2ODHA

Restriction endonuclease bcni in the absence of dna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
238
structure length
233
Chain Sequence
MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENNITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNLSKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMDLCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords R.BcnI
publication title Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA.
pubmed doi rcsb
source organism Brevibacillus centrosporus
total genus 57
structure length 233
sequence length 238
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2odhA02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2odhA01
2OAAA 2ODHA 3IMBA 2ODIA 2OA9A 2Q10A
chains in the Genus database with same CATH superfamily
1L9PA 2IGLA 3QH3B 4BFIA 1UZ6F 3QXAA 2LTQC 2QKIC 4I9WE 1JYWA 4PB9H 4OU3A 4XBPB 2OZ4H 1EHNA 4K3JH 4TQEH 3VD4A 4J3OD 1I53A 1HQRA 5GRUL 4LXFA 3TESA 3QJTB 5HY9A 4DVBA 4FG2A 4F37F 1IE4A 1O6SB 1HNYA 2CZNA 3CSTA 2BP5M 2B77A 4JG1H 4Y9EA 2QPEB 3VFGL 1Z9PA 1A65A 3NZUA 4F1ZA 4NQED 4K3GA 3NABH 2XWDA 2Y2WA 4Z9KB 3HR6A 3L4YA 5D7IF 3OWEA 1C8QA 2HJLB 3ZSTA 1JFQL 3LMJH 4WEMB 4X6CA 4ZQKA 3WIIH 5FYJD 1H8NA 1E4XH 3NT0A 4EDWH 1XZWA 3AAZA 2WUCL 5DJ8A 1Q1JL 1MCDA 2QQQA 3VFTB 1NLBH 3TF4A 2X6MA 3ZTJH 2H8PA 5JW5A 1N6QH 3LQAL 2DMCA 1CDBA 1GZHA 4RGND 3LQZB 4X9IA 2RHEA 4KRPB 4LF3A 4G59C 4NP4H 4Y5VA 3KYKH 4M6ML 4ZNEA 2X70A 3T4AA 5KVGH 3ZHKA 1WJ3A 4HUXB 1W2KT 2WKGA 1JRHH 1CXLA 2R8SH 2VM4A 3VG9B 3EFDL 2DDQH 5DURB 2NY4D 5KSUA 5CD5D 3MRRA 4WIQA 4Z0XB 2XVBA 1ITBB 5FM8A 1O5DT 4A6YH 2WXLA 3S3JA 2PO6C 1AQKL 1AVAA 1A3RH 1B0WA 2EO1A 5I15H 1HOCB 4NQDD 5D7LD 4N5UA 1C5CH 1SVZA 2WXGA 4PREB 1BVKA 1UB6B 3ALPA 4TUKL 3OKDA 2EEXA 1WHPA 1UJ3A 2MTPA 3Q1EA 4NRZA 1BP3B 3Q2WA 1G4MA 3DX6A 4KK9C 2AABL 3IFOA 3IGAA 1WF5A 1EAPB 4IEFA 3QXDB 3P54A 3QUML 3C87A 5G4OA 1TKWB 1MCLA 1BMZA 5DMKA 4KC3B 5MEQA 1U30A 4HUNB 1S9WB 5B8CA 1LEIA 2OMWB 1A6TB 1HJCA 2P8LA 4DP1X 1P69B 3CG8A 2JIXA 4NCC2 4XHJC 2VH5L 1G5AA 4KAQL 4XMWA 3VFSA 3WFCL 1H3GA 3WIFA 4HMEA 4R26H 35C8L 1QW8A 4JFVA 4G3YH 4N20A 3OPUA 3GBML 4LCYB 4AYBA 4OZFG 5IR1A 4U1IB 5GZOD 4YSSA 1FFNA 1D9KC 3QCTL 2Q10A 4FEIA 4FQ2L 4Z7UE 3LSOA 1HKFA 1RLBA 1ZOXA 2VDPL 2OR7A 3PQYD 4AJYV 4U2YA 3X1NA 2ZXEB 1RJLB 4OZGE 4PCKA 4IS6A 4KTDH 1KPUA 5ICXA 1BXUA 4P9HL 4X50A 1DYZA 3UXFA 1N64H 2ZKXA 1D6VH 2FD6H 1JV5A 4WWNA 1FVDA 1HT6A 1JK8A 2BSSA 2EIDA 2YUXA 3ML8A 4XTRC 4W9LC 4GJTB 3Q06A 5IHWA 2ILLA 2QSVA 2AS5M 2J20A 1UFUA 2E6QA 4P2RB 4RZCA 2XG5B 5D1QE 2R0WL 3MLVL 4PR5B 1EK3A 3HZMA 1UVQB 4IKIA 3DMMC 2ZG2A 2NXZB 3C8KB 2G5BA 3GTVA 4UOW1 4W9DC 4MNGA 2LQRA 3FQYA 2CGZA 1XGPA 4X6FA 2ZOKA 1PX4A 1IC0A 3FT2B 4HLZH 3ZE1B 5I6NA 4GPVA 1XBRA 4AJWA 3HHMA 2AAVA 1CFMA 3NPZB 3HMXA 1LP9F 4HW6A 4NKMA 1ZD6A 3IPFA 1IGIL 1FNAA 3SZKC 1T5XA 1KBGL 4JRWA 3IGKA 3GHBH 4TVUA 5AYQA 1U2CA 2EICA 2YXFA 4KO9A 4GRWE 4G8GD 5IMKA 3GJFA 3U7WL 4DN4L 2CJ3A 2XWBB 4DP2X 3GGWB 4AQAA 2YD2A 4CKVX 1DDHB 2D7NA 4UNTA 2RD0A 4I8DA 1OY3B 2HFFA 4U49A 3S3BB 5T5FA 1FL6A 4AENB 4Z1PA 1WCQA 5E1AB 4NQEA 4KNSA 1FL5A 5I6KA 1G9MH 4DOHE 4JKNA 5TF0A 3UBXG 3BKML 5C09B 1J9TA 1A1OA 2Y6SC 5AOLA 1M9SA 3H42L 5DJCB 1CUOA 3H9HA 4QRSB 2OCCB 3BHBA 4X8CA 4E5XB 1VGKA 5D72H 1YUHA 3GI9L 4CW1B 4CMHB 1S8DB 4WFFE 1PVUA 3US9A 3CGTA 4QRRB 3RRQA 5I6LA 4NIYE 4PGBB 4ZX4A 3E6HB 1YECL 2VR4A 3V4PB 4ZUSA 3JBG7 4KHTL 5H35B 1F02I 5BOZG 5FYLD 1WWWX 3FT4A 1LDPL 2MNWA 2Y2TA 4M8VA 4WFHD 4ES9A 4FXGB 1DSFL 1RZJL 4P3WA 5EN2A 1I9RL 3O6LL 2G2RA 1JF1A 2JSFA 4LHUG 4Z7UA 1AQMA 1F4HA 1E7VA 4F8PA 1J1OH 2Y3NA 1BPVA 2EDKA 1T0OA 5H37A 1WBYB 2DIEA 2VABB 2N0KA 2A6IB 4CILA 5D5ME 2WWKT 1PNDA 3BN9C 2WYTA 3C5SA 5IJVB 3APMA 3QARA 5C0FB 4NQDA 5DC4B 1HWHB 1NM4A 1EEZB 3VI3E 4FNTA 2CJTA 2ZWYA 3IDIB 5IQNA 4BELD 1MI5D 5BXFB 2I24N 4BYHA 1F1DA 1ECYA 4YPGB 2R2EB 4LPTA 1MY7A 2D3JA 3SO5A 4MAYB 4RBPH 1YMHB 4I0PD 4UQ2A 1BREA 3FYIB 3GIZH 2QTVA 4M5ZL 4ZAKC 1GOGA 5I71C 2I9LA 4ZS6C 5LNEA 3K71B 1ZHLA 4BE5A 4B5ZA 1YEKH 3RGBA 3FOLB 2G0KA 4G42B 2A6KB 2H6PA 3NN8A 1G9MC 1I8IB 3SQOH 3U1PA 3CFNA 1JS4A 2J8UB 2XTJC 4PJFE 5AB2A 3GBEA 2CKBL 3B1TA 4A38A 2WVTA 1KCWA 4F1SA 3U46B 5D2LA 4NC1E 2GSGB 5B1JA 3BJ91 1TZGH 3CDYA 4KZEL 1TTBA 1UH4A 2NZIA 1FO0H 5J6HB 1T6BX 4N0CD 2QZ5A 1HIMH 2ZWSA 1VJSA 4JY6A 4NUJB 5D7SH 4HJJL 3TT3H 1TQSA 4FFZL 1PZ5A 3PE9A 3DOIA 4L23A 3QIBB 3PFQA 3SKNA 1N0XL 3MLTB 1I8KA 4U1JB 5BVJB 3ZK0A 1MXGA 2LTQB 1MCSA 2QKIB 4KJWC 1CDJA 1DL7L 4YX2L 3WTSA 4I5BA 1XD1A 4PEEA 3QULB 5C0ND 2W8CA 3RB7A 1EX0A 3K0WA 4B9ZA 5GS1A 5L2KD 3FMGL 2Z7UA 2B9BA 2PCFA 5B3JE 4I0KA 3CX2A 1FI8C 2OTWA 4QTIL 3N43F 3OZ9L 5KJ4A 3LN4A 5EIIA 3L3KA 3FO9A 4Y4KB 4FLSA 4LCWB 1HL8A 4KXZI 2XA3A 3L3IA 3EUDA 2OS7A 4HIQA 1UOLA 1J8KA 2PCXA 3N2JA 5I1HH 3IETB 4D8OA 5CMAA 2AAAA 4Z6AT 3KLAB 4ZUVA 2ZX5A 2HAZA 1H6UA 1ZHBA 5D5MA 4XN7A 5IB5B 1OCZB 2PR9A 3S3DB 2HB0A 4X4MA 3S35L 2W65B 4DAGH 2H7WA 3P11H 3EGXB 1UM5H 2ZOTA 4K5LA 1TYEB 5ISZE 4G8GA 4WY7H 1KEGH 1MVFA 3N5AA 3H3PL 3HNTH 1ZJBA 3GUFA 4NNPH 5BZWA 3ZOAA 3W39B 5AW4B 1MRCL 1U0QA 3BAXA 3ORJA 3QORD 4NN7C 3QJHB 4POUB 4D7PA 2ZUUA 4KVPA 4JE4B 1ROWA 