2RKIA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
557
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase (RT) p66
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 153
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rkiA05
3NHGA 4H54A 2D3UA 1TL1A 4B08A 1NK9A 3WNEA 1BI4B 2JEGA 5KTQA 1X9MA 3UR0A 4NCGA 4CESA 5HRRA 3KJVA 3BJYA 3AVFA 1RBRA 4CF9A 4DG1B 1B9FA 3DLRA 4CEOA 1YTUA 4CFAA 3AVKA 2YNFB 3OL8A 2VWKA 5JUMA 3ZCMA 2BE2B 3C6UB 2VG6A 3FFIA 1L3TA 5L1LA 3KHGA 3V9UA 4O3NA 2B5JA 4PA1A 3HXMA 3NGYA 5KFOA 3SCXA 4WFXA 3LP3A 3CFRA 1A5XA 3VQ8A 3WNFA 1JL2A 1NK7A 4I2PB 3OL7A 2E9TA 4CJSA 4DTJA 1ZBUA 1EP4B 4U6PA 4ZP9A 1BL3A 3T5JA 2LSNA 3L3UA 1KFSA 1ZYQA 1TL1B 2UVRA 4XPCA 4R8UA 1D1UA 1RBVA 3V1OA 4URQU 4DFKA 3PVXA 1L3UA 3GV7B 1UWBA 5FRNA 1B92A 2KFZA 3OYDA 1NK0A 4KPYA 2D0BA 2DFHA 3ISNC 4Z4EA 5HRNA 2VG6B 1JLEA 1SL1A 1QSSA 2D0CA 3DMJB 4ZPDA 3OJSA 1VSFA 1HYVA 4FJIA 3PX0A 4KREA 3SYZA 3CG7A 3RBEA 4M3ZA 2HVHA 4IRCA 2D5RA 3G10A 3V6JA 4CGHA 3CJ5A 1BQMA 2HHTA 2PY5A 1JL1A 1R0AB 1S0NA 1RDBA 3DM2A 3ZSXA 4E7HA 4B9NA 4DS5A 4ECRA 4L8RB 1IM4A 4DSKA 3VQSA 4O4GB 3THVA 1RT5A 4JV2A 3CVKA 4FW2A 3MECB 1YTAA 4O0IA 3LP0A 4O3PA 3QGHA 3H4BA 3WNHA 3HP6A 3PR5B 3QEVA 4WZQA 1WSFA 5HBMB 4CK2A 4LSLA 4TYAA 4JV0A 1N4LA 3NFAA 1UWBB 1WSJA 3DLBA 3MF5A 3K57A 2RF2B 2FBTA 4BE1A 1TKZB 3M8PA 1JLEB 2A1SA 4TYBA 3QEIA 4ED0A 4NCAA 2HAIA 2JEJA 3D45A 3LALA 3CDUA 5J2MB 2IBKA 4ED2A 2E4LA 4R5PA 4KHSA 4E19A 4ID5A 1QSYA 4EP5A 3DM2B 2WRMA 1HNVA 5FDLB 1NKCA 4RNNA 4FLWA 3MAQA 4CF0A 4QWBA 3Q8SB 5D3GA 1YVFA 1HPZB 1RT5B 3K5LA 5F9LA 3LP2B 3RRGA 1TVRA 4WXWA 4CK1A 3IG1A 3H59A 4J9LA 3LP0B 2BQ3A 3VQDA 3CQ8A 3DI6A 2GC8A 2JGUA 3DLGA 3KMQA 2IAJB 3UDLA 1NJYA 2BDPA 3RRHA 4JS5A 2YNHA 1K1QA 4DEZA 5DQIA 4J9NA 3IGVA 4DTXA 4N5SA 4NLOA 2FVQA 3RMCA 3EYZA 3F9KA 3KLFA 3M8PB 2Q3SA 4FJ5A 5DLGA 2A1RA 4FZZA 3NH0A 4M3UA 3FRZA 2AGQA 4FLYA 2AQ4A 1W0HA 3I0SA 1TV6A 4RG8A 2BGGA 4R5PB 4ID5B 1LV5A 1S6PA 1UOCA 1HNVB 3OYMA 2XRIA 4C8KA 3H5UA 4IG3A 4CJ4A 3CJ0A 2CJQA 5KFZA 3MR6A 4GC6A 2C2RA 1RTIB 2P51A 3M9MB 4J2AA 4PY5A 4FJMA 2XO7A 3DLGB 3SZ2A 4NLSA 5KFEA 4BE0A 3IAYA 2HHUA 4IRDA 1N5YB 2YNHB 3V81A 4M42A 3AVLA 4CEEA 2UVUA 2ITGA 2JEFA 3AVNA 4BDZA 3KLIA 3KLFB 2UUWA 4NLTA 2W7PA 3LWMA 4IFYA 1KVBA 2KFNA 4CJLA 3ZSWA 4FLVA 1TV6B 3KLGA 4IKFA 4QWDA 4CE9A 4G1QA 4DTRA 4CJ5A 1RDCA 4Z4GA 3TAGA 5JS2A 1RTHB 4WE1A 3QERA 3AVGA 1TAUA 2FVRA 4EO6A 1NK5A 3C95A 2O4IA 3KNAA 3HVAA 3S3NA 3O4QA 3HKWA 1TK5A 2FJWA 4B9UA 4LQ3A 4Y1DA 3ISND 3LANA 2DPIA 2J6TA 3JYTB 1IKWA 4JUZA 3NH2A 1RDRA 3TABA 5J2PA 4KTQA 3KLIB 5KFVA 5KFXA 3TANA 4ZP6A 4KI4A 4DMNA 2FBVA 3D5MA 4C8OA 2V9WA 3KLGB 5E41A 4CHYA 3AVHA 4W5QA 1C1AA 3H40A 3Q8RB 3SI6A 3V9ZA 3B6PA 3LZIA 4WE1B 3M8RA 2QKKA 4OGEA 2R7YA 4BE2A 2C2DA 4QWCA 1S9FA 5J1EA 3OSNA 3VQ6A 4RW7B 5KFRA 3M9NB 2RN2A 3CWJA 5KFJA 3QLHB 2AGOA 4AHVA 3QIPA 1Q9YA 2G8FA 4KTZA 4ELTA 1IKWB 4CEBA 4B9MA 1U49A 4KE5A 4F2RA 4FW1A 1C1BA 4DF4A 2F8EX 4KHMA 4YR3A 1TL3A 1NJWA 3CIZA 3NBPA 4DS4A 3EZ5A 2EHGA 4DSEA 1CXQA 3VA3A 4F8RA 5DLFA 1IKXB 2E6MA 5JXSA 3KMSA 4CHOA 1TK0A 1D9FA 3OSPA 4DSFA 3ZSRA 3GYNA 4KFBA 4GVMA 4CHPA 3L2VA 3I5CA 3KK1A 3RBDA 4K50A 3I5BA 1LW0B 3NF6A 3KLHA 4UQGA 1BCMA 4RNHA 2E9ZA 3DOLA 2AJQA 5I42B 3IS9A 1IKYA 3DLEA 1WSHA 3AA3A 4J9SA 2D0AA 1LWCB 5L1KA 4DTSA 1RA7A 3HL8A 1L3VA 4H4MA 3AVBA 1JLBA 4CGDA 4AHTA 2OYQA 4URGA 1GOCA 4CCHA 1I3AA 4TY8B 4BWMA 3TR8A 4KI6A 3K2PA 3NBPB 4DL7A 5T7BA 1KFDA 1KSPA 1C0MA 5KFSA 3QO9B 4ELVA 4KHNA 3HM9A 1QUVA 3KHHA 2GUIA 3I8DA 4O4RA 3QZ7A 3CJ2A 4CJTA 4KFBB 1J53A 3SNNA 4CJWA 1KLMA 3KK2A 1SH2A 1XHXA 1S1UA 3EPIA 4B9VA 2D3ZA 4F4XA 4H8KA 3SQ0A 4DTNA 2HNZA 4TN2A 4HUEA 4Q5VA 1YT3A 4CJUA 3SQ1A 1G15A 3DLEB 4W5RA 4GW6A 4I2QB 1EX4A 5KFDA 3L2WA 4HYKA 4RW6B 1ASVA 4PWDA 1JKHB 4O44A 2AX0A 3PJWA 4KAZA 4AILC 4IR9A 3H98A 1WSIA 3DOKA 2FVSA 4F3TA 2ATQA 1BQNB 3RB0A 2RDJA 5JS1A 2FC0A 1FKOA 4F4WA 4DG1A 4QWAA 4CJQA 1BCOA 4ZTJA 4ZPAA 2KZZA 3KHLA 1JX4A 3RB4A 3KKSA 4B3OA 3BGRB 3BSCA 3KK3A 2X6NA 1KLMB 4BDPA 3KK2B 4CGFA 2G8WA 1C0UA 3KD1E 1IO2A 3H5YA 5KG4A 1Z26A 4CF8A 3H5XA 4F4YA 3GIMA 4J2EA 4I2PA 3V6KA 5KFQA 2G8HA 1QSLA 4YNQA 1JLCB 2Z1GA 4RW9B 1EP4A 3DLHA 1U04A 4ED6A 3NKYA 3RMBA 3AVJA 2OPQA 4O44B 4CIGA 3QIDA 2IA6A 3DOKB 3SUQA 2O4GA 4DSLA 1EETA 1FKOB 4FJLA 2ZQBA 1NJXA 3OYCA 1N56A 3N6NA 4B3OB 3KK3B 4DU1A 3OS1A 5CZ2A 1XHZA 1WNEA 2W8LA 1C0UB 3DMJA 4FVMA 2FJXA 3QEXA 3HPHA 1D0EA 4M41A 3EPGA 4NCBA 3AA5X 3ZT4A 4FJ8A 4ZVHA 5KT4A 1LW2B 1ZTWA 1R0AA 3GIJA 4QCLA 2IM0A 3TAEA 1S4FA 4O4GA 2YHAA 3VQ7A 4KSEB 2OPQB 2YNGB 1XR5A 1TKXB 3WNGA 4NLUA 4ZHRA 4TQSA 3MXMA 1N6QA 4Y34A 3RMDA 3MECA 2CKWA 3F73A 3E01A 5KRTA 2XGPA 1RT7A 1BIZA 4ED3A 3VQQA 3I0RA 1JXLA 3D28A 5FRMA 2HHSA 1EETB 3B6OA 5HBMA 1S10A 1XI1A 4RW4A 2I5JA 3QZ8A 5KFGA 1KTQA 4C8NA 2Y1IA 2XCPA 5KFLA 3ZT3A 4QWEA 1I6JA 3A2FA 3O3HA 1SKRA 1RBSA 2RF2A 5EWFA 4ELUA 1T3NA 3KD5E 3DRPB 1TKZA 4DTPA 5CY4A 2WONB 5SZTA 2HNYA 5DQHA 3TQ1A 2XWYA 1U09A 5J2MA 3UPFA 2Z1HA 1CLQA 2B43A 4F2SA 4RNOA 3BREA 4NLQA 1A5VA 2QV6A 4KHYA 3MEGA 4CJKA 3KLEB 4OPKA 4NLXA 2EC0A 4LD0A 5FDLA 1MU2B 