4EJUA

Staphylococcus epidermidis tcar full length
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
RRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator TcaR
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejuA00
5HS8A 3F72A 4CYDA 4ZZLA 5FB2A 4EJTA 3BJOA 1USSA 1WWXA 4LMYA 3F6VA 3M7GA 2XROA 4IJAA 3NRVA 1NHAA 3K1NA 3P9CA 2M30A 4FT8A 2IA2A 5ILSA 3ZPLA 3J81K 4KYWA 4N9HA 4M72A 4OU0A 1OR7A 3JSPA 5LGNA 4RB3C 5FGMA 2CG4A 1B4AA 2HQNA 1WRJA 1STZA 4M9XA 5LEKA 1IN5A 3TOAA 3EQLF 4IXAA 1FP1D 1ZYRF 4LD5A 2WWYA 3REOA 1LVAA 1O3RA 3DXJF 5CLSA 3M8FA 4HOBA 3MFKA 1U6GA 1LNWA 3LQQA 5J6XA 4EJUA 2VC1A 2CYYA 2V1XA 3FWEA 3JSOA 4JK1X 2DFIA 5CYVA 1ON1A 4A0XA 4UNOA 3V8JA 2COMA 5L3FA 1PUEE 2QVOA 4ASNA 3F8MA 2V6CA 4CO8A 1Z1DA 1XMKA 3FMRA 1FZPB 3E97A 2FF4A 3WTYC 4Z2YA 2W84A 2D1HA 3ZQ7A 1I1SA 3U2RA 2GA1A 2VN2A 4LK1F 4AVPA 5KK1A 2JSCA 2KIUA 3DPLC 1RUOA 3TDZC 4UVBA 5L3EA 1W5SA 2PBIA 3HTUA 1S7AA 5K5OA 1SAXA 1WKMA 3R6SA 4K2EA 3RJPA 3FM3A 5CVIA 2JT1A 3J80K 1YO5C 1HQCA 3O6BB 3T0YA 3ELKA 4HQEA 3VODA 1XSDA 3LWFA 1H9GA 2P5KA 4WXHA 1YS6A 3EYIA 1I27A 3CLOA 2C6YA 1IF1A 2M87A 5A2QZ 3HRSA 4GYIA 1G3SA 2OD5A 2MLKA 3K69A 4PDKA 1ZRFA 4IF4A 1XCVA 3D5LA 1YFHA 2WV0A 1RZ4A 2H94A 3ZP5A 3I64A 5H6RA 2AXLA 4HLXA 1IXSB 1EH7A 4IRIA 3KP5A 5FFZA 1ZRDA 1LJ9A 1G4DA 1BJAA 3E6DA 4KNYA 3FX3A 2RVCA 4EM0B 3KEQA 2PG4A 3F6OA 2QM3A 3V8LA 4HX8A 3CUQA 5E1XA 1T6SA 2ZKZA 1KU2A 5HDKA 2A6HF 1YLFA 4IVNA 3SZTA 2J5OA 4YIFA 5ICGA 3KP7A 1BN5A 3O2PE 2P6SA 2LSOA 2ZXJA 4KIBA 4RB2C 4I2OA 3V7RA 3ABTA 3K2ZA 4MHGA 1XGSA 1C0WA 3U9GA 2NNNA 2G9WA 2P7CB 5J8CA 5BS6A 1ZG1A 4XBFA 2ELHA 1J75A 2Q8KA 3KCCA 3RKYA 2W85A 1UCRA 5TJJA 1F1ZA 4OIOF 1K78B 3SHFA 5HVQC 2EB7A 2BEOA 4OIPF 1L3LA 2P5VA 2OAZA 3WTWC 2YSRA 1KA8A 2HTJA 1W4MA 4ZYEA 4NB5A 4BAYA 4RB1A 4LG0B 1MDMA 5LEJA 4WWCA 5F1RA 2RNJA 2HDCA 1IXCA 1P92A 1XN7A 5DYMA 2Y48A 1FSEA 4HV6A 3BZ6A 1T0FA 3P9KA 2Z99A 4DNCA 1O3SA 1F9NA 2MBFA 1J59A 5D5UB 1QZYA 2FA5A 4IHSA 3I59B 1GHCA 5KVRA 5E8IA 2M5WA 3COAC 3IRQA 1ZN2A 2PMUA 3I58A 1RNLA 4ZYGA 1T39A 2UXXA 2XAHA 2K02A 2GQQA 2HOEA 2MLGA 1HW1A 1I6XA 5CVVA 4O3MA 2QENA 3MAJA 2DK8A 4A5NA 3LA3A 5LGTA 1K7AA 1BI2A 2QLZA 4RB0A 4L0YB 3TDUC 2W57A 1JE8A 1MKMA 3HOSA 2E1NA 3CJNA 1R22A 4OIQF 3K1MA 3ERED 4HYEA 2IW5A 1BC8C 4O5VA 5LHIA 5LHGA 2Z33A 4G9YA 4YFXF 1TQPA 2XAJA 5CVJA 5E1WA 4OOIA 4Q4ZF 3KZZA 2BV6A 2OZUA 3K1PA 1Z7UA 2F5EA 3G3ZA 3CUOA 4OMYA 5JVTA 2O61A 1TNSA 3LQRA 3T8TA 4GO1A 1H9TA 4HLYA 4U0YA 3GF2A 1F4KA 2IP2A 2IT0A 1SD4A 3N4MA 1R5GA 2F5FA 4G8XA 3IKVA 4MNUA 5D4SA 3RPQA 2M8EA 3FM5A 3NQOA 3BPVA 4RS8A 1LEBA 4EMSA 2X0LA 2DTRA 4XSXF 2ESHA 1K6OA 1U78A 2HFHA 1S29A 4I01A 2VE9A 3B02A 1ZGAA 2EWNA 3SQNA 5ILUA 2DW4A 3GXOA 5E18F 1YTYA 1KU3A 4I0AA 2ESNA 4PGGA 4KDPA 2ZBKA 4XRFA 1FWZA 2OQRA 3IWFA 2EFQA 5BQTA 3HRTA 2GA2A 2J5PA 3GFIA 1SD7A 2EV0A 2IVMA 1REPC 4RGUA 2MH2A 4UUVA 4PCQA 1J0RA 3WE2A 1QPMA 2GXBA 2L3DA 1T2KA 1FX7A 2XV4S 5AIQA 1SD5A 3RKXA 2EJRA 4AIJA 1YW9A 3TGNA 1HKQA 4LG0A 4CZZA 1HXDA 4KICA 1R00A 1BBYA 2HTSA 4LJZF 2KJCA 1AWCA 1Y0UA 3KZYA 5BPIA 1K79A 1GVJA 3ROUA 1IN8A 1XGMA 5ILVA 4U0VA 3RDIA 3Q5FA 4GYGA 1D8JA 5FLXK 4WXDA 1W7PA 4CICA 1GXQA 3V7CA 2Z5UA 1MD0A 1ZARA 4UV8A 3GX4X 4HZFA 3CTAA 3C3WA 4YFKF 2OA4A 4A6DA 4ENNA 2A68F 2O03A 2O8XA 1R5HA 1BC7C 1IXRC 3IL2A 3BPXA 1R23A 3RIRA 4HDUA 4A12A 2M45A 1D8KA 4L9VA 1P4AA 2ZNYA 2DK5A 3RYPA 2RQPA 1Z05A 1XDSA 1TBXA 3ECHA 4AWXB 2QQAA 1IN4A 5ICFA 3ML6A 3CUQB 5CJ9A 2O6GE 5D5VB 1KQ8A 1JHFA 3R0AA 3TO6A 1SD6A 4L9JA 2QBYA 5HS9A 2A6EF 1LQ1A 5JHUA 1FBUA 4P9UA 1V4RA 2ISZA 4HBLA 4P9FA 5F6FA 3R60A 1BIAA 2VODA 3LA2A 4PGHA 2UWMA 5AONA 3WGGA 2F5CA 3F3XA 1YW7A 2RKHA 2XUBA 4KT5C 4A6EA 3PQKA 3GEZA 2B0LA 3NEUA 2A3SA 2NNYA 2JZYA 4KIFA 3IHUA 3IKTA 3L9FA 3QU3A 3M8EA 2RN7A 3KE2A 3RPUA 2PLYA 5L3GA 3TQNA 3I5UA 1MGTA 4GXOA 4AIHA 1MDMB 2K7LA 2QQBA 1OYIA 1MJAA 2Q0OA 2M1BA 2L01A 5FD6A 2TDXA 1ZAOA 2EA4A 1PP7U 1QZZA 5ERIA 1V3FA 3KP4A 4B8XA 4HV5A 5D6EA 3H3UA 4HQMA 1FLIA 1SMTA 3EETA 3C7JA 4HX7A 4WXCA 2XKOA 4G6DA 2V79A 3FHZA 1E2XA 1ZRCA 2ZNZA 4DQ2A 3G73A 2DI3A 1VTNC 4OIRF 3IWZA 4JBAA 3E3VA 4Y17A 2R7DA 4KIGA 5ICCA 3R0JA 1JGSA 3VOEA 3RKWA 3QP6A 1FT9A 4ON0A 2CSOA 1KU7A 1B1BA 1LEAA 4ENKA 3F8CA 4EM2A 1R1UA 1USTA 4RGSA 4ESJA 2PJPA 3I54A 3MZYA 1SFXA 4M9SA 4E70A 4MEXF 2H09A 1CF7A 4HX4A 3HSFA 3P9IA 4LK0F 4OMZA 1HBXG 2D45A 4FX4A 3DF8A 5BMZA 2XKPA 3TO7A 3HSEA 1QBJA 2E1CA 5H6QA 1P2FA 2E7WA 3M1EA 4QLCU 1E17A 2Z3YA 3GYHX 3GFMA 1FY7A 5D5XB 3TKYA 1MZBA 3BOQA 3O3KA 1P4XA 2D2WA 3LA7A 1X3UA 3C1DA 1J7KA 1TQMA 3GZ6A 3HHHA 4XLPF 1Q1HA 4G7HF 2AS5F 5BOXA 3ZMDA 2A5YB 5FD5A 2X4HA 3VB2A 1KGSA 4AD9A 2O3FA 5D6FA 3ZN0A 3CO7C 1ODDA 1S8NA 2HEOA 5LBQA 3FF5A 1G3YA 2BGCA 3BP8A 3HSRA 3WGIA 4M6YA 2XIGA 2OZ6A 1FYKA 1U5TA 2Z9OA 3DPTA 1BM9A 2JPCA 5D5WB 4ETSA 1FOKA 3R61A 5E20A 3JW4A 1OYWA 5K1YA 1S7OA 1FC3A 2JTVA 5IT9Z 1YIOA 3IRRA 5DEQA 2XHKA 4L0ZB 3E5XA 3MCZA 3W6KB 2EFPA 1RUNA 1BIBA 2DLLA 1BI1A 3CO6C 5FO5A 4LLLA 4P55A 2K86A 2LKPA 2HZTA 4UXNA 1W7PB 2HYFA 1P4WA 4HW0A 3V4GA 2QYOA 1W7PD 1UB9A 4KN7X 2MC3A 4UVAA 2PQ8A 3F21A 4JQFA 3MEXA 3Q9VA 1QGPA 3BDDA 3L09A 3OOPA 4O6JA 3RYRA 4A0ZA 1O7LA 4LB6B 4G7OF 1FP2A 2O0YA 1G6NA 2ZCWA 4Y15A 2GXGA 1HKSA 5A2QK 1ZREA 4OINF 2VT2A 3R4KA 1EH6A 2MH9A 3I4PA 2CQKA 1F5TA 3T5XA 4EM1A 4ENJA 3GUDA 1ZHFA 3RTRA 4ZZDA 2PI0A 1DPUA 1J5YA 5DCMA 4WF2A 2QBYB 1I5ZA 1EH8A 2EA2A 3M9AA 4NHJA 4G94A 5E1ZB 1XMAA 3E6BA 3J81Z 3ISPA 1W5TA 1D3YA 1U5TC 2UZKA 2PN6A 3LFKA 2LNBA 2JRTA 3V8KA 3WTSC 4HA8A 2VE8A 2R7FA 2VBWA 3WTZA 4L9TA 2FMLA 2LF8A 4HF2A 3K0LA 2YX4A 4HDVA 2HKXA 4L5JA 4ZH4F 4BHPA 1FYMA 1T98A 3JTGA 4PZJA 2DAOA 4EJVA 1A04A 2NS0A 4ZYHA 2F2EA 3GZ5A 4A5MA 3L2CA 1KQ0A 5ED4A 2A61A 3T8RA 4I02A 4KA4A 2KRFA 3KEOA 2FBIA 5LHHA 2L4AA 2ZFWA 5DDGA 2VONA 1Z6TA 1Z9CA 1B59A 1CGPA 1R58A 3E5UA 1IW7F 1XGOA 4CXFA 1ZGJA 5HLHA 4FX0A 3HIFA 4CHUA 4YG2F 2Y0MA 3HRUA 1PP8F 2ZJ2A 4MQ9F 4I0BA 2VXZA 1TNTA 5EEHA 3H3ZA 4RGRA 1HSTA 1YYVA 3JAMK 3ZMTA 3QP5A 1XCBA 3WG9A 3DFGA 4B09A 1U3EM 2ZMEA 3KLOA 3SFZA 3J80Z 3AAFA 4BXUA 2L02A 1DDNA 2R3SA 4R79A 4I7HA 3VEPA 2CFXA 3S2WA 2YPRA 2DO7A 4BHCA 1UHWA 1QQIA 2EFWA 4I98B 2DT5A 2P4WA 1O3TA 1YS7A 2GZWA 4R1HA 4BNCA 2RDPA 1CF7B 3E6CC 1HKTA 4GCVA 1T38A 4EJOA 2DQLA 3V7SA 2EK5A 2NYXA 2FQ3A 4LLNA 2RGVA 5HS7A 2GAUA 2Q2EA 2VOOA 5E17F 3KETA 4KUMA 3WTUC 3QPTA 4TV7A 1QO0D 2STWA 4Q47A 2K4BA 1KQ9A 5BPDA 5L3CA 3PFIA 3TO9A 1FBSA 5D8KB 4BH9A 1HSJA 3WU0A 4U7DA 3HTSB 1IRFA 3ZMVA 2FNAA 5HLGA 4KMUX 3F22A 5JFRA 3WODF 3I71A 4F7ZA 2IJLA 1H0MA 2CW0F 3Q9SA 3BWGA 1MJBA 1O7FA 2DPUA 3SXYA 4ENMA 2GIVA 4WCGA 2XAFA 2OBPA 2LDUA 1U5TB 2FXAA 4UHTA 2W24A 4CGZA 5K5QA 2H27A 4MTEA 2A07F 3KP6A 3FXUA 3D0SA 3DP7A 2A69F 2RC4A 3PQJA 1YW8A 2DQRA 5D8LB 1FBQA 1RIOH 2PEXA 2WTEA 2ZO4A 2VOPA 3FXRA 1WSUA 4Q48A 1KYZA 3GO5A 1YG2A 3I53A 4XSZF 3TOBA 3VFZA 5DV5A 4D0PA 4BYYA 5EEGA 2FMYA 1BI0A 2K4JA 1R7JA 3ZMUA 1AOYA 1TQIA 3ZMSA 4EVIA 1IN7A 3QAHA 1S6LA 4P96A 1XGNA 1B9NA 5AIPA 3FXQA 5K5RA 3B73A 2P8TA 5JI6A 1UFMA 4LB5A 4IRHA 2P6TA 3E6MA 1HW5A 2XASA 5DD8A 2CGPA 2DBBA 1O57A 3GWZA 4EV0A 5HDNA 4A0YA 1IZ1A 2H6CA 3DV8A 2IA0A 2YR2A 1LDDA 5CVUA 3L00A 5DCMB 4ESBA 3HRMA 2HWVA 3P7NA 3LAPA 3HYIA 2L54A 1SFUA 3LAJA 4YIIA 1Z6RA 4BQAA 1L0OC 2W25A 1XSXA 1LDJA 2YU3A 2KIMA 2FRHA 4G6QA 2XAGA 5LRRA 1J9IA 4QWQA 5JR3A 1IRGA 1OMIA 2XRNA 5H20A 3HHGA 5HDGA 2ADUA 1OPCA 3DQVC 1XD7A 1DUXC 5ICEA 3BY6A 3BJ6A 1I1GA 3T1BA 2HYGD 4EGZA 4I09A 4WX9A 2FNPA 2Y75A 1TTYA 3GFLA 1KU9A 5LRSA 2P5LC 3KP2A 4CDGA 2HGCA 3QPHA 1OYYA 5CVRA 4LGWA 2L4MA 2PMHA 4FHTA 2HKOA 3DEUA 3FMQA 4L9NA 1U2WA 3F8BA 3QOPA 3ECOA 2K27A 1ZLJA 1ON2A 4U0WA 2IRFG 2FE3A 3HUGA 4L18B 2NRAC 1YQAA 3ZN1A 2KKOA 3LSTA 4YFNF 1SMYF 2EFOA 1BI3A 2F5DA 2KIFA 4KMFA 2ZMEB 5DCFA 2HR3A 3WTVC 3GFJA 3JAMZ 3WGHA 2EV6A 2FOKA 3I0TA 5LLQA 2DU9A 1U8RA 4Q5SF 2RV8A 2DPDA 2FSWA 4XLNF 1HW2A 5FLXZ 2IA1A 4MTDA 4R8HA 3HOTA 2ACJA 3K9TA 2FU4A 2BYVE 1IAWA 3MZHA 3EYYA 4LLGF 3J7AO 4U88A 1ZG3A 3F8NA 4L5IA 1MJ9A 4ESFA 1J2XA 3ULQB 5E8GA 2JPBA 3KFWX 1TLHB 2QZ8A 3DKWA 3EDPA 3CUQC 4GGGA 4Y13A 2VT3A 5LGUA 4H0EA 5D4RA 1XSVA 1R1TA 2BE5F 1TW2A 4M74A 2YX7A 1R1VA 3OV8A 2P7VB 5HLIA 1SFEA 2G7HA 5FFXA 1JXSA 1DP7P 4P5OA 3F23A 4EGYA 3MQ0A 4RGXA 3F8FA 4U7BA 1Z91A 1FYLA 3KLNA 2XAQA 3MWMA 2EFNA 4ZYDA 1PDNC 2H6BA 3KP3A 3WTXC 4EQQA 1R36A 2QQ9A 2BBYA 2STTA 4KN4X 4WK8F 1G3WA 3U1DA 6PAXA 2VBYA 1GXPA 2FBKA 4S04A 3ZMZA 2OU2A 2VBXA 3CDHA 4MQVA 4MGRA 2HS5A 4KFCA 2CO5A 1LDKB 1OKRA 1XB4A 2UXNA 3FZVA 2IPQX 2LF7A 1TW3A 5DUIA 3L7WA 2ETHA 4AIKA 4LFUA 1ZG5A 5L3DA 2E7XA 4MEYF 4N9IA 2CWEA 2G7UA 1P6RA 4RAYA 5J8FA 4UVCA 2XVCA 3GW2A 3BJAA 2KJBA 1QNTA 3FMSA 1ULYA 4RAZA 4G7ZF 3IC7A 2V1UA 1O3QA 2QWWA 1B9MA 3ABUA 2MA3A 1RI7A 5DD4A 4IHTA 3EUHA 2FBHA 1K78A 1UHMA 3W6JB 5TRDA 3SZPA 5IT9K 4A2UA 2ISYA 1ZH5A 2OQGA 1XDUA 1IN6A 3H92A 5IT3A 5F64A 5DUKA 2XGXA 2HQRA 4EJWA 1ZLKA 4HF1A 4M71A 3WTTC 3RI4A 1EV7A 1FPQA 4M9ZA 2QUFA 1FNNA 2D1VA 3I59A 3GLXA 3WU1B 4UV9A 2PFBA 4IRGA 1FSHA 3E5QA 1JHHA 1BOAA 5HOOA 1DPRA 4N0BA 1D5VA 3BROA 3C18A 4IPAA 2WC2A 3WE3A 3JTHA 4NQWA 3QU6A 1B6AA 2NAZA 2MD5A 2V9VA 4S05A 3QRFF 2FEZA 2VC0A 1LB2A 4M6XA 1KYWA 3N97A 4HAMA 4HF0A 1S3JA 1WI9A 2EV5A 4BHBA 1G3TA 5L3BA 2VBZA 2V1DA 1WQ2A 3GVAA 1ONVA 4M73A 1IUYA 2GWRA
chains in the Genus database with same CATH superfamily
5HS8A 3F72A 2P81A 2DFEA 4CYDA 4ZZLA 5FB2A 3IV5A 4EJTA 3BJOA 3OS1A 2Y69H 1USSA 1WWXA 4LMYA 3F6VA 3M7GA 2XROA 1MBEA 3NRVA 4IJAA 1NHAA 5F08A 4XK4A 3K1NA 3MN2A 1PJRA 2M30A 2WY7Q 3P9CA 1VQLI 4FT8A 2IA2A 3PSIA 1R5ID 5ILSA 3ZPLA 3J81K 4KYWA 4N9HA 4M72A 2IAIA 3P5JA 4A3DJ 4OU0A 1OR7A 2LY1A 3JSPA 5LGNA 2LKSA 3MMYB 4RB3C 5FGMA 4XRSA 2CG4A 1B4AA 2HQNA 1WRJA 1STZA 4M9XA 5LEKA 1I3QJ 2DJIA 3DEEA 4C3JJ 1TZLA 2GLOA 3MZ8A 1IN5A 3RQIA 3TOAA 3EQLF 4IXAA 3VYUB 3CF5F 3IUOA 3K4KA 1FP1D 3GTGJ 1Z77A 1ZYRF 1X2NA 5LFAA 1Y8QB 5IPAA 4LD5A 3OL4A 2WWYA 3A0BC 1S9HA 4JYKA 3REOA 3ZQHA 1LVAA 2R92J 1LVKA 1O3RA 3DXJF 5DTDA 5CLSA 3M8FA 4HOBA 3MFKA 4B48A 1UELB 1U6GA 1LNWA 4MLOA 1MBGA 3LQQA 5J6XA 2FD5A 4EJUA 4F92B 3OYFA 2VC1A 2CYYA 2V1XA 3FWEA 1HLVA 3JSOA 4JK1X 4W1UA 2DFIA 4XKWA 3HUGB 2NVXJ 5CYVA 3CF2A 1ON1A 1W5CC 1XG1A 2G0EA 5GP9A 4A0XA 4C3HJ 3OYGA 1F43A 2R5YA 1AKHB 4UNOA 3V8JA 5F27A 2COMA 2GOXB 4A3KJ 5L3FA 3B6AA 2QVOA 1PUEE 2M8GX 4ASNA 3DU6A 2WBMA 4OWRB 3RZDJ 3PUFA 3F8MA 2V6CA 4CO8A 1Z1DA 1XMKA 3FMRA 1FZPB 3E97A 2FF4A 3L1PA 3WTYC 4Z2YA 4F3QA 3S16J 4CYCB 2W84A 3CC2I 3K70C 2OF7A 2D1HA 3ZQ7A 3HPHA 3EUKL 1I1SA 2MSYA 2GA1A 3U2RA 2VN2A 4CCJA 5E3MA 4LK1F 3HXLA 4AVPA 5KK1A 2JSCA 2KIUA 1VQOI 1TT5B 2Y9ZA 3CC7I 2X1EA 1V55H 3DPLC 1OQYA 1MBHA 1BOBA 2X6YA 1FEXA 1RUOA 3TDZC 3CLQA 5KAFC 1FOWA 4UVBA 2JA6J 5L3EA 1A6QA 1JT0A 2R7VA 1W5SA 1RRJA 2PBIA 3HTUA 1S7AA 1K4TA 5K5OA 1SAXA 1VQ8I 1WKMA 3R6SA 4K2EA 3RJPA 3FM3A 5CVIA 2JT1A 3J80K 1YO5C 1JJ6C 4BE2A 2OJED 1HQCA 3O6BB 3HOXJ 3T0YA 3ELKA 3FDYA 3A02A 4HQEA 2IBDA 3VODA 1XSDA 3LWFA 1H9GA 2P5KA 4WXHA 2EZIA 1YS6A 2AO9A 3S32A 2K9QA 2N8GA 4J01A 1WZ2A 4Y33A 4ZDOA 4BU2A 3EYIA 2NOJB 1I27A 3CLOA 2C6YA 2JVHA 1IF1A 2M87A 1JI8A 1YJWI 2HU9A 3BG3A 4BQOA 3VSLA 3BC8A 5A2QZ 1W36C 4E7SA 3HRSA 2BHYA 4GYIA 2DMPA 2HDDA 3QQAA 2GBYA 1G3SA 2OD5A 4UB6C 2DYRH 2ZXHA 5EDNA 1FOXA 2MLKA 1LE8A 3K69A 3HKZN 4PDKA 1ZRFA 4IF4A 1XCVA 3D5LA 5IP7J 1YFHA 2WV0A 5J1UA 1VQ9I 1RZ4A 2RREA 2H94A 3ZP5A 5J1RA 2V9KA 3I64A 2ZXIA 2HZDA 1MBFA 5H6RA 2AXLA 4A69C 2WAEA 2UUZA 4HLXA 1IXSB 1EH7A 4IRIA 2CRGA 4E7ZA 5JHFA 2DA3A 2UV1A 4NC7A 4E7HA 1N25A 3KP5A 5FFZA 1MSFC 1ZRDA 2DDBA 1LJ9A 1G4DA 1BJAA 3E6DA 4KNYA 3FX3A 2RVCA 4EM0B 3KEQA 3D1NI 2X6OA 1IDYA 5IOYA 2PG4A 5TGTA 3F6OA 2QM3A 3V8LA 4UUSB 4HX8A 3CUQA 3H36A 1UJ8A 5E1XA 4XN3A 2X51A 4IHWA 1T6SA 2ZKZA 2ID6A 5KNLA 1KU2A 2KQRA 5HDKA 2A6HF 4RMNA 1QA6A 3CJQB 