2ODHA

Restriction endonuclease bcni in the absence of dna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
238
structure length
233
Chain Sequence
MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENNITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNLSKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMDLCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R.BcnI
publication title Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA.
pubmed doi rcsb
source organism Brevibacillus centrosporus
molecule tags Hydrolase
total genus 57
structure length 233
sequence length 238
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2odhA02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2odhA01
3IMBA 2Q10A 2OA9A 2OAAA 2ODHA 2ODIA
chains in the Genus database with same CATH superfamily
3QNYB 4Z77B 1RZFH 1DN2A 5GGQH 2DEWX 3WN6A 1YPZA 2WQXA 1HH6B 3Q8FA 2MHAA 2NNRA 2AMUA 2WXMA 2NDFA 1DSFL 5SX4I 3ZSTA 2P26A 3KBHE 3WAKA 1BLNA 5IG7B 1QSED 2YA1A 2WXNA 2UYLB 1XGRB 5JQ6H 1MH5A 1MRCL 2IADB 3UEZA 5EIIB 1KCBA 3CHOA 4QTFA 3H9SB 1JZ6A 4RMQA 2XQYG 2FEDC 3UADA 2Y9RT 5GS1C 1GVIA 5K9OA 3CFEB 2Y7MA 3BH9B 3W39B 4C56B 2CIIB 1CE6B 1KCUH 4ES9A 2JJVA 3PWNB 1OAQH 1UCBL 2DWEA 3WFBH 3U4EA 3LKSB 1R5IA 4MFHA 1ORQA 4WUUE 3FS9A 2MQGA 3KPLA 5TFSH 3V0VA 4N9GB 4J3OG 3RIFK 1UOLA 1G5AA 2Y24A 2QTVA 4FZ8H 1YMME 2NZ1A 1TMCB 4MYPA 2WLHA 1DBKH 5F7LB 1HZLA 1F90L 3PPEA 2YIHA 3OAYH 3FB5A 4QF1B 4PTUA 5D72L 5HJDA 1ZK9A 3D3VA 2A9MH 2EKJA 5DK0B 3VQMA 5A40E 3KJ6H 3D85D 2NTFB 1JK9A 4EAEA 2EVJA 4Q9RL 2OAAA 1Z0MA 1OAYH 3K2UL 2WC7A 1FDLL 2O6PA 2BP8B 1ZA3A 3D2UA 1JGUH 3X13A 1M9SA 2B0SL 3Q0HA 5B8CC 4JAMA 2ZKHH 3KDMA 1KPUA 2A6DA 2V17H 4ANVA 1FCGA 2CD0A 2WWOA 1KYUA 1U8KA 2ITDB 3N85H 4HX1A 5EOTB 4RQQA 3SDDC 1WFUA 4DP6X 4MJ5B 2O6DA 3EJTA 2R7EB 2BHYA 4ZYKA 1TVHA 1I1AB 1S7VB 5C3TA 4PJ9A 5DVMA 4MB3A 4NENA 4BCYA 1PKOA 3LKPA 3VYPA 1TTCA 2W60B 3SKUD 5FIEA 5IESL 3K4ZA 1D9KA 1I7ZB 1TKWA 4GSUA 4OSUH 3V7AG 3ZZLA 2P47B 3GK8H 3F2LA 2H1PL 5BZZA 3GSUB 4UQEA 4YDVA 5DMGC 3TF4A 2CZNA 3HNVL 4NRZA 3KYMA 3MBXL 1DUZB 3ZXAC 2RFXA 4P2QB 2WIIB 4A2HA 2O26U 2FECI 1JGLH 3BRFA 2CBPA 2EVIA 3RVVC 2OYLA 5E0QA 1P5UC 1DQJB 4WJKB 1DO5A 1IE4A 3H9HB 3BP4B 4LQFH 3WGUB 4AITA 1AMXA 2VDRL 3BHBB 4MGXA 5FOJA 3F12A 2VLRD 1DQDH 4RA0C 4KITB 1NLBL 4K5OA 1QTSA 4LGRB 5GZOD 3RPKA 3MV9B 1S7UB 4CN4A 5GGVH 2AXGB 5I5MA 3ZQXA 3NGBB 5SX5K 4MCMA 1KGCE 4YZWA 1TNNA 4M7JL 1RFDH 2QQLH 4J28A 1AE6L 4P06A 4LGSB 1WEJL 2PXYA 3QPKA 5ALCH 1F1GA 2JI3A 4A04A 4ODTH 4ODUB 4OD1H 1JZ7A 1CG9A 5I26A 3CSYB 1IAIH 3L4XA 1J7VR 4F7PA 2Q3ZA 1MVUB 1E5CA 1OANA 1E3FA 5CMAB 3MRQA 4AL8C 2W0FB 4ZMLA 4KDTC 2IQ9H 2X4SA 3BEVA 1UD2A 4LLYA 3HS0A 4DAGL 3NIDF 4NO5B 5FV1L 1HYSC 3K91A 2IH3A 1V27A 3FZUC 4PFEA 4DVRH 1HWWA 1N8ZB 5IQ7L 3I9IA 5D6CA 4G7VH 3P4LA 2DDQL 3BUTA 3MLXL 3T77B 3ZE2E 2XVGA 1FZJB 1TTAA 4XN7A 2G60H 4R7NA 1N0LA 3QJRB 1JYNA 4XC3H 2V2TB 4GBXB 4NOFA 1CIUA 4A2GA 1ZJBA 1YYCA 1KIQB 4N1CA 4QJ4B 5D5MF 4GP8B 4PGEB 2AK4A 2ADGB 1JWUB 1KXQE 2VGLM 4LSVH 5IBUB 3HNTH 1CICD 4HK0A 1DO6A 1IGIL 2B77A 4M8RA 1TFPA 2GSGA 1JUFA 2GCYA 1A6UH 1LD9B 4PJXE 2FTAA 4X9FA 2H41A 4FMVA 4BSVB 2X4UA 3GIVA 4N25A 4AGNA 4EXKA 1OW0A 2G5RA 3TFKD 3DJ9A 3H56A 3SQOH 2PTTA 3IDJA 3HS8A 1AGFA 5D7JA 3CZFA 4ZO9A 3D2UD 1K2DB 4MMXA 3PCYA 5ESVA 1A6TB 4FNQA 1CYGA 2JCCF 1WAAF 1MDAA 2FO4B 2H32B 4YPGB 4JVWA 1S9WB 4L5FE 2WWMC 4HA1A 1ZLUH 4AKOA 3V0IA 4NKOB 4TNWK 1IQWL 4L1BA 4G7YL 5I24A 5L2JB 1OP5K 1B88A 5F7EH 5FO9B 1JD9A 4OIIL 5I18L 4ZTOL 2YOAA 3GI9H 4AIXA 4AMXA 5BVPL 4NYLB 1IQDB 1XV8A 2YK1L 2ENSA 4PJ9D 5LCVH 1FAIL 2A6IB 3ARZA 4PY7A 5DMIL 5AW0B 1OGPA 4GFTB 4M62H 1D9KD 4NS0A 4PS4H 1E9PB 1A6AA 5F9JA 3LZFH 3MCKA 1RI8A 4I2XE 1KCRL 4L8DA 4PJ7F 4XT1C 5E7FA 5B38B 5IQMA 2CK2A 1ZTXL 3Q2WA 4LRIA 2EE0A 2K1MA 3LV3B 5IVXE 3P4NB 2ZUXA 3F6IA 2HFFA 3ZE0F 4X5XA 1FZOA 2P5WE 3BUQA 5DWUL 4FTVD 1C08A 3HC0A 3LXCA 4GEIA 4ZX5A 4LCWB 2EC8A 1DQML 4H20L 4Y7MA 4DETA 4DTGL 1TJMA 4G3YH 2I9TB 3OD3A 4QTIL 1AQHA 5EULV 4X83A 3UBXB 2NY0C 4KQ3H 3TWCH 5KTEH 4AIZA 5GGTA 3O41A 4PGZA 1GC1C 2H0JA 2VKWA 4I87A 4M9OA 3ZUCA 5GSRB 4APXA 3ILDA 3SE8L 3T2NH 1XCQB 2FX8H 2HRGA 1YUHB 3FB6B 3GSNB 2PXYD 2DI8A 3MRCB 3FQUB 3JWDC 5I5JA 5ES4B 1QRKA 1P1ZA 1YEIH 1ZAGA 2ZAHA 4JY4A 3SCMA 1FNAA 3Q1SL 5CNHA 2A83A 1Q72L 5EDXA 1R5VB 2Q3AA 4J6RL 1CR9L 2LABA 3RUGB 3FQTB 5KSVA 4GJTB 3PRZA 3SZKC 2OKMA 4RLDA 5F7DA 5E51A 5IBLC 2YN5A 4PUBH 4LIQL 2GJZA 1U2CA 2BIMA 2LQRA 3MV7E 4YGVB 3TCLB 4N2LA 3QRLA 4PJXA 3GQFA 3G6AA 3WXVL 1G94A 3CV5A 2FEDD 3Q8EA 4O9HL 3WDHA 1LE9A 4DQAA 1F58L 4NHUA 3WBDA 2X1WL 1A4KB 4YAQB 3T2PA 1J5OL 4H1LH 3WMPA 3TA3B 4ZTPL 4WZ9A 1D2OA 3POCA 5I1HH 4UYPA 3BEWB 4K3EL 5F89B 2AK4D 2Q7YB 4KHXL 5B4MD 4HIPA 4R6UA 3L95B 4UT9A 3VDAA 4AYID 3N42F 5C6TH 2AANA 2QGBA 1M6UA 1M7IB 1TU2A 1UJ3C 4H7VA 2OMNA 4NJAL 2C3XA 5IK3A 5IV2B 1UQSA 2CO2A 1FZKA 3KEDA 3TXAA 2IGTA 4BFRA 4ESKA 1ACYL 1AVAA 1WFTA 3D05A 4N87A 3DX8B 3IGLA 4AJ0A 2GK0B 4D0CB 3EIFA 4EDWL 1TF4A 2W94A 4IJ3B 1NANI 1CF8H 4I2XA 2CRZA 5GGSB 1XF2B 3T2OA 4HJ0D 1NGXA 1JI2A 3MC0A 3QO1A 1BWWA 1HVXA 1PCXA 4AEIH 2XIIA 1BZ7A 4P9HC 1XCWA 1YEJL 3N91A 4MJ4A 5E2JA 