2RKIA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase (RT) p66
total genus 153
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rkiA05
2E4LA 5J2MA 3HPOA 3NGZA 1TKZB 4QPXA 2BQ3A 1BQMA 5CZ2A 4O3SA 2PYJA 2R2TA 4B8AB 3OYDA 3FQLA 3MECB 3AA5X 3MECA 3T3FA 3JSMA 4M41A 3ITHA 2IC3B 2RKIA 2I5JB 4PQUB 3DLEB 3NF7A 2UVWA 2F96A 4CF9A 4KAZA 2HHWA 2RN2A 5J2MB 3D28A 3ASMA 1SUQA 3BSNA 4ICLA 5I42A 3QETA 1S1WA 3N6LA 4EBCA 2ASJA 3P5JA 4FZYA 3LP0A 4DFJA 4RUAA 3V81A 2D3UA 3PVXA 4CJWA 4LH5A 1LWCB 3CJ0A 4FJHA 1QAIA 1BQNB 4FK4A 1HNIB 4EO8A 2OPSB 3KK3A 3KHLA 2XCPA 2RDJA 2W9BA 4CFBA 2AU0A 4IG3A 3HYFA 3TAGA 4FXDA 1XC9A 3HVAA 1BIUA 4HUGA 3F9KA 3VQAA 2HMIA 2IDOA 3QZ8A 3IGNA 4I9QA 1QSYA 2XO7A 1XI1A 4F2SA 1QHTA 4O3PA 3OYLA 4E7IA 2QK9A 4CCHA 4XPEA 3I0SB 4PQUA 4DFMA 3IG1A 1B9FA 3DLBA 2ILZA 2BGGA 4MK8A 5J1EA 4CEFA 3NH0A 4DSKA 2IM1A 1K6YA 4DTOA 1S0NA 1VSIA 4ECQA 5KFPA 3LZJA 4DL7A 2VWJA 2HMIB 2W7PA 2FJWA 3OYAA 5KG4A 4LD0A 1N5YB 2WB4A 3OLAA 2Y1IA 5KFBA 2BE2B 2JLEA 3VA0A 1VK0A 4IFVB 3AO1A 3QYYA 4CHYA 2G8UA 1LAVA 4E1MA 4O3NA 2D5RA 4ED6A 4IFVA 3OS2A 3QGHA 1S6PB 4EZ6A 3T5HA 1S48A 4HCCA 4DSIA 4TQSA 3DRPA 1A5WA 1ZYQA 4J9KA 2B4JA 4Q8EA 3MEDA 4MKAA 1NJWA 2ZD1A 1DLOB 3AO4A 2YKMB 4I2PA 4QW9A 4EBEA 5KFDA 3H5YA 5FRMA 2AX0A 3ZCMA 5CYMB 4W5RA 3KLEA 4CJFA 2R8GA 3TABA 3KHRA 1YVFA 4NLPA 3ISNC 5I3UB 3PX6A 1T03B 1C0UB 3S3OA 4Q44A 1S1VA 3MR5A 3HHKA 2XI3A 2EX3A 4OGCA 3MR3A 5HRSA 3AVFA 4TYAA 4EYIB 4DL2A 4H4OA 2W9CB 1JLBB 4TY8B 1WSFA 1SL0A 1TVRA 3PW5A 2IOCA 3NGDA 4DSLA 3M8QB 3OYHA 4AHSA 5KFXA 4H8KA 4YMEA 1NK5A 1RT3B 4FZXC 3KK3B 3UDLA 3HPGA 2YKMA 4I2PB 2FJVA 4CGHA 2FLNA 1RT5A 1CZBA 4ED0A 2ZQBA 4OLAA 1S6PA 4B08A 3V81B 4DU1A 3JYTA 1ASVA 3AVNA 4ZPCA 2BQRA 1NK6A 1S1WB 3IN5A 5I42B 3WNEA 1HNIA 4M3RA 3BQ0A 4NCGB 1QSLA 4Q43A 3KKSA 2Z1IA 3ZSQA 2HNYB 4K4ZA 1L5UA 3H5XA 3SQ4A 2IC3A 5EWEA 1NJZA 