1A5WA

Asv integrase core domain with hiv-1 integrase inhibitor y3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INTEGRASE
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5wA00
4FJJA 3HXMA 4LD0A 2F8SA 4BE2A 4KRFA 1RT6A 4CGGA 4CJQA 2P1JA 4C8NA 3VN5A 3AA4A 4C8MA 3HP6A 3DRPA 4HUFA 4E7JA 2YNFA 5K14A 4KKOA 3AVCA 4DF4A 2XY7A 2FC0A 3KD1E 4CJKA 3CFPA 3TABA 4DQQA 4DQPA 1RCHA 1I39A 2O4GA 3K5MA 2X74A 4CESA 4LH4A 3O3GA 1FXXA 1TGOA 3SYZA 1S1UA 4B9TA 1C0TA 2IOCA 4DU1A 5KGWA 3QESA 3CYMA 4IG3A 4F3TA 1A5WA 4ICLA 3S9HA 3C6TA 4AHVA 3SZ2A 1BISA 3AVBA 3C95A 5C42A 4FZZA 1Y97A 3NF8A 4FJIA 4FK4A 4TSXA 4DTXA 4KV8A 4OLBA 3WNHA 3F9KA 4KO0A 1RT4A 5DK5A 3WNGA 4O5BA 2OYQA 1RTHA 4LY7A 3NH1A 1A5XA 4CJLA 2RF2A 1T7PA 1DTQA 5CYMA 1X9WA 5FRMA 4CIEA 5J2MA 4E7KA 3ZT4A 1Q8IA 4CGJA 4CGDA 1SV5A 3SUPA 1S9GA 3EYZA 4ELVA 1X1PA 3TANA 3AVAA 4FJLA 3V9SA 5T7BA 4OKKA 1NK4A 3KLHA 3OYAA 4CEBA 4CEDA 3D0PA 5D3GA 4N5SA 2Y1JA 3KK3A 3TAQA 3AVJA 1S6QA 1JL2A 3PX6A 1JLCA 1S1VA 3K2PA 3RR7A 3HK2A 1LWEA 1VSFA 3V9ZA 1UA1A 1CZ9A 2Z1HA 4DQRA 5C25A 3LPTA 4CIFA 4CCHA 2D0BA 3LALA 4F4KA 3M8RA 2G8UA 2OZSA 3QEXA 3MXJA 4FJMA 2QXFA 3ZSWA 3HT3A 2G8FA 1NJZA 3NH2A 2Q3SA 2KZMA 3K5LA 4BDYA 4W5NA 1HQUA 3ASMA 1T03A 4J2EA 1JLFA 1LW0A 2ZQBA 3LANA 4ID5A 2FBTA 1T05A 4Z4CA 4BE0A 3H08A 3SV4A 1T8EA 3QO9A 1EP4A 1QSYA 1JLGA 4FJXA 1RILA 2YKMA 3RWUA 2BE2A 2W42A 3LP1A 4CJTA 4E1NA 4FLTA 3RTVA 1VK0A 1DTTA 2D0CA 4E7LA 1NK0A 2G8IA 4FK0A 3VQQA 1SKSA 3O3FA 3V1OA 4Z4HA 4M45A 2DFFA 5HP1A 2FBYA 4CGIA 3CG7A 3B6OA 3NF7A 5DMRA 1L5UA 3HPHA 4N76A 1B92A 1L3TA 1NK8A 1KLMA 1KTQA 3O4QA 3TWHA 2IDOA 3CQ8A 4EZ9A 3AVIA 1RNHA 1VSJA 4N41A 4B9NA 3OS0A 1BIUA 1ASUA 1WSIA 3BDPA 1IKWA 4G1QA 1RDAA 1YT3A 1W9HA 4AHUA 4CHPA 3OY9A 2PYJA 4M3UA 3O4NA 3CM6A 3T3FA 4HCBA 4E1MA 3AO4A 3MECA 4DLEA 1QS4A 4LH5A 3K59A 4Z4FA 1RT1A 3VQPA 4CJSA 4CHNA 3SQ1A 3LP0A 4CF0A 4FLUA 4UQGA 1ZBUA 4B8AB 4I9LA 4CERA 4CK1A 3K58A 3KK2A 4O0IA 1L3SA 1QSLA 3DLHA 3DOKA 4PUOA 2P5GA 4AILC 1FKOA 2D0AA 3SPYA 1UAXA 2NUBA 4CFAA 3OS2A 2KQ2A 1D5AA 1X9MA 2OPRA 4F3OA 3DYAA 3HL8A 3ISNC 1CXUA 3P5JA 3AVHA 4CJRA 4FJKA 3HO1A 2O4IA 1VSMA 1RT2A 3K5OA 2ATQA 3NGYA 2YNGA 1QHTA 1KFSA 4DQIA 1GOBA 1LAWA 4NYFA 1EETA 3VQEA 3P1GA 1NK6A 4LSNA 1WLJA 3M8SA 2G8KA 4BACA 3OYDA 3LWMA 4Z0UA 2XO7A 4FLXA 4CEFA 1C0MA 3DLEA 4DMNA 4JS5A 4FW2A 2OPSA 3AO1A 4C8OA 4KREA 2KW4A 3OYGA 1IKYA 3L2QA 1ZBLA 4PWDA 2X6NA 4DTOA 4DWIA 5CYQA 3V9XA 3RR8A 1NOZA 4JRPA 1UWBA 4NYNA 3NGZA 5JS2A 2KZZA 2B4JA 3AO3A 5EU7A 4M41A 3ZSXA 4KFBA 3F73A 1NK5A 2AJQA 1RBVA 4Y1CA 3SI6A 2VG5A 2QK9A 3L2RA 1NKEA 1TAQA 4XIUA 1J9AA 4RW4A 4E7HA 4GMJB 1SKRA 2BGGA 3SQ2A 3HYFA 3VQCA 1KVAA 1TKZA 3NF9A 3PUFA 3U3YA 4FJ9A 3SQ4A 3KLIA 3ZCMA 2OZMA 3QNOA 1XC9A 2HB5A 3B6PA 4F2SA 1U47A 4HTUA 1JLQA 3HVRA 3MAQA 2GBZA 1IG9A 2DFHA 1HNVA 3CFRA 1ZBIA 4KB0A 1RDBA 1HYVA 1NKBA 2PY5A 3OJUA 4IKFA 4OGCA 4YFUA 3VQ5A 5JS1A 3KK1A 1RTIA 1RBSA 3LWLA 4HUGA 4CHOA 4EP5A 1QSSA 1BIZA 1REVA 4QOZB 4FYDA 3NH0A 1XHXA 2BANA 1C0UA 4AHTA 1KCFA 3VA0A 3RRGA 4M3WA 4KI4A 1TKTA 4FVMA 1VRUA 1J54A 3NGIA 4N47A 4CGFA 5HLFA 1NJWA 4RW8A 4HUEA 4FK2A 2QKBA 2FBXA 1QE1A 3VQ9A 4JRQA 4GVMA 4CGHA 4L8RB 3OYFA 3TAMA 4FZYA 3PO4A 2OA8A 2FBVA 3NFAA 1U4BA 4MQ3A 4CK2A 3ZT1A 3V4IA 1BI4A 5CZ1A 1VRTA 4N56A 3OYEA 1U45A 4CEOA 3LPUA 4FM2A 4B9SA 3C6UA 3D45A 3V9WA 4CEAA 2X78A 3SUNA 3OYBA 2HHUA 3QLHA 3KIOA 1TVRA 3SUQA 4CFDA 3NF6A 4ZTJA 1S9EA 4ID1A 4WE1A 3KLEA 4CHQA 1WN7A 4DF8A 2JLEA 2RPIA 3DI6A 5KRSA 3K5NA 2A1SA 1R0AA 4QCLA 4CE9A 1U49A 3OYIA 3S3NA 4CJFA 1S6PA 2XRIA 4DTMA 3E01A 3QEVA 3M8QA 3ZSRA 1G15A 1SL0A 3KLFA 2A1RA 3RMCA 1LAVA 4OKEA 5CY4A 3NDKA 4FLVA 4IDKA 4FJ7A 3HVTA 1WSJA 3ZSYA 3EY1A 4I2QA 3IS9A 3SCXA 1LWCA 1FKPA 2D5RA 3AVLA 4GW6A 4NCBA 1ZBHA 5I3UA 4DU3A 2ZD1A 1B9DA 3NCIA 3A2FA 4Y1DA 1D9FA 3JYTA 3DRRA 4DTSA 3QEWA 3LAMA 3ZT3A 3I8DA 1GOAA 5SWMA 4M3XA 1RT3A 3KTQA 1TK0A 5FROA 4E3SA 3CFOA 4KHSA 1WSFA 1TK5A 1JLEA 2YKNA 4H8KA 3VQAA 1SL1A 4I9QA 1HQEA 2B5JA 1HNIA 4ELUA 3V1QA 3RMAA 1HMVA 4BDZA 1X9SA 4I7FA 5HROA 4KHWA 4B08A 2VG6A 4BDPA 1U48A 4KHUA 1XI1A 1JL1A 3DLKA 4O44A 1U04A 5C24A 2LSNA 4B8CA 3HP9A 2PYLA 2DFEA 1EXQA 1TAUA 3KLGA 4FXDA 2DTUA 1JLBA 5HRNA 4ELTA 4OPJA 4M42A 3NAEA 1KFDA 1KVCA 1RDDA 3KJVA 4KHYA 2HNZA 4CHZA 1LV5A 1MU2A 4W5TA 4CF8A 4DSFA 3SJJA 3TI0A 2IGIA 2I5JA 2OPQA 3VQDA 2VWJA 3ZSZA 2HMIA 2XY8A 1BL3A 1VSHA 4DSKA 4F8RA 4DTRA 3MXMA 1NJYA 1RDCA 1YTUA 2HNYA 1ASWA 3BGRA 1TL1A 4PA1A 3ULDA 4FLZA 5J2QA 1TV6A 2X6SA 3VQBA 3MXIA 4CF1A 2HHWA 4AHSA 4FLWA 1O1WA 1J5OA 5FRNA 4IFYA 4W5RA 2KFNA 4O4GA 3I0RA 2F8TA 2EX3A 3TAFA 3AA3A 4KTZA 1NK9A 3NHGA 4M3TA 4KTWA 4BE1A 1BCMA 4PQUA 2XY5A 2VWKA 4ZTFA 4AH9A 5KRTA 2HW3A 2HHXA 1DLOA 3DMJA 5FDLA 1HJRA 2Y1IA 4OGEA 2WOMA 3T1AA 4CF9A 2G8VA 3KD5E 3L8BA 4IG0A 4OVLA 1F21A 1TK8A 2IS3A 1C1AA 1C1CA 4E7IA 4B9VA 1L3VA 4CJUA 1FK9A 1TKDA 1HYSA 1Z25A 2BDPA 1WAFA 1NOYA 1LW2A 4DLGA 4C8LA 3L2WA 3ITHA 4Z4GA 2HHVA 5E41A 3AVMA 4HHTA 4M3ZA 5J2NA 2YHBA 4H4MA 2KTQA 3LZIA 1Q9XA 3EZ5A 1CLQA 3SPZA 1K6YA 1YTAA 1ITGA 1EX4A 4KAZA 3IRXA 3L3UA 4RW7A 4CJEA 1Q9YA 3ZT2A 1ZYQA 4CIGA 1WNSA 1GOCA 4Q0BA 3AO5A 3TAPA 1C1BA 1RBUA 3QNNA 4M3RA 3HM9A 2RKIA 4RW6A 3JSMA 4M3YA 1S1WA 1UOCA 2KFZA 4FJ8A 3IG1A 3VQ4A 3U3GA 3HPOA 3SQ0A 1SUQA 1KVBA 5HBMA 4DFKA 1VSEA 4J2AA 5SZTA 3OYHA 1BQNA 3LZJA 1TKXA 3M8PA 4AHRA 3P83D 4DS5A 3LAKA 1XHZA 4FJ5A 2ETJA 3DRSA 1BCOA 4DU4A 5J2PA 4PY5A 3PY8A 4FJNA 1YVUA 3SNNA 5HRRA 2P5OA 4B3OA 3DLRA 4Z4EA 3HJFA 3OJSA 1JLAA 3AVFA 4O0JA 4CJ5A 4Z4IA 1TL3A 4F2RA 4DTPA 4B9LA 2R7YA 1QTMA 4E0DA 1RT5A 2E6MA 4KI6A 1VSKA 1RBTA 1WSEA 3PX0A 4CEZA 4DSIA 4FZXC 4H4OA 3ZSOA 2GV9A 3L3VA 3RRHA 1A5VA 1JKHA 4RW9A 4Q5VA 3RMBA 1SL2A 3MEDA 4CJ3A 4ZHRA 3AVGA 4RG8A 3OS1A 5I42A 4EP4A 4MFBA 2B6AA 3MEGA 1IO2A 1HRHA 1WSGA 4E89A 5KGXA 3OYKA 1N6QA 1D9DA 2P51A 3HSTB 4NCAA 3L2VA 5HRPA 3ALYA 4DG1A 2G8WA 4QAGA 2PZSA 3V81A 4JS4A 3SV3A 3S3OA 4CECA 4CJPA 2ZE2A 3LDSA 4FM1A 1KLNA 1BHLA 5HRSA 4B9MA 2YNIA 2OPPA 1CXQA 2Z1JA 3VQ7A 3ZSQA 4DTNA 4KPYA 1S1XA 3KKSA 4DSEA 3VA3A 3PV8A 1LWFA 1S5JA 4CFBA 4W5QA 1KSPA 4B9UA 3OYNA 3LP2A 1JXEA 4OPKA 2RN2A 1ZBFA 2Z1GA 2YNHA 3G10A 1IKXA 2DY4A 3OYCA 4K8XA 3OYMA 3WNFA 1CZBA 3S3MA 4I2PA 2E6LA 3DLBA 4YNQA 5CZ2A 1Z26A 1C6VA 1RBRA 4CJVA 4K8ZA 4HCCA 4AHCA 3QETA 4KTQA 3G0ZA 2ITGA 1NKCA 2F96A 3QERA 4J2BA 2HHTA 4JLHA 1IKVA 3AVNA 4DSJA 3OYLA 1KRPA 3TAGA 4KB1A 2YV0X 2G8HA 1EKEA 1S1TA 3O3HA 1NJXA 4E19A 3TARA 4R5PA 4FCYA 2IAJA 3AA5X 4J2DA 1W0HA 3ZSVA 3K57A 3DLGA 3AVKA 3NBPA 4CF2A 4OJRA 3SUOA 1NK7A 3CM5A 2HNDA 2XY6A 1ASVA 4CEQA 4CJWA 3RMDA 4O55A 3V1RA 1WAJA 3QIOA 3QEPA 3IAYA 2HVHA 2JGUA 3AO2A 4FJGA 4C8KA 4FLYA 3KKRA 3V9UA 1BGXT 2XHBA 5J1EA 4DTJA 4CK3A 2QKKA 4OLAA 2E4LA 3AA2A 2VG7A 1QQCA 5KI6A 4DTUA 2YHAA 1BQMA 3I0SA 3V6DA 4DS4A 1I3AA 3DOLA 1SKWA 4LSLA 1J53A 3QEIA 1N5YA 3C94A 1L3UA 3OVNA 4BWMA 3WNEA 4KHNA 4OKJA 4BWJA 1RTDA 2Z1IA 3LP3A 3L2UA 3TR8A 3TAEA 3PX4A 4HVJA 4FJHA 4IBNA 4FW1A 2EHGA 3DM2A 4EZ6A 2IC3A 4NCGA 1HPZA 3THVA 1HYZA 3T19A 4CEEA 3FFIA 3HPGA 4CHYA 3NE6A 4CFCA 3ZT0A 1WSHA 2HHSA 4DFMA 4KHQA 1VSIA 1UA0A 3OYJA 2WONA 1VSDA 3QIPA 1D8YA 1JXBA 3VQ8A 3PO5A 1VSLA 4DFPA 1B9FA 2GUIA 3U6FA 4DFJA 3QINA 3UIQA 1RT7A 3AV9A 4IFVA 5KTQA 2HVIA 4DQSA 1IH7A 2HHQA 1RTJA 1XWLA 3MEEA 4FM0A 3VQ6A 4CJ4A 4DSLA 1BI4B 4W5OA
chains in the Genus database with same CATH superfamily
3CCMN 2O8EA 3DAWA 5BPNA 1RT6A 3WEEB 2P1JA 4XH4A 3VN5A 4E7JA 4HUFA 5K14A 2XY7A 2FC0A 1KQSM 4LF4K 1DT9A 1S1UA 2IOCA 2RHKA 4ICLA 1QQOA 2D4WA 4FJIA 4KV8A 4CD1A 3QBWA 3GDQA 1CZAN 3UKUA 2RF2A 1JCEA 1DTQA 5FRMA 4CIEA 2NRVA 4CGJA 4CGDA 1SV5A 2CH5A 3BP8A 3VTHA 1X1PA 3TANA 3AVAA 4F9OA 3V9SA 2O8FA 1NK4A 3D0PA 3CCQN 2Y1JA 3AVJA 4GNIA 4JKHA 1JL2A 3PX6A 1S1VA 5AJ3K 3WEEA 3V9ZA 1CZ9A 2Z1HA 5C25A 2D0BA 4F4KA 4EIAA 1T44A 2G8UA 5M1KA 3ZSWA 4YY3K 2G8FA 2KZMA 4CZJA 2V7ZA 1T03A 4B1WB 1LW0A 2ZQBA 4FVUA 4ID5A 1T05A 4Z4CA 3SV4A 1QSYA 4FJXA 3R3LA 4LFCK 4FK0A 1QZ6A 3F5TA 3O3FA 4JN4A 4Z4HA 2DFFA 2D0OA 2FBYA 3NF7A 3M5RA 5DMRA 2VQFK 1B92A 4B1UB 4PKGA 3O4QA 3CQ8A 1VSJA 3OS0A 1BIUA 1IBMK 3BDPA 4A62A 4M3UA 1YT3A 1W9HA 1WOQA 4C1NI 3CM6A 3T3FA 4HCBA 4DUYK 5AQVA 4Z4FA 1OH8A 3LP0A 5BRHA 4CBUA 4UQGA 1RFQA 2P5GA 2HOEA 3OS2A 1D5AA 2OPRA 4PHTX 4EHUA 4JV5K 2QW9A 3ISNC 3L6QA 2NRZA 4FJKA 4CJRA 4YOTA 1Z05A 1XMQK 4MDBA 1Q7YO 1RT2A 4BC3A 1QHTA 2GX9A 4NYFA 1EETA 3VQEA 4JI2K 2A6AA 5ELZA 1WLJA 1NK6A 3M8SA 4DV4K 4FLXA 2OPSA 3AO1A 4DR1K 2KW4A 3CMEN 2VQEK 3WQUA 4K42A 2V51B 3VGLA 3KK7A 4A5AA 3RR8A 2O8DB 3NGZA 4B3TK 3NVKA 2KZZA 2B4JA 3ZSXA 1NK5A 2AJQA 1GLFO 1YUWA 2VG5A 3SI6A 1NKEA 3CI5A 1J9AA 3E1YA 1YJWN 4BQZA 1SKRA 4CBWA 1TKZA 3PUFA 3KLIA 2Q1NA 3QNOA 1S22A 1XC9A 1U47A 3DLLL 2GBZA 1HNVA 1N33K 4YOUA 4DUZK 4IKFA 4OGCA 3JS6A 3VQ5A 3EE9A 1K73O 1RTIA 4BR9A 3LWLA 4CHOA 4EP5A 2YI1A 4NB4A 2BANA 3MCAB 4AHTA 4KI4A 1TKTA 4FVMA 1VRUA 3CPEA 2QXLA 3NGIA 4N47A 1NJWA 4LF5K 4RW8A 4HUEA 5JMVA 4JRQA 3R8EA 2GWJA 3OYFA 3HBTA 3VETA 3NFAA 5LY3A 5M1PA 1NGDA 