3OTOK

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3otoK00
4B3MK 4DUYK 5LL6Z 1IBLK 4GKKK 1I94K 4V19S 4LF6K 2VQFK 4LFCK 4LFBK 4LF8K 2UUAK 1XMQK 4X66K 4JYAK 4JI6K 1N33K 2E5LK 4CW7B 3OTOK 4DR5K 5A2QO 3T1YK 3J7AP 4JI4K 1IBMK 4AQYK 4DR1K 1IBKK 4LF7K 5IWAK 5LMNK 2ZM6K 4DV2K 4JV5K 5LMUK 4NXMK 4K0KK 2UXBK 1XMOK 4DV3K 4DV4K 4X62K 4JI1K 4DR2K 1N36K 4LF5K 1XNRK 5IT9O 2HHHK 4JI0K 2UXCK 2VQEK 5BR8K 2UUBK 4JI8K 4DR6K 3J7YP 3T1HK 4DV1K 4DV0K 4DR3K 4NXNK 4GKJK 1FJGK 4DV7K 1HNWK 4YHHK 2F4VK 4B3SK 4DV6K 3J81O 4CVNE 4JI3K 4LFAK 1XNQK 3J80O 4OX9K 2UXDK 4JI5K 4LF4K 1HNZK 1HR0K 4YY3K 4X65K 4B3TK 4KHPK 4DR7K 4JI7K 2UUCK 1J5EK 5AJ3K 1HNXK 4JI2K 2UU9K 4X64K 1N34K 4DUZK 5FLXO 3JAMO 4DR4K 4LF9K 1N32K 4B3RK 4DV5K
chains in the Genus database with same CATH superfamily
4LSNA 4CIFA 3KIOA 4BDPA 2KW4A 3KWIA 3CQYA 3P4IA 4E7JA 3HTVA 4GKKK 3CC4N 2QI2A 3TAFA 2PY5A 1BUPA 1YT3A 2QWNA 4B9VA 4LF8K 4FJ5A 1O13A 2PYLA 1RDWX 4KKOA 4JYAK 4LSLA 4J2EA 1JLFA 4DSFA 3LDSA 3MWPA 1TAUA 1RCHA 1RDUA 3OTOK 4XH4A 3R1XA 3EEQA 1GLCG 1C1AA 5C42A 4JK8A 5HL7L 3U6FA 1KD1O 3T1YK 4WQ4C 1U48A 4ISFA 3J7AP 1W7AA 3C6AA 4QS9A 4YOXA 3CXCM 4DB3A 3TSUA 2ZM6K 4QOZB 5J2MA 4ILJA 4G1QA 2F8TA 4MQ3A 1U2VB 4IFYA 1QZ6A 5EX5A 4ELVA 3I33A 5T7BA 2IC3A 3ZT0A 4CJ7A 3LAKA 1LAVA 1BO5O 4NCBA 1HPZA 1BISA 3OYMA 3KLGA 1XHXA 3ENBA 4CHZA 4K8ZA 2OPSA 2UUBK 4WCEL 5HBMA 1JLCA 2V7ZA 5DMRA 3AO1A 4CFAA 4CEEA 3VESA 1NOYA 4CEQA 3OYEA 4J2DA 2YCHA 1NM1A 1TK0A 2GWKA 4XH1A 4LFAK 3MN9A 1YUWA 3O1WA 3CCQN 3QNOA 4MLHA 3PV8A 1DTTA 1J9AA 2B6AA 2ZE2A 4JI7K 1VSKA 2O8EA 1HNIA 1S22A 3K59A 1L5UA 3JS6A 5FRNA 2UU9K 1RT5A 2P5OA 1LV5A 3SAFA 4HTUA 2BTFA 1IG8A 1NU0A 2FC0A 1UAXA 1S3XA 3CQXA 4BVOA 2RE2A 3B6PA 4LF9K 3TAPA 2HOEA 3DLGA 3SZ2A 2GWJA 1J54A 1ATSA 1I94K 1R59O 4Y1DA 4V19S 3TABA 3KK1A 3T3FA 3VEZA 5KPRA 4FCYA 3CHWA 4CHOA 4OKJA 1VQPN 1EXQA 3AVIA 2OA8A 2PYJA 1IJJA 1T03A 1XC9A 1N6QA 4DQRA 1XWLA 4BRMA 4BC4A 1L3UA 3KK7A 5AZJA 3KKSA 1SKWA 1TAQA 3PO5A 3HOTA 2P9SB 1IO2A 3TARA 4BG8A 5BRFA 4YORA 3H3OB 4ID1A 3VEVA 3RVCA 1C6VA 1VQNN 3HXMA 4L3QA 4B3OA 1U4BA 4X62K 2DY4A 1Q9XA 1RBTA 3RMDA 4JI0K 1TK5A 3AY9A 4KB0A 3SUPA 3CQ8A 3J7YP 3C7NA 5F0XA 2P9IB 5JLFA 4DV0K 1XC3A 4YDUC 5BPMA 4FVMA 4H0TB 4NO7A 3L3VA 2E6LA 3AA5X 3QFPA 3LPUA 1OVYA 1HKGA 1ILYA 2ZQBA 1GLJO 1VAZA 1S1XA 3ZSQA 3CCLN 3KK2A 1S1UA 4FLYA 3VQ8A 2KKZA 2IVPA 3PSFA 3THWB 4WQ5A 3SMPA 4E7LA 4XIUA 5ADXA 4OO1J 3I55N 1NKEA 3KZBA 1WN7A 3ULEB 1D4XA 4FPBA 3SQ4A 1YTUA 1OH8A 3VTHA 5LL6Z 1NGCA 2F7TA 4BRDA 1E3MA 1T3VA 1T6CA 2OZMA 2RPIA 4O0IA 4IWVA 4QCLA 1CXQA 2E2OA 3PLAA 4QAGA 3D2FA 4JKAA 5M1PA 3HO1A 4BROA 1YAGA 4OGCA 3ZCMA 4KV8A 1DEJA 2FBXA 3CJBA 3VQ5A 3MN6A 4E19A 3HJFA 1D9DA 4IFEA 1KSPA 4M42A 1QHAA 1OH6A 3QFUA 2HBJA 4FWLA 4DR1K 4WFNL 3MCAB 3K5LA 3H3NO 1RBSA 4DFMA 3UKUA 3JXUA 4B8CA 1NK7A 5SZTA 1MU2A 2KTQA 4J8FA 2E2NA 4FJHA 2GTDA 2IVNA 1BHLA 1NGEA 1KVAA 2EHGA 2HHHK 3WNGA 4CF9A 2HHXA 4IXCA 5KPZA 1OKJA 4EHUA 3VENA 2XY5A 3CJAA 2OYQA 3U4LA 4C23A 1KAZA 3A5LC 4E0DA 4Z0UA 1HX1A 5AQQA 3NDKA 3AO4A 1Q86O 4W5NA 1E4FT 3MWTA 3NBPA 5M1QA 4CJTA 4O8KA 4CF2A 1XHZA 3RMAA 2G8UA 2HW3A 4CJKA 1G15A 4JI5K 3ZSRA 1Z05A 3WQTA 3FZKA 4CJEA 4X65K 4BWMA 2ZD1A 1C0MA 4YDUA 3MECA 1EQYA 2I7NA 1QTMA 2FSNA 3KD1E 3O9SA 1YHQN 3RSEB 4BRFA 4PKIA 3M8RA 4AHTA 3DAWA 3O9QA 3JAMO 4ID5A 2DPNA 3KD5E 4KTWA 4CEDA 3LP0A 3CCJN 4FJIA 3QDKA 4B3MK 1BI4A 2PBDA 2E20A 3H45C 5GADP 1KFSA 4KHSA 4LF6K 2CH5A 2V52B 5BRDA 4CGGA 5AQJA 3ZEUA 3BF3A 3L8BA 1N5YA 4ILGB 1VQMN 2QWQA 3TTCA 3GE1A 3HYFA 2P9LB 2F8SA 1ZYQA 2OTJN 4JD2A 1W0HA 3OYLA 1NK8A 5AQTA 3SYZA 1TYQB 3SBTA 4A5BA 3AVLA 1WSFA 4DMNA 2ASPA 1WSJA 3AARA 3V4IA 5C10A 4WFAL 2QM1A 2O8FB 4BR0A 3MN5A 2JGUA 4OVLA 4BRHA 4NXMK 3F5TA 4K0KK 4HCCA 4F9OA 4DU4A 4ELUA 4H0YB 4KREA 2HNYA 3FE1A 3CMAN 3AVAA 5H1SQ 2FSJA 4M3YA 4M63C 2Q97A 2QKBA 3IS9A 4ELTA 1BA1A 3O3FA 3LWLA 4DS4A 4BY9C 2CGLA 2RF2A 3T1HK 1JCEA 3FFIA 5AQSA 3UE5A 3K57A 4GKJK 3FLCO 4NLBA 1FJGK 4CJ5A 4B9QA 4B1ZA 1TKTA 1QQMA 2V7YA 3AVCA 3CJ9A 3CCVN 5E26A 4DU3A 2BDPA 4O8UA 1ASWA 1X1PA 1LW2A 4BE1A 4PWDA 4CJQA 3L2RA 2VGNA 5AR0A 2CGJA 5LJWA 1V4SA 4B3TK 3QICA 4FJNA 3F9MA 2Q1NA 4BDYA 3OS1A 4DTPA 2G8HA 2OPQA 1W97L 4CEOA 1DKGD 1I3AA 4HCBA 4GVEA 3OYDA 3TAGA 3OYKA 3LAMA 3F2KA 4C8KA 3P83D 3WXKA 2X78A 5KPTA 3NVKA 1NJIO 2D0AA 2UYTA 3RRHA 2I5JA 3WUHA 1VSHA 3AAQA 3UKRA 1DTQA 3NCIA 4A62A 4LFBK 4YOTA 2OANA 4BC5A 4PUOA 4C8LA 1TUUA 3DOKA 4M7YA 3H1VX 3JSMA 1VSIA 2Z1HA 1RDCA 3AGKA 3MAQA 3EL2A 4IO9L 4E7HA 4N76A 2XHBA 2QWLA 3NH0A 1LWFA 4EFHA 1CLQA 1ASVA 1EWQA 2YHWA 3L4QA 4H4MA 4FWNA 3ZETA 4IOXA 4PL7A 4B9TA 4FVUA 4LF7K 3ZSZA 2IIRA 1C1CA 1RDDA 4HHTA 4JRPA 1JLQA 3BGRA 3V9XA 4HVJA 5C24A 1QSLA 3BZCA 3O4NA 3VQ9A 4FWSA 2UXCK 4CGFA 4RW8A 4OLBA 3EYZA 1CZBA 5BR8K 5C2DA 3H6EA 3EZ5A 4M45A 2XY8A 1NMDA 4DS5A 2O8DA 1GOCA 2NRXA 2AJQA 2IDOA 2EWSA 3ZSOA 3QETA 4M3WA 1NLVA 5BPLA 1NMNA 4FJKA 1ATRA 4H03B 4A2AA 2E2PA 3DLBA 3ATVA 