2ODHA

Restriction endonuclease bcni in the absence of dna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
238
structure length
233
Chain Sequence
b'MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENNITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNLSKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMDLCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R.BcnI
publication title Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA.
pubmed doi rcsb
source organism Brevibacillus centrosporus
molecule tags Hydrolase
total genus 57
structure length 233
sequence length 238
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2odhA02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2odhA01
2ODHA 2ODIA 2OA9A 2Q10A 2OAAA 3IMBA
chains in the Genus database with same CATH superfamily
2GQHA 3GM0A 2OL3B 2CKBH 2YPVA 4EN2A 2N3JA 1RZ8B 2BNQE 1N70A 4E42B 4W9DC 4Y5VB 3MRGA 3WEXA 1Y6MR 4J6RH 2P24A 4PQXA 3GRWH 5E5RB 3VAEA 4LRIC 3EFFA 4FCAA 4CSPA 2KLTA 4KGJA 3N42F 2Z7ZA 4PJ8D 3HG1E 2K4WA 3COOA 2J72A 4EVNB 2WO3B 1MH5A 4QRRB 4YVNA 3ML9A 5JTWA 4KJPC 2X42A 2VZ1A 3D18A 3D06A 1NDMA 2FSDA 2WZ0A 4RZCA 5MEOA 2FEJA 5EEUA 2GBVA 4QXGL 5BPPA 1VGKB 1EPFA 5KVDL 3LXCA 2WXJA 3U46B 3C75A 3RWFA 4M9OA 4I89A 1M1XA 2B39A 2P8MB 5EZPA 1KEGL 3VWJC 2ZX8A 4P59H 4OZIB 4DK3A 3NCYP 4ODVH 1NUFA 5I6MA 5I16B 4BSWB 2XPGB 1RULH 2BLFA 2X9WA 2FJGB 3U0TA 1MCWW 2VXTH 1U3JA 4N8UA 1YEIH 5ESVA 3O6FD 5DD1H 2PO6C 4MGXA 1AGEB 1H3PL 1YJDC 5I6KA 4RQQA 3V9FA 2IAMA 4BCYA 3MRKA 3UJIH 4M7JL 3FT9A 4U6HB 3AM8C 2X4OB 1FH2A 4D9RE 2LR4A 4JVWA 5C3IA 3MROA 1BG9A 4OZGB 4HU8A 4TL4A 2NNCA 5JQIB 1MLCA 4IDJH 4MNGB 2FL5A 3AW5A 3O11A 4O2FA 4XH2A 5BRZB 5LG6A 4GBXB 4W93A 3QDMB 3WTSA 4G80A 1D5BA 5F7MC 3S3CB 1Z66A 1HJBC 4GKOA 4M6MH 3WMPA 4WW1B 3GF8A 3C12A 2ZXDA 3LH9A 1HCZA 3PJSB 1T21A 1A3QA 3T77A 2OR9H 1IMHC 4LEEA 2ZUWA 4IU2B 3CVHB 4W1TA 2AERT 2EYTA 1YY9C 4JFYB 4WI2A 5C0GA 1T5WA 3FFCE 3PPSA 5EC2B 5A43C 4PRHB 5IVZA 1DBBH 4X83A 3LHPH 3RIKA 3TH2T 3KPMB 3MQIA 5AUMB 3ROLA 4B9IA 3F7RA 3ATBA 3I3BA 4P46B 3NJXA 4P3DB 1GW6A 3DKHA 1MNNA 2X3BA 4FI7A 3KYAA 3Q1SL 4AV0A 1RZKL 3DJTA 5JHLL 3SKOA 1ANUA 2VDPH 5KWYC 1EJ8A 1DVSA 4HWZB 4N0UE 5JPMB 3ES6B 3Q01A 3RWCA 3UAJC 3RQ3A 4XMUA 1U8MB 1JGUL 4UAOC 3HZYB 4Y9GA 4NFCA 1UB6B 1KCVH 3WJJC 1Q1JH 2W9EH 3BESR 2A9BA 1NSNH 4AYID 1QRNB 1MI5D 4N6RA 1MI5A 4QI3A 1SY6H 4LLYB 5BRQA 1TMQA 1JVKA 3VMOA 3HC3H 3P9LB 3WKNA 1NLDL 1MFMA 2EDFA 5B22A 2AZUA 3T1WA 1XEUA 2H5UA 4Y1AA 2AJ3B 4Y4HC 1JWUA 2VAAB 4XMLL 1QFHA 5I0XA 1DTUA 1X5LA 3B2VL 5BXFB 4FQXA 2W80C 4CA4A 4PJAE 3NTCH 4LARL 3O9WA 2KDYA 1Z9LA 2I32A 1RP9A 2WZPD 1AR1C 4JN1H 1X9UA 4C54A 4D0CB 1K2DB 2XWEA 4Q58C 5HHMB 5HHPB 2ICWB 1KEMH 3O81A 2K4AA 5D1ZB 3WSQH 4P2RA 4PB0H 2BVQB 4NQED 4AIXA 3MLPA 1DLHA 1G84A 2HKHL 2RCSH 2ZCHH 3BAIA 4KFZC 4MA1C 5EU4B 4YXKH 4MDJB 4PFEA 4ZOAA 3CFCL 1X7SA 2DMCA 3I9IA 1B3JA 2EXTA 3JTTB 2NY5L 4YDZA 3ROOB 3BGMB 1XGYH 5D1XC 2Q8BH 4ISVB 4DGVH 4LCUA 1FYTB 3STZA 3P0VL 2WLJA 1EEYB 1MFBH 4A7VA 4QAWA 3KM2A 1QOKA 1FO0B 2GK2A 3TA4D 2XBZA 3DTXB 4A7GA 2APXA 4GKLA 4MD5A 4A6YL 5CINL 3WIAA 1LE9B 1T1XA 2XFGB 2B15A 1XFPA 1N9PA 4AGNA 1OXYA 1A4AA 1ZEAH 2WYHA 3D33A 5IESL 4FP8L 3PYCA 1ZVYA 3VCLA 4K71B 1YAZA 4LP8A 4YGAB 5GGQH 3C6SA 5AENA 1CDHA 1TFHA 3IFOA 3L4UA 4PHXA 3MV7D 3BAEH 3MV7A 4PV1C 1DJIA 4XB7A 5E8OA 5EUOE 3BP6A 1J11A 4OUUB 4PTTB 4YO0A 2DQHL 4ELMF 4E0RA 4UTAH 4A2FA 5GS1A 4JDVA 3NIDE 1OKEA 2IDUA 1N5YL 1PX4A 2EUXA 2GTZB 2PETA 3LRHA 1FGNH 1QATA 2B0SL 1CFVH 2UXFA 4ALAC 5J0BA 2VMJA 2NX5B 1ZLWK 4ONHA 3DYOA 7TAAA 4E68A 1PD1A 2NY3C 3I6GB 4OD3H 3UJJH 3ZZSA 4JGMA 1Z3RA 5EZIH 1RK0A 3KCPB 1EJOH 1WGVA 5DR5H 4W9KC 1SQ2N 2X1QA 2YBRA 2WXLA 1N6UA 1JMXA 3DSFL 3D8MA 2VJ8A 5HGBB 3L3IB 1X4ZA 1G7JA 4DNLA 4PGJA 1VRSA 5IHUL 4NKMA 3AMLA 1U42A 1WCBB 1BMGA 1G7IB 3IAQA 1F41A 3AB0C 2AGJL 3GZOA 3UTSE 1LLAA 1AXIB 4F24A 3CZFA 4H8PA 2YGVA 4JHAL 2FBJL 4R4FH 3RWHB 5CJ8A 1JUFB 2F5BH 3ARDA 3ORJA 2E4FA 2WUBH 4KHXL 1JPSH 2Z92B 3CE1A 3SPIA 4MBOA 3EGDA 4DP4X 2PPEA 1N2RA 5CIPB 2GIXA 5D70L 4O02A 3AWGA 4AJVA 5T3ZE 4QD2E 4FHKA 2WN2A 3FTZA 4IM8A 5I0ZA 5HY9A 4O2CB 1NCCH 1IEBA 3LH8A 4P49A 2OW7A 2WMPB 4BFIB 2B1AH 2YGPA 3JYBA 5KSBE 2N59A 5IVXF 1QW8A 3CSFA 4ONOA 3V7MA 3W3BA 5INDA 2WYTA 2Y23A 1W6LA 4OIAA 3T1FA 5ENWB 1MCWM 2F53D 3SBQA 2F53A 4NUMA 5D2NE 1CZ8L 1W0WA 2DYRB 2XBDA 3NJLA 2RD0A 3SYCA 1WHPA 2GBUA 4QRQA 2EJ1A 2DQFB 4YAQB 5IBUB 3TZVA 1XF1A 2OW6A 1P6AB 4R4BA 5TTRA 4BWWA 1S8DB 2C34A 1YEJH 3L1FA 3LPGA 3B3IA 4YDVA 3Q5TA 4PI2A 4HK0B 4Q6IB 4U1MA 5TFSL 2FH6A 2X4SA 4P5TD 4Z18A 2VLJD 2HJFB 1EWHA 1AO7A 5EHFA 1T5KA 4JK0D 3UGXA 2V17L 4BA0A 3VO0A 3CMOH 2BDNH 2LW3A 4KZEH 3P3RA 2HRPH 1J05B 2HTKC 1X7QA 4I2XA 1VFBA 5LQBL 2XWDA 1NAML 3M07A 5DJ6A 4QTHA 2C9UA 4BQ8A 4HUKB 4XP1H 2ZT9C 2XN9B 1F18A 2ADIA 3GSWB 3MLWH 3DIVA 3LDBB 2XA8H 3MBWB 1BZ9A 2AJUL 2UWEF 4A6YB 3NACH 4U4IA 4PPTA 4TVSa 1MJ8H 3CDYA 2J5LB 3ARUA 4N0YH 3F6IA 1XSKA 1AAJA 1KCBA 1V7ML 2CR3A 2MH4A 2YSTA 5HI5C 4HUNB 4Q8BA 3TC9A 3PJLA 1UHVA 1U8KB 3PY9A 3ULVL 4MQTB 4JZNB 4GXVH 1FLTX 3GJFA 1GCYA 3L5XL 4ZXBC 2LT9A 3LH2L 4TVPD 5GS0D 2PPCA 3QPKA 2YQBA 2ODHA 