5F7NC 3B83A 3DNKA 4FFZL 5DZNA 5DJ2A 2Y07H 2WVSA 2Y36L 3GINA 1SBSL 4YDLB 3TT1L 4AQ8A 4MD4A 1CD0A 3GSQB 1DUYB 3P02A 1N64L 4HUWB 4N9OB 3FT3A 3VA6A 4XXDB 4ZI8A 2R2BB 3WNMA 2DMGA 4TVPH 4P5TA 2YAPA 3UYRH 2Z93A 3MACL 4KRPD 4E42B 5E6YA 2IH8A 5ISZE 4AV0A 4MA3A 5T1DL 3T3ME 1TXKA 5AVVB 4OB5H 2QV2A 3FF7A 5K69A 4AVIA 3DURA 2OTUB 3O9WC 1BZ8A 4FOMA 2KHAA 1E4KA 3BZ4B 1Z9NA 2WXQA 4BKLA 3FFCE 1WIOA 5D5MA 1K3ZA 2ISDA 3CX5J 3BQVA 4K3GA 4MDIB 4F2FA 4LNRA 3WSQL 3GMLB 1J8HB 2FSEB 3LXBA 4ZX6A 2IF7A 4K23L 1F4HA 4V1DD 2X2IA 1EHLL 5G4OA 2VDML 3RTQA 3VB8A 1M6OA 4Y2OA 4LSRH 2J5LB 1KCVL 2AJUL 4HCRA 3VXUB 2VR4A 1P53A 2DH2A 4P4KB 3CZNA 5E4EC 5C7XH 1HHKB 4UM8A 1EH9A 3EADA 2PCYA 4JFFD 3SCMD 4PIBA 4Y19E 5GRVK 3CFJB 3L2NA 1LDPL 2J21A 5F6HI 2HRPH 4JW3A 3E6HA 1JXJA 2H47C 4JM2F 2UY7A 3AREC 4Z3FA 2HWZL 2PCPA 2X87A 4YBQC 3D6GA 1T1YB 2BP0A 1CFNA 2F68X 2QKSA 3AS2A 4PSPA 4PJFE 2V37A 3HZVB 5EN2A 4LGPB 1IVTA 5CBEA 1LQBC 3PWVA 3ZO0A 2FQEA 3D39E 1AHWB 1KB3A 1ZRUA 2GHWB 2XBTA 3C75A 4LLVA 4X0KB 4M6NL 5EU7C 3TF7C 1C1EL 1OAUH 3C5ZC 3LEVL 3O6LH 5I19L 1A1OA 1BFTA 5DFAA 1I7TA 3PNWB 2YMXH 3GRWL 1A21A 1RZFL 3A23A 5GGQL 2QSVA 4PRHB 4LL1A 5SX5H 1PG7X 1TCMA 2H2PC 3CVCA 4FL4C 4PLNC 3CN1A 1I1RA 3KWVA 2NY5H 2YA0A 1XF3B 4QYOB 3O45A 1L6PA 1SQMA 1MWAH 4HP5A 4K7FA 2OL3H 4OUOA 3ZL4H 2PWHA 5JQ6L 4L1TA 3HAEG 3IMSA 4QRPB 4GAYB 3RJOA 5EF1A 1GHFH 1LO0H 4U2ZA 4ONFH 4QO1A 3ZY7A 2YEVB 1GH7A 1OK0A 1NOLA 2VN6A 4D2NA 1X6LA 3C9NA 3NSYA 4I4WB 4CC0A 2DL9A 2UWEF 5KBNC 4XNBA 5CCJA 5E24E 1KCUL 4OZFH 3C2AH 5JIQA 2ED9A 4FNLH 2FJGB 1OAQL 3WFBL 1E2ZA 2R1YA 5TFSL 5DYOB 1I75A 5AAWC 4MWFB 4FQXB 4DP4X 5E70A 2BFVH 4CNIB 4FZ8L 1ADQA 1S9XB 2WWMD 2AJVH 4P2OD 4X0NA 4YNYA 3ML9A 5CZXC 2ZG1A 4JM2C 1DBKL 4HSQA 4XO4A 5EC2A 5HI3D 5I66A 4MD0A 3HTLX 1BIIB 4EN2A 2F08A 5JHMA 1HILA 3NCYS 2WQAA 3DBSA 3UAEA 3FFCA 1ETA1 1NIAA 1OP3H 3QQ3B 4UQDA 3U36B 2EEDA 4MBRA 2A9ML 4JANB 3NAAH 4AUJA 5CP3H 2VO8A 4X8JB 3G9VA 2YEZA 3KJ6L 1F86A 3FTUA 1G7LB 1J1OH 3D51A 1OAYL 4P5TD 3VFVB 2CBOA 4KXAA 4BFBD 2GTWB 3MOBH 1JGIA 1JGUL 5KOVC 3P4OB 5KSUA 3KGSA 2ZKHL 2CPUA 2AEOA 2V17L 1WS7A 1WHOA 3CWGA 5JIMA 3UEQA 4NQCA 3TTSA 4K8RC 3G6JE 3F62A 3PGDA 2NUPA 2X6BA 4NDMA 3N85L 5GRUH 2MCAA 4LLQB 3GS0A 4Y19A 3VWJC 3VXNA 1SHMA 2H6UA 5C07B 1ZGLP 3I6LD 3L6FA 5K9QI 4IHBA 3NOIA 5F8QC 1QNIA 3U6XA 3WIHH 2ESVE 5LXGH 3DRQB 1JRHI 1QVOA 3KPRE 1E5YA 5EEXA 4OSUL 3FU6A 1E3ZA 3GK8L 1RPUA 4LEBA 5LHDA 2IALB 2OMUA 2Q76A 2AERT 3C8HA 4KTYA 3D07A 5DRWA 4LLAA 5CLWA 2CLZA 4KKZA 3DVNA 2YLKA 4B9KC 1DE4A 4PRID 1JGLL 1J9QA 3WU1A 1K5WA 1X7TA 3RDTC 2DKSA 4BQ9A 1CI3M 2ZOUA 1DBBH 3T4AA 4LQFL 2B14A 3P3RA 3RWCA 5EO1B 2GY5A 5J8OA 2CRIA 2A4CA 1DQDL 4P5KB 1QFPA 2M83A 5EUKB 1FGVH 5GGVL 1AR1C 2EP6A 1TSRA 1N26A 3R06B 1FYTB 2VRKA 3UTSA 4F8QA 1RFDL 5DJAA 3CFBA 2QQLL 2OW7A 5ALCL 2X4RA 4YDJB 43CAA 2P4AB 4QDGA 4YZFE 4N68A 5ESQB 4ODTL 4OD1L 1IAIL 2DMBA 1NEUA 2SEBB 3H53A 3BVVA 5ENWB 1XZ0A 1YQVH 2KT6A 2YPVA 3O3AA 4GG8A 4IBQA 1A1NA 2IQ9L 3FT0A 5SX4H 2GC7C 4L8CB 1N0XH 2ZXGA 5E8PA 4G11A 1BXXA 1TUPA 4AH2B 4EUPB 5I0ZA 4DVRL 3UTPE 4AYGA 1JERA 4N0UB 1NI0A 2KLRA 1JPGB 1ZT1B 3CK0H 3Q1EA 4G7VL 4P04A 1BPVA 1W0WB 3JZ7A 4QHUA 1GMEA 2ADIA 2ITCA 3CDFA 2FYYB 5JUEH 4U1KA 1HSAA 4XC3L 5E5MA 2DIEA 5HGAA 3OX8A 2E7LA 4RSYA 5I6LA 4NZUH 1XDTT 2Q9OA 1HXYB 2X2HA 3UDWA 4LSVL 4WO0A 4AC4A 3HNTL 1ZV5A 5FKPB 3P9MB 3G6JA 3F7LA 4HCFA 5J3HD 2A0LC 2X4TA 4M02A 2B59A 2BP5M 5TJWK 1A6UL 4AENA 2P5ED 4YHLH 5GRYA 4IU3B 5IOPB 5I8EB 5DVPA 2OW6A 3KWWA 4UOW0 3SQOL 1R3KB 1U58B 1I7UA 3SKMB 3WN5A 2FWUA 2WNGA 1HNGA 2DAVA 3C6SA 5IWLA 2NNAB 4MB4A 1SXZA 2EDHA 2IC2A 3A0OA 4S0TD 1A6ZA 4FYQA 3BD5A 3UG3A 3RA7H 3MRDB 3DJTA 1B2YA 4NQCD 4PWFA 3ZKQD 2XXMB 1HEZB 3CN3A 3QUKB 5F7EL 5EZLB 4HETA 5F6IC 4H13C 3FN3A 3GI9L 1IFGA 1NMBH 2BO0A 2P45B 4QRUB 5LCVL 3M17A 5GGRY 5IJVB 1JZGA 2XN9E 1AGEA 1FP5A 1WAEA 1MHPH 3HRZB 4W6YB 2XU9A 3WHE1 4M62L 5EZOH 4PS4L 1CI5A 2YKKA 3MJ6A 3HZMA 5KJ4A 3Q3GA 2DB8A 1P84K 1SQ2N 5EU3A 3LZFL 3QDGE 5IEKB 1EBAA 1YMHA 2B1OA 4YDMA 2EZ0D 5D6DC 1X6NA 2UWEA 3S8GB 1CXKA 5MI0B 3ULVE 1VERA 2WYIA 1T3FB 4RAUB 1DJSA 2PPFA 3K46A 1LE5B 4JO3H 4XVSH 3KXFA 1U3HC 3X3FH 3IJ7A 4Z23A 1EAOA 3KPSE 2IPUK 1TQBB 3RL1A 1OF2A 5JPNB 4N85A 1BAWA 2K4WA 3DVFA 1FVCB 5B1KA 4G3YL 1KWKA 3C8KB 4W4NA 5IQ9B 4PCTA 2VDNH 2HFGH 3EJCA 2FNBA 3E7JA 4KQ3L 3TWCL 1RJYB 2MSPA 3EDJA 3F8UB 5FYJE 3ZL1A 5BJTB 5KTEL 4AT6B 2HJKA 1UWFA 4R0LB 2MNWA 4ZODA 5CEZH 3DXAD 3T2NL 4XMLH 2FX8L 4KJPC 5HGHB 1KCWA 4PJGF 1FG2B 4JK0D 4NUGH 4XP9H 1YEIL 4OCLC 4F3FA 5HYFA 5HHME 4AGLA 5DZLA 4HLZG 2UZIH 3FAWA 5AKVA 1R3HA 1IAOA 4KMLB 1F2XK 4Y5YC 3T8VA 4U1IB 4U0RC 3II3A 3RZCC 5AW5B 4PUBL 4TLSA 2QDVA 5CGYD 4JPKH 1KYOK 1UJ3B 1VAHA 2RGSA 5C86A 3PQYB 4XO5A 4QRSB 5ANMA 1MELA 1AQ8A 1ESOA 2YD8A 4HUUA 3AB0C 4ZT1A 1CTOA 3S6CA 4YHPB 4FG0A 4RGNE 1TTGA 2JV6A 1J9RA 1T0MB 2HT2C 3DETC 5SWSE 5I1HL 1RKRA 3H0TA 1JDAA 1U8CA 3TEYA 3GGWA 5C6TL 4PGDB 1EZSA 2AQ3A 4Y9CA 1CFMA 4OZHF 3RZWA 3G5ZA 4DPAX 4JM2D 4TL5A 1IM3B 2Y5QA 2DWDB 3ZMNA 3U9UB 3TASA 5I75C 3UPAA 2V7NB 5F21B 1FFRA 3B1UA 1H5BA 4Z7AA 3D12B 3IVKB 4DK6A 2YSSB 4UQ3B 3MDJA 3Q7JA 3TZVA 4GY4A 3SDYH 1CF8L 1OWWA 4XTRD 5IVZA 2WTRA 