2RKIA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase (RT) p66
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 153
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rkiA05
3KD5E 4ED7A 3KHRA 3KMQA 2KFNA 3RWUA 1A5VA 3H4BA 4PQUA 3NHGA 2GIRA 2V0NA 3VQEA 5C42B 1WSHA 1RTJB 2HW3A 5KFTA 4Q8EA 2ZD1A 3C6UA 3K57A 4BDZA 3S3NA 1TAQA 1LWFA 4YMEA 3HHKA 4O4GB 4K4UA 4IG3A 4BWMA 1T05B 3VQAA 4YR2A 4B9MA 1S6PA 4LQ3A 3ZSVA 2HMIB 4DFJA 2R8HA 1NOZA 4GVMA 4F2SA 3UDLA 4K4ZA 4OKKA 2HHQA 4M3UA 3NH2A 3IRXA 4E7IA 4KBIA 3HP6A 3UQSA 3HVTB 4W5QA 3QIPA 3DM2A 3RBDA 3SUPA 3HVWA 1Z4UA 3TI0A 4CFBA 3BJYA 4CEEA 1S1XA 3EZ5A 4MIAA 3IS9B 1GOCA 4Z0UA 1IKYB 1UA0A 1U4BA 3CDEA 1U45A 1TK5A 2OPQA 4ECXA 4O0IA 2VG7B 4WE1B 1BQMA 3M8SA 3KHHA 3CWJA 2C2RA 2RF2A 4DL3A 4DG1B 3DMJA 3DOKB 1RDCA 4B9LA 1XHXA 3PJXA 3QIDA 2OPRA 4NLWA 4ED3A 3V9WA 3C6TB 1JLGB 2FLPA 3N6LA 5KT7A 4BE2A 3M8RA 4I9LA 3O3FA 4NRUA 3MECA 1FKOB 4DQQA 4NLOA 1YT3A 3V9UA 4CHQA 3M9OB 2VG6A 3OYGA 2IDOA 3QNNA 1S49A 1JLBA 1HARA 1HPZA 4G1QB 1QUVA 4I2QA 3TARA 1L5UA 4CCHA 3V6DA 4FBTA 4FK4A 3PZPA 5KFBA 2E6LA 4CJKA 4MKBA 3ISND 1RT7B 3E01B 5KFZA 4ECVA 1LAVA 4HUGA 4KHQA 1XHZA 2V9WA 1X9SA 3V4IA 2JC0A 3G6VA 2J6TA 3WNGA 4MFBA 4N56A 1DTQA 1ZBLA 4O3QA 4Z4GA 3ITHB 4QW8A 3P1GA 4WFXA 4NLGA 2XY7A 3I5BA 1QQCA 3LPTA 1RT5A 3E51A 1Q9YA 1QSYA 2G8UA 2D3ZA 4F4WA 4FJIA 4DL2A 3L8BA 2IC3B 2Q3SA 1R0AA 3S9HA 5J2QA 4H4OA 4W5TA 5K14B 4R8UB 4CJPA 4FLUA 2IAJB 3C94A 4RW8A 1D0EA 2E9ZA 3U3YA 3JYTA 1JLCB 5HLFA 3H2LA 2KW4A 4XPCA 1JLAB 5EWGA 1EX4A 1SV5A 4NLVA 1U04A 1JX4A 1K6YA 4NLXA 3OS2A 4J9KA 3UPFA 3M8PB 1J54A 4C8LA 4R5PB 4KV8B 3QLHA 3ZSZA 2A1RA 1RBTA 3GILA 1HYZA 4B3OB 1NOYA 4TSXA 4NCGB 4FJXA 2IM0A 1S0NA 3VQDA 3L2RA 3MAQA 1ASVA 4J2BA 4KHUA 3GYNA 1WSEA 3OYNA 3T5HA 4Z4EA 1MU2B 2X6NA 4J9LA 4QW9A 4BE1A 3KOAA 3KIOA 4KSEB 4OJRA 1RT2A 4F3TA 1FK9A 2BE2A 3T3FA 4XPEA 4QCLA 3SV3A 1CXUA 2HNDB 1SKWA 2JGUA 4J9OA 1C0UA 3LP0A 4NLUA 3KK3A 2B43A 3NF6A 2D3UA 3ZSYA 1SH0A 3F73A 2GUIA 4Q43A 1RYSA 1RT4A 3QEPA 2W42A 3GIMA 1L3TA 1DLOA 4PQUB 1NKCA 4CEAA 3AVBA 4IOBA 3GQCA 2R2TA 2QV6A 3V1QA 4HUFA 3LZIA 2XY8A 3AVFA 5EDWA 3G6XA 2IOCA 5KT4A 3C6UB 5KFGA 3T1AA 2ILZA 4ZPCA 3LWMA 1L3VA 1LWFB 4ECQA 3KLGA 5HP1A 1S1TA 1REVA 4IG3B 3L2UA 3DI6B 5T14A 5D3GB 1S6PB 4DTJA 5KFUA 3ISNC 4CHNA 3DRRA 1XR6A 5HRSA 3V1OA 1FXXA 2FJWA 3NE6A 1RTDA 3OYLA 3AA2A 2Z1JA 3IRXB 3OYEA 1U09A 3LP1A 4J9NA 5KFAA 3QIPB 3DM2B 4QPXA 2GV9A 5JS1A 1RBUA 4Q45A 1S1XB 2E9TA 1C6VA 4FJKA 1HJRA 2G8IA 3TAMA 3QINA 4CJSA 1U48A 4Q0BA 4O0JA 2OPQB 3NDKA 2BANA 1BQMB 3SQ4A 4IFYA 2RF2B 1VSFA 4KE5A 4LQ9A 3ZSXA 5HBMA 3DLKB 1JL1A 1JIHA 4OGCA 2VA2A 4NLRA 4O55A 4CGHA 4RNHA 2HWIA 4AHRA 2XC9A 3BSNA 3KLHA 4OL8A 1D5AA 4CESA 3DLHA 1KHVA 4YFUA 3MXMA 1EP4A 4KRFA 3EYZA 4F4ZA 3RRGA 4I7FA 3WNFA 2ASJA 3ZSOA 3GIJA 4AHVA 2HHUA 1EKEA 4FXDA 1LWCB 3MR6A 4DMNA 4Y34A 1IKVA 1JLBB 1HPZB 4DFPA 4I2QB 3V6DB 4O4GA 2O5DA 1JKHA 3PW7A 1W0HA 4FZZA 3AVHA 5SZTA 1T05A 4IH6A 1T8EA 3SUOA 2P1JA 1CXQA 4KHMA 2EHGA 5J2PB 3NAEA 1RDBA 4FZXC 1TKZA 1B92A 3V4IB 3SNNA 2BRLA 5DMRA 4KFBB 5KFIA 4OVLA 1DTQB 4RW7A 2Z1IA 3AVIA 4M45A 1D9FA 3PV8A 4B8CA 4O3PA 4G3IA 2C22A 4CHOA 3RMCA 3G0ZA 4RZRA 1JXEA 1TK0A 3AVMA 1RT5B 2YKNA 1X9MA 3RB6A 1X9WA 4ID5B 4O44A 3M9NB 4EYIB 5F8GA 2FVCA 1VSJA 3DLRA 4RUCA 5HROA 1R0AB 3NGDA 1WAJA 3DYAA 1J53A 5J2QB 4E3SA 2B6AA 4LH4A 4B9UA 4KHRA 3AVNA 4RW8B 1HYVA 3MXIA 2FVSA 3JYTB 1VSKA 4Y2CA 5HLFB 3QIOA 3CO9A 2DY4A 1SL0A 1SKRA 1N56A 3QZ8A 1LWEA 1VSEA 4IQXA 2HB5A 1T3NA 3SPYA 4E1NA 3BGRA 5L1IA 4ECZA 2ITGA 4OLBA 1RNHA 2HVIA 2XGQA 4CK3A 4WYLA 3QLHB 3RR8A 2R8IA 3U6FA 4NYZA 4DS4A 4RW4A 3DLGA 5HRNA 4GC7A 4JRPA 1CSJA 3RB4A 3PX4A 1FK9B 2BE2B 2XRIA 3PR5B 3KKRA 3DLEA 1IH7A 4YR3A 2PY5A 4FLVA 4B9TA 3KLEB 3M8QA 4ZTJA 2DFFA 1C0UB 3LP0B 3KK3B 1RBVA 4E19A 3NF9A 3P5JA 3OYAA 3RRHA 1RT7A 4OKEA 1RT4B 2UVWA 1A5WA 2OZSA 4KTWA 3VA0A 1DLOB 4PWDB 5JS2A 1UAXA 1XI1A 3ZT2A 3ITHA 4KHNA 5F8MA 5KT5A 3HVAA 3NKYA 4JRQA 1BIUA 1Q8IA 2Y1IA 2AGPA 4CFCA 4JUZA 2QKKA 3I0RA 5DK5A 4MKAA 4WYWA 3EZUA 4DSIA 3KLGB 5HP1B 2F8TA 2IC3A 1S1TB 2R2UA 3AVKA 4W5NA 1TK8A 4B9NA 2HHVA 4YNQA 1QSLA 5T7BA 4R8UA 3OLBA 1OS5A 4AHCA 3DRRB 3L3VA 3OL6A 3LALA 1TV6A 4KHSA 4EBEA 5DQIA 3LP1B 3QEWA 4HVJA 4ZPDA 2F8EX 2ALZA 2D41A 3QEIA 3TAQA 4MK8A 3RB0A 2KZMA 3OSNA 3HM9A 2GC8A 2XI3A 4DLEA 4Q0BB 2LSNA 4CJRA 4DTPA 1T7PA 3O3GA 3CFOA 1N4LA 1NK4A 1CZBA 1S0OA 2BQUA 2R8GA 2YNFB 4IFYB 1A5XA 4TY9A 3K58A 4E0DA 2HNDA 2YHAA 4DTXA 4DWIA 4H54A 3KLHB 2JC1A 4WZMA 3KHLA 2OPSA 1RTHB 4NYFA 3EPIA 4H8KA 1EP4B 3G6YA 4I7FB 3SUNA 4CJFA 1N48A 3V6JA 3SQ0A 2JLEA 5J2NA 1NHUA 2WHOA 4O5BA 1SKSA 1UWBA 3DOLB 5KG7A 3SI6A 1IKVB 2B4JA 4O3NA 3OS0A 2I1RA 5C24A 1JKHB 4KKOA 3OL9A 3DI6A 5KFSA 5D3GA 5KFNA 3O3HA 4IG0A 4F50A 4HUEA 2ATQA 4M3RA 4ECUA 3L2WA 1TKZB 4LSLA 5KG1A 4WFZA 4RW7B 4TQRA 4CGJA 3LP2B 4J9RA 2JEFA 2UUWA 3ZCMA 4FJLA 2YKNB 5DQHA 4FJGA 5KG6A 3KLFA 5KFMA 4O44B 4B08A 1UOCA 3HPOA 2WONA 1ZYQA 5HROB 5CYMA 3N6NA 3TABA 1RILA 4DL7A 3DYAB 2G8HA 4GMJB 2B6AB 3CIZA 4FJ8A 3K5MA 3CDWA 4UQGA 1RT3A 3DLKA 5KFJA 2FBXA 3NH0A 