3OTOK

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3otoK00
4DR4K 4JI6K 5IT9O 4DR6K 1XNQK 4X66K 5LMUK 4B3TK 4JI3K 5LL6Z 2VQEK 4LFCK 1XMOK 4DV2K 2VQFK 5IWAK 4JI1K 1N36K 1XNRK 4B3SK 3J7AP 4X64K 4LFAK 3J7YP 4GKJK 4X62K 2UXBK 2ZM6K 4JI7K 2HHHK 1I94K 2F4VK 2E5LK 4B3MK 5FLXO 4B3RK 4LFBK 5LMNK 1IBKK 4JI2K 4DV3K 4JI4K 1HNXK 4JI5K 1N32K 4DR3K 1XMQK 4JYAK 4DV4K 2UUBK 4X65K 4DUYK 4CVNE 4DR5K 4V19S 4DV0K 4AQYK 1N34K 4KHPK 2UXDK 4K0KK 4JV5K 4LF8K 4DR7K 1HNZK 1HR0K 4LF6K 4JI0K 4LF4K 1J5EK 2UUAK 4NXNK 1FJGK 1HNWK 4JI8K 4DV5K 4OX9K 4GKKK 4DR1K 3J81O 4CW7B 4DUZK 4DV7K 3T1YK 2UU9K 4YY3K 2UUCK 4YHHK 5BR8K 3T1HK 4LF7K 3OTOK 2UXCK 4DR2K 5AJ3K 1IBLK 3J80O 4DV1K 5A2QO 4LF5K 4LF9K 3JAMO 1IBMK 4DV6K 4NXMK 1N33K
chains in the Genus database with same CATH superfamily
2B5JA 1M90O 1X9MA 1MWKA 1Q8IA 1SL0A 3EYZA 1FXXA 2OPPA 2HNYA 2KLAA 4FVUA 3PUFA 3DM2A 4KB0A 4BGBA 5JLHA 1UOCA 1VRUA 2IC3A 2VWKA 2D0OA 1S9EA 1NGHA 1BI4B 2HMPA 4CJ3A 2GV9A 3WEEA 2JGUA 4DB3A 1YJWN 1KD1O 3KTQA 3BY5A 5AZJB 2F8SA 4ICLA 1RBUA 1F21A 2GWKA 3CQYA 3L2QA 3ZSOA 2ZE2A 1RT2A 4B9NA 3WEEB 3F9KA 4ILJA 1SUQA 2H3GX 1L3UA 4XH5A 1X9WA 1BCOA 1ILYA 3CCVN 3NGYA 5C42A 2IIRA 3VTHA 3HJFA 2X6SA 1NGDA 1NK7A 1CZAN 4JK9A 3C7NB 3IS9A 1GOAA 1WNSA 3CJ7A 1W2BM 1QVFM 1T44A 5AQTA 4H0YB 1RTHA 3WQUA 1BU6O 4C8NA 2P9UB 3WXJA 1QSLA 3I56N 4CFCA 3AVBA 5AQXA 4GV6A 3ATVA 4DV0K 3ZEUA 1N34K 4J8FA 3V9SA 3QETA 1J5OA 3B8AX 1BUPA 4DFMA 4CEQA 4WF9L 3MMVA 3QEWA 3ZCMA 3IUCA 1BL3A 1EQYA 4CF8A 3MWTA 2ASPA 1JLFA 2YNIA 4BE0A 4C1NK 4CD1A 5M1OA 3HO1A 1TKZA 4CW7B 3FZFA 3OBWA 4KI4A 2R7YA 1HYSA 1V4TA 3B6OA 4FWPA 3VQPA 3ENHA 2UXCK 3G0ZA 3VGMA 3NF7A 4FPAA 5E84A 1JLAA 1D5AA 3C65A 1YVNA 1HLUA 1TUUA 1Q9YA 1LOTB 4LF9K 2CGLA 3EO3A 1HYVA 3MCAB 3NGIA 2ITMA 4NXMK 3SQ0A 3MWPA 1X3NA 5EVZA 4FVMA 4DCHA 1KVAA 3THYA 1VQ9N 4F3OA 1QTMA 4WQ5C 3OYAA 3KLFA 1EKEA 1C0GA 4WQ4A 1KAZA 1KFDA 1MWMA 3HVTA 4JN4A 4KFBA 3HSCA 3HPGA 4Z4CA 2WTUA 5AR0A 1IKVA 4CF2A 1ZBIA 5CHIA 1VSEA 4E7HA 3C0BA 3M8QA 2YHAA 3QFPA 4FWQA 2UXBK 1IKWA 1KCFA 4CJ7A 4JHDA 3LDSA 1VSJA 4DSEA 4O8UA 4RW4A 4JAXA 4BRHA 4FJ7A 4J2EA 2O8FA 5LMNK 4XIUA 4DTUA 5C15A 3LM9A 4FLYA 3ENOA 3UKUA 3C94A 1HNXK 3A5LC 3VF4A 1SL1A 4BQZA 3R3LA 3AARA 3CMEN 3L3UA 1P8ZA 2YNFA 1K6YA 4CBWA 3KVGA 4CJSA 3SV4A 3WNGA 2OPSA 4M7XA 4KHUA 3H46O 3HXMA 3AO4A 1J5EK 4ID1A 2HB5A 4FWLA 4YOVA 2UUAK 2QKKA 3IKMA 2VWJA 1ITGA 3OYKA 4DTOA 3WXMB 3NDKA 3T7ZA 4FZZA 3NH1A 2VG5A 4YORA 2BTFA 3ATUA 1OH8A 1VQ8N 4QS7A 1Z05A 3ZSVA 4CEDA 1BIZA 3R8EA 1HKGA 1VQKN 1I39A 5DMRA 3ZLJA 1VSFA 4GV9A 1LWCA 3QB0A 1K8KB 1Z25A 2Q97A 3VMFB 3OYLA 4IDKA 3V9UA 4DSIA 1BWFO 4M7YA 4BRAA 3D7EO 4E19A 1NMNA 1HJOA 1DLOA 3V4IA 5BPMA 3EZ5A 4KB1A 3KJVA 1NLVA 2QKBA 1T6DA 4W5OA 4CEOA 1HPZA 5F2RA 3VEWA 4FXDA 4CK3A 2W6LA 5KQDA 1A5XA 4ELUA 3V1RA 3M3ZA 4FO0A 4Y1CA 3QICA 3VA3A 1VQ6N 4HTUA 3D2EB 4WFBL 3K59A 4E7KA 3HOTA 4FK0A 4FCYA 1G99A 1HNIA 4BDPA 2HW3A 2IDOA 4DQ8A 2P9IA 2NNWA 2XY8A 4O0JA 1RBTA 1HRHA 4X64K 4O0IA 4C8MA 3ZX0A 5JLFA 1JXBA 3J7YP 3ZT4A 1KAYA 4CBXA 4WFNL 4IOXA 1I94K 3AVAA 1EWRA 3RRGA 4B3MK 4JLHA 4FOEA 4KH6A 4YOUA 4WQ4C 4W5TA 4CJLA 5LJVA 4FWSA 1QVGM 1YUWA 2E6LA 5BREA 4JI5K 1HX1A 3CCRN 1LV5A 4FZYA 4GV3A 3LANA 5BN8A 1HUXA 3CJ9A 4EIAA 1UA0A 1XUPO 2D1KA 2FC0A 5BRFA 2UUBK 3UKRA 1EP4A 3WNEA 3UIQA 1M1KO 4CVNE 1L3TA 3MEEA 1VSKA 5HOOA 3WQTA 3ULDA 4FPBA 3TPQA 2CH5A 5KRSA 4FJ9A 3CG7A 3CYMA 2NRXA 5KGXA 4E7JA 4FLXA 2KW4A 1WBBA 4HWIA 2YHWA 3OA9A 3SQ4A 4KBOA 4NXNK 2ZGZA 1RT6A 5AQWA 2HBLA 3RMAA 1T6CA 4RCHA 5TKWA 4DUZK 1H1VA 2QM1A 3VQ8A 5J1EA 1O13A 4PL8A 2YHYA 2KZMA 3SUOA 4CF0A 3UE5A 3P38A 1A5WA 3DAWA 4DTMA 3P4IA 4B9VA 1ATNA 3NF6A 5BPNA 3ZT1A 3VEOA 5AJ3K 4Z4GA 3SZ2A 2VG7A 3V81A 2FBVA 2E1ZA 1K9MO 4GVMA 3IRXA 4CJFA 2YI1A 3O3HA 1T7PA 4E1MA 1T3VA 5KRTA 1N6QA 2PAVA 1N33K 3PIOL 3AAQA 1TAUA 4IFEA 4Q5VA 3IG1A 4A5AA 1LCUA 3P5JA 1C1BA 3TR8A 2P9PA 3EL2A 2NRVA 1DTQA 3KWIA 5AFUA 3VQ5A 3QIOA 1C0TA 4LFCK 5AZIB 2OZMA 2WC9A 4FJ5A 4Z4IA 4UY8O 3LDQA 4NCAA 3TAEA 1WB9A 4JI1K 4BC3A 3QEVA 1U4BA 1U49A 4C1NI 1LWEA 2JWKA 2V7ZA 3AO2A 1C0FA 2CGKA 3AVJA 1QE1A 1W0HA 2ETJA 2Q0RA 3G71N 1NGAA 4MO4A 3AV9A 1EX4A 1BG3A 2Y1JA 1NJIO 4J2BA 4F2RA 3HPOA 3I55N 1B9DA 2WFBA 2FBTA 3UKUB 3VQEA 4DKWA 4DG1A 4K41A 3VQQA 4CEZA 4JYAK 4QAGA 3VEXA 1D9FA 1XC3A 4F8RA 4N41A 5JICA 5AQYA 1NK4A 4QS9A 3CETA 3TSPA 1RDDA 2P9NA 3VEYA 5AQFA 4M45A 3VOVA 2E88A 2IVPA 1D4XA 3WUHA 4EHTA 3LL3A 1FJGK 3DLGA 2HNDA 3THVA 4FJIA 4W5QA 3ZX2A 1RTIA 2ZD1A 3O4WA 3ZT0A 4DTJA 5J2NA 1KAXA 2HBMA 3QEPA 1RDBA 4GMJB 4CIGA 4OPHA 4B1UB 2P5GA 2VWBA 2B6AA 1RDUA 4FM1A 1NJYA 4CJEA 4HUFA 3RTVA 4DSKA 2EWSA 4M3TA 3TAQA 1ZBLA 5HP1A 2ZJRL 3SUQA 4FK2A 4O5FA 2YCHA 3SQ2A 3MXJA 2Z1JA 1HMVA 3HP6A 2O8DA 3O5BA 4JEPA 4M3ZA 2A41A 1QZ6A 5LL6Z 4BRFA 4BRGA 4CK1A 3D2EA 5AQNA 5GIPA 1VQPN 2FXUA 1BO5O 3AA2A 3BZKA 5AQKA 4MLEA 1S72N 3AA5X 3MCPA 2O8CB 4FOIA 3WXKA 4ISGA 1YT3A 4OKEA 2I7PA 4G1QA 1BI4A 3L3VA 3O80A 