2ODHA

Restriction endonuclease bcni in the absence of dna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
238
structure length
233
Chain Sequence
MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENNITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNLSKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMDLCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA.
pubmed doi rcsb
source organism Brevibacillus centrosporus
molecule tags Hydrolase
molecule keywords R.BcnI
total genus 57
structure length 233
sequence length 238
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2odhA02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2odhA01
3IMBA 2OAAA 2Q10A 2OA9A 2ODIA 2ODHA
chains in the Genus database with same CATH superfamily
1ES0B 4KI5E 4NAQA 3GRGA 1EVTC 3LHAA 2KKQA 4NT6B 5DURB 2ATPA 1HK6A 2AQ1A 2IVFC 4QHKJ 2YBGA 4AYEC 5T1LA 3PE9A 5IJKA 2X6AA 1HXMA 1RPUA 4Y1SA 1A4KB 1KCUL 2PCFB 3DURB 4XXWA 1HYSD 3IDMB 5AFAA 2BPBA 1HC1A 2QTVA 2VXQL 4ELKB 5B39B 3PWUB 3POCA 2R51A 2C4FU 5F93C 3A0OA 3LZNA 4PGCB 5E95B 5C7XL 2JKXA 5T33L 2VAJA 3OKLB 4HS3A 1YQVL 2ITDB 1TETH 2WBKA 3FT1A 4CKQA 5ISZE 1KC5L 5CZXC 2IDSA 2D7OA 4PJXE 5DK3A 5IMLA 1AGDA 1AYOA 1NL0L 4AE0A 1LK3L 3Q7JA 3HCVB 4UQ9A 1A9EB 5GJTH 3RWHB 2APFA 3P0YL 4HD9A 1FDLH 3DBXB 3G3LA 1YEEL 4K8RD 4MAYA 3WFDH 4AQOA 4TSBH 2H2SC 3B43A 1A6VL 1D5ZA 2VXUL 4OJFH 5AB9A 2Y6TE 1REIA 2F7RA 2J44A 4H2AA 4KMLB 1QZ1A 2H1XA 2ZE0A 1MFCH 1JK9A 1ZS2A 1DANT 3BSGA 3ATAA 5EU5A 5D70L 2I5YL 1L9OA 3EZJB 4FLOA 4IBZA 3T4AB 4L3EB 1CL7L 4GO6B 1TTGA 2YQ3A 3HG3A 4MCMA 3H6JA 4JL1A 1AGEA 3ZBMA 4JFEB 2IOOA 5FOBA 4JZJA 4L2LA 4P2YA 3HE7A 3RVXC 4AKPA 1QPPA 2VLKD 4DUWA 3BKCL 4TUKH 4Z76B 3MNZB 3T3PE 4WI5A 3C6LD 1J0IA 3ECBA 4Y4KC 3BGFB 4F15B 2WNXA 4PJ9A 4FI6A 3IDIA 1E3XA 3H9SA 3WAKA 2LFGA 5E2VH 4QO1A 3ZYIA 2QR0A 5I1HH 5F9AC 3WMPA 1N68A 5AVXB 4X2UA 2DQIL 3HKFA 4HZAA 4M3HA 1EEYB 2CCVA 4LPYA 1J1XL 1WIOA 1ZXKA 4OLUH 4MA3A 1CXLA 4QOKD 3RX8A 4NJ9H 3QIWB 2FBOJ 2XWDA 3BUDA 5TH2B 2XWTA 4XMUA 4UQEA 4KXBA 3IYLW 3WJJC 3ZR6A 4NZJA 2GB2A 3RWIA 3W0WD 2Y5TB 5DSCB 3JT2A 1W0WB 1YAZA 4CVZB 1O7SA 3B6SB 3IF1B 3D39A 4AQAB 4BZ1A 3DHUA 4EUPH 2C26A 5A1AA 4K71C 4YHZL 4V1DE 3WS6A 3LEXB 2RIKA 1PNCA 3D12B 2WZPD 4WSKA 2W0LA 1ETA1 2BSSB 3RP1A 4Z77A 4WV1C 3L5XL 1UCTA 4PI0A 1YY9D 4ZXBC 4OZ4B 2Y3AA 4DQOL 2ZCZA 1CF8L 5F7AA 3BE1L 5BRZA 1G0YR 3SD2A 1FZJA 2PWGA 4HA1A 3BP7B 1GZQA 1U8HB 3MKGA 1GOFA 4GXUN 4X6CF 4X5WA 2H2PD 4NKIL 3VGEA 2VXTH 4HK0A 4L8BA 3OLEA 2XXFA 1AS8A 3KLHC 2BSED 4CJ1A 2OI9C 3QDJE 5J57B 1U8OA 4R96A 7PCYA 3T6QC 1L9TA 2R4RL 1IFRA 4JHVA 4LVHC 2CO2A 4NT6A 3OAUH 5AVRB 4LF3B 4IRSD 4RRPG 4TQHA 1MHEA 3MRJA 2OR9H 3HHSB 2CO4A 4DK5A 3JYCA 2P45B 5C6WH 4GIAA 4FC3E 2JI2A 4JY5L 1VA9A 1IC5L 4PRNB 3GMOB 5JOPD 4LAJH 1HWHB 4PRHE 1MFUA 4DKAA 3R19A 5DA4A 3WN6A 1MHPH 2X1QA 1CICA 4KTEL 1Z9PA 4U4BA 4NQXA 2YC1B 4I48B 4UYPA 4OZHA 4JFOB 2OR9L 1CE6A 3DETD 5ABDE 2X4UA 3K2UL 2IV8A 2WLLA 1T7YA 3GI8L 3DUUB 4HBCL 2ZCLH 1P4BH 5ALBL 4DP2X 1BQLH 2WWMD 4MZIA 1ZHLB 1YDPA 3PAVA 3GMMB 3GBEA 5D96B 4NM4H 4HJJH 3ZYJA 3HR5A 4IU3B 3BWAB 2GTZB 3JVFC 5D1ZB 5IROC 4KJPD 1LEIB 5E8PB 4P5TB 4A04A 2H1PH 2W07B 3P0GB 2WLMA 1P7KA 3HC3H 3DO7A 2V9QA 3EGDB 5JQIB 4HGWA 4Y4HD 5D2NC 3LZFH 1QBBA 4JRLA 5I1GL 5KVGL 4L5FL 5F0MB 4YDJB 1L0PA 2ZUQC 1LDSA 4DPBX 3IETA 3NEXA 1Y6NR 2YGQA 5KZCD 4A7GA 1ADWA 2GY7B 1HILB 1MHHA 3HKZA 3I2CL 3L3OB 4FXGA 3GI9L 1FPTH 2YA0A 2EDTA 4LDEB 3D2UA 3FAXA 5FM5O 4CGTA 4N0YL 1VHPA 3QA3B 3TFKC 1SN5A 2P26A 4HXAH 3LEYL 1R3KB 4H8WL 5E1HB 4L4TB 2YAQA 5SX4H 1G9NC 4FHKA 2YXFA 3VM5A 5EH1A 1SF3A 1H56A 2YRLA 1EJ8A 5GXBB 2ALWA 4KJQC 2IANA 4M5SA 5DJCA 3K6SB 4DOHE 2AJVH 3RVTD 1PYWA 3GHEH 3IDYB 1VESA 3IFLH 4GP4B 4IGBC 4AIZA 1CFVH 5HYJA 4LXFA 4N0YH 4KFZC 3W0WE 2VERN 3B2VL 2PTTA 3BN9D 1S7XB 4LHUG 2K6YA 4Z77B 2FWOA 1E27B 1KTJA 4EI5C 2XV0A 3H56A 3L3GA 4PJHE 4WFHE 2Z6FA 4YUEH 3CC5A 3VU2A 4MAUH 1UD6A 4KHTH 4I4WA 3U7AA 8FABB 5JHBA 4R84A 2C1OB 1FJ1A 2MQCA 4G8GE 3GSVB 5J6GA 2CK0H 1GC1H 1JRHI 4W9ZA 1S9XA 5GGSB 3EH4B 3OR7B 3KYKL 2CIKB 5F7WC 2V5RA 3SE8H 1HNYA 4F80A 5F3BA 5K9KA 2FLRT 4RMVA 3P2TA 1JL8A 3E8UH 4M6NH 1A7OH 1THAA 5FYLL 2EIMB 2E4FA 3NJLA 5I1CH 4LL1A 2EO7A 2PP8A 2K3HA 1R1CA 1J0KA 3T2NL 2GBUA 5H2BA 1UH4A 2YMTA 2CJTA 1IEHA 1BP3B 5KBLA 3SPIA 3V5DB 1I8KB 3HRPA 1P6WA 5DYOA 1DVFB 2BMKA 1U8PA 4RMQA 5E4IA 3TT3L 4TVPH 1IAOA 1F6AB 2COVD 2Y06H 2VDML 4GW4A 3GIZL 2VDMB 4PD4J 3UDWC 1MCKA 4OTXH 4N2FA 3D30A 1MLBA 1T7VA 1Z5HA 3CUPA 1D7BA 3PXJA 2E7MA 5IB2B 3V52H 1BJ1J 1EHAA 4FZEL 2DLFL 1JNNL 1ACYL 5I17A 1RFDL 3BKJH 1UGKA 5F96L 1CZ8L 5A40E 1CE6B 2A7BA 4OCWL 1E6JL 2CSPA 2PWDA 4A38A 3PL6D 4A7UA 1WCBA 6TAAA 1P2CA 2AV7B 1KEMH 1CI5A 2KLTA 3NIDF 2UWEB 4UT6A 3UACA 1Q94B 4QJ5B 1L9QA 4ZUUB 5BV7L 4DUVA 3PREA 2GJ6A 4XNYL 1RL1A 4XP5H 2J5WA 1ZVNA 3UTQA 1S9YB 1EV2E 1TKWA 4DP9X 5I16A 3ARGC 3ABMB 3CDGA 3QEQE 2NY0B 5TE6L 3T71A 2J6EH 3TBSB 5AAMC 2NW2A 1BF2A 1O6SA 4ZYKB 2KQNA 5KTEH 2XX0A 5SWSB 1YYMH 1S3KL 1XBRA 1HZLA 2R69H 3GHBL 1ZEAL 1QFWL 1OAJA 4AENA 3F7RA 1OB0A 1ZT1A 4KJWD 4UDTB 4UILL 2X5PA 1I1AD 5DEZA 5H8DA 1PX4A 2FSEB 2XY2A 5F9OH 5ITBL 1IKNC 