  2XPW A;  2ZFU A;  2R4G A;  2VC1 A;  3LSR A;  3N05 A;  3ZPL A;  2DT6 A;  2BHZ A;  4OIN F;  1UB9 A;  3F6O A;  4CCO A;  4IEJ A;  3CUQ A;  4XNF A;  2F4I A;  1V54 H;  3O8H A;  4IL6 C;  2HYJ A;  2VOO A;  1I1G A;  2D5V A;  1VQ9 I;  3BRO A;  2LDU A;  2ECB A;  4EVI A;  3JCU C;  2HVR A;  1IAW A;  1RKT A;  1Z21 A;  5E1X A;  2BBY A;  2K86 A;  3K0L A;  2IS2 A;  2XAG A;  2JPC A;  4A69 C;  2OV7 A;  3TQN A;  3ZQG A;  2L5Q A;  2K3F A;  1K78 A;  3EQL F;  4IHV A;  5IOZ A;  4A3G J;  1D1A A;  3M8J A;  3F8B A;  4XKW A;  1S7O A;  3MQ0 A;  1YJW I;  2I8D A;  4NDL A;  1BW6 A;  4FIS A;  2XF5 A;  1REP C;  1FOY A;  1VQ5 I;  5LHG A;  1TLH B;  5M3M J;  3RCO A;  2H09 A;  4PJJ A;  2RV8 A;  3H0G J;  2R7O A;  2V1U A;  2A68 F;  1UAA A;  1FP1 D;  2Z1D A;  4DBR A;  2JZY A;  2LC2 A;  2QLZ A;  4KIC A;  2MYS A;  4DGW B;  2XPV A;  2L7K A;  3B6C A;  1E3P A;  3Q0U A;  3CMA I;  2ETH A;  4LG0 B;  1IG7 A;  2E35 A;  2KLO A;  4C9Y A;  2EFO A;  1LUJ B;  2KHM A;  1JUM A;  1D1C A;  1SAN A;  2LKX A;  4A0X A;  2HZT A;  1X2M A;  4B09 A;  3SJM A;  2CQQ A;  4QPO A;  2GXB A;  1MBG A;  2HOT A;  2DOF A;  2W84 A;  1K4S A;  5D5V B;  3EET A;  4IQJ A;  5F08 A;  3M1E A;  4E7H A;  2NAZ A;  3GUD A;  2DTZ A;  2AQF A;  1QQI A;  2WAQ A;  4BGD A;  5EF6 A;  4LG3 A;  4MHG A;  3Q5F A;  4HNT A;  3QU6 A;  1QHH D;  2E1N A;  4M71 A;  4B43 A;  4LD5 A;  3S15 J;  1O3R A;  1ZRE A;  2FUG 2;  2W7N A;  2OZ6 A;  1XMA A;  1P7J A;  1ON1 A;  4RAY A;  3G1M A;  2E2H J;  1QHG A;  3F72 A;  1FMW A;  1ZK8 A;  1ACI A;  2XV4 S;  1OR7 A;  2Y0S A;  4P55 A;  2FJ1 A;  1PP7 U;  1MGT A;  1R49 A;  4B44 A;  4DOZ A;  2HYG D;  2IVM A;  5CVI A;  3SYT A;  1V5G A;  1NG6 A;  3CMY A;  5FRN A;  3LMM A;  2CFO A;  1ODD A;  1TNT A;  5JR3 A;  5K1Y A;  3FBN B;  5CVU A;  1GT0 C;  2L7M P;  1AKH B;  1J75 A;  1T38 A;  2M34 A;  1U5T B;  2KJB A;  2VLA A;  2VL8 A;  3FXQ A;  4A2U A;  4N0B A;  2R7D A;  4BH9 A;  4OAY A;  2LFB A;  3V7S A;  1OYW A;  1YW9 A;  3BG7 A;  4KIS A;  2OA4 A;  1X1D A;  2JN6 A;  1MBF A;  1OMI A;  1WJD A;  2FBI A;  2QUF A;  4IJA A;  5DUK A;  1U78 A;  2BZT A;  3HM5 A;  3LFU A;  1XSX A;  4L0Y B;  4XLA A;  3GTO J;  1ETV A;  1PVE A;  1A6Q A;  2YUS A;  2EA4 A;  1QVU A;  1B9N A;  2RKH A;  1ZGA A;  4TV7 A;  2X1C A;  3DTK A;  4IRI A;  3K70 D;  5H6Q A;  4D0P A;  5LGT A;  1MND A;  3R4K A;  2NRA C;  2VOD A;  4HX7 A;  1KQ0 A;  1QPI A;  3QYB A;  1J7K A;  4EM1 A;  5DCF A;  4F7Z A;  4FCY A;  2R92 J;  1UEL B;  4XLC A;  3TO6 A;  3W6K B;  1VQ6 I;  1X1A A;  4RLQ A;  3VEP A;  3IWZ A;  3S14 J;  5FKN A;  3C2G A;  4AU7 A;  3A02 A;  4BBR J;  5K7Z A;  3IV5 A;  4FX0 A;  2BW3 A;  4BXF A;  2HOS A;  4RAF A;  1Y39 A;  3HC7 A;  2X6Y A;  2VJJ A;  4CYC A;  1PUF A;  1MH4 A;  3FXL A;  5HLH A;  3GTP J;  2WY7 Q;  1IUY A;  3J81 Z;  2XPU A;  1K83 J;  2DFH A;  3BTL A;  2VE9 A;  2FRH A;  1FBS A;  2KDZ A;  1IDY A;  4A3M J;  2V1N A;  1JTY A;  3HOV J;  4ITV A;  2CW7 A;  3GLL A;  4X1E A;  1TT5 B;  1R4N B;  2DK5 A;  1HXD A;  3I4N J;  4P1W A;  2IS6 A;  5C3E J;  3L1P A;  2EIL H;  1B1B A;  4D5F A;  3OSF A;  3OYN A;  4QSH A;  4Y4R A;  4YG2 F;  3CME I;  5LRR A;  2ME6 A;  2Q2E A;  2RNG A;  2NVX J;  1DUX C;  1P6R A;  2BY2 A;  1SFU A;  1ZR4 A;  4BQN A;  3G71 I;  2GA1 A;  2VAS A;  3AG1 H;  3GW2 A;  4A12 A;  2IXS A;  3IP4 B;  1DP3 A;  4HF2 A;  1YQA A;  2E1O A;  2E5Z A;  2GIZ A;  2EV0 A;  3REO A;  1ERD A;  2A61 A;  2ISY A;  2MD5 A;  1DPR A;  1MKM A;  1TNS A;  4XR6 A;  3QAH A;  4CZC A;  2Y48 A;  3KP7 A;  3FXR A;  1ZRF A;  3RYR A;  2KRC A;  3DF8 A;  1UG0 A;  2DPU A;  5EZG A;  2HS5 A;  2DXI A;  1Z77 A;  2Y75 A;  1Q1H A;  3S3N A;  4CYD A;  5K7F A;  1C0W A;  2H94 A;  3MFK A;  4XN3 A;  4AIJ A;  2E1M B;  2XAH A;  3HOW J;  2DMU A;  4J00 A;  3M8F A;  4V2G A;  1E3H A;  1WJC A;  2EV5 A;  2NVU B;  1ENH A;  3Q9V A;  4BE2 A;  1BI3 A;  1S5L C;  3FF5 A;  2JWT A;  1TW2 A;  3S1M J;  3COA C;  1NTC A;  4II3 A;  3HXL A;  1BOB A;  5FFX A;  