4O2EA 2Q76B 2AV7B 2W9LA 3FB5A 2K8QA 3GXPA 1RURH 3S4SA 4Q9RH 4YSDA 1S7TB 2NSXA 4E9VA 2ZSWB 4PRPE 4BKLA 1NFDF 3JTTB 2PO6B 1BQLL 4FTDA 3PG2A 1TQTA 2OR9H 1S5IH 2XKNB 2E7MA 1HEHC 4TS6A 1KTDA 5I6OA 2IPUG 1MWAA 2W0KA 4PJXB 5AAMA 1P7QB 4F7PB 2FWOB 3ZTNL 3MJGX 3N1QC 5F6HJ 5LCVL 3PHAA 4IHOA 2QJDA 3OAUH 1PFOA 4ZMXA 1I7TB 5DZOA 1T4WA 3Q43A 2WLHA 4GW1B 4LL4A 32C2B 2BVYA 5DS8B 4ZMWA 4WO0A 5JMRA 4MVBC 2OK0L 4MA7H 5T1MB 3ARGD 4NXKA 1MI5A 1WEJH 4PGDB 2FNWA 1IZJA 3X3FH 4U31A 1CDGA 5IB1A 4PGEB 5E0QA 2ITDA 1LEGB 3EJCA 2A0LD 3E6FA 4M7LT 1D9KB 1ZMYA 4P9MH 3KAAA 4KFZC 5IEKB 1AGBB 1KGUA 1NANH 5I24A 5CLZA 2BY3A 5JQ6H 5J57B 1OGTA 3L54A 5C2BL 1XAKA 2M8XA 3GB7A 4HCRL 2F54E 4MNHB 3SGEH 1KFAL 5KVDH 3B83A 4ODSL 4TSAH 4C58B 5I8OL 3B3BA 1BJ1H 4FYRA 4R6UA 4J1UB 4YIQB 2EDBA 1RHHA 4YDJA 3FT3B 2VN7A 3AU1A 3LD8C 4JGUA 3PWLB 1AQ8A 5FUZL 2E3VA 1V10A 1OB1B 4H4NA 3NCMA 1UYWH 3TIDB 3ZDXF 4A6YB 4XCNB 1FLRH 3GMRA 4NZ8A 1VFBA 4WU7B 5E6IA 4Z7OF 3RZCD 2JV6A 3H55A 3DMMB 3ZTEA 4OLVL 4AV4A 1F97A 4EZLA 3RI5K 3W11C 4AGLA 3L81A 4Y1AE 1M05B 4LIQE 4YNYB 3V4VB 4CGUB 1E9OB 1MAMH 3VFNA 4F2ME 2YD3A 2DIBA 4W70A 3WS3B 5AVQB 2CRMA 1W0VA 3GEWB 1KFGA 1V3KA 2IF7A 4P5TD 4HSAC 3LN9A 3LPFA 3V0JA 1MJ7H 1J1PH 5GHWL 5DEFA 5F9OL 3ZRCC 1AS6A 2YMOA 2E8ZA 3G5WA 1RUQL 1RIVH 4M7ZB 1VLXA 1DJXA 2M1KA 3MRQA 1YEGH 4I77L 4U0RB 5LB1A 5EIQA 4OVUA 4NHUA 1XCTB 3GXIA 2PWHA 1P7KB 5T3ZE 2C26A 3L3DB 5AAPA 1I3GH 1JTOA 1LHZA 2VXQH 3VFWA 1BYPA 4NUGL 2JJSC 2Y7QA 4BKSC 4IOFC 4NUPA 1BX2B 4DK3A 1VADA 3V2AR 1NCDH 4OF5A 1CK0H 2XWJB 4AQEA 3O41A 2FT7A 4JQXA 3SKUD 3ZGHA 5HYSG 4J23A 4MD0A 4ZFFB 2F68X 3TL5A 4UYPA 3T0BA 2H26B 4FCHA 4K8RH 3QORA 5SX4I 4QHLB 2AW2A 2HUEA 3DUSA 3HE7D 3KGUA 1Q1PA 1UZ8A 2DWXA 1XEUA 2EVIA 3LQMA 1MHCB 5ABAA 1U8IA 3SY6A 2XFGB 4XVJH 4PI0A 5D7JB 5I1EL 1DBJL 5AVVB 4RMRA 1KLFB 2ZUXA 3OHMB 4QJ5B 1P4IH 2GVYA 4MA3B 4GO9A 2ETWA 2F54A 7CGTA 3JT2A 1KV3A 3D3VB 1UH2A 1EDQA 1GC1L 4L5FL 3ESPA 4LEBA 2DYPB 3G5XB 3P3TA 4JFPA 4DCQA 4UIMB 2YPVH 3MLSL 4RIRA 4AEEA 4ONFL 5SX5H 3ULVL 1AKJD 1NMBL 4IKKA 4PD4J 2B0SH 2MCG1 5AYUH 1AD0A 4JRYE 3S98A 2B14A 1HWGB 5K9OB 1Q9WA 3TOPA 1WC7A 2HLAA 2VITB 3GC3A 1W0WA 1ZIBA 2D7QA 4FI8A 4RBPK 4Y1AA 5E00B 3KPRB 1HKLL 2ENQA 1E42A 2O5XL 4XB7A 4ZAKB 4Y4FB 3HZYA 5I71B 3WIHA 4HIJB 3ML9A 1KG0B 4H20L 4F2MA 3QUYC 2YUZA 3D34A 5F3FA 3GS4A 4L0ZA 1CL7H 4H5SA 3T0EE 5HI3D 3DSNA 4G80B 4QRTA 3MRPA 1NDMA 3U9PL 2ADFH 4V11A 2XTJB 2N56A 3QUXA 4B9PA 2QGEA 4GKNA 3NSFA 1DANT 1N7ML 4HU2A 3MRFB 4XAKD 4PJCE 3JTSA 2OMUA 4IHBA 4BZYA 1GIGL 3UTPE 2OFQA 4UOW0 2BCKB 5L9DL 2W1NA 1PY4A 4ZG1A 5JPNA 1G7MB 4PJHE 5C92A 2W0FB 4K7PH 5C9JA 4OD1H 3LIUA 4PW4A 3OMAB 5KTEH 4BFFA 5AZEL 2H5UA 3QDMD 4M5YH 1W0YT 2WXKA 4WUKL 1F56A 3LH8A 2LAGB 2LV4A 5KSAD 3OAYK 4LLVB 4RLDA 3UTTD 5CKAA 3MRGB 5IEHB 1MFAH 1AZUA 1E4KC 4B95C 4FAAB 5HYJD 5TDOA 2LLNA 1L0YA 4PJ8C 4K94C 4AZ8A 5G55A 1DR9A 1EJOH 3FFCB 4HS3B 1CLOH 3EYSL 3VM7A 4IBYA 1OL0A 1SQ2N 1N3NB 3V8OA 1OE3A 2QMKA 4OLUH 1NCWH 3JVFC 3K6SB 3ABMB 3L7EB 3QQ4A 4MB5A 4U6XB 4A2GA 1U8CB 3RZCA 3QIWD 3EJYD 3S37X 3LXCA 3RPIB 1WS8A 2HMIC 3ULUH 1K5WA 3RNKA 2HG5B 4X5PA 3FAXA 1E67A 1FZMB 3BFQG 1M53A 2AXJA 1KJVB 2GK2A 1TPXB 2W0LA 3L9RB 5I0YA 1E0OB 4H26A 3ILDA 1R4XA 4P5TA 2NZ9C 2RCSL 4CKQA 4GSQA 4FQJL 3D2UB 3WN6A 4I1RA 4DKFL 3I02B 4RAUB 2YMXH 2FT8A 4JRYA 5CNHA 4HKJA 4U3HA 5E8NB 2NDFA 1I9JL 2F5AH 1U8QB 3JUYA 4QT5A 4AQ1A 4JO4L 5JOEA 5LHDA 3KJ6H 3FBQA 4NN7B 4FMFA 3V0VA 5EU6D 1N8OE 5I1DA 3Q5OA 3BGFC 5I1AA 1I9IL 1KXVC 2Y07L 3BAKA 4KJYA 4X6BA 5LG1A 3GSUA 4YXKL 4GT7A 5FYKH 3Q6FB 3T0EA 2HN7A 3PJLA 4H8UA 2H6OA 3D0LB 1A14L 3C2AH 5ALCH 2R27A 3ALWA 1ZV2A 4ELMA 5IBLD 1K8DA 4G6MH 4JDTL 2X12A 2ZT9C 5DFVC 5GS0D 2UZYA 1NSNL 3H7LA 4HIIB 1UXSB 4FQCH 3MODH 5IMMB 3CBJB 3FCSA 4RMBA 5DK0B 5AZ2L 3HFFA 4N1CA 5AW6B 2IAMD 3MRNA 4QGTA 1PMYA 1U9KA 2EYRB 2O5YL 1V7MH 5E6ZA 1WICA 3QFJE 3PXJA 3LDBC 2VDKH 1EO5A 4AX3A 4U1NA 5IJCC 5EC1A 3ZMRA 3VRJA 1G9NC 3PHOB 5D4QA 2VDNL 2IANE 1YMMD 3VD5A 3FTWA 3L4UA 5GJSH 2ESVB 5KSBA 1ZPLA 1VKXA 4ZDHA 3CUPA 1HHHA 3T3MF 1DTUA 3JXAA 3ZUNC 3P4NA 2B59A 4UT7L 3HG5A 2MSPA 1T04A 4ZPVA 2VUYA 2LLGA 3QRBA 3VGDA 3N43B 3OMZA 4G43B 5DMGD 2WN2A 1E4WH 3B9AA 3EXJA 4WHCA 4KGLA 4FYSA 1QSFB 2LR4A 2HP4A 1TZAA 1KC5L 3W0WB 4A66A 2YR3A 2CUAA 1OTSD 4WKZA 2X2IA 4MCZA 1RL1A 1DLHB 4KVCL 4Q8BA 1E6OH 2R0KH 1NCAH 1SOKA 4UT9H 3UJTL 5C70A 3FU7A 4MJ4A 1J0YA 4Q6YA 5L6YL 3BPNC 1ZANH 3NIFF 4HF5L 4LLYB 1VEPA 4BK5A 1Q1JH 3ETBJ 5ACLA 4J5VA 1WAPA 3FCBA 2F7PA 1F6AB 1NEZG 1KDIA 3QJXA 4PVNA 5LKNA 4XB8A 2D0FA 1JGUH 2XKUA 4EUPA 1G0YR 4MMYA 1H6EA 5B3NA 2WIMA 3FT0A 3B6SA 2GC4C 2GSIA 4MJ6A 5K33A 3HMXL 5A7BA 4ZZFA 1MCIA 1AHMA 5CZVH 5KN5B 3B1UA 4LGPB 2VERN 1AD9A 2C3VA 2VR6A 1WDAA 4H40A 4NNXB 5T33H 3RX9A 3TYFB 3V0WL 1B4JL 3ZTCC 3MLZH 5EUOA 5CINH 2NY3C 4FABL 2GTZA 2DQJH 1IC7H 3KBHE 4NAJA 4JN1H 4XP4H 1J8SA 2CD0A 3ZHFA 2ODHA 2ZWZA 4TKWA 1I4FB 3UAJC 3ZDWA 3CSYB 4LB8A 3GSWA 1MRDH 4K5OA 3RWHB 5CLYA 5FW8A 1JPTL 3UTTA 4MQXD 5KSAA 2WLMA 4JO5A 1NFDB 4HJGB 5EOQL 5HYJA 2VN3A 5ITBH 1GPOH 5HDBE 1IO4C 3ARFD 3QUGA 1L7TL 1AZBA 1BM3L 4TNEA 1YNKL 1XF2A 4EN3C 3M1BB 1E40A 3L5HA 4Y5YC 4RMSA 3VWKC 3VXNB 2C3XA 3QFJA 