3CU7A 4XVTL 2V8MA 4YSUA 3JBG7 3M1BA 2F6AA 1EBPA 2GT9B 3ESMA 1MJ7H 4H8PA 4GXVH 3UTSD 4H0HB 5T5FA 3O2VH 3MJ7B 4P9ML 2UXVA 5E08H 1KDJA 3L4ZA 4JFWA 3V4UH 2DYPD 1QFWI 1IAOB 4W9CC 1UT2A 5K9JL 3S3SA 2EH8H 3KJ4B 2DQDL 3CHXA 1FLTX 4MXWL 3DOSB 1TTAA 2C34A 3FUMA 3GXPA 3LD8C 3P3TA 4KY2A 2M83A 4TQPA 1INEL 4WUUD 3FQXB 5FGRA 4KZEL 4XBGB 5AVSB 4ZK8A 3VXUB 3HUJF 3O2VL 1LGVA 4AV5A 1FN4B 3E6HA 3C60A 2VSKB 3EYSL 1I1RA 4YSSA 1HIMH 3PP3K 4MJ2A 1DBJL 5IREA 4NQCB 5I18L 1CFVL 3ME0B 4M1CC 1RUQH 5F9JA 2LFEA 2ITCB 3PFQA 4F7CA 5TDPA 1JHKL 3SGDH 5F88A 1RJZB 1RJLB 4L8DB 2NNRA 1BJ8A 1MVUB 4TQEH 2V5MA 5EUOE 1M9WA 4E42B 2DN7A 3JWNG 4DP8X 1KB3A 1OGTA 3VYPA 4P23B 1T4KB 5CSBA 3F3HA 4JS7A 1IMHC 3KZ8A 3L3HA 4ALAH 3MRIB 4AUJA 1ZHKB 1EDYA 1WT5C 4TQIA 4X5XB 3EJCA 2CK0L 5AENA 4WW1B 3GMPB 1ZLDA 3TV8A 4WHDA 4KJYB 4AEHL 1B4JH 2CBMA 5KYXB 3PQYD 3UPRB 2YPVL 4TMPA 3FQUA 4E0RB 1JTOA 1OT4A 1R3LB 2XWJA 3PHSA 5CD5C 2I60L 1T21A 4PRHD 1LD9B 3QWRA 3U9WA 4E5XB 3JWDC 4NO3A 3AB0B 3CFCL 1T2QL 3W5NA 1N7MH 2IANB 5DJCB 3K6SA 3X12A 3NZHL 2EIDA 3EFFA 3V95A 4R26L 2O26U 5DJZA 5HYJB 1N6UA 3RVUC 3F7QA 4PVMA 4P23C 5HI5C 4D9QE 4MCYB 3EO9H 4ZTEA 1UOKA 1XD0A 4A6YL 1E9QA 3EFDH 4OFPA 4F2ME 3T0VA 3BYTA 1JPTL 5CF3A 3QARA 1GZPB 2AW2A 5F1IA 3FB8A 2DQCH 4R7DA 3VTAA 4OFDA 4YDZA 1ZRUA 5E2TH 3DRQB 3FMGH 2IGFH 2GJPA 3NJVA 4JUSA 2D7TL 1EAPA 4KKCC 1G7LB 5DHYB 1L0QA 2GI0A 2NRDA 5J3HC 3U9PH 3NT0A 4BFIB 4S11A 1H5BC 1XGYH 1DUZB 2Q3XA 4J3OH 4KI5D 1CURA 5IY5B 4OCWH 3S5LB 3GWJA 3TCLB 1FO0A 4KH9A 5I71C 3D7PA 1QUNA 3THMH 3RRQA 4W9EC 2V7NA 2VN7A 4XVSH 4Z23A 1SUJA 5EEZA 4U3HA 3O4OC 1ECYA 4TLKA 1XF2A 4NGHL 1AMYA 1BECA 2A77H 1RJLA 4Q4EA 4A55A 4BD4A 4HMCA 1IEBB 1P69B 2XA8L 4K7FB 1U58A 2GJZB 3C75A 3VI4E 4DKEH 3RWEA 3GM8A 3GMRB 3V0FA 1JFQL 1T6BX 4X7EC 1CR9L 3IXAB 3LHPL 4K3EH 3N1FC 1XF5A 4HWBA 4YQXH 3U7YL 3DXAD 2HMIC 1I7UB 1Y7VA 1UJ3C 2UVEA 3I50L 2IWFA 3FTZA 3LN5B 3STZB 1OP5K 4LPWA 3UABA 1QHQA 5IJCC 1Y18A 4A2GA 1OP9A 3QUXA 4A2MA 2QQKL 2X05A 3NK4A 1OAZL 4CADB 5AZEH 1KPUA 3UAJC 5HYIA 1CGYA 1QOKA 3TA3B 4XO3A 4R7NB 4KQ3H 5FO8A 1YMHB 5AWNL 4A7GF 3UG3A 1YVLA 3N91A 4GBXA 2H47C 3MRHA 2GG1A 1RD6A 2BP8B 3LQMA 4HD5A 4RAVB 4L5FE 1QSEE 3ILQC 5HDWA 3ZL2A 4AIOA 2EH8L 1QFHA 4ZXBB 1T1XA 1ID5I 4NQQA 5FCSH 3DTDA 5JW4R 1AXSB 4LRIC 3ZVVA 4OVUA 1ND0B 4N2GA 4IRZL 2XWZA 4PRAB 1BAGA 2BZ7A 4XMKH 4GPVA 3MBWB 4E42A 2AF2A 4AQ1A 3OXRA 1WC7A 4WLCA 1IARB 2F61A 4ETYA 4ZODA 1Q90A 1F8TL 4MWFB 3S3BB 2NR6C 3DBSA 4Y5YC 3BP7A 3S98A 1J86A 3GSNB 3MUUA 3RGBA 3FTXA 5ACZB 5T1JA 2CLZB 1MW1A 2BIIA 1VAHA 4YHZH 4HLEA 4JZNB 3MREA 2NUTB 3AROA 2JK5A 3MA7B 2VR5A 2W9DL 5FECA 2V6HA 4KXZI 5DUBB 2I25N 2WGXA 3EJSA 3ISYA 5HJGA 3EFFB 4WWOA 3FH8A 3ZL4L 3WLWD 1SNRA 4GG8B 3FFCD 4KRNA 4U7KA 2AJUL 4HS8L 2ZSVB 1JGLH 3HG0A 4F37F 1BEYL 1ZGLB 4J3XA 3R06A 4MA7H 3V5HA 4P2OA 4QJ3B 4GG6B 5E7FA 4PW3A 2XQYA 4YX2H 2Z1KA 4W6YB 5JPMB 2B08A 1G84A 1OPOA 3G08B 4LARH 4JZOB 3WJMA 4JFXB 3QQ4B 4M02A 4PB9L 1DVXA 3LKOA 1HEZB 1ZWIA 2DQJH 3H0TA 4QRFA 4M1GH 4C8XA 5EUKA 5EEWA 7TAAA 4MJ5A 2WLYA 3MA9H 5F89B 2FEEL 3SDYH 1B4TA 5D1QE 1IC5H 3PCYA 3T04D 3VD3A 1JVOA 2G3MA 2Z64C 4WHYG 1TJIH 4D9LL 1Z9SB 5IFAL 4HWNA 4LHJB 5C0GB 3C12A 3QUHA 3MHZA 3HC4H 5FYLE 3RU8H 4L8DA 4D0BB 1LYQA 3BUQA 4PJCA 1OEZW 4XNMA 5KVDL 3SQBA 3VFTA 4NXKA 3UTSE 5C0CD 5D7IB 1F3JA 4LB8A 4OI8A 2NX5B 4G8FA 5JZ7D 3VRJA 2LGNA 4J5VA 4EVNB 1NUGA 1B6DA 2CZNA 4Q6KA 5AYQA 4G9FE 3CZGA 4GXFA 3FK3A 4W4OC 1O6VA 4ZFZB 4LGSB 3CVDA 1VFUA 4LMQI 5E6RB 4R3SA 3VWJD 1V55B 5CEYA 3QJQB 1NFDA 3EFOB 4IKLA 4JRYA 3VU1A 2ZCKL 3DJRA 4J3OD 3NCFB 3MBXH 5E5UB 2VJXA 4LPXA 1W80A 4MDIA 4UDUA 5EULV 3BQVA 3NSYA 2ZG1A 2F0CA 4WEBH 4XPTL 1G9HA 3O9WA 5E94B 4ZMVA 2CXKA 1RI8A 4X6FA 3PV6A 2ZUTA 2JCCF 1Q38A 3LHPH 4L9DA 5D4HA 5EOCH 5CLWA 3AMKA 1Z9OA 1K2DB 1DVFA 2BMKB 3H9HB 1WT5A 1H9DA 2FWLB 3B2XA 1FFNB 2G3XA 2F7OA 4QXGL 3ULUE 1MJ8H 4XNQB 2Y36H 4GW4B 2V7HA 3HE6A 3ARTA 1OK0A 2A4ZA 2P5EB 3MLSL 3WFHA 3REVB 2EH7L 2HX8A 5AW6B 3GSRB 5DJDB 2YN3A 2C5DC 1ZANH 4M48H 4Z7AA 2DQHL 2XQYG 2B2XH 4XCEB 4ANUA 3KWTA 5HJ3B 3HMWL 2BOBB 4LU5H 4NZTH 4RAVA 1DQQA 1NINA 2AXWA 3ETTA 4J3OG 5DUMH 1C12A 3ILPB 4PS4H 3I6LE 5F9WB 2OR7A 5DDHA 4ZS6D 2XN9B 1TLKA 4XMZA 3QR0A 3HW7A 3T2OA 5ABZA 2VITA 4J12A 5DI8A 1BZDA 2CUIA 2B39A 4FCAA 5IW1B 4KX9A 4EOWH 4WU7A 2P28B 2OL3L 2F5AH 5I6XC 4DZBB 1IGCH 2HJFA 2V2WA 1V3JA 4JDTL 3P3YA 4AEIH 2JF1A 4ZNEA 2JLLA 2PYEE 3LPPA 4BE5A 2VM9A 2XYBA 2F2HA 3LN5A 5G4OA 2GAZA 3CDYA 1IO4C 1PZ5A 1J9TA 2WWMC 2CPCA 3APNA 1XGPA 4H13C 4U33A 3U0TB 5SWSD 4YDVB 4GRWH 5DVNA 3VWKC 1G6RB 5C0IB 5IQLA 2UY6B 1KXTA 5EO1B 3BQUD 1NLBH 3MLVL 1UEMA 4MNQE 4OFQA 1T89A 2XN1A 3QUYD 4M00A 2Z31D 1QVOB 3L4XA 3EH2A 3UMNA 3DNKA 1E5ZA 4FG0A 4XPFH 5GSRA 3LS4L 5JDSB 2VR9A 3P30L 1RMFH 3MBXL 3FSZA 4K7PY 1I9RH 1SVZA 3R4RA 4NHUB 3CFKA 5BZWA 1UQSB 1GJUA 4JQIA 2X28A 1J10A 2A6IB 4I13B 2BCKB 2XVBA 3KYAA 4JKKA 3SDDD 1EXUA 3Q13A 1MJUL 3EBIA 5FO9A 2OQJB 1X3DA 3ESPA 5ITFB 3VWKB 1SDAB 2PF6A 2P46B 3I9AA 5CLYA 3T65B 2N0MA 3K2MC 2ARWA 3MNMA 1K72A 1OSPH 2GC7C 5IQ9A 4YDJA 1DJSA 4LP8A 2J56A 2YKLL 1Z0NA 3A6BH 5TPWL 4EDWL 2YBRA 5CD3A 3IKCA 3GMLB 3QXDA 3GSWA 1EMTH 3LRLA 1UXWA 2GEEA 1E9OA 