4EJVA

Staphylococcus epidermidis tcar in complex with chloramphenicol
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
147
structure length
135
Chain Sequence
IEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator TcaR
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
total genus 48
structure length 135
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejvA00
3ZN1A 2AXLA 2FSWA 1H9TA 2X0LA 3B02A 1K78B 2FRHA 5L3BA 1ZARA 1KA8A 2P6SA 3F6OA 4GGGA 4WXHA 5E17F 4ENMA 2MH9A 3ABTA 2HEOA 2KRFA 3PFIA 1HW5A 2UZKA 3GYHX 3HOTA 3WTTC 1ZGAA 2FQ3A 3AAFA 3L7WA 5FFXA 5BS6A 1F1ZA 2PEXA 1Q1HA 2MD5A 3KP4A 2XAQA 1T0FA 1XD7A 3V8LA 3H3UA 3RKYA 4BH9A 4L9NA 1BIAA 4KDPA 1YQAA 4ENJA 1SD4A 5HOOA 1YW9A 3J80Z 3KP7A 1MD0A 4KIGA 4P9UA 1RIOH 2GA2A 4EM0B 1R5GA 4MQVA 1QNTA 4CXFA 4U0VA 2MLGA 4KN7X 3HHGA 3GFLA 2DK8A 3HSFA 2P6TA 1LEBA 3LQQA 1LJ9A 2W25A 3EQLF 1Z6TA 4I01A 5K5OA 4NQWA 4E70A 4BHPA 2KIUA 2AS5F 4A0ZA 3L09A 4RGUA 5E20A 1XSVA 1B1BA 3ZMUA 1U78A 4HV6A 2Z99A 4LJZF 4PZJA 3MAJA 4AIJA 1GXQA 2ZBKA 3FMRA 1YFHA 3MZHA 2YX4A 4LMYA 2A6HF 1AOYA 2KJCA 3L2CA 2ZXJA 4GCVA 3KP2A 5L3FA 1XGSA 2DQLA 2OZUA 3BJAA 2EK5A 3HRSA 4M73A 4WX9A 3BY6A 1REPC 4U7BA 2D45A 4RAYA 1ULYA 3P7NA 1J0RA 2GA1A 3M8FA 2RQPA 4N9HA 1IXCA 1DPRA 5F64A 4NB5A 5DDGA 3F8CA 5BPIA 3HTSB 3IHUA 1KQ8A 1BI1A 3IKTA 1WQ2A 3BWGA 2P5KA 2YSRA 4U0YA 2COMA 2IRFG 1KYWA 2P5LC 3Q9SA 2OA4A 2IA1A 2E1CA 4Z2YA 2EA4A 1W7PD 1OKRA 2FBIA 2W85A 3WTXC 1SAXA 3I5UA 2GXGA 3HSRA 5DD8A 4XSZF 1XGMA 3E6DA 3MEXA 1TW3A 1F5TA 5FO5A 4OIRF 5ICCA 4LLLA 2QQBA 1IUYA 2CWEA 2E7WA 3TDUC 2VE9A 1JHFA 4A6DA 2VT3A 2A6EF 1B9NA 4CHUA 1BIBA 2HR3A 3TO7A 2WC2A 4GO1A 1HSTA 3R4KA 1MJBA 2RV8A 4L9JA 4OU0A 5CJ9A 1BI3A 3HRUA 3WGGA 1FP1D 3K1MA 2CG4A 2MH2A 3H3ZA 1U5TC 4YFKF 3DEUA 2VOPA 3DF8A 1O7FA 1KQ0A 3K1NA 1IXSB 1VTNC 4KMFA 4XBFA 4EQQA 2XAFA 2EWNA 2EJRA 1RNLA 3QP6A 2CFXA 1QQIA 4P96A 5E8GA 4KN4X 5AIQA 1YTYA 1UHWA 1D8KA 3IRQA 1DP7P 4HDVA 3CO6C 1BOAA 1S8NA 4YFXF 3WG9A 1L3LA 1F4KA 2CYYA 3KP6A 2DFIA 3U1DA 1PDNC 4OIOF 3QPHA 4HLXA 3FZVA 4UXNA 5K1YA 1YW7A 4FT8A 5DUKA 1Z7UA 1ZRFA 1MJ9A 3TGNA 2LKPA 2V1UA 2C6YA 3RPUA 2FE3A 2UXXA 2Z3YA 3R0AA 5JHUA 4N9IA 1HKTA 4M71A 5TRDA 4O5VA 2PN6A 2XIGA 3N97A 2F5CA 4PGHA 3FMQA 1UB9A 3QPTA 1RUOA 4A5MA 2K02A 4Q48A 3C3WA 4YIIA 2CQKA 5DUIA 4EGYA 2K4BA 2K27A 4MGRA 4B8XA 2A3SA 1BBYA 3IL2A 1R22A 1P2FA 2UXNA 3DPTA 1E2XA 5KK1A 3QAHA 4IHTA 2HKOA 1HSJA 2EFOA 2M1BA 3N4MA 2ELHA 1G3TA 3WU0A 3SXYA 3WGIA 1ONVA 2HFHA 3TOBA 2FXAA 4Q47A 3MZYA 1I5ZA 4EJWA 1FYMA 3TO9A 1S29A 2YX7A 3FXRA 4WXDA 2W57A 3BP8A 2H27A 2OZ6A 3IKVA 5E8IA 2OBPA 1FPQA 5FGMA 1BN5A 4G94A 2VE8A 1BC8C 3JSPA 4IVNA 3KEQA 1LDJA 4L5JA 3CUQB 5HLGA 1AWCA 2YR2A 1T98A 5LGNA 2RKHA 4WWCA 5IT9K 4JQFA 1R5HA 4G8XA 1IAWA 3O2PE 1ZAOA 1R1TA 1G3WA 3CLOA 3ECOA 1JE8A 2VODA 2RGVA 1LQ1A 1IW7F 1YG2A 3KLOA 2HYFA 5LHIA 3RI4A 2DI3A 5HDKA 5DV5A 1XCBA 3ISPA 2QLZA 4MEXF 2DO7A 5CVVA 3V7CA 1XSDA 2R3SA 2QENA 3H92A 1IF1A 2XROA 3RDIA 2ISZA 2XV4S 2H6CA 1TNSA 2ESHA 5F1RA 1ZRDA 2ZJ2A 5LHGA 5BQTA 2CGPA 3GW2A 1S6LA 3QU3A 4BHBA 1B4AA 2NAZA 2IT0A 1KU3A 3F72A 5D5WB 3K69A 2QUFA 2OQRA 2IVMA 3F22A 4ENNA 2XASA 4A2UA 1ZYRF 3VB2A 1ZREA 1X3UA 4R8HA 2DU9A 2O3FA 3JW4A 3HIFA 3WTWC 2VBXA 3TOAA 2P8TA 2D1VA 4RB0A 3BROA 1HW1A 1DDNA 4CZZA 4QWQA 2HS5A 1QGPA 3F23A 4DNCA 3C18A 4MTEA 2ZNZA 2P7VB 4ESFA 3TO6A 2J5OA 5LLQA 1V4RA 2QVOA 5JI6A 4S04A 2STWA 4L9VA 2H94A 3GWZA 4R79A 2PFBA 1FBUA 3HRMA 3V8KA 1SFUA 5E1XA 5HDNA 3CUQC 3VFZA 2HYGD 2BEOA 1GXPA 4LFUA 4WCGA 5LRSA 2ZFWA 3I54A 1LDDA 2EFQA 2L02A 2VC0A 3E6MA 4A0XA 2O6GE 4HX7A 3T1BA 3WU1B 2GZWA 3RKWA 4LK1F 1W7PA 4ASNA 4MHGA 1FP2A 3ZN0A 2L4MA 3ELKA 2FOKA 3J80K 5H20A 3I4PA 3FHZA 3LSTA 5LGTA 2Y0MA 2V1XA 1R58A 3ZMZA 4JBAA 3COAC 4L9TA 2ZKZA 5D5XB 1TQIA 3R0JA 1RZ4A 3RYRA 1QO0D 1XCVA 2HTSA 3PQKA 3V8JA 3I59A 1R1UA 1ON1A 5K5RA 1I27A 1ZG5A 4G7ZF 3WTYC 5F6FA 4FHTA 2IA0A 1TW2A 1LNWA 2QBYA 5J6XA 4A12A 4OIPF 4ZH4F 3LAJA 1Z91A 4L0YB 2JZYA 5ILSA 3LWFA 4ETSA 4EV0A 3EUHA 3SZTA 2NNYA 4GYIA 3MCZA 1IN5A 2BV6A 3FXUA 3KE2A 3GVAA 3KCCA 3IWFA 2Y48A 4I0BA 5E1ZB 1HW2A 2FBKA 2Q0OA 1XDUA 4KNYA 3JAMZ 1SFXA 2V9VA 3BDDA 1TBXA 1BC7C 3GX4X 4PDKA 3EYIA 1FBSA 1P4XA 1T6SA 1HKSA 2DT5A 1PP7U 3E5XA 3U9GA 4LG0A 3BJ6A 5TJJA 3FMSA 2Q2EA 3V7RA 3E3VA 4ESBA 1YIOA 2ISYA 2G7UA 2LNBA 3C7JA 1FT9A 3G3ZA 3I58A 3WTVC 2HWVA 2IP2A 5HS8A 1T39A 4XSXF 4EGZA 3ZQ7A 3HUGA 2XGXA 2DTRA 4UUVA 1YO5C 5K5QA 3KFWX 4KUMA 1L0OC 3M8EA 5DYMA 4HV5A 5CVIA 2EV5A 1Y0UA 1DUXC 1WWXA 5FB2A 2V6CA 5D6FA 4HW0A 1SD6A 1OYIA 2L4AA 4I98B 3CO7C 2G9WA 3GZ6A 2LF7A 3ZMVA 2P7CB 1OR7A 5HS9A 4XRFA 1HXDA 3KP5A 5CVUA 2OU2A 4EVIA 4ZYDA 3JSOA 3CDHA 1QBJA 1SMYF 3GF2A 4I7HA 2MLKA 1UHMA 1XDSA 4Y15A 5KVRA 3Q5FA 4KMUX 1W4MA 3HOSA 1I1GA 1ZLKA 3C1DA 1FLIA 4RGXA 4UV8A 2YU3A 4EM2A 2ZCWA 4P55A 1R00A 1USSA 5CYVA 3FM5A 1MDMA 4P5OA 3I64A 1OPCA 4I02A 2HZTA 1D8JA 5CVJA 4RB3C 3GZ5A 5A2QK 4CYDA 4OIQF 3T8RA 5A2QZ 2KIFA 2QQ9A 1XB4A 3TQNA 1FNNA 2VOOA 4KIBA 4BHCA 5ILUA 4M74A 4OINF 4B09A 2CO5A 1U8RA 1P4AA 1WSUA 2O03A 3V7SA 1XMKA 1T2KA 3BPVA 2Q8KA 2ZMEA 2RVCA 1O3TA 1J7KA 4EJOA 3JTGA 3VOEA 3IC7A 4BYYA 2QYOA 1GVJA 3DP7A 2DAOA 4M9XA 2M45A 5DCMA 4BQAA 3KP3A 3KEOA 3J81K 1EH6A 1FY7A 4MNUA 3J81Z 2XAGA 1F9NA 2LF8A 2RNJA 2A07F 2PMUA 1A04A 4F7ZA 4MEYF 1R23A 1STZA 2X4HA 2PMHA 1B9MA 2WWYA 1ZG3A 4YG2F 5L3GA 1H9GA 1WRJA 1U5TA 4ZYGA 5L3CA 2M8EA 2R7FA 1TQPA 1IRGA 4PGGA 3BOQA 5D4RA 3CTAA 4HX4A 4LD5A 4L5IA 3E97A 2BYVE 3ULQB 1B6AA 5FFZA 1CF7A 1ZHFA 4EMSA 1W7PB 2FNAA 5E18F 2HDCA 3CUOA 2F5FA 2B0LA 2HQRA 2EFNA 2ADUA 1XGOA 1FYLA 4N0BA 3Q9VA 3B73A 4IRIA 3J7AO 4R1HA 2BGCA 4LK0F 2JT1A 3REOA 4M6YA 1FBQA 4A5NA 3GXOA 2VN2A 1USTA 1LDKB 2CSOA 1TTYA 3I59B 3BZ6A 3KZZA 4HYEA 4IHSA 3ZMTA 2EFWA 4I0AA 2QBYB 1QZYA 1G3YA 2M87A 1FSEA 1XMAA 4G9YA 2VBZA 5AIPA 4HX8A 2XKPA 1FOKA 5LGUA 3ZMSA 2R7DA 3D5LA 5IT3A 4H0EA 4CICA 4CGZA 2RN7A 1XSXA 4I09A 5D4SA 5FLXK 1UFMA 4HF0A 2E7XA 5DEQA 2ZO4A 5FLXZ 3O6BB 2HGCA 5D6EA 1J2XA 2OD5A 4UHTA 1I1SA 3FF5A 2K4JA 5HLHA 1RI7A 4WK8F 1O57A 5EEHA 2HOEA 1R36A 2FMYA 3EYYA 4BNCA 4U7DA 4NHJA 3V4GA 4G6QA 3S2WA 4JK1X 3LAPA 3L00A 4LG0B 1YW8A 4L0ZB 3DQVC 3GEZA 3RYPA 4P9FA 2K86A 3LFKA 2PI0A 5ED4A 3ERED 4KA4A 3F8BA 3GO5A 2GXBA 4PCQA 2GAUA 1CGPA 3T5XA 2M5WA 5E1WA 2DW4A 5FD5A 3W6KB 2VT2A 3M9AA 1D5VA 3ZP5A 3R61A 5JVTA 4ZZLA 3P9KA 4AD9A 2VBYA 2BBYA 2Y75A 2E1NA 4EJUA 3T0YA 4HZFA 2F5DA 4RGSA 5BOXA 1S7AA 4G7OF 5LRRA 3DFGA 1R1VA 2RC4A 3GFMA 1B59A 4OMYA 1U3EM 5HDGA 5LEJA 5LBQA 6PAXA 1BI0A 5CVRA 4DQ2A 4UVBA 2ACJA 2VBWA 5AONA 5JR3A 1BJAA 3LA7A 2Z33A 2MA3A 5LEKA 2ETHA 2O0YA 2XKOA 4IF4A 3LA3A 3SFZA 1MGTA 3TDZC 4HBLA 3SHFA 2EV0A 3SZPA 3E6CC 1TQMA 3EDPA 4UVAA 1YS7A 1C0WA 1P4WA 1TNTA 3MQ0A 2V79A 5J8FA 4Y13A 4G6DA 5ICFA 1Z05A 3KLNA 4FX0A 1FC3A 1TLHB 1MDMB 2D1HA 3GFJA 3RJPA 4LB5A 1ZH5A 1MJAA 1NHAA 2OAZA 4Y17A 4IPAA 2FNPA 2UWMA 2FU4A 2MC3A 3P9CA 4HF2A 3BPXA 3VEPA 1IN7A 5D8LB 1SD5A 2DPDA 4RAZA 5H6QA 5JFRA 2W24A 2ZMEB 1KU2A 2CW0F 1RUNA 5D8KB 3PQJA 1XGNA 2EA2A 1S3JA 2HQNA 5DCMB 1FYKA 3JTHA 4AVPA 1U2WA 1T38A 4U88A 3CUQA 1U6GA 2LSOA 1O3SA 3FX3A 2DBBA 3JAMK 2KKOA 3NEUA 2PJPA 3D0SA 3VODA 1WKMA 4QLCU 3QRFF 4UVCA 3GFIA 2L3DA 2GWRA 4EJVA 2JRTA 4AWXB 1UCRA 1XN7A 2XUBA 4M72A 1J5YA 4EM1A 2G7HA 3ABUA 4FX4A 3I71A 1OYYA 5D5VB 3GUDA 1U5TB 1BI2A 5DD4A 3R6SA 4LLGF 2XAHA 1J9IA 4ZYHA 1IZ1A 2A61A 3I0TA 5HVQC 3ROUA 1MZBA 4EJTA 4UV9A 3IRRA 1CF7B 1PP8F 1IN6A 3NRVA 3IWZA 3T8TA 1G4DA 1FSHA 2XVCA 3W6JB 3F8MA 3I53A 2NS0A 1EV7A 4OMZA 2FBHA 2NRAC 5BPDA 3EETA 5J8CA 3QOPA 3WTZA 1KGSA 5BMZA 3P9IA 1KU9A 1G3SA 2J5PA 1EH7A 1BM9A 1QPMA 3F6VA 3KZYA 3ZMDA 3M7GA 2A69F 1WI9A 3HTUA 2STTA 4K2EA 4I2OA 3DKWA 3K9TA 3FM3A 1K78A 1ZRCA 3M1EA 3TKYA 4L18B 4M9SA 3WE2A 2Z9OA 1EH8A 4XLNF 3BJOA 3QU6A 1H0MA 4KICA 1K79A 3DV8A 1ZG1A 5ICEA 4HQEA 2DPUA 3HSEA 4ZZDA 5D5UB 5L3EA 3LA2A 1O3RA 4HDUA 5L3DA 2M30A 3RPQA 4WF2A 2VXZA 4HA8A 1P92A 2FA5A 1OMIA 3KETA 4BAYA 3MWMA 2KIMA 2FMLA 2BE5F 2K7LA 1W5SA 2ESNA 4AIKA 1I6XA 4KIFA 2IJLA 1Z9CA 1K6OA 1P6RA 2H09A 3DPLC 4RGRA 5EEGA 2PQ8A 1HBXG 2PBIA 4IRHA 3NQOA 1K7AA 4O6JA 2F2EA 4M6XA 5HLIA 4WXCA 2P4WA 3G73A 4D0PA 4XLPF 4HQMA 4CDGA 4MTDA 2NYXA 1OYWA 2IW5A 2OQGA 2H6BA 4IJAA 3F21A 2LDUA 3F8FA 4IXAA 3E5UA 1S7OA 2P5VA 4LGWA 3LQRA 1YLFA 3OV8A 4GXOA 4ON0A 1E17A 4OOIA 1MKMA 2HKXA 2GQQA 3CJNA 4RB2C 3RIRA 1DPUA 1IXRC 4IRGA 3RKXA 3U2RA 3WTUC 2A68F 2WTEA 4LB6B 1PUEE 1W5TA 3K0LA 1IN8A 2DLLA 5DCFA 3E5QA 2XAJA 2XRNA 3K1PA 4HOBA 5ERIA 4Q5SF 4RS8A 5HS7A 1FX7A 1O7LA 2JTVA 2QM3A 1FZPB 4O3MA 4A0YA 4U0WA 3MFKA 2QZ8A 3ECHA 1LVAA 1KQ9A 2KJBA 2A5YB 1YYVA 2DQRA 3WE3A 1IN4A 2VONA 1Z6RA 2JPBA 4MQ9F 1IRFA 2RDPA 4TV7A 2TDXA 2QQAA 4RB1A 5LHHA 2W84A 1V3FA 2L54A 4UNOA 3WODF 2O61A 3QP5A 1FWZA 4S05A 3L9FA 1ZN2A 4A6EA 1SMTA 2VC1A 1QZZA 3F3XA 3WTSC 2Z5UA 1ZLJA 3ML6A 3F8NA 1SFEA 1SD7A 4ESJA 1JXSA 1JGSA 4G7HF 4HF1A 3O3KA 3FWEA 2L01A 3R60A 2EFPA 1GHCA 4ENKA 1KU7A 3ZPLA 3E6BA 3WGHA 3HRTA 2YPRA 3RTRA 2D2WA 4Q4ZF 1ODDA 4GYGA 3SQNA 3OOPA 1D3YA 3FXQA 2HTJA 1G6NA 2MBFA 5IT9Z 1ZGJA 1ON2A 1KYZA 3HYIA 4M9ZA 1YS6A 4KYWA 2ZNYA 2JSCA 2XHKA 1R7JA 2WV0A 1HQCA 2PLYA 2F5EA 3DXJF 2O8XA 1JHHA 2V1DA 2DK5A 4HAMA 2IPQX 4BXUA 2IA2A 2FF4A 2GIVA 4ZYEA 3HHHA 2QWWA 2FEZA 4KT5C 5CLSA 4HLYA 5ICGA 3K2ZA 1J75A 1LEAA 2JPCA 2NNNA 1Z1DA 4CO8A 5H6RA 2PG4A 2EB7A 3GLXA 5ILVA 4YFNF 4LLNA 4KFCA 1O3QA 1HKQA 1LB2A 1J59A 2EV6A 4AIHA 5FD6A 4YIFA
chains in the Genus database with same CATH superfamily
1SFKA 5M5YJ 3ZN1A 2AXLA 2FSWA 3ZQHA 3F0CA 1H9TA 2X0LA 3B02A 1K78B 2FRHA 3A0BC 4Y52J 5L3BA 1ZARA 3L1PA 2JWTA 1VQPI 4QSHA 1KA8A 2M4GA 3PJRA 2P6SA 3FHNA 4A69C 1GT0C 1TT0A 3F6OA 4GGGA 3N05A 2KL4A 4NDLA 4V2GA 3FBIB 3H9JA 4WXHA 1DU0A 5E17F 1U8BA 2XPWA 1H89C 4ENMA 1O4XA 1IC8A 2MH9A 3ABTA 5B1AH 3MN2A 3OYEA 2KT0A 2HEOA 2KRFA 3OS2A 3PFIA 1HW5A 2UZKA 3GYHX 3HOTA 2K3FA 4B48A 5IOZA 3WTTC 1ZGAA 4QPOA 2X6WA 3ABMH 2EZKA 4BXFA 5F1JA 2FQ3A 2Z16A 3AAFA 3OYJA 2IGNA 4RLFA 1R4NB 2R7QA 3L7WA 4DYRA 5FFXA 5BS6A 1F1ZA 2PEXA 3MKYB 1Q1HA 2MD5A 3KP4A 2XAQA 1JJ8C 1OFCX 1T0FA 2EPFA 1XD7A 3V8LA 3H3UA 3RKYA 3SYTA 1MMDA 4BH9A 4L9NA 3S1MJ 2XPVA 3LSJA 1BIAA 4KDPA 3S1QJ 1YQAA 5JLXA 4ENJA 1SD4A 1BA5A 3HZJA 5HOOA 4V2FA 4IHWA 1YW9A 3J80Z 1AKHB 5JLWA 1T08B 2R93J 1SEUA 3KP7A 2ZXHA 1MD0A 3LSKA 3BLYA 5K7FA 4NC7A 4KIGA 3SDGA 4P9UA 1RIOH 4BGDA 2GA2A 4EM0B 1R5GA 2CV1A 4JYKA 4XICA 4MQVA 3CDIA 3KPHA 1QNTA 3FBNB 4U0VA 2MLGA 4CXFA 4KN7X 4A93J 3HHGA 1WHUA 3KX2A 3GFLA 3OIOA 2DK8A 4BQNA 3HSFA 2CMPA 2LY2A 2P6TA 3CCJI 1LEBA 2KDZA 3H5RA 3LQQA 1LJ9A 2X85A 2W25A 4XLFA 2DN0A 1FEXA 3DBRB 2X6YA 1ETYA 3GTMJ 3EQLF 1JUMA 1Z6TA 1TWCJ 1A35A 4AIDA 2R7UA 3AL0C 4I01A 1JT0A 5K5OA 1MMGA 4NQWA 1N25A 4E70A 4BHPA 2KIUA 3I3LA 3CCEI 2LLKA 2AS5F 1ITYA 3M1CA 4A0ZA 3L09A 1Y1WJ 5IYCJ 3UKGA 4RGUA 4LITA 2B63J 5E20A 2BW3A 1YHQI 5K7HA 1XSVA 1WJFA 1B1BA 3ZMUA 1U78A 2NXNB 2IS2A 4HV6A 2BXYA 2Z99A 4LJZF 4PJLA 1RPWA 1VQ7I 4PZJA 3J7AY 3MAJA 4B4CA 4AIJA 3HOYJ 1GXQA 1YE9A 2ZBKA 3FMRA 1YFHA 3MZHA 1OR7C 5KHDA 2YX4A 1VQ5I 3HC7A 5J1YA 4LMYA 2A6HF 1AOYA 2HYJA 2P81A 4CSWA 4NBQA 3G6EI 1SVOA 2KJCA 3ASOH 1D0ZA 1YX3A 5EG0B 3G1LA 3L2CA 2ZXJA 2LY9A 3A01B 4GCVA 1Z21A 2E5ZA 3KP2A 5L3FA 2E5NA 1XGSA 2DQLA 2EIKH 3GZNB 1YJNI 2OZUA 3BJAA 2ME6A 3V42A 1Z77A 2BVLA 2EK5A 3AG2H 3HRSA 4M73A 4WX9A 3BY6A 1REPC 4U7BA 3OS0A 5KAFC 2D45A 2VKDA 3JRGA 4RAYA 1VQNI 2KDOA 1ULYA 2N8GA 2F4OB 2MG4A 5FLVA 3P7NA 4XLHA 1J0RA 2GA1A 3M8FA 2RQPA 4N9HA 5EZGA 1H8AC 4XLCA 4BEHA 4V19K 5HNFA 3K6GA 1IXCA 1DPRA 3HB9A 5F64A 4NB5A 1TZLA 4CCNA 5DDGA 4PFPA 5BNGA 3F8CA 5BPIA 2K40A 5GPCA 1JGGA 3HTSB 1HF0A 1MW7A 3IHUA 2X1DA 1BI1A 1KQ8A 1DGWY 3IKTA 1WQ2A 4EEFG 3BWGA 3OOUA 2HDDA 2P5KA 2YSRA 1H88C 4XKVA 3BZKA 4U0YA 2COMA 4A3KJ 1KYWA 2IRFG 5DS9A 2P5LC 1MSEC 3FK6A 