4RW6A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 146
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw6A05
1KHVA 3KLIA 3G6VA 1ZETA 3SV4A 3MEDA 2IOCA 1C0UA 4BDZA 3OY9A 1MU2B 2FLLA 1BGXT 1SL0A 1ZTWA 3I0RB 2I1RA 5CYMB 3DRPB 4EBEA 1RYRA 4B8CA 2V4RA 5DQIA 2B6AB 4J9KA 3OSNA 4DTRA 5KG1A 4DLGA 3O3HA 4ZMMA 4K4ZA 1IH7A 3PO4A 4OVLA 2HHVA 4BACA 2E9ZA 4NZ0A 5I3UA 3RB3A 2XRIA 3MXJA 1KLMB 1EP4B 4WFZA 1JLQB 4FLVA 2JEIA 1QE1A 4ECTA 4E3SA 4I7FA 4DLEA 1SKSA 3GIKA 3JYTA 1XWLA 3I5CA 3IS9B 3M9OB 3H08A 4BWMA 1RT6A 3QINA 1UWBB 1T05B 4TXSA 1RTHA 1JL1A 3HSTB 4OGCA 5SWMA 3NF9A 4QWCA 3OS2A 5KG5A 5KG2A 2AX0A 5DLFA 4RUCA 4RNFA 3CDUA 2FLNA 2UVUA 3RAQA 4DF4A 2D0BA 1BIUA 1YTUA 3IG1A 4NLRA 3OYFA 5DQHA 5DG9A 3OSPA 2XHBA 1NJWA 2IBKA 4O3RA 4Y1DA 1TKXA 1FKPA 4WZQA 3NAEA 3CJ4A 1RNHA 3OYAA 4ZVFA 4NRUA 2P51A 4RG8A 1CZBA 3SUQA 2OA8A 2ASJA 2ILZA 3MXMA 1SH3A 1HNIA 4TSXA 4NLGA 1RBUA 4FZXC 1CZ9A 1JLFB 3NGDA 4ED3A 4CJ3A 2HAIA 4TYAA 4W5QA 3HP6A 3NGZA 1JLGB 4AILC 5D3GA 4DL7A 3FQLA 4ZPBA 4C8MA 4B9VA 3L2VA 4ECRA 4ED1A 4IH5A 1DTQA 3QZ8A 3B6OA 2ITGA 4IOBA 1D0EA 4J9MA 2VWKA 3S3MA 4B9SA 5E41A 1S1XA 3TABA 3WNHA 5F8GA 3ISND 3AVLA 1BQMA 3F73A 4J9QA 4RW8B 4DSFA 4ELUA 4ECZA 3MR2A 4QWBA 2QXFA 1W0HA 3QGGA 3RTVA 4FW2A 1EX4A 5CYQB 3LALA 1KFSA 3OVNA 1KVCA 5KT7A 4RW8A 3HVWA 2KFNA 5EWEA 4BE0A 1ASUA 4Z0UA 3PR5B 1S1XB 1S4FA 1N48A 3SQ0A 3QEVA 4CCHA 5K14A 3AVJA 1B92A 4CGJA 5DQGA 3I8DA 1RT1B 2R7YA 4DTMA 1T05A 4KHNA 1C0MA 3TANA 3NCIA 3MF5A 1T8EA 1JLGA 3RWUA 3CJ5A 3JYTB 2IJFA 4YMEA 1ZBFA 3ZT4A 1MMLA 4Z4CA 3PY8A 3OJUA 3MFIA 4C8OA 2WK4A 3UPFA 3MR6A 4NLVA 3M8PA 2IM0A 1JLQA 1KLMA 2R8JA 3OHBA 3Q8PB 3QEXA 1JXLA 4ECXA 5I3UB 4QW8A 3AV9A 2DY4A 4CERA 3KMQA 3UR0A 1KCFA 1I39A 3G0ZA 3AO1A 3E01B 2RDIA 2ZKUA 4IFVA 3CWJA 2Z1HA 1LWCA 2IAJB 4FJHA 4CEDA 5T14A 3RRHA 5C24B 4TY8A 4DTJA 5KFGA 1TL3A 3PR4A 2RN2A 3OJSA 3I0RA 2VA3A 3NGYA 4K4WA 1WSIA 2ZQBA 4M45A 1GX6A 4IKAA 3QZ7A 4KB1A 4YR2A 4DQSA 4DMNA 4FM0A 3S9HA 4TQSA 4CEFA 3SNNA 4IRKA 4F2SA 3G10A 3T3FA 4DSIA 2W9BB 1VSLA 2B43A 1IKYB 3DM2B 3IS9A 3KHGA 3QEPA 1RT7B 1LW0A 1HYVA 1IKXB 1WSFA 3ZCMA 2XY7A 3IAYA 3DLKB 1NK0A 3P1GA 5JS1A 3MEGB 1EP4A 5JUMA 3GV8B 1RDRA 1BCMA 5HRSA 3ZT2A 4OKKA 4KO0A 3DDKA 4E7HA 2KW4A 3CJ2A 1BCOA 1SL1A 4N47A 4EZ6A 1TVRB 4ECVA 2G8VA 4F50A 4NLUA 4I9LA 1WNEA 2YKMB 2J6UA 4B9UA 2BANA 2VG5A 5KGXA 4XO0A 2BQ3A 4MQ3A 3MEGA 2G8KA 4HKQA 4ZVGA 1VRTA 3HKWA 5CZ1A 3KLIB 4CJRA 3MFHA 4GW6A 2RKIA 4KE5A 1S0OA 1LWFB 2W9CA 3NF6A 5J2QA 2W8LA 5KT4A 2WOMA 3H5UA 1WLJA 5CY4A 4CFDA 1BISA 4KHUA 4TN2A 5KFZA 4RW4A 1N6QA 2BGGA 2O4IA 1KLNA 1RDDA 2JGUA 4FXDA 3RMDA 4QAGA 2HHQA 3SQ2A 4O44A 2E6LA 3VQ4A 3LANA 3C95A 4TY8B 3L2WA 1HQUA 2Q3SA 1LWCB 3F9KA 4IR9A 4JV1A 2DPJA 4FM2A 4KHWA 2A1RA 1NKBA 4E89A 4CHOA 3C94A 2IGIA 3CJ3A 3G6YA 3KLHA 4NCAA 3H2LA 3BSOA 4MH8A 5KFAA 3JSMB 2PY5A 3BDPA 4Z4IA 1J5OB 2HNYB 2VG7A 4KAZA 1F21A 3CJ0A 4OGEA 2XGQA 1BHLA 3K5OA 4FJ8A 4CEZA 3HPHA 5FRMA 1JKHA 2A1SA 3GIIA 4DL6A 4Q5VA 2YNHA 5HRNA 3OYKA 1N5YB 2HVHA 3OYCA 1D1UA 4PQUA 4ED8A 5K14B 3CM5A 4NCBA 3KD5E 1C1CA 2XY6A 1WNSA 4K4TA 3C6UA 4J2AA 3ZT1A 3NBPA 1NJXA 4FZYA 2F8EX 3D28A 4FJIA 1B9DA 5KFOA 3AO2A 3LP2B 3L2RA 2G8HA 4LSNB 1QQCA 1YVUA 4HCCA 3K5NA 1NKCA 1WSHA 3DYAB 1S1UB 2XWYA 3N6MA 5HLFB 5KFHA 3GQCA 2X6SA 4QPXA 1S1TB 4WYLA 4CFBA 4EZ9A 1VSMA 4NLWA 4DQRA 3OYGA 3KK1B 4ED0A 1D8YA 4Q44A 4QWAA 5J1EB 4LQ9A 1QS4A 1SL2A 1C1BB 1S9GB 5FDLA 3GILA 3H4DA 1CXQA 3M9NB 4E7LA 4DSKA 1RTJA 1TGOA 5DMRA 4RW6B 1O1WA 2OZSA 1RDAA 4FBTA 4CGGA 3DOKA 3PO5A 4Z4FA 4EYHB 1TK0A 4EO8A 4DU3A 1RTDB 2RF2B 3PW7A 1TV6B 4ZPDA 3OYIA 4KHMA 3U3YA 4WXWA 2ZD1A 4CJQA 4FJNA 3KD1E 3SQ1A 4DG1B 2IMWP 3PW0A 4J2BA 3V9UA 2HNZA 1RYSA 1ZBUA 3SFGA 4M41A 2FC0A 4DFJA 2FBXA 2V4QA 1B9FA 3MAQA 1TAQA 1TK5A 2HHSA 4RNHA 1RDCA 1SH2A 4WE1A 3D5MA 3NKYA 3BSNA 2YHAA 4CHZA 1S6QA 4ECYA 3HL8A 4KREA 1LAVA 4ZP7A 1W25A 2FJWA 1IKVB 4BWJA 1VK0A 4K4UA 3SJJA 1RT4B 4I7FB 3TWHA 5J2NB 2FVPA 4CF1A 3WNGA 3G86A 1IO2A 3BSCA 4M3RA 4HCBA 1XC9A 2GIRA 1ZTTA 1K1SA 2C2EA 3QIPB 4IBNA 3LWMA 3QEWA 1JXBA 5DLGA 2G8WA 4CIEA 5KFPA 4YR3A 3VQQA 3BQ2A 3CDWA 2R8IA 5EU7A 2WONB 4NCGB 4N5SA 4FLYA 3L2QA 4Q0BB 4M3YA 1D9DA 2ZD1B 4CF2A 2GIQA 4FJLA 4O55A 2VG6A 5KT3A 2E6MA 3OL8A 4FS1A 1ITGA 1C1CB 1TKZA 3CQ8A 4E7IA 2OPPA 5KFYA 1XR7A 2CKWA 4N41A 3VQ9A 1S0NA 4PUOA 4F4YA 1HNVA 3VQPA 2C2DA 2X74A 4DFPA 1NOZA 4JLHA 1HRHA 4CGDA 2HMIB 3CFRA 1JKHB 3TAEA 3LP0A 2IC3A 4JUZA 3M8SA 4EYIB 1NHVA 4EEYA 2R8KA 1JLAB 3K59A 2D3UA 2QE5A 3FSIA 3GV7B 3DRSA 5I42B 3AVHA 3ZSOA 4J9NA 4FJJA 4IKFA 3NFAA 2AGQA 1NK5A 3ITHA 4UQGA 3DYAA 1X9SA 2E9TA 1SUQB 3BGRA 3ZSVA 3OYHA 4XPEA 2OZMA 5C42A 5KFTA 3VQBA 1Q8IA 3LPUA 3TAFA 4AHCA 4FYDA 4H8KA 4Y2CA 3BQ0A 4JRQA 4K8ZA 2W8KA 2PYJA 4NLYA 2DPIA 3GIJA 3TAMA 4KHSA 4NYFA 1N5YA 4RW4B 3K58A 4JS5A 3KK2B 4NLDA 1QSSA 1Q9XA 2FBYA 3HT3A 5C25B 5KT5A 3KIOA 1DTTB 1RBVA 4I2QB 1LWFA 1KFDA 5CZ2A 1TKDA 4FK4A 1J5OA 3RBEA 3HP9A 3RB4A 5EUHA 4N76A 3O4NA 2HHWA 3P83D 1HQEB 3KHLA 4IG3B 2ALZA 2AU0A 4LD0A 1N56A 4DFMA 4Q0BA 4MIAA 2VG5B 3H5YA 2BANB 4WZMA 1WSEA 3L3VA 1ASWA 