1A5WA

Asv integrase core domain with hiv-1 integrase inhibitor y3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
molecule keywords INTEGRASE
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5wA00
1HRHA 3RR7A 3ITHA 3AA3A 4DFJA 1QHTA 4BACA 3HXMA 4W5TA 3SJJA 2PYLA 3RMCA 4OLAA 1RT3A 3OS2A 3LZJA 1RT6A 2HHXA 2OA8A 4IG3A 4DSFA 4Q5VA 3I0SA 2QKBA 3AVHA 3NH0A 3OYMA 1T7PA 4CGDA 1LWCA 2GUIA 4J2DA 1D8YA 1LAVA 1WSGA 4OKJA 4B8CA 3HPGA 3V9SA 4FJIA 1WSJA 2GV9A 2EHGA 4RW9A 2DFFA 3C95A 4LD0A 5FROA 2Z1GA 3EYZA 3SZ2A 2A1RA 1RILA 1IKYA 2HHUA 2HVHA 3VQEA 1EXQA 1FKPA 1TK5A 1A5WA 3SQ2A 2VWKA 2GBZA 4CJUA 2HHVA 2G8KA 2X6SA 4CJEA 4DSEA 4FZZA 3CM5A 3NF7A 4AHSA 4M3YA 3M8QA 3SCXA 2YNIA 3VN5A 3I0RA 5JS2A 1BI4B 3NGZA 1C0MA 4BDZA 3MXIA 3QIPA 1S5JA 3NF9A 1IO2A 4DFKA 4K8XA 1K6YA 1S1XA 3B6OA 4FCYA 1A5XA 3PO4A 2KQ2A 2XY6A 3THVA 1BIZA 2IAJA 3V9WA 2YV0X 3HP9A 3K5OA 4IFYA 1ASUA 3KLHA 3S3OA 1U49A 1SL1A 4B9LA 4N76A 4CK2A 4J2EA 4F2RA 3V1RA 3OVNA 1N5YA 2XY5A 3DRPA 1ASWA 3CQ8A 3SYZA 1Q9YA 1KRPA 4NCAA 2ZQBA 1TVRA 3CFOA 3LP0A 2G8WA 2BE2A 4J2BA 3TWHA 2D0BA 3DLEA 3LANA 1EX4A 1D9DA 4CHNA 4I7FA 1TGOA 4DMNA 3OYCA 3OYKA 4FJGA 2E6MA 4KRFA 4KREA 1RBUA 3NF8A 2ITGA 4CE9A 4O0IA 1LAWA 3V4IA 3KD1E 4KHQA 1RCHA 4CJLA 3BGRA 1C0TA 1VSHA 2O4GA 4KKOA 1U47A 4FJNA 1NKBA 2RN2A 4DTRA 1NK7A 1BL3A 1QSLA 4FK0A 2D5RA 1L3TA 2HNZA 3ZSOA 4EP5A 1RNHA 1L3UA 4AHUA 3E01A 4CJPA 3F73A 1NK8A 4ZTJA 1JXEA 2PY5A 4FJKA 4OGCA 1KVCA 4MFBA 3AO4A 4C8NA 4JS4A 4B9VA 1X1PA 4CF2A 4CGFA 5E41A 4FLWA 5CZ2A 4DF8A 5C42A 1SL2A 1JXBA 1RT7A 4IFVA 3KLFA 3AO1A 3RMBA 3QEPA 1NJWA 3K5LA 1I39A 4N5SA 1VRTA 4JRPA 3BDPA 2OZSA 3AVFA 3M8PA 5HROA 3NHGA 4L8RB 3LALA 3U6FA 2X78A 2OYQA 1Q8IA 3ZT2A 3RRHA 5C24A 4DWIA 4RW6A 3KK1A 2ATQA 1BQMA 3VA3A 5FRMA 3EZ5A 4GVMA 4C8OA 1U4BA 1T05A 2W42A 3SUQA 3ZSZA 4ZHRA 2KFZA 4RG8A 1RTDA 1DTTA 4AH9A 1NK9A 4F2SA 3O4NA 3OYAA 4CF8A 4N41A 3AO2A 3ZT1A 1NJYA 4Y1CA 4CJSA 4Z4FA 2QXFA 1KLMA 1YT3A 3TAPA 4FJHA 1T03A 4C8LA 1O1WA 3ZSWA 3RWUA 1HNVA 3M8RA 3ALYA 4BE2A 1WSFA 3VQDA 3AA4A 4TSXA 3L2QA 4KB1A 1IKWA 4CEOA 2KZMA 2F8TA 1JLCA 3QEXA 3NFAA 1RDBA 1NK0A 1C1BA 4FM1A 3SQ0A 1QTMA 5HRNA 4B9NA 3SPYA 1LWEA 2OPRA 4HCCA 4PWDA 4DTMA 2O4IA 1KVBA 4I9QA 2F8SA 3MXMA 1L3SA 2YHAA 3VQBA 4Z4IA 3HJFA 3C94A 1HJRA 1JLFA 1RTIA 4DQQA 1TAQA 1X9WA 1HYZA 1FKOA 4GW6A 3M8SA 3LWLA 3PV8A 1RTHA 1RDDA 4M3RA 1VSJA 4CERA 3SQ4A 5KGXA 3QEWA 2BDPA 2HB5A 3SQ1A 2B6AA 1EP4A 1S6QA 3ZSRA 4CIGA 4FM0A 3V9ZA 4E7IA 1XC9A 4DQPA 4F3TA 4O55A 4FZYA 4LSNA 4EZ6A 1CZ9A 3QETA 4KHUA 3L3VA 1JLEA 4E7KA 4KFBA 2IC3A 3RMDA 3KD5E 4FZXC 2KTQA 3V1OA 5D3GA 2G8HA 4KHNA 4LH5A 1KFDA 3EY1A 4OGEA 4PY5A 1KSPA 3TI0A 3WNFA 5FDLA 4KV8A 4HTUA 3AVGA 3CM6A 4CK3A 1TL1A 4DU1A 3OYGA 1N6QA 3O3FA 1B92A 2YNHA 3NBPA 2DTUA 4FJ5A 3DRRA 4M3XA 4HCBA 4E1MA 4B08A 4BE1A 3MEGA 2X74A 1UA1A 4W5NA 3LAMA 4Z4HA 3DMJA 5CY4A 1TAUA 3QESA 1VRUA 2IDOA 3VQ9A 4FJ8A 4M3UA 1XWLA 3DLKA 2QK9A 2G8IA 1TK8A 4O44A 1BCMA 3VQPA 4FM2A 3AVNA 2RPIA 4C8MA 3U3GA 1LWFA 1QE1A 4CFAA 4E0DA 3TAMA 3NAEA 4CHOA 3P1GA 3TAGA 1ITGA 1S9GA 3VA0A 1NOYA 1J9AA 3U3YA 1WSIA 3CFPA 1JLGA 3KKSA 1A5VA 2ZE2A 5DMRA 1TK0A 2ZD1A 2Y1JA 4CGIA 5J2MA 3FFIA 3P83D 1UA0A 1IKXA 2HMIA 3AVJA 1I3AA 1Y97A 3O4QA 4H4OA 4PA1A 1KTQA 3OYEA 2PZSA 1TKZA 2E4LA 1LW0A 2OPSA 2YNGA 1X9MA 1KFSA 4KI6A 4DSLA 2RKIA 4PUOA 1SV5A 4FVMA 1DTQA 4DLEA 4DSIA 1UAXA 3DOKA 4I2PA 4FLTA 3VQQA 4IBNA 4BDPA 1FXXA 4J2AA 4I9LA 3DLHA 3HVTA 2VG5A 4DF4A 3V81A 4DS5A 2HVIA 4DU4A 2D0CA 1NK5A 1WSHA 5JS1A 4YFUA 3L2VA 4OVLA 3VQ8A 3NDKA 1HNIA 1VSFA 4F8RA 1TV6A 4CJ4A 4H8KA 2DY4A 2XY8A 3OYLA 1J53A 3AO3A 1W9HA 2FC0A 3IRXA 2BANA 3AVMA 1WAFA 4QAGA 2HHSA 3IG1A 3V9UA 1J54A 2BGGA 1XHZA 5SZTA 4NCGA 1QSYA 5HRPA 2JLEA 3CYMA 4CJ3A 3OJUA 3S9HA 3C6UA 4CCHA 5KRSA 4FYDA 5J1EA 1T8EA 1X9SA 4FLZA 4CFBA 4OKEA 4O0JA 4CHZA 4HUEA 1NJZA 1NOZA 3HM9A 1ZBUA 4DTNA 2HHQA 1D5AA 1WSEA 4CF0A 4LSLA 3ZT3A 5J2NA 1RTJA 4G1QA 3L2RA 1IG9A 3WNGA 2D0AA 4PQUA 1SKWA 2ETJA 1G15A 3DOLA 3IAYA 3NF6A 3K58A 2F96A 4E89A 3D45A 2OZMA 4OPJA 4ICLA 2AJQA 3PX4A 3K57A 5KRTA 1JL2A 4CF1A 2FBVA 1WNSA 3ASMA 4KTWA 3AVCA 4NYNA 5EU7A 4AHTA 3F9KA 3OYFA 1ZBHA 1LW2A 5J2QA 1JLAA 2Z1HA 3HPOA 3TABA 3ZSYA 3KLEA 5CZ1A 3WNEA 4ELUA 2Z1IA 3AVIA 3AVBA 4ZTFA 1ZBLA 4AHCA 3OYNA 4RW8A 4JRQA 4W5QA 2IGIA 4KO0A 2OPPA 3JYTA 1S6PA 3A2FA 2NUBA 3OYIA 2WOMA 4CK1A 3OS1A 4CIEA 3LP3A 4FJJA 3G10A 1VSKA 4CESA 1R0AA 1D9FA 2OPQA 1RT1A 1S9EA 3L2UA 3NCIA 1YTAA 1F21A 4Y1DA 3RTVA 2R7YA 4KB0A 3HL8A 4CEDA 5I3UA 3NGYA 3JSMA 1ASVA 2LSNA 4DG1A 2KZZA 1QQCA 1BIUA 2XO7A 1LV5A 4KPYA 3NH1A 4CEFA 3QEIA 3O3GA 1YVUA 2HNDA 3QO9A 1RDCA 1J5OA 4DFMA 4B9TA 3ISNC 1NK4A 2Z1JA 4B9UA 4HVJA 3MEEA 1JLBA 4CECA 2P5GA 3NH2A 3CG7A 1EKEA 3DI6A 4ID1A 4LY7A 1W0HA 4CGHA 4CF9A 4CFDA 4AILC 4FJXA 4CEZA 4K8ZA 1VSIA 4CJRA 4FJ7A 3OYDA 4FJLA 1XHXA 4CJQA 3ZSVA 2FBXA 1GOCA 1BHLA 1S1VA 4CEBA 4YNQA 1ZBIA 4JLHA 4M41A 1VSDA 1C1CA 1DLOA 4RW4A 3QNOA 1BI4A 3QERA 1NKEA 3SV4A 5DK5A 4EP4A 3ZSQA 4GMJB 4LH4A 4R5PA 2YHBA 3I8DA 3TR8A 3VQ6A 4DQRA 3NE6A 3RMAA 3S3MA 4IG0A 1SUQA 1VSEA 2PYJA 2HHWA 4OKKA 4FW2A 4CGGA 1CXQA 1Z25A 2IS3A 3DYAA 3K5MA 1HQEA 1NJXA 3TAQA 3SPZA 4N56A 3H08A 4RW7A 1JKHA 1L5UA 1BQNA 2HHTA 1BCOA 1RT2A 4QOZB 4BE0A 3AVLA 4DTSA 5T7BA 1NK6A 2G8FA 1Q9XA 3KLGA 3LAKA 3LWMA 4KTZA 5I42A 4W5OA 1CLQA 4DQSA 1U04A 2B5JA 3KK3A 3SV3A 2VG7A 1HYSA 1EETA 4Z0UA 2EX3A 3QNNA 1WN7A 3RR8A 2I5JA 4EZ9A 3K2PA 1S1WA 3SUNA 1RBTA 3VQCA 3V6DA 3KLIA 3KK2A 4FLVA 3AA5X 2X6NA 1JLQA 2G8VA 1IKVA 3C6TA 4OLBA 3B6PA 3SI6A 4KAZA 3KJVA 3PX6A 1ZBFA 1FK9A 5HLFA 3LPUA 3AVAA 3VQ4A 1REVA 3NGIA 3WNHA 4W5RA 4HUGA 4OPKA 4E3SA 2Q3SA 4CEAA 3O3HA 3QEVA 4FW1A 3LP1A 3MECA 2DFEA 3HSTB 2YKNA 1RT4A 1TKXA 2KW4A 1JL1A 4OJRA 3HT3A 4B3OA 2WONA 3OY9A 3MEDA 2JGUA 2B4JA 1C0UA 4CFCA 4HHTA 3AA2A 4WE1A 3KIOA 3TAFA 3HP6A 1U45A 1S1UA 5SWMA 4FJ9A 2DFHA 1WLJA 3VQ7A 4H4MA 2VG6A 4E1NA 4NCBA 2QKKA 1CXUA 2P51A 3HPHA 3DM2A 1RT5A 4E7JA 3SUOA 3LPTA 3ZSXA 4CJFA 1C6VA 2P1JA 4FXDA 1HPZA 4DTPA 2P5OA 4M3ZA 1GOAA 3T19A 1XI1A 1SKRA 4B8AB 3PY8A 4E7LA 3HYFA 4DSKA 4M3TA 2XHBA 4FLXA 3CFRA 1KVAA 4N47A 3TANA 2VWJA 4UQGA 1QSSA 3PO5A 4MQ3A 1UWBA 3G0ZA 1TL3A 1HMVA 5K14A 3AO5A 4AHVA 4DTUA 4DS4A 2XY7A 4M3WA 1BISA 3LP2A 4I2QA 1RBSA 4FK4A 1VSLA 3LZIA 4CHQA 3KTQA 1HYVA 4B9SA 5KI6A 2Y1IA 4KI4A 1Z26A 3OYBA 4CJWA 4FJMA 4Q0BA 3V9XA 4CHPA 3V1QA 4DTJA 4BDYA 3SNNA 2E6LA 3HO1A 5HRRA 1S1TA 4IDKA 4CJTA 3K59A 4KHSA 3AVKA 3DLGA 4IKFA 4KHWA 3DLBA 4B9MA 5KGWA 4CIFA 2YKMA 3QLHA 3AV9A 3KKRA 4DU3A 3DRSA 4E7HA 3TARA 4C8KA 3QINA 4CGJA 4CJKA 4AHRA 4KTQA 2XRIA 3QIOA 4BWMA 4F4KA 4CJVA 1VK0A 4Z4EA 3PUFA 3L3UA 3IS9A 1B9DA 3ZT4A 3OYJA 2KFNA 4F3OA 3VQ5A 4DQIA 5CYQA 4E19A 3T3FA 1TKDA 3P5JA 1BGXT 2FBYA 5J2PA 3L2WA 4CJ5A 4QCLA 3K5NA 1MU2A 1UOCA 1YTUA 2HNYA 5HBMA 5KTQA 3D0PA 4M42A 4ELTA 3HVRA 1SKSA 4O5BA 1KCFA 4JS5A 3PX0A 3HK2A 1CZBA 3L8BA 1U48A 1NKCA 3ULDA 3OYHA 4DTOA 1KLNA 5FRNA 1RBRA 3MXJA 4NYFA 1B9FA 3ZCMA 4CEEA 4Z4CA 3TAEA 3LDSA 4FLYA 1L3VA 3OJSA 3DLRA 4M45A 3MAQA 4HUFA 2FBTA 4BWJA 4FK2A 1GOBA 3OS0A 1VSMA 4XIUA 4DFPA 4ELVA 5C25A 4Z4GA 4O4GA 5HP1A 2HW3A 1RBVA 4KHYA 2YNFA 4FLUA 1RDAA 1C1AA 2A1SA 2IOCA 3SUPA 1SL0A 3ZT0A 1HQUA 3T1AA 4CHYA 4DSJA 3UIQA 2G8UA 3RRGA 1IH7A 5CYMA 5HRSA 1TKTA 4ID5A 4DLGA 4DTXA 1ZYQA 1WAJA 1QS4A 3S3NA 4CEQA 3VQAA 2RF2A
chains in the Genus database with same CATH superfamily
4X64K 3A5OC 3SJJA 2PYLA 1BWFO 2NLXA 4IG3A 3J8AA 3I0SA 3C7NB 4CGDA 2GUIA 4GY2B 2GX9A 4J2DA 3G6EN 4FJIA 4IJAA 3CQYA 4WQ5A 2GV9A 2EHGA 4FL9A 2QEXN 4LD0A 4BRDA 1DKGD 3ENBA 1IKYA 3PIPL 3G71N 4B3TK 2HHUA 5AQLA 3M5RA 1FKPA 4BRFA 1A5WA 4MLEA 3FZMA 2VWKA 2GBZA 4CJUA 2X6SA 2CH5A 3CJAA 4BRHA 3MN5A 4BGBA 2HHVA 4BDZA 1C0MA 2BH1A 4H0VB 5AR0A 2D0OA 2P9LB 4CZMA 1A5XA 5C2DA 2OTJN 2HSTA 3HP9A 1HNZK 1U49A 4H0YB 1ASUA 4FO0A 2H3GX 4JKBA 5M1KA 3VEYA 3GBTA 1Q9YA 3OBWA 3CI5A 5AQJA 3MK6A 4J2BA 3LP0A 2ZJPL 4KRFA 4I7FA 4DMNA 2Q31A 3OYKA 4FJGA 2E20A 4KREA 1RBUA 4FJNA 1VSHA 1BL3A 3TTCA 4FK0A 1L3TA 4DCHA 4EP5A 3MX5A 1L3UA 1NK8A 4CJPA 3ENHA 1JXEA 2IVPA 4FJKA 4C8NA 4B9VA 5BR8K 3DLLL 3DAWA 3MCPA 5CZ2A 1JXBA 1WUAA 3KLFA 1NJWA 3SBTA 3K5LA 4N5SA 3EL2A 3I55N 4IJNA 3AVFA 3PSFA 4OO1J 3NHGA 3U6FA 1Q8IA 4NXMK 3ZLJA 4RW6A 3CHWA 1BDGA 4BRPA 4CBWA 4A5BA 3VA3A 3ZSZA 4ZHRA 4RG8A 2Q0RA 4AH9A 4N41A 4CF8A 4NXNK 4Y1CA 4CJSA 2QXFA 3VF2A 5ADXH 3TAPA 2E1ZA 4C8LA 2O8BA 1HNVA 4WFAL 2QWRA 4BE2A 3VQDA 1IKWA 2KZMA 4CZGA 1JLCA 5AQNA 1RDBA 4B3MK 1C1BA 4DV7K 3SPYA 1LWEA 2O4IA 4HCCA 4JKFA 1KVBA 4MO5A 4I9QA 2ZF5O 2P9UB 3FGUA 5GAGP 1HYZA 3LWLA 1RTHA 4CERA 1M90O 3SLCA 3QFPA 2B6AA 1S6QA 4E7IA 4O55A 4LSNA 1CZ9A 1Y64A 5DM6L 2IC3A 5D3GA 1N8RO 3UB5A 4C23A 4KHNA 1BU6O 4LH5A 4LFAK 2P9LA 3CC2N 3AVGA 3CM6A 3CC4N 1QZ5A 1TL1A 4M3XA 4HCBA 4E1MA 1VQPN 4Z4HA 3DMJA 1VRUA 4BQZA 2IDOA 5AQTA 4M3UA 3DLKA 4C8MA 4E0DA 3FFKB 3TAMA 2FLOA 4CHOA 4BREA 1KAZA 4B9QA 3CFPA 1JLGA 3TTFA 4OPHA 4JI2K 3M1FA 5J2MA 1UA0A 1JCGA 1V4SA 3OYEA 2RKIA 4PUOA 3IUCA 2E88A 