2IAIA 3Q9SA 2OA4A 2IA1A 2E1CA 4ITVA 1NK2P 4Z2YA 2EA4A 1E3PA 1W7PD 4RM2A 1M1EB 1WJAA 1T95A 1OKRA 2MW8A 1X3ZB 4W97A 1LPQA 2QKMB 2LBFA 2FBIA 2W85A 3WTXC 1SAXA 1LKXA 2Z2SB 3I5UA 4FCYA 1ZR2A 2GXGA 2LY1A 3HSRA 2ZMEC 1QU3A 5DD8A 3WU2C 2K3PA 3CCUI 1Y6IA 2HPIA 4XSZF 1XGMA 2KFDA 2V9KA 1V54H 3E6DA 3MEXA 4YRVA 1TW3A 1F5TA 2CRGA 3OYIA 1X4OA 2FJ1A 5FO5A 5FKLA 1Y8RB 3CQZJ 4OIRF 3VWBA 5ICCA 1FOWA 4LLLA 2QQBA 1IUYA 2UUZA 5HNHA 4G12A 1G59A 2CWEA 2E7WA 2ZSHB 1JKRC 1OCOH 4D9JA 4UY8I 2WY8Q 3TDUC 2VE9A 4ZDOA 2VPRA 1JHFA 4A6DA 3BT9A 2VT3A 3SZGA 2A6EF 1B9NA 2X6OA 3MZ8A 4CHUA 1JKQC 2BHZA 1BIBA 4PSWA 4XRSA 4FISA 2IS4A 3ABLH 4E6KG 2IGKA 2IEKA 2M7AA 2HR3A 3TO7A 4X6AJ 2G0EA 2WC2A 4GO1A 3GBGA 3OYMA 3DKYA 1HSTA 4D5CA 3S17J 2FX0A 2DA5A 3R4KA 1MJBA 2RV8A 3WHBA 4L9JA 4OU0A 5CJ9A 3DU5A 1BI3A 3HRUA 3WGGA 1VQ8I 1FP1D 3K1MA 2CG4A 3J7ZI 2MH2A 2ZJPF 3H3ZA 1U5TC 1I50J 2XRLA 4YFKF 2BXZA 4C2MJ 3DEUA 3S8PA 2VOPA 1WJBA 3DF8A 4XKWA 1O7FA 4XORA 2QQ8A 1KQ0A 3HOVJ 3K1NA 1IXSB 1MNEA 1VTNC 3OSGA 4KMFA 4XBFA 4EQQA 2XAFA 1JTXA 3I9V2 2BY0A 2EWNA 2EJRA 4XQFA 3HBLA 1RNLA 3QP6A 2CW7A 2CFXA 1QQIA 3K70C 2ICWG 3CCRI 4P96A 1VQKI 1DGRM 2XF5A 3D5RC 1S9HA 3K4BA 5E8GA 1XPXA 4KN4X 4PUSA 3CD6I 5AIQA 3ZQLA 1YTYA 1XMXA 1NG6A 1UHWA 1D8KA 4ZTJA 3IRQA 1DP7P 2OTLI 4OAZA 1HCRA 4HDVA 1IDZA 3CO6C 3RQIA 1BOAA 1S8NA 4YFXF 3WG9A 4IOCF 4LG3A 2PMZN 1L3LA 3W6VA 1F4KA 4A3FJ 4IZZA 1G8XA 1TC3C 2GIZA 4LIVA 1Z7LA 4XNFA 1GV2A 2CYYA 2JA5J 3KP6A 2V26A 1WI3A 2VASA 2JUCA 2DFIA 2RAEA 3U1DA 1PDNC 2VL8A 4OIOF 3QPHA 4HLXA 2QSHX 3FZVA 4UXNA 5EJCA 1JJ6C 5K1YA 3LFUA 2E2JJ 1YW7A 4FT8A 5DUKA 1Z7UA 1MBFA 2X51A 3S1RJ 4HRIA 1ZRFA 1OQYA 5E3OA 3M3YJ 1MJ9A 1AA7A 3TGNA 1RRJA 2O9LA 2LKPA 3HJEA 3K2AA 2V1UA 2C6YA 2W48A 1OCCH 1EJ9A 5JHFA 1MIJA 3RPUA 1WVRA 2FE3A 2UXXA 2Z3YA 3DEEA 5B5EC 3R0AA 2Y30A 4BBSJ 4IOAF 4KJZA 1ZTRA 2DFHA 3OYHA 4XKBA 1NG7A 5JHUA 2MSYA 5F27A 4N9IA 1HKTA 3CMAI 4M71A 4CZCA 3SJMA 4BDZA 5TRDA 3DEWA 1JTYA 4O5VA 3B6CA 2PN6A 2XIGA 3N97A 2F5CA 3DLAA 4PGHA 1D1AA 1VQ9I 3FMQA 1BW5A 1UB9A 3QPTA 1X1CA 3A1YA 1X4PA 2X6XA 4A5MA 1RUOA 2EH3A 2K02A 1K4SA 2PJRA 4Q48A 4QIWN 3C3WA 4YIIA 2CQKA 1IO2A 1WPKA 3OYGA 4BJ5C 5DUIA 4EGYA 2K4BA 3IV5A 3VYTB 2K27A 2GOXB 4MGRA 4B8XA 2A3SA 1BBYA 3IL2A 1R22A 2P0WA 3NARA 1P2FA 2E71A 3AG3H 1VF9A 1XC5A 2UXNA 3RSNA 2BVMA 2LH9A 3DPTA 2ELKA 2OPTA 3G1OA 1E2XA 5KK1A 3QAHA 1I3AA 4IHTA 1ETWA 2HKOA 2EZIA 1HSJA 1W0UA 2EFOA 2DA4A 2M7BA 2M1BA 4RMNA 2R7VA 5LFAA 3N4MA 2ELHA 3BC8A 5C4JJ 3GTOJ 1G3TA 3WU0A 3SXYA 3WGIA 5J4VA 1LFBA 1QRYA 4QTRA 3JRHA 3CF2A 3S3OA 1ONVA 3P5JA 5FLMJ 1DU6A 2HFHA 3TOBA 2FXAA 4Q47A 3MZYA 1I5ZA 4EJWA 1ORKA 1FYMA 1Z0XA 3TO9A 1S29A 4AYBN 2YX7A 4N4NB 2GOMA 3FXRA 4WXDA 3FKJA 1XG1A 2W57A 3BP8A 2H27A 2OZ6A 4IHVA 3IKVA 1BR2A 5E8IA 5EEAA 2F5VA 3OIQA 5IPAA 2OBPA 1FPQA 5FGMA 5IP9J 4F3QA 1BN5A 3MVPA 4G94A 2VE8A 5GADJ 2I5UA 3JR9A 1BC8C 2OCCH 3JSPA 1ZK8A 4IVNA 3ZRGA 2HOSA 3KEQA 4NQWB 1LDJA 4UUSA 4L5JA 2EZHA 3CUQB 4W1UA 3EUKL 5HLGA 3LSMA 3JCUC 3PIOF 1AU7A 5J1UA 1P7IA 1AWCA 3S1NJ 2YR2A 1T98A 2BW3B 2E34A 4BUPA 5LGNA 2RKHA 4WWCA 5IT9K 4JQFA 1R5HA 2MD0A 4BQOA 1VI0A 2KMUA 2Y0SA 3QODA 4G8XA 1IAWA 2GXAA 3Q0UA 3O2PE 1ZAOA 2HZDA 1R1TA 1G3WA 3CLOA 3ECOA 2I10A 1JE8A 2HNHA 3PM1A 4XOPA 2MC4A 2VODA 2RGVA 1V55H 1MSFC 2B9SA 1LQ1A 1IW7F 1YG2A 1ACIA 3KLOA 2HYFA 5LHIA 3RI4A 2DI3A 5HDKA 5DV5A 5FKKA 4E7SA 1XCBA 3ISPA 3A4CA 2QLZA 2VJJA 4F93B 4MEXF 1MBHA 2DO7A 5CVVA 3V7CA 1XSDA 2R3SA 2HOAA 2LOOA 2DJIA 1XX5A 2DOAA 2QENA 5FJ8J 3H92A 5TGTA 5B66C 1RKTA 1IF1A 3O8GA 2XROA 2IXSA 4B3XA 3RDIA 4BQQA 2ISZA 2XV4S 2X48A 2XC7A 2L9RA 2H6CA 5GTHC 4XOTA 1TNSA 4E7IA 2ESHA 1ETVA 4IO9F 4DYQA 2L7ZA 2M2EA 5F1RA 2ZJ2A 3FISA 5H2FC 5LHGA 3NAUA 5BQTA 1ZRDA 2CGPA 4IHXA 1P7JA 3GW2A 1S6LA 4MLOA 3DTEA 3DCFA 4BEHB 1FOYA 3QU3A 4BHBA 1B4AA 2NAZA 2OCEA 4BE0A 1MH3A 3HOXJ 1TT5B 1KU3A 3F72A 5D5WB 2DFFA 2IT0A 3K69A 4FE4A 3BG6A 2QUFA 3L2VA 2AHQA 4C2UA 2OQRA 2IVMA 3AFHA 2MFZA 3F22A 4G6TB 2XASA 4MFDA 4ENNA 1R4MB 4A2UA 1ZYRF 2F4MB 3B6AA 2QGUA 4XMYA 3VB2A 1IG7A 1X3UA 1ZREA 4R8HA 2DU9A 2O3FA 4H4KC 4A3LJ 3JW4A 3HIFA 4CUGA 4DYCA 3WTWC 2VBXA 3TEDA 3TOAA 3K70D 2EQRA 2P8TA 2D1VA 1T8IA 4RB0A 2L9NA 3OYNA 2TRTA 3BROA 1HW1A 1DDNA 3BR3A 3CMEI 3FDYA 3MKWB 4CZZA 3OYKA 2LBFB 4QWQA 5EZHA 1R9TJ 3ERMA 2HS5A 2WA0A 1QGPA 2Y2ZA 3F23A 4YEJA 4DNCA 5KNLA 5JVGF 3C18A 1HA8A 4MTEA 2E1MB 5FKOA 3QQAA 2ZNZA 2P7VB 3I56I 4ESFA 3W3CA 3TO6A 2J5OA 5LLQA 3CDLA 1TWFJ 1V4RA 1JKPC 2QVOA 3HG9A 1YI2I 1OISA 5JI6A 4S04A 2STWA 4L9VA 1RR8C 2XAUA 5J40A 1YJ9I 1SFOJ 2ZSIB 2H94A 3GWZA 4R79A 5F0HA 4JX6A 2VJ4A 2KIQA 2PFBA 2L9SA 4RAGA 5M5WJ 1FBUA 3HRMA 3NWSA 3ZCOA 2R0QC 3V8KA 1SFUA 4J00A 5CPRB 2EIMH 5E1XA 5HDNA 3CUQC 3VFZA 4A3BJ 2HYGD 1T33A 2DA2A 1MNDA 2BEOA 2K9SA 1TWGJ 1UG0A 3L2WA 1GXPA 3S15J 2AXTC 4LFUA 4WCGA 4XN3A 5LRSA 2ZFWA 3EPZA 3I54A 1LDDA 1HLVA 1AHDP 2I8DA 2EFQA 2L02A 1QHHD 2VC0A 1XTAA 5C4XJ 3E6MA 1RR7A 4A0XA 3SEZA 2O6GE 4HX7A 3T1BA 3PO3J 3BG9A 2R7RA 3WU1B 2GZWA 1FIPA 2KISA 3RKWA 2NVXJ 4LK1F 3KYCB 1W7PA 4ASNA 4MHGA 1WH7A 1FP2A 3ZN0A 3FK7A 4J19A 4XLEA 2L4MA 3ELKA 2FOKA 1W36D 3J80K 2JSPA 5K7ZA 4BBRJ 3CLQA 5H20A 3I4PA 2X9DA 2CUFA 4BE1A 4U87A 1KONA 2L7KA 4YIRX 3FHZA 2JA7J 3LSTA 2YU9J 3E0JB 5LGTA 4I76A 1MMAA 2Y0MA 3LMMA 3H9GA 2V1XA 2NVQJ 1R58A 4PSXA 1IV6A 2PX9A 3ZMZA 4MO7A 4JBAA 3COAC 4L9TA 2ZKZA 3DBHB 1K83J 5D5XB 1TQIA 3R0JA 2XSJC 1RZ4A 3RYRA 1QO0D 1XCVA 4RDUA 2HTSA 2R5YA 3PQKA 1I3QJ 3V8JA 3I59A 1R1UA 2BHYA 1ON1A 5K5RA 1IUFA 1I27A 1ZG5A 4G7ZF 2DA1A 3WTYC 1HDDC 2EBIA 5F6FA 4FHTA 2IA0A 1TW2A 1LNWA 5IOYA 2QBYA 3H35A 5J6XA 5M3FJ 4A12A 2LFBA 3HKZA 2CU7A 2GLOA 4OIPF 4ZH4F 3LAJA 1Z91A 3VYUB 4L0YB 2JZYA 5ILSA 3LWFA 4ETSA 4FE7A 4EV0A 3EUHA 3SZTA 2BOLA 2NNYA 4GYIA 3MCZA 1IN5A 2BV6A 3FXUA 1Y56A 3KE2A 3GVAA 4HSRA 3KCCA 3IWFA 3MMYB 2Y48A 2OV7A 2VKEA 1I39A 3ZQQA 2AQFA 1B72A 4I0BA 5E1ZB 2M8GX 2E1MC 1HW2A 2FBKA 1N77A 2Q0OA 2XB5A 1XDUA 4KNYA 1W5CC 3JAMZ 5E3MA 3WHCA 2RNGA 2JK3A 1SFXA 2V9VA 3BDDA 1TBXA 1BC7C 2QA4I 3GX4X 4PDKA 3HXLA 4CCMA 3IH2A 3EYIA 1FBSA 1Q1VA 4XLAA 1YRNA 3FXJA 2VPLA 3DPUA 2DOEA 2R7TA 1P4XA 1T6SA 1MMSA 1HKSA 2DT5A 1ZQ3P 1PP7U 2PJRB 3HGYA 3E5XA 3U9GA 4J01A 4LG0A 3BJ6A 5TJJA 3VYSB 2V9PA 3FMSA 2Q2EA 3V7RA 1W1WE 3E3VA 4ESBA 2DT7B 3TP0A 2XGEA 1S7EA 1YIOA 2ISYA 2G7UA 2LNBA 1PVEA 3QYEA 3C7JA 1FIAA 1EKEA 1K4TA 1RESA 1FT9A 3CJRB 1R71A 2VI6A 3G3ZA 3I58A 3WTVC 2HWVA 2IP2A 5HS8A 1T39A 2XGDA 1GLNA 1MBKA 2CJJA 3OIPA 4XSXF 4EGZA 3ZQ7A 2X1EA 1Y0NA 3HUGA 4LIUA 5E3NA 2XGXA 2DTRA 2DODA 2LREA 4UUVA 1YO5C 5K5QA 5IYDJ 3KFWX 4KUMA 1L0OC 2EILH 3M8EA 1SC7A 5DYMA 1NK3P 2OJED 4C30A 3KIOA 4HV5A 2K9LA 2XDVA 5CVIA 4XK4A 3C2BA 2HQ5A 2EV5A 1TWHJ 2KRHA 4FETA 1Y0UA 4ZDPA 1DUXC 1X2NA 1ETQA 1LE8A 1WWXA 3OYAA 5FB2A 1R6RA 2V6CA 1MH4A 3O8HA 5D6FA 4HW0A 5C44J 2CW8A 1SD6A 4PJNA 1RC9A 1OYIA 2L4AA 4I98B 3CO7C 2G9WA 3GZ6A 1WH5A 2LF7A 3LL7A 3BG5A 4AUXA 3ZMVA 2P7CB 1OR7A 3HOZJ 4UUSB 5HS9A 4XRFA 3BR2A 1HXDA 3KP5A 4MFEA 3S3MA 4ZC3A 3S14J 5CVUA 2OU2A 4EVIA 4ZYDA 3OS1A 3JSOA 3CDHA 1SAUA 3LSRA 3VDXA 1QBJA 4CCKA 1SMYF 2MGQA 3GF2A 5J47A 4I7HA 2MLKA 1UHMA 4NUBA 4IKFA 1XDSA 3E1SA 4Y15A 2AO9A 2DT6A 5KVRA 3Q5FA 1MBEA 2HPMA 4DZPA 2DMNA 4DW6A 2BY3A 4KMUX 3ZXSA 3ONQA 2FD5A 5C3EJ 1W4MA 1A36A 1MBGA 3HOSA 1I1GA 1ZLKA 3C1DA 1FLIA 4AU7A 4RGXA 3GLLA 4UV8A 4ABZA 2JQ7A 2VQGA 2YU3A 5DTDA 4EM2A 4FASD 2ZCWA 3PNTA 4P55A 3VSLA 3G4SI 1VZ0A 3QPLA 1R00A 1USSA 5CYVA 4E7ZA 3FM5A 1WJ5A 2DOFA 2R7ZJ 1MDMA 3ESWB 4P5OA 1OPCA 3I64A 3C2GA 4I02A 2HZTA 2MYSA 2VQCA 4X0GA 5CVJA 1D8JA 2CUZA 2WAQN 4RB3C 4XM3A 3GZ5A 1ETXA 5A2QK 1PYVA 3K4CA 2DFEA 2KLOA 4CCJA 4CYDA 4HNTA 2DTZA 3T8RA 4OIQF 1WJCA 2E1OA 5A2QZ 1D5YA 2KIFA 2QQ9A 1U9NA 3VYRB 1NTCA 1XB4A 2EIJH 1BR4A 1WJDA 4RA2A 3TQNA 1FNNA 2VOOA 2HVRA 4KIBA 4BHCA 5ILUA 4M74A 2DMUA 4OINF 2CO5A 4B09A 3WG7H 3HL2A 1P4AA 1U8RA 3VSKA 1WSUA 2O03A 3V7SA 1XMKA 1NH3A 2Q1ZB 2R5ZA 4C3JJ 1T2KA 3BPVA 2Q8KA 2ZMEA 2RVCA 1WFXA 1O3TA 1Y1VJ 1J7KA 4EJOA 4UB6C 3JTGA 3VOEA 1N75A 3BCAA 3IC7A 4BYYA 2QYOA 1GVJA 3DP7A 1RKWA 2DAOA 4M9XA 3H0DA 2M45A 3SDBA 1OCTC 2LKSA 5DCMA 5DM7F 1FTZA 4DZJA 2R7XA 1T56A 2IBDA 5EDNA 4BQAA 3DTKA 1BR1A 2R7WA 3KP3A 3PUBA 1IJWC 3KEOA 3J81K 1EH6A 2ID3A 1FY7A 2VB6A 4M3GA 4MNUA 3J81Z 3IH3A 3S16J 2XAGA 1F9NA 4M3EA 2LF8A 2RNJA 2ME0A 1LFUP 2LR8A 1R5ID 1ERDA 2HXOA 2L7FP 2A07F 2PMUA 1A04A 4F7ZA 4MEYF 3BTCA 1R23A 1STZA 2Y0SN 3CCMI 2X4HA 1WJEA 2PMHA 1A6QA 1B9MA 4GDFA 1UJ8A 1J09A 3IAM2 4A3MJ 2O5RA 2WWYA 1ZG3A 4RLQA 4BDYA 2IS6A 4YG2F 3HPGA 1H9GA 5L3GA 1Y39A 1VNDA 1N78A 1WRJA 3S2HJ 2L0KA 1U5TA 4ZYGA 5L3CA 2M8EA 3CCVI 2R7FA 4D7MA 2JJ7A 1TQPA 3I55I 1IRGA 4PGGA 3RCOA 3BOQA 2XGCA 3BR5A 3CJTB 5D4RA 3CTAA 1ENHA 3U21A 1V5FA 4HX4A 3ASNH 4LD5A 5GP9A 4L5IA 3E97A 2D5VA 2ZXIA 2BYVE 2BY2A 2NVTJ 3ULQB 2LC2A 3IP4B 1B6AA 2WAQA 4PJ0C 2QKLB 1HOMA 5FFZA 1CF7A 3I4MJ 3TBIA 1ZHFA 4EMSA 1D1CA 2QF7A 1W7PB 2FNAA 5E18F 2HDCA 3BTJA 3CUOA 1OLTA 2F5FA 2KP6A 2UV1A 1DP3A 4E7KA 2LRDA 5GTIC 2F4IA 2JUGA 3RZOJ 3JRIA 2B0LA 2HQRA 2QEXI 2EFNA 5GAHJ 3GTLJ 2ADUA 1XGOA 1FYLA 4JP0A 3Q9VA 4N0BA 3B73A 2CUJA 2IGOA 5IY5H 2YUSA 1BW6A 1A5JA 3GMEA 4IRIA 3J7AO 3GTQJ 4R1HA 2BGCA 1JUPA 3MKZA 4LK0F 2JT1A 3REOA 4DGWB 4M6YA 3ZQCA 1FBQA 4Z6YA 4AC0A 3CP8A 1E3OC 4IQ4A 4A5NA 3GXOA 2VN2A 4I99C 1USTA 1LDKB 4B1RA 5CQGA 1VQMI 2CSOA 2R5YB 1TTYA 3UR3C 3OL3A 3OR1C 1MMNA 2WADA 3I59B 3BZ6A 1X1DA 4JX5A 3KZZA 2KZVA 4B43A 5J1RA 3K4JA 1Z67A 4HYEA 4IHSA 5F04A 1TP4A 2XB0X 3ZMTA 3HPHA 2EFWA 4I0AA 2QBYB 1QZYA 1G3YA 2M87A 2DMTA 1FSEA 2AQEA 3QYBA 5E3LA 2V1NA 1IRXA 1XMAA 4G9YA 2VBZA 3ZR8X 3H1CA 2JMWA 5AIPA 1FTTA 4HX8A 2XKPA 4Y7NJ 1FOKA 4A3GJ 4Y33A 5LGUA 3S3NA 3ZMSA 2R7DA 4BJTA 2FOWA 3D5LA 2COBA 5IT3A 4H0EA 4CICA 5GAGJ 5FKNA 2QSGX 4CGZA 2RN7A 1XSXA 4I09A 1LVKA 2DYRH 5D4SA 5FLXK 1UFMA 2W1OA 2VIXA 4HF0A 2E7XA 5DEQA 2ZO4A 1B72B 5FLXZ 3O6BB 3GTJJ 2HGCA 3LNQA 5D6EA 1J2XA 1X2MA 2OD5A 4UHTA 1I1SA 3IH4A 3FF5A 3FIWA 2K4JA 5FROA 5HLHA 1RI7A 2H8RA 4WK8F 1O57A 5EEHA 2HOEA 4F92B 1R36A 1VQ6I 4RM3A 1YRNB 2FMYA 3EYYA 4BNCA 2DA3A 4AM3A 4U7DA 2NOJB 4NHJA 1EA3A 3V4GA 2CV2A 4G6QA 3DWLE 3TW6A 1QA6A 3S2WA 2K9QA 4P1WA 4JK1X 1PUFA 1BOBA 4ZDLA 3LAPA 4F91B 3L00A 4LG0B 1YW8A 2Q2EB 4L0ZB 1D0YA 3DQVC 3GEZA 3RYPA 4P9FA 2K86A 3LFKA 4UUTA 2K85A 2IGMA 2Y9YA 2VKVA 2PI0A 5ED4A 3D1NI 3ERED 4KA4A 4CYCA 3F8BA 3GO5A 2GXBA 4PCQA 2GAUA 1T0FC 1FMVA 1CGPA 1JUSA 2M5WA 3T5XA 5E1WA 2Y31A 3HM5A 2DW4A 3HUGB 5FD5A 2GM4A 3W6KB 3DKXA 2VT2A 3KZIC 4XR6A 1FMWA 3M9AA 3L2UA 3BTLA 2ZJQF 3DU6A 1D5VA 3ZP5A 3R61A 5JVTA 5F0FA 4ZZLA 3P9KA 4AD9A 3A0HC 2VBYA 2M3AA 1MBJA 3AL0B 3F9KA 2BBYA 2Y75A 2E1NA 3AKZA 2Y9ZA 3LSIA 3PSIA 4EJUA 3T0YA 4HZFA 1LFPA 3OYDA 2F5DA 3U1KA 2NS7A 4RGSA 1A31A 3HKZN 5BOXA 1I6HJ 1S7AA 2ZC2A 1LE8B 4G7OF 1X1BA 5LRRA 3DFGA 1ZELA 1R1VA 2HQAA 2RC4A 3GFMA 3OMYA 1B59A 4OMYA 5EGOA 3A02A 1U3EM 5HDGA 4GRIA 5LEJA 3GTPJ 1BL0A 4C3HJ 5LBQA 6PAXA 1B8IA 4BY1J 2L2OA 3IAS2 1BI0A 4CA0A 2CS3A 5CVRA 4DQ2A 1G2HA 4UVBA 2ACJA 2JN6A 2VBWA 2HVQA 3W2AA 4FQGA 5AONA 5JR3A 1HDPA 3L2QA 2DDBA 1BJAA 1Z3YA 3LA7A 2Z33A 3BR1A 3TP3A 2MA3A 1UG2A 2M0MA 3AG1H 5LEKA 2ETHA 2O0YA 2XKOA 5CQEA 1CQTA 4IF4A 3LA3A 3SFZA 3ZQFA 4BJ6C 4D5FA 1MGTA 3TDZC 3EUHC 3PSFA 1APLC 1K6YA 4HBLA 2EV0A 3SHFA 2HDWA 3SZPA 3E6CC 2DA6A 3RZDJ 1UZCA 1TQMA 4NC8A 1IRZA 3EDPA 4UVAA 2Z1DA 1YS7A 2E2HJ 2E36A 1C0WA 2NOGA 3H5AA 1P4WA 1TNTA 4PJJA 2NVYJ 3MQ0A 1X1AA 4ANJA 2KZGA 2V79A 5J8FA 4Y13A 4G6DA 2E35A 2KPMA 3M07A 1Z05A 5ICFA 3KLNA 4FX0A 1FC3A 1TLHB 1MDMB 2D1HA 3GFJA 3RJPA 4C3IJ 4M3BA 4LB5A 1ZH5A 1MJAA 3Q0WA 2NS8A 3Q0VA 1NHAA 3A03A 3OYLA 2OAZA 4Y17A 4IPAA 2FNPA 2UWMA 2FU4A 2MC3A 3P9CA 4HF2A 3VPRA 3J7YJ 4DBRA 1S5LC 2V7FA 1WCMJ 3BPXA 3SEQA 3OYCA 3VEPA 1IN7A 3BR6A 5D8LB 1SD5A 2WV1A 2DPDA 2EINH 3OYFA 4RAZA 2R5ZB 5H6QA 2ZB9A 