3OTOK

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3otoK00
4DR4K 4DR6K 2UU9K 3JAMO 4YHHK 4JYAK 4DR7K 4DR5K 4DV5K 5IT9O 2UXCK 4JI3K 1HNXK 5LL6Z 4K0KK 5BR8K 4B3TK 1XNQK 2UUCK 4LFBK 4GKKK 4CW7B 4LF9K 1HR0K 4DV2K 4DV3K 4JI8K 2UXDK 5IWAK 2HHHK 1J5EK 4DV6K 2ZM6K 4LF5K 4AQYK 4LF7K 1N33K 2VQFK 4DUYK 4DUZK 2E5LK 4DV7K 4NXMK 4DR3K 1FJGK 4LF4K 5FLXO 4DV0K 4V19S 4B3RK 2VQEK 4DV4K 4DR2K 3T1HK 1N32K 1HNZK 1N34K 1XMOK 5LMNK 4DV1K 4B3MK 3OTOK 1I94K 4KHPK 4JI4K 5A2QO 4OX9K 4JV5K 1IBLK 3J7YP 3T1YK 3J7AP 4JI7K 1IBKK 1IBMK 4B3SK 4JI5K 3J80O 1HNWK 4X62K 2UUAK 2UUBK 4NXNK 4GKJK 5LMUK 2UXBK 4JI0K 2F4VK 4JI1K 4LF6K 4JI6K 1XNRK 4X66K 4LFAK 1N36K 4DR1K 4LF8K 1XMQK 4LFCK 4X65K 4CVNE 5AJ3K 4YY3K 4X64K 3J81O 4JI2K
chains in the Genus database with same CATH superfamily
3DXMB 5I9EB 1W97L 4CZEA 3NBPA 3J7ZO 3MXIA 3O9UA 1ZBSA 1D9FA 3BP8A 3MN5A 4F4KA 3DXKA 1UA0A 2FF3B 1KRPA 2BTFA 4DU3A 4CZKA 4AM7A 4IJNA 4FWKA 1C1AA 3KLGA 1LWCA 1BA1A 2HF4A 5LY3A 4YOTA 4J2BA 1J5OA 1Y64A 3HVTA 4LF9K 1QVGM 2E2NA 1WOQA 1S1TA 3AVLA 4XH4A 4KHQA 1W0HA 3ITHA 4DQPA 4JI8K 2X6SA 1BISA 5HRNA 4AHTA 3KD5E 3S3MA 3CD6N 1TKXA 2ASOA 3NF9A 4JNEA 3OYIA 3L0QA 4DWIA 4ID1A 2PZSA 1WB9A 4BR4A 2HW3A 3A5MC 1S6PA 2QXLA 4FWMA 1X1PA 3O9RA 3BF3A 3C6HA 4I2PA 1Y97A 3C6TA 2FXUA 1C0FA 2QI2A 5AQJA 1NBWA 3RSEB 1M90O 4B3RK 3PSIA 3U9ZA 1C0UA 1BU6O 4YOWA 3QFUA 3VQEA 1BWFO 3AV9A 4DTOA 3THYA 4C1NI 5K14A 1NK6A 3L8BA 1IBKK 1SUQA 4PKIA 5C15A 4IDKA 5AQMA 4WFBL 4IXCA 2GUPA 3AA3A 3QLHA 2P9SB 4CHNA 3MMVA 1KLNA 4YDUC 1SL0A 4M63C 4EP4A 2P9PB 1U49A 4IEIA 1QQNA 3RMAA 4X65K 1TL3A 5AQXA 3MN7A 4CJFA 3ZX2A 1NU0A 2XY6A 3V9ZA 3AVFA 1GLFO 3LPUA 3DLHA 4N47A 3TARA 2E88A 1D4XA 4O0IA 3HI0A 2KTQA 3CJAA 4CHOA 2ASPA 3LAKA 1QVFM 1REVA 3GG4A 4DV5K 1LAWA 1S1UA 1L3TA 3M8SA 3TSPA 1SV5A 3L4IA 2OTJN 5KPZA 1NGGA 2QWMA 3CHWA 2P1JA 4B1UB 3MCAB 4MDBA 5B8HA 1RDAA 4PWDA 2A5XA 1VQ6N 3D45A 1I3AA 4CERA 4JKGB 4OGEA 5EX5A 4E7JA 3DYAA 2Q0RA 4JKCA 2V51B 4BRAA 3CM5A 2ZGZA 4DS5A 3RWUA 4BRNA 3IFRA 3CJ9A 4BRHA 3SAHA 4KH6A 5AQTA 4YDUA 4FVUA 5HP1A 1X3NA 3MEEA 1HQEA 4C8OA 1C1CA 4QCLA 4QAGA 1D9DA 3CMEN 4XH5A 2YHBA 5EVZA 1KAZA 4BDYA 3C94A 3ATUA 3IDHA 2KZZA 3OYKA 3VQPA 2ASMA 3HO1A 2XY5A 3DOKA 4B9NA 3E9LA 1YT3A 1JLAA 4DU4A 3RR8A 1KTQA 4IWVA 4CJ5A 3EZWA 3KWIA 2FBTA 4LSNA 5A2QO 3HOTA 3FE1A 4H5WA 1JCGA 4FWQA 2BUPA 3BEXA 3OBWA 4B9QA 4FPAA 1IBMK 2EWSA 1BOTO 1S1VA 2FSNA 1EX4A 2E2QA 3KLHA 4KHUA 4JKBA 4NCAA 3K5OA 1KSPA 1S9GA 5M1NA 4B1YB 5FRNA 2X6NA 3SMSA 5KGWA 2PFUA 3AAPA 4N5SA 4BE1A 1V4TA 4BR2A 3DRPA 4CVNE 3I56N 4BVPA 3VA3A 1FK9A 4J2DA 3AA2A 4EHTA 1ESVA 4UY8O 1DLOA 4O8UA 3KK1A 1VSIA 2KZMA 2QKKA 4KV8A 3CI5A 3RMBA 3KWGA 4H0TB 1VHXA 1GOCA 3WNFA 1BCMA 4FSVA 4Y0WA 1HNVA 4PKGA 3M8QA 4C8MA 5FROA 3AVNA 2QWNA 3F9KA 4DV2K 3QEVA 4OPAA 1NK8A 1HYSA 3RRHA 5E41A 3NE6A 4CK3A 5JVHL 4CJ3A 1ASVA 2FSKA 4RWTA 5KTQA 1VQKN 4JK7A 4IKFA 4C23A 4IG0A 1VSLA 1U2VB 1HPZA 3ISNC 4BRQA 4AH9A 1IV0A 4M7XA 1KVBA 2ITMA 3F9MA 4AM6A 1Q8IA 3UKRA 1FKPA 2WC9A 3QIOA 4WQ5C 1YJNN 4FJ8A 4R5PA 4CJPA 2CGJA 3QBWA 1EXQA 4JD2B 4CBWA 5FLXO 5CE3A 2O8BB 4WFNL 4E89A 2E20A 1T03A 1HJOA 4Z4CA 4FWOA 3O6WA 1XMOK 3FZFA 1VSJA 5C24A 3NVKA 4YOUA 3VEYA 3KZBA 5BN9A 1XWLA 4PUOA 4HWIA 3KTQA 2YNFA 4DFKA 3AO1A 4GY2B 3P83D 4B3SK 2CH5A 3P31A 4NLCA 2RHKA 3HPOA 2Q1NA 4A62A 2LSNA 5D3GA 3CXCM 1C0TA 4OKKA 1RDCA 1K8KB 5JLFA 1Q9YA 3HRGA 1JLQA 5GIOA 3DLLL 3OYEA 1XMQK 1JLEA 2ATQA 5CZ1A 2F96A 4LD0A 4JKEA 1SKWA 5BR9A 2B6AA 1LCUA 1YF5L 4K42A 5AJ3K 3CCRN 3OYBA 5JMVA 2QA4N 4DR6K 3I8DA 3CCJN 4FLYA 3FZHA 2G8UA 2I5JA 4DQRA 3VQBA 4E0DA 3TAGA 3PX6A 4NYNA 2W42A 3NGYA 3OBYA 2HVHA 1LAVA 3LDLA 3QMLA 1RBSA 3LP3A 4FYDA 1VQPN 3NF7A 4OKJA 4E3SA 4EAHD 4KI4A 4CW7B 2NUBA 2YI1A 3VQAA 4C1NK 2FSJA 1T05A 3CQXA 3KKRA 1I39A 4FOEA 4NLBA 4OJRA 1NGAA 1WN7A 5HROA 4IO9L 3NH0A 1RT4A 3VF4A 3QETA 4PHTX 1TAQA 3CFRA 3TTCA 3D6RA 3DXKB 2HHSA 3HT3A 3WT0A 1A5XA 1YUWA 4M3RA 3AO4A 3MECA 2HBKA 2VWBA 4CGHA 2VGNA 3TABA 2P9LA 1N32K 1RDDA 4NCGA 5CY4A 3SBGA 4ZTJA 4B9VA 3HSTB 3S41A 4KO0A 4JKAA 4CGIA 3QERA 5GAHP 5E84A 4MLHA 2ZJPL 3WNGA 3QDKA 3MEDA 4CF0A 3V4IA 4KBOA 1BO5O 3RMDA 3E1YA 3ZX3A 1HNWK 2UUAK 1Q9XA 4HVJA 1GOAA 3HOSA 3SQ4A 4BC4A 4YOXA 3THWA 2HVIA 4X66K 4ID5A 5AQIA 4CFAA 4CD1A 3LZIA 3O08A 4B1WB 5TKYA 5AFUA 3CCQN 4OGCA 3O4NA 1XC9A 2D4WA 3L2WA 4X64K 3K0SA 4DR4K 3IG1A 4K41A 3DI6A 3LDPA 4FM1A 3THYB 1BI4A 5EXWA 5I3UA 3FZKA 1UAXA 2G8FA 4GVEA 1QTMA 3PY8A 1EKEA 3P39A 2W41A 4CJ4A 3CJBA 4CEBA 1VK0A 3FLCO 1XUPO 3TTFA 3IRXA 4UQGA 3LDQA 3O9SA 1TAUA 2P9KA 4Z4GA 3MX2A 3NH1A 1T6DA 4IZ9A 5KPRA 2YHXA 4YNQA 4DMNA 3S3OA 2JGUA 4GVMA 5DMRA 1JXEA 3VEXA 3ZSOA 2QWQA 3KHYA 5ADXH 5C2FA 2V7YA 3AO5A 3F2KA 3DLEA 5AQVA 4MFBA 3SJJA 3OYJA 4CK2A 3CCUN 1IG8A 3G71N 4DV7K 1BUPA 4DF8A 4JS4A 3AGRA 5GAEP 3V1OA 4GW6A 3OYFA 1RBUA 1NLVA 2OANA 3FFKB 4DTPA 4FWRA 4RCHA 3ZT0A 2G8KA 4RW4A 1SQKA 1X9JA 3O9TA 4A5AA 2HBMA 3MDQA 2QWPA 3LDOA 1R0AA 3O1WA 