3OTOK

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3otoK00
1IBLK 5AJ3K 1J5EK 2HHHK 4NXMK 5LL6Z 5BR8K 1HNZK 1I94K 4JI5K 4JI7K 3J7YP 4JI1K 4CW7B 4DV5K 4OX9K 2ZM6K 5LMUK 4YHHK 5LMNK 4DV1K 3T1HK 4X62K 4NXNK 1HNWK 4DR7K 4JV5K 4JI8K 3J7AP 1XMQK 5IT9O 2F4VK 4DR6K 4DR1K 4JI2K 2VQFK 4DR5K 1XMOK 2UXBK 2UUCK 4V19S 2UUBK 1XNQK 4LF8K 4JYAK 1IBKK 4GKJK 4KHPK 5FLXO 4DR4K 2UXDK 4B3MK 4JI6K 4LF9K 4DUYK 3J81O 4K0KK 4DUZK 1N33K 5IWAK 4B3TK 4B3SK 4JI4K 1IBMK 1HNXK 4DV7K 1HR0K 4LFAK 4LFBK 2UXCK 4LF6K 4DV4K 2VQEK 4AQYK 1N36K 4YY3K 3J80O 4CVNE 4DV2K 4DV6K 3JAMO 4LF7K 1XNRK 1N34K 2UUAK 4X64K 4X65K 4DV0K 2E5LK 4GKKK 4B3RK 4LFCK 1N32K 1FJGK 5A2QO 3OTOK 4LF5K 4X66K 2UU9K 4JI3K 4LF4K 4DR2K 3T1YK 4DV3K 4DR3K 4JI0K
chains in the Genus database with same CATH superfamily
3VQ9A 3ENHA 3FFKB 4FJ8A 3TARA 2P1JA 5T7BA 3OA9A 1HNZK 4FLUA 1OKJA 3WUHA 1ATSA 3M8SA 1ATRA 2JWLA 3U3YA 4M45A 3H3OB 4DWIA 4DFMA 1V4SA 2D4WA 4IO8A 2BDPA 4CJSA 4IOAL 1D9DA 4FJLA 3HOTA 4FJ7A 4CGFA 3OBWA 3K5MA 4PUOA 2VQFK 4DR5K 4FXDA 1HRHA 3IAYA 1JCFA 2HB5A 1Q9YA 4JYAK 2BUPA 2HHTA 3BY5A 1C0FA 2FBXA 3AVKA 1X9SA 1RBTA 4Z4IA 3OYFA 4DHYA 1B9DA 2UXDK 1EETA 3VPZA 4DSIA 4BRAA 1NGEA 2E88A 4DFKA 5AQWA 1N33K 3C95A 4NLBA 3VGLA 4BRDA 4DTOA 3RRGA 2O8EA 5BRFA 3CCSN 1HJRA 3SQ4A 4L8RB 3O1BA 5AZJB 5C24A 1BHLA 4AQYK 4JKFA 2NUBA 3FZFA 4DV2K 1NK8A 4MFBA 3SPYA 3QO9A 2ASPA 1REVA 1RBRA 3DAWA 4B1UB 3CG7A 3PUFA 3SAHA 4EP5A 2OTJN 4Y1DA 3CJBA 1M1KO 1RDDA 4LF5K 4CEQA 4WCEL 1IJJA 1BL3A 4JKEA 4CEFA 2ZJPL 4OPKA 4DLEA 1TK5A 1NGJA 4PL7A 3N4QA 3CCVN 2KHOA 2ETJA 1SS6A 2WUSA 1R0AA 1GLDG 1RT3A 3TR8A 3VEVA 3DWLA 1S1UA 2VGMA 1UAXA 2P9SB 1W97L 4RW8A 2QWQA 2ZD1A 3LPTA 1S1XA 4OX9K 2OPQA 4BG9A 1IKVA 3HT3A 3C6TA 4NXNK 3LM9A 4AHSA 4F9OA 5I42A 1Q86O 3VQCA 1CZBA 1JKHA 1RDWX 1QTMA 2X6NA 4CZKA 4OKKA 5IT9O 3AA5X 1I39A 1RILA 2IVNA 2GV9A 4DSLA 3C65A 4Y1CA 1X9WA 3UKUA 1GLFO 3WXLA 2IS3A 1WNSA 1OH8A 1TAQA 2LSNA 4B9TA 2NRHA 4FK0A 5FLXO 3LDLA 4CHZA 4BRHA 3QETA 1GLBG 1CZAN 4C8MA 1NLVA 4HTUA 3MX5A 1N5YA 1S1VA 3ZSYA 5CYMA 3MXJA 4OLAA 3RR8A 3V9XA 1K9MO 1RDUA 4CCHA 2RPIA 1YTAA 2YV0X 2O8DB 4M41A 3CFPA 1V4TA 3SUNA 4E3SA 1WSGA 3LP0A 4BDPA 3IFRA 4CJ3A 5AFUH 4FJHA 3RSEB 3LWMA 2P5OA 5J2QA 4ZTJA 3IG1A 4FPBA 1VRTA 4KV8A 3R8EA 3AVMA 3CETA 4CGIA 4PHTX 4DU3A 1KLNA 3THWB 3HZ6A 1NGDA 2G8HA 2ITGA 5I3UA 3THYA 4G9ZA 4FJJA 2GUPA 4Z0UA 4H0YB 2OZMA 1UA0A 1TKXA 4J2DA 3OBYA 3BEXA 3CJ7A 4CD3A 1DT9A 4JKDA 3MCPA 3OS0A 2QW9A 3A5MC 4FWMA 4A61A 1NJZA 3OY9A 3K5LA 2E6MA 3NGZA 1HLUA 1S72N 4C8LA 5J1EA 5DK5A 4NXMK 4FWRA 1WUAA 3NBPA 1RT6A 4BROA 2YCHA 4KB0A 2NRXA 4FCYA 4CK2A 4J2EA 5HRRA 3PIOL 1YVNA 2HHUA 4HCBA 1VSDA 1DEJA 2IAJA 1NKBA 3AO4A 2FBVA 1YUWA 1A5XA 1J9AA 2GX9A 4A5AA 3L2QA 3VGKA 1RFQA 3ULDA 2F96A 4BRFA 1TUYA 4EP4A 2BGGA 4KH5A 4RWTA 1GLJO 5M1FA 1WLJA 3T19A 3O9SA 1JLQA 1VSJA 3BZCA 3J7ZO 4DTMA 1NK4A 4Q0BA 4E89A 3FR0A 2YNIA 1XUPO 3DLKA 3I8DA 4H4OA 3CC4N 3DLGA 1TKZA 5AQKA 2JWKA 3NGIA 3TAFA 3QEPA 1L5UA 2QA4N 2KZMA 4B3SK 3SAGA 1YJNN 3VESA 2HNYA 4BC4A 3O9TA 5HRNA 1TK8A 3QMLA 1S6QA 3OVNA 5JMVA 3NH1A 3J80O 4HUFA 1T03A 4JRQA 4BRPA 1VQNN 3OYDA 5HRPA 3HOSA 3M8QA 4JNEA 1IO2A 4DCHA 4FYDA 4W5QA 1SAZA 4FL9A 3BF1A 4CJWA 4I2PA 1L3SA 4DTNA 3ZETA 5HL7L 4DTXA 3AO2A 2QM1A 2QKBA 3AVJA 4ISEA 3AVIA 3CCJN 1SL0A 2W41A 3R6MA 4Z4CA 3L4IA 4B9MA 4JLHA 3M8PA 4E1MA 3GG4A 1RTJA 2G8KA 5J2MA 3L2UA 5BRHA 2Q3SA 1HNVA 3NHGA 1O1WA 3SQ0A 4CEAA 3NF7A 1SZ2A 3CMEN 2HBMA 4BRNA 4WQ4A 2VG6A 3DOLA 1YF5L 2QWOA 2E2QA 1VQON 4YHHK 4CJPA 1HUXA 4K8ZA 1T6CA 4BWJA 3V9WA 1HNWK 3SMSA 5BREA 1BI4A 1QVFM 4K25A 4CECA 3QESA 3SMPA 4FWPA 1ASWA 5KTQA 2D1KA 3U6FA 4CIEA 3DLRA 1HYVA 3HPGA 3V9SA 4KHYA 2EX3A 2B5JA 4V19S 1Q18A 2NRWA 1VSIA 1HQEA 5AQTA 2Q36A 4FLXA 1RDBA 4WFAL 3KJVA 3K5OA 1SKWA 2Q31A 2G8FA 3FGUA 3GE1A 4H5TA 4BRMA 4XH1A 4M42A 4A2BA 4BREA 3CM5A 4Z94A 4N41A 5FDLA 1W7AA 1E4GT 4JI4K 3HRGA 2YHYA 3VERA 1KLMA 4N47A 4M3TA 3H08A 3DJCA 4RW6A 3MEDA 1HQUA 4JEPA 1NU0A 1WSEA 3H6EA 4CVNE 1K6YA 4YDUA 1CZ9A 5JVHL 2YJFA 1B9FA 1XHXA 3VEYA 1T44A 4GKKK 4LFCK 1N32K 4M3XA 2VWBA 4CEDA 3SUOA 2KFNA 4ELUA 5AZIA 1YAGA 4B3OA 1GLAG 2RE2A 3R9PA 4Z4HA 4LF4K 3QBWA 2FC0A 3KKSA 4M7YA 4AHVA 3BUZB 1VSEA 1Y64A 2YHBA 3LP3A 4KH6A 4YORA 1WAFA 3CQYA 3G25A 5HLFA 5E26A 4DQQA 2A6AA 4CW7B 4OGEA 4BC2A 2P9LA 4FWQA 1TUUA 3PY8A 2PYJA 2FLOA 3OYNA 4CEBA 3JXUA 4OJRA 2DY4A 4CGGA 4B08A 5CHIA 3ZT2A 3CCRN 4JHDA 2A42A 4JD2A 2VG7A 3ZX0A 5K14A 5AQRA 1BWFO 3L2RA 1QZ5A 3MK6A 2D0OA 1C1CA 3VA0A 1BIUA 1XWLA 4CI6A 1YT3A 2E1YA 3KK1A 3KLEA 5EY4A 3TTCA 3M5RA 3SI6A 4O5FA 2PY5A 3WT0A 5DM6L 1EO1A 2F8TA 4DUYK 5BPLA 2QWRA 3V9UA 2HSTA 4FOIA 1NG9A 2IVPA 5AQIA 4CJTA 4XH5A 3OYAA 2B6AA 2AP1A 1A5WA 3U3GA 1NK5A 4IO9L 1BG3A 4I7FA 4JKBA 4LFBK 4DFJA 4FSVA 1HJOA 4CGDA 2P9KA 4C1NK 2ZWHA 2OTLN 3FFIA 3OW2M 3BF3A 2XY6A 1P90A 3LAKA 3KLIA 3IS9A 4U67L 2P9IB 4FWSA 1FXXA 1RNHA 3SLCA 3P39A 3LP1A 2D0BA 4CK1A 1L3UA 3ENBA 4AM7A 3LDPA 