1YLFA 3BR2A 3HOWJ 1APLC 4IVNA 3SZTA 2J5OA 4YIFA 5ICGA 5JLXA 4RBOA 3CESA 3KP7A 1BN5A 4XKCA 3L2WA 2EIKH 2L9RA 3O2PE 2VJ5A 2LMDA 2P6SA 4BJ5C 5EYRA 2ZXWH 2LSOA 2ZXJA 4KIBA 5FKOA 4RB2C 5GPCA 1R6RA 4I2OA 3V7RA 1B8IB 1IRXA 2LVSA 3A01A 4A3EJ 3ABTA 3CJRB 2PJRB 2B63J 5CPRB 3K2ZA 4MHGA 1XGSA 1C0WA 1YITI 2Y0SN 3U9GA 2NNNA 2G9WA 2P7CB 5J8CA 5BS6A 2DODA 1ZG1A 2M2EA 4XBFA 3TL4X 2L7FP 4YEJA 2ELHA 1J75A 2Q8KA 4BQNA 3KCCA 3RKYA 2W85A 1UCRA 5TJJA 1F1ZA 1ETVA 4OIOF 3LNQA 2ZC2A 1K78B 3SHFA 5HVQC 1AKHA 2EB7A 4CSWA 2BEOA 4OIPF 4H4KC 1L3LA 4AM3A 2P5VA 2OAZA 2E5ZA 2Z1DA 3WTWC 2JRMA 3IH4A 2YSRA 2CS3A 1KA8A 2HTJA 3O8HA 1W4MA 4ZYEA 4NB5A 4BAYA 4RB1A 4LG0B 1MDMA 5C4XJ 5LEJA 4WWCA 5F1RA 1J09A 2RNJA 3L2UA 1SVOA 2E2HJ 2HDCA 1IXCA 3NARA 4V2FA 1P92A 1XN7A 5DYMA 4M6VA 2Y48A 3M8JA 1FSEA 2CQNA 4HV6A 4XLHA 3BZ6A 1T0FA 4BQQA 3P9KA 3H1CA 2Z99A 1I39A 3K4LA 4DNCA 3JR9A 2ECBA 1O3SA 2I10A 1F9NA 2MBFA 4CCOA 5D5UB 1J59A 1H8AC 1QZYA 2BOLA 3SZGA 2FA5A 2K3FA 3I59B 4IHSA 1GHCA 1NK3P 5KVRA 5E8IA 2M5WA 3COAC 3NWTA 4ABZA 1D1AA 3IRQA 1ZN2A 2PMUA 4JP0A 3BR3A 3I58A 3K4MA 1RNLA 4ZYGA 1MH4A 2UXXA 2XAHA 2LREA 1T39A 2K02A 1V5FA 2GQQA 2HOEA 2MLGA 4NQWB 5F0HA 2K5CA 2DMQA 4PFOA 1HW1A 1I6XA 2IS4A 3ABKH 5CVVA 4O3MA 2QENA 3MAJA 2DK8A 3OYDA 4A5NA 3LA3A 5JVGF 5LGTA 1K7AA 1BI2A 4XLCA 2QLZA 1A36A 4RB0A 2O8KA 1ZTRA 3FBIB 1CQTA 4L0YB 5F0CA 3TDUC 3QYFA 5M3MJ 2F4MB 2W57A 3H9JA 3OYEA 1JE8A 2LD5A 1LKXA 1MKMA 2DJNA 1OCTC 3RCOA 3PIPF 3HOSA 2E1NA 3H5NA 3CJNA 1R22A 4OIQF 4E4HA 2DA2A 2LK2A 2F4IA 3K1MA 2IW5A 4HYEA 3ERED 2XPWA 1BC8C 4O5VA 5LHIA 4B4CA 4F93B 5LHGA 2H1LA 2E60A 5EZGA 4G9YA 2Z33A 4YFXF 1AU7A 5DS9A 1JT6A 1GLNA 2LRDA 4PJ0C 1TQPA 2PMZN 1GT0C 2XAJA 5CVJA 2E71A 3SEQA 2BVMA 5E1WA 4OOIA 4Q4ZF 4CUGA 3Q0VA 3KZZA 3OY9A 2BV6A 2OZUA 3WG7H 3K1PA 1Z7UA 2F5EA 4RM3A 3G3ZA 2XGEA 4BBRJ 2DOAA 1S72I 3CUOA 1JKPC 4IKFA 2DFFA 4OMYA 3A1YA 5JVTA 2HI3A 2O61A 1TNSA 4A3CJ 1HCRA 3LQRA 3T8TA 1E3PA 2X9DA 4GO1A 4EEFG 3W6VA 2L7KA 1H9TA 4HLYA 4U0YA 1U9NA 3GF2A 1F4KA 2MYSA 4U87A 2DTZA 3MKYB 2IP2A 2IT0A 3ABLH 2NVYJ 4II3A 5JLWA 1SD4A 3N4MA 1R5GA 2F5FA 4KITB 4G8XA 3ESWB 4Y3OA 3IKVA 4MNUA 5D4SA 3RPQA 4E7IA 4UUSA 2M8EA 3FM5A 3NQOA 2NVUB 3G2BA 5KCMA 3CCUI 2CQ7A 3BPVA 4RS8A 1LEBA 4PJNA 2X48A 1OCOH 4EMSA 2X0LA 2DTRA 4XSXF 3HZJA 2ESHA 1JKQC 1K6OA 2E35A 4I99C 3HOUJ 1Y6IA 4I76A 1U78A 5J40A 2HFHA 4ZTFA 1S29A 4I01A 1ENHA 2W1OA 3OL3A 3LSRA 2VE9A 3B02A 2M3AA 2V4JC 2EILH 1ZGAA 5EZHA 2IXSA 2TRTA 2EWNA 1TWCJ 1SAUA 3SQNA 1ERDA 5ILUA 2DW4A 3GXOA 1NG7A 5E18F 1YTYA 2LYCA 1KU3A 2CQQA 2VIXA 4I0AA 2ESNA 4PGGA 4KDPA 2ZBKA 2LOOA 3OYAA 2EZHA 4XRFA 1FWZA 2OQRA 3IWFA 5KHDA 2EFQA 3RPUD 5BQTA 3D5SC 4PFPA 3HRTA 3ZRGA 4DZPA 1SEUA 2GA2A 3DLLF 4BACA 2J5PA 3GFIA 2V1NA 4A3IJ 1SD7A 2KLOA 2EV0A 2IVMA 5HNHA 4RGUA 1REPC 4Z6YA 2Z2SB 2LY9A 2MH2A 3GMEA 4UUVA 2CH0A 2ZJQF 4PCQA 1J0RA 3AKZA 3WE2A 2CV2A 2DYSH 1QPMA 4XONA 2GXBA 2BZTA 2L3DA 4DIQA 1T2KA 1FX7A 2XV4S 5DM7F 3D5RC 4E7LA 5AIQA 1SD5A 3RKXA 1VQNI 2XAUA 2EJRA 4AIJA 1BJZA 1YW9A 3WHCA 4BXFA 1DP3A 3TGNA 5E3OA 1Y39A 4EATA 1HKQA 2DMTA 5IY5H 3ASNH 4LG0A 4XKVA 2NS7A 1X1CA 4AIDA 4CZZA 1HXDA 4KICA 4NDLA 1HDDC 1R00A 1BBYA 2HTSA 4NC8A 4BY7J 4PSXA 4D5FA 4LJZF 2EIMH 3GTLJ 2XF5A 2KJCA 1AWCA 2IS1A 1WPKA 1Y0UA 2DT7B 3KZYA 1TC3C 5BPIA 1K79A 1GVJA 3ROUA 3HL2A 1IN8A 5EGOA 1ETXA 3ONQA 1XGMA 5ILVA 2R0QC 4U0VA 1Z67A 2EPFA 2E1MC 4GYGA 3RDIA 3Q5FA 1D8JA 5FLXK 3KZIC 3E0JB 5GTHC 4WXDA 1W7PA 4CICA 1GXQA 3V42A 3V7CA 3OS0A 2Z5UA 1MD0A 3JRDA 3QPLA 4XORA 1ZARA 4UV8A 3EPZA 1G8XA 3GX4X 4HZFA 1NH3A 2IS6A 3CTAA 2IGOA 3DTIA 3C3WA 4YFKF 2X85A 2OA4A 1MNMC 2ELKA 2QSHX 1IV6A 4A6DA 1LE8B 1Q1VA 5GAGJ 2DCEA 1JGGA 1RKTA 4IX7A 4ENNA 4BGDA 2A68F 1QU3A 4GRIA 3L2VA 1GUUA 2O03A 2O8XA 2E36A 2LFBA 2MD0A 3OSFA 1BL0A 1YX3A 1ZQ3P 1T8IA 1R5HA 1BC7C 1IXRC 3IL2A 1X1DA 3BPXA 1R23A 3HKZA 3RIRA 4LOCA 4HDUA 4A12A 2AQFA 2M45A 3KYDB 1JTXA 4JOMA 1D8KA 1Z3XA 4L9VA 3L2RA 1P4AA 2X1DA 2ZNYA 2HQAA 3PJRA 2DK5A 1KZHA 1ETQA 2CUFA 3GBGA 2RQPA 3RYPA 1Z05A 3ERMA 5FKMA 1XDSA 1TBXA 2V6EA 2EH3A 1BW5A 3ECHA 4AWXB 2QQAA 1IN4A 5B66C 5ICFA 4XQFA 3PM1A 3ML6A 5EEAA 2EBIA 3CUQB 5CJ9A 1MH3A 4X6AJ 2O6GE 4HSTA 2LH9A 5D5VB 5TISC 1KQ8A 1JHFA 3R0AA 3TO6A 4C9YA 1SD6A 1OLTA 1SVMA 2HYJA 2VQCA 4L9JA 1W0UA 1JJ8C 2QBYA 4Y52J 1IDZA 1RPWA 2XB5A 3W2AA 1S7EA 4B1RA 4A3LJ 2W00A 2HOTA 2NS8A 5HS9A 1T56A 2JWTA 2DA1A 2A6EF 4UUTA 4L5EA 2A5WA 1LQ1A 5JHUA 3PO3J 1FBUA 4P9UA 1V4RA 4J00A 2ISZA 1E3OC 4HBLA 2R7TA 4P9FA 3HOYJ 5EJCA 5F6FA 2VLAA 2JMWA 3FXLA 2CUJA 4XNFA 2VKHA 3A01B 3HJEA 3R60A 1BIAA 3S8PA 2VODA 3LA2A 4PGHA 2UWMA 3BQZA 3JRIA 5AONA 2KT0A 3BG6A 3WGGA 1OFCX 2F5CA 3F3XA 5F04A 4CCNA 1YW7A 1O4XA 2RKHA 2XUBA 4IEJA 1X4OA 3OYKA 4IHXA 3DPUA 1IO2A 4KT5C 1OJLA 4A6EA 4N4NB 2HXIA 3PQKA 3GEZA 5C44J 2B0LA 1EJ9A 3NEUA 4D5CA 2A3SA 2NNYA 2JZYA 3AG2H 4KIFA 1K61A 3IHUA 3IKTA 2Y0SA 4KJZA 3HEFA 3L9FA 3QU3A 2BY3A 3SEZA 3S3OA 1IV8A 1DGRM 3M8EA 3FISA 4HSRA 1UZCA 3LSJA 3OYHA 2RN7A 3KE2A 3RPUA 1NK2P 5L3GA 1W0TA 2PLYA 3TQNA 3I5UA 2OUMA 2VI6A 1V54H 3DBHB 1MGTA 1VQPI 3RQ4A 3KIOA 1GDTA 2I8DA 2JSPA 4GXOA 3HGYA 4AIHA 2O5RA 2VQGA 3JCUC 1R49A 3AG4H 1MDMB 2LTPA 1R9TJ 1JKOC 3GZNB 4BKXA 4CCLA 5GTIC 2K7LA 2QQBA 1OYIA 1MJAA 2Q0OA 2M1BA 2L01A 5FD6A 2TDXA 1ZAOA 3ZCOA 3ZOBA 4XLFA 2EA4A 3BCAA 1PP7U 3WU2C 1QZZA 5ERIA 1V3FA 3KP4A 1SC7A 4B8XA 1RC9A 4HV5A 5D6EA 3HOZJ 4LIUA 1ITYA 3H3UA 3CC4I 4HQMA 3M07A 1SMTA 4IQ4A 1FLIA 3EETA 2R7QA 2BW3A 2JK3A 3C7JA 3H5AA 5GADJ 5FJ8J 4I6ZA 4HX7A 4WXCA 2XKOA 3U1KA 2XPUA 3K4CA 4G6DA 2V79A 3FHZA 1E2XA 1ZRCA 2ZNZA 4DQ2A 3G73A 3PO2J 2DI3A 1VTNC 2JA5J 4OIRF 3IWZA 2WY8Q 4JBAA 3E3VA 4Y17A 2R7DA 2W82A 2HDWA 3G71I 4GDFA 4KIGA 2CUEA 4BJTA 2DA4A 3LSIA 1QVUA 5ICCA 3R0JA 4OAZA 1MW7A 1XC5A 2CQXA 1JGSA 3VOEA 3FKIJ 3PNTA 1ACIA 3RKWA 2RNGA 2CW8A 3QP6A 4OAYA 2DT6A 1FT9A 4ON0A 2V26A 3VYRB 2CSOA 3AFHA 4D1QA 3QYBA 1KU7A 1B1BA 3BR5A 1LEAA 3I56I 3PL8A 4HNTA 3C2GA 4ENKA 2FOWA 3F8CA 2CUZA 3JRBA 4EM2A 2K9NA 4FCYA 1R1UA 4XM3A 1USTA 4RGSA 4ESJA 4A3GJ 2PJPA 4QPQA 2BY0A 3TMOA 4W97A 3I54A 3MZYA 3K4NA 1VQMI 4NC6A 1SFXA 2LKXA 3S17J 3JRCA 4M9SA 4E70A 4MEXF 2OCEA 2H09A 5M5WJ 1CF7A 4HX4A 3HSFA 3P9IA 4LK0F 2E1MB 3CMAI 4OMZA 5J4VA 1NTCA 3X2QH 3ZQFA 1HBXG 2PMZA 3OWTA 4XLEA 4F55A 3ZQGA 2D45A 2QKMB 1EF4A 5FRMA 4FTHA 4FX4A 3DF8A 5M3FJ 5BMZA 2XKPA 5FKNA 3TO7A 4A3FJ 3HSEA 3FK7A 1QBJA 1X1AA 1ETYA 2KZVA 1D1BA 2E1CA 5H6QA 1HF0A 3GTPJ 4BL0B 1P2FA 5HNFA 2Y30A 3S1RJ 3S14J 3CMEI 2R7SA 2E7WA 3M1EA 4QLCU 1E17A 2Z3YA 5FRNA 2K40A 1JUSA 3GYHX 2M4GA 3GFMA 1FY7A 2BHZA 5D5XB 3TKYA 5B1AH 1MZBA 3BOQA 4XMYA 3CCVI 2MG4A 1P4XA 3O3KA 2D2WA 3LA7A 4YELA 1X3UA 4PJLA 3C1DA 1J7KA 2HNHA 1TQMA 3SYTA 3GZ6A 3HHHA 2XGCA 4XLPF 3VWBA 1ETKA 2XSJC 5GAHJ 1FOYA 2K9SA 4NUBA 3BTLA 3DKXA 1Q1HA 1UG0A 4G7HF 2AS5F 5BOXA 3KYLA 5IP9J 3ZMDA 2A5YB 5FD5A 3ZQQA 2OCCH 2X1CA 2X4HA 2KDOA 3H9QA 3VB2A 2GM4A 1KGSA 4AD9A 2O3FA 5D6FA 1GVDA 4ZDLA 3ZN0A 3CO7C 4HG2A 3LSPA 1YX5A 1ODDA 1S8NA 2KIQA 1WFXA 3PUBA 2HEOA 2KZGA 5LBQA 3FF5A 1G3YA 2BGCA 4Y4RA 1QPIA 2DN0A 3BP8A 3HSRA 3MD2A 2XGDA 1HA8A 3WGIA 2A05A 4M6YA 3LFUA 2XIGA 2A6TA 2OZ6A 1FYKA 1U5TA 2Z9OA 4UY8I 3DPTA 2L5QA 4C3IJ 1X3ZB 1BM9A 1D0ZA 2JPCA 5D5WB 4ETSA 1BR1A 2XC7A 2CW7A 2V7FA 1X4PA 1FOKA 3R61A 3NWSA 4M3BA 5E20A 3JW4A 1OYWA 5K1YA 2VQHA 1S7OA 1FC3A 2CMPA 3OYBA 3JREA 2JTVA 2CJJA 5IT9Z 5B1BH 1YIOA 1YIJI 3IRRA 5DEQA 3VYTB 1A35A 2ELJA 4ANJA 3FIWA 1XS9A 2XHKA 5FROA 2O7OA 4L0ZB 1A6IA 3E5XA 1G2HA 2RQQA 3MCZA 3W6KB 1Y1VJ 1Y8RB 1FJLA 2OPTA 3DU5A 2JA7J 2EFPA 1RUNA 5EGOB 1BIBA 5E3NA 2DLLA 1BI1A 4C2MJ 2VKEA 3CO6C 1V5EA 5FO5A 4LLLA 4ZJZA 3K7AJ 2JA8J 2QCOA 3K4JA 2K86A 4P55A 4MFDA 2X6WA 1POGA 2LKPA 2HZTA 4UXNA 1W7PB 2HYFA 4AC0A 1P4WA 2Q1ZB 3IAS2 4JX4A 4HW0A 3V4GA 2QYOA 1K83J 3PNYA 1W7PD 1UB9A 4KN7X 4XR6A 2R93J 2L9SA 2MC3A 3KX2A 4UVAA 2PQ8A 3LSKA 3F21A 3LMMA 4JQFA 3MEXA 3Q9VA 1QGPA 2Y2ZA 3BDDA 3L09A 2HPIA 3OOPA 4O6JA 2LBFA 2VL8A 2B9SA 1P9QC 1O7LA 3K70D 1LPQA 4LB6B 3CCQI 1I3AA 4G7OF 1FP2A 5B3SH 1QZEA 1HDPA 2Y9YA 4XLAA 2O0YA 1G6NA 3WHBA 2F4OB 1WVRA 3ZQIA 1X1BA 1MMAA 2ZCWA 2ID3A 4Y15A 1WJFA 2M34A 2GXGA 1HKSA 1M1EB 2YU9J 5J3LA 4FE4A 2MABA 5A2QK 1OCCH 4OINF 1ZREA 2VT2A 3R4KA 4E7JA 1EH6A 2MH9A 3G1MA 2BXZA 3OIQA 2IGMA 2HVRA 4ZDPA 2Q2EB 3ZR8X 4X0GA 1IJWC 3I4PA 1Y0NA 2CQKA 2M9HA 3S15J 3OS2A 1F5TA 3T5XA 4EM1A 2BY2A 4II2A 4ENJA 3GUDA 1VI0A 1ZHFA 3RTRA 4ZZDA 4BE1A 3J7ZI 3GTMJ 5FLMJ 3IP4B 2PI0A 3AL0C 2HPMA 1Y56A 1R71A 1DPUA 1J5YA 2EZKA 5DCMA 3OOUA 4WF2A 2QBYB 1I5ZA 1MMGA 1MNEA 2WADA 1EH8A 2EA2A 3M9AA 4DBQA 5CKTA 4NHJA 2R7UA 3FK6A 4XOPA 4G94A 2WAQN 5E1ZB 2HOAA 1W36D 1XMAA 3BCBA 3E6BA 2CV0A 2DA5A 3J81Z 3ISPA 1W5TA 1D3YA 1U5TC 2M7AA 2UZKA 2VQLA 2PN6A 5EG0A 2EZLA 1YOVB 3LFKA 3CQZJ 2LNBA 2FUG2 2JRTA 1I50J 5F0FA 3FXMA 3V8KA 3I55I 3WTSC 2I5UA 3CDLA 4HA8A 4AUXA 2LC2A 1HOMA 2VE8A 2R7FA 2VBWA 3WTZA 4L9TA 2FMLA 2LF8A 4HF2A 2W7NA 5GPAA 2XF7A 3K0LA 1MBJA 2YX4A 4HDVA 2HKXA 4B44A 4L5JA 4ZH4F 4BHPA 2HVQA 2ICWG 1T98A 1FYMA 3JTGA 4PZJA 2DAOA 3CP2A 4DOZA 3QOEA 4EJVA 5FKLA 1N78A 1A04A 2NS0A 3BG5A 4M3DA 2F2EA 4ZYHA 4XKBA 4FASD 1IRZA 2Z16A 2IGKA 3GZ5A 1TWHJ 3CCYA 2NXNB 4A5MA 2KMUA 3S93A 1LFUP 4IOCF 3L2CA 1KQ0A 5ED4A 3RYRA 4AVZA 4BJ6C 1Z7LA 2A61A 4BEHA 3T8RA 4I02A 4KA4A 2FJ1A 4M3EA 2KRFA 3KEOA 2FBIA 5LHHA 1QRYA 2L4AA 2ZFWA 5DDGA 3CDIA 2QA4I 1K6YA 3ABMH 1TWFJ 3JRGA 2VONA 1D0XA 1T33A 1Z6TA 1Z9CA 1B59A 2MW8A 3J7YJ 1CGPA 2JN6A 1R58A 3E5UA 1IC8A 1IW7F 5IOZA 1BA5A 1XGOA 4CXFA 9ANTA 1ZGJA 5HLHA 3W2WA 2BW3B 3HIFA 4FX0A 3BZKA 5CQEA 1TWAJ 2CU7A 3PSFA 3CCMI 1PUFA 4CHUA 4B47A 1E0EA 4YG2F 2Y0MA 3HRUA 5H2FC 1N75A 1WJAA 1PP8F 3K10A 2ZJ2A 4MQ9F 4I0BA 2VXZA 1TNTA 5EEHA 3H3ZA 3SJMA 2LLKA 4RGRA 1HSTA 1YYVA 4ZTJA 3JAMK 2D5VA 3J7AY 3ZMTA 3QP5A 1YJNI 1JUMA 1XCBA 2DOFA 3WG9A 1MSEC 2IS2A 3DFGA 3SDGA 4B09A 2JUCA 4C2UA 1XPXA 4IZZA 1U3EM 3OYJA 1VNDA 3S1QJ 2ZMEA 3KLOA 1XX5A 3SFZA 3J80Z 3AAFA 4V2GA 4BXUA 2L02A 3O8GA 2GXAA 1DDNA 2R3SA 3JRHA 2VUMJ 1Z3YA 4R79A 3CJTB 2WV1A 4N4OB 3TEDA 1WJCA 1X1PA 4I7HA 2EINH 2ME0A 2W48A 4NBQA 3VEPA 2CFXA 2ZSHB 3S2WA 2E2IJ 2XB0X 4RA2A 2YPRA 2DO7A 4BHCA 2R5ZB 4HNVA 2HVSA 1UHWA 4B3AA 1QQIA 2K9LA 2EFWA 3I4NJ 4I98B 3JRAA 3HM5A 2K85A 3OMYA 1EA3A 2DT5A 4XIDA 2P4WA 2XDVA 2QSGX 4E6KG 4C2TA 4NNJA 1YS7A 1O3TA 2GZWA 4R1HA 4BNCA 3FBNB 1WJ5A 3E7LA 2RDPA 3OYIA 1CF7B 5E79C 5K7ZA 3E6CC 1HKTA 3KEYA 1N77A 4GCVA 1T38A 1D1CA 4DYCA 4EJOA 2DQLA 3V7SA 2EK5A 1X3WB 2BVLA 2NYXA 2FQ3A 5K7HA 4LLNA 4PUSA 2RGVA 5HS7A 4P1WA 2GAUA 4D7MA 2Q2EA 4ZC3A 2VOOA 2KDZA 5E17F 1B72A 1QVTA 3KETA 2VKVA 2R7RA 4KUMA 2F5VA 3WTUC 5C4JJ 3QPTA 4TV7A 2KRCA 1QO0D 2DOEA 2VASA 2STWA 3IH3A 4RDUA 4Q47A 2K4BA 1KQ9A 3DLAA 5BPDA 5L3CA 3PFIA 3FXOA 3HPGA 2AHQA 3TO9A 1FBSA 3Q0UA 3HBLA 3S2DJ 5DM6F 3FXKA 5D8KB 2JVGA 3HGGA 4BH9A 1HSJA 5IYDJ 1MIJA 2OC6A 3WU0A 4BBSJ 2FQ4A 4U7DA 3TP0A 1ZK8A 3MKZA 2MC4A 3HTSB 1IRFA 1WJDA 3ZMVA 2FNAA 5HLGA 4KMUX 3ZQLA 3F22A 4XICA 2L9NA 3A4CA 5JFRA 1UHSA 3WODF 4DGWB 3H35A 1JTYA 3I71A 1SANA 3BR6A 3ZGKA 2VJIA 3OIPA 4F7ZA 2NVTJ 2IJLA 1XTAA 3CMYA 1Y1WJ 1H0MA 2CW0F 2XRLA 3Q9SA 3BWGA 2IGNA 4MFEA 3DKYA 1WHUA 3F9KA 3AL0B 3EUHC 2W4SA 1YJ9I 1MJBA 3DTKA 4KISA 1O7FA 2DPUA 2M7BA 3SXYA 2EIJH 2QKLB 4ENMA 1UG2A 3ASOH 3MKLA 1MMDA 4DW6A 3M3YJ 3GTOJ 1TL8A 2GIVA 4WCGA 1U8BA 2IEKA 2KFDA 2XAFA 2OBPA 2LDUA 1U5TB 2ZMEC 2FXAA 4HEA2 4F52A 1YRNA 1BW6A 3I4MJ 3BZCA 4UHTA 2W24A 3OSGA 4CGZA 1YE9A 1MMSA 5K5QA 2H27A 1YHQI 4RLFA 4MTEA 2A07F 3KP6A 2L0KA 3FXUA 3D0SA 4PJJA 3DP7A 2A69F 3TBIA 1SFOJ 4MO7A 2RC4A 1G59A 3PQJA 5CQGA 3G4SI 1YW8A 1I6HJ 2DQRA 5D8LB 4XL9A 5HLTA 1P7JA 1FBQA 3A2KA 1RIOH 2YS9A 2PEXA 2WTEA 2ZO4A 3Q0WA 3S1MJ 2VOPA 4AYBN 3FXRA 1WSUA 4Q48A 1KYZA 1MMNA 3GO5A 1YG2A 4BS9A 3I53A 3CCLI 3N05A 4XSZF 3G1OA 1QHGA 1RESA 1D0YA 3PFYA 