4RW6A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
554
structure length
538
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 146
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw6A05
4IH7A 5KFLA 3BJYA 4ECVA 5FDLA 2NUBA 4EBEA 4FZYA 3OYEA 4CK3A 3V9ZA 1WSFA 4DTJA 3ASMA 1X9SA 2A1SA 1RDAA 3M8RA 4KB0A 4KTZA 3LWLA 4NCGB 3OYIA 4CESA 1CXUA 3N6LA 4N41A 1T03A 4AHCA 4IKFA 4CJKA 4NLSA 5C24A 4IR9A 1WAJA 4AHVA 5KG3A 4FLUA 3HPHA 4Q44A 3PZPA 2VG6B 3MXMA 3CIZA 1SL0A 3TWHA 2R8IA 3E01A 3MECA 3DOKA 2BANA 5J2PA 5J2MB 2PYJA 3CDWA 1WSHA 4FW1A 2HHXA 4J9SA 4KKOA 4QAGA 3PR4A 3IAYA 2KFNA 4M41A 1D8YA 3LP1B 1VRUA 3M8QA 3TARA 1F21A 4FJ7A 3VQPA 3MEGB 2HWIA 3JYTA 3SI6A 2XCPA 1HJRA 5KT4A 1KTQA 1IKVB 4KB1A 1Q9XA 5DGBA 3KKRA 2D3ZA 3ZSWA 3KHLA 4DS4A 4FVMA 5L1JA 4Z4IA 1IM4A 1JLCB 4NYZA 3HL8A 4O4RA 4ECRA 4ZHRA 5FRMA 4LY7A 3T1AA 1HNIA 3M9NB 3ZT4A 3AO4A 1XHZA 3NAHA 3RB0A 4FJ9A 3BSNA 1Y97A 3I0RA 4E7HA 1EP4B 4DL2A 3AVBA 4F4ZA 5E41A 1TKTA 3T5HA 2FLPA 3IS9A 5KT7A 3KIOA 1NK7A 4FLZA 3PJXA 4FK2A 2E9ZA 2E6LA 5EUHA 2HNYA 3IG1B 2W7PA 4B9UA 4U7CA 1S0OA 4DG1A 4JV0A 4XPCA 3LANA 4EBDA 3MECB 4TYAA 4WFZA 1IKWB 1LW2A 4JRPA 1CLQA 4KV8A 4EO6A 3SCXA 3KK1B 3RMCA 1BI4B 3SNNA 1QSLA 4PQUB 2B5JB 2D5RA 3CDUA 2VWJA 1YTUA 4K4YA 4NLWA 3H4BA 4IKAA 1U04A 4I2PA 1WNEA 3KD1E 3TABA 4K4XA 2IS3A 2D41A 4CIEA 4BDZA 2HWHA 4URSA 3SFGA 3CQ8A 4PUOA 2HNDA 5JUMA 4QOZB 5EWGA 5HRRA 1NOZA 3VQDA 4NLGA 4CHYA 5CYQA 5KGWA 1U4BA 1JXEA 3RMAA 1W9HA 4HCBA 4CJSA 3KHGA 4KI4A 4B8CA 1GOBA 1WNSA 3CJ5A 1KCFA 4J9LA 3KMQA 2PY5A 3OSNA 4ECYA 4ED2A 3C6UB 4F4WA 1S97A 3OY9A 4ED7A 3AVLA 2W42A 4FM2A 5KGXA 4I9QA 3NDKA 4FJ5A 4ECZA 2BQRA 1XC9A 1VSEA 4DL6A 3ULDA 4CE9A 4B08A 2FLLA 3AVMA 2R7YA 1CSJA 4N76A 5I42B 4RW7A 3QEWA 5DLFA 4YP3A 4QCLA 4QWAA 4O44B 4E7KA 1S1WA 4E7JA 1LW2B 1L3VA 4RW9A 1JLAA 1L3SA 1NK8A 4FK0A 2P1JA 4DSIA 1CXQA 4IG3A 4F50A 4CJ4A 3ISND 4CJEA 4FZXC 2ETJA 3NHGA 4NLXA 1JLBB 2IM0A 3SV3A 2VG7A 1NNDA 3C95A 4DWIA 1WN7A 2XY5A 3AO1A 3O3GA 3RAQA 4DFPA 4K4UA 3OL7A 5CYQB 1A5WA 2OA8A 3V1QA 3NBPB 3HHKA 3O4QA 4WZMA 1NK5A 1EETB 3VN5A 3OHAA 2O4IA 2J6UA 4C8KA 4CF9A 3NGZA 2JEIA 1LWEB 1BHLA 2W9CA 4IFYB 4MK9A 1QSYA 4TN2A 3DM2B 5D3GA 1IKYB 4CEBA 4MIAA 4OPJA 3AV9A 1NJYA 4CJFA 5L1KA 1RBTA 2FJWA 5F8IA 1QHTA 4FJHA 1QAJA 3HVRA 3V6JA 1VSJA 1S6QB 4KTQA 3BSAA 4ELUA 5FRNA 2F8SA 1RTDB 1C0UA 1REVA 3QZ8A 5KFTA 2FBXA 4NZ0A 4H4MA 1X9WA 3JSMB 1S1WB 2C2DA 2OYQA 4CJQA 4RW9B 1X9MA 2IA6A 4N47A 4E1NA 2P5GA 3H5UA 4G1QA 1A5VA 3H5XA 2C28A 3QGGA 4CHZA 3FSIA 3AVCA 4RG8A 4KAIA 4EP4A 4JLHA 2AWZA 1C1BA 3KK2A 4Z4FA 5DQGA 2E6MA 3QERA 3PW7A 2XY6A 4IDKB 1N4LA 3HK2A 4ZP8A 1S1UA 3E51A 1HPZA 1S6PA 1TV6A 2RF2A 1N5YB 4I2QA 3I0SB 1J54A 3DLRA 1VRTB 4M95A 1JKHB 2Z1HA 4DF8A 2UVRA 4IRCA 3DI6A 4M3XA 2GV9A 1GX5A 1NHUA 5KG5A 5D3GB 3KLGA 1XWLA 3OL9A 1XR5A 3DYAA 3V1RA 3ZT0A 1RT3A 5I3UA 1RNHA 4R8UB 1TKDA 3L2QA 1RILA 2XI3A 4Y1CA 4Q8EA 3HP6A 2IJNA 2BE2A 2WK4A 1KHVA 1RT7A 2R8HA 1C0UB 3CJ0A 3GILA 4BWMA 4H4MB 4KHNA 4ZPAA 5KG0A 3AVNA 3SZ2A 3AVKA 4NCAA 1R0AA 3VQ8A 1MMLA 4XO0A 3KJVA 1FXXA 3NL0A 3DRSA 4LQ9A 3CFRA 4K4VA 3G6VA 4PY5A 2YNIA 4DU4A 2RDJA 3ITHB 4AH9A 1C1BB 3KK2B 4FLYA 1S1TB 2OPRB 4MKAA 4CEAA 4J2EA 5EWFA 3K58A 5T7BA 4QWDA 2DFEA 3TANA 3DOLB 1SV5A 3OVNA 2O5DA 1TV6B 2RF2B 4I2QB 2YNGB 4FJXA 4DQRA 3G10A 3SUQA 4RUAA 5J2NB 3KK3A 4Z0UA 3DLHA 3WNHA 2ATLA 3K5OA 3L3UA 4CEFA 4ED6A 1FKPA 4OVLA 2V0NA 1HYSA 4CFBA 1T8EA 1RBVA 4Z4EA 4M3RA 2BE2B 3V1OA 4F8RA 4O3QA 3OYCA 3OS2A 3VA3A 3H59A 5K14B 1J5OA 4JRQA 3LALA 3NH0A 4WFYA 3LPTA 1T3NA 3OYBA 1NK0A 4Q0BA 1S1VA 3S3OA 4F2RA 1ASWA 4E19A 2X6SA 4JUZA 2HHQA 5HP1B 3AVIA 5J1EB 1C1AA 5C25A 4ZP9A 4W5OA 4KFBB 3DLGA 4DFKA 4H4OA 2C2EA 4AILC 5KRSA 2G8IA 4CEOA 4ELVA 1YT3A 1U49A 1VSIA 4OKJA 2D0AA 4DL5A 3RTVA 1SV5B 1LWFA 4B8AB 3IRXB 2R2RA 1VK0A 3OL8A 3GV8B 1TQLA 1RDDA 4KPYA 3P5JA 3EYZA 3SQ0A 1TAUA 4F4XA 4NCGA 4IBNA 5F9LA 3LP2B 1RT2A 2BRKA 1JLFA 4MH8A 3KHHA 3IGVA 1TK8A 5KFQA 1C6VA 3M8SA 2VG6A 4EYIB 1S1VB 2GBZA 1B92A 4FBUA 1JXBA 1QUVA 3MEEB 2ZD1B 4FJGA 3FFIB 3PW2A 1SKSA 1B9DA 4Q43A 2LSNA 3O3FA 2QK9A 5DQHA 1RTHB 1SH2A 1KSPA 1S10A 3K5MA 3H5YA 3ZT3A 1S4FA 3ZT2A 1K1QA 3LP1A 2O4GA 3QEPA 4O0IA 4ECXA 3MR2A 3OYMA 4DLEA 3MAQA 3MEGA 3DLGB 4IH6A 2IM3A 3LZJA 4TLRA 3QEXA 2JC1A 1JLCA 4TY8A 3TQ1A 4DSKA 5T14A 1LWFB 4ZMMA 3QNOA 1KVBA 4DFMA 4EEYA 3PHEA 3G6YA 1RT4B 1NHVA 3THVA 4Q5VA 2W8KA 2GUIA 4BWJA 1EP4A 3VQBA 3T5LA 3N6NA 4N56A 4URGA 2R8GA 4IQXA 4PWDA 4ZTJA 1RT2B 4HUGA 1JLFB 5DK5A 2W7OA 4B9TA 4CGGA 3RR7A 1ZBIA 4WE1B 5HBMB 2E9RX 4DQQA 1JL2A 1ZTTA 3AVAA 3IG1A 3Q8PB 3M8PB 3QO9B 2VA2A 3BDPA 3PX0A 3NGIA 4HKQA 3BR9A 2HHVA 4ECTA 2HHSA 1IKWA 1VSMA 4KI6A 2RKIA 3EZ5A 3KK1A 4Y2AA 1BI4A 1NJWA 1QE1B 4PQUA 2E4LA 2B5JA 3G6XA 2JEJA 2UUTA 1Q9YA 3IN5A 2GIQA 4UQGA 2WRMA 4W5TA 3RBEA 3H4DA 3FRZA 3H2LA 5KFHA 3D0PA 1KFDA 1TL1B 4ED0A 2WHOA 5DGAA 4TY8B 3I5AA 4U6PA 1G15A 5CZ2A 2OPSB 3RB6A 4GVMA 2FVRA 1RYSA 3NH2A 5KG1A 3MEDB 1S5JA 2D0BA 3K2PA 4MK7A 4HUEA 4CGHA 2AGOA 2VG5A 3QGHA 4OKEA 2F8TA 4CJ5A 4B9VA 4E89A 4FJKA 4J9PA 3C6UA 3HPGA 4KB7A 4PWDB 4K8ZA 2ASDA 