1C2PA 3EY1A 1SUQB 3NL0A 4FLZA 1HPZA 4E7JA 3MFHA 3LP2A 4ZHRB 4NLWA 1N6QB 4CF2A 4Z4HA 3E01B 3N6MA 3C6TB 1RT7B 3I0RB 2JC1A 4Z4FA 1HYSB 2IAJA 3T3FA 4RW4B 2I5JB 1U48A 3IRXA 4DL3A 5KG0A 1QAJA 1ZETA 4KO0A 4JS4A 1RT3B 3LWLA 2HNYB 5C42B 3DRRA 1Z25A 2XHBA 4N76A 4K8ZA 2FLNA 3HVWA 4WYWA 2VA3A 3C94A 4NRTA 3MEGB 3V4IB 3PHEA 4IQXA 1RYSA 3HK2A 5DQGA 1GX6A 4W5OA 1CZ9A 4ED8A 2X6SA 5KFCA 5KFBA 5K14A 5F8IA 3KIOA 3BR9A 1RTIA 2HWHA 1CZBA 2BQRA 3VQEA 4WZMA 2W42A 4DFPA 4KHQA 1NHVA 3JSMA 5DK5A 3HVTA 1RTDA 4JLHA 4CIFA 1Y97A 2QXFA 5KG7A 1N5YA 3IRXB 4AH9A 4CK3A 4Q43A 1HQEA 3U3GA 5EUHA 4RUAA 4K4WA 4KO0B 1CSJA 4YP3A 2G8KA 4OPJA 2G8VA 2YKNB 1D5AA 1SKWA 4E7IA 3KLVA 2DPJA 1WAFA 3DRRB 2O5DA 3ITHB 3H4DA 4Q8EA 4Z4IA 4E3SA 5KG5A 4KHUA 2ZE2B 4WXOA 4K4VA 4OKKA 3MTKA 2JLEA 3AO4A 4ZPCA 1RBTA 2ZKUA 3LPTA 3TI0A 2YV0X 4FCYA 3MR2A 1RTHA 1HNIA 1S1VA 5K14B 2ILZA 3SQ2A 2VG5B 4DTUA 4O0JA 3NGIA 1J9AA 3ALYA 4FXDA 3NH1A 4CEZA 3JSMB 2B4JA 3S3OA 1D9DA 2BANB 3HVTB 1RTDB 4K4TA 3JYTA 3ZT1A 4EBEA 5F8HA 5C5JA 2DY4A 1T94A 3KTQA 1HQEB 2R8IA 1VRTB 3M8QB 3T19A 2VWJA 1NHUA 5KRSA 4KB1A 4EBCA 1RILA 5DGBA 2PYJA 2Z1IA 4KB0A 1I39A 4DQRA 2FBYA 4KTWA 5CYMB 1S1TB 1W9HA 4EO8A 2BQUA 3CFPA 4OLBA 3VQCA 3BSNA 4O3OA 2W9AA 4EZ6A 4E1NA 1UAXA 4M95A 3GV5B 3GQCA 4CEFA 1BHLA 1HNIB 1S1VB 4M45A 1RT1A 4HVJA 3PX4A 3OYGA 3BQ1A 4RW7A 1NOYA 3BSOA 4IH7A 3QLHA 2BRLA 4K4XA 2R8HA 4B8AB 4B9TA 5F8JA 4OLAA 3G6YA 1N48A 4CFBA 2ZD1A 4ZP8A 3DRSA 1ASWA 4XIUA 1LAVA 1VSMA 4N47A 1GOAA 1U4BA 1DLOA 1TP7A 1NJZA 5HP1A 5DMRA 2JEIA 4CFCA 3L2QA 3AO2A 2KW4A 1IKXA 3V1QA 4F4ZA 3UQSA 3PV8A 5KFAA 2HHXA 3DLKA 2DFEA 4KKOB 3GIKA 1RT1B 2XY5A 2Z1JA 1D8YA 1VRUA 2F96A 1LW0A 4XO0A 1KVCA 1FXXA 2HWIA 3LDSA 3QEPA 1ASUA 1L5UA 3L3VA 5FROA 5KGWA 5I42A 3K59A 2ZD1B 3AO5A 2OA8A 4J2BA 4J9PA 4U7CA 3DRSB 3QINA 4CJFA 1LWCA 2XCAA 3LP1B 4OKEA 3TVKA 2W8KA 4M94A 4J9QA 1JXEA 1S9GA 2W7OA 1S5JA 4IKAA 3ZSQA 3AV9A 1LWFA 2RKIB 2VG7B 3G6VA 4TY8A 3MR5A 1DLOB 4KRFA 5HP1B 3QO9A 4F3OA 4AHSA 3BDPA 3P83D 3CJ4A 1RNHA 3FDSA 2R8KA 3BQ2A 4DL4A 4ZTFA 2E9RX 3VQ4A 3DLKB 2YHBA 4IG0A 1T8EA 4RW8A 1S1XA 1VRUB 4FLXA 3ZT2A 1EKEA 3H2LA 5KGXA 1WSGA 3PUFA 2RPIA 4TXSA 1HRHA 1HARA 4FLUA 3N6LA 3VQ5A 4LSNA 2ASDA 3NMAA 3SV4A 3PW0A 1RDAA 2C22A 3RB6A 3GIIA 2HB5A 4I2QA 4FJJA 1LWEA 1HJRA 1SL0A 4EEYA 4KV8B 4DQIA 4RW6A 4O55A 3HPOA 4IBNA 1JKHA 1QAIA 1OS5A 4E7LA 1S1WA 1S9GB 4QOZB 4IDKB 1LWFB 3AO1A 2WTFA 4M3RA 1A5WA 4WFZA 4MQ3A 1BGXT 1BQNA 3SFGA 1RT4B 4TSXA 2V4QA 4F50A 3VA0A 4FJXA 4CGJA 2D7SA 3Q8QB 2YKMB 3SFUA 3LAMA 3BGRA 1FKPA 3DYAA 4IG0B 5KFYA 4RW8B 3OVNA 4Y2CA 1RT6A 1S1XB 3AA2A 4DSJA 3CDEA 4AHCA 2IC3A 3VQAA 1JLQB 2Y1JA 2R8JA 4LSNB 3OYKA 4DL5A 3TAMA 1C1CB 3T5LA 2OPSB 4NYFA 1JLCA 4YR2A 4RW9A 1QQCA 5KFKA 3AVCA 1LWEB 1UA0A 5C25B 4H4OA 2D41A 4CEQA 3M8SA 3RMAA 3MFIA 5F8MA 3OS0A 1S1WB 3RWUA 4NLRA 1RTJB 4Q44A 4J2DA 3NF8A 4NLYA 3PZPA 4FK4A 1S9EB 4ECXA 4N41A 4ECUA 4CJ3A 1F21A 3HVRA 4FJ9A 2W9BB 4MK7A 4JV1A 2IM1A 1FKPB 3DYAB 2ASLA 1KCFA 1RT6B 3O3GA 3PR4A 2OH2A 5KG6A 2IC3B 2RDIA 4DF8A 3TAPA 3PW7A 4CJEA 2X74A 1JIHA 3NAIA 1JLGA 4NLDA 1LW2A 1ZBFA 1VK0A 3TAMB 1QE1B 1K6YA 3V6DB 3O4NA 2IM2A 2GIQA 3ZSVA 4H4OB 4DU4A 3QESA 1NK8A 1QHTA 1QS4A 4JRPA 2YNGA 1TKTB 1TKXA 1SH0A 1Q9XA 4F4KA 4MKBA 1WNSA 3NCIA 4I9QA 1JLAB 3CM5A 4FBUA 1VSDA 1L3SA 4QPXA 3K5MA 4B8CA 3S3MA 4KBIA 3OYJA 4TLRA 5KT3A 4Y3CA 1J54A 4MFBB 3OYEA 3BQ0A 1T05B 4FM2A 3PO5A 3CJ3A 3NDKA 3DRPA 2HW3A 3QGGA 2WONA 4DTOA 3OYLA 4QW9A 4LH4A 1RA6A 2GV9A 3ZSOA 3SJJA 1O1WA 4M3TA 4ZMMA 2FJVA 3ZT0A 1VSJA 3CFOA 1JLGB 4IH6A 2C2EA 3KLEA 4EBDA 2FVCA 4ICLB 4O3SA 4OVLA 4EZ9A 3OHBA 5J2QB 4ECVA 4ZPBA 1SV5A 1MU2A 1S0OA 2WCXA 4CGGA 3MR3A 1SUQA 5L9XA 5CYQA 4NLVA 3QEWA 4CIEA 4FJNA 3ICLA 4DQSA 1VSHA 4DL6A 5F8NA 4TQRA 3C6TA 2XY6A 4PQUA 3QNNA 1HYSA 1YVUA 3NGDA 5KG1A 4RU9A 3OYAA 3OYBA 2XI2A 1RDDA 1GX5A 3VQPA 1ZBIA 4C8MA 2P1JA 4CEAA 4CHQA 3ZSZA 4MIAA 1RT3A 4WYLA 5KT2A 3PX6A 5EWEA 4DU3A 5DG7A 4NCGB 3RB3A 5C42A 3KJVB 1REVA 2ASJA 3K5OA 1UA1A 3MEEA 4G3IA 3SI8A 4FJ7A 3V4IA 4PUOA 3GV8B 1NK6A 3SUPA 3RR8A 5KFNA 3RTVA 3OL9A 2DFFA 4NRUA 4YFUA 1SV5B 3FFIB 2R2UA 2R2TA 4OL8A 3OJUA 2B5JB 2FLPA 4MH8A 2UVVA 5KFPA 5CYQB 3IN5A 4DFJA 3DDKA 2XY7A 2QE5A 3HYFA 1KLNA 3PY8A 4FYDA 3V9SA 3GILA 1LAWA 1J5OA 4DSIA 4PQUB 5I3UA 4KB7A 5EU7A 1GOBA 1WSEA 3HSTB 3VQBA 2PYLA 4RZRA 3I5AA 4HCCA 4E89A 3KOAA 2YKNA 3H08A 4MK9A 4R8UB 1S48A 4FJGA 1REVB 4QAGA 3ITHA 3PW2A 4ZVFA 3MEEB 3ASMA 4FM0A 4RNMA 2ZE2A 5C24A 4PUOB 4FS1A 1B9DA 4ECZA 4ZVEA 2X78A 3CM6A 3EZUA 4CHNA 3V9XA 4NLPA 5HLFA 5L1JA 4FZXC 3NF9A 1BISA 2VG5A 1C6VA 1WN7A 3UIQA 2HVIA 1S6QA 2UUTA 4KHWA 1BQMB 4K4UA 2GBZA 5KG3A 1VSEA 2BANA 1J5OB 4ED1A 1VSIA 5I3UB 5KFUA 3IGNA 2IDOA 3T5KA 1S49A 2G8IA 3T1AA 2HMIA 4CGIA 3FQLA 4CERA 3AVMA 3M9OB 1VRTA 3M8QA 3V9WA 3BSAA 2QKBA 1FK9A 4ZP7A 4ECQA 1BIUA 1XR7A 3QIOA 2XGQA 4AHRA 4YMEA 4LSLB 5KFTA 3OYFA 3NAEA 5CYMA 1S1TA 5C24B 3MEDA 1NKEA 4YQWA 4QW8A 3NAHA 2JC0A 4E0DA 3T5HA 2HNDA 1X9WA 5SWMA 1SKSA 5HLFB 3S9HA 1TAQA 1KHWA 2XY8A 3SQ4A 3G6XA 1T03A 1T7PA 1S6QB 3HHKA 3NF7A 4RNFA 4YR0A 4EYIB 4CF1A 4J9RA 3HP9A 2R8GA 