3TOBA 3VFZA 1VQ4I 5DV5A 4D0PA 2ME6A 4BYYA 5EEGA 2FMYA 1BI0A 2K4JA 1R7JA 4LG3A 1XMXA 2WB1N 4PSWA 3GLLA 1UMQA 3TW6A 3ZMUA 2LBFB 2F48A 1AOYA 2XPVA 1TQIA 3ZMSA 3DTEA 4EVIA 1IN7A 3QAHA 1S6LA 4P96A 1XGNA 1B9NA 5AIPA 3FXQA 5K5RA 3B73A 1PVEA 2P8TA 1VZ0A 5JI6A 3I9V2 4RM2A 1UFMA 4A0ZA 2ZJPF 4LB5A 2PX9A 4FETA 2MFZA 4IRHA 2P6TA 3E6MA 1ZKGA 4CA0A 3SDBA 2R5ZA 1HW5A 1IUFA 2XASA 5DD8A 1EKEA 2CGPA 2DBBA 1O57A 3GWZA 4EV0A 1RR7A 5HDNA 4IO9F 4A0YA 1IZ1A 2DMUA 2H6CA 3DV8A 2IA0A 1OR7C 2BY1A 2COBA 2OV7A 2YR2A 3IH2A 2E34A 4HPQA 2GIZA 2VB6A 1LDDA 1VQKI 5CVUA 3L00A 5DCMB 3FHNA 5EF6A 4LITA 1U0JA 4G12A 2DA6A 2ZB9A 4ESBA 3HRMA 5J1YA 2HWVA 3P7NA 3LAPA 3BG9A 3HYIA 3VPRA 2L54A 3W3CA 1SFUA 1JKRC 2P0WA 1T95A 4DYRA 3LAJA 5J4YA 4YIIA 1Z6RA 4BQAA 3GCMA 1L0OC 1P7IA 2W25A 1XSXA 3L2QA 1LDJA 1WGXA 2YU3A 3BTCA 5EG0B 2KIMA 3OYNA 2FRHA 4G6QA 2XAGA 4ZYAA 1V5GA 3G6EI 1T08B 3W2VA 4PJMA 1A5JA 1FIAA 5LRRA 2WAQA 1J9IA 2KRHA 4QWQA 5JR3A 2H1KA 4A3MJ 1IRGA 1OMIA 3S1NJ 3PNVA 2XRNA 2JJ7A 1KONA 5H20A 2F6CA 3BT9A 3HHGA 1E3HA 2Y31A 1PYVA 3AG1H 5HDGA 2ADUA 1OPCA 1SVLA 3FKJA 2XSDC 3DQVC 1GV2A 1XD7A 2V9PA 2ECCA 3CMMA 3CP8A 5ICEA 1DUXC 1ETWA 3BJ6A 3BY6A 1I1GA 4DJAA 3BR1A 3T1BA 2JQ7A 4C30A 5IP6A 2TCTA 2HYGD 4EGZA 1FTZA 4QPOA 4I09A 4WX9A 1DQUA 4BDYA 2FNPA 2Y75A 1TTYA 1OISA 1TWGJ 4DZJA 4V19K 1ZR4A 3GFLA 1KU9A 4MIMA 5LRSA 2P5LC 4QIWN 2DXIA 4UB8C 3UKGA 1ZELA 4BEHB 3KP2A 4CDGA 2VPLA 2HGCA 3QPHA 2DFHA 2KP6A 1OYYA 1K4SA 5CVRA 4LGWA 3TW7A 2L4MA 2PMHA 4FHTA 3S2HJ 1WCMJ 1SFKA 2HKOA 4IHVA 4A3JJ 2ZFUA 3DEUA 3FMQA 3Q3SA 4L9NA 1U2WA 3BLYA 2KL4A 3F8BA 2EQRA 1RETA 3DCFA 5LD2C 3BTIA 3SFIA 3QOPA 3ECOA 2K27A 4ITVA 1ZLJA 3QYEA 1IG7A 1ON2A 3QWLA 2M0MA 1PUFB 4A93J 1S5LC 1DU0A 2VKDA 4U0WA 2IRFG 2FE3A 3HUGA 5BNGA 2QQ8A 3FXJA 1R4MB 3H9GA 4L18B 2NRAC 1YQAA 5FLVA 3ZN1A 2KKOA 3LSTA 3OIOA 2QF7A 4YFNF 1SMYF 4XOTA 2EFOA 2ZJRF 3CCJI 2QEXI 1BI3A 1LUJB 4HRIA 3QPSA 2F5DA 2KIFA 5K7FA 4CYCA 2E1OA 2ZMEB 5DCFA 3OYLA 4KMFA 4IQJA 3HOVJ 4GFBA 2HR3A 3WTVC 4BE0A 3GFJA 3LL7A 5F1JA 3JAMZ 3WGHA 2AQEA 2EV6A 2FOKA 3I0TA 4AU7A 2L7MP 2CV1A 1VQ5I 5LLQA 3HG9A 1IGNA 4BDZA 2DU9A 1U8RA 3A0HC 5E3LA 4Q5SF 3B6CA 2RV8A 2DPDA 4JX6A 2FSWA 2ZSIB 4XLNF 1HW2A 5FLXZ 2HXOA 2IA1A 3LOCA 5HODA 4YIRX 3UR3C 4MTDA 3M1CA 4R8HA 3H0GJ 1LFBA 2B7EA 3HOTA 2ACJA 1MNDA 3K9TA 2FU4A 2BYVE 1IAWA 3MZHA 3EYYA 4LLGF 2L9VA 1OCRH 3J7AO 4U88A 1ZG3A 3MKWB 3JRFA 3F8NA 4L5IA 1WJBA 2LR8A 1MJ9A 2M0CA 3C2BA 4ESFA 4D9JA 2JA2A 1J2XA 1NG6A 3ULQB 3M4OJ 5E8GA 3K2AA 3S3NA 2JPBA 3KFWX 1TLHB 2QZ8A 3DKWA 3EDPA 3CUQC 4GGGA 3PIOF 2VJ4A 3BG7A 2LP0A 4Y13A 3G1LA 2VT3A 5LGUA 4H0EA 1B72B 1D5YA 5D4RA 1XSVA 4RAFA 1R1TA 4F91B 2QSFX 1YI2I 2BE5F 2VJJA 4XRSG 1TW2A 3I3LA 4M74A 4E7KA 2YX7A 1R1VA 3OV8A 4BUPA 2GOMA 3HC7A 1ZR2A 1OCZH 2P7VB 4X1EA 5J47A 1UAAA 3QODA 4KT6A 5HLIA 1F36A 2OTLI 1SFEA 2G7HA 5FFXA 3H5RA 4A3BJ 1JXSA 3AG3H 1DP7P 4P5OA 2WA0A 3F23A 4EGYA 3MQ0A 3IAM2 4RGXA 2H8RA 3F8FA 4U7BA 1OCPA 3ZQCA 1HC8A 1Z91A 1FYLA 3H0DA 3KLNA 1FTTA 3CCSI 2XAQA 3MWMA 2EFNA 4YRVA 4ZYDA 1PDNC 2H6BA 3KP3A 3WTXC 1WI3A 4EQQA 1LFPA 2WAFA 1R36A 3VDXA 2QQ9A 1ZGWA 1QHHD 2JUGA 4M3FA 1MBKA 2BBYA 2STTA 2X6XA 4KN4X 4WK8F 2NOGA 4D7NA 1G3WA 3U1DA 3ZXSA 4BXXJ 6PAXA 2VBYA 4Y7NJ 1GXPA 2FBKA 2KISA 1Z21A 4S04A 3ZMZA 3RKQA 3TP3A 3CD6I 2OU2A 2VBXA 1JUPA 3CDHA 3LSHA 4MQVA 1YRNB 5GAEJ 4MGRA 2E19A 2HS5A 3HDDA 4QSHA 3GTKJ 4KFCA 2CO5A 4RAGA 3NAUA 1LDKB 1OKRA 1T0FC 1X58A 1XB4A 1ETOA 2LG4A 2UXNA 4M3GA 4S0HB 3FZVA 1VQ6I 2IPQX 2M4KA 3K4BA 4QTRA 3CCEI 2HOSA 2LF7A 4CZCA 1TW3A 5C3EJ 1RR8C 5IYCJ 5DUIA 3L7WA 2ETHA 1TP4A 4AIKA 1B8IA 2AXTC 2R5YB 3CZ6A 3K6GA 4LFUA 4J19A 1ZG5A 2PJRA 5L3DA 2E7XA 4MEYF 3H3VK 4N9IA 2CWEA 2G7UA 2RAEA 1GV5A 1P6RA 4RAYA 5J8FA 4CCMA 4PK4A 3BQYA 4IL6C 4JX5A 4UVCA 1AHDP 2QGUA 2XVCA 3GW2A 3BJAA 2KJBA 1QNTA 4B43A 1BR4A 2DMNA 3FMSA 4DBRA 4HNUA 1ULYA 3OYCA 4RAZA 3DBLB 1WH5A 4G7ZF 3IC7A 1WH7A 4FISA 4FQGA 2QWWA 1B9MA 3ABUA 2MA3A 1O3QA 2E2JJ 4XN0A 2V1UA 1X19A 1ORKA 1RI7A 5DD4A 4IHTA 3EUHA 1DU6A 3UNGC 2E5NA 2FBHA 1K78A 2DDAA 4AYBA 1UHMA 3W6JB 3LSMA 5TRDA 3SZPA 5IT9K 4CH7A 1X2MA 4A2UA 1TT0A 4XRMA 3F0CA 2HQ5A 2ISYA 5M5YJ 2R7OA 3RZOJ 4DYQA 2R4GA 1ZH5A 2OQGA 1XDUA 1IN6A 4B3XA 1W1WE 2K9MA 3OR2C 3H92A 3C2HA 5IT3A 5F64A 5DUKA 3S3MA 1A31A 2XGXA 2HQRA 4BY1J 2VXDA 4EJWA 1ZLKA 4HF1A 4M71A 3KPHA 3WTTC 2WB1A 3RI4A 1EV7A 1FPQA 4M9ZA 1H89C 1VFCA 2QUFA 5FKKA 1FNNA 2D1VA 3I59A 3GLXA 3DWLE 2L7ZA 4UV9A 2PFBA 3WU1B 4IRGA 2FX0A 2H8WA 4FE7A 1FSHA 1VF9A 2OTJI 3E5QA 2R7XA 1RKWA 1JHHA 1BOAA 5HOOA 2BXYA 3GTQJ 1DPRA 4N0BA 2O9LA 1FMWA 1D5VA 2R7WA 3BROA 3DEWA 1R4NB 3C18A 4IPAA 1H88C 2WC2A 3WE3A 3JTHA 4IHYA 2NVQJ 5M5XJ 4NQWA 5IYBJ 3OYMA 3QU6A 1B6AA 2K3PA 4G6TB 2NAZA 2MD5A 2V9VA 5B5EC 4S05A 3QRFF 2FEZA 2KPMA 2VC0A 2KHMA 3A03A 3KYCB 3EUAA 1WJEA 2LY2A 3VSKA 1LB2A 4LIVA 4M6XA 1KYWA 3VYSB 3HB9A 3N97A 4HAMA 1DGWY 2MGQA 1FIPA 3BR0A 1AA7A 2YUSA 4HF0A 1S3JA 2CFOA 1BR2A 3LSGA 1WI9A 2XF6A 4CCKA 2EV5A 4BHBA 1G3TA 4RLQA 2DA7A 3DBRB 1VQ7I 2L2OA 5KAIC 5L3BA 2VPRA 1FMVA 2VBZA 3BTJA 3RSNA 1Z0XA 3E1SA 3MVPA 2R7ZJ 2V1DA 1U9OA 3OR1C 1WQ2A 3GVAA 1ONVA 3U21A 3CCRI 4M73A 4IOAF 1IUYA 2GWRA 3GTJJ
chains in the Genus database with same CATH topology
5HS8A 3F72A 4CYDA 4ZZLA 5FB2A 4EJTA 3BJOA 1USSA 1WWXA 4LMYA 3F6VA 3M7GA 2XROA 4IJAA 3NRVA 1NHAA 3K1NA 3P9CA 2M30A 4FT8A 2IA2A 5ILSA 3ZPLA 3J81K 4KYWA 4N9HA 4M72A 4OU0A 1OR7A 3JSPA 5LGNA 4RB3C 5FGMA 2CG4A 1B4AA 2HQNA 1WRJA 1STZA 4M9XA 5LEKA 1IN5A 3TOAA 3EQLF 4IXAA 1FP1D 1ZYRF 4LD5A 2WWYA 3REOA 1LVAA 1O3RA 3DXJF 5CLSA 3M8FA 4HOBA 3MFKA 1U6GA 1LNWA 3LQQA 5J6XA 4EJUA 2VC1A 2CYYA 2V1XA 3FWEA 3JSOA 4JK1X 2DFIA 5CYVA 1ON1A 4A0XA 4UNOA 3V8JA 2COMA 5L3FA 1PUEE 2QVOA 4ASNA 3F8MA 2V6CA 4CO8A 1Z1DA 1XMKA 3FMRA 1FZPB 3E97A 2FF4A 3WTYC 4Z2YA 2W84A 2D1HA 3ZQ7A 1I1SA 3U2RA 2GA1A 2VN2A 4LK1F 4AVPA 5KK1A 2JSCA 2KIUA 3DPLC 1RUOA 3TDZC 4UVBA 5L3EA 1W5SA 2PBIA 3HTUA 1S7AA 5K5OA 1SAXA 1WKMA 3R6SA 4K2EA 3RJPA 3FM3A 5CVIA 2JT1A 3J80K 1YO5C 1HQCA 3O6BB 3T0YA 3ELKA 4HQEA 3VODA 1XSDA 3LWFA 1H9GA 2P5KA 4WXHA 1YS6A 3EYIA 1I27A 3CLOA 2C6YA 1IF1A 2M87A 5A2QZ 3HRSA 4GYIA 1G3SA 2OD5A 2MLKA 3K69A 4PDKA 1ZRFA 4IF4A 1XCVA 3D5LA 1YFHA 2WV0A 1RZ4A 2H94A 3ZP5A 3I64A 5H6RA 2AXLA 4HLXA 1IXSB 1EH7A 4IRIA 3KP5A 5FFZA 1ZRDA 1LJ9A 1G4DA 1BJAA 3E6DA 4KNYA 3FX3A 2RVCA 4EM0B 3KEQA 2PG4A 3F6OA 2QM3A 3V8LA 4HX8A 3CUQA 5E1XA 1T6SA 2ZKZA 1KU2A 5HDKA 2A6HF 1YLFA 4IVNA 3SZTA 2J5OA 4YIFA 5ICGA 3KP7A 1BN5A 3O2PE 2P6SA 2LSOA 2ZXJA 4KIBA 4RB2C 4I2OA 3V7RA 3ABTA 3K2ZA 4MHGA 1XGSA 1C0WA 3U9GA 2NNNA 2G9WA 2P7CB 5J8CA 5BS6A 1ZG1A 4XBFA 2ELHA 1J75A 2Q8KA 3KCCA 3RKYA 2W85A 1UCRA 5TJJA 1F1ZA 4OIOF 1K78B 3SHFA 5HVQC 2EB7A 2BEOA 4OIPF 1L3LA 2P5VA 2OAZA 3WTWC 2YSRA 1KA8A 2HTJA 1W4MA 4ZYEA 4NB5A 4BAYA 4RB1A 4LG0B 1MDMA 5LEJA 4WWCA 5F1RA 2RNJA 2HDCA 1IXCA 1P92A 1XN7A 5DYMA 2Y48A 1FSEA 4HV6A 3BZ6A 1T0FA 3P9KA 2Z99A 4DNCA 1O3SA 1F9NA 2MBFA 1J59A 5D5UB 1QZYA 2FA5A 4IHSA 3I59B 1GHCA 5KVRA 5E8IA 2M5WA 3COAC 3IRQA 1ZN2A 2PMUA 3I58A 1RNLA 4ZYGA 1T39A 2UXXA 2XAHA 2K02A 2GQQA 2HOEA 2MLGA 1HW1A 1I6XA 5CVVA 4O3MA 2QENA 3MAJA 2DK8A 4A5NA 3LA3A 5LGTA 1K7AA 1BI2A 2QLZA 4RB0A 4L0YB 3TDUC 2W57A 1JE8A 1MKMA 3HOSA 2E1NA 3CJNA 1R22A 4OIQF 3K1MA 3ERED 4HYEA 2IW5A 1BC8C 4O5VA 5LHIA 5LHGA 2Z33A 4G9YA 4YFXF 1TQPA 2XAJA 5CVJA 5E1WA 4OOIA 4Q4ZF 3KZZA 2BV6A 2OZUA 3K1PA 1Z7UA 2F5EA 3G3ZA 3CUOA 4OMYA 5JVTA 2O61A 1TNSA 3LQRA 3T8TA 4GO1A 1H9TA 4HLYA 4U0YA 3GF2A 1F4KA 2IP2A 2IT0A 1SD4A 3N4MA 1R5GA 2F5FA 4G8XA 3IKVA 4MNUA 5D4SA 3RPQA 2M8EA 3FM5A 3NQOA 3BPVA 4RS8A 1LEBA 4EMSA 2X0LA 2DTRA 4XSXF 2ESHA 1K6OA 1U78A 2HFHA 1S29A 4I01A 2VE9A 3B02A 1ZGAA 2EWNA 3SQNA 5ILUA 2DW4A 3GXOA 5E18F 1YTYA 1KU3A 4I0AA 2ESNA 4PGGA 4KDPA 2ZBKA 4XRFA 1FWZA 2OQRA 3IWFA 2EFQA 5BQTA 3HRTA 2GA2A 2J5PA 3GFIA 1SD7A 2EV0A 2IVMA 1REPC 4RGUA 2MH2A 4UUVA 4PCQA 1J0RA 3WE2A 1QPMA 2GXBA 2L3DA 1T2KA 1FX7A 2XV4S 5AIQA 1SD5A 3RKXA 2EJRA 4AIJA 1YW9A 3TGNA 1HKQA 4LG0A 4CZZA 1HXDA 4KICA 1R00A 1BBYA 2HTSA 4LJZF 2KJCA 1AWCA 1Y0UA 3KZYA 5BPIA 1K79A 1GVJA 3ROUA 1IN8A 1XGMA 5ILVA 4U0VA 3RDIA 3Q5FA 4GYGA 1D8JA 5FLXK 4WXDA 1W7PA 4CICA 1GXQA 3V7CA 2Z5UA 1MD0A 1ZARA 4UV8A 3GX4X 4HZFA 3CTAA 3C3WA 4YFKF 2OA4A 4A6DA 4ENNA 2A68F 2O03A 2O8XA 1R5HA 1BC7C 1IXRC 3IL2A 3BPXA 1R23A 3RIRA 4HDUA 4A12A 2M45A 1D8KA 4L9VA 1P4AA 2ZNYA 2DK5A 3RYPA 2RQPA 1Z05A 1XDSA 1TBXA 3ECHA 4AWXB 2QQAA 1IN4A 5ICFA 3ML6A 3CUQB 5CJ9A 2O6GE 5D5VB 1KQ8A 1JHFA 3R0AA 3TO6A 1SD6A 4L9JA 2QBYA 5HS9A 2A6EF 1LQ1A 5JHUA 1FBUA 4P9UA 1V4RA 2ISZA 4HBLA 4P9FA 5F6FA 3R60A 1BIAA 2VODA 3LA2A 4PGHA 2UWMA 5AONA 3WGGA 2F5CA 3F3XA 1YW7A 2RKHA 2XUBA 4KT5C 4A6EA 3PQKA 3GEZA 2B0LA 3NEUA 2A3SA 2NNYA 2JZYA 4KIFA 3IHUA 3IKTA 3L9FA 3QU3A 3M8EA 2RN7A 3KE2A 3RPUA 2PLYA 5L3GA 3TQNA 3I5UA 1MGTA 4GXOA 4AIHA 1MDMB 2K7LA 2QQBA 1OYIA 1MJAA 2Q0OA 2M1BA 2L01A 5FD6A 2TDXA 1ZAOA 2EA4A 1PP7U 1QZZA 5ERIA 1V3FA 3KP4A 4B8XA 4HV5A 5D6EA 3H3UA 4HQMA 1FLIA 1SMTA 3EETA 3C7JA 4HX7A 4WXCA 2XKOA 4G6DA 2V79A 3FHZA 1E2XA 1ZRCA 2ZNZA 4DQ2A 3G73A 2DI3A 1VTNC 4OIRF 3IWZA 4JBAA 3E3VA 4Y17A 2R7DA 4KIGA 5ICCA 3R0JA 1JGSA 3VOEA 3RKWA 3QP6A 1FT9A 4ON0A 2CSOA 1KU7A 1B1BA 1LEAA 4ENKA 3F8CA 4EM2A 1R1UA 1USTA 4RGSA 4ESJA 2PJPA 3I54A 3MZYA 1SFXA 4M9SA 4E70A 4MEXF 2H09A 1CF7A 4HX4A 3HSFA 3P9IA 4LK0F 4OMZA 1HBXG 2D45A 4FX4A 3DF8A 5BMZA 2XKPA 3TO7A 3HSEA 1QBJA 2E1CA 5H6QA 1P2FA 2E7WA 3M1EA 4QLCU 1E17A 2Z3YA 3GYHX 3GFMA 1FY7A 5D5XB 3TKYA 1MZBA 3BOQA 3O3KA 1P4XA 2D2WA 3LA7A 1X3UA 3C1DA 1J7KA 1TQMA 3GZ6A 3HHHA 4XLPF 1Q1HA 4G7HF 2AS5F 5BOXA 3ZMDA 2A5YB 5FD5A 2X4HA 3VB2A 1KGSA 4AD9A 2O3FA 5D6FA 3ZN0A 3CO7C 1ODDA 1S8NA 2HEOA 5LBQA 3FF5A 1G3YA 2BGCA 3BP8A 3HSRA 3WGIA 4M6YA 2XIGA 2OZ6A 1FYKA 1U5TA 2Z9OA 3DPTA 1BM9A 2JPCA 5D5WB 4ETSA 1FOKA 3R61A 5E20A 3JW4A 1OYWA 5K1YA 1S7OA 1FC3A 2JTVA 5IT9Z 1YIOA 3IRRA 5DEQA 2XHKA 4L0ZB 3E5XA 3MCZA 3W6KB 2EFPA 1RUNA 1BIBA 2DLLA 1BI1A 3CO6C 5FO5A 4LLLA 4P55A 2K86A 2LKPA 2HZTA 4UXNA 1W7PB 2HYFA 1P4WA 4HW0A 3V4GA 2QYOA 1W7PD 1UB9A 4KN7X 2MC3A 4UVAA 2PQ8A 3F21A 4JQFA 3MEXA 3Q9VA 1QGPA 3BDDA 3L09A 3OOPA 4O6JA 3RYRA 4A0ZA 1O7LA 4LB6B 4G7OF 1FP2A 2O0YA 1G6NA 2ZCWA 4Y15A 2GXGA 1HKSA 5A2QK 1ZREA 4OINF 2VT2A 3R4KA 1EH6A 2MH9A 3I4PA 2CQKA 1F5TA 3T5XA 4EM1A 4ENJA 3GUDA 1ZHFA 3RTRA 4ZZDA 2PI0A 1DPUA 1J5YA 5DCMA 4WF2A 2QBYB 1I5ZA 1EH8A 2EA2A 3M9AA 4NHJA 4G94A 5E1ZB 1XMAA 3E6BA 3J81Z 3ISPA 1W5TA 1D3YA 1U5TC 2UZKA 2PN6A 3LFKA 2LNBA 2JRTA 3V8KA 3WTSC 4HA8A 2VE8A 2R7FA 2VBWA 3WTZA 4L9TA 2FMLA 2LF8A 4HF2A 3K0LA 2YX4A 4HDVA 2HKXA 4L5JA 4ZH4F 4BHPA 1FYMA 1T98A 3JTGA 4PZJA 2DAOA 4EJVA 1A04A 2NS0A 4ZYHA 2F2EA 3GZ5A 4A5MA 3L2CA 1KQ0A 5ED4A 2A61A 3T8RA 4I02A 4KA4A 2KRFA 3KEOA 2FBIA 5LHHA 2L4AA 2ZFWA 5DDGA 2VONA 1Z6TA 1Z9CA 1B59A 1CGPA 1R58A 3E5UA 1IW7F 1XGOA 4CXFA 1ZGJA 5HLHA 4FX0A 3HIFA 4CHUA 4YG2F 2Y0MA 3HRUA 1PP8F 2ZJ2A 4MQ9F 4I0BA 2VXZA 1TNTA 5EEHA 3H3ZA 4RGRA 1HSTA 1YYVA 3JAMK 3ZMTA 3QP5A 1XCBA 3WG9A 3DFGA 4B09A 1U3EM 2ZMEA 3KLOA 3SFZA 3J80Z 3AAFA 4BXUA 2L02A 1DDNA 2R3SA 4R79A 4I7HA 3VEPA 2CFXA 3S2WA 2YPRA 2DO7A 4BHCA 1UHWA 1QQIA 2EFWA 4I98B 2DT5A 2P4WA 1O3TA 1YS7A 2GZWA 4R1HA 4BNCA 2RDPA 1CF7B 3E6CC 1HKTA 4GCVA 1T38A 4EJOA 2DQLA 3V7SA 2EK5A 2NYXA 2FQ3A 4LLNA 2RGVA 5HS7A 2GAUA 2Q2EA 2VOOA 5E17F 3KETA 4KUMA 3WTUC 3QPTA 4TV7A 1QO0D 2STWA 4Q47A 2K4BA 1KQ9A 5BPDA 5L3CA 3PFIA 3TO9A 1FBSA 5D8KB 4BH9A 1HSJA 3WU0A 4U7DA 3HTSB 1IRFA 3ZMVA 2FNAA 5HLGA 4KMUX 3F22A 5JFRA 3WODF 3I71A 4F7ZA 2IJLA 1H0MA 2CW0F 3Q9SA 3BWGA 1MJBA 1O7FA 2DPUA 3SXYA 4ENMA 2GIVA 4WCGA 2XAFA 2OBPA 2LDUA 1U5TB 2FXAA 4UHTA 2W24A 4CGZA 5K5QA 2H27A 4MTEA 2A07F 3KP6A 3FXUA 3D0SA 3DP7A 2A69F 2RC4A 3PQJA 1YW8A 2DQRA 5D8LB 1FBQA 1RIOH 2PEXA 2WTEA 2ZO4A 2VOPA 