2EDRA 3IT8D 3J2PA 4HJJH 4YIQB 5E03A 2C1PA 1QSEA 3EDDA 1PQZB 1MCBA 4MLIA 3N55A 5J3HD 1BF5A 1MFDL 3FCUB 3MV8A 3FRPG 1G7MA 1XSIA 3MLVL 2WXKA 1AKJA 3G9VA 1FFNB 4AOFA 2Y1YA 1D2PA 1JJUA 2B1HH 2WM0A 3DBXB 1EGJH 5E8PB 2VXQA 1Q72L 2QQLH 2E6JA 3EBHA 4QAMB 5BZWB 2GTWA 1FL5A 5MEPB 3B9KB 3KJ4C 2IH9A 5K33A 1MAKA 1JL8A 1CF8L 3F01A 1TJGL 4OM1L 4H25A 3VWJD 1CGXA 3D7PA 3EJJX 1BX2B 3QIUA 3QIUD 1MG3C 3BUQA 1N0LA 2WWKT 2X4QB 4MHHG 1DVZA 4AI7A 4ZW7A 3RAJH 5F3HA 1XZ0B 1XQ4A 4LQ1A 4PWIA 1CLYH 2KLSA 3CLFL 1JN6B 3DPBA 1J87A 3OKOB 4PW9A 5DMIH 2E27H 4NXKA 2PO6D 4LLWA 4MXQC 1UQSA 1INEH 4HJTA 3SHSA 3I6LE 4DO6A 2P26A 2JMRA 1JD7A 4LLMB 2CO6A 2N7BA 1CVRA 3MODH 3MCKB 4Z7UB 5FS5A 5HJBA 4J39A 4WWKC 1ZV5A 1KGCD 3SGKA 2D2CC 2YHGA 4ES9A 1Z5LB 3U4EA 3LKQB 2CUHA 3FQYA 3TO4C 5BS0A 3BYYA 4AC2A 5BS0D 3FU0A 1LEIA 1T3FB 5EUKA 2BY0A 3EFOB 3NJHA 3UH8A 2XN1A 3QIBD 3QIBA 5DD6B 5J13C 1HZHL 1R3KB 4XPHL 1WG3A 1E30A 1OWRM 1KTDA 3NESA 1QO3A 3JWOH 3RWIB 1JBJA 4R7DA 5ICYA 1BBDH 4O51B 4OLXL 3MI6A 3KLAA 3FQNB 3U2SA 2BWIA 4XVJH 4MD4B 3HZMA 4YSDA 1F4WH 4OD1H 1M2VB 5D4HA 1NMAL 3TWYA 1LNUB 4HK3J 1UXLA 3VFNA 1J12A 1ZE3H 3EDFA 4B41A 3OKLA 4MCYA 1NINA 1S78C 3HR6A 1BD2B 1S7SB 3BZ5A 4PJBE 3OKKA 4ZAKA 3BO8B 1IFHL 1RL1A 4PLNC 5CBAB 2Q10A 1QLEL 3UADA 32C2B 3ATAA 3OPZL 4NZUH 2JK5A 2EDMA 3RX9A 5K69A 3UAJD 1NPUA 2NNXA 1WH0A 5BUPA 1GYWA 4HIXH 1F11A 5EU7C 1SFDA 3L4CA 3CU1A 4PLOB 4FD0A 1A4CA 4Y1SA 1BVKA 4FQJH 4HX1A 4TNWF 4YXHH 5J6GB 1MHCB 4QRUA 4AEEA 3HZ3A 2IPKA 4WEBH 1A1NB 4IMKC 2CALA 4Y4HD 1CFBA 5JR1H 1AGDB 2CBPA 4LSDA 2HLAA 3KDMA 4AEHL 1RZ7H 3MUGA 4FAAB 5I76A 2ZUVA 4LQFH 4ZUVB 4HJUA 3ZQWA 1GZPA 3F65A 3QEGL 3A6CH 3RI5F 3SCMB 4FQQB 1BPVA 3RE0A 2D0HA 4ZI8A 1HEHC 2EEBA 5D7JA 3ZQ9A 3MR9B 5JMOC 2Y25A 3PGFL 4XPTL 4P5MB 3D0LB 2QHRH 5EO0B 2ZAHA 1ADQL 4OR1A 4NT6A 4PJDB 3DUSA 3ZDYE 3MA7A 4AJWA 5IMMB 5JOFB 4D0DA 5IJKC 1D9KA 2X6CA 4F3FA 3D2UB 4S1RH 2H4EA 2WBXA 1DLFH 3MRMA 2DKUA 4DZ8B 5FYJH 3UABA 3QJFA 2Q20A 1MCKA 4AW7A 3HC4L 1VF5C 1RZIB 2LGNA 1CBVH 4YBQD 5J12C 4L4TB 2VM3A 2IF7A 2OYPA 2ZOLB 4QOKA 4R7XA 3DHPA 1ETJA 5CCJA 4HHAA 5AKTA 1A6UL 4HFUH 1BA9A 2W92A 4YE0A 2NY1D 5EOQL 5IW3A 3S37H 2WNXA 1DDTA 3OLGA 4KQ4L 3U82B 4AMKH 2PVIA 4YDKL 4LCYB 1C5DB 2OXGB 4FNPA 2H1LM 4I3SH 4BUHA 4TSBH 5D55A 4X4YB 1CLOL 2J8UB 4UT6L 4ZW3A 1RSYA 3GI9L 1NDGA 2HN7B 3HHMA 2IC2A 3BKYL 3TIEA 3BJLA 2Y06L 3QIWB 1O7DE 2VDQL 4NHCH 5G4NA 2YGQA 4TQHA 4QTIH 2ZICA 1ZGLM 1MRCL 3EBIA 4K15A 6PAZA 4XB3A 3U9PH 1THAA 4HQQH 5E99H 3NABH 1E9OB 4FADA 5AW9B 1RIHL 4XP5H 4G1MA 3GSQA 5GGSA 4Z7NF 1IM9B 4K8RC 4OTXL 2C5DC 1IVLA 1I7TA 1TTAA 1Z9SB 2C9PA 3GPSA 1DQIA 3BYTA 3NFNA 4P05A 5D7SL 4Z9KB 2DLGA 1XGPB 3DRQA 1GTFA 2R51A 3V0DA 4KGLA 4PJXA 2IANB 1ZANH 2NY3D 1A3ZA 4QHUA 3TNMB 1N18A 3N44F 4HC1A 4BH8B 4U1NA 1U8IA 3B2MA 3ZKMC 5HI4D 4MAYA 4NKDB 2GSGB 4DCQA 1SLXA 1AZBA 5EO1B 1R3HA 1MIEH 1NL0L 1NGPL 3BAXA 1U30A 3CIAA 4POUB 5IB1A 3U4AA 3PQYE 4MRCA 2F19H 3K6SA 1T2XA 4JRWA 1HOCA 4JQVC 2EKSB 2LLLA 1IX2A 2B4CC 4QRSA 4ALAL 2YAPA 4D0BA 2XRAL 2EH7H 3VD0A 2D8KA 5CSBA 2WLIB 5JYLA 3X3FH 3TBVA 6FABL 1MWAL 3GLEA 1GYUA 4FI6A 5IMLA 2A9NL 2CLZB 2ORBH 3I75B 4K7FB 5T1KD 3OSKA 3RGBA 2CO2A 2NLJA 3LB6C 3U0PB 3BAWA 5B21A 4DP2X 1XGUA 2R1XA 3MGOA 2W0FB 4OFPA 5T1LA 3SPCA 2X3CA 4TL5A 1L0XA 4I3RL 1T2JA 1A4JA 5IWLA 4WQOA 3MFGB 1ET7A 5JNYB 5KBMA 3DWTA 2OKMA 4ZMPA 2OK0H 3DC0A 1E28B 5KBPA 3KPSE 3RG1C 4ZFFB 2NNRA 4ABQA 3G6JA 2D7QA 4JCWA 3GEFA 5SX4I 5BW7C 4OJEH 3HMXH 1R3LB 4KRPC 3ZL2A 4CN6A 1EHAA 4ODSL 1ZLSL 5C6TL 4FQ2H 1LP9A 3S88H 2ENYA 1EAOA 5MENB 3HNSH 4Z95H 5FDWB 1JZ3A 4AGPA 2GBAA 3LIZA 5FXCH 5CD3B 4I1RA 5IFHH 1A2YB 3RYMA 3RTLA 2VE6B 3IJ8A 4RDQG 2WKGA 5DQDL 2ZYSA 3LN9A 2QADC 1JDCA 3PHSA 3LRLA 3UTPE 4PGZA 4D3CL 1RZQA 4NCC2 1RMFL 3RFZC 1K4DB 3I50H 1F8TL 4RNRB 3FJTA 4Z7OE 3NDYE 5DO8A 4RGNC 1NA8A 2HTKD 3D07A 1RZFL 2EDTA 2ZX5A 2DQUL 2MPAH 4JM4L 2AV1A 5C0AB 3WFBH 4RDQF 4H0GA 4CMHB 2NXYC 5LWYH 5K9JH 1VZIA 4Y4FB 4P4KB 2J57A 4I8DA 1CICD 5EZOH 1CICA 1HHHB 2CA3A 3MNMA 3GHBH 1F5WA 1ROCA 3PLYA 4AM0A 4L9LA 5JW4R 2AK4B 5A6IA 3GXTA 1X5AA 4R96A 1L9QA 5CF3A 1JYXA 4P2QB 2GVYA 2OCJA 1ZXKA 5E1HB 4PJ5A 2RMNA 2ZOKA 5EOTA 3BOVA 3FTUA 3H3PL 2BHUA 2BOBB 4AQ1A 4HUUA 3Q8CA 1QEWB 1RLBA 4IKIA 3JV4A 3EUDA 4LHUB 2CA4A 1IQDA 1I8MB 1IBGL 4GRWE 2VDQB 1NEUA 4XP9L 4Y5VC 5DHMC 5IK3B 1SEQH 1F4AA 3QB7C 2ZXEB 4ZXBD 1A21A 1KXVC 3KBPA 1E90A 3K2UL 1SHSA 5C09E 5KG9A 4KNUA 4LIQH 5SWZD 3FUHA 1NUNB 1DQMH 2X4TA 5C3LD 3QHFH 1HYSD 1NEZA 1OZUA 4WHCA 1UYWL 2YD6A 1KLGB 3DHMA 1CN4A 4I18B 4NYLB 1J8HD 3E1F1 2PTUA 3ZMRA 4EN3B 1VZGA 1YO4A 3IF1B 4OSUL 4DFHA 2C4FU 1LK2A 1MJUH 4KJQC 4YHPB 2HYMA 4FHJA 5FC9A 1A7OH 4S1SL 5HHQB 5CZVH 1OCZB 1U3HB 3TBBA 2R1WA 5F96H 3W9EA 4U1LB 4Y16A 2BVOA 3S96A 5KBLA 1XXDC 2EZ0C 1ZWIA 2K6ZA 1QVOA 4UU9A 1OSYA 4GINA 2EUWA 2BJML 1SEBB 1KPVB 4XWGL 4ZUUA 4Z0XB 2X6AA 3TT1L 2YAFA 3SO3B 1UXWB 3U7YH 1QR1B 2A6IB 2AQQA 5L2JB 5DZVA 4W4NA 3QZLA 1N59A 3FQUB 3OQRA 5DD5H 2JJTA 2CO4A 2VQUA 4LVEA 4H8HA 3C60B 3WAKA 2EXWC 3SE9H 1MWAB 2NCMA 4WWKD 5EBLB 5DEFA 1U4EA 3F84A 3VX0A 4KH9A 3WLBA 1XHHA 3RJQB 4GBXC 5F71A 3EW3B 3MXVL 5IEKB 4ZTOH 1J5DA 1U8CB 1E42A 1ZVHA 5E2UL 1QFUL 3EYFB 3B9VA 