4RW6A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 146
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw6A05
3MXIA 5T7BA 4Q43A 3EPIA 3IRXB 1RDBA 3KLVA 5KFJA 1HNIA 2I5JB 3HVTA 5EDWA 4M94A 1X9SA 4IG3B 1FKPB 4NYFA 4DSFA 5DQGA 4CF9A 4AHRA 1XHZA 4B9NA 3MR2A 3MECA 3F9KA 3VQ6A 1TKZA 4EZ9A 3TQ1A 4HYKA 4DTUA 3V6DA 1NKEA 4DTXA 5HLFB 4I7FB 4DQPA 1R0AB 5CYQA 4ECXA 3DRPB 1TL3B 1ZBLA 4IKAA 1C0UB 2UVRA 3H5UA 3M8QB 4JRQA 4Q0BA 3ZSQA 4OLAA 4ZPDA 3KOAA 5KRSA 3TAGA 2Y1IA 1F21A 2YKMA 4PWDB 1HYVA 5C24A 3G0ZA 1S48A 1QE1A 5KFGA 3S3MA 4ZVEA 1LW0B 2KW4A 4KI6A 4J2EA 4HHTA 2C2EA 5J2PB 4TQSA 5HP1A 4AHTA 3H5XA 3LALA 3KK3B 4FVMA 3TARA 4HCCA 4EO6A 2QK9A 1S0NA 3H4DA 4DQRA 2FVCA 2XI2A 3OLBA 3OJUA 4KHQA 1D0EA 2AX1A 2XWYA 5SWMA 5KT6A 1KLNA 3RMDA 3BSAA 4FJ9A 1FKOB 1N5YA 4WYLA 2JLEA 1EP4A 2BRLA 4URGA 1L3SA 5KG4A 4CJPA 3AV9A 2JEIA 3TAFA 1NK6A 3QGGA 4CEQA 4DMNA 3O4NA 5I3UB 3HHKA 1Y97A 1LWFB 3C6TB 1JL1A 2G8IA 2ZKUA 3VQCA 4QAGA 4O44A 1C1CA 4JV2A 4O4GB 3TAQA 4FLTA 3WNFA 3QEPA 4ICLB 3RRHA 1JLGA 3QEXA 4C8MA 3N6MA 4IRDA 3GIIA 1ZYQA 4YR0A 2F8SA 2KTQA 4F3TA 1W0HA 1LW2A 2IJNA 4IFVB 1MMLA 1RTIA 1S6QA 4ECSA 4DS5A 1BGXT 3HYFA 3NF8A 3RBDA 1VSDA 3DRRA 2KFNA 3OYDA 3NH2A 3VQBA 2BQUA 5F8NA 2AQ4A 2BANA 3H4BA 1NKCA 3MR5A 3DI6A 4ECRA 3SUOA 4K4ZA 1U09A 4QCLA 4LD0A 4CEEA 4ZVGA 3HVAA 4HUGA 5KG6A 4ZHRA 4DS4A 3GIJA 4L8RB 4B3OB 5DLGA 5KFDA 4KHRA 2HMIA 1JKHB 4M41A 4CGGA 3FRZA 4KAZA 3NBPB 1WLJA 4RNNA 4ECQA 1BCMA 4DFPA 3DOLA 2W9CA 3SYZA 3CDWA 4ED3A 4RW4B 4CK2A 4F4WA 2Z1HA 2Z1GA 4XPEA 4QPXA 3QGHA 2YKMB 1N48A 5F8HA 2GBZA 4ED1A 4E7HA 2WCXA 3RBEA 3I0SB 1S10A 3S3OA 3V1OA 4OPKA 3M9OB 5DLFA 1HQEA 4E1NA 3SQ0A 4WYWA 2PY5A 1CSJA 3G6VA 1SKSA 4HTUA 4EBDA 4AHCA 3P1GA 1REVA 2ITGA 1Z25A 2HB5A 4FZXC 4PWDA 2F8EX 3EYZA 3MFIA 1S1UA 3CQ8A 3RR7A 5HROA 4PQUA 4FJHA 2QXFA 5HRRA 4MK9A 2AU0A 5HP1B 1LAVA 1T05A 1BHLA 4KRFA 4ECZA 1HNVB 3A2FA 3TAEA 4RG8A 3NAHA 5DG9A 1S9EB 3NFAA 5KFZA 1JLEA 4RUAA 2P1JA 3LAMA 4HKQA 1IKXB 4IQXA 2E9TA 4F4YA 3OYBA 4NCBA 2YNFA 3T5KA 2AGPA 4HCBA 4DTOA 3KD5E 3IS9B 4KO0B 1O1WA 3KLHA 2JGUA 2HHXA 3CWJA 2BR0A 3CFPA 3M8PA 4IFVA 5KFUA 2Z1IA 4C8OA 3T3FA 1VSJA 4DF8A 1TAUA 4J9PA 3GILA 2DFEA 1BQMA 4JRPA 4FLYA 1N6QA 3KIOA 1W25A 4KE5A 4ELVA 4M95A 4TY9A 4URQU 2HHVA 2GUIA 2BRKA 3M9MB 5DK5A 3D5MA 1WSFA 2ASDA 1UOCA 2ZE2B 3HPOA 5J2QA 1YVFA 4J9RA 1X9WA 1L5UA 4Z4HA 1S6QB 3UIQA 5KRTA 4B9TA 5CYMA 4N41A 1S4FA 3VA0A 3BGRB 4LSNB 5I42A 4OLBA 5KFYA 2G8UA 4OKEA 2BQRA 1MU2A 1JXEA 1Z26A 2R8IA 2WB4A 4ECTA 3CYMA 1S49A 4E19A 3QEWA 4DL7A 3TR8A 3OS1A 3E01A 4ZVFA 4CJ3A 1TKZB 4G1QB 1TV6B 3TAPA 3IRXA 5KT3A 2OA8A 5HBMA 5KG7A 4LQ3A 1RYSA 3KLIB 3DRPA 5L1LA 3QYYA 3NMAA 1RNHA 2W8LA 3HP9A 3S9HA 2JC1A 4KV8A 3NE6A 4RUCA 3RB4A 4FS2A 2R8JA 5K14A 1S6PB 4JS4A 4YMEA 2ZD1B 5T14A 4M42A 1BL3A 4LSLA 1IKVB 3OL9A 3S3NA 4Q8EA 3H40A 2D41A 2R8GA 5KFBA 1LW0A 1RT2B 3ULDA 4Q44A 3ITHA 3RRGA 3KLGA 4MKBA 1T03B 2B6AA 3QIPB 4YR2A 3OYGA 2BE2A 4NLYA 2IM0A 3QLHB 4CHOA 1BI4B 4FW1A 5CZ2A 3AA3A 4OGCA 4DL3A 3LWMA 4AHUA 2IM2A 1NOZA 3AVHA 2C2DA 3MXMA 3ISNC 1QE1B 4N56A 2HNDB 4ZP6A 1BQNA 4DTRA 1RBSA 4ZTJA 5KG5A 4IG0B 5KFMA 1GOBA 4BE1A 4FZZA 4NLWA 4I9LA 3I5AA 2WTFA 1SH0A 1OS5A 3OYNA 4BWMA 4NLSA 1KHWA 2PYJA 4FLZA 2ILYA 4M3RA 2OZSA 3RB0A 2Y1JA 2BGGA 4KAIA 3DOKA 3M8PB 4Y1DA 1LWEA 4I2PB 4NCAA 1HNVA 1KFDA 3V6KA 3VQSA 3MFHA 2YNIA 5KT4A 2R2TA 3D28A 4AHSA 4OGEA 4GC7A 3MXJA 3AVLA 4ZPBA 1KFSA 4EYHB 1QUVA 4FJLA 3V9ZA 4OKKA 3ASMA 3UDLA 3NHGA 4KHSA 2FLPA 2NUBA 4U6PA 3CM6A 4DSKA 2D5RA 3QO9B 4I2QB 3LZIA 5EWEA 3T1AA 4KHUA 4YR3A 1GX5A 5KFPA 2IDOA 2B43A 3CJ4A 3RMBA 1KVCA 4KHYA 3NGYA 1B9FA 3KHGA 4QOZB 1B9DA 2EX3A 3SNNA 1HPZB 3QNOA 4IH5A 5KFOA 1G15A 4EBEA 4EZ6A 4ED0A 4O5BA 3V1QA 2W42A 5DQIA 3IN5A 5KFTA 5EUHA 4EYIB 1K1QA 1WSIA 4K4VA 5DG8A 3EY1A 4NLUA 4URSA 3NCIA 4FLXA 2W9CB 4O3RA 5D3GA 2WONB 4DLEA 3V1RA 5JS2A 2ZD1A 5KI6A 3ZSZA 3KK2B 3NDKA 2V4QA 4CEFA 2RN2A 1RT3B 3H5YA 3ITHB 4F4XA 2P5GA 3EZUA 1L3TA 3UPFA 1JKHA 4K4UA 1EXQA 1TK0A 3AVKA 4ED6A 3DYAB 1TGOA 1BI4A 2XO7A 4W5QA 4ZP8A 5L1IA 3EPGA 3WNHA 2XCAA 1RA6A 4IR9A 1RAJA 5EWFA 4Z4CA 2ASJA 2P5OA 4KI4A 3KLEA 1QAJA 2OYQA 5KG2A 5KFKA 3T5LA 1D9FA 1WAJA 2EC0A 3CDEA 2W9AA 3KLGB 1DTTB 4BWJA 2JEFA 3BQ1A 1HMVB 2AWZA 4BE2A 1ZTWA 3HM9A 1NK0A 1XI1A 4TXSA 2EHGA 3VQPA 4CGFA 2W9BA 2W8KA 3QEIA 2ATLA 5F8IA 4EO8A 3G6YA 3SPYA 3RMAA 1FXXA 4Y2AA 1S9FA 3VQ8A 3LP1A 4PA1A 3ZT0A 4CHNA 3KHHA 1A5WA 4FJGA 3ZT1A 5KGWA 4KBIA 4FXDA 4DWIA 3ZT3A 3FFIB 1ZTTA 3VQQA 1VSFA 2HNYA 3DLHA 3LP0A 5JXSA 1IKWA 5FRMA 4K4SA 1XR6A 2ETJA 5J2MA 2W7PA 4CK1A 3ISND 4CIEA 3NF9A 3T5HA 1SL0A 1ASVA 4RNMA 4KREA 3LPUA 3FDSA 3BREA 3KD1E 2F8TA 3OHAA 4CGDA 5F8JA 3DLGA 2AGOA 2VA2A 4CJ4A 1FK9B 3ZT4A 1TKTA 1U45A 1RDDA 1HNIB 1RTDA 3AVNA 4NCGA 4FJJA 3WNGA 2WOMA 4J9LA 4IKFA 2HVHA 3BSNA 1N6QB 3VQ7A 4CJQA 4DTPA 4ZPCA 3PJXA 1ASWA 1TQLA 1LV5A 4YNQA 3DMJB 2DPJA 2WK4A 4EP5A 2ILZA 3VN5A 3CDUA 2X74A 2IA6A 4DFJA 3LAKA 1Q9XA 1U4BA 4ID5A 4CJTA 1XHXA 4FJ8A 3PHEA 4E3SA 1S9GB 4KB1A 4W5RA 4KB7A 5C42A 2R2UA 1VSHA 4DSLA 1RBUA 4O3OA 4FK4A 4YFUA 4CESA 2YKNB 