2ITGA 5DM7L 4CEDA 1JCFA 5BRDA 4EP5A 3TPQA 3CCSN 1KAXA 3VQDA 4A57A 2E1ZA 3VETA 2FBVA 4CBUA 5JLHA 4DG1A 3V9XA 4JI1K 2D0BA 3AVJA 1XHXA 3LP1A 4BACA 1YITN 4DR1K 4JKDA 1KVCA 2FBYA 1L3UA 1G15A 3ZSZA 1VQ5N 1LOTB 4O8KA 4IEEA 1X9WA 5CHIA 3SUQA 4CFCA 4CEAA 3VPZA 4EFHA 1CXQA 2GEMA 1JJ2M 3MWPA 5KRTA 1IO2A 4H0PA 1CLQA 4A2BA 4IG3A 3M6GA 4PQUA 3AGKA 3UKUA 4B3TK 3CQYA 4F3OA 3SUOA 2HMPA 4CJKA 2P9UA 4H4OA 4KRFA 4MDAA 4CGDA 3LZJA 4CCHA 3WXLA 5AQZA 4WYBA 1KFSA 3GL1A 2IGIA 2YHAA 3ZLJA 2ZJRL 2HHQA 3CC4N 1EETA 1TVRA 3SPZA 1N8RO 3V81A 2HSTA 2WTUA 5BN8A 1HNIA 3PLAA 2XRIA 1HKCA 4IDHA 3N4PA 4L3QA 4BRFA 3V1QA 1T7PA 4CECA 2NRWA 4LH4A 3MEGA 4OPJA 4N41A 4IOAL 3LANA 4WE1A 3OVNA 4LSLA 4O55A 1ZYQA 1U47A 4Z4IA 1MWMA 4Q5VA 4CHYA 4XEIA 4KPYA 4CZGA 2X74A 3KK3A 5LMNK 4XH1A 2R7YA 5AQFA 1S1XA 3DRSA 3OYGA 3V9SA 3K58A 2VGMA 3LAMA 1VSFA 1SKRA 3QNOA 2KHOA 3J80O 4KTZA 4HCCA 1DGKN 4K8XA 1GLCG 5FPNA 1K8AO 4CHPA 4IOCL 4FW2A 3UKRB 4H5VA 4LFAK 1RFQA 1NJYA 1BIUA 3ID8A 4PL7A 5C25A 3ID6A 3WEEA 3MN9A 2GBZA 3SAGA 3BZKA 5EOYA 4DTJA 5F1XA 3M8PA 5AQWA 4F3TA 1WSEA 1RT5A 3TSQA 4AHCA 4JEPA 1UOCA 3J8AA 4M45A 3VQQA 1NOYA 4CIEA 3LDSA 2YV0X 3AVCA 2AJQA 4HHTA 3P1GA 4YORA 2XY7A 2IIRA 3LWMA 4CJWA 2HB5A 3L6QA 1L3VA 5J2MA 3L2QA 4LFBK 3BZCA 1EQYA 2O8FA 4GKKK 5J2QA 3EKSA 2DPNA 1ZBIA 2JWKA 3GBTA 4ELUA 3CJCA 3TU5A 2OYQA 3SNNA 4PL8A 4BWMA 2UXDK 4F2SA 3EE8A 1IG9A 5AQQA 5AR0A 5IWAK 4BC5A 1DKGD 1OVYA 4B1ZA 2Q97A 2ZM6K 4LF5K 1EWQA 1WSJA 1NGHA 1Z05A 4W5NA 2QEXN 1ZBUA 3W0LA 1WNSA 2HHVA 4CF1A 3K59A 3EYZA 2P5GA 1KFDA 3OHRA 4OPHA 1BCOA 2PY5A 1NOZA 3FR0A 4V19S 2A41A 5HRRA 4DV4K 4FL9A 3I8BA 4JRPA 3P4IA 2O8EA 4B3MK 5CYMA 4BQLA 4H0XB 1DTQA 1HKGA 3CQ8A 3BY5A 3OS2A 1ZBFA 4JHDA 3AVGA 2HOEA 3THVA 3GOIA 3VF2A 3O3GA 1GLLO 4I2QA 1K6YA 4LY7A 3HP6A 2OPRA 4GKJK 4GV6A 1UWBA 1VSMA 3VGKA 2DY4A 4FWSA 3I55N 3QESA 2OZMA 3VGMA 1OH6A 5JS2A 4FJNA 3C65A 4MO5A 1XNRK 3HVRA 4FJGA 3HL8A 1NGFA 4DKWA 2Z1GA 3IKMA 2DFEA 2DFFA 1HUXA 2P9LB 4LH5A 3VENA 2BH1A 4FJKA 3G25A 1VQ7N 4YY3K 3THXA 1HX1A 2Z1IA 4CEOA 1P8ZA 2NZTA 4R79A 3OJSA 4JKHA 3NHGA 4FZZA 4FJ9A 3T1AA 1HPMA 3ENBA 4CZFA 1Q7YO 3L2UA 4JK8A 1B9FA 3VQ8A 5BPNA 3GDQA 1HNXK 4AF1A 1BQMA 4CI6A 1MA9B 1NK0A 1O1WA 1KQSM 2UYTA 1NGEA 3MX5A 5GINA 2OZSA 4FPBA 1T3VA 2XHBA 4WQ4C 2GV9A 1GLAG 3O4QA 3THWB 4ELVA 2X78A 2KKZA 3EY1A 3E9OA 3CETA 3IUCA 1MDUB 3H46O 4FVMA 1JXBA 1BIZA 3ZSRA 4H0OA 5FDLA 1NK5A 1GOBA 3D0PA 2YNGA 1BI4B 1RBVA 5KQ8A 2D0OA 1X3MA 2O8CA 4EZ6A 4ZHRA 4JN4A 4MO4A 3HBTA 3I0RA 4Y1DA 4LF4K 2KFZA 3T1HK 1MWKA 4BR5A 1H1VA 1N34K 3NDKA 3M3ZA 2CGKA 4DTSA 1VRTA 1LWEA 4DSLA 1TV6A 2P9KB 4Z94A 4O5BA 4HUGA 3J7YP 1TKDA 3A8YA 4IFVA 3O8MA 5FPMA 3TAFA 1ZC6A 1RDWX 4I6MA 4DS4A 2E4LA 4FLTA 4X62K 5BPMA 4WQ4A 2UUBK 3LDNA 1HYZA 3VGLA 1CZ9A 1HMVA 5MLCQ 5J2PA 1U4BA 3CFOA 4AHSA 3SZ2A 3TANA 5AQNA 1Q82O 3VERA 4OKEA 2QXFA 4AHUA 3S9HA 3EN9A 1XHZA 1IKWA 4IFEA 4ICLA 3VESA 4JYAK 4J2EA 5FRMA 4DR5K 5AQOA 3EKUA 4E19A 5F0XA 3PIOL 2OCEA 3CERA 4GV3A 4FWNA 3HTVA 4B9MA 1YXQA 4BGAA 3AO2A 1VQLN 4BR0A 4GMJB 5HOOA 2A1RA 1NKBA 3G6EN 3A5OC 1VAZA 1RNHA 3RRGA 3VOVA 3L3UA 1U04A 4NYFA 3LPTA 1NKCA 4DU1A 2HHXA 4ISEA 3BF1A 1LW2A 2XY8A 4DV6K 1EP4A 1QSLA 1LW0A 3SQ0A 1TK8A 1RTJA 4NO7A 4EZ9A 4DF4A 4DUYK 2NLXA 2BANA 4YOVA 4QS8A 3AVMA 4ILJA 5ADXA 3QO9A 4FJJA 4FM0A 1SZ2A 3LL3A 3OYHA 3UKUB 4N56A 2P9UB 4DTNA 1IKYA 3D2EA 2A1SA 3PIPL 4YOYA 1I94K 3DMJA 4KHPK 1GLJO 3LM2A 5AQYA 5HRSA 3B6OA 1XQSC 4HUFA 1T6CA 3T1YK 4HCBA 3O1BA 4CJQA 1SL1A 3AVKA 4C8NA 4JI5K 2E1YA 1RDBA 4DHYA 5M1QA 1NK7A 4CFBA 3QIPA 3WXIA 5M1FA 5SWMA 1JLCA 3FZMA 4K25A 5BREA 5CZ2A 1WAJA 1RBTA 3P38A 4O4GA 4Z0UA 2ETJA 3MAQA 2AP1A 3VEOA 1NM1A 1GLBG 4LF8K 4IOXA 3D2FA 2VYPA 3LP2A 4FWPA 2VCPA 3HPGA 1L5UA 4FJMA 3CJ7A 3SYZA 4FJIA 3KLFA 2KQ2A 3ALYA 3VEVA 3CC2N 1NGDA 4JI3K 3PX0A 1MU2A 3ZT3A 1S6QA 3VF6A 4Z4HA 3SQ1A 2RF2A 3A2FA 3TI0A 3IAYA 2OA8A 2HNDA 3HJFA 1HLUA 4A2AA 1ITGA 1OVQA 2BGGA 4I9QA 4DLGA 4DFPA 3RR7A 3JS6A 1BA0A 3ZT1A 3WEEB 4O0JA 1W2BM 1CZBA 3SBTA 5JVGL 2IAJA 4CF2A 4AQYK 1Z25A 3H6EA 2YHWA 2G8HA 3ZYYX 1LV5A 3O9QA 2YNIA 5DM6L 4CEZA 4JS5A 4BRGA 3ENHA 5C42A 4J2AA 4W5OA 4Q0BA 1Q81O 5HL7L 4ILGB 1HRHA 4K8ZA 4FM2A 2EX3A 4CBXA 3T3FA 4CE9A 1RTIA 3L4QA 2O8FB 2JLEA 3UIQA 4WF9L 1T44A 2YJFA 4B8CA 4KKOA 4OX9K 1IBLK 3ZETA 1DEJA 2GWJA 3OW2M 2F7TA 1ILYA 3FFIA 5HBMA 4KB0A 1Z26A 3K9JA 4EHUA 3S3NA 1DT9A 3C95A 4CGJA 1TKTA 2GUIA 3WXJA 4KHYA 3VQ4A 1IJJA 3VTIA 3OA9A 1RTHA 4KH5A 4IBNA 4KHWA 5BRFA 1D8YA 2ZQBA 3T69A 4JLHA 4DTRA 3KIOA 1RILA 4OLAA 1N36K 4F9OA 4BREA 4RW8A 1NGJA 1BG3A 1VRUA 1VQ4N 1TK5A 2WBNA 4L8RB 5C2DA 4E7LA 3CMAN 2O8EB 3NF8A 4FJLA 1FKOA 2ZE2A 1BHLA 4M3XA 4RG8A 1RT3A 2E2PA 3SV4A 4CJLA 5AQUA 2W6LA 4JHDB 3B6PA 3AARA 3U8XA 5T7BA 2A42A 3D7EO 2UXCK 3ZSXA 2QWRA 4K0KK 3O3FA 4AILC 1QQMA 3LALA 1SAZA 4OO1J 1BDGA 3MN6A 2CGLA 2A3ZA 3NCIA 1BGXT 2ZD1A 1E4FT 2E2OA 3R9PA 2NNWA 3CCEN 2P9IA 3H08A 4BRPA 3THXB 1J5EK 3V1RA 1S5JA 4LF7K 3MWTA 