4UQGA 2GBZA 4N5SA 2B5JB 3O3HA 2R2SA 3TANA 4NLOA 4M3YA 3VQQA 2D7SA 4AHUA 4MIBA 3LALA 1LW2A 3SJJA 1C0UA 3EZUA 3FQKA 5JUMA 4FM0A 1RILA 4CF0A 1W25A 1MU2A 1RNHA 3TVKA 1SL2A 4FJJA 3LZIA 2VG5A 4H4MA 2R8IA 3KLEB 2V9WA 3AO2A 4TYBA 4O5BA 4ELVA 1KHWA 2EHGA 4HYKA 3CWJA 1VSDA 4MK9A 2KTQA 1QTMA 4RG8A 3DOLB 1LWFA 3ZSOA 3ZSXA 4E7KA 1ZBIA 3RTVA 3DRRA 3OJUA 2PY5A 4IH5A 1D0EA 4M95A 2Y1JA 5HLFA 2W8LA 4FYDA 4LSNB 1RTDB 5E41A 5KFHA 4FJXA 1RT7A 1BCOA 3HT3A 5C24A 2OPSA 3UIQA 4F4WA 2HNDA 1SH0A 2D0CA 4ZP8A 2P5GA 1X1PA 3TARA 3K57A 2R8HA 3GIIA 3GV5B 5DG8A 5J2QB 5KRTA 5JS1A 4NCAA 1VRTA 4HVJA 1LV5A 4KHUA 3LAKA 4RW4B 5HP1A 5DLFA 3SUQA 3H4DA 3OL7A 4ED3A 3C95A 4RNFA 2KZZA 3AA4A 2RKIB 4RZRA 5J2NB 1KVBA 2HHXA 3RR8A 1VRUB 3QGGA 3IRXA 3LDSA 4CJPA 3LWLA 1QQCA 3QNNA 4CF8A 1SH2A 1WSIA 1RT4B 1RBSA 3RMCA 4IR1A 4X2BA 3EPIA 2HB5A 4BWJA 3KJVB 4FLYA 2G8KA 3H5UA 1X9MA 2ITGA 3LPTA 1S49A 1GOAA 5F8MA 2C22A 3HVWA 3O4NA 4DTNA 5HBMB 4WXOA 2WONA 1S9FA 1LWEA 3ZT0A 1A5XA 3PR5B 1C1BB 1TKTA 2IA6A 4KPYA 2VG6B 4QWEA 4KV8B 3MEEA 3CIZA 3I5BA 1IG9A 1WSHA 4KB0A 2FVSA 4EP5A 4RW8B 1QE1B 5KG3A 3PX0A 3M8PB 1TKXB 2OPPB 3PY8A 2E9RX 3V6JA 3OSPA 3VQ6A 4C8KA 4ZVGA 5KG5A 5KRSA 4U7CA 5F8HA 3NGIA 4NYZA 1RTIA 1NOYA 4LQ9A 5C24B 2PYLA 3SNNA 1TK0A 1NOZA 4K4VA 4ECSA 3DLGB 2A1RA 4DS5A 4B9LA 2IS3A 4DFKA 1RDBA 3GIKA 4ZTJA 1WNEA 5KFJA 3AVMA 1WN7A 1UWBB 4R5PA 1JLEB 4K4TA 3L2RA 4CHZA 2XHBA 2OH2A 4PY5A 4LSLB 1N6QA 4CEOA 1JLQA 3HVTA 4IG0A 5K14B 5KFRA 4CJ3A 2E9TA 4IG0B 2D0AA 4CJ4A 2B6AA 4LSLA 4RU9A 4N76A 2CKWA 1K1SA 3MAQA 1FKPA 4M45A 3KLGA 4Q45A 5KFQA 1MU2B 3SFGA 4KBIA 4CESA 4O3OA 4AILC 2RPIA 2AGPA 1SL1A 4FJIA 3NF6A 4LY7A 4RW6B 4URQU 4FCYA 3HPHA 1Y97A 3I5AA 3GV7B 3KKRA 4CE9A 1WSJA 3V1RA 2HNZA 5KT4A 2W8KA 1ITGA 2P1JA 4O0JA 4FZZA 1LWCA 3TR8A 1Q9YA 4LH4A 4J2DA 3SPYA 1W9HA 3OYIA 2HWIA 4G1QA 4E7JA 3PUFA 4KKOB 4ID5B 3KK2B 