4K50A 5CYQB 1NOYA 3LP2A 3OL8A 2GIRA 4FM0A 1QQCA 1T94A 2QKBA 3GQCA 1RBTA 4DU4A 4RW9A 3CFOA 3O3GA 3SI8A 3HSTB 3TANA 3L2RA 3C95A 4BACA 4BE0A 1U47A 4HUFA 4FLUA 4FJXA 1IKYA 2PYLA 4CEZA 2FLLA 3DLKA 3E51A 2IM1A 2HWIA 4N76A 3DRRB 5HLFA 1C0TB 1T03A 4H54A 3THVA 3T5JA 2ATQA 3KKRA 3AVJA 2BE2B 3PX6A 2R8KA 2IAJB 4FBTA 1XR7A 3VQ4A 3DI6B 4CERA 5DMRA 4UQGA 2R8HA 3MEDB 4PUOA 3PO5A 2V0NA 3UQSA 4BDZA 1RBVA 1UWBB 2R2RA 4WFZA 4LSLB 1S0MA 3UR0A 3VQAA 2OPPA 2AX0A 4IG0A 1XWLA 4WZMA 2B6AB 1DTTA 4U7CA 2G8WA 4J9OA 5KFHA 5DG7A 5FROA 2HNYB 2XY7A 3TAMB 4RW4A 2GC8A 5F8MA 3V9UA 3QLHA 3G86A 5KG1A 4R8UA 4CF2A 4NLQA 4O3QA 1ZBFA 4E0DA 4FK2A 4H4OB 3NH0A 4CJVA 3D0PA 4HVJA 1VSLA 1QTMA 5C25B 3OYKA 5SZTA 3AA2A 4CJSA 3O3FA 1JLCB 1RDRA 3QINA 3HVRA 4JV1A 3CJ5A 3DM2A 3HL8A 4CEDA 4TLRA 3L2QA 4J9MA 3ZSYA 2XY5A 1EKEA 1NK4A 3DRSB 2X6SA 2HHUA 1RTIB 1JX4A 1TKTB 1IH7A 3QIDA 1JLQB 1LWCB 4RW6A 4DQIA 3L2VA 3AO4A 1KCFA 4O4GA 1C6VA 3SQ1A 1JLGB 3O3HA 4RW7A 3SZ2A 1HJRA 3SQ4A 4PY5A 3AVGA 1YT3A 4QWBA 2IC3B 3OYEA 1TVRA 3NF6A 4ED7A 4G3IA 4C8KA 4CEOA 2HWHA 4IDKA 1SL2A 2FVSA 3AO3A 1KSPA 4IRKA 4IBNA 3JSMA 4IH6A 2YV0X 2YKNA 1RTJA 1BCOA 1Q9YA 3IS9A 4KO0A 1JXLA 3NAIA 3VQDA 3OHBA 3QZ7A 5KFXA 3KLFA 3MEGA 3KK1A 3OS2A 2V4RA 1A5VA 4WFXA 4O55A 2FVPA 4B08A 4MQ3A 3DLKB 3Q8RB 2DFFA 2I5JA 1JLAA 4OVLA 5HRPA 1C0TA 1U04A 1DLOB 1KHVA 2FVQA 1XC9A 2G8FA 1ITGA 3PUFA 3SUNA 1NK5A 4ED8A 1Z4UA 1SL1A 1VSIA 4ELUA 2G8HA 4KFBB 2XC9A 3KHLA 4TSXA 5KFIA 3LWLA 4RW9B 3OYMA 5JS1A 3MECB 4ECVA 1JL2A 4ZVHA 3QERA 4M3UA 5KFLA 3PV8A 2YHBA 1ZBUA 2DFHA 4LSNA 5I42B 4XO0A 1IKYB 5KT5A 3F73A 2DTUA 4O4RA 1T7PA 1SUQB 3AVCA 2QE5A 1GOAA 2VG5B 1JLBB 2FJVA 4AH9A 4J9SA 2XRIA 3AVBA 4ECWA 2AGQA 4FYDA 3VA3A 3KMSA 1J9AA 3OYJA 2P51A 4DQQA 1RT5B 4H4OA 4CHYA 5E41A 3K59A 1S9EA 2HNZB 4NLDA 1BIZA 4M3WA 4E89A 3CFRA 3P83D 4DSEA 4YQWA 1VRUA 4RNHA 3L8BA 3DDKA 3I0RB 3L2WA 3PW4A 2YNFB 1KTQA 4FM1A 3OL7A 2XY8A 3LP0B 1QS4A 2HHTA 3PR5B 4CECA 2W9BB 4NYZA 5EWGA 2J6UA 2JC0A 4FCYA 2IBKA 4RW8B 3N6NA 2O5DA 1JLEB 1RT7A 2D3UA 3HT3A 1IKXA 4CHPA 3QIPA 4QWDA 4DL6A 4J2DA 3FFIA 5KT2A 2F96A 4E1MA 3H08A 2CJQA 2YNGB 1TAQA 4N5SA 1RTDB 2D0BA 3SI6A 4R5PB 4Y2CA 3CO9A 4DTNA 1LWCA 1HYSA 3RB6A 1K6YA 1S97A 1GOCA 1RTHB 2HAIA 3PR4A 2V9WA 1J5OA 3K2PA 1MU2B 4J2AA 1BISA 2XCPA 5J1EA 1U49A 2UVVA 5CZ1A 1TKXB 1LWFA 4NLPA 3SPZA 4WZQA 1LW2B 4CJFA 3V9SA 4B8CA 4B9VA 1TVRB 5HRSA 2OPSA 3AVIA 4DTMA 1RT4B 1T3NA 1S9GA 3DLEA 1WSJA 4CEBA 1N4LA 3ZSVA 4ICLA 4IDKB 3KLIA 4C8LA 2GIQA 2DPIA 1C1BB 1RTJB 2D3ZA 5EU7A 3V6JA 4CIFA 2BANB 4ELTA 4WE1B 4NRUA 1RT6B 1HYZA 1S1XB 5KFSA 2HVIA 2I1RA 4FLWA 2R7YA 4TY8B 4FJIA 4RU9A 4Q8FA 4OPJA 2JEGA 4J9QA 2BDPA 4ZHRB 4Z4GA 1RT2A 4OL8A 4KKOA 3Q8PB 1HARA 4Z4IA 1JLAB 1D9DA 3GIMA 1NK9A 3OLAA 4W5OA 1TKDA 3CIZA 2A1RA 1NKBA 5KFNA 3HVWA 5FDLB 3CJ3A 1RT5A 1J54A 4DL2A 4CJLA 2FBVA 4CHZA 3NKYA 1QHTA 4IRCA 2X78A 5FRNA 3K5OA 2HNDA 3G6XA 4BDYA 1W9HA 3M8SA 2VG6B 1K1SA 4FM2A 1SUQA 3RB3A 4NLGA 2RPIA 4OJRA 2OPQA 4IFYA 3ZSRA 3NL0A 2UUWA 2IOCA 1TK5A 3U6FA 4DFMA 1IM4A 3WNEA 4CGJA 3TVKA 2UUTA 2XGQA 1C1AA 4B9SA 5F8LA 3NH1A 3V6HA 3PW2A 2E6LA 3I0SA 2LSNA 3AVFA 2OPPB 1S1UB 2XGPA 3BQ2A 3MF5A 1EETA 1R0AA 4O3NA 4ECYA 4H8KA 1JLCA 1FKPA 4MIAA 1LAWA 4PQUB 4DL5A 3TABA 1SV5A 2C22A 3PO4A 3RWUA 3AO5A 4ECUA 1TK8A 2GV9A 2CKWA 3Q8SB 4MKAA 4XPCA 4F4KA 3H5SA 3MEEA 3SUQA 3H98A 3CM5A 2E9ZA 5HROB 3K57A 4F8RA 4X2BA 4KHWA 1SH2A 4WXOA 3P5JA 3KK3A 4LH5A 4F4ZA 4HUEA 3B6PA 1T05B 4TYAA 3SUPA 1NK7A 4Z4FA 1KLMA 1QSLA 1CXQA 3V4IA 1RDAA 1JIHA 4CJUA 3SQ2A 4H4MA 2YNGA 1X1PA 2HHSA 1NJWA 4CGHA 5KFRA 3QGIA 3Q8QB 4CE9A 3L3UA 4AHVA 3I5CA 4FJMA 2VG7B 2RF2B 4MH8A 3IGNA 1UA0A 4DL4A 1SH3A 4NZ0A 1SKRA 4KB0A 3V81B 5KT7A 3HPGA 2AJQA 2ZE2A 3OSNA 3NGZA 4O44B 2WRMA 3BR9A 4FJ7A 1ZETA 2B5JB 1D8YA 4KHNA 3GV5B 4B9MA 4CFDA 4XIUA 2FJWA 5KFAA 4C8NA 4DG1B 4TYBA 1KRPA 4E7LA 5DGAA 3BSOA 3C6TA 3V9XA 4GW6A 4M3YA 4Y1CA 1FK9A 3I5BA 1S1XA 4EP4A 3MR3A 4JV0A 4EBCA 2G8KA 3G10A 4CF0A 4FS1A 3IAYA 2QKKA 4ZP9A 3C94A 4CJEA 2B4JA 2D0AA 5L1KA 1TL3A 4O3SA 2FBXA 4FW2A 4IH7A 1C0UA 4KTQA 1B92A 4O3PA 4I9QA 3OJSA 4N47A 3FQKA 5F9NA 4O0IA 2HHQA 3PY8A 1WN7A 5HBMB 4CJKA 4TN2A 5C42B 4IR1A 3KLEB 4F2RA 2KZMA 5KFQA 3I0RA 2IMWP 3PZPA 3NBPA 2G8VA 3AVAA 3PVXA 4JUZA 4DSIA 2C28A 1BIUA 3LDSA 4J2BA 2IS3A 4KV8B 2OPQB 4KHMA 1L3UA 1S1TA 1QSYA 3KKSA 5JUMA 5KGXA 3SV4A 2O4GA 1NJXA 3LANA 3KTQA 1S6PA 2OPRB 3ZT2A 4FJNA 3PJWA 2ZQBA 1IKVA 3TI0A 3MEEB 4R0EA 3BSCA 5F9LA 1RT7B 3CVKA 1WSGA 1YVUA 1HQEB 1VRUB 1WNEA 4JLHA 4Y3CA 3DLGB 3M8RA 3L2UA 4J9KA 4EEYA 4CCHA 4Z4EA 4B8AB 4K8XA 1RT1A 4RZRA 4CGIA 3ZSOA 4KSEB 3SFUA 1RTHA 4FLVA 1GX6A 3QNNA 3ALYA 1TKXA 3RTVA 3U3GA 3RMCA 4NLOA 3SV3A 3JYTA 3C6UA 3V81A 2HW3A 3GV8B 1HQUB 4DQSA 1S1WB 2IJFA 1RCHA 1RT4A 1REVB 1C2PA 4DFKA 4DTJA 4BDPA 3K5MA 4H4MB 3IG1B 4FK0A 3LP3A 4R5PA 2FBYA 4NCGB 5KFWA 4B9LA 3HJFA 4DG1A 4DEZA 4YP3A 5KTQA 1DTQB 2W7OA 1NK8A 1L3VA 5DQHA 3FQLA 4MK7A 4ED2A 4ZTFA 4DSJA 4FZYA 3GYNA 5KFEA 1JLQA 4K4TA 4E7KA 2Q3SA 3I8DA 2IM3A 2Z1JA 1KVBA 1ZBIA 2HHWA 4CJ5A 4B3OA 3M9NB 1QAIA 2RKIA 3K5LA 1C1BA 4MK8A 4IOBA 