1A5WA

Asv integrase core domain with hiv-1 integrase inhibitor y3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5wA00
1I39A 1ASUA 1C0TA 4O4GA 3L3UA 1IO2A 1REVA 3LP0A 3SZ2A 3CFOA 4DQIA 4DSJA 3K5MA 3V9XA 4DWIA 1KTQA 3AO2A 1ZBIA 3WNGA 2D0BA 1B9DA 3HT3A 3EY1A 4FM1A 1C1BA 1SKSA 4HCCA 3LZJA 3VN5A 1SV5A 3NGIA 2Y1JA 4IKFA 3U6FA 5J2NA 4CJTA 2IC3A 3KLGA 2G8IA 4FLWA 1HMVA 4DLGA 4O0IA 4OPJA 3RMCA 4LD0A 2X78A 1CXUA 1NJXA 4CEOA 3V4IA 2XY6A 3HK2A 2W42A 1NK9A 3AVJA 1RT1A 4UQGA 3OS0A 4DS5A 3SV4A 4DFPA 3KLIA 4E0DA 4FW2A 2HW3A 2HHUA 2P5GA 1F21A 1WSEA 2DFFA 1C1CA 4IFYA 4CFDA 4L8RB 3NGZA 4FLVA 1YTUA 4CGDA 1RBUA 4KTZA 2X6SA 4E7LA 1ZYQA 5KTQA 3KJVA 3MAQA 4Y1DA 4ELTA 3PV8A 2FC0A 4DSIA 3HPHA 3P83D 4N41A 1NOZA 1CLQA 4CFBA 4KPYA 4Z4FA 4CIFA 3TAQA 3KLFA 4OKKA 3AA4A 4I9QA 4W5NA 5I3UA 4KHWA 4E7KA 1WLJA 2YHBA 1QTMA 3LP1A 1J53A 4MFBA 2G8UA 3V1RA 3AA3A 5HRSA 3SYZA 5JS2A 4FCYA 3AVLA 4M41A 1L3VA 1Q8IA 4FYDA 1N5YA 1D9FA 1ITGA 1WSFA 4OGCA 3OYKA 4AHTA 3LDSA 3QEVA 2OPPA 3NDKA 2IS3A 2X6NA 1UA1A 1TVRA 4C8OA 3LAKA 4NCGA 4FM2A 1KRPA 4CJFA 4Z4EA 1N6QA 1XC9A 4FZZA 3UIQA 3B6OA 4O5BA 1RDAA 1S5JA 1VK0A 3AA2A 1QQCA 4CECA 2HHQA 1TGOA 2FBYA 3HM9A 1GOBA 2HHXA 2YV0X 4DTXA 4M3RA 4YNQA 3NF6A 2QK9A 1WN7A 4ELVA 3KK1A 5JS1A 3HPOA 4M3ZA 5SZTA 4AHUA 2VWJA 2G8FA 4PQUA 3ZSRA 1YT3A 2OPSA 4JS5A 3DLBA 4FVMA 1S1VA 3IAYA 5DK5A 1JLQA 4CF2A 5CYMA 2KFZA 3TAEA 2GBZA 1VSFA 3DOKA 2P51A 3NF9A 4E3SA 4NCAA 1MU2A 3TAMA 2ITGA 3AVGA 4KI6A 4CGFA 4NYFA 2Z1JA 3VQ4A 4FLXA 5CY4A 1XHZA 1RTJA 5KI6A 1Z26A 1Z25A 4CEDA 4W5TA 4AHVA 4CJWA 3WNHA 4KTQA 3DM2A 3L8BA 2RF2A 3G0ZA 4E89A 1ZBLA 3HO1A 3VQ7A 1RCHA 3KD1E 2EHGA 4KB0A 3VQDA 1HRHA 1BQNA 4IBNA 3ZT4A 2D0CA 2Z1IA 3O3HA 3QETA 1U48A 3AVAA 1TK8A 3AO3A 4ID1A 4CGHA 5E41A 5I42A 3K5LA 1IG9A 1FXXA 3NF8A 3AO1A 3MEGA 3RWUA 3TARA 4E19A 1WSJA 4FM0A 4OKJA 5CZ2A 3ZT3A 3NFAA 1RT6A 3SNNA 4FJ9A 3DLHA 1SKWA 1HPZA 2VG5A 3PY8A 1CZBA 4DTJA 1NKEA 3LALA 4BDYA 2GUIA 5C42A 3A2FA 4AILC 4KB1A 4DFMA 3DLKA 1NJYA 1D9DA 3RRGA 2F96A 4OGEA 1BGXT 2B4JA 3SCXA 1KCFA 3C6UA 4HHTA 3S3OA 5EU7A 2DFEA 4XIUA 4DTOA 4CHQA 1NK0A 3VQPA 3PO4A 3TWHA 2P5OA 4FJLA 3OYFA 4I2QA 3F73A 1T7PA 3HVTA 1DTTA 4CEBA 1NK5A 1NK8A 3KLHA 4QAGA 3RTVA 3RR8A 4DG1A 3O3FA 1G15A 3K59A 4DQRA 4M42A 3QINA 1HNIA 4J2EA 5HROA 2R7YA 4KHYA 4FJGA 4DQPA 1NKBA 4B9TA 3PO5A 3QEIA 4O0JA 2Y1IA 2Z1HA 1UAXA 3ASMA 2EX3A 1WAJA 3TAFA 1BCMA 3O3GA 3RMDA 4B08A 3TAGA 4HTUA 3DLGA 1JLCA 1Q9YA 2BDPA 3P5JA 3B6PA 2PZSA 5SWMA 3AV9A 2JGUA 3AVNA 3EYZA 3LP2A 1NK6A 3CFPA 3SI6A 1ZBUA 1VSIA 4HVJA 4C8NA 1VSLA 1IKVA 2ATQA 2D0AA 4IG0A 1RT5A 3LP3A 3SQ1A 2F8TA 1RT7A 2LSNA 4H4MA 3VQ8A 3OYDA 3OYIA 4FZXC 4CGGA 1S9EA 3VQ9A 4B9SA 4FJJA 3SPZA 4PUOA 4MQ3A 1KFSA 1WSHA 3NAEA 4EP4A 1C6VA 3RMBA 1KSPA 1VSHA 1BI4A 3BGRA 4KKOA 1JXEA 4GMJB 3IRXA 4AHSA 4CGJA 4DU4A 4HUEA 3MEDA 4E7JA 3HSTB 2XY8A 1WSIA 1QE1A 1LAVA 2VG7A 4JS4A 2YNIA 4CJUA 3RR7A 4Z4IA 1RTDA 1UOCA 4CCHA 3CM5A 4N76A 4E1NA 1BL3A 5C25A 4CF1A 4CJVA 1B9FA 3RRHA 3AO5A 5D3GA 3LANA 1HQEA 4I7FA 2DTUA 3M8PA 4CFAA 3JSMA 1EKEA 4HUGA 4BE2A 3SUQA 1QSLA 4FJMA 3KKRA 3OYNA 3QEPA 3SUNA 4LH5A 1SUQA 4FXDA 3WNEA 1WAFA 5J1EA 3THVA 4IG3A 1EXQA 2DFHA 3VA3A 4E7IA 3S9HA 1A5WA 3SQ0A 3MXMA 1LV5A 1RBVA 3VQAA 1XI1A 4F4KA 4FJNA 2XY7A 5C24A 2HVHA 4CJEA 2I5JA 4KTWA 3KIOA 1J54A 1LWEA 2KZMA 1NK7A 2IDOA 3HL8A 5K14A 3OYJA 4KAZA 2HMIA 3AO4A 1XWLA 1WNSA 4CEEA 3KLEA 1YVUA 3V6DA 1U45A 4B9NA 4BDPA 4J2DA 1BIUA 2D5RA 3AA5X 1S1WA 3MEEA 5FDLA 4N5SA 4CF9A 2ZQBA 1QS4A 4CHNA 4Q5VA 4CK2A 4BE0A 3L2QA 2KZZA 2BE2A 4H4OA 2RPIA 4Z0UA 4B8CA 3OYEA 1QSSA 4CEZA 4CIGA 3HP9A 1NOYA 1S6PA 1Y97A 3BDPA 4RW6A 4B8AB 1KFDA 1HJRA 1JLGA 2FBTA 4LH4A 4CHPA 2IGIA 4M3YA 1DTQA 1TAQA 3QLHA 4WE1A 4J2BA 1W0HA 4CHZA 4FJKA 3V1OA 4OJRA 3ZSQA 3T19A 1QSYA 2YNFA 1RDDA 3HXMA 4DF8A 3DYAA 4F2RA 1EETA 1RILA 3P1GA 3TANA 3VQEA 3MXIA 2G8WA 2HHTA 2IAJA 3MECA 1FKOA 3ZSZA 5HBMA 4DFKA 4J2AA 4KI4A 2ZD1A 3V9WA 4I9LA 1GOAA 1TL1A 4QCLA 1JKHA 3I0RA 4LY7A 5FRNA 2HHWA 4CFCA 3SV3A 4IDKA 3NBPA 2X74A 4E7HA 1C1AA 3PUFA 4C8MA 1TL3A 4Z4CA 4FJIA 3NH2A 3IG1A 4RG8A 1ASWA 1T8EA 3U3YA 1O1WA 1D8YA 3FFIA 3AVHA 1UA0A 1B92A 2E6MA 3K2PA 1TKXA 4JRQA 4DQQA 4E1MA 3KD5E 1K6YA 3OYMA 4KV8A 4FK2A 4FJ7A 4DSFA 1C0MA 2F8SA 2G8HA 4TSXA 2Z1GA 2QXFA 4M3WA 3M8QA 4AHCA 1IKYA 3PX4A 1TKTA 4M3UA 3I0SA 3VQ5A 4DQSA 1QHTA 3QNOA 3DMJA 3ZSXA 3ZT1A 2OYQA 4DSKA 4OLBA 4F3OA 1JLAA 1ASVA 2XRIA 4FK0A 2KTQA 3V81A 1IH7A 4CK1A 1X9SA 4RW4A 1T05A 1L5UA 4F2SA 4FZYA 2HVIA 4C8KA 1NJZA 4BWMA 4CEFA 4GW6A 4KRFA 4KFBA 1RDCA 5FROA 1LWFA 1S6QA 2DY4A 1LW0A 2YKNA 3KTQA 4JLHA 1RT4A 3SQ4A 1XHXA 3CFRA 1YTAA 1Q9XA 1ZBFA 2Q3SA 4PWDA 3S3MA 1RTHA 4KO0A 1SL2A 2AJQA 1BIZA 3QESA 2O4GA 2HHVA 4QOZB 3KKSA 1EP4A 3V1QA 5KGWA 4CE9A 4G1QA 1GOCA 1ZBHA 4OKEA 5J2MA 1HYZA 1CXQA 3AVBA 4ID5A 2HNDA 1J9AA 3H08A 4ICLA 4N56A 3VQQA 4HUFA 1RBTA 5KGXA 3ALYA 2KW4A 4CGIA 1T03A 3OS1A 2VWKA 3LPUA 2YKMA 4IFVA 2E4LA 4CEQA 4DU3A 4B9UA 1BI4B 4FJ5A 4DS4A 1S1TA 3C6TA 1RT3A 1FKPA 4CERA 3SQ2A 1RDBA 4CK3A 3DLEA 3MXJA 4I2PA 4BE1A 3VA0A 4B9MA 2HHSA 1EX4A 4K8ZA 3HYFA 4DU1A 1KVAA 1X1PA 5HRPA 4PY5A 3OYLA 2B5JA 3TI0A 4H8KA 4FLZA 2XHBA 1HQUA 2FBVA 3OY9A 3T1AA 4ZTFA 3M8SA 3C94A 3K5NA 1IKXA 1KLMA 2GV9A 3PX0A 1KLNA 3NH0A 1BHLA 4AH9A 1S1XA 2WOMA 2ETJA 4AHRA 3QNNA 4NYNA 1R0AA 2QKBA 4CJSA 1RBSA 1VSEA 3OJSA 5KRSA 3OJUA 3VQ6A 4ZTJA 4O55A 4DTNA 3ITHA 2VG6A 3LPTA 3LAMA 3TAPA 4W5QA 4FJXA 3OYBA 1U47A 1TK0A 1C0UA 2O4IA 2RN2A 3DLRA 5CYQA 3HP6A 2OZSA 3VQBA 3TR8A 3M8RA 4CESA 4FLTA 4BDZA 1JL2A 3T3FA 5FRMA 1KVCA 4CF0A 4CJKA 3K57A 2BANA 1VSKA 3JYTA 4Z4HA 2JLEA 4FLUA 2A1RA 3ISNC 1SKRA 4FJHA 1RTIA 3DOLA 4CJRA 3NH1A 2XO7A 4KREA 3E01A 3OS2A 3NCIA 1D5AA 1X9MA 1TV6A 3O4QA 4W5RA 2QKKA 1A5XA 2OPQA 3DI6A 3RMAA 2ZE2A 3OYAA 1JLFA 3QIPA 4CJ4A 3SPYA 5KRTA 4DLEA 1HYVA 1X9WA 1SL1A 4B9VA 4OLAA 3V9SA 1J5OA 3TABA 3QO9A 1TK5A 1HNVA 4Q0BA 1JLEA 3U3GA 2G8VA 1RBRA 3L2RA 4KHNA 2OPRA 3PX6A 2PYJA 2RKIA 1SL0A 5T7BA 3HVRA 1VSMA 4OPKA 4FLYA 4B3OA 1DLOA 3L2WA 1VSJA 3AVCA 3C95A 4FK4A 3G10A 3VQCA 4Z4GA 3OYHA 3ULDA 3CG7A 3NGYA 1TKZA 3ZSWA 1RT2A 4F3TA 1KVBA 3F9KA 4KHQA 3WNFA 3L2UA 3V9ZA 3QERA 1VRTA 1NK4A 3LZIA 4RW7A 2HNZA 3CM6A 3ZT0A 2YHAA 4M45A 1HYSA 4FJ8A 4CF8A 1VSDA 4DTMA 4BACA 3KK3A 3QEWA 5J2PA 2XY5A 4KHUA 2A1SA 4OVLA 4EP5A 3L2VA 2BGGA 1W9HA 1S9GA 2WONA 2PYLA 3AVMA 1BCOA 2KFNA 4BWJA 5HLFA 3EZ5A 4O44A 4CEAA 3AVKA 3D45A 4JRPA 2FBXA 4LSLA 4DSLA 4HCBA 1BQMA 4CJPA 4FW1A 3OYGA 2HB5A 5DMRA 3K5OA 1JL1A 1U49A 3SJJA 1NKCA 4B9LA 3CQ8A 2PY5A 3LWMA 4GVMA 4RW8A 2YNGA 3KK2A 4DMNA 4W5OA 1FK9A 3DRRA 1JLBA 4LSNA 5HRRA 4KHSA 1CZ9A 2B6AA 3AVIA 4CIEA 4DTRA 2NUBA 2YNHA 3CYMA 3O4NA 4C8LA 4M3XA 1IKWA 3NE6A 1I3AA 4ELUA 3IS9A 4ZHRA 5HRNA 1L3SA 5J2QA 5CZ1A 1RNHA 3QIOA 4DFJA 1A5VA 2OA8A 4EZ6A 1VRUA 1L3UA 4CJ5A 3AVFA 3ZSYA 4CJQA 2KQ2A 3DRPA 4Y1CA 3LWLA 3V9UA 4DTSA 3SUPA 4DSEA 4NCBA 3SUOA 3K58A 3S3NA 4DTUA 4RW9A 4CJ3A 3HPGA 4R5PA 1UWBA 3NF7A 1L3TA 3ZSVA 4CJLA 4F8RA 3ZT2A 4YFUA 4DF4A 2IOCA 2P1JA 4PA1A 4CHOA 4M3TA 3OVNA 1JXBA 1WSGA 4EZ9A 3I8DA 3OYCA 1TAUA 4DTPA 1TKDA 1S1UA 5HP1A 2OZMA 1BISA 1U4BA 1NJWA 3DRSA 4K8XA 4N47A 3ZCMA 2HNYA 3NHGA 1LAWA 1LW2A 1U04A 2E6LA 3ZSOA 3D0PA 3QEXA 4CHYA 2G8KA 3HJFA 3L3VA 1LWCA
chains in the Genus database with same CATH superfamily
4BREA 4LF9K 4GV3A 4EHTA 4BG9A 3SZ2A 4DSJA 2CGJA 4Y0WA 3K5MA 1ZBIA 1KTQA 5BREA 3WNGA 2D0BA 3HT3A 3EY1A 1C1BA 3IFRA 4A59A 3VN5A 3KWIA 3HTVA 3U6FA 4JK9A 1Q86O 4CJTA 2G8IA 3CCLN 4X66K 4LD0A 2X78A 4OX9K 3ZX0A 1W2BM 1QZ6A 1TYQB 1MWMA 3AVJA 5BPNA 3O5BA 1RT1A 4UQGA 5AFUH 4DS5A 3IUCA 3KLIA 1HUXA 4FLVA 4E7LA 1ZYQA 4Y1DA 4ELTA 3C0BA 1CZAN 4KPYA 4GNIA 4Z4FA 4OO1J 3KLFA 4I9QA 4W5NA 4KHWA 4E7KA 1WLJA 4CZGA 2G8UA 4M41A 4OGCA 4K0KK 2E2QA 1WOQA 2IS3A 2X6NA 5EOYA 4FM2A 3HBTA 4MLEA 4DV7K 1N6QA 4FZZA 1VQ8N 1NM1A 3B6OA 3QICA 3CF5L 1RDAA 1VK0A 1QQCA 3OBWA 5AQKA 4BR2A 3PIPL 3OHRA 3SMSA 3NF6A 4YNQA 4U7BA 5KQDA 3CPWM 1OH8A 4DCHA 2VWJA 3ZSRA 3GBTA 1JLQA 4CF2A 3TAEA 2P51A 3NF9A 4E3SA 2UU9K 5AQWA 3ATUA 2A40A 1XHZA 5KI6A 3C65A 3WNHA 3D2FB 1ZBLA 2QM1A 2EHGA 1YUWA 4BQLA 3VQDA 5JLFA 1HRHA 1BQNA 2D0CA 5FPNA 1NGHA 4BR4A 1U48A 3AVAA 3AO3A 5E41A 4RCHA 3LM9A 5C12A 4E19A 4FM0A 5LMUK 4OKJA 3ID6A 5F2RA 2ASOA 2GTDA 4ISEA 4LF5K 1HPZA 4BDYA 4O8UA 3VEYA 4AILC 3VTHA 3ULEB 3DLKA 1NJYA 4YOVA 1BGXT 3SCXA 2P9LB 2O8BB 3C6UA 1LCUA 2F9WA 4XIUA 5AQFA 1NK0A 2NNWA 3TWHA 5AQPA 3AGRA 2P5OA 3E1YA 1T7PA 4FJLA 3HVTA 3FZLA 3RTVA 4C1NI 3K59A 1G15A 5GIPA 4M42A 5AQIA 4FJGA 1NKBA 3CQXA 4NLCA 3A5OC 3C6HA 2Y1IA 2Z1HA 1UAXA 4AM7A 1WAJA 1BCMA 4HTUA 2O8DA 4X64K 3AV9A 3FFKB 3CFPA 2HBJA 1ZBUA 4M63C 2LSNA 4FZXC 4CGGA 1S9EA 2A3ZA 3SPZA 3C7NA 3NAEA 1KSPA 4BRAA 1BI4A 2Q1NA 2JWKA 3GE1A 1HKGA 4KKOA 4GMJB 3IRXA 4CGJA 4DU4A 5IWAK 3CXCM 4WYBA 4FWSA 3BF1A 3GDQA 2YNIA 3KVGA 1VQNN 2QWOA 4N76A 1BL3A 1B9FA 3M8PA 4CFAA 3KKRA 3OYNA 2GWJA 4LH5A 4IOXA 5J1EA 4LFAK 4B3OA 4E7IA 5FPMA 4B3RK 2VGMA 3VQAA 2W6LA 1VHXA 4CJEA 4KTWA 