3AA3A 1IKXB 3SI8A 3QIPB 4FBTA 3DLEA 2HHUA 4EYHB 4LH4A 4W5RA 5C5JA 1SKWA 3UR0A 1EX4A 4E3SA 3KLIB 1LW0B 5I42A 4NRUA 3RMBA 1J53A 3LAMA 4O44A 3BSCA 1HMVB 5KRTA 4BDYA 2RKIB 3GYNA 4CEDA 2ASJA 3AO5A 1GX6A 3DRPB 4I9LA 4TSXA 4ECUA 3LDSA 4CERA 1GOCA 1JLBA 4RW8A 4IR1A 4CF1A 1UA0A 4FM1A 4F4YA 3GV7B 3TAMA 1LAWA 3NBPA 1ZBFA 1I39A 1ZYQA 1Z26A 4ECSA 1NOYA 5HRPA 1ZTWA 1EETA 1BCOA 4W5NA 2IMWP 3QIOA 3OJSA 4Y2CA 2DPIA 2VG5B 4FLTA 2OZMA 1LWEA 1CZ9A 3NF8A 3OSPA 4IFYA 3H40A 3DM2A 1IKYA 2ASLA 1GOAA 5KT3A 3QEVA 1TP7A 3C6TB 4M3UA 3ZSQA 4IH5A 3NMAA 3DLEB 3OYNA 4C8OA 1S6QA 3UQSA 5KG7A 3OYFA 3CJ2A 1RTDA 5EDWA 1DTQB 4EZ9A 2X6NA 5C42A 4LD0A 5KFKA 3JSMA 4E1MA 1XR6A 4BDPA 2JEGA 3AA4A 4M3TA 3KTQA 4ELTA 4MIBA 5KFRA 2HHWA 5KFGA 4CK2A 4NLVA 4RW8B 4HTUA 5KFZA 3MR5A 2IGIA 2Q3SA 1I6JA 4BE0A 4DQPA 4R5PA 2BRLA 4MFBB 4HHTA 4DL7A 3V6DB 5KFEA 3TAMB 4TQRA 3V6KA 3TAGA 3MXIA 3IGNA 1TKXB 4IDKA 4FJNA 1N5YA 1KLNA 3I0SA 4CF2A 4DFJA 1XR7A 1KVCA 3OYLA 1VRTA 5F8NA 3TR8A 4FZZA 1JKHA 1N56A 3V9SA 5SWMA 2F8EX 2IAJA 3H98A 3T5KA 5F8LA 3L2VA 4KO0B 3V4IB 3VQ4A 3ICLA 4R8UA 4FK4A 1A5XA 1WSEA 2UVVA 3NF6A 1BQNB 2BQ3A 5C42B 4B9MA 4NRTA 3CYMA 3LP0B 4RUCA 3ISNC 3PV8A 4H54A 1ASUA 2DY4A 4CIFA 4CJWA 2FJVA 2AX0A 1DLOB 1U09A 4AHUA 4O3NA 4Q45A 3S3MA 2J6SA 4TQSA 3QLHB 4CGJA 1K1SA 2G8VA 3BREA 3ITHA 1L3UA 4OPKA 5CY4A 3QEIA 4R5PB 2YNFB 4DEZA 1S1TA 4NLPA 2OPRA 2WCXA 5KI6A 1KLMB 4IRDA 4CFCA 4CCHA 2ZQBA 2FLNA 3EPGA 4ED3A 3DOLA 1QS4A 4DTXA 2YNGA 4KBIA 1WSJA 1JLQB 1J9AA 1ZBLA 2QKBA 1S0NA 1VSLA 1BIZA 2IAJB 5J2NA 1FK9A 1KHWA 2YHAA 2IC3B 2V9WA 2IM2A 3WNGA 3KLHA 1C0MA 4LH5A 1SUQB 2HB5A 2XRIA 1KVAA 4QWBA 1XI1A 3L3VA 4IRKA 4ZVGA 4AHTA 3AA2A 5K14A 5F9NA 2AQ4A 1L3TA 4LSNA 3OHBA 2Y1JA 1HYZA 1HARA 2FBVA 1NK6A 4Z4CA 3K57A 4W5QA 5HROA 1BISA 4IG0B 4ICLA 1RT6A 4CF0A 2ILYA 5HP1A 4JV2A 3HKWA 2YKMB 2I5JB 1RBUA 1DTTB 5J1EA 1HQUA 3PR5B 4K50A 3NF9A 2AX1A 3KLEB 3CDEA 2FVCA 4NYFA 4QWCA 1BCMA 4CEQA 2QKKA 2C2RA 4KFBA 3OYJA 3D45A 1T7PA 4CHPA 1RCHA 3NCIA 5EU7A 3UDLA 4NLRA 2WOMA 4O3RA 2A1RA 2BR0A 3MFIA 4GMJB 3RRGA 3CWJA 4R0EA 1W0HA 4ECQA 1RTIB 1EXQA 3IRXA 3V9WA 2XY7A 2OPQB 4O4GB 5CYMB 4CFAA 1UWBA 3OJUA 1S0MA 1FK9B 5L1IA 5HRSA 2YHBA 4KE5A 1X1PA 3KLHB 2WB4A 1K6YA 4LSLB 4K4SA 3WNEA 1HNVB 4F2SA 1BGXT 3LP2A 3VQAA 1JLGB 1RT5B 3C94A 1NJXA 1BQMA 5HRNA 4CHOA 3LWMA 1S49A 2PYLA 1EKEA 4LSNB 4RNOA 3NFAA 3HXMA 1RA6A 4DF4A 3DLBA 2JEFA 5HROB 3KOAA 2IDOA 3MEEA 2ZD1A 4CHNA 4ICLB 3U6FA 1RT6B 3FFIA 1QAIA 3GIIA 4ED1A 5EWEA 3MXJA 3KLVA 1RTHA 1HQUB 4LQ3A 4OKKA 4M3ZA 2HNZA 1QQCA 1S9EB 3OL6A 2Z1GA 3NE6A 2HMIB 1LAVA 1VSHA 3PX4A 2IOCA 2G8FA 3G0ZA 2EC0A 4RW6B 3LZIA 4KHWA 2WOMB 4WYLA 5KFOA 4DSLA 3CVKA 1CZBA 2JGUA 4YR0A 4QPXA 3CG7A 3RAXA 1RT4A 4NCBA 4OLBA 4ID5B 4TXSA 2C22A 4B3OA 4DU3A 2FVPA 1UWBB 4CHQA 1TVRA 4IFVB 3NAIA 3WNFA 4FJLA 4ZVEA 2OPPB 1D5AA 4JS5A 5KT6A 2DFHA 4E7IA 3S3NA 1TKZB 3ZSVA 5JXSA 4CK1A 3I5BA 2XI2A 4KHYA 1BQMB 4WFXA 4WZQA 4WE1A 5HBMA 2YKNB 1T05B 3AVHA 3P83D 4CJUA 1U47A 3M8PA 3QO9A 1N48A 5DMRA 5KFNA 3VA0A 2E9TA 3ZSXA 3HVTB 1HQEB 4EP5A 5F8GA 2DFFA 4Z4HA 3BSOA 2B6AB 3QIDA 2KTQA 3Q8QB 4NLOA 4EBCA 1QE1A 2XCAA 3QGIA 1RBSA 4WXWA 3KMSA 2XHBA 2HNZB 3DLKB 3OS0A 3B6PA 4I7FB 1YTAA 1UOCA 2KW4A 1RTJB 2I1RA 2J6TA 3TVKA 3PO4A 2B43A 4J9MA 1TL1A 1ZBHA 1FKOB 1RDCA 2OPSA 4X2BA 2OH2A 4DS5A 1NKBA 5CZ1A 2XGPA 4Y3CA 3I8DA 2JC0A 3MEDA 3SQ1A 4B3OB 4NLYA 1TVRB 4ZTFA 3QYYA 1QSSA 4ED8A 4C8MA 4RW4B 4BE1A 3CO9A 4CF8A 3OYHA 4KTWA 1IKXA 3QIPA 2DPJA 1O1WA 1VSFA 3L2RA 3RWUA 4QW8A 1XHXA 5KFMA 1NK4A 1SL2A 3Q8SB 1D0EA 1NJZA 2BGGA 3S9HA 1Q8IA 5KFYA 3KLIA 1LW0A 4YNQA 4NLTA 1HRHA 4CECA 3OLBA 1HMVA 3ZSZA 4DTMA 3KLFB 2HVIA 3V9UA 4FYDA 1T94A 2G8KA 4ECWA 3DRRA 5HLFA 1L5UA 3N6MA 3D28A 2XO7A 3DRPA 4MK8A 2RDIA 4Y34A 3VQQA 3SPYA 1RAJA 1U48A 4FJ8A 1JX4A 1JLEB 4J9NA 1ZETA 1TK0A 2XWYA 3VQ7A 4CGDA 1Z4UA 3RMDA 3NGDA 3MTKA 4E7LA 2KQ2A 2Z1IA 2V4RA 4DLGA 3H08A 2FVSA 4HYKA 3NKYA 2UVUA 5KG2A 2YNHB 3O4NA 2ITGA 4ID1A 3EZUA 5J2QB 4F3TA 3U3GA 4CJPA 1NKEA 2VWKA 3C6TA 3VQSA 4J9QA 5FDLB 2RN2A 4M94A 2R2TA 3CM5A 4KSEB 5KFXA 1LWCA 5F8JA 4CGIA 4HVJA 3NH1A 1DTQA 3GIMA 4CFDA 2W9BA 4Z4GA 4NLUA 1JXLA 3M9MB 3BGRA 1T03B 2ZE2A 5C24B 3DRRB 1YVUA 2WONA 5HLFB 1VSDA 4O3SA 1TAQA 3K5LA 4CEZA 4XPEA 4CJRA 3AA5X 4EO8A 4KREA 4YQWA 3E01B 4AHRA 4O3PA 3DOKB 2HW3A 3FDSA 2BANB 5J2PB 2FVQA 3PY8A 2RPIA 5SZTA 4MFBA 3AVJA 3KKSA 3OYDA 3LP3A 4RNFA 3F73A 3Q8RB 3HP9A 4KKOB 3V6DA 4M45A 2HVHA 3DMJA 3D5MA 3MR6A 2KZMA 3M8QB 1TKXA 1VRUB 1RDRA 4RNNA 3K59A 3BQ1A 4K4ZA 1S1XA 3JYTB 3AO3A 3H5SA 1UAXA 4O5BA 4FLVA 4KO0A 1WSIA 3V4IA 4ZHRB 5KFFA 4B9LA 2FC0A 4HUFA 3T3FA 2AU0A 1HNIB 1I3AA 3AVGA 4CJTA 4CJVA 2QXFA 4TY9A 3PO5A 4ZVHA 3QETA 1BQNA 1LWCB 5DLGA 2R8JA 3CFOA 3I0RB 1SKRA 5KG6A 2G8WA 3VQ9A 2W9BB 1TKTB 3GIKA 3F9KA 3VQ6A 3BGRB 1Z25A 3IS9B 3LP0A 2YV0X 4DTUA 2ZE2B 4OL8A 3RBDA 4CEEA 5FROA 5KFWA 2HAIA 4XIUA 3HVWA 4GC6A 2WONB 1NK9A 2ILZA 4M3WA 4OLAA 2HNYB 1IG9A 1DLOA 1UA1A 3TAEA 4DG1B 3SUOA 5KFAA 3QLHA 3UIQA 5JS1A 4J2DA 1C1CA 4KV8B 3V81A 3NAEA 2YNFA 5KT2A 3QESA 3SUPA 5DQIA 1S48A 3TAPA 1KLMA 3DMJB 3CJ4A 1N6QA 