4E89A 2G8KA 3KLIA 1YJNN 2FBVA 4CD1A 2YJEA 5E41A 5C12A 1YTAA 2DFFA 5M1NA 4KH4A 4MLEA 5DM7L 3WXJA 4I9LA 4BQLA 3CERA 3K5OA 2ZJRL 1XI1A 5CYMA 3PUFA 2GUPA 3AVKA 3O4WA 4CERA 3ZX3A 1XUPO 2O8BB 1CZ9A 4JS5A 4CEBA 3O3GA 1BL3A 3VTIA 1TGOA 5BRHA 1K8KB 3BZKA 2BANA 2GUIA 5AQZA 3SAHA 3THVA 4IDHA 4CI6A 5FRMA 2FXUA 1K9MO 3NF8A 2VYPA 3G71N 2A3ZA 3TTDA 1RT4A 1N33K 4BRQA 4I2PA 3KHYA 1VQ7N 1QSSA 3IKMA 1VRTA 3GBTA 4JKCA 3VQEA 2HSTA 3G25A 3KLHA 3BP8A 1KAXA 1IBMK 4GW6A 2A1RA 4FPAA 4IBNA 1LAWA 3IAYA 1HLUA 1SL1A 5AFUH 2A1SA 4PL8A 1GOAA 4ISGA 4YNQA 4H0OA 1RTIA 4O5BA 3THXB 1VSLA 3JYTA 4FW2A 2E2QA 4K25A 4EIAA 1XMOK 2ZJPL 4A61A 4DV4K 3IG1A 1I39A 1RTDA 3W0LA 1A5XA 1VK0A 1C0GA 3ULEA 4BE2A 2VG7A 1WSEA 1YJWN 3OBWA 3S41A 4BACA 3THYB 1WOQA 4IFVA 4KHWA 4CF1A 3U9ZA 4AM7A 2WC9A 3DXMA 3SJJA 3KVGA 1VSDA 4CBUA 4CFDA 2W42A 1ZXOA 1U49A 2P9NA 3J81O 1KVCA 4DV6K 1GLAG 4BRAA 4CESA 3RWUA 1YVUA 1GOBA 4YY3K 1WBDA 4BR9A 4NLCA 2ATQA 2YJFA 2HNZA 1HRHA 2W40A 3MXIA 3E9PA 1YXQA 3VEXA 4JI2K 4BRNA 4E7KA 5KRTA 4MDBA 2E1YA 3F9KA 4GV9A 4JKEA 3MMVA 3CYMA 3LP2A 5FPNA 4DV5K 4WQ5C 4LC9B 3P5JA 1EWRA 1X9SA 2JWLA 3LDQA 4FOIA 4BR5A 4NYNA 1IBLK 3WXMB 4CJ4A 3VA0A 4JK9A 4CJ3A 3PY8A 3SCXA 1SKRA 4KFBA 4FJLA 1RT1A 5AZIB 2VQFK 4CEFA 4JHDA 3NHGA 3AVJA 3U9DA 3O1BA 3N4PA 5BREA 2YNIA 1ZBLA 5HP1A 3QBWA 5KTQA 3HPGA 3BEXA 4U67L 1EETA 1NGDA 4FK2A 4OPHA 3CFOA 1NJXA 2Q36A 4A59A 5DM6L 1JCGA 4CW7B 2HMPA 3L2VA 2NRVA 2QWOA 3SUNA 4I6MB 4XH5A 3P1GA 4HWIA 1X9WA 3AVFA 4CJLA 3D0PA 3GL1A 2HNDA 4Z4HA 4DV2K 4FWRA 1UA1A 3LP1A 4DV3K 3RSEA 2HMIA 5KGXA 1KC8O 4K43A 4CJVA 1X9MA 4UQGA 1DT9A 1VSMA 5CR4A 4KTQA 3C6TA 2GX9A 3HP6A 3D45A 4H5RA 4O0JA 4RWTA 3RTVA 3CETA 2KFNA 4H4OA 4Y1CA 3QESA 3FGUA 1Y64A 3EKUA 3EN9A 3HK2A 3ZT1A 5GINA 5C25A 3B6OA 2VG5A 3UIQA 4C8OA 1HJOA 4CEZA 3HM9A 3J8AA 1SL2A 2E1ZA 2RHKA 1HQUA 3MEDA 1KTQA 3WNHA 2QK9A 1XNQK 4OX9K 3C94A 2OZSA 3EE9A 1ZBUA 5GIOA 1MDUB 4OPJA 2P9LA 4KHNA 4C1NI 1NJWA 1S6PA 3V6DA 4YOUA 3M3ZA 4BREA 2ETJA 4FM1A 3DJCA 2ITMA 1NK5A 4GVMA 4KH5A 3QERA 5AJ3K 4J2BA 1BIZA 3PO4A 3KTQA 3M8SA 1Z6RA 3S3NA 3E01A 3TTFA 5FLXO 2FSKA 4CGIA 4FLZA 3J7ZO 3L4IA 2GEMA 3VN5A 1SQKA 2GBZA 3WEEB 5GIPA 1HMVA 1W2BM 3I8BA 4AHVA 2NRRA 2YKMA 1RT3A 3CG7A 3B8AX 4BR7A 2F96A 4PHTX 4NCAA 4WE1A 2P51A 4K41A 4A2BA 3HI0A 3SLCA 1NGHA 2FF6A 4H5WA 4JI6K 4WFBL 3H46O 3ZX2A 4DFJA 5KQ8A 5A2QO 1OH5A 2BE2A 5EOYA 3CC7N 3EKSA 2F9TA 3G0ZA 3VQPA 3NMUA 4FLWA 5LMUK 3O5BA 3VQ7A 3DM2A 5CYQA 4W5QA 1YJ9N 1G99A 5JS1A 4BC2A 4H0PA 3LDNA 2P9PA 4FOEA 3OYJA 4DSLA 3OW2M 3V9ZA 5E84A 1NNEA 2YHYA 4RTFD 4K42A 3OYAA 3GDQA 2O8CB 2YKNA 4CZMA 1QS4A 3QINA 3DRRA 3MX2A 2NUBA 4H5NA 1RFQA 3DMJA 3KLFA 3K0SA 3O9TA 2IOCA 5F1XA 3M8QA 3E9LA 4JRQA 1MWKA 4FZYA 2X6NA 3U3YA 1B9FA 4JKGB 3CI5A 2A5XA 2X74A 4FWMA 4DQIA 4CBWA 2HHUA 5SWMA 2O4IA 4H0XB 3HSCA 2KLAA 3HBTA 2YHBA 1NGFA 3SMSA 1HYVA 1JL2A 4I2QA 3QEVA 1HJRA 5BN9A 3ZX0A 4JEPA 2P9KA 3HT3A 2ZF5O 2FBTA 3OYBA 1TUYA 3L2WA 1A5WA 3MN7A 1S72N 4N56A 4GMJB 1VSEA 2O8EB 3TAQA 2ASOA 4ICLA 3KLEA 3ZSXA 4NB4A 2D0OA 2IAJA 4BRPA 3MK6A 2Z1GA 4RW9A 5FPMA 4F2SA 4LFCK 2AA4A 3O08A 4KPYA 5M1KA 1KCFA 4M41A 3AVHA 4RG8A 3CCSN 1XMQK 4JKFA 4M7XA 4QS8A 2Q0UA 4OPKA 1UWBA 4JK7A 3VF4A 3L6QA 4I9QA 1VQ9N 4QS7A 3PX0A 1T6DA 4FK4A 4IOAL 2Z1JA 2AP1A 4RW6A 5AQGA 4AHCA 4Q5VA 3WXLA 3E66A 3NAEA 5IWAK 3A2FA 3D6RA 3SPZA 1LWCA 4OPAA 2ASMA 1V4TA 1BWFO 3AA4A 2P9UB 1RNHA 3BY5A 4FXDA 3LM9A 1TL3A 4RW4A 5MLCQ 2Q3SA 5J2NA 1N36K 4CJRA 1WB9A 1DGKN 2O8BA 4CGHA 1OVQA 4Z94A 3OA9A 2WOMA 3CCMN 4FLUA 5AQHA 4DQQA 1YVNA 3DLKA 4OGEA 3D2EA 2O4GA 2QWRA 1K8KA 2FF3B 1J5OA 5AQUA 3AVMA 5GAHP 4DV7K 2LSNA 2R7YA 3PSIA 1ITGA 1B92A 3P39A 4B3SK 2G8FA 4CVNE 2YHAA 1BCOA 2QA4N 3SAGA 2UXDK 3C7NB 4OKKA 1HNZK 5ADXH 4CHYA 5HROA 4CZFA 1RDBA 2B4JA 3LP3A 3VEOA 5M1OA 5AQLA 3G10A 1D5AA 3P31A 2YNHA 4FJJA 2D5RA 5JVGL 1ZBIA 3N4QA 1TVRA 4JKDA 4YOVA 1LCUA 4CZEA 5AQMA 2D4WA 3V1QA 4GV3A 3PX6A 1TKXA 3V1RA 3C95A 3R8EA 1JXBA 3LALA 3EE8A 1C1BA 3QB0A 2A42A 3KWGA 3OVNA 3CM5A 4C8NA 1ATNA 3DYAA 1JL1A 4RCHA 1QE1A 1S1TA 3R6MA 3O3HA 3DLLL 3THYA 1REVA 3AA3A 3ZSVA 3NE6A 3DRSA 4MFBA 3OYHA 1TKZA 5AQFA 3HRGA 5D3GA 2NRTA 3QMLA 3TAMA 1U2VA 2VG6A 4I7FA 3K9JA 1BQNA 3FFKB 3NFAA 3P38A 3D2FB 3K5MA 4E7IA 1JLAA 5EXWA 4DU1A 2HHVA 4M3XA 2CH6A 1IBKK 1RTJA 2G8IA 4NYFA 1Q8IA 3O9RA 3D7EO 2HF3A 3GG4A 4DF4A 3CF5L 4IO8A 3QEIA 3SI6A 4CJFA 2X6SA 2G8WA 2E6MA 4PY5A 1RBVA 1CXUA 4KHUA 3C65A 4DTRA 1NK0A 1K8AO 1IV0A 3UKUB 4JI8K 4DR6K 1Z26A 3CIPA 1VSFA 3DLHA 2HBKA 2A41A 1RT7A 2QEXN 4KB1A 4GNIA 4BRKA 2EX3A 4DQSA 1C0UA 5J2PA 5AZIA 4IDKA 3NF7A 1HPMA 3VGMA 4CF0A 4FJMA 5EY4A 1NGJA 3ZT3A 4BC3A 5HRNA 3S3OA 4DSKA 4KTZA 1HR0K 2CGKA 2H3GX 3QLHA 2QWPA 3VF2A 4ISEA 3OYFA 4HUGA 5AQIA 2OPPA 5AQNA 4FJGA 3ZYYX 3IFRA 4I6MA 1KQSM 2DFEA 5CY4A 4DQPA 3M1FA 1GLBG 2BGGA 3A5MC 4DUZK 4DLGA 1ZBHA 2QXLA 3WT0A 2Q31A 4IJNA 1NGAA 4CECA 4BG9A 2GV9A 2VWJA 4CJWA 4EZ6A 1RILA 2F9WA 1VSJA 2QTDA 3QO9A 3PIPL 