4DQPA 4FZZA 3SZ2A 2ILYA 2HWIA 3CVKA 4FK2A 5KFQA 3I5AA 5DK5A 4J9OA 4R8UB 2DFHA 1A5XA 5F8HA 3GYNA 4C8NA 4CHPA 4KFBA 3BSAA 1REVB 1T7PA 4DTSA 4IQXA 4WXOA 3QESA 1L3VA 1NK4A 5DGBA 3OYDA 4FJKA 2D41A 5KFBA 3OLAA 3AVGA 4DWIA 1DLOA 3VQ8A 1ASVA 1RT4A 1NOYA 2BDPA 5KG0A 2WOMB 4RW9A 3GV5B 1S9FA 5HP1B 4AHRA 3RRGA 2RDJA 1RT7A 3MEEA 3SI8A 3TAQA 2RKIB 1WSGA 3LP1B 4IH7A 2BE2A 1S6QB 4DF8A 2BQUA 1HPZB 4CEBA 2IM1A 3AVMA 3ZSWA 3AO3A 3NF7A 2HNDB 4G3IA 5C24A 2YKMA 2XI2A 3OL6A 4FBUA 4B9MA 3QO9A 1BI4A 4M3UA 4FLXA 3ZT3A 1RT3A 2AWZA 1RBSA 3IGNA 3OYEA 5KT6A 3E01A 5F8MA 3CO9A 3AVBA 3BR9A 4DS4A 3H40A 1RILA 3MECA 4IG0B 3PW5A 4CJVA 2FLPA 1XI1A 4KTQA 5J2PB 3LP3A 2AJQA 4RW7A 3NH2A 3OLBA 3AA5X 3QIOA 1TL1B 1FK9A 5DG7A 3AVIA 4CGIA 5KFJA 4OPKA 3DM2A 5FDLB 1IKYA 4DS5A 1S6PB 2FVQA 3V81B 4EBDA 5KFLA 2ASDA 3VQAA 3NAIA 4KRFA 1JL2A 4M3XA 4DTOA 4DL2A 5EWFA 4MKBA 3HXMA 3HPOA 4Z4GA 4R5PB 2ASLA 1RCHA 1RDBA 1S1UA 5KFIA 1K6YA 4N56A 1QHTA 2HNZB 4GC6A 4L8RB 3KJVB 4O0JA 1BQNA 1VSHA 4CFAA 1NK8A 3U3GA 4NLXA 1RBTA 1RA6A 4DG1A 1T03B 1S48A 1QSLA 1VSEA 5T7BA 4AHTA 3CM6A 4QWDA 3AVAA 3C6UB 4FVMA 1J53A 5L1JA 4F4WA 2WB4A 1BQMB 4CEEA 5EWGA 2YNIB 3DOKB 1VSFA 4NLQA 1TKTB 4ZVEA 2ZE2B 4URSA 2FVCA 1D9FA 1HMVB 1RBRA 3CIZA 4CJWA 3C6TA 4K4SA 2UUTA 3BREA 2CJQA 2RPIA 4O4RA 2VG7B 2JLEA 5DG8A 4AHSA 2XC9A 3FDSA 3JSMA 2J6SA 3ULDA 5HROB 4NLOA 1FKOB 4EP4A 3SPZA 4I2PB 4XPCA 3V6JA 4ZP9A 3DLGB 4LSNA 3LP2A 4Q8FA 3FQKA 2X6NA 2KTQA 1S1VA 3V6KA 5KFUA 3KHRA 4OLAA 4JV2A 3E51A 3DLBA 4YNQA 1T94A 3A2FA 4PQUB 5C5JA 3HYFA 4YFUA 1U4BA 4MIBA 4O3OA 1LW2A 2W42A 2YNHB 2DFEA 4ID5A 1TQLA 1UWBA 4B08A 2GV9A 1NK6A 5D3GB 5KFKA 4B9TA 4KTWA 4BDPA 3DLRA 1RT5A 4CIGA 2HWHA 4RW7B 3QNNA 2HB5A 4CJTA 4IRDA 5KFRA 4CGHA 4OL8A 4JRPA 3HHKA 4W5RA 3L3UA 4IG0A 2J6TA 1WAJA 2G8IA 4K4XA 4CK2A 3GIMA 3AVCA 3RR7A 1YVFA 1TKXB 2QKBA 3K5LA 3VQ5A 1EETA 1RA7A 1ZBLA 4B3OA 3QO9B 4CEQA 5F9NA 4F3TA 2YNGA 1HYZA 4QW9A 1SKWA 4B9LA 2HNDA 1X1PA 4XIUA 3Q8QB 1WSJA 4NYZA 2R2UA 4RUAA 3RB6A 1N6QB 2QK9A 1CSJA 3KMSA 1S97A 3VQDA 1TAUA 2E9RX 4KHYA 2Z1GA 3V9SA 1I3AA 4FJXA 3U6FA 4FLWA 3DRRB 1HJRA 2AGPA 4FW1A 5J2QB 3MEEB 3DOLA 1YT3A 4QWEA 4PA1A 1DLOB 3QLHB 4Z4EA 1VSJA 4FLUA 2I5JB 4OLBA 1EKEA 3KLGB 3IGVA 5FROA 3V6HA 1L5UA 5F8IA 4KFBB 3OYLA 1S1WA 5KG3A 1GOBA 2EHGA 3QERA 2IAJA 1EXQA 1EETB 1TVRA 3IRXB 1Z26A 3V9WA 4FM1A 3DRPA 2OPRA 4J9PA 4CIFA 3H5SA 1S1WB 4HYKA 1QSYA 4IG3A 1HYSB 3SQ4A 1CXUA 3WNFA 3KLGA 4CJ5A 2DTUA 1MU2A 5KFFA 5L9XA 4HUGA 2ATQA 1KVAA 1U04A 3MEDB 1RT5B 2XCAA 3CFPA 3Q8SB 4DTNA 5KG6A 3D0PA 3VA3A 3QGHA 4GMJB 3RBDA 2P5GA 4AHVA 1RT1A 4KTZA 4Q45A 2YV0X 4J2DA 1QAIA 3OS0A 4GC7A 3SPYA 3QNOA 3V9XA 2D7SA 4K50A 3G6XA 2P5OA 5JS2A 1I6JA 3TAMB 2BQRA 4CJSA 3T5JA 1TL3B 4CJPA 4NLSA 2YNGB 1NHUA 3MTKA 4O5BA 4IDKB 1S1VB 2V0NA 4IFVB 5CYQA 4O3PA 3P5JA 5C42B 4MKAA 5HBMB 2BRLA 4CK3A 4W5OA 4BDYA 1T3NA 3KNAA 1FKOA 4R0EA 1X9WA 4ECSA 3M8PB 5FRNA 3DRSB 3VQ6A 3PJXA 4M95A 4FCYA 1N4LA 3OYBA 3TAGA 1S49A 3ISNC 4FLZA 2WTFA 2HMIA 4J9LA 4ID5B 1NJYA 2PYLA 1LW2B 3C6TB 4TLRA 1ZBHA 4FJGA 3PVXA 2ZE2A 5KRSA 1TKTA 4BE2A 4E1MA 2OPPB 3DI6A 4U6PA 4DQIA 2GBZA 4AHUA 4ZTJA 3ALYA 3CYMA 2VG6B 3NMAA 3OS1A 2W9AA 4KHQA 4IFYB 2WHOA 3RMBA 4IFYA 4B8AB 4YP3A 3NGIA 3ZSQA 4Y34A 4I2PA 3MR3A 4F4XA 4H4OB 4KI4A 1ZBIA 2F8TA 1HARA 1K1QA 3VA0A 1S9EA 4Y1CA 3QIPA 1UOCA 4URGA 3SCXA 2B5JA 1DTQB 2ATLA 5KFNA 4LSLA 3V81A 1KHWA 4MK7A 3OL9A 1QTMA 5L1LA 4CFCA 1RT6B 4DSLA 2Y1JA 3VQSA 1HMVA 1IKVA 3EZUA 5L1KA 3PX6A 2KQ2A 1UA1A 1TL1A 3ZT0A 5L1IA 3PHEA 3HVRA 2YNIA 4DL5A 1QE1B 4ZHRA 5J2PA 1TK8A 4MK8A 1VSIA 4ED6A 4OJRA 2BRKA 3TI0A 4FS2A 1XR6A 1U09A 1TP7A 2AGOA 5HBMA 3ZSXA 1T03A 2FVRA 2R8GA 1WAFA 1QAJA 5HRPA 3VN5A 4F3OA 4FLTA 1BQNB 3KJVA 3M9MB 3D45A 4CHNA 4LQ3A 1NJZA 4HUEA 3Q8RB 5CYMA 4E19A 1TV6A 3RMAA 2RF2A 2XO7A 4ZVHA 5F8NA 4M42A 4EO6A 3O4QA 3OYMA 2GUIA 1JLEA 3LP1A 3ZSYA 4CGFA 4KB7A 4CE9A 1RTJB 4ZP8A 5HP1A 4RW9B 4JV0A 1FK9B 5J1EA 3ASMA 3AVKA 3O3GA 1BL3A 3M8QA 5KFSA 2G8UA 4ZPCA 3HK2A 1VRUA 2IDOA 5EDWA 4IRCA 5F8JA 3OHAA 1S1TA 3ZSRA 2X78A 4C8KA 4CHYA 3AO5A 4K8XA 1NNDA 3MECB 2VWJA 2O5DA 2OPQA 3L8BA 3ZSZA 4TY9A 4R8UA 1OS5A 2EX3A 3CG7A 2B6AA 1RT3B 3UDLA 4B9NA 2FVSA 2UVWA 3KOAA 1L3SA 3V4IA 3VQ7A 2W7PA 4KKOA 3KKSA 1Q9YA 4KBIA 3NBPB 3EPIA 4PWDA 5SZTA 3I0SA 4O4GB 4NRTA 3EPGA 3PX0A 1SKRA 2I5JA 2EC0A 2QV6A 4MFBA 2YKNA 4QOZB 2Z1IA 3V6DA 3QLHA 3TAPA 2Z1JA 2QKKA 4CEOA 3K57A 2UVVA 1LAWA 4G1QA 2OPSA 4PY5A 4ECUA 2D5RA 4CK1A 4I2QA 3DOLB 2UUWA 3PW4A 4MK9A 5KFVA 3M8RA 3LAKA 4J2EA 2C2RA 5KI6A 1NKEA 1R0AA 4LH5A 3LZIA 3PW2A 4FJ5A 3MXIA 4GVMA 1REVA 3KLEB 4NLPA 1NK7A 2F96A 4BE1A 4YQWA 4K4VA 4WFYA 4ELVA 1RT2B 3DLEA 4ED2A 3AO4A 4B3OB 2AQ4A 3VQEA 1JLCA 3AA2A 1C2PA 2E4LA 4QCLA 2HHTA 4LY7A 1JLBA 4URQU 5KFMA 2XGPA 3DMJB 3SV3A 3MR5A 1LWEB 3CFOA 1S5JA 1JLBB 4HVJA 2GC8A 4DFKA 4RNNA 1W9HA 4DTUA 3IN5A 4H4MA 3WNEA 3KLVA 3RAXA 1RAJA 1WN7A 2IA6A 1XHXA 3TVKA 1HQUB 3L2UA 1ZYQA 2YHBA 3KKRA 4CF0A 1U45A 4DTXA 2JC1A 4ECWA 2D3ZA 2YNFA 4OKEA 2XY8A 5KG4A 3HVTB 3CDEA 4X2BA 1SH0A 4CJUA 1GOAA 3NH0A 3TR8A 2C28A 3LWLA 3HO1A 5C25A 2HHUA 1VSDA 