3FXRA 1WSUA 4Q48A 1KYZA 3GO5A 1YG2A 3I53A 4XSZF 3TOBA 3VFZA 5DV5A 4D0PA 4BYYA 5EEGA 2FMYA 1BI0A 2K4JA 1R7JA 3ZMUA 1AOYA 1TQIA 3ZMSA 4EVIA 1IN7A 3QAHA 1S6LA 4P96A 1XGNA 1B9NA 5AIPA 3FXQA 5K5RA 3B73A 2P8TA 5JI6A 1UFMA 4LB5A 4IRHA 2P6TA 3E6MA 1HW5A 2XASA 5DD8A 2CGPA 2DBBA 1O57A 3GWZA 4EV0A 5HDNA 4A0YA 1IZ1A 2H6CA 3DV8A 2IA0A 2YR2A 1LDDA 5CVUA 3L00A 5DCMB 4ESBA 3HRMA 2HWVA 3P7NA 3LAPA 3HYIA 2L54A 1SFUA 3LAJA 4YIIA 1Z6RA 4BQAA 1L0OC 2W25A 1XSXA 1LDJA 2YU3A 2KIMA 2FRHA 4G6QA 2XAGA 5LRRA 1J9IA 4QWQA 5JR3A 1IRGA 1OMIA 2XRNA 5H20A 3HHGA 5HDGA 2ADUA 1OPCA 3DQVC 1XD7A 1DUXC 5ICEA 3BY6A 3BJ6A 1I1GA 3T1BA 2HYGD 4EGZA 4I09A 4WX9A 2FNPA 2Y75A 1TTYA 3GFLA 1KU9A 5LRSA 2P5LC 3KP2A 4CDGA 2HGCA 3QPHA 1OYYA 5CVRA 4LGWA 2L4MA 2PMHA 4FHTA 2HKOA 3DEUA 3FMQA 4L9NA 1U2WA 3F8BA 3QOPA 3ECOA 2K27A 1ZLJA 1ON2A 4U0WA 2IRFG 2FE3A 3HUGA 4L18B 2NRAC 1YQAA 3ZN1A 2KKOA 3LSTA 4YFNF 1SMYF 2EFOA 1BI3A 2F5DA 2KIFA 4KMFA 2ZMEB 5DCFA 2HR3A 3WTVC 3GFJA 3JAMZ 3WGHA 2EV6A 2FOKA 3I0TA 5LLQA 2DU9A 1U8RA 4Q5SF 2RV8A 2DPDA 2FSWA 4XLNF 1HW2A 5FLXZ 2IA1A 4MTDA 4R8HA 3HOTA 2ACJA 3K9TA 2FU4A 2BYVE 1IAWA 3MZHA 3EYYA 4LLGF 3J7AO 4U88A 1ZG3A 3F8NA 4L5IA 1MJ9A 4ESFA 1J2XA 3ULQB 5E8GA 2JPBA 3KFWX 1TLHB 2QZ8A 3DKWA 3EDPA 3CUQC 4GGGA 4Y13A 2VT3A 5LGUA 4H0EA 5D4RA 1XSVA 1R1TA 2BE5F 1TW2A 4M74A 2YX7A 1R1VA 3OV8A 2P7VB 5HLIA 1SFEA 2G7HA 5FFXA 1JXSA 1DP7P 4P5OA 3F23A 4EGYA 3MQ0A 4RGXA 3F8FA 4U7BA 1Z91A 1FYLA 3KLNA 2XAQA 3MWMA 2EFNA 4ZYDA 1PDNC 2H6BA 3KP3A 3WTXC 4EQQA 1R36A 2QQ9A 2BBYA 2STTA 4KN4X 4WK8F 1G3WA 3U1DA 6PAXA 2VBYA 1GXPA 2FBKA 4S04A 3ZMZA 2OU2A 2VBXA 3CDHA 4MQVA 4MGRA 2HS5A 4KFCA 2CO5A 1LDKB 1OKRA 1XB4A 2UXNA 3FZVA 2IPQX 2LF7A 1TW3A 5DUIA 3L7WA 2ETHA 4AIKA 4LFUA 1ZG5A 5L3DA 2E7XA 4MEYF 4N9IA 2CWEA 2G7UA 1P6RA 4RAYA 5J8FA 4UVCA 2XVCA 3GW2A 3BJAA 2KJBA 1QNTA 3FMSA 1ULYA 4RAZA 4G7ZF 3IC7A 2V1UA 1O3QA 2QWWA 1B9MA 3ABUA 2MA3A 1RI7A 5DD4A 4IHTA 3EUHA 2FBHA 1K78A 1UHMA 3W6JB 5TRDA 3SZPA 5IT9K 4A2UA 2ISYA 1ZH5A 2OQGA 1XDUA 1IN6A 3H92A 5IT3A 5F64A 5DUKA 2XGXA 2HQRA 4EJWA 1ZLKA 4HF1A 4M71A 3WTTC 3RI4A 1EV7A 1FPQA 4M9ZA 2QUFA 1FNNA 2D1VA 3I59A 3GLXA 3WU1B 4UV9A 2PFBA 4IRGA 1FSHA 3E5QA 1JHHA 1BOAA 5HOOA 1DPRA 4N0BA 1D5VA 3BROA 3C18A 4IPAA 2WC2A 3WE3A 3JTHA 4NQWA 3QU6A 1B6AA 2NAZA 2MD5A 2V9VA 4S05A 3QRFF 2FEZA 2VC0A 1LB2A 4M6XA 1KYWA 3N97A 4HAMA 4HF0A 1S3JA 1WI9A 2EV5A 4BHBA 1G3TA 5L3BA 2VBZA 2V1DA 1WQ2A 3GVAA 1ONVA 4M73A 1IUYA 2GWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HS8 A;  3F72 A;  4CYD A;  4ZZL A;  5FB2 A;  4EJT A;  3BJO A;  1USS A;  1WWX A;  4LMY A;  3F6V A;  3M7G A;  2XRO A;  4IJA A;  3NRV A;  1NHA A;  3K1N A;  3P9C A;  2M30 A;  4FT8 A;  2IA2 A;  5ILS A;  3ZPL A;  3J81 K;  4KYW A;  4N9H A;  4M72 A;  4OU0 A;  1OR7 A;  3JSP A;  5LGN A;  4RB3 C;  5FGM A;  2CG4 A;  1B4A A;  2HQN A;  1WRJ A;  1STZ A;  4M9X A;  5LEK A;  1IN5 A;  3TOA A;  3EQL F;  4IXA A;  1FP1 D;  1ZYR F;  4LD5 A;  2WWY A;  3REO A;  1LVA A;  1O3R A;  3DXJ F;  5CLS A;  3M8F A;  4HOB A;  3MFK A;  1U6G A;  1LNW A;  3LQQ A;  5J6X A;  4EJU A;  2VC1 A;  2CYY A;  2V1X A;  3FWE A;  3JSO A;  4JK1 X;  2DFI A;  5CYV A;  1ON1 A;  4A0X A;  4UNO A;  3V8J A;  2COM A;  5L3F A;  1PUE E;  2QVO A;  4ASN A;  3F8M A;  2V6C A;  4CO8 A;  1Z1D A;  1XMK A;  3FMR A;  1FZP B;  3E97 A;  2FF4 A;  3WTY C;  4Z2Y A;  2W84 A;  2D1H A;  3ZQ7 A;  1I1S A;  3U2R A;  2GA1 A;  2VN2 A;  4LK1 F;  4AVP A;  5KK1 A;  2JSC A;  2KIU A;  3DPL C;  1RUO A;  3TDZ C;  4UVB A;  5L3E A;  1W5S A;  2PBI A;  3HTU A;  1S7A A;  5K5O A;  1SAX A;  1WKM A;  3R6S A;  4K2E A;  3RJP A;  3FM3 A;  5CVI A;  2JT1 A;  3J80 K;  1YO5 C;  1HQC A;  3O6B B;  3T0Y A;  3ELK A;  4HQE A;  3VOD A;  1XSD A;  3LWF A;  1H9G A;  2P5K A;  4WXH A;  1YS6 A;  3EYI A;  1I27 A;  3CLO A;  2C6Y A;  1IF1 A;  2M87 A;  5A2Q Z;  3HRS A;  4GYI A;  1G3S A;  2OD5 A;  2MLK A;  3K69 A;  4PDK A;  1ZRF A;  4IF4 A;  1XCV A;  3D5L A;  1YFH A;  2WV0 A;  1RZ4 A;  2H94 A;  3ZP5 A;  3I64 A;  5H6R A;  2AXL A;  4HLX A;  1IXS B;  1EH7 A;  4IRI A;  3KP5 A;  5FFZ A;  1ZRD A;  1LJ9 A;  1G4D A;  1BJA A;  3E6D A;  4KNY A;  3FX3 A;  2RVC A;  4EM0 B;  3KEQ A;  2PG4 A;  3F6O A;  2QM3 A;  3V8L A;  4HX8 A;  3CUQ A;  5E1X A;  1T6S A;  2ZKZ A;  1KU2 A;  5HDK A;  2A6H F;  1YLF A;  4IVN A;  3SZT A;  2J5O A;  4YIF A;  5ICG A;  3KP7 A;  1BN5 A;  3O2P E;  2P6S A;  2LSO A;  2ZXJ A;  4KIB A;  4RB2 C;  4I2O A;  3V7R A;  3ABT A;  3K2Z A;  4MHG A;  1XGS A;  1C0W A;  3U9G A;  2NNN A;  2G9W A;  2P7C B;  5J8C A;  5BS6 A;  1ZG1 A;  4XBF A;  2ELH A;  1J75 A;  2Q8K A;  3KCC A;  3RKY A;  2W85 A;  1UCR A;  5TJJ A;  1F1Z A;  4OIO F;  1K78 B;  3SHF A;  5HVQ C;  2EB7 A;  2BEO A;  4OIP F;  1L3L A;  2P5V A;  2OAZ A;  3WTW C;  2YSR A;  1KA8 A;  2HTJ A;  1W4M A;  4ZYE A;  4NB5 A;  4BAY A;  4RB1 A;  4LG0 B;  1MDM A;  5LEJ A;  4WWC A;  5F1R A;  2RNJ A;  2HDC A;  1IXC A;  1P92 A;  1XN7 A;  5DYM A;  2Y48 A;  1FSE A;  4HV6 A;  3BZ6 A;  1T0F A;  3P9K A;  2Z99 A;  4DNC A;  1O3S A;  1F9N A;  2MBF A;  1J59 A;  5D5U B;  1QZY A;  2FA5 A;  4IHS A;  3I59 B;  1GHC A;  5KVR A;  5E8I A;  2M5W A;  3COA C;  3IRQ A;  1ZN2 A;  2PMU A;  3I58 A;  1RNL A;  4ZYG A;  1T39 A;  2UXX A;  2XAH A;  2K02 A;  2GQQ A;  2HOE A;  2MLG A;  1HW1 A;  1I6X A;  5CVV A;  4O3M A;  2QEN A;  3MAJ A;  2DK8 A;  4A5N A;  3LA3 A;  5LGT A;  1K7A A;  1BI2 A;  2QLZ A;  4RB0 A;  4L0Y B;  3TDU C;  2W57 A;  1JE8 A;  1MKM A;  3HOS A;  2E1N A;  3CJN A;  1R22 A;  4OIQ F;  3K1M A;  3ERE D;  4HYE A;  2IW5 A;  1BC8 C;  4O5V A;  5LHI A;  5LHG A;  2Z33 A;  4G9Y A;  4YFX F;  1TQP A;  2XAJ A;  5CVJ A;  5E1W A;  4OOI A;  4Q4Z F;  3KZZ A;  2BV6 A;  2OZU A;  3K1P A;  1Z7U A;  2F5E A;  3G3Z A;  3CUO A;  4OMY A;  5JVT A;  2O61 A;  1TNS A;  3LQR A;  3T8T A;  4GO1 A;  1H9T A;  4HLY A;  4U0Y A;  3GF2 A;  1F4K A;  2IP2 A;  2IT0 A;  1SD4 A;  3N4M A;  1R5G A;  2F5F A;  4G8X A;  3IKV A;  4MNU A;  5D4S A;  3RPQ A;  2M8E A;  3FM5 A;  3NQO A;  3BPV A;  4RS8 A;  1LEB A;  4EMS A;  2X0L A;  2DTR A;  4XSX F;  2ESH A;  1K6O A;  1U78 A;  2HFH A;  1S29 A;  4I01 A;  2VE9 A;  3B02 A;  1ZGA A;  2EWN A;  3SQN A;  5ILU A;  2DW4 A;  3GXO A;  5E18 F;  1YTY A;  1KU3 A;  4I0A A;  2ESN A;  4PGG A;  4KDP A;  2ZBK A;  4XRF A;  1FWZ A;  2OQR A;  3IWF A;  2EFQ A;  5BQT A;  3HRT A;  2GA2 A;  2J5P A;  3GFI A;  1SD7 A;  2EV0 A;  2IVM A;  1REP C;  4RGU A;  2MH2 A;  4UUV A;  4PCQ A;  1J0R A;  3WE2 A;  1QPM A;  2GXB A;  2L3D A;  1T2K A;  1FX7 A;  2XV4 S;  5AIQ A;  1SD5 A;  3RKX A;  2EJR A;  4AIJ A;  1YW9 A;  3TGN A;  1HKQ A;  4LG0 A;  4CZZ A;  1HXD A;  4KIC A;  1R00 A;  1BBY A;  2HTS A;  4LJZ F;  2KJC A;  1AWC A;  1Y0U A;  3KZY A;  5BPI A;  1K79 A;  1GVJ A;  3ROU A;  1IN8 A;  1XGM A;  5ILV A;  4U0V A;  3RDI A;  3Q5F A;  4GYG A;  1D8J A;  5FLX K;  4WXD A;  1W7P A;  4CIC A;  1GXQ A;  3V7C A;  2Z5U A;  1MD0 A;  1ZAR A;  4UV8 A;  3GX4 X;  4HZF A;  3CTA A;  3C3W A;  4YFK F;  2OA4 A;  4A6D A;  4ENN A;  2A68 F;  2O03 A;  2O8X A;  1R5H A;  1BC7 C;  1IXR C;  3IL2 A;  3BPX A;  1R23 A;  3RIR A;  4HDU A;  4A12 A;  2M45 A;  1D8K A;  4L9V A;  1P4A A;  2ZNY A;  2DK5 A;  3RYP A;  2RQP A;  1Z05 A;  1XDS A;  1TBX A;  3ECH A;  4AWX B;  2QQA A;  1IN4 A;  5ICF A;  3ML6 A;  3CUQ B;  5CJ9 A;  2O6G E;  5D5V B;  1KQ8 A;  1JHF A;  3R0A A;  3TO6 A;  1SD6 A;  4L9J A;  2QBY A;  5HS9 A;  2A6E F;  1LQ1 A;  5JHU A;  1FBU A;  4P9U A;  1V4R A;  2ISZ A;  4HBL A;  4P9F A;  5F6F A;  3R60 A;  1BIA A;  2VOD A;  3LA2 A;  4PGH A;  2UWM A;  5AON A;  3WGG A;  2F5C A;  3F3X A;  1YW7 A;  2RKH A;  2XUB A;  4KT5 C;  4A6E A;  3PQK A;  3GEZ A;  2B0L A;  3NEU A;  2A3S A;  2NNY A;  2JZY A;  4KIF A;  3IHU A;  3IKT A;  3L9F A;  3QU3 A;  3M8E A;  2RN7 A;  3KE2 A;  3RPU A;  2PLY A;  5L3G A;  3TQN A;  3I5U A;  1MGT A;  4GXO A;  4AIH A;  1MDM B;  2K7L A;  2QQB A;  1OYI A;  1MJA A;  2Q0O A;  2M1B A;  2L01 A;  5FD6 A;  2TDX A;  1ZAO A;  2EA4 A;  1PP7 U;  1QZZ A;  5ERI A;  1V3F A;  3KP4 A;  4B8X A;  4HV5 A;  5D6E A;  3H3U A;  4HQM A;  1FLI A;  1SMT A;  3EET A;  3C7J A;  4HX7 A;  4WXC A;  2XKO A;  4G6D A;  2V79 A;  3FHZ A;  1E2X A;  1ZRC A;  2ZNZ A;  4DQ2 A;  3G73 A;  2DI3 A;  1VTN C;  4OIR F;  3IWZ A;  4JBA A;  3E3V A;  4Y17 A;  2R7D A;  4KIG A;  5ICC A;  3R0J A;  1JGS A;  3VOE A;  3RKW A;  3QP6 A;  1FT9 A;  4ON0 A;  2CSO A;  1KU7 A;  1B1B A;  1LEA A;  4ENK A;  3F8C A;  4EM2 A;  1R1U A;  1UST A;  4RGS A;  4ESJ A;  2PJP A;  3I54 A;  3MZY A;  1SFX A;  4M9S A;  4E70 A;  4MEX F;  2H09 A;  1CF7 A;  4HX4 A;  3HSF A;  3P9I A;  4LK0 F;  4OMZ A;  1HBX G;  2D45 A;  4FX4 A;  3DF8 A;  5BMZ A;  2XKP A;  3TO7 A;  3HSE A;  1QBJ A;  2E1C A;  5H6Q A;  1P2F A;  2E7W A;  3M1E A;  4QLC U;  1E17 A;  2Z3Y A;  3GYH X;  3GFM A;  1FY7 A;  5D5X B;  3TKY A;  1MZB A;  3BOQ A;  3O3K A;  1P4X A;  2D2W A;  3LA7 A;  1X3U A;  3C1D A;  1J7K A;  1TQM A;  3GZ6 A;  3HHH A;  4XLP F;  1Q1H A;  4G7H F;  2AS5 F;  5BOX A;  3ZMD A;  2A5Y B;  5FD5 A;  2X4H A;  3VB2 A;  1KGS A;  4AD9 A;  2O3F A;  5D6F A;  3ZN0 A;  3CO7 C;  1ODD A;  1S8N A;  2HEO A;  5LBQ A;  3FF5 A;  1G3Y A;  2BGC A;  3BP8 A;  3HSR A;  3WGI A;  4M6Y A;  2XIG A;  2OZ6 A;  1FYK A;  1U5T A;  2Z9O A;  3DPT A;  1BM9 A;  2JPC A;  5D5W B;  4ETS A;  1FOK A;  3R61 A;  5E20 A;  3JW4 A;  1OYW A;  5K1Y A;  1S7O A;  1FC3 A;  2JTV A;  5IT9 Z;  1YIO A;  3IRR A;  5DEQ A;  2XHK A;  4L0Z B;  3E5X A;  3MCZ A;  3W6K B;  2EFP A;  1RUN A;  1BIB A;  2DLL A;  1BI1 A;  3CO6 C;  5FO5 A;  4LLL A;  4P55 A;  2K86 A;  2LKP A;  2HZT A;  4UXN A;  1W7P B;  2HYF A;  1P4W A;  4HW0 A;  3V4G A;  2QYO A;  1W7P D;  1UB9 A;  4KN7 X;  2MC3 A;  4UVA A;  2PQ8 A;  3F21 A;  4JQF A;  3MEX A;  3Q9V A;  1QGP A;  3BDD A;  3L09 A;  3OOP A;  4O6J A;  3RYR A;  4A0Z A;  1O7L A;  4LB6 B;  4G7O F;  1FP2 A;  2O0Y A;  1G6N A;  2ZCW A;  4Y15 A;  2GXG A;  1HKS A;  5A2Q K;  1ZRE A;  4OIN F;  2VT2 A;  3R4K A;  1EH6 A;  2MH9 A;  3I4P A;  2CQK A;  1F5T A;  3T5X A;  4EM1 A;  4ENJ A;  3GUD A;  1ZHF A;  3RTR A;  4ZZD A;  2PI0 A;  1DPU A;  1J5Y A;  5DCM A;  4WF2 A;  2QBY B;  1I5Z A;  1EH8 A;  2EA2 A;  3M9A A;  4NHJ A;  4G94 A;  5E1Z B;  1XMA A;  3E6B A;  3J81 Z;  3ISP A;  1W5T A;  1D3Y A;  1U5T C;  2UZK A;  2PN6 A;  3LFK A;  2LNB A;  2JRT A;  3V8K A;  3WTS C;  4HA8 A;  2VE8 A;  2R7F A;  2VBW A;  3WTZ A;  4L9T A;  2FML A;  2LF8 A;  4HF2 A;  3K0L A;  2YX4 A;  4HDV A;  2HKX A;  4L5J A;  4ZH4 F;  4BHP A;  1FYM A;  1T98 A;  3JTG A;  4PZJ A;  2DAO A;  4EJV A;  1A04 A;  2NS0 A;  4ZYH A;  2F2E A;  3GZ5 A;  4A5M A;  3L2C A;  1KQ0 A;  5ED4 A;  2A61 A;  3T8R A;  4I02 A;  4KA4 A;  2KRF A;  3KEO A;  2FBI A;  5LHH A;  2L4A A;  2ZFW A;  5DDG A;  2VON A;  1Z6T A;  1Z9C A;  1B59 A;  1CGP A;  1R58 A;  3E5U A;  1IW7 F;  1XGO A;  4CXF A;  1ZGJ A;  5HLH A;  4FX0 A;  3HIF A;  4CHU A;  4YG2 F;  2Y0M A;  3HRU A;  1PP8 F;  2ZJ2 A;  4MQ9 F;  4I0B A;  2VXZ A;  1TNT A;  5EEH A;  3H3Z A;  4RGR A;  1HST A;  1YYV A;  3JAM K;  3ZMT A;  3QP5 A;  1XCB A;  3WG9 A;  3DFG A;  4B09 A;  1U3E M;  2ZME A;  3KLO A;  3SFZ A;  3J80 Z;  3AAF A;  4BXU A;  2L02 A;  1DDN A;  2R3S A;  4R79 A;  4I7H A;  3VEP A;  2CFX A;  3S2W A;  2YPR A;  2DO7 A;  4BHC A;  1UHW A;  1QQI A;  2EFW A;  4I98 B;  2DT5 A;  2P4W A;  1O3T A;  1YS7 A;  2GZW A;  4R1H A;  4BNC A;  2RDP A;  1CF7 B;  3E6C C;  1HKT A;  4GCV A;  1T38 A;  4EJO A;  2DQL A;  3V7S A;  2EK5 A;  2NYX A;  2FQ3 A;  4LLN A;  2RGV A;  5HS7 A;  2GAU A;  2Q2E A;  2VOO A;  5E17 F;  3KET A;  4KUM A;  3WTU C;  3QPT A;  4TV7 A;  1QO0 D;  2STW A;  4Q47 A;  2K4B A;  1KQ9 A;  5BPD A;  5L3C A;  