4EJWA

Staphylococcus epidermidis tcar in complex with streptomycin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
136
Chain Sequence
RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator TcaR
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis rp62a
total genus 47
structure length 136
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejwA00
4U7BA 1BIBA 3M8EA 2K4BA 5ERIA 3GFIA 3GWZA 5DUIA 2YX4A 1K78B 1KU7A 1G3TA 4LGWA 1U78A 2L3DA 1REPC 5E1WA 1R23A 2VBXA 3NRVA 2EK5A 1I5ZA 3L7WA 4OMYA 3F22A 4UVBA 1TQPA 3CO7C 2ZKZA 1TW3A 1CF7B 3U2RA 3EYIA 5CJ9A 2HWVA 1O3SA 2PBIA 4U88A 2GXGA 4E70A 4ZYGA 1IN7A 5BQTA 3ROUA 1O3TA 1XDUA 3E6MA 3CJNA 5ICGA 1FZPB 2CWEA 1BI0A 2BEOA 2P6TA 3QP6A 5DD4A 4CYDA 3T1BA 2D1HA 3GZ6A 1RI7A 1T2KA 1KGSA 3TO6A 1HBXG 2HTSA 3P9CA 4XSXF 1FP1D 3ML6A 4LJZF 3HHGA 4GXOA 3COAC 2FNAA 3RDIA 5LBQA 3F72A 3M1EA 1F9NA 1FC3A 5E18F 4EGZA 2DK8A 4EM1A 2XHKA 1Z6TA 2X4HA 3DXJF 2K27A 2FEZA 3CDHA 4A5MA 4MGRA 1R5GA 3PQKA 1WI9A 1W5TA 4BYYA 4ZYHA 1R36A 4QWQA 3JSPA 1CGPA 4B8XA 3FXUA 1KYWA 4KA4A 2CGPA 3VFZA 3T8TA 1T39A 1XGNA 3R4KA 3KETA 4LB5A 1Y0UA 2D2WA 5ILVA 1YO5C 2HQRA 2RV8A 3I64A 2TDXA 3BROA 3EETA 1Z7UA 2HTJA 1Z05A 2DW4A 3IRRA 4CZZA 2F5FA 3ABTA 3IHUA 3REOA 2GIVA 3Q5FA 1PUEE 5TRDA 4L18B 4FHTA 4K2EA 2W57A 4EQQA 1O7LA 1WWXA 3E5UA 1W4MA 5DDGA 2M8EA 3D0SA 4IPAA 4AIKA 2O61A 2XVCA 1IRFA 2UZKA 1G6NA 2OU2A 1SD6A 4HLXA 3RPUA 2EFPA 3ZQ7A 5DCFA 3RTRA 4XLPF 4D0PA 1MD0A 1VTNC 2KIMA 1O3RA 3B02A 4S04A 1LJ9A 1OMIA 2VT3A 3KE2A 2VOPA 3KCCA 2JRTA 3V8JA 3GVAA 1QGPA 4WF2A 5TJJA 5FD6A 5CVUA 2A5YB 2XKOA 4JQFA 2ISZA 4RB0A 4MTEA 2GWRA 2M30A 4HV6A 1IXSB 5FGMA 3FF5A 3WE2A 2Z99A 1RUOA 2F5DA 2IW5A 2IT0A 2IP2A 5EEGA 2JPBA 2PFBA 2P7VB 3U9GA 4JK1X 3T8RA 2P6SA 5IT3A 1PP8F 2FA5A 1YFHA 3V4GA 1ZHFA 3ELKA 4WCGA 1P4WA 3F21A 1IW7F 4WK8F 5IT9K 4HF1A 2QZ8A 3ECOA 5D4SA 4RGUA 4FX4A 5DCMA 3DQVC 4AIJA 5LHGA 4A12A 1ZH5A 2DK5A 4DNCA 5DV5A 2H94A 1ZRDA 2RDPA 4M9ZA 3V8LA 5D4RA 2M1BA 1XGOA 4BH9A 3L2CA 4HAMA 2EA2A 2RQPA 4IVNA 3K2ZA 3S2WA 1BI1A 5HS8A 2RKHA 5F64A 5KVRA 2MH9A 3DKWA 1ZREA 3V7RA 4WXCA 4UV9A 3K1PA 1KQ9A 5A2QZ 3HSFA 2QQBA 4BHBA 5AIQA 4HW0A 2WC2A 2OAZA 3R0JA 1Z9CA 1TTYA 1O57A 4LD5A 3LAPA 1UFMA 1QZZA 1XD7A 2A6HF 2P4WA 5DUKA 4YFNF 1ZG3A 2FU4A 4G6QA 6PAXA 4HDVA 2PQ8A 4MQ9F 2DPUA 5LLQA 1IAWA 3GEZA 3KEOA 2C6YA 1SD4A 1L3LA 3BJAA 2STTA 1JGSA 2XAQA 4A2UA 2W84A 4ZZDA 2FQ3A 5EEHA 1U8RA 1D8KA 4O3MA 3ZMDA 1EH7A 3VB2A 1FLIA 3RKYA 3WTTC 4G8XA 3C3WA 2XAFA 1FPQA 3GZ5A 4MNUA 4ENJA 3KLNA 3RI4A 2GXBA 3F3XA 2EB7A 2XGXA 3FM5A 2QENA 1D3YA 5HOOA 3BWGA 2O3FA 3OOPA 1S6LA 4LLGF 1FOKA 4L9JA 4AVPA 2FF4A 3TGNA 2ZMEB 3H92A 3TOBA 3N4MA 2IPQX 1P6RA 3QPHA 5DEQA 3GFMA 3FWEA 2MLGA 2A07F 2FBKA 2JT1A 1YG2A 4A0YA 3I53A 3NEUA 3CUQB 3R0AA 3JW4A 3MEXA 3GO5A 4P9UA 3AAFA 3QPTA 2JZYA 3WTVC 5K5RA 2HYGD 3WGHA 3WTWC 3DV8A 1MDMB 2DTRA 4Q4ZF 1YW8A 2COMA 2DO7A 1JHHA 5CVRA 4OOIA 1P4XA 2ZNZA 2K02A 3DFGA 1R58A 2DQRA 4RAZA 1YYVA 3OV8A 1ON1A 2M87A 3U1DA 2DQLA 5DD8A 4N0BA 2H27A 3T5XA 3GFLA 1ZRFA 1MKMA 1J9IA 1ZN2A 5LGUA 2XAGA 5D6EA 3FHZA 4HOBA 3I54A 1TW2A 2R7DA 3M8FA 5K5OA 3HTSB 4L9TA 2NS0A 1I6XA 2HR3A 3R6SA 3J81Z 3WTUC 4G7ZF 4UVCA 4G7HF 3WU0A 2V1UA 4XBFA 5BPIA 5BOXA 2A69F 4UXNA 3LAJA 2CQKA 3TKYA 4EV0A 2EV5A 4GCVA 5D5UB 3HYIA 2Y48A 3GF2A 3BPVA 1YS7A 2B0LA 4I2OA 1ZARA 2G7HA 3G73A 4Q5SF 4ZYEA 1MGTA 5FLXK 2JSCA 4A6EA 2HKXA 3SZTA 2RNJA 3Q9SA 3HOSA 5L3FA 1P2FA 4HV5A 3E5XA 1EH8A 3HRUA 2PN6A 3ZN1A 5HDGA 2HZTA 4U0WA 1ZLJA 2QYOA 4EVIA 2J5PA 3GFJA 5JHUA 3QRFF 1IUYA 3ZMVA 4RB3C 3VEPA 2ZXJA 4U7DA 4ON0A 1J75A 1R5HA 5FO5A 3LFKA 4HQEA 4HQMA 5L3BA 2BE5F 1XGMA 4KIGA 3WODF 1QO0D 2OD5A 2UWMA 2V9VA 4HYEA 1BC8C 4GO1A 4MEYF 4HF2A 4RB1A 4RAYA 3IC7A 1B6AA 2RVCA 3QU3A 3MFKA 2YPRA 2PI0A 2O8XA 1C0WA 2HKOA 3W6JB 4O5VA 3L9FA 4BNCA 2L01A 4LK0F 2IRFG 1KU2A 2YU3A 4MTDA 2LNBA 4ESFA 3ZMSA 3GUDA 2M5WA 2UXNA 5L3DA 4AD9A 1UB9A 3HIFA 2EFOA 1FSHA 2Q0OA 3E6CC 2HDCA 1O3QA 5LEJA 2A68F 2O6GE 4YIIA 4TV7A 1FYMA 1B1BA 1TQMA 5F1RA 4L0ZB 4BHPA 1J7KA 1R22A 3I4PA 5HDKA 4Y15A 3TQNA 5FFZA 2O0YA 3ZMUA 3IWFA 2A6EF 1F5TA 2FE3A 3SXYA 1K6OA 3HRMA 1WKMA 2QQ9A 1UHWA 4M73A 2ZO4A 4M71A 1Z1DA 4YG2F 4I0BA 1U2WA 3L00A 2OQGA 2Q8KA 2HFHA 1HKSA 1SD7A 2ZBKA 3DPLC 5J8CA 1RZ4A 2VT2A 5D8KB 2K7LA 4R8HA 3C7JA 1B9NA 1UCRA 4NHJA 2ZJ2A 4RB2C 1LNWA 3RYRA 1LDDA 2VC0A 4I7HA 4OU0A 1TNTA 3WGIA 4GYGA 4EJUA 1SFXA 3FXRA 1A04A 2ACJA 3WTSC 2PEXA 3E97A 1QNTA 2ELHA 1FT9A 3C18A 3GXOA 3HSRA 5ILSA 3VOEA 1ZG1A 1MZBA 4HBLA 5H6QA 4ASNA 2MD5A 4IXAA 4L9VA 1HW2A 4HA8A 4BHCA 1FX7A 2QBYB 4HX8A 2V6CA 1P4AA 2O03A 4PCQA 2R3SA 5HLGA 2PJPA 3LA3A 1S8NA 4KICA 3GLXA 3ZMTA 1B59A 3BOQA 5LRSA 3K1NA 2DT5A 3F8CA 1LVAA 3G3ZA 2F5CA 2CO5A 1ULYA 4UHTA 1U5TB 1XSXA 2HEOA 1FBSA 4UNOA 2BV6A 1MJBA 3R60A 3J80Z 2VODA 1E2XA 4LLLA 4KMFA 3KZYA 4M6XA 1TQIA 1S3JA 3BJ6A 1OKRA 1T38A 1IF1A 3RIRA 1IXCA 4GYIA 2KJCA 4P5OA 3B73A 5JFRA 5L3GA 3KP4A 3VODA 1I1GA 5AIPA 1LEAA 4AWXB 2L54A 4ZZLA 1KYZA 1HSJA 4BQAA 3JAMZ 5LGTA 3P9KA 5ICFA 2BBYA 3HOTA 5HVQC 2XROA 3JSOA 4L0YB 1B4AA 3DF8A 1FBQA 3M7GA 3I0TA 2VBWA 2G9WA 2V79A 5D5WB 2Q2EA 3KP7A 3R61A 4RGRA 1HKTA 3LA7A 3F8BA 5LRRA 3MWMA 4RGXA 5J6XA 5ILUA 2J5OA 2Z33A 3WU1B 4EJOA 3JTHA 4P96A 1BBYA 5D5XB 2KKOA 3WTXC 4DQ2A 1LDJA 4LMYA 3EDPA 2RN7A 1G3YA 2XAJA 3HRSA 1G4DA 1XSVA 5L3EA 1QBJA 1JHFA 1YLFA 5L3CA 2ZMEA 2ZCWA 3CUQC 1J0RA 1WSUA 3RPQA 2LDUA 2A61A 1I1SA 1IN8A 2QUFA 2BYVE 1T6SA 2CYYA 2IA2A 3CUQA 4FX0A 2VC1A 4M9XA 1KQ8A 1R1TA 1FYLA 4KN4X 3ERED 1SFEA 5CVJA 2OZ6A 1X3UA 4XRFA 4I09A 2KRFA 1QZYA 2EA4A 5J8FA 1MDMA 3E5QA 2FXAA 3TO9A 4Y17A 2XKPA 5E1ZB 1O7FA 3GW2A 2D45A 5HLIA 2DLLA 2GA2A 3O3KA 1HXDA 3LA2A 4N9IA 4H0EA 1IN6A 2JPCA 4BAYA 2W25A 2D1VA 1H9GA 4OMZA 2MC3A 1BN5A 1HW1A 1XGSA 4IF4A 3F8FA 5A2QK 1B9MA 5K5QA 2L4MA 4LLNA 3SZPA 1V3FA 3LSTA 2YR2A 4R1HA 5CVVA 1XB4A 1WRJA 2VONA 5E8GA 4OIPF 2F5EA 1W5SA 2ZNYA 4I0AA 4LG0B 1RIOH 3W6KB 1H9TA 2ETHA 2H09A 2OBPA 1T0FA 1HKQA 3I71A 2H6BA 1PP7U 4M74A 3ISPA 5HDNA 2DPDA 1J5YA 3QP5A 1RUNA 3F6VA 5FB2A 1IN4A 3ABUA 5JR3A 3ZMZA 1ZAOA 1BOAA 1ON2A 3N97A 3ULQB 4PGGA 2OZUA 3J7AO 2XV4S 4HX4A 4CICA 2GZWA 1E17A 1LB2A 2L02A 2YX7A 2HS5A 1HQCA 2GQQA 4ZH4F 2FMYA 4PGHA 3M9AA 2P8TA 3I58A 4WWCA 1KU9A 1FYKA 3TO7A 3I59B 3EYYA 5CYVA 4G9YA 2QQAA 1S7OA 4UUVA 2Y75A 1U6GA 3F6OA 2P5KA 1DPRA 3TDUC 4S05A 2CG4A 4Y13A 1L0OC 5BPDA 5ICEA 1ZYRF 4L5IA 3E6BA 1XMAA 3HSEA 1W7PB 4JBAA 1LDKB 3H3UA 1LQ1A 5JI6A 3DPTA 2RC4A 4RGSA 3IKTA 4OIQF 4M72A 2EV6A 4IRGA 1RNLA 1H0MA 2FBIA 4HZFA 4A5NA 2LKPA 3SFZA 2LSOA 2W24A 2HGCA 1YQAA 1ODDA 4KMUX 4I98B 4UV8A 3F23A 4F7ZA 4WXHA 1HSTA 3CUOA 1IXRC 4KN7X 3V8KA 3WE3A 1NHAA 2EWNA 2Z5UA 4BXUA 3KP6A 1ZLKA 1DDNA 4HX7A 4Q47A 2NRAC 1Z6RA 1USTA 1SAXA 2XIGA 4P55A 1STZA 4CDGA 3EUHA 1DUXC 2G7UA 4MEXF 1V4RA 2V1XA 4EMSA 2XASA 4LB6B 1EV7A 4KDPA 2EFNA 4NQWA 1FBUA 3FMRA 4OIRF 3LWFA 4L9NA 1G3WA 1J59A 3KP3A 3J81K 2QVOA 3F8NA 3WTYC 2VOOA 1KA8A 3O2PE 1FWZA 4KIBA 2MA3A 3BDDA 2EJRA 3P9IA 1AOYA 2VBYA 2HYFA 3HTUA 1BJAA 3CLOA 3SHFA 3RKXA 4ESBA 1TNSA 1XCVA 5LGNA 2FOKA 2QM3A 4G6DA 4IRHA 1GXQA 4NB5A 4YFKF 3FX3A 5HS7A 5ICCA 2IA1A 1AWCA 2FNPA 4B09A 1FSEA 2XRNA 2FMLA 1GVJA 4KUMA 3ZN0A 3DEUA 4YIFA 3TOAA 2P5VA 4G7OF 5K1YA 2E1NA 3EQLF 3D5LA 3BJOA 1R7JA 1LEBA 4A6DA 2AXLA 4IJAA 5D6FA 1BI3A 2EFQA 3CTAA 4KNYA 2QBYA 2ZFWA 2OA4A 1OPCA 2GA1A 5IT9Z 3K9TA 1DP7P 1OYWA 2VE8A 3TDZC 4CGZA 1U5TC 2BGCA 2MLKA 4RS8A 2CW0F 2R7FA 1YW7A 5E8IA 1P92A 1ZGJA 2LF8A 2K4JA 5AONA 5HS9A 3GX4X 2M45A 3FMQA 5E17F 2P5LC 2PG4A 2VBZA 3C1DA 4M6YA 1U5TA 3HUGA 3KP2A 3RYPA 4IHSA 2QLZA 3K69A 1F1ZA 1R1VA 3HHHA 3FM3A 2WV0A 3PFIA 3O6BB 3BPXA 5CVIA 3KP5A 2ESNA 1IZ1A 2E7WA 2MH2A 1KQ0A 2MBFA 3FZVA 4CHUA 5DYMA 4XLNF 3F8MA 1J2XA 2ISYA 2CSOA 5LHIA 2IJLA 3JTGA 2L4AA 2FBHA 4ESJA 3RJPA 1GHCA 1MJAA 2AS5F 4KIFA 4P9FA 5LEKA 4Q48A 2UXXA 3RKWA 1XMKA 2P7CB 1S29A 4EM2A 1W7PD 1F4KA 4MHGA 2HQNA 3MZHA 1I27A 2EV0A 3BZ6A 1TBXA 3IWZA 1G3SA 2STWA 2F2EA 3BP8A 3K1MA 2PMUA 5LHHA 4UVAA 1XCBA 4KYWA 1BIAA 1XN7A 1TLHB 4WXDA 1WQ2A 4ENNA 1Q1HA 2EFWA 4IHTA 3KFWX 3MQ0A 1UHMA 1BC7C 4EJWA 4QLCU 4EJTA 1K79A 3DP7A 4I02A 1MJ9A 2LF7A 2Z9OA 3L09A 4U0VA 1R00A 4PZJA 3MAJA 4L5JA 4IRIA 3V7SA 4ZYDA 4GGGA 3CO6C 2WTEA 3K0LA 2W85A 1SMTA 5DCMB 1YTYA 4LFUA 3I5UA 4FT8A 2V1DA 4EM0B 3BY6A 1EH6A 2NAZA 1K7AA 5F6FA 2ESHA 2VXZA 5E20A 3WGGA 4G94A 2KIFA 3SQNA 1ZRCA 2DI3A 3J80K 1QPMA 1YIOA 2Y0MA 3IL2A 2ADUA 2IVMA 3KEQA 3ZP5A 2VE9A 1DPUA 5FD5A 1YW9A 4LG0A 3HRTA 1SD5A 1D8JA 3QOPA 2FSWA 1ZG5A 3QU6A 4WX9A 3Q9VA 2A3SA 5D5VB 2IA0A 4HLYA 2WWYA 2HOEA 3WG9A 4KFCA 3H3ZA 1USSA 2Z3YA 1OYIA 4A0XA 4EGYA 2E1CA 2PLYA 3JAMK 4N9HA 1XSDA 3NQOA 2NNNA 1QQIA 2E7XA 2FRHA 5BS6A 1FP2A 4Z2YA 1U3EM 5KK1A 1OYYA 4ETSA 3FMSA 1YS6A 4M9SA 2QWWA 2KIUA 4OIOF 3T0YA 3LQQA 2RGVA 1OR7A 1D5VA 4HF0A 1T98A 3PQJA 5FFXA 4OINF 5D8LB 2DFIA 4CXFA 2YSRA 1FNNA 4ENMA 2NYXA 4ENKA 1JE8A 2DBBA 2PMHA 3MZYA 4KT5C 1KU3A 5BMZA 4HDUA 3V7CA 2VN2A 1ONVA 3MCZA 2GAUA 1HW5A 1ZGAA 3I59A 3FXQA 2JTVA 3P7NA 2X0LA 3IRQA 1IRGA 1XDSA 3KZZA 1GXPA 2OQRA 3LQRA 5FLXZ 2CFXA 5H20A 3GYHX 2DAOA 3ZPLA 5H6RA 2NNYA 3WTZA 4I01A 4AIHA 1S7AA 1W7PA 4MQVA 3E3VA 4LK1F 5E1XA 4CO8A 1K78A 3IKVA 1IN5A 1SFUA 4U0YA 1JXSA 2KJBA 2XAHA 5HLHA 4A0ZA 1BM9A 3E6DA 1PDNC 4YFXF 3QAHA 3ECHA 1BI2A 4PDKA 1CF7A 4R79A 1SMYF 3KLOA 2DU9A 4XSZF 2K86A 1Z91A 4O6JA 5CLSA 5JVTA 2H6CA 2XUBA 4EJVA 1R1UA 5ED4A 1FY7A
chains in the Genus database with same CATH superfamily
1LFPA 4XLAA 3IAM2 4U7BA 1BIBA 1V54H 5FKMA 1X1AA 2QQ8A 2K4BA 3M8EA 5J1UA 2TRTA 5ERIA 2JA8J 3GFIA 4UB6C 3DU5A 1NG6A 4G12A 3GWZA 2V26A 5DUIA 3A4CA 2YX4A 1K78B 1KU7A 1G3TA 4LGWA 2MD0A 1U78A 2L3DA 4PK4A 1REPC 4B47A 5E1WA 5HNHA 1R23A 3GTQJ 2VBXA 3FDYA 3NRVA 3CC7I 2EK5A 1I5ZA 3L7WA 5EG0A 2KMUA 4OMYA 1Y8QB 3F22A 3QQAA 1TQPA 3PNTA 4UVBA 3CO7C 2ZKZA 1TW3A 2L9VA 3ZOBA 2CUJA 4KJZA 1CF7B 3U2RA 4AYBN 3EYIA 1XG1A 2EIJH 3BR6A 3TMOA 3ASOH 4PFOA 3MKWB 5CJ9A 1Z7LA 2HWVA 2F48A 1O3SA 1GLNA 2PBIA 1APLC 4HSTA 2E71A 4U88A 5FKLA 1MBFA 4PJMA 2MC4A 2GXGA 3CJRB 4E70A 3ZQGA 2M9HA 4ZYGA 1QHHD 1SFKA 2NVQJ 1IN7A 1OCPA 3GLLA 5BQTA 5F04A 2K9QA 2JA5J 3ROUA 2H8WA 2ZJRF 2XB5A 1O3TA 3SFIA 1XDUA 3E6MA 5IYBJ 4XLEA 3CJNA 4S0HB 3QOEA 3H9GA 3A0BC 5ICGA 2COBA 3AKZA 4A3EJ 1FZPB 2CWEA 1BI0A 1MNMC 2FUG2 2BEOA 4CCOA 2P6TA 2YUSA 4D9JA 3HOXJ 1D1BA 2LK2A 3G1OA 3QP6A 5DD4A 2E19A 4CYDA 3T1BA 2JSPA 2D1HA 3GZ6A 1RI7A 1XTAA 1T2KA 3A01B 4C2MJ 4M3EA 1KGSA 2CUFA 3TO6A 2VASA 2HTSA 1HBXG 3P9CA 4HNUA 3I4MJ 3AL0B 2NS7A 4XSXF 1FP1D 3ML6A 4LJZF 3HHGA 5B1AH 2WAFA 4GXOA 4LG3A 2FNAA 3ABKH 3RDIA 5LBQA 3COAC 3FXMA 3CCUI 3F72A 3M1EA 1F9NA 1IRXA 3OYCA 1FC3A 3KYDB 3GTOJ 5E18F 4EGZA 2DK8A 4EM1A 2KIQA 3FK7A 5C44J 2XHKA 3CF5F 1Z6TA 1IGNA 4C2TA 4AYBA 2X4HA 3DXJF 3FXKA 4XORA 2K27A 2FEZA 3GTGJ 3LSRA 3CDHA 4A5MA 4ZJZA 3PUFA 3UR3C 4MGRA 1R5GA 1DGWY 3PQKA 1WI9A 2BZTA 4W97A 1W5TA 4BYYA 2BVMA 4IO9F 4ZYHA 2EINH 1A5JA 1R36A 4QWQA 1ZTRA 5GAHJ 3JSPA 2PMZN 2B9SA 2IS2A 5M5YJ 1CGPA 2Z2SB 4B8XA 2LVSA 4OAYA 3UKGA 4PSWA 3FXUA 1QRYA 3TP0A 4AUXA 1U9NA 1KYWA 4KA4A 2CGPA 1VQKI 3VFZA 3A03A 3T8TA 1AU7A 2E34A 2XPWA 3CCYA 1T39A 1XGNA 3R4KA 4B43A 3KETA 2HPMA 3OS2A 4LB5A 5F08A 1Y0UA 2D2WA 2HZDA 1RPWA 5ILVA 1YO5C 3IH2A 2HQRA 2RV8A 3I64A 5EZGA 2TDXA 3BROA 5GPAA 3EETA 1Z7UA 4YELA 1GUUA 4C30A 3JRIA 1A6QA 2HTJA 2R7RA 4X6AJ 1Z05A 2DW4A 1VQ4I 1UG0A 4HRIA 1OLTA 3IRRA 3K10A 1WHUA 4CZZA 2F5FA 2FD5A 3FISA 3ABTA 1RRJA 3LSKA 3IH4A 1X2MA 3IHUA 1ETQA 2VJIA 3PUBA 3REOA 2ZJPF 2GIVA 3Q5FA 2M3AA 3BTCA 1PUEE 2CS3A 5J1RA 3JRGA 1SVLA 4XKBA 4DYCA 2EZKA 5TRDA 4L18B 4FHTA 4K2EA 2W82A 2W57A 4EQQA 1O7LA 3F9KA 1WWXA 3VWBA 3E5UA 1W4MA 3SEQA 5DDGA 2M8EA 3D0SA 3H36A 4IPAA 4BE2A 1ZGWA 1Z3YA 3W6VA 4AIKA 1RESA 2O61A 2XVCA 5H2FC 1IRFA 2UZKA 2BHYA 1G6NA 1W1WE 