3HTVA 4H0PA 4HTLA 5CR4A 1K8AO 1OH8A 4JI7K 4EIAA 3DLHA 2QTDA 2F7TA 1NGBA 2HVIA 4G9ZA 4NLBA 3L2VA 3MMVA 1VSFA 3IMXA 1TV6A 3OYLA 1VQ4N 1W7AA 4DR3K 5EOYA 1N32K 2OCEA 4QAGA 2HHSA 2JWKA 4CZLA 3THWA 2BGGA 1XHZA 1YITN 2RF2A 4DR5K 4IOXA 3N4QA 2NRXA 3THWB 3CYMA 2W6KA 3OJUA 3S9HA 1VQNN 5KRSA 4FYDA 5J1EA 2HF4A 4FLZA 2F4VK 4H5WA 3CJBA 4O0JA 5BRFA 1NJZA 1NOZA 3CCRN 5KQ8A 1D5AA 3WQUA 1DT9A 3L2RA 2W6LA 2ETJA 1G15A 3FZLA 3NF6A 4FSVA 5AQSA 1RDWX 1NGAA 4BVPA 4MDBA 4KTWA 4NB4A 4AHTA 3AAQA 3CCUN 3F2KA 2ITMA 5J2QA 3VETA 1KAXA 4GKKK 3TABA 3KLEA 2Z1IA 1VHXA 4WFBL 4CW7B 1HLUA 2QWQA 3MN9A 4W5QA 1HR0K 3F9MA 3FZHA 3SAFA 3OS1A 1ATNA 1R0AA 1OH5A 1D9FA 3AGRA 4KB0A 3GE1A 1K8KB 3ID6A 4KPYA 1IBMK 3QEIA 1J5OA 4GKJK 4B1XB 1W97L 1NGJA 4U67L 2P5GA 3NH2A 4LY7A 1W0HA 3RVCA 3OBYA 3OYDA 1LCUA 1XHXA 1QVGM 2FBXA 1S1VA 4CEBA 3EZWA 1BA1A 4YNQA 4PKGA 1DLOA 3W0LA 3QNOA 1BI4A 3QBWA 4JV5K 4GMJB 4R5PA 3TR8A 4B1VA 3CCQN 4DQRA 2QA4N 3S3MA 1GLBG 2PYJA 2ZJRL 2NRRA 1CXQA 3CJ1A 1Z25A 5BN8A 3TAQA 1HKBA 2YHYA 2HHTA 4BR0A 4HWIA 4BE0A 3O5BA 4KTZA 4W5OA 1CLQA 4DQSA 2A6AA 3O08A 2VG7A 1HYSA 1NGDA 2D0PA 2E5LK 3RR8A 2O8EA 3K2PA 3VQCA 4BQLA 1C0GA 1IKVA 4EAHD 3SI6A 4DUZK 4H5NA 3PX6A 1FK9A 5KPRA 5AQKA 3D2FB 3C65A 2Q3SA 3O3HA 2Q1NA 4CD3A 2DFEA 4JK8A 1TKXA 3MEDA 5AQFA 3A5MC 3AA2A 4IEEA 1XMOK 1U45A 1E4FT 2DFHA 3VQ7A 4E1NA 2QKKA 1CXUA 2P51A 2A42A 4CJFA 5FPEA 1HPZA 5JVHL 5AFUA 1XI1A 3T19A 4QS9A 3VTIA 3AARA 4IOAL 2HBLA 4GVEA 4BC3A 4LF5K 3KVGA 3D2FA 3VTHA 2VWJA 3G0ZA 1TL3A 4M3WA 4BRAA 1NMNA 4CHQA 3ID8A 1ATSA 3KTQA 4B9SA 4KI4A 2ASMA 1Z26A 3OYBA 4CHPA 2RE2A 3HO1A 2I7NA 1Q86O 3D6RA 4KHWA 3DLBA 2YKMA 3AV9A 3KKRA 3UKRA 1TUUA 2VWBA 4RCHA 1NGIA 1VK0A 4Z4EA 3PUFA 4O8KA 3OYJA 5BPMA 2O8FA 1XQSC 4E19A 1GLAG 1TKDA 3L2WA 3C0BA 4H03B 4KH4A 1KAYA 4O5BA 5AQVA 4JS5A 3L8BA 3FR0A 1NU0A 4DTOA 2E2NA 3GL1A 4DV0K 1NMDA 3MXJA 1B9FA 1ZBSA 3VPZA 4Z4CA 2IIRA 4JYAK 3DLRA 1JCFA 2YJEA 3L4QA 4BWJA 3K0SA 5EVZA 3CERA 1P90A 2YNFA 4M7YA 1RDAA 4GV9A 4WQ4A 1SL0A 3SUPA 1K8KA 1HQUA 4DSJA 1IH7A 5CYMA 2V7YA 3EN9A 2A41A 3M3ZA 4BRLA 3ITHA 3AA3A 2O8CB 4DFJA 4OLAA 1RT3A 2UXDK 3LZJA 2HHXA 4Q5VA 3OA9A 1T7PA 1WSGA 4OKJA 4B8CA 3V9SA 2RHKA 1DGKN 1BO5O 4RW9A 5FROA 3C95A 2QI2A 3SQ2A 2CGKA 4LFCK 2G8KA 4DSEA 4FWRA 3NF7A 4KBOA 4AHSA 4K41A 3M8QA 3SCXA 2YNIA 4GNIA 3I0RA 5JS2A 1BI4B 4DFKA 1S5JA 1IO2A 1CZAN 1K6YA 4FCYA 3PO4A 4BR5A 3THVA 3V9WA 4B9LA 3K5OA 5AQOA 2CH6A 4N76A 3OVNA 2GEMA 3D2EA 3TSPA 3DRPA 1ASWA 3CQ8A 2XY5A 4NCAA 2ZQBA 4BC4A 4FVUA 4B3SK 4YORA 4LF6K 3UE5A 3NF8A 2ITGA 4O0IA 3THYA 3KD1E 1RCHA 3GDQA 4CJLA 2O4GA 4KKOA 5AZJB 4YHHK 2RN2A 3CF5L 4DTRA 4KH5A 1QSLA 1ZC6A 5BPLA 2HNZA 3ZSOA 1RNHA 4IXCA 3VESA 2AA4A 3CMAN 1SZ2A 1RT7A 1HKGA 3AO1A 4JRPA 3M8PA 4DV2K 4BG8A 1T6DA 4L8RB 2GUPA 5C24A 4DWIA 2ZGZA 3KK1A 5FRMA 4DQ8A 3H45C 3EZ5A 1U4BA 4C1NK 3QICA 1NK9A 3O4NA 4JAXA 5F0XA 4FWOA 3AO2A 4BC5A 2NRVA 1YT3A 3HM8A 4FJHA 1EQYA 1GLDG 4OX9K 3O1BA 3WQTA 4BRKA 1WSFA 2QWMA 3E66A 5F2RA 4WQ5C 3L2QA 4KB1A 3H3NO 3MWPA 3NFAA 3U4LA 2OPRA 3SBGA 4EHTA 2F8SA 1L3SA 3CC7N 3WT0A 3HJFA 5KPZA 1RTIA 1WOQA 3O4WA 1TAQA 3M6GA 4FWSA 1RDDA 3SQ4A 1GLCG 5KGXA 3QEWA 2HB5A 3ZEUA 3SQ1A 3ZX2A 3R9PA 2V51B 1EP4A 4CIGA 4FZYA 5BREA 2P9NA 1VAZA 4KHUA 3L3VA 4X66K 3RMDA 3Q7BA 2G8HA 2HBJA 4FWKA 1KFDA 2QXLA 3WNFA 4KV8A 3SMSA 4CK3A 4F9OA 3OYGA 3O3FA 4DV3K 4FXDA 3DRRA 3O1WA 5I9EB 1UA1A 3KZBA 2A5XA 5AQYA 1JJ2M 4FJ8A 1TK8A 1BCMA 1KXPA 3AVNA 3O8MA 3NAEA 2E2QA 4ISGA 3TSQA 1ITGA 1RDUA 4BRNA 1Q7YO 5M1FA 3AGKA 3KKSA 3T1HK 3G25A 5DMRA 1TK0A 4DR7K 3KWGA 3FFIA 3P83D 2HMIA 1KTQA 2PZSA 1TKZA 3O9SA 2YNGA 3P4IA 1X9MA 2VGMA 4IEIA 3CCVN 3HSCA 4WYBA 3DOKA 4FLTA 4DV1K 5AQZA 1XC3A 1FXXA 4LFBK 4I9LA 4DF4A 4DR6K 5M1PA 1NK5A 2D0CA 3R1XA 4OVLA 1HNIA 3H3OB 2DY4A 1YJNN 2BANA 3IG1A 5AQPA 3H6EA 1J54A 3V9UA 3FZFA 5C10A 1K73O 5SZTA 4NCGA 2NRHA 1RFQA 4Y0WA 1T8EA 4OKEA 4CHZA 5GADP 3HM9A 4DTNA 1FJGK 2HHQA 4CF0A 4LSLA 3ZT3A 3W3DA 1RTJA 5AQGA 3IAYA 4FWNA 3OTOK 1XMQK 2ZM6K 5LJVA 3BZCA 3K57A 5KRTA 1JL2A 4CF1A 3OYFA 4NYNA 5EU7A 1IJJA 3SJHA 3GOIA 1LW2A 1JLAA 3L0QA 1KC8O 3ZSYA 4JKHA 3WNEA 1RGIA 2PAVA 3TPQA 3OYNA 2IGIA 2VGNA 2OPPA 4KO0A 3R8EA 2WOMA 3IDHA 4CK1A 3LP3A 3G10A 1RT1A 1S9EA 3L2UA 4Y1DA 4FWPA 4B1ZA 5I3UA 3JSMA 1ASVA 2LSNA 1HNWK 2P9KA 4KHPK 1NM1A 3O3GA 3ISNC 2Z1JA 4K42A 3VENA 4LF4K 3PIOL 1EKEA 4ID1A 4CGHA 5E84A 5BR9A 4FJXA 4CEZA 4M7XA 1MA9B 1BHLA 3ENOA 2A40A 4EP4A 3J7ZO 2YHBA 3FE1A 5H1SQ 4IG0A 1VSEA 4OKKA 4FW2A 2IS3A 1HQEA 4YOVA 3SPZA 4BRQA 1JKHA 2Q36A 1RT2A 3E9LA 2NZTA 4DTSA 5T7BA 3EKSA 4BR9A 3KLGA 3LAKA 5I42A 4IOCL 3KK3A 4BR7A 3SV3A 2V7ZA 2EX3A 2I5JA 3SUNA 1RBTA 4FLVA 3LM9A 2X6NA 1WBDA 2G8VA 2P9KB 1ZBFA 5DM7L 3AVAA 1REVA 3NGIA 4W5RA 4HUGA 5FPMA 4OPKA 4DHYA 4CEAA 4FW1A 2QWNA 2KW4A 1JL1A 4ISFA 4JI3K 2JGUA 1C0UA 4HHTA 1BG3A 1S1UA 4A62A 3SUOA 1XUPO 3WEEA 2UYTA 3ZSXA 5C15A 2P1JA 5IWAK 4B1UB 2WBNA 4M3ZA 1ATRA 1O13A 1SKRA 3EE8A 4AQYK 4PKHA 3J7YP 4FLXA 4N47A 4JEPA 1QSSA 1UWBA 4E1JA 3AO5A 4AHVA 4DS4A 4U7BA 4A2BA 3LZIA 5KI6A 2O8FB 3DWLA 4CJWA 4BDYA 1S1TA 4IDKA 2HF3A 3I8BA 1XNQK 3AVKA 5KGWA 4CIFA 4C8KA 1NGGA 4CJKA 2XRIA 3AAPA 3QIOA 5JLHA 3VQ5A 5LMNK 4JI8K 2FBYA 4XH1A 3K5NA 2HNYA 5HBMA 4JK9A 1J6ZA 3HVRA 1OVYA 3PX0A 3O6WA 1CZBA 2YJFA 4JKGA 2UXCK 5JVGL 2QW9A 3TAEA 3LDSA 4A61A 3OJSA 2YX6A 3CPWM 3MAQA 5C0YA 2FBTA 2D1KA 4O8UA 3CMEN 1W2BM 1GOBA 4IO9L 4RWTA 4XIUA 4DV4K 4ELVA 1E4GT 4Z4GA 3CQXA 1VQON 2QWLA 5HP1A 1RBVA 4KHYA 3K9KA 2W41A 1NBWA 4FLUA 2IOCA 4BR2A 5LMUK 2NRTA 3RRGA 1TKTA 4H5TA 4DLGA 1YXQA 2W40A 4CEQA 1HRHA 3ATUA 4BACA 2NNWA 2PBDA 1RT6A 4DSFA 3AVHA 3OYMA 5KPTA 1D8YA 1LAVA 4CD1A 3A0IX 1WSJA 3LDNA 2EWSA 2DFFA 2A1RA 3EYZA 2Z1GA 2P9IB 3SZ2A 4H0TB 4LF7K 5AFUH 4X62K 4WF9L 1X3NA 1IBLK 4FZZA 3CM5A 2Q2RA 3JAMO 3VN5A 2DPNA 1HKCA 1S1XA 3B6OA 1I94K 4BY9C 5AQUA 3CXCM 1QZ6A 3S3OA 1SL1A 4CZFA 3CPEA 4J2EA 4IFEA 1XNRK 4F2RA 2P9NB 2KKZA 1N5YA 3SYZA 1TVRA 3CFOA 4FOEA 2D0BA 3DLEA 3LANA 1EX4A 1NG9A 1TGOA 3U8XA 1LAWA 3V4IA 4KHQA 3SAGA 3BGRA 1C0TA 1U47A 3C6AA 1SS6A 3CIPA 3VEOA 4X65K 4B3RK 3F73A 3BY5A 4ZTJA 2Q0UA 4NLCA 1KVCA 4OGCA 3AO4A 1X1PA 4CF2A 4CGFA 5E41A 4FLWA 3EO3A 4DF8A 1SL2A 3RMBA 3QEPA 1N34K 1C0FA 1VRTA 3BDPA 3E9OA 5HROA 2X78A 2OYQA 3ZT2A 3RRHA 3QB0A 1BQMA 4C8OA 2FXUA 2W42A 1T05A 2WC9A 2KFZA 3G4SN 1RTDA 4EFHA 4F2SA 4ILJA 4BROA 3ZT1A 2O8DA 3O9QA 1T03A 1MWMA 3CCMN 5ADXA 1M1KO 3M8RA 3VMFB 1YJ9N 1YF5L 3AA4A 2UUAK 1S3XA 3QEXA 1NK0A 4FM1A 4FWMA 1QTMA 4ISEA 4B9NA 4PWDA 4DTMA 1NNEA 3O9TA 2YHAA 4IWVA 3CETA 3C94A 3J80O 4DQQA 1FKOA 2JWLA 1TYQB 5JICA 2BDPA 2P9UA 3LDOA 3U9DA 1XC9A 2P9SA 4KH6A 4DQPA 4EZ6A 4YOXA 4RTFD 1HUXA 2ZJQL 3D7EO 3KD5E 3V1OA 4M63C 1OH7A 3IFRA 1KSPA 4HTUA 5FDLA 5M1QA 4DU1A 3S41A 5LJWA 3FZKA 1B92A 2YNHA 3NBPA 2DTUA 4L3QA 2X74A 3Q7CA 4W5NA 3LAMA 5FPDA 3MCAB 3VQ9A 2G8IA 3A5LC 4O44A 3VQPA 4FM2A 1LWFA 3T7ZA 3RSEA 3P1GA 3TAGA 1NOYA 1J9AA 1NWKA 1WSIA 2YHXA 1IG8A 1A5VA 2ZE2A 4PKIA 2ZD1A 2O8EB 2Y1JA 1OKJA 1IKXA 3AVJA 1I3AA 4H4OA 4PA1A 1GLFO 5HL7L 3QDKA 4KI6A 4BC2A 1MWKA 1SV5A 4FVMA 2FSNA 1YUWA 1UAXA 4PL8A 4IBNA 3ATVA 2KHOA 4BVOA 1BA0A 4FWLA 3HVTA 4DS5A 4DU4A 3WUHA 5JS1A 3NDKA 3VQ8A 5F1XA 5AQQA 3D2EB 3AO3A 4LF9K 3IRXA 3AVMA 2UXBK 1VQMN 3T1YK 1Z6RA 5HRPA 4FPAA 3JXUA 3C6UA 1U6ZA 1X9SA 5EX5A 3VGMA 1WSEA 5J2NA 3HI0A 3P38A 5ELZA 4CZJA 2D0AA 4PQUA 1SKWA 3DOLA 3AY9A 3K58A 2OZMA 3MN7A 1QQNA 4ICLA 3EE9A 1QVFM 1ZBHA 4A59A 3VEZA 4DUYK 4K25A 3HPOA 5CZ1A 5FLXO 3SMPA 5GAEP 1E3MA 4ELUA 4QS7A 3AVIA 2A3ZA 4AHCA 4RW8A 1YJWN 4JRQA 3JYTA 5LY3A 3DXMA 1T44A 2NUBA 4YOWA 4CIEA 4FJJA 2E2OA 3R6MA 1VSKA 5M1OA 4CESA 1VQ7N 2GWJA 2OPQA 1QQOA 3BF1A 1F21A 2WTUA 3RTVA 3DXKB 4CEDA 3NGYA 4BRIA 2KZZA 4PHTX 5CHIA 5AQWA 1LV5A 3QFUA 3NH1A 2NRZA 1YVUA 3QO9A 1RDCA 4IO8A 5EXWA 4B9TA 2OTLN 3MEEA 2CGJA 1JLBA 2J4RA 3BF3A 4AILC 1VSIA 3TU5A 4FJ7A 4FJLA 1GOCA 3E9PA 1ZBIA 4M41A 1VSDA 1C1CA 3VEXA 3SV4A 1NJIO 5C12A 3I8DA 1KQSM 3TSUA 3NE6A 2HHWA 1HX1A 4CGGA 3DYAA 3K5MA 3QMLA 3A8YA 5C2FA 1NJXA 4N56A 4RW7A 1L5UA 3LDLA 4QOZB 3AVLA 3LWMA 1VQ5N 5AZIB 3THXB 3QNNA 1S1WA 3BUZB 4I6MA 3KLIA 4MLHA 1YAGA 4B1YB 3VEVA 3C6TA 3B6PA 2E1YA 2HBMA 5E26A 3PLAA 3KJVA 3FLCO 5AQIA 1S22A 3VQ4A 3WNHA 4JKCA 3QEVA 5BRDA 3WXJA 3LP1A 4XEIA 4V19S 3HSTB 3MDQA 2YKNA 1RT4A 4B3OA 2IVNA 3OY9A 2B4JA 4CFCA 1U2VB 4WE1A 3U9ZA 3HP6A 4FJ9A 1WLJA 1U2VA 3HPHA 4E7JA 3DM2A 1RT5A 3LPTA 1C6VA 4DTPA 2P5OA 4B8AB 3PY8A 3VGLA 4E7LA 2VCPA 3HYFA 4DSKA 5EY4A 3KK7A 2XHBA 4M3TA 1VQ6N 4UQGA 1HMVA 5K14A 3VERA 4I2QA 4FK4A 4IDHA 1HYVA 1TUYA 3CJCA 3HOSA 4Q0BA 1SAZA 3VF4A 4DTJA 3I33A 4CJTA 4KHSA 2BUPA 3DLGA 2IVOA 4B9MA 3QLHA 3DRSA 4E7HA 3TARA 3QINA 4CGJA 4BWMA 3VF6A 3ZX3A 3L3UA 3IS9A 2KFNA 4NO7A 5GAHP 5CYQA 2O8CA 3P5JA 1BGXT 5J2PA 2GWKA 4GV6A 4DV5K 3E1YA 4M42A 4CZKA 5B8HA 1SKSA 3WXLA 3ZETB 3NMUA 3ULEB 1U48A 3OYHA 1KLNA 3HOTA 4NYFA 4PL7A 5HOOA 4FLYA 1V4TA 4HUFA 4CJ7A 3UKUB 4DFPA 5C25A 2HW3A 2WFBA 4XH4A 3RSEB 4JHDA 3H46O 3T1AA 1WB9A 2I7PA 5HRSA 4CZIA 1ZYQA 1WAJA 1QS4A 