3PFI A;  3TO9 A;  1FBS A;  5D8K B;  4BH9 A;  1HSJ A;  3WU0 A;  4U7D A;  3HTS B;  1IRF A;  3ZMV A;  2FNA A;  5HLG A;  4KMU X;  3F22 A;  5JFR A;  3WOD F;  3I71 A;  4F7Z A;  2IJL A;  1H0M A;  2CW0 F;  3Q9S A;  3BWG A;  1MJB A;  1O7F A;  2DPU A;  3SXY A;  4ENM A;  2GIV A;  4WCG A;  2XAF A;  2OBP A;  2LDU A;  1U5T B;  2FXA A;  4UHT A;  2W24 A;  4CGZ A;  5K5Q A;  2H27 A;  4MTE A;  2A07 F;  3KP6 A;  3FXU A;  3D0S A;  3DP7 A;  2A69 F;  2RC4 A;  3PQJ A;  1YW8 A;  2DQR A;  5D8L B;  1FBQ A;  1RIO H;  2PEX A;  2WTE A;  2ZO4 A;  2VOP A;  3FXR A;  1WSU A;  4Q48 A;  1KYZ A;  3GO5 A;  1YG2 A;  3I53 A;  4XSZ F;  3TOB A;  3VFZ A;  5DV5 A;  4D0P A;  4BYY A;  5EEG A;  2FMY A;  1BI0 A;  2K4J A;  1R7J A;  3ZMU A;  1AOY A;  1TQI A;  3ZMS A;  4EVI A;  1IN7 A;  3QAH A;  1S6L A;  4P96 A;  1XGN A;  1B9N A;  5AIP A;  3FXQ A;  5K5R A;  3B73 A;  2P8T A;  5JI6 A;  1UFM A;  4LB5 A;  4IRH A;  2P6T A;  3E6M A;  1HW5 A;  2XAS A;  5DD8 A;  2CGP A;  2DBB A;  1O57 A;  3GWZ A;  4EV0 A;  5HDN A;  4A0Y A;  1IZ1 A;  2H6C A;  3DV8 A;  2IA0 A;  2YR2 A;  1LDD A;  5CVU A;  3L00 A;  5DCM B;  4ESB A;  3HRM A;  2HWV A;  3P7N A;  3LAP A;  3HYI A;  2L54 A;  1SFU A;  3LAJ A;  4YII A;  1Z6R A;  4BQA A;  1L0O C;  2W25 A;  1XSX A;  1LDJ A;  2YU3 A;  2KIM A;  2FRH A;  4G6Q A;  2XAG A;  5LRR A;  1J9I A;  4QWQ A;  5JR3 A;  1IRG A;  1OMI A;  2XRN A;  5H20 A;  3HHG A;  5HDG A;  2ADU A;  1OPC A;  3DQV C;  1XD7 A;  1DUX C;  5ICE A;  3BY6 A;  3BJ6 A;  1I1G A;  3T1B A;  2HYG D;  4EGZ A;  4I09 A;  4WX9 A;  2FNP A;  2Y75 A;  1TTY A;  3GFL A;  1KU9 A;  5LRS A;  2P5L C;  3KP2 A;  4CDG A;  2HGC A;  3QPH A;  1OYY A;  5CVR A;  4LGW A;  2L4M A;  2PMH A;  4FHT A;  2HKO A;  3DEU A;  3FMQ A;  4L9N A;  1U2W A;  3F8B A;  3QOP A;  3ECO A;  2K27 A;  1ZLJ A;  1ON2 A;  4U0W A;  2IRF G;  2FE3 A;  3HUG A;  4L18 B;  2NRA C;  1YQA A;  3ZN1 A;  2KKO A;  3LST A;  4YFN F;  1SMY F;  2EFO A;  1BI3 A;  2F5D A;  2KIF A;  4KMF A;  2ZME B;  5DCF A;  2HR3 A;  3WTV C;  3GFJ A;  3JAM Z;  3WGH A;  2EV6 A;  2FOK A;  3I0T A;  5LLQ A;  2DU9 A;  1U8R A;  4Q5S F;  2RV8 A;  2DPD A;  2FSW A;  4XLN F;  1HW2 A;  5FLX Z;  2IA1 A;  4MTD A;  4R8H A;  3HOT A;  2ACJ A;  3K9T A;  2FU4 A;  2BYV E;  1IAW A;  3MZH A;  3EYY A;  4LLG F;  3J7A O;  4U88 A;  1ZG3 A;  3F8N A;  4L5I A;  1MJ9 A;  4ESF A;  1J2X A;  3ULQ B;  5E8G A;  2JPB A;  3KFW X;  1TLH B;  2QZ8 A;  3DKW A;  3EDP A;  3CUQ C;  4GGG A;  4Y13 A;  2VT3 A;  5LGU A;  4H0E A;  5D4R A;  1XSV A;  1R1T A;  2BE5 F;  1TW2 A;  4M74 A;  2YX7 A;  1R1V A;  3OV8 A;  2P7V B;  5HLI A;  1SFE A;  2G7H A;  5FFX A;  1JXS A;  1DP7 P;  4P5O A;  3F23 A;  4EGY A;  3MQ0 A;  4RGX A;  3F8F A;  4U7B A;  1Z91 A;  1FYL A;  3KLN A;  2XAQ A;  3MWM A;  2EFN A;  4ZYD A;  1PDN C;  2H6B A;  3KP3 A;  3WTX C;  4EQQ A;  1R36 A;  2QQ9 A;  2BBY A;  2STT A;  4KN4 X;  4WK8 F;  1G3W A;  3U1D A;  6PAX A;  2VBY A;  1GXP A;  2FBK A;  4S04 A;  3ZMZ A;  2OU2 A;  2VBX A;  3CDH A;  4MQV A;  4MGR A;  2HS5 A;  4KFC A;  2CO5 A;  1LDK B;  1OKR A;  1XB4 A;  2UXN A;  3FZV A;  2IPQ X;  2LF7 A;  1TW3 A;  5DUI A;  3L7W A;  2ETH A;  4AIK A;  4LFU A;  1ZG5 A;  5L3D A;  2E7X A;  4MEY F;  4N9I A;  2CWE A;  2G7U A;  1P6R A;  4RAY A;  5J8F A;  4UVC A;  2XVC A;  3GW2 A;  3BJA A;  2KJB A;  1QNT A;  3FMS A;  1ULY A;  4RAZ A;  4G7Z F;  3IC7 A;  2V1U A;  1O3Q A;  2QWW A;  1B9M A;  3ABU A;  2MA3 A;  1RI7 A;  5DD4 A;  4IHT A;  3EUH A;  2FBH A;  1K78 A;  1UHM A;  3W6J B;  5TRD A;  3SZP A;  5IT9 K;  4A2U A;  2ISY A;  1ZH5 A;  2OQG A;  1XDU A;  1IN6 A;  3H92 A;  5IT3 A;  5F64 A;  5DUK A;  2XGX A;  2HQR A;  4EJW A;  1ZLK A;  4HF1 A;  4M71 A;  3WTT C;  3RI4 A;  1EV7 A;  1FPQ A;  4M9Z A;  2QUF A;  1FNN A;  2D1V A;  3I59 A;  3GLX A;  3WU1 B;  4UV9 A;  2PFB A;  4IRG A;  1FSH A;  3E5Q A;  1JHH A;  1BOA A;  5HOO A;  1DPR A;  4N0B A;  1D5V A;  3BRO A;  3C18 A;  4IPA A;  2WC2 A;  3WE3 A;  3JTH A;  4NQW A;  3QU6 A;  1B6A A;  2NAZ A;  2MD5 A;  2V9V A;  4S05 A;  3QRF F;  2FEZ A;  2VC0 A;  1LB2 A;  4M6X A;  1KYW A;  3N97 A;  4HAM A;  4HF0 A;  1S3J A;  1WI9 A;  2EV5 A;  4BHB A;  1G3T A;  5L3B A;  2VBZ A;  2V1D A;  1WQ2 A;  3GVA A;  1ONV A;  4M73 A;  1IUY A;  2GWR A; 
#chains in the Genus database with same CATH topology
 5HS8 A;  3F72 A;  2P81 A;  2DFE A;  4CYD A;  4ZZL A;  5FB2 A;  3IV5 A;  4EJT A;  3BJO A;  3OS1 A;  2Y69 H;  1USS A;  1WWX A;  4LMY A;  3F6V A;  3M7G A;  2XRO A;  1MBE A;  3NRV A;  4IJA A;  1NHA A;  5F08 A;  4XK4 A;  3K1N A;  3MN2 A;  1PJR A;  2M30 A;  2WY7 Q;  3P9C A;  1VQL I;  4FT8 A;  2IA2 A;  3PSI A;  1R5I D;  5ILS A;  3ZPL A;  3J81 K;  4KYW A;  4N9H A;  4M72 A;  2IAI A;  3P5J A;  4A3D J;  4OU0 A;  1OR7 A;  2LY1 A;  3JSP A;  5LGN A;  2LKS A;  3MMY B;  4RB3 C;  5FGM A;  4XRS A;  2CG4 A;  1B4A A;  2HQN A;  1WRJ A;  1STZ A;  4M9X A;  5LEK A;  1I3Q J;  2DJI A;  3DEE A;  4C3J J;  1TZL A;  2GLO A;  3MZ8 A;  1IN5 A;  3RQI A;  3TOA A;  3EQL F;  4IXA A;  3VYU B;  3CF5 F;  3IUO A;  3K4K A;  1FP1 D;  3GTG J;  1Z77 A;  1ZYR F;  1X2N A;  5LFA A;  1Y8Q B;  5IPA A;  4LD5 A;  3OL4 A;  2WWY A;  3A0B C;  1S9H A;  4JYK A;  3REO A;  3ZQH A;  1LVA A;  2R92 J;  1LVK A;  1O3R A;  3DXJ F;  5DTD A;  5CLS A;  3M8F A;  4HOB A;  3MFK A;  4B48 A;  1UEL B;  1U6G A;  1LNW A;  4MLO A;  1MBG A;  3LQQ A;  5J6X A;  2FD5 A;  4EJU A;  4F92 B;  3OYF A;  2VC1 A;  2CYY A;  2V1X A;  3FWE A;  1HLV A;  3JSO A;  4JK1 X;  4W1U A;  2DFI A;  4XKW A;  3HUG B;  2NVX J;  5CYV A;  3CF2 A;  1ON1 A;  1W5C C;  1XG1 A;  2G0E A;  5GP9 A;  4A0X A;  4C3H J;  3OYG A;  1F43 A;  2R5Y A;  1AKH B;  4UNO A;  3V8J A;  5F27 A;  2COM A;  2GOX B;  4A3K J;  5L3F A;  3B6A A;  2QVO A;  1PUE E;  2M8G X;  4ASN A;  3DU6 A;  2WBM A;  4OWR B;  3RZD J;  3PUF A;  3F8M A;  2V6C A;  4CO8 A;  1Z1D A;  1XMK A;  3FMR A;  1FZP B;  3E97 A;  2FF4 A;  3L1P A;  3WTY C;  4Z2Y A;  4F3Q A;  3S16 J;  4CYC B;  2W84 A;  3CC2 I;  3K70 C;  2OF7 A;  2D1H A;  3ZQ7 A;  3HPH A;  3EUK L;  1I1S A;  2MSY A;  2GA1 A;  3U2R A;  2VN2 A;  4CCJ A;  5E3M A;  4LK1 F;  3HXL A;  4AVP A;  5KK1 A;  2JSC A;  2KIU A;  1VQO I;  1TT5 B;  2Y9Z A;  3CC7 I;  2X1E A;  1V55 H;  3DPL C;  1OQY A;  1MBH A;  1BOB A;  2X6Y A;  1FEX A;  1RUO A;  3TDZ C;  3CLQ A;  5KAF C;  1FOW A;  4UVB A;  2JA6 J;  5L3E A;  1A6Q A;  1JT0 A;  2R7V A;  1W5S A;  1RRJ A;  2PBI A;  3HTU A;  1S7A A;  1K4T A;  5K5O A;  1SAX A;  1VQ8 I;  1WKM A;  3R6S A;  4K2E A;  3RJP A;  3FM3 A;  5CVI A;  2JT1 A;  3J80 K;  1YO5 C;  1JJ6 C;  4BE2 A;  2OJE D;  1HQC A;  3O6B B;  3HOX J;  3T0Y A;  3ELK A;  3FDY A;  3A02 A;  4HQE A;  2IBD A;  3VOD A;  1XSD A;  3LWF A;  1H9G A;  2P5K A;  4WXH A;  2EZI A;  1YS6 A;  2AO9 A;  3S32 A;  2K9Q A;  2N8G A;  4J01 A;  1WZ2 A;  4Y33 A;  4ZDO A;  4BU2 A;  3EYI A;  2NOJ B;  1I27 A;  3CLO A;  2C6Y A;  2JVH A;  1IF1 A;  2M87 A;  1JI8 A;  1YJW I;  2HU9 A;  3BG3 A;  4BQO A;  3VSL A;  3BC8 A;  5A2Q Z;  1W36 C;  4E7S A;  3HRS A;  2BHY A;  4GYI A;  2DMP A;  2HDD A;  3QQA A;  2GBY A;  1G3S A;  2OD5 A;  4UB6 C;  2DYR H;  2ZXH A;  5EDN A;  1FOX A;  2MLK A;  1LE8 A;  3K69 A;  3HKZ N;  4PDK A;  1ZRF A;  4IF4 A;  1XCV A;  3D5L A;  5IP7 J;  1YFH A;  2WV0 A;  5J1U A;  1VQ9 I;  1RZ4 A;  2RRE A;  2H94 A;  3ZP5 A;  5J1R A;  2V9K A;  3I64 A;  2ZXI A;  2HZD A;  1MBF A;  5H6R A;  2AXL A;  4A69 C;  2WAE A;  2UUZ A;  4HLX A;  1IXS B;  1EH7 A;  4IRI A;  2CRG A;  4E7Z A;  5JHF A;  2DA3 A;  2UV1 A;  4NC7 A;  4E7H A;  1N25 A;  3KP5 A;  5FFZ A;  1MSF C;  1ZRD A;  2DDB A;  1LJ9 A;  1G4D A;  1BJA A;  3E6D A;  4KNY A;  3FX3 A;  2RVC A;  4EM0 B;  3KEQ A;  3D1N I;  2X6O A;  1IDY A;  5IOY A;  2PG4 A;  5TGT A;  3F6O A;  2QM3 A;  3V8L A;  4UUS B;  4HX8 A;  3CUQ A;  3H36 A;  1UJ8 A;  5E1X A;  4XN3 A;  2X51 A;  4IHW A;  1T6S A;  2ZKZ A;  2ID6 A;  5KNL A;  1KU2 A;  2KQR A;  5HDK A;  2A6H F;  4RMN A;  1QA6 A;  3CJQ B;  1YLF A;  3BR2 A;  3HOW J;  1APL C;  4IVN A;  3SZT A;  2J5O A;  4YIF A;  5ICG A;  5JLX A;  4RBO A;  3CES A;  3KP7 A;  1BN5 A;  4XKC A;  3L2W A;  2EIK H;  2L9R A;  3O2P E;  2VJ5 A;  2LMD A;  2P6S A;  4BJ5 C;  5EYR A;  2ZXW H;  2LSO A;  2ZXJ A;  4KIB A;  5FKO A;  4RB2 C;  5GPC A;  1R6R A;  4I2O A;  3V7R A;  1B8I B;  1IRX A;  2LVS A;  3A01 A;  4A3E J;  3ABT A;  3CJR B;  2PJR B;  2B63 J;  5CPR B;  3K2Z A;  4MHG A;  1XGS A;  1C0W A;  1YIT I;  2Y0S N;  3U9G A;  2NNN A;  2G9W A;  2P7C B;  5J8C A;  5BS6 A;  2DOD A;  1ZG1 A;  2M2E A;  4XBF A;  3TL4 X;  2L7F P;  4YEJ A;  2ELH A;  1J75 A;  2Q8K A;  4BQN A;  3KCC A;  3RKY A;  2W85 A;  1UCR A;  5TJJ A;  1F1Z A;  1ETV A;  4OIO F;  3LNQ A;  2ZC2 A;  1K78 B;  3SHF A;  5HVQ C;  1AKH A;  2EB7 A;  4CSW A;  2BEO A;  4OIP F;  4H4K C;  1L3L A;  4AM3 A;  2P5V A;  2OAZ A;  2E5Z A;  2Z1D A;  3WTW C;  2JRM A;  3IH4 A;  2YSR A;  2CS3 A;  1KA8 A;  2HTJ A;  3O8H A;  1W4M A;  4ZYE A;  4NB5 A;  4BAY A;  4RB1 A;  4LG0 B;  1MDM A;  5C4X J;  5LEJ A;  4WWC A;  5F1R A;  1J09 A;  2RNJ A;  3L2U A;  1SVO A;  2E2H J;  2HDC A;  1IXC A;  3NAR A;  4V2F A;  1P92 A;  1XN7 A;  5DYM A;  4M6V A;  2Y48 A;  3M8J A;  1FSE A;  2CQN A;  4HV6 A;  4XLH A;  3BZ6 A;  1T0F A;  4BQQ A;  3P9K A;  3H1C A;  2Z99 A;  1I39 A;  3K4L A;  4DNC A;  3JR9 A;  2ECB A;  1O3S A;  2I10 A;  1F9N A;  2MBF A;  4CCO A;  5D5U B;  1J59 A;  1H8A C;  1QZY A;  2BOL A;  3SZG A;  2FA5 A;  2K3F A;  3I59 B;  4IHS A;  1GHC A;  1NK3 P;  5KVR A;  5E8I A;  2M5W A;  3COA C;  3NWT A;  4ABZ A;  1D1A A;  3IRQ A;  1ZN2 A;  2PMU A;  4JP0 A;  3BR3 A;  3I58 A;  3K4M A;  1RNL A;  4ZYG A;  1MH4 A;  2UXX A;  2XAH A;  2LRE A;  1T39 A;  2K02 A;  1V5F A;  2GQQ A;  2HOE A;  2MLG A;  4NQW B;  5F0H A;  2K5C A;  2DMQ A;  4PFO A;  1HW1 A;  1I6X A;  2IS4 A;  3ABK H;  5CVV A;  4O3M A;  2QEN A;  3MAJ A;  2DK8 A;  3OYD A;  4A5N A;  3LA3 A;  5JVG F;  5LGT A;  1K7A A;  1BI2 A;  4XLC A;  2QLZ A;  1A36 A;  4RB0 A;  2O8K A;  1ZTR A;  3FBI B;  1CQT A;  4L0Y B;  5F0C A;  3TDU C;  3QYF A;  5M3M J;  2F4M B;  2W57 A;  3H9J A;  3OYE A;  1JE8 A;  2LD5 A;  1LKX A;  1MKM A;  2DJN A;  1OCT C;  3RCO A;  3PIP F;  3HOS A;  2E1N A;  3H5N A;  3CJN A;  1R22 A;  4OIQ F;  4E4H A;  2DA2 A;  2LK2 A;  2F4I A;  3K1M A;  2IW5 A;  4HYE A;  3ERE D;  2XPW A;  1BC8 C;  4O5V A;  5LHI A;  4B4C A;  4F93 B;  5LHG A;  2H1L A;  2E60 A;  5EZG A;  4G9Y A;  2Z33 A;  4YFX F;  1AU7 A;  5DS9 A;  1JT6 A;  1GLN A;  2LRD A;  4PJ0 C;  1TQP A;  2PMZ N;  1GT0 C;  2XAJ A;  5CVJ A;  2E71 A;  3SEQ A;  2BVM A;  5E1W A;  4OOI A;  4Q4Z F;  4CUG A;  3Q0V A;  3KZZ A;  3OY9 A;  2BV6 A;  2OZU A;  3WG7 H;  3K1P A;  1Z7U A;  2F5E A;  4RM3 A;  3G3Z A;  2XGE A;  4BBR J;  2DOA A;  1S72 I;  3CUO A;  1JKP C;  4IKF A;  2DFF A;  4OMY A;  3A1Y A;  5JVT A;  2HI3 A;  2O61 A;  1TNS A;  4A3C J;  1HCR A;  3LQR A;  3T8T A;  1E3P A;  2X9D A;  4GO1 A;  4EEF G;  3W6V A;  2L7K A;  1H9T A;  4HLY A;  4U0Y A;  1U9N A;  3GF2 A;  1F4K A;  2MYS A;  4U87 A;  2DTZ A;  3MKY B;  2IP2 A;  2IT0 A;  3ABL H;  2NVY J;  4II3 A;  5JLW A;  1SD4 A;  3N4M A;  1R5G A;  2F5F A;  4KIT B;  4G8X A;  3ESW B;  4Y3O A;  3IKV A;  4MNU A;  5D4S A;  3RPQ A;  4E7I A;  4UUS A;  2M8E A;  3FM5 A;  3NQO A;  2NVU B;  3G2B A;  5KCM A;  3CCU I;  2CQ7 A;  3BPV A;  4RS8 A;  1LEB A;  4PJN A;  2X48 A;  1OCO H;  4EMS A;  2X0L A;  2DTR A;  4XSX F;  3HZJ A;  2ESH A;  1JKQ C;  1K6O A;  2E35 A;  4I99 C;  3HOU J;  1Y6I A;  4I76 A;  1U78 A;  5J40 A;  2HFH A;  4ZTF A;  1S29 A;  4I01 A;  1ENH A;  2W1O A;  3OL3 A;  3LSR A;  2VE9 A;  3B02 A;  2M3A A;  2V4J C;  2EIL H;  1ZGA A;  5EZH A;  2IXS A;  2TRT A;  2EWN A;  1TWC J;  1SAU