1A5WA

Asv integrase core domain with hiv-1 integrase inhibitor y3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5wA00
1HNVA 3LP3A 4CJTA 1U49A 4KHSA 3IRXA 3O3FA 5KGWA 1ITGA 1UOCA 3B6OA 4AHRA 2ETJA 1BGXT 4TSXA 4DQPA 5J2NA 1NKBA 1S1WA 4E19A 2F8SA 4KFBA 3K5OA 3LWMA 2G8WA 3D45A 1QS4A 1XHZA 3QIOA 2RPIA 3AV9A 2HHQA 3DLBA 1TV6A 3A2FA 3KLGA 1IKVA 4DFJA 4PWDA 4FLXA 3TI0A 5SZTA 3DLGA 1HJRA 2YNIA 4KI4A 1VSDA 3L3VA 5J1EA 1BHLA 3SJJA 3V9SA 2KZZA 1TGOA 3ZCMA 3AVIA 4Z4HA 4CJFA 5KTQA 5FROA 4BACA 3RR8A 4F2RA 4KI6A 1BQNA 1TAUA 3S3OA 1VSKA 2XRIA 4B9SA 4HUEA 1SV5A 1UA1A 4FJIA 2HNYA 3VQ7A 1EETA 1F21A 2FC0A 2RN2A 3LAMA 1TVRA 4Y1CA 1LAVA 4IG0A 4CEEA 2KQ2A 1DTQA 4DFPA 3DLRA 2OZMA 1UAXA 3NF6A 3F9KA 4DU4A 3HP6A 1RBSA 2KZMA 1ASWA 1Q9XA 4ZHRA 3BDPA 3V81A 1C1BA 1RTJA 1IKWA 5C25A 4GVMA 4HTUA 1L3SA 2G8IA 1JXBA 4DTOA 2Q3SA 5HRNA 3PX4A 1JLAA 5I42A 4FLWA 4KTZA 3AVGA 4CIEA 3CFRA 1LV5A 4C8KA 4M3TA 1CLQA 1BI4A 4AHUA 4O0IA 2OPQA 3CYMA 3LP0A 3NDKA 4FJ5A 4NCAA 5JS2A 4C8MA 3NHGA 4I2PA 3DLKA 2D0AA 3MAQA 1C1CA 4F3OA 1LWEA 4KHQA 3O3HA 4PUOA 1NK0A 1HYVA 3LPTA 3PV8A 3NBPA 4L8RB 1ZBIA 3NF8A 2GV9A 1TK5A 3P1GA 4RW4A 1RTDA 2HHVA 3OYDA 5JS1A 3SV4A 4EP5A 4FJLA 1NJXA 2VG5A 1LWCA 3KLIA 3M8SA 4RW8A 4W5NA 3SCXA 2YNHA 1S6QA 3TR8A 1RT1A 4Z0UA 1BCMA 1VRTA 2HNDA 4O55A 3KD5E 3OYGA 2D0CA 2DY4A 4IFVA 3KTQA 4PA1A 5C24A 4CGIA 5SWMA 1L3UA 2O4IA 2D0BA 4NCBA 2PZSA 3AO4A 4CFAA 1B9FA 4Y1DA 3RR7A 1W9HA 2LSNA 1CZBA 2P51A 4CJ4A 4KB0A 3LANA 3SQ1A 5HRSA 4DSEA 1R0AA 4OVLA 1XHXA 1DTTA 3ISNC 4AH9A 1KRPA 2VG7A 3E01A 3QEIA 1NK8A 2G8UA 3DMJA 1I39A 4YFUA 1WSFA 4ELVA 3I0SA 1KFSA 4J2BA 4KHWA 3VQPA 3SQ2A 2ZE2A 4HCBA 1CXUA 4CJ5A 3OYCA 4BDPA 1ZBUA 3AA3A 1ZBLA 1HPZA 1NK7A 4NYFA 4B3OA 2P1JA 3AVKA 1EXQA 3TAGA 2YHBA 1C1AA 4W5QA 3K2PA 1JLBA 2YV0X 4KRFA 4I7FA 1SKRA 3NH2A 4W5RA 4DSFA 1KVCA 4KV8A 3TANA 1WSJA 3ZSWA 3KJVA 4FJ9A 2P5GA 1NK4A 4E7JA 1QE1A 3DRRA 2DFHA 3ZSRA 1LW0A 4CGHA 1VSLA 4B8AB 1NOYA 4H4OA 3P5JA 3VQ6A 4OKKA 1BL3A 3U3GA 4CK3A 3QESA 4ELUA 1HQEA 4CF2A 4N56A 4CHYA 3L2UA 4LH5A 3OYKA 4H8KA 5HROA 4CK2A 2ITGA 4YNQA 2FBXA 3TAMA 3OYHA 1KLMA 4FLTA 1IKXA 2P5OA 3MEDA 4Z4EA 4LD0A 3L8BA 3QNNA 3JYTA 4DLGA 1C0MA 1HQUA 3HYFA 3KK1A 4HCCA 3KLFA 4Z4IA 4B9UA 1RBVA 1IO2A 2B4JA 3HXMA 3SYZA 3SUOA 3ZSQA 2GUIA 3U6FA 2BDPA 3CFPA 2VWJA 3ZT0A 3VQEA 4QCLA 3C6TA 2IDOA 4FXDA 3B6PA 1N5YA 1RBUA 4M3ZA 4Q0BA 4WE1A 3HVRA 3RMDA 1SKSA 2BGGA 4CHOA 4JRQA 1S9EA 3SQ0A 1XI1A 4K8XA 3DM2A 4BWJA 3HT3A 1NJWA 1NKEA 3SUNA 4KAZA 1WAFA 1NOZA 4MFBA 3OS0A 1U48A 1YTUA 2YKNA 1K6YA 4JS5A 1BISA 3L3UA 3IS9A 3PX6A 4LH4A 1TKZA 4CHQA 2PY5A 1J53A 1GOBA 3KKRA 1JLEA 4FK2A 2DTUA 1NJYA 4C8LA 1S6PA 4ID1A 3TAFA 3HPOA 4E1MA 1HMVA 3WNHA 4CJSA 1RCHA 3VQBA 4AILC 4KHYA 1Z26A 3FFIA 1JLQA 3QEVA 3K58A 2GBZA 4CFBA 1RT2A 5D3GA 3NF7A 2YHAA 3AVCA 4CJVA 3MXIA 4HVJA 4N41A 4CJQA 5HLFA 4CK1A 1SL0A 1QSYA 3VQ4A 1TAQA 4FW2A 3ZT2A 3EYZA 3QEXA 2KFNA 3TAEA 2I5JA 4FLVA 4DSJA 1T7PA 1B92A 3T19A 4BDZA 1U04A 2XY6A 4J2EA 4R5PA 2DFEA 4ID5A 3S3MA 5C42A 4CJPA 4CEAA 4B8CA 2X6SA 3AA4A 1RTIA 1SL2A 2FBTA 1RBRA 4OLBA 1X9SA 2B5JA 1QTMA 3L2WA 4DS5A 3VQ8A 1JLFA 1X9MA 3HK2A 4IKFA 4GW6A 1S1TA 1VSHA 4CF9A 1Q8IA 4HUGA 4I9LA 5KRSA 1LW2A 4CHNA 2QK9A 3ZSOA 2OPPA 2X6NA 1VK0A 1W0HA 3WNEA 1RDCA 1VSMA 3C95A 3HSTB 3AVAA 4O4GA 4CE9A 3OYBA 3AVMA 4CESA 3QERA 4FJ8A 1GOAA 3V1OA 2VWKA 3OS2A 3THVA 4HHTA 4RW7A 4DTNA 1RNHA 3P83D 3HM9A 2F8TA 1WSEA 3SUPA 1IG9A 1Q9YA 2ZD1A 3HP9A 1JKHA 1HRHA 3OVNA 4IFYA 4NCGA 1L5UA 4FJMA 2KFZA 2QXFA 1FKPA 4O0JA 1D9FA 1QHTA 2D5RA 3ITHA 3M8PA 3IAYA 3HO1A 1BIUA 2E6MA 4CEOA 4CF1A 3AA2A 3K57A 2IS3A 4CIGA 1T03A 1D8YA 3DI6A 4JLHA 1RT4A 3KLHA 3QNOA 3RRHA 1L3TA 3AVBA 4FZXC 3M8RA 1SL1A 1BCOA 3NAEA 4E89A 3LZIA 1YT3A 4MQ3A 1IH7A 4F8RA 3LZJA 5HRPA 5DK5A 5CYMA 4AHTA 4OPKA 4KKOA 3VQQA 2RKIA 4W5TA 1ZBHA 3VQAA 3OJUA 2W42A 3SPYA 4CECA 1D9DA 1C0TA 5J2PA 4CGGA 4FK4A 4CEFA 4CERA 3ULDA 3DYAA 1ZYQA 1IKYA 3G0ZA 3JSMA 3K5LA 1XC9A 4FM1A 4E7KA 4FJGA 3QIPA 4EP4A 4BE0A 1KLNA 3ZT1A 1JXEA 3K5NA 4KHNA 1A5XA 3NGIA 2OA8A 5CZ2A 3AVLA 1RT6A 1GOCA 2AJQA 1J9AA 3BGRA 2XY5A 4FJXA 3T1AA 4EZ9A 4CEBA 1B9DA 2JLEA 2XY8A 3PUFA 3KK3A 4M45A 3KLEA 2BANA 5FDLA 4ZTFA 1QSSA 3DLHA 4OGEA 4CEQA 3L2VA 1J54A 1NJZA 3NFAA 3V1RA 4KO0A 1Z25A 5J2QA 2ATQA 2HVIA 4DTMA 4I9QA 2FBYA 4CFCA 1HNIA 4Z4FA 3V4IA 3OY9A 1EP4A 2IOCA 3CM6A 1JL2A 2A1SA 3V9WA 1HYZA 4BE2A 3QINA 3HL8A 3RMBA 1UA0A 3G10A 4GMJB 3ZT3A 3NGYA 4QOZB 1TL3A 2B6AA 4OKEA 4M3UA 2PYJA 4F3TA 2HVHA 4KHUA 1S1XA 4CCHA 4FJNA 4CFDA 1UWBA 2A1RA 1TL1A 3DLEA 4UQGA 3V1QA 4FJKA 2EHGA 1RT3A 4IBNA 1JLCA 4FM2A 1O1WA 1RT7A 1SUQA 4IG3A 4HUFA 3RMCA 3RMAA 3QEWA 4DSKA 2HHUA 1FKOA 2JGUA 2G8VA 2HHWA 4AHSA 3LDSA 4DTPA 4M3YA 1U47A 4FK0A 3OYIA 2QKBA 4CJEA 3SNNA 2VG6A 5HP1A 5FRMA 1J5OA 2OPSA 4O44A 4DSIA 4K8ZA 4N47A 4J2DA 5HBMA 1ASVA 1YTAA 3VQDA 3K59A 4FW1A 4DS4A 2E4LA 3AVFA 4OGCA 1BIZA 4OJRA 3D0PA 3T3FA 4FCYA 1EKEA 3HPGA 1WAJA 3HVTA 1ASUA 2IGIA 2YKMA 3L2QA 4KTWA 3OS1A 3MECA 3MEGA 3RWUA 1BQMA 4DTSA 4FJHA 4W5OA 4OLAA 3DRPA 1YVUA 5DMRA 3ZSVA 4AHVA 1S1VA 5HRRA 4FLZA 3NE6A 1X9WA 5KI6A 1VSEA 1TK0A 4OKJA 1CZ9A 1RILA 3LP1A 3I0RA 4DQIA 1KTQA 4AHCA 2OPRA 3AVHA 4J2AA 3AO1A 4CHZA 3CFOA 3MEEA 1XWLA 1S9GA 1S5JA 3PO4A 4CJ3A 4B9TA 2OZSA 2PYLA 1Y97A 1T8EA 4FLUA 1WN7A 4CGFA 4E7IA 4M3RA 3WNGA 3IG1A 4CGJA 4DTUA 1NK9A 2BE2A 2Y1JA 1KSPA 4BWMA 2Z1HA 2RF2A 3WNFA 1RBTA 3CG7A 4DU1A 3EY1A 2O4GA 4DFMA 2R7YA 2HW3A 4E7LA 2XO7A 2Z1IA 4E7HA 1TKDA 1DLOA 4DSLA 4FYDA 4KB1A 2WONA 3SV3A 2KTQA 1S1UA 1HYSA 4M3WA 3LAKA 4RW6A 4CF8A 4DU3A 4O5BA 4DWIA 1NK6A 2IC3A 4M41A 4M42A 3TAPA 2G8KA 2EX3A 1D5AA 1RDBA 3H08A 4CEDA 4CF0A 3RRGA 4CGDA 1VRUA 3O4NA 4CJLA 3EZ5A 5J2MA 1RT5A 4N76A 1SKWA 2G8HA 4B9MA 4E3SA 4F4KA 4F2SA 1FXXA 3KK2A 4DTXA 1I3AA 3VQ9A 4PQUA 4DTRA 4OPJA 4DQQA 3VN5A 1WSHA 4KTQA 3LWLA 3OYJA 5KGXA 3RTVA 2KW4A 4DMNA 3ZT4A 3TWHA 3PY8A 3NF9A 4FJJA 1TKTA 3SZ2A 1U4BA 4CJRA 3CM5A 3NH0A 2Y1IA 1FK9A 2DFFA 1WNSA 3C6UA 3OYLA 3KD1E 4CEZA 3SQ4A 3DOKA 1BI4B 3DRSA 3AVJA 4ICLA 4CIFA 1C0UA 4B08A 4KREA 3ZSXA 3NH1A 2XY7A 3AVNA 2FBVA 3OYEA 3NCIA 1JL1A 5CYQA 4DF4A 2IAJA 3O4QA 4Z4GA 5I3UA 1TK8A 1EX4A 4DQRA 3MXJA 4ELTA 4RG8A 4FZZA 3V9XA 2HHXA 3O3GA 1VSJA 2Z1JA 1WSGA 3OYFA 1A5VA 4JRPA 1KVBA 3HJFA 4IDKA 4DG1A 5CZ1A 4B9LA 3LP2A 3ZSZA 2NUBA 4DTJA 4LSNA 1L3VA 4JS4A 4CJKA 4PY5A 1RDDA 1RTHA 3VA3A 1X1PA 3CQ8A 1T05A 1TKXA 3AO5A 3QLHA 4H4MA 3ZSYA 2HNZA 3S9HA 3SI6A 3I8DA 4E0DA 1QSLA 4M3XA 2X74A 3OYMA 1N6QA 2HHTA 3KIOA 3AO2A 3V6DA 3HPHA 3S3NA 1C6VA 1JLGA 1KCFA 1REVA 3LALA 3TARA 3L2RA 2HMIA 3TABA 1CXQA 4CHPA 5KRTA 4FLYA 2X78A 2E6LA 5K14A 1NKCA 3SPZA 3OYAA 3QO9A 2WOMA 3K5MA 2Z1GA 3SUQA 2ZQBA 5CY4A 3OJSA 3AO3A 4NYNA 3V9UA 4LY7A 4FVMA 4E1NA 3NGZA 1VSIA 4CJUA 3QEPA 3M8QA 1ZBFA 3PX0A 4DFKA 3QETA 3C94A 3OYNA 1KFDA 4I2QA 4Q5VA 4DF8A 4ZTJA 1NK5A 1G15A 1WSIA 3F73A 4BE1A 4BDYA 5EU7A 3UIQA 4C8NA 1A5WA 4Z4CA 3ASMA 4DLEA 4QAGA 4CJWA 4KPYA 1MU2A 3DOLA 2OYQA 2F96A 2HHSA 4DQSA 4C8OA 3TAQA 3PO5A 5E41A 3ALYA 4FM0A 3KKSA 3U3YA 2XHBA 4XIUA 1VSFA 3LPUA 3VQ5A 5T7BA 4EZ6A 2HB5A 4LSLA 2QKKA 4RW9A 3AA5X 2G8FA 1KVAA 1LAWA 3V9ZA 3MXMA 4FJ7A 2YNFA 1WLJA 4G1QA 1LWFA 1U45A 4FZYA 2YNGA 4N5SA 1QQCA 4B9NA 1RDAA 5FRNA 4B9VA 3VQCA 3VA0A
chains in the Genus database with same CATH superfamily
1HNVA 4CJTA 1U49A 1NMDA 5KGWA 1ITGA 4AHRA 2OANA 4TSXA 5JMVA 5J2NA 1S1WA 4E19A 3LWMA 2G8WA 1XHZA 2RPIA 3AV9A 2HHQA 3EKSA 2QWOA 3A5OC 1IKVA 4PWDA 3DLGA 1HJRA 1OKJA 3L3VA 5J1EA 1BHLA 5IT9O 4Z4HA 5KTQA 4CJFA 4F2RA 4KI6A 3S3OA 3UB5A 4CVNE 1C0GA 1UA1A 4IEIA 4FJIA 1EETA 2RN2A 4PL8A 4Y1CA 4A2BA 4CEEA 1DTQA 4DFPA 4DR6K 1UAXA 1NGDA 3F9KA 3V81A 1RTJA 5C25A 1IKWA 4HTUA 1L3SA 3CC7N 2P9PA 2G8IA 1E3MA 4DTOA 5HRNA 3THYB 3PX4A 1JLAA 3AVGA 4AHUA 4YOXA 3CYMA 3LP0A 2E2PA 2D0AA 4J8FA 3LL3A 3ZYYX 3SLCA 3NBPA 1ZBIA 3CJ9A 4RW4A 2CGJA 4BRCA 5JS1A 1JCEA 1ATRA 3AAPA 4FJLA 3D2EB 2VG5A 1NJXA 2F7TA 4BRDA 3OBYA 5EY4A 3I55N 5EVZA 2UUCK 4BVPA 1B9FA 2BH1A 1RDWX 4YDUA 3SQ1A 3R9PA 1WB9A 4IFEA 3J81O 5AZIA 1XHXA 1DTTA 2Q2RA 3ISNC 5FPDA 2FSNA 4X64K 3E01A 3P4IA 3QEIA 5M1PA 2G8UA 3I0SA 3CMAN 2CGLA 2NRHA 4BR7A 3AA3A 3JS6A 1VHXA 1ZBLA 2P1JA 1C1AA 2P9NB 2V52B 4YHHK 3K2PA 4W5QA 3SBTA 3OTOK 4I7FA 4LF8K 3NH2A 4KV8A 1WSJA 4GNIA 3VETA 3UE5A 1QE1A 2FLOA 2O8DA 4CGHA 1VSLA 4B8AB 4H4OA 4H0PA 4H5VA 4CBUA 4WF9L 1OH7A 4CF2A 2QTDA 4CHYA 4N56A 3O9UA 4LH5A 4CK2A 2HBJA 2FBXA 2P5OA 5AQTA 4LF9K 4Z4EA 4C23A 4LD0A 2Q0UA 5AQLA 4HCCA 1C0MA 4Z4IA 3KK1A 4AM6A 5FPEA 2GUIA 2BDPA 4DV5K 3ZT0A 1EQYA 4QCLA 1J5EK 4FXDA 3B6PA 4DV2K 2QI2A 3HVRA 1SKSA 2BGGA 1S9EA 4K8XA 4JI0K 2ZGYA 1NJWA 2O8FB 4KAZA 2FF6A 1WAFA 1VQ9N 1XMOK 1P8ZA 4MLEA 3IS9A 4CBWA 4CHQA 1J53A 1JLEA 3HM8A 4FK2A 4BRIA 1HMVA 4CJSA 2NLXA 3BEXA 3FFIA 1GLFO 3QEVA 4H0OA 1KXPA 4CFBA 1RT2A 1QVFM 3P38A 2YHAA 5HLFA 4FWQA 4CK1A 3QEXA 1TAQA 4FW2A 3TAEA 2I5JA 1T7PA 3S3MA 5C42A 4H0XB 3AA4A 1SL2A 2B5JA 2D0PA 1QTMA 3L2WA 3HOSA 3F5TA 5AZJA 4I9LA 4BRNA 4CHNA 1JCGA 