1RTIA 2XI3A 5KG7A 2YNFB 4ID1A 1HNVB 2WRMA 4O0IA 1Z4UA 4PUOB 3V6DB 3NHGA 2YKNB 3V9ZA 3TQ1A 4J9SA 1TKZB 1SV5A 3V1RA 3QEIA 1U47A 4M3TA 2JEJA 4FK0A 2O4GA 4NLTA 3HM9A 4KKOB 1UA0A 3KK3B 3ICLA 4F4ZA 2WONA 2XCPA 3DLGA 1KRPA 4KHRA 3K2PA 3I5BA 4K4YA 4DU4A 3THVA 3EYZA 5JXSA 3FRZA 1VSKA 3ITHB 5J2MB 4U7CA 5HROA 2OPQB 2JEGA 2LSNA 4KO0B 1JLAA 3KLEA 3UIQA 1FXXA 2R8HA 4Z4HA 4ICLB 3RB0A 1GOCA 1R0AB 1VRUB 3H4BA 3DLKA 3PZPA 1KTQA 2WCXA 4DTPA 3KLFB 2IC3B 3LP0B 3BQ1A 3SUNA 2FBTA 1S0MA 1LW0B 4JS4A 3HJFA 1IM4A 2OPSB 5DGAA 2W9BA 1C0TB 4DL3A 1L3TA 2P1JA 4F8RA 4MFBB 4WYWA 4C8LA 4J9RA 1IKWB 3FFIA 3AVNA 1Z25A 2DFFA 4WE1B 3LPTA 3O3FA 1S10A 4DEZA 3NH1A 3V4IB 3T5LA 2IM3A 4NCGA 4IH6A 4FJMA 4HHTA 4ELTA 3KTQA 2OYQA 4CECA 4E7JA 1U49A 4KB0A 4RU9A 4R5PA 2FJXA 1UAXA 2R2SA 4H54A 4IR1A 4CF8A 3S3NA 2Y1IA 4CHQA 5KFCA 2W7OA 4Q8EA 1RTDA 3BJYA 1IKWA 3FFIB 2HW3A 4ZHRB 3HVAA 3B6PA 1J54A 3QIDA 5J2NA 4Q43A 5F8LA 4OPJA 3LAMA 5KTQA 1S6PA 4KI6A 2KFZA 4LH4A 3H98A 5HRRA 4CF9A 4FJ7A 1JLEB 1KSPA 3TARA 4RNOA 4O3SA 1JX4A 4CESA 2IJNA 2HVIA 3NDKA 5HLFA 4ZPAA 2FBVA 3HPGA 1S9EB 4O3QA 5KFDA 1XR5A 5J2MA 4F2RA 1C1AA 3SYZA 2D0CA 2R2TA 4CJ4A 1BI4B 3T5HA 2ETJA 4OKJA 2IM2A 2R2RA 1CLQA 3T19A 3KK3A 4HUFA 3PJWA 3AA3A 1L3UA 3VQCA 4TYBA 1HPZA 4DQQA 1SV5B 2BE2B 2AX1A 3QGIA 1G15A 3H5XA 4RW6A 1C0TA 3K5MA 3RMCA 4AH9A 3AA4A 3NE6A 4WFXA 4NYNA 4KSEB 4W5TA 1C1BA 1S9GA 1X9MA 1A5WA 2C22A 4E7KA 3PUFA 3KLFA 3KK1A 5KFXA 4LSLB 2IS3A 4ICLA 3N6NA 2B5JB 2HNYA 1JLFA 4KAIA 3KLHB 4M94A 1HNIB 4YR0A 4FJ9A 2KZZA 4RNMA 4H4MB 4E0DA 4H4OA 5KFWA 3S3OA 4E1NA 1LWEA 1YTAA 3DMJA 2BR0A 2KZMA 2HHXA 1JXEA 1QUVA 3EZ5A 1JIHA 2PZSA 1FKPB 1JLCB 5KT2A 4I9QA 1HQEA 4ED7A 3EY1A 4IDKA 3NL0A 2G8FA 1RT2A 3DLEB 3DI6B 3LDSA 1U48A 4O44B 3DLHA 3IG1B 1BIZA 4W5NA 3SFUA 1NK9A 4CJKA 1KVBA 3SI6A 1GX5A 3SUOA 4HTUA 1RTIB 2JEFA 2VA2A 4CJLA 3LZJA 1DTTA 1J9AA 1RTHB 2FJVA 3T5KA 2V9WA 1A5VA 4ECQA 2OH2A 3KK2A 3HVTA 4ZTFA 5F9LA 4EP5A 2UVRA 4G1QB 4O3NA 1C6VA 3SUPA 3NAHA 3T1AA 1VRTB 3OL7A 3NF8A 2JC0A 3AVFA 4ZP6A 3I0SB 4O4GA 4PWDB 1HYSA 3KHHA 3UQSA 4M3WA 4KPYA 3PX4A 3OYNA 3OYJA 3V1QA 4CEAA 3RR8A 5KFEA 2XY5A 2OPRB 5KRTA 1XHZA 4EBCA 4M3ZA 3IRXA 1SUQA 3BGRB 1Y97A 4F4KA 3QYYA 3H59A 1LV5A 5I42A 4DU1A 1IG9A 3QETA 4RZRA 4CJEA 3PV8A 4DSJA 2D0AA 4CJFA 4DL4A 1C0UB 2B4JA 4Y2AA 3M8QB 1IKXA 4DSEA 2F8SA 4KV8A 4TQRA 4Y3CA 2W9CB 3V1OA 1D5AA 3N6LA 2NUBA 3DRRA 4KV8B 5KGWA
chains in the Genus database with same CATH superfamily
3SV4A 1C0UA 4BDZA 1R8HA 2QW9A 3NVKA 2Y0SD 3IRWP 4QR1A 4A8KA 3M30A 1R31A 3DFEA 3I0RB 1K8KA 3Q2SC 1N34J 4DV7J 2ZJRL 3MM8B 1FJGF 1RCXB 2I1RA 3TX8A 3C19A 3ISZA 1V3ZA 2XHCA 2V4RA 3R2DJ 4J9KA 3OSNA 2N7CA 1RADB 3AOAA 4DLGA 2HHVA 3DHXA 2PE8A 4U95A 4LBPA 4QIVA 4WFZA 1JLQB 1CJVB 4S0MA 4FLVA 4BC5A 2QMUB 2CQGA 4ECTA 1AZSB 1S12A 3GIKA 3JYTA 1NB2A 1XWLA 3I5CA 3M9OB 4BWMA 1YHQS 1UWBB 4K59A 1JL1A 1TL7A 4OGCA 4QWCA 4RUCA 1WHYA 4RNFA 2UVUA 1S59A 4CQ1A 1HNXF 1FT8A 3LTOA 3TUIC 1NJWA 3N4QA 2IBKA 4O3RA 2IRXA 1FKPA 1RNHA 3OYAA 5ADZA 1NGCA 3TJAA 1QUPA 4JV5F 1WG4A 2ILZA 1J5EJ 3HSGA 3E9LA 3KWIA 1CZ9A 2JNJA 4ED3A 4CJ3A 4W5QA 3W5YA 1Q8LA 3MMJA 5M2RA 4DL7A 3FQLA 5G4DA 3MGJA 4H03B 3F5TA 3L2VA 3ATUA 2HS4A 4IH5A 1BQXA 4LF8K 3GSDA 2ITGA 1D0EA 4J9MA 3M1VB 1HR0K 4B9SA 3C14B 3UCZP 2V52B 3WNHA 2E2QA 3AVLA 2KT5A 4J9QA 5MLCQ 2DTJA 4LFCK 2DNGA 4OZ5A 3DDIA 1FTCA 2NUHA 3QSYB 2OCEA 3QGGA 4JI8F 2VF3A 1EX4A 4X4QA 2LU1A 4F9OA 4PYDA 2VKRA 1DGKN 3CPEA 3S01A 1ASUA 3EDQB 1S1XB 1N48A 4G1IA 3SQ0A 2B3TB 3RGIA 3SBTA 2D3OR 3EN9A 4CDIA 1YJWS 2MSSA 2KG1A 1T6CA 1ZPWX 3QFPA 3TANA 2Q6BA 3MF5A 4K7QA 3R7BB 3R27A 1Q8BA 1ZBFA 4JI8J 2VDHA 4KH5A 3ZT4A 3ZNUA 4UTGA 4DV4J 3NCQA 4QYZJ 5BR8F 1SIZA 3M8PA 3ZZTA 2IM0A 2GUPA 2UXBK 2EG1A 2V4JA 4I6YA 3AV9A 4CERA 2F8MA 1I39A 4FP9A 1SJ3P 2DR8A 2WVDA 4FWOA 1LWCA 4ZCKA 2YCHA 5D6GA 4TY8A 3I56N 3NMUA 3PR4A 3SMPA 3I0RA 2VA3A 3HHLA 4P74A 4FYVB 4IKAA 1TMMA 3NLCA 2VD3A 5DRKA 3VF4A 1IXKA 2GV1A 4DMNA 3IXQA 4TQSA 3BZQA 4DPYA 4F2SA 3BM7A 3LGNA 2B43A 1HIYA 8ATCB 3IS9A 3KHGA 4JKBA 1M5OC 2ERRA 1LXNA 4EHTA 2MKIA 3FZFA 3IAYA 3DLKB 1YITN 3THPA 4JI7F 2EEYA 3HSZA 3MEGB 3SCLE 1EP4A 2WAQD 3G82B 3TEGA 2FB0A 3ZT2A 3IC1A 1PAUB 4EWTA 3CJ2A 1BCOA 5AQTA 4H5RA 4ECVA 2G8VA 1ZAXA 2FQQB 5EHHA 3O1WA 2J6UA 2OI2A 2VG5A 4BY9C 5C15A 2BQ3A 4MQ3A 1OKJA 3IKMA 3GWCA 4EHUA 2G8KA 3AB4B 4PL7A 2ZDOA 4HKQA 2QA4N 2V2QA 1VRTA 4J9UE 4JKAA 1CQMA 5CZ1A 4CO4A 3WX4A 4CJRA 3O80A 2ZBCA 2AZ3A 4ILHA 3RG6A 5J2QA 4X4VA 5KT4A 2M5YA 2P8IA 4DL0C 3AQPA 4CFDA 2DNPA 2GGPB 1BISA 1MMDA 1YIJN 1QTNB 3HFZB 4JD2A 2BGGA 3E8OA 4JI1K 2JGUA 4FXDA 1S72S 2E6LA 3C95A 1HQUA 2Q3SA 3VAMA 3UDEA 3LDOA 3DN9A 5D0HA 2IRYA 3G96A 2UUAJ 3O9UA 1E4FT 1VIXA 4I68A 4YOTA 4IEIA 1NKBA 1ICEB 1UJ5A 3CJ3A 1OIAA 5JLFA 4OV6A 4MH8A 3DXBA 1WD6A 4Z4IA 1N54B 4BRQA 1F21A 4M5MA 2RT3A 4DR2J 5JICA 2K1RB 3Q7CA 4LRDA 4QU7A 1U8WA 1RHKB 3K5OA 3Q0AA 3KKFA 4CEZA 3HPHA 4I67A 2BJ1A 1HLUA 3KWGA 1VQPS 2K7KA 1N5YB 1V5IB 4PQUA 2DNOA 4CO0A 3WDOA 1IJEB 2MQPA 3D4JA 1PYSB 3GJTB 3TP2A 3ZT1A 5AQFA 3EO3A 5C2GA 1TL4A 3SMZA 3RRKA 4FJIA 3SAHA 3EGWB 