4RW6A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 146
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw6A05
2W8LA 1JLBB 4B9SA 3LAKA 3LPUA 3OYGA 1S5JA 2W42A 2YNFB 2RDJA 4QWDA 3DLKA 3NF8A 2RF2A 4RW7A 1S1XA 3AVBA 4FK4A 2IJNA 2O5DA 4H4MB 5KG1A 4KFBB 2X74A 2AJQA 4YQWA 2WOMA 1NKCA 3K5OA 3OYLA 4ZTFA 2QE5A 4ZPAA 5KGXA 1SV5B 4Y2AA 3LP0A 4IRCA 4PWDB 1RT6B 3CFPA 2JEGA 2XGPA 1Z25A 3KD5E 2XI2A 4XPCA 3NMAA 3CO9A 4CEBA 1BI4B 3AO5A 2D7SA 2IJFA 3BSCA 5KG2A 4FW1A 3AVCA 1TL3B 3FRZA 2EC0A 3AO3A 4EZ9A 1S6QA 1RDDA 3LDSA 3PR5B 3T3FA 4CJKA 2W9CA 3H5UA 4W5OA 3CJ0A 3QZ7A 3SPYA 5HP1A 4DF8A 1SUQA 5C42A 5DQHA 3L2WA 4DU3A 3DRRA 1R0AA 1KLMA 3MR5A 4GC6A 4NYFA 4DMNA 4DFKA 4LD0A 4JRQA 3NGIA 3CJ4A 3M8SA 4KE5A 2F96A 3ZSRA 3L2UA 4EBCA 2ZQBA 1S0NA 3QETA 3DLKB 2RF2B 4RW7B 1S1XB 4M3YA 2R2SA 4NZ0A 3DYAA 4ECTA 3CFRA 4Z4CA 4FK0A 2E4LA 4FJXA 1FKOA 4RNFA 1DTTB 1NJXA 4R8UA 5F8NA 4O44B 3RR8A 2ZKUA 3DLGA 3LP0B 3AVMA 4KTZA 3KHHA 1IKVA 4DEZA 2JGUA 3H4BA 1IKWA 1VK0A 2YNGB 4F4XA 4DSIA 4FJ8A 5KG6A 3QNOA 3CIZA 2Y1IA 1JLGA 4H8KA 1S6QB 3PJXA 4CFCA 3PW0A 1JKHA 2W9CB 2OA8A 2J6UA 4C8NA 3ALYA 2HNYB 4ED7A 4OPJA 1SUQB 3U3GA 3DRRB 4WYWA 1R0AB 5KFTA 4MKAA 2WHOA 3SFGA 3KD1E 4KHUA 4EZ6A 4ED8A 1TKDA 2C2EA 2CKWA 2YV0X 3H2LA 3LWLA 4CK1A 4CJFA 1C2PA 4J9NA 3D0PA 5KFDA 3HVTA 3CM6A 5KRSA 3FFIA 1TK8A 3GIKA 4B9UA 2QKBA 1ZBHA 1T7PA 3O3GA 3KMQA 2BRLA 2WONA 4R8UB 2WK4A 2OZSA 5F9NA 3S3OA 3GV8B 4L8RB 3KLGA 1IKVB 3L8BA 5DQGA 1IKWB 4K50A 4CK3A 3LP2B 3QEVA 1MMLA 3L2RA 2WCXA 4WZMA 4OJRA 3I5BA 4K4SA 4FM2A 4MIBA 2VG5A 4K4XA 2Z1HA 2PZSA 4FJMA 4IRDA 3VQEA 1JKHB 2BRKA 3EYZA 4C8LA 3IGNA 3PX6A 1S1WA 4CEOA 3VQ6A 5KFVA 3PUFA 4ZVGA 4I2PA 1DTQA 2R2RA 3V6HA 3ULDA 3PR4A 4AH9A 3O4NA 1JLAA 1QE1A 3IRXA 3CDWA 4ZP8A 2P1JA 2NUBA 1N6QA 3CQ8A 1TV6A 3HVTB 4Q44A 2IGIA 1BL3A 5HBMB 4JV0A 3FFIB 3PX4A 2YNIA 4O4RA 1HNIB 4EBEA 1QQCA 2WONB 3ZT0A 1Q9YA 4ZPDA 3V81A 2C2RA 3OL9A 5KFGA 1C1BB 2GC8A 2GIQA 2QK9A 1UAXA 1QSYA 4DSFA 1BHLA 4DL2A 2VG5B 4MK9A 1TK5A 1ZBIA 3ZSQA 2XI3A 3CJ5A 3PW5A 1UOCA 4ZP6A 4GVMA 1MU2B 3NH1A 1S1WB 2EX3A 2V0NA 1RBSA 4I2PB 1DTQB 3EZ5A 3OJSA 3Q8QB 3GV5B 4JV2A 2R7YA 3MTKA 1ZBUA 4FJLA 4JS5A 3NDKA 4F4WA 4DQRA 4M3ZA 3S9HA 3QIPB 3D45A 2DFEA 3SFUA 1U09A 1JLAB 1QE1B 3IRXB 4FLZA 4B9MA 1N6QB 2D0CA 1TP7A 4AILC 4CHNA 4OL8A 3NAIA 2YNIB 2ASLA 4FVMA 5KFJA 5KT5A 1IKYA 4I7FA 3KNAA 4CESA 2R2TA 4E7LA 1LWCA 1WSHA 1GX5A 4PQUA 4TSXA 2W7OA 1QAJA 3V6DA 4E19A 4DQQA 4FCYA 2PYLA 3T1AA 1J53A 4HKQA 3BSNA 5J2NB 1N48A 1D0EA 3MF5A 4HHTA 4N76A 1VRTB 4URSA 4IFVA 1SL1A 4J9MA 3BR9A 2D41A 4Q5VA 4KHMA 3OJUA 4WFZA 4BACA 2Z1JA 1BISA 4AHCA 1N56A 4FLWA 1YTUA 2ZE2A 3P1GA 1VSLA 2QXFA 4NLOA 2BE2A 2ILZA 2DPJA 1IKYB 4I7FB 4W5TA 5CZ1A 1JL2A 4J9KA 1LWCB 3AO4A 2YKMB 5KG3A 1RT3A 4NLTA 3HT3A 2UVRA 2RKIA 5F8MA 1RT7A 3GIJA 3KJVA 3OS2A 4O4GA 2KFNA 1W25A 4LSLA 4CERA 3P83D 3BQ0A 1VSIA 2WB4A 4M45A 3DLHA 3I0SA 3H08A 3V9WA 4CEAA 3ZCMA 2HNDA 4NCBA 2F8EX 4IFVB 2KW4A 4H4OA 1A5WA 1UA1A 1TGOA 4O3QA 1TAUA 4CEZA 1T03A 4EYIB 3DM2A 3RBEA 4FLVA 4AHUA 4BDZA 2XGQA 2FJXA 4CGJA 2DFHA 2AX0A 2ZE2B 2XCAA 4N41A 4FXDA 3I5CA 4KBIA 1CXUA 3SUQA 2BE2B 3M8RA 4HYKA 2G8KA 3MFIA 5JS1A 2XWYA 3KLHB 3VQ7A 1QUVA 5KFEA 3LWMA 1RT3B 3SI8A 4OKEA 3OSNA 1RA6A 3BJYA 2RKIB 2JLEA 5L1IA 1D9FA 1XR7A 1HYVA 4O4GB 1RDCA 2AGPA 4LSLB 4BE1A 2GUIA 3B6PA 1FK9A 3I0SB 1EX4A 1B9DA 4IKFA 3JYTA 1GOCA 2R2UA 3GV7B 2HNDB 5HRRA 4BWMA 3E51A 1WNEA 2IS3A 3WNHA 3K5NA 2BQRA 4H4OB 1L3VA 1J54A 5JUMA 3PO5A 1BGXT 4KV8A 1T94A 4CF2A 4M42A 2UVWA 5KG7A 3SQ4A 3ZT3A 1RYRA 4FLUA 4E1NA 3HP9A 3DM2B 1SH2A 4E7JA 3V4IB 3KK3A 4NLYA 3BSOA 3RB3A 4K4ZA 4DQSA 2R8KA 1RYSA 3FDSA 3QNNA 3HPGA 5KFKA 1RT5A 2HWIA 4HUFA 4ELVA 4KSEB 2E9TA 3HL8A 3SPZA 1S48A 4JUZA 5DG7A 3LANA 3EPIA 4F2SA 2HHXA 3TR8A 4CIFA 1FK9B 3JYTB 3OSPA 4EYHB 2HHQA 4O0JA 4ECUA 2XY5A 1W9HA 3IS9A 1TL3A 4WE1B 3RRHA 4GMJB 4KV8B 5HRPA 1WSIA 2VA2A 1EETA 3SV4A 4ZHRA 1XWLA 4CJWA 1ZTWA 3KK3B 2VG7A 1QHTA 4KTQA 3NHGA 3M8QB 3HK2A 4U7CA 1NK5A 3L2VA 4Z4HA 4KO0B 1RT2A 4DTXA 4FS2A 3K59A 2UUTA 3N6NA 3SV3A 4WZQA 1RT5B 1U45A 1LAVA 4F2RA 4KPYA 1Z26A 4IBNA 5I42A 3QLHA 1DTTA 2HAIA 3ZSXA 4Y1DA 4O44A 1JLCA 4MK7A 5T14A 3NBPA 1QS4A 5KT3A 4MFBA 4NLDA 5KG0A 3ITHA 3AVAA 2YNGA 2X6NA 3I8DA 3IS9B 3HVRA 1S10A 1HYSA 4CEFA 4TYAA 4ED3A 3QEXA 3CDEA 1WSFA 3RMAA 5KFRA 1EETB 2IAJA 4ZHRB 1SKSA 2HNYA 2DPIA 2VG7B 2FVQA 3BREA 2IA6A 4J9QA 3SJJA 1Q8IA 4RNOA 2JEFA 4FZZA 3NKYA 2OPQA 3O3HA 1RT2B 2ZD1A 5DLFA 3KK1A 5C5JA 1RT4A 3V6KA 1IH7A 2ATLA 4IRKA 1SL0A 3OL7A 1N4LA 2HW3A 3FSIA 4IG3A 5CZ2A 3N6MA 3H5XA 2OZMA 5EWGA 5I42B 3QLHB 3VQDA 4RNNA 2JEJA 3V1RA 2ASJA 3OS0A 4I9LA 1WAFA 4QAGA 3GILA 2PY5A 1JLCB 4Y2CA 1VRUA 2HHTA 1NHVA 1ASVA 3NBPB 1KVAA 3AA5X 2OYQA 4YR2A 5KFIA 4JV1A 4MFBB 3OLAA 3ITHB 3LP2A 1GOAA 1B92A 4O0IA 3M8PA 3B6OA 1HYSB 4NLXA 4KHQA 2IM1A 4DTSA 3N6LA 1VSDA 1X9MA 5KT7A 1RILA 4B9VA 2ITGA 4FJ5A 1JL1A 3AA3A 2IAJB 1FKPA 3O3FA 1T3NA 3ZT2A 4CEDA 3SUPA 3NL0A 3AVHA 3HPHA 3KKRA 2I5JA 3PW4A 4TXSA 1ZTTA 4RW9A 5DLGA 4CK2A 2OPQB 2IC3A 1GOBA 3UR0A 4KREA 4KHSA 4CJLA 4F4KA 2ZD1B 3KK1B 