3HT3A 3TI0A 4WXOA 3OS1A 4DTOA 4I2PB 2QV6A 4FS2A 1S1XB 1JLQA 4DTRA 4TYBA 4G3IA 2D3UA 4PUOB 4OGEA 2HNDB 3B6OA 2IC3A 4FCYA 4J9RA 1ASVA 1RYRA 1W25A 1SUQA 4MKBA 5KFBA 4RNMA 3T19A 3CFPA 1BIUA 2X74A 3OYAA 4OJRA 2KFZA 3OYGA 2R2SA 3HVAA 4HCCA 3SYZA 1SH3A 5KFVA 3SPZA 4NYNA 3U3YA 4DQIA 3TAQA 4IG0A 1D9DA 3RR8A 2BQUA 4KHMA 4URQU 3RB4A 4YMEA 4FLWA 2YKMA 2I5JA 4NLDA 4J9OA 1DTTA 3DDKA 5KFUA 4RW7B 4ZP6A 4GC7A 3KLEA 3PW4A 1RDBA 5KFDA 1C1CB 3V81B 1JLAB 3QNNA 3VQCA 3HJFA 5KFCA 1JL1A 4PA1A 4B9SA 4ZPBA 4DTPA 3RB3A 4IG3B 4YR2A 2KZZA 1B9FA 3K5NA 1N6QB 4J2BA 1D9FA 1RTIA 3ZT1A 4O55A 3KHRA 2OPQA 1RT1A 2VG7B 4O4GA 3PW5A 5CYMA 2QE5A 4WYWA 2FJXA 5F8HA 4KHQA 4M42A 3AVFA 2F96A 4FXDA 1WLJA 3CM6A 4LSLA 1HNVA 3ZSYA 4AHSA 2G8UA 1JLGA 1RT5A 5KFPA 3L8BA 5L9XA 4CGFA 1C0TA 4JS4A 3SJJA 2ZKUA 2W9CB 4DSJA 4NLQA 5L1LA 3L2UA 2CKWA 3PW0A 2D7SA 4KHRA 1QTMA 3HM9A 3PX6A 1KRPA 4RNHA 3ALYA 4H8KA 3TAFA 2AGQA 3HYFA 4J2AA 1SH0A 1REVB 3QZ7A 1RBRA 3P1GA 2R2UA 1TGOA 1S9EA 4FJJA 4FJMA 2HMIA 2W9AA 3V9XA 3VQEA 4C8LA 3HPOA 5KFSA 4ZPCA 2IBKA 4DMNA 4RW6A 4F3OA 1HYVA 4G1QB 2GIRA 4E0DA 4K4WA 3SQ2A 2IJFA 1RA7A 3LAKA 2CJQA 1JIHA 3BQ0A 1RT1B 1TK5A 4FJIA 5KT5A 4FW2A 4ID5A 1OS5A 3A2FA 4QWEA 4IFVA 5KG4A 3GQCA 3T5JA 4Y1DA 2W8LA 2ALZA 2OPPA 3SQ4A 2Y1IA 1TKZA 1S1UB 4O3OA 1S9GA 4QW9A 1HPZB 1S6PB 4FM0A 3LPUA 5KFIA 4DTNA 1C0TB 2YKNA 1T05A 3BQ2A 3DI6B 3PUFA 4Q8FA 4DTSA 3KLGB 2DTUA 1NKCA 4KAZA 4O0JA 1YVFA 3HVTA 3DYAB 4DL4A 3FQKA 1RT3B 5I3UB 5DG7A 2P5OA 4BACA 1HQEA 2D0CA 1SL1A 3O3HA 4OGCA 1MU2A 3OYKA 1RT7B 2B6AA 2OZSA 3AO2A 2XY8A 3KD5E 3I5CA 4FS1A 4B9NA 3DLKA 3V6HA 4I7FA 4GW6A 3VQ5A 1S9FA 1RTJA 1R0AB 4CJLA 4K8XA 3CJ3A 2AGPA 3KJVB 3MF5A 2R8KA 1U45A 4DL3A 4F4KA 3DRSB 4L8RB 1FKOA 4ZPDA 3ZSOA 1BL3A 3M9OB 1C2PA 2YNIB 5JS2A 3G86A 3FQLA 2P51A 2V4QA 4KRFA 3NGYA 4MQ3A 2JLEA 2BDPA 2GC8A 1WAFA 4JV1A 3SUNA 3EY1A 4KHSA 3MR3A 5DG8A 4YR3A 4RW4A 5DG9A 4KHUA 5KTQA 1TL3A 3GIJA 3EPIA 4CIGA 4DSEA 1S9GB 3OLAA 3GV5B 2VA3A 4K4TA 4J9KA 3KK3B 2G8HA 4EZ6A 4ZVFA 2B4JA 2WTFA 4DQSA 4DSFA 5F8MA 3SV4A 4RZRA 4ZP7A 5KFJA 1FKPB 2X78A 1HYSB 2EHGA 3KLFA 1WSGA 3ZCMA 4CJ3A 1MU2B 3PVXA 1D1UA 2UUWA 3PJWA 1J5OB 1LV5A 4DU1A 2AJQA 4Q0BB 1IH7A 2EX3A 4YFUA 2FBTA 3QINA 4M3YA 2ATQA 1JLEA 3MFHA 5J2MA 3RRHA 2Z1JA 2FBYA 2UVWA 4C8NA 1KFSA 4IOBA 2PZSA 3ZSRA 2HHTA 5C25B 1VSKA 1ZBUA 3KNAA 2XC9A 3SFUA 2XGQA 2IM1A 4BE2A 3HO1A 4FLXA 4H4OB 3L2WA 2YNHA 1IKVA 3NF7A 4N5SA 5J2QA 4RU9A 1IO2A 1ITGA 1TL3B 3UPFA 3HSTB
chains in the Genus database with same CATH superfamily
4IH7A 2NLXA 3RW7A 3MCMA 4ZVUB 4EBEA 2Q6BA 2G2ZA 3OYEA 4CK3A 3V9ZA 3OA9A 4RCHA 3R97A 4DTJA 2HGLA 1X9SA 1RDAA 1VRQC 3M8ZA 2ZH3A 3QDKA 1QAYA 1BOTO 3ENQA 2VJVA 3M6VA 3AAQA 3HHLA 4HI2A 3KHYA 5KG3A 2HLTA 3F5TA 4PG8A 2J4RA 1I5OB 3MXMA 3CIZA 4LF8J 3P38A 1K8KB 2DR6A 3CDWA 2CGJA 1YVNA 5E3RA 1YG0A 4KKOA 5A6PA 1YUWA 4LFBJ 3PR4A 1VQKN 1XNQF 3CJKB 5AQLA 3SAHA 3M8QA 3PRBA 4A8XA 2VU5A 1R59O 1F21A 1W7WA 4Q2MA 3SI6A 1RTZA 2KHCA 1HJRA 5KT4A 1VQLS 3ZSWA 3DLLQ 4DS4A 3E9PA 4OFZA 1YGYA 1JLCB 3ISZA 3HL8A 4O4RA 2PEHA 4ZHRA 2RRNA 4ZCLA 5B0EA 3T1AA 1IXKA 3CC2S 3AO4A 1XHZA 2IMOA 3RB0A 2IFXA 3MX2A 1EKSA 4C23A 4X62F 4L76A 4NB4A 4DL2A 3AVBA 5BREA 2BJ3A 5AQGA 4W90B 5AE3A 3L3CA 4AF1A 5AJ3J 1NK7A 2KI2A 4FLZA 4FK2A 4JV5K 5EUHA 2PFUA 2HNYA 1ILYA 3I96A 4U7CA 1S0OA 4X66K 4L73A 4IQMA 3SCXA 3H25A 5LL6d 1DKGD 3KK1B 3D3CJ 4AT1B 2NPIA 2VH7A 2B5JB 2D5RA 2P8IA 3LDQA 3H4BA 3JQMA 4NYPA 1U04A 3W8GA 2IS3A 1Y00A 2HWHA 4ES2A 2J9CA 1IR2A 1WUAA 3MHYA 3EZOA 4PXDA 2J8SA 3MWPA 4JKHA 3CMES 4A62A 3TW0A 4HWIA 2A40A 1W9HA 4BRIA 4B8CA 2YWEA 2LFVA 2JFKA 4CO5A 3D6RA 4ECYA 1FRJA 4HLBA 2ZUGA 2W42A 4JP8A 4FM2A 3VAFA 2XS5A 2VQFJ 2RU9A 1VSEA 3ULDA 3A8YA 2FLLA 1OH5A 1CSJA 4N76A 4RW7A 3QEWA 4UTGA 4YP3A 1Q81T 2OD4A 2X51A 4E7KA 1N32F 4E7JA 1HBUA 4ILHA 4FYWB 4AE5A 1L3VA 4RW9A 2J7WA 2DGSA 1HR0F 1L3SA 4FK0A 4A57A 2Y3YA 3MM5B 4EWTA 4DSIA 3OPKA 4IG3A 4CJ4A 2IHR1 3UE2A 4X4TA 2UUCJ 2MB0B 2VFVA 2ETJA 2Q79A 1VQSA 5GAEP 2IM0A 3O5BA 2HSTA 2HSEB 3LA0A 3C95A 3C65A 1NB7A 4IOCQ 2MZTA 3O3GA 1RWXB 4K4UA 1BWEA 3R6MA 3LM9A 3NBPB 2ZEJA 1GLFO 3O4QA 5M1OA 1NK5A 1NU4A 4DR2J 3OHAA 3ZX2A 1UEKA 2IYIA 4C8KA 4CF9A 3NGZA 3D6TB 1XNRK 5HJYA 1QSYA 2VKRA 5HI7A 4TN2A 5D3GA 4U9RA 4OHZA 1FXDA 4ILMA 5F8IA 2YTCA 3CMAN 3WX4A 2D9PA 3KJNB 1LK5A 1Y9OA 3GLJA 5KFTA 1AT1B 4JI6F 3W2VA 4CJQA 3ENOA 4CTAA 2VKZG 2P5GA 3KWIA 1A5VA 3M1FA 3H5XA 1MMNA 1K73T 2RJZA 2C28A 3QGGA 4P75A 5IZHA 3AVCA 4KAIA 4RG8A 3BH6B 3VF2A 4PEOA 5AQTA 4EP4A 3EXCX 4I6MB 3U9DA 3KK2A 2QA4G 2H48B 3FZMA 2LLZA 3VEXA 4BGAA 4DR3J 3FZHA 3PW7A 3MCNA 2GUPA 4DPUA 2B4OA 4CLLA 3ENAA 4OHVA 1VRTB 2NRVA 4M63C 4BC7A 4DF8A 2UVRA 4X4RA 3DI6A 2MSTA 1HNXF 1GX5A 2P9SA 5E33A 3KLGA 5MLCQ 3OL9A 1N5QA 3DU5A 1XR5A 1RT3A 2XI3A 5D77A 3J7AN 3UKRB 1VBXA 2R8HA 1ZM2A 4C98A 4BWMA 4Q2LA 5BYSA 4H4MB 1R8CA 1TU0B 2BE9B 5U47A 4DV0K 3AVKA 4NCAA 4F3MA 1R0AA 1VJQA 3VQ8A 8RUCA 3HX9A 5AQPA 1MMLA 1OPIA 4N77A 5LXRA 2KJVA 3NL0A 3CFRA 3EGWB 1O51A 4PXCA 2LA4A 5L39A 1OY6A 4DU4A 3N5FA 1FWLA 3EL2A 4O8UA 2Q36A 4AH9A 1VQLN 4A46A 2F8MA 3RSEA 1YZ7A 