4RW6A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 146
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw6A05
3KLEB 4J9OA 4PQUA 3H98A 1QUVA 4QWDA 3NGDA 3D0PA 5KT4A 3KHLA 2V9WA 4KFBB 1BCOA 4B9NA 4IH7A 3AVLA 3T5HA 5F8MA 1TAQA 5C42A 1RT5A 1SL0A 4Y2AA 3UR0A 2YNIB 3M9NB 2W8KA 3OHAA 3KLVA 5C24A 1BQNA 1U48A 3AA4A 3SQ2A 3SYZA 2XGPA 3QESA 4OPKA 4C8NA 5KG0A 5KFBA 1RT7B 4C8LA 3K58A 3DLGB 4PWDB 2GBZA 3OLBA 5CYQA 2QKBA 2OPQB 2JGUA 4FCYA 4EZ6A 2HW3A 3ZT0A 4OPJA 4CJLA 2BQ3A 1TP7A 5EWFA 2W9BA 2HNYA 3ITHB 1N5YA 1Z26A 1RBSA 1ASWA 1S6PA 3E51A 5J1EA 3AVGA 3VQBA 1HYSA 1WNSA 3LDSA 4MQ3A 2QK9A 4L8RB 2VG7A 3O3HA 1RT6B 4DL2A 4FYDA 4OKKA 4RW8A 2WOMB 4ECZA 1Q8IA 5D3GB 3EPGA 1KCFA 3CM5A 4HCCA 1RTJB 4CERA 4FLUA 4KB7A 2W9AA 3MAQA 5DG8A 3NH2A 3AVHA 3M8PA 2HHSA 4CJSA 1J5OB 4QWBA 4HUEA 3SQ0A 2OZMA 5KFNA 5JXSA 5KT2A 2D5RA 4G3IA 3GIJA 3GIKA 3SUPA 4O0JA 3GV7B 4CK3A 4B9LA 4YNQA 1JXEA 1RT1B 5KFAA 1QAJA 3QEWA 4CJEA 3PVXA 1A5WA 1TQLA 2P51A 1IM4A 2XY5A 1JXBA 1RDBA 3K2PA 5J2QB 3SFGA 4HKQA 4QW9A 4IFYB 4BE2A 4RW7B 1S6QA 4KB0A 4JS4A 3RMAA 2RDIA 4LH4A 4AHRA 2RF2B 1WN7A 3I0RA 4HUFA 4ZHRA 4IKAA 4FJJA 4O4GA 4DU4A 3P83D 3BREA 4CF1A 4CEZA 5J2PA 3RAXA 5HRRA 5K14B 5KRTA 1BI4B 4GC7A 5KFFA 1NNDA 3AVKA 2OA8A 4CFBA 4CCHA 1TAUA 2R8IA 5HLFB 4ZMMA 1U47A 1JL2A 4J2AA 4FJLA 4NCBA 4KHQA 3OLAA 3SJJA 3RR8A 2FBTA 4CJQA 1NKCA 2VWJA 4W5NA 3ASMA 3I5CA 4TY8B 1FK9B 1UA0A 1GX6A 1U49A 4DMNA 4B9TA 4TYAA 2ATLA 4DS5A 4BWMA 4TYBA 4I7FB 1EX4A 2ZQBA 1S1XA 4FBTA 2DPJA 1EETA 4CJWA 4KO0B 2EHGA 3HM9A 1LWFA 4JV2A 3HVTA 3WNHA 2OZSA 2D0CA 4DTMA 4TQSA 4BDZA 4F4ZA 1KRPA 3M9MB 4IH5A 4M42A 4R0EA 1HMVA 3V6DB 3MEDB 3VQ7A 3HHKA 2X78A 4CFDA 5HROA 3V81B 2WK4A 2FLPA 1WSGA 3H4DA 1C0UB 2XCPA 4DQSA 3NGYA 2P1JA 1RBRA 5F8GA 2UUTA 2GC8A 4BE1A 3PZPA 5I3UA 3JYTA 2O4IA 1DLOA 3KKRA 2BANB 4OGCA 2XY7A 3MECA 5HRSA 3BJYA 1F21A 3KHGA 4QPXA 1IKWA 4NLWA 4AHSA 4FJKA 4CGDA 3CFPA 3DRRA 3ZT1A 1S0MA 3OYKA 4DFMA 3BSAA 4HVJA 3MEEA 1IKXA 3OYDA 3DDKA 1U04A 3BQ1A 3DLRA 2OPRB 1RT4B 3TABA 4MH8A 1ZTWA 4MKBA 5HBMB 4JUZA 1S4FA 3KLHB 1KLNA 1FXXA 2WRMA 3D5MA 1VSHA 4DTPA 4PUOB 3TAGA 3WNGA 2XHBA 3QZ8A 1TKZA 4HCBA 1T03B 3GV5B 4DSEA 5KFRA 4ZP7A 2F8EX 3OYAA 1YVUA 4IRKA 2VG5B 4RW9B 4H4MB 4H8KA 4CK2A 4FS2A 5C25B 4CIGA 2BQUA 3CDWA 1VRTB 3K5NA 1RTIA 3NL0A 1IH7A 1S1VB 1U09A 4KHRA 2E9RX 1S49A 4O4RA 3GQCA 1J54A 3P5JA 3TWHA 4RG8A 1C0MA 4QCLA 3G0ZA 2AWZA 2QV6A 4IRCA 4B9UA 2DY4A 1HQUA 4QW8A 4QAGA 1TL3A 3RMBA 3MXMA 1UWBA 4E7KA 4CFAA 3HJFA 3LZJA 1KFSA 1RT3B 1O1WA 3RB0A 2VA3A 1X9SA 1JLCA 2C2DA 4NLDA 2G8HA 2Z1IA 4CJ3A 5L1JA 3DOLA 3KHHA 4NCGB 2OH2A 2CKWA 5J2MB 4I2QB 2HNZB 3F9KA 1NJYA 2HMIA 3LZIA 2W9CB 4HHTA 4B9SA 1WSJA 4ECQA 5CZ1A 4Z4CA 3RR7A 4R8UB 5CYMB 3H5UA 3S9HA 4GW6A 1KHWA 4EP5A 2KFNA 1HJRA 5DGBA 3VQPA 4B8AB 4N5SA 3MTKA 4MFBA 4NLRA 2UVWA 3HK2A 2WHOA 3CDEA 4EBCA 2J6UA 3V1QA 3QLHB 4FJ7A 4TQRA 4GVMA 1RBTA 1REVB 4Q44A 2IC3A 1JLQB 4J9KA 1TV6B 3KLIB 2VWKA 3M8QB 2GUIA 4ED0A 4CIEA 4Z0UA 4CGHA 3CDUA 4ZTJA 4LQ3A 5DGAA 3VQCA 4IR1A 2V4RA 3EY1A 3IG1B 1QQCA 4KBIA 1T7PA 2BE2B 2IAJB 4Y3CA 3KLGA 3ZSVA 1TKXA 1RBVA 3ZSWA 4DSKA 3I0SB 4W5RA 3DLKB 4Y1DA 3H08A 5DQHA 4DL7A 2VA2A 2ASLA 3AVBA 4AILC 1LWEA 2I5JA 3KMSA 3NAEA 4IBNA 4O55A 1RAJA 4M3WA 3IGVA 3G6VA 1HYVA 1JLAB 5DQIA 4WZQA 2WTFA 4FW1A 1I39A 2HHVA 1XR7A 1TKTA 3AVMA 3D45A 4DG1B 3T1AA 2P5OA 2CJQA 3KNAA 4FZZA 3H4BA 1LW2A 3IGNA 5JS2A 1CSJA 1QAIA 3NMAA 4CEAA 4RW4B 3NF9A 1I6JA 4FJHA 1I3AA 2FVQA 1HYSB 4KHSA 5KTQA 1GOCA 4DTXA 1FKPA 2DPIA 4RW6B 4BDPA 3DM2A 1MU2A 5KT7A 2X6SA 4ICLA 3CJ3A 4CJ4A 1KTQA 2G8WA 1BL3A 4KB1A 1N56A 1JX4A 4DF4A 3TAQA 4CJTA 3IS9A 2E4LA 1VSJA 1EP4B 1T94A 1KLMA 1WAJA 2E9TA 4CHZA 1S1WA 3OYHA 4IDKA 4IR9A 4Z4FA 4ID5B 4IG0A 2J6SA 4B3OA 3KK3A 4F3TA 3HPHA 5T14A 4LQ9A 3QIOA 4OL8A 2HWHA 5KFLA 3MR5A 1W25A 3DLEB 3QYYA 3KD1E 3DLHA 4FJ9A 4DSJA 1JXLA 3K5LA 2W7PA 4KRFA 3AVFA 5J2NA 1RDRA 4BWJA 4URSA 1JLGB 3NGZA 1C2PA 4JRPA 4TN2A 3AVJA 1RT2A 4TY9A 5KFVA 3QGGA 2OPSA 4I2PB 1C6VA 1NOYA 1YT3A 1C0TA 3RBEA 3NH1A 3QGHA 1L3UA 4OJRA 1N6QB 4DSLA 3HVRA 1SV5A 4EO6A 3V4IB 1BHLA 4C8KA 5KFMA 4H4OA 4E3SA 2AGOA 1NK8A 2YNHB 2RKIA 2E9ZA 1RTDB 3TARA 4FK0A 4WE1A 4CJRA 2DFHA 1LWCB 5KFYA 1Y97A 1RDDA 3VQ4A 4UQGA 1D9FA 3ZT4A 3V1RA 2AX1A 3OS0A 3HL8A 4NLPA 4DFKA 3IRXA 3SI6A 1TK8A 2W8LA 2XI2A 4KAIA 3DMJB 4O0IA 1BQMA 4KKOA 3OYCA 3TANA 3AO4A 3THVA 3LWLA 1SUQB 3DLBA 4DQRA 5JS1A 4DF8A 4CEQA 1DTQA 3OS2A 3GV8B 4FLXA 1NKBA 4LY7A 2B5JA 4E1NA 5HP1B 3RMDA 1TL1A 2YNFB 1WAFA 3DRPA 1C1AA 4F2RA 1LW0A 3PX6A 4M3TA 1QHTA 5I42A 3E01B 3O3GA 3SFUA 4Y34A 5EDWA 3B6PA 4NLYA 1RA7A 1QE1A 3KK1A 2C2EA 3KK2B 2IM1A 4QWAA 1NHVA 2ZE2A 1ZYQA 3UIQA 3NAHA 1JLFB 1W0HA 3TAMA 1NOZA 5CY4A 3L2UA 5CZ2A 3MEGA 1Q9XA 5KG5A 3KOAA 3QEXA 4PY5A 1X9MA 3LPTA 5SWMA 4NZ0A 4AH9A 2AGPA 4FJIA 4RZRA 3C6TB 4MK8A 1VRUA 5KFKA 3DI6A 4K4ZA 3PW0A 1C1CA 2BRLA 4DL3A 4KTQA 4CF9A 4CHOA 4M95A 1WSFA 4ZP9A 2R8HA 3OYMA 3PY8A 1BIUA 4N41A 4K4SA 4ZPCA 4KHYA 2HHXA 4IG3A 2OPPA 5DLGA 1XHZA 1YTAA 2IJFA 3IN5A 1QTMA 5DLFA 2UVRA 2ZD1A 3OYFA 1QSLA 1HNIA 4O44A 1HYZA 1JLBA 