3ZSOA 1NGIA 2OPPA 2X6NA 3VEZA 2IVOA 1W0HA 1M90O 1RDCA 3C95A 2YJFA 4O4GA 4A2AA 3QERA 4FJ8A 4K41A 1X3MA 1VQ4N 3P83D 3HP9A 3OVNA 4NCGA 1D9FA 1SS6A 4JD2A 3ITHA 4R79A 4BG9A 3AA2A 2IS3A 4CIGA 1T03A 3DI6A 1RT4A 4JI6K 3D7EO 4K42A 4I6MB 3LDPA 3NAEA 3L4QA 4DQ8A 3WT0A 2I7PA 1MA9B 5KPRA 3PSIA 3VQQA 3H1QA 1ZBHA 4MO5A 4E1JA 4XH4A 2A6AA 4CEFA 1IKYA 3K5LA 1R59O 2NRVA 2E2QA 1JJ2M 2O8EA 3QIPA 2J4RA 2IIRA 2CGKA 2ZWHA 1GOCA 3O80A 2AJQA 1J9AA 3QBWA 4C1NK 1B9DA 3KLEA 4O5FA 3DLHA 4OGEA 3H46O 1NJZA 2E5LK 3NFAA 2W41A 3WXKA 4CFCA 5FLXO 3V4IA 3OY9A 2IOCA 1X9JA 1VQ6N 1K9MO 4BE2A 3RMBA 4JKCA 3G10A 4GMJB 3M3ZA 3CPWM 4B3MK 2JWKA 1DEJA 4DR4K 1TL1A 1W2BM 4UQGA 3V1QA 1RT7A 4HUFA 3RMAA 3QEWA 2JGUA 2UXDK 5BREA 1HNXK 4KH5A 3ID8A 3OYIA 4CJEA 5HP1A 2WFBA 3O1BA 3R3LA 4K8ZA 4JHDB 5BN9A 4N47A 1ASVA 3VQDA 2PAVA 5CHIA 2E4LA 3MN6A 4OGCA 4OJRA 2IGIA 3E66A 3ZETB 3OS1A 1YUWA 5HOOA 4FJHA 3DRPA 1X9WA 3NE6A 4OKJA 1RILA 2P9KA 2OPRA 3M1FA 4CJ3A 3TSPA 4BQLA 4PKGA 4E7IA 4HTLA 4CGJA 1NK9A 2BE2A 5IWAK 2Z1HA 3D6RA 2Z1IA 1E4GT 1DLOA 3H6EA 1Q81O 4DSLA 4FYDA 3CCSN 2KTQA 3SV3A 2V7ZA 1S1UA 4M3WA 4CF8A 4O5BA 4DWIA 1NK6A 2IC3A 4K25A 2G8KA 2D1KA 4CF0A 3A5NC 5J2MA 3L6QA 1RT5A 4MDBA 3E9LA 3VN5A 3J8AA 4KTQA 4B1UB 1KAZA 3PY8A 4JK8A 3EKUA 3LDQA 3ZT4A 4U7BA 4DKWA 1TKTA 4CJRA 3NH0A 3KK7A 3C6UA 3ZEUB 4CZEA 4BGBA 3DOKA 1BI4B 2BUPA 3DRSA 3H45C 3NH1A 2XY7A 3NCIA 2FBVA 1JL1A 4M7YA 1TK8A 1EX4A 4DQRA 3CJAA 4LC9B 2O8BA 3V9XA 4IO8A 2Z1JA 3GDQA 3OYFA 1KVBA 3FLCO 4IDKA 4B9LA 4DTJA 4JS4A 2PBDA 3K9KA 1WOQA 4OO1J 1TKXA 4H4MA 3ZSYA 3O8MA 2ZJQL 3OYMA 2HHTA 3JXUA 1C6VA 1JLGA 3LALA 3ZX2A 3LM2A 4FLYA 4BRHA 3DLLL 3OYAA 2WOMA 2Z1GA 3OJSA 1NMNA 1D4XA 1TYQB 4LY7A 4FVMA 4E1NA 1T3VA 1QVGM 4BRQA 3EEQA 1ZBFA 1IV0A 3OYNA 1KFDA 3EN9A 2BTFA 3MX2A 5AQOA 4ZTJA 4JK9A 1NK5A 4JYAK 4JKDA 4IDHA 4Z4CA 4BC3A 4B1VA 1W7AA 3EZWA 4FM0A 1N8RO 5DM7L 3KWGA 5AQIA 4EHTA 1VSFA 2V51B 4JAXA 2HB5A 5AQHA 1KVAA 4KH6A 3MXMA 1WLJA 2YHWA 1U45A 2YNGA 4N5SA 4B9NA 3O9TA 4B9VA 1NM1A 4JKFA 2E8AA 3LP3A 3J80O 5AQNA 4IWVA 3B6OA 2ETJA 3CD6N 4EIAA 4A57A 3PIOL 4KFBA 3D45A 4EFHA 1QS4A 3DXMB 4B1ZA 5C15A 1E4FT 5JICA 3O9RA 1EWQA 4FLXA 5SZTA 4BR2A 1VSDA 3AVIA 3CCJN 1MWKA 1BQNA 1TAUA 4JKAA 4K43A 1VSKA 3HRGA 4B9SA 4HUEA 1SV5A 3CC2N 2QXLA 3VQ7A 3O1WA 2AA4A 4IG0A 2KQ2A 1RBSA 2QW9A 1U6ZA 1Q9XA 3BDPA 1OVQA 1ZXOA 3SK3A 1N36K 1NGGA 4CIEA 3CFRA 1LV5A 4C8KA 4G9ZA 4ILHA 4O0IA 3NDKA 4NCAA 4DHYA 3U4LA 5KPTA 3D2EA 5LJWA 4BY9C 2HSTA 1LWEA 2P9LB 3LPTA 4B3TK 2AP1A 3OYDA 3SV4A 4EP5A 3KLIA 4AF1A 4RW8A 3M8SA 5BRFA 4DV1K 4GVEA 2YNHA 3TR8A 4Z0UA 1VRTA 1TUYA 3CCQN 2DY4A 3ENOA 4NCBA 3AO4A 3RR7A 1CZBA 4KB0A 5AQYA 1V4SA 1R0AA 1HX1A 4H03B 4OVLA 4AH9A 2VG7A 3O9QA 3DMJA 1I39A 4YFUA 1WSFA 1S22A 4KHWA 3SQ2A 2ZE2A 1CXUA 3OYCA 2P9IB 4NB4A 1NK7A 1HPZA 4BR0A 3TAGA 4F9OA 2A42A 1ATSA 3BUZB 4BR5A 3WXLA 1NK4A 2HBMA 3DRRA 3ZSRA 3VPZA 3O5BA 4OKKA 1BL3A 4ELUA 4JKGB 5KQ8A 2UYTA 3SMSA 2O8CA 4YNQA 1KLMA 3VGKA 1IKXA 3OW2M 3L8BA 4DLGA 2VQEK 4M63C 5EX5A 4B9UA 1IO2A 2ZGZA 3SYZA 3ZSQA 5CR4A 2Q0RA 2VWJA 2UXBK 3VQEA 1YIJN 4Q0BA 1N5YA 3RMDA 4JRQA 3SQ0A 3DAWA 3FZMA 3HTVA 3Q7CA 5GINA 4MFBA 3OS0A 1YTUA 4JS5A 1K6YA 2WTUA 3CC4N 2FSKA 4C1NI 2PY5A 1GOBA 3CJ7A 1CZAN 4CZIA 1S6PA 3HPOA 5E84A 4WCEL 1NNEA 4AILC 1JLQA 1HKGA 4CJVA 3AVCA 4HVJA 1QZ5A 1QSYA 1Z6RA 3T19A 2YHYA 4J2EA 4X66K 2PFUA 2X6SA 3MX5A 4Z94A 2FBTA 1RBRA 3Q7BA 1J6ZA 4DS5A 3VQ8A 3HK2A 1NLVA 4IKFA 4GW6A 1KC8O 1Q8IA 4HUGA 1LOTB 3CCVN 4DV3K 2IVPA 4CE9A 3AVMA 4CESA 1S3XA 4LF5K 3OS2A 2F8TA 1WSEA 2GWJA 1IG9A 4LF7K 2ZD1A 1HRHA 4IFYA 4I6MA 3QDKA 2QXFA 2OTLN 1HJOA 3T1YK 2D5RA 4WFAL 1BIUA 3K57A 1D8YA 4A5BA 3KLHA 3AVBA 5BRHA 3M8RA 1BCOA 4E89A 3LZIA 1YT3A 4MQ3A 3G25A 2NZTA 1MDUB 2HF4A 4CECA 1D9DA 5J2PA 1ZYQA 3ULDA 3DYAA 3JSMA 3MWPA 1XC9A 4FM1A 3ULEB 1KLNA 3ZT1A 3K5NA 5GAHP 2OA8A 4OX9K 4JI1K 3O08A 4XH5A 2NRWA 2XY5A 4FJXA 4FWPA 3QFUA 3ID6A 3CCEN 4FWOA 3KK3A 4M45A 5FDLA 1BO5O 4CZLA 1Z25A 2ATQA 2GWKA 1HNIA 3THXB 3IUCA 1SZ2A 4ISGA 4A5AA 3J7YP 5AQRA 1JL2A 2A1SA 3N4PA 5H1SQ 1HYZA 5F1XA 4JN4A 1TL3A 3NMUA 2PYJA 4F3TA 4JKBA 4KHUA 1S1XA 4CCHA 1HKCA 4FJKA 4BGAA 4IBNA 1JLCA 1O1WA 2E20A 1FKOA 4JHDA 1Q82O 2HHWA 4ISEA 3LDSA 4DTPA 1U47A 4H5NA 3SNNA 5FRMA 3BY5A 4O44A 1ILYA 1YITN 1HLUA 4J2DA 5HBMA 1SQKA 1YTAA 4GV6A 4DS4A 1BIZA 4FCYA 2Q31A 3HVTA 4FVUA 3L2QA 3SBGA 4KTWA 4HWIA 4DTSA 4W5OA 4FZXC 5DMRA 1TK0A 1S1VA 4DR2K 4FOEA 4FLZA 1VSEA 1CZ9A 2QWRA 4DQIA 4AHCA 3AVHA 3FR0A 2WUSA 3CFOA 3IDHA 3PO4A 2E2OA 3WQTA 4ISFA 2YJEA 2FF3B 1Y97A 4M3RA 4DTUA 3IG1A 4BWMA 5BN8A 3WNFA 1RBTA 1KD1O 1RFQA 1BWFO 2O4GA 4DFMA 2HW3A 1YAGA 2XO7A 1TKDA 1VQ7N 2WONA 4YOVA 3TAPA 4MDAA 1D5AA 3H08A 1NBWA 3RRGA 4H0YB 1VRUA 4H0TB 4CJLA 3EZ5A 1SKWA 4B9MA 4E3SA 4DTXA 1I3AA 4B1XB 4IXCA 4OPJA 3ZEUA 4MLHA 3L4IA 3BZCA 3OYJA 2KW4A 5EXWA 2E1YA 4DMNA 5HL7L 5FPMA 2P9PB 3AY9A 1FK9A 4NO7A 4DR7K 4H5RA 1WUAA 1OVYA 4CEZA 4ICLA 4WQ5C 4CIFA 1N34K 1C0UA 3ZX3A 3SJHA 3ZSXA 5C10A 5I3UA 3HZ6A 4ELTA 5AQXA 3O3GA 1NJIO 1YF5L 3BF1A 4H5WA 1VQPN 3LP2A 1L3VA 3RSEA 4PY5A 1RDDA 3CQ8A 3C0BA 3IFRA 3AO5A 5AQKA 1H1VA 3DJCA 3WUHA 3VTIA 4JKEA 2Q36A 2CH6A 5E26A 3S3NA 1KCFA 1REVA 4X62K 3L2RA 2HMIA 1CXQA 5KRTA 1P90A 3P39A 1NKCA 3K5MA 3SUQA 2ZQBA 5CY4A 4NYNA 2WBNA 4CJUA 4FOIA 2D0OA 1ZC6A 1HUXA 4DFKA 3C94A 4CZGA 3IKMA 1U2VA 3QETA 3O6WA 4I2QA 4Q5VA 4DF8A 1WSIA 2Q1NA 3E9PA 4DLEA 4CJWA 3DOLA 5AQSA 2HHSA 3N4QA 4C8OA 3PO5A 3ALYA 3CQXA 3KKSA 2F9TA 2XHBA 4XIUA 2D4WA 1JCFA 4EZ6A 3AA5X 4LF4K 3V9ZA 3K0SA 4JI4K 4OPAA 3THWB 4G1QA 1LWFA 4FZYA 2F9WA 4BRFA 1RDAA 5FRNA 4IJNA 3VQCA 3DXMA 3MCAB 1MWMA 4GY2B 4WQ5A 3VESA 1UOCA 3WXMB 2F8SA 3PIPL 1TV6A 3A2FA 3KLGA 3UKRB 3TI0A 2UXCK 4X65K 3V9SA 2KZZA 1TGOA 3ZCMA 3EO3A 4BACA 4XH1A 3CXCM 1XUPO 2XRIA 3DWLA 4WQ4A 2FC0A 3LAMA 1TVRA 5BR9A 1LAVA 4WFBL 4M7XA 4PKHA 3DLRA 5LMUK 3NF6A 4AM7A 3HP6A 4JNEA 2KZMA 1NGFA 3AGKA 2Q3SA 2P9LA 5I42A 4KTZA 1CLQA 2OPQA 4IOCL 5LY3A 5JS2A 4DV6K 5TKYA 4I2PA 2YI1A 3DLKA 3MAQA 1VQKN 4BREA 4KHQA 2ASPA 3PV8A 4L8RB 3NF8A 1TK5A 5C2FA 1X3NA 1O13A 1S6QA 1YJNN 3J7ZO 3VEYA 1BCMA 2HNDA 2H3GX 3D2FB 4BR9A 3OYGA 2D0CA 3VF2A 1VQ8N 4BRAA 3W0LA 3KTQA 4PA1A 5C24A 5SWMA 1L3UA 2O4IA 2P9UB 2PZSA 4LFBK 1W9HA 2LSNA 4CJ4A 5GADP 3VEVA 4DSEA 4YY3K 2I7NA 3ATUA 4CBXA 1IBKK 3P31A 4ELVA 1T6CA 2E88A 3MN7A 4HCBA 4CJ5A 4BDPA 1ZBUA 4NYFA 4IOAL 3AVKA 1EXQA 4JI5K 4NLBA 4U67L 1XMQK 1HR0K 3WQUA 3CCUN 2YV0X 2O8EB 4H0VB 4W5RA 5LMNK 2RE2A 4JKGA 1YHQN 4BG8A 3TANA 3ZSWA 2P5GA 3WEEB 4E7JA 3HOTA 3PLAA 1LW0A 1NOYA 3P5JA 2RHKA 3VQ6A 4CK3A 1HQEA 3L2UA 3DXKB 3OBWA 5HROA 2ITGA 3W3DA 3OYHA 1Q7YO 4FLTA 3CQYA 4OPHA 2ZJPL 1BUPA 1V4TA 4RWTA 3QNNA 1ATNA 3JYTA 1RBVA 2B4JA 3HXMA 3SUOA 1BA1A 1Z05A 3C65A 2IDOA 5BRDA 1RBUA 1VAZA 4CHOA 1YXQA 3DM2A 3HT3A 1DT9A 3SUNA 2KHOA 1NGAA 4LH4A 3KKRA 1NJYA 4C8LA 3TAFA 3TTCA 4E1MA 5M1OA 1RCHA 3VQBA 1VQNN 2GBZA 2E1ZA 5D3GA 3MXIA 1GLLO 4CJQA 3HSCA 1SL0A 3VQ4A 2KFNA 4FO0A 3THYA 1QHAA 1VQLN 4BDZA 1U04A 2XY6A 4R5PA 2DFEA 3CMEN 4ID5A 2VQFK 2W6KA 4B8CA 4CEAA 1RTIA 3ZX0A 1K8KB 4OLBA 3M5RA 2OTJN 3CJCA 1X9MA 4H5TA 4CF9A 1S1TA 2P9SB 1K8AO 5KRSA 1LW2A 4BVOA 2KKZA 3LM9A 1YJWN 2A5XA 4RCHA 4DCHA 3OYBA 1VSMA 5AQWA 3AVAA 4O8KA 1GOAA 2VWKA 5FPNA 4HHTA 1RNHA 2GUPA 3SUPA 1N32K 4LFCK 1JKHA 1I94K 4FJMA 3M8PA 3J7AP 2HOEA 3HO1A 4CEOA 4CF1A 1IJJA 4JLHA 3RRHA 1L3TA 4YOTA 5DK5A 5CYMA 4AHTA 4OPKA 4W5TA 2GEMA 3VQAA 3OJUA 3KHYA 4GKKK 4FK4A 1BG3A 4CERA 2P9NA 3G4SN 4BE0A 3TPQA 1A5XA 3NGIA 5CZ2A 3AVLA 1XC3A 3BGRA 1GLCG 3VERA 4CJ7A 3T1AA 4CEBA 3NVMA 2JLEA 1YVNA 3A0IX 3PUFA 4ZTFA 4CEQA 1J54A 1KQSM 4FPBA 5KQDA 4WFNL 2HVIA 4DTMA 5AR0A 2DPNA 4BRLA 5B8HA 5DM6L 4DUZK 3VMFB 5AFUH 1EP4A 3CM6A 2NRRA 1BDGA 2YX6A 4JV5K 3OHRA 3ZT3A 3NGYA 4M3UA 4DV0K 4BRKA 1SAZA 2HVHA 5M1NA 4CFDA 5TKWA 2A1RA 3DLEA 4CZFA 5C0YA 3C7NB 4FM2A 4IG3A 2O8FA 4DSKA 4FK0A 3TU5A 2VG6A 1G99A 2OPSA 5LL6Z 2YHXA 4FW1A 5C2DA 3D0PA 4A59A 1EKEA 3HPGA 1ASUA 2A41A 1T6DA 3MECA 3MEGA 1BQMA 4OLAA 4FWRA 5HRRA 3R6MA 4B3SK 5KI6A 3LP1A 4YOYA 3BZKA 2F4VK 3LDLA 1KTQA 4J2AA 1XWLA 1S9GA 4B9TA 2OZSA 1T8EA 4CD1A 1WN7A 4CGFA 4FLUA 3CIPA 3VENA 3WNGA 2WC9A 1KSPA 2ZM6K 4CZHA 1ESVA 2ZJRL 3CG7A 4E7HA 1OH5A 5F0XA 3CJBA 3LDOA 4DU3A 5M1QA 5GAGP 4M42A 2VYPA 2EX3A 4CGDA 2HMPA 4NXMK 1C0FA 4F4KA 3VF4A 1FXXA 3KK2A 4PQUA 3VQ9A 4DTRA 3MCPA 1GLEG 1WSHA 3FZHA 4FL9A 4IJAA 5AFUA 1S72N 3RTVA 3TWHA 3NF9A 4BQZA 2VGMA 3SZ2A 4FWSA 1U4BA 3CM5A 2QWNA 1QQMA 3I8BA 1WNSA 2QWQA 3SQ4A 4JK7A 3A5MC 4B08A 4KREA 3L0QA 4XEIA 4WYBA 3OYEA 5CYQA 3O4QA 3VEOA 5M1FA 4RG8A 4FZZA 4DV4K 2HHXA 1VSJA 1WSGA 4JRPA 1A5VA 1YI2N 5AQPA 3O9SA 5AQUA 2NUBA 1KAXA 1RTHA 1X1PA 1T05A 3S9HA 3SI6A 4E0DA 4M3XA 2VWBA 3AO2A 5JLHA 5AQZA 3TARA 2EWSA 4CHPA 4B3RK 3IMXA 2X78A 1Q18A 3QO9A 3V9UA 3H3NO 3K9JA 3QEPA 4JI3K 5M1KA 4BE1A 3MDQA 3UIQA 4BDYA 5EU7A 1A5WA 4QAGA 4KPYA 2OYQA 3ATVA 4DQSA 4PL7A 3VGMA 5AQQA 3THWA 3LPUA 3ZETA 2GTDA 4LSLA 4FWMA 1LCUA 4IEEA 4BRMA 5KPZA 2G8FA 4FJ7A 4ILGB 2YNFA 3VEXA 4PHTX 