4FLYA 1S1TB 1FNOA 4Y65A 1GNKA 2QRRA 5D0EA 3CC2N 3JB9k 3DOLB 1OJ4A 5AE2A 2LDIA 2RF2B 4I2QB 1XMOK 2ZWHA 3SLCA 5ETVA 2DNYA 2LEAA 4RUAA 3KK3A 1H98A 1S99A 3HFKA 2F9JA 3CCLN 1JJ2R 3UCGA 1IBKK 4CEFA 1KAZA 5CABA 1T8EA 4CFBA 3GSIA 5HVFA 3T1HJ 4DMZA 3M30B 3R1XA 1GAOA 3OYCA 1VK3A 1NDKA 3CCJS 1NK0A 6FDRA 2XLKA 2OSRA 1ZM4A 1QD1A 4WPAA 3S3OA 1ASWA 4ANDA 2HHQA 5HP1B 2HFUA 3C7NA 2V2KA 1MWQA 4BS2A 1CBKA 1Z2LA 4J7CA 3LH2S 1OH8A 4I6WA 4OX9J 1G3OA 1YXQA 3LGMA 4ZP9A 3ZX0A 4W5OA 4KFBB 3DLGA 1AFJA 4H5VA 5KRSA 3OTOJ 1SJ4P 1VHXA 4ELVA 5D4NA 5ETTA 4MYTA 2YJEA 1ATRA 2B4UA 3PCOB 1LK7A 1WTFA 1SV5B 2ADCA 3SBGA 4UQTA 5AR0A 3KKFA 2NCKL 5KPTA 4KPYA 3OTEA 4UOHA 3VGMA 4U7BA 1I94J 2GV1A 1RT2A 1WI6A 2BRKA 1JLFA 4FWLA 5E7OB 4LREA 1NZAA 1TK8A 1J6ZA 4P74A 1YX2A 1EAYC 5KFQA 3SK3A 3M8SA 3M2UA 3IM9A 4EYIB 4JI4J 1U2FA 2ZD1B 1FKAF 3H1VX 1SKSA 1DFDA 4AM6A 4Q43A 5C2CA 1XMQK 2QK9A 4LF9J 1SH2A 1S10A 1S4FA 3ZT2A 4RUHA 3LP1A 1RAFB 3UI3A 3ZZUA 5GAHU 2MEWA 1REGX 5AT1B 4O0IA 4ECXA 3QEPA 4DUZK 2MKIA 3MAQA 2FHJD 2JVRA 3CQXA 3DN9A 2YPZA 2GX8A 4B02A 5T14A 1LWFB 4D3HA 1VQPS 2Q43A 4IEEA 1NZ8A 1KVBA 1R0CB 3PHEA 2ZH8A 3D67A 1NHVA 3THVA 1NGGA 3EEQA 1KQKA 2XM3A 2HOEA 3CMQA 3NCQA 2VASA 3BN7A 3TZYA 5L8RC 3G87A 2YKPA 2ZBCA 4ZTJA 4P6QA 3R5JB 5DK5A 3HOTA 5DM6L 4CGGA 4OZNA 2GVDA 4U96A 4BRCA 2CZVC 4WE1B 4JI3J 4LR9A 2XULA 4DQQA 2H9ZA 3IG1A 5BR8F 4O0NA 3PX0A 1RKJA 2R7UA 3NGIA 2AZ1A 3M2VB 2MSSA 2HHVA 2HHSA 5JVHL 2RKIA 4DI6A 1M1HA 2V4JA 3EZ5A 4XH5A 1BI4A 1VCTA 5F41A 4AXJA 2FHKA 1LXJA 2JEJA 2F65A 3Q2SC 1Q9YA 1HKGA 5JICA 2H3GX 2LA6A 3W66A 2WRMA 4ZS6A 4QIGA 1VK8A 3MMCB 5KFHA 2F4VJ 2QFIA 4ED0A 3GU0A 3UR3C 2LKZA 4TY8B 4FOEA 4U6PA 5CZ2A 1H72C 1OMSA 1RYSA 5K5MA 3MEDB 1S5JA 1HWJA 3K2PA 2UU9J 2VG5A 4B9VA 4WP3A 1D9AA 2BTFA 4E89A 2AT1B 3HPGA 1ZAXA 2JVOA 3CSKA 4PWDB 1NM1A 3C19A 4K8ZA 2ASDA 3AA3A 2VICA 2RH3A 1VQ6S 4CLTA 4W5RA 4DR4K 1RB0A 2EBGA 5I42A 3ILIA 4BRAA 1VBZA 3ENBA 3N28A 2NZTA 5A0YB 4CEDA 2ZZMA 2ASJA 1T3VA 1MSWD 5IQQA 3VF0B 3H3OB 3BM7A 1MN9A 3UVJA 4K5RA 5C12A 2FF3B 2GQCA 3DRPB 5CZXA 1KS2A 4H0YB 5BR9A 3MGJA 2RUSA 3MMAB 1GOCA 2GMJA 1JJCB 4IR1A 2CADA 2QM1A 1UA0A 4FM1A 2BJDA 3MPDA 2UUBF 4JOUA 4CT9A 3CJ9A 2Z30B 1ZTWA 1EETA 5C7PA 4A2BA 2P9EA 5IT9Y 2IMWP 4IFEA 3OFHA 5ETSA 4DHYA 3I32A 1LWEA 3BB5A 1CZ9A 4IFYA 3EM1A 3EMTA 3CCMS 3DM2A 4CM0A 2ASLA 4K0KK 3GFZA 3W7BA 5IWAF 2ASYA 3OYNA 1S6QA 1NRKA 4M5LA 1YAGA 3CCJN 3C14B 3P96A 2VGMA 5C42A 2Z0GA 3BBCA 4E1MA 2QYGA 4C97A 3Q23A 2FIUA 1OY8A 4LRDA 5AQJA 3I56S 4MIBA 1H7WA 2OJ3A 2OSQA 5LSLA 4CK2A 4NLVA 1EJ7L 4HTUA 2JWNA 2C2KB 4JI5J 3CERA 5JMNA 1W2IA 1KVKA 3V6DB 4JAXA 1T02A 4OYPA 4BC4A 3TAGA 2XEXA 3I0SA 2GS8A 2V8DA 4DFJA 4B1YB 3D0GE 3ZTPA 4FZZA 5F8NA 3TR8A 4FXWA 1N56A 2CZ9A 2PI5A 3CQYA 5F8LA 3L2VA 4KO0B 1QDUB 2JOQA 4M7YA 3K17A 3ICLA 5CZVA 1NH8A 1WSEA 3DXKB 2DXFA 4J9VA 2UVVA 2VQEK 3NF6A 1BQNB 4CO4A 1N8RO 4B9MA 2WVEA 3CYMA 3LP0B 3ISNC 4H54A 2EPIA 2E20A 2FJVA 2DT9A 1U09A 4Q45A 1RKIA 1CJTA 4TQSA 3VENA 1H74A 4CGJA 3JAMO 3G8SA 4C2MA 4B9QA 3UN5A 3BGFA 1G1XA 1KLMB 3O9SA 4CCHA 5DO2A 4AXIA 2FLNA 4I6YA 4DU8A 2P6TA 4ED3A 3CB4A 1IM6A 3DWLA 2OP5A 2YNGA 4X4SA 1YRTA 2QKBA 3AGKA 4RPFA 4ED4A 1VSLA 2AF6A 4F4AA 1BIZA 3ZTRA 2K1RA 2YY3A 3W9HA 2V9WA 2IM2A 3DFEA 3QFWA 3U1MA 4LH5A 1M5OC 1PBUA 2VODA 2XRIA 1X4CA 1S3XA 3ULHA 1OO0B 4KHPJ 1X5OA 2RMLA 3MI7X 4AHTA 2M5YA 3CEDA 3MR7A 1FFWB 5F9NA 2AQ4A 4LSNA 3BF4A 3OHBA 3E3XA 3W3DA 3JQKA 4M5DB 4FPAA 1BISA 3P6YC 4ICLA 4CF0A 1YI2S 4JV2A 3LGHA 4F04B 4U67Q 2E1YA 3KLEB 2ROEA 5IV4A 3V5RA 2V67A 1C0FA 4B1XB 3OYJA 4YB7A 2VHGA 4CHPA 1MWMA 5EU7A 2WOMA 5AXLA 3ZZTA 1WG4A 3CCUN 3H8YA 1FDBA 5AJ3F 4R0EA 5D6GA 2G13A 1N32K 1HNWF 2XLIA 2P2CB 1UWBA 1RHQB 1FK9B 5L1IA 2YHBA 4WFNQ 4DV3J 2RRAA 1X1PA 1K6YA 1CJUA 3PNIA 3WNEA 1BMQB 4QS9A 1BGXT 3LP2A 3ETOA 3G2XA 1RT5B 1VQ6N 2UV8A 1NJXA 3C94A 2KHDA 2CDQA 1BQMA 4CHOA 3JXOA 3LWMA 2CPFA 2QL7B 3DAWA 1EKEA 3M32A 1ROFA 2E2OA 3NFAA 3DHWC 1Z6RA 3KOAA 3A3NB 3O3LA 1RT6B 1KWMA 5E5NA 2CG4A 3O4WA 3GIIA 3KLVA 2IY5B 3B6BA 4LMZA 3VGLA 4JI0J 2HVDA 5EX0A 1HIYA 2JLFA 1QQCA 1S9EB 2Z1GA 3NE6A 4V19X 1M1KT 2KHOA 2DHAA 1LAVA 3PX4A 3O8MA 4BR2A 4BR5A 2G8FA 2NNWA 2BM1A 3G0ZA 4RW6B 2O8BB 4KHWA 2VQFF 1IWGA 3UO0A 3AD8C 2QWMA 3CVKA 4EIAA 5IC4B 2HK2A 3M6XA 5A8RB 4NCBA 4TXSA 3HZEA 1VQNN 3CCMN 4CHQA 4FYYB 4FJLA 1Q86O 2Y0SD 2P9UA 4ETXA 2NPFA 3QATA 4NMXA 3G8QA 5JXSA 4ILGB 4KHYA 3ATUA 4I6AA 2LCWA 2MKHA 1WF1A 2YKNB 4A5BA 3AVHA 1S22A 1U47A 4CJUA 3M8PA 2E9TA 1FJGK 1HJOA 1KN6A 1FJCA 3BGLA 3EGVA 3E1YA 2UXBK 2DFFA 2B6AB 4PWWA 4ZVRB 2NRZA 5DDRC 3VEVA 1RK8A 2XCAA 1RBSA 4DR2F 3OQ2A 3LGNA 2KW4A 1RTJB 2I1RA 2J6TA 2CQBA 3LDLA 2KVIA 4ERDA 3IAM9 5D8HB 3R5GA 1RDCA 2XBPA 1UVJA 2OPSA 4JK9A 4ZLJA 1HKBA 2QXLA 2NRWA 1IJFB 1RBOB 5AQIA 2OMLA 3HFVA 1TVRB 3Q7CA 3QYYA 1C4CA 1SQGA 3IMQJ 4BE1A 2FZKB 1KC8T 4FF2A 1IKXA 2LQ9A 4DUTA 4H5NA 2ZNZA 1SIZA 4L3KA 3AQPA 2J7UA 2GGPA 4LF4J 3OR1B 3UWTA 1LW0A 3VGSA 1YIJN 2JZ5A 1U24A 3FC9A 1HMVA 1KEKA 2PA3A 3KLFB 2HVIA 2HK3A 3DRRA 3PFEA 2XO7A 4CI6A 1U0HB 5GADU 2H3EB 4IJAA 3O1LA 3VERA 2RDIA 5AQOA 3VQQA 1VYAA 2CQ2A 