4OKJA 1D0EA 2VG6B 3VQAA 4OKEA 1ZBIA 1IKYA 2G8KA 4I9QA 2LSNA 1S10A 4F4KA 4URGA 4LSNA 4MIBA 3DRSA 4F2SA 1VK0A 1S9GB 3AA5X 2R8KA 2O4GA 2R2SA 4FM2A 4NCAA 4E0DA 2F8TA 2Y1IA 1VSDA 2WB4A 2BRKA 4K4VA 2B6AA 2YKMA 5KG4A 4CJ5A 3QIPB 3BR9A 1T05B 2FLNA 4DU1A 3SPZA 1JLEB 4CFCA 2HNDA 4CJFA 3JSMB 3LP1B 1S9FA 3FFIB 3OYNA 2BR0A 4TXSA 2IDOA 3I8DA 4DQQA 5KI6A 1IKVB 2X6NA 4URQU 3NBPA 4KREA 4TLRA 3QO9A 2UVVA 3PJXA 1L3SA 4ZPAA 4Q0BB 1KVCA 2DTUA 2YHBA 4IFVA 3FRZA 2IM0A 5L1KA 2RPIA 4KV8A 4M3ZA 4RNHA 4CIFA 3MXJA 1VSEA 3BGRB 4ZVGA 4DFJA 3SQ1A 4LD0A 1XI1A 3GIIA 3VN5A 2YNGA 2W7OA 1K1QA 4O3RA 1S1TB 5EUHA 3BQ0A 2B4JA 3G6YA 4F4XA 2Y1JA 4KFBA 3HP6A 3BSOA 4KAZA 1SH2A 3TQ1A 3AVAA 2QE5A 1TGOA 4GMJB 3PX4A 1TVRB 3I5AA 3RTVA 2YNIA 3RB3A 2Q3SA 1YTUA 2WONB 4N76A 1TKDA 1J53A 4E89A 4KHUA 4F4WA 1RT7A 2DFEA 5KFEA 3SUNA 4BACA 1X9WA 1IG9A 3DLGA 4F8RA 4PWDA 5KFHA 3NHGA 1RTHB 2OYQA 4FLVA 2OPQA 2ITGA 1NK4A 3I5BA 4CEEA 1UAXA 3LP0B 1TK0A 3KIOA 3IAYA 4JS5A 3KHRA 3ICLA 3O4NA 3QEIA 3ITHA 4FJMA 4QWEA 3HP9A 4DTNA 4DTRA 1YVFA 3ZT3A 2Z1GA 4H54A 3HT3A 4YR2A 3PW2A 4XO0A 1B9DA 3S3NA 4ECYA 4WXOA 1FKPB 5KT6A 3LWMA 4CEOA 4CEBA 1RT6A 3HPGA 5FRNA 4B9MA 4EEYA 3QEVA 2XO7A 3DOKB 4KE5A 4JV0A 2WOMA 5D3GA 1WNEA 3D28A 4NYZA 1FKOA 1C1BB 4FXDA 3K59A 2G8VA 5F8IA 4WFYA 3CFRA 1RTJA 5KFWA 2R2UA 3QINA 4XPEA 2IM3A 3K5OA 1BISA 2EX3A 4Y2CA 1BGXT 4ZPBA 3EPIA 1J5OA 3LAMA 1S9EB 4E7JA 3OYGA 1A5VA 1B9FA 1GOAA 3Q8SB 1DTTB 5FDLB 3BSNA 5F8JA 4I9LA 3DYAB 3QEPA 3NF6A 4DSFA 1RT1A 3PR5B 3QNOA 5KFZA 2FJXA 2D7SA 1HNVB 4E7LA 4G1QB 3H5SA 4ZP8A 3T19A 2UUWA 4EO8A 4RUAA 3HO1A 4K50A 4J9SA 3Q8QB 5J2QA 3B6OA 1CLQA 1ZETA 4DTOA 4IFYA 4LSLB 4RW7A 2FBVA 3KLFB 2RF2A 2HHUA 4CJVA 4ELUA 3KJVB 4ECWA 2D3UA 3FDSA 3L8BA 5K14A 4FM1A 1BI4A 3TI0A 2C28A 2JEIA 4W5QA 4M41A 2F96A 2ETJA 4CHPA 1LV5A 5HLFA 2FBXA 4WYLA 2XWYA 3LP2B 1R0AB 1RDCA 1T3NA 3QGIA 4J9MA 1WSHA 1CXQA 1HQEA 1NK7A 4NLGA 1CXUA 2IS3A 4PA1A 3OHBA 1JKHB 4WFXA 4TY8A 1FK9A 3MR6A 4DL6A 1GX5A 3K5MA 5E41A 1W9HA 1CZ9A 2XI3A 2ILYA 3SPYA 1VSIA 4KI6A 3EZUA 4FJXA 2JC1A 3L2QA 4OVLA 4ELVA 4PQUB 4KO0A 4DS4A 4CGIA 3RRGA 1QSYA 4ECVA 2YHAA 5C42B 4J9RA 3ZSXA 3OS1A 4HUGA 3QZ7A 1KFDA 1RT5B 4E7HA 1QS4A 3V6DA 5C24B 1BQNB 3MEDA 3NKYA 4K8XA 3V81A 4ECXA 3PO4A 1RBUA 4J9NA 1ZBHA 1C0UA 1S97A 3FSIA 4M3YA 5CYQB 1EKEA 2V0NA 5KT5A 4Z4IA 1XWLA 2R8JA 4EP4A 2BQRA 3Q8RB 4M3UA 1T8EA 2BANA 3PV8A 2XRIA 4IQXA 2W9BB 5L9XA 2FVRA 2HNYB 1N5YB 1B92A 1KVBA 1S6PB 5J1EB 2A1RA 5FROA 2J6TA 1XR6A 2XCAA 3KMQA 4DL5A 2OPRA 2VG7B 1RT4A 4AHVA 2Z1JA 4ED6A 3VQEA 4B9VA 5HBMA 3M8RA 3SZ2A 2BGGA 4RW8B 3QIDA 3PJWA 5EWEA 2XC9A 3RAQA 2HVIA 3KLHA 3N6LA 4KTWA 4M3XA 4EBEA 1ZBUA 3ISND 3LAKA 3M8PB 4PUOA 3V6HA 2RDJA 4U6PA 3SNNA 3U6FA 1T03A 4ED7A 3L2WA 1S1UA 4W5TA 2VG5A 4CGGA 4RW9A 4H4MA 3G6XA 3AA3A 5C25A 4TSXA 4O44B 4NLQA 1VRTA 3UQSA 1SKSA 3GYNA 4YR3A 2FJVA 4CEFA 4F4YA 5L1LA 3V6JA 4J9PA 4FW2A 4R5PA 1S1VA 4NRTA 4B8CA 5L1IA 1G15A 4Q8FA 5F9LA 4FJNA 1HRHA 4ZP6A 3M9OB 5KG7A 2PYJA 1S6QB 1RT3A 4AHTA 2YKNA 3I0RB 1RYRA 2HAIA 4ZHRB 2R2RA 1NK5A 4O4GB 1NK6A 3NF7A 3S3MA 1S48A 2IM2A 5F8LA 2R8GA 4NCGA 5J2PB 3AV9A 5J2MA 2KQ2A 3VQQA 3RWUA 4I2QA 2HNZA 3O4QA 4Z4GA 1VSKA 5F9NA 1K6YA 2W9CA 4M45A 4IOBA 3MR3A 2C22A 3CWJA 5CYMA 4R8UA 3MFHA 4BE0A 1HARA 2HHWA 4KI4A 4NLOA 3PW5A 4NLTA 4J2EA 2F8SA 3OL8A 3H40A 4ZTFA 4KHNA 4O3QA 4DFPA 4GC6A 3C6UA 3QLHA 3MFIA 1REVA 4NLUA 1S1XB 4WXWA 3ZSRA 3QNNA 1JLQA 1EETB 1TV6A 3KLIA 4DTJA 3PX0A 4FM0A 3PR4A 3M8QA 4J9QA 1LWFB 4ZVHA 3HVTB 4DLEA 3VQSA 2JEJA 2XY6A 3HVAA 2AU0A 5KFGA 1NJZA 3IG1A 3OL7A 3U3GA 4O5BA 4J9LA 1HMVB 3Q8PB 1RCHA 2AJQA 2BE2A 4Q8EA 2IAJA 3RB6A 1BCMA 1MMLA 1GOBA 5HROB 3OYJA 1HPZA 2W42A 2G8IA 3I0SA 3DLKA 4ZVEA 5HRPA 5I3UB 3JYTB 1DLOB 4CF2A 2R7YA 3MECB 4O3OA 5DQGA 3C95A 3KD5E 2HHQA 3HVWA 3BQ2A 1IKWB 1JLAA 3T5JA 1XC9A 2FJWA 4WZMA 1L3TA 2E6MA 5KFOA 3DRRB 2PZSA 1Z4UA 3N6MA 4DG1A 3MEEB 1IKXB 1NK0A 1D8YA 4IH6A 4U7CA 4O3NA 5EWGA 4CF0A 1ZBLA 4RW4A 2X74A 3ISNC 4KTZA 1SH3A 4CESA 4RW6A 4ID1A 2E6LA 1TK5A 5KFQA 1ASVA 1TKZB 4DQPA 2FVCA 3AO5A 1FKOB 2PY5A 4WYWA 1EP4A 4DTUA 3NDKA 3OL9A 4XIUA 3MXIA 4ZPDA 1X1PA 1N4LA 1LAVA 3CG7A 1RTIB 3LANA 4ID5A 1XR5A 5KFTA 1S5JA 3CJ0A 2WCXA 3MR2A 3DLEA 1VSLA 1HQUB 5KG3A 1TL3B 1UWBB 2D0BA 4W5OA 3O3FA 3SUOA 1JLGA 2KZMA 2D41A 1JLCB 4MK7A 3KKSA 1SL1A 3DOLB 4I2PA 4M94A 2HVHA 4QWCA 3F73A 3VA0A 2ASDA 1N6QA 1N48A 2HMIB 1ZTTA 3V4IA 3H5YA 2KZZA 4Q43A 4M3RA 2YNHA 4F3OA 1RTDA 3WNFA 4HTUA 1LWCA 3CJ2A 4C8MA 4J2BA 4MFBB 4YR0A 3PW7A 2ALZA 4CHNA 4RNFA 4Z4EA 4HYKA 1A5XA 3OJUA 1HQEB 3DMJA 2IC3B 4EYIB 2FC0A 3T3FA 1SUQA 4FLTA 3OVNA 4CHQA 1JIHA 5KRSA 3KLEA 3M8SA 4B08A 2GIRA 4CF8A 3SQ4A 4JRQA 4O3SA 5HP1A 2FVSA 3SUQA 2YNFA 2G8UA 3KLGB 1RILA 1SKWA 1TKXB 1BIZA 3E01A 2DFFA 1SL2A 4QOZB 1VSFA 4CJPA 2KW4A 1LWEB 2I5JB 2IJNA 3OYBA 4K8ZA 5KFPA 3ZSYA 4ELTA 3T5LA 3RRHA 1NHUA 3KK2A 4JLHA 3HXMA 1JLFA 3NFAA 4FLWA 4F50A 4DLGA 1WLJA 3PHEA 5DMRA 1KHVA 1TKTB 2AQ4A 5KFCA 2UVUA 3QETA 3FQLA 1RNHA 2ATQA 1D1UA 4C8OA 4KHMA 2ZKUA 3CJ4A 3V1OA 4CE9A 2GV9A 4DU3A 1LW2B 1NKEA 2YV0X 4EYHB 4FBUA 4ED1A 1Q9YA 3C6TA 