1LWEB 5KFCA 1JLEA 4MK9A 3CJ2A 4OLAA 3QESA 3BGRB 1N5YA 1KCFA 4CEOA 4DSJA 3I5CA 2HHSA 2RDIA 4HTUA 4R0EA 4ZPAA 1U49A 4ECSA 4IDKA 2RKIA 4RW4B 3DLGB 1C1CA 3PJWA 3K5OA 5KG3A 4K4XA 3VN5A 2FVQA 5EWEA 1LWCA 3QETA 1UA1A 1ZTTA 3NH1A 3MR2A 1B9FA 3DLEB 4FCYA 3M8QB 4HKQA 4YR0A 2JEGA 3KMSA 1WSFA 5J2PA 5DQGA 4DF8A 1T03A 3MFIA 3TWHA 2HNYA 1TL1A 2HWHA 2FVRA 2Z1GA 4KFBA 1Y97A 2AU0A 2JEIA 3KLIA 4NCBA 3KK1A 1QHTA 4O3OA 5I3UA 4DL6A 4CF9A 5KI6A 3TQ1A 4ID5A 2C2DA 4RUAA 4FLZA 3I0RB 3QEXA 4W5RA 3C95A 4IBNA 3OHBA 1YVFA 4KTZA 3ALYA 5CZ1A 4QWBA 3NGZA 4CGDA 1NK0A 3ZSRA 4FS1A 3PW0A 1TV6B 1LW2B 3CFPA 4DU3A 3RMDA 2VA3A 1KLMB 4O3RA 3ZT4A 4CERA 2ASDA 1CLQA 4M41A 2J6UA 3KKSA 3LAKA 4ECYA 3H5XA 1D9DA 3H4DA 2P5OA 3OLAA 3AO1A 3MEDB 1Z25A 2VWJA 3RBEA 1T94A 3VA3A 1N6QA 4GC6A 4B8AB 4U6PA 3TAFA 5KG0A 3LDSA 3BQ0A 2R2RA 3KLEA 4U7CA 4J9QA 3CJ0A 4CFAA 4KPYA 4EO8A 4FVMA 4TYBA 2QKBA 3OHAA 5F8NA 1GOAA 1KFDA 3HPHA 2WTFA 2BR0A 4Y3CA 2OPSB 1SL1A 1TVRA 4IH5A 3OJSA 3K2PA 3CFRA 4NYNA 4J2AA 4FJMA 3CDUA 2ASLA 3RTVA 5E41A 1TQLA 1VK0A 2C28A 4DQIA 4PWDA 2DFEA 3NF7A 1RT6B 3HT3A 5J2NB 1RDDA 2OZMA 1Z26A 4RNMA 2E6MA 1C1BB 3QNOA 4PY5A 1UWBB 3HVRA 3V9ZA 4KAIA 1TKDA 4I2PA 4NLYA 5C24B 3HXMA 2GBZA 4KKOB 3VQSA 3AVGA 4NLPA 4LY7A 5KT3A 4IG0B 2DPJA 2QE5A 4O4RA 1RT1A 1RA7A 4EO6A 3DRPA 4LSLB 3IGNA 3TAPA 1L3SA 5F8JA 1S6QA 1NKEA 1BL3A 3MXJA 4TYAA 1O1WA 3EY1A 4FJNA 4CJTA 5J1EA 3EPGA 4JS4A 3KLFB 4ED2A 3AO3A 2WONB 5CYMB 5KFWA 5DLFA 2O4GA 2YNIA 5KRSA 1JL2A 3UIQA 3OYBA 2RDJA 3LWLA 3BDPA 3OS1A 2YNFA 3D28A 1RT3B 1S5JA 3I8DA 1WN7A 4DQRA 3QZ7A 1NK9A 3GV5B 2VWKA 4K4YA 1JLEB 3SV4A 3QYYA 3AVAA 1LV5A 4M3ZA 3NGIA 1HYSA 4GW6A 3FSIA 1N5YB 2WB4A 4FW2A 4J9SA 1KRPA 1RTHA 2ETJA 1NJXA 3CM5A 3PR4A 4KB7A 2FBYA 5KFHA 1JLFA 4BDYA 4IDKB 2RKIB 3M9MB 4XIUA 4ELUA 2UVUA 2RN2A 3PX0A 1C1CB 4CHYA 1WNSA 4CIEA 3TANA 1QAIA 3VQ6A 4CGIA 2UVVA 3DOLA 4Z4HA 3VQCA 3SQ1A 3H98A 4DQSA 4CIGA 4W5OA 1XR5A 4ZVEA 2IM1A 3SYZA 4CK1A 4DTRA 3MF5A 1HQUB 4E89A 1DTTA 1T03B 2HNYB 1TL1B 2BGGA 4ELTA 3K5NA 1MMLA 4M3XA 3ZSQA 3Q8RB 3MEEB 1Q9XA 3KLIB 3VQPA 3KK1B 3LP2A 1EETA 5I3UB 1F21A 3DRSB 2E4LA 4E7LA 3LP3A 1HNIA 4ZVGA 4IRKA 3SCXA 1KVCA 3FDSA 1YTUA 3PW2A 3NAIA 4AHTA 2HNZA 1SH2A 4DU1A 1HQEA 3TAGA 4EEYA 4ECTA 4O3SA 4DFMA 4CEZA 1XR7A 3IN5A 4IKFA 3NGYA 5FROA 4ED1A 3VQ8A 1BQNB 2XHBA 4JS5A 3FRZA 3MFHA 3BSAA 4NRTA 4K4SA 4M42A 4DS5A 3AO2A 5L9XA 1S9GA 5DGAA 3NCIA 1S4FA 2PZSA 1K1SA 4DSKA 4C8NA 2CJQA 1LAWA 3AA4A 1HNVA 1NKBA 2VG5A 4QWEA 3VQ7A 4Z4FA 3PY8A 5J2MB 1N6QB 2AQ4A 1VSIA 5KFOA 5FDLA 5I42B 4RW6B 4ZHRA 4FLYA 2XY5A 4FJ7A 4E7HA 1KVBA 4PUOB 1VRUA 4E1MA 2P5GA 4QOZB 4FK0A 4Y2AA 5KFYA 1TKTA 3BR9A 3OL7A 1GOBA 3IG1A 1TVRB 3SQ2A 1YVUA 4IFVB 4FLWA 2FJXA 4DTUA 5DG9A 2ZKUA 2IJFA 2F96A 1IKWB 4K4WA 2AWZA 3HYFA 1CZ9A 4BWJA 2IA6A 3GIIA 3NFAA 2I5JA 3P83D 4I2PB 4KI4A 4RW9B 4ED6A 3WNHA 3D45A 2PYLA 3TAEA 4M3WA 1IO2A 1HRHA 4M94A 2C2EA 3V6HA 4DLGA 4EYHB 3OYDA 3ZT3A 4CIFA 1S9FA 1NJZA 2BDPA 3AO4A 4NLQA 1BCOA 2BQ3A 1RT1B 4CJLA 2JEJA 1WSJA 2IBKA 3DRPB 2BRKA 1WSGA 4H4MA 1LW2A 1RBSA 3OL8A 2G8WA 1S6QB 1ASUA 4K8ZA 4EBDA 1KLMA 2AJQA 2R8JA 3D5MA 4YQWA 3KLVA 3MR5A 3VQ4A 3A2FA 3TR8A 4Y1CA 4DSFA 3OYMA 4QAGA 1L3UA 4N76A 3BQ2A 5J1EB 1KSPA 1NHVA 4NLSA 1XWLA 3FFIA 4MIBA 3RAQA 5L1JA 3AVLA 2YNIB 2DFHA 3MEDA 2V4QA 3SFUA 2D5RA 2KFZA 4QWDA 4EZ6A 4E7JA 4Z4CA 4F4YA 3CM6A 3VQ5A 4M95A 3PW4A 4FBUA 4OKJA 3NBPA 1WNEA 4FLTA 4TN2A 3HK2A 1BI4B 1W9HA 1HYSB 3BREA 1SUQA 4LD0A 1D8YA 3CVKA 5DG7A 2F8SA 3T19A 2AGOA 2R8KA 3LAMA 4CJQA 1NK7A 2AGQA 1JLFB 1J9AA 3V6KA 1KLNA 3HP9A 1C0MA 2O4IA 1RT6A 2W9CB 5KG4A 2OH2A 4NCAA 1RDRA 1C1BA 3LANA 3QO9A 5C5JA 1LW0A 1RBRA 3Q8SB 5KFEA 4KREA 4B9VA 2PYJA 4ZVFA 1W25A 4DTSA 3QGGA 1WLJA 4NZ0A 3S3OA 4IKAA 2NUBA 4DL4A 3DDKA 1DTTB 1VSMA 2YNGA 1D1UA 5KFVA 3AA3A 4M3YA 1C1AA 2A1SA 4MH8A 3IGVA 5EU7A 2YNHA 1BISA 1I6JA 2W8KA 3K5LA 1EETB 5JXSA 4ZPBA 2R2SA 2W7PA 1KTQA 2XWYA 3PW5A 3TVKA 1I3AA 4K50A 3PO5A 2CKWA 1HNIB 2XGPA 1JXLA 2HNZB 4ICLA 3NF8A 2ZE2A 2IGIA 1HQEB 3QEVA 4FM1A 3JSMA 2Y1JA 4Q5VA 2OPPA 2HHXA 4MQ3A 3AVJA 1HMVA 2IM3A 3N6MA 1KVAA 3AVCA 1S1VA 1VRTB 4JLHA 4WXOA 4CJUA 5HRPA 1RAJA 3V9SA 4HCBA 2FLNA 4QWCA 3PVXA 3ULDA 3KTQA 3CJ3A 3H40A 3O4NA 1S97A 4KAZA 3NL0A 4Z4IA 4ZVHA 1S9GB 3SI8A 4FW1A 1QE1A 4CJ5A 3ASMA 2WRMA 3QGHA 2WOMB 4DTNA 3FQLA 1HNVB 4JV0A 2VG5B 4DFKA 3Q8QB 4NLDA 4LSNA 5KFRA 4RG8A 4URQU 5FDLB 2AX0A 4ZHRB 4IH7A 5L1LA 1VRUB 3VQBA 5KFXA 2P51A 4CECA 1HQUA 5KFDA 1TKTB 3OY9A 3IG1B 3OJUA 4CK2A 1GX6A 1GX5A 5CY4A 1S48A 4CF2A 3MEEA 1WSIA 4N41A 5SWMA 3CYMA 4FLXA 4ZP8A 1RDAA 3PUFA 3O4QA 3DRSA 3B6PA 2IM2A 4CJEA 3B6OA 3KJVA 4MK7A 4DEZA 2I5JB 3H5SA 4IR9A 2G8KA 2XCPA 4YP3A 5KT2A 2W9BA 1QSSA 2DTUA 3HSTB 4K4TA 2DPIA 3ZT1A 1ASWA 3Q8PB 4FJJA 4CJ3A 4Y1DA 2XY6A 2X74A 2V4RA 4JV2A 2Z1HA 4H4MB 1TKXA 4ZMMA 1BQNA 4FZYA 1S1WB 4URSA 3SPZA 1IG9A 4TQSA 3NMAA 1NJWA 3PO4A 1S1UA 1JLQA 3CG7A 2YKMA 4J9MA 2ZQBA 3CQ8A 3FFIB 4X2BA 4URGA 1RTIB 4OPKA 5CZ2A 4K4VA 3BQ1A 4DTMA 3RR7A 4DSEA 1C0TA 3HJFA 3QGIA 4CHPA 1TL3A 5J2MA 3S3MA 4ELVA 1IKXA 3F9KA 2J6SA 5CYQB 4EP5A 5I42A 4RW6A 3NBPB 4CHZA 