4DX5A 1UVMA 1JLEB 3LPEA 3MOJB 4J9NA 3CCQS 5B0GA 5A2QY 4H4KC 2XWYA 3VQ7A 1Z4UA 2PT0A 1HD0A 3R8YA 4IJNA 2C3UA 4AL6A 2FJEB 3MCOA 2D1KA 3IR5B 4H0TB 1Q7LB 3QJLA 3RGIA 5AQSA 2J8AA 2FZCB 2Q3PA 4K2JA 3IR6B 2EFNA 3HT0A 3O4NA 1H1VA 2ITGA 4ID1A 5J2QB 4F3TA 2BEFA 2KG1A 3B54A 4J9QA 3HI0A 1YHQS 2RN2A 5FLXY 4FPBA 2DRDA 2W9BA 1FDAA 2ZBRA 2HIYA 1JXLA 5ETRA 1TL5A 1YI2N 2FPHX 4ISFA 2XSJA 4HHHA 2EKYA 3HHLB 4BG8A 2VFSA 3K5LA 1S72S 4CEZA 1NLKL 3J80Y 3L09A 4JI7K 4CJRA 2RD5C 4OPAA 4O3PA 1XBWA 2FVQA 2RPIA 3I55S 4M63A 3X1LB 5E3PA 1WOOA 4A8WA 5J1PA 3R5BA 3Q8RB 4KKOB 4M45A 4XAKA 2HVHA 1TR0A 3M8QB 1TKXA 1RDWX 2CH6A 3SXLA 2V51B 3QMQA 3BF1A 2QWNA 4K4ZA 3SSSA 5HVHA 3NMUA 1BC6A 2D74B 1WSIA 4ZHRB 5DM7Q 1L3KA 3T3FA 2V8HA 4S0MA 4CJTA 1E3MA 3Q2TC 4TY9A 1Z05A 3W0LA 4ZVHA 1LWCB 3HDSA 5DLGA 3CFOA 3GG0A 2G8WA 3CJSA 5GADI 3CF5L 1JXVA 4NWBA 3F9KA 4OL8A 2HURA 3VR1A 4FF4A 3F9MA 3RBDA 5HATA 4DV1K 3SCJE 2ILZA 3N5BA 4C3MA 5E3CA 4CO0A 3RJMB 2LXUA 2HNYB 1DLOA 3TAEA 4PWUA 4PG4A 4JV5J 5AXMA 4J2DA 1C1CA 3TR5A 2KKHA 4X66J 3SIPB 7FDRA 3K0JA 3K2YA 4OHWA 1YJNS 4FZVA 1B0VA 3OS1A 2RS2A 2OHDA 3CD6S 4P73A 2ZJQL 4NXNJ 1U1OA 4J9RA 4FKYA 2IDLA 3BN4A 2VDIA 3QICA 1K47A 5D0HA 2PMHA 2ZJRQ 3T19A 3RRKA 1BIUA 2X74A 3OYAA 4OJRA 2KFZA 3OYGA 3UKUB 1AUDA 1Q81O 4HCCA 1SH3A 1FO1A 5KFVA 3RBXA 1ZA1B 2BQUA 4URQU 4CLKA 4NLDA 1DTTA 5CH7B 2NYIA 5F1XA 1SVDA 4RW7B 4ZP6A 3TUIC 3PRVA 4DZ6A 4DPTA 2O1PA 5ETKA 4MDBA 3QT6A 1HI8A 4O5FA 5KFDA 5LMNJ 3MMJA 3V81B 3CIPA 4CO2A 3MEKA 1KNZA 4IG3B 3OXGA 4UUXA 1B9FA 3K5NA 1F5AA 4U8VA 4JI3F 4DN9A 4BC9A 1TL7A 4O4GA 2MLYA 4EHTA 5CYMA 2QE5A 3THYA 2FJXA 5F8HA 1UJ6A 1DHMA 4FDFA 2F96A 4DPOA 1PYOB 1WLJA 4LSLA 2Y0BB 1HNVA 1U0SA 2G8UA 2BJ8A 2QTWA 4JS4A 3R7BB 5HMXA 1X4FA 1GMUA 4DSJA 1LFWA 4KR0B 1VHFA 2D7SA 3F56A 1XNRJ 2A2CA 1UZDA 1KRPA 4RNHA 1K73O 3TAFA 4NI2A 5AQQA 1XEZA 2AGQA 3HYFA 4FSVA 2HHHF 3DOMA 4I64A 2H51B 2HFZA 4MJKA 2HQGA 4UOCA 2HRYA 4NX9A 1TGOA 3W2VB 3TEGA 2HMIA 3LDOA 4M5HA 3AB2B 1NPKA 2NRRA 3SEOA 4CTAB 1NG9A 4C8LA 3B82A 2E1PA 4DMNA 1E6VB 1YJWS 4HH1A 2IJFA 5I3QA 1TUWA 3LAKA 2Y8WA 3BQ0A 3VVTA 1RT1B 4KH1B 3Q8VA 2DNLA 2EXUA 3MOZA 4ID5A 2ADBA 4ILRA 4MKYA 2ZOGA 3ET6A 3CDBA 4DPYA 4FM0A 4GVLA 3KZBA 5M1PA 2YQ3A 1C0TB 2R7QA 4LIWA 5CAAA 3MMBB 3LDNA 2HBZB 3DI6B 3PUFA 1RHMB 3FK4A 3OBWA 2P9SB 3GB0A 4DTSA 3KLGB 3RUBL 4KAZA 5BPNA 3M8YA 1RT3B 3CJRA 4OYIA 5DG7A 1QZ5A 2NQPA 1MU2A 3OYKA 4G65A 4BCAA 2OCEA 3I5CA 3C3LA 3ZFVA 3TUZC 5IM0A 3DLKA 3V6HA 2UXCF 3ATVA 2QSFA 2I8EA 1R0AB 1WC6A 2CIMA 3RAMA 4DV0J 3MM6B 1XC3A 3M9OB 2IVYA 5JS2A 3MN6A 4KRFA 1PAEX 4PXBA 2B9YA 3RSEB 2GWJA 4ALZA 4KHSA 5DDOC 3EY1A 4YR3A 5DG9A 1RWVB 5KTQA 3H3NO 4ZN1A 2NXCA 4DSEA 3R5DA 1UVNA 2VUGA 1U1MA 3VF4A 3TJAA 3L4BC 3KK3B 2OD6A 2YVSA 4NLCA 8ATCB 4CJ3A 1IBKJ 4KRWA 4XDDA 4Y6IA 2UUWA 3CGIA 1O0PA 4DU1A 4AL7A 4BRFA 4DR1F 1HWUA 2N7CA 3FCWA 4YFUA 3QINA 4M3YA 2ATQA 5E3AA 4BR7A 3NOCA 1JCFA 4C8NA 2UVWA 3OUYA 1YJNN 2HKEA 1VSKA 4NLBA 3QFUA 3BR8A 2XGQA 2A5XA 2E8AA 3NF7A 4N5SA 2HRUA 5ADXA 4RU9A 4WQ5C 3VAHA 1RAOA 2Y1RI 5KFLA 4OYWA 1KAYA 4KH4A 1RJJA 3GZ7A 1RWMB 2MLXA 2VBZA 3QT7A 1NBEB 4CESA 1CXUA 3QB0A 1PJ6A 3BF3A 4HTLA 3N6LA 1DY3A 2FHMA 2JHEA 4N41A 2E1ZA 1XUPO 4AHCA 1ITPA 2AMCB 4IR9A 2KXFA 4AHVA 2HQCA 4FLUA 3HPHA 1KTVA 3S1TA 3FMBA 4IO8A 2R8IA 4B1WB 3J7Z5 3M2RB 3EWGA 1HWIA 3WT0A 2BANA 5J2PA 3TRGA 3D2FB 1VQ7N 4FW1A 4E2FB 5KAKA 1LNQA 4J9SA 2HGNA 3IAYA 4KHPF 5HOOA 4M41A 1D8YA 2BW7A 3LP1B 3B8HA 1UFLA 4H5RA 3DDIA 1SC6A 3CDAA 2XCPA 2PN6A 1KTQA 4KB1A 3KKRA 3GE9A 3KHLA 2DGUA 4FVMA 4CH0S 3C6AA 4NYZA 4ECRA 2D69A 3M9NB 3ZT4A 3P8BB 1YQHA 3NAHA 4FJ9A 3BSNA 1Y97A 4YHHF 3WIVA 1TKTA 1NHKL 3T5HA 1APSA 1X4HA 4ANCA 3LQVA 2GVDB 4BRNA 2V50A 1FE4A 3HHDA 3PJXA 2E9ZA 2E6LA 3HJVA 2RS8A 3IG1B 4L75A 2OUGA 4B9UA 3WXMB 4LFAJ 4DG1A 4JV0A 4XPCA 2HS3A 4WFZA 4ZPTR 3OBIA 2ZM6J 2V4JB 3RMCA 1BI4B 2W25A 3N9UC 4DB3A 2VWJA 1EZZB 4NLWA 1UP1A 2QEXN 1WG5A 1FTRA 5JMVA 1CJVA 4I56A 2HZCA 4K4XA 3NNHA 1RHUB 1G99A 4DCPB 1GMWD 2HNDA 5JUMA 4QOZB 2KXHA 3DJCA 1X60A 2DNZA 5KGWA 3K8WA 3NCRA 4CJSA 4M1KA 4KI4A 1WNSA 2Z56B 3BKTA 3ULEA 3OSNA 1S6UA 4NO7A 4ED2A 1S97A 1FWKA 3BEGB 3PYDA 1M5KC 2QIFA 5KGXA 5M2PA 3NDKA 4ECZA 1XC9A 1N5TA 4BC3A 4CE9A 3MDFA 1DEJA 1BWVA 2FDNA 3AVMA 2HEKA 5I42B 2BJ9A 5DLFA 4QCLA 1JLAA 1Q18A 1NK8A 4H5WA 1FDDA 2GAHC 2ZDPA 4FZXC 2W1BA 2JH3A 4YY3F 4I6MA 2B8PA 1JQGA 1WN7A 2DYAA 1D8ZA 1MWKA 4DFPA 3RAQA 3OL7A 1T9WA 1A5WA 3GONA 2DY1A 5B7WA 4A8YA 1YZ6A 1EETB 4X64F 3VWSA 3L7OA 1LWEB 4IFYB 2C3YA 1Y4ZB 3DM2B 4F0KA 4USVA 4MIAA 1HBMA 1CVJA 3AV9A 1NJYA 4CJFA 1RBTA 4A8SA 1QHTA 1EQMA 4H0VB 1VSJA 1S6QB 3BSAA 4ELUA 3MM9A 2EI5A 3SSRA 1RDUA 1REVA 5AQKA 1GFWB 4DR5K 4H4MA 1TFWA 1X9WA 1S1WB 2C2DA 1QVFM 2IA6A 1S79A 2YJFA 4E1NA 3O9QA 3H5UA 3M4XA 4G1QA 3W62A 3FLCO 2FSNA 3HCXA 1TYQB 3D7SB 1Y3KA 1ZC6A 3J81U 4C1NI 1FT8A 5DQGA 5KOXA 5ETOA 1TTHB 4LF5K 3KDOA 1RXOB 5FD1A 3VEOA 3HK2A 3AOCA 2QTDA 1S6PA 2RF2A 3WBZA 3MAAA 4I2QA 3I0SB 1J54A 3G82A 2LDYA 1IG8A 2E44A 2CPYA 1XERA 3HF5A 5KG5A 1XWLA 2QSWA 4MIWA 1FNMA 3ZT0A 1V5IB 3EKUA 5K9FA 1RILA 3L2QA 4Q8EA 1YBUA 1S0VA 