3QERA 2RN2A 3L3VA 2D0AA 3NCIA 5KG6A 4EBDA 5T7BA 3AA2A 3DM2B 2QKKA 1MU2B 4ICLB 5KG2A 4CK1A 3VQ9A 2XGQA 1RYSA 4K4XA 4DL4A 3S3OA 1QSSA 3RBDA 3HSTB 3UPFA 3SCXA 3IS9B 1L5UA 4CGFA 4N56A 3T5KA 1KLMB 1S1WB 2P5GA 1VSMA 4OGEA 2AGQA 4Q5VA 4IDKB 2XY8A 3VA3A 3CO9A 4IG0B 5DK5A 1XHXA 4B3OB 3OJSA 1OS5A 3KK3B 2C2RA 4CGJA 1S1UB 3SV4A 4ED8A 2IA6A 5KFXA 4KPYA 2VG6A 1S0NA 1NK9A 3LP3A 1IO2A 4DQIA 2KTQA 2FLLA 4ED2A 3TAFA 3VQ5A 4E1MA 4ECRA 5KFIA 4FZYA 5J2NB 3NAIA 4R5PB 3TVKA 4RNMA 4EZ9A 3PUFA 3UDLA 3N6NA 1RT2B 3L3UA 1S9GA 2OPSB 4FK4A 4K4TA 3TAPA 1C0TB 3LPUA 1SH0A 3OYEA 1RA6A 1U4BA 4ED3A 3OSPA 1SV5B 2YKNB 3V9XA 2HHTA 3H2LA 3SI8A 4RNOA 3OY9A 4H4OB 4XPCA 3A2FA 3GILA 2RKIB 3QIPA 2B43A 4WE1B 1K1SA 1T05A 3CVKA 1UA1A 3ZSQA 3AVIA 4CECA 1JLEA 2AX0A 1EXQA 1CZBA 2FBYA 3CM6A 5KGXA 4MIAA 4E19A 3JSMA 2Z1HA 3LP1A 3IRXB 3FFIA 1D9DA 3FQKA 3CQ8A 4NYFA 4ECSA 3OYIA 1D5AA 3CFOA 3CJ5A 1BQMB 4KKOB 3VQDA 4X2BA 1IKVA 4FJ8A 3U3YA 1U45A 3PO5A 4NYNA 3LALA 4RUCA 1ITGA 3C6UB 4I7FA 1DTQB 1KVAA 4Q0BA 4FLZA 4FLYA 4FVMA 3V6KA 1SKRA 1WSEA 2B5JB 3BSCA 4DWIA 2HB5A 4IKFA 2FVPA 1WSIA 2JEGA 1TL1B 4YMEA 3BGRA 2ILZA 3ALYA 4CJUA 2IBKA 4WFZA 2IOCA 3MF5A 2EC0A 1UOCA 3DRPB 2JLEA 1LW0B 4RNNA 1J9AA 4DSIA 1S1TA 5I42B 3PW4A 4OLBA 2JEFA 4K4UA 4CJKA 3L2RA 1QE1B 3KK1B 2BDPA 3AVNA 3NF8A 1TVRA 1HPZB 2ZE2B 5EU7A 4J2DA 3VQ6A 3TAMB 2WONA 4ECTA 1RDAA 2PYLA 3HKWA 3TR8A 4NLVA 3MEGB 5HRNA 3G86A 5KFSA 1RTHA 2QXFA 1Z25A 1ASUA 1VRUB 3LP0A 3NH0A 4FJGA 3DI6B 4AHUA 1C1CB 2JC0A 3VQ8A 4AHCA 4FZXC 1S0OA 3RB4A 4NLXA 3L2VA 4ECUA 3V9ZA 5F8HA 4ZVFA 3CYMA 1L3VA 2G8FA 4NLSA 4Z4HA 2HWIA 3ZT2A 4IG3B 3EZ5A 2OPPB 3ULDA 1NJXA 1ZBFA 3NGIA 4Q45A 4IRDA 3V9UA 3DOKA 2GIQA 4BDYA 1C1BA 4YQWA 2ZD1B 1HNIB 4DEZA 3GIMA 1JLBB 3H59A 2R2TA 4CHYA 4E7IA 4JV1A 3KTQA 4N47A 4KHWA 1IKYB 4MK9A 1S9EA 4CEDA 5C5JA 3BDPA 5F8NA 2IMWP 3P1GA 2V4QA 2NUBA 2I1RA 4K4YA 3H5XA 3WNEA 1DTTA 4MKAA 4LSNB 4O3PA 4YFUA 4FS1A 5FDLA 5KT3A 2ASJA 3K57A 3DYAA 3DRSB 4YP3A 1LAWA 1HNVA 4G1QA 4LH5A 3CIZA 3V9SA 3NE6A 3EYZA 2D3ZA 2B6AB 4LSLA 4FJ5A 2YKMB 3KLFA 3V9WA 1KSPA 3AVCA 3KJVA 2O5DA 4FK2A 5KFJA 3TAEA 4RU9A 5JUMA 2HNDB 3AO3A 5FRMA 3SV3A 5KG1A 5DG7A 4Y1CA 3ZCMA 5KGWA 3AO1A 3ZSZA 3OYLA 3OL6A 5KFUA 4OLAA 2KFZA 3LP2A 3NBPB 1R0AA 3ZSOA 4DTSA 5DG9A 4NRUA 3QO9B 3AO2A 1JKHA 4IFVB 1NJWA 3HPOA 3OSNA 3HYFA 4KV8B 4KSEB 1JL1A 5KFDA 3G10A 5SZTA 2A1SA 2YNGB 3C94A 2IGIA 4K4WA 3RMCA
chains in the Genus database with same CATH superfamily
1Q86T 4PQUA 3H98A 3D0PA 2CADA 3SAFA 2V9WA 3OR1B 3OTOJ 1ROFA 4B9NA 4IH7A 4FWSA 2V63A 3T5HA 1FERA 4ZKAA 2C3YA 4K0KF 4B3MK 3UR0A 4NZ6A 5E3PA 2W8KA 1XNRJ 3H3NO 3AA4A 1T3VA 3L7PA 1DY3A 3B6BA 3I9ZA 2XGPA 4C8NA 2YH0A 1SC3B 3I55S 1RT7B 5GMKa 4C8LA 2ZBQA 5JMVA 4PWDB 3OLBA 5HOOA 2QKBA 1H2UX 3ZT0A 4CJLA 4BRPA 1KNZA 3S7RA 3LTOA 1RWWB 4CM2A 1N5YA 5F41A 1R7IA 1IQTA 5J1EA 3VQBA 1SXLA 1KBRA 4OX9J 4L8RB 3SQGB 2VG7A 4F3MA 2AYGA 1R89A 5T7LA 3EE8A 2P9GA 2H48B 2R4FA 4FYDA 3VAFA 4OKKA 2WOMB 4ECZA 3EPGA 3CM5A 4HCCA 1X60A 4CERA 4KB7A 2CFXA 3NH2A 3JSBA 3HOSA 3H90A 1QDUB 4EFHA 4FPIA 5CHCB 5GADU 2KG0A 1J5OB 4HUEA 1FD2A 4G3IA 4DV5F 3TOQA 3ZX0A 1QQMA 3GV7B 2GHPA 2CJ9A 2YH1A 3CC2N 1BXNA 2Q36A 2KG1A 3GCXP 1Y3KA 3BY5A 3SDEA 3PVXA 1TQLA 4LF4F 2XY5A 3SFGA 3VGSA 1A0OB 2DGWA 1NJIO 4OZ5A 2V69A 3TJ9A 2NRTA 5CD4A 2DR5A 4ZHRA 4IKAA 1NG9A 2QMUB 4PAAA 4O4GA 2GV1A 2HBLA 4CF1A 3O9SA 4KGZB 5HRRA 3EWGA 3KG0A 4CLWA 3C6HA 1NNDA 1U0HB 3THPA 3D54A 2OA8A 4OPHA 1N32F 3WX8A 1V9OA 4DR3K 2MLZA 1T9UA 3E8OA 4ZMMA 3D2EA 3CCUN 2V94A 4JKDA 1J2VA 4NCBA 4IXCA 4KHQA 3SJJA 4CJQA 2CQ2A 3AB4B 4LBIA 5GAEI 3I5CA 1MDUB 1V4TA 2CWKA 3E9LA 1R8CA 4DMNA 4JI1K 1IVZA 4TYAA 4F0HA 3PKYA 2QG9B 4BWMA 3R6LB 4BGBA 4TYBA 5H1SQ 4I7FB 1S1XA 4B3TJ 4CO2A 4C7QA 3FLCO 1EETA 4J9UE 2XHCA 4QOTA 3SK3A 1QQNA 2NLWA 1HI1A 1YIJN 4HTIA 3H6EA 3HHNB 5G0RA 1D3WA 1RDWX 2ZNZA 4HHUA 4KY3A 4DUZJ 2Z30B 3EJMA 2X78A 4CFDA 3BZCA 1B7YB 3MGJA 2Q3PA 4F36A 4JV5K 1SJRA 4DQSA 4L3KA 4M5HA 2EC2A 2P1JA 2GC8A 2BJ1A 1I5OB 2LQ9A 3R3LA 1T9YA 2GX9A 3NP5A 4BC7A 1JMTA 3KHGA 4AHSA 1X0FA 4CGDA 1EKRA 2AYMA 3C8YA 3DRRA 3FK4A 5D6GA 3MCAB 4DFMA 3BSAA 3OYKA 1IKXA 3OYDA 1U04A 3BQ1A 3WQTA 2NYHA 3MPYA 4MKBA 3QGPA 1S4FA 4X4SA 5IT4A 2VC1A 3ENHA 2ZITA 4DV1F 4Y2MA 4F25A 5AQKA 4USIA 4L74A 3QZ8A 2YPZA 1TKZA 3UCZP 4LF5J 1T03B 5KOXA 3C46A 5L38A 4IRKA 2VG5B 4RW9B 4H4MB 4H8KA 1KVIA 1U02A 4CIGA 5JMNA 1VRTB 2E88A 1Q78A 3C19A 3K5NA 1PAEX 2C2MB 3RW7A 3QWPA 3GU0A 1FJGF 1H2VZ 1S49A 3GQCA 4DPYA 5AQVA 1M1GA 4C4WA 1H0HB 2VYPA 4QCLA 2QV6A 4IRCA 4V19S 2DY4A 1HQUA 4CO5A 4E7KA 3O9UA 1O1WA 2VA3A 5HJYA 1YSJA 1X9SA 2C2DA 5ETMA 4BRIA 2Z1IA 4Y6IA 2YQ3A 3DOLA 2OH2A 2CKWA 2PI5A 4LFCJ 3W8GA 2DGVA 2KFYA 2XMUA 3F9KA 2HVEA 3M2RA 1IBKK 3ZZTA 4OYIA 1XERA 2M52A 1HHQA 2YX4A 4RWTA 4OYPA 3LDPA 3NWRA 1IR0A 4EP5A 2RQ4A 5DGBA 3CJKA 4NLRA 2ZH2A 2UVWA 1LFPA 3M5RA 1GLBG 2DCUB 2E8AA 3QLHB 2PGCA 3P49B 3MZIA 4FJ7A 4Q44A 2CQ0A 1ZZNA 1YI2N 1TV6B 5H1SV 5E0OA 3TRGA 2ZC4A 4ED0A 3QB0A 3I31A 3FBCA 3CDUA 4ED5A 3IXQA 2MKKA 4LQ3A 3VQCA 3MN6A 1HUXA 3O6WA 3Q8VA 4P2MA 4EMDA 2IAJB 1WELA 