3ZT1A 3TAPA 4FZYA 1RT4B 3DI6A 2OH2A 5KFCA 4M3WA 2IM3A 3NFAA 4IG3B 5HBMA 1NK9A 3ZSYA 1I6JA 4IG0A 1KVBA 1SL2A 3NF7A 1HNIA 4WXWA 5KFFA 1JXLA 4MQ3A 1JLEB 4CHYA 3G0ZA 1VRUB 5CY4A 4K4TA 1C1BA 2O4IA 3I5AA 4Z0UA 4JS4A 2FBVA 1C0TA 3CM5A 3K57A 5KI6A 1NK6A 2ATQA 4E0DA 3M8PB 3TAMB 1VSKA 2IM2A 2FVRA 2D0AA 2UVUA 4WFYA 4DL3A 1RBUA 4FBTA 1FKPB 4B3OA 4FBUA 4QW8A 4B9LA 4J2AA 1MU2A 3QESA 1HMVA 4FLTA 4YR3A 3RB0A 3LPTA 2I5JB 4ED1A 1CSJA 4RW9B 3CWJA 4EO6A 2OPRB 2IC3B 4CF9A 1C0UB 4B9TA 4CF8A 1SH3A 3L3VA 4DF4A 3QIPA 4FS1A 4Y34A 2FVCA 3DI6B 4CFBA 1WAJA 4K8XA 2KTQA 4DTJA 3NAEA 1LAWA 4NCGA 4B9NA 4K4UA 4IG0B 2FC0A 2A1RA 1WNSA 1L3UA 2UVVA 3GIMA 1SH0A 4TYBA 2BR0A 3EPGA 4ECXA 5J1EA 2IDOA 1RDRA 1BQMB 4EEYA 5KFLA 1C0TB 2G8UA 4M3TA 1JIHA 3PV8A 2R8GA 1X9SA 2FBYA 2CJQA 5DG8A 4DS4A 1K1QA 2XY6A 3RMCA 3MR3A 1FXXA 5CYQA 1SKRA 5KGWA 5J2NA 3T5LA 3HXMA 4B3OB 4KAIA 3OHAA 3HVWA 5KT2A 3KIOA 1TAQA 3RAQA 1HMVB 2FLLA 4DQPA 4KTWA 3MECB 3KHGA 3ASMA 5FROA 1VRTA 3HM9A 1XI1A 2IBKA 1ZYQA 1RBTA 3DRPA 3QGHA 4CF0A 5J2QB 4KHYA 4M94A 4Z4GA 1KLNA 5C24A 2AGQA 1UA0A 3OLBA 4HTUA 4NCGB 3DOLA 3OYDA 4LH4A 3OYKA 4QWBA 4CJQA 2XRIA 3V9XA 4WXOA 1A5VA 2E6LA 5L1KA 4FYDA 5DGAA 3HYFA 4FLYA 4I2QB 5J1EB 3K5LA 3C6UA 3DLBA 2C2DA 3AO2A 2YKMA 4M3RA 2ASDA 1VSEA 4QWAA 4IR1A 4ED0A 2XY7A 3NAHA 4FJ7A 2DY4A 3BDPA 4CGFA 1C1CA 2AQ4A 5CYQB 3EY1A 5KFYA 3T5JA 2JC1A 1S9FA 1LW0A 3RB4A 1EKEA 2W9AA 4MKBA 4F50A 3TAFA 4RNMA 3IAYA 4RZRA 3DRPB 5C25B 3SQ2A 2G8IA 2W8KA 5C24B 4CF1A 3HVAA 3VQCA 3PZPA 1TL1A 3DOLB 4NRUA 1N5YB 3GQCA 3AO1A 3S3MA 1IG9A 1I39A 1X9WA 1VSJA 1RT1B 4ZVHA 2O4GA 4GW6A 4DLEA 1YTAA 4TY9A 4IH5A 5FDLB 3KHRA 1YVFA 4KB1A 4LQ3A 3KHLA 1YT3A 2VG6A 3OL8A 2XC9A 3CYMA 3C6UB 3KLHA 4YP3A 1NKEA 4BE2A 3DOKA 3SCXA 3IN5A 3PJWA 3AVLA 4NLRA 4ZP9A 2P5OA 5KFPA 2HHSA 4Y3CA 1RA7A 3OYEA 5DG9A 2F8TA 2HHVA 1BCOA 1C1CB 4NLUA 4KAZA 2V4QA 3NE6A 1D1UA 4M95A 3DLEA 3KLIA 1LW0B 4JLHA 3V9ZA 4HCBA 4OVLA 3BQ1A 1G15A 4FJKA 1NOZA 3A2FA 2BQ3A 4Q43A 3VQPA 1XR5A 2BGGA 4ZPCA 4PUOA 2Z1IA 3LZIA 5DMRA 3AV9A 2J6TA 2VWKA 3G86A 1TKZA 3V4IA 3K2PA 4CECA 1TL1B 4ECQA 3M9MB 3VQBA 1RTHA 3RR7A 4OKJA 1S6PA 1RNHA 3WNEA 2ALZA 3F9KA 2QV6A 2VG6B 3Q8RB 3QEWA 3HHKA 3QO9A 2BQUA 4Q8FA 4E7HA 3DOKB 1LWFA 3QGGA 4KRFA 5KG4A 4C8KA 1WSGA 3ZSWA 4URQU 2AWZA 3KTQA 1IKXA 4DFPA 4NLPA 4CJSA 4YR0A 3DLEB 3KLIB 3MEDA 4E7IA 1KHVA 2B6AB 2Q3SA 2P51A 2C28A 1YVUA 3QIOA 3VQQA 2D3UA 4WE1A 4ICLA 3OS1A 3TVKA 4ZMMA 2B4JA 5HRSA 1EXQA 5EUHA 4PUOB 3KK2A 2XHBA 1Z4UA 1TKZB 4BDYA 1NJZA 4IKAA 5F8JA 3PX0A 4BWJA 4F8RA 1RTHB 4ECSA 3M8QA 5HLFA 1IM4A 1BQNA 3SQ0A 4ED6A 4HVJA 4KO0A 4C8OA 1S6PB 3G6YA 4CJRA 2WTFA 4IR9A 1LWEA 3QO9B 3BGRA 3VQ8A 5JXSA 2FVSA 2FLNA 3WNFA 4OLBA 1LWFB 3DLRA 1U49A 5SZTA 4B08A 4W5QA 4RUCA 1NK8A 5T7BA 4E3SA 1IKXB 1S0MA 4KHNA 4R0EA 1HJRA 3VN5A 4ELUA 2Z1GA 4AHSA 1ITGA 2HB5A 4KHRA 3SNNA 4TQSA 2X6SA 3RTVA 4QWCA 3MEDB 5L9XA 5DQIA 2R8JA 3TI0A 2P5GA 1QSLA 4DSLA 2BANA 2YHBA 4IH6A 3DRSA 4DTOA 4ICLB 5HRNA 1X1PA 3CDUA 3TABA 4ZP7A 4CJ3A 3IGVA 2YHAA 3KK2B 5KT6A 5KFZA 1XC9A 1QSSA 2QKKA 1BCMA 4KKOA 4CJEA 2D0BA 4CHOA 4ED2A 2A1SA 3ISND 5HLFB 1JX4A 3V1QA 1BQNB 1T05A 4CHPA 4J9LA 1LWEB 1NNDA 3DDKA 3BGRB 1C0MA 3QGIA 3RBDA 4NLQA 3LP1A 5EU7A 1S4FA 4O3OA 5KFNA 4O5BA 2DTUA 4DTMA 3TAEA 4E7KA 1SKWA 5F8GA 3NH2A 2XO7A 4NYZA 4J9RA 4DFJA 5J2MB 4B8CA 4WYLA 4CJ5A 5KFBA 3GYNA 1CZ9A 2BANB 4KI4A 5F8IA 3TARA 3DRSB 4HCCA 2UUWA 1RDBA 4FJNA 1WSJA 3BSAA 4DL7A 1UWBA 2V4RA 3NCIA 4YNQA 1ASWA 1HQEA 2ILYA 1LW2A 4ZVEA 4UQGA 2HWHA 4KKOB 4K8ZA 3C94A 4XO0A 2HNZB 3KMSA 4LY7A 1S97A 2R8HA 4Y1CA 1KHWA 2E9ZA 5DGBA 4CJ4A 3MEEA 4RNHA 1T05B 4CJUA 4NRTA 1VSMA 1O1WA 4NLVA 1OS5A 2OPPA 4EBDA 2FBTA 4QCLA 2AX1A 1DLOB 1S1TB 4ECRA 1ZETA 3F73A 3LP1B 2RDIA 4G1QA 3TAQA 4J2DA 2RPIA 3OVNA 3PW7A 4CIGA 2RN2A 4QPXA 3K58A 1JLEA 5SWMA 1Y97A 4FZXC 4QOZB 3KLEA 4Q8EA 2G8FA 3V6JA 3ZSOA 4BDPA 2YNHA 3OYNA 4TY8A 4KB7A 2WOMB 1NK7A 2LSNA 3TAMA 4PY5A 1UWBB 3H40A 1NOYA 3THVA 3HKWA 4AHRA 4CJVA 4Z4IA 1HQEB 3H98A 4M41A 4F3OA 4XPEA 3FQLA 1K1SA 3LP3A 4WFXA 4ECVA 1LW2B 4ZPBA 3LALA 1W0HA 4FJIA 5K14A 5HROA 3VQSA 3RAXA 3OYJA 5F8HA 4DSKA 4DWIA 4EP5A 4ZVFA 3DMJA 2D5RA 1TKXA 4O3NA 4FJHA 4NYNA 2OPRA 3MEEB 1C0UA 5L1LA 1KRPA 4FJGA 3AVFA 2YKNA 1WLJA 2OPPB 4TN2A 4I9QA 5HP1B 1I3AA 4HUEA 3RB6A 2HMIA 5C42B 4G1QB 1KLMB 3UPFA 4NLWA 4C8MA 2VA3A 1BIZA 4Z4EA 3RWUA 4QWEA 4OKKA 3V1OA 3OYCA 3VA0A 2EHGA 3L2QA 4CEQA 4RG8A 2ETJA 4AHTA 3PW2A 3KLEB 1RAJA 3HO1A 4FLXA 5FRNA 1BQMA 2YNHB 2IM0A 4CHQA 3VQ9A 3OYMA 3DYAB 4Q0BA 3V9UA 4TY8B 4W5NA 1RTIA 1FKOB 1D8YA 2KZMA 4R5PA 4RUAA 1D5AA 3VQ5A 3G6XA 3JSMA 3DLGB 4OLAA 3QIDA 1F21A 4H54A 4CGGA 1RTJA 4F4YA 1NHUA 1ASUA 3MFHA 1GX6A 4URGA 2V9WA 1RTDA 4B8AB 1RCHA 5D3GA 2FBXA 3O4QA 2G8HA 3MECA 4RW8A 5KFSA 5KFOA 4CGDA 1J9AA 5K14B 5HROB 5F8LA 3UDLA 3DMJB 1TKXB 5J2QA 1JLGB 4G3IA 3UIQA 2D3ZA 2C22A 4AHVA 2YKNB 1NJYA 1B9FA 3C6TA 2HMIB 2FJWA 3CVKA 5KFMA 3KKSA 2B43A 3MXMA 4DL5A 1VSHA 2W9BA 2KZZA 1ZBLA 4E89A 4N47A 3HPOA 4FJ9A 4N56A 3ICLA 4I2QA 2GV9A 4CHZA 1KSPA 4J2EA 3D28A 4KB0A 4N5SA 4RU9A 4FM1A 4Q0BB 3CJ3A 1NJWA 3OYIA 