1SL2A 4FJ5A 4PUOA 4ECRA 3RAXA 3T5JA 3LPUA 1S10A 3PHEA 4TLRA 3HPGA 4OGEA 1VSHA 1NK5A 3SUQA 1SUQB 4JV1A 1TP7A 2HAIA 3MEGA 4TY8A 5F8LA 4IFVA 1NNDA 1TAUA 4FM0A 5EWFA 4KO0A 4WZQA 2FJVA 3RMAA 4ED8A 4ZTFA 1IKWA 3KNAA 4RNOA 3V9XA 3QO9B 1LW0B 2HHWA 3SFGA 4DL5A 3OSPA 4RW9A 2OYQA 4CEDA 4CGFA 4EZ9A 2X6SA 2XO7A 4XO0A 2HVHA 2KQ2A 3AA5X 2UVRA 2B5JA 2AX1A 5F9LA 2YNGB 4Q44A 4CEQA 4DF4A 4J2DA 5C25A 2D0BA 4AHSA 2ZD1B 1NJYA 5L1KA 3I5AA 3G10A 4DTOA 5DG8A 2D0AA 3D0PA 2YNHB 4CEBA 4CF1A 3V81A 4J9PA 4E7KA 1NK8A 1J5OA 4F8RA 1ZBUA 4BDPA 2WCXA 2W7OA 4C8KA 1QS4A 2KZZA 5KFQA 4CF8A 2W8LA 5FRNA 2FLLA 4ICLB 2ZE2B 1BCMA 4NLTA 4KB1A 3JSMB 4B9SA 2OPPB 3H5YA 1HMVB 1RCHA 4KHWA 4WFYA 5KFKA 1FKPA 1X1PA 2HHTA 1S1VB 3KHGA 1ZBFA 5KFPA 4IR1A 4KI6A 1BI4A 2OA8A 5KG2A 1RA6A 3BSCA 4FS2A 5KFLA 1QE1B 4CF0A 4TXSA 3H08A 4HCCA 1JXBA 4FM2A 5KTQA 4HYKA 2X78A 3DMJB 3KK2A 1ZBHA 1YTAA 2FBTA 1S9EA 3I0SA 2BQRA 4LSNB 2W9CA 2OPRB 4DU4A 5F9NA 4CJ4A 4CGGA 1RYRA 4ID1A 1S0MA 2RPIA 4ECWA 3CJ5A 3MECB 3L2QA 3IAYA 4FJHA 4AH9A 2VG6B 5C42A 3BSOA 1RTJA 2QK9A 4F2RA 3HKWA 5EUHA 4CE9A 4RU9A 3L3UA 5KGXA 5HRRA 2IMWP 4FJ9A 2HMIA 3CJ4A 3KJVB 4DSLA 1C2PA 2G8VA 3ZT0A 2G8FA 1ZTWA 2GIQA 4M3TA 4L8RB 3WNEA 2R7YA 4AHUA 4ZP9A 4IRDA 4MFBB 2XCAA 1ITGA 2W9BB 4PA1A 3HVTA 4ZP7A 4CJVA 4FYDA 1K1QA 1VRTA 3H59A 3IS9A 1TKXB 3NAHA 1IKYA 3KD1E 3AV9A 3K59A 4H4OB 3VQ9A 1S1UB 1U47A 2VG7A 3HO1A 4WE1A 1JLQB 1KFSA 1NK6A 2YKMB 1EXQA 4DG1A 3RB3A 2WOMA 1SV5B 3DOKA 2IS3A 2IJNA 1WAFA 5F8IA 1C0TB 2EX3A 1TL3B 3OYCA 1IKXB 4EBCA 1TGOA 5KFFA 4K8XA 3C6TA 4CFDA 3T5LA 1JLGA 2W9AA 3HL8A 4OPJA 4AILC 2FBVA 1FKOA 3UR0A 4RNFA 3VQQA 3FQKA 2FC0A 1I39A 4EP4A 3OYKA 1ZBIA 3MEGB 4TY8B 4DQPA 4CEFA 1RT2B 4G1QA 4ED0A 1VSDA 1XC9A 4KO0B 4BACA 5JUMA 5F8HA 4KHYA 3ICLA 5FRMA 1IM4A 3E01A 4KTQA 2YV0X 3OVNA 1QAJA 2QXFA 4FK2A 4C8OA 3U3GA 5KGWA 3V1RA 4F4XA 2D0CA 4ZP6A 2B5JB 2EC0A 5C25B 4WXWA 3H5UA 2XI2A 3ZSWA 3DLBA 2KTQA 3OYFA 3LZJA 1S1WA 4C8MA 1REVB 1ZETA 3V81B 3GV7B 1J5OB 5K14A 3PX6A 4RNNA 3MTKA 4Q8FA 2IAJA 4IRCA 2FVPA 4F4KA 1JLCA 1BIZA 2D7SA 3MR3A 1JLAA 1RTDB 3OYHA 1RTIA 1B9DA 2E9RX 1QTMA 4CJWA 3L2VA 3RMBA 1SH3A 1BHLA 3T5KA 1VSLA 4LH5A 4HHTA 3G86A 3M8PA 5CYQA 1FKPB 3QERA 4R5PA 4KV8A 3THVA 4N5SA 3SZ2A 3TAMB 1G15A 4KB0A 4B3OA 3OYJA 2ILYA 3GV8B 3AO5A 5DGBA 2WK4A 5KT6A 1KHWA 5KRTA 4NCGA 2BANB 3OYIA 5DLGA 1MU2A 5HBMB 5KG5A 2UUTA 4J2EA 3SJJA 3KK2B 4QWAA 1S9EB 4BE0A 3I0SB 1BGXT 4N47A 4F3OA 2ATLA 3GIKA 2YHBA 4I9QA
chains in the Genus database with same CATH superfamily
2E1PA 2YWEA 4DV3F 3KMQA 3W7BA 1UVIA 3CJSA 1SVDA 4PQUA 2E66A 5I3QA 5DO2A 2GIRA 3Q86A 2E5GA 5GADI 1RTJB 4NA1A 4W92B 4Q8EA 3K57A 4JK9A 4CH0S 4O4GB 2NREA 2OHDA 2KVQE 1T05B 4YR2A 4H4KC 3CD0A 5D77A 1YSJA 1RCOB 4LQ3A 2RHSB 2XMJA 4P2SA 4M1KA 3HP6A 3UQSA 4OI6A 4KJIA 2XEXA 5AQQA 3C16A 4DR7F 1Z4UA 3I4HX 1QTNB 2QLBB 3IS9B 1W2BM 3PSIA 1UA0A 3F0NA 5LMNF 1K8AT 3CDEA 4PXDA 1MSWD 4CO4A 2OPQA 4DR2K 4O0IA 4WE1B 1VQSA 3KHHA 3MMCB 3HM8A 1IN0A 4HI2A 2UUBJ 4C0OC 4F0KA 2M0GB 2P6SA 3FMBA 2CDRB 2UUCF 2O8FB 1QHAA 5ETVA 2P9NB 2R7XA 3S01A 2YWKA 3ZETA 1OSDA 3WHIA 1CJTB 5LSRA 2KG1A 1DEJA 4B3SK 1CJUA 3R1XA 3D7EO 3M8RA 3D1HA 4I9LA 1EWRA 1RHJB 5A8KB 5DZ7A 5CHIA 3R8YA 5FPEA 3ZNJ1 3W8PA 1HPZA 4I2QA 2WZ1A 1R3NA 4X66J 4HT7A 5KFBA 2E6LA 4CJKA 2QWNA 1E6VB 4A8XA 3H3OB 3E01B 5KFZA 1FWKA 1X9SA 1QVFR 1NGDA 2JC0A 3WNGA 4I67A 4G65A 4DPOA 3Q23A 4O3QA 2IVFB 4QW8A 3P1GA 4JKEA 1QQCA 1RT5A 1Q9YA 1QSYA 2G8UA 4H03B 1IJFB 3L8BA 2HURA 3O6QA 3ENWA 3VGKA 4C48A 3S9HA 4HHJA 4GVEA 5C7PA 3HHNB 2NRHA 4Z94A 3M4XA 3T1YF 3M32A 2E9ZA 3JYTA 2AZ1A 2I38A 2CYYA 1IBMJ 4YOWA 2JX2A 1SV5A 1GTHA 1U04A 1PBUA 4HHUA 5LSOA 4NLXA 3OS2A 2BW7A 3WXKA 3BB5A 1URNA 4DR3J 3ZSZA 4YB7A 2HQFA 1RBTA 1HYZA 3R5GA 1JCEA 1VR6A 4TSXA 3TP2A 1Q7LB 5DJBA 3K8VA 4FZVA 2IM0A 1WI6A 3GYNA 2OTJS 3EWGA 3T5HA 4Z4EA 4LF5J 2GHVC 3KOAA 1RT2A 4KR0B 4BC5A 4ZCKA 1CJVB 1FRLA 1CXUA 4DR1F 2RD5C 4BRLA 4J9OA 4NLUA 2JRSA 3F73A 3M30B 3ZSYA 2PA8D 2N7YA 3HD2A 4WQ4C 4QJVA 3BYPA 1D4XA 1RACB 1TTHB 2DGUA 1DLOA 4EHTA 3NMUA 1NKCA 3GQCA 1Y3JA 2QV6A 4CI6A 6AT1B 2XY8A 1FKAF 1DZ5A 3IWXA 3G6XA 4DBQA 1RISA 2F5GA 3GFYA 3IAM9 4ISEA 2ZOMA 2L48A 5D3GB 2YKPA 2B0GA 4NX9A 1FCAA 1NO8A 5KFUA 2FJWA 3HZGA 1RTDA 2UXDJ 4DR5F 1D09B 3KDNA 1U09A 2EXUA 3TJ8A 4J9NA 4NE9C 5JS1A 3MTJA 2OD6A 1N34J 4LF8F 3LTOA 2DGWA 4ZVOB 3DLJA 2GMJA 3LW5C 4JKGB 3NNAA 4HWIA 2JFDA 1BQMB 3SQ4A 2KM8B 4IJAA 2J0WA 2ZGZA 4DB3A 1TMJA 2RF2B 5M1PA 4LQ9A 3ZSXA 3IFRA 3L7PA 1FRHA 2WW8A 1JL1A 5B0AA 4OGCA 1VQ7N 4CGHA 2HWIA 4FKXA 2VFTA 2AYMA 5RUBA 5CXTA 3H2VE 5GIPA 3VR1A 4CESA 2IDEA 3DLHA 2O8DA 4PWWA 1T9TA 4YFUA 2FSKA 4A8KA 4KRFA 1EQMA 4FN5A 2F7TA 3WNFA 1H3DA 2MKHA 3TA0A 3ZSOA 1C0GA 1B70B 2HHUA 1BWEA 4FXDA 2FSJA 1VHXA 1SS6A 1LWCB 4DUYK 3UVJB 2X7IA 3V6DB 4KGMA 4BCAA 3PW7A 3AVHA 3DXMA 3MCAB 3IAS9 4ANEA 3IUCA 5GMKa 4ETZA 1RDBA 1TKZA 5D4PA 4U8VA 1JXVA 4PG5A 5HVFA 1UP1A 2BRLA 4OVLA 4G1PA 4RW7A 1RHMB 4BBYA 1D9FA 2Z1IA 3JAMU 2MZQA 4G3IA 3P5BP 2CQ4A 3CJCA 1X9MA 2EBGA 2CIMA 2KU7A 2KT3A 3CD7A 1VSJA 1WBBA 4OJHA 3HKZD 3RRKA 1R0AB 3BM7A 5J2QB 