3S3NA 1Q9XA 3RR7A 1HNXK 1QHTA 3HXMA 4W5TA 3RMCA 1LOTB 3BZKA 4YY3K 3OS2A 4H5VA 2OA8A 2UUBK 3CCEN 4BRCA 2QKBA 3H1QA 3NH0A 1LWCA 3UKRB 2FF3B 5TKYA 3HPGA 2HHHK 4CZEA 1RILA 2HMPA 2P9SB 2HVHA 5IT9O 4O5FA 4A2AA 1YI2N 3VQEA 1EXQA 1TK5A 4H0OA 1GLLO 3DJCA 3VOVA 4YOYA 5JMVA 4AF1A 4YDUC 4CJEA 4DR4K 4JKAA 4CZHA 4M3YA 4JN4A 4AM6A 4ILGB 3NGZA 3MXIA 1NKEA 4K8XA 3QIPA 3NF9A 3PSIA 2Q97A 2KQ2A 2XY6A 1BIZA 2IAJA 1NGHA 2YV0X 4IFYA 3KLHA 2CGLA 3LL3A 3L4IA 4CK2A 2AP1A 3V1RA 4UY8O 1KRPA 4JI0K 2G8WA 2BE2A 4MO4A 3TWHA 2ZGYA 1D9DA 3NVMA 4CHNA 2HOEA 3OYCA 1TYQA 2E6MA 3SAHA 4CE9A 3JS6A 1H1VA 3SK3A 2WUSA 3DXKA 1NKBA 1NK7A 2D5RA 3CD6N 3HZ6A 4AHUA 3E01A 2PY5A 3O9UA 4MFBA 4JS4A 2KLAA 5C42A 4JK7A 4IFVA 1BUPA 1I39A 3THXA 2OZSA 4BRGA 4CI6A 3LALA 4JKEA 1ZXOA 2ATQA 4GVMA 3SUQA 3ZETA 1NLVA 1DTTA 3KHYA 2YI1A 3OYAA 2GTDA 1NJYA 4Z4FA 1KLMA 2GELA 2V52B 1O1WA 3ZSWA 3RWUA 1Z05A 3ALYA 1OVQA 4TSXA 4CEOA 2F8TA 1NGCA 3SQ0A 5HRNA 1YIJN 2E2PA 1QQMA 3WXKA 4JKGB 1X9JA 3R3LA 1P8ZA 3MXMA 3ZEUB 3VQBA 4GV3A 4Z4IA 1HJRA 1JLFA 1X9WA 4GW6A 4A5AA 3M8SA 3NVKA 3PV8A 4M3RA 1VSJA 1GLJO 5GINA 3OW2M 3V9ZA 3ZSRA 4FM0A 4F3TA 4YOTA 3CCLN 2E8AA 3QETA 1JLEA 4E7KA 2YCHA 4KFBA 4FZXC 2KTQA 2P9PA 4WFNL 3EY1A 4OGEA 4PY5A 3ZX0A 3TI0A 1Q18A 1N6QA 2O8DB 4JI6K 4FJ5A 2FSKA 4B08A 2ASOA 3MEGA 3T69A 4BE1A 3IKMA 1TAUA 5CY4A 3QESA 5FPNA 5MLCQ 2UUCK 1XWLA 4JI4K 2UU9K 2QK9A 3BP8A 1S72N 3U3GA 1NGEA 2RPIA 5AQRA 4CFAA 1QE1A 1HJOA 1S9GA 5GIOA 3VA0A 4C1NI 3U3YA 4FPBA 4CGIA 1Y97A 3O4QA 2E4LA 1LW0A 2VQFK 2OPSA 2FF6A 1KFSA 4DSLA 4DLEA 1DTQA 4DSIA 4I2PA 3VQQA 5AZJA 5AQMA 4BRMA 4BDPA 4ILHA 4DR2K 4J2AA 5CE3A 4WQ4C 2VG5A 4JKDA 3V81A 1WSHA 4YFUA 4F8RA 2OANA 4CJ4A 3P31A 4H8KA 2XY8A 1J53A 1W9HA 2FC0A 3LM2A 3O9RA 1WAFA 1K9MO 1QSYA 2JLEA 4CJ3A 4CCHA 3ULEA 4CFBA 2QWOA 2O8BB 4HUEA 1ZBUA 2VYPA 4G1QA 4K43A 1IG9A 3WNGA 4B1WB 2F96A 4E89A 3D45A 5BPNA 4OPJA 1D4XA 2AJQA 3HRGA 3PX4A 3F5TA 2FBVA 1WNSA 3ASMA 5BN9A 3AVCA 3F9KA 3J7AP 2Z1HA 3B8AX 3BEXA 4JI5K 3DXMB 4JI1K 3VGKA 1ESVA 2YHWA 3AVBA 4ZTFA 3GG4A 1ZBLA 1MDUB 4XH5A 1S6PA 3A2FA 3OYIA 3WXIA 5AQXA 4LF8K 1EWRA 3NCIA 1N36K 1YTAA 1WBBA 2R7YA 3HL8A 4H0XB 1ILYA 5AQHA 4DG1A 1QQCA 1BIUA 1YVNA 2XO7A 4CEFA 4BG9A 4DR1K 3P39A 3EKUA 2HNDA 4DFMA 1JCEA 1NK4A 4I6MB 3WEEB 4B9UA 4HVJA 4CECA 1GLEG 1T6CA 5A2QO 2HBKA 2VQEK 3CG7A 3DI6A 3A5NC 5AZIA 4CFDA 4CF9A 4FWQA 1IBKK 4K8ZA 4H5RA 3LDPA 3EEQA 3MN6A 4CJRA 2F9TA 3I56N 1NGFA 1G99A 2P9PB 4CJQA 3ZSVA 4JLHA 3L6QA 4RW4A 3QERA 5DK5A 3ZSQA 4LH4A 4R79A 3VQ6A 3RMAA 1SUQA 2BTFA 1KD1O 3TTDA 5JLFA 1QHAA 3MWTA 1IV0A 3H08A 1BQNA 1BCOA 1VQ8N 1NK6A 2G8FA 3C6HA 5GIPA 4JNEA 3O80A 3LDQA 1U04A 3CCJN 2B5JA 1EETA 4Z0UA 1WN7A 4EZ9A 4CBUA 4EHUA 4CBXA 3V6DA 3KK2A 3AA5X 3H1VX 1VQ9N 1JLQA 4OLBA 1VQLN 1YHQN 1Q81O 4YOUA 4KAZA 5HLFA 4BR4A 3LPUA 4IZ9A 1EWQA 4E3SA 3VEWA 3MECA 1HPMA 4OJRA 4JHDB 3HT3A 4DV6K 2WONA 5M1NA 4CVNE 1OH6A 4JD2A 3TAFA 3KIOA 3K9JA 3CJ9A 4AM7A 5SWMA 2NRWA 3UKUA 2ZWHA 4H4MA 2VG6A 4NCBA 4JD2B 1FW6A 4DKWA 1GOAA 2ASPA 1VQKN 3CFRA 1KVAA 4K0KK 3J81O 3TANA 3PO5A 4MQ3A 2PFUA 4DTUA 2XY7A 3WXMB 1BISA 3LP2A 5TKWA 1RBSA 1VSLA 1J5EK 2Y1IA 2D4WA 3KWIA 4FJMA 3V9XA 3V1QA 5BRHA 3SNNA 2E6LA 3OHRA 1N33K 3CJ7A 5HRRA 3K59A 4IKFA 4DU3A 4KTQA 4AHRA 3C7NA 2QWPA 4F4KA 1Q82O 4CJVA 5LL6Z 2QM1A 1B9DA 3ZT4A 4F3OA 5KQDA 4DQIA 3T3FA 4CJ5A 3HBTA 4QCLA 1MU2A 1UOCA 1YTUA 5KTQA 2FSJA 4MDAA 3D0PA 4ELTA 1T3VA 3MX2A 1KCFA 3HK2A 1NKCA 3ULDA 5FRNA 1RBRA 4OPAA 3ZCMA 4CEEA 4Z94A 1SQKA 1X3MA 1BOTO 2P9IA 1L3VA 4M45A 4J8FA 4FK2A 5AJ3K 3OS0A 1VSMA 1R59O 4DB3A 4O4GA 3ZYYX 4A57A 1C1AA 2A1SA 4QS8A 3ZT0A 3N4PA 4WCEL 4YDUA 3CCSN 4CHYA 1EO1A 4BGAA 3UIQA 2G8UA 1DEJA 4FOIA 2F9WA 4ID5A 4DTXA 4LC9B 3THYB 3VQAA 3QBXA
chains in the Genus database with same CATH topology
1HRHA 3RR7A 3ITHA 3AA3A 4DFJA 1QHTA 4BACA 3HXMA 4W5TA 3SJJA 2PYLA 3RMCA 4OLAA 1RT3A 3OS2A 3LZJA 1RT6A 2HHXA 2OA8A 4IG3A 4DSFA 4Q5VA 3I0SA 2QKBA 3AVHA 3NH0A 3OYMA 1T7PA 4CGDA 1LWCA 2GUIA 4J2DA 1D8YA 1LAVA 1WSGA 4OKJA 4B8CA 3HPGA 3V9SA 4FJIA 1WSJA 2GV9A 2EHGA 4RW9A 2DFFA 3C95A 4LD0A 5FROA 2Z1GA 3EYZA 3SZ2A 2A1RA 1RILA 1IKYA 2HHUA 2HVHA 3VQEA 1EXQA 1FKPA 1TK5A 1A5WA 3SQ2A 2VWKA 2GBZA 4CJUA 2HHVA 2G8KA 2X6SA 4CJEA 4DSEA 4FZZA 3CM5A 3NF7A 4AHSA 4M3YA 3M8QA 3SCXA 2YNIA 3VN5A 3I0RA 5JS2A 1BI4B 3NGZA 1C0MA 4BDZA 3MXIA 3QIPA 1S5JA 3NF9A 1IO2A 4DFKA 4K8XA 1K6YA 1S1XA 3B6OA 4FCYA 1A5XA 3PO4A 2KQ2A 2XY6A 3THVA 1BIZA 2IAJA 3V9WA 2YV0X 3HP9A 3K5OA 4IFYA 1ASUA 3KLHA 3S3OA 1U49A 1SL1A 4B9LA 4N76A 4CK2A 4J2EA 4F2RA 3V1RA 3OVNA 1N5YA 2XY5A 3DRPA 1ASWA 3CQ8A 3SYZA 1Q9YA 1KRPA 4NCAA 2ZQBA 1TVRA 3CFOA 3LP0A 2G8WA 2BE2A 4J2BA 3TWHA 2D0BA 3DLEA 3LANA 1EX4A 1D9DA 4CHNA 4I7FA 1TGOA 4DMNA 3OYCA 3OYKA 4FJGA 2E6MA 4KRFA 4KREA 1RBUA 3NF8A 2ITGA 4CE9A 4O0IA 1LAWA 3V4IA 3KD1E 4KHQA 1RCHA 4CJLA 3BGRA 1C0TA 1VSHA 2O4GA 4KKOA 1U47A 4FJNA 1NKBA 2RN2A 4DTRA 1NK7A 1BL3A 1QSLA 4FK0A 2D5RA 1L3TA 2HNZA 3ZSOA 4EP5A 1RNHA 1L3UA 4AHUA 3E01A 4CJPA 3F73A 1NK8A 4ZTJA 1JXEA 2PY5A 4FJKA 4OGCA 1KVCA 4MFBA 3AO4A 4C8NA 4JS4A 4B9VA 1X1PA 4CF2A 4CGFA 5E41A 4FLWA 5CZ2A 4DF8A 5C42A 1SL2A 1JXBA 1RT7A 4IFVA 3KLFA 3AO1A 3RMBA 3QEPA 1NJWA 3K5LA 1I39A 4N5SA 1VRTA 4JRPA 3BDPA 2OZSA 3AVFA 3M8PA 5HROA 3NHGA 4L8RB 3LALA 3U6FA 2X78A 2OYQA 1Q8IA 3ZT2A 3RRHA 5C24A 4DWIA 4RW6A 3KK1A 2ATQA 1BQMA 3VA3A 5FRMA 3EZ5A 4GVMA 4C8OA 1U4BA 1T05A 2W42A 3SUQA 3ZSZA 4ZHRA 2KFZA 4RG8A 1RTDA 1DTTA 4AH9A 1NK9A 4F2SA 3O4NA 3OYAA 4CF8A 4N41A 3AO2A 3ZT1A 1NJYA 4Y1CA 4CJSA 4Z4FA 2QXFA 1KLMA 1YT3A 3TAPA 4FJHA 1T03A 4C8LA 1O1WA 3ZSWA 3RWUA 1HNVA 3M8RA 3ALYA 4BE2A 1WSFA 3VQDA 3AA4A 4TSXA 3L2QA 4KB1A 1IKWA 4CEOA 2KZMA 2F8TA 1JLCA 3QEXA 3NFAA 1RDBA 1NK0A 1C1BA 4FM1A 3SQ0A 1QTMA 5HRNA 4B9NA 3SPYA 1LWEA 2OPRA 4HCCA 4PWDA 4DTMA 2O4IA 1KVBA 4I9QA 2F8SA 3MXMA 1L3SA 2YHAA 3VQBA 4Z4IA 3HJFA 3C94A 1HJRA 1JLFA 1RTIA 4DQQA 1TAQA 1X9WA 1HYZA 1FKOA 4GW6A 3M8SA 3LWLA 3PV8A 1RTHA 1RDDA 4M3RA 1VSJA 4CERA 3SQ4A 5KGXA 3QEWA 2BDPA 2HB5A 3SQ1A 2B6AA 1EP4A 1S6QA 3ZSRA 4CIGA 4FM0A 3V9ZA 4E7IA 1XC9A 4DQPA 4F3TA 4O55A 4FZYA 4LSNA 4EZ6A 1CZ9A 3QETA 4KHUA 3L3VA 1JLEA 4E7KA 4KFBA 2IC3A 3RMDA 3KD5E 4FZXC 2KTQA 3V1OA 5D3GA 2G8HA 4KHNA 4LH5A 1KFDA 3EY1A 4OGEA 4PY5A 1KSPA 3TI0A 3WNFA 5FDLA 4KV8A 4HTUA 3AVGA 3CM6A 4CK3A 1TL1A 4DU1A 3OYGA 1N6QA 3O3FA 1B92A 2YNHA 3NBPA 2DTUA 4FJ5A 3DRRA 4M3XA 4HCBA 4E1MA 4B08A 4BE1A 3MEGA 2X74A 1UA1A 4W5NA 3LAMA 4Z4HA 3DMJA 5CY4A 1TAUA 3QESA 1VRUA 2IDOA 3VQ9A 4FJ8A 4M3UA 1XWLA 3DLKA 2QK9A 2G8IA 1TK8A 4O44A 1BCMA 3VQPA 4FM2A 3AVNA 2RPIA 4C8MA 3U3GA 1LWFA 1QE1A 4CFAA 4E0DA 3TAMA 3NAEA 4CHOA 3P1GA 3TAGA 1ITGA 1S9GA 3VA0A 1NOYA 1J9AA 3U3YA 1WSIA 3CFPA 1JLGA 3KKSA 1A5VA 2ZE2A 5DMRA 1TK0A 2ZD1A 2Y1JA 4CGIA 5J2MA 3FFIA 3P83D 1UA0A 1IKXA 2HMIA 3AVJA 1I3AA 1Y97A 3O4QA 4H4OA 4PA1A 1KTQA 3OYEA 2PZSA 1TKZA 2E4LA 1LW0A 2OPSA 2YNGA 1X9MA 1KFSA 4KI6A 4DSLA 2RKIA 4PUOA 1SV5A 4FVMA 1DTQA 4DLEA 4DSIA 1UAXA 3DOKA 4I2PA 4FLTA 3VQQA 4IBNA 4BDPA 1FXXA 4J2AA 4I9LA 3DLHA 3HVTA 2VG5A 4DF4A 3V81A 4DS5A 2HVIA 4DU4A 2D0CA 1NK5A 1WSHA 5JS1A 4YFUA 3L2VA 4OVLA 3VQ8A 3NDKA 1HNIA 1VSFA 4F8RA 1TV6A 4CJ4A 4H8KA 2DY4A 2XY8A 3OYLA 1J53A 3AO3A 1W9HA 2FC0A 3IRXA 2BANA 3AVMA 1WAFA 4QAGA 2HHSA 3IG1A 3V9UA 1J54A 2BGGA 1XHZA 5SZTA 4NCGA 1QSYA 5HRPA 2JLEA 3CYMA 4CJ3A 3OJUA 3S9HA 3C6UA 4CCHA 5KRSA 4FYDA 5J1EA 1T8EA 1X9SA 4FLZA 4CFBA 4OKEA 4O0JA 4CHZA 4HUEA 1NJZA 1NOZA 3HM9A 1ZBUA 4DTNA 2HHQA 1D5AA 1WSEA 4CF0A 4LSLA 3ZT3A 5J2NA 1RTJA 4G1QA 3L2RA 1IG9A 3WNGA 2D0AA 4PQUA 1SKWA 2ETJA 1G15A 3DOLA 3IAYA 3NF6A 3K58A 2F96A 4E89A 3D45A 2OZMA 4OPJA 4ICLA 2AJQA 3PX4A 3K57A 5KRTA 1JL2A 4CF1A 2FBVA 1WNSA 3ASMA 4KTWA 3AVCA 4NYNA 5EU7A 4AHTA 3F9KA 3OYFA 1ZBHA 1LW2A 5J2QA 1JLAA 2Z1HA 3HPOA 3TABA 3ZSYA 3KLEA 5CZ1A 3WNEA 4ELUA 2Z1IA 3AVIA 3AVBA 4ZTFA 1ZBLA 4AHCA 3OYNA 4RW8A 4JRQA 4W5QA 2IGIA 4KO0A 2OPPA 3JYTA 1S6PA 3A2FA 2NUBA 3OYIA 2WOMA 4CK1A 3OS1A 4CIEA 3LP3A 4FJJA 3G10A 1VSKA 4CESA 1R0AA 1D9FA 2OPQA 1RT1A 1S9EA 3L2UA 3NCIA 1YTAA 1F21A 4Y1DA 3RTVA 2R7YA 4KB0A 3HL8A 4CEDA 5I3UA 3NGYA 3JSMA 1ASVA 2LSNA 4DG1A 2KZZA 1QQCA 1BIUA 2XO7A 1LV5A 4KPYA 3NH1A 4CEFA 3QEIA 3O3GA 1YVUA 2HNDA 3QO9A 1RDCA 1J5OA 4DFMA 4B9TA 3ISNC 1NK4A 2Z1JA 4B9UA 4HVJA 3MEEA 1JLBA 4CECA 2P5GA 3NH2A 3CG7A 1EKEA 3DI6A 4ID1A 4LY7A 1W0HA 4CGHA 4CF9A 4CFDA 4AILC 4FJXA 4CEZA 4K8ZA 1VSIA 4CJRA 4FJ7A 3OYDA 4FJLA 1XHXA 4CJQA 3ZSVA 2FBXA 1GOCA 1BHLA 1S1VA 4CEBA 4YNQA 1ZBIA 4JLHA 4M41A 1VSDA 1C1CA 1DLOA 4RW4A 3QNOA 1BI4A 3QERA 1NKEA 3SV4A 5DK5A 4EP4A 3ZSQA 4GMJB 4LH4A 4R5PA 2YHBA 3I8DA 3TR8A 3VQ6A 4DQRA 3NE6A 3RMAA 3S3MA 4IG0A 1SUQA 1VSEA 2PYJA 2HHWA 4OKKA 4FW2A 4CGGA 1CXQA 1Z25A 2IS3A 3DYAA 3K5MA 1HQEA 1NJXA 3TAQA 3SPZA 4N56A 3H08A 4RW7A 1JKHA 1L5UA 1BQNA 2HHTA 1BCOA 1RT2A 4QOZB 4BE0A 3AVLA 4DTSA 5T7BA 1NK6A 2G8FA 1Q9XA 3KLGA 3LAKA 3LWMA 4KTZA 5I42A 4W5OA 1CLQA 4DQSA 1U04A 2B5JA 3KK3A 3SV3A 2VG7A 1HYSA 1EETA 4Z0UA 2EX3A 3QNNA 1WN7A 3RR8A 2I5JA 