5C0AB 1O5PA 2J8HA 1LNUB 4AEIL 3CZSA 4KXZH 2DTMH 3I6KB 2QMKA 2D0FA 1OSPH 3J07A 4MNGB 4Y2DC 1URZA 3LVTA 4ZFOL 2Y07L 3KPSA 3U2SA 1AZNA 3ASWA 5DHXB 2Y4SA 3O9WB 4ETYA 4Y4KA 1KPRA 3BAWA 1INQB 1R0AH 6TAAA 2I69A 1T1XA 1YEDA 3ILPB 2IMMA 5T5FH 2NTSP 4TVPL 4KK6C 3UYRL 3LZNA 4IDJH 1FL3B 3OPZH 1S5HA 5B1JA 5BRZB 3D25A 4RETB 2FO8A 4L8SB 3PWPA 4PEEA 4OFYD 5E6IB 3KXFD 4OB5L 3ECQA 2ZCKH 4O51A 3HOGA 3VD2A 5HHVH 4FCHA 4F8PA 2LOEA 5D1XA 3RDTD 5C9KA 3KLQA 1D2PA 2FEJA 3QULA 4G7RB 1A8ZA 5CF3A 2Q10A 2FL5A 1F42A 4X6DE 1KZYA 1WZKA 3MLZH 4H8HA 5PCYA 2BMKB 2ZX5A 3DUHA 4HAFA 5SWZD 1WZLA 2FYVA 2ZUQB 2YGNA 1Z9SB 3HLAB 4LSRL 3VI3B 5EU4B 5C7XL 4MNHA 2OTWA 3GI8H 2WLZA 3WEMA 5I1CH 1D5ZB 5SWSA 2CBTA 4L4TB 5JLZB 2HRPL 4I1PA 3VXSE 5IM7B 3JVGC 4NN5C 2NUTA 5L2KB 1YEFH 2CE6A 3NA4A 1EO5A 5GS0D 1INDH 4Y1AD 4ZMTA 2VZ1A 3R8BB 5IEHA 3C12A 1NM9A 4ZXBB 3VGGA 4D0BB 2XNAA 2FX9H 1OAUL 3O6LL 3DPDA 1A14H 4MXVF 2YMXL 4Z0BH 3S7GA 3BVUA 4P2RA 4OGZA 4ZW3A 4GH7B 4H26B 1TOXA 4J3WA 2VITA 1X5AA 5F93C 1NPUA 3RY5A 2NY5L 3ZDXB 3O3DB 2C1OB 1MWAL 2Z4TA 3NFNA 2OL3L 3ZL4L 4NSKA 5DRNA 2X4NA 3EHBC 3UCQA 1GHFL 1LO0L 5HD8C 4ONFL 1NZRA 3PREA 1BMZA 4RSVA 3PY9A 3SGJC 5AW9B 1MJUH 4R5VA 4XMZA 3PGFH 1S7TA 2YUZA 2LAGB 3MLUH 3UJJH 2B16A 2E6PA 3W9DB 1OTTD 3C2AL 1JZIA 4FNLL 1GS6X 4Z3IA 1B3IA 1U93B 1S7QB 3IE4A 3QUXA 4FQQB 3V5DB 4LCVA 2BS9A 1HESA 3LPOA 4XOEA 3H9SE 4FHBD 2WB7A 4ZSOB 3DUSB 2BFVL 2QSQA 4IBYA 2AJVL 3MRBA 3KHQA 3MUGB 2X6MA 4PJGA 4BE5A 1EFXA 3SDCC 5D7LB 2YGOA 2NYKA 2BVEA 4O2FA 5CLYA 1FA4A 5EIQA 3OJMB 5J7CC 4M61B 5ETUB 1J0HA 3GLZA 4RRPM 4Y4KD 5F9WB 1YEGH 3VWJB 2DZEA 3IDNA 3NAAL 2DRUA 2ZNWA 4PWHA 4X6DA 5FO8B 2WO4A 3K71B 3O8XA 1AMYA 1J11A 4NRXA 1SJXA 3K6SA 5FYKD 4PCKA 1TCRB 4R96A 1J1OL 5EOCJ 2PO6C 3C60B 4TSCH 3MOBL 4S2SB 2EDLA 4Z7QB 4Q9CA 3PWPD 4EI0A 3D06A 1CDBA 4X4KA 4KJYB 1JF1A 5GRUL 5AB1A 2H45A 3DPBB 2C34A 2EKSB 5D1XD 3B5TA 1TZGH 3VXSA 3WUWG 4KDVA 1DJIA 1QPKA 3WIHL 1PZ5A 5LXGL 1HL9A 4OZHA 1SOKA 5EIIG 2MJWA 3CVHH 3QS2A 2DQTH 3SOBH 3BVNA 1IUZA 4WNQB 1G6RA 3QE5A 5CGMA 3AU1A 4KQ4H 1K72A 4LPYA 5HY9A 3WIAA 4ZO6A 3GMNA 3UJIH 3IKCB 2ZAIA 1XH1A 1AR1B 2BSSA 1FO0B 4V2BA 3FB7A 5J06A 1RK1B 1ZVSB 3OAWA 3WTYA 1DBBL 5MEQB 1A7RH 5TQ2H 4IQHA 4JFXB 4U49A 2DIBA 1MHEA 3V6BR 1P6WA 3CHRA 4R4FH 4P2QE 3FSVA 3QNYA 4I7ZC 4BQCA 4Z77A 1F8TH 1FGVL 3ZKMC 5BUPA 1HH6A 2ZTBA 1CGYA 4P2RD 1WCQA 4U7KA 2IGFH 3UABA 2ZF9A 4AG4H 1AD9B 3AS1A 5IG7A 1LP9E 3QXDB 2BOBB 3FPYA 3U9PH 1AZBA 2UYLA 1XGRA 4GKNB 4K94H 2I9LB 5AW4B 1EGJA 2IADA 5EIIA 3D08A 4M5YH 3MV9E 4HKBB 3H9SA 1YQVL 2AW2A 1Q9WB 4HOMA 2VW4A 4G9FB 1N0XL 1RHFA 3CFEA 3BH9A 3W39A 5DUPH 2AITA 4C56A 2CIIA 4BWWA 1CE6A 4GQ9H 3IN2A 5CZRA 3PWNA 1N5YH 3CK0L 2DLGA 2R0LH 3LKSA 1AJ7H 4N9GA 5DHMC 3WDIA 4KZDH 2GB2A 2DWYA 2I07B 4KMQA 5JUEL 3QUXD 2BIQA 4NPYB 4G80B 1DQIA 4KJWD 3NZSA 4N5ED 5JHLA 5MENB 4NKMB 4NZUL 3MODH 1LVEA 1CCZA 2ZXAA 4QF1A 3ZUNC 4H0HB 1J05B 1AGBB 1XAKA 4DIXA 5DK0A 4D7PA 1TIUA 3VXMB 3E2HC 3BKJH 2KPNA 3IPEA 4LB8A 3MFFB 2NTFA 2ZUSA 4YHLL 1A25A 5CEXA 3N9GH 5F6IB 2Y1AA 3BESR 4KKCC 2BP8A 4ACTA 4M5TA 3C5XA 4N28A 1MCDA 3BN9C 1JVKA 1MFEH 3ZE1F 2YAOA 1SLXA 2ITDA 3RUGF 3D69B 4PV8B 5EOTA 3DHPA 3RA7L 1AOZA 4MJ5A 2FCBA 3NZ8B 4DW2H 2R7EA 1A4JB 2WUCH 1PZ2A 3VVWA 3Q06A 1PVIA 1I1AA 1S7VA 1UD3A 1MI5B 3FPXA 2FGZA 3Q43A 4NCC1 5CKGA 1ETJA 4MA8H 3SPVB 2IDCA 2P49B 2G9KA 1NMBL 2W60A 3AMKA 3ARXA 5TDNB 1I7ZA 1MHPL 3GSUA 1L9OA 1U3HB 3A4EA 2KERA 5EZOL 1PG7H 4HYTB 3VSUA 3UYOD 1DUZA 2UZXB 4OU3A 1EHAA 4P2QA 2WIIA 4PJEF 3TH2T 1JRHH 1DVTA 1JIBA 4NCDA 1MCWW 1RERA 2OZNA 4G72B 5FV2A 3FT2B 1DQJA 1HCFX 4PM1A 3MZGB 3H9HA 4DGVH 3BP4A 4I89A 4HKXB 1FFQA 1NGYB 3BHBA 4HALA 4JO3L 4XVSL 5IZ7A 4S1QH 1OM9A 3X3FL 1PAMA 3MJGX 5H37H 2ZOKB 4K4KA 3MV9A 1S7UA 8CGTA 4WWOA 3TIDB 4C83B 5ID0B 3S36X 3MOQA 2AXGA 2VDNL 2HFGL 3LY6A 4KTGA 1QSZA 3BP6B 3GDCA 5DTFB 4I9XA 4EZMA 4PS8A 4QHNB 4ERSH 2Q3XA 3ZT7A 1ZLDA 1LTXA 5CEZL 4LMQE 1KJ2B 4XMLL 3AU0A 4ODUA 3U4AA 1BM7A 3RZCB 3CSYA 5EN3A 1MVUA 2Y1YA 5CMAA 1JXKA 1YY9C 4OM1H 2Y72A 4UT6H 2W0FA 4NUGL 4WW2C 4XP9L 4L3EB 4JG5A 3CMOH 4W68A 4XN5A 5DA0B 4NO5A 3QUZC 2VLRE 3AB0B 2UZIL 3Q5OA 5GRVL 1QZ1A 1ECYA 3FUIA 4WI6A 5A2LH 1N8ZA 4XBMA 4G6JH 3FAXA 1F4AA 4C56D 1XSKA 1EDQA 3T77A 1XR9B 3TBSB 3IMRA 1FZJA 1JZ3A 3EHBD 4GT0A 3HW7A 3H3PH 3NJJA 2YFNA 3HN5A 1R5WB 1S7WB 5HD8D 4JPKL 2V2TA 1CDYA 4GBXA 1KIQA 4DHLA 2A73B 4BK5C 3EO1B 5I75B 4PREB 1XIWA 3F83A 4PGEA 4I0PB 5C2UB 2J5WA 2ADGA 1JWUA 3CSTA 2AHIA 4XCFH 2GPZA 4U05A 3NCYP 2C1PB 3QUHA 5E94B 1GY1A 1LD9A 4OF7A 3OLEA 4BSVA 1FORH 2A2QT 4GRLB 5INDB 3FT1A 5MHSD 2F7PA 1L6ZA 3K8LA 2IH1B 3RFZC 1KZQA 1K2DA 3AT8A 1A6TA 3OG4B 4YPGA 2H32A 2FO4A 2Z31C 4Y2DB 1S9WA 3IFNH 1BCIA 4XN9A 4NKOA 2QGDA 1Q0XH 3SDYL 5L2JA 2MWCA 1THCA 4DESA 2PO6D 2JJTA 5FO9A 2CH8A 3TT3H 5KAQF 1OM3H 5AW8B 1KGWA 2VR9A 2IANE 2ZCLH 1NGQH 4N6QA 4NYLA 2DTML 1IQDA 5JIDA 4OJCA 4EN3B 2A6IA 1OSPL 3PIQB 5B39G 5BO1H 1CQKA 4OLXH 3UACA 3ULVH 1E9PA 3GXIA 3T8XB 3LRGA 4F8NA 5B38A 1R0AL 4C47A 1RZ8B 5DURB 1DQTA 1DL7H 1TTRA 3GXTA 3LV3A 3MRPB 3P4NA 4MJ6B 1HOEA 2ZX7A 4NN6B 5GSVB 5FEBA 5I6NA 2WSKA 4L9LC 5T5FL 4DO4A 5JW3H 4IDJL 4XBEH 5CHNB 2PVIA 3OPZL 3SJVB 4LCWA 1HKFA 