2MCMA 2CIIB 3B2XA 5ID0B 3V9FA 1EZVY 3SPJA 2IANA 4UTBL 3UP6A 1RY7B 3MOQA 4GQPH 4HC1A 1R34A 1I82A 4JLRA 4TNGA 5FB8A 1A6ZB 1J5DA 4R2GC 4AQOA 4ADGA 1J9SA 1YQVH 1IC4H 2PP7A 3RWDA 4QHMA 3VU1A 2BXZA 3KLHC 1J8HD 3N41F 4ZFGL 2KBGA 3RVTD 2VQ1B 3EJZC 3K5RA 5ICYB 1E5ZA 1PQZA 1CYXA 1ZPUA 4GUQA 3WFHA 2ED8A 2W9EL 2IWFA 3CMOL 3ASWA 1G0DA 2UWEF 3FSOA 3G6AB 5D9SB 5I8CA 3A23A 5JLZA 3NIGF 4OUUA 1FZJB 4NWTL 5I1LA 1QOKA 3B2DC 3LQAC 5C0DA 1OHZA 4XOAA 1XH3B 3BSZH 1QTPA 3DX7A 2E0PA 4D0DB 2EYTB 1SY6H 3FRPB 4CAGA 2OSLB 4TQ8A 1X44A 1OTTD 2IH9A 2QR0B 1MCJA 4U6YA 2XPGA 4F7TA 2A1WH 2Q8BL 4AGPA 4XNMB 5EORH 2CO2A 1QSED 4HAKA 5I17B 4E5XG 4L0YA 2A74C 4PTTA 1PZCA 1Y18B 4LHUD 1E27A 2BP0A 3D7PA 3JWNC 4Q9QL 3A22A 2XZAH 1ZLSH 4DPBX 3E3QC 2IAMA 1MDAA 2KDGA 1OAJA 4OCSH 3ZDXB 5SX5K 4G6JH 4B6ZA 4O51B 2WK2A 3WKPA 4L3ED 1DEEA 2FJGA 4UM8A 1IKFL 4N2CA 4OCWH 1RUPH 2BSRB 5GSRA 3RNQA 1YMMA 3EO1A 3RKDD 2X3CA 4I2XE 4JL1A 4KV5E 1N2RB 2NNAB 3QUYB 5AD0A 4GFTB 4ZX3A 3UJJL 3BUDA 2V2WB 5IHBA 2AK4D 3GEFA 1A5FH 3BLBA 3BPCB 3ZQ9A 1IX2A 5L2JB 3O6KH 1OZUA 4G5AA 4DN4H 1T5KA 4OFQA 2NUPB 3CFEB 3VRIB 1NCBH 1ZLDA 2LVEA 1AO7D 3MXVH 3EO9H 2EIJB 1SBSL 4PIRF 3IFLH 3Q9QA 4TNFA 2P52A 1FFPB 1OW0A 5JZ7C 1X5MA 3BKMH 1RULH 3E8UL 3KS0H 3GSVB 2H0EA 4B9CA 1TJHH 1HSBB 3BWUF 3BWZA 3VWJD 4E0RB 2I9TB 5DD3L 3L2LA 3KLSA 4OZFA 2OJZH 4BZ1H 2WQ8A 1NM9A 4PJAB 1HZHL 5MI0C 5CGYC 3WKYA 4P9HC 1UXLA 1UKSA 3EYVB 2J72A 4C83B 5HYIA 3O6LH 2V5MA 5A6MA 3FCUB 1QRNB 4FXLA 3TWCH 4ETYA 4H44C 4Z7WA 4ODVL 1TJGH 4RRPG 5K59F 3IJSB 5KZCD 1K72A 4D9QE 5BRZB 1U93A 3U36A 4FG6C 4Q0XH 1OAKL 1RQ5A 1H8SA 1U6AL 1VAHA 2VLME 3LIZH 2BNRD 4RESB 1YDPB 4RWHA 4YBQC 1WT5C 2B4CL 4ZRGA 5MEOA 1CC3A 1YO4A 3ZKXC 3GMMB 3APCA 5H4ZA 3HW7A 1ND0B 4F2FA 2OMZA 1VZGA 1JUFA 4BSWB 2C1OA 3ARFA 4QXUL 1OAYH 5IUSA 1PFCA 3MJ9L 5HPMA 2XWZA 3ZTNH 2IO5A 1UA3A 2IBZY 2P8MB 3FAWA 5KYNA 4DUVA 2Z7ZA 1F90H 4DKEL 1G1YA 1DQJA 1E5UI 3KWWB 1IEAB 1TR7A 1DJGA 3UTZA 2P45B 4BJLA 2NDGA 2V7HB 1OP3H 4CSSA 4M5ZH 4HIHB 4R3SB 3VXRB 4YZWA 5FLUA 2FEDC 3S9DB 3RL2A 5BJTA 1MCOL 3BGFB 3L1OL 5I18H 2FGWL 3O6MH 1DQDL 1MWAL 2K8MA 1JTTA 1YUKB 2ZUYA 4HUMB 1QA9B 3O9WC 5JO5A 5FGSA 5TD4A 4J3WA 1J8HA 2FSEA 5C86A 4WV1A 1PD6A 4HEPG 4JHUA 5F96L 4AEHH 2E59A 5LXVA 4ZTOL 1XSOA 5MERB 4E36A 5DFTA 4HWZB 1LO3L 2C7UA 1D5BA 2GI7A 4OLXL 3VE0B 4TLKA 1JAEA 3O3UN 4JFED 4JDEB 5TDNB 4YDKL 1EHLH 3LDBB 4N0UB 4DGYH 4F9LA 3BWUC 1D7BA 1RZJC 4KWUA 2R9HD 4PWEA 1XGUB 1OAXL 3VGEA 2OMXA 3VXTA 4D0BA 1QYGL 2BNRE 4XAWH 2XETA 2BVQB 1AI1L 5EULV 4GMSH 1KGCD 5F97E 4D2NA 3MV11 3CC5A 4AMKL 5I19L 4LHUA 2GBAA 1GW0A 1EO8L 4M7KH 3GK8H 4PTUB 1I1YA 2IADA 3OZ9H 3MV9B 3UBXI 5DHMC 5GGTA 3MFGB 4CSZA 1NBYB 1G7QB 2Q7AA 1CFQB 3LKRB 4LKCB 4R7NB 5AAWC 1ZWIB 3B43A 3DLQR 1J05A 1YN7A 4S1QL 4PG9A 4F33A 1DLFL 3BCDA 3LB6C 3OB0H 1DUYB 2VLLA 1UEYA 3QIUC 4X6DB 3HCVA 3STZA 3DV6B 4B96A 3KW7A 2B08A 4HWUA 4M1CD 4S2SB 5BO0D 3BPNB 3IKCA 6FABL 2MNUA 1TXKA 5EN3A 5BV7L 3TFKD 3P0YH 4W9ZA 3ETBF 2WGXA 15C8L 3GF8A 3KPQA 1FSKC 4FI7A 5TE4H 4LSUH 4M5TA 1TOXA 2UXTA 2DTSA 1CGTA 1EVUA 2H2SC 2BZCA 4P2OD 3BLKA 3Q9PA 2OYMA 3FB8A 3PGDB 4FJYA 4GG6E 4OFKA 4DK5A 3EDDA 5CUSL 5FECB 5ICZB 1MRCH 1PY9A 3MRJB 4GKLA 5IGXL 4Y2OA 5LAXA 4ETQB 3T4YB 1L9QA 1LO5B 1YRKA 4ZZKA 2NY3B 4WI2A 3P73A 2VJ0A 4MX7A 4JK0D 4P57A 5F7EH 3ZN6A 4HJIA 1S2EA 1RIHH 3VWJA 3ZTJG 3ZRSA 4HULB 1H8OA 2VDKB 2A38A 4YBLC 5E7BA 3U79A 1YEHH 4ZPTA 3P4OB 2QDVA 5H2BA 4GG8A 3VA2C 2Y0SA 1JPFA 3RDTC 5LQBH 5DD6A 2NX5B 4N0YL 4B0MM 4EN3B 1N6UA 2XVGA 5G5DA 5BW7C 8FABB 1O9ZA 3NCYS 4Y5YB 3VWKB 3L3JB 1RMFL 3SYCA 3Q05A 3QNXB 3RZWA 2DBLH 3HPJA 4MS8C 4B9YA 3INUH 3RWJB 3KYNA 3F12A 2BIIA 3WFEH 3DHMA 4PRAA 4WWKC 1G6RL 2QV4A 2EO7A 4TF4A 4UNUA 4QRPE 1TEYA 5L0QC 5DHVB 5MHSD 3MJ8A 1GZQB 2K6WA 4FQIH 4JFDE 4AUYA 2BNRA 1F41A 3T3MB 1ORQB 3OXSA 5EEWA 3II3A 5AUMB 4ZXBD 4XBEL 5IM7A 1FC2D 4CN1A 3TBVA 5J8OA 3QJOA 3OJVC 3LS4L 1KIPB 3SKJL 3GLZA 4Q6KA 1TETL 4M1DL 4ZW8A 1YEWA 2EEDA 3SY0B 4ONGH 1F1GA 1DANU 2VZ1A 3AQYA 1QI5A 2KT6A 3PAVA 2X38A 3MMEB 3FQ1A 3QHTC 1CFBA 5JHLH 2IPKA 2ERJC 4JVWA 2EVHA 4AI7A 4JKPH 1P84K 4F7KA 3D0VB 4FE9A 2W38A 3KXFD 1AGFB 4DW2L 2WINA 1CT8A 4JR9H 3NIFB 2Q0ZX 1MCRA 3SDAC 2G9KA 4WFGD 1FV1B 2QHRL 4J4PC 2YXMA 3WJMA 4LIQL 4Z78B 3ZDYF 3ETTA 5LBSH 2A9AA 3ZXAC 2Y1VA 4AT6A 2A74B 4GG6A 5DC9B 1TJIH 2FX9H 2Z91A 4PJBE 4Y0GA 3UGUA 3G08B 4URKA 5HD8D 2GCYB 4KRLB 2CK0L 3IDNA 3FCTB 1FAKT 5K1JA 2IQAA 2WWOA 1HHIB 5IMOB 1M7IA 4OZHF 2EE6A 4OLWL 2JJTA 5F71A 1URIA 5F8QC 5HVFB 1MJUL 5CM1A 1MCKA 1ZT1A 4HPYL 2Q2LA 2OCJA 4PJ9A 5DTFB 3RTQC 2WLLA 3TCLB 4HQQL 5DHYA 3QUMB 3UTSB 4K7FB 2HKAA 2K3TA 4KZ0A 5C07E 3OF6D 1GHFL 5F9DC 4HMDA 1YPZF 3ILEA 5AW2B 4D8PA 3ARBD 4OJFH 2Q87A 1X3DA 4LKXB 1IM9B 5H4YA 3NA9H 2DLTA 1NLDL 3U0WL 4EVNB 4PUBL 3M46A 4HLZG 3FHEA 3W81A 4FFVD 1GL4B 3L17A 4QEGA 4Y2LA 1DCLA 4R7DA 2X0UA 4QRPA 4P49A 5CXPA 1MRFL 3TX4A 3ZQXA 1XMEB 4JFDA 4RFOH 1QWHA 3VI4F 1JBJA 3BP7B 5FFOA 4BQ6A 1OK0A 4ZMQA 1L9MA 2X4TB 5C97A 1N0LA 3PWVB 2ZUSA 4LZKA 3SE3A 2AJ3B 4UQIM 5DU7A 4PJDB 3QUZD 1J88A 1XGYH 1R3KA 2N59A 3N41B 2VDPB 3BP4A 4NLHA 3FN9A 3IJ7A 3IU3B 4YXHH 4XCYA 4P2OA 1A7RH 3DOHA 4NJAL 1Z9SB 1KYFA 1AZVA 3V4UL 