3MAHA 2KM8B 2G8HA 3ENAA 1KP6A 1G3OA 3W60A 5ETQA 4CZCA 1Y9OA 1SBRA 4A4JA 4DR7J 2B9EA 2XWYA 2W01A 1WEYA 3CCQS 1NGFA 1KXPA 4DMZA 5HLFB 3GQCA 2MPUA 3SDEB 4WP8A 4QPXA 2NXNA 1HX1A 1YI2S 2P9PB 4CFBA 1GQEA 2HYIB 4DQRA 4NLWA 3KK1B 2MLZA 5H9EJ 5J1EB 1UWAA 5IZHA 1R59O 1C1BB 3H4DA 4E7LA 2QZ8A 1RTJA 2VU5A 2Y1RI 1HL6A 1NJIO 1EJ7L 5B08A 2G2YA 4RW6B 3NCPA 5A8KB 4X66K 1TFYA 4H4KA 4FBTA 4Z4FA 4HHHA 1WTBA 4DU3A 1N0UA 1TV6B 4ZPDA 4ES2A 3OYIA 3U3YA 4CJQA 4FJNA 3SQ1A 3WXLA 5EVZA 1HR0F 2B51A 1HBUA 1VQLS 4M41A 1B9FA 3FBBA 4WE1A 2VFRA 4KRWA 2YHAA 4CHZA 2CYYA 2RQMA 5BN9A 2HFVA 2G9OA 4DPWA 1UMJA 2XEXA 1VK0A 1DZ5A 2R7SA 5H9EK 3HSDA 1X7VA 4DV2J 3CCLN 2YKQA 2PD1A 1AB8A 2XSJB 3O5TB 5J2NB 2D0OA 1IO2A 1LNQA 2CNNB 3N5FA 1ZTTA 3L3CA 5MLCV 3LGMA 4WFBQ 4IBNA 1EHWA 3P4UB 2AKWB 1JXBA 2LP4A 4WU3A 4ERDA 4PAAA 2LQJA 5EU7A 5FIIA 4AUKA 4DUZF 4F25A 3L2QA 4Q0BB 2BJ9A 3LPEA 1RSCA 3B54A 2E6MA 1N36K 3G6ES 1VMBA 4U67Q 3H90A 1S0NA 4PUOA 4BRGA 3J80U 4I6WA 4CLTA 2F4FA 4JLHA 2N3LA 4TKTA 4CT9A 4JK9A 1XK8A 2RU3A 3TAEA 1R27B 2CPHA 1UEKA 1Y3KA 3AARA 4EYIB 5HL7Q 1U1LA 1NDLA 2FSKA 2R8KA 4M5IA 3E3XA 4ED4A 3FCWA 3MR7A 3M05A 2HZAA 3FSIA 2B7BB 2DVIA 1Q82O 3ZSOA 4IKFA 3N01A 4L76A 1DQAA 2OP5A 4UQGA 1HNWJ 5F0XA 2JVRA 3BGRA 1HW8A 2BE9B 4XPEA 2MKHA 3FZBA 3CC2S 3DU5A 1VQNS 4I0WA 4KIAA 1HWUA 3VQBA 2V9KA 4CLLA 3LPUA 3TAFA 1VBXA 3T1YK 4NOHA 2W2MP 1YJWN 4WP9A 2DRBA 1WHVA 2UYTA 4JRQA 2CZVC 1YIJS 3T6BA 3GIJA 4Z37A 4NYFA 2W25A 3FNNA 2DHAA 2XWXA 3TJ9A 4CNZA 1NSKL 5KT5A 4MDBA 3IUCA 3DC2A 3TZYA 3LDLA 4U67L 4LR7A 1TKDA 2CPZA 2CQCA 4FK4A 2WFBA 3MD1A 3OR2A 4LJMA 3PRVA 5A8RA 4ITSA 2HHWA 2I2YA 4CNYA 3KHLA 1YJNN 4DFMA 5HL7L 5ETSA 4BCAA 3L3VA 3UR3C 1RWMB 2PIIA 5BYQA 2PO4A 3JTPA 1T9VA 3UKUB 4FK2A 5KFQA 3CD6N 4C3MA 2QYGA 4J9OA 3CEDA 4R8UB 2DFHA 1A5XA 5I9EB 3VPZA 4CHPA 1VHFA 1REVB 5ETRA 4DTSA 4MT1A 4BQLA 5DGBA 3DU6A 4FJKA 4X4UA 1HR0J 2CH6A 4XDCA 1RABB 2D41A 5KFBA 3CC7N 3GV5B 4AHRA 5IWAF 3OTOK 1QY7A 3O1BA 2P9UB 2Z30B 4C11B 4QPTA 3TAQA 4LREA 2FY8A 3G8SA 3Q22A 2P9SA 2BBEA 1NSAA 5E33A 2IM1A 3A13A 3NF7A 4LUBA 2KYXA 1SQFA 4IJAA 4DB3A 5C24A 4WFAQ 3ZT3A 5K20B 1RT3A 1GTHA 3MPUB 1RBOB 3DRXA 3OYEA 5KT6A 2IIHA 4UZCA 4IG0B 4LFAF 4P52A 3E9PA 1J2VA 2VH7A 1V3SA 3AFGA 3FZHA 3D2WA 1G99A 3GFXA 4EFAC 5AT1B 3I33A 1Z2ZA 1ZS6A 2AJQA 3NH2A 1RU1A 2XZTB 5E2QA 1WKLA 4NA1A 1MMNA 2QC3A 3IDHA 3DM2A 3P3DA 4WKRA 4LF4F 3CD6S 1N0VC 5RUBA 3BDEA 1XUPO 2ASDA 1F1BB 3VQAA 4ZVSB 1HNZF 3SSQA 5IV4A 1FDNA 1VQ8S 4DTOA 1W7WA 1VJWA 4H0PA 3TPQA 5M1KA 2ASLA 1RCHA 4GO5X 1EB0A 1H2TZ 5KFIA 3P31A 4N56A 1QHTA 5TKWA 3KJVB 2B4OA 2M0GB 4JI5F 4HTLA 3F44A 2VPZB 1VSEA 3OR1A 4ZJQA 4FVMA 5L1JA 1BQMB 4G6VB 1QZ5A 3WQTA 2V8HA 1FDBA 2P9NA 3TR5A 3L09A 3TZXA 3HLUA 4R25A 2CXEA 3BBCA 1SIWB 3M8YA 2V7ZA 2K1RA 3U27A 4KYZA 4DUYJ 3H1QA 2VG7B 3AOBA 5DG8A 1FEEA 5GMDA 2G0CA 3R8EA 4YY3K 2MYFA 1FKOB 4LRBA 4X64F 4JHDB 3SBMA 2CH5A 1AUDA 4CT8A 3EZWA 3LP2A 1VQOS 3RBXA 2R7OA 4K0KJ 3FQKA 2X6NA 3ATVA 4K0KK 4Y2MA 2KTQA 4OX6A 2GX8A 2RHKA 1UZDA 1SCJB 1MWYA 1YVNA 4OYWA 3E51A 2BABA 1KVJA 1T94A 1XEZA 4YFUA 2YBVA 4R79A 1LW2A 4H5VA 1K47A 2W42A 4ID5A 2GMHA 1TQLA 4X65J 4FKXA 2HFNA 2DCUB 3DDNA 4B08A 1NK6A 3PSIA 5D3GB 2H3EB 2YJEA 4B9TA 3ILIA 4PXEA 4CIGA 1T3VA 1R6YA 3BP8A 4RW7B 5IC4B 3ELHA 2IIRA 1RISA 2LQ9A 4IRDA 1X3NA 5KFRA 2BOPA 2QYCA 5AZIA 4K4XA 1PJ6A 4UOHA 2A3ZA 4OYMA 1O8BA 5EXWA 3GIMA 3AVCA 1TKXB 3GIRA 3HHDA 2QKBA 4ZITA 3K5LA 1WOPA 2N7YA 4B3OA 3HZGA 2YNGA 1UW9A 1W97L 4QW9A 2HNDA 4OHZA 4XIUA 1R89A 2CGKA 1RB0A 3Q8QB 2QL5B 1WSJA 3P6YC 2R2UA 3RB6A 1MW7A 3VQDA 1TAUA 1VQ5N 2Z1GA 4KH0B 3U6FA 3H8YA 4FLWA 2HZCA 1K44A 3MEEB 1Y10A 4FNIA 3U7JA 1UL3A 3OVAA 4K42A 2DGUA 4DBQA 3KLGB 5FROA 4AXJA 4GMKA 5AQKA 1S1WA 1UVJA 2CIMA 2NSCA 4ZVRB 2PN6A 2XMVA 4GVLA 1V9OA 4FWKA 3PFEA 3DRPA 4FM1A 1T9UA 4J9PA 4CIFA 3H5SA 1S1WB 4JI0J 4WQ4A 1GK8A 4HYKA 1ZH5A 1FKAF 1I94K 5LT5A 4A5AA 3N5BA 2ATQA 2W4PA 4HTJA 1IBMF 1KVAA 4BRMA 1U04A 3MEDB 1NH7A 1UAWA 2V7YA 4CLZA 2QEXN 3KJNB 2HBQB 2Z57B 4AT1B 1CJUB 1B3TA 1E4GT 2PMHA 1RT1A 1Q8KA 4GC7A 2YKPA 3V9XA 2D7SA 5AQOA 4NLBA 4M7XA 2HKEA 3TAMB 2CUYA 2BQRA 1KAYA 3HTVA 4CJPA 2AHOB 3ZEUA 4LF6F 3MTKA 4B1XB 4BRLA 1KD1T 4DU8A 1UETA 4IFVB 2MQOA 2ZH5A 3VHQA 4O3PA 3E66A 3P5JA 2DY9A 1RBAA 3W9JA 2Q3PA 3KDNA 3W5XA 1AFIA 2ZJQL 4V1Ak 4Z2XA 2BJ8A 4BDYA 4DR5J 3IM8A 3EDRB 1K8AO 2RVJA 1FDDA 3M8PB 4JOUA 1F3VA 3CMEN 4J5OA 4CH0S 3I55N 3PKMA 1N5TA 1N4LA 4OI2A 5C0YA 5G0RA 3ISNC 2JWNA 3UCUP 4FLZA 2CZ4A 1R43A 2PYLA 2WB1D 5HMWA 3C6TB 4MO5A 4WFBL 4OYZA 4RKUC 4IXCA 3R7SB 1ZBHA 4FJGA 3R6MA 1TKTA 3GG4A 4J37A 1E6VB 4U6PA 2WSFC 4AHUA 4DV6J 3CYMA 2DR5A 3M2UB 3NMAA 3OS1A 2UU9K 2YQ0A 2ZZTA 1JMTA 5HVGA 4PEOA 1OH5A 5ETLA 2EBGA 4IFYB 4AQYK 4IOAQ 2Z0GA 3H0PA 4IFYA 4YOEA 4B8AB 4DN0A 3ZSQA 1WOOA 2FLOA 3VA0A 2NPIA 4Y1CA 3C14A 3JXOA 2GHPA 4N8OA 4DQ8A 2W6KA 1QAXA 2FDNA 5GAHP 1FF2A 4CLPA 2ZOGA 4CFCA 3CXCR 4DR4J 2Y1JA 1CEZA 1RAHB 3PX6A 2KQ2A 3AT1B 1RI7A 2IVYA 4DL5A 2HIYA 2RMLA 2ADCA 1VSIA 1ZM2A 3M32B 4NXMJ 1R0CB 2FVRA 2BYCA 4OZ3A 1KWMA 5EOYA 5HMXA 4FLTA 2KO1A 3RBZA 3BF3A 4P73A 1N5VA 3J7ZO 