1UKSA 2YRLA 3KLAB 3BX7C 3T0EB 3QUMB 4L23A 4QIRA 4ODBD 4B60A 4U6HB 2I9TA 2ZCKL 2C3GA 5HHVL 2CJ3A 3BT0A 5TTRA 3T0WA 2RACA 3UBXA 3LH2H 1WGOA 4WW1B 4LCCC 2AC0A 4N2EA 2BXZA 4U6YB 5GSRA 4WFGE 2VL5B 3MLZL 5F3BB 1G4RA 4A7SA 4FYTA 2JVUA 1XCQA 2A6KB 3CVIH 2DF3A 1LK3H 1YUHA 3BGAA 3FB6A 3GSNA 4UCFA 1MNNA 3MRCA 4CJ0A 3FQUA 5JORB 2Q2LA 2VAAB 3WCYA 5DJYB 3DHJA 3T2QA 1UHVA 2EC9U 1QLEB 2I7OA 3GI8L 1R5VA 2Q7AA 5I1CL 3VDBA 3DDGA 3MJ7B 3RUGA 3FQTA 1J1XH 4KNTA 4PJDE 3B9KA 3GMQB 3QG6B 4HWBA 1YEFL 5FXCH 2VZVA 2ZYIA 2JKJA 3P1VA 1AC0A 4YGVA 3VFPB 3H1ZA 3TCLA 3W11D 3HBGA 5JYLA 1INDL 2J1ZA 3L7FB 4PPTA 5I74C 4E68A 2YQ3A 2K8QA 1A4KA 2ICEC 3L9YA 1BQLH 4GBXD 5ICYB 4OVUA 4XE5B 2FX9L 3TA3A 4A63A 4BFFA 1A14L 4Z0BL 1XIWD 3LZOA 4KKQA 5DQJB 3BEWA 5F89A 2DTSA 2Q7YA 3AG3B 3L95A 3IF1B 4XNDA 2QPSA 4RWHA 3QZNA 4J4PA 3IT8D 4F9LA 3QARA 1M7IA 3AY4A 4PJAB 4PJHB 3TEUA 1NCCH 1RIHH 3WEBA 1ODUA 5IV2A 3ULUC 2Q86B 3WNPA 1XGUB 3L4UA 3RI5K 3QNZB 1U33A 2OZ4H 3NCBB 1PCSA 2VDPH 4TLUA 3DX8A 2GK0A 2WBJC 4CBPA 1Q0YH 4D0CA 3BC9A 1UGKA 2AXWA 4NO0D 3L3IB 5DT1H 3SDCB 5E5RB 1MJUL 2IQAB 5GGSA 3PGFL 1XF2A 3ARRA 1YNKH 3NCWA 4XVTH 1J0KA 3MLUL 4M7ZC 3UJJL 3VG9C 4I3SH 1NFKA 4Q2ZB 1QTYT 4L3FA 1UKTA 2W5PA 4U1HB 1JOIA 2OQJB 4XXWC 2E76C 5JW4R 3DRTA 4QRPE 4AUUA 3W81A 2VWEC 3CBKB 5T3XH 5IHWA 4FG4A 5IQNA 1H8OA 4KKBD 4JN2B 3G3LA 1M42A 3ETTA 2N1KA 4NNXB 2DQHH 4HGKC 3GSQA 1U8JB 1DUYA 4YK4B 2HLAB 3JWOH 5FM5M 3LNFA 3ZIMA 4HUWA 4OZGF 1IO4C 4XXDA 2R2BA 5H2BB 1YEGL 4OKVB 4IMLB 2P8MB 4ELDA 2J57A 1MAMH 2WSPA 3LIUA 4E42A 4F8OA 5KAQG 3V6OC 4TSCL 3GB7B 3V4UH 2R0ZH 4P49A 4LCWD 4NQQA 3T3PB 3W56A 3CLWA 2GQHA 2OTUA 5CJXC 3PDOB 3BZ4A 3EFOB 3RJQB 2IBBA 4MDIA 1XGZA 3F84A 5A7EA 3L1FA 3BZFB 3GMLA 3VMOA 1J8HA 3OLIA 4R9HA 2NCMA 2FSEA 3K2IA 1TZGL 3O4OC 1N5AB 3RX8A 2BX5A 3E1ZA 2JELH 2WTOA 1USZA 2QFPA 1G7HB 3TBTB 4BZ2H 1HINH 4LRNH 3LKOB 4F15B 1ILSA 1FBIH 4GFXA 4N0CD 3VXUA 4Z7VB 3CVHL 4P4KA 4H2AA 4P2CG 4W1TA 4Z0XB 2BY3A 2DQTL 2FLBT 3SOBL 4ABUA 1HHKA 4Z7WF 1QBLL 1IJ9A 2F61A 5B3JE 3QJUB 3CFJA 4KQ4L 3VXOB 2HP4A 3ABLB 5HYIA 3D4ZA 3UJIL 1YNTB 1T04B 3K6FA 2PWEA 1XWVA 1MXGA 4LSTH 3B9KD 5K1NA 1T1YA 2K70A 3VXRB 2H2SC 3O4LB 3HZVA 2YJLA 2JJSA 1AHWA 2BY2A 1A7RL 3SGKA 4X0KA 3QRBA 5TQ2L 2QJDA 1C7TA 2R0WH 3CQFA 4F20A 2KZBA 5T1JA 4Y4HC 4R4FL 1I8KB 4N2GA 1NPJA 5IFHH 1F8TL 2IXQB 4HJGB 1BV8A 4RX4A 4PRHA 5J1AB 2CHZA 3GJFH 2IGFL 3WS6C 1XF3A 4QYOA 4A37A 4AG4L 3UIZA 1E6OH 4H44C 5K5YA 3U9PL 4K94L 5B1AB 3DGDA 1A0QH 2XSKA 3GSRB 4M5YL 1LO2H 4QRPA 4GAYA 1OTSD 4JHUA 5AVQB 1ZIAA 1WITA 2MOGA 3EJYC 3Q5TA 5EU6D 1BF2A 1DZBA 1FYTE 2G4GA 4I4WA 2Q8BH 5DUPL 1UD8A 4KNSA 1XB6A 2VDRB 4GQ9L 5HDRA 2QPEB 2FJGA 1N5YL 2R0LL 3DI3B 2BNRE 4X7FC 1UUSA 4NM4H 4AYBA 1AJ7L 5D1QC 3DIVA 5DYOA 1RK0B 4MWFA 2VERN 4FQXA 4OCWH 4RFEA 4DKDC 4KZDL 4EF3A 1EJFA 4CNIA 1S9XA 3KLLA 3CHPA 4JFED 2VR3A 2LR4A 3ZTJG 2EVHA 2XQYK 6PAZA 5FO2A 1BIIA 4FCAA 3MODL 5DVOA 3QQ3A 3U36A 2H9GB 4K3JH 1EQWA 4GP5B 1P4UA 3RWFB 3BKJL 4X8JA 3RNKB 1FFPA 5A2KH 2BVQB 1G7LA 3N9GL 4ANKA 3VFVA 5M7QA 2V3FA 2GTWA 3TVMC 7FABH 4XMPH 3WY1A 3P4OA 3U4BH 3ZYIA 2YN3A 3CSPA 3L5HA 2HTLC 1MFEL 1E7VA 3SBWC 2NY1C 2JTYA 4XGZB 3TYFB 3L4YA 5DQDH 5K39A 4LLQA 4UV7H 3G5YB 5C07A 3VCLB 2IDUA 3U83A 4DW2L 2WUCL 3TJHD 3MUHL 4HOWA 1EEQA 1J8HD 3QW9A 4MA8L 5FF6B 2EILB 1ZXQA 5DO2C 5CAYB 4WSJA 1JYWA 2DYRB 1VJSA 2AXFB 3DRQA 2V5MA 1RH8A 4KROB 2VOTA 3T6VA 4MD5B 2IALA 1SOSA 4UWQB 3VXUD 5KZCD 2R69H 1PG7L 4P4KD 4U4BA 2Y25A 2CDEB 4HGWB 5BW7C 3W0WE 1M53A 4KH2A 3VFRB 4JPSA 5DRZB 4OZ4B 5IROC 1JRHL 2HSIA 3ABKB 1VFAB 3NABH 1UZ6E 4MNQD 3PL6C 4XAKE 4HKZB 1F3JB 4IYKA 4DGVL 5CUSH 3CU1A 5EO1A 2WM0A 3PAYA 2UXGA 4S1QL 4H2CA 2WQ8A 4P5KA 5F9DC 5I6XB 5EUOF 2PMZA 4XWOC 4FAAB 2DWXA 5EUKA 4M29A 3BZ5A 4J27A 3H9YA 3RL2B 4JRYB 4MJIE 3R06A 2N7AA 2VSCA 1FYTA 2XWBB 5ID1B 4X4ZA 4OLVH 4PRHD 1BQUA 3WLWC 2JMRA 4OIBA 4OZGA 4YDJA 3JTBA 4ERSL 1MREH 4XP6H 1BF8A 3WNIA 2YHGA 5ESQA 2JKWA 3QXWA 4PRIE 3QJSB 3BJ91 5C97A 2SEBA 3STBA 4JZJC 1AZVA 3ZQWA 5ENWA 5IUSA 3VFMB 4OM1L 4UT6L 1OOAA 3AS3A 4JHZA 2YEQA 3CMOL 2QADB 5T1LD 5E1AB 5TDPB 3UFIA 4F2EA 5IOKA 4EIZC 2HLEB 4AH2A 3IGAB 4MVBC 4EUPA 4CILA 3F00A 2YPLD 2X38A 5CXPA 4N0UA 3GD1C 1JPGA 1ZT1A 3PG2A 1I82A 2NLJB 4G6JL 1QI3A 5KYNA 1W0WA 1WLHA 5F7YC 2OFQA 2XHNA 4QTHB 3H3PL 2FYYA 3LN4B 5GQBA 1R33A 4DP9X 1CO1A 4JKWA 3FL7A 2P52A 1AYRA 1FV1B 4Z5RB 1HCZA 2C9UA 4G8GD 1MY5A 3JUYA 3ESVF 1HXYA 2Y7LA 1MAKA 4OF3A 4PJIF 4XCFL 2Z31B 5DJ8B 5FKPA 3P9MA 4K5LA 4XO9A 2GBAA 5HVGB 3MLSH 4ENZA 3ZTCC 4J1UB 2PABA 4Q97A 1HS6A 1FORL 1YEWA 2WNWA 4IU3A 5I8EA 5IOPA 5CBAB 1MWOA 4HCGA 4AYSA 1R3KA 1U58A 3GMMB 3SKMA 3VH8G 1DQVA 1N18A 2NNAA 1JE6A 4HUXB 5AD0B 4FXTA 5T5NF 2WZ6A 1PSKH 5EV7A 5FA4B 1T03H 3ABGA 3IFNL 3MRDA 3LHPH 3U7YH 4F1ZA 1Q0XL 2XN2A 1HEZA 1IKOP 3QUKA 4YC2B 1GKEA 3O6MH 4GIOA 5EZLA 4GMSH 3FU8A 3IJEA 3L16A 1EPFA 5C07D 1OM3L 3TT3L 1KXTB 2NY6C 2ZCLL 4PMEA 5BQ7B 1NGQL 4NZDA 4QRUA 2BFGA 2V5YA 3BUYB 3HG1B 4L9LB 5IJVA 2WP3O 3HRZA 2YUVA 3TNMB 4ANXA 2X1PA 5BO1L 4OLXL 3FUMA 3ULVL 2P24B 2Q6WB 4R84A 1HE8A 5E9DD 1PLBA 1SXCA 3HPLB 5C0AE 5IEKA 1J10A 2WXKA 3GSWB 4K73A 4W9IC 1DL7L 3D0VB 3KS0H 4Z7UB 4GO6B 2G0KA 1T3FA 