3ZSVA 1RBVA 3ZSWA 1EWQA 2W4PA 3AY9A 4BGAA 4JI6K 2UXBF 3HFZB 2ASLA 3U8XA 2JX2A 1RHUB 2Z56B 2HIYA 4PXBA 3AAPA 4IBNA 1UVKA 4ILRA 2MLXA 2JVOA 4M3WA 3IGVA 1HBMB 2Y1LB 3Q83A 2WTFA 4FW1A 2HHVA 5D0EA 3N9UC 4P73A 3T1AA 4FZZA 2P9KB 1LW2A 3IGNA 1CSJA 1QAIA 4RW4B 3NF9A 1WHWA 4CRJA 4DTXA 1FKPA 1XMOF 4RW6B 4BDPA 1PC4A 3DM2A 1MU2A 4LFAF 1AZSB 2CG8A 1KTQA 4PKGA 2UXDJ 4KB1A 2K06A 1CULA 2W2OP 3TAQA 4CJTA 3IS9A 5M1QA 1F0XA 2NS1B 4ZN1A 4FOEA 2MZQA 2G0JA 2E9TA 2EWHA 1S1WA 2A2DA 4OX9K 4IG0A 3N01A 4B3OA 2HHHK 2KDOA 2FYXA 3KK3A 3I55N 4CO3A 5KFLA 3CUNA 3QYYA 3DLHA 3GJTB 1LXNA 4KRFA 3AVFA 1LEOA 4B1UB 3ET6A 1KAYA 3QGGA 2OPSA 2GHVC 4I2PB 3MCPA 1NOYA 1YT3A 2O8BA 4OYOA 1PIEA 2P6SA 3QGHA 1FX4A 2J9EA 3M8ZA 4HHJA 4YY3K 4DHVA 4EO6A 2MEWA 3J7AP 4ATNA 2AGOA 2J9DA 4TU7A 1XEZA 2RKIA 1U0SA 2CQ3A 5B0CA 4RX6A 4BBYA 3VQ4A 2FGOA 3CJBA 3ZT4A 2ZOMA 2AX1A 3OS0A 3BKUA 3KDOA 4NLPA 4LVNP 1VIXA 2MQQA 2CWXA 2XI2A 3VERA 2OEJA 1RLDA 1BQMA 2PMWA 3TANA 3AO4A 3THVA 2B56A 3LWLA 3TJ8A 1R8AA 3D3CJ 2FJAB 3J7Z5 1DTQA 3M2VA 3OS2A 2CZ9A 1S3XA 1UZDA 4QIFA 3A0IX 4ZITA 1NBWA 3LDOA 5LJWA 1GLLO 1UTAA 3MMJA 5U47A 4QQBA 2ZHOA 1ILYA 3DRPA 3P6YC 5G4DA 2MHEA 3U02A 3PX6A 3I8BA 1Q1KA 1FJEB 4WKRA 1WF0A 1EQMA 1Q79A 2JOQA 1B0PA 2HIQA 5I9EB 2DHXA 4KJIA 3DFEA 3MEGA 5ELZA 2JWLA 4DV4F 1CBKA 1GMUA 4FJIA 4DUZK 3HZEA 4MO4A 2W2MP 5KPTA 4JHDB 4QU6A 3T9ZA 2ZZTA 5AJ3F 4JKBA 1HKCA 4RCHA 1N36F 3DGVA 4CHOA 5AXKA 2FXUA 2KHDA 3CCSS 4YOTA 3TVYA 3ZETA 2K7JA 2OPPA 3PKMA 4MLEA 1XQIA 1VQYA 1QTMA 3DOMA 3S1TA 4O44A 1HYZA 2J7UA 1GH8A 2ZDOA 3MMAA 1D0EA 1MROB 2PDAA 4OKEA 4JI8K 2H51B 5J1PA 1OQ3A 3BUZB 1YJUA 1QM9A 5I4MA 4WJBA 4JD2A 2LSNA 2UUAJ 4F4KA 4LSNA 1BWFO 2XULA 1GAOA 2E7WA 1VK0A 1R6VA 3D1HA 4IO9L 2KVQE 1NDKA 4H03B 4LUBA 4C11A 1HNWF 4E0DA 4ZVOB 4YEAA 2HFVA 2ZJQQ 1FA0A 1B99A 4GV6A 2L08A 2BH1A 5KG4A 3QIPB 2PN6A 3FRYA 5FLXO 3SPZA 1BE4A 4CFCA 3BH6B 4CJFA 2RNEA 3LP1B 2COLA 1S9FA 5CCMA 5FPDA 1RZMA 2IDOA 2J7WA 4ZVPB 2M88A 4DQQA 1U1OA 3UE5A 1APSA 4LFCK 2X6NA 2H9ZA 2DD8S 4URQU 2CPHA 4F02A 3QO9A 1XN9A 2ZJRQ 3UKUB 4ZPAA 5AQQA 4Q0BB 1KVCA 4KH6A 3TTCA 1K73O 1HNZJ 2IM0A 2O8EB 4KV8A 2P9SB 4M3ZA 2P5VA 4RNHA 3BGRB 3SCLE 4ETZA 3SQ1A 2VFTA 3C2PA 2ITMA 2RHKA 4IO1A 4FPAA 4BRDA 1IG8A 3EM1A 2JFDA 2Q66A 3J8AA 2EFOA 2MB0B 1FO1A 3OR1A 2HSEB 3HP6A 8RUCA 3CJ1A 2NXJA 2QE5A 1V6HA 1OO0B 2FF6A 5C2GA 2ZH6A 2XZTB 2LQ5A 3RTVA 3RVCA 3MCOA 2WVEA 3TX0A 2QFJA 1SC1B 1BA0A 4N76A 1TKDA 4KHPF 2RE2A 4F4WA 4DU8A 1RT7A 2V2QA 1IG9A 4BACA 1WTFA 4PWDA 4PXCA 3NHGA 2WVCA 4FLVA 1NJIT 4P9SA 3LP0B 1KP6A 2RRBA 3KHRA 3O4NA 3L9ZA 5EOYA 5AFUH 2JLFA 4KPCA 4H54A 1DZ5A 1UPPA 5A6WA 2VKRA 1UL3A 1Q18A 5IV3A 2H54B 3CJRA 3SQGA 3LWMA 1IWGA 1ULRA 2JHEA 1T3OA 2WOMA 3ENVA 1FKOA 2GQ2A 3K59A 2VHGA 1QVGR 4LR7A 1HKGA 1BO5O 2YXLA 3UO0A 2EBEA 1RUSA 1LCUA 1FNOA 1TL4A 2EX3A 1S72N 4XEIA 2VPXB 3WXIA 1J5OA 1C0GA 3LAMA 4PZVA 1A5VA 1GOAA 2UXDK 4K42A 3QEPA 4DSFA 3MM9B 3PR5B 3VAIA 2D7SA 4E7LA 3H5SA 4ZP8A 3AA9A 5AQNA 4BVPA 1U6ZA 2FC8A 3HO1A 3KWIA 1N8RT 1WDDA 1RAEB 4IOAL 4NWBA 1AW0A 4FKYA 3KLFB 1X4GA 1R3NA 2HHUA 3O9RA 4NXNJ 2WB1D 3KJVB 1H74A 4ECWA 4WF9Q 1Z2LA 4FM1A 4AL7A 1S59A 1U0HA 3G87A 4LF7J 2F96A 2YBVA 1LV5A 2F9DA 1U1PA 2ERRA 5LJVA 4AM7A 3QT5A 3TUPA 1RK8A 4LIWA 1HQEA 3FBFA 4NLGA 2IS3A 4PA1A 5THWA 3MR6A 1RHRB 1K9MO 2NREA 1W9HA 1ZAWA 2GJ2A 1YRUA 2LCWA 2IVFB 3CJAA 5B0BA 1T9XA 4FPRA 4QR0A 1F9FA 3IAM9 1KC8T 2LQJA 3GWCA 2BJ3A 2HQ3A 4ZA1A 5C42B 4J9RA 3ZSXA 1BOTO 2BJEA 1KFDA 4DV6J 2QM1A 2VQEK 4P2XA 5JVHQ 5AQGA 5GINA 1RBUA 2YJFA 3CIMA 5M2UA 5M1PA 2OSQA 1Y4ZB 2DNZA 3THWB 5CYQB 4Z4IA 5KT5A 3PTWA 1WKLA 2KT2A 5DM6L 2R8JA 3VENA 1T8EA 1OSCA 2E5LK 2XRIA 2W9BB 5L9XA 5FPMA 2HNYB 4BRCA 1KVBA 3CD5A 4UTGA 2WC9A 4HHHA 3R6MA 1Q8LA 1ATRA 2AJFE 2J6TA 1XMQF 1CJUB 4YDXA 3I9V9 4A5AA 5IT9Y 4OX7A 2BGGA 3QDKA 4RW8B 1YJ9S 3JAMU 2XTJP 2XC9A 2ADBA 4ALZA 4ES2A 4MIWA 4U6PA 1T03A 2PA8D 1NSKL 3CQXA 1OH5A 4C0BA 2F9WA 2VG5A 4RW9A 4H4MA 2YKAA 3VZHA 3AA3A 5HQ8A 4H4KC 1VRTA 2B7CB 3TSUA 3UQSA 5EX0A 1MWKA 2FJVA 1WKKA 5HSPA 4NRTA 3H8YA 5L1IA 2VZ9A 4GKJJ 4Q8FA 1IBLF 3JAMO 5FLXY 4WU2A 1D9AA 3QMLA 1D4XA 2GNKA 3IM9A 3MTJA 2KYXA 2OIHA 1IJEB 5IFMA 2YKNA 2R2RA 3Q0AA 4KIAA 4UY8O 4N7TA 5F8LA 3VQQA 5KPZA 3CCSN 2UUAK 2M5YA 1SAZA 3Q2TC 4PPZA 1K6YA 5BYQA 4JI0F 1X5PA 4M45A 2GA7A 4CLLA 2HS4A 2B9EA 3MFHA 1RWVB 1P8GA 2ZBPA 5HMZA 4AM6A 2HHWA 2CQBA 1U24A 2B9WA 2PD1A 2QTDA 3F5TA 2POKA 2F8SA 2ZZNA 1MSWD 3H40A 3ENAA 4O3QA 3C6UA 1YJTA 2E29A 3UDVA 4X62J 3QLHA 1BQXA 3MFIA 4DXLA 1CZAN 3TA2A 1TV6A 4FM0A 1WOOA 3H25A 3CMES 2V9KA 4X84A 3HVTB 1Q4RA 4BCAA 1M5VC 2JEJA 1U2CA 4FXWA 3A8EA 3PSFA 1PJ6A 3M32B 1NJZA 3OL7A 4XH5A 1HMVB 4CBXA 3DLLQ 2QYCA 1KN6A 4H5WA 2DHGA 4A61A 4BY9C 2IAJA 1B0VA 1HNZK 3GB0A 1UVMA 1YZ7A 4I64A 1CJKB 2G8IA 3J7A1 3Q8YA 2VU5A 4EAHD 4H0PA 4CO1A 4FYYB 5C2CA 1WC4A 1NCLA 4MO5A 4CF2A 1LFWA 4WP3A 1QHAA 4LFBF 2HHQA 2RT3A 5DQGA 2QLWA 4OZNA 3J7AN 4ILMA 1X5SA 2YVSA 3IFRA 1HBMA 2M70A 3HDSA 2ZJRL 3NGRA 1XC9A 4X65K 2N7CA 5KFOA 1Z4UA 3N6MA 1JWWA 1X4HA 4IH6A 3BO4A 4U7CA 4FN5A 3V5RA 2P9KA 3SEOA 2WVBA 3IMQJ 4CH1A 