4BROA 3K9KA 4O5FA 4U67L 4B9TA 3OYAA 3R3LA 3O5BA 3CG7A 4H4MA 5AQGA 4FLXA 2E5LK 2P5OA 4YFUA 1QSSA 3OS1A 1DTTA 2RN2A 1FJGK 2HNYA 3WQTA 4DV0K 5AZIA 2RE2A 1Q18A 3SI6A 4WFAL 4FZXC 1RT7A 4DV1K 3WNEA 4G9ZA 2IS3A 3EZ5A 3ZSYA 4H5RA 3DAWA 1HKBA 3HK2A 4RTFD 4NB4A 3AVHA 1ATNA 3CYMA 2J4RA 3C6AA 3HM9A 3CJ1A 5LJVA 3F73A 2RPIA 1XC3A 3EE9A 3VQ9A 4FJ5A 4BRMA 5M1KA 3VMFB 4KAZA 5FPDA 1YVNA 4BDZA 3MXMA 3KLIA 3E66A 4C8KA 3Q7CA 2O8CB 4E1MA 5AQLA 1KAYA 3QNNA 4DCHA 3KVGA 2HHUA 4LFCK 3AA5X 3BUZB 4OVLA 1WBBA 1YJWN 4CF9A 5BPLA 2IVOA 4JI2K 3JXUA 4IFYA 3DWLA 3T7ZA 3SQ2A 1WSFA 1G99A 2O4IA 3WXKA 1TL1A 1TK0A 4KB1A 4DR7K 1NGIA 3SUNA 5AQSA 4G1QA 3TSUA 2Q2RA 3MK6A 3SPYA 4CD3A 4I6MB 2IOCA 3TR8A 3KKSA 2I7NA 1NJWA 4CJVA 3CF5L 4FCYA 5GIPA 3H1VX 3QBXA 3K5LA 1NG9A 3CIPA 3KJVA 3VEWA 1YI2N 2WFBA 3CCMN 3M5RA 2FC0A 1HR0K 3TTDA 4E7IA 3SLCA 5SZTA 1U48A 3PUFA 4M3UA 2OPPA 1B9DA 2ZF5O 4CGFA 3L3VA 1VSHA 2HBJA 4CEEA 3CCLN 5BRHA 3C6UA 2IDOA 3ZT4A 4B08A 3QEXA 5JICA 3DOLA 5AQHA 4DTMA 1CXUA 2KLAA 4K43A 2Z1JA 2F9TA 1IKVA 3KLEA 1VSEA 1IH7A 2OPSA 2DFHA 2QW9A 3C7NA 3ZT2A 1QSYA 5KQDA 3QB0A 3AAQA 3OY9A 4CEQA 1JCEA 4CIGA 2HHTA 3CM6A 3EEQA 3MXJA 3AVAA 3PO4A 4FZYA 3OJUA 3HYFA 4CZLA 3K57A 3TAEA 1VQ8N 1QQOA 1ASUA 3J7AP 3DLRA 4FW1A 3TAMA 4A5BA 2RKIA 3DM2A 4DQQA 3LP0A 2NRTA 3F5TA 4AHVA 3TWHA 1EWRA 4BE0A 4NXNK 4CFDA 2O8DA 3M1FA 4LF6K 4JI6K 1P90A 3EO3A 2E6MA 4M42A 4E7KA 1CZAN 4KREA 3U3YA 4B3OA 4E1NA 3RVCA 4BRLA 4DQIA 3D2EB 5AZJA 4F2RA 3VEZA 1VQMN 1B92A 1KD1O 2UU9K 3JAMO 1C0MA 4CJ7A 1YTAA 4W5QA 3WUHA 4MQ3A 2A6AA 2WOMA 4ISFA 1FW6A 2F8SA 4HTLA 3NFAA 5LL6Z 2P9NA 4FO0A 4RW9A 3R8EA 1EO1A 2VG7A 2WONA 5I42A 3V6DA 3EL2A 3O4WA 2PBDA 3VQ6A 1KC8O 2NRVA 5AQPA 4CGGA 2GELA 3HP9A 3D2FB 2PYJA 1NGBA 1S3XA 1WUAA 1JLGA 3U9DA 5H1SQ 2A40A 3VQCA 3W3DA 4CK1A 3DLKA 4E1JA 1W9HA 2D5RA 1N33K 1QQCA 1TYQA 2E8AA 3G10A 4DUZK 4BG9A 4DSJA 2AA4A 3OYNA 4FLUA 4FK4A 4GNIA 4DR3K 3ULEA 3ATVA 4JKFA 1NMNA 4CIFA 2Q3SA 1J53A 3HPHA 3I33A 1HNZK 3ZEUA 4GV9A 4W5TA 2WUSA 3OYCA 4M3ZA 5KGXA 3DXMA 1S72N 2Q0UA 1JL2A 1C6VA 2G8WA 5CR4A 1SKSA 2VWKA 1HJRA 4B9SA 2EHGA 4B9UA 4DTXA 1VSDA 1Z6RA 1NKEA 3SAFA 3SJHA 4ISGA 4BY9C 3OYMA 3VTHA 1RT6A 1NWKA 1QE1A 3O3HA 3CFPA 4JI0K 4BRCA 4KHNA 3LM9A 4Z4EA 3H45C 4DQSA 1VSKA 4BC3A 4M3YA 1TKZA 4BWJA 4BR9A 2Z1HA 1UA1A 4RW7A 1WSIA 4TSXA 3J81O 4DSFA 4BGBA 1NJIO 3QEIA 3O80A 1QZ6A 3HZ6A 3BGRA 1S1WA 2G8VA 2P51A 3ZETB 2FF6A 2DTUA 4H0YB 2FBXA 1NMDA 3L2VA 4KI6A 3TAQA 3DJCA 5LJWA 4M3WA 1X9MA 1QHAA 4B9LA 1O13A 3G0ZA 3RSEA 1WSGA 3AO3A 1M1KO 1XNQK 2UUCK 3ZCMA 1WAFA 3I0SA 3MCPA 2PAVA 1KVAA 1GLDG 2F9WA 2Y1IA 2GWKA 4CZJA 3N4QA 1E4GT 1WSHA 5J2NA 4BC2A 4ELTA 2YKMA 1S9EA 1JKHA 4OPKA 3SV3A 4IO8A 2P9SA 4KFBA 1E3MA 4CZMA 1SL2A 2BDPA 4DSIA 2VQFK 3SMPA 3PO5A 4I7FA 4FK2A 3C0BA 1HQUA 2P9PA 2O4GA 1ASWA 1U6ZA 4FJHA 3WXMB 1C1BA 3G4SN 4DSEA 4DR2K 2ZGYA 1S22A 5F2RA 1OKJA 1LWFA 3OTOK 4KH4A 1X9SA 3R1XA 3QINA 4PKHA 2B4JA 3ZSQA 2IVNA 2YJEA 4BR7A 4W5RA 3FZLA 3CC7N 4FK0A 4DSKA 4N76A 2V52B 3ENOA 4JI7K 4QS9A 1TUUA 2P9IB 4CJUA 1JLFA 1RDUA 1D5AA 2Q31A 1KLMA 4CHZA 3JSMA 1YAGA 3M8RA 3TAPA 4WQ5A 1Q86O 3U4LA 4M7YA 4IJAA 4LC9B 4QS7A 4JKGA 3B8AX 3VQ5A 3SK3A 3A5LC 4DFJA 3A5NC 5AZIB 3AVBA 4ZTFA 5CYQA 4JK9A 2ZJQL 3R6MA 5ELZA 4PA1A 4YHHK 1KCFA 4CZHA 2D1KA 1ZBHA 5E26A 1JLBA 4XIUA 1TGOA 1W7AA 3LWLA 5IT9O 3OS0A 1JL1A 1FXXA 4CJEA 4FLZA 2F8TA 4FOIA 1ATSA 4HUEA 4H03B 1BQNA 1ZBLA 4Z4FA 5BR8K 3DRRA 3SUPA 2YHYA 2HBLA 4AHRA 1L3SA 4M41A 4CZIA 3AA4A 3KK7A 1YHQN 1BL3A 1QS4A 2NRHA 4CJSA 1RTDA 1ZXOA 2NRXA 2IC3A 4B8AB 1ATRA 3T19A 3VA0A 3AVIA 4M3TA 4BVOA 4BDPA 2D0AA 4NCBA 5GADP 3NVMA 3SCXA 4F8RA 2I7PA 4H5NA 4WCEL 3PX4A 3DLBA 5C10A 4CEFA 2D0PA 1YJ9N 1KXPA 4CESA 3H3NO 5C0YA 4DQ8A 4DTUA 2CH6A 1NK4A 5J1EA 4MLEA 3V9UA 4BRKA 4EIAA 1NNEA 4NXMK 2QTDA 3OYDA 4BRIA 4CJTA 2VQEK 3CCVN 4FWLA 2G8IA 1XI1A 3QICA 2VWJA 1N6QA 4JV5K 4RW6A 3Q7BA 2HF3A 3E01A 1J6ZA 3GE1A 1NJXA 5TKWA 1HYVA 1RT1A 4CJRA 1U45A 1J9AA 2QWOA 4O44A 3NGZA 1NK9A 2VG5A 1RBRA 4C8LA 1NJZA 2NRZA 4FJXA 2UXBK 3NMUA 3WQUA 3NH2A 3C7NB 3PV8A 1RCHA 3VQ7A 4DFMA 3A0IX 2V7ZA 2KW4A 5HLFA 2W40A 3HSCA 3K5NA 3QEPA 3U3GA 2GTDA 3OYLA 5C12A 1YVUA 4A59A 4DLEA 1VQ9N 2YNHA 3P5JA 2FLOA 4JAXA 3UB5A 4B1XB 1U2VA 2QM1A 3NAEA 5KPTA 2HMIA 3ULDA 1K73O 2Y1JA 1WLJA 2Q36A 3NF6A 3HXMA 3H3OB 2JWLA 5FPEA 1VQON 5M1OA 3NGIA 1YIJN 3JYTA 1F21A 1QZ5A 4JD2A 4BRDA 2OPQA 5KI6A 5HRPA 2O8BA 3KK2A 5JS1A 3UE5A 3K5MA 2NRRA 1RT2A 2O8DB 3DLGA 4KTQA 4U7BA 4B1VA 5AQKA 4FXDA 5DK5A 2YCHA 4DV3K 4Y1CA 3RMCA 3CPWM 2B5JA 2IVPA 3ZX0A 1QHTA 2VG6A 2HHHK 2QK9A 2HNZA 4CF8A 5AZJB 3FGUA 4BQZA 2PYLA 1VQNN 1IKXA 4PY5A 4BE2A 1A5VA 2HHWA 5M1PA 1K8KA 2QKBA 4H5TA 5KRSA 1RGIA 3ZSWA 4A61A 1T8EA 3VN5A 3BDPA 4KHSA 5EY4A 2P9NB 1A5WA 4FJ7A 3IMXA 2ZWHA 1OH8A 3KD1E 5EU7A 2XO7A 4E7HA 3IS9A 2W6KA 4JI4K 3HM8A 2QWLA 1NGCA 4CHQA 3L2RA 1OH7A 1J54A 1C0GA 1OH5A 4ILHA 4KTWA 3K2PA 3WNHA 4BG8A 3CPEA 4I9LA 4H8KA 3ASMA 3AY9A 3V9WA 3QFPA 1V4SA 4QOZB 2YX6A 2GX9A 5AFUH 2OTLN 1TYQB 4DB3A 5LMUK 4OLBA 2H3GX 4FLVA 1YTUA 1R59O 3H1QA 3ZSVA 5GAGP 2F4VK 3PSFA 4HTUA 4FLWA 2D0CA 1WBDA 4J8FA 2BE2A 2YKNA 1TUYA 5AQRA 3E9PA 3ULEB 1K9MO 1GLEG 1SS6A 1N5YA 4H0VB 3ZEUB 3RTVA 4JRQA 2KFNA 3QEWA 3U6FA 2E6LA