1U4BA 2O8DA 5CZ1A 1VRTA 4B9SA 2AP1A 3D45A 3UB5A 2X78A 3OYBA 2HHUA 2VCPA 4HWIA 3PIOL 2EWSA 4OX9K 4ID1A 3O9SA 4DF8A 1R0AA 3CCSN 4QCLA 1HX1A 3E01A 3C0BA 3ZSRA 1SL0A 3VESA 3KLFA 5AQNA 3D2EB 2ZJRL 4OKEA 2A1RA 1HNXK 2BTFA 3ZSYA 4UY8O 2D5RA 4NCBA 2VGMA 1BA1A 3NCIA 4FPAA 3QEWA 4CBXA 3LAMA 3FFKB 3I8DA 5SWMA 1RT3A 1T3VA 3CFOA 4Z94A 1I94K 4KHSA 4LF8K 1HNIA 2H3GX 5TKWA 3RMAA 1IG8A 4BG8A 4BDZA 4BRPA 1X9SA 2P9SB 4BDPA 2VG6A 5FPNA 1MA9B 1E4GT 3O80A 3UKRB 1U48A 4KHUA 4LFAK 2PYLA 1EXQA 4FXDA 5HRNA 4OPJA 4KH5A 3O9RA 4JKAA 2ASPA 3D2EA 3SJJA 2I5JA 4LC9B 2XY8A 2F4VK 5KPTA 1VQLN 3MXMA 1NJYA 3BGRA 5J2QA 3ID8A 1VQNN 4FLWA 4A57A 5FRNA 1XNRK 1Q82O 3AA3A 4KTZA 3G4SN 4KTWA 1BCMA 4PQUA 1YF5L 4ZTFA 1BUPA 2QWRA 1HJRA 3TTFA 3KD5E 4JAXA 2W6LA 2P9SA 4IG0A 3UKRA 3SAFA 4WQ4C 2IS3A 1C1CA 3BZKA 5JVGL 4CJUA 1Z25A 1LW2A 4DLGA 4A2AA 3L2WA 4Z4GA 3AVMA 4A61A 3DXMB 2KTQA 3OA9A 4YOXA 5HL7L 1YTAA 3L3UA 3J81O 3QICA 1NMNA 1WNSA 4Q0BA 4XH1A 4M3RA 1HJOA 3MK6A 3JSMA 2UU9K 2KFZA 3VQ4A 3U3GA 5CE3A 2PFUA 4J2AA 4DQ8A 2PAVA 3OYHA 4IO8A 1ZC6A 3M8PA 1HNWK 4NLBA 2Q31A 3MDQA 2Q0RA 3DRSA 5AQMA 3EL2A 4PY5A 4FJNA 3SNNA 5HRRA 4EFHA 4Z4EA 3HJFA 4BY9C 3T69A 4JK7A 4O0JA 1TL3A 1TYQB 4F2RA 5AQTA 4C1NK 4KI6A 1EO1A 3DXMA 2NRXA 3O9QA 5C12A 3SAHA 1JKHA 5BRFA 4MFBA 3CMAN 4NCAA 2G8WA 4QAGA 1QVGM 4CZLA 1GLAG 2ZJPL 4I6MB 4FM1A 3FZHA 3LM2A 4YOVA 1KLNA 3FZLA 4C23A 4B9MA 4X64K 2Z1JA 3C7NB 2YHYA 3ENHA 3P4IA 4DSEA 3VA3A 1LWFA 1S5JA 4OPKA 1JXEA 4RCHA 1ZBFA 3OHRA 1IKXA 3OYCA 4WF9L 4K8XA 4U67L 1TYQA 3S3MA 4I2PA 2E6LA 3DLBA 4YNQA 3U9ZA 5CZ2A 1Z26A 4Y0WA 4FO0A 3K9KA 4AHCA 2P9UB 3VEYA 4KTQA 5LL6Z 2HHTA 4IJAA 3AVNA 1GLBG 5AZIB 3TAGA 1XUPO 3HM8A 1EKEA 3TARA 4FCYA 1W0HA 4IOXA 3AVKA 4OJRA 1T6CA 1WBBA 2HNDA 3IAYA 3VGKA 3QEPA 4C8KA 3V9UA 4DTJA 3C7NA 3AARA 2D0PA 4DTUA 2HHHK 3I0SA 3DOLA 1SKWA 1IV0A 3OVNA 3DWLA 3F2KA 3L2UA 1HKGA 4FJHA 4IBNA 5EX5A 4FW1A 1SS6A 2EHGA 1HPZA 3NE6A 4CHYA 4JHDB 2HHSA 2P9KB 4KHQA 1VSIA 5IWAK 1VSDA 4B1YB 1JXBA 3HTVA 3PO5A 1VSLA 5AFUA 4DR2K 5JLFA 4JK9A 1XWLA 4FM0A 5M1OA 4W5OA 3THWB 4FJJA 3SLCA 3MX5A 3ENBA 4PKIA 2RE2A 4CGGA 1J5OA 2IVNA 3BF1A 2KFNA 2YNFA 4KKOA 4DF4A 3KD1E 3TABA 3R6MA 1RCHA 1I39A 3K5MA 4LH4A 1BO5O 3MX2A 1FXXA 1TGOA 2QWMA 3ID6A 4JKGB 5KGWA 4IG3A 1Q86O 4JYAK 5BN8A 4YORA 3SZ2A 4FZZA 3AVBA 3WXJA 1Y97A 5A2QO 4TSXA 4DTXA 1RT4A 4CW7B 4JHDA 2OYQA 1RTHA 3NH1A 1A5XA 2HF3A 3ZT4A 1HKBA 4CZFA 3N4PA 4ISGA 3SUPA 1IBLK 2UXBK 1QQMA 3OYAA 4CEBA 4CEDA 5D3GA 3THWA 3KK3A 4IEIA 2GWKA 2P9IB 1O13A 1S6QA 3VTIA 3K2PA 3HK2A 1VSFA 1BWFO 2DPNA 3EO3A 1NJZA 4JKGA 3EE8A 3K5LA 4W5NA 1N8RO 4J2EA 5GADP 3LANA 2FBTA 1EP4A 3HI0A 1IJJA 1JLGA 2YKMA 2BE2A 2W42A 3LP1A 4CJTA 4E1NA 4DV7K 4FLTA 3HSCA 1VK0A 4JI7K 2VYPA 2GEMA 3HZ6A 4BR0A 3V1OA 4M45A 3MN5A 3CG7A 1L5UA 3HPHA 1KAXA 1KTQA 3CCVN 2FF3B 3L0QA 4GV6A 1IKWA 1QZ5A 1OVYA 3OY9A 4AHUA 1HUXA 2P9IA 3O4NA 3MECA 2A41A 1QS4A 5AQIA 3CETA 4CJSA 1X9JA 1Y64A 4CF0A 4CK1A 3KK2A 4O0IA 3DOKA 5EOYA 2D0AA 1UAXA 2NUBA 3OW2M 3CJ9A 1K8KB 3H46O 4JI4K 3P5JA 3HO1A 5C2DA 5B8HA 3K5OA 4DQIA 3P1GA 4LSNA 1IBKK 2G8KA 4Z0UA 4FWQA 2CGJA 4K0KK 1C0MA 3DLEA 2YJEA 4C8OA 4PL7A 3PSIA 5JICA 3L2QA 5KQ8A 4PWDA 1TUUA 1NOZA 1QQNA 5ADXH 4YHHK 5JS2A 3F73A 5EU7A 4Y1CA 1OVQA 3L2RA 4XIUA 2J4RA 4H0OA 3B6PA 4F2SA 1K8KA 3GE1A 1JLQA 4MDAA 3CFRA 4JI8K 1HYVA 1YAGA 2E2PA 2A3ZA 4YFUA 3KK1A 2QWQA 3MCPA 3VEOA 1QSSA 1BIZA 3LL3A 4FYDA 1C0UA 2E88A 1NGAA 3CJ1A 3A5OC 4WYBA 3VQ9A 5AZJB 4L8RB 3TAMA 4FZYA 1YVNA 1XMOK 1X3MA 2FBVA 3V4IA 2NLXA 3OYEA 1U45A 1GLDG 3LPUA 4DR4K 3V9WA 3KIOA 4JI6K 1TVRA 3NF6A 4ZTJA 1S9EA 3KLEA 4KBOA 4BRQA 2VWBA 1S6PA 2XRIA 1LAVA 1RDUA 3NDKA 4FLVA 3NVMA 4NXMK 2NZTA 3HVTA 1LOTB 4I2QA 1NMDA 3AVLA 1ZBHA 5I3UA 3MWTA 3J7AP 1Q18A 3MMVA 4ISEA 4YDUA 3A5LC 3DRRA 3ZT3A 1GOAA 3KTQA 1MWKA 2CGLA 4NXNK 5FROA 2ZWHA 4E3SA 4MO4A 3CQXA 4CZKA 3J7YP 3ATVA 3VQAA 1SL1A 3VPZA 3V1QA 3H1VX 4QS7A 3O8MA 3C6AA 4B08A 4H5RA 4O44A 1J5EK 4JI5K 3HP9A 3SAGA 3DXKB 2YHWA 3CCRN 5JVHL 2UUAK 3NAEA 4A59A 4KHYA 2HBMA 2HNZA 1LV5A 4BG9A 3W0LA 2VWJA 4AM6A 3AAPA 4DSKA 4DTRA 1YTUA 2GTDA 1ASWA 2OCEA 3KVGA 2CGKA 4AHSA 4IFYA 4W5RA 4O4GA 4DR7K 5E84A 4WFAL 2F8TA 2EX3A 1NK9A 2XY5A 1VQPN 4KHPK 2HHXA 1DLOA 2Y1IA 4CF9A 2HBJA 1VQKN 4OVLA 5F2RA 1ZXOA 4E7IA 3SJHA 1L3VA 1XQSC 1TKDA 3CXCM 2BDPA 2CH6A 1OH7A 4M3ZA 2YHBA 4H4MA 3G71N 3LZIA 1Q9XA 3EZ5A 1EX4A 1D4XA 3T7ZA 3LDQA 1RBUA 4XH5A 4IEEA 4QS9A 1S1WA 3SQ0A 4LFBK 1SUQA 1KVBA 3MN6A 4AM7A 5FPDA 2YX6A 1XHZA 3LAKA 3TTCA 4BRCA 4DU4A 5C2FA 2GELA 4GKJK 4B9QA 3DLRA 1C0FA 3AVFA 4DTPA 4B9LA 4DV6K 3ZX2A 1RT5A 4CI6A 2E6MA 1VSKA 3MWPA 4PKHA 3FR0A 2ASMA 2KHOA 1A5VA 4RW9A 4BRNA 1SL2A 3QFUA 3OS1A 2D1KA 2B6AA 4E89A 5KGXA 1N6QA 5AQZA 3ALYA 4DG1A 1HPMA 3A5MC 5FLXO 3E9OA 3FZMA 4EHTA 4YOWA 1YI2N 3BY5A 1V4TA 2IVOA 1HKCA 1Q81O 3PLAA 1CXQA 3VQ7A 3PV8A 1KSPA 4W5QA 4B9UA 2YNHA 3G10A 5AQUA 2A40A 3O9TA 3QB0A 4H5TA 4H03B 1P90A 2V52B 3OYMA 2DY4A 5EVZA 1T6DA 1C6VA 1RBRA 4CJVA 4HCCA 2ITGA 2W41A 3QERA 5AQLA 1YHQN 5EXWA 1XNQK 4V19S 4KB1A 3T1HK 1FJGK 4GV3A 1S1TA 2UYTA 3O3HA 4E19A 2IAJA 3AA5X 4FOIA 4J2DA 2P9LB 3K57A 2NRHA 4CF2A 1NK7A 4X66K 2XY6A 4OPAA 5BR9A 4FJGA 3QBXA 4O8KA 3KKRA 1BGXT 3A5NC 3U4LA 4OLAA 3E9PA 2E4LA 1V4SA 3AA2A 1HNZK 2VG7A 2O8CB 2FSNA 4DS4A 2KKZA 1E4FT 3HOSA 2O8BB 3WNEA 4KHNA 4BWJA 2ZGYA 3CJ7A 1RTDA 4CD3A 4BREA 3TR8A 3WXMB 3TAEA 4HVJA 1VQ8N 4JNEA 4N76A 4EZ6A 4NCGA 3HPGA 1WSHA 2NRRA 4H0YB 4JI3K 4BQLA 3VMFB 2WONA 4DV0K 2P9NB 1D8YA 3U6FA 3VOVA 4A5BA 4M7XA 1RT7A 3AV9A 4IFVA 5BRDA 5KTQA 4DQSA 3VQ6A 4CJ4A 3D7EO 1BI4B 4BE2A 4KRFA 3ULEB 4U7BA 4CJQA 4C8NA 3HP6A 3DRPA 3PIPL 3UIQA 3AVCA 2E1YA 4DQPA 4DQQA 2O4GA 3SYZA 5CHIA 4B9TA 4F3TA 1C0TA 2E2QA 3E9LA 4JI0K 1A5WA 3H45C 3S9HA 4AHVA 3C95A 5C42A 4X65K 4OLBA 3WNHA 5DK5A 3WNGA 4O5BA 1P8ZA 2Q97A 4CJLA 1T7PA 5CYMA 5J2MA 4E7KA 1Q8IA 4ILHA 2E2NA 2E8AA 4ELVA 4FJLA 3I33A 5T7BA 4OKKA 4WQ5C 4BRLA 4GY2B 4H5WA 3KZBA 1LWEA 4CIFA 4CCHA 3LALA 3CJAA 5GINA 2OZSA 3QEXA 4FJMA 2UUBK 3NH2A 1N32K 1HQUA 3MN7A 3H08A 1T8EA 5GIPA 3P39A 4HTLA 3RWUA 1BOTO 4DV1K 3P38A 4JD2B 4L3QA 2G8IA 3VQQA 1NNEA 2V7YA 5HP1A 4CGIA 2WC9A 4FWOA 1NK8A 2QEXN 1EWRA 2IDOA 3AVIA 1RNHA 1KC8O 5AQXA 4B9NA 3J7ZO 1WSIA 2W40A 4G1QA 4YOYA 2PYJA 3AO4A 4DLEA 1OH6A 4I6MA 4LH5A 2NRWA 3K59A 3VQPA 4CHNA 2WUSA 2OTLN 1ZBUA 4B8AB 4I9LA 1L3SA 3K58A 1QSLA 4OO1J 5M1NA 1FKOA 3SPYA 4DR6K 3SK3A 2E20A 3HL8A 4BRDA 3AVHA 3IFRA 2O4IA 4JD2A 3NGYA 2YNGA 2P9UA 1LAWA 4FWMA 4E1JA 1ATNA 5AZIA 3OYDA 4BACA 3O4WA 2XO7A 4B1ZA 1EWQA 4RWTA 4KREA 1NWKA 1WUAA 1IKYA 3VERA 1DKGD 4DTOA 4DWIA 5CYQA 2QWOA 3D6RA 4NYNA 2HMPA 3AO3A 4M41A 1RBVA 4J8FA 4B1XB 3ZYYX 4GMJB 2BGGA 3SQ2A 4FJ9A 1KVAA 4FL9A 5HOOA 3U3YA 3ZCMA 2OZMA 2HB5A 2QWPA 4HTUA 3IMXA 5BPLA 1VQ4N 1KXPA 2DFHA 1IG9A 1ZBIA 3KHYA 1RDBA 1FW6A 1NKBA 3OJUA 5JS1A 1RBSA 2ASOA 3GBTA 5BN9A 1REVA 4QOZB 3NH0A 1XHXA 2P9KA 3VA0A 2HBLA 1J54A 4CZIA 4CGFA 3BEXA 5HLFA 4CZHA 4IWVA 2QKBA 2FBXA 1QE1A 4BR4A 4GVMA 4BRFA 4CZMA 3PO4A 5F1XA 4MLHA 1J6ZA 3ZT1A 5GAGP 4NO7A 3FLCO 3BF3A 3C6UA 4B3RK 5H1SQ 4CEAA 3SUQA 3WXLA 2JWKA 3DI6A 2RPIA 4GVEA 5KRSA 2A1SA 3S3NA 4CJFA 3WXIA 3O08A 4LF7K 3QEVA 3FZKA 1G15A 2ZF5O 1WBDA 3SCXA 1FKPA 4DU3A 2ZD1A 1B9DA 1H1VA 3A2FA 3H6EA 2FSKA 2VGNA 4CJ7A 3J80O 1WSFA 1TK5A 2OTJN 2YKNA 1HQEA 4ELUA 5AQSA 5HROA 4KHWA 4DV2K 1XI1A 1JL1A 3DLKA 5C24A 2LSNA 2DFEA 3KWIA 1JLBA 4ELTA 3VF2A 5ADXA 4M42A 1VQ5N 1MU2A 4W5TA 4CF8A 2IGIA 2F9TA 3VQDA 3WQTA 5DM6L 1RDCA 3THYB 2HNYA 4PA1A 4DHYA 3ULDA 1N36K 3MXIA 3MN9A 1E3MA 4DB3A 2O8EB 4B3SK 3EEQA 3S41A 4PL8A 5GAEP 2ZJQL 2WTUA 4BE1A 4AH9A 5KRTA 1DEJA 2HW3A 2BUPA 4OGEA 5AQRA 4G9ZA 3WT0A 3L8BA 2QWLA 1C1AA 4B9VA 4IOAL 1FK9A 4C8LA 3ITHA 5E41A 5J2NA 4IO9L 1YITN 4BRGA 3CQYA 3CC2N 1CLQA 3SPZA 2A42A 4KAZA 3IRXA 4RW7A 4CJEA 1Q9YA 2YHXA 3ZT2A 3THYA 4CIGA 1R59O 1C1BA 3QNNA 4YDUC 1NGCA 2RKIA 3BZCA 4FJ8A 3IG1A 1KD1O 5HBMA 5SZTA 4IOCL 3LZJA 2AA4A 2QI2A 1EQYA 1N34K 2E1ZA 5AQGA 3A8YA 4FSVA 4B3OA 3OJSA 1JLAA 1Z6RA 4AQYK 2FLOA 4M63C 2R7YA 5KPZA 3PX0A 4DSIA 4FZXC 2FSJA 3RRHA 3TSPA 4Q5VA 3MEDA 4RG8A 5I42A 4EP4A 2UUCK 1IO2A 1D9DA 2P51A 5HRPA 3DJCA 3V81A 3U8XA 3W3DA 4JS4A 3OTOK 2UXDK 2ZE2A 3LDSA 1BHLA 5HRSA 2YNIA 2OPPA 5AZJA 1LCUA 1NGGA 4DTNA 4KPYA 1S1XA 3KKSA 4LF9K 4A2BA 3OYNA 3L4IA 3LP2A 2RN2A 2Z1GA 1K9MO 1YXQA 2F7TA 4BRKA 1CZBA 5AQQA 3G6EN 3EKSA 3H1QA 3QETA 1NKCA 4J2BA 4JLHA 5BR8K 3OYLA 4DSJA 1KRPA 3IDHA 3CF5L 2YV0X 3CERA 2G8HA 3TPQA 4BRHA 3O6WA 3TTDA 3CC7N 3KWGA 5GIOA 3DLGA 3NBPA 3HRGA 1YJ9N 1ASVA 2GUPA 3GL1A 3V1RA 5C0YA 2JGUA 3H3NO 4IXCA 4FLYA 4CK3A 2QKKA 2NNWA 3EN9A 3V6DA 2YHAA 5LJWA 1N5YA 4FJ5A 1VQ6N 3FE1A 1J53A 4LSLA 4BC2A 3C94A 3QEIA 3A0IX 4OKJA 1BG3A 2Z1IA 3LP3A 4K25A 2BH1A 3C6HA 1HYZA 3T19A 4CEEA 4BR7A 1S72N 3DXKA 4CFCA 3ZT0A 4DFMA 3ZLJA 2OANA 1OKJA 2FXUA 5KPRA 2Q2RA 4DFPA 1B9FA 2GUIA 1M1KO 4H0VB 1RTJA 4O8UA 3ATUA 3RMCA 3HXMA 4LD0A 2F8SA 3LDLA 4WFBL 2WFBA 3AA4A 4C8MA 5C10A 4CJKA 3CFPA 3SBGA 2X74A 1YJNN 4CESA 3O3GA 3WUHA 