4JKDA 4OVLA 3TTDA 1KC8O 3OYHA 3LAKA 4I2QA 3SMPA 2QXLA 3V9ZA 4H5TA 2KZZA 4CZMA 4E1NA 4C23A 1MA9B 3CPEA 1KLMA 4HUGA 3U3YA 2E2PA 4BR2A 4AILC 3AVHA 4HCCA 4IBNA 3AA3A 1G15A 4B3OA 1Q86O 3SYZA 1VHXA 4H0TB 5EY4A 3QBWA 3VGKA 1XC9A 3LWMA 4BRMA 1ZC6A 1TGOA 3SQ1A 4K25A 2NRTA 3ZX3A 4PKGA 2F9TA 3NGZA 2YNHA 2G8IA 3DXKB 2QWRA 4IXCA 2P9UA 5HRPA 1A5VA 1ZBFA 4JD2B 1KVBA 4FSVA 2ZWHA 3MAQA 4FJHA 4IEIA 3OYMA 3PO4A 2NRRA 3SPZA 4KV8A 4Z4HA 5BRHA 1Q82O 3GE1A 4NLBA 3O4QA 4CZKA 2HVIA 3PY8A 4YNQA 1WSIA 4CD3A 2HHVA 3I0RA 4BGAA 1E4FT 1UWBA 3VQDA 4FWOA 4ISEA 3O3GA 3I8DA 4PQUA 1DTTA 5FPNA 4DR4K 4H5RA 1KTQA 4CGFA 3ENBA 1OVYA 3ZSQA 1XNQK 4L3QA 2Q2RA 3DXMB 2G8FA 4R79A 3VQAA 5JMVA 2NUBA 3K5NA 3V9WA 2PZSA 1E4GT 1NGBA 2RN2A 2VQFK 4Z94A 2P9IB 2IVNA 3VENA 1NGJA 3NMUA 1JCGA 1ASVA 4RG8A 2O8BA 3LZIA 1NWKA 4YOXA 4IDHA 3EKUA 2GBZA 1HQUA 1JL1A 4JS4A 4DF8A 4N76A 4JRQA 3VQ7A 3SBTA 3SUNA 2A42A 1RFQA 2YKNA 1RCHA 4AHUA 1Z26A 2P9PB 4CZHA 3SBGA 1NBWA 3FGUA 4GVEA 1ASWA 3FR0A 3NFAA 3AO1A 3BZCA 3VESA 1XWLA 2P9SB 4KI6A 3E1YA 4BC4A 3LP1A 4BE2A 1WAFA 3GL1A 4M3YA 1SS6A 1RT5A 3CIPA 1ZBUA 3THXA 4KH4A 4CJTA 4NYFA 3VEZA 3R9PA 4JS5A 3CCEN 4IOCL 5AFUH 2DFEA 2QEXN 3T1AA 3PSIA 1O1WA 3CI5A 4HCBA 4F9OA 4CZLA 1UA1A 3HTVA 4O4GA 1QSYA 2P1JA 4B1YB 3V6DA 1VQ4N 1S1XA 1Y97A 5KQ8A 2GTDA 2J4RA 4DV7K 4RWTA 1BGXT 5GAGP 2V51B 5HL7L 5J2QA 1UAXA 3NF8A 3QMLA 5DK5A 5ELZA 1NK8A 1QHTA 3OS0A 1GLLO 1OVQA 4FLVA 4RW7A 1HJRA 2FBXA 4CJUA 4H0OA 1JLCA 4M3XA 1L3VA 5IT9O 3PX6A 2OTJN 1J54A 1TKTA 3FE1A 4FJNA 3F2KA 1BQMA 3HI0A 3UB5A 4DFKA 3MXMA 2JWLA 4BROA 3ZSZA 4IWVA 3OYDA 2QWNA 2A3ZA 3LP3A 2BGGA 3K58A 1MU2A 5AQQA 1QZ5A 4CGHA 3V1OA 2P9LA 3FFIA 2BANA 3PLAA 2O4GA 4B3SK 1TKDA 4N47A 1NMDA 4BDZA 4X62K 1E3MA 3P1GA 5EX5A 2YX6A 3O8MA 4EZ6A 1W7AA 2E5LK 3MEDA 4U7BA 3THWA 3NH2A 5CZ1A 4BR7A 2OTLN 5CR4A 2VYPA 5C25A 3K5LA 5I9EB 5TKYA 4I9QA 2HF3A 4BG8A 1YVUA 3H3NO 4CZJA 3W3DA 3VN5A 3K9KA 5E41A 3HL8A 1YXQA 2XHBA 1K8AO 3TU5A 3SAHA 4V19S 4IZ9A 5I42A 2E6MA 1Q81O 3OYCA 5BR9A 1NKCA 2LSNA 1EWQA 5BRDA 2B4JA 4NO7A 4H5NA 2G8WA 3QESA 4GKKK 3O9UA 3KK1A 1XQSC 3AO3A 3OHRA 1CZBA 4DQPA 1IO2A 3L4IA 4LH5A 3E01A 1WUAA 3DOKA 3VPZA 3MECA 4GY2B 4EFHA 4W5NA 4FJ8A 5A2QO 4CBUA 4ZHRA 3CM6A 3MN6A 4M63C 3RVCA 3NVMA 5C12A 2EHGA 1IBMK 1KVCA 3C6UA 3TAPA 4FJXA 3KHYA 3PV8A 1YITN 1NK9A 3CCUN 3DMJA 4PY5A 4AHRA 4KHSA 4ZTFA 1QQMA 5C2FA 4JKGB 5KI6A 1YTAA 4F2SA 3K0SA 2CH6A 5B8HA 1YJNN 4HVJA 4DLEA 4BRDA 3O4NA 4LSNA 3ZT3A 2VGMA 5GADP 2D5RA 3KLIA 3RR8A 4O44A 3J7AP 2HF4A 3VF2A 3DLEA 4KTWA 3GBTA 2IVOA 1VQNN 1SKSA 2FF6A 4CFDA 3TAFA 5SWMA 3ULEA 2QWMA 3U8XA 3LDPA 3IFRA 1U2VB 4RW6A 4FW2A 4KHQA 2W6KA 2Y1IA 2QI2A 5M1QA 1N32K 2D0AA 1XI1A 3KK7A 4DR3K 1GLDG 4E3SA 3TTFA 3U9DA 4DU3A 3W0LA 3CJCA 3OS1A 1C1AA 1NJXA 3S3MA 2Q0UA 5C10A 4YDUC 4AH9A 4K0KK 4CJ5A 3ZSWA 1NK6A 3DRRA 2P5OA 4EHUA 1YJ9N 5DM7L 3NHGA 4BRLA 3HPHA 4IO9L 2VGNA 4OJRA 4HHTA 2G8VA 2A1SA 3S3OA 4JK8A 2ITGA 1U47A 4J2DA 2E8AA 4B1XB 1NJZA 4DR1K 2OZSA 4DQIA 5F0XA 3PX4A 4E89A 3HZ6A 3HRGA 4CIFA 5JVGL 2NLXA 3T1HK 5AQPA 5FPMA 4CGGA 4M42A 2RKIA 4CJPA 4LSLA 2FSNA 4JHDB 3QLHA 3FFKB 5HLFA 4LF5K 2GWJA 4CJ4A 3JAMO 1YAGA 1TL3A 3QERA 2DPNA 3DI6A 1SKRA 4HTLA 1HQEA 1NGIA 4B9LA 3SCXA 1RBRA 4IFYA 3QEIA 2HHSA 1NKBA 4B9QA 5K14A 4CF9A 3QFUA 3C6AA 3M8RA 2G8KA 4DQSA 4WCEL 3I8BA 4Q0BA 1CZ9A 3VQ6A 1VK0A 3E9OA 3WXLA 4DSJA 3RWUA 1YF5L 1C6VA 4IG0A 4PKHA 3KWGA 4JKHA 3OBYA 3THYB 2ATQA 3A8YA 2O8EB 3E9LA 4M3WA 4KHYA 4GKJK 5AQRA 3U6FA 3QO9A 5CE3A 3WT0A 4JI7K 5H1SQ 4AM7A 2RPIA 3E9PA 4JKGA 3HYFA 4BWJA 3G25A 4IG3A 2G8UA 4BRKA 2D4WA 4B3RK 4ID5A 3CM5A 5MLCQ 1IBKK 4BVOA 3NH0A 2IAJA 3JSMA 4CHZA 3CFOA 2O4IA 4J2AA 3MN5A 3DLBA 5GAEP 4OPKA 1QSSA 3Q7BA 3L0QA 3KIOA 3AA4A 2EX3A 3DLKA 4JD2A 1VQ7N 3C95A 5AQGA 5GIOA 2PYLA 5C24A 1IG8A 3V9XA 2JLEA 2UXDK 4RTFD 4OKJA 4PHTX 5ADXA 1HNZK 4JRPA 3LP2A 3M5RA 3KK2A 1QQCA 2GEMA 4LF4K 1B9FA 2ZJPL 4A62A 1Z6RA 5FPDA 4F4KA 1FK9A 1HPMA 2QA4N 3OJSA 4B8AB 4BVPA 4JI8K 1TK8A 2P51A 4BWMA 4CK2A 4ILHA 3OS2A 4YHHK 3KLEA 1ATRA 4OPJA 1EETA 4K42A 3S3NA 1EO1A 3VETA 1IV0A 4KAZA 2HOEA 4A5BA 4DV1K 4OLBA 4OO1J 4KTQA 4YOTA 2DY4A 3F5TA 3QDKA 4WE1A 3TARA 3BF3A 3VERA 4A2AA 4O55A 2WUSA 1S6QA 3BGRA 1WSEA 2YJEA 4JK7A 4W5RA 5C2DA 1RTDA 1NU0A 3LWLA 3E66A 3VQ9A 3I0SA 3TSUA 3OY9A 4DFPA 3ZSYA 1JL2A 5IWAK 4CJVA 5FRNA 3DXMA 5KPZA 1SL2A 4C8LA 1VSDA 4OKKA 1W97L 4LY7A 3O08A 3K5MA 4B9TA 3ID6A 1EXQA 4DQQA 3G10A 1KSPA 1X9SA 4FK4A 3IDHA 1T8EA 3CXCM 4JI2K 1WSFA 3A0IX 3K57A 1SV5A 3T3FA 3K5OA 2XY6A 4CJKA 4ZTJA 2HBJA 4QOZB 3DYAA 3ITHA 4KTZA 5LY3A 2Q3SA 3OYJA 5CYQA 1LWFA 3L2UA 3BF1A 2OANA 1JLGA 1IG9A 1NK0A 4CGJA 4BREA 3PSFA 5GAHP 4BRIA 3M1FA 3J7ZO 3VTIA 2RF2A 4IJAA 5AQLA 1RNHA 4FZXC 2P9KA 4JNEA 3QIPA 3O3FA 1VQ5N 4RW9A 4R5PA 4MFBA 3CCJN 1TK5A 4ELTA 4DS5A 3VQ4A 2UUCK 1SKWA 1LAVA 4LD0A 3HSTB 5M1KA 3TWHA 4M41A 1QQNA 2QTDA 3M8SA 1D8YA 4BC2A 1WSHA 3AAPA 4FM2A 4DV6K 3CD6N 2HHTA 1HKCA 3LPUA 4FWRA 3CPWM 