5JFRA 2W24A 2ZMEB 3E7LA 2E19A 1KU2A 2CW0F 4B3AA 1RUNA 5D8KB 1SVLA 4ZJZA 3PQJA 2VUMJ 1XGNA 1JKOC 1ZGWA 2EA2A 1S3JA 2DMQA 4D1QA 4IL6C 2V4JC 1E0EA 2HQNA 2WAEA 4BE2A 5DCMB 3M8JA 1IV8A 1FJLA 1FYKA 2ECCA 3JTHA 4DJAA 4AVPA 1OCPA 2JVHA 3QPSA 1U2WA 3X2QH 3CJQB 2XSDC 1T38A 1SANA 2E60A 1VQOI 1U9OA 4U88A 3CUQA 1U6GA 2LSOA 1O3SA 2JA6J 3FX3A 2DBBA 3JAMK 2KKOA 2XF7A 3NEUA 2PJPA 3D0SA 3VODA 4JX4A 1WKMA 4QLCU 2Y69H 4II3A 4XIDA 3QRFF 4UVCA 3GFIA 2L3DA 3OSFA 2GWRA 4EJVA 4CCLA 2JRTA 4AWXB 1UCRA 1XN7A 2XUBA 4M72A 4NC6A 1YIJI 1J5YA 4EM1A 2K9MA 2G7HA 3ABUA 4FX4A 3I71A 5HODA 2NVUB 3PO2J 2DJNA 1OYYA 1QVUA 5D5VB 3GUDA 1U5TB 3CCSI 2LTPA 3PNVA 4IX7A 1BI2A 5DD4A 3GTKJ 3R6SA 4LLGF 4XONA 3PL8A 3MKLA 3K7AJ 2XAHA 5B1BH 4OAYA 2VKHA 1J9IA 4ZYHA 1IZ1A 2M9HA 1MNMC 2A61A 3I0TA 5HVQC 3ROUA 1MZBA 1U0JA 4EJTA 4UV9A 3PFYA 4JOMA 3DTIA 2QCOA 3KEYA 4IEJA 3HGGA 3IRRA 1CF7B 1PP8F 2R7OA 1IN6A 3NRVA 2A05A 3LSHA 2LMDA 3IWZA 3T8TA 5J3LA 4A3EJ 3S2DJ 4A3DJ 1G4DA 5EF6A 1FSHA 2XVCA 3D5SC 1KZHA 3W6JB 3SFIA 3F8MA 1P9QC 4A3JJ 3I53A 2NS0A 2M4KA 1EV7A 3TW7A 4BS9A 3HDDA 4OMZA 4PFOA 2FBHA 2ZJRF 2NRAC 3ZOBA 4PJMA 3MD2A 5BPDA 3EETA 5J8CA 3HOWJ 3QOPA 3WTZA 4KITB 1KGSA 2EZLA 4C9YA 5BMZA 3CC4I 3P9IA 1KU9A 3HEFA 5J4YA 2ID6A 4RBOA 1D0XA 1G3SA 2J5PA 1EH7A 4BKXA 1BM9A 1QPMA 3F6VA 3KZYA 3ZMDA 2BY1A 2LP0A 2OUMA 3M7GA 2A69F 1WI9A 1HC8A 3HTUA 1QVTA 3QYFA 2STTA 3IUOA 4K2EA 4MIMA 4I2OA 3DKWA 3K9TA 1R49A 3FM3A 1K78A 2ZXWH 3M1EA 3K4MA 1ZRCA 5FRNA 3CCQI 1SVMA 2K9NA 2JA8J 3G2BA 3GCMA 3TKYA 4L18B 3FXMA 3Q3SA 4CCOA 3JRDA 3L2RA 4M9SA 3WE2A 2Z9OA 1Y8QB 2KHMA 3HOUJ 1EH8A 2DA7A 4RAFA 2CQQA 3BJOA 4XLNF 3QU6A 1H0MA 4KICA 3JREA 1K79A 3DV8A 3W2WA 1F36A 2E2IJ 1ZG1A 4HNUA 2LD5A 5ICEA 5GAEJ 2W7NA 4II2A 4HQEA 2DPUA 3HSEA 4ZZDA 2CH0A 2VQHA 5IP7J 5D5UB 5L3EA 3LA2A 1O3RA 4HDUA 2GBYA 2JVGA 5L3DA 2M30A 3RPQA 4WF2A 2VXZA 1POGA 4DIQA 5KAIC 2B7EA 2ELJA 4HA8A 5LD2C 1P92A 5FRMA 2FA5A 1OMIA 4A3CJ 3KETA 4BAYA 1QHGA 3ABKH 3LOCA 3MWMA 4S0HB 3FXLA 3K10A 2KIMA 3CC2I 3H36A 2FMLA 2BE5F 2K7LA 4X1EA 1OJLA 1W5SA 2ESNA 3H9QA 4AIKA 1I6XA 4KIFA 1PUFB 4ZTFA 2IJLA 4GFBA 1F43A 1Z9CA 1K6OA 2DCEA 1W0TA 4XRSG 3JRCA 1P6RA 2H09A 3DPLC 4RGRA 2HXIA 5EEGA 2PQ8A 3PUFA 1AKHA 1ZKGA 2PBIA 1HBXG 3JRAA 3BG3A 4EATA 1OCZH 5IYBJ 3BZCA 4IRHA 1UELB 2LK2A 3NQOA 1K7AA 4BXXJ 4O6JA 2F2EA 4M6XA 5HLIA 5IP6A 4CYCB 4WXCA 1QZEA 2P4WA 3G73A 4D0PA 4XLPF 4HQMA 4CDGA 4MTDA 3RQ4A 3UNGC 5FKMA 1YJWI 2H8WA 4PK4A 2NYXA 2JRMA 1OYWA 2IW5A 2OQGA 5CKTA 3G1MA 1IGNA 1V5GA 3JRBA 2H6BA 4IJAA 4Y4RA 3F21A 2WY7Q 2LDUA 3F8FA 3CF5F 2W00A 3TMOA 4IXAA 3E5UA 1S7OA 1VFCA 2P5VA 1VQLI 2M0CA 1X1PA 3K4KA 1JI8A 2CFOA 4LGWA 3LQRA 2VQLA 2LKXA 1BJZA 1YLFA 3OV8A 4GXOA 4ON0A 2W4SA 1E17A 3QOEA 5KCMA 2VJ5A 3JRFA 3H5NA 4OOIA 3NWTA 1MKMA 3GTGJ 3OL4A 2HKXA 2GQQA 3CJNA 4RB2C 3CESA 1YX5A 3RIRA 1DPUA 1IXRC 4IRGA 3RKXA 1EF4A 3U2RA 5EGOB 1QPIA 3WTUC 2CV0A 4NNJA 1E3HA 4B44A 2A68F 1DQUA 2HI3A 2WTEA 4LB6B 1B8IB 1PUEE 1W5TA 3K0LA 1IN8A 3OR2C 2DLLA 5B3SH 2CUEA 5DCFA 4HNVA 3E5QA 1K61A 1TWAJ 2XAJA 2XRNA 3K1PA 1UHSA 4HOBA 5ERIA 3FKIJ 4Q5SF 3BTIA 4RS8A 5HS7A 1FX7A 4CH7A 1VQ4I 2V6EA 1O7LA 2JTVA 2QM3A 3OWTA 1UAAA 1FZPB 4O3MA 2OTJI 4A0YA 5EG0A 4LOCA 4I6ZA 1WZ2A 3A01A 1RETA 1PJRA 4U0WA 2TCTA 3MFKA 1XS9A 2K5CA 4Y3OA 3S93A 1W36C 2QZ8A 3PIPF 2WB1N 3ECHA 4XN0A 1LVAA 2XPUA 1KQ9A 2KJBA 2VJIA 2RQQA 2A5YB 1YYVA 2JA2A 2DQRA 3KYLA 3WE3A 4D7NA 2A5WA 4HG2A 1IN4A 2KQRA 3FXKA 2VONA 2F6CA 2CQXA 4FTHA 2DYSH 1Z6RA 2F48A 2O7OA 3I4NJ 3ZGKA 1X3WB 2KRCA 2JPBA 4MQ9F 1IRFA 2RDPA 4OWRB 4XL9A 1GDTA 4BY7J 4M3DA 4TV7A 2TDXA 2QQAA 4RB1A 5LHHA 2W84A 2WBMA 3W2VA 1V3FA 2M34A 2L54A 4UNOA 3WODF 2O61A 1LUJB 3QP5A 4E4HA 1FWZA 4C2TA 2HOTA 3CC7I 2CQNA 4S05A 5M5XJ 3L9FA 2DDAA 4KT6A 1ZN2A 1IDYA 4A6EA 2HU9A 1SMTA 3BG7A 2VC1A 1QZZA 3F3XA 2PMZA 3WTSC 2Z5UA 1ZLJA 1GVDA 2LYCA 3ML6A 3F8NA 3H3VK 2MABA 5HLTA 3LSPA 1SFEA 2DMPA 2L9VA 4DOZA 1SD7A 3BQYA 2X1CA 3H0GJ 3C2HA 5DM6F 2R92J 4QPQA 1ETOA 2ECBA 4ESJA 3BCBA 4HSTA 1JGSA 4XRMA 3OY9A 1JXSA 4N4OB 1S72I 5F08A 4G7HF 4L5EA 1WGXA 3DBLB 2WAFA 3FXOA 4HF1A 3O3KA 3FWEA 1X19A 2L01A 3ZQIA 3R60A 2EFPA 4AVZA 1GHCA 4IQJA 3AG4H 2ZFUA 4ENKA 1X58A 1KU7A 3ZPLA 3E6BA 3S32A 2BZTA 3WGHA 3HRTA 4E7HA 2IS1A 2YPRA 4F55A 3CZ6A 3RTRA 3CCYA 2D2WA 2LG4A 4UB8C 1TL8A 5F0CA 4Q4ZF 2QSFX 3BR0A 4M3FA 1ODDA 4GYGA 3SQNA 3OOPA 3TL4X 9ANTA 1D3YA 1YOVB 3FXQA 2HTJA 1G6NA 2MBFA 2FUG2 5IT9Z 1YITI 4DBQA 1ZGJA 4BL0B 5M3MJ 1ON2A 3CMYA 2WB1A 4F52A 2A6TA 1A6IA 4B47A 1KYZA 2R7SA 3HYIA 4M9ZA 5E79C 1YS6A 4KYWA 2ZNYA 4XKCA 2JSCA 4IHYA 2XHKA 1R7JA 2WV0A 1HQCA 2XF6A 1JT6A 1ZR4A 4A3IJ 2PLYA 2F5EA 2H1LA 1ETKA 2W82A 1V5EA 3DXJF 4BACA 2O8XA 3CP2A 1JHHA 3RPUD 2RREA 2V1DA 2DK5A 1OCRH 2YS9A 2L5QA 4HAMA 2FQ4A 2IPQX 4BXUA 5EYRA 2IA2A 2FF4A 3RKQA 2GIVA 4ZYEA 3M4OJ 5TISC 2VXDA 3CMMA 3HHHA 4BU2A 1Z3XA 5GPAA 2QWWA 3K4NA 2FEZA 4E7LA 2HVSA 1D1BA 4KT5C 5CLSA 4HLYA 1GV5A 3LSGA 5ICGA 4YELA 3ZQGA 3K2ZA 2VLAA 3BQZA 1J75A 3EUAA 3QWLA 1LEAA 2JPCA 1FOXA 4KISA 4HEA2 2NNNA 1Z1DA 3CCLI 1GUUA 1UMQA 4CO8A 2L7MP 5H6RA 4ZYAA 2DXIA 2CQ7A 2OF7A 2PG4A 2EB7A 2LVSA 3GLXA 5ILVA 3G71I 4YFNF 4AYBA 2R4GA 4LLNA 2H1KA 4KFCA 4E7JA 1O3QA 4HPQA 3KYDB 2O8KA 1HKQA 1LB2A 1J59A 3A2KA 3OYBA 3K4LA 2OC6A 2EV6A 3PNYA 4AIHA 4YIFA 5FD6A 3DLLF 4M6VA
chains in the Genus database with same CATH topology
3ZN1A 2AXLA 2FSWA 1H9TA 2X0LA 3B02A 1K78B 2FRHA 5L3BA 1ZARA 1KA8A 2P6SA 3F6OA 4GGGA 4WXHA 5E17F 4ENMA 2MH9A 3ABTA 2HEOA 2KRFA 3PFIA 1HW5A 2UZKA 3GYHX 3HOTA 3WTTC 1ZGAA 2FQ3A 3AAFA 3L7WA 5FFXA 5BS6A 1F1ZA 2PEXA 1Q1HA 2MD5A 3KP4A 2XAQA 1T0FA 1XD7A 3V8LA 3H3UA 3RKYA 4BH9A 4L9NA 1BIAA 4KDPA 1YQAA 4ENJA 1SD4A 5HOOA 1YW9A 3J80Z 3KP7A 1MD0A 4KIGA 4P9UA 1RIOH 2GA2A 4EM0B 1R5GA 4MQVA 1QNTA 4CXFA 4U0VA 2MLGA 4KN7X 3HHGA 3GFLA 2DK8A 3HSFA 2P6TA 1LEBA 3LQQA 1LJ9A 2W25A 3EQLF 1Z6TA 4I01A 5K5OA 4NQWA 4E70A 4BHPA 2KIUA 2AS5F 4A0ZA 3L09A 4RGUA 5E20A 1XSVA 1B1BA 3ZMUA 1U78A 4HV6A 2Z99A 4LJZF 4PZJA 3MAJA 4AIJA 1GXQA 2ZBKA 3FMRA 1YFHA 3MZHA 2YX4A 4LMYA 2A6HF 1AOYA 2KJCA 3L2CA 2ZXJA 4GCVA 3KP2A 5L3FA 1XGSA 2DQLA 2OZUA 3BJAA 2EK5A 3HRSA 4M73A 4WX9A 3BY6A 1REPC 4U7BA 2D45A 4RAYA 1ULYA 3P7NA 1J0RA 2GA1A 3M8FA 2RQPA 4N9HA 1IXCA 1DPRA 5F64A 4NB5A 5DDGA 3F8CA 5BPIA 3HTSB 3IHUA 1KQ8A 1BI1A 3IKTA 1WQ2A 3BWGA 2P5KA 2YSRA 4U0YA 2COMA 2IRFG 1KYWA 2P5LC 3Q9SA 2OA4A 2IA1A 2E1CA 4Z2YA 2EA4A 1W7PD 1OKRA 2FBIA 2W85A 3WTXC 1SAXA 3I5UA 2GXGA 3HSRA 5DD8A 4XSZF 1XGMA 3E6DA 3MEXA 1TW3A 1F5TA 5FO5A 4OIRF 5ICCA 4LLLA 2QQBA 1IUYA 2CWEA 2E7WA 3TDUC 2VE9A 1JHFA 4A6DA 2VT3A 2A6EF 1B9NA 4CHUA 1BIBA 2HR3A 3TO7A 2WC2A 4GO1A 1HSTA 3R4KA 1MJBA 2RV8A 4L9JA 4OU0A 5CJ9A 1BI3A 3HRUA 3WGGA 1FP1D 3K1MA 2CG4A 2MH2A 3H3ZA 1U5TC 4YFKF 3DEUA 2VOPA 3DF8A 1O7FA 1KQ0A 3K1NA 1IXSB 1VTNC 4KMFA 4XBFA 4EQQA 2XAFA 2EWNA 2EJRA 1RNLA 3QP6A 2CFXA 1QQIA 4P96A 5E8GA 4KN4X 5AIQA 1YTYA 1UHWA 1D8KA 3IRQA 1DP7P 4HDVA 3CO6C 1BOAA 1S8NA 4YFXF 3WG9A 1L3LA 1F4KA 2CYYA 3KP6A 2DFIA 3U1DA 1PDNC 4OIOF 3QPHA 4HLXA 3FZVA 4UXNA 5K1YA 1YW7A 4FT8A 5DUKA 1Z7UA 1ZRFA 1MJ9A 3TGNA 2LKPA 2V1UA 2C6YA 3RPUA 2FE3A 2UXXA 2Z3YA 3R0AA 5JHUA 4N9IA 1HKTA 4M71A 5TRDA 4O5VA 2PN6A 2XIGA 3N97A 2F5CA 4PGHA 3FMQA 1UB9A 3QPTA 1RUOA 4A5MA 2K02A 4Q48A 3C3WA 4YIIA 2CQKA 5DUIA 4EGYA 2K4BA 2K27A 4MGRA 4B8XA 2A3SA 1BBYA 3IL2A 1R22A 1P2FA 2UXNA 3DPTA 1E2XA 5KK1A 3QAHA 4IHTA 2HKOA 1HSJA 2EFOA 2M1BA 3N4MA 2ELHA 1G3TA 3WU0A 3SXYA 3WGIA 1ONVA 2HFHA 3TOBA 2FXAA 4Q47A 3MZYA 1I5ZA 4EJWA 1FYMA 3TO9A 1S29A 2YX7A 3FXRA 4WXDA 2W57A 3BP8A 2H27A 2OZ6A 3IKVA 5E8IA 2OBPA 1FPQA 5FGMA 1BN5A 4G94A 2VE8A 1BC8C 3JSPA 4IVNA 3KEQA 1LDJA 4L5JA 3CUQB 5HLGA 1AWCA 2YR2A 1T98A 5LGNA 2RKHA 4WWCA 5IT9K 4JQFA 1R5HA 4G8XA 1IAWA 3O2PE 1ZAOA 1R1TA 1G3WA 3CLOA 3ECOA 1JE8A 2VODA 2RGVA 1LQ1A 1IW7F 1YG2A 3KLOA 2HYFA 5LHIA 3RI4A 2DI3A 5HDKA 5DV5A 1XCBA 3ISPA 2QLZA 4MEXF 2DO7A 5CVVA 3V7CA 1XSDA 2R3SA 2QENA 3H92A 1IF1A 2XROA 3RDIA 2ISZA 2XV4S 2H6CA 1TNSA 2ESHA 5F1RA 1ZRDA 2ZJ2A 5LHGA 5BQTA 2CGPA 3GW2A 1S6LA 3QU3A 4BHBA 1B4AA 2NAZA 2IT0A 1KU3A 3F72A 5D5WB 3K69A 2QUFA 2OQRA 2IVMA 3F22A 4ENNA 2XASA 4A2UA 1ZYRF 3VB2A 1ZREA 1X3UA 4R8HA 2DU9A 2O3FA 3JW4A 3HIFA 3WTWC 2VBXA 3TOAA 2P8TA 2D1VA 4RB0A 3BROA 1HW1A 1DDNA 4CZZA 4QWQA 2HS5A 1QGPA 3F23A 4DNCA 3C18A 4MTEA 2ZNZA 2P7VB 4ESFA 3TO6A 2J5OA 5LLQA 1V4RA 2QVOA 5JI6A 4S04A 2STWA 4L9VA 2H94A 3GWZA 4R79A 2PFBA 1FBUA 3HRMA 3V8KA 1SFUA 5E1XA 5HDNA 3CUQC 3VFZA 2HYGD 2BEOA 1GXPA 4LFUA 4WCGA 5LRSA 2ZFWA 3I54A 1LDDA 2EFQA 2L02A 2VC0A 3E6MA 4A0XA 2O6GE 4HX7A 3T1BA 3WU1B 2GZWA 3RKWA 4LK1F 1W7PA 4ASNA 4MHGA 1FP2A 3ZN0A 2L4MA 3ELKA 2FOKA 3J80K 5H20A 3I4PA 3FHZA 3LSTA 5LGTA 2Y0MA 2V1XA 1R58A 3ZMZA 4JBAA 3COAC 4L9TA 2ZKZA 5D5XB 1TQIA 3R0JA 1RZ4A 3RYRA 1QO0D 1XCVA 2HTSA 3PQKA 3V8JA 3I59A 1R1UA 1ON1A 5K5RA 1I27A 1ZG5A 4G7ZF 3WTYC 5F6FA 4FHTA 2IA0A 1TW2A 1LNWA 2QBYA 5J6XA 4A12A 4OIPF 4ZH4F 3LAJA 1Z91A 4L0YB 2JZYA 5ILSA 3LWFA 4ETSA 4EV0A 3EUHA 3SZTA 2NNYA 4GYIA 3MCZA 1IN5A 2BV6A 3FXUA 3KE2A 3GVAA 3KCCA 3IWFA 2Y48A 4I0BA 5E1ZB 1HW2A 2FBKA 2Q0OA 1XDUA 4KNYA 3JAMZ 1SFXA 2V9VA 3BDDA 1TBXA 1BC7C 3GX4X 4PDKA 3EYIA 1FBSA 1P4XA 1T6SA 1HKSA 2DT5A 1PP7U 3E5XA 3U9GA 4LG0A 3BJ6A 5TJJA 3FMSA 2Q2EA 3V7RA 3E3VA 4ESBA 1YIOA 2ISYA 2G7UA 2LNBA 3C7JA 1FT9A 3G3ZA 3I58A 3WTVC 2HWVA 2IP2A 5HS8A 1T39A 4XSXF 4EGZA 3ZQ7A 3HUGA 2XGXA 2DTRA 4UUVA 1YO5C 5K5QA 3KFWX 4KUMA 1L0OC 3M8EA 5DYMA 4HV5A 5CVIA 2EV5A 1Y0UA 1DUXC 1WWXA 5FB2A 2V6CA 5D6FA 4HW0A 1SD6A 1OYIA 2L4AA 4I98B 3CO7C 2G9WA 3GZ6A 2LF7A 3ZMVA 2P7CB 1OR7A 5HS9A 4XRFA 1HXDA 3KP5A 5CVUA 2OU2A 4EVIA 4ZYDA 3JSOA 3CDHA 1QBJA 1SMYF 3GF2A 4I7HA 2MLKA 1UHMA 1XDSA 4Y15A 5KVRA 3Q5FA 4KMUX 1W4MA 3HOSA 1I1GA 1ZLKA 3C1DA 1FLIA 4RGXA 4UV8A 2YU3A 4EM2A 2ZCWA 4P55A 1R00A 1USSA 5CYVA 3FM5A 1MDMA 4P5OA 3I64A 1OPCA 4I02A 2HZTA 1D8JA 5CVJA 4RB3C 3GZ5A 5A2QK 4CYDA 4OIQF 3T8RA 5A2QZ 2KIFA 2QQ9A 1XB4A 3TQNA 1FNNA 2VOOA 4KIBA 4BHCA 5ILUA 4M74A 4OINF 4B09A 2CO5A 1U8RA 1P4AA 1WSUA 2O03A 3V7SA 1XMKA 1T2KA 3BPVA 2Q8KA 2ZMEA 2RVCA 1O3TA 1J7KA 4EJOA 3JTGA 3VOEA 3IC7A 4BYYA 2QYOA 1GVJA 3DP7A 2DAOA 4M9XA 2M45A 5DCMA 4BQAA 3KP3A 3KEOA 3J81K 1EH6A 1FY7A 4MNUA 3J81Z 2XAGA 1F9NA 2LF8A 2RNJA 2A07F 2PMUA 1A04A 4F7ZA 4MEYF 1R23A 1STZA 2X4HA 2PMHA 1B9MA 2WWYA 1ZG3A 4YG2F 5L3GA 1H9GA 1WRJA 1U5TA 4ZYGA 5L3CA 2M8EA 2R7FA 1TQPA 1IRGA 4PGGA 3BOQA 5D4RA 3CTAA 4HX4A 4LD5A 4L5IA 3E97A 2BYVE 3ULQB 1B6AA 5FFZA 1CF7A 1ZHFA 4EMSA 1W7PB 2FNAA 5E18F 2HDCA 3CUOA 2F5FA 2B0LA 2HQRA 2EFNA 2ADUA 1XGOA 1FYLA 4N0BA 3Q9VA 3B73A 4IRIA 3J7AO 4R1HA 2BGCA 4LK0F 2JT1A 3REOA 4M6YA 1FBQA 4A5NA 3GXOA 2VN2A 1USTA 1LDKB 2CSOA 1TTYA 3I59B 3BZ6A 3KZZA 4HYEA 4IHSA 3ZMTA 2EFWA 4I0AA 2QBYB 1QZYA 1G3YA 2M87A 1FSEA 1XMAA 4G9YA 2VBZA 5AIPA 4HX8A 2XKPA 1FOKA 5LGUA 3ZMSA 2R7DA 3D5LA 5IT3A 4H0EA 4CICA 4CGZA 2RN7A 1XSXA 4I09A 5D4SA 5FLXK 1UFMA 4HF0A 2E7XA 5DEQA 2ZO4A 5FLXZ 3O6BB 2HGCA 5D6EA 1J2XA 2OD5A 4UHTA 1I1SA 3FF5A 2K4JA 5HLHA 1RI7A 4WK8F 1O57A 5EEHA 2HOEA 1R36A 2FMYA 3EYYA 4BNCA 4U7DA 4NHJA 3V4GA 4G6QA 3S2WA 4JK1X 3LAPA 3L00A 4LG0B 1YW8A 4L0ZB 3DQVC 3GEZA 3RYPA 4P9FA 2K86A 3LFKA 2PI0A 5ED4A 3ERED 4KA4A 3F8BA 3GO5A 2GXBA 4PCQA 2GAUA 1CGPA 3T5XA 2M5WA 5E1WA 2DW4A 5FD5A 3W6KB 2VT2A 3M9AA 1D5VA 3ZP5A 3R61A 5JVTA 4ZZLA 3P9KA 4AD9A 2VBYA 2BBYA 2Y75A 2E1NA 4EJUA 3T0YA 4HZFA 2F5DA 4RGSA 5BOXA 1S7AA 4G7OF 5LRRA 3DFGA 1R1VA 2RC4A 3GFMA 1B59A 4OMYA 1U3EM 5HDGA 5LEJA 5LBQA 6PAXA 1BI0A 5CVRA 4DQ2A 4UVBA 2ACJA 2VBWA 5AONA 5JR3A 1BJAA 3LA7A 2Z33A 2MA3A 5LEKA 2ETHA 2O0YA 2XKOA 4IF4A 3LA3A 3SFZA 1MGTA 3TDZC 4HBLA 3SHFA 2EV0A 3SZPA 3E6CC 1TQMA 3EDPA 4UVAA 1YS7A 1C0WA 1P4WA 1TNTA 3MQ0A 2V79A 5J8FA 4Y13A 4G6DA 5ICFA 1Z05A 3KLNA 4FX0A 1FC3A 1TLHB 1MDMB 2D1HA 3GFJA 3RJPA 4LB5A 