2YJEA 3KIOA 1J54A 5F1XA 3D6RA 1WNSA 3KLEA 2FF3B 4K43A 4YOYA 1BIUA 2P9PA 4JKFA 5FDLA 1QS4A 1BA1A 4CHNA 2JWLA 3HI0A 4H4OA 4JNEA 5BRHA 2RPIA 2WC9A 5JMVA 4B8AB 3VOVA 3E9OA 3NMUA 3QLHA 4CHZA 3NVMA 3FLCO 4JI3K 1OKJA 4DF8A 1EETA 1RILA 3O9QA 4K42A 3SBTA 2G8WA 2ZJRL 2ZD1A 3V9WA 4I9LA 2GEMA 1JCFA 1SAZA 1Q7YO 3G4SN 3PUFA 3U9ZA 4Z4CA 2Q0UA 1D8YA 1T44A 1B92A 4JRQA 1TKXA 1BU6O 4ILHA 3D2EA 3OYMA 4KV8A 4FJ7A 4JI5K 2F8SA 4JD2A 4TSXA 4WFNL 4M3WA 4X62K 3PX4A 1NGIA 3E9LA 4M3UA 3I0SA 4DQSA 4JEPA 3ZSXA 3ZT1A 2OYQA 1VQMN 4FK0A 1VQ9N 2A42A 4RW4A 4FZYA 3THXA 2FLOA 5M1QA 4C8KA 2V51B 2V7ZA 4KRFA 5FROA 1LWFA 2DY4A 1GLJO 1VQ6N 4JLHA 3UKUA 3H46O 1VQ5N 2AJQA 1SL2A 2A41A 2O4GA 3KKSA 5KGWA 3KHYA 4BRPA 1HYZA 1CXQA 3AVBA 2ZF5O 4ID5A 5CR4A 3OS1A 2D4WA 4H0YB 4H0PA 4FJ5A 3ZX2A 1GLAG 4PKGA 2FXUA 4WCEL 3DLEA 5AZIA 4CK3A 4BE1A 5GINA 3HYFA 3F2KA 4JKCA 3C94A 4NB4A 3PIOL 3NH0A 2P9NA 1BHLA 1KAXA 1KAZA 2HHHK 1Z6RA 4CZHA 5KPRA 2QKBA 4CJSA 1JJ2M 1VSEA 1Y64A 1IG8A 3LPTA 4WQ5A 4W5QA 3MN6A 3CJ7A 3OYBA 5CYQA 2PFUA 4ISFA 5M1KA 4CESA 3M5RA 4BDZA 3HM8A 2QWNA 4CJKA 4DV0K 2JLEA 3ISNC 1RTIA 3DOLA 3NH1A 4GVEA 2NLXA 2W41A 2OPQA 3RMAA 1JCEA 2WUSA 4H0VB 1HYVA 4IFEA 1TK5A 2BH1A 4NO7A 4EIAA 2OPRA 1SL0A 3HVRA 4F9OA 1DLOA 2NRZA 5A2QO 3DXKA 4KBOA 1YVNA 3F9KA 4BC3A 3CCRN 2F9TA 3WNFA 5AQLA 2UUAK 3V9ZA 3QERA 1VRTA 4EHUA 3LZIA 3DLLL 4M45A 5M1FA 3QDKA 4BROA 4CF8A 3RSEB 3P4IA 4BG8A 1K73O 2YHXA 4PKHA 2A1SA 4OVLA 3L2VA 1W9HA 4M7XA 2PYLA 2KFNA 5AQVA 4BWJA 4JRPA 5IT9O 1G99A 4CJPA 4FW1A 4CZJA 1Q81O 5DMRA 3FZHA 1JL1A 4KHPK 4B9QA 4B9LA 3CQ8A 2PY5A 3LWMA 1OH5A 2YNGA 1JLBA 4KHSA 3E9PA 1LOTB 2ASMA 4H5TA 4CBWA 4ELUA 1I3AA 2A5XA 3IS9A 5KPTA 4BRLA 2P9SA 4WFAL 2Q0RA 1A5VA 3VEZA 3BEXA 3FZMA 3S3NA 3EKSA 3UE5A 3ZSVA 4YFUA 4A5AA 2IOCA 4PA1A 1JXBA 1J5EK 2NRRA 3VEVA 3D0PA 1LW2A 4JI4K 5AR0A 3L3VA 1VQPN 3EZWA 4CJ7A 1MA9B 4O4GA 4B1UB 1NGDA 1REVA 3CJAA 4DQIA 3V9XA 1T6CA 2QXLA 1B9DA 4HCCA 2YHWA 1SV5A 5M1OA 3NGIA 2IC3A 3KLGA 1NJXA 4O0IA 4U67L 3J7AP 1XMQK 4CEOA 2XY6A 3CJ1A 2W42A 1FJGK 3O6WA 3G6EN 3WXKA 3J7YP 3TU5A 1WBDA 1IV0A 4FW2A 5I9EB 1ZC6A 2HW3A 1WSEA 4JKBA 4CGDA 4CZMA 3J7ZO 1RBUA 4KTZA 2X6SA 2O8EA 5KTQA 3KJVA 3MAQA 5GADP 1K8KA 1CLQA 3ZETB 1KXPA 4CIFA 3O1WA 3O08A 1IBKK 4MLHA 5EY4A 3BZCA 3V1RA 3AA3A 3SYZA 5JS2A 4YOWA 1ITGA 1WSFA 4BRNA 3LDSA 2OPPA 1UA1A 3LAKA 4CJFA 3W3DA 4O5BA 2WTUA 3AA2A 4H0OA 4CECA 2HHQA 1TGOA 4A57A 1VQON 4RTFD 2YV0X 3K0SA 3K9KA 4M3RA 3MWPA 5JICA 1WN7A 3KK1A 5JS1A 4DV2K 1SS6A 5DK5A 3T69A 3MN5A 4DR2K 5GAHP 4GKJK 2GELA 3TAMA 1IJJA 3VQ4A 1RTJA 4IEEA 5GAEP 4CEDA 1Z25A 1O13A 3R1XA 4W5TA 4AHVA 3DXMB 3DM2A 2RF2A 4KH4A 1RCHA 5H1SQ 2P9IB 4IBNA 3O3HA 2Z1IA 3QETA 1EQYA 1TK8A 1YXQA 4ID1A 3A5MC 3K5LA 5I42A 1FXXA 3HSCA 3NF8A 1OH7A 5DM6L 3TARA 2UUCK 1GLEG 4FJ9A 1SKWA 2FSNA 5JVHL 4DTJA 4KB1A 4DFMA 1D9DA 4OGEA 1KCFA 4V19S 4BR5A 2YI1A 4DTOA 5BR8K 3PO4A 3PSIA 4I2QA 3F73A 3MDQA 3WXMB 5E26A 1NK5A 4ELVA 3HK2A 3E66A 2VGNA 3O3FA 4IDHA 4J2EA 5HROA 4KHYA 1NBWA 4O0JA 2QA4N 3FGUA 3VGLA 3CC7N 3RMDA 4B08A 3TAGA 1JLCA 1NWKA 2QEXN 4DV1K 2BDPA 3OBYA 3ZLJA 3ENOA 3SJHA 1VSIA 4HVJA 5GAGP 5EVZA 1K8AO 2D0AA 3LP3A 3SQ1A 1RT7A 3OYDA 3OYIA 4H5VA 4A61A 1NNEA 3WEEA 3VQ9A 4DKWA 4MQ3A 1VSHA 4JN4A 3BGRA 3MEDA 3VENA 3HSTB 2VQFK 4RWTA 3D7EO 1TUUA 5HL7L 5C25A 4CJVA 1X3NA 1QZ5A 4WQ5C 5D3GA 5B8HA 1XMOK 4I7FA 4LFCK 3JSMA 1EKEA 4HUGA 3SUQA 4UY8O 3QEPA 4YDUC 1SUQA 4A5BA 4FXDA 1WAFA 4IG3A 2DFHA 3SQ0A 1T6DA 3T1YK 4B1XB 3EE8A 4JKDA 5C24A 4JHDB 2I5JA 2KZMA 1NK7A 4JAXA 4CZLA 3AGKA 5K14A 3OYJA 4KAZA 3SK3A 4B9NA 4N5SA 4CF9A 1DKGD 4Q5VA 3O9TA 4BE0A 4FPAA 3K9JA 4CVNE 1GLDG 4B8CA 4QS9A 4CIGA 3HP9A 1NOYA 3DJCA 1YAGA 2W40A 2P9UB 4BVOA 1HJRA 2FBTA 4M3YA 4J2BA 2J4RA 3EKUA 3V1OA 3EEQA 1RDDA 4F2RA 2HOEA 1XNRK 2HHTA 1FKOA 3ZSZA 5HBMA 4DFKA 4KI4A 5AQJA 2O8FB 1JKHA 3I0RA 2HHWA 4DQ8A 3AARA 4GKKK 3NBPA 5TKYA 4E7HA 1C1AA 3D2EB 1U2VA 2EWSA 3NH2A 4RG8A 1ASWA 3H3NO 2P9KB 1D4XA 1O1WA 2QWLA 3U3YA 2OTJN 5AQTA 3O8MA 5BN9A 3FZFA 1BWFO 3TTDA 4E1MA 3KD5E 4DB3A 4DSFA 5M1NA 1VQLN 4MO4A 4DV5K 4AHCA 1IKYA 3THXB 2PAVA 4BGBA 1QHTA 1JLAA 1ASVA 1OH6A 3MMVA 3UKUB 1YITN 4GW6A 4KFBA 4AQYK 5AQSA 2E2NA 1XHXA 1Q9XA 5AZJB 2CH6A 4BR9A 2Q3SA 3M1FA 4PWDA 1RTHA 5AQZA 3QESA 2FSKA 2PBDA 5AQOA 2CH5A 1GOCA 4O8KA 1ZBHA 4ILJA 2I7NA 3ALYA 2KW4A 4CGIA 3LPUA 4CEQA 1HKBA 3IDHA 4JKGA 3J8AA 4B9UA 3NVKA 4CERA 1FKPA 1RDBA 4YOUA 3VETA 4I2PA 2UXDK 4K8ZA 5HRPA 1X1PA 4PY5A 3H1VX 4FLZA 1HQUA 2FBVA 3OY9A 3T1AA 3SBGA 4A2AA 3M8SA 3K5NA 4B3MK 3W0LA 5FPEA 2GV9A 2UXCK 2WOMA 4AHRA 3QNNA 1R0AA 5AJ3K 2KHOA 5KRSA 5ADXA 4DTNA 2VG6A 1BDGA 3LAMA 3TAPA 1TK0A 1C0UA 2O4IA 2RN2A 1N33K 1YF5L 5FLXO 2OZSA 5C2FA 3CC2N 3M8RA 5FRMA 4FLTA 5F0XA 3K57A 4FLUA 5EX5A 4H0TB 1D5AA 2KLAA 1X9MA 1GLFO 4W5RA 4GY2B 3DI6A 1S3XA 2ZJQL 5AQHA 1JLFA 3SPYA 4CJ4A 3V9SA 3TABA 3N4PA 3QO9A 4Q0BA 4IOCL 5T7BA 4FLYA 1XUPO 4H5NA 1VSJA 3M6GA 1X9JA 3ULDA 4F3TA 1QQOA 1RT2A 4KHQA 4X65K 4FWLA 4B1VA 4BRGA 3VMFB 1NK4A 4RW7A 3LDNA 3ZT0A 4KH5A 2DPNA 4DR4K 4DTMA 2ZGZA 4BACA 4JI1K 5LY3A 3VTIA 2WONA 3FZKA 3AVMA 1P8ZA 5HLFA 3SAFA 4O44A 3CD6N 4DSLA 4WQ4A 1BQMA 3ENBA 5AQNA 3EL2A 4RW8A 4W5OA 1N34K 4LSNA 1CZ9A 3AVIA 4AF1A 4CIEA 3CYMA 4C8LA 4M3XA 2CGLA 3CCEN 5CZ1A 1RNHA 5KQ8A 3QIOA 2HBLA 4DFJA 2VYPA 3L0QA 4YORA 1VQ7N 3ZSYA 4B9MA 4CJQA 2KQ2A 4DTSA 2NRWA 1HJOA 3HPGA 1UWBA 4CBUA 4K41A 4DF4A 3LDLA 3OVNA 1WSGA 4NXNK 3ULEA 4BRHA 2V52B 1BISA 2P9LA 3JS6A 2O8BA 3NHGA 2HNYA 1YJNN 1LAWA 1U04A 2E6LA 2G8KA 3DLHA 4CHYA 3EO3A 3DAWA 1ASUA 3LP0A 1QQMA 3WT0A 2HF4A 4YOXA 3JXUA 1SKSA 4FM1A 4LF6K 1ZXOA 4IZ9A 4FLWA 3LDOA 4WFBL 1HMVA 4DLGA 4GV6A 1DT9A 3V4IA 4OPHA 3QFPA 3F5TA 3OS0A 3HRGA 4LFBK 3SV4A 4NLBA 2HHUA 2DFFA 3THYB 1C1CA 4I6MB 1QVGM 1YTUA 4G9ZA 2HBMA 3P39A 4JI6K 2E20A 3PV8A 3HPHA 3MCPA 4JK8A 2IVPA 4FVUA 3TAQA 4OKKA 5I3UA 3O9SA 4B1WB 1NJIO 5HRSA 3N4QA 4FYDA 1Q8IA 4BGAA 4GV9A 3OYKA 4AHTA 1WBBA 4BRQA 4LC9B 3NDKA 3OTOK 4C8OA 1TVRA 4BRFA 4NCGA 1KRPA 1XC9A 4A62A 3RVCA 3UIQA 1S5JA 2FBYA 3HM9A 3CPEA 2HHXA 4DTXA 3UKRB 4M3ZA 3VGKA 4AHUA 2G8FA 2OPSA 3DLBA 2QI2A 3DOKA 1VSFA 4FWPA 1ATSA 3EE9A 3QFUA 1MDUB 4KI6A 3AVGA 3WQUA 2YJFA 4CGFA 1BG3A 3U8XA 4FLXA 1Z26A 3TSUA 4E89A 3G0ZA 3HO1A 3VQ7A 1RFQA 1Z05A 4FSVA 3AY9A 3Q7BA 3SAHA 1IG9A 2QWRA 3THWB 3WXLA 3FE1A 3WUHA 1NMDA 5CZ2A 1H1VA 1RT6A 3SNNA 1EWRA 5LJWA 3KZBA 1CZBA 1NKEA 3R3LA 3LALA 5C42A 3A2FA 3LDPA 4KH6A 3RRGA 1KQSM 5EU7A 4CW7B 3VQPA 3OYFA 1NMNA 4CEBA 4DG1A 4DQRA 1HNIA 3CJ9A 3VEOA 4B9TA 2D1KA 3ASMA 2EX3A 2HMPA 2E1YA 3O3GA 3A5LC 4FWQA 3DLGA 3TTFA 3VF4A 2GX9A 2PZSA 2JGUA 3EYZA 1YHQN 2ZWHA 1NK6A 2CGKA 4CZFA 2WFBA 1VSLA 4IG0A 2ASPA 2QTDA 4H4MA 3OW2M 1OVQA 4B9SA 4FJJA 1HLUA 4PUOA 1KFSA 1WSHA 1C6VA 3SMPA 2NRTA 4XEIA 4AHSA 4HUEA 3MWTA 2XY8A 1LAVA 3RR7A 2BUPA 3FR0A 1RTDA 4CCHA 3CM5A 4WF9L 3LDQA 4CF1A 3RRHA 3AO5A 3LANA 1HQEA 4C23A 4FJMA 3HZ6A 4BE2A 3O1BA 4H0XB 1RDWX 4FWKA 3SAGA 3THVA 5C2DA 3MXMA 1LV5A 1A5WA 1RBVA 2RE2A 1ATRA 3VGMA 2HVHA 4CI6A 3L4QA 2E5LK 2HMIA 4XH5A 4CEEA 3V6DA 1U45A 1YVUA 4BDPA 4BRKA 5AQRA 2ZQBA 2KZZA 3U9DA 3OYEA 1QSSA 3O9RA 4NXMK 2OCEA 4RW6A 1GLCG 1KFDA 4LF8K 5EXWA 1DTQA 1TAQA 1W0HA 4OJRA 3T19A 3CMAN 1QSYA 3HXMA 3VERA 3P1GA 3TANA 3VQEA 2IAJA 3MECA 2OTLN 1U2VB 1GOAA 1TL1A 4QCLA 2O8CA 4LY7A 4CFCA 4M7YA 2X74A 4A2BA 1V4TA 3RSEA 3IG1A 4DHYA 4DR5K 1T8EA 1BO5O 1YIJN 3L4IA 1UA0A 2E6MA 3K2PA 4DQQA 3B8AX 3CERA 1N32K 4FK2A 1C0MA 1GLBG 2Z1GA 1C0FA 4DV6K 3M8QA 1K9MO 1TKTA 3BUZB 3L6QA 4DSKA 4OLBA 4F3OA 1I94K 1ESVA 2KTQA 3V81A 1X9SA 4CK1A 1L5UA 4F2SA 1TUYA 2ZJPL 2UXBK 4IOAL 2HVIA 4CEFA 2UYTA 3KTQA 3HOSA 1RT4A 3CFRA 1YTAA 4XH4A 4FWMA 3H45C 2O8DB 3C6AA 4KO0A 4IEIA 2HHVA 1S72N 4BC4A 4IXCA 4G1QA 4JKGB 5BRFA 3CC4N 4OKEA 5J2MA 4JKAA 4N56A 1J9AA 3SI6A 4EZ9A 2VWKA 4IFVA 3C7NB 4DU3A 1BI4B 4DS4A 1EO1A 3BF3A 3SQ2A 3VA0A 3CCSN 1EX4A 3J80O 1KVAA 5C15A 3WQTA 3OYLA 4O5FA 1E3MA 4H8KA 1NGCA 2V7YA 4FOEA 1IKXA 4DUZK 3KWGA 4H5RA 3PX0A 1KLNA 1S1XA 2ETJA 4IO9L 1NLVA 2ITMA 1RBSA 3OJSA 5E84A 3OJUA 4ZTJA 4CZKA 3ITHA 1IBLK 4FPBA 3HP6A 3VQBA 3TR8A 5AFUA 4HWIA 5HOOA 4LF7K 2BANA 2A1RA 3VEXA 2P9PB 2IIRA 2XO7A 3NCIA 3CJBA 1TV6A 4BRIA 4YY3K 1HR0K 4LF4K 3EN9A 3PSFA 2ZE2A 3QIPA 1X9WA 4DLEA 1XC3A 4OLAA 1JLEA 2G8VA 3ZETA 3PX6A 2PYJA 2RKIA 4BR7A 1VSMA 4OPKA 3QBXA 3LM2A 3OYHA 5FPDA 1TKZA 1KVBA 3AAQA 1W97L 4JKHA 3CM6A 4ISGA 2YHAA 4JV5K 3LL3A 1VSDA 3QBWA 4FWOA 3KK3A 4IJNA 2E2PA 4QS8A 2VQEK 4PL8A 2XY5A 1U6ZA 1S9GA 4JD2B 3TSPA 5AQMA 3EZ5A 4CEAA 3AVKA 5KPZA 2F7TA 3G25A 4CD1A 2FBXA 3JAMO 3CQYA 4HCBA 2E88A 2RHKA 3OYGA 4BQZA 3K5OA 4FOIA 1NGFA 4GVMA 3KK2A 4JYAK 5C0YA 3DRRA 4BRDA 5HRRA 2YHYA 1SZ2A 3MK6A 4BC5A 3DXMA 5BRDA 5BR9A 4DTRA 2YNHA 1IKWA 2P9IA 3F9MA 1N36K 4ZHRA 1L3SA 1HKCA 4JI2K 4BR0A 2OA8A 2D0PA 4EZ6A 1VRUA 1L3UA 2Q2RA 3LWLA 4Y1CA 2HF3A 3SUPA 1ATNA 4EAHD 3SUOA 3K58A 5LJVA 4K25A 1L3TA 3NF7A 4F8RA 2P1JA 4M3TA 4CHOA 5AZIB 3OYCA 4DTPA 1T3VA 2ZGYA 1HNWK 1VQKN 1NJWA 1VQ4N 4K8XA 3A5NC 4N47A 3ZSOA 3QEXA 