2QXFA 4H8KA 5JS1A 4ILGB 4IKFA 1QS4A 5AZJA 4FL9A 2XY7A 2GX9A 1VSLA 4B9SA 1DGKN 4AHTA 3MN9A 4KO0A 2VQEK 3AVLA 4Z4EA 3AVMA 5M1NA 4PWDA 3VEVA 4DHYA 1XMOK 1VQLN 1N36K 3EZWA 4CEFA 3AGRA 2ASOA 1CXQA 4FYDA 3KD1E 4Y0WA 3SAGA 4LFAK 3HOSA 1WAJA 3SUPA 4IJNA 1X3MA 3AVGA 4FLZA 4DTPA 4MQ3A 2E1YA 4PL7A 1JLQA 3RMBA 2DTUA 3TANA 4JI4K 3L2RA 1C0MA 3DLRA 1XMQK 1NK5A 3THWB 4O8KA 1S1TA 4BE1A 3QNNA 3VA0A 3QBXA 2V7YA 4ISFA 3EY1A 3FZLA 3ZSRA 4IFVA 2NRHA 4FWKA 4ELVA 3GOIA 4E7LA 4AM6A 2XRIA 3DRSA 1LW2A 4H4OA 4L8RB 3EN9A 4OLAA 3FLCO 5HROA 4FM0A 3J81O 5I3UA 2X6NA 2IGIA 4JKCA 4AHSA 4YY3K 3D6RA 4OGEA 2O8CA 1CLQA 4LF7K 3WNFA 1VSHA 2OPRA 2YJFA 2PY5A 4NCBA 1WOQA 3P83D 1NGGA 1JKHA 3THXB 3OYFA 3DJCA 4I6MB 3AGKA 4H5VA 3CCMN 2V52B 3QEXA 3Q7CA 1GLBG 1Q18A 3AVNA 4XH4A 1Q9XA 1K8KA 2GUIA 4IO8A 1DEJA 1NG9A 4RW8A 3LDLA 4KH5A 3OYBA 2ZJQL 4DR6K 2FF3B 3ZETA 4LC9B 2ASMA 4IOAL 4BACA 2I7NA 1GLFO 2A6AA 4MDAA 5AQSA 1R0AA 3M8PA 1IJJA 1RBVA 3L6QA 4NLCA 1ESVA 3HM9A 1K73O 2OA8A 3U3GA 5FRMA 5KTQA 3AVCA 2G8HA 3CJAA 5CYMA 1BIUA 1S5JA 1YTUA 5ADXH 2WBNA 1HNVA 2FBYA 4FWMA 4K43A 3FZKA 5J2PA 1J53A 1NJWA 3S9HA 2ZM6K 4KREA 5HBMA 3IAYA 4CHNA 1SQKA 2W40A 2WONA 1VSIA 4FLTA 3EKSA 4Z4FA 1SAZA 3ID8A 2YHBA 1ZXOA 5DM6L 3D0PA 2XY5A 5KPTA 1W9HA 2XO7A 4B9MA 3OYNA 1GLEG 4CZFA 1J6ZA 3EE9A 5SZTA 4WFAL 3CFRA 1OH5A 4DV4K 1BISA 1NOYA 4BQLA 3HK2A 4CFBA 3BUZB 3ISNC 1RT4A 4H0PA 4N56A 4GNIA 4KHPK 1LW0A 4K8ZA 4EP5A 3O1BA 2Q31A 4CEEA 5AQIA 4DF4A 4DS4A 2RE2A 2BUPA 3CJ1A 4JKEA 4BRCA 3QINA 3WXIA 3LM2A 3BDPA 5BPLA 4AHCA 2UU9K 4U67L 3TABA 3CF5L 1OKJA 3NF9A 2PBDA 4YDUA 1QQOA 4BDYA 4BR0A 3MXIA 4IEEA 1RT1A 1S1UA 1C1CA 3CQXA 1BA0A 3IMXA 2HMIA 4EP4A 3K9JA 1V4SA 2HVHA 5EU7A 3H08A 3MDQA 3ZETB 1FKOA 1JLEA 1IH7A 2QW9A 1NOZA 4BY9C 3ULEB 1LAWA 1RDWX 3AVFA 4B3TK 4CHOA 2VG6A 1B92A 3SJHA 3O1WA 5D3GA 1ZBSA 5E26A 3OVNA 4CFAA 4H0XB 4KKOA 2BDPA 1RILA 1HYZA 1RDAA 3HVRA 1VRTA 4CZIA 2KFZA 2E20A 4CESA 2F8TA 3OYIA 4NCGA 3TI0A 2F4VK 1I3AA 4WYBA 3PO5A 3SLCA 2QWOA 5AQUA 1TYQB 4FWNA 4CHQA 1NGCA 3C7NA 3A2FA 1JXEA 3PIPL 4DU4A 3LDOA 3NE6A 1ASUA 3CFPA 3CCSN 3TSQA 4BR5A 1KXPA 5JS2A 3TAMA 1MDUB 3UKRB 2HBKA 1RTJA 2DFHA 1S1WA 3OW2M 1TAQA 5GINA 2D0PA 4DR5K 4QS8A 4KRFA 5J2MA 2KTQA 4HUEA 3SPYA 3CC4N 4JKFA 5F1XA 4LF8K 1D9DA 3C6TA 3HT3A 1HR0K 4LF6K 2ZQBA 3SNNA 2VCPA 3MX2A 1RBSA 2RHKA 1REVA 3BEXA 1HNWK 3ZT2A 5M1PA 2A5XA 2NZTA 1NM1A 1S9GA 3AVIA 4F3TA 5C0YA 1NGFA 1WSGA 5JVHL 5BR8K 2AP1A 5M1FA 3CMAN 2PYJA 2GELA 1TYQA 2OYQA 1WSJA 4B1ZA 1IBLK 4BR9A 1S3XA 3MK6A 3HM8A 2FSKA 4G9ZA 3NVKA 1GOCA 2IS3A 3N4PA 4A2BA 4A57A 2O8EA 4BR4A 1NNEA 1U45A 5AQZA 3I33A 3CJBA 4CCHA 4JKAA 2F96A 2QWQA 2QWPA 5KPRA 5KGWA 5FDLA 3K2PA 4C8OA 1RGIA 3LP0A 4DSLA 1YIJN 3AVKA 4UQGA 3L2WA 4H03B 1CXUA 3H45C 3CC7N 2YNGA 3H3OB 4WQ5A 3KKRA 1DT9A 4DV2K 4YOWA 1L5UA 3KLHA 1GLJO 4FLWA 1ZYQA 2HHWA 1R59O 3S41A 3L4QA 4FJKA 1WBDA 1N5YA 3KK3A 4I2PA 5AZIA 4CIEA 1RT3A 3T69A 5HRNA 4KHNA 2BE2A 3A5NC 4LFBK 3MEGA 4N5SA 1IKXA 4DV3K 3JXUA 4BC5A 3O9SA 3SJJA 4B9UA 3CERA 1L3SA 4XEIA 4NYNA 3MX5A 1BCMA 5AQMA 1U2VA 2OPQA 1XHXA 4AF1A 3G4SN 3OJUA 4DLGA 1TUYA 4CECA 4X65K 4DUYK 4C8KA 3U4LA 4DTSA 3EEQA 4I9LA 4AQYK 2E2QA 2DFFA 1U6ZA 4DTRA 3ZSXA 4YFUA 2AJQA 1OH6A 5AQJA 3H6EA 3F73A 1TV6A 2P9KB 2PFUA 3SK3A 3LPTA 4DV5K 3O9TA 3B6PA 3O9QA 4I7FA 5CY4A 1S1VA 3HBTA 4EZ9A 5EXWA 1T03A 1ZBHA 2GUPA 2Z1GA 3ZYYX 5FPEA 4NB4A 4BRPA 4DR2K 4FJMA 1RDCA 3J80O 4K8XA 4DU1A 2Q36A 2A1RA 4DMNA 3CC2N 4M3UA 2HNZA 1SZ2A 4CHYA 3NBPA 4DQRA 1XHZA 1N8RO 1TVRA 3F9MA 4OPAA 3RSEA 4AHVA 2YKMA 4JI3K 2HHQA 3H1VX 4B8CA 5EOYA 3KZBA 4H0VB 1VQMN 3RR7A 3P39A 2E4LA 2F9WA 3BP8A 2X78A 1DKGD 4CZGA 1X1PA 1XNRK 2O8BB 3V1QA 3GG4A 4H4MA 3VF6A 4JKBA 3T19A 4E0DA 4H5WA 4Z0UA 2WOMA 3R6MA 1J9AA 2HHHK 1BHLA 4DTXA 1GLCG 3RSEB 3DXKA 4OGCA 4PKIA 1NKEA 4FLUA 4M3RA 3JYTA 5HRSA 3RMCA 3SMSA 3ALYA 4Y1DA 1BDGA 4BRQA 1U48A 5HRRA 1VQON 5AQOA 4A61A 4MO5A 3L2VA 4DFJA 4CJWA 2P9SA 4CJQA 1BOTO 3AY9A 2P9LB 4KHWA 2QK9A 4E7IA 1TKXA 3RMDA 2HHUA 4CGDA 4DWIA 5AQHA 5T7BA 3MN7A 4OX9K 3J8AA 3KKSA 4CGIA 1JJ2M 3T1YK 4E1JA 4MDBA 2KQ2A 3QNOA 3TTCA 3P31A 1RT7A 3OTOK 3DLLL 3FZMA 4PUOA 2D0BA 4CEAA 5LJWA 4BRNA 3A5OC 3NCIA 1YHQN 1NGEA 2AA4A 2A40A 3TAGA 1GLAG 2D0CA 4I6MA 1KFSA 3VQBA 1KLNA 3SAFA 2O8DB 2UYTA 1JLBA 3AO5A 4JI6K 2X74A 2Z1HA 2Z1IA 4X66K 2YHXA 3R1XA 3PX0A 4BG9A 3CHWA 1ATSA 5LMUK 4B1WB 4DSFA 3D2FA 4FW1A 2CGJA 2E2OA 5AQVA 1BA1A 3OYEA 3JS6A 2W42A 3LAMA 2QWLA 1T05A 3D2FB 4FJLA 4MLHA 3L8BA 3RRHA 3EE8A 5FROA 3GDQA 3M6GA 3WNHA 4FJGA 4CHPA 4CI6A 2F7TA 4CERA 4FJJA 5BN9A 1TK0A 3DWLA 4B08A 2ZGYA 5CZ2A 3FZHA 5FLXO 1C0UA 4DTNA 2HHXA 4QCLA 2I5JA 3LDNA 4B1VA 1YI2N 2KKZA 1S6PA 1GOBA 3CCQN 4KPYA 2P9NB 2NRZA 1BQNA 1TL1A 1VSMA 1FW6A 3O9RA 2O8FB 2KFNA 1P90A 4O5BA 1QHAA 3VGLA 4A59A 3LALA 2YV0X 1X9JA 3A5MC 4CE9A 3DRPA 3CCLN 3SI6A 2E2NA 1Q7YO 3KD5E 3LZJA 1JCFA 1FKPA 1KQSM 4CF1A 4JV5K 3D45A 3CQ8A 1S22A 3H1QA 4DR7K 3G6EN 4JI0K 3ASMA 4TSXA 4CEBA 2HSTA 3O6WA 4PA1A 4YOYA 2KHOA 1WN7A 1Y64A 2NRWA 4XH1A 1IKYA 3NAEA 3C6HA 3OYGA 4CZEA 2Q1NA 1U04A 2W41A 2FSJA 2ZF5O 3DLHA 3SV3A 2OCEA 3ZEUB 2BH1A 4GW6A 4EAHD 4CJRA 3N4QA 4LH4A 1KRPA 1JCEA 3DOLA 3HP9A 2IOCA 1VAZA 3KLGA 1HKBA 2FLOA 1OH7A 3VQCA 1WLJA 3U9ZA