5H35B 3OKOA 1ACXA 4QRPD 1WD8A 3FQYA 4S1RL 1MCLA 4WZ9A 4AW7A 1Q72H 4P2RD 4IIQB 5L7XL 4OZFA 1OP4A 4W81A 1P84K 3JV4B 3QUML 1ZHKA 1N10A 3TIDB 3N44B 5L88L 3O6KH 2UUDK 1ONQB 3MXWL 2OMZA 1RHFA 4OGZA 5BRZE 2V9UA 3ARFB 1WFTA 5HJDA 3QQ9C 1B9KA 5F6HI 4NN6C 1ESOA 1HOCA 1P1ZB 4S2SA 3T4AC 2VNCA 4QGTA 1KTLA 1E40A 3B7YA 2O1AA 3RAJH 3TNNB 1J1PL 1BQ5A 3O81A 3TYGL 2VAAA 4J6RH 5JW5A 1SPDA 2QADD 3ZMEA 1A3QA 3CQQA 1N5AA 2VLRA 4X5PA 3CVHH 5FHBL 1ITBB 3O8XC 3N40P 4L9LC 4OM0L 4K3GA 1S2EA 4NQDD 3A23A 4J4PD 1FE8L 2ENQA 2W59A 4L4VE 1DVSA 4PJDF 5AAWA 1GMEA 1CO1A 3E38A 1KUMA 2R0ZL 4AYSA 1QYGL 1FFOA 1A4JA 3OAYK 3QVAA 4AV0A 3V4PB 1MCWW 5DD0L 3RTQA 2AABL 2RFXB 3RURA 3SSGA 1J1OL 1MREL 1VZHA 3BZDA 4QHKI 1M2OA 1HI6B 3EOBB 1PJWA 3ARZA 4RMBA 3UTZA 4FQCH 4YDVA 2FSEA 1JD9A 3O3AB 2KI6A 5CWSA 1UM5H 1H3VA 2R29A 4JRYB 4LHUA 1DVQA 2GAZB 3X3GH 3UC2A 1JGVH 4WGKA 4KI5F 3L3HB 4FG6C 4CC1A 1LK2B 2BZCA 3GNML 4K3JL 4Q6IC 1RUPH 3B4NA 3EBHA 4G9FB 2ODHA 1HCFX 2R0KL 1PCXA 1IGTA 2DJ4A 1YNTF 3MDJA 4FKKA 1NGQH 1FFPA 1A14L 5KJ7E 5DLML 2EADA 1EHNA 4ZS6C 2VIRA 3UJJL 5INDB 1PG7L 3S3DB 4PB0L 3CFJA 3BIAX 3TIEA 4WDIB 3OV6A 5CCKH 2ZZUT 5ISZA 3L6FB 1MVYA 4U1IB 3O6FC 2ZWYA 3P11L 4YWGH 3SE8L 1A1OB 1NAMA 2J21A 4XMXA 5E4AA 3BPCA 4AI7A 3RL2B 5CHNA 4FHJA 1YMMD 5AW7B 5AKRA 1IM9A 1P9MA 3H8NA 5EBGA 2E7LA 4JQXA 1W6WA 2V9RA 5EORL 4KQ4L 2OYPA 4L1HA 1QSFD 3GK8H 4FNPA 4YK4C 2XXMB 2Q8AL 3QIBA 2F58H 4OGAC 3ULVL 4P8QA 4K0OA 4HC1A 4AG4L 4KZDH 1MCCA 1PGRB 1U2HA 3FN9A 2HJFB 4ZFOL 4X8GA 2ZUVA 3JWOC 1OANA 5SWZE 3KPPA 2X0UA 1WZLA 3IFPB 3QCUL 4BHUA 1FNLA 4IU2A 3QHZL 3MROA 2LR4A 1T5XB 3WTXA 4XBPB 3U4EB 4LSTH 3APCA 3X1FA 4GRWF 4M7JL 5ACLA 4EPSA 2ZPKH 4I18C 1F97A 2C9VA 4AM0B 2JK5B 4BBWA 3D25B 4LZKA 1A6ZB 1W72A 4YK4B 4ATWA 1GGIL 5D1XC 2GI7A 1EX0A 4NKDA 5ICXA 4ADGA 2BOCB 1AHKA 3QEQD 4PBDA 2W9EH 3F58L 3ARXA 4LP5A 5JYLA 1VACA 1HOCB 3QFGA 5C0DB 2YRBA 4LLYB 1AVAA 5I8KL 2OFQA 4A2EA 3PJSB 1S7QA 4ZOBA 5D6DC 3MGOA 4WV1A 1KLFB 1IFHH 1IZKA 5JPMA 4MMZB 1P53A 3N85H 1OD9A 5EBLB 1ACZA 3CDZB 4UTBL 1RURH 4NQCD 4MBRA 1YMHA 3G9VA 1AJ7H 4KVNL 2ATKB 4AQEB 3EFDL 1FFOB 3CBKB 1I9IL 4H8QA 1LO0H 5CHNB 1MFEH 3KL3A 4XP9L 5CILL 5EZJB 4RSYA 4PUBL 2NCMA 3EYOB 1AZZC 5KW9L 4OI7A 3NGBC 1M3JA 4F27A 2YARA 4ODTH 4BKLA 4O2FB 2WQSA 4G43A 1IZJA 3KPRA 4OZIE 2YWYA 4XP4L 4G6AC 4LCCA 1OIOA 5I74B 4Y19D 1CD1A 5EIIG 1IIIA 5TQ2L 3RWEB 5GISL 4FNQA 1MRDH 4UQIM 4HMDA 1KOAA 3BCDA 2YD2A 1ZHNB 2MCPH 4IRZH 4JG1H 4RMTA 4S10A 4ZX3A 4Y2DB 2WB1A 4NP9A 1SF5A 3T1WA 2Z35A 1HCZA 2XZQH 4PTTB 4TTDC 3NZ8B 4JRFA 4ZUSB 3NIFB 1LK2A 2CUAA 1IBHA 5JHDD 2FYYA 4UTAL 1A3LH 1UOWA 2GHZA 3LKQB 3ZE1F 3HI1A 4BK4A 4V2CB 1HNFA 1Q1JH 2BP8A 4M7LL 3ECUA 4S1SH 2PPCA 2VL5A 5T1LB 2VRAA 4KKLC 1NCBH 3KW8A 5AYUL 1MCNA 1G7MB 3DSFH 4BQBA 3PPSA 3IS1X 4TUUA 2DWYA 1KYDA 4TVUA 4AMXA 4QRBA 2EDKA 2E76C 1IX2A 2HT4D 3EO1B 5CGMA 5F70A 1E5AA 2MKWA 2W07A 2EC9U 2QKIA 5L0QC 2FGZA 2YXMA 3I3BA 4HMEA 5E1AB 3ZL1A 3DX7B 1PG7H 4W4OA 1FNGA 1CBVH 1GXEA 4RWHA 2DMHA 2H6PB 3H6AA 3MJ8A 5DK2B 4EEEA 2ZX8A 4X4MA 1TYJA 2F53B 3VSUA 4IK6A 1T0NB 3QJFA 5CLTA 2DY2A 4DZ8A 2YFOA 1X5YA 3VFOB 1FNAA 4AUYA 4HIQA 3BVDB 4OF5A 1NCDL 3EJZD 4PN6A 1ODUA 3VGAC 3AUWB 3WLBA 2ARJA 3MN8A 4ZW8A 2VKXA 5C07D 3MFFB 3WXVL 4I88A 1YN6A 1OT2A 2OPCA 3IRCA 3VB8A 1NFDE 3ES6B 2F7QA 4PJXA 3C5SA 1AQ8A 3LDBB 2X4TA 4WFEE 1UXLA 4KVNH 4HKXA 5DMIL 2WXIA 3OBAA 3Q5YA 3LQAH 1AKJB 3HRZB 2Q1EA 1I8IB 4NQSB 5B4MC 1FFRA 3U83A 4WNJA 3QUYC 4PJIF 3G6AB 4IOFD 4E2OA 5CLZA 1E42A 1JF5A 3HI6H 4WY7H 3VMOA 4QRRD 3CSPA 1N8ZA 2F08A 4PJCE 1M71A 2MPVA 2GBVA 4ZI8A 1T7XA 1KCBA 3LPFA 3WFDL 5FM8A 1CYGA 3L9EA 4LSTL 1CUOA 4L3AA 4JG0H 1S7WA 1INDH 3CNKA 3UJTH 2HFTA 4ZJ9A 4MXQC 2XKNB 2Y0SA 4YDIL 2VXSH 3QXTA 4QRUA 3W3BA 2XN2A 4WIQA 2YAOA 4A7VA 3ET9F 2BNRA 2AK1L 5C0AB 2XTLA 4ODSH 4ALAC 4BUQA 1DLHA 3WIHL 4F3FB 4KVCL 4ONFH 4WUKL 3KXFA 4NKIH 3VAEA 3E6HB 3VVWA 3ARYA 4PCKA 4N2AA 4Y5VA 2IH9A 5GGVH 1AIZA 5IEKB 1ZDQA 1IM3B 2J71A 1QASA 1JFQH 2G30A 3U79A 1H3PL 4Z7NE 1BPLB 3MX0A 5EZLB 2Q7YB 2LQRA 5EO9B 3TBVA 4KJQD 1IKFL 2ATKA 4WFFE 4AJWA 4AL8H 3W9EB 4Z7QB 1SHXA 4HC1H 4GI9A 1WBZB 3INUL 4HCGA 5DU7A 3TV3L 1CN4A 3AC0A 4O02H 5CR1A 4QT5A 4M6ML 4JQVA 1NFDF 1UZ6F 2P5PA 1GZHC 3C5ZD 1WA1X 1S8DB 1SJHB 2ESVD 2PCFA 3DURA 1FYTA 1J1XH 1V5JA 4OLUL 1K8DA 4P2AA 4CBPA 2EJ1A 4ZUSA 1TXKA 5E2UH 1CLYH 4WEMB 4D7PA 5DGRA 1AHWA 1KXQE 2OA9A 1HHIB 4KO5A 5C0DA 2APVA 3RI5F 4NKDB 3FONB 1PPIA 3PV6B 2CLVA 5LVEA 4UU9B 2F5AL 2BW5A 1WZKA 4HEPA 3H9HA 3Q1EA 2IH8A 5CJOL 4NOFA 1KGYE 2CMRH 3HB3B 4NUPA 1XAKA 4UF7C 5BQDA 2V17H 3BGAA 4XC1H 4P2RE 2GIMA 5C0BB 4K3HA 4FA8A 3TM6A 3VMNA 1OWRM 1SY6H 4YL4A 1DBKL 4YDKH 2NMSA 2DLHA 3HI5H 1PLAA 2ENPA 1KELH 3F04A 2EP6A 3OZKA 5T5FH 4L5FH 5DD6A 4C4KT 5TE4L 1NSNH 3FB7A 2BNRB 3C08L 4NRZA 3GSXA 4QY8A 5KBPA 3QRGL 3ZKXB 1BEXA 4JBSA 1RH8A 3TO4B 5HHQA 1JZDC 2R7EA 1T1YB 4QYAA 5DRZB 3SQOL 2ZX7A 1T3FA 3V4PH 1A5FH 1YEEH 4HUXA 4G7SB 5D1XE 1RZJL 3BZ4B 3VX1A 5KYUB 4I0PB 1Y0LB 3H3PH 3O45B 3POHA 2EAEA 4Q8BA 2CBQA 1UACL 1MNNA 1L5GB 1QFUL 4AGOA 3SY0A 1MFDL 1RUKH 5JIDA 2GEQA 2JVUA 1TZIB 3FU7B 5AYTA 2PWEA 4XC3H 1MCBA 4WW2A 2DQJL 3DSNB 2WBWB 3MA9L 3L1EA 3R4DA 4P2QA 