2JB6B 4ZSOB 2NY5L 2X28A 2FHCA 2UWEB 2VR9A 1PYWB 4LCCC 1T21B 3NIGB 3T6WA 1WH0A 2AEPL 4K5NA 2DQCH 2D03L 5DR5L 4EIBA 1JZ5A 1FE8L 1GS7A 4P5KB 3ZPDA 3P0GB 1QW9A 3DSFL 1JXGA 2X9YA 4E9LA 4MXWL 2AV1A 5HJBA 5KYUB 4KBPA 3UZQA 3MV01 3BMWA 4IRJB 1IGFH 4EI6A 2FJUB 3TBWA 5MENE 3GHEH 3NK3A 3ZKXB 1BBJA 2QQNL 3DVGA 1IMHC 4E41D 2JTYA 1XIWA 4PJBA 3ZT5A 1A66A 1LO0L 4Z76B 2DWEB 3O2VH 4ZFZB 4NI6A 3A24A 2FATL 1NMBH 1IAII 2XY2A 5AVSB 3U82B 2NYZA 3H7BA 4RMWA 1ZSDA 3CX5J 1C5BL 1A0QL 2ZUQC 1XF5B 3BZFA 3PAYA 1H0DA 4RDBA 2GJZB 4WTZG 3MBXL 3NDZE 1JN6A 2EXYC 4YZFE 4LQFH 1JWMB 2XXCB 2LFEA 3AS3A 4Q14A 1AXTL 1E9PB 4LESA 3TT1H 1A3LL 1H3TA 1UACH 3O9WB 4YHKH 3QR1A 1QUPA 1E8ZA 2RA1A 2YEZB 4UILL 2D8KA 2FX8H 3QA3A 2HJFA 1T6VN 4HXBH 4NO2B 2NYKA 1ED3B 1XMWA 3HG1B 3L5WA 1UUNA 5EC2A 5LUMA 5ID1B 3K1DA 5EU4A 3P69A 4XVUC 4G9FE 4JPVL 4PW3A 3UAEA 3PAUA 3HHRB 5DYOB 5EBWA 3TV3L 2WQUA 3OJDB 1GYAA 1JHTA 4I48A 3T2NL 3UC0L 4YH6A 2EJ1A 5CILH 3S36X 3O6FD 4PJIE 4WJG3 1AQHA 4LCIL 4HLJA 5F1SA 2V9RA 3CMGA 1VFAA 1OF2B 1V7NL 4GB9A 5HYSA 1KB5A 2QSCH 4KK8C 4N86A 5IG7B 5CU9A 4KQ4H 1DUZA 1WZLA 1R3IL 3KPTA 1TQCC 3V5HB 1LL1A 3FN3A 4LSQL 3SKMB 3FULA 4NYLB 1RZIB 5F6IC 3WXVH 4O02H 2QT6A 1YNTA 1PZDA 2GJPA 4P5MB 2CXGA 5F88B 4BWUA 2HWZL 3EF4A 1BVLA 2N7AA 5L8LB 5LWYL 2XV2A 1I9EA 1DBAH 1GC1C 1LMKA 3C5ZD 2EXWC 2PWEA 1A47A 5E51A 2AXGA 1OSYA 4DP9X 3CVBA 3HOGA 4UINL 1F86A 1YJDH 3RGVC 1XCXA 2WOBA 3ULVC 1I7ZB 2F2HA 2LHAA 4XXDB 2HKFL 4TTDC 3QIUB 5ADOH 3I50L 5FPIA 4EDXA 1TZIB 3HLKA 1XZ0B 1FIEA 5MENA 1HE7A 1YYML 4ABQA 2OMYB 4U1KB 4NN5C 1LEKB 3OF6A 2NUTB 4XMTA 1SOXA 1FSKB 3MGAA 3QI9A 3ARBA 5JW4N 5IW1B 1ACYL 3MBEC 1G9EA 1BZEA 2H0JA 2P42B 3QJSB 5E9DD 4U3SB 2Q8AL 3VW3H 2K6YA 1BIIA 3UBHA 2R69A 2PXYD 3FQXB 3OZLA 1X5JA 2CKBB 2YOCA 1MAKA 3D4YA 3ATFA 5FO2A 1KCSH 1XR8A 3DDFA 3ZMNA 4AMXA 5CP7B 2AJZB 1UM4H 5C0RL 1Z3GH 2BNQE 2J12B 2ZIDA 1M6OB 2OMTB 4NZUH 2RR3A 4C56E 4DFHA 3G5ZB 3GBDA 1UT2A 3L6FA 2MIZA 2V9QA 3OSKA 3UYRH 4JS7A 4PY8J 3SODB 1FVCA 2WNKA 5C0EB 2MRYA 3QUZA 5IW6A 3DXAD 1HS6A 3IMRA 4HOXA 4HC1L 3OR6B 4YBLB 3MPCA 4TVPH 3GD1C 4XVOA 3F00A 2O61A 4ODXB 1A7QH 1T03H 1A4BA 2PPAA 2O26U 1OK8A 3NFNA 3RDTB 4BFBD 3MCKB 4P2QD 2IPTL 1SOQA 4YDLC 3CN0A 3VFRB 3AS0A 1JGEA 2NTFA 1H56A 1PJWA 4HGWA 2FB4L 3ET9F 1IGTB 4YAQB 5GRYA 5I1GH 3O0RL 5E8DH 5JOPD 5IQ9A 3HC4H 4WWKB 3CU7A 4CJ0A 3DIFA 4GW4A 5L0QB 1ZHKB 1NOLA 5DRXA 4LNVA 5D2NE 4ATWA 1PG7X 5FK9A 1WK0A 3MFFA 1GZHC 4DP7X 3SDYL 1EFXD 2A2QT 3VQMA 3MREA 4B0MB 5SWZD 2WXNA 1BM7A 4E41A 3SIKA 2APFA 1F8TL 4Y88A 3GINA 3QEQB 2PP8A 5EA0H 2UY7B 3CK0H 4KDTA 3T4AC 1N70A 1OPGH 1WVZA 2Z35A 3DO7B 4C57C 3ZKND 1ORSA 4LMQE 4PS4L 5IOKA 4MNQB 3MGOB 1ITCA 3GRWH 5MEPB 4GBXD 4X99B 1AACA 4L8CA 2MNJB 4EOWH 4EPSA 2BOCA 2Z9TA 4DUXA 3CZFA 3P30L 4WI9A 2D9QB 2VNCA 2GY7B 2DQ6A 5IFJA 2X6UA 2VQUA 1MHHB 2AQ3A 5J12C 2F1EA 3HVNA 1Y1DA 2DM2A 5D6CB 3DIVA 5E5LA 1GAFL 5PCYA 5KS9A 5E8PA 1DVUA 1UJ3C 2FUTA 3QWOA 4EMZA 1JXKA 4PI2A 3N9GH 4JFQB 2L7EA 1UTDA 1U8MA 3QWQB 4MYPA 3FTGA 3CVHH 1I31A 2YUVA 3F7YA 3PJSA 3C6SB 1JGVL 4J3OH 4UM9A 4KUZL 1S7QB 1JHLL 3ZYZA 5B8CC 3FQRA 3PWUB 2BSTA 5EO1A 5A7EA 1FWXA 1F3DH 1H9DA 2EYSA 1XGTA 2BNQA 1I8LC 3O6FA 1MXDA 4LSPL 4NM8H 4C56A 5T5FH 3PWPE 1FGVH 2HRGA 1WTLA 1T1ZB 1DEDA 1KCRL 4XP5L 3RTQB 3F6IA 1BF5A 4ZUWB 2DYSB 5SWSE 1T5WB 2AF2A 3I6GB 3FRPG 4KO6A 5FYJH 9CGTA 4Q4EA 2IEPA 4KKRA 5SWZE 5TH2A 4PLNC 1DBBL 3OPZL 2EQDA 3WLWC 2F53D 3BYYA 3VH8G 2CDEB 4Z7UF 4L18A 1UCTA 2WUBL 3C5ZA 3QPXH 4ORGB 5KYYA 2P5EB 2YK1H 4OZGF 4XNUH 5IVXA 2H1PH 4YXLL 3HKZA 4N0RA 4XX5A 5HGDA 5D2NA 1EHKB 1XSIA 3M17B 4JFTA 2AHIA 3VM5A 2XCMC 2Q6WA 2UXGA 2DQUH 4OH2A 2HRPH 2I60L 3G5VA 1INEH 3ARDD 1GZPB 5JXAH 3F5WA 4OZ4B 3CWGA 4JO8A 4YVNA 4P46D 5E9DA 3SQRA 3IJYB 1X5LA 3MRCA 2CHNA 2DRUA 3OKEA 1JGLH 4LCCB 1JPEA 3TNNB 5GPRA 1LWRA 2PXYA 4HX1A 1F18A 4XCEB 4JRXD 4AC2A 2IQ9H 3BVNA 4I3SH 4UAHA 1NEZA 1CE1L 3O81A 4GKSB 1NIDA 1F4YH 3AWEA 3B8YA 1S3KL 4E2OA 5C09E 4X0KA 4AH2B 1VEOA 2YUWA 4L2LA 4XWOC 3Q2VA 5E2JA 4GRWF 3ZL4H 1HI6B 2BMKA 3V5DA 5IZ7A 2MOQA 2VKXA 3ZU8A 4NZTH 5HDQL 3DXAA 1UASA 2FEEI 3ZDYB 1MNUH 4L4VB 2FYYB 3GSRA 1KXTA 1ONQA 3AXLB 4Z95H 3VFPA 1IAOA 3CDGB 2GIYA 4WDIA 3CFKA 3I6LE 2ZKWA 3HC0B 3RVXD 1LWHA 5DSCB 4FHJA 3CXHJ 4F37K 4EKXA 4LMQI 4XCCH 2F53E 4HISA 4WEBL 2BOLA 1AXSA 2WBXA 5FV1L 3L1EA 4DPAX 5F3HA 1I8MB 3VXUB 4OZHB 5FFLA 2IGTA 3PWPA 4W9HC 1SLUA 2CGRH 1JFHA 3U83A 3NJHA 4E9RA 3WG7B 5CJOL 2DWDA 1L6ZA 2VDOL 5SWSA 2YPLD 4YSEA 1XGQB 3U2IA 1ILSA 4UBDC 3IDGB 3U7YH 5SWZA 4MBOA 5DQ9B 1RSFA 1BGXH 4ISVB 3U6RA 4AKQA 3NZ8A 4OF7A 2JKNA 3DK0A 2RTTA 4FZEH 1MCHA 5C0AD 4FYTA 3MOAH 7PCYA 4OJYA 4FQHA 3ES6A 3H1ZA 1MPAL 3NFPA 1FIGH 3PS6A 2HTLC 1FZKA 1IAKB 5CP3H 2FO8A 5CBAA 1R5IB 5D5MF 4WI7A 2OMVA 3NH7H 5AVXB 3VI4B 2HPOA 5DRNA 1P2CB 4N87A 4XBMA 3D39D 5IVOA 3HC3L 3VI3F 4R4ND 4M9OA 4Z3TA 5CN2A 4Z7VA 1RVFL 4YO0A 1FRGH 2AQ2A 1TQCB 1C08B 4UOJA 2OQJA 3GIVB 1GGBL 1RK1B 5F6IB 3CN2A 4XN9A 2WV3A 2X4OA 2X42A 4RZKA 4K9EL 3IBEA 2ZP0T 12E8H 4LARL 3ZZSA 4JNXA 1X7TA 1P4LB 2MFNA 2X44D 3QJRB 4MD4A 1DDTA 2XTSA 4ANUA 3RGVB 2Q3XA 1INDH 2ZXQA 3DNKA 4TULL 1MFDH 4BUGA 4E42B 1IL1B 2ARJB 1YEFL 1NWOA 3ARED 4PJFF 3UTOA 