chains in the Genus database with same CATH topology
4DR4K 4JI6K 5IT9O 4DR6K 1XNQK 4X66K 5LMUK 4B3TK 4JI3K 5LL6Z 2VQEK 4LFCK 1XMOK 4DV2K 2VQFK 5IWAK 4JI1K 1N36K 1XNRK 4B3SK 3J7AP 4X64K 4LFAK 3J7YP 4GKJK 4X62K 2UXBK 2ZM6K 4JI7K 2HHHK 1I94K 2F4VK 2E5LK 4B3MK 5FLXO 4B3RK 4LFBK 5LMNK 1IBKK 4JI2K 4DV3K 4JI4K 1HNXK 4JI5K 1N32K 4DR3K 1XMQK 4JYAK 4DV4K 2UUBK 4X65K 4DUYK 4CVNE 4DR5K 4V19S 4DV0K 4AQYK 1N34K 4KHPK 2UXDK 4K0KK 4JV5K 4LF8K 4DR7K 1HNZK 1HR0K 4LF6K 4JI0K 4LF4K 1J5EK 2UUAK 4NXNK 1FJGK 1HNWK 4JI8K 4DV5K 4OX9K 4GKKK 4DR1K 3J81O 4CW7B 4DUZK 4DV7K 3T1YK 2UU9K 4YY3K 2UUCK 4YHHK 5BR8K 3T1HK 4LF7K 3OTOK 2UXCK 4DR2K 5AJ3K 1IBLK 3J80O 4DV1K 5A2QO 4LF5K 4LF9K 3JAMO 1IBMK 4DV6K 4NXMK 1N33K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 K;  4JI6 K;  5IT9 O;  4DR6 K;  1XNQ K;  4X66 K;  5LMU K;  4B3T K;  4JI3 K;  5LL6 Z;  2VQE K;  4LFC K;  1XMO K;  4DV2 K;  2VQF K;  5IWA K;  4JI1 K;  1N36 K;  1XNR K;  4B3S K;  3J7A P;  4X64 K;  4LFA K;  3J7Y P;  4GKJ K;  4X62 K;  2UXB K;  2ZM6 K;  4JI7 K;  2HHH K;  1I94 K;  2F4V K;  2E5L K;  4B3M K;  5FLX O;  4B3R K;  4LFB K;  5LMN K;  1IBK K;  4JI2 K;  4DV3 K;  4JI4 K;  1HNX K;  4JI5 K;  1N32 K;  4DR3 K;  1XMQ K;  4JYA K;  4DV4 K;  2UUB K;  4X65 K;  4DUY K;  4CVN E;  4DR5 K;  4V19 S;  4DV0 K;  4AQY K;  1N34 K;  4KHP K;  2UXD K;  4K0K K;  4JV5 K;  4LF8 K;  4DR7 K;  1HNZ K;  1HR0 K;  4LF6 K;  4JI0 K;  4LF4 K;  1J5E K;  2UUA K;  4NXN K;  1FJG K;  1HNW K;  4JI8 K;  4DV5 K;  4OX9 K;  4GKK K;  4DR1 K;  3J81 O;  4CW7 B;  4DUZ K;  4DV7 K;  3T1Y K;  2UU9 K;  4YY3 K;  2UUC K;  4YHH K;  5BR8 K;  3T1H K;  4LF7 K;  3OTO K;  2UXC K;  4DR2 K;  5AJ3 K;  1IBL K;  3J80 O;  4DV1 K;  5A2Q O;  4LF5 K;  4LF9 K;  3JAM O;  1IBM K;  4DV6 K;  4NXM K;  1N33 K; 
#chains in the Genus database with same CATH topology
 2B5J A;  1M90 O;  1X9M A;  1MWK A;  1Q8I A;  1SL0 A;  3EYZ A;  1FXX A;  2OPP A;  2HNY A;  2KLA A;  4FVU A;  3PUF A;  3DM2 A;  4KB0 A;  4BGB A;  5JLH A;  1UOC A;  1VRU A;  2IC3 A;  2VWK A;  2D0O A;  1S9E A;  1NGH A;  1BI4 B;  2HMP A;  4CJ3 A;  2GV9 A;  3WEE A;  2JGU A;  4DB3 A;  1YJW N;  1KD1 O;  3KTQ A;  3BY5 A;  5AZJ B;  2F8S A;  4ICL A;  1RBU A;  1F21 A;  2GWK A;  3CQY A;  3L2Q A;  3ZSO A;  2ZE2 A;  1RT2 A;  4B9N A;  3WEE B;  3F9K A;  4ILJ A;  1SUQ A;  2H3G X;  1L3U A;  4XH5 A;  1X9W A;  1BCO A;  1ILY A;  3CCV N;  3NGY A;  5C42 A;  2IIR A;  3VTH A;  3HJF A;  2X6S A;  1NGD A;  1NK7 A;  1CZA N;  4JK9 A;  3C7N B;  3IS9 A;  1GOA A;  1WNS A;  3CJ7 A;  1W2B M;  1QVF M;  1T44 A;  5AQT A;  4H0Y B;  1RTH A;  3WQU A;  1BU6 O;  4C8N A;  2P9U B;  3WXJ A;  1QSL A;  3I56 N;  4CFC A;  3AVB A;  5AQX A;  4GV6 A;  3ATV A;  4DV0 K;  3ZEU A;  1N34 K;  4J8F A;  3V9S A;  3QET A;  1J5O A;  3B8A X;  1BUP A;  4DFM A;  4CEQ A;  4WF9 L;  3MMV A;  3QEW A;  3ZCM A;  3IUC A;  1BL3 A;  1EQY A;  4CF8 A;  3MWT A;  2ASP A;  1JLF A;  2YNI A;  4BE0 A;  4C1N K;  4CD1 A;  5M1O A;  3HO1 A;  1TKZ A;  4CW7 B;  3FZF A;  3OBW A;  4KI4 A;  2R7Y A;  1HYS A;  1V4T A;  3B6O A;  4FWP A;  3VQP A;  3ENH A;  2UXC K;  3G0Z A;  3VGM A;  3NF7 A;  4FPA A;  5E84 A;  1JLA A;  1D5A A;  3C65 A;  1YVN A;  1HLU A;  1TUU A;  1Q9Y A;  1LOT B;  4LF9 K;  2CGL A;  3EO3 A;  1HYV A;  3MCA B;  3NGI A;  2ITM A;  4NXM K;  3SQ0 A;  3MWP A;  1X3N A;  5EVZ A;  4FVM A;  4DCH A;  1KVA A;  3THY A;  1VQ9 N;  4F3O A;  1QTM A;  4WQ5 C;  3OYA A;  3KLF A;  1EKE A;  1C0G A;  4WQ4 A;  1KAZ A;  1KFD A;  1MWM A;  3HVT A;  4JN4 A;  4KFB A;  3HSC A;  3HPG A;  4Z4C A;  2WTU A;  5AR0 A;  1IKV A;  4CF2 A;  1ZBI A;  5CHI A;  1VSE A;  4E7H A;  3C0B A;  3M8Q A;  2YHA A;  3QFP A;  4FWQ A;  2UXB K;  1IKW A;  1KCF A;  4CJ7 A;  4JHD A;  3LDS A;  1VSJ A;  4DSE A;  4O8U A;  4RW4 A;  4JAX A;  4BRH A;  4FJ7 A;  4J2E A;  2O8F A;  5LMN K;  4XIU A;  4DTU A;  5C15 A;  3LM9 A;  4FLY A;  3ENO A;  3UKU A;  3C94 A;  1HNX K;  3A5L C;  3VF4 A;  1SL1 A;  4BQZ A;  3R3L A;  3AAR A;  3CME N;  3L3U A;  1P8Z A;  2YNF A;  1K6Y A;  4CBW A;  3KVG A;  4CJS A;  3SV4 A;  3WNG A;  2OPS A;  4M7X A;  4KHU A;  3H46 O;  3HXM A;  3AO4 A;  1J5E K;  4ID1 A;  2HB5 A;  4FWL A;  4YOV A;  2UUA K;  2QKK A;  3IKM A;  2VWJ A;  1ITG A;  3OYK A;  4DTO A;  3WXM B;  3NDK A;  3T7Z A;  4FZZ A;  3NH1 A;  2VG5 A;  4YOR A;  2BTF A;  3ATU A;  1OH8 A;  1VQ8 N;  4QS7 A;  1Z05 A;  3ZSV A;  4CED A;  1BIZ A;  3R8E A;  1HKG A;  1VQK N;  1I39 A;  5DMR A;  3ZLJ A;  1VSF A;  4GV9 A;  1LWC A;  3QB0 A;  1K8K B;  1Z25 A;  2Q97 A;  3VMF B;  3OYL A;  4IDK A;  3V9U A;  4DSI A;  1BWF O;  4M7Y A;  4BRA A;  3D7E O;  4E19 A;  1NMN