3HTS B;  2P81 A;  1SVO A;  1NHA A;  2R5Z A;  1W7P D;  4OWR B;  2BGC A;  1XDU A;  3PFI A;  2W85 A;  3PNY A;  2PJR B;  2GIV A;  2CV1 A;  3TP3 A;  3GXO A;  2GAU A;  3FWE A;  2V1X A;  2WB1 N;  3HIF A;  2Q1Z B;  2MFZ A;  1JKO C;  5HVQ C;  1VQP I;  1QZE A;  4KNY A;  5HS7 A;  1UMQ A;  1WCM J;  5JLW A;  2AQE A;  3E3V A;  3BPV A;  1T8I A;  1XTA A;  4WF2 A;  5B3S H;  1KON A;  2CSO A;  5ILV A;  1KQ8 A;  3S16 J;  1KGS A;  2HNH A;  3F6V A;  2DA5 A;  4C2U A;  4ZC3 A;  4M6Y A;  2P5V A;  2W00 A;  5H20 A;  4Y33 A;  2ZJQ F;  1P7I A;  2X6O A;  3JRA A;  4RM2 A;  1IN8 A;  2DN0 A;  1YX5 A;  5EEG A;  4BHB A;  3DKY A;  3K4J A;  4KN7 X;  1E0E A;  4XIC A;  2XC7 A;  1Z67 A;  4U7D A;  1ETY A;  3MKY B;  1A6I A;  4M3G A;  2VBX A;  3O2P E;  3PUB A;  4M3E A;  4BAY A;  4PJM A;  1VQK I;  4UVC A;  2JVH A;  2F5C A;  4EQQ A;  5E18 F;  3OS1 A;  3F3X A;  1IRG A;  1KYZ A;  5K5Q A;  3T8T A;  4B4C A;  2DT5 A;  4G9Y A;  5IT9 K;  4V2F A;  2EWN A;  2LTP A;  4OIO F;  4C3J J;  3HOS A;  1A35 A;  2DDA A;  3KIO A;  1HLV A;  4HYE A;  5DD4 A;  4E4H A;  4LIV A;  2ZB9 A;  4B3X A;  5K7H A;  3LNQ A;  3JSO A;  3ZP5 A;  2O7O A;  1FBU A;  3RKQ A;  5CLS A;  3FHN A;  4JK1 X;  1SD7 A;  2DO7 A;  2XRO A;  1G59 A;  1FMV A;  2PMH A;  1I6X A;  4BYY A;  3CQZ J;  2LF7 A;  1SVL A;  3FM5 A;  4R79 A;  2F5F A;  1AWC A;  2K27 A;  3HGG A;  2EIM H;  3CP2 A;  3LA7 A;  1TP4 A;  3ZN1 A;  2FML A;  3NAR A;  2TRT A;  3RI4 A;  1R36 A;  5E79 C;  2LYC A;  1BJA A;  2COM A;  1I3Q J;  2OBP A;  5F0H A;  1H9G A;  1WI3 A;  1Z6T A;  2XGE A;  3K4M A;  3J7Z I;  2GLO A;  2HWV A;  3R6S A;  3UNG C;  2R93 J;  1FC3 A;  1YW7 A;  5BNG A;  4CUG A;  1WHU A;  1Z7L A;  3WTX C;  4BQQ A;  3MKW B;  3DQV C;  1FX7 A;  2V26 A;  2QCO A;  4RAG A;  3I59 B;  3DEE A;  4FQG A;  3KE2 A;  4MFE A;  4U87 A;  5E17 F;  2H27 A;  5CVR A;  3W6J B;  4BDY A;  3GTM J;  5LHI A;  1B8I B;  2LKS A;  2LY2 A;  1MBE A;  5F1J A;  1D5V A;  3I3L A;  2MC4 A;  2CJJ A;  2WV1 A;  1IUF A;  2KIM A;  2DYR H;  2CUZ A;  3VSL A;  1YOV B;  2XIG A;  1XPX A;  4L9J A;  1POG A;  2IGM A;  1ZYR F;  4MTE A;  3W6V A;  4YIF A;  3HB9 A;  4XON A;  4A3D J;  5F0F A;  2FBK A;  1JGG A;  2L02 A;  5A2Q Z;  2QBY B;  4ZTF A;  2KPM A;  1O7F A;  1W5T A;  1FOX A;  2WB1 A;  2XF7 A;  2E1M C;  1I6H J;  5GTH C;  3MWM A;  4PZJ A;  4R1H A;  1IN5 A;  5J40 A;  4HDV A;  3MD2 A;  3S32 A;  4LIU A;  3SDG A;  3ZQI A;  2LG4 A;  1F43 A;  1Y0N A;  1TQM A;  2CQ7 A;  4MIM A;  1RPW A;  1ZN2 A;  2P5L C;  1O3T A;  2HQN A;  1BC7 C;  2VON A;  2M7A A;  3L2Q A;  1K7A A;  3WTU C;  2L3D A;  1U9O A;  3FHZ A;  3W2A A;  3FM3 A;  4XKB A;  2QQA A;  4YFK F;  5E3N A;  4EM2 A;  5KAF C;  5TIS C;  2JSP A;  1B59 A;  3HBL A;  4D7M A;  3J7A Y;  2P5K A;  1R58 A;  3KLN A;  4HV6 A;  4GYI A;  4GXO A;  2ZME B;  3GEZ A;  4A6E A;  4P5O A;  1QPM A;  5IPA A;  2N8G A;  4YFN F;  5LBQ A;  2Z16 A;  4WXC A;  2OUM A;  5HDK A;  2VXD A;  2V6C A;  2L7F P;  1Y8Q B;  1YS7 A;  2X6X A;  2Y0M A;  4LJZ F;  2KFD A;  3LQR A;  4M6X A;  1OCR H;  2KT0 A;  3ZCO A;  3U9G A;  5ICC A;  1BJZ A;  1A5J A;  2QKL B;  1IN6 A;  3A2K A;  2VKH A;  2XAS A;  2CRG A;  1YIT I;  3FK6 A;  1ZGJ A;  3H35 A;  4RMN A;  3CC2 I;  1D3Y A;  2MH9 A;  3R0A A;  3G3Z A;  2PMZ N;  4ZJZ A;  3VWB A;  1X2N A;  4AVP A;  2A5W A;  3CCL I;  1HW5 A;  5EJC A;  4AIH A;  3CCS I;  3FXJ A;  3KP6 A;  1O7L A;  4O6J A;  5DCM A;  5D6E A;  1PP8 F;  1T0F C;  2C6Y A;  3K70 C;  1IGN A;  3BR1 A;  2XSJ C;  4WWC A;  4P9U A;  5BPD A;  3WU2 C;  2A6T A;  3JRE A;  2NOG A;  2F5E A;  3EUA A;  4IOC F;  1FYM A;  3OYF A;  5DYM A;  3F8M A;  2EZL A;  1D5Y A;  4MGR A;  1CF7 B;  1XN7 A;  3FMR A;  2LP0 A;  1TQI A;  3VOD A;  1WH5 A;  2COB A;  2O0Y A;  2Y9Z A;  4KMU X;  4ZDL A;  4L18 B;  4AVZ A;  3CTA A;  2XSD C;  4D9J A;  1MJA A;  3ML6 A;  1SD4 A;  4JBA A;  4E7J A;  2FMY A;  3LAJ A;  1X3W B;  2JTV A;  4A3F J;  1HDD C;  3CCU I;  2DBB A;  4LFU A;  1BI0 A;  3I64 A;  1R7J