4E3SA 4OYPA 3I55S 3ZZ0A 2P9KA 4I0WA 4CZGA 4KHRA 3AVNA 4RW8B 3MXIA 4J91A 4LF6K 5HLFB 2CPIA 3GIRA 1EARA 1K0VA 3QZ8A 2XTJP 1N0VC 1R43A 3O9UA 4IQXA 4DV6F 3SDEA 3BGLA 5L1IA 3IM8A 2ITGA 2Z57B 5K9FA 2KHDA 4LIWA 2V7YA 3QLHB 3RR8A 2E1CA 3HFZB 3U6FA 1T11A 1P8ZA 3H45C 1VJQA 1TUWA 2CWKA 1R6YA 4HVZA 3FZLA 3A12A 2E88A 2MKCA 4DHVA 1CSJA 3ONQA 3QQCD 3DU5A 4BRAA 3RW6A 4L3NA 3RB4A 1FK9B 2BE2B 3EKUA 4DV0F 4FNHA 3M6VA 4W90B 2HZVA 3F41A 4I1TA 4BC4A 3MM8A 1C0UB 4E19A 1SJRA 3OYAA 4OKEA 3CETA 1RT4B 5A8RB 1TUYA 2CNKB 1XI1A 3ITHA 5E3RA 2H4WB 4JI4F 5KT5A 3HVAA 2V7ZA 4WJBA 1RI7A 3G82B 1BIUA 2EWHA 4JI2F 5BYRA 2G13A 4JUZA 5DK5A 4YB6A 2OUGA 3KLGB 2D9PA 2J8SA 3AVKA 4B9NA 3M8WA 3TUJC 2HHVA 1N8RO 4K0KK 4A8MP 1YAGA 4R8UA 3TQEA 1OS5A 2NLXA 1RWWB 2ACYA 1LK5A 1YJUA 3LALA 2XHCA 3KNGA 3A1YG 4AYBD 1C4CA 4HVJA 4ZPDA 1LQ9A 2QWPA 2D41A 2RIJA 4M5IA 4F0HA 3RB0A 4C3KA 2OGUA 4UY8O 3LO3A 4RX6A 4UUWA 2VIHA 2KZMA 3NS5A 2VQFK 3HM9A 3DLLL 2KXHA 1T7PA 3SMZA 2GMLA 2O8EA 1GMUA 1CZBA 3TNVA 3CPWR 3GL1A 3OFGA 2OMLA 4KH1B 4IO9L 4AD6A 1VBYA 2IIRA 2MHEA 4GKJK 3EDQB 1FXRA 4WZMA 1RTHB 4NYFA 3EPIA 3GFXA 3WQPA 4CT9A 4AQYJ 3A3OB 3SUNA 4CJFA 5J2NA 1NHUA 4LF9J 3OTOF 3RSEA 1WWHA 4O5BA 1SKSA 4NXNK 2Z2ZA 3IR5B 1Y5LB 1IKVB 4QR1A 3CO0P 3S6EA 5F41A 4O3NA 1E4GT 1EX8A 1JKHB 3OL9A 3DI6A 5KFNA 4I6YA 4IG0A 4M3RA 3MMAA 4YHHF 2Q31A 2ITMA 4ILHA 5KG1A 4TQRA 3LP2B 2UUWA 2MMYA 2VQEK 1HWJA 1VQ7S 4X65K 5J1PA 5HROB 2IVYA 3HBTA 4C3MA 1RILA 3KJQB 4QQBA 4GMJB 3VESA 1XMOJ 1FW6A 3K5MA 3T1HF 5GAGI 1PJ5A 3NOGA 3NH0A 5GAEI 1WUAA 5LJ5Y 3Q2TC 1RWPB 3J80O 3O1LA 2J7WA 1KCFA 2ZOFA 4OYWA 2MQMA 1JJCB 2RDIA 5D4OA 4R0EA 4ZPAA 2RE2A 2ZM6K 1U49A 3O9RA 4BGAA 2BKPA 3DLGB 5D0RA 3B82A 3K5OA 2LLZA 4K4XA 1ZM3A 3VN5A 1RWVB 5EWEA 4NYOA 1VFJA 1VK8A 4FYVB 5BRFA 3MR2A 3A0IX 4JKCA 4B1VA 1TUGB 4WF9Q 3M8QB 1HLWA 2R7SA 2VFUA 1YBUA 2JEGA 3KMSA 5J2PA 3L09A 2ZITA 5FLXO 5BR8J 4JI5F 3VAGA 1ZZFA 3SBGA 5B0FA 2HNYA 1TL1A 2HWHA 2NXCA 3CULA 3C15A 3NGKA 1YBTA 3R6MA 3MI7X 1H2TZ 4ILLA 1YQHA 3KHYA 4P72A 3H25A 2BJ3A 4D3GA 5KI6A 1UVLA 1WOPA 1CC8A 1UJ6A 4USWA 2V8VA 3ALYA 4QWBA 3OBIA 2XMVA 4K5RA 1P9YA 1FFSB 3C14A 1DAXA 1P1LA 4LRDA 2PE8A 1TV6B 4DUZK 2O1PA 1F2HA 2A2CA 2VA3A 4O3RA 2WC9A 3ZT4A 2BXJA 1WF1A 2ASDA 4DV5K 1WHYA 3O9SA 3SAHA 1YLXA 2E29A 3OXLA 5FD1A 4M41A 2J6UA 4DX5A 3DAWA 1XBWA 3EVMA 1UL3A 3VVUA 1BDGA 4WKYA 3EO3A 4A5AA 3RBEA 4BVPA 3VA3A 1NBWA 3OR1A 2A10A 2HGMA 4ANCA 3OTBA 4U6PA 3TAFA 3LDSA 3BQ0A 4NOHA 1IQTA 3OW2M 5FPNA 3KLEA 3UN2A 1GQEA 3CJ0A 4CFAA 4KPYA 3I4PA 4EO8A 3BN4A 3HPHA 2WTFA 1S99A 2OPSB 1MMNA 4IH5A 3K2PA 2DKOB 3CFRA 2KFYA 1X31C 2ASLA 4JI7K 4DQIA 4PWDA 2Z58B 1N88A 4DCPB 1HHTP 1R0BG 1RDDA 4KH0B 1Z26A 4RNMA 1FJGF 1C1BB 3QNOA 4CYUA 4KAIA 4L75A 2YKQA 3PIPL 4I2PA 1RHUB 4NLYA 5LJVA 1VI7A 5C24B 4BREA 4KKOB 1LFWA 1R8BA 4C8ZA 4NLPA 3AVGA 1SQFA 5H9EJ 1WSRA 4FWMA 2P8IA 2MQLA 3MCNA 1PC5A 2QE5A 2DPJA 4JHDA 4ZVSB 2PDAA 1IJJA 1RA7A 1YKWA 2W4PA 4UOFA 2VPXB 1L3SA 1VQYA 1YRTA 2AP6A 2E44A 4DPWA 4LFCK 1S6QA 3D1QA 3MR7A 2CGKA 4JKFA 1VQMS 4TYAA 3EY1A 1VLYA 4LRBA 2JVRA 4EFHA 4CJTA 1QLNA 4JS4A 4ED2A 3BR8A 4M5DA 1I94F 3AO3A 2E2PA 2WONB 2BX6A 5KFWA 2MY7A 2FSNA 1ZBTA 1JL2A 3M2VB 3QFHA 1X4EA 2MQ8A 3OYBA 2HRYA 3BDPA 3TSUA 2YNFA 3D28A 2LA4A 1S0VA 4LF4J 3FBFA 4DQRA 1WN7A 2ZJQL 1NJIO 1BUPA 2VWKA 1JLEB 3QYYA 1LKZA 1LV5A 2V94A 3DDIA 3NGIA 3FSIA 4DMZA 3L0QA 3D2EB 3C46A 1KRPA 4OZ2A 1SC4B 3WIUA 3NCPA 2HQ3A 4IDKB 4JOUA 4KYZA 2QLWA 4ELUA 4C3LA 1BLUA 2RN2A 5C2DA 4CHYA 4DZ6A 3R7SB 2VONA 4IUFA 3LDQA 1ZPVA 4DQSA 2RU9A 4BC7A 4CIGA 1XUPO 4GVBA 4CJ7A 2MYFA 1HQUB 5ETKA 4RPFA 3PM9A 2BGGA 3K5NA 5A8WB 1X4HA 3QBWA 3Q8RB 2HBKA 4MTPA 3KLIB 5LT5A 4RLEA 2AHOB 3M1FA 2HQGA 4LF7K 2QL9B 1GMWA 2CQBA 3RAMA 3DRSB 2H4YB 5AE3A 3EVWA 5AXNA 1YTUA 1UKUA 3NAIA 3IM9A 4AHTA 2CGLA 1SH2A 4DU1A 4EEYA 4AM6A 4CEZA 3IN5A 1UVJA 3G71N 3O9QA 5FROA 2P9UB 2W6KA 3WQTA 2XHBA 2ASMA 3W60A 2GIFA 2DHAA 3AO2A 1FWPA 8AT1B 3HHLC 2EKYA 1X5PA 2P6TA 1LAWA 3AA4A 1HKCA 1HNVA 1NKBA 4X4PA 2VG5A 3VQ7A 5J2MB 2O01C 1VMBA 2FJEB 4CLZA 2AQ4A 3IA0A 3KYLA 4ILGB 4AM7A 4ZHRA 4KT0C 3TJ9A 2G4BA 2HKEA 1XQSC 4A8QA 4E7HA 2GV1A 1JK9B 3JQJA 2Y8YA 2DHSA 1VRUA 2FB0A 3R97A 1R8HA 3PKYA 3OL7A 1YX2A 3SQ2A 2HFUA 2IY5B 3H8YA 4YDUA 1EKSA 3O8MA 3EZWA 3D67A 4DTUA 3MAAB 1A0OB 2DNPA 1M5PC 1GXUA 2W2PP 4K4WA 2ASOA 2AWZA 1ZM2A 3MWPA 4JI0K 1L3KA 9RUBA 3NFAA 5DDQC 2I5JA 1NEEA 3WNHA 3D45A 3TAEA 2P9CA 3MGJA 1VQ4S 2C2EA 3CMQA 2L3MA 1VYAA 1SBRA 4DLGA 4E8UA 3CQXA 3ZT3A 4OX9J 2C2NA 4PXEA 4WFNL 1RT1B 4CJLA 4DCHA 1WSJA 1HI8A 3DRPB 1WSGA 3TSPA 1RBSA 3MN5A 4K8ZA 2YHWA 1KLMA 3O6WA 4TU9A 4YQWA 3TR8A 1X4AA 2OEKA 1HKAA 3A8EA 3OYMA 5DZ6A 1BY9A 4Z7YA 1GLBG 4QS7A 2QM1A 4X64J 1VBZA 3J80U 2OCEA 3LF0A 2YNIB 3EUNA 2DFHA 2V4QA 3ZO7A 4Y28C 3K7RA 2D5RA 1SJ1A 2UUBF 4EWTA 2MQQA 1BMQB 5ETLA 2DJWA 1XK8A 4X84A 1EHWA 4Z4CA 2ZH2A 3VQ5A 4M95A 3VTIA 1WNEA 3ENAA 4FLTA 4TN2A 4FWQA 2NR0A 1G3OA 1HYSB 2DNZA 4ILMA 3MPUB 2GFFA 4QYZJ 3CVKA 2W4DA 3T19A 2MJNA 1LEOA 5AJ3K 1JLFB 3D0HE 3Q89A 3V6KA 3HP9A 3NGSA 4ZPWR 2DH9A 1RT6A 2FIUA 3EXCX 2BUPA 1YJWN 3OR2B 2RMLA 5KG4A 