3THYB 3OS1A 1NJWA 3EY1A 3RTVA 4B1WB 3VQPA 3D2EA 3NF6A 3OYKA 3AO1A 4MO4A 3VENA 4DG1A 3NH0A 4WFBL 3V6DA 4CFDA 2WTUA 1YJWN 3ZSZA 3NH2A 2X78A 3E9PA 3MN9A 4FW2A 1JJ2M 5JVGL 2QXFA 4C1NI 3AVHA 1NK9A 4IFEA 3EZWA 1C1AA 3FLCO 4AH9A 4WFNL 4DTUA 3BGRA 4EHUA 3EZ5A 3PV8A 2F8SA 4DV1K 4BRKA 3T1HK 3QIPA 4O44A 4N56A 3WNGA 4BQLA 5KI6A 3TANA 3KTQA 2VYPA 5KPTA 3ZCMA 1E4FT 1NKEA 4H03B 1Q8IA 1EKEA 3D2FB 4JI2K 3G4SN 4IOXA 3ULEA 4CHQA 4ELTA 3TSPA 3O9QA 4CEZA 4KTWA 3DLHA 2BE2A 1JCEA 5CY4A 4BG8A 4I9QA 4BE2A 3DXMA 1VSFA 3QEWA 4CJ5A 4E19A 3LALA 1VQLN 3SBTA 1SL2A 4JI6K 3EO3A 1KVCA 4IZ9A 1C6VA 1JCGA 1RDAA 4AF1A 1QQCA 4DUZK 2HVHA 3VF2A 4LH4A 4DLGA 4BR4A 1NGFA 3KKRA 3HJFA 5JICA 1NOYA 4A59A 3AARA 5F1XA 2RKIA 3MAQA 2KLAA 3ATVA 2KTQA 5LJWA 3JAMO 1NGBA 2HHQA 4RW7A 4GY2B 1LAVA 3OYMA 2YNGA 3KLFA 3G6EN 2P9PB 3ZYYX 4MDAA 4BRIA 3KD5E 4HUEA 4YOUA 1Z25A 5E41A 3VETA 3ZSQA 3RRHA 2ZGZA 4FWLA 4CJLA 4BE1A 1VQ7N 4CD1A 4DS4A 1NMDA 1FJGK 5F2RA 3EKSA 1YIJN 2F9TA 3CIPA 3EE9A 1J6ZA 3HYFA 3ZEUB 3VF6A 3UE5A 3T1AA 3AGRA 5J2PA 4FJMA 3S3NA 4DTRA 4M3WA 1C0TA 1NGCA 4DU1A 2YKNA 4JI7K 2DTUA 4KTZA 4JI1K 3OJUA 4CHYA 1EX4A 4KFBA 4DV5K 1Q81O 1G15A 4E7HA 3HSTB 4IBNA 2NRTA 1TYQB 5SZTA 4O55A 2W40A 4J2AA 5AFUA 3J7AP 3SQ2A 1SQKA 2E6LA 2FSKA 3SUPA 3QICA 3BP8A 5KRTA 2Z1IA 4CZGA 4GVMA 4I9LA 2QWLA 4FZZA 3LDNA 3L3UA 4RTFD 1K8KB 1S1TA 4FM1A 2EHGA 3LAMA 1BUPA 3LL3A 4OPJA 1KAZA 1VSMA 4DSEA 4CE9A 5BN9A 5J2NA 1NJXA 2E2NA 2YNHA 1KTQA 1K73O 2X6SA 5AQPA 2Z1JA 5BR9A 3CMAN 1QZ6A 1D4XA 1IBMK 3UB5A 4B9SA 1HR0K 4BRQA 2KZZA 1NJIO 2YHWA 1RTIA 4MLHA 5FRMA 1DGKN 4AHTA 4KPYA 3V4IA 3CCUN 3CFOA 4W5NA 2GTDA 1B92A 5FRNA 3LANA 1TK0A 1BCMA 1ZYQA 2XY8A 5M1PA 3ID6A 2ZGYA 5CYQA 4K42A 2G8UA 2HHVA 3QEIA 1RGIA 4QAGA 5AQOA 3HPOA 1NGHA 4B1XB 1FKPA 4G1QA 4FLYA 1NBWA 4IEIA 1D5AA 3HK2A 2QWNA 1IV0A 3KLGA 2KFZA 4H5VA 5ADXH 1SUQA 4M7XA 3OYJA 1JLGA 2IVOA 4BQZA 4MQ3A 4OKEA 1Q82O 3ZSWA 1MDUB 4RW9A 2GEMA 3R3LA 1F21A 3ALYA 4FPAA 4NCAA 3MMVA 1BQMA 1JXBA 1IKXA 4X62K 1HX1A 2QTDA 4PQUA 1KCFA 5KGWA 3S3OA 4N5SA 5AQZA 1ASUA 2O8BB 4FJIA 5SWMA 3B6PA 1ZXOA 4CESA 2G8IA 1BOTO 1JL1A 4WE1A 3VN5A 4B8AB 1NNEA 1LWFA 4KB1A 1DLOA 1ASVA 3E1YA 1CXQA 5DM7L 3AO3A 3C6AA 3O80A 2P9UB 2FBTA 1MU2A 3HSCA 4H5RA 2OZSA 1BDGA 4CIGA 2NRRA 3V1RA 3RVCA 1Q7YO 4J2BA 4UY8O 4FW1A 2FF3B 4CJEA 4JK8A 3MN6A 3UKRB 2G8VA 1LW0A 3ZLJA 2FSNA 2ATQA 4CHNA 1QE1A 3ZSVA 4DQIA 3DI6A 3MXIA 3D0PA 4CFAA 1QQNA 4A62A 4CBXA 3OHRA 2ZE2A 3K9JA 4B8CA 4K43A 4DV7K 1VQ8N 3MEGA 3FZMA 2O8CB 3CJCA 3AA3A 1TKTA 3PIPL 4OPHA 4FLTA 3A2FA 4ISGA 4YNQA 3CYMA 2WOMA 2BTFA 4CF8A 1HNIA 3JS6A 3AY9A 4BGBA 4FZXC 4IOCL 4KHNA 2ZJRL 2WBNA 4IKFA 1SKSA 3HXMA 1RT1A 4X64K 3C7NB 4DSKA 3PSFA 3CC2N 4MLEA 4DB3A 4BDYA 3V81A 2VCPA 2P9NB 4YOWA 4B9QA 4YDUC 1GOCA 4FWKA 2QK9A 2QEXN 3KZBA 4FVMA 4FJXA 3EKUA 2YJEA 4DSFA 3OJSA 1W9HA 1WB9A 3ZX2A 4JS5A 3ZT4A 4NO7A 4I6MB 1QHTA 1VQ4N 2J4RA 5GIPA 2WC9A 1WOQA 5BN8A 5BPMA 1RT7A 2NLXA 1YTUA 3KWGA 3DOKA 4QOZB 2YNFA 3MCAB 1KQSM 2XO7A 5CR4A 3CFRA 3J7YP 3THXA 4FJNA 4F2SA 1EP4A 1LAWA 3VQ5A 4R79A 2PZSA 2ZM6K 1WSHA 5LMUK 4CJKA 4KH4A 4L3QA 4MDBA 3LZJA 2XY5A 4CJVA 1U6ZA 3OYGA 4IEEA 4KKOA 4DR7K 3DRPA 3MECA 3G0ZA 4OLBA 5FROA 1WN7A 2W6KA 5CE3A 1U4BA 4NCGA 4KHQA 3S9HA 1BCOA 4JKCA 4LC9B 3GOIA 5AZJA 1XMOK 3IKMA 5M1QA 2Z1HA 4F3OA 3K0SA 3L2WA 4NCBA 3DRRA 4XIUA 1YI2N 3BZKA 5C42A 4E7LA 3CM6A 3ZT1A 1ZBIA 3G71N 3THVA 4BGAA 4B3MK 3I0SA 3VEXA 3HVTA 1E3MA 2H3GX 3WQTA 3CC7N 4WQ5C 3JYTA 4PKHA 4CJ7A 1D8YA 2WFBA 1N6QA 3C6UA 3ZSXA 3P5JA 2VWKA 3DLBA 4K8XA 4HCCA 3A0IX 4BR9A 3KLHA 4FLWA 1NGAA 1I3AA 4F8RA 3TI0A 3WNFA 3A5OC 4GMJB 3S3MA 3IUCA 3H45C 2PBDA 3WNEA 4JKGA 1N34K 2P9SA 1CLQA 3LWLA 1TL3A 4KREA 4DV0K 3VQ6A 3MXMA 3GL1A 4B9NA 3AVCA 1Z6RA 2HOEA 3E66A 4CGHA 2VWJA 2Y1JA 2O4GA 4DQ8A 4A57A 2GWKA 3AVNA 3CQXA 3OTOK 1NJYA 1OH6A 4AHRA 2OPRA 2YX6A 5FPDA 2O8EB 1DTQA 3R1XA 2IOCA 3SK3A 4BDZA 5C0YA 3RMCA 1UA1A 3ID8A 4CZFA 4CZLA 3QDKA 2AA4A 1T6DA 2E4LA 3BDPA 4FK4A 4HTLA 2W6LA 2PYLA 3DLEA 4JK7A 5GINA 4QS9A 1KXPA 4W5TA 4BVOA 4E0DA 4F4KA 2E20A 3NVMA 5LL6Z 3FE1A 2CGKA 3VQBA 3P83D 4FM0A 1O13A 3P4IA 3KVGA 3H1QA 3CPWM 2E8AA 4J8FA 5AQFA 5LMNK 4FVUA 2V7ZA 3I55N 3P38A 1UOCA 4JV5K 5EXWA 2GELA 2Q97A 2FXUA 2R7YA 4BE0A 3ZX3A 2CH6A 1S22A 1H1VA 5C12A 2O8DA 3NAEA 3SQ1A 1QS4A 4WF9L 3RSEA 1ZBHA 2UXBK 3LZIA 3NE6A 4W5OA 2UUBK 3SJJA 1QSLA 1XNQK 1QQMA 1NK6A 3QNOA 3I33A 4C8OA 1IBKK 5AQJA 3THWA 4GKJK 2E2OA 3QFUA 4NYNA 2DFHA 3ZT3A 4O0IA 4Z4GA 4YOTA 3VF4A 4H5NA 2CGJA 1YHQN 3KK7A 3TSUA 2HF3A 5I9EB 4ILJA 5E84A 3T69A 4AM6A 4IG3A 4YOYA 2HMPA 4DS5A 4LFAK 1YVUA 4LY7A 4KAZA 4FK2A 4DV4K 3UKUB 4K41A 4DQRA 3HI0A 3QEVA 1TL1A 4FM2A 3K58A 4DV6K 1CXUA 4LF7K 1ATNA 2HBKA 2ASOA 3ZSOA 4RW4A 1LWCA 1BO5O 5C15A 3SAFA 3W0LA 3NFAA 1WSIA 5JS2A 1KFSA 3AVFA 4DKWA 4B9UA 4H4MA 2E1ZA 1KRPA 1DKGD 3AVLA 3PX6A 4JKAA 1S1WA 5EVZA 5C10A 3CCLN 1S3XA 3HPHA 3CERA 3OYIA 2Q1NA 1Z26A 1BA0A 3TTFA 3OS2A 2A3ZA 2V51B 4DR3K 