A;  2E34 A;  2BHY A;  1XX5 A;  2CUF A;  1MMN A;  2E5N A;  4IO9 F;  4ESB A;  5ILS A;  3OYM A;  1Q1V A;  2ZXJ A;  5BQT A;  2LD5 A;  2JA6 J;  1OQY A;  3RPU D;  2X9D A;  2FQ4 A;  3IUO A;  5ICF A;  3GZ5 A;  5E8I A;  2QQ8 A;  1LJ9 A;  1YS6 A;  5F64 A;  3HKZ A;  5EG0 A;  4U0Y A;  1GLN A;  1SEU A;  1XGO A;  3TP0 A;  2BY1 A;  5HOO A;  2JA8 J;  3OR2 C;  2VBZ A;  1RES A;  2JT1 A;  4MNU A;  2R0Q C;  4E7L A;  2HYF A;  1ETQ A;  3TO9 A;  1EF4 A;  2KIQ A;  1SFE A;  1G3Y A;  4XKV A;  4Y52 J;  3CC4 I;  4CH7 A;  3W3C A;  1IRF A;  3BT9 A;  4UV9 A;  1I27 A;  2ISZ A;  3MEX A;  4C2M J;  3ZQC A;  3DWL E;  1DDN A;  2PLY A;  5L3E A;  3BZ6 A;  3ECO A;  3P9C A;  1YW8 A;  9ANT A;  4Y3O A;  3P9I A;  1APL C;  1J59 A;  3F21 A;  1V5E A;  3WHB A;  1ZAO A;  3L7W A;  2XHK A;  2Z5U A;  5LGN A;  4ENK A;  3OSG A;  4KDP A;  1SAU A;  1TBX A;  4BUP A;  1ZAR A;  5K5O A;  1TTY A;  3I58 A;  1LDD A;  3S1R J;  2Y9Y A;  1NK2 P;  2FOW A;  3K6G A;  4ON0 A;  3D5L A;  1T2K A;  4MFD A;  1EH7 A;  3HRS A;  3RTR A;  3FKI J;  4XRM A;  2E2J J;  1AU7 A;  1FOK A;  4XRS G;  2WBM A;  4XRF A;  2LH9 A;  3RPQ A;  3K69 A;  3ZQF A;  2EV6 A;  2KQR A;  4Z6Y A;  3ZMU A;  1WWX A;  1TWG J;  1A36 A;  4AYB A;  1U3E M;  2DLL A;  2P7V B;  3DPL C;  3LOC A;  2EBI A;  2VPR A;  3CJR B;  2PMZ A;  5DM6 F;  2JUG A;  4F3Q A;  3FIW A;  4D7N A;  1MMD A;  4A93 J;  4BU2 A;  4PGG A;  4KIB A;  1YRN A;  2XDV A;  2KDO A;  1LDJ A;  4G6T B;  1MZB A;  3OYK A;  3PUF A;  2F5D A;  5FKK A;  1Y0U A;  1X58 A;  4A5N A;  1LNW A;  2O3F A;  2R7U A;  4IZZ A;  2VJ5 A;  1OKR A;  3E5X A;  2VQH A;  1ZLJ A;  2BV6 A;  4KUM A;  3ZMT A;  3WTW C;  2MLK A;  3OL3 A;  4AIK A;  1TWH J;  4UXN A;  5L3B A;  2IT0 A;  2LK2 A;  1SD5 A;  2BXY A;  3PSI A;  3ABK H;  3I53 A;  3B02 A;  3U2R A;  4XN0 A;  4MLO A;  1MSF C;  4EJU A;  3N4M A;  1P92 A;  4KYW A;  1E3O C;  3JRH A;  4HW0 A;  6PAX A;  2B0L A;  2V1D A;  1T33 A;  3BCB A;  4HAM A;  2P0W A;  4HV5 A;  2E19 A;  4M9S A;  1NG7 A;  3OOU A;  2RC4 A;  2EK5 A;  5E3O A;  1LE8 A;  4PK4 A;  3BG5 A;  3FXM A;  4GYG A;  4B1R A;  3BPX A;  5CVV A;  3U21 A;  1BOA A;  2DA4 A;  3HSE A;  2K40 A;  4QTR A;  1HCR A;  2ID6 A;  2JRM A;  1R5I D;  2R7Q A;  2RGV A;  5HLI A;  5DEQ A;  2M30 A;  2D1V A;  3AG2 H;  3G73 A;  1JGS A;  3I9V 2;  3LQQ A;  3R60 A;  1XC5 A;  3VSK A;  4S04 A;  4ANJ A;  4C2T A;  1P9Q C;  3S2H J;  2ZBK A;  4ESF A;  5ICG A;  3LSH A;  2KJC A;  3HL2 A;  3F23 A;  4K2E A;  1FZP B;  4O3M A;  3JR9 A;  2VKE A;  2RDP A;  3H92 A;  5ERI A;  1UHM A;  1WJF A;  3G1O A;  3LSK A;  2NVT J;  3PM1 A;  1F36 A;  4OMZ A;  3C3W A;  1RRJ A;  4G8X A;  4EJV A;  3AL0 B;  2YS9 A;  2DYS H;  1HBX G;  3OIQ A;  4DW6 A;  3WTZ A;  3OOP A;  5D4S A;  4JOM A;  2R7R A;  2GXG A;  4RGX A;  1ZQ3 P;  1DU6 A;  2WAF A;  2BEO A;  5L3D A;  2HOA A;  3TED A;  4OIQ F;  3HYI A;  1WH7 A;  3J81 K;  2MD0 A;  1HDP A;  4B3A A;  4WCG A;  1OPC A;  2UV1 A;  2JA2 A;  4IX7 A;  4E7Z A;  3CDL A;  3HPH A;  3LAP A;  3K4N A;  4XLE A;  3HTU A;  3V4G A;  2LKP A;  1MH3 A;  1P4W A;  3A01 A;  1FJL A;  2W57 A;  3B73 A;  1VTN C;  1LFB A;  2K4J A;  1BA5 A;  2L9V A;  2R7W A;  4M6V A;  3Q3S A;  2FXA A;  2XGD A;  3SFI A;  5JVG F;  5J8C A;  3E6M A;  1MBH A;  1YLF A;  4XLF A;  3GFI A;  4AID A;  2A07 F;  4BBS J;  3DBH B;  4ESJ A;  4I2O A;  2BE5 F;  4ZTJ A;  2M4K A;  4L9N A;  5B66 C;  2PJP A;  3SZP A;  1ZRD A;  1ZRC A;  2MGQ A;  3S8P A;  1D0Y A;  4FET A;  4BHP A;  5E20 A;  3BCA A;  4BEH B;  4A5M A;  2V6E A;  4BNC A;  1R23 A;  1FYL A;  2RRE A;  4NB5 A;  1ZR2 A;  3ULQ B;  3FBI B;  3G6E I;  2ZCW A;  5M3F J;  5HS8 A;  2HU9 A;  3CC7 I;  4ASN A;  3PSF A;  5EGO A;  4XRS A;  1FOW A;  2GQQ A;  5CPR B;  1RET A;  3CF5 F;  1J09 A;  3CUQ B;  3KP3 A;  2ACJ A;  3I54 A;  3QOP A;  3Q0W A;  1XGS A;  2R5Y A;  4ZDP A;  2Y30 A;  3QPL A;  2L4M A;  3QOD A;  2AO9 A;  2DMP A;  2OJE D;  2DQL A;  4UUT A;  4C30 A;  2F6C A;  1OJL A;  3H0D A;  1O57 A;  