1ZH5A 1MJAA 1NHAA 2OAZA 4Y17A 4IPAA 2FNPA 2UWMA 2FU4A 2MC3A 3P9CA 4HF2A 3BPXA 3VEPA 1IN7A 5D8LB 1SD5A 2DPDA 4RAZA 5H6QA 5JFRA 2W24A 2ZMEB 1KU2A 2CW0F 1RUNA 5D8KB 3PQJA 1XGNA 2EA2A 1S3JA 2HQNA 5DCMB 1FYKA 3JTHA 4AVPA 1U2WA 1T38A 4U88A 3CUQA 1U6GA 2LSOA 1O3SA 3FX3A 2DBBA 3JAMK 2KKOA 3NEUA 2PJPA 3D0SA 3VODA 1WKMA 4QLCU 3QRFF 4UVCA 3GFIA 2L3DA 2GWRA 4EJVA 2JRTA 4AWXB 1UCRA 1XN7A 2XUBA 4M72A 1J5YA 4EM1A 2G7HA 3ABUA 4FX4A 3I71A 1OYYA 5D5VB 3GUDA 1U5TB 1BI2A 5DD4A 3R6SA 4LLGF 2XAHA 1J9IA 4ZYHA 1IZ1A 2A61A 3I0TA 5HVQC 3ROUA 1MZBA 4EJTA 4UV9A 3IRRA 1CF7B 1PP8F 1IN6A 3NRVA 3IWZA 3T8TA 1G4DA 1FSHA 2XVCA 3W6JB 3F8MA 3I53A 2NS0A 1EV7A 4OMZA 2FBHA 2NRAC 5BPDA 3EETA 5J8CA 3QOPA 3WTZA 1KGSA 5BMZA 3P9IA 1KU9A 1G3SA 2J5PA 1EH7A 1BM9A 1QPMA 3F6VA 3KZYA 3ZMDA 3M7GA 2A69F 1WI9A 3HTUA 2STTA 4K2EA 4I2OA 3DKWA 3K9TA 3FM3A 1K78A 1ZRCA 3M1EA 3TKYA 4L18B 4M9SA 3WE2A 2Z9OA 1EH8A 4XLNF 3BJOA 3QU6A 1H0MA 4KICA 1K79A 3DV8A 1ZG1A 5ICEA 4HQEA 2DPUA 3HSEA 4ZZDA 5D5UB 5L3EA 3LA2A 1O3RA 4HDUA 5L3DA 2M30A 3RPQA 4WF2A 2VXZA 4HA8A 1P92A 2FA5A 1OMIA 3KETA 4BAYA 3MWMA 2KIMA 2FMLA 2BE5F 2K7LA 1W5SA 2ESNA 4AIKA 1I6XA 4KIFA 2IJLA 1Z9CA 1K6OA 1P6RA 2H09A 3DPLC 4RGRA 5EEGA 2PQ8A 1HBXG 2PBIA 4IRHA 3NQOA 1K7AA 4O6JA 2F2EA 4M6XA 5HLIA 4WXCA 2P4WA 3G73A 4D0PA 4XLPF 4HQMA 4CDGA 4MTDA 2NYXA 1OYWA 2IW5A 2OQGA 2H6BA 4IJAA 3F21A 2LDUA 3F8FA 4IXAA 3E5UA 1S7OA 2P5VA 4LGWA 3LQRA 1YLFA 3OV8A 4GXOA 4ON0A 1E17A 4OOIA 1MKMA 2HKXA 2GQQA 3CJNA 4RB2C 3RIRA 1DPUA 1IXRC 4IRGA 3RKXA 3U2RA 3WTUC 2A68F 2WTEA 4LB6B 1PUEE 1W5TA 3K0LA 1IN8A 2DLLA 5DCFA 3E5QA 2XAJA 2XRNA 3K1PA 4HOBA 5ERIA 4Q5SF 4RS8A 5HS7A 1FX7A 1O7LA 2JTVA 2QM3A 1FZPB 4O3MA 4A0YA 4U0WA 3MFKA 2QZ8A 3ECHA 1LVAA 1KQ9A 2KJBA 2A5YB 1YYVA 2DQRA 3WE3A 1IN4A 2VONA 1Z6RA 2JPBA 4MQ9F 1IRFA 2RDPA 4TV7A 2TDXA 2QQAA 4RB1A 5LHHA 2W84A 1V3FA 2L54A 4UNOA 3WODF 2O61A 3QP5A 1FWZA 4S05A 3L9FA 1ZN2A 4A6EA 1SMTA 2VC1A 1QZZA 3F3XA 3WTSC 2Z5UA 1ZLJA 3ML6A 3F8NA 1SFEA 1SD7A 4ESJA 1JXSA 1JGSA 4G7HF 4HF1A 3O3KA 3FWEA 2L01A 3R60A 2EFPA 1GHCA 4ENKA 1KU7A 3ZPLA 3E6BA 3WGHA 3HRTA 2YPRA 3RTRA 2D2WA 4Q4ZF 1ODDA 4GYGA 3SQNA 3OOPA 1D3YA 3FXQA 2HTJA 1G6NA 2MBFA 5IT9Z 1ZGJA 1ON2A 1KYZA 3HYIA 4M9ZA 1YS6A 4KYWA 2ZNYA 2JSCA 2XHKA 1R7JA 2WV0A 1HQCA 2PLYA 2F5EA 3DXJF 2O8XA 1JHHA 2V1DA 2DK5A 4HAMA 2IPQX 4BXUA 2IA2A 2FF4A 2GIVA 4ZYEA 3HHHA 2QWWA 2FEZA 4KT5C 5CLSA 4HLYA 5ICGA 3K2ZA 1J75A 1LEAA 2JPCA 2NNNA 1Z1DA 4CO8A 5H6RA 2PG4A 2EB7A 3GLXA 5ILVA 4YFNF 4LLNA 4KFCA 1O3QA 1HKQA 1LB2A 1J59A 2EV6A 4AIHA 5FD6A 4YIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZN1 A;  2AXL A;  2FSW A;  1H9T A;  2X0L A;  3B02 A;  1K78 B;  2FRH A;  5L3B A;  1ZAR A;  1KA8 A;  2P6S A;  3F6O A;  4GGG A;  4WXH A;  5E17 F;  4ENM A;  2MH9 A;  3ABT A;  2HEO A;  2KRF A;  3PFI A;  1HW5 A;  2UZK A;  3GYH X;  3HOT A;  3WTT C;  1ZGA A;  2FQ3 A;  3AAF A;  3L7W A;  5FFX A;  5BS6 A;  1F1Z A;  2PEX A;  1Q1H A;  2MD5 A;  3KP4 A;  2XAQ A;  1T0F A;  1XD7 A;  3V8L A;  3H3U A;  3RKY A;  4BH9 A;  4L9N A;  1BIA A;  4KDP A;  1YQA A;  4ENJ A;  1SD4 A;  5HOO A;  1YW9 A;  3J80 Z;  3KP7 A;  1MD0 A;  4KIG A;  4P9U A;  1RIO H;  2GA2 A;  4EM0 B;  1R5G A;  4MQV A;  1QNT A;  4CXF A;  4U0V A;  2MLG A;  4KN7 X;  3HHG A;  3GFL A;  2DK8 A;  3HSF A;  2P6T A;  1LEB A;  3LQQ A;  1LJ9 A;  2W25 A;  3EQL F;  1Z6T A;  4I01 A;  5K5O A;  4NQW A;  4E70 A;  4BHP A;  2KIU A;  2AS5 F;  4A0Z A;  3L09 A;  4RGU A;  5E20 A;  1XSV A;  1B1B A;  3ZMU A;  1U78 A;  4HV6 A;  2Z99 A;  4LJZ F;  4PZJ A;  3MAJ A;  4AIJ A;  1GXQ A;  2ZBK A;  3FMR A;  1YFH A;  3MZH A;  2YX4 A;  4LMY A;  2A6H F;  1AOY A;  2KJC A;  3L2C A;  2ZXJ A;  4GCV A;  3KP2 A;  5L3F A;  1XGS A;  2DQL A;  2OZU A;  3BJA A;  2EK5 A;  3HRS A;  4M73 A;  4WX9 A;  3BY6 A;  1REP C;  4U7B A;  2D45 A;  4RAY A;  1ULY A;  3P7N A;  1J0R A;  2GA1 A;  3M8F A;  2RQP A;  4N9H A;  1IXC A;  1DPR A;  5F64 A;  4NB5 A;  5DDG A;  3F8C A;  5BPI A;  3HTS B;  3IHU A;  1KQ8 A;  1BI1 A;  3IKT A;  1WQ2 A;  3BWG A;  2P5K A;  2YSR A;  4U0Y A;  2COM A;  2IRF G;  1KYW A;  2P5L C;  3Q9S A;  2OA4 A;  2IA1 A;  2E1C A;  4Z2Y A;  2EA4 A;  1W7P D;  1OKR A;  2FBI A;  2W85 A;  3WTX C;  1SAX A;  3I5U A;  2GXG A;  3HSR A;  5DD8 A;  4XSZ F;  1XGM A;  3E6D A;  3MEX A;  1TW3 A;  1F5T A;  5FO5 A;  4OIR F;  5ICC A;  4LLL A;  2QQB A;  1IUY A;  2CWE A;  2E7W A;  3TDU C;  2VE9 A;  1JHF A;  4A6D A;  2VT3 A;  2A6E F;  1B9N A;  4CHU A;  1BIB A;  2HR3 A;  3TO7 A;  2WC2 A;  4GO1 A;  1HST A;  3R4K A;  1MJB A;  2RV8 A;  4L9J A;  4OU0 A;  5CJ9 A;  1BI3 A;  3HRU A;  3WGG A;  1FP1 D;  3K1M A;  2CG4 A;  2MH2 A;  3H3Z A;  1U5T C;  4YFK F;  3DEU A;  2VOP A;  3DF8 A;  1O7F A;  1KQ0 A;  3K1N A;  1IXS B;  1VTN C;  4KMF A;  4XBF A;  4EQQ A;  2XAF A;  2EWN A;  2EJR A;  1RNL A;  3QP6 A;  2CFX A;  1QQI A;  4P96 A;  5E8G A;  4KN4 X;  5AIQ A;  1YTY A;  1UHW A;  1D8K A;  3IRQ A;  1DP7 P;  4HDV A;  3CO6 C;  1BOA A;  1S8N A;  4YFX F;  3WG9 A;  1L3L A;  1F4K A;  2CYY A;  3KP6 A;  2DFI A;  3U1D A;  1PDN C;  4OIO F;  3QPH A;  4HLX A;  3FZV A;  4UXN A;  5K1Y A;  1YW7 A;  4FT8 A;  5DUK A;  1Z7U A;  1ZRF A;  1MJ9 A;  3TGN A;  2LKP A;  2V1U A;  2C6Y A;  3RPU A;  2FE3 A;  2UXX A;  2Z3Y A;  3R0A A;  5JHU A;  4N9I A;  1HKT A;  4M71 A;  5TRD A;  4O5V A;  2PN6 A;  2XIG A;  3N97 A;  2F5C A;  4PGH A;  3FMQ A;  1UB9 A;  3QPT A;  1RUO A;  4A5M A;  2K02 A;  4Q48 A;  3C3W A;  4YII A;  2CQK A;  5DUI A;  4EGY A;  2K4B A;  2K27 A;  4MGR A;  4B8X A;  2A3S A;  1BBY A;  3IL2 A;  1R22 A;  1P2F A;  2UXN A;  3DPT A;  1E2X A;  5KK1 A;  3QAH A;  4IHT A;  2HKO A;  1HSJ A;  2EFO A;  2M1B A;  3N4M A;  2ELH A;  1G3T A;  3WU0 A;  3SXY A;  3WGI A;  1ONV A;  2HFH A;  3TOB A;  2FXA A;  4Q47 A;  3MZY A;  1I5Z A;  4EJW A;  1FYM A;  3TO9 A;  1S29 A;  2YX7 A;  3FXR A;  4WXD A;  2W57 A;  3BP8 A;  2H27 A;  2OZ6 A;  3IKV A;  5E8I A;  2OBP A;  1FPQ A;  5FGM A;  1BN5 A;  4G94 A;  2VE8 A;  1BC8 C;  3JSP A;  4IVN A;  3KEQ A;  1LDJ A;  4L5J A;  3CUQ B;  5HLG A;  1AWC A;  2YR2 A;  1T98 A;  5LGN A;  2RKH A;  4WWC A;  5IT9 K;  4JQF A;  1R5H A;  4G8X A;  1IAW A;  3O2P E;  1ZAO A;  1R1T A;  1G3W A;  3CLO A;  3ECO A;  1JE8 A;  2VOD A;  2RGV A;  1LQ1 A;  1IW7 F;  1YG2 A;  3KLO A;  2HYF A;  5LHI A;  3RI4 A;  2DI3 A;  5HDK A;  5DV5 A;  1XCB A;  3ISP A;  2QLZ A;  4MEX F;  2DO7 A;  5CVV A;  3V7C A;  1XSD A;  2R3S A;  2QEN A;  3H92 A;  1IF1 A;  2XRO A;  3RDI A;  2ISZ A;  2XV4 S;  2H6C A;  1TNS A;  2ESH A;  5F1R A;  1ZRD A;  2ZJ2 A;  5LHG A;  5BQT A;  2CGP A;  3GW2 A;  1S6L A;  3QU3 A;  4BHB A;  1B4A A;  2NAZ A;  2IT0 A;  1KU3 A;  3F72 A;  5D5W B;  3K69 A;  2QUF A;  2OQR A;  2IVM A;  3F22 A;  4ENN A;  2XAS A;  4A2U A;  1ZYR F;  3VB2 A;  1ZRE A;  1X3U A;  4R8H A;  2DU9 A;  2O3F A;  3JW4 A;  3HIF A;  3WTW C;  2VBX A;  3TOA A;  2P8T A;  2D1V A;  4RB0 A;  3BRO A;  1HW1 A;  1DDN A;  4CZZ A;  4QWQ A;  2HS5 A;  1QGP A;  3F23 A;  4DNC A;  3C18 A;  4MTE A;  2ZNZ A;  2P7V B;  4ESF A;  3TO6 A;  2J5O A;  5LLQ A;  1V4R A;  2QVO A;  5JI6 A;  4S04 A;  2STW A;  4L9V A;  2H94 A;  3GWZ A;  4R79 A;  2PFB A;  1FBU A;  3HRM A;  3V8K A;  1SFU A;  5E1X A;  5HDN A;  3CUQ C;  3VFZ A;  2HYG D;  2BEO A;  1GXP A;  4LFU A;  4WCG A;  5LRS A;  2ZFW A;  3I54 A;  1LDD A;  2EFQ A;  2L02 A;  2VC0 A;  3E6M A;  4A0X A;  2O6G E;  4HX7 A;  3T1B A;  3WU1 B;  2GZW A;  3RKW A;  4LK1 F;  1W7P A;  4ASN A;  4MHG A;  1FP2 A;  3ZN0 A;  2L4M A;  3ELK A;  2FOK A;  3J80 K;  5H20 A;  3I4P A;  3FHZ A;  3LST A;  5LGT A;  2Y0M A;  2V1X A;  1R58 A;  3ZMZ A;  4JBA A;  3COA C;  4L9T A;  2ZKZ A;  5D5X B;  1TQI A;  3R0J A;  1RZ4 A;  3RYR A;  1QO0 D;  1XCV A;  2HTS A;  3PQK A;  3V8J A;  3I59 A;  1R1U A;  1ON1 A;  5K5R A;  1I27 A;  1ZG5 A;  4G7Z F;  3WTY C;  5F6F A;  4FHT A;  2IA0 A;  1TW2 A;  1LNW A;  2QBY A;  5J6X A;  4A12 A;  4OIP F;  4ZH4 F;  3LAJ A;  1Z91 A;  4L0Y B;  2JZY A;  5ILS A;  3LWF A;  4ETS A;  4EV0 A;  3EUH A;  3SZT A;  2NNY A;  4GYI A;  3MCZ A;  1IN5 A;  2BV6 A;  3FXU A;  3KE2 A;  3GVA A;  3KCC A;  3IWF A;  2Y48 A;  4I0B A;  5E1Z B;  1HW2 A;  2FBK A;  2Q0O A;  1XDU A;  4KNY A;  3JAM Z;  1SFX A;  2V9V A;  3BDD A;  1TBX A;  1BC7 C;  3GX4 X;  4PDK A;  3EYI A;  1FBS A;  1P4X A;  1T6S A;  1HKS A;  2DT5 A;  1PP7 U;  3E5X A;  3U9G A;  4LG0 A;  3BJ6 A;  5TJJ A;  3FMS A;  2Q2E A;  3V7R A;  3E3V A;  4ESB A;  1YIO A;  2ISY A;  2G7U A;  2LNB A;  3C7J A;  1FT9 A;  3G3Z A;  3I58 A;  3WTV C;  2HWV A;  2IP2 A;  5HS8 A;  1T39 A;  4XSX F;  4EGZ A;  3ZQ7 A;  3HUG A;  2XGX A;  2DTR A;  4UUV A;  1YO5 C;  5K5Q A;  3KFW X;  4KUM A;  1L0O C;  3M8E A;  5DYM A;  4HV5 A;  5CVI A;  2EV5 A;  1Y0U A;  1DUX C;  1WWX A;  5FB2 A;  2V6C A;  5D6F A;  4HW0 A;  1SD6 A;  1OYI A;  2L4A A;  4I98 B;  3CO7 C;  2G9W A;  3GZ6 A;  2LF7 A;  3ZMV A;  2P7C B;  1OR7 A;  5HS9 A;  4XRF A;  1HXD A;  3KP5 A;  5CVU A;  2OU2 A;  4EVI A;  4ZYD A;  3JSO A;  3CDH A;  1QBJ A;  1SMY F;  3GF2 A;  4I7H A;  2MLK A;  1UHM A;  1XDS A;  4Y15 A;  5KVR A;  3Q5F A;  4KMU X;  1W4M A;  3HOS A;  1I1G A;  1ZLK A;  3C1D A;  1FLI A;  4RGX A;  4UV8 A;  2YU3 A;  4EM2 A;  2ZCW A;  4P55 A;  1R00 A;  1USS A;  5CYV A;  3FM5 A;  1MDM A;  4P5O A;  3I64 A;  1OPC A;  4I02 A;  2HZT A;  1D8J A;  5CVJ A;  4RB3 C;  3GZ5 A;  5A2Q K;  4CYD A;  4OIQ F;  3T8R A;  5A2Q Z;  2KIF A;  2QQ9 A;  1XB4 A;  3TQN A;  1FNN A;  2VOO A;  4KIB A;  4BHC A;  5ILU A;  4M74 A;  4OIN F;  4B09 A;  2CO5 A;  1U8R A;  1P4A A;  1WSU A;  2O03 A;  3V7S A;  1XMK A;  1T2K A;  3BPV A;  2Q8K A;  2ZME A;  2RVC A;  1O3T A;  1J7K A;  4EJO A;  3JTG A;  3VOE A;  3IC7 A;  4BYY A;  2QYO A;  1GVJ A;  3DP7 A;  2DAO A;  4M9X A;  2M45 A;  5DCM A;  4BQA A;  3KP3 A;  3KEO A;  3J81 K;  1EH6 A;  1FY7 A;  4MNU A;  3J81 Z;  2XAG A;  1F9N A;  2LF8 A;  2RNJ A;  2A07 F;  2PMU A;  1A04 A;  4F7Z A;  4MEY F;  1R23 A;  1STZ A;  2X4H A;  2PMH A;  1B9M A;  2WWY A;  1ZG3 A;  4YG2 F;  5L3G A;  1H9G A;  1WRJ A;  1U5T A;  4ZYG A;  5L3C A;  2M8E A;  2R7F A;  1TQP A;  1IRG A;  4PGG A;  3BOQ A;  5D4R A;  3CTA A;  4HX4 A;  4LD5 A;  4L5I A;  3E97 A;  2BYV E;  3ULQ B;  1B6A A;  5FFZ A;  1CF7 A;  1ZHF A;  4EMS A;  1W7P B;  2FNA A;  5E18 F;  2HDC A;  3CUO A;  2F5F A;  2B0L A;  2HQR A;  2EFN A;  2ADU A;  1XGO A;  1FYL A;  4N0B A;  3Q9V A;  3B73 A;  4IRI A;  3J7A O;  4R1H A;  2BGC A;  4LK0 F;  2JT1 A;  3REO A;  4M6Y A;  1FBQ A;  4A5N A;  3GXO A;  2VN2 A;  1UST A;  1LDK B;  2CSO A;  1TTY A;  3I59 B;  3BZ6 A;  3KZZ A;  4HYE A;  4IHS A;  3ZMT A;  2EFW A;  4I0A A;  2QBY B;  1QZY A;  1G3Y A;  2M87 A;  1FSE A;  1XMA A;  4G9Y A;  2VBZ A;  5AIP A;  4HX8 A;  2XKP A;  1FOK A;  5LGU A;  3ZMS A;  2R7D A;  3D5L A;  5IT3 A;  4H0E A;  4CIC A;  4CGZ A;  2RN7 A;  1XSX A;  4I09 A;  5D4S A;  5FLX K;  1UFM A;  4HF0 A;  2E7X A;  5DEQ A;  2ZO4 A;  5FLX Z;  3O6B B;  2HGC A;  5D6E A;  1J2X A;  2OD5 A;  4UHT A;  1I1S A;  3FF5 A;  2K4J A;  5HLH A;  1RI7 A;  4WK8 F;  1O57 A;  5EEH A;  2HOE A;  1R36 A;  2FMY A;  3EYY A;  4BNC A;  4U7D A;  4NHJ A;  3V4G A;  4G6Q A;  3S2W A;  4JK1 X;  3LAP A;  3L00 A;  4LG0 B;  1YW8 A;  4L0Z B;  3DQV C;  3GEZ A;  3RYP A;  4P9F A;  2K86 A;  3LFK A;  2PI0 A;  5ED4 A;  3ERE D;  4KA4 A;  3F8B A;  3GO5 A;  2GXB A;  4PCQ A;  2GAU A;  1CGP A;  3T5X A;  2M5W A;  5E1W A;  2DW4 A;  5FD5 A;  3W6K B;  2VT2 A;  3M9A A;  1D5V A;  3ZP5 A;  3R61 A;  5JVT A;  4ZZL A;  3P9K A;  4AD9 A;  2VBY A;  2BBY A;  2Y75 A;  2E1N A;  4EJU A;  3T0Y A;  4HZF A;  2F5D A;  4RGS A;  5BOX A;  1S7A A;  4G7O F;  5LRR A;  3DFG A;  1R1V A;  2RC4 A;  3GFM A;  1B59 A;  4OMY A;  1U3E M;  5HDG A;  5LEJ A;  