4XPEA 4ECSA 2GIRA 1XR6A 1XWLA 1CXUA 3RAXA 4ECTA 3PW5A 3L8BA 4K8XA 2KQ2A 4DTMA 4DWIA 1JXBA 2HMIB 3QETA 5D3GB 2NUBA 1HQUA 3AVIA 2J6SA 4HHTA 1K1SA 1TVRB 3K58A 1HMVA 1RT2A 2KZMA 3IG1B 4X2BA 3ZSYA 1FK9B 1SL2A 1C0TA 5F8GA 3DI6B 4FLTA 1WAJA 1RBUA 2OZMA 3KKRA 1RCHA 3OLAA 1HYZA 3MEDB 2AWZA 4ID1A 2OZSA 2PZSA 2HNDB 2VA2A 4KKOA 1T03B 3I0SB 1TK8A 1SH3A 5DG9A 3RR7A 3H5SA 1RYRA 4ECWA 2XI3A 3HT3A 1NK4A 4DLEA 3VQ9A 1S0MA 1TQLA 1WLJA 1TGOA 4JRQA 4R0EA 1S6PB 4DQPA 4O3QA 4Z0UA 3CYMA 3SUNA 4HKQA 4IG3B 4HUFA 3LP1A 2FLLA 1HQUB 2I1RA 1HMVB 1RT2B 4IH5A 1C0TB 2B6AA 4J9KA 2G8UA 2RKIA 3HPGA 4NYNA 2VG7A 3FQKA 5KFMA 4OKJA 3OL6A 3V81B 4J9OA 4CECA 5HRSA 1NOZA 3MXJA 1EXQA 2WB4A 3KHRA 4NYZA 3TAFA 4IFYB 4RUCA 2F8SA 3SUOA 5KFWA 3RAQA 4CHZA 3D0PA 2F8TA 4DFMA 4IR1A 2OPPA 4G1QB 2IGIA 4FBTA 3P5JA 4M3YA 4B9SA 1NNDA 1W25A 4Q8FA 5KT7A 2XC9A 1IKVA 4Q0BA 4KAIA 2HHWA 4KV8A 3LAKA 2P5GA 3G86A 4E1MA 1RAJA 3OY9A 4MK8A 2B6AB 3NGZA 4IDKA 2HHQA 1QTMA 2IM3A 3V1RA 2YNIA 5EDWA 3LPUA 3K5NA 2QK9A 3HJFA 1RT4A 1ITGA 1X9SA 3SPYA 3OHAA 4E7KA 1IG9A 4LY7A 1KHVA 3OYHA 2IJNA 5J2PB 5DG8A 2P5OA 2YKMA 4K4SA 2AX1A 3NE6A 4OGCA 1KRPA 2AU0A 4I7FA 4CJRA 5F9NA 5KT5A 4FK0A 1JLQA 4N56A 2OPPB 4LQ9A 4MKAA 3CO9A 3L2RA 3CDWA 1MMLA 2IS3A 5J2NA 4LH5A 1C1CA 2OPSA 1IKVB 4Q0BB 2V4RA 5C25A 4Y2AA 3PO4A 5J1EB 3AO3A 4M3XA 5CZ1A 5HROA 4Q45A 5KT6A 4K4YA 4HUGA 3QIPB 4AHUA 1DTTA 1RTJA 4K4ZA 1VSKA 3V6HA 3P1GA 2YNIB 2ILYA 4BDYA 3G0ZA 2IMWP 1JLFA 3PJXA 3AVAA 1S9EA 3QGIA 2R2RA 4GMJB 4CJVA 3OYIA 1IH7A 2WK4A 3PW4A 1C1BB 4IOBA 3OYNA 4BACA 4OJRA 2V0NA 2W9BA 2R2SA 2FBXA 5F8LA 2EX3A 5L1IA 3TWHA 4DLGA 1TL3B 4IRKA 2IOCA 4CFDA 3SPZA 4I7FB 1ZTTA 4IFVA 4ZVGA 3SV3A 5KFIA 4ECYA 5J2NB 1DTQA 4HTUA 4Z4CA 5T14A 1QE1A 3V6DA 2OPRA 3KK1B 2C28A 2KTQA 5KI6A 2BRKA 1ZBLA 2ALZA 5KG2A 5HROB 4FJHA 3KLHB 5KFFA 3DOLB 3AA4A 1TKTA 2FVPA 4EYHB 3HO1A 1S97A 1DTTB 4BWJA 3OS2A 3TAQA 5KFHA 1JLAA 4EP4A 2HHVA 3VN5A 3LZJA 4FZYA 3IS9B 1IKYB 2WOMA 1JLFB 4NLGA 4NZ0A 4FM1A 3ULDA 4C8LA 4URSA 1XC9A 2UVWA 4KHRA 4H4MB 3TARA 1JLBB 3L2UA 2W9CA 4MFBA 3QYYA 1T05A 1Z4UA 4FS2A 1ZBHA 1U45A 4W5TA 1TKDA 1BI4A 4Y1CA 4IFVB 4W5NA 4B9LA 4MIBA 4WFYA 3QNOA 4J9MA 4O3RA 1DTQB 1NKBA 4ICLA 2YNFA 2ETJA 4TY9A 2BE2A 2OPRB 5J2QA 5DGAA 3C6UA 4ED7A 4I9LA 3U6FA 4M3WA 2BR0A 1S1UB 5EWGA 1VSLA 2ATLA 3O3FA 2DTUA 3FSIA 3OLBA 4O5BA 2WHOA 4FK2A 2HNZB 3U3YA 5HRPA 2AGPA 1X1PA 3E51A 3Q8PB 1U47A 2J6UA 1KVAA 4FJKA 2WOMB 3MXIA 4CJPA 2E6LA 4HCBA 4GC7A 1Q8IA 4DL2A 4DQQA 4PWDB 2IJFA 2W9CB 4CEDA
chains in the Genus database with same CATH superfamily
2P9NB 5D4OA 2X7IA 2CVEA 3B8AX 3WNEA 2JEGA 1X9MA 3D0IE 4NCGA 1FDDA 3AVFA 1GMWA 4BRHA 2FF6A 1IR1A 3DLRA 2Y1LB 2J0QD 1H3DA 5GAEP 3GE1A 4UZBA 2FHMA 3SCXA 1XNRJ 3LP3A 1C4CA 3CFRA 2FSNA 3M5RA 5H9FJ 1NK7A 5DDOC 1WBBA 4CJSA 4DTJA 4U6PA 3T5JA 4WYBA 2RE1A 2H54B 2XMUA 1KFSA 2V51B 2O67A 3SMSA 2UVRA 4BR9A 1SB6A 4P9SA 1K0VA 4PG8A 3V1OA 4YOXA 4URQU 4LF9K 1L3UA 3KUHA 4HVZA 2DR6A 1J5EF 1A7GE 5FRNA 1B92A 1HD0A 2RRAA 5M1PA 3OYDA 1ICEB 1NK0A 3SQGA 3O1LA 3G82B 1UAWA 4Z4EA 1JLEA 1VQPN 3CCMN 1WOSA 3DMJB 2A1BA 1Q8KA 4KREA 3CERA 3W8PA 2MXYA 3G10A 3FCVA 1Q86T 3LDNA 4Z94A 4CM0A 2ZGYA 3T69A 2VV5A 2KJWA 3ZSXA 2V8DA 3SSQA 5L38A 5DZ6A 2CPIA 3T1HK 3ENVA 3GJSB 3OFEA 4LF5J 2ZH3A 1RT5A 5FJ4A 3PRDA 4JV2A 3I56S 2YKQA 4O3PA 3C2PA 4UY8O 3QGHA 1J6ZA 5GAGI 3HP6A 2XZTB 4LREA 2BE9B 1BU6O 4CK2A 4JI1K 3MCOA 3U8XA 3DLBA 1X8DA 1HKGA 3SQGB 1VK3A 3CCVN 4BE1A 1EHWA 1WG5A 1TKZB 1JLEB 4DBQA 2RRBA 4H5VA 1V5VA 3LALA 1H98A 4DR7J 5J2MB 2FB0A 1YJUA 4R5PA 5EX5A 4ID5A 4ETZA 1I1GA 4WK1A 2J0XA 2PN6A 4U67Q 1MW7A 4EP5A 2MQMA 3FJ2A 3ID8A 4FLWA 3MAQA 1RAOA 2CZVC 4RUBA 1RT5B 3NLCA 3K5LA 2ZKTA 3RRGA 3M1VA 3R8EA 3VQDA 4M7XA 3CQ8A 2D0PA 3WQTA 2A41A 4K42A 2GJIA 4JS5A 3POTA 2YNHA 2VONA 4DEZA 2XMKA 2DNKA 3MAAA 2FVQA 1U02A 3DGPA 1TL5A 1C0FA 4RBUA 4CLKA 1ZAXA 3MCAB 3LQVA 5DLGA 2A1RA 2WBRA 2R7RA 4M3UA 3EX7B 2AGQA 4FLYA 5B0EA 3PRBA 2CNLB 3E9LA 2IFXA 4X4OA 4FOEA 2DXFA 3CC7N 2BGGA 4R5PB 2V2KA 3A8YA 4ID5B 2B9XA 1UOCA 2IVYA 1CULA 4B3MK 2K2PA 3CJ0A 2ZWOA 2C2RA 1RTIB 3OXFA 2P51A 1NGJA 1DARA 4C48A 2F8HA 2WVCA 1M5VC 2BW7A 1ROFA 1N5SA 2XMTA 3D6FB 2JZ5A 5KFEA 1HKBA 5AZIA 1PKUA 4IRDA 1N5YB 2KRRA 2YNHB 3POTB 3V81A 4ALZA 2I9SA 3AVLA 2OMLA 2NLXA 1NUEA 3CTRA 3MAAB 2MTLA 2UVUA 2J7KA 3NGUA 3MHYA 4BQZA 2AYEA 3DGPB 1S7HA 3KLIA 4PABA 4DR4F 2UUWA 4FWLA 4NLTA 2Z58B 2CGLA 1UMJA 1Q16B 4FLVA 4FPIA 4CE9A 3GSDA 2DXEA 2VICA 2MKHA 1N34K 1CULB 1RDCA 2WFBA 2CPZA 1SC6A 3NWRA 2Q1LA 1Z2ZA 4KQZA 2R7VA 1TAUA 2DCLA 2FVRA 1NK5A 3C95A 3O4QA 4OPAA 4DUZJ 2HS3A 3LANA 2CQPA 2EFQA 3LDLA 1NBWA 5AQFA 1IKWA 5KPZA 3HHLA 2IHR1 5J1PA 4F02A 2PMZD 3KLIB 2Z4PA 5GAEI 4KI4A 2FBVA 2BJDA 5E41A 5AXMA 2LP4A 2AYBA 4P71A 1CG2A 4QS9A 4DR5F 4ILRA 2DHGA 3M8RA 1NB2A 2R7YA 4BE2A 3GJRB 5BPMA 5CE3A 3P6YC 5J1EA 3OSNA 3VQ6A 1H2TZ 5KFRA 5KFJA 3QIPA 2W4CA 1GLCG 4KTZA 4ELTA 1FNOA 1IKWB 3HHLB 1U49A 2NRVA 3BH6B 4F2RA 3QB0A 1X60A 1PAEX 4MO4A 3BP8A 4DF4A 2JOQA 2RMLA 4X66K 5B0GA 4BHQA 1KD1O 4CLWA 1NJWA 5IS2A 3NBPA 4Y0FA 3BDEA 2EHGA 3G6EN 4IZ9A 4DSEA 2A10A 3K8VA 