4DR5K 3QESA 4DU1A 4ISFA 3CYMA 3C6TA 1BISA 3NF8A 4FK4A 5AQHA 3F9KA 4KO0A 4JKDA 1RGIA 2QWNA 4LY7A 5KQDA 4JKBA 4NLCA 5BREA 1X9WA 3OBYA 4JKCA 1S9GA 3EYZA 3L4QA 3VF6A 3KLHA 1K8AO 1VAZA 1MWMA 4N5SA 3FZFA 3SMSA 3TAQA 4FPBA 4BGBA 4BRAA 2ITMA 1JLCA 3RR7A 3G25A 1UA1A 2A5XA 1U2VB 4DQRA 3CIPA 3LPTA 1NJIO 4K43A 3R9PA 2I7PA 4H5VA 4JKFA 3M8RA 1GLEG 3MXJA 2QXFA 4BR2A 3HT3A 2I7NA 2Q3SA 4WFNL 4BDYA 3ASMA 3QDKA 3O1BA 1JLFA 5E26A 4H5NA 3FGUA 4BE0A 3QO9A 3ZETB 3LDOA 1RILA 1NGHA 4JI1K 4B1VA 1ZBSA 3RTVA 1DTTA 2D0CA 4E7LA 1NK0A 2UXCK 1SKSA 4FWKA 4MLEA 4MO5A 5CR4A 4DV3K 3B6OA 4BRMA 3EKUA 1L3TA 1KLMA 4O5FA 3TWHA 3LM9A 3K0SA 1NGBA 4EZ9A 4N41A 2Q0UA 4IJNA 1ASUA 1W97L 1RDAA 4CHPA 1BDGA 3CCUN 4E1MA 4CZGA 1U2VA 1RT1A 3SQ1A 4FLUA 3I8BA 3M1FA 3H3OB 4CERA 3DLHA 4PUOA 4AILC 4H0XB 4CFAA 4XEIA 2KQ2A 4QS8A 1X9MA 4F3OA 5AQPA 2KLAA 3DYAA 3ZETA 1CXUA 3CJCA 1VSMA 1KFSA 2ATQA 1GOBA 3M3ZA 3WXKA 3GG4A 1U6ZA 1GLJO 1NGEA 3LWMA 3D2FB 5TKYA 4KH6A 1VQ7N 4CEFA 3E66A 3O5BA 4DMNA 4JS5A 4FW2A 3OYGA 5EY4A 1ZBLA 2P9LA 2X6NA 3ZEUB 3Q7BA 1BA0A 3V9XA 4X62K 4BC5A 1UWBA 4JRPA 3OBWA 4KFBA 3ZX3A 2QK9A 1TAQA 4FWRA 3JXUA 3UE5A 4RW4A 3ZX0A 4E7HA 2YCHA 2O8CA 3QFPA 3HYFA 3VQCA 1GLLO 3O1WA 3NF9A 3CCEN 3SQ4A 5AQYA 1NLVA 1TUYA 2O8BA 3HVRA 3MAQA 3RVCA 4KB0A 2PY5A 2HF4A 1ATRA 4HUGA 3JAMO 5F0XA 5C15A 4M3WA 1KCFA 3RRGA 2ZM6K 4H0PA 4OPHA 3C65A 3D2FA 4CZEA 4DKWA 3RSEB 4ILGB 1QHAA 4FK2A 2P9NA 1KAZA 1NU0A 5DM7L 4CGHA 3LDPA 3ZEUA 4BR5A 2OA8A 4MQ3A 4CK2A 1BI4A 4N56A 4CEOA 4FM2A 3ULEA 4K41A 3VEXA 1NG9A 3SUNA 3QLHA 4BGAA 4CFDA 4FWPA 4WQ4A 1X3NA 4WE1A 3CHWA 1WN7A 2FF6A 2JLEA 4CHQA 5JLHA 3K5NA 1VQMN 5AR0A 1W7AA 1NM1A 4CE9A 3GOIA 5AQWA 5MLCQ 3OYIA 1U49A 1OH5A 1WB9A 4DTMA 2ZGZA 3M8QA 4M7YA 4RTFD 3N4QA 1ATSA 5CY4A 4IDKA 3ENOA 3TSQA 4FJ7A 1WSJA 3EY1A 3IS9A 1LWCA 4GW6A 1NGIA 1DGKN 3RSEA 4FWNA 4Y1DA 5M1QA 2NRTA 3JYTA 1D9FA 4DTSA 4M3XA 3VEVA 1TK0A 1VQ9N 3SBTA 1JLEA 4I9QA 4H8KA 2B5JA 3O9UA 1HMVA 4I7FA 4EAHD 1JCFA 4BRIA 1G99A 1U04A 4KH4A 4B8CA 1TAUA 3KLGA 3CJBA 2DTUA 3SMPA 1KFDA 1KVCA 1RDDA 3QMLA 3KJVA 4CHZA 4DSFA 3TI0A 2OPQA 2QTDA 3ZSZA 2HMIA 3PSFA 1SAZA 2WBNA 1BL3A 1VSHA 1NBWA 4F8RA 1TL1A 4FLZA 4WQ5A 1TV6A 2X6SA 3VQBA 4CF1A 2IIRA 2HHWA 1O1WA 1GLCG 4AF1A 5GAHP 4FWSA 1C0GA 3P31A 3I0RA 3T1YK 3TAFA 4BVPA 3NHGA 3AAQA 4M3TA 4JK8A 2VWKA 3BUZB 3VEWA 3DMJA 5FDLA 3T1AA 2WOMA 1YIJN 2G8VA 3TU5A 1ESVA 1F21A 1TK8A 4IDHA 4DCHA 5FPEA 3CPWM 1HYSA 1WAFA 4JKEA 1NOYA 2Q36A 2HHVA 3R1XA 4HHTA 1M90O 1RDWX 3NMUA 3VEZA 4JEPA 1K6YA 1ITGA 3M6GA 4BC4A 2JWLA 3IKMA 3HOTA 5IT9O 4GV9A 1ZYQA 5AQOA 1GOCA 3AO5A 3TAPA 3HM9A 4GKKK 4RW6A 4M3YA 1UOCA 1XC3A 3VF4A 3HPOA 4DFKA 1VSEA 3VENA 1HR0K 1BQNA 1TKXA 4AHRA 2HBKA 2PBDA 3P83D 4DS5A 2ETJA 1BCOA 5J2PA 3PY8A 2F9WA 1YVUA 3U9DA 2P5OA 1JJ2M 4FOEA 4CJ5A 3F9MA 4Z4IA 3AY9A 3I55N 3AGRA 4E0DA 1QTMA 3EZWA 5AFUH 3IUCA 1RBTA 1WSEA 1NGFA 4CEZA 1QVFM 4H4OA 3ZSOA 2GV9A 3J8AA 3L3VA 3I56N 1HLUA 3RMBA 4CJ3A 4ZHRA 5BPMA 3AVGA 3K9JA 3MEGA 3OYKA 1HRHA 1NGJA 1VHXA 1WSGA 5FPMA 3HSTB 3L2VA 1S3XA 2PZSA 2W6KA 1SZ2A 1JCGA 4LF6K 2P9PB 3SV3A 3S3OA 4CECA 4CJPA 1BU6O 3B8AX 2E2OA 3ZSQA 4CFBA 3TSUA 3WNFA 1KAYA 5LJVA 4K8ZA 3G0ZA 2F96A 1SQKA 1IKVA 3THXB 4DR3K 4R79A 1NJXA 1ILYA 5I9EB 4R5PA 1VQON 3Q7CA 5AQJA 3ZSVA 3SUOA 3CM5A 3RMDA 4CEQA 4ILJA 1MDUB 2P9PA 4O55A 5AQFA 1WAJA 3QIOA 4CJWA 2HVHA 3AO2A 2YJFA 5AQKA 2XHBA 5J1EA 2E5LK 4WCEL 2QM1A 5KI6A 1QQCA 1BQMA 1I3AA 5LMUK 4FWLA 1L3UA 4BWMA 3VGMA 5M1FA 3PX4A 4IZ9A 3DM2A 4B3MK 2IC3A 3THVA 4IFEA 4H0TB 3FFIA 3CD6N 3UKUB 2HSTA 1UA0A 3AGKA 3OYJA 5LMNK 4CVNE 3THXA 1W2BM 3QIPA 4DV5K 3CC4N 3LDNA 3VQ8A 3CCJN 4BROA 3CCLN 4DFJA 3QINA 4BVOA 2O8FB 2HVIA 2IVPA 2HHQA 1IH7A 3MEEA 2QA4N 4DSLA
chains in the Genus database with same CATH topology
4FJJA 3HXMA 4LD0A 2F8SA 4BE2A 4KRFA 1RT6A 4CGGA 4CJQA 2P1JA 4C8NA 3VN5A 3AA4A 4C8MA 3HP6A 3DRPA 4HUFA 4E7JA 2YNFA 5K14A 4KKOA 3AVCA 4DF4A 2XY7A 2FC0A 3KD1E 4CJKA 3CFPA 3TABA 4DQQA 4DQPA 1RCHA 1I39A 2O4GA 3K5MA 2X74A 4CESA 4LH4A 3O3GA 1FXXA 1TGOA 3SYZA 1S1UA 4B9TA 1C0TA 2IOCA 4DU1A 5KGWA 3QESA 3CYMA 4IG3A 4F3TA 1A5WA 4ICLA 3S9HA 3C6TA 4AHVA 3SZ2A 1BISA 3AVBA 3C95A 5C42A 4FZZA 1Y97A 3NF8A 4FJIA 4FK4A 4TSXA 4DTXA 4KV8A 4OLBA 3WNHA 3F9KA 4KO0A 1RT4A 5DK5A 3WNGA 4O5BA 2OYQA 1RTHA 4LY7A 3NH1A 1A5XA 4CJLA 2RF2A 1T7PA 1DTQA 5CYMA 1X9WA 5FRMA 4CIEA 5J2MA 4E7KA 3ZT4A 1Q8IA 4CGJA 4CGDA 1SV5A 3SUPA 1S9GA 3EYZA 4ELVA 1X1PA 3TANA 3AVAA 4FJLA 3V9SA 5T7BA 4OKKA 1NK4A 3KLHA 3OYAA 4CEBA 4CEDA 3D0PA 5D3GA 4N5SA 2Y1JA 3KK3A 3TAQA 3AVJA 1S6QA 1JL2A 3PX6A 1JLCA 1S1VA 3K2PA 3RR7A 3HK2A 1LWEA 1VSFA 3V9ZA 1UA1A 1CZ9A 2Z1HA 4DQRA 5C25A 3LPTA 4CIFA 4CCHA 2D0BA 3LALA 4F4KA 3M8RA 2G8UA 2OZSA 3QEXA 3MXJA 4FJMA 2QXFA 3ZSWA 3HT3A 2G8FA 1NJZA 3NH2A 2Q3SA 2KZMA 3K5LA 4BDYA 4W5NA 1HQUA 3ASMA 1T03A 4J2EA 1JLFA 1LW0A 2ZQBA 3LANA 4ID5A 2FBTA 1T05A 4Z4CA 4BE0A 3H08A 3SV4A 1T8EA 3QO9A 1EP4A 1QSYA 1JLGA 4FJXA 1RILA 2YKMA 3RWUA 2BE2A 2W42A 3LP1A 4CJTA 4E1NA 4FLTA 3RTVA 1VK0A 1DTTA 2D0CA 4E7LA 1NK0A 2G8IA 4FK0A 3VQQA 1SKSA 3O3FA 3V1OA 4Z4HA 4M45A 2DFFA 5HP1A 2FBYA 4CGIA 3CG7A 3B6OA 3NF7A 5DMRA 1L5UA 3HPHA 4N76A 1B92A 1L3TA 1NK8A 1KLMA 1KTQA 3O4QA 3TWHA 2IDOA 3CQ8A 4EZ9A 3AVIA 1RNHA 1VSJA 4N41A 4B9NA 3OS0A 1BIUA 1ASUA 1WSIA 3BDPA 1IKWA 4G1QA 1RDAA 1YT3A 1W9HA 4AHUA 4CHPA 3OY9A 2PYJA 4M3UA 3O4NA 3CM6A 3T3FA 4HCBA 4E1MA 3AO4A 3MECA 4DLEA 1QS4A 4LH5A 3K59A 4Z4FA 1RT1A 3VQPA 4CJSA 4CHNA 3SQ1A 3LP0A 4CF0A 4FLUA 4UQGA 1ZBUA 4B8AB 4I9LA 4CERA 4CK1A 3K58A 3KK2A 4O0IA 1L3SA 1QSLA 3DLHA 3DOKA 4PUOA 2P5GA 4AILC 1FKOA 2D0AA 3SPYA 1UAXA 2NUBA 4CFAA 3OS2A 2KQ2A 1D5AA 1X9MA 2OPRA 4F3OA 3DYAA 3HL8A 3ISNC 1CXUA 3P5JA 3AVHA 4CJRA 4FJKA 3HO1A 2O4IA 1VSMA 1RT2A 3K5OA 2ATQA 3NGYA 2YNGA 1QHTA 1KFSA 4DQIA 1GOBA 1LAWA 4NYFA 1EETA 3VQEA 3P1GA 1NK6A 4LSNA 1WLJA 3M8SA 2G8KA 4BACA 3OYDA 3LWMA 4Z0UA 2XO7A 4FLXA 4CEFA 1C0MA 3DLEA 4DMNA 4JS5A 4FW2A 2OPSA 3AO1A 4C8OA 4KREA 2KW4A 3OYGA 1IKYA 3L2QA 1ZBLA 4PWDA 2X6NA 4DTOA 4DWIA 5CYQA 3V9XA 3RR8A 1NOZA 4JRPA 1UWBA 4NYNA 3NGZA 5JS2A 2KZZA 2B4JA 3AO3A 5EU7A 4M41A 3ZSXA 4KFBA 3F73A 1NK5A 2AJQA 1RBVA 4Y1CA 3SI6A 2VG5A 2QK9A 3L2RA 1NKEA 1TAQA 4XIUA 1J9AA 4RW4A 4E7HA 4GMJB 1SKRA 2BGGA 3SQ2A 3HYFA 3VQCA 1KVAA 1TKZA 3NF9A 3PUFA 3U3YA 4FJ9A 3SQ4A 3KLIA 3ZCMA 2OZMA 3QNOA 1XC9A 2HB5A 3B6PA 4F2SA 1U47A 4HTUA 1JLQA 3HVRA 3MAQA 2GBZA 1IG9A 2DFHA 1HNVA 3CFRA 1ZBIA 4KB0A 1RDBA 1HYVA 1NKBA 2PY5A 3OJUA 4IKFA 4OGCA 4YFUA 3VQ5A 5JS1A 3KK1A 1RTIA 1RBSA 3LWLA 4HUGA 4CHOA 4EP5A 1QSSA 1BIZA 1REVA 4QOZB 4FYDA 3NH0A 1XHXA 2BANA 1C0UA 4AHTA 1KCFA 3VA0A 3RRGA 4M3WA 4KI4A 1TKTA 4FVMA 1VRUA 1J54A 3NGIA 4N47A 4CGFA 5HLFA 1NJWA 4RW8A 4HUEA 4FK2A 2QKBA 2FBXA 1QE1A 3VQ9A 4JRQA 4GVMA 4CGHA 4L8RB 3OYFA 3TAMA 4FZYA 3PO4A 2OA8A 2FBVA 3NFAA 1U4BA 4MQ3A 4CK2A 3ZT1A 3V4IA 1BI4A 5CZ1A 1VRTA 4N56A 3OYEA 1U45A 4CEOA 3LPUA 4FM2A 4B9SA 3C6UA 3D45A 3V9WA 4CEAA 2X78A 3SUNA 3OYBA 2HHUA 3QLHA 3KIOA 1TVRA 3SUQA 4CFDA 3NF6A 4ZTJA 1S9EA 4ID1A 4WE1A 3KLEA 4CHQA 1WN7A 4DF8A 2JLEA 2RPIA 3DI6A 5KRSA 3K5NA 2A1SA 1R0AA 4QCLA 4CE9A 1U49A 3OYIA 3S3NA 4CJFA 1S6PA 2XRIA 4DTMA 3E01A 3QEVA 3M8QA 3ZSRA 1G15A 1SL0A 3KLFA 2A1RA 3RMCA 1LAVA 4OKEA 5CY4A 3NDKA 4FLVA 4IDKA 4FJ7A 3HVTA 1WSJA 3ZSYA 3EY1A 4I2QA 3IS9A 3SCXA 1LWCA 1FKPA 2D5RA 3AVLA 4GW6A 4NCBA 1ZBHA 5I3UA 4DU3A 2ZD1A 1B9DA 3NCIA 3A2FA 4Y1DA 1D9FA 3JYTA 3DRRA 4DTSA 3QEWA 3LAMA 3ZT3A 3I8DA 1GOAA 5SWMA 4M3XA 1RT3A 3KTQA 1TK0A 5FROA 4E3SA 3CFOA 4KHSA 1WSFA 1TK5A 1JLEA 2YKNA 4H8KA 3VQAA 1SL1A 4I9QA 1HQEA 2B5JA 1HNIA 4ELUA 3V1QA 3RMAA 1HMVA 4BDZA 1X9SA 4I7FA 5HROA 4KHWA 4B08A 2VG6A 4BDPA 1U48A 4KHUA 1XI1A 1JL1A 3DLKA 4O44A 1U04A 5C24A 2LSNA 4B8CA 3HP9A 2PYLA 2DFEA 1EXQA 1TAUA 3KLGA 4FXDA 2DTUA 1JLBA 5HRNA 4ELTA 4OPJA 4M42A 3NAEA 1KFDA 1KVCA 1RDDA 3KJVA 4KHYA 2HNZA 4CHZA 1LV5A 1MU2A 4W5TA 4CF8A 4DSFA 3SJJA 3TI0A 2IGIA 2I5JA 2OPQA 3VQDA 2VWJA 3ZSZA 2HMIA 2XY8A 1BL3A 1VSHA 4DSKA 4F8RA 4DTRA 3MXMA 1NJYA 1RDCA 1YTUA 2HNYA 1ASWA 3BGRA 1TL1A 4PA1A 3ULDA 4FLZA 5J2QA 1TV6A 2X6SA 3VQBA 3MXIA 4CF1A 2HHWA 4AHSA 4FLWA 1O1WA 1J5OA 5FRNA 4IFYA 4W5RA 2KFNA 4O4GA 3I0RA 2F8TA 2EX3A 3TAFA 3AA3A 4KTZA 1NK9A 3NHGA 4M3TA 4KTWA 4BE1A 1BCMA 4PQUA 2XY5A 2VWKA 4ZTFA 4AH9A 5KRTA 2HW3A 2HHXA 1DLOA 3DMJA 5FDLA 1HJRA 2Y1IA 4OGEA 2WOMA 3T1AA 4CF9A 2G8VA 3KD5E 3L8BA 4IG0A 4OVLA 1F21A 1TK8A 2IS3A 1C1AA 1C1CA 4E7IA 4B9VA 1L3VA 4CJUA 1FK9A 1TKDA 1HYSA 1Z25A 2BDPA 1WAFA 1NOYA 1LW2A 4DLGA 4C8LA 3L2WA 3ITHA 4Z4GA 2HHVA 5E41A 3AVMA 4HHTA 4M3ZA 5J2NA 2YHBA 4H4MA 2KTQA 3LZIA 1Q9XA 3EZ5A 1CLQA 3SPZA 1K6YA 1YTAA 1ITGA 1EX4A 4KAZA 3IRXA 3L3UA 4RW7A 4CJEA 1Q9YA 3ZT2A 1ZYQA 4CIGA 1WNSA 1GOCA 4Q0BA 3AO5A 3TAPA 1C1BA 1RBUA 3QNNA 4M3RA 3HM9A 2RKIA 4RW6A 3JSMA 4M3YA 1S1WA 1UOCA 2KFZA 4FJ8A 3IG1A 3VQ4A 3U3GA 3HPOA 3SQ0A 1SUQA 1KVBA 5HBMA 4DFKA 1VSEA 4J2AA 5SZTA 3OYHA 1BQNA 3LZJA 1TKXA 3M8PA 4AHRA 3P83D 4DS5A 3LAKA 1XHZA 4FJ5A 2ETJA 3DRSA 1BCOA 4DU4A 5J2PA 