4NKOA 4U6HB 1UC6A 3NCJH 1FORL 1GS8A 1EJ6A 1M1XB 4KO5A 2GTWB 5AFAA 3TS8A 5DVMA 1DQKA 1S7XB 4HPOL 1JL8A 4NN5B 4TQPA 5DWPA 1T20B 3MLWL 3OKLB 3CFCL 4FNRA 2IALB 3CCHB 5ECGA 2F53A 3DK2A 1CZ8H 3MBEB 4L3CB 2H32A 3RX8A 4OJEH 5K1NA 1KBBA 1KJMA 3DJZA 4AL8H 3MYJB 5E7FA 1N5YL 1M71A 3HNVH 4NRXA 2GK0A 3HG2A 3GRBA 4A7SA 4BFIB 3QXAB 5FYLH 1XD0A 3SCMA 4TOYH 3BSGA 3NEEA 1JNJA 4XO4A 1F58H 2RJMA 3H8NA 3M45A 3TPUA 1LO4L 2OKMA 4WI4A 1XB8A 4N28A 2JNZA 2YZ1A 5GS1C 4AM0A 1HQRB 4QXVA 3CD4A 3KPSD 5HY9B 4DVBB 3BDYL 3VXME 2FSDA 5B3JF 3OKNA 1NFKA 1KCBA 3ARDA 4LSSL 5ESVA 2AQSA 4G9DA 5F96H 1KN4H 2J1KA 1TVHA 1B90A 1QUNA 1P6AB 4P5RA 1QATA 2CBMA 3IS0X 2O6FA 2WWNA 1IM3A 2JI3A 3LNEA 4EZJA 4OLYH 4ZQKB 4YDLB 4JRXA 2G9HA 1AQDA 1WBXA 3WY3A 3SPCA 1NGWA 1WBZA 1DBML 2OYPA 3AAZB 1AC0A 2VXVL 5DJ8B 1NGQL 1DQML 2DI7A 4KJQC 4X7FC 1HE8A 2WJ7A 5F93C 1TFHA 2H8PB 5FGRA 5JW5B 2EDOA 5HHPA 3KBPA 4KYWA 3VGBA 3V7AG 4FNPA 5F89A 2CM5A 2J43A 3QS2A 1V5JA 1I1AD 4LF3B 1JPSL 4RRPA 5EZIL 4AEFA 4Y5VB 2B4CC 1W8EA 3LZOA 3NYKA 3IGFA 1W16A 2X70B 4FNLH 3T4AB 1OLLA 1HINL 1UWGL 5KUKA 4Q6IA 1LMIA 4F93B 3BKJL 3IJEA 4JB9H 4NCDA 1IBGL 1J9QA 3QYNA 3DO4A 1BQ5A 2QVTA 5DQDH 3MRRB 1NAKL 4N5ED 4F5CE 4C47A 5J12B 4NC1C 2FWUA 2YPLA 4PVMA 2A9NH 1KLGA 3AWGA 1BVKB 4PJ5D 3OKDB 1UJ3B 4NRZB 5EHFA 4HUUA 4KMTL 3DX6B 3LPGA 2VOTA 3IGAB 3GI8L 4KK5D 1JI2A 3A3YB 3K2UH 3LKNA 4IEFB 3K7UA 5AAMC 4A2MA 3OX8B 2X09A 1QX1A 1HAUA 4DTGL 1U8JA 2EDRA 5DMKB 5MEQB 1C9SA 1LEIB 3PIQA 5B8CB 3UTQA 4GAFB 4OCRH 4WO4D 2P8LB 2JIXB 5E6RB 3VFSB 1PSKL 3D39A 4HEPA 3VXMA 4NKIH 5EPMA 3WIFB 1EEYA 1CXIA 4D9LH 3E1F1 5KVGE 4G6KL 2VDNB 3ZKMC 5IR1B 3JV6A 2R1YA 3TBSA 1T0NA 3ENEA 4N0YH 3AY4A 1FFNB 4M56A 2XRAH 5EWIL 5J1AA 4A55A 3VB9A 3LEVH 1CGWA 3LSOB 3RFZA 1TITA 3VVVA 3SGDI 4IS6B 3TJHD 1KPUB 5ICXB 2CR0A 3P2TA 1MAJA 1M7UA 1MFCH 4X9BA 3BRFA 1IAIL 2ZE0A 2I25N 3UABA 1JV5B 4PP1D 1FVDB 2Y25A 3NOIA 1JK8B 2BSSB 2NQ3A 4Y2DA 2J7LA 1VESA 3BUIA 5HHXH 1BFOA 4RZCB 4G8IA 4BKTC 1M3IA 4DP5X 2DQTL 5E6IC 1W80A 3HZMB 3D1MC 5BV7C 1OWRM 2XZQL 2OZ4A 1NIFA 1B6UA 2G5BB 2YZ8A 5I5MA 4MNGB 1ETZB 5J1TC 1MIEH 4OI9A 1XGPB 3HI1A 4X6FB 2ZOKB 1Q94A 5FA4A 1V54B 2CLRA 4ESKA 3VDBA 4WNQA 4HJEA 3C8HA 4AQ8C 1A6UL 2UZIL 5BMFL 4O9HL 4NKMB 4YQXL 1IU1A 3S5LG 1T5XB 3EKCA 3VG0L 4IRSD 2IWGA 1FF5A 3BUBA 4JFZH 4AJ0A 1IQDA 2Z3FA 2FBRA 5IMKB 1JHKL 3GJFB 3MVSA 1PS3A 2B1HL 2HKHH 1QEWA 2ICES 5AVTB 6TAAA 4AQAB 1QZ1A 3SGKA 2Q2EB 1MHPH 4R0LA 3GSQA 4OBSA 3WIHH 3MRLA 2HFFB 5I73C 2KQNA 1FL6B 1ODUA 3BKCL 1CO1A 2OL3H 4NQEB 3U1SL 2W88A 1FL5B 2MEJB 4QHKI 3IPBA 2O5ZH 1A1OB 1BCIA 4G82A 2BFVH 3VJ6A 1GCYA 2XT1B 1B4TA 2QADC 3BHBB 3H9HB 3IFNL 4WW2A 1VGKB 2M26A 1YUHB 3PDOA 4XP6H 1S5HA 1C5DA 3RVWD 1OANA 2D3VA 1MJUH 4JFFD 4YUEH 4FEMA 4OTXH 2CMRL 4ZUSB 1AZCA 3BX7C 1G7JA 2X40A 3FT4B 4JQXC 4EQ3A 1LILA 1GHFH 1LTXA 1I1AA 5I1IH 1TQBC 3BXNB 1E4XI 5EN2B 3TN0A 4BDVA 3ZW3A 4JY4B 3CZLA 2G2RB 2Y6TE 2DN7A 1JF1B 2QPSA 1BJMA 3QORC 5IMLA 2O1AA 4Z7UB 1NFAA 4M03A 2H1XA 3LTVA 1KB5L 3KPPA 2ATPA 4OGXL 5CCKH 2XWTA 2R0LL 4PBDA 4HUVA 5AKTA 4DN3H 5T5NF 2OP4L 2IH1A 3AW5A 4UU9A 2QQKH 1VA9A 2RAMA 4KPHL 3VACA 3C5SB 1J5OL 4APQC 2Y5EA 3IE9A 4N68A 2YFOA 2VDLL 3E38A 4NQDB 4OGAD 3R7RA 4PRHE 3T8XA 2E7LA 1RV6X 4TV3A 2LE9A 4DP6X 2CRIA 4AYMC 3PABA 1JRHI 3N40P 4PHXA 5J5EA 4E9TA 4ODHL 1NI0A 2XTJE 3OAZH 3R4DA 2DWSA 3O2WH 4UQ2B 4ODUA 2VLJD 1UWXH 4XC3H 3RUGA 3WENA 2I9LB 5AYTA 1ZHLB 2WWKO 4QYOA 2AVGA 4PMEA 4MJ5A 3SQBA 1NAML 2NR6C 3F7RA 5L88H 3MV8D 3NN8B 1PD1A 1B88A 2Y22A 2FRGP 3BC9A 4GRWB 4HH8A 4JPKH 2X05A 3QUXC 3F04A 4ZO8A 5D2LB 4D3CH 2ORBH 3JVGC 4PJCF 4L3AA 1DVFD 5A3IC 1Z3RA 1QNZH 3T6XA 3HKFA 5JPNC 4JY6B 4PJHF 2A0LC 3VGFA 1P5VA 1HH9A 2WWMC 1P7BA 1PZ5B 5I6MA 3P9MA 5AB9A 3K8LA 2ED9A 4P4RA 1KCUL 3SKNB 4C54A 4RFEA 1I8KB 3AXIA 4QAWA 4IU2A 5HDLA 3UJIL 4I5BB 1NJ9A 4JAMA 1QFWH 3WSQH 5IESH 1MFMA 1CF8H 5GS1B 4ZMZA 3QDJE 1R17A 1A3LH 2JKXA 2PCFB 5GRJL 1N12A 1OSPL 2OTWB 1FP5A 5HGGS 1OVZA 3FU9A 3LN4B 2QQLL 3L3KB 5EIIB 4JFXA 3FO9B 3VDCA 1ZE3H 1QSZA 2Z1PA 3L3IB 4IIQA 3C5XA 4K23H 3C2SA 1I3VA 5CMAB 5F7AA 4JZOA 3TV3H 3F8UB 4ZUVB 3D6GA 4B3VA 4ENZA 1ZHBB 4JPSA 5D5MB 2K70A 1U3NA 2NY0D 5ESAA 1CD0A 3THML 4L05A 2NY5C 2VM9A 1T4KB 5F72S 3DURA 4FYQA 4OCYL 5C3TA 3SZ6A 4PRHA 3VD2A 3B2UC 2F19H 4UV7H 5I1KL 3ZL1A 4IRZH 3I75A 4J3VA 4A2DA 4KY2A 2NY6C 4F15C 3MOBH 3ZZQA 5E6UB 2CLZA 1CICD 2CPUA 2XSKA 3KPOA 3DGGA 5E2WL 5BZWB 2VERA 4NO5A 4AQ1C 1XEDA 2Q20A 1GXEA 1T0MA 3VGGA 2HZHA 1FG9C 1XTLA 4QCIA 1DVZA 5F0JB 4EUPH 3DX9A 1AG0A 4O2EB 4Z8FH 2E56A 1T7YA 1TQVA 4LOUD 2JELL 3FB5B 4M7JL 4KXBA 5ALBL 3MRKA 3S4SB 3T0EC 2OULB 1OLZA 3IXAA 1ZRUA 1GGIH 1CXEA 2UVFA 2PTTA 2V3EA 3H53A 4BKLB 2FX7L 3GMLA 2IDTA 5E94A 1X9UA 4N2DA 3WIAA 4BA0A 3SPVA 1JZ7A 4QR7A 4DGIL 4IBVA 4JKLA 2BVPA 5J9PA 4OKDA 3RWGA 2O6CA 1MWAB 3HHSA 2GG1A 2VMFA 4ELDA 3CNKA 4XCFL 3WTVA 1MVUA 2Z1KA 3MA9H 4GRLA 4MXQD 4IHOB 1P1ZA 1QLFB 2UXVA 2JKLA 1ZE3C 3R8QA 3W0WE 4AQZA 1F4WH 3HB3C 4D9RE 4JY5H 4M8RA 4ZO7A 3NEOA 1J9RA 3CTTA 1ETJA 4MQTB 1OAUL 3QDJA 4OCXL 1IVLA 4MQ7A 3WKNA 1NICA 3EJRA 3T2OA 5CLTA 4OW6A 1MI5B 4HEME 1TDQA 1CIUA 3GMOB 5IFAL 4EI5A 5AG9A 5I9QC 5IB1B 4AYSA 4NQVA 3BH4A 2ITDB 3QRLA 2DMGA 