4F2SA 3KLHB 5FDLA 4DLGA 3MEDA 1TL1A 4PUOB 4NYNA 1JLFB 4TY8A 3KJVB 2YNHB 1TP7A 1D5AA 1NHUA 4K4WA 3OL6A 1NNDA 2X6NA 3NAEA 2WHOA 3SFGA 2VG6A 3B6OA 4Q45A 3PW0A 1I39A 1VRTA 5CY4A 3DLRA 1S5JA 3AO1A 4Z0UA 5D3GB 5KG0A 1S0OA 5J2QB 4M3TA 2KZZA 4G1QA 3KK2A 3MR6A 3CJ2A 4DU3A 4GVMA 5CYMB 2FC0A 1Q8IA 1EETB 1J53A 5KFFA 4IG3A 2E6MA 1CZ9A 4JS5A 4DU1A 1RILA 4CIGA 4AILC 1SV5B 1HMVA 3E01B 1KVAA 3M8QA 4CF1A 1S1TB 3HO1A 4R8UB 4M3ZA 4TQRA 3OYIA 2XY6A 4CFAA 3VQEA 3OYCA 1RYRA 2XI3A 2J6SA 4F3OA 1WNSA 2DY4A 2C2RA 2E4LA 3QIOA 3OY9A 3V6DB 4GMJB 2VWKA 4I7FA 2R2SA 3EZ5A 2ASLA 2UVUA 1IKWB 3DLBA 1S1WA 5K14B 3AA4A 4LQ9A 3V9WA 1CXUA 5C24B 1BQMB 1EP4B 3KNAA 4KPYA 1VSMA 5J2PA 5I3UA 3U3YA 2E9RX 4KTWA 1XR5A 3LPTA 3BQ0A 3HP6A 3DOKB 4ZPAA 2O4IA 1NHVA 3JYTB 3D45A 3KLFB 3SCXA 4CFCA 3V4IB 1HQUA 2FJXA 2FVRA 5J2MB 1RA7A 3K58A 4Y34A 1CZBA 5L9XA 3IG1A 3T19A 1C0MA 1VK0A 3HK2A 5J2NA 2KFZA 1WSEA 1BQNB 2BQ3A 5DGBA 2VA3A 2OZMA 2FBTA 2VG7A 4E7IA 3QZ8A 3RAQA 4M45A 1I3AA 4KFBA 3AO2A 4NRTA 4OKJA 1YTAA 1IO2A 3NGDA 1N56A 3BJYA 1U48A 3KJVA 2A1SA 4I2QA 2YNHA 1IG9A 3GV7B 3AVMA 4K4XA 1TV6A 2WOMB 2B5JA 2ALZA 3HXMA 3PW5A 3NGIA 2PZSA 1DLOA 3DMJA 2RKIB 2VG5A 4Q5VA 3LP2B 3FSIA 4MFBA 2D0CA 2JEJA 4W5TA 1JLFA 3QO9A 5KFVA 3HVTB 2HNZA 4NLVA 3SJJA 4DTSA 3OYHA 1D1UA 3PX0A 1ASUA 1I6JA 4K8ZA 1S1VA 2IGIA 3LZJA 1JLBA 2IAJA 1RT6A 3MAQA 4W5NA 4CJWA 3MTKA 4NLTA 4QWEA 3L3VA 3GIKA 3ZSWA 4CFBA 4ZMMA 1RT3A 2J6TA 1HRHA 4K4YA 4FJ5A 4NLRA 4E7JA 4CEAA 1T8EA 3N6LA 3O4QA 2XHBA 3TWHA 3HKWA 2HMIB 4B9UA 3OS0A 3DOLB 4J9NA 4Q0BB 4WXWA 1NJZA 1X9MA 3QESA 2OPRA 1LWEB 1UWBA 4I2PA 4QWCA 5HRNA 1WAFA 3KMQA 1SKWA 3H2LA 4QW8A 4RW8A 2YNIB 3VQ5A 4F50A 3K5NA 2OH2A 4QW9A 1J5OB 3OYFA 1YTUA 1JXBA 5J1EB 4IFYB 3OSPA 2RDJA 1EX4A 5KG3A 1RDCA 4O0JA 3C6UB 3DYAA 4QWAA 3TAMA 1NJYA 3DRSA 3RAXA 1A5XA 2OPSB 3HPHA 4RNFA 1UAXA 1RT1B 2FLNA 3AA5X 3IGVA 3DLEB 4M3XA 4RW6B 5C25A 5J2NB 3ZCMA 1HYSB 1CLQA 3H59A 3CJ0A 1QSSA 1VSKA 4GC6A 3OVNA 3DM2B 4MIBA 4CF8A 4RW7B 3QETA 3PX4A 1WSHA 4KTZA 2UVWA 1RBRA 4CK3A 4DF4A 3NF7A 4LH4A 2D7SA 2VWJA 4LY7A 1HPZA 4FBUA 1FKOA 1N5YB 2QV6A 3CG7A 3PW7A 3LP1B 3VQ9A 3ICLA 3JSMB 4RNOA 4ID1A 1DTQA 4CJRA 5L1JA 1KLMB 3OYLA 1TL1B 4MFBB 5C5JA 2IC3A 4WE1A 3MEGB 2WONA 5KFCA 1VSEA 1C1CB 4NLXA 3RR8A 3BGRA 2RF2A 4KKOB 3BDPA 4CHQA 1VRTB 2KQ2A 3OYAA 4ZP7A 2RDIA 1S1VB 5F8GA 3KHRA 1UA1A 2YHAA 3ZSXA 1ZBHA 4ID5B 3KK1B 4WFYA 3QEVA 4FJKA
chains in the Genus database with same CATH superfamily
4Q43A 2BTFA 3EPIA 5KFJA 1HNIA 5CCMA 4ZK7M 5EDWA 4P9SA 1X9SA 3FZKA 1FKPB 1UEVA 5IXUA 1PC4A 4GVBB 1YK9A 1XHZA 4B9NA 2O8BA 3MECA 3VQ6A 2J8SA 4IYQA 3GFXA 3HHLB 5ADXH 1EQMA 2HSTA 3R6LB 3D54A 1OYEA 3T1YF 5AQQA 5L38A 4DTXA 3IFEA 4GKJK 1R0AB 3ATVA 5CYQA 4ECXA 1TL3B 3NCPA 4IKAA 2P9SB 2XYGB 1ZBLA 1X0FA 4NXNK 2UVRA 4Q0BA 3JAMO 3MWTA 4JHDB 1V3RA 3W64A 4OLAA 4ZPDA 5KRSA 3QMLA 1ATSA 2YKMA 4PWDB 1PSDA 1M5VC 1QE1A 4Y0FA 1LW0B 4J2EA 4I68A 4HHTA 5J2PB 3E8OA 2NXUA 5AT1B 4TQSA 1PYSB 4AHTA 3H5XA 4CWBA 1GLJO 4J8FA 3DRYA 2NPFA 4PHTX 1S0NA 3TX8A 4DQRA 3Q7CA 2XI2A 2YX7A 3OLBA 2U2FA 1D0EA 1VQKN 3MZIA 5KT6A 4M5KA 1KLNA 5IZHA 4WFBL 5H9EK 3CCWA 2DKOB 3IBCB 1NK6A 3C16B 3O4NA 3EICA 2R7VA 3JS9A 4DV2K 1Y97A 5LMNK 5HVFA 1JL1A 2G8IA 1FI4A 4O44A 3VF4A 1C1CA 4CTAA 4CI0B 4O4GB 4A8YA 4FLTA 2B9EA 2W4DA 3T7ZA 4CO2A 4C8MA 2B3TB 4F3TA 2F4FA 3W62A 2E8AA 1T6CA 5CH7B 4IFVB 2GIFA 3KJQB 2VGNA 2OEMA 3NF8A 1N36K 2RQ4A 5BN8A 4OI1A 3CJSA 3W2WB 2HHHJ 4AM7A 2BANA 1NKCA 5EX0A 3DI6A 4IOCQ 4KHPJ 1R8CA 4ECRA 2H4YB 3SUOA 4F0HA 4K0KK 4BRFA 2KRRA 4ZVGA 3HVAA 3PFOA 3IAM9 4JAXA 3FK4A 4EFAC 2HBLA 5DLGA 2A41A 2VOOA 2M70A 3GJTB 3L7PA 3R5CA 3W5XA 1KR4A 4ECQA 4FP9A 4JI2K 3DOLA 2W9CA 3SYZA 1HIYA 4B1VA 2DNQA 3HT0A 3BBCA 2Z1GA 1FD8A 2W1BA 1N48A 4ED1A 1BA0A 4E7HA 2WCXA 1X7VA 3QPIA 2CWXA 1J6ZA 3ZTRA 3MMVA 4QIEA 1HQEA 4ZPWR 2YHYA 3CDBA 5LSLA 1RISA 2R4FA 3SQ0A 4O23A 1TL4A 1EKSA 1HUXA 2DH7A 3PRVA 1VQPN 3P1GA 2CPYA 3VF0B 4DUZJ 4FZXC 4HTIA 1UJ5A 1UKUA 5HROA 1FTRA 1WEZA 1FEHA 1TFWA 2N4DA 2WSFC 2AU0A 5HP1B 1LAVA 3TJ8A 1AT1B 1BLUA 4LFCK 1XMBA 4UZCA 1TL7B 3LGHA 4RG8A 5IT9O 1RAAB 4LF5J 4JI8K 2GVDB 4JYAK 5DG9A 1S9EB 2DR7A 2AT1B 1N33F 2P1JA 3LAMA 3IM8A 3UKUA 4F4YA 4LF4F 4NCBA 1KVKA 2YNFA 4K2JA 3ZZTA 1KAXA 8ATCB 2XS7A 3IS9B 4JKGB 4UOFA 5DS7A 3KLHA 4FXVA 2DBBA 3T3FA 4RBVA 4DF8A 2DFEA 1KQKA 3NCQA 3O44A 3MCOA 3PCOB 4J7CA 3E9OA 2I7NA 2MZ1A 1W25A 2RUSA 4KE5A 4URQU 2GUIA 4L6V3 5KOXA 2VFRA 5TKYA 3K8WA 4ES1A 2ZE2B 2MKYA 4ZN1A 4JV5K 2EFVA 1L5UA 4Z4HA 2O8CB 1IQZA 2NLWA 3VAMA 3UIQA 2C2NA 3KJFB 5BYQA 1MMDA 1F9EB 2WB4A 2CZ4A 3W63A 4E19A 2OAUA 3AD9C 3QEWA 2L48A 2HBRB 2V4JB 2V52B 2ALYB 5E84A 5T41A 2WBNA 2OA8A 1CJUA 5HBMA 1P9YA 1OSCA 1RYSA 3F5TA 3MX5A 1FEEA 4IEEA 3VGMA 3CD7A 3DRPA 4KGMA 4BRNA 2N7YA 2POKA 4UY85 4RUCA 3TZZA 1IBKK 3ZX2A 2R8JA 3A3OB 1S6PB 4JS4A 1RABB 5T14A 3CJTA 1BL3A 5CD4A 3OL9A 3H40A 2D41A 3ULDA 3GJRB 5CAAA 2E5IA 2Y8WA 2VJUA 3GCWP 2B6AA 3T9NA 3NRBA 2Q31A 4YR2A 4ETZA 2AJFE 1S7HA 3NS6A 3EE8A 3QLHB 1H7WA 3EM1A 1BI4B 4FW1A 4BC7A 2KH9A 3UDCA 3AAQA 4CZMA 4AHUA 1RWOB 2C2DA 3ISNC 3B6BA 