1ZBLA 1Y5LB 4RW4A 3BGOP 4KTZA 5AQWA 4C1NK 4RW6A 1SQKA 2J0WA 3HCXA 2E6LA 2J0XA 1AZSA 4WFBL 1C4AA 3R5AA 4K25A 1ASVA 2R7QA 4DQPA 3T69A 4RR5A 3E2EA 2CPZA 5AXNA 3NWGA 2I6WA 1T11A 4WYWA 4DTUA 4OI2A 4J37A 4DUTA 3OL9A 4XIUA 5AR0A 1X4FA 1WTBA 4WP8A 5HMYA 3CG7A 2HGNA 3CMQA 3LANA 2G1DA 2UUCK 1FCAA 1S5JA 1JNZB 3CJ0A 3MR2A 1S7IA 3NNHA 5A8RB 1VSLA 2DNPA 2DT9A 1X4CA 2VPYB 5AT1B 3QFPA 2KZMA 1A6LA 3KKSA 3FZMA 2YJEA 4I2PA 4M94A 3DLJA 1GMVA 4I67A 3B82A 2WFBA 3F73A 4M8LA 1N48A 2Z4PA 2J76E 5D4PA 1PBUA 4JI7F 2VASA 2G2OA 2IIHA 4HTUA 3GR1A 2AJ2A 3H0PA 4MFBB 4UOHA 4RNFA 4K5SA 2VJUA 4NXNK 4HYKA 1O6XA 3FUYA 1HHSA 2G2ZA 2XYGB 3DAWA 2HS3A 4WBFA 3GSDA 2X1FA 3ILJA 4LF7K 3OVNA 1WUAA 4QIVA 3LOUA 3NS5A 3KLEA 3ZTOA 1HLUA 5HL7Q 4O3SA 2FVSA 3SUQA 5D4OA 3DN9A 1B0TA 1GLAG 3IMXA 3GG1A 4YHHJ 4QOZB 4DR1K 2FTRA 5GIPA 1SJQA 4CJPA 4B3SJ 1N5TA 2FUG9 2IJNA 2L9WA 3T5LA 1DT9A 4JLHA 3GG4A 3NFAA 1ZPWX 4FLWA 4X64J 3DC2A 3EVWA 5DMRA 1VS3A 1Q95G 1TKTB 4ZCIA 2UVUA 3FQLA 1RNHA 2ATQA 1HKAA 1GNKA 2ZKUA 1NMDA 3FKBA 2A1BA 3BM7A 3BF3A 2P6TA 3QERA 3LF0A 4OFZA 2RN2A 2OGUA 3M7VA 3NCIA 1HR0J 2KXNB 3AA2A 1RISA 4ICLB 3CQYA 4PRFA 5KG2A 4CK1A 2IA0A 3J81j 1FXDA 2CXEA 4XDDA 3HSTB 4OLOA 3UPFA 5A2QU 2QL5B 1RFQA 1GK8A 2U1AA 1KLMB 4BC3A 3AB2B 2LEPA 2XYPB 2P5GA 4Q5VA 4FYXB 2XY8A 3VA3A 3JAMY 3CO9A 2OANA 1J5EF 4CGJA 4F04B 4A8WA 2MQPA 1MROA 3W64A 2E44A 2KJWA 4KPYA 1NK9A 1S0NA 3VMFB 3W66A 2FLLA 3NVMA 3W1YC 5KFIA 3TPQA 4IUFA 5M1KA 3VF0B 4OZ2A 4EZ9A 4IZ9A 4NA3A 4EFAC 3N6NA 1RT2B 5LXRA 4FK4A 3M30B 2GWKA 1SV5B 1OH6A 3V9XA 2HHTA 3H2LA 3SI8A 4XPCA 1YJ9N 3A2FA 4GKJK 2FSNA 3QIPA 1NGDA 4WE1B 2NPIA 4JI5F 1FNXH 3ZTSA 4CECA 3W2VB 1N88A 2AX0A 1EXQA 3T41A 5D15A 1CZBA 3CM6A 3PIPQ 4Z37A 4E19A 3LP1A 3IRXB 4GKKJ 3FQKA 4OQJA 2BYCA 4NYFA 2RAQA 3OYIA 1KOHA 4BC9A 2J5AA 2V2KA 2A5XA 3PO5A 4NYNA 4M63C 1YF5L 2RU3A 4CW7B 3C16A 3UKUA 4Q0BA 4FVMA 3OPKA 1VC0A 1WSEA 2B5JB 4IKFA 2O8EA 2V8HA 2P9SA 4YMEA 3BGRA 4CJUA 2IBKA 4PL7A 4JEPA 4PKHA 3VWSA 3OFEA 3TW0A 1U6BA 2JLEA 1J9AA 5BJRA 2V52B 4DSIA 4DV2K 4A62A 4FWNA 3IKMA 2F3JA 1F2HA 4CJKA 1QE1B 3KK1B 2AHOB 2ZE2B 4J2DA 1HWKA 3C7NB 2RILA 3CJ8A 2BZ2A 1MMDA 4BC5A 5EHHA 4ECTA 1S7HA 2D74B 2A6AA 1RDAA 2PYLA 3KYLA 4NLVA 4OI0A 3D66A 2C2OB 3T6BA 3A5NC 4A4JA 2QXFA 3TJAA 4LF8J 4WTYA 1JXVA 4DPXA 1RAAB 1ASUA 3LP0A 3FVYA 3SAHA 2ADCA 2JC0A 3VQ8A 1K0VA 2IHR1 3RB4A 1DQ8A 3TZXA 1Y5IB 2HZAA 4ZVFA 2FSKA 2HWIA 3ZT2A 4IG3B 1ZZFA 3EZ5A 4GY2B 4Q45A 2CG4A 4CO4A 2HBQB 5E2QA 5BYSA 4USJC 4DEZA 1K9MT 1EHWA 1ZM4A 3GIMA 1VAZA 1JLBB 2BW7A 2W6KA 1UVJA 4DV0K 3KTQA 3S6EA 5AQLA 1ACMB 3SCIE 2R7XA 2H3EB 2NUHA 1P27B 1T02A 3EEQA 4CZIA 3PLAA 3JS9A 3LGHA 4DX8H 3D6TB 1OY6A 3MI7X 1RGIA 1RCOB 2ASJA 1IR2A 3VESA 3HKZD 3MM9A 2IRYA 1LAWA 4GRSA 2ZFHA 2Q1LA 2Z2ZA 1VDHA 2V50A 2DXDA 1ATSA 3Q8UA 3THXB 4LH5A 5DM7Q 3QRQA 2NRXA 4YOWA 1BWEA 1OSDA 1EJ7L 2D3ZA 4QJVA 3G4SS 1FRJA 2VL1A 3KLFA 2WBMA 1H98A 3AVCA 2KU7A 1YG0A 3GMGA 3KJVA 2O5DA 4RU9A 4ZPVR 2HNDB 5DRKA 4BC2A 3AO3A 5GMDA 5KG1A 3VGUA 4B3RJ 3AOBA 3VVTA 2CQHA 5DG7A 3AO1A 5IQQA 3ZSZA 5BPNA 1N0VC 3WT0A 1AUDA 3M4XA 4P2FA 3ZSOA 2JFKA 3AO2A 4CWBA 2RQMA 3HPOA 2W25A 1N34K 4RU2A 5AFUA 3BYPA 2BKNA 1NGEA 4DZ6A 5AQUA 2M7SA 4CI6A 4ZVQB 5IWAJ 3PYDA 4I0WA 1QJHA 5L46A 3NGDA 2N3OA 4Q2MA 2AYBA 5KT4A 1FDNA 2FHOB 5CYJA 4KFBB 3IDHA 2MKIA 4JK9A 3JSYA 4U8VA 3AVLA 2DVIA 3O44A 2W41A 3VEOA 4QR1A 5C42A 5CR4A 1UJ4A 4Y2AA 1M90T 4CLKA 3M9NB 1U6FA 4NXMJ 3EN9A 1U48A 1J6ZA 2NYIA 3QESA 5F2RA 4FWMA 3K58A 4BR0A 4BR2A 3THWA 5CZXA 2ZDPA 2QSWA 5CYQA 3F41A 4NMXA 5EN1A 3MMCB 3OTDA 4UY8T 5EWFA 3CD0A 2W9BA 4YHHK 2HNYA 4KGMA 3LL3A 1ITPA 3RSEB 3MN5A 1HYSA 1PYTA 2RDDA 5C12A 1RACB 3OBWA 3MPUB 1CJUA 3LDSA 4MQ3A 2QK9A 3K17A 1MN9A 4OI3A 2E1CA 5AQYA 4X64K 2XS5A 3HHLB 1RT6B 3DKDA 4RW8A 5LMUF 1Q8IA 4JI4F 3T1YF 1UEKA 3UD5A 3R3TA 3PEJA 3IWNC 4FLUA 4B9QA 1HQ2A 2EBGA 4OV1A 5F0XA 4YOXA 2LEBA 4QWBA 2OZMA 5GAGU 5JXSA 2CPYA 5KT2A 3HSDA 4A8XA 3W9JA 2CQDA 3GIKA 1NDPA 1VBZA 4O0JA 3PRDA 4B9LA 2UUBJ 3SLCA 1I3OB 4GMKA 4CJEA 1A5WA 2P51A 1Y64A 1JXBA 4DQ8A 1RDBA 3K2PA 2FB0A 4HDGA 4Y0FA 4HKQA 4BE2A 4KB0A 3RMAA 3VOVA 2W2QP 1FKAF 2HBJA 1WN7A 3NVKA 1LNQA 1WOQA 1VQ7S 5IXUA 3RAXA 5K14B 2W2NP 5KRTA 2H5JB 9ATCB 2MZRA 1BUPA 1M5OC 3AXKA 3MWPA 1TUUA 5HLFB 1GLCG 4J2AA 4RWXA 3OLAA 3RR8A 1NKCA 1VQPS 3BKTA 4WFNQ 3VETA 1TMMA 4TY8B 1FK9B 2V34A 1NDLA 2VFVA 1UA0A 4JK7A 3PYGA 4B1ZA 1RWUA 1WI6A 4B9TA 4C98A 4RWWA 4H0YB 1XBWA 1VC6A 3TU5A 2ZQBA 1HD1A 1FRMA 2AZ1A 4FBTA 1YLXA 4KO0B 1TYQB 3O08A 3HVTA 3WNHA 2CZVC 4DTMA 4HH0A 2JLGA 4BDZA 1YTYA 4M42A 3R1LA 3ETMA 2O8CB 1HMVA 4E8UA 3V6DB 5CXTA 3MEDB 2NR0A 2M8HA 3VQ7A 3FC9A 3UD4P 4P75A 2WK4A 2LVWA 1WSGA 1CJKA 1YBTA 3BS9A 3BO2A 2UUTA 4ZVSB 2ZGZA 4PG7A 5C2DA 3KKRA 3LA0A 2IDLA 5HRSA 3BJYA 1F21A 3H2VE 4QIEA 4QPXA 3MPWA 1VQKN 4NLWA 2QGFB 2B9YA 2C2KB 1RLCL 1S0MA 4HVJA 3WBZA 3QBXA 1NDCA 3DDKA 3TUIC 3DLRA 3H3OB 5LT5A 4EGLA 4JI2F 2BOAA 3EE9A 2HRTA 3GTYX 3D6MB 3LM9A 2EVZA 2F7VA 3MCNA 3G96A 1Y7PA 3KLHB 1HNXK 3ZO7A 1KLNA 2LDYA 3CJSA 2Z58B 2WRMA 4IWVA 3D5MA 4LF8K 4DTPA 4OO1J 2W4DA 4PUOB 2YHXA 4JKEA 