chains in the Genus database with same CATH topology
4DR4K 4DR6K 2UU9K 3JAMO 4YHHK 4JYAK 4DR7K 4DR5K 4DV5K 5IT9O 2UXCK 4JI3K 1HNXK 5LL6Z 4K0KK 5BR8K 4B3TK 1XNQK 2UUCK 4LFBK 4GKKK 4CW7B 4LF9K 1HR0K 4DV2K 4DV3K 4JI8K 2UXDK 5IWAK 2HHHK 1J5EK 4DV6K 2ZM6K 4LF5K 4AQYK 4LF7K 1N33K 2VQFK 4DUYK 4DUZK 2E5LK 4DV7K 4NXMK 4DR3K 1FJGK 4LF4K 5FLXO 4DV0K 4V19S 4B3RK 2VQEK 4DV4K 4DR2K 3T1HK 1N32K 1HNZK 1N34K 1XMOK 5LMNK 4DV1K 4B3MK 3OTOK 1I94K 4KHPK 4JI4K 5A2QO 4OX9K 4JV5K 1IBLK 3J7YP 3T1YK 3J7AP 4JI7K 1IBKK 1IBMK 4B3SK 4JI5K 3J80O 1HNWK 4X62K 2UUAK 2UUBK 4NXNK 4GKJK 5LMUK 2UXBK 4JI0K 2F4VK 4JI1K 4LF6K 4JI6K 1XNRK 4X66K 4LFAK 1N36K 4DR1K 4LF8K 1XMQK 4LFCK 4X65K 4CVNE 5AJ3K 4YY3K 4X64K 3J81O 4JI2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 K;  4DR6 K;  2UU9 K;  3JAM O;  4YHH K;  4JYA K;  4DR7 K;  4DR5 K;  4DV5 K;  5IT9 O;  2UXC K;  4JI3 K;  1HNX K;  5LL6 Z;  4K0K K;  5BR8 K;  4B3T K;  1XNQ K;  2UUC K;  4LFB K;  4GKK K;  4CW7 B;  4LF9 K;  1HR0 K;  4DV2 K;  4DV3 K;  4JI8 K;  2UXD K;  5IWA K;  2HHH K;  1J5E K;  4DV6 K;  2ZM6 K;  4LF5 K;  4AQY K;  4LF7 K;  1N33 K;  2VQF K;  4DUY K;  4DUZ K;  2E5L K;  4DV7 K;  4NXM K;  4DR3 K;  1FJG K;  4LF4 K;  5FLX O;  4DV0 K;  4V19 S;  4B3R K;  2VQE K;  4DV4 K;  4DR2 K;  3T1H K;  1N32 K;  1HNZ K;  1N34 K;  1XMO K;  5LMN K;  4DV1 K;  4B3M K;  3OTO K;  1I94 K;  4KHP K;  4JI4 K;  5A2Q O;  4OX9 K;  4JV5 K;  1IBL K;  3J7Y P;  3T1Y K;  3J7A P;  4JI7 K;  1IBK K;  1IBM K;  4B3S K;  4JI5 K;  3J80 O;  1HNW K;  4X62 K;  2UUA K;  2UUB K;  4NXN K;  4GKJ K;  5LMU K;  2UXB K;  4JI0 K;  2F4V K;  4JI1 K;  4LF6 K;  4JI6 K;  1XNR K;  4X66 K;  4LFA K;  1N36 K;  4DR1 K;  4LF8 K;  1XMQ K;  4LFC K;  4X65 K;  4CVN E;  5AJ3 K;  4YY3 K;  4X64 K;  3J81 O;  4JI2 K; 
#chains in the Genus database with same CATH topology
 3DXM B;  5I9E B;  1W97 L;  4CZE A;  3NBP A;  3J7Z O;  3MXI A;  3O9U A;  1ZBS A;  1D9F A;  3BP8 A;  3MN5 A;  4F4K A;  3DXK A;  1UA0 A;  2FF3 B;  1KRP A;  2BTF A;  4DU3 A;  4CZK A;  4AM7 A;  4IJN A;  4FWK A;  1C1A A;  3KLG A;  1LWC A;  1BA1 A;  2HF4 A;  5LY3 A;  4YOT A;  4J2B A;  1J5O A;  1Y64 A;  3HVT A;  4LF9 K;  1QVG M;  2E2N A;  1WOQ A;  1S1T A;  3AVL A;  4XH4 A;  4KHQ A;  1W0H A;  3ITH A;  4DQP A;  4JI8 K;  2X6S A;  1BIS A;  5HRN A;  4AHT A;  3KD5 E;  3S3M A;  3CD6 N;  1TKX A;  2ASO A;  3NF9 A;  4JNE A;  3OYI A;  3L0Q A;  4DWI A;  4ID1 A;  2PZS A;  1WB9 A;  4BR4 A;  2HW3 A;  3A5M C;  1S6P A;  2QXL A;  4FWM A;  1X1P A;  3O9R A;  3BF3 A;  3C6H A;  4I2P A;  1Y97 A;  3C6T A;  2FXU A;  1C0F A;  2QI2 A;  5AQJ A;  1NBW A;  3RSE B;  1M90 O;  4B3R K;  3PSI A;  3U9Z A;  1C0U A;  1BU6 O;  4YOW A;  3QFU A;  3VQE A;  1BWF O;  3AV9 A;  4DTO A;  3THY A;  4C1N I;  5K14 A;  1NK6 A;  3L8B A;  1IBK K;  1SUQ A;  4PKI A;  5C15 A;  4IDK A;  5AQM A;  4WFB L;  4IXC A;  2GUP A;  3AA3 A;  3QLH A;  2P9S B;  4CHN A;  3MMV A;  1KLN A;  4YDU C;  1SL0 A;  4M63 C;  4EP4 A;  2P9P B;  1U49 A;  4IEI A;  1QQN A;  3RMA A;  4X65 K;  1TL3 A;  5AQX A;  3MN7 A;  4CJF A;  3ZX2 A;  1NU0 A;  2XY6 A;  3V9Z A;  3AVF A;  1GLF O;  3LPU A;  3DLH A;  4N47 A;  3TAR A;  2E88 A;  1D4X A;  4O0I A;  3HI0 A;  2KTQ A;  3CJA A;  4CHO A;  2ASP A;  3LAK A;  1QVF M;  1REV A;  3GG4 A;  4DV5 K;  1LAW A;  1S1U A;  1L3T A;  3M8S A;  3TSP A;  1SV5 A;  3L4I A;  2OTJ N;  5KPZ A;  1NGG A;  2QWM A;  3CHW A;  2P1J A;  4B1U B;  3MCA B;  4MDB A;  5B8H A;  1RDA A;  4PWD A;  2A5X A;  1VQ6 N;  3D45 A;  1I3A A;  4CER A;  4JKG B;  4OGE A;  5EX5 A;  4E7J A;  3DYA A;  2Q0R A;  4JKC A;  2V51 B;  4BRA A;  3CM5 A;  2ZGZ A;  4DS5 A;  3RWU A;  4BRN A;  3IFR A;  3CJ9 A;  4BRH A;  3SAH A;  4KH6 A;  5AQT A;  4YDU A;  4FVU A;  5HP1 A;  1X3N A;  3MEE A;  1HQE A;  4C8O A;  1C1C A;  4QCL A;  4QAG A;  1D9D A;  3CME N;  4XH5 A;  2YHB A;  5EVZ A;  1KAZ A;  4BDY A;  3C94 A;  3ATU A;  3IDH A;  2KZZ A;  3OYK A;  3VQP A;  2ASM A;  3HO1 A;  2XY5 A;  3DOK A;  4B9N A;  3E9L A;  1YT3 A;  1JLA A;  4DU4 A;  3RR8 A;  1KTQ A;  4IWV A;  4CJ5 A;  3EZW A;  3KWI A;  2FBT A;  4LSN A;  5A2Q O;  3HOT A;  3FE1 A;  4H5W A;  1JCG A;  4FWQ A;  2BUP A;  3BEX A;  3OBW A;  4B9Q A;  4FPA A;  1IBM K;  2EWS A;  1BOT O;  1S1V A;  2FSN A;  1EX4 A;  2E2Q A;  3KLH A;  4KHU A;  4JKB A;  4NCA A;  3K5O A;  1KSP A;  1S9G A;  5M1N A;  4B1Y B;  5FRN A;  2X6N A;  3SMS A;  5KGW A;  2PFU A;  3AAP A;  4N5S A;  4BE1 A;  1V4T A;  4BR2 A;  3DRP A;  4CVN E;  3I56 N;  4BVP A;  3VA3 A;  1FK9 A;  4J2D A;  3AA2 A;  4EHT A;  1ESV A;  4UY8 O;  1DLO A;  4O8U A;  3KK1 A;  1VSI A;  2KZM A;  2QKK A;  4KV8 A;  3CI5 