4JY6B 3RNQB 5IESH 2BHZA 5A16B 5DUPH 1OTSD 4M6MH 4HJGA 4HIIB 5D1QD 4AGLA 2UY7A 5D1QC 3U7WH 4N2EA 2L4OA 4C56A 3NJNA 2YZ8A 3QNZA 4D0CB 3HPJB 1HX0A 3I02B 4KROC 3FQXA 4C47A 3CN2A 2CQVA 5ADOH 1U8IA 3KYOA 4YXHH 4G6KH 2AK4A 3E9TA 5I1LB 2C3WA 4XODA 3M1CA 3ROLA 2QGCA 3DIFA 4DCQA 3G5YB 2NYKA 4HEPG 4P5MB 1YNLL 5D1ZD 1RPKA 4EDXB 4I3SL 4KPHH 1TTCA 2XFXB 3MLVH 1QSEA 4N1EA 2DLIA 1I7RB 1ED3A 3NUKA 4HJIA 4F7TB 5KBKA 3O6ML 1TETL 4JREC 4K8RH 1URZA 3A4AA 3GZQA 1I85C 5E6IC 4U1SB 5ALCL 2K9UA 3BPLB 4R0LC 2UUDH 1AZUA 3EOAB 3PUUA 2CJUL 1CVRA 1RZ7H 2BVUA 3AJ7A 4AYFA 2BIHA 3T0EE 3KPSD 2WV3A 4MWFA 1EHLL 5JHLL 1E90A 3Q6FA 4M5ZL 3P9MA 2Q2EB 2R2CA 1F4HA 1MFCL 5AW1B 4RLDA 4AQ1B 2PR4L 4GKSB 5I82A 5K9QI 4LFHD 2EUXA 4UAOC 7PAZA 4KTEH 2UX6A 4DQOH 1RULL 4U6TA 2UZIL 2FBRA 3PWNB 5EZIL 2BNQE 1UWEH 4NN5B 1ZCRA 4M1CD 1NDMA 4H7VA 4YDNA 1SOSA 4P9HC 5F3HA 1VCAA 2JXMB 3ZGIA 4OZIB 1MHHB 2MTAA 5MEPA 2A9CA 1FO0H 1SYVB 4WI0A 4Y2LA 1D9KC 1E9QB 5C92A 1U6AH 3AG2B 4N22A 1G7PB 4M8VA 4PJFA 3OAUL 3B9KA 3SBPA 3BVNA 5HY9B 4KY1H 3MRPB 5E70A 3MV9E 1SJEA 3ATBA 4JANB 4CN4A 4F3FA 1TZGL 3BEVA 3WKMH 4QWWD 2CGZA 4ZAKB 4F91B 2P42B 4QRUB 1T0MA 1A8JH 1MW2A 2DTSA 4FQ1H 5C0AA 3ZKND 3U0WH 4FZ8H 4EOWL 4Y16C 4PJ8D 4JUTA 4GRWB 4AIZB 3IJSB 2VMEA 1DQML 1B0WA 4ERSL 3BWAA 4UM9D 1AR1D 4PJ7E 1XDTT 2PTTB 4FL4C 1EVUA 2NY5H 4JFDA 3TO2A 2JWYA 2R0KH 3V8OA 4JB9L 5HPMA 1N3NA 1LP9E 3DGDA 4PI2A 5HHPB 4HUNB 3TJHC 4JFPB 3ROOB 1PBYA 2ZKHH 1KG0A 4HJ0C 3FB6A 2XXGA 3B7SA 2R2BB 1NLBL 3N55A 4NLAA 4BFBD 1G0DA 1A9BB 4N2DA 4OF0A 5F21B 3GBMH 2GCYB 2I9TA 4J8QA 3IETB 1WH0A 3WO4C 3BRDA 1NI0A 3L95A 1EJOL 2V0AA 3D2UB 3CFNA 4AMWA 5J3HD 4FXKA 4JDVB 1MN4A 2HLFC 3KGUA 3L5HA 4MDRA 1FQ9C 2Q8BL 4FXGB 3G5VB 2VXTL 4ZUWB 4X6EB 4DW2H 2AJVL 1J12A 3MV01 4GW1B 2A2QT 4JEGB 4NZ8A 3CZKA 3RPIA 3BDYL 1NANI 4NDMB 4XO9A 1NCGA 4LOEA 1BOGB 1KBGH 3SE3C 1RY7B 5DMKA 2DKMA 4B95C 2DBLH 4WWPA 1GVIA 5GGQL 4PLKD 3ZJAA 1UVQB 2PYFB 3IJEA 2CHDA 1VPOL 4HWUA 4X7DC 5E1QA 4S0HA 1PIGA 3T77B 1UA7A 2K7QA 4X4XA 3NA4A 4YAQB 3T6ZA 2JQAA 1U2CA 1XAUA 2AEQH 5E23A 2BLFA 1G4RA 5IBLC 4RGND 1BQUA 1U30A 2GK2A 3O9WB 4QOKA 4KAQH 4FERA 4M7LT 5TPWH 3GXDA 4EDWH 3K8MA 1MHPL 5GGUA 1U8KA 4ZD3H 1ED3B 1CD0A 2VL5B 3CXDH 3H9ZA 1YEGH 1K4CB 4XVUD 4JFDE 3K80A 3D39D 4U31A 3HNSH 4P5MA 3UBXB 1JNJA 1L7IH 2QPEB 3H4HA 1UD3A 4HUWB 2WZPA 4MD0B 3SPCA 1F90L 3CMGA 3C8KB 3ZE1B 4DEWA 2NY4B 1CYXA 3HIZA 3X3FL 4CDGC 5DDHB 2YAEA 4DFIA 3QDMA 2RJMA 1AY1H 1O6TA 2ZSWA 3C8DA 3KS0H 4WWKC 3TT3H 3WE1A 1MZZA 1YY8B 1MWAH 2Y7QA 2EKJA 4AEFA 4TSCL 4YIQA 3W11C 3OJ2C 2FHBA 4RQQB 2J8UE 2JCCB 4DN4L 4HP5A 1KYAA 1SYSB 4LT7A 1KIQB 1L9MA 2YEZA 1RP8A 4K94H 5DQDH 1MCOL 3HE7B 1NDGB 2CO3A 3ZN6A 4JGJA 4CUCA 2XG4A 4OLEA 3AXIA 2G0LA 2WYIA 4NFDA 1H8SA 3HG1E 3HPLA 4NFCA 3NDYE 4ZAKD 3LPWA 3GJEA 3O4LB 2NQDA 1K5WA 3FO0L 1TFPA 3DYOA 4LCUA 1PDKA 3FMGL 2PO6C 2XHNA 1MLBB 4JO1H 1D6EB 4AGPA 2NLJB 2VDOH 5IB2A 3GF8A 4OZHE 3SGJC 2BHYA 4LIQH 15C8H 3D0AA 4XRCB 2AK4B 3PJLA 4X0NA 3MOAH 5EOCJ 1X9QA 3GBNL 2A4EA 1MI5B 4LSQL 1ZHBB 1Q9LB 4K2UH 1TUPA 1HHKB 4OIIH 1QLEL 5J4MA 3NFPA 4Z7UB 3UTTA 1YJDC 1FI8C 4CVZA 4YBLB 4MA3B 5C09B 3L54A 4UM9B 2B59A 2VW4A 4U0RC 1FORL 3D05A 2BS9A 4BE6A 5D8JH 2N1TE 2E3VA 4CU7A 4X6DA 1LP9F 4XO5A 2QFRA 3O3BB 1JCVA 4M7KH 5CCGE 4X9FA 1IQDA 3BJLA 5TQ0H 5CBAB 1U4FA 5DZ9A 4KNQA 5I8EB 1CYWA 3EJTA 4YHNB 4ETQA 4R26H 2R9HD 3NN8A 3UC0L 1PSKH 1TPXC 2NR6A 3AUVA 4Y5YA 2E27H 3KJ6L 3MBED 5ID1B 3E1ZA 5GGRY 3QQXA 3RZCB 5B1JA 5BOPA 2EICA 2DI9A 4P2QE 5E94A 3RFZC 5IHUL 1IL1B 1KN4H 4PS8A 5I5IA 3VACA 3P11H 5IBUB 3MRKA 1K4DA 4N26A 1AQHA 3VI3E 1BFVL 1ZTMA 2C3HA 4O58L 3T3PB 3KJ6H 4X4XB 4YAQA 2C3XA 1SZNA 1RZPA 3QRBA 5JIQA 1RUQL 4R2GC 2WO3B 1Y1DA 5GZOC 2F74B 3UERA 1R3KA 2MCMA 3I9GH 4PIBA 1GC1C 1MQKL 1QRND 5AW5B 5MI0C 3BKYL 1OARH 3F00A 4G7QB 1NGWA 3T65A 5GZNC 3H7BB 4F8QA 1T66C 5DC0A 4ZO6A 4OQ1A 5FGCB 1JIBA 2DI8A 1E4WH 2BSTA 4L3ED 1NC2B 4MNHA 4X83A 1OCWH 2P7TA 3CXDL 1DQLH 3QISA 4BFGA 2GHWB 4C56E 4DPAX 1NC4A 3HS0A 2DF3A 2P5WD 1U3NA 4Q0XL 3O3UN 2EVHA 2QPUA 1IE4A 3EGDA 4GS7B 3DUSA 1U3HD 5TDOB 1KGWA 4WTZA 5IKCA 5DFWH 2DWTA 3OJMB 4APQC 2O5YH 5AKSA 1M53A 4PJGF 5B8CA 1NOLA 3D85D 3O41A 1FDLL 4N0UE 5DRZA 3Q8AA 3ATDA 5KBMA 5HTSA 1UJTA 1VEPA 4U1HA 3RTQB 2NOYA 1UWGL 3L5IA 1JXKA 3KR3L 1WBZA 3PAYA 3WYRA 3QDJB 1MUJB 2WXQA 2D7PA 1NGYA 5FB8A 5KTEL 4QT5B 2OJZL 5FYJH 4N6QA 4X5QA 5DD3H 2R69L 2R1YA 3GHBH 5AB1A 5TK2A 3EG9B 4RH4A 5DQDL 2F7PA 4CILA 4P0DA 4FFZL 2ROYA 5ESQA 3N3EA 4FG4A 2YJQA 5C70A 1A3RH 3ZDYF 2PO6B 3S37H 5LN4A 4PJDB 1TU2B 2WBJA 4R97B 3LDBC 5E1GA 3U46B 5DD3L 3IGUA 2QGBA 2VRQA 3LKSA 1YMMB 2K78A 2BS71 1BM3L 5JMOC 3PL6A 5L2KD 1KLUB 3HE7C 1P6FA 3KXFE 5PAZA 4IOFC 3RUGB 3NSCA 4L8SB 1ET7A 2BZDA 2DQIH 3S37L 5BV7C 1LDPH 1T1XB 1C7SA 5KVGH 1B4RA 4XNAA 5D2LA 1MI5D 4OV5A 2GJ6D 3ZT6A 3IDGA 2IGFL 3NIDB 3GRBA 3OTTA 1MF2H 2NY1D 5HGBB 3WIHH 2YO3A 2UX7A 1OAYL 4KBPA 2DL9A 3JV4A 2MHAB 4WEBL 5DEGB 1JHTA 3RDJA 1QWNA 1VJSA 3FOMA 5IMMA 5HGDB 2G9KA 3VJ6A 1XWVA 2Z65C 3CVHA 4EZKA 4OU3A 5LLIC 4XXCC 2I24N 3AZUA 3OHXC 3G6JA 1CL7H 3FO2A 3VGHA 2BP3A 1N12A 2TRYA 3IGAA 2YPLB 4WGVB 5IQOA 1OAQH 4UYQA 4KDVA 3V6OA 2VWEC 1CE1L 3KD4A 4FLQA 