1VHIA 1WWHA 3BF3A 3OFHA 4OMFG 3OFEA 3QT8A 1H72C 2WTFA 3HSDA 2E5JA 4NLSA 2J7UA 4M3RA 4IO8A 2OELA 4NCAA 1LWEA 4Y1DA 1HNVA 5HMZA 1VBKA 4XAKA 2FZCB 3MFHA 1NHKL 3BZCA 4HACA 1O13A 1HNXK 4GC7A 4C4WA 2VFSA 4ZPBA 1WB9A 4WP3A 2DITA 3ASMA 4DV0K 5CD4H 5I9EB 5FPEA 1R0CB 1SQFA 3FE1A 2D5RA 1WJ9A 3QO9B 3G6ES 3SQGB 4LRAA 2DNOA 4ED5A 3P8BB 2ROEA 5EWEA 3BGUA 1JQGA 3CCVN 2ASOA 3NGYA 1B9FA 2EX3A 5GIPA 2V63A 3QNOA 5B0BA 1BHNA 1WOPA 1X4CA 2H54B 4HL9A 2PMWA 2W2PP 3A5MC 2BKNA 5G4DA 1XUPO 4H0VB 5DQIA 1CULA 5KFTA 5EUHA 4URSA 4IFEA 4O3RA 3IO1A 3BDEA 3MOZA 2WONB 2RHSB 4LR9A 3V1RA 5LSOA 5GIOA 5JS2A 2ZD1A 3ZSZA 2E2NA 2V4QA 3A8YA 4CEFA 1OPZA 1FX2A 2ZH9A 1R8BA 1RT3B 4OX7A 3ITHB 1L3TA 5I3PA 1BY9A 5D77A 3L95X 4K4UA 2BYCA 4KH0B 1CBKA 4CLYA 2HHHK 1ZAVA 4AL5A 3AVKA 3SEOA 5A8KB 2VUGA 1TGOA 4K0KJ 3O6QA 4ZP8A 1AROP 2VF3A 1RA6A 1M90T 4Z4CA 1FVSA 3ZZPA 1NPPA 2FJBB 3FEXB 1MWQA 2EC0A 1HKGA 3CDEA 1VK3A 3KLGB 1DTTB 4DV1J 3J7A1 3BQ1A 4ISEA 3HHDA 4BE2A 1R0BG 1ZTWA 5K8MA 3HM9A 4EIAA 1YJWS 3EVOA 4DV4F 3VQPA 4CGFA 1WG5A 2W9BA 3UI3A 2AHOB 2ATLA 3LA0A 3UD3P 2K2PA 3Q8YA 1EX8A 5KQ8A 3RMAA 2EFPA 1UW4A 5MLCQ 5M1QA 4J9VA 3KHHA 3UDEA 3ZT1A 4DWIA 1F3VA 3ZT3A 3FFIB 1KONA 4BREA 1IKWA 2V2QA 2ZJQL 3W5ZA 1XR6A 4WPAA 1FKAF 4DUZK 1WHYA 4NEZA 3D7EO 3CCTA 3ISND 4CM0A 1PO6A 2V51B 3DOMB 3NF9A 5L46A 3T5HA 4RNMA 4KREA 1VQ4S 3LPUA 5M2UA 1PYOB 1BQXA 1FNOA 4JI8F 3BREA 3QRPA 4JI3K 3CC4S 3PTWA 5HN0A 2AGOA 2VA2A 2RHKA 2ACMA 1AFJA 3Q8VA 4U9RA 1TUUA 4K59A 3CD6N 1TKTA 3UNGC 4GKKF 4WF9Q 2LQ5A 2LU1A 3WNGA 4J9LA 2HVHA 2YX6A 3CJ1A 1XMQJ 2UP1A 2DPJA 2RT3A 2WK4A 4DKWA 2GX8A 2ILZA 2X74A 4DV4K 2IA6A 2MEWA 4DFJA 1RQ0A 3LAKA 3JXUA 3PIPQ 4H5VA 1H7XA 3PFEA 4YS2A 4YN3B 2LECA 4IOAQ 4OI2A 4E3SA 1XMQF 4KB7A 2NS1B 4NA1A 5C42A 1VSHA 3C0BA 4CESA 3MMCA 3UKRB 4C1NI 2HRTA 1NOYA 1CG2A 2GIRA 2VOPA 2XO6A 4RW9A 3Q8UA 3HSTB 3HTVA 3L2RA 2EPIA 2YPZA 4BACA 2E44A 3ADAC 2B7CB 1IKYA 3EVWA 4CEZA 3DLKA 4JYAF 2Z58B 3BN4A 2IM1A 5GAEI 2HWIA 4N76A 1GMWD 2ZDPA 1C0TB 2PI4A 2VU5A 2UU9K 3W2WA 3KKRA 1QVGM 5AQMA 3RW6A 2R8KA 3BGLA 1XR7A 3DI6B 5JICA 2FJEB 4DPUA 2R8HA 3MEDB 3FRYA 2V0NA 3UQSA 4YORA 3BH6B 4HHUA 1UWBB 2R2RA 5AR0A 1XWLA 1QVGR 2QTDA 4UTGA 4U7CA 2Z2ZA 4J9OA 5KFHA 5DG7A 3CCMN 3MUMP 3V9UA 1NMDA 1VLOA 1TYQB 4O3QA 1ZBFA 3D0PA 1W7WA 4HVJA 2XEXA 3AHPA 1NGCA 1VSLA 1QTMA 4RO0A 4GKJF 4CJSA 3O3FA 1HBNA 1JLCB 3S7RA 3HVRA 2MQ8A 4JI2F 3HL8A 5M1NA 1UPPA 2ZH2A 3O9UA 4BR7A 1B0PA 2XY5A 1EKEA 5CCLA 1RTIB 3M30A 2NRTA 4JI0J 2AEJA 3VETA 3L2VA 3AO4A 1VQSA 1KCFA 2G9OA 1SQEA 3TA1A 5AE1A 2JWNA 4CZJA 4OFZA 3E3XA 2A6AA 4CLTA 3SZ2A 1HJRA 2YH1A 4PY5A 2AYMA 5M1PA 4QWBA 1ZZFA 3OYEA 3SCJE 3EL2A 1N36F 3QSIA 1DT9A 5F0WA 1X3MA 3CJKA 4CEOA 4DV7J 2FVSA 1KSPA 3JSMA 3QGPA 2KM8C 3IS9A 4BLGA 4P74A 4S0MA 4DN9A 3QZ7A 4CLFA 1GTEA 2Q1LA 3PACA 2WW8A 4CLKA 4J5OA 3O1BA 4LFBF 2FVPA 4B08A 3ZXWA 3Q8RB 2DFFA 3DLLQ 2APOA 1N34J 5HRPA 1U04A 2QG9B 3C15B 2G8FA 2ZBIA 4RX6A 3FMBA 5F41A 3C6HA 3PUFA 1Q7YT 1Z4UA 4ZCIA 2CPDA 1VSIA 3TUIC 2WB1D 3LWLA 5JS1A 2MQLA 4ECVA 1TUGB 4ZVHA 3BR8A 2YHBA 3RSEA 2DFHA 1NXIA 4XO0A 5C7PA 5KT5A 3I4HX 5GADU 2A2DA 4FN5A 1SUQB 1PBAA 3AVCA 4DUYF 1GOAA 2FJVA 5ETOA 4J9SA 5B09A 3KMSA 2OHDA 1J9AA 2IIHA 4OYWA 2P51A 1BWFO 2WW4A 4DB3A 3WIUA 2QFIA 2A10A 3VZIA 5AQOA 1PKUA 4NLDA 5H1SV 3P83D 3DDKA 2YY3A 1KTQA 3OL7A 1LOUA 1NSAA 4NXNF 1SJRA 1QS4A 2HHTA 1GXLA 2XS2A 4CECA 3R9LA 3NGSA 1TTHB 4DR6F 4NYZA 4QIFA 2JC0A 5K8OA 2RNEA 2IBKA 3L0QA 2P9PA 4OLPA 4USMA 4NXMF 1JLEB 4TNOA 2Z57B 1IKXA 2QO3A 4DV1K 4CHPA 1VQ7N 3QIPA 4YOWA 2W2NP 4QWDA 2WFBA 2P9EA 1RDUA 5AZJA 1EARA 2EFOA 1LEOA 1K8AT 1T9UA 3H08A 2JVOA 3LTOA 2XQCA 3L3CA 4N5SA 1RE1B 4YB6A 3TYTA 1Y3KA 2D0BA 3SI6A 3CO9A 4DTNA 3MM7B 3H46O 2V9WA 2XCPA 2C2KB 1U49A 5L39A 4LFBK 2M5YA 4NLPA 2DY9A 4H5TA 2QA4S 4KGKA 1S9GA 4ZS6A 5ETLA 5DDPC 1N4LA 4JP8A 4RUHA 1KD1O 2GIQA 5KPZA 3R5AA 1C1BB 2DRDA 2D3ZA 2ZHAA 5EU7A 1P8ZA 2I38A 1FJGF 2R7OA 4ELTA 4WE1B 3B8AX 4NRUA 1H73A 4FLWA 1FFWB 4X84A 4RU9A 1NEEA 1FXLA 3MEKA 4G9ZA 2V2ZA 3TTFA 2LQ9A 4DHYA 4ZVRB 4KKOA 1HARA 1JLAB 1D9DA 5CHCB 1MDUB 1PYTA 2COLA 1U1KA 3VAKA 4W5OA 4ILRA 3CIZA 3D66A 3HD2A 5KFNA 3HVWA 1HWLA 3HMJG 5GADP 1MROB 4DL2A 4CJLA 1RCXB 3T1HK 3A4TA 3M2UB 1F2GA 3NKYA 3I82A 4DX6A 4H4KA 1D9AA 4FWSA 1M1HA 3G6XA 4YEAA 2CQ4A 3HBTA 3RB3A 4NLGA 1UP1A 4JI2J 2MQMA 1U1PA 4DCOB 2P9GA 2NXCA 2UUWA 2PBDA 1S72N 3U6FA 1IM4A 3WNEA 3J81Y 2G13A 2UUTA 3EWGA 1C1AA 2R7QA 3TA0A 4ZVSB 4JKHA 5M1FA 1FDDA 1GNKA 3D68A 3G4SN 1AFIA 1LAWA 3PHTA 4GVLA 1Y00A 4OO1J 1Z6RA 2W24A 4JKBA 1Q8KA 3G8QA 3UWTA 3LL3A 2MQOA 1U1OA 2GV9A 3MDFA 3MEEA 2OTJN 2QC3A 3QFPA 2F65A 2E9ZA 5HROB 4X2BA 3P5JA 3KK3A 4CD3A 3ULEA 4HT7A 4HUEA 3B6PA 4TYAA 2DB1A 1XEZA 1S7IA 2QRRA 1XTZA 1ZBTA 3QNWB 4AF1A 1JIHA 4OZJA 1S6OA 2DK2A 4JYAJ 2LEPA 1X1PA 4YY3J 4K43A 2DNZA 4CGHA 3QGIA 1RLCL 4JI5F 2P9IB 3L3UA 2DH9A 2Z2YB 2P9LA 5DO2A 1OQ6A 3UVJB 2OI2A 2LXFA 4WCEQ 1UA0A 2VCPA 3WX8A 3I31A 4KB0A 1HI8A 2OTLN 2AJQA 3HPGA 2Z30B 3CPWM 3OSNA 3CULA 1ZXOA 2G0CA 4ZA1A 4CDIA 2KN4A 2GGPB 4QS8A 3MHYA 4CO1A 1FCAA 4ERDA 4KHNA 2V6AA 4FSVA 3JTOA 2RB7A 