A;  3RMB A;  3KWG A;  4H0T B;  1VHX A;  1GOC A;  3WNF A;  1BCM A;  4FSV A;  4Y0W A;  1HNV A;  4PKG A;  3M8Q A;  4C8M A;  5FRO A;  3AVN A;  2QWN A;  3F9K A;  4DV2 K;  3QEV A;  4OPA A;  1NK8 A;  1HYS A;  3RRH A;  5E41 A;  3NE6 A;  4CK3 A;  5JVH L;  4CJ3 A;  1ASV A;  2FSK A;  4RWT A;  5KTQ A;  1VQK N;  4JK7 A;  4IKF A;  4C23 A;  4IG0 A;  1VSL A;  1U2V B;  1HPZ A;  3ISN C;  4BRQ A;  4AH9 A;  1IV0 A;  4M7X A;  1KVB A;  2ITM A;  3F9M A;  4AM6 A;  1Q8I A;  3UKR A;  1FKP A;  2WC9 A;  3QIO A;  4WQ5 C;  1YJN N;  4FJ8 A;  4R5P A;  4CJP A;  2CGJ A;  3QBW A;  1EXQ A;  4JD2 B;  4CBW A;  5FLX O;  5CE3 A;  2O8B B;  4WFN L;  4E89 A;  2E20 A;  1T03 A;  1HJO A;  4Z4C A;  4FWO A;  3O6W A;  1XMO K;  3FZF A;  1VSJ A;  5C24 A;  3NVK A;  4YOU A;  3VEY A;  3KZB A;  5BN9 A;  1XWL A;  4PUO A;  4HWI A;  3KTQ A;  2YNF A;  4DFK A;  3AO1 A;  4GY2 B;  3P83 D;  4B3S K;  2CH5 A;  3P31 A;  4NLC A;  2RHK A;  3HPO A;  2Q1N A;  4A62 A;  2LSN A;  5D3G A;  3CXC M;  1C0T A;  4OKK A;  1RDC A;  1K8K B;  5JLF A;  1Q9Y A;  3HRG A;  1JLQ A;  5GIO A;  3DLL L;  3OYE A;  1XMQ K;  1JLE A;  2ATQ A;  5CZ1 A;  2F96 A;  4LD0 A;  4JKE A;  1SKW A;  5BR9 A;  2B6A A;  1LCU A;  1YF5 L;  4K42 A;  5AJ3 K;  3CCR N;  3OYB A;  5JMV A;  2QA4 N;  4DR6 K;  3I8D A;  3CCJ N;  4FLY A;  3FZH A;  2G8U A;  2I5J A;  4DQR A;  3VQB A;  4E0D A;  3TAG A;  3PX6 A;  4NYN A;  2W42 A;  3NGY A;  3OBY A;  2HVH A;  1LAV A;  3LDL A;  3QML A;  1RBS A;  3LP3 A;  4FYD A;  1VQP N;  3NF7 A;  4OKJ A;  4E3S A;  4EAH D;  4KI4 A;  4CW7 B;  2NUB A;  2YI1 A;  3VQA A;  4C1N K;  2FSJ A;  1T05 A;  3CQX A;  3KKR A;  1I39 A;  4FOE A;  4NLB A;  4OJR A;  1NGA A;  1WN7 A;  5HRO A;  4IO9 L;  3NH0 A;  1RT4 A;  3VF4 A;  3QET A;  4PHT X;  1TAQ A;  3CFR A;  3TTC A;  3D6R A;  3DXK B;  2HHS A;  3HT3 A;  3WT0 A;  1A5X A;  1YUW A;  4M3R A;  3AO4 A;  3MEC A;  2HBK A;  2VWB A;  4CGH A;  2VGN A;  3TAB A;  2P9L A;  1N32 K;  1RDD A;  4NCG A;  5CY4 A;  3SBG A;  4ZTJ A;  4B9V A;  3HST B;  3S41 A;  4KO0 A;  4JKA A;  4CGI A;  3QER A;  5GAH P;  5E84 A;  4MLH A;  2ZJP L;  3WNG A;  3QDK A;  3MED A;  4CF0 A;  3V4I A;  4KBO A;  1BO5 O;  3RMD A;  3E1Y A;  3ZX3 A;  1HNW K;  2UUA K;  1Q9X A;  4HVJ A;  1GOA A;  3HOS A;  3SQ4 A;  4BC4 A;  4YOX A;  3THW A;  2HVI A;  4X66 K;  4ID5 A;  5AQI A;  4CFA A;  4CD1 A;  3LZI A;  3O08 A;  4B1W B;  5TKY A;  5AFU A;  3CCQ N;  4OGC A;  3O4N A;  1XC9 A;  2D4W A;  3L2W A;  4X64 K;  3K0S A;  4DR4 K;  3IG1 A;  4K41 A;  3DI6 A;  3LDP A;  4FM1 A;  3THY B;  1BI4 A;  5EXW A;  5I3U A;  3FZK A;  1UAX A;  2G8F A;  4GVE A;  1QTM A;  3PY8 A;  1EKE A;  3P39 A;  2W41 A;  4CJ4 A;  3CJB A;  4CEB A;  1VK0 A;  3FLC O;  1XUP O;  3TTF A;  3IRX A;  4UQG A;  3LDQ A;  3O9S A;  1TAU A;  2P9K A;  4Z4G A;  3MX2 A;  3NH1 A;  1T6D A;  4IZ9 A;  5KPR A;  2YHX A;  4YNQ A;  4DMN A;  3S3O A;  2JGU A;  4GVM A;  5DMR A;  1JXE A;  3VEX A;  3ZSO A;  2QWQ A;  3KHY A;  5ADX H;  5C2F A;  2V7Y A;  3AO5 A;  3F2K A;  3DLE A;  5AQV A;  4MFB A;  3SJJ A;  3OYJ A;  4CK2 A;  3CCU N;  1IG8 A;  3G71 N;  4DV7 K;  1BUP A;  4DF8 A;  4JS4 A;  3AGR A;  5GAE P;  3V1O A;  4GW6 A;  3OYF A;  1RBU A;  1NLV A;  2OAN A;  3FFK B;  4DTP A;  4FWR A;  4RCH A;  3ZT0 A;  2G8K A;  4RW4 A;  1SQK A;  1X9J A;  3O9T A;  4A5A A;  2HBM A;  3MDQ A;  2QWP A;  3LDO A;  1R0A A;  3O1W A;  2ITG A;  5DM7 L;  4CED A;  1JCF A;  5BRD A;  4EP5 A;  3TPQ A;  3CCS N;  1KAX A;  3VQD A;  4A57 A;  2E1Z A;  3VET A;  2FBV A;  4CBU A;  5JLH A;  4DG1 A;  3V9X A;  4JI1 K;  2D0B A;  3AVJ A;  1XHX A;  3LP1 A;  4BAC A;  1YIT N;  4DR1 K;  4JKD A;  1KVC A;  2FBY A;  1L3U A;  1G15 A;  3ZSZ A;  1VQ5 N;  1LOT B;  4O8K A;  4IEE A;  1X9W A;  5CHI A;  3SUQ A;  4CFC A;  4CEA A;  3VPZ A;  4EFH A;  1CXQ A;  2GEM A;  1JJ2 M;  3MWP A;  5KRT A;  1IO2 A;  4H0P A;  1CLQ A;  4A2B A;  4IG3 A;  3M6G A;  4PQU A;  3AGK A;  3UKU A;  4B3T K;  3CQY A;  4F3O A;  3SUO A;  2HMP A;  4CJK A;  2P9U A;  4H4O A;  4KRF A;  4MDA A;  4CGD A;  3LZJ A;  4CCH A;  3WXL A;  5AQZ A;  4WYB A;  1KFS A;  3GL1 A;  2IGI A;  2YHA A;  3ZLJ A;  2ZJR L;  2HHQ A;  3CC4 N;  1EET A;  1TVR A;  3SPZ A;  1N8R O;  3V81 A;  2HST A;  2WTU A;  5BN8 A;  1HNI A;  3PLA A;  2XRI A;  1HKC A;  4IDH A;  3N4P A;  4L3Q A;  4BRF A;  3V1Q A;  1T7P A;  4CEC A;  2NRW A;  4LH4 A;  3MEG A;  4OPJ A;  4N41 A;  4IOA L;  3LAN A;  4WE1 A;  3OVN A;  4LSL A;  4O55 A;  1ZYQ A;  1U47 A;  4Z4I A;  1MWM A;  4Q5V A;  4CHY A;  4XEI A;  4KPY A;  4CZG A;  2X74 A;  3KK3 A;  5LMN K;  4XH1 A;  2R7Y A;  5AQF A;  1S1X A;  3DRS A;  3OYG A;  3V9S A;  3K58 A;  2VGM A;  3LAM A;  1VSF A;  1SKR A;  3QNO A;  2KHO A;  3J80 O;  4KTZ A;  4HCC A;  1DGK N;  4K8X A;  1GLC G;  5FPN A;  1K8A O;  4CHP A;  4IOC L;  4FW2 A;  3UKR B;  4H5V A;  4LFA K;  1RFQ A;  1NJY A;  1BIU A;  3ID8 A;  4PL7 A;  5C25 A;  3ID6 A;  3WEE A;  3MN9 A;  