3MR6A 3WNGA 1S9GA 1RTIB 4ECZA 5KT4A 4R5PB 2XY8A 4NLSA 1HNVA 3JSMB 1S0OA 4E1MA 1JLQA 3KLGB 1RTJB 3SYZA 1JXEA 5DK5A 1RTDB 2G8VA 5D3GB 1NKBA 4RW8B 4RW6A 4IDKA 1HPZA 5C25A 3SZ2A 1K6YA 3BQ2A 1S49A 3H4DA 3MR2A 3D5MA 3TWHA 4DU1A 1WN7A 1JLFA 3MXIA 3QZ8A 3HSTB 3C6TB 1N5YA 2HVHA 1XHXA 1TVRA 2Y1JA 4DL4A 4CFAA 4J9SA 4DLGA 1RT1A 2W9BB 4DS5A 1REVA 4QW9A 1C1AA 5EWEA 4ID5A 5FDLA 4O3SA 3PO4A 4CIEA 4Z4FA 3NF9A 3VQAA 2I1RA 4DTUA 3Q8SB 4FK2A 1TV6B 3AVJA 4YMEA 4X2BA 1KFSA 4J9OA 1WSEA 5F9LA 1S9GB 1TQLA 4TQRA 2DFFA 3NGZA 3OYBA 3G10A 1T8EA 1J5OA 4DTPA 1HNVB 2E6MA 4NCAA 4M3XA 3V81B 3OHBA 1JLQB 1C6VA 1RBVA 4BE0A 3AVKA 1L3SA 1D9DA 3KLFA 4FW2A 2W7PA 3CJ2A 3SQ1A 4RW6B 4KI6A 3OYAA 3H59A 3PVXA 2JEIA 4IDKB 1HPZB 1XR6A 1TKTA 4IOBA 3E01A 1CXQA 1ZBFA 4DSJA 4EP4A 2B5JA 2OPSA 3OYHA 3MEGA 1JLFB 5E41A 3U6FA 2FJVA 3AVNA 4DTNA 1TVRB 5CYMA 4OGCA 4O55A 1JXBA 4TLRA 1REVB 4ID5B 5KG5A 2PYJA 5KRTA 4DL6A 4DU4A 2FVPA 3P5JA 4CJPA 4O3RA 1L5UA 4EO8A 3OY9A 1KVCA 3KLVA 4YFUA 4Q45A 1S1VA 4MK8A 2E9RX 3H5SA 1Q9XA 2X78A 4IQXA 5KFQA 1J5OB 5J2PA 4LSNA 2IMWP 2GBZA 3OYFA 3KOAA 3QEIA 3PY8A 4HUGA 1NK0A 4CGIA 3QEPA 1XHZA 3KLFB 1S9EA 2B6AA 4PQUB 4OGEA 4PA1A 1CZBA 2KFZA 3V6DB 4J9PA 4ECWA 1TKTB 3ZSZA 3RRGA 3AA2A 4U6PA 3E01B 3S3NA 4GC7A 2KQ2A 3RMBA 4ZTJA 4IH7A 4F4ZA 3PHEA 2B5JB 2OPSB 3M9OB 5JS2A 3MEGB 2AU0A 4ECYA 5KFAA 4CCHA 4XIUA 4DSEA 4FJJA 3L3UA 5L1JA 3AVIA 3HJFA 3LAMA 5CYMB 4KHWA 3Q8PB 3TAGA 2IOCA 5KFXA 3K5MA 1IO2A 4CJTA 4RW4A 4K4VA 1QTMA 4IFYA 4MH8A 3NF6A 4K4YA 3EZUA 3SUOA 2HHWA 2G8WA 3M9NB 3C95A 1S1VB 3NGYA 3VQ4A 1U48A 3IG1A 1HQUA 1VSFA 5J2PB 4LSNB 3AVGA 1U04A 4NLGA 1TK0A 4W5RA 2FLPA 1EP4A 2J6SA 3I0RA 1S9EB 3NGDA 5FRMA 1S1UA 1RT7B 3KJVB 3U3YA 5I3UA 5KFHA 2GIRA 5EDWA 2HHUA 5KFUA 5EWFA 3H5YA 1QAIA 3NH0A 1LV5A 4MIAA 3MXJA 3LZJA 4JRPA 1RDAA 3GIIA 4CE9A 4CFDA 4K4WA 4DG1A 4F3TA 4RW4B 1T03B 3AA4A 3T5HA 3ZT4A 3ZSVA 4IFYB 1KFDA 3OL6A 4DQIA 1JLBA 4CEEA 1KCFA 4ELTA 1RBRA 2YNFA 3V9SA 3SUNA 1U4BA 3IG1B 2XCPA 1U47A 1HARA 1HQUB 3QINA 1KTQA 5J2MA 4J2BA 3QERA 4DFMA 2R8IA 4LH5A 3QYYA 1L3TA 1EP4B 4O3PA 3I0RB 4H4MA 4KFBA 2WRMA 3T5KA 1HYZA 1S1UB 2VWJA 4CGHA 3UQSA 1NK4A 2AGOA 1SV5A 5I3UB 5KFWA 2F8SA 1CLQA 3HP6A 4PWDA 1RT6A 5KTQA 1BIUA 3VA3A 3TANA 1A5XA 2HVIA 2BDPA 4LQ9A 1BI4A 3FQKA 4ID1A 3MAQA 2HNZA 4DTRA 3T19A 2JC0A 1HRHA 4DG1B 3CG7A 3SI6A 3G6VA 3RMDA 3ISNC 4M3UA 1DLOA 1S1TA 4OPKA 3CFOA 4FM0A 3TQ1A
chains in the Genus database with same CATH superfamily
2HEKA 1KC8O 1S5JA 3T7ZA 2W42A 5AQNA 2AYBA 4QWDA 4PAAA 3NF8A 4RW7A 3CCJS 1NCLA 3NCPA 4MJKA 3SIPB 3D1OA 3AVBA 4FK4A 4JV5F 3AAQA 4N8OA 4YQWA 1UPMB 4G1IA 5IZHA 3NNHA 2MJNA 4USJC 3OYLA 3AXKA 4Y2AA 3LP0A 4IRCA 2V69A 4PWDB 1TU0B 1RT6B 1TUGB 3KD5E 4WFNQ 2FHJD 1IBLJ 4L3KA 2W4CA 3BSCA 4O8KA 1TL3B 2FZKB 2EC0A 3AO3A 2QZ8A 2NQPA 5AJ3J 3I9ZA 3LDSA 3PR5B 4PRFA 4CJKA 3H5UA 5AQXA 3CJ0A 3QZ7A 4DF8A 2C3UA 5FD1A 1SUQA 4BC3A 3L09A 2B3TB 5DQHA 1KLMA 3A3PB 2NSBA 5ETOA 4DFKA 1RAOA 3CJ4A 3M8SA 2R7SA 3O08A 5IWAF 3UO0A 3ZSRA 1OVYA 3DLKB 1K47A 2E5HA 4KRWA 1TMJA 2R2SA 1NSAA 3MMAB 4DR6K 4MO4A 4DR4J 4ECTA 2H65B 2GHPA 2MKJA 1TTHB 4EFAC 4P10A 4RNFA 3VTIA 3C2PA 2HOEA 1HI1A 4LREA 4DPOA 3DLGA 3D2EB 5ETQA 1N52B 2JGUA 4B3TK 1VK0A 4JI7F 3EZOA 1KDNA 5BRFA 1S79A 1Y0HA 2UU9K 1HNWJ 1YWXA 1HNZF 5E3PA 2K2PA 3CCRS 3TA0A 1S6QB 2VQEJ 2HBJA 2Q6CA 2W9CB 2XNRA 1XERA 1VDHA 2MHNA 2J6UA 1YLXA 1HWKA 4DR1J 1K0VA 2GQCA 1EHWA 5BN9A 4CTAB 1R0AB 4YB6A 2W41A 4WFAQ 4I6AA 4F0MA 1UEKA 3VMFB 2C2EA 5C10A 3FZLA 3HULA 1Z05A 4CK1A 1G7CB 3EKUA 4J9NA 3FRYA 3KJNB 2QKBA 3O3GA 3M32B 3ETOA 1JJ4A 4R8UB 3CD6N 3IXQA 4IEIA 3KLGA 1IKVB 5DQGA 3VGMA 4KH4A 4KH5A 1KD1O 1C0GA 4WKRA 4DUYJ 2JHEA 4PG4A 4JI8J 3ZYYX 2VFTA 4K4SA 4FM2A 3GG4A 4MIBA 4IRDA 1GTHA 1JKHB 4FYYB 2OGUA 3PX6A 3VQ6A 2MLYA 3PUFA 2P9KB 4DPYA 2FDNA 1RFQA 4QIWD 1LKZA 2CJBA 5F1XA 2FZCB 1UVMA 3CDWA 2YY3A 2P1JA 1NNEA 1W7WA 3MM8A 4OYMA 3CQ8A 3HVTB 4Q44A 5HBMB 4JV0A 2MZJA 3PX4A 2A40A 2E1ZA 2DNGA 1QQCA 3JAMY 4OJ3A 2MZ1A 3OL9A 2GIQA 2P9LA 2UXBJ 4DR7J 4DSFA 3IBCB 3SBTA 2K8GA 4WF9L 1O6XA 4RBVA 2FXUA 2XI3A 2P9NB 1UOCA 2NRXA 2XBPA 2BTFA 1JQGA 3ET6A 2B8PA 3RUBL 4CH7A 1S1WB 1VBYA 1SQGA 2QA1A 1UEUA 1DTQB 3Q8QB 3TR5A 4J37A 2QJ3A 4UTGA 2GCFA 4F4WA 4DQRA 3NDKA 3S9HA 3VAGA 2DFEA 1H2TZ 4K0KK 2J76E 1U09A 1JLAB 1J5EK 3CI5A 4B9MA 4AILC 1OH6A 4JYAJ 4CHNA 3I56S 1R43A 4KHPF 4PZVA 4DV6J 2ZOGA 4CLYA 4DHYA 1ZC6A 2AKWB 5C15A 4I7FA 1EQ0A 3P4UB 1YAGA 4E7LA 3EM1A 1WSHA 1ZBSA 4BRGA 2W7OA 5AE2A 2AW0A 3ZTRA 1SC6A 2PA3A 2Y1LB 2GELA 3BKUA 2DR7A 4HKQA 4BVPA 2X7IA 4BR0A 4AT1B 3RYLA 3QT6A 1N48A 2W25A 3FGVA 4HHTA 4N76A 1VRTB 1T44A 1S72S 4J9MA 2R7QA 1O13A 3TSPA 1FJGJ 4NO7A 2E2PA 4KHMA 3OJUA 4OMFG 2ASMA 2Z1JA 1BMQB 2M5YA 4AHCA 3CMAS 1N56A 3MD1A 3CSKA 3ZTOA 3KXDA 1F9FA 3CPWR 1YTUA 5LM7E 2BE2A 1IBLF 3GSDA 1IKYB 1X5SA 4K7QA 5T7LA 2OUGA 4RUHA 3AO4A 1VIOA 2CNNB 5KG3A 5AJ3F 2VU5A 1Q53A 3C14B 2QMXA 4JKFA 4CERA 2OD6A 3W9HA 3DLHA 3K0SA 2RH3A 4ZVOB 3H08A 2HNDA 4CZLA 1WC3A 4HI2A 4BRFA 1SJRA 3FZBA 1TGOA 3QAEA 4DR4F 2HBRB 4O3QA 2BUPA 4HH0A 4OHWA 1T03A 3CJSA 1I1GA 2MZTA 