2H3GX 4DUYK 3HJFA 1LWCA 2P9NB 2WBNA 1I39A 1C0TA 3L3UA 1IO2A 3CFOA 3ZEUA 4DWIA 3AO2A 4H5WA 5AQGA 3LZJA 4ILGB 2Y1JA 4IKFA 1N8RO 1IBMK 5J2NA 1JCGA 5ADXH 4DR3K 4OPJA 3RMCA 1CXUA 1NK9A 3PLAA 1YJWN 1ILYA 4DFPA 4PKIA 4E0DA 5JLHA 2P5GA 1F21A 4IFYA 4CFDA 4L8RB 3NGZA 1TYQA 1YI2N 1R59O 5JVGL 4BRMA 2OANA 4DSIA 2FC0A 3P83D 3CETA 4N41A 1NOZA 4CFBA 1J6ZA 3AA4A 5GIOA 2YHBA 3DXKB 3LP1A 1J53A 4MFBA 4JK7A 4FCYA 3AVLA 1L3VA 1N5YA 1D9FA 3H1QA 3QEVA 3MCAB 4DR6K 4Z4EA 1NG9A 4JHDA 1GOBA 4R79A 2QK9A 4H03B 2E1ZA 5BN8A 3HPOA 1RGIA 5SZTA 4PQUA 4DR7K 1YT3A 3BP8A 4JS5A 4FVMA 1S1VA 3IAYA 5LL6Z 2KFZA 3GOIA 5CYMA 2GBZA 4NCAA 4IJAA 4HTLA 1MU2A 4DV3K 2ITGA 2P9UA 1S22A 4NYFA 2Z1JA 1NU0A 5CY4A 1Q82O 3GL1A 4CJWA 4KTQA 3L8BA 1BUPA 3KD1E 5C10A 2UUBK 4KB0A 1WB9A 2NRXA 3ZT4A 3I55N 2P9SB 1KC8O 4L3QA 3D2FA 4JI0K 2O8FA 4CGHA 3AO1A 2YX6A 3MEGA 3RWUA 4B3SK 3R6MA 1QQNA 1WSJA 1M90O 1DGKN 3ZT3A 3NFAA 2P9KA 2VG5A 3MX5A 3PY8A 2GUIA 2F96A 1NGBA 4XH1A 2B4JA 4HHTA 3S3OA 2DFEA 4CHQA 5DM7L 1DTTA 1NK8A 3RR8A 3KLHA 4QAGA 3QINA 1QVFM 2R7YA 4DQPA 3P38A 3PO5A 3QEIA 4IO8A 2D0OA 3TAFA 5AZJA 1Q9YA 3P5JA 3B6PA 3O9UA 5SWMA 1YJ9N 2AP1A 3AVNA 3LP2A 3WXIA 4C8NA 2F8TA 1IKVA 2ATQA 1RT5A 4FWRA 3VQ8A 4BVPA 2O8EB 4EP4A 3RMBA 1K8KB 3TSQA 3O4WA 1JXEA 2QWMA 4BRCA 4E7JA 1WSIA 1QE1A 3J81O 2VG7A 4JS4A 4CJUA 4FL9A 4Z4IA 1UOCA 3ID8A 3O80A 4MDAA 4E1NA 2E2OA 3WXJA 3T1HK 2DTUA 2Q31A 1QSLA 1DEJA 1MWKA 3SUNA 5AQQA 3WNEA 4E1JA 1EXQA 4YDUA 3VA3A 1WUAA 3S9HA 1FW6A 4CD3A 1XI1A 4F4KA 4FJNA 2XY7A 2GUPA 3CCJN 1LWEA 2IDOA 3HL8A 2AA4A 3TPQA 3P31A 3ZX3A 3AO4A 1XWLA 1ZBSA 2A6AA 4J2DA 5CHIA 2D5RA 5CE3A 3AA5X 1S1WA 3CCVN 3MEEA 2FF6A 4CK2A 3L2QA 1RDUA 2BE2A 2NRHA 4Z0UA 1HNZK 3IKMA 4CEZA 3MN7A 4B1YB 1S6PA 2F4VK 1Y97A 3BDPA 1JLGA 1BOTO 1SQKA 4LH4A 2IGIA 4CHPA 4WE1A 5LMNK 3CHWA 4FJKA 3ZSQA 2YNFA 5FRNA 4AM6A 3DYAA 5BPMA 2O8CB 3UB5A 3MXIA 4J2AA 1NGEA 5ELZA 1GLLO 1QHAA 2W6KA 3M3ZA 1Q18A 3ZYYX 3SV3A 4IDKA 3CJCA 4C8MA 1TL3A 4FJIA 3AAPA 3FFIA 3AVHA 2HBKA 1K6YA 3HOTA 3SLCA 4B1ZA 2G8HA 3CCMN 1E4FT 1X3MA 2QXFA 4YOTA 1HX1A 3VQ5A 3OA9A 3QNOA 3DMJA 2XRIA 3I8BA 4YHHK 2QWQA 1IH7A 1T05A 4JI8K 2Q36A 2HSTA 1V4SA 3QMLA 3Q7CA 1NJZA 4BWMA 4C1NK 1RDCA 3H3OB 1S6QA 1LW0A 2YKNA 4JI7K 3SQ4A 5AQXA 1KAYA 2I7PA 5TKWA 1ZBFA 3TTCA 3S3MA 3IMXA 1BIZA 2VCPA 1W7AA 2NRVA 4QOZB 3V1QA 1EP4A 4CE9A 3T7ZA 4J8FA 3KK7A 2HNDA 3H08A 4ICLA 4DV4K 4HUFA 3VQQA 1RBTA 5KGXA 1T03A 3DWLA 3WEEB 1HNXK 5AQUA 2YCHA 2YKMA 2E4LA 2VWBA 1S1TA 3C6TA 1EWQA 1RT3A 1QTMA 3H6EA 2HHSA 3MXJA 3MN9A 4DU1A 2B5JA 3ENHA 3TI0A 2XHBA 3CCQN 4ZTFA 1XQSC 1KLMA 3A8YA 4AH9A 3CCUN 4NYNA 2NZTA 3CMEN 2ZM6K 4BC2A 2QW9A 4IWVA 1NGGA 3VQ6A 4O55A 5AQYA 4QS7A 3I33A 4FJXA 1U47A 5BPLA 3DLRA 3T3FA 1JL2A 1KVCA 4CF0A 2FSJA 1VSKA 5M1PA 4Z4HA 3JYTA 1SKRA 4FJHA 4FO0A 3VESA 4CJRA 4CZIA 4EFHA 4KREA 3E01A 3OS2A 1OVYA 5MLCQ 3O4QA 3THYA 4I6MA 2QKKA 1A5XA 2Q97A 4Z94A 4OPAA 3OYAA 4B9VA 5KRTA 1SL1A 1J5OA 1HNVA 3U3GA 3I56N 1RBRA 3L2RA 3BY5A 4KHNA 1VAZA 1C0GA 3L2WA 4FK4A 3AVCA 3C95A 3G10A 3R8EA 3VQCA 4Z4GA 3CG7A 3NGYA 3ZSWA 3QB0A 4JKEA 4FWNA 3L2UA 3U4LA 2HNZA 1E4GT 1XNQK 1HYSA 3MX2A 4FJ8A 4MDBA 3ATVA 2GWKA 3R9PA 3QEWA 5J2PA 4PL7A 3G71N 4KHUA 4EP5A 2BGGA 3UKRA 1BCOA 4WQ4C 3D45A 4BY9C 4LSLA 1BA0A 1NGJA 2BTFA 3GG4A 3S41A 2HB5A 1HPMA 1U49A 3SJJA 1NKCA 2IVNA 4DMNA 3A0IX 1FK9A 4DR1K 2B6AA 4MO5A 2NUBA 3O4NA 2QWPA 3NE6A 3VF6A 1NGAA 5HRNA 5J2QA 3VF2A 3CI5A 1P90A 4CJ5A 3AVFA 3THWA 3DRPA 3V9UA 4DSEA 3VEWA 4DTUA 4RW9A 4CJ3A 4R5PA 4CJLA 3ZT2A 2IVOA 3BZKA 4B3TK 4CZEA 3I8DA 1M1KO 1TAUA 1TKDA 4PHTX 1S1UA 5HP1A 2OZMA 3VPZA 1U4BA 3DRSA 3ZEUB 3ZCMA 4CBXA 4NCBA 2KKZA 3CIPA 2E8AA 1KD1O
chains in the Genus database with same CATH topology
1I39A 1ASUA 1C0TA 4O4GA 3L3UA 1IO2A 1REVA 3LP0A 3SZ2A 3CFOA 4DQIA 4DSJA 3K5MA 3V9XA 4DWIA 1KTQA 3AO2A 1ZBIA 3WNGA 2D0BA 1B9DA 3HT3A 3EY1A 4FM1A 1C1BA 1SKSA 4HCCA 3LZJA 3VN5A 1SV5A 3NGIA 2Y1JA 4IKFA 3U6FA 5J2NA 4CJTA 2IC3A 3KLGA 2G8IA 4FLWA 1HMVA 4DLGA 4O0IA 4OPJA 3RMCA 4LD0A 2X78A 1CXUA 1NJXA 4CEOA 3V4IA 2XY6A 3HK2A 2W42A 1NK9A 3AVJA 1RT1A 4UQGA 3OS0A 4DS5A 3SV4A 4DFPA 3KLIA 4E0DA 4FW2A 2HW3A 2HHUA 2P5GA 1F21A 1WSEA 2DFFA 1C1CA 4IFYA 4CFDA 4L8RB 3NGZA 4FLVA 1YTUA 4CGDA 1RBUA 4KTZA 2X6SA 4E7LA 1ZYQA 5KTQA 3KJVA 3MAQA 4Y1DA 4ELTA 3PV8A 2FC0A 4DSIA 3HPHA 3P83D 4N41A 1NOZA 1CLQA 4CFBA 4KPYA 4Z4FA 4CIFA 3TAQA 3KLFA 4OKKA 3AA4A 4I9QA 4W5NA 5I3UA 4KHWA 4E7KA 1WLJA 2YHBA 1QTMA 3LP1A 1J53A 4MFBA 2G8UA 3V1RA 3AA3A 5HRSA 3SYZA 5JS2A 4FCYA 3AVLA 4M41A 1L3VA 1Q8IA 4FYDA 1N5YA 1D9FA 1ITGA 1WSFA 4OGCA 3OYKA 4AHTA 3LDSA 3QEVA 2OPPA 3NDKA 2IS3A 2X6NA 1UA1A 1TVRA 4C8OA 3LAKA 4NCGA 4FM2A 1KRPA 4CJFA 4Z4EA 1N6QA 1XC9A 4FZZA 3UIQA 3B6OA 4O5BA 1RDAA 1S5JA 1VK0A 3AA2A 1QQCA 4CECA 2HHQA 1TGOA 2FBYA 3HM9A 1GOBA 2HHXA 2YV0X 4DTXA 4M3RA 4YNQA 3NF6A 2QK9A 1WN7A 4ELVA 3KK1A 5JS1A 3HPOA 4M3ZA 5SZTA 4AHUA 2VWJA 2G8FA 4PQUA 3ZSRA 1YT3A 2OPSA 4JS5A 3DLBA 4FVMA 1S1VA 3IAYA 5DK5A 1JLQA 4CF2A 5CYMA 2KFZA 3TAEA 2GBZA 1VSFA 3DOKA 2P51A 3NF9A 4E3SA 4NCAA 1MU2A 3TAMA 2ITGA 3AVGA 4KI6A 4CGFA 4NYFA 2Z1JA 3VQ4A 4FLXA 5CY4A 1XHZA 1RTJA 5KI6A 1Z26A 1Z25A 4CEDA 4W5TA 4AHVA 4CJWA 3WNHA 4KTQA 3DM2A 3L8BA 2RF2A 3G0ZA 4E89A 1ZBLA 3HO1A 3VQ7A 1RCHA 3KD1E 2EHGA 4KB0A 3VQDA 1HRHA 1BQNA 4IBNA 3ZT4A 2D0CA 2Z1IA 3O3HA 3QETA 1U48A 3AVAA 1TK8A 3AO3A 4ID1A 4CGHA 5E41A 5I42A 3K5LA 1IG9A 1FXXA 3NF8A 3AO1A 3MEGA 3RWUA 3TARA 4E19A 1WSJA 4FM0A 4OKJA 5CZ2A 3ZT3A 3NFAA 1RT6A 3SNNA 4FJ9A 3DLHA 1SKWA 1HPZA 2VG5A 3PY8A 1CZBA 4DTJA 1NKEA 3LALA 4BDYA 2GUIA 5C42A 3A2FA 4AILC 4KB1A 4DFMA 3DLKA 1NJYA 1D9DA 3RRGA 2F96A 4OGEA 1BGXT 2B4JA 3SCXA 1KCFA 3C6UA 4HHTA 3S3OA 5EU7A 2DFEA 4XIUA 4DTOA 4CHQA 1NK0A 3VQPA 3PO4A 3TWHA 2P5OA 4FJLA 3OYFA 4I2QA 3F73A 1T7PA 3HVTA 1DTTA 4CEBA 1NK5A 1NK8A 3KLHA 4QAGA 3RTVA 3RR8A 4DG1A 3O3FA 1G15A 3K59A 4DQRA 4M42A 3QINA 1HNIA 4J2EA 5HROA 2R7YA 4KHYA 4FJGA 4DQPA 1NKBA 4B9TA 3PO5A 3QEIA 4O0JA 2Y1IA 2Z1HA 1UAXA 3ASMA 2EX3A 1WAJA 3TAFA 1BCMA 3O3GA 3RMDA 4B08A 3TAGA 4HTUA 3DLGA 1JLCA 1Q9YA 2BDPA 3P5JA 3B6PA 2PZSA 5SWMA 3AV9A 2JGUA 3AVNA 3EYZA 3LP2A 1NK6A 3CFPA 3SI6A 1ZBUA 1VSIA 4HVJA 4C8NA 1VSLA 1IKVA 2ATQA 2D0AA 4IG0A 1RT5A 3LP3A 3SQ1A 2F8TA 1RT7A 2LSNA 4H4MA 3VQ8A 3OYDA 3OYIA 4FZXC 4CGGA 1S9EA 3VQ9A 4B9SA 4FJJA 3SPZA 4PUOA 4MQ3A 1KFSA 1WSHA 3NAEA 4EP4A 1C6VA 3RMBA 1KSPA 1VSHA 1BI4A 3BGRA 4KKOA 1JXEA 4GMJB 3IRXA 4AHSA 4CGJA 4DU4A 4HUEA 3MEDA 4E7JA 3HSTB 2XY8A 1WSIA 1QE1A 1LAVA 2VG7A 4JS4A 2YNIA 4CJUA 3RR7A 4Z4IA 1RTDA 1UOCA 4CCHA 3CM5A 4N76A 4E1NA 1BL3A 5C25A 4CF1A 4CJVA 1B9FA 3RRHA 3AO5A 5D3GA 3LANA 1HQEA 4I7FA 2DTUA 3M8PA 4CFAA 3JSMA 1EKEA 4HUGA 4BE2A 3SUQA 1QSLA 4FJMA 3KKRA 3OYNA 3QEPA 3SUNA 4LH5A 1SUQA 4FXDA 3WNEA 1WAFA 5J1EA 3THVA 4IG3A 1EXQA 2DFHA 3VA3A 4E7IA 3S9HA 1A5WA 3SQ0A 3MXMA 1LV5A 1RBVA 3VQAA 1XI1A 4F4KA 4FJNA 2XY7A 5C24A 2HVHA 4CJEA 2I5JA 4KTWA 3KIOA 1J54A 1LWEA 2KZMA 1NK7A 2IDOA 3HL8A 5K14A 3OYJA 4KAZA 2HMIA 3AO4A 1XWLA 1WNSA 4CEEA 3KLEA 1YVUA 3V6DA 1U45A 4B9NA 4BDPA 4J2DA 1BIUA 2D5RA 3AA5X 1S1WA 3MEEA 5FDLA 4N5SA 4CF9A 2ZQBA 1QS4A 4CHNA 4Q5VA 4CK2A 4BE0A 3L2QA 2KZZA 2BE2A 4H4OA 2RPIA 4Z0UA 4B8CA 3OYEA 1QSSA 4CEZA 4CIGA 3HP9A 1NOYA 1S6PA 1Y97A 3BDPA 4RW6A 4B8AB 1KFDA 1HJRA 1JLGA 2FBTA 4LH4A 4CHPA 2IGIA 4M3YA 1DTQA 1TAQA 3QLHA 4WE1A 4J2BA 1W0HA 4CHZA 4FJKA 3V1OA 4OJRA 3ZSQA 3T19A 1QSYA 2YNFA 1RDDA 3HXMA 4DF8A 3DYAA 4F2RA 1EETA 1RILA 3P1GA 3TANA 3VQEA 3MXIA 2G8WA 2HHTA 2IAJA 3MECA 1FKOA 3ZSZA 5HBMA 4DFKA 4J2AA 4KI4A 2ZD1A 3V9WA 4I9LA 1GOAA 1TL1A 4QCLA 1JKHA 3I0RA 4LY7A 5FRNA 2HHWA 4CFCA 3SV3A 4IDKA 3NBPA 2X74A 4E7HA 1C1AA 3PUFA 4C8MA 1TL3A 4Z4CA 4FJIA 3NH2A 3IG1A 4RG8A 1ASWA 1T8EA 3U3YA 1O1WA 1D8YA 3FFIA 3AVHA 1UA0A 1B92A 2E6MA 3K2PA 1TKXA 4JRQA 4DQQA 4E1MA 3KD5E 1K6YA 3OYMA 4KV8A 4FK2A 4FJ7A 4DSFA 1C0MA 2F8SA 2G8HA 4TSXA 2Z1GA 2QXFA 4M3WA 3M8QA 4AHCA 1IKYA 3PX4A 1TKTA 4M3UA 3I0SA 3VQ5A 4DQSA 1QHTA 3QNOA 3DMJA 3ZSXA 3ZT1A 2OYQA 4DSKA 4OLBA 4F3OA 1JLAA 1ASVA 2XRIA 4FK0A 2KTQA 3V81A 1IH7A 4CK1A 1X9SA 4RW4A 1T05A 1L5UA 4F2SA 4FZYA 2HVIA 4C8KA 1NJZA 4BWMA 4CEFA 4GW6A 4KRFA 4KFBA 1RDCA 5FROA 1LWFA 1S6QA 2DY4A 1LW0A 2YKNA 3KTQA 4JLHA 1RT4A 3SQ4A 1XHXA 3CFRA 1YTAA 1Q9XA 1ZBFA 2Q3SA 4PWDA 3S3MA 1RTHA 4KO0A 1SL2A 2AJQA 1BIZA 3QESA 2O4GA 2HHVA 4QOZB 3KKSA 1EP4A 3V1QA 5KGWA 4CE9A 4G1QA 1GOCA 1ZBHA 4OKEA 5J2MA 1HYZA 1CXQA 3AVBA 4ID5A 2HNDA 1J9AA 3H08A 4ICLA 4N56A 3VQQA 4HUFA 1RBTA 5KGXA 3ALYA 2KW4A 4CGIA 1T03A 3OS1A 2VWKA 3LPUA 2YKMA 4IFVA 2E4LA 4CEQA 4DU3A 4B9UA 1BI4B 4FJ5A 4DS4A 1S1TA 3C6TA 1RT3A 1FKPA 4CERA 3SQ2A 1RDBA 4CK3A 3DLEA 3MXJA 4I2PA 4BE1A 3VA0A 4B9MA 2HHSA 1EX4A 4K8ZA 3HYFA 4DU1A 1KVAA 1X1PA 5HRPA 4PY5A 3OYLA 2B5JA 3TI0A 4H8KA 4FLZA 2XHBA 1HQUA 2FBVA 3OY9A 3T1AA 4ZTFA 3M8SA 3C94A 3K5NA 1IKXA 1KLMA 2GV9A 3PX0A 1KLNA 3NH0A 1BHLA 4AH9A 1S1XA 2WOMA 2ETJA 4AHRA 3QNNA 4NYNA 1R0AA 2QKBA 4CJSA 1RBSA 1VSEA 3OJSA 5KRSA 3OJUA 3VQ6A 4ZTJA 4O55A 4DTNA 