4CJVA 4FLVA 4FJNA 2FVPA 5KG1A 5T7BA 2OPQA 3CJ3A 1U48A 3V9SA 3H2LA 3GV8B 4WFYA 1C1BA 4J2AA 2GIQA 2AX1A 2ATQA 1CSJA 3VQ9A 2WONB 3CO9A 1WAFA 1L3TA 4O4GB 3I0RA 3OYBA 4ECXA 4ZHRB 1BQMB 5KGXA 5KI6A 2DFEA 4FK0A 2HHVA 4FJLA 3HJFA 5L9XA 3QEVA 4WFXA 1TL1B 2W42A 2YNGB 1RYRA 4FLZA 3AO3A 3RWUA 3KJVA 3H4BA 3MXMA 3T5LA 4IDKA 3L3VA 1FKPB 4FJ7A 3KD5E 4RNNA 4I2QB 2XC9A 3QLHA 2BDPA 1UA0A 4I2QA 4RNOA 5KG7A 2FVQA 3ZT1A 5KFYA 2KZMA 2UUTA 4KHNA 3QEWA 2WK4A 1GX5A 5J2NA 3AVAA 4W5OA 3QO9A 3HVTB 1T05A 3TAPA 4MFBB 4M3ZA 3M8SA 3BR9A 2ALZA 3U6FA 4ZHRA 3VQ7A 1TKDA 3DYAB 4F4KA 3DLRA 3ISND 4CK2A 3ZSWA 5EWGA 1BIZA 4CHPA 2BR0A 1ZBFA 4CEBA 5KFGA 3O4QA 5KFZA 4CJLA 4YR0A 4ZVEA 3E51A 1EETA 3GQCA 3OVNA 5KT7A 3T5KA 3BGRA 2JC0A 3AVJA 1KVAA 3M8PA 1J9AA 1J5OB 4F3TA 4RW9A 1ZTWA 1RBVA 3TAEA 3DRRB 5KFKA 2IM3A 3DM2A 3QESA 4J9OA 3C6TA 1RDRA 3MFHA 3ULDA 4GVMA 1QS4A 3NBPA 2X78A 4FW2A 5D3GA 4K4WA 4ECZA 2VG6A 1QUVA 4OPKA 3T5JA 1EP4A 3CVKA 2IJFA 4JS5A 1KSPA 4ELUA 5KFUA 1TAUA 3VQBA 3QLHB 2DPIA 1NKCA 2HAIA 1JLCB 5F8IA 4OPJA 3NCIA 3DI6A 1HQEB 2G8IA 1Z4UA 3NBPB 2R8KA 4K50A 3RB3A 2F8TA 1N6QB 1I3AA 2VA2A 2VG7B 1HNVA 2XY5A 2QE5A 1IKWB 3RRGA 3OYCA 5FROA 4R5PB 2X6SA 4CJEA 5J2PB 3N6NA 4GW6A 3DLKB 2BRLA 3S3MA 1RT1B 5CY4A 4DQSA 4FM1A 5C25B 3QEPA 4M3UA 4KTWA 1ZBHA 4ZMMA 4NYFA 4JV2A 2FBYA 1XWLA 4OL8A 1IKYB 1S0OA 1HYVA 1VSLA 2XY6A 2E6LA 1JLFB 3NL0A 4GC7A 3G86A 4URGA 1GOBA 4CEDA 2E6MA 4W5TA 3AVIA 5C5JA 4FS1A 2Q3SA 4C8OA 4TY9A 3KOAA 5DK5A 1RA6A 3CDUA 1REVA 2CJQA 1BHLA 3KLGB 5F9NA 4KRFA 1TVRB 4H54A 4IRCA 1JLBA 4TY8A 3SV4A 1TL1A 1S97A 4H4OB 4KE5A 4R8UB 3V9XA 3V1OA 2FC0A 3LWMA 5KT5A 4NLSA 4FLUA 2V0NA 2JEIA 4IR9A 5KGWA 5KT2A 3TWHA 1C2PA 4DTMA 3UR0A 5D3GB 2VWKA 3TAFA 1JLAB 4YR3A 3NFAA 2QV6A 2D0BA 3K5OA 3C6TB 3EYZA 3SI8A 1S9EB 4CGGA 5CYMA 3D45A 4J9QA 1SV5B 1O1WA 4M94A 3RMAA 3NF9A 4KKOA 2YHBA 3H59A 1S1XA 1DLOA 