2XHBA 4K43A 3LPEA 2QXLA 2DIUA 3GV5B 5KFRA 3G2XA 3BN4A 3CPEA 4MJKA 4FS2A 1IV0A 1OPIA 4IJAA 3HHLD 1FE0A 5A8KB 4IOCQ 5AQOA 1IH7A 1U09A 5LM7E 4ZJLA 1J54A 4OHZA 1IJJA 2FC9A 3PEHA 3HJVA 2CQIA 4U96A 4FNIA 5A8RA 4B9UA 1RWKB 2O8DB 1U8SA 2CRLA 2OEMA 3RMBA 2AYEA 4CFAA 3MM6B 4PXEA 1KFSA 3P8BB 2UXCK 3DGPB 2GAGC 5J2MB 3AAWB 4I2QB 1B7FA 2VGMA 1DURA 4FDFA 4A8SA 2ACYA 3LZIA 2W9CB 5AQFA 3G9CA 4NEYA 1EB0A 4B9SA 4QYZJ 5BN9A 2N7YA 3CF5Q 1VLOA 1GTEA 3L4IA 4GW6A 1KHWA 3R7NB 3A8IA 3M8YA 2KFNA 4B1WB 1KQGB 1HJRA 1OH8A 4DR3F 2PI4A 3VQPA 4DX5A 4MFBA 3JTOA 5BRHA 3CDEA 4HEA9 2J6UA 3VF4A 3V1QA 5LSLA 1KD1O 4TQRA 3D6HB 2V67A 4FP9A 3MX5A 3ZTQA 4JI1F 1IWAA 3M8QB 2NPFA 2GUIA 1VHXA 3KHYA 4CGHA 5DO2A 1IBMJ 1YUWA 5DGAA 3QT8A 2V4RA 1YJWS 1E6YB 5K9FA 4DN9A 2V7ZA 4K0KK 3M3ZA 4KBIA 3WZ0A 1C4CA 3UE2A 3W3DA 5BRDA 2P9CA 2BE2B 3G4SN 4Y3CA 4GVEA 2PEHA 4UOFA 4PR6A 3DLKB 4Y1DA 3W7BA 4M5LA 4DL7A 2VA2A 1NBEB 3NS6A 3AVBA 3NAEA 5F3ZA 1KVJA 4DV3J 4BRMA 3DHXA 2VQFJ 4B17A 1HYVA 2RQCA 1I39A 1TKTA 2P5OA 2CJQA 1RBOB 4HACB 4NXMK 3MK6A 2MSTA 1W2BR 1Y9OA 1VFJA 4M5JA 3QFWA 1GOCA 4MT1A 3A3OB 2BEFA 2X6SA 4ICLA 3CJ3A 5HVFA 4CJ4A 2G8WA 3EDRB 1YJNS 1BL3A 3UB5A 2DNYA 3EDQB 1T6CA 4CZKA 2OJ3A 3TX8A 1NSAA 5AQSA 2E4LA 5ADXA 1VSJA 1EP4B 2XZWA 2AP6A 2KVIA 1KLMA 1WAJA 4OV6A 4LRFA 5KOWA 4CHZA 2E1AA 3RJMB 4Y28C 2YI1A 2OAUA 3THYB 1K44A 2E2NA 4TLQA 5T14A 2L9NA 5BYRA 2UU9J 4LF4K 3KD1E 2B0GA 3K5LA 4CQ1A 2W7PA 2FHJD 2GS8A 4ES1A 4ETXA 2MY7A 1RDRA 4BWJA 2VKZG 5MLCQ 4URSA 4DPUA 1RT2A 4TY9A 5KFVA 4TU8A 4Y00A 3M30A 3RBEA 3NH1A 2UV8A 4FWLA 4OJRA 4FF2A 1SV5A 3J80U 4C8KA 5KFMA 4P74A 2X7IA 1KQSM 2YNHB 3TARA 3P45B 4WE1A 1IBKF 2PMZD 3W2VA 5M1FA 1MG7A 3WUHA 3V1RA 2X1GA 1EWRA 3MOJB 3HL8A 4ISFA 4DFKA 4HLBA 3IRXA 3I96A 2PO4A 3SI6A 2W8LA 5HK4A 2J0SD 1GQEA 2GCFA 3DMJB 1CJTB 4O0IA 1UFKA 4L76A 3OYCA 4FNHA 1DQAA 2ZH5A 1ZAVA 1RCXB 2AEMA 3J80O 1WSRA 2VDHA 4X4TA 2WBRA 1NKBA 4LY7A 2B5JA 2IYIA 2VGNA 4E1NA 5HP1B 2MSSA 3RMDA 4FPBA 2YNFB 2BUNA 2YCHA 1ZOTA 1G6BA 3CI5A 4M3TA 3E01B 2LQBA 4KQZA 4A59A 3SFUA 1QQOA 4USMA 3BEXA 3W5XA 1ICEB 5K8MA 1QE1A 3KK1A 1BWVA 2HBRB 4NB4A 4KGVB 1FFGB 2ZE2A 1NHVA 4JI6F 3C7NA 1R0CB 4K41A 2V4JB 2Y3YA 2HG4A 4PY5A 1X9MA 2CJKA 3LPTA 5SWMA 3OTOF 4NZ0A 2N4DA 3HX9A 4RZRA 4MK8A 3CJ7A 4I6AA 3EO3A 1FESA 2WSEC 1XNRF 2BRLA 4DL3A 3UW1A 4KTQA 3S01A 5LSOA 1Q82O 4M95A 1WSFA 2R8HA 3G6ES 4FYVB 3PY8A 3OYMA 1Q16B 1BIUA 2RQKA 5C15A 3MAAA 2E1YA 3TUJC 4ZPCA 3C3LA 4IFEA 4J5OA 4IG3A 1WF2A 2KKZA 4GO5X 3SBMA 3BF1A 1OVYA 5DLFA 4EUVA 5CE3A 5JLFA 3OYFA 1FJGK 1JLBA 3GPAA 2P8IA 2ROEA 2OTJN 3D2WA 4OX9F 3WC2A 1YDLA 4BRFA 4A8QA 2HF3A 3HSCA 1X5TA 3FSXA 3HSGA 5MLCV 1S9GB 3VTHA 1UMJA 2R8KA 3R97A 2F40A 4FM2A 4NCAA 3THXA 2VD3A 3AQOA 2ZH3A 2F8TA 1VSDA 1FJCA 2BRKA 1GXUA 4P71A 3VAJA 2D4WA 2EG1A 3M2RB 1JLEB 1WACA 3HHDA 4IEIA 2HNDA 3POTB 2I38A 2ZOGA 4F67A 3OYNA 2R7SA 4J9VA 4NE9C 2BR0A 1RBAA 4TXSA 1RABB 3I8DA 2DK2A 2MHNA 3GG0A 5K8NA 1IKVB 3R9LA 2UVVA 1L3SA 2ALYB 4LSZB 5ITHA 5B0FA 1S6UA 4QYZK 5L1KA 3C0BA 2NSCA 4CIFA 2R7VA 3R1XA 4DFJA 3J7YI 4B3MJ 4LD0A 1NH8A 1MWZA 2OSRA 1H3DA 3VN5A 3PJ9A 4KBOA 4K59A 1FJ7A 1S1TB 4HR2A 2UXBK 2B4JA 3G6YA 4F4XA 4KFBA 4LC9B 5DS7A 3ELHA 1SH2A 3TQ1A 3AVAA 2LA4A 3ZZUA 1TGOA 4PHTX 4A48A 4CLUA 1TVRB 2BA9A 1IUJA 3I5AA 3CF5L 3RB3A 1QD1A 3CXCR 1UP1A 4PYDA 2WONB 4B3TF 5GVQA 3RGIA 3ATUA 4JKGB 2W40A 4XAKA 2OELA 1U1KA 5KFEA 1X9WA 3ULEA 4F8RA 2OYQA 1CG2A 3AJ1A 3EE3A 1S22A 1XMOK 3MMVA 2G9OA 3MMCA 3HP9A 4DUZF 3N0VA 4YDUC 2K7KA 3RSEA 3ZT3A 1WC6A 2Z1GA 1NGBA 4XH4A 1DQ9A 3ZNUA 3HT3A 3PW2A 2VQFK 4WXOA 1FKPB 1YJWN 4CZGA 1WORA 1RT6A 3DOKB 4KE5A 4JV0A 2B8PA 1JCFA 3D28A 4WFYA 3VEZA 1QZ6A 1NSQA 3FMBA 3WIUA 3HLUA 4Y2CA 1GLFO 3O1WA 4JNEA 3VALA 4ZPBA 3EPIA 2K8GA 1XMBA 2D0PA 3OVSA 4WCEL 3C66A 3OYGA 1B9FA 2HQFA 3ZLJA 1UCNA 5IM0B 5FDLB 3BKFA 4QS9A 3NOCA 4LF2A 3QNOA 3W5YA 4ZPTR 2FJXA 2IVMA 2AJ0A 1S57A 3P4UB 2BACA 2HMPA 2E2OA 3T19A 2UUWA 4RUAA 2C3MA 1ATNA 2HGLA 4LF5F 4J9SA 3ZZOA 5F1XA 2ZJPQ 2HEKA 3K8WA 1QVFM 1U2FA 2HBMA 4H5NA 5HVHA 2UU9K 1XNQJ 4OI4A 4ELUA 2MY8A 3U1NA 2D3UA 5K14A 2MXYA 2C28A 4WWSA 3MM7B 3CJTA 5HLFA 2XWYA 3HRGA 1R0AB 1RDCA 1RBLA 3QGIA 3HFKA 1K0TA 1CXQA 1M5SA 3KJQB 3OHBA 5T41A 4TY8A 2BW2A 1FK9A 2NXEA 5ETVA 3UVJB 4DL6A 4LFCF 3LO3A 2A18A 1S79A 1LWXA 2XI3A 4FWOA 4WFAL 3SPYA 1Y11A 1FTCA 3F56A 1NU4A 3SMPA 3UWTA 2E1RA 4KO0A 2MQOA 4DS4A 3H1QA 4CGIA 2KI2A 4K2XA 4JV5J 2OP5A 2VJVA 4WQ5C 4I1TA 3QZ7A 1RT5B 2O8CA 2M8DB 3V6DA 3MEDA 1X9JA 4K8XA 5FJ4A 2Z2LA 2CDQA 1ZS6A 2KLAA 4DCPB 4PL8A 1J27A 2OMOA 3TP2A 4DV4K 1S97A 1OY8A 4M3YA 2BQRA 4M3UA 1PKUA 3PV8A 2FVRA 3PHTA 3GFYA 4PWWA 2FZKB 3N79A 1S6PB 1VQMN 2A1RA 3M1VB 3KMQA 4DL5A 2Z1JA 4WQ4C 5CABA 2XLJA 2EFNA 3HD2A 4C3MA 3QIDA 3E9OA 3PJWA 5EWEA 3KLHA 3S41A 4M3XA 2WW8A 4EBEA 1YRXA 1ZBUA 3LAKA 4PUOA 2ASOA 3U6FA 1KD1T 4LF6J 4LMZA 4O44B 4NLQA 5A8KA 4YR3A 4K2JA 4J9PA 4R5PA 1EX8A 3TSQA 3IA0A 1HNWK 2UXDF 2CZ4A 4QIGA 4ZP6A 2MJNA 4FVUA 2O8DA 5AQTA 2PYJA 2LP4A 1GMWA 1Q5YA 2ROGA 1N5QA 1UVLA 1S77D 1NNEA 3NF7A 2E1MC 3DGPA 3K0SA 3FMWA 3L0QA 1NLKL 2MTLA 1VIOA 1OMSA 