3ITHA 2VG6A 3LPTA 3LAMA 3TAPA 4W5QA 4FJXA 3OYBA 1U47A 1TK0A 1C0UA 2O4IA 2RN2A 3DLRA 5CYQA 3HP6A 2OZSA 3VQBA 3TR8A 3M8RA 4CESA 4FLTA 4BDZA 1JL2A 3T3FA 5FRMA 1KVCA 4CF0A 4CJKA 3K57A 2BANA 1VSKA 3JYTA 4Z4HA 2JLEA 4FLUA 2A1RA 3ISNC 1SKRA 4FJHA 1RTIA 3DOLA 4CJRA 3NH1A 2XO7A 4KREA 3E01A 3OS2A 3NCIA 1D5AA 1X9MA 1TV6A 3O4QA 4W5RA 2QKKA 1A5XA 2OPQA 3DI6A 3RMAA 2ZE2A 3OYAA 1JLFA 3QIPA 4CJ4A 3SPYA 5KRTA 4DLEA 1HYVA 1X9WA 1SL1A 4B9VA 4OLAA 3V9SA 1J5OA 3TABA 3QO9A 1TK5A 1HNVA 4Q0BA 1JLEA 3U3GA 2G8VA 1RBRA 3L2RA 4KHNA 2OPRA 3PX6A 2PYJA 2RKIA 1SL0A 5T7BA 3HVRA 1VSMA 4OPKA 4FLYA 4B3OA 1DLOA 3L2WA 1VSJA 3AVCA 3C95A 4FK4A 3G10A 3VQCA 4Z4GA 3OYHA 3ULDA 3CG7A 3NGYA 1TKZA 3ZSWA 1RT2A 4F3TA 1KVBA 3F9KA 4KHQA 3WNFA 3L2UA 3V9ZA 3QERA 1VRTA 1NK4A 3LZIA 4RW7A 2HNZA 3CM6A 3ZT0A 2YHAA 4M45A 1HYSA 4FJ8A 4CF8A 1VSDA 4DTMA 4BACA 3KK3A 3QEWA 5J2PA 2XY5A 4KHUA 2A1SA 4OVLA 4EP5A 3L2VA 2BGGA 1W9HA 1S9GA 2WONA 2PYLA 3AVMA 1BCOA 2KFNA 4BWJA 5HLFA 3EZ5A 4O44A 4CEAA 3AVKA 3D45A 4JRPA 2FBXA 4LSLA 4DSLA 4HCBA 1BQMA 4CJPA 4FW1A 3OYGA 2HB5A 5DMRA 3K5OA 1JL1A 1U49A 3SJJA 1NKCA 4B9LA 3CQ8A 2PY5A 3LWMA 4GVMA 4RW8A 2YNGA 3KK2A 4DMNA 4W5OA 1FK9A 3DRRA 1JLBA 4LSNA 5HRRA 4KHSA 1CZ9A 2B6AA 3AVIA 4CIEA 4DTRA 2NUBA 2YNHA 3CYMA 3O4NA 4C8LA 4M3XA 1IKWA 3NE6A 1I3AA 4ELUA 3IS9A 4ZHRA 5HRNA 1L3SA 5J2QA 5CZ1A 1RNHA 3QIOA 4DFJA 1A5VA 2OA8A 4EZ6A 1VRUA 1L3UA 4CJ5A 3AVFA 3ZSYA 4CJQA 2KQ2A 3DRPA 4Y1CA 3LWLA 3V9UA 4DTSA 3SUPA 4DSEA 4NCBA 3SUOA 3K58A 3S3NA 4DTUA 4RW9A 4CJ3A 3HPGA 4R5PA 1UWBA 3NF7A 1L3TA 3ZSVA 4CJLA 4F8RA 3ZT2A 4YFUA 4DF4A 2IOCA 2P1JA 4PA1A 4CHOA 4M3TA 3OVNA 1JXBA 1WSGA 4EZ9A 3I8DA 3OYCA 1TAUA 4DTPA 1TKDA 1S1UA 5HP1A 2OZMA 1BISA 1U4BA 1NJWA 3DRSA 4K8XA 4N47A 3ZCMA 2HNYA 3NHGA 1LAWA 1LW2A 1U04A 2E6LA 3ZSOA 3D0PA 3QEXA 4CHYA 2G8KA 3HJFA 3L3VA 1LWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I39 A;  1ASU A;  1C0T A;  4O4G A;  3L3U A;  1IO2 A;  1REV A;  3LP0 A;  3SZ2 A;  3CFO A;  4DQI A;  4DSJ A;  3K5M A;  3V9X A;  4DWI A;  1KTQ A;  3AO2 A;  1ZBI A;  3WNG A;  2D0B A;  1B9D A;  3HT3 A;  3EY1 A;  4FM1 A;  1C1B A;  1SKS A;  4HCC A;  3LZJ A;  3VN5 A;  1SV5 A;  3NGI A;  2Y1J A;  4IKF A;  3U6F A;  5J2N A;  4CJT A;  2IC3 A;  3KLG A;  2G8I A;  4FLW A;  1HMV A;  4DLG A;  4O0I A;  4OPJ A;  3RMC A;  4LD0 A;  2X78 A;  1CXU A;  1NJX A;  4CEO A;  3V4I A;  2XY6 A;  3HK2 A;  2W42 A;  1NK9 A;  3AVJ A;  1RT1 A;  4UQG A;  3OS0 A;  4DS5 A;  3SV4 A;  4DFP A;  3KLI A;  4E0D A;  4FW2 A;  2HW3 A;  2HHU A;  2P5G A;  1F21 A;  1WSE A;  2DFF A;  1C1C A;  4IFY A;  4CFD A;  4L8R B;  3NGZ A;  4FLV A;  1YTU A;  4CGD A;  1RBU A;  4KTZ A;  2X6S A;  4E7L A;  1ZYQ A;  5KTQ A;  3KJV A;  3MAQ A;  4Y1D A;  4ELT A;  3PV8 A;  2FC0 A;  4DSI A;  3HPH A;  3P83 D;  4N41 A;  1NOZ A;  1CLQ A;  4CFB A;  4KPY A;  4Z4F A;  4CIF A;  3TAQ A;  3KLF A;  4OKK A;  3AA4 A;  4I9Q A;  4W5N A;  5I3U A;  4KHW A;  4E7K A;  1WLJ A;  2YHB A;  1QTM A;  3LP1 A;  1J53 A;  4MFB A;  2G8U A;  3V1R A;  3AA3 A;  5HRS A;  3SYZ A;  5JS2 A;  4FCY A;  3AVL A;  4M41 A;  1L3V A;  1Q8I A;  4FYD A;  1N5Y A;  1D9F A;  1ITG A;  1WSF A;  4OGC A;  3OYK A;  4AHT A;  3LDS A;  3QEV A;  2OPP A;  3NDK A;  2IS3 A;  2X6N A;  1UA1 A;  1TVR A;  4C8O A;  3LAK A;  4NCG A;  4FM2 A;  1KRP A;  4CJF A;  4Z4E A;  1N6Q A;  1XC9 A;  4FZZ A;  3UIQ A;  3B6O A;  4O5B A;  1RDA A;  1S5J A;  1VK0 A;  3AA2 A;  1QQC A;  4CEC A;  2HHQ A;  1TGO A;  2FBY A;  3HM9 A;  1GOB A;  2HHX A;  2YV0 X;  4DTX A;  4M3R A;  4YNQ A;  3NF6 A;  2QK9 A;  1WN7 A;  4ELV A;  3KK1 A;  5JS1 A;  3HPO A;  4M3Z A;  5SZT A;  4AHU A;  2VWJ A;  2G8F A;  4PQU A;  3ZSR A;  1YT3 A;  2OPS A;  4JS5 A;  3DLB A;  4FVM A;  1S1V A;  3IAY A;  5DK5 A;  1JLQ A;  4CF2 A;  5CYM A;  2KFZ A;  3TAE A;  2GBZ A;  1VSF A;  3DOK A;  2P51 A;  3NF9 A;  4E3S A;  4NCA A;  1MU2 A;  3TAM A;  2ITG A;  3AVG A;  4KI6 A;  4CGF A;  4NYF A;  2Z1J A;  3VQ4 A;  4FLX A;  5CY4 A;  1XHZ A;  1RTJ A;  5KI6 A;  1Z26 A;  1Z25 A;  4CED A;  4W5T A;  4AHV A;  4CJW A;  3WNH A;  4KTQ A;  3DM2 A;  3L8B A;  2RF2 A;  3G0Z A;  4E89 A;  1ZBL A;  3HO1 A;  3VQ7 A;  1RCH A;  3KD1 E;  2EHG A;  4KB0 A;  3VQD A;  1HRH A;  1BQN A;  4IBN A;  3ZT4 A;  2D0C A;  2Z1I A;  3O3H A;  3QET A;  1U48 A;  3AVA A;  1TK8 A;  3AO3 A;  4ID1 A;  4CGH A;  5E41 A;  5I42 A;  3K5L A;  1IG9 A;  1FXX A;  3NF8 A;  3AO1 A;  3MEG A;  3RWU A;  3TAR A;  4E19 A;  1WSJ A;  4FM0 A;  4OKJ A;  5CZ2 A;  3ZT3 A;  3NFA A;  1RT6 A;  3SNN A;  4FJ9 A;  3DLH A;  1SKW A;  1HPZ A;  2VG5 A;  3PY8 A;  1CZB A;  4DTJ A;  1NKE A;  3LAL A;  4BDY A;  2GUI A;  5C42 A;  3A2F A;  4AIL C;  4KB1 A;  4DFM A;  3DLK A;  1NJY A;  1D9D A;  3RRG A;  2F96 A;  4OGE A;  1BGX T;  2B4J A;  3SCX A;  1KCF A;  3C6U A;  4HHT A;  3S3O A;  5EU7 A;  2DFE A;  4XIU A;  4DTO A;  4CHQ A;  1NK0 A;  3VQP A;  3PO4 A;  3TWH A;  2P5O A;  4FJL A;  3OYF A;  4I2Q A;  3F73 A;  1T7P A;  3HVT A;  1DTT A;  4CEB A;  1NK5 A;  1NK8 A;  3KLH A;  4QAG A;  3RTV A;  3RR8 A;  4DG1 A;  3O3F A;  1G15 A;  3K59 A;  4DQR A;  4M42 A;  3QIN A;  1HNI A;  4J2E A;  5HRO A;  2R7Y A;  4KHY A;  4FJG A;  4DQP A;  1NKB A;  4B9T A;  3PO5 A;  3QEI A;  4O0J A;  2Y1I A;  2Z1H A;  1UAX A;  3ASM A;  2EX3 A;  1WAJ A;  3TAF A;  1BCM A;  3O3G A;  3RMD A;  4B08 A;  3TAG A;  4HTU A;  3DLG A;  1JLC A;  1Q9Y A;  2BDP A;  3P5J A;  3B6P A;  2PZS A;  5SWM A;  3AV9 A;  2JGU A;  3AVN A;  3EYZ A;  3LP2 A;  1NK6 A;  3CFP A;  3SI6 A;  1ZBU A;  1VSI A;  4HVJ A;  4C8N A;  1VSL A;  1IKV A;  2ATQ A;  2D0A A;  4IG0 A;  1RT5 A;  3LP3 A;  3SQ1 A;  2F8T A;  1RT7 A;  2LSN A;  4H4M A;  3VQ8 A;  3OYD A;  3OYI A;  4FZX C;  4CGG A;  1S9E A;  3VQ9 A;  4B9S A;  4FJJ A;  3SPZ A;  4PUO A;  4MQ3 A;  1KFS A;  1WSH A;  3NAE A;  4EP4 A;  1C6V A;  3RMB A;  1KSP A;  1VSH A;  1BI4 A;  3BGR A;  4KKO A;  1JXE A;  4GMJ B;  3IRX A;  4AHS A;  4CGJ A;  4DU4 A;  4HUE A;  3MED A;  4E7J A;  3HST B;  2XY8 A;  1WSI A;  1QE1 A;  1LAV A;  2VG7 A;  4JS4 A;  2YNI A;  4CJU A;  3RR7 A;  4Z4I A;  1RTD A;  1UOC A;  4CCH A;  3CM5 A;  4N76 A;  4E1N A;  1BL3 A;  5C25 A;  4CF1 A;  4CJV A;  1B9F A;  3RRH A;  3AO5 A;  5D3G A;  3LAN A;  1HQE A;  4I7F A;  2DTU A;  3M8P A;  4CFA A;  3JSM A;  1EKE A;  4HUG A;  4BE2 A;  3SUQ A;  1QSL A;  4FJM A;  3KKR A;  3OYN A;  3QEP A;  3SUN A;  4LH5 A;  1SUQ A;  4FXD A;  3WNE A;  1WAF A;  5J1E A;  3THV A;  4IG3 A;  1EXQ A;  2DFH A;  3VA3 A;  4E7I A;  3S9H A;  1A5W A;  3SQ0 A;  3MXM A;  1LV5 A;  1RBV A;  3VQA A;  1XI1 A;  4F4K A;  4FJN A;  2XY7 A;  5C24 A;  2HVH A;  4CJE A;  2I5J A;  4KTW A;  3KIO A;  1J54 A;  1LWE A;  2KZM A;  1NK7 A;  2IDO A;  3HL8 A;  5K14 A;  3OYJ A;  4KAZ A;  2HMI A;  3AO4 A;  1XWL A;  1WNS A;  4CEE A;  3KLE A;  1YVU A;  3V6D A;  1U45 A;  4B9N A;  4BDP A;  4J2D A;  1BIU A;  2D5R A;  3AA5 X;  1S1W A;  3MEE A;  5FDL A;  4N5S A;  4CF9 A;  2ZQB A;  1QS4 A;  4CHN A;  4Q5V A;  4CK2 A;  4BE0 A;  3L2Q A;  2KZZ A;  2BE2 A;  4H4O A;  2RPI A;  4Z0U A;  4B8C A;  3OYE A;  1QSS A;  4CEZ A;  4CIG A;  3HP9 A;  1NOY A;  1S6P A;  1Y97 A;  3BDP A;  4RW6 A;  4B8A B;  1KFD A;  1HJR A;  1JLG A;  2FBT A;  4LH4 A;  4CHP A;  2IGI A;  4M3Y A;  1DTQ A;  1TAQ A;  3QLH A;  4WE1 A;  4J2B A;  1W0H A;  4CHZ A;  4FJK A;  3V1O A;  4OJR A;  3ZSQ A;  3T19 A;  1QSY A;  2YNF A;  1RDD A;  3HXM A;  4DF8 A;  3DYA A;  4F2R A;  1EET A;  1RIL A;  3P1G A;  3TAN A;  3VQE A;  3MXI A;  2G8W A;  2HHT A;  2IAJ A;  3MEC A;  1FKO A;  3ZSZ A;  5HBM A;  4DFK A;  4J2A A;  4KI4 A;  2ZD1 A;  3V9W A;  4I9L A;  1GOA A;  1TL1 A;  4QCL A;  1JKH A;  3I0R A;  4LY7 A;  5FRN A;  2HHW A;  4CFC A;  3SV3 A;  4IDK A;  3NBP A;  2X74 A;  4E7H A;  1C1A A;  3PUF A;  4C8M A;  1TL3 A;  4Z4C A;  4FJI A;  3NH2 A;  3IG1 A;  4RG8 A;  1ASW A;  1T8E A;  3U3Y A;  1O1W A;  1D8Y A;  3FFI A;  3AVH A;  1UA0 A;  1B92 A;  2E6M A;  3K2P A;  1TKX A;  4JRQ A;  4DQQ A;  4E1M A;  3KD5 E;  1K6Y A;  3OYM A;  4KV8 A;  4FK2 A;  4FJ7 A;  4DSF A;  1C0M A;  2F8S A;  2G8H A;  4TSX A;  2Z1G A;  2QXF A;  4M3W A;  3M8Q A;  4AHC A;  1IKY A;  3PX4 A;  1TKT A;  4M3U A;  3I0S A;  3VQ5 A;  4DQS A;  1QHT A;  3QNO A;  3DMJ A;  3ZSX A;  3ZT1 A;  2OYQ A;  4DSK A;  4OLB A;  4F3O A;  1JLA A;  1ASV A;  2XRI A;  4FK0 A;  2KTQ A;  3V81 A;  1IH7 A;  4CK1 A;  1X9S A;  4RW4 A;  1T05 A;  1L5U A;  4F2S A;  4FZY A;  2HVI A;  4C8K A;  1NJZ A;  4BWM A;  4CEF A;  4GW6 A;  4KRF A;  4KFB A;  1RDC A;  5FRO A;  1LWF A;  1S6Q A;  2DY4 A;  1LW0 A;  2YKN A;  3KTQ A;  4JLH A;  1RT4 A;  3SQ4 A;  1XHX A;  3CFR A;  1YTA A;  1Q9X A;  1ZBF A;  2Q3S A;  4PWD A;  3S3M A;  1RTH A;  4KO0 A;  1SL2 A;  2AJQ A;  1BIZ A;  3QES A;  2O4G A;  2HHV A;  4QOZ B;  3KKS A;  1EP4 A;  3V1Q A;  5KGW A;  4CE9 A;  4G1Q A;  1GOC A;  1ZBH A;  4OKE A;  5J2M A;  1HYZ A;  1CXQ A;  3AVB A;  4ID5 A;  2HND A;  1J9A A;  3H08 A;  4ICL A;  