4PY5A 3PY8A 4FJNA 1YVUA 3SNNA 5HRRA 2P5OA 4B3OA 3DLRA 4Z4EA 3HJFA 3OJSA 1JLAA 3AVFA 4O0JA 4CJ5A 4Z4IA 1TL3A 4F2RA 4DTPA 4B9LA 2R7YA 1QTMA 4E0DA 1RT5A 2E6MA 4KI6A 1VSKA 1RBTA 1WSEA 3PX0A 4CEZA 4DSIA 4FZXC 4H4OA 3ZSOA 2GV9A 3L3VA 3RRHA 1A5VA 1JKHA 4RW9A 4Q5VA 3RMBA 1SL2A 3MEDA 4CJ3A 4ZHRA 3AVGA 4RG8A 3OS1A 5I42A 4EP4A 4MFBA 2B6AA 3MEGA 1IO2A 1HRHA 1WSGA 4E89A 5KGXA 3OYKA 1N6QA 1D9DA 2P51A 3HSTB 4NCAA 3L2VA 5HRPA 3ALYA 4DG1A 2G8WA 4QAGA 2PZSA 3V81A 4JS4A 3SV3A 3S3OA 4CECA 4CJPA 2ZE2A 3LDSA 4FM1A 1KLNA 1BHLA 5HRSA 4B9MA 2YNIA 2OPPA 1CXQA 2Z1JA 3VQ7A 3ZSQA 4DTNA 4KPYA 1S1XA 3KKSA 4DSEA 3VA3A 3PV8A 1LWFA 1S5JA 4CFBA 4W5QA 1KSPA 4B9UA 3OYNA 3LP2A 1JXEA 4OPKA 2RN2A 1ZBFA 2Z1GA 2YNHA 3G10A 1IKXA 2DY4A 3OYCA 4K8XA 3OYMA 3WNFA 1CZBA 3S3MA 4I2PA 2E6LA 3DLBA 4YNQA 5CZ2A 1Z26A 1C6VA 1RBRA 4CJVA 4K8ZA 4HCCA 4AHCA 3QETA 4KTQA 3G0ZA 2ITGA 1NKCA 2F96A 3QERA 4J2BA 2HHTA 4JLHA 1IKVA 3AVNA 4DSJA 3OYLA 1KRPA 3TAGA 4KB1A 2YV0X 2G8HA 1EKEA 1S1TA 3O3HA 1NJXA 4E19A 3TARA 4R5PA 4FCYA 2IAJA 3AA5X 4J2DA 1W0HA 3ZSVA 3K57A 3DLGA 3AVKA 3NBPA 4CF2A 4OJRA 3SUOA 1NK7A 3CM5A 2HNDA 2XY6A 1ASVA 4CEQA 4CJWA 3RMDA 4O55A 3V1RA 1WAJA 3QIOA 3QEPA 3IAYA 2HVHA 2JGUA 3AO2A 4FJGA 4C8KA 4FLYA 3KKRA 3V9UA 1BGXT 2XHBA 5J1EA 4DTJA 4CK3A 2QKKA 4OLAA 2E4LA 3AA2A 2VG7A 1QQCA 5KI6A 4DTUA 2YHAA 1BQMA 3I0SA 3V6DA 4DS4A 1I3AA 3DOLA 1SKWA 4LSLA 1J53A 3QEIA 1N5YA 3C94A 1L3UA 3OVNA 4BWMA 3WNEA 4KHNA 4OKJA 4BWJA 1RTDA 2Z1IA 3LP3A 3L2UA 3TR8A 3TAEA 3PX4A 4HVJA 4FJHA 4IBNA 4FW1A 2EHGA 3DM2A 4EZ6A 2IC3A 4NCGA 1HPZA 3THVA 1HYZA 3T19A 4CEEA 3FFIA 3HPGA 4CHYA 3NE6A 4CFCA 3ZT0A 1WSHA 2HHSA 4DFMA 4KHQA 1VSIA 1UA0A 3OYJA 2WONA 1VSDA 3QIPA 1D8YA 1JXBA 3VQ8A 3PO5A 1VSLA 4DFPA 1B9FA 2GUIA 3U6FA 4DFJA 3QINA 3UIQA 1RT7A 3AV9A 4IFVA 5KTQA 2HVIA 4DQSA 1IH7A 2HHQA 1RTJA 1XWLA 3MEEA 4FM0A 3VQ6A 4CJ4A 4DSLA 1BI4B 4W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJJ A;  3HXM A;  4LD0 A;  2F8S A;  4BE2 A;  4KRF A;  1RT6 A;  4CGG A;  4CJQ A;  2P1J A;  4C8N A;  3VN5 A;  3AA4 A;  4C8M A;  3HP6 A;  3DRP A;  4HUF A;  4E7J A;  2YNF A;  5K14 A;  4KKO A;  3AVC A;  4DF4 A;  2XY7 A;  2FC0 A;  3KD1 E;  4CJK A;  3CFP A;  3TAB A;  4DQQ A;  4DQP A;  1RCH A;  1I39 A;  2O4G A;  3K5M A;  2X74 A;  4CES A;  4LH4 A;  3O3G A;  1FXX A;  1TGO A;  3SYZ A;  1S1U A;  4B9T A;  1C0T A;  2IOC A;  4DU1 A;  5KGW A;  3QES A;  3CYM A;  4IG3 A;  4F3T A;  1A5W A;  4ICL A;  3S9H A;  3C6T A;  4AHV A;  3SZ2 A;  1BIS A;  3AVB A;  3C95 A;  5C42 A;  4FZZ A;  1Y97 A;  3NF8 A;  4FJI A;  4FK4 A;  4TSX A;  4DTX A;  4KV8 A;  4OLB A;  3WNH A;  3F9K A;  4KO0 A;  1RT4 A;  5DK5 A;  3WNG A;  4O5B A;  2OYQ A;  1RTH A;  4LY7 A;  3NH1 A;  1A5X A;  4CJL A;  2RF2 A;  1T7P A;  1DTQ A;  5CYM A;  1X9W A;  5FRM A;  4CIE A;  5J2M A;  4E7K A;  3ZT4 A;  1Q8I A;  4CGJ A;  4CGD A;  1SV5 A;  3SUP A;  1S9G A;  3EYZ A;  4ELV A;  1X1P A;  3TAN A;  3AVA A;  4FJL A;  3V9S A;  5T7B A;  4OKK A;  1NK4 A;  3KLH A;  3OYA A;  4CEB A;  4CED A;  3D0P A;  5D3G A;  4N5S A;  2Y1J A;  3KK3 A;  3TAQ A;  3AVJ A;  1S6Q A;  1JL2 A;  3PX6 A;  1JLC A;  1S1V A;  3K2P A;  3RR7 A;  3HK2 A;  1LWE A;  1VSF A;  3V9Z A;  1UA1 A;  1CZ9 A;  2Z1H A;  4DQR A;  5C25 A;  3LPT A;  4CIF A;  4CCH A;  2D0B A;  3LAL A;  4F4K A;  3M8R A;  2G8U A;  2OZS A;  3QEX A;  3MXJ A;  4FJM A;  2QXF A;  3ZSW A;  3HT3 A;  2G8F A;  1NJZ A;  3NH2 A;  2Q3S A;  2KZM A;  3K5L A;  4BDY A;  4W5N A;  1HQU A;  3ASM A;  1T03 A;  4J2E A;  1JLF A;  1LW0 A;  2ZQB A;  3LAN A;  4ID5 A;  2FBT A;  1T05 A;  4Z4C A;  4BE0 A;  3H08 A;  3SV4 A;  1T8E A;  3QO9 A;  1EP4 A;  1QSY A;  1JLG A;  4FJX A;  1RIL A;  2YKM A;  3RWU A;  2BE2 A;  2W42 A;  3LP1 A;  4CJT A;  4E1N A;  4FLT A;  3RTV A;  1VK0 A;  1DTT A;  2D0C A;  4E7L A;  1NK0 A;  2G8I A;  4FK0 A;  3VQQ A;  1SKS A;  3O3F A;  3V1O A;  4Z4H A;  4M45 A;  2DFF A;  5HP1 A;  2FBY A;  4CGI A;  3CG7 A;  3B6O A;  3NF7 A;  5DMR A;  1L5U A;  3HPH A;  4N76 A;  1B92 A;  1L3T A;  1NK8 A;  1KLM A;  1KTQ A;  3O4Q A;  3TWH A;  2IDO A;  3CQ8 A;  4EZ9 A;  3AVI A;  1RNH A;  1VSJ A;  4N41 A;  4B9N A;  3OS0 A;  1BIU A;  1ASU A;  1WSI A;  3BDP A;  1IKW A;  4G1Q A;  1RDA A;  1YT3 A;  1W9H A;  4AHU A;  4CHP A;  3OY9 A;  2PYJ A;  4M3U A;  3O4N A;  3CM6 A;  3T3F A;  4HCB A;  4E1M A;  3AO4 A;  3MEC A;  4DLE A;  1QS4 A;  4LH5 A;  3K59 A;  4Z4F A;  1RT1 A;  3VQP A;  4CJS A;  4CHN A;  3SQ1 A;  3LP0 A;  4CF0 A;  4FLU A;  4UQG A;  1ZBU A;  4B8A B;  4I9L A;  4CER A;  4CK1 A;  3K58 A;  3KK2 A;  4O0I A;  1L3S A;  1QSL A;  3DLH A;  3DOK A;  4PUO A;  2P5G A;  4AIL C;  1FKO A;  2D0A A;  3SPY A;  1UAX A;  2NUB A;  4CFA A;  3OS2 A;  2KQ2 A;  1D5A A;  1X9M A;  2OPR A;  4F3O A;  3DYA A;  3HL8 A;  3ISN C;  1CXU A;  3P5J A;  3AVH A;  4CJR A;  4FJK A;  3HO1 A;  2O4I A;  1VSM A;  1RT2 A;  3K5O A;  2ATQ A;  3NGY A;  2YNG A;  1QHT A;  1KFS A;  4DQI A;  1GOB A;  1LAW A;  4NYF A;  1EET A;  3VQE A;  3P1G A;  1NK6 A;  4LSN A;  1WLJ A;  3M8S A;  2G8K A;  4BAC A;  3OYD A;  3LWM A;  4Z0U A;  2XO7 A;  4FLX A;  4CEF A;  1C0M A;  3DLE A;  4DMN A;  4JS5 A;  4FW2 A;  2OPS A;  3AO1 A;  4C8O A;  4KRE A;  2KW4 A;  3OYG A;  1IKY A;  3L2Q A;  1ZBL A;  4PWD A;  2X6N A;  4DTO A;  4DWI A;  5CYQ A;  3V9X A;  3RR8 A;  1NOZ A;  4JRP A;  1UWB A;  4NYN A;  3NGZ A;  5JS2 A;  2KZZ A;  2B4J A;  3AO3 A;  5EU7 A;  4M41 A;  3ZSX A;  4KFB A;  3F73 A;  1NK5 A;  2AJQ A;  1RBV A;  4Y1C A;  3SI6 A;  2VG5 A;  2QK9 A;  3L2R A;  1NKE A;  1TAQ A;  4XIU A;  1J9A A;  4RW4 A;  4E7H A;  4GMJ B;  1SKR A;  2BGG A;  3SQ2 A;  3HYF A;  3VQC A;  1KVA A;  1TKZ A;  3NF9 A;  3PUF A;  3U3Y A;  4FJ9 A;  3SQ4 A;  3KLI A;  3ZCM A;  2OZM A;  3QNO A;  1XC9 A;  2HB5 A;  3B6P A;  4F2S A;  1U47 A;  4HTU A;  1JLQ A;  3HVR A;  3MAQ A;  2GBZ A;  1IG9 A;  2DFH A;  1HNV A;  3CFR A;  1ZBI A;  4KB0 A;  1RDB A;  1HYV A;  1NKB A;  2PY5 A;  3OJU A;  4IKF A;  4OGC A;  4YFU A;  3VQ5 A;  5JS1 A;  3KK1 A;  1RTI A;  1RBS A;  3LWL A;  4HUG A;  4CHO A;  4EP5 A;  1QSS A;  1BIZ A;  1REV A;  4QOZ B;  4FYD A;  3NH0 A;  1XHX A;  2BAN A;  1C0U A;  4AHT A;  1KCF A;  3VA0 A;  3RRG A;  4M3W A;  4KI4 A;  1TKT A;  4FVM A;  1VRU A;  1J54 A;  3NGI A;  4N47 A;  4CGF A;  5HLF A;  1NJW A;  4RW8 A;  4HUE A;  4FK2 A;  2QKB A;  2FBX A;  1QE1 A;  3VQ9 A;  4JRQ A;  4GVM A;  4CGH A;  4L8R B;  3OYF A;  3TAM A;  4FZY A;  3PO4 A;  2OA8 A;  2FBV A;  3NFA A;  1U4B A;  4MQ3 A;  4CK2 A;  3ZT1 A;  3V4I A;  1BI4 A;  5CZ1 A;  1VRT A;  4N56 A;  3OYE A;  1U45 A;  4CEO A;  3LPU A;  4FM2 A;  4B9S A;  3C6U A;  3D45 A;  3V9W A;  4CEA A;  2X78 A;  3SUN A;  3OYB A;  2HHU A;  3QLH A;  3KIO A;  1TVR A;  3SUQ A;  4CFD A;  3NF6 A;  4ZTJ A;  1S9E A;  4ID1 A;  4WE1 A;  3KLE A;  4CHQ A;  1WN7 A;  4DF8 A;  2JLE A;  2RPI A;  3DI6 A;  5KRS A;  3K5N A;  2A1S A;  1R0A A;  4QCL A;  4CE9 A;  1U49 A;  3OYI A;  3S3N A;  4CJF A;  1S6P A;  2XRI A;  4DTM A;  3E01 A;  3QEV A;  3M8Q A;  3ZSR A;  1G15 A;  1SL0 A;  3KLF A;  2A1R A;  3RMC A;  1LAV A;  4OKE A;  5CY4 A;  3NDK A;  4FLV A;  4IDK A;  4FJ7 A;  3HVT A;  1WSJ A;  3ZSY A;  3EY1 A;  4I2Q A;  3IS9 A;  3SCX A;  1LWC A;  1FKP A;  2D5R A;  3AVL A;  4GW6 A;  4NCB A;  1ZBH A;  5I3U A;  4DU3 A;  2ZD1 A;  1B9D A;  3NCI A;  3A2F A;  4Y1D A;  1D9F A;  3JYT A;  3DRR A;  4DTS A;  3QEW A;  3LAM A;  3ZT3 A;  3I8D A;  1GOA A;  5SWM A;  4M3X A;  1RT3 A;  3KTQ A;  1TK0 A;  5FRO A;  4E3S A;  3CFO A;  4KHS A;  1WSF A;  1TK5 A;  1JLE A;  2YKN A;  4H8K A;  3VQA A;  1SL1 A;  4I9Q A;  1HQE A;  2B5J A;  1HNI A;  4ELU A;  3V1Q A;  3RMA A;  1HMV A;  4BDZ A;  1X9S A;  4I7F A;  5HRO A;  4KHW A;  4B08 A;  2VG6 A;  4BDP A;  1U48 A;  4KHU A;  1XI1 A;  1JL1 A;  3DLK A;  4O44 A;  1U04 A;  5C24 A;  2LSN A;  4B8C A;  3HP9 A;  2PYL A;  2DFE A;  1EXQ A;  1TAU A;  3KLG A;  4FXD A;  2DTU A;  1JLB A;  5HRN A;  4ELT A;  4OPJ A;  4M42 A;  3NAE A;  1KFD A;  1KVC A;  1RDD A;  3KJV A;  4KHY A;  2HNZ A;  4CHZ A;  1LV5 A;  1MU2 A;  4W5T A;  4CF8 A;  4DSF A;  3SJJ A;  3TI0 A;  2IGI A;  2I5J A;  2OPQ A;  3VQD A;  2VWJ A;  3ZSZ A;  2HMI A;  2XY8 A;  1BL3 A;  1VSH A;  4DSK A;  4F8R A;  4DTR A;  3MXM A;  1NJY A;  1RDC A;  1YTU A;  2HNY A;  1ASW A;  3BGR A;  1TL1 A;  4PA1 A;  3ULD A;  4FLZ A;  5J2Q A;  1TV6 A;  2X6S A;  3VQB A;  3MXI A;  4CF1 A;  2HHW A;  4AHS A;  4FLW A;  1O1W A;  1J5O A;  5FRN A;  4IFY A;  4W5R A;  2KFN A;  4O4G A;  3I0R A;  2F8T A;  2EX3 A;  3TAF A;  3AA3 A;  4KTZ A;  1NK9 A;  3NHG A;  4M3T A;  4KTW A;  4BE1 A;  1BCM A;  4PQU A;  2XY5 A;  2VWK A;  4ZTF A;  4AH9 A;  5KRT A;  2HW3 A;  2HHX A;  1DLO A;  3DMJ A;  5FDL A;  1HJR A;  2Y1I A;  4OGE A;  2WOM A;  3T1A A;  4CF9 A;  2G8V A;  3KD5 E;  3L8B A;  4IG0 A;  4OVL A;  1F21 A;  1TK8 A;  2IS3 A;  1C1A A;  1C1C A;  4E7I A;  4B9V A;  1L3V A;  4CJU A;  1FK9 A;  1TKD A;  1HYS A;  1Z25 A;  2BDP A;  1WAF