2AXGA 4I5BA 4WW2F 2RFXA 3JZYA 4R7LA 3W0WB 4F7PB 1I8IB 5H35B 4NERA 1YMMA 5DUMH 2J55A 5KBKA 3FQRA 3KDPB 3NCJL 3V6ZB 4OLYL 3FU3A 4OU3A 2WN3A 3NA9L 2OI9B 4PTUB 1TNMA 4IGBC 5KVEE 2BVUA 2QZ5A 3TNNA 3HZKA 4OFIA 1M7XA 2FECL 4WI4A 1J9RA 1DFXA 2GSMB 3DX3A 5L2KB 4TKWA 4G7YH 4X7TA 4UOW0 3N06B 2FWOB 3QJUB 4JJHA 5F88A 3QULA 1H8OA 5AKRA 1PVUA 4WHTA 1CPUA 3K72B 4PJGA 1BFTA 1AGFA 4OGYH 1KB5A 4KOCA 4Z76A 2X4UA 4E9WA 4F20A 5EU5A 1V3MA 3P0YL 1WBYB 4KI5D 2Q6WB 3S2CA 4LSSH 4XPFL 3QDGB 3V4PB 5JPMC 5LJYH 1W80A 4W70A 4G9DA 4NQCB 4PRIE 3GSVB 1JI1A 1FJ1A 3RA7H 5C2BH 5CS7A 4BQBA 4PMEA 4K07A 3HE7D 3HE7A 4OF6A 1OK8A 4HLZG 3TCLA 4HF5L 4XNUL 4RIRA 4YR6B 1BQHB 4J23A 2GB2A 5DJZA 4JFTA 5FGRA 2WINA 2XI9A 3BWUC 2V3EA 1QFWL 1JGVH 2YMOA 2DYPD 3PXJA 2DYPA 4PJFB 2VR9A 3CHPA 2EIZB 3QZBA 5D71L 4M7KL 2NSQA 3T4AA 5CEZL 5CSZA 2WAQA 5B1BB 2X4RA 1M42A 2IBZY 1CO1A 3MJ7B 5SWSE 1L9TA 2R1YA 4KKLC 3N0AA 4N3TA 3PUCA 3H9ZA 4HCFA 5D1ZC 1OQXA 1IE5A 2EDLA 1V55B 1RU9H 3FSVA 4HU2A 1JF1B 1BFSA 3G3LA 3MLXL 5HP5A 4K55A 3QNYA 1AGBB 3KXFE 1RIVH 4OAWA 3OJ2C 1KT2A 1H8NA 4XNXH 5H2BA 3X14A 1WWBX 5BQ7B 3BAKA 4FLRA 5GS3A 2CLVB 2MQ3A 1WFOA 2DL9A 3CZGA 2VMEA 4ZTPL 5EIIG 3RTQC 5I8KH 3J07A 3PHOB 2OMWB 4J3VA 4W9HC 4ZDHA 4C4KO 4D8PB 1J5IA 1A3LH 1JFQL 2BINA 1L7IL 2P80D 4JLRA 3GK8H 2WKOA 3W57A 1NCBL 1U41A 4LLVA 3RLSA 4AQEA 3G5XA 4KO6A 1IGTB 3OB8A 1AZVA 3BT0A 5EULV 3SBWC 2C9SA 4DPCX 3PWNA 1X5IA 3MKGA 3GJEB 5ISZB 4YHOH 3T0EB 3IDGB 2E7MA 4UT7H 5L88L 1QLRA 3OXRA 3WY3A 1KJ2H 1T22B 2BVYA 1BJ1J 5GGVH 2VN4A 4KTDH 1KTLB 4GH7B 5KYUB 3DUUA 3H7BB 1V3KA 4DETA 4NCC1 1PMYA 3C5SB 1X5HA 5DK3A 1TLMA 2O5NA 1EDQA 1IGCL 1T89A 3D0VB 3FT4B 5FKAB 2J2ZB 3L3DB 3CXFA 3D25A 3S9DB 2CH8A 3FONA 3AXIA 5A7BA 4WUUD 5D5MB 3H54A 3OHXC 3KE0A 4WUUA 4HJSA 5TF1L 3QS2A 4YSUA 7PAZA 4K94L 5I18L 2I5YH 4PR5B 4DUXA 3DDGA 1MCLA 2ESVA 1MWOA 3MLRH 1BLNA 3P3TA 3BE1L 3IDNA 1P4UA 4NPYB 1V8HA 2QZQA 2ZYHA 3G6AA 2HVJA 4RAVB 1H5BB 4U3XA 2MPVA 1CE1H 1MZZA 3D87B 3QPXH 3OKDA 4PSRA 3F6JA 3FN9A 4HCRA 4AKPA 3QQ3B 2QR0B 1MY7A 1BMZA 4PLKD 3DVGA 3FTSA 5KSAB 3FZUC 1XCWA 4HT1H 4PRPD 1X9QA 3NN8A 4B9CA 1MAJA 2LVCA 3FTGB 3H56A 3LPWA 5T3ZL 5E2WL 4GRMB 2JKWA 1A0QL 3B2UC 1ZDSA 4BK5A 1HEJC 4YPGB 1GGUA 4OFDA 3O2DH 4NRZB 2BXYA 2Z35B 1HHKB 1X5ZA 4P0DA 1L3WA 1JV2B 2XN0A 4L8DB 4JN2A 1KJVB 1TVHB 5KTEL 3BVWA 1VACA 1MJJA 4I88A 1TG8A 1FAIH 4LOFA 4NP4H 3IN2A 5E9DD 5DEGB 4PEEA 4YFLF 4XMWA 4AEIH 5C07D 1AP2A 3O3AA 4YHNB 5DK0A 2DEYX 3VG9B 1RZGA 2QGDA 2PN5A 2X1OA 4IW4C 4JL2A 5DT1L 2PPDA 3DSNB 2FEDC 1N7MH 3MAWA 4LLDB 4YK4B 3S97C 1AD0B 2IOMA 2NOYA 2JB6A 3VFOB 4AQ8C 3BQVA 1F3JA 1CK0L 2JLLA 1JPFA 1SJEA 3KYMB 3ZL4L 3FQTA 1S9XA 2P5EE 4AMWA 1ZHNB 4Q4IA 3KPLA 4Q6IC 3I3DA 1UGNA 1LWHA 3GDCA 1SDDB 5C0CB 2A0LC 1SLVA 5ECGA 3SOTA 4JO5A 3ZR5A 2NT0A 3JSSA 2DV6A 3N1FC 1UFGA 4X6BB 3VD7A 2DEXX 1RZPA 3BKJL 4C83B 1DQDH 3QWOB 2VZ3A 3B1TA 4JCMA 2PXYD 2PXYA 3C8KA 3D69B 4LEOB 1WITA 4Q6KA 1Q1PA 4MQSB 4XWOC 1N8ZA 1XGZA 3PWPE 4TULL 3FHQA 2CNYA 2J6EL 1EMTL 2ROYA 3R19A 4N85A 5CEYA 4ONGL 3MRQB 3MRRA 2GI7A 3M17B 1D7BA 1RY7B 2NRDA 3DX7B 3IE4A 4XC1L 4WDIB 5GSVA 2EIJB 5MHSD 2JJSA 5ACMA 1TUPA 2EYSB 3WFCL 3WN5A 4LSUL 1CXKA 1I3GL 4APQA 4YN3A 2BZ7A 3LQAL 2J5LC 1AI1H 3X3GH 3KL5A 1NGWB 5IGXL 2CG9X 3J27A 2CUAA 4PJEE 1IBHA 4X6CA 3RBSA 3T09A 1S5HB 1HL5A 2ZOOA 1RI8A 4M00A 4F2MA 1W0VB 5DUJA 3WG7B 4PLJC 1RZ8A 4OLEA 4K5NA 5E08L 3QI9B 1BMWA 1WAPA 5E5UB 3Q05A 5J4MA 3QEUA 5DJYB 3AXHA 3AUVA 4I77L 3WHE1 2ZP0T 2SEBB 4LESA 4CN1A 3TYGH 2NY6B 3BI9X 1IC7H 4Z7VF 3U6RB 3E8UH 1I8AA 2XG5A 4QRRD 1I8KA 1DJHA 3V0GA 4UYPA 2YJQA 5C0AE 3OC5A 4U1IA 5DVNA 4ZUTB 3EYOB 5JW4M 3S7GA 3L3HA 4I4WB 4U05A 1YQVH 4UUJA 2GHWB 4K2UL 3LKPA 4YGVB 4QIRA 3HUJE 5KVGH 1KCRH 2HH0L 3SKNA 4PHZA 1JGLH 4O02H 3S35H 1NGYB 3QFJA 4FRWA 3FULA 1OP3H 5JQ6L 4PS7A 1T0MA 3B9KC 1BQKA 1J1PL 4NO3B 4A7GF 2X6BA 5D96B 3VACA 4GT0A 2BOCB 2JSFA 3EDKA 4DP0X 1CVSC 1J9CT 3Q2NA 2AJZA 2PTTB 3P1VA 2B9AA 2EIBA 4NUJB 5DS8A 4UQBA 5D7LE 5CFAA 3VW3L 3JWDL 5DVKA 3V5DA 3EXJA 5EBGA 5FYKD 4H88H 1OAUL 1VPOL 5HHNB 2HP4A 2WIIA 3FUNA 4P8QA 4XP6H 5FK9B 1SN0A 4IBZA 5ES4B 4LOVA 3VXQB 4GMTL 2X5PA 4MQ7B 5I5RA 1JGDB 1R3IH 1S5IL 4HUWA 4QJ3B 4Z7WA 3ZUNC 2CO3A 3S36X 1HXMA 4DERA 3ZKNC 4M7LH 4F9LC 2WQWA 3ZE1F 5BRZD 5D72H 4KNQA 1BXAA 2GK0B 3BISA 3QDMD 2VXUH 1KB3A 3WIFA 1J5CA 2RAMA 2G9KA 4XNMB 5F7DB 1TCMA 1TFPA 2KT6A 1EO7A 1DBAL 5F21B 1PKQE 4KO9A 4OD2B 2QJDA 3KEHA 3CCHA 4GW1A 3DV4A 4H20L 5F8RC 5FCSH 2WVUA 4ILDA 3SPVB 4M1CD 4XO9A 4HXBL 4HOZA 5K9KB 5AL8A 3I74A 2QFPA 1IM3B 3BN9D 4JHWH 5EC2A 4PRHD 3V0IA 3LJ3A 3IMBA 3SY0A 3KYNB 1PDKA 5IROA 4LVNB 2NZ1A 3U1SH 1HXYA 4KPHH 4B9FA 5AUMA 4P46D 5I9QC 4QO1A 3ZKQD 2WWOA 3NSFA 1ASPA 4YWGH 2AJVH 2YQ2A 3GUFA 3PE9A 5DZ9A 1ZDQA 3WNLA 3ZE2B 5TE6H 5KYXB 5DZPA 4XBEH 5JDSA 2F54E 3NAAH 2HRLA 3UPRB 2ZUYA 1H19A 4L18A 2YPKA 3N9GL 3O6LL 4YC2B 5IVOA 3ZIMA 3K8KA 1U8MA 2WPGA 1JG9A 1KPUB 1QLFB 3E3QC 3ILPB 1CQKA 3GJFH 3QPQC 5GS0H 2HA1A 3RY6A 2KDGA 1QRND 4TVPH 4G8GB 4CDHA 1PG7X 5F9OL 4Z7QB 3FB8B 4PJIB 1JNJA 4PGBB 2WTPA 1A7RL 4K7PY 3UZQA 1XCXA 3VGBA 3MLZH 1RERA 3IFNL 1GSKA 5DJ8A 1KLUB 4UV7H 3L9EA 5CJOH 1RZJC 2A83B 4L8SB 1PKOA 3PDOA 3SDAC 