2P81A 2OU2A 4ZDLA 1SD6A 4HLXA 3RPUA 4KT6A 2EFPA 3RZDJ 3ZQ7A 1JUSA 1J09A 5DCFA 3RTRA 5FLVA 4XLPF 4D0PA 4DYRA 1MD0A 1VTNC 2KIMA 4A3LJ 1ORKA 1O3RA 4ZC3A 3HL2A 3B02A 9ANTA 4S04A 1LJ9A 1OMIA 2VT3A 3K4KA 3KE2A 2VOPA 3KCCA 4XIDA 2JRTA 3V8JA 1OQYA 3G2BA 3GVAA 1QGPA 1VF9A 2DA3A 4WF2A 2IAIA 4YRVA 4E7JA 5TJJA 3HKZN 1R4MB 4PSXA 5FD6A 2WY7Q 5CVUA 1DU0A 2WAEA 2KRCA 2ICWG 4QSHA 2A5YB 3ZRGA 3H0GJ 4CYCB 2XKOA 4JQFA 1VQNI 2ISZA 2V4JC 1QVUA 4RB0A 5EJCA 4MTEA 2CH0A 2GWRA 2M30A 3VYRB 3OIQA 4F55A 4HV6A 1IXSB 5FGMA 3FF5A 4Y33A 3BQYA 2Z99A 3WE2A 1RUOA 2F5DA 2IW5A 2IT0A 2IP2A 5EEGA 2JPBA 3OSFA 1MMDA 4NNJA 2PFBA 2DMNA 2P7VB 3BCAA 3LSJA 2JA7J 3U9GA 4JK1X 2VPRA 3T8RA 2I5UA 2P6SA 2A05A 5IT3A 2IGKA 1PP8F 3D5RC 4YEJA 4D1QA 2FA5A 3ASNH 1YFHA 3V4GA 3QYFA 1ZHFA 1ETXA 2YS9A 2R7SA 3ELKA 4FISA 4WCGA 3CCLI 1P4WA 1IV6A 3F21A 1FMWA 1IW7F 4DYQA 4WK8F 2L7ZA 4FTHA 1T56A 1SC7A 5IT9K 2M7BA 4HF1A 1BW6A 2QZ8A 4DBRA 3BR1A 4BJ6C 3G1LA 4D7NA 3JREA 3ECOA 5D4SA 4RGUA 4FX4A 5DCMA 4V19K 3K4MA 3DQVC 2R7WA 2R5ZA 4AIJA 1MW7A 5LHGA 5GAGJ 3PL8A 5CPRB 4A12A 1ZH5A 1IO2A 2QKMB 3HKZA 4XOTA 2DK5A 2K5CA 4DNCA 3ZGKA 5DV5A 2H94A 2CRGA 5B66C 2JMWA 5DTDA 3EUAA 2NS8A 1ZRDA 2RDPA 3DCFA 1MBEA 4M9ZA 3V8LA 5D4RA 4M6VA 2M2EA 2M1BA 1XGOA 2F4IA 4BH9A 3AFHA 3L2CA 2EZIA 4HAMA 3OOUA 2Y2ZA 2EA2A 2RQPA 4IVNA 2EH3A 2NOJB 3K2ZA 3S2WA 5KAFC 1BI1A 2QSFX 4UUSB 5HS8A 2RKHA 3BT9A 1U0JA 5F64A 5KVRA 5IPAA 3VDXA 5J3LA 2R7ZJ 2MH9A 4IHWA 3LFUA 3DKWA 1ZREA 3V7RA 4WXCA 4UV9A 3K1PA 1KQ9A 1JJ6C 5A2QZ 4BBSJ 3HOZJ 3HSFA 1JUPA 3BCBA 2QQBA 5F1JA 4BHBA 4UUTA 5AIQA 4HW0A 2WC2A 2OAZA 2RQQA 3R0JA 2JA2A 1Z9CA 1TTYA 5E3OA 1O57A 1UG2A 4LD5A 2R5ZB 3LAPA 1UFMA 2IS6A 1QZZA 1K4TA 1XD7A 3BLYA 4BS9A 3W2VA 4IOAF 4XQFA 2A6HF 2L7KA 2P4WA 4N4OB 3QPSA 5DUKA 4YFNF 1ZG3A 1GDTA 1X4PA 2FU4A 2EZHA 4ZDOA 2CQ7A 4G6QA 1T95A 2K9SA 6PAXA 2AHQA 4HDVA 2PQ8A 2DA7A 4MQ9F 3KEYA 3JRAA 4CCJA 2ZXHA 2DPUA 5LLQA 3FBIB 3OY9A 3HPHA 1IAWA 3Q3SA 3GEZA 1XPXA 2DFHA 3ABLH 3KEOA 2JVGA 4XKVA 3S15J 1YI2I 2C6YA 1SD4A 1L3LA 3DBHB 3RKQA 3BJAA 3H5AA 4JX6A 2STTA 3SJMA 2GLOA 2CJJA 5KNLA 4J19A 4B48A 1JGSA 1NTCA 2XAQA 4A2UA 5GP9A 4A3IJ 3OR1C 2W84A 4ZZDA 2FQ3A 2B63J 3LSGA 4V2FA 5EEHA 1U8RA 1OCCH 1FIPA 4A3KJ 2VJJA 4B3AA 3Q0UA 1D8KA 4O3MA 3ZMDA 1K6YA 4U87A 4PJLA 5KHDA 1EH7A 3VB2A 1BJZA 2ID3A 2M0CA 3RKYA 1N78A 1FLIA 5EGOA 2NOGA 2K3PA 2AQFA 3WTTC 4G8XA 3C3WA 2XAFA 1FPQA 5C4JJ 3GZ5A 4MNUA 1UHSA 2Q2EB 4ENJA 3OYAA 4IHXA 3KLNA 4Y3OA 3CCSI 4IOCF 2MYSA 4RM3A 4M3FA 3JR9A 3VYSB 1AHDP 3CMYA 3RI4A 3L1PA 1FJLA 2GXBA 1E3PA 3DLAA 3F3XA 2EB7A 1SANA 2XGXA 3FM5A 3L2QA 3UNGC 2CU7A 2QENA 1Y1VJ 1D3YA 5HOOA 3BWGA 1B72A 2M4GA 2O3FA 3OOPA 1S6LA 4LLGF 2EILH 4MO7A 1FOKA 4L9JA 4AVPA 1PUFB 2KDZA 2FF4A 2X6WA 1Z3XA 2HXIA 3TGNA 2HPIA 1SAUA 4LIVA 3VSLA 3O8HA 2ZMEB 3H92A 3GTMJ 1DGRM 3TOBA 3N4MA 2IPQX 4UB8C 1P7JA 1MMAA 1P6RA 3QPHA 2Z1DA 5FRNA 5DEQA 3GFMA 1MSFC 3FWEA 4XRMA 2PX9A 2MLGA 2A07F 5FJ8J 5IP9J 3DWLE 2FBKA 2JT1A 4BU2A 1YG2A 4A0YA 2DJNA 3I53A 3NEUA 2OC6A 2IEKA 3CUQB 3R0AA 3FKJA 4C3JJ 5B3SH 3JW4A 3MEXA 5EGOB 1S9HA 3GO5A 3ONQA 5J47A 4FQGA 4P9UA 2DDBA 3QPTA 2JZYA 3AAFA 3WTVC 3S2HJ 5K5RA 3KYLA 3CDIA 2CQNA 2LYCA 2E36A 1HF0A 2HYGD 2LR8A 3WGHA 1BW5A 1XS9A 3QODA 4P1WA 3WTWC 4E7ZA 3DV8A 1MDMB 3JRBA 2DTRA 4Q4ZF 3U1KA 1DU6A 1YW8A 2LMDA 3DU6A 2COMA 2DO7A 3CQZJ 3OS0A 1JHHA 2EZLA 4OOIA 2DOEA 5CVRA 2HOTA 3AG1H 2L2OA 1P4XA 2ZNZA 2XC7A 2HDDA 4E7IA 3OWTA 3TEDA 2K02A 4YIRX 5E3NA 1W36D 4A3BJ 2NVXJ 3DFGA 1R58A 2DQRA 1RETA 4RAZA 1QHGA 3FK6A 1YYVA 1LUJB 3OV8A 1ON1A 1YJ9I 2F4OB 2M87A 3U1DA 2DQLA 5DD8A 2JWTA 3OYBA 4N0BA 2H27A 1Z77A 4CUGA 3BZCA 3FIWA 3T5XA 3GFLA 1ZRFA 2E2HJ 1MKMA 1J9IA 2QSHX 5IOYA 2L5QA 1ZN2A 5LGUA 2XAGA 1R9TJ 5CQEA 4AM3A 5D6EA 4M3BA 1MSEC 4MIMA 3FHZA 3DBRB 3JRDA 1VQ5I 4I6ZA 1ETVA 4HOBA 1ENHA 2ECCA 3I54A 3DLLF 3OMYA 3SYTA 3OYMA 1WJCA 4XN0A 1TW2A 2R7DA 3M8FA 5K5OA 2V7FA 3PJRA 4QPQA 3HTSB 4L9TA 2X1DA 2BY3A 2NS0A 1I6XA 2Z16A 3DEWA 2HR3A 5E3MA 2X9DA 3R6SA 2LY1A 3J81Z 4FETA 3SDGA 3WTUC 1TT5B 4G7ZF 2ZB9A 1A31A 4UVCA 4G7HF 4BGDA 3WU0A 1TWAJ 1LFUP 4E6KG 2KLOA 2DYRH 2DT7B 3AL0C 2V1UA 4XBFA 1I6HJ 1IJWC 5BPIA 3M8JA 4HSRA 3SDBA 5BOXA 2A69F 4UXNA 3LAJA 3SEZA 2XAUA 2CQKA 3A01A 4GRIA 4W1UA 3TKYA 4EV0A 2EV5A 1YE9A 4GCVA 3HZJA 5D5UB 3HYIA 2Y48A 3GF2A 3BPVA 4CSWA 4ABZA 1YS7A 4BE0A 4DJAA 2B0LA 2VL8A 1WZ2A 1ZR4A 4I2OA 2OTJI 1ZARA 2G7HA 3G73A 4Q5SF 4ZYEA 1MGTA 2ME0A 5FLXK 3BR3A 1JT0A 2JSCA 4LIUA 4A6EA 2HKXA 1NH3A 3SZTA 2RNJA 3Q9SA 3G6EI 4BJTA 3ZQFA 2X48A 3HOSA 5L3FA 5CKTA 1QA6A 1G8XA 1I39A 1P2FA 2I10A 3HOYJ 4HV5A 3E5XA 2V9PA 1EH8A 3HRUA 2PN6A 3ZN1A 5HDGA 4LOCA 2HZTA 1YIJI 2CV1A 4U0WA 3H35A 1ZLJA 2CQQA 2QYOA 2OTLI 2DOAA 4EVIA 2J5PA 2HI3A 3GFJA 5JHUA 3QRFF 1IUYA 1VQ8I 3ZMVA 4RB3C 1I3QJ 3VEPA 2F6CA 2ZXJA 2X6XA 3H3VK 4ZTFA 4U7DA 4DGWB 1R6RA 4ON0A 1F36A 1R4NB 5E3LA 3RSNA 1J75A 1GV5A 2R93J 2M7AA 1R5HA 5FO5A 3LFKA 3NWTA 4HQEA 4HQMA 3WG7H 5L3BA 2BE5F 1XGMA 1UJ8A 2BXYA 5K7ZA 4KIGA 4L5EA 2W7NA 5B5EC 3WODF 1QO0D 1HCRA 2OD5A 2UWMA 3GTKJ 2V9VA 1HC8A 1K4SA 2XF6A 1T33A 1WJ5A 4HYEA 4GO1A 4MEYF 3BG5A 1BC8C 1MBJA 4HF2A 1V5GA 4RB1A 4RAYA 3IC7A 1B6AA 2RVCA 3QU3A 3MFKA 2YPRA 2PI0A 2O8XA 1C0WA 3QPLA 2QKLB 4II2A 1W0TA 1ZELA 2HKOA 2V1NA 1P9QC 3W6JB 3LL7A 2O9LA 4O5VA 3OYIA 2H8RA 3L9FA 2HOAA 3H9JA 4BNCA 2L01A 4G6TB 4A3JJ 4LK0F 2IRFG 1KU2A 2YU3A 4MTDA 3ZQLA 2WY8Q 2LNBA 1ETWA 4F93B 2HVRA 3PNVA 4ESFA 1N75A 1SFOJ 5J4YA 3ESWB 2IGMA 2UV1A 3MMYB 3ZMSA 3S32A 4Y4RA 2KZVA 2E1OA 3OS1A 2K9NA 3OYFA 2RNGA 2LKSA 3GUDA 3BR0A 2Y31A 2M5WA 2UXNA 1X58A 5L3DA 3SZGA 4XKCA 1UB9A 4AD9A 3CMEI 3HIFA 4F92B 1YJWI 2EFOA 4GDFA 1FSHA 1MBGA 2Q0OA 3E6CC 2HDCA 1O3QA 3OSGA 1B8IA 5LEJA 2K85A 2A68F 2O6GE 3CCMI 2L9NA 2MABA 4YIIA 5EEAA 3CP2A 4TV7A 1W36C 2V6EA 1FYMA 1IDZA 2VQLA 1B1BA 4NQWB 1TQMA 5F1RA 1JKRC 3PIOF 4L0ZB 4EEFG 4BHPA 1J7KA 1R22A 3I4PA 2WA0A 5HDKA 2MG4A 2JVHA 4ITVA 4Y15A 5IYCJ 1G2HA 5FROA 3TQNA 3WHBA 5FFZA 1UMQA 2O0YA 3ZMUA 3G4SI 1X1DA 4E7HA 3DKXA 4E7KA 2W48A 1RC9A 3IWFA 2A6EF 3PSFA 2DMUA 1F5TA 2FE3A 1EA3A 3SXYA 1JUMA 1K6OA 3HRMA 1WKMA 2QQ9A 1UHWA 4M73A 2R0QC 2MGQA 1D5YA 3W2AA 2ZO4A 4M71A 1Z1DA 4YG2F 3CP8A 4I0BA 4CYCA 2Y9ZA 4CCNA 1WPKA 1U2WA 1BA5A 3L00A 2QF7A 1FOWA 2OQGA 4RAGA 2Q8KA 4RAFA 3MZ8A 3ERMA 2L0KA 4LITA 3MKLA 3RZOJ 1ETKA 2HFHA 1EJ9A 1LPQA 2LP0A 1T08B 2CUEA 5J4VA 1HKSA 1SD7A 4QIWN 2ZBKA 3KYCB 3DPLC 5J40A 5J8CA 1RZ4A 4XNFA 2CMPA 2VJ4A 1ACIA 4C2UA 2VT2A 2FX0A 3RQ4A 5D8KB 3ZXSA 2K7LA 4R8HA 1VNDA 3C7JA 4BBRJ 1B9NA 3GTJJ 1UCRA 4NHJA 3J7ZI 2ZJ2A 4RB2C 1B8IB 3HOVJ 3CF2A 4PJJA 5FKKA 1G59A 1LNWA 1QVTA 3RYRA 1WI3A 2YU9J 3S2DJ 1LDDA 2K3FA 4D5FA 5M5XJ 3PO3J 2VC0A 2F4MB 4E7SA 2OCCH 4I7HA 4OU0A 1TNTA 3DTEA 4F3QA 3WGIA 4GYGA 3OR2C 4EJUA 2EBIA 1SFXA 3FXRA 4CZCA 1A04A 2Y0SN 2ACJA 2A6TA 2XPVA 3WTSC 2PEXA 3E97A 3C2BA 1QNTA 3OYGA 2ELHA 3OL3A 1FT9A 1MMGA 3C18A 3GXOA 3HC7A 3HSRA 5ILSA 3VOEA 3L2VA 4XICA 1ZG1A 2E2IJ 1MZBA 4HBLA 5H6QA 3S1MJ 4ASNA 2MD5A 4IXAA 4L9VA 1HW2A 3L2RA 2EQRA 1YX3A 4HA8A 4BHCA 1FX7A 2QBYB 1UELB 4NDLA 2HDWA 2TCTA 2R5YB 4HX8A 1VQ6I 2V6CA 1P4AA 2V9KA 4EATA 2O03A 4PCQA 3G71I 2R3SA 1FIAA 3K2AA 1I3AA 5HLGA 2PJPA 3K4NA 1JKPC 1E3OC 3LA3A 2H1LA 1S8NA 5J1YA 2LTPA 4KICA 1VQMI 3GLXA 3ZMTA 3VYUB 1FEXA 1MNDA 1B59A 4UUSA 3BOQA 5LRSA 3H1CA 3K1NA 1M1EB 2KP6A 4XM3A 2DT5A 3F8CA 1Z21A 1LVAA 3G3ZA 3S3NA 3OYJA 2F5CA 2CO5A 5FRMA 4ANJA 1ULYA 4FCYA 4UHTA 2CFOA 1U5TB 3HUGB 3S16J 1XSXA 2JK3A 3A02A 2HEOA 1FBSA 5HLTA 3FBNB 4UNOA 2NVUB 4A3CJ 2BV6A 3A0HC 3HG9A 1MJBA 3R60A 3J80Z 2VODA 1IUFA 3CCJI 3E7LA 1E2XA 3OYHA 4LLLA 2Y0SA 2CUZA 4KMFA 2HVQA 3KZYA 4M6XA 4JX4A 1TQIA 1S3JA 2VQCA 3BJ6A 3C2HA 3FXJA 1OKRA 2E1MB 1R49A 3LSPA 1T38A 1IF1A 2Y9YA 1JGGA 3RIRA 3PO2J 4D5CA 1IXCA 1X19A 2ZSIB 4GYIA 2KJCA 4P5OA 3B73A 4HNTA 5JFRA 3KP4A 5L3GA 1ZK8A 1BR4A 3VODA 1Y0NA 4XR6A 2XF5A 1I1GA 5AIPA 1FTZA 1KONA 1LEAA 4AWXB 2L54A 1MMSA 4ZZLA 1H8AC 1KYZA 1HSJA 1YJNI 4BQAA 3JAMZ 1RKTA 5F0CA 2K9LA 5LGTA 3P9KA 5ICFA 2LRDA 2BBYA 3HOTA 2W00A 5HVQC 3CMMA 2XROA 3JSOA 2JUGA 3KIOA 2XF7A 4L0YB 3CJQB 1B4AA 5M3FJ 3DF8A 4FE7A 1FBQA 3D1NI 3M7GA 3I0TA 4PUSA 1PJRA 2VBWA 4HEA2 2JA6J 2G9WA 2KZGA 4JYKA 1BL0A 2V79A 2OV7A 4HG2A 2O7OA 1D1AA 5D5WB 2M0MA 2Q2EA 2LBFB 3ZR8X 1YHQI 3KP7A 3R61A 2LLKA 4RGRA 1TT0A 1HKTA 3LA7A 3F8BA 3WHCA 5LRRA 1X4OA 3MWMA 4RGXA 5J6XA 5ILUA 2J5OA 2Z33A 2KHMA 3WU1B 4EJOA 4A3MJ 3JTHA 4P96A 1BBYA 5D5XB 5FLMJ 2KKOA 3WTXC 4DQ2A 1HLVA 1LDJA 4MFDA 2ZMEC 1QPIA 4LMYA 2GIZA 5DM6F 3EDPA 2RN7A 2DJIA 1G3YA 2XAJA 2BW3B 3HRSA 4X0GA 2A5WA 1PUFA 1G4DA 3W2WA 2VJ5A 2VKVA 1XSVA 5L3EA 3U21A 1QBJA 1JHFA 1YLFA 3J7AY 5L3CA 2ZMEA 2ZCWA 3CUQC 1J0RA 1IC8A 1WSUA 3RPQA 2LDUA 2A61A 1I1SA 1IN8A 2QUFA 2BYVE 1T6SA 3CC2I 2RREA 2CYYA 3QYBA 2LFBA 4RBOA 5JLWA 1IRZA 1NK3P 1O4XA 2IA2A 3CUQA 4B3XA 4FX0A 1VQOI 1FOXA 1GV2A 2VC1A 4M9XA 5KAIC 1KQ8A 1ZKGA 1R1TA 2X6OA 3CESA 3D5SC 4KN4X 3VSKA 3OYEA 3ERED 1SFEA 1FYLA 1D0YA 5CVJA 2OZ6A 4N4NB 1X3UA 4XRFA 1X3ZB 4I09A 2KRFA 1QZYA 2EA4A 5J8FA 2R7UA 3EPZA 3BG7A 2G0EA 1MDMA 2IBDA 2UUZA 2FXAA 3E5QA 1MBKA 4IL6C 3TO9A 5KCMA 1W0UA 3LSHA 4DZJA 2CW7A 4Y17A 5IY5H 2XKPA 3K4CA 5E1ZB 1O7FA 1YRNB 2O8KA 2LG4A 3EUKL 2XGCA 3GW2A 2D45A 5HLIA 2DLLA 3L2WA 2GA2A 2KFDA 3O3KA 1F43A 4X1EA 1V5EA 1HXDA 3LA2A 4B4CA 4N9IA 1IN6A 4H0EA 2JPCA 2Y69H 4BAYA 1WJDA 2R7VA 1S5LC 2W25A 2VKHA 3GCMA 4J00A 2D1VA 5C3EJ 1H9GA 4OMZA 1W5CC 5GADJ 4Z6YA 2MC3A 2MFZA 5JHFA 4JX5A 1BN5A 3M3YJ 1HW1A 4FASD 1U8BA 1PVEA 1XGSA 4IF4A 3F8FA 5A2QK 1B9MA 1P7IA 3NARA 2O5RA 1LE8B 3CC4I 3HGYA 2EPFA 2VQHA 5K5QA 2HQ5A 2L4MA 2HQAA 1VZ0A 4NC8A 5GTHC 4DOZA 2GOMA 4LLNA 3SZPA 1V3FA 2DTZA 1TZLA 3LSTA 1TWHJ 2K9MA 3JRHA 1T0FC 3VPRA 2YR2A 4R1HA 5CVVA 1XB4A 1WRJA 1X1BA 2LD5A 2VONA 2M8GX 2DA2A 2DYSH 5E8GA 4OIPF 2FOWA 2R7OA 2F5EA 1W5SA 2ZNYA 4I0AA 4LG0B 1RIOH 3W6KB 1OISA 3S3OA 4ZYAA 1H9TA 2X1CA 2L9SA 2LOOA 2ETHA 3BTLA 1A35A 2H09A 1UZCA 1T0FA 1HKQA 2OBPA 3I71A 4IKFA 1TC3C 2IS1A 2H6BA 2AXTC 1IG7A 1FTTA 1PP7U 1R5ID 4M74A 3ISPA 5HDNA 2DPDA 1J5YA 3QP5A 1RUNA 1ETYA 3F6VA 5FB2A 3PIPF 1OCOH 3LSMA 5E79C 1IN4A 3AG2H 3ABUA 5JR3A 3ZMZA 2OUMA 2XGDA 2DT6A 1ZAOA 1BOAA 3ZQQA 1ON2A 1FMVA 3KX2A 5EYRA 3N97A 1HA8A 2LY9A 2VIXA 4PJ0C 3ULQB 2E2JJ 4ZDPA 4PGGA 2OZUA 3I56I 3CCRI 4A3GJ 3MKYB 3ZQCA 3J7AO 3PSIA 2ZFUA 4NBQA 2PJRB 2XV4S 4HX4A 4CICA 2GZWA 4CA0A 1E17A 1LB2A 2DFEA 4A69C 2L02A 3DBLB 3DEEA 3TL4X 1OCZH 1H88C 4DW6A 3GTLJ 2YX7A 2HS5A 1HQCA 2GQQA 4ZH4F 2FMYA 3JCUC 4PGHA 2BOLA 3M9AA 3AG3H 2DA4A 5GPCA 2P8TA 3I58A 4WWCA 5EDNA 1AA7A 1KU9A 5TGTA 2ZSHB 3MD2A 2NXNB 1FYKA 2BHZA 4RM2A 3TO7A 3CDLA 4XN3A 2ID6A 3I59B 3EYYA 5CYVA 4A3FJ 1YX5A 3IP4B 4G9YA 4MLOA 3GMEA 2FJ1A 2QQAA 1S7OA 1WJBA 4BQQA 4UUVA 3IUOA 3GTPJ 2Y75A 2OCEA 2JN6A 5EF6A 1KZHA 1U6GA 4CCLA 3F6OA 2P5KA 1DPRA 3DTIA 3TDUC 3M1CA 4S05A 2CG4A 4Y13A 1L0OC 5BPDA 5ICEA 1ZYRF 4L5IA 3E6BA 1XMAA 3QWLA 3HSEA 1W7PB 3K4JA 3MVPA 1LDKB 4JBAA 1BR2A 3H3UA 3VYTB 1LQ1A 3S8PA 4M3GA 3GZNB 1X1PA 1A36A 4IEJA 3O8GA 3BG3A 5JI6A 2X85A 3DPTA 2RC4A 4RGSA 3BR2A 3IKTA 2HU9A 4OIQF 4XMYA 2K40A 4D7MA 4F52A 4J01A 2GM4A 4BY1J 3S1NJ 4M72A 2EV6A 4F91B 4IRGA 1RNLA 3BTJA 4E7LA 1H0MA 2VB6A 2FBIA 2XPUA 4HZFA 2LKPA 3SFZA 4A5NA 2LSOA 2W24A 2HGCA 1YQAA 1ODDA 4KMUX 1X2NA 3HXLA 4I98B 4UV8A 3F23A 4F7ZA 4WXHA 1TL8A 1HSTA 3Q0VA 3CUOA 1IXRC 4KN7X 3V8KA 3WE3A 1JT6A 4BE1A 4IHYA 1NHAA 2EWNA 4FE4A 3S1RJ 3EUHC 3OYKA 4XRSG 2Z5UA 1SEUA 4BXUA 1U9OA 3KP6A 1ZLKA 2LKXA 1DDNA 4HX7A 4Q47A 2VXDA 2NRAC 4I99C 2IGOA 1Z6RA 1USTA 1SAXA 4BKXA 2DN0A 2XIGA 2GBYA 4P55A 1STZA 3I55I 1NK2P 1VQ7I 2W1OA 1CQTA 1H89C 3M07A 4CDGA 4XLFA 3EUHA 4A93J 1DUXC 2G7UA 5M3MJ 4MEXF 1V4RA 2V1XA 4EMSA 4PFPA 4XOPA 3S93A 2XASA 1ZQ3P 4LB6B 4OAZA 1EV7A 4BQNA 4KDPA 2EFNA 3QYEA 5B1BH 5TISC 4NQWA 2X6YA 4AIDA 1FBUA 3FMRA 4OIRF 3LWFA 