A;  3SQN A;  1ERD A;  5ILU A;  2DW4 A;  3GXO A;  1NG7 A;  5E18 F;  1YTY A;  2LYC A;  1KU3 A;  2CQQ A;  2VIX A;  4I0A A;  2ESN A;  4PGG A;  4KDP A;  2ZBK A;  2LOO A;  3OYA A;  2EZH A;  4XRF A;  1FWZ A;  2OQR A;  3IWF A;  5KHD A;  2EFQ A;  3RPU D;  5BQT A;  3D5S C;  4PFP A;  3HRT A;  3ZRG A;  4DZP A;  1SEU A;  2GA2 A;  3DLL F;  4BAC A;  2J5P A;  3GFI A;  2V1N A;  4A3I J;  1SD7 A;  2KLO A;  2EV0 A;  2IVM A;  5HNH A;  4RGU A;  1REP C;  4Z6Y A;  2Z2S B;  2LY9 A;  2MH2 A;  3GME A;  4UUV A;  2CH0 A;  2ZJQ F;  4PCQ A;  1J0R A;  3AKZ A;  3WE2 A;  2CV2 A;  2DYS H;  1QPM A;  4XON A;  2GXB A;  2BZT A;  2L3D A;  4DIQ A;  1T2K A;  1FX7 A;  2XV4 S;  5DM7 F;  3D5R C;  4E7L A;  5AIQ A;  1SD5 A;  3RKX A;  1VQN I;  2XAU A;  2EJR A;  4AIJ A;  1BJZ A;  1YW9 A;  3WHC A;  4BXF A;  1DP3 A;  3TGN A;  5E3O A;  1Y39 A;  4EAT A;  1HKQ A;  2DMT A;  5IY5 H;  3ASN H;  4LG0 A;  4XKV A;  2NS7 A;  1X1C A;  4AID A;  4CZZ A;  1HXD A;  4KIC A;  4NDL A;  1HDD C;  1R00 A;  1BBY A;  2HTS A;  4NC8 A;  4BY7 J;  4PSX A;  4D5F A;  4LJZ F;  2EIM H;  3GTL J;  2XF5 A;  2KJC A;  1AWC A;  2IS1 A;  1WPK A;  1Y0U A;  2DT7 B;  3KZY A;  1TC3 C;  5BPI A;  1K79 A;  1GVJ A;  3ROU A;  3HL2 A;  1IN8 A;  5EGO A;  1ETX A;  3ONQ A;  1XGM A;  5ILV A;  2R0Q C;  4U0V A;  1Z67 A;  2EPF A;  2E1M C;  4GYG A;  3RDI A;  3Q5F A;  1D8J A;  5FLX K;  3KZI C;  3E0J B;  5GTH C;  4WXD A;  1W7P A;  4CIC A;  1GXQ A;  3V42 A;  3V7C A;  3OS0 A;  2Z5U A;  1MD0 A;  3JRD A;  3QPL A;  4XOR A;  1ZAR A;  4UV8 A;  3EPZ A;  1G8X A;  3GX4 X;  4HZF A;  1NH3 A;  2IS6 A;  3CTA A;  2IGO A;  3DTI A;  3C3W A;  4YFK F;  2X85 A;  2OA4 A;  1MNM C;  2ELK A;  2QSH X;  1IV6 A;  4A6D A;  1LE8 B;  1Q1V A;  5GAG J;  2DCE A;  1JGG A;  1RKT A;  4IX7 A;  4ENN A;  4BGD A;  2A68 F;  1QU3 A;  4GRI A;  3L2V A;  1GUU A;  2O03 A;  2O8X A;  2E36 A;  2LFB A;  2MD0 A;  3OSF A;  1BL0 A;  1YX3 A;  1ZQ3 P;  1T8I A;  1R5H A;  1BC7 C;  1IXR C;  3IL2 A;  1X1D A;  3BPX A;  1R23 A;  3HKZ A;  3RIR A;  4LOC A;  4HDU A;  4A12 A;  2AQF A;  2M45 A;  3KYD B;  1JTX A;  4JOM A;  1D8K A;  1Z3X A;  4L9V A;  3L2R A;  1P4A A;  2X1D A;  2ZNY A;  2HQA A;  3PJR A;  2DK5 A;  1KZH A;  1ETQ A;  2CUF A;  3GBG A;  2RQP A;  3RYP A;  1Z05 A;  3ERM A;  5FKM A;  1XDS A;  1TBX A;  2V6E A;  2EH3 A;  1BW5 A;  3ECH A;  4AWX B;  2QQA A;  1IN4 A;  5B66 C;  5ICF A;  4XQF A;  3PM1 A;  3ML6 A;  5EEA A;  2EBI A;  3CUQ B;  5CJ9 A;  1MH3 A;  4X6A J;  2O6G E;  4HST A;  2LH9 A;  5D5V B;  5TIS C;  1KQ8 A;  1JHF A;  3R0A A;  3TO6 A;  4C9Y A;  1SD6 A;  1OLT A;  1SVM A;  2HYJ A;  2VQC A;  4L9J A;  1W0U A;  1JJ8 C;  2QBY A;  4Y52 J;  1IDZ A;  1RPW A;  2XB5 A;  3W2A A;  1S7E A;  4B1R A;  4A3L J;  2W00 A;  2HOT A;  2NS8 A;  5HS9 A;  1T56 A;  2JWT A;  2DA1 A;  2A6E F;  4UUT A;  4L5E A;  2A5W A;  1LQ1 A;  5JHU A;  3PO3 J;  1FBU A;  4P9U A;  1V4R A;  4J00 A;  2ISZ A;  1E3O C;  4HBL A;  2R7T A;  4P9F A;  3HOY J;  5EJC A;  5F6F A;  2VLA A;  2JMW A;  3FXL A;  2CUJ A;  4XNF A;  2VKH A;  3A01 B;  3HJE A;  3R60 A;  1BIA A;  3S8P A;  2VOD A;  3LA2 A;  4PGH A;  2UWM A;  3BQZ A;  3JRI A;  5AON A;  2KT0 A;  3BG6 A;  3WGG A;  1OFC X;  2F5C A;  3F3X A;  5F04 A;  4CCN A;  1YW7 A;  1O4X A;  2RKH A;  2XUB A;  4IEJ A;  1X4O A;  3OYK A;  4IHX A;  3DPU A;  1IO2 A;  4KT5 C;  1OJL A;  4A6E A;  4N4N B;  2HXI A;  3PQK A;  3GEZ A;  5C44 J;  2B0L A;  1EJ9 A;  3NEU A;  4D5C A;  2A3S A;  2NNY A;  2JZY A;  3AG2 H;  4KIF A;  1K61 A;  3IHU A;  3IKT A;  2Y0S A;  4KJZ A;  3HEF A;  3L9F A;  3QU3 A;  2BY3 A;  3SEZ A;  3S3O A;  1IV8 A;  1DGR M;  3M8E A;  3FIS A;  4HSR A;  1UZC A;  3LSJ A;  3OYH A;  2RN7 A;  3KE2 A;  3RPU A;  1NK2 P;  5L3G A;  1W0T A;  2PLY A;  3TQN A;  3I5U A;  2OUM A;  2VI6 A;  1V54 H;  3DBH B;  1MGT A;  1VQP I;  3RQ4 A;  3KIO A;  1GDT A;  2I8D A;  2JSP A;  4GXO A;  3HGY A;  4AIH A;  2O5R A;  2VQG A;  3JCU C;  1R49 A;  3AG4 H;  1MDM B;  2LTP A;  1R9T J;  1JKO C;  3GZN B;  4BKX A;  4CCL A;  5GTI C;  2K7L A;  2QQB A;  1OYI A;  1MJA A;  2Q0O A;  2M1B A;  2L01 A;  5FD6 A;  2TDX A;  1ZAO A;  3ZCO A;  3ZOB A;  4XLF A;  2EA4 A;  3BCA A;  1PP7 U;  3WU2 C;  1QZZ A;  5ERI A;  1V3F A;  3KP4 A;  1SC7 A;  4B8X A;  1RC9 A;  4HV5 A;  5D6E A;  3HOZ J;  4LIU A;  1ITY A;  3H3U A;  3CC4 I;  4HQM A;  3M07 A;  1SMT A;  4IQ4 A;  1FLI A;  3EET A;  2R7Q A;  2BW3 A;  2JK3 A;  3C7J A;  3H5A A;  5GAD J;  5FJ8 J;  4I6Z A;  4HX7 A;  4WXC A;  2XKO A;  3U1K A;  2XPU A;  3K4C A;  4G6D A;  2V79 A;  3FHZ A;  1E2X A;  1ZRC A;  2ZNZ A;  4DQ2 A;  3G73 A;  3PO2 J;  2DI3 A;  1VTN C;  2JA5 J;  4OIR F;  3IWZ A;  2WY8 Q;  4JBA A;  3E3V A;  4Y17 A;  2R7D A;  2W82 A;  2HDW A;  3G71 I;  4GDF A;  4KIG A;  2CUE A;  4BJT A;  2DA4 A;  3LSI A;  1QVU A;  5ICC A;  3R0J A;  4OAZ A;  1MW7 A;  1XC5 A;  2CQX A;  1JGS A;  3VOE A;  3FKI J;  3PNT A;  1ACI A;  3RKW A;  2RNG A;  2CW8 A;  3QP6 A;  4OAY A;  2DT6 A;  1FT9 A;  4ON0 A;  2V26 A;  3VYR B;  2CSO A;  3AFH A;  4D1Q A;  3QYB A;  1KU7 A;  1B1B A;  3BR5 A;  1LEA A;  3I56 I;  3PL8 A;  4HNT A;  3C2G A;  4ENK A;  2FOW A;  3F8C A;  2CUZ A;  3JRB A;  4EM2 A;  2K9N A;  4FCY A;  1R1U A;  4XM3 A;  1UST A;  4RGS A;  4ESJ A;  4A3G J;  2PJP A;  4QPQ A;  2BY0 A;  3TMO A;  4W97 A;  3I54 A;  3MZY A;  3K4N A;  1VQM I;  4NC6 A;  1SFX A;  2LKX A;  3S17 J;  3JRC A;  4M9S A;  4E70 A;  4MEX F;  2OCE A;  2H09 A;  5M5W J;  1CF7 A;  4HX4 A;  3HSF A;  3P9I A;  4LK0 F;  2E1M B;  3CMA I;  4OMZ A;  5J4V A;  1NTC A;  3X2Q H;  3ZQF A;  1HBX G;  2PMZ A;  3OWT A;  4XLE A;  4F55 A;  3ZQG A;  2D45 A;  2QKM B;  1EF4 A;  5FRM A;  4FTH A;  4FX4 A;  3DF8 A;  5M3F J;  5BMZ A;  2XKP A;  5FKN A;  3TO7 A;  4A3F J;  3HSE A;  3FK7 A;  1QBJ A;  1X1A A;  1ETY A;  2KZV A;  1D1B A;  2E1C A;  5H6Q A;  1HF0 A;  3GTP J;  4BL0 B;  1P2F A;  5HNF A;  2Y30 A;  3S1R J;  3S14 J;  3CME I;  2R7S A;  2E7W A;  3M1E A;  4QLC U;  1E17 A;  2Z3Y A;  5FRN A;  2K40 A;  1JUS A;  3GYH X;  2M4G A;  3GFM A;  1FY7 A;  2BHZ A;  5D5X B;  3TKY A;  5B1A H;  1MZB A;  3BOQ A;  4XMY A;  3CCV I;  2MG4 A;  1P4X A;  3O3K A;  2D2W A;  3LA7 A;  4YEL A;  1X3U A;  4PJL A;  3C1D A;  1J7K A;  2HNH A;  1TQM A;  3SYT A;  3GZ6 A;  3HHH A;  2XGC A;  4XLP F;  3VWB A;  1ETK A;  2XSJ C;  5GAH J;  1FOY A;  2K9S A;  4NUB A;  3BTL A;  3DKX A;  1Q1H A;  1UG0 A;  4G7H F;  2AS5 F;  5BOX A;  3KYL A;  5IP9 J;  3ZMD A;  2A5Y B;  5FD5 A;  3ZQQ A;  2OCC H;  2X1C A;  2X4H A;  2KDO A;  3H9Q A;  3VB2 A;  2GM4 A;  1KGS A;  4AD9 A;  2O3F A;  5D6F A;  1GVD A;  4ZDL A;  3ZN0 A;  3CO7 C;  4HG2 A;  3LSP A;  1YX5 A;  1ODD A;  1S8N A;  2KIQ A;  1WFX A;  3PUB A;  2HEO A;  2KZG A;  5LBQ A;  3FF5 A;  1G3Y A;  2BGC A;  4Y4R A;  1QPI A;  2DN0 A;  3BP8 A;  3HSR A;  3MD2 A;  2XGD A;  1HA8 A;  3WGI A;  2A05 A;  4M6Y A;  3LFU A;  2XIG A;  2A6T A;  2OZ6 A;  1FYK A;  1U5T A;  2Z9O A;  4UY8 I;  3DPT A;  2L5Q A;  4C3I J;  1X3Z B;  1BM9 A;  1D0Z A;  2JPC A;  5D5W B;  4ETS A;  1BR1 A;  2XC7 A;  2CW7 A;  2V7F A;  1X4P A;  1FOK A;  3R61 A;  3NWS A;  4M3B A;  5E20 A;  3JW4 A;  1OYW A;  5K1Y A;  2VQH A;  1S7O A;  1FC3 A;  2CMP A;  3OYB A;  3JRE A;  2JTV A;  2CJJ A;  5IT9 Z;  5B1B H;  1YIO A;  1YIJ I;  3IRR A;  5DEQ A;  3VYT B;  1A35 A;  2ELJ A;  4ANJ A;  3FIW A;  1XS9 A;  2XHK A;  5FRO A;  2O7O A;  4L0Z B;  1A6I A;  3E5X A;  1G2H A;  2RQQ A;  3MCZ A;  3W6K B;  1Y1V J;  1Y8R B;  1FJL A;  2OPT A;  3DU5 A;  2JA7 J;  2EFP A;  1RUN A;  5EGO B;  1BIB A;  5E3N A;  2DLL A;  1BI1 A;  4C2M J;  2VKE A;  3CO6 C;  1V5E A;  5FO5 A;  4LLL A;  4ZJZ A;  3K7A J;  2JA8 J;  2QCO A;  3K4J A;  2K86 A;  4P55 A;  4MFD A;  2X6W A;  1POG A;  2LKP A;  2HZT A;  4UXN A;  1W7P B;  2HYF A;  4AC0 A;  1P4W A;  2Q1Z B;  3IAS 2;  4JX4 A;  4HW0 A;  3V4G A;  2QYO A;  1K83 J;  3PNY A;  1W7P D;  1UB9 A;  4KN7 X;  4XR6 A;  2R93 J;  2L9S A;  2MC3 A;  3KX2 A;  4UVA A;  2PQ8 A;  3LSK A;  3F21 A;  3LMM A;  4JQF A;  3MEX A;  3Q9V A;  1QGP A;  2Y2Z A;  3BDD A;  3L09 A;  2HPI A;  3OOP A;  4O6J A;  2LBF A;  2VL8 A;  2B9S A;  1P9Q C;  1O7L A;  3K70 D;  1LPQ A;  4LB6 B;  3CCQ I;  1I3A A;  4G7O F;  1FP2 A;  5B3S H;  1QZE A;  1HDP A;  2Y9Y A;  4XLA A;  2O0Y A;  1G6N A;  3WHB A;  2F4O B;  1WVR A;  3ZQI A;  1X1B A;  1MMA A;  2ZCW A;  2ID3 A;  4Y15 A;  1WJF A;  2M34 A;  2GXG A;  1HKS A;  1M1E B;  2YU9 J;  5J3L A;  4FE4 A;  2MAB A;  5A2Q K;  1OCC H;  4OIN F;  1ZRE A;  2VT2 A;  3R4K A;  4E7J A;  1EH6 A;  2MH9 A;  3G1M A;  2BXZ A;  3OIQ A;  2IGM A;  2HVR A;  4ZDP A;  2Q2E B;  3ZR8 X;  4X0G A;  1IJW C;  3I4P A;  1Y0N A;  2CQK A;  2M9H A;  3S15 J;  3OS2 A;  1F5T A;  3T5X A;  4EM1 A;  2BY2 A;  4II2 A;  4ENJ A;  3GUD A;  1VI0 A;  1ZHF A;  3RTR A;  4ZZD A;  4BE1 A;  3J7Z I;  3GTM J;  5FLM J;  3IP4 B;  2PI0 A;  3AL0 C;  2HPM A;  1Y56 A;  1R71 A;  1DPU A;  1J5Y A;  2EZK A;  5DCM A;  3OOU A;  4WF2 A;  2QBY B;  1I5Z A;  1MMG A;  1MNE A;  2WAD A;  1EH8 A;  2EA2 A;  3M9A A;  4DBQ A;  5CKT A;  4NHJ A;  2R7U A;  3FK6 A;  4XOP A;  4G94 A;  2WAQ N;  5E1Z B;  2HOA A;  1W36 D;  1XMA A;  3BCB A;  3E6B A;  2CV0 A;  2DA5 A;  3J81 Z;  3ISP A;  1W5T A;  1D3Y A;  1U5T C;  2M7A A;  2UZK A;  2VQL A;  2PN6 A;  5EG0 A;  2EZL A;  1YOV B;  3LFK A;  3CQZ J;  2LNB A;  2FUG 2;  2JRT A;  1I50 J;  5F0F A;  3FXM A;  3V8K A;  3I55 I;  3WTS C;  2I5U A;  3CDL A;  4HA8 A;  4AUX A;  2LC2 A;  1HOM A;  2VE8 A;  2R7F A;  2VBW A;  3WTZ A;  4L9T A;  2FML A;  2LF8 A;  4HF2 A;  2W7N A;  5GPA A;  2XF7 A;  3K0L A;  1MBJ A;  2YX4 A;  4HDV A;  2HKX A;  4B44 A;  4L5J A;  4ZH4 F;  4BHP A;  2HVQ A;  2ICW G;  1T98 A;  1FYM A;  3JTG A;  4PZJ A;  2DAO A;  3CP2 A;  4DOZ A;  3QOE A;  4EJV A;  5FKL A;  1N78 A;  1A04 A;  2NS0 A;  3BG5 A;  4M3D A;  2F2E A;  4ZYH A;  4XKB A;  4FAS D;  1IRZ A;  2Z16 A;  2IGK A;  3GZ5 A;  1TWH J;  3CCY A;  2NXN B;  4A5M A;  2KMU A;  3S93 A;  1LFU P;  4IOC F;  3L2C A;  1KQ0 A;  5ED4 A;  3RYR A;  4AVZ A;  4BJ6 C;  1Z7L A;  2A61 A;  4BEH A;  3T8R A;  4I02 A;  4KA4 A;  2FJ1 A;  4M3E A;  2KRF A;  3KEO A;  2FBI A;  5LHH A;  1QRY A;  2L4A A;  2ZFW A;  5DDG A;  3CDI A;  2QA4 I;  1K6Y A;  3ABM H;  1TWF J;  3JRG A;  2VON A;  1D0X A;  1T33 A;  1Z6T A;  1Z9C A;  1B59 A;  2MW8 A;  3J7Y J;  1CGP A;  2JN6 A;  1R58 A;  3E5U A;  1IC8 A;  1IW7 F;  5IOZ A;  1BA5 A;  1XGO A;  4CXF A;  9ANT A;  1ZGJ A;  5HLH A;  3W2W A;  2BW3 B;  3HIF A;  4FX0 A;  3BZK A;  5CQE A;  1TWA J;  2CU7 A;  3PSF A;  3CCM I;  1PUF A;  4CHU A;  4B47 A;  1E0E A;  4YG2 F;  2Y0M A;  3HRU A;  5H2F C;  1N75 A;  1WJA A;  1PP8 F;  3K10 A;  2ZJ2 A;  4MQ9 F;  4I0B A;  2VXZ A;  1TNT A;  5EEH A;  3H3Z A;  3SJM A;  2LLK A;  4RGR A;  1HST A;  1YYV A;  4ZTJ A;  3JAM K;  2D5V A;  3J7A Y;  3ZMT A;  3QP5 A;  1YJN I;  1JUM A;  1XCB A;  2DOF A;  3WG9 A;  1MSE C;  2IS2 A;  3DFG A;  3SDG A;  4B09 A;  2JUC A;  4C2U A;  1XPX A;  4IZZ A;  1U3E M;  3OYJ A;  1VND A;  3S1Q J;  2ZME A;  3KLO A;  1XX5 A;  3SFZ A;  3J80 Z;  3AAF A;  4V2G A;  4BXU A;  2L02 A;  3O8G A;  2GXA A;  1DDN A;  2R3S A;  3JRH A;  2VUM J;  1Z3Y A;  4R79 A;  3CJT B;  2WV1 A;  4N4O B;  3TED A;  1WJC A;  1X1P A;  4I7H A;  2EIN H;  2ME0 A;  2W48 A;  4NBQ A;  3VEP A;  2CFX A;  2ZSH B;  3S2W A;  2E2I J;  2XB0 X;  4RA2 A;  2YPR A;  2DO7 A;  4BHC A;  2R5Z B;  4HNV A;  2HVS A;  1UHW A;  4B3A A;  1QQI A;  2K9L A;  2EFW A;  3I4N J;  4I98 B;  3JRA A;  3HM5 A;  2K85 A;  3OMY A;  1EA3 A;  2DT5 A;  4XID A;  2P4W A;  2XDV A;  2QSG X;  4E6K G;  4C2T A;  4NNJ A;  1YS7 A;  1O3T A;  2GZW A;  4R1H A;  4BNC A;  3FBN B;  1WJ5 A;  3E7L A;  2RDP A;  3OYI A;  1CF7 B;  5E79 C;  5K7Z A;  