5LBQ A;  6PAX A;  1BI0 A;  5CVR A;  4DQ2 A;  4UVB A;  2ACJ A;  2VBW A;  5AON A;  5JR3 A;  1BJA A;  3LA7 A;  2Z33 A;  2MA3 A;  5LEK A;  2ETH A;  2O0Y A;  2XKO A;  4IF4 A;  3LA3 A;  3SFZ A;  1MGT A;  3TDZ C;  4HBL A;  3SHF A;  2EV0 A;  3SZP A;  3E6C C;  1TQM A;  3EDP A;  4UVA A;  1YS7 A;  1C0W A;  1P4W A;  1TNT A;  3MQ0 A;  2V79 A;  5J8F A;  4Y13 A;  4G6D A;  5ICF A;  1Z05 A;  3KLN A;  4FX0 A;  1FC3 A;  1TLH B;  1MDM B;  2D1H A;  3GFJ A;  3RJP A;  4LB5 A;  1ZH5 A;  1MJA A;  1NHA A;  2OAZ A;  4Y17 A;  4IPA A;  2FNP A;  2UWM A;  2FU4 A;  2MC3 A;  3P9C A;  4HF2 A;  3BPX A;  3VEP A;  1IN7 A;  5D8L B;  1SD5 A;  2DPD A;  4RAZ A;  5H6Q A;  5JFR A;  2W24 A;  2ZME B;  1KU2 A;  2CW0 F;  1RUN A;  5D8K B;  3PQJ A;  1XGN A;  2EA2 A;  1S3J A;  2HQN A;  5DCM B;  1FYK A;  3JTH A;  4AVP A;  1U2W A;  1T38 A;  4U88 A;  3CUQ A;  1U6G A;  2LSO A;  1O3S A;  3FX3 A;  2DBB A;  3JAM K;  2KKO A;  3NEU A;  2PJP A;  3D0S A;  3VOD A;  1WKM A;  4QLC U;  3QRF F;  4UVC A;  3GFI A;  2L3D A;  2GWR A;  4EJV A;  2JRT A;  4AWX B;  1UCR A;  1XN7 A;  2XUB A;  4M72 A;  1J5Y A;  4EM1 A;  2G7H A;  3ABU A;  4FX4 A;  3I71 A;  1OYY A;  5D5V B;  3GUD A;  1U5T B;  1BI2 A;  5DD4 A;  3R6S A;  4LLG F;  2XAH A;  1J9I A;  4ZYH A;  1IZ1 A;  2A61 A;  3I0T A;  5HVQ C;  3ROU A;  1MZB A;  4EJT A;  4UV9 A;  3IRR A;  1CF7 B;  1PP8 F;  1IN6 A;  3NRV A;  3IWZ A;  3T8T A;  1G4D A;  1FSH A;  2XVC A;  3W6J B;  3F8M A;  3I53 A;  2NS0 A;  1EV7 A;  4OMZ A;  2FBH A;  2NRA C;  5BPD A;  3EET A;  5J8C A;  3QOP A;  3WTZ A;  1KGS A;  5BMZ A;  3P9I A;  1KU9 A;  1G3S A;  2J5P A;  1EH7 A;  1BM9 A;  1QPM A;  3F6V A;  3KZY A;  3ZMD A;  3M7G A;  2A69 F;  1WI9 A;  3HTU A;  2STT A;  4K2E A;  4I2O A;  3DKW A;  3K9T A;  3FM3 A;  1K78 A;  1ZRC A;  3M1E A;  3TKY A;  4L18 B;  4M9S A;  3WE2 A;  2Z9O A;  1EH8 A;  4XLN F;  3BJO A;  3QU6 A;  1H0M A;  4KIC A;  1K79 A;  3DV8 A;  1ZG1 A;  5ICE A;  4HQE A;  2DPU A;  3HSE A;  4ZZD A;  5D5U B;  5L3E A;  3LA2 A;  1O3R A;  4HDU A;  5L3D A;  2M30 A;  3RPQ A;  4WF2 A;  2VXZ A;  4HA8 A;  1P92 A;  2FA5 A;  1OMI A;  3KET A;  4BAY A;  3MWM A;  2KIM A;  2FML A;  2BE5 F;  2K7L A;  1W5S A;  2ESN A;  4AIK A;  1I6X A;  4KIF A;  2IJL A;  1Z9C A;  1K6O A;  1P6R A;  2H09 A;  3DPL C;  4RGR A;  5EEG A;  2PQ8 A;  1HBX G;  2PBI A;  4IRH A;  3NQO A;  1K7A A;  4O6J A;  2F2E A;  4M6X A;  5HLI A;  4WXC A;  2P4W A;  3G73 A;  4D0P A;  4XLP F;  4HQM A;  4CDG A;  4MTD A;  2NYX A;  1OYW A;  2IW5 A;  2OQG A;  2H6B A;  4IJA A;  3F21 A;  2LDU A;  3F8F A;  4IXA A;  3E5U A;  1S7O A;  2P5V A;  4LGW A;  3LQR A;  1YLF A;  3OV8 A;  4GXO A;  4ON0 A;  1E17 A;  4OOI A;  1MKM A;  2HKX A;  2GQQ A;  3CJN A;  4RB2 C;  3RIR A;  1DPU A;  1IXR C;  4IRG A;  3RKX A;  3U2R A;  3WTU C;  2A68 F;  2WTE A;  4LB6 B;  1PUE E;  1W5T A;  3K0L A;  1IN8 A;  2DLL A;  5DCF A;  3E5Q A;  2XAJ A;  2XRN A;  3K1P A;  4HOB A;  5ERI A;  4Q5S F;  4RS8 A;  5HS7 A;  1FX7 A;  1O7L A;  2JTV A;  2QM3 A;  1FZP B;  4O3M A;  4A0Y A;  4U0W A;  3MFK A;  2QZ8 A;  3ECH A;  1LVA A;  1KQ9 A;  2KJB A;  2A5Y B;  1YYV A;  2DQR A;  3WE3 A;  1IN4 A;  2VON A;  1Z6R A;  2JPB A;  4MQ9 F;  1IRF A;  2RDP A;  4TV7 A;  2TDX A;  2QQA A;  4RB1 A;  5LHH A;  2W84 A;  1V3F A;  2L54 A;  4UNO A;  3WOD F;  2O61 A;  3QP5 A;  1FWZ A;  4S05 A;  3L9F A;  1ZN2 A;  4A6E A;  1SMT A;  2VC1 A;  1QZZ A;  3F3X A;  3WTS C;  2Z5U A;  1ZLJ A;  3ML6 A;  3F8N A;  1SFE A;  1SD7 A;  4ESJ A;  1JXS A;  1JGS A;  4G7H F;  4HF1 A;  3O3K A;  3FWE A;  2L01 A;  3R60 A;  2EFP A;  1GHC A;  4ENK A;  1KU7 A;  3ZPL A;  3E6B A;  3WGH A;  3HRT A;  2YPR A;  3RTR A;  2D2W A;  4Q4Z F;  1ODD A;  4GYG A;  3SQN A;  3OOP A;  1D3Y A;  3FXQ A;  2HTJ A;  1G6N A;  2MBF A;  5IT9 Z;  1ZGJ A;  1ON2 A;  1KYZ A;  3HYI A;  4M9Z A;  1YS6 A;  4KYW A;  2ZNY A;  2JSC A;  2XHK A;  1R7J A;  2WV0 A;  1HQC A;  2PLY A;  2F5E A;  3DXJ F;  2O8X A;  1JHH A;  2V1D A;  2DK5 A;  4HAM A;  2IPQ X;  4BXU A;  2IA2 A;  2FF4 A;  2GIV A;  4ZYE A;  3HHH A;  2QWW A;  2FEZ A;  4KT5 C;  5CLS A;  4HLY A;  5ICG A;  3K2Z A;  1J75 A;  1LEA A;  2JPC A;  2NNN A;  1Z1D A;  4CO8 A;  5H6R A;  2PG4 A;  2EB7 A;  3GLX A;  5ILV A;  4YFN F;  4LLN A;  4KFC A;  1O3Q A;  1HKQ A;  1LB2 A;  1J59 A;  2EV6 A;  4AIH A;  5FD6 A;  4YIF A; 
#chains in the Genus database with same CATH topology
 1SFK A;  5M5Y J;  3ZN1 A;  2AXL A;  2FSW A;  3ZQH A;  3F0C A;  1H9T A;  2X0L A;  3B02 A;  1K78 B;  2FRH A;  3A0B C;  4Y52 J;  5L3B A;  1ZAR A;  3L1P A;  2JWT A;  1VQP I;  4QSH A;  1KA8 A;  2M4G A;  3PJR A;  2P6S A;  3FHN A;  4A69 C;  1GT0 C;  1TT0 A;  3F6O A;  4GGG A;  3N05 A;  2KL4 A;  4NDL A;  4V2G A;  3FBI B;  3H9J A;  4WXH A;  1DU0 A;  5E17 F;  1U8B A;  2XPW A;  1H89 C;  4ENM A;  1O4X A;  1IC8 A;  2MH9 A;  3ABT A;  5B1A H;  3MN2 A;  3OYE A;  2KT0 A;  2HEO A;  2KRF A;  3OS2 A;  3PFI A;  1HW5 A;  2UZK A;  3GYH X;  3HOT A;  2K3F A;  4B48 A;  5IOZ A;  3WTT C;  1ZGA A;  4QPO A;  2X6W A;  3ABM H;  2EZK A;  4BXF A;  5F1J A;  2FQ3 A;  2Z16 A;  3AAF A;  3OYJ A;  2IGN A;  4RLF A;  1R4N B;  2R7Q A;  3L7W A;  4DYR A;  5FFX A;  5BS6 A;  1F1Z A;  2PEX A;  3MKY B;  1Q1H A;  2MD5 A;  3KP4 A;  2XAQ A;  1JJ8 C;  1OFC X;  1T0F A;  2EPF A;  1XD7 A;  3V8L A;  3H3U A;  3RKY A;  3SYT A;  1MMD A;  4BH9 A;  4L9N A;  3S1M J;  2XPV A;  3LSJ A;  1BIA A;  4KDP A;  3S1Q J;  1YQA A;  5JLX A;  4ENJ A;  1SD4 A;  1BA5 A;  3HZJ A;  5HOO A;  4V2F A;  4IHW A;  1YW9 A;  3J80 Z;  1AKH B;  5JLW A;  1T08 B;  2R93 J;  1SEU A;  3KP7 A;  2ZXH A;  1MD0 A;  3LSK A;  3BLY A;  5K7F A;  4NC7 A;  4KIG A;  3SDG A;  4P9U A;  1RIO H;  4BGD A;  2GA2 A;  4EM0 B;  1R5G A;  2CV1 A;  4JYK A;  4XIC A;  4MQV A;  3CDI A;  3KPH A;  1QNT A;  3FBN B;  4U0V A;  2MLG A;  4CXF A;  4KN7 X;  4A93 J;  3HHG A;  1WHU A;  3KX2 A;  3GFL A;  3OIO A;  2DK8 A;  4BQN A;  3HSF A;  2CMP A;  2LY2 A;  2P6T A;  3CCJ I;  1LEB A;  2KDZ A;  3H5R A;  3LQQ A;  1LJ9 A;  2X85 A;  2W25 A;  4XLF A;  2DN0 A;  1FEX A;  3DBR B;  2X6Y A;  1ETY A;  3GTM J;  3EQL F;  1JUM A;  1Z6T A;  1TWC J;  1A35 A;  4AID A;  2R7U A;  3AL0 C;  4I01 A;  1JT0 A;  5K5O A;  1MMG A;  4NQW A;  1N25 A;  4E70 A;  4BHP A;  2KIU A;  3I3L A;  3CCE I;  2LLK A;  2AS5 F;  1ITY A;  3M1C A;  4A0Z A;  3L09 A;  1Y1W J;  5IYC J;  3UKG A;  4RGU A;  4LIT A;  2B63 J;  5E20 A;  2BW3 A;  1YHQ I;  5K7H A;  1XSV A;  1WJF A;  1B1B A;  3ZMU A;  1U78 A;  2NXN B;  2IS2 A;  4HV6 A;  2BXY A;  2Z99 A;  4LJZ F;  4PJL A;  1RPW A;  1VQ7 I;  4PZJ A;  3J7A Y;  3MAJ A;  4B4C A;  4AIJ A;  3HOY J;  1GXQ A;  1YE9 A;  2ZBK A;  3FMR A;  1YFH A;  3MZH A;  1OR7 C;  5KHD A;  2YX4 A;  1VQ5 I;  3HC7 A;  5J1Y A;  4LMY A;  2A6H F;  1AOY A;  2HYJ A;  2P81 A;  4CSW A;  4NBQ A;  3G6E I;  1SVO A;  2KJC A;  3ASO H;  1D0Z A;  1YX3 A;  5EG0 B;  3G1L A;  3L2C A;  2ZXJ A;  2LY9 A;  3A01 B;  4GCV A;  1Z21 A;  2E5Z A;  3KP2 A;  5L3F A;  2E5N A;  1XGS A;  2DQL A;  2EIK H;  3GZN B;  1YJN I;  2OZU A;  3BJA A;  2ME6 A;  3V42 A;  1Z77 A;  2BVL A;  2EK5 A;  3AG2 H;  3HRS A;  4M73 A;  4WX9 A;  3BY6 A;  1REP C;  4U7B A;  3OS0 A;  5KAF C;  2D45 A;  2VKD A;  3JRG A;  4RAY A;  1VQN I;  2KDO A;  1ULY A;  2N8G A;  2F4O B;  2MG4 A;  5FLV A;  3P7N A;  4XLH A;  1J0R A;  2GA1 A;  3M8F A;  2RQP A;  4N9H A;  5EZG A;  1H8A C;  4XLC A;  4BEH A;  4V19 K;  5HNF A;  3K6G A;  1IXC A;  1DPR A;  3HB9 A;  5F64 A;  4NB5 A;  1TZL A;  4CCN A;  5DDG A;  4PFP A;  5BNG A;  3F8C A;  5BPI A;  2K40 A;  5GPC A;  1JGG A;  3HTS B;  1HF0 A;  1MW7 A;  3IHU A;  2X1D A;  1BI1 A;  1KQ8 A;  1DGW Y;  3IKT A;  1WQ2 A;  4EEF G;  3BWG A;  3OOU A;  2HDD A;  2P5K A;  2YSR A;  1H88 C;  4XKV A;  3BZK A;  4U0Y A;  2COM A;  4A3K J;  1KYW A;  2IRF G;  5DS9 A;  2P5L C;  1MSE C;  3FK6 A;  2IAI A;  3Q9S A;  2OA4 A;  2IA1 A;  2E1C A;  4ITV A;  1NK2 P;  4Z2Y A;  2EA4 A;  1E3P A;  1W7P D;  4RM2 A;  1M1E B;  1WJA A;  1T95 A;  1OKR A;  2MW8 A;  1X3Z B;  4W97 A;  1LPQ A;  2QKM B;  2LBF A;  2FBI A;  2W85 A;  3WTX C;  1SAX A;  1LKX A;  2Z2S B;  3I5U A;  4FCY A;  1ZR2 A;  2GXG A;  2LY1 A;  3HSR A;  2ZME C;  1QU3 A;  5DD8 A;  3WU2 C;  2K3P A;  3CCU I;  1Y6I A;  2HPI A;  4XSZ F;  1XGM A;  2KFD A;  2V9K A;  1V54 H;  3E6D A;  3MEX A;  4YRV A;  1TW3 A;  1F5T A;  2CRG A;  3OYI A;  1X4O A;  2FJ1 A;  5FO5 A;  5FKL A;  1Y8R B;  3CQZ J;  4OIR F;  3VWB A;  5ICC A;  1FOW A;  4LLL A;  2QQB A;  1IUY A;  2UUZ A;  5HNH A;  4G12 A;  1G59 A;  2CWE A;  2E7W A;  2ZSH B;  1JKR C;  1OCO H;  4D9J A;  4UY8 I;  2WY8 Q;  3TDU C;  2VE9 A;  4ZDO A;  2VPR A;  1JHF A;  4A6D A;  3BT9 A;  2VT3 A;  3SZG A;  2A6E F;  1B9N A;  2X6O A;  3MZ8 A;  4CHU A;  1JKQ C;  2BHZ A;  1BIB A;  4PSW A;  4XRS A;  4FIS A;  2IS4 A;  3ABL H;  4E6K G;  2IGK A;  2IEK A;  2M7A A;  2HR3 A;  3TO7 A;  4X6A J;  2G0E A;  2WC2 A;  4GO1 A;  3GBG A;  3OYM A;  3DKY A;  1HST A;  4D5C A;  3S17 J;  2FX0 A;  2DA5 A;  3R4K A;  1MJB A;  2RV8 A;  3WHB A;  4L9J A;  4OU0 A;  5CJ9 A;  3DU5 A;  1BI3 A;  3HRU A;  3WGG A;  1VQ8 I;  1FP1 D;  3K1M A;  2CG4 A;  3J7Z I;  2MH2 A;  2ZJP F;  3H3Z A;  1U5T C;  1I50 J;  2XRL A;  4YFK F;  2BXZ A;  4C2M J;  3DEU A;  3S8P A;  2VOP A;  1WJB A;  3DF8 A;  4XKW A;  1O7F A;  4XOR A;  2QQ8 A;  1KQ0 A;  3HOV J;  3K1N A;  1IXS B;  1MNE A;  1VTN C;  3OSG A;  4KMF A;  4XBF A;  4EQQ A;  2XAF A;  1JTX A;  3I9V 2;  2BY0 A;  2EWN A;  2EJR A;  4XQF A;  3HBL A;  1RNL A;  3QP6 A;  2CW7 A;  2CFX A;  1QQI A;  3K70 C;  2ICW G;  3CCR I;  4P96 A;  1VQK I;  1DGR M;  2XF5 A;  3D5R C;  1S9H A;  3K4B A;  5E8G A;  1XPX A;  4KN4 X;  4PUS A;  3CD6 I;  5AIQ A;  3ZQL A;  1YTY A;  1XMX A;  1NG6 A;  1UHW A;  1D8K A;  4ZTJ A;  3IRQ A;  1DP7 P;  2OTL I;  4OAZ A;  1HCR A;  4HDV A;  1IDZ A;  3CO6 C;  3RQI A;  1BOA A;  1S8N A;  4YFX F;  3WG9 A;  4IOC F;  4LG3 A;  2PMZ N;  1L3L A;  3W6V A;  1F4K A;  4A3F J;  4IZZ A;  1G8X A;  1TC3 C;  2GIZ A;  4LIV A;  1Z7L A;  4XNF A;  1GV2 A;  2CYY A;  2JA5 J;  3KP6 A;  2V26 A;  1WI3 A;  2VAS A;  2JUC A;  2DFI A;  2RAE A;  3U1D A;  1PDN C;  2VL8 A;  4OIO F;  3QPH A;  4HLX A;  2QSH X;  3FZV A;  4UXN A;  5EJC A;  1JJ6 C;  5K1Y A;  3LFU A;  2E2J J;  1YW7 A;  4FT8 A;  5DUK A;  1Z7U A;  1MBF A;  2X51 A;  3S1R J;  4HRI A;  1ZRF A;  1OQY A;  5E3O A;  3M3Y J;  1MJ9 A;  1AA7 A;  3TGN A;  1RRJ A;  2O9L A;  2LKP A;  3HJE A;  3K2A A;  2V1U A;  2C6Y A;  2W48 A;  1OCC H;  1EJ9 A;  5JHF A;  1MIJ A;  3RPU A;  1WVR A;  2FE3 A;  2UXX A;  2Z3Y A;  3DEE A;  5B5E C;  3R0A A;  2Y30 A;  4BBS J;  4IOA F;  4KJZ A;  1ZTR A;  2DFH A;  3OYH A;  4XKB A;  1NG7 A;  5JHU A;  2MSY A;  5F27 A;  4N9I A;  1HKT A;  3CMA I;  4M71 A;  4CZC A;  3SJM A;  4BDZ A;  5TRD A;  3DEW A;  1JTY A;  4O5V A;  3B6C A;  2PN6 A;  2XIG A;  3N97 A;  2F5C A;  3DLA A;  4PGH A;  1D1A A;  1VQ9 I;  3FMQ A;  1BW5 A;  1UB9 A;  3QPT A;  1X1C A;  3A1Y A;  1X4P A;  2X6X A;  4A5M A;  1RUO A;  2EH3 A;  2K02 A;  1K4S A;  2PJR A;  4Q48 A;  4QIW N;  3C3W A;  4YII A;  2CQK A;  1IO2 A;  1WPK A;  3OYG A;  4BJ5 C;  5DUI A;  4EGY A;  2K4B A;  3IV5 A;  3VYT B;  2K27 A;  2GOX B;  4MGR A;  4B8X A;  2A3S A;  1BBY A;  3IL2 A;  1R22 A;  2P0W A;  3NAR A;  1P2F A;  2E71 A;  3AG3 H;  1VF9 A;  1XC5 A;  2UXN A;  3RSN A;  2BVM A;  2LH9 A;  3DPT A;  2ELK A;  2OPT A;  3G1O A;  1E2X A;  5KK1 A;  3QAH A;  1I3A A;  4IHT A;  1ETW A;  2HKO A;  2EZI A;  1HSJ A;  1W0U A;  2EFO A;  2DA4 A;  2M7B A;  2M1B A;  4RMN A;  2R7V A;  5LFA A;  3N4M A;  2ELH A;  3BC8 A;  5C4J J;  3GTO J;  1G3T A;  3WU0 A;  3SXY A;  3WGI A;  5J4V A;  1LFB A;  1QRY A;  4QTR A;  3JRH A;  3CF2 A;  3S3O A;  1ONV A;  3P5J A;  