4L9NA 1G3WA 5M5WJ 4BXXJ 1XC5A 1J59A 3KP3A 4AC0A 1N77A 3J81K 2QVOA 2W4SA 3F8NA 3WTYC 2VOOA 1KA8A 5EG0B 3O2PE 1FWZA 2RAEA 4KIBA 4AU7A 1D0ZA 4NUBA 4IZZA 2MA3A 1FOYA 1WH5A 1MMNA 3BDDA 4JOMA 2EJRA 4XRSA 4BEHA 3P9IA 4RA2A 3H5NA 1AOYA 1JTYA 3BZKA 2WAQN 2XDVA 2VBYA 3AG4H 4C9YA 3IH3A 2HYFA 4B44A 1Y1WJ 3HTUA 1ITYA 1BJAA 3CLOA 2R7TA 2CW8A 3SHFA 4KISA 5LD2C 3RKXA 3BG9A 3B6CA 1V55H 1TNSA 4ESBA 1VI0A 1XCVA 2KRHA 2VI6A 5C4XJ 3TBIA 1XMXA 1WCMJ 2ZJQF 5LGNA 2FOKA 2L7FP 1WJAA 2QM3A 1TWGJ 4G6DA 4IRHA 1MH4A 1VQPI 3RCOA 2QA4I 2NVYJ 2D5VA 1GXQA 3CMAI 4BDYA 5IYDJ 1OJLA 4NB5A 4E4HA 4M3DA 4XK4A 4YFKF 3FX3A 5HS7A 2DMPA 1WVRA 5ICCA 2IA1A 2LREA 2KL4A 4Y7NJ 1AWCA 2FNPA 4B09A 2VKEA 3OYNA 1FSEA 3FXLA 2XRNA 2FMLA 1GVJA 1SVOA 4KUMA 3ZN0A 3DEUA 1Z0XA 4YIFA 5JLXA 1Y6IA 1A6IA 3TOAA 2HOSA 2P5VA 4UY8I 5K1YA 2E1NA 3EQLF 4G7OF 3D5LA 2WBMA 3BJOA 1R7JA 3DPUA 1LEBA 4Y52J 3ZQHA 4A6DA 4BXFA 3M4OJ 2AXLA 4IJAA 4MFEA 4BEHB 3N05A 3LMMA 3CLQA 5D6FA 1HOMA 3HOUJ 1BI3A 2EFQA 2BXZA 3CTAA 4KNYA 4XLCA 1HDDC 2QBYA 2ZFWA 2R5YA 1Z67A 1S72I 3S17J 2OA4A 1OPCA 2GA1A 2WAQA 4QTRA 5IT9Z 3K9TA 1DP7P 2IGNA 1LKXA 2VQGA 2L7MP 2R4GA 4XL9A 1RKWA 2BVLA 1OYWA 2VE8A 3BTIA 3S14J 3TDZC 4CGZA 1U5TC 3L2UA 2BGCA 2MLKA 2DMTA 2XGEA 4RS8A 2CW0F 2R7FA 1YW7A 3HJEA 3KPHA 5E8IA 5F0HA 1VFCA 3FKIJ 3CCVI 1P92A 1ZGJA 2LF8A 2K4JA 2XRLA 2ZXWH 5AONA 5HS9A 3GX4X 2M45A 3FMQA 1WJFA 2PMZA 3V42A 2P5LC 5E17F 2JRMA 2FQ4A 2PG4A 2LC2A 2WB1N 2VBZA 3C1DA 4M6YA 1ZR2A 1U5TA 3CJTB 3HUGA 3KP2A 5LFAA 3FHNA 2E1MC 4I76A 4C3IJ 2ME6A 3RYPA 4IHSA 2DA5A 2QLZA 3K69A 2JQ7A 1F1ZA 2EIKH 1GVDA 2IXSA 1R1VA 3HHHA 3NWSA 3FM3A 2LY2A 2WV0A 3PFIA 5GAEJ 2I8DA 3O6BB 3BPXA 3BC8A 5CVIA 3KP5A 2KQRA 1UAAA 2ESNA 1IZ1A 2E7WA 1ERDA 2JUCA 2DDAA 3CZ6A 2QGUA 2MH2A 2DCEA 3GBGA 1KQ0A 2MBFA 3IV5A 3FZVA 4CHUA 5DYMA 4BQOA 4XLNF 3HM5A 3F8MA 1X3WB 2DMQA 3E0JB 4B1RA 4BACA 3G1MA 1MBHA 4KITB 1J2XA 2ISYA 2CSOA 2IJLA 5LHIA 3JTGA 2L4AA 2FBHA 1RR8C 2OF7A 4GFBA 4ESJA 3RJPA 1GHCA 1MJAA 2KPMA 1T8IA 2AS5F 2NVTJ 4KIFA 1X1CA 4P9FA 5LEKA 3K6GA 4Q48A 2KDOA 1AKHA 5IOZA 2UXXA 1E3HA 3RKWA 1XMKA 2N8GA 1S29A 2P7CB 3MN2A 4EM2A 5FKNA 3BR5A 3W3CA 1Y56A 4PJNA 1W7PD 5K7HA 1Q1VA 5EZHA 1WJEA 1F4KA 4MHGA 2WB1A 1RR7A 2LBFA 2M4KA 2HQNA 3MZHA 2R7QA 1I27A 4II3A 1V5FA 2EV0A 3BZ6A 3HB9A 1WGXA 1OCTC 3OIPA 4RDUA 2HVSA 1JTXA 1TBXA 3IWZA 5HODA 3JRCA 1G3SA 2STWA 4RLFA 3B6AA 3HOWJ 2F2EA 3BP8A 3K1MA 4DZPA 2PMUA 5LHHA 2X51A 4UVAA 4RLQA 1XCBA 4DIQA 4KYWA 1BIAA 1DQUA 1XN7A 1TLHB 2BW3A 4WXDA 1WQ2A 4ENNA 1Q1HA 2CV0A 3HBLA 1DP3A 2E35A 3HEFA 5HNFA 2E60A 2EFWA 4IHTA 3TP3A 1I50J 3KFWX 3MQ0A 1UHMA 3ABMH 1BC7C 4EJWA 3BQZA 4IQ4A 2XSDC 2GOXB 4QLCU 4EJTA 5JVGF 1HDPA 1AKHB 3H0DA 2HYJA 1K79A 3DP7A 1EF4A 4I02A 1BOBA 2WV1A 1MJ9A 2LF7A 2Z9OA 3L09A 3K70D 2M34A 5CQGA 4U0VA 4IX7A 1R00A 2Q1ZB 3LOCA 4PZJA 3MAJA 4L5JA 4IRIA 1EKEA 2B7EA 3V7SA 4ZYDA 5F27A 4GGGA 3CO6C 4A3DJ 2R7XA 2WTEA 3K0LA 4XONA 2HXOA 3DTKA 1YRNA 3DKYA 3FXOA 2W85A 1SMTA 2ZXIA 3PFYA 5DCMB 2ECBA 4C3HJ 1VQ9I 1YTYA 2DODA 4LFUA 2HNHA 3I5UA 4BL0B 4FT8A 4HPQA 1MIJA 1D0XA 2V1DA 2ELKA 1JKQC 4EM0B 3BY6A 1VQLI 2OJED 1EH6A 2NAZA 1K7AA 5F6FA 2ESHA 2VXZA 1TWCJ 1BR1A 5E20A 3WGGA 1LE8A 4G94A 4V2GA 1Y8RB 2P0WA 2KIFA 2E5ZA 3SQNA 1MNEA 2QCOA 5F0FA 4QPOA 3LSIA 1ZRCA 2DI3A 2ZC2A 1JKOC 3J80K 5GTIC 1JI8A 1QPMA 1YIOA 2Y0MA 3IL2A 2VLAA 2ADUA 1GT0C 2JJ7A 2IVMA 3TW7A 2WADA 3KEQA 3ZP5A 2VE9A 1DPUA 3K4BA 5FD5A 2E5NA 3K7AJ 1YW9A 4LG0A 4CCMA 3HRTA 1SD5A 3RQIA 2EIMH 1D8JA 3QOPA 3X2QH 1POGA 2FSWA 1ZG5A 1S7EA 3QU6A 4WX9A 2BY2A 3Q9VA 4DBQA 2A3SA 5D5VB 1NG7A 2IA0A 3HGGA 4HLYA 2WWYA 1LVKA 2AQEA 2HOEA 3A2KA 4JP0A 3ZQIA 3WG9A 4KFCA 3H3ZA 1USSA 2Z3YA 1OYIA 4A0XA 3H5RA 3A1YA 4EGYA 2QEXI 2E1CA 1IDYA 2PLYA 3JAMK 1Y39A 3OIOA 4N9HA 4OWRB 5DS9A 3NQOA 1XSDA 2NNNA 1QQIA 1OR7C 2E7XA 3OYDA 1MH3A 2FRHA 4CCKA 5BS6A 1FP2A 1QZEA 1D1CA 4Z2YA 1U3EM 3BG6A 5KK1A 1OYYA 4ETSA 1TP4A 3TW6A 4NC7A 3FMSA 4BUPA 1YS6A 4M9SA 2QWWA 1OCRH 2KIUA 2XSJC 3I9V2 4OIOF 3MKZA 3S3MA 3T0YA 2QSGX 5FKOA 2AO9A 3I4NJ 3LQQA 3NAUA 2RGVA 1OR7A 3HDDA 1D5VA 4HF0A 1T98A 2PJRA 3CD6I 3PQJA 5FFXA 2F5VA 4OINF 2DXIA 3H9QA 2R92J 5D8LB 2DFIA 4CXFA 2YSRA 1E0EA 1FNNA 1K83J 5BNGA 4H4KC 4ENMA 2NYXA 4ENKA 3PM1A 3J7YJ 1JE8A 2DBBA 2PMHA 3MZYA 4KT5C 1KU3A 2XB0X 4XLHA 5BMZA 4HDUA 3V7CA 2VN2A 1ONVA 2X1EA 4AVZA 3MCZA 5IP7J 2GXAA 4RMNA 3S1QJ 3C2GA 2GAUA 1HW5A 3I3LA 1ZGAA 1N25A 2VKDA 3I59A 3FXQA 1JJ8C 2CQXA 2JTVA 3HPGA 3P7NA 1XX5A 1OFCX 1WH7A 1QU3A 2H1KA 2L9RA 2X0LA 3IRQA 1IRGA 1XDSA 3KZZA 3JRFA 3Q0WA 1GXPA 2OQRA 3LQRA 5FLXZ 2CFXA 5H20A 3GYHX 2DAOA 2MW8A 3ZPLA 2DFFA 5H6RA 3KZIC 2NNYA 3WTZA 4I01A 4AIHA 1S7AA 2CV2A 1W7PA 1IV8A 4MQVA 3E3VA 3F0CA 2Y30A 2BY0A 2LH9A 4BY7J 4LK1F 5E1XA 4CO8A 4IQJA 1K78A 3IKVA 1IN5A 1B72B 4BJ5C 1SFUA 2VPLA 3IAS2 2KT0A 3K4LA 5K7FA 4U0YA 1SVMA 2KISA 4XKWA 1JXSA 1ETOA 2KJBA 2XAHA 4ZTJA 3CCQI 2ELJA 5HLHA 4A0ZA 5DM7F 1BM9A 1PYVA 2VUMJ 3CCEI 3E6DA 1PDNC 3OYLA 4YFXF 3QAHA 1TWFJ 4HNVA 3ECHA 2DA1A 2OPTA 1BI2A 1WFXA 4PDKA 3ZCOA 3E1SA 3LNQA 1CF7A 2DOFA 4R79A 1LFBA 4BDZA 4CH7A 1YOVB 3PNYA 3P5JA 1SMYF 1K61A 2MSYA 3KLOA 2DU9A 4XSZF 2K86A 3RPUD 1Z91A 4O6JA 3K70C 5CLSA 5IP6A 3OL4A 2IS4A 5JVTA 2H6CA 2BY1A 1R71A 2DA6A 2XUBA 3WU2C 4EJVA 1R1UA 4NC6A 4IHVA 5ED4A 1YITI 1FY7A
chains in the Genus database with same CATH topology
4U7BA 1BIBA 3M8EA 2K4BA 5ERIA 3GFIA 3GWZA 5DUIA 2YX4A 1K78B 1KU7A 1G3TA 4LGWA 1U78A 2L3DA 1REPC 5E1WA 1R23A 2VBXA 3NRVA 2EK5A 1I5ZA 3L7WA 4OMYA 3F22A 4UVBA 1TQPA 3CO7C 2ZKZA 1TW3A 1CF7B 3U2RA 3EYIA 5CJ9A 2HWVA 1O3SA 2PBIA 4U88A 2GXGA 4E70A 4ZYGA 1IN7A 5BQTA 3ROUA 1O3TA 1XDUA 3E6MA 3CJNA 5ICGA 1FZPB 2CWEA 1BI0A 2BEOA 2P6TA 3QP6A 5DD4A 4CYDA 3T1BA 2D1HA 3GZ6A 1RI7A 1T2KA 1KGSA 3TO6A 1HBXG 2HTSA 3P9CA 4XSXF 1FP1D 3ML6A 4LJZF 3HHGA 4GXOA 3COAC 2FNAA 3RDIA 5LBQA 3F72A 3M1EA 1F9NA 1FC3A 5E18F 4EGZA 2DK8A 4EM1A 2XHKA 1Z6TA 2X4HA 3DXJF 2K27A 2FEZA 3CDHA 4A5MA 4MGRA 1R5GA 3PQKA 1WI9A 1W5TA 4BYYA 4ZYHA 1R36A 4QWQA 3JSPA 1CGPA 4B8XA 3FXUA 1KYWA 4KA4A 2CGPA 3VFZA 3T8TA 1T39A 1XGNA 3R4KA 3KETA 4LB5A 1Y0UA 2D2WA 5ILVA 1YO5C 2HQRA 2RV8A 3I64A 2TDXA 3BROA 3EETA 1Z7UA 2HTJA 1Z05A 2DW4A 3IRRA 4CZZA 2F5FA 3ABTA 3IHUA 3REOA 2GIVA 3Q5FA 1PUEE 5TRDA 4L18B 4FHTA 4K2EA 2W57A 4EQQA 1O7LA 1WWXA 3E5UA 1W4MA 5DDGA 2M8EA 3D0SA 4IPAA 4AIKA 2O61A 2XVCA 1IRFA 2UZKA 1G6NA 2OU2A 1SD6A 4HLXA 3RPUA 2EFPA 3ZQ7A 5DCFA 3RTRA 4XLPF 4D0PA 1MD0A 1VTNC 2KIMA 1O3RA 3B02A 4S04A 1LJ9A 1OMIA 2VT3A 3KE2A 2VOPA 3KCCA 2JRTA 3V8JA 3GVAA 1QGPA 4WF2A 5TJJA 5FD6A 5CVUA 2A5YB 2XKOA 4JQFA 2ISZA 4RB0A 4MTEA 2GWRA 2M30A 4HV6A 1IXSB 5FGMA 3FF5A 3WE2A 2Z99A 1RUOA 2F5DA 2IW5A 2IT0A 2IP2A 5EEGA 2JPBA 2PFBA 2P7VB 3U9GA 4JK1X 3T8RA 2P6SA 5IT3A 1PP8F 2FA5A 1YFHA 3V4GA 1ZHFA 3ELKA 4WCGA 1P4WA 3F21A 1IW7F 4WK8F 5IT9K 4HF1A 2QZ8A 3ECOA 5D4SA 4RGUA 4FX4A 5DCMA 3DQVC 4AIJA 5LHGA 4A12A 1ZH5A 2DK5A 4DNCA 5DV5A 2H94A 1ZRDA 2RDPA 4M9ZA 3V8LA 5D4RA 2M1BA 1XGOA 4BH9A 3L2CA 4HAMA 2EA2A 2RQPA 4IVNA 3K2ZA 3S2WA 1BI1A 5HS8A 2RKHA 5F64A 5KVRA 2MH9A 3DKWA 1ZREA 3V7RA 4WXCA 4UV9A 3K1PA 1KQ9A 5A2QZ 3HSFA 2QQBA 4BHBA 5AIQA 4HW0A 2WC2A 2OAZA 3R0JA 1Z9CA 1TTYA 1O57A 4LD5A 3LAPA 1UFMA 1QZZA 1XD7A 2A6HF 2P4WA 5DUKA 4YFNF 1ZG3A 2FU4A 4G6QA 6PAXA 4HDVA 2PQ8A 4MQ9F 2DPUA 5LLQA 1IAWA 3GEZA 3KEOA 2C6YA 1SD4A 1L3LA 3BJAA 2STTA 1JGSA 2XAQA 4A2UA 2W84A 4ZZDA 2FQ3A 5EEHA 1U8RA 1D8KA 4O3MA 3ZMDA 1EH7A 3VB2A 1FLIA 3RKYA 3WTTC 4G8XA 3C3WA 2XAFA 1FPQA 3GZ5A 4MNUA 4ENJA 3KLNA 3RI4A 2GXBA 3F3XA 2EB7A 2XGXA 3FM5A 2QENA 1D3YA 5HOOA 3BWGA 2O3FA 3OOPA 1S6LA 4LLGF 1FOKA 4L9JA 4AVPA 2FF4A 3TGNA 2ZMEB 3H92A 3TOBA 3N4MA 2IPQX 1P6RA 3QPHA 5DEQA 3GFMA 3FWEA 2MLGA 2A07F 2FBKA 2JT1A 1YG2A 4A0YA 3I53A 3NEUA 3CUQB 3R0AA 3JW4A 3MEXA 3GO5A 4P9UA 3AAFA 3QPTA 2JZYA 3WTVC 5K5RA 2HYGD 3WGHA 3WTWC 3DV8A 1MDMB 2DTRA 4Q4ZF 1YW8A 2COMA 2DO7A 1JHHA 5CVRA 4OOIA 1P4XA 2ZNZA 2K02A 3DFGA 1R58A 2DQRA 4RAZA 1YYVA 3OV8A 1ON1A 2M87A 3U1DA 2DQLA 5DD8A 4N0BA 2H27A 3T5XA 3GFLA 1ZRFA 1MKMA 1J9IA 1ZN2A 5LGUA 2XAGA 5D6EA 3FHZA 4HOBA 3I54A 1TW2A 2R7DA 3M8FA 5K5OA 3HTSB 4L9TA 2NS0A 1I6XA 2HR3A 3R6SA 3J81Z 3WTUC 4G7ZF 4UVCA 4G7HF 3WU0A 2V1UA 4XBFA 5BPIA 5BOXA 2A69F 4UXNA 3LAJA 2CQKA 3TKYA 4EV0A 2EV5A 4GCVA 5D5UB 3HYIA 2Y48A 3GF2A 3BPVA 1YS7A 2B0LA 4I2OA 1ZARA 2G7HA 3G73A 4Q5SF 4ZYEA 1MGTA 5FLXK 2JSCA 4A6EA 2HKXA 3SZTA 2RNJA 3Q9SA 3HOSA 5L3FA 1P2FA 4HV5A 3E5XA 1EH8A 3HRUA 2PN6A 3ZN1A 5HDGA 2HZTA 4U0WA 1ZLJA 2QYOA 4EVIA 2J5PA 3GFJA 5JHUA 3QRFF 1IUYA 3ZMVA 4RB3C 3VEPA 2ZXJA 4U7DA 4ON0A 1J75A 1R5HA 5FO5A 3LFKA 4HQEA 4HQMA 5L3BA 2BE5F 1XGMA 4KIGA 3WODF 1QO0D 2OD5A 2UWMA 2V9VA 4HYEA 1BC8C 4GO1A 4MEYF 4HF2A 4RB1A 4RAYA 3IC7A 1B6AA 2RVCA 3QU3A 3MFKA 2YPRA 2PI0A 2O8XA 1C0WA 2HKOA 3W6JB 4O5VA 3L9FA 4BNCA 2L01A 4LK0F 2IRFG 1KU2A 2YU3A 4MTDA 2LNBA 4ESFA 3ZMSA 3GUDA 2M5WA 2UXNA 5L3DA 4AD9A 1UB9A 3HIFA 2EFOA 1FSHA 2Q0OA 3E6CC 2HDCA 1O3QA 5LEJA 2A68F 2O6GE 4YIIA 4TV7A 1FYMA 1B1BA 1TQMA 5F1RA 4L0ZB 4BHPA 1J7KA 1R22A 3I4PA 5HDKA 4Y15A 3TQNA 5FFZA 2O0YA 3ZMUA 3IWFA 2A6EF 1F5TA 2FE3A 3SXYA 1K6OA 3HRMA 1WKMA 2QQ9A 1UHWA 4M73A 2ZO4A 4M71A 1Z1DA 4YG2F 4I0BA 1U2WA 3L00A 2OQGA 2Q8KA 2HFHA 1HKSA 1SD7A 2ZBKA 3DPLC 5J8CA 1RZ4A 2VT2A 5D8KB 2K7LA 4R8HA 3C7JA 1B9NA 1UCRA 4NHJA 2ZJ2A 4RB2C 1LNWA 3RYRA 1LDDA 2VC0A 4I7HA 4OU0A 1TNTA 3WGIA 4GYGA 4EJUA 1SFXA 3FXRA 1A04A 2ACJA 3WTSC 2PEXA 3E97A 1QNTA 2ELHA 1FT9A 3C18A 3GXOA 3HSRA 5ILSA 3VOEA 1ZG1A 1MZBA 4HBLA 5H6QA 4ASNA 2MD5A 4IXAA 4L9VA 1HW2A 4HA8A 4BHCA 1FX7A 2QBYB 4HX8A 2V6CA 1P4AA 2O03A 4PCQA 2R3SA 5HLGA 2PJPA 3LA3A 1S8NA 4KICA 3GLXA 3ZMTA 1B59A 3BOQA 5LRSA 3K1NA 2DT5A 3F8CA 1LVAA 3G3ZA 2F5CA 2CO5A 1ULYA 4UHTA 1U5TB 1XSXA 2HEOA 1FBSA 4UNOA 2BV6A 1MJBA 3R60A 3J80Z 2VODA 1E2XA 4LLLA 4KMFA 3KZYA 4M6XA 1TQIA 1S3JA 3BJ6A 1OKRA 1T38A 1IF1A 3RIRA 1IXCA 4GYIA 2KJCA 4P5OA 3B73A 5JFRA 5L3GA 3KP4A 3VODA 1I1GA 5AIPA 1LEAA 4AWXB 2L54A 4ZZLA 1KYZA 1HSJA 4BQAA 3JAMZ 5LGTA 3P9KA 5ICFA 2BBYA 3HOTA 5HVQC 2XROA 3JSOA 4L0YB 1B4AA 3DF8A 1FBQA 3M7GA 3I0TA 2VBWA 2G9WA 2V79A 5D5WB 2Q2EA 3KP7A 3R61A 4RGRA 1HKTA 3LA7A 3F8BA 5LRRA 3MWMA 4RGXA 5J6XA 5ILUA 2J5OA 2Z33A 3WU1B 4EJOA 3JTHA 4P96A 1BBYA 5D5XB 2KKOA 3WTXC 4DQ2A 1LDJA 4LMYA 3EDPA 2RN7A 1G3YA 2XAJA 3HRSA 1G4DA 1XSVA 5L3EA 1QBJA 1JHFA 1YLFA 5L3CA 2ZMEA 2ZCWA 3CUQC 1J0RA 1WSUA 3RPQA 2LDUA 2A61A 1I1SA 1IN8A 2QUFA 2BYVE 1T6SA 2CYYA 2IA2A 3CUQA 4FX0A 2VC1A 4M9XA 1KQ8A 1R1TA 1FYLA 4KN4X 3ERED 1SFEA 5CVJA 2OZ6A 1X3UA 4XRFA 4I09A 2KRFA 1QZYA 2EA4A 5J8FA 1MDMA 3E5QA 2FXAA 3TO9A 4Y17A 2XKPA 5E1ZB 1O7FA 3GW2A 2D45A 5HLIA 2DLLA 2GA2A 3O3KA 1HXDA 3LA2A 4N9IA 4H0EA 1IN6A 2JPCA 4BAYA 2W25A 2D1VA 1H9GA 4OMZA 2MC3A 1BN5A 1HW1A 1XGSA 4IF4A 3F8FA 5A2QK 1B9MA 5K5QA 2L4MA 4LLNA 3SZPA 1V3FA 3LSTA 2YR2A 4R1HA 5CVVA 1XB4A 1WRJA 2VONA 5E8GA 4OIPF 2F5EA 1W5SA 2ZNYA 4I0AA 4LG0B 1RIOH 3W6KB 1H9TA 2ETHA 2H09A 2OBPA 1T0FA 1HKQA 3I71A 2H6BA 1PP7U 4M74A 3ISPA 5HDNA 2DPDA 1J5YA 3QP5A 1RUNA 3F6VA 5FB2A 1IN4A 3ABUA 5JR3A 3ZMZA 1ZAOA 1BOAA 1ON2A 3N97A 3ULQB 4PGGA 2OZUA 3J7AO 2XV4S 4HX4A 4CICA 2GZWA 1E17A 1LB2A 2L02A 2YX7A 2HS5A 1HQCA 2GQQA 4ZH4F 2FMYA 4PGHA 3M9AA 2P8TA 3I58A 4WWCA 1KU9A 1FYKA 3TO7A 3I59B 3EYYA 5CYVA 4G9YA 2QQAA 1S7OA 4UUVA 2Y75A 1U6GA 3F6OA 2P5KA 1DPRA 3TDUC 4S05A 2CG4A 4Y13A 1L0OC 5BPDA 5ICEA 1ZYRF 4L5IA 3E6BA 1XMAA 3HSEA 1W7PB 4JBAA 1LDKB 3H3UA 1LQ1A 5JI6A 3DPTA 2RC4A 4RGSA 3IKTA 4OIQF 4M72A 2EV6A 4IRGA 1RNLA 1H0MA 2FBIA 4HZFA 4A5NA 2LKPA 3SFZA 2LSOA 2W24A 2HGCA 1YQAA 1ODDA 4KMUX 4I98B 4UV8A 3F23A 4F7ZA 4WXHA 1HSTA 3CUOA 1IXRC 4KN7X 3V8KA 3WE3A 1NHAA 2EWNA 2Z5UA 4BXUA 3KP6A 1ZLKA 1DDNA 4HX7A 4Q47A 2NRAC 1Z6RA 1USTA 1SAXA 2XIGA 4P55A 1STZA 4CDGA 3EUHA 1DUXC 2G7UA 4MEXF 1V4RA 2V1XA 4EMSA 2XASA 4LB6B 