4O9HH 4PLNC 1IGJB 4E41A 2XSKA 1V7NH 4FQPA 3I84A 4WI0B 5IHHA 3I02A 3ZTJH 2DYPA 4C4UA 5A16A 3PLYA 1R6VA 3WUWB 5IHBA 3QWOB 4PRDA 1KZYA 3OL2A 4BK5C 2MWCA 2GIXA 4ICWA 2XBDA 2VLLA 4Z7WF 2XG5A 1FIGH 3VG9C 1O9WA 1PKOA 5GRWA 4PG9A 1A47A 1GKEA 4H8VA 1F4YH 1H9VA 1D7DA 2P5EA 4MJ6A 1KY7A 1LWRA 1S7QB 4EXKA 5CJOH 3UO8B 2Z93B 3O3EA 4O2EB 4YBLC 1WP6A 3II1A 1T1YA 3AQZA 3NMEA 3FH7A 4Y5XA 4HUXB 3GTVA 1XL6A 3SOTA 1AGBA 1F6FB 2EIZA 2NY3C 3HI5L 3Q3GB 2NQCA 1WRFA 1JF1B 2KHAA 5C08D 3E8VA 3CAFA 2E74C 2F19H 1MW0A 2LHAA 1CU4L 5KANI 2OMVB 1W9XA 1BVLB 2XYCA 3DROA 2GFBA 4V1DB 1WVZA 2VZ3A 3EYOA 1NKGA 4KI1A 4XBPA 4JAMB 3KPPB 3ZTNL 4F8TA 1VZIA 1E2WA 1U8NA 1W0YT 4PB9H 3AITA 3WTWA 2V4LA 1EAOA 3RY6A 5F7HA 1B3IA 1MWOA 3MRKB 1M7IB 4IW4C 4QUOA 2B20A 3MV11 3GD1C 3DVNB 4Y1TA 1UYWL 2BRQA 1JPGA 2CUMA 1ACYH 4KX8A 2OTWB 3WEXA 1UOVA 1T21B 3WI9A 4M43L 1YNKL 3Q48A 4M6AA 1UZGA 3B37A 3PJSA 4H26B 3R8QA 4Z3TA 4RDBA 5FCUH 4ELKA 1H3UA 1Z9SA 3WDIA 2ETWA 1MOEA 1ORSB 3ATEA 5J1TC 5J6HB 3HUJA 2YK1L 2X4SB 3MRMA 3L45A 3UYRH 2EE2A 2LU4A 1BWMA 4UINL 1CLZH 2OMBA 2J2ZA 4RX4D 2ENJA 4ENZA 1ZMYA 4JHAH 2VISA 2WO4A 4P46C 4LESA 3IN2A 2BSTB 4JNXA 3OVUB 1FLRH 3GPSA 2J1YA 5E5RB 2VR6A 2CO6A 3NOIA 1PG7X 3DGCR 2J7LA 4I0PA 2CGYA 5FUOH 5F3BB 4PJIE 1FN4A 5IWLA 3M17B 3GEFA 1FWXA 3NYKA 5C0ND 3QUMH 5D2NB 4O5LL 8PAZA 2EDQA 2P8MA 3B2VH 4LEXH 5IB3A 2NY1B 1FCCA 1OM9A 5I1EH 4OZGE 4XTRC 3L3JA 4TNWF 1U92A 5JYMA 1RUPL 1H3WM 3TZVC 3QULA 4TSAL 1JCKA 3WAJA 4QTFA 2ZWZA 4R90L 4OD2B 4Z9KB 5D1ZC 3JZYA 5F1OB 2OX5A 1R0AH 5AUMA 3ZTDC 4HPOL 5DA0B 3VJ6B 3FT0A 4FFVC 3DROB 2NW3A 4W1TA 2PUQT 3AREA 3QJXA 3DXAA 2E7BA 3VFRB 4G8GD 4DTGL 1ODAA 2IDUA 2ITDA 2C7UA 1R9FA 3D3VA 5CMAA 3QG6A 1B6UA 3IU4H 2EYSA 1A9VA 4OR1A 5AW9B 1CMOA 2A9AA 5ID0A 1R3HB 3GJEB 3H54A 3DOHA 1M1SA 1FHNA 2N0KA 4LEBA 4PP2B 3UAAA 1E4XH 3BVVA 1NEZB 3JV6A 2WM0A 2LAAA 4ORZC 3BQUC 1BEYH 4E41E 1SGKA 3MXVH 1A5FL 4O2CB 3IDJA 3WUWA 3VXNB 2LU7A 2E5EA 4L8SA 4PJBF 1S7VB 4WEEA 4NCC2 1DQDL 3FS9A 4GBXD 4ODUB 5L8KB 4ZMTA 4Q9BA 2HZHA 2XG5B 2F58L 2K70A 2AC0A 1MZYA 5DJAB 3BAIA 5TF0A 5HVFB 2AQPA 3CBJB 3MLYL 5C2BL 1A1NB 3QEHB 2OL3A 2IEPA 1UXSB 2EIBA 3WKML 4Z18A 5DRWB 1OM3L 4HFWA 4L9LB 3M88A 1JERA 1Q72L 5L7XH 4KKAC 5T3XE 2MQ0A 3QCVH 1IGFH 3F62A 4GO9A 4N68A 3KPSB 4Y5VB 2CALA 1SVCP 2IH1A 1H6TA 5ETUB 3SDCA 5IV2A 3C6EA 4WJKB 4NZRL 1RK0A 5JTWA 3VXRD 5CEZL 4LL4A 2XN9E 2H1PL 3MLYH 1PZ2A 3K46A 3OMNB 3WE6A 4Z7UF 4JB9H 1T04B 1K3ZA 3TX4A 3WKYA 1A4JB 4ZMXA 1BVLA 3B83A 3QDGB 1PY9A 5D6CA 4NKOA 3IJEB 5CGYC 4YFDB 4D94A 3IDNA 4MRBA 5AQ0A 3IM1A 4NUGL 4ACPA 1A7RH 3A24A 4OM1H 2OW6A 4WJG3 2D0GA 4IEFA 4P4KB 1IEBA 5B3JE 1R46A 1AQDA 4U1LB 4JQIL 1SFDA 4N5UA 1P4IL 2K6ZA 1A7OL 2Y7MA 4NQXB 3AABA 1JZ2A 1HQRA 4ZO9A 4I3RH 1FPTL 4ABUA 1MKFA 3STLA 3LZOA 4UTBH 1HL9A 1VADA 3FCSB 4UQAA 3EDKA 4ELMA 4K4KA 1ACCA 3S5LA 2Y69B 4LNRA 2NY3D 4DP5X 5F9JB 1DN2A 4PCSA 5FO9B 1JE6A 4XOEA 4BFIA 1EANA 4PLJC 4BDVB 1FNEB 5FCUL 4YR6A 1DBBH 4R4BB 4BELD 5EIQA 4MJIB 1RUAL 1PCSA 4JREB 3T3PF 2EXWD 2O4EA 3WUWG 5AG9A 3ZDYB 1L6XA 3HS9A 1LEIA 3JTSA 3UG4A 3T9WA 2RH0A 4IBSA 3F8UB 2Y6SC 3UXFA 2WOYA 1I1CA 5ILTL 2W65A 1W8NA 1XGZA 4ZW3A 3OKOB 1KEML 2Q2LA 3DMMD 3A6OA 1OT1A 3M6DA 5C0EB 2H41A 3RUGF 1F90H 1DBML 4OGXH 5SWZD 2BO0A 4NI6A 4MQ7A 5FDWA 3PQYE 3QO1B 2HKFL 2K4WA 2PLTA 3U1SH 1N19A 4F57H 4JRYD 1JWSA 5M94B 4I85A 1MFNA 1DLFH 1DSFL 4IKJA 5HVHC 1NMAL 5C2UB 4LEOB 2CKBH 4GKOA 3L3DA 5C0BD 3QQDB 3LEVL 5EOTB 2N59A 3BO8B 1PNDA 3K6OA 4PJGB 1T2XA 2AJZA 4QGYA 3GS0A 3V79C 1OE2A 3DV4B 3WIAA 1UXMA 2UY7B 2XWBA 3D18B 4TNGA 3GZOA 2LAGB 3NABL 4ANKA 3RNKA 3FUIA 1A2YA 1OZUA 1YC7A 5KSVA 4ZS7L 3GSUA 4M93C 3DHMA 2TAAA 4HLZH 4AG4H 1N7ML 2ZCHL 5C9KA 1EJOH 4HUCA 2VWEE 1EBAA 3GSRA 3P77A 4MNGE 1BXXA 1E28A 1NCHA 4PRPA 1WWCA 4PR5A 1RZKC 5GHWL 1DQDH 3O0RH 2XFXA 6FABL 5TF1H 3T3MF 1NFAA 4X9GA 2QVTA 4QTIH 3UH8A 2DD8H 2HLAA 2I69A 2ZCHH 5AUMB 4GUQA 3MGTB 2J73A 1IL1A 4AQEA 1KIRB 2OTUA 2QELA 4Y5YB 4UT6L 1D9KD 1TCRA 4N2KA 3J2PA 3QULB 2W5PA 1RK0B 1MRFH 5DI8B 3QCVL 4A39A 1BG9A 1JHKH 1SJXA 4JN1H 4PJIB 5HI3D 3JVGC 4Y19E 5LBSL 4AY0A 4JO4L 1MDTA 4U6HA 1X4XA 4TRPL 4R3SB 5LO7A 4BA8A 3HZ3A 5K9OB 5B1BB 1AC0A 4HALA 5SWSA 3FHAA 4HJGB 4DQAA 2ZAIA 4ANXA 4QWWC 1UKQA 2C3GA 3UTTE 1C7TA 3VH8A 4MQSB 3IU3A 2IDTA 4N2HA 5EU7E 4X6CA 4TVPE 1IGTB 2O5YL 2MOGA 1MRFL 3VXNA 4JPWL 5LNGA 2EE6A 2CNYA 1A02N 1XFPA 3OMZA 2HKFH 1ZHBA 4TULL 3JV6B 2EEAA 1J48A 3BXNB 3C5ZC 4BFJA 2P80A 2XWRA 2MSPA 1AP2A 2ZXDA 4TL4A 2FR4B 1A0QH 2Q20A 2XZAH 5IHWA 4YGVB 5CILH 1VFOA 3WFHB 5BO0D 5IHZB 1OAXH 3U36B 3ZDXB 2QJDA 2VE6A 4UV4H 1QPKA 4IRJD 3WXVH 3HE6B 4P5SA 1A6AA 5JA9A 1I7RA 1NEZG 5D7LA 1SEQH 5DT1H 4XMVA 3W39B 1S5HB 2ZXQA 2BM3A 4TVPD 5DQJA 2O93L 5CGBA 2I7OA 4G80A 2BSSA 4JFHD 2HT3D 4EUPG 2ZYHA 3MNWB 4PW4A 5ID1A 5ETUA 1H0DB 4KO7A 1NFDB 1RPQA 2ZNXA 1A7NL 2NXYB 3U30B 4NRXB 4AMKL 5I1DA 2BNQD 3O8XD 2H45A 4NO0B 5E2UL 4OW6A 2IQAB 4K07A 3G6DH 3L17A 5I1IL 4PLKC 2O30A 5I0YA 4PRBA 3K74B 2W8CA 4QRPA 2PYEA 4XBMA 5CEYB 3VSQA 4AITA 1OXYA 3U2JA 5ICZB 5J0BA 1PZUB 1JF1A 5HI5D 2NYYC 4ZUWA 2MTPA 1FG9C 3RZWA 5MEND 2GSIA 5AZ2H 3K5RA 2PWHA 1C5BL 5F0JB 4QO1B 4YSRA 1TQCC 2VXSL 4FTVD 1XR8A 