1ATNA 4DG1B 2CPIA 3OXGA 4ID8A 4KH1B 1KRPA 2QSFA 2M4MA 5CYJA 3JAMU 3G96A 2HLUA 2YBVA 3MX2A 1I3OB 5GAEP 1S1XA 2ZKTA 3M6UA 2G1HA 4CF0A 3MPVA 3CUNA 4JI7J 5IM0A 3C94A 2B4JA 4Y0WA 3IMQJ 4OYPA 1E4GT 4O3SA 2LDIA 3DJCA 4FW2A 1VLYA 3C14B 1RTZA 3CNQP 4I9QA 3OJSA 3OD2A 1DGKN 2HHQA 2C3MA 4OX9K 5HBMB 2PFDA 4NASA 3QT6A 2W7AA 4TN2A 5D8HB 5C42B 2RQMA 2JDJA 2RS8A 3I0RA 3H90A 3PZPA 2G8VA 3PVXA 1YJ9S 4JUZA 5ETRA 1BIUA 4N8NA 3VZHA 3M3ZA 2OPQB 1R31A 2CQBA 4QS7A 1S1TA 2W4CA 1NJXA 1AW0A 1M1KO 3LANA 1S6PA 4BR9A 2XWXA 2X1AA 1VRQC 4R0EA 5GVQA 3CVKA 3EVMA 1WSGA 1Y11A 4PL8A 3PIOL 3CCLS 5BR8F 3ZEUA 3J7ZO 3DLGB 1N32J 4B1XB 4CCHA 4Z4EA 1H6KX 4I64A 4A8OA 3OTOK 1KXPA 2X1FA 3ENOA 2R7SA 3K17A 3FUYA 4BGAA 2DXFA 4KJIA 4YDDB 1HNWF 1BUXA 2HOEA 1SVDA 1NGHA 4NLOA 3SV3A 3C6UA 3V81A 5IT0A 2GMLA 2RU9A 2ZUAA 2IJFA 4USUA 4DFKA 4BDPA 1EAYC 3LP3A 4R5PA 2FBYA 4WYBA 4NCGB 1B70B 2UUBJ 2YWWA 1BXNA 2CDQA 2GS8A 1T9YA 3NGKA 2J9CA 3ATUA 1SC1B 5LL6d 3BKUA 1XNRF 4MK7A 4ED2A 4FZYA 3HM8A 1TL7A 1X5SA 2J9EA 1IBMK 4K4TA 4RCHA 3OXFA 4NI2B 4BGBA 2Z1JA 1ZBIA 3PM9A 3VGTA 2DO0A 4X4TA 4QZVB 3M9NB 1QAIA 4DR2F 4TLQA 2HRYA 4F2SA 3KLHB 4PUOB 1Y5IB 2GVZB 3H7HB 3ZZRA 1NHUA 4K4WA 3OL6A 1QQOA 3H2UB 1NNDA 2KG0A 3SFGA 4Q45A 3PW0A 2V94A 1I39A 1HNXF 5CY4A 2KXHA 1S99A 1OY6A 1DKGD 2N7CA 1TU0B 2W01A 2V5HG 2ZM6J 4M3TA 3OR2A 3R8YA 3JQKA 3HD1A 4PL7A 1X4EA 4KRWA 4G1QA 5LJWA 3KK2A 4BVOA 3TRGA 2KXFA 3CJ2A 4GVMA 5CYMB 1R89A 3M32B 2QWOA 1J53A 1JWWA 3H42A 4O0NA 3UCZP 3RYLA 4YB1P 1CZ9A 4YOXA 4CIGA 2XLKA 3POTB 3MWPA 5B0CA 4LF5F 1HMVA 3H2VE 1KVAA 2A40A 4CF1A 2V4JA 3HO1A 4R8UB 4TQRA 1RYRA 2E1AA 4L73A 3KUGA 3MN6A 3QIOA 4GV9A 4GMJB 2B4VA 2Q3PA 3QMQA 4I7FA 4CYUB 4ED4A 1LOTB 3ELHA 3WXMB 2KVQE 1NSQA 1GMWA 2DEIA 1IBCB 2ASLA 2UVUA 2XTJP 2E2PA 3MPYA 2PFFB 1S1WA 1BD6A 1U24A 2DR8A 2IVNA 2I2YA 2D4WA 3R5JB 2RRNA 2KT2A 4HI2A 1RHQB 2O01C 3EJMA 5AQJA 4G1PA 1VSMA 2E9RX 3D67A 3SBMA 1O8BA 3D0HE 4ZPAA 1NHVA 2OD4A 4X64J 1MG7A 1U2VA 5M1KA 3A1YG 3V4IB 1TUVA 5LMUJ 3K58A 3CIMA 2ZBPA 1AUDA 3M8ZA 3HK2A 5J2NA 1WSEA 2BQ3A 4DOZA 3OPKA 2VA3A 2CQ3A 2W2OP 1HHQA 5GMKa 4MO4A 3I55N 3Q86A 3R27A 4O8UA 3DGVA 2IMOA 4NRTA 3PNIA 2VYPA 2OEJA 2A1SA 3G82B 4LF8J 1QVFM 2CPHA 2R42A 5FPMA 4KT0C 3N4QA 2C3PA 3IR7B 1DLOA 4JI6K 3DMJA 2RKIB 2AYBA 4Q5VA 4ZOSA 2P9NA 5G0RB 2RUGA 3J80U 2D0CA 4LFAJ 2JEJA 3BO3A 4W5TA 3VOVA 1JLFA 4DX8H 2PT0A 3TPQA 2E66A 1J5EJ 1CS4B 4F25A 3OYHA 5AFUA 4C1NK 1I6JA 5AQHA 1S4EA 1JLBA 2IAJA 3MAQA 4LFAF 2NLXA 1K44A 5HQ8A 1EQ0A 3MTKA 2EFQA 2CUYA 5BYRA 2G2YA 1XIQA 2FZKB 4LT6A 3L3VA 3CCES 4Y65A 2FB0A 3TWHA 2UU9J 3KHYA 1UJ6A 4B9UA 2E1MC 2O8FB 3DOLB 4J9NA 4Q0BB 1WF0A 4ZCKA 3HRGA 3ID8A 1HBUA 1X9MA 3D1OA 2OPRA 3O2IA 4QWCA 1T0TV 1Q4RA 3PIOQ 2O8EA 3KMQA 2KVIA 1IBKJ 4RW8A 2YNIB 2QGFB 1WHVA 4DU7A 2OH2A 2OJ3A 5AJ3J 1YTUA 5J1EB 4Z2XA 1RDCA 4O0JA 2RDJA 5KG3A 1PCAA 3CIPA 3FBEA 1NJYA 2ERRA 3DRSA 3RAXA 2OPSB 1NBWA 2E5LJ 3HPHA 4RNFA 1YHQN 3AA5X 3IGVA 4M3XA 1T9WA 2ACYA 2PA3A 1T11A 1JMTA 1HYSB 2RE1A 4FKYA 2I7PA 5DM6Q 1HBNB 4NZ6A 1UCNA 5AQSA 1ACMB 4FF2A 2M8DB 4MIBA 3PRDA 4RW7B 4KTZA 4OZ5A 2UVWA 3Q2TC 1G7CB 4CK3A 2W4PA 3M30B 4DV5J 3EE9A 3HX9A 4ZLPA 3N28A 1GEHA 1FKOA 5BXIA 2QV6A 3CG7A 2WSEC 3ICLA 1FA0A 3MMAB 2KYZA 4RNOA 3G8TA 1DTQA 4CJRA 3WHIA 3N0VA 1TL1B 3G71N 3VERA 2FXUA 3MM5B 3HFKA 2Y1LB 1Y5NB 1I94J 2RF2A 3C19A 4CHQA 3AXKA 1VRTB 2KQ2A 3I96A 4ZP7A 4LVNP 1S1VB 3ZZOA 3KHRA 1UA1A 1NGJA 1GQEA 2BA9A 4FJKA 3MXIA 4ZIWA 5T7BA 2G0IA 1RDBA 1DAXA 4CO3A 4WQ4C 2D69A 1NH7A 4GVEA 3CD0A 3WC2A 2G2OA 2VDIA 1IWAA 1S57A 4AHRA 3N5FA 1T44A 2RH3A 2XMWA 1AZSB 1OY8A 4OHZA 4FWMA 5JLHA 5LL6Z 1LK7A 2KFYA 4UW2A 4EZ9A 4K42A 3TQ1A 4CZFA 1OYDA 2MLZA 5HLFB 3H1QA 4NX9A 3MM9B 1Y10A 2LU2A 1MWKA 1YRUA 2Y1RI 3VEYA 4B3TF 2IY5B 2R7XA 1IN0A 3H5UA 1XMOF 1K8AO 4JRQA 1Q82O 2NXNA 3ZSQA 1HKCA 3IXQA 3KOAA 3E2EA 1SJFA 2HQDA 1M5PC 5C24A 3M2RB 1TUWA 1FJEB 3P4IA 1M5OC 2KW4A 2GJ2A 3O4WA 1ZA1B 3PYEA 1IR0A 3LALA 1MN7A 4LIWA 4FVMA 3TARA 3H4DA 3OJUA 3F44A 1CJVA 2PMZD 1H2UX 3ZTPA 3QSYB 2ZVIA 3J7Z5 4L76A 1HFEL 1EP4A 4URGA 5KG4A 4CJPA 2JEIA 3ZEUB 2HRUA 5I3UB 1B0TA 2CNNB 4NPOA 4MO5A 2DHSA 4CT9A 4X65F 3VQCA 1ZM4A 2HAFA 3QFHA 3J7AN 2OFGX 2VL1A 5E3CA 3TAQA 4CLLA 3QEPA 4ICLB 2Q79A 3UD4P 2F8SA 2JVRA 2IRXA 4C97A 2IJNA 3CJCA 1YJ7A 1MMLA 2QW9A 1RTIA 3P96A 1S6QA 2BJ1A 3A8IA 3OR1A 1M90O 7AT1B 1OO0B 3LPYA 2GMJA 4JKCA 3RBDA 3EGZA 3FCWA 1VSDA 3SDEA 2KFNA 2GQQA 3NH2A 2RIJA 3ZTQA 2B56A 3KVGA 3OYDA 5DDOC 1GH8A 1FF2A 2AQ4A 1S3XA 2O8CA 4QCLA 5IV4A 2UUBF 2BJEA 4CEEA 5KG6A 2V7ZA 4ZHRA 3GIJA 4JI3F 1HNWK 3C15A 4Z94A 3DU5A 2EK6A 5ITHA 4CGGA 3FRZA 4UUXA 2YCHA 2AF6A 4V19X 4DR7J 4F4WA 2Z1HA 3OTEA 4QPXA 3QGHA 1KEKA 3CW2C 5F8HA 2H48B 3I0SB 2L9WA 1S10A 2YPYA 3S3OA 2LYVA 1UFLA 4OPKA 4K2XA 1FO1A 3J81O 4LBPA 4JI6F 2OCEA 2GX9A 4E1NA 4IQMA 4CLWA 4WYWA 1YAGA 3RBZA 1SKSA 4FWLA 4PZVA 1W2IA 1FWPA 4Y28C 1WTFA 4JHDA 1OPIA 1REVA 4AM6A 1Z25A 1RAGB 4DR1J 2KU7A 3RW7A 3CQ8A 1X4DA 2E7VA 3KDOA 4LFCJ 2YKOA 4G1IA 4LF5K 3IC1A 3AODA 2VH7A 2Q1NA 1HNVB 3A2FA 3QFWA 3AOBA 4M8LA 3GE1A 2M0GB 3VEZA 4HKQA 1IKXB 2V8DA 2E9TA 