2HQFA 5EX0A 1OSDA 3D45A 4RUHA 2LXUA 1N8RO 1VQON 4I6MA 4HUEA 5CYMA 3J81Y 3QT8A 2FJBB 2QA4G 2C42A 4EO6A 4FF1A 3O44A 1ELOA 3K17A 1VQKS 4CGFA 4H0TB 3HRGA 2BACA 1CJUA 3C3LA 3TUPA 1M5HA 1HLWA 2E2NA 2OLWA 2GNKA 5B7WA 1WF1A 2RQ4A 3O3GA 1KDNA 3DNCA 2G8UA 3D7SB 4LT6A 1KTVA 3OHAA 4Y00A 3ZSRA 2X78A 2NREA 1XTZA 2OFGX 3AO5A 4K8XA 5GADU 1ITPA 3QRPA 1NHKL 1RT3B 2MKKA 2BMBA 4B9NA 1RWPB 4JEPA 3PIPL 1ZBTA 3VQ7A 3IR7B 3VTIA 2MGZA 1EWRA 1ZA2B 4WQ4C 4KBIA 2PA3A 3THWA 3EPIA 1OY6A 4OMFG 3I0SA 4NRTA 3QNWB 4HLBA 2P9SB 1SVDA 2DITA 3BV8A 3K57A 3TU5A 1LAWA 2E5LF 2B56A 3US5A 4DR1K 1I94F 4Q2LA 4O8UA 2UUWA 1IWAA 2RNEA 4MK9A 3R9LA 4GKJJ 1NGHA 2C2RA 2YHXA 3VVUA 3I9V9 1N33F 4FJ5A 2VYPA 4GVMA 2QMWA 4Z7CA 3KLEB 4NLPA 1OPZA 1M1KT 4YQWA 1RHRB 1WC4A 3MN5A 2FHKA 4ED2A 4PYAA 1JLCA 4UOGA 4LY7A 3AGRA 4L3QA 2XGPA 1H1VA 3CFOA 1JLBB 1SJ1A 2GC8A 1ROFA 3WNEA 3KLVA 3RAXA 1CJTA 1MWZA 1VQKN 2L9WA 3L2UA 2XULA 2YHBA 4M5GA 2ZEJA 4CF0A 3A3PB 2R7TA 2LKZA 4ECWA 2D3ZA 2V69A 4CO1A 2FGCA 2AP1A 3NH0A 1GOAA 3TR8A 2O66A 2OJ3A 5ELZA 5M1OA 2B4VA 3HO1A 4USWA 5C25A 5F3TA 2MQ8A 2JWKA 3BPSP 4PG5A 1UZHA 3U8XA 1PBAA 4PUOB 3NHGA 2BW7A 5IS2A 4J9SA 3V1RA 2CJYB 2JEJA 1YJRA 1WWHA 1ZZFA 3HX9A 3IFRA 4FK0A 2O4GA 2JDJA 3SAFA 1JJ2R 3SQGB 3ICLA 3Q8UA 2K3IA 3K2PA 3I5BA 4DU4A 3THVA 5E0OA 3J7ZT 1EQYA 4YDUA 1DAXA 2YQ1A 1VSKA 1AT1B 4XK8C 5M1NA 4U7CA 2XMWA 2DO0A 3K8WA 2JEGA 4J8FA 4WCEQ 1JLAA 1PSDA 1S79A 3UIQA 2HQCA 3AJDA 4ICLB 3DXKA 1GOCA 1EIYB 1VRUB 2CNLB 5AQQA 4WJBA 2FBTA 3POTB 5DGAA 1C0TB 5F3ZA 1HBMB 4LMZA 4F8RA 4FSVA 3EVWA 2ZC4A 3H45C 2VCPA 1CULB 2NCKL 1Z25A 2DT9A 3LPTA 3O3FA 2P6SA 2HOEA 1RBLA 4C6AA 3NH1A 4UZBA 1CQNA 4OZNA 4BRKA 4YY3F 3T5LA 4IH6A 4JP8A 1HBUB 3A3OB 4HHTA 1Y00A 5T7LA 4PWUA 2B4UA 3VESA 1VIOA 4MAKA 4LF9J 2MKCA 4ANEA 3GR1A 2DIUA 2GEMA 1O5JA 2R2SA 2ACMA 4H54A 4IR1A 3M32A 4CF8A 5H1SQ 3S3NA 1R7IA 4CHQA 1Q53A 2J0QD 4ZHRB 3B6PA 3OVBA 2NPFA 3HHNB 1TFWA 4Q43A 5F8LA 3UVJA 4ZCLA 1FO1A 4B1WB 2LECA 3TRGA 1FRIA 2R7RA 1SQKA 3H98A 4V19J 4CF9A 3O5BA 2QXLA 1Q7YT 1KSPA 4YB5A 4JI2K 3TARA 1ZOTA 4ZPTR 4RNOA 1HKBA 4PR6A 4H0OA 1JX4A 3AD7C 3WBZA 5E3QA 2IJNA 4C97A 2HVIA 1S9EB 4OHXA 3CMAS 4U7UD 4O3QA 5A2QU 1OQ6A 3HI9A 5LMUK 1P1TA 4F2RA 1C1AA 4CM2A 4WK1A 1RDUA 4M5KA 4JKHA 3BBFA 2BM1A 3Q89A 4OKJA 5MAOA 2IM2A 2R2RA 1CLQA 2IFXA 3AA3A 1L3UA 2E5GA 4FXVA 3VQCA 1F60B 5D0EA 3HFVA 1TL5A 4ZA1A 3KYLA 4KGZB 1RAFB 1HBMA 1RGVA 2ZM6F 2Z2LA 2QWPA 3AA4A 4HDHA 3GLJA 2HF4A 2M52A 4KSEB 3TA2A 1C1BA 1F5BA 2I38A 3MOJB 3H2VE 4JI3J 2B9XA 4E7KA 3KLFA 2M2BA 4DR4K 3UE5A 3GFZA 3C66A 1NB7A 4E2FB 1FRKA 3LM9A 2PMWA 3NNHA 1XNQJ 3VEOA 4YDDB 2ZH6A 1VQ6S 1HNIB 3CF5Q 1Q7LB 4FPBA 4H4OA 5D4PA 4J9VA 5A6PA 4A2BA 3ZO7A 3WUHA 1KAZA 1FI4A 5KT2A 4I9QA 4OX7A 2DNZA 1X4HA 2CPXA 2U1AA 4LFCJ 4JI1J 4NE9C 2H5EA 1NK9A 1KVBA 5D4OA 3CCMN 4CW7B 3SI6A 1WKKA 4XH5A 3DJCA 4G65A 3VV2B 4GV3A 4N77A 1A5VA 3IMQJ 4ZTFA 3UW1A 4EP5A 3CMAN 2UVRA 2Q6CA 2L48A 4G1QB 4LF5K 1C6VA 2FZKB 4C3KA 1VRTB 5BN8A 4YDXA 3KG4A 4M63A 3OD2A 3EXYA 5IXUA 3GE1A 3UQSA 5LJ3Y 4KPYA 3OYJA 2VBXA 1J5EK 3NWGA 3CCUN 3WEEB 3UI3A 1IBKJ 2OPRB 4YB1P 5KRTA 4M3ZA 5AZJA 3UCGA 3BGRB 4F4KA 2VONA 4NXNK 1FJEB 1NUEA 1LV5A 2ASPA 3MM8A 3U1MA 1PIEA 2GA7A 3EE3A 4DV7F 3I96A 1IBMK 1ATSA 5HJXA 2H4WB 2D0AA 1MN9A 4USIA 4DL4A 3M8QB 3VEXA 4DSEA 3CCVS 3UKRB 2O67A 5HVHA 4Y3CA 1GLBG 3TSUA 2ZNYA 2NUBA 3OBWA 5FLXY 3KLIA 4YDUC 2RRAA 2C3PA 3OFGA 1MU2B 1RKJA 1IR2A 2GAGC 4LF5F 2VBZA 1X5TA 4CZFA 2D1CA 3THWB 2H48B 2Z4PA 2BVZA 4LVNP 1RLCL 1Q1KA 4I6MB 3DXSX 1RYRA 2DGSA 2AIRB 5DQIA 3O08A 2ZHAA 5ADXH 2E2PA 2RJZA 3X3UA 2CVIA 5KG1A 2HFUA 3O3LA 4ZMMA 3PO4A 4K4ZA 1IH7A 4BACA 5I3UA 1FWPA 4FPRA 3O9SA 2XRIA 1CJKB 2M88A 4EMDA 2MLXA 1NDKA 2JEIA 2P9LA 4QOTA 2V63A 4I7FA 2A2DA 2MZTA 4BGBA 3IR6B 1XIQA 3H08A 3CE8A 3ZXWA 4TXSA 1RTHA 2LQ5A 5JVHQ 3SCJE 5LL6d 5AJ3J 3OS2A 5KG5A 2QWNA 3JAMY 2EWSA 2BKPA 3CDUA 2ZM6J 4DF4A 3H46O 1U0HB 2A0FB 3OYFA 5DG9A 2XHBA 4NMXA 3IWLA 3CJ4A 1FFWB 2JWLA 1P27B 4NRUA 4RG8A 3BBBA 2NXCA 1CZBA 1OSCA 3C7NB 2OA8A 4X4PA 2ASJA 1DURA 1LK5A 3D2EA 5LSRA 3CCZA 3OXFA 1SZ2A 4FZXC 1JLFB 3AGKA 2ZOMA 3CI5A 2HAIA 4TYAA 1MNEA 1HNXJ 1JLGB 4Q7AA 5D3GA 4ZPBA 1NDPA 4B9VA 1FD2A 1FRHA 4ECRA 2M8DB 2YWEA 4CRJA 2P9NB 4IOBA 2C2KB 3K0SA 5AQGA 3O2IA 3S3MA 1S1XA 2FF6A 5F8GA 4DR5K 1S6OA 5A8WA 3P5TL 4ELUA 2DNKA 5M1FA 4ECZA 3MR2A 3PIPQ 2D69A 2VFTA 4QWBA 2QXFA 3LDNA 1T9WA 2V50A 2KB2A 1RAEB 4BVPA 5CYQB 3O6WA 3GYGA 1KFSA 1HWKA 3R5GA 1BUPA 3OVNA 2Y3YA 3VEVA 3MEKA 4BE0A 1S4FA 3SAGA 2ZVSA 5B0AA 4NI2B 3RW6A 5K14A 2EKNA 2AYMA 1EWQA 1YI2N 1B92A 2MQQA 4DTMA 1UW4A 3NCIA 1T8EA 1MROB 2IJFA 1U24A 3NEKA 4USUA 1FE4A 3Q23A 1VQYA 2WK4A 3J7AP 4GY2B 2VQFJ 2KLAA 4JI0K 3OHBA 3Q8PB 3OXGA 2ZH8A 4OO1J 3QEXA 1JXLA 3JQMA 4ECXA 3ULHA 4QW8A 1K0VA 5AQSA 3AO1A 4BRHA 2RDIA 4HWIA 2ZKUA 4LF4K 2RIJA 3J80O 2Y0BB 1OH7A 2G0JA 4FJHA 2OO4A 4CEDA 3MAAB 5AQHA 2RN2A 4ED5A 4M45A 1GX6A 1PILA 3QZ7A 2GO9A 4ILRA 4C8ZA 4DQSA 4JD2B 4FM0A 3FZ2A 1MWKA 3OQ2A 3G10A 1VSLA 4C11A 1RT7B 2ZGZA 4Y2IA 5ETTA 1IKXB 4GNIA 2J8AA 4F0KA 2XY7A 3TEHB 3M4XA 5IFMA 3QJLA 5JS1A 1CC7A 