2D0PA 4H0TB 1C0GA 1HPZA 3O9UA 1KSPA 4OGCA 4H0OA 3NGYA 1U2VA 2BANA 2HHHK 1Y97A 5KPRA 3FZLA 3MEEA 1HYSA 3KIOA 2NNWA 1BQNA 3CD6N 3O3FA 3PSIA 3EYZA 2NZTA 4Y0WA 2YHXA 2A40A 2QKKA 3Q7BA 3VQEA 2NRZA 4DTSA 1VHXA 1XMQK 4NB4A 4JS4A 4KTQA 1EQYA 3QBXA 3VEWA 3L2VA 3H46O 2ASMA 4DQSA 4BRCA 4KI4A 3CCQN 4U7BA 1U47A 2X74A 2HNDA 3KK2A 4DF8A 4ILGB 2V7YA 3CQ8A 4NYFA 4CF9A 3U4LA 3CI5A 4DR4K 3FZKA 2F7TA 1J53A 4BACA 4CJRA 3J81O 2HBLA 5AQLA 3VMFB 3PLAA 3CJAA 4M3RA 3V1QA 5MLCQ 4ISFA 4B3TK 4W5RA 4E7KA 3CJ1A 3ZSRA 2ZJQL 4A2AA 4R5PA 4LF6K 3PX0A 1VAZA 3OYHA 1Z05A 4B1VA 4YY3K 4M3YA 1TAUA 4CFBA 1S5JA 4Z4EA 4FWOA 1OVQA 3SPZA 1BA1A 1XNRK 3AGKA 5FPNA 1X3NA 1LW2A 3ENOA 3K9KA 1HKCA 2E5LK 1NK7A 1C1BA 1SL1A 1T3VA 3O4WA 5EX5A 4IFVA 2VG5A 3NVKA 1X9MA 3DYAA 2HHXA 4CBWA 5AQGA 3MWPA 3AAPA 1RCHA 4EZ9A 2PAVA 2PFUA 4EZ6A 4DV3K 4HUGA 4Z4FA 2WONA 1X9JA 3K59A 3SUQA 1IBLK 4DQPA 3B8AX 3E01A 3TTDA 4O8UA 4E1JA 4IFYA 1A5VA 4FO0A 3HP9A 1JLCA 1QHAA 5GAEP 4FJ9A 4JI5K 1IKWA 2OCEA 4FWNA 3THXB 1U48A 4BR7A 1IH7A 3ZETB 5GIOA 4M3UA 5JLFA 2HBJA 3V1OA 1HMVA 4O0JA 1KAXA 5D3GA 1GLLO 4OKJA 4CZIA 5AQXA 3WXJA 4ID5A 3WXKA 4BC5A 5LJVA 3CCEN 3HBTA 2F4VK 1WSJA 3QFPA 3M6GA 3U9DA 1FKOA 4OVLA 5B8HA 1WBDA 2QXLA 1QSSA 1KAYA 2OPPA 4ZTFA 2E2PA 3LDQA 1RTHA 4HVJA 4GVEA 5C2FA 4KHPK 3ISNC 4CBUA 2A1SA 2UYTA 3WNHA 3AVBA 2CH5A 1VQ5N 1T7PA 5HBMA 3O3GA 2GUIA 2Q2RA 3I8BA 4ZHRA 1GOAA 5FPEA 3J8AA 4KHUA 1BI4B 2VGNA 3K57A 1BISA 4TSXA 4RCHA 3AVAA 5H1SQ 4HWIA 5JLHA 4YFUA 3TWHA 1XI1A 1NKCA 2D0CA 4CZJA 4F2RA 5AQQA 2VQEK 5KGXA 2HHWA 3OYBA 4PL8A 5ADXA 1RT4A 3MDQA 4QS7A 4RG8A 2JLEA 1NMNA 3EL2A 4PKGA 3P31A 2HNZA 4NLCA 4EAHD 3S41A 2UUAK 1EWRA 2NRVA 4JKGB 3RWUA 1VSHA 4B3RK 1TVRA 4DF4A 4E7JA 3QLHA 4LD0A 3VOVA 3CF5L 1J5OA 4I2QA 2Q0RA 3GBTA 3L4QA 4CF1A 2OYQA 3SJHA 2RF2A 4EIAA 1IG9A 1W0HA 4BR0A 1XHZA 3HVRA 2DFFA 4CHPA 3PO4A 4DMNA 1VQ9N 1QQOA 1KC8O 3JSMA 1T8EA 3C0BA 2GWJA 4GV9A 5GAGP 3VEOA 4WYBA 3PX4A 1NM1A 3QEXA 3QNNA 1MA9B 5EOYA 1HYZA 2KKZA 2O8FA 4H0PA 5BPNA 4DSJA 4AHUA 3HL8A 3C6HA 1HPMA 4H0XB 4BWMA 5AZIB 3H3NO 4CF0A 5AQVA 3SV3A 3FZHA 3AV9A 5M1NA 1C0UA 3B6OA 3F9KA 4GW6A 2P9IA 3QERA 3E9OA 1OH5A 2XRIA 2QI2A 4CIFA 3EE8A 1Q9XA 3VGMA 2P9LB 1K8AO 3WEEA 1XQSC 1KD1O 3VQ7A 3SZ2A 1JXEA 3ITHA 4K0KK 3OYEA 3MWTA 5IWAK 4WQ4C 1YJ9N 3RMAA 1RT2A 4JHDB 1VQ6N 3M3ZA 4JD2B 1SKRA 4AILC 4CFCA 2D5RA 4BRGA 3VQ8A 2V52B 1S6PA 5CZ2A 1FK9A 4CGJA 1VSLA 2Z1GA 3VQ4A 1RDCA 4BRLA 4YOXA 3HP6A 3N4PA 1WAJA 3RMDA 4FLVA 3NF9A 3CCMN 2I5JA 2GBZA 2FBYA 3DXKA 4LH5A 3VQDA 4CZMA 2HW3A 5A2QO 4X66K 2YHAA 4C8NA 3TAEA 1U49A 3IRXA 1DTTA 4JI3K 2I7PA 2IGIA 3CXCM 4MO5A 3VTIA 4XH4A 5C25A 1LCUA 4IJNA 2P9KB 3KWIA 3D2FA 5ELZA 1LWEA 4O8KA 4PKIA 3WQUA 1J5EK 3M8RA 1BU6O 4LSNA 3O6WA 3NDKA 1MWKA 5EU7A 2KQ2A 3L0QA 4EFHA 1IKYA 3CJ9A 1U04A 5M1KA 1U2VB 1VSKA 5KRSA 3KHYA 3HM8A 4JK9A 3TAMA 1M90O 5AQNA 2OA8A 3K5NA 4CJUA 3L8BA 5GADP 3D2EB 1EXQA 1GLCG 2YI1A 3AAQA 3GDQA 3I0RA 3DMJA 1BIZA 5M1OA 1JL2A 4OO1J 2A1RA 3QINA 3NF8A 1ZBFA 4O4GA 1GLEG 4DTPA 2HMIA 4UQGA 3TPQA 2P9PA 4KO0A 4CHOA 5AQMA 4CEEA 3RMBA 4IWVA 3L3VA 3A8YA 1KFDA 4LF9K 5KPZA 3QB0A 2QWMA 4JAXA 4BY9C 3I56N 1U45A 3VEZA 3Q7CA 4B1ZA 4KBOA 4YOVA 2I7NA 5HP1A 1HNXK 2QWPA 3AA2A 3ZEUA 2FSJA 2Q0UA 2UXCK 3ZT0A 3TAQA 3ULEB 3O4NA 1IG8A 4BR2A 4CK3A 3LP2A 1VRUA 1N36K 3O8MA 3E9LA 2ZQBA 1QVGM 3LDOA 3CPEA 4O5BA 5GAHP 2P5GA 4GV6A 3DXMB 3VTHA 2Y1IA 4XEIA 1UWBA 5HROA 3TU5A 1ZBSA 4FJ5A 1WSFA 5AQSA 1XC9A 5CZ1A 1TGOA 3TAGA 2RHKA 1TYQA 1KVBA 3WXIA 4E7IA 4HHTA 4ELVA 1RTDA 1HKGA 4CZEA 4JN4A 3U8XA 3OYLA 3ATUA 3V9ZA 3T1YK 3A5LC 1YITN 3CHWA 4JI0K 2O4IA 2W42A 5AJ3K 4KHWA 3EN9A 4H8KA 1S9EA 2JGUA 3D6RA 3RR7A 3TAPA 1NWKA 1ITGA 4CJ4A 5BR8K 1J54A 1K8KA 2IC3A 1NGIA 5AR0A 1OH7A 2ITMA 3LDSA 4GV3A 4H0VB 5AQHA 3T3FA 4PA1A 1N8RO 4IXCA 3KK3A 4B9LA 2F9WA 4FJGA 4FJKA 3O4QA 5KQDA 4M3ZA 3O9RA 3SCXA 4IDHA 3UIQA 1R59O 2B4JA 4FLZA 4M63C 4CZHA 3SV4A 2UUCK 3IDHA 1MWMA 2A5XA 4H5WA 3U9ZA 1RT5A 1NGGA 1X3MA 1KVAA 5HRSA 2D0AA 1TKDA 2HHSA 3O3HA 3F5TA 1SV5A 4BC3A 3AO5A 2XY7A 3O5BA 3D7EO 2HVIA 1YXQA 1L3TA 2IDOA 4CJQA 3OYCA 5TKWA 5TKYA 4JKHA 4EHTA 2CGLA 4OPAA 3F2KA 3L6QA 1ILYA 2G8WA 4BR5A 4IDKA 3MN5A 4C23A 4Q5VA 1NOZA 3WXMB 4E1NA 1T05A 3QIOA 1GOBA 3P1GA 2EWSA 3VQAA 4GNIA 4JRPA 3C94A 4IG0A 3MN7A 4IJAA 2BH1A 2P51A 1QSYA 1LV5A 1D9FA 1FW6A 2O8BA 3SNNA 1RBUA 4FOEA 4CEOA 3IMXA 1G99A 3D45A 1JLBA 2OPSA 1W2BM 4KHSA 4DFPA 2P9UA 3H1VX 1OVYA 4BVPA 1I94K 4DTJA 3M1FA 4WQ5A 3AVGA 3NCIA 4B9VA 3UKRA 1X1PA 5LY3A 5AQYA 3K2PA 3NMUA 1S9GA 2O8FB 1JLFA 4JI8K 4C8KA 1RBVA 2DFEA 4CERA 3MX2A 4KI6A 4QS8A 4ICLA 3EEQA 1JLEA 1VQPN 3SYZA 2KW4A 4DR1K 4DR6K 5DMRA 3T7ZA 1ESVA 3TABA 2O8CA 5FPMA 3G10A 3TSQA 5F0XA 2RN2A 3VA3A 4CJFA 1ZBLA 3VQQA 2HF4A 1L3VA 3W3DA 4LF8K 1VQKN 3LPUA 4DU4A 4QCLA 3F9MA 4ILHA 3PO5A 3A5NC 3O08A 2DPNA 3C7NA 1C0MA 3DRSA 3WEEB 2P9NA 1P8ZA 4N76A 1ZBUA 4AHCA 4LSLA 2ZF5O 4ID1A 1BGXT 3AA4A 1RBSA 1EWQA 3DM2A 4I6MA 3DLLL 5JS1A 4KRFA 3HO1A 3HTVA 3HM9A 2XHBA 1ZC6A 2OANA 5HOOA 1HKBA 4FZYA 2AJQA 5C2DA 5KQ8A 1JLAA 2IIRA 4X65K 1VK0A 1LOTB 1VQMN 4PWDA 4B1YB 1WBBA 3ASMA 2FF6A 2A41A 4F3TA 3DXKB 4PY5A 2UU9K 3SBGA 5AQUA 3LM2A 1XC3A 2YKMA 4CF2A 3O1WA 3KD1E 5BRDA 3F73A 4DR2K 4A5BA 1NK0A 1TV6A