5ETQA 3KZBA 3KMSA 4NE9C 3OSPA 1XNRF 4DSFA 4KFBA 4GVMA 2EC2A 1IJFB 2V50A 1PAUB 3E66A 3RBDA 2B4PA 3I5BA 2QLWA 2P9LA 1BCMA 2E9ZA 2N3LA 3UVJA 2R7UA 1X4FA 2AJQA 2QTDA 4CM2A 1YVNA 4J9SA 5L1KA 4FWOA 4TKTA 2RB7A 2VFSA 1YITS 1RSCA 3J7AP 1F2HA 4CCHA 2JX2A 3CJ1A 4TY8B 4BWMA 3TR8A 3NBPB 4DL7A 1NGIA 1EKSA 1C0MA 3A3PB 3F5TA 4K2JA 5KFSA 1Y00A 4ELVA 4KHNA 4PXBA 1FWKA 3HHDA 2PEHA 3BPDA 3W2VA 1PSDA 4KFBB 4CJWA 2WBNA 3EO3A 5AQJA 1KLMA 4LMZA 1S59A 1OQ3A 3IM8A 4YHHJ 2KO1A 2D3ZA 2EK1A 1H7WA 4F4XA 3UCUP 3SQ0A 3P96A 3TJ9A 2XO6A 4HUEA 4LF5F 2K3KA 4XDCA 1G15A 1DGKN 4W5RA 2L9DA 2PC6A 4HYKA 2XS2A 3O9UA 1D4XA 2XLJA 1KP6A 2AX0A 3PJWA 2CDQA 3H98A 3LW5C 4USIA 4F3TA 1BQNB 4KGZB 2K1RB 3TSPA 2ZITA 4A8KA 2FC0A 2Z0GA 4F4WA 2FHKA 3MN5A 4DR7F 2HHHJ 3KK3A 1KLMB 4BDPA 1VQ6N 2G8WA 4FF2A 1WC1A 1IO2A 4USHA 1RDUA 3H5XA 4F4YA 2RDDA 3DCAA 4M63C 2MQNA 5L46A 3THYB 4BRKA 1TL7A 3IWXA 4DZ6A 1QSLA 2GS8A 3DXKB 1Q81O 2Z1GA 4RW9B 1VHFA 3ZXWA 1U04A 2MMYA 2VJVA 2EBEA 3QICA 4CIOA 3WUHA 2OHDA 4DN0A 1Q53A 3D1QA 3EM1A 4LF4J 5HQ8A 4H0TB 3TA1A 2AA4A 2E1MC 2ZQBA 2CGKA 1VMBA 4NA3A 3OYCA 1YF5L 4EAHD 1UPPA 4FXVA 1V3RA 3KK3B 4PKDB 3D2WA 3BKTA 1NSKL 1GLBG 4JKDA 4RR5A 1D0EA 3EPGA 1UVNA 1IBMJ 1WKLA 1CS4B 2O8BA 2NXEA 1E3MA 2HMPA 2QA2A 3PIPL 4DCPB 1S4FA 4O4GA 2YHAA 4F3QA 3QT7A 4CZLA 3CXCR 4KSEB 4NLUA 5AE2A 4TQSA 3DHWC 3MXMA 1N6QA 4A8YA 4CZJA 3NS7B 4M1KA 2RH3A 2A6AA 1RT7A 4ED3A 3FGUA 3I0RA 3CPWM 5HBMA 3EGNA 5A8RA 1S10A 4JKEA 5KFGA 1KTQA 4F26A 4Q2LA 3TP2A 1I6JA 3E8OA 4A48A 4ELUA 1T3NA 3KD5E 2DO4A 4YDDB 1MWQA 5IWAJ 4FWMA 1KQSR 1NU4A 1U09A 4JHDA 2Z1HA 1CLQA 4FZVA 2B43A 3SCIE 4RNOA 4NLQA 2I38A 1A5VA 1FVQA 2O8BB 4OPKA 4X62J 2ZGZA 3DKDA 4DUZF 2BJEA 1C2PA 3OFHA 2WZ1A 4DPWA 3EZWA 1HNXK 4NXNK 1N6QB 3N6MA 1WDTA 1RT7B 5F0XA 2OIHA 3I0RB 5THWA 3CCWA 3T3FA 1TR0A 4NEZA 1QAJA 2VPZB 5DDQC 1JCFA 2P5VA 1RT3B 1V6HA 2MGZB 5F3TA 4CP5A 4JHDB 2LVWA 4JB8B 2LDYA 1OPZA 4HACA 2LU2A 5D4LA 4GMKA 3HK2A 1M1HA 3MM6B 2HSEB 1QQNA 1T44A 3AXKA 5KFBA 2ZVIA 4A5BA 4BRLA 1VHXA 3QFHA 1EO1A 4UTGA 1VYAA 3KIOA 4C11A 2BQRA 3VQEA 5LSLA 3JTNA 2HIQA 5LSOA 3JSMA 3R9PA 1Y5IB 2FHJD 3BKUA 2QXFA 3AJ1A 3I56N 4AH9A 3TEHB 2BJ9A 3SSRA 1VR6A 4YP3A 4OPJA 2YKNB 4ILGB 1HA1A 1SKWA 3RUBL 3KLVA 2DGXA 2DPJA 3GB0A 3E1YA 3ITHB 2EFVA 4HACB 2FZGB 4K4VA 2JLEA 4YY3J 1FHTA 4WQ4C 1RBTA 2E1RA 4USTA 5IT9O 2H65B 1RTHA 1P8GA 1KQKA 1S1VA 4WFAQ 2ILZA 3DFEA 4C11B 1Q5VA 3VHQA 3WX8A 2VG5B 1FJ7A 3NGIA 3ALYA 2PO4A 4FXDA 3JSMB 5L8RC 4K4TA 1IQTA 1K9MT 3JYTA 3ZT1A 2QA4G 4DKWA 3KTQA 2IRUA 1Y5NB 2OCEA 5HL7Q 4BRPA 3M8QB 2VWJA 1NHUA 5KRSA 4KB1A 1RILA 3R27A 2VD3A 2N7YA 1FJGJ 1QVFM 3UN5A 1ZZFA 4G1PA 1UVKA 3DRXA 3C14A 1V4TA 1S1TB 2O01C 1W9HA 4EO8A 3F44A 2BQUA 4YHHF 4EZ6A 5HJYA 2BXJA 4CEFA 1S1VB 3G8QA 3OTCA 4IFEA 1RT1A 4HVJA 3SAHA 4RW7A 3AD9C 3CQYA 4IH7A 1U0HA 4PYDA 4B1VA 1FEHA 2BRLA 2R8HA 5F8JA 4OLAA 3TZWA 4U96A 2ZH1A 1E6YA 2WAQD 2ZD1A 1MA9B 1S79A 4AE5A 3CCEN 4BR5A 3HZEA 1ZA2B 1ASWA 2OMOA 4LIWA 5E3RA 3LTOA 3I33A 4N47A 2HHHF 1HLWA 3C14B 5DMRA 2QWOA 2ZC3A 3L2QA 4GV3A 2P9EA 2KW4A 4EHTA 4TU8A 3CC2S 3V1QA 4M8LA 3IAM9 5KFAA 2QL9B 3ENBA 3THPA 2HHXA 3P8BB 5IOLA 3B78A 4KKOB 3B8HA 2P9PB 1RT1B 3FSXA 4BR4A 2OTJS 1D8YA 1VRUA 4TU9A 2HWIA 4C23A 1U0HB 3QEPA 2DD8S 4K8RA 1L5UA 4OFZA 2NUUG 5FROA 3G9CA 5KGWA 5MLCQ 5I42A 3M2RA 3K59A 3FE1A 2ZD1B 2VFTA 4J9PA 4NOHA 3TVKA 4LF4F 1S9GA 4DUYF 3AV9A 2HFVA 3ZO7A 3G6VA 1P6TA 1QJHA 4BRNA 3QO9A 2AJ1A 1N36K 1GMWD 1HWJA 3CJ4A 1RNHA 1RK8A 4DL4A 4ZTFA 1IBMF 4DZDA 4BQLA 1HNWJ 3R1HA 1VLOA 1ELOA 4ZLNA 1VRUB 3ZT2A 1SKUB 1EKEA 5KGXA 1WSGA 2W2MP 1LOUA 1HARA 3N6LA 3VQ5A 4LSNA 2ASDA 1MDUB 4DR1J 4CZKA 1RDAA 1X4CA 2C22A 3RB6A 1CJUA 4I2QA 4DV2J 3T1YJ 4EEYA 4DQIA 4JI2J 2HRUA 4B3TK 1QAIA 4QOZB 1S9GB 4IDKB 3O6WA 2M8DB 4M3RA 2QMUB 2HFNA 1BGXT 1XTZA 3SFGA 5HK4A 1NG9A 2GZOA 3KNGA 3IFRA 3UN2A 5IWAF 1YK9A 3E2EA 2G4BA 3Q8QB 2V7YA 5C2GA 3BGUA 3SFUA 2E1CA 3M32B 2P6TA 3OVNA 4WP3A 1RT6A 3GFHA 2CPEA 5JLHA 4X62F 4KGXB 1RJJA 3CDEA 4JI3J 5E84A 4QZVB 4WKYA 2Y1JA 4LSNB 1GLAG 3TAMA 1C1CB 2BABA 3W9HA 1JLCA 4YN3B 4YR2A 2LQBA 1A6LA 4R25A 2D41A 3AHPA 4NPOA 1XMQF 3ATVA 3S01A 3HSZA 3WT0A 5AJ3K 2HBZB 2F4VK 4ES2A 2UP1A 4ECUA 1S12A 4CJ3A 4PQAA 2FC9A 2K7KA 2IM1A 4C9DA 4RX6A 3MI7X 1RLDA 1RT6B 3O3GA 2LXFA 5KG6A 2B8QA 1S72N 3PW7A 3R8YA 1VQ7S 4CJEA 2X74A 1K73T 4ZPTR 4ZLPA 3TAMB 1HWUA 3O4NA 3FMBA 2RHKA 6FD1A 2BM0A 2A2DA 1CJTA 2KG1A 1RAFB 5K8NA 2AF6A 1TKTB 1GLJO 4F4KA 2W4PA 2V68A 4CLUA 1WNSA 3CM5A 4FBUA 4L3QA 3W2WA 1L3SA 2KVIA 3K5MA 2DR9A 3CQXA 1VJWA 1APSA 2CQHA 4Y3CA 3PO5A 5H9EJ 5KOWA 1AXQA 1G2EA 4YY3F 4QJVA 3BF3A 3MX2A 3EE9A 2Q79A 4LH4A 2DHHA 1N33F 3L7PA 1R7IA 5BJRA 3SJJA 1O1WA 4CZCA 2FJVA 3ZT0A 1Y3JA 3P5TL 2C2EA 3KLEA 2RQKA 3SAGA 3MMBB 4EZ9A 2O8CA 2VPXB 4GVBB 2Y0BB 1IG8A 1NZ8A 1SV5A 2DGVA 5IQ6A 2ZWHA 1CJTB 4CGGA 2IVMA 3MR3A 1SUQA 2E5IA 2KL8A 2HQCA 4NLVA 3QEWA 1H2UX 2P9GA 1URRA 7FD1A 1QD1A 1VSHA 5DM6L 1LEOA 4A8WA 5F8NA 3W2WB 3C6TA 1N5QA 2QLFB 4PQUA 3MD1A 4NYOA 5D0GA 3QNNA 2B4VA 4CLYA 4WQ4A 2ZH6A 2C2OB 5BRDA 1FJGF 2B7BB 1GTEA 5EWEA 4Y00A 4KH5A 3OXGA 2YH1A 4ZCKA 1UWAA 4QIEA 