1EV7A 4KDPA 2EFNA 4NQWA 1FBUA 3FMRA 4OIRF 3LWFA 4L9NA 1G3WA 1J59A 3KP3A 3J81K 2QVOA 3F8NA 3WTYC 2VOOA 1KA8A 3O2PE 1FWZA 4KIBA 2MA3A 3BDDA 2EJRA 3P9IA 1AOYA 2VBYA 2HYFA 3HTUA 1BJAA 3CLOA 3SHFA 3RKXA 4ESBA 1TNSA 1XCVA 5LGNA 2FOKA 2QM3A 4G6DA 4IRHA 1GXQA 4NB5A 4YFKF 3FX3A 5HS7A 5ICCA 2IA1A 1AWCA 2FNPA 4B09A 1FSEA 2XRNA 2FMLA 1GVJA 4KUMA 3ZN0A 3DEUA 4YIFA 3TOAA 2P5VA 4G7OF 5K1YA 2E1NA 3EQLF 3D5LA 3BJOA 1R7JA 1LEBA 4A6DA 2AXLA 4IJAA 5D6FA 1BI3A 2EFQA 3CTAA 4KNYA 2QBYA 2ZFWA 2OA4A 1OPCA 2GA1A 5IT9Z 3K9TA 1DP7P 1OYWA 2VE8A 3TDZC 4CGZA 1U5TC 2BGCA 2MLKA 4RS8A 2CW0F 2R7FA 1YW7A 5E8IA 1P92A 1ZGJA 2LF8A 2K4JA 5AONA 5HS9A 3GX4X 2M45A 3FMQA 5E17F 2P5LC 2PG4A 2VBZA 3C1DA 4M6YA 1U5TA 3HUGA 3KP2A 3RYPA 4IHSA 2QLZA 3K69A 1F1ZA 1R1VA 3HHHA 3FM3A 2WV0A 3PFIA 3O6BB 3BPXA 5CVIA 3KP5A 2ESNA 1IZ1A 2E7WA 2MH2A 1KQ0A 2MBFA 3FZVA 4CHUA 5DYMA 4XLNF 3F8MA 1J2XA 2ISYA 2CSOA 5LHIA 2IJLA 3JTGA 2L4AA 2FBHA 4ESJA 3RJPA 1GHCA 1MJAA 2AS5F 4KIFA 4P9FA 5LEKA 4Q48A 2UXXA 3RKWA 1XMKA 2P7CB 1S29A 4EM2A 1W7PD 1F4KA 4MHGA 2HQNA 3MZHA 1I27A 2EV0A 3BZ6A 1TBXA 3IWZA 1G3SA 2STWA 2F2EA 3BP8A 3K1MA 2PMUA 5LHHA 4UVAA 1XCBA 4KYWA 1BIAA 1XN7A 1TLHB 4WXDA 1WQ2A 4ENNA 1Q1HA 2EFWA 4IHTA 3KFWX 3MQ0A 1UHMA 1BC7C 4EJWA 4QLCU 4EJTA 1K79A 3DP7A 4I02A 1MJ9A 2LF7A 2Z9OA 3L09A 4U0VA 1R00A 4PZJA 3MAJA 4L5JA 4IRIA 3V7SA 4ZYDA 4GGGA 3CO6C 2WTEA 3K0LA 2W85A 1SMTA 5DCMB 1YTYA 4LFUA 3I5UA 4FT8A 2V1DA 4EM0B 3BY6A 1EH6A 2NAZA 1K7AA 5F6FA 2ESHA 2VXZA 5E20A 3WGGA 4G94A 2KIFA 3SQNA 1ZRCA 2DI3A 3J80K 1QPMA 1YIOA 2Y0MA 3IL2A 2ADUA 2IVMA 3KEQA 3ZP5A 2VE9A 1DPUA 5FD5A 1YW9A 4LG0A 3HRTA 1SD5A 1D8JA 3QOPA 2FSWA 1ZG5A 3QU6A 4WX9A 3Q9VA 2A3SA 5D5VB 2IA0A 4HLYA 2WWYA 2HOEA 3WG9A 4KFCA 3H3ZA 1USSA 2Z3YA 1OYIA 4A0XA 4EGYA 2E1CA 2PLYA 3JAMK 4N9HA 1XSDA 3NQOA 2NNNA 1QQIA 2E7XA 2FRHA 5BS6A 1FP2A 4Z2YA 1U3EM 5KK1A 1OYYA 4ETSA 3FMSA 1YS6A 4M9SA 2QWWA 2KIUA 4OIOF 3T0YA 3LQQA 2RGVA 1OR7A 1D5VA 4HF0A 1T98A 3PQJA 5FFXA 4OINF 5D8LB 2DFIA 4CXFA 2YSRA 1FNNA 4ENMA 2NYXA 4ENKA 1JE8A 2DBBA 2PMHA 3MZYA 4KT5C 1KU3A 5BMZA 4HDUA 3V7CA 2VN2A 1ONVA 3MCZA 2GAUA 1HW5A 1ZGAA 3I59A 3FXQA 2JTVA 3P7NA 2X0LA 3IRQA 1IRGA 1XDSA 3KZZA 1GXPA 2OQRA 3LQRA 5FLXZ 2CFXA 5H20A 3GYHX 2DAOA 3ZPLA 5H6RA 2NNYA 3WTZA 4I01A 4AIHA 1S7AA 1W7PA 4MQVA 3E3VA 4LK1F 5E1XA 4CO8A 1K78A 3IKVA 1IN5A 1SFUA 4U0YA 1JXSA 2KJBA 2XAHA 5HLHA 4A0ZA 1BM9A 3E6DA 1PDNC 4YFXF 3QAHA 3ECHA 1BI2A 4PDKA 1CF7A 4R79A 1SMYF 3KLOA 2DU9A 4XSZF 2K86A 1Z91A 4O6JA 5CLSA 5JVTA 2H6CA 2XUBA 4EJVA 1R1UA 5ED4A 1FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7B A;  1BIB A;  3M8E A;  2K4B A;  5ERI A;  3GFI A;  3GWZ A;  5DUI A;  2YX4 A;  1K78 B;  1KU7 A;  1G3T A;  4LGW A;  1U78 A;  2L3D A;  1REP C;  5E1W A;  1R23 A;  2VBX A;  3NRV A;  2EK5 A;  1I5Z A;  3L7W A;  4OMY A;  3F22 A;  4UVB A;  1TQP A;  3CO7 C;  2ZKZ A;  1TW3 A;  1CF7 B;  3U2R A;  3EYI A;  5CJ9 A;  2HWV A;  1O3S A;  2PBI A;  4U88 A;  2GXG A;  4E70 A;  4ZYG A;  1IN7 A;  5BQT A;  3ROU A;  1O3T A;  1XDU A;  3E6M A;  3CJN A;  5ICG A;  1FZP B;  2CWE A;  1BI0 A;  2BEO A;  2P6T A;  3QP6 A;  5DD4 A;  4CYD A;  3T1B A;  2D1H A;  3GZ6 A;  1RI7 A;  1T2K A;  1KGS A;  3TO6 A;  1HBX G;  2HTS A;  3P9C A;  4XSX F;  1FP1 D;  3ML6 A;  4LJZ F;  3HHG A;  4GXO A;  3COA C;  2FNA A;  3RDI A;  5LBQ A;  3F72 A;  3M1E A;  1F9N A;  1FC3 A;  5E18 F;  4EGZ A;  2DK8 A;  4EM1 A;  2XHK A;  1Z6T A;  2X4H A;  3DXJ F;  2K27 A;  2FEZ A;  3CDH A;  4A5M A;  4MGR A;  1R5G A;  3PQK A;  1WI9 A;  1W5T A;  4BYY A;  4ZYH A;  1R36 A;  4QWQ A;  3JSP A;  1CGP A;  4B8X A;  3FXU A;  1KYW A;  4KA4 A;  2CGP A;  3VFZ A;  3T8T A;  1T39 A;  1XGN A;  3R4K A;  3KET A;  4LB5 A;  1Y0U A;  2D2W A;  5ILV A;  1YO5 C;  2HQR A;  2RV8 A;  3I64 A;  2TDX A;  3BRO A;  3EET A;  1Z7U A;  2HTJ A;  1Z05 A;  2DW4 A;  3IRR A;  4CZZ A;  2F5F A;  3ABT A;  3IHU A;  3REO A;  2GIV A;  3Q5F A;  1PUE E;  5TRD A;  4L18 B;  4FHT A;  4K2E A;  2W57 A;  4EQQ A;  1O7L A;  1WWX A;  3E5U A;  1W4M A;  5DDG A;  2M8E A;  3D0S A;  4IPA A;  4AIK A;  2O61 A;  2XVC A;  1IRF A;  2UZK A;  1G6N A;  2OU2 A;  1SD6 A;  4HLX A;  3RPU A;  2EFP A;  3ZQ7 A;  5DCF A;  3RTR A;  4XLP F;  4D0P A;  1MD0 A;  1VTN C;  2KIM A;  1O3R A;  3B02 A;  4S04 A;  1LJ9 A;  1OMI A;  2VT3 A;  3KE2 A;  2VOP A;  3KCC A;  2JRT A;  3V8J A;  3GVA A;  1QGP A;  4WF2 A;  5TJJ A;  5FD6 A;  5CVU A;  2A5Y B;  2XKO A;  4JQF A;  2ISZ A;  4RB0 A;  4MTE A;  2GWR A;  2M30 A;  4HV6 A;  1IXS B;  5FGM A;  3FF5 A;  3WE2 A;  2Z99 A;  1RUO A;  2F5D A;  2IW5 A;  2IT0 A;  2IP2 A;  5EEG A;  2JPB A;  2PFB A;  2P7V B;  3U9G A;  4JK1 X;  3T8R A;  2P6S A;  5IT3 A;  1PP8 F;  2FA5 A;  1YFH A;  3V4G A;  1ZHF A;  3ELK A;  4WCG A;  1P4W A;  3F21 A;  1IW7 F;  4WK8 F;  5IT9 K;  4HF1 A;  2QZ8 A;  3ECO A;  5D4S A;  4RGU A;  4FX4 A;  5DCM A;  3DQV C;  4AIJ A;  5LHG A;  4A12 A;  1ZH5 A;  2DK5 A;  4DNC A;  5DV5 A;  2H94 A;  1ZRD A;  2RDP A;  4M9Z A;  3V8L A;  5D4R A;  2M1B A;  1XGO A;  4BH9 A;  3L2C A;  4HAM A;  2EA2 A;  2RQP A;  4IVN A;  3K2Z A;  3S2W A;  1BI1 A;  5HS8 A;  2RKH A;  5F64 A;  5KVR A;  2MH9 A;  3DKW A;  1ZRE A;  3V7R A;  4WXC A;  4UV9 A;  3K1P A;  1KQ9 A;  5A2Q Z;  3HSF A;  2QQB A;  4BHB A;  5AIQ A;  4HW0 A;  2WC2 A;  2OAZ A;  3R0J A;  1Z9C A;  1TTY A;  1O57 A;  4LD5 A;  3LAP A;  1UFM A;  1QZZ A;  1XD7 A;  2A6H F;  2P4W A;  5DUK A;  4YFN F;  1ZG3 A;  2FU4 A;  4G6Q A;  6PAX A;  4HDV A;  2PQ8 A;  4MQ9 F;  2DPU A;  5LLQ A;  1IAW A;  3GEZ A;  3KEO A;  2C6Y A;  1SD4 A;  1L3L A;  3BJA A;  2STT A;  1JGS A;  2XAQ A;  4A2U A;  2W84 A;  4ZZD A;  2FQ3 A;  5EEH A;  1U8R A;  1D8K A;  4O3M A;  3ZMD A;  1EH7 A;  3VB2 A;  1FLI A;  3RKY A;  3WTT C;  4G8X A;  3C3W A;  2XAF A;  1FPQ A;  3GZ5 A;  4MNU A;  4ENJ A;  3KLN A;  3RI4 A;  2GXB A;  3F3X A;  2EB7 A;  2XGX A;  3FM5 A;  2QEN A;  1D3Y A;  5HOO A;  3BWG A;  2O3F A;  3OOP A;  1S6L A;  4LLG F;  1FOK A;  4L9J A;  4AVP A;  2FF4 A;  3TGN A;  2ZME B;  3H92 A;  3TOB A;  3N4M A;  2IPQ X;  1P6R A;  3QPH A;  5DEQ A;  3GFM A;  3FWE A;  2MLG A;  2A07 F;  2FBK A;  2JT1 A;  1YG2 A;  4A0Y A;  3I53 A;  3NEU A;  3CUQ B;  3R0A A;  3JW4 A;  3MEX A;  3GO5 A;  4P9U A;  3AAF A;  3QPT A;  2JZY A;  3WTV C;  5K5R A;  2HYG D;  3WGH A;  3WTW C;  3DV8 A;  1MDM B;  2DTR A;  4Q4Z F;  1YW8 A;  2COM A;  2DO7 A;  1JHH A;  5CVR A;  4OOI A;  1P4X A;  2ZNZ A;  2K02 A;  3DFG A;  1R58 A;  2DQR A;  4RAZ A;  1YYV A;  3OV8 A;  1ON1 A;  2M87 A;  3U1D A;  2DQL A;  5DD8 A;  4N0B A;  2H27 A;  3T5X A;  3GFL A;  1ZRF A;  1MKM A;  1J9I A;  1ZN2 A;  5LGU A;  2XAG A;  5D6E A;  3FHZ A;  4HOB A;  3I54 A;  1TW2 A;  2R7D A;  3M8F A;  5K5O A;  3HTS B;  4L9T A;  2NS0 A;  1I6X A;  2HR3 A;  3R6S A;  3J81 Z;  3WTU C;  4G7Z F;  4UVC A;  4G7H F;  3WU0 A;  2V1U A;  4XBF A;  5BPI A;  5BOX A;  2A69 F;  4UXN A;  3LAJ A;  2CQK A;  3TKY A;  4EV0 A;  2EV5 A;  4GCV A;  5D5U B;  3HYI A;  2Y48 A;  3GF2 A;  3BPV A;  1YS7 A;  2B0L A;  4I2O A;  1ZAR A;  2G7H A;  3G73 A;  4Q5S F;  4ZYE A;  1MGT A;  5FLX K;  2JSC A;  4A6E A;  2HKX A;  3SZT A;  2RNJ A;  3Q9S A;  3HOS A;  5L3F A;  1P2F A;  4HV5 A;  3E5X A;  1EH8 A;  3HRU A;  2PN6 A;  3ZN1 A;  5HDG A;  2HZT A;  4U0W A;  1ZLJ A;  2QYO A;  4EVI A;  2J5P A;  3GFJ A;  5JHU A;  3QRF F;  1IUY A;  3ZMV A;  4RB3 C;  3VEP A;  2ZXJ A;  4U7D A;  4ON0 A;  1J75 A;  1R5H A;  5FO5 A;  3LFK A;  4HQE A;  4HQM A;  5L3B A;  2BE5 F;  1XGM A;  4KIG A;  3WOD F;  1QO0 D;  2OD5 A;  2UWM A;  2V9V A;  4HYE A;  1BC8 C;  4GO1 A;  4MEY F;  4HF2 A;  4RB1 A;  4RAY A;  3IC7 A;  1B6A A;  2RVC A;  3QU3 A;  3MFK A;  2YPR A;  2PI0 A;  2O8X A;  1C0W A;  2HKO A;  3W6J B;  4O5V A;  3L9F A;  4BNC A;  2L01 A;  4LK0 F;  2IRF G;  1KU2 A;  2YU3 A;  4MTD A;  2LNB A;  4ESF A;  3ZMS A;  3GUD A;  2M5W A;  2UXN A;  5L3D A;  4AD9 A;  1UB9 A;  3HIF A;  2EFO A;  1FSH A;  2Q0O A;  3E6C C;  2HDC A;  1O3Q A;  5LEJ A;  2A68 F;  2O6G E;  4YII A;  4TV7 A;  1FYM A;  1B1B A;  1TQM A;  5F1R A;  4L0Z B;  4BHP A;  1J7K A;  1R22 A;  3I4P A;  5HDK A;  4Y15 A;  3TQN A;  5FFZ A;  2O0Y A;  3ZMU A;  3IWF A;  2A6E F;  1F5T A;  2FE3 A;  3SXY A;  1K6O A;  3HRM A;  1WKM A;  2QQ9 A;  1UHW A;  4M73 A;  2ZO4 A;  4M71 A;  1Z1D A;  4YG2 F;  4I0B A;  1U2W A;  3L00 A;  2OQG A;  2Q8K A;  2HFH A;  1HKS A;  1SD7 A;  2ZBK A;  3DPL C;  5J8C A;  1RZ4 A;  2VT2 A;  5D8K B;  2K7L A;  4R8H A;  3C7J A;  1B9N A;  1UCR A;  4NHJ A;  2ZJ2 A;  4RB2 C;  1LNW A;  3RYR A;  1LDD A;  2VC0 A;  4I7H A;  4OU0 A;  1TNT A;  3WGI A;  4GYG A;  4EJU A;  1SFX A;  3FXR A;  1A04 A;  2ACJ A;  3WTS C;  2PEX A;  3E97 A;  1QNT A;  2ELH A;  1FT9 A;  3C18 A;  3GXO A;  3HSR A;  5ILS A;  3VOE A;  1ZG1 A;  1MZB A;  4HBL A;  5H6Q A;  4ASN A;  2MD5 A;  4IXA A;  4L9V A;  1HW2 A;  4HA8 A;  4BHC A;  1FX7 A;  2QBY B;  4HX8 A;  2V6C A;  1P4A A;  2O03 A;  4PCQ A;  2R3S A;  5HLG A;  2PJP A;  3LA3 A;  1S8N A;  4KIC A;  3GLX A;  3ZMT A;  1B59 A;  3BOQ A;  5LRS A;  3K1N A;  2DT5 A;  3F8C A;  1LVA A;  3G3Z A;  2F5C A;  2CO5 A;  1ULY A;  4UHT A;  1U5T B;  1XSX A;  2HEO A;  1FBS A;  4UNO A;  2BV6 A;  1MJB A;  3R60 A;  3J80 Z;  2VOD A;  1E2X A;  4LLL A;  4KMF A;  3KZY A;  4M6X A;  1TQI A;  1S3J A;  3BJ6 A;  1OKR A;  1T38 A;  1IF1 A;  3RIR A;  1IXC A;  4GYI A;  2KJC A;  4P5O A;  3B73 A;  5JFR A;  5L3G A;  3KP4 A;  3VOD A;  1I1G A;  5AIP A;  1LEA A;  4AWX B;  2L54 A;  4ZZL A;  1KYZ A;  1HSJ A;  4BQA A;  3JAM Z;  5LGT A;  3P9K A;  5ICF A;  2BBY A;  3HOT A;  5HVQ C;  2XRO A;  3JSO A;  4L0Y B;  1B4A A;  3DF8 A;  1FBQ A;  3M7G A;  3I0T A;  2VBW A;  2G9W A;  2V79 A;  5D5W B;  2Q2E A;  3KP7 A;  3R61 A;  4RGR A;  1HKT A;  3LA7 A;  3F8B A;  5LRR A;  3MWM A;  4RGX A;  5J6X A;  5ILU A;  2J5O A;  2Z33 A;  3WU1 B;  4EJO A;  3JTH A;  4P96 A;  1BBY A;  5D5X B;  2KKO A;  3WTX C;  4DQ2 A;  1LDJ A;  4LMY A;  3EDP A;  2RN7 A;  1G3Y A;  2XAJ A;  3HRS A;  1G4D A;  1XSV A;  5L3E A;  1QBJ A;  1JHF A;  1YLF A;  5L3C A;  2ZME A;  2ZCW A;  3CUQ C;  1J0R A;  1WSU A;  3RPQ A;  2LDU A;  2A61 A;  1I1S A;  1IN8 A;  2QUF A;  2BYV E;  1T6S A;  2CYY A;  2IA2 A;  3CUQ A;  4FX0 A;  2VC1 A;  4M9X A;  1KQ8 A;  1R1T A;  1FYL A;  4KN4 X;  3ERE D;  1SFE A;  5CVJ A;  2OZ6 A;  1X3U A;  4XRF A;  4I09 A;  2KRF A;  1QZY A;  2EA4 A;  5J8F A;  1MDM A;  3E5Q A;  2FXA A;  3TO9 A;  4Y17 A;  2XKP A;  5E1Z B;  1O7F A;  3GW2 A;  2D45 A;  5HLI A;  2DLL A;  2GA2 A;  3O3K A;  1HXD A;  3LA2 A;  4N9I A;  4H0E A;  1IN6 A;  2JPC A;  4BAY A;  2W25 A;  2D1V A;  1H9G A;  4OMZ A;  2MC3 A;  1BN5 A;  1HW1 A;  1XGS A;  4IF4 A;  3F8F A;  5A2Q K;  1B9M A;  5K5Q A;  2L4M A;  4LLN A;  3SZP A;  1V3F A;  3LST A;  2YR2 A;  4R1H A;  5CVV A;  1XB4 A;  1WRJ A;  2VON A;  5E8G A;  4OIP F;  2F5E A;  1W5S A;  2ZNY A;  4I0A A;  4LG0 B;  1RIO H;  3W6K B;  1H9T A;  2ETH A;  2H09 A;  2OBP A;  1T0F A;  1HKQ A;  3I71 A;  2H6B A;  1PP7 U;  4M74 A;  3ISP A;  5HDN A;  2DPD A;  1J5Y A;  3QP5 A;  1RUN A;  3F6V A;  5FB2 A;  1IN4 A;  3ABU A;  5JR3 A;  3ZMZ A;  1ZAO A;  1BOA A;  1ON2 A;  3N97 A;  3ULQ B;  4PGG A;  2OZU A;  3J7A O;  2XV4 S;  4HX4 A;  4CIC A;  2GZW A;  1E17 A;  1LB2 A;  2L02 A;  2YX7 A;  2HS5 A;  1HQC A;  2GQQ A;  4ZH4 F;  2FMY A;  4PGH A;  3M9A A;  2P8T A;  3I58 A;  4WWC A;  1KU9 A;  1FYK A;  3TO7 A;  3I59 B;  3EYY A;  5CYV A;  4G9Y A;  2QQA A;  1S7O A;  4UUV A;  2Y75 A;  1U6G A;  3F6O A;  2P5K A;  1DPR A;  3TDU C;  4S05 A;  2CG4 A;  4Y13 A;  1L0O C;  5BPD A;  5ICE A;  1ZYR F;  4L5I A;  3E6B A;  1XMA A;  3HSE A;  1W7P B;  4JBA A;  1LDK B;  3H3U A;  1LQ1 A;  5JI6 A;  3DPT A;  2RC4 A;  4RGS A;  3IKT A;  4OIQ F;  4M72 A;  