chains in the Genus database with same CATH topology
1IBLK 5AJ3K 1J5EK 2HHHK 4NXMK 5LL6Z 5BR8K 1HNZK 1I94K 4JI5K 4JI7K 3J7YP 4JI1K 4CW7B 4DV5K 4OX9K 2ZM6K 5LMUK 4YHHK 5LMNK 4DV1K 3T1HK 4X62K 4NXNK 1HNWK 4DR7K 4JV5K 4JI8K 3J7AP 1XMQK 5IT9O 2F4VK 4DR6K 4DR1K 4JI2K 2VQFK 4DR5K 1XMOK 2UXBK 2UUCK 4V19S 2UUBK 1XNQK 4LF8K 4JYAK 1IBKK 4GKJK 4KHPK 5FLXO 4DR4K 2UXDK 4B3MK 4JI6K 4LF9K 4DUYK 3J81O 4K0KK 4DUZK 1N33K 5IWAK 4B3TK 4B3SK 4JI4K 1IBMK 1HNXK 4DV7K 1HR0K 4LFAK 4LFBK 2UXCK 4LF6K 4DV4K 2VQEK 4AQYK 1N36K 4YY3K 3J80O 4CVNE 4DV2K 4DV6K 3JAMO 4LF7K 1XNRK 1N34K 2UUAK 4X64K 4X65K 4DV0K 2E5LK 4GKKK 4B3RK 4LFCK 1N32K 1FJGK 5A2QO 3OTOK 4LF5K 4X66K 2UU9K 4JI3K 4LF4K 4DR2K 3T1YK 4DV3K 4DR3K 4JI0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL K;  5AJ3 K;  1J5E K;  2HHH K;  4NXM K;  5LL6 Z;  5BR8 K;  1HNZ K;  1I94 K;  4JI5 K;  4JI7 K;  3J7Y P;  4JI1 K;  4CW7 B;  4DV5 K;  4OX9 K;  2ZM6 K;  5LMU K;  4YHH K;  5LMN K;  4DV1 K;  3T1H K;  4X62 K;  4NXN K;  1HNW K;  4DR7 K;  4JV5 K;  4JI8 K;  3J7A P;  1XMQ K;  5IT9 O;  2F4V K;  4DR6 K;  4DR1 K;  4JI2 K;  2VQF K;  4DR5 K;  1XMO K;  2UXB K;  2UUC K;  4V19 S;  2UUB K;  1XNQ K;  4LF8 K;  4JYA K;  1IBK K;  4GKJ K;  4KHP K;  5FLX O;  4DR4 K;  2UXD K;  4B3M K;  4JI6 K;  4LF9 K;  4DUY K;  3J81 O;  4K0K K;  4DUZ K;  1N33 K;  5IWA K;  4B3T K;  4B3S K;  4JI4 K;  1IBM K;  1HNX K;  4DV7 K;  1HR0 K;  4LFA K;  4LFB K;  2UXC K;  4LF6 K;  4DV4 K;  2VQE K;  4AQY K;  1N36 K;  4YY3 K;  3J80 O;  4CVN E;  4DV2 K;  4DV6 K;  3JAM O;  4LF7 K;  1XNR K;  1N34 K;  2UUA K;  4X64 K;  4X65 K;  4DV0 K;  2E5L K;  4GKK K;  4B3R K;  4LFC K;  1N32 K;  1FJG K;  5A2Q O;  3OTO K;  4LF5 K;  4X66 K;  2UU9 K;  4JI3 K;  4LF4 K;  4DR2 K;  3T1Y K;  4DV3 K;  4DR3 K;  4JI0 K; 
#chains in the Genus database with same CATH topology
 3VQ9 A;  3ENH A;  3FFK B;  4FJ8 A;  3TAR A;  2P1J A;  5T7B A;  3OA9 A;  1HNZ K;  4FLU A;  1OKJ A;  3WUH A;  1ATS A;  3M8S A;  1ATR A;  2JWL A;  3U3Y A;  4M45 A;  3H3O B;  4DWI A;  4DFM A;  1V4S A;  2D4W A;  4IO8 A;  2BDP A;  4CJS A;  4IOA L;  1D9D A;  4FJL A;  3HOT A;  4FJ7 A;  4CGF A;  3OBW A;  3K5M A;  4PUO A;  2VQF K;  4DR5 K;  4FXD A;  1HRH A;  3IAY A;  1JCF A;  2HB5 A;  1Q9Y A;  4JYA K;  2BUP A;  2HHT A;  3BY5 A;  1C0F A;  2FBX A;  3AVK A;  1X9S A;  1RBT A;  4Z4I A;  3OYF A;  4DHY A;  1B9D A;  2UXD K;  1EET A;  3VPZ A;  4DSI A;  4BRA A;  1NGE A;  2E88 A;  4DFK A;  5AQW A;  1N33 K;  3C95 A;  4NLB A;  3VGL A;  4BRD A;  4DTO A;  3RRG A;  2O8E A;  5BRF A;  3CCS N;  1HJR A;  3SQ4 A;  4L8R B;  3O1B A;  5AZJ B;  5C24 A;  1BHL A;  4AQY K;  4JKF A;  2NUB A;  3FZF A;  4DV2 K;  1NK8 A;  4MFB A;  3SPY A;  3QO9 A;  2ASP A;  1REV A;  1RBR A;  3DAW A;  4B1U B;  3CG7 A;  3PUF A;  3SAH A;  4EP5 A;  2OTJ N;  4Y1D A;  3CJB A;  1M1K O;  1RDD A;  4LF5 K;  4CEQ A;  4WCE L;  1IJJ A;  1BL3 A;  4JKE A;  4CEF A;  2ZJP L;  4OPK A;  4DLE A;  1TK5 A;  1NGJ A;  4PL7 A;  3N4Q A;  3CCV N;  2KHO A;  2ETJ A;  1SS6 A;  2WUS A;  1R0A A;  1GLD G;  1RT3 A;  3TR8 A;  3VEV A;  3DWL A;  1S1U A;  2VGM A;  1UAX A;  2P9S B;  1W97 L;  4RW8 A;  2QWQ A;  2ZD1 A;  3LPT A;  1S1X A;  4OX9 K;  2OPQ A;  4BG9 A;  1IKV A;  3HT3 A;  3C6T A;  4NXN K;  3LM9 A;  4AHS A;  4F9O A;  5I42 A;  1Q86 O;  3VQC A;  1CZB A;  1JKH A;  1RDW X;  1QTM A;  2X6N A;  4CZK A;  4OKK A;  5IT9 O;  3AA5 X;  1I39 A;  1RIL A;  2IVN A;  2GV9 A;  4DSL A;  3C65 A;  4Y1C A;  1X9W A;  3UKU A;  1GLF O;  3WXL A;  2IS3 A;  1WNS A;  1OH8 A;  1TAQ A;  2LSN A;  4B9T A;  2NRH A;  4FK0 A;  5FLX O;  3LDL A;  4CHZ A;  4BRH A;  3QET A;  1GLB G;  1CZA N;  4C8M A;  1NLV A;  4HTU A;  3MX5 A;  1N5Y A;  1S1V A;  3ZSY A;  5CYM A;  3MXJ A;  4OLA A;  3RR8 A;  3V9X A;  1K9M O;  1RDU A;  4CCH A;  2RPI A;  1YTA A;  2YV0 X;  2O8D B;  4M41 A;  3CFP A;  1V4T A;  3SUN A;  4E3S A;  1WSG A;  3LP0 A;  4BDP A;  3IFR A;  4CJ3 A;  5AFU H;  4FJH A;  3RSE B;  3LWM A;  2P5O A;  5J2Q A;  4ZTJ A;  3IG1 A;  4FPB A;  1VRT A;  4KV8 A;  3R8E A;  3AVM A;  3CET A;  4CGI A;  4PHT X;  4DU3 A;  1KLN A;  3THW B;  3HZ6 A;  1NGD A;  2G8H A;  2ITG A;  5I3U A;  3THY A;  4G9Z A;  4FJJ A;  2GUP A;  4Z0U A;  4H0Y B;  2OZM A;  1UA0 A;  1TKX A;  4J2D A;  3OBY A;  3BEX A;  3CJ7 A;  4CD3 A;  1DT9 A;  4JKD A;  3MCP A;  3OS0 A;  2QW9 A;  3A5M C;  4FWM A;  4A61 A;  1NJZ A;  3OY9 A;  3K5L A;  2E6M A;  3NGZ A;  1HLU A;  1S72 N;  4C8L A;  5J1E A;  5DK5 A;  4NXM K;  4FWR A;  1WUA A;  3NBP A;  1RT6 A;  4BRO A;  2YCH A;  4KB0 A;  2NRX A;  4FCY A;  4CK2 A;  4J2E A;  5HRR A;  3PIO L;  1YVN A;  2HHU A;  4HCB A;  1VSD