2W9CB 1GXLA 4NCAA 2HHHF 4X66F 4M7XA 2A0FB 3Q8SB 5KFEA 4B9VA 2G0JA 1A6LA 1HWIA 1RHRB 5IS2A 4DV4J 4ZVFA 3QGGA 4DUTA 2VICA 4NZ0A 1WLJA 2K8GA 4DL4A 3DDKA 1DTTB 5T7LA 2YNGA 3AA3A 2EG2A 2A1SA 3CNQP 5D15A 4TU7A 5EU7A 3ULHA 3NY0A 5AXMA 3K5LA 2N4CA 4ZPBA 2W7PA 1PO6A 3NVMA 3TVKA 1I3AA 4XH4A 3TWZA 4K50A 4QS8A 3NGTA 4RKUC 1HNIB 4NB4A 2VFRA 2D9OA 1MN9A 2P9GA 5E33A 4C6AA 2PN6A 3NXZA 4BRDA 1IBMF 2HHXA 5B0EA 3BKFA 4NZ6A 2EFOA 3AVCA 4BC2A 1S1VA 1HBUB 2FHKA 4CRJA 3GMGA 1PAUB 4R0JA 1FESA 3G8SA 4WQ5A 1U2CA 2FLNA 4QWCA 3PVXA 4DR3F 3KTQA 1H0HB 1ATNA 3P38A 1Z2ZA 3L9ZA 3MZIA 4Z4IA 4B3MJ 1S9GB 2D1CA 3SI8A 4FW1A 1XN9A 1OVQA 3I33A 2WRMA 3QGHA 2K06A 2WOMB 4DTNA 3HCXA 4LF5F 4DFKA 2XLIA 1HBOB 2WBRA 2WBNA 2PMWA 1KQSM 2AX0A 4I6MB 4NXMJ 4JKAA 2ZWOA 3G4SN 4B3RK 4OLPA 4X4TA 3W2WB 3BBCA 1XMQK 1VC5A 3OY9A 3IG1B 3CXCM 4IJNA 2VC0A 3OJUA 4CK2A 1RAFB 2DO4A 3H2UB 2OEJA 4H0VB 3GDQA 4CF2A 3MEEA 1WOQA 1WSIA 5LMUK 5SWMA 2CDQA 1RKJA 3S8SA 3VQTA 1RDAA 2KLAA 2OIHA 3UN3A 4MK7A 4DEZA 3CMAN 2E1YA 3QPIA 5DRKA 2G0CA 2AT1B 2DTUA 3HSTB 2UXDF 3ZT1A 3QATA 3ATVA 3Q8PB 4CJ3A 4OI3A 3H3NO 1VHIA 2SXLA 1YGYA 4URSA 3SPZA 3AARA 4BGBA 1N34F 1WEYA 1JLQA 1RFQA 4JK7A 2ZQBA 2BACA 4RTFD 1D9AA 2ZHOA 1HNZK 3VMFB 4X2BA 3OTCA 4ED4A 4ENOA 3SEOA 4FXWA 4OI0A 4DSEA 3ULEB 4CHPA 3TOQA 2MHNA 3GJRB 3TYTA 2V63A 3LPUA 3OVSA 1RWOB 3HPGA 2CJXB 3KUHA 1SUQB 3W5YA 1Q4RA 4TY8A 4WKRA 5A2QO 5F8LA 2QMWA 1E6YB 4DR2J 3FGVA 3D1OA 1OVYA 5EWFA 5AXLA 4JI8K 1MROA 1LOUA 1IKWA 2KH9A 3QO9B 2XSJA 4DL5A 4LBHA 3HTVA 5IV4A 3U1LA 2LECA 4EZ9A 5T41A 2X6SA 4K7QA 2XO7A 2R7VA 2HVHA 3QT7A 5IT4A 1Z6RA 2B9XA 2UVRA 4CEQA 4B3SJ 3D6MB 3NEKA 2YNHB 4J9PA 2V8GA 1FFWB 4J37A 4F8RA 1ZBUA 2QLFB 2W7OA 1PIEA 1QS4A 1YUWA 3L4QA 4CF8A 2HK2A 4ICLB 3UDVA 2ZE2B 1BCMA 3JSMB 3WX8A 2XLKA 1RCHA 1APSA 2CQCA 1X1PA 4DX6A 4UY8T 1ZBFA 5KFPA 4IR1A 5IQQA 1WDDA 4ES1A 3R2CJ 4WFAQ 5CD4A 1Z05A 3TVZA 4CW7B 2LQ9A 1RKIA 4BR7A 2X78A 2F8HA 3BV8A 3DXBA 3I0SA 2IYGA 4HTJA 3UB5A 1CVJA 5F9NA 4CJ4A 3I8BA 3TJAA 2NRVA 3AAWB 2NRXA 5AZIB 1Q95G 1NPPA 1AUSL 2HGLA 3C6AA 1IBLK 5C42A 5E3PA 4CLPA 2ABYA 2ZBPA 2BE7D 3EXYA 2GQQA 5MLCV 3OBYA 4F04B 3FEYB 3L3UA 3MN6A 5KGXA 2C3PA 2CVEA 2I2YA 3JQMA 2A6AA 5F2RA 1NMDA 3KJVB 3ADAC 4DSLA 3GB0A 1B7YB 3GJTB 2DTJA 3THWA 3MM9B 4U8YA 3WNEA 4AHUA 2ZH9A 4IRDA 2F1FA 2CQDA 3ELHA 4A8OA 2Q6BA 1VJWA 4LFAK 2E5IA 2NCKL 1HNWK 3H59A 2VB6A 1TKXB 1IKYA 3EVOA 3AV9A 2AYGA 3D3BJ 2IRXA 3K59A 3G4SS 1U47A 2MQNA 3CB4A 2VG7A 3EGNA 2DIVA 3JTOA 3BZKA 1PJ6A 3GG1A 4CBUA 4PKIA 4DV2K 4DG1A 3MXHP 3RB3A 1WKLA 1B99A 4BRCA 2KRBA 5AQLA 2IS3A 2IJNA 4PG6A 1C0TB 5F1XA 2EX3A 2ZVSA 3OYCA 2DXFA 4QOTA 3OFHA 5KPTA 1UPMB 1S59A 4K8XA 4WK3A 4CFDA 4BRKA 1JLGA 3CMEN 3HL8A 3CMAS 4A2BA 2VASA 4KY3A 2FBVA 4KIAA 3VENA 1ZBIA 4AQYF 2ALYB 5HN0A 3J81O 4LF9F 4WBFA 3CERA 4G1QA 3J80Y 2MLXA 4PCQA 4BACA 5GVQA 3ETOA 4GV9A 3ICLA 1IM4A 4YB5A 2Z2LA 2PIIA 2GVDA 2V50A 2QXFA 4C8OA 2JZ5A 3CCSS 1DY3A 1UETA 3R5JB 5KGWA 4MMOA 3CI5A 4C1NI 2FF6A 4WXWA 4OZJA 2XI2A 3O1BA 5GMDA 4XAKA 1T9VA 1S1WA 1ZETA 2CJBA 2RNEA 4DUYJ 5CYJA 5FLXY 5K14A 3PX6A 3RJMB 1AW0A 1HL6A 4CO1A 3D68A 4IRCA 4F4KA 1JLCA 3BO2A 3MR3A 1JLAA 3CGIA 3OYHA 1RTIA 1B9DA 1XMOF 1DBDA 1HD0A 1SKUB 1VBKA 3RMBA 1SH3A 3R5BA 3T5KA 3O8WA 1Q8LA 4KGVB 2JSXA 2V52B 3UCUP 1T9WA 2F8MA 4N5SA 4B3OA 1H74A 4OHXA 2E7XA 4P52A 1KHWA 3EX7B 3AJDA 5C2CA 1VQ9N 3LGNA 1MU2A 2P9PA 1S72N 3AODA 2IJRA 4NA3A 1H72C 4C7QA 4J2EA 3KK2B 4YORA 4LF6J 4CLSA 2L9NA 3FLCO 3D54A 2WSEC 4ZVPB 3KHRA 3BGUA 1GMWD 2KFNA 2K7KA 3TPQA 1R27B 2C2ZB 5BR8F 3H4BA 1QD1A 3NHGA 3QNWB 2JFKA 2V0NA 5AR0A 3VQEA 5KFTA 3MCSA 2ZD1A 3C6UA 3DDNA 4BRNA 2G0IA 2Q36A 4A59A 1HWUA 2GQCA 1M0SA 4JI1K 4BWMA 3VQAA 3TX8A 4OQJA 1S6PA 1W7WA 3ZSVA 2RRAA 2HMIB 2W41A 2V2KA 2R8HA 1IBCB 1NOZA 2HWTA 4GVMA 3UDLA 4K4ZA 1KC8O 3IRXA 4E7IA 2R3VA 4W5QA 4FVUA 3DM2A 2CQ2A 3TI0A 4CFBA 1MWMA 4YEAA 1TYQA 1V3SA 2KYXA 3POTB 3D6HB 4LBPA 4LR8A 1GOCA 5AQUA 5HAOA 5AZJA 2NQPA 3B8HA 1U45A 4FPAA 1TK5A 5BYSA 4Y00A 4ECXA 1U2VA 1UJ5A 4ZVRB 3M2RA 4UZBA 4K0KJ 4BRQA 1XNRK 3SAFA 3DMJA 4K59A 3DOKB 1FFGB 4X62K 3OV7A 1XHXA 4OHZA 3LL3A 3QGPA 2F9JA 3PJXA 3QIDA 4MYTA 2DNYA 3J7A1 4ED3A 1CULB 3V9WA 3C6TB 3LH2S 5JLHA 4LFBK 2RRNA 4BE2A 3O3FA 1KONA 1FKOB 4DQQA 4A5BA 3M9OB 2VG6A 2VQFJ 1BU6O 3QNNA 2J9EA 1JLBA 2WUSA 4QYRA 1HARA 3CC2S 1QUVA 2QEXS 4U67Q 3QFPA 4CCHA 3AGRA 4FK4A 3HSJA 5C2FA 3D9BA 1X5SA 4ILRA 3FVYA 3ISND 4DPXA 4TLQA 1M5HA 1RU1A 3VWSA 4HUGA 4KHQA 3V4IA 3NRBA 1OY6A 3I31A 3MDFA 3IC1A 4J5OA 4GKJJ 2J6TA 4RL1A 4MFBA 2NRZA 2PI4A 4F3MA 5AQFA 4OV6A 3Q83A 1N32K 2DITA 3E51A 1F6TA 2QMXA 1N5TA 4F4WA 4BY9C 1TFYA 4FJIA 4DL2A 2Q3SA 2JLGA 4W5TA 2ZH3A 2IAJB 1D0EA 4C11A 4GRSA 1WELA 3MOJB 1P27B 3K9JA 2VKZG 2FHOB 3R3LA 4LF4F 1F0XA 3UPFA 2QWRA 2QA2A 4C8LA 4R5PB 4KV8B 4BROA 2VQEJ 3NS7B 4X65J 1NSQA 4P2FA 1H7WA 4NCGB 2YCHA 5I9EB 1S0NA 2O66A 1ASVA 1WSEA 2V2VA 4J9LA 2A42A 4F3TA 1EIYB 2R7RA 4JYAK 2YXLA 3TTFA 3IR7B 2ZZMA 2JGUA 3FZFA 3LP0A 2B43A 3NF6A 2D3UA 2HRTA 2QLXA 1U1KA 4RO0A 2W42A 3GIMA 5SUHA 4PQUB 4CEAA 4CTAA 4LJMA 4H5NA 3V1QA 2ZM6J 4NO7A 3CIPA 4Z7CA 2IOCA 