4RAUA 3OHXB 4ORGB 5T3ZE 3DO4A 1LE5A 4DP8X 5JW3L 3ECBB 4MNGE 4XBEL 5DHVB 2NXYB 1AHKA 2QHRH 5C0BB 5HJ3B 5JHDB 1OAJA 1G0YR 3W5MA 5JPNA 4U6TA 3ETBF 1B90A 1FVCA 4N8PA 3OPUA 3C8KA 5IQ9A 3BQUB 3T5WA 2Z65C 4IGBC 5BJTA 4NAQA 4Y16C 2H2SD 2F0CA 3LH2L 4TQPA 4QHPA 4AT6A 1OEZW 1ZHNB 2NX5B 2BIOA 5DZPA 4FXKB 4R0LA 2XWTB 4UQ2B 3H42H 1EO7A 5BRZE 3CVIL 1WF5A 1LK3L 1T89C 4GKOA 5HGHA 5DSCB 3C6LC 2Z7UA 5IMKB 1FG2A 2IFFH 5HVFB 5FAAA 1NTDA 4MAYC 5I74B 3PS6A 3CJJA 2PTUA 1J18A 3QH3A 1U8NB 2V3DA 4D8OA 1J1XL 2VLME 1TPXB 2QLVB 2VERA 2OV0A 4U1IA 1N70A 1FPTH 3S3SA 2OMBA 3FO1B 3UBFA 4XVUD 2E8ZA 2QTEA 3VI3E 1UJ3A 3FHAA 5FC9A 1N6QH 3PQYA 7CGTA 4QRSA 5EU7E 1PNDA 1CLOH 1BQLL 4YHPA 5D4QA 3X11B 5AYTA 1MQKH 4W9EC 1T0MA 4L4TE 5L0QB 4UV4H 2WBJB 2RH0A 3IE9A 4Q89A 4BKTC 5KSBB 2YZ1A 2ZOOA 4MHHG 2AJXH 1YLBB 4FG6D 2VN7A 5D1ZD 1T20A 2VDMB 1REIA 4PGDA 3ZDZF 5AUMB 2ZPKH 3ZRSA 1JPST 3SGEH 1NCCL 1RIHL 1IM3A 5FYJU 2DWDA 1RUPH 3U9UA 1MFVA 4ONGH 2V9RA 2V7NA 1V5JA 4Y4FC 1J0JA 4QXTB 2OZ4L 3WMQA 1BG9A 2VDPL 4G43B 3RKDC 3KVPA 3OKOB 5KANG 5BOJA 3RG1C 4URKA 1Q0YL 3IVKA 2YSSA 4UQ3A 2Y1ZA 2FH8A 2EE6A 5DT1L 2OMYB 1BX2B 3TTYA 5LDUA 4TKWA 1M7XA 3ZDXE 2DJMA 5E1GA 5KBDA 2D7NA 1YNKL 3VW3H 3IRPX 4XVTL 4I3SL 1LNUA 4UUJB 5GS2D 4B96A 1LO5B 4BSJA 3H3KA 1UWXH 3S2CA 1EERB 4ABQA 3I6KA 1QBAA 3MBEC 2K7QA 4WENB 5HHPB 3S36H 1K4CB 4MNGA 5T3XL 5BS0D 3UTTB 4DNLA 2G30A 3MYZA 4QUOA 5AENA 4XCNB 2QPUA 3O9WA 2DQHL 1INQA 3UBHA 4RESB 3JWOL 3S2AA 2AAAA 3ILPA 4HEMA 2YQ2A 3VFUB 3QCTH 3LZLA 2XWCA 1MAML 3IJSB 3L3HB 1FL3A 1WWCA 4FJYA 2FIRT 5CD5D 4J3OH 3V8OA 1EJOH 3I75B 3S0PA 3ZK0A 4L8SA 3X1FA 5E6IA 1BECA 2R0ZL 1RPKA 3V4UL 2HTKC 1B0WA 1J5IA 3EKCA 2ZP0T 3UZVB 2BSTB 3UAJC 2IDFA 5F96H 3POHA 1EXHA 2OCJA 2KDGA 4AYFB 3ARGC 5KVFH 4X9IA 3QIBC 1BFVH 4PJIA 1DN0B 2X53A 3ZHDA 1YJDC 1BD2B 2X89D 5EORH 5BQDA 1PZAA 1ICTA 4JG9A 2BMKA 3ARUA 3V4VH 2JELL 4BZ2L 1AKJB 1HINL 4LRNL 1Z9SA 2X5PA 3HLAA 1FBIL 3FRPB 3VI3A 4AVHA 4Z7QE 3HG3A 4FQPA 4R7XA 5EU4A 3DOSB 5AVTB 4GW4B 3AW5A 4JJ5B 4CW1B 4FXGB 2LU7A 1OGSA 5TDOB 5JLZA 4L4TA 2JLLA 2EXWD 5IM7A 1T7ZA 1KENH 2Z8RA 2W0KA 5L2KA 3K6NA 4LSTL 2XZCH 5FS5A 1KLGB 3MUJA 3UO8B 1NGZB 2WBKA 1BFOB 1ND0B 3O81A 4D0BA 4ZXBA 2EEBA 1KG0B 2R0WL 3PQYD 3OB8A 1J88A 1GGCH 1NBYB 4LEOB 4NKQB 3QZWB 5C70A 3ORJA 5IFHL 3MJ9H 4AE1A 4ZPVB 5J6SA 3QVAA 3KH4A 3BWAB 2I5YH 4NFBA 1E4HA 2APVA 5IB4B 3O3DA 1TVBB 2XTJD 2C1OA 1E6OL 2X3CA 3PUUA 4OV6F 2YC1B 4AYDC 3KH3A 4NQDB 3VB9A 2ZF8A 1A0QL 2QELA 4HG4J 4I13B 1LO2L 2TAAA 1OD7A 3UZEA 4NI6A 5IF0B 3LEYH 1DJZA 4WI2A 1FVEB 4CC4C 1G9MH 2Q8BL 3QQNA 4ZD3H 3COOA 1DJWA 2XV3A 3W9DA 1JN6B 3V4PH 1OCOB 5K59E 3P77B 3FSAA 1U93A 1S7QA 3MV8B 3PXHA 4NM4L 4FQQA 3V5DA 1L7IH 1P7KB 4ZSOA 4OCWL 5CCGE 3DUSA 3KGUA 4FFYH 1JPEA 4UMGA 4G9FE 1H3WM 3MUGA 3TVMB 3SDXF 3SO5A 4APQD 4JFQB 5D7LA 2YXFA 4Y5XC 1IZJA 3K2MC 2J6WA 4H25B 4BEIA 3CSBA 4M61A 2K6YA 1T66C 2NY1B 2Q5BA 5ETUA 1JZ4A 4GPVA 4OW6A 1WT5A 4FEMA 3JTTB 2P44B 4K3JL 5FYLD 3VWJA 1E8ZA 4FLHA 3M1BB 2QQNH 5B22A 5FO8A 3K71A 3QYCA 1TCRA 1EFQA 4UZUA 3CFTA 3C60A 1T0OA 4M3HA 5IB2B 2O5ZH 7FABL 4XMPL 4S2SA 5DVNA 5C92A 2KZ1B 3U4BL 4JFDD 4OIFA 3AG4B 5MENE 1LWRA 1WTLA 4Y9EA 3QUYC 3E38A 4FZEH 5DQDL 1N6UA 2UUDH 3DPBA 3BH8B 1UOVA 4UV7L 1XXFC 3TS8A 4JVUA 2DKMA 2Y2WA 2JTDA 3S48A 4A2LA 1TQTA 3PL6B 1FFTB 5I17B 4IW4C 2WAHA 1BAFH 1E0OB 1X4ZA 4Y16D 4DZBB 4WNQA 4NO3B 2H1LM 5DC2A 4XAWH 2HKAA 1MJJB 2R69L 4IBVA 5HI4C 4ES8A 1HU8A 1DVFB 3IKCA 1WH0A 2R27A 3WE6B 4YBLB 1FO0A 2N01B 2ZUVA 4AQ1C 1JGEB 3QBTB 3WJJA 1RK1A 2WXGA 3NABL 1ZVSA 1I8UA 4IK6A 5BOZG 5CUSL 2YRZA 3FCTB 3QWRA 4ETQB 2DM4A 2CDFB 3DGCR 1WFNA 1GY2A 3B7YA 4JFXA 4LKCB 4U31A 1H56A 3GDBA 3CHXA 4ZXBD 2E3VA 4A68A 2IWKA 2R29H 3L7EB 5DCCA 2WUBH 4S1SH 4S1DD 4UBDC 3VXPB 4ECNA 1FC1A 1V54B 4OLVL 1AD9A 4AL8H 3DSFH 1E27B 1C8PA 1R3IH 1RSFA 2BOBA 3QXDA 5T33H 1EV2E 1MREL 3ATAA 1QR4A 4GKNA 4XP6L 2I9LA 3QZPA 2EE3A 3KLSA 4JQIH 3KCWA 5D2NB 4H8UA 4AC2A 2NSXA 4LBAA 4Y9FA 1EMTH 1B0IA 4HKBA 4BUGA 3H7BB 1BLIA 4I18B 3S35X 3VG0H 3A67H 1Q9WA 1T7VA 2YD3A 2Y3AA 4XZUB 1UZ8B 3J8F7 4G9FA 2PP7A 3QDJB 3I02B 3VFWB 1UYWH 3RIKA 4F57H 1AS7A 2B08A 2DYPD 4UT9H 5BZDB 3QS3A 1CIDA 1DANU 1GGYA 3TU6A 4Q9QH 1ILUA 2NY3B 1U8PB 1V3JA 3BLPX 1CDGA 1I9EA 3EOBB 5DUJA 3EUUA 3RKDD 4U1MB 1HYRC 2I07A 3PNRB 5AVZB 2LU4A 2UY6B 4L3EE 4G80A 4NPYA 3ZDYB 4HT1H 4WJ5B 4GUCA 2BWDA 3P4MB 4XVJH 3RVWC 3GMOB 5MENA 4X6CB 1MCKA 4NKMA 4GAAA 4Z3GA 5D7LD 4BINA 1J05A 1AGBA 2WLLB 5TF0A 1CDCA 2CKBH 4WFHD 3MBED 1WZAA 3VXMA 4EEEA 4PJ8C 3MLSL 3MFFA 4MRBA 3EH1A 5TPWH 1CGXA 1R46A 4G6MH 4KO6A 3C60D 5FA3B 3I6GB 4M7LT 1PSKL 4Q8BA 3D69A 1T03L 4PV8A 2A9BA 1LO4H 4TQIA 1NFIB 3U7YL 3LHPL 4QWWC 3LDBC 3NZ8A 1A4JA 1OGAE 1TO5A 3V95A 4IKJA 4NC0B 2PPEA 2WXRA 1MI5A 3O6ML 4GMSL 3ARBC 3SPVA 4U1JA 4AQZA 4F80A 3U46A 3U30C 3HC2A 4F2MB 2GITB 4H1LB 3CSGA 3BWZA 4Z18A 1HL4A 5J0BA 5TDNA 3EH3B 2J8UF 3SDAD 1BWMA 1W8EA 2EXTA 1GS7A 4B9YA 3L2LA 3ZJAA 5DHEA 4XX1G 4ADIA 2D3NA 1CFQB 2UZXA 4IOFC 3UZQB 3LIZA 2XTSA 2VDQH 4IGBB 3FUNA 4P9MH 2B5IB 3RJDA 1E9OB 4IMKC 3FT2A 1E67A 4IKLA 3MFGB 4AEFA 4HKXA 1NGYA 2QHRL 3LN9A 4J2QA 2ZOKA 3B7RL 1G43A 4X80H 3P3UA 4L29B 3C6LB 4FD0A 1WS8A 1X4YA 1KDIA 