A;  1DEJ A;  2IAJ A;  1NKB A;  3AO4 A;  2FBV A;  1YUW A;  1A5X A;  1J9A A;  2GX9 A;  4A5A A;  3L2Q A;  3VGK A;  1RFQ A;  3ULD A;  2F96 A;  4BRF A;  1TUY A;  4EP4 A;  2BGG A;  4KH5 A;  4RWT A;  1GLJ O;  5M1F A;  1WLJ A;  3T19 A;  3O9S A;  1JLQ A;  1VSJ A;  3BZC A;  3J7Z O;  4DTM A;  1NK4 A;  4Q0B A;  4E89 A;  3FR0 A;  2YNI A;  1XUP O;  3DLK A;  3I8D A;  4H4O A;  3CC4 N;  3DLG A;  1TKZ A;  5AQK A;  2JWK A;  3NGI A;  3TAF A;  3QEP A;  1L5U A;  2QA4 N;  2KZM A;  4B3S K;  3SAG A;  1YJN N;  3VES A;  2HNY A;  4BC4 A;  3O9T A;  5HRN A;  1TK8 A;  3QML A;  1S6Q A;  3OVN A;  5JMV A;  3NH1 A;  3J80 O;  4HUF A;  1T03 A;  4JRQ A;  4BRP A;  1VQN N;  3OYD A;  5HRP A;  3HOS A;  3M8Q A;  4JNE A;  1IO2 A;  4DCH A;  4FYD A;  4W5Q A;  1SAZ A;  4FL9 A;  3BF1 A;  4CJW A;  4I2P A;  1L3S A;  4DTN A;  3ZET A;  5HL7 L;  4DTX A;  3AO2 A;  2QM1 A;  2QKB A;  3AVJ A;  4ISE A;  3AVI A;  3CCJ N;  1SL0 A;  2W41 A;  3R6M A;  4Z4C A;  3L4I A;  4B9M A;  4JLH A;  3M8P A;  4E1M A;  3GG4 A;  1RTJ A;  2G8K A;  5J2M A;  3L2U A;  5BRH A;  2Q3S A;  1HNV A;  3NHG A;  1O1W A;  3SQ0 A;  4CEA A;  3NF7 A;  1SZ2 A;  3CME N;  2HBM A;  4BRN A;  4WQ4 A;  2VG6 A;  3DOL A;  1YF5 L;  2QWO A;  2E2Q A;  1VQO N;  4YHH K;  4CJP A;  1HUX A;  4K8Z A;  1T6C A;  4BWJ A;  3V9W A;  1HNW K;  3SMS A;  5BRE A;  1BI4 A;  1QVF M;  4K25 A;  4CEC A;  3QES A;  3SMP A;  4FWP A;  1ASW A;  5KTQ A;  2D1K A;  3U6F A;  4CIE A;  3DLR A;  1HYV A;  3HPG A;  3V9S A;  4KHY A;  2EX3 A;  2B5J A;  4V19 S;  1Q18 A;  2NRW A;  1VSI A;  1HQE A;  5AQT A;  2Q36 A;  4FLX A;  1RDB A;  4WFA L;  3KJV A;  3K5O A;  1SKW A;  2Q31 A;  2G8F A;  3FGU A;  3GE1 A;  4H5T A;  4BRM A;  4XH1 A;  4M42 A;  4A2B A;  4BRE A;  3CM5 A;  4Z94 A;  4N41 A;  5FDL A;  1W7A A;  1E4G T;  4JI4 K;  3HRG A;  2YHY A;  3VER A;  1KLM A;  4N47 A;  4M3T A;  3H08 A;  3DJC A;  4RW6 A;  3MED A;  1HQU A;  4JEP A;  1NU0 A;  1WSE A;  3H6E A;  4CVN E;  1K6Y A;  4YDU A;  1CZ9 A;  5JVH L;  2YJF A;  1B9F A;  1XHX A;  3VEY A;  1T44 A;  4GKK K;  4LFC K;  1N32 K;  4M3X A;  2VWB A;  4CED A;  3SUO A;  2KFN A;  4ELU A;  5AZI A;  1YAG A;  4B3O A;  1GLA G;  2RE2 A;  3R9P A;  4Z4H A;  4LF4 K;  3QBW A;  2FC0 A;  3KKS A;  4M7Y A;  4AHV A;  3BUZ B;  1VSE A;  1Y64 A;  2YHB A;  3LP3 A;  4KH6 A;  4YOR A;  1WAF A;  3CQY A;  3G25 A;  5HLF A;  5E26 A;  4DQQ A;  2A6A A;  4CW7 B;  4OGE A;  4BC2 A;  2P9L A;  4FWQ A;  1TUU A;  3PY8 A;  2PYJ A;  2FLO A;  3OYN A;  4CEB A;  3JXU A;  4OJR A;  2DY4 A;  4CGG A;  4B08 A;  5CHI A;  3ZT2 A;  3CCR N;  4JHD A;  2A42 A;  4JD2 A;  2VG7 A;  3ZX0 A;  5K14 A;  5AQR A;  1BWF O;  3L2R A;  1QZ5 A;  3MK6 A;  2D0O A;  1C1C A;  3VA0 A;  1BIU A;  1XWL A;  4CI6 A;  1YT3 A;  2E1Y A;  3KK1 A;  3KLE A;  5EY4 A;  3TTC A;  3M5R A;  3SI6 A;  4O5F A;  2PY5 A;  3WT0 A;  5DM6 L;  1EO1 A;  2F8T A;  4DUY K;  5BPL A;  2QWR A;  3V9U A;  2HST A;  4FOI A;  1NG9 A;  2IVP A;  5AQI A;  4CJT A;  4XH5 A;  3OYA A;  2B6A A;  2AP1 A;  1A5W A;  3U3G A;  1NK5 A;  4IO9 L;  1BG3 A;  4I7F A;  4JKB A;  4LFB K;  4DFJ A;  4FSV A;  1HJO A;  4CGD A;  2P9K A;  4C1N K;  2ZWH A;  2OTL N;  3FFI A;  3OW2 M;  3BF3 A;  2XY6 A;  1P90 A;  3LAK A;  3KLI A;  3IS9 A;  4U67 L;  2P9I B;  4FWS A;  1FXX A;  1RNH A;  3SLC A;  3P39 A;  3LP1 A;  2D0B A;  4CK1 A;  1L3U A;  3ENB A;  4AM7 A;  3LDP A;  3THY B;  3OS1 A;  1NJW A;  3EY1 A;  3RTV A;  4B1W B;  3VQP A;  3D2E A;  3NF6 A;  3OYK A;  3AO1 A;  4MO4 A;  3VEN A;  4DG1 A;  3NH0 A;  4WFB L;  3V6D A;  4CFD A;  2WTU A;  1YJW N;  3ZSZ A;  3NH2 A;  2X78 A;  3E9P A;  3MN9 A;  4FW2 A;  1JJ2 M;  5JVG L;  2QXF A;  4C1N I;  3AVH A;  1NK9 A;  4IFE A;  3EZW A;  1C1A A;  3FLC O;  4AH9 A;  4WFN L;  4DTU A;  3BGR A;  4EHU A;  3EZ5 A;  3PV8 A;  2F8S A;  4DV1 K;  4BRK A;  3T1H K;  3QIP A;  4O44 A;  4N56 A;  3WNG A;  4BQL A;  5KI6 A;  3TAN A;  3KTQ A;  2VYP A;  5KPT A;  3ZCM A;  1E4F T;  1NKE A;  4H03 B;  1Q8I A;  1EKE A;  3D2F B;  4JI2 K;  3G4S N;  4IOX A;  3ULE A;  4CHQ A;  4ELT A;  3TSP A;  3O9Q A;  4CEZ A;  4KTW A;  3DLH A;  2BE2 A;  1JCE A;  5CY4 A;  4BG8 A;  4I9Q A;  4BE2 A;  3DXM A;  1VSF A;  3QEW A;  4CJ5 A;  4E19 A;  3LAL A;  1VQL N;  3SBT A;  1SL2 A;  4JI6 K;  3EO3 A;  1KVC A;  4IZ9 A;  1C6V A;  1JCG A;  1RDA A;  4AF1 A;  1QQC A;  4DUZ K;  2HVH A;  3VF2 A;  4LH4 A;  4DLG A;  4BR4 A;  1NGF A;  3KKR A;  3HJF A;  5JIC A;  1NOY A;  4A59 A;  3AAR A;  5F1X A;  2RKI A;  3MAQ A;  2KLA A;  3ATV A;  2KTQ A;  5LJW A;  3JAM O;  1NGB A;  2HHQ A;  4RW7 A;  4GY2 B;  1LAV A;  3OYM A;  2YNG A;  3KLF A;  3G6E N;  2P9P B;  3ZYY X;  4MDA A;  4BRI A;  3KD5 E;  4HUE A;  4YOU A;  1Z25 A;  5E41 A;  3VET A;  3ZSQ A;  3RRH A;  2ZGZ A;  4FWL A;  4CJL A;  4BE1 A;  1VQ7 N;  4CD1 A;  4DS4 A;  1NMD A;  1FJG K;  5F2R A;  3EKS A;  1YIJ N;  2F9T A;  3CIP A;  3EE9 A;  1J6Z A;  3HYF A;  3ZEU B;  3VF6 A;  