3AV9A 5J2MA 4I2QA 4ILLA 3O4QA 4Z4GA 3TA0A 1VSKA 4XH1A 1H73A 2W9CA 3V2UC 3UKRB 2FD2A 5GAEU 3CWJA 1OWXA 4M5DB 3VF6A 2JWNA 1HARA 3A4TA 3KK7A 4KI4A 1F5CA 3PW5A 3VZIA 4A57A 3KUGA 2GMJA 1R31A 1VBXA 4J2EA 1BY9A 4DFPA 3E1YA 2L48A 3WQUA 3O9TA 2PA3A 3O5BA 1FX2A 4TKTA 3IC1A 1OVQA 4NLUA 2EKNA 3ZSRA 3QNNA 1VJQA 3PX0A 3PR4A 3M8QA 4OLPA 5D77A 1LWFB 4J9QA 4O23A 2DR9A 3UR3C 4ZVHA 4RUHA 3VQSA 1VGYA 1E6YA 3J7ZT 1DBDA 2LXFA 4A8FA 1RCHA 2Y9HA 2BE2A 3RB6A 3K7RA 2QRRA 3TUZC 4BG9A 1HI0P 1HPZA 2JZ5A 4IYQA 1DHMA 1QAXA 2F7TA 3DLKA 4D3GA 3N28A 4KR0B 3VGVA 1RKJA 2CPXA 3CULA 5I3UB 3CERA 3JYTB 3GYXB 3R1HA 3GDQA 4EI2A 3US5A 1IKWB 4U8YA 1CS4B 4WZMA 3EXCX 2V8GA 4HACA 2CIMA 3AD7C 3V4MA 1X31C 5EWGA 1W7WA 2QJ3A 5IC4B 4U9RA 2W7AA 1R59O 3ISNC 1RAFB 2C3OA 4WKYA 4USTA 4CESA 3EGZA 4ID1A 3OD2A 3AHPA 1TK5A 2HHHJ 5KFQA 2V51B 4CZFA 1NGFA 2FVCA 1FKOB 2QLBB 3HULA 2V6AA 1EP4A 3MR7A 2K3IA 1F3VA 4ZPDA 1OYEA 1LAVA 1RTIB 5HQLA 1GXTA 3A1YG 3THYA 4B02A 1IQZA 4G6VB 3AJ2A 3A8KA 4L73A 2ZHAA 2Z57B 3WEEB 1JCGA 2MDAA 1VCTA 1PYOB 2KXHA 2PAVA 4YY3J 3UNGC 1FRLA 1UWBB 4OI6A 2OCEA 3PXGa 1Z2ZA 4AL5A 1SL1A 4DOZA 3PIOL 3QRPA 3T1HJ 3BYRA 1FWKA 1ZTTA 2YNHA 5A6PA 2VV5A 1NGJA 3Q89A 2UUAF 3EVOA 1JJ2R 3FJ2A 3CMAS 2WUSA 4CM0A 4C8MA 4J2BA 5F0WA 4CHNA 3JS6A 1XNQK 2VH7A 1RI7A 2MQLA 3OW2R 4C48A 4Y2KA 1HQEB 4U7UD 3DMJA 1CJTA 4EYIB 1Q82T 5IOLA 4CBUA 2GELA 3S8SA 4F0KA 3T3FA 1JCEA 3P3DA 2ZJPL 1S12A 4B08A 2DEIA 5HP1A 1N33J 2YNFA 4CLFA 2DNOA 2XMKA 3C14B 4NO7A 1N0UA 1QUPA 3FEYB 3OXGA 1F9EB 1F2GA 4DHYA 4DDFA 1SKWA 1TKXB 4DX6A 4CLPA 2MQ8A 3E01A 2DFFA 2HQCA 1N8RO 1PJ7A 1HNZF 3R2CJ 1LWEB 2I5JB 4H0OA 5KFPA 3MN7A 3ZSYA 3M6UA 4ELTA 3RRHA 4L3QA 5LJ5Y 3HXMA 7FD1A 5BRFA 1TUGB 2CJAA 1FF2A 2V4JA 1Q8KA 1VR6A 3QETA 3ATVA 2GIFA 1D1UA 4KHMA 4M7XA 2D69A 4Z7YA 4EYHB 4FBUA 4ED1A 1Q9YA 2IPOB 1E3MA 1YBUA 1KDNA 4NLCA 4BHQA 2XZDB 2VBXA 4LIRA 2QKKA 2F8HA 4IO9Q 3QSYB 3VQ9A 4EK2A 4QR2A 4V19X 4OHXA 4JI8J 3M2UB 4CGFA 2CPDA 3A12A 4DPOA 4N56A 3GE1A 1MW7A 1JJHA 2AGQA 1H72C 4DMZA 1S4EA 4YOUA 4WPAA 1YJ7A 2HBYB 1M5KC 1KC8O 3VAKA 2C2RA 3SV4A 3TO8A 3OV7A 1IBLK 3R2DJ 1FRKA 5IT0A 3LP3A 3VQ5A 5EX3A 4ECRA 5J2NB 3NAIA 4M7YA 4YOEA 4LRCA 2DHAA 5ETRA 5GAEP 4J90A 2LMIA 3AQPA 3H45C 3L3UA 4LF6K 1S9GA 3CETA 1M1HA 4U67L 3OYEA 1ZC6A 1RA6A 1U4BA 4ED3A 2YKNB 2M3DA 2MMYA 4DR2J 2KB2A 2RIJA 2O1PA 1SZ2A 4RNOA 2XSJB 4H4OB 5A0YB 3GILA 2B43A 1SCJB 3ZSQA 3D6FB 1JLEA 4UUXA 1IN0A 1NAQA 3GR0A 4MIAA 4U7BA 5AE1A 3POTA 3IR7B 2GQQA 2WVFA 3IWLA 4V1Ak 1AA1B 3MCSA 3CCMS 1R8PA 1D5AA 4F0MA 4B1XB 2D9PA 1SBRA 3VQDA 1IKVA 2F4VJ 3LALA 2ZBIA 3MEKA 3C6UB 2B9XA 1KVAA 3CTRA 1SKRA 4OJHA 2FVPA 1OY9A 5AZJB 1PCAA 4IDHA 3WHIA 4LF7F 2IJRA 1VQON 2EC0A 2DH7A 4RTFD 5I3PA 5BPLA 1LW0B 2QZ8A 1WWHA 1I51B 1S1TA 3PW4A 2EXUA 2CGJA 3EKUA 2JEFA 5LL6Z 4BS2A 4OYXA 1GLJO 3M6GA 1VRQC 3AVNA 1TVRA 2FZCB 5ETSA 3R7BB 1Q8BA 3VQ6A 3EX7B 2IVOA 4YB1P 1LOUA 3TAMB 1QZ5A 2WONA 1OQ6A 3HZ6A 3TR8A 3GP9A 4JKGA 1V5IB 3N4QA 5HRNA 1CJVA 3N5BA 2DIVA 4NI2B 3NMUA 4KT0C 2P9EA 1OPZA 2F63A 4DV6F 4JKCA 4FJGA 4BREA 4AHUA 4J7CA 1WKJA 4FZXC 4GO7X 3VGTA 2KT3A 1UFLA 2GGPB 3V9ZA 1GTHA 4DUYJ 3CYMA 3O1BA 2NZ4A 4IOAQ 4NLSA 1YITS 1NJXA 1ZBFA 3DOKA 4DPWA 3AFGA 3CCVS 5GMEA 2EPIA 1HNIB 2AJ1A 4WIQA 3H59A 1NGHA 3BH7B 2R2TA 2E20A 4ZDNA 4E7IA 4I6YA 2QYGA 4DV7J 5CQGA 2FIUA 3HI9A 4KHWA 1IKYB 4MK9A 1CQMA 2JSXA 3MXHP 4NA1A 1HPMA 2ZF5O 2IMWP 4K4YA 4A8YA 4YFUA 3WNEA 5IM0A 2GJFA 2Y0BB 5FDLA 5KT3A 3TVZA 3VGLA 5IC6B 4XDCA 2MGZB 3VPZA 3N4WA 4MKYA 4DR6J 2AJ4A 1P9YA 4FJ5A 2YKMB 1FW6A 3QWUA 4JKFA 3V9WA 3FGUA 1KSPA 4DU7A 3GBTA 5KFJA 3QBWA 4BROA 2DH9A 1OJ4A 5JUMA 1PJ5A 1DRZA 3NCQA 3JTNA 4GKJF 3SV3A 2A42A 1HI8A 3MM7A 5KPRA 3KZBA 5KFUA 5A8WB 3QNWB 3NBPB 1R0AA 1WEYA 4DTSA 5DG9A 2Q6CA 4L72B 3T1HK 5E84A 4H0VB 3EGVA 2QLJB 3UVJA 5DM6Q 2QLFB 3TNVA 1JL1A 4KH5A 3FCVA 5KFDA 1M5PC 3O3LA 2R7OA 1VK8A 4HVZA 2A1SA 4QU7A 2YNGB 4R0JA 2VQEJ 3ZEUB 3C94A 2IGIA 3BZQA 3KLEB 4J9OA 4QWDA 3TEGA 1CC8A 3KHLA 3CJ9A 1BCOA 2H65B 4KGKA 3WXLA 2R7RA 3ZZRA 2AW0A 1YVNA 1SC4B 1RT5A 3L95X 4X62F 2YNIB 2E5LJ 2DR8A 3GL1A 3QFUA 3KLVA 3SCJE 4UY85 2UYTA 3SQ2A 1V3SA 4OPKA 5KG0A 3ZZ0A 1N33K 2NNWA 2H3GX 1VISA 3U9ZA 3DLGB 1FFWB 2GBZA 2LU1A 1SI9A 2GHWA 4ZS6A 2JGUA 5HATA 3EZOA 1KONA 4FCYA 4EZ6A 2HW3A 1FVQA 2BQ3A 2G4BA 1V4SA 1GXLA 3ITHB 1RBSA 4Y0WA 3OQ2A 1ZAXA 5HANA 3CSKA 5IT9U 1S6PA 1ZBTA 3E51A 4WTOB 1XQSC 4DCHA 4I6MB 2L9DA 3M1VA 2ZH7A 2VF3A 3O3HA 4DL2A 5J1NA 1G3OA 1LK5A 5D3GB 1CVJA 1KCFA 5E3RA 2HHPA 2W9AA 3MAQA 5DG8A 2RS2A 3AVHA 3CD7A 4YDDB 1KEKA 1NZ8A 4CJSA 3SQ0A 5KFNA 2D5RA 3IR5B 3SSSA 5IT9O 5DDPC 2ZEJA 2JRSA 4CK3A 5FLXU 2KM8C 3K0JA 1JXEA 5GAHI 1RT1B 4BRKA 4BG8A 1EKSA 4CZEA 5KFAA 2X1AA 3VV2B 3QEWA 2QTWA 4RLEA 5E3CA 1X8DA 2O3DA 2DGSA 2HF4A 3MM8B 4BRLA 1ZXOA 4IFYB 2YX7A 4OJGA 4JS4A 2RDIA 4LH4A 4AHRA 4JI5K 3ULHA 2DNHA 3P83D 3BREA 1RWOB 1VBYA 4CEZA 5B0AA 1JK9B 5A76A 2RU9A 1SS6A 4X4QA 3AVKA 1WDTA 3MURP 4U7UK 4OYZA 2YKPA 1T0TV 4OYWA 2R8IA 3UKRA 2P9IA 1PSDA 3GFZA 4M5DA 2ASMA 1S0VA 4UOCA 3ENOA 4W5NA 1FE4A 3NGTA 4FF3A 4DR2K 4ES3A 3CCES 1GX6A 1MNEA 1U49A 