4BR4A 4FF4A 2ZUGA 2FPHX 2O8EA 2HHPA 4TNOA 4OKKA 2J7KA 4N47A 4F50A 1H74A 1N5QA 4WCEL 4NLUA 3A4TA 1WNEA 2YKMB 3WEEA 2CQ3A 3I32A 1VBKA 5KGXA 4XO0A 3BO4A 2DR6A 5DJBA 4AXIA 3BGFA 3BGUA 3WT0A 2LVWA 4X4SA 4GW6A 1B70B 1S0OA 3EVMA 2W9CA 5H9FJ 4ES3A 2W8LA 3TZWA 5HVFA 1WLJA 1M5KC 3HD1A 5CY4A 2O01C 3W66A 4TN2A 3AODA 5IV3A 4RW4A 2B0GA 1SKUB 1N6QA 3CSKA 1NU0A 4QS9A 3HD2A 5CD4H 2I0XA 2C2MB 4QAGA 3SQ2A 1YBAA 4FXWA 3L2WA 1GMUA 2YXLA 2CDQA 2HFOA 1LWCB 3F9KA 3MCOA 4JV1A 4UF4A 4NXNJ 3VTHA 2VJUA 4J90A 3A5MC 4KHWA 1PYOB 3C94A 1WTFA 4CO5A 3AAWB 2IGIA 6FD1A 3KLHA 2LEBA 3JSMB 4P10A 4N8NA 3CJ0A 4OGEA 1BHLA 3GSIA 4TU9A 3M7VA 4DR6K 5E3RA 3AY0A 4LF6J 3ENHA 4WPAA 3CW2C 4Q5VA 2HGLA 2I7NA 3TWZA 3OYCA 4H4KC 1D1UA 5K14B 4NCBA 1Q5YA 4X4OA 3KD5E 3P38A 2OD4A 1C1CA 3S8SA 4K4TA 3C6UA 4X65F 3NBPA 2VZ9A 4K2XA 2CQBA 2JVOA 1KN6A 2F8EX 2GFFA 2W24A 2KN4A 3AO2A 1X5OA 3L2RA 4LSNB 1LXJA 4USHA 3PDNA 3Q83A 2MJNA 4OZ2A 1NKCA 2OANA 1GLFO 1S1UB 5EY4A 9RUBA 3D67A 2X6SA 4NYPA 3BZCA 1XNQK 1NH8A 4DX6A 5ETMA 4MMOA 2HQDA 4U7UK 5FLXO 3OYGA 3W0LA 5AQRA 3M1FA 3Q8YA 1QS4A 3GILA 2E66A 1X4BA 1YJ9N 1TGOA 3WZ0A 5DMRA 4B3TK 1RDAA 4CZLA 2DNHA 3DOKA 4FYWB 2L9NA 1TK0A 3W61A 3EXCX 3UD3P 2MB0B 2RF2B 3PW7A 4LFCF 4JI4J 4X4TA 4IZ9A 2F4VK 4DXLA 3T69A 2RHSB 4P2SA 3PW0A 2H51B 4WK3A 1IBKK 3P49B 5LM7E 2FBXA 2HBZB 3W9HA 2WTUA 2HHSA 4RNHA 3D5MA 3NKYA 3ENQA 2CGJA 5DETA 3W7BA 4ECYA 2DIVA 1TL7B 4ZP7A 1W25A 1XBWA 1ZA1B 2FJWA 1IKVB 4BWJA 2ALYB 5C12A 4QIFA 1H38A 1T02A 3SJJA 4CO2A 3PLAA 4QU6A 4I7FB 2CQIA 4MLEA 3TWHA 3N4PA 4CF1A 2QWMA 1FJCA 3BSCA 2HLUA 4M3RA 5CAAA 4A61A 3D6TB 3QB0A 2F4VF 2GIRA 2DEIA 2XMMA 4DV3F 4EAHD 1G1XA 3S7RA 1F0XA 2ZWHA 1SJ4P 1T6DA 2KHOA 1SC3B 4OX9J 2WONB 4NCGB 2C3UA 1X0FA 3BN7A 2EFNA 4RWTA 5DM6Q 1VS3A 4ZVOB 4EK2A 2E1MC 2VBYA 5KT3A 3OL8A 5F41A 5A8RB 3CQ8A 4E7IA 1XR7A 4LF5J 4N41A 4OI3A 3CJCA 4F4YA 3VQPA 4FYXB 2V6AA 1SB6A 4RBVA 4BREA 4DOZA 2IRUA 4F0HA 2GZOA 3KDOA 3CFRA 3LP0A 1RLDA 1H73A 1FEHA 4JUZA 5L39A 1FESA 1QQNA 4CIOA 1JLAB 2D3UA 5ETOA 3DRSA 5I42B 3AVHA 5AQMA 4EFHA 1CJTB 3NVMA 1HHSA 2E9TA 3ZSVA 2JSXA 3SQGA 5IM0A 5BYRA 2QJ3A 2W7AA 1YF5L 1Q8IA 1S72N 1VOMA 4AHCA 2N4CA 2F9DA 4FYDA 5IT9Y 1VK8A 5T41A 3BQ0A 2AEFA 4KV8B 5GINA 2W8KA 3VOVA 4NLYA 3TAMA 1JWWA 4FF3A 3H6EA 1APSA 4KHSA 2X1FA 1YJUA 4JI2J 2AJ0A 3W3SA 1U1OA 3K58A 1OH8A 3R5DA 5GADP 3HOTA 5C25B 1OVYA 1P8GA 3SK3A 1DTTB 1RBVA 3O4WA 2NS1B 4K5SA 3VAKA 1KFDA 2C3YA 2A2CA 3QJJA 3F41A 2QFIA 5CZ2A 2CFXA 4ALZA 1J5OA 3IM9A 3HP9A 3D1HA 4N76A 1WG1A 1J5EF 1HKCA 5L9NA 4JI1F 1HQEB 5J1PA 3MDFA 4QQBA 2HBMA 3HZ6A 4Q0BA 4MIAA 3H5YA 4FZZA 3SZ2A 3BPDA 2ILYA 3CVKA 4CLYA 3RU0A 4B3SK 2DH8A 3DHWC 1NLVA 1GXUA 4DPOA 1T7PA 5EX5A 1NK4A 1F9FA 1XN9A 3OYDA 5AXNA 3H3NO 4CTAB 2HHHF 2IDLA 3WQUA 1NOYA 5KG0A 2WOMB 2WSEC 1S9FA 2RDJA 5LMNJ 4P71A 2FJEB 3SI8A 1WSGA 4A62A 4L73A 3LP1B 1DHMA 4IH7A 1S6QB 4PPZA 5I4MA 3THYB 2HFZA 3GCXP 1HPZB 3S1TA 3AVMA 3WXJA 3BGLA 1VQ9S 2XTJP 2HNDB 3A8EA 2YKMA 1OWXA 2MZSA 2XI2A 1ACMB 3QO9A 1S3XA 4YOWA 1RBSA 4ZVTB 1H72C 2QSFA 3AVBA 2QTWA 3BR9A 3QMLA 4BRCA 5LMNF 1RILA 3MECA 3PW5A 4J91A 4CJVA 1J6ZA 2ASOA 2Q0UA 1GLAG 2XM3A 2XHWA 2MXYA 4TU7A 3MX5A 4PZVA 4Y65A 3OLBA 3AA5X 3LGHA 2UXDJ 1FK9A 3NXZA 3AVIA 4DX7A 5BREA 5AR0A 2HGMA 5FDLB 5FLXU 2FVQA 1F6TA 3V81B 2FF3B 5KFLA 1O51A 1RHUB 4LF9F 3NAIA 3TUJC 4KRFA 1AROP 2KM8C 2P9PA 3W8GA 2YPZA 5IT9O 1NBWA 3HXMA 3HPOA 3F56A 4R5PB 2W4CA 4ZVUB 1S1UA 1DQ8A 3RVCA 2HNZB 2CPYA 4GC6A 3HF5A 2QG9B 1BQNA 4YN3B 1VSHA 2F63A 1GLCG 2BKNA 4X62K 1T03B 1GEHA 3CM6A 3AVAA 3VEYA 1QZ6A 1J53A 4F4WA 5IC6B 4JI5K 4CEEA 5EWGA 2UXBJ 1AW0A 4NLQA 3KG1A 1TKTB 2ZE2B 1X4FA 4URSA 3FKBA 4CJWA 4KY3A 4K4SA 3DAWA 2UUTA 3RZAA 2P6TA 2CJQA 3BREA 2G4BA 1JQGA 4DR2K 2YWGA 2XLJA 3K7RA 4O4RA 2VFUA 2KXHA 2KT3A 3CC2N 3MM7A 4OYIA 3Q7BA 2XC9A 3FDSA 2J6SA 1RWVB 3ULDA 5HROB 4NLOA 2E88A 1NGDA 5BPLA 3H2UB 3CJ1A 3SPZA 4I2PB 4XPCA 2VC0A 2PFDA 4ZP9A 2W4DA 3CTRA 4PG7A 4LSNA 3D66A 2HRUA 2P5VA 4Q8FA 1IR1A 4P2MA 4NYOA 2AA4A 1S1VA 3V6KA 2P9IA 1M5VC 4LVOP 4BGAA 3KHRA 1YJVA 4JV2A 2IYGA 4CVNE 3CMQA 3MURP 4JI6J 1XMOK 2G2OA 4O3OA 2DFEA 2Q1LA 1CBKA 4GKJK 4JAXA 4LF8J 1WELA 1VI7A 5KFKA 3AA8A 4BRNA 4JN4A 4DR6J 4KTWA 2GVDA 5JLHA 3DLRA 1RT5A 2HWHA 1RAGB 2HB5A 1I1GA 4WP3A 2QM1A 5AFUA 2YH0A 3TX0A 4CJTA 2Q66A 2FJAB 5IT4A 5F0UA 3OTOF 3PXGa 4JRPA 3W5ZA 2G8IA 4JI6F 4CK2A 3L7PA 5D0GA 3J7AN 2JZ5A 1LEOA 1YVFA 1HBNA 2NRZA 2BXJA 1EETA 1RA7A 4FL9A 4C7QA 3QO9B 4CEQA 3EJMA 1HPMA 4F3TA 1SKWA 4B9LA 4ETZA 5AQYA 1XNRF 4B3SF 3KMSA 1NPPA 1BY9A 3H25A 4HI2A 1RHMB 3K2YA 3ZZRA 4E98A 3LL3A 4FJXA 4FW1A 1SPBP 1YT3A 4CI0B 5DDPC 2M4MA 2NQPA 2W41A 1ZPVA 2I5JB 4OLBA 3TOQA 1T11A 4USJC 1EKEA 4BR9A 1VQ4N 4KFBB 2ZJQQ 3AJ2A 3E1YA 3CC4S 4HACA 1VGYA 3VEZA 1Q4RA 2CQ1A 4ZJLA 4FPIA 2IAJA 1EETB 4NA2A 5AJ3F 4C0BA 2OPRA 4KGVB 1URRA 3HI0A 4IG3A 1CXUA 1OO0B 2G1HA 3N0VA 2QA2A 5KQDA 4CJ5A 1Y5NB 2VGNA 5L9XA 3CDBA 1GH8A 2XCAA 2B8PA 2LFVA 3BYRA 2HIQA 2AF6A 3PYFA 2NXEA 4ZJOA 3CJQA 4B9QA 1Q7YO 3ZTRA 3ZFVA 3MUVP 4J2DA 2UXBF 1SC6A 1QAIA 3G6XA 3I55S 1I6JA 2J0SD 1NLKL 2J7UA 3U9ZA 4NLSA 2YNGB 