4L9V A;  4U0V A;  2VC0 A;  3MVP A;  4RM3 A;  1H8A C;  1W0T A;  2Z9O A;  2O61 A;  3JRI A;  2XB0 X;  1KU3 A;  1X3Z B;  1VQN I;  1OCC H;  5GAG J;  1K78 B;  2X1D A;  1G6N A;  1EH6 A;  4LB5 A;  1R00 A;  2DOA A;  2LVS A;  4A3K J;  1FNN A;  4I0A A;  3ZMV A;  1FLI A;  1RZ4 A;  1MDM A;  3WHC A;  4UUV A;  2W24 A;  3DXJ F;  3VYU B;  5J47 A;  1ULY A;  3RSN A;  1YFH A;  1MNM C;  5BS6 A;  2BOL A;  1DQU A;  3GZN B;  2KZG A;  3GTJ J;  3F22 A;  1E2X A;  4HQE A;  3JRB A;  3RIR A;  1G4D A;  2DT7 B;  3VYT B;  3I5U A;  1XCB A;  4PJL A;  1IN7 A;  5H6R A;  3S3O A;  4L5J A;  3BQY A;  5B1B H;  3V8J A;  2ZSH B;  4B48 A;  4EEF G;  1SFO J;  4IHS A;  5ICE A;  1F1Z A;  4JQF A;  2E36 A;  4G6D A;  2HDW A;  2QSF X;  3A03 A;  4EMS A;  2DJI A;  3OYB A;  2FNA A;  4DIQ A;  3V42 A;  4BY1 J;  2PBI A;  1QNT A;  2DCE A;  4HF1 A;  2DFE A;  4UNO A;  1IXS B;  2ZO4 A;  5LHH A;  1MNE A;  3R61 A;  2NVQ J;  1G2H A;  2KIS A;  2ZSI B;  3TL4 X;  4PFO A;  2DFI A;  2QF7 A;  2HXI A;  4GDF A;  3ZN0 A;  1H0M A;  1HSJ A;  4JP0 A;  1LVK A;  4MQ9 F;  2ZJ2 A;  3OYE A;  4FX4 A;  1LB2 A;  2CGP A;  5EZH A;  2EJR A;  3K1N A;  3KYL A;  2EZK A;  3CCY A;  4EGZ A;  4MEY F;  5JLX A;  5J8F A;  2RVC A;  1VI0 A;  4CCN A;  3CD6 I;  4AC0 A;  3WGI A;  3KZY A;  4FTH A;  1IDZ A;  1K4T A;  4BS9 A;  4HQM A;  2HDC A;  2OQR A;  2WAD A;  3GCM A;  2F2E A;  2MLG A;  1JTX A;  2E1C A;  4IQ4 A;  1KYW A;  2CQK A;  3GME A;  3PL8 A;  4QWQ A;  1U8R A;  2K9M A;  3BJ6 A;  1J5Y A;  1DPU A;  3IKT A;  5HDN A;  2QA4 I;  2JUC A;  4IRH A;  3E6B A;  1LFP A;  1IJW C;  4PGH A;  1SAX A;  4M74 A;  3VOE A;  3WTY C;  1KU7 A;  1ETX A;  1XSD A;  3G2B A;  2DQR A;  5GPC A;  2IA1 A;  2RQQ A;  3QYE A;  2R5Y B;  4HOB A;  5L3G A;  5TGT A;  1G3S A;  3HOZ J;  2L01 A;  1GDT A;  3RZO J;  4JX4 A;  5KCM A;  3TBI A;  4RB0 A;  2HDD A;  2OAZ A;  4LIT A;  2NVY J;  4QLC U;  2BY0 A;  4CCL A;  3WE2 A;  3WG9 A;  3QQA A;  3EUH C;  2CQX A;  1YHQ I;  5J4Y A;  4YEJ A;  1YE9 A;  1WGX A;  1UHS A;  2QEN A;  1U5T C;  2KL4 A;  2X4H A;  3JAM Z;  1XD7 A;  1ZG3 A;  3BC8 A;  1XSV A;  4CIC A;  5L3F A;  2W48 A;  5A2Q K;  1S7E A;  4WXH A;  2XGC A;  1GXQ A;  4XOR A;  3ZR8 X;  1N75 A;  2F48 A;  3OMY A;  2PFB A;  1DGW Y;  3BY6 A;  3CJN A;  3H5A A;  5DS9 A;  2PI0 A;  5KHD A;  1GUU A;  3ZXS A;  4YII A;  4E7I A;  2BW3 B;  4JX6 A;  3CCE I;  1FTT A;  2HVS A;  2NS0 A;  1MDM B;  3KYC B;  4XK4 A;  1R5H A;  3AKZ A;  1YX3 A;  3H3U A;  3HUG A;  1S6L A;  4HX4 A;  4CYC B;  1PUF B;  5M5W J;  3BR5 A;  5CQE A;  3DP7 A;  3VYR B;  3IRR A;  3K10 A;  1GV2 A;  5F04 A;  1W7P A;  3BP8 A;  3CZ6 A;  3W2V A;  2RN7 A;  4IHW A;  3FMS A;  5H2F C;  2K9L A;  1W5C C;  2PQ8 A;  3Q0V A;  5FO5 A;  1SFK A;  2CO5 A;  3DEU A;  3ROU A;  3F9K A;  3V7R A;  4EM0 B;  3BJA A;  3ABT A;  3KYD B;  1JUS A;  3M7G A;  4P9F A;  1OIS A;  2Q2E B;  1YIJ I;  4BXX J;  3SQN A;  1EJ9 A;  1WJ5 A;  2Z33 A;  3TOA A;  2H8W A;  3OYJ A;  1BM9 A;  3A4C A;  4ENJ A;  4A3L J;  1UST A;  5LEK A;  4L9T A;  4BE0 A;  3ZMZ A;  2QEX I;  3JRC A;  2FBH A;  3OY9 A;  1IRX A;  5BOX A;  1FT9 A;  3E6D A;  1LDK B;  4Q4Z F;  4S05 A;  3O3K A;  1QZZ A;  4CXF A;  1W0U A;  2KRF A;  5HLG A;  3OYA A;  4ZZD A;  2FD5 A;  1QO0 D;  4KMF A;  1MD0 A;  1XCV A;  3ABL H;  3FK7 A;  3HGY A;  4DYC A;  1T95 A;  1B72 A;  4EJW A;  4HLX A;  4NC8 A;  2A05 A;  2AHQ A;  2H8R A;  3MCZ A;  4Z2Y A;  2X6W A;  3K4K A;  2HXO A;  4HDU A;  1L0O C;  3WTT C;  2GOM A;  1B6A A;  2HPM A;  3CF2 A;  3RJP A;  4ZYH A;  3A0H C;  2VE8 A;  1OCP A;  3KLO A;  3V8L A;  4M73 A;  4XSX F;  3FDY A;  4I09 A;  2FEZ A;  1TQP A;  5FLX Z;  2EB7 A;  3MKL A;  1GV5 A;  4G6Q A;  1FIP A;  4IPA A;  1X3U A;  1B4A A;  3ZQ7 A;  1D0X A;  3K4B A;  1D8J A;  1IN4 A;  3RYP A;  3KX2 A;  3OL4 A;  2X85 A;  2NYX A;  2JRT A;  3VB2 A;  1MJB A;  2ID3 A;  1U9N A;  3L2V A;  2R5Z B;  1YJ9 I;  1VQM I;  5D5U B;  3QPH A;  4AUX A;  3GFM A;  3PQK A;  4XLH A;  3TKY A;  2L0K