4EZ9A 3K2PA 1S1WA 3SUNA 1RBTA 3VQCA 3V6DA 3KLIA 3KK2A 4FLVA 3AA5X 2X6NA 1JLQA 2G8VA 1IKVA 3C6TA 4OLBA 3B6PA 3SI6A 4KAZA 3KJVA 3PX6A 1ZBFA 1FK9A 5HLFA 3LPUA 3AVAA 3VQ4A 1REVA 3NGIA 3WNHA 4W5RA 4HUGA 4OPKA 4E3SA 2Q3SA 4CEAA 3O3HA 3QEVA 4FW1A 3LP1A 3MECA 2DFEA 3HSTB 2YKNA 1RT4A 1TKXA 2KW4A 1JL1A 4OJRA 3HT3A 4B3OA 2WONA 3OY9A 3MEDA 2JGUA 2B4JA 1C0UA 4CFCA 4HHTA 3AA2A 4WE1A 3KIOA 3TAFA 3HP6A 1U45A 1S1UA 5SWMA 4FJ9A 2DFHA 1WLJA 3VQ7A 4H4MA 2VG6A 4E1NA 4NCBA 2QKKA 1CXUA 2P51A 3HPHA 3DM2A 1RT5A 4E7JA 3SUOA 3LPTA 3ZSXA 4CJFA 1C6VA 2P1JA 4FXDA 1HPZA 4DTPA 2P5OA 4M3ZA 1GOAA 3T19A 1XI1A 1SKRA 4B8AB 3PY8A 4E7LA 3HYFA 4DSKA 4M3TA 2XHBA 4FLXA 3CFRA 1KVAA 4N47A 3TANA 2VWJA 4UQGA 1QSSA 3PO5A 4MQ3A 1UWBA 3G0ZA 1TL3A 1HMVA 5K14A 3AO5A 4AHVA 4DTUA 4DS4A 2XY7A 4M3WA 1BISA 3LP2A 4I2QA 1RBSA 4FK4A 1VSLA 3LZIA 4CHQA 3KTQA 1HYVA 4B9SA 5KI6A 2Y1IA 4KI4A 1Z26A 3OYBA 4CJWA 4FJMA 4Q0BA 3V9XA 4CHPA 3V1QA 4DTJA 4BDYA 3SNNA 2E6LA 3HO1A 5HRRA 1S1TA 4IDKA 4CJTA 3K59A 4KHSA 3AVKA 3DLGA 4IKFA 4KHWA 3DLBA 4B9MA 5KGWA 4CIFA 2YKMA 3QLHA 3AV9A 3KKRA 4DU3A 3DRSA 4E7HA 3TARA 4C8KA 3QINA 4CGJA 4CJKA 4AHRA 4KTQA 2XRIA 3QIOA 4BWMA 4F4KA 4CJVA 1VK0A 4Z4EA 3PUFA 3L3UA 3IS9A 1B9DA 3ZT4A 3OYJA 2KFNA 4F3OA 3VQ5A 4DQIA 5CYQA 4E19A 3T3FA 1TKDA 3P5JA 1BGXT 2FBYA 5J2PA 3L2WA 4CJ5A 4QCLA 3K5NA 1MU2A 1UOCA 1YTUA 2HNYA 5HBMA 5KTQA 3D0PA 4M42A 4ELTA 3HVRA 1SKSA 4O5BA 1KCFA 4JS5A 3PX0A 3HK2A 1CZBA 3L8BA 1U48A 1NKCA 3ULDA 3OYHA 4DTOA 1KLNA 5FRNA 1RBRA 3MXJA 4NYFA 1B9FA 3ZCMA 4CEEA 4Z4CA 3TAEA 3LDSA 4FLYA 1L3VA 3OJSA 3DLRA 4M45A 3MAQA 4HUFA 2FBTA 4BWJA 4FK2A 1GOBA 3OS0A 1VSMA 4XIUA 4DFPA 4ELVA 5C25A 4Z4GA 4O4GA 5HP1A 2HW3A 1RBVA 4KHYA 2YNFA 4FLUA 1RDAA 1C1AA 2A1SA 2IOCA 3SUPA 1SL0A 3ZT0A 1HQUA 3T1AA 4CHYA 4DSJA 3UIQA 2G8UA 3RRGA 1IH7A 5CYMA 5HRSA 1TKTA 4ID5A 4DLGA 4DTXA 1ZYQA 1WAJA 1QS4A 3S3NA 4CEQA 3VQAA 2RF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HRH A;  3RR7 A;  3ITH A;  3AA3 A;  4DFJ A;  1QHT A;  4BAC A;  3HXM A;  4W5T A;  3SJJ A;  2PYL A;  3RMC A;  4OLA A;  1RT3 A;  3OS2 A;  3LZJ A;  1RT6 A;  2HHX A;  2OA8 A;  4IG3 A;  4DSF A;  4Q5V A;  3I0S A;  2QKB A;  3AVH A;  3NH0 A;  3OYM A;  1T7P A;  4CGD A;  1LWC A;  2GUI A;  4J2D A;  1D8Y A;  1LAV A;  1WSG A;  4OKJ A;  4B8C A;  3HPG A;  3V9S A;  4FJI A;  1WSJ A;  2GV9 A;  2EHG A;  4RW9 A;  2DFF A;  3C95 A;  4LD0 A;  5FRO A;  2Z1G A;  3EYZ A;  3SZ2 A;  2A1R A;  1RIL A;  1IKY A;  2HHU A;  2HVH A;  3VQE A;  1EXQ A;  1FKP A;  1TK5 A;  1A5W A;  3SQ2 A;  2VWK A;  2GBZ A;  4CJU A;  2HHV A;  2G8K A;  2X6S A;  4CJE A;  4DSE A;  4FZZ A;  3CM5 A;  3NF7 A;  4AHS A;  4M3Y A;  3M8Q A;  3SCX A;  2YNI A;  3VN5 A;  3I0R A;  5JS2 A;  1BI4 B;  3NGZ A;  1C0M A;  4BDZ A;  3MXI A;  3QIP A;  1S5J A;  3NF9 A;  1IO2 A;  4DFK A;  4K8X A;  1K6Y A;  1S1X A;  3B6O A;  4FCY A;  1A5X A;  3PO4 A;  2KQ2 A;  2XY6 A;  3THV A;  1BIZ A;  2IAJ A;  3V9W A;  2YV0 X;  3HP9 A;  3K5O A;  4IFY A;  1ASU A;  3KLH A;  3S3O A;  1U49 A;  1SL1 A;  4B9L A;  4N76 A;  4CK2 A;  4J2E A;  4F2R A;  3V1R A;  3OVN A;  1N5Y A;  2XY5 A;  3DRP A;  1ASW A;  3CQ8 A;  3SYZ A;  1Q9Y A;  1KRP A;  4NCA A;  2ZQB A;  1TVR A;  3CFO A;  3LP0 A;  2G8W A;  2BE2 A;  4J2B A;  3TWH A;  2D0B A;  3DLE A;  3LAN A;  1EX4 A;  1D9D A;  4CHN A;  4I7F A;  1TGO A;  4DMN A;  3OYC A;  3OYK A;  4FJG A;  2E6M A;  4KRF A;  4KRE A;  1RBU A;  3NF8 A;  2ITG A;  4CE9 A;  4O0I A;  1LAW A;  3V4I A;  3KD1 E;  4KHQ A;  1RCH A;  4CJL A;  3BGR A;  1C0T A;  1VSH A;  2O4G A;  4KKO A;  1U47 A;  4FJN A;  1NKB A;  2RN2 A;  4DTR A;  1NK7 A;  1BL3 A;  1QSL A;  4FK0 A;  2D5R A;  1L3T A;  2HNZ A;  3ZSO A;  4EP5 A;  1RNH A;  1L3U A;  4AHU A;  3E01 A;  4CJP A;  3F73 A;  1NK8 A;  4ZTJ A;  1JXE A;  2PY5 A;  4FJK A;  4OGC A;  1KVC A;  4MFB A;  3AO4 A;  4C8N A;  4JS4 A;  4B9V A;  1X1P A;  4CF2 A;  4CGF A;  5E41 A;  4FLW A;  5CZ2 A;  4DF8 A;  5C42 A;  1SL2 A;  1JXB A;  1RT7 A;  4IFV A;  3KLF A;  3AO1 A;  3RMB A;  3QEP A;  1NJW A;  3K5L A;  1I39 A;  4N5S A;  1VRT A;  4JRP A;  3BDP A;  2OZS A;  3AVF A;  3M8P A;  5HRO A;  3NHG A;  4L8R B;  3LAL A;  3U6F A;  2X78 A;  2OYQ A;  1Q8I A;  3ZT2 A;  3RRH A;  5C24 A;  4DWI A;  4RW6 A;  3KK1 A;  2ATQ A;  1BQM A;  3VA3 A;  5FRM A;  3EZ5 A;  4GVM A;  4C8O A;  1U4B A;  1T05 A;  2W42 A;  3SUQ A;  3ZSZ A;  4ZHR A;  2KFZ A;  4RG8 A;  1RTD A;  1DTT A;  4AH9 A;  1NK9 A;  4F2S A;  3O4N A;  3OYA A;  4CF8 A;  4N41 A;  3AO2 A;  3ZT1 A;  1NJY A;  4Y1C A;  4CJS A;  4Z4F A;  2QXF A;  1KLM A;  1YT3 A;  3TAP A;  4FJH A;  1T03 A;  4C8L A;  1O1W A;  3ZSW A;  3RWU A;  1HNV A;  3M8R A;  3ALY A;  4BE2 A;  1WSF A;  3VQD A;  3AA4 A;  4TSX A;  3L2Q A;  4KB1 A;  1IKW A;  4CEO A;  2KZM A;  2F8T A;  1JLC A;  3QEX A;  3NFA A;  1RDB A;  1NK0 A;  1C1B A;  4FM1 A;  3SQ0 A;  1QTM A;  5HRN A;  4B9N A;  3SPY A;  1LWE A;  2OPR A;  4HCC A;  4PWD A;  4DTM A;  2O4I A;  1KVB A;  4I9Q A;  2F8S A;  3MXM A;  1L3S A;  2YHA A;  3VQB A;  4Z4I A;  3HJF A;  3C94 A;  1HJR A;  1JLF A;  1RTI A;  4DQQ A;  1TAQ A;  1X9W A;  1HYZ A;  1FKO A;  4GW6 A;  3M8S A;  3LWL A;  3PV8 A;  1RTH A;  1RDD A;  4M3R A;  1VSJ A;  4CER A;  3SQ4 A;  5KGX A;  3QEW A;  2BDP A;  2HB5 A;  3SQ1 A;  2B6A A;  1EP4 A;  1S6Q A;  3ZSR A;  4CIG A;  4FM0 A;  3V9Z A;  4E7I A;  1XC9 A;  4DQP A;  4F3T A;  4O55 A;  4FZY A;  4LSN A;  4EZ6 A;  1CZ9 A;  3QET A;  4KHU A;  3L3V A;  1JLE A;  4E7K A;  4KFB A;  2IC3 A;  3RMD A;  3KD5 E;  4FZX C;  2KTQ A;  3V1O A;  5D3G A;  2G8H A;  4KHN A;  4LH5 A;  1KFD A;  3EY1 A;  4OGE A;  4PY5 A;  1KSP A;  3TI0 A;  3WNF A;  5FDL A;  4KV8 A;  4HTU A;  3AVG A;  3CM6 A;  4CK3 A;  1TL1 A;  4DU1 A;  3OYG A;  1N6Q A;  3O3F A;  1B92 A;  2YNH A;  3NBP A;  2DTU A;  4FJ5 A;  3DRR A;  4M3X A;  4HCB A;  4E1M A;  4B08 A;  4BE1 A;  3MEG A;  2X74 A;  1UA1 A;  4W5N A;  3LAM A;  4Z4H A;  3DMJ A;  5CY4 A;  1TAU A;  3QES A;  1VRU A;  2IDO A;  3VQ9 A;  4FJ8 A;  4M3U A;  1XWL A;  3DLK A;  2QK9 A;  2G8I A;  1TK8 A;  4O44 A;  1BCM A;  3VQP A;  4FM2 A;  3AVN A;  2RPI A;  4C8M A;  3U3G A;  1LWF A;  1QE1 A;  4CFA A;  4E0D A;  3TAM A;  3NAE A;  4CHO A;  3P1G A;  3TAG A;  1ITG A;  1S9G A;  3VA0 A;  1NOY A;  1J9A A;  3U3Y A;  1WSI A;  3CFP A;  1JLG A;  3KKS A;  1A5V A;  2ZE2 A;  5DMR A;  1TK0 A;  2ZD1 A;  2Y1J A;  4CGI A;  5J2M A;  3FFI A;  3P83 D;  1UA0 A;  1IKX A;  2HMI A;  3AVJ A;  1I3A A;  1Y97 A;  3O4Q A;  4H4O A;  4PA1 A;  1KTQ A;  3OYE A;  2PZS A;  1TKZ A;  2E4L A;  1LW0 A;  2OPS A;  2YNG A;  1X9M A;  1KFS A;  4KI6 A;  4DSL A;  2RKI A;  4PUO A;  1SV5 A;  4FVM A;  1DTQ A;  4DLE A;  4DSI A;  1UAX A;  3DOK A;  4I2P A;  4FLT A;  3VQQ A;  4IBN A;  4BDP A;  1FXX A;  4J2A A;  4I9L A;  3DLH A;  3HVT A;  2VG5 A;  4DF4 A;  3V81 A;  4DS5 A;  2HVI A;  4DU4 A;  2D0C A;  1NK5 A;  1WSH A;  5JS1 A;  4YFU A;  3L2V A;  4OVL A;  3VQ8 A;  3NDK A;  1HNI A;  1VSF A;  4F8R A;  1TV6 A;  4CJ4 A;  4H8K A;  2DY4 A;  2XY8 A;  3OYL A;  1J53 A;  3AO3 A;  1W9H A;  2FC0 A;  3IRX A;  2BAN A;  3AVM A;  1WAF A;  4QAG A;  2HHS A;  3IG1 A;  3V9U A;  1J54 A;  2BGG A;  1XHZ A;  5SZT A;  4NCG A;  1QSY A;  5HRP A;  2JLE A;  3CYM A;  4CJ3 A;  3OJU A;  3S9H A;  3C6U A;  4CCH A;  5KRS A;  4FYD A;  5J1E A;  1T8E A;  1X9S A;  4FLZ A;  4CFB A;  4OKE A;  4O0J A;  4CHZ A;  4HUE A;  1NJZ A;  1NOZ A;  3HM9 A;  1ZBU A;  4DTN A;  2HHQ A;  1D5A A;  1WSE A;  4CF0 A;  4LSL A;  3ZT3 A;  5J2N A;  1RTJ A;  4G1Q A;  3L2R A;  1IG9 A;  3WNG A;  2D0A A;  4PQU A;  1SKW A;  2ETJ A;  1G15 A;  3DOL A;  3IAY A;  3NF6 A;  3K58 A;  2F96 A;  4E89 A;  3D45 A;  2OZM A;  4OPJ A;  4ICL A;  2AJQ A;  3PX4 A;  3K57 A;  5KRT A;  1JL2 A;  4CF1 A;  2FBV A;  1WNS A;  3ASM A;  4KTW A;  3AVC A;  4NYN A;  5EU7 A;  4AHT A;  3F9K A;  3OYF A;  1ZBH A;  1LW2 A;  5J2Q A;  1JLA A;  2Z1H A;  3HPO A;  3TAB A;  3ZSY A;  3KLE A;  5CZ1 A;  3WNE A;  4ELU A;  2Z1I A;  3AVI A;  3AVB A;  4ZTF A;  1ZBL A;  4AHC A;  3OYN A;  4RW8 A;  4JRQ A;  4W5Q A;  2IGI A;  4KO0 A;  2OPP A;  3JYT A;  1S6P A;  3A2F A;  2NUB A;  3OYI A;  2WOM A;  4CK1 A;  3OS1 A;  4CIE A;  3LP3 A;  4FJJ A;  3G10 A;  1VSK A;  4CES A;  1R0A A;  1D9F A;  2OPQ A;  1RT1 A;  1S9E A;  3L2U A;  3NCI A;  1YTA A;  1F21 A;  4Y1D A;  3RTV A;  2R7Y A;  4KB0 A;  3HL8 A;  4CED A;  5I3U A;  3NGY A;  3JSM A;  1ASV A;  2LSN A;  4DG1 A;  2KZZ A;  1QQC A;  1BIU A;  2XO7 A;  1LV5 A;  4KPY A;  3NH1 A;  4CEF A;  3QEI A;  3O3G A;  1YVU A;  2HND A;  3QO9 A;  1RDC A;  1J5O A;  4DFM A;  4B9T A;  3ISN C;  1NK4 A;  2Z1J A;  4B9U A;  4HVJ A;  3MEE A;  1JLB A;  4CEC A;  2P5G A;  3NH2 A;  3CG7 A;  1EKE A;  3DI6 A;  4ID1 A;  4LY7 A;  1W0H A;  4CGH A;  4CF9 A;  4CFD A;  4AIL C;  4FJX A;  4CEZ A;  4K8Z A;  1VSI A;  4CJR A;  4FJ7 A;  3OYD A;  4FJL A;  1XHX A;  4CJQ A;  3ZSV A;  2FBX A;  1GOC A;  1BHL A;  1S1V A;  4CEB A;  4YNQ A;  1ZBI A;  