1IBMK 3UKUB 2O8CB 4CW7B 3GOIA 3MMVA 3CERA 3VA0A 2GELA 1BA0A 4JI8K 4KHSA 3IRXA 3RVCA 3O3FA 5JLFA 3UKRA 3FZLA 1BGXT 4DQPA 4BRPA 1NKBA 1RDUA 1HNZK 3K5OA 5AQGA 3QIOA 3AARA 3DLBA 4DFJA 1QZ6A 1BU6O 2YNIA 4KI4A 1NGJA 4O8UA 3E9OA 5BPMA 3SJJA 2NRXA 3RR8A 5FROA 3SAFA 3WXJA 3F2KA 3U8XA 3VEWA 3GL1A 2HNYA 1F21A 3A5LC 1VQMN 2Q97A 2OZMA 3JAMO 4PKIA 4DU4A 1ASWA 4ZHRA 4GV3A 1C1BA 4GVMA 1JXBA 4BC5A 3PSFA 4FLWA 1NGHA 2FSJA 4M3TA 3I33A 1BI4A 4FJ5A 3R8EA 4C8MA 3NHGA 1YJ9N 3S41A 4F3OA 1C1CA 3O3HA 4PUOA 1NK0A 1HYVA 4RTFD 1NGBA 2GV9A 3P1GA 1RTDA 3D2FA 2HHVA 3ZLJA 5AQJA 5JVGL 1LWCA 1OH8A 4W5NA 2P9UA 5F2RA 3I56N 3SCXA 3TSQA 1EWRA 1RT1A 3KD5E 4O55A 3C6HA 4IO9L 4QS9A 4IFVA 4IZ9A 4CGIA 4QS8A 2D0BA 4CFAA 4Y1DA 2NNWA 2W40A 2P51A 3LANA 2NRZA 5HRSA 1W97L 1KRPA 3BP8A 4WQ4C 1NK8A 4FPAA 1TYQA 3FZKA 3VTHA 1KFSA 4J2BA 3VQPA 5AZIB 5BPLA 5MLCQ 3WEEA 2HBLA 4B3OA 1IG8A 2W6LA 2YHBA 1JLBA 4KRFA 1SKRA 1HPMA 4DSFA 4BC4A 1KVCA 1HNWK 2QWPA 3KJVA 4FJ9A 3DXKA 4DB3A 2DFHA 4NXNK 3EE8A 4IOXA 3CCLN 3H3OB 3U3GA 3QESA 1VQON 4B9QA 3OYKA 4H8KA 2A40A 4EHUA 3TAMA 2O8DB 2HBKA 4NLCA 3MEDA 3CPEA 1VQ5N 3HYFA 1HQUA 3KLFA 3U6FA 3CFPA 5AQMA 3C6TA 4M3ZA 4WE1A 5A2QO 1XI1A 2ZF5O 4YORA 4BWJA 1NKEA 1NOZA 1U48A 2YKNA 4UY8O 1BISA 3L3UA 4QS7A 1HKBA 3PX6A 1TKZA 1Q86O 2DTUA 3GBTA 4ID1A 4FWKA 1QQNA 3WNHA 4KHYA 1Z26A 3E1YA 3EL2A 3K58A 3KWIA 3NF7A 4N41A 2QM1A 3EYZA 1K8KA 3ZT2A 4YOWA 4FLVA 4DSJA 3NVKA 1B92A 4DR5K 3VGLA 1GLBG 3QBXA 4CJPA 2P9SA 5ADXH 4ILJA 3ENBA 5AQFA 4EAHD 1X9SA 3BF3A 4AQYK 1OH6A 4DR3K 3TTDA 1JLFA 5ELZA 2E2NA 1K73O 1XNQK 1TUUA 1VSHA 2QWMA 2UUBK 2QK9A 1VK0A 2HF3A 2VGNA 1NG9A 4YOUA 3WNEA 3HSTB 2GX9A 3V1OA 3GE1A 5AZJB 3THVA 4RW7A 4DTNA 4JKHA 3HM9A 3T7ZA 1Q9YA 2KFZA 1L5UA 4FWNA 1FKPA 3ENHA 3FZFA 4O0JA 1QHTA 1M1KO 3IAYA 2E6MA 3SAHA 3F9MA 3CETA 5GAEP 4BRGA 3QNOA 4B1WB 1SL1A 5JVHL 3VF6A 4JD2B 1IH7A 4DR1K 3LZJA 2QEXN 5HRPA 4F8RA 4KKOA 2RKIA 5BR8K 3FE1A 2W42A 2P9IA 3SPYA 1C0TA 4CGGA 3G0ZA 1GLDG 4E7KA 2A3ZA 4FJGA 4EP4A 4KHNA 3KVGA 1JXEA 1XQSC 1IBLK 1RT6A 3HI0A 5CE3A 1NU0A 1Y64A 4EZ9A 2IVNA 2YCHA 2XY8A 1QSSA 3QB0A 2NRTA 2BANA 3L2VA 4FWLA 3KZBA 1WBDA 3V1RA 4KO0A 5J2QA 1WBBA 1NGEA 4I9QA 2FBYA 1T44A 4Z4FA 3RSEB 2FXUA 3R1XA 3V9WA 2UUAK 4BROA 3QINA 3HL8A 1UA0A 3C7NA 2VCPA 4OKEA 2B6AA 4QOZB 3MWTA 4CD3A 5LJVA 4FJNA 4JEPA 1UWBA 5ADXA 4K0KK 3OA9A 2ASOA 2OCEA 2EHGA 1RT3A 3RMCA 1SUQA 2ITMA 4JI2K 2HHUA 2G8VA 4AHSA 2JWLA 4M3YA 3A8YA 3EE9A 3HBTA 4GKJK 1U2VB 2QWLA 2QKBA 1J5OA 3AGRA 1NGCA 4DSIA 1QQOA 2CH5A 3K59A 1DGKN 2QA4N 3AVFA 4CZMA 3T3FA 3G6EN 3AAQA 1WAJA 2HHHK 2YKMA 4MO4A 3RWUA 1BOTO 1EO1A 4AHVA 1YVUA 3ZSVA 4CI6A 5AJ3K 4CZJA 3I0RA 3B8AX 3AO1A 4CHZA 3MEEA 1S5JA 3MN9A 4L3QA 3O4WA 2PYLA 3TSUA 1RGIA 2P9KB 2Y1JA 2ASMA 3CF5L 2RF2A 4DUYK 4DU1A 3EY1A 2R7YA 4E7LA 3CCRN 4BR4A 4KB1A 3U9ZA 1HYSA 4JI7K 3LAKA 4RW6A 4B1YB 4M41A 1RDBA 4CEDA 3O4NA 4N76A 2G8HA 4F2SA 3C6AA 4FSVA 4DQQA 3MK6A 3LWLA 4V19S 5KGXA 4KHPK 4CZKA 4FJJA 2KLAA 2Y1IA 2DFFA 3OYLA 3KD1E 1ZBSA 4A62A 3ULEA 5GIOA 1NWKA 3AVJA 4BC2A 1DKGD 3AVNA 4DF4A 2IAJA 1N33K 4Z4GA 5C12A 3MXJA 5I9EB 3SAGA 3T1HK 3VOVA 3HJFA 5BPNA 4DG1A 5CZ1A 3ZSZA 4LSNA 3GG4A 1XNRK 4CJKA 3THXA 3QMLA 3QICA 2O8BB 3VA3A 3CHWA 3QLHA 2HNZA 3I8DA 3QFPA 1QSLA 2X74A 3TTFA 3U9DA 1N6QA 3MN5A 4GV9A 3KIOA 3V6DA 3HPHA 5AQVA 3TABA 4Y0WA 2E6LA 3CCMN 5K14A 3SPZA 4A61A 5GIPA 3AO3A 3FFKB 3NGZA 1VSIA 1FW6A 3LDNA 3T69A 3M8QA 3G71N 3PX0A 1G15A 3F73A 2V7YA 4C8NA 3M6GA 3ASMA 3FGUA 4DV7K 1MU2A 2F96A 1KAYA 3TAQA 5E41A 3H1VX 3U3YA 4LFAK 3UKUA 3CI5A 2UU9K 4KH4A 4KBOA 3VQ5A 5T7BA 3WXIA 3SMPA 2QKKA 1GLAG 1FJGK 4RW9A 4LF6K 1LAWA 3CJ1A 1GLJO 5EOYA 1QQCA 4YDUC
chains in the Genus database with same CATH topology
1HNVA 3LP3A 4CJTA 1U49A 4KHSA 3IRXA 3O3FA 5KGWA 1ITGA 1UOCA 3B6OA 4AHRA 2ETJA 1BGXT 4TSXA 4DQPA 5J2NA 1NKBA 1S1WA 4E19A 2F8SA 4KFBA 3K5OA 3LWMA 2G8WA 3D45A 1QS4A 1XHZA 3QIOA 2RPIA 3AV9A 2HHQA 3DLBA 1TV6A 3A2FA 3KLGA 1IKVA 4DFJA 4PWDA 4FLXA 3TI0A 5SZTA 3DLGA 1HJRA 2YNIA 4KI4A 1VSDA 3L3VA 5J1EA 1BHLA 3SJJA 3V9SA 2KZZA 1TGOA 3ZCMA 3AVIA 4Z4HA 4CJFA 5KTQA 5FROA 4BACA 3RR8A 4F2RA 4KI6A 1BQNA 1TAUA 3S3OA 1VSKA 2XRIA 4B9SA 4HUEA 1SV5A 1UA1A 4FJIA 2HNYA 3VQ7A 1EETA 1F21A 2FC0A 2RN2A 3LAMA 1TVRA 4Y1CA 1LAVA 4IG0A 4CEEA 2KQ2A 1DTQA 4DFPA 3DLRA 2OZMA 1UAXA 3NF6A 3F9KA 4DU4A 3HP6A 1RBSA 2KZMA 1ASWA 1Q9XA 4ZHRA 3BDPA 3V81A 1C1BA 1RTJA 1IKWA 5C25A 4GVMA 4HTUA 1L3SA 2G8IA 1JXBA 4DTOA 2Q3SA 5HRNA 3PX4A 1JLAA 5I42A 4FLWA 4KTZA 3AVGA 4CIEA 3CFRA 1LV5A 4C8KA 4M3TA 1CLQA 1BI4A 4AHUA 4O0IA 2OPQA 3CYMA 3LP0A 3NDKA 4FJ5A 4NCAA 5JS2A 4C8MA 3NHGA 4I2PA 3DLKA 2D0AA 3MAQA 1C1CA 4F3OA 1LWEA 4KHQA 3O3HA 4PUOA 1NK0A 1HYVA 3LPTA 3PV8A 3NBPA 4L8RB 1ZBIA 3NF8A 2GV9A 1TK5A 3P1GA 4RW4A 1RTDA 2HHVA 3OYDA 5JS1A 3SV4A 4EP5A 4FJLA 1NJXA 2VG5A 1LWCA 3KLIA 3M8SA 4RW8A 4W5NA 3SCXA 2YNHA 1S6QA 3TR8A 1RT1A 4Z0UA 1BCMA 1VRTA 2HNDA 4O55A 3KD5E 3OYGA 2D0CA 2DY4A 4IFVA 3KTQA 4PA1A 5C24A 4CGIA 5SWMA 1L3UA 2O4IA 2D0BA 4NCBA 2PZSA 3AO4A 4CFAA 1B9FA 4Y1DA 3RR7A 1W9HA 2LSNA 1CZBA 2P51A 4CJ4A 4KB0A 3LANA 3SQ1A 5HRSA 4DSEA 1R0AA 4OVLA 1XHXA 1DTTA 3ISNC 4AH9A 1KRPA 2VG7A 3E01A 3QEIA 1NK8A 2G8UA 3DMJA 1I39A 4YFUA 1WSFA 4ELVA 3I0SA 1KFSA 4J2BA 4KHWA 3VQPA 3SQ2A 2ZE2A 4HCBA 1CXUA 4CJ5A 3OYCA 4BDPA 1ZBUA 3AA3A 1ZBLA 1HPZA 1NK7A 4NYFA 4B3OA 2P1JA 3AVKA 1EXQA 3TAGA 2YHBA 1C1AA 4W5QA 3K2PA 1JLBA 2YV0X 4KRFA 4I7FA 1SKRA 3NH2A 4W5RA 4DSFA 1KVCA 4KV8A 3TANA 1WSJA 3ZSWA 3KJVA 4FJ9A 2P5GA 1NK4A 4E7JA 1QE1A 3DRRA 2DFHA 3ZSRA 1LW0A 4CGHA 1VSLA 4B8AB 1NOYA 4H4OA 3P5JA 3VQ6A 4OKKA 1BL3A 3U3GA 4CK3A 3QESA 4ELUA 1HQEA 4CF2A 4N56A 4CHYA 3L2UA 4LH5A 3OYKA 4H8KA 5HROA 4CK2A 2ITGA 4YNQA 2FBXA 3TAMA 3OYHA 1KLMA 4FLTA 1IKXA 2P5OA 3MEDA 4Z4EA 4LD0A 3L8BA 3QNNA 3JYTA 4DLGA 1C0MA 1HQUA 3HYFA 3KK1A 4HCCA 3KLFA 4Z4IA 4B9UA 1RBVA 1IO2A 2B4JA 3HXMA 3SYZA 3SUOA 3ZSQA 2GUIA 3U6FA 2BDPA 3CFPA 2VWJA 3ZT0A 3VQEA 4QCLA 3C6TA 2IDOA 4FXDA 3B6PA 1N5YA 1RBUA 4M3ZA 4Q0BA 4WE1A 3HVRA 3RMDA 1SKSA 2BGGA 4CHOA 4JRQA 1S9EA 3SQ0A 1XI1A 4K8XA 3DM2A 4BWJA 3HT3A 1NJWA 1NKEA 3SUNA 4KAZA 1WAFA 1NOZA 4MFBA 3OS0A 1U48A 1YTUA 2YKNA 1K6YA 4JS5A 1BISA 3L3UA 3IS9A 3PX6A 4LH4A 1TKZA 4CHQA 2PY5A 1J53A 1GOBA 3KKRA 1JLEA 4FK2A 2DTUA 1NJYA 4C8LA 1S6PA 4ID1A 3TAFA 3HPOA 4E1MA 1HMVA 3WNHA 4CJSA 1RCHA 3VQBA 4AILC 4KHYA 1Z26A 3FFIA 1JLQA 3QEVA 3K58A 2GBZA 4CFBA 1RT2A 5D3GA 3NF7A 2YHAA 3AVCA 4CJVA 3MXIA 4HVJA 4N41A 4CJQA 5HLFA 4CK1A 1SL0A 1QSYA 3VQ4A 1TAQA 4FW2A 3ZT2A 3EYZA 3QEXA 2KFNA 3TAEA 2I5JA 4FLVA 4DSJA 1T7PA 1B92A 3T19A 4BDZA 1U04A 2XY6A 4J2EA 4R5PA 2DFEA 4ID5A 3S3MA 5C42A 4CJPA 4CEAA 4B8CA 2X6SA 3AA4A 1RTIA 1SL2A 2FBTA 1RBRA 4OLBA 1X9SA 2B5JA 1QTMA 3L2WA 4DS5A 3VQ8A 1JLFA 1X9MA 3HK2A 4IKFA 4GW6A 1S1TA 1VSHA 4CF9A 1Q8IA 4HUGA 4I9LA 5KRSA 1LW2A 4CHNA 2QK9A 3ZSOA 2OPPA 2X6NA 1VK0A 1W0HA 3WNEA 1RDCA 1VSMA 3C95A 3HSTB 3AVAA 4O4GA 4CE9A 3OYBA 3AVMA 4CESA 3QERA 4FJ8A 1GOAA 3V1OA 2VWKA 3OS2A 3THVA 4HHTA 4RW7A 4DTNA 1RNHA 3P83D 3HM9A 2F8TA 1WSEA 3SUPA 1IG9A 1Q9YA 2ZD1A 3HP9A 1JKHA 1HRHA 3OVNA 4IFYA 4NCGA 1L5UA 4FJMA 2KFZA 2QXFA 1FKPA 4O0JA 1D9FA 1QHTA 2D5RA 3ITHA 3M8PA 3IAYA 3HO1A 1BIUA 2E6MA 4CEOA 4CF1A 3AA2A 3K57A 2IS3A 4CIGA 1T03A 1D8YA 3DI6A 4JLHA 1RT4A 3KLHA 3QNOA 3RRHA 1L3TA 3AVBA 4FZXC 3M8RA 1SL1A 1BCOA 3NAEA 4E89A 3LZIA 1YT3A 4MQ3A 1IH7A 4F8RA 3LZJA 5HRPA 5DK5A 5CYMA 4AHTA 4OPKA 4KKOA 3VQQA 2RKIA 4W5TA 1ZBHA 3VQAA 3OJUA 2W42A 3SPYA 4CECA 1D9DA 1C0TA 5J2PA 4CGGA 4FK4A 4CEFA 4CERA 3ULDA 3DYAA 1ZYQA 1IKYA 3G0ZA 3JSMA 3K5LA 1XC9A 4FM1A 4E7KA 4FJGA 3QIPA 4EP4A 4BE0A 1KLNA 3ZT1A 1JXEA 3K5NA 4KHNA 1A5XA 3NGIA 2OA8A 5CZ2A 3AVLA 1RT6A 1GOCA 2AJQA 1J9AA 3BGRA 2XY5A 4FJXA 3T1AA 4EZ9A 4CEBA 1B9DA 2JLEA 2XY8A 3PUFA 3KK3A 4M45A 3KLEA 2BANA 5FDLA 4ZTFA 1QSSA 3DLHA 4OGEA 4CEQA 3L2VA 1J54A 1NJZA 3NFAA 3V1RA 4KO0A 1Z25A 5J2QA 2ATQA 2HVIA 4DTMA 4I9QA 2FBYA 4CFCA 1HNIA 4Z4FA 3V4IA 3OY9A 1EP4A 2IOCA 3CM6A 1JL2A 2A1SA 3V9WA 1HYZA 4BE2A 3QINA 3HL8A 3RMBA 1UA0A 3G10A 4GMJB 3ZT3A 3NGYA 4QOZB 1TL3A 2B6AA 4OKEA 4M3UA 2PYJA 4F3TA 2HVHA 4KHUA 1S1XA 4CCHA 4FJNA 4CFDA 1UWBA 2A1RA 1TL1A 3DLEA 4UQGA 3V1QA 4FJKA 2EHGA 1RT3A 4IBNA 1JLCA 4FM2A 1O1WA 1RT7A 1SUQA 4IG3A 4HUFA 3RMCA 3RMAA 3QEWA 4DSKA 2HHUA 1FKOA 2JGUA 2G8VA 2HHWA 4AHSA 3LDSA 4DTPA 4M3YA 1U47A 4FK0A 3OYIA 2QKBA 4CJEA 3SNNA 2VG6A 5HP1A 5FRMA 1J5OA 2OPSA 4O44A 4DSIA 4K8ZA 4N47A 4J2DA 5HBMA 1ASVA 1YTAA 3VQDA 3K59A 4FW1A 4DS4A 2E4LA 3AVFA 4OGCA 1BIZA 4OJRA 3D0PA 3T3FA 4FCYA 1EKEA 3HPGA 1WAJA 3HVTA 1ASUA 2IGIA 2YKMA 3L2QA 4KTWA 3OS1A 3MECA 3MEGA 3RWUA 1BQMA 4DTSA 4FJHA 4W5OA 4OLAA 3DRPA 1YVUA 5DMRA 3ZSVA 4AHVA 1S1VA 5HRRA 4FLZA 3NE6A 1X9WA 5KI6A 1VSEA 1TK0A 4OKJA 1CZ9A 1RILA 3LP1A 3I0RA 4DQIA 1KTQA 4AHCA 2OPRA 3AVHA 4J2AA 3AO1A 4CHZA 3CFOA 3MEEA 1XWLA 1S9GA 1S5JA 3PO4A 4CJ3A 4B9TA 2OZSA 2PYLA 1Y97A 1T8EA 4FLUA 1WN7A 4CGFA 4E7IA 4M3RA 3WNGA 3IG1A 4CGJA 4DTUA 1NK9A 2BE2A 2Y1JA 1KSPA 4BWMA 2Z1HA 2RF2A 