2GBZ A;  3SAG A;  3BZK A;  5EOY A;  4DTJ A;  5F1X A;  3M8P A;  5AQW A;  4F3T A;  1WSE A;  1RT5 A;  3TSQ A;  4AHC A;  4JEP A;  1UOC A;  3J8A A;  4M45 A;  3VQQ A;  1NOY A;  4CIE A;  3LDS A;  2YV0 X;  3AVC A;  2AJQ A;  4HHT A;  3P1G A;  4YOR A;  2XY7 A;  2IIR A;  3LWM A;  4CJW A;  2HB5 A;  3L6Q A;  1L3V A;  5J2M A;  3L2Q A;  4LFB K;  3BZC A;  1EQY A;  2O8F A;  4GKK K;  5J2Q A;  3EKS A;  2DPN A;  1ZBI A;  2JWK A;  3GBT A;  4ELU A;  3CJC A;  3TU5 A;  2OYQ A;  3SNN A;  4PL8 A;  4BWM A;  2UXD K;  4F2S A;  3EE8 A;  1IG9 A;  5AQQ A;  5AR0 A;  5IWA K;  4BC5 A;  1DKG D;  1OVY A;  4B1Z A;  2Q97 A;  2ZM6 K;  4LF5 K;  1EWQ A;  1WSJ A;  1NGH A;  1Z05 A;  4W5N A;  2QEX N;  1ZBU A;  3W0L A;  1WNS A;  2HHV A;  4CF1 A;  3K59 A;  3EYZ A;  2P5G A;  1KFD A;  3OHR A;  4OPH A;  1BCO A;  2PY5 A;  1NOZ A;  3FR0 A;  4V19 S;  2A41 A;  5HRR A;  4DV4 K;  4FL9 A;  3I8B A;  4JRP A;  3P4I A;  2O8E A;  4B3M K;  5CYM A;  4BQL A;  4H0X B;  1DTQ A;  1HKG A;  3CQ8 A;  3BY5 A;  3OS2 A;  1ZBF A;  4JHD A;  3AVG A;  2HOE A;  3THV A;  3GOI A;  3VF2 A;  3O3G A;  1GLL O;  4I2Q A;  1K6Y A;  4LY7 A;  3HP6 A;  2OPR A;  4GKJ K;  4GV6 A;  1UWB A;  1VSM A;  3VGK A;  2DY4 A;  4FWS A;  3I55 N;  3QES A;  2OZM A;  3VGM A;  1OH6 A;  5JS2 A;  4FJN A;  3C65 A;  4MO5 A;  1XNR K;  3HVR A;  4FJG A;  3HL8 A;  1NGF A;  4DKW A;  2Z1G A;  3IKM A;  2DFE A;  2DFF A;  1HUX A;  2P9L B;  4LH5 A;  3VEN A;  2BH1 A;  4FJK A;  3G25 A;  1VQ7 N;  4YY3 K;  3THX A;  1HX1 A;  2Z1I A;  4CEO A;  1P8Z A;  2NZT A;  4R79 A;  3OJS A;  4JKH A;  3NHG A;  4FZZ A;  4FJ9 A;  3T1A A;  1HPM A;  3ENB A;  4CZF A;  1Q7Y O;  3L2U A;  4JK8 A;  1B9F A;  3VQ8 A;  5BPN A;  3GDQ A;  1HNX K;  4AF1 A;  1BQM A;  4CI6 A;  1MA9 B;  1NK0 A;  1O1W A;  1KQS M;  2UYT A;  1NGE A;  3MX5 A;  5GIN A;  2OZS A;  4FPB A;  1T3V A;  2XHB A;  4WQ4 C;  2GV9 A;  1GLA G;  3O4Q A;  3THW B;  4ELV A;  2X78 A;  2KKZ A;  3EY1 A;  3E9O A;  3CET A;  3IUC A;  1MDU B;  3H46 O;  4FVM A;  1JXB A;  1BIZ A;  3ZSR A;  4H0O A;  5FDL A;  1NK5 A;  1GOB A;  3D0P A;  2YNG A;  1BI4 B;  1RBV A;  5KQ8 A;  2D0O A;  1X3M A;  2O8C A;  4EZ6 A;  4ZHR A;  4JN4 A;  4MO4 A;  3HBT A;  3I0R A;  4Y1D A;  4LF4 K;  2KFZ A;  3T1H K;  1MWK A;  4BR5 A;  1H1V A;  1N34 K;  3NDK A;  3M3Z A;  2CGK A;  4DTS A;  1VRT A;  1LWE A;  4DSL A;  1TV6 A;  2P9K B;  4Z94 A;  4O5B A;  4HUG A;  3J7Y P;  1TKD A;  3A8Y A;  4IFV A;  3O8M A;  5FPM A;  3TAF A;  1ZC6 A;  1RDW X;  4I6M A;  4DS4 A;  2E4L A;  4FLT A;  4X62 K;  5BPM A;  4WQ4 A;  2UUB K;  3LDN A;  1HYZ A;  3VGL A;  1CZ9 A;  1HMV A;  5MLC Q;  5J2P A;  1U4B A;  3CFO A;  4AHS A;  3SZ2 A;  3TAN A;  5AQN A;  1Q82 O;  3VER A;  4OKE A;  2QXF A;  4AHU A;  3S9H A;  3EN9 A;  1XHZ A;  1IKW A;  4IFE A;  4ICL A;  3VES A;  4JYA K;  4J2E A;  5FRM A;  4DR5 K;  5AQO A;  3EKU A;  4E19 A;  5F0X A;  3PIO L;  2OCE A;  3CER A;  4GV3 A;  4FWN A;  3HTV A;  4B9M A;  1YXQ A;  4BGA A;  3AO2 A;  1VQL N;  4BR0 A;  4GMJ B;  5HOO A;  2A1R A;  1NKB A;  3G6E N;  3A5O C;  1VAZ A;  1RNH A;  3RRG A;  3VOV A;  3L3U A;  1U04 A;  4NYF A;  3LPT A;  1NKC A;  4DU1 A;  2HHX A;  4ISE A;  3BF1 A;  1LW2 A;  2XY8 A;  4DV6 K;  1EP4 A;  1QSL A;  1LW0 A;  3SQ0 A;  1TK8 A;  1RTJ A;  4NO7 A;  4EZ9 A;  4DF4 A;  4DUY K;  2NLX A;  2BAN A;  4YOV A;  4QS8 A;  3AVM A;  4ILJ A;  5ADX A;  3QO9 A;  4FJJ A;  4FM0 A;  1SZ2 A;  3LL3 A;  3OYH A;  3UKU B;  4N56 A;  2P9U B;  4DTN A;  1IKY A;  3D2E A;  2A1S A;  3PIP L;  4YOY A;  1I94 K;  3DMJ A;  4KHP K;  1GLJ O;  3LM2 A;  5AQY A;  5HRS A;  3B6O A;  1XQS C;  4HUF A;  1T6C A;  3T1Y K;  4HCB A;  3O1B A;  4CJQ A;  1SL1 A;  3AVK A;  4C8N A;  4JI5 K;  2E1Y A;  1RDB A;  4DHY A;  5M1Q A;  1NK7 A;  4CFB A;  3QIP A;  3WXI A;  5M1F A;  5SWM A;  1JLC A;  3FZM A;  4K25 A;  5BRE A;  5CZ2 A;  1WAJ A;  1RBT A;  3P38 A;  4O4G A;  4Z0U A;  2ETJ A;  3MAQ A;  2AP1 A;  3VEO A;  1NM1 A;  1GLB G;  4LF8 K;  4IOX A;  3D2F A;  2VYP A;  3LP2 A;  4FWP A;  2VCP A;  3HPG A;  1L5U A;  4FJM A;  3CJ7 A;  3SYZ A;  4FJI A;  3KLF A;  2KQ2 A;  3ALY A;  3VEV A;  3CC2 N;  1NGD A;  4JI3 K;  3PX0 A;  1MU2 A;  3ZT3 A;  1S6Q A;  3VF6 A;  4Z4H A;  3SQ1 A;  2RF2 A;  3A2F A;  3TI0 A;  3IAY A;  2OA8 A;  2HND A;  3HJF A;  1HLU A;  4A2A A;  1ITG A;  1OVQ A;  2BGG A;  4I9Q A;  4DLG A;  4DFP A;  3RR7 A;  3JS6 A;  1BA0 A;  3ZT1 A;  3WEE B;  4O0J A;  1W2B M;  1CZB A;  3SBT A;  5JVG L;  2IAJ A;  4CF2 A;  4AQY K;  1Z25 A;  3H6E A;  2YHW A;  2G8H A;  3ZYY X;  1LV5 A;  3O9Q A;  2YNI A;  5DM6 L;  4CEZ A;  4JS5 A;  4BRG A;  3ENH A;  5C42 A;  4J2A A;  4W5O A;  4Q0B A;  1Q81 O;  5HL7 L;  4ILG B;  1HRH A;  4K8Z A;  4FM2 A;  2EX3 A;  4CBX A;  3T3F A;  4CE9 A;  1RTI A;  3L4Q A;  2O8F B;  2JLE A;  3UIQ A;  4WF9 L;  1T44 A;  2YJF A;  4B8C A;  4KKO A;  4OX9 K;  1IBL K;  3ZET A;  1DEJ A;  2GWJ A;  3OW2 M;  2F7T A;  1ILY A;  3FFI A;  