4JLH A;  4M41 A;  1VSD A;  1C1C A;  1DLO A;  4RW4 A;  3QNO A;  1BI4 A;  3QER A;  1NKE A;  3SV4 A;  5DK5 A;  4EP4 A;  3ZSQ A;  4GMJ B;  4LH4 A;  4R5P A;  2YHB A;  3I8D A;  3TR8 A;  3VQ6 A;  4DQR A;  3NE6 A;  3RMA A;  3S3M A;  4IG0 A;  1SUQ A;  1VSE A;  2PYJ A;  2HHW A;  4OKK A;  4FW2 A;  4CGG A;  1CXQ A;  1Z25 A;  2IS3 A;  3DYA A;  3K5M A;  1HQE A;  1NJX A;  3TAQ A;  3SPZ A;  4N56 A;  3H08 A;  4RW7 A;  1JKH A;  1L5U A;  1BQN A;  2HHT A;  1BCO A;  1RT2 A;  4QOZ B;  4BE0 A;  3AVL A;  4DTS A;  5T7B A;  1NK6 A;  2G8F A;  1Q9X A;  3KLG A;  3LAK A;  3LWM A;  4KTZ A;  5I42 A;  4W5O A;  1CLQ A;  4DQS A;  1U04 A;  2B5J A;  3KK3 A;  3SV3 A;  2VG7 A;  1HYS A;  1EET A;  4Z0U A;  2EX3 A;  3QNN A;  1WN7 A;  3RR8 A;  2I5J A;  4EZ9 A;  3K2P A;  1S1W A;  3SUN A;  1RBT A;  3VQC A;  3V6D A;  3KLI A;  3KK2 A;  4FLV A;  3AA5 X;  2X6N A;  1JLQ A;  2G8V A;  1IKV A;  3C6T A;  4OLB A;  3B6P A;  3SI6 A;  4KAZ A;  3KJV A;  3PX6 A;  1ZBF A;  1FK9 A;  5HLF A;  3LPU A;  3AVA A;  3VQ4 A;  1REV A;  3NGI A;  3WNH A;  4W5R A;  4HUG A;  4OPK A;  4E3S A;  2Q3S A;  4CEA A;  3O3H A;  3QEV A;  4FW1 A;  3LP1 A;  3MEC A;  2DFE A;  3HST B;  2YKN A;  1RT4 A;  1TKX A;  2KW4 A;  1JL1 A;  4OJR A;  3HT3 A;  4B3O A;  2WON A;  3OY9 A;  3MED A;  2JGU A;  2B4J A;  1C0U A;  4CFC A;  4HHT A;  3AA2 A;  4WE1 A;  3KIO A;  3TAF A;  3HP6 A;  1U45 A;  1S1U A;  5SWM A;  4FJ9 A;  2DFH A;  1WLJ A;  3VQ7 A;  4H4M A;  2VG6 A;  4E1N A;  4NCB A;  2QKK A;  1CXU A;  2P51 A;  3HPH A;  3DM2 A;  1RT5 A;  4E7J A;  3SUO A;  3LPT A;  3ZSX A;  4CJF A;  1C6V A;  2P1J A;  4FXD A;  1HPZ A;  4DTP A;  2P5O A;  4M3Z A;  1GOA A;  3T19 A;  1XI1 A;  1SKR A;  4B8A B;  3PY8 A;  4E7L A;  3HYF A;  4DSK A;  4M3T A;  2XHB A;  4FLX A;  3CFR A;  1KVA A;  4N47 A;  3TAN A;  2VWJ A;  4UQG A;  1QSS A;  3PO5 A;  4MQ3 A;  1UWB A;  3G0Z A;  1TL3 A;  1HMV A;  5K14 A;  3AO5 A;  4AHV A;  4DTU A;  4DS4 A;  2XY7 A;  4M3W A;  1BIS A;  3LP2 A;  4I2Q A;  1RBS A;  4FK4 A;  1VSL A;  3LZI A;  4CHQ A;  3KTQ A;  1HYV A;  4B9S A;  5KI6 A;  2Y1I A;  4KI4 A;  1Z26 A;  3OYB A;  4CJW A;  4FJM A;  4Q0B A;  3V9X A;  4CHP A;  3V1Q A;  4DTJ A;  4BDY A;  3SNN A;  2E6L A;  3HO1 A;  5HRR A;  1S1T A;  4IDK A;  4CJT A;  3K59 A;  4KHS A;  3AVK A;  3DLG A;  4IKF A;  4KHW A;  3DLB A;  4B9M A;  5KGW A;  4CIF A;  2YKM A;  3QLH A;  3AV9 A;  3KKR A;  4DU3 A;  3DRS A;  4E7H A;  3TAR A;  4C8K A;  3QIN A;  4CGJ A;  4CJK A;  4AHR A;  4KTQ A;  2XRI A;  3QIO A;  4BWM A;  4F4K A;  4CJV A;  1VK0 A;  4Z4E A;  3PUF A;  3L3U A;  3IS9 A;  1B9D A;  3ZT4 A;  3OYJ A;  2KFN A;  4F3O A;  3VQ5 A;  4DQI A;  5CYQ A;  4E19 A;  3T3F A;  1TKD A;  3P5J A;  1BGX T;  2FBY A;  5J2P A;  3L2W A;  4CJ5 A;  4QCL A;  3K5N A;  1MU2 A;  1UOC A;  1YTU A;  2HNY A;  5HBM A;  5KTQ A;  3D0P A;  4M42 A;  4ELT A;  3HVR A;  1SKS A;  4O5B A;  1KCF A;  4JS5 A;  3PX0 A;  3HK2 A;  1CZB A;  3L8B A;  1U48 A;  1NKC A;  3ULD A;  3OYH A;  4DTO A;  1KLN A;  5FRN A;  1RBR A;  3MXJ A;  4NYF A;  1B9F A;  3ZCM A;  4CEE A;  4Z4C A;  3TAE A;  3LDS A;  4FLY A;  1L3V A;  3OJS A;  3DLR A;  4M45 A;  3MAQ A;  4HUF A;  2FBT A;  4BWJ A;  4FK2 A;  1GOB A;  3OS0 A;  1VSM A;  4XIU A;  4DFP A;  4ELV A;  5C25 A;  4Z4G A;  4O4G A;  5HP1 A;  2HW3 A;  1RBV A;  4KHY A;  2YNF A;  4FLU A;  1RDA A;  1C1A A;  2A1S A;  2IOC A;  3SUP A;  1SL0 A;  3ZT0 A;  1HQU A;  3T1A A;  4CHY A;  4DSJ A;  3UIQ A;  2G8U A;  3RRG A;  1IH7 A;  5CYM A;  5HRS A;  1TKT A;  4ID5 A;  4DLG A;  4DTX A;  1ZYQ A;  1WAJ A;  1QS4 A;  3S3N A;  4CEQ A;  3VQA A;  2RF2 A; 
#chains in the Genus database with same CATH topology
 4X64 K;  3A5O C;  3SJJ A;  2PYL A;  1BWF O;  2NLX A;  4IG3 A;  3J8A A;  3I0S A;  3C7N B;  4CGD A;  2GUI A;  4GY2 B;  2GX9 A;  4J2D A;  3G6E N;  4FJI A;  4IJA A;  3CQY A;  4WQ5 A;  2GV9 A;  2EHG A;  4FL9 A;  2QEX N;  4LD0 A;  4BRD A;  1DKG D;  3ENB A;  1IKY A;  3PIP L;  3G71 N;  4B3T K;  2HHU A;  5AQL A;  3M5R A;  1FKP A;  4BRF A;  1A5W A;  4MLE A;  3FZM A;  2VWK A;  2GBZ A;  4CJU A;  2X6S A;  2CH5 A;  3CJA A;  4BRH A;  3MN5 A;  4BGB A;  2HHV A;  4BDZ A;  1C0M A;  2BH1 A;  4H0V B;  5AR0 A;  2D0O A;  2P9L B;  4CZM A;  1A5X A;  5C2D A;  2OTJ N;  2HST A;  3HP9 A;  1HNZ K;  1U49 A;  4H0Y B;  1ASU A;  4FO0 A;  2H3G X;  4JKB A;  5M1K A;  3VEY A;  3GBT A;  1Q9Y A;  3OBW A;  3CI5 A;  5AQJ A;  3MK6 A;  4J2B A;  3LP0 A;  2ZJP L;  4KRF A;  4I7F A;  4DMN A;  2Q31 A;  3OYK A;  4FJG A;  2E20 A;  4KRE A;  1RBU A;  4FJN A;  1VSH A;  1BL3 A;  3TTC A;  4FK0 A;  1L3T A;  4DCH A;  4EP5 A;  3MX5 A;  1L3U A;  1NK8 A;  4CJP A;  3ENH A;  1JXE A;  2IVP A;  4FJK A;  4C8N A;  4B9V A;  5BR8 K;  3DLL L;  3DAW A;  3MCP A;  5CZ2 A;  1JXB A;  1WUA A;  3KLF A;  1NJW A;  3SBT A;  3K5L A;  4N5S A;  3EL2 A;  3I55 N;  4IJN A;  3AVF A;  3PSF A;  4OO1 J;  3NHG A;  3U6F A;  1Q8I A;  4NXM K;  3ZLJ A;  4RW6 A;  3CHW A;  1BDG A;  4BRP A;  4CBW A;  4A5B A;  3VA3 A;  3ZSZ A;  4ZHR A;  4RG8 A;  2Q0R A;  4AH9 A;  4N41 A;  4CF8 A;  4NXN K;  4Y1C A;  4CJS A;  2QXF A;  3VF2 A;  5ADX H;  3TAP A;  2E1Z A;  4C8L A;  2O8B A;  1HNV A;  4WFA L;  2QWR A;  4BE2 A;  3VQD A;  1IKW A;  2KZM A;  4CZG A;  1JLC A;  5AQN A;  1RDB A;  4B3M K;  1C1B A;  4DV7 K;  3SPY A;  1LWE A;  2O4I A;  4HCC A;  4JKF A;  1KVB A;  4MO5 A;  4I9Q A;  2ZF5 O;  2P9U B;  3FGU A;  5GAG P;  1HYZ A;  3LWL A;  1RTH A;  4CER A;  1M90 O;  3SLC A;  3QFP A;  2B6A A;  1S6Q A;  4E7I A;  4O55 A;  4LSN A;  1CZ9 A;  1Y64 A;  5DM6 L;  2IC3 A;  5D3G A;  1N8R O;  3UB5 A;  4C23 A;  4KHN A;  1BU6 O;  4LH5 A;  4LFA K;  2P9L A;  3CC2 N;  3AVG A;  3CM6 A;  3CC4 N;  1QZ5 A;  1TL1 A;  4M3X A;  4HCB A;  4E1M A;  1VQP N;  4Z4H A;  3DMJ A;  1VRU A;  4BQZ A;  2IDO A;  5AQT A;  4M3U A;  3DLK A;  4C8M A;  4E0D A;  3FFK B;  3TAM A;  2FLO A;  4CHO A;  4BRE A;  1KAZ A;  4B9Q A;  3CFP A;  1JLG A;  3TTF A;  4OPH A;  4JI2 K;  3M1F A;  5J2M A;  1UA0 A;  1JCG A;  1V4S A;  3OYE A;  2RKI A;  4PUO A;  3IUC A;  2E88 A;  3HTV A;  4H0P A;  4HTL A;  5CR4 A;  1K8A O;  1OH8 A;  4JI7 K;  4EIA A;  3DLH A;  2QTD A;  2F7T A;  1NGB A;  2HVI A;  4G9Z A;  4NLB A;  3L2V A;  3MMV A;  1VSF A;  3IMX A;  1TV6 A;  3OYL A;  1VQ4 N;  1W7A A;  4DR3 K;  5EOY A;  1N32 K;  2OCE A;  4QAG A;  2HHS A;  2JWK A;  4CZL A;  3THW A;  2BGG A;  1XHZ A;  1YIT N;  2RF2 A;  4DR5 K;  4IOX A;  3N4Q A;  2NRX A;  3THW B;  3CYM A;  2W6K A;  3OJU A;  3S9H A;  1VQN N;  5KRS A;  4FYD A;  5J1E A;  2HF4 A;  4FLZ A;  2F4V K;  4H5W A;  3CJB A;  4O0J A;  5BRF A;  1NJZ A;  1NOZ A;  3CCR N;  5KQ8 A;  1D5A A;  3WQU A;  1DT9 A;  3L2R A;  2W6L A;  2ETJ A;  1G15 A;  3FZL A;  3NF6 A;  4FSV A;  5AQS A;  1RDW X;  1NGA A;  4BVP A;  4MDB A;  4KTW A;  4NB4 A;  4AHT A;  3AAQ A;  3CCU N;  3F2K A;  2ITM A;  5J2Q A;  3VET A;  1KAX A;  4GKK K;  3TAB A;  3KLE A;  2Z1I A;  1VHX A;  4WFB L;  4CW7 B;  1HLU A;  2QWQ A;  3MN9 A;  4W5Q A;  1HR0 K;  3F9M A;  3FZH A;  3SAF A;  3OS1 A;  1ATN A;  1R0A A;  1OH5 A;  1D9F A;  3AGR A;  4KB0 A;  3GE1 A;  1K8K B;  3ID6 A;  4KPY A;  1IBM K;  3QEI A;  1J5O A;  4GKJ K;  4B1X B;  1W97 L;  1NGJ A;  4U67 L;  2P5G A;  3NH2 A;  4LY7 A;  1W0H A;  3RVC A;  3OBY A;  3OYD A;  1LCU A;  1XHX A;  1QVG M;  2FBX A;  1S1V A;  4CEB A;  3EZW A;  1BA1 A;  4YNQ A;  4PKG A;  1DLO A;  3W0L A;  3QNO A;  1BI4 A;  3QBW A;  4JV5 K;  4GMJ B;  4R5P A;  3TR8 A;  4B1V A;  3CCQ N;  4DQR A;  2QA4 N;  3S3M A;  1GLB G;  2PYJ A;  2ZJR L;  2NRR A;  1CXQ A;  3CJ1 A;  1Z25 A;  5BN8 A;  3TAQ A;  1HKB A;  2YHY A;  2HHT A;  4BR0 A;  4HWI A;  4BE0 A;  3O5B A;  4KTZ A;  4W5O A;  1CLQ A;  4DQS A;  2A6A A;  3O08 A;  2VG7 A;  1HYS A;  1NGD A;  2D0P A;  2E5L K;  3RR8 A;  2O8E A;  3K2P A;  3VQC A;  4BQL A;  1C0G A;  1IKV A;  4EAH D;  3SI6 A;  4DUZ K;  4H5N A;  3PX6 A;  1FK9 A;  5KPR A;  5AQK A;  3D2F B;  3C65 A;  2Q3S A;  3O3H A;  2Q1N A;  4CD3 A;  2DFE A;  4JK8 A;  1TKX A;  3MED A;  5AQF A;  3A5M C;  3AA2 A;  4IEE A;  1XMO K;  1U45 A;  1E4F T;  2DFH A;  3VQ7 A;  4E1N A;  2QKK A;  1CXU A;  2P51 A;  2A42 A;  4CJF A;  5FPE A;  1HPZ A;  5JVH L;  5AFU A;  1XI1 A;  3T19 A;  4QS9 A;  3VTI A;  3AAR A;  4IOA L;  2HBL A;  4GVE A;  4BC3 A;  4LF5 K;  3KVG A;  3D2F A;  3VTH A;  2VWJ A;  3G0Z A;  1TL3 A;  4M3W A;  4BRA A;  1NMN A;  4CHQ A;  3ID8 A;  1ATS A;  3KTQ A;  4B9S A;  4KI4 A;  2ASM A;  1Z26 A;  3OYB A;  4CHP A;  2RE2 A;  3HO1 A;  2I7N A;  1Q86 O;  3D6R A;  4KHW A;  3DLB A;  2YKM A;  3AV9 A;  3KKR A;  3UKR A;  1TUU A;  2VWB A;  4RCH A;  1NGI A;  1VK0 A;  4Z4E A;  3PUF A;  4O8K A;  3OYJ A;  5BPM A;  2O8F A;  1XQS C;  4E19 A;  1GLA G;  1TKD A;  3L2W A;  3C0B A;  4H03 B;  4KH4 A;  1KAY A;  4O5B A;  5AQV A;  4JS5 A;  3L8B A;  3FR0 A;  1NU0 A;  4DTO A;  2E2N A;  3GL1 A;  4DV0 K;  1NMD A;  3MXJ A;  1B9F A;  1ZBS A;  3VPZ A;  4Z4C A;  2IIR A;  4JYA K;  3DLR A;  