1JF6A 4PGBB 1MRCL 2R4SL 4U6HB 4H8UA 5CN2A 5K9OA 5C86A 3LV3A 4BM7A 5C6TH 5DJDA 4AEHH 4AIEA 3N44F 1GIGL 2X2JA 4H88L 1GPOH 1KN2H 1A6VH 2VXUH 2DM2A 2KMWA 2VC2L 2CD0A 3ARFA 4WUUB 2CKBL 1CDIA 1H6UA 5EC1B 4J1UA 5DQ9A 4ENEC 1NAMH 5FYJL 2HJKB 3MRLA 4EIUA 1P7HL 3VQMA 4QHMA 4FP8L 1A14H 2O5XL 4LCIH 2VLLB 3EDEA 2QSCH 4FMFA 1LILA 1F11A 1KEGH 2P5EE 3EO9L 2H3NB 4K94C 1JZ3A 1TJMA 1MJJA 1EK3A 1OCZB 4LSRL 4MD5B 2WNGA 2HTLD 4E68A 2UXGA 3TLRA 4J4PA 4NQVB 1EJFA 3DA0A 3TWYA 4UQ3B 1VEMA 5K39A 2BXYA 4G8AC 1P5VB 4ATTA 4OKDA 4IMKC 3VCLB 4PJBB 3O2WL 5DO2D 2XTJB 3AM8A 4YSAA 2JJTC 4ZBJA 5EO0B 1CG9A 5GIRB 1IBGH 2EIZB 3G5XA 5GHWH 2WXKA 3U48A 1AZVA 3CZUB 4R97C 4U3CA 4UT7L 5I0ZA 1HL8A 3O0LA 1DTUA 1Y6MR 3CVHB 2ZSWB 3DPBB 3THML 3FRPA 4DH2A 5EBWA 3FZUD 1RIVL 3VQ2C 2GJZA 5FYKL 1HYSC 4LHUD 3REWB 4Z7VE 4PJHA 1K6QL 5IJVB 4P4RA 3N50A 3RGVB 3N41F 4MSWB 4LHUB 3V10A 2LU5A 2ADJA 3TBTB 3OAYH 2YD5A 3QZPA 4UNUA 5GSRB 2E9BA 2FUQA 4M7JH 4E9LA 1KELL 4KVPA 5F7KC 1FP5A 1YECL 3QWOA 2WUBH 2YWZA 2UZXA 3PL6B 4AW4A 4PWIA 1QEWB 2OMZB 3NJGA 2ICWJ 2ZOTA 4NO5B 4KO6A 2C9RA 2Y1YA 2OTWA 3CX2A 5T3XL 4FXLA 5KOVC 3P4MA 2R4SH 3H3KA 1G9MC 3K2KA 5K1NA 1ZV2A 4TV3A 1ASQA 3V0HA 1CE1H 3EOTL 4XB8A 2VO8A 1HYRC 4QJ4B 1YDPB 2CRMA 2H6PA 2WXNA 2NXYD 3GMLA 3Q01A 5AYUH 1IJNA 1VFAB 5C0RH 4CN1A 2CAKA 5E0FA 2VABA 5EOCL 4KQ3L 3VGFA 2YSSA 3FUNA 5MEOA 1MFDH 1RUKL 4DZBA 3MBEC 2WC7A 3CXHJ 4A2DA 3MNVA 4OVVA 4IKIA 1EXGA 2D7NA 4OT1L 4U1GB 3S88L 2E8ZA 4YEEA 3KLLA 1SBSL 2ZXAA 2YZ1A 1QFPA 4WTXA 1E2VA 3C5ZB 4OCSH 5HHVH 1V7ML 1QSFB 4MA8L 2H9GA 2JJSA 3BUTA 1LD9A 3MV7E 3UTPD 4E5XA 5JQ6H 3O4LD 3L5WB 3GYRA 4K9EH 4I89A 4PJ6A 3BAJA 2A6DB 2R2HA 3HHSA 2KZBA 5CJ8A 3SB3A 1VKXB 4JJOA 4YL9A 2VO5A 4IDJL 5DVMA 3MTXA 1YEIH 4H1LG 4XP4H 2NXZB 1ONQA 5F8QC 4BFRA 1HSAA 4FA7B 1MY5A 5ADOL 1PLBA 1LWHA 1N8ZB 2OMWB 3TONA 3MODH 4FLSA 3RBSA 1FNSL 5IR1B 4NWTH 4YDKL 4D9QD 2ZUXA 5CBEB 2EUZA 3JT0A 2ZCLL 5ALBH 4M9PA 4NO2A 2R29L 3D5OF 3ZE0B 2MPAL 2VLJB 2DQUH 3EJYD 4HCFA 4PGBA 1WFMA 2EYTA 3B3IB 4HH9B 1AQKH 3TA3A 4JDZB 1GOGA 4AVKA 2WCSA 3QXUA 3MI6A 6PCYA 4KUCF 2VLJD 3GBLA 2MOQA 5EU3B 1OAKH 3EGSB 4NN5C 4UUJB 4KKBC 1ZLSH 1CK0L 2XJKA 3PY9A 2YD6A 1G7HB 5IQ9B 1JZEA 1KV7A 1MH5A 3EZ8A 1QYGH 4TUJA 3EJRA 3L1GA 1VFBA 5KANG 5KSBB 1XD1A 4UQ3A 5I1LA 4EQ3A 3J7HA 5E51A 5AEAA 4OCLC 4I2XA 3QS2A 3IPEA 4Y9BA 4HCRH 2WP3O 3MCLH 1R5VB 4EN3C 5IQ7H 5TD4A 3BWZA 4ZMAT 1YSOA 1PG7W 3QG7H 3HMXH 1HSBA 1ORQB 5DCCA 5C8JA 1A1NA 5LGHH 1FYTE 5TDOA 3GM0A 1K5NB 3NEOA 5B8CB 3H2PA 3BI9X 1LXMA 2VDPB 4YHNA 1KIPA 1USQA 4KJWC 2HVJA 4F2FA 1AO7D 3Q6FB 5IJVA 5HHNB 4XC1L 3L7FB 1AGEB 4XMPH 3SPJA 4Z6AT 4FXKC 4Y2OA 4Q74A 2MCAA 1EQWA 2VSMB 4PJHB 1YPZF 4XHJD 2VN6A 4MB3A 4P2OB 3GJFH 1QI4A 4NUMA 2VLME 1EFXA 4AK2A 2EE9A 2EDDA 3MR9B 3PYCA 4H1LA 4PS7A 3UGUA 3S6CA 3N1MC 1JAEA 3D25A 4X8XA 3MQIA 5E56A 1T4WA 1MIEH 4PY8I 3G5YA 1HCYA 1J0YA 2ZYIA 4DP6X 3EUUA 2X0WA 2VH5H 3PIQB 5DO2C 1XSOA 2FZ3B 2VZVA 1DUYB 1L9RA 3UG5A 3NCEB 1EEYA 4P9HH 4ZSOE 3BVUA 1AGCB 2XRAH 5BJTA 4GSUA 5K39B 4YXLL 2HH0L 3IU4L 3EDFA 4F9LC 3JWOH 1OTTD 3L3OC 4XCCH 3CDZA 3K3QA 4MJID 3GGWA 3FU9A 4XC3L 4OF7A 4GAJH 4NXSA 5C0GA 3ILEA 5FYLH 3TASA 2NX5A 3NQIA 4KTDH 1WGOA 2W92A 4X7FC 4HXBH 5DUPL 5DJ0A 4UOW1 1MJUH 4ISVA 5C07B 3ZRFC 2FQGA 1WS7A 1CT8B 1O6SB 1J05B 4TVPL 5FA3A 5HHOD 5D70H 4XN5A 1IAII 4AL8L 2G5BA 4PIRF 3DARA 4P3WA 5C8JB 1OCCB 4LASL 1PLCA 3ARRA 5SWZB 4LMQE 4QKXB 4FMVA 4PPTA 2HRHA 2AFNA 2FBJH 3RDTD 4K5LA 4HS6A 5I66B 3SE4C 4LSPH 2OV0A 3ARSA 3KVDD 4IQHA 4I0CC 1AD0B 3WLWC 3HNVL 5BO1L 3TJPA 2AABH 1NM9A 5FGBC 1WFNA 2JFCA 1HN1A 5GS2D 2Y5QA 2ZQKA 3VFGL 5JIIA 4L3EE 4IDJH 2V2XA 4YUEL 2EDWA 1AS7A 4KRPC 4PCYA 1JTTA 1XCWA 4KXCA 5FYKE 2A6KA 1AXTL 5I17B 1K0ZA 4U1MB 2E7HA 1IC0A 5L88H 4H40A 4FNTA 2V2TB 4JKNA 3B2MA 4L48A 3LB6C 5E0QA 1DJXA 3OB0K 5E5MB 2AITA 1MAKA 3L4UA 1LMKA 1FL5A 2HXAA 1PIFA 5KJRL 3KXFD 4RDQG 2X4QB 4OLXH 3DX0A 2JJUA 3L2LA 5M7QA 1NQBA 5JHLA 4W4NA 3UZEC 2ZG2A 5IHZA 1OAKL 3B5HA 3I2CH 1E28B 2QV2A 3BP4A 3FYIB 4PAZA 5GZOD 3FBQA 3O3DA 4K94L 1JHLH 4AVHA 2EINB 5F3FA 5CCKL 4KKNA 5IT2H 2HVBA 3HBPA 2FO8A 4XOAA 1PW3A 4KROB 4HXAL 3VA6A 2R69A 1HSBB 1ORQA 2JCCE 2Y06L 2OSYA 2JKTM 3IWVA 4LL9A 4XAWL 3GPEA 3AM8C 1CXEA 3L5WA 4QRPE 5IFJA 1SXZA 2VKWA 4C4BA 2NY2C 2FX8L 2A6DA 2R2HB 2GTWB 2NUPB 2ESVA 1NCUA 4LVOB 4U1JB 4FXKB 1QABA 3NFNB 2AMUA 3GK8L 5IFHH 2A1WL 2Q76A 1LO3L 3LAFA 5CP3A 2NDGA 2QQQA 4PJDA 2DAVA 4X9YA 3AS1A 3H42L 3FFCE 5EU3A 4FFTA 2Y6SD 4JGMA 2XZCL 1CJYA 3QCUH 4QOKB 4OGXL 4CC4A 3FHEA 4OLWH 3NACL 2ZKXA 4JM4H 4LPCA 3T77A 3E6FA 4X0KB 4P57A 5IW6B 2D0HA 4PRIB 1G94A 1Q9OB 5E1AA 4IRSC 3N41B 3MUZ1 3VXQA 4MAYD 3WDHA 4FTDA 4HOZA 3PUCA 3FU6A 3H42H 4CMMA 1NGZB 2X0VA 6CGTA 1QEXA 2IPUK 2X89A 2X88A 1AXTH 3SCMA 4DSYA 1LQBC 1UT1A 1YHPA 3LQAC 4R0LB 3KPLB 5I1CL 4WU7B 4F9LA 4P5TC 1DUZA 3KS0J 2NY7H 3CHPA 2X53A 4FZ8L 1MVUA 4DERA 4XH2A 4RZCA 3V4LA 2IANE 3WS3B 2AEOA 2V7NB 2XVLA 3DYPA 2G2RA 2X4TB 1YCSA 1XF1A 2JKWA 4Y2DA 3ZHNA 4HIEA 3RL1A 1T1ZB 4Y7OC 4Y9GA 5I6MA 2BIPA 3FOLB 5DS8A 3HE7D 3S37X 4ZMPA 3HI6L 1OP3H 4UV7L 4PJBA 1MFMA 2VLKA 3WFBL 1NMCC 2J8HA 1MHEB 3AQYA 2IGLA 1S4IA 3EJUA 3DJTA 5D7HA 1KZQA 4NRYB 5E8EA 3LH8A 