2CNKB 2ATLA 2KXFA 3Q86A 2GVZB 1EX4A 1QTNB 1G2EA 3C16B 1F1BB 3ILLA 4CJWA 2AIRB 1LWFA 1RP5A 1QY7A 2OZSA 4OYAA 1KRPA 2CNLB 4JP8A 3M9MB 3QFHA 2F4VK 3Q2SC 5B08A 2ZUAA 2ACMA 2EFQA 4WFBQ 3HHKA 4X65J 3B54A 4MKVA 2J4RA 1GT8A 1C0UB 3CC2S 3JTPA 3NGYA 2FZGB 2WVDA 3VAGA 3R5BA 5I3UA 1YK9A 3JYTA 2O4IA 1UKUA 2BANB 2XY7A 5B09A 3TZYA 4AQYJ 2FQQB 2HFOA 1IKWA 4FJKA 3P96A 1CS4A 1WC0A 4X66J 4YHHF 2Q0RA 4RJVA 3M6VA 3TABA 4B1YB 1ZTWA 4B3SF 3G82B 3KUEA 5HBMB 4CZCA 5CH7B 5ETQA 3UN5A 4YOYA 3R8EA 4X64F 4FF4A 2UUCJ 2CQGA 3TAGA 1WC1A 4HCBA 5BR8J 3L3CA 3SSQA 3O6QA 2KM8B 2RD5C 4ZP7A 2F8EX 1KOOA 2LECA 2GZOA 1W2IA 3CHWA 3K89A 4CK2A 5BR9A 5E5NA 5C25B 4IOXA 1RXOB 2BQUA 1TMJA 3CDWA 4ANCA 4DUYK 1HR0F 1RTIA 1S1VB 4ITSA 2EK6A 1N5SA 3R5DA 4O4RA 3TWHA 1Q7YT 3WEEA 2DRDA 1C0MA 5E7OB 3D7SB 3ZTRA 1NB2A 4QAGA 1RHMB 1FDBA 3MXMA 1UWBA 3MPVA 3HJFA 3LZJA 1RT3B 2YX1A 3RB0A 4DV7K 2QC3A 3GE9A 2VB6A 2QN6B 1CEZA 6FDRA 2HNZB 2QFIA 3W3SA 4C8ZA 3LM2A 1YITN 2A2CA 3KWMA 4ECQA 4R8UB 1FTRA 3IR6B 2PBDA 3MD3A 1D8ZA 3Q23A 5ADZA 4DR6K 2WW4A 1SKUB 1XJWB 1KKHA 4N5SA 2DNNA 2Q2RA 1M1KO 3TEHB 3U7JA 1VQ4S 2WHOA 4TU9A 3QT7A 4EBCA 2HOEA 2VWBA 3BZKA 2BJ8A 7AT1B 1JLQB 4YOVA 4DR5J 2WAQD 4LVOP 4X4PA 2B4VA 4Z0UA 3MX2A 1RHQB 4IR1A 4DR1J 3CC7S 2WSFC 3IG1B 4GKKF 1QQCA 1UW4A 1T7PA 2DH8A 3C14A 4F3QA 5EY4A 3ILOA 5HAOA 3LDLA 4H5VA 2CNOB 1TKXA 2L41A 4DSKA 3I0SB 3FZHA 2UP1A 2ZM6J 2A3JA 2FF3B 2UV8G 3QICA 1LWEA 2I5JA 3KMSA 1RWXB 3NCRA 1RAJA 3G6VA 2EWSA 4FF1A 1JNRB 4WZQA 2ZVIA 5KQDA 3D45A 2BM0A 4MMOA 4DG1B 3G8TA 3HSJA 2A3ZA 3NMAA 1MN7A 1I6JA 4FJHA 2FVQA 1HYSB 4ZLPA 5KTQA 5CA5A 2IVPA 4KHSA 4ZLNA 2DPIA 3NGKA 4OZ0A 2DITA 1TUVA 4DKWA 1UPMB 4IJNA 4OYMA 2QWNA 2M9KA 1EZZB 3CC4S 5LMNJ 3K9KA 1N56A 3DRYA 4UUWA 3M2UA 4LF8F 3T6JA 3D67A 2PE8A 4CLTA 1T94A 2NRWA 1RAIB 2C2ZB 4MAKA 4P10A 1H7XA 2XMJA 4IR9A 4Z4FA 4ID5B 2ZBRA 2J6SA 4Z7CA 3FBBA 5DZ7A 4LQ9A 3QIOA 4OL8A 3TTFA 4FYWB 4JOUA 3G25A 3DNCA 4FJ9A 2YKQA 1JXLA 3FSYA 2XMVA 2BMBA 1M90O 5J2NA 2R42A 1JLGB 3W9HA 3NGZA 2V7YA 1C2PA 1B4SA 2HAFA 2MLYA 2GX8A 2BABA 2DHHA 4TVAB 4MTPA 5AQPA 1N6QB 4DSLA 1Y00A 2IRXA 3HVRA 3UDCA 4USVA 1FNMA 5DJBA 4CZJA 3NOGA 1SJ3P 2XSJA 4H4OA 3AOAA 5A0YA 1NK8A 1RTDB 1P6TA 3OBYA 4CJRA 2DFHA 1LWCB 3D0HE 1Y97A 4C8YA 4PKIA 4UQGA 1D9FA 2PFDA 5D0RA 1Y5NB 1H7WA 3UCUP 3R27A 1TK8A 3NNCA 3KDNA 2NXNA 4I56A 1JQGA 2KT5A 2PFFB 4A47A 3NRBA 4CLZA 1SUQB 1SQFA 4DV2J 4CEQA 5D0GA 2P9LB 4DBQA 4NZ7A 4FLXA 4DX7A 4S0MA 3CJQA 5AZJA 4B3RF 1DJ0A 3A3PB 2VFRA 2UZAA 1O8BA 4HDHA 4Y2IA 4Q2LA 4F2RA 1LW0A 2YTCA 3CJCA 1QHTA 3O3GA 4Y34A 5EDWA 1UEVA 1VQNS 4DR4J 2CQ1A 4H0TB 3B6PA 1K8KB 4NLYA 3PG9A 4OIXA 2QL9B 3GLJA 2QWQA 2C3UA 2C2EA 3KK2B 2IM1A 5ETKA 3NAHA 1W0HA 1T6DA 3E9PA 5IWAF 1Q7LB 3TAMA 1NOZA 5CY4A 2YWFA 5KG5A 3KOAA 4JI2K 4AH9A 4LF9J 3CCEN 2AGPA 4AFFA 4NI2A 1PAUB 3C6TB 3D1OA 3WQPA 3PW0A 3FZLA 4NXMF 4CF9A 2GGPA 1HL6A 1K8AT 4N41A 4DV0J 2G1HA 4AQYK 2W01A 4ER8A 4KHYA 1FFSB 1GLEG 5DLGA 1OYDA 3FGVA 2M2BA 1YTAA 2IJFA 3IN5A 4X66K 3BPDA 4USHA 1WC5A 2UVRA 1HNIA 2C1EB 4FWQA 4OKJA 3VQAA 1O0PA 1ZBIA 2IVYA 1IKYA 4YB7A 4ZVTB 2ASPA 1NSPA 2G8KA 4RUBA 3LW5C 1T9TA 4JYAF 1S10A 5TKYA 1NMEB 4URGA 5BR8K 2A41A 4F2SA 3AA5X 3C65A 3VGMA 2O4GA 2RHSB 2B8QA 2MGZA 2Y1IA 4AXJA 3WDOA 4K4VA 3BP8A 3U1LA 3A13A 1TL7B 2YKMA 2HLUA 3D7EO 2Q0UA 3H7HB 1T05B 2UUBF 3IUCA 2FLNA 1YHQS 2GW8A 3CD6S 1D09B 2NCKL 1X3NA 2VDIA 3JSMB 1N34J 3FFIB 1RQ0A 2FLOA 2AA4A 5ADXH 5A8WA 3DXMB 5KI6A 4GVLA 3NBPA 4KREA 4TLRA 4PABA 3PJXA 1RU2A 2YHBA 4DR7J 2RPIA 3D1QA 1SB6A 1VSEA 2Z2YB 3JB9k 1XI1A 3GIIA 2YNGA 2W7OA 2FHMA 1K1QA 3ZEUA 4O3RA 5D0HA 5LSRA 2NZTA 1QAYA 3BQ0A 1RWMB 2Y1JA 1WEZA 1W97L 3HFVA 1FWLA 2BOPA 4GMJB 3PX4A 3DXKB 1RHKB 2GJIA 4DR5K 2LQ8A 3L6QA 1CLFA 2YNIA 3MDFA 3ETOA 1HX1A 2QA1A 3D0GE 2I0XA 3CCLS 1J53A 2HK3A 4E89A 1BHNA 2YKOA 3SUNA 3DLGA 2ZC3A 5FPNA 1VQ4N 2ITGA 3B78A 3VCDA 3HOTA 1NK4A 4CEEA 4CI0B 3BGLA 4CLYA 3PYEA 1F3FA 3ICLA 2ZM6K 3ITHA 4QWEA 1BD6A 4DTNA 2KN4A 5HQMA 1YVFA 5E3QA 3WXJA 4ILGB 3CGIA 4I6MA 4XO0A 1B9DA 2NRZA 3S3NA 4ECYA 5AE2A 1MMNA 4CEBA 1VHIA 2BXJA 3HPGA 3CC7N 4B9MA 2XO7A 2GO8A 1U1NA 1WG4A 5D3GA 4FXDA 2G8VA 5F8IA 3CFRA 1EO1A 3BV8A 5KFWA 4AD6A 3QINA 4XPEA 4ERDA 3K5OA 1BISA 1G99A 3HHEA 2VBWA 3OTBA 2Q1NA 1S9EB 1LXJA 1RTZA 5GADI 4E7JA 3B8AX 2JVRA 5LMNK 1X5OA 4C2MA 3BSNA 5F8JA 4I9LA 3NF6A 4FWRA 4MLHA 1RT1A 3MAHA 5KFZA 1HNVB 5IQ6A 5K20B 5BN8A 2NXCA 3Q8QB 6FD1A 4NX9A 3MM8A 1ZETA 4IFYA 4LSLB 2YQ0A 2BJDA 2D0OA 3JXOA 2C3PA 4CLSA 1VHFA 1X4AA 3L8BA 3CC4N 5ETOA 1RADB 2YWEA 2JEIA 2OD4A 4M41A 5KQ8A 1MWYA 1TUYA 1I94J 2FBXA 1TELA 4WYLA 3LP2B 4J9MA 1WSHA 1RWNB 2HQIA 3BGUA 4WFXA 4OI1A 5D4NA 4BR7A 1GX5A 3K5MA 5AZIB 3SIPB 2ILYA 4PPDA 2GVZA 1VSIA 3EZUA 2HQGA 1URNA 2PC6A 3HT0A 5EXWA 4C23A 4QYRA 1QSYA 2DJWA 1W26A 2A40A 2B3TB 2YHAA 1S72S 3CW2C 2QSFA 1QS4A 2IRUA 3SQOP 3SBTA 5C24B 1BQNB 3NKYA 4NL5A 2QWOA 1R8BA 1SJ1A 1C0UA 2F4FA 3OTOK 3I32A 2PT0A 1IBMF 4CIOA 4ZJOA 2XM3A 4A5BA 1OKJA 2HS0A 2ZKTA 4EP4A 2NRVA 3HMJG 3D3BJ 4ZCMA 2BANA 1O51A 5GADP 4IQXA 1XNRK 2H1YA 2J8AA 1HNXJ 4DR4K 1SIZA 3O5TB 5FROA 3R5JB 5D78A