3UE5 A;  3T1A A;  3AGR A;  5J2P A;  4FJM A;  3S3N A;  4DTR A;  4M3W A;  1C0T A;  1NGC A;  4DU1 A;  2YKN A;  4JI7 K;  2DTU A;  4KTZ A;  4JI1 K;  3OJU A;  4CHY A;  1EX4 A;  4KFB A;  4DV5 K;  1Q81 O;  1G15 A;  4E7H A;  3HST B;  4IBN A;  2NRT A;  1TYQ B;  5SZT A;  4O55 A;  2W40 A;  4J2A A;  5AFU A;  3J7A P;  3SQ2 A;  1SQK A;  2E6L A;  2FSK A;  3SUP A;  3QIC A;  3BP8 A;  5KRT A;  2Z1I A;  4CZG A;  4GVM A;  4I9L A;  2QWL A;  4FZZ A;  3LDN A;  3L3U A;  4RTF D;  1K8K B;  1S1T A;  4FM1 A;  2EHG A;  3LAM A;  1BUP A;  3LL3 A;  4OPJ A;  1KAZ A;  1VSM A;  4DSE A;  4CE9 A;  5BN9 A;  5J2N A;  1NJX A;  2E2N A;  2YNH A;  1KTQ A;  1K73 O;  2X6S A;  5AQP A;  2Z1J A;  5BR9 A;  3CMA N;  1QZ6 A;  1D4X A;  1IBM K;  3UB5 A;  4B9S A;  1HR0 K;  4BRQ A;  2KZZ A;  1NJI O;  2YHW A;  1RTI A;  4MLH A;  5FRM A;  1DGK N;  4AHT A;  4KPY A;  3V4I A;  3CCU N;  3CFO A;  4W5N A;  2GTD A;  1B92 A;  5FRN A;  3LAN A;  1TK0 A;  1BCM A;  1ZYQ A;  2XY8 A;  5M1P A;  3ID6 A;  2ZGY A;  5CYQ A;  4K42 A;  2G8U A;  2HHV A;  3QEI A;  1RGI A;  4QAG A;  5AQO A;  3HPO A;  1NGH A;  4B1X B;  1FKP A;  4G1Q A;  4FLY A;  1NBW A;  4IEI A;  1D5A A;  3HK2 A;  2QWN A;  1IV0 A;  3KLG A;  2KFZ A;  4H5V A;  5ADX H;  1SUQ A;  4M7X A;  3OYJ A;  1JLG A;  2IVO A;  4BQZ A;  4MQ3 A;  4OKE A;  1Q82 O;  3ZSW A;  1MDU B;  4RW9 A;  2GEM A;  3R3L A;  1F21 A;  3ALY A;  4FPA A;  4NCA A;  3MMV A;  1BQM A;  1JXB A;  1IKX A;  4X62 K;  1HX1 A;  2QTD A;  4PQU A;  1KCF A;  5KGW A;  3S3O A;  4N5S A;  5AQZ A;  1ASU A;  2O8B B;  4FJI A;  5SWM A;  3B6P A;  1ZXO A;  4CES A;  2G8I A;  1BOT O;  1JL1 A;  4WE1 A;  3VN5 A;  4B8A B;  1NNE A;  1LWF A;  4KB1 A;  1DLO A;  1ASV A;  3E1Y A;  1CXQ A;  5DM7 L;  3AO3 A;  3C6A A;  3O80 A;  2P9U B;  2FBT A;  1MU2 A;  3HSC A;  4H5R A;  2OZS A;  1BDG A;  4CIG A;  2NRR A;  3V1R A;  3RVC A;  1Q7Y O;  4J2B A;  4UY8 O;  4FW1 A;  2FF3 B;  4CJE A;  4JK8 A;  3MN6 A;  3UKR B;  2G8V A;  1LW0 A;  3ZLJ A;  2FSN A;  2ATQ A;  4CHN A;  1QE1 A;  3ZSV A;  4DQI A;  3DI6 A;  3MXI A;  3D0P A;  4CFA A;  1QQN A;  4A62 A;  4CBX A;  3OHR A;  2ZE2 A;  3K9J A;  4B8C A;  4K43 A;  4DV7 K;  1VQ8 N;  3MEG A;  3FZM A;  2O8C B;  3CJC A;  3AA3 A;  1TKT A;  3PIP L;  4OPH A;  4FLT A;  3A2F A;  4ISG A;  4YNQ A;  3CYM A;  2WOM A;  2BTF A;  4CF8 A;  1HNI A;  3JS6 A;  3AY9 A;  4BGB A;  4FZX C;  4IOC L;  4KHN A;  2ZJR L;  2WBN A;  4IKF A;  1SKS A;  3HXM A;  1RT1 A;  4X64 K;  3C7N B;  4DSK A;  3PSF A;  3CC2 N;  4MLE A;  4DB3 A;  4BDY A;  3V81 A;  2VCP A;  2P9N B;  4YOW A;  4B9Q A;  4YDU C;  1GOC A;  4FWK A;  2QK9 A;  2QEX N;  3KZB A;  4FVM A;  4FJX A;  3EKU A;  2YJE A;  4DSF A;  3OJS A;  1W9H A;  1WB9 A;  3ZX2 A;  4JS5 A;  3ZT4 A;  4NO7 A;  4I6M B;  1QHT A;  1VQ4 N;  2J4R A;  5GIP A;  2WC9 A;  1WOQ A;  5BN8 A;  5BPM A;  1RT7 A;  2NLX A;  1YTU A;  3KWG A;  3DOK A;  4QOZ B;  2YNF A;  3MCA B;  1KQS M;  2XO7 A;  5CR4 A;  3CFR A;  3J7Y P;  3THX A;  4FJN A;  4F2S A;  1EP4 A;  1LAW A;  3VQ5 A;  4R79 A;  2PZS A;  2ZM6 K;  1WSH A;  5LMU K;  4CJK A;  4KH4 A;  4L3Q A;  4MDB A;  3LZJ A;  2XY5 A;  4CJV A;  1U6Z A;  3OYG A;  4IEE A;  4KKO A;  4DR7 K;  3DRP A;  3MEC A;  3G0Z A;  4OLB A;  5FRO A;  1WN7 A;  2W6K A;  5CE3 A;  1U4B A;  4NCG A;  4KHQ A;  3S9H A;  1BCO A;  4JKC A;  4LC9 B;  3GOI A;  5AZJ A;  1XMO K;  3IKM A;  5M1Q A;  2Z1H A;  4F3O A;  3K0S A;  3L2W A;  4NCB A;  3DRR A;  4XIU A;  1YI2 N;  3BZK A;  5C42 A;  4E7L A;  3CM6 A;  3ZT1 A;  1ZBI A;  3G71 N;  3THV A;  4BGA A;  4B3M K;  3I0S A;  3VEX A;  3HVT A;  1E3M A;  2H3G X;  3WQT A;  3CC7 N;  4WQ5 C;  3JYT A;  4PKH A;  4CJ7 A;  1D8Y A;  2WFB A;  1N6Q A;  3C6U A;  3ZSX A;  3P5J A;  2VWK A;  3DLB A;  4K8X A;  4HCC A;  3A0I X;  4BR9 A;  3KLH A;  4FLW A;  1NGA A;  1I3A A;  4F8R A;  3TI0 A;  3WNF A;  3A5O C;  4GMJ B;  3S3M A;  3IUC A;  3H45 C;  2PBD A;  3WNE A;  4JKG A;  1N34 K;  2P9S A;  1CLQ A;  3LWL A;  1TL3 A;  4KRE A;  4DV0 K;  3VQ6 A;  3MXM A;  3GL1 A;  4B9N A;  3AVC A;  1Z6R A;  2HOE A;  3E66 A;  4CGH A;  2VWJ A;  2Y1J A;  2O4G A;  4DQ8 A;  4A57 A;  2GWK A;  3AVN A;  3CQX A;  3OTO K;  1NJY A;  1OH6 A;  4AHR A;  2OPR A;  2YX6 A;  5FPD A;  2O8E B;  1DTQ A;  3R1X A;  2IOC A;  3SK3 A;  4BDZ A;  5C0Y A;  3RMC A;  1UA1 A;  3ID8 A;  4CZF A;  4CZL A;  3QDK A;  2AA4 A;  1T6D A;  2E4L A;  3BDP A;  4FK4 A;  4HTL A;  2W6L A;  2PYL A;  3DLE A;  4JK7 A;  5GIN A;  4QS9 A;  1KXP A;  4W5T A;  4BVO A;  4E0D A;  4F4K A;  2E20 A;  3NVM A;  5LL6 Z;  3FE1 A;  2CGK A;  3VQB A;  3P83 D;  4FM0 A;  1O13 A;  3P4I A;  3KVG A;  3H1Q A;  3CPW M;  2E8A A;  4J8F A;  5AQF A;  5LMN K;  4FVU A;  2V7Z A;  3I55 N;  3P38 A;  1UOC A;  4JV5 K;  5EXW A;  2GEL A;  2Q97 A;  2FXU A;  2R7Y A;  4BE0 A;  3ZX3 A;  2CH6 A;  1S22 A;  1H1V A;  5C12 A;  2O8D A;  3NAE A;  3SQ1 A;  1QS4 A;  4WF9 L;  3RSE A;  1ZBH A;  2UXB K;  3LZI A;  