15C8L 4LCVA 1PEWA 3C6LA 4FYQA 4JGNA 3JYBA 3STZA 4XPAH 3ELQA 4OLVH 5BVJA 2DD8L 1IGIL 3MV7B 3NSFA 4P2QD 4PJ9D 4CBZA 3BZEB 2Y9RT 3MUGB 3H9SD 4B97A 4MQTB 4DK3A 3HC0A 3KLKA 5HD8D 4LRNL 1FG2B 4MS8C 4MNGA 1Q9KA 2DIBA 2I07B 3APMA 1RQ5A 2QKIB 4U1GC 1BPVA 4YFEA 2AJXL 4JHZA 4G83A 3K8KA 2HPOA 4YSDA 2OI9B 2AK4D 3QRLA 1FVDB 3W0WA 3GMMA 1JYVA 2B5IC 2IDQA 4JFVA 2XFGB 4WCYH 3NVQA 3ESOA 5FGCE 4RMRA 1QSED 4HKJA 5DTFA 5DZLA 4HPHA 3RILA 1UWXH 2CJSA 5DHEA 4JFFD 3PG2A 3O11B 5BRZD 5GRJL 4O02L 5DJ6B 1M7UA 1NGWB 1PD0A 1R17A 2XWCA 3IN0A 2BFVL 3T0BA 2VC2H 4YHIB 3IJYB 4M9OA 5GJSL 3ZT5A 4UTBA 4LKXB 5F0PB 4ZUUA 4TUKL 2IQAA 4HGMA 3BIKB 5L2JB 3B7TA 2PYEB 5HDLA 4B0MM 1AO7E 3QPKA 3MRFA 3SJVB 3G5XB 7FABL 3NZSA 3B5TA 1G9NH 3BYYA 3MTRA 3IFPA 3BKMH 4QRRB 3WGUB 3MOBH 2RACA 3SY0B 4HCIA 2VQ4A 4J4PC 3MROB 1G9ML 2QQKH 5J5EA 3S48A 4B9PA 5GRUL 3SEPA 4GSDH 1ANUA 2AVFA 1NCDH 2ZUYA 5E9DE 4Z7QF 4AGMA 3BGFC 3GLZA 4TUOA 1O7VA 2ZT9C 2KYIA 3B9KD 4FLHA 5E4EB 1RUMH 1IT9L 4Z5RB 4ZFGL 3AXHA 4BKSC 3WFEH 1I53A 2DJUA 3CK0H 4BSJA 4UNIA 3HBZA 5F7EL 4ABVA 2VLKE 3BZFB 4YO0B 4PJHF 2ZNWA 4PJ8A 4Q2ZA 3O3BA 3QDAA 3NJIA 4MLSA 4RESB 4BWUA 1NC2A 3C8HA 4F7EA 3HHRB 4OIBA 2DBJA 2WWOA 1FVCA 2DQFB 2IBZY 3CGTA 3RE0A 2NSXA 5C3IA 5I76A 2DEXX 2EUWA 3FQRB 4G6AD 2CCWA 5DJAA 4FEIA 1MI5E 2DRUA 2EO9A 1PZAA 3FUDA 1WA0X 4Y4HA 2AJYH 3F5WA 3NCXA 1QTYT 2J88L 4JM2C 5EU6E 5F7EH 4L8CB 1VGKB 3DVFA 3P4OA 4EF3A 1S9YA 2X1XR 2VDPH 5INCB 3O45A 3L1OH 3RA7H 1RZFH 4Y8AA 5EF3A 1CXHA 1ZVYA 1XGRB 1ZLUK 3X3FH 4TTDD 1Q0XH 1HJCA 2ZWLT 4CL7A 5GRJH 3OWRA 1R33A 2PP7A 3OHXA 5C0RL 3AREB 1BFTA 4KKPA 5HDQH 1UD4A 5TE6H 4NAMA 1TQUA 4B60A 3R06B 4OLZL 4PJ5B 4WKZB 4E9RA 4FF9A 5DJ2A 3RVWD 2R15A 3D2UD 1V54B 4FQ2L 4GG6A 2G3ZA 2NZIA 1F6AA 3EFOA 5AWNH 2EDOA 4HUUA 1FGNL 2QSQA 4M1GL 4Y2NA 4MDIB 3QZLA 2IAMC 5I8OH 2YPVA 4WSJA 3QK0A 4LLDB 5CFAA 2X09A 5FGBA 3A6CH 1BA9A 3LX9A 3ZIMA 1WWWX 1DQLL 2P24B 3LXUX 2OSWA 3WTUA 5F44A 1JGDA 5F71A 4YC2B 4PGCA 3RNKB 1A9EA 1EO5A 1O9VA 2DM4A 4X5LA 3GUTB 1RLBA 2ZWSA 4D0BA 4WSGA 3GSUB 1C16A 4TLTA 3DV4A 1IAMA 1DBAH 4ONOA 3QZNA 3VFTB 1XH0A 3KGRA 2HRLA 4OV5B 3SY6A 3HNTL 1F2QA 3KBFA 2BNUA 4KGJA 1YECH 2G60H 3FFDA 2WUCH 2CIKA 3BCFA 2J1KA 4NJ9L 2NY0D 5AZUA 2NY0C 3P3UA 4ODVH 4OGAD 3IAQA 1A6TB 3QDMD 1B88A 1N2RA 3C8KA 4ICXA 3VXRB 1BW8A 4HPOH 4W9JC 2F53D 1G1CA 1YEDA 4APXB 4NC1E 2Z7WA 3HG2A 5CJBA 5I1JL 2XV2A 4HT1H 4R7XA 5I26A 3B9VA 4KMTH 5I5JA 3ULAB 2Z7YA 4A63A 2WQWA 4BRJA 1AKJA 1NFKA 2VUOA 1E9OB 4DNLA 5BVJB 2OR8A 4NQCE 3F7YA 3C5SB 1AC6A 2GITA 4JANA 5EN3A 2FTAA 2H8PA 3FN0H 1PSKL 5JIHA 1P9MC 1QLRB 3MUGA 7FABH 1KJMB 4NDMA 4JHUA 4ZAKA 1JMXA 4Z7QE 1NDGA 4G7YH 3FO2B 1ZANL 4M48L 3KWVA 1U8NB 1PX3A 4FG2A 2VDKH 3VWJC 1KFAH 4D9LH 4P48A 5DMGC 2PPDA 3D18A 1VLXA 3QFJE 1DQMH 4AL8C 4UTCA 1MCQA 4MJHA 1S7WB 2OYMA 2A4CA 1E3FA 1YY9C 2NY5L 3KHOA 3ZQWA 3O2WH 4NPYA 3DX9B 5LB1A 1MF2L 5PCYA 1C12B 4J7RA 3C6LC 2EDRA 3DRTA 3FTUA 2EXSA 4JMXA 4OZIF 3O11A 3WD5L 1KB5L 2J4WH 1SLWA 4IS6B 4RGNE 5IF0B 5TGBA 3FRPG 3ROOA 4AUUA 4JKLA 3ARPA 3I75A 4ZFGH 3MRQA 2EDNA 5T3ZL 1JPTH 4NS0A 2FB4L 4AYFB 2GCYA 4QKTA 4QHPA 3EXJA 2J3SA 3P9MB 3FRUA 3WJLC 2CDFB 2FJFA 2NX5E 3FB6B 3PGDB 3ZOAA 5KN5B 1P7KB 4WNSA 5DEJA 3QPQC 3HR5B 1LO4L 3II3A 4IU3A 1MFBH 2HUHA 4WWID 1KB5A 3TZVA 3CX5K 1HHJA 1PMYA 3ES6A 1LP9B 4PJXB 4YMPA 2LE9A 4X5WB 1ZHNA 5SV3A 3K0WA 4TVSa 1J0JA 1TTBA 3QXDB 3VFSA 3TBVB 5D7JD 4ZSOA 2BVQA 2J88H 2VZSA 3T1FB 1N4XL 3CMOL 4KKBD 4MS6A 3U0TA 1I1AA 4KKCD 2VZ1A 3ZSTA 1G7PA 2X6UA 5B1JC 3VXTA 4I5BA 4XNZB 5AW2B 3VNYA 2Q5BA 4JO2L 3UTSA 3VSVA 1ZA3B 5AB0A 1PX8A 2ESVB 1U58B 1UWGH 3ZK0A 4L1SA 2M1KA 1QFUH 2FL5B 2BCKA 5LHDA 4HEMA 3MV8A 4IIZA 4GKNB 5C07E 3UO1H 3VD1A 1JPSH 1OGAE 4WJ5B 5LNDA 3CFKB 3QUKA 4Q9RH 4Z3HA 3HAEB 1AH1A 4YH6A 1OSPL 2PWFA 3NJFA 2FAUA 4WUUA 4FE9A 3GDCA 1JMZA 1KENL 1DDHB 4FNLH 4G7RB 1QRNA 3C60D 2WZ5A 1U8CA 2H3XC 3HNVH 5BO1H 2BY0A 5F88B 1WO2A 3O2DA 4POZC 1GZQB 2A73A 3BH9B 4JFEE 4U6YA 2PTUA 1VIWA 3VFMA 4RISH 3TCLA 12E8H 3DRTB 3IE4A 4JFHE 2NTSP 2I85A 1U8MA 4Z7VF 5DZJA 3S3JA 3WY4A 1KGXA 3GSXB 4QY8B 1SY6L 3Q43A 1NC4D 2NY4D 1YUHB 1JUFA 2P5WA 3SYAA 5I6NA 1TZHB 3U4KA 1B2YA 3U9UB 1MCOH 3GMQB 4N87A 2X87A 3PF2A 1J8RA 5ANMB 4NRZB 1CPUA 3RPBA 1MLCA 1JD7A 3P4LA 5EO0A 5GIRA 3L9BA 1SFHA 3O6LL 3QC5X 1UUNA 5ALCH 1R34A 2IWGA 5GS0C 4CC4C 1XF4A 1AANA 4OCXL 1EGJL 3F7YB 4XPFL 4M3JA 3X12B 3L5JA 1T5KA 2AMGA 4S1QH 3CU1A 3KHQA 3LOWA 1RZ7L 3IDUA 3QWRD 5MEQB 1AZNA 2WLNA 2A3TA 4P2RB 3NPSC 3KYMB 4CA4A 4F8LA 4XRCA 1KWGA 1QKZL 1WAPA 1ZK5A 4KYWA 2QT6A 2C8NA 2JE8A 3FT3A 4HSAC 2Y7NA 3FQ4A 3G9AB 3GBML 4MXWH 4PJEB 1ZGLP 5CUSH 5CJQL 1X5ZA 3AMLA 1HHIA 1OHQA 4WI7A 1U9KA 1HZKA 4J6IA 2H1LM 2FWSA 4J1UB 4MYPA 5HGAA 5CP7A 2WBJD 2X4SA 3DX4A 3PHAA 5IVXE 4DVBA 2E7LC 5I19H 1ND0A 1XVSA 5FW8A 3CFJB 3HZYB 3VW3L 2GIYA 3LXBA 4BWTA 3ULVC 2VZOA 4GRMA 3ULVD 1QW9A 3QAZB 4HW6A 3WCYA 3AREC 4M7KL 5L2KA 2Y1VA 1VPOH 4YBQC 5IIEB 2BIMA 3LKOB 3Q8CA 3LKRB 4H20L 3U6XS 4KHXL 4M62L 1HESA 4GFXA 4F92B 3WD5H 5JHDE 2CM6A 1T3FB 3CSTA 3N9GH 3W57A 2WPGA 4QRSA 4FQJH 1HDMA 3P9LA 1F4YL 5T1KA 2UWEA 4LAQH 5ES4B 4JN1L 4QTHB 4KRPD 4V2BA 1F4XH 3WN5B 4B3VA 1TJGL 4K8RL 3MREB 3TT1L 