A;  1HJO A;  1DLO A;  3V4I A;  5BPM A;  3EZ5 A;  4KB1 A;  3KJV A;  1NLV A;  2QKB A;  1T6D A;  4W5O A;  4CEO A;  1HPZ A;  5F2R A;  3VEW A;  4FXD A;  4CK3 A;  2W6L A;  5KQD A;  1A5X A;  4ELU A;  3V1R A;  3M3Z A;  4FO0 A;  4Y1C A;  3QIC A;  3VA3 A;  1VQ6 N;  4HTU A;  3D2E B;  4WFB L;  3K59 A;  4E7K A;  3HOT A;  4FK0 A;  4FCY A;  1G99 A;  1HNI A;  4BDP A;  2HW3 A;  2IDO A;  4DQ8 A;  2P9I A;  2NNW A;  2XY8 A;  4O0J A;  1RBT A;  1HRH A;  4X64 K;  4O0I A;  4C8M A;  3ZX0 A;  5JLF A;  1JXB A;  3J7Y P;  3ZT4 A;  1KAY A;  4CBX A;  4WFN L;  4IOX A;  1I94 K;  3AVA A;  1EWR A;  3RRG A;  4B3M K;  4JLH A;  4FOE A;  4KH6 A;  4YOU A;  4WQ4 C;  4W5T A;  4CJL A;  5LJV A;  4FWS A;  1QVG M;  1YUW A;  2E6L A;  5BRE A;  4JI5 K;  1HX1 A;  3CCR N;  1LV5 A;  4FZY A;  4GV3 A;  3LAN A;  5BN8 A;  1HUX A;  3CJ9 A;  4EIA A;  1UA0 A;  1XUP O;  2D1K A;  2FC0 A;  5BRF A;  2UUB K;  3UKR A;  1EP4 A;  3WNE A;  3UIQ A;  1M1K O;  4CVN E;  1L3T A;  3MEE A;  1VSK A;  5HOO A;  3WQT A;  3ULD A;  4FPB A;  3TPQ A;  2CH5 A;  5KRS A;  4FJ9 A;  3CG7 A;  3CYM A;  2NRX A;  5KGX A;  4E7J A;  4FLX A;  2KW4 A;  1WBB A;  4HWI A;  2YHW A;  3OA9 A;  3SQ4 A;  4KBO A;  4NXN K;  2ZGZ A;  1RT6 A;  5AQW A;  2HBL A;  3RMA A;  1T6C A;  4RCH A;  5TKW A;  4DUZ K;  1H1V A;  2QM1 A;  3VQ8 A;  5J1E A;  1O13 A;  4PL8 A;  2YHY A;  2KZM A;  3SUO A;  4CF0 A;  3UE5 A;  3P38 A;  1A5W A;  3DAW A;  4DTM A;  3P4I A;  4B9V A;  1ATN A;  3NF6 A;  5BPN A;  3ZT1 A;  3VEO A;  5AJ3 K;  4Z4G A;  3SZ2 A;  2VG7 A;  3V81 A;  2FBV A;  2E1Z A;  1K9M O;  4GVM A;  3IRX A;  4CJF A;  2YI1 A;  3O3H A;  1T7P A;  4E1M A;  1T3V A;  5KRT A;  1N6Q A;  2PAV A;  1N33 K;  3PIO L;  3AAQ A;  1TAU A;  4IFE A;  4Q5V A;  3IG1 A;  4A5A A;  1LCU A;  3P5J A;  1C1B A;  3TR8 A;  2P9P A;  3EL2 A;  2NRV A;  1DTQ A;  3KWI A;  5AFU A;  3VQ5 A;  3QIO A;  1C0T A;  4LFC K;  5AZI B;  2OZM A;  2WC9 A;  4FJ5 A;  4Z4I A;  4UY8 O;  3LDQ A;  4NCA A;  3TAE A;  1WB9 A;  4JI1 K;  4BC3 A;  3QEV A;  1U4B A;  1U49 A;  4C1N I;  1LWE A;  2JWK A;  2V7Z A;  3AO2 A;  1C0F A;  2CGK A;  3AVJ A;  1QE1 A;  1W0H A;  2ETJ A;  2Q0R A;  3G71 N;  1NGA A;  4MO4 A;  3AV9 A;  1EX4 A;  1BG3 A;  2Y1J A;  1NJI O;  4J2B A;  4F2R A;  3HPO A;  3I55 N;  1B9D A;  2WFB A;  2FBT A;  3UKU B;  3VQE A;  4DKW A;  4DG1 A;  4K41 A;  3VQQ A;  4CEZ A;  4JYA K;  4QAG A;  3VEX A;  1D9F A;  1XC3 A;  4F8R A;  4N41 A;  5JIC A;  5AQY A;  1NK4 A;  4QS9 A;  3CET A;  3TSP A;  1RDD A;  2P9N A;  3VEY A;  5AQF A;  4M45 A;  3VOV A;  2E88 A;  2IVP A;  1D4X A;  3WUH A;  4EHT A;  3LL3 A;  1FJG K;  3DLG A;  2HND A;  3THV A;  4FJI A;  4W5Q A;  3ZX2 A;  1RTI A;  2ZD1 A;  3O4W A;  3ZT0 A;  4DTJ A;  5J2N A;  1KAX A;  2HBM A;  3QEP A;  1RDB A;  4GMJ B;  4CIG A;  4OPH A;  4B1U B;  2P5G A;  2VWB A;  2B6A A;  1RDU A;  4FM1 A;  1NJY A;  4CJE A;  4HUF A;  3RTV A;  4DSK A;  2EWS A;  4M3T A;  3TAQ A;  1ZBL A;  5HP1 A;  2ZJR L;  3SUQ A;  4FK2 A;  4O5F A;  2YCH A;  3SQ2 A;  3MXJ A;  2Z1J A;  1HMV A;  3HP6 A;  2O8D A;  3O5B A;  4JEP A;  4M3Z A;  2A41 A;  1QZ6 A;  5LL6 Z;  4BRF A;  4BRG A;  4CK1 A;  3D2E A;  5AQN A;  5GIP A;  1VQP N;  2FXU A;  1BO5 O;  3AA2 A;  3BZK A;  5AQK A;  4MLE A;  1S72 N;  3AA5 X;  3MCP A;  2O8C B;  4FOI A;  3WXK A;  4ISG A;  1YT3 A;  4OKE A;  2I7P A;  4G1Q A;  1BI4 A;  3L3V A;  3O80 A;  4JKD A;  4OVL A;  3TTD A;  1KC8 O;  3OYH A;  3LAK A;  4I2Q A;  3SMP A;  2QXL A;  3V9Z A;  4H5T A;  2KZZ A;  4CZM A;  4E1N A;  4C23 A;  1MA9 B;  3CPE A;  1KLM A;  4HUG A;  3U3Y A;  2E2P A;  4BR2 A;  4AIL C;  3AVH A;  4HCC A;  4IBN A;  3AA3 A;  1G15 A;  4B3O A;  1Q86 O;  3SYZ A;  1VHX A;  4H0T B;  5EY4 A;  3QBW A;  3VGK A;  1XC9 A;  3LWM A;  4BRM A;  1ZC6 A;  1TGO A;  3SQ1 A;  4K25 A;  2NRT A;  3ZX3 A;  4PKG A;  2F9T A;  3NGZ A;  2YNH A;  2G8I A;  3DXK B;  2QWR A;  4IXC A;  2P9U A;  5HRP A;  1A5V A;  1ZBF A;  4JD2 B;  1KVB A;  4FSV A;  2ZWH A;  3MAQ A;  4FJH A;  4IEI A;  3OYM A;  3PO4 A;  2NRR A;  3SPZ A;  4KV8 A;  4Z4H A;  5BRH A;  1Q82 O;  3GE1 A;  4NLB A;  3O4Q A;  4CZK A;  2HVI A;  3PY8 A;  4YNQ A;  1WSI A;  4CD3 A;  2HHV A;  3I0R A;  4BGA A;  1E4F T;  1UWB A;  3VQD A;  4FWO A;  4ISE A;  3O3G A;  3I8D A;  4PQU A;  1DTT A;  5FPN A;  4DR4 K;  4H5R A;  1KTQ A;  4CGF A;  3ENB A;  1OVY A;  3ZSQ A;  1XNQ K;  4L3Q A;  2Q2R A;  3DXM B;  2G8F A;  4R79 A;  3VQA A;  5JMV A;  2NUB A;  3K5N A;  3V9W A;  2PZS A;  1E4G T;  1NGB A;  2RN2 A;  2VQF K;  4Z94 A;  2P9I B;  2IVN A;  3VEN A;  1NGJ A;  3NMU A;  1JCG A;  1ASV A;  4RG8 A;  2O8B A;  3LZI A;  1NWK A;  4YOX A;  4IDH A;  3EKU A;  2GBZ A;  1HQU A;  1JL1 A;  4JS4 A;  4DF8 A;  4N76 A;  4JRQ A;  3VQ7 A;  3SBT A;  3SUN A;  2A42 A;  1RFQ A;  2YKN A;  1RCH A;  4AHU A;  1Z26 A;  2P9P B;  4CZH A;  3SBG A;  1NBW A;  3FGU A;  4GVE A;  1ASW A;  3FR0 A;  3NFA A;  3AO1 A;  3BZC A;  3VES A;  