A;  1NOY A;  1LW2 A;  4DLG A;  4C8L A;  3L2W A;  3ITH A;  4Z4G A;  2HHV A;  5E41 A;  3AVM A;  4HHT A;  4M3Z A;  5J2N A;  2YHB A;  4H4M A;  2KTQ A;  3LZI A;  1Q9X A;  3EZ5 A;  1CLQ A;  3SPZ A;  1K6Y A;  1YTA A;  1ITG A;  1EX4 A;  4KAZ A;  3IRX A;  3L3U A;  4RW7 A;  4CJE A;  1Q9Y A;  3ZT2 A;  1ZYQ A;  4CIG A;  1WNS A;  1GOC A;  4Q0B A;  3AO5 A;  3TAP A;  1C1B A;  1RBU A;  3QNN A;  4M3R A;  3HM9 A;  2RKI A;  4RW6 A;  3JSM A;  4M3Y A;  1S1W A;  1UOC A;  2KFZ A;  4FJ8 A;  3IG1 A;  3VQ4 A;  3U3G A;  3HPO A;  3SQ0 A;  1SUQ A;  1KVB A;  5HBM A;  4DFK A;  1VSE A;  4J2A A;  5SZT A;  3OYH A;  1BQN A;  3LZJ A;  1TKX A;  3M8P A;  4AHR A;  3P83 D;  4DS5 A;  3LAK A;  1XHZ A;  4FJ5 A;  2ETJ A;  3DRS A;  1BCO A;  4DU4 A;  5J2P A;  4PY5 A;  3PY8 A;  4FJN A;  1YVU A;  3SNN A;  5HRR A;  2P5O A;  4B3O A;  3DLR A;  4Z4E A;  3HJF A;  3OJS A;  1JLA A;  3AVF A;  4O0J A;  4CJ5 A;  4Z4I A;  1TL3 A;  4F2R A;  4DTP A;  4B9L A;  2R7Y A;  1QTM A;  4E0D A;  1RT5 A;  2E6M A;  4KI6 A;  1VSK A;  1RBT A;  1WSE A;  3PX0 A;  4CEZ A;  4DSI A;  4FZX C;  4H4O A;  3ZSO A;  2GV9 A;  3L3V A;  3RRH A;  1A5V A;  1JKH A;  4RW9 A;  4Q5V A;  3RMB A;  1SL2 A;  3MED A;  4CJ3 A;  4ZHR A;  3AVG A;  4RG8 A;  3OS1 A;  5I42 A;  4EP4 A;  4MFB A;  2B6A A;  3MEG A;  1IO2 A;  1HRH A;  1WSG A;  4E89 A;  5KGX A;  3OYK A;  1N6Q A;  1D9D A;  2P51 A;  3HST B;  4NCA A;  3L2V A;  5HRP A;  3ALY A;  4DG1 A;  2G8W A;  4QAG A;  2PZS A;  3V81 A;  4JS4 A;  3SV3 A;  3S3O A;  4CEC A;  4CJP A;  2ZE2 A;  3LDS A;  4FM1 A;  1KLN A;  1BHL A;  5HRS A;  4B9M A;  2YNI A;  2OPP A;  1CXQ A;  2Z1J A;  3VQ7 A;  3ZSQ A;  4DTN A;  4KPY A;  1S1X A;  3KKS A;  4DSE A;  3VA3 A;  3PV8 A;  1LWF A;  1S5J A;  4CFB A;  4W5Q A;  1KSP A;  4B9U A;  3OYN A;  3LP2 A;  1JXE A;  4OPK A;  2RN2 A;  1ZBF A;  2Z1G A;  2YNH A;  3G10 A;  1IKX A;  2DY4 A;  3OYC A;  4K8X A;  3OYM A;  3WNF A;  1CZB A;  3S3M A;  4I2P A;  2E6L A;  3DLB A;  4YNQ A;  5CZ2 A;  1Z26 A;  1C6V A;  1RBR A;  4CJV A;  4K8Z A;  4HCC A;  4AHC A;  3QET A;  4KTQ A;  3G0Z A;  2ITG A;  1NKC A;  2F96 A;  3QER A;  4J2B A;  2HHT A;  4JLH A;  1IKV A;  3AVN A;  4DSJ A;  3OYL A;  1KRP A;  3TAG A;  4KB1 A;  2YV0 X;  2G8H A;  1EKE A;  1S1T A;  3O3H A;  1NJX A;  4E19 A;  3TAR A;  4R5P A;  4FCY A;  2IAJ A;  3AA5 X;  4J2D A;  1W0H A;  3ZSV A;  3K57 A;  3DLG A;  3AVK A;  3NBP A;  4CF2 A;  4OJR A;  3SUO A;  1NK7 A;  3CM5 A;  2HND A;  2XY6 A;  1ASV A;  4CEQ A;  4CJW A;  3RMD A;  4O55 A;  3V1R A;  1WAJ A;  3QIO A;  3QEP A;  3IAY A;  2HVH A;  2JGU A;  3AO2 A;  4FJG A;  4C8K A;  4FLY A;  3KKR A;  3V9U A;  1BGX T;  2XHB A;  5J1E A;  4DTJ A;  4CK3 A;  2QKK A;  4OLA A;  2E4L A;  3AA2 A;  2VG7 A;  1QQC A;  5KI6 A;  4DTU A;  2YHA A;  1BQM A;  3I0S A;  3V6D A;  4DS4 A;  1I3A A;  3DOL A;  1SKW A;  4LSL A;  1J53 A;  3QEI A;  1N5Y A;  3C94 A;  1L3U A;  3OVN A;  4BWM A;  3WNE A;  4KHN A;  4OKJ A;  4BWJ A;  1RTD A;  2Z1I A;  3LP3 A;  3L2U A;  3TR8 A;  3TAE A;  3PX4 A;  4HVJ A;  4FJH A;  4IBN A;  4FW1 A;  2EHG A;  3DM2 A;  4EZ6 A;  2IC3 A;  4NCG A;  1HPZ A;  3THV A;  1HYZ A;  3T19 A;  4CEE A;  3FFI A;  3HPG A;  4CHY A;  3NE6 A;  4CFC A;  3ZT0 A;  1WSH A;  2HHS A;  4DFM A;  4KHQ A;  1VSI A;  1UA0 A;  3OYJ A;  2WON A;  1VSD A;  3QIP A;  1D8Y A;  1JXB A;  3VQ8 A;  3PO5 A;  1VSL A;  4DFP A;  1B9F A;  2GUI A;  3U6F A;  4DFJ A;  3QIN A;  3UIQ A;  1RT7 A;  3AV9 A;  4IFV A;  5KTQ A;  2HVI A;  4DQS A;  1IH7 A;  2HHQ A;  1RTJ A;  1XWL A;  3MEE A;  4FM0 A;  3VQ6 A;  4CJ4 A;  4DSL A;  1BI4 B;  4W5O A; 
#chains in the Genus database with same CATH topology
 3CCM N;  2O8E A;  3DAW A;  5BPN A;  1RT6 A;  3WEE B;  2P1J A;  4XH4 A;  3VN5 A;  4E7J A;  4HUF A;  5K14 A;  2XY7 A;  2FC0 A;  1KQS M;  4LF4 K;  1DT9 A;  1S1U A;  2IOC A;  2RHK A;  4ICL A;  1QQO A;  2D4W A;  4FJI A;  4KV8 A;  4CD1 A;  3QBW A;  3GDQ A;  1CZA N;  3UKU A;  2RF2 A;  1JCE A;  1DTQ A;  5FRM A;  4CIE A;  2NRV A;  4CGJ A;  4CGD A;  1SV5 A;  2CH5 A;  3BP8 A;  3VTH A;  1X1P A;  3TAN A;  3AVA A;  4F9O A;  3V9S A;  2O8F A;  1NK4 A;  3D0P A;  3CCQ N;  2Y1J A;  3AVJ A;  4GNI A;  4JKH A;  1JL2 A;  3PX6 A;  1S1V A;  5AJ3 K;  3WEE A;  3V9Z A;  1CZ9 A;  2Z1H A;  5C25 A;  2D0B A;  4F4K A;  4EIA A;  1T44 A;  2G8U A;  5M1K A;  3ZSW A;  4YY3 K;  2G8F A;  2KZM A;  4CZJ A;  2V7Z A;  1T03 A;  4B1W B;  1LW0 A;  2ZQB A;  4FVU A;  4ID5 A;  1T05 A;  4Z4C A;  3SV4 A;  1QSY A;  4FJX A;  3R3L A;  4LFC K;  4FK0 A;  1QZ6 A;  3F5T A;  3O3F A;  4JN4 A;  4Z4H A;  2DFF A;  2D0O A;  2FBY A;  3NF7 A;  3M5R A;  5DMR A;  2VQF K;  1B92 A;  4B1U B;  4PKG A;  3O4Q A;  3CQ8 A;  1VSJ A;  3OS0 A;  1BIU A;  1IBM K;  3BDP A;  4A62 A;  4M3U A;  1YT3 A;  1W9H A;  1WOQ A;  4C1N I;  3CM6 A;  3T3F A;  4HCB A;  4DUY K;  5AQV A;  4Z4F A;  1OH8 A;  3LP0 A;  5BRH A;  4CBU A;  4UQG A;  1RFQ A;  2P5G A;  2HOE A;  3OS2 A;  1D5A A;  2OPR A;  4PHT X;  4EHU A;  4JV5 K;  2QW9 A;  3ISN C;  3L6Q A;  2NRZ A;  4FJK A;  4CJR A;  4YOT A;  1Z05 A;  1XMQ K;  4MDB A;  1Q7Y O;  1RT2 A;  4BC3 A;  1QHT A;  2GX9 A;  4NYF A;  1EET A;  3VQE A;  4JI2 K;  2A6A A;  5ELZ A;  1WLJ A;  1NK6 A;  3M8S A;  4DV4 K;  4FLX A;  2OPS A;  3AO1 A;  4DR1 K;  2KW4 A;  3CME N;  2VQE K;  3WQU A;  4K42 A;  2V51 B;  3VGL A;  3KK7 A;  4A5A A;  3RR8 A;  2O8D B;  3NGZ A;  4B3T K;  3NVK A;  2KZZ A;  2B4J A;  3ZSX A;  1NK5 A;  2AJQ A;  1GLF O;  1YUW A;  2VG5 A;  3SI6 A;  1NKE A;  3CI5 A;  1J9A A;  3E1Y A;  1YJW N;  4BQZ A;  1SKR A;  4CBW A;  1TKZ A;  3PUF A;  3KLI A;  2Q1N A;  3QNO A;  1S22 A;  1XC9 A;  1U47 A;  3DLL L;  2GBZ A;  1HNV A;  1N33 K;  4YOU A;  4DUZ K;  4IKF A;  4OGC A;  3JS6 A;  3VQ5 A;  3EE9 A;  1K73 O;  1RTI A;  4BR9 A;  3LWL A;  4CHO A;  4EP5 A;  2YI1 A;  4NB4 A;  2BAN A;  3MCA B;  4AHT A;  4KI4 A;  1TKT A;  4FVM A;  1VRU A;  3CPE A;  2QXL A;  3NGI A;  4N47 A;  1NJW A;  4LF5 K;  4RW8 A;  4HUE A;  5JMV A;  4JRQ A;  3R8E A;  2GWJ A;  3OYF A;  3HBT A;  3VET A;  3NFA A;  5LY3 A;  5M1P A;  1NGD A;  1U4B A;  2O8D A;  5CZ1 A;  1VRT A;  4B9S A;  2AP1 A;  3D45 A;  3UB5 A;  2X78 A;  3OYB A;  2HHU A;  2VCP A;  4HWI A;  3PIO L;  2EWS A;  4OX9 K;  4ID1 A;  3O9S A;  4DF8 A;  1R0A A;  3CCS N;  4QCL A;  1HX1 A;  3E01 A;  3C0B A;  3ZSR A;  1SL0 A;  3VES A;  3KLF A;  5AQN A;  3D2E B;  2ZJR L;  4OKE A;  2A1R A;  1HNX K;  2BTF A;  3ZSY A;  4UY8 O;  2D5R A;  4NCB A;  2VGM A;  1BA1 A;  3NCI A;  4FPA A;  3QEW A;  4CBX A;  3LAM A;  3FFK B;  3I8D A;  5SWM A;  1RT3 A;  1T3V A;  3CFO A;  4Z94 A;  1I94 K;  4KHS A;  4LF8 K;  1HNI A;  2H3G X;  5TKW A;  3RMA A;  1IG8 A;  4BG8 A;  4BDZ A;  4BRP A;  1X9S A;  2P9S B;  4BDP A;  2VG6 A;  5FPN A;  1MA9 B;  1E4G T;  3O80 A;  3UKR B;  1U48 A;  4KHU A;  4LFA K;  2PYL A;  1EXQ A;  4FXD A;  5HRN A;  4OPJ A;  4KH5 A;  3O9R A;  4JKA A;  2ASP A;  3D2E A;  3SJJ A;  2I5J A;  4LC9 B;  2XY8 A;  2F4V K;  5KPT A;  1VQL N;  3MXM A;  1NJY A;  3BGR A;  5J2Q A;  3ID8 A;  1VQN N;  4FLW A;  4A57 A;  5FRN A;  1XNR K;  1Q82 O;  3AA3 A;  4KTZ A;  3G4S N;  4KTW A;  1BCM A;  4PQU A;  1YF5 L;  4ZTF A;  1BUP A;  2QWR A;  1HJR A;  3TTF A;  3KD5 E;  4JAX A;  2W6L A;  2P9S A;  4IG0 A;  3UKR A;  3SAF A;  4WQ4 C;  2IS3 A;  1C1C A;  3BZK A;  5JVG L;  4CJU A;  1Z25 A;  1LW2 A;  4DLG A;  4A2A A;  3L2W A;  4Z4G A;  3AVM A;  4A61 A;  3DXM B;  2KTQ A;  3OA9 A;  4YOX A;  5HL7 L;  1YTA A;  3L3U A;  3J81 O;  3QIC A;  1NMN A;  1WNS A;  4Q0B A;  4XH1 A;  4M3R A;  1HJO A;  3MK6 A;  3JSM A;  2UU9 K;  2KFZ A;  3VQ4 A;  3U3G A;  5CE3 A;  2PFU A;  4J2A A;  4DQ8 A;  2PAV A;  3OYH A;  4IO8 A;  1ZC6 A;  3M8P A;  1HNW K;  4NLB A;  2Q31 A;  3MDQ A;  2Q0R A;  3DRS A;  5AQM A;  3EL2 A;  4PY5 A;  4FJN A;  3SNN A;  5HRR A;  4EFH A;  4Z4E A;  3HJF A;  4BY9 C;  3T69 A;  4JK7 A;  4O0J A;  1TL3 A;  1TYQ B;  4F2R A;  5AQT A;  4C1N K;  4KI6 A;  1EO1 A;  3DXM A;  2NRX A;  3O9Q A;  5C12 A;  3SAH A;  1JKH A;  5BRF A;  4MFB A;  3CMA N;  4NCA A;  2G8W A;  4QAG A;  1QVG M;  4CZL A;  1GLA G;  2ZJP L;  4I6M B;  4FM1 A;  3FZH A;  3LM2 A;  4YOV A;  1KLN A;  3FZL A;  4C23 A;  4B9M A;  4X64 K;  2Z1J A;  3C7N B;  2YHY A;  3ENH A;  3P4I A;  4DSE A;  3VA3 A;  1LWF A;  1S5J A;  4OPK A;  1JXE A;  4RCH A;  1ZBF A;  3OHR A;  1IKX A;  3OYC A;  4WF9 L;  4K8X A;  4U67 L;  1TYQ A;  3S3M A;  4I2P A;  2E6L A;  3DLB A;  4YNQ A;  3U9Z A;  5CZ2 A;  1Z26 A;  4Y0W A;  4FO0 A;  3K9K A;  4AHC A;  2P9U B;  3VEY A;  4KTQ A;  5LL6 Z;  2HHT A;  4IJA A;  3AVN A;  1GLB G;  5AZI B;  3TAG A;  1XUP O;  3HM8 A;  1EKE A;  3TAR A;  4FCY A;  1W0H A;  4IOX A;  3AVK A;  4OJR A;  1T6C A;  1WBB A;  2HND A;  3IAY A;  3VGK A;  3QEP A;  4C8K A;  3V9U A;  4DTJ A;  3C7N A;  3AAR A;  2D0P A;  4DTU A;  2HHH K;  3I0S A;  3DOL A;  1SKW A;  1IV0 A;  3OVN A;  3DWL A;  3F2K A;  3L2U A;  1HKG A;  4FJH A;  4IBN A;  5EX5 A;  4FW1 