3E6C C;  1HKT A;  3KEY A;  1N77 A;  4GCV A;  1T38 A;  1D1C A;  4DYC A;  4EJO A;  2DQL A;  3V7S A;  2EK5 A;  1X3W B;  2BVL A;  2NYX A;  2FQ3 A;  5K7H A;  4LLN A;  4PUS A;  2RGV A;  5HS7 A;  4P1W A;  2GAU A;  4D7M A;  2Q2E A;  4ZC3 A;  2VOO A;  2KDZ A;  5E17 F;  1B72 A;  1QVT A;  3KET A;  2VKV A;  2R7R A;  4KUM A;  2F5V A;  3WTU C;  5C4J J;  3QPT A;  4TV7 A;  2KRC A;  1QO0 D;  2DOE A;  2VAS A;  2STW A;  3IH3 A;  4RDU A;  4Q47 A;  2K4B A;  1KQ9 A;  3DLA A;  5BPD A;  5L3C A;  3PFI A;  3FXO A;  3HPG A;  2AHQ A;  3TO9 A;  1FBS A;  3Q0U A;  3HBL A;  3S2D J;  5DM6 F;  3FXK A;  5D8K B;  2JVG A;  3HGG A;  4BH9 A;  1HSJ A;  5IYD J;  1MIJ A;  2OC6 A;  3WU0 A;  4BBS J;  2FQ4 A;  4U7D A;  3TP0 A;  1ZK8 A;  3MKZ A;  2MC4 A;  3HTS B;  1IRF A;  1WJD A;  3ZMV A;  2FNA A;  5HLG A;  4KMU X;  3ZQL A;  3F22 A;  4XIC A;  2L9N A;  3A4C A;  5JFR A;  1UHS A;  3WOD F;  4DGW B;  3H35 A;  1JTY A;  3I71 A;  1SAN A;  3BR6 A;  3ZGK A;  2VJI A;  3OIP A;  4F7Z A;  2NVT J;  2IJL A;  1XTA A;  3CMY A;  1Y1W J;  1H0M A;  2CW0 F;  2XRL A;  3Q9S A;  3BWG A;  2IGN A;  4MFE A;  3DKY A;  1WHU A;  3F9K A;  3AL0 B;  3EUH C;  2W4S A;  1YJ9 I;  1MJB A;  3DTK A;  4KIS A;  1O7F A;  2DPU A;  2M7B A;  3SXY A;  2EIJ H;  2QKL B;  4ENM A;  1UG2 A;  3ASO H;  3MKL A;  1MMD A;  4DW6 A;  3M3Y J;  3GTO J;  1TL8 A;  2GIV A;  4WCG A;  1U8B A;  2IEK A;  2KFD A;  2XAF A;  2OBP A;  2LDU A;  1U5T B;  2ZME C;  2FXA A;  4HEA 2;  4F52 A;  1YRN A;  1BW6 A;  3I4M J;  3BZC A;  4UHT A;  2W24 A;  3OSG A;  4CGZ A;  1YE9 A;  1MMS A;  5K5Q A;  2H27 A;  1YHQ I;  4RLF A;  4MTE A;  2A07 F;  3KP6 A;  2L0K A;  3FXU A;  3D0S A;  4PJJ A;  3DP7 A;  2A69 F;  3TBI A;  1SFO J;  4MO7 A;  2RC4 A;  1G59 A;  3PQJ A;  5CQG A;  3G4S I;  1YW8 A;  1I6H J;  2DQR A;  5D8L B;  4XL9 A;  5HLT A;  1P7J A;  1FBQ A;  3A2K A;  1RIO H;  2YS9 A;  2PEX A;  2WTE A;  2ZO4 A;  3Q0W A;  3S1M J;  2VOP A;  4AYB N;  3FXR A;  1WSU A;  4Q48 A;  1KYZ A;  1MMN A;  3GO5 A;  1YG2 A;  4BS9 A;  3I53 A;  3CCL I;  3N05 A;  4XSZ F;  3G1O A;  1QHG A;  1RES A;  1D0Y A;  3PFY A;  3TOB A;  3VFZ A;  1VQ4 I;  5DV5 A;  4D0P A;  2ME6 A;  4BYY A;  5EEG A;  2FMY A;  1BI0 A;  2K4J A;  1R7J A;  4LG3 A;  1XMX A;  2WB1 N;  4PSW A;  3GLL A;  1UMQ A;  3TW6 A;  3ZMU A;  2LBF B;  2F48 A;  1AOY A;  2XPV A;  1TQI A;  3ZMS A;  3DTE A;  4EVI A;  1IN7 A;  3QAH A;  1S6L A;  4P96 A;  1XGN A;  1B9N A;  5AIP A;  3FXQ A;  5K5R A;  3B73 A;  1PVE A;  2P8T A;  1VZ0 A;  5JI6 A;  3I9V 2;  4RM2 A;  1UFM A;  4A0Z A;  2ZJP F;  4LB5 A;  2PX9 A;  4FET A;  2MFZ A;  4IRH A;  2P6T A;  3E6M A;  1ZKG A;  4CA0 A;  3SDB A;  2R5Z A;  1HW5 A;  1IUF A;  2XAS A;  5DD8 A;  1EKE A;  2CGP A;  2DBB A;  1O57 A;  3GWZ A;  4EV0 A;  1RR7 A;  5HDN A;  4IO9 F;  4A0Y A;  1IZ1 A;  2DMU A;  2H6C A;  3DV8 A;  2IA0 A;  1OR7 C;  2BY1 A;  2COB A;  2OV7 A;  2YR2 A;  3IH2 A;  2E34 A;  4HPQ A;  2GIZ A;  2VB6 A;  1LDD A;  1VQK I;  5CVU A;  3L00 A;  5DCM B;  3FHN A;  5EF6 A;  4LIT A;  1U0J A;  4G12 A;  2DA6 A;  2ZB9 A;  4ESB A;  3HRM A;  5J1Y A;  2HWV A;  3P7N A;  3LAP A;  3BG9 A;  3HYI A;  3VPR A;  2L54 A;  3W3C A;  1SFU A;  1JKR C;  2P0W A;  1T95 A;  4DYR A;  3LAJ A;  5J4Y A;  4YII A;  1Z6R A;  4BQA A;  3GCM A;  1L0O C;  1P7I A;  2W25 A;  1XSX A;  3L2Q A;  1LDJ A;  1WGX A;  2YU3 A;  3BTC A;  5EG0 B;  2KIM A;  3OYN A;  2FRH A;  4G6Q A;  2XAG A;  4ZYA A;  1V5G A;  3G6E I;  1T08 B;  3W2V A;  4PJM A;  1A5J A;  1FIA A;  5LRR A;  2WAQ A;  1J9I A;  2KRH A;  4QWQ A;  5JR3 A;  2H1K A;  4A3M J;  1IRG A;  1OMI A;  3S1N J;  3PNV A;  2XRN A;  2JJ7 A;  1KON A;  5H20 A;  2F6C A;  3BT9 A;  3HHG A;  1E3H A;  2Y31 A;  1PYV A;  3AG1 H;  5HDG A;  2ADU A;  1OPC A;  1SVL A;  3FKJ A;  2XSD C;  3DQV C;  1GV2 A;  1XD7 A;  2V9P A;  2ECC A;  3CMM A;  3CP8 A;  5ICE A;  1DUX C;  1ETW A;  3BJ6 A;  3BY6 A;  1I1G A;  4DJA A;  3BR1 A;  3T1B A;  2JQ7 A;  4C30 A;  5IP6 A;  2TCT A;  2HYG D;  4EGZ A;  1FTZ A;  4QPO A;  4I09 A;  4WX9 A;  1DQU A;  4BDY A;  2FNP A;  2Y75 A;  1TTY A;  1OIS A;  1TWG J;  4DZJ A;  4V19 K;  1ZR4 A;  3GFL A;  1KU9 A;  4MIM A;  5LRS A;  2P5L C;  4QIW N;  2DXI A;  4UB8 C;  3UKG A;  1ZEL A;  4BEH B;  3KP2 A;  4CDG A;  2VPL A;  2HGC A;  3QPH A;  2DFH A;  2KP6 A;  1OYY A;  1K4S A;  5CVR A;  4LGW A;  3TW7 A;  2L4M A;  2PMH A;  4FHT A;  3S2H J;  1WCM J;  1SFK A;  2HKO A;  4IHV A;  4A3J J;  2ZFU A;  3DEU A;  3FMQ A;  3Q3S A;  4L9N A;  1U2W A;  3BLY A;  2KL4 A;  3F8B A;  2EQR A;  1RET A;  3DCF A;  5LD2 C;  3BTI A;  3SFI A;  3QOP A;  3ECO A;  2K27 A;  4ITV A;  1ZLJ A;  3QYE A;  1IG7 A;  1ON2 A;  3QWL A;  2M0M A;  1PUF B;  4A93 J;  1S5L C;  1DU0 A;  2VKD A;  4U0W A;  2IRF G;  2FE3 A;  3HUG A;  5BNG A;  2QQ8 A;  3FXJ A;  1R4M B;  3H9G A;  4L18 B;  2NRA C;  1YQA A;  5FLV A;  3ZN1 A;  2KKO A;  3LST A;  3OIO A;  2QF7 A;  4YFN F;  1SMY F;  4XOT A;  2EFO A;  2ZJR F;  3CCJ I;  2QEX I;  1BI3 A;  1LUJ B;  4HRI A;  3QPS A;  2F5D A;  2KIF A;  5K7F A;  4CYC A;  2E1O A;  2ZME B;  5DCF A;  3OYL A;  4KMF A;  4IQJ A;  3HOV J;  4GFB A;  2HR3 A;  3WTV C;  4BE0 A;  3GFJ A;  3LL7 A;  5F1J A;  3JAM Z;  3WGH A;  2AQE A;  2EV6 A;  2FOK A;  3I0T A;  4AU7 A;  2L7M P;  2CV1 A;  1VQ5 I;  5LLQ A;  3HG9 A;  1IGN A;  4BDZ A;  2DU9 A;  1U8R A;  3A0H C;  5E3L A;  4Q5S F;  3B6C A;  2RV8 A;  2DPD A;  4JX6 A;  2FSW A;  2ZSI B;  4XLN F;  1HW2 A;  5FLX Z;  2HXO A;  2IA1 A;  3LOC A;  5HOD A;  4YIR X;  3UR3 C;  4MTD A;  3M1C A;  4R8H A;  3H0G J;  1LFB A;  2B7E A;  3HOT A;  2ACJ A;  1MND A;  3K9T A;  2FU4 A;  2BYV E;  1IAW A;  3MZH A;  3EYY A;  4LLG F;  2L9V A;  1OCR H;  3J7A O;  4U88 A;  1ZG3 A;  3MKW B;  3JRF A;  3F8N A;  4L5I A;  1WJB A;  2LR8 A;  1MJ9 A;  2M0C A;  3C2B A;  4ESF A;  4D9J A;  2JA2 A;  1J2X A;  1NG6 A;  3ULQ B;  3M4O J;  5E8G A;  3K2A A;  3S3N A;  2JPB A;  3KFW X;  1TLH B;  2QZ8 A;  3DKW A;  3EDP A;  3CUQ C;  4GGG A;  3PIO F;  2VJ4 A;  3BG7 A;  2LP0 A;  4Y13 A;  3G1L A;  2VT3 A;  5LGU A;  4H0E A;  1B72 B;  1D5Y A;  5D4R A;  1XSV A;  4RAF A;  1R1T A;  4F91 B;  2QSF X;  1YI2 I;  2BE5 F;  2VJJ A;  4XRS G;  1TW2 A;  3I3L A;  4M74 A;  4E7K A;  2YX7 A;  1R1V A;  3OV8 A;  4BUP A;  2GOM A;  3HC7 A;  1ZR2 A;  1OCZ H;  2P7V B;  4X1E A;  5J47 A;  1UAA A;  3QOD A;  4KT6 A;  5HLI A;  1F36 A;  2OTL I;  1SFE A;  2G7H A;  5FFX A;  3H5R A;  4A3B J;  1JXS A;  3AG3 H;  1DP7 P;  4P5O A;  2WA0 A;  3F23 A;  4EGY A;  3MQ0 A;  3IAM 2;  4RGX A;  2H8R A;  3F8F A;  4U7B A;  1OCP A;  3ZQC A;  1HC8 A;  1Z91 A;  1FYL A;  3H0D A;  3KLN A;  1FTT A;  3CCS I;  2XAQ A;  3MWM A;  2EFN A;  4YRV A;  4ZYD A;  1PDN C;  2H6B A;  3KP3 A;  3WTX C;  1WI3 A;  4EQQ A;  1LFP A;  2WAF A;  1R36 A;  3VDX A;  2QQ9 A;  1ZGW A;  1QHH D;  2JUG A;  4M3F A;  1MBK A;  2BBY A;  2STT A;  2X6X A;  4KN4 X;  4WK8 F;  2NOG A;  4D7N A;  1G3W A;  3U1D A;  3ZXS A;  4BXX J;  6PAX A;  2VBY A;  4Y7N J;  1GXP A;  2FBK A;  2KIS A;  1Z21 A;  4S04 A;  3ZMZ A;  3RKQ A;  3TP3 A;  3CD6 I;  2OU2 A;  2VBX A;  1JUP A;  3CDH A;  3LSH A;  4MQV A;  1YRN B;  5GAE J;  4MGR A;  2E19 A;  2HS5 A;  3HDD A;  4QSH A;  3GTK J;  4KFC A;  2CO5 A;  4RAG A;  3NAU A;  1LDK B;  1OKR A;  1T0F C;  1X58 A;  1XB4 A;  1ETO A;  2LG4 A;  2UXN A;  4M3G A;  4S0H B;  3FZV A;  1VQ6 I;  2IPQ X;  2M4K A;  3K4B A;  4QTR A;  3CCE I;  2HOS A;  2LF7 A;  4CZC A;  1TW3 A;  5C3E J;  1RR8 C;  5IYC J;  5DUI A;  3L7W A;  2ETH A;  1TP4 A;  4AIK A;  1B8I A;  2AXT C;  2R5Y B;  3CZ6 A;  3K6G A;  4LFU A;  4J19 A;  1ZG5 A;  2PJR A;  5L3D A;  2E7X A;  4MEY F;  3H3V K;  4N9I A;  2CWE A;  2G7U A;  2RAE A;  1GV5 A;  1P6R A;  4RAY A;  5J8F A;  4CCM A;  4PK4 A;  3BQY A;  4IL6 C;  4JX5 A;  4UVC A;  1AHD P;  2QGU A;  2XVC A;  3GW2 A;  3BJA A;  2KJB A;  1QNT A;  4B43 A;  1BR4 A;  2DMN A;  3FMS A;  4DBR A;  4HNU A;  1ULY A;  3OYC A;  4RAZ A;  3DBL B;  1WH5 A;  4G7Z F;  3IC7 A;  1WH7 A;  4FIS A;  4FQG A;  2QWW A;  1B9M A;  3ABU A;  2MA3 A;  1O3Q A;  2E2J J;  4XN0 A;  2V1U A;  1X19 A;  1ORK A;  1RI7 A;  5DD4 A;  4IHT A;  3EUH A;  1DU6 A;  3UNG C;  2E5N A;  2FBH A;  1K78 A;  2DDA A;  4AYB A;  1UHM A;  3W6J B;  3LSM A;  5TRD A;  3SZP A;  5IT9 K;  4CH7 A;  1X2M A;  4A2U A;  1TT0 A;  4XRM A;  3F0C A;  2HQ5 A;  2ISY A;  5M5Y J;  2R7O A;  3RZO J;  4DYQ A;  2R4G A;  1ZH5 A;  2OQG A;  1XDU A;  1IN6 A;  4B3X A;  1W1W E;  2K9M A;  3OR2 C;  3H92 A;  3C2H A;  5IT3 A;  5F64 A;  5DUK A;  3S3M A;  1A31 A;  2XGX A;  2HQR A;  4BY1 J;  2VXD A;  4EJW A;  1ZLK A;  4HF1 A;  4M71 A;  3KPH A;  3WTT C;  2WB1 A;  3RI4 A;  1EV7 A;  1FPQ A;  4M9Z A;  1H89 C;  1VFC A;  2QUF A;  5FKK A;  1FNN A;  2D1V A;  3I59 A;  3GLX A;  3DWL E;  2L7Z A;  4UV9 A;  2PFB A;  3WU1 B;  4IRG A;  2FX0 A;  2H8W A;  4FE7 A;  1FSH A;  1VF9 A;  2OTJ I;  3E5Q A;  2R7X A;  1RKW A;  1JHH A;  1BOA A;  5HOO A;  2BXY A;  3GTQ J;  1DPR A;  4N0B A;  2O9L A;  1FMW A;  1D5V A;  2R7W A;  3BRO A;  3DEW A;  1R4N B;  3C18 A;  4IPA A;  1H88 C;  2WC2 A;  3WE3 A;  3JTH A;  4IHY A;  2NVQ J;  5M5X J;  4NQW A;  5IYB J;  3OYM A;  3QU6 A;  1B6A A;  2K3P A;  4G6T B;  2NAZ A;  2MD5 A;  2V9V A;  5B5E C;  4S05 A;  3QRF F;  2FEZ A;  2KPM A;  2VC0 A;  2KHM A;  3A03 A;  3KYC B;  3EUA A;  1WJE A;  2LY2 A;  3VSK A;  1LB2 A;  4LIV A;  4M6X A;  1KYW A;  3VYS B;  3HB9 A;  3N97 A;  4HAM A;  1DGW Y;  2MGQ A;  1FIP A;  3BR0 A;  1AA7 A;  2YUS A;  4HF0 A;  1S3J A;  2CFO A;  1BR2 A;  3LSG A;  1WI9 A;  2XF6 A;  4CCK A;  2EV5 A;  4BHB A;  1G3T A;  4RLQ A;  2DA7 A;  3DBR B;  1VQ7 I;  2L2O A;  5KAI C;  5L3B A;  2VPR A;  1FMV A;  2VBZ A;  3BTJ A;  3RSN A;  1Z0X A;  3E1S A;  3MVP A;  2R7Z J;  2V1D A;  1U9O A;  3OR1 C;  1WQ2 A;  3GVA A;  1ONV A;  3U21 A;  3CCR I;  4M73 A;  4IOA F;  1IUY A;  2GWR A;  3GTJ J; 
#chains in the Genus database with same CATH homology
 5HS8 A;  3F72 A;  4CYD A;  4ZZL A;  5FB2 A;  4EJT A;  3BJO A;  1USS A;  1WWX A;  4LMY A;  3F6V A;  3M7G A;  2XRO A;  4IJA A;  3NRV A;  1NHA A;  3K1N A;  3P9C A;  2M30 A;  4FT8 A;  2IA2 A;  5ILS A;  3ZPL A;  3J81 K;  4KYW A;  4N9H A;  4M72 A;  4OU0 A;  1OR7 A;  3JSP A;  5LGN A;  4RB3 C;  5FGM A;  2CG4 A;  1B4A A;  2HQN A;  1WRJ A;  1STZ A;  4M9X A;  5LEK A;  1IN5 A;  3TOA A;  3EQL F;  4IXA A;  1FP1 D;  1ZYR F;  4LD5 A;  2WWY A;  3REO A;  1LVA A;  1O3R A;  3DXJ F;  5CLS A;  3M8F A;  4HOB A;  3MFK A;  1U6G A;  1LNW A;  3LQQ A;  5J6X A;  4EJU A;  2VC1 A;  2CYY A;  2V1X A;  3FWE A;  3JSO A;  4JK1 X;  2DFI A;  5CYV A;  1ON1 A;  4A0X A;  4UNO A;  3V8J A;  2COM A;  5L3F A;  1PUE E;  2QVO A;  4ASN A;  3F8M A;  2V6C A;  4CO8 A;  1Z1D A;  1XMK A;  3FMR A;  1FZP B;  3E97 A;  2FF4 A;  3WTY C;  4Z2Y A;  2W84 A;  2D1H A;  3ZQ7 A;  1I1S A;  3U2R A;  2GA1 A;  2VN2 A;  4LK1 F;  4AVP A;  5KK1 A;  2JSC A;  2KIU A;  3DPL C;  1RUO A;  3TDZ C;  4UVB A;  5L3E A;  1W5S A;  2PBI A;  3HTU A;  1S7A A;  5K5O A;  1SAX A;  1WKM A;  3R6S A;  4K2E A;  3RJP A;  3FM3 A;  5CVI A;  2JT1 A;  3J80 K;  1YO5 C;  1HQC A;  3O6B B;  3T0Y A;  3ELK A;  4HQE A;  3VOD A;  1XSD A;  3LWF A;  1H9G A;  2P5K A;  4WXH A;  1YS6 A;  3EYI A;  1I27 A;  3CLO A;  2C6Y A;  1IF1 A;  2M87 A;  5A2Q Z;  3HRS A;  4GYI A;  1G3S A;  2OD5 A;  2MLK A;  3K69 A;  4PDK A;  1ZRF A;  4IF4 A;  1XCV A;  3D5L A;  1YFH A;  2WV0 A;  1RZ4 A;  2H94 A;  3ZP5 A;  3I64 A;  5H6R A;  2AXL A;  4HLX A;  1IXS B;  1EH7 A;  4IRI A;  3KP5 A;  5FFZ A;  1ZRD A;  1LJ9 A;  1G4D A;  1BJA A;  3E6D A;  4KNY A;  3FX3 A;  2RVC A;  4EM0 B;  3KEQ A;  2PG4 A;  3F6O A;  2QM3 A;  3V8L A;  4HX8 A;  3CUQ A;  5E1X A;  1T6S A;  2ZKZ A;  1KU2 A;  5HDK A;  2A6H F;  