2WV3A 4ZMZA 3NEEA 5D2LA 4YSQA 4LCCA 1B9ZA 2WNGA 2VXQH 2FAUA 3L08A 3DO7A 2BS8A 1JZIA 1MCDA 3BP4A 3N42B 5HHMD 5EOCJ 5FKPB 3MGAA 3F8UB 5D1ZD 1QKZH 1IBBA 3V0WH 3VXUB 3CK0H 4IEFA 5DJDA 3VGAB 3ZTCC 3QORB 1RHFA 4D9QE 2LQRA 3IKCB 5EU4A 1F4HA 3BUDA 2WLNA 2ADFL 1UJ3B 4Q2ZA 4MJ5B 1DBJL 2QL1A 4FLQA 3ROOA 5DZOA 2BS71 4E41E 2EINB 3ISYA 1FYTD 4JZOA 1U95B 2XY1A 3MRLB 3NIFF 3OAUH 3MACH 1NCWL 4EDXA 3FRUA 3VI3A 5ICZA 1N67A 4KK5C 3GSOB 1IGIH 5E6ZA 1LE9A 1ZLDA 2HRHA 3H2PA 1FE8L 3OR6B 2DQTH 3QVAA 2DYSB 5EOCH 4KKCD 4O4YH 1CL7H 1QSFB 3FO0L 4LOUC 3SYQA 2VRAA 3QIWC 4ERSH 1F4YL 3UO1H 1NDTA 1OSZA 2C3VA 4OT1H 1Z0NA 4WTXA 4WNJA 2WWMC 3T0XA 2XWCA 4QWWD 4L1TA 4LO9A 3WHXA 1KYFA 4ZG1A 1SMDA 1WWAX 1C1EH 3WMSA 1MFCL 2X10A 3QUML 3PG2A 3TX4A 4Y19B 1LEKA 5L4IA 2DQEH 2NX5D 3BEWB 3CXHJ 4APXB 3I9PA 4R26L 5C0BE 4UTBL 4YHZL 4JPKL 3II2A 2V2TB 4G9FE 1RVFL 2CKBB 2DIBA 2Q7YB 1CU4L 4QGYA 1TJXA 5EF0A 2CE6A 3O45B 4WJ5A 4XCFH 4EKJA 4OCXH 2DWSA 1TQSA 2NQ3A 3CZSA 3L1GA 3O3UN 4TSCH 4YDJB 7FABH 2G5RA 4KRMB 5TE4L 1RURH 4X98A 5HDQH 4OF7A 2OR8A 1K6QH 4ONFL 3V6BR 2AJXL 3ESOA 1P4LB 4U31A 1QZ1A 4MAZA 5I1GL 2KH2B 1UB5A 4R83A 1OAYH 2EEAA 4QXTB 1GAFL 4Q9QH 5B1JA 1S9VA 2B3IA 2HX9A 4HKBB 2F7QA 3B2UD 4DP5X 2YK1H 1M7IB 3IDJA 3GUTB 4L4JA 4NO0A 4Q0XL 1E4WH 1S7WA 3DX6B 1MW0A 2NXZB 3QXAB 4GW4B 1OGAE 1KYOJ 2L7QA 5JO5B 1T1YA 2WMPA 3S0PA 4BFIA 1UWFA 1XF3B 4NB7A 2EKJA 4TQEH 5H94A 2CDEB 3ZE0E 2OAAA 4JFHD 3NPZB 1ZK9A 3DRTA 4RH4A 1MF2L 1L5GB 4E9LA 3DIFA 5I8EB 1GHFL 5E00B 1BEYL 1P7KB 2CDGA 3HI5L 3KLQA 1NGZB 2E74C 4HW6A 4XN4A 2AABL 2ICWI 2IQ9H 1OAKH 4X99A 4OLUL 4GUOA 4FOMA 4ZUWA 4U1SB 5DS1A 5JOPD 4TUJB 4GRLC 2C4FT 2H3NB 2F8OA 3U9WA 1WZLA 3KPPB 4EZKA 3HFFA 5CKAA 3GTNA 2BVTA 4P48A 4HV8B 2FD6L 3OC8A 2DBLH 5TDPA 1H0DA 3OMNB 3GHEH 4DGYH 1ETB1 2HZHA 4OVVA 4I1NB 3M8OL 4DOHE 5I6OA 1IAOB 3R4DA 2L04A 3EDEA 2DLHA 2O6PA 3DO3A 1RUKL 3P3UA 3WKQA 1BREA 1X7TA 1A47A 1ZT4B 5IQNA 4B3EA 4AWJC 1P5UA 4NRYB 2FR4A 5DJ0A 2ALAA 4GUPA 4H2CA 5AD0A 1Y18B 5C08E 3KM1A 1UT2A 2CK2A 4Y4FC 4L48A 3LZLA 2XN9D 4ICWA 4JX0A 4AIZB 4WWPA 1N3NB 4IRJB 3UTTB 5CJQH 2K8MA 2AI0H 3RWEA 4LRNL 5D8JH 4U3SB 5DQJB 3MUUA 4XXDA 2B77A 3TBSA 3MGTB 4N8CH 2R23B 2ZXAA 4Y5YA 5LBSH 2BSEA 3IXTB 3M1BA 1NIDA 1I85A 5CJ5A 4PVBA 2XWTA 5EEWA 4DAGH 2DM4A 1NCAL 1KCSL 2V7NB 2X1WL 1SZNA 2VLKB 2LU4A 2NY4B 1MCOL 2FJSA 3NIGB 5LCVL 4OGAD 4ELMB 1LE5B 1OD7A 3GYRA 2X9XA 3T3PF 4PLJD 1TJIH 2VW6A 3P73B 1J1XH 4FG4A 2FH8A 5I1EL 5HHXL 3FH7A 4DVRL 1EAJA 1QWHA 3AROA 1MFAH 5B8CC 2FX7L 5E94B 2ZP8A 1U8LB 2NY0C 4AV4A 3N1GC 3JUYA 4AYFB 4XOEA 4U3HA 1H3WM 3CSPA 4MLSA 4LGRB 3FUEA 3QUYB 3VWKB 3WV0A 2X41A 3GT6A 3QNXA 2VR8A 1I7UB 3T5WA 1D5ZB 2EVIA 3MDJA 3TA3A 4N22A 5E8PA 2EDOA 4PG9A 4PJ7A 3UG3A 1U3HC 1U93B 3QZNA 1P84J 3QR2A 3PRZA 3FN0L 4XNZC 4YHMH 5E4OA 5DRZB 2AANA 1N64H 2ICEC 2V2WB 3AU1B 4JB9H 3WNNA 3K6IA 2O5YL 3KWXA 4LL9A 2VDKH 3CFJA 2VJXA 2HVKA 3M1CA 3RB7A 5HYJD 5HYJA 4X6DF 4ZD3H 1JXKA 1P6FA 1RFDL 4PCTA 3U4BH 3LD8B 1XZ0A 1GGIH 3FOLB 3QJVB 1JN6A 2MCPL 4WK4B 4JO2H 2FCBA 2G60L 4JAMA 4FMVA 4M6OH 1SJHB 5I1KH 1IAIM 5FCUH 1F2XK 1HL4A 4PJCE 3C60C 4F2EA 1Q9OA 1UEYA 3VA2C 5IVXB 3LIZH 2Z4TA 1Q0YH 3CZJA 4RFOH 4YNYB 3LKOB 5DTFB 1V3LA 3CFBB 4JPIA 4ANVA 5F7NC 3IMSA 4EPSA 5KVEL 4M9PA 3TJPA 5IFAL 4A04A 3EFOA 1FNSL 1KIQB 2CR0A 3B7YA 3HNTL 4K9EC 1W9XA 4ODHH 5FDYA 3UYPA 4HJ1A 2VLRB 3ARGD 3ARGA 4PJXF 2ATPA 4LSRH 4W6XB 4XZUB 5DJXB 4JPQA 4MA8L 3CN0A 5E8DL 3FO9A 3RWIA 2J21A 4FZEL 4XN1A 2H32B 4BJLA 2VABB 2OI9C 3IMRA 4Q74A 1IC5L 3TEYA 1KELH 3NGBB 1TZGL 2P5WE 3ME0B 2O61B 1QD0A 1S9YB 3CDZA 5ACZB 3T8XA 4ZMVA 4IBYA 2R7EB 1Z1WA 2UX7A 1HSAB 2GBTA 2DQDL 1MFVA 2I85A 1XIWC 2YMXL 5DFVC 1BD2D 1X5JA 1BD2A 1VFAA 2DQCH 3QUXA 4JPWH 5KJRL 2WK2A 2DLFH 4FQ1L 3B2DC 4U0QB 4JFOB 1RHHA 1EEZA 4L1SA 4Z78B 3S36L 2YRZA 3G5VA 3X11B 32C2A 1TF4A 1GOHA 2ARJQ 1GC1C 3BIKA 2ZUXA 2BSSB 1F42A 1LD9A 3HPJB 3QEHB 3UBFA 1R0AH 1D6VL 2IWEA 3WXVH 4PG2A 1TEFA 3AXLB 3L4YA 4UWQB 3WL9A 3CWGA 1AQHA 2FQEA 3VI4E 1VERA 3QCTH 4ZTEA 3U4KA 3KLHC 1NAMA 5AVVB 4N5ED 2R27A 4DFIA 1JWMB 4U6YB 2WB7A 1A1NA 3ERXA 2WB1A 5DUBB 2GJ6B 1KBBA 2OMVB 3QDAA 1R17A 3FQWB 4JJOA 5LN8A 1HXKA 4PJ9C 1MREL 5HBBA 3NA4A 2JVUA 4X5XA 3QHZL 1JRHL 3G6JF 2JH2A 3SCMD 3SCMA 2QKIA 4BRVA 4EDWL 2R4RL 1D5IL 3EHBB 3CVIL 4GG6E 4ATTA 1ED3A 2Q86A 3RHWF 1LP9F 3D0LA 3A0OA 4KJYB 4MWFB 5JOFA 2WNWA 3D2UD 2X0VA 5I6PA 2OMBA 4GQZA 3ULVD 3SYOA 4E2OA 3G5WA 4NZJA 5BVJB 2A74A 3FCSA 4XX5A 5CP7B 3QARA 3EGSB 3T6XA 5JHDB 1YEHL 1V7NH 4LU5H 1ZT1A 3BSZL 3L9BA 5I1LB 3PP3H 3QWRD 5DZNA 2WSPA 1E5UI 2FLRT 5HGAA 4OV5B 3FT3B 1FSKB 2APVA 3DA0A 2IPTL 4DWHA 2NNAA 5E5MB 4H8UA 2YSSB 3ARSA 4PMFA 1ZA3B 2FEEL 1EXHA 3P40A 3VXRD 3JQOB 4WO4B 3VXRA 3RNQB 1LO4H 4HIIB 4KNSA 5GJTH 3VXMA 3G5ZA 4U6TA 4ETQB 4UB0L 1GL4B 4MJID 4G3YH 1VCBC 2N1KA 4MJIA 5T3XL 3T0EC 2HJLB 3FUMA 4OLVH 1AE6L 4LOUD 5TD4A 1OM3H 1ETZB 5EA0H 4CVXB 4XBMA 1FAKT 2H2PC 3DOSB 4MNQE 5DYOB 2XUWA 4LRIA 3FU6A 4BFGA 1CXIA 2CCLA 1NEZG 1JNHB 3A67L 2GAZA 1EUTA 2Y7NA 4KVPA 4V2CB 3OAYK 4BCZA 1RUPL 1LO3H 4XMXA 5DO2D 5DMGD 1RSFA 5ESQB 5CZXC 3D39A 1IM9D 3GRGA 1IM9A 4JFXA 1OGPA 4XAKD 5D1QB 2X53A 3VDCA 4J5VA 1LEGA 2P44B 3OZ9H 3ZIYA 1QTYT 