4OLOA 3DM2A 4CO4A 4AF1A 2XGQA 3U9ZA 2C3PA 4K2XA 3VWSA 2LXIA 4FXDA 4LIRA 1WACA 3M8RA 4FYWB 2DNMA 3J7AN 1HNWF 3MFIA 5JS1A 3KLHB 1QUVA 2PFFB 2HHPA 3DRYA 3ILLA 2DEIA 2VQEF 5L1IA 4YHHJ 3TYTA 1HYVA 4DR1F 1U24A 1RDCA 3ADAC 3SDEB 5M1FA 1UFLA 3D54A 2BE9B 3DXMB 1FRHA 2ASYA 1M90T 4BWMA 2IS3A 2CQGA 3K5NA 2BQRA 4JHDB 1LFWA 1J54A 5JUMA 4RLEA 4LRFA 4CF2A 5AQVA 2UVWA 3VHQA 2JWNA 2LDYA 1N5SA 2XULA 4C7QA 3CJ7A 1SH2A 1QDUB 4JOUA 3LM9A 1V9OA 5LY3A 4NLYA 4E1JA 3BSOA 4DQSA 2AEMA 1AB8A 3FJ2A 2QWOA 2R8KA 1MN9A 3HX9A 4DUYF 4JI8F 4DV1K 5ETSA 2UYTA 2Q97A 1UETA 1JB0C 5E3CA 4HACB 4X4UA 1TFWA 1RT5A 4NXNJ 5ADZA 4HUFA 4ELVA 4UOHA 3HDSA 3M1VB 3EUNA 3HL8A 4JUZA 3PTWA 4U96A 3U1MA 3RU0A 1IM6A 3JYTB 1QTNB 2Q79A 1RHJB 3OSPA 4V19J 2AF6A 3GFXA 3KVGA 3W2VA 2FY1A 3KZBA 1W9HA 1WORA 2LDIA 5EVZA 1WSIA 3THYB 4E2FB 3UN5A 2UUAK 2G1HA 4CJWA 1ZTWA 3KK3B 5K8NA 4LRBA 4WP9A 1VQLN 3DGPA 4X4PA 3M8QB 4MAKA 4P74A 3L2VA 1WOPA 2UXBF 1RT2A 1U25A 4DR7F 1B99A 1VHXA 3K59A 1MWZA 5A2QY 5M1QA 2CQHA 2N4CA 2OJ3A 4I68A 2HGMA 1E6YA 3UFCX 1DZ5A 1LAVA 5I42A 2HAIA 5AQMA 4Y1DA 4O44A 4LF2A 4YOUA 4MK7A 2OO4A 3NBPA 5KT3A 4DCPB 3SCJE 1HL6A 4NLDA 5F2RA 3AVAA 1BD6A 2HPUA 4HWIA 3HFZB 3AA9A 3UCUP 1HKBA 4JYAF 4LFAK 2QI2A 3RMAA 4C1NI 2IAJA 3TP2A 5B8HA 4DV6F 4FDFA 2FYXA 3HOTA 2VJVA 3C65A 5AQRA 3T1HJ 3PLAA 3U02A 3CQXA 1OWXA 2NCKL 1Q8IA 2XG8A 1YJRA 3FZ2A 3KG1A 1GH8A 3PIPQ 3CD6S 1N54B 4ZA1A 3H3OB 1Z1ZA 2GVDA 4A46A 5DZ6A 2QO3A 1FRIA 2HQGA 3IP0A 1N88A 3C46A 3B8HA 3QLHB 2XZWA 1XUPO 3V1RA 5BXIA 4I9LA 3CJCA 3GILA 2PY5A 1U1RA 1VRUA 5A8RB 2N3OA 1ASVA 3AA5X 4JV1A 1FJGF 2PE8A 1EZZB 3QRQA 5GAHI 2DITA 5BPNA 1LFPA 5MLCV 1HYSB 3J81U 3KUEA 4NLXA 4KHQA 1BOTO 4NEZA 3N6LA 1WEYA 3D2WA 2G4BA 2HGLA 1KKHA 3AA3A 1AFIA 3P4IA 5MLCQ 3O3FA 3MMBA 3D66A 1NSPA 4NXMK 3IRWP 4CEDA 2L9WA 3KKRA 4FF1A 3FZMA 2HLTA 4X64J 3J7A1 3THXB 1X3MA 2H54B 1GAOA 4CH1A 2J5AA 2ZD1B 2KJWA 2YWGA 3TAPA 2OH2A 5KFCA 4M3WA 1RU1A 2IM3A 2W4PA 3NFAA 4IG3B 1NK9A 4CYUA 2C2NA 3HD2A 4KGZB 2VWBA 5JJBA 1KVBA 5AQIA 4UQTA 4H5NA 2P9CA 5CCMA 1GFWB 3AD9C 4MQ3A 3V4MA 4CHYA 5HVHA 2KHOA 2FB0A 5CY4A 2NR0A 2E1PA 4ATNA 4Z0UA 2BJ1A 1C0TA 3G8QA 2XMUA 5KI6A 2OKQA 1VSKA 2FVRA 4PYAA 1PSDA 4DL3A 3H7HB 2MHEA 2GMJA 4NLCA 4B3OA 4FBUA 1KP6A 5G0RB 2VBZA 3R2DJ 3VZHA 4YR3A 2KXNB 4ED1A 1IN0A 3M2VB 3THWB 2OPRB 2IC3B 5IT9U 3WIUA 4CF8A 3TUJC 2YKOA 4USIA 3QIPA 1S3XA 4Y34A 3JTOA 4CFBA 4YHHF 2KTQA 5IXUA 4DTJA 1LCUA 1HHQA 2NXJA 4IG0B 4C2MA 2FC0A 1Y64A 2A1RA 1WNSA 4OX9K 1F3FA 3EVWA 1DKGD 3TOQA 3GLJA 5J1EA 4LMZA 1HHTP 2QMWA 2YHWA 5KPZA 4K41A 4EEYA 1IR1A 1JIHA 4E8UA 1TL7A 3WT0A 4IQMA 2FBYA 1WI6A 3PACA 1ESVA 3P38A 5EX5A 1XN9A 3HVWA 2OEJA 1HMVB 4DQPA 3ASMA 5FROA 2ZOFA 2QMUB 3DRPA 2MQMA 4CF0A 4HL9A 5DM7L 4Z4GA 1RCOB 3J80O 4NXNF 3MX2A 5C24A 3QAUA 1UA0A 3OYDA 1IBMJ 4WXOA 2I6WA 2E6LA 5L1KA 5GADP 2FPHX 4DV0F 4FLYA 4I2QB 3K5LA 3CJBA 1U7LA 2C2DA 1SS6A 3T69A 4P73A 3FC9A 4QWAA 1UP1A 3O5TB 3TTFA 4PXBA 2QGFB 2XSJA 2PC6A 4M5NA 1CQNA 2AQ4A 3EY1A 3MCPA 3WUHA 4IOCL 4PABA 3RB4A 3H90A 3SCIE 1EKEA 2QTDA 2WBRA 3N0VA 3TAFA 4NLBA 2CJKA 1ATNA 1REGX 2YH1A 5C25B 3K2YA 4FNIA 4P2MA 4CF1A 3HVAA 2XMTA 1V4SA 3DOLB 1IG9A 3GQCA 3MM5B 3AO1A 4L72B 1I39A 1TMMA 1RT1B 2O4GA 5ELZA 4DLEA 1S7HA 2KRRA 2Z2YB 1U1LA 4KB1A 4LQ3A 1F5AA 1YT3A 2XO6A 4KIAA 3BBFA 4C0BA 3VPZA 2MSTA 1N32K 4WQ4C 4EK2A 3THTA 3GTYX 3FMBA 3IN5A 2ZZMA 4R25A 4NLRA 4ZP9A 2P5OA 1XQIA 3T1HF 1TELA 5CHCB 1BCOA 3ZEUA 1C1CB 3VAKA 2V4QA 2QC3A 1T9WA 3CD0A 4M95A 4OZ3A 3KLIA 4A59A 1LW0B 3PHTA 4JLHA 1GXLA 2EBEA 4I6WA 3V9ZA 4CLUA 2E1AA 1PJ6A 5CCLA 3KWGA 1Q8LA 1BWEA 5DMRA 4F4AA 2J6TA 3ILOA 1TKZA 3V4IA 2ZFHA 3OVSA 3UN2A 3C7NA 2KM8B 4PG5A 2L9DA 2GX9A 3GR1A 1HBOA 3R7SB 3KNGA 3Q8UA 3WNEA 2E1CA 3K5PA 3Q8RB 4ZPTR 1HWIA 4O0NA 3DOKB 3DHWC 2VC1A 4GV6A 4ISFA 1Q81T 2O8DA 5BYQA 4V19X 4EHTA 1FRJA 2MSSA 4DFPA 4X64F 1NUEA 3DLEB 2J0XA 1KHVA 3M2UA 4H0YB 1JJ2M 3G8TA 1VQLS 2W2OP 3CC2N 1HBMA 3OS1A 2FZGB 4PUOB 1W97L 4BR2A 1NG9A 2BKPA 2GZOA 3UVJA 3NRBA 1LWXA 1F9HA 2F63A 1XTZA 4OJGA 1RTHB 4F8RA 1SQFA 2I38A 1RSCA 1BQNA 2RS2A 4FN5A 3Q2SC 2WTFA 4IR9A 3WBZA 3QO9B 4A8OA 5JXSA 1NGAA 1LWFB 3H45C 4DPXA 5SZTA 5L9NA 4M5GA 3J7YI 1NK8A 4KBOA 1IKXB 4KHNA 2Z1GA 4KHRA 1I5OB 3EVOA 2X6SA 2GVZA 2HFNA 2F5GA 3A13A 3ENQA 1SI9A 2VASA 1QSLA 4DSLA 1RK8A 3AY9A 3DRSA 4JKEA 4K25A 3O6QA 4YOTA 1RHKB 2FJEB 3TABA 4C11B 1B0PA 1H73A 3KK2B 2NNWA 1P9QC 1XC9A 1WUAA 2DY9A 2HZAA 4KKOA 4GVLA 2LQ8A 3CD5A 2R7RA 3K8WA 2ZJRQ 4ED2A 3SSRA 3MM7A 1X4AA 1JX4A 3HF5A 2Q31A 3IR7B 2IVNA 2JDJA 1VQ5N 1LWEB 4TU8A 3C3LA 1SQEA 2IVMA 4NLQA 3E2EA 2YWKA 3LP1A 2J9CA 2KKZA 1R6YA 4O5BA 1PCAA 2XZTB 4G1PA 4DTMA 1PBUA 4TVAB 1FJ7A 1VQNN 4CJ5A 3KWMA 5K8OA 3DLLQ 1FWKA 1X4EA 4B17A 3G82B 2LQ5A 4HTLA 1Q7YT 5LSRA 1WG4A 2UUWA 3BSAA 2AHOB 1CC8A 1IBMF 3O8WA 3M05A 4ZVEA 4DHVA 1RUSA 3C15A 2ZH1A 3NS5A 2R8HA 2XS2A 4Y1CA 1KHWA 5DGBA 1KQSR 1IG8A 1T05B 1CEZA 4CJUA 1GMUA 4NLVA 2YJFA 4EHUA 3Q83A 3MDFA 4GV3A 1DLOB 4ECRA 4F04B 3F73A 2HBKA 5EOYA 4G1QA 3BKTA 4JI6J 1E3MA 2RN2A 4A5BA 4H0TB 1U2CA 5SWMA 3VVTA 2HQCA 2K7JA 2G8FA 2VFVA 2E7VA 1NGIA 3ZSOA 