3EH5B 3FRUB 1WZMA 4HSAC 4PCYA 3TIDA 4C83A 4E41B 5CCKH 5ID0A 2EIZB 3BP6A 5DTFA 1WYJA 3JWDH 1KEGH 4ZS6C 1SBBA 3HBPA 4QHNA 4ZZKA 1KGYE 3H42L 8FABB 1KJ2A 3LD8B 4KI5C 3D50A 1X3DA 4ZFOB 3IJ9A 3RZCA 5FOBA 4GAGH 1DJGA 1WISA 1RCYA 3LKQB 2IFFL 2F6AA 2XUWA 4L3EA 4ZOAA 5E2WH 3QI9C 2X09A 3QFJB 1XCXA 3I3EA 1RIUH 1THAA 4LP4A 2DLIA 2BLFA 1ORSB 1FPTL 4Q6IC 2XWEA 3TBSA 1XR9A 2GIYA 4JFVA 1ZIBA 4F8TA 5JA9A 1R5WA 1BYPA 1S7WA 3HRPA 1R9FA 5IB5B 5L9DH 1BZOA 4IIQC 3O3UN 4UTAH 4OQTA 5LAPA 3SE6A 1N6QL 2A73A 3EO1A 4YHOH 4PREA 3SZ6A 4BHUI 2ODIA 2HLFC 1KULA 1CLOL 4Y4FB 5CSBA 5E4OA 4I0PA 2D0HA 1QEWB 2L7UA 1MQKL 4M5ZH 4NAJA 2IMNA 3BPLC 3FNKA 4UV4L 1BDYA 4AQAB 3QFGA 2C1PA 3X1EA 2AJXL 5E94A 4EBQH 2QPDB 4XBGB 1UEYA 3LQAC 1JZ5A 5INDA 1GOGA 4GRLA 2ZPKL 3VXMD 3TN0D 3KWTA 1RUPL 2IH1A 1QLRB 2Z7ZA 4ONGL 4GI8A 4WGVB 4AMWA 1PD0A 1K8IB 2X7LB 1T66D 5DJZB 4UDUB 5C09D 3EDKA 4Y2DA 5E8EB 1P2CA 2LTQB 5KYYB 3VW3L 4PJAE 4PJHE 5TK4A 3DYMA 2HVKB 4LHUB 1I85A 5ITFB 4M5SA 5EFIB 1MI5D 4QAWA 1KTLB 3BMVA 1IC7H 4EN3A 2J8OA 3PIQA 3VI4F 4C4KT 4UQAA 3HAEH 3ZR6A 1QZNA 3S36L 4PJBE 1KY6A 3B34A 1ZSDB 4WEMB 3T8XA 4A55A 4NFCA 4NQUA 1H3TA 3RQ3A 5ICZA 5KW9H 2MRYA 1RZ8A 4X5PA 1MWAB 5LKNA 2OL3B 3MRPA 2SODB 4MJ6A 5GSVA 2A1WH 3ARGB 3QG7H 5JOPD 4OGAC 3QCTL 3VRLF 4K3DH 5CHNA 2D7QA 4B97A 5IMMB 3SJVA 1BQHB 3FFDB 4DVBB 1JZ2A 3FO9B 3KLAA 4OLUH 5HI4D 3T0EA 3QUMA 1CGTA 1FN4B 2R8SH 4U6HA 3HN8A 1AGDB 4OZFB 5F96L 5J11C 5FFGA 1FHNA 5KVFL 2HH0H 3GT6A 3Q6FB 4WW1A 1TFHA 4PJCF 1EZVX 1BFVL 4U6YA 1E40A 4OFPA 5E1IA 2VL5A 5EORL 2EDWA 5F3BA 3ARQA 3CN2A 2A6KA 4FLOA 4P46B 3DV6B 3V4VL 1S9KC 1MFAH 5JORA 3T3PE 1MXDA 2Y1VA 2VAAA 3RX9A 3D18B 1AC6A 5DJYA 3UXFA 1FLRH 1FSKC 2YMOA 3FO2B 4FQCH 1B0RB 2XPZA 2F54B 1HKLH 4GG6B 1S9VB 3MJ7A 1SHWA 3KPMB 4EKXA 3K8MA 4ZNEE 1WA0X 1QQDB 1KENL 3MRMB 3UYPB 3GMQA 2FT7A 3N2JA 3QG6A 4F7KA 4HLEA 5T1KD 1HFUA 3VFPA 1CQYA 4B7IA 2XZCL 4Z7VE 3L7FA 5C7ZA 4LVNC 2WZPD 3QC6X 5ICYA 4FYRA 4M43H 2EYTB 3NZUA 1GGCL 4BHUA 2YUXA 2J88H 4JN1H 3H54A 5DQJA 4OTXH 1UT9A 3MJ9L 5K93A 3IF1A 4MTMA 3LHAA 3SGJA 2I5YL 3VXRE 3SKNA 4TUOB 4PJAA 4PJHA 2FWLB 2O5YH 3B7SA 2Q86A 1XGUA 1TZAA 3NJNA 4YOKA 2JKNA 4GRLD 3RVWD 3QNZA 4A1RA 3ARFB 3ILQC 1ZHKB 2XQBH 2Y5EA 4XPGH 4WHTB 2J1KA 2C9AA 5BCAA 2NT0A 2Z91B 3L3IA 3LEYL 4PJ8D 4IRSB 3QISA 3SDCA 2IQAA 4YVNA 2YKLH 1B0GB 1G9ML 3M7FB 1I3UA 4ZD3L 6CGTA 3VE0A 4FS0A 1MUJB 4Q2ZA 4U1HA 3N43B 3V4PL 2OQJA 4ZAKB 4ATWA 4O4YH 4W9LC 4N0FB 1URLA 2BINA 3W9EB 4NOBA 1L7IL 4O02A 2FH6A 2AS5M 1GGBH 4BQBA 1MHCB 3H8NA 2ZT9C 4FFYL 4DUXA 1HWGB 1KBPA 1QFUH 2Y6SC 2HT4C 4RAVB 5ABDE 4JN2A 3B1TA 4NNXA 1PPIA 3P54A 3TJEH 3V10A 4D9RD 4D9QD 1SJEB 5F3FA 4A7VA 1U8JA 3WMSA 2HLAA 2NW2B 1DCLA 3K8KA 1QUPA 5DURD 1W6LA 5H2BA 1G1CA 2GJPA 3QRGH 2P8MA 4IMLA 4XPAH 3WELA 2DL2A 2QQNL 2JH2A 1ZOXA 1HL5A 3MRGB 4XNAA 4RDQF 2F58H 1MG2C 2ZUWA 3GB7A 1PZBA 3LQMA 2CKNA 3PDDA 2O5ZL 4WUUB 5J6HB 1OQXA 1JPTH 1RY7B 2X6CA 3OF6D 3SJVD 1MCCA 2WKGA 3ZTNH 1XD0A 5J12B 3PDOA 3T0ED 1YMMB 2QSCH 3EFOA 1T7WA 5ACLA 5KG9B 4FZEL 3MPCA 4MQXC 3KL3A 3BZFA 4Z7OF 4RFNB 3VD4A 4S0SD 4DN4H 4ZNEA 4AQ1B 3VNYA 1N5AA 4LL9A 1NKRA 2NY4B 1G7HA 1JWSB 3C09C 3TBTA 2ZWSA 1HC1A 3LKOA 2ZX9A 3QIWB 5B7EA 3KVQA 5B3SB 1BAFL 4Z0XA 4Z7VA 2VDKH 1ZT4B 3WKPA 3HCVB 5IJBC 4XAWL 1GL4B 2OR8A 2Z7WA 3ASNB 3I50H 3V6ZB 3VXOA 4Z3JA 1YNTA 2BNUB 1IT9H 1T04A 4X42A 4GNKB 5CGBA 3VXRA 3QR2A 1LLAA 3O4LA 4RA3A 4QHMB 3ZTEA 4FADA 3ZBMA 4CSZA 1QR1B 4P23B 2YMTA 3GRGA 3EDDA 3K2KA 1A4CA 4BYHA 1Z3RA 4W9JC 2D8KA 2ZG2A 3OGOE 4UM9B 1D6EB 1I8KA 4PI2A 3ZLQC 1MCQA 2IXQA 4HJGA 2V2WB 5J1AA 2J6EH 2R29L 1VF5C 2WUBL 4S1SL 4GB9A 3IWUA 4AGQA 1E5AA 4WSKA 5TD4A 2CR3A 1PAZA 3DSFL 3K5SA 4AL8L 1F6FB 1KJMB 1R3IL 4OF0A 5AVRB 5T33L 2HLFD 4JQIL 3OLDA 5EBLB 1L0YA 3US9A 3GSRA 5C1MB 1EMTL 3RIAK 2EDDA 2IPUG 4UOZA 4ZMVA 3VG0L 3A67L 4JRYE 1SDDB 5GZND 3ENEA 4OY9A 5JIPA 4YX2H 3NIGF 1M05B 1EEZB 1OZTG 2WLYA 1UYWL 3UERA 4F57L 2ARWA 1O9WA 2ILLA 3QA3B 1PLGH 4IRJB 4UT9L 4Q9QL 4HWZB 3JWNE 2X6AA 5E00B 1RK0A 4U3HA 1K0ZA 1T6BX 2JFCA 2WOBA 3GZQA 1ZTXE 4TNGA 2VDNB 4HT1L 2VXUH 3MGTB 4CMHB 4X4YB 4HLZH 4XVJL 5FCUH 2DLFH 5CJ8A 1V8HA 4NP9A 3TC9A 1CMOA 2H9GA 3MAWA 3QFDB 2CKBL 4N3TA 3EAKA 4L1DA 1UH4A 3RWFA 3VJ6B 3RNKA 1E8WA 2BVQA 4JPIB 5TPWL 1GGTA 3WEXB 2IWFA 4G6ML 3WHE0 5LJYH 3RVUD 2XXCB 4M93B 1LMIA 1IAKA 4XGZA 5HYSG 3TYFA 2MNUA 2EO9A 1LO4L 3G7TA 4B9ZA 3G5YA 1HNFA 3ES6B 3VCLA 1NINA 3ZN6A 4GI9A 2ERJB 5H8DA 5AAMA 1CPUA 4C8XA 4ZUSB 1QSFD 1RJZB 2C9VA 5FYKH 1TEGA 5FF6A 4CSTA 3CBRA 1RZIB 2AXFA 2AQ1A 2NY2B 3FUFA 9PCYA 2YXMA 4LSQH 4RDQG 2ZUYA 1UOKA 4MD5A 1LGVA 4LIQE 4FFWC 4E9WA 4MLSA 3UL4A 3MUY1 3ZHKA 2CDEA 4HGWA 3HR6A 4HC1H 1ANUA 3VFRA 3QAZC 1IZKA 2WBXA 3P0GB 4OZ4A 5DRZA 2BNQE 4WI0B 4P9ML 2DQCH 1VFAA 1F18A 1KIRB 2IBZX 2WBWB 2D03H 2P42B 4HKZA 1F3JA 1IGJB 3DTXB 4YEEA 4Y88A 1ZANH 2PCFB 3MBWB 4X80L 1NFAA 4LPUA 4NQTA 1WCBB 3RL2A 5CCKL 4JO2H 2OCCB 4JRYA 4DPRA 3QI9B 3EYOB 4XNMB 4Z7UE 2XWBA 3INOA 5ID1A 2V9UA 2VJXA 4LCYB 4JPVH 3JWDL 3R4RA 1S46A 4JY5H 1KEGL 2BHZA 4S11A 2X12A 5C0BE 3A21A 5JHDE 5IVXB 3DK0A 4CRPA 1SVCP 4GAGL 4UQ9A 2P5WB 2QSTA 4PRPD 3VFMA 4JFWA 2EDMA 3WJLC 5E2WL 5TDPA 5E1AA 4YL4A 3IGAA 2BVTA 