2EV6 A;  4IRG A;  1RNL A;  1H0M A;  2FBI A;  4HZF A;  4A5N A;  2LKP A;  3SFZ A;  2LSO A;  2W24 A;  2HGC A;  1YQA A;  1ODD A;  4KMU X;  4I98 B;  4UV8 A;  3F23 A;  4F7Z A;  4WXH A;  1HST A;  3CUO A;  1IXR C;  4KN7 X;  3V8K A;  3WE3 A;  1NHA A;  2EWN A;  2Z5U A;  4BXU A;  3KP6 A;  1ZLK A;  1DDN A;  4HX7 A;  4Q47 A;  2NRA C;  1Z6R A;  1UST A;  1SAX A;  2XIG A;  4P55 A;  1STZ A;  4CDG A;  3EUH A;  1DUX C;  2G7U A;  4MEX F;  1V4R A;  2V1X A;  4EMS A;  2XAS A;  4LB6 B;  1EV7 A;  4KDP A;  2EFN A;  4NQW A;  1FBU A;  3FMR A;  4OIR F;  3LWF A;  4L9N A;  1G3W A;  1J59 A;  3KP3 A;  3J81 K;  2QVO A;  3F8N A;  3WTY C;  2VOO A;  1KA8 A;  3O2P E;  1FWZ A;  4KIB A;  2MA3 A;  3BDD A;  2EJR A;  3P9I A;  1AOY A;  2VBY A;  2HYF A;  3HTU A;  1BJA A;  3CLO A;  3SHF A;  3RKX A;  4ESB A;  1TNS A;  1XCV A;  5LGN A;  2FOK A;  2QM3 A;  4G6D A;  4IRH A;  1GXQ A;  4NB5 A;  4YFK F;  3FX3 A;  5HS7 A;  5ICC A;  2IA1 A;  1AWC A;  2FNP A;  4B09 A;  1FSE A;  2XRN A;  2FML A;  1GVJ A;  4KUM A;  3ZN0 A;  3DEU A;  4YIF A;  3TOA A;  2P5V A;  4G7O F;  5K1Y A;  2E1N A;  3EQL F;  3D5L A;  3BJO A;  1R7J A;  1LEB A;  4A6D A;  2AXL A;  4IJA A;  5D6F A;  1BI3 A;  2EFQ A;  3CTA A;  4KNY A;  2QBY A;  2ZFW A;  2OA4 A;  1OPC A;  2GA1 A;  5IT9 Z;  3K9T A;  1DP7 P;  1OYW A;  2VE8 A;  3TDZ C;  4CGZ A;  1U5T C;  2BGC A;  2MLK A;  4RS8 A;  2CW0 F;  2R7F A;  1YW7 A;  5E8I A;  1P92 A;  1ZGJ A;  2LF8 A;  2K4J A;  5AON A;  5HS9 A;  3GX4 X;  2M45 A;  3FMQ A;  5E17 F;  2P5L C;  2PG4 A;  2VBZ A;  3C1D A;  4M6Y A;  1U5T A;  3HUG A;  3KP2 A;  3RYP A;  4IHS A;  2QLZ A;  3K69 A;  1F1Z A;  1R1V A;  3HHH A;  3FM3 A;  2WV0 A;  3PFI A;  3O6B B;  3BPX A;  5CVI A;  3KP5 A;  2ESN A;  1IZ1 A;  2E7W A;  2MH2 A;  1KQ0 A;  2MBF A;  3FZV A;  4CHU A;  5DYM A;  4XLN F;  3F8M A;  1J2X A;  2ISY A;  2CSO A;  5LHI A;  2IJL A;  3JTG A;  2L4A A;  2FBH A;  4ESJ A;  3RJP A;  1GHC A;  1MJA A;  2AS5 F;  4KIF A;  4P9F A;  5LEK A;  4Q48 A;  2UXX A;  3RKW A;  1XMK A;  2P7C B;  1S29 A;  4EM2 A;  1W7P D;  1F4K A;  4MHG A;  2HQN A;  3MZH A;  1I27 A;  2EV0 A;  3BZ6 A;  1TBX A;  3IWZ A;  1G3S A;  2STW A;  2F2E A;  3BP8 A;  3K1M A;  2PMU A;  5LHH A;  4UVA A;  1XCB A;  4KYW A;  1BIA A;  1XN7 A;  1TLH B;  4WXD A;  1WQ2 A;  4ENN A;  1Q1H A;  2EFW A;  4IHT A;  3KFW X;  3MQ0 A;  1UHM A;  1BC7 C;  4EJW A;  4QLC U;  4EJT A;  1K79 A;  3DP7 A;  4I02 A;  1MJ9 A;  2LF7 A;  2Z9O A;  3L09 A;  4U0V A;  1R00 A;  4PZJ A;  3MAJ A;  4L5J A;  4IRI A;  3V7S A;  4ZYD A;  4GGG A;  3CO6 C;  2WTE A;  3K0L A;  2W85 A;  1SMT A;  5DCM B;  1YTY A;  4LFU A;  3I5U A;  4FT8 A;  2V1D A;  4EM0 B;  3BY6 A;  1EH6 A;  2NAZ A;  1K7A A;  5F6F A;  2ESH A;  2VXZ A;  5E20 A;  3WGG A;  4G94 A;  2KIF A;  3SQN A;  1ZRC A;  2DI3 A;  3J80 K;  1QPM A;  1YIO A;  2Y0M A;  3IL2 A;  2ADU A;  2IVM A;  3KEQ A;  3ZP5 A;  2VE9 A;  1DPU A;  5FD5 A;  1YW9 A;  4LG0 A;  3HRT A;  1SD5 A;  1D8J A;  3QOP A;  2FSW A;  1ZG5 A;  3QU6 A;  4WX9 A;  3Q9V A;  2A3S A;  5D5V B;  2IA0 A;  4HLY A;  2WWY A;  2HOE A;  3WG9 A;  4KFC A;  3H3Z A;  1USS A;  2Z3Y A;  1OYI A;  4A0X A;  4EGY A;  2E1C A;  2PLY A;  3JAM K;  4N9H A;  1XSD A;  3NQO A;  2NNN A;  1QQI A;  2E7X A;  2FRH A;  5BS6 A;  1FP2 A;  4Z2Y A;  1U3E M;  5KK1 A;  1OYY A;  4ETS A;  3FMS A;  1YS6 A;  4M9S A;  2QWW A;  2KIU A;  4OIO F;  3T0Y A;  3LQQ A;  2RGV A;  1OR7 A;  1D5V A;  4HF0 A;  1T98 A;  3PQJ A;  5FFX A;  4OIN F;  5D8L B;  2DFI A;  4CXF A;  2YSR A;  1FNN A;  4ENM A;  2NYX A;  4ENK A;  1JE8 A;  2DBB A;  2PMH A;  3MZY A;  4KT5 C;  1KU3 A;  5BMZ A;  4HDU A;  3V7C A;  2VN2 A;  1ONV A;  3MCZ A;  2GAU A;  1HW5 A;  1ZGA A;  3I59 A;  3FXQ A;  2JTV A;  3P7N A;  2X0L A;  3IRQ A;  1IRG A;  1XDS A;  3KZZ A;  1GXP A;  2OQR A;  3LQR A;  5FLX Z;  2CFX A;  5H20 A;  3GYH X;  2DAO A;  3ZPL A;  5H6R A;  2NNY A;  3WTZ A;  4I01 A;  4AIH A;  1S7A A;  1W7P A;  4MQV A;  3E3V A;  4LK1 F;  5E1X A;  4CO8 A;  1K78 A;  3IKV A;  1IN5 A;  1SFU A;  4U0Y A;  1JXS A;  2KJB A;  2XAH A;  5HLH A;  4A0Z A;  1BM9 A;  3E6D A;  1PDN C;  4YFX F;  3QAH A;  3ECH A;  1BI2 A;  4PDK A;  1CF7 A;  4R79 A;  1SMY F;  3KLO A;  2DU9 A;  4XSZ F;  2K86 A;  1Z91 A;  4O6J A;  5CLS A;  5JVT A;  2H6C A;  2XUB A;  4EJV A;  1R1U A;  5ED4 A;  1FY7 A; 
#chains in the Genus database with same CATH topology
 1LFP A;  4XLA A;  3IAM 2;  4U7B A;  1BIB A;  1V54 H;  5FKM A;  1X1A A;  2QQ8 A;  2K4B A;  3M8E A;  5J1U A;  2TRT A;  5ERI A;  2JA8 J;  3GFI A;  4UB6 C;  3DU5 A;  1NG6 A;  4G12 A;  3GWZ A;  2V26 A;  5DUI A;  3A4C A;  2YX4 A;  1K78 B;  1KU7 A;  1G3T A;  4LGW A;  2MD0 A;  1U78 A;  2L3D A;  4PK4 A;  1REP C;  4B47 A;  5E1W A;  5HNH A;  1R23 A;  3GTQ J;  2VBX A;  3FDY A;  3NRV A;  3CC7 I;  2EK5 A;  1I5Z A;  3L7W A;  5EG0 A;  2KMU A;  4OMY A;  1Y8Q B;  3F22 A;  3QQA A;  1TQP A;  3PNT A;  4UVB A;  3CO7 C;  2ZKZ A;  1TW3 A;  2L9V A;  3ZOB A;  2CUJ A;  4KJZ A;  1CF7 B;  3U2R A;  4AYB N;  3EYI A;  1XG1 A;  2EIJ H;  3BR6 A;  3TMO A;  3ASO H;  4PFO A;  3MKW B;  5CJ9 A;  1Z7L A;  2HWV A;  2F48 A;  1O3S A;  1GLN A;  2PBI A;  1APL C;  4HST A;  2E71 A;  4U88 A;  5FKL A;  1MBF A;  4PJM A;  2MC4 A;  2GXG A;  3CJR B;  4E70 A;  3ZQG A;  2M9H A;  4ZYG A;  1QHH D;  1SFK A;  2NVQ J;  1IN7 A;  1OCP A;  3GLL A;  5BQT A;  5F04 A;  2K9Q A;  2JA5 J;  3ROU A;  2H8W A;  2ZJR F;  2XB5 A;  1O3T A;  3SFI A;  1XDU A;  3E6M A;  5IYB J;  4XLE A;  3CJN A;  4S0H B;  3QOE A;  3H9G A;  3A0B C;  5ICG A;  2COB A;  3AKZ A;  4A3E J;  1FZP B;  2CWE A;  1BI0 A;  1MNM C;  2FUG 2;  2BEO A;  4CCO A;  2P6T A;  2YUS A;  4D9J A;  3HOX J;  1D1B A;  2LK2 A;  3G1O A;  3QP6 A;  5DD4 A;  2E19 A;  4CYD A;  3T1B A;  2JSP A;  2D1H A;  3GZ6 A;  1RI7 A;  1XTA A;  1T2K A;  3A01 B;  4C2M J;  4M3E A;  1KGS A;  2CUF A;  3TO6 A;  2VAS A;  2HTS A;  1HBX G;  3P9C A;  4HNU A;  3I4M J;  3AL0 B;  2NS7 A;  4XSX F;  1FP1 D;  3ML6 A;  4LJZ F;  3HHG A;  5B1A H;  2WAF A;  4GXO A;  4LG3 A;  2FNA A;  3ABK H;  3RDI A;  5LBQ A;  3COA C;  3FXM A;  3CCU I;  3F72 A;  3M1E A;  1F9N A;  1IRX A;  3OYC A;  1FC3 A;  3KYD B;  3GTO J;  5E18 F;  4EGZ A;  2DK8 A;  4EM1 A;  2KIQ A;  3FK7 A;  5C44 J;  2XHK A;  3CF5 F;  1Z6T A;  1IGN A;  4C2T A;  4AYB A;  2X4H A;  3DXJ F;  3FXK A;  4XOR A;  2K27 A;  2FEZ A;  3GTG J;  3LSR A;  3CDH A;  4A5M A;  4ZJZ A;  3PUF A;  3UR3 C;  4MGR A;  1R5G A;  1DGW Y;  3PQK A;  1WI9 A;  2BZT A;  4W97 A;  1W5T A;  4BYY A;  2BVM A;  4IO9 F;  4ZYH A;  2EIN H;  1A5J A;  1R36 A;  4QWQ A;  1ZTR A;  5GAH J;  3JSP A;  2PMZ N;  2B9S A;  2IS2 A;  5M5Y J;  1CGP A;  2Z2S B;  4B8X A;  2LVS A;  4OAY A;  3UKG A;  4PSW A;  3FXU A;  1QRY A;  3TP0 A;  4AUX A;  1U9N A;  1KYW A;  4KA4 A;  2CGP A;  1VQK I;  3VFZ A;  3A03 A;  3T8T A;  1AU7 A;  2E34 A;  2XPW A;  3CCY A;  1T39 A;  1XGN A;  3R4K A;  4B43 A;  3KET A;  2HPM A;  3OS2 A;  4LB5 A;  5F08 A;  1Y0U A;  2D2W A;  2HZD A;  1RPW A;  5ILV A;  1YO5 C;  3IH2 A;  2HQR A;  2RV8 A;  3I64 A;  5EZG A;  2TDX A;  3BRO A;  5GPA A;  3EET A;  1Z7U A;  4YEL A;  1GUU A;  4C30 A;  3JRI A;  1A6Q A;  2HTJ A;  2R7R A;  4X6A J;  1Z05 A;  2DW4 A;  1VQ4 I;  1UG0 A;  4HRI A;  1OLT A;  3IRR A;  3K10 A;  1WHU A;  4CZZ A;  2F5F A;  2FD5 A;  3FIS A;  3ABT A;  1RRJ A;  3LSK A;  3IH4 A;  1X2M A;  3IHU A;  1ETQ A;  2VJI A;  3PUB A;  3REO A;  2ZJP F;  2GIV A;  3Q5F A;  2M3A A;  3BTC A;  1PUE E;  2CS3 A;  5J1R A;  3JRG A;  1SVL A;  4XKB A;  4DYC A;  2EZK A;  5TRD A;  4L18 B;  4FHT A;  4K2E A;  2W82 A;  2W57 A;  4EQQ A;  1O7L A;  3F9K A;  1WWX A;  3VWB A;  3E5U A;  1W4M A;  3SEQ A;  5DDG A;  2M8E A;  3D0S A;  3H36 A;  4IPA A;  4BE2 A;  1ZGW A;  1Z3Y A;  3W6V A;  4AIK A;  1RES A;  2O61 A;  2XVC A;  5H2F C;  1IRF A;  2UZK A;  2BHY A;  1G6N A;  1W1W E;  2P81 A;  2OU2 A;  4ZDL A;  1SD6 A;  4HLX A;  3RPU A;  4KT6 A;  2EFP A;  3RZD J;  3ZQ7 A;  1JUS A;  1J09 A;  5DCF A;  3RTR A;  5FLV A;  4XLP F;  4D0P A;  4DYR A;  1MD0 A;  1VTN C;  2KIM A;  4A3L J;  1ORK A;  1O3R A;  4ZC3 A;  3HL2 A;  3B02 A;  9ANT A;  4S04 A;  1LJ9 A;  1OMI A;  2VT3 A;  3K4K A;  3KE2 A;  2VOP A;  3KCC A;  4XID A;  2JRT A;  3V8J A;  1OQY A;  3G2B A;  3GVA A;  1QGP A;  1VF9 A;  2DA3 A;  4WF2 A;  2IAI A;  4YRV A;  4E7J A;  5TJJ A;  3HKZ N;  1R4M B;  4PSX A;  5FD6 A;  2WY7 Q;  5CVU A;  1DU0 A;  2WAE A;  2KRC A;  2ICW G;  4QSH A;  2A5Y B;  3ZRG A;  3H0G J;  4CYC B;  2XKO A;  4JQF A;  1VQN I;  2ISZ A;  2V4J C;  1QVU A;  4RB0 A;  5EJC A;  4MTE A;  2CH0 A;  2GWR A;  2M30 A;  3VYR B;  3OIQ A;  4F55 A;  4HV6 A;  1IXS B;  5FGM A;  3FF5 A;  4Y33 A;  3BQY A;  2Z99 A;  3WE2 A;  1RUO A;  2F5D A;  2IW5 A;  2IT0 A;  2IP2 A;  5EEG A;  2JPB A;  3OSF A;  1MMD A;  4NNJ A;  2PFB A;  2DMN A;  2P7V B;  3BCA A;  3LSJ A;  2JA7 J;  3U9G A;  4JK1 X;  2VPR A;  3T8R A;  2I5U A;  2P6S A;  2A05 A;  5IT3 A;  2IGK A;  1PP8 F;  3D5R C;  4YEJ A;  4D1Q A;  2FA5 A;  3ASN H;  1YFH A;  3V4G A;  3QYF A;  1ZHF A;  1ETX A;  2YS9 A;  2R7S A;  3ELK A;  4FIS A;  4WCG A;  3CCL I;  1P4W A;  1IV6 A;  3F21 A;  1FMW A;  1IW7 F;  4DYQ A;  4WK8 F;  2L7Z A;  4FTH A;  1T56 A;  1SC7 A;  5IT9 K;  2M7B A;  4HF1 A;  1BW6 A;  2QZ8 A;  4DBR A;  3BR1 A;  4BJ6 C;  3G1L A;  4D7N A;  3JRE A;  3ECO A;  5D4S A;  4RGU A;  4FX4 A;  5DCM A;  4V19 K;  3K4M A;  3DQV C;  2R7W A;  2R5Z A;  4AIJ A;  1MW7 A;  5LHG A;  5GAG J;  3PL8 A;  5CPR B;  4A12 A;  1ZH5 A;  1IO2 A;  2QKM B;  3HKZ A;  4XOT A;  2DK5 A;  2K5C A;  4DNC A;  3ZGK A;  5DV5 A;  2H94 A;  2CRG A;  5B66 C;  2JMW A;  5DTD A;  3EUA A;  2NS8 A;  1ZRD A;  2RDP A;  3DCF A;  1MBE A;  4M9Z A;  3V8L A;  5D4R A;  4M6V A;  2M2E A;  2M1B A;  1XGO A;  2F4I A;  4BH9 A;  3AFH A;  3L2C A;  2EZI A;  4HAM A;  3OOU A;  2Y2Z A;  2EA2 A;  2RQP A;  4IVN A;  2EH3 A;  2NOJ B;  3K2Z A;  3S2W A;  5KAF C;  1BI1 A;  2QSF X;  4UUS B;  5HS8 A;  2RKH A;  3BT9 A;  1U0J A;  5F64 A;  5KVR A;  5IPA A;  3VDX A;  5J3L A;  2R7Z J;  2MH9 A;  4IHW A;  3LFU A;  3DKW A;  1ZRE A;  3V7R A;  4WXC A;  4UV9 A;  3K1P A;  1KQ9 A;  1JJ6 C;  5A2Q Z;  4BBS J;  3HOZ J;  3HSF A;  1JUP A;  3BCB A;  2QQB A;  5F1J A;  4BHB A;  4UUT A;  5AIQ A;  4HW0 A;  2WC2 A;  2OAZ A;  2RQQ A;  3R0J A;  2JA2 A;  1Z9C A;  1TTY A;  5E3O A;  1O57 A;  1UG2 A;  4LD5 A;  2R5Z B;  3LAP A;  1UFM A;  2IS6 A;  1QZZ A;  1K4T A;  1XD7 A;  3BLY A;  4BS9 A;  3W2V A;  4IOA F;  4XQF A;  2A6H F;  2L7K A;  2P4W A;  4N4O B;  3QPS A;  5DUK A;  4YFN F;  1ZG3 A;  1GDT A;  1X4P A;  2FU4 A;  2EZH A;  4ZDO A;  2CQ7 A;  4G6Q A;  1T95 A;  2K9S A;  6PAX A;  2AHQ A;  4HDV A;  2PQ8 A;  2DA7 A;  4MQ9 F;  3KEY A;  3JRA A;  4CCJ A;  2ZXH A;  2DPU A;  5LLQ A;  3FBI B;  3OY9 A;  3HPH A;  1IAW A;  3Q3S A;  3GEZ A;  1XPX A;  2DFH A;  3ABL H;  3KEO A;  2JVG A;  4XKV A;  3S15 J;  1YI2 I;  2C6Y A;  1SD4 A;  1L3L A;  3DBH B;  3RKQ A;  3BJA A;  3H5A A;  4JX6 A;  2STT A;  3SJM A;  2GLO A;  2CJJ A;  5KNL A;  4J19 A;  4B48 A;  1JGS A;  1NTC A;  2XAQ A;  4A2U A;  5GP9 A;  4A3I J;  3OR1 C;  2W84 A;  4ZZD A;  2FQ3 A;  2B63 J;  3LSG A;  4V2F A;  5EEH A;  1U8R A;  1OCC H;  1FIP A;  4A3K J;  2VJJ A;  4B3A A;  3Q0U A;  1D8K A;  4O3M A;  3ZMD A;  1K6Y A;  4U87 A;  4PJL A;  5KHD A;  1EH7 A;  3VB2 A;  1BJZ A;  2ID3 A;  2M0C A;  3RKY A;  1N78 A;  1FLI A;  5EGO A;  2NOG A;  2K3P A;  2AQF A;  3WTT C;  4G8X A;  3C3W A;  2XAF A;  1FPQ A;  5C4J J;  3GZ5 A;  4MNU A;  1UHS A;  2Q2E B;  4ENJ A;  3OYA A;  4IHX A;  3KLN A;  4Y3O A;  3CCS I;  4IOC F;  2MYS A;  4RM3 A;  4M3F A;  3JR9 A;  3VYS B;  1AHD P;  3CMY A;  3RI4 A;  3L1P A;  1FJL A;  2GXB A;  1E3P A;  3DLA A;  3F3X A;  2EB7 A;  