4N56 A;  3VQQ A;  4HUF A;  1RBT A;  5KGX A;  3ALY A;  2KW4 A;  4CGI A;  1T03 A;  3OS1 A;  2VWK A;  3LPU A;  2YKM A;  4IFV A;  2E4L A;  4CEQ A;  4DU3 A;  4B9U A;  1BI4 B;  4FJ5 A;  4DS4 A;  1S1T A;  3C6T A;  1RT3 A;  1FKP A;  4CER A;  3SQ2 A;  1RDB A;  4CK3 A;  3DLE A;  3MXJ A;  4I2P A;  4BE1 A;  3VA0 A;  4B9M A;  2HHS A;  1EX4 A;  4K8Z A;  3HYF A;  4DU1 A;  1KVA A;  1X1P A;  5HRP A;  4PY5 A;  3OYL A;  2B5J A;  3TI0 A;  4H8K A;  4FLZ A;  2XHB A;  1HQU A;  2FBV A;  3OY9 A;  3T1A A;  4ZTF A;  3M8S A;  3C94 A;  3K5N A;  1IKX A;  1KLM A;  2GV9 A;  3PX0 A;  1KLN A;  3NH0 A;  1BHL A;  4AH9 A;  1S1X A;  2WOM A;  2ETJ A;  4AHR A;  3QNN A;  4NYN A;  1R0A A;  2QKB A;  4CJS A;  1RBS A;  1VSE A;  3OJS A;  5KRS A;  3OJU A;  3VQ6 A;  4ZTJ A;  4O55 A;  4DTN A;  3ITH A;  2VG6 A;  3LPT A;  3LAM A;  3TAP A;  4W5Q A;  4FJX A;  3OYB A;  1U47 A;  1TK0 A;  1C0U A;  2O4I A;  2RN2 A;  3DLR A;  5CYQ A;  3HP6 A;  2OZS A;  3VQB A;  3TR8 A;  3M8R A;  4CES A;  4FLT A;  4BDZ A;  1JL2 A;  3T3F A;  5FRM A;  1KVC A;  4CF0 A;  4CJK A;  3K57 A;  2BAN A;  1VSK A;  3JYT A;  4Z4H A;  2JLE A;  4FLU A;  2A1R A;  3ISN C;  1SKR A;  4FJH A;  1RTI A;  3DOL A;  4CJR A;  3NH1 A;  2XO7 A;  4KRE A;  3E01 A;  3OS2 A;  3NCI A;  1D5A A;  1X9M A;  1TV6 A;  3O4Q A;  4W5R A;  2QKK A;  1A5X A;  2OPQ A;  3DI6 A;  3RMA A;  2ZE2 A;  3OYA A;  1JLF A;  3QIP A;  4CJ4 A;  3SPY A;  5KRT A;  4DLE A;  1HYV A;  1X9W A;  1SL1 A;  4B9V A;  4OLA A;  3V9S A;  1J5O A;  3TAB A;  3QO9 A;  1TK5 A;  1HNV A;  4Q0B A;  1JLE A;  3U3G A;  2G8V A;  1RBR A;  3L2R A;  4KHN A;  2OPR A;  3PX6 A;  2PYJ A;  2RKI A;  1SL0 A;  5T7B A;  3HVR A;  1VSM A;  4OPK A;  4FLY A;  4B3O A;  1DLO A;  3L2W A;  1VSJ A;  3AVC A;  3C95 A;  4FK4 A;  3G10 A;  3VQC A;  4Z4G A;  3OYH A;  3ULD A;  3CG7 A;  3NGY A;  1TKZ A;  3ZSW A;  1RT2 A;  4F3T A;  1KVB A;  3F9K A;  4KHQ A;  3WNF A;  3L2U A;  3V9Z A;  3QER A;  1VRT A;  1NK4 A;  3LZI A;  4RW7 A;  2HNZ A;  3CM6 A;  3ZT0 A;  2YHA A;  4M45 A;  1HYS A;  4FJ8 A;  4CF8 A;  1VSD A;  4DTM A;  4BAC A;  3KK3 A;  3QEW A;  5J2P A;  2XY5 A;  4KHU A;  2A1S A;  4OVL A;  4EP5 A;  3L2V A;  2BGG A;  1W9H A;  1S9G A;  2WON A;  2PYL A;  3AVM A;  1BCO A;  2KFN A;  4BWJ A;  5HLF A;  3EZ5 A;  4O44 A;  4CEA A;  3AVK A;  3D45 A;  4JRP A;  2FBX A;  4LSL A;  4DSL A;  4HCB A;  1BQM A;  4CJP A;  4FW1 A;  3OYG A;  2HB5 A;  5DMR A;  3K5O A;  1JL1 A;  1U49 A;  3SJJ A;  1NKC A;  4B9L A;  3CQ8 A;  2PY5 A;  3LWM A;  4GVM A;  4RW8 A;  2YNG A;  3KK2 A;  4DMN A;  4W5O A;  1FK9 A;  3DRR A;  1JLB A;  4LSN A;  5HRR A;  4KHS A;  1CZ9 A;  2B6A A;  3AVI A;  4CIE A;  4DTR A;  2NUB A;  2YNH A;  3CYM A;  3O4N A;  4C8L A;  4M3X A;  1IKW A;  3NE6 A;  1I3A A;  4ELU A;  3IS9 A;  4ZHR A;  5HRN A;  1L3S A;  5J2Q A;  5CZ1 A;  1RNH A;  3QIO A;  4DFJ A;  1A5V A;  2OA8 A;  4EZ6 A;  1VRU A;  1L3U A;  4CJ5 A;  3AVF A;  3ZSY A;  4CJQ A;  2KQ2 A;  3DRP A;  4Y1C A;  3LWL A;  3V9U A;  4DTS A;  3SUP A;  4DSE A;  4NCB A;  3SUO A;  3K58 A;  3S3N A;  4DTU A;  4RW9 A;  4CJ3 A;  3HPG A;  4R5P A;  1UWB A;  3NF7 A;  1L3T A;  3ZSV A;  4CJL A;  4F8R A;  3ZT2 A;  4YFU A;  4DF4 A;  2IOC A;  2P1J A;  4PA1 A;  4CHO A;  4M3T A;  3OVN A;  1JXB A;  1WSG A;  4EZ9 A;  3I8D A;  3OYC A;  1TAU A;  4DTP A;  1TKD A;  1S1U A;  5HP1 A;  2OZM A;  1BIS A;  1U4B A;  1NJW A;  3DRS A;  4K8X A;  4N47 A;  3ZCM A;  2HNY A;  3NHG A;  1LAW A;  1LW2 A;  1U04 A;  2E6L A;  3ZSO A;  3D0P A;  3QEX A;  4CHY A;  2G8K A;  3HJF A;  3L3V A;  1LWC A; 
#chains in the Genus database with same CATH topology
 4BRE A;  4LF9 K;  4GV3 A;  4EHT A;  4BG9 A;  3SZ2 A;  4DSJ A;  2CGJ A;  4Y0W A;  3K5M A;  1ZBI A;  1KTQ A;  5BRE A;  3WNG A;  2D0B A;  3HT3 A;  3EY1 A;  1C1B A;  3IFR A;  4A59 A;  3VN5 A;  3KWI A;  3HTV A;  3U6F A;  4JK9 A;  1Q86 O;  4CJT A;  2G8I A;  3CCL N;  4X66 K;  4LD0 A;  2X78 A;  4OX9 K;  3ZX0 A;  1W2B M;  1QZ6 A;  1TYQ B;  1MWM A;  3AVJ A;  5BPN A;  3O5B A;  1RT1 A;  4UQG A;  5AFU H;  4DS5 A;  3IUC A;  3KLI A;  1HUX A;  4FLV A;  4E7L A;  1ZYQ A;  4Y1D A;  4ELT A;  3C0B A;  1CZA N;  4KPY A;  4GNI A;  4Z4F A;  4OO1 J;  3KLF A;  4I9Q A;  4W5N A;  4KHW A;  4E7K A;  1WLJ A;  4CZG A;  2G8U A;  4M41 A;  4OGC A;  4K0K K;  2E2Q A;  1WOQ A;  2IS3 A;  2X6N A;  5EOY A;  4FM2 A;  3HBT A;  4MLE A;  4DV7 K;  1N6Q A;  4FZZ A;  1VQ8 N;  1NM1 A;  3B6O A;  3QIC A;  3CF5 L;  1RDA A;  1VK0 A;  1QQC A;  3OBW A;  5AQK A;  4BR2 A;  3PIP L;  3OHR A;  3SMS A;  3NF6 A;  4YNQ A;  4U7B A;  5KQD A;  3CPW M;  1OH8 A;  4DCH A;  2VWJ A;  3ZSR A;  3GBT A;  1JLQ A;  4CF2 A;  3TAE A;  2P51 A;  3NF9 A;  4E3S A;  2UU9 K;  5AQW A;  3ATU A;  2A40 A;  1XHZ A;  5KI6 A;  3C65 A;  3WNH A;  3D2F B;  1ZBL A;  2QM1 A;  2EHG A;  1YUW A;  4BQL A;  3VQD A;  5JLF A;  1HRH A;  1BQN A;  2D0C A;  5FPN A;  1NGH A;  4BR4 A;  1U48 A;  3AVA A;  3AO3 A;  5E41 A;  4RCH A;  3LM9 A;  5C12 A;  4E19 A;  4FM0 A;  5LMU K;  4OKJ A;  3ID6 A;  5F2R A;  2ASO A;  2GTD A;  4ISE A;  4LF5 K;  1HPZ A;  4BDY A;  4O8U A;  3VEY A;  4AIL C;  3VTH A;  3ULE B;  3DLK A;  1NJY A;  4YOV A;  1BGX T;  3SCX A;  2P9L B;  2O8B B;  3C6U A;  1LCU A;  2F9W A;  4XIU A;  5AQF A;  1NK0 A;  2NNW A;  3TWH A;  5AQP A;  3AGR A;  2P5O A;  3E1Y A;  1T7P A;  4FJL A;  3HVT A;  3FZL A;  3RTV A;  4C1N I;  3K59 A;  1G15 A;  5GIP A;  4M42 A;  5AQI A;  4FJG A;  1NKB A;  3CQX A;  4NLC A;  3A5O C;  3C6H A;  2Y1I A;  2Z1H A;  1UAX A;  4AM7 A;  1WAJ A;  1BCM A;  4HTU A;  2O8D A;  4X64 K;  3AV9 A;  3FFK B;  3CFP A;  2HBJ A;  1ZBU A;  4M63 C;  2LSN A;  4FZX C;  4CGG A;  1S9E A;  2A3Z A;  3SPZ A;  3C7N A;  3NAE A;  1KSP A;  4BRA A;  1BI4 A;  2Q1N A;  2JWK A;  3GE1 A;  1HKG A;  4KKO A;  4GMJ B;  3IRX A;  4CGJ A;  4DU4 A;  5IWA K;  3CXC M;  4WYB A;  4FWS A;  3BF1 A;  3GDQ A;  2YNI A;  3KVG A;  1VQN N;  2QWO A;  4N76 A;  1BL3 A;  1B9F A;  3M8P A;  4CFA A;  3KKR A;  3OYN A;  2GWJ A;  4LH5 A;  4IOX A;  5J1E A;  4LFA K;  4B3O A;  4E7I A;  5FPM A;  4B3R K;  2VGM A;  3VQA A;  2W6L A;  1VHX A;  4CJE A;  4KTW A;  2YJE A;  3KIO A;  1J54 A;  5F1X A;  3D6R A;  1WNS A;  3KLE A;  2FF3 B;  4K43 A;  4YOY A;  1BIU A;  2P9P A;  4JKF A;  5FDL A;  1QS4 A;  1BA1 A;  4CHN A;  2JWL A;  3HI0 A;  4H4O A;  4JNE A;  5BRH A;  2RPI A;  2WC9 A;  5JMV A;  4B8A B;  3VOV A;  3E9O A;  3NMU A;  3QLH A;  4CHZ A;  3NVM A;  3FLC O;  4JI3 K;  1OKJ A;  4DF8 A;  1EET A;  1RIL A;  3O9Q A;  4K42 A;  3SBT A;  2G8W A;  2ZJR L;  2ZD1 A;  3V9W A;  4I9L A;  2GEM A;  1JCF A;  1SAZ A;  1Q7Y O;  3G4S N;  3PUF A;  3U9Z A;  4Z4C A;  2Q0U A;  1D8Y A;  1T44 A;  1B92 A;  4JRQ A;  1TKX A;  1BU6 O;  4ILH A;  3D2E A;  3OYM A;  4KV8 A;  4FJ7 A;  4JI5 K;  2F8S A;  4JD2 A;  4TSX A;  4WFN L;  4M3W A;  4X62 K;  3PX4 A;  1NGI A;  3E9L A;  4M3U A;  3I0S A;  4DQS A;  4JEP A;  3ZSX A;  3ZT1 A;  2OYQ A;  1VQM N;  4FK0 A;  1VQ9 N;  2A42 A;  4RW4 A;  4FZY A;  3THX A;  2FLO A;  5M1Q A;  4C8K A;  2V51 B;  2V7Z A;  4KRF A;  5FRO A;  1LWF A;  2DY4 A;  1GLJ O;  1VQ6 N;  4JLH A;  3UKU A;  3H46 O;  1VQ5 N;  2AJQ A;  1SL2 A;  2A41 A;  2O4G A;  3KKS A;  5KGW A;  3KHY A;  4BRP A;  1HYZ A;  1CXQ A;  3AVB A;  2ZF5 O;  4ID5 A;  5CR4 A;  3OS1 A;  2D4W A;  4H0Y B;  4H0P A;  4FJ5 A;  3ZX2 A;  1GLA G;  4PKG A;  2FXU A;  4WCE L;  3DLE A;  5AZI A;  4CK3 A;  4BE1 A;  5GIN A;  3HYF A;  3F2K A;  4JKC A;  3C94 A;  4NB4 A;  3PIO L;  3NH0 A;  2P9N A;  1BHL A;  1KAX A;  1KAZ A;  2HHH K;  1Z6R A;  4CZH A;  5KPR A;  2QKB A;  4CJS A;  1JJ2 M;  1VSE A;  1Y64 A;  1IG8 A;  3LPT A;  4WQ5 A;  4W5Q A;  3MN6 A;  3CJ7 A;  3OYB A;  5CYQ A;  2PFU A;  4ISF A;  5M1K A;  4CES A;  3M5R A;  4BDZ A;  3HM8 A;  2QWN A;  4CJK A;  4DV0 K;  2JLE A;  3ISN C;  1RTI A;  3DOL A;  3NH1 A;  4GVE A;  2NLX A;  2W41 A;  2OPQ A;  3RMA A;  1JCE A;  2WUS A;  4H0V B;  1HYV A;  4IFE A;  1TK5 A;  2BH1 A;  4NO7 A;  4EIA A;  2OPR A;  1SL0 A;  3HVR A;  4F9O A;  1DLO A;  2NRZ A;  5A2Q O;  3DXK A;  4KBO A;  1YVN A;  3F9K A;  4BC3 A;  3CCR N;  2F9T A;  3WNF A;  5AQL A;  2UUA K;  3V9Z A;  3QER A;  1VRT A;  4EHU A;  3LZI A;  3DLL L;  4M45 A;  5M1F A;  3QDK A;  4BRO A;  4CF8 A;  3RSE B;  3P4I A;  4BG8 A;  1K73 O;  2YHX A;  4PKH A;  2A1S A;  4OVL A;  3L2V A;  1W9H A;  4M7X A;  2PYL A;  2KFN A;  5AQV A;  4BWJ A;  4JRP A;  5IT9 O;  1G99 A;  4CJP A;  4FW1 A;  4CZJ A;  1Q81 O;  5DMR A;  3FZH A;  1JL1 A;  4KHP K;  4B9Q A;  4B9L A;  3CQ8 A;  2PY5 A;  3LWM A;  1OH5 A;  2YNG A;  1JLB A;  4KHS A;  3E9P A;  1LOT B;  2ASM A;  4H5T A;  4CBW A;  4ELU A;  1I3A A;  2A5X A;  3IS9 A;  5KPT A;  4BRL A;  2P9S A;  4WFA L;  2Q0R A;  1A5V A;  3VEZ A;  3BEX A;  3FZM A;  3S3N A;  3EKS A;  3UE5 A;  3ZSV A;  4YFU A;  4A5A A;  2IOC A;  4PA1 A;  1JXB A;  1J5E K;  2NRR A;  3VEV A;  3D0P A;  1LW2 A;  4JI4 K;  5AR0 A;  3L3V A;  1VQP N;  3EZW A;  