A;  1RC9 A;  1YIO A;  2WV0 A;  3EDP A;  1H88 C;  1PYV A;  1WFX A;  1WSU A;  4C3I J;  3FMQ A;  5DDG A;  4AM3 A;  2M0C A;  2VUM J;  1XDS A;  3TDU C;  3RQ4 A;  3CLQ A;  3GFL A;  3C2H A;  3KET A;  1I50 J;  1S72 I;  2EFP A;  2QGU A;  3MMY B;  1IZ1 A;  2A5Y B;  4AWX B;  3ZMS A;  5JI6 A;  3H5N A;  2ZXW H;  1W1W E;  1O4X A;  5TJJ A;  1R4M B;  2CUJ A;  2DK8 A;  2IJL A;  3TOB A;  2Y69 H;  3J7A O;  3RKY A;  4XMY A;  1S29 A;  2IGK A;  5GAE J;  3BTJ A;  4W97 A;  2ZNY A;  1I5Z A;  2KKO A;  1SMT A;  1WZ2 A;  1IXR C;  2W4S A;  4ETS A;  3S2D J;  2VT3 A;  4UVB A;  2R7F A;  3GF2 A;  5FRO A;  4AD9 A;  3GO5 A;  1TWA J;  3H3V K;  1KZH A;  1F9N A;  1RNL A;  2XUB A;  1ZH5 A;  4RB1 A;  3D0S A;  4JX5 A;  3K4C A;  1GVJ A;  4OMY A;  1UHW A;  2R7T A;  4NC6 A;  3UKG A;  2LBF A;  2M0M A;  4RGU A;  2IGO A;  1MBJ A;  2FU4 A;  3CCV I;  4M9Z A;  4GCV A;  3T0Y A;  2GA2 A;  2UZK A;  3CO7 C;  4YRV A;  1MIJ A;  3GX4 X;  2ELK A;  2LOO A;  2ZFW A;  3LST A;  1BN5 A;  4I76 A;  2VJ4 A;  4F93 B;  4V19 K;  2CUE A;  3BR3 A;  1STZ A;  3ASO H;  3E97 A;  2F4O B;  5KK1 A;  2ESN A;  3ELK A;  4L0Z B;  4MEX F;  1ZEL A;  2ZNZ A;  3KFW X;  2DOD A;  2Y2Z A;  4DBQ A;  2CQN A;  4OU0 A;  5KAI C;  2YX7 A;  1EH8 A;  3SXY A;  3PNV A;  3F8C A;  3PFY A;  3IKV A;  1JUP A;  1KA8 A;  1XMK A;  2WY8 Q;  4I98 B;  2K9S A;  1L3L A;  3QWL A;  3F0C A;  2L9N A;  3EUK L;  1OLT A;  2AXL A;  3DV8 A;  2M2E A;  2M8G X;  1JHF A;  3LSG A;  1Y1W J;  5IP7 J;  4A0Y A;  4IHX A;  2DW4 A;  3ZQL A;  2A3S A;  2CH0 A;  2F4M B;  1B72 B;  2E7X A;  5CYV A;  3B6A A;  4DZP A;  3A0B C;  1CGP A;  3TW7 A;  1U2W A;  3F8F A;  4F91 B;  2VPL A;  1T6S A;  2WA0 A;  3LSP A;  1TWC J;  3N97 A;  5IY5 H;  2M7B A;  3OWT A;  1QRY A;  2UXN A;  4W1U A;  2DMN A;  2FF4 A;  3BDD A;  2EIN H;  2FE3 A;  3CCM I;  1B9M A;  2DTR A;  4FE7 A;  4ZYE A;  1G3T A;  5LLQ A;  5GP9 A;  2IRF G;  3OV8 A;  2JMW A;  2R7S A;  3WGG A;  3S2W A;  2VQL A;  1ETW A;  4CDG A;  1QGP A;  4WK8 F;  1WQ2 A;  3AG4 H;  2HGC A;  3BG6 A;  3LFK A;  2LNB A;  2FOK A;  3U1K A;  3VYS B;  1ZLK A;  4RAZ A;  4A3I J;  2V9V A;  3AAF A;  3K9T A;  3S1Q J;  1QU3 A;  1IRZ A;  2KRH A;  4HF0 A;  3CUO A;  2PG4 A;  2HR3 A;  3ERM A;  4I0B A;  2LRD A;  3RKW A;  5LEJ A;  4A0Z A;  2O03 A;  5IP6 A;  3L2C A;  2D45 A;  1JE8 A;  1WPK A;  1KU2 A;  2OZU A;  1P2F A; 
#chains in the Genus database with same CATH homology
 1HQC A;  4YFX F;  2ELH A;  2DI3 A;  2HOE A;  2HTJ A;  5DUI A;  3WTS C;  3RPU A;  2VBY A;  1MJ9 A;  1J9I A;  1Z91 A;  1RI7 A;  5FGM A;  1HST A;  2M87 A;  4ZYD A;  1LVA A;  2A6H F;  2D2W A;  3ERE D;  1HW2 A;  4XBF A;  4HBL A;  4N9I A;  4OOI A;  2XAJ A;  2XKP A;  2FA5 A;  2M45 A;  2XAF A;  3HRM A;  4PDK A;  3V7C A;  4OIR F;  4LLG F;  2EFQ A;  5ILU A;  4G7O F;  1FYK A;  2P7C B;  1QZY A;  5DCM B;  2Z3Y A;  2LSO A;  4BHC A;  1S3J A;  2H6C A;  5E1W A;  3KEQ A;  1HW1 A;  1IW7 F;  3JTH A;  3EUH A;  4O5V A;  4I7H A;  1FSE A;  3J80 Z;  4IRG A;  1U5T A;  3WTV C;  3I0T A;  3KZZ A;  3R0J A;  5D4R A;  4UHT A;  4UV8 A;  1R1T A;  4MQV A;  1G3W A;  4BQA A;  1QBJ A;  2K02 A;  4KIF A;  3WU0 A;  2WC2 A;  5AIQ A;  3QPT A;  4LB6 B;  4N9H A;  3DFG A;  2XKO A;  3BWG A;  5D8L B;  4EJO A;  2M5W A;  3K2Z A;  1Z9C A;  2QQB A;  1SFX A;  1D8K A;  3C1D A;  3WU1 B;  2YX4 A;  3HOT A;  2R3S A;  3JTG A;  1O3S A;  3I71 A;  2G9W A;  4KIG A;  2ADU A;  4XLN F;  1FSH A;  1YO5 C;  3P9K A;  4CO8 A;  1JHH A;  3M8E A;  2PEX A;  2M8E A;  1V3F A;  2OD5 A;  3SFZ A;  2VXZ A;  1SMY F;  1O3Q A;  4ZH4 F;  2DU9 A;  2HKO A;  1A04 A;  1FP2 A;  2G7U A;  2GZW A;  1HKT A;  2CG4 A;  2WTE A;  4G7H F;  5HS9 A;  1RUN A;  1R5G A;  5EEH A;  2P6S A;  1XGM A;  3QU3 A;  4MTD A;  1ON2 A;  3GYH X;  2W25 A;  4B8X A;  3C7J A;  5JHU A;  4Q48 A;  4RGS A;  1BI1 A;  3EYY A;  4E70 A;  4EGY A;  3CO6 C;  1ONV A;  3IWF A;  3SZT A;  1Z1D A;  2O8X A;  1BIA A;  5FFZ A;  1WI9 A;  5CVJ A;  4HX8 A;  3HRU A;  