1NHUA 2QN6B 4IDKB 1S1VB 2CADA 2V0NA 1F2HA 2HBLA 1GMWA 1P6TA 2Y9HA 3G8TA 4CYUB 4WFNQ 1N36F 5HBMB 2VPYB 1FRMA 4XTTA 1IBLK 3FZKA 1FKOA 1HA1A 5FRNA 3JS6A 4JKCA 4DUZK 4WYBA 1VQ4S 4DV1K 1HI8A 1XMQF 4FCYA 3MM7B 3SJHA 1S49A 4DI6A 2HMIA 4ID5B 2EKYA 1NJYA 2WC9A 3JTOA 1LW2B 2DNYA 1RU2A 4TLRA 2R7WA 3EUNA 3ZTSA 2QT7A 5KRSA 5CHIA 3JSRA 4BE2A 1BD6A 2OPPB 2VG6B 4EGLA 2CAJA 2X1AA 2ZGYA 4CLKA 4CH7A 5DM6L 5CZVA 4BC9A 4L72B 1KQSM 2CDRB 5ETKA 4Y34A 3MR3A 2HVDA 4F4XA 3ZTOA 1T44A 1HARA 1K1QA 4B3MF 1S9EA 2H3GX 1MN7A 3SCXA 2LEPA 4RX6A 2CRLA 4YY3J 1IBKF 2A42A 1YX2A 3QT5A 1BXNA 1UVKA 1DTQB 1RCOB 1NG9A 1FW6A 2UV8A 1NU4A 5GAEP 2NZCA 1VQSA 5L1LA 4DSLA 3JQJA 4UUXA 3MMAA 4GRSA 3MN9A 1UA1A 1TL1A 4F02A 3IAS9 3PHEA 1HNXK 1RWUA 1CC8A 2WVCA 2X51A 4AQYF 5J2PA 1TK8A 4MK8A 3T1HF 2Q79A 4FS2A 1U09A 5C7PA 1H2UX 3KZBA 1UKUA 4X4RA 3ZSXA 3TJ8A 2E1RA 3FMWA 1QAJA 4CYUA 4F3OA 3VN5A 1S7HA 1BQNB 4HH0A 3M9MB 1SJQA 4CHNA 3Q8RB 3ETMA 1Y64A 3I4HX 4UT4A 4X4NA 3EE9A 4E19A 1TV6A 3RMAA 4USTA 2GX9A 3GFYA 3GPAA 2LQBA 1F3FA 1SQEA 3OTEA 4Z7YA 4CE9A 4NO7A 4X65K 4GVBB 2DKOB 5HP1A 4JV0A 1HHTP 1FJGK 1FK9B 3ASMA 3AVKA 1BL3A 2NYHA 5KFSA 4IRCA 2W1BA 1RAIB 2DXDA 5F8JA 3VENA 5BPMA 4IDHA 4CHYA 5GAEU 2KXNB 1WOSA 3L8BA 3ZSZA 2HS0A 2H5JB 4OZ1A 5M1PA 2N3OA 2B6AA 5DDQC 1WC5A 3ZZZA 4K25A 5HQMA 1L3SA 2E20A 1H3DA 4M8LA 3CIMA 2W7PA 1RDWX 3JQKA 4P2FA 1VLOA 1XMBA 4FWNA 4PWDA 2N4DA 4OJ1A 1CULA 2HQIA 2IJRA 2ZVIA 4OJ3A 4DUYK 4MFBA 4A47A 5HANA 4QOZB 2OIHA 2Z1JA 4QZVB 4CZIA 4G9ZA 4G1QA 4ECUA 3T9NA 2D5RA 4CK1A 2FZGB 4QIEA 3DOLB 2F9JA 2DCLA 2M7SA 3PW4A 3M8RA 3LAKA 2I8EA 4A2AA 5IQ6A 1B0PA 1R0AA 1VQ7S 4DV1J 2HK2A 3LZIA 3AD9C 4FDFA 1REVA 2HBRB 1UJ4A 4BE1A 1DRZA 2ROPA 2OTJN 3SMSA 1OVQA 1TMJA 4ELVA 1VQMS 2AQ4A 1DEJA 3VQEA 5GIOA 1N32F 4QCLA 2FHJA 2KL8A 4URQU 1NEEA 5KFMA 2HVZA 3MR5A 4DFKA 5AZIB 1RWOB 4RPFA 1FDAA 2WVFA 2JH3A 3PTWA 4H4MA 1Y3JA 1XHXA 4GO7X 2BJEA 3UN2A 2XMAA 3R1HA 1U45A 2PMZD 2JC1A 1G4CA 2XY8A 4ANCA 4FWQA 2DK2A 3CDEA 3HT0A 3C16B 2XO6A 4X2BA 4ETXA 2C28A 5HQLA 2OEMA 2X1BA 3LWLA 1D3WA 1U26A 3UWTA 4A8YA 4JI7K 2YNFB 4BC4A 1NSQA 2UUAF 4O0IA 3TW0A 4F4AA 3L95X 1O0PA 2F8HA 2D1KA 1WC3A 5IM0B 3KK3B 1N33K 3BH6B 1WKJA 3M6UA 3GMGA 4KHRA 4K4YA 5FPEA 2ZH4A 2YWWA 3CCEN 3EYZA 2VQFF 2VFVA 4UOFA 3ZYYX 1HNWK 4KO0B 3B4MA 4NEYA 3IFEA 3KLEA 2VL1A 4A8SA 3RB0A 1XERA 1XMOF 5A76A 1B7FA 2DHSA 4AD6A 3KLFB 3KWMA 3P4IA 2NUUG 3HJFA 1KNZA 3FMBA 2ZNZA 5CCMA 2W9BA 4DL3A 5AE3A 3KUEA 4DX8H 3TA1A 4J9RA 1IKWB 3AVNA 2GJFA 4USMA 2OUGA 5HAOA 4WE1B 5A2QY 2J9DE 3ZNJ1 2WZ1A 1VDHA 2MGZB 1RJJA 3J7Z5 3T6JA 4NCGA 2BTFA 4X62J 4FJMA 3M2VA 2GJ2A 4E7JA 1FXLA 1VISA 3D7EO 3VWSA 3BO3A 1UAXA 1CLFA 2W7OA 4KH6A 3FFIB 2HW3A 4BVOA 3QIDA 5J2NA 2ASMA 3OTOJ 2KFZA 4DR5F 3QFWA 3CF5L 2XYPB 3P45B 4JKGB 1WEZA 4X62F 2GO8A 3R3LA 5KQ8A 4CESA 4C98A 4F26A 5CR4A 2ZH3A 2IDEA 5AQJA 5GVQA 3LF0A 2FXUA 3OXLA 3T1HK 1KR4A 3T1YJ 2YKAA 5J2MA 1U6FA 3CIPA 4B3RK 2R2TA 2V8VA 2VOOA 4KH4A 1NGGA 2ETJA 4A57A 3EGNA 4OFZA 3T19A 1TUGB 1EX8A 4HUFA 3NGUA 2OSRA 3PJWA 1CG2A 3GCWP 4TYBA 1OPIA 1LOUA 1HPZA 3C0BA 3RW7A 4DQQA 1X5SA 3FBCA 5LJWA 2AX1A 1KS2A 1X8DA 3QGIA 1G15A 3H5XA 1M1HA 2QI2A 1C0TA 3K5MA 3RMCA 3UB5A 3NE6A 2GS8A 4WFXA 4W5TA 1A5WA 4P6QA 5LMNK 3KK1A 5KFXA 4LSLB 1WC1A 3C16A 3MCMA 3VVTA 5GADI 3N6NA 2OGUA 2CPDA 1T9TA 4BS2A 4YOUA 3N4WA 5FD1A 1JLFA 1N36J 2PT0A 4M94A 2RS2A 1LWXA 4YR0A 2KZZA 5BXIA 4RNMA 4E0DA 3R2CJ 3ZZYA 5KFWA 3WC0A 3S3OA 4M5DB 3UKUA 3MCSA 1LWEA 4AFFA 1U1MA 3VF6A 2KZMA 5M1QA 2HHXA 2PZSA 1NGIA 4ED7A 3NNAA 4IDKA 4WQ5A 1C4CA 3FK4A 4A5BA 1RT2A 3AAQA 4C8YA 3LDSA 4O44B 3MMCB 3IG1B 4DV1F 4CJKA 2YWKA 3L4QA 3SUOA 3VGTA 1UVMA 4P7TA 2JEFA 1A6LA 4CJLA 1RTHB 3T5KA 1IN0A 3J8AA 3D0HE 3WXKA 2DGXA 4DV0K 1RZMA 4DV0J 2OH2A 3QFUA 3HVTA 5F9LA 3VGMA 1R6VA 4O3NA 3D68A 3SUPA 3NF8A 4HT7A 2JC0A 4LBHA 3LH2S 3AVFA 4ZP6A 3I0SB 1B0TA 4CWBA 3PX4A 3V1QA 4DCHA 3FE1A 2XMJA 2XSFA 3VGVA 2XY5A 3M2RA 1Q81O 1XHZA 2GVZB 1K9MT 1FVSA 3C8YA 4LFBJ 2KJWA 3H59A 1N8RT 5I42A 4DU1A 2PSZA 3ULEB 4DX5A 5FPNA 3M30B 2GTDA 2J76E 2J9DA 2OKQA 4K5RA 4BQZA 5JVHL 4F3QA 4DSJA 1MDUB 3CD0A 2B4JA 4ER8A 1LOTB 3OFFA 1IKXA 2PGCA 2NLWA 4KV8A 4IYQA 1OMSA 4TQRA 4OPHA 2NR0A 1JXVA 5KGWA 3WC2A 1KHVA 4ZIWA 3G6VA 1FJ7A 1ZETA 1VK3A 2IOCA 4CI6A 2NRVA 3AXKA 3PG9A 3OY9A 1BGXT 2FLLA 2DGWA 1IG8A 5CCLA 2WBMA 2XLIA 3HHLB 3BKFA 1GAOA 2HBJA 5K5MA 4MTPA 1Q78A 2Q36A 3DRPB 1HI1A 4B17A 2P2CB 4DTRA 1JNZB 2MDAA 5BPNA 3A1YG 3VCDA 3M3ZA 1S57A 4OVLA 2E9ZA 4NZ0A 5HK4A 4WBFA 4ZS6A 2NRTA 1VYAA 2O8EB 1EP4B 2HG4A 3BF1A 2M8HA 4E3SA 1FD8A 1SKSA 2AJFE 2OEKA 3MMAB 2O8BB 1KVIA 4ILJA 3VGSA 2X3DA 1U1PA 1RT6A 1YQHA 3QINA 2DGTA 1T05B 3HSTB 5SWMA 3NF9A 2NXUA 5KG2A 2AX0A 2CQ2A 3PYDA 7FD1A 1BIUA 1YTUA 3IG1A 4BC7A 4M5HA 2F65A 2VDIA 5DQHA 1FWKA 3CCLS 4FKYA 4PQAA 4NWBA 4Y1DA 4WZQA 4AM6A 3NAEA 2ZC3A 2ROGA 1T95A 1A9NB 2I7PA 4H0VB 2P51A 1WOQA 1KQFB 1RK8A 3X1LB 3MXMA 1SH3A 1NGBA 4HDGA 4TSXA 4NLGA 3IBFB 1RBUA 2CVEA 1VAZA 4OHVA 3NGKA 3IWXA 4WU2A 3HP6A 3KFWX 4C8MA 2O8CA 3MD3A 4ED1A 1VQLN 1N32J 5E26A 1FRXA 1DTQA 3QZ8A 3F9MA 2QX0A 3LDPA 4CZKA 