4CJ7 A;  1MA9 B;  4O4G A;  4B1U B;  1NGD A;  1REV A;  3CJA A;  4DQI A;  3V9X A;  1T6C A;  2QXL A;  1B9D A;  4HCC A;  2YHW A;  1SV5 A;  5M1O A;  3NGI A;  2IC3 A;  3KLG A;  1NJX A;  4O0I A;  4U67 L;  3J7A P;  1XMQ K;  4CEO A;  2XY6 A;  3CJ1 A;  2W42 A;  1FJG K;  3O6W A;  3G6E N;  3WXK A;  3J7Y P;  3TU5 A;  1WBD A;  1IV0 A;  4FW2 A;  5I9E B;  1ZC6 A;  2HW3 A;  1WSE A;  4JKB A;  4CGD A;  4CZM A;  3J7Z O;  1RBU A;  4KTZ A;  2X6S A;  2O8E A;  5KTQ A;  3KJV A;  3MAQ A;  5GAD P;  1K8K A;  1CLQ A;  3ZET B;  1KXP A;  4CIF A;  3O1W A;  3O08 A;  1IBK K;  4MLH A;  5EY4 A;  3BZC A;  3V1R A;  3AA3 A;  3SYZ A;  5JS2 A;  4YOW A;  1ITG A;  1WSF A;  4BRN A;  3LDS A;  2OPP A;  1UA1 A;  3LAK A;  4CJF A;  3W3D A;  4O5B A;  2WTU A;  3AA2 A;  4H0O A;  4CEC A;  2HHQ A;  1TGO A;  4A57 A;  1VQO N;  4RTF D;  2YV0 X;  3K0S A;  3K9K A;  4M3R A;  3MWP A;  5JIC A;  1WN7 A;  3KK1 A;  5JS1 A;  4DV2 K;  1SS6 A;  5DK5 A;  3T69 A;  3MN5 A;  4DR2 K;  5GAH P;  4GKJ K;  2GEL A;  3TAM A;  1IJJ A;  3VQ4 A;  1RTJ A;  4IEE A;  5GAE P;  4CED A;  1Z25 A;  1O13 A;  3R1X A;  4W5T A;  4AHV A;  3DXM B;  3DM2 A;  2RF2 A;  4KH4 A;  1RCH A;  5H1S Q;  2P9I B;  4IBN A;  3O3H A;  2Z1I A;  3QET A;  1EQY A;  1TK8 A;  1YXQ A;  4ID1 A;  3A5M C;  3K5L A;  5I42 A;  1FXX A;  3HSC A;  3NF8 A;  1OH7 A;  5DM6 L;  3TAR A;  2UUC K;  1GLE G;  4FJ9 A;  1SKW A;  2FSN A;  5JVH L;  4DTJ A;  4KB1 A;  4DFM A;  1D9D A;  4OGE A;  1KCF A;  4V19 S;  4BR5 A;  2YI1 A;  4DTO A;  5BR8 K;  3PO4 A;  3PSI A;  4I2Q A;  3F73 A;  3MDQ A;  3WXM B;  5E26 A;  1NK5 A;  4ELV A;  3HK2 A;  3E66 A;  2VGN A;  3O3F A;  4IDH A;  4J2E A;  5HRO A;  4KHY A;  1NBW A;  4O0J A;  2QA4 N;  3FGU A;  3VGL A;  3CC7 N;  3RMD A;  4B08 A;  3TAG A;  1JLC A;  1NWK A;  2QEX N;  4DV1 K;  2BDP A;  3OBY A;  3ZLJ A;  3ENO A;  3SJH A;  1VSI A;  4HVJ A;  5GAG P;  5EVZ A;  1K8A O;  2D0A A;  3LP3 A;  3SQ1 A;  1RT7 A;  3OYD A;  3OYI A;  4H5V A;  4A61 A;  1NNE A;  3WEE A;  3VQ9 A;  4DKW A;  4MQ3 A;  1VSH A;  4JN4 A;  3BGR A;  3MED A;  3VEN A;  3HST B;  2VQF K;  4RWT A;  3D7E O;  1TUU A;  5HL7 L;  5C25 A;  4CJV A;  1X3N A;  1QZ5 A;  4WQ5 C;  5D3G A;  5B8H A;  1XMO K;  4I7F A;  4LFC K;  3JSM A;  1EKE A;  4HUG A;  3SUQ A;  4UY8 O;  3QEP A;  4YDU C;  1SUQ A;  4A5B A;  4FXD A;  1WAF A;  4IG3 A;  2DFH A;  3SQ0 A;  1T6D A;  3T1Y K;  4B1X B;  3EE8 A;  4JKD A;  5C24 A;  4JHD B;  2I5J A;  2KZM A;  1NK7 A;  4JAX A;  4CZL A;  3AGK A;  5K14 A;  3OYJ A;  4KAZ A;  3SK3 A;  4B9N A;  4N5S A;  4CF9 A;  1DKG D;  4Q5V A;  3O9T A;  4BE0 A;  4FPA A;  3K9J A;  4CVN E;  1GLD G;  4B8C A;  4QS9 A;  4CIG A;  3HP9 A;  1NOY A;  3DJC A;  1YAG A;  2W40 A;  2P9U B;  4BVO A;  1HJR A;  2FBT A;  4M3Y A;  4J2B A;  2J4R A;  3EKU A;  3V1O A;  3EEQ A;  1RDD A;  4F2R A;  2HOE A;  1XNR K;  2HHT A;  1FKO A;  3ZSZ A;  5HBM A;  4DFK A;  4KI4 A;  5AQJ A;  2O8F B;  1JKH A;  3I0R A;  2HHW A;  4DQ8 A;  3AAR A;  4GKK K;  3NBP A;  5TKY A;  4E7H A;  1C1A A;  3D2E B;  1U2V A;  2EWS A;  3NH2 A;  4RG8 A;  1ASW A;  3H3N O;  2P9K B;  1D4X A;  1O1W A;  2QWL A;  3U3Y A;  2OTJ N;  5AQT A;  3O8M A;  5BN9 A;  3FZF A;  1BWF O;  3TTD A;  4E1M A;  3KD5 E;  4DB3 A;  4DSF A;  5M1N A;  1VQL N;  4MO4 A;  4DV5 K;  4AHC A;  1IKY A;  3THX B;  2PAV A;  4BGB A;  1QHT A;  1JLA A;  1ASV A;  1OH6 A;  3MMV A;  3UKU B;  1YIT N;  4GW6 A;  4KFB A;  4AQY K;  5AQS A;  2E2N A;  1XHX A;  1Q9X A;  5AZJ B;  2CH6 A;  4BR9 A;  2Q3S A;  3M1F A;  4PWD A;  1RTH A;  5AQZ A;  3QES A;  2FSK A;  2PBD A;  5AQO A;  2CH5 A;  1GOC A;  4O8K A;  1ZBH A;  4ILJ A;  2I7N A;  3ALY A;  2KW4 A;  4CGI A;  3LPU A;  4CEQ A;  1HKB A;  3IDH A;  4JKG A;  3J8A A;  4B9U A;  3NVK A;  4CER A;  1FKP A;  1RDB A;  4YOU A;  3VET A;  4I2P A;  2UXD K;  4K8Z A;  5HRP A;  1X1P A;  4PY5 A;  3H1V X;  4FLZ A;  1HQU A;  2FBV A;  3OY9 A;  3T1A A;  3SBG A;  4A2A A;  3M8S A;  3K5N A;  4B3M K;  3W0L A;  5FPE A;  2GV9 A;  2UXC K;  2WOM A;  4AHR A;  3QNN A;  1R0A A;  5AJ3 K;  2KHO A;  5KRS A;  5ADX A;  4DTN A;  2VG6 A;  1BDG A;  3LAM A;  3TAP A;  1TK0 A;  1C0U A;  2O4I A;  2RN2 A;  1N33 K;  1YF5 L;  5FLX O;  2OZS A;  5C2F A;  3CC2 N;  3M8R A;  5FRM A;  4FLT A;  5F0X A;  3K57 A;  4FLU A;  5EX5 A;  4H0T B;  1D5A A;  2KLA A;  1X9M A;  1GLF O;  4W5R A;  4GY2 B;  3DI6 A;  1S3X A;  2ZJQ L;  5AQH A;  1JLF A;  3SPY A;  4CJ4 A;  3V9S A;  3TAB A;  3N4P A;  3QO9 A;  4Q0B A;  4IOC L;  5T7B A;  4FLY A;  1XUP O;  4H5N A;  1VSJ A;  3M6G A;  1X9J A;  3ULD A;  4F3T A;  1QQO A;  1RT2 A;  4KHQ A;  4X65 K;  4FWL A;  4B1V A;  4BRG A;  3VMF B;  1NK4 A;  4RW7 A;  3LDN A;  3ZT0 A;  4KH5 A;  2DPN A;  4DR4 K;  4DTM A;  2ZGZ A;  4BAC A;  4JI1 K;  5LY3 A;  3VTI A;  2WON A;  3FZK A;  3AVM A;  1P8Z A;  5HLF A;  3SAF A;  4O44 A;  3CD6 N;  4DSL A;  4WQ4 A;  1BQM A;  3ENB A;  5AQN A;  3EL2 A;  4RW8 A;  4W5O A;  1N34 K;  4LSN A;  1CZ9 A;  3AVI A;  4AF1 A;  4CIE A;  3CYM A;  4C8L A;  4M3X A;  2CGL A;  3CCE N;  5CZ1 A;  1RNH A;  5KQ8 A;  3QIO A;  2HBL A;  4DFJ A;  2VYP A;  3L0Q A;  4YOR A;  1VQ7 N;  3ZSY A;  4B9M A;  4CJQ A;  2KQ2 A;  4DTS A;  2NRW A;  1HJO A;  3HPG A;  1UWB A;  4CBU A;  4K41 A;  4DF4 A;  3LDL A;  3OVN A;  1WSG A;  4NXN K;  3ULE A;  4BRH A;  2V52 B;  1BIS A;  2P9L A;  3JS6 A;  2O8B A;  3NHG A;  2HNY A;  1YJN N;  1LAW A;  1U04 A;  2E6L A;  2G8K A;  3DLH A;  4CHY A;  3EO3 A;  3DAW A;  1ASU A;  3LP0 A;  1QQM A;  3WT0 A;  2HF4 A;  4YOX A;  3JXU A;  1SKS A;  4FM1 A;  4LF6 K;  1ZXO A;  4IZ9 A;  4FLW A;  3LDO A;  4WFB L;  1HMV A;  4DLG A;  4GV6 A;  1DT9 A;  3V4I A;  4OPH A;  3QFP A;  3F5T A;  3OS0 A;  3HRG A;  4LFB K;  3SV4 A;  4NLB A;  2HHU A;  2DFF A;  3THY B;  1C1C A;  4I6M B;  1QVG M;  1YTU A;  4G9Z A;  2HBM A;  3P39 A;  4JI6 K;  2E20 A;  3PV8 A;  3HPH A;  3MCP A;  4JK8 A;  2IVP A;  4FVU A;  3TAQ A;  4OKK A;  5I3U A;  3O9S A;  4B1W B;  1NJI O;  5HRS A;  3N4Q A;  4FYD A;  1Q8I A;  4BGA A;  4GV9 A;  3OYK A;  4AHT A;  1WBB A;  4BRQ A;  4LC9 B;  3NDK A;  3OTO K;  4C8O A;  1TVR A;  4BRF A;  4NCG A;  1KRP A;  1XC9 A;  4A62 A;  3RVC A;  3UIQ A;  1S5J A;  2FBY A;  3HM9 A;  3CPE A;  2HHX A;  4DTX A;  3UKR B;  4M3Z A;  3VGK A;  4AHU A;  2G8F A;  2OPS A;  3DLB A;  2QI2 A;  3DOK A;  1VSF A;  4FWP A;  1ATS A;  3EE9 A;  3QFU A;  1MDU B;  4KI6 A;  3AVG A;  3WQU A;  2YJF A;  4CGF A;  1BG3 A;  3U8X A;  4FLX A;  1Z26 A;  3TSU A;  4E89 A;  3G0Z A;  3HO1 A;  3VQ7 A;  1RFQ A;  1Z05 A;  4FSV A;  3AY9 A;  3Q7B A;  3SAH A;  1IG9 A;  2QWR A;  3THW B;  3WXL A;  3FE1 A;  3WUH A;  1NMD A;  5CZ2 A;  1H1V A;  1RT6 A;  3SNN A;  1EWR A;  5LJW A;  3KZB A;  1CZB A;  1NKE A;  3R3L A;  3LAL A;  5C42 A;  3A2F A;  3LDP A;  4KH6 A;  3RRG A;  1KQS M;  5EU7 A;  4CW7 B;  3VQP A;  3OYF A;  1NMN A;  4CEB A;  4DG1 A;  4DQR A;  1HNI A;  3CJ9 A;  3VEO A;  4B9T A;  2D1K A;  3ASM A;  2EX3 A;  2HMP A;  2E1Y A;  3O3G A;  3A5L C;  4FWQ A;  3DLG A;  3TTF A;  3VF4 A;  2GX9 A;  2PZS A;  2JGU A;  3EYZ A;  1YHQ N;  2ZWH A;  1NK6 A;  2CGK A;  4CZF A;  2WFB A;  1VSL A;  4IG0 A;  2ASP A;  2QTD A;  4H4M A;  3OW2 M;  1OVQ A;  4B9S A;  4FJJ A;  1HLU A;  4PUO A;  1KFS A;  1WSH A;  1C6V A;  3SMP A;  2NRT A;  4XEI A;  4AHS A;  4HUE A;  3MWT A;  2XY8 A;  1LAV A;  3RR7 A;  2BUP A;  3FR0 A;  1RTD A;  4CCH A;  3CM5 A;  4WF9 L;  3LDQ A;  4CF1 A;  3RRH A;  3AO5 A;  3LAN A;  1HQE A;  4C23 A;  4FJM A;  3HZ6 A;  4BE2 A;  3O1B A;  4H0X B;  1RDW X;  4FWK A;  3SAG A;  3THV A;  5C2D A;  3MXM A;  1LV5 A;  1A5W A;  1RBV A;  2RE2 A;  1ATR A;  3VGM A;  2HVH A;  4CI6 A;  3L4Q A;  2E5L K;  2HMI A;  4XH5 A;  4CEE A;  3V6D A;  1U45 A;  1YVU A;  4BDP A;  4BRK A;  5AQR A;  2ZQB A;  2KZZ A;  3U9D A;  3OYE A;  1QSS A;  3O9R A;  4NXM K;  2OCE A;  4RW6 A;  1GLC G;  1KFD A;  4LF8 K;  5EXW A;  1DTQ A;  1TAQ A;  1W0H A;  4OJR A;  3T19 A;  3CMA N;  1QSY A;  3HXM A;  3VER A;  3P1G A;  3TAN A;  3VQE A;  2IAJ A;  3MEC A;  2OTL N;  1U2V B;  1GOA A;  1TL1 A;  4QCL A;  2O8C A;  4LY7 A;  4CFC A;  4M7Y A;  2X74 A;  4A2B A;  1V4T A;  3RSE A;  3IG1 A;  4DHY A;  4DR5 K;  1T8E A;  1BO5 O;  1YIJ N;  3L4I A;  1UA0 A;  2E6M A;  3K2P A;  4DQQ A;  3B8A X;  3CER A;  1N32 K;  4FK2 A;  1C0M A;  1GLB G;  2Z1G A;  1C0F A;  4DV6 K;  3M8Q A;  1K9M O;  1TKT A;  3BUZ B;  3L6Q A;  4DSK A;  4OLB A;  4F3O A;  1I94 K;  1ESV A;  2KTQ A;  3V81 A;  1X9S A;  4CK1 A;  1L5U A;  4F2S A;  1TUY A;  2ZJP L;  2UXB K;  4IOA L;  2HVI A;  4CEF A;  2UYT A;  3KTQ A;  3HOS A;  1RT4 A;  3CFR A;  1YTA A;  4XH4 A;  4FWM A;  3H45 C;  2O8D B;  3C6A A;  4KO0 A;  4IEI A;  2HHV A;  1S72 N;  4BC4 A;  4IXC A;  4G1Q A;  4JKG B;  5BRF A;  3CC4 N;  4OKE A;  5J2M A;  4JKA A;  4N56 A;  1J9A A;  3SI6 A;  4EZ9 A;  2VWK A;  4IFV A;  3C7N B;  4DU3 A;  1BI4 B;  4DS4 A;  1EO1 A;  3BF3 A;  3SQ2 A;  3VA0 A;  3CCS N;  1EX4 A;  3J80 O;  1KVA A;  5C15 