4UVA A;  3ABU A;  3KP2 A;  3O6B B;  5DD8 A;  3KP4 A;  3GFJ A;  3HSR A;  2QWW A;  4OIP F;  2HKX A;  5BPI A;  4LMY A;  2STW A;  2Z99 A;  4GGG A;  3M9A A;  3RDI A;  4I01 A;  3NEU A;  4G7Z F;  2X0L A;  3IL2 A;  2QZ8 A;  4LK1 F;  1S8N A;  2O6G E;  3MZY A;  3JAM K;  2A69 F;  3KEO A;  4Y17 A;  4Q47 A;  5DV5 A;  3E5U A;  1T0F A;  4KT5 C;  2Q8K A;  5CJ9 A;  4LLN A;  3QP5 A;  3GZ6 A;  2L54 A;  4HLY A;  3C18 A;  1PUE E;  5JVT A;  2VN2 A;  5E1Z B;  2TDX A;  5FB2 A;  1BC8 C;  3L9F A;  5LGU A;  4U88 A;  3L09 A;  4NQW A;  2HQR A;  2AS5 F;  4EV0 A;  4BXU A;  2EA2 A;  3JW4 A;  3NQO A;  4U7B A;  2P8T A;  3LWF A;  2OQG A;  3ECH A;  4L5I A;  2YSR A;  3DKW A;  2CYY A;  2QM3 A;  2IA0 A;  1PDN C;  4LK0 F;  3MZH A;  3QP6 A;  4R8H A;  2NNY A;  4ZZL A;  5D6F A;  1OYY A;  3I59 A;  2CW0 F;  3WOD F;  2MA3 A;  4Y15 A;  4G94 A;  1BI2 A;  2EFW A;  2K7L A;  5AIP A;  3NRV A;  2NNN A;  2OU2 A;  1W5S A;  1IF1 A;  2CFX A;  3V8K A;  5FLX K;  2QBY A;  1T98 A;  2ZKZ A;  3WE3 A;  3CUQ C;  3LA3 A;  1DP7 P;  4CZZ A;  2ESH A;  2P6T A;  3FXU A;  4IF4 A;  3BOQ A;  2FQ3 A;  4ENN A;  2RQP A;  3GVA A;  3FZV A;  4LGW A;  1R1U A;  1FWZ A;  2QVO A;  3HHH A;  5TRD A;  3TDZ C;  1F4K A;  2FSW A;  2ZME A;  3F8N A;  2JPB A;  4A6D A;  1I1S A;  2MBF A;  4WXD A;  1OYI A;  3U1D A;  2IA2 A;  1LEA A;  4RB2 C;  3IRQ A;  1XGN A;  1Z05 A;  2G7H A;  3WGH A;  2XAQ A;  4HZF A;  2QQ9 A;  1ZG1 A;  3I4P A;  2DPD A;  5FD6 A;  2H6B A;  2L4A A;  3HRT A;  3H3Z A;  2Q0O A;  5LRS A;  4Y13 A;  5D5W B;  2XRN A;  1ZHF A;  2PN6 A;  3VFZ A;  4ZYG A;  1CF7 A;  1R1V A;  1TW3 A;  2DAO A;  5ED4 A;  3LA2 A;  1P4X A;  2IP2 A;  2RNJ A;  2PMU A;  5D5X B;  4IVN A;  2M1B A;  1UFM A;  3CDH A;  2VT2 A;  3T1B A;  1YTY A;  2UWM A;  2V79 A;  1SD6 A;  1ZG5 A;  2YU3 A;  1EV7 A;  4PCQ A;  5IT3 A;  4ENM A;  3GLX A;  4XSZ F;  4LLL A;  2K4B A;  3DPT A;  2MH2 A;  1K79 A;  5F1R A;  1YG2 A;  2CWE A;  2IPQ X;  2A6E F;  2HTS A;  4RB3 C;  3K1P A;  5HDG A;  5IT9 Z;  4Q5S F;  4CHU A;  2J5P A;  3E5Q A;  1W7P B;  3IC7 A;  1RUO A;  3KP5 A;  3HHG A;  1K6O A;  1USS A;  2P4W A;  3IHU A;  2IW5 A;  2LF8 A;  5KVR A;  3QRF F;  1FBQ A;  5L3C A;  1WRJ A;  4GO1 A;  3T8R A;  2EFN A;  1IXC A;  1BIB A;  1P4A A;  1FY7 A;  1KQ9 A;  2D1H A;  1WKM A;  1J0R A;  2WWY A;  2UXX A;  1XB4 A;  2KIU A;  5JFR A;  4CGZ A;  1HKQ A;  4EJT A;  4KFC A;  4KA4 A;  3TGN A;  4KN4 X;  3TO7 A;  4HA8 A;  3JSP A;  1HKS A;  2YPR A;  3GWZ A;  5FD5 A;  4IXA A;  3L00 A;  3J80 K;  3T5X A;  1GXP A;  1R22 A;  3ZMD A;  2YR2 A;  2KIF A;  2MC3 A;  1KU9 A;  4DQ2 A;  1Z6R A;  1F5T A;  3MAJ A;  3K1M A;  4P96 A;  4RGR A;  4WX9 A;  1AOY A;  2XVC A;  4U0W A;  1T39 A;  4FHT A;  3HSF A;  2J5O A;  2E7W A;  5J6X A;  1UCR A;  2GWR A;  3ISP A;  3BJO A;  4M72 A;  1Z7U A;  4I02 A;  5AON A;  3EYI A;  4LG0 A;  1V4R A;  5BMZ A;  3P7N A;  1J2X A;  3E6C C;  4NHJ A;  5D8K B;  1W4M A;  2HFH A;  1LQ1 A;  3PQJ A;  1LEB A;  3Q9S A;  3FX3 A;  3KCC A;  1U6G A;  4IHT A;  2JSC A;  1YYV A;  1JXS A;  3SHF A;  2VOP A;  1H9T A;  3RKX A;  1FPQ A;  1BBY A;  4XLP F;  2HEO A;  2VBW A;  2FNP A;  1S7A A;  1E17 A;  5F6F A;  2STT A;  2XGX A;  4M9X A;  4RS8 A;  1GHC A;  4FT8 A;  2BYV E;  1RIO H;  3CLO A;  2QYO A;  5K5R A;  4DNC A;  5E8G A;  4H0E A;  2VC1 A;  3ZPL A;  4OIN F;  1UB9 A;  3F6O A;  3CUQ A;  2VOO A;  1I1G A;  3BRO A;  2LDU A;  4EVI A;  1IAW A;  5E1X A;  2BBY A;  2K86 A;  3K0L A;  2XAG A;  2JPC A;  3TQN A;  1K78 A;  3EQL F;  3F8B A;  1S7O A;  3MQ0 A;  1REP C;  5LHG A;  1TLH B;  2H09 A;  2RV8 A;  2V1U A;  2A68 F;  1FP1 D;  2JZY A;  2QLZ A;  4KIC A;  2ETH A;  4LG0 B;  2EFO A;  4A0X A;  2HZT A;  4B09 A;  2GXB A;  2W84 A;  5D5V B;  3EET A;  3M1E A;  2NAZ A;  3GUD A;  1QQI A;  4MHG A;  3Q5F A;  3QU6 A;  2E1N A;  4M71 A;  4LD5 A;  1O3R A;  1ZRE A;  2OZ6 A;  1XMA A;  1ON1 A;  4RAY A;  3F72 A;  2XV4 S;  1OR7 A;  4P55 A;  1PP7 U;  1MGT A;  2HYG D;  2IVM A;  5CVI