A;  1SS6 A;  2EHG A;  1HPZ A;  3NE6 A;  4CHY A;  4JHD B;  2HHS A;  2P9K B;  4KHQ A;  1VSI A;  5IWA K;  1VSD A;  4B1Y B;  1JXB A;  3HTV A;  3PO5 A;  1VSL A;  5AFU A;  4DR2 K;  5JLF A;  4JK9 A;  1XWL A;  4FM0 A;  5M1O A;  4W5O A;  3THW B;  4FJJ A;  3SLC A;  3MX5 A;  3ENB A;  4PKI A;  2RE2 A;  4CGG A;  1J5O A;  2IVN A;  3BF1 A;  2KFN A;  2YNF A;  4KKO A;  4DF4 A;  3KD1 E;  3TAB A;  3R6M A;  1RCH A;  1I39 A;  3K5M A;  4LH4 A;  1BO5 O;  3MX2 A;  1FXX A;  1TGO A;  2QWM A;  3ID6 A;  4JKG B;  5KGW A;  4IG3 A;  1Q86 O;  4JYA K;  5BN8 A;  4YOR A;  3SZ2 A;  4FZZ A;  3AVB A;  3WXJ A;  1Y97 A;  5A2Q O;  4TSX A;  4DTX A;  1RT4 A;  4CW7 B;  4JHD A;  2OYQ A;  1RTH A;  3NH1 A;  1A5X A;  2HF3 A;  3ZT4 A;  1HKB A;  4CZF A;  3N4P A;  4ISG A;  3SUP A;  1IBL K;  2UXB K;  1QQM A;  3OYA A;  4CEB A;  4CED A;  5D3G A;  3THW A;  3KK3 A;  4IEI A;  2GWK A;  2P9I B;  1O13 A;  1S6Q A;  3VTI A;  3K2P A;  3HK2 A;  1VSF A;  1BWF O;  2DPN A;  3EO3 A;  1NJZ A;  4JKG A;  3EE8 A;  3K5L A;  4W5N A;  1N8R O;  4J2E A;  5GAD P;  3LAN A;  2FBT A;  1EP4 A;  3HI0 A;  1IJJ A;  1JLG A;  2YKM A;  2BE2 A;  2W42 A;  3LP1 A;  4CJT A;  4E1N A;  4DV7 K;  4FLT A;  3HSC A;  1VK0 A;  4JI7 K;  2VYP A;  2GEM A;  3HZ6 A;  4BR0 A;  3V1O A;  4M45 A;  3MN5 A;  3CG7 A;  1L5U A;  3HPH A;  1KAX A;  1KTQ A;  3CCV N;  2FF3 B;  3L0Q A;  4GV6 A;  1IKW A;  1QZ5 A;  1OVY A;  3OY9 A;  4AHU A;  1HUX A;  2P9I A;  3O4N A;  3MEC A;  2A41 A;  1QS4 A;  5AQI A;  3CET A;  4CJS A;  1X9J A;  1Y64 A;  4CF0 A;  4CK1 A;  3KK2 A;  4O0I A;  3DOK A;  5EOY A;  2D0A A;  1UAX A;  2NUB A;  3OW2 M;  3CJ9 A;  1K8K B;  3H46 O;  4JI4 K;  3P5J A;  3HO1 A;  5C2D A;  5B8H A;  3K5O A;  4DQI A;  3P1G A;  4LSN A;  1IBK K;  2G8K A;  4Z0U A;  4FWQ A;  2CGJ A;  4K0K K;  1C0M A;  3DLE A;  2YJE A;  4C8O A;  4PL7 A;  3PSI A;  5JIC A;  3L2Q A;  5KQ8 A;  4PWD A;  1TUU A;  1NOZ A;  1QQN A;  5ADX H;  4YHH K;  5JS2 A;  3F73 A;  5EU7 A;  4Y1C A;  1OVQ A;  3L2R A;  4XIU A;  2J4R A;  4H0O A;  3B6P A;  4F2S A;  1K8K A;  3GE1 A;  1JLQ A;  4MDA A;  3CFR A;  4JI8 K;  1HYV A;  1YAG A;  2E2P A;  2A3Z A;  4YFU A;  3KK1 A;  2QWQ A;  3MCP A;  3VEO A;  1QSS A;  1BIZ A;  3LL3 A;  4FYD A;  1C0U A;  2E88 A;  1NGA A;  3CJ1 A;  3A5O C;  4WYB A;  3VQ9 A;  5AZJ B;  4L8R B;  3TAM A;  4FZY A;  1YVN A;  1XMO K;  1X3M A;  2FBV A;  3V4I A;  2NLX A;  3OYE A;  1U45 A;  1GLD G;  3LPU A;  4DR4 K;  3V9W A;  3KIO A;  4JI6 K;  1TVR A;  3NF6 A;  4ZTJ A;  1S9E A;  3KLE A;  4KBO A;  4BRQ A;  2VWB A;  1S6P A;  2XRI A;  1LAV A;  1RDU A;  3NDK A;  4FLV A;  3NVM A;  4NXM K;  2NZT A;  3HVT A;  1LOT B;  4I2Q A;  1NMD A;  3AVL A;  1ZBH A;  5I3U A;  3MWT A;  3J7A P;  1Q18 A;  3MMV A;  4ISE A;  4YDU A;  3A5L C;  3DRR A;  3ZT3 A;  1GOA A;  3KTQ A;  1MWK A;  2CGL A;  4NXN K;  5FRO A;  2ZWH A;  4E3S A;  4MO4 A;  3CQX A;  4CZK A;  3J7Y P;  3ATV A;  3VQA A;  1SL1 A;  3VPZ A;  3V1Q A;  3H1V X;  4QS7 A;  3O8M A;  3C6A A;  4B08 A;  4H5R A;  4O44 A;  1J5E K;  4JI5 K;  3HP9 A;  3SAG A;  3DXK B;  2YHW A;  3CCR N;  5JVH L;  2UUA K;  3NAE A;  4A59 A;  4KHY A;  2HBM A;  2HNZ A;  1LV5 A;  4BG9 A;  3W0L A;  2VWJ A;  4AM6 A;  3AAP A;  4DSK A;  4DTR A;  1YTU A;  2GTD A;  1ASW A;  2OCE A;  3KVG A;  2CGK A;  4AHS A;  4IFY A;  4W5R A;  4O4G A;  4DR7 K;  5E84 A;  4WFA L;  2F8T A;  2EX3 A;  1NK9 A;  2XY5 A;  1VQP N;  4KHP K;  2HHX A;  1DLO A;  2Y1I A;  4CF9 A;  2HBJ A;  1VQK N;  4OVL A;  5F2R A;  1ZXO A;  4E7I A;  3SJH A;  1L3V A;  1XQS C;  1TKD A;  3CXC M;  2BDP A;  2CH6 A;  1OH7 A;  4M3Z A;  2YHB A;  4H4M A;  3G71 N;  3LZI A;  1Q9X A;  3EZ5 A;  1EX4 A;  1D4X A;  3T7Z A;  3LDQ A;  1RBU A;  4XH5 A;  4IEE A;  4QS9 A;  1S1W A;  3SQ0 A;  4LFB K;  1SUQ A;  1KVB A;  3MN6 A;  4AM7 A;  5FPD A;  2YX6 A;  1XHZ A;  3LAK A;  3TTC A;  4BRC A;  4DU4 A;  5C2F A;  2GEL A;  4GKJ K;  4B9Q A;  3DLR A;  1C0F A;  3AVF A;  4DTP A;  4B9L A;  4DV6 K;  3ZX2 A;  1RT5 A;  4CI6 A;  2E6M A;  1VSK A;  3MWP A;  4PKH A;  3FR0 A;  2ASM A;  2KHO A;  1A5V A;  4RW9 A;  4BRN A;  1SL2 A;  3QFU A;  3OS1 A;  2D1K A;  2B6A A;  4E89 A;  5KGX A;  1N6Q A;  5AQZ A;  3ALY A;  4DG1 A;  1HPM A;  3A5M C;  5FLX O;  3E9O A;  3FZM A;  4EHT A;  4YOW A;  1YI2 N;  3BY5 A;  1V4T A;  2IVO A;  1HKC A;  1Q81 O;  3PLA A;  1CXQ A;  3VQ7 A;  3PV8 A;  1KSP A;  4W5Q A;  4B9U A;  2YNH A;  3G10 A;  5AQU A;  2A40 A;  3O9T A;  3QB0 A;  4H5T A;  4H03 B;  1P90 A;  2V52 B;  3OYM A;  2DY4 A;  5EVZ A;  1T6D A;  1C6V A;  1RBR A;  4CJV A;  4HCC A;  2ITG A;  2W41 A;  3QER A;  5AQL A;  1YHQ N;  5EXW A;  1XNQ K;  4V19 S;  4KB1 A;  3T1H K;  1FJG K;  4GV3 A;  1S1T A;  2UYT A;  3O3H A;  4E19 A;  2IAJ A;  3AA5 X;  4FOI A;  4J2D A;  2P9L B;  3K57 A;  2NRH A;  4CF2 A;  1NK7 A;  4X66 K;  2XY6 A;  4OPA A;  5BR9 A;  4FJG A;  3QBX A;  4O8K A;  3KKR A;  1BGX T;  3A5N C;  3U4L A;  4OLA A;  3E9P A;  2E4L A;  1V4S A;  3AA2 A;  1HNZ K;  2VG7 A;  2O8C B;  2FSN A;  4DS4 A;  2KKZ A;  1E4F T;  3HOS A;  2O8B B;  3WNE A;  4KHN A;  4BWJ A;  2ZGY A;  3CJ7 A;  1RTD A;  4CD3 A;  4BRE A;  3TR8 A;  3WXM B;  3TAE A;  4HVJ A;  1VQ8 N;  4JNE A;  4N76 A;  4EZ6 A;  4NCG A;  3HPG A;  1WSH A;  2NRR A;  4H0Y B;  4JI3 K;  4BQL A;  3VMF B;  2WON A;  4DV0 K;  2P9N B;  1D8Y A;  3U6F A;  3VOV A;  4A5B A;  4M7X A;  1RT7 A;  3AV9 A;  4IFV A;  5BRD A;  5KTQ A;  4DQS A;  3VQ6 A;  4CJ4 A;  3D7E O;  1BI4 B;  4BE2 A;  4KRF A;  3ULE B;  4U7B A;  4CJQ A;  4C8N A;  3HP6 A;  3DRP A;  3PIP L;  3UIQ A;  3AVC A;  2E1Y A;  4DQP A;  4DQQ A;  2O4G A;  3SYZ A;  5CHI A;  4B9T A;  4F3T A;  1C0T A;  2E2Q A;  3E9L A;  4JI0 K;  1A5W A;  3H45 C;  3S9H A;  4AHV A;  3C95 A;  5C42 A;  4X65 K;  4OLB A;  3WNH A;  5DK5 A;  3WNG A;  4O5B A;  1P8Z A;  2Q97 A;  4CJL A;  1T7P A;  5CYM A;  5J2M A;  4E7K A;  1Q8I A;  4ILH A;  2E2N A;  2E8A A;  4ELV A;  4FJL A;  3I33 A;  5T7B A;  4OKK A;  4WQ5 C;  4BRL A;  4GY2 B;  4H5W A;  3KZB A;  1LWE A;  4CIF A;  4CCH A;  3LAL A;  3CJA A;  5GIN A;  2OZS A;  3QEX A;  4FJM A;  2UUB K;  3NH2 A;  1N32 K;  1HQU A;  3MN7 A;  3H08 A;  1T8E A;  5GIP A;  3P39 A;  4HTL A;  3RWU A;  1BOT O;  4DV1 K;  3P38 A;  4JD2 B;  4L3Q A;  2G8I A;  3VQQ A;  1NNE A;  2V7Y A;  5HP1 A;  4CGI A;  2WC9 A;  4FWO A;  1NK8 A;  2QEX N;  1EWR A;  2IDO A;  3AVI A;  1RNH A;  1KC8 O;  5AQX A;  4B9N A;  3J7Z O;  1WSI A;  2W40 A;  4G1Q A;  4YOY A;  2PYJ A;  3AO4 A;  4DLE A;  1OH6 A;  4I6M A;  4LH5 A;  2NRW A;  3K59 A;  3VQP A;  4CHN A;  2WUS A;  2OTL N;  1ZBU A;  4B8A B;  4I9L A;  1L3S A;  3K58 A;  1QSL A;  4OO1 J;  5M1N A;  1FKO A;  3SPY A;  4DR6 K;  3SK3 A;  2E20 A;  3HL8 A;  4BRD A;  3AVH A;  3IFR A;  2O4I A;  4JD2 A;  3NGY A;  2YNG A;  2P9U A;  1LAW A;  4FWM A;  4E1J A;  1ATN A;  5AZI A;  3OYD A;  4BAC A;  3O4W A;  2XO7 A;  4B1Z A;  1EWQ A;  4RWT A;  4KRE A;  1NWK A;  1WUA A;  1IKY A;  3VER A;  1DKG D;  4DTO A;  4DWI A;  5CYQ A;  2QWO A;  3D6R A;  4NYN A;  2HMP A;  3AO3 A;  4M41 A;  1RBV A;  4J8F A;  4B1X B;  3ZYY X;  4GMJ B;  2BGG A;  3SQ2 A;  4FJ9 A;  1KVA A;  4FL9 A;  5HOO A;  3U3Y A;  3ZCM A;  2OZM A;  2HB5 A;  2QWP A;  4HTU A;  3IMX A;  5BPL A;  1VQ4 N;  1KXP A;  2DFH A;  1IG9 A;  1ZBI A;  3KHY A;  1RDB A;  1FW6 A;  1NKB A;  3OJU A;  5JS1 A;  1RBS A;  2ASO A;  3GBT A;  5BN9 A;  1REV A;  4QOZ B;  3NH0 A;  1XHX A;  2P9K A;  3VA0 A;  2HBL A;  1J54 A;  4CZI A;  4CGF A;  3BEX A;  5HLF A;  4CZH A;  4IWV A;  2QKB A;  2FBX A;  1QE1 A;  4BR4 A;  4GVM A;  4BRF A;  4CZM A;  3PO4 A;  5F1X A;  4MLH A;  1J6Z A;  3ZT1 A;  5GAG P;  4NO7 A;  3FLC O;  3BF3 A;  3C6U A;  4B3R K;  5H1S Q;  4CEA A;  3SUQ A;  3WXL A;  2JWK A;  3DI6 A;  2RPI A;  4GVE A;  5KRS A;  2A1S A;  3S3N A;  4CJF A;  3WXI A;  3O08 A;  4LF7 K;  3QEV A;  3FZK A;  1G15 A;  2ZF5 O;  1WBD A;  3SCX A;  1FKP A;  4DU3 A;  2ZD1 A;  1B9D A;  1H1V A;  3A2F A;  3H6E A;  2FSK A;  2VGN A;  4CJ7 A;  3J80 O;  1WSF A;  1TK5 A;  2OTJ N;  2YKN A;  1HQE A;  4ELU A;  5AQS A;  5HRO A;  4KHW A;  4DV2 K;  1XI1 A;  1JL1 A;  3DLK A;  5C24 A;  2LSN A;  2DFE A;  3KWI A;  1JLB A;  4ELT A;  3VF2 A;  5ADX A;  4M42 A;  1VQ5 N;  1MU2 A;  4W5T A;  4CF8 A;  2IGI A;  2F9T A;  3VQD A;  3WQT A;  5DM6 L;  1RDC A;  3THY B;  2HNY A;  4PA1 A;  4DHY A;  3ULD A;  1N36 K;  3MXI A;  3MN9 A;  1E3M A;  4DB3 A;  2O8E B;  4B3S K;  3EEQ A;  3S41 A;  4PL8 A;  5GAE P;  2ZJQ L;  2WTU A;  4BE1 A;  4AH9 A;  5KRT A;  1DEJ A;  2HW3 A;  2BUP A;  4OGE A;  5AQR A;  4G9Z A;  3WT0 A;  3L8B A;  2QWL A;  1C1A A;  4B9V A;  4IOA L;  1FK9 A;  4C8L A;  3ITH A;  5E41 A;  5J2N A;  4IO9 L;  1YIT N;  4BRG A;  3CQY A;  3CC2 N;  1CLQ A;  3SPZ A;  2A42 A;  4KAZ A;  3IRX A;  4RW7 A;  4CJE A;  1Q9Y A;  2YHX A;  3ZT2 A;  3THY A;  4CIG A;  1R59 O;  1C1B A;  3QNN A;  4YDU C;  1NGC A;  2RKI A;  3BZC A;  4FJ8 A;  3IG1 A;  1KD1 O;  5HBM A;  5SZT A;  4IOC L;  3LZJ A;  