A;  3WQT A;  3OYL A;  4O5F A;  1E3M A;  4H8K A;  1NGC A;  2V7Y A;  4FOE A;  1IKX A;  4DUZ K;  3KWG A;  4H5R A;  3PX0 A;  1KLN A;  1S1X A;  2ETJ A;  4IO9 L;  1NLV A;  2ITM A;  1RBS A;  3OJS A;  5E84 A;  3OJU A;  4ZTJ A;  4CZK A;  3ITH A;  1IBL K;  4FPB A;  3HP6 A;  3VQB A;  3TR8 A;  5AFU A;  4HWI A;  5HOO A;  4LF7 K;  2BAN A;  2A1R A;  3VEX A;  2P9P B;  2IIR A;  2XO7 A;  3NCI A;  3CJB A;  1TV6 A;  4BRI A;  4YY3 K;  1HR0 K;  4LF4 K;  3EN9 A;  3PSF A;  2ZE2 A;  3QIP A;  1X9W A;  4DLE A;  1XC3 A;  4OLA A;  1JLE A;  2G8V A;  3ZET A;  3PX6 A;  2PYJ A;  2RKI A;  4BR7 A;  1VSM A;  4OPK A;  3QBX A;  3LM2 A;  3OYH A;  5FPD A;  1TKZ A;  1KVB A;  3AAQ A;  1W97 L;  4JKH A;  3CM6 A;  4ISG A;  2YHA A;  4JV5 K;  3LL3 A;  1VSD A;  3QBW A;  4FWO A;  3KK3 A;  4IJN A;  2E2P A;  4QS8 A;  2VQE K;  4PL8 A;  2XY5 A;  1U6Z A;  1S9G A;  4JD2 B;  3TSP A;  5AQM A;  3EZ5 A;  4CEA A;  3AVK A;  5KPZ A;  2F7T A;  3G25 A;  4CD1 A;  2FBX A;  3JAM O;  3CQY A;  4HCB A;  2E88 A;  2RHK A;  3OYG A;  4BQZ A;  3K5O A;  4FOI A;  1NGF A;  4GVM A;  3KK2 A;  4JYA K;  5C0Y A;  3DRR A;  4BRD A;  5HRR A;  2YHY A;  1SZ2 A;  3MK6 A;  4BC5 A;  3DXM A;  5BRD A;  5BR9 A;  4DTR A;  2YNH A;  1IKW A;  2P9I A;  3F9M A;  1N36 K;  4ZHR A;  1L3S A;  1HKC A;  4JI2 K;  4BR0 A;  2OA8 A;  2D0P A;  4EZ6 A;  1VRU A;  1L3U A;  2Q2R A;  3LWL A;  4Y1C A;  2HF3 A;  3SUP A;  1ATN A;  4EAH D;  3SUO A;  3K58 A;  5LJV A;  4K25 A;  1L3T A;  3NF7 A;  4F8R A;  2P1J A;  4M3T A;  4CHO A;  5AZI B;  3OYC A;  4DTP A;  1T3V A;  2ZGY A;  1HNW K;  1VQK N;  1NJW A;  1VQ4 N;  4K8X A;  3A5N C;  4N47 A;  3ZSO A;  3QEX A;  2H3G X;  4DUY K;  3HJF A;  1LWC A;  2P9N B;  2WBN A;  1I39 A;  1C0T A;  3L3U A;  1IO2 A;  3CFO A;  3ZEU A;  4DWI A;  3AO2 A;  4H5W A;  5AQG A;  3LZJ A;  4ILG B;  2Y1J A;  4IKF A;  1N8R O;  1IBM K;  5J2N A;  1JCG A;  5ADX H;  4DR3 K;  4OPJ A;  3RMC A;  1CXU A;  1NK9 A;  3PLA A;  1YJW N;  1ILY A;  4DFP A;  4PKI A;  4E0D A;  5JLH A;  2P5G A;  1F21 A;  4IFY A;  4CFD A;  4L8R B;  3NGZ A;  1TYQ A;  1YI2 N;  1R59 O;  5JVG L;  4BRM A;  2OAN A;  4DSI A;  2FC0 A;  3P83 D;  3CET A;  4N41 A;  1NOZ A;  4CFB A;  1J6Z A;  3AA4 A;  5GIO A;  2YHB A;  3DXK B;  3LP1 A;  1J53 A;  4MFB A;  4JK7 A;  4FCY A;  3AVL A;  1L3V A;  1N5Y A;  1D9F A;  3H1Q A;  3QEV A;  3MCA B;  4DR6 K;  4Z4E A;  1NG9 A;  4JHD A;  1GOB A;  4R79 A;  2QK9 A;  4H03 B;  2E1Z A;  5BN8 A;  3HPO A;  1RGI A;  5SZT A;  4PQU A;  4DR7 K;  1YT3 A;  3BP8 A;  4JS5 A;  4FVM A;  1S1V A;  3IAY A;  5LL6 Z;  2KFZ A;  3GOI A;  5CYM A;  2GBZ A;  4NCA A;  4IJA A;  4HTL A;  1MU2 A;  4DV3 K;  2ITG A;  2P9U A;  1S22 A;  4NYF A;  2Z1J A;  1NU0 A;  5CY4 A;  1Q82 O;  3GL1 A;  4CJW A;  4KTQ A;  3L8B A;  1BUP A;  3KD1 E;  5C10 A;  2UUB K;  4KB0 A;  1WB9 A;  2NRX A;  3ZT4 A;  3I55 N;  2P9S B;  1KC8 O;  4L3Q A;  3D2F A;  4JI0 K;  2O8F A;  4CGH A;  3AO1 A;  2YX6 A;  3MEG A;  3RWU A;  4B3S K;  3R6M A;  1QQN A;  1WSJ A;  1M90 O;  1DGK N;  3ZT3 A;  3NFA A;  2P9K A;  2VG5 A;  3MX5 A;  3PY8 A;  2GUI A;  2F96 A;  1NGB A;  4XH1 A;  2B4J A;  4HHT A;  3S3O A;  2DFE A;  4CHQ A;  5DM7 L;  1DTT A;  1NK8 A;  3RR8 A;  3KLH A;  4QAG A;  3QIN A;  1QVF M;  2R7Y A;  4DQP A;  3P38 A;  3PO5 A;  3QEI A;  4IO8 A;  2D0O A;  3TAF A;  5AZJ A;  1Q9Y A;  3P5J A;  3B6P A;  3O9U A;  5SWM A;  1YJ9 N;  2AP1 A;  3AVN A;  3LP2 A;  3WXI A;  4C8N A;  2F8T A;  1IKV A;  2ATQ A;  1RT5 A;  4FWR A;  3VQ8 A;  4BVP A;  2O8E B;  4EP4 A;  3RMB A;  1K8K B;  3TSQ A;  3O4W A;  1JXE A;  2QWM A;  4BRC A;  4E7J A;  1WSI A;  1QE1 A;  3J81 O;  2VG7 A;  4JS4 A;  4CJU A;  4FL9 A;  4Z4I A;  1UOC A;  3ID8 A;  3O80 A;  4MDA A;  4E1N A;  2E2O A;  3WXJ A;  3T1H K;  2DTU A;  2Q31 A;  1QSL A;  1DEJ A;  1MWK A;  3SUN A;  5AQQ A;  3WNE A;  4E1J A;  1EXQ A;  4YDU A;  3VA3 A;  1WUA A;  3S9H A;  1FW6 A;  4CD3 A;  1XI1 A;  4F4K A;  4FJN A;  2XY7 A;  2GUP A;  3CCJ N;  1LWE A;  2IDO A;  3HL8 A;  2AA4 A;  3TPQ A;  3P31 A;  3ZX3 A;  3AO4 A;  1XWL A;  1ZBS A;  2A6A A;  4J2D A;  5CHI A;  2D5R A;  5CE3 A;  3AA5 X;  1S1W A;  3CCV N;  3MEE A;  2FF6 A;  4CK2 A;  3L2Q A;  1RDU A;  2BE2 A;  2NRH A;  4Z0U A;  1HNZ K;  3IKM A;  4CEZ A;  3MN7 A;  4B1Y B;  1S6P A;  2F4V K;  1Y97 A;  3BDP A;  1JLG A;  1BOT O;  1SQK A;  4LH4 A;  2IGI A;  4CHP A;  4WE1 A;  5LMN K;  3CHW A;  4FJK A;  3ZSQ A;  2YNF A;  5FRN A;  4AM6 A;  3DYA A;  5BPM A;  2O8C B;  3UB5 A;  3MXI A;  4J2A A;  1NGE A;  5ELZ A;  1GLL O;  1QHA A;  2W6K A;  3M3Z A;  1Q18 A;  3ZYY X;  3SV3 A;  4IDK A;  3CJC A;  4C8M A;  1TL3 A;  4FJI A;  3AAP A;  3FFI A;  3AVH A;  2HBK A;  1K6Y A;  3HOT A;  3SLC A;  4B1Z A;  2G8H A;  3CCM N;  1E4F T;  1X3M A;  2QXF A;  4YOT A;  1HX1 A;  3VQ5 A;  3OA9 A;  3QNO A;  3DMJ A;  2XRI A;  3I8B A;  4YHH K;  2QWQ A;  1IH7 A;  1T05 A;  4JI8 K;  2Q36 A;  2HST A;  1V4S A;  3QML A;  3Q7C A;  1NJZ A;  4BWM A;  4C1N K;  1RDC A;  3H3O B;  1S6Q A;  1LW0 A;  2YKN A;  4JI7 K;  3SQ4 A;  5AQX A;  1KAY A;  2I7P A;  5TKW A;  1ZBF A;  3TTC A;  3S3M A;  3IMX A;  1BIZ A;  2VCP A;  1W7A A;  2NRV A;  4QOZ B;  3V1Q A;  1EP4 A;  4CE9 A;  3T7Z A;  4J8F A;  3KK7 A;  2HND A;  3H08 A;  4ICL A;  4DV4 K;  4HUF A;  3VQQ A;  1RBT A;  5KGX A;  1T03 A;  3DWL A;  3WEE B;  1HNX K;  5AQU A;  2YCH A;  2YKM A;  2E4L A;  2VWB A;  1S1T A;  3C6T A;  1EWQ A;  1RT3 A;  1QTM A;  3H6E A;  2HHS A;  3MXJ A;  3MN9 A;  4DU1 A;  2B5J A;  3ENH A;  3TI0 A;  2XHB A;  3CCQ N;  4ZTF A;  1XQS C;  1KLM A;  3A8Y A;  4AH9 A;  3CCU N;  4NYN A;  2NZT A;  3CME N;  2ZM6 K;  4BC2 A;  2QW9 A;  4IWV A;  1NGG A;  3VQ6 A;  4O55 A;  5AQY A;  4QS7 A;  3I33 A;  4FJX A;  1U47 A;  5BPL A;  3DLR A;  3T3F A;  1JL2 A;  1KVC A;  4CF0 A;  2FSJ A;  1VSK A;  5M1P A;  4Z4H A;  3JYT A;  1SKR A;  4FJH A;  4FO0 A;  3VES A;  4CJR A;  4CZI A;  4EFH A;  4KRE A;  3E01 A;  3OS2 A;  1OVY A;  5MLC Q;  3O4Q A;  3THY A;  4I6M A;  2QKK A;  1A5X A;  2Q97 A;  4Z94 A;  4OPA A;  3OYA A;  4B9V A;  5KRT A;  1SL1 A;  1J5O A;  1HNV A;  3U3G A;  3I56 N;  1RBR A;  3L2R A;  3BY5 A;  4KHN A;  1VAZ A;  1C0G A;  3L2W A;  4FK4 A;  3AVC A;  3C95 A;  3G10 A;  3R8E A;  3VQC A;  4Z4G A;  3CG7 A;  3NGY A;  3ZSW A;  3QB0 A;  4JKE A;  4FWN A;  3L2U A;  3U4L A;  2HNZ A;  1E4G T;  1XNQ K;  1HYS A;  3MX2 A;  4FJ8 A;  4MDB A;  3ATV A;  2GWK A;  3R9P A;  3QEW A;  5J2P A;  4PL7 A;  3G71 N;  4KHU A;  4EP5 A;  2BGG A;  3UKR A;  1BCO A;  4WQ4 C;  3D45 A;  4BY9 C;  4LSL A;  1BA0 A;  1NGJ A;  2BTF A;  3GG4 A;  3S41 A;  2HB5 A;  1HPM A;  1U49 A;  3SJJ A;  1NKC A;  2IVN A;  4DMN A;  3A0I X;  1FK9 A;  4DR1 K;  2B6A A;  4MO5 A;  2NUB A;  3O4N A;  2QWP A;  3NE6 A;  3VF6 A;  1NGA A;  5HRN A;  5J2Q A;  3VF2 A;  3CI5 A;  1P90 A;  4CJ5 A;  3AVF A;  3THW A;  3DRP A;  3V9U A;  4DSE A;  3VEW A;  4DTU A;  4RW9 A;  4CJ3 A;  4R5P A;  4CJL A;  3ZT2 A;  2IVO A;  3BZK A;  4B3T K;  4CZE A;  3I8D A;  1M1K O;  1TAU A;  1TKD A;  4PHT X;  1S1U A;  5HP1 A;  2OZM A;  3VPZ A;  1U4B A;  3DRS A;  3ZEU B;  3ZCM A;  4CBX A;  4NCB A;  2KKZ A;  3CIP A;  2E8A A;  1KD1 O; 
#chains in the Genus database with same CATH homology
 1I39 A;  1ASU A;  1C0T A;  4O4G A;  3L3U A;  1IO2 A;  1REV A;  3LP0 A;  3SZ2 A;  3CFO A;  4DQI A;  4DSJ A;  3K5M A;  3V9X A;  4DWI A;  1KTQ A;  3AO2 A;  1ZBI A;  3WNG A;  2D0B A;  1B9D A;  3HT3 A;  3EY1 A;  4FM1 A;  1C1B A;  1SKS A;  4HCC A;  3LZJ A;  3VN5 A;  1SV5 A;  3NGI A;  2Y1J A;  4IKF A;  3U6F A;  5J2N A;  4CJT A;  2IC3 A;  3KLG A;  2G8I A;  4FLW A;  1HMV A;  4DLG A;  4O0I A;  4OPJ A;  3RMC A;  4LD0 A;  2X78 A;  1CXU A;  1NJX A;  4CEO A;  3V4I A;  2XY6 A;  3HK2 A;  2W42 A;  1NK9 A;  3AVJ A;  1RT1 A;  4UQG A;  3OS0 A;  4DS5 A;  3SV4 A;  4DFP A;  3KLI A;  4E0D A;  4FW2 A;  2HW3 A;  2HHU A;  2P5G A;  1F21 A;  1WSE A;  2DFF A;  1C1C A;  4IFY A;  4CFD A;  4L8R B;  3NGZ A;  4FLV A;  1YTU A;  4CGD A;  1RBU A;  4KTZ A;  2X6S A;  4E7L A;  1ZYQ A;  5KTQ A;  3KJV A;  3MAQ A;  4Y1D A;  4ELT A;  3PV8 A;  2FC0 A;  4DSI A;  3HPH A;  3P83 D;  4N41 A;  1NOZ A;  1CLQ A;  4CFB A;  4KPY A;  4Z4F A;  4CIF A;  3TAQ A;  3KLF A;  4OKK A;  3AA4 A;  4I9Q A;  4W5N A;  5I3U A;  4KHW A;  4E7K A;  1WLJ A;  2YHB A;  1QTM A;  3LP1 A;  1J53 A;  4MFB A;  2G8U A;  3V1R A;  3AA3 A;  5HRS A;  3SYZ A;  5JS2 A;  4FCY A;  3AVL A;  4M41 A;  1L3V A;  1Q8I A;  4FYD A;  1N5Y A;  1D9F A;  1ITG A;  1WSF A;  4OGC A;  3OYK A;  4AHT A;  3LDS A;  3QEV A;  2OPP A;  3NDK A;  2IS3 A;  2X6N A;  1UA1 A;  1TVR A;  4C8O A;  3LAK A;  4NCG A;  4FM2 A;  1KRP A;  4CJF A;  4Z4E A;  1N6Q A;  1XC9 A;  4FZZ A;  3UIQ A;  3B6O A;  4O5B A;  1RDA A;  1S5J A;  1VK0 A;  3AA2 A;  1QQC A;  4CEC A;  2HHQ A;  1TGO A;  2FBY A;  3HM9 A;  1GOB A;  2HHX A;  2YV0 X;  4DTX A;  4M3R A;  4YNQ A;  3NF6 A;  2QK9 A;  1WN7 A;  4ELV A;  3KK1 A;  5JS1 A;  3HPO A;  4M3Z A;  