1FA0A 5GAGU 3FUYA 3SDEA 5K8MA 5E41A 2FD2A 1VBYA 1BQMA 2OHDA 3F73A 4RW8B 2F9WA 2P9IB 4BG9A 5C10A 2KG0A 1S7IA 1W0HA 1RWXB 3RTVA 1Q81T 4FW2A 1N52B 4X66F 1X4CA 1ILYA 3CD7A 3BB5A 1KVCA 4O23A 5KT7A 1FVQA 3HVWA 2XZWA 2KFNA 1E6VA 4Z0UA 3PR5B 2DYAA 4FNHA 1U1NA 3QEVA 3VALA 2MKYA 4PCQA 1U8SA 1EO1A 2HAFA 4WTYA 5DQGA 3B8HA 4CM0A 1RT1B 4R0JA 3TTFA 1VHXA 1VQ5S 3VAJA 2NRXA 3D3CJ 3SSRA 2DEJA 3RWUA 4LF6K 2NSBA 3BS9A 1MMLA 4Z4CA 3OJUA 4MIWA 3MFIA 2OFHX 4C8OA 2RB7A 3UPFA 2C3MA 4NLVA 3A3NB 3K0JA 3D2EB 4HH1A 1JLQA 1CJVA 2R8JA 2BA9A 5IQQA 3FC9A 4ES1A 3NS5A 5I3UB 2DY4A 1IJFB 3UR0A 1FERA 4P75A 3G0ZA 3QPIA 3E01B 2N82B 4IFVA 3V4MA 2A1BA 2P9CA 1EAYC 3UN5A 2BOAA 3VZHA 5C24B 3RRHA 2F4VJ 4CD3A 4DTJA 2GMLA 4A8FA 2QWLA 5F1XA 3BO2A 9ATCB 3NGYA 4K4WA 1KC8O 1T9YA 4DR3J 4KB1A 1WC0A 4WWSA 2XS2A 4DV4K 2BKOA 2HWTA 3S9HA 4ILMA 3NCRA 4JNEA 4IRKA 3CPWM 3A5NC 4OX9F 2G2ZA 1IKYB 3DM2B 2FHJD 3TTCA 1HYVA 2DNRA 2Z8QA 1CZAN 2KH9A 3PFOA 2FHMA 4YUDA 3J81j 3NNCA 1NK0A 3P1GA 2E7WA 2GJIA 3OW2R 1JK9B 2UXDF 5JUMA 4I56A 3SXLA 3GV8B 1RDRA 3MMVA 4KO0A 3DDKA 5D8HB 3CCSS 1ZZNA 1SL1A 3PEJA 4EZ6A 2CPIA 1P9YA 5CXTA 1N33J 3C15A 4NZ7A 3TNVA 4B9UA 1Z2LA 2C2NA 2EPIA 3CC4N 2V2VA 2YX1A 4ZVGA 1BOTO 4HL9A 4JI7J 2VQEF 3KLIB 4CD1A 2B7CB 2Z2MA 3NF6A 2Q43A 3FEZA 4MO4A 2XNRA 1FJGJ 4F36A 2WOMA 2ZOFA 4DJBA 2YQ3A 2DNLA 2RE2A 5CZXA 1QQOA 2QTDA 4W4MA 1M0SA 3R5CA 4OI6A 3PIOL 1KLNA 4CP5A 3VGLA 5TKYA 2HHQA 3CHWA 4O44A 3MMCA 3LANA 4TY8B 5B0CA 3W2VB 5KPZA 4M1KA 4BROA 3QT6A 4IR9A 3J81U 3IBCB 4FM2A 2CQ4A 3BGOP 5F2RA 2BUNA 1IR0A 1EARA 3K9JA 4CHOA 2PDAA 4NCAA 3BDPA 2PY5A 3WIUA 1J5OB 2AP6A 4KAZA 3I8BA 3PNIA 5DO2A 2XGQA 3T1YF 1TYQB 3BUZB 3RJMB 4FJ8A 3PRBA 3QGPA 5FRMA 1JKHA 1YWXA 2VV5A 1UVLA 3GIIA 4DL6A 3OA9A 1UEUA 2YNHA 3WIVA 5HRNA 1OYDA 5E84A 2DGOA 1NCLA 3CM5A 4ED8A 2YWFA 1VCTA 1FNOA 5ETPA 3BKUA 2LQ8A 2VKZG 1VQPN 2XY6A 4OYAA 1WNSA 2NRRA 4J2AA 1HUXA 4F67A 4NEZA 5KFOA 1QQCA 3K5NA 2ZH1A 2QFJA 1IQTA 2ZBQA 3T9ZA 1WSHA 2PI4A 4FWLA 1BHNA 2K3KA 1BUXA 4C1NK 2J9EA 3CETA 1X0PA 3AQOA 3M6VA 3N6MA 2EFOA 3UD4P 1KC8T 2FSJA 5E5NA 1S1TB 2RUSA 1Y4ZB 4WYLA 3AD8C 3PYGA 1P90A 4K41A 2NZ4A 1P9QC 1MSWD 2OD6A 2Z56B 3KVGA 2XSJA 4QWAA 4LQ9A 2FUG9 1S9GB 5FDLA 1CXQA 3M9NB 4DSKA 2YPYA 1F5AA 4DR3F 1OY9A 1O1WA 2OZSA 3FSYA 4QBUA 4Y0WA 4EYHB 4LFBF 4EO8A 2F7TA 2KFYA 4WXWA 2ZD1A 2CJ9A 3KD1E 4MKVA 2W2NP 4DG1B 4YS2A 4J2BA 5JVGL 4I69A 3V9UA 3ZLJA 1ATRA 2CG4A 1RYSA 1WJ9A 3GONA 1X31C 3SFGA 4DFJA 2FC0A 4B3MK 4FOIA 3VGKA 1TK5A 1TAQA 1RDCA 1SH2A 1HBOA 4IOCL 1WB9A 3BSNA 2EXUA 5E3CA 2FTRA 1S6QA 3MPYA 4OQJA 1NRKA 1LAVA 4F04B 4K4UA 1JJ4A 2IY5B 4HEA9 3G86A 4AF1A 4W90B 7FDRA 4HCBA 2LU2A 3GR0A 3I9ZA 3O9QA 2DB1A 2QGFB 3AB2B 1CVJA 1F9HA 4RU2A 1DJ0A 3D6FB 2BE7D 2VASA 3HHLD 1URNA 3LWMA 3MXHP 3QEWA 4BG8A 3LM2A 5DLGA 3CPWR 4DCJB 4B3TF 2G8WA 1XMQK 3CGIA 2MY8A 3BQ2A 2R8IA 5CH7B 1WF0A 2BZ2A 2ROEA 2ZBRA 5AQZA 4N5SA 1D9DA 1BLUA 4CF2A 2PI5A 1IBLF 4DV5K 4NX9A 1ITGA 4ZIVA 2A40A 1C1CB 2OPPA 5KFYA 3MN7A 3GJSB 3VQ9A 1HNVA 1PBUA 4OYPA 2X74A 4DFPA 4C48A 1NOZA 2Y1LB 1L3KA 3O9RA 2BH1A 2KHCA 1KOOA 4YOYA 1IBCB 2AZ1A 3MI7X 1NHVA 3QSIA 1PJ5A 3QAEA 1C0GA 4V19S 3GV7B 1IBLJ 3THXA 2E1ZA 3D3BJ 2AGQA 1NK5A 3NMRA 5K8PA 3DYAA 1X9SA 5DZ6A 3A5OC 1YITS 1SUQB 3OYHA 4W92B 2OZMA 1IQZA 3ZC4A 3M6XA 5C42A 2BJ3A 3KUHA 5KFTA 3D54A 3VAHA 5CD4A 4C0HA 4JI3F 3ZX3A 2UZAA 4H8KA 3WXMB 4K8ZA 1E3MA 2DPIA 1GMVA 3TVZA 3NY0A 5AJ3K 3QFHA 1N5YA 4RW4B 3KK2B 1QSSA 3P39A 1Q9XA 2FBYA 2HQ3A 3SQOP 3B82A 4L3KA 4X64J 3M6WA 1LWFA 1U2RA 2V34A 2YVSA 4NXNF 4NZ6A 1NJIT 3F2KA 1W26A 3G71S 4CO3A 5GAHI 3O4NA 1WG5A 4H5NA 2ALZA 4IG3B 4LD0A 3NWRA 1N56A 2VG5B 4JK8A 2BANB 4WZMA 2YTCA 1WSEA 1QJHA 1ASWA 3ET6A 3UO0A 1BG3A 2HWIA 4RLEA 4LF1A 1XNRK 3LQVA 4PRFA 3TSPA 1PO6A 2ASYA 4A8QA 3PHTA 4QS8A 5F8HA 3N79A 3GYNA 2VQEK 2VICA 4DV5F 4ATNA 2CJAA 2HRTA 5CYJA 5K8OA 1L3VA 4JYAJ 3VF2A 3B8AX 4DWIA 3AVGA 4KHPJ 4ZN3A 2QL9B 1ASVA 4RW9A 4DPTA 1JJ2M 1RT7A 1GLDG 3RYLA 3MEEA 2MEWA 1RE1B 2J0WA 2RKIB 3ZZ0A 2YX4A 4IJNA 2BQUA 2UUCF 4NA3A 2DISA 4MJKA 1HBOB 1SJRA 3AO3A 3E9OA 3OL6A 4B9MA 4O8KA 3EEQA 4FLXA 3O1LA 3QWPA 4DCPB 3TSQA 3E01A 2ZKTA 3CO9A 3W9IA 4DS4A 1R8CA 5THWA 3D0GE 4DR4F 5LSLA 2FLPA 5LMUJ 4KTQA 1VHIA 2FY1A 1MWQA 5J2PB 2CGLA 2H9ZA 5BR8J 3LP3A 3R9PA 1BMQB 1UJ6A 2ZH9A 5EN1A 3HJVA 2WBRA 2RDDA 4CGIA 2LA6A 3OTBA 2ATCB 1IKYA 4KJIA 2K2PA 1NM2A 2CNOB 1Y5LB 4ID8A 1D4XA 3I82A 3TQEA 3CCQN 3OV7A 2VWBA 3U9DA 1I5OB 1JL2A 1HWJA 4M3XA 5A2QO 4MYUA 4DL2A 4B3RF 4OZLA 1YJNS 4MKBA 3DGPA 1Q82T 1RDBA 2Q31A 3KHYA 1S6UA 4FVCA 4O0JA 2GMJA 4NLXA 1JCEA 5ETNA 1KQSR 1RBTA 1RA6A 4DG1A 2RRNA 1KOHA 1S48A 5T7BA 4AHTA 4JHDA 3NS7B 1U6BA 1R3NA 2WB4A 3ZX2A 2CJKA 3DOKB 2BEFA 1YTYA 1XC3A 2NNWA 1D9FA 4LRFA 1RBRA 3CIZA 5AXLA 1UEVA 2RPIA 3BKTA 2IPOB 1RWKB 3N9UC 4FN5A 2QSWA 2O3DA 5BRHA 5IT9U 1T3OA 2LLZA 2JLEA 1K73O 3D6MB 2FGOA 1NM1A 3VAIA 1KD1O 3OFEA 4EP4A 3EVOA 2J7WA 4PG6A 1HKAA 5BYSA 3OUYB 4IUFA 4AL5A 1TUVA 1JCFA 4LFAK 5KFUA 2E7VA 3DGPB 2L41A 3ZZPA 2WVEA 2DHGA 4IQMA 4PQUB 3HYFA 4ZDNA 3W65A 3L9ZA 4M5NA 4MIBA 2QLFB 2D74B 2A3JA 2CJBA 2RQCA 4JV5K