3BYRA 2B9EA 3AGKA 3GV8B 3SUPA 2O8CB 1PBUA 4YFUA 1AB8A 1SV5B 3FNNA 3OJUA 2B5JB 2ROGA 3VERA 4MH8A 3CCLS 4P2MA 5KFPA 3IN5A 3SCLE 2MQ8A 3UD4P 4HI2A 2L9WA 3ZTRA 4F4AA 2QSWA 3W66A 4FYDA 2VKZG 1WI8A 3GILA 1P9YA 4PQUB 4ZJLA 1CC7A 3ENWA 1NU0A 1GOBA 3PFEA 4MDBA 3VQBA 3SK3A 2PYLA 5I4MA 3HHLD 4HCCA 3IWNC 5GIOA 1NHKL 4IEIA 1BA1A 5FPNA 3DLJA 2XNQA 4QS7A 4Z7CA 4PWWA 3VEZA 2DGOA 3LOUA 4ZVFA 2GVZB 2H9ZA 1X9JA 3ASMA 2W6LA 5C24A 3OVBA 2A6OA 4FS1A 2YJFA 4ECZA 1NSQA 4HTLA 3CM6A 3V9XA 3P3DA 4KBOA 1NLVA 2DNQA 2V8GA 4GY2B 3NF9A 1XEZA 2F1FA 4LVOP 1WHYA 2ZJRL 2EG1A 2HVIA 4CLZA 1DQ8A 1V9OA 1BQMB 3LGMA 2KYXA 2GBZA 2H5EA 4CZIA 1VSEA 4JKFA 3J81U 1QZ5A 3IGNA 5HI7A 1XN9A 4CLLA 4DV5K 2HMIA 1UKUA 2ITMA 1AUSL 4CGIA 4CERA 1VI7A 2JNJA 3HT0A 1U6ZA 3CCRS 2QKBA 1NO8A 1U7LA 4PL7A 1T95A 4AHRA 5KFTA 1OH8A 5C24B 4QW8A 2R9LA 4E0DA 1HNZJ 5SWMA 2BW2A 5HVGA 2I2YA 1S77D 1TAQA 5AQQA 2HBMA 4DR1F 1NGAA 3NP5A 1M0SA 4DV2F 3UKRB 3T1YF 4EYIB 4CF1A 4JI2F 5HQMA 2D4WA 1XR6A 2B0GA 1XWLA 2HZAA 3RAXA 1JJHA 4ECTA 3T1HJ 4DTMA 2HMIB 4PKHA 4Y0WA 3QETA 5D3GB 3WDOA 2NUBA 1RWXB 1OH7A 1M5OC 3K89A 1MWYA 3K5PA 2VWBA 3DI6B 5K20B 2FSKA 4QIWD 2QC3A 4M5HA 4YB1P 1HYZA 1C4AA 4LRCA 4LRFA 3A8IA 1X4DA 1Y5LB 2ASMA 4OYAA 4JI3F 1R8AA 1NB7A 4ES1A 3HD2A 4C0BA 4M7YA 3JS6A 2VHGA 3I0SB 1SH3A 5DG9A 3H5SA 3NGSA 2E20A 4DV0K 1TQLA 1WLJA 3PFOA 4X64J 4OJ3A 4O3QA 3CYMA 2ZBQA 3PIPQ 4IG3B 4UQTA 3VZHA 2OJ3A 2MZJA 1VQKS 1F6TA 1QVGM 2NZTA 3THWB 4IH5A 1T9WA 2ROEA 1XQSC 2B6AA 4QU6A 3DXSX 3FQKA 2EXUA 4OKJA 2CQ1A 2DH9A 4JI4J 5BPNA 1MROA 4GRSA 1OIAA 2CFXA 4ZCIA 4P7TA 4WQ5C 2WB4A 3WHIA 1Q82T 2ROPA 2VPYB 1CQMA 4IFYB 3ENAA 1DFDA 1GH8A 3D0PA 2PD1A 3F41A 2IIRA 4IR1A 4WWSA 4WKRA 1AROP 4B3MJ 1SJ3P 5D15A 1SAZA 4HT7A 5ETNA 5B7WA 2MKIA 5IT4A 4Q0BA 3J81Y 4WK3A 2P5GA 4P74A 3GFXA 2HYIB 1RBOB 4E1MA 1RAJA 3OY9A 2E5LK 4WPAA 3EGWB 5LSRA 2B6AB 1PJ6A 3CJCA 2V8VA 1QTMA 3V1RA 2DPNA 2KKZA 5GAGU 3HJFA 4J37A 3SPYA 2XTJP 2J8AA 3OHAA 2GEMA 1FDAA 1IG9A 1HWIA 1P9QC 1MROB 4O23A 1T9UA 5C15A 4DV3K 4I7FA 5KT5A 1VQOS 3W3SA 3BGOP 5GMEA 2OTJN 2X1AA 3CO9A 1KQGB 3DXMA 3L2RA 2H51B 1MMLA 3CDWA 1N34J 4BC5A 5E26A 2P9KA 2PMWA 3OUYA 1VOMA 4Q0BB 2EKNA 2V4RA 3ILLA 1S3XA 4DR5K 5HROA 3TVYA 2Z2YB 4AM6A 5A6WA 4HUGA 4AHUA 4K4ZA 3V6HA 3W8GA 2ILYA 1YJWS 3V5RA 1OYDA 1PCAA 1JJCB 3FKBA 1S9EA 4M5JA 4ISFA 1IH7A 1W26A 3PW4A 1C1BB 3ONQA 2IJRA 2NRHA 2YWGA 3CPWR 4H5RA 1KC8O 4GV9A 5HMYA 2EX3A 3D0GE 3TWHA 2E1YA 1TL3B 1X4BA 2IOCA 3VVTA 1VFJA 4IOCL 4I7FB 4ZVGA 4CLSA 3SV3A 5KFIA 4CO4A 5LT5A 1YJRA 3CJRA 3R1LA 3DXMB 2GGPB 4JYAK 3H1VX 5T14A 2R4FA 1QE1A 2P9KB 3V6DA 3OUYB 2OPRA 1ZC6A 5GADI 1ZBLA 5HROB 4FJHA 1FTRA 3DOLB 4OJGA 2NR0A 1S97A 2KYZA 5KFHA 3D3BJ 3ZZZA 4YOWA 2CNOB 2WOMA 1WF1A 5E0OA 4A4JA 4NZ0A 4LR7A 4C8LA 3DGVA 4WFBL 3L2UA 1T05A 1Z4UA 4X66J 4FS2A 2UV8G 3TX0A 1VK8A 2QYCA 4BRIA 2O3DA 1TKDA 4L74A 5C2FA 3HSDA 4OYZA 1JWWA 3BEGB 1DY3A 2A6MA 4ICLA 3I55N 5LL6d 2OPRB 5DGAA 5LM7E 4PG4A 4ED7A 2RU9A 4M3WA 5EWGA 2RQMA 2ATLA 4UOFA 2GIFA 2WHOA 3IC1A 4ZLLA 4DL0C 1UW9A 1KVAA 2DNNA 4PEOA 2WOMB 3MXIA 3G4SN 5IM0A 2Q66A 1Q8IA 2RHQB 3QDKA 4PWDB 3MTJA 4PAAA 4CEDA 3NHGA 1BMQB 4H54A 2D3UA 4B08A 1NK9A 2C3OA 3UR0A 1HNZF 3KJVA 4DG1B 5I3PA 4NA1A 4CEOA 1X4AA 3AVKA 3CHWA 3NRBA 5IT9U 2DRBA 2VWKA 1VQ7N 3UR3C 2UU9K 4K59A 4HH0A 1Z2LA 3L7UA 3FFIA 3SQOP 1U6FA 3EGVA 4PA1A 5G0RB 5KFOA 3HOTA 3T1HF 3WNFA 4I2PB 4AL6A 4FWSA 4S0MA 1IWAA 1BWFO 3OL7A 1T3VA 3TUZC 5E33A 5IM0B 1EP4B 3LUYA 5EGYA 4P2SA 4ZP9A 2AV5A 1BL3A 2QJ3A 1FD2A 2V2VA 4D3GA 5B08A 1ZYQA 2PI4A 4XPCA 2PGCA 1D1UA 1N0VC 2HWTA 4DFKA 2JH3A 5LY3A 2WSEC 1RAIB 2HFUA 2CG4A 1QVFR 2DFHA 3BEXA 4UOHA 2BV3A 5HRNA 4FWQA 4K7QA 2OGUA 5E7OB 4FJIA 1HYVA 4B17A 3CG7A 3RBEA 2D5RA 4JEPA 2PY5A 1R0AB 2FTRA 2YQ0A 1RDBA 1U1OA 3DM2A 1JB0C 4LFCK 3P38A 3RSEA 2ZDPA 4USVA 4DSKA 5AZJB 1BWVA 3RU0A 2ZF5O 2ZJQL 1Y4ZB 1X4EA 4BBYA 3CVKA 4FW2A 3MECB 2F9TA 1YTAA 3PCOB 1RWVB 3LP0A 1VC6A 3PYGA 4JI4F 1RABB 3N4PA 4P73A 2BBEA 3QEVA 2DVIA 4LSLA 2YQ1A 1N4LA 3SIPB 3NFAA 4MT1A 4JP8A 5FLXO 1IR0A 3ZTQA 1WKKA 2A1SA 3QEIA 4ED0A 3A12A 2HAIA 3WZ0A 1NGBA 1O5JA 4ZVTB 4B3MF 4H4KC 2IBKA 4ZITA 2NYIA 2E4LA 3UKUA 4E19A 1VQLN 3CCLN 3CC4S 3BZKA 3DM2B 1SC4B 1NKCA 2FF3B 4RNNA 1FFWB 1W2BM 2O8DA 3Q8SB 2KXFA 1HPZB 4DPUA 2V7ZA 4BRGA 3H2UB 3TO8A 2YQ3A 3LP0B 1YXQA 3KWMA 1OVYA 3GU0A 2GJ2A 2GC8A 1WSRA 2JGUA 2DNGA 1X5OA 3RRHA 4J9NA 3IGVA 3KDNA 4NLOA 2B9WA 1CC8A 4N5SA 1M1KT 3G8SA 3SCJE 3O3LA 2DGSA 2JSXA 3CJSA 3EYZA 3CD6S 3F9KA 3TWZA 4F04B 3QSIA 2C2ZB 1N34F 1W0HA 1FRKA 3DLLL 1TV6A 4HDGA 3UKUB 1KTVA 1LV5A 4QYZJ 2YWEA 2O8DB 4LF2A 2RS2A 4CJ4A 4KYZA 3QT6A 2CJQA 3O1WA 4GC6A 4KJIA 4NXNJ 2Y3YA 4PY5A 1NMDA 5IC6B 3SZ2A 4NLSA 3S6EA 3CCRN 2C3YA 3O8WA 1U1KA 2GHPA 4RBTA 4OJ1A 3QPIA 2R3VA 2AMCB 2P9UB 4LJMA 3I96A 1DEJA 1RBLA 1KVBA 5DDPC 2KFNA 5B0BA 3ZSWA 4ETXA 3MN7A 1TV6B 3HULA 1ZXOA 1GQEA 4CJ5A 4JKGA 3TAGA 5JS2A 2DR5A 5HAOA 3HVAA 4ES3A 3HKWA 1S4EA 4RWWA 2FJWA 2GHVC 4JNEA 2WUSA 1B99A 2Z2MA 9RUBA 4CQ1A 1WBDA 5DM6Q 2GW8A 4Y1DA 3TVZA 3ISND 2VOPA 3CPEA 2J6TA 2RUSA 4KGKA 1L3KA 1AA1B 4X66F 1G6BA 4A61A 3BN7A 4ZPWR 3J7ZT 