1SAN A;  2XGX A;  3FM5 A;  3L2Q A;  3UNG C;  2CU7 A;  2QEN A;  1Y1V J;  1D3Y A;  5HOO A;  3BWG A;  1B72 A;  2M4G A;  2O3F A;  3OOP A;  1S6L A;  4LLG F;  2EIL H;  4MO7 A;  1FOK A;  4L9J A;  4AVP A;  1PUF B;  2KDZ A;  2FF4 A;  2X6W A;  1Z3X A;  2HXI A;  3TGN A;  2HPI A;  1SAU A;  4LIV A;  3VSL A;  3O8H A;  2ZME B;  3H92 A;  3GTM J;  1DGR M;  3TOB A;  3N4M A;  2IPQ X;  4UB8 C;  1P7J A;  1MMA A;  1P6R A;  3QPH A;  2Z1D A;  5FRN A;  5DEQ A;  3GFM A;  1MSF C;  3FWE A;  4XRM A;  2PX9 A;  2MLG A;  2A07 F;  5FJ8 J;  5IP9 J;  3DWL E;  2FBK A;  2JT1 A;  4BU2 A;  1YG2 A;  4A0Y A;  2DJN A;  3I53 A;  3NEU A;  2OC6 A;  2IEK A;  3CUQ B;  3R0A A;  3FKJ A;  4C3J J;  5B3S H;  3JW4 A;  3MEX A;  5EGO B;  1S9H A;  3GO5 A;  3ONQ A;  5J47 A;  4FQG A;  4P9U A;  2DDB A;  3QPT A;  2JZY A;  3AAF A;  3WTV C;  3S2H J;  5K5R A;  3KYL A;  3CDI A;  2CQN A;  2LYC A;  2E36 A;  1HF0 A;  2HYG D;  2LR8 A;  3WGH A;  1BW5 A;  1XS9 A;  3QOD A;  4P1W A;  3WTW C;  4E7Z A;  3DV8 A;  1MDM B;  3JRB A;  2DTR A;  4Q4Z F;  3U1K A;  1DU6 A;  1YW8 A;  2LMD A;  3DU6 A;  2COM A;  2DO7 A;  3CQZ J;  3OS0 A;  1JHH A;  2EZL A;  4OOI A;  2DOE A;  5CVR A;  2HOT A;  3AG1 H;  2L2O A;  1P4X A;  2ZNZ A;  2XC7 A;  2HDD A;  4E7I A;  3OWT A;  3TED A;  2K02 A;  4YIR X;  5E3N A;  1W36 D;  4A3B J;  2NVX J;  3DFG A;  1R58 A;  2DQR A;  1RET A;  4RAZ A;  1QHG A;  3FK6 A;  1YYV A;  1LUJ B;  3OV8 A;  1ON1 A;  1YJ9 I;  2F4O B;  2M87 A;  3U1D A;  2DQL A;  5DD8 A;  2JWT A;  3OYB A;  4N0B A;  2H27 A;  1Z77 A;  4CUG A;  3BZC A;  3FIW A;  3T5X A;  3GFL A;  1ZRF A;  2E2H J;  1MKM A;  1J9I A;  2QSH X;  5IOY A;  2L5Q A;  1ZN2 A;  5LGU A;  2XAG A;  1R9T J;  5CQE A;  4AM3 A;  5D6E A;  4M3B A;  1MSE C;  4MIM A;  3FHZ A;  3DBR B;  3JRD A;  1VQ5 I;  4I6Z A;  1ETV A;  4HOB A;  1ENH A;  2ECC A;  3I54 A;  3DLL F;  3OMY A;  3SYT A;  3OYM A;  1WJC A;  4XN0 A;  1TW2 A;  2R7D A;  3M8F A;  5K5O A;  2V7F A;  3PJR A;  4QPQ A;  3HTS B;  4L9T A;  2X1D A;  2BY3 A;  2NS0 A;  1I6X A;  2Z16 A;  3DEW A;  2HR3 A;  5E3M A;  2X9D A;  3R6S A;  2LY1 A;  3J81 Z;  4FET A;  3SDG A;  3WTU C;  1TT5 B;  4G7Z F;  2ZB9 A;  1A31 A;  4UVC A;  4G7H F;  4BGD A;  3WU0 A;  1TWA J;  1LFU P;  4E6K G;  2KLO A;  2DYR H;  2DT7 B;  3AL0 C;  2V1U A;  4XBF A;  1I6H J;  1IJW C;  5BPI A;  3M8J A;  4HSR A;  3SDB A;  5BOX A;  2A69 F;  4UXN A;  3LAJ A;  3SEZ A;  2XAU A;  2CQK A;  3A01 A;  4GRI A;  4W1U A;  3TKY A;  4EV0 A;  2EV5 A;  1YE9 A;  4GCV A;  3HZJ A;  5D5U B;  3HYI A;  2Y48 A;  3GF2 A;  3BPV A;  4CSW A;  4ABZ A;  1YS7 A;  4BE0 A;  4DJA A;  2B0L A;  2VL8 A;  1WZ2 A;  1ZR4 A;  4I2O A;  2OTJ I;  1ZAR A;  2G7H A;  3G73 A;  4Q5S F;  4ZYE A;  1MGT A;  2ME0 A;  5FLX K;  3BR3 A;  1JT0 A;  2JSC A;  4LIU A;  4A6E A;  2HKX A;  1NH3 A;  3SZT A;  2RNJ A;  3Q9S A;  3G6E I;  4BJT A;  3ZQF A;  2X48 A;  3HOS A;  5L3F A;  5CKT A;  1QA6 A;  1G8X A;  1I39 A;  1P2F A;  2I10 A;  3HOY J;  4HV5 A;  3E5X A;  2V9P A;  1EH8 A;  3HRU A;  2PN6 A;  3ZN1 A;  5HDG A;  4LOC A;  2HZT A;  1YIJ I;  2CV1 A;  4U0W A;  3H35 A;  1ZLJ A;  2CQQ A;  2QYO A;  2OTL I;  2DOA A;  4EVI A;  2J5P A;  2HI3 A;  3GFJ A;  5JHU A;  3QRF F;  1IUY A;  1VQ8 I;  3ZMV A;  4RB3 C;  1I3Q J;  3VEP A;  2F6C A;  2ZXJ A;  2X6X A;  3H3V K;  4ZTF A;  4U7D A;  4DGW B;  1R6R A;  4ON0 A;  1F36 A;  1R4N B;  5E3L A;  3RSN A;  1J75 A;  1GV5 A;  2R93 J;  2M7A A;  1R5H A;  5FO5 A;  3LFK A;  3NWT A;  4HQE A;  4HQM A;  3WG7 H;  5L3B A;  2BE5 F;  1XGM A;  1UJ8 A;  2BXY A;  5K7Z A;  4KIG A;  4L5E A;  2W7N A;  5B5E C;  3WOD F;  1QO0 D;  1HCR A;  2OD5 A;  2UWM A;  3GTK J;  2V9V A;  1HC8 A;  1K4S A;  2XF6 A;  1T33 A;  1WJ5 A;  4HYE A;  4GO1 A;  4MEY F;  3BG5 A;  1BC8 C;  1MBJ A;  4HF2 A;  1V5G A;  4RB1 A;  4RAY A;  3IC7 A;  1B6A A;  2RVC A;  3QU3 A;  3MFK A;  2YPR A;  2PI0 A;  2O8X A;  1C0W A;  3QPL A;  2QKL B;  4II2 A;  1W0T A;  1ZEL A;  2HKO A;  2V1N A;  1P9Q C;  3W6J B;  3LL7 A;  2O9L A;  4O5V A;  3OYI A;  2H8R A;  3L9F A;  2HOA A;  3H9J A;  4BNC A;  2L01 A;  4G6T B;  4A3J J;  4LK0 F;  2IRF G;  1KU2 A;  2YU3 A;  4MTD A;  3ZQL A;  2WY8 Q;  2LNB A;  1ETW A;  4F93 B;  2HVR A;  3PNV A;  4ESF A;  1N75 A;  1SFO J;  5J4Y A;  3ESW B;  2IGM A;  2UV1 A;  3MMY B;  3ZMS A;  3S32 A;  4Y4R A;  2KZV A;  2E1O A;  3OS1 A;  2K9N A;  3OYF A;  2RNG A;  2LKS A;  3GUD A;  3BR0 A;  2Y31 A;  2M5W A;  2UXN A;  1X58 A;  5L3D A;  3SZG A;  4XKC A;  1UB9 A;  4AD9 A;  3CME I;  3HIF A;  4F92 B;  1YJW I;  2EFO A;  4GDF A;  1FSH A;  1MBG A;  2Q0O A;  3E6C C;  2HDC A;  1O3Q A;  3OSG A;  1B8I A;  5LEJ A;  2K85 A;  2A68 F;  2O6G E;  3CCM I;  2L9N A;  2MAB A;  4YII A;  5EEA A;  3CP2 A;  4TV7 A;  1W36 C;  2V6E A;  1FYM A;  1IDZ A;  2VQL A;  1B1B A;  4NQW B;  1TQM A;  5F1R A;  1JKR C;  3PIO F;  4L0Z B;  4EEF G;  4BHP A;  1J7K A;  1R22 A;  3I4P A;  2WA0 A;  5HDK A;  2MG4 A;  2JVH A;  4ITV A;  4Y15 A;  5IYC J;  1G2H A;  5FRO A;  3TQN A;  3WHB A;  5FFZ A;  1UMQ A;  2O0Y A;  3ZMU A;  3G4S I;  1X1D A;  4E7H A;  3DKX A;  4E7K A;  2W48 A;  1RC9 A;  3IWF A;  2A6E F;  3PSF A;  2DMU A;  1F5T A;  2FE3 A;  1EA3 A;  3SXY A;  1JUM A;  1K6O A;  3HRM A;  1WKM A;  2QQ9 A;  1UHW A;  4M73 A;  2R0Q C;  2MGQ A;  1D5Y A;  3W2A A;  2ZO4 A;  4M71 A;  1Z1D A;  4YG2 F;  3CP8 A;  4I0B A;  4CYC A;  2Y9Z A;  4CCN A;  1WPK A;  1U2W A;  1BA5 A;  3L00 A;  2QF7 A;  1FOW A;  2OQG A;  4RAG A;  2Q8K A;  4RAF A;  3MZ8 A;  3ERM A;  2L0K A;  4LIT A;  3MKL A;  3RZO J;  1ETK A;  2HFH A;  1EJ9 A;  1LPQ A;  2LP0 A;  1T08 B;  2CUE A;  5J4V A;  1HKS A;  1SD7 A;  4QIW N;  2ZBK A;  3KYC B;  3DPL C;  5J40 A;  5J8C A;  1RZ4 A;  4XNF A;  2CMP A;  2VJ4 A;  1ACI A;  4C2U A;  2VT2 A;  2FX0 A;  3RQ4 A;  5D8K B;  3ZXS A;  2K7L A;  4R8H A;  1VND A;  3C7J A;  4BBR J;  1B9N A;  3GTJ J;  1UCR A;  4NHJ A;  3J7Z I;  2ZJ2 A;  4RB2 C;  1B8I B;  3HOV J;  3CF2 A;  4PJJ A;  5FKK A;  1G59 A;  1LNW A;  1QVT A;  3RYR A;  1WI3 A;  2YU9 J;  3S2D J;  1LDD A;  2K3F A;  4D5F A;  5M5X J;  3PO3 J;  2VC0 A;  2F4M B;  4E7S A;  2OCC H;  4I7H A;  4OU0 A;  1TNT A;  3DTE A;  4F3Q A;  3WGI A;  4GYG A;  3OR2 C;  4EJU A;  2EBI A;  1SFX A;  3FXR A;  4CZC A;  1A04 A;  2Y0S N;  2ACJ A;  2A6T A;  2XPV A;  3WTS C;  2PEX A;  3E97 A;  3C2B A;  1QNT A;  3OYG A;  2ELH A;  3OL3 A;  1FT9 A;  1MMG A;  3C18 A;  3GXO A;  3HC7 A;  3HSR A;  5ILS A;  3VOE A;  3L2V A;  4XIC A;  1ZG1 A;  2E2I J;  1MZB A;  4HBL A;  5H6Q A;  3S1M J;  4ASN A;  2MD5 A;  4IXA A;  4L9V A;  1HW2 A;  3L2R A;  2EQR A;  1YX3 A;  4HA8 A;  4BHC A;  1FX7 A;  2QBY B;  1UEL B;  4NDL A;  2HDW A;  2TCT A;  2R5Y B;  4HX8 A;  1VQ6 I;  2V6C A;  1P4A A;  2V9K A;  4EAT A;  2O03 A;  4PCQ A;  3G71 I;  2R3S A;  1FIA A;  3K2A A;  1I3A A;  5HLG A;  2PJP A;  3K4N A;  1JKP C;  1E3O C;  3LA3 A;  2H1L A;  1S8N A;  5J1Y A;  2LTP A;  4KIC A;  1VQM I;  3GLX A;  3ZMT A;  3VYU B;  1FEX A;  1MND A;  1B59 A;  4UUS A;  3BOQ A;  5LRS A;  3H1C A;  3K1N A;  1M1E B;  2KP6 A;  4XM3 A;  2DT5 A;  3F8C A;  1Z21 A;  1LVA A;  3G3Z A;  3S3N A;  3OYJ A;  2F5C A;  2CO5 A;  5FRM A;  4ANJ A;  1ULY A;  4FCY A;  4UHT A;  2CFO A;  1U5T B;  3HUG B;  3S16 J;  1XSX A;  2JK3 A;  3A02 A;  2HEO A;  1FBS A;  5HLT A;  3FBN B;  4UNO A;  2NVU B;  4A3C J;  2BV6 A;  3A0H C;  3HG9 A;  1MJB A;  3R60 A;  3J80 Z;  2VOD A;  1IUF A;  3CCJ I;  3E7L A;  1E2X A;  3OYH A;  4LLL A;  2Y0S A;  2CUZ A;  4KMF A;  2HVQ A;  3KZY A;  4M6X A;  4JX4 A;  1TQI A;  1S3J A;  2VQC A;  3BJ6 A;  3C2H A;  3FXJ A;  1OKR A;  2E1M B;  1R49 A;  3LSP A;  1T38 A;  1IF1 A;  2Y9Y A;  1JGG A;  3RIR A;  3PO2 J;  4D5C A;  1IXC A;  1X19 A;  2ZSI B;  4GYI A;  2KJC A;  4P5O A;  3B73 A;  4HNT A;  5JFR A;  3KP4 A;  5L3G A;  1ZK8 A;  1BR4 A;  3VOD A;  1Y0N A;  4XR6 A;  2XF5 A;  1I1G A;  5AIP A;  1FTZ A;  1KON A;  1LEA A;  4AWX B;  2L54 A;  1MMS A;  4ZZL A;  1H8A C;  1KYZ A;  1HSJ A;  1YJN I;  4BQA A;  3JAM Z;  1RKT A;  5F0C A;  2K9L A;  5LGT A;  3P9K A;  5ICF A;  2LRD A;  2BBY A;  3HOT A;  2W00 A;  5HVQ C;  3CMM A;  2XRO A;  3JSO A;  2JUG A;  3KIO A;  2XF7 A;  4L0Y B;  3CJQ B;  1B4A A;  5M3F J;  3DF8 A;  4FE7 A;  1FBQ A;  3D1N I;  3M7G A;  3I0T A;  4PUS A;  1PJR A;  2VBW A;  4HEA 2;  2JA6 J;  2G9W A;  2KZG A;  4JYK A;  1BL0 A;  2V79 A;  2OV7 A;  4HG2 A;  2O7O A;  1D1A A;  5D5W B;  2M0M A;  2Q2E A;  2LBF B;  3ZR8 X;  1YHQ I;  3KP7 A;  3R61 A;  2LLK A;  4RGR A;  1TT0 A;  1HKT A;  3LA7 A;  3F8B A;  3WHC A;  5LRR A;  1X4O A;  3MWM A;  4RGX A;  5J6X A;  5ILU A;  2J5O A;  2Z33 A;  2KHM A;  3WU1 B;  4EJO A;  4A3M J;  3JTH A;  4P96 A;  1BBY A;  5D5X B;  5FLM J;  2KKO A;  3WTX C;  4DQ2 A;  1HLV A;  1LDJ A;  4MFD A;  2ZME C;  1QPI A;  4LMY A;  2GIZ A;  5DM6 F;  3EDP A;  2RN7 A;  2DJI A;  1G3Y A;  2XAJ A;  2BW3 B;  3HRS A;  4X0G A;  2A5W A;  1PUF A;  1G4D A;  3W2W A;  2VJ5 A;  2VKV A;  1XSV A;  5L3E A;  3U21 A;  1QBJ A;  1JHF A;  1YLF A;  3J7A Y;  5L3C A;  2ZME A;  2ZCW A;  3CUQ C;  1J0R A;  1IC8 A;  1WSU A;  3RPQ A;  2LDU A;  2A61 A;  1I1S A;  1IN8 A;  2QUF A;  2BYV E;  1T6S A;  3CC2 I;  2RRE A;  2CYY A;  3QYB A;  2LFB A;  4RBO A;  5JLW A;  1IRZ A;  1NK3 P;  1O4X A;  2IA2 A;  3CUQ A;  4B3X A;  4FX0 A;  1VQO I;  1FOX A;  1GV2 A;  2VC1 A;  4M9X A;  5KAI C;  1KQ8 A;  1ZKG A;  1R1T A;  2X6O A;  3CES A;  3D5S C;  4KN4 X;  3VSK A;  3OYE A;  3ERE D;  1SFE A;  1FYL A;  1D0Y A;  5CVJ A;  2OZ6 A;  4N4N B;  1X3U A;  4XRF A;  1X3Z B;  4I09 A;  2KRF A;  1QZY A;  2EA4 A;  5J8F A;  2R7U A;  3EPZ A;  3BG7 A;  2G0E A;  1MDM A;  2IBD A;  2UUZ A;  2FXA A;  3E5Q A;  1MBK A;  4IL6 C;  3TO9 A;  5KCM A;  1W0U A;  3LSH A;  4DZJ A;  2CW7 A;  4Y17 A;  5IY5 H;  2XKP A;  3K4C A;  5E1Z B;  1O7F A;  1YRN B;  2O8K A;  2LG4 A;  3EUK L;  2XGC A;  3GW2 A;  2D45 A;  5HLI A;  2DLL A;  3L2W A;  2GA2 A;  2KFD A;  3O3K A;  1F43 A;  4X1E A;  1V5E A;  1HXD A;  3LA2 A;  4B4C A;  4N9I A;  1IN6 A;  4H0E A;  2JPC A;  2Y69 H;  4BAY A;  1WJD A;  2R7V A;  1S5L C;  2W25 A;  2VKH A;  3GCM A;  4J00 A;  2D1V A;  5C3E J;  1H9G A;  4OMZ A;  1W5C C;  5GAD J;  4Z6Y A;  2MC3 A;  2MFZ A;  5JHF A;  4JX5 A;  1BN5 A;  3M3Y J;  1HW1 A;  4FAS D;  1U8B A;  1PVE A;  1XGS A;  4IF4 A;  3F8F A;  5A2Q K;  1B9M A;  1P7I A;  3NAR A;  2O5R A;  1LE8 B;  3CC4 I;  3HGY A;  2EPF A;  2VQH A;  5K5Q A;  2HQ5 A;  2L4M A;  2HQA A;  1VZ0 A;  4NC8 A;  5GTH C;  4DOZ A;  2GOM A;  4LLN A;  3SZP A;  1V3F A;  2DTZ A;  1TZL A;  3LST A;  1TWH J;  2K9M A;  3JRH A;  1T0F C;  3VPR A;  2YR2 A;  4R1H A;  5CVV A;  1XB4 A;  1WRJ A;  1X1B A;  2LD5 A;  2VON A;  2M8G X;  2DA2 A;  2DYS H;  5E8G A;  4OIP F;  2FOW A;  2R7O A;  2F5E A;  1W5S A;  2ZNY A;  4I0A A;  4LG0 B;  1RIO H;  3W6K B;  1OIS A;  3S3O A;  4ZYA A;  1H9T A;  2X1C A;  2L9S A;  2LOO A;  2ETH A;  3BTL A;  1A35 A;  2H09 A;  1UZC A;  1T0F A;  1HKQ A;  2OBP A;  3I71 A;  4IKF A;  1TC3 C;  2IS1 A;  2H6B A;  2AXT C;  1IG7 A;  1FTT A;  1PP7 U;  1R5I D;  4M74 A;  3ISP A;  5HDN A;  2DPD A;  1J5Y A;  3QP5 A;  1RUN A;  1ETY A;  3F6V A;  5FB2 A;  3PIP F;  1OCO H;  3LSM A;  5E79 C;  1IN4 A;  3AG2 H;  3ABU A;  5JR3 A;  3ZMZ A;  2OUM A;  2XGD A;  2DT6 A;  1ZAO A;  1BOA A;  3ZQQ A;  1ON2 A;  1FMV A;  3KX2 A;  5EYR A;  3N97 A;  1HA8 A;  2LY9 A;  2VIX A;  4PJ0 C;  3ULQ B;  2E2J J;  4ZDP A;  4PGG A;  2OZU A;  3I56 I;  3CCR I;  4A3G J;  3MKY B;  3ZQC A;  3J7A O;  3PSI A;  2ZFU A;  4NBQ A;  2PJR B;  2XV4 S;  4HX4 A;  4CIC A;  2GZW A;  4CA0 A;  1E17 A;  1LB2 A;  2DFE A;  4A69 C;  2L02 A;  3DBL B;  3DEE A;  3TL4 X;  1OCZ H;  1H88 C;  4DW6 A;  3GTL J;  2YX7 A;  2HS5 A;  1HQC A;  2GQQ A;  4ZH4 F;  2FMY A;  