3MR6A 2OPPA 3NKYA 1RT2A 1CXUA 1DTQA 3K2PA 4IH7A 2W7OA 1T8EA 4Y3CA 2ETJA 1R0AB 4Y1CA 1C6VA 1C1AA 3EY1A 4IKFA 1JXLA 3G10A 2UUWA 3OYNA 3AVBA 2DFFA 2IBKA 1W0HA 2KFZA 4OJRA 2GIRA 3V6DA 3HK2A 2IM0A 2C28A 3DYAA 2ILYA 5HBMA 3LANA 3OS1A 4FBTA 2DPJA 1L3UA 4ZPBA 4JRQA 3ZSYA 4DSJA 4AHVA 4KFBB 4DL3A 3TAQA 4JV0A 5CZ1A 1RT3A 1U09A 2HHSA 4NLXA 4CHQA 4CJUA 2G8FA 5DG7A 1CXQA 1Z25A 2HWHA 3NE6A 3VQEA 1F21A 1HJRA 2HHUA 1OS5A 1GOCA 1UOCA 4DSFA 3E01B 3KHHA 4EBDA 3LP1B 3RB4A 4NLDA 3O3GA 4DQPA 4CJRA 1LW2B 1T03A 3NGYA 2HHQA 4ECRA 1FKOA 1MMLA 3G6VA 4YNQA 4IFYB 1YVUA 3PHEA 1D5AA 3FSIA 1QE1A 4BE1A 3S3NA 4O55A 1DTTB 4E0DA 3KK2A 4KTQA 3MXJA 1RT7B 4RW7B 1ZBUA 3MEEB 3ZT2A 4EEYA 1SKWA 4ZPDA 3ICLA 4OKKA 3MF5A 1HPZA 1VSMA 4M3XA 3DRPB 1JKHA 4WXWA 3MXIA 1TAQA 3RB6A 5HROB 1U04A 2I1RA 4C8MA 3HM9A 4CJKA 3CFOA 3PV8A 3IS9A 4CIFA 3D0PA 4F4ZA 4O3QA 4DWIA 3DI6B 5KFIA 4N47A 2GV9A 2WOMB 4B9UA 2LSNA 1NK0A 1C0TB 3PX4A 1UA1A 4CEZA 3BREA 1X9SA 3DMJB 3VQDA 2BQUA 1QAJA 2AGQA 5KG0A 2ASLA 4Z4CA 1RDCA 4E7LA 3BSOA 3FFIB 1JLQB 4FS2A 3F73A 3DDKA 4RNMA 2P5OA 3OL6A 4KI6A 3ZSRA 3LPUA 4CFAA 1BI4A 3AO5A 3SQ0A 4OGEA 1Q9XA 4ELTA 2OA8A 4MK7A 4NLVA 3H5SA 1HYSA 5JXSA 4DL6A 5SZTA 2WOMA 3UQSA 2IGIA 3A2FA 2XI2A 3RMBA 1NK8A 4K4XA 1NJXA 5DGBA 4ECWA 5EU7A 4NRUA 5HRRA 4K8XA 2W9AA 4QWAA 5SWMA 4IH6A 4EO6A 3OY9A 3PW0A 2C2RA 3KLFA 2QKKA 4PUOB 3RRHA 2Z1GA 1EKEA 3SZ2A 3CYMA 4NCBA 1TV6B 4J2BA 4DL4A 2JC1A 3VQ8A 1D8YA 3SV3A 4RW7A 1S10A 3QZ7A 4CGIA 1R0AA 1S1UB 3V6HA 3PW4A 4KI4A 3UPFA 3H40A 2X74A 4O0IA 1U45A 1RT6B 1DTQB 3S9HA 3TI0A 4K4SA 4ED8A 4CEEA 4Q8FA 1BI4B 4EZ9A 1SUQB 4DTSA 1SV5A 4DTRA 4HUFA 3TAMB 3CFPA 4DG1B 4O44A 4IRDA 2E9ZA 3PJWA 3WNGA 3OJSA 1XR6A 3KLVA 1RT4A 1VSJA 5KFCA 4Y1DA 5FDLA 4CEQA 3DMJA 3U3YA 3M9MB 4KB1A 3PW2A 1TP7A 1VSFA 1RT6A 3N6MA 1KLNA 2FVRA 4DTUA 2KFNA 1TKZA 5KFOA 3RMDA 1ASWA 1WSEA 1VSKA 4KHMA 