2AA4 A;  2QI2 A;  1EQY A;  1N34 K;  2E1Z A;  5AQG A;  3A8Y A;  4FSV A;  4B3O A;  3OJS A;  1JLA A;  1Z6R A;  4AQY K;  2FLO A;  4M63 C;  2R7Y A;  5KPZ A;  3PX0 A;  4DSI A;  4FZX C;  2FSJ A;  3RRH A;  3TSP A;  4Q5V A;  3MED A;  4RG8 A;  5I42 A;  4EP4 A;  2UUC K;  1IO2 A;  1D9D A;  2P51 A;  5HRP A;  3DJC A;  3V81 A;  3U8X A;  3W3D A;  4JS4 A;  3OTO K;  2UXD K;  2ZE2 A;  3LDS A;  1BHL A;  5HRS A;  2YNI A;  2OPP A;  5AZJ A;  1LCU A;  1NGG A;  4DTN A;  4KPY A;  1S1X A;  3KKS A;  4LF9 K;  4A2B A;  3OYN A;  3L4I A;  3LP2 A;  2RN2 A;  2Z1G A;  1K9M O;  1YXQ A;  2F7T A;  4BRK A;  1CZB A;  5AQQ A;  3G6E N;  3EKS A;  3H1Q A;  3QET A;  1NKC A;  4J2B A;  4JLH A;  5BR8 K;  3OYL A;  4DSJ A;  1KRP A;  3IDH A;  3CF5 L;  2YV0 X;  3CER A;  2G8H A;  3TPQ A;  4BRH A;  3O6W A;  3TTD A;  3CC7 N;  3KWG A;  5GIO A;  3DLG A;  3NBP A;  3HRG A;  1YJ9 N;  1ASV A;  2GUP A;  3GL1 A;  3V1R A;  5C0Y A;  2JGU A;  3H3N O;  4IXC A;  4FLY A;  4CK3 A;  2QKK A;  2NNW A;  3EN9 A;  3V6D A;  2YHA A;  5LJW A;  1N5Y A;  4FJ5 A;  1VQ6 N;  3FE1 A;  1J53 A;  4LSL A;  4BC2 A;  3C94 A;  3QEI A;  3A0I X;  4OKJ A;  1BG3 A;  2Z1I A;  3LP3 A;  4K25 A;  2BH1 A;  3C6H A;  1HYZ A;  3T19 A;  4CEE A;  4BR7 A;  1S72 N;  3DXK A;  4CFC A;  3ZT0 A;  4DFM A;  3ZLJ A;  2OAN A;  1OKJ A;  2FXU A;  5KPR A;  2Q2R A;  4DFP A;  1B9F A;  2GUI A;  1M1K O;  4H0V B;  1RTJ A;  4O8U A;  3ATU A;  3RMC A;  3HXM A;  4LD0 A;  2F8S A;  3LDL A;  4WFB L;  2WFB A;  3AA4 A;  4C8M A;  5C10 A;  4CJK A;  3CFP A;  3SBG A;  2X74 A;  1YJN N;  4CES A;  3O3G A;  3WUH A;  4DR5 K;  3QES A;  4DU1 A;  4ISF A;  3CYM A;  3C6T A;  1BIS A;  3NF8 A;  4FK4 A;  5AQH A;  3F9K A;  4KO0 A;  4JKD A;  1RGI A;  2QWN A;  4LY7 A;  5KQD A;  4JKB A;  4NLC A;  5BRE A;  1X9W A;  3OBY A;  4JKC A;  1S9G A;  3EYZ A;  3L4Q A;  3VF6 A;  3KLH A;  1K8A O;  1VAZ A;  1MWM A;  4N5S A;  3FZF A;  3SMS A;  3TAQ A;  4FPB A;  4BGB A;  4BRA A;  2ITM A;  1JLC A;  3RR7 A;  3G25 A;  1UA1 A;  2A5X A;  1U2V B;  4DQR A;  3CIP A;  3LPT A;  1NJI O;  4K43 A;  3R9P A;  2I7P A;  4H5V A;  4JKF A;  3M8R A;  1GLE G;  3MXJ A;  2QXF A;  4BR2 A;  3HT3 A;  2I7N A;  2Q3S A;  4WFN L;  4BDY A;  3ASM A;  3QDK A;  3O1B A;  1JLF A;  5E26 A;  4H5N A;  3FGU A;  4BE0 A;  3QO9 A;  3ZET B;  3LDO A;  1RIL A;  1NGH A;  4JI1 K;  4B1V A;  1ZBS A;  3RTV A;  1DTT A;  2D0C A;  4E7L A;  1NK0 A;  2UXC K;  1SKS A;  4FWK A;  4MLE A;  4MO5 A;  5CR4 A;  4DV3 K;  3B6O A;  4BRM A;  3EKU A;  1L3T A;  1KLM A;  4O5F A;  3TWH A;  3LM9 A;  3K0S A;  1NGB A;  4EZ9 A;  4N41 A;  2Q0U A;  4IJN A;  1ASU A;  1W97 L;  1RDA A;  4CHP A;  1BDG A;  3CCU N;  4E1M A;  4CZG A;  1U2V A;  1RT1 A;  3SQ1 A;  4FLU A;  3I8B A;  3M1F A;  3H3O B;  4CER A;  3DLH A;  4PUO A;  4AIL C;  4H0X B;  4CFA A;  4XEI A;  2KQ2 A;  4QS8 A;  1X9M A;  4F3O A;  5AQP A;  2KLA A;  3DYA A;  3ZET A;  1CXU A;  3CJC A;  1VSM A;  1KFS A;  2ATQ A;  1GOB A;  3M3Z A;  3WXK A;  3GG4 A;  1U6Z A;  1GLJ O;  1NGE A;  3LWM A;  3D2F B;  5TKY A;  4KH6 A;  1VQ7 N;  4CEF A;  3E66 A;  3O5B A;  4DMN A;  4JS5 A;  4FW2 A;  3OYG A;  5EY4 A;  1ZBL A;  2P9L A;  2X6N A;  3ZEU B;  3Q7B A;  1BA0 A;  3V9X A;  4X62 K;  4BC5 A;  1UWB A;  4JRP A;  3OBW A;  4KFB A;  3ZX3 A;  2QK9 A;  1TAQ A;  4FWR A;  3JXU A;  3UE5 A;  4RW4 A;  3ZX0 A;  4E7H A;  2YCH A;  2O8C A;  3QFP A;  3HYF A;  3VQC A;  1GLL O;  3O1W A;  3NF9 A;  3CCE N;  3SQ4 A;  5AQY A;  1NLV A;  1TUY A;  2O8B A;  3HVR A;  3MAQ A;  3RVC A;  4KB0 A;  2PY5 A;  2HF4 A;  1ATR A;  4HUG A;  3JAM O;  5F0X A;  5C15 A;  4M3W A;  1KCF A;  3RRG A;  2ZM6 K;  4H0P A;  4OPH A;  3C65 A;  3D2F A;  4CZE A;  4DKW A;  3RSE B;  4ILG B;  1QHA A;  4FK2 A;  2P9N A;  1KAZ A;  1NU0 A;  5DM7 L;  4CGH A;  3LDP A;  3ZEU A;  4BR5 A;  2OA8 A;  4MQ3 A;  4CK2 A;  1BI4 A;  4N56 A;  4CEO A;  4FM2 A;  3ULE A;  4K41 A;  3VEX A;  1NG9 A;  3SUN A;  3QLH A;  4BGA A;  4CFD A;  4FWP A;  4WQ4 A;  1X3N A;  4WE1 A;  3CHW A;  1WN7 A;  2FF6 A;  2JLE A;  4CHQ A;  5JLH A;  3K5N A;  1VQM N;  5AR0 A;  1W7A A;  1NM1 A;  4CE9 A;  3GOI A;  5AQW A;  5MLC Q;  3OYI A;  1U49 A;  1OH5 A;  1WB9 A;  4DTM A;  2ZGZ A;  3M8Q A;  4M7Y A;  4RTF D;  3N4Q A;  1ATS A;  5CY4 A;  4IDK A;  3ENO A;  3TSQ A;  4FJ7 A;  1WSJ A;  3EY1 A;  3IS9 A;  1LWC A;  4GW6 A;  1NGI A;  1DGK N;  3RSE A;  4FWN A;  4Y1D A;  5M1Q A;  2NRT A;  3JYT A;  1D9F A;  4DTS A;  4M3X A;  3VEV A;  1TK0 A;  1VQ9 N;  3SBT A;  1JLE A;  4I9Q A;  4H8K A;  2B5J A;  3O9U A;  1HMV A;  4I7F A;  4EAH D;  1JCF A;  4BRI A;  1G99 A;  1U04 A;  4KH4 A;  4B8C A;  1TAU A;  3KLG A;  3CJB A;  2DTU A;  3SMP A;  1KFD A;  1KVC A;  1RDD A;  3QML A;  3KJV A;  4CHZ A;  4DSF A;  3TI0 A;  2OPQ A;  2QTD A;  3ZSZ A;  2HMI A;  3PSF A;  1SAZ A;  2WBN A;  1BL3 A;  1VSH A;  1NBW A;  4F8R A;  1TL1 A;  4FLZ A;  4WQ5 A;  1TV6 A;  2X6S A;  3VQB A;  4CF1 A;  2IIR A;  2HHW A;  1O1W A;  1GLC G;  4AF1 A;  5GAH P;  4FWS A;  1C0G A;  3P31 A;  3I0R A;  3T1Y K;  3TAF A;  4BVP A;  3NHG A;  3AAQ A;  4M3T A;  4JK8 A;  2VWK A;  3BUZ B;  3VEW A;  3DMJ A;  5FDL A;  3T1A A;  2WOM A;  1YIJ N;  2G8V A;  3TU5 A;  1ESV A;  1F21 A;  1TK8 A;  4IDH A;  4DCH A;  5FPE A;  3CPW M;  1HYS A;  1WAF A;  4JKE A;  1NOY A;  2Q36 A;  2HHV A;  3R1X A;  4HHT A;  1M90 O;  1RDW X;  3NMU A;  3VEZ A;  4JEP A;  1K6Y A;  1ITG A;  3M6G A;  4BC4 A;  2JWL A;  3IKM A;  3HOT A;  5IT9 O;  4GV9 A;  1ZYQ A;  5AQO A;  1GOC A;  3AO5 A;  3TAP A;  3HM9 A;  4GKK K;  4RW6 A;  4M3Y A;  1UOC A;  1XC3 A;  3VF4 A;  3HPO A;  4DFK A;  1VSE A;  3VEN A;  1HR0 K;  1BQN A;  1TKX A;  4AHR A;  2HBK A;  2PBD A;  3P83 D;  4DS5 A;  2ETJ A;  1BCO A;  5J2P A;  3PY8 A;  2F9W A;  1YVU A;  3U9D A;  2P5O A;  1JJ2 M;  4FOE A;  4CJ5 A;  3F9M A;  4Z4I A;  3AY9 A;  3I55 N;  3AGR A;  4E0D A;  1QTM A;  3EZW A;  5AFU H;  3IUC A;  1RBT A;  1WSE A;  1NGF A;  4CEZ A;  1QVF M;  4H4O A;  3ZSO A;  2GV9 A;  3J8A A;  3L3V A;  3I56 N;  1HLU A;  3RMB A;  4CJ3 A;  4ZHR A;  5BPM A;  3AVG A;  3K9J A;  3MEG A;  3OYK A;  1HRH A;  1NGJ A;  1VHX A;  1WSG A;  5FPM A;  3HST B;  3L2V A;  1S3X A;  2PZS A;  2W6K A;  1SZ2 A;  1JCG A;  4LF6 K;  2P9P B;  3SV3 A;  3S3O A;  4CEC A;  4CJP A;  1BU6 O;  3B8A X;  2E2O A;  3ZSQ A;  4CFB A;  3TSU A;  3WNF A;  1KAY A;  5LJV A;  4K8Z A;  3G0Z A;  2F96 A;  1SQK A;  1IKV A;  3THX B;  4DR3 K;  4R79 A;  1NJX A;  1ILY A;  5I9E B;  4R5P A;  1VQO N;  3Q7C A;  5AQJ A;  3ZSV A;  3SUO A;  3CM5 A;  3RMD A;  4CEQ A;  4ILJ A;  1MDU B;  2P9P A;  4O55 A;  5AQF A;  1WAJ A;  3QIO A;  4CJW A;  2HVH A;  3AO2 A;  2YJF A;  5AQK A;  2XHB A;  5J1E A;  2E5L K;  4WCE L;  2QM1 A;  5KI6 A;  1QQC A;  1BQM A;  1I3A A;  5LMU K;  4FWL A;  1L3U A;  4BWM A;  3VGM A;  5M1F A;  3PX4 A;  4IZ9 A;  3DM2 A;  4B3M K;  2IC3 A;  3THV A;  4IFE A;  4H0T B;  3FFI A;  3CD6 N;  3UKU B;  2HST A;  1UA0 A;  3AGK A;  3OYJ A;  5LMN K;  4CVN E;  3THX A;  1W2B M;  3QIP A;  4DV5 K;  3CC4 N;  3LDN A;  3VQ8 A;  3CCJ N;  4BRO A;  3CCL N;  4DFJ A;  3QIN A;  4BVO A;  2O8F B;  2HVI A;  2IVP A;  2HHQ A;  1IH7 A;  3MEE A;  2QA4 N;  4DSL A; 
#chains in the Genus database with same CATH homology
 4FJJ A;  3HXM A;  4LD0 A;  2F8S A;  4BE2 A;  4KRF A;  1RT6 A;  4CGG A;  4CJQ A;  2P1J A;  4C8N A;  3VN5 A;  3AA4 A;  4C8M A;  3HP6 A;  3DRP A;  4HUF A;  4E7J A;  2YNF A;  5K14 A;  4KKO A;  3AVC A;  4DF4 A;  2XY7 A;  2FC0 A;  3KD1 E;  4CJK A;  3CFP A;  3TAB A;  4DQQ A;  4DQP A;  1RCH A;  1I39 A;  2O4G A;  3K5M A;  2X74 A;  4CES A;  4LH4 A;  3O3G A;  1FXX A;  1TGO A;  3SYZ A;  1S1U A;  4B9T A;  1C0T A;  2IOC A;  4DU1 A;  5KGW A;  3QES A;  3CYM A;  4IG3 A;  4F3T A;  1A5W A;  4ICL A;  3S9H A;  3C6T A;  4AHV A;  3SZ2 A;  1BIS A;  3AVB A;  3C95 A;  5C42 A;  4FZZ A;  1Y97 A;  3NF8 A;  4FJI A;  4FK4 A;  4TSX A;  4DTX A;  4KV8 A;  4OLB A;  3WNH A;  3F9K A;  4KO0 A;  1RT4 A;  5DK5 A;  3WNG A;  4O5B A;  2OYQ A;  1RTH A;  4LY7 A;  3NH1 A;  1A5X A;  4CJL A;  2RF2 A;  1T7P A;  1DTQ A;  5CYM A;  1X9W A;  5FRM A;  4CIE A;  5J2M A;  4E7K A;  3ZT4 A;  1Q8I A;  4CGJ A;  4CGD A;  1SV5 A;  3SUP A;  1S9G A;  3EYZ A;  4ELV A;  1X1P A;  3TAN A;  3AVA A;  4FJL A;  3V9S A;  5T7B A;  4OKK A;  1NK4 A;  3KLH A;  3OYA A;  4CEB A;  4CED A;  3D0P A;  5D3G A;  4N5S A;  2Y1J A;  3KK3 A;  3TAQ A;  3AVJ A;  1S6Q A;  1JL2 A;  3PX6 A;  1JLC A;  1S1V A;  3K2P A;  3RR7 A;  3HK2 A;  1LWE A;  1VSF A;  3V9Z A;  1UA1 A;  1CZ9 A;  2Z1H A;  4DQR A;  5C25 A;  3LPT A;  4CIF A;  4CCH A;  2D0B A;  3LAL A;  4F4K A;  3M8R A;  2G8U A;  2OZS A;  3QEX A;  3MXJ A;  4FJM A;  2QXF A;  3ZSW A;  3HT3 A;  2G8F A;  1NJZ A;  3NH2 A;  2Q3S A;  2KZM A;  3K5L A;  4BDY A;  4W5N A;  1HQU A;  3ASM A;  1T03 A;  4J2E A;  1JLF A;  1LW0 A;  2ZQB A;  3LAN A;  4ID5 A;  2FBT A;  1T05 A;  4Z4C A;  4BE0 A;  3H08 A;  3SV4 A;  1T8E A;  3QO9 A;  1EP4 A;  1QSY A;  