1XWL A;  2P9S B;  4KI6 A;  3E1Y A;  4BC4 A;  3LP1 A;  4BE2 A;  1WAF A;  3GL1 A;  4M3Y A;  1SS6 A;  1RT5 A;  3CIP A;  1ZBU A;  3THX A;  4KH4 A;  4CJT A;  4NYF A;  3VEZ A;  3R9P A;  4JS5 A;  3CCE N;  4IOC L;  5AFU H;  2DFE A;  2QEX N;  3T1A A;  3PSI A;  1O1W A;  3CI5 A;  4HCB A;  4F9O A;  4CZL A;  1UA1 A;  3HTV A;  4O4G A;  1QSY A;  2P1J A;  4B1Y B;  3V6D A;  1VQ4 N;  1S1X A;  1Y97 A;  5KQ8 A;  2GTD A;  2J4R A;  4DV7 K;  4RWT A;  1BGX T;  5GAG P;  2V51 B;  5HL7 L;  5J2Q A;  1UAX A;  3NF8 A;  3QML A;  5DK5 A;  5ELZ A;  1NK8 A;  1QHT A;  3OS0 A;  1GLL O;  1OVQ A;  4FLV A;  4RW7 A;  1HJR A;  2FBX A;  4CJU A;  4H0O A;  1JLC A;  4M3X A;  1L3V A;  5IT9 O;  3PX6 A;  2OTJ N;  1J54 A;  1TKT A;  3FE1 A;  4FJN A;  3F2K A;  1BQM A;  3HI0 A;  3UB5 A;  4DFK A;  3MXM A;  2JWL A;  4BRO A;  3ZSZ A;  4IWV A;  3OYD A;  2QWN A;  2A3Z A;  3LP3 A;  2BGG A;  3K58 A;  1MU2 A;  5AQQ A;  1QZ5 A;  4CGH A;  3V1O A;  2P9L A;  3FFI A;  2BAN A;  3PLA A;  2O4G A;  4B3S K;  1TKD A;  4N47 A;  1NMD A;  4BDZ A;  4X62 K;  1E3M A;  3P1G A;  5EX5 A;  2YX6 A;  3O8M A;  4EZ6 A;  1W7A A;  2E5L K;  3MED A;  4U7B A;  3THW A;  3NH2 A;  5CZ1 A;  4BR7 A;  2OTL N;  5CR4 A;  2VYP A;  5C25 A;  3K5L A;  5I9E B;  5TKY A;  4I9Q A;  2HF3 A;  4BG8 A;  1YVU A;  3H3N O;  4CZJ A;  3W3D A;  3VN5 A;  3K9K A;  5E41 A;  3HL8 A;  1YXQ A;  2XHB A;  1K8A O;  3TU5 A;  3SAH A;  4V19 S;  4IZ9 A;  5I42 A;  2E6M A;  1Q81 O;  3OYC A;  5BR9 A;  1NKC A;  2LSN A;  1EWQ A;  5BRD A;  2B4J A;  4NO7 A;  4H5N A;  2G8W A;  3QES A;  4GKK K;  3O9U A;  3KK1 A;  1XQS C;  3AO3 A;  3OHR A;  1CZB A;  4DQP A;  1IO2 A;  3L4I A;  4LH5 A;  3E01 A;  1WUA A;  3DOK A;  3VPZ A;  3MEC A;  4GY2 B;  4EFH A;  4W5N A;  4FJ8 A;  5A2Q O;  4CBU A;  4ZHR A;  3CM6 A;  3MN6 A;  4M63 C;  3RVC A;  3NVM A;  5C12 A;  2EHG A;  1IBM K;  1KVC A;  3C6U A;  3TAP A;  4FJX A;  3KHY A;  3PV8 A;  1YIT N;  1NK9 A;  3CCU N;  3DMJ A;  4PY5 A;  4AHR A;  4KHS A;  4ZTF A;  1QQM A;  5C2F A;  4JKG B;  5KI6 A;  1YTA A;  4F2S A;  3K0S A;  2CH6 A;  5B8H A;  1YJN N;  4HVJ A;  4DLE A;  4BRD A;  3O4N A;  4LSN A;  3ZT3 A;  2VGM A;  5GAD P;  2D5R A;  3KLI A;  3RR8 A;  4O44 A;  3J7A P;  2HF4 A;  3VF2 A;  3DLE A;  4KTW A;  3GBT A;  2IVO A;  1VQN N;  1SKS A;  2FF6 A;  4CFD A;  3TAF A;  5SWM A;  3ULE A;  2QWM A;  3U8X A;  3LDP A;  3IFR A;  1U2V B;  4RW6 A;  4FW2 A;  4KHQ A;  2W6K A;  2Y1I A;  2QI2 A;  5M1Q A;  1N32 K;  2D0A A;  1XI1 A;  3KK7 A;  4DR3 K;  1GLD G;  4E3S A;  3TTF A;  3U9D A;  4DU3 A;  3W0L A;  3CJC A;  3OS1 A;  1C1A A;  1NJX A;  3S3M A;  2Q0U A;  5C10 A;  4YDU C;  4AH9 A;  4K0K K;  4CJ5 A;  3ZSW A;  1NK6 A;  3DRR A;  2P5O A;  4EHU A;  1YJ9 N;  5DM7 L;  3NHG A;  4BRL A;  3HPH A;  4IO9 L;  2VGN A;  4OJR A;  4HHT A;  2G8V A;  2A1S A;  3S3O A;  4JK8 A;  2ITG A;  1U47 A;  4J2D A;  2E8A A;  4B1X B;  1NJZ A;  4DR1 K;  2OZS A;  4DQI A;  5F0X A;  3PX4 A;  4E89 A;  3HZ6 A;  3HRG A;  4CIF A;  5JVG L;  2NLX A;  3T1H K;  5AQP A;  5FPM A;  4CGG A;  4M42 A;  2RKI A;  4CJP A;  4LSL A;  2FSN A;  4JHD B;  3QLH A;  3FFK B;  5HLF A;  4LF5 K;  2GWJ A;  4CJ4 A;  3JAM O;  1YAG A;  1TL3 A;  3QER A;  2DPN A;  3DI6 A;  1SKR A;  4HTL A;  1HQE A;  1NGI A;  4B9L A;  3SCX A;  1RBR A;  4IFY A;  3QEI A;  2HHS A;  1NKB A;  4B9Q A;  5K14 A;  4CF9 A;  3QFU A;  3C6A A;  3M8R A;  2G8K A;  4DQS A;  4WCE L;  3I8B A;  4Q0B A;  1CZ9 A;  3VQ6 A;  1VK0 A;  3E9O A;  3WXL A;  4DSJ A;  3RWU A;  1YF5 L;  1C6V A;  4IG0 A;  4PKH A;  3KWG A;  4JKH A;  3OBY A;  3THY B;  2ATQ A;  3A8Y A;  2O8E B;  3E9L A;  4M3W A;  4KHY A;  4GKJ K;  5AQR A;  3U6F A;  3QO9 A;  5CE3 A;  3WT0 A;  4JI7 K;  5H1S Q;  4AM7 A;  2RPI A;  3E9P A;  4JKG A;  3HYF A;  4BWJ A;  3G25 A;  4IG3 A;  2G8U A;  4BRK A;  2D4W A;  4B3R K;  4ID5 A;  3CM5 A;  5MLC Q;  1IBK K;  4BVO A;  3NH0 A;  2IAJ A;  3JSM A;  4CHZ A;  3CFO A;  2O4I A;  4J2A A;  3MN5 A;  3DLB A;  5GAE P;  4OPK A;  1QSS A;  3Q7B A;  3L0Q A;  3KIO A;  3AA4 A;  2EX3 A;  3DLK A;  4JD2 A;  1VQ7 N;  3C95 A;  5AQG A;  5GIO A;  2PYL A;  5C24 A;  1IG8 A;  3V9X A;  2JLE A;  2UXD K;  4RTF D;  4OKJ A;  4PHT X;  5ADX A;  1HNZ K;  4JRP A;  3LP2 A;  3M5R A;  3KK2 A;  1QQC A;  2GEM A;  4LF4 K;  1B9F A;  2ZJP L;  4A62 A;  1Z6R A;  5FPD A;  4F4K A;  1FK9 A;  1HPM A;  2QA4 N;  3OJS A;  4B8A B;  4BVP A;  4JI8 K;  1TK8 A;  2P51 A;  4BWM A;  4CK2 A;  4ILH A;  3OS2 A;  4YHH K;  3KLE A;  1ATR A;  4OPJ A;  1EET A;  4K42 A;  3S3N A;  1EO1 A;  3VET A;  1IV0 A;  4KAZ A;  2HOE A;  4A5B A;  4DV1 K;  4OLB A;  4OO1 J;  4KTQ A;  4YOT A;  2DY4 A;  3F5T A;  3QDK A;  4WE1 A;  3TAR A;  3BF3 A;  3VER A;  4A2A A;  4O55 A;  2WUS A;  1S6Q A;  3BGR A;  1WSE A;  2YJE A;  4JK7 A;  4W5R A;  5C2D A;  1RTD A;  1NU0 A;  3LWL A;  3E66 A;  3VQ9 A;  3I0S A;  3TSU A;  3OY9 A;  4DFP A;  3ZSY A;  1JL2 A;  5IWA K;  4CJV A;  5FRN A;  