5HBM A;  4KB0 A;  1Z26 A;  3K9J A;  4EHU A;  3S3N A;  1DT9 A;  3C95 A;  4CGJ A;  1TKT A;  2GUI A;  3WXJ A;  4KHY A;  3VQ4 A;  1IJJ A;  3VTI A;  3OA9 A;  1RTH A;  4KH5 A;  4IBN A;  4KHW A;  5BRF A;  1D8Y A;  2ZQB A;  3T69 A;  4JLH A;  4DTR A;  3KIO A;  1RIL A;  4OLA A;  1N36 K;  4F9O A;  4BRE A;  4RW8 A;  1NGJ A;  1BG3 A;  1VRU A;  1VQ4 N;  1TK5 A;  2WBN A;  4L8R B;  5C2D A;  4E7L A;  3CMA N;  2O8E B;  3NF8 A;  4FJL A;  1FKO A;  2ZE2 A;  1BHL A;  4M3X A;  4RG8 A;  1RT3 A;  2E2P A;  3SV4 A;  4CJL A;  5AQU A;  2W6L A;  4JHD B;  3B6P A;  3AAR A;  3U8X A;  5T7B A;  2A42 A;  3D7E O;  2UXC K;  3ZSX A;  2QWR A;  4K0K K;  3O3F A;  4AIL C;  1QQM A;  3LAL A;  1SAZ A;  4OO1 J;  1BDG A;  3MN6 A;  2CGL A;  2A3Z A;  3NCI A;  1BGX T;  2ZD1 A;  1E4F T;  2E2O A;  3R9P A;  2NNW A;  3CCE N;  2P9I A;  3H08 A;  4BRP A;  3THX B;  1J5E K;  3V1R A;  1S5J A;  4LF7 K;  3MWT A;  4BRO A;  3K9K A;  4O5F A;  4U67 L;  4B9T A;  3OYA A;  3R3L A;  3O5B A;  3CG7 A;  4H4M A;  5AQG A;  4FLX A;  2E5L K;  2P5O A;  4YFU A;  1QSS A;  3OS1 A;  1DTT A;  2RN2 A;  1FJG K;  2HNY A;  3WQT A;  4DV0 K;  5AZI A;  2RE2 A;  1Q18 A;  3SI6 A;  4WFA L;  4FZX C;  1RT7 A;  4DV1 K;  3WNE A;  4G9Z A;  2IS3 A;  3EZ5 A;  3ZSY A;  4H5R A;  3DAW A;  1HKB A;  3HK2 A;  4RTF D;  4NB4 A;  3AVH A;  1ATN A;  3CYM A;  2J4R A;  3C6A A;  3HM9 A;  3CJ1 A;  5LJV A;  3F73 A;  2RPI A;  1XC3 A;  3EE9 A;  3VQ9 A;  4FJ5 A;  4BRM A;  5M1K A;  3VMF B;  4KAZ A;  5FPD A;  1YVN A;  4BDZ A;  3MXM A;  3KLI A;  3E66 A;  4C8K A;  3Q7C A;  2O8C B;  4E1M A;  5AQL A;  1KAY A;  3QNN A;  4DCH A;  3KVG A;  2HHU A;  4LFC K;  3AA5 X;  3BUZ B;  4OVL A;  1WBB A;  1YJW N;  4CF9 A;  5BPL A;  2IVO A;  4JI2 K;  3JXU A;  4IFY A;  3DWL A;  3T7Z A;  3SQ2 A;  1WSF A;  1G99 A;  2O4I A;  3WXK A;  1TL1 A;  1TK0 A;  4KB1 A;  4DR7 K;  1NGI A;  3SUN A;  5AQS A;  4G1Q A;  3TSU A;  2Q2R A;  3MK6 A;  3SPY A;  4CD3 A;  4I6M B;  2IOC A;  3TR8 A;  3KKS A;  2I7N A;  1NJW A;  4CJV A;  3CF5 L;  4FCY A;  5GIP A;  3H1V X;  3QBX A;  3K5L A;  1NG9 A;  3CIP A;  3KJV A;  3VEW A;  1YI2 N;  2WFB A;  3CCM N;  3M5R A;  2FC0 A;  1HR0 K;  3TTD A;  4E7I A;  3SLC A;  5SZT A;  1U48 A;  3PUF A;  4M3U A;  2OPP A;  1B9D A;  2ZF5 O;  4CGF A;  3L3V A;  1VSH A;  2HBJ A;  4CEE A;  3CCL N;  5BRH A;  3C6U A;  2IDO A;  3ZT4 A;  4B08 A;  3QEX A;  5JIC A;  3DOL A;  5AQH A;  4DTM A;  1CXU A;  2KLA A;  4K43 A;  2Z1J A;  2F9T A;  1IKV A;  3KLE A;  1VSE A;  1IH7 A;  2OPS A;  2DFH A;  2QW9 A;  3C7N A;  3ZT2 A;  1QSY A;  5KQD A;  3QB0 A;  3AAQ A;  3OY9 A;  4CEQ A;  1JCE A;  4CIG A;  2HHT A;  3CM6 A;  3EEQ A;  3MXJ A;  3AVA A;  3PO4 A;  4FZY A;  3OJU A;  3HYF A;  4CZL A;  3K57 A;  3TAE A;  1VQ8 N;  1QQO A;  1ASU A;  3J7A P;  3DLR A;  4FW1 A;  3TAM A;  4A5B A;  2RKI A;  3DM2 A;  4DQQ A;  3LP0 A;  2NRT A;  3F5T A;  4AHV A;  3TWH A;  1EWR A;  4BE0 A;  4NXN K;  4CFD A;  2O8D A;  3M1F A;  4LF6 K;  4JI6 K;  1P90 A;  3EO3 A;  2E6M A;  4M42 A;  4E7K A;  1CZA N;  4KRE A;  3U3Y A;  4B3O A;  4E1N A;  3RVC A;  4BRL A;  4DQI A;  3D2E B;  5AZJ A;  4F2R A;  3VEZ A;  1VQM N;  1B92 A;  1KD1 O;  2UU9 K;  3JAM O;  1C0M A;  4CJ7 A;  1YTA A;  4W5Q A;  3WUH A;  4MQ3 A;  2A6A A;  2WOM A;  4ISF A;  1FW6 A;  2F8S A;  4HTL A;  3NFA A;  5LL6 Z;  2P9N A;  4FO0 A;  4RW9 A;  3R8E A;  1EO1 A;  2VG7 A;  2WON A;  5I42 A;  3V6D A;  3EL2 A;  3O4W A;  2PBD A;  3VQ6 A;  1KC8 O;  2NRV A;  5AQP A;  4CGG A;  2GEL A;  3HP9 A;  3D2F B;  2PYJ A;  1NGB A;  1S3X A;  1WUA A;  1JLG A;  3U9D A;  5H1S Q;  2A40 A;  3VQC A;  3W3D A;  4CK1 A;  3DLK A;  4E1J A;  1W9H A;  2D5R A;  1N33 K;  1QQC A;  1TYQ A;  2E8A A;  3G10 A;  4DUZ K;  4BG9 A;  4DSJ A;  2AA4 A;  3OYN A;  4FLU A;  4FK4 A;  4GNI A;  4DR3 K;  3ULE A;  3ATV A;  4JKF A;  1NMN A;  4CIF A;  2Q3S A;  1J53 A;  3HPH A;  3I33 A;  1HNZ K;  3ZEU A;  4GV9 A;  4W5T A;  2WUS A;  3OYC A;  4M3Z A;  5KGX A;  3DXM A;  1S72 N;  2Q0U A;  1JL2 A;  1C6V A;  2G8W A;  5CR4 A;  1SKS A;  2VWK A;  1HJR A;  4B9S A;  2EHG A;  4B9U A;  4DTX A;  1VSD A;  1Z6R A;  1NKE A;  3SAF A;  3SJH A;  4ISG A;  4BY9 C;  3OYM A;  3VTH A;  1RT6 A;  1NWK A;  1QE1 A;  3O3H A;  3CFP A;  4JI0 K;  4BRC A;  4KHN A;  3LM9 A;  4Z4E A;  3H45 C;  4DQS A;  1VSK A;  4BC3 A;  4M3Y A;  1TKZ A;  4BWJ A;  4BR9 A;  2Z1H A;  1UA1 A;  4RW7 A;  1WSI A;  4TSX A;  3J81 O;  4DSF A;  4BGB A;  1NJI O;  3QEI A;  3O80 A;  1QZ6 A;  3HZ6 A;  3BGR A;  1S1W A;  2G8V A;  2P51 A;  3ZET B;  2FF6 A;  2DTU A;  4H0Y B;  2FBX A;  1NMD A;  3L2V A;  4KI6 A;  3TAQ A;  3DJC A;  5LJW A;  4M3W A;  1X9M A;  1QHA A;  4B9L A;  1O13 A;  3G0Z A;  3RSE A;  1WSG A;  3AO3 A;  1M1K O;  1XNQ K;  2UUC K;  3ZCM A;  1WAF A;  3I0S A;  3MCP A;  2PAV A;  1KVA A;  1GLD G;  2F9W A;  2Y1I A;  2GWK A;  4CZJ A;  3N4Q A;  1E4G T;  1WSH A;  5J2N A;  4BC2 A;  4ELT A;  2YKM A;  1S9E A;  