4HCIA 4CUCA 2E76C 5L6YL 4O2EB 3ELAT 1KB5H 2CJUH 4Q52A 4Y2DA 4HKXB 5KYWA 2BRQA 3DBSA 4DQOH 2YMTA 4U6XB 2YBGA 3GMPB 1XCQB 35C8L 4NKDA 3IU3A 1H5BC 4Z3JA 1IZJA 3HBZA 5F1IA 2R0ZH 3PWLA 4JM2B 3JV5A 4DVBA 2JIXB 5KSAC 5JW5B 2ADGA 2EO7A 2Q76A 1ZS8B 2LLGA 1QNZH 2OTPA 1JZJA 1JHKH 3CG8A 4ZFOA 1KJ3H 2WP3O 2XIBA 4YUEL 3GSNA 5T33L 2WLIA 1FBIH 1YPZA 3NCFB 4M29A 2VOTA 1U0QA 3KL0A 1CG9B 3CHOA 1NFDA 3L5JA 4JQIL 3Q13A 3QJSB 4WJKB 4LPCA 2QGCA 3LRKA 3V6OA 2NSXA 3X17A 3SDDB 1MHEB 3ZL1A 3QRLA 3NZHL 1SXSA 3LMJL 3QDJB 2E7LC 4NNXB 4Z8FH 2ZUSA 2X6VA 3CDGB 3KH3A 1EO8L 2NR6C 2YGNA 1CE6A 3VQ1C 3QUKB 2BRRH 4WWNA 5IIEB 3CPLB 3UBXB 1E28A 2A38A 4IDLA 4JRYA 3VXOB 2FSEA 3UTQB 1IAIH 5F7YC 3K4ZA 3QFDB 1VFUA 4XOAA 4QYAA 4YK4C 3GGWB 2X70A 1X44A 2HFGL 1QBBA 4PWFA 3ZDXF 3WD5L 1OF0A 1NGQH 5HYIA 5C0DA 2KZKA 2XOTA 5MEND 4IBUA 5FDWA 1G9MH 4WHYG 4HSCX 2C7UA 5F7KC 1Y1UA 5IR1B 2R4SH 4WFED 3PREA 2JCCA 1MFEH 1BXVA 1FNLA 4J8QA 3H7LA 1E4XH 2DOCA 1JFHA 5I5MA 1G7HB 4PJGF 5C6WH 3RUGA 1DVXA 1FNGB 1I9IH 1RJYA 3D2TA 4G6KL 4U0RC 4WFGD 2QT6A 4KI5F 4RNRA 3IVKA 1JCKA 3THMH 1TKWB 2I07A 2YXWA 1SOSA 3PNRB 4FQCH 4J7RA 5EZJA 2ZJSL 4AX3A 5EEZA 4JUSA 4ABWA 4P4KD 1KYAA 2VLME 4GS7C 3GXFA 5DURD 1Q9WB 4XBPA 3ULUL 2CIKB 4J4PD 4J4PA 2D31A 5K39B 3WTYA 3AGVA 3EJUA 1KJMA 5LGJA 4BGLA 2AK4D 3DGGB 3V5HA 2YKLH 3ECBB 5IJBC 1E4KA 4Y2OA 4P2QD 5IOPA 4P2QA 4PGDA 1UKTA 2JKJA 2DQ6A 4KYWA 1HQRB 4AZ8B 3B7SA 4P2OB 4V1DB 4UT6A 1YNTA 4Z7NB 4LHUD 4FA8A 3KEDA 2MCAA 3TVMB 1R5VB 1I8MA 2YAHA 3HLAA 4IRZH 5A3IC 2G75A 2CDFB 3EYUH 4XNAA 1E8WA 2GFBA 3HNVL 3QI9C 1OTSD 3GNMH 5DI8A 4J12A 3DJSA 4HCRH 4XE0A 3NCYS 5D1XA 2BP3A 3EOBB 2NY6C 1ORSB 1I9JL 3GINA 2BP8B 2I9LA 4U1HA 5ERWA 3GO1H 3MYJB 2B4CH 3A3YB 4I0KA 3HI1A 4I18A 5BJTB 4EN3D 2BIPA 1IILE 2GITA 4OCLC 5BVPH 4NO5A 5EZLB 4ACPA 3CHRA 4FKEA 4MMZA 5FHAL 4H13C 3TYFB 3WDIA 4LASL 1FL3A 3OMZA 1JF5A 2WKOF 4BQ6A 1P1ZB 3AWEA 4MX7B 4XPBH 3NZUA 3RWGB 3MTRA 3QRGL 4V33A 3ULSB 2G2PA 4IHBA 1M6OA 5KOVC 5D96C 2Z7UA 3CXHK 5DXWA 4RA0C 5B38A 1G6RL 3MMEA 5KBDA 1FN4A 4HUMB 3CH1A 4Z0XA 1A8JH 4LGPB 2FK9A 1T4KB 4K5MA 4PVNA 3TM6A 4B3VA 2KZBA 3KPRD 3SDXA 3KPRA 5F70A 3OL2A 2IBBA 2VQTA 2VSMB 3VU1A 1AS7A 1I7ZA 3HFML 5I19H 1S46A 1IUZA 1MWAA 4NLHA 2BSRA 1HSBA 1O6SA 2IDCA 3AUWB 2W0LA 5F0PB 2J43A 1S7UB 4GY4A 3PCYA 5FFLA 3Q5YA 3L4WA 3WTVA 3SO5A 1DQQB 4ZMAT 1UACL 3C6LB 4M56A 2QLVB 4LLQB 2DF3A 2VJ0A 3ABLB 2FB4H 3W0WD 4F7PA 1HINH 1J9SA 1SVBA 8CGTA 1I1FB 4UDUA 3L95B 3OJDB 1JDAA 2OV0A 2X12A 1A4KB 2DIJA 3NZSA 1G4MA 3MRNB 2IXQB 4PTUA 1KYOK 1N4XL 1OHZA 3HAEA 4MMYB 3WGVB 3REWB 4OF3A 3BVXA 3O4OC 4YLCA 4JHUA 1PSKL 3D5OF 5DFVD 3K72A 1DEEA 4PP1D 2X4NA 1NCDL 2V2XA 3BSHA 5F9JB 1GPOL 1WBYA 3EAKA 3FUJA 3QDGD 3QDGA 5CGYC 3MV9B 3WE6A 4YC2C 5IW1A 2UY6A 2OL3H 3GSVA 2VDNL 1A6AA 2NW2B 4OZHE 1LDPH 4FLOA 2W65B 3GMNB 1S7VB 3U2JA 4JFFE 1Q9KA 2V5YA 4AG4L 2KYIA 4POZC 4IOFC 1HHJB 4YR6A 1PLGH 3W11D 3T71A 3KLHD 4MA3B 5C0IA 3ZZQA 1YEEL 2ZNWA 1AS8A 4NQDB 4R97B 3PWJA 4WK0B 4X6FB 3V8CA 2HWZH 4TVUA 4L8SC 4AKQA 3VD3A 3IWUA 3AAZA 2EIZA 4OCRH 2J56A 3F04A 3VRIA 3RGVC 2NY2C 4CSTA 3EZ8A 2R29L 2BNQA 2Z1PA 4NQVB 2X9ZA 3FCTA 4CBZA 3MRIB 1J10A 1K72A 4FXKC 5C2UB 3VMNA 2NYZA 5CCKH 1G4RA 1UCTA 1KG0B 2EDYA 3HG1D 3HG1A 1QUNB 1IEAB 4XCCL 3QORC 3UTZA 3FAXA 4KJWC 4BKLB 1UJ3C 2GYSA 4WGVB 4NKIL 3VXSE 3BQUB 1AGBA 5FECA 1YEFL 2VZSA 3MRJA 1JHTB 2D03L 2DJSA 1GYVA 4IBQA 5FYKH 2V5RA 5AALA 1AOHA 4FJ6A 3KVPA 2UWEE 2IEPA 3QC5X 1K5NB 4MB1A 1UZ6F 1H3TA 3ZXAC 1GCFA 3GDBA 4HS8L 5AYQA 4D7PA 5HGHB 1KGJA 1QBML 4HFWB 2CK0H 2WQRA 4JDEA 4JHVA 3OXSA 3PV7A 4GYBA 4UNUA 3G9AB 2BCKB 5ISZD 3UC0L 1AIFB 3LS4L 4M8QB 2YZ8A 4FTVB 5C0RL 5HI3C 1BIIA 4YFEA 3ZBMA 3BDXA 3RX5A 3O2VL 1C16B 1KMGA 1T03L 1AJ7L 3AREA 1C12B 4WENB 3VNZA 3B2XA 4X6CF 4QF1B 2W59A 4KY1L 4N0FB 5JIPA 1DZBA 3OSVA 4DGIL 2GSIB 3C5SA 3ZSSA 3VG0H 1P84K 1NCJA 4OGZA 3V4VA 4AITA 1M3IA 4AXWB 3I6KB 3FT4A 4QTFA 4UQAA 2QKSA 2HTLC 1E6JL 1HI6B 3RB5A 1C7TA 5IQLA 8FABA 3MNWB 1BZDA 1KPRA 1Y0LA 4WW2B 3NEXA 4XTRC 4XVUC 1A6VL 4WTWA 3GXMA 5LHDA 4HPYH 4NHUA 4CVUA 4JFEB 3T0VA 4NRXB 5TQ2L 2XXCB 5HHOE 9CGTA 5HYQB 4K5OA 2E46A 4OI7A 4A38A 1JNNH 2AP2A 4HH8A 4G8FA 4JFDE 3FFCA 3QQ4B 1M71A 1YMHA 3HC0B 3ARVA 5C0FB 2ICWJ 2X2YA 3WUWA 1GJWA 3TURA 1YQ2A 2VDRL 3KR3L 1QBLH 1GOFA 2PP9A 3VA6A 4YHKL 4JREB 5KSAD 2PYFB 4XO8A 3RIFF 4FXGA 2ROXA 3FTGA 4N0UA 3C5ZA 3FCBA 2HJKB 3IMUA 4GRMA 2VQ4A 4UAHA 3V4UL 4AJ0A 1YZZA 1BYOA 2FYVA 3KPOB 2PR4L 3CVDA 5IQMA 1J0HA 3VGHA 5ANMB 4IK6A 4DN3L 4I7ZC 3TO4A 2G9HB 3C9NA 3MLYL 4N2CA 5T1JA 1OPGH 2E47A 1TVHA 4YLQT 1IARB 3DPDA 3RWJB 1JGEA 1JK9B 4UMSA 1FNHA 1UD6A 1F97A 1MIML 3GSXA 4TUUA 2ITFA 2VDNB 3L9RA 2FYYA 3L3OC 4EXPX 1JTOA 4PJAA 4LEXL 2X05A 3TESA 4PJHE 4PCYA 3KVQA 3VFTA 2BXZA 2JKRM 4LLDA 3WJMB 4XMZA 1K3IA 1I75A 3VFOA 3E6HB 3E8VA 3IMWA 4G6AC 2WW8A 3WUZA 5CEZD 4UT9H 1ADWA 1EZLA 1TPXB 3L3GA 3BH8B 1NJ9B 4J6IA 3WJLA 4QXGH 3UYRL 2APBA 2MWCA 1JPGB 3HHSB 2I69A 4XHJC 5KVDH 5TDNB 3WN6A 5INCB 4XN7A 2OMZA 1ZGLB 3PP3K 2EYRA 3ARXA 2XTJE 1I9EA 1SDDA 3CDCA 5C0CD 1KEGH 1OIOA 1MNUH 4UIMB 3WIHL 1QW9A 5AQ0A 4GKNA 2GJJA 4R0LB 5KYYB 1FG2B 5D7KD 3V8OA 3PHQA 3X1BA 5IHZA 1DBML 2ZOTA 3UMNA 1XL6A 