5B8HA 1NG9A 4A57A 2E8AA 4B9SA 1U47A 4FLTA 2HHQA 1YIJN 5CE3A 1FW6A 1FXXA 1BU6O 5JS2A 2P9SA 4FM2A 3SJHA 5GAEP 1JLGA 1BI4B 2YV0X 2FLOA 3T7ZA 1NJYA 1QQCA 4CZHA 2PZSA 4DG1A 1JKHA 3O9UA 1RTHA 1ZBSA 3ZEUB 3VQAA 1D8YA 4IZ9A 1SZ2A 1U45A 1VQKN 3CCEN 3HL8A 4R5PA 4DTOA 2XRIA 4A5AA 2WUSA 1WLJA 3VEYA 1EKEA 1KLMA 3I0SA 5LY3A 3DOLA 3V1OA 1F21A 4BWJA 1GLDG 5I42A 4BRLA 2P9IA 2XO7A 1IKXA 4JS4A 3L2UA 2P5GA 1XNRK 5KGWA 5I3UA 4IOCL 1ESVA 1Q7YO 3O80A 1IKYA 2QKKA 1U04A 4BRGA 4CHNA 3KK3A 1L3TA 3CD6N 4N5SA 1WNSA 4BQZA 3TI0A 4DV1K 1A5VA 3NH1A 3WXIA 4IEIA 3LPTA 4EAHD 3VETA 1IG9A 2F4VK 4BVPA 4KHYA 1C0FA 1S9EA 3THWA 5KQDA 4AHSA 3J80O 4Z4IA 3ULDA 1RT2A 3ID6A 3LDOA 3FZLA 3TAEA 1TL1A 3LZJA 4Q0BA 2RN2A 4LD0A 3CM6A 3VF6A 3IDHA 3CMEN 2KHOA 3IRXA 1M90O 3CFRA 1QSYA 1QQOA 2NNWA 1HUXA 3U8XA 2YX6A 4ZHRA 4CE9A 4UY8O 2YNFA 5HRPA 1NWKA 4BRIA 1TK8A 4Z4CA 3ID8A 4KRFA 2UUAK 1IKWA 2DFHA 1HQEA 2O8CA 1UA0A 4B1WB 3A8YA 5AQWA 1J53A 4IG3A 5JMVA 2KFZA 4CFCA 3QEXA 1BGXT 2V51B 3Q7BA 4CIGA 3UKRB 3FZMA 4H5TA 3VQ4A 4PA1A 1L3VA 4Z4GA 3A0IX 3M8PA 3WNFA 1KXPA 2D0PA 5JVHL 3L2QA 3CJ7A 5KRSA 3K5NA 3TANA 4HUEA 2NRZA 4JKGA 5AQVA 4BGBA 4EZ9A 4LY7A 4CK2A 1HYSA 4MO4A 1S9GA 4Z4EA 4AQYK 3W3DA 2HVIA 3AAPA 1KVBA 3TPQA 3OJSA 4DTMA 2ZJQL 1EO1A 3K58A 2IGIA 2HHSA 3ZETB 1NOZA 4NCGA 1NK6A 4DTNA 1MA9B 3QBXA 3WQUA 4CJSA 3VGLA 2VQEK 1KAYA 3LM2A 4WF9L 2ZGZA 3DRPA 4DWIA 3MCPA 4B1XB 1RDAA 4BGAA 2IVOA 5J1EA 1B9DA 3HVTA 4E1NA 3ZLJA 4DR3K 2ZWHA 4DSJA 2W41A 2Y1IA 1KRPA 5HLFA 4FM0A 3AVNA 3H08A 3MEEA 5I9EB 2NLXA 2NZTA 4L8RB 2Q2RA 3O8MA 4DQ8A 3SQ1A 4DSIA 2O8DB 4B1VA 4CCHA 4JKBA 1FKPA 4KHPK 4TSXA 4FO0A 2I7PA 2KZMA 1JLBA 5M1FA 1S5JA 4CD3A 4JKHA 1J5EK 4B9UA 1YF5L 1O1WA 1NJZA 1L3SA 1R0AA 2GELA 1N34K 3NF9A 1NKBA 1HKBA 4CIEA 3DXKB 3RR8A 1QZ5A 3SBGA 1KLNA 3ENOA 4W5RA 3FR0A 2FBYA 1K73O 4FJXA 2P9UA 1BG3A 2NRHA 4LH4A 4CZKA 4DUYK 3HVRA 4U7BA 4CK1A 4FWKA 1DLOA 3I8DA 1NK4A 4YOYA 5EVZA 3VMFB 3AVGA 4FZZA 1K6YA 1RBRA 3HZ6A 4B1UB 4BR4A 4RW7A 4Z4FA 1TYQA 3OS0A 4CZGA 1WSIA 4E1JA 4C8MA 4B9NA 4CZLA 2O8FA 5K14A 3ZSYA 2Z1IA 2D1KA 4WQ4A 3VERA 4CEAA 2BH1A 3OYGA 4DR5K 4O55A 1VQ4N 1EP4A 1QVGM 1SL0A 4DFPA 3TWHA 3I0RA 3RMCA 4KAZA 1M1KO 4JI4K 4AHUA 1JJ2M 5JICA 4JV5K 4CGDA 1JXEA 4AHRA 3C6HA 3OS2A 5HOOA 4DTUA 4EHTA 2W6KA 3SK3A 3O6WA 4JI1K 1BIUA 3VQDA 5IT9O 3MX5A 4DFKA 2ZGYA 5FPEA 3V9SA 4JNEA 3LANA 3QIOA 3VEWA 1TV6A 3TU5A 3KKRA 1JCFA 3LZIA 4BDZA 1XQSC 2XY6A 4EP4A 1D9FA 3V9UA 4M3ZA 4YHHK 3M6GA 4WYBA 1IH7A 3F73A 3A5OC 1QVFM 4JI3K 2E4LA 1SUQA 2XY7A 3QEPA 5BN8A 3ZT4A 3VQQA 2KZZA 4FYDA 2J4RA 3DXMB 4DTXA 3V81A 1BCMA 2QXFA 3VQCA 4B08A 3LWMA 3Q7CA 3T1AA 4H5VA 3A5NC 1Q18A 4CZIA 2P9NB 3DI6A 1ZBFA 1E4GT 1BA0A 4H8KA 3EO3A 2A40A 4F8RA 4OLAA 3AVBA 2HBMA 3NF6A 1SKSA 1J6ZA 4DHYA 2OPRA 1LOTB 4EP5A 4FSVA 4PKHA 1VRUA 4CBXA 4IEEA 3EY1A 4FWOA 4DCHA 4DKWA 4KI6A 3CJCA 4XEIA 1FK9A 1JLEA 1SAZA 3AO5A 4CF8A 3S3MA 2BUPA 2E5LK 3CCRN 2PFUA 5TKWA 3RR7A 4PKGA 4JHDB 5HRSA 2VGMA 5AQXA 4B9MA 2QWMA 3CJ1A 3BUZB 1HKCA 4FJ7A 3H1QA 4H0VB 3OBYA 1FKOA 4ILHA 1NKCA 3VQ6A 3VA3A 2UXBK 1HYZA 4FWQA 2Y1JA 5C0YA 2DTUA 1VQON 4DR2K 3QIPA 4LF5K 1QQNA 4JN4A 1X3MA 5J2QA 4KBOA 5AQRA 1YITN 5ELZA 4FWPA 3CPEA 3O4QA 4CHPA 4DF8A 4OJRA 3FZHA 4YOWA 1HNWK 5AZJB 4FJ9A 4YFUA 1NGBA 2A6AA 4AH9A 3QEWA 3MEGA 1VQ8N 4JLHA 4F2RA 2WBNA 4OKEA 4CHQA 5FROA 5JLHA 4KH6A 4DR7K 4B1YB 3BDPA 2UUCK 2P1JA 3RRGA 4GY2B 1WAJA 4N47A 3HPOA 1GLLO 3OYCA 1Q9YA 1TKDA 4E1MA 4ZTFA 3SUQA 3AV9A 1BDGA 3RMBA 1LWEA 4BE0A 3HP9A 1CZAN 1HNVA 5FPDA 3FZFA 4O4GA 3SUOA 1P8ZA 4E3SA 2VCPA 1T8EA 3C0BA 3ISNC 3ENHA 2YNGA 3IUCA 1Q81O 4O5FA 2JLEA 5DK5A 5KI6A 3HOSA 5C2FA 3R3LA 4FLXA 1T44A 5EU7A 2WTUA 1BOTO 1WBBA 2Q0RA 3M5RA 3THXA 4CJPA 3AO2A 5TKYA 4KHQA 4CK3A 1VHXA 5CHIA 2VWKA 4FZXC 4FJ8A 3NH2A 4M3TA 3V9WA 2WONA 2RKIA 2OTLN 3G6EN 4G9ZA 3ATUA 3HM8A 2D0BA 5LMNK 4MO5A 3ALYA 3E1YA 3NGZA 3G4SN 3IMXA 4CJUA 3LL3A 1P90A 4IKFA 1Z25A 5AQOA 4BR2A 5HRRA 3SQ2A 2WFBA 4AILC 3OYIA 5AFUA 4W5OA 3TSQA 3U3GA 5BR9A 2HBLA 1SV5A 5F2RA 3SV3A 3DLEA 3OHRA 3T69A 1NGIA 2P9PB 1VQ6N 4CGJA 3SPYA 1WSGA 3E9OA 1W9HA 4FLVA 2HHTA 4HUFA 4B8AB 1UOCA 1GLFO 3MXJA 4O44A 2IS3A 2HVHA 1OH7A 3K9KA 4CZJA 1RGIA 5AQPA 4K8XA 3VOVA 4LF4K 4KI4A 2ITGA 2D0CA 3DLRA 3VPZA 1MWMA 2E88A 1C0TA 4Y0WA 1SS6A 3DWLA 2QW9A 1X3NA 1NGGA 3GOIA 4FL9A 5AQYA 3MDQA 1ASUA 1HNXK 4X64K 3CC2N 3CCUN 2OCEA 1LW0A 4LH5A 2G8VA 1N32K 3C6UA 1ZC6A 4B3RK 2HF4A 1RBUA 4MDAA 3AA2A 3T19A 3K2PA 3VGKA 4FW1A 5AQKA 4M3UA 3AO3A 4M3RA 1T05A 2P9KB 3NVMA 3PIOL 2HHWA 3ZSWA 1WSHA 1WUAA 5LJVA 1NBWA 1H1VA 1Y97A 3QNNA 1YI2N 3TR8A 3OY9A 1T7PA 4DTJA 4AF1A 4X66K 3ITHA 4PQUA 1RT6A 2W6LA 3AGRA 4R79A 4BRCA 5C15A 4JAXA 4F3OA 3OJUA 1Q82O 3SNNA 3VQBA 4ZTJA 4J2AA 5GAGP 2B5JA 2PAVA 2YHXA 3S9HA 3EZWA 2YI1A 5CZ1A 1IKVA 1S1WA 4C1NK 1GLEG 3ASMA 2VWBA 1QHTA 3I56N 1U6ZA 1VQLN 4B9LA 3DXKA 4IG0A 3SV4A 1BQMA 4KO0A 3OYNA 4GV6A 3PX4A 3LDLA 3SQ0A 3L3UA 4F4KA 3WNEA 4HTLA 1X9JA 1VQ5N 2JWKA 4DTSA 4NXNK 4JD2B 3BF1A 1EX4A 3R9PA 5CZ2A 1KFDA 3KJVA 4W5TA 4AM6A 5FDLA 3TSPA 3CPWM 1WAFA 3D2EB 3HPHA 1S1VA 1NK9A 3NGIA 4N41A 4F3TA 3WEEA 3UB5A 4CFBA 3HSTB 5BPNA 2KQ2A 3ZT2A 4DLEA 4IJAA 1N8RO 3MXMA 4DSEA 3LDPA 1S6QA 3L0QA 2NRWA 2HB5A 4FK0A 4DR4K 3CFPA 3NGYA