5SZT A;  4AHU A;  2VWJ A;  2G8F A;  4PQU A;  3ZSR A;  1YT3 A;  2OPS A;  4JS5 A;  3DLB A;  4FVM A;  1S1V A;  3IAY A;  5DK5 A;  1JLQ A;  4CF2 A;  5CYM A;  2KFZ A;  3TAE A;  2GBZ A;  1VSF A;  3DOK A;  2P51 A;  3NF9 A;  4E3S A;  4NCA A;  1MU2 A;  3TAM A;  2ITG A;  3AVG A;  4KI6 A;  4CGF A;  4NYF A;  2Z1J A;  3VQ4 A;  4FLX A;  5CY4 A;  1XHZ A;  1RTJ A;  5KI6 A;  1Z26 A;  1Z25 A;  4CED A;  4W5T A;  4AHV A;  4CJW A;  3WNH A;  4KTQ A;  3DM2 A;  3L8B A;  2RF2 A;  3G0Z A;  4E89 A;  1ZBL A;  3HO1 A;  3VQ7 A;  1RCH A;  3KD1 E;  2EHG A;  4KB0 A;  3VQD A;  1HRH A;  1BQN A;  4IBN A;  3ZT4 A;  2D0C A;  2Z1I A;  3O3H A;  3QET A;  1U48 A;  3AVA A;  1TK8 A;  3AO3 A;  4ID1 A;  4CGH A;  5E41 A;  5I42 A;  3K5L A;  1IG9 A;  1FXX A;  3NF8 A;  3AO1 A;  3MEG A;  3RWU A;  3TAR A;  4E19 A;  1WSJ A;  4FM0 A;  4OKJ A;  5CZ2 A;  3ZT3 A;  3NFA A;  1RT6 A;  3SNN A;  4FJ9 A;  3DLH A;  1SKW A;  1HPZ A;  2VG5 A;  3PY8 A;  1CZB A;  4DTJ A;  1NKE A;  3LAL A;  4BDY A;  2GUI A;  5C42 A;  3A2F A;  4AIL C;  4KB1 A;  4DFM A;  3DLK A;  1NJY A;  1D9D A;  3RRG A;  2F96 A;  4OGE A;  1BGX T;  2B4J A;  3SCX A;  1KCF A;  3C6U A;  4HHT A;  3S3O A;  5EU7 A;  2DFE A;  4XIU A;  4DTO A;  4CHQ A;  1NK0 A;  3VQP A;  3PO4 A;  3TWH A;  2P5O A;  4FJL A;  3OYF A;  4I2Q A;  3F73 A;  1T7P A;  3HVT A;  1DTT A;  4CEB A;  1NK5 A;  1NK8 A;  3KLH A;  4QAG A;  3RTV A;  3RR8 A;  4DG1 A;  3O3F A;  1G15 A;  3K59 A;  4DQR A;  4M42 A;  3QIN A;  1HNI A;  4J2E A;  5HRO A;  2R7Y A;  4KHY A;  4FJG A;  4DQP A;  1NKB A;  4B9T A;  3PO5 A;  3QEI A;  4O0J A;  2Y1I A;  2Z1H A;  1UAX A;  3ASM A;  2EX3 A;  1WAJ A;  3TAF A;  1BCM A;  3O3G A;  3RMD A;  4B08 A;  3TAG A;  4HTU A;  3DLG A;  1JLC A;  1Q9Y A;  2BDP A;  3P5J A;  3B6P A;  2PZS A;  5SWM A;  3AV9 A;  2JGU A;  3AVN A;  3EYZ A;  3LP2 A;  1NK6 A;  3CFP A;  3SI6 A;  1ZBU A;  1VSI A;  4HVJ A;  4C8N A;  1VSL A;  1IKV A;  2ATQ A;  2D0A A;  4IG0 A;  1RT5 A;  3LP3 A;  3SQ1 A;  2F8T A;  1RT7 A;  2LSN A;  4H4M A;  3VQ8 A;  3OYD A;  3OYI A;  4FZX C;  4CGG A;  1S9E A;  3VQ9 A;  4B9S A;  4FJJ A;  3SPZ A;  4PUO A;  4MQ3 A;  1KFS A;  1WSH A;  3NAE A;  4EP4 A;  1C6V A;  3RMB A;  1KSP A;  1VSH A;  1BI4 A;  3BGR A;  4KKO A;  1JXE A;  4GMJ B;  3IRX A;  4AHS A;  4CGJ A;  4DU4 A;  4HUE A;  3MED A;  4E7J A;  3HST B;  2XY8 A;  1WSI A;  1QE1 A;  1LAV A;  2VG7 A;  4JS4 A;  2YNI A;  4CJU A;  3RR7 A;  4Z4I A;  1RTD A;  1UOC A;  4CCH A;  3CM5 A;  4N76 A;  4E1N A;  1BL3 A;  5C25 A;  4CF1 A;  4CJV A;  1B9F A;  3RRH A;  3AO5 A;  5D3G A;  3LAN A;  1HQE A;  4I7F A;  2DTU A;  3M8P A;  4CFA A;  3JSM A;  1EKE A;  4HUG A;  4BE2 A;  3SUQ A;  1QSL A;  4FJM A;  3KKR A;  3OYN A;  3QEP A;  3SUN A;  4LH5 A;  1SUQ A;  4FXD A;  3WNE A;  1WAF A;  5J1E A;  3THV A;  4IG3 A;  1EXQ A;  2DFH A;  3VA3 A;  4E7I A;  3S9H A;  1A5W A;  3SQ0 A;  3MXM A;  1LV5 A;  1RBV A;  3VQA A;  1XI1 A;  4F4K A;  4FJN A;  2XY7 A;  5C24 A;  2HVH A;  4CJE A;  2I5J A;  4KTW A;  3KIO A;  1J54 A;  1LWE A;  2KZM A;  1NK7 A;  2IDO A;  3HL8 A;  5K14 A;  3OYJ A;  4KAZ A;  2HMI A;  3AO4 A;  1XWL A;  1WNS A;  4CEE A;  3KLE A;  1YVU A;  3V6D A;  1U45 A;  4B9N A;  4BDP A;  4J2D A;  1BIU A;  2D5R A;  3AA5 X;  1S1W A;  3MEE A;  5FDL A;  4N5S A;  4CF9 A;  2ZQB A;  1QS4 A;  4CHN A;  4Q5V A;  4CK2 A;  4BE0 A;  3L2Q A;  2KZZ A;  2BE2 A;  4H4O A;  2RPI A;  4Z0U A;  4B8C A;  3OYE A;  1QSS A;  4CEZ A;  4CIG A;  3HP9 A;  1NOY A;  1S6P A;  1Y97 A;  3BDP A;  4RW6 A;  4B8A B;  1KFD A;  1HJR A;  1JLG A;  2FBT A;  4LH4 A;  4CHP A;  2IGI A;  4M3Y A;  1DTQ A;  1TAQ A;  3QLH A;  4WE1 A;  4J2B A;  1W0H A;  4CHZ A;  4FJK A;  3V1O A;  4OJR A;  3ZSQ A;  3T19 A;  1QSY A;  2YNF A;  1RDD A;  3HXM A;  4DF8 A;  3DYA A;  4F2R A;  1EET A;  1RIL A;  3P1G A;  3TAN A;  3VQE A;  3MXI A;  2G8W A;  2HHT A;  2IAJ A;  3MEC A;  1FKO A;  3ZSZ A;  5HBM A;  4DFK A;  4J2A A;  4KI4 A;  2ZD1 A;  3V9W A;  4I9L A;  1GOA A;  1TL1 A;  4QCL A;  1JKH A;  3I0R A;  4LY7 A;  5FRN A;  2HHW A;  4CFC A;  3SV3 A;  4IDK A;  3NBP A;  2X74 A;  4E7H A;  1C1A A;  3PUF A;  4C8M A;  1TL3 A;  4Z4C A;  4FJI A;  3NH2 A;  3IG1 A;  4RG8 A;  1ASW A;  1T8E A;  3U3Y A;  1O1W A;  1D8Y A;  3FFI A;  3AVH A;  1UA0 A;  1B92 A;  2E6M A;  3K2P A;  1TKX A;  4JRQ A;  4DQQ A;  4E1M A;  3KD5 E;  1K6Y A;  3OYM A;  4KV8 A;  4FK2 A;  4FJ7 A;  4DSF A;  1C0M A;  2F8S A;  2G8H A;  4TSX A;  2Z1G A;  2QXF A;  4M3W A;  3M8Q A;  4AHC A;  1IKY A;  3PX4 A;  1TKT A;  4M3U A;  3I0S A;  3VQ5 A;  4DQS A;  1QHT A;  3QNO A;  3DMJ A;  3ZSX A;  3ZT1 A;  2OYQ A;  4DSK A;  4OLB A;  4F3O A;  1JLA A;  1ASV A;  2XRI A;  4FK0 A;  2KTQ A;  3V81 A;  1IH7 A;  4CK1 A;  1X9S A;  4RW4 A;  1T05 A;  1L5U A;  4F2S A;  4FZY A;  2HVI A;  4C8K A;  1NJZ A;  4BWM A;  4CEF A;  4GW6 A;  4KRF A;  4KFB A;  1RDC A;  5FRO A;  1LWF A;  1S6Q A;  2DY4 A;  1LW0 A;  2YKN A;  3KTQ A;  4JLH A;  1RT4 A;  3SQ4 A;  1XHX A;  3CFR A;  1YTA A;  1Q9X A;  1ZBF A;  2Q3S A;  4PWD A;  3S3M A;  1RTH A;  4KO0 A;  1SL2 A;  2AJQ A;  1BIZ A;  3QES A;  2O4G A;  2HHV A;  4QOZ B;  3KKS A;  1EP4 A;  3V1Q A;  5KGW A;  4CE9 A;  4G1Q A;  1GOC A;  1ZBH A;  4OKE A;  5J2M A;  1HYZ A;  1CXQ A;  3AVB A;  4ID5 A;  2HND A;  1J9A A;  3H08 A;  4ICL A;  4N56 A;  3VQQ A;  4HUF A;  1RBT A;  5KGX A;  3ALY A;  2KW4 A;  4CGI A;  1T03 A;  3OS1 A;  2VWK A;  3LPU A;  2YKM A;  4IFV A;  2E4L A;  4CEQ A;  4DU3 A;  4B9U A;  1BI4 B;  4FJ5 A;  4DS4 A;  1S1T A;  3C6T A;  1RT3 A;  1FKP A;  4CER A;  3SQ2 A;  1RDB A;  4CK3 A;  3DLE A;  3MXJ A;  4I2P A;  4BE1 A;  3VA0 A;  4B9M A;  2HHS A;  1EX4 A;  4K8Z A;  3HYF A;  4DU1 A;  1KVA A;  1X1P A;  5HRP A;  4PY5 A;  3OYL A;  2B5J A;  3TI0 A;  4H8K A;  4FLZ A;  2XHB A;  1HQU A;  2FBV A;  3OY9 A;  3T1A A;  4ZTF A;  3M8S A;  3C94 A;  3K5N A;  1IKX A;  1KLM A;  2GV9 A;  3PX0 A;  1KLN A;  3NH0 A;  1BHL A;  4AH9 A;  1S1X A;  2WOM A;  2ETJ A;  4AHR A;  3QNN A;  4NYN A;  1R0A A;  2QKB A;  4CJS A;  1RBS A;  1VSE A;  3OJS A;  5KRS A;  3OJU A;  3VQ6 A;  4ZTJ A;  4O55 A;  4DTN A;  3ITH A;  2VG6 A;  3LPT A;  3LAM A;  3TAP A;  4W5Q A;  4FJX A;  3OYB A;  1U47 A;  1TK0 A;  1C0U A;  2O4I A;  2RN2 A;  3DLR A;  5CYQ A;  3HP6 A;  2OZS A;  3VQB A;  3TR8 A;  3M8R A;  4CES A;  4FLT A;  4BDZ A;  1JL2 A;  3T3F A;  5FRM A;  1KVC A;  4CF0 A;  4CJK A;  3K57 A;  2BAN A;  1VSK A;  3JYT A;  4Z4H A;  2JLE A;  4FLU A;  2A1R A;  3ISN C;  1SKR A;  4FJH A;  1RTI A;  3DOL A;  4CJR A;  3NH1 A;  2XO7 A;  4KRE A;  3E01 A;  3OS2 A;  3NCI A;  1D5A A;  1X9M A;  1TV6 A;  3O4Q A;  4W5R A;  2QKK A;  1A5X A;  2OPQ A;  3DI6 A;  3RMA A;  2ZE2 A;  3OYA A;  1JLF A;  3QIP A;  4CJ4 A;  3SPY A;  5KRT A;  4DLE A;  1HYV A;  1X9W A;  1SL1 A;  4B9V A;  4OLA A;  3V9S A;  1J5O A;  3TAB A;  3QO9 A;  1TK5 A;  1HNV A;  4Q0B A;  1JLE A;  3U3G A;  2G8V A;  1RBR A;  3L2R A;  4KHN A;  2OPR A;  3PX6 A;  2PYJ A;  2RKI A;  1SL0 A;  5T7B A;  3HVR A;  1VSM A;  4OPK A;  4FLY A;  4B3O A;  1DLO A;  3L2W A;  1VSJ A;  3AVC A;  3C95 A;  4FK4 A;  3G10 A;  3VQC A;  4Z4G A;  3OYH A;  3ULD A;  3CG7 A;  3NGY A;  1TKZ A;  3ZSW A;  1RT2 A;  4F3T A;  1KVB A;  3F9K A;  4KHQ A;  3WNF A;  3L2U A;  3V9Z A;  3QER A;  1VRT A;  1NK4 A;  3LZI A;  4RW7 A;  2HNZ A;  3CM6 A;  3ZT0 A;  2YHA A;  4M45 A;  1HYS A;  4FJ8 A;  4CF8 A;  1VSD A;  4DTM A;  4BAC A;  3KK3 A;  3QEW A;  5J2P A;  2XY5 A;  4KHU A;  2A1S A;  4OVL A;  4EP5 A;  3L2V A;  2BGG A;  1W9H A;  1S9G A;  2WON A;  2PYL A;  3AVM A;  1BCO A;  2KFN A;  4BWJ A;  5HLF A;  3EZ5 A;  4O44 A;  4CEA A;  3AVK A;  3D45 A;  4JRP A;  2FBX A;  4LSL A;  4DSL A;  4HCB A;  1BQM A;  4CJP A;  4FW1 A;  3OYG A;  2HB5 A;  5DMR A;  3K5O A;  1JL1 A;  1U49 A;  3SJJ A;  1NKC A;  4B9L A;  3CQ8 A;  2PY5 A;  3LWM A;  4GVM A;  4RW8 A;  2YNG A;  3KK2 A;  4DMN A;  4W5O A;  1FK9 A;  3DRR A;  1JLB A;  4LSN A;  5HRR A;  4KHS A;  1CZ9 A;  2B6A A;  3AVI A;  4CIE A;  4DTR A;  2NUB A;  2YNH A;  3CYM A;  3O4N A;  4C8L A;  4M3X A;  1IKW A;  3NE6 A;  1I3A A;  4ELU A;  3IS9 A;  4ZHR A;  5HRN A;  1L3S A;  5J2Q A;  5CZ1 A;  1RNH A;  3QIO A;  4DFJ A;  1A5V A;  2OA8 A;  4EZ6 A;  1VRU A;  1L3U A;  4CJ5 A;  3AVF A;  3ZSY A;  4CJQ A;  2KQ2 A;  3DRP A;  4Y1C A;  3LWL A;  3V9U A;  4DTS A;  3SUP A;  4DSE A;  4NCB A;  3SUO A;  3K58 A;  3S3N A;  4DTU A;  4RW9 A;  4CJ3 A;  3HPG A;  4R5P A;  1UWB A;  3NF7 A;  1L3T A;  3ZSV A;  4CJL A;  4F8R A;  3ZT2 A;  4YFU A;  4DF4 A;  2IOC A;  2P1J A;  4PA1 A;  4CHO A;  4M3T A;  3OVN A;  1JXB A;  1WSG A;  4EZ9 A;  3I8D A;  3OYC A;  1TAU A;  4DTP A;  1TKD A;  1S1U A;  5HP1 A;  2OZM A;  1BIS A;  1U4B A;  1NJW A;  3DRS A;  4K8X A;  4N47 A;  3ZCM A;  2HNY A;  3NHG A;  1LAW A;  1LW2 A;  1U04 A;  2E6L A;  3ZSO A;  3D0P A;  3QEX A;  4CHY A;  2G8K A;  3HJF A;  3L3V A;  1LWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...