5KT4A 3CJ7A 3T1AA 3LWMA 4CD3A 1SQEA 3J7YP 4UW2A 5M1QA 3D2FA 1J2VA 4DTJA 4A48A 5D0HA 3ISNC 3DRRA 3C66A 4IEIA 3V1OA 1HBNA 3FMWA 3AGKA 4F02A 2Z1JA 4OZNA 1S72S 4WP9A 3LP1A 2BYCA 2OO4A 3CC7N 3C16B 2GV9A 2E9TA 1IWGA 2ZVIA 2GX9A 3W3SA 4FJKA 1HJRA 2G8IA 3TAMA 2WVEA 1EQYA 1K8AO 1ZS6A 1U48A 4Q0BA 2MZSA 4CNYA 2OPQB 5KPZA 2H54B 4HACB 1RAHB 1IR0A 2BABA 4IFYA 2ZJPQ 2GHWA 5B0DA 5HJYA 4FPIA 2VA2A 1WG1A 1SJ4P 4CLKA 1GTEA 3KLHA 4OL8A 4DUZJ 1V9OA 1D5AA 3ZETB 1FEHA 2ZBIA 5C0YA 1EP4A 3EYZA 4DR6K 2DEIA 4DV5J 3MAHA 4F4ZA 1NGBA 1CJUB 3ENOA 5A76A 2F63A 4KH6A 2A5XA 3BF4A 4F3QA 4CLFA 2HF3A 1XNQK 3GE1A 1YITS 2DHXA 1HPZB 4DFPA 4I2QB 4MLHA 4I68A 4O4GA 1RADB 1W0HA 4FZZA 1GH8A 1T05A 2NUHA 5ITHA 1T8EA 4WF9L 1CXQA 4OO1J 2BZ2A 3ZTRA 1B92A 5HOOA 3SNNA 2E5LK 5DMRA 2GJFA 2VYPA 3WEEA 4DCOB 4FO0A 3G0ZA 4RZRA 1JXEA 4WWSA 4JI7J 1TK0A 1RT5B 2YKNA 4PPDA 2NXEA 1YJVA 5FPDA 3QRPA 3M9NB 3THYB 1KQFB 4RUCA 1OJ4A 2GELA 4BRGA 1WAJA 1J53A 4X64F 2VZ9A 2OKQA 1GLEG 2B6AA 4B9UA 4H0PA 2HEKA 4HH1A 1HYVA 3M32B 3Q8UA 3JYTB 3ET6A 4Y2CA 3GBTA 4USHA 1CS4A 1SKRA 3CCVN 4EUVA 2ZJRQ 4L6V3 4B17A 3IR6B 1GLLO 3E8OA 2WBMA 1W26A 4E1NA 3SIPB 4OLBA 4LFCJ 1W97L 2HVIA 5L38A 2XGQA 4CK3A 1PJ7A 3DU6A 1CJTA 4EHUA 2R8IA 2NXUA 1KQKA 2HSEB 1NLKL 4NYZA 2Y0BB 3GG4A 4RW4A 1VQON 5DDPC 1DQ8A 5E2QA 5HRNA 2IFXA 2MKIA 4N77A 3CCQN 4JRPA 2MKSA 3CCRN 3L7UA 4JI6K 2ZZTA 2QWOA 3DLEA 1D8ZA 4YR3A 4FLVA 4B9TA 2VWBA 3ATUA 4ZTJA 2DFFA 1OY9A 4IWVA 3NF9A 3TUIC 3CCMN 4DV4F 2IVNA 3PG9A 2UVWA 1BA1A 2RRBA 2GNKA 3VA0A 1DLOB 2DEJA 2IRUA 1UAXA 3ZT2A 1T3VA 5H1SQ 2E2NA 3NKYA 1M1HA 2BJ1A 1QY7A 1CQNA 1Q8IA 3G9CA 2HLTA 2QKKA 4MKAA 2Z30B 3EZUA 4DSIA 2MDAA 3HHDA 2VL1A 4W5NA 1S79A 4YNQA 4MJKA 4OYIA 3R27A 5T7BA 4UF4A 1B7FA 1TMMA 2K2PA 3D4JA 2YJFA 2PEBA 3OL6A 4O8KA 2F65A 5DQIA 2DGXA 5IM0B 3K0JA 3UFCX 1RAAB 2OI2A 1KQSR 3ZX3A 2K1RB 3TZXA 2MXYA 3AD8C 2J4RA 3J7YU 2RDDA 1VQ8N 4NASA 4LF7J 1PCAA 1P1TA 4DCJB 1FTRA 3CXCR 4DLEA 4B3MF 1N4LA 1Q8KA 5CD4H 1Y4ZB 4BR5A 2R8GA 2OJ3A 3WXIA 1A5XA 1RGVA 1OH8A 1T6CA 4TY9A 1Y00A 2YHAA 4DTXA 4DWIA 3FK4A 1X0PA 4H54A 3I56N 4NXMF 1B64A 2RHKA 3KHLA 3EM1A 5CCMA 4FWNA 4H8KA 3G6YA 2G1HA 2VHGA 3ILOA 1YWXA 1EKRA 1KVIA 3SQ0A 2JLEA 3PCOB 1UVKA 1UWBA 3DOLB 3PACA 3K0SA 3OS0A 1HNXK 2MY8A 4P75A 3MD1A 2QO3A 5D3GA 1UEKA 1FI4A 4F50A 2ATQA 3DHWC 5BYQA 8RUCA 1TKZB 3L2WA 1NDCA 2D3O1 4LSLA 1B0TA 3O4WA 1OWXA 4RW7B 3PFOA 3SCJE 3CCLN 2JEFA 3E1YA 2HS4A 1SXLA 3J8AA 4LRFA 1YK9A 5DQHA 5KG6A 5KFMA 1NH7A 4U9RA 1UOCA 2BKOA 3ZYYX 3HPOA 2XS5A 4X4QA 5CYMA 3H42A 5GADP 2DXDA 2DIUA 4JI0J 4KH4A 3THXA 2PGCA 5DDOC 5F0UA 3CD6S 2P9KB 3A4TA 2H3GX 1GXTA 4UQGA 3MX5A 3BZQA 3I9V9 2R7QA 5KFCA 1GLDG 3SDEB 2KHCA 3W2VA 3CJ2A 1IG8A 3DFEA 1N5YA 5AE1A 3I5CA 4HTUA 2OELA 2VPYB 2F4VK 4B1ZA 2RKIA 3MX2A 3CF5Q 4KH5A 3NVKA 5KG3A 4DR2F 2VU5A 1LWCA 1UA1A 3MM6B 3J7Z5 1V4TA 1HQ2A 3D3CJ 1ZZNA 1E3MA 2G2YA 4HKQA 3MM8B 2J8AA 5DQGA 4DF8A 1T03A 3MFIA 1IBKK 2BOPA 2NXNA 3W65A 2FVRA 2D3OR 2E5HA 4ZCIA 5FPMA 2JEIA 2AU0A 1YG0A 3KK1A 4J90A 4B3SF 3F44A 2YX6A 5AJ3J 4LVOP 4RWTA 4MDAA 3VEWA 2DNKA 4FLZA 2QT7A 3QEXA 2DGOA 3C95A 4HTLA 1RZMA 4UOHA 3BS9A 4GO5X 1KS2A 5BJRA 4P10A 3HRGA 1NGCA 1WEXA 2DGVA 3HJVA 1NNEA 1SJQA 5FIIA 2FUG9 3ZSRA 1WC1A 4FS1A 3CCQS 3FC9A 1JWWA 3KFWX 3PNIA 4CLYA 3CCRS 1U0SA 4NEYA 3RMDA 1LK7A 5LL6d 4CERA 3FZ2A 1N0UA 3SK3A 1UZHA 1CLQA 2RJZA 3LAKA 3GFZA 5ADZA 4ECYA 2LXFA 1D9DA 4V1Ak 3H4DA 3CCMS 2P5OA 2M4MA 3QAUA 3OLAA 2PT0A 5F3ZA 3H0PA 2QSFA 4OYXA 2O8EB 3C7NA 3MCMA 1TL5A 2QA4G 2L08A 1N6QA 3IO1A 1XEZA 4OZ1A 1QM9A 2A6MA 3MUMP 1ATSA 2FHMA 2LQ5A 1E4FT 2PBDA 4ZIWA 4U7CA 4J9QA 4JB8B 2BBEA 5CZVA 3EJMA 4TYBA 1KFDA 3UE5A 1R8AA 2GA7A 4DV1K 1TVRA 2P9IA 2YJEA 2RE1A 4NYNA 2DR7A 1VQLN 4FJMA 2Q97A 5E41A 1U6BA 4WIIA 2CPEA 3WX4A 4OJ1A 5B09A 4Q2LA 4XDCA 5J2NB 3RSEB 1VOMA 2Z2MA 4WFBQ 4PY5A 3HVRA 3UDEA 4OIXA 3D6TB 1TKDA 2OMOA 2MKJA 1CZAN 3VQSA 4IG0B 4O4RA 4USMA 4B3RJ 3J81Y 2Q2RA 1B0PA 3MMAB 4IZ9A 4MT1A 1XMQJ 4CLLA 3IGNA 3MMVA 5F8JA 5H9FK 3ZEUA 1NKEA 3MXJA 2MPUA 4JD2A 1HW8A 2XS7A 4ILJA 2YX7A 5EY4A 3OTDA 3FE1A 2NUUG 3EPGA 5LMUJ 1Z2LA 3VZHA 1GLAG 2O4GA 2H48B 1M1KT 3MCPA 2RDJA 4ZVTB 2CPXA 1RWKB 2R7TA 2CXEA 3GV5B 4Y6IA 3U4LA 4ZCLA 2CG4A 2F9WA 4FW2A 4FWPA 4J9SA 1RTHA 3VAFA 5GADU 3PR4A 2FBYA 1SQGA 2Y8WA 2LQJA 3VOVA 2J0SD 4XIUA 1F1BB 2ROEA 3MPWA 2UVUA 4ED5A 2HIQA 1N33J 1HNZJ 2F9TA 3VQ6A 4Z4HA 2NLWA 1X8DA 4OX9K 4ZVEA 1KDNA 3SYZA 4DTRA 3CJRA 4E89A 3B6BA 4X4VA 2HNYB 1TL1B 1MMLA 3W66A 4M3XA 3C15B 3LP2A 1EETA 4FF4A 3MEKA 1WSVA 4GO7X 4DKWA 2E4LA 1Y64A 3LP3A 3VAMA 4DUYF 4JI8J 4C9DA 4ZVGA 1NCLA 4G9ZA 3ZZRA 3EZOA 3FRYA 4JP8A 2J5AA 3IBFB 1AA1B 3PDNA 1HQEA 3TAGA 5GIOA 2CPDA 3C14B 2HYIB 2N7CA 3NGYA 2EKNA 1CC7A 5HQMA 2P9SA 3FRZA 3HULA 3MFHA 2ZF5O 3E66A 1Y5NB 1ZPWX 4NRTA 4DPTA 2HOEA 1SZ2A 1XERA 5DGAA 1S4FA 4ZN1A 4ISFA 4ITSA 3PSFA 2BE9B 1RCXB 1QQOA 2RH3A 4QWEA 4Z4FA 4ZCMA 3Q22A 3OR1B 5KFOA 5I42B 2XY5A 4LF6F 4FJ7A 2QN6B 1OPIA 2KJWA 1S5ZA 4ES2A 4QOZB 3KJNB 2Y1LB 5KFYA 3BR9A 2UYTA 3JTNA 2ZC3A 2LFVA 1YVUA 1REGX 3QICA 2C1EB 4P2MA 4IFVB 2X51A 3MDQA 3B4DA 2F96A 1LXJA 2CNNB 