chains in the Genus database with same CATH topology
4B3MK 4DUYK 5LL6Z 1IBLK 4GKKK 1I94K 4V19S 4LF6K 2VQFK 4LFCK 4LFBK 4LF8K 2UUAK 1XMQK 4X66K 4JYAK 4JI6K 1N33K 2E5LK 4CW7B 3OTOK 4DR5K 5A2QO 3T1YK 3J7AP 4JI4K 1IBMK 4AQYK 4DR1K 1IBKK 4LF7K 5IWAK 5LMNK 2ZM6K 4DV2K 4JV5K 5LMUK 4NXMK 4K0KK 2UXBK 1XMOK 4DV3K 4DV4K 4X62K 4JI1K 4DR2K 1N36K 4LF5K 1XNRK 5IT9O 2HHHK 4JI0K 2UXCK 2VQEK 5BR8K 2UUBK 4JI8K 4DR6K 3J7YP 3T1HK 4DV1K 4DV0K 4DR3K 4NXNK 4GKJK 1FJGK 4DV7K 1HNWK 4YHHK 2F4VK 4B3SK 4DV6K 3J81O 4CVNE 4JI3K 4LFAK 1XNQK 3J80O 4OX9K 2UXDK 4JI5K 4LF4K 1HNZK 1HR0K 4YY3K 4X65K 4B3TK 4KHPK 4DR7K 4JI7K 2UUCK 1J5EK 5AJ3K 1HNXK 4JI2K 2UU9K 4X64K 1N34K 4DUZK 5FLXO 3JAMO 4DR4K 4LF9K 1N32K 4B3RK 4DV5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M K;  4DUY K;  5LL6 Z;  1IBL K;  4GKK K;  1I94 K;  4V19 S;  4LF6 K;  2VQF K;  4LFC K;  4LFB K;  4LF8 K;  2UUA K;  1XMQ K;  4X66 K;  4JYA K;  4JI6 K;  1N33 K;  2E5L K;  4CW7 B;  3OTO K;  4DR5 K;  5A2Q O;  3T1Y K;  3J7A P;  4JI4 K;  1IBM K;  4AQY K;  4DR1 K;  1IBK K;  4LF7 K;  5IWA K;  5LMN K;  2ZM6 K;  4DV2 K;  4JV5 K;  5LMU K;  4NXM K;  4K0K K;  2UXB K;  1XMO K;  4DV3 K;  4DV4 K;  4X62 K;  4JI1 K;  4DR2 K;  1N36 K;  4LF5 K;  1XNR K;  5IT9 O;  2HHH K;  4JI0 K;  2UXC K;  2VQE K;  5BR8 K;  2UUB K;  4JI8 K;  4DR6 K;  3J7Y P;  3T1H K;  4DV1 K;  4DV0 K;  4DR3 K;  4NXN K;  4GKJ K;  1FJG K;  4DV7 K;  1HNW K;  4YHH K;  2F4V K;  4B3S K;  4DV6 K;  3J81 O;  4CVN E;  4JI3 K;  4LFA K;  1XNQ K;  3J80 O;  4OX9 K;  2UXD K;  4JI5 K;  4LF4 K;  1HNZ K;  1HR0 K;  4YY3 K;  4X65 K;  4B3T K;  4KHP K;  4DR7 K;  4JI7 K;  2UUC K;  1J5E K;  5AJ3 K;  1HNX K;  4JI2 K;  2UU9 K;  4X64 K;  1N34 K;  4DUZ K;  5FLX O;  3JAM O;  4DR4 K;  4LF9 K;  1N32 K;  4B3R K;  4DV5 K; 
#chains in the Genus database with same CATH topology
 4LSN A;  4CIF A;  3KIO A;  4BDP A;  2KW4 A;  3KWI A;  3CQY A;  3P4I A;  4E7J A;  3HTV A;  4GKK K;  3CC4 N;  2QI2 A;  3TAF A;  2PY5 A;  1BUP A;  1YT3 A;  2QWN A;  4B9V A;  4LF8 K;  4FJ5 A;  1O13 A;  2PYL A;  1RDW X;  4KKO A;  4JYA K;  4LSL A;  4J2E A;  1JLF A;  4DSF A;  3LDS A;  3MWP A;  1TAU A;  1RCH A;  1RDU A;  3OTO K;  4XH4 A;  3R1X A;  3EEQ A;  1GLC G;  1C1A A;  5C42 A;  4JK8 A;  5HL7 L;  3U6F A;  1KD1 O;  3T1Y K;  4WQ4 C;  1U48 A;  4ISF A;  3J7A P;  1W7A A;  3C6A A;  4QS9 A;  4YOX A;  3CXC M;  4DB3 A;  3TSU A;  2ZM6 K;  4QOZ B;  5J2M A;  4ILJ A;  4G1Q A;  2F8T A;  4MQ3 A;  1U2V B;  4IFY A;  1QZ6 A;  5EX5 A;  4ELV A;  3I33 A;  5T7B A;  2IC3 A;  3ZT0 A;  4CJ7 A;  3LAK A;  1LAV A;  1BO5 O;  4NCB A;  1HPZ A;  1BIS A;  3OYM A;  3KLG A;  1XHX A;  3ENB A;  4CHZ A;  4K8Z A;  2OPS A;  2UUB K;  4WCE L;  5HBM A;  1JLC A;  2V7Z A;  5DMR A;  3AO1 A;  4CFA A;  4CEE A;  3VES A;  1NOY A;  4CEQ A;  3OYE A;  4J2D A;  2YCH A;  1NM1 A;  1TK0 A;  2GWK A;  4XH1 A;  4LFA K;  3MN9 A;  1YUW A;  3O1W A;  3CCQ N;  3QNO A;  4MLH A;  3PV8 A;  1DTT A;  1J9A A;  2B6A A;  2ZE2 A;  4JI7 K;  1VSK A;  2O8E A;  1HNI A;  1S22 A;  3K59 A;  1L5U A;  3JS6 A;  5FRN A;  2UU9 K;  1RT5 A;  2P5O A;  1LV5 A;  3SAF A;  4HTU A;  2BTF A;  1IG8 A;  1NU0 A;  2FC0 A;  1UAX A;  1S3X A;  3CQX A;  4BVO A;  2RE2 A;  3B6P A;  4LF9 K;  3TAP A;  2HOE A;  3DLG A;  3SZ2 A;  2GWJ A;  1J54 A;  1ATS A;  1I94 K;  1R59 O;  4Y1D A;  4V19 S;  3TAB A;  3KK1 A;  3T3F A;  3VEZ A;  5KPR A;  4FCY A;  3CHW A;  4CHO A;  4OKJ A;  1VQP N;  1EXQ A;  3AVI A;  2OA8 A;  2PYJ A;  1IJJ A;  1T03 A;  1XC9 A;  1N6Q A;  4DQR A;  1XWL A;  4BRM A;  4BC4 A;  1L3U A;  3KK7 A;  5AZJ A;  3KKS A;  1SKW A;  1TAQ A;  3PO5 A;  3HOT A;  2P9S B;  1IO2 A;  3TAR A;  4BG8 A;  5BRF A;  4YOR A;  3H3O B;  4ID1 A;  3VEV A;  3RVC A;  1C6V A;  1VQN N;  3HXM A;  4L3Q A;  4B3O A;  1U4B A;  4X62 K;  2DY4 A;  1Q9X A;  1RBT A;  3RMD A;  4JI0 K;  1TK5 A;  3AY9 A;  4KB0 A;  3SUP A;  3CQ8 A;  3J7Y P;  3C7N A;  5F0X A;  2P9I B;  5JLF A;  4DV0 K;  1XC3 A;  4YDU C;  5BPM A;  4FVM A;  4H0T B;  4NO7 A;  3L3V A;  2E6L A;  3AA5 X;  3QFP A;  3LPU A;  1OVY A;  1HKG A;  1ILY A;  2ZQB A;  1GLJ O;  1VAZ A;  1S1X A;  3ZSQ A;  3CCL N;  3KK2 A;  1S1U A;  4FLY A;  3VQ8 A;  2KKZ A;  2IVP A;  3PSF A;  3THW B;  4WQ5 A;  3SMP A;  4E7L A;  4XIU A;  5ADX A;  4OO1 J;  3I55 N;  1NKE A;  3KZB A;  1WN7 A;  3ULE B;  1D4X A;  4FPB A;  3SQ4 A;  1YTU A;  1OH8 A;  3VTH A;  5LL6 Z;  1NGC A;  2F7T A;  4BRD A;  1E3M A;  1T3V A;  1T6C A;  2OZM A;  2RPI A;  4O0I A;  4IWV A;  4QCL A;  1CXQ A;  2E2O A;  3PLA A;  4QAG A;  3D2F A;  4JKA A;  5M1P A;  3HO1 A;  4BRO A;  1YAG A;  4OGC A;  3ZCM A;  4KV8 A;  1DEJ A;  2FBX