4BDPA 2YNHA 3OYNA 2OSQA 3WHIA 3MM9A 1FWLA 4KB7A 1RWKB 1NK7A 1Y4ZB 5L38A 4X4TA 3LM2A 1HQEB 3TPQA 4A8MP 4BG9A 4XPEA 3FQLA 2J4RA 2UUBK 4ECVA 3D3CJ 1LW2B 4WCEQ 5AXLA 1HBNA 2MPUA 4PXEA 1U1QA 4W4MA 3OYJA 4FJHA 1TKXA 4O3NA 2GTDA 4NYNA 5B09A 4J91A 5L1LA 4FJGA 3VGVA 2YKNA 2WSCC 3H42A 5HP1B 1I3AA 2W7AA 6FDRA 1HNXK 1XNRK 4C8YA 4ID8A 5GAEI 2VA3A 1BIZA 2V52B 3RWUA 4Z4EA 2VBYA 1M1KT 3V1OA 3OYCA 1JNRB 3VA0A 2EHGA 2N82B 4H5RA 4XTTA 3VQ9A 3DYAB 2XZDB 3V9UA 2HFVA 5FPMA 1RTIA 3QBXA 2X1BA 2N4DA 1HKAA 3HHEA 2VDIA 4RUAA 2K1RA 3JSMA 1PJ5A 2KT3A 3K8VA 4C3KA 4UZBA 3IA0A 4H54A 3I55N 3CCLN 4DJBA 1RTJA 4F4YA 3MFHA 3CT9A 4B8AB 2A0FB 5JVHQ 1XIQA 4RW8A 2H5IB 1T6DA 4OZ0A 1YK9A 1G3OA 2MTLA 3UIQA 1MN7A 4AHVA 2YX6A 1B9FA 3KUGA 2EG2A 2J0SD 3ENHA 3CVKA 2CIMA 4DL5A 2KZZA 2F4VK 3FBEA 4N47A 2R4FA 4A57A 2GV9A 3POTA 4CHZA 1VAZA 1Y3JA 4N5SA 3AJ1A 5IQ6A 3MR6A 2F8MA 4ECZA 4CH0S 5KT4A 3NWRA 1H72C 1GT8A 3ZX2A 4AL6A 1JLQA 2FUG9 4UUWA 1S57A 1PO6A 1NKBA 4IDKA 3EX7B 2KU7A 2ZBQA 2XHWA 4QR1A 1JJHA 1RAEB 4NPOA 1HX1A 3TWHA 3C6AA 3MN9A 5D0HA 4OZ5A 3C6TB 1N5YA 2HVHA 1XHXA 1FJCA 4DLGA 4DL4A 2W9BB 4DS5A 1C1AA 3PO4A 4DUTA 1K73T 3CUNA 2I1RA 4DTUA 1TV6B 4YMEA 2B9YA 1KFSA 2GUPA 4J9OA 5KPTA 2XS5A 4TQRA 3OYBA 5J1PA 3G10A 5AFUA 4DTPA 1HNVB 4NCAA 2E6MA 2KRBA 3V81B 1RBVA 5K8MA 3RAMA 5EY4A 1D9DA 3VEVA 4OYOA 3CJ2A 2W7PA 4RW6B 4C8ZA 3IMXA 1GXTA 4KI6A 3OYAA 3H59A 4GVBB 2ZNYA 2VQFK 1HPZB 1Z2ZA 3E01A 1FW6A 5AQSA 4DSJA 4EP4A 2CUYA 4HT7A 2FGCA 2W2QP 4DTNA 2PDAA 3R6LB 4PL8A 4OGCA 4O55A 3G6EN 1JXBA 1REVB 1NSQA 1G2EA 1E6VB 3VR1A 4GVEA 4DL6A 1URRA 1VOMA 4BRKA 5A8WA 1S1VA 2IJRA 2E9RX 3H5SA 2X78A 3L4QA 2RDDA 4OJHA 2A10A 3QGPA 3CC2S 2GBZA 3S1TA 4B3MJ 4HUGA 3R1XA 3EMTA 4CGIA 1XHZA 3KLFB 3IFRA 1CULB 2IVPA 5E26A 3D67A 4PQUB 2HZCA 2M0GB 4CBWA 1CZBA 4FOIA 4C4WA 4U6PA 1MROA 2R3VA 2KQ2A 1W2IA 4IH7A 2CJ9A 4F4ZA 4JI6F 2B5JB 3M8WA 1CJVB 4ECYA 4YB5A 2QWNA 3S7RA 3L3UA 3EXCX 3EXYA 1FCAA 4ZN3A 2JL9A 2DNYA 4LSZB 1KNZA 3Q8PB 2FF6A 2CPYA 3NGSA 2MZSA 1N33K 4CJTA 3HZEA 3J7ZT 4RW4A 1QTMA 5D4NA 3BN7A 3M8YA 4MH8A 3UKUA 3QWUA 4K4YA 2DD8S 2VHGA 3G96A 3NGYA 4B9QA 2EFVA 5RUBA 1V5IB 2MQPA 4CI0B 5J2PB 4B3SK 4JNEA 2QTWA 2CJXB 3AVGA 1ROFA 4NLGA 1TK0A 4W5RA 3ULEB 1S1UA 2FIUA 3KJVB 3RJMB 3HHLC 4I6YA 2ZOMA 5EDWA 3L4BC 1P8ZA 2OMLA 1VQ5S 3HHLA 4YOWA 3TNVA 2EK6A 3MXJA 4FF3A 1RDAA 3GIIA 2Q2RA 4CFDA 3ZZZA 3AOBA 2V4JB 3TSQA 1FKAF 3AOAA 2CPFA 4F3TA 3VALA 4KY3A 2VCPA 2Y8WA 1S4EA 3ZT4A 3JXUA 3JXOA 1VQNS 1KFDA 2MQNA 3OL6A 5AQLA 4CEEA 2DGSA 3W64A 4DCJB 4ELTA 2YNFA 2V8GA 4PPDA 3IG1B 1HARA 3C8YA 3BP8A 3KHYA 4J2BA 2D9OA 3EDRB 4DFMA 4AFFA 1UAWA 2NPFA 1RWUA 4W90B 1L3TA 2AJ0A 3CPEA 3I0RB 2BJ3A 4ILMA 1Y5NB 3L95X 3BS9A 5I3UB 5KFWA 1HWUA 1BIUA 3VA3A 1FX2A 2O8CA 1BI4A 3TW0A 3R8EA 2HNZA 1DURA 4ISGA 2HK3A 3TU5A 3OR1A 3FBBA 3TTCA 5L46A 1U8SA 1FD8A 2RDJA 1YJ9N 1FJEB 1HKGA 5A8KB 2RF2A 2R7VA 1S1XA 4QR2A 1R7IA 5LMNK 3BEGB 1UVJA 5KG1A 4KFBB 1VS3A 3CCTA 3K5OA 5ETRA 4I64A 1VJQA 2QE5A 3UW1A 4M8LA 2CQCA 3AGRA 4BC2A 2IRXA 3QQCD 2QL5B 2VD3A 3CFPA 3AJ2A 4J9VA 3G87A 4XPCA 2AP1A 2F4VF 4U8YA 1TUYA 2MEWA 2D7SA 1WF1A 5FLXU 1JJCB 4FYVB 1U0HA 1H0HB 4TNOA 4AD6A 2XWXA 2GAHC 2QEXN 5C42A 3GYXB 3DRRA 4NYFA 2MLZA 2JJ4D 4LD0A 1H38A 3NGIA 3MAAA 2Q1NA 2F96A 2KN4A 2V8HA 1S0NA 2V2VA 4WYBA 4RW7B 2ZEJA 4LBHA 2G2OA 4DDFA 3CCLS 3CFRA 2DNZA 3CO0P 4Y0WA 2E4LA 4BRQA 4FJXA 2WAQD 1WHWA 3MK6A 4OYBA 1NJXA 2O8BA 5HANA 5F8NA 2GEMA 3GFZA 2ZKUA 3LP0B 4X4OA 3KHHA 2F7VA 5ETVA 4DEZA 3CPWM 2F8HA 3MUVP 4YDDB 1KAXA 3WZ0A 1ZPVA 2V2ZA 2P9UB 2CA9A 3OFFA 4FJ8A 4CLPA 4LFBF 4MKVA 4YOYA 1JLGA 4CFCA 2Q36A 2OA8A 2D69A 2HNYB 2LA6A 4ED7A 1SUQB 4QYZJ 2JLGA 4M5DA 3RW6A 4FWNA 3U3GA 4WYWA 4MKAA 2F4FA 3GJQB 4B3MF 5BR8J 4EZ6A 3QDKA 3LWLA 4LF5K 1OSCA 1MMNA 1C2PA 2AJFE 5F3TA 1XMQK 1OH7A 3Q7BA 2DH8A 3UCGA 2IY5B 3PYDA 1H98A 3FFIA 3F56A 3ULHA 5HMZA 1TK8A 4B9UA 4OO1J 4AL7A 4GO7X 3D7SB 2WONA 4F36A 5BPMA 3GG0A 3UB5A 3NCQA 2EEYA 5F9NA 4RL1A 2QLFB 3MTJA 1U1PA 1YG0A 3CXCM 1ZZNA 1SQKA 3LP2B 1MMLA 2WCXA 4B3RK 3BDEA 2EKNA 2VG5A 4K4XA 3SCKE 4BR5A 3OVBA 4LVNP 1VQPN 4ZVSB 2BRKA 2OANA 2A2DA 3EYZA 1H6KX 4C8LA 2Z0GA 3J80Y 4A48A 5KFVA 3GIRA 3HSJA 2A18A 4I2PA 3PKMA 2DRDA 3CCMN 3ZETA 1FXRA 4H0XB 1U2RA 4G65A 4OYWA 3T6JA 5D4PA 5IM0A 2JSXA 4RX6A 2EVZA 1QE1A 3IRXA 2DNQA 4OZ2A 4K42A 1N6QA 1RWOB 1BL3A 5CYJA 5HMYA 4CLZA 2OEKA 3DXBA 1U6ZA 2L9NA 5D8HB 2YNIA 2RNEA 4O4RA 3M6GA 1HNIB 2ZH8A 1FNMA 1BLUA 4QR0A 2LXFA 3NLCA 4OIXA 4U9RA 5KFGA 1C1BB 3IM8A 4CLKA 1UAXA 2E29A 1IXKA 2AEJA 4KGXB 2JFKA 2LP4A 3G6ES 3SMSA 2BM0A 3ZSQA 3CJ5A 3PW5A 4OX8A 1MU2B 2M8HA 3NWGA 4C23A 4L74A 1WC5A 4JV2A 2DRAA 3MTKA 4P2FA 3AD7C 4CNZA 4JS5A 4CM0A 1WB9A 2PFDA 2EI5A 4FLZA 2PO4A 3LDOA 2D0CA 1TP7A 5IV3A 2A1BA 1S5ZA 4OL8A 4U7BA 3S01A 3O9RA 3QWPA 3TVYA 1VHIA 4DV5K 2CGLA 3KNAA 5AQHA 2OMOA 4FL9A 1LWCA 4JKGA 4ANCA 2P9LB 2QRRA 4WTYA 5KPRA 3SBGA 1QAJA 3V6DA 2RB7A 4DQQA 4FCYA 2N3LA 3TUZC 1IBKJ 5J2NB 1R31A 3FEZA 3NP5A 3MF5A 2YX4A 3PIOL 3P8BB 4JI3J 5H9EJ 3BR9A 2E20A 2DK2A 4EI2A 1FXLA 1HQ2A 3OTOJ 1XNQK 5GADU 3H1QA 4WFZA 3FCWA 3LA0A 3O8MA 