1RHRB 4YHHK 4H5RA 3T5KA 1M5HA 4HCBA 2JSXA 1V4TA 1DBDA 2OEKA 5EHHA 1VC5A 2HHXA 2BR0A 4IFVA 3VAJA 4CM2A 4C8OA 3AT1B 4USKA 1TAUA 5KPTA 3CCUS 4FLYA 2HURA 1VBYA 2HK2A 3VAGA 2NYIA 3LH2S 3BGFA 2HHVA 1TUYA 1FD2A 3IWNC 1OWXA 2ASDA 5J2QA 1GXUA 2HQFA 5KRTA 3HOTA 4B9TA 4JV5J 2MMYA 3QBCA 1NO8A 2MZRA 1GTHA 2DNHA 5KFYA 2G8UA 2BQRA 1Z2LA 2E7XA 3ENAA 4CZCA 3NNCA 3QJPA 1Z26A 2N82B 4ECTA 1OH8A 3GP9A 1S49A 6AT1B 4DV7K 3ILLA 1F60B 1XMOJ 3OS1A 1C4CA 3AXMA 2HBMA 2LFVA 2A18A 4HLBA 4CJ3A 2CPZA 2GEMA 4F36A 2YHWA 1Y0HA 3TAPA 3TOQA 2DD8S 1HQ2A 3CEDA 5KG7A 2VQEJ 4LQ3A 2HBQB 3IR6B 3UO0A 5F1XA 2NRWA 2E20A 4FYVB 3QYYA 3NMAA 1KDNA 2W8LA 3S9HA 2RMLA 2JC1A 1RGIA 3NE6A 3RB4A 2C2MB 2HBJA 1VYAA 2ZD1B 5HI7A 2DR9A 4LSLA 2F8HA 3MCAB 2ZH7A 4X4SA 2ZBCA 4Q44A 4MKBA 2CADA 3T41A 3M6GA 3OYGA 2BE2A 1S12A 2P9SA 5I3QA 4NLYA 2IM0A 1HD0A 2PN6A 5CZ2A 3AA3A 1SAZA 3M2UA 2O67A 3P3DA 3AVHA 4B3TK 3N4WA 1QE1B 2KI2A 4N56A 3QICA 4ZP6A 4ZTJA 5BN9A 2QWMA 1GOBA 5KFMA 1YSJA 4BE1A 1RUSA 4NLWA 3VHQA 3I5AA 1SH0A 5GAEU 3OYNA 1N32K 1KHWA 4A8FA 4DR4J 4D3HA 2ZH3A 3RB0A 2BGGA 3TSQA 3DOKA 3M8PB 3MOJB 2IRUA 1KFDA 2FGCA 1TMJA 5DDRC 2A6OA 2YNIA 5KT4A 4P2SA 2ASYA 2BE7D 8RUCA 4BRPA 3MXJA 3MTJA 4BQZA 1B7YB 2QZ8A 4B3RJ 1KFSA 4FJLA 4OKKA 1K9MO 4BQLA 4KHSA 2XMJA 3CPWR 2PI5A 3ENHA 3ILOA 3DAWA 2BACA 2G1DA 2ZZNA 4I2QB 4I1TA 4W98A 3T1AA 1GX5A 3UVJA 2DNLA 2B51A 3CJ4A 2MZJA 2HQCA 1KVCA 4KHYA 4ILGB 3KHGA 1GFWB 1D09B 5KFOA 4BCAA 4EZ6A 5A0YB 4ED0A 2BH1A 3VMFB 4ZVQB 2BXJA 2Q97A 1K1QA 2ZFHA 3EY1A 2CJYB 4F04B 4NLUA 5DG8A 1SQGA 3CSKA 3NCIA 4MLEA 5D3GA 3CMEN 3MN7A 1GLEG 3O5TB 4JI5K 4W4MA 3H5YA 2E5LF 3T9ZA 4B3SF 4NXMK 4ED6A 4H03B 3O9SA 1O6XA 3R1LA 1BI4A 2XO7A 5L1IA 4AQYK 3D6FB 3AARA 2YQ1A 1NM2A 3CQXA 2ASJA 3IMXA 4KI4A 1QAJA 2YTCA 3T5LA 1WAJA 2W9AA 5E2QA 1MWZA 5GINA 1HWJA 3W65A 1IBLJ 4DR7K 1Z1ZA 2BOPA 2W8KA 3CCVS 4EO8A 1G99A 1DEJA 5H1SQ 1FXXA 1YIJN 2MY7A 4PA1A 2V8VA 4CHNA 4FXDA 2BM1A 4ISFA 4AL7A 3U1NA 1ZTTA 1VSFA 3DLHA 3EGVA 1ZAXA 2KRBA 5CQGA 3F41A 1K0TA 2K7JA 2GJFA 4HDHA 5J2MA 2W7PA 4P7TA 4JI3J 3O6WA 4CIEA 4I56A 2Y0BB 2BOAA 1T95A 3MPDA 3KD1E 4CGDA 2XMAA 1DRZA 3S01A 1KQSM 3KUEA 1R43A 4CZHA 2ADCA 5FLXO 4CJ4A 2G2ZA 2UZAA 2ZJRL 2F9TA 2JLGA 2KO1A 1HNIB 3AVNA 4IKFA 4FOIA 4X66K 2ZVSA 1HWKA 2WTUA 2FLOA 2MGZA 3VQ7A 2W40A 5C2GA 3MM7A 1ASWA 5L8RC 1RHKB 2CQCA 3D2FA 4A2AA 4DCHA 4M5DA 4UY8T 4ID5A 4PWUA 1CJUB 1C0FA 2D3O1 2KG1A 2CQ2A 1SPBP 2A42A 1CC7A 1QD1A 2XZDB 4DSLA 4O3OA 4A4JA 3FZBA 4YFUA 3W9HA 5CYQB 4CLPA 5AQNA 4ZVUB 2LLZA 3H20A 1T94A 1RBTA 4DU4A 4M5IA 3CFOA 3VGVA 2O8BB 3SI8A 1NBEB 4PKDB 1U47A 2DY1A 4M5LA 4HUFA 1FT8A 4FLUA 4PXCA 2PYLA 3NXZA 2FLLA 4TVAB 3E51A 1AA1B 3AVJA 2MQNA 1VQOS 5HJYA 3ZNUA 3VQ4A 2J9DA 3K0SA 4L75A 1RSCA 1RAFB 3DN9A 2V8GA 3T6BA 1FDNA 1TZ0A 4BDZA 3QT7A 4LUBA 1S0MA 3SK3A 1REGX 2OPPA 3L7UA 1VBXA 4IG0A 1R8PA 1MW7A 5AQYA 5C2CA 2M7SA 4JB8B 2B6AB 3DFEA 1DTTA 4BG9A 3WBZA 1NDPA 3WXJA 3WX4A 3A0IX 2HNYB 1LFWA 4CH0S 2XY7A 1RAIB 4RW4A 5F8MA 1KP6A 3QLHA 5KG1A 4BS2A 4R8UA 4C98A 4NLQA 4PQAA 4FK2A 3NH0A 4CJVA 3ZZYA 2DHGA 5C25B 1WDDA 2I8EA 3AA2A 1U1LA 4EI2A 4ISGA 3CJBA 1APSA 3MN5A 3DM2A 4CEDA 2WUSA 4IJAA 2ZJPQ 3L2QA 3ZSYA 2XMVA 3DRSB 2QLFB 3T6JA 2HHUA 1HKAA 3QIDA 1JLQB 2M88A 1LWCB 2CZ9A 1V6HA 1YWXA 1EQYA 4O4GA 3UD5A 4LF6J 4X4RA 3FEZA 4IJNA 4RW7A 3VPZA 3AVGA 3RUBL 1NNEA 2F4VF 2IC3B 2GAGC 3TVYA 1TVRA 4JD2B 3OTOF 5CE3A 4ED7A 2XLJA 4C8KA 2UUCF 2OGUA 2HWHA 3UE2A 2E29A 4FWKA 4IRKA 4FNHA 1R27B 5CABA 1Q9YA 5HOOA 2H3GX 4OYXA 2V67A 3OHBA 1GT8A 2RSQA 2KHCA 3SCIE 3WC0A 3MEGA 3KK1A 1VAZA 2DEJA 1JJ2R 3OS2A 2V2KA 3G82A 2V4RA 3CCJN 4WFXA 4KYZA 3J7YU 2GHWA 4AXIA 2J4RA 1E6YB 4AQYF 3HCXA 1I94K 2DGSA 4OVLA 2VWBA 1IBMJ 2FVQA 1XC9A 4WKRA 1ITGA 2P9NB 1NK5A 3SUNA 4ELUA 2D74B 1YZ6A 4DUZF 2K1RB 4RW9B 4MT1A 2CAJA 2HZCA 3MECB 2E1RA 2EK1A 3QERA 5KFLA 4NOHA 5F3TA 1RK8A 1SC3B 4LSNA 5I42B 1XN9A 2Q66A 3SAHA 2EBEA 3F73A 2HZVA 4RWTA 1CQNA 4O4RA 3C8YA 2J5AA 3W61A 2UUAJ 4M7YA 3K9JA 1Q7LB 3L09A 4CW7B 1SKUB 4ILMA 4J9UE 1N0VC 5E41A 1YBTA 2FC9A 4I67A 1RHJB 3ENWA 3TW0A 1SXLA 1X31C 1FTCA 4E89A 2XM3A 1T6DA 4DSEA 3L8BA 4DR5F 3PW4A 5D0GA 5AQVA 3HJVA 1VBZA 1ZS6A 3NOCA 3ZZ0A 1VQ8N 2F9JA 2J6UA 2V8PA 4OYZA 4X65K 2HHHF 3GSDA 1SIZA 4BR4A 3UKUB 1X5OA 4J2DA 2DGVA 2EVZA 1VQLS 3LO3A 4E1MA 1HBUB 4P71A 2LXUA 1JCFA 3D1HA 4OZNA 3Q83A 1K6YA 1S97A 2UXCK 3MMBA 2B9WA 3T69A 2BABA 1UPMB 1BISA 5C2DA 4LMZA 1EB0A 1TKXB 1S72S 4ILHA 2NUHA 2GWKA 3V9SA 2KKZA 5IC4B 4B8CA 1T3NA 3VTHA 2VBZA 2QL9B 2QA2A 2CNLB 4CEBA 1VQPS 3OQ2A 1UFWA 4IDKB 3A5OC 4W90B 4FNIA 4C8LA 5AE2A 2P2CB 2OTJS 4QU7A 1RTJB 1UVNA 3RGIA 4I6YA 3SIPB 3MR7A 1DZ5A 1S1XB 5KFSA 5LJ3Y 4W92B 3CC2S 2XBPA 1ULRA 4ZN3A 2B4OA 2E5GA 3DRXA 2NSCA 1UZHA 2BDPA 4J9QA 3MM8A 4GKKK 1GLCG 2MZTA 1RT2A 3K8VA 4OL8A 3Q8PB 2ZWHA 4LF1A 3MMCB 3TSUA 3UKRA 2NNWA 3MUTP 3HFVA 3MGJA 1WBBA 3TJ9A 1WC0A 2R7RA 2J0SD 2EEYA 4JI1J 3HI0A 3WDOA 4IZ9A 2X78A 3K5OA 5KAKA 1N32F 1F9FA 2HNDA 3M8SA 3OVBA 1Q86O 2FDNA 1SUQA 2RPIA 4OJRA 4FF3A 3PSIA 2HVZA 4IFYA 2GQCA 4ANCA 2IOCA 2J0XA 3TVKA 3CD5A 3MCMA 4OX6A 4KR0B 1H3DA 2FHJA 1K9MT 