4C9DA 3THTA 1XNQJ 2D0PA 2CWXA 1LCUA 4PG5A 4YB6A 4ZIVA 3CJ0A 3U27A 2VQEJ 4DUYF 3DLLL 4TVAB 2R7TA 4KPCA 3M05A 3POTA 4XO0A 3FEYB 3DRSA 3EE3A 4QS8A 4JKAA 3TA2A 4X62J 2RDJA 5K8OA 1C1BB 4CZKA 4KT0C 1K8AT 4FWRA 4MKAA 3ZZZA 4RTFD 3EDQB 2DHSA 5EWFA 3K58A 1B0PA 1V6HA 2DFEA 3PEHA 1SV5A 3OVNA 5H1SV 4CZGA 2YNGB 4FJXA 3ZC4A 2RT3A 2H5IB 4Z0UA 2K1RB 3DLHA 4BR4A 3WNHA 2ZOFA 1H7XA 3K5OA 4ED6A 4F02A 4OHXA 2PC6A 3MMVA 1RADB 2BE2B 4H4KA 2GMHA 2PAVA 1HNZK 3VA3A 1DGKN 4PPZA 1T9VA 1F5CA 4DV6F 4F2RA 4E19A 3L95X 3PTWA 5D4LA 1J5EF 2NXEA 2Z8QA 4K59A 3NS5A 5C25A 3FKBA 2XB2D 4CNZA 3PKMA 1YLXA 3EJMA 3T6JA 1GXUA 4DR7K 1VQ5S 2YWFA 4DFKA 2BOAA 2G8IA 1YT3A 1U49A 3O6WA 4FWOA 4RR5A 4LF6K 4X65K 4DL5A 1LWFA 3FCHA 3C66A 2NSBA 1IBMK 2PBDA 2QI2A 2N4DA 3OV7A 1TZ0A 1TQLA 4JV5F 1N32J 4PZVA 1TAUA 3EYZA 2KKZA 4PKIA 4GV9A 4C3LA 1CJUB 3R6GB 1LXNA 4X66F 3LP2B 4KH0B 2DHGA 3KHHA 3CJAA 3OFFA 4ZLNA 1C6VA 1UMJA 3MTJA 2JLGA 4EMDA 1NSPA 3M5RA 2QO3A 3AD7C 5AQRA 4IOCL 2P5VA 4P2MA 3EDRB 1JXBA 1QUVA 3KUEA 3I4HX 1MLAA 4B3TK 1R0BG 4FJGA 3PRDA 2P9GA 1OYEA 2K7KA 2JFDA 2KYZA 2LSNA 2DY9A 1YBTA 1JCEA 2QA1A 5DQHA 3K5MA 3ZT3A 3SAGA 2E1RA 4M5IA 4CZJA 4LBPA 3MEGA 4IEIA 2IM3A 3ENHA 2HHHK 2KN4A 3PIOQ 2KM8C 4CZHA 4TY8A 3TPQA 4B3MF 3TQ1A 1X4DA 2MZ1A 1MA9B 4EEYA 5B8HA 3ENVA 5GAEU 4Q5VA 2BUNA 2W8KA 2GUIA 2BM0A 4BVOA 4BWJA 5LMUK 1DARA 5CD4H 3T5LA 3N6NA 4Z7CA 4N56A 2QLFB 4IQXA 1KP6A 4PWDA 4QQBA 1RE1B 3GFHA 4HUGA 4WK1A 2DCUB 4I67A 2W7OA 4B9TA 2NZCA 3G6ES 1I51B 1UW4A 3R5CA 3VALA 3FGVA 1QQMA 4ITSA 3M8PB 2U2FA 3OXFA 4HKQA 2I6WA 2V2VA 3G8TA 2IJRA 4A61A 2MZQA 2E5GA 1NJWA 2I7NA 4PQUA 2NXNA 1Y10A 2UUTA 1WB9A 1S7IA 3MMAA 2GIQA 3BYRA 4B1VA 4W5TA 1PCAA 4QOTA 3P3DA 2NXJA 1KC8O 1KFDA 5AQYA 1XNRF 4USJC 2WHOA 3DGVA 1G15A 2OPSB 3HZ6A 2R42A 2R7OA 3RB6A 4GVMA 2AJ0A 4HUEA 4MK7A 4CGHA 4OZ0A 3TP2A 4BRKA 2GJFA 2F8TA 4J9PA 1NAQA 3CPWM 4LT6A 1IKXB 3SI8A 3C16A 1NDPA 5FJ4A 3AGRA 3K8VA 2DRBA 4GKJK 5C5JA 4OJ3A 2CJAA 4N8NA 3VHQA 1JWWA 2YPYA 2ZGZA 4ZVQB 2WSCC 4ILLA 4E3SA 2YH1A 1LW0B 5CA5A 1OWXA 2HQDA 2WVBA 1J53A 4O44A 3BSCA 1HMVB 2QWOA 5E3QA 3W65A 3B78A 2ZITA 4GY2B 2DH9A 2AJ1A 1OSCA 1X4AA 2IVOA 3CD5A 2V34A 3TYTA 4CERA 4DHVA 1SCJB 3DRXA 2LYVA 1LAWA 2HWTA 1ZBFA 1I39A 4DR1K 1NOYA 1PJ5A 2GX9A 4ES1A 4CZMA 1YRUA 2R7RA 3QIOA 4FWQA 3SBTA 2DPIA 2OZMA 1EQYA 3NF8A 6AT1B 3H40A 5DS7A 3AOBA 1VHIA 1IKYA 5A8WB 5T41A 2FHOB 4U8YA 3ZSQA 4IWVA 3D66A 1IQZA 1VQ9S 3DLEB 2PE8A 1QVFR 1BHNA 1H73A 1NGEA 3PFOA 3NY0A 3OYFA 3J7ZT 8AT1B 3HMJG 2N3OA 4OZ2A 1RTDA 4BRGA 1RU1A 2Z4PA 3O80A 2X6NA 1WI8A 3GG1A 1RQ0A 4LD0A 2CA9A 3JSMA 3IO1A 4BQZA 2XSJB 3B8AX 4BDPA 1M5VC 1Y11A 3UCUP 3U7JA 3F44A 4ELTA 4C3KA 4DV2K 4DR6K 3ZZ0A 4HT5A 2WUSA 3MR5A 2IGIA 2Q3SA 2XZWA 2KL8A 3CCZA 4NA3A 1XMOF 5L38A 4WFBL 4YOTA 4OPHA 4JYAF 4BE0A 1SIWB 4M5KA 4DL7A 2KG0A 3V6KA 2F3JA 3BGUA 4MDAA 1TKXB 4IDKA 2PA8D 4C0HA 2ZHBA 2O8FA 1N5YA 1SJFA 4ISGA 5HJXA 2WVCA 3SQGA 2F8EX 4P72A 3T5KA 5EGYA 3M7VA 2FYXA 3MUMP 2NLWA 4NOHA 5HMWA 5IT9O 5EOYA 3MD3A 1VJWA 2B7CB 3HSZA 2J0WA 2M8DB 3FUYA 3NOGA 3ILLA 4P2SA 4NRTA 1KONA 3MD1A 1VISA 1RSCA 4B3SK 4RWWA 1UZHA 3PV8A 2CQIA 1R6VA 1DLOB 3KK7A 2P9LA 4G6VB 4ZVPB 2WFBA 4HI1A 4QS7A 3BREA 3ITHA 5BYRA 4OPKA 3QEIA 2B7BB 2OPRA 2WCXA 5HQMA 3T1YK 1Z2ZA 1P8ZA 2WSFC 2GWKA 1WC3A 1NGCA 4PYDA 5JJBA 1ZBLA 3BZQA 1ZOTA 4FWNA 2IAJB 2NUHA 1FK9A 3DLJA 3VESA 2Z2YB 1A6LA 5ETPA 2L9WA 3KG0A 2HB5A 4JKDA 1TUVA 5DDPC 3G6EN 2WB1D 1UTAA 2QGFB 4IRKA 2CJKA 1XMQF 1WC0A 3AA2A 3LF0A 3CJBA 1L3TA 1HARA 4K5SA 4Z4CA 2QA4S 4UF4A 2F8HA 4W5QA 5IT0A 2CQHA 4DUZF 1NPPA 1SPBP 1UVLA 1RT6A 2G0CA 2OAUA 1HD1A 3HSJA 3HKWA 1Q82T 5HL7Q 2IDEA 1DTTB 1N0UA 1TUYA 3AODA 5H9FK 4WQ5A 3NF9A 2FY8A 3ZX3A 2F4FA 2Q31A 2QKKA 2C2RA 3VEWA 1CC8A 5E0OA 3MZIA 2EWSA 2J7KA 4GMJB 3QWPA 4YDDB 2MKYA 1TL7B 3CCRS 1YKWA 3IRXA 2BA9A 2XY7A 4O4GB 3HOSA 5CYMB 5A8RA 2E7VA 3THYB 1S0MA 3KLHB 4FYXB 4LSLB 5CQGA 1HNVB 2CQGA 2X1AA 3LM2A 3FJ2A 4RL1A 5HRNA 3IRWP 4WFAQ 2RQKA 2C42A 4OLOA 2PO4A 2JDJA 5HK4A 5HVGA 2DGVA 4RNOA 2XYHB 4DF4A 4RLEA 2JEFA 5HROB 1VFJA 2QZ8A 4X84A 3MEEA 3RG6A 4CHNA 2GHPA 3U6FA 1B0TA 1VC0A 5LSOA 2UUBJ 4NI2B 2ALYB 2CQDA 3DOMB 5EWEA 3MXJA 2D9OA 3VMFB 3D1QA 2BABA 1HBOB 4KGXB 4LQ3A 1NBWA 4OKKA 4JKGA 3OL6A 2HMIB 4A47A 4ED5A 2ZVSA 1VSHA 3FZLA 2VFRA 1NMEB 4LF2A 3PIPQ 4OYMA 4WYLA 4IO9Q 2H5JB 3EE9A 1X0FA 3CG7A 3RAXA 4ID5B 3TWZA 4DU3A 2FVPA 2IVNA 3A8IA 4DR4F 2VYPA 1TVRA 3NAIA 3ET6B 2LEBA 4K43A 4ZVEA 1IR1A 4DV5K 3I5BA 3HM8A 2RILA 4WFXA 4WZQA 1IV0A 4XH1A 5HBMA 4C4WA 5K20B 5HAOA 2MQNA 3QO9A 3VA0A 1N52B 4USKA 2O8DA 1WWHA 2YX1A 4EP5A 4Z4HA 4EBCA 2NUUG 3QGIA 2YX4A 4WXWA 2XHBA 3CJQA 2HNZB 2QJ3A 1FD2A 2AKWB 5IM0B 2MMYA 3DLKB 2MDAA 4CLUA 3B6PA 1CS4B 2F63A 4N8OA 2QG9B 3PO4A 4OI6A 3OVSA 2LECA 3SBMA 3G4SS 5A6WA 2Q6CA 2M4MA 3CPWR 4K0KF 5E26A 1TFYA 2JC0A 3SQ1A 4B3OB 3NWRA 3N0VA 1PBAA 2NYHA 1WKKA 1QSSA 4C8MA 3V4MA 3DXBA 3CIMA 3AY0A 1EKRA 2XMVA 3VEYA 1VSFA 3RWUA 3ZLJA 3C8YA 1BUXA 4WU3A 4CZLA 1SL2A 2B8QA 5CCMA 1Q8IA 1EQ0A 2AEFA 4ID8A 4BRPA 3ZSZA 3S01A 3IWNC 1UKUA 3FZKA 2C2OB 4WWSA 2MGZB 2DNPA 1V5VA 5IQ6A 4WF9Q 1L5UA 