2HFUA 3J7Z5 1TR0A 2QN6B 1UVIA 5A2QU 2IMOA 2ZE2A 4FWSA 1RE1B 4I7FB 2DNKA 2QFIA 5CZ1A 3C16B 2FTRA 2YKMB 2UVRA 4CZFA 5AZJA 3EGZA 2ZKTA 1RT7A 4H5WA 4O4GA 2LQJA 3J81O 2RUSA 1W25A 3O9QA 1R8HA 2IRUA 3D9BA 2H3GX 3I0SA 4ZJLA 5FPDA 3V9WA 1A6LA 3ZCMA 4JEPA 5GAGP 4J7CA 2KW4A 1A5WA 2UUCJ 2BEFA 1TAUA 4DV3K 2XMVA 4EYIB 2OHDA 3T1YK 2I7NA 4BDZA 3EE3A 2HFZA 5U47A 4XDDA 3VAJA 2DFHA 1NWKA 4BRNA 3FEXB 5LSOA 2B51A 1VFJA 2WVDA 2XCAA 3I5CA 3VF6A 2BE2B 5FJ4A 2LEPA 2AMCB 4HYKA 2G8KA 1KXPA 5T7LB 4WFNL 2XWYA 3ZTQA 4G6VB 4ES1A 2XYGB 2RSQA 3OSNA 3BJYA 4RUBA 4QU7A 2JLEA 2DHHA 2G0CA 1D9FA 1VQ7N 3P39A 2VBWA 1RCXB 2P9IB 2DGQA 2ZH2A 1FK9A 1EX4A 4IKFA 3WXIA 5BR8F 2HNDB 1SPBP 3CJ1A 2C42A 5HRRA 2YVSA 2GMLA 3JSRA 5IT9O 4M42A 2KHDA 5E3QA 5KG7A 1CS4B 1YJWN 1UTAA 1KONA 2J8AA 2MKKA 1YJ9S 4PKIA 4FLUA 4UOFA 4WFBL 2B9WA 3DM2B 1DGKN 3L9ZA 3GZ7A 1BG3A 1LK5A 4M1KA 2ZZTA 4K4ZA 2AIRB 2GMHA 5LL6d 3QSYB 3I96A 5M2PA 4C98A 3SAHA 3FLCO 2E9TA 2BM1A 2RU3A 4LF8K 5HQMA 1Q8BA 5DG7A 2HHXA 4EYHB 3NGTA 1UPPA 1VQYA 5TKWA 2QEXS 4WFAL 4DU8A 2FF3B 1TL3A 2PAVA 4WE1B 3RRHA 4GMJB 1T9VA 4ZCMA 1P90A 2V2KA 1GLBG 4ZHRA 2VV5A 4MMOA 1TYQA 1Q0NA 2HRYA 4LF7J 2VG7A 3A12A 3N9UC 3DXSX 5HI7A 4K5SA 1QHTA 4DPTA 3HK2A 4OHZA 4U7CA 4USWA 1S0VA 2V2QA 1SJQA 2UUTA 1S99A 4B3RF 3ZNUA 1GLJO 2A3JA 4LF4K 3OFEA 2K06A 2J7KA 1RT5B 1RGVA 3MI7X 5ADXH 1GMWA 3TZXA 4YDUA 3RBXA 2QA4G 4OI3A 1JLCA 3D68A 5T14A 1OKJA 3ITHA 1K44A 3W2VB 2X6NA 2E66A 5JVGQ 1S10A 2H4YB 3CCZA 4TYAA 3QEXA 1WSFA 2ZBCA 2NXCA 4OI1A 1R3NA 4IZ9A 2DPIA 1QZ5A 1HIYA 4P52A 3BREA 3SJJA 4NYOA 4DX8H 4A8WA 4FZZA 2KXHA 5DM6Q 2OPQA 4U8VA 4A2AA 2X1GA 1RT2B 3L7UA 5C5JA 4IOAQ 4LFCJ 3AY0A 1IH7A 2ATLA 1NU4A 4IRKA 1TL4A 3FSIA 5CZ2A 1E6YB 3N6MA 1IBKF 2BJEA 1U1OA 2OZMA 2GQ2A 5I42B 2WSEC 3GE1A 4JI3F 1VQPS 3NBPB 1KVAA 3M30A 2G9OA 3ATUA 3I31A 2DNPA 3OTOF 1GOAA 3ENVA 4LF9K 5AQJA 1B92A 4O0IA 3M8PA 4A8YA 5LMUK 1IR0A 2AZ1A 3CCMS 1JL1A 4CLFA 2IAJB 1FKPA 5ITHA 1O0PA 3UNGC 1T95A 3ZT2A 2DBBA 3NL0A 3AVHA 2I5JA 3PW4A 2P9KA 4PG6A 4RW9A 3EGVA 1AA1B 4BHQA 2M88A 1M90O 4KHSA 4CJLA 3FZFA 2YPYA 4X65J 3DI6A 1SVDA 3GFHA 2J8SA 4K59A 2GVDB 4OX7A 5HBMA 4Z7YA 5D4OA 3ZSYA 1VQ9S 2O1PA 5D77A 2W2NP 4WXWA 1JXLA 1JLEB 5J1NA 1JJ2R 1ACMB 1BWVA 1RBAA 3NOGA 1VRUB 2GNKA 3MZIA 2VL1A 4K4TA 3RZAA 4AQYK 4AXIA 2U1AA 3I5AA 2UUCF 5HO4A 4P75A 3TAMB 3BH7B 2IM2A 2CWXA 1P6TA 1N36J 4HHUA 3QPIA 4O23A 3HOSA 2A3ZA 4FBTA 3MMBB 4B9LA 3UKRB 2M8DB 2WVBA 3RB0A 5DDQC 2V8VA 4DR2J 4ISEA 3UDVA 2C2ZB 1C0UB 4B9TA 4NZ6A 4DF4A 3DOMA 2E5LJ 4K5RA 4JI4J 2P9EA 4QIFA 1SAZA 1LAWA 1NHKL 1CJTA 3TVZA 1HD1A 4CYUB 2WSFC 2HHHJ 4L3QA 3D6HB 1SH0A 4TYBA 4HI1A 3MEKA 1OO0B 2YHYA 1V6HA 4OYIA 4DV7J 2JRSA 5B0EA 2M52A 3OXGA 2ZM6K 5CHIA 1C0TB 3H1VX 2HQIA 2G8UA 4M3TA 1D3WA 4ZCKA 3PV8A 1X9SA 2CJQA 4BVOA 1Q82O 2AJ4A 5CYQA 3AB4B 3T5LA 4DXLA 3HXMA 3O6WA 4B3OB 4DV2J 1Q18A 3OHAA 5KT2A 4YOEA 3GYGA 3MECB 2ROPA 5IOLA 3UI3A 1VRTA 2IBKA 1RBTA 2ZUGA 3QGHA 3UD5A 1Q5VA 4U67Q 5J2QB 2CZVC 1NGJA 1KLNA 1YRUA 4U95A 3IWXA 1N34J 1I94K 3PRBA 3LDNA 1A5VA 3TJ8A 1ZPWX 4L75A 4FYDA 5DGAA 3CJ8A 1NGCA 5J1EB 4A8KA 2VGNA 2FGOA 3NEKA 3AO2A 1MW7A 2BACA 4M3RA 3TTDA 2EW9A 1TL7B 3C14A 3NAHA 4FJ7A 4LF7F 2DY4A 1RHRB 2W24A 1MWQA 3T5JA 1S9FA 4C9DA 1TUVA 2W9AA 2C2KB 1EJ7L 2E88A 4LR9A 4EU0A 1PGZA 1BY9A 4ZVRB 1UJ5A 3DRPB 1C4AA 2RMLA 2XNQA 3IWLA 4DPUA 4BR7A 3KK7A 3VZIA 2QYCA 2W8KA 5C24B 3PZPA 2BUNA 2V68A 1QVFR 3AT1B 4NRUA 8RUCA 3W9JA 1X9WA 1K9MO 4ZLNA 3ZZOA 2B4VA 2VPWB 2YCHA 4GKJK 1SZ2A 4GKKJ 1YXQA 2RQ4A 1YJVA 4IH5A 2NRTA 1RWWB 1FD2A 1VQ7S 3CCVS 5B08A 3KLHA 1NKEA 4OI2A 2G0IA 3SCXA 3JS6A 3RG6A 4BCAA 5KFPA 4YY3K 1FFGB 2F8TA 2XSJB 1T9XA 2B4OA 1WDDA 1YJWS 3DXMA 1PC4A 2OFHX 5HAOA 1E4GT 4QBUA 1NM1A 1JCEA 3T9ZA 2GS8A 4HCBA 4P72A 4GO5X 4OVLA 1G15A 4FJKA 4LFCF 1NOZA 4DV4K 3MHYA 3D6TB 1OY9A 3LGHA 4FOEA 4JHDA 1K0TA 1F6TA 2OP5A 3ZLJA 3W65A 5H9FK 5AQQA 1EWRA 1EKSA 3A1YG 4B1YB 2VWKA 2Q3PA 3K2PA 4ECQA 1YGYA 1K8KA 4KC5A 3VQBA 4PPZA 3RR7A 3HCXA 4OKJA 1YHQN 1U0SA 4DZ6A 2FSNA 3SJHA 3IFEA 4IO8A 1S6PA 2ALZA 4WWSA 5HL7Q 2QV6A 2BQUA 4Q8FA 1J6ZA 4E7HA 4DR5J 4A8QA 4TU7A 3D6MB 2IIHA 4KRFA 4HDGA 3M1VA 4URQU 4X62K 2R9LA 1YDLA 4NEYA 2HURA 5CXTA 4NLPA 4YR0A 3BZQA 5DJBA 1WHVA 3ZFVA 3KLIB 1Y7PA 3MEDA 4X66K 4C3LA 2B6AB 2Q3SA 2C28A 2GHWA 1YVUA 4X65F 4CZGA 2AD9A 4ICLA 4OZNA 3B6BA 3CJTA 4ZMMA 3PIPL 5HRSA 5EUHA 3EN9A 2BX6A 1Z4UA 2XHBA 1TKZB 1OH8A 4IKAA 5F8JA 2KLAA 3C7NB 2NUHA 1KQKA 4J5OA 3M8QA 3D0IE 5MAOA 1IM4A 1SC1B 1ZM9A 1B3TA 4HVJA 3QMLA 4Y28C 4OX6A 2KT5A 1N36F 2FLNA 3SK3A 4DX6A 3G2XA 3G4SN 2O8DB 1U49A 4B08A 2QFJA 4W5QA 1FXDA 1HJRA 3VN5A 4YOXA 4ELUA 1ITGA 4DR2F 2KH9A 4IJAA 1IQZA 4QWCA 4JI0J 3R7BB 6FD1A 1RWNB 3M2UB 3HSCA 3N28A 1O8BA 4KH6A 2E5LF 4JI4F 4BGBA 4DTOA 1HBMB 4ES2A 2DXFA 1RXOB 3D0HE 2RU9A 3AH6A 4ZP7A 3JB9k 4CJ3A 2HHHF 2IVOA 3UVJB 4CQ1A 4F0KA 1VC5A 1BCMA 3I4HX 3W8GA 3A5LC 4DV7F 3ISND 2A1SA 4AQYF 1BQNB 4CHPA 2B9EA 4EAHD 3OTBA 2GGPA 2LQ9A 3N01A 4PYDA 2C1EB 2HKEA 2J9EA 1X5TA 5CE3A 3MWBA 5KFNA 3LPEA 2RIJA 2Y0SD 2DTUA 2XMAA 1NPKA 2PGCA 4DV2F 4HEA9 2AEFA 1GMWD 3TX8A 1ZAXA 2PI4A 