5FLM J;  1DU6 A;  2HFH A;  3TOB A;  2FXA A;  4Q47 A;  3MZY A;  1I5Z A;  4EJW A;  1ORK A;  1FYM A;  1Z0X A;  3TO9 A;  1S29 A;  4AYB N;  2YX7 A;  4N4N B;  2GOM A;  3FXR A;  4WXD A;  3FKJ A;  1XG1 A;  2W57 A;  3BP8 A;  2H27 A;  2OZ6 A;  4IHV A;  3IKV A;  1BR2 A;  5E8I A;  5EEA A;  2F5V A;  3OIQ A;  5IPA A;  2OBP A;  1FPQ A;  5FGM A;  5IP9 J;  4F3Q A;  1BN5 A;  3MVP A;  4G94 A;  2VE8 A;  5GAD J;  2I5U A;  3JR9 A;  1BC8 C;  2OCC H;  3JSP A;  1ZK8 A;  4IVN A;  3ZRG A;  2HOS A;  3KEQ A;  4NQW B;  1LDJ A;  4UUS A;  4L5J A;  2EZH A;  3CUQ B;  4W1U A;  3EUK L;  5HLG A;  3LSM A;  3JCU C;  3PIO F;  1AU7 A;  5J1U A;  1P7I A;  1AWC A;  3S1N J;  2YR2 A;  1T98 A;  2BW3 B;  2E34 A;  4BUP A;  5LGN A;  2RKH A;  4WWC A;  5IT9 K;  4JQF A;  1R5H A;  2MD0 A;  4BQO A;  1VI0 A;  2KMU A;  2Y0S A;  3QOD A;  4G8X A;  1IAW A;  2GXA A;  3Q0U A;  3O2P E;  1ZAO A;  2HZD A;  1R1T A;  1G3W A;  3CLO A;  3ECO A;  2I10 A;  1JE8 A;  2HNH A;  3PM1 A;  4XOP A;  2MC4 A;  2VOD A;  2RGV A;  1V55 H;  1MSF C;  2B9S A;  1LQ1 A;  1IW7 F;  1YG2 A;  1ACI A;  3KLO A;  2HYF A;  5LHI A;  3RI4 A;  2DI3 A;  5HDK A;  5DV5 A;  5FKK A;  4E7S A;  1XCB A;  3ISP A;  3A4C A;  2QLZ A;  2VJJ A;  4F93 B;  4MEX F;  1MBH A;  2DO7 A;  5CVV A;  3V7C A;  1XSD A;  2R3S A;  2HOA A;  2LOO A;  2DJI A;  1XX5 A;  2DOA A;  2QEN A;  5FJ8 J;  3H92 A;  5TGT A;  5B66 C;  1RKT A;  1IF1 A;  3O8G A;  2XRO A;  2IXS A;  4B3X A;  3RDI A;  4BQQ A;  2ISZ A;  2XV4 S;  2X48 A;  2XC7 A;  2L9R A;  2H6C A;  5GTH C;  4XOT A;  1TNS A;  4E7I A;  2ESH A;  1ETV A;  4IO9 F;  4DYQ A;  2L7Z A;  2M2E A;  5F1R A;  2ZJ2 A;  3FIS A;  5H2F C;  5LHG A;  3NAU A;  5BQT A;  1ZRD A;  2CGP A;  4IHX A;  1P7J A;  3GW2 A;  1S6L A;  4MLO A;  3DTE A;  3DCF A;  4BEH B;  1FOY A;  3QU3 A;  4BHB A;  1B4A A;  2NAZ A;  2OCE A;  4BE0 A;  1MH3 A;  3HOX J;  1TT5 B;  1KU3 A;  3F72 A;  5D5W B;  2DFF A;  2IT0 A;  3K69 A;  4FE4 A;  3BG6 A;  2QUF A;  3L2V A;  2AHQ A;  4C2U A;  2OQR A;  2IVM A;  3AFH A;  2MFZ A;  3F22 A;  4G6T B;  2XAS A;  4MFD A;  4ENN A;  1R4M B;  4A2U A;  1ZYR F;  2F4M B;  3B6A A;  2QGU A;  4XMY A;  3VB2 A;  1IG7 A;  1X3U A;  1ZRE A;  4R8H A;  2DU9 A;  2O3F A;  4H4K C;  4A3L J;  3JW4 A;  3HIF A;  4CUG A;  4DYC A;  3WTW C;  2VBX A;  3TED A;  3TOA A;  3K70 D;  2EQR A;  2P8T A;  2D1V A;  1T8I A;  4RB0 A;  2L9N A;  3OYN A;  2TRT A;  3BRO A;  1HW1 A;  1DDN A;  3BR3 A;  3CME I;  3FDY A;  3MKW B;  4CZZ A;  3OYK A;  2LBF B;  4QWQ A;  5EZH A;  1R9T J;  3ERM A;  2HS5 A;  2WA0 A;  1QGP A;  2Y2Z A;  3F23 A;  4YEJ A;  4DNC A;  5KNL A;  5JVG F;  3C18 A;  1HA8 A;  4MTE A;  2E1M B;  5FKO A;  3QQA A;  2ZNZ A;  2P7V B;  3I56 I;  4ESF A;  3W3C A;  3TO6 A;  2J5O A;  5LLQ A;  3CDL A;  1TWF J;  1V4R A;  1JKP C;  2QVO A;  3HG9 A;  1YI2 I;  1OIS A;  5JI6 A;  4S04 A;  2STW A;  4L9V A;  1RR8 C;  2XAU A;  5J40 A;  1YJ9 I;  1SFO J;  2ZSI B;  2H94 A;  3GWZ A;  4R79 A;  5F0H A;  4JX6 A;  2VJ4 A;  2KIQ A;  2PFB A;  2L9S A;  4RAG A;  5M5W J;  1FBU A;  3HRM A;  3NWS A;  3ZCO A;  2R0Q C;  3V8K A;  1SFU A;  4J00 A;  5CPR B;  2EIM H;  5E1X A;  5HDN A;  3CUQ C;  3VFZ A;  4A3B J;  2HYG D;  1T33 A;  2DA2 A;  1MND A;  2BEO A;  2K9S A;  1TWG J;  1UG0 A;  3L2W A;  1GXP A;  3S15 J;  2AXT C;  4LFU A;  4WCG A;  4XN3 A;  5LRS A;  2ZFW A;  3EPZ A;  3I54 A;  1LDD A;  1HLV A;  1AHD P;  2I8D A;  2EFQ A;  2L02 A;  1QHH D;  2VC0 A;  1XTA A;  5C4X J;  3E6M A;  1RR7 A;  4A0X A;  3SEZ A;  2O6G E;  4HX7 A;  3T1B A;  3PO3 J;  3BG9 A;  2R7R A;  3WU1 B;  2GZW A;  1FIP A;  2KIS A;  3RKW A;  2NVX J;  4LK1 F;  3KYC B;  1W7P A;  4ASN A;  4MHG A;  1WH7 A;  1FP2 A;  3ZN0 A;  3FK7 A;  4J19 A;  4XLE A;  2L4M A;  3ELK A;  2FOK A;  1W36 D;  3J80 K;  2JSP A;  5K7Z A;  4BBR J;  3CLQ A;  5H20 A;  3I4P A;  2X9D A;  2CUF A;  4BE1 A;  4U87 A;  1KON A;  2L7K A;  4YIR X;  3FHZ A;  2JA7 J;  3LST A;  2YU9 J;  3E0J B;  5LGT A;  4I76 A;  1MMA A;  2Y0M A;  3LMM A;  3H9G A;  2V1X A;  2NVQ J;  1R58 A;  4PSX A;  1IV6 A;  2PX9 A;  3ZMZ A;  4MO7 A;  4JBA A;  3COA C;  4L9T A;  2ZKZ A;  3DBH B;  1K83 J;  5D5X B;  1TQI A;  3R0J A;  2XSJ C;  1RZ4 A;  3RYR A;  1QO0 D;  1XCV A;  4RDU A;  2HTS A;  2R5Y A;  3PQK A;  1I3Q J;  3V8J A;  3I59 A;  1R1U A;  2BHY A;  1ON1 A;  5K5R A;  1IUF A;  1I27 A;  1ZG5 A;  4G7Z F;  2DA1 A;  3WTY C;  1HDD C;  2EBI A;  5F6F A;  4FHT A;  2IA0 A;  1TW2 A;  1LNW A;  5IOY A;  2QBY A;  3H35 A;  5J6X A;  5M3F J;  4A12 A;  2LFB A;  3HKZ A;  2CU7 A;  2GLO A;  4OIP F;  4ZH4 F;  3LAJ A;  1Z91 A;  3VYU B;  4L0Y B;  2JZY A;  5ILS A;  3LWF A;  4ETS A;  4FE7 A;  4EV0 A;  3EUH A;  3SZT A;  2BOL A;  2NNY A;  4GYI A;  3MCZ A;  1IN5 A;  2BV6 A;  3FXU A;  1Y56 A;  3KE2 A;  3GVA A;  4HSR A;  3KCC A;  3IWF A;  3MMY B;  2Y48 A;  2OV7 A;  2VKE A;  1I39 A;  3ZQQ A;  2AQF A;  1B72 A;  4I0B A;  5E1Z B;  2M8G X;  2E1M C;  1HW2 A;  2FBK A;  1N77 A;  2Q0O A;  2XB5 A;  1XDU A;  4KNY A;  1W5C C;  3JAM Z;  5E3M A;  3WHC A;  2RNG A;  2JK3 A;  1SFX A;  2V9V A;  3BDD A;  1TBX A;  1BC7 C;  2QA4 I;  3GX4 X;  4PDK A;  3HXL A;  4CCM A;  3IH2 A;  3EYI A;  1FBS A;  1Q1V A;  4XLA A;  1YRN A;  3FXJ A;  2VPL A;  3DPU A;  2DOE A;  2R7T A;  1P4X A;  1T6S A;  1MMS A;  1HKS A;  2DT5 A;  1ZQ3 P;  1PP7 U;  2PJR B;  3HGY A;  3E5X A;  3U9G A;  4J01 A;  4LG0 A;  3BJ6 A;  5TJJ A;  3VYS B;  2V9P A;  3FMS A;  2Q2E A;  3V7R A;  1W1W E;  3E3V A;  4ESB A;  2DT7 B;  3TP0 A;  2XGE A;  1S7E A;  1YIO A;  2ISY A;  2G7U A;  2LNB A;  1PVE A;  3QYE A;  3C7J A;  1FIA A;  1EKE A;  1K4T A;  1RES A;  1FT9 A;  3CJR B;  1R71 A;  2VI6 A;  3G3Z A;  3I58 A;  3WTV C;  2HWV A;  2IP2 A;  5HS8 A;  1T39 A;  2XGD A;  1GLN A;  1MBK A;  2CJJ A;  3OIP A;  4XSX F;  4EGZ A;  3ZQ7 A;  2X1E A;  1Y0N A;  3HUG A;  4LIU A;  5E3N A;  2XGX A;  2DTR A;  2DOD A;  2LRE A;  4UUV A;  1YO5 C;  5K5Q A;  5IYD J;  3KFW X;  4KUM A;  1L0O C;  2EIL H;  3M8E A;  1SC7 A;  5DYM A;  1NK3 P;  2OJE D;  4C30 A;  3KIO A;  4HV5 A;  2K9L A;  2XDV A;  5CVI A;  4XK4 A;  3C2B A;  2HQ5 A;  2EV5 A;  1TWH J;  2KRH A;  4FET A;  1Y0U A;  4ZDP A;  1DUX C;  1X2N A;  1ETQ A;  1LE8 A;  1WWX A;  3OYA A;  5FB2 A;  1R6R A;  2V6C A;  1MH4 A;  3O8H A;  5D6F A;  4HW0 A;  5C44 J;  2CW8 A;  1SD6 A;  4PJN A;  1RC9 A;  1OYI A;  2L4A A;  4I98 B;  3CO7 C;  2G9W A;  3GZ6 A;  1WH5 A;  2LF7 A;  3LL7 A;  3BG5 A;  4AUX A;  3ZMV A;  2P7C B;  1OR7 A;  3HOZ J;  4UUS B;  5HS9 A;  4XRF A;  3BR2 A;  1HXD A;  3KP5 A;  4MFE A;  3S3M A;  4ZC3 A;  3S14 J;  5CVU A;  2OU2 A;  4EVI A;  4ZYD A;  3OS1 A;  3JSO A;  3CDH A;  1SAU A;  3LSR A;  3VDX A;  1QBJ A;  4CCK A;  1SMY F;  2MGQ A;  3GF2 A;  5J47 A;  4I7H A;  2MLK A;  1UHM A;  4NUB A;  4IKF A;  1XDS A;  3E1S A;  4Y15 A;  2AO9 A;  2DT6 A;  5KVR A;  3Q5F A;  1MBE A;  2HPM A;  4DZP A;  2DMN A;  4DW6 A;  2BY3 A;  4KMU X;  3ZXS A;  3ONQ A;  2FD5 A;  5C3E J;  1W4M A;  1A36 A;  1MBG A;  3HOS A;  1I1G A;  1ZLK A;  3C1D A;  1FLI A;  4AU7 A;  4RGX A;  3GLL A;  4UV8 A;  4ABZ A;  2JQ7 A;  2VQG A;  2YU3 A;  5DTD A;  4EM2 A;  4FAS D;  2ZCW A;  3PNT A;  4P55 A;  3VSL A;  3G4S I;  1VZ0 A;  3QPL A;  1R00 A;  1USS A;  5CYV A;  4E7Z A;  3FM5 A;  1WJ5 A;  2DOF A;  2R7Z J;  1MDM A;  3ESW B;  4P5O A;  1OPC A;  3I64 A;  3C2G A;  4I02 A;  2HZT A;  2MYS A;  2VQC A;  4X0G A;  5CVJ A;  1D8J A;  2CUZ A;  2WAQ N;  4RB3 C;  4XM3 A;  3GZ5 A;  1ETX A;  5A2Q K;  1PYV A;  3K4C A;  2DFE A;  2KLO A;  4CCJ A;  4CYD A;  4HNT A;  2DTZ A;  3T8R A;  4OIQ F;  1WJC A;  2E1O A;  5A2Q Z;  1D5Y A;  2KIF A;  2QQ9 A;  1U9N A;  3VYR B;  1NTC A;  1XB4 A;  2EIJ H;  1BR4 A;  1WJD A;  4RA2 A;  3TQN A;  1FNN A;  2VOO A;  2HVR A;  4KIB A;  4BHC A;  5ILU A;  4M74 A;  2DMU A;  4OIN F;  2CO5 A;  4B09 A;  3WG7 H;  3HL2 A;  1P4A A;  1U8R A;  3VSK A;  1WSU A;  2O03 A;  3V7S A;  1XMK A;  1NH3 A;  2Q1Z B;  2R5Z A;  4C3J J;  1T2K A;  3BPV A;  2Q8K A;  2ZME A;  2RVC A;  1WFX A;  1O3T A;  1Y1V J;  1J7K A;  4EJO A;  4UB6 C;  3JTG A;  3VOE A;  1N75 A;  3BCA A;  3IC7 A;  4BYY A;  2QYO A;  1GVJ A;  3DP7 A;  1RKW A;  2DAO A;  4M9X A;  3H0D A;  2M45 A;  3SDB A;  1OCT C;  2LKS A;  5DCM A;  5DM7 F;  1FTZ A;  4DZJ A;  2R7X A;  1T56 A;  2IBD A;  5EDN A;  4BQA A;  3DTK A;  1BR1 A;  2R7W A;  3KP3 A;  3PUB A;  1IJW C;  3KEO A;  3J81 K;  1EH6 A;  2ID3 A;  1FY7 A;  2VB6 A;  4M3G A;  4MNU A;  3J81 Z;  3IH3 A;  3S16 J;  2XAG A;  1F9N A;  4M3E A;  2LF8 A;  2RNJ A;  2ME0 A;  1LFU P;  2LR8 A;  1R5I D;  1ERD A;  2HXO A;  2L7F P;  2A07 F;  2PMU A;  1A04 A;  4F7Z A;  4MEY F;  3BTC A;  1R23 A;  1STZ A;  2Y0S N;  3CCM I;  2X4H A;  1WJE A;  2PMH A;  1A6Q A;  1B9M A;  4GDF A;  1UJ8 A;  1J09 A;  3IAM 2;  4A3M J;  2O5R A;  2WWY A;  1ZG3 A;  4RLQ A;  4BDY A;  2IS6 A;  4YG2 F;  3HPG A;  1H9G A;  5L3G A;  1Y39 A;  1VND A;  1N78 A;  1WRJ A;  3S2H J;  2L0K A;  1U5T A;  4ZYG A;  5L3C A;  2M8E A;  3CCV I;  2R7F A;  4D7M A;  2JJ7 A;  1TQP A;  3I55 I;  1IRG A;  4PGG A;  3RCO A;  3BOQ A;  2XGC A;  3BR5 A;  3CJT B;  5D4R A;  3CTA A;  1ENH A;  3U21 A;  1V5F A;  4HX4 A;  3ASN H;  4LD5 A;  5GP9 A;  4L5I A;  3E97 A;  2D5V A;  2ZXI A;  2BYV E;  2BY2 A;  2NVT J;  3ULQ B;  2LC2 A;  3IP4 B;  1B6A A;  2WAQ A;  4PJ0 C;  2QKL B;  1HOM A;  5FFZ A;  1CF7 A;  3I4M J;  3TBI A;  1ZHF A;  4EMS A;  1D1C A;  2QF7 A;  1W7P B;  2FNA A;  5E18 F;  2HDC A;  3BTJ A;  3CUO A;  1OLT A;  2F5F A;  2KP6 A;  2UV1 A;  1DP3 A;  4E7K A;  2LRD A;  5GTI C;  2F4I A;  2JUG A;  3RZO J;  3JRI A;  2B0L A;  2HQR A;  2QEX I;  2EFN A;  5GAH J;  3GTL J;  2ADU A;  1XGO A;  1FYL A;  4JP0 A;  3Q9V A;  4N0B A;  3B73 A;  2CUJ A;  2IGO A;  5IY5 H;  2YUS A;  1BW6 A;  1A5J A;  3GME A;  4IRI A;  3J7A O;  3GTQ J;  4R1H A;  2BGC A;  1JUP A;  3MKZ A;  4LK0 F;  2JT1 A;  3REO A;  4DGW B;  4M6Y A;  3ZQC A;  1FBQ A;  4Z6Y A;  4AC0 A;  3CP8 A;  1E3O C;  4IQ4 A;  4A5N A;  3GXO A;  2VN2 A;  4I99 C;  1UST A;  1LDK B;  4B1R A;  5CQG A;  1VQM I;  2CSO A;  2R5Y B;  1TTY A;  3UR3 C;  3OL3 A;  3OR1 C;  1MMN A;  2WAD A;  3I59 B;  3BZ6 A;  1X1D A;  4JX5 A;  3KZZ A;  2KZV A;  4B43 A;  5J1R A;  3K4J A;  1Z67 A;  4HYE A;  4IHS A;  5F04 A;  1TP4 A;  2XB0 X;  3ZMT A;  3HPH A;  2EFW A;  4I0A A;  2QBY B;  1QZY A;  1G3Y A;  2M87 A;  2DMT A;  1FSE A;  2AQE A;  3QYB A;  5E3L A;  2V1N A;  1IRX A;  1XMA A;  4G9Y A;  2VBZ A;  3ZR8 X;  3H1C A;  2JMW A;  5AIP A;  1FTT A;  4HX8 A;  2XKP A;  4Y7N J;  1FOK A;  4A3G J;  4Y33 A;  5LGU A;  3S3N A;  3ZMS A;  2R7D A;  4BJT A;  2FOW A;  3D5L A;  2COB A;  5IT3 A;  4H0E A;  4CIC A;  5GAG J;  5FKN A;  2QSG X;  4CGZ A;  2RN7 A;  1XSX A;  4I09 A;  1LVK A;  2DYR H;  5D4S A;  5FLX K;  1UFM A;  2W1O A;  2VIX A;  4HF0 A;  2E7X A;  5DEQ A;  2ZO4 A;  1B72 B;  5FLX Z;  3O6B B;  3GTJ J;  2HGC A;  3LNQ A;  5D6E A;  1J2X A;  1X2M A;  2OD5 A;  4UHT A;  1I1S A;  3IH4 A;  3FF5 A;  3FIW A;  2K4J A;  5FRO A;  5HLH A;  1RI7 A;  2H8R A;  4WK8 F;  1O57 A;  5EEH A;  2HOE A;  4F92 B;  1R36 A;  1VQ6 I;  4RM3 A;  1YRN B;  2FMY A;  3EYY A;  4BNC A;  2DA3 A;  4AM3 A;  4U7D A;  2NOJ B;  4NHJ A;  1EA3 A;  3V4G A;  2CV2 A;  4G6Q A;  3DWL E;  3TW6 A;  1QA6 A;  3S2W A;  2K9Q A;  4P1W A;  4JK1 X;  1PUF A;  1BOB A;  4ZDL A;  3LAP A;  4F91 B;  3L00 A;  4LG0 B;  1YW8 A;  2Q2E B;  4L0Z B;  1D0Y A;  3DQV C;  3GEZ A;  3RYP A;  4P9F A;  2K86 A;  3LFK A;  4UUT A;  2K85 A;  2IGM A;  2Y9Y A;  2VKV A;  2PI0 A;  5ED4 A;  3D1N I;  3ERE D;  4KA4 A;  4CYC A;  3F8B A;  3GO5 A;  2GXB A;  4PCQ A;  2GAU A;  1T0F C;  1FMV A;  1CGP A;  1JUS A;  2M5W A;  3T5X A;  5E1W A;  2Y31 A;  3HM5 A;  2DW4 A;  3HUG B;  5FD5 A;  2GM4 A;  3W6K B;  3DKX A;  2VT2 