3DXM A;  5KPZ A;  1SL2 A;  4C8L A;  1VSD A;  4OKK A;  1W97 L;  4LY7 A;  3O08 A;  3K5M A;  4B9T A;  3ID6 A;  1EXQ A;  4DQQ A;  3G10 A;  1KSP A;  1X9S A;  4FK4 A;  3IDH A;  1T8E A;  3CXC M;  4JI2 K;  1WSF A;  3A0I X;  3K57 A;  1SV5 A;  3T3F A;  3K5O A;  2XY6 A;  4CJK A;  4ZTJ A;  2HBJ A;  4QOZ B;  3DYA A;  3ITH A;  4KTZ A;  5LY3 A;  2Q3S A;  3OYJ A;  5CYQ A;  1LWF A;  3L2U A;  3BF1 A;  2OAN A;  1JLG A;  1IG9 A;  1NK0 A;  4CGJ A;  4BRE A;  3PSF A;  5GAH P;  4BRI A;  3M1F A;  3J7Z O;  3VTI A;  2RF2 A;  4IJA A;  5AQL A;  1RNH A;  4FZX C;  2P9K A;  4JNE A;  3QIP A;  3O3F A;  1VQ5 N;  4RW9 A;  4R5P A;  4MFB A;  3CCJ N;  1TK5 A;  4ELT A;  4DS5 A;  3VQ4 A;  2UUC K;  1SKW A;  1LAV A;  4LD0 A;  3HST B;  5M1K A;  3TWH A;  4M41 A;  1QQN A;  2QTD A;  3M8S A;  1D8Y A;  4BC2 A;  1WSH A;  3AAP A;  4FM2 A;  4DV6 K;  3CD6 N;  2HHT A;  1HKC A;  3LPU A;  4FWR A;  3CPW M;  2QXF A;  4H8K A;  5JS1 A;  4ILG B;  4IKF A;  1QS4 A;  5AZJ A;  4FL9 A;  2XY7 A;  2GX9 A;  1VSL A;  4B9S A;  1DGK N;  4AHT A;  3MN9 A;  4KO0 A;  2VQE K;  3AVL A;  4Z4E A;  3AVM A;  5M1N A;  4PWD A;  3VEV A;  4DHY A;  1XMO K;  1VQL N;  1N36 K;  3EZW A;  4CEF A;  3AGR A;  2ASO A;  1CXQ A;  4FYD A;  3KD1 E;  4Y0W A;  3SAG A;  4LFA K;  3HOS A;  1WAJ A;  3SUP A;  4IJN A;  1X3M A;  3AVG A;  4FLZ A;  4DTP A;  4MQ3 A;  2E1Y A;  4PL7 A;  1JLQ A;  3RMB A;  2DTU A;  3TAN A;  4JI4 K;  3L2R A;  1C0M A;  3DLR A;  1XMQ K;  1NK5 A;  3THW B;  4O8K A;  1S1T A;  4BE1 A;  3QNN A;  3VA0 A;  3QBX A;  2V7Y A;  4ISF A;  3EY1 A;  3FZL A;  3ZSR A;  4IFV A;  2NRH A;  4FWK A;  4ELV A;  3GOI A;  4E7L A;  4AM6 A;  2XRI A;  3DRS A;  1LW2 A;  4H4O A;  4L8R B;  3EN9 A;  4OLA A;  3FLC O;  5HRO A;  4FM0 A;  3J81 O;  5I3U A;  2X6N A;  2IGI A;  4JKC A;  4AHS A;  4YY3 K;  3D6R A;  4OGE A;  2O8C A;  1CLQ A;  4LF7 K;  3WNF A;  1VSH A;  2OPR A;  2YJF A;  2PY5 A;  4NCB A;  1WOQ A;  3P83 D;  1NGG A;  1JKH A;  3THX B;  3OYF A;  3DJC A;  4I6M B;  3AGK A;  4H5V A;  3CCM N;  2V52 B;  3QEX A;  3Q7C A;  1GLB G;  1Q18 A;  3AVN A;  4XH4 A;  1Q9X A;  1K8K A;  2GUI A;  4IO8 A;  1DEJ A;  1NG9 A;  4RW8 A;  3LDL A;  4KH5 A;  3OYB A;  2ZJQ L;  4DR6 K;  2FF3 B;  3ZET A;  4LC9 B;  2ASM A;  4IOA L;  4BAC A;  2I7N A;  1GLF O;  2A6A A;  4MDA A;  5AQS A;  1R0A A;  3M8P A;  1IJJ A;  1RBV A;  3L6Q A;  4NLC A;  1ESV A;  3HM9 A;  1K73 O;  2OA8 A;  3U3G A;  5FRM A;  5KTQ A;  3AVC A;  2G8H A;  3CJA A;  5CYM A;  1BIU A;  1S5J A;  1YTU A;  5ADX H;  2WBN A;  1HNV A;  2FBY A;  4FWM A;  4K43 A;  3FZK A;  5J2P A;  1J53 A;  1NJW A;  3S9H A;  2ZM6 K;  4KRE A;  5HBM A;  3IAY A;  4CHN A;  1SQK A;  2W40 A;  2WON A;  1VSI A;  4FLT A;  3EKS A;  4Z4F A;  1SAZ A;  3ID8 A;  2YHB A;  1ZXO A;  5DM6 L;  3D0P A;  2XY5 A;  5KPT A;  1W9H A;  2XO7 A;  4B9M A;  3OYN A;  1GLE G;  4CZF A;  1J6Z A;  3EE9 A;  5SZT A;  4WFA L;  3CFR A;  1OH5 A;  4DV4 K;  1BIS A;  1NOY A;  4BQL A;  3HK2 A;  4CFB A;  3BUZ B;  3ISN C;  1RT4 A;  4H0P A;  4N56 A;  4GNI A;  4KHP K;  1LW0 A;  4K8Z A;  4EP5 A;  3O1B A;  2Q31 A;  4CEE A;  5AQI A;  4DF4 A;  4DS4 A;  2RE2 A;  2BUP A;  3CJ1 A;  4JKE A;  4BRC A;  3QIN A;  3WXI A;  3LM2 A;  3BDP A;  5BPL A;  4AHC A;  2UU9 K;  4U67 L;  3TAB A;  3CF5 L;  1OKJ A;  3NF9 A;  2PBD A;  4YDU A;  1QQO A;  4BDY A;  4BR0 A;  3MXI A;  4IEE A;  1RT1 A;  1S1U A;  1C1C A;  3CQX A;  1BA0 A;  3IMX A;  2HMI A;  4EP4 A;  3K9J A;  1V4S A;  2HVH A;  5EU7 A;  3H08 A;  3MDQ A;  3ZET B;  1FKO A;  1JLE A;  1IH7 A;  2QW9 A;  1NOZ A;  4BY9 C;  3ULE B;  1LAW A;  1RDW X;  3AVF A;  4B3T K;  4CHO A;  2VG6 A;  1B92 A;  3SJH A;  3O1W A;  5D3G A;  1ZBS A;  5E26 A;  3OVN A;  4CFA A;  4H0X B;  4KKO A;  2BDP A;  1RIL A;  1HYZ A;  1RDA A;  3HVR A;  1VRT A;  4CZI A;  2KFZ A;  2E20 A;  4CES A;  2F8T A;  3OYI A;  4NCG A;  3TI0 A;  2F4V K;  1I3A A;  4WYB A;  3PO5 A;  3SLC A;  2QWO A;  5AQU A;  1TYQ B;  4FWN A;  4CHQ A;  1NGC A;  3C7N A;  3A2F A;  1JXE A;  3PIP L;  4DU4 A;  3LDO A;  3NE6 A;  1ASU A;  3CFP A;  3CCS N;  3TSQ A;  4BR5 A;  1KXP A;  5JS2 A;  3TAM A;  1MDU B;  3UKR B;  2HBK A;  1RTJ A;  2DFH A;  1S1W A;  3OW2 M;  1TAQ A;  5GIN A;  2D0P A;  4DR5 K;  4QS8 A;  4KRF A;  5J2M A;  2KTQ A;  4HUE A;  3SPY A;  3CC4 N;  4JKF A;  5F1X A;  4LF8 K;  1D9D A;  3C6T A;  3HT3 A;  1HR0 K;  4LF6 K;  2ZQB A;  3SNN A;  2VCP A;  3MX2 A;  1RBS A;  2RHK A;  1REV A;  3BEX A;  1HNW K;  3ZT2 A;  5M1P A;  2A5X A;  2NZT A;  1NM1 A;  1S9G A;  3AVI A;  4F3T A;  5C0Y A;  1NGF A;  1WSG A;  5JVH L;  5BR8 K;  2AP1 A;  5M1F A;  3CMA N;  2PYJ A;  2GEL A;  1TYQ A;  2OYQ A;  1WSJ A;  4B1Z A;  1IBL K;  4BR9 A;  1S3X A;  3MK6 A;  3HM8 A;  2FSK A;  4G9Z A;  3NVK A;  1GOC A;  2IS3 A;  3N4P A;  4A2B A;  4A57 A;  2O8E A;  4BR4 A;  1NNE A;  1U45 A;  5AQZ A;  3I33 A;  3CJB A;  4CCH A;  4JKA A;  2F96 A;  2QWQ A;  2QWP A;  5KPR A;  5KGW A;  