A;  5K1Y A;  1ODD A;  1TNT A;  5JR3 A;  5CVU A;  1J75 A;  1T38 A;  1U5T B;  2KJB A;  3FXQ A;  4A2U A;  4N0B A;  2R7D A;  4BH9 A;  3V7S A;  1OYW A;  1YW9 A;  2OA4 A;  1OMI A;  2FBI A;  2QUF A;  4IJA A;  5DUK A;  1U78 A;  1XSX A;  4L0Y B;  2EA4 A;  1B9N A;  2RKH A;  1ZGA A;  4TV7 A;  4IRI A;  5LGT A;  4D0P A;  5H6Q A;  3R4K A;  2NRA C;  2VOD A;  4HX7 A;  1KQ0 A;  1J7K A;  4EM1 A;  5DCF A;  4F7Z A;  3TO6 A;  3W6K B;  3VEP A;  3IWZ A;  4FX0 A;  5HLH A;  1IUY A;  3J81 Z;  2VE9 A;  2FRH A;  1FBS A;  2DK5 A;  1HXD A;  1B1B A;  4YG2 F;  5LRR A;  2Q2E A;  1DUX C;  1P6R A;  1SFU A;  2GA1 A;  3GW2 A;  4A12 A;  4HF2 A;  1YQA A;  2EV0 A;  3REO A;  2A61 A;  2ISY A;  2MD5 A;  1DPR A;  1MKM A;  1TNS A;  3QAH A;  2Y48 A;  3KP7 A;  3FXR A;  1ZRF A;  3RYR A;  3DF8 A;  2DPU A;  2HS5 A;  2Y75 A;  1Q1H A;  4CYD A;  1C0W A;  2H94 A;  3MFK A;  4AIJ A;  2XAH A;  3M8F A;  2EV5 A;  3Q9V A;  1BI3 A;  3FF5 A;  1TW2 A;  3COA C;  5FFX A;  3HTS B;  1NHA A;  1W7P D;  2BGC A;  1XDU A;  3PFI A;  2W85 A;  2GIV A;  3GXO A;  2GAU A;  3FWE A;  2V1X A;  3HIF A;  5HVQ C;  4KNY A;  5HS7 A;  3E3V A;  3BPV A;  4WF2 A;  2CSO A;  5ILV A;  1KQ8 A;  1KGS A;  3F6V A;  4M6Y A;  2P5V A;  5H20 A;  1IN8 A;  5EEG A;  4BHB A;  4KN7 X;  4U7D A;  2VBX A;  3O2P E;  4BAY A;  4UVC A;  4EQQ A;  2F5C A;  5E18 F;  3F3X A;  1IRG A;  1KYZ A;  5K5Q A;  3T8T A;  5IT9 K;  2DT5 A;  4G9Y A;  2EWN A;  4OIO F;  3HOS A;  4HYE A;  5DD4 A;  3JSO A;  3ZP5 A;  1FBU A;  5CLS A;  4JK1 X;  1SD7 A;  2DO7 A;  2XRO A;  2PMH A;  1I6X A;  4BYY A;  2LF7 A;  3FM5 A;  4R79 A;  2F5F A;  1AWC A;  2K27 A;  3ZN1 A;  3LA7 A;  2FML A;  3RI4 A;  1R36 A;  1BJA A;  2COM A;  2OBP A;  1H9G A;  1Z6T A;  2HWV A;  3R6S A;  1FC3 A;  1YW7 A;  3WTX C;  3DQV C;  1FX7 A;  3I59 B;  3KE2 A;  5E17 F;  2H27 A;  5CVR A;  3W6J B;  5LHI A;  1D5V A;  2KIM A;  2XIG A;  4L9J A;  4MTE A;  1ZYR F;  4YIF A;  2FBK A;  2L02 A;  5A2Q Z;  2QBY B;  1O7F A;  1W5T A;  3MWM A;  4PZJ A;  4R1H A;  1IN5 A;  4HDV A;  1TQM A;  1ZN2 A;  2P5L C;  1O3T A;  2HQN A;  1BC7 C;  2VON A;  1K7A A;  3WTU C;  2L3D A;  3FHZ A;  3FM3 A;  2QQA A;  4YFK F;  4EM2 A;  1B59 A;  2P5K A;  1R58 A;  3KLN A;  4HV6 A;  4GYI A;  4GXO A;  2ZME B;  3GEZ A;  4A6E A;  4P5O A;  1QPM A;  4YFN F;  5LBQ A;  4WXC A;  5HDK A;  2V6C A;  1YS7 A;  4M6X A;  2Y0M A;  4LJZ F;  3LQR A;  3U9G A;  5ICC A;  1IN6 A;  2XAS A;  1ZGJ A;  1D3Y A;  2MH9 A;  3R0A A;  3G3Z A;  4AVP A;  1HW5 A;  4AIH A;  3KP6 A;  1O7L A;  4O6J A;  5DCM A;  5D6E A;  1PP8 F;  2C6Y A;  4WWC A;  4P9U A;  5BPD A;  2F5E A;  1FYM A;  5DYM A;  3F8M A;  4MGR A;  1CF7 B;  1XN7 A;  3FMR A;  1TQI A;  3VOD A;  2O0Y A;  4KMU X;  4L18 B;  3CTA A;  1MJA A;  3ML6 A;  1SD4 A;  4JBA A;  2FMY A;  3LAJ A;  2JTV A;  2DBB A;  4LFU A;  1BI0 A;  3I64 A;  1R7J A;  4ESB A;  5ILS A;  2ZXJ A;  5BQT A;  5ICF A;  3GZ5 A;  5E8I A;  1LJ9 A;  1YS6 A;  5F64 A;  4U0Y A;  1XGO A;  5HOO A;  2VBZ A;  2JT1 A;  4MNU A;  2HYF A;  3TO9 A;  1SFE A;  1G3Y A;  1IRF A;  4UV9 A;  1I27 A;  2ISZ A;  3MEX A;  1DDN A;  2PLY A;  5L3E A;  3BZ6 A;  3ECO A;  3P9C A;  1YW8 A;  3P9I A;  1J59 A;  3F21 A;  1ZAO A;  3L7W A;  2XHK A;  2Z5U A;  5LGN A;  4ENK A;  4KDP A;  1TBX A;  1ZAR A;  5K5O A;  1TTY A;  3I58 A;  1LDD A;  4ON0 A;  3D5L A;  1T2K A;  1EH7 A;  3HRS A;  3RTR A;  1FOK A;  4XRF A;  3RPQ A;  3K69 A;  2EV6 A;  3ZMU A;  1WWX A;  1U3E M;  2DLL A;  2P7V B;  3DPL C;  4PGG A;  4KIB A;  1LDJ A;  1MZB A;  2F5D A;  1Y0U A;  4A5N A;  1LNW A;  2O3F A;  1OKR A;  3E5X A;  1ZLJ A;  2BV6 A;  4KUM A;  3ZMT A;  3WTW C;  2MLK A;  4AIK A;  4UXN A;  5L3B A;  2IT0 A;  1SD5 A;  3I53 A;  3B02 A;  3U2R A;  4EJU A;  3N4M A;  1P92 A;  4KYW A;  4HW0 A;  6PAX A;  2B0L A;  2V1D A;  4HAM A;  4HV5 A;  4M9S A;  2RC4 A;  2EK5 A;  4GYG A;  3BPX A;  5CVV A;  1BOA A;  3HSE A;  2RGV A;  5HLI A;  5DEQ A;  2M30 A;  2D1V A;  3G73 A;  1JGS A;  3R60 A;  