A;  3KZI C;  4XR6 A;  1FMW A;  3M9A A;  3L2U A;  3BTL A;  2ZJQ F;  3DU6 A;  1D5V A;  3ZP5 A;  3R61 A;  5JVT A;  5F0F A;  4ZZL A;  3P9K A;  4AD9 A;  3A0H C;  2VBY A;  2M3A A;  1MBJ A;  3AL0 B;  3F9K A;  2BBY A;  2Y75 A;  2E1N A;  3AKZ A;  2Y9Z A;  3LSI A;  3PSI A;  4EJU A;  3T0Y A;  4HZF A;  1LFP A;  3OYD A;  2F5D A;  3U1K A;  2NS7 A;  4RGS A;  1A31 A;  3HKZ N;  5BOX A;  1I6H J;  1S7A A;  2ZC2 A;  1LE8 B;  4G7O F;  1X1B A;  5LRR A;  3DFG A;  1ZEL A;  1R1V A;  2HQA A;  2RC4 A;  3GFM A;  3OMY A;  1B59 A;  4OMY A;  5EGO A;  3A02 A;  1U3E M;  5HDG A;  4GRI A;  5LEJ A;  3GTP J;  1BL0 A;  4C3H J;  5LBQ A;  6PAX A;  1B8I A;  4BY1 J;  2L2O A;  3IAS 2;  1BI0 A;  4CA0 A;  2CS3 A;  5CVR A;  4DQ2 A;  1G2H A;  4UVB A;  2ACJ A;  2JN6 A;  2VBW A;  2HVQ A;  3W2A A;  4FQG A;  5AON A;  5JR3 A;  1HDP A;  3L2Q A;  2DDB A;  1BJA A;  1Z3Y A;  3LA7 A;  2Z33 A;  3BR1 A;  3TP3 A;  2MA3 A;  1UG2 A;  2M0M A;  3AG1 H;  5LEK A;  2ETH A;  2O0Y A;  2XKO A;  5CQE A;  1CQT A;  4IF4 A;  3LA3 A;  3SFZ A;  3ZQF A;  4BJ6 C;  4D5F A;  1MGT A;  3TDZ C;  3EUH C;  3PSF A;  1APL C;  1K6Y A;  4HBL A;  2EV0 A;  3SHF A;  2HDW A;  3SZP A;  3E6C C;  2DA6 A;  3RZD J;  1UZC A;  1TQM A;  4NC8 A;  1IRZ A;  3EDP A;  4UVA A;  2Z1D A;  1YS7 A;  2E2H J;  2E36 A;  1C0W A;  2NOG A;  3H5A A;  1P4W A;  1TNT A;  4PJJ A;  2NVY J;  3MQ0 A;  1X1A A;  4ANJ A;  2KZG A;  2V79 A;  5J8F A;  4Y13 A;  4G6D A;  2E35 A;  2KPM A;  3M07 A;  1Z05 A;  5ICF A;  3KLN A;  4FX0 A;  1FC3 A;  1TLH B;  1MDM B;  2D1H A;  3GFJ A;  3RJP A;  4C3I J;  4M3B A;  4LB5 A;  1ZH5 A;  1MJA A;  3Q0W A;  2NS8 A;  3Q0V A;  1NHA A;  3A03 A;  3OYL A;  2OAZ A;  4Y17 A;  4IPA A;  2FNP A;  2UWM A;  2FU4 A;  2MC3 A;  3P9C A;  4HF2 A;  3VPR A;  3J7Y J;  4DBR A;  1S5L C;  2V7F A;  1WCM J;  3BPX A;  3SEQ A;  3OYC A;  3VEP A;  1IN7 A;  3BR6 A;  5D8L B;  1SD5 A;  2WV1 A;  2DPD A;  2EIN H;  3OYF A;  4RAZ A;  2R5Z B;  5H6Q A;  2ZB9 A;  5JFR A;  2W24 A;  2ZME B;  3E7L A;  2E19 A;  1KU2 A;  2CW0 F;  4B3A A;  1RUN A;  5D8K B;  1SVL A;  4ZJZ A;  3PQJ A;  2VUM J;  1XGN A;  1JKO C;  1ZGW A;  2EA2 A;  1S3J A;  2DMQ A;  4D1Q A;  4IL6 C;  2V4J C;  1E0E A;  2HQN A;  2WAE A;  4BE2 A;  5DCM B;  3M8J A;  1IV8 A;  1FJL A;  1FYK A;  2ECC A;  3JTH A;  4DJA A;  4AVP A;  1OCP A;  2JVH A;  3QPS A;  1U2W A;  3X2Q H;  3CJQ B;  2XSD C;  1T38 A;  1SAN A;  2E60 A;  1VQO I;  1U9O A;  4U88 A;  3CUQ A;  1U6G A;  2LSO A;  1O3S A;  2JA6 J;  3FX3 A;  2DBB A;  3JAM K;  2KKO A;  2XF7 A;  3NEU A;  2PJP A;  3D0S A;  3VOD A;  4JX4 A;  1WKM A;  4QLC U;  2Y69 H;  4II3 A;  4XID A;  3QRF F;  4UVC A;  3GFI A;  2L3D A;  3OSF A;  2GWR A;  4EJV A;  4CCL A;  2JRT A;  4AWX B;  1UCR A;  1XN7 A;  2XUB A;  4M72 A;  4NC6 A;  1YIJ I;  1J5Y A;  4EM1 A;  2K9M A;  2G7H A;  3ABU A;  4FX4 A;  3I71 A;  5HOD A;  2NVU B;  3PO2 J;  2DJN A;  1OYY A;  1QVU A;  5D5V B;  3GUD A;  1U5T B;  3CCS I;  2LTP A;  3PNV A;  4IX7 A;  1BI2 A;  5DD4 A;  3GTK J;  3R6S A;  4LLG F;  4XON A;  3PL8 A;  3MKL A;  3K7A J;  2XAH A;  5B1B H;  4OAY A;  2VKH A;  1J9I A;  4ZYH A;  1IZ1 A;  2M9H A;  1MNM C;  2A61 A;  3I0T A;  5HVQ C;  3ROU A;  1MZB A;  1U0J A;  4EJT A;  4UV9 A;  3PFY A;  4JOM A;  3DTI A;  2QCO A;  3KEY A;  4IEJ A;  3HGG A;  3IRR A;  1CF7 B;  1PP8 F;  2R7O A;  1IN6 A;  3NRV A;  2A05 A;  3LSH A;  2LMD A;  3IWZ A;  3T8T A;  5J3L A;  4A3E J;  3S2D J;  4A3D J;  1G4D A;  5EF6 A;  1FSH A;  2XVC A;  3D5S C;  1KZH A;  3W6J B;  3SFI A;  3F8M A;  1P9Q C;  4A3J J;  3I53 A;  2NS0 A;  2M4K A;  1EV7 A;  3TW7 A;  4BS9 A;  3HDD A;  4OMZ A;  4PFO A;  2FBH A;  2ZJR F;  2NRA C;  3ZOB A;  4PJM A;  3MD2 A;  5BPD A;  3EET A;  5J8C A;  3HOW J;  3QOP A;  3WTZ A;  4KIT B;  1KGS A;  2EZL A;  4C9Y A;  5BMZ A;  3CC4 I;  3P9I A;  1KU9 A;  3HEF A;  5J4Y A;  2ID6 A;  4RBO A;  1D0X A;  1G3S A;  2J5P A;  1EH7 A;  4BKX A;  1BM9 A;  1QPM A;  3F6V A;  3KZY A;  3ZMD A;  2BY1 A;  2LP0 A;  2OUM A;  3M7G A;  2A69 F;  1WI9 A;  1HC8 A;  3HTU A;  1QVT A;  3QYF A;  2STT A;  3IUO A;  4K2E A;  4MIM A;  4I2O A;  3DKW A;  3K9T A;  1R49 A;  3FM3 A;  1K78 A;  2ZXW H;  3M1E A;  3K4M A;  1ZRC A;  5FRN A;  3CCQ I;  1SVM A;  2K9N A;  2JA8 J;  3G2B A;  3GCM A;  3TKY A;  4L18 B;  3FXM A;  3Q3S A;  4CCO A;  3JRD A;  3L2R A;  4M9S A;  3WE2 A;  2Z9O A;  1Y8Q B;  2KHM A;  3HOU J;  1EH8 A;  2DA7 A;  4RAF A;  2CQQ A;  3BJO A;  4XLN F;  3QU6 A;  1H0M A;  4KIC A;  3JRE A;  1K79 A;  3DV8 A;  3W2W A;  1F36 A;  2E2I J;  1ZG1 A;  4HNU A;  2LD5 A;  5ICE A;  5GAE J;  2W7N A;  4II2 A;  4HQE A;  2DPU A;  3HSE A;  4ZZD A;  2CH0 A;  2VQH A;  5IP7 J;  5D5U B;  5L3E A;  3LA2 A;  1O3R A;  4HDU A;  2GBY A;  2JVG A;  5L3D A;  2M30 A;  3RPQ A;  4WF2 A;  2VXZ A;  1POG A;  4DIQ A;  5KAI C;  2B7E A;  2ELJ A;  4HA8 A;  5LD2 C;  1P92 A;  5FRM A;  2FA5 A;  1OMI A;  4A3C J;  3KET A;  4BAY A;  1QHG A;  3ABK H;  3LOC A;  3MWM A;  4S0H B;  3FXL A;  3K10 A;  2KIM A;  3CC2 I;  3H36 A;  2FML A;  2BE5 F;  2K7L A;  4X1E A;  1OJL A;  1W5S A;  2ESN A;  3H9Q A;  4AIK A;  1I6X A;  4KIF A;  1PUF B;  4ZTF A;  2IJL A;  4GFB A;  1F43 A;  1Z9C A;  1K6O A;  2DCE A;  1W0T A;  4XRS G;  3JRC A;  1P6R A;  2H09 A;  3DPL C;  4RGR A;  2HXI A;  5EEG A;  2PQ8 A;  3PUF A;  1AKH A;  1ZKG A;  2PBI A;  1HBX G;  3JRA A;  3BG3 A;  4EAT A;  1OCZ H;  5IYB J;  3BZC A;  4IRH A;  1UEL B;  2LK2 A;  3NQO A;  1K7A A;  4BXX J;  4O6J A;  2F2E A;  4M6X A;  5HLI A;  5IP6 A;  4CYC B;  4WXC A;  1QZE A;  2P4W A;  3G73 A;  4D0P A;  4XLP F;  4HQM A;  4CDG A;  4MTD A;  3RQ4 A;  3UNG C;  5FKM A;  1YJW I;  2H8W A;  4PK4 A;  2NYX A;  2JRM A;  1OYW A;  2IW5 A;  2OQG A;  5CKT A;  3G1M A;  1IGN A;  1V5G A;  3JRB A;  2H6B A;  4IJA A;  4Y4R A;  3F21 A;  2WY7 Q;  2LDU A;  3F8F A;  3CF5 F;  2W00 A;  3TMO A;  4IXA A;  3E5U A;  1S7O A;  1VFC A;  2P5V A;  1VQL I;  2M0C A;  1X1P A;  3K4K A;  1JI8 A;  2CFO A;  4LGW A;  3LQR A;  2VQL A;  2LKX A;  1BJZ A;  1YLF A;  3OV8 A;  4GXO A;  4ON0 A;  2W4S A;  1E17 A;  3QOE A;  5KCM A;  2VJ5 A;  3JRF A;  3H5N A;  4OOI A;  3NWT A;  1MKM A;  3GTG J;  3OL4 A;  2HKX A;  2GQQ A;  3CJN A;  4RB2 C;  3CES A;  1YX5 A;  3RIR A;  1DPU A;  1IXR C;  4IRG A;  3RKX A;  1EF4 A;  3U2R A;  5EGO B;  1QPI A;  3WTU C;  2CV0 A;  4NNJ A;  1E3H A;  4B44 A;  2A68 F;  1DQU A;  2HI3 A;  2WTE A;  4LB6 B;  1B8I B;  1PUE E;  1W5T A;  3K0L A;  1IN8 A;  3OR2 C;  2DLL A;  5B3S H;  2CUE A;  5DCF A;  4HNV A;  3E5Q A;  1K61 A;  1TWA J;  2XAJ A;  2XRN A;  3K1P A;  1UHS A;  4HOB A;  5ERI A;  3FKI J;  4Q5S F;  3BTI A;  4RS8 A;  5HS7 A;  1FX7 A;  4CH7 A;  1VQ4 I;  2V6E A;  1O7L A;  2JTV A;  2QM3 A;  3OWT A;  1UAA A;  1FZP B;  4O3M A;  2OTJ I;  4A0Y A;  5EG0 A;  4LOC A;  4I6Z A;  1WZ2 A;  3A01 A;  1RET A;  1PJR A;  4U0W A;  2TCT A;  3MFK A;  1XS9 A;  2K5C A;  4Y3O A;  3S93 A;  1W36 C;  2QZ8 A;  3PIP F;  2WB1 N;  3ECH A;  4XN0 A;  1LVA A;  2XPU A;  1KQ9 A;  2KJB A;  2VJI A;  2RQQ A;  2A5Y B;  1YYV A;  2JA2 A;  2DQR A;  3KYL A;  3WE3 A;  4D7N A;  2A5W A;  4HG2 A;  1IN4 A;  2KQR A;  3FXK A;  2VON A;  2F6C A;  2CQX A;  4FTH A;  2DYS H;  1Z6R A;  2F48 A;  2O7O A;  3I4N J;  3ZGK A;  1X3W B;  2KRC A;  2JPB A;  4MQ9 F;  1IRF A;  2RDP A;  4OWR B;  4XL9 A;  1GDT A;  4BY7 J;  4M3D A;  4TV7 A;  2TDX A;  2QQA A;  4RB1 A;  5LHH A;  2W84 A;  2WBM A;  3W2V A;  1V3F A;  2M34 A;  2L54 A;  4UNO A;  3WOD F;  2O61 A;  1LUJ B;  3QP5 A;  4E4H A;  1FWZ A;  4C2T A;  2HOT A;  3CC7 I;  2CQN A;  4S05 A;  5M5X J;  3L9F A;  2DDA A;  4KT6 A;  1ZN2 A;  1IDY A;  4A6E A;  2HU9 A;  1SMT A;  3BG7 A;  2VC1 A;  1QZZ A;  3F3X A;  2PMZ A;  3WTS C;  2Z5U A;  1ZLJ A;  1GVD A;  2LYC A;  3ML6 A;  3F8N A;  3H3V K;  2MAB A;  5HLT A;  3LSP A;  1SFE A;  2DMP A;  2L9V A;  4DOZ A;  1SD7 A;  3BQY A;  2X1C A;  3H0G J;  3C2H A;  5DM6 F;  2R92 J;  4QPQ A;  1ETO A;  2ECB A;  4ESJ A;  3BCB A;  4HST A;  1JGS A;  4XRM A;  3OY9 A;  1JXS A;  4N4O B;  1S72 I;  5F08 A;  4G7H F;  4L5E A;  1WGX A;  3DBL B;  2WAF A;  3FXO A;  4HF1 A;  3O3K A;  3FWE A;  1X19 A;  2L01 A;  3ZQI A;  3R60 A;  2EFP A;  4AVZ A;  1GHC A;  4IQJ A;  3AG4 H;  2ZFU A;  4ENK A;  1X58 A;  1KU7 A;  3ZPL A;  3E6B A;  3S32 A;  2BZT A;  3WGH A;  3HRT A;  4E7H A;  2IS1 A;  2YPR A;  4F55 A;  3CZ6 A;  3RTR A;  3CCY A;  2D2W A;  2LG4 A;  4UB8 C;  1TL8 A;  5F0C A;  4Q4Z F;  2QSF X;  3BR0 A;  4M3F A;  1ODD A;  4GYG A;  3SQN A;  3OOP A;  3TL4 X;  9ANT A;  1D3Y A;  1YOV B;  3FXQ A;  2HTJ A;  1G6N A;  2MBF A;  2FUG 2;  5IT9 Z;  1YIT I;  4DBQ A;  1ZGJ A;  4BL0 B;  5M3M J;  1ON2 A;  3CMY A;  2WB1 A;  4F52 A;  2A6T A;  1A6I A;  4B47 A;  1KYZ A;  2R7S A;  3HYI A;  4M9Z A;  5E79 C;  1YS6 A;  4KYW A;  2ZNY A;  4XKC A;  2JSC A;  4IHY A;  2XHK A;  1R7J A;  2WV0 A;  1HQC A;  2XF6 A;  1JT6 A;  1ZR4 A;  4A3I J;  2PLY A;  2F5E A;  2H1L A;  1ETK A;  2W82 A;  1V5E A;  3DXJ F;  4BAC A;  2O8X A;  3CP2 A;  1JHH A;  3RPU D;  2RRE A;  2V1D A;  2DK5 A;  1OCR H;  2YS9 A;  2L5Q A;  4HAM A;  2FQ4 A;  2IPQ X;  4BXU A;  5EYR A;  2IA2 A;  2FF4 A;  3RKQ A;  2GIV A;  4ZYE A;  3M4O J;  5TIS C;  2VXD A;  3CMM A;  3HHH A;  4BU2 A;  1Z3X A;  5GPA A;  2QWW A;  3K4N A;  2FEZ A;  4E7L A;  2HVS A;  1D1B A;  4KT5 C;  5CLS A;  4HLY A;  1GV5 A;  3LSG A;  5ICG A;  4YEL A;  3ZQG A;  3K2Z A;  2VLA A;  3BQZ A;  1J75 A;  3EUA A;  3QWL A;  1LEA A;  2JPC A;  1FOX A;  4KIS A;  4HEA 2;  2NNN A;  1Z1D A;  3CCL I;  1GUU A;  1UMQ A;  4CO8 A;  2L7M P;  5H6R A;  4ZYA A;  2DXI A;  2CQ7 A;  2OF7 A;  2PG4 A;  2EB7 A;  2LVS A;  3GLX A;  5ILV A;  3G71 I;  4YFN F;  4AYB A;  2R4G A;  4LLN A;  2H1K A;  4KFC A;  4E7J A;  1O3Q A;  4HPQ A;  3KYD B;  2O8K A;  1HKQ A;  1LB2 A;  1J59 A;  3A2K A;  3OYB A;  3K4L A;  2OC6 A;  2EV6 A;  3PNY A;  4AIH A;  4YIF A;  5FD6 A;  3DLL F;  4M6V A; 
#chains in the Genus database with same CATH homology
 3ZN1 A;  2AXL A;  2FSW A;  1H9T A;  2X0L A;  3B02 A;  1K78 B;  2FRH A;  5L3B A;  1ZAR A;  1KA8 A;  2P6S A;  3F6O A;  4GGG A;  4WXH A;  5E17 F;  4ENM A;  2MH9 A;  3ABT A;  2HEO A;  2KRF A;  3PFI A;  1HW5 A;  2UZK A;  3GYH X;  3HOT A;  3WTT C;  1ZGA A;  2FQ3 A;  3AAF A;  3L7W A;  5FFX A;  5BS6 A;  1F1Z A;  2PEX A;  1Q1H A;  2MD5 A;  3KP4 A;  2XAQ A;  1T0F A;  1XD7 A;  3V8L A;  3H3U A;  3RKY A;  4BH9 A;  4L9N A;  1BIA A;  4KDP A;  1YQA A;  4ENJ A;  1SD4 A;  5HOO A;  1YW9 A;  3J80 Z;  3KP7 A;  1MD0 A;  4KIG A;  4P9U A;  1RIO H;  2GA2 A;  4EM0 B;  1R5G A;  4MQV A;  1QNT A;  4CXF A;  4U0V A;  2MLG A;  4KN7 X;  3HHG A;  3GFL A;  2DK8 A;  3HSF A;  2P6T A;  1LEB A;  3LQQ A;  1LJ9 A;  2W25 A;  3EQL F;  1Z6T A;  4I01 A;  5K5O A;  4NQW A;  4E70 A;  4BHP A;  2KIU A;  2AS5 F;  4A0Z A;  3L09 A;  4RGU A;  5E20 A;  1XSV A;  1B1B A;  3ZMU A;  1U78 A;  4HV6 A;  2Z99 A;  4LJZ F;  4PZJ A;  3MAJ A;  4AIJ A;  1GXQ A;  2ZBK A;  3FMR A;  1YFH A;  3MZH A;  2YX4 A;  4LMY A;  2A6H F;  1AOY A;  2KJC A;  3L2C A;  2ZXJ A;  4GCV A;  3KP2 A;  5L3F A;  1XGS A;  2DQL A;  2OZU A;  3BJA A;  2EK5 A;  3HRS A;  4M73 A;  4WX9 A;  3BY6 A;  1REP C;  4U7B A;  2D45 A;  4RAY A;  1ULY A;  3P7N A;  1J0R A;  2GA1 A;  3M8F A;  2RQP A;  4N9H A;  1IXC A;  1DPR A;  5F64 A;  4NB5 A;  5DDG A;  3F8C A;  5BPI A;  3HTS B;  3IHU A;  1KQ8 A;  1BI1 A;  3IKT A;  1WQ2 A;  3BWG A;  2P5K A;  2YSR A;  4U0Y A;  2COM A;  2IRF G;  1KYW A;  2P5L C;  3Q9S A;  2OA4 A;  2IA1 A;  2E1C A;  4Z2Y A;  2EA4 A;  1W7P D;  1OKR A;  2FBI A;  2W85 A;  3WTX C;  1SAX A;  3I5U A;  2GXG A;  3HSR A;  5DD8 A;  4XSZ F;  1XGM A;  3E6D A;  3MEX A;  1TW3 A;  1F5T A;  5FO5 A;  4OIR F;  5ICC A;  4LLL A;  2QQB A;  1IUY A;  2CWE A;  