A;  3CJB A;  3VQ5 A;  3MN6 A;  4E19 A;  3HJF A;  1D9D A;  4IFE A;  1KSP A;  4M42 A;  1QHA A;  1OH6 A;  3QFU A;  2HBJ A;  4FWL A;  4DR1 K;  4WFN L;  3MCA B;  3K5L A;  3H3N O;  1RBS A;  4DFM A;  3UKU A;  3JXU A;  4B8C A;  1NK7 A;  5SZT A;  1MU2 A;  2KTQ A;  4J8F A;  2E2N A;  4FJH A;  2GTD A;  2IVN A;  1BHL A;  1NGE A;  1KVA A;  2EHG A;  2HHH K;  3WNG A;  4CF9 A;  2HHX A;  4IXC A;  5KPZ A;  1OKJ A;  4EHU A;  3VEN A;  2XY5 A;  3CJA A;  2OYQ A;  3U4L A;  4C23 A;  1KAZ A;  3A5L C;  4E0D A;  4Z0U A;  1HX1 A;  5AQQ A;  3NDK A;  3AO4 A;  1Q86 O;  4W5N A;  1E4F T;  3MWT A;  3NBP A;  5M1Q A;  4CJT A;  4O8K A;  4CF2 A;  1XHZ A;  3RMA A;  2G8U A;  2HW3 A;  4CJK A;  1G15 A;  4JI5 K;  3ZSR A;  1Z05 A;  3WQT A;  3FZK A;  4CJE A;  4X65 K;  4BWM A;  2ZD1 A;  1C0M A;  4YDU A;  3MEC A;  1EQY A;  2I7N A;  1QTM A;  2FSN A;  3KD1 E;  3O9S A;  1YHQ N;  3RSE B;  4BRF A;  4PKI A;  3M8R A;  4AHT A;  3DAW A;  3O9Q A;  3JAM O;  4ID5 A;  2DPN A;  3KD5 E;  4KTW A;  4CED A;  3LP0 A;  3CCJ N;  4FJI A;  3QDK A;  4B3M K;  1BI4 A;  2PBD A;  2E20 A;  3H45 C;  5GAD P;  1KFS A;  4KHS A;  4LF6 K;  2CH5 A;  2V52 B;  5BRD A;  4CGG A;  5AQJ A;  3ZEU A;  3BF3 A;  3L8B A;  1N5Y A;  4ILG B;  1VQM N;  2QWQ A;  3TTC A;  3GE1 A;  3HYF A;  2P9L B;  2F8S A;  1ZYQ A;  2OTJ N;  4JD2 A;  1W0H A;  3OYL A;  1NK8 A;  5AQT A;  3SYZ A;  1TYQ B;  3SBT A;  4A5B A;  3AVL A;  1WSF A;  4DMN A;  2ASP A;  1WSJ A;  3AAR A;  3V4I A;  5C10 A;  4WFA L;  2QM1 A;  2O8F B;  4BR0 A;  3MN5 A;  2JGU A;  4OVL A;  4BRH A;  4NXM K;  3F5T A;  4K0K K;  4HCC A;  4F9O A;  4DU4 A;  4ELU A;  4H0Y B;  4KRE A;  2HNY A;  3FE1 A;  3CMA N;  3AVA A;  5H1S Q;  2FSJ A;  4M3Y A;  4M63 C;  2Q97 A;  2QKB A;  3IS9 A;  4ELT A;  1BA1 A;  3O3F A;  3LWL A;  4DS4 A;  4BY9 C;  2CGL A;  2RF2 A;  3T1H K;  1JCE A;  3FFI A;  5AQS A;  3UE5 A;  3K57 A;  4GKJ K;  3FLC O;  4NLB A;  1FJG K;  4CJ5 A;  4B9Q A;  4B1Z A;  1TKT A;  1QQM A;  2V7Y A;  3AVC A;  3CJ9 A;  3CCV N;  5E26 A;  4DU3 A;  2BDP A;  4O8U A;  1ASW A;  1X1P A;  1LW2 A;  4BE1 A;  4PWD A;  4CJQ A;  3L2R A;  2VGN A;  5AR0 A;  2CGJ A;  5LJW A;  1V4S A;  4B3T K;  3QIC A;  4FJN A;  3F9M A;  2Q1N A;  4BDY A;  3OS1 A;  4DTP A;  2G8H A;  2OPQ A;  1W97 L;  4CEO A;  1DKG D;  1I3A A;  4HCB A;  4GVE A;  3OYD A;  3TAG A;  3OYK A;  3LAM A;  3F2K A;  4C8K A;  3P83 D;  3WXK A;  2X78 A;  5KPT A;  3NVK A;  1NJI O;  2D0A A;  2UYT A;  3RRH A;  2I5J A;  3WUH A;  1VSH A;  3AAQ A;  3UKR A;  1DTQ A;  3NCI A;  4A62 A;  4LFB K;  4YOT A;  2OAN A;  4BC5 A;  4PUO A;  4C8L A;  1TUU A;  3DOK A;  4M7Y A;  3H1V X;  3JSM A;  1VSI A;  2Z1H A;  1RDC A;  3AGK A;  3MAQ A;  3EL2 A;  4IO9 L;  4E7H A;  4N76 A;  2XHB A;  2QWL A;  3NH0 A;  1LWF A;  4EFH A;  1CLQ A;  1ASV A;  1EWQ A;  2YHW A;  3L4Q A;  4H4M A;  4FWN A;  3ZET A;  4IOX A;  4PL7 A;  4B9T A;  4FVU A;  4LF7 K;  3ZSZ A;  2IIR A;  1C1C A;  1RDD A;  4HHT A;  4JRP A;  1JLQ A;  3BGR A;  3V9X A;  4HVJ A;  5C24 A;  1QSL A;  3BZC A;  3O4N A;  3VQ9 A;  4FWS A;  2UXC K;  4CGF A;  4RW8 A;  4OLB A;  3EYZ A;  1CZB A;  5BR8 K;  5C2D A;  3H6E A;  3EZ5 A;  4M45 A;  2XY8 A;  1NMD A;  4DS5 A;  2O8D A;  1GOC A;  2NRX A;  2AJQ A;  2IDO A;  2EWS A;  3ZSO A;  3QET A;  4M3W A;  1NLV A;  5BPL A;  1NMN A;  4FJK A;  1ATR A;  4H03 B;  4A2A A;  2E2P A;  3DLB A;  3ATV A;  4E89 A;  2G8K A;  3KLI A;  1YJN N;  2FBV A;  4CD1 A;  2YJE A;  5E41 A;  5C12 A;  1YTA A;  2DFF A;  5M1N A;  4KH4 A;  4MLE A;  5DM7 L;  3WXJ A;  4I9L A;  4BQL A;  3CER A;  3K5O A;  2ZJR L;  1XI1 A;  5CYM A;  3PUF A;  2GUP A;  3AVK A;  3O4W A;  4CER A;  3ZX3 A;  1XUP O;  2O8B B;  1CZ9 A;  4JS5 A;  4CEB A;  3O3G A;  1BL3 A;  3VTI A;  1TGO A;  5BRH A;  1K8K B;  3BZK A;  2BAN A;  2GUI A;  5AQZ A;  3SAH A;  3THV A;  4IDH A;  4CI6 A;  5FRM A;  2FXU A;  1K9M O;  3NF8 A;  2VYP A;  3G71 N;  2A3Z A;  3TTD A;  1RT4 A;  1N33 K;  4BRQ A;  4I2P A;  3KHY A;  1VQ7 N;  1QSS A;  3IKM A;  1VRT A;  3GBT A;  4JKC A;  3VQE A;  2HST A;  3G25 A;  3KLH A;  3BP8 A;  1KAX A;  1IBM K;  4GW6 A;  2A1R A;  4FPA A;  4IBN A;  1LAW A;  3IAY A;  1HLU A;  1SL1 A;  5AFU H;  2A1S A;  4PL8 A;  1GOA A;  4ISG A;  4YNQ A;  4H0O A;  1RTI A;  4O5B A;  3THX B;  1VSL A;  3JYT A;  4FW2 A;  2E2Q A;  4K25 A;  4EIA A;  1XMO K;  2ZJP L;  4A61 A;  4DV4 K;  3IG1 A;  1I39 A;  1RTD A;  3W0L A;  1A5X A;  1VK0 A;  1C0G A;  3ULE A;  4BE2 A;  2VG7 A;  1WSE A;  1YJW N;  3OBW A;  3S41 A;  4BAC A;  3THY B;  1WOQ A;  4IFV A;  4KHW A;  4CF1 A;  3U9Z A;  4AM7 A;  2WC9 A;  3DXM A;  3SJJ A;  3KVG A;  1VSD A;  4CBU A;  4CFD A;  2W42 A;  1ZXO A;  1U49 A;  2P9N A;  3J81 O;  1KVC A;  4DV6 K;  1GLA G;  4BRA A;  4CES A;  3RWU A;  1YVU A;  1GOB A;  4YY3 K;  1WBD A;  4BR9 A;  4NLC A;  2ATQ A;  2YJF A;  2HNZ A;  1HRH A;  2W40 A;  3MXI A;  3E9P A;  1YXQ A;  3VEX A;  4JI2 K;  4BRN A;  4E7K A;  