3LQQ A;  4S04 A;  2ZBK A;  4ESF A;  5ICG A;  2KJC A;  3F23 A;  4K2E A;  1FZP B;  4O3M A;  2RDP A;  3H92 A;  5ERI A;  1UHM A;  4OMZ A;  3C3W A;  4G8X A;  4EJV A;  1HBX G;  3WTZ A;  3OOP A;  5D4S A;  2GXG A;  4RGX A;  2BEO A;  5L3D A;  4OIQ F;  3HYI A;  3J81 K;  4WCG A;  1OPC A;  3LAP A;  3V4G A;  3HTU A;  2LKP A;  1P4W A;  2W57 A;  3B73 A;  1VTN C;  2K4J A;  2FXA A;  5J8C A;  3E6M A;  1YLF A;  3GFI A;  2A07 F;  4ESJ A;  4I2O A;  2BE5 F;  4L9N A;  2PJP A;  3SZP A;  1ZRD A;  1ZRC A;  4BHP A;  5E20 A;  4A5M A;  4BNC A;  1R23 A;  1FYL A;  4NB5 A;  3ULQ B;  2ZCW A;  5HS8 A;  4ASN A;  2GQQ A;  3CUQ B;  3KP3 A;  2ACJ A;  3I54 A;  3QOP A;  1XGS A;  2L4M A;  2DQL A;  1O57 A;  4L9V A;  4U0V A;  2VC0 A;  2Z9O A;  2O61 A;  1KU3 A;  1K78 B;  1G6N A;  1EH6 A;  4LB5 A;  1R00 A;  1FNN A;  4I0A A;  3ZMV A;  1FLI A;  1RZ4 A;  1MDM A;  4UUV A;  2W24 A;  3DXJ F;  1ULY A;  1YFH A;  5BS6 A;  3F22 A;  1E2X A;  4HQE A;  1G4D A;  3RIR A;  3I5U A;  1XCB A;  1IN7 A;  5H6R A;  4L5J A;  3V8J A;  4IHS A;  5ICE A;  1F1Z A;  4JQF A;  4G6D A;  4EMS A;  2FNA A;  2PBI A;  1QNT A;  4HF1 A;  4UNO A;  1IXS B;  2ZO4 A;  5LHH A;  3R61 A;  2DFI A;  3ZN0 A;  1H0M A;  1HSJ A;  4MQ9 F;  2ZJ2 A;  4FX4 A;  1LB2 A;  2CGP A;  2EJR A;  3K1N A;  4EGZ A;  4MEY F;  5J8F A;  2RVC A;  3WGI A;  3KZY A;  4HQM A;  2HDC A;  2OQR A;  2F2E A;  2MLG A;  2E1C A;  1KYW A;  2CQK A;  1U8R A;  4QWQ A;  3BJ6 A;  1J5Y A;  1DPU A;  3IKT A;  5HDN A;  4IRH A;  3E6B A;  4PGH A;  1SAX A;  4M74 A;  3VOE A;  3WTY C;  1KU7 A;  1XSD A;  2DQR A;  2IA1 A;  4HOB A;  5L3G A;  1G3S A;  2L01 A;  4RB0 A;  2OAZ A;  4QLC U;  3WE2 A;  3WG9 A;  2QEN A;  1U5T C;  2X4H A;  3JAM Z;  1XD7 A;  1ZG3 A;  1XSV A;  4CIC A;  5L3F A;  5A2Q K;  4WXH A;  1GXQ A;  2PFB A;  3CJN A;  3BY6 A;  2PI0 A;  4YII A;  2NS0 A;  1MDM B;  1R5H A;  3H3U A;  3HUG A;  1S6L A;  4HX4 A;  3IRR A;  3DP7 A;  1W7P A;  3BP8 A;  2RN7 A;  3FMS A;  2PQ8 A;  5FO5 A;  2CO5 A;  3DEU A;  3ROU A;  3V7R A;  4EM0 B;  3ABT A;  3BJA A;  3M7G A;  4P9F A;  3SQN A;  2Z33 A;  3TOA A;  1BM9 A;  4ENJ A;  1UST A;  5LEK A;  4L9T A;  3ZMZ A;  2FBH A;  5BOX A;  1FT9 A;  3E6D A;  1LDK B;  4Q4Z F;  4S05 A;  3O3K A;  1QZZ A;  4CXF A;  2KRF A;  5HLG A;  4ZZD A;  1QO0 D;  4KMF A;  1MD0 A;  1XCV A;  4EJW A;  4HLX A;  3MCZ A;  4Z2Y A;  4HDU A;  1L0O C;  3WTT C;  1B6A A;  3RJP A;  4ZYH A;  2VE8 A;  3KLO A;  3V8L A;  4M73 A;  4XSX F;  4I09 A;  2FEZ A;  1TQP A;  5FLX Z;  2EB7 A;  4G6Q A;  4IPA A;  1X3U A;  1B4A A;  3ZQ7 A;  1D8J A;  1IN4 A;  3RYP A;  2NYX A;  2JRT A;  3VB2 A;  1MJB A;  5D5U B;  3QPH A;  3GFM A;  3PQK A;  3TKY A;  1YIO A;  2WV0 A;  3EDP A;  1WSU A;  3FMQ A;  5DDG A;  1XDS A;  3TDU C;  3GFL A;  3KET A;  2EFP A;  1IZ1 A;  2A5Y B;  4AWX B;  3ZMS A;  5JI6 A;  5TJJ A;  2DK8 A;  2IJL A;  3TOB A;  3J7A O;  3RKY A;  1S29 A;  2ZNY A;  1I5Z A;  2KKO A;  1SMT A;  1IXR C;  4ETS A;  2VT3 A;  4UVB A;  2R7F A;  3GF2 A;  4AD9 A;  3GO5 A;  1F9N A;  1RNL A;  2XUB A;  1ZH5 A;  4RB1 A;  3D0S A;  1GVJ A;  4OMY A;  1UHW A;  4RGU A;  2FU4 A;  4M9Z A;  4GCV A;  3T0Y A;  2GA2 A;  2UZK A;  3CO7 C;  3GX4 X;  2ZFW A;  3LST A;  1BN5 A;  1STZ A;  3E97 A;  5KK1 A;  2ESN A;  3ELK A;  4L0Z B;  4MEX F;  2ZNZ A;  3KFW X;  4OU0 A;  2YX7 A;  1EH8 A;  3SXY A;  3F8C A;  3IKV A;  1KA8 A;  1XMK A;  4I98 B;  1L3L A;  2AXL A;  3DV8 A;  1JHF A;  4A0Y A;  2DW4 A;  2A3S A;  2E7X A;  5CYV A;  1CGP A;  1U2W A;  3F8F A;  1T6S A;  3N97 A;  2UXN A;  3BDD A;  2FF4 A;  2FE3 A;  1B9M A;  2DTR A;  4ZYE A;  1G3T A;  5LLQ A;  2IRF G;  3OV8 A;  3WGG A;  3S2W A;  4CDG A;  1QGP A;  4WK8 F;  1WQ2 A;  2HGC A;  3LFK A;  2LNB A;  2FOK A;  1ZLK A;  4RAZ A;  2V9V A;  3AAF A;  3K9T A;  4HF0 A;  3CUO A;  2PG4 A;  2HR3 A;  4I0B A;  3RKW A;  5LEJ A;  4A0Z A;  2O03 A;  3L2C A;  2D45 A;  1JE8 A;  1KU2 A;  2OZU A;  1P2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...