5EN1A 4Y2MA 5J1NA 2IA6A 1X4CA 2BJ7A 4I2PB 1M90O 4RW9B 1HRHA 4M94A 2RAQA 2JHEA 5K8PA 1WC6A 4U7UD 2ZH7A 4JHDB 1S9FA 1NJZA 3T69A 2BQ3A 2IBKA 5JMNA 2BRKA 4ZPTR 1ZM9A 4H4MA 5KQ8A 1IBLJ 1S6QB 1ASUA 1FDNA 3BKTA 4PG8A 3AXKA 3W1YC 2UU9K 2R8JA 3MR5A 3JAMO 4QAGA 4N76A 1FDAA 2QL5B 1NGHA 1S77D 2ZBQA 4NLSA 4MIBA 2RUGA 4BVOA 3IWNC 5IT9U 1V4SA 5L1JA 3GTYX 1GEHA 3SFUA 4RBVA 2KFZA 1PAEX 4BHQA 4K0KF 4E7JA 1WHWA 4F4YA 3CM6A 2DNOA 2NRRA 3Q8YA 3PW4A 2Z0GA 3NBPA 1W2IA 3ID8A 4LFAJ 5IC4B 2E1ZA 5I3PA 1BI4B 3BREA 3E9OA 4HDGA 5DG7A 2AGOA 4USUA 2R8KA 4WFAL 3JXOA 2AGQA 1J9AA 2LA6A 1KLNA 2VQFF 2R9LA 1RWMB 2KT2A 1C0MA 6FDRA 2O4IA 1WB9A 3SQGA 1NUEA 2OH2A 3S7RA 1JJHA 1RDRA 3LM2A 2IIHA 1C1BA 3LANA 4HL9A 5C5JA 4FWKA 4C1NK 1OH5A 2JJ4D 2E20A 4CNZA 2YX4A 1W25A 3Q8VA 4IKAA 5KQDA 4GKJF 1F5CA 3RBZA 5KFVA 2W1BA 2DCLA 1C1AA 3OUYA 1SC1B 3DWLA 1OSCA 5JXSA 1KTQA 2XWYA 3PW5A 1PYSB 3PO5A 2Z2YB 4NXNF 3J7AP 3VERA 1U24A 2YY3A 2P2CB 4F9OA 3M2VA 4BR2A 2RU3A 2QLJB 3NF8A 1Q79A 3BO3A 4X4RA 4FM1A 3FFKB 3FBEA 2VDHA 4Q5VA 2OPPA 1WF2A 4MQ3A 3AVJA 3RGIA 2IM3A 4JNEA 1KVAA 4JLHA 2DNLA 4DR4J 3Q7CA 4M5KA 4CJUA 5HRPA 1RAJA 3UW1A 2YPZA 1JCFA 4GVLA 3CJ3A 1S76D 1T9XA 4Q7AA 2VQEF 3O3LA 4KAZA 4X65F 2F3JA 2FC8A 5CAAA 1QE1A 3ASMA 3CCWA 2EI5A 1YF5L 3FQLA 1HNVB 4JV0A 3W3DA 2VG5B 3Q8QB 3IMQJ 4NLDA 4LSNA 3MM7A 3ZX0A 5AQMA 1NU4A 5KFRA 3HZEA 4ZHRB 3GWCA 1AYEA 3OTEA 3PFEA 1FNXH 3VF6A 1VRUB 3PYDA 5KFXA 4CECA 1HQUA 5KFDA 5GAGP 1P8GA 5GAEP 3S1TA 1GX6A 2HVDA 9ATCB 1GX5A 2DY1A 2ZM6F 2HBMA 4N41A 1RUSA 3MD3A 2AJ2A 4FLXA 2FZKB 1MLAA 4ZP8A 1AFIA 3DRSA 5JJBA 2W2QP 3M3ZA 4CJEA 2HAFA 2I5JB 2HBZB 3WUHA 2B4PA 4YP3A 5KT2A 2W9BA 3SAGA 3I82A 4K4TA 4FF3A 1RWXB 3O08A 4IOAQ 3MN9A 1KP6A 4JV2A 5M2RA 2X1AA 3C8YA 2Z1HA 4ZMMA 2WSFC 4OV1A 3AHPA 4ZJOA 4TQSA 4YDDB 1NJWA 2DGTA 3RYLA 3T7ZA 3US5A 2CNLB 4JI1J 2YKMA 2PSZA 4P7TA 5JVHQ 5EOYA 4RCHA 4DTMA 3RR7A 1UEUA 2HGNA 1HBMA 1ROFA 5J2MA 2J6SA 5CYQB 5E0OA 4A57A 1SL2A 3F9MA 3HX9A 4M8LA 2CJAA 4ECRA 4DUZF 2AV5A 3EE8A 4OGEA 1VSHA 4NLBA 1YI2N 4CZJA 5CR4A 3BBBA 4DV5F 3MEGA 2K7JA 3T41A 2WFBA 1HHSA 1NNDA 4H5VA 3HFVA 3TVYA 4KO0A 1MNEA 2FJVA 4CI0B 3QMLA 1XNRJ 3AQOA 3KNAA 4RNOA 2PFDA 1NGAA 3HOSA 4ZJLA 5F0XA 4CZKA 4X62J 2AF6A 1PILA 2AJ1A 2OYQA 4CEDA 4MAKA 2EFPA 4DXLA 4XO0A 3OT9A 1MG7A 4LFBJ 4E1JA 5T7LB 3BGFA 4QR2A 2B5JA 5F9LA 2YNGB 2RQ4A 4CWBA 1NJYA 2C2MB 3R1HA 4JI7F 4DTOA 5DG8A 4CZCA 2D0AA 4CEBA 3D6FB 4CF1A 1NK8A 1U0HA 4BDPA 1NGGA 4C8KA 1K73T 5KFQA 5DM7Q 2J7UA 2GGPA 4XH5A 2W8LA 3U8XA 3LPYA 4KB1A 3FZMA 2V67A 3PLAA 4B9SA 5HL7Q 4OFZA 4ZLPA 4KHWA 1TL7A 5KFKA 1ZAWA 1Q16B 1FKPA 1N36K 2HHTA 1S1VB 2NZTA 2R7OA 4N8OA 3MM5A 4OHWA 4LFCF 1N32J 4KI6A 5E3AA 1A9NB 2OA8A 5KG2A 4KGZB 4JI3K 1BXNA 2C3UA 1RA6A 4FS2A 2HFNA 3U02A 2ZFHA 5K20B 4TXSA 2VOOA 3SSRA 4FM2A 5KTQA 4DN0A 5BPLA 1OPZA 1S9EA 5ETMA 2BQRA 2KO1A 2NPFA 2W9CA 2OPRB 4CGGA 3T9ZA 4D3HA 3W64A 4ECWA 5HMWA 1YHQN 3MECB 3IAYA 4BRFA 3ZX2A 3D0GE 2J7KA 5EUHA 4CE9A 4RU9A 1Q53A 2UXBK 4ER8A 4U67L 1Q86T 1VQ6N 5D4NA 2KVIA 4WIQA 4EAHD 3MK6A 5HRRA 2YQ3A 4FOIA 3W63A 4JYAJ 4M5GA 2XMUA 2GO9A 2OTLN 3FR0A 4TU8A 2XCAA 5GAGU 4LC9B 5GAEU 3HVTA 4ZP7A 4CJVA 1U6FA 4C8YA 3TRGA 4PG4A 1U7LA 2NYHA 3NAHA 5GAHP 2DCUB 4B1XB 4LF7F 4H4OB 3DC2A 1VQ5N 1JLQB 1CQMA 2LEBA 4B1YB 4FF1A 1EXQA 2ZH6A 2WOMA 5IQ6A 5B0CA 2F4FA 3G87A 4EBCA 2VGNA 4YY3K 2NNWA 5TKWA 3T5LA 1U1QA 4HT5A 1HX1A 2GS8A 2FC0A 3OYKA 4TY8B 1YDLA 3QFWA 2APOA 4IO1A 4CEFA 1PG5B 2B9WA 1UPPA 4WU2A 1CG2A 5IT9Y 2CFXA 4WQ4A 2A40A 2AA4A 1MROB 4CVNE 3M2UA 2CA9A 5JUMA 4KQZA 1R8CA 3H7HB 4PAAA 2XLJA 3TTDA 3K5PA 4USJC 2XSJB 3OVNA 2DH7A 3E2EA 1QAJA 5C15A 2Q0RA 2FGOA 4C4WA 4FXVA 2N4DA 1FRIA 2ZH4A 4LVNP 3NNCA 2AD9A 3U3GA 3NGRA 4F4XA 4DR6J 2P9LA 4DX8H 3ZSWA 4O0NA 5K8MA 3QAEA 2KTQA 3OYFA 1UFKA 3TA2A 1REVB 5AFUH 1XNQJ 1KQGB 3RG6A 4YUDA 2CPZA 3HSCA 3MTKA 4JI0F 1YI2S 4Q8FA 4ZK7M 2MGZA 2DHHA 2FVPA 2D7SA 5JVGQ 3UKRA 3IP0A 2DR9A 1UW9A 1BHLA 4BQZA 1G7CB 4LH5A 2L9WA 2E5LJ 2CVIA 1ZXOA 3M8PA 3CIMA 3QERA 3M6WA 1YJ9N 3TU5A 4V19X 3SZ2A 1G15A 4KB0A 3OYJA 3AD9C 2ILYA 3J7AN 4LUBA 5DGBA 5KT6A 1X4DA 1WOSA 2BANB 3OYIA 4UQTA 3EGVA 4OZ5A 1NB7A 3L4BC 2YVSA 5HBMB 2ZJPL 2UUTA 1CLFA 2OSQA 3ZNUA 4QWAA 4BE0A 3I0SB 2RT3A 4N47A 5AQZA 1JCGA 3CCZA 4I9QA 3N4QA 4CLUA 3M5RA 4X4SA 1Q82T 2CZVC 5A0YA 3CJQA 1A5VA 2B7BB 3W62A 1Z1ZA 3JXUA 3BZCA 5C42B 1WSHA 2HW3A 2VFVA 1QVGR 5AJ3F 4BDZA 3EEQA 2ZC4A 3WXLA 1LWFA 4YMEA 3HHKA 3AH6A 4K4UA 4IG3A 3NWGA 2CNOB 4B9MA 2PA3A 4JI6J 1F3VA 4F0MA 5E3CA 1KR4A 2XWXA 4OKKA 2HHQA 3NH2A 5EXWA 4ZA1A 4KBIA 3V4MA 1WKKA 3QIPA 2KYZA 3RBDA 3SUPA 1T6DA 1TELA 1S1XA 4Z0UA 2XZWA 1IKYB 3MPVA 1U4BA 4QIVA 3DHXA 2VG7B 2LCWA 3M8SA 1NMNA 1UJ4A 2C2RA 5ETTA 4DG1B 4AUKA 4U95A 4L76A 4AF1A 5LJ3Y 2ZJRL 3U1MA 4B9LA 1WF0A 4FDFA 4UOGA 4PABA 5GAHU 3RW7A 3AJ2A 1JLGB 3EGWB 3N6LA 1F5AA 1WG4A 4J7CA 4NRUA 2DK2A 2OTLS 5BRHA 1BWFO 4NLOA 4CT8A 1ACMB 3V9UA 4CHQA 3ILIA 4NWBA 3NWRA 3TUZC 1IWAA 5ADXA 4JV5K 3CTRA 2N3LA 1RAOA 1UTAA 4G1QB 4EMDA 1RBAA 4FBTA 1ILYA 3PZPA 2WVCA 1F3FA 2WAQD 1VCTA 3R2DJ 3ID6A 3RUBL 1RT7B 4ECVA 1LAVA 2V9WA 2GVDB 3ZFVA 4N56A 