1RDRA 1DQ9A 4J9UE 4ENOA 2LQ9A 1FCAA 2MZSA 4ZP6A 4NLCA 1Q1KA 3SBMA 3LF0A 2JWLA 3MOJB 2OELA 4EI2A 5AT1B 3WBZA 4CHYA 2NCKL 4QBUA 1Y3KA 1Y11A 1RU2A 4W5QA 2KT2A 1KAZA 4JKGB 3H40A 3MAHA 1R59O 3B6PA 3LZIA 2QKKA 2PA8D 4B1YB 4QWCA 4NZ6A 2GO8A 2K7JA 3Q7BA 2A40A 1EX8A 1RACB 1FDNA 3FZLA 4AHVA 1Q9YA 1UFKA 2K8GA 1Q86O 3KJFB 3FVYA 2EFNA 4ZVPB 4I67A 2XYPB 3FBCA 5BYQA 3JAMO 2F8EX 3O1BA 2QL7B 3CE8A 3BO4A 3JSBA 4CH1A 3CGIA 3CCUS 4IUFA 3EZ5A 4F8RA 3VA3A 1XUPO 1IKXB 3GPAA 2RE2A 3DU6A 4CHOA 3Q8VA 1NXIA 3EMTA 1BUPA 2LECA 4CHPA 5KQ8A 3L2VA 3US5A 1RAHB 5AQWA 3I5CA 3KK1A 1UJ4A 4K50A 1LW0B 2ZJRQ 4C3LA 4UQGA 2ADBA 1FE4A 4RNHA 4DV7K 3FRYA 2ZZTA 2QXLA 3LA0A 2HFSA 3RG6A 2WTUA 3IS9A 5T7LB 3R1XA 4DTSA 3CJKA 3HL8A 4H4MA 2CNNB 4KY3A 3AVBA 4CGDA 2HBJA 4FVUA 3I87A 3CCQS 2ZM6J 3O08A 1GOCA 5AQVA 4EFHA 3CJBA 4LF4K 3K2PA 3F9MA 1YHQN 5T7BA 2QLXA 1I51B 5SUHA 5HATA 3LDOA 3TW0A 5CD4A 3I8DA 4O4RA 4CJTA 5A2QO 1J53A 1GNKA 5E2QA 1A0OB 2IA0A 1XHXA 3EPIA 4XH5A 2HS0A 4DQ8A 4A2AA 4LF7J 2FUG9 1RU1A 4A8OA 2L9NA 4BR2A 1JMTA 4CJUA 4X65J 5K9FA 5L39A 1H0HB 1WELA 4DU8A 4CBXA 2V9KA 1EX4A 1QHAA 1CEZA 3TTCA 1U2FA 1YJWN 3K9JA 4LRDA 3C19A 1JKHB 3OV7A 2G0IA 4AILC 3NVKA 4IR9A 3U7JA 1WSIA 1FVSA 3CSKA 3MMVA 1B7YB 4PG6A 4XAKA 2HURA 4QWAA 4ZTJA 2V67A 1JX4A 3HKZD 4USMA 3B54A 1QQOA 3KKSA 3C15A 4N8NA 3BGRB 3BSCA 2X6NA 1PIEA 1KS2A 5IWAK 4L72B 3H5YA 1SQKA 1YJNN 2N3OA 3VEWA 5E5NA 5LJWA 2AJFE 4ZJOA 2BX6A 3VCDA 3EXCX 1G3OA 4U9RA 4RPFA 4CTAA 4CT8A 2OSQA 2CYYA 3PYEA 3BR8A 3DLHA 1X5TA 1SIZA 3BO3A 3NKYA 2MDAA 4B3TJ 2E1PA 4FYYB 2OLWA 1Z1ZA 3QIDA 2IA6A 4H4KA 3KKFA 2O4GA 2GA7A 3CF5L 4FJLA 1NJXA 1YQHA 3C15B 1MN7A 3G87A 4DR3K 1WNEA 1ZBTA 2COLA 2Q31A 4E1JA 2FJXA 1EQMA 5KOXA 3AAWB 3FSYA 3QSYB 1CBKA 1BDGA 2XB2D 1LW2B 5AE1A 3CCMS 5ETPA 4NXNF 4QCLA 1RDWX 4QS8A 3CJ7A 3TYTA 3UNGC 2PA3A 2CJXB 1XR5A 1TKXB 3WNGA 4ZHRA 1GTHA 4Y34A 3RMDA 3GTYX 2XGPA 1BIZA 2HHSA 1JXLA 3VQQA 2P9SA 2J0SD 1RWMB 1Y0HA 4FYWB 3B6OA 4GKJK 2F4VJ 2U1AA 1XI1A 2VFVA 4PKGA 2I5JA 4C8NA 2YJEA 2GX9A 3O3HA 4QWEA 1SKRA 2RF2A 1QLNA 3DRPB 2OAUA 2FYXA 2HNYA 2GWKA 2HZCA 5AQTA 4LFBK 4J9VA 4F2SA 3ILJA 3LDPA 2GMHA 2QV6A 3MEGA 3D67A 1FD8A 2EC0A 5FDLA 5E3QA 1MU2B 4U7UK 1M90O 4A47A 3LP2A 4ZHRB 2RQCA 1KD1T 4CF2A 4Z4HA 4Y2MA 3UDCA 1XMBA 4H0OA 1QVGR 2P9SB 2JFKA 2IAJA 1FEEA 2CQ0A 4FPBA 2I5JB 4DL3A 2LXIA 1Y64A 4OMFG 1F3VA 2G13A 3D2FA 3LWLA 2HNYB 4IOCQ 5C42B 3MGJA 4K8ZA 1GXLA 1R0CB 2DJWA 1HJOA 3HVWA 2I7PA 5E3CA 3MEGB 2KFYA 3Q86A 1RYSA 5JLFA 5DQGA 4BLGA 1GX6A 1K0TA 4ED8A 4CDIA 4F0HA 2M8HA 3UW1A 1FKAF 2Z8QA 4BGBA 1CZBA 2HWHA 4USJC 4OHYA 2KU7A 3PSFA 1X7VA 3HVTA 2LMIA 2UUCK 2C1EB 4K0KJ 4Q43A 2VDIA 1HQEA 3VQTA 2G8KA 1VQ5N 3D2FB 1U1LA 2KHCA 1WAFA 1UP1A 1NH7A 3EGZA 3FC9A 2ZUAA 3JTPA 4E3SA 4H5WA 2GMLA 2AKWB 2LA4A 4OZ0A 3M3ZA 2BVZA 2ZE2B 5AXLA 4WXOA 3UB5A 5CCLA 1EARA 3AO4A 4ZPCA 3TI0A 2YV0X 1KDNA 4FCYA 3MR2A 3R6LB 1SI9A 3CC4N 5CQGA 1YG0A 5HMWA 2QWQA 1FW6A 1NNEA 2MSSA 5A8WA 3T7ZA 4DUTA 3HVTB 3D9BA 5F8HA 1RHKB 2DY4A 2MKJA 1T94A 1QZ6A 1N54B 1HQEB 4FPAA 2KT5A 2WSCC 4OI4A 3HFKA 2PYJA 2Z1IA 1I39A 5MLCV 5DDRC 4PHTX 2M3DA 5CYMB 2H4WB 4BVOA 3CFPA 3EKUA 3VQCA 1HR0K 3BSNA 1CJVA 1G99A 3FFKB 3AQOA 4E8UA 5D6GA 3BKFA 4OIXA 1HNWK 4LF7F 4RO0A 3OW2M 5FPMA 2D74B 1OY8A 4X65F 1ILYA 3A5OC 5BR9A 3BQ1A 3AJDA 1MWZA 2MKCA 3BSOA 2JDJA 2B7CB 3QLHA 3GP9A 4B9TA 1FWLA 3DC2A 3FR0A 4DV5J 3CIPA 3SDEB 4IOAL 4C1NK 2DEIA 4LT6A 3W3DA 5L9NA 4NASA 1N36F 3GOIA 1GOAA 3IP0A 1DLOA 4R0JA 3W9JA 1TP7A 3MPVA 1JXVA 4Q2MA 1NJZA 2NSBA 1NGFA 1EKRA 3C7NA 3PM9A 1CJVB 4IOXA 3PV8A 2ABYA 1UVJA 2GVDA 3O5BA 3G6ES 4GNIA 3HRGA 1N32J 1KVCA 4JI3K 2H48B 2UXDK 3LDSA 1OSCA 2XZWA 1IXKA 1ASUA 3GYXB 5U47A 1WHVA 4DR2K 3ZLJA 4P2FA 4B3TF 5HVFA 2PEBA 1S22A 4J2BA 3ENOA 1LWCA 2XCAA 4OKEA 1RZMA 3I9ZA 4CW7B 2QI2A 4IXCA 4IKAA 1ZAWA 4RUHA 2RKIB 3ZTSA 3CCJS 2VG7B 3L4IA 3OXLA 3TZXA 3MR5A 1DLOB 4KRFA 4F3OA 3C7NB 2L48A 3FDSA 5GAGP 3PYDA 2Q43A 2GVDB 2E44A 4RW8A 4J7CA 2AP6A 2RAQA 4EMDA 3H2LA 1EQYA 3J80O 4DV0J 3PUFA 2RPIA 3VGSA 2WW8A 4TXSA 4I6MB 4FLUA 1CJKA 3AT1B 4BRMA 1YBTA 2HB5A 1SL0A 3OTOK 4BS2A 4RW6A 4O55A 3HPOA 4IBNA 1OS5A 2VUGA 1S1WA 2F4VF 5GMDA 3R2DJ 3UI3A 4UOGA 4WFZA 2DK2A 4DX7A 2Q97A 1RT4B 4OX6A 4TSXA 2V4QA 2EW9A 2LLZA 1BQXA 2NRTA 3G71S 3H46O 1WUAA 1DZ5A 4ZOSA 2YKMB 4A57A 3NWGA 3QFWA 3DYAA 4RW8B 1S76D 5K8PA 1IBKK 4DSJA 4AHCA 4W4MA 3DLLQ 4FL9A 2OSRA 3H42A 3MR7A 4CLTA 3UD5A 3HHLC 2R8JA 2IIHA 1VQ6S 1VLYA 1UL3A 4XK8C 8AT1B 3OYKA 1SQGA 3T5LA 4WCEL 4NYFA 3AVCA 5C25B 4L6V3 2DNPA 3DXBA 4CEQA 3RMAA 3CD7A 2GQCA 3OS0A 1S1WB 2E5LJ 3RWUA 2DRAA 3I6PA 2UXBK 2WBMA 4J2DA 2DHSA 3W5YA 1H1VA 3RJMB 3PZPA 3CCQN 4FK4A 1PC4A 2RRNA 4HTIA 1K9MO 3J7AN 1Q8LA 2A3JA 4LBPA 3THXA 3IBCB 5FLXU 1F21A 4B1ZA 3QT8A 2MY8A 4JV1A 2M4MA 3U02A 3BZQA 3DYAB 2ASLA 3CMES 4DV3J 5HOOA 4DF8A 3Q2TC 2V69A 3CIMA 2EG2A 4MYTA 1ZBFA 2HFOA 2UXCJ 1SCJB 1JQGA 3KG4A 2ZH9A 1V4SA 3PG9A 3ZSVA 5EHHA 2N7CA 2CPXA 1QHTA 2YNGA 2DHAA 5LJ5Y 1Q9XA 4K0KF 4MKBA 5AQGA 3NCIA 4I9QA 2BUNA 1B0TA 1M1GA 3AB4B 3KWGA 3U4LA 1EZZB 2XYHB 2G2OA 2HRTA 1FJCA 4MFBB 3HM8A 3LDQA 3L4BC 3FUYA 3CJ3A 