3WNFA 1RBTA 3CG7A 4DU1A 3EY1A 2O4GA 4DFMA 2R7YA 2HW3A 4E7LA 2XO7A 2Z1IA 4E7HA 1TKDA 1DLOA 4DSLA 4FYDA 4KB1A 2WONA 3SV3A 2KTQA 1S1UA 1HYSA 4M3WA 3LAKA 4RW6A 4CF8A 4DU3A 4O5BA 4DWIA 1NK6A 2IC3A 4M41A 4M42A 3TAPA 2G8KA 2EX3A 1D5AA 1RDBA 3H08A 4CEDA 4CF0A 3RRGA 4CGDA 1VRUA 3O4NA 4CJLA 3EZ5A 5J2MA 1RT5A 4N76A 1SKWA 2G8HA 4B9MA 4E3SA 4F4KA 4F2SA 1FXXA 3KK2A 4DTXA 1I3AA 3VQ9A 4PQUA 4DTRA 4OPJA 4DQQA 3VN5A 1WSHA 4KTQA 3LWLA 3OYJA 5KGXA 3RTVA 2KW4A 4DMNA 3ZT4A 3TWHA 3PY8A 3NF9A 4FJJA 1TKTA 3SZ2A 1U4BA 4CJRA 3CM5A 3NH0A 2Y1IA 1FK9A 2DFFA 1WNSA 3C6UA 3OYLA 3KD1E 4CEZA 3SQ4A 3DOKA 1BI4B 3DRSA 3AVJA 4ICLA 4CIFA 1C0UA 4B08A 4KREA 3ZSXA 3NH1A 2XY7A 3AVNA 2FBVA 3OYEA 3NCIA 1JL1A 5CYQA 4DF4A 2IAJA 3O4QA 4Z4GA 5I3UA 1TK8A 1EX4A 4DQRA 3MXJA 4ELTA 4RG8A 4FZZA 3V9XA 2HHXA 3O3GA 1VSJA 2Z1JA 1WSGA 3OYFA 1A5VA 4JRPA 1KVBA 3HJFA 4IDKA 4DG1A 5CZ1A 4B9LA 3LP2A 3ZSZA 2NUBA 4DTJA 4LSNA 1L3VA 4JS4A 4CJKA 4PY5A 1RDDA 1RTHA 3VA3A 1X1PA 3CQ8A 1T05A 1TKXA 3AO5A 3QLHA 4H4MA 3ZSYA 2HNZA 3S9HA 3SI6A 3I8DA 4E0DA 1QSLA 4M3XA 2X74A 3OYMA 1N6QA 2HHTA 3KIOA 3AO2A 3V6DA 3HPHA 3S3NA 1C6VA 1JLGA 1KCFA 1REVA 3LALA 3TARA 3L2RA 2HMIA 3TABA 1CXQA 4CHPA 5KRTA 4FLYA 2X78A 2E6LA 5K14A 1NKCA 3SPZA 3OYAA 3QO9A 2WOMA 3K5MA 2Z1GA 3SUQA 2ZQBA 5CY4A 3OJSA 3AO3A 4NYNA 3V9UA 4LY7A 4FVMA 4E1NA 3NGZA 1VSIA 4CJUA 3QEPA 3M8QA 1ZBFA 3PX0A 4DFKA 3QETA 3C94A 3OYNA 1KFDA 4I2QA 4Q5VA 4DF8A 4ZTJA 1NK5A 1G15A 1WSIA 3F73A 4BE1A 4BDYA 5EU7A 3UIQA 4C8NA 1A5WA 4Z4CA 3ASMA 4DLEA 4QAGA 4CJWA 4KPYA 1MU2A 3DOLA 2OYQA 2F96A 2HHSA 4DQSA 4C8OA 3TAQA 3PO5A 5E41A 3ALYA 4FM0A 3KKSA 3U3YA 2XHBA 4XIUA 1VSFA 3LPUA 3VQ5A 5T7BA 4EZ6A 2HB5A 4LSLA 2QKKA 4RW9A 3AA5X 2G8FA 1KVAA 1LAWA 3V9ZA 3MXMA 4FJ7A 2YNFA 1WLJA 4G1QA 1LWFA 1U45A 4FZYA 2YNGA 4N5SA 1QQCA 4B9NA 1RDAA 5FRNA 4B9VA 3VQCA 3VA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNV A;  3LP3 A;  4CJT A;  1U49 A;  4KHS A;  3IRX A;  3O3F A;  5KGW A;  1ITG A;  1UOC A;  3B6O A;  4AHR A;  2ETJ A;  1BGX T;  4TSX A;  4DQP A;  5J2N A;  1NKB A;  1S1W A;  4E19 A;  2F8S A;  4KFB A;  3K5O A;  3LWM A;  2G8W A;  3D45 A;  1QS4 A;  1XHZ A;  3QIO A;  2RPI A;  3AV9 A;  2HHQ A;  3DLB A;  1TV6 A;  3A2F A;  3KLG A;  1IKV A;  4DFJ A;  4PWD A;  4FLX A;  3TI0 A;  5SZT A;  3DLG A;  1HJR A;  2YNI A;  4KI4 A;  1VSD A;  3L3V A;  5J1E A;  1BHL A;  3SJJ A;  3V9S A;  2KZZ A;  1TGO A;  3ZCM A;  3AVI A;  4Z4H A;  4CJF A;  5KTQ A;  5FRO A;  4BAC A;  3RR8 A;  4F2R A;  4KI6 A;  1BQN A;  1TAU A;  3S3O A;  1VSK A;  2XRI A;  4B9S A;  4HUE A;  1SV5 A;  1UA1 A;  4FJI A;  2HNY A;  3VQ7 A;  1EET A;  1F21 A;  2FC0 A;  2RN2 A;  3LAM A;  1TVR A;  4Y1C A;  1LAV A;  4IG0 A;  4CEE A;  2KQ2 A;  1DTQ A;  4DFP A;  3DLR A;  2OZM A;  1UAX A;  3NF6 A;  3F9K A;  4DU4 A;  3HP6 A;  1RBS A;  2KZM A;  1ASW A;  1Q9X A;  4ZHR A;  3BDP A;  3V81 A;  1C1B A;  1RTJ A;  1IKW A;  5C25 A;  4GVM A;  4HTU A;  1L3S A;  2G8I A;  1JXB A;  4DTO A;  2Q3S A;  5HRN A;  3PX4 A;  1JLA A;  5I42 A;  4FLW A;  4KTZ A;  3AVG A;  4CIE A;  3CFR A;  1LV5 A;  4C8K A;  4M3T A;  1CLQ A;  1BI4 A;  4AHU A;  4O0I A;  2OPQ A;  3CYM A;  3LP0 A;  3NDK A;  4FJ5 A;  4NCA A;  5JS2 A;  4C8M A;  3NHG A;  4I2P A;  3DLK A;  2D0A A;  3MAQ A;  1C1C A;  4F3O A;  1LWE A;  4KHQ A;  3O3H A;  4PUO A;  1NK0 A;  1HYV A;  3LPT A;  3PV8 A;  3NBP A;  4L8R B;  1ZBI A;  3NF8 A;  2GV9 A;  1TK5 A;  3P1G A;  4RW4 A;  1RTD A;  2HHV A;  3OYD A;  5JS1 A;  3SV4 A;  4EP5 A;  4FJL A;  1NJX A;  2VG5 A;  1LWC A;  3KLI A;  3M8S A;  4RW8 A;  4W5N A;  3SCX A;  2YNH A;  1S6Q A;  3TR8 A;  1RT1 A;  4Z0U A;  1BCM A;  1VRT A;  2HND A;  4O55 A;  3KD5 E;  3OYG A;  2D0C A;  2DY4 A;  4IFV A;  3KTQ A;  4PA1 A;  5C24 A;  4CGI A;  5SWM A;  1L3U A;  2O4I A;  2D0B A;  4NCB A;  2PZS A;  3AO4 A;  4CFA A;  1B9F A;  4Y1D A;  3RR7 A;  1W9H A;  2LSN A;  1CZB A;  2P51 A;  4CJ4 A;  4KB0 A;  3LAN A;  3SQ1 A;  5HRS A;  4DSE A;  1R0A A;  4OVL A;  1XHX A;  1DTT A;  3ISN C;  4AH9 A;  1KRP A;  2VG7 A;  3E01 A;  3QEI A;  1NK8 A;  2G8U A;  3DMJ A;  1I39 A;  4YFU A;  1WSF A;  4ELV A;  3I0S A;  1KFS A;  4J2B A;  4KHW A;  3VQP A;  3SQ2 A;  2ZE2 A;  4HCB A;  1CXU A;  4CJ5 A;  3OYC A;  4BDP A;  1ZBU A;  3AA3 A;  1ZBL A;  1HPZ A;  1NK7 A;  4NYF A;  4B3O A;  2P1J A;  3AVK A;  1EXQ A;  3TAG A;  2YHB A;  1C1A A;  4W5Q A;  3K2P A;  1JLB A;  2YV0 X;  4KRF A;  4I7F A;  1SKR A;  3NH2 A;  4W5R A;  4DSF A;  1KVC A;  4KV8 A;  3TAN A;  1WSJ A;  3ZSW A;  3KJV A;  4FJ9 A;  2P5G A;  1NK4 A;  4E7J A;  1QE1 A;  3DRR A;  2DFH A;  3ZSR A;  1LW0 A;  4CGH A;  1VSL A;  4B8A B;  1NOY A;  4H4O A;  3P5J A;  3VQ6 A;  4OKK A;  1BL3 A;  3U3G A;  4CK3 A;  3QES A;  4ELU A;  1HQE A;  4CF2 A;  4N56 A;  4CHY A;  3L2U A;  4LH5 A;  3OYK A;  4H8K A;  5HRO A;  4CK2 A;  2ITG A;  4YNQ A;  2FBX A;  3TAM A;  3OYH A;  1KLM A;  4FLT A;  1IKX A;  2P5O A;  3MED A;  4Z4E A;  4LD0 A;  3L8B A;  3QNN A;  3JYT A;  4DLG A;  1C0M A;  1HQU A;  3HYF A;  3KK1 A;  4HCC A;  3KLF A;  4Z4I A;  4B9U A;  1RBV A;  1IO2 A;  2B4J A;  3HXM A;  3SYZ A;  3SUO A;  3ZSQ A;  2GUI A;  3U6F A;  2BDP A;  3CFP A;  2VWJ A;  3ZT0 A;  3VQE A;  4QCL A;  3C6T A;  2IDO A;  4FXD A;  3B6P A;  1N5Y A;  1RBU A;  4M3Z A;  4Q0B A;  4WE1 A;  3HVR A;  3RMD A;  1SKS A;  2BGG A;  4CHO A;  4JRQ A;  1S9E A;  3SQ0 A;  1XI1 A;  4K8X A;  3DM2 A;  4BWJ A;  3HT3 A;  1NJW A;  1NKE A;  3SUN A;  4KAZ A;  1WAF A;  1NOZ A;  4MFB A;  3OS0 A;  1U48 A;  1YTU A;  2YKN A;  1K6Y A;  4JS5 A;  1BIS A;  3L3U A;  3IS9 A;  3PX6 A;  4LH4 A;  1TKZ A;  4CHQ A;  2PY5 A;  1J53 A;  1GOB A;  3KKR A;  1JLE A;  4FK2 A;  2DTU A;  1NJY A;  4C8L A;  1S6P A;  4ID1 A;  3TAF A;  3HPO A;  4E1M A;  1HMV A;  3WNH A;  4CJS A;  1RCH A;  3VQB A;  4AIL C;  4KHY A;  1Z26 A;  3FFI A;  1JLQ A;  3QEV A;  3K58 A;  2GBZ A;  4CFB A;  1RT2 A;  5D3G A;  3NF7 A;  2YHA A;  3AVC A;  4CJV A;  3MXI A;  4HVJ A;  4N41 A;  4CJQ A;  5HLF A;  4CK1 A;  1SL0 A;  1QSY A;  3VQ4 A;  1TAQ A;  4FW2 A;  3ZT2 A;  3EYZ A;  3QEX A;  2KFN A;  3TAE A;  2I5J A;  4FLV A;  4DSJ A;  1T7P A;  1B92 A;  3T19 A;  4BDZ A;  1U04 A;  2XY6 A;  4J2E A;  4R5P A;  2DFE A;  4ID5 A;  3S3M A;  5C42 A;  4CJP A;  4CEA A;  4B8C A;  2X6S A;  3AA4 A;  1RTI A;  1SL2 A;  2FBT A;  1RBR A;  4OLB A;  1X9S A;  2B5J A;  1QTM A;  3L2W A;  4DS5 A;  3VQ8 A;  1JLF A;  1X9M A;  3HK2 A;  4IKF A;  4GW6 A;  1S1T A;  1VSH A;  4CF9 A;  1Q8I A;  4HUG A;  4I9L A;  5KRS A;  1LW2 A;  4CHN A;  2QK9 A;  3ZSO A;  2OPP A;  2X6N A;  1VK0 A;  1W0H A;  3WNE A;  1RDC A;  1VSM A;  3C95 A;  3HST B;  3AVA A;  4O4G A;  4CE9 A;  3OYB A;  3AVM A;  4CES A;  3QER A;  4FJ8 A;  1GOA A;  3V1O A;  2VWK A;  3OS2 A;  3THV A;  4HHT A;  4RW7 A;  4DTN A;  1RNH A;  3P83 D;  3HM9 A;  2F8T A;  1WSE A;  3SUP A;  1IG9 A;  1Q9Y A;  2ZD1 A;  3HP9 A;  1JKH A;  1HRH A;  3OVN A;  4IFY A;  4NCG A;  1L5U A;  4FJM A;  2KFZ A;  2QXF A;  1FKP A;  4O0J A;  1D9F A;  1QHT A;  2D5R A;  3ITH A;  3M8P A;  3IAY A;  3HO1 A;  1BIU A;  2E6M A;  4CEO A;  4CF1 A;  3AA2 A;  3K57 A;  2IS3 A;  4CIG A;  1T03 A;  1D8Y A;  3DI6 A;  4JLH A;  1RT4 A;  3KLH A;  3QNO A;  3RRH A;  1L3T A;  3AVB A;  4FZX C;  3M8R A;  1SL1 A;  1BCO A;  3NAE A;  4E89 A;  3LZI A;  1YT3 A;  4MQ3 A;  1IH7 A;  4F8R A;  3LZJ A;  5HRP A;  5DK5 A;  5CYM A;  4AHT A;  4OPK A;  4KKO A;  3VQQ A;  2RKI A;  4W5T A;  1ZBH A;  3VQA A;  3OJU A;  2W42 A;  3SPY A;  4CEC A;  1D9D A;  1C0T A;  5J2P A;  4CGG A;  4FK4 A;  4CEF A;  4CER A;  3ULD A;  3DYA A;  1ZYQ A;  1IKY A;  3G0Z A;  3JSM A;  3K5L A;  1XC9 A;  4FM1 A;  4E7K A;  4FJG A;  3QIP A;  4EP4 A;  4BE0 A;  1KLN A;  3ZT1 A;  1JXE A;  3K5N A;  4KHN A;  1A5X A;  3NGI A;  2OA8 A;  5CZ2 A;  3AVL A;  1RT6 A;  1GOC A;  2AJQ A;  1J9A A;  3BGR A;  2XY5 A;  4FJX A;  3T1A A;  4EZ9 A;  4CEB A;  1B9D A;  2JLE A;  2XY8 A;  3PUF A;  3KK3 A;  4M45 A;  3KLE A;  2BAN A;  5FDL A;  4ZTF A;  1QSS A;  3DLH A;  4OGE A;  4CEQ A;  3L2V A;  1J54 A;  1NJZ A;  3NFA A;  3V1R A;  4KO0 A;  1Z25 A;  5J2Q A;  2ATQ A;  2HVI A;  4DTM A;  4I9Q A;  2FBY A;  4CFC A;  1HNI A;  4Z4F A;  3V4I A;  3OY9 A;  1EP4 A;  2IOC A;  3CM6 A;  1JL2 A;  2A1S A;  3V9W A;  1HYZ A;  4BE2 A;  3QIN A;  3HL8 A;  3RMB A;  1UA0 A;  3G10 A;  4GMJ B;  3ZT3 A;  3NGY A;  4QOZ B;  1TL3 A;  2B6A A;  4OKE A;  4M3U A;  2PYJ A;  4F3T A;  2HVH A;  4KHU A;  1S1X A;  4CCH A;  4FJN A;  4CFD A;  1UWB A;  2A1R A;  1TL1 A;  3DLE A;  4UQG A;  3V1Q A;  4FJK A;  2EHG A;  1RT3 A;  4IBN A;  1JLC A;  4FM2 A;  1O1W A;  1RT7 A;  1SUQ A;  4IG3 A;  4HUF A;  3RMC A;  3RMA A;  3QEW A;  4DSK A;  2HHU A;  1FKO A;  2JGU A;  2G8V A;  2HHW A;  4AHS A;  3LDS A;  4DTP A;  4M3Y A;  1U47 A;  4FK0 A;  3OYI A;  2QKB A;  4CJE A;  3SNN A;  2VG6 A;  5HP1 A;  5FRM A;  1J5O A;  2OPS A;  4O44 A;  4DSI A;  4K8Z A;  4N47 A;  4J2D A;  5HBM A;  1ASV A;  1YTA A;  