2E7W A;  3TDU C;  2VE9 A;  1JHF A;  4A6D A;  2VT3 A;  2A6E F;  1B9N A;  4CHU A;  1BIB A;  2HR3 A;  3TO7 A;  2WC2 A;  4GO1 A;  1HST A;  3R4K A;  1MJB A;  2RV8 A;  4L9J A;  4OU0 A;  5CJ9 A;  1BI3 A;  3HRU A;  3WGG A;  1FP1 D;  3K1M A;  2CG4 A;  2MH2 A;  3H3Z A;  1U5T C;  4YFK F;  3DEU A;  2VOP A;  3DF8 A;  1O7F A;  1KQ0 A;  3K1N A;  1IXS B;  1VTN C;  4KMF A;  4XBF A;  4EQQ A;  2XAF A;  2EWN A;  2EJR A;  1RNL A;  3QP6 A;  2CFX A;  1QQI A;  4P96 A;  5E8G A;  4KN4 X;  5AIQ A;  1YTY A;  1UHW A;  1D8K A;  3IRQ A;  1DP7 P;  4HDV A;  3CO6 C;  1BOA A;  1S8N A;  4YFX F;  3WG9 A;  1L3L A;  1F4K A;  2CYY A;  3KP6 A;  2DFI A;  3U1D A;  1PDN C;  4OIO F;  3QPH A;  4HLX A;  3FZV A;  4UXN A;  5K1Y A;  1YW7 A;  4FT8 A;  5DUK A;  1Z7U A;  1ZRF A;  1MJ9 A;  3TGN A;  2LKP A;  2V1U A;  2C6Y A;  3RPU A;  2FE3 A;  2UXX A;  2Z3Y A;  3R0A A;  5JHU A;  4N9I A;  1HKT A;  4M71 A;  5TRD A;  4O5V A;  2PN6 A;  2XIG A;  3N97 A;  2F5C A;  4PGH A;  3FMQ A;  1UB9 A;  3QPT A;  1RUO A;  4A5M A;  2K02 A;  4Q48 A;  3C3W A;  4YII A;  2CQK A;  5DUI A;  4EGY A;  2K4B A;  2K27 A;  4MGR A;  4B8X A;  2A3S A;  1BBY A;  3IL2 A;  1R22 A;  1P2F A;  2UXN A;  3DPT A;  1E2X A;  5KK1 A;  3QAH A;  4IHT A;  2HKO A;  1HSJ A;  2EFO A;  2M1B A;  3N4M A;  2ELH A;  1G3T A;  3WU0 A;  3SXY A;  3WGI A;  1ONV A;  2HFH A;  3TOB A;  2FXA A;  4Q47 A;  3MZY A;  1I5Z A;  4EJW A;  1FYM A;  3TO9 A;  1S29 A;  2YX7 A;  3FXR A;  4WXD A;  2W57 A;  3BP8 A;  2H27 A;  2OZ6 A;  3IKV A;  5E8I A;  2OBP A;  1FPQ A;  5FGM A;  1BN5 A;  4G94 A;  2VE8 A;  1BC8 C;  3JSP A;  4IVN A;  3KEQ A;  1LDJ A;  4L5J A;  3CUQ B;  5HLG A;  1AWC A;  2YR2 A;  1T98 A;  5LGN A;  2RKH A;  4WWC A;  5IT9 K;  4JQF A;  1R5H A;  4G8X A;  1IAW A;  3O2P E;  1ZAO A;  1R1T A;  1G3W A;  3CLO A;  3ECO A;  1JE8 A;  2VOD A;  2RGV A;  1LQ1 A;  1IW7 F;  1YG2 A;  3KLO A;  2HYF A;  5LHI A;  3RI4 A;  2DI3 A;  5HDK A;  5DV5 A;  1XCB A;  3ISP A;  2QLZ A;  4MEX F;  2DO7 A;  5CVV A;  3V7C A;  1XSD A;  2R3S A;  2QEN A;  3H92 A;  1IF1 A;  2XRO A;  3RDI A;  2ISZ A;  2XV4 S;  2H6C A;  1TNS A;  2ESH A;  5F1R A;  1ZRD A;  2ZJ2 A;  5LHG A;  5BQT A;  2CGP A;  3GW2 A;  1S6L A;  3QU3 A;  4BHB A;  1B4A A;  2NAZ A;  2IT0 A;  1KU3 A;  3F72 A;  5D5W B;  3K69 A;  2QUF A;  2OQR A;  2IVM A;  3F22 A;  4ENN A;  2XAS A;  4A2U A;  1ZYR F;  3VB2 A;  1ZRE A;  1X3U A;  4R8H A;  2DU9 A;  2O3F A;  3JW4 A;  3HIF A;  3WTW C;  2VBX A;  3TOA A;  2P8T A;  2D1V A;  4RB0 A;  3BRO A;  1HW1 A;  1DDN A;  4CZZ A;  4QWQ A;  2HS5 A;  1QGP A;  3F23 A;  4DNC A;  3C18 A;  4MTE A;  2ZNZ A;  2P7V B;  4ESF A;  3TO6 A;  2J5O A;  5LLQ A;  1V4R A;  2QVO A;  5JI6 A;  4S04 A;  2STW A;  4L9V A;  2H94 A;  3GWZ A;  4R79 A;  2PFB A;  1FBU A;  3HRM A;  3V8K A;  1SFU A;  5E1X A;  5HDN A;  3CUQ C;  3VFZ A;  2HYG D;  2BEO A;  1GXP A;  4LFU A;  4WCG A;  5LRS A;  2ZFW A;  3I54 A;  1LDD A;  2EFQ A;  2L02 A;  2VC0 A;  3E6M A;  4A0X A;  2O6G E;  4HX7 A;  3T1B A;  3WU1 B;  2GZW A;  3RKW A;  4LK1 F;  1W7P A;  4ASN A;  4MHG A;  1FP2 A;  3ZN0 A;  2L4M A;  3ELK A;  2FOK A;  3J80 K;  5H20 A;  3I4P A;  3FHZ A;  3LST A;  5LGT A;  2Y0M A;  2V1X A;  1R58 A;  3ZMZ A;  4JBA A;  3COA C;  4L9T A;  2ZKZ A;  5D5X B;  1TQI A;  3R0J A;  1RZ4 A;  3RYR A;  1QO0 D;  1XCV A;  2HTS A;  3PQK A;  3V8J A;  3I59 A;  1R1U A;  1ON1 A;  5K5R A;  1I27 A;  1ZG5 A;  4G7Z F;  3WTY C;  5F6F A;  4FHT A;  2IA0 A;  1TW2 A;  1LNW A;  2QBY A;  5J6X A;  4A12 A;  4OIP F;  4ZH4 F;  3LAJ A;  1Z91 A;  4L0Y B;  2JZY A;  5ILS A;  3LWF A;  4ETS A;  4EV0 A;  3EUH A;  3SZT A;  2NNY A;  4GYI A;  3MCZ A;  1IN5 A;  2BV6 A;  3FXU A;  3KE2 A;  3GVA A;  3KCC A;  3IWF A;  2Y48 A;  4I0B A;  5E1Z B;  1HW2 A;  2FBK A;  2Q0O A;  1XDU A;  4KNY A;  3JAM Z;  1SFX A;  2V9V A;  3BDD A;  1TBX A;  1BC7 C;  3GX4 X;  4PDK A;  3EYI A;  1FBS A;  1P4X A;  1T6S A;  1HKS A;  2DT5 A;  1PP7 U;  3E5X A;  3U9G A;  4LG0 A;  3BJ6 A;  5TJJ A;  3FMS A;  2Q2E A;  3V7R A;  3E3V A;  4ESB A;  1YIO A;  2ISY A;  2G7U A;  2LNB A;  3C7J A;  1FT9 A;  3G3Z A;  3I58 A;  3WTV C;  2HWV A;  2IP2 A;  5HS8 A;  1T39 A;  4XSX F;  4EGZ A;  3ZQ7 A;  3HUG A;  2XGX A;  2DTR A;  4UUV A;  1YO5 C;  5K5Q A;  3KFW X;  4KUM A;  1L0O C;  3M8E A;  5DYM A;  4HV5 A;  5CVI A;  2EV5 A;  1Y0U A;  1DUX C;  1WWX A;  5FB2 A;  2V6C A;  5D6F A;  4HW0 A;  1SD6 A;  1OYI A;  2L4A A;  4I98 B;  3CO7 C;  2G9W A;  3GZ6 A;  2LF7 A;  3ZMV A;  2P7C B;  1OR7 A;  5HS9 A;  4XRF A;  1HXD A;  3KP5 A;  5CVU A;  2OU2 A;  4EVI A;  4ZYD A;  3JSO A;  3CDH A;  1QBJ A;  1SMY F;  3GF2 A;  4I7H A;  2MLK A;  1UHM A;  1XDS A;  4Y15 A;  5KVR A;  3Q5F A;  4KMU X;  1W4M A;  3HOS A;  1I1G A;  1ZLK A;  3C1D A;  1FLI A;  4RGX A;  4UV8 A;  2YU3 A;  4EM2 A;  2ZCW A;  4P55 A;  1R00 A;  1USS A;  5CYV A;  3FM5 A;  1MDM A;  4P5O A;  3I64 A;  1OPC A;  4I02 A;  2HZT A;  1D8J A;  5CVJ A;  4RB3 C;  3GZ5 A;  5A2Q K;  4CYD A;  4OIQ F;  3T8R A;  5A2Q Z;  2KIF A;  2QQ9 A;  1XB4 A;  3TQN A;  1FNN A;  2VOO A;  4KIB A;  4BHC A;  5ILU A;  4M74 A;  4OIN F;  4B09 A;  2CO5 A;  1U8R A;  1P4A A;  1WSU A;  2O03 A;  3V7S A;  1XMK A;  1T2K A;  3BPV A;  2Q8K A;  2ZME A;  2RVC A;  1O3T A;  1J7K A;  4EJO A;  3JTG A;  3VOE A;  3IC7 A;  4BYY A;  2QYO A;  1GVJ A;  3DP7 A;  2DAO A;  4M9X A;  2M45 A;  5DCM A;  4BQA A;  3KP3 A;  3KEO A;  3J81 K;  1EH6 A;  1FY7 A;  4MNU A;  3J81 Z;  2XAG A;  1F9N A;  2LF8 A;  2RNJ A;  2A07 F;  2PMU A;  1A04 A;  4F7Z A;  4MEY F;  1R23 A;  1STZ A;  2X4H A;  2PMH A;  1B9M A;  2WWY A;  1ZG3 A;  4YG2 F;  5L3G A;  1H9G A;  1WRJ A;  1U5T A;  4ZYG A;  5L3C A;  2M8E A;  2R7F A;  1TQP A;  1IRG A;  4PGG A;  3BOQ A;  5D4R A;  3CTA A;  4HX4 A;  4LD5 A;  4L5I A;  3E97 A;  2BYV E;  3ULQ B;  1B6A A;  5FFZ A;  1CF7 A;  1ZHF A;  4EMS A;  1W7P B;  2FNA A;  5E18 F;  2HDC A;  3CUO A;  2F5F A;  2B0L A;  2HQR A;  2EFN A;  2ADU A;  1XGO A;  1FYL A;  4N0B A;  3Q9V A;  3B73 A;  4IRI A;  3J7A O;  4R1H A;  2BGC A;  4LK0 F;  2JT1 A;  3REO A;  4M6Y A;  1FBQ A;  4A5N A;  3GXO A;  2VN2 A;  1UST A;  1LDK B;  2CSO A;  1TTY A;  3I59 B;  3BZ6 A;  3KZZ A;  4HYE A;  4IHS A;  3ZMT A;  2EFW A;  4I0A A;  2QBY B;  1QZY A;  1G3Y A;  2M87 A;  1FSE A;  1XMA A;  4G9Y A;  2VBZ A;  5AIP A;  4HX8 A;  2XKP A;  1FOK A;  5LGU A;  3ZMS A;  2R7D A;  3D5L A;  5IT3 A;  4H0E A;  4CIC A;  4CGZ A;  2RN7 A;  1XSX A;  4I09 A;  5D4S A;  5FLX K;  1UFM A;  4HF0 A;  2E7X A;  5DEQ A;  2ZO4 A;  5FLX Z;  3O6B B;  2HGC A;  5D6E A;  1J2X A;  2OD5 A;  4UHT A;  1I1S A;  3FF5 A;  2K4J A;  5HLH A;  1RI7 A;  4WK8 F;  1O57 A;  5EEH A;  2HOE A;  1R36 A;  2FMY A;  3EYY A;  4BNC A;  4U7D A;  4NHJ A;  3V4G A;  4G6Q A;  3S2W A;  4JK1 X;  3LAP A;  3L00 A;  4LG0 B;  1YW8 A;  4L0Z B;  3DQV C;  3GEZ A;  3RYP A;  4P9F A;  2K86 A;  3LFK A;  2PI0 A;  5ED4 A;  3ERE D;  4KA4 A;  3F8B A;  3GO5 A;  2GXB A;  4PCQ A;  2GAU A;  1CGP A;  3T5X A;  2M5W A;  5E1W A;  2DW4 A;  5FD5 A;  3W6K B;  2VT2 A;  3M9A A;  1D5V A;  3ZP5 A;  3R61 A;  5JVT A;  4ZZL A;  3P9K A;  4AD9 A;  2VBY A;  2BBY A;  2Y75 A;  2E1N A;  4EJU A;  3T0Y A;  4HZF A;  2F5D A;  4RGS A;  5BOX A;  1S7A A;  4G7O F;  5LRR A;  3DFG A;  1R1V A;  2RC4 A;  3GFM A;  1B59 A;  4OMY A;  1U3E M;  5HDG A;  5LEJ A;  5LBQ A;  6PAX A;  1BI0 A;  5CVR A;  4DQ2 A;  4UVB A;  2ACJ A;  2VBW A;  5AON A;  5JR3 A;  1BJA A;  3LA7 A;  2Z33 A;  2MA3 A;  5LEK A;  2ETH A;  2O0Y A;  2XKO A;  4IF4 A;  3LA3 A;  3SFZ A;  1MGT A;  3TDZ C;  4HBL A;  3SHF A;  2EV0 A;  3SZP A;  3E6C C;  1TQM A;  3EDP A;  4UVA A;  1YS7 A;  1C0W A;  1P4W A;  1TNT A;  3MQ0 A;  2V79 A;  5J8F A;  4Y13 A;  4G6D A;  5ICF A;  1Z05 A;  3KLN A;  4FX0 A;  1FC3 A;  1TLH B;  1MDM B;  2D1H A;  3GFJ A;  3RJP A;  4LB5 A;  1ZH5 A;  1MJA A;  1NHA A;  2OAZ A;  4Y17 A;  4IPA A;  2FNP A;  2UWM A;  2FU4 A;  2MC3 A;  3P9C A;  4HF2 A;  3BPX A;  3VEP A;  1IN7 A;  5D8L B;  1SD5 A;  2DPD A;  4RAZ A;  5H6Q A;  5JFR A;  2W24 A;  2ZME B;  1KU2 A;  2CW0 F;  1RUN A;  5D8K B;  3PQJ A;  1XGN A;  2EA2 A;  1S3J A;  2HQN A;  5DCM B;  1FYK A;  3JTH A;  4AVP A;  1U2W A;  1T38 A;  4U88 A;  3CUQ A;  1U6G A;  2LSO A;  1O3S A;  3FX3 A;  2DBB A;  3JAM K;  2KKO A;  3NEU A;  2PJP A;  3D0S A;  3VOD A;  1WKM A;  4QLC U;  3QRF F;  4UVC A;  3GFI A;  2L3D A;  2GWR A;  4EJV A;  2JRT A;  4AWX B;  1UCR A;  1XN7 A;  2XUB A;  4M72 A;  1J5Y A;  4EM1 A;  2G7H A;  3ABU A;  4FX4 A;  3I71 A;  1OYY A;  5D5V B;  3GUD A;  1U5T B;  1BI2 A;  5DD4 A;  3R6S A;  4LLG F;  2XAH A;  1J9I A;  4ZYH A;  1IZ1 A;  2A61 A;  3I0T A;  5HVQ C;  3ROU A;  1MZB A;  4EJT A;  4UV9 A;  3IRR A;  1CF7 B;  1PP8 F;  1IN6 A;  3NRV A;  3IWZ A;  3T8T A;  1G4D A;  1FSH A;  2XVC A;  3W6J B;  3F8M A;  3I53 A;  2NS0 A;  1EV7 A;  4OMZ A;  2FBH A;  2NRA C;  5BPD A;  3EET A;  5J8C A;  3QOP A;  3WTZ A;  1KGS A;  5BMZ A;  3P9I A;  1KU9 A;  1G3S A;  2J5P A;  1EH7 A;  1BM9 A;  1QPM A;  3F6V A;  3KZY A;  3ZMD A;  3M7G A;  2A69 F;  1WI9 A;  3HTU A;  2STT A;  4K2E A;  4I2O A;  3DKW A;  3K9T A;  3FM3 A;  1K78 A;  1ZRC A;  3M1E A;  3TKY A;  4L18 B;  4M9S A;  3WE2 A;  2Z9O A;  1EH8 A;  4XLN F;  3BJO A;  3QU6 A;  1H0M A;  4KIC A;  1K79 A;  3DV8 A;  1ZG1 A;  5ICE A;  4HQE A;  2DPU A;  3HSE A;  4ZZD A;  5D5U B;  5L3E A;  3LA2 A;  1O3R A;  4HDU A;  5L3D A;  2M30 A;  3RPQ A;  4WF2 A;  2VXZ A;  4HA8 A;  1P92 A;  2FA5 A;  1OMI A;  3KET A;  4BAY A;  3MWM A;  2KIM A;  2FML A;  2BE5 F;  2K7L A;  1W5S A;  2ESN A;  4AIK A;  1I6X A;  4KIF A;  2IJL A;  1Z9C A;  1K6O A;  1P6R A;  2H09 A;  3DPL C;  4RGR A;  5EEG A;  2PQ8 A;  1HBX G;  2PBI A;  4IRH A;  3NQO A;  1K7A A;  4O6J A;  2F2E A;  4M6X A;  5HLI A;  4WXC A;  2P4W A;  3G73 A;  4D0P A;  4XLP F;  4HQM A;  4CDG A;  4MTD A;  2NYX A;  1OYW A;  2IW5 A;  2OQG A;  2H6B A;  4IJA A;  3F21 A;  2LDU A;  3F8F A;  4IXA A;  3E5U A;  1S7O A;  2P5V A;  4LGW A;  3LQR A;  1YLF A;  3OV8 A;  4GXO A;  4ON0 A;  1E17 A;  4OOI A;  1MKM A;  2HKX A;  2GQQ A;  3CJN A;  4RB2 C;  3RIR A;  1DPU A;  1IXR C;  4IRG A;  3RKX A;  3U2R A;  3WTU C;  2A68 F;  2WTE A;  4LB6 B;  1PUE E;  1W5T A;  3K0L A;  1IN8 A;  2DLL A;  5DCF A;  3E5Q A;  2XAJ A;  2XRN A;  3K1P A;  4HOB A;  5ERI A;  4Q5S F;  4RS8 A;  5HS7 A;  1FX7 A;  1O7L A;  2JTV A;  2QM3 A;  1FZP B;  4O3M A;  4A0Y A;  4U0W A;  3MFK A;  2QZ8 A;  3ECH A;  1LVA A;  1KQ9 A;  2KJB A;  2A5Y B;  1YYV A;  2DQR A;  3WE3 A;  1IN4 A;  2VON A;  1Z6R A;  2JPB A;  4MQ9 F;  1IRF A;  2RDP A;  4TV7 A;  2TDX A;  2QQA A;  4RB1 A;  5LHH A;  2W84 A;  1V3F A;  2L54 A;  4UNO A;  3WOD F;  2O61 A;  3QP5 A;  1FWZ A;  4S05 A;  3L9F A;  1ZN2 A;  4A6E A;  1SMT A;  2VC1 A;  1QZZ A;  3F3X A;  3WTS C;  2Z5U A;  1ZLJ A;  3ML6 A;  3F8N A;  1SFE A;  1SD7 A;  4ESJ A;  1JXS A;  1JGS A;  4G7H F;  4HF1 A;  3O3K A;  3FWE A;  2L01 A;  3R60 A;  2EFP A;  1GHC A;  4ENK A;  1KU7 A;  3ZPL A;  3E6B A;  3WGH A;  3HRT A;  2YPR A;  3RTR A;  2D2W A;  4Q4Z F;  1ODD A;  4GYG A;  3SQN A;  3OOP A;  1D3Y A;  3FXQ A;  2HTJ A;  1G6N A;  2MBF A;  5IT9 Z;  1ZGJ A;  1ON2 A;  1KYZ A;  3HYI A;  4M9Z A;  1YS6 A;  4KYW A;  2ZNY A;  2JSC A;  2XHK A;  1R7J A;  2WV0 A;  1HQC A;  2PLY A;  2F5E A;  3DXJ F;  2O8X A;  1JHH A;  2V1D A;  2DK5 A;  4HAM A;  2IPQ X;  4BXU A;  2IA2 A;  2FF4 A;  2GIV A;  4ZYE A;  3HHH A;  2QWW A;  2FEZ A;  4KT5 C;  5CLS A;  4HLY A;  5ICG A;  3K2Z A;  1J75 A;  1LEA A;  2JPC A;  2NNN A;  1Z1D A;  4CO8 A;  5H6R A;  2PG4 A;  2EB7 A;  3GLX A;  5ILV A;  4YFN F;  4LLN A;  4KFC A;  1O3Q A;  1HKQ A;  1LB2 A;  1J59 A;  2EV6 A;  4AIH A;  5FD6 A;  4YIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...