5KRT A;  4MDB A;  2E1Y A;  3F9K A;  4GV9 A;  4JKE A;  3MMV A;  3CYM A;  3LP2 A;  5FPN A;  4DV5 K;  4WQ5 C;  4LC9 B;  3P5J A;  1EWR A;  1X9S A;  2JWL A;  3LDQ A;  4FOI A;  4BR5 A;  4NYN A;  1IBL K;  3WXM B;  4CJ4 A;  3VA0 A;  4JK9 A;  4CJ3 A;  3PY8 A;  3SCX A;  1SKR A;  4KFB A;  4FJL A;  1RT1 A;  5AZI B;  2VQF K;  4CEF A;  4JHD A;  3NHG A;  3AVJ A;  3U9D A;  3O1B A;  3N4P A;  5BRE A;  2YNI A;  1ZBL A;  5HP1 A;  3QBW A;  5KTQ A;  3HPG A;  3BEX A;  4U67 L;  1EET A;  1NGD A;  4FK2 A;  4OPH A;  3CFO A;  1NJX A;  2Q36 A;  4A59 A;  5DM6 L;  1JCG A;  4CW7 B;  2HMP A;  3L2V A;  2NRV A;  2QWO A;  3SUN A;  4I6M B;  4XH5 A;  3P1G A;  4HWI A;  1X9W A;  3AVF A;  4CJL A;  3D0P A;  3GL1 A;  2HND A;  4Z4H A;  4DV2 K;  4FWR A;  1UA1 A;  3LP1 A;  4DV3 K;  3RSE A;  2HMI A;  5KGX A;  1KC8 O;  4K43 A;  4CJV A;  1X9M A;  4UQG A;  1DT9 A;  1VSM A;  5CR4 A;  4KTQ A;  3C6T A;  2GX9 A;  3HP6 A;  3D45 A;  4H5R A;  4O0J A;  4RWT A;  3RTV A;  3CET A;  2KFN A;  4H4O A;  4Y1C A;  3QES A;  3FGU A;  1Y64 A;  3EKU A;  3EN9 A;  3HK2 A;  3ZT1 A;  5GIN A;  5C25 A;  3B6O A;  2VG5 A;  3UIQ A;  4C8O A;  1HJO A;  4CEZ A;  3HM9 A;  3J8A A;  1SL2 A;  2E1Z A;  2RHK A;  1HQU A;  3MED A;  1KTQ A;  3WNH A;  2QK9 A;  1XNQ K;  4OX9 K;  3C94 A;  2OZS A;  3EE9 A;  1ZBU A;  5GIO A;  1MDU B;  4OPJ A;  2P9L A;  4KHN A;  4C1N I;  1NJW A;  1S6P A;  3V6D A;  4YOU A;  3M3Z A;  4BRE A;  2ETJ A;  4FM1 A;  3DJC A;  2ITM A;  1NK5 A;  4GVM A;  4KH5 A;  3QER A;  5AJ3 K;  4J2B A;  1BIZ A;  3PO4 A;  3KTQ A;  3M8S A;  1Z6R A;  3S3N A;  3E01 A;  3TTF A;  5FLX O;  2FSK A;  4CGI A;  4FLZ A;  3J7Z O;  3L4I A;  2GEM A;  3VN5 A;  1SQK A;  2GBZ A;  3WEE B;  5GIP A;  1HMV A;  1W2B M;  3I8B A;  4AHV A;  2NRR A;  2YKM A;  1RT3 A;  3CG7 A;  3B8A X;  4BR7 A;  2F96 A;  4PHT X;  4NCA A;  4WE1 A;  2P51 A;  4K41 A;  4A2B A;  3HI0 A;  3SLC A;  1NGH A;  2FF6 A;  4H5W A;  4JI6 K;  4WFB L;  3H46 O;  3ZX2 A;  4DFJ A;  5KQ8 A;  5A2Q O;  1OH5 A;  2BE2 A;  5EOY A;  3CC7 N;  3EKS A;  2F9T A;  3G0Z A;  3VQP A;  3NMU A;  4FLW A;  5LMU K;  3O5B A;  3VQ7 A;  3DM2 A;  5CYQ A;  4W5Q A;  1YJ9 N;  1G99 A;  5JS1 A;  4BC2 A;  4H0P A;  3LDN A;  2P9P A;  4FOE A;  3OYJ A;  4DSL A;  3OW2 M;  3V9Z A;  5E84 A;  1NNE A;  2YHY A;  4RTF D;  4K42 A;  3OYA A;  3GDQ A;  2O8C B;  2YKN A;  4CZM A;  1QS4 A;  3QIN A;  3DRR A;  3MX2 A;  2NUB A;  4H5N A;  1RFQ A;  3DMJ A;  3KLF A;  3K0S A;  3O9T A;  2IOC A;  5F1X A;  3M8Q A;  3E9L A;  4JRQ A;  1MWK A;  4FZY A;  2X6N A;  3U3Y A;  1B9F A;  4JKG B;  3CI5 A;  2A5X A;  2X74 A;  4FWM A;  4DQI A;  4CBW A;  2HHU A;  5SWM A;  2O4I A;  4H0X B;  3HSC A;  2KLA A;  3HBT A;  2YHB A;  1NGF A;  3SMS A;  1HYV A;  1JL2 A;  4I2Q A;  3QEV A;  1HJR A;  5BN9 A;  3ZX0 A;  4JEP A;  2P9K A;  3HT3 A;  2ZF5 O;  2FBT A;  3OYB A;  1TUY A;  3L2W A;  1A5W A;  3MN7 A;  1S72 N;  4N56 A;  4GMJ B;  1VSE A;  2O8E B;  3TAQ A;  2ASO A;  4ICL A;  3KLE A;  3ZSX A;  4NB4 A;  2D0O A;  2IAJ A;  4BRP A;  3MK6 A;  2Z1G A;  4RW9 A;  5FPM A;  4F2S A;  4LFC K;  2AA4 A;  3O08 A;  4KPY A;  5M1K A;  1KCF A;  4M41 A;  3AVH A;  4RG8 A;  3CCS N;  1XMQ K;  4JKF A;  4M7X A;  4QS8 A;  2Q0U A;  4OPK A;  1UWB A;  4JK7 A;  3VF4 A;  3L6Q A;  4I9Q A;  1VQ9 N;  4QS7 A;  3PX0 A;  1T6D A;  4FK4 A;  4IOA L;  2Z1J A;  2AP1 A;  4RW6 A;  5AQG A;  4AHC A;  4Q5V A;  3WXL A;  3E66 A;  3NAE A;  5IWA K;  3A2F A;  3D6R A;  3SPZ A;  1LWC A;  4OPA A;  2ASM A;  1V4T A;  1BWF O;  3AA4 A;  2P9U B;  1RNH A;  3BY5 A;  4FXD A;  3LM9 A;  1TL3 A;  4RW4 A;  5MLC Q;  2Q3S A;  5J2N A;  1N36 K;  4CJR A;  1WB9 A;  1DGK N;  2O8B A;  4CGH A;  1OVQ A;  4Z94 A;  3OA9 A;  2WOM A;  3CCM N;  4FLU A;  5AQH A;  4DQQ A;  1YVN A;  3DLK A;  4OGE A;  3D2E A;  2O4G A;  2QWR A;  1K8K A;  2FF3 B;  1J5O A;  5AQU A;  3AVM A;  5GAH P;  4DV7 K;  2LSN A;  2R7Y A;  3PSI A;  1ITG A;  1B92 A;  3P39 A;  4B3S K;  2G8F A;  4CVN E;  2YHA A;  1BCO A;  2QA4 N;  3SAG A;  2UXD K;  3C7N B;  4OKK A;  1HNZ K;  5ADX H;  4CHY A;  5HRO A;  4CZF A;  1RDB A;  2B4J A;  3LP3 A;  3VEO A;  5M1O A;  5AQL A;  3G10 A;  1D5A A;  3P31 A;  2YNH A;  4FJJ A;  2D5R A;  5JVG L;  1ZBI A;  3N4Q A;  1TVR A;  4JKD A;  4YOV A;  1LCU A;  4CZE A;  5AQM A;  2D4W A;  3V1Q A;  4GV3 A;  3PX6 A;  1TKX A;  3V1R A;  3C95 A;  3R8E A;  1JXB A;  3LAL A;  3EE8 A;  1C1B A;  3QB0 A;  2A42 A;  3KWG A;  3OVN A;  3CM5 A;  4C8N A;  1ATN A;  3DYA A;  1JL1 A;  4RCH A;  1QE1 A;  1S1T A;  3R6M A;  3O3H A;  3DLL L;  3THY A;  1REV A;  3AA3 A;  3ZSV A;  3NE6 A;  3DRS A;  4MFB A;  3OYH A;  1TKZ A;  5AQF A;  3HRG A;  5D3G A;  2NRT A;  3QML A;  3TAM A;  1U2V A;  2VG6 A;  4I7F A;  3K9J A;  1BQN A;  3FFK B;  3NFA A;  3P38 A;  3D2F B;  3K5M A;  4E7I A;  1JLA A;  5EXW A;  4DU1 A;  2HHV A;  4M3X A;  2CH6 A;  1IBK K;  1RTJ A;  2G8I A;  4NYF A;  1Q8I A;  3O9R A;  3D7E O;  2HF3 A;  