3E6FB 1QHPA 1AY1H 2FEEL 1UGKA 4R96A 2UVEA 3Q5TA 3WKML 4XOBA 1V3MA 3V8CA 3FTSA 4BK5C 1GTNA 1F4XL 2ICWA 1OGTB 3GQFA 2ZXWB 4FZ8H 5DRWA 4BK4A 1FO0A 3GB7B 2FE0A 2BOBA 4LLUA 1RP9A 1WHOA 1CLYL 4LRIA 1RHHB 3AZUA 4YDJB 1NFDE 1DVFA 3AU1B 2E9IA 5CD3A 4IBUA 4IU3A 1OSZB 4X5XA 2KI6A 5C7ZA 1ZCRA 2BIPA 5D1XD 3P3UA 3GMRB 1NUNB 3P4MA 1VFBB 1J0IA 5E6IB 5BV7B 2F74A 3INOA 2XVLA 3VTMA 3LH2H 3UERA 1CPUA 4GUPB 3NRFA 3FUKA 5GS0H 3GSXA 1VEMA 2AXHA 2YAQA 1EAJA 2ICWI 2XU9A 2XZCL 3DGCR 4ICXA 3F3HA 4PH8A 3VFNB 2D2CC 4GP5B 4QOKD 2PYED 5HDBF 1K2DA 1W0VB 3FHAA 4JO2L 5DEFB 2WCSA 2N4IA 4XVSL 3B9KD 2HLEB 1Z1WA 4C4BA 5I73B 5GGVL 2ZD0A 2ZOWA 1DE4B 5GIRA 3IWUA 1MF2L 2ZICA 3EJYC 3VQ2C 4AYGA 1R47A 4KUZH 5DI8A 4FP8H 3MRQB 5IF0A 2WNWA 5I1CH 2A9ML 1GW6A 5I16A 1FYTD 3PNRB 1EZVX 1UT1A 3MU3A 2YS4A 2NQDA 1YEIH 3D50A 4NHUB 5GZND 3CXDH 5T1KD 1OE1A 4YS4A 1QO3A 1KMGA 1NGPH 4FF9A 4IYKA 1X5YA 2QADB 3QHZL 4LHQB 4BWTA 3MUZ1 5CR1A 5KVDE 3D30A 3EYUH 3ARYA 3ISRA 3MI6A 2EEBA 5I30H 4HDIA 3VFWB 3W5NA 5ENWA 5C0BD 3KHOA 3TH3T 3IU4L 4AW7A 2ZPKH 3LZFL 5C08E 2Y23A 1VADB 2A83A 2VLRD 3WTUA 4XNXH 2DQIL 4AQEB 2DMHA 3O41B 2WTRA 1B0RA 1G6RB 1MQ8A 1J8RA 1T2XA 4NCC1 1TENA 4MD0B 4G7VH 4XWGL 1TQBB 2RFXA 2ENSA 4ZMTA 4S1SL 5D8JH 3QORB 4YJZL 2A9BA 4KKLD 3DUSB 3FQUA 3L4TA 4YEFA 4GLRH 1UZ8B 4J8RA 2B5IC 3ZT6A 5C0GB 1XTMA 3P3SA 1U8IB 3N85L 4S1RH 1DZBA 3UZVA 1MREL 1GRWA 4WWID 2F54B 1G1CA 5EBGA 5FX3A 5FO7A 2WQRA 5EDXA 2EEFA 1TLKA 3GHPA 4R90L 4DCQB 4JFPB 4YEEA 4RIRB 1GMEA 1VFOA 1VF5C 2ZCLL 2WP3T 5FV2A 3ABZA 4OM0L 2GJ6D 3VXSD 4TNVK 4FXKA 4RWYL 2F8VA 1AD0B 1E4HA 2BSCA 5I74C 4FA8A 4FNQA 5E99H 4HUWA 3RWCA 2AMUA 2Z6FA 5CEZD 1L9NA 1Q9WB 5DUBA 5IQ7L 2R2HA 1WC7B 2HLAB 3OAZK 1W0WB 4YHML 2FZ3A 4Y1AB 5D4HA 2YGOA 1KENH 3SE8L 5F3BA 1J5IA 1U8LB 3GSOA 4O00A 4LVNC 4KV5F 1CE1H 3FUMA 2NQCA 5DMJB 4F2MB 3FF7A 1SM3H 4X7TA 1NL0H 3F58H 4H5SB 3DSNB 2VWEE 4GY4A 1BJ8A 1NDMB 2K7QA 3MRPB 4QRTB 1UWEH 4RSYA 25C8H 4WENB 3QUXB 2BIHA 5F2FA 1HOEA 3L2NA 4GKNB 1JV2A 1V3JA 1KGIA 3JTSB 2OMUB 1VGEL 4PJAE 1IARB 2PLTA 1KN2H 5JPNB 4NSKA 2C9AA 1OW0C 3BUPA 4H8QA 4KKCD 3S8GB 5C9JB 2B3RA 3CFBA 4OT1L 2JE8A 4X4XA 4XP9L 4OJCA 1XF3A 3S35X 2X3BA 3WBDA 1X5XA 5TTRA 1QRNE 2CG9X 2G60L 2EUZA 1YCSA 3DROA 4LVEA 2DD8L 1FFOA 4U1SA 1BOGA 1R24A 1KEML 5BRZE 2VDOH 1QASA 5C08A 5TDOB 2DJ4A 4KVNL 4AZ8B 2G75A 2AANA 3VH8A 4OBRA 1JZ8A 3NAAH 1B2WL 2PTVA 3A6CH 3ULUD 1NANI 5BPPA 1DJWA 2DLEA 2EDXA 3Q13A 4MAZA 4BA8A 2YGQA 2GSMB 3SGEI 1WCBA 1BQSA 2WKOA 2YKLL 1KXQE 3GMNA 3RNKB 1IBBA 5LGHL 5GGTH 4MA1C 3OD3A 1RFDH 3VXRE 3EZ8A 5FWQA 1RZFL 3GDCA 4QOKA 1NOFA 1CG9A 4H26B 2X4UB 4X80L 3ARFC 2YA2A 4JM4L 3L4ZA 3MJ7A 2BS71 3ZYIA 2GTQA 1AFVH 4F15B 3HC2A 1U8PA 4X5RA 3ZE0B 4JRYB 4LPXA 4HKJB 2CO1A 3H9YA 5CGTA 3GKZA 1FDLH 4AQ1B 4GXFA 1NC4D 4QT5B 1CD9B 1IGML 4JG0L 3EGSA 3JWOH 2DLHA 3V0VB 1FYTA 3K8KA 4FG4A 5CSGA 3CFIC 5GZNA 5I1DB 4P5SA 4BQCA 4LU5L 5I1AB 2AJSL 3NCFB 4PJ7E 1UUSA 3LKSA 4KJYB 4X6BB 4NFBA 3GSUB 4JJHA 5IW3A 2AJUL 3T0EB 2HN7B 4N0UE 4UAOC 1CXFA 1WO2A 1QG3A 3TO4C 1OOAA 2ZKMX 4L4TD 4WV1C 1FPTH 4ELMB 2G4GA 1K8DB 2UZYB 2PETA 3ATEA 3WMQA 1ZEAL 4NGHH 5A16A 2XJLA 4OKVA 2IH3A 3T77A 4XZUA 3FCSB 1AIFA 3GRGA 3J27A 3ZSSA 4NQCE 5HHOD 3TJEH 1JXDA 3MRNB 4IJ3C 5L7XH 3ULUE 5DHXB 1UADC 1WFOA 3I85A 4U1NB 4NLAA 4OIIL 2NCMA 4X9FA 5EC1B 3VRJB 7FABH 3TVMC 3UPCA 2Z4QA 3L8QA 4M62H 2YPVA 3F64A 4GUOA 3U7AA 3K1KC 2FAUA 3A47A 3HB3B 4TXVB 2FGZA 1VKXB 3MRIA 4CVXA 2APXA 3IMUA 3CUPB 1HHHB 4ZTEA 4ZDHB 4X6DE 3P4NB 2B59B 4ALAH 3HA0A 5JHDD 4ZMLA 3KR3L 3TBCA 1T04B 2F08A 4ZPVB 2NNXA 3ZHDA 4AZUA 4FXTA 4QWWC 2EH8H 4BH7A 3BZEA 4OM1L 4OSUH 1JVLA 1K5NA 3QRGL 3TA3D 5LGJA 5ADPL 5SV3A 4MMZC 1A7BA 2IV9A 3G6DL 5HP5A 5F8RC 4H2CA 4HFUL 5I9QB 5LDSA 2MPAL 2X41A 4WKZB 2BXYA 2QDWA 1KXQA 4MCZB 3CLWA 4LHJB 5FYKE 5DT1L 2VB5A 3E9TA 1W91A 2IWEA 3CN4A 3FU7B 4IDJH 4PD4K 2Z31D 1Q72H 4RX4D 4PB9L 1NGQH 4HG4J 2OZ4L 3D9AL 4K9EC 4K3JL 4TQEL 1AG6A 2A6DA 2YAMA 3LJ3A 3REVA 2J8OA 3V7AE 1Z7JA 2CLVA 5IB3A 4EUPB 4UB0H 1T7XA 1K6QL 4MMYB 4ELKA 2ED6A 3B6SB 4MJ6B 2GSIB 3STLA 3VUAA 2AQNA 4GG6F 4M61A 1U3HD 1X5GA 3UEZA 4JG1L 1AD9B 2C3VB 1BDYA 4PY7A 4F8LA 4BWWA 3NABL 1ES0A 4PYGA 2GTZB 4FQXD 1CL7I 3TEZA 4ZW6A 3B3IA 2Q7YA 3NSXA 4PJ7A 3SPGA 3LMJL 3BKJH 3WIIL 5K9KA 4OD2A 5KYXA 1E4XL 4S10A 3VWJC 4EDWL 1MCBA 4TM9A 3GSWB 3TC9A 5KSAB 3UTTB 4PWJA 1A4CA 4YPJA 4B7LA 3S3CB 2XJKA 1LD9A 1NLBL 3GSNA 1XF2B 2C9SA 4CNIA 1KV7A 5FM5O 3S34H 4ZUUA 4J3SA 3VXOA 4HXAH 4NQCA 1N6QL 4WEUD 4OGZA 3C60A 4YHPA 1HDMA 1Z9LA 4ONOA 3QFJB 4NP4L 3QXVA 1CFSA 3KYKL 1TTGA 3K81A 1I7RA 4HKBA 3LHAA 4MZ2A 5KVGL 3N1MC 1X7QA 2IANB 3AQXA 3M6DA 5HJ3B 3ROLA 3ZDZB 1JRHL 3VXPA 4JLRB 1ZS2A 5FB8B 2R8SL 3HJEA 2DDQL 5MP6H 3IF1A 3H6JA 1RZGA 1IGYA 4FLHA 3UEQA 3TEYA 1KTKE 1NCIA 1DO6A 3RWDB 2V7NA 2ZOOA 4QHMB 1KYUA 4A6YL 1MIMH 1TCMA 2ZWNA 3SOTA 4AYID 5I15L 4FMVA 5J3HC 4HD9A 1C5CL 1HFUA 4M8QA 2ZOUA 3DI3B 5TE6H 3WFHB 1L3WA 4J3OG 4PRBA 4ECNA 4N90D 1IKOP 4PHZA 5IBTH 4WVRA 1W6WA 1WTGT 5I8CB 4AGOA 5JLZB 3C5JA 3IKKA 4OUUB 1GSMA 1IJNA 5I1LB 2EIZA 2AQPA 3MACH 1UQSA 2FDBP 5C0DB 1A6VH 2V4LA 2X6BA 3BGAA 3DX7B 5BUAA 3GZQA 4O4YH 2WXQA 3E3QE 1FLTX 3F85A 2B5IB 1NBZA 3N44F 