2BJ1A 3MCMA 2HW3A 3SMZA 2WONA 2ZUGA 2MQOA 4JK7A 3ZYYX 4DTOA 3OYLA 1YZ7A 4QW9A 1N88A 3KJQB 2KM8B 3H3OB 1VSJA 2W24A 5DZ7A 2RD5C 3CFOA 4IH6A 4JYAJ 4EBDA 2ACMA 2HOEA 4O3SA 3ZC4A 5J2QB 4AXJA 1UW4A 3K7RA 2H4YB 4W92B 2HGNA 3Q8UA 2DH7A 4CIEA 1NDPA 4DQSA 3KWIA 1D8ZA 4DL6A 5G4DA 1AZSA 4GVLA 5A8KA 4HHJA 1F9EB 3ENQA 4FWKA 1HYSA 3NGDA 1ZA1B 1GX5A 3VQPA 1R8BA 1R8HA 3CO0P 4CYUA 4C8MA 2P1JA 4CHQA 3OR1A 3ZSZA 4ILMA 4RKUC 2QLBB 3VGMA 5EX0A 4NCGB 2XS7A 5M2PA 3HSJA 3R5JB 4A5AA 3V4IA 3BBFA 3R7NB 4PUOA 1HNZK 1NK6A 2KXHA 3RR8A 3OL9A 1PO6A 4G65A 1U1NA 5D4NA 2FLPA 2UVVA 3CJ9A 4BC4A 1HHSA 2XY7A 1WC4A 3PY8A 4LR8A 4DV5F 3V9SA 1AZSB 3FBFA 3NGTA 4OJHA 2HQ3A 5I3UA 1BLUA 1YIJN 2ZWPA 1WSEA 3HSTB 5D0HA 5B0CA 4CYUB 4MTPA 2F65A 4ILLA 2G2ZA 1IR2A 3MPUB 1S48A 4YDXA 3CB4A 1FDBA 4WFNL 1WG4A 4PUOB 3OTBA 2Q0UA 4ZVEA 5KPTA 1Q4RA 2UU9J 5HLFA 2DIUA 5AQXA 3L7OA 4EWTA 1BISA 5GADU 2CWXA 3E3XA 4PCQA 2CJBA 2MPUA 3UIQA 4BR0A 5JJBA 2CQ3A 1WF0A 4X64K 4LRAA 2BANA 2F8MA 4ED1A 2M5YA 3FZ2A 4A8XA 5I3UB 2ADCA 5KFUA 2ALYB 1RP5A 2IDOA 3T5KA 3MM8A 1S49A 3FQLA 4N7TA 3AQPA 2OUGA 3JAMU 2IRYA 4NL5A 2CH5A 3UFCX 1VRTA 1TU0B 3GR0A 3BSAA 9ATCB 4ZP7A 2G1HA 1SJRA 4ECQA 1F60B 2GAHC 3HCXA 4AUKA 2Q2RA 3QFUA 1H7XA 3QIOA 4AL7A 4OX7A 3OHRA 2DNMA 1SJ4P 4H5TA 4CO1A 1NKEA 4JI4K 1W97L 3P4UB 2JC0A 1P8ZA 2CJYB 1X9WA 5HLFB 5AQYA 3S9HA 4DV0F 1TUGB 3VZIA 4DCOB 4A8QA 4AL5A 1IM6A 2Q6CA 4QR2A 3MM5A 1GMVA 5B8HA 3HHKA 3ILOA 1QAXA 5F0UA 3NOGA 2HRYA 4YR0A 4J9RA 4PR6A 3JQMA 2R8GA 3LO3A 2GIRA 4LFCJ 3QMQA 3L8BA 3MM8B 2B8PA 4DV1J 1JXBA 4C0OC 4MDAA 3PTWA 4BCAA 3M6UA 4DDFA 3FK4A 4HHTA 1K1SA 2D69A 3K58A 4LF8K 3M1VB 2FHOB 2BKNA 3CCES 5GAHI 2OZMA 3KKRA 1IWGA 1NJIT 2AJ2A 5K8OA 4ID1A 1WJ9A 2PZSA 5A2QU 2VA2A 3KUEA 1KEKA 1WEXA 1PJ7A 2YHXA 4BG9A 2XLKA 3MDQA 4HLBA 3ZX3A 3MM5B 1O51A 4B3SK 4DLEA 3GE9A 1S0MA 1TGOA 3ZZTA 2U2FA 2GMJA 1X4GA 3P5BP 3GIRA 2E5LF 4YOEA 5IV3A 4HUFA 4BR7A 3Q24A 3LP1A 2FLLA 3O9RA 1FO1A 2O66A 3ULEA 5AE3A 5MAOA 1FRMA 4P2XA 1FRLA 2JFDA 4J9KA 1XMOK 2G8UA 3PKYA 1BWEA 3HPGA 4NYNA 5KAKA 5AZIB 1T9TA 4YS2A 3V81B 4CECA 5HRSA 4DV3F 3LGNA 4USWA 3AFGA 2E29A 1IJJA 4NYZA 2UXCF 4RUCA 5ETTA 3IDHA 5KFWA 5I9EB 3RAQA 3MUTP 4DFMA 2BMBA 2GV1A 1SS6A 3P5JA 3MZIA 4B9SA 5CZXA 3BGFA 1NNDA 1W25A 2HHWA 4KV8A 3LAKA 3ULEB 1U8WA 5BR8K 2EWSA 1IBLJ 2HHQA 3DAWA 2JL9A 4CZMA 1S99A 2LEBA 2Y0SD 2QT7A 3M1FA 1B0PA 2DY9A 3M2VA 1X9SA 2F40A 1H72C 1VQ8S 4EUVA 3DRYA 4PPZA 4E7KA 3SSSA 4LY7A 4N8OA 3OYHA 1ZM2A 2ZH7A 3NE6A 3TPQA 2QA4N 2VDHA 1RAGB 3P31A 1T9VA 4JYAF 3SMPA 3N01A 1RWUA 1LXNA 2ZH5A 5CR4A 2UZAA 4FK0A 1JLQA 2PDAA 2W6KA 4M5DA 5LXYA 5J2NA 4LH5A 2CA9A 2OPSA 3SXLA 3VEOA 3HX9A 3QAUA 3PO4A 5J1EB 4Q45A 2ZBIA 3QIPB 1RTJA 3P1GA 2YKOA 4MLEA 2IMWP 2VB6A 4GMJB 2R2RA 4CJVA 3CCJN 5CD4H 2JRSA 2AEFA 3AODA 4OJRA 2W9BA 4CRJA 4JKHA 1HKCA 2R2SA 2FBXA 5F8LA 3MUVP 5L1IA 4YUDA 1DJ0A 4DV4K 2I8EA 4IFVA 4JK8A 3FEXB 4EGLA 3ENHA 4M5DB 3CJAA 5GVQA 5J2NB 4HTUA 3PACA 4JI8K 1WB9A 1UVLA 1S72S 4NB4A 3MPDA 2KTQA 5KI6A 4CO5A 2BRKA 2R42A 2P9LB 5KFFA 1GLLO 3UVJB 5B0FA 1JLAA 3R7SB 5M1KA 5AQZA 2CPJA 3H1QA 2ZHBA 1RHQB 4JI7K 3MMJA 4FM1A 1V5IB 3R5GA 4ZVOB 4NMXA 4ZK7M 4HTJA 3FGVA 3QYYA 3G71N 1ZBHA 5BN9A 1U45A 1BI4A 4Y1CA 2D3OR 3WEEA 2IVPA 3SBTA 2UU9F 4IFVB 4MIBA 2JWNA 1GK8A 5JMNA 3C66A 2NXCA 5HMZA 1N0UA 3W2VB 4QU7A 4L75A 4UT4A 2CRLA 5D78A 2YNFA 2GAGC 2BE2A 4C3MA 3C6UA 3U6FA 2M9KA 3LH2S 3ID6A 2M7SA 4HHHA 1VSLA 3O3FA 2DTUA 2C3MA 4DV7J 3I31A 4FK2A 1RWPB 5ETLA 2HKEA 3U3YA 1T11A 2AGPA 4ED4A 4DR6J 2AP1A 3Q8PB 1PYSB 4K2XA 3HD1A 2HF3A 4RWXA 4HCBA 3RBZA 4IOAQ 4PZVA 5FD1A 4BRFA 1RCXB 4LBIA 1TL1A 2DGTA 2IY5B 4HI1A 1BI4B 4YOYA 4C1NI 4CESA 5HRRA 1RBRA 4CF9A 4ZJQA 3W65A 2QWLA 1RQ0A 2BJ8A 3CMEN 4CFAA 4L3KA 2GQ2A 2YNFB 2Q36A 3EVOA 2BE2B 2N4DA 3ZCMA 3C6UB 1LQ9A 1HI0P 3EE3A 5L1LA 1L3TA 4O3NA 5A6PA 3QBXA 4FOIA 3NGYA 1S6OA 1Q82O 4LFCF 3IA0A 3M6XA 4DV1F 2ZZNA 1WTBA 4BGAA 1B4SA 1TL7B 4ZS6A 5BYRA 1FRJA 2IYGA 3BO2A 2YTCA 2E9TA 1MMNA 2K06A 1ZBUA 4WJBA 4IO9L 3GZ7A 1RHUB 2R7WA 2LSNA 5FPEA 3L3UA 2M88A 1NMNA 2QEXN 2HG4A 3SJHA 1TL1B 4R8UA 4C7QA 5AQRA 4IO1A 5F2RA 1RBVA 4F36A 3GV7B 1NGHA 2DY1A 1YZ6A 2GQQA 1UWBA 3DOMA 4BRDA 5HVHA 2YX6A 3TQEA 3QRQA 4KPYA 2D0BA 3MN9A 3ISNC 5F3ZA 1SL1A 1QSSA 2J8SA 3OPKA 2D0CA 1NGCA 4ZPDA 3OJSA 1VSFA 4PPDA 3PX0A 3SLCA 3I32A 4IRCA 3VAJA 4B1WB 3OW2R 3V6JA 5JVGL 4H0VB 4CGHA 3CJ5A 2HHTA 3TA0A 1JL1A 4QYZK 1WORA 1IQZA 1OYEA 4E7HA 4B9NA 4DS5A 4ECRA 1NSAA 1IM4A 4ITSA 4O4GB 1QTNB 3CDAA 3FZFA 3QJLA 1VBKA 4KC5A 2BJ7A 3WNHA 3IFEA 3ZEUA 1WSFA 5HBMB 5A8RB 4JV0A 1TFWA 1UWBB 1WSJA 3MF5A 3K57A 1NGGA 4DR3J 3M8PA 4NCAA 1T0TV 4CZFA 3D45A 2AHOB 3DJCA 2VBYA 3CDUA 2CUYA 1WI6A 4X4RA 3RRKA 2EBGA 3E9PA 3MWPA 1QSYA 2WRMA 2HHPA 3N0VA 4OZ1A 3I8BA 2XMVA 2MZTA 1IBLF 4CF0A 4QWBA 1KC8T 2JVRA 2CQIA 1QQMA 1BUXA 1YVFA 1C0GA 1TVRA 3IG1A 3H59A 2VF3A 1RKJA 2HBRB 1FRIA 3DLGA 2AT1B 2ATCB 1K1QA 4GKJJ 3O44A 1AUDA 5DQIA 4BRCA 3M8PB 2Q3SA 3IWLA 3FRZA 5E3AA 1PC5A 3JQKA 3BY5A 1NGEA 4X4NA 4LFBJ 1YLXA 4U95A 3J80U 2F9JA 5LOQA 4RG8A 2VJUA 5F41A 1S6PA 3OYMA 4FXWA 2XRIA 4C8KA 1KVKA 4XDDA 4NO7A 5GMKa 