3FSYA 1G4CA 2NR0A 1NDCA 3JSYA 4MK8A 4PL7A 4GVEA 2A10A 1AZSA 3SPYA 1U48A 2H65B 3QBWA 1RAGB 1Q16B 3RMDA 3MTKA 3OUYB 2OEJA 3PDNA 3THXA 3B4MA 1WHVA 3GR1A 5BXIA 3BZCA 4DV6K 2AV5A 2I9SA 4PXEA 4HYKA 1J5EK 4K7QA 3NKYA 4ZJQA 2UVUA 5KG2A 2VQEF 2R7SA 3EZUA 3MX5A 3U3GA 3OFGA 2VWKA 4IDHA 3C6TA 5C0YA 4F26A 2DNMA 4U67L 3VTHA 3QBXA 3CM5A 3OD2A 4KSEB 3AXKA 3UN2A 4K42A 5KFXA 1LWCA 2HGMA 3VETA 4CGIA 4HVJA 3NH1A 2QA4N 1DTQA 3GIMA 3FMWA 2BKOA 1JJ4A 1IJEB 3CHWA 4MO5A 3M9MB 3J7YP 2JRSA 2CPEA 5HLFB 1VSDA 3UDCA 4RBVA 1HNWJ 1U2VA 4PKDB 3AA5X 4LFCK 4ZCIA 4KREA 2PI4A 4BHQA 2HW3A 3JS9A 1JK9B 3FDSA 2BANB 5J2PB 2BKPA 3WXJA 4GKKK 3R3TA 2ZJPQ 2E1CA 4MFBA 1VQ8S 3MWTA 4RNFA 3F73A 3D7EO 3HP9A 2P9KA 2YKQA 3D6MB 1D3WA 3HSGA 1M5SA 4PG6A 4J5OA 2F40A 4RNNA 3NGRA 3IBWA 5A2QO 3U9ZA 1NNEA 1KOHA 2B9EA 2QL9B 4KH6A 2PEBA 2YXLA 2GJ2A 2QFJA 3H20A 1O5JA 2MZRA 2ZBPA 2W6LA 3VEZA 4H0XB 5KFFA 2A42A 2FC0A 4HUFA 3TU5A 2QXFA 4AUKA 3UKUA 4EFHA 3ONQA 3RU0A 3QETA 5KG6A 3UD4P 3VQ9A 3HTVA 5ETQA 4B3MK 1TKTB 3VAMA 3VQ6A 5FLXO 1Z25A 3U1NA 2ZE2B 1O13A 1NSKL 2ROGA 1V3RA 2IYGA 4CEEA 4IOAQ 5KFWA 3KNGA 1NEEA 2BE7D 1NK9A 1VQYA 3EN9A 1IG9A 1FERA 4DG1B 3SUOA 4IUFA 3QLHA 1F2HA 2EFGA 2NREA 3V81A 3NAEA 3CULA 3J80O 2XSFA 1VIXA 3TAPA 5HMYA 4P2FA 3TI0A 1CJVB 1HW9A 3ZZRA 1BY9A 3RZAA 2QV6A 1S1XB 1JLQA 4F0MA 4DTRA 1FRHA 2HNDB 3AY9A 2IC3A 2CFXA 2V2ZA 4NYOA 4FCYA 1TL4A 2QL5B 1ZXOA 4TLQA 3E66A 2DGQA 2VWBA 1SUQA 4MKBA 4KJIA 4RNMA 3D6FB 4JI2F 4EGLA 1I1GA 3ULEB 1BG3A 1DQAA 3PG9A 2A2DA 1RCXB 2YCHA 3TUJC 2ZDOA 2BMBA 5KQ8A 4OIXA 3RB4A 4YMEA 2I5JA 3MN9A 5IS2A 5AQFA 4DV4K 2GHWA 1C0GA 4FPIA 1JLAB 3I31A 4M5JA 4QR0A 4E8UA 2EC2A 5KFCA 2OIHA 5AQXA 1E6VA 1F6TA 2G1DA 4DTPA 4YR2A 1VDHA 2MKJA 1C4AA 3EVOA 3PXGa 1Q7YT 2JWLA 4CW7B 3G25A 2OTJN 3KHRA 2OPQA 1RT1A 3GG4A 3FZ2A 3UN3A 2FXUA 4KHQA 4MT1A 4M42A 3AVFA 1FJGF 3ZSYA 1X0PA 1SC4B 1CC7A 1TMMA 4EAHD 3AJ2A 1C0TA 2UXBF 2BBEA 2DTJA 3MMBA 3BP8A 5L1LA 2Z57B 3VAKA 2CGKA 4USIA 3PW0A 1HBMB 3NEKA 4OYZA 3PX6A 4H8KA 3WQTA 3P4UB 3MM9B 1REVB 4ZLLA 3P1GA 1FFSB 4LR7A 1R3NA 2Q1LA 2HLUA 4FJJA 4DV7F 2W9AA 4C8YA 3CT9A 3SCIE 4DR5J 2GIFA 2J0QD 1HYVA 4G1QB 2GIRA 1Q5YA 2LU2A 3ELHA 3FCVA 4K4WA 1P6TA 3MM6A 5DZ7A 4K41A 1JIHA 3CJTA 4NA2A 1QHAA 1OH6A 3E9OA 4FJIA 3DDNA 3K0SA 3A2FA 1OS5A 5JVGQ 3W9JA 1I94K 1SQEA 4BRMA 3Q7BA 1HHSA 4PKHA 2OPPA 2Y1IA 2HBYB 1V4TA 4QW9A 1S6PB 1OPZA 3AJDA 3MAAB 3LPUA 4LF5J 3G82B 4JYAK 1K0VA 1EO1A 4JI4K 3W8PA 1T05A 2ZFHA 4NZ7A 3BQ2A 1W7AA 2UYTA 3CCSS 2MPUA 2DTUA 3ZNUA 3G71S 5B0DA 4O0JA 3FQKA 4LF9K 4BY9C 2EG1A 4BACA 2D0CA 2R7WA 1N88A 2MJNA 1WC1A 4HTJA 1Q8KA 3X3UA 2OZSA 3AO2A 1HUXA 2XY8A 3RBZA 3KD5E 1NGIA 4ER8A 1PO6A 1RABB 4B9NA 2YX6A 3Q8UA 4GW6A 4JB8B 2E5HA 4ZITA 1K8AO 4BRDA 1BQXA 2HHPA 3VQ5A 4ZLPA 4NXMK 3R2CJ 3V2UC 1VQ8N 5DM7L 3EICA 4CJLA 3POTB 4XH4A 3CJ3A 2AGPA 1U45A 1FXRA 5DRKA 1FESA 3DRSB 1WSRA 1FKOA 3PACA 3ZSOA 1HKCA 4FP9A 3FQLA 2P51A 2V4QA 4ZN3A 4X4VA 3NGYA 4MQ3A 2E66A 4ZPVR 2OEKA 4ATNA 4UZCA 4QR1A 3CMEN 5DG8A 3R7NB 4RW4A 2OTLS 4CO1A 1S4EA 4WTOB 4R79A 1S9GB 3W3SA 5L9NA 4KGKA 2IRUA 2XHCA 2YH0A 4K4TA 1QQNA 1YTYA 4JI7F 2B4JA 1EB0A 1R89A 3ZXWA 5F8MA 3SV4A 4RZRA 1V3ZA 3M3ZA 4OYAA 3CC4S 4WK3A 2AEJA 5GAGI 3PVXA 3JAMU 1Q95G 2AJQA 4UY85 1UCNA 1HNZJ 2F4VK 3THWA 2EX3A 3M2RA 2BKNA 3L6QA 3RRHA 3D2FA 1F9EB 2Z1JA 1KFSA 4IOBA 2EKNA 3ZSRA 5C25B 1LWXA 1ZBUA 1YDLA 2UU9K 2NRTA 1DQ9A 3GWCA 2M70A 2OEMA 1IO2A 2B9XA 1TL3B 2W4CA 4P52A 3H0PA 4ECVA 3UB5A 1RCOB 4Q7AA 4LF6J 2BX6A 4X65J 4DV1F 4KY3A 4F9OA 3M8RA 1D09B 1IBMJ 4KTZA 3LWLA 3Q8YA 1IR0A 1Q8BA 4IKFA 1WELA 4LIRA 2ZHOA 3MURP 1GMVA 3PZPA 1QY7A 4FF1A 1SL0A 3HD1A 3TWHA 3IFRA 3E9LA 2AIRB 4P71A 5THWA 1WSHA 2F9DA 4H5TA 4NMLA 5I4MA 4B3TJ 2ZWOA 4OLPA 1VRUA 1FI4A 4RWXA 2ZH9A 3H1QA 3VQPA 3MEGB 2HWIA 4HHJA 3JYTA 4AD6A 5AQHA 3VVUA 4BR9A 2D3ZA 2V8PA 1FEEA 4FOIA 5L1JA 5FRMA 2HHHJ 4LY7A 4K2XA 4CLWA 1HNIA 2HFNA 3A8EA 2CNKB 1NM2A 5HO4A 4HR2A 2NRXA 4NASA 2RQMA 3I0RA 4E7HA 3AXMA 4F0HA 5E41A 2FLPA 4ZIWA 5LMUJ 1QTNB 2B4VA 4XTTA 4CRJA 1LOTB 5KT7A 3KIOA 2CAJA 5K8PA 3T9NA 1F0XA 2K7JA 4OZJA 1KD1T 2J5AA 2QLJB 3LANA 4EBDA 3MECB 5CE3A 4JRPA 1CLQA 4UW2A 4C0OC 3HHNB 3SNNA 4PQUB 3CDUA 2FB0A 2RDDA 5IXUA 3JTPA 4IKAA 1QJHA 4UUWA 1WNEA 3KD1E 2D41A 4CIEA 3O08A 4BDZA 3HRGA 2RE1A 4URSA 3DXMB 4Z94A 3SFGA 3W63A 2HZAA 1M90T 3HSDA 5HRRA 3VQDA 4NLGA 4CHYA 3SSQA 2VBYA 1JJHA 3HHLD 2UV8G 1JXEA 3KHGA 4FXVA 3CJ5A 4J9LA 2RU3A 3KMQA 2PY5A 4CNYA 2UXCJ 1N34K 2VD3A 1G2EA 4GV3A 4YUDA 3G71N 1WOQA 2HFOA 2V7ZA 3OY9A 1F9FA 1FEHA 4NA1A 4ED7A 2C2MB 2GQQA 3AVLA 3BEXA 2WBMA 3C16B 4I9QA 2OI2A 3RW6A 3L9ZA 5EX3A 1HPMA 3GJRB 2XWXA 1NSAA 1MDUB 2XS7A 3ZEUA 2BVZA 4GKJJ 2ZH6A 2WZ1A 5C2GA 1UL3A 4O44B 2H1YA 4FKXA 1S1WA 1LW2B 2L48A 5AQMA 4Y0WA 5E84A 2P1JA 1GLDG 1CXQA 2COLA 5F3TA 1ZAVA 4IYQA 3KUHA 3KJFB 3NHGA 4NLXA 1TYQA 3SV3A 2ACMA 3OW2M 2PIIA 2HS4A 2VG7A 1NNDA 3Q83A 2XY5A 2OTLN 4OYXA 3AO1A 2BACA 3DXSX 5CYQB 3V1QA 3HHKA 3J7ZO 4WZMA 4DU7A 2E2NA 4WP9A 1R8AA 4LBHA 3VN5A 3CJ7A 4DR1J 1PC5A 2J6UA 2YHXA 1AXQA 2GHVC 3IBCB 2W9CA 4MK9A 3Q0AA 1IKYB 4JEPA 2XMMA 4ZKAA 2OMOA 2VBXA 