2F61A 2R2BA 4GO8A 4M7LH 4PPTA 1KB3A 2H6UA 2X0WA 3QVAA 1O9VA 1IEHA 2APSA 5IHLB 1B4RA 4U6YB 2J44A 2XPGB 4F7TB 4FFYH 4L4TA 5K69A 5DD5H 1H6FA 4MB1A 3MRMA 2GUOA 4JQVA 4PTTB 2RMNA 4R26L 1OP5H 4JG5A 1E27B 4PJBF 2BP0B 3L13A 4TUUA 4K5MA 1IGJA 4JM2A 3UTSE 1Z5YD 1ZTXH 2IAMB 4O2FA 1MCFA 1R9FA 4R4BA 4TRPH 1DEEB 2FJGB 3BESR 4NKDA 1AGCA 4UM8B 4PBXA 5EFIA 2JJTC 4M6AA 5CN3A 3AS2A 5F44A 1YMMB 3EO1B 5GSRB 3RNQB 3H4FA 3SDDD 3LEXA 4KTDL 4PJ9C 5BMFH 4LVNB 5AD0B 1W72A 3QQ3A 5EEZA 2X1XR 5HDBB 1CXKA 1N64L 1TVDA 2VZOA 1D6VL 2FD6L 2ZXBA 4KRPD 3MDJA 3ISYA 5IROA 2YKKA 3KDMA 1IKNA 4UT9A 4PJDE 2EE9A 4MQSB 4U05A 3V5KA 2DLGA 4WZ9A 1XSJA 4N90E 4Z18A 3IRCA 2IBBA 4HJ0C 2LW3A 4A2HA 2B9AA 4KX8A 4ZSOE 3N42B 4H13C 4NAQA 2YD0A 2ZAIA 4P23C 2ZTBA 4AXWA 1FN4A 3QJFA 4CN6A 2Z31A 1JDDA 4RX4A 1QHOA 4LT7A 5ACZA 3SE3C 3E80A 2XN2A 5FOBB 4OZFB 1CGYA 2YBGA 3I9GH 3GHBL 2B15A 2WMPA 4EEEA 4WW1A 3OHXA 1U91A 4HUKB 3RBGA 2Z34A 1U3HA 1IC1A 1YNTF 1A3QA 2Y36H 2UZPA 4PLKC 5CGBA 1OCWH 1RZQA 1KZQA 3LZNA 4L1DA 2JF1A 2WAQA 4XI5C 4XPTH 3O11A 1A02N 4Z7WB 3EXLA 4OIBA 3KCWA 2D4DA 2GHWB 2HTKD 2JJVA 1U93B 3U36B 3R0MA 1MLCA 4ZMVA 5D72L 1WG3A 1BVNT 1HCVA 1YC7A 3IJ9A 3F6LA 4MA1B 4L37A 5IQMA 1RD6A 2OMZB 1JUFB 4NQSA 2C1OB 1XIWC 3ARFB 4CDHA 5HPMB 1JYXA 2J88H 2FL5A 4PP2B 4IW4C 5EU5A 1DQJB 5CAYB 2A77H 3V6BR 1RPUA 4ODHH 5E23A 4BHUA 2Z0BA 3UTZB 5HHMD 1TTCA 3HG1E 2R56H 2FYVA 4CBZA 3BKYH 5E6YA 4Z0BH 3S5LA 3BIKA 1ZIAA 5GGRA 2N3JA 4W9KC 4S1DD 1J1OL 4YZFF 3RL2B 1EZSA 1N68A 5BJTB 1D2PA 3NZHH 4FHKA 1V05A 3CIQA 1M9WA 3BUQA 4MMXC 5JO5B 2R69H 3QZWA 2VLKD 1FHNA 4UAOB 2APVA 1J8HB 2FSEB 4YR6A 4P2RD 4WV1B 1H6TA 4JCWA 4LGRB 1SVBA 3BSZA 1WGVA 2NXZD 1SY6A 4GYBA 3V79C 1IBHA 2ZYHA 2C7UB 1D5BB 2W81C 3X2QB 4BHUI 3QH3A 1HAWA 2VDOB 4GXUM 4IJ3B 4LPYA 2VN4A 2XC8A 3LVTA 5DZAA 2EDWA 3GIZL 2NT0A 4NDMA 4PJIF 2JKJA 4R9HA 5FAAA 4EXPX 4J6RH 1YEKL 3WTYA 3BZ5A 1JNNH 2OMXB 1KPVA 3VXTB 4NIKB 5EZPA 4D0BB 3FUNA 1AC6A 3SQOL 1E5BA 2I07A 4X8JA 3CC5B 4LHUB 3WO4B 2CUMA 2XBZA 1I1YB 2IADB 1CDUA 5HD8C 1B3IA 1TZGL 4QJ3B 3WAJA 1T89C 3BP5A 1FAIH 2Y1ZA 1FO0L 3ILQD 2X2UA 4Z7IA 1HIML 1ZA6A 5D7SL 2JI2A 4Q4IA 3TT3L 3PYCA 4YDMA 4Q7DA 1J05B 3AG1B 4F33B 4PG9B 3S3PA 1Z32X 2KQMA 2OXHA 5KANI 2VLLB 5B4MD 4QRRD 1MG3C 3SDDA 3HCVB 3STZB 4F80A 3VFTA 4N8PA 2PPEA 4YDZA 4HZLA 1QBLH 4CSPA 4YFLI 2L7QA 2J55A 1P0SE 3T0DA 2WQXA 4YC2C 5GGVY 3WV0A 4BUQA 5K9QG 1A1MA 43CAA 1A6AA 4N8CL 3KPQB 3QI9C 3IM1A 2X88A 4XZ4A 4POZD 5E2WH 1ML0A 3EFOA 1MW3A 3TEWA 3WN5A 3SO3C 4Y2OB 3LRSA 3UMTA 5LAXB 5I1HL 2IXQA 1U92A 1KJ2A 3VQ1C 3PPSA 1OT2A 3AB0B 3P73B 1W6LA 4BZ1A 4MX7B 4HFWA 4P57B 2I7OA 4JZNA 3VWJB 4YLQT 2LLLA 3M7OA 2H9GA 1OV8A 3TONA 2NW2A 4DAGL 4J2XA 3QDAA 5GRZA 1UM5L 4ZPTB 5H2BB 1O7VA 3G9VA 4WK2B 2XXFA 4DGVL 4A7VA 4JQIH 4GG8B 4WY7L 1KEGL 1QPPA 1JPFB 4MAYD 5DD6B 3A6OA 3HNTL 1G4RA 3N1GC 5G5DB 4GOSA 5EEVA 4E9XA 1HJBC 4GUCA 1A9EA 4NNPL 3I84A 3QEQE 3LIZA 4AC4A 3HPJB 3KH4A 5GGUA 5D6DA 3KYNB 3F12B 3WE6B 4A7UA 4PRAB 2OXGA 4V1DD 5F0PB 1JYVA 1NPJA 3MJ8B 4MNQE 4LK4A 4J3XA 1RURL 3W38A 2BNRB 4Q9RL 4LLDA 1BZ9A 3OXSB 2A99A 3OXRA 4EZKA 1MZZA 4W9FC 2X4SA 3D25A 3EADA 3U9WA 4R5XA 2WTOA 3TBVB 5GS2D 1KYOK 4KXAA 1ID5I 4KDTC 3Q7JA 2OR9L 1S5IL 2JH2A 4PV1C 2X6VA 2F8XC 5E9NA 1VCBC 4QHKJ 2QL1A 2IDUA 5E4AA 1D6EA 3NCEB 3UP1A 1RJLA 4WWPA 1EDHA 1BBDH 1A25A 3CHXA 3LNIA 4UOZA 2IWKA 2GUYA 1IAMA 2P24A 2A4ZA 3OAUL 5DUPH 1SHXA 2WINB 1CT8B 4TSCH 1VSCA 1Z5LA 4LEXH 1M42A 2DJUA 2X4NA 4AV0A 3WJMB 2VLKA 4B50A 2NLJA 3B7YA 3RJOA 4XO8A 4MA7L 3SHSA 4LCWD 5KG9A 4AT6B 4GG6B 1WEJL 3TURA 2Z91B 5SWQA 1SUHA 1OP5K 3X3FL 3KCPA 3P3YA 1NINA 1XDTT 4KK6C 3IDNB 4N2NA 4KI5E 2R59A 2IQAB 3HIZA 3SDXE 1M7IB 4P9ML 2AXFA 3U2SA 4L1BA 3S48A 2P5EE 3EH3B 4HHAB 2XV3A 1M57B 4Y19D 1ZT1B 4PJ9B 3TYGH 2WLLB 3ZO9A 5D7KE 5DHYB 4ORZC 4PV8A 1QLRA 1L9SA 4LP4A 3WAKA 5BS0D 3D4GA 4NOFA 5KVDL 4LAJH 1MEXH 4TSAL 1KGJA 3KDPB 4D8PB 4YHZH 1NGZA 1QP1A 3OB8A 1E7UA 5D96B 2ARJQ 4OF3A 4KNQA 3EH1A 1S7UA 1S7SA 4JANA 3BH8A 1UYWL 5FUOH 1FLRL 4OD3H 4P4KA 3GZKA 3TTYA 1EDYA 4R7DB 4QRPB 1F13A 4DVRH 5D2NC 1ET5A 1D7CA 4QRRA 4DF9A 4JFDB 2OJEA 4X9YA 4HS6A 3MV7D 3D85A 4ODTH 3WXWH 3QCUH 4EE2A 4MJ2A 1MAML 1BZ7A 1Z9OA 1N0LB 2FJSA 3DWTA 5B38G 1ADQA 2VR7A 5T3XD 3KGTA 1R3KB 3V9CA 1UD8A 3BP4B 5FUCE 4LLWB 4M93C 4KK9D 4XCYB 3UZEA 2DQEH 4P2OB 1MJ7L 5DEGA 1J1PL 2C3GA 3O3EA 3JZ7A 1WIOA 1P7QD 3ZDYE 2AERT 3T6QC 1SMOA 4L4VE 2BDNH 2PXYC 3W9DA 1RIVL 4OFVA 3C08L 3BJLA 2IDQA 3QS3A 4YE4H 2IGFH 2AJVL 3BLPX 2PWGA 1YEGL 5F0MB 4N2AA 4XHJD 2HLFD 3WTWA 1WZKA 2AV1B 5M7QA 3GKWH 5E5MA 3VXUE 3UZQB 4ZOCA 4KOBA 4EI6B 1I3GL 3WMSA 1WAEA 3TBWB 1BBJB 3WUWA 2VXSH 3P02A 1XIWB 4PJBB 5D1ZA 1NCDL 2XV0A 1C1EH 1CK0L 2N1TE 1O75A 2ZCLH 4HS8H 1D9KD 2ZG1A 4N8VG 2WLNA 1TEFA 1DJSA 3H7BB 4JBSA 3AGVA 1ZSDB 2YSTA 3SDXA 1E5CA 1U8NA 1A6WH 1K3IA 5DEJA 3STBA 3EDJA 4DEWA 1RZ8B 4K8RL 1SXAA 3BZFB 3N0PB 1H0DB 4F8OA 3MCYA 4V1DA 4M3KB 2KC0A 1F1AA 4M48H 1EXHA 3ABLB 2Y72A 1JN6B 2KLTA 4XVJL 4FULA 1IFHH 3KL0A 1PZUB 1QR1A 2XI9A 2H32H 5C1MB 1IBZA 3MR9A 5INDA 4JEGB 4XTRD 5E1QA 5LXGH 3QA3B 2D0GA 2YPVL 5D1ZI 1U8HA 2HJFB 3L5WB 3SBRA 5EC2B 3BGMA 2WD0A 5AZUA 1RI8A 5A2JH 4Z3HA 1JF6A 3GNML 3ZKNC 