4Z0BL 1OM9A 3E9TA 1WFJA 2Y6SD 3UPCA 1T83A 4QY8B 1SYVB 2A73B 1NUDA 1WC7A 1OGSA 1WZ1H 1H3PH 3DX7A 3V5KB 4MS8D 4M7JH 5T8IA 4KUZL 4M7ZC 1TJHL 2G5UA 4WKXA 2MTAA 3VFVB 4LK4A 4L0YA 2EYSA 3MJ6A 5I6XC 2PW1B 2YA0A 4KUCD 1OT2A 5EUOA 4WI6A 3VNYA 4CSZA 1B2YA 5AW6B 3SY6A 5C0EA 4RRPM 5D2LF 5BQDA 1VADA 3IDYB 1PLCA 2W95A 3MRGB 3ETBJ 3P30L 3Q7JA 2WQXA 3WEXB 4HEME 2JF1A 1WCQA 2P24B 2YLKA 4KK8D 5D9SA 3EFFB 3M7FB 3LKSA 3F12A 3QO1B 2F7IA 1XR8A 1QACA 2XICA 4QMEA 2NY6D 5FM4A 5D7HA 1CD9B 2IGLA 2NZ9C 1Z6JT 1JV5A 3HMWL 3QUYC 4NZDA 1XAUA 1NDMB 4RZCB 3VWKC 5MEOB 3QGVA 3RWDA 2QDVA 5I26A 4X4ME 5DZAA 1AD9A 1QYGH 3SPGA 4OCNC 3WDHA 4DPBX 5K1NA 3Q1SH 4HBQA 4LBAA 1RZKH 3U36A 5JHLH 1HH9A 3RWFB 2DMHA 1B90A 1G7PB 1OB1A 1NCNA 1M1XB 3BKML 3BD5A 4PB9L 5CIPH 2D73A 1GMIA 2P8PA 2YPLE 3UDWA 1JTPA 1IAMA 1JGUH 4JRXE 4JFUA 4IRSA 3VI3F 3NH7L 3AZUA 2ITCA 3U0TB 2BOCA 2VDRB 2BWQA 4QXUL 5ESVB 2PTTA 2YOAA 4NUJA 2H1PL 1NLDH 4H0LC 3EIFA 4YZFF 4RQQB 2IAMB 2SODB 3H8NA 4AKOA 4MYWB 4XMLH 3BD3A 5FK9A 2J7LA 2DQJL 3MROB 3B2VH 3VXQA 1MLCB 4HIHB 2GI0A 4UV4H 2FL5B 4I13B 3T2NL 3W5NA 5IG7A 3O11B 4O2FB 2RGSA 4WVRA 4XH2B 5KSBA 4LARH 4PRDA 3VFMA 4G80B 1D5BB 2XTSA 4ZO9A 4TTDC 1H6EA 2CGRL 2WXHA 1KBWA 4ZS6C 1QTSA 4GG8A 1T21B 1INDL 2XKSA 4NN5C 4XNMA 3T77B 5AOIA 1FCGA 3V9EA 1S2EA 3DX8A 3QISA 3PAYA 5D2NA 2EYTB 4H1LA 1A6WH 2HKHH 4XRCB 3MRDA 1EZSA 4G6ML 5C0GB 1T5WB 3BAYA 4N1HB 3MV11 3CFCH 4XGZA 3V6FA 5IVZB 1JXDA 1IM3D 3NJJA 2NY5H 5FYJE 5BCAA 5CZRA 1PD6A 3SJVE 3NCCB 2PYEE 1QSZA 3T3ME 4U1JA 4A2GA 4FQIH 3ROLB 1T66C 2OSWA 1PS3A 3FB7A 3MRPA 3P0VH 1TENA 3B8YA 1ZTXL 3BVNA 3SKOB 4I0PA 5A16A 3PFUA 2ZF8A 4A6YH 1O9VA 5CINH 5A6MA 4U1GB 5ABDE 2HT2C 3RWCB 3V0AC 3IFPA 1E65A 3D4CA 4RBPK 1IZKA 1V3JA 1BCIA 5CGYD 5IESH 5L8KB 4FP8H 3M88A 2K1MA 4LCIH 1G6VK 1PW3A 4N6RB 1MI5B 4HPHA 5J11C 5E6ID 5E6IA 2UXGA 2ZSVA 2D7NA 3H9SE 4G8GD 3CD4A 4JY5L 2Y5TA 4IOFD 4Y1AB 1JWUB 4OQTH 4PJIA 1BZEA 1GGYA 2PPAA 2XXFA 4FQXB 3QJQB 4NO2A 1N5YH 4LVOC 2XV3A 3KS0J 4LSQL 2YQGA 1HHGA 3O9WB 4HJ0D 4U6VL 5I1CL 2V7HA 1KENL 1FPTL 4XBGA 1L0YA 3I2CL 4OFQA 4EE2A 5M95B 1D5XB 4JPVL 4Z3EA 2GIYA 3V0VA 4P2RB 1DLHB 4Z7VB 3RFZA 1VENA 2DQIH 3HG4A 2ZXQA 3VXUD 4JDZA 3ZDZF 5I1HH 1NKOA 3IKCA 1KIUA 1TZHA 2XACC 4NDMA 4X4ZA 2GJPA 5IHUH 3TU6A 3UFIA 2V9TA 5DMKA 1FGVH 1TMCB 4MJ5A 4K23L 15C8H 3RVUD 1MVFA 2AGJH 1RKRA 2L3BA 1GS6X 1H9VA 1V27A 4YSPA 5G2NA 3ZKSD 3STZB 4JHAH 2FBJH 4NUGH 2YGOA 4MDRA 5LNEA 2AEIT 4GXUN 3TTYA 4A2HA 1SN5A 2A4ZA 4MD5B 3MUY1 3U6XS 4TNVF 4ENZA 1KXHA 1IQWH 2ARJA 5E2JA 4K7PH 4WO4C 5F97E 3GSOA 2VC2L 5D70H 3ZGIA 2W60B 4LOEA 3VCLB 3EJQA 5C71A 1QSFD 5JIMA 1QSFA 4X8CA 5FGBC 2Q7NA 4XXCA 3C6SB 2IQAA 3ZUCA 2YKKA 2X40A 4H40A 5IQ7L 5E8OB 3MV7B 1F1DA 3JWNE 1O6VA 3BP6B 4UQ9A 2VDLL 4QHNA 5CLYA 4YO0B 1AZUA 4E0RB 1HQ4A 3ZE1B 1DVQA 4LCWE 4JDVB 3MUJA 2R56L 1AANA 3BWZA 2IALA 1CZ8H 1YNLL 3T8MA 3D85B 5I30H 2M83A 3ATDA 4Y19D 1USZA 2ZYIA 2YXVA 2E7BA 3N41F 4NZ8A 5DA0B 5DJCB 1NLBL 1MQKL 3BEWA 1YEGL 1RK0B 2CZNA 2AKRB 2BERA 5CWSA 1EEUA 2X7LA 3MCLL 3HN8A 5TFSH 4BEIA 43CAA 3Q3GA 2GPZA 5DD3L 2DBJA 2EILB 2GIMA 2LAGB 2V8LA 1G7JB 4J3XA 5EDXA 3TN0A 4ATWA 1ACYL 1CDCA 4JFVA 3SKJH 4PJ7F 4QKTA 4YDJA 4AIEA 3RILA 4CC0A 2XVLA 4FKKA 3WKML 3SB3A 1TSRA 3CZFB 1C5CL 3CTTA 3D3VE 4F1SA 2HKFL 2PKDA 5LQBH 1NAMH 4PJBA 1DQTA 3ARDB 3O8XC 2WQUA 4QHKI 3EGDB 2ZXGA 2VUOA 2VXVL 4YDIH 2AJUH 4N0CC 1Z3GH 3ILQC 1N2RB 2GW5A 2HX8A 4QXVA 4O02B 1CFNA 5HY9B 4HH9B 1IEBB 2NXZD 3A23A 4EIUA 1O9WA 3VGFA 5JW3L 3NJMA 1MG2C 4Z7UF 4J6RL 1V7MH 2XQ0A 4GAJL 2CM6A 2YFOA 3ULVH 5INDB 2RQEA 5GIRA 3L5XH 2V9RA 3LH2H 4Y4KB 4IGBA 3FHAA 2AFNA 2BIIA 4PWHA 3T1FB 3KD4A 4MA7L 4NIYE 2EDDA 5EBWA 4ZMOA 1W0WB 1LM8V 1NGZA 3KCWA 1MFDH 4FLHA 4LIQE 1UH3A 5EPMB 4NENA 4QRQB 3ABZA 3TZVB 3RVTC 3V0FA 4U1SA 3MLVH 2JJUA 4U49A 3UP1A 2PWDA 2VRKA 1NAKH 3AS0A 3B3IB 4YDVB 3GMMA 3RJDA 3VYPA 4POYA 2PW2B 4U1MB 2X4SB 4RMRA 1Q72H 2BW5A 2OMYB 4GLRH 5DHVA 4ODVL 1AO7B 1ROWA 3ARRA 3DVNA 4AUUA 4L4VE 2XJKA 4BK8A 1RULL 1UGKA 1IAOA 1CF8H 2ITEA 1TJGH 3JWOC 4OM1H 4V2BA 4XCEB 3N0PB 4I2XB 2WLYA 1VFBB 1XEDA 2Q8AH 5DJ6B 2BNRE 2Z34A 4L37A 2XKNB 4KXZI 3CLFH 1N6QL 1CYGA 2Z31A 4NFDA 2PABA 1DDHB 2ADIB 2WBJA 1ZE3C 4IDJL 1T0PB 2KKQA 3GIZL 3RZCB 4IRJD 3UTTD 5TH2B 3I84A 4ODWA 1H56A 4MASA 1XF4A 3LOWA 5HDRA 3DLQR 4L1BA 1BECA 5IHHA 2DIEA 2OR9L 3IPBA 1JZFA 1XWVA 2KZ1B 2NY4D 3RJOA 1JPTL 3GJFB 4KROB 3TVMC 4CN4A 2ZTBA 1AHWC 4XPHH 1CDJA 5H4ZA 5JORA 2C1PB 1QSEB 1T6VN 2CMRL 5LGYA 2VDLB 5DGQA 1IRAY 2XCMC 1KUMA 4RGMB 4OLXH 3RTQA 3MV8B 5I74C 3ULVF 3LN4A 1G7MB 2JI2A 1A6PA 1NBYA 3Q6GL 1Y1DA 3VTTA 4AYFA 2MNJB 1NMAH 3P2DA 4H8WL 1AKJB 2Z64C 3QUMA 2VDPL 4R4NC 5IZ7A 3EBGA 3VWKD 3WAJA 5G4OA 4IYKA 2ZCKL 3B9EA 1P7QA 3PQYD 3PQYA 1SYSA 1TQCC 4ZJ9A 5BV7L 5AZ2L 3P4LA 4UTBA 5CJXA 1IFHH 3V95A 1BM3H 1FL5B 1KCLA 1QLEH 3BVDB 3LNGA 2BK8A 1OSPL 3UO8B 3OPZH 2VZOA 3V9CA 3CXDL 3V0HA 4H25B 3KGUA 3QIUB 2C1OA 3OLDA 5DRZA 2V2WA 3D48R 4UQDA 4CKQA 2VUYA 5F3HB 5D6CA 4HIJB 3DPBB 3L4XA 5I24A 2EO1A 4AGLA 2X2IA 4TTGA 1W6WA 3GI8L 2P5PA 4AV5A 3ARTA 4LLWB 2ARWA 1COBA 4EAEA 2X3AA 5FR3A 3QJZA 2CO6B 4AEHH 1ZJAA 4GW5A 3VD9A 2EIDA 3QCUL 4U33A 2Z1KA 3QEGH 4JGJA 3U30B 5ITBH 3L2LA 