1JKH A;  4OPK A;  3SV3 A;  4IO8 A;  2P9S A;  4KFB A;  1E3M A;  4CZM A;  1SL2 A;  2BDP A;  4DSI A;  2VQF K;  3SMP A;  3PO5 A;  4I7F A;  4FK2 A;  3C0B A;  1HQU A;  2P9P A;  2O4G A;  1ASW A;  1U6Z A;  4FJH A;  3WXM B;  1C1B A;  3G4S N;  4DSE A;  4DR2 K;  2ZGY A;  1S22 A;  5F2R A;  1OKJ A;  1LWF A;  3OTO K;  4KH4 A;  1X9S A;  3R1X A;  3QIN A;  4PKH A;  2B4J A;  3ZSQ A;  2IVN A;  2YJE A;  4BR7 A;  4W5R A;  3FZL A;  3CC7 N;  4FK0 A;  4DSK A;  4N76 A;  2V52 B;  3ENO A;  4JI7 K;  4QS9 A;  1TUU A;  2P9I B;  4CJU A;  1JLF A;  1RDU A;  1D5A A;  2Q31 A;  1KLM A;  4CHZ A;  3JSM A;  1YAG A;  3M8R A;  3TAP A;  4WQ5 A;  1Q86 O;  3U4L A;  4M7Y A;  4IJA A;  4LC9 B;  4QS7 A;  4JKG A;  3B8A X;  3VQ5 A;  3SK3 A;  3A5L C;  4DFJ A;  3A5N C;  5AZI B;  3AVB A;  4ZTF A;  5CYQ A;  4JK9 A;  2ZJQ L;  3R6M A;  5ELZ A;  4PA1 A;  4YHH K;  1KCF A;  4CZH A;  2D1K A;  1ZBH A;  5E26 A;  1JLB A;  4XIU A;  1TGO A;  1W7A A;  3LWL A;  5IT9 O;  3OS0 A;  1JL1 A;  1FXX A;  4CJE A;  4FLZ A;  2F8T A;  4FOI A;  1ATS A;  4HUE A;  4H03 B;  1BQN A;  1ZBL A;  4Z4F A;  5BR8 K;  3DRR A;  3SUP A;  2YHY A;  2HBL A;  4AHR A;  1L3S A;  4M41 A;  4CZI A;  3AA4 A;  3KK7 A;  1YHQ N;  1BL3 A;  1QS4 A;  2NRH A;  4CJS A;  1RTD A;  1ZXO A;  2NRX A;  2IC3 A;  4B8A B;  1ATR A;  3T19 A;  3VA0 A;  3AVI A;  4M3T A;  4BVO A;  4BDP A;  2D0A A;  4NCB A;  5GAD P;  3NVM A;  3SCX A;  4F8R A;  2I7P A;  4H5N A;  4WCE L;  3PX4 A;  3DLB A;  5C10 A;  4CEF A;  2D0P A;  1YJ9 N;  1KXP A;  4CES A;  3H3N O;  5C0Y A;  4DQ8 A;  4DTU A;  2CH6 A;  1NK4 A;  5J1E A;  4MLE A;  3V9U A;  4BRK A;  4EIA A;  1NNE A;  4NXM K;  2QTD A;  3OYD A;  4BRI A;  4CJT A;  2VQE K;  3CCV N;  4FWL A;  2G8I A;  1XI1 A;  3QIC A;  2VWJ A;  1N6Q A;  4JV5 K;  4RW6 A;  3Q7B A;  2HF3 A;  3E01 A;  1J6Z A;  3GE1 A;  1NJX A;  5TKW A;  1HYV A;  1RT1 A;  4CJR A;  1U45 A;  1J9A A;  2QWO A;  4O44 A;  3NGZ A;  1NK9 A;  2VG5 A;  1RBR A;  4C8L A;  1NJZ A;  2NRZ A;  4FJX A;  2UXB K;  3NMU A;  3WQU A;  3NH2 A;  3C7N B;  3PV8 A;  1RCH A;  3VQ7 A;  4DFM A;  3A0I X;  2V7Z A;  2KW4 A;  5HLF A;  2W40 A;  3HSC A;  3K5N A;  3QEP A;  3U3G A;  2GTD A;  3OYL A;  5C12 A;  1YVU A;  4A59 A;  4DLE A;  1VQ9 N;  2YNH A;  3P5J A;  2FLO A;  4JAX A;  3UB5 A;  4B1X B;  1U2V A;  2QM1 A;  3NAE A;  5KPT A;  2HMI A;  3ULD A;  1K73 O;  2Y1J A;  1WLJ A;  2Q36 A;  3NF6 A;  3HXM A;  3H3O B;  2JWL A;  5FPE A;  1VQO N;  5M1O A;  3NGI A;  1YIJ N;  3JYT A;  1F21 A;  1QZ5 A;  4JD2 A;  4BRD A;  2OPQ A;  5KI6 A;  5HRP A;  2O8B A;  3KK2 A;  5JS1 A;  3UE5 A;  3K5M A;  2NRR A;  1RT2 A;  2O8D B;  3DLG A;  4KTQ A;  4U7B A;  4B1V A;  5AQK A;  4FXD A;  5DK5 A;  2YCH A;  4DV3 K;  4Y1C A;  3RMC A;  3CPW M;  2B5J A;  2IVP A;  3ZX0 A;  1QHT A;  2VG6 A;  2HHH K;  2QK9 A;  2HNZ A;  4CF8 A;  5AZJ B;  3FGU A;  4BQZ A;  2PYL A;  1VQN N;  1IKX A;  4PY5 A;  4BE2 A;  1A5V A;  2HHW A;  5M1P A;  1K8K A;  2QKB A;  4H5T A;  5KRS A;  1RGI A;  3ZSW A;  4A61 A;  1T8E A;  3VN5 A;  3BDP A;  4KHS A;  5EY4 A;  2P9N B;  1A5W A;  4FJ7 A;  3IMX A;  2ZWH A;  1OH8 A;  3KD1 E;  5EU7 A;  2XO7 A;  4E7H A;  3IS9 A;  2W6K A;  4JI4 K;  3HM8 A;  2QWL A;  1NGC A;  4CHQ A;  3L2R A;  1OH7 A;  1J54 A;  1C0G A;  1OH5 A;  4ILH A;  4KTW A;  3K2P A;  3WNH A;  4BG8 A;  3CPE A;  4I9L A;  4H8K A;  3ASM A;  3AY9 A;  3V9W A;  3QFP A;  1V4S A;  4QOZ B;  2YX6 A;  2GX9 A;  5AFU H;  2OTL N;  1TYQ B;  4DB3 A;  5LMU K;  4OLB A;  2H3G X;  4FLV A;  1YTU A;  1R59 O;  3H1Q A;  3ZSV A;  5GAG P;  2F4V K;  3PSF A;  4HTU A;  4FLW A;  2D0C A;  1WBD A;  4J8F A;  2BE2 A;  2YKN A;  1TUY A;  5AQR A;  3E9P A;  3ULE B;  1K9M O;  1GLE G;  1SS6 A;  1N5Y A;  4H0V B;  3ZEU B;  3RTV A;  4JRQ A;  2KFN A;  3QEW A;  3U6F A;  2E6L A; 
#chains in the Genus database with same CATH homology
 4DR4 K;  4DR6 K;  2UU9 K;  3JAM O;  4YHH K;  4JYA K;  4DR7 K;  4DR5 K;  4DV5 K;  5IT9 O;  2UXC K;  4JI3 K;  1HNX K;  5LL6 Z;  4K0K K;  5BR8 K;  4B3T K;  1XNQ K;  2UUC K;  4LFB K;  4GKK K;  4CW7 B;  4LF9 K;  1HR0 K;  4DV2 K;  4DV3 K;  4JI8 K;  2UXD K;  5IWA K;  2HHH K;  1J5E K;  4DV6 K;  2ZM6 K;  4LF5 K;  4AQY K;  4LF7 K;  1N33 K;  2VQF K;  4DUY K;  4DUZ K;  2E5L K;  4DV7 K;  4NXM K;  4DR3 K;  1FJG K;  4LF4 K;  5FLX O;  4DV0 K;  4V19 S;  4B3R K;  2VQE K;  4DV4 K;  4DR2 K;  3T1H K;  1N32 K;  1HNZ K;  1N34 K;  1XMO K;  5LMN K;  4DV1 K;  4B3M K;  3OTO K;  1I94 K;  4KHP K;  4JI4 K;  5A2Q O;  4OX9 K;  4JV5 K;  1IBL K;  3J7Y P;  3T1Y K;  3J7A P;  4JI7 K;  1IBK K;  1IBM K;  4B3S K;  4JI5 K;  3J80 O;  1HNW K;  4X62 K;  2UUA K;  2UUB K;  4NXN K;  4GKJ K;  5LMU K;  2UXB K;  4JI0 K;  2F4V K;  4JI1 K;  4LF6 K;  4JI6 K;  1XNR K;  4X66 K;  4LFA K;  1N36 K;  4DR1 K;  4LF8 K;  1XMQ K;  4LFC K;  4X65 K;  4CVN E;  5AJ3 K;  4YY3 K;  4X64 K;  3J81 O;  4JI2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...