1WFIA 5E4OA 1BEYH 1DFBH 2B0SL 5AYUL 7PAZA 5EBWB 4U1JA 3P2DA 1ZHNA 3HAEH 5LBVA 1JHTB 4I48B 4XP9H 2ICEA 1SZNA 4YSTA 3BVWA 5FW7A 5LBSA 4AW4A 4L5FE 1NC2A 4AUUA 1VFAB 2Y3AA 2A3TA 2V8LA 3RB5A 3OAWA 4GAJL 3FQ4A 4QRAA 3WCYA 5HYSB 5CSBA 1KB5B 1WV7T 4FFWD 2OTUA 5J13C 3ULVE 1DUZB 4Z3JA 3L4WA 2ADFL 3BH9A 1Z0NA 5FGCB 1YNTB 3WNMA 3NK4A 1BD2D 1FUNA 1BVLB 1LDSA 1FH5H 3L45A 3DV4A 1F0LA 4GIPD 2Y6SD 2AXGB 1LK2A 5C3LD 5K9JH 4K7PL 3JQOB 4OD1L 5KTEL 4IBQA 4IBTA 3WO3B 5EU3A 5E70A 4Y19A 4M5YL 1TZHA 5TPWH 2B2XH 4NRYA 4EDXB 1ROCA 4WSGA 1RZFH 5MENB 4HKZA 2VMEA 2X7LA 1MFAL 1UHVA 2J73A 3L5XL 5BS0A 3KVDD 4U7MA 4YC2B 3S5ZA 3X1GA 3QI9B 1DN0A 3ARBB 1GCFA 4XP1L 4K15A 1CLOL 5BO1H 5KBKA 1J1XH 5TF1H 1FNHA 1BIIB 2XKSA 2ENYA 4OLUL 1OOWA 1NCWL 1MDTA 3SO3B 3SCMC 1MELA 1HWWA 3HLAA 1REIA 4RGOH 1XR8B 3ESUF 5DLLA 3KM1A 3VGAC 5EDSA 1NDGA 5CF3A 3ULUL 2RQEA 3MV7A 3X13A 4X6CE 4N3UA 1I8UA 4MJHA 3L6FB 5B39G 1M7DA 4KTGA 3UC2A 3ARDC 2XKNA 1U3YA 1FVCB 5IW6B 1NMCC 3QUZB 3EH4B 4Z3EA 2O61B 4M8UA 4FNUA 3BP6A 3EBIA 3NFNB 3B8SA 4Q9BA 5F7BA 2YMXL 2Y7MA 2QPFA 4EUPG 3KPRD 5K39A 2R29A 4RRPM 4ZAKD 1NGXA 2F5AL 1KYAA 5F7FA 1JGEB 1MN4A 5AOIA 3FU0A 4ZS6D 2NTFB 1AMXA 1R5VA 5C0CE 4GAGH 4HGWB 3WNLA 3UDWC 2ICWJ 3B56A 3DX8A 3KJ6L 4OIIH 4UYQA 4KITB 5CZXD 1BLNA 5IQ9B 5TFSH 3RIAK 4L8BA 3DIFB 4GW4B 4KJPC 4Q89A 5DRXB 5GSVA 3FUIA 2QFRA 4XMXA 2W9DH 3FTVA 4PRNA 1CDYA 5FK9B 5FYKL 5DGRA 3MFFB 5IV2A 4P04A 5C7XH 3MREB 5ALCL 3C2AL 4NN6B 5ETUA 4E41B 1ET8A 1OGAD 2VR8A 4G6ML 4JFSA 3BQVA 2A6JA 1SMAA 4FQCL 3MODL 4WFED 1MFEH 5D7IA 2EINB 1OP9A 1MCWW 2CHDA 2Z35B 1S78C 5AB1A 4Q6IC 2E7CA 1ORSB 3V0DA 4BCYA 1V7ML 1B0GA 4RQQA 4U7KA 5GGSA 4FTVD 4L8CB 4X0NA 2P28B 2BOCB 5DJ0B 3CZFB 5AW5B 4WHDA 4KJWD 5IFJB 4ONHA 1Y07A 5T3ZH 2YJLA 5GJSL 3BYTA 3WL9A 4TVPE 2HFGH 3D9AH 5KS9B 4DZBA 7FABL 5E8PB 1GGCH 3HNSH 3QWOB 1K6QH 2W07A 2PYFA 2FIKA 4JPWH 4JHWH 3UL4A 1J0KA 4G1EA 1U8MB 2XQBH 5FKAA 3FTGB 3GDBA 4PLJC 3F7YB 3PJSB 4NNYA 4P2CG 4Y4KC 4Y9GA 4RFNC 4UM9B 1H5BA 1E4WL 1HK6A 4MXVE 1AZRA 3FQRB 2BSTB 5EO1B 1BZOA 1KGWA 3WE1A 2EYSB 1XGTB 1TG8A 2BNQB 3O6FB 3HRZA 3F7LA 1E6OL 4WW2F 2BZ7A 1NCAL 2R0KL 4K3EH 4UT9L 3S5YA 4C56B 5FFGA 5EOCJ 5JNYA 2FR4A 4IM8A 2BVOA 2FECI 4R4NC 1ZANL 2WXOA 1OT1A 3NJJA 4FQQA 4O02A 4XOEA 3BQUA 3D2UD 5DWUH 4XC1H 3HG3A 4QMEA 4M4PA 2K6ZA 1WITA 1JGUL 4ZD3H 2W92A 3D05A 4YHIA 4ABVA 5TH2B 1J86A 3G5YA 3US1A 1M3JA 3V7MA 1BD2A 2DH2A 3BISA 3CAFA 3EW3B 4KO7A 5CZVL 3RFZC 5C0CA 1AS7A 3C5ZB 4GXUN 2QSTA 4GO6B 5KYYB 3LPPA 2CK2A 3RQ3A 5T33L 3TP4A 2VZSA 5DS2A 4MJIE 3D12B 3K6IA 3MLZL 5CINL 4H88H 5IVXB 1JNLH 2DQJL 1IC7L 1ZK9A 4XP4L 4JN1L 4MNGE 5HGDB 5D2NB 2YGNA 4AITA 1Z66A 3SBQA 5CHNA 5DD0H 5AVWB 2Q1EA 4BFNA 1MRDL 2Q6WB 1NPNA 1U3JA 4Y2DC 4Y9FA 3G5VB 5IBUB 1NCCH 3F5WB 1JWSA 1GPOL 5ITBL 4M3JA 4YBHA 3D51A 3RVUC 4DP8X 1YA5A 3N3EA 4M93B 4DH2A 5E9DB 1RJYA 1JSYA 3MRCB 3ZKSD 3OKEB 2PXYB 4KNUA 3CXFA 4HX1B 4HJTA 3RUGF 3ROOA 4BFGA 2VW7A 3RAJH 4NQEE 4UDUA 1E8XA 2SODB 2XG4A 3BVNB 4ZNCD 5IKCA 2ESVD 1NEZB 2HFEA 3QYMA 2J3SA 2C1PA 3UYPA 4QXTB 3JWDH 2XBDA 3I2CH 3KD4A 5FYJE 1Y6MR 3ZYOA 4MVBD 5IY5B 2BMKB 3V5DB 5E1IA 1YQVL 3DXAB 1IC4L 3LYRA 4R0LC 1QFHA 1A4AA 3MRHA 4W4NA 3SKOA 5AENA 2Y7SA 3GSRB 1ONQB 3VFPB 1T80A 4R5VA 1IAOB 1QSFD 2ALWA 3CFKB 4UQ9A 5HGAA 2GB2A 3A4EA 3E8VA 4RGNE 2VDRL 3BFWA 1AXSB 3IMBA 4ZS7H 5ILTH 1WFUA 5F3HB 1AAJA 4WW2C 1BAFH 1LP9A 4OUOA 3BRGC 3BSZL 3PWPB 5A2BA 2D7MA 4NQUA 1SY6L 4XPFH 2HT3C 4EXKA 1T7VA 2DWDB 4JL2A 3CH1B 1DSYA 3KBFA 5SWSB 3BDXA 2VSDA 1PLAA 2GIMA 3O3DA 3Q1SH 2A1WL 5SWZB 3RI5F 1I1AC 5EORL 1OGAA 3WOVA 3TN0C 4FKEA 4X5QA 3U6RB 3GRWA 4NQDE 5D7LE 1T3FA 3NZ8B 4GP4B 3DX2A 5F70A 3WS6C 2BSED 1UM6H 2XZAL 1ZLSL 2CO7A 1QSVA 2OLDA 3HBPA 3K4AA 4OCSL 2Z65C 1N59A 3ES6B 4G6JL 4MJIA 5J89A 3OR7A 3NFPB 4FTVA 2MCPH 1FZKB 2Y7OA 4JN2A 5CBAB 3TLRA 1YSOA 2WXMA 4UV4H 2OMVB 1MJJA 4OCWL 1RUPL 5DRNB 4M6NH 4MKTA 3U0PA 1L0PA 3N04A 1HEJC 2BVTA 3CVHA 1BW8A 3NESA 2DB8A 1PDKB 2WO4A 4Z7VB 1N3NA 4K3DH 4YO0B 1A5FL 5J13B 2PW2A 4KK5C 3MGTA 1EAQA 3NVQA 3O6KL 4WUUD 5CLXA 4LASH 1HVXA 3NCWA 2OQJB 3AROA 4U1LA 1NCBL 2EH7H 5D2LE 1NIEA 2B3IA 2X4OB 2P5PA 3MXVL 3QNYA 4M7ZC 3EO9L 5KJRH 3DTXA 2F7OA 1AANA 1SHSA 1OB0A 2C9VA 4MD4B 4YHLH 3FUHA 3IFLL 2W95A 4U0RC 1RULL 5FHAH 3HBQA 3PQYE 1TJHL 4LDCA 1GSKA 4NKOB 4JFOA 4IOFD 2ADIA 5DMYA 5JOFA 2DL2A 3BE1H 4B9JA 2OJZL 4BZ1L 2ISDA 2XXGA 3CZNA 3QZOA 3UG5A 1H15A 3TIEA 4YSCA 2F53B 2H32B 5AKSA 3CLFH 1BZ8A 1KJMB 3AITA 2YFNA 1DSWA 3EBAA 4H1LA 5JMOC 5E03A 1M71B 4NRXB 2GK0B 3TWCL 4BINA 2VE6A 4M29A 3SCMB 1TJGL 3SOBH 3D5OF 4Y8DC 2UV3A 1AR2A 5D7JC 3VGAB 2JB5H 3TPUB 4G6FB 4XMZA 5BVPH 4XODA 5CJXC 4Q0XL 4N2EA 3IMVA 2ZWLT 4AM0B 2M2DA 3LIZL 4IMKA 3W37A 4HSQA 3BT2H 2C9RA 4HIIA 1FVEA 3OKNB 3ARDB 5IMMA 3ZMEA 4X4ME 5ESVB 3LXUX 2XQYK 1NMCB 5D7LA 1BQKA 2WQSA 4KUCF 5D71H 4G9DB 4JO1H 1OAYL 1Q8MA 1TVHB 3E1ZA 4TQHA 2DM7A 4IIQC 1QUNB 3KNBA 4G8GE 1UD5A 4WUUE 3VFOA 4HOZA 1F90L 1KTBA 5E5RB 5BQDA 2WVVA 3SGJC 3RILA 2XICA 4XMKH 1IM3B 3RU8H 5IHZA 3BUTA 1ZVSA 4NENA 2FQFA 2CA4A 1DJYA 4JRXB 2G9HB 1AQDB 4P59H 1A7NH 1WBXB 1NGWB 1WBZB 1WZ1L 3EDEA 4PQXA 4DEUA 4Y4FC 4MGXA 4OV5A 3B2VH 4MASA 4F24A 4AG4H 3C9NA 4NKQB