2YRPA 1U92B 4QXTB 1NMCB 2GKIA 3EOBA 1JZ4A 2BSCA 3P3RA 4KHTL 2IFFL 2OULB 4IRJC 4KKAD 1CVSC 5AAPA 4JRXE 4PREB 4JG5A 4P23D 1N70A 3HS8A 3OSKA 2BVQB 2DWEA 2CLVB 1PEZA 2Y07H 3S36X 1P7BA 1ZE3C 2BSBA 3CN0A 2QSTA 4B9ZA 3UJIL 3UBHA 5FR3A 4PHXA 3G04A 3DSNA 2VOTA 3KYKH 4C55A 2WHVA 3ARDB 4M03A 3CMOH 1ZT1B 3CZSA 2RQ8A 1HXYA 1KCKA 4M6OL 1I8KA 2PN5A 5DYOB 3WY3A 3OKKA 1A4KA 4PWFA 5JIPA 4Z7IA 4MJ4A 4E41D 3MMEB 1EERB 4BHUI 4HPYL 3MRHB 2VZTA 1BD2E 2HFFA 2J5LB 1M9SA 1ASPA 3KH3A 5TJWK 5ITBH 2EQDA 2J8UF 3KH4A 2WJ5A 5I30H 2XTSA 1NA8A 5IF0A 3ZW3A 5A2JH 2YD7A 4NP4L 4GNKB 1IC4L 4KY1L 2YUVA 3NRPA 1TYRA 3C2AL 5GS3A 5GSVB 2DWXA 1C8QA 1THCA 4Z7WB 1JDAA 2KQMA 2C1PB 2ORBH 2R1XA 1XSIA 4Q2ZB 3LRKA 3T3ME 2WWNA 4I9WD 5ANMA 4GSQA 2YPVH 3SBWA 2CCLA 1I1AB 3CSGA 3LMJH 3QFJD 2MMXA 4NC0B 3V0EA 1Z0MA 4DF9A 1N3NB 4EJ1C 3TJEH 3EUDA 2YPKB 5C08A 4JE0A 1PFCA 2ZOKB 4UQ2A 3VSTA 1NAKL 4J3BA 4N2OA 2V3EA 1JHTB 4UMSA 3RVWC 4PJXF 3TBWA 1X44A 1YYLL 5DEFB 5BV7H 3Q3GA 2WN3A 4UB0H 3GSWB 3U82B 2IADB 2HTLC 3RBGA 4A6YB 4C59B 1I8LA 3WTYA 5H37G 3NIFF 5E6ZA 2YQ2A 2XI9A 4XPGH 5GGRB 2HKAA 2ZXBA 5CBEA 1URLA 1OTSC 4OQTA 5FHAL 5DMKB 1YEKL 2Q8BH 1XR9B 4KITB 2BWQA 5FO7B 5AVUB 3GHPA 2Z31B 3LJ3A 1OP3K 5KAQF 1VGEL 2CKNA 5T1MA 1FA4A 4X4YA 1JRHH 1KXVA 3LKSB 1OF2A 4X98B 4UZUA 2G75B 3TCTA 4PVLA 4PRDB 2ZUSA 4GKLA 5EEUA 3FSOA 4XPHL 5JHAA 5GRUH 1P5UB 4CMHC 5DJ6A 3AFLA 2O72A 4EI0A 4HKJB 1JVLA 3V6OC 4RX4A 3F6JA 4JPKH 4OBSA 1JGDB 5TFSH 1G7HA 5F1IB 5E6ID 5HHPA 2WVVA 3TEUA 2AS5M 1FNGB 3NPSB 4OV6F 3PVIA 2HAZA 1DJIA 4JFTA 3VFWA 1CDHA 1BLIA 3MJ8B 3WMSA 3L7EA 2ED6A 3DKHA 1NCAH 3FT9A 5IUCA 5EEVA 3VE0A 1YPZB 1XGPB 2OAAA 1AKPA 1RUAH 3PWPB 4FQQA 3BKYH 2IAMA 1W72L 3CD4A 2AEPL 5G5DB 3QT2A 4I9WE 2WD0A 1PJ9A 1NGYB 2EIEA 3KM2A 2NY1C 3FT4A 2J12B 3I50H 3NDZE 4ODWA 3S8FB 2DJSA 4OGYH 5D7KE 4RVBA 3LS5L 2Q10A 3MV7A 3IMTA 2D3LA 5IR1A 3FQUB 2YBRB 3BP6A 1F4XL 1NICA 3OHXB 4HH8A 5DWPA 1HAWA 2FJGA 3DV6A 2FD6L 2VLMD 1AZRA 5SWQA 4X50A 2QL1A 5EC2A 1RZQA 3EHBD 3EHBC 4NENA 5L8LB 1CXFA 1Z3GH 3M07A 1WIUA 1TQBC 2UXFA 2YD9A 1HILA 1I8UA 4TS6A 3LKNB 3HI1B 1YYLH 2WZ0A 3BPLC 5HI3C 3D3VD 4L18A 1JG9A 1DVFD 5J06A 2EVJA 3C6SB 3V0GA 4OFIA 1GZPA 3O0RL 2MIZA 5EU6D 4BSWB 1RLWA 1FAIL 1FVCB 1D2PA 2DQFA 4KI5C 1HEJC 1KCVL 2AJSH 2P24A 1R5WA 2VR3A 4X7TB 3CFMA 5DVKA 3TCXA 4P5KA 3LIZA 4IRJB 4G9DB 3NESA 4XI5C 2H0JA 3GSQA 1OGAB 4YEFA 2YAPA 2PKDA 3US0A 4TXVB 2OXHA 1HHGA 4PJFF 3QZWA 5KYNA 4RGOL 3NABH 5BRZB 1S9VB 3M7OA 4MGXA 1RK1B 2QFPA 5FUZL 1QO3B 3MRDB 1I4FA 4KV5F 2H3NA 3QHTC 2E9GA 1G87A 1MEXH 3CH8A 4WW1A 3Q6GL 4KK8D 5IB5A 1GGIH 1FSKB 3FB7B 5CFHA 1A6TA 5JXAH 2I26N 3CVIH 3ETBF 2HMID 3VXRA 1JFHA 3X11B 2PPEA 1GGCL 4XR8C 1SXCA 1MSPA 2DWSA 1ZT7A 1BREA 2NT1A 1COBA 3QI9B 2ICEB 4FJZA 1Z1WA 3X1BA 4DGYL 5I8KH 4DHLA 4Z7VB 4C4KO 2E6PA 4AYGA 3FUHA 4ETQB 2OJ1A 2EYRA 3S8GB 3ULVE 3GMOA 1V8HA 3EYVA 4HWBH 4OLYL 4UMGA 1SBBA 5DF0A 1X9UA 2SEBA 2FRGP 3UC0H 5DC9B 5E8DH 2GTWA 2IPTL 2NUPA 4U1JA 1N6QH 2Z31A 3SKJL 4G9FA 3NJHA 1TVHB 3F7VB 3GUTA 1CLZL 3C09B 3P0VH 1W72B 3H9YA 1CGVA 3O4OB 1JS4A 1HE7A 4PY8J 4IM8A 5J6HA 3P4NB 5KSAA 4LBAA 1OWWA 5GJSH 1DJHA 3PDOA 2C7UB 4MJJA 2G9HB 5J11B 2J57A 5J1SC 3SDDA 3GGWB 4BXSV 1EIBA 2HCZX 3VRIA 4TYUA 3MRBB 2XC8A 3QUZD 3GFUA 3QZMA 4XHJC 5C3TA 5I8CA 3LNEA 4RBPH 3SKMA 4BIKA 2OZ4L 1F11B 4GH7B 3P0VL 4O5LH 1FZOA 4NNYB 5I2IA 5LGHL 2WLJA 1GHFH 4CAGA 3J8F7 2XPGA 5I1EL 3L3JB 3W9EA 2F7IA 4A2HA 3V4PA 1ZT4A 5HVGB 2EVGA 4HJSA 4AEEA 1BFOA 5IVNA 4JAMA 4ODBD 1CDBA 5DK0A 2IIJA 1QI5A 2YHGA 4WO4B 1EZVX 2WP3T 3D9AH 4HFWB 4L9LA 3UAJA 1FNSH 2G0KA 1HVXA 1GIGH 4B0MB 1HJBC 4EN2A 3VFNB 3CDGB 4XX5A 2FB4H 3VXPA 1T6VN 4HJTA 3FONA 4WO0A 1SN0A 4G8FB 4MS8D 1JI1A 2QQNH 3RNQA 3FPXA 4ES9A 4JFED 5BMFL 3E7JA 1P1ZA 4S2SB 5C6PB 3B9DA 3NIDE 5F72S 2J1ZA 1UJ3B 1ZV9A 2FCBA 3G6DL 3ZTEA 3MFGB 1KTLB 3NRFA 4GOSA 4ODSL 3B8YA 1XZ0A 2IG2H 5FYJE 5B7EA 2VR7A 1XTLA 1ZAGA 2W80C 4LSRH 1R3HA 4PP2A 4FTVB 2ATPB 1D7FA 3KR3H 3JV0A 4JZOA 3WJMB 4PSRA 4EE2A 1EEZB 3BVTA 4I77H 3ZE2F 3D07A 4JFYA 4RFEA 4ZXBA 4ZW7A 2OXGA 2C3VA 1IVTA 3BPOB 5D5ME 3G08A 2WSKA 2FL5A 4JO2H 4R83A 4TULH 5LGJA 4FFZA 1Q0XL 4P57B 3V7MA 5GS0L 5DHVB 3RLSA 4O9HL 2VLRD 2JELL 3TTSA 1KFAL 1PZ3A 4GRLA 4MA8H 1P7QA 3OKMB 1DYZA 4NQDA 1T5WA 4OAWB 4Y4KD 3F7PC 3M1OA 5BS0E 3RVTC 3R1GL 4UUJA 2VDNH 2OXHB 2UV3A 3TPUA 9PCYA 2AXJA 4PRPD 4LKCB 4X6CE 4ZQKB 4FJ6A 2ZP0T 1XXDC 2UYLA 2WW8A 3RWJA 2DQTH 5CKAA 1W2KT 4L1BA 1S7RA 3A4DA 3CFEA 4IKNA 5ERWB 3OKEB 2NUTA 4EVNA 3QCTH 5DFVC 3L3IA 4LKXA 2NXYC 3CQFA 1F3JB 3QEUA 4Q14A 4X7SL 3T3MB 4HJJL 1D9KA 2MHAA 1LO0L 4Q52A 4MZ3A 2Y1AA 2R2BA 1MCHA 2P8LB 3RGVD 1BHGA 1MXDA 4JN2B 1HSAB 2X7LA 1OY3B 3PWNA 4TPRH 4KK5C 3QDGD 3L95B 4IHOB 2CJ3A 4F7PA 4BUHA 1H3TA 4WVRA 4P07A 2Q7NA 3ZR5A 2XA8H 2X4NB 2HVJB 1CK0H 4IYKA 2DMCA 3VRLE 1O9ZA 3Q06A 1NWPA 3HNTH 1N0XL 4P3CL 3VXUD 1SHSA 4GKZB 4X0KA 3QO1A 4N8CL 4JDTH 3QIWD 1YZZA 4WHCA 1G6RA 2FIKA 5TE4H 5ANME 1BD2A 4HHAB 1N5YH 2Z35B 5CINL 2A9NH 3QIUC 1CF8H 2P80D 2VMCA 5DMJB 1NIEA 3MLZH 4UZSA 5ISZD 1TU2A 1MNUL 2R1WA 3KPOB 4FQLH 3UZVA 4Y1AB 2DWDB 2IH3A 5D9SA 4DIXA 1YO4A 3CN4A 1HL4A 1V7NL 2CO7A 2L04A 4WFGD 1IM9D 4DGUA 3D39B 3V7AE 2HLFD 4AQAA