1SKWA 4BLGA 5CD4A 5JLHA 5J2MB 2K3KA 5A8RA 2A2CA 3CMQA 1YKWA 4KI4A 5F8IA 4PL7A 3DRSB 4FJNA 1Q7LB 2DR5A 3MD3A 4DL7A 1UWBA 1VCTA 1N34F 2V4RA 3NCIA 3ID6A 4YNQA 1IWAA 3L6QA 2ILYA 4W92B 1EQMA 3AA8A 2HWHA 3PXGa 1IR2A 4KKOB 2D9PA 4LY7A 2MKSA 1S97A 3UDEA 4YN3B 3THXA 2E9ZA 3MM7B 2BABA 3MEEA 2DNLA 1OS5A 3F44A 4QCLA 1AFJA 4WTOB 1S1TB 2WW8A 2UP1A 4LF6K 4BBYA 2I9SA 1EB0A 4BROA 2JFDA 3LP1B 3TAQA 3GPAA 1S7IA 2RPIA 3GP9A 4CIGA 3MCMA 4QPXA 3K58A 1Y11A 1Y97A 3AQPA 3PEJA 4WFBQ 4NI2A 4TY8A 2WOMB 5BPLA 1QJHA 3TA1A 1FEHA 3THVA 5E2QA 4AHRA 3LDQA 1Q81O 3JTPA 3M6VA 3H98A 4DX7A 1K1SA 4CBUA 2WB1D 5G0RA 4GKKF 1OIAA 3BBBA 4ZPBA 5I9EB 5K14A 1JK9B 3VQSA 3C15B 2J9DA 3Q22A 4I4BA 1CJKA 3SMPA 4ZVFA 2CGKA 3M2VA 1UJ6A 2OPRA 2PD1A 1NU0A 1KRPA 3QBWA 1WLJA 4I9QA 3D3BJ 3RB6A 3E3XA 2HMIA 4OQJA 2VPYB 4G1QB 2XB2D 4C48A 1WOQA 1FESA 1WEXA 4OKKA 3VESA 4F9OA 5IQQA 3HI0A 2CPEA 3L2QA 2VGMA 4CEQA 1OPIA 2ETJA 2BJ9A 1SJ4P 1WHXA 5I3PA 2O66A 2YNHB 4F7VA 4DR6J 4CHQA 3OYMA 1HI0P 4Q0BA 3MM9B 1NDKA 2GIFA 1FKOB 4E98A 1D8YA 4R5PA 2M2BA 3EICA 1B7YB 4OLAA 3QIDA 4CGGA 3J81j 3VF0B 4M5MA 5AQUA 2DY1A 1NHUA 2B7CB 4B3TJ 2V9WA 3FR0A 1RTDA 1HBNB 5D3GA 3O4QA 3NGRA 2G8HA 2JWKA 5KFSA 2BE7D 4CGDA 1J9AA 3Q89A 2RQMA 3MN6A 3AXMA 1EAYC 2UU9J 3UDLA 5FPNA 1TKXB 2DHSA 4DR5F 4FNHA 2C22A 2YKNB 1LEOA 1WDTA 1ZXOA 3OUYA 5AE1A 3D7EO 1IV0A 1QHAA 2P2CB 4E89A 3LOUA 4YOVA 2VZ9A 3HPOA 4PHTX 4N56A 3GBTA 4X4VA 4I2QA 1KSPA 4J2EA 3I82A 4RU9A 1YZ7A 2UXCK 3CJ3A 1RTIB 3G71N 5BJRA 2DVIA 2CZ9A 3G9CA 2XY8A 2K1RB 5EN1A 4NLSA 3JSMB 4HLBA 3K9JA 4E1MA 1RTJB 3SYZA 4BC7A 1JXEA 4JI5K 4DR3K 4ZK7M 2G8VA 3E8OA 4RW8B 2FLOA 3CTRA 3MM6A 5C25A 3GSIA 3SZ2A 4A8SA 1K6YA 3CJAA 1Q7YO 1S49A 1DAXA 2COLA 1X4FA 1Q79A 2APOA 1I3OB 4JI1K 4P7VA 2DGXA 1PYOB 1RT1A 4QW9A 5EWEA 2NXEA 4JI0F 4HHJA 1Q86T 2OD4A 1HR0K 2VF3A 4FWPA 3Q8SB 4FK2A 4CJ7A 1YBTA 2JX2A 5AXKA 1RAAB 2V94A 4LJMA 1WSEA 4UOCA 2L48A 4NYPA 1NLKL 1C0FA 2KI2A 2OCEA 1JLQB 2WC9A 3MR7A 3AVKA 5F41A 1L3SA 3QFWA 3J81Y 1M1HA 4Y0FA 5HK4A 1S22A 1NMEB 5FLXO 2JEIA 4IDKB 4EWTA 1NPRA 1XR6A 1TKTA 4EGLA 1S6UA 1YHQS 1ZBFA 4WPAA 2OPSA 3QFHA 3O44A 5E41A 2CVIA 3U6FA 2PA8D 1PIEA 3N4QA 2EFOA 2LQBA 5CYMA 5GVQA 1AT1B 1AROP 2EFQA 4H0PA 2BKOA 1S76D 2FVPA 1OQ3A 2NRZA 4K0KJ 4CJPA 4O3RA 1J5EJ 1D4XA 4XDCA 4M63C 2MDAA 3MAHA 2ROEA 3OY9A 1KVCA 3MX5A 3PEHA 3BUZB 2NLWA 2NRWA 5CAAA 4M63A 1R8AA 1M1KO 3QEIA 1NK0A 2P9PA 4ITSA 4CO1A 2ZJRL 1UVKA 3SMZA 2D0PA 4OGEA 4PA1A 2Q0UA 1LOUA 4NWBA 4ECWA 3ZSZA 3E01B 5HATA 4GC7A 3RMBA 4ZTJA 4DUZK 4WK3A 3PHEA 5JS2A 2YKPA 1RP5A 4XIUA 2IRYA 3HJFA 2HF4A 3VF4A 5D4LA 3VEYA 3UE5A 4KHWA 4QYRA 4A61A 1IO2A 3G4SS 3DLLL 5BRDA 3VAHA 4USVA 4Q2LA 4X84A 3CJ9A 2BOAA 1NB2A 3NF6A 5A8WB 3SUOA 2V63A 2E7XA 3M9NB 1S1VB 3BO2A 3CXCR 1HQUA 3A8KA 1SXLA 2MQLA 2O01C 3AARA 3KDNA 3MPWA 1RDWX 2J6SA 2V8DA 3NGDA 2VFRA 5GAGU 5JLFA 3BEXA 3K0JA 3O1BA 3R5BA 2ZNZA 2HWTA 1MROB 3GONA 2HHUA 2HBQB 5HVGA 2XMMA 1NZAA 2Y1RI 5KFUA 5EWFA 1QAIA 2RJZA 3NH0A 1LV5A 4MIAA 1F2HA 2IVYA 2VUGA 4JRPA 2VB6A 1QD1A 3ZZRA 4K4WA 4DR6F 4DG1A 2BJDA 1H7XA 3RRKA 4RW4B 2JVOA 3HSZA 1B64A 5AQWA 2H3EB 2BOPA 1SCJB 1JLBA 4LBIA 2UXDK 1RBRA 4JKHA 4LC9B 3V9SA 4B3TF 3SUNA 2XCPA 2F9DA 1Y9OA 4JK9A 3OT9A 3QINA 2BA9A 2P5VA 3ISZA 4WCEL 3QERA 2UU9F 3M1FA 2RVJA 3LH2S 1K73O 4H4MA 2WZ1A 4O8UA 2GO8A 4LF1A 2WRMA 1HYZA 1S1UB 4J90A 2VWJA 4CGHA 4B1VA 1NK4A 1X3NA 1SV5A 3EL2A 2F8SA 1SC4B 3OBIA 3TANA 5C12A 5B0GA 4KYZA 2CDQA 2BDPA 3HHLB 2PMHA 1NH7A 3GB0A 4DV0J 3O3LA 3MAQA 2EK1A 3KWIA 4Z2XA 3CG7A 3G6VA 5BN8A 4M3UA 1DLOA 2B0GA 4OPKA 3MMCA 3TQ1A 2KG0A 2PN6A 2DTJA 2YHXA 1VQSA 3OYGA 2YNFB 3MDQA 1B0VA 2GWKA 1AYEA 4QOTA 4DV1J 5JVHL 2CPDA 2D3OR 2O5DA 2AJQA 5CA5A 1NKCA 4DKWA 1FHTA 4ZPAA 5KGXA 1GLLO 3QFPA 2AYMA 3PM9A 1Z25A 2XI2A 2O8CB 3FCVA 1U02A 3NMAA 3CO9A 2ZH6A 1BI4B 3U1NA 2ZHAA 2IHR1 4FXVA 4JP8A 5KG2A 4FW1A 4QPTA 4FPBA 2LFVA 3FRZA 1RWMB 3CCWA 1XMOK 1RDDA 4WIIA 2UUAJ 3SPYA 5HP1A 2X3GA 3WXJA 3ZC4A 3OR1B 2YXLA 2KKHA 1FDAA 5E7OB 4GC6A 3MR5A 3HTVA 5A2QO 1NXIA 4RKUC 2PFUA 3U8XA 3L2UA 3CJQA 3D4JA 2RF2B 1S1XB 3EJMA 4M3YA 2ZITA 3J7ZO 3A3NB 2YKQA 3DYAA 2HQ3A 3W60A 4KJIA 2ZDPA 4FK0A 3LTOA 2IYGA 1IJEB 1DTTB 5KOWA 2CWKA 4KTZA 1MMDA 3BY5A 4JI2K 1IKWA 3R5AA 1VQ6N 3ENOA 4M5KA 3LUYA 2M9KA 2YNGB 3PCOB 3OTEA 1CPZA 2VOOA 4K0KF 1J5EF 3QNOA 3CIZA 2Y1IA 1FE0A 2DH7A 1U0HB 4CD1A 3PJXA 3WEEA 3PW0A 4LFAJ 2C2OB 1IUJA 5IC4B 3GJSB 3US5A 4OPJA 1XBWA 4WK1A 3DRRB 2CQBA 5KFTA 2WHOA 2ZJQQ 2HBZB 1NZ8A 5AQZA 3KD1E 4JKDA 4KHUA 1D09B 3MAAB 4R0JA 4ED8A 1TKDA 1DBDA 3G71S 1S77D 2CKWA 2YV0X 3H2LA 1G4CA 2NRHA 2C3OA 4CJFA 1BQXA 4CZEA 3R1LA 3D0PA 3CERA 3O2IA 1YJNN 3R27A 3CM6A 2Q66A 5HMWA 3GIKA 1ZBHA 3OR2A 3VAMA 1T7PA 1HPMA 1MWMA 2O8BB 3VVUA 4RU2A 2OZSA 3S3OA 4L8RB 2E44A 3L8BA 2HAFA 1NGGA 4Z37A 4K50A 4HTJA 2MKYA 1YTYA 2V9KA 4CK3A 4WZMA 3I5BA 3BF3A 3NG8A 2PZSA 3CULA 2CQPA 4FJMA 4N7TA 4JV5K 1RWPB 3VQEA 4X4QA 4QU6A 2RQCA 3OBWA 4WU2A 4M5DB 4ZVGA 1M5VC 4JBCA 1JMTA 1RACB 2R2RA 3TWZA 2E1YA 3ULDA 1YRTA 3O4NA 4KQZA 4H4KA 1Z2LA 4ZP8A 2NUBA 4KGVB 1PYTA 1TV6A 2IGIA 4OYPA 3FFIB 4I6MA 5B0BA 