3VQD A;  3K59 A;  4FW1 A;  4DS4 A;  2E4L A;  3AVF A;  4OGC A;  1BIZ A;  4OJR A;  3D0P A;  3T3F A;  4FCY A;  1EKE A;  3HPG A;  1WAJ A;  3HVT A;  1ASU A;  2IGI A;  2YKM A;  3L2Q A;  4KTW A;  3OS1 A;  3MEC A;  3MEG A;  3RWU A;  1BQM A;  4DTS A;  4FJH A;  4W5O A;  4OLA A;  3DRP A;  1YVU A;  5DMR A;  3ZSV A;  4AHV A;  1S1V A;  5HRR A;  4FLZ A;  3NE6 A;  1X9W A;  5KI6 A;  1VSE A;  1TK0 A;  4OKJ A;  1CZ9 A;  1RIL A;  3LP1 A;  3I0R A;  4DQI A;  1KTQ A;  4AHC A;  2OPR A;  3AVH A;  4J2A A;  3AO1 A;  4CHZ A;  3CFO A;  3MEE A;  1XWL A;  1S9G A;  1S5J A;  3PO4 A;  4CJ3 A;  4B9T A;  2OZS A;  2PYL A;  1Y97 A;  1T8E A;  4FLU A;  1WN7 A;  4CGF A;  4E7I A;  4M3R A;  3WNG A;  3IG1 A;  4CGJ A;  4DTU A;  1NK9 A;  2BE2 A;  2Y1J A;  1KSP A;  4BWM A;  2Z1H A;  2RF2 A;  3WNF A;  1RBT A;  3CG7 A;  4DU1 A;  3EY1 A;  2O4G A;  4DFM A;  2R7Y A;  2HW3 A;  4E7L A;  2XO7 A;  2Z1I A;  4E7H A;  1TKD A;  1DLO A;  4DSL A;  4FYD A;  4KB1 A;  2WON A;  3SV3 A;  2KTQ A;  1S1U A;  1HYS A;  4M3W A;  3LAK A;  4RW6 A;  4CF8 A;  4DU3 A;  4O5B A;  4DWI A;  1NK6 A;  2IC3 A;  4M41 A;  4M42 A;  3TAP A;  2G8K A;  2EX3 A;  1D5A A;  1RDB A;  3H08 A;  4CED A;  4CF0 A;  3RRG A;  4CGD A;  1VRU A;  3O4N A;  4CJL A;  3EZ5 A;  5J2M A;  1RT5 A;  4N76 A;  1SKW A;  2G8H A;  4B9M A;  4E3S A;  4F4K A;  4F2S A;  1FXX A;  3KK2 A;  4DTX A;  1I3A A;  3VQ9 A;  4PQU A;  4DTR A;  4OPJ A;  4DQQ A;  3VN5 A;  1WSH A;  4KTQ A;  3LWL A;  3OYJ A;  5KGX A;  3RTV A;  2KW4 A;  4DMN A;  3ZT4 A;  3TWH A;  3PY8 A;  3NF9 A;  4FJJ A;  1TKT A;  3SZ2 A;  1U4B A;  4CJR A;  3CM5 A;  3NH0 A;  2Y1I A;  1FK9 A;  2DFF A;  1WNS A;  3C6U A;  3OYL A;  3KD1 E;  4CEZ A;  3SQ4 A;  3DOK A;  1BI4 B;  3DRS A;  3AVJ A;  4ICL A;  4CIF A;  1C0U A;  4B08 A;  4KRE A;  3ZSX A;  3NH1 A;  2XY7 A;  3AVN A;  2FBV A;  3OYE A;  3NCI A;  1JL1 A;  5CYQ A;  4DF4 A;  2IAJ A;  3O4Q A;  4Z4G A;  5I3U A;  1TK8 A;  1EX4 A;  4DQR A;  3MXJ A;  4ELT A;  4RG8 A;  4FZZ A;  3V9X A;  2HHX A;  3O3G A;  1VSJ A;  2Z1J A;  1WSG A;  3OYF A;  1A5V A;  4JRP A;  1KVB A;  3HJF A;  4IDK A;  4DG1 A;  5CZ1 A;  4B9L A;  3LP2 A;  3ZSZ A;  2NUB A;  4DTJ A;  4LSN A;  1L3V A;  4JS4 A;  4CJK A;  4PY5 A;  1RDD A;  1RTH A;  3VA3 A;  1X1P A;  3CQ8 A;  1T05 A;  1TKX A;  3AO5 A;  3QLH A;  4H4M A;  3ZSY A;  2HNZ A;  3S9H A;  3SI6 A;  3I8D A;  4E0D A;  1QSL A;  4M3X A;  2X74 A;  3OYM A;  1N6Q A;  2HHT A;  3KIO A;  3AO2 A;  3V6D A;  3HPH A;  3S3N A;  1C6V A;  1JLG A;  1KCF A;  1REV A;  3LAL A;  3TAR A;  3L2R A;  2HMI A;  3TAB A;  1CXQ A;  4CHP A;  5KRT A;  4FLY A;  2X78 A;  2E6L A;  5K14 A;  1NKC A;  3SPZ A;  3OYA A;  3QO9 A;  2WOM A;  3K5M A;  2Z1G A;  3SUQ A;  2ZQB A;  5CY4 A;  3OJS A;  3AO3 A;  4NYN A;  3V9U A;  4LY7 A;  4FVM A;  4E1N A;  3NGZ A;  1VSI A;  4CJU A;  3QEP A;  3M8Q A;  1ZBF A;  3PX0 A;  4DFK A;  3QET A;  3C94 A;  3OYN A;  1KFD A;  4I2Q A;  4Q5V A;  4DF8 A;  4ZTJ A;  1NK5 A;  1G15 A;  1WSI A;  3F73 A;  4BE1 A;  4BDY A;  5EU7 A;  3UIQ A;  4C8N A;  1A5W A;  4Z4C A;  3ASM A;  4DLE A;  4QAG A;  4CJW A;  4KPY A;  1MU2 A;  3DOL A;  2OYQ A;  2F96 A;  2HHS A;  4DQS A;  4C8O A;  3TAQ A;  3PO5 A;  5E41 A;  3ALY A;  4FM0 A;  3KKS A;  3U3Y A;  2XHB A;  4XIU A;  1VSF A;  3LPU A;  3VQ5 A;  5T7B A;  4EZ6 A;  2HB5 A;  4LSL A;  2QKK A;  4RW9 A;  3AA5 X;  2G8F A;  1KVA A;  1LAW A;  3V9Z A;  3MXM A;  4FJ7 A;  2YNF A;  1WLJ A;  4G1Q A;  1LWF A;  1U45 A;  4FZY A;  2YNG A;  4N5S A;  1QQC A;  4B9N A;  1RDA A;  5FRN A;  4B9V A;  3VQC A;  3VA0 A; 
#chains in the Genus database with same CATH topology
 1HNV A;  4CJT A;  1U49 A;  1NMD A;  5KGW A;  1ITG A;  4AHR A;  2OAN A;  4TSX A;  5JMV A;  5J2N A;  1S1W A;  4E19 A;  3LWM A;  2G8W A;  1XHZ A;  2RPI A;  3AV9 A;  2HHQ A;  3EKS A;  2QWO A;  3A5O C;  1IKV A;  4PWD A;  3DLG A;  1HJR A;  1OKJ A;  3L3V A;  5J1E A;  1BHL A;  5IT9 O;  4Z4H A;  5KTQ A;  4CJF A;  4F2R A;  4KI6 A;  3S3O A;  3UB5 A;  4CVN E;  1C0G A;  1UA1 A;  4IEI A;  4FJI A;  1EET A;  2RN2 A;  4PL8 A;  4Y1C A;  4A2B A;  4CEE A;  1DTQ A;  4DFP A;  4DR6 K;  1UAX A;  1NGD A;  3F9K A;  3V81 A;  1RTJ A;  5C25 A;  1IKW A;  4HTU A;  1L3S A;  3CC7 N;  2P9P A;  2G8I A;  1E3M A;  4DTO A;  5HRN A;  3THY B;  3PX4 A;  1JLA A;  3AVG A;  4AHU A;  4YOX A;  3CYM A;  3LP0 A;  2E2P A;  2D0A A;  4J8F A;  3LL3 A;  3ZYY X;  3SLC A;  3NBP A;  1ZBI A;  3CJ9 A;  4RW4 A;  2CGJ A;  4BRC A;  5JS1 A;  1JCE A;  1ATR A;  3AAP A;  4FJL A;  3D2E B;  2VG5 A;  1NJX A;  2F7T A;  4BRD A;  3OBY A;  5EY4 A;  3I55 N;  5EVZ A;  2UUC K;  4BVP A;  1B9F A;  2BH1 A;  1RDW X;  4YDU A;  3SQ1 A;  3R9P A;  1WB9 A;  4IFE A;  3J81 O;  5AZI A;  1XHX A;  1DTT A;  2Q2R A;  3ISN C;  5FPD A;  2FSN A;  4X64 K;  3E01 A;  3P4I A;  3QEI A;  5M1P A;  2G8U A;  3I0S A;  3CMA N;  2CGL A;  2NRH A;  4BR7 A;  3AA3 A;  3JS6 A;  1VHX A;  1ZBL A;  2P1J A;  1C1A A;  2P9N B;  2V52 B;  4YHH K;  3K2P A;  4W5Q A;  3SBT A;  3OTO K;  4I7F A;  4LF8 K;  3NH2 A;  4KV8 A;  1WSJ A;  4GNI A;  3VET A;  3UE5 A;  1QE1 A;  2FLO A;  2O8D A;  4CGH A;  1VSL A;  4B8A B;  4H4O A;  4H0P A;  4H5V A;  4CBU A;  4WF9 L;  1OH7 A;  4CF2 A;  2QTD A;  4CHY A;  4N56 A;  3O9U A;  4LH5 A;  4CK2 A;  2HBJ A;  2FBX A;  2P5O A;  5AQT A;  4LF9 K;  4Z4E A;  4C23 A;  4LD0 A;  2Q0U A;  5AQL A;  4HCC A;  1C0M A;  4Z4I A;  3KK1 A;  4AM6 A;  5FPE A;  2GUI A;  2BDP A;  4DV5 K;  3ZT0 A;  1EQY A;  4QCL A;  1J5E K;  4FXD A;  3B6P A;  4DV2 K;  2QI2 A;  3HVR A;  1SKS A;  2BGG A;  1S9E A;  4K8X A;  4JI0 K;  2ZGY A;  1NJW A;  2O8F B;  4KAZ A;  2FF6 A;  1WAF A;  1VQ9 N;  1XMO K;  1P8Z A;  4MLE A;  3IS9 A;  4CBW A;  4CHQ A;  1J53 A;  1JLE A;  3HM8 A;  4FK2 A;  4BRI A;  1HMV A;  4CJS A;  2NLX A;  3BEX A;  3FFI A;  1GLF O;  3QEV A;  4H0O A;  1KXP A;  4CFB A;  1RT2 A;  1QVF M;  3P38 A;  2YHA A;  5HLF A;  4FWQ A;  4CK1 A;  3QEX A;  1TAQ A;  4FW2 A;  3TAE A;  2I5J A;  1T7P A;  3S3M A;  5C42 A;  4H0X B;  3AA4 A;  1SL2 A;  2B5J A;  2D0P A;  1QTM A;  3L2W A;  3HOS A;  3F5T A;  5AZJ A;  4I9L A;  4BRN A;  4CHN A;  1JCG A;  3ZSO A;  1NGI A;  2OPP A;  2X6N A;  3VEZ A;  2IVO A;  1W0H A;  1M90 O;  1RDC A;  3C95 A;  2YJF A;  4O4G A;  4A2A A;  3QER A;  4FJ8 A;  4K41 A;  1X3M A;  1VQ4 N;  3P83 D;  3HP9 A;  3OVN A;  4NCG A;  1D9F A;  1SS6 A;  4JD2 A;  3ITH A;  4R79 A;  4BG9 A;  3AA2 A;  2IS3 A;  4CIG A;  1T03 A;  3DI6 A;  1RT4 A;  4JI6 K;  3D7E O;  4K42 A;  4I6M B;  3LDP A;  3NAE A;  3L4Q A;  4DQ8 A;  3WT0 A;  2I7P A;  1MA9 B;  5KPR A;  3PSI A;  3VQQ A;  3H1Q A;  1ZBH A;  4MO5 A;  4E1J A;  4XH4 A;  2A6A A;  4CEF A;  1IKY A;  3K5L A;  1R59 O;  2NRV A;  2E2Q A;  1JJ2 M;  2O8E A;  3QIP A;  2J4R A;  2IIR A;  2CGK A;  2ZWH A;  1GOC A;  3O80 A;  2AJQ A;  1J9A A;  3QBW A;  4C1N K;  1B9D A;  3KLE A;  4O5F A;  3DLH A;  4OGE A;  3H46 O;  1NJZ A;  2E5L K;  3NFA A;  2W41 A;  3WXK A;  4CFC A;  5FLX O;  3V4I A;  3OY9 A;  2IOC A;  1X9J A;  1VQ6 N;  1K9M O;  4BE2 A;  3RMB A;  4JKC A;  3G10 A;  4GMJ B;  3M3Z A;  3CPW M;  4B3M K;  2JWK A;  1DEJ A;  4DR4 K;  1TL1 A;  1W2B M;  4UQG A;  3V1Q A;  1RT7 A;  4HUF A;  3RMA A;  3QEW A;  2JGU A;  2UXD K;  5BRE A;  1HNX K;  4KH5 A;  3ID8 A;  3OYI A;  4CJE A;  5HP1 A;  2WFB A;  3O1B A;  3R3L A;  4K8Z A;  4JHD B;  5BN9 A;  4N47 A;  1ASV A;  3VQD A;  2PAV A;  5CHI A;  2E4L A;  3MN6 A;  4OGC A;  4OJR A;  2IGI A;  3E66 A;  3ZET B;  3OS1 A;  1YUW A;  5HOO A;  4FJH A;  3DRP A;  1X9W A;  3NE6 A;  4OKJ A;  1RIL A;  2P9K A;  2OPR A;  3M1F A;  4CJ3 A;  3TSP A;  4BQL A;  4PKG A;  4E7I A;  4HTL A;  4CGJ A;  1NK9 A;  2BE2 A;  5IWA K;  2Z1H A;  3D6R A;  2Z1I A;  1E4G T;  1DLO A;  3H6E A;  1Q81 O;  4DSL A;  4FYD A;  3CCS N;  2KTQ A;  3SV3 A;  2V7Z A;  1S1U A;  4M3W A;  4CF8 A;  4O5B A;  4DWI A;  1NK6 A;  2IC3 A;  4K25 A;  2G8K A;  2D1K A;  4CF0 A;  3A5N C;  5J2M A;  3L6Q A;  1RT5 A;  4MDB A;  3E9L A;  3VN5 A;  3J8A A;  4KTQ A;  4B1U B;  1KAZ A;  3PY8 A;  4JK8 A;  3EKU A;  3LDQ A;  3ZT4 A;  4U7B A;  4DKW A;  1TKT A;  4CJR A;  3NH0 A;  3KK7 A;  3C6U A;  3ZEU B;  4CZE A;  4BGB A;  3DOK A;  1BI4 B;  2BUP A;  3DRS A;  3H45 C;  3NH1 A;  2XY7 A;  3NCI A;  2FBV A;  1JL1 A;  4M7Y A;  1TK8 A;  1EX4 A;  4DQR A;  3CJA A;  4LC9 B;  2O8B A;  3V9X A;  4IO8 A;  2Z1J A;  3GDQ A;  3OYF A;  1KVB A;  3FLC O;  4IDK A;  4B9L A;  4DTJ A;  4JS4 A;  2PBD A;  3K9K A;  1WOQ A;  4OO1 J;  1TKX A;  4H4M A;  3ZSY A;  3O8M A;  2ZJQ L;  3OYM A;  2HHT A;  3JXU A;  1C6V A;  1JLG A;  3LAL A;  3ZX2 A;  3LM2 A;  4FLY A;  4BRH A;  3DLL L;  3OYA A;  2WOM A;  2Z1G A;  3OJS A;  1NMN A;  1D4X A;  1TYQ B;  4LY7 A;  4FVM A;  4E1N A;  1T3V A;  1QVG M;  4BRQ A;  3EEQ A;  1ZBF A;  1IV0 A;  3OYN A;  1KFD A;  3EN9 A;  2BTF A;  3MX2 A;  5AQO A;  4ZTJ A;  4JK9 A;  1NK5 A;  4JYA K;  4JKD A;  4IDH A;  4Z4C A;  4BC3 A;  4B1V A;  1W7A A;  3EZW A;  