3NE6 A;  4W5O A;  2UUB K;  3SJJ A;  1QSL A;  1XNQ K;  1QQM A;  1NK6 A;  3QNO A;  3I33 A;  4C8O A;  1IBK K;  5AQJ A;  3THW A;  4GKJ K;  2E2O A;  3QFU A;  4NYN A;  2DFH A;  3ZT3 A;  4O0I A;  4Z4G A;  4YOT A;  3VF4 A;  4H5N A;  2CGJ A;  1YHQ N;  3KK7 A;  3TSU A;  2HF3 A;  5I9E B;  4ILJ A;  5E84 A;  3T69 A;  4AM6 A;  4IG3 A;  4YOY A;  2HMP A;  4DS5 A;  4LFA K;  1YVU A;  4LY7 A;  4KAZ A;  4FK2 A;  4DV4 K;  3UKU B;  4K41 A;  4DQR A;  3HI0 A;  3QEV A;  1TL1 A;  4FM2 A;  3K58 A;  4DV6 K;  1CXU A;  4LF7 K;  1ATN A;  2HBK A;  2ASO A;  3ZSO A;  4RW4 A;  1LWC A;  1BO5 O;  5C15 A;  3SAF A;  3W0L A;  3NFA A;  1WSI A;  5JS2 A;  1KFS A;  3AVF A;  4DKW A;  4B9U A;  4H4M A;  2E1Z A;  1KRP A;  1DKG D;  3AVL A;  3PX6 A;  4JKA A;  1S1W A;  5EVZ A;  5C10 A;  3CCL N;  1S3X A;  3HPH A;  3CER A;  3OYI A;  2Q1N A;  1Z26 A;  1BA0 A;  3TTF A;  3OS2 A;  2A3Z A;  2V51 B;  4DR3 K;  2D0P A;  4H0T B;  1C0G A;  1HPZ A;  3O9U A;  1KSP A;  4OGC A;  4H0O A;  3NGY A;  1U2V A;  2BAN A;  2HHH K;  1Y97 A;  5KPR A;  3FZL A;  3MEE A;  1HYS A;  3KIO A;  2NNW A;  1BQN A;  3CD6 N;  3O3F A;  3PSI A;  3EYZ A;  2NZT A;  4Y0W A;  2YHX A;  2A40 A;  2QKK A;  3Q7B A;  3VQE A;  2NRZ A;  4DTS A;  1VHX A;  1XMQ K;  4NB4 A;  4JS4 A;  4KTQ A;  1EQY A;  3QBX A;  3VEW A;  3L2V A;  3H46 O;  2ASM A;  4DQS A;  4BRC A;  4KI4 A;  3CCQ N;  4U7B A;  1U47 A;  2X74 A;  2HND A;  3KK2 A;  4DF8 A;  4ILG B;  2V7Y A;  3CQ8 A;  4NYF A;  4CF9 A;  3U4L A;  3CI5 A;  4DR4 K;  3FZK A;  2F7T A;  1J53 A;  4BAC A;  4CJR A;  3J81 O;  2HBL A;  5AQL A;  3VMF B;  3PLA A;  3CJA A;  4M3R A;  3V1Q A;  5MLC Q;  4ISF A;  4B3T K;  4W5R A;  4E7K A;  3CJ1 A;  3ZSR A;  2ZJQ L;  4A2A A;  4R5P A;  4LF6 K;  3PX0 A;  1VAZ A;  3OYH A;  1Z05 A;  4B1V A;  4YY3 K;  4M3Y A;  1TAU A;  4CFB A;  1S5J A;  4Z4E A;  4FWO A;  1OVQ A;  3SPZ A;  1BA1 A;  1XNR K;  3AGK A;  5FPN A;  1X3N A;  1LW2 A;  3ENO A;  3K9K A;  1HKC A;  2E5L K;  1NK7 A;  1C1B A;  1SL1 A;  1T3V A;  3O4W A;  5EX5 A;  4IFV A;  2VG5 A;  3NVK A;  1X9M A;  3DYA A;  2HHX A;  4CBW A;  5AQG A;  3MWP A;  3AAP A;  1RCH A;  4EZ9 A;  2PAV A;  2PFU A;  4EZ6 A;  4DV3 K;  4HUG A;  4Z4F A;  2WON A;  1X9J A;  3K59 A;  3SUQ A;  1IBL K;  4DQP A;  3B8A X;  3E01 A;  3TTD A;  4O8U A;  4E1J A;  4IFY A;  1A5V A;  4FO0 A;  3HP9 A;  1JLC A;  1QHA A;  5GAE P;  4FJ9 A;  4JI5 K;  1IKW A;  2OCE A;  4FWN A;  3THX B;  1U48 A;  4BR7 A;  1IH7 A;  3ZET B;  5GIO A;  4M3U A;  5JLF A;  2HBJ A;  3V1O A;  1HMV A;  4O0J A;  1KAX A;  5D3G A;  1GLL O;  4OKJ A;  4CZI A;  5AQX A;  3WXJ A;  4ID5 A;  3WXK A;  4BC5 A;  5LJV A;  3CCE N;  3HBT A;  2F4V K;  1WSJ A;  3QFP A;  3M6G A;  3U9D A;  1FKO A;  4OVL A;  5B8H A;  1WBD A;  2QXL A;  1QSS A;  1KAY A;  2OPP A;  4ZTF A;  2E2P A;  3LDQ A;  1RTH A;  4HVJ A;  4GVE A;  5C2F A;  4KHP K;  3ISN C;  4CBU A;  2A1S A;  2UYT A;  3WNH A;  3AVB A;  2CH5 A;  1VQ5 N;  1T7P A;  5HBM A;  3O3G A;  2GUI A;  2Q2R A;  3I8B A;  4ZHR A;  1GOA A;  5FPE A;  3J8A A;  4KHU A;  1BI4 B;  2VGN A;  3K57 A;  1BIS A;  4TSX A;  4RCH A;  3AVA A;  5H1S Q;  4HWI A;  5JLH A;  4YFU A;  3TWH A;  1XI1 A;  1NKC A;  2D0C A;  4CZJ A;  4F2R A;  5AQQ A;  2VQE K;  5KGX A;  2HHW A;  3OYB A;  4PL8 A;  5ADX A;  1RT4 A;  3MDQ A;  4QS7 A;  4RG8 A;  2JLE A;  1NMN A;  3EL2 A;  4PKG A;  3P31 A;  2HNZ A;  4NLC A;  4EAH D;  3S41 A;  2UUA K;  1EWR A;  2NRV A;  4JKG B;  3RWU A;  1VSH A;  4B3R K;  1TVR A;  4DF4 A;  4E7J A;  3QLH A;  4LD0 A;  3VOV A;  3CF5 L;  1J5O A;  4I2Q A;  2Q0R A;  3GBT A;  3L4Q A;  4CF1 A;  2OYQ A;  3SJH A;  2RF2 A;  4EIA A;  1IG9 A;  1W0H A;  4BR0 A;  1XHZ A;  3HVR A;  2DFF A;  4CHP A;  3PO4 A;  4DMN A;  1VQ9 N;  1QQO A;  1KC8 O;  3JSM A;  1T8E A;  3C0B A;  2GWJ A;  4GV9 A;  5GAG P;  3VEO A;  4WYB A;  3PX4 A;  1NM1 A;  3QEX A;  3QNN A;  1MA9 B;  5EOY A;  1HYZ A;  2KKZ A;  2O8F A;  4H0P A;  5BPN A;  4DSJ A;  4AHU A;  3HL8 A;  3C6H A;  1HPM A;  4H0X B;  4BWM A;  5AZI B;  3H3N O;  4CF0 A;  5AQV A;  3SV3 A;  3FZH A;  3AV9 A;  5M1N A;  1C0U A;  3B6O A;  3F9K A;  4GW6 A;  2P9I A;  3QER A;  3E9O A;  1OH5 A;  2XRI A;  2QI2 A;  4CIF A;  3EE8 A;  1Q9X A;  3VGM A;  2P9L B;  1K8A O;  3WEE A;  1XQS C;  1KD1 O;  3VQ7 A;  3SZ2 A;  1JXE A;  3ITH A;  4K0K K;  3OYE A;  3MWT A;  5IWA K;  4WQ4 C;  1YJ9 N;  3RMA A;  1RT2 A;  4JHD B;  1VQ6 N;  3M3Z A;  4JD2 B;  1SKR A;  4AIL C;  4CFC A;  2D5R A;  4BRG A;  3VQ8 A;  2V52 B;  1S6P A;  5CZ2 A;  1FK9 A;  4CGJ A;  1VSL A;  2Z1G A;  3VQ4 A;  1RDC A;  4BRL A;  4YOX A;  3HP6 A;  3N4P A;  1WAJ A;  3RMD A;  4FLV A;  3NF9 A;  3CCM N;  2I5J A;  2GBZ A;  2FBY A;  3DXK A;  4LH5 A;  3VQD A;  4CZM A;  2HW3 A;  5A2Q O;  4X66 K;  2YHA A;  4C8N A;  3TAE A;  1U49 A;  3IRX A;  1DTT A;  4JI3 K;  2I7P A;  2IGI A;  3CXC M;  4MO5 A;  3VTI A;  4XH4 A;  5C25 A;  1LCU A;  4IJN A;  2P9K B;  3KWI A;  3D2F A;  