1YLF A;  4IVN A;  3SZT A;  2J5O A;  4YIF A;  5ICG A;  3KP7 A;  1BN5 A;  3O2P E;  2P6S A;  2LSO A;  2ZXJ A;  4KIB A;  4RB2 C;  4I2O A;  3V7R A;  3ABT A;  3K2Z A;  4MHG A;  1XGS A;  1C0W A;  3U9G A;  2NNN A;  2G9W A;  2P7C B;  5J8C A;  5BS6 A;  1ZG1 A;  4XBF A;  2ELH A;  1J75 A;  2Q8K A;  3KCC A;  3RKY A;  2W85 A;  1UCR A;  5TJJ A;  1F1Z A;  4OIO F;  1K78 B;  3SHF A;  5HVQ C;  2EB7 A;  2BEO A;  4OIP F;  1L3L A;  2P5V A;  2OAZ A;  3WTW C;  2YSR A;  1KA8 A;  2HTJ A;  1W4M A;  4ZYE A;  4NB5 A;  4BAY A;  4RB1 A;  4LG0 B;  1MDM A;  5LEJ A;  4WWC A;  5F1R A;  2RNJ A;  2HDC A;  1IXC A;  1P92 A;  1XN7 A;  5DYM A;  2Y48 A;  1FSE A;  4HV6 A;  3BZ6 A;  1T0F A;  3P9K A;  2Z99 A;  4DNC A;  1O3S A;  1F9N A;  2MBF A;  1J59 A;  5D5U B;  1QZY A;  2FA5 A;  4IHS A;  3I59 B;  1GHC A;  5KVR A;  5E8I A;  2M5W A;  3COA C;  3IRQ A;  1ZN2 A;  2PMU A;  3I58 A;  1RNL A;  4ZYG A;  1T39 A;  2UXX A;  2XAH A;  2K02 A;  2GQQ A;  2HOE A;  2MLG A;  1HW1 A;  1I6X A;  5CVV A;  4O3M A;  2QEN A;  3MAJ A;  2DK8 A;  4A5N A;  3LA3 A;  5LGT A;  1K7A A;  1BI2 A;  2QLZ A;  4RB0 A;  4L0Y B;  3TDU C;  2W57 A;  1JE8 A;  1MKM A;  3HOS A;  2E1N A;  3CJN A;  1R22 A;  4OIQ F;  3K1M A;  3ERE D;  4HYE A;  2IW5 A;  1BC8 C;  4O5V A;  5LHI A;  5LHG A;  2Z33 A;  4G9Y A;  4YFX F;  1TQP A;  2XAJ A;  5CVJ A;  5E1W A;  4OOI A;  4Q4Z F;  3KZZ A;  2BV6 A;  2OZU A;  3K1P A;  1Z7U A;  2F5E A;  3G3Z A;  3CUO A;  4OMY A;  5JVT A;  2O61 A;  1TNS A;  3LQR A;  3T8T A;  4GO1 A;  1H9T A;  4HLY A;  4U0Y A;  3GF2 A;  1F4K A;  2IP2 A;  2IT0 A;  1SD4 A;  3N4M A;  1R5G A;  2F5F A;  4G8X A;  3IKV A;  4MNU A;  5D4S A;  3RPQ A;  2M8E A;  3FM5 A;  3NQO A;  3BPV A;  4RS8 A;  1LEB A;  4EMS A;  2X0L A;  2DTR A;  4XSX F;  2ESH A;  1K6O A;  1U78 A;  2HFH A;  1S29 A;  4I01 A;  2VE9 A;  3B02 A;  1ZGA A;  2EWN A;  3SQN A;  5ILU A;  2DW4 A;  3GXO A;  5E18 F;  1YTY A;  1KU3 A;  4I0A A;  2ESN A;  4PGG A;  4KDP A;  2ZBK A;  4XRF A;  1FWZ A;  2OQR A;  3IWF A;  2EFQ A;  5BQT A;  3HRT A;  2GA2 A;  2J5P A;  3GFI A;  1SD7 A;  2EV0 A;  2IVM A;  1REP C;  4RGU A;  2MH2 A;  4UUV A;  4PCQ A;  1J0R A;  3WE2 A;  1QPM A;  2GXB A;  2L3D A;  1T2K A;  1FX7 A;  2XV4 S;  5AIQ A;  1SD5 A;  3RKX A;  2EJR A;  4AIJ A;  1YW9 A;  3TGN A;  1HKQ A;  4LG0 A;  4CZZ A;  1HXD A;  4KIC A;  1R00 A;  1BBY A;  2HTS A;  4LJZ F;  2KJC A;  1AWC A;  1Y0U A;  3KZY A;  5BPI A;  1K79 A;  1GVJ A;  3ROU A;  1IN8 A;  1XGM A;  5ILV A;  4U0V A;  3RDI A;  3Q5F A;  4GYG A;  1D8J A;  5FLX K;  4WXD A;  1W7P A;  4CIC A;  1GXQ A;  3V7C A;  2Z5U A;  1MD0 A;  1ZAR A;  4UV8 A;  3GX4 X;  4HZF A;  3CTA A;  3C3W A;  4YFK F;  2OA4 A;  4A6D A;  4ENN A;  2A68 F;  2O03 A;  2O8X A;  1R5H A;  1BC7 C;  1IXR C;  3IL2 A;  3BPX A;  1R23 A;  3RIR A;  4HDU A;  4A12 A;  2M45 A;  1D8K A;  4L9V A;  1P4A A;  2ZNY A;  2DK5 A;  3RYP A;  2RQP A;  1Z05 A;  1XDS A;  1TBX A;  3ECH A;  4AWX B;  2QQA A;  1IN4 A;  5ICF A;  3ML6 A;  3CUQ B;  5CJ9 A;  2O6G E;  5D5V B;  1KQ8 A;  1JHF A;  3R0A A;  3TO6 A;  1SD6 A;  4L9J A;  2QBY A;  5HS9 A;  2A6E F;  1LQ1 A;  5JHU A;  1FBU A;  4P9U A;  1V4R A;  2ISZ A;  4HBL A;  4P9F A;  5F6F A;  3R60 A;  1BIA A;  2VOD A;  3LA2 A;  4PGH A;  2UWM A;  5AON A;  3WGG A;  2F5C A;  3F3X A;  1YW7 A;  2RKH A;  2XUB A;  4KT5 C;  4A6E A;  3PQK A;  3GEZ A;  2B0L A;  3NEU A;  2A3S A;  2NNY A;  2JZY A;  4KIF A;  3IHU A;  3IKT A;  3L9F A;  3QU3 A;  3M8E A;  2RN7 A;  3KE2 A;  3RPU A;  2PLY A;  5L3G A;  3TQN A;  3I5U A;  1MGT A;  4GXO A;  4AIH A;  1MDM B;  2K7L A;  2QQB A;  1OYI A;  1MJA A;  2Q0O A;  2M1B A;  2L01 A;  5FD6 A;  2TDX A;  1ZAO A;  2EA4 A;  1PP7 U;  1QZZ A;  5ERI A;  1V3F A;  3KP4 A;  4B8X A;  4HV5 A;  5D6E A;  3H3U A;  4HQM A;  1FLI A;  1SMT A;  3EET A;  3C7J A;  4HX7 A;  4WXC A;  2XKO A;  4G6D A;  2V79 A;  3FHZ A;  1E2X A;  1ZRC A;  2ZNZ A;  4DQ2 A;  3G73 A;  2DI3 A;  1VTN C;  4OIR F;  3IWZ A;  4JBA A;  3E3V A;  4Y17 A;  2R7D A;  4KIG A;  5ICC A;  3R0J A;  1JGS A;  3VOE A;  3RKW A;  3QP6 A;  1FT9 A;  4ON0 A;  2CSO A;  1KU7 A;  1B1B A;  1LEA A;  4ENK A;  3F8C A;  4EM2 A;  1R1U A;  1UST A;  4RGS A;  4ESJ A;  2PJP A;  3I54 A;  3MZY A;  1SFX A;  4M9S A;  4E70 A;  4MEX F;  2H09 A;  1CF7 A;  4HX4 A;  3HSF A;  3P9I A;  4LK0 F;  4OMZ A;  1HBX G;  2D45 A;  4FX4 A;  3DF8 A;  5BMZ A;  2XKP A;  3TO7 A;  3HSE A;  1QBJ A;  2E1C A;  5H6Q A;  1P2F A;  2E7W A;  3M1E A;  4QLC U;  1E17 A;  2Z3Y A;  3GYH X;  3GFM A;  1FY7 A;  5D5X B;  3TKY A;  1MZB A;  3BOQ A;  3O3K A;  1P4X A;  2D2W A;  3LA7 A;  1X3U A;  3C1D A;  1J7K A;  1TQM A;  3GZ6 A;  3HHH A;  4XLP F;  1Q1H A;  4G7H F;  2AS5 F;  5BOX A;  3ZMD A;  2A5Y B;  5FD5 A;  2X4H A;  3VB2 A;  1KGS A;  4AD9 A;  2O3F A;  5D6F A;  3ZN0 A;  3CO7 C;  1ODD A;  1S8N A;  2HEO A;  5LBQ A;  3FF5 A;  1G3Y A;  2BGC A;  3BP8 A;  3HSR A;  3WGI A;  4M6Y A;  2XIG A;  2OZ6 A;  1FYK A;  1U5T A;  2Z9O A;  3DPT A;  1BM9 A;  2JPC A;  5D5W B;  4ETS A;  1FOK A;  3R61 A;  5E20 A;  3JW4 A;  1OYW A;  5K1Y A;  1S7O A;  1FC3 A;  2JTV A;  5IT9 Z;  1YIO A;  3IRR A;  5DEQ A;  2XHK A;  4L0Z B;  3E5X A;  3MCZ A;  3W6K B;  2EFP A;  1RUN A;  1BIB A;  2DLL A;  1BI1 A;  3CO6 C;  5FO5 A;  4LLL A;  4P55 A;  2K86 A;  2LKP A;  2HZT A;  4UXN A;  1W7P B;  2HYF A;  1P4W A;  4HW0 A;  3V4G A;  2QYO A;  1W7P D;  1UB9 A;  4KN7 X;  2MC3 A;  4UVA A;  2PQ8 A;  3F21 A;  4JQF A;  3MEX A;  3Q9V A;  1QGP A;  3BDD A;  3L09 A;  3OOP A;  4O6J A;  3RYR A;  4A0Z A;  1O7L A;  4LB6 B;  4G7O F;  1FP2 A;  2O0Y A;  1G6N A;  2ZCW A;  4Y15 A;  2GXG A;  1HKS A;  5A2Q K;  1ZRE A;  4OIN F;  2VT2 A;  3R4K A;  1EH6 A;  2MH9 A;  3I4P A;  2CQK A;  1F5T A;  3T5X A;  4EM1 A;  4ENJ A;  3GUD A;  1ZHF A;  3RTR A;  4ZZD A;  2PI0 A;  1DPU A;  1J5Y A;  5DCM A;  4WF2 A;  2QBY B;  1I5Z A;  1EH8 A;  2EA2 A;  3M9A A;  4NHJ A;  4G94 A;  5E1Z B;  1XMA A;  3E6B A;  3J81 Z;  3ISP A;  1W5T A;  1D3Y A;  1U5T C;  2UZK A;  2PN6 A;  3LFK A;  2LNB A;  2JRT A;  3V8K A;  3WTS C;  4HA8 A;  2VE8 A;  2R7F A;  2VBW A;  3WTZ A;  4L9T A;  2FML A;  2LF8 A;  4HF2 A;  3K0L A;  2YX4 A;  4HDV A;  2HKX A;  4L5J A;  4ZH4 F;  4BHP A;  1FYM A;  1T98 A;  3JTG A;  4PZJ A;  2DAO A;  4EJV A;  1A04 A;  2NS0 A;  4ZYH A;  2F2E A;  3GZ5 A;  4A5M A;  3L2C A;  1KQ0 A;  5ED4 A;  2A61 A;  3T8R A;  4I02 A;  4KA4 A;  2KRF A;  3KEO A;  2FBI A;  5LHH A;  2L4A A;  2ZFW A;  5DDG A;  2VON A;  1Z6T A;  1Z9C A;  1B59 A;  1CGP A;  1R58 A;  3E5U A;  1IW7 F;  1XGO A;  4CXF A;  1ZGJ A;  5HLH A;  4FX0 A;  3HIF A;  4CHU A;  4YG2 F;  2Y0M A;  3HRU A;  1PP8 F;  2ZJ2 A;  4MQ9 F;  4I0B A;  2VXZ A;  1TNT A;  5EEH A;  3H3Z A;  4RGR A;  1HST A;  1YYV A;  3JAM K;  3ZMT A;  3QP5 A;  1XCB A;  3WG9 A;  3DFG A;  4B09 A;  1U3E M;  2ZME A;  3KLO A;  3SFZ A;  3J80 Z;  3AAF A;  4BXU A;  2L02 A;  1DDN A;  2R3S A;  4R79 A;  4I7H A;  3VEP A;  2CFX A;  3S2W A;  2YPR A;  2DO7 A;  4BHC A;  1UHW A;  1QQI A;  2EFW A;  4I98 B;  2DT5 A;  2P4W A;  1O3T A;  1YS7 A;  2GZW A;  4R1H A;  4BNC A;  2RDP A;  1CF7 B;  3E6C C;  1HKT A;  4GCV A;  1T38 A;  4EJO A;  2DQL A;  3V7S A;  2EK5 A;  2NYX A;  2FQ3 A;  4LLN A;  2RGV A;  5HS7 A;  2GAU A;  2Q2E A;  2VOO A;  5E17 F;  3KET A;  4KUM A;  3WTU C;  3QPT A;  4TV7 A;  1QO0 D;  2STW A;  4Q47 A;  2K4B A;  1KQ9 A;  5BPD A;  5L3C A;  3PFI A;  3TO9 A;  1FBS A;  5D8K B;  4BH9 A;  1HSJ A;  3WU0 A;  4U7D A;  3HTS B;  1IRF A;  3ZMV A;  2FNA A;  5HLG A;  4KMU X;  3F22 A;  5JFR A;  3WOD F;  3I71 A;  4F7Z A;  2IJL A;  1H0M A;  2CW0 F;  3Q9S A;  3BWG A;  1MJB A;  1O7F A;  2DPU A;  3SXY A;  4ENM A;  2GIV A;  4WCG A;  2XAF A;  2OBP A;  2LDU A;  1U5T B;  2FXA A;  4UHT A;  2W24 A;  4CGZ A;  5K5Q A;  2H27 A;  4MTE A;  2A07 F;  3KP6 A;  3FXU A;  3D0S A;  3DP7 A;  2A69 F;  2RC4 A;  3PQJ A;  1YW8 A;  2DQR A;  5D8L B;  1FBQ A;  1RIO H;  2PEX A;  2WTE A;  2ZO4 A;  2VOP A;  3FXR A;  1WSU A;  4Q48 A;  1KYZ A;  3GO5 A;  1YG2 A;  3I53 A;  4XSZ F;  3TOB A;  3VFZ A;  5DV5 A;  4D0P A;  4BYY A;  5EEG A;  2FMY A;  1BI0 A;  2K4J A;  1R7J A;  3ZMU A;  1AOY A;  1TQI A;  3ZMS A;  4EVI A;  1IN7 A;  3QAH A;  1S6L A;  4P96 A;  1XGN A;  1B9N A;  5AIP A;  3FXQ A;  5K5R A;  3B73 A;  2P8T A;  5JI6 A;  1UFM A;  4LB5 A;  4IRH A;  2P6T A;  3E6M A;  1HW5 A;  2XAS A;  5DD8 A;  2CGP A;  2DBB A;  1O57 A;  3GWZ A;  4EV0 A;  5HDN A;  4A0Y A;  1IZ1 A;  2H6C A;  3DV8 A;  2IA0 A;  2YR2 A;  1LDD A;  5CVU A;  3L00 A;  5DCM B;  4ESB A;  3HRM A;  2HWV A;  3P7N A;  3LAP A;  3HYI A;  2L54 A;  1SFU A;  3LAJ A;  4YII A;  1Z6R A;  4BQA A;  1L0O C;  2W25 A;  1XSX A;  1LDJ A;  2YU3 A;  2KIM A;  2FRH A;  4G6Q A;  2XAG A;  5LRR A;  1J9I A;  4QWQ A;  5JR3 A;  1IRG A;  1OMI A;  2XRN A;  5H20 A;  3HHG A;  5HDG A;  2ADU A;  1OPC A;  3DQV C;  1XD7 A;  1DUX C;  5ICE A;  3BY6 A;  3BJ6 A;  1I1G A;  3T1B A;  2HYG D;  4EGZ A;  4I09 A;  4WX9 A;  2FNP A;  2Y75 A;  1TTY A;  3GFL A;  1KU9 A;  5LRS A;  2P5L C;  3KP2 A;  4CDG A;  2HGC A;  3QPH A;  1OYY A;  5CVR A;  4LGW A;  2L4M A;  2PMH A;  4FHT A;  2HKO A;  3DEU A;  3FMQ A;  4L9N A;  1U2W A;  3F8B A;  3QOP A;  3ECO A;  2K27 A;  1ZLJ A;  1ON2 A;  4U0W A;  2IRF G;  2FE3 A;  3HUG A;  4L18 B;  2NRA C;  1YQA A;  3ZN1 A;  2KKO A;  3LST A;  4YFN F;  1SMY F;  2EFO A;  1BI3 A;  2F5D A;  2KIF A;  4KMF A;  2ZME B;  5DCF A;  2HR3 A;  3WTV C;  3GFJ A;  3JAM Z;  3WGH A;  2EV6 A;  2FOK A;  3I0T A;  5LLQ A;  2DU9 A;  1U8R A;  4Q5S F;  2RV8 A;  2DPD A;  2FSW A;  4XLN F;  1HW2 A;  5FLX Z;  2IA1 A;  4MTD A;  4R8H A;  3HOT A;  2ACJ A;  3K9T A;  2FU4 A;  2BYV E;  1IAW A;  3MZH A;  3EYY A;  4LLG F;  3J7A O;  4U88 A;  1ZG3 A;  3F8N A;  4L5I A;  1MJ9 A;  4ESF A;  1J2X A;  3ULQ B;  5E8G A;  2JPB A;  3KFW X;  1TLH B;  2QZ8 A;  3DKW A;  3EDP A;  3CUQ C;  4GGG A;  4Y13 A;  2VT3 A;  5LGU A;  4H0E A;  5D4R A;  1XSV A;  1R1T A;  2BE5 F;  1TW2 A;  4M74 A;  2YX7 A;  1R1V A;  3OV8 A;  2P7V B;  5HLI A;  1SFE A;  2G7H A;  5FFX A;  1JXS A;  1DP7 P;  4P5O A;  3F23 A;  4EGY A;  3MQ0 A;  4RGX A;  3F8F A;  4U7B A;  1Z91 A;  1FYL A;  3KLN A;  2XAQ A;  3MWM A;  2EFN A;  4ZYD A;  1PDN C;  2H6B A;  3KP3 A;  3WTX C;  4EQQ A;  1R36 A;  2QQ9 A;  2BBY A;  2STT A;  4KN4 X;  4WK8 F;  1G3W A;  3U1D A;  6PAX A;  2VBY A;  1GXP A;  2FBK A;  4S04 A;  3ZMZ A;  2OU2 A;  2VBX A;  3CDH A;  4MQV A;  4MGR A;  2HS5 A;  4KFC A;  2CO5 A;  1LDK B;  1OKR A;  1XB4 A;  2UXN A;  3FZV A;  2IPQ X;  2LF7 A;  1TW3 A;  5DUI A;  3L7W A;  2ETH A;  4AIK A;  4LFU A;  1ZG5 A;  5L3D A;  2E7X A;  4MEY F;  4N9I A;  2CWE A;  2G7U A;  1P6R A;  4RAY A;  5J8F A;  4UVC A;  2XVC A;  3GW2 A;  3BJA A;  2KJB A;  1QNT A;  3FMS A;  1ULY A;  4RAZ A;  4G7Z F;  3IC7 A;  2V1U A;  1O3Q A;  2QWW A;  1B9M A;  3ABU A;  2MA3 A;  1RI7 A;  5DD4 A;  4IHT A;  3EUH A;  2FBH A;  1K78 A;  1UHM A;  3W6J B;  5TRD A;  3SZP A;  5IT9 K;  4A2U A;  2ISY A;  1ZH5 A;  2OQG A;  1XDU A;  1IN6 A;  3H92 A;  5IT3 A;  5F64 A;  5DUK A;  2XGX A;  2HQR A;  4EJW A;  1ZLK A;  4HF1 A;  4M71 A;  3WTT C;  3RI4 A;  1EV7 A;  1FPQ A;  4M9Z A;  2QUF A;  1FNN A;  2D1V A;  3I59 A;  3GLX A;  3WU1 B;  4UV9 A;  2PFB A;  4IRG A;  1FSH A;  3E5Q A;  1JHH A;  1BOA A;  5HOO A;  1DPR A;  4N0B A;  1D5V A;  3BRO A;  3C18 A;  4IPA A;  2WC2 A;  3WE3 A;  3JTH A;  4NQW A;  3QU6 A;  1B6A A;  2NAZ A;  2MD5 A;  2V9V A;  4S05 A;  3QRF F;  2FEZ A;  2VC0 A;  1LB2 A;  4M6X A;  1KYW A;  3N97 A;  4HAM A;  4HF0 A;  1S3J A;  1WI9 A;  2EV5 A;  4BHB A;  1G3T A;  5L3B A;  2VBZ A;  2V1D A;  1WQ2 A;  3GVA A;  1ONV A;  4M73 A;  1IUY A;  2GWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...