5L1KA 4CD3A 3VGKA 4ZVTB 4FJHA 3HVRA 4PABA 4KTQA 2A6MA 2F8SA 4UT4A 2YI1A 1HBNA 1RTDB 3QZ8A 1RWPB 2KVQE 4NZ0A 2XZDB 4LJMA 4DDFA 3JSMB 2XNQA 1X9MA 4N47A 1KR4A 1DBDA 2DNOA 3D68A 3NP5A 3FSIA 3R27A 5AXNA 1YF5L 5F0UA 2KJWA 4PRFA 4GRSA 4DV3K 4WYBA 1C1BA 1VC6A 4DV2J 4Z4FA 4J37A 2LEPA 4DQ8A 1YSJA 4DR6J 2CRLA 3H2VE 3UDEA 2UUAF 1VGYA 4ZCKA 3QERA 2XY6A 1ESVA 1VQPN 2XHWA 4UOGA 4IDKB 1N4LA 2IRYA 1S1UA 4TNOA 2FLOA 2O8FB 1N5YB 1OQ3A 3DLRA 4M95A 1HKAA 4CD1A 2Z1HA 3SQGB 4IRCA 4M3XA 2GV9A 2WW4A 4USTA 3DCAA 2RQCA 5K8NA 3DYAA 2M88A 3K7RA 2HYIB 5I3UA 1TKDA 4QPTA 4Y1CA 3OVAA 1CQNA 2BE2A 2WK4A 4M5NA 2F7TA 1FRIA 3AA8A 1RT7A 4M5MA 1WHXA 3W60A 1C0UB 3GILA 3H46O 2Q0RA 3PYFA 3FR0A 4KHNA 4ZPAA 1SC3B 2WSEC 4NZ6A 3TQEA 3KJVA 1FXXA 4B3SJ 4KGVB 1G6BA 3G6VA 2P9LB 4PY5A 1U02A 4DL0C 1B7FA 1T9TA 3GSDA 4YHHJ 2MLZA 2MTLA 3ITHB 1WSVA 4RO0A 1FRLA 2OPRB 4J2EA 1QZ6A 2CWKA 4QWDA 3TANA 1WBBA 4OO1J 1TV6B 3WC2A 3SCKE 4DQRA 3G10A 3SUQA 3SQOP 3TZWA 2FHJA 2ATLA 2CQCA 4WP8A 2AA4A 1XJWB 5LL6Z 1Q82O 4OVLA 3O5TB 1RBVA 4Z4EA 4M3RA 3V1OA 1P27B 5A8KA 4F8RA 1MN7A 4N7TA 1J5OA 2WAQD 3LALA 2CQ0A 3NH0A 3LPTA 3FBBA 1T95A 2F1FA 4Q0BA 3NNCA 1O6XA 3KWGA 4I4BA 2X6SA 2MQ8A 4JUZA 5B0AA 1LEOA 2V8VA 4JI2K 2YBVA 3AVIA 1C1AA 4OX7A 1RWKB 2VC1A 3QSYB 3ZETA 5LOQA 4H4OA 4AILC 3TUPA 2LU1A 2CJBA 4PHTX 1VSIA 2PGCA 3D6HB 3RTVA 4TU8A 4B8AB 2YHWA 3IRXB 2R2RA 2AYGA 1VK0A 3ZTOA 3W61A 1RI7A 2CPZA 1KVIA 1FE0A 2ACYA 3GV8B 3GOIA 2GJIA 3P5JA 3SQ0A 4F4XA 5EY4A 4NCGA 5HSPA 2W2OP 4IBNA 5F9LA 2JL9A 3SAFA 1AROP 4IOXA 4MH8A 3CMAS 2IVPA 2VG6A 4YY3J 1S1VB 2GBZA 3ZZOA 1B92A 4FBUA 2Z2LA 3VAIA 4C0BA 1H6KX 3MEEB 1N54B 2E2QA 4DX7A 1S7HA 4P7VA 3I56N 2E1AA 1N33F 2G0IA 4X64J 3Q89A 3IAS9 4O23A 3H5YA 1K1QA 4JKGB 4HACB 4XK8C 3WDOA 3MR2A 4DLEA 3OYMA 3GJSB 2J9EA 1X31C 2QWLA 4IH6A 3LZJA 1CG2A 1YJUA 3CCES 3ZZYA 3QNWB 4TLRA 3QEXA 2JC1A 2EW9A 4X4PA 5JLHA 4JK7A 4DV7K 4ZMMA 3BO2A 3QNOA 4DFMA 3G6YA 3T6BA 4ZJOA 5GIPA 3MM8B 2HF4A 4R0JA 3MPWA 3C46A 1EP4A 1T9YA 2R8GA 1IBLK 3CTRA 3RR7A 2XQCA 2HBLA 1PKUA 4C8ZA 5BYQA 5HBMB 3IP0A 4DV5J 1JL2A 9RUBA 1ZTTA 4WCEQ 3VCDA 3QO9B 2VA2A 3BDPA 3ID8A 3ETMA 4HVZA 3KJQB 5GAGP 3BR9A 4ECTA 2FGCA 2O8DB 1IKWA 1VSMA 4B1UB 3CXCM 5EN1A 5AQVA 1QAXA 2VDHA 2FJDB 2E4LA 3QQCD 2VZ9A 2C3OA 1FWPA 2G2YA 3IN5A 3I82A 4UQGA 5T7LA 4DX6A 4FN5A 4BLGA 3H4DA 3A0IX 4ZVSB 2PMZD 1X4GA 2VPWB 2AJFE 2CPXA 3BDEA 3B4DA 2FTRA 3I5AA 4DXLA 3R1LA 4G1IA 5BRFA 3NH2A 5KG1A 1MROA 1B99A 4CLZA 4DUYJ 1S5ZA 4LVNP 2AGOA 4OKEA 2VV5A 5CCLA 5LJ3Y 4CJ5A 4A4JA 3C6UA 3I6PA 2RHQB 5H9EJ 1MG7A 3CCLS 4KB7A 1WORA 5A8WA 5F0XA 4DR5F 4I0WA 4RUBA 1FNXH 1VIOA 3DLEA 3P45B 4UY8T 2HHUA 1RP5A 1N36K 4LH4A 3UR0A 4CYUA 3GBTA 2PMWA 1EX4A 4FYVB 2O3DA 1UW9A 4NRUA 3J7A1 3RMBA 4DCOB 2C2NA 3NVMA 3LAMA 2FC9A 4X4NA 2I2YA 2E5LF 2B9WA 3OW2R 5KRTA 3GYNA 2R7XA 5LJWA 4MKVA 2NZ4A 3AO5A 4JI8K 1FJ7A 1GX6A 3PKYA 2E29A 4LF5F 2MJUA 4LF7K 4ECUA 1AZSB 2ZC4A 4NXNK 1JLBA 2G1HA 2V69A 1NJIT 4F4YA 2EK1A 3PHTA 4PCQA 4G9ZA 3T7ZA 4ETZA 2DPNA 3UE5A 3M6UA 2XG8A 3GCXP 3THXB 1Z26A 4ECSA 4C11A 1FDNA 2KRRA 2BXJA 4W5NA 4LF1A 2CXEA 4FLTA 4DV6J 3WXLA 3TO8A 4FWKA 4FVUA 1J5EJ 4IO1A 2ASPA 3C6TB 4M3UA 4IH5A 3NMAA 5BN8A 4OMFG 4B3RK 3UD5A 2DVIA 2MYFA 4AL5A 2I0XA 3TZZA 4CP5A 3CJ2A 1KXPA 5LMNK 1DTQB 4EZ9A 1RISA 1YWXA 3MCSA 2R4FA 5B0BA 1WC4A 2J0XA 2N7YA 4CBUA 2HF3A 2JEGA 4U95A 3WQUA 3BGOP 1BLUA 1U2VB 3MCAB 2DNNA 1OSDA 2HHWA 4CH1A 5KFGA 3CE8A 4RW8B 4DOZA 4PKGA 4LFCJ 5HMZA 1A0OB 4MFBB 3DU6A 4OHYA 2P9KB 3TAMB 4GKKJ 4TQRA 4A8KA 3IGNA 1NO8A 1PYTA 3WC0A 2DH7A 4FJNA 3KDNA 1U1PA 3D9BA 3OXLA 1WBDA 5C10A 1XR7A 4W4MA 1JKHA 3V9SA 1HNZF 3BZKA 5SWMA 2IAJA 4L3QA 2W2MP 1FX2A 5AZJB 1YJ9S 3TTCA 3LW5C 2I7PA 3VQ4A 1DJ0A 4R8UA 5D78A 2DGOA 2DIVA 1HL6A 5DETA 4EU0A 2ZBQA 2FY1A 1H2VZ 5ADZA 2BQ3A 4KQZA 2FSJA 1W26A 3GE1A 2HQFA 2FC8A 3PIOL 1NDLA 4DR7F 1ASUA 3JSRA 4B3MJ 4CIFA 2QLXA 4CJWA 5HQLA 5M1NA 3TZXA 2K3KA 2AX0A 2M2BA 3NG8A 4O3NA 4LF6F 4X65F 3S3MA 3QLHB 3WQPA 1K1SA 3EVMA 1IBMF 2DISA 3CCEN 3W1YC 3VF6A 5CY4A 5KPRA 4R5PB 4NLPA 2EBEA 5KI6A 4H0PA 1DURA 4CFCA 3IKMA 2ZQBA 2YWWA 3NGTA 3EPGA 1RWOB 2AJ4A 4HDHA 5A76A 3S41A 4KBIA 1JLQB 3C0BA 2IRXA 4IZ9A 3H42A 5J2NA 3QMLA 2P9NA 1IUJA 2IC3B 5CYJA 3KLHA 4X4QA 3NGKA 1SUQB 2MHEA 4B3TF 3I9V9 2F9WA 1U6ZA 2WTUA 3L3VA 2EFQA 2VPZB 3VQTA 1XIQA 5K14A 2VPXB 1RHRB 2FBVA 1NK6A 1A7GE 1XTZA 3K57A 1S77D 2JSXA 5HROA 2KYXA 3UW1A 3R5AA 2AEMA 3VGUA 1Q7YO 2I5JB 3DRYA 5J1EA 1YJ7A 3DC2A 2GQ2A 4MO4A 3H6EA 4AYBD 2HMPA 5AFUA 1HBOA 1T11A 3CDEA 4YDXA 3CCQN 2O8EB 4NYFA 4QWCA 1BCMA 4JN4A 4CEQA 1K9MT 1K44A 4DV4J 1T7PA 3AT1B 1RCHA 2EG2A 3NCIA 3UDLA 5LMUF 1NU0A 4AQYF 2BR0A 1OIAA 3MFIA 1OH7A 4JI1F 2G2OA 3JQJA 5BRDA 4KC5A 1X8DA 4ECQA 1EXQA 3V9WA 2OPQB 2PFDA 2E5JA 3BPSP 4CFAA 3F41A 4QYZK 1BWFO 3CJ1A 4KE5A 2K2PA 2WB4A 3C15B 1YHQN 4PG7A 2V7YA 1R8HA 3QGPA 2HS0A 4MTPA 2W01A 3U02A 3EO3A 1Q4RA 3I4PA 1S49A 4BBYA 2EWHA 1RA6A 1OY9A 2VF3A 2V2QA 3HULA 3OFEA 3CW2C 2OFHX 4LSZB 3FFIA 1QAIA 3MPUB 1S72N 5LSRA 1F1BB 1EX8A 2B51A 1RTHA 1HQUB 2KM8B 4FNIA 1S6OA 2HNZA 3RVCA 1AB8A 1CS4A 2AYMA 2OO4A 1B4SA 2X1GA 3I55N 2