4LF9F 2E6LA 3I0SA 1VIXA 2IRYA 2LSNA 3ILIA 1D3WA 2XGPA 4FPBA 4ECYA 1JLCA 4IWVA 2ZITA 4CYUA 4DL5A 1ZAWA 3TABA 3RJMB 4DPXA 2OO4A 2C22A 3PO4A 1Q53A 3AO5A 4ECUA 1URNA 4P2XA 2CKWA 3Q8SB 4MKAA 4F4KA 4DR1K 2HEKA 3SUQA 1DQ8A 2O8DB 1CPZA 1D8ZA 3MD1A 1QVFR 4KHWA 1UL3A 2PSZA 1IWGA 2JZ5A 2HQ3A 4UQTA 1UVLA 4YOUA 3VEOA 3A5NC 1NK7A 4HT5A 1RAHB 2ZBRA 2X3DA 1IUJA 3PYFA 5AJ3K 3V4IA 1RDAA 3SQ2A 2A0FB 3NGRA 4JK9A 4B3MK 4DV4J 4BC9A 2IVOA 4AHVA 1IBLF 3I5CA 1CULB 4F4AA 3U02A 3PXGa 4NZ0A 1SKRA 1NGIA 3V81B 5JVGL 5KT7A 2LA4A 2V7YA 3L4IA 2WRMA 1WBDA 4NI2A 2AD9A 1CZAN 4FJ7A 3HZEA 5A2QO 1ZETA 1OH5A 4DR6K 2B5JB 3GV5B 5D4PA 4XIUA 3ENVA 5KFAA 4C8NA 3LM9A 3GFYA 2G4BA 3C6TA 1Q5VA 3V9XA 4GW6A 1X4GA 3I5BA 2PEHA 2E2QA 3FVYA 1YJUA 3ZC4A 4FZVA 2MYFA 3CC7S 3E9PA 2QTWA 4HVZA 3G9CA 4ZP9A 4FPRA 4DDFA 4NZ7A 4LF4K 2KYXA 3IR5B 3VENA 4CJEA 2CH6A 2NRZA 1CEZA 4JKEA 1H2TZ 5K20B 4KTQA 3WT0A 4O3PA 3FQKA 5AQWA 3JSYA 2JNJA 3IBWA 5F9NA 4O0IA 2V9KA 3KLEB 2JHEA 1U0HA 5HATA 2KZMA 2F9WA 1HWUA 4KQZA 2VFUA 3AVAA 2QYCA 4DV3K 2ITMA 3H0PA 5F0XA 3O3LA 3LDSA 4J2BA 2IS3A 3WEEB 4DPTA 4KV8B 2QWPA 2F63A 4KHMA 1QSYA 3KKSA 5KGXA 2MDAA 2XMKA 3KTQA 3VEVA 4A46A 2OPRB 4AFFA 3ZT2A 3PJWA 3MEEB 5F9LA 3BSCA 3M32A 1RT7B 2J0QD 1YVUA 3TR5A 1WG4A 2B7BB 3P49B 4OQJA 4Y3CA 3MAAB 3ENQA 3C16A 4JI0K 3L2UA 4J9KA 2BM0A 3BPDA 4K8XA 1HI1A 4RZRA 5IT9Y 4KSEB 4ZVOB 3D0IE 1RTHA 4FLVA 3O80A 1WI6A 3OTOJ 3RMCA 3JYTA 3HF5A 1K8KB 1FERA 2UUBK 3GV8B 3GSIA 1REVB 1C2PA 2P9CA 4H0PA 3CMAN 4DTJA 5JVGQ 1U1MA 1XJWB 4C3LA 4ZJOA 1SJ4P 2AMCB 3Q24A 1SIWB 4DG1A 2VBYA 4K7QA 4DEZA 5KTQA 2FF6A 1FRJA 1DTQB 2CJXB 2QLXA 1L3VA 5F0UA 5EVZA 3FQLA 3GYNA 2B9YA 2FD2A 1JLQA 3S6EA 2CPFA 1NPKA 4E7KA 2Q3SA 3EUNA 4C8YA 1P90A 2YQ0A 1KVBA 1RWNB 3AAWB 4U67Q 2RKIA 4OHVA 2BX6A 1C1BA 2WBRA 4QS9A 3SAGA 3CT9A 2YX1A 3R2CJ 5FDLA 3C14A 2NZTA 4CLSA 5B0FA 1JLFB 4NYNA 3CCMS 2HS3A 4TY8A 1E4FT 4DR3F 1TP7A 3W8PA 1D5AA 4OX8A 4ATNA 1HHSA 1I51B 2WHOA 3UFCX 2EW9A 3FZHA 1VRTA 1C0GA 3OTCA 3GIRA 4WBFA 5D3GB 2XNRA 3A12A 3FBCA 4Y2MA 4HWIA 1WOSA 4DU3A 1WHXA 2GNKA 1EETB 3P5TL 3M05A 2Q36A 4IG3A 4V19S 2PO4A 1S77D 1SQKA 2XMTA 5DZ7A 4AILC 1SV5B 4PEOA 3GLJA 3A8EA 3OHRA 4AQYJ 5EY4A 2V50A 4M3ZA 3CC4N 3ZLJA 3CJ8A 4BG8A 2XI3A 4IOXA 1IBMF 1WNSA 4FO0A 2DXEA 2C2RA 2XYPB 4WQ5C 4X62K 4JN4A 3JAMY 2R2SA 4KHPF 3EZ5A 2HFOA 4BY9C 2CGJA 1BO5O 4PG4A 3DLBA 5K14B 2LDYA 3AA4A 1IBKF 5IQQA 1VIOA 3V9WA 2FSKA 4X4NA 2DNGA 2ZGZA 2OTLS 5C24B 1KOOA 4FYWB 1BQMB 3HOSA 2YKQA 1VS3A 1U8SA 5I3UA 4H5NA 3U3YA 5HVGA 3GG0A 2O4IA 3U1MA 4AUKA 4CFCA 3CDAA 4IO9Q 4Y34A 1MA9B 3KG1A 3MXHP 1C0MA 2KFZA 5IWAJ 3HULA 1BQNB 5DGBA 2ZNZA 2AP6A 4YB7A 2GV1A 4OYMA 3QZ8A 2F40A 3M2VA 1KQFB 3RAQA 4M45A 5ADXA 4KFBA 1FWKA 4YHHJ 3CCQS 1IO2A 1X0PA 4I2QA 1IG9A 2GGPA 3GV7B 3CF5Q 2WVDA 3AVMA 1TV6A 2WOMB 2ALZA 2R7WA 2IJRA 4L3KA 4ZKAA 4NA3A 3PW5A 3NGIA 5U47A 3R6GB 4QQBA 4I0WA 3D2FB 2VG5A 4PWWA 4WIQA 2GCFA 1CJTA 4DR3J 3FSIA 3OR2B 5HL7Q 1WD6A 2X1BA 2LXIA 4MYUA 4O5FA 4Q2MA 2P6TA 4PYAA 1ZZNA 3THYA 3PX0A 2GO9A 4NL5A 4LR8A 2QLBB 3POTA 3LZJA 4IOAL 5D0HA 4W5NA 3IDHA 1AZSA 4CJWA 5ADZA 1W97L 4QWEA 5MAOA 3GIKA 2YKPA 2XNQA 3OTBA 4K0KF 3L4QA 4NLRA 5EOYA 4E7JA 1T8EA 2YHXA 2XHBA 2HHPA 3G6EN 2L08A 3SJHA 2I9SA 4PR6A 3DXKA 1HBOA 4I6MA 2Q6BA 3GYXB 4WXWA 5A8WA 4K8RA 1JK9B 3QESA 2V34A 1LWEB 5HRNA 3LQVA 1WAFA 3C65A 3H2LA 3VAIA 2D1KA 3NWRA 3VQ5A 4MJKA 9ATCB 3OV7A 4DV3J 2ZJPL 4IFYB 3DYAA 3C3LA 3TQEA 1QTNB 2GHVC 3S8SA 1N8RT 2ASMA 5FPNA 5GMDA 2Z2MA 2CQ0A 1UAXA 2DGWA 5AQFA 1X4BA 5J2NB 2UXCF 1NB7A 4EGLA 3T1YJ 3KJNB 3OUYB 5D0EA 2PA8D 5AXMA 3DM2B 3PX4A 1JJ2M 3GU0A 4LFCF 4GMKA 3VGUA 3I4PA 4ETXA 4M5JA 4LY7A 1HPZA 2FJDB 4FBUA 4DR1F 1NGEA 3HHLC 7FDRA 3X1LB 3EZWA 4BC5A 2AZ3A 3ONQA 1PJ6A 4H0XB 2KDOA 3JSMB 2PC6A 1Q81O 1I1GA 1KLMB 4F0KA 3OYLA 4MFBB 3C46A 4C11B 4WE1A 1BC6A 2WONA 4JD2A 3BB5A 4OLOA 4QYRA 2VKRA 4A61A 3VEXA 2GO8A 4LF8F 1KVIA 3BGRA 2CQGA 3IWLA 1XNQK 1ZC6A 3BDPA 4BC3A 1F9HA 1VISA 1F5AA 3FEYB 1MSWD 2MSSA 1VC6A 2UXBJ 2YHAA 3ZSXA 4OV1A 4WFYA 3U9ZA 1AXQA 3IRXB 1QUPA 3W1YC 3ZO7A 1FDBA 2YX4A 2I5JB 3HVTA 2HFZA 1CS4A 4V1Ak 4M94A 4BRAA 5GADI 3CERA 2F5GA 2CQHA 4DSFA 3L9ZA 5DQGA 3TTDA 4CF9A 3DLLL 3KWGA 3LOUA 3JXOA 1V5IB 4FWRA 2QEXN 3MWBA 5DM7L 3MDQA 5DDQC 3V6DA 4QIGA 4I7FB 4JI5J 2MLYA 2MKHA 4NO7A 3EXYA 5AZIA 1C0UB 1AB8A 3M8QB 2AW0A 3OVSA 5C2FA 3AQPA 4DR5K 5E0OA 2JOQA 3CQYA 2NRVA 1F21A 2YQ3A 4WTOB 2O8EB 3DLJA 1S48A 2VD3A 5KFGA 3S3MA 4ZVEA 5L9NA 5A2QU 4JK7A 3ZETB 2OLWA 3SXLA 3KK3B 3WEEA 2FHKA 4HCCA 4EO6A 2QK9A 4N8OA 4DV0J 4CT8A 1O5JA 1SI9A 3R7SB 5SWMA 3BSAA 4FJ9A 1FKOB 2BRLA 1L3SA 2CG4A 3DGPA 3MAAA 1FNMA 3NOGA 4C3MA 4CEQA 4DMNA 3H3NO 2P5VA 2CGKA 1VQLN 1LWFB 2ZKUA 3I56N 1NUEA 1WTBA 3PSFA 4QAGA 4NYOA 1JCGA 3MAHA 4I6AA 4JV2A 3QT5A 4DBQA 4JKAA 2R9LA 5D78A 1P6TA 2K06A 2YWKA 3PEHA 4DR2K 1JLGA 4JNEA 1R6VA 3QEXA 4IRDA 2DTJA 3GIIA 1ZYQA 3MMAA 2PIIA 2IFXA 2KTQA 2VPXB 1W0HA 1VGYA 3OA9A 1RWKB 3D6MB 1KVJA 4ECSA 4DS5A 1M1GA 1U7LA 1YJ9N 1BGXT 4QJVA 2E88A 2ZGYA 3HYFA 2DISA 1HKBA 5AQIA 3GZ7A 1IR1A 3GWCA 2NR0A 4CO0A 5F8NA 1G2EA 3H4BA 1WC3A 4GNIA 