4LF1A 5KFZA 3MR6A 3CI5A 3M9MB 4J2AA 3AARA 1UEVA 3R3TA 3DLGB 1F5AA 5CHIA 4BE0A 3IAYA 3C16A 3M8ZA 4QPTA 3MDFA 2YCHA 3CCSS 2EEYA 3M8WA 1TMMA 2ITGA 5DM7L 5M2UA 2ZZMA 4BDZA 1K8AO 1BOTO 2W7PA 2D9OA 4OPHA 1B0VA 1B3TA 3S1TA 1U26A 4QWDA 2YWKA 2DIVA 3R3LA 4G1QA 1H6KX 1ATSA 4DTRA 2MEWA 2Y9HA 1WHXA 4FNIA 1RTHB 3QERA 1R89A 1QUPA 2LEAA 4EO6A 2O4IA 3S3NA 1GT8A 1TK5A 5AQOA 2MJUA 4EFAC 2HBKA 2LDIA 1ATNA 2APOA 3EKSA 2DPIA 3JYTB 4JUZA 3C16B 3NH2A 2UUCJ 5A0YA 2QN6B 5HMXA 1I5OB 1RI7A 3TABA 5J2PA 1OY9A 2YHYA 2RNEA 3VETA 2BUPA 2ZM6K 4ZA1A 3TANA 2J76E 1XNQK 4O8KA 4I0WA 4C8OA 1YBAA 3NGRA 3CJ8A 1RAEB 1RHMB 3BYPA 2VQFK 4WIIA 1QAYA 1C1AA 3MPYA 2FJEB 3Q8RB 3V9ZA 4DV7F 5M1FA 1B70B 2W1BA 3BN4A 4LF6K 1S9FA 1FTCA 4RW7B 3M9NB 2RN2A 3CWJA 4LF7K 4ZCMA 2E2QA 2G8FA 3PLAA 4X65K 4CEBA 4B9MA 1E6YB 2QWNA 1ZM3A 5A0YB 1T6DA 5IV4A 3HF5A 4KE5A 2BH1A 4FW1A 3FBEA 2HBLA 4UUWA 3HDSA 1UVIA 4KHMA 1TUVA 3IR7B 3CIZA 4DS4A 1ATRA 4WFNQ 3W64A 1BXNA 4O5FA 2V6AA 5C10A 5LJVA 4OI1A 4Z2XA 1HR0J 1TK0A 2QWPA 1OKJA 1R6VA 3ZSRA 3ETOA 2NS1B 5KPRA 4MLHA 2EFOA 4OZNA 1T02A 4AD6A 1ESVA 4Z7YA 3KLHA 3EUNA 4V19S 1RHJB 3O6QA 2XBPA 5I42B 3M2RB 1IKYA 1WSHA 4WU3A 2D0AA 4KGVB 4CI0B 5LMNK 1RA7A 2ZDOA 1L3VA 1JLBA 3O5TB 3T9ZA 5GIPA 2EWHA 1VQ8N 2OYQA 5D0EA 1S7IA 4ED5A 2LXUA 3PKMA 4DR4J 3QO9B 3HM9A 1QUVA 2GUIA 1NSPA 1OJ4A 3TZZA 1XERA 3SNNA 3NOCA 2GCFA 5CH7B 3GJTB 1SH2A 1S1UA 2CDRB 5AQSA 3QRRA 2UXDJ 3I55S 3A3OB 4DTNA 2NRWA 2HNZA 2QYGA 4TN2A 4DR2J 2LFVA 2OKQA 1AW0A 1CJUB 4I2QB 2V4JA 5KFDA 2C3PA 3L2WA 4F0KA 1ASVA 2FGOA 5ITHA 2QFJA 1IJEB 3C6AA 1HI8A 2P9NA 1YAGA 4KAZA 3G4SS 3KFWX 4GVEA 3RGIA 2FVSA 3AA9A 1HUXA 2RDJA 3VESA 3M6WA 4DR3F 2XSFA 1Q7YT 1OY6A 4CJQA 1BCOA 4OZLA 4ANDA 2UV8A 2KZZA 4B3OA 2X3GA 2M70A 2R7XA 1RLCL 5M1NA 1C0UA 4WFAL 3KD1E 2QL5B 4AF1A 4AYBD 5KG4A 1F3FA 3AH6A 3MM7A 2KLAA 1IV0A 4JAXA 2YWFA 3GIMA 4J2EA 3VENA 3V6KA 1G1XA 2R7TA 5KFQA 2G8HA 5IZHA 4YNQA 1JLCB 2V4JB 3OTOJ 3RMBA 3PYFA 2CH6A 2OPQA 1EWQA 4NWBA 4GKJF 1Q18A 4QIVA 2G0CA 3ZNJ1 4V19J 4Y6IA 2A42A 1VIOA 2W2PP 4OZJA 2YH0A 2V8PA 3AOBA 1D9AA 1LFWA 4DJBA 1HWKA 3N6NA 3KK7A 4B3OB 3H90A 4LFBF 3J7ZO 2P9CA 3OS1A 3G82A 5CZ2A 3K0SA 5DS7A 1C0UB 3DMJA 3QEXA 3IMXA 1IBKJ 5HQLA 4NCBA 3MM7B 3QGPA 4OYMA 4FJ8A 2DGQA 4RBVA 4NZ7A 1KQFB 1KNZA 3GIJA 4PXDA 3ZX0A 2IM0A 1U1PA 3NNCA 3IXQA 3K9KA 3TAEA 2LYVA 3VQ7A 2OPQB 4F7VA 1SXLA 1R3NA 1SBRA 2A0FB 3NCQA 3WC2A 2UXBJ 3E01A 3D28A 5FRMA 2XWXA 1OVQA 3J7YU 4K0KK 1NLKL 2CPDA 2F4FA 1NPRA 4MKYA 2OANA 3W5XA 4FYVB 5KFLA 2EFGA 3A2FA 3RW7A 5EWFA 2F63A 1YUWA 2C2NA 1TKZA 2CGJA 3TQ1A 1HFEL 2G2YA 4OQJA 5J2MA 2FY8A 2Z2LA 4CO2A 1WC3A 4OI3A 3KLEB 1SC1B 4NLXA 4USKA 4LD0A 2HIYA 3GCXP 1LK7A 4FF4A 4KGMA 3GMGA 1SUQB 1VQLS 3NL0A 4FLZA 3MFHA 2UUCF 2V34A 3BGLA 4CO3A 3E01B 4ZCLA 3C6TB 2GX8A 2JC1A 4Z4FA 3IRXA 5KG0A 1N8RT 2NZ4A 4DPXA 2RHSB 2QG9B 3JXUA 4KO0A 2OTLN 2NSCA 2HLUA 4DX6A 5C12A 2JWKA 2QMXA 4I1TA 3W9IA 3P49B 5TKWA 3DRRA 1FI4A 1Z25A 2XHBA 4N76A 2Y1RI 3IBFB 2VA3A 1M5HA 3PHEA 4IQXA 2RILA 1Z6RA 4OLOA 4BC9A 1CZ9A 2X6SA 1FFSB 5KFCA 1DURA 1FRHA 2AZ1A 2ZVSA 1IUJA 4FO0A 5K14A 1F0XA 5F8IA 1RTIA 1ULRA 4EU0A 1F5CA 4KR0B 4WZMA 2W42A 4DFPA 5DK5A 4GKKJ 3A4TA 5GADP 3R5AA 4JLHA 2HBQB 2YKPA 4P10A 1RKIA 1Y97A 1VBYA 1AT1B 1N5YA 3L0QA 2NUHA 3IRXB 2L41A 4CK3A 2LEPA 2WB1D 2ASOA 3VAMA 3U3GA 1X5PA 4RUAA 5CABA 4KO0B 1CSJA 1U0SA 4JD2A 2G8VA 2VH7A 4JKBA 2CADA 2SXLA 2O1PA 2W2QP 1HR0F 2IPOB 2CQ4A 3DRRB 2O5DA 4V19X 3H4DA 4Z4IA 2RU3A 1HNWF 4BROA 3ELHA 4DI6A 1W7WA 2PIIA 4OKKA 3MTKA 4GV6A 2OI2A 3TX8A 2ZKUA 3IO1A 1GEHA 3NS6A 4DN9A 2DTJA 1HNIA 5K14B 1N32K 4DTUA 4O0JA 1J9AA 3R6GB 3NMRA 3NH1A 1VQ4S 3ZZPA 2B4JA 4H0XB 5C5JA 3QJPA 4JI6K 4CZEA 2FPHX 1VQNN 1LWXA 4NX9A 3B4MA 2R8IA 4J90A 4C97A 4JD2B 4EBCA 3Q7CA 2W2OP 4KB0A 3C0BA 3N5BA 3D0HE 2FBYA 4KTWA 3SBGA 4DCJB 1WEYA 3VR1A 4OLBA 2W9AA 4U8VA 4M95A 2XULA 2UXDF 2Y8YA 1UAXA 3PIOL 3GQCA 1BHLA 1HNIB 4M45A 1P27B 4DR2F 3OYGA 1Y9OA 3VGVA 3LPEA 3OVAA 2MKKA 2CWKA 4K4XA 1YJ9S 3G6YA 4NEYA 2E5JA 3M6GA 3U1MA 2DNRA 4IO9Q 1YX2A 1R27B 3W7BA 2OP5A 3NNHA 4XIUA 3CCSN 5LXRA 4GO5X 1XK8A 3IBWA 1U4BA 4OHXA 2Q3PA 5AQNA 5HP1A 3AO2A 4F4ZA 3HHEA 3UQSA 2W2NP 5CAAA 3DLKA 2DFEA 2QX0A 4HHUA 3GIKA 3EDRB 3QNWB 2Z1JA 2E7VA 4XO0A 2POKA 4KHPK 1SJQA 5JVGQ 5EX3A 1WOPA 3OTOF 4IWVA 4GO7X 3KVGA 3J81O 3H7HB 2OA8A 4U7CA 3QINA 3VOVA 2RSQA 4CJFA 3GL1A 5BRFA 4LF8J 1JXEA 2QZ8A 2W7OA 1FRXA 1NMEB 2P8IA 4TY8A 3WX4A 1WUUA 5HP1B 3PNIA 3B6BA 3K8WA 4Y28C 3BDPA 4AHSA 3P83D 4OX8A 1IBKF 4WBFA 3BQ2A 2CJAA 1M90T 3DLKB 1YHQS 4NLBA 4YDUA 4IG0A 3MOZA 4USUA 4B02A 4B3SJ 3GG0A 2J4RA 3WIUA 1HRHA 2QM1A 2UXCK 3NMAA 3SV4A 3D6MB 3VEXA 3PW0A 2C3UA 3GIIA 4ZN1A 4FJJA 1GAOA 1LWEA 2UXBF 1HJRA 4G9ZA 2XMMA 1QM9A 2JHEA 3I4HX 4P75A 4M5KA 3DDIA 3VGUA 3U1LA 4E7LA 2WVEA 1LOTB 2D1KA 1WOOA 1XMOJ 3KG0A 1A5WA 2EVZA 4MQ3A 1BQNA 2K1RA 2KHOA 3D6TB 2R7SA 4WP8A 4F50A 2HPUA 4FJXA 2QWRA 4CGJA 2CJKA 2GELA 1R31A 1TMJA 1FE0A 3LAMA 4IG0B 5KFYA 2F5GA 4Y2CA 4LRBA 3AA2A 3RYLA 1HKAA 3M6VA 3AGRA 2BZ2A 1W2IA 3ZTOA 3THYA 4U8YA 2L3MA 3MM9A 3DXKA 1YJNS 4RW9A 1QQCA 5KFKA 2E5HA 1LWEB 3CUNA 3VMFB