1JCF A;  2YJE A;  3L4Q A;  4BWJ A;  3K0S A;  5EVZ A;  3CER A;  1P90 A;  2YNF A;  4M7Y A;  1RDA A;  4GV9 A;  4WQ4 A;  1SL0 A;  3SUP A;  1K8K A;  1HQU A;  4DSJ A;  1IH7 A;  5CYM A;  2V7Y A;  3EN9 A;  2A41 A;  3M3Z A;  4BRL A;  3ITH A;  3AA3 A;  2O8C B;  4DFJ A;  4OLA A;  1RT3 A;  2UXD K;  3LZJ A;  2HHX A;  4Q5V A;  3OA9 A;  1T7P A;  1WSG A;  4OKJ A;  4B8C A;  3V9S A;  2RHK A;  1DGK N;  1BO5 O;  4RW9 A;  5FRO A;  3C95 A;  2QI2 A;  3SQ2 A;  2CGK A;  4LFC K;  2G8K A;  4DSE A;  4FWR A;  3NF7 A;  4KBO A;  4AHS A;  4K41 A;  3M8Q A;  3SCX A;  2YNI A;  4GNI A;  3I0R A;  5JS2 A;  1BI4 B;  4DFK A;  1S5J A;  1IO2 A;  1CZA N;  1K6Y A;  4FCY A;  3PO4 A;  4BR5 A;  3THV A;  3V9W A;  4B9L A;  3K5O A;  5AQO A;  2CH6 A;  4N76 A;  3OVN A;  2GEM A;  3D2E A;  3TSP A;  3DRP A;  1ASW A;  3CQ8 A;  2XY5 A;  4NCA A;  2ZQB A;  4BC4 A;  4FVU A;  4B3S K;  4YOR A;  4LF6 K;  3UE5 A;  3NF8 A;  2ITG A;  4O0I A;  3THY A;  3KD1 E;  1RCH A;  3GDQ A;  4CJL A;  2O4G A;  4KKO A;  5AZJ B;  4YHH K;  2RN2 A;  3CF5 L;  4DTR A;  4KH5 A;  1QSL A;  1ZC6 A;  5BPL A;  2HNZ A;  3ZSO A;  1RNH A;  4IXC A;  3VES A;  2AA4 A;  3CMA N;  1SZ2 A;  1RT7 A;  1HKG A;  3AO1 A;  4JRP A;  3M8P A;  4DV2 K;  4BG8 A;  1T6D A;  4L8R B;  2GUP A;  5C24 A;  4DWI A;  2ZGZ A;  3KK1 A;  5FRM A;  4DQ8 A;  3H45 C;  3EZ5 A;  1U4B A;  4C1N K;  3QIC A;  1NK9 A;  3O4N A;  4JAX A;  5F0X A;  4FWO A;  3AO2 A;  4BC5 A;  2NRV A;  1YT3 A;  3HM8 A;  4FJH A;  1EQY A;  1GLD G;  4OX9 K;  3O1B A;  3WQT A;  4BRK A;  1WSF A;  2QWM A;  3E66 A;  5F2R A;  4WQ5 C;  3L2Q A;  4KB1 A;  3H3N O;  3MWP A;  3NFA A;  3U4L A;  2OPR A;  3SBG A;  4EHT A;  2F8S A;  1L3S A;  3CC7 N;  3WT0 A;  3HJF A;  5KPZ A;  1RTI A;  1WOQ A;  3O4W A;  1TAQ A;  3M6G A;  4FWS A;  1RDD A;  3SQ4 A;  1GLC G;  5KGX A;  3QEW A;  2HB5 A;  3ZEU A;  3SQ1 A;  3ZX2 A;  3R9P A;  2V51 B;  1EP4 A;  4CIG A;  4FZY A;  5BRE A;  2P9N A;  1VAZ A;  4KHU A;  3L3V A;  4X66 K;  3RMD A;  3Q7B A;  2G8H A;  2HBJ A;  4FWK A;  1KFD A;  2QXL A;  3WNF A;  4KV8 A;  3SMS A;  4CK3 A;  4F9O A;  3OYG A;  3O3F A;  4DV3 K;  4FXD A;  3DRR A;  3O1W A;  5I9E B;  1UA1 A;  3KZB A;  2A5X A;  5AQY A;  1JJ2 M;  4FJ8 A;  1TK8 A;  1BCM A;  1KXP A;  3AVN A;  3O8M A;  3NAE A;  2E2Q A;  4ISG A;  3TSQ A;  1ITG A;  1RDU A;  4BRN A;  1Q7Y O;  5M1F A;  3AGK A;  3KKS A;  3T1H K;  3G25 A;  5DMR A;  1TK0 A;  4DR7 K;  3KWG A;  3FFI A;  3P83 D;  2HMI A;  1KTQ A;  2PZS A;  1TKZ A;  3O9S A;  2YNG A;  3P4I A;  1X9M A;  2VGM A;  4IEI A;  3CCV N;  3HSC A;  4WYB A;  3DOK A;  4FLT A;  4DV1 K;  5AQZ A;  1XC3 A;  1FXX A;  4LFB K;  4I9L A;  4DF4 A;  4DR6 K;  5M1P A;  1NK5 A;  2D0C A;  3R1X A;  4OVL A;  1HNI A;  3H3O B;  2DY4 A;  1YJN N;  2BAN A;  3IG1 A;  5AQP A;  3H6E A;  1J54 A;  3V9U A;  3FZF A;  5C10 A;  1K73 O;  5SZT A;  4NCG A;  2NRH A;  1RFQ A;  4Y0W A;  1T8E A;  4OKE A;  4CHZ A;  5GAD P;  3HM9 A;  4DTN A;  1FJG K;  2HHQ A;  4CF0 A;  4LSL A;  3ZT3 A;  3W3D A;  1RTJ A;  5AQG A;  3IAY A;  4FWN A;  3OTO K;  1XMQ K;  2ZM6 K;  5LJV A;  3BZC A;  3K57 A;  5KRT A;  1JL2 A;  4CF1 A;  3OYF A;  4NYN A;  5EU7 A;  1IJJ A;  3SJH A;  3GOI A;  1LW2 A;  1JLA A;  3L0Q A;  1KC8 O;  3ZSY A;  4JKH A;  3WNE A;  1RGI A;  2PAV A;  3TPQ A;  3OYN A;  2IGI A;  2VGN A;  2OPP A;  4KO0 A;  3R8E A;  2WOM A;  3IDH A;  4CK1 A;  3LP3 A;  3G10 A;  1RT1 A;  1S9E A;  3L2U A;  4Y1D A;  4FWP A;  4B1Z A;  5I3U A;  3JSM A;  1ASV A;  2LSN A;  1HNW K;  2P9K A;  4KHP K;  1NM1 A;  3O3G A;  3ISN C;  2Z1J A;  4K42 A;  3VEN A;  4LF4 K;  3PIO L;  1EKE A;  4ID1 A;  4CGH A;  5E84 A;  5BR9 A;  4FJX A;  4CEZ A;  4M7X A;  1MA9 B;  1BHL A;  3ENO A;  2A40 A;  4EP4 A;  3J7Z O;  2YHB A;  3FE1 A;  5H1S Q;  4IG0 A;  1VSE A;  4OKK A;  4FW2 A;  2IS3 A;  1HQE A;  4YOV A;  3SPZ A;  4BRQ A;  1JKH A;  2Q36 A;  1RT2 A;  3E9L A;  2NZT A;  4DTS A;  5T7B A;  3EKS A;  4BR9 A;  3KLG A;  3LAK A;  5I42 A;  4IOC L;  3KK3 A;  4BR7 A;  3SV3 A;  2V7Z A;  2EX3 A;  2I5J A;  3SUN A;  1RBT A;  4FLV A;  3LM9 A;  2X6N A;  1WBD A;  2G8V A;  2P9K B;  1ZBF A;  5DM7 L;  3AVA A;  1REV A;  3NGI A;  4W5R A;  4HUG A;  5FPM A;  4OPK A;  4DHY A;  4CEA A;  4FW1 A;  2QWN A;  2KW4 A;  1JL1 A;  4ISF A;  4JI3 K;  2JGU A;  1C0U A;  4HHT A;  1BG3 A;  1S1U A;  4A62 A;  3SUO A;  1XUP O;  3WEE A;  2UYT A;  3ZSX A;  5C15 A;  2P1J A;  5IWA K;  4B1U B;  2WBN A;  4M3Z A;  1ATR A;  1O13 A;  1SKR A;  3EE8 A;  4AQY K;  4PKH A;  3J7Y P;  4FLX A;  4N47 A;  4JEP A;  1QSS A;  1UWB A;  4E1J A;  3AO5 A;  4AHV A;  4DS4 A;  4U7B A;  4A2B A;  3LZI A;  5KI6 A;  2O8F B;  3DWL A;  4CJW A;  4BDY A;  1S1T A;  4IDK A;  2HF3 A;  3I8B A;  1XNQ K;  3AVK A;  5KGW A;  4CIF A;  4C8K A;  1NGG A;  4CJK A;  2XRI A;  3AAP A;  3QIO A;  5JLH A;  3VQ5 A;  5LMN K;  4JI8 K;  2FBY A;  4XH1 A;  3K5N A;  2HNY A;  5HBM A;  4JK9 A;  1J6Z A;  3HVR A;  1OVY A;  3PX0 A;  3O6W A;  1CZB A;  2YJF A;  4JKG A;  2UXC K;  5JVG L;  2QW9 A;  3TAE A;  3LDS A;  4A61 A;  3OJS A;  2YX6 A;  3CPW M;  3MAQ A;  5C0Y A;  2FBT A;  2D1K A;  4O8U A;  3CME N;  1W2B M;  1GOB A;  4IO9 L;  4RWT A;  4XIU A;  4DV4 K;  4ELV A;  1E4G T;  4Z4G A;  3CQX A;  1VQO N;  2QWL A;  5HP1 A;  1RBV A;  4KHY A;  3K9K A;  2W41 A;  1NBW A;  4FLU A;  2IOC A;  4BR2 A;  5LMU K;  2NRT A;  3RRG A;  1TKT A;  4H5T A;  4DLG A;  1YXQ A;  2W40 A;  4CEQ A;  1HRH A;  3ATU A;  4BAC A;  2NNW A;  2PBD A;  1RT6 A;  4DSF A;  3AVH A;  3OYM A;  5KPT A;  1D8Y A;  1LAV A;  4CD1 A;  3A0I X;  1WSJ A;  3LDN A;  2EWS A;  2DFF A;  2A1R A;  3EYZ A;  2Z1G A;  2P9I B;  3SZ2 A;  4H0T B;  4LF7 K;  5AFU H;  4X62 K;  4WF9 L;  1X3N A;  1IBL K;  4FZZ A;  3CM5 A;  2Q2R A;  3JAM O;  3VN5 A;  2DPN A;  1HKC A;  1S1X A;  3B6O A;  1I94 K;  4BY9 C;  5AQU A;  3CXC M;  1QZ6 A;  3S3O A;  1SL1 A;  4CZF A;  3CPE A;  4J2E A;  4IFE A;  1XNR K;  4F2R A;  2P9N B;  2KKZ A;  1N5Y A;  3SYZ A;  1TVR A;  3CFO A;  4FOE A;  2D0B A;  3DLE A;  3LAN A;  1EX4 A;  1NG9 A;  1TGO A;  3U8X A;  1LAW A;  3V4I A;  4KHQ A;  3SAG A;  3BGR A;  1C0T A;  1U47 A;  3C6A A;  1SS6 A;  3CIP A;  3VEO A;  4X65 K;  4B3R K;  3F73 A;  3BY5 A;  4ZTJ A;  2Q0U A;  4NLC A;  1KVC A;  4OGC A;  3AO4 A;  1X1P A;  4CF2 A;  4CGF A;  5E41 A;  4FLW A;  3EO3 A;  4DF8 A;  1SL2 A;  3RMB A;  3QEP A;  1N34 K;  1C0F A;  1VRT A;  3BDP A;  3E9O A;  5HRO A;  2X78 A;  2OYQ A;  3ZT2 A;  3RRH A;  3QB0 A;  1BQM A;  4C8O A;  2FXU A;  2W42 A;  1T05 A;  2WC9 A;  2KFZ A;  3G4S N;  1RTD A;  4EFH A;  4F2S A;  4ILJ A;  4BRO A;  3ZT1 A;  2O8D A;  3O9Q A;  1T03 A;  1MWM A;  3CCM N;  5ADX A;  1M1K O;  3M8R A;  3VMF B;  1YJ9 N;  1YF5 L;  3AA4 A;  2UUA K;  1S3X A;  3QEX A;  1NK0 A;  4FM1 A;  4FWM A;  1QTM A;  4ISE A;  4B9N A;  4PWD A;  4DTM A;  1NNE A;  3O9T A;  2YHA A;  4IWV A;  3CET A;  3C94 A;  3J80 O;  4DQQ A;  1FKO A;  2JWL A;  1TYQ B;  5JIC A;  2BDP A;  2P9U A;  3LDO A;  3U9D A;  1XC9 A;  2P9S A;  4KH6 A;  4DQP A;  4EZ6 A;  4YOX A;  4RTF D;  1HUX A;  2ZJQ L;  3D7E O;  3KD5 E;  3V1O A;  4M63 C;  1OH7 A;  3IFR A;  1KSP A;  4HTU A;  5FDL A;  5M1Q A;  4DU1 A;  3S41 A;  5LJW A;  3FZK A;  1B92 A;  2YNH A;  3NBP A;  2DTU A;  4L3Q A;  2X74 A;  3Q7C A;  4W5N A;  3LAM A;  5FPD A;  3MCA B;  3VQ9 A;  2G8I A;  3A5L C;  4O44 A;  3VQP A;  4FM2 A;  1LWF A;  3T7Z A;  3RSE A;  3P1G A;  3TAG A;  1NOY A;  1J9A A;  1NWK A;  1WSI A;  2YHX A;  1IG8 A;  1A5V A;  2ZE2 A;  4PKI A;  2ZD1 A;  2O8E B;  2Y1J A;  1OKJ A;  1IKX A;  3AVJ A;  1I3A A;  4H4O A;  4PA1 A;  1GLF O;  5HL7 L;  3QDK A;  4KI6 A;  4BC2 A;  1MWK A;  1SV5 A;  4FVM A;  2FSN A;  1YUW A;  1UAX A;  4PL8 A;  4IBN A;  3ATV A;  2KHO A;  4BVO A;  1BA0 A;  4FWL A;  3HVT A;  4DS5 A;  4DU4 A;  3WUH A;  5JS1 A;  3NDK A;  3VQ8 A;  5F1X A;  5AQQ A;  3D2E B;  3AO3 A;  4LF9 K;  3IRX A;  3AVM A;  2UXB K;  1VQM N;  3T1Y K;  1Z6R A;  5HRP A;  4FPA A;  3JXU A;  3C6U A;  1U6Z A;  1X9S A;  5EX5 A;  3VGM A;  1WSE A;  5J2N A;  3HI0 A;  3P38 A;  5ELZ A;  4CZJ A;  2D0A A;  4PQU A;  1SKW A;  3DOL A;  3AY9 A;  3K58 A;  2OZM A;  3MN7 A;  1QQN A;  4ICL A;  3EE9 A;  1QVF M;  1ZBH A;  4A59 A;  3VEZ A;  4DUY K;  4K25 A;  3HPO A;  5CZ1 A;  5FLX O;  3SMP A;  5GAE P;  1E3M A;  4ELU A;  4QS7 A;  3AVI A;  2A3Z A;  4AHC A;  4RW8 A;  1YJW N;  4JRQ A;  3JYT A;  5LY3 A;  3DXM A;  1T44 A;  2NUB A;  4YOW A;  4CIE A;  4FJJ A;  2E2O A;  3R6M A;  1VSK A;  5M1O A;  4CES A;  1VQ7 N;  2GWJ A;  2OPQ A;  1QQO A;  3BF1 A;  1F21 A;  2WTU A;  3RTV A;  3DXK B;  4CED A;  3NGY A;  4BRI A;  2KZZ A;  4PHT X;  5CHI A;  5AQW A;  1LV5 A;  3QFU A;  3NH1 A;  2NRZ A;  1YVU A;  3QO9 A;  1RDC A;  4IO8 A;  5EXW A;  4B9T A;  2OTL N;  3MEE A;  2CGJ A;  1JLB A;  2J4R A;  3BF3 A;  4AIL C;  1VSI A;  3TU5 A;  4FJ7 A;  4FJL A;  1GOC A;  3E9P A;  1ZBI A;  4M41 A;  1VSD A;  1C1C A;  3VEX A;  3SV4 A;  1NJI O;  5C12 A;  3I8D A;  1KQS M;  3TSU