5B0GA 3PKYA 3D6RA 4JK8A 3NNAA 4K4ZA 4ALZA 1U09A 2CVIA 1X5TA 1RCOB 2PMHA 4HUGA 3O9RA 4DS4A 4L8RB 4DV5F 5KFDA 4CBUA 1JKHB 3NBPB 2OANA 1BCMA 4DFPA 3KG4A 4Y2KA 5LMUF 1LK5A 1HNWJ 2P9UB 2J7KA 4CK2A 5EX3A 3VGSA 3GONA 3DDNA 4XPEA 2GBZA 5DLFA 3MM9A 3L6QA 1ZA2B 3I56S 1CSJA 3G6VA 4HTUA 4EBDA 2EI5A 4AHCA 1JNRB 3Q89A 2ITGA 2PFUA 3BP8A 2KM8B 2F8EX 3EYZA 4A62A 3MFIA 1S1UA 2CQ1A 4WQ5A 3RR7A 5EGYA 5C12A 2RS2A 1YJNS 4FJHA 5HRRA 3ULEB 2VQEF 1YITS 2FC8A 1NSPA 3GMGA 3R97A 1T05A 2BW7A 1BHLA 4KRFA 2A2CA 1Q18A 3LM2A 5ETPA 3TAEA 3DCAA 1UZDA 2HSEB 4BRHA 3Q22A 3K2YA 4F02A 2KB2A 5KFZA 2HKEA 4DCPB 1A7GE 3OYBA 3QFUA 2AGPA 4DTOA 1RZMA 1AYEA 1NPRA 3KD5E 4KO0B 1X4AA 1NDCA 3D3BJ 4DZ6A 1LWXA 1RBAA 3CWJA 3CFPA 5E3PA 1VQ5S 3M8PA 5KFUA 2Z1IA 3NNHA 4WFAL 4J9PA 3GILA 1BQMA 4ER8A 1NCLA 3KIOA 5AQLA 2CXEA 4TY9A 2QEXS 1RBOB 3TZYA 2C2OB 5DK5A 1LXJA 1WSFA 2RQKA 4P6QA 3A8KA 1UOCA 3HPOA 4J9RA 2DNRA 3HZGA 1F5BA 1X9WA 4K41A 4OZ1A 3M8WA 1S6QB 2IBOA 3MPUB 3OFFA 5CYMA 1YJWN 4N41A 4P7VA 4OLBA 2XYHB 3VAFA 4OKEA 3I9V9 1JXEA 2QWLA 3I9ZA 3OBIA 3CYMA 1GLFO 3TR8A 3AY0A 2KXNB 4M5DB 1RXOB 1Q81T 2NRXA 4U7UD 1G1XA 2XSJB 1TKZB 5IWAF 1QHAA 1N5TA 4FOEA 4G1QB 1TV6B 5KT3A 3NS5A 1V3ZA 3T1HF 1SJ3P 1FESA 4H0OA 3KLIB 5TKWA 3K5PA 2Y8YA 5L1LA 1T3VA 4C7QA 2V69A 2CA9A 2Y3YA 3HP9A 2VQEK 2D9OA 4LF9J 2DNKA 4YMEA 5D0RA 2K8GA 3S3NA 1R6YA 4Q8EA 2R8GA 2Q0UA 1RT2B 1YXQA 1QJHA 3J7ZT 1D4XA 1GMVA 2YJFA 3QIPB 3FKBA 4AT1B 2QLWA 4B3TJ 4KIAA 4CHOA 4F3MA 3NGUA 2X51A 3U27A 4DUTA 2MKIA 1B99A 4QYZJ 1NOZA 4FVUA 3MXMA 5D15A 2HNDB 4DTRA 1RBSA 1DHMA 1HD1A 5KG5A 4IG0B 4DHVA 2MKCA 2CPXA 4L74A 1OS5A 4BWMA 5AQZA 3S41A 2F4VK 2RQCA 3G8SA 2Y1JA 3FCHA 3C2PA 1JJHA 4I2PB 2MB0B 3VQSA 3V5RA 3TA2A 3VF2A 2R2TA 1OSDA 4BBYA 4RLEA 1V3SA 1HWIA 1VHFA 4OGEA 5ETMA 3VGLA 2ROPA 3TUZC 3N4PA 1QUVA 4C0HA 3V9ZA 1C4AA 3UDLA 3ETMA 4ITSA 3QJLA 5LOQA 4YDUA 3MM6B 3D7SB 5GAGU 2NUBA 4U6PA 3N5BA 2AV5A 4WFBQ 3OR1B 1ILYA 1I94F 1NDKA 2LVWA 4DXLA 1UTAA 5LJ5Y 1GMUA 1FVQA 3EZOA 2R7UA 3LZIA 2NXEA 4KHUA 1RP5A 2FHJD 5KFPA 4B1UB 2IDOA 3RMBA 2LQ8A 3AJ1A 3FZ2A 1PG5B 2HZAA 4B3RF 4O8KA 3SNNA 1HPZB 1P9QC 4IH5A 2RE2A 3IUCA 1B7FA 4FF1A 3MPWA 2ZEJA 3GTYX 4O5BA 3V1QA 2WSCC 3IN5A 3TVZA 4EYIB 1WSIA 1NLVA 1VQON 1O51A 4DUYK 3EXCX 3THWA 2FY8A 3JQJA 5HVHA 1GLDG 4DLEA 2MJNA 3BPSP 2ADBA 3KK2B 3NDKA 4BR0A 4TU7A 1KD1T 2OSRA 4Y00A 3QATA 4M7XA 4F4XA 4RWXA 3EZUA 5JMVA 3UPFA 2E2OA 1EXQA 3U4LA 1RAOA 4R25A 1TK0A 4IOCL 3H8YA 1N88A 2ATCB 2ROGA 1L3KA 2RVJA 4IR9A 5EWFA 4C48A 3KLEA 1Q8BA 3QRQA 5AXKA 2OYQA 5KG2A 2XB2D 2KJVA 4JI1K 1N33J 4HH0A 4BWJA 4KC5A 4PPZA 2AWZA 3GBTA 2EHGA 2NYHA 1VDHA 3NY0A 3QEIA 1H2VZ 2QJ3A 4GRSA 3G6YA 4ES2A 1HBMA 3BV8A 4DX7A 3OFGA 1WC4A 2DGXA 2SXLA 1S9FA 2BKOA 1IQTA 3ZT0A 3FNNA 1SB6A 4FJGA 5KGWA 4KBIA 4YDXA 3VVTA 5FLXU 3D0GE 2CQPA 2HNYA 4KBOA 3C66A 5JXSA 4K4SA 1B0VA 4C3KA 2LEAA 3J80Y 4PPDA 2ETJA 3W2VA 4U8VA 3D1QA 4CK1A 4N77A 2HYIB 2FSJA 3RRKA 3FDSA 1VJWA 1NH8A 4NLCA 1RB0A 5F8JA 1RU2A 1N5VA 1KC8O 2VPWB 1VC0A 1FK9B 1U45A 5BPLA 3VV2B 3NEKA 3MK6A 4LF8K 4FJJA 3FLCO 2DVIA 4UZBA 3BSNA 1N6QB 1WC5A 4CJQA 4DTPA 4ZPCA 1TQLA 3CJQA 1LV5A 4YNQA 4DPWA 3DMJB 3C7NA 4EP5A 1X60A 2W25A 3P39A 3VN5A 3CDUA 1U4BA 3BM7A 3O08A 1E6VA 4M5MA 1XHXA 4FJ8A 5HK4A 3TUJC 3PHEA 3UR3C 4JI1F 4KB1A 5A0YA 3AH6A 2R2UA 1VCTA 4HI1A 1RI7A 1UMJA 4LRCA 4K50A 2ZH5A 1WC1A 3LP2A 4B1YB 3QB0A 3OL8A 2VASA 1Q1KA 1QQCA 3OTDA 4N7TA 3GQCA 3CCLN 3O3GA 3SMZA 3TANA 2J76E 3C95A 2LQBA 3IP0A 4BE0A 2UV8A 1HNZK 3M2RA 2DIVA 3Q7BA 3CB4A 3ILJA 2ZC3A 5HLFA 1T03A 4H54A 3THVA 2ATQA 5HAOA 1VQ9S 2BE2B 3PX6A 4RBTA 5EXWA 4CERA 5DMRA 3U8XA 4WFZA 4LSLB 3J7AP 3R3TA 4A57A 1U26A 3ID6A 2AJ0A 1FE0A 3P5BP 4M5NA 2CJAA 2E7WA 1U6ZA 4WZMA 4FWOA 4X4OA 5AFUH 1HBOB 2QSWA 2VICA 2HVDA 2GC8A 3RG6A 2W2QP 4NEYA 4CF2A 3FSYA 2MLXA 3S1TA 1N34F 1N54B 1YJRA 4FKXA 3TNVA 2XULA 5SZTA 1NU4A 3NGTA 1RAEB 2HMPA 1RJJA 5KQDA 1X4HA 3QINA 4WF9L 4LF7K 1KS2A 4JV1A 4CLZA 4CH7A 4OPHA 4IEIA 2ASPA 2HS0A 1NK4A 2X6SA 1IH7A 3VGKA 4DV5K 2HQGA 5LXRA 4DQIA 2AZ1A 1C6VA 2YJEA 2JRSA 3CCZA 3G4SS 3H3OB 3SQ4A 3CMAS 4M5HA 4MKYA 4LF6K 2JWKA 4UF4A 3N01A 3NF6A 4FWNA 4G3IA 5HSPA 4F67A 2X3GA 3R8EA 2XZWA 4IDKA 2ZH4A 3NP5A 4TU9A 1ZOTA 4IH6A 4PRFA 4IBNA 2YV0X 2YKNA 4OJ3A 1RTJA 1NZAA 4KO0A 5AQTA 1H1VA 3VQDA 3PLAA 4PKHA 2WAQD 5KFXA 1BA1A 5BPNA 3ENBA 3M1FA 2H5EA 2QL5B 4O55A 1XNQJ 5LY3A 1LXNA 3CC7N 1KHVA 1FRKA 1G6BA 3VVUA 3MN9A 1SL1A 1DQAA 2ZUGA 1NSKL 4KFBB 3KHLA 4TSXA 5KFIA 4JOUA 4M3UA 1T9XA 2UUAK 1VHXA 3PJ9A 4WP8A 3R1XA 4CD1A 2DTUA 1Y7PA 4J91A 1T7PA 2QE5A 4JI4J 1PC5A 2VG5B 1M0SA 4AH9A 4LRFA 2XRIA 1WUUA 4DPOA 1A9NB 4ECWA 3VA3A 4DPYA 4OPAA 3OYJA 3W3SA 1RT5B 4H4OA 1X8DA 2QX0A 3RAMA 2C42A 1BIZA 4IO1A 4M3WA 4DR4K 3CFRA 1YJVA 4YQWA 1VRUA 4ZJLA 4RNHA 3V2UC 4KH6A 3L2WA 1WORA 3M8YA 4DR4F 4UUWA 2XY8A 1CJKA 5AZIB 1X4FA 3LP0B 3HFZB 4DV6K 4KGZB 5B0AA 2NPIA 3PR5B 5AE3A 5D4NA 3SSSA 4FPIA 4FCYA 4HH1A 4M63C 3N6NA 2O5DA 1RT7A 5AXNA 4PG7A 1PIEA 1QQMA 3TU5A 3R5DA 4C2MA 2Q43A 5KT2A 2F96A 4QBUA 4LIRA 2CJQA 1YX2A 2YNGB 1TAQA 2E1PA 1RTDB 2HBKA 4ILLA 4HTLA 2JFDA 3IM9A 1LWCA