1DTQA 4B3RF 4H0OA 1YJRA 5LXRA 4Z4GA 4PEOA 2XS2A 1EQ0A 4WFXA 2CQIA 2XY7A 1XMQF 3O44A 3I5BA 5BPNA 3LPTA 3BF3A 2ZNYA 1H2VZ 5KOXA 1SIZA 4B3TK 2IC3B 2F40A 5LMUF 5K14B 4CJPA 3KVGA 2W40A 1VQNN 1HNXJ 5IWAK 3C94A 3U3YA 1JLCB 1MWZA 3CJBA 2O8BB 3H2LA 4XPCA 1JLAB 1X4GA 5EWGA 1EX4A 4NLVA 1I5OB 3CD5A 3QBCA 3ZZUA 2FJDB 3AQPA 2WTUA 3BH6B 2ZH8A 1LWXA 2HK3A 4F67A 4B3OB 2KB2A 1NOYA 4FJXA 3VQDA 4J2BA 4PL7A 1MU2B 2X6NA 1XMBA 4USIA 4OJRA 3CHWA 2IPOB 1SPBP 1HNZF 4RJVA 3SV3A 2YKAA 2HNDB 3R5AA 1KVJA 3I9ZA 2D0OA 4DV7K 1HR0K 3KK3A 3QBXA 1WORA 2XO6A 2GUIA 2DNGA 1RYSA 1L3TA 3CJ1A 4U7BA 3FZHA 3AVBA 4IOBA 1SI9A 1R8PA 4KGXB 5B08A 4LRAA 2F4VJ 5EDWA 4K42A 3C6UB 4JK8A 4ZPCA 3QJLA 5HP1A 1M90T 1S1TA 1P6TA 1NMEB 2LVWA 4JI8F 3L2UA 4LRCA 5T14A 2LEPA 1S6PB 3PRBA 2YWWA 5HRSA 4NA2A 4A2AA 1FRKA 5AQJA 2JWLA 4HR2A 3PYGA 4IXCA 3OYLA 3IRXB 3M05A 2ASYA 1IBKJ 5U47A 1U6ZA 5KFAA 3DM2B 1HD1A 1WJ9A 2M7SA 4M5NA 4QPXA 1TYQB 3VVTA 2H5JB 1C6VA 2AW0A 3P96A 3QINA 5AZJB 1V6HA 3G2XA 4P7VA 3NDKA 2VBWA 4OZ0A 4KE5A 3JS9A 3O2IA 1BHNA 3JQKA 4IOCQ 3DLKB 3RBXA 4GKKK 3FCWA 4TVAB 4O55A 3JAMY 1VDHA 2ZWPA 5ETNA 2CH6A 4LF2A 4OYZA 2AYBA 1UFWA 2ZNZA 4K25A 4O8UA 1FVSA 4I7FA 2ASJA 3CF5L 3JS6A 1WHXA 3M1VA 5AQVA 2XULA 1EKEA 2DNMA 2OAUA 3MR6A 5ETPA 2N82B 1JLBB 1BUXA 4AXIA 5SZTA 2QL7B 2XMMA 4IH6A 2PMZD 2Y3YA 2P1JA 4KHMA 4LMZA 2V8DA 4HHHA 5GAHI 3JTPA 3NAEA 4FZXC 5M1NA 4QU6A 3V4IB 2QA4N 5LL6Z 1G6BA 2HF4A 3L95X 4KFBB 4M45A 3PV8A 4DV1J 3DN9A 4O3PA 1NGEA 4CHOA 2C22A 3RMCA 1CPZA 4U96A 4C2MA 3KWIA 3GFHA 1IBLF 4ID5B 4O44A 3POTA 5F8GA 4C0HA 2Q66A 3DLRA 5M2UA 2V34A 2JNJA 3DYAA 1I94J 3CQYA 4NPOA 3L7OA 2MB0B 3J7ZO 1VGYA 2W6LA 5AT1B 4LH4A 5IFMA 4C11B 1SL0A 4DOZA 1LWEA 4J9UE 1T3NA 3SPYA 3BGRA 5LOQA 4ECZA 4LFAF 5IZHA 2W01A 5H9FJ 5HQ8A 3TA1A 1AROP 4WYLA 3QJJA 1HNWF 3RU0A 1S7IA 4GC7A 3TEGA 3FEXB 3UKUA 4ZLLA 3CJ8A 3GJSB 3PX4A 2XRIA 3DKDA 3PR5B 1KVKA 5AQHA 4WCEQ 4DV2F 1IH7A 3OQ2A 2PY5A 2MJUA 1NHKL 2J9DE 5C2GA 3LP0B 1RBVA 1QAYA 4USKA 2M5YA 3MURP 2OZSA 5DS7A 1K8KB 2OTJN 4KHNA 4CTAB 4JRQA 4XK8C 1HW9A 2Y1IA 1BQXA 4WFBL 4CFCA 2W25A 3Q24A 3CE8A 1UMJA 5ETQA 3I0RA 5AQYA 2W4CA 2F8TA 3D2FB 2AYEA 4BR9A 1QSLA 5M2PA 2L9DA 3P6YC 1Q81T 2UP1A 4AHCA 3DRRB 4X4OA 2U1AA 3P45B 1HBNB 3LDPA 4PG7A 3HSZA 4KHSA 3LP1B 1ELOA 3QEWA 4MDBA 2FHJA 3OD2A 3R7NB 1EJ7L 4YOXA 3TAQA 1DHMA 3VF0B 5BREA 2EPIA 5G4DA 2GC8A 4Q0BB 3MWBA 1TUVA 2H3EB 2C3OA 1N54B 3O5BA 2DHGA 4XH1A 5L46A 2BQUA 4IFYB 2NSCA 3PYFA 4XDDA 4K41A 3RZAA 4IOXA 5AQIA 5B7WA 3KLHB 1YZ6A 2AMCB 4CBWA 4YS2A 3FZKA 1EP4B 3OFEA 4OHVA 3N4PA 5G0RB 3KZBA 2G2OA 3C6HA 2I8EA 3V6JA 2YWFA 2R42A 3BPSP 4BLGA 2ZWHA 4CZLA 2DRDA 1WTBA 3GLJA 1NAQA 3MOZA 3DOMA 5GMEA 4B1UB 2I1RA 3PEHA 2CQ0A 2LP4A 2VJVA 1U2RA 3O3HA 1HFEL 4HUEA 4ECUA 1N5SA 2GJ2A 4EGLA 3QWPA 4WFZA 4U7UK 1SCJB 4NI2B 4CGJA 3WEEB 2J9DA 3CCJN 4FYYB 1R31A 3ZCMA 2YKNB 3QWUA 2E7VA 1MWYA 2AEFA 3KLFA 1S57A 2GO8A 5HVGA 1YRUA 4K5SA 4I69A 1ZYQA 3DCAA 4DQ8A 4Q2MA 3N6NA 3CJKB 3QRQA 2ZH1A 2QSWA 4JI1F 4RBUA 2POKA 2B6AB 3CIZA 4HACA 4FYWB 3CDWA 3ET6B 1RT3A 1HLUA 1CS4B 5KFJA 2A3ZA 4OYAA 1YXQA 4MK9A 1WUUA 3HHLA 2GAHC 5B8HA 4OLAA 3QESA 4FNIA 3HLUA 3VF4A 4DSJA 2HHSA 2UU9J 2MLYA 1V5IB 3DGPA 3I55N 4PYDA 1VS3A 4ZDNA 4RW4B 1MWKA 2QA4S 1C1CA 3PJWA 3DRYA 4P2XA 3TUPA 3WC0A 1WC3A 3QETA 3KK7A 1ZTTA 1XNRF 2HHHJ 3U9ZA 4FOEA 3DLEB 2XNQA 2QXLA 4FCYA 4BQLA 4X62F 1RBOB 1P9QC 2IHR1 3TWHA 4DU8A 5AQRA 3VHQA 2Z1GA 4LFBF 1Y97A 5L8RC 1RP5A 3G71S 1N5QA 4FL9A 2E1RA 5I3UA 4M5LA 1SAZA 4DL6A 4CF9A 1RLDA 4RUAA 3SJHA 4TKTA 4W5RA 3THYA 4IBNA 3QDKA 3OHBA 1URRA 2VBXA 1YVFA 2DXEA 5CZ1A 1FJ7A 4H0TB 3NGZA 1IR1A 3PRDA 3EMTA 2N3OA 3IFEA 3PW0A 1LW2B 4DU3A 2WSCC 4O5FA 1EWQA 3HT0A 2YI1A 3H1QA 3AB4B 2QIFA 3GPAA 3KUGA 2C3YA 1TL4A 3NLCA 1N32F 2AJ4A 1NDPA 4HTIA 1F2GA 3KKSA 1N33K 3H5XA 1SJFA 1IV0A 1M1GA 5F3TA 3AAQA 3A5NC 3MEDB 1Q7YT 3ZZOA 2VWJA 1T94A 1TU0B 4NEZA 1X3NA 4B8AB 1X5TA 3VEZA 4BG9A 3LUYA 2R2RA 3K89A 3CDBA 4ZOSA 4FVMA 1GOAA 2X3DA 2G2ZA 1SL1A 3PXGa 1UEVA 3OJSA 3GG0A 4J2AA 3CDUA 1YRXA 2A1BA 2G1DA 2HIYA 1TQLA 2ZKTA 3TZZA 3NF7A 5MLCQ 3HT3A 1NDLA 2UXCK 2OZMA 4RWXA 3G8TA 2I7PA 1V3ZA 1OYEA 1UWBB 3MUVP 2HFOA 3HXMA 2GMHA 3UWTA 4JYAF 2GBZA 1C4AA 2ADCA 2CQPA 1EAYC 3ILJA 2J9CA 3GJQB 2VJUA 2V2ZA 3RVCA 4LSLB 1C0FA 3TAPA 3CJ9A 5IM0A 3ILLA 2RUSA 1BL3A 2XYGB 1DFDA 2K1RA 1H98A 1O1WA 3VEVA 1ZBSA 1U8WA 4FJNA 3LDOA 1JJ2M 5J1EA 2J0QD 3ENBA 1X60A 5CYMB 2PMHA 4CZFA 4WP8A 3THXB 4LR9A 3UI3A 4QPTA 3LWLA 1T3OA 1HHQA 1B4SA 3I8DA 1YJWS 3QZ7A 1NK9A 2GEMA 3FNNA 4XEIA 4K4YA 2B8QA 3DXKA 3SV4A 3AVAA 3W2VB 4OZLA 1J5EK 1N5YB 2K3IA 3GOIA 4MKYA 1OQ3A 4MIWA 2ETJA 3CM5A 4KB7A 5KFHA 2VBYA 1RGIA 1I1GA 4BDYA 4G6VB 2M8DB 3JSRA 2RKIB 2W24A 4CQ1A 3M9MB 2M88A 2DPNA 3H6EA 3MMBA 1WNSA 4KRWA 3TANA 5ADXH 1QAIA 3DOLA 3BBFA 3ZTPA 3CCJS 1NSAA 3VQCA 4UTGA 3ZLJA 3HDSA 3FCVA 4W5OA 4P6QA 4OI1A 2NSBA 1XR5A 3WT0A 3BP8A 1T03B 3D66A 3ZSQA 4DR6F 3IKMA 1Q9XA 1FRXA 2LXIA 3VQPA 3KK1B 4BRHA 1HWLA 2RQMA 1LNQA 2GJIA 5IC6B 4E7LA 1XNQF 4IRKA 3SCXA 1KVCA 3PW2A 1RU2A 3B4MA 4AL6A 2M3DA 2HNZA 3I96A 2QYGA 4ECTA 4O3SA 4DFMA 2DYAA 4P74A