4NX9A 4EBEA 2WONB 4OYAA 5DRKA 3V81A 5DO2A 2C2RA 1KEKA 4OI4A 2CPHA 2QK9A 5IWAK 1XK8A 1QSYA 2P6SA 1BHLA 2VG5B 4MK9A 4Y00A 1ZBIA 1VGYA 5LJWA 1NJIO 2EXUA 4ZP6A 2QSFA 3H6EA 1IJJA 4ZPVR 2PIIA 2WBNA 3U27A 2PEHA 2EX3A 5C2GA 4I2PB 2CXEA 3EZ5A 3TRGA 4JI7K 3ZETB 1E6VA 3E66A 1ZBUA 4M3ZA 4Q7AA 5IM0B 3QRRA 2XSFA 4BQLA 1HNZK 4G9ZA 1QE1B 3IRXB 3W5YA 4CRJA 1N6QB 3CJKA 2ITMA 3IAS9 1LOTB 2ERRA 2DKOB 4LUBA 2YNIB 4OX9J 4FVMA 5KFJA 5KT5A 2R2TA 2LLZA 2F9TA 1D9AA 5TKYA 1GX5A 4PQUA 4TSXA 2QW9A 1KVJA 4BC9A 4E19A 1WC1A 2PYLA 1RWXB 3W5XA 2UV8G 3ZXWA 2DCUB 1MG7A 1D0EA 3TZWA 3W66A 2CH6A 4IFVA 1SL1A 2R7XA 4DV1F 1QQOA 5DDPC 2D41A 3WDOA 1QVGM 2QWPA 4BACA 3ONQA 1N5VA 1BISA 1ZH5A 4BY9C 2ACMA 5F0UA 3D0GE 2H51B 3HJVA 3P1GA 1X4BA 1KVIA 2QXFA 4NLOA 2G13A 3TO8A 3D2FA 2BBEA 1LWCB 5C2CA 1RT3A 1U1MA 4NLTA 3HT3A 3UR3C 4IO9Q 2RKIA 1KR4A 5F8MA 2UUAF 3KJVA 2B4UA 3DN9A 1DEJA 2KFNA 1K8AT 4LSLA 4ZVUB 2ZF5O 3DRXA 1YI2N 2WB4A 4M45A 4CEAA 2P9GA 4NCBA 3LW5C 2F8EX 3LO3A 2QLXA 4F02A 3ATVA 4CZMA 3EE8A 4CI6A 4H4OA 1J27A 3AB2B 1UA1A 2E8AA 4I56A 5LT5A 4NA2A 5LOQA 3CMEN 4B02A 1DQAA 3R1HA 2V5HG 1WSVA 2ROGA 2Z58B 1T9TA 1U6BA 1UEVA 4AHUA 4FLVA 2O8FA 2FJXA 3M2RB 3TZYA 1NGHA 2AX0A 2ZE2B 4N41A 4YDXA 1CXUA 4ANEA 3P5BP 1U6FA 2HRUA 3VQ7A 3R8YA 2HIYA 1N32J 3LWMA 4OKEA 4XEIA 4Y65A 2EG1A 3BF1A 4LFAF 2VH7A 5AZJB 3I9V9 2YWHA 1XR7A 4O4GB 4Y2MA 2AGPA 4LRCA 4BE1A 4KHPK 2E1MC 2GUIA 3B6PA 1RDUA 4C0OC 4C0HA 3I0SB 3AQOA 1GOCA 5AE3A 3GV7B 4FF2A 3SQGA 3F41A 2QX0A 3E51A 4BS2A 3W61A 3F5TA 3WNHA 3MXHP 1L3VA 3E9LA 1BGXT 4KV8A 5HMXA 1T94A 1MWYA 1X7VA 3ZT3A 2CVEA 1FVSA 3VCDA 4XK8C 4E1NA 2ZBRA 3HP9A 4ZCIA 3QRPA 4CZIA 4ZJOA 1DHMA 4Q2MA 5G4DA 3A0IX 4H0OA 2FHKA 1DFDA 2A41A 4Z94A 2GWJA 2CH5A 2E5GA 2H4WB 5A8KA 1L3KA 1RYSA 2HG4A 1O51A 2ZH9A 1KOOA 3IDHA 2QWMA 2QYGA 5KFKA 4C6AA 3OW2R 2HWIA 2V50A 1VMBA 1UL3A 1DQ8A 2KVIA 2L08A 2U2FA 5B0DA 1FNOA 1VQMS 4NXMF 3W2WA 3BPSP 3EPIA 1APSA 4F2SA 4L3NA 1B4SA 4CIFA 1FK9B 4EIAA 3Q86A 1IBLK 4O0JA 4BR4A 3IS9A 1HJOA 1QM9A 4JB8B 1VYAA 4P2XA 4CLSA 4FP9A 5AJ3K 4RWTA 1VR6A 2VODA 1YF5L 3MMJA 2QT7A 1M5SA 1EETA 3FFKB 3I4PA 1NGDA 1BE4A 4NMLA 2YPZA 1NK5A 4KO0B 4DTXA 4FS2A 3CDAA 5AZIA 2ZGYA 2CADA 2EPIA 3N6NA 3JQJA 1CVJA 3AHPA 2ZGZA 2FHMA 3SV3A 4DR4K 2F1FA 2O8EB 1VQ6S 4F2RA 2DNNA 4KPYA 1Z26A 2H9ZA 3VTHA 5ETPA 7FDRA 2ASOA 3ZSXA 3B82A 1RHMB 5HJXA 4MFBA 5KG0A 3R5GA 3I8DA 1HI8A 1HNWK 3HVRA 2P9UA 3DGVA 4CEFA 4ED3A 1EARA 2KL8A 2VQEK 1WC4A 3CDEA 3LGMA 3NS7B 3IO1A 2YWFA 4ZHRB 2RHQB 4DR1K 1TYQB 2HNYA 2F40A 4OX9F 4PKGA 2VG7B 2IA6A 3O4WA 1YJNS 1WSRA 4AYBD 4LRAA 1AUSL 1V3RA 2ZHBA 3O3HA 3KK1A 3OA9A 1RT4A 3V6KA 4OZ1A 2HW3A 3WX8A 4FWRA 2G0JA 4FPIA 4F25A 1LNQA 4NOHA 3CCUN 4XH1A 3W8PA 3UN3A 1Y00A 1QVFM 2JEJA 3OS0A 1WAFA 4QAGA 1JLCB 4Y2CA 3QMQA 3VQTA 2OYQA 1PKUA 1RB0A 4YR2A 5KFIA 3OLAA 3ITHB 3LP2A 1MA9B 2LU2A 4DUYK 4JI8K 1U2VB 2BW2A 2UZAA 4PKDB 2IM1A 4DTSA 1X9MA 2CGJA 5CH7B 5KT7A 1GMVA 4B9VA 1RILA 3SAGA 1U8WA 1T3NA 1S12A 4JKAA 3SUPA 2ZH3A 4TXSA 2I0XA 1ZTTA 5AQKA 5DLGA 3H2VE 3EKSA 2OPQB 1GOBA 3SEOA 3TEGA 3UR0A 3Q7CA 1PAUB 5GADI 5THWA 5GMEA 2BKNA 3OQ2A 3DAWA 2ZH7A 5F0WA 1N0UA 1KAYA 1YBAA 3B8AX 3A8IA 1CZAN 1Y3KA 3QT7A 1SL2A 5GIOA 1HNIA 2CAJA 3N5BA 1P1LA 4FXWA 3G0ZA 1MSWD 1C1BA 1RBOB 3M30B 2UXBK 3IMQJ 4DR7K 4JS4A 4I1TA 2FBVA 1X8DA 3PJ9A 1NK6A 4FF4A 3M8PB 1BDGA 2D1KA 5M2RA 3NOCA 1H3DA 2CYYA 2D0AA 2UVUA 4AUKA 4WFYA 3V2UC 1RBUA 3VETA 2PMWA 3SXLA 1FKPB 3I87A 2UUBJ 1MU2A 3QESA 3VF2A 3BO3A 1RAIB 2I5JB 4RW9B 3CWJA 5LJ3Y 2QIFA 5AQPA 2QLBB 1N32F 4CF9A 5GMKa 2MKHA 3L3VA 4FS1A 2Z2MA 4A5AA 2FVCA 3DI6B 1M5HA 2HBMA 1WAJA 4K8XA 2VDHA 1RABB 2MB0B 3NAEA 4NCGA 4JYAK 4B9NA 3CB4A 5DETA 1HNXJ 3QT5A 1XNRJ 4PKHA 4DV6K 4NZ7A 2P9SB 3GIMA 4F26A 3D1QA 2BR0A 4CZKA 3EPGA 4ECXA 2GQQA 1RDRA 3MUTP 3HHNB 2D0OA 1BQMB 5KFLA 4DU7A 1YJTA 3NXZA 2R8GA 1A9NB 2A6AA 4DS4A 1K1QA 2XY6A 3RMCA 4H5VA 3MR3A 1FXXA 2FC9A 1X4CA 4WP3A 4F3QA 5KGWA 5J2NA 3BV8A 1RU2A 5FLXY 2FLLA 5GAHP 3KHGA 3HM9A 1EWQA 1ZYQA 3DFEA 3H0PA 4UY8T 1FJGK 4OI0A 4KHYA 5BR9A 3J7AP 5CABA 3DOMB 1T9UA 3OLBA 2WFBA 1PAEX 4HTUA 2CPZA 3S6EA 1CJTB 3OYKA 4QWBA 2XRIA 1X4HA 4M7YA 2EBGA 3OFGA 1OYDA 3I6PA 4MDBA 2F4VJ 3HYFA 4OZJA 3C16A 3C6UA 2M3DA 3JTNA 1YI2S 1T3OA 3HHDA 3PRDA 2YKMA 2MYFA 3Q8VA 2QA4N 3C6HA 1VSEA 4MTPA 3CC4N 4TKTA 1H2VZ 5M1PA 4ED0A 4ETZA 1ZA1B 3BDPA 4CIOA 4CGFA 5CYQB 3P96A 2CG8A 3H20A 5JMNA 2A5XA 5KFYA 4AXJA 1VQOS 3CMES 2JC1A 5DS7A 2F9JA 3ZZTA 4RNMA 5C2DA 2CPIA 3SQ2A 4CLTA 1PC5A 1TL1A 3S3MA 1KQGB 2W40A 1VLYA 2BV3A 4ZVHA 1R59O 4CT8A 1YTAA 4TY9A 3ILIA 3VERA 5FDLB 4F0HA 3KHRA 2WUSA 2HSEB 3KHLA 1YIJN 2VG6A 3OL8A 2XC9A 1H7WA 2G2ZA 4LFBJ 3N79A 3CF5Q 3PJWA 4YHHK 5CZVA 2HHSA 4Y3CA 1SBRA 1CQMA 3K9KA 2HHVA 3OYEA 4CWBA 2P9IA 4NLUA 3AAWB 5D0RA 3NE6A 2KJVA 1RLCL 1D1UA 2IBOA 4A4JA 4L73A 2BQ3A 4Q43A 2VQFJ 2W6LA 4FZVA 1XR5A 1CS4A 2EWSA 2J9DE 4OPHA 3QEWA 3GL1A 1WBBA 5JVGL 4NXNK 3QGGA 2FHOB 4C3MA 3H2UB 4CO3A 4C8KA 1WSGA 2KFYA 2M70A 4XAKA 1QAXA 2VPZB 4E7IA 1BUPA 2P51A 4DV0K 3HZ6A 4BRCA 5DM6L 5M1NA 3QIOA 3VQQA 3SQOP 1ZA2B 4WE1A 2X1AA 1WKJA 3GFYA 3ILJA 3MOZA