4KTEH 1RIUL 2NX5E 4HUMB 1ASQA 4W4OC 4P2YA 2XI9A 3FUEA 4JX0A 4IBWA 3BPLB 3GZPA 3BP7B 3FTZA 1S78C 2NLJA 3GO1H 3MI6A 4KK5C 1Q4NX 3B7TA 3ILQD 5EEVA 4QTHA 4KX9A 3K4DA 1BXAA 4GIPD 4Q52A 25C8H 4MJHA 1PLAA 3PU7A 3LN4A 2XFGB 2YLHA 5L9DL 4YFLI 4UTAL 2VM4A 2Z8VC 4Z5RA 1FV1A 5HJGA 3FUKA 4YHOL 4X7TB 1QLFB 1JNJA 5F7WC 4M5ZL 4FMFA 3UTQB 2H1XA 5DJ8A 2Z31A 2VXQH 1AZCA 4XCYB 1RU9H 4GW1B 4EBQL 1MRFH 1Q1PA 3L5XH 3R1GH 4W9GC 5EEWA 1NC2B 3EOYG 1PS3A 3JV0A 4J1UA 4PR5B 5TK2A 3MN8A 5CBAA 3ULUE 5CD3B 3V52H 1Z32X 3GMMA 1MCJA 3MV7B 1P84J 5LBSH 4PIRF 4XMWA 2UZYB 4HUXA 5JDSB 5KOMC 3MLYH 5KSBE 5FA4A 4FI6A 2G5UA 3UIYA 5EOQL 1BVLB 5AWNH 5L4JA 4AV5A 4G8GE 3V0WH 1BFSA 5L7XH 5F6HJ 3WNOA 1KXTA 5BQ7A 4B0MM 3LNHA 3B2DC 4W70A 3L45A 3BUYA 4WHCA 3SO3C 3HG1A 1IC7L 4L9LA 4W93A 2F7OA 2VWEE 3TNMA 3MKGA 5FUOH 4MQXD 3EYQD 2P24A 2Q6WA 5E8OA 3HPLA 4PBWD 1G7PB 5KW9L 3IMVA 3GSWA 4IKKA 4N1HB 3D0VA 4ONHB 4Z7UA 2AQQA 3E9UA 1JGVH 2A1WL 3OHXA 3QG7L 4ORGA 3OMAB 4ZFZB 1SF3A 4U6VH 5I16B 3S35H 4K3DL 1OK8A 3ECBA 5DHVA 1KBBA 1PYWB 2NYYD 4UZSA 3B2UC 4MB1A 2EE2A 5HJ3A 5C0BA 3UTTE 3V6OE 4FKEA 5CLZA 3VWKB 5JHDA 4LOVA 4OLUL 3IGKA 2R8SL 3FQRB 3IGUA 3NCCB 3BQUA 3IRZA 2C3HA 2P3YA 3KBPA 2FQFA 2HH0L 1KYOJ 1ZHNA 2NX5A 2YSTA 3NDYE 4DK3A 4YLCA 4FXKA 4UQ2A 2XWTA 2W95A 4OF6A 4FFZA 3BKYH 1Q9LB 4AGMA 3RGVC 4HS3B 1E5ZA 1MFAL 1MCWM 5DSCA 5IMKA 4XHJC 4P3DB 4QRRD 5ISZB 4M4RB 1FLRL 4QJ5B 2ZWLT 4RGMC 3STLB 5JW4N 4HK3J 3NUKA 3EJZC 4FQCL 3T3MB 3F7PC 1HKLL 1CLZH 1A7OH 1BJ1H 2DICA 2EEXA 4P3WA 3FCBA 1BD2E 1U8NA 4ZUVB 5IW1B 3HHSB 2A74B 3GHEH 2WTPA 3FO1A 1SDYA 1KXVC 1G7IB 2E9GA 2J1XA 5F7BA 3TBBA 1U3ZA 4Q0XH 2AV7B 4K5NA 1GAFH 2H5UA 4M43L 4MCYA 3X11A 5GRJH 1VKXB 2AJSH 2J88L 2K6WA 2QV4A 2VUYA 4JN1L 5KSBA 4OTXL 1Y1UA 3DK2A 3EBHA 3QPXH 4IBZA 5CP7B 5JXEC 2A9NH 3BUBA 2VE6B 2BZ7A 4LXFA 3HI6H 1SOQA 1C12B 2E4FA 3CVHB 5AUMA 3GXNA 2IAMB 2O5YL 2ED7A 1ONQB 4AJWA 3QJOA 2XZZA 5FX3A 4XXWA 4V11A 4E9XA 4QXTA 2XQBL 4PJFB 4XPGL 3MA7B 3SPHA 5A7BA 4G43A 5EDSA 1EAPB 3OKOA 3D39B 4TNFA 3ZOAA 2VMJA 3GBMH 1AS6A 2OMYA 1BX2A 3AQXA 4PRDB 4XNYH 2YKLL 3V9FA 1AZZC 3WI9A 4QOKE 2UXTA 3RY6C 1UENA 4FLSA 4UUJA 5AVUB 1LO5A 4NGHH 3TBWB 4DO6A 4BRVA 1W9XA 4O4YL 5D1QE 5FGBC 3GRWA 1UWYA 5HHPA 2B4CC 1KTBA 4NI3A 1IBDA 1K4CA 1R24B 5JZ7D 1GGBL 5F0LB 3HG1D 3V6OA 2XIBA 2ZKXA 3UTTA 5AYUH 1QFUL 1B4RA 3ATEA 3CDYA 4XH2B 4XCNA 3TJEL 2AKRB 3HMWH 5K1JA 2VNCA 4M6OH 2IV9A 2N7SA 1ZCRA 1TQVA 1AS8A 3N3EA 3QRGL 3VFUA 4XPAL 5IHBA 1SMAA 2H26B 3L3HA 3IJSA 4C57C 2PP8A 1KTJA 3CVDA 5F70A 2RQ8A 2K7PA 3I75A 4FFWD 1R47A 3KLKA 2F58L 1S8DB 4YN3A 2NQCA 3GHPA 1JPTL 2NXYD 2W88A 4YSRA 5FDWA 1BAGA 5GGUB 3ZTNL 1HHIB 4W9KC 3UZVA 2BSTA 2E7BA 3N1QC 2QSCL 2XLLA 1KJVB 3HB3C 4AYFA 3EW3B 5AKTA 3M45A 2ARJB 5IJKA 4UAOC 1DN0A 1HT6A 4JRXD 1PJ9A 1SJMA 1BD2A 2YD2A 3FU0A 4XI5C 5KSAD 3SE9H 4DN4L 3W5NA 1IKNC 3HZ3A 3IMWA 5FUCC 1UXLA 4YL9A 2F7RA 1AKJA 3LPPA 2ED6A 2TRYA 3ZDYF 1DHKA 3PJLA 3FRPA 2XPGB 2VDKL 3CFUA 3DOSA 3L9RB 3PV6B 4GW4A 4JJ5A 4X6CF 3K74B 4CW1A 4FXGA 3I50L 1D5RA 3VQ1C 1U8LB 2H7WA 1DVZA 4XOBA 4JPWH 2XY1A 2J12B 4DPCX 1IT9L 3VGAC 3DX9B 2HMID 1VRSA 3LOWA 3WO4C 1W8NA 3WS6A 1KLGA 3BWUC 3OKDB 2PTVA 1NIEA 4G70B 1T4KB 1NGZA 2K8MA 3QORB 1ND0A 1BFOA 1OHQA 5J13B 4NZFA 2ESVB 3VACA 1KG0A 3EZ8A 4FEIA 4BJLA 3KPRB 5DUMH 1BPLB 1NBYA 2FAUA 4JKPH 3QZWA 4LEOA 4PGJA 1S78D 2ZXEB 2BWIA 4ZPVA 2CM6A 2J6EL 3BWAA 3NVQA 3MCYA 5LG1A 5IB4A 1TVBA 3MRIB 3OKNB 4F8LA 1BIHA 1KSRA 4PJ6A 4PTTB 2HCZX 2YC1A 4F9PA 3GBEA 4NQDA 1G87A 1YC7A 4LE8A 4NQVB 2D7MA 3OGCB 2EUVA 5IF0A 2NR6A 4YHIB 4U3XA 4GKZB 2GABA 4N90E 4YX2L 1FVEA 4AYMC 4MQTB 5FKAB 1QWNA 4OVVA 4ZW7A 2VLJD 1OCWH 1JN6A 1PLGL 2AEPH 5CEYB 3SPIA 4HISA 5F7MC 4KGLA 3MSPA 3P77A 4N4YB 5D2NE 3MV8A 2P8LB 4KRMB 4M03A 3RTLA 1PZUB 2Q8AH 1P7KA 1U9KA 5D7KD 1P7BA 3RHWF 4ELME 2UXFA 2ZCHH 3TVMA 2BRQA 2VXUL 2WXFA 3E8UH 3QDJE 3QCUH 2DEXX 4JFQA 2OK0H 5FCUL 1CFVH 1WFOA 4H25A 1LK2B 3K81A 4ZOBA 5JYMA 1UASA 2XA3A 3JTTA 1OARH 4JY6B 3ARDC 2ALWA 3M1BA 3ZHNA 1ZLWK 3EO9H 4LOFA 3MJWA 5IB2A 1PMYA 4U1SB 1FJ1B 1QRND 3MOAH 1HXMB 2D73A 1KTKE 2OMZB 4KK8D 3HE7B 3SIKA 3X14B 4G6FD 3BH8A 3B3BA 2Q1EA 2NDGA 4EOWH 5BW7A 1I8LC 2VQ4A 1G6VK 1U3YA 4HVBA 3B2UD 5KANI 4L4JA 4JEGB 4Y5VB 5FYKL 3EJRA 3OXSB 2RR3A 5F0JB 3DMMB 1KGIA 3PL6A 2K0RA 1LHZA 2LFGA 2ZKYA 3O2WH 5I17A 2HVJB 4HJTA 4LSQL 1AKJD 2NXZC 2YFOA 4IOSA 5HGDB 1GA2A 2FIKB 4NO3A 3SGDH 5EBWB 1MJJA 1FFOB 5J4MA 1DVFA 4GKSB 2WSDA 4HC1L 1PVHA 3WE6A 5GRXG 3FC8A 4GRWE 1NEZG 1BXVA 1CYWA 1JGEA 3N55A 4S10A 2CBQA 2DQCL 2FQGA 3FU5A 1NH6A 3ZU8A 4F33A 2D03L 2BERA 4Z7NB 4FNTA 4JFUA 2CRYA 3FCTA 4ETQA 1JHKH 3IPBA 2CDFA 1ZMYA 1QO3B 1P4IH 2F1AA 1ZANL 4LKCA 1RZJC 3NYKA 5KBPA 2MPVA 2XN9B 5IQLA 1UB6B 1BG1A 4JO2L 2X4OB 1VFBB 3L7EA 1NCJA 3VXPA 4ISVB 1FNLA 3WTTA 3IMTA 1L3NA 4JPVL 3WFHB 3QDGB 1E27A 4JY5L 3QIUB 2GYSA 3VFOA 3C5JB 3GXDA 5D2NA 1BOYA 4G59C 4KQ0A 1GYUA 1HX0A 1M2VB 1W0YT 3KNBB 3H7BA 4I18A 3NIFE 3QEQB 3QDMD 2BOCB 1L3WA 3MNZB 4XZUA 1UZ8A 4UNUA 4WO4C 4YSAA 4KMTH 3QDJA 3I02A 3VFWA 1YPZF 5HVHC 4KTEL 5L4MA 1ETB1 5BZDA 4HIQA 3GO1L 4PLJD 5C0EB 1G7QB 1DDHB 1U8PA 2VLLB 2CG9X 3EOBA 5JTWA 5ABAA 2M26A 4U1MA 4W9ZA 25C8L 3MV8D 5TH2B 2UY6A 