5ELZ A;  1LWE A;  4O8K A;  4PKI A;  3WQU A;  1J5E K;  3M8R A;  1BU6 O;  4LSN A;  3O6W A;  3NDK A;  1MWK A;  5EU7 A;  2KQ2 A;  3L0Q A;  4EFH A;  1IKY A;  3CJ9 A;  1U04 A;  5M1K A;  1U2V B;  1VSK A;  5KRS A;  3KHY A;  3HM8 A;  4JK9 A;  3TAM A;  1M90 O;  5AQN A;  2OA8 A;  3K5N A;  4CJU A;  3L8B A;  5GAD P;  3D2E B;  1EXQ A;  1GLC G;  2YI1 A;  3AAQ A;  3GDQ A;  3I0R A;  3DMJ A;  1BIZ A;  5M1O A;  1JL2 A;  4OO1 J;  2A1R A;  3QIN A;  3NF8 A;  1ZBF A;  4O4G A;  1GLE G;  4DTP A;  2HMI A;  4UQG A;  3TPQ A;  2P9P A;  4KO0 A;  4CHO A;  5AQM A;  4CEE A;  3RMB A;  4IWV A;  3L3V A;  3A8Y A;  1KFD A;  4LF9 K;  5KPZ A;  3QB0 A;  2QWM A;  4JAX A;  4BY9 C;  3I56 N;  1U45 A;  3VEZ A;  3Q7C A;  4B1Z A;  4KBO A;  4YOV A;  2I7N A;  5HP1 A;  1HNX K;  2QWP A;  3AA2 A;  3ZEU A;  2FSJ A;  2Q0U A;  2UXC K;  3ZT0 A;  3TAQ A;  3ULE B;  3O4N A;  1IG8 A;  4BR2 A;  4CK3 A;  3LP2 A;  1VRU A;  1N36 K;  3O8M A;  3E9L A;  2ZQB A;  1QVG M;  3LDO A;  3CPE A;  4O5B A;  5GAH P;  2P5G A;  4GV6 A;  3DXM B;  3VTH A;  2Y1I A;  4XEI A;  1UWB A;  5HRO A;  3TU5 A;  1ZBS A;  4FJ5 A;  1WSF A;  5AQS A;  1XC9 A;  5CZ1 A;  1TGO A;  3TAG A;  2RHK A;  1TYQ A;  1KVB A;  3WXI A;  4E7I A;  4HHT A;  4ELV A;  1RTD A;  1HKG A;  4CZE A;  4JN4 A;  3U8X A;  3OYL A;  3ATU A;  3V9Z A;  3T1Y K;  3A5L C;  1YIT N;  3CHW A;  4JI0 K;  2O4I A;  2W42 A;  5AJ3 K;  4KHW A;  3EN9 A;  4H8K A;  1S9E A;  2JGU A;  3D6R A;  3RR7 A;  3TAP A;  1NWK A;  1ITG A;  4CJ4 A;  5BR8 K;  1J54 A;  1K8K A;  2IC3 A;  1NGI A;  5AR0 A;  1OH7 A;  2ITM A;  3LDS A;  4GV3 A;  4H0V B;  5AQH A;  3T3F A;  4PA1 A;  1N8R O;  4IXC A;  3KK3 A;  4B9L A;  2F9W A;  4FJG A;  4FJK A;  3O4Q A;  5KQD A;  4M3Z A;  3O9R A;  3SCX A;  4IDH A;  3UIQ A;  1R59 O;  2B4J A;  4FLZ A;  4M63 C;  4CZH A;  3SV4 A;  2UUC K;  3IDH A;  1MWM A;  2A5X A;  4H5W A;  3U9Z A;  1RT5 A;  1NGG A;  1X3M A;  1KVA A;  5HRS A;  2D0A A;  1TKD A;  2HHS A;  3O3H A;  3F5T A;  1SV5 A;  4BC3 A;  3AO5 A;  2XY7 A;  3O5B A;  3D7E O;  2HVI A;  1YXQ A;  1L3T A;  2IDO A;  4CJQ A;  3OYC A;  5TKW A;  5TKY A;  4JKH A;  4EHT A;  2CGL A;  4OPA A;  3F2K A;  3L6Q A;  1ILY A;  2G8W A;  4BR5 A;  4IDK A;  3MN5 A;  4C23 A;  4Q5V A;  1NOZ A;  3WXM B;  4E1N A;  1T05 A;  3QIO A;  1GOB A;  3P1G A;  2EWS A;  3VQA A;  4GNI A;  4JRP A;  3C94 A;  4IG0 A;  3MN7 A;  4IJA A;  2BH1 A;  2P51 A;  1QSY A;  1LV5 A;  1D9F A;  1FW6 A;  2O8B A;  3SNN A;  1RBU A;  4FOE A;  4CEO A;  3IMX A;  1G99 A;  3D45 A;  1JLB A;  2OPS A;  1W2B M;  4KHS A;  4DFP A;  2P9U A;  3H1V X;  1OVY A;  4BVP A;  1I94 K;  4DTJ A;  3M1F A;  4WQ5 A;  3AVG A;  3NCI A;  4B9V A;  3UKR A;  1X1P A;  5LY3 A;  5AQY A;  3K2P A;  3NMU A;  1S9G A;  2O8F B;  1JLF A;  4JI8 K;  4C8K A;  1RBV A;  2DFE A;  4CER A;  3MX2 A;  4KI6 A;  4QS8 A;  4ICL A;  3EEQ A;  1JLE A;  1VQP N;  3SYZ A;  2KW4 A;  4DR1 K;  4DR6 K;  5DMR A;  3T7Z A;  1ESV A;  3TAB A;  2O8C A;  5FPM A;  3G10 A;  3TSQ A;  5F0X A;  2RN2 A;  3VA3 A;  4CJF A;  1ZBL A;  3VQQ A;  2HF4 A;  1L3V A;  3W3D A;  4LF8 K;  1VQK N;  3LPU A;  4DU4 A;  4QCL A;  3F9M A;  4ILH A;  3PO5 A;  3A5N C;  3O08 A;  2DPN A;  3C7N A;  1C0M A;  3DRS A;  3WEE B;  2P9N A;  1P8Z A;  4N76 A;  1ZBU A;  4AHC A;  4LSL A;  2ZF5 O;  4ID1 A;  1BGX T;  3AA4 A;  1RBS A;  1EWQ A;  3DM2 A;  4I6M A;  3DLL L;  5JS1 A;  4KRF A;  3HO1 A;  3HTV A;  3HM9 A;  2XHB A;  1ZC6 A;  2OAN A;  5HOO A;  1HKB A;  4FZY A;  2AJQ A;  5C2D A;  5KQ8 A;  1JLA A;  2IIR A;  4X65 K;  1VK0 A;  1LOT B;  1VQM N;  4PWD A;  4B1Y B;  1WBB A;  3ASM A;  2FF6 A;  2A41 A;  4F3T A;  3DXK B;  4PY5 A;  2UU9 K;  3SBG A;  5AQU A;  3LM2 A;  1XC3 A;  2YKM A;  4CF2 A;  3O1W A;  3KD1 E;  5BRD A;  3F73 A;  4DR2 K;  4A5B A;  1NK0 A;  1TV6 A; 
#chains in the Genus database with same CATH homology
 1IBL K;  5AJ3 K;  1J5E K;  2HHH K;  4NXM K;  5LL6 Z;  5BR8 K;  1HNZ K;  1I94 K;  4JI5 K;  4JI7 K;  3J7Y P;  4JI1 K;  4CW7 B;  4DV5 K;  4OX9 K;  2ZM6 K;  5LMU K;  4YHH K;  5LMN K;  4DV1 K;  3T1H K;  4X62 K;  4NXN K;  1HNW K;  4DR7 K;  4JV5 K;  4JI8 K;  3J7A P;  1XMQ K;  5IT9 O;  2F4V K;  4DR6 K;  4DR1 K;  4JI2 K;  2VQF K;  4DR5 K;  1XMO K;  2UXB K;  2UUC K;  4V19 S;  2UUB K;  1XNQ K;  4LF8 K;  4JYA K;  1IBK K;  4GKJ K;  4KHP K;  5FLX O;  4DR4 K;  2UXD K;  4B3M K;  4JI6 K;  4LF9 K;  4DUY K;  3J81 O;  4K0K K;  4DUZ K;  1N33 K;  5IWA K;  4B3T K;  4B3S K;  4JI4 K;  1IBM K;  1HNX K;  4DV7 K;  1HR0 K;  4LFA K;  4LFB K;  2UXC K;  4LF6 K;  4DV4 K;  2VQE K;  4AQY K;  1N36 K;  4YY3 K;  3J80 O;  4CVN E;  4DV2 K;  4DV6 K;  3JAM O;  4LF7 K;  1XNR K;  1N34 K;  2UUA K;  4X64 K;  4X65 K;  4DV0 K;  2E5L K;  4GKK K;  4B3R K;  4LFC K;  1N32 K;  1FJG K;  5A2Q O;  3OTO K;  4LF5 K;  4X66 K;  2UU9 K;  4JI3 K;  4LF4 K;  4DR2 K;  3T1Y K;  4DV3 K;  4DR3 K;  4JI0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...