A;  3NE6 A;  2HHW A;  1HX1 A;  4CGG A;  3DYA A;  3K5M A;  3QML A;  3A8Y A;  5C2F A;  1NJX A;  4N56 A;  4RW7 A;  1L5U A;  3LDL A;  4QOZ B;  3AVL A;  3LWM A;  1VQ5 N;  5AZI B;  3THX B;  3QNN A;  1S1W A;  3BUZ B;  4I6M A;  3KLI A;  4MLH A;  1YAG A;  4B1Y B;  3VEV A;  3C6T A;  3B6P A;  2E1Y A;  2HBM A;  5E26 A;  3PLA A;  3KJV A;  3FLC O;  5AQI A;  1S22 A;  3VQ4 A;  3WNH A;  4JKC A;  3QEV A;  5BRD A;  3WXJ A;  3LP1 A;  4XEI A;  4V19 S;  3HST B;  3MDQ A;  2YKN A;  1RT4 A;  4B3O A;  2IVN A;  3OY9 A;  2B4J A;  4CFC A;  1U2V B;  4WE1 A;  3U9Z A;  3HP6 A;  4FJ9 A;  1WLJ A;  1U2V A;  3HPH A;  4E7J A;  3DM2 A;  1RT5 A;  3LPT A;  1C6V A;  4DTP A;  2P5O A;  4B8A B;  3PY8 A;  3VGL A;  4E7L A;  2VCP A;  3HYF A;  4DSK A;  5EY4 A;  3KK7 A;  2XHB A;  4M3T A;  1VQ6 N;  4UQG A;  1HMV A;  5K14 A;  3VER A;  4I2Q A;  4FK4 A;  4IDH A;  1HYV A;  1TUY A;  3CJC A;  3HOS A;  4Q0B A;  1SAZ A;  3VF4 A;  4DTJ A;  3I33 A;  4CJT A;  4KHS A;  2BUP A;  3DLG A;  2IVO A;  4B9M A;  3QLH A;  3DRS A;  4E7H A;  3TAR A;  3QIN A;  4CGJ A;  4BWM A;  3VF6 A;  3ZX3 A;  3L3U A;  3IS9 A;  2KFN A;  4NO7 A;  5GAH P;  5CYQ A;  2O8C A;  3P5J A;  1BGX T;  5J2P A;  2GWK A;  4GV6 A;  4DV5 K;  3E1Y A;  4M42 A;  4CZK A;  5B8H A;  1SKS A;  3WXL A;  3ZET B;  3NMU A;  3ULE B;  1U48 A;  3OYH A;  1KLN A;  3HOT A;  4NYF A;  4PL7 A;  5HOO A;  4FLY A;  1V4T A;  4HUF A;  4CJ7 A;  3UKU B;  4DFP A;  5C25 A;  2HW3 A;  2WFB A;  4XH4 A;  3RSE B;  4JHD A;  3H46 O;  3T1A A;  1WB9 A;  2I7P A;  5HRS A;  4CZI A;  1ZYQ A;  1WAJ A;  1QS4 A;  3S3N A;  1Q9X A;  3RR7 A;  1HNX K;  1QHT A;  3HXM A;  4W5T A;  3RMC A;  1LOT B;  3BZK A;  4YY3 K;  3OS2 A;  4H5V A;  2OA8 A;  2UUB K;  3CCE N;  4BRC A;  2QKB A;  3H1Q A;  3NH0 A;  1LWC A;  3UKR B;  2FF3 B;  5TKY A;  3HPG A;  2HHH K;  4CZE A;  1RIL A;  2HMP A;  2P9S B;  2HVH A;  5IT9 O;  4O5F A;  4A2A A;  1YI2 N;  3VQE A;  1EXQ A;  1TK5 A;  4H0O A;  1GLL O;  3DJC A;  3VOV A;  4YOY A;  5JMV A;  4AF1 A;  4YDU C;  4CJE A;  4DR4 K;  4JKA A;  4CZH A;  4M3Y A;  4JN4 A;  4AM6 A;  4ILG B;  3NGZ A;  3MXI A;  1NKE A;  4K8X A;  3QIP A;  3NF9 A;  3PSI A;  2Q97 A;  2KQ2 A;  2XY6 A;  1BIZ A;  2IAJ A;  1NGH A;  2YV0 X;  4IFY A;  3KLH A;  2CGL A;  3LL3 A;  3L4I A;  4CK2 A;  2AP1 A;  3V1R A;  4UY8 O;  1KRP A;  4JI0 K;  2G8W A;  2BE2 A;  4MO4 A;  3TWH A;  2ZGY A;  1D9D A;  3NVM A;  4CHN A;  2HOE A;  3OYC A;  1TYQ A;  2E6M A;  3SAH A;  4CE9 A;  3JS6 A;  1H1V A;  3SK3 A;  2WUS A;  3DXK A;  1NKB A;  1NK7 A;  2D5R A;  3CD6 N;  3HZ6 A;  4AHU A;  3E01 A;  2PY5 A;  3O9U A;  4MFB A;  4JS4 A;  2KLA A;  5C42 A;  4JK7 A;  4IFV A;  1BUP A;  1I39 A;  3THX A;  2OZS A;  4BRG A;  4CI6 A;  3LAL A;  4JKE A;  1ZXO A;  2ATQ A;  4GVM A;  3SUQ A;  3ZET A;  1NLV A;  1DTT A;  3KHY A;  2YI1 A;  3OYA A;  2GTD A;  1NJY A;  4Z4F A;  1KLM A;  2GEL A;  2V52 B;  1O1W A;  3ZSW A;  3RWU A;  1Z05 A;  3ALY A;  1OVQ A;  4TSX A;  4CEO A;  2F8T A;  1NGC A;  3SQ0 A;  5HRN A;  1YIJ N;  2E2P A;  1QQM A;  3WXK A;  4JKG B;  1X9J A;  3R3L A;  1P8Z A;  3MXM A;  3ZEU B;  3VQB A;  4GV3 A;  4Z4I A;  1HJR A;  1JLF A;  1X9W A;  4GW6 A;  4A5A A;  3M8S A;  3NVK A;  3PV8 A;  4M3R A;  1VSJ A;  1GLJ O;  5GIN A;  3OW2 M;  3V9Z A;  3ZSR A;  4FM0 A;  4F3T A;  4YOT A;  3CCL N;  2E8A A;  3QET A;  1JLE A;  4E7K A;  2YCH A;  4KFB A;  4FZX C;  2KTQ A;  2P9P A;  4WFN L;  3EY1 A;  4OGE A;  4PY5 A;  3ZX0 A;  3TI0 A;  1Q18 A;  1N6Q A;  2O8D B;  4JI6 K;  4FJ5 A;  2FSK A;  4B08 A;  2ASO A;  3MEG A;  3T69 A;  4BE1 A;  3IKM A;  1TAU A;  5CY4 A;  3QES A;  5FPN A;  5MLC Q;  2UUC K;  1XWL A;  4JI4 K;  2UU9 K;  2QK9 A;  3BP8 A;  1S72 N;  3U3G A;  1NGE A;  2RPI A;  5AQR A;  4CFA A;  1QE1 A;  1HJO A;  1S9G A;  5GIO A;  3VA0 A;  4C1N I;  3U3Y A;  4FPB A;  4CGI A;  1Y97 A;  3O4Q A;  2E4L A;  1LW0 A;  2VQF K;  2OPS A;  2FF6 A;  1KFS A;  4DSL A;  4DLE A;  1DTQ A;  4DSI A;  4I2P A;  3VQQ A;  5AZJ A;  5AQM A;  4BRM A;  4BDP A;  4ILH A;  4DR2 K;  4J2A A;  5CE3 A;  4WQ4 C;  2VG5 A;  4JKD A;  3V81 A;  1WSH A;  4YFU A;  4F8R A;  2OAN A;  4CJ4 A;  3P31 A;  4H8K A;  2XY8 A;  1J53 A;  1W9H A;  2FC0 A;  3LM2 A;  3O9R A;  1WAF A;  1K9M O;  1QSY A;  2JLE A;  4CJ3 A;  4CCH A;  3ULE A;  4CFB A;  2QWO A;  2O8B B;  4HUE A;  1ZBU A;  2VYP A;  4G1Q A;  4K43 A;  1IG9 A;  3WNG A;  4B1W B;  2F96 A;  4E89 A;  3D45 A;  5BPN A;  4OPJ A;  1D4X A;  2AJQ A;  3HRG A;  3PX4 A;  3F5T A;  2FBV A;  1WNS A;  3ASM A;  5BN9 A;  3AVC A;  3F9K A;  3J7A P;  2Z1H A;  3B8A X;  3BEX A;  4JI5 K;  3DXM B;  4JI1 K;  3VGK A;  1ESV A;  2YHW A;  3AVB A;  4ZTF A;  3GG4 A;  1ZBL A;  1MDU B;  4XH5 A;  1S6P A;  3A2F A;  3OYI A;  3WXI A;  5AQX A;  4LF8 K;  1EWR A;  3NCI A;  1N36 K;  1YTA A;  1WBB A;  2R7Y A;  3HL8 A;  4H0X B;  1ILY A;  5AQH A;  4DG1 A;  1QQC A;  1BIU A;  1YVN A;  2XO7 A;  4CEF A;  4BG9 A;  4DR1 K;  3P39 A;  3EKU A;  2HND A;  4DFM A;  1JCE A;  1NK4 A;  4I6M B;  3WEE B;  4B9U A;  4HVJ A;  4CEC A;  1GLE G;  1T6C A;  5A2Q O;  2HBK A;  2VQE K;  3CG7 A;  3DI6 A;  3A5N C;  5AZI A;  4CFD A;  4CF9 A;  4FWQ A;  1IBK K;  4K8Z A;  4H5R A;  3LDP A;  3EEQ A;  3MN6 A;  4CJR A;  2F9T A;  3I56 N;  1NGF A;  1G99 A;  2P9P B;  4CJQ A;  3ZSV A;  4JLH A;  3L6Q A;  4RW4 A;  3QER A;  5DK5 A;  3ZSQ A;  4LH4 A;  4R79 A;  3VQ6 A;  3RMA A;  1SUQ A;  2BTF A;  1KD1 O;  3TTD A;  5JLF A;  1QHA A;  3MWT A;  1IV0 A;  3H08 A;  1BQN A;  1BCO A;  1VQ8 N;  1NK6 A;  2G8F A;  3C6H A;  5GIP A;  4JNE A;  3O80 A;  3LDQ A;  1U04 A;  3CCJ N;  2B5J A;  1EET A;  4Z0U A;  1WN7 A;  4EZ9 A;  4CBU A;  4EHU A;  4CBX A;  3V6D A;  3KK2 A;  3AA5 X;  3H1V X;  1VQ9 N;  1JLQ A;  4OLB A;  1VQL N;  1YHQ N;  1Q81 O;  4YOU A;  4KAZ A;  5HLF A;  4BR4 A;  3LPU A;  4IZ9 A;  1EWQ A;  4E3S A;  3VEW A;  3MEC A;  1HPM A;  4OJR A;  4JHD B;  3HT3 A;  4DV6 K;  2WON A;  5M1N A;  4CVN E;  1OH6 A;  4JD2 A;  3TAF A;  3KIO A;  3K9J A;  3CJ9 A;  4AM7 A;  5SWM A;  2NRW A;  3UKU A;  2ZWH A;  4H4M A;  2VG6 A;  4NCB A;  4JD2 B;  1FW6 A;  4DKW A;  1GOA A;  2ASP A;  1VQK N;  3CFR A;  1KVA A;  4K0K K;  3J81 O;  3TAN A;  3PO5 A;  4MQ3 A;  2PFU A;  4DTU A;  2XY7 A;  3WXM B;  1BIS A;  3LP2 A;  5TKW A;  1RBS A;  1VSL A;  1J5E K;  2Y1I A;  2D4W A;  3KWI A;  4FJM A;  3V9X A;  3V1Q A;  5BRH A;  3SNN A;  2E6L A;  3OHR A;  1N33 K;  3CJ7 A;  5HRR A;  3K59 A;  4IKF A;  4DU3 A;  4KTQ A;  4AHR A;  3C7N A;  2QWP A;  4F4K A;  1Q82 O;  4CJV A;  5LL6 Z;  2QM1 A;  1B9D A;  3ZT4 A;  4F3O A;  5KQD A;  4DQI A;  3T3F A;  4CJ5 A;  3HBT A;  4QCL A;  1MU2 A;  1UOC A;  1YTU A;  5KTQ A;  2FSJ A;  4MDA A;  3D0P A;  4ELT A;  1T3V A;  3MX2 A;  1KCF A;  3HK2 A;  1NKC A;  3ULD A;  5FRN A;  1RBR A;  4OPA A;  3ZCM A;  4CEE A;  4Z94 A;  1SQK A;  1X3M A;  1BOT O;  2P9I A;  1L3V A;  4M45 A;  4J8F A;  4FK2 A;  5AJ3 K;  3OS0 A;  1VSM A;  1R59 O;  4DB3 A;  4O4G A;  3ZYY X;  4A57 A;  1C1A A;  2A1S A;  4QS8 A;  3ZT0 A;  3N4P A;  4WCE L;  4YDU A;  3CCS N;  4CHY A;  1EO1 A;  4BGA A;  3UIQ A;  2G8U A;  1DEJ A;  4FOI A;  2F9W A;  4ID5 A;  4DTX A;  4LC9 B;  3THY B;  3VQA A;  3QBX A; 
#chains in the Genus database with same CATH homology
 1HRH A;  3RR7 A;  3ITH A;  3AA3 A;  4DFJ A;  1QHT A;  4BAC A;  3HXM A;  4W5T A;  3SJJ A;  2PYL A;  3RMC A;  4OLA A;  1RT3 A;  3OS2 A;  3LZJ A;  1RT6 A;  2HHX A;  2OA8 A;  4IG3 A;  4DSF A;  4Q5V A;  3I0S A;  2QKB A;  3AVH A;  3NH0 A;  3OYM A;  1T7P A;  4CGD A;  1LWC A;  2GUI A;  4J2D A;  1D8Y A;  1LAV A;  1WSG A;  4OKJ A;  4B8C A;  3HPG A;  3V9S A;  4FJI A;  1WSJ A;  2GV9 A;  2EHG A;  4RW9 A;  2DFF A;  3C95 A;  4LD0 A;  5FRO A;  2Z1G A;  3EYZ A;  3SZ2 A;  2A1R A;  1RIL A;  1IKY A;  2HHU A;  2HVH A;  3VQE A;  1EXQ A;  1FKP A;  1TK5 A;  1A5W A;  3SQ2 A;  2VWK A;  2GBZ A;  4CJU A;  2HHV A;  2G8K A;  2X6S A;  4CJE A;  4DSE A;  4FZZ A;  3CM5 A;  3NF7 A;  4AHS A;  4M3Y A;  3M8Q A;  3SCX A;  2YNI A;  3VN5 A;  3I0R A;  5JS2 A;  1BI4 B;  3NGZ A;  1C0M A;  4BDZ A;  3MXI A;  3QIP A;  1S5J A;  3NF9 A;  1IO2 A;  4DFK A;  4K8X A;  1K6Y A;  1S1X A;  3B6O A;  4FCY A;  1A5X A;  3PO4 A;  2KQ2 A;  2XY6 A;  3THV A;  1BIZ A;  2IAJ A;  3V9W A;  2YV0 X;  3HP9 A;  3K5O A;  4IFY A;  1ASU A;  3KLH A;  3S3O A;  1U49 A;  1SL1 A;  4B9L A;  4N76 A;  4CK2 A;  4J2E A;  4F2R A;  3V1R A;  3OVN A;  1N5Y A;  2XY5 A;  3DRP A;  1ASW A;  3CQ8 A;  3SYZ A;  1Q9Y A;  1KRP A;  4NCA A;  2ZQB A;  1TVR A;  3CFO A;  3LP0 A;  2G8W A;  2BE2 A;  4J2B A;  3TWH A;  2D0B A;  3DLE A;  3LAN A;  1EX4 A;  1D9D A;  4CHN A;  4I7F A;  1TGO A;  4DMN A;  3OYC A;  3OYK A;  4FJG A;  2E6M A;  4KRF A;  4KRE A;  1RBU A;  3NF8 A;  2ITG A;  4CE9 A;  4O0I A;  1LAW A;  3V4I A;  3KD1 E;  4KHQ A;  1RCH A;  4CJL A;  3BGR A;  1C0T A;  1VSH A;  2O4G A;  4KKO A;  1U47 A;  4FJN A;  1NKB A;  2RN2 A;  4DTR A;  1NK7 A;  1BL3 A;  1QSL A;  4FK0 A;  2D5R A;  1L3T A;  