5FDL A;  3K2P A;  4C8O A;  1RGI A;  3LP0 A;  4DSL A;  1YIJ N;  3AVK A;  4UQG A;  3L2W A;  4H03 B;  1CXU A;  3H45 C;  3CC7 N;  2YNG A;  3H3O B;  4WQ5 A;  3KKR A;  1DT9 A;  4DV2 K;  4YOW A;  1L5U A;  3KLH A;  1GLJ O;  4FLW A;  1ZYQ A;  2HHW A;  1R59 O;  3S41 A;  3L4Q A;  4FJK A;  1WBD A;  1N5Y A;  3KK3 A;  4I2P A;  5AZI A;  4CIE A;  1RT3 A;  3T69 A;  5HRN A;  4KHN A;  2BE2 A;  3A5N C;  4LFB K;  3MEG A;  4N5S A;  1IKX A;  4DV3 K;  3JXU A;  4BC5 A;  3O9S A;  3SJJ A;  4B9U A;  3CER A;  1L3S A;  4XEI A;  4NYN A;  3MX5 A;  1BCM A;  5AQM A;  1U2V A;  2OPQ A;  1XHX A;  4AF1 A;  3G4S N;  3OJU A;  4DLG A;  1TUY A;  4CEC A;  4X65 K;  4DUY K;  4C8K A;  3U4L A;  4DTS A;  3EEQ A;  4I9L A;  4AQY K;  2E2Q A;  2DFF A;  1U6Z A;  4DTR A;  3ZSX A;  4YFU A;  2AJQ A;  1OH6 A;  5AQJ A;  3H6E A;  3F73 A;  1TV6 A;  2P9K B;  2PFU A;  3SK3 A;  3LPT A;  4DV5 K;  3O9T A;  3B6P A;  3O9Q A;  4I7F A;  5CY4 A;  1S1V A;  3HBT A;  4EZ9 A;  5EXW A;  1T03 A;  1ZBH A;  2GUP A;  2Z1G A;  3ZYY X;  5FPE A;  4NB4 A;  4BRP A;  4DR2 K;  4FJM A;  1RDC A;  3J80 O;  4K8X A;  4DU1 A;  2Q36 A;  2A1R A;  4DMN A;  3CC2 N;  4M3U A;  2HNZ A;  1SZ2 A;  4CHY A;  3NBP A;  4DQR A;  1XHZ A;  1N8R O;  1TVR A;  3F9M A;  4OPA A;  3RSE A;  4AHV A;  2YKM A;  4JI3 K;  2HHQ A;  3H1V X;  4B8C A;  5EOY A;  3KZB A;  4H0V B;  1VQM N;  3RR7 A;  3P39 A;  2E4L A;  2F9W A;  3BP8 A;  2X78 A;  1DKG D;  4CZG A;  1X1P A;  1XNR K;  2O8B B;  3V1Q A;  3GG4 A;  4H4M A;  3VF6 A;  4JKB A;  3T19 A;  4E0D A;  4H5W A;  4Z0U A;  2WOM A;  3R6M A;  1J9A A;  2HHH K;  1BHL A;  4DTX A;  1GLC G;  3RSE B;  3DXK A;  4OGC A;  4PKI A;  1NKE A;  4FLU A;  4M3R A;  3JYT A;  5HRS A;  3RMC A;  3SMS A;  3ALY A;  4Y1D A;  1BDG A;  4BRQ A;  1U48 A;  5HRR A;  1VQO N;  5AQO A;  4A61 A;  4MO5 A;  3L2V A;  4DFJ A;  4CJW A;  2P9S A;  4CJQ A;  1BOT O;  3AY9 A;  2P9L B;  4KHW A;  2QK9 A;  4E7I A;  1TKX A;  3RMD A;  2HHU A;  4CGD A;  4DWI A;  5AQH A;  5T7B A;  3MN7 A;  4OX9 K;  3J8A A;  3KKS A;  4CGI A;  1JJ2 M;  3T1Y K;  4E1J A;  4MDB A;  2KQ2 A;  3QNO A;  3TTC A;  3P31 A;  1RT7 A;  3OTO K;  3DLL L;  3FZM A;  4PUO A;  2D0B A;  4CEA A;  5LJW A;  4BRN A;  3A5O C;  3NCI A;  1YHQ N;  1NGE A;  2AA4 A;  2A40 A;  3TAG A;  1GLA G;  2D0C A;  4I6M A;  1KFS A;  3VQB A;  1KLN A;  3SAF A;  2O8D B;  2UYT A;  1JLB A;  3AO5 A;  4JI6 K;  2X74 A;  2Z1H A;  2Z1I A;  4X66 K;  2YHX A;  3R1X A;  3PX0 A;  4BG9 A;  3CHW A;  1ATS A;  5LMU K;  4B1W B;  4DSF A;  3D2F A;  4FW1 A;  2CGJ A;  2E2O A;  5AQV A;  1BA1 A;  3OYE A;  3JS6 A;  2W42 A;  3LAM A;  2QWL A;  1T05 A;  3D2F B;  4FJL A;  4MLH A;  3L8B A;  3RRH A;  3EE8 A;  5FRO A;  3GDQ A;  3M6G A;  3WNH A;  4FJG A;  4CHP A;  4CI6 A;  2F7T A;  4CER A;  4FJJ A;  5BN9 A;  1TK0 A;  3DWL A;  4B08 A;  2ZGY A;  5CZ2 A;  3FZH A;  5FLX O;  1C0U A;  4DTN A;  2HHX A;  4QCL A;  2I5J A;  3LDN A;  4B1V A;  1YI2 N;  2KKZ A;  1S6P A;  1GOB A;  3CCQ N;  4KPY A;  2P9N B;  2NRZ A;  1BQN A;  1TL1 A;  1VSM A;  1FW6 A;  3O9R A;  2O8F B;  2KFN A;  1P90 A;  4O5B A;  1QHA A;  3VGL A;  4A59 A;  3LAL A;  2YV0 X;  1X9J A;  3A5M C;  4CE9 A;  3DRP A;  3CCL N;  3SI6 A;  2E2N A;  1Q7Y O;  3KD5 E;  3LZJ A;  1JCF A;  1FKP A;  1KQS M;  4CF1 A;  4JV5 K;  3D45 A;  3CQ8 A;  1S22 A;  3H1Q A;  4DR7 K;  3G6E N;  4JI0 K;  3ASM A;  4TSX A;  4CEB A;  2HST A;  3O6W A;  4PA1 A;  4YOY A;  2KHO A;  1WN7 A;  1Y64 A;  2NRW A;  4XH1 A;  1IKY A;  3NAE A;  3C6H A;  3OYG A;  4CZE A;  2Q1N A;  1U04 A;  2W41 A;  2FSJ A;  2ZF5 O;  3DLH A;  3SV3 A;  2OCE A;  3ZEU B;  2BH1 A;  4GW6 A;  4EAH D;  4CJR A;  3N4Q A;  4LH4 A;  1KRP A;  1JCE A;  3DOL A;  3HP9 A;  2IOC A;  1VAZ A;  3KLG A;  1HKB A;  2FLO A;  1OH7 A;  3VQC A;  1WLJ A;  3U9Z A; 
#chains in the Genus database with same CATH homology
 4DR4 K;  4JI6 K;  5IT9 O;  4DR6 K;  1XNQ K;  4X66 K;  5LMU K;  4B3T K;  4JI3 K;  5LL6 Z;  2VQE K;  4LFC K;  1XMO K;  4DV2 K;  2VQF K;  5IWA K;  4JI1 K;  1N36 K;  1XNR K;  4B3S K;  3J7A P;  4X64 K;  4LFA K;  3J7Y P;  4GKJ K;  4X62 K;  2UXB K;  2ZM6 K;  4JI7 K;  2HHH K;  1I94 K;  2F4V K;  2E5L K;  4B3M K;  5FLX O;  4B3R K;  4LFB K;  5LMN K;  1IBK K;  4JI2 K;  4DV3 K;  4JI4 K;  1HNX K;  4JI5 K;  1N32 K;  4DR3 K;  1XMQ K;  4JYA K;  4DV4 K;  2UUB K;  4X65 K;  4DUY K;  4CVN E;  4DR5 K;  4V19 S;  4DV0 K;  4AQY K;  1N34 K;  4KHP K;  2UXD K;  4K0K K;  4JV5 K;  4LF8 K;  4DR7 K;  1HNZ K;  1HR0 K;  4LF6 K;  4JI0 K;  4LF4 K;  1J5E K;  2UUA K;  4NXN K;  1FJG K;  1HNW K;  4JI8 K;  4DV5 K;  4OX9 K;  4GKK K;  4DR1 K;  3J81 O;  4CW7 B;  4DUZ K;  4DV7 K;  3T1Y K;  2UU9 K;  4YY3 K;  2UUC K;  4YHH K;  5BR8 K;  3T1H K;  4LF7 K;  3OTO K;  2UXC K;  4DR2 K;  5AJ3 K;  1IBL K;  3J80 O;  4DV1 K;  5A2Q O;  4LF5 K;  4LF9 K;  3JAM O;  1IBM K;  4DV6 K;  4NXM K;  1N33 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...