4FM0 A;  1N8R O;  5DM7 L;  3KWG A;  5AQI A;  4EHT A;  1VSF A;  2V51 B;  4JAX A;  2HB5 A;  5AQH A;  1KVA A;  4KH6 A;  3MXM A;  1WLJ A;  2YHW A;  1U45 A;  2YNG A;  4N5S A;  4B9N A;  3O9T A;  4B9V A;  1NM1 A;  4JKF A;  2E8A A;  3LP3 A;  3J80 O;  5AQN A;  4IWV A;  3B6O A;  2ETJ A;  3CD6 N;  4EIA A;  4A57 A;  3PIO L;  4KFB A;  3D45 A;  4EFH A;  1QS4 A;  3DXM B;  4B1Z A;  5C15 A;  1E4F T;  5JIC A;  3O9R A;  1EWQ A;  4FLX A;  5SZT A;  4BR2 A;  1VSD A;  3AVI A;  3CCJ N;  1MWK A;  1BQN A;  1TAU A;  4JKA A;  4K43 A;  1VSK A;  3HRG A;  4B9S A;  4HUE A;  1SV5 A;  3CC2 N;  2QXL A;  3VQ7 A;  3O1W A;  2AA4 A;  4IG0 A;  2KQ2 A;  1RBS A;  2QW9 A;  1U6Z A;  1Q9X A;  3BDP A;  1OVQ A;  1ZXO A;  3SK3 A;  1N36 K;  1NGG A;  4CIE A;  3CFR A;  1LV5 A;  4C8K A;  4G9Z A;  4ILH A;  4O0I A;  3NDK A;  4NCA A;  4DHY A;  3U4L A;  5KPT A;  3D2E A;  5LJW A;  4BY9 C;  2HST A;  1LWE A;  2P9L B;  3LPT A;  4B3T K;  2AP1 A;  3OYD A;  3SV4 A;  4EP5 A;  3KLI A;  4AF1 A;  4RW8 A;  3M8S A;  5BRF A;  4DV1 K;  4GVE A;  2YNH A;  3TR8 A;  4Z0U A;  1VRT A;  1TUY A;  3CCQ N;  2DY4 A;  3ENO A;  4NCB A;  3AO4 A;  3RR7 A;  1CZB A;  4KB0 A;  5AQY A;  1V4S A;  1R0A A;  1HX1 A;  4H03 B;  4OVL A;  4AH9 A;  2VG7 A;  3O9Q A;  3DMJ A;  1I39 A;  4YFU A;  1WSF A;  1S22 A;  4KHW A;  3SQ2 A;  2ZE2 A;  1CXU A;  3OYC A;  2P9I B;  4NB4 A;  1NK7 A;  1HPZ A;  4BR0 A;  3TAG A;  4F9O A;  2A42 A;  1ATS A;  3BUZ B;  4BR5 A;  3WXL A;  1NK4 A;  2HBM A;  3DRR A;  3ZSR A;  3VPZ A;  3O5B A;  4OKK A;  1BL3 A;  4ELU A;  4JKG B;  5KQ8 A;  2UYT A;  3SMS A;  2O8C A;  4YNQ A;  1KLM A;  3VGK A;  1IKX A;  3OW2 M;  3L8B A;  4DLG A;  2VQE K;  4M63 C;  5EX5 A;  4B9U A;  1IO2 A;  2ZGZ A;  3SYZ A;  3ZSQ A;  5CR4 A;  2Q0R A;  2VWJ A;  2UXB K;  3VQE A;  1YIJ N;  4Q0B A;  1N5Y A;  3RMD A;  4JRQ A;  3SQ0 A;  3DAW A;  3FZM A;  3HTV A;  3Q7C A;  5GIN A;  4MFB A;  3OS0 A;  1YTU A;  4JS5 A;  1K6Y A;  2WTU A;  3CC4 N;  2FSK A;  4C1N I;  2PY5 A;  1GOB A;  3CJ7 A;  1CZA N;  4CZI A;  1S6P A;  3HPO A;  5E84 A;  4WCE L;  1NNE A;  4AIL C;  1JLQ A;  1HKG A;  4CJV A;  3AVC A;  4HVJ A;  1QZ5 A;  1QSY A;  1Z6R A;  3T19 A;  2YHY A;  4J2E A;  4X66 K;  2PFU A;  2X6S A;  3MX5 A;  4Z94 A;  2FBT A;  1RBR A;  3Q7B A;  1J6Z A;  4DS5 A;  3VQ8 A;  3HK2 A;  1NLV A;  4IKF A;  4GW6 A;  1KC8 O;  1Q8I A;  4HUG A;  1LOT B;  3CCV N;  4DV3 K;  2IVP A;  4CE9 A;  3AVM A;  4CES A;  1S3X A;  4LF5 K;  3OS2 A;  2F8T A;  1WSE A;  2GWJ A;  1IG9 A;  4LF7 K;  2ZD1 A;  1HRH A;  4IFY A;  4I6M A;  3QDK A;  2QXF A;  2OTL N;  1HJO A;  3T1Y K;  2D5R A;  4WFA L;  1BIU A;  3K57 A;  1D8Y A;  4A5B A;  3KLH A;  3AVB A;  5BRH A;  3M8R A;  1BCO A;  4E89 A;  3LZI A;  1YT3 A;  4MQ3 A;  3G25 A;  2NZT A;  1MDU B;  2HF4 A;  4CEC A;  1D9D A;  5J2P A;  1ZYQ A;  3ULD A;  3DYA A;  3JSM A;  3MWP A;  1XC9 A;  4FM1 A;  3ULE B;  1KLN A;  3ZT1 A;  3K5N A;  5GAH P;  2OA8 A;  4OX9 K;  4JI1 K;  3O08 A;  4XH5 A;  2NRW A;  2XY5 A;  4FJX A;  4FWP A;  3QFU A;  3ID6 A;  3CCE N;  4FWO A;  3KK3 A;  4M45 A;  5FDL A;  1BO5 O;  4CZL A;  1Z25 A;  2ATQ A;  2GWK A;  1HNI A;  3THX B;  3IUC A;  1SZ2 A;  4ISG A;  4A5A A;  3J7Y P;  5AQR A;  1JL2 A;  2A1S A;  3N4P A;  5H1S Q;  1HYZ A;  5F1X A;  4JN4 A;  1TL3 A;  3NMU A;  2PYJ A;  4F3T A;  4JKB A;  4KHU A;  1S1X A;  4CCH A;  1HKC A;  4FJK A;  4BGA A;  4IBN A;  1JLC A;  1O1W A;  2E20 A;  1FKO A;  4JHD A;  1Q82 O;  2HHW A;  4ISE A;  3LDS A;  4DTP A;  1U47 A;  4H5N A;  3SNN A;  5FRM A;  3BY5 A;  4O44 A;  1ILY A;  1YIT N;  1HLU A;  4J2D A;  5HBM A;  1SQK A;  1YTA A;  4GV6 A;  4DS4 A;  1BIZ A;  4FCY A;  2Q31 A;  3HVT A;  4FVU A;  3L2Q A;  3SBG A;  4KTW A;  4HWI A;  4DTS A;  4W5O A;  4FZX C;  5DMR A;  1TK0 A;  1S1V A;  4DR2 K;  4FOE A;  4FLZ A;  1VSE A;  1CZ9 A;  2QWR A;  4DQI A;  4AHC A;  3AVH A;  3FR0 A;  2WUS A;  3CFO A;  3IDH A;  3PO4 A;  2E2O A;  3WQT A;  4ISF A;  2YJE A;  2FF3 B;  1Y97 A;  4M3R A;  4DTU A;  3IG1 A;  4BWM A;  5BN8 A;  3WNF A;  1RBT A;  1KD1 O;  1RFQ A;  1BWF O;  2O4G A;  4DFM A;  2HW3 A;  1YAG A;  2XO7 A;  1TKD A;  1VQ7 N;  2WON A;  4YOV A;  3TAP A;  4MDA A;  1D5A A;  3H08 A;  1NBW A;  3RRG A;  4H0Y B;  1VRU A;  4H0T B;  4CJL A;  3EZ5 A;  1SKW A;  4B9M A;  4E3S A;  4DTX A;  1I3A A;  4B1X B;  4IXC A;  4OPJ A;  3ZEU A;  4MLH A;  3L4I A;  3BZC A;  3OYJ A;  2KW4 A;  5EXW A;  2E1Y A;  4DMN A;  5HL7 L;  5FPM A;  2P9P B;  3AY9 A;  1FK9 A;  4NO7 A;  4DR7 K;  4H5R A;  1WUA A;  1OVY A;  4CEZ A;  4ICL A;  4WQ5 C;  4CIF A;  1N34 K;  1C0U A;  3ZX3 A;  3SJH A;  3ZSX A;  5C10 A;  5I3U A;  3HZ6 A;  4ELT A;  5AQX A;  3O3G A;  1NJI O;  1YF5 L;  3BF1 A;  4H5W A;  1VQP N;  3LP2 A;  1L3V A;  3RSE A;  4PY5 A;  1RDD A;  3CQ8 A;  3C0B A;  3IFR A;  3AO5 A;  5AQK A;  1H1V A;  3DJC A;  3WUH A;  3VTI A;  4JKE A;  2Q36 A;  2CH6 A;  5E26 A;  3S3N A;  1KCF A;  1REV A;  4X62 K;  3L2R A;  2HMI A;  1CXQ A;  5KRT A;  1P90 A;  3P39 A;  1NKC A;  3K5M A;  3SUQ A;  2ZQB A;  5CY4 A;  4NYN A;  2WBN A;  4CJU A;  4FOI A;  2D0O A;  1ZC6 A;  1HUX A;  4DFK A;  3C94 A;  4CZG A;  3IKM A;  1U2V A;  3QET A;  3O6W A;  4I2Q A;  4Q5V A;  4DF8 A;  1WSI A;  2Q1N A;  3E9P A;  4DLE A;  4CJW A;  3DOL A;  5AQS A;  2HHS A;  3N4Q A;  4C8O A;  3PO5 A;  3ALY A;  3CQX A;  3KKS A;  2F9T A;  2XHB A;  4XIU A;  2D4W A;  1JCF A;  4EZ6 A;  3AA5 X;  4LF4 K;  3V9Z A;  3K0S A;  4JI4 K;  4OPA A;  3THW B;  4G1Q A;  1LWF A;  4FZY A;  2F9W A;  4BRF A;  1RDA A;  5FRN A;  4IJN A;  3VQC A;  3DXM A;  3MCA B;  1MWM A;  4GY2 B;  4WQ5 A;  3VES A;  1UOC A;  3WXM B;  2F8S A;  3PIP L;  1TV6 A;  3A2F A;  3KLG A;  3UKR B;  3TI0 A;  2UXC K;  4X65 K;  3V9S A;  2KZZ A;  1TGO A;  3ZCM A;  3EO3 A;  4BAC A;  4XH1 A;  3CXC M;  1XUP O;  2XRI A;  3DWL A;  4WQ4 A;  2FC0 A;  3LAM A;  1TVR A;  5BR9 A;  1LAV A;  4WFB L;  4M7X A;  4PKH A;  3DLR A;  5LMU K;  3NF6 A;  4AM7 A;  3HP6 A;  4JNE A;  2KZM A;  1NGF A;  3AGK A;  2Q3S A;  2P9L A;  5I42 A;  4KTZ A;  1CLQ A;  2OPQ A;  4IOC L;  5LY3 A;  5JS2 A;  4DV6 K;  5TKY A;  4I2P A;  2YI1 A;  3DLK A;  3MAQ A;  1VQK N;  4BRE A;  4KHQ A;  2ASP A;  3PV8 A;  4L8R B;  3NF8 A;  1TK5 A;  5C2F A;  1X3N A;  1O13 A;  1S6Q A;  1YJN N;  3J7Z O;  3VEY A;  1BCM A;  2HND A;  2H3G X;  3D2F B;  4BR9 A;  3OYG A;  2D0C A;  3VF2 A;  1VQ8 N;  4BRA A;  3W0L A;  3KTQ A;  4PA1 A;  5C24 A;  5SWM A;  1L3U A;  2O4I A;  2P9U B;  2PZS A;  4LFB K;  1W9H A;  2LSN A;  4CJ4 A;  5GAD P;  3VEV A;  4DSE A;  4YY3 K;  2I7N A;  3ATU A;  4CBX A;  1IBK K;  3P31 A;  4ELV A;  1T6C A;  2E88 A;  3MN7 A;  4HCB A;  4CJ5 A;  4BDP A;  1ZBU A;  4NYF A;  4IOA L;  3AVK A;  1EXQ A;  4JI5 K;  4NLB A;  4U67 L;  1XMQ K;  1HR0 K;  3WQU A;  3CCU N;  2YV0 X;  2O8E B;  4H0V B;  4W5R A;  5LMN K;  2RE2 A;  4JKG A;  1YHQ N;  4BG8 A;  3TAN A;  3ZSW A;  2P5G A;  3WEE B;  4E7J A;  3HOT A;  3PLA A;  1LW0 A;  1NOY A;  3P5J A;  2RHK A;  3VQ6 A;  4CK3 A;  1HQE A;  3L2U A;  3DXK B;  3OBW A;  5HRO A;  2ITG A;  3W3D A;  3OYH A;  1Q7Y O;  4FLT A;  3CQY A;  4OPH A;  2ZJP L;  1BUP A;  1V4T A;  4RWT A;  3QNN A;  1ATN A;  3JYT A;  1RBV A;  2B4J A;  3HXM A;  3SUO A;  1BA1 A;  1Z05 A;  3C65 A;  2IDO A;  5BRD A;  1RBU A;  1VAZ A;  4CHO A;  1YXQ A;  3DM2 A;  3HT3 A;  1DT9 A;  3SUN A;  2KHO A;  1NGA A;  4LH4 A;  3KKR A;  1NJY A;  4C8L A;  3TAF A;  3TTC A;  4E1M A;  5M1O A;  1RCH A;  3VQB A;  1VQN N;  2GBZ A;  2E1Z A;  5D3G A;  3MXI A;  1GLL O;  4CJQ A;  3HSC A;  1SL0 A;  3VQ4 A;  2KFN A;  4FO0 A;  3THY A;  1QHA A;  1VQL N;  4BDZ A;  1U04 A;  2XY6 A;  4R5P A;  2DFE A;  3CME N;  4ID5 A;  2VQF K;  2W6K A;  4B8C A;  4CEA A;  1RTI A;  3ZX0 A;  1K8K B;  4OLB A;  3M5R A;  2OTJ N;  3CJC A;  1X9M A;  4H5T A;  4CF9 A;  1S1T A;  2P9S B;  1K8A O;  5KRS A;  1LW2 A;  4BVO A;  2KKZ A;  3LM9 A;  1YJW N;  2A5X A;  4RCH A;  4DCH A;  3OYB A;  1VSM A;  5AQW A;  3AVA A;  4O8K A;  1GOA A;  2VWK A;  5FPN A;  4HHT A;  1RNH A;  2GUP A;  3SUP A;  1N32 K;  4LFC K;  1JKH A;  1I94 K;  4FJM A;  3M8P A;  3J7A P;  2HOE A;  3HO1 A;  4CEO A;  4CF1 A;  1IJJ A;  4JLH A;  3RRH A;  1L3T A;  4YOT A;  5DK5 A;  5CYM A;  4AHT A;  4OPK A;  4W5T A;  2GEM A;  3VQA A;  3OJU A;  3KHY A;  4GKK K;  4FK4 A;  1BG3 A;  4CER A;  2P9N A;  3G4S N;  4BE0 A;  3TPQ A;  1A5X A;  3NGI A;  5CZ2 A;  3AVL A;  1XC3 A;  3BGR A;  1GLC G;  3VER A;  4CJ7 A;  3T1A A;  4CEB A;  3NVM A;  2JLE A;  1YVN A;  3A0I X;  3PUF A;  4ZTF A;  4CEQ A;  1J54 A;  1KQS M;  4FPB A;  5KQD A;  4WFN L;  2HVI A;  4DTM A;  5AR0 A;  2DPN A;  4BRL A;  5B8H A;  5DM6 L;  4DUZ K;  3VMF B;  5AFU H;  1EP4 A;  3CM6 A;  2NRR A;  1BDG A;  2YX6 A;  4JV5 K;  3OHR A;  3ZT3 A;  3NGY A;  4M3U A;  4DV0 K;  4BRK A;  1SAZ A;  2HVH A;  5M1N A;  4CFD A;  5TKW A;  2A1R A;  3DLE A;  4CZF A;  5C0Y A;  3C7N B;  4FM2 A;  4IG3 A;  2O8F A;  4DSK A;  4FK0 A;  3TU5 A;  2VG6 A;  1G99 