1JLG A;  4FJX A;  1RIL A;  2YKM A;  3RWU A;  2BE2 A;  2W42 A;  3LP1 A;  4CJT A;  4E1N A;  4FLT A;  3RTV A;  1VK0 A;  1DTT A;  2D0C A;  4E7L A;  1NK0 A;  2G8I A;  4FK0 A;  3VQQ A;  1SKS A;  3O3F A;  3V1O A;  4Z4H A;  4M45 A;  2DFF A;  5HP1 A;  2FBY A;  4CGI A;  3CG7 A;  3B6O A;  3NF7 A;  5DMR A;  1L5U A;  3HPH A;  4N76 A;  1B92 A;  1L3T A;  1NK8 A;  1KLM A;  1KTQ A;  3O4Q A;  3TWH A;  2IDO A;  3CQ8 A;  4EZ9 A;  3AVI A;  1RNH A;  1VSJ A;  4N41 A;  4B9N A;  3OS0 A;  1BIU A;  1ASU A;  1WSI A;  3BDP A;  1IKW A;  4G1Q A;  1RDA A;  1YT3 A;  1W9H A;  4AHU A;  4CHP A;  3OY9 A;  2PYJ A;  4M3U A;  3O4N A;  3CM6 A;  3T3F A;  4HCB A;  4E1M A;  3AO4 A;  3MEC A;  4DLE A;  1QS4 A;  4LH5 A;  3K59 A;  4Z4F A;  1RT1 A;  3VQP A;  4CJS A;  4CHN A;  3SQ1 A;  3LP0 A;  4CF0 A;  4FLU A;  4UQG A;  1ZBU A;  4B8A B;  4I9L A;  4CER A;  4CK1 A;  3K58 A;  3KK2 A;  4O0I A;  1L3S A;  1QSL A;  3DLH A;  3DOK A;  4PUO A;  2P5G A;  4AIL C;  1FKO A;  2D0A A;  3SPY A;  1UAX A;  2NUB A;  4CFA A;  3OS2 A;  2KQ2 A;  1D5A A;  1X9M A;  2OPR A;  4F3O A;  3DYA A;  3HL8 A;  3ISN C;  1CXU A;  3P5J A;  3AVH A;  4CJR A;  4FJK A;  3HO1 A;  2O4I A;  1VSM A;  1RT2 A;  3K5O A;  2ATQ A;  3NGY A;  2YNG A;  1QHT A;  1KFS A;  4DQI A;  1GOB A;  1LAW A;  4NYF A;  1EET A;  3VQE A;  3P1G A;  1NK6 A;  4LSN A;  1WLJ A;  3M8S A;  2G8K A;  4BAC A;  3OYD A;  3LWM A;  4Z0U A;  2XO7 A;  4FLX A;  4CEF A;  1C0M A;  3DLE A;  4DMN A;  4JS5 A;  4FW2 A;  2OPS A;  3AO1 A;  4C8O A;  4KRE A;  2KW4 A;  3OYG A;  1IKY A;  3L2Q A;  1ZBL A;  4PWD A;  2X6N A;  4DTO A;  4DWI A;  5CYQ A;  3V9X A;  3RR8 A;  1NOZ A;  4JRP A;  1UWB A;  4NYN A;  3NGZ A;  5JS2 A;  2KZZ A;  2B4J A;  3AO3 A;  5EU7 A;  4M41 A;  3ZSX A;  4KFB A;  3F73 A;  1NK5 A;  2AJQ A;  1RBV A;  4Y1C A;  3SI6 A;  2VG5 A;  2QK9 A;  3L2R A;  1NKE A;  1TAQ A;  4XIU A;  1J9A A;  4RW4 A;  4E7H A;  4GMJ B;  1SKR A;  2BGG A;  3SQ2 A;  3HYF A;  3VQC A;  1KVA A;  1TKZ A;  3NF9 A;  3PUF A;  3U3Y A;  4FJ9 A;  3SQ4 A;  3KLI A;  3ZCM A;  2OZM A;  3QNO A;  1XC9 A;  2HB5 A;  3B6P A;  4F2S A;  1U47 A;  4HTU A;  1JLQ A;  3HVR A;  3MAQ A;  2GBZ A;  1IG9 A;  2DFH A;  1HNV A;  3CFR A;  1ZBI A;  4KB0 A;  1RDB A;  1HYV A;  1NKB A;  2PY5 A;  3OJU A;  4IKF A;  4OGC A;  4YFU A;  3VQ5 A;  5JS1 A;  3KK1 A;  1RTI A;  1RBS A;  3LWL A;  4HUG A;  4CHO A;  4EP5 A;  1QSS A;  1BIZ A;  1REV A;  4QOZ B;  4FYD A;  3NH0 A;  1XHX A;  2BAN A;  1C0U A;  4AHT A;  1KCF A;  3VA0 A;  3RRG A;  4M3W A;  4KI4 A;  1TKT A;  4FVM A;  1VRU A;  1J54 A;  3NGI A;  4N47 A;  4CGF A;  5HLF A;  1NJW A;  4RW8 A;  4HUE A;  4FK2 A;  2QKB A;  2FBX A;  1QE1 A;  3VQ9 A;  4JRQ A;  4GVM A;  4CGH A;  4L8R B;  3OYF A;  3TAM A;  4FZY A;  3PO4 A;  2OA8 A;  2FBV A;  3NFA A;  1U4B A;  4MQ3 A;  4CK2 A;  3ZT1 A;  3V4I A;  1BI4 A;  5CZ1 A;  1VRT A;  4N56 A;  3OYE A;  1U45 A;  4CEO A;  3LPU A;  4FM2 A;  4B9S A;  3C6U A;  3D45 A;  3V9W A;  4CEA A;  2X78 A;  3SUN A;  3OYB A;  2HHU A;  3QLH A;  3KIO A;  1TVR A;  3SUQ A;  4CFD A;  3NF6 A;  4ZTJ A;  1S9E A;  4ID1 A;  4WE1 A;  3KLE A;  4CHQ A;  1WN7 A;  4DF8 A;  2JLE A;  2RPI A;  3DI6 A;  5KRS A;  3K5N A;  2A1S A;  1R0A A;  4QCL A;  4CE9 A;  1U49 A;  3OYI A;  3S3N A;  4CJF A;  1S6P A;  2XRI A;  4DTM A;  3E01 A;  3QEV A;  3M8Q A;  3ZSR A;  1G15 A;  1SL0 A;  3KLF A;  2A1R A;  3RMC A;  1LAV A;  4OKE A;  5CY4 A;  3NDK A;  4FLV A;  4IDK A;  4FJ7 A;  3HVT A;  1WSJ A;  3ZSY A;  3EY1 A;  4I2Q A;  3IS9 A;  3SCX A;  1LWC A;  1FKP A;  2D5R A;  3AVL A;  4GW6 A;  4NCB A;  1ZBH A;  5I3U A;  4DU3 A;  2ZD1 A;  1B9D A;  3NCI A;  3A2F A;  4Y1D A;  1D9F A;  3JYT A;  3DRR A;  4DTS A;  3QEW A;  3LAM A;  3ZT3 A;  3I8D A;  1GOA A;  5SWM A;  4M3X A;  1RT3 A;  3KTQ A;  1TK0 A;  5FRO A;  4E3S A;  3CFO A;  4KHS A;  1WSF A;  1TK5 A;  1JLE A;  2YKN A;  4H8K A;  3VQA A;  1SL1 A;  4I9Q A;  1HQE A;  2B5J A;  1HNI A;  4ELU A;  3V1Q A;  3RMA A;  1HMV A;  4BDZ A;  1X9S A;  4I7F A;  5HRO A;  4KHW A;  4B08 A;  2VG6 A;  4BDP A;  1U48 A;  4KHU A;  1XI1 A;  1JL1 A;  3DLK A;  4O44 A;  1U04 A;  5C24 A;  2LSN A;  4B8C A;  3HP9 A;  2PYL A;  2DFE A;  1EXQ A;  1TAU A;  3KLG A;  4FXD A;  2DTU A;  1JLB A;  5HRN A;  4ELT A;  4OPJ A;  4M42 A;  3NAE A;  1KFD A;  1KVC A;  1RDD A;  3KJV A;  4KHY A;  2HNZ A;  4CHZ A;  1LV5 A;  1MU2 A;  4W5T A;  4CF8 A;  4DSF A;  3SJJ A;  3TI0 A;  2IGI A;  2I5J A;  2OPQ A;  3VQD A;  2VWJ A;  3ZSZ A;  2HMI A;  2XY8 A;  1BL3 A;  1VSH A;  4DSK A;  4F8R A;  4DTR A;  3MXM A;  1NJY A;  1RDC A;  1YTU A;  2HNY A;  1ASW A;  3BGR A;  1TL1 A;  4PA1 A;  3ULD A;  4FLZ A;  5J2Q A;  1TV6 A;  2X6S A;  3VQB A;  3MXI A;  4CF1 A;  2HHW A;  4AHS A;  4FLW A;  1O1W A;  1J5O A;  5FRN A;  4IFY A;  4W5R A;  2KFN A;  4O4G A;  3I0R A;  2F8T A;  2EX3 A;  3TAF A;  3AA3 A;  4KTZ A;  1NK9 A;  3NHG A;  4M3T A;  4KTW A;  4BE1 A;  1BCM A;  4PQU A;  2XY5 A;  2VWK A;  4ZTF A;  4AH9 A;  5KRT A;  2HW3 A;  2HHX A;  1DLO A;  3DMJ A;  5FDL A;  1HJR A;  2Y1I A;  4OGE A;  2WOM A;  3T1A A;  4CF9 A;  2G8V A;  3KD5 E;  3L8B A;  4IG0 A;  4OVL A;  1F21 A;  1TK8 A;  2IS3 A;  1C1A A;  1C1C A;  4E7I A;  4B9V A;  1L3V A;  4CJU A;  1FK9 A;  1TKD A;  1HYS A;  1Z25 A;  2BDP A;  1WAF A;  1NOY A;  1LW2 A;  4DLG A;  4C8L A;  3L2W A;  3ITH A;  4Z4G A;  2HHV A;  5E41 A;  3AVM A;  4HHT A;  4M3Z A;  5J2N A;  2YHB A;  4H4M A;  2KTQ A;  3LZI A;  1Q9X A;  3EZ5 A;  1CLQ A;  3SPZ A;  1K6Y A;  1YTA A;  1ITG A;  1EX4 A;  4KAZ A;  3IRX A;  3L3U A;  4RW7 A;  4CJE A;  1Q9Y A;  3ZT2 A;  1ZYQ A;  4CIG A;  1WNS A;  1GOC A;  4Q0B A;  3AO5 A;  3TAP A;  1C1B A;  1RBU A;  3QNN A;  4M3R A;  3HM9 A;  2RKI A;  4RW6 A;  3JSM A;  4M3Y A;  1S1W A;  1UOC A;  2KFZ A;  4FJ8 A;  3IG1 A;  3VQ4 A;  3U3G A;  3HPO A;  3SQ0 A;  1SUQ A;  1KVB A;  5HBM A;  4DFK A;  1VSE A;  4J2A A;  5SZT A;  3OYH A;  1BQN A;  3LZJ A;  1TKX A;  3M8P A;  4AHR A;  3P83 D;  4DS5 A;  3LAK A;  1XHZ A;  4FJ5 A;  2ETJ A;  3DRS A;  1BCO A;  4DU4 A;  5J2P A;  4PY5 A;  3PY8 A;  4FJN A;  1YVU A;  3SNN A;  5HRR A;  2P5O A;  4B3O A;  3DLR A;  4Z4E A;  3HJF A;  3OJS A;  1JLA A;  3AVF A;  4O0J A;  4CJ5 A;  4Z4I A;  1TL3 A;  4F2R A;  4DTP A;  4B9L A;  2R7Y A;  1QTM A;  4E0D A;  1RT5 A;  2E6M A;  4KI6 A;  1VSK A;  1RBT A;  1WSE A;  3PX0 A;  4CEZ A;  4DSI A;  4FZX C;  4H4O A;  3ZSO A;  2GV9 A;  3L3V A;  3RRH A;  1A5V A;  1JKH A;  4RW9 A;  4Q5V A;  3RMB A;  1SL2 A;  3MED A;  4CJ3 A;  4ZHR A;  3AVG A;  4RG8 A;  3OS1 A;  5I42 A;  4EP4 A;  4MFB A;  2B6A A;  3MEG A;  1IO2 A;  1HRH A;  1WSG A;  4E89 A;  5KGX A;  3OYK A;  1N6Q A;  1D9D A;  2P51 A;  3HST B;  4NCA A;  3L2V A;  5HRP A;  3ALY A;  4DG1 A;  2G8W A;  4QAG A;  2PZS A;  3V81 A;  4JS4 A;  3SV3 A;  3S3O A;  4CEC A;  4CJP A;  2ZE2 A;  3LDS A;  4FM1 A;  1KLN A;  1BHL A;  5HRS A;  4B9M A;  2YNI A;  2OPP A;  1CXQ A;  2Z1J A;  3VQ7 A;  3ZSQ A;  4DTN A;  4KPY A;  1S1X A;  3KKS A;  4DSE A;  3VA3 A;  3PV8 A;  1LWF A;  1S5J A;  4CFB A;  4W5Q A;  1KSP A;  4B9U A;  3OYN A;  3LP2 A;  1JXE A;  4OPK A;  2RN2 A;  1ZBF A;  2Z1G A;  2YNH A;  3G10 A;  1IKX A;  2DY4 A;  3OYC A;  4K8X A;  3OYM A;  3WNF A;  1CZB A;  3S3M A;  4I2P A;  2E6L A;  3DLB A;  4YNQ A;  5CZ2 A;  1Z26 A;  1C6V A;  1RBR A;  4CJV A;  4K8Z A;  4HCC A;  4AHC A;  3QET A;  4KTQ A;  3G0Z A;  2ITG A;  1NKC A;  2F96 A;  3QER A;  4J2B A;  2HHT A;  4JLH A;  1IKV A;  3AVN A;  4DSJ A;  3OYL A;  1KRP A;  3TAG A;  4KB1 A;  2YV0 X;  2G8H A;  1EKE A;  1S1T A;  3O3H A;  1NJX A;  4E19 A;  3TAR A;  4R5P A;  4FCY A;  2IAJ A;  3AA5 X;  4J2D A;  1W0H A;  3ZSV A;  3K57 A;  3DLG A;  3AVK A;  3NBP A;  4CF2 A;  4OJR A;  3SUO A;  1NK7 A;  3CM5 A;  2HND A;  2XY6 A;  1ASV A;  4CEQ A;  4CJW A;  3RMD A;  4O55 A;  3V1R A;  1WAJ A;  3QIO A;  3QEP A;  3IAY A;  2HVH A;  2JGU A;  3AO2 A;  4FJG A;  4C8K A;  4FLY A;  3KKR A;  3V9U A;  1BGX T;  2XHB A;  5J1E A;  4DTJ A;  4CK3 A;  2QKK A;  4OLA A;  2E4L A;  3AA2 A;  2VG7 A;  1QQC A;  5KI6 A;  4DTU A;  2YHA A;  1BQM A;  3I0S A;  3V6D A;  4DS4 A;  1I3A A;  3DOL A;  1SKW A;  4LSL A;  1J53 A;  3QEI A;  1N5Y A;  3C94 A;  1L3U A;  3OVN A;  4BWM A;  3WNE A;  4KHN A;  4OKJ A;  4BWJ A;  1RTD A;  2Z1I A;  3LP3 A;  3L2U A;  3TR8 A;  3TAE A;  3PX4 A;  4HVJ A;  4FJH A;  4IBN A;  4FW1 A;  2EHG A;  3DM2 A;  4EZ6 A;  2IC3 A;  4NCG A;  1HPZ A;  3THV A;  1HYZ A;  3T19 A;  4CEE A;  3FFI A;  3HPG A;  4CHY A;  3NE6 A;  4CFC A;  3ZT0 A;  1WSH A;  2HHS A;  4DFM A;  4KHQ A;  1VSI A;  1UA0 A;  3OYJ A;  2WON A;  1VSD A;  3QIP A;  1D8Y A;  1JXB A;  3VQ8 A;  3PO5 A;  1VSL A;  4DFP A;  1B9F A;  2GUI A;  3U6F A;  4DFJ A;  3QIN A;  3UIQ A;  1RT7 A;  3AV9 A;  4IFV A;  5KTQ A;  2HVI A;  4DQS A;  1IH7 A;  2HHQ A;  1RTJ A;  1XWL A;  3MEE A;  4FM0 A;  3VQ6 A;  4CJ4 A;  4DSL A;  1BI4 B;  4W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...