3GG4 A;  4DF4 A;  3CF5 L;  4IO8 A;  3QEI A;  3SI6 A;  4CJF A;  2X6S A;  2G8W A;  2E6M A;  4PY5 A;  1RBV A;  1CXU A;  4KHU A;  3C65 A;  4DTR A;  1NK0 A;  1K8A O;  1IV0 A;  3UKU B;  4JI8 K;  4DR6 K;  1Z26 A;  3CIP A;  1VSF A;  3DLH A;  2HBK A;  2A41 A;  1RT7 A;  2QEX N;  4KB1 A;  4GNI A;  4BRK A;  2EX3 A;  4DQS A;  1C0U A;  5J2P A;  5AZI A;  4IDK A;  3NF7 A;  1HPM A;  3VGM A;  4CF0 A;  4FJM A;  5EY4 A;  1NGJ A;  3ZT3 A;  4BC3 A;  5HRN A;  3S3O A;  4DSK A;  4KTZ A;  1HR0 K;  2CGK A;  2H3G X;  3QLH A;  2QWP A;  3VF2 A;  4ISE A;  3OYF A;  4HUG A;  5AQI A;  2OPP A;  5AQN A;  4FJG A;  3ZYY X;  3IFR A;  4I6M A;  1KQS M;  2DFE A;  5CY4 A;  4DQP A;  3M1F A;  1GLB G;  2BGG A;  3A5M C;  4DUZ K;  4DLG A;  1ZBH A;  2QXL A;  3WT0 A;  2Q31 A;  4IJN A;  1NGA A;  4CEC A;  4BG9 A;  2GV9 A;  2VWJ A;  4CJW A;  4EZ6 A;  1RIL A;  2F9W A;  1VSJ A;  2QTD A;  3QO9 A;  3PIP L;  5B8H A;  1NG9 A;  4A57 A;  2E8A A;  4B9S A;  1U47 A;  4FLT A;  2HHQ A;  1YIJ N;  5CE3 A;  1FW6 A;  1FXX A;  1BU6 O;  5JS2 A;  2P9S A;  4FM2 A;  3SJH A;  5GAE P;  1JLG A;  1BI4 B;  2YV0 X;  2FLO A;  3T7Z A;  1NJY A;  1QQC A;  4CZH A;  2PZS A;  4DG1 A;  1JKH A;  3O9U A;  1RTH A;  1ZBS A;  3ZEU B;  3VQA A;  1D8Y A;  4IZ9 A;  1SZ2 A;  1U45 A;  1VQK N;  3CCE N;  3HL8 A;  4R5P A;  4DTO A;  2XRI A;  4A5A A;  2WUS A;  1WLJ A;  3VEY A;  1EKE A;  1KLM A;  3I0S A;  5LY3 A;  3DOL A;  3V1O A;  1F21 A;  4BWJ A;  1GLD G;  5I42 A;  4BRL A;  2P9I A;  2XO7 A;  1IKX A;  4JS4 A;  3L2U A;  2P5G A;  1XNR K;  5KGW A;  5I3U A;  4IOC L;  1ESV A;  1Q7Y O;  3O80 A;  1IKY A;  2QKK A;  1U04 A;  4BRG A;  4CHN A;  3KK3 A;  1L3T A;  3CD6 N;  4N5S A;  1WNS A;  4BQZ A;  3TI0 A;  4DV1 K;  1A5V A;  3NH1 A;  3WXI A;  4IEI A;  3LPT A;  4EAH D;  3VET A;  1IG9 A;  2F4V K;  4BVP A;  4KHY A;  1C0F A;  1S9E A;  3THW A;  5KQD A;  4AHS A;  3J80 O;  4Z4I A;  3ULD A;  1RT2 A;  3ID6 A;  3LDO A;  3FZL A;  3TAE A;  1TL1 A;  3LZJ A;  4Q0B A;  2RN2 A;  4LD0 A;  3CM6 A;  3VF6 A;  3IDH A;  3CME N;  2KHO A;  3IRX A;  1M90 O;  3CFR A;  1QSY A;  1QQO A;  2NNW A;  1HUX A;  3U8X A;  2YX6 A;  4ZHR A;  4CE9 A;  4UY8 O;  2YNF A;  5HRP A;  1NWK A;  4BRI A;  1TK8 A;  4Z4C A;  3ID8 A;  4KRF A;  2UUA K;  1IKW A;  2DFH A;  1HQE A;  2O8C A;  1UA0 A;  4B1W B;  3A8Y A;  5AQW A;  1J53 A;  4IG3 A;  5JMV A;  2KFZ A;  4CFC A;  3QEX A;  1BGX T;  2V51 B;  3Q7B A;  4CIG A;  3UKR B;  3FZM A;  4H5T A;  3VQ4 A;  4PA1 A;  1L3V A;  4Z4G A;  3A0I X;  3M8P A;  3WNF A;  1KXP A;  2D0P A;  5JVH L;  3L2Q A;  3CJ7 A;  5KRS A;  3K5N A;  3TAN A;  4HUE A;  2NRZ A;  4JKG A;  5AQV A;  4BGB A;  4EZ9 A;  4LY7 A;  4CK2 A;  1HYS A;  4MO4 A;  1S9G A;  4Z4E A;  4AQY K;  3W3D A;  2HVI A;  3AAP A;  1KVB A;  3TPQ A;  3OJS A;  4DTM A;  2ZJQ L;  1EO1 A;  3K58 A;  2IGI A;  2HHS A;  3ZET B;  1NOZ A;  4NCG A;  1NK6 A;  4DTN A;  1MA9 B;  3QBX A;  3WQU A;  4CJS A;  3VGL A;  2VQE K;  1KAY A;  3LM2 A;  4WF9 L;  2ZGZ A;  3DRP A;  4DWI A;  3MCP A;  4B1X B;  1RDA A;  4BGA A;  2IVO A;  5J1E A;  1B9D A;  3HVT A;  4E1N A;  3ZLJ A;  4DR3 K;  2ZWH A;  4DSJ A;  2W41 A;  2Y1I A;  1KRP A;  5HLF A;  4FM0 A;  3AVN A;  3H08 A;  3MEE A;  5I9E B;  2NLX A;  2NZT A;  4L8R B;  2Q2R A;  3O8M A;  4DQ8 A;  3SQ1 A;  4DSI A;  2O8D B;  4B1V A;  4CCH A;  4JKB A;  1FKP A;  4KHP K;  4TSX A;  4FO0 A;  2I7P A;  2KZM A;  1JLB A;  5M1F A;  1S5J A;  4CD3 A;  4JKH A;  1J5E K;  4B9U A;  1YF5 L;  1O1W A;  1NJZ A;  1L3S A;  1R0A A;  2GEL A;  1N34 K;  3NF9 A;  1NKB A;  1HKB A;  4CIE A;  3DXK B;  3RR8 A;  1QZ5 A;  3SBG A;  1KLN A;  3ENO A;  4W5R A;  3FR0 A;  2FBY A;  1K73 O;  4FJX A;  2P9U A;  1BG3 A;  2NRH A;  4LH4 A;  4CZK A;  4DUY K;  3HVR A;  4U7B A;  4CK1 A;  4FWK A;  1DLO A;  3I8D A;  1NK4 A;  4YOY A;  5EVZ A;  3VMF B;  3AVG A;  4FZZ A;  1K6Y A;  1RBR A;  3HZ6 A;  4B1U B;  4BR4 A;  4RW7 A;  4Z4F A;  1TYQ A;  3OS0 A;  4CZG A;  1WSI A;  4E1J A;  4C8M A;  4B9N A;  4CZL A;  2O8F A;  5K14 A;  3ZSY A;  2Z1I A;  2D1K A;  4WQ4 A;  3VER A;  4CEA A;  2BH1 A;  3OYG A;  4DR5 K;  4O55 A;  1VQ4 N;  1EP4 A;  1QVG M;  1SL0 A;  4DFP A;  3TWH A;  3I0R A;  3RMC A;  4KAZ A;  1M1K O;  4JI4 K;  4AHU A;  1JJ2 M;  5JIC A;  4JV5 K;  4CGD A;  1JXE A;  4AHR A;  3C6H A;  3OS2 A;  5HOO A;  4DTU A;  4EHT A;  2W6K A;  3SK3 A;  3O6W A;  4JI1 K;  1BIU A;  3VQD A;  5IT9 O;  3MX5 A;  4DFK A;  2ZGY A;  5FPE A;  3V9S A;  4JNE A;  3LAN A;  3QIO A;  3VEW A;  1TV6 A;  3TU5 A;  3KKR A;  1JCF A;  3LZI A;  4BDZ A;  1XQS C;  2XY6 A;  4EP4 A;  1D9F A;  3V9U A;  4M3Z A;  4YHH K;  3M6G A;  4WYB A;  1IH7 A;  3F73 A;  3A5O C;  1QVF M;  4JI3 K;  2E4L A;  1SUQ A;  2XY7 A;  3QEP A;  5BN8 A;  3ZT4 A;  3VQQ A;  2KZZ A;  4FYD A;  2J4R A;  3DXM B;  4DTX A;  3V81 A;  1BCM A;  2QXF A;  3VQC A;  4B08 A;  3LWM A;  3Q7C A;  3T1A A;  4H5V A;  3A5N C;  1Q18 A;  4CZI A;  2P9N B;  3DI6 A;  