A;  2OPS A;  5LL6 Z;  2YHX A;  4FW1 A;  5C2D A;  3D0P A;  4A59 A;  1EKE A;  3HPG A;  1ASU A;  2A41 A;  1T6D A;  3MEC A;  3MEG A;  1BQM A;  4OLA A;  4FWR A;  5HRR A;  3R6M A;  4B3S K;  5KI6 A;  3LP1 A;  4YOY A;  3BZK A;  2F4V K;  3LDL A;  1KTQ A;  4J2A A;  1XWL A;  1S9G A;  4B9T A;  2OZS A;  1T8E A;  4CD1 A;  1WN7 A;  4CGF A;  4FLU A;  3CIP A;  3VEN A;  3WNG A;  2WC9 A;  1KSP A;  2ZM6 K;  4CZH A;  1ESV A;  2ZJR L;  3CG7 A;  4E7H A;  1OH5 A;  5F0X A;  3CJB A;  3LDO A;  4DU3 A;  5M1Q A;  5GAG P;  4M42 A;  2VYP A;  2EX3 A;  4CGD A;  2HMP A;  4NXM K;  1C0F A;  4F4K A;  3VF4 A;  1FXX A;  3KK2 A;  4PQU A;  3VQ9 A;  4DTR A;  3MCP A;  1GLE G;  1WSH A;  3FZH A;  4FL9 A;  4IJA A;  5AFU A;  1S72 N;  3RTV A;  3TWH A;  3NF9 A;  4BQZ A;  2VGM A;  3SZ2 A;  4FWS A;  1U4B A;  3CM5 A;  2QWN A;  1QQM A;  3I8B A;  1WNS A;  2QWQ A;  3SQ4 A;  4JK7 A;  3A5M C;  4B08 A;  4KRE A;  3L0Q A;  4XEI A;  4WYB A;  3OYE A;  5CYQ A;  3O4Q A;  3VEO A;  5M1F A;  4RG8 A;  4FZZ A;  4DV4 K;  2HHX A;  1VSJ A;  1WSG A;  4JRP A;  1A5V A;  1YI2 N;  5AQP A;  3O9S A;  5AQU A;  2NUB A;  1KAX A;  1RTH A;  1X1P A;  1T05 A;  3S9H A;  3SI6 A;  4E0D A;  4M3X A;  2VWB A;  3AO2 A;  5JLH A;  5AQZ A;  3TAR A;  2EWS A;  4CHP A;  4B3R K;  3IMX A;  2X78 A;  1Q18 A;  3QO9 A;  3V9U A;  3H3N O;  3K9J A;  3QEP A;  4JI3 K;  5M1K A;  4BE1 A;  3MDQ A;  3UIQ A;  4BDY A;  5EU7 A;  1A5W A;  4QAG A;  4KPY A;  2OYQ A;  3ATV A;  4DQS A;  4PL7 A;  3VGM A;  5AQQ A;  3THW A;  3LPU A;  3ZET A;  2GTD A;  4LSL A;  4FWM A;  1LCU A;  4IEE A;  4BRM A;  5KPZ A;  2G8F A;  4FJ7 A;  4ILG B;  2YNF A;  3VEX A;  4PHT X;  1IBM K;  3UKU B;  2O8C B;  4CW7 B;  3GOI A;  3MMV A;  3CER A;  3VA0 A;  2GEL A;  1BA0 A;  4JI8 K;  4KHS A;  3IRX A;  3RVC A;  3O3F A;  5JLF A;  3UKR A;  3FZL A;  1BGX T;  4DQP A;  4BRP A;  1NKB A;  1RDU A;  1HNZ K;  3K5O A;  5AQG A;  3QIO A;  3AAR A;  3DLB A;  4DFJ A;  1QZ6 A;  1BU6 O;  2YNI A;  4KI4 A;  1NGJ A;  4O8U A;  3E9O A;  5BPM A;  3SJJ A;  2NRX A;  3RR8 A;  5FRO A;  3SAF A;  3WXJ A;  3F2K A;  3U8X A;  3VEW A;  3GL1 A;  2HNY A;  1F21 A;  3A5L C;  1VQM N;  2Q97 A;  2OZM A;  3JAM O;  4PKI A;  4DU4 A;  1ASW A;  4ZHR A;  4GV3 A;  1C1B A;  4GVM A;  1JXB A;  4BC5 A;  3PSF A;  4FLW A;  1NGH A;  2FSJ A;  4M3T A;  3I33 A;  1BI4 A;  4FJ5 A;  3R8E A;  4C8M A;  3NHG A;  1YJ9 N;  3S41 A;  4F3O A;  1C1C A;  3O3H A;  4PUO A;  1NK0 A;  1HYV A;  4RTF D;  1NGB A;  2GV9 A;  3P1G A;  1RTD A;  3D2F A;  2HHV A;  3ZLJ A;  5AQJ A;  5JVG L;  1LWC A;  1OH8 A;  4W5N A;  2P9U A;  5F2R A;  3I56 N;  3SCX A;  3TSQ A;  1EWR A;  1RT1 A;  3KD5 E;  4O55 A;  3C6H A;  4IO9 L;  4QS9 A;  4IFV A;  4IZ9 A;  4CGI A;  4QS8 A;  2D0B A;  4CFA A;  4Y1D A;  2NNW A;  2W40 A;  2P51 A;  3LAN A;  2NRZ A;  5HRS A;  1W97 L;  1KRP A;  3BP8 A;  4WQ4 C;  1NK8 A;  4FPA A;  1TYQ A;  3FZK A;  3VTH A;  1KFS A;  4J2B A;  3VQP A;  5AZI B;  5BPL A;  5MLC Q;  3WEE A;  2HBL A;  4B3O A;  1IG8 A;  2W6L A;  2YHB A;  1JLB A;  4KRF A;  1SKR A;  1HPM A;  4DSF A;  4BC4 A;  1KVC A;  1HNW K;  2QWP A;  3KJV A;  4FJ9 A;  3DXK A;  4DB3 A;  2DFH A;  4NXN K;  3EE8 A;  4IOX A;  3CCL N;  3H3O B;  3U3G A;  3QES A;  1VQO N;  4B9Q A;  3OYK A;  4H8K A;  2A40 A;  4EHU A;  3TAM A;  2O8D B;  2HBK A;  4NLC A;  3MED A;  3CPE A;  1VQ5 N;  3HYF A;  1HQU A;  3KLF A;  3U6F A;  3CFP A;  5AQM A;  3C6T A;  4M3Z A;  4WE1 A;  5A2Q O;  1XI1 A;  2ZF5 O;  4YOR A;  4BWJ A;  1NKE A;  1NOZ A;  1U48 A;  2YKN A;  4UY8 O;  1BIS A;  3L3U A;  4QS7 A;  1HKB A;  3PX6 A;  1TKZ A;  1Q86 O;  2DTU A;  3GBT A;  4ID1 A;  4FWK A;  1QQN A;  3WNH A;  4KHY A;  1Z26 A;  3E1Y A;  3EL2 A;  3K58 A;  3KWI A;  3NF7 A;  4N41 A;  2QM1 A;  3EYZ A;  1K8K A;  3ZT2 A;  4YOW A;  4FLV A;  4DSJ A;  3NVK A;  1B92 A;  4DR5 K;  3VGL A;  1GLB G;  3QBX A;  4CJP A;  2P9S A;  5ADX H;  4ILJ A;  3ENB A;  5AQF A;  4EAH D;  1X9S A;  3BF3 A;  4AQY K;  1OH6 A;  4DR3 K;  3TTD A;  1JLF A;  5ELZ A;  2E2N A;  1K73 O;  1XNQ K;  1TUU A;  1VSH A;  2QWM A;  2UUB K;  2QK9 A;  1VK0 A;  2HF3 A;  2VGN A;  1NG9 A;  4YOU A;  3WNE A;  3HST B;  2GX9 A;  3V1O A;  3GE1 A;  5AZJ B;  3THV A;  4RW7 A;  4DTN A;  4JKH A;  3HM9 A;  3T7Z A;  1Q9Y A;  2KFZ A;  1L5U A;  4FWN A;  1FKP A;  3ENH A;  3FZF A;  4O0J A;  1QHT A;  1M1K O;  3IAY A;  2E6M A;  3SAH A;  3F9M A;  3CET A;  5GAE P;  4BRG A;  3QNO A;  4B1W B;  1SL1 A;  5JVH L;  3VF6 A;  4JD2 B;  1IH7 A;  4DR1 K;  3LZJ A;  2QEX N;  5HRP A;  4F8R A;  4KKO A;  2RKI A;  5BR8 K;  3FE1 A;  2W42 A;  2P9I A;  3SPY A;  1C0T A;  4CGG A;  3G0Z A;  1GLD G;  4E7K A;  2A3Z A;  4FJG A;  4EP4 A;  4KHN A;  3KVG A;  1JXE A;  1XQS C;  1IBL K;  1RT6 A;  3HI0 A;  5CE3 A;  1NU0 A;  1Y64 A;  4EZ9 A;  2IVN A;  2YCH A;  2XY8 A;  1QSS A;  3QB0 A;  2NRT A;  2BAN A;  3L2V A;  4FWL A;  3KZB A;  1WBD A;  3V1R A;  4KO0 A;  5J2Q A;  1WBB A;  1NGE A;  4I9Q A;  2FBY A;  1T44 A;  4Z4F A;  3RSE B;  2FXU A;  3R1X A;  3V9W A;  2UUA K;  4BRO A;  3QIN A;  3HL8 A;  1UA0 A;  3C7N A;  2VCP A;  4OKE A;  2B6A A;  4QOZ B;  3MWT A;  4CD3 A;  5LJV A;  4FJN A;  4JEP A;  1UWB A;  5ADX A;  4K0K K;  3OA9 A;  2ASO A;  2OCE A;  2EHG A;  1RT3 A;  3RMC A;  1SUQ A;  2ITM A;  4JI2 K;  2HHU A;  2G8V A;  4AHS A;  2JWL A;  4M3Y A;  3A8Y A;  3EE9 A;  3HBT A;  4GKJ K;  1U2V B;  2QWL A;  2QKB A;  1J5O A;  3AGR A;  1NGC A;  4DSI A;  1QQO A;  2CH5 A;  3K59 A;  1DGK N;  2QA4 N;  3AVF A;  4CZM A;  3T3F A;  3G6E N;  3AAQ A;  1WAJ A;  2HHH K;  2YKM A;  4MO4 A;  3RWU A;  1BOT O;  1EO1 A;  4AHV A;  1YVU A;  3ZSV A;  4CI6 A;  5AJ3 K;  4CZJ A;  3I0R A;  3B8A X;  3AO1 A;  4CHZ A;  3MEE A;  1S5J A;  3MN9 A;  4L3Q A;  3O4W A;  2PYL A;  3TSU A;  1RGI A;  2P9K B;  2Y1J A;  2ASM A;  3CF5 L;  2RF2 A;  4DUY K;  4DU1 A;  3EY1 A;  2R7Y A;  4E7L A;  3CCR N;  4BR4 A;  4KB1 A;  3U9Z A;  1HYS A;  4JI7 K;  3LAK A;  4RW6 A;  4B1Y B;  4M41 A;  1RDB A;  4CED A;  3O4N A;  4N76 A;  2G8H A;  4F2S A;  3C6A A;  4FSV A;  4DQQ A;  3MK6 A;  3LWL A;  4V19 S;  5KGX A;  4KHP K;  4CZK A;  4FJJ A;  2KLA A;  2Y1I A;  2DFF A;  3OYL A;  3KD1 E;  1ZBS A;  4A62 A;  3ULE A;  5GIO A;  1NWK A;  3AVJ A;  4BC2 A;  1DKG D;  3AVN A;  4DF4 A;  2IAJ A;  1N33 K;  4Z4G A;  5C12 A;  3MXJ A;  5I9E B;  3SAG A;  3T1H K;  3VOV A;  3HJF A;  5BPN A;  4DG1 A;  5CZ1 A;  3ZSZ A;  4LSN A;  3GG4 A;  1XNR K;  4CJK A;  3THX A;  3QML A;  3QIC A;  2O8B B;  3VA3 A;  3CHW A;  3QLH A;  2HNZ A;  3I8D A;  3QFP A;  1QSL A;  2X74 A;  3TTF A;  3U9D A;  1N6Q A;  3MN5 A;  4GV9 A;  3KIO A;  3V6D A;  3HPH A;  5AQV A;  3TAB A;  4Y0W A;  2E6L A;  3CCM N;  5K14 A;  3SPZ A;  4A61 A;  5GIP A;  3AO3 A;  3FFK B;  3NGZ A;  1VSI A;  1FW6 A;  3LDN A;  3T69 A;  3M8Q A;  3G71 N;  3PX0 A;  1G15 A;  3F73 A;  2V7Y A;  4C8N A;  3M6G A;  3ASM A;  3FGU A;  4DV7 K;  1MU2 A;  2F96 A;  1KAY A;  3TAQ A;  5E41 A;  3H1V X;  3U3Y A;  4LFA K;  3UKU A;  3CI5 A;  2UU9 K;  4KH4 A;  4KBO A;  3VQ5 A;  5T7B A;  3WXI A;  3SMP A;  2QKK A;  1GLA G;  1FJG K;  4RW9 A;  4LF6 K;  1LAW A;  3CJ1 A;  1GLJ O;  5EOY A;  1QQC A;  4YDU C; 
#chains in the Genus database with same CATH homology
 1HNV A;  3LP3 A;  4CJT A;  1U49 A;  4KHS A;  3IRX A;  3O3F A;  5KGW A;  1ITG A;  1UOC A;  3B6O A;  4AHR A;  2ETJ A;  1BGX T;  4TSX A;  4DQP A;  5J2N A;  1NKB A;  1S1W A;  4E19 A;  2F8S A;  4KFB A;  3K5O A;  3LWM A;  2G8W A;  3D45 A;  1QS4 A;  1XHZ A;  3QIO A;  2RPI A;  3AV9 A;  2HHQ A;  3DLB A;  1TV6 A;  3A2F A;  3KLG A;  1IKV A;  4DFJ A;  4PWD A;  4FLX A;  3TI0 A;  5SZT A;  3DLG A;  1HJR A;  2YNI A;  4KI4 A;  1VSD A;  3L3V A;  5J1E A;  1BHL A;  3SJJ A;  3V9S A;  2KZZ A;  1TGO A;  3ZCM A;  3AVI A;  4Z4H A;  4CJF A;  5KTQ A;  5FRO A;  4BAC A;  3RR8 A;  4F2R A;  4KI6 A;  1BQN A;  1TAU A;  3S3O A;  1VSK A;  2XRI A;  4B9S A;  4HUE A;  1SV5 A;  1UA1 A;  4FJI A;  2HNY A;  3VQ7 A;  1EET A;  1F21 A;  2FC0 A;  2RN2 A;  3LAM A;  1TVR A;  4Y1C A;  1LAV A;  4IG0 A;  4CEE A;  2KQ2 A;  1DTQ A;  4DFP A;  3DLR A;  2OZM A;  1UAX A;  3NF6 A;  3F9K A;  4DU4 A;  3HP6 A;  1RBS A;  2KZM A;  1ASW A;  1Q9X A;  4ZHR A;  3BDP A;  3V81 A;  1C1B A;  1RTJ A;  1IKW A;  5C25 A;  4GVM A;  4HTU A;  1L3S A;  2G8I A;  1JXB A;  4DTO A;  2Q3S A;  5HRN A;  3PX4 A;  1JLA A;  5I42 A;  4FLW A;  4KTZ A;  3AVG A;  4CIE A;  3CFR A;  1LV5 A;  4C8K A;  4M3T A;  1CLQ A;  1BI4 A;  4AHU A;  4O0I A;  2OPQ A;  3CYM A;  3LP0 A;  3NDK A;  4FJ5 A;  4NCA A;  5JS2 A;  4C8M A;  3NHG A;  4I2P A;  3DLK A;  2D0A A;  3MAQ A;  1C1C A;  4F3O A;  1LWE A;  4KHQ A;  3O3H A;  4PUO A;  1NK0 A;  1HYV A;  3LPT A;  3PV8 A;  3NBP A;  4L8R B;  1ZBI A;  3NF8 A;  2GV9 A;  1TK5 A;  3P1G A;  4RW4 A;  1RTD A;  2HHV A;  3OYD A;  5JS1 A;  3SV4 A;  4EP5 A;  4FJL A;  1NJX A;  2VG5 A;  1LWC A;  3KLI A;  3M8S A;  4RW8 A;  4W5N A;  3SCX A;  2YNH A;  1S6Q A;  3TR8 A;  1RT1 A;  