2HNZ A;  3ZSO A;  4EP5 A;  1RNH A;  1L3U A;  4AHU A;  3E01 A;  4CJP A;  3F73 A;  1NK8 A;  4ZTJ A;  1JXE A;  2PY5 A;  4FJK A;  4OGC A;  1KVC A;  4MFB A;  3AO4 A;  4C8N A;  4JS4 A;  4B9V A;  1X1P A;  4CF2 A;  4CGF A;  5E41 A;  4FLW A;  5CZ2 A;  4DF8 A;  5C42 A;  1SL2 A;  1JXB A;  1RT7 A;  4IFV A;  3KLF A;  3AO1 A;  3RMB A;  3QEP A;  1NJW A;  3K5L A;  1I39 A;  4N5S A;  1VRT A;  4JRP A;  3BDP A;  2OZS A;  3AVF A;  3M8P A;  5HRO A;  3NHG A;  4L8R B;  3LAL A;  3U6F A;  2X78 A;  2OYQ A;  1Q8I A;  3ZT2 A;  3RRH A;  5C24 A;  4DWI A;  4RW6 A;  3KK1 A;  2ATQ A;  1BQM A;  3VA3 A;  5FRM A;  3EZ5 A;  4GVM A;  4C8O A;  1U4B A;  1T05 A;  2W42 A;  3SUQ A;  3ZSZ A;  4ZHR A;  2KFZ A;  4RG8 A;  1RTD A;  1DTT A;  4AH9 A;  1NK9 A;  4F2S A;  3O4N A;  3OYA A;  4CF8 A;  4N41 A;  3AO2 A;  3ZT1 A;  1NJY A;  4Y1C A;  4CJS A;  4Z4F A;  2QXF A;  1KLM A;  1YT3 A;  3TAP A;  4FJH A;  1T03 A;  4C8L A;  1O1W A;  3ZSW A;  3RWU A;  1HNV A;  3M8R A;  3ALY A;  4BE2 A;  1WSF A;  3VQD A;  3AA4 A;  4TSX A;  3L2Q A;  4KB1 A;  1IKW A;  4CEO A;  2KZM A;  2F8T A;  1JLC A;  3QEX A;  3NFA A;  1RDB A;  1NK0 A;  1C1B A;  4FM1 A;  3SQ0 A;  1QTM A;  5HRN A;  4B9N A;  3SPY A;  1LWE A;  2OPR A;  4HCC A;  4PWD A;  4DTM A;  2O4I A;  1KVB A;  4I9Q A;  2F8S A;  3MXM A;  1L3S A;  2YHA A;  3VQB A;  4Z4I A;  3HJF A;  3C94 A;  1HJR A;  1JLF A;  1RTI A;  4DQQ A;  1TAQ A;  1X9W A;  1HYZ A;  1FKO A;  4GW6 A;  3M8S A;  3LWL A;  3PV8 A;  1RTH A;  1RDD A;  4M3R A;  1VSJ A;  4CER A;  3SQ4 A;  5KGX A;  3QEW A;  2BDP A;  2HB5 A;  3SQ1 A;  2B6A A;  1EP4 A;  1S6Q A;  3ZSR A;  4CIG A;  4FM0 A;  3V9Z A;  4E7I A;  1XC9 A;  4DQP A;  4F3T A;  4O55 A;  4FZY A;  4LSN A;  4EZ6 A;  1CZ9 A;  3QET A;  4KHU A;  3L3V A;  1JLE A;  4E7K A;  4KFB A;  2IC3 A;  3RMD A;  3KD5 E;  4FZX C;  2KTQ A;  3V1O A;  5D3G A;  2G8H A;  4KHN A;  4LH5 A;  1KFD A;  3EY1 A;  4OGE A;  4PY5 A;  1KSP A;  3TI0 A;  3WNF A;  5FDL A;  4KV8 A;  4HTU A;  3AVG A;  3CM6 A;  4CK3 A;  1TL1 A;  4DU1 A;  3OYG A;  1N6Q A;  3O3F A;  1B92 A;  2YNH A;  3NBP A;  2DTU A;  4FJ5 A;  3DRR A;  4M3X A;  4HCB A;  4E1M A;  4B08 A;  4BE1 A;  3MEG A;  2X74 A;  1UA1 A;  4W5N A;  3LAM A;  4Z4H A;  3DMJ A;  5CY4 A;  1TAU A;  3QES A;  1VRU A;  2IDO A;  3VQ9 A;  4FJ8 A;  4M3U A;  1XWL A;  3DLK A;  2QK9 A;  2G8I A;  1TK8 A;  4O44 A;  1BCM A;  3VQP A;  4FM2 A;  3AVN A;  2RPI A;  4C8M A;  3U3G A;  1LWF A;  1QE1 A;  4CFA A;  4E0D A;  3TAM A;  3NAE A;  4CHO A;  3P1G A;  3TAG A;  1ITG A;  1S9G A;  3VA0 A;  1NOY A;  1J9A A;  3U3Y A;  1WSI A;  3CFP A;  1JLG A;  3KKS A;  1A5V A;  2ZE2 A;  5DMR A;  1TK0 A;  2ZD1 A;  2Y1J A;  4CGI A;  5J2M A;  3FFI A;  3P83 D;  1UA0 A;  1IKX A;  2HMI A;  3AVJ A;  1I3A A;  1Y97 A;  3O4Q A;  4H4O A;  4PA1 A;  1KTQ A;  3OYE A;  2PZS A;  1TKZ A;  2E4L A;  1LW0 A;  2OPS A;  2YNG A;  1X9M A;  1KFS A;  4KI6 A;  4DSL A;  2RKI A;  4PUO A;  1SV5 A;  4FVM A;  1DTQ A;  4DLE A;  4DSI A;  1UAX A;  3DOK A;  4I2P A;  4FLT A;  3VQQ A;  4IBN A;  4BDP A;  1FXX A;  4J2A A;  4I9L A;  3DLH A;  3HVT A;  2VG5 A;  4DF4 A;  3V81 A;  4DS5 A;  2HVI A;  4DU4 A;  2D0C A;  1NK5 A;  1WSH A;  5JS1 A;  4YFU A;  3L2V A;  4OVL A;  3VQ8 A;  3NDK A;  1HNI A;  1VSF A;  4F8R A;  1TV6 A;  4CJ4 A;  4H8K A;  2DY4 A;  2XY8 A;  3OYL A;  1J53 A;  3AO3 A;  1W9H A;  2FC0 A;  3IRX A;  2BAN A;  3AVM A;  1WAF A;  4QAG A;  2HHS A;  3IG1 A;  3V9U A;  1J54 A;  2BGG A;  1XHZ A;  5SZT A;  4NCG A;  1QSY A;  5HRP A;  2JLE A;  3CYM A;  4CJ3 A;  3OJU A;  3S9H A;  3C6U A;  4CCH A;  5KRS A;  4FYD A;  5J1E A;  1T8E A;  1X9S A;  4FLZ A;  4CFB A;  4OKE A;  4O0J A;  4CHZ A;  4HUE A;  1NJZ A;  1NOZ A;  3HM9 A;  1ZBU A;  4DTN A;  2HHQ A;  1D5A A;  1WSE A;  4CF0 A;  4LSL A;  3ZT3 A;  5J2N A;  1RTJ A;  4G1Q A;  3L2R A;  1IG9 A;  3WNG A;  2D0A A;  4PQU A;  1SKW A;  2ETJ A;  1G15 A;  3DOL A;  3IAY A;  3NF6 A;  3K58 A;  2F96 A;  4E89 A;  3D45 A;  2OZM A;  4OPJ A;  4ICL A;  2AJQ A;  3PX4 A;  3K57 A;  5KRT A;  1JL2 A;  4CF1 A;  2FBV A;  1WNS A;  3ASM A;  4KTW A;  3AVC A;  4NYN A;  5EU7 A;  4AHT A;  3F9K A;  3OYF A;  1ZBH A;  1LW2 A;  5J2Q A;  1JLA A;  2Z1H A;  3HPO A;  3TAB A;  3ZSY A;  3KLE A;  5CZ1 A;  3WNE A;  4ELU A;  2Z1I A;  3AVI A;  3AVB A;  4ZTF A;  1ZBL A;  4AHC A;  3OYN A;  4RW8 A;  4JRQ A;  4W5Q A;  2IGI A;  4KO0 A;  2OPP A;  3JYT A;  1S6P A;  3A2F A;  2NUB A;  3OYI A;  2WOM A;  4CK1 A;  3OS1 A;  4CIE A;  3LP3 A;  4FJJ A;  3G10 A;  1VSK A;  4CES A;  1R0A A;  1D9F A;  2OPQ A;  1RT1 A;  1S9E A;  3L2U A;  3NCI A;  1YTA A;  1F21 A;  4Y1D A;  3RTV A;  2R7Y A;  4KB0 A;  3HL8 A;  4CED A;  5I3U A;  3NGY A;  3JSM A;  1ASV A;  2LSN A;  4DG1 A;  2KZZ A;  1QQC A;  1BIU A;  2XO7 A;  1LV5 A;  4KPY A;  3NH1 A;  4CEF A;  3QEI A;  3O3G A;  1YVU A;  2HND A;  3QO9 A;  1RDC A;  1J5O A;  4DFM A;  4B9T A;  3ISN C;  1NK4 A;  2Z1J A;  4B9U A;  4HVJ A;  3MEE A;  1JLB A;  4CEC A;  2P5G A;  3NH2 A;  3CG7 A;  1EKE A;  3DI6 A;  4ID1 A;  4LY7 A;  1W0H A;  4CGH A;  4CF9 A;  4CFD A;  4AIL C;  4FJX A;  4CEZ A;  4K8Z A;  1VSI A;  4CJR A;  4FJ7 A;  3OYD A;  4FJL A;  1XHX A;  4CJQ A;  3ZSV A;  2FBX A;  1GOC A;  1BHL A;  1S1V A;  4CEB A;  4YNQ A;  1ZBI A;  4JLH A;  4M41 A;  1VSD A;  1C1C A;  1DLO A;  4RW4 A;  3QNO A;  1BI4 A;  3QER A;  1NKE A;  3SV4 A;  5DK5 A;  4EP4 A;  3ZSQ A;  4GMJ B;  4LH4 A;  4R5P A;  2YHB A;  3I8D A;  3TR8 A;  3VQ6 A;  4DQR A;  3NE6 A;  3RMA A;  3S3M A;  4IG0 A;  1SUQ A;  1VSE A;  2PYJ A;  2HHW A;  4OKK A;  4FW2 A;  4CGG A;  1CXQ A;  1Z25 A;  2IS3 A;  3DYA A;  3K5M A;  1HQE A;  1NJX A;  3TAQ A;  3SPZ A;  4N56 A;  3H08 A;  4RW7 A;  1JKH A;  1L5U A;  1BQN A;  2HHT A;  1BCO A;  1RT2 A;  4QOZ B;  4BE0 A;  3AVL A;  4DTS A;  5T7B A;  1NK6 A;  2G8F A;  1Q9X A;  3KLG A;  3LAK A;  3LWM A;  4KTZ A;  5I42 A;  4W5O A;  1CLQ A;  4DQS A;  1U04 A;  2B5J A;  3KK3 A;  3SV3 A;  2VG7 A;  1HYS A;  1EET A;  4Z0U A;  2EX3 A;  3QNN A;  1WN7 A;  3RR8 A;  2I5J A;  4EZ9 A;  3K2P A;  1S1W A;  3SUN A;  1RBT A;  3VQC A;  3V6D A;  3KLI A;  3KK2 A;  4FLV A;  3AA5 X;  2X6N A;  1JLQ A;  2G8V A;  1IKV A;  3C6T A;  4OLB A;  3B6P A;  3SI6 A;  4KAZ A;  3KJV A;  3PX6 A;  1ZBF A;  1FK9 A;  5HLF A;  3LPU A;  3AVA A;  3VQ4 A;  1REV A;  3NGI A;  3WNH A;  4W5R A;  4HUG A;  4OPK A;  4E3S A;  2Q3S A;  4CEA A;  3O3H A;  3QEV A;  4FW1 A;  3LP1 A;  3MEC A;  2DFE A;  3HST B;  2YKN A;  1RT4 A;  1TKX A;  2KW4 A;  1JL1 A;  4OJR A;  3HT3 A;  4B3O A;  2WON A;  3OY9 A;  3MED A;  2JGU A;  2B4J A;  1C0U A;  4CFC A;  4HHT A;  3AA2 A;  4WE1 A;  3KIO A;  3TAF A;  3HP6 A;  1U45 A;  1S1U A;  5SWM A;  4FJ9 A;  2DFH A;  1WLJ A;  3VQ7 A;  4H4M A;  2VG6 A;  4E1N A;  4NCB A;  2QKK A;  1CXU A;  2P51 A;  3HPH A;  3DM2 A;  1RT5 A;  4E7J A;  3SUO A;  3LPT A;  3ZSX A;  4CJF A;  1C6V A;  2P1J A;  4FXD A;  1HPZ A;  4DTP A;  2P5O A;  4M3Z A;  1GOA A;  3T19 A;  1XI1 A;  1SKR A;  4B8A B;  3PY8 A;  4E7L A;  3HYF A;  4DSK A;  4M3T A;  2XHB A;  4FLX A;  3CFR A;  1KVA A;  4N47 A;  3TAN A;  2VWJ A;  4UQG A;  1QSS A;  3PO5 A;  4MQ3 A;  1UWB A;  3G0Z A;  1TL3 A;  1HMV A;  5K14 A;  3AO5 A;  4AHV A;  4DTU A;  4DS4 A;  2XY7 A;  4M3W A;  1BIS A;  3LP2 A;  4I2Q A;  1RBS A;  4FK4 A;  1VSL A;  3LZI A;  4CHQ A;  3KTQ A;  1HYV A;  4B9S A;  5KI6 A;  2Y1I A;  4KI4 A;  1Z26 A;  3OYB A;  4CJW A;  4FJM A;  4Q0B A;  3V9X A;  4CHP A;  3V1Q A;  4DTJ A;  4BDY A;  3SNN A;  2E6L A;  3HO1 A;  5HRR A;  1S1T A;  4IDK A;  4CJT A;  3K59 A;  4KHS A;  3AVK A;  3DLG A;  4IKF A;  4KHW A;  3DLB A;  4B9M A;  5KGW A;  4CIF A;  2YKM A;  3QLH A;  3AV9 A;  3KKR A;  4DU3 A;  3DRS A;  4E7H A;  3TAR A;  4C8K A;  3QIN A;  4CGJ A;  4CJK A;  4AHR A;  4KTQ A;  2XRI A;  3QIO A;  4BWM A;  4F4K A;  4CJV A;  1VK0 A;  4Z4E A;  3PUF A;  3L3U A;  3IS9 A;  1B9D A;  3ZT4 A;  3OYJ A;  2KFN A;  4F3O A;  3VQ5 A;  4DQI A;  5CYQ A;  4E19 A;  3T3F A;  1TKD A;  3P5J A;  1BGX T;  2FBY A;  5J2P A;  3L2W A;  4CJ5 A;  4QCL A;  3K5N A;  1MU2 A;  1UOC A;  1YTU A;  2HNY A;  5HBM A;  5KTQ A;  3D0P A;  4M42 A;  4ELT A;  3HVR A;  1SKS A;  4O5B A;  1KCF A;  4JS5 A;  3PX0 A;  3HK2 A;  1CZB A;  3L8B A;  1U48 A;  1NKC A;  3ULD A;  3OYH A;  4DTO A;  1KLN A;  5FRN A;  1RBR A;  3MXJ A;  4NYF A;  1B9F A;  3ZCM A;  4CEE A;  4Z4C A;  3TAE A;  3LDS A;  4FLY A;  1L3V A;  3OJS A;  3DLR A;  4M45 A;  3MAQ A;  4HUF A;  2FBT A;  4BWJ A;  4FK2 A;  1GOB A;  3OS0 A;  1VSM A;  4XIU A;  4DFP A;  4ELV A;  5C25 A;  4Z4G A;  4O4G A;  5HP1 A;  2HW3 A;  1RBV A;  4KHY A;  2YNF A;  4FLU A;  1RDA A;  1C1A A;  2A1S A;  2IOC A;  3SUP A;  1SL0 A;  3ZT0 A;  1HQU A;  3T1A A;  4CHY A;  4DSJ A;  3UIQ A;  2G8U A;  3RRG A;  1IH7 A;  5CYM A;  5HRS A;  1TKT A;  4ID5 A;  4DLG A;  4DTX A;  1ZYQ A;  1WAJ A;  1QS4 A;  3S3N A;  4CEQ A;  3VQA A;  2RF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...