3JCU C;  4PGH A;  2BOL A;  3M9A A;  3AG3 H;  2DA4 A;  5GPC A;  2P8T A;  3I58 A;  4WWC A;  5EDN A;  1AA7 A;  1KU9 A;  5TGT A;  2ZSH B;  3MD2 A;  2NXN B;  1FYK A;  2BHZ A;  4RM2 A;  3TO7 A;  3CDL A;  4XN3 A;  2ID6 A;  3I59 B;  3EYY A;  5CYV A;  4A3F J;  1YX5 A;  3IP4 B;  4G9Y A;  4MLO A;  3GME A;  2FJ1 A;  2QQA A;  1S7O A;  1WJB A;  4BQQ A;  4UUV A;  3IUO A;  3GTP J;  2Y75 A;  2OCE A;  2JN6 A;  5EF6 A;  1KZH A;  1U6G A;  4CCL A;  3F6O A;  2P5K A;  1DPR A;  3DTI A;  3TDU C;  3M1C A;  4S05 A;  2CG4 A;  4Y13 A;  1L0O C;  5BPD A;  5ICE A;  1ZYR F;  4L5I A;  3E6B A;  1XMA A;  3QWL A;  3HSE A;  1W7P B;  3K4J A;  3MVP A;  1LDK B;  4JBA A;  1BR2 A;  3H3U A;  3VYT B;  1LQ1 A;  3S8P A;  4M3G A;  3GZN B;  1X1P A;  1A36 A;  4IEJ A;  3O8G A;  3BG3 A;  5JI6 A;  2X85 A;  3DPT A;  2RC4 A;  4RGS A;  3BR2 A;  3IKT A;  2HU9 A;  4OIQ F;  4XMY A;  2K40 A;  4D7M A;  4F52 A;  4J01 A;  2GM4 A;  4BY1 J;  3S1N J;  4M72 A;  2EV6 A;  4F91 B;  4IRG A;  1RNL A;  3BTJ A;  4E7L A;  1H0M A;  2VB6 A;  2FBI A;  2XPU A;  4HZF A;  2LKP A;  3SFZ A;  4A5N A;  2LSO A;  2W24 A;  2HGC A;  1YQA A;  1ODD A;  4KMU X;  1X2N A;  3HXL A;  4I98 B;  4UV8 A;  3F23 A;  4F7Z A;  4WXH A;  1TL8 A;  1HST A;  3Q0V A;  3CUO A;  1IXR C;  4KN7 X;  3V8K A;  3WE3 A;  1JT6 A;  4BE1 A;  4IHY A;  1NHA A;  2EWN A;  4FE4 A;  3S1R J;  3EUH C;  3OYK A;  4XRS G;  2Z5U A;  1SEU A;  4BXU A;  1U9O A;  3KP6 A;  1ZLK A;  2LKX A;  1DDN A;  4HX7 A;  4Q47 A;  2VXD A;  2NRA C;  4I99 C;  2IGO A;  1Z6R A;  1UST A;  1SAX A;  4BKX A;  2DN0 A;  2XIG A;  2GBY A;  4P55 A;  1STZ A;  3I55 I;  1NK2 P;  1VQ7 I;  2W1O A;  1CQT A;  1H89 C;  3M07 A;  4CDG A;  4XLF A;  3EUH A;  4A93 J;  1DUX C;  2G7U A;  5M3M J;  4MEX F;  1V4R A;  2V1X A;  4EMS A;  4PFP A;  4XOP A;  3S93 A;  2XAS A;  1ZQ3 P;  4LB6 B;  4OAZ A;  1EV7 A;  4BQN A;  4KDP A;  2EFN A;  3QYE A;  5B1B H;  5TIS C;  4NQW A;  2X6Y A;  4AID A;  1FBU A;  3FMR A;  4OIR F;  3LWF A;  4L9N A;  1G3W A;  5M5W J;  4BXX J;  1XC5 A;  1J59 A;  3KP3 A;  4AC0 A;  1N77 A;  3J81 K;  2QVO A;  2W4S A;  3F8N A;  3WTY C;  2VOO A;  1KA8 A;  5EG0 B;  3O2P E;  1FWZ A;  2RAE A;  4KIB A;  4AU7 A;  1D0Z A;  4NUB A;  4IZZ A;  2MA3 A;  1FOY A;  1WH5 A;  1MMN A;  3BDD A;  4JOM A;  2EJR A;  4XRS A;  4BEH A;  3P9I A;  4RA2 A;  3H5N A;  1AOY A;  1JTY A;  3BZK A;  2WAQ N;  2XDV A;  2VBY A;  3AG4 H;  4C9Y A;  3IH3 A;  2HYF A;  4B44 A;  1Y1W J;  3HTU A;  1ITY A;  1BJA A;  3CLO A;  2R7T A;  2CW8 A;  3SHF A;  4KIS A;  5LD2 C;  3RKX A;  3BG9 A;  3B6C A;  1V55 H;  1TNS A;  4ESB A;  1VI0 A;  1XCV A;  2KRH A;  2VI6 A;  5C4X J;  3TBI A;  1XMX A;  1WCM J;  2ZJQ F;  5LGN A;  2FOK A;  2L7F P;  1WJA A;  2QM3 A;  1TWG J;  4G6D A;  4IRH A;  1MH4 A;  1VQP I;  3RCO A;  2QA4 I;  2NVY J;  2D5V A;  1GXQ A;  3CMA I;  4BDY A;  5IYD J;  1OJL A;  4NB5 A;  4E4H A;  4M3D A;  4XK4 A;  4YFK F;  3FX3 A;  5HS7 A;  2DMP A;  1WVR A;  5ICC A;  2IA1 A;  2LRE A;  2KL4 A;  4Y7N J;  1AWC A;  2FNP A;  4B09 A;  2VKE A;  3OYN A;  1FSE A;  3FXL A;  2XRN A;  2FML A;  1GVJ A;  1SVO A;  4KUM A;  3ZN0 A;  3DEU A;  1Z0X A;  4YIF A;  5JLX A;  1Y6I A;  1A6I A;  3TOA A;  2HOS A;  2P5V A;  4UY8 I;  5K1Y A;  2E1N A;  3EQL F;  4G7O F;  3D5L A;  2WBM A;  3BJO A;  1R7J A;  3DPU A;  1LEB A;  4Y52 J;  3ZQH A;  4A6D A;  4BXF A;  3M4O J;  2AXL A;  4IJA A;  4MFE A;  4BEH B;  3N05 A;  3LMM A;  3CLQ A;  5D6F A;  1HOM A;  3HOU J;  1BI3 A;  2EFQ A;  2BXZ A;  3CTA A;  4KNY A;  4XLC A;  1HDD C;  2QBY A;  2ZFW A;  2R5Y A;  1Z67 A;  1S72 I;  3S17 J;  2OA4 A;  1OPC A;  2GA1 A;  2WAQ A;  4QTR A;  5IT9 Z;  3K9T A;  1DP7 P;  2IGN A;  1LKX A;  2VQG A;  2L7M P;  2R4G A;  4XL9 A;  1RKW A;  2BVL A;  1OYW A;  2VE8 A;  3BTI A;  3S14 J;  3TDZ C;  4CGZ A;  1U5T C;  3L2U A;  2BGC A;  2MLK A;  2DMT A;  2XGE A;  4RS8 A;  2CW0 F;  2R7F A;  1YW7 A;  3HJE A;  3KPH A;  5E8I A;  5F0H A;  1VFC A;  3FKI J;  3CCV I;  1P92 A;  1ZGJ A;  2LF8 A;  2K4J A;  2XRL A;  2ZXW H;  5AON A;  5HS9 A;  3GX4 X;  2M45 A;  3FMQ A;  1WJF A;  2PMZ A;  3V42 A;  2P5L C;  5E17 F;  2JRM A;  2FQ4 A;  2PG4 A;  2LC2 A;  2WB1 N;  2VBZ A;  3C1D A;  4M6Y A;  1ZR2 A;  1U5T A;  3CJT B;  3HUG A;  3KP2 A;  5LFA A;  3FHN A;  2E1M C;  4I76 A;  4C3I J;  2ME6 A;  3RYP A;  4IHS A;  2DA5 A;  2QLZ A;  3K69 A;  2JQ7 A;  1F1Z A;  2EIK H;  1GVD A;  2IXS A;  1R1V A;  3HHH A;  3NWS A;  3FM3 A;  2LY2 A;  2WV0 A;  3PFI A;  5GAE J;  2I8D A;  3O6B B;  3BPX A;  3BC8 A;  5CVI A;  3KP5 A;  2KQR A;  1UAA A;  2ESN A;  1IZ1 A;  2E7W A;  1ERD A;  2JUC A;  2DDA A;  3CZ6 A;  2QGU A;  2MH2 A;  2DCE A;  3GBG A;  1KQ0 A;  2MBF A;  3IV5 A;  3FZV A;  4CHU A;  5DYM A;  4BQO A;  4XLN F;  3HM5 A;  3F8M A;  1X3W B;  2DMQ A;  3E0J B;  4B1R A;  4BAC A;  3G1M A;  1MBH A;  4KIT B;  1J2X A;  2ISY A;  2CSO A;  2IJL A;  5LHI A;  3JTG A;  2L4A A;  2FBH A;  1RR8 C;  2OF7 A;  4GFB A;  4ESJ A;  3RJP A;  1GHC A;  1MJA A;  2KPM A;  1T8I A;  2AS5 F;  2NVT J;  4KIF A;  1X1C A;  4P9F A;  5LEK A;  3K6G A;  4Q48 A;  2KDO A;  1AKH A;  5IOZ A;  2UXX A;  1E3H A;  3RKW A;  1XMK A;  2N8G A;  1S29 A;  2P7C B;  3MN2 A;  4EM2 A;  5FKN A;  3BR5 A;  3W3C A;  1Y56 A;  4PJN A;  1W7P D;  5K7H A;  1Q1V A;  5EZH A;  1WJE A;  1F4K A;  4MHG A;  2WB1 A;  1RR7 A;  2LBF A;  2M4K A;  2HQN A;  3MZH A;  2R7Q A;  1I27 A;  4II3 A;  1V5F A;  2EV0 A;  3BZ6 A;  3HB9 A;  1WGX A;  1OCT C;  3OIP A;  4RDU A;  2HVS A;  1JTX A;  1TBX A;  3IWZ A;  5HOD A;  3JRC A;  1G3S A;  2STW A;  4RLF A;  3B6A A;  3HOW J;  2F2E A;  3BP8 A;  3K1M A;  4DZP A;  2PMU A;  5LHH A;  2X51 A;  4UVA A;  4RLQ A;  1XCB A;  4DIQ A;  4KYW A;  1BIA A;  1DQU A;  1XN7 A;  1TLH B;  2BW3 A;  4WXD A;  1WQ2 A;  4ENN A;  1Q1H A;  2CV0 A;  3HBL A;  1DP3 A;  2E35 A;  3HEF A;  5HNF A;  2E60 A;  2EFW A;  4IHT A;  3TP3 A;  1I50 J;  3KFW X;  3MQ0 A;  1UHM A;  3ABM H;  1BC7 C;  4EJW A;  3BQZ A;  4IQ4 A;  2XSD C;  2GOX B;  4QLC U;  4EJT A;  5JVG F;  1HDP A;  1AKH B;  3H0D A;  2HYJ A;  1K79 A;  3DP7 A;  1EF4 A;  4I02 A;  1BOB A;  2WV1 A;  1MJ9 A;  2LF7 A;  2Z9O A;  3L09 A;  3K70 D;  2M34 A;  5CQG A;  4U0V A;  4IX7 A;  1R00 A;  2Q1Z B;  3LOC A;  4PZJ A;  3MAJ A;  4L5J A;  4IRI A;  1EKE A;  2B7E A;  3V7S A;  4ZYD A;  5F27 A;  4GGG A;  3CO6 C;  4A3D J;  2R7X A;  2WTE A;  3K0L A;  4XON A;  2HXO A;  3DTK A;  1YRN A;  3DKY A;  3FXO A;  2W85 A;  1SMT A;  2ZXI A;  3PFY A;  5DCM B;  2ECB A;  4C3H J;  1VQ9 I;  1YTY A;  2DOD A;  4LFU A;  2HNH A;  3I5U A;  4BL0 B;  4FT8 A;  4HPQ A;  1MIJ A;  1D0X A;  2V1D A;  2ELK A;  1JKQ C;  4EM0 B;  3BY6 A;  1VQL I;  2OJE D;  1EH6 A;  2NAZ A;  1K7A A;  5F6F A;  2ESH A;  2VXZ A;  1TWC J;  1BR1 A;  5E20 A;  3WGG A;  1LE8 A;  4G94 A;  4V2G A;  1Y8R B;  2P0W A;  2KIF A;  2E5Z A;  3SQN A;  1MNE A;  2QCO A;  5F0F A;  4QPO A;  3LSI A;  1ZRC A;  2DI3 A;  2ZC2 A;  1JKO C;  3J80 K;  5GTI C;  1JI8 A;  1QPM A;  1YIO A;  2Y0M A;  3IL2 A;  2VLA A;  2ADU A;  1GT0 C;  2JJ7 A;  2IVM A;  3TW7 A;  2WAD A;  3KEQ A;  3ZP5 A;  2VE9 A;  1DPU A;  3K4B A;  5FD5 A;  2E5N A;  3K7A J;  1YW9 A;  4LG0 A;  4CCM A;  3HRT A;  1SD5 A;  3RQI A;  2EIM H;  1D8J A;  3QOP A;  3X2Q H;  1POG A;  2FSW A;  1ZG5 A;  1S7E A;  3QU6 A;  4WX9 A;  2BY2 A;  3Q9V A;  4DBQ A;  2A3S A;  5D5V B;  1NG7 A;  2IA0 A;  3HGG A;  4HLY A;  2WWY A;  1LVK A;  2AQE A;  2HOE A;  3A2K A;  4JP0 A;  3ZQI A;  3WG9 A;  4KFC A;  3H3Z A;  1USS A;  2Z3Y A;  1OYI A;  4A0X A;  3H5R A;  3A1Y A;  4EGY A;  2QEX I;  2E1C A;  1IDY A;  2PLY A;  3JAM K;  1Y39 A;  3OIO A;  4N9H A;  4OWR B;  5DS9 A;  3NQO A;  1XSD A;  2NNN A;  1QQI A;  1OR7 C;  2E7X A;  3OYD A;  1MH3 A;  2FRH A;  4CCK A;  5BS6 A;  1FP2 A;  1QZE A;  1D1C A;  4Z2Y A;  1U3E M;  3BG6 A;  5KK1 A;  1OYY A;  4ETS A;  1TP4 A;  3TW6 A;  4NC7 A;  3FMS A;  4BUP A;  1YS6 A;  4M9S A;  2QWW A;  1OCR H;  2KIU A;  2XSJ C;  3I9V 2;  4OIO F;  3MKZ A;  3S3M A;  3T0Y A;  2QSG X;  5FKO A;  2AO9 A;  3I4N J;  3LQQ A;  3NAU A;  2RGV A;  1OR7 A;  3HDD A;  1D5V A;  4HF0 A;  1T98 A;  2PJR A;  3CD6 I;  3PQJ A;  5FFX A;  2F5V A;  4OIN F;  2DXI A;  3H9Q A;  2R92 J;  5D8L B;  2DFI A;  4CXF A;  2YSR A;  1E0E A;  1FNN A;  1K83 J;  5BNG A;  4H4K C;  4ENM A;  2NYX A;  4ENK A;  3PM1 A;  3J7Y J;  1JE8 A;  2DBB A;  2PMH A;  3MZY A;  4KT5 C;  1KU3 A;  2XB0 X;  4XLH A;  5BMZ A;  4HDU A;  3V7C A;  2VN2 A;  1ONV A;  2X1E A;  4AVZ A;  3MCZ A;  5IP7 J;  2GXA A;  4RMN A;  3S1Q J;  3C2G A;  2GAU A;  1HW5 A;  3I3L A;  1ZGA A;  1N25 A;  2VKD A;  3I59 A;  3FXQ A;  1JJ8 C;  2CQX A;  2JTV A;  3HPG A;  3P7N A;  1XX5 A;  1OFC X;  1WH7 A;  1QU3 A;  2H1K A;  2L9R A;  2X0L A;  3IRQ A;  1IRG A;  1XDS A;  3KZZ A;  3JRF A;  3Q0W A;  1GXP A;  2OQR A;  3LQR A;  5FLX Z;  2CFX A;  5H20 A;  3GYH X;  2DAO A;  2MW8 A;  3ZPL A;  2DFF A;  5H6R A;  3KZI C;  2NNY A;  3WTZ A;  4I01 A;  4AIH A;  1S7A A;  2CV2 A;  1W7P A;  1IV8 A;  4MQV A;  3E3V A;  3F0C A;  2Y30 A;  2BY0 A;  2LH9 A;  4BY7 J;  4LK1 F;  5E1X A;  4CO8 A;  4IQJ A;  1K78 A;  3IKV A;  1IN5 A;  1B72 B;  4BJ5 C;  1SFU A;  2VPL A;  3IAS 2;  2KT0 A;  3K4L A;  5K7F A;  4U0Y A;  1SVM A;  2KIS A;  4XKW A;  1JXS A;  1ETO A;  2KJB A;  2XAH A;  4ZTJ A;  3CCQ I;  2ELJ A;  5HLH A;  4A0Z A;  5DM7 F;  1BM9 A;  1PYV A;  2VUM J;  3CCE I;  3E6D A;  1PDN C;  3OYL A;  4YFX F;  3QAH A;  1TWF J;  4HNV A;  3ECH A;  2DA1 A;  2OPT A;  1BI2 A;  1WFX A;  4PDK A;  3ZCO A;  3E1S A;  3LNQ A;  1CF7 A;  2DOF A;  4R79 A;  1LFB A;  4BDZ A;  4CH7 A;  1YOV B;  3PNY A;  3P5J A;  1SMY F;  1K61 A;  2MSY A;  3KLO A;  2DU9 A;  4XSZ F;  2K86 A;  3RPU D;  1Z91 A;  4O6J A;  3K70 C;  5CLS A;  5IP6 A;  3OL4 A;  2IS4 A;  5JVT A;  2H6C A;  2BY1 A;  1R71 A;  2DA6 A;  2XUB A;  3WU2 C;  4EJV A;  1R1U A;  4NC6 A;  4IHV A;  5ED4 A;  1YIT I;  1FY7 A; 
#chains in the Genus database with same CATH homology
 4U7B A;  1BIB A;  3M8E A;  2K4B A;  5ERI A;  3GFI A;  3GWZ A;  5DUI A;  2YX4 A;  1K78 B;  1KU7 A;  1G3T A;  4LGW A;  1U78 A;  2L3D A;  1REP C;  5E1W A;  1R23 A;  2VBX A;  3NRV A;  2EK5 A;  1I5Z A;  3L7W A;  4OMY A;  3F22 A;  4UVB A;  1TQP A;  3CO7 C;  2ZKZ A;  1TW3 A;  1CF7 B;  3U2R A;  3EYI A;  5CJ9 A;  2HWV A;  1O3S A;  2PBI A;  4U88 A;  2GXG A;  4E70 A;  4ZYG A;  1IN7 A;  5BQT A;  3ROU A;  1O3T A;  1XDU A;  3E6M A;  3CJN A;  5ICG A;  1FZP B;  2CWE A;  1BI0 A;  2BEO A;  2P6T A;  3QP6 A;  5DD4 A;  4CYD A;  3T1B A;  2D1H A;  3GZ6 A;  1RI7 A;  1T2K A;  1KGS A;  3TO6 A;  1HBX G;  2HTS A;  3P9C A;  4XSX F;  1FP1 D;  3ML6 A;  4LJZ F;  3HHG A;  4GXO A;  3COA C;  2FNA A;  3RDI A;  5LBQ A;  3F72 A;  3M1E A;  1F9N A;  1FC3 A;  5E18 F;  4EGZ A;  2DK8 A;  4EM1 A;  2XHK A;  1Z6T A;  2X4H A;  3DXJ F;  2K27 A;  2FEZ A;  3CDH A;  4A5M A;  4MGR A;  1R5G A;  3PQK A;  1WI9 A;  1W5T A;  4BYY A;  4ZYH A;  1R36 A;  4QWQ A;  3JSP A;  1CGP A;  4B8X A;  3FXU A;  1KYW A;  4KA4 A;  2CGP A;  3VFZ A;  3T8T A;  1T39 A;  1XGN A;  3R4K A;  3KET A;  4LB5 A;  1Y0U A;  2D2W A;  5ILV A;  1YO5 C;  2HQR A;  2RV8 A;  3I64 A;  2TDX A;  3BRO A;  3EET A;  1Z7U A;  2HTJ A;  1Z05 A;  2DW4 A;  3IRR A;  4CZZ A;  2F5F A;  3ABT A;  3IHU A;  3REO A;  2GIV A;  3Q5F A;  1PUE E;  5TRD A;  4L18 B;  4FHT A;  4K2E A;  2W57 A;  4EQQ A;  1O7L A;  1WWX A;  3E5U A;  1W4M A;  5DDG A;  2M8E A;  3D0S A;  4IPA A;  4AIK A;  2O61 A;  2XVC A;  1IRF A;  2UZK A;  1G6N A;  2OU2 A;  1SD6 A;  4HLX A;  3RPU A;  2EFP A;  3ZQ7 A;  5DCF A;  3RTR A;  4XLP F;  4D0P A;  1MD0 A;  1VTN C;  2KIM A;  1O3R A;  3B02 A;  4S04 A;  1LJ9 A;  1OMI A;  2VT3 A;  3KE2 A;  2VOP A;  3KCC A;  2JRT A;  3V8J A;  3GVA A;  1QGP A;  4WF2 A;  5TJJ A;  5FD6 A;  5CVU A;  2A5Y B;  2XKO A;  4JQF A;  2ISZ A;  4RB0 A;  4MTE A;  2GWR A;  2M30 A;  4HV6 A;  1IXS B;  5FGM A;  3FF5 A;  3WE2 A;  2Z99 A;  1RUO A;  2F5D A;  2IW5 A;  2IT0 A;  2IP2 A;  5EEG A;  2JPB A;  2PFB A;  2P7V B;  3U9G A;  4JK1 X;  3T8R A;  2P6S A;  5IT3 A;  1PP8 F;  2FA5 A;  1YFH A;  3V4G A;  1ZHF A;  3ELK A;  4WCG A;  1P4W A;  3F21 A;  1IW7 F;  4WK8 F;  5IT9 K;  4HF1 A;  2QZ8 A;  3ECO A;  5D4S A;  4RGU A;  4FX4 A;  5DCM A;  3DQV C;  4AIJ A;  5LHG A;  4A12 A;  1ZH5 A;  2DK5 A;  4DNC A;  5DV5 A;  2H94 A;  1ZRD A;  2RDP A;  4M9Z A;  3V8L A;  5D4R A;  2M1B A;  1XGO A;  4BH9 A;  3L2C A;  4HAM A;  2EA2 A;  2RQP A;  4IVN A;  3K2Z A;  3S2W A;  1BI1 A;  5HS8 A;  2RKH A;  5F64 A;  5KVR A;  2MH9 A;  3DKW A;  1ZRE A;  3V7R A;  4WXC A;  4UV9 A;  3K1P A;  1KQ9 A;  5A2Q Z;  3HSF A;  2QQB A;  4BHB A;  5AIQ A;  4HW0 A;  2WC2 A;  2OAZ A;  3R0J A;  1Z9C A;  1TTY A;  1O57 A;  4LD5 A;  3LAP A;  1UFM A;  1QZZ A;  1XD7 A;  2A6H F;  2P4W A;  5DUK A;  4YFN F;  1ZG3 A;  2FU4 A;  4G6Q A;  6PAX A;  4HDV A;  2PQ8 A;  4MQ9 F;  2DPU A;  5LLQ A;  1IAW A;  3GEZ A;  3KEO A;  2C6Y A;  1SD4 A;  1L3L A;  3BJA A;  2STT A;  1JGS A;  2XAQ A;  4A2U A;  2W84 A;  4ZZD A;  2FQ3 A;  5EEH A;  1U8R A;  1D8K A;  4O3M A;  3ZMD A;  1EH7 A;  3VB2 A;  1FLI A;  3RKY A;  3WTT C;  4G8X A;  3C3W A;  2XAF A;  1FPQ A;  3GZ5 A;  4MNU A;  4ENJ A;  3KLN A;  3RI4 A;  2GXB A;  3F3X A;  2EB7 A;  2XGX A;  3FM5 A;  2QEN A;  1D3Y A;  5HOO A;  3BWG A;  2O3F A;  3OOP A;  1S6L A;  4LLG F;  1FOK A;  4L9J A;  4AVP A;  2FF4 A;  3TGN A;  2ZME B;  3H92 A;  3TOB A;  3N4M A;  2IPQ X;  1P6R A;  3QPH A;  5DEQ A;  3GFM A;  3FWE A;  2MLG A;  2A07 F;  2FBK A;  2JT1 A;  1YG2 A;  4A0Y A;  3I53 A;  3NEU A;  3CUQ B;  3R0A A;  3JW4 A;  3MEX A;  3GO5 A;  4P9U A;  3AAF A;  3QPT A;  2JZY A;  3WTV C;  5K5R A;  2HYG D;  3WGH A;  3WTW C;  3DV8 A;  1MDM B;  2DTR A;  4Q4Z F;  1YW8 A;  2COM A;  2DO7 A;  1JHH A;  5CVR A;  4OOI A;  1P4X A;  2ZNZ A;  2K02 A;  3DFG A;  1R58 A;  2DQR A;  4RAZ A;  1YYV A;  3OV8 A;  1ON1 A;  2M87 A;  3U1D A;  2DQL A;  5DD8 A;  4N0B A;  2H27 A;  3T5X A;  3GFL A;  1ZRF A;  1MKM A;  1J9I A;  1ZN2 A;  5LGU A;  2XAG A;  5D6E A;  3FHZ A;  4HOB A;  3I54 A;  1TW2 A;  2R7D A;  3M8F A;  5K5O A;  3HTS B;  4L9T A;  2NS0 A;  1I6X A;  2HR3 A;  3R6S A;  3J81 Z;  3WTU C;  4G7Z F;  4UVC A;  4G7H F;  3WU0 A;  2V1U A;  4XBF A;  5BPI A;  5BOX A;  2A69 F;  4UXN A;  3LAJ A;  2CQK A;  3TKY A;  4EV0 A;  2EV5 A;  4GCV A;  5D5U B;  3HYI A;  2Y48 A;  3GF2 A;  3BPV A;  1YS7 A;  2B0L A;  4I2O A;  1ZAR A;  2G7H A;  3G73 A;  4Q5S F;  4ZYE A;  1MGT A;  5FLX K;  2JSC A;  4A6E A;  2HKX A;  3SZT A;  2RNJ A;  3Q9S A;  3HOS A;  5L3F A;  1P2F A;  4HV5 A;  3E5X A;  1EH8 A;  3HRU A;  2PN6 A;  3ZN1 A;  5HDG A;  2HZT A;  4U0W A;  1ZLJ A;  2QYO A;  4EVI A;  2J5P A;  3GFJ A;  5JHU A;  3QRF F;  1IUY A;  3ZMV A;  4RB3 C;  3VEP A;  2ZXJ A;  4U7D A;  4ON0 A;  1J75 A;  1R5H A;  5FO5 A;  3LFK A;  4HQE A;  4HQM A;  5L3B A;  2BE5 F;  1XGM A;  4KIG A;  3WOD F;  1QO0 D;  2OD5 A;  2UWM A;  2V9V A;  4HYE A;  1BC8 C;  4GO1 A;  4MEY F;  4HF2 A;  4RB1 A;  4RAY A;  3IC7 A;  1B6A A;  2RVC A;  3QU3 A;  3MFK A;  2YPR A;  2PI0 A;  2O8X A;  1C0W A;  2HKO A;  3W6J B;  4O5V A;  3L9F A;  4BNC A;  2L01 A;  4LK0 F;  2IRF G;  1KU2 A;  2YU3 A;  4MTD A;  2LNB A;  4ESF A;  3ZMS A;  3GUD A;  2M5W A;  2UXN A;  5L3D A;  4AD9 A;  1UB9 A;  3HIF A;  2EFO A;  1FSH A;  2Q0O A;  3E6C C;  2HDC A;  1O3Q A;  5LEJ A;  2A68 F;  2O6G E;  4YII A;  4TV7 A;  1FYM A;  1B1B A;  1TQM A;  5F1R A;  4L0Z B;  4BHP A;  1J7K A;  1R22 A;  3I4P A;  5HDK A;  4Y15 A;  3TQN A;  5FFZ A;  2O0Y A;  3ZMU A;  3IWF A;  2A6E F;  1F5T A;  2FE3 A;  3SXY A;  1K6O A;  3HRM A;  1WKM A;  2QQ9 A;  1UHW A;  4M73 A;  2ZO4 A;  4M71 A;  1Z1D A;  4YG2 F;  4I0B A;  1U2W A;  3L00 A;  2OQG A;  2Q8K A;  2HFH A;  1HKS A;  1SD7 A;  2ZBK A;  3DPL C;  5J8C A;  1RZ4 A;  2VT2 A;  5D8K B;  2K7L A;  4R8H A;  3C7J A;  1B9N A;  1UCR A;  4NHJ A;  2ZJ2 A;  4RB2 C;  1LNW A;  3RYR A;  1LDD A;  2VC0 A;  4I7H A;  4OU0 A;  1TNT A;  3WGI A;  4GYG A;  4EJU A;  1SFX A;  3FXR A;  1A04 A;  2ACJ A;  3WTS C;  2PEX A;  3E97 A;  1QNT A;  2ELH A;  1FT9 A;  3C18 A;  3GXO A;  3HSR A;  5ILS A;  3VOE A;  1ZG1 A;  1MZB A;  4HBL A;  5H6Q A;  4ASN A;  2MD5 A;  4IXA A;  4L9V A;  1HW2 A;  4HA8 A;  4BHC A;  1FX7 A;  2QBY B;  4HX8 A;  2V6C A;  1P4A A;  2O03 A;  4PCQ A;  2R3S A;  5HLG A;  2PJP A;  3LA3 A;  1S8N A;  4KIC A;  3GLX A;  3ZMT A;  1B59 A;  3BOQ A;  5LRS A;  3K1N A;  2DT5 A;  3F8C A;  1LVA A;  3G3Z A;  2F5C A;  2CO5 A;  1ULY A;  4UHT A;  1U5T B;  1XSX A;  2HEO A;  1FBS A;  4UNO A;  2BV6 A;  1MJB A;  3R60 A;  3J80 Z;  2VOD A;  1E2X A;  4LLL A;  4KMF A;  3KZY A;  4M6X A;  1TQI A;  1S3J A;  3BJ6 A;  1OKR A;  1T38 A;  1IF1 A;  3RIR A;  1IXC A;  4GYI A;  2KJC A;  4P5O A;  3B73 A;  5JFR A;  5L3G A;  3KP4 A;  3VOD A;  1I1G A;  5AIP A;  1LEA A;  4AWX B;  2L54 A;  4ZZL A;  1KYZ A;  1HSJ A;  4BQA A;  3JAM Z;  5LGT A;  3P9K A;  5ICF A;  2BBY A;  3HOT A;  5HVQ C;  2XRO A;  3JSO A;  4L0Y B;  1B4A A;  3DF8 A;  1FBQ A;  3M7G A;  3I0T A;  2VBW A;  2G9W A;  2V79 A;  5D5W B;  2Q2E A;  3KP7 A;  3R61 A;  4RGR A;  1HKT A;  3LA7 A;  3F8B A;  5LRR A;  3MWM A;  4RGX A;  5J6X A;  5ILU A;  2J5O A;  2Z33 A;  3WU1 B;  4EJO A;  3JTH A;  4P96 A;  1BBY A;  5D5X B;  2KKO A;  3WTX C;  4DQ2 A;  1LDJ A;  4LMY A;  3EDP A;  2RN7 A;  1G3Y A;  2XAJ A;  3HRS A;  1G4D A;  1XSV A;  5L3E A;  1QBJ A;  1JHF A;  1YLF A;  5L3C A;  2ZME A;  2ZCW A;  3CUQ C;  1J0R A;  1WSU A;  3RPQ A;  2LDU A;  2A61 A;  1I1S A;  1IN8 A;  2QUF A;  2BYV E;  1T6S A;  2CYY A;  2IA2 A;  3CUQ A;  4FX0 A;  2VC1 A;  4M9X A;  1KQ8 A;  1R1T A;  1FYL A;  4KN4 X;  3ERE D;  1SFE A;  5CVJ A;  2OZ6 A;  1X3U A;  4XRF A;  4I09 A;  2KRF A;  1QZY A;  2EA4 A;  5J8F A;  1MDM A;  3E5Q A;  2FXA A;  3TO9 A;  4Y17 A;  2XKP A;  5E1Z B;  1O7F A;  3GW2 A;  2D45 A;  5HLI A;  2DLL A;  2GA2 A;  3O3K A;  1HXD A;  3LA2 A;  4N9I A;  4H0E A;  1IN6 A;  2JPC A;  4BAY A;  2W25 A;  2D1V A;  1H9G A;  4OMZ A;  2MC3 A;  1BN5 A;  1HW1 A;  1XGS A;  4IF4 A;  3F8F A;  5A2Q K;  1B9M A;  5K5Q A;  2L4M A;  4LLN A;  3SZP A;  1V3F A;  3LST A;  2YR2 A;  4R1H A;  5CVV A;  1XB4 A;  1WRJ A;  2VON A;  5E8G A;  4OIP F;  2F5E A;  1W5S A;  2ZNY A;  4I0A A;  4LG0 B;  1RIO H;  3W6K B;  1H9T A;  2ETH A;  2H09 A;  2OBP A;  1T0F A;  1HKQ A;  3I71 A;  2H6B A;  1PP7 U;  4M74 A;  3ISP A;  5HDN A;  2DPD A;  1J5Y A;  3QP5 A;  1RUN A;  3F6V A;  5FB2 A;  1IN4 A;  3ABU A;  5JR3 A;  3ZMZ A;  1ZAO A;  1BOA A;  1ON2 A;  3N97 A;  3ULQ B;  4PGG A;  2OZU A;  3J7A O;  2XV4 S;  4HX4 A;  4CIC A;  2GZW A;  1E17 A;  1LB2 A;  2L02 A;  2YX7 A;  2HS5 A;  1HQC A;  2GQQ A;  4ZH4 F;  2FMY A;  4PGH A;  3M9A A;  2P8T A;  3I58 A;  4WWC A;  1KU9 A;  1FYK A;  3TO7 A;  3I59 B;  3EYY A;  5CYV A;  4G9Y A;  2QQA A;  1S7O A;  4UUV A;  2Y75 A;  1U6G A;  3F6O A;  2P5K A;  1DPR A;  3TDU C;  4S05 A;  2CG4 A;  4Y13 A;  1L0O C;  5BPD A;  5ICE A;  1ZYR F;  4L5I A;  3E6B A;  1XMA A;  3HSE A;  1W7P B;  4JBA A;  1LDK B;  3H3U A;  1LQ1 A;  5JI6 A;  3DPT A;  2RC4 A;  4RGS A;  3IKT A;  4OIQ F;  4M72 A;  2EV6 A;  4IRG A;  1RNL A;  1H0M A;  2FBI A;  4HZF A;  4A5N A;  2LKP A;  3SFZ A;  2LSO A;  2W24 A;  2HGC A;  1YQA A;  1ODD A;  4KMU X;  4I98 B;  4UV8 A;  3F23 A;  4F7Z A;  4WXH A;  1HST A;  3CUO A;  1IXR C;  4KN7 X;  3V8K A;  3WE3 A;  1NHA A;  2EWN A;  2Z5U A;  4BXU A;  3KP6 A;  1ZLK A;  1DDN A;  4HX7 A;  4Q47 A;  2NRA C;  1Z6R A;  1UST A;  1SAX A;  2XIG A;  4P55 A;  1STZ A;  4CDG A;  3EUH A;  1DUX C;  2G7U A;  4MEX F;  1V4R A;  2V1X A;  4EMS A;  2XAS A;  4LB6 B;  1EV7 A;  4KDP A;  2EFN A;  4NQW A;  1FBU A;  3FMR A;  4OIR F;  3LWF A;  4L9N A;  1G3W A;  1J59 A;  3KP3 A;  3J81 K;  2QVO A;  3F8N A;  3WTY C;  2VOO A;  1KA8 A;  3O2P E;  1FWZ A;  4KIB A;  2MA3 A;  3BDD A;  2EJR A;  3P9I A;  1AOY A;  2VBY A;  2HYF A;  3HTU A;  1BJA A;  3CLO A;  3SHF A;  3RKX A;  4ESB A;  1TNS A;  1XCV A;  5LGN A;  2FOK A;  2QM3 A;  4G6D A;  4IRH A;  1GXQ A;  4NB5 A;  4YFK F;  3FX3 A;  5HS7 A;  5ICC A;  2IA1 A;  1AWC A;  2FNP A;  4B09 A;  1FSE A;  2XRN A;  2FML A;  1GVJ A;  4KUM A;  3ZN0 A;  3DEU A;  4YIF A;  3TOA A;  2P5V A;  4G7O F;  5K1Y A;  2E1N A;  3EQL F;  3D5L A;  3BJO A;  1R7J A;  1LEB A;  4A6D A;  2AXL A;  4IJA A;  5D6F A;  1BI3 A;  2EFQ A;  3CTA A;  4KNY A;  2QBY A;  2ZFW A;  2OA4 A;  1OPC A;  2GA1 A;  5IT9 Z;  3K9T A;  1DP7 P;  1OYW A;  2VE8 A;  3TDZ C;  4CGZ A;  1U5T C;  2BGC A;  2MLK A;  4RS8 A;  2CW0 F;  2R7F A;  1YW7 A;  5E8I A;  1P92 A;  1ZGJ A;  2LF8 A;  2K4J A;  5AON A;  5HS9 A;  3GX4 X;  2M45 A;  3FMQ A;  5E17 F;  2P5L C;  2PG4 A;  2VBZ A;  3C1D A;  4M6Y A;  1U5T A;  3HUG A;  3KP2 A;  3RYP A;  4IHS A;  2QLZ A;  3K69 A;  1F1Z A;  1R1V A;  3HHH A;  3FM3 A;  2WV0 A;  3PFI A;  3O6B B;  3BPX A;  5CVI A;  3KP5 A;  2ESN A;  1IZ1 A;  2E7W A;  2MH2 A;  1KQ0 A;  2MBF A;  3FZV A;  4CHU A;  5DYM A;  4XLN F;  3F8M A;  1J2X A;  2ISY A;  2CSO A;  5LHI A;  2IJL A;  3JTG A;  2L4A A;  2FBH A;  4ESJ A;  3RJP A;  1GHC A;  1MJA A;  2AS5 F;  4KIF A;  4P9F A;  5LEK A;  4Q48 A;  2UXX A;  3RKW A;  1XMK A;  2P7C B;  1S29 A;  4EM2 A;  1W7P D;  1F4K A;  4MHG A;  2HQN A;  3MZH A;  1I27 A;  2EV0 A;  3BZ6 A;  1TBX A;  3IWZ A;  1G3S A;  2STW A;  2F2E A;  3BP8 A;  3K1M A;  2PMU A;  5LHH A;  4UVA A;  1XCB A;  4KYW A;  1BIA A;  1XN7 A;  1TLH B;  4WXD A;  1WQ2 A;  4ENN A;  1Q1H A;  2EFW A;  4IHT A;  3KFW X;  3MQ0 A;  1UHM A;  1BC7 C;  4EJW A;  4QLC U;  4EJT A;  1K79 A;  3DP7 A;  4I02 A;  1MJ9 A;  2LF7 A;  2Z9O A;  3L09 A;  4U0V A;  1R00 A;  4PZJ A;  3MAJ A;  4L5J A;  4IRI A;  3V7S A;  4ZYD A;  4GGG A;  3CO6 C;  2WTE A;  3K0L A;  2W85 A;  1SMT A;  5DCM B;  1YTY A;  4LFU A;  3I5U A;  4FT8 A;  2V1D A;  4EM0 B;  3BY6 A;  1EH6 A;  2NAZ A;  1K7A A;  5F6F A;  2ESH A;  2VXZ A;  5E20 A;  3WGG A;  4G94 A;  2KIF A;  3SQN A;  1ZRC A;  2DI3 A;  3J80 K;  1QPM A;  1YIO A;  2Y0M A;  3IL2 A;  2ADU A;  2IVM A;  3KEQ A;  3ZP5 A;  2VE9 A;  1DPU A;  5FD5 A;  1YW9 A;  4LG0 A;  3HRT A;  1SD5 A;  1D8J A;  3QOP A;  2FSW A;  1ZG5 A;  3QU6 A;  4WX9 A;  3Q9V A;  2A3S A;  5D5V B;  2IA0 A;  4HLY A;  2WWY A;  2HOE A;  3WG9 A;  4KFC A;  3H3Z A;  1USS A;  2Z3Y A;  1OYI A;  4A0X A;  4EGY A;  2E1C A;  2PLY A;  3JAM K;  4N9H A;  1XSD A;  3NQO A;  2NNN A;  1QQI A;  2E7X A;  2FRH A;  5BS6 A;  1FP2 A;  4Z2Y A;  1U3E M;  5KK1 A;  1OYY A;  4ETS A;  3FMS A;  1YS6 A;  4M9S A;  2QWW A;  2KIU A;  4OIO F;  3T0Y A;  3LQQ A;  2RGV A;  1OR7 A;  1D5V A;  4HF0 A;  1T98 A;  3PQJ A;  5FFX A;  4OIN F;  5D8L B;  2DFI A;  4CXF A;  2YSR A;  1FNN A;  4ENM A;  2NYX A;  4ENK A;  1JE8 A;  2DBB A;  2PMH A;  3MZY A;  4KT5 C;  1KU3 A;  5BMZ A;  4HDU A;  3V7C A;  2VN2 A;  1ONV A;  3MCZ A;  2GAU A;  1HW5 A;  1ZGA A;  3I59 A;  3FXQ A;  2JTV A;  3P7N A;  2X0L A;  3IRQ A;  1IRG A;  1XDS A;  3KZZ A;  1GXP A;  2OQR A;  3LQR A;  5FLX Z;  2CFX A;  5H20 A;  3GYH X;  2DAO A;  3ZPL A;  5H6R A;  2NNY A;  3WTZ A;  4I01 A;  4AIH A;  1S7A A;  1W7P A;  4MQV A;  3E3V A;  4LK1 F;  5E1X A;  4CO8 A;  1K78 A;  3IKV A;  1IN5 A;  1SFU A;  4U0Y A;  1JXS A;  2KJB A;  2XAH A;  5HLH A;  4A0Z A;  1BM9 A;  3E6D A;  1PDN C;  4YFX F;  3QAH A;  3ECH A;  1BI2 A;  4PDK A;  1CF7 A;  4R79 A;  1SMY F;  3KLO A;  2DU9 A;  4XSZ F;  2K86 A;  1Z91 A;  4O6J A;  5CLS A;  5JVT A;  2H6C A;  2XUB A;  4EJV A;  1R1U A;  5ED4 A;  1FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...