4Z0U A;  1BCM A;  1VRT A;  2HND A;  4O55 A;  3KD5 E;  3OYG A;  2D0C A;  2DY4 A;  4IFV A;  3KTQ A;  4PA1 A;  5C24 A;  4CGI A;  5SWM A;  1L3U A;  2O4I A;  2D0B A;  4NCB A;  2PZS A;  3AO4 A;  4CFA A;  1B9F A;  4Y1D A;  3RR7 A;  1W9H A;  2LSN A;  1CZB A;  2P51 A;  4CJ4 A;  4KB0 A;  3LAN A;  3SQ1 A;  5HRS A;  4DSE A;  1R0A A;  4OVL A;  1XHX A;  1DTT A;  3ISN C;  4AH9 A;  1KRP A;  2VG7 A;  3E01 A;  3QEI A;  1NK8 A;  2G8U A;  3DMJ A;  1I39 A;  4YFU A;  1WSF A;  4ELV A;  3I0S A;  1KFS A;  4J2B A;  4KHW A;  3VQP A;  3SQ2 A;  2ZE2 A;  4HCB A;  1CXU A;  4CJ5 A;  3OYC A;  4BDP A;  1ZBU A;  3AA3 A;  1ZBL A;  1HPZ A;  1NK7 A;  4NYF A;  4B3O A;  2P1J A;  3AVK A;  1EXQ A;  3TAG A;  2YHB A;  1C1A A;  4W5Q A;  3K2P A;  1JLB A;  2YV0 X;  4KRF A;  4I7F A;  1SKR A;  3NH2 A;  4W5R A;  4DSF A;  1KVC A;  4KV8 A;  3TAN A;  1WSJ A;  3ZSW A;  3KJV A;  4FJ9 A;  2P5G A;  1NK4 A;  4E7J A;  1QE1 A;  3DRR A;  2DFH A;  3ZSR A;  1LW0 A;  4CGH A;  1VSL A;  4B8A B;  1NOY A;  4H4O A;  3P5J A;  3VQ6 A;  4OKK A;  1BL3 A;  3U3G A;  4CK3 A;  3QES A;  4ELU A;  1HQE A;  4CF2 A;  4N56 A;  4CHY A;  3L2U A;  4LH5 A;  3OYK A;  4H8K A;  5HRO A;  4CK2 A;  2ITG A;  4YNQ A;  2FBX A;  3TAM A;  3OYH A;  1KLM A;  4FLT A;  1IKX A;  2P5O A;  3MED A;  4Z4E A;  4LD0 A;  3L8B A;  3QNN A;  3JYT A;  4DLG A;  1C0M A;  1HQU A;  3HYF A;  3KK1 A;  4HCC A;  3KLF A;  4Z4I A;  4B9U A;  1RBV A;  1IO2 A;  2B4J A;  3HXM A;  3SYZ A;  3SUO A;  3ZSQ A;  2GUI A;  3U6F A;  2BDP A;  3CFP A;  2VWJ A;  3ZT0 A;  3VQE A;  4QCL A;  3C6T A;  2IDO A;  4FXD A;  3B6P A;  1N5Y A;  1RBU A;  4M3Z A;  4Q0B A;  4WE1 A;  3HVR A;  3RMD A;  1SKS A;  2BGG A;  4CHO A;  4JRQ A;  1S9E A;  3SQ0 A;  1XI1 A;  4K8X A;  3DM2 A;  4BWJ A;  3HT3 A;  1NJW A;  1NKE A;  3SUN A;  4KAZ A;  1WAF A;  1NOZ A;  4MFB A;  3OS0 A;  1U48 A;  1YTU A;  2YKN A;  1K6Y A;  4JS5 A;  1BIS A;  3L3U A;  3IS9 A;  3PX6 A;  4LH4 A;  1TKZ A;  4CHQ A;  2PY5 A;  1J53 A;  1GOB A;  3KKR A;  1JLE A;  4FK2 A;  2DTU A;  1NJY A;  4C8L A;  1S6P A;  4ID1 A;  3TAF A;  3HPO A;  4E1M A;  1HMV A;  3WNH A;  4CJS A;  1RCH A;  3VQB A;  4AIL C;  4KHY A;  1Z26 A;  3FFI A;  1JLQ A;  3QEV A;  3K58 A;  2GBZ A;  4CFB A;  1RT2 A;  5D3G A;  3NF7 A;  2YHA A;  3AVC A;  4CJV A;  3MXI A;  4HVJ A;  4N41 A;  4CJQ A;  5HLF A;  4CK1 A;  1SL0 A;  1QSY A;  3VQ4 A;  1TAQ A;  4FW2 A;  3ZT2 A;  3EYZ A;  3QEX A;  2KFN A;  3TAE A;  2I5J A;  4FLV A;  4DSJ A;  1T7P A;  1B92 A;  3T19 A;  4BDZ A;  1U04 A;  2XY6 A;  4J2E A;  4R5P A;  2DFE A;  4ID5 A;  3S3M A;  5C42 A;  4CJP A;  4CEA A;  4B8C A;  2X6S A;  3AA4 A;  1RTI A;  1SL2 A;  2FBT A;  1RBR A;  4OLB A;  1X9S A;  2B5J A;  1QTM A;  3L2W A;  4DS5 A;  3VQ8 A;  1JLF A;  1X9M A;  3HK2 A;  4IKF A;  4GW6 A;  1S1T A;  1VSH A;  4CF9 A;  1Q8I A;  4HUG A;  4I9L A;  5KRS A;  1LW2 A;  4CHN A;  2QK9 A;  3ZSO A;  2OPP A;  2X6N A;  1VK0 A;  1W0H A;  3WNE A;  1RDC A;  1VSM A;  3C95 A;  3HST B;  3AVA A;  4O4G A;  4CE9 A;  3OYB A;  3AVM A;  4CES A;  3QER A;  4FJ8 A;  1GOA A;  3V1O A;  2VWK A;  3OS2 A;  3THV A;  4HHT A;  4RW7 A;  4DTN A;  1RNH A;  3P83 D;  3HM9 A;  2F8T A;  1WSE A;  3SUP A;  1IG9 A;  1Q9Y A;  2ZD1 A;  3HP9 A;  1JKH A;  1HRH A;  3OVN A;  4IFY A;  4NCG A;  1L5U A;  4FJM A;  2KFZ A;  2QXF A;  1FKP A;  4O0J A;  1D9F A;  1QHT A;  2D5R A;  3ITH A;  3M8P A;  3IAY A;  3HO1 A;  1BIU A;  2E6M A;  4CEO A;  4CF1 A;  3AA2 A;  3K57 A;  2IS3 A;  4CIG A;  1T03 A;  1D8Y A;  3DI6 A;  4JLH A;  1RT4 A;  3KLH A;  3QNO A;  3RRH A;  1L3T A;  3AVB A;  4FZX C;  3M8R A;  1SL1 A;  1BCO A;  3NAE A;  4E89 A;  3LZI A;  1YT3 A;  4MQ3 A;  1IH7 A;  4F8R A;  3LZJ A;  5HRP A;  5DK5 A;  5CYM A;  4AHT A;  4OPK A;  4KKO A;  3VQQ A;  2RKI A;  4W5T A;  1ZBH A;  3VQA A;  3OJU A;  2W42 A;  3SPY A;  4CEC A;  1D9D A;  1C0T A;  5J2P A;  4CGG A;  4FK4 A;  4CEF A;  4CER A;  3ULD A;  3DYA A;  1ZYQ A;  1IKY A;  3G0Z A;  3JSM A;  3K5L A;  1XC9 A;  4FM1 A;  4E7K A;  4FJG A;  3QIP A;  4EP4 A;  4BE0 A;  1KLN A;  3ZT1 A;  1JXE A;  3K5N A;  4KHN A;  1A5X A;  3NGI A;  2OA8 A;  5CZ2 A;  3AVL A;  1RT6 A;  1GOC A;  2AJQ A;  1J9A A;  3BGR A;  2XY5 A;  4FJX A;  3T1A A;  4EZ9 A;  4CEB A;  1B9D A;  2JLE A;  2XY8 A;  3PUF A;  3KK3 A;  4M45 A;  3KLE A;  2BAN A;  5FDL A;  4ZTF A;  1QSS A;  3DLH A;  4OGE A;  4CEQ A;  3L2V A;  1J54 A;  1NJZ A;  3NFA A;  3V1R A;  4KO0 A;  1Z25 A;  5J2Q A;  2ATQ A;  2HVI A;  4DTM A;  4I9Q A;  2FBY A;  4CFC A;  1HNI A;  4Z4F A;  3V4I A;  3OY9 A;  1EP4 A;  2IOC A;  3CM6 A;  1JL2 A;  2A1S A;  3V9W A;  1HYZ A;  4BE2 A;  3QIN A;  3HL8 A;  3RMB A;  1UA0 A;  3G10 A;  4GMJ B;  3ZT3 A;  3NGY A;  4QOZ B;  1TL3 A;  2B6A A;  4OKE A;  4M3U A;  2PYJ A;  4F3T A;  2HVH A;  4KHU A;  1S1X A;  4CCH A;  4FJN A;  4CFD A;  1UWB A;  2A1R A;  1TL1 A;  3DLE A;  4UQG A;  3V1Q A;  4FJK A;  2EHG A;  1RT3 A;  4IBN A;  1JLC A;  4FM2 A;  1O1W A;  1RT7 A;  1SUQ A;  4IG3 A;  4HUF A;  3RMC A;  3RMA A;  3QEW A;  4DSK A;  2HHU A;  1FKO A;  2JGU A;  2G8V A;  2HHW A;  4AHS A;  3LDS A;  4DTP A;  4M3Y A;  1U47 A;  4FK0 A;  3OYI A;  2QKB A;  4CJE A;  3SNN A;  2VG6 A;  5HP1 A;  5FRM A;  1J5O A;  2OPS A;  4O44 A;  4DSI A;  4K8Z A;  4N47 A;  4J2D A;  5HBM A;  1ASV A;  1YTA A;  3VQD A;  3K59 A;  4FW1 A;  4DS4 A;  2E4L A;  3AVF A;  4OGC A;  1BIZ A;  4OJR A;  3D0P A;  3T3F A;  4FCY A;  1EKE A;  3HPG A;  1WAJ A;  3HVT A;  1ASU A;  2IGI A;  2YKM A;  3L2Q A;  4KTW A;  3OS1 A;  3MEC A;  3MEG A;  3RWU A;  1BQM A;  4DTS A;  4FJH A;  4W5O A;  4OLA A;  3DRP A;  1YVU A;  5DMR A;  3ZSV A;  4AHV A;  1S1V A;  5HRR A;  4FLZ A;  3NE6 A;  1X9W A;  5KI6 A;  1VSE A;  1TK0 A;  4OKJ A;  1CZ9 A;  1RIL A;  3LP1 A;  3I0R A;  4DQI A;  1KTQ A;  4AHC A;  2OPR A;  3AVH A;  4J2A A;  3AO1 A;  4CHZ A;  3CFO A;  3MEE A;  1XWL A;  1S9G A;  1S5J A;  3PO4 A;  4CJ3 A;  4B9T A;  2OZS A;  2PYL A;  1Y97 A;  1T8E A;  4FLU A;  1WN7 A;  4CGF A;  4E7I A;  4M3R A;  3WNG A;  3IG1 A;  4CGJ A;  4DTU A;  1NK9 A;  2BE2 A;  2Y1J A;  1KSP A;  4BWM A;  2Z1H A;  2RF2 A;  3WNF A;  1RBT A;  3CG7 A;  4DU1 A;  3EY1 A;  2O4G A;  4DFM A;  2R7Y A;  2HW3 A;  4E7L A;  2XO7 A;  2Z1I A;  4E7H A;  1TKD A;  1DLO A;  4DSL A;  4FYD A;  4KB1 A;  2WON A;  3SV3 A;  2KTQ A;  1S1U A;  1HYS A;  4M3W A;  3LAK A;  4RW6 A;  4CF8 A;  4DU3 A;  4O5B A;  4DWI A;  1NK6 A;  2IC3 A;  4M41 A;  4M42 A;  3TAP A;  2G8K A;  2EX3 A;  1D5A A;  1RDB A;  3H08 A;  4CED A;  4CF0 A;  3RRG A;  4CGD A;  1VRU A;  3O4N A;  4CJL A;  3EZ5 A;  5J2M A;  1RT5 A;  4N76 A;  1SKW A;  2G8H A;  4B9M A;  4E3S A;  4F4K A;  4F2S A;  1FXX A;  3KK2 A;  4DTX A;  1I3A A;  3VQ9 A;  4PQU A;  4DTR A;  4OPJ A;  4DQQ A;  3VN5 A;  1WSH A;  4KTQ A;  3LWL A;  3OYJ A;  5KGX A;  3RTV A;  2KW4 A;  4DMN A;  3ZT4 A;  3TWH A;  3PY8 A;  3NF9 A;  4FJJ A;  1TKT A;  3SZ2 A;  1U4B A;  4CJR A;  3CM5 A;  3NH0 A;  2Y1I A;  1FK9 A;  2DFF A;  1WNS A;  3C6U A;  3OYL A;  3KD1 E;  4CEZ A;  3SQ4 A;  3DOK A;  1BI4 B;  3DRS A;  3AVJ A;  4ICL A;  4CIF A;  1C0U A;  4B08 A;  4KRE A;  3ZSX A;  3NH1 A;  2XY7 A;  3AVN A;  2FBV A;  3OYE A;  3NCI A;  1JL1 A;  5CYQ A;  4DF4 A;  2IAJ A;  3O4Q A;  4Z4G A;  5I3U A;  1TK8 A;  1EX4 A;  4DQR A;  3MXJ A;  4ELT A;  4RG8 A;  4FZZ A;  3V9X A;  2HHX A;  3O3G A;  1VSJ A;  2Z1J A;  1WSG A;  3OYF A;  1A5V A;  4JRP A;  1KVB A;  3HJF A;  4IDK A;  4DG1 A;  5CZ1 A;  4B9L A;  3LP2 A;  3ZSZ A;  2NUB A;  4DTJ A;  4LSN A;  1L3V A;  4JS4 A;  4CJK A;  4PY5 A;  1RDD A;  1RTH A;  3VA3 A;  1X1P A;  3CQ8 A;  1T05 A;  1TKX A;  3AO5 A;  3QLH A;  4H4M A;  3ZSY A;  2HNZ A;  3S9H A;  3SI6 A;  3I8D A;  4E0D A;  1QSL A;  4M3X A;  2X74 A;  3OYM A;  1N6Q A;  2HHT A;  3KIO A;  3AO2 A;  3V6D A;  3HPH A;  3S3N A;  1C6V A;  1JLG A;  1KCF A;  1REV A;  3LAL A;  3TAR A;  3L2R A;  2HMI A;  3TAB A;  1CXQ A;  4CHP A;  5KRT A;  4FLY A;  2X78 A;  2E6L A;  5K14 A;  1NKC A;  3SPZ A;  3OYA A;  3QO9 A;  2WOM A;  3K5M A;  2Z1G A;  3SUQ A;  2ZQB A;  5CY4 A;  3OJS A;  3AO3 A;  4NYN A;  3V9U A;  4LY7 A;  4FVM A;  4E1N A;  3NGZ A;  1VSI A;  4CJU A;  3QEP A;  3M8Q A;  1ZBF A;  3PX0 A;  4DFK A;  3QET A;  3C94 A;  3OYN A;  1KFD A;  4I2Q A;  4Q5V A;  4DF8 A;  4ZTJ A;  1NK5 A;  1G15 A;  1WSI A;  3F73 A;  4BE1 A;  4BDY A;  5EU7 A;  3UIQ A;  4C8N A;  1A5W A;  4Z4C A;  3ASM A;  4DLE A;  4QAG A;  4CJW A;  4KPY A;  1MU2 A;  3DOL A;  2OYQ A;  2F96 A;  2HHS A;  4DQS A;  4C8O A;  3TAQ A;  3PO5 A;  5E41 A;  3ALY A;  4FM0 A;  3KKS A;  3U3Y A;  2XHB A;  4XIU A;  1VSF A;  3LPU A;  3VQ5 A;  5T7B A;  4EZ6 A;  2HB5 A;  4LSL A;  2QKK A;  4RW9 A;  3AA5 X;  2G8F A;  1KVA A;  1LAW A;  3V9Z A;  3MXM A;  4FJ7 A;  2YNF A;  1WLJ A;  4G1Q A;  1LWF A;  1U45 A;  4FZY A;  2YNG A;  4N5S A;  1QQC A;  4B9N A;  1RDA A;  5FRN A;  4B9V A;  3VQC A;  3VA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...