4K07A 2BSRB 4WJ5A 2DQGH 3QFJE 2ICWJ 4FA6A 2JJUA 3ZDWA 4L0YA 3BFOA 3L1GA 3P4MA 4U0QB 4TVPE 3GMOA 4X6CA 2C4FT 3EO0B 1EHKB 5HHMB 2WLLA 2VXQL 3NJHA 4GAFB 4DZ8B 1ITBB 3MLTB 3E80A 2CDGB 3CXFA 1FFNB 1RU9L 1FCCA 3D4CA 1MRFL 4LASH 3L5XL 3R1GL 4I3GA 2ZUTA 5KYXB 4ZMNA 3Q8CA 1AI1H 1N68A 3OL2A 3VVVA 2Z92B 3WG7B 1SMOA 2WV3A 1DVYA 4ZK8A 4J8QA 3V52L 4UTCA 1F6LL 1JG9A 3GMPB 5LBSL 3SO3B 1NA8A 3L9EA 5C6PB 3GSXB 5FA3A 3EH4B 1EZLA 3I6GA 5G5DB 3F64A 1LEGB 3MLYL 1F0OA 1EJ8A 1NFIA 5IMOB 4ZTEA 5AWNL 1I3RB 5GZOC 3V0WL 2WVVB 3PP4H 3O11B 5L7XL 3ULAB 4F2MA 2GITA 4H1LA 3THMH 1U3NA 4G82A 3HB3D 3BPCB 3OKLB 2E9IA 4U2YA 5FUOL 4JDTH 4Q74A 2HUHA 1W0VA 1WIPA 3ZPDA 4XI5D 1CFQA 3L3OB 3UZQA 1A9VA 3RBGA 3HLKA 2VABB 4IGBA 1DVFD 3OB0H 5C08B 1ZTMA 2ATKB 2G3NA 2Z64C 4HMEA 1E9OA 5H4YA 3II1A 4U6VL 4QPEA 1SXBA 2VDPB 3S35L 2GJ6E 2K3HA 3RGVB 1T89A 1EEUA 3U2IA 2A38A 1S6NA 3QCVH 4LVHB 5D4HA 3K6OA 4QRFA 4L8BB 1AQDB 4L29A 3C6LA 3FN0H 3FRUA 4E41A 4MKMA 3A47A 3P2BA 3BWSA 2EIZA 3L5WB 1ID2A 5AB9A 1AO7E 4AW7A 4GYBA 5HHNB 1MFCH 2AXJA 1S3RA 4Z76B 1KCSH 8FABA 3BKYL 3U4KA 4ZFOA 5JNYB 2BZDA 5FWQA 2JQZA 3GSOB 3KL5A 4PHZA 3LKQA 2W92A 2K9FB 3TFKC 1L9TA 1TT6A 2BRRH 2L7JA 3QFJA 5HYJE 3KPTA 1WUNT 2OA9A 2GBUA 1CLZL 4XC1H 1A7OL 4MXQD 1ORSA 4NBYB 4EI5B 1R34A 4WI3A 2EYRB 4K9EC 1MOEA 3LKRB 3GHEL 3JQOB 4QXUH 4QHLB 3HJ0A 5IB5A 2NY3D 3BVTA 4QKXB 1YN7B 3A24A 1OALA 4Q0XL 5I73C 3DIDA 2F54E 2ICWB 3FCGA 4Y4FA 1ADWA 4GG6E 1GAFL 1QEWA 4PJ9C 2R39A 5GRJL 3T0DA 1MQ8A 5JXAH 1TQCC 4WKZB 2AJSL 3ULUH 1VLXA 2PLTA 4AQAA 3QPXL 1G9HA 4BV1A 2A9NL 1D9KC 4PLOB 1XBRA 3NQKA 4XBGA 1FE8H 1SYSB 3HI6L 1I9IH 4HEPA 3D5OF 2AAVA 3LPFA 3N1PC 5DA4A 1QLRA 4RMUA 3BD3A 1MJ8H 3GXMA 4KXBA 2D3VA 5J5EA 4ZMZA 1K8IA 2X7LA 2YBRB 4E9QA 1KF9B 5DJZA 4UDUA 4TVUA 1TZHB 5MEPB 5E8EA 5I8CB 2YUWA 4N8UA 3BRDA 3NN8B 4MA1C 4OZFG 3GBML 1UT2A 5AVYB 4XNYL 2L8AA 3A22A 5KYYA 3IDGB 4L4VB 5EO9B 4UI2A 3PF2A 3PABB 2HVKA 4M6MH 1HN1A 4LHUA 5ITFA 2VZOA 4NGHL 5EFIA 4X5LA 2F8OA 1KTLA 3S98A 2HX8A 4BA0A 2DBLH 1O6SB 1T4WA 5D7IB 3VUAA 2BCMA 1KIPB 3B2MA 2XY2A 1C1EH 5AYUL 1ZSDA 3NH7H 1T5XB 4TLKA 2E8YA 2LVCA 4HMCA 4C55A 2PXYC 3GJFB 4S1RH 4P59H 4HPOH 4JFHD 1BP3B 1MWAA 3UAJA 3HMWL 4I9WD 3SYOA 2OL3A 4QD2E 2WNXA 4M6OL 3ARGA 4N8VB 1GZHA 2BH0A 4L3AA 4CC1A 2NXZD 1ZLWH 3HS0C 5IMMA 3BSZH 1BQHA 3FFDA 2XWXA 4DVBA 4XNUH 3FO9A 2R9HD 1FN4A 2IOMA 5AL8A 2Z1PA 3SODB 4R2GC 5F7FA 3ZTJH 3PGCB 1AGDA 1YAIA 4OZFA 3RE0A 4M7KH 4E41D 4TLTA 2FLMA 3Q6FA 2DKUA 3EYFB 5T8IA 5IB1B 3SE9L 3L8QA 1ZD6A 4P46A 3DV6A 3N0PB 3NPSC 3WO4B 5B4MC 1MFBH 1P9MA 3C5SB 1WJ3A 1G9MC 3D18A 1PFOA 2JKTM 5AOJA 4WFEE 3O6FB 3MA9H 1X5ZA 2E9WA 3WXWH 1HCVA 1BMWA 3FO2A 1B0RA 3OQRA 2F54A 3PHOB 4PG2A 3P3SA 4L2YA 3ESPA 3O2DH 1QATA 4KFMA 4GG6A 3JV6B 1S9VA 5CP3A 1NAKH 4ZJ9A 1OW0C 3KPMA 4UIMB 2VAJA 3EJSA 3MLRH 1QQDA 4JPWL 3MRMA 5AZEH 3UYPA 2FHBA 1RUAH 5D7JC 4YHNB 1AGCB 3IDXH 4MMXC 3ZE2F 3ZT5A 4XVOA 3NJIA 4HJ0C 4WO4D 2AQTA 2Z34A 1QHPA 1U4FA 1SYVB 2EYTA 1RHHB 2N4IA 5DUML 4JKPL 4AM0Q 5IY5B 3WIHA 2E27H 3MR9B 4TUOA 5DJ6B 4XX1E 4S0HA 4UTBH 4PJXF 3ARFA 2Z35B 3S4SB 1ZHKA 4WCYH 5FCSH 4LRIC 4WHTA 1EK3A 3ROLB 5IB3B 4KRPC 2P1YA 2Z91A 1VCBC 1B2WH 1FLTX 3IETB 3IBEA 3KS0J 2WWKO 5D4JA 4IRSA 1UD5A 5IT2H 1B0GA 1QI4A 1RD6A 3TO4D 3BYYA 2F1EA 3CC5B 3NJGA 3A4FA 3EGSB 4R26H 4PW9A 4ZFQA 4YHYB 4BZ1H 2X6VA 1MUJA 1OCWL 2AEPL 1QUNB 1XMEB 4ZAKA 3KJ4B 3ARDB 1PIGA 4N0FA 4LHUD 3W9EA 2Q8AL 4FHKA 3T1WA 1LP9B 3UPRB 1MHCA 2ZCHL 3LXAA 4RAVA 3E8UL 1K5NB 3QCUL 4OUUB 2OK0L 2ICES 1CFVL 1SJEA 1I9JH 1F02I 3E6FB 4OZIB 4PY8J 2NW2A 2XKNB 2ETWA 4FG2A 1TDQA 2NNFA 1OARL 3SCMC 5IVXF 4KUZH 2BW4A 1TZOA 3MRGA 4OF8A 4B9JA 1S9YB 3EO9L 5F3HB 4KAQH 3M46A 5J6HA 4WUUA 5GRWA 1T80A 4XPFH 2IFGA 3MOAL 1J5DA 3AQZA 3BT2H 4PSRA 3IK2A 3Q9QA 5CEZE 1YMMA 1ZDSA 1I1CA 3F3HA 3PJNA 2WYTA 5KG9A 2LE9A 4GIAA 4JBSA 3VGEA 4EOWL 1PQZB 2ZSVB 2R1WB 4AQ1A 2ZX6A 1ZLSH 3BKMH 1JWSA 4OCRH 5DLMH 4GO8A 1BREA 3QIWA 4X99B 4YSDA 4P46D 3O2WL 4FQIH 3N44B 1CD8A 3NK3A 1ZT4A 4WV1B 2XBDA 3LNEA 4YJZL 1VACB 4PYHA 3HCVA 1CE1H 3SKOB 3V6ZA 1H9DA 3DV4B 4N2MA 1M71B 3N50A 5DF0A 2BNUA 2DOCA 1ZHBB 3T1FB 3WFDH 1MCBA 2C9XA 3B9EA 3QEHB 4FP8H 4CKVX 3D3VD 3U1PA 4QHMA 3WKQA 1LM8V 4P05A 1IGTB 1QR1A 4P23A 1ZGLM 2AMGA 4Y7OC 1MNUH 1RLWA 3IS1X 1JHKL 3FDWA 2CU9A 1P4IL 4WTZA 4G6KH 4HJUA 4TV3A 1D6EA 4UM9A 3ARSA 2VN3A 5D93B 2FR4B 4X4ME 1CB4A 4KXZI 4XN1A 3GXUB 4JB9H 4NIYE 2V2WA 3VSVA 1T22B 2DM3A 5IJDC 1I4FB 4P2OC 5JW4Q 3QEUA 5HVHB 4PP2B 5HI3C 3Q2LA 1IBYA 2XYBA 2AK1H 1TQWA 3SYAA 1P4LB 2JKXA 2CCLA 5CN2A 3ZYOA 1KJMA 4KI5E 3U79A 1HWHB 5EBLA 3QNXB 1I3GH 2CQVA 1JF6A 4FRWA 4AQ8C 3SE4A 1ITCA 3ARWA 3J7HA 3ZKND 2VLKE 4H8PA 4NPJA 3MRJB 1SDDA 3Q5YA 3I74A 4ABWA 4P5TC 3RILA 2VM3A 1M05A 1EEZA 2W0PA 4KMTL 2DM2A 4WGKA 3RWEB 2MKWA 1TJXA 2YAFA 1DEDA 4X7CC 3QA3A 4W81A 5GISH 3FSZA 4IRJA 3FHEA 1RJLB 3MRRB 1MAJA 4NP4H 3HFMH 4HWZA 5E00A 2VTFA 4JREC 1WK0A 2FJSA 3BGFB 1RJCA 2AF2A 2DQGL 2B2XH 4GQQA 3MGTA 3L9BA 4X4YA 2VSKB 1Y7VA 4OFKA 2XQ0A 1KBKA 4WI8A 3ZL2A 3ML8A 3GS4A 1TJGH 2VCOA 3RTQC 2VXTH 2WKOA 2X9YA 3QFDA 2VLRB 1P4BH 4LASL 3B2VH 3VJ6A 2BDNH 4Q58C 3HG4A 1AI1L 4JPIA 1DVXA 3PWJB 2A3TA 5GIRB 2Y7NA 3WEXA 1RP8A </