1ZBF A;  1E4G T;  1BA0 A;  4H8K A;  3EO3 A;  2A40 A;  4F8R A;  4OLA A;  3AVB A;  2HBM A;  3NF6 A;  1SKS A;  1J6Z A;  4DHY A;  2OPR A;  1LOT B;  4EP5 A;  4FSV A;  4PKH A;  1VRU A;  4CBX A;  4IEE A;  3EY1 A;  4FWO A;  4DCH A;  4DKW A;  4KI6 A;  3CJC A;  4XEI A;  1FK9 A;  1JLE A;  1SAZ A;  3AO5 A;  4CF8 A;  3S3M A;  2BUP A;  2E5L K;  3CCR N;  2PFU A;  5TKW A;  3RR7 A;  4PKG A;  4JHD B;  5HRS A;  2VGM A;  5AQX A;  4B9M A;  2QWM A;  3CJ1 A;  3BUZ B;  1HKC A;  4FJ7 A;  3H1Q A;  4H0V B;  3OBY A;  1FKO A;  4ILH A;  1NKC A;  3VQ6 A;  3VA3 A;  2UXB K;  1HYZ A;  4FWQ A;  2Y1J A;  5C0Y A;  2DTU A;  1VQO N;  4DR2 K;  3QIP A;  4LF5 K;  1QQN A;  4JN4 A;  1X3M A;  5J2Q A;  4KBO A;  5AQR A;  1YIT N;  5ELZ A;  4FWP A;  3CPE A;  3O4Q A;  4CHP A;  4DF8 A;  4OJR A;  3FZH A;  4YOW A;  1HNW K;  5AZJ B;  4FJ9 A;  4YFU A;  1NGB A;  2A6A A;  4AH9 A;  3QEW A;  3MEG A;  1VQ8 N;  4JLH A;  4F2R A;  2WBN A;  4OKE A;  4CHQ A;  5FRO A;  5JLH A;  4KH6 A;  4DR7 K;  4B1Y B;  3BDP A;  2UUC K;  2P1J A;  3RRG A;  4GY2 B;  1WAJ A;  4N47 A;  3HPO A;  1GLL O;  3OYC A;  1Q9Y A;  1TKD A;  4E1M A;  4ZTF A;  3SUQ A;  3AV9 A;  1BDG A;  3RMB A;  1LWE A;  4BE0 A;  3HP9 A;  1CZA N;  1HNV A;  5FPD A;  3FZF A;  4O4G A;  3SUO A;  1P8Z A;  4E3S A;  2VCP A;  1T8E A;  3C0B A;  3ISN C;  3ENH A;  2YNG A;  3IUC A;  1Q81 O;  4O5F A;  2JLE A;  5DK5 A;  5KI6 A;  3HOS A;  5C2F A;  3R3L A;  4FLX A;  1T44 A;  5EU7 A;  2WTU A;  1BOT O;  1WBB A;  2Q0R A;  3M5R A;  3THX A;  4CJP A;  3AO2 A;  5TKY A;  4KHQ A;  4CK3 A;  1VHX A;  5CHI A;  2VWK A;  4FZX C;  4FJ8 A;  3NH2 A;  4M3T A;  3V9W A;  2WON A;  2RKI A;  2OTL N;  3G6E N;  4G9Z A;  3ATU A;  3HM8 A;  2D0B A;  5LMN K;  4MO5 A;  3ALY A;  3E1Y A;  3NGZ A;  3G4S N;  3IMX A;  4CJU A;  3LL3 A;  1P90 A;  4IKF A;  1Z25 A;  5AQO A;  4BR2 A;  5HRR A;  3SQ2 A;  2WFB A;  4AIL C;  3OYI A;  5AFU A;  4W5O A;  3TSQ A;  3U3G A;  5BR9 A;  2HBL A;  1SV5 A;  5F2R A;  3SV3 A;  3DLE A;  3OHR A;  3T69 A;  1NGI A;  2P9P B;  1VQ6 N;  4CGJ A;  3SPY A;  1WSG A;  3E9O A;  1W9H A;  4FLV A;  2HHT A;  4HUF A;  4B8A B;  1UOC A;  1GLF O;  3MXJ A;  4O44 A;  2IS3 A;  2HVH A;  1OH7 A;  3K9K A;  4CZJ A;  1RGI A;  5AQP A;  4K8X A;  3VOV A;  4LF4 K;  4KI4 A;  2ITG A;  2D0C A;  3DLR A;  3VPZ A;  1MWM A;  2E88 A;  1C0T A;  4Y0W A;  1SS6 A;  3DWL A;  2QW9 A;  1X3N A;  1NGG A;  3GOI A;  4FL9 A;  5AQY A;  3MDQ A;  1ASU A;  1HNX K;  4X64 K;  3CC2 N;  3CCU N;  2OCE A;  1LW0 A;  4LH5 A;  2G8V A;  1N32 K;  3C6U A;  1ZC6 A;  4B3R K;  2HF4 A;  1RBU A;  4MDA A;  3AA2 A;  3T19 A;  3K2P A;  3VGK A;  4FW1 A;  5AQK A;  4M3U A;  3AO3 A;  4M3R A;  1T05 A;  2P9K B;  3NVM A;  3PIO L;  2HHW A;  3ZSW A;  1WSH A;  1WUA A;  5LJV A;  1NBW A;  1H1V A;  1Y97 A;  3QNN A;  1YI2 N;  3TR8 A;  3OY9 A;  1T7P A;  4DTJ A;  4AF1 A;  4X66 K;  3ITH A;  4PQU A;  1RT6 A;  2W6L A;  3AGR A;  4R79 A;  4BRC A;  5C15 A;  4JAX A;  4F3O A;  3OJU A;  1Q82 O;  3SNN A;  3VQB A;  4ZTJ A;  4J2A A;  5GAG P;  2B5J A;  2PAV A;  2YHX A;  3S9H A;  3EZW A;  2YI1 A;  5CZ1 A;  1IKV A;  1S1W A;  4C1N K;  1GLE G;  3ASM A;  2VWB A;  1QHT A;  3I56 N;  1U6Z A;  1VQL N;  4B9L A;  3DXK A;  4IG0 A;  3SV4 A;  1BQM A;  4KO0 A;  3OYN A;  4GV6 A;  3PX4 A;  3LDL A;  3SQ0 A;  3L3U A;  4F4K A;  3WNE A;  4HTL A;  1X9J A;  1VQ5 N;  2JWK A;  4DTS A;  4NXN K;  4JD2 B;  3BF1 A;  1EX4 A;  3R9P A;  5CZ2 A;  1KFD A;  3KJV A;  4W5T A;  4AM6 A;  5FDL A;  3TSP A;  3CPW M;  1WAF A;  3D2E B;  3HPH A;  1S1V A;  1NK9 A;  3NGI A;  4N41 A;  4F3T A;  3WEE A;  3UB5 A;  4CFB A;  3HST B;  5BPN A;  2KQ2 A;  3ZT2 A;  4DLE A;  4IJA A;  1N8R O;  3MXM A;  4DSE A;  3LDP A;  1S6Q A;  3L0Q A;  2NRW A;  2HB5 A;  4FK0 A;  4DR4 K;  3CFP A;  3NGY A; 
#chains in the Genus database with same CATH homology
 4B3M K;  4DUY K;  5LL6 Z;  1IBL K;  4GKK K;  1I94 K;  4V19 S;  4LF6 K;  2VQF K;  4LFC K;  4LFB K;  4LF8 K;  2UUA K;  1XMQ K;  4X66 K;  4JYA K;  4JI6 K;  1N33 K;  2E5L K;  4CW7 B;  3OTO K;  4DR5 K;  5A2Q O;  3T1Y K;  3J7A P;  4JI4 K;  1IBM K;  4AQY K;  4DR1 K;  1IBK K;  4LF7 K;  5IWA K;  5LMN K;  2ZM6 K;  4DV2 K;  4JV5 K;  5LMU K;  4NXM K;  4K0K K;  2UXB K;  1XMO K;  4DV3 K;  4DV4 K;  4X62 K;  4JI1 K;  4DR2 K;  1N36 K;  4LF5 K;  1XNR K;  5IT9 O;  2HHH K;  4JI0 K;  2UXC K;  2VQE K;  5BR8 K;  2UUB K;  4JI8 K;  4DR6 K;  3J7Y P;  3T1H K;  4DV1 K;  4DV0 K;  4DR3 K;  4NXN K;  4GKJ K;  1FJG K;  4DV7 K;  1HNW K;  4YHH K;  2F4V K;  4B3S K;  4DV6 K;  3J81 O;  4CVN E;  4JI3 K;  4LFA K;  1XNQ K;  3J80 O;  4OX9 K;  2UXD K;  4JI5 K;  4LF4 K;  1HNZ K;  1HR0 K;  4YY3 K;  4X65 K;  4B3T K;  4KHP K;  4DR7 K;  4JI7 K;  2UUC K;  1J5E K;  5AJ3 K;  1HNX K;  4JI2 K;  2UU9 K;  4X64 K;  1N34 K;  4DUZ K;  5FLX O;  3JAM O;  4DR4 K;  4LF9 K;  1N32 K;  4B3R K;  4DV5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...