3U4EB 1BQLH 5BS0B 1F90L 1QPXA 4OB5L 1LEIB 5EUKB 4HC1L 3WSQL 3PGFH 4S2SA 4XPTH 1IT9L 3B7TA 3KPSA 1UOKA 2OJZL 2RCSL 3CFBA 3EYQC 1ADQH 4R2GB 5FAAA 3QIBB 2FO4A 3LHAA 2ILLA 3VB8A 1KTDB 1QO3B 4BQCA 2VLRD 4R7DB 3SQRA 5ICYB 2VLLA 4HCGA 5DJXA 3OKNA 3HE6C 2BM3A 2MMXA 1HEZA 2HUHA 2Q8BL 3KLAB 3HC4H 3U2SB 4W4OC 2IG2H 1DSFL 2HT3C 2H32A 2O6DA 1A14L 2VABA 1BQUA 3HZMB 2DRUA 4ZW6A 3R7QA 1MFBL 2B59A 3E1ZA 1FC2D 3VFNB 2G4EA 3LAFA 2AEOA 3ME0A 3OKLB 4MCYB 1E0OB 5E95B 1XGTA 3UTPD 1A6UH 2R7EA 4KRNA 3OKKB 5EOQH 4ZAKB 3DNKA 1FDLL 1TR7A 4GO6B 2XZZA 4H2AA 4KQ4H 1A1MB 4YDKH 2HT2D 3T0AA 4ZX4A 4JFOA 3EOTH 4FYTA 5DC9B 2MQCA 3GKWL 4KKZA 4JFPA 1CLOH 1YPZF 3MO1A 4UT6H 1F11B 1HKFA 3BAEL 3GI9H 4BFKA 1OK0A 3I85A 4DP6X 4LLAA 2OSLA 2P7TB 1NFDF 1FLRL 2VDQH 3BLKA 1BVKB 4HX1B 3LZPA 3B4NA 1MRCH 4QRUB 2Z7YA 1AZRA 3D4ZA 4FFVD 2IPKB 1T1WA 3AXLA 4NZTL 1M9SA 4WKZA 5EBMA 1NCUA 3KH4A 1ZSHA 2HLAB 3KDMB 4ESKA 1RIHH 3CFEA 2X1PA 1JWMA 3MUGB 4NNYA 3F58H 5I76B 1VKXA 1GZPB 1KGUA 1FZJA 2GJ6D 4OTXH 2WC7A 5DU7A 5E7FA 2WGNB 3VMPA 2XA3A 5C7XH 2E56A 3FQWA 4RWHA 1TU2A 1F02I 2KI6A 5D7JB 2AQTA 3KLDA 1EJOL 3IDMA 1SBSL 3EHBD 2Z4QA 4NT6B 3DUSB 3MA7B 5C09A 4D0DB 3NK3A 1D9KB 4HG4J 1TZOA 4F3FB 1QHQA 4YOKA 3U83A 3MRMB 3UZEA 1UD2A 3DXAB 4G59C 1NL0H 3RPIB 1NGPH 3QJFB 2J1WA 1EFXA 3WIIL 4YX2L 2EC8A 1IC0A 1BFVL 5CP7A 3RRQA 3EGSA 5JHDD 4GXUM 3WFEL 3WO3B 4QOKB 4QLWA 4ZQTA 1U2HA 3PL6C 1JWSA 1UWXH 2WUBL 3LKRA 3RUGF 4I9WD 2OYMA 3CX5J 2CGYA 2E9BA 4HHAB 1BZ8A 2A1WL 4OV5A 2XRAH 3GWJA 1G0XA 4MB5A 3MOBH 1DN0A 1QFWM 4QYOB 1SUHA 1G9NL 3WFDL 4U3CA 6FABH 1MWAH 5AB2A 2XVKA 3IPEA 1BVNT 3ZDWA 1D7CA 1D7FA 1UATA 2A9NH 3IBEA 2J5WA 2B1AL 1SLWA 4WO4D 2ZKMX 3CFTA 4ETQA 4HIIA 4RMSA 1NDGB 3RVXC 4YEFA 4LDEB 2BY1A 2KHAA 4I3RH 3S8GB 2NDFA 2Z8SA 1IKFH 2UY7A 5DYOA 4OFYA 4BKTC 4AYGA 4UZSA 1AFVH 2JKSA 3HN3A 3WU1A 3EO9L 4NQEE 3GSQB 5GGSB 2DWXA 1ZLVK 3VVWA 4ELKA 4B95C 1BP3B 1XGQA 4MJ2A 1Q94A 2V3FA 1JZDC 5D1QD 1X9RA 4ODSH 5DFTA 4JE4B 1CB4A 3NFNB 5C6TH 1YEJL 2BX5A 3K0WA 4WW2C 3DRQB 5MERA 4HJEA 4L8BB 4ODUA 4PJXB 4IIQA 1ZD6A 3B6SA 3A47A 3L4ZA 1FNAA 3V10A 5IT2L 4U1NB 1U8IB 3IRPX 1EDYA 1P4BL 4HKXA 4MAYB 3V4PH 1ZOXA 3V4LA 5DQDH 5B38G 1R3HB 3BUPA 5MP6L 2BDNL 4KZEL 1XCQA 2DDQH 4FYRA 3K6SB 1RMFH 4L1LA 2WQVA 1UXMA 1F8TH 1HOCB 1HT6A 4OIFA 4JM2D 4A2MA 4JM2A 1MCCA 5B7MA 2JIXD 1RZFH 4JREC 4QRSB 4JM4H 1MCRA 4J8RA 4L3EB 4FMFA 3GBML 4D0BB 1OPOA 3IYLW 4Y9BA 2VDOB 5LAXA 1BM7A 3DROA 4MD0B 3TBVB 4Z5RA 5L8JB 1MJ8L 4N0YL 4PRID 1OTTC 1J0JA 4PRIA 2Y1AA 3N43F 1JGIA 5EU6E 4G42A 2M1KA 3BPCB 4F9LA 4N0CD 3E80A 9PCYA 1XVSA 4PV8A 1OAQH 2DQGL 2NLJB 3SDXF 2V5MA 4N2NA 1X3DA 4H0IA 1XGUB 2R1XB 1L9PA 1HL8A 1TTCA 3MGOB 5T1LB 5DZJA 1PZ5A 3SDDD 1A4JB 5F3BA 5FEBA 3GRBA 3QDJD 3QDJA 1DYZA 4FTDA 2Q2EB 3C2SA 4XP9H 1ORQA 1OP9A 5I1JL 2XQYA 3HAEG 3G6JB 2BSBA 3K2UH 4UCFA 1YLBB 4XCNA 3KBHE 3TT3L 3UBXA 5IB2A 4V11A 2CJTA 4C56B 3UTQA 2IAAC 3B37A 5I71B 1LP9B 5SWSA 1UYWH 1EGJL 1KNOA 2QQLL 3GBEA 4WFHE 4HWBL 2Z0UA 4OSUH 1TPXC 4KTYA 1JE6A 2BSTA 2E9WA 3QFGA 2Z0BA 4WHDA 5CHNA 5IUSA 2XVBA 3T4YA 4S1SH 3SDCA 4F9PC 1YY8A 2EIMB 3L7FB 3UZVA 5KVGE 5B7EA 3ZLQC 1TYRA 3K6NA 3QXUA 1WFIA 4OGXL 3K8MA 5C86A 3GTVA 3TJHD 1QI5A 4R0LC 1YYMH 2QELA 4XWGH 2K9FB 4A7UA 2N1TE 2AV1B 2L0DA 1F4XL 4YSRA 5HPMA 1OCOB 1CICB 5A1AA 2D0FA 3NJNA 1A9EA 4WAFA 3SDAA 4AM0B 2IPUG 2QSTA 4L9LB 5AFAA 4WLCA 2F53E 1CTMA 1Q9WA 4R96B 1Y7VA 3LS5L 1XZWA 5TGBA 5AG9A 2K3HA 4PJ5B 5AW4B 4B9ZA 2OJEA 4P57A 4AQ1B 2UUDH 3BC9A 3MXVH 4GAFB 5T3XD 3ZT7A 4AZ8A 4P2OD 3L81A 1IQDB 5E2UH 1QFUH 5HGDA 1R5VA 2VLJE 5GZND 5GZNA 4XVJL 5KG9B 5C1MB 3VQMA 4OLYH 4UM8A 3TF7C 4KK6C 3QO0A 2X4TB 3O41A 4OCYL 4PJ8C 2I60L 1NEZB 3TF4A 3W2DL 3BSGA 2Y2YA 4ECNA 1FRGL 5HPOA 4RX4A 3NIFE 5FGSA 4ANUA 3F05A 1AXSA 4R4ND 4PVLA 5DMYA 1LK2B 1Q0XL 4IIZA 1OCCB 2VQ1A 4OGQC 1F86A 1CLCA 2R1WB 3DURA 4MJ6B 4N2IA 3W9EB 3UL4A 4M3JA 4Y16B 2BVOB 3P0YH 4M6NL 3BZFA 4P3CL 4XPFH 4RWYL 5J06A 5KS9E 1QVOB 3IJYA 4B9PA 4DP7X 4UU9B 4Z3FA 1M1SA 3N6YA 2BHZA 3P4MA 3VXNA 5HVFB 1BHGA 2FUQA 4IBWA 4QJ4B 4AK1A 4A7QA 1NI0A 3IJSA 5CBEA 4HF5H 4XNUH 1OLLA 3LEYL 3O6ML 2Y07L 3O6FC 4LQFL 5I82A 1DANU 4M43L 1N59B 1L3NA 2A6KA 1R34A 2QTVA 1F6LL 1QFWH 1OANA 4PBDA 1FIEA 1TIUA 4QRPE 4HJGA 3SE4C 1N10A 3AY2A 4PYGA 4X7SL 1URIA 4EI5B 5D71H 5DEFB 4M7KH 2QHRL 3LVTA 2ZUTA 3WLBB 5CEZH 4M5ZH 4CBPA 1X5XA 2QFRA 4HDIA 4JQIA 1OLZA 5CLWA 4X8JA 2MKLC 1E9QA 2AXGB 4I5BB 4Q14A 3WUWG 2WQAA 2RFXB 4PW4A 2X89A 5FYJL 3C6LD 4I3GA 4KY2A 1BZQK 1YMMB 2EDXA 1U6AL 3FQRB 3HKFA 1Z9OA 2MTPA 3ZDXB 3UGUA 4W9EC 1GA2A 3Q8FA 3Q2CA 3AG3B 2VR5A 3MLXH 4S10A 3TNNB 3HZKB 4I85A 2HT3D 3L1OL 4FA6A 5BOPA 3VDBA 4NC1C 1PF3A 2P5EA 2XX1A 3VH8G 4J1UA 2XYBA 5CILH 4ZTPH 5F88B 1R5IA 1MN4A 1YRKA 3F5WB 3GQFA 4WHTB 4UQ2A 4AMKL 1P4IL 5I1AB 3L13A 4TM9A 4PJGB 1L7IH 1AGFB 1KB5B 3RIAK 4ZNCD 1W8EA 1NCBH 5ALBL 4TSBL 5F7WC 4Z76B 1SFHA 2I9TA 5EU5B 3QBTB 4NPJA 3OAWA 5BZXA 2JI1A 5IVNA 1KFAH 1QFOA 3HS9A 3BFOA 4GKSA 1A66A 4G9DB 1U91A 1KGCE 1FJ1B 3GFUA 3MV9D 3PWPA 3MV9A 4F37F 3HE7B 1S7TA 5CGBA 1H3GA 5L88H 4W9JC 3N5AA 1BGXL 5E99L 3TCLB 1ZHBA 4RIRB 2R0WH 4M4PA 5F9WB 1S7VA 2NQDA 1DQJA 4LPTA 5DJZB 3O2WL 2WINB 1GS7A 2HFEA 3CSGA 4B9YA 1BJMA 4FQXC 4GRLA 4XPGL 4PJEA 4X6FA 1EVTC 4PJAF 5CSZB 1E5BA 3ULUD 2IH8A 2X4RB 3OWEA 3O9WC 3IETA 4KFMA 1YAIA 2IWFA 1SHXA 4UOW1 2CPUA 4LF3A 4FJYA 2WSDA 3S3DB 5TF1H 2FDBP 2R1YB 3DX9A 1WLHA 2VZTA 3P3SA 4K94H 1H8SA 2ZSWA 3UCRA 5I18H 2WKLA 3ARFB 4XVSL 1CCZA 2RTTA 3IXAA 1KFGA 1KG0A 3K2KA 3BE1H 5JIQA 1NANH 1Z2KA 5GQBA 2ZYRA 4G43B 1VGEL 1XH2A 2AITA 3IE9A 4RMWA 5E8NA 4YS4A 1T0OA 3QNYB 3MLTB 1KT2B 1BFOA 1GIGL 5H2BB 1A6ZA 1YN7A 3BQUD 4XZ4A 4F1ZA 5GZOD 5GZOA 3U6XA 1PTZA 4ZDHB 3HUJA 2Y36L 4MRBA 4OIIL 1KYDA 3K46A 4JLRB 1A0QH 3KWTA 3PDGA 4JGUA 1OALA 1K5NA 2I27N 4LLVB 4AQEB 3G5XB 1IGMH 5HGHA 4LDOB 1Y6NR 2R59A 5I15L 1GZHC 1R19A 3HS0C 3PWNB 5CLZA 4AVHA 4X8GA 3WY1A 3GHPA 5HSFA 2F8VA 1RH8A 5D7LA 4QUOA 1FFPA 3RVXD 1NBZA 5B3JF 3T3PE 1QLRB 3OXRB 4TNEA 5B3NA 3WNPA 5FM8A 3TH3T 2K78A 1KGYE 25C8L 3B83A 4KUCF 3DUUB 1G6RA 2DTML 5EUOF 3IU4H 5AOJA 2OULB 5BOJA 2EECA 4QF1A 4HUXA 1PFCA 4X9HA 4N0FA 2VRQA 5DT1H 4ZMQA 1OHQA 2W38A 3P2TA 5GS1C 2XZQH 4WGKA 4FABH 4QLRA 3D25B 3VU2A 3NIDF 5CP3A 4AXWA 3FONB 3IJ7A 4HAKA 3I6KA 4LSTL 4PWEA 1DL7H 4OCWH 4PAZA 3HB3D 3N85L 2KZWA 1CK0H 3N40P 1PKQA 3OQ3B 3ZL4H 3ABGA 1SF3A 4Y88A 1WTLA 5FYJU 4CMMB 4F5CE 2WQ8A 2ESVB 3SE3C 1BLNB 3ABKB 3IDNB 5D4IA 1UM6L 3G6AB 1WWCA 2HVJB 2OYKA 1TZAA 3WFHB 4XMKL 3A4AA 3BRFA 4X6DE 1C5BL 2AEQL 2VM9A 4W9GC 3OKDB 1MHHA 4NJAH 2O5ZL 3BKJH 3DVGB 5B1AB 3FO1A 2JB5L 5BZDA 5EZOL 3EYSH 3NN8B 3P9MA 4ZW8A 5IFJA 2FQDA 1DR9A 4TULH 4XODA 2J6EH 1Q90A 1EMTH 2Y3NA 2AQRA 4MB3A 4YZWA 4XC1H 1UASA 4Y7OC 2F5AH 5D4QA 3TASA 4F33A 4XPAL 4JN2B 2HG5A 1J0ZA 3KWUA 1OQOA 4KBPA 4M03A 5H4YA 3WFCH 4QCIA 5I0VA 4LSUH 2A4EA 4L0ZA 1I3GH 5HDBB 4MJHA 1MJJB 1XV8A 2VH5L 2VO8A 4H1LG 2G5BA 1SEQL 3QG6A 3VXPA 1AP2B 5KSBF 4F7EA 4UNTA 5DK0B 1ECZA 2F7OA 3ZQXA 1A9VA 1DQML 1RZGB 2ZWYA 3QHFL 5E08H 2AK1L 1JXGA 1QABA 2X44D 2OJ1A 5K9OA 4G8EA 1YN6A 2LV4A 3IMTA 2V4LA 1AH1A 3IJEA 3B8SA 3UGEA 5DC4B 2JB6B 3VQ2C 3LRMA 1F3JB 2XWBA 1JPFB 1SJEB 5JLZB 1XIWA 5CZVL 4JO4L 3ZZ1A 1HDMA 3FQTB 3SKMA 4QNPE 1BAFL 2QQKH 3RNKA 3KPLB 1TQBB 1NJ9A 4K2UH 1NFIA 2H8PA 4IKKA 2V33A 4P5TC 4QR7A 2HH0H 1SNRA 5JQ6H 4RSYA 5INCA 5FLVA 1OO2A 1J1PH 4E41A 2MSPA 5IM7B 3C8KB 5T5FL 2F8XC 4K5LA 2X9YA 1N8ZB 3DYPA 4BHUI 3VW3H 2BNUA 4X80H 4OBRA 5CEYB 3JWDH 2COVD 2DWEA 2ENQA 2JELH 2QPUA 3MRRB 4HG4K 4Z77A 1O7SA 2BC4A 1QRKA 2OSYA 1OAUH 1VPOH 4M1DH 4ZSOE 5GSVB 4PJ9A 5DC0A 3TBYB 5C97A 4Y5XA 1OCWL 2R0KL 2ZAGA 4GMTH 4DN4L 4NBXB 3HRZC 3GMLB 1ET8A 3WN5B 3Q2VA 4XI5C 4PJIF 1U8QA 4APQB 3VFVA 2NW3A 1S7XA 1PZAA 1W0YT 1PL3A 3EO0A 3PV6A 3Q0HA 4M61A 3S3PA 4YSSA 3QWNA 4X6CB 2K70A 2F15A 3RPKA 4F2MB 3Q6FA 3CX5K 3ZYOA 1UOWA 1DVYA 4N2EA 2GT9B 3QS3A 4FI8A 1RPUA 5GS0C 1DBAH 4U7MA 1EJ6A 4B6ZA 3QEUB 4H20H 4PYHA 4M4RA 4HXBH 1PU0A 4P4RA 4PS4L 3SBRA 4KK6D 2FUTA 2GUOA 5J3HC 1OE2A 3QO1A 4RGMC 3RZWA 3GKZA 5C0BD 5C0BA 2XFXA 2XG5B 1B0WA 1I8KB 1KV3A 1LDSA 4U1IB 4G9FA 2FHFA 4YHYC 2ZWLT 3L3HB 4HMEA 1O5DT 1U8NA 3MJ8A 1TQTA 4UUJB 1I8LA 3LKPB 3PJNA 1B0GA 2FE0A 2YS4A 3SKNB 3A5VA 5IBLD 3QFJB 5C2BL 3U7WL 1C08A 3B5GA 1M53A 1G7PA 1T0MB 2XYCA 1KTRL 2BIQA 4HSQA 3EF7A 1AZNA 3PAVA 1I1AB 1M3JA 3P2BA 1C7SA 3N9GH 1KN2L 3O6LH 3QIUC 5HVHB 1T7XA 5T1DL 5CMAA 4BWUA 3LNDA 2AJZB 5DS8B 1B4TA 1TITA 1B6UA 4YXLH 2EIKB 3V5DB 5EB9A 5F9OH 5AOZA 3U25A 2COQA 4EBQL 2WIIB 1A7RH 2JTYA 3QUZD 3QUZA 3IFNH 2IAMD 4Z7WB 4HUWB 5SWZE 4RFEA 1OGAA 2HMID 1HXMB 3AG1B 4UBDD 3DI3B 3D9AH 2WLKA 3U0WH 4HIHA 4P5RA 5HJ3A 3TBTA 2CHZA 3BDBA 2H26A 1J8HE 3H4HA 1AHMA 2J88H 4BINA 3F7VA 1IB5A 3W82A 1CLZL 3WIFB 1A25A 4FFWD 4A2EA 3GBLA 1OARL 5DHVH 1OD9A 3QIBC 3QNFA 4AL8L 1T04B 2J8HA 3CCHB 4GW1B 3DV4B 1AC6A 1OV8A 6CGTA 5F6IB 3OLEA 12E8L 4XRCA 3CSBA 4XMPL 4R5TA 4MTMA 5E24E 2ADFH 4JKKA 3GTTA 2NNFA 3NOIA 4XVTL 1ICTA 3SY0B 1EEQA 1PDKB 2ENPA 1HXYB 1KN4L 4JE0A 4QO1B 4DKEL 2EDQA 5C92A 5M7QA 1MHPL 1CURA 1NCWH 4ZAKC 4QHMA 1FH5L 1NBCA 1KLFA 5JDSB 4OLZL 4ANXA 1D2OA 2OZ4L 4JFZL 1SJXA 3BPNC 4F93B 2YPKB 1FE8H 1KJ2L 2E7LA 3WNOA 1IC4L 3UJTL 4KTDL 5C08D 2ADJB 5C08A 5GXBB 1YEDA 3WIHA 1F4YH 3MRCA 3I9GL 5AVRB 3UZQB 2VUKA 2CRIA 3VE0A 2Y1ZA 4Y1AD 5DJ8B 5HTSA 5EG6C 5EEYA 3A4EA 2QQNL 1ZXQA 4BH7A 3GB7B 1MFCH 1NMCB 4FQXD 3GBDA 3PDOB 1F3DJ 2VISA 5D2LB 4F15B 4DKFL 2I5YL 4LCCB 5EF2A 1RQ5A 5D7JC 3O9WD 2C9XA 5DEJA 3JV6A 3DO7B 1WA1X 1PCXA 2PR9A 4YDNA 4R26H 1D5XA 3L7EA 4Q4EA 3BP4B 4UTBH 4N90D 4JPKH 3H9HA 4YHZH 1NMBL 2CCWA 4BV1A 1D9KC 3ZDYF 1C9SA 1RVFH 1CU4H 4X5PA 4R7VA 4P2RD 4IEFB 4RISL 5DJDB 1YG9A 1UWEL 2CU9A 5GRUH 4WEMB 4Q2ZB 4HT1L 5TE4H 43C9A 2B7DT 4DTGL 4F37K 4YBQC 4ONFH 3NEOA 3HCVA 5EU7E 3DK0A 5I1GH 3QJRB 1F3DH 4JZOB 4RGOL 1GAFH 5SX5H 4CU8A 4JL1A 4NM4H 4UOQA 1BEXA 4EIGB 2HG0A 1GGBL 5CSGA 3IGLA 1X5GA 1HIMH 2NY1C 4EDXB 1K5WA 3FRUB 1ZAGA 4TV3A 2NPLX 3VI3B 5ICZB 5K9QG 4Q0XH 4UILL 4BZYA 3SOBL 3HI6H 4S0SD 2AQ3A 2W60A 2FT6A 4DKDC 3MA9L 4GEIA 1Q9LA 1PJWA 2C9AA 1OSZB 2C3VB 4GIPD 3HR5B 4PJCA 4MVBD 2H2SD 2AZAA 3WHXB 4HOXA 1MF2H 2QVTA 3OD3A 1NC4A 2H32H 5LGHL 1GHFH 3NIGF 3PP4L 4UYQA 1BEYH 5DEZA 3HI5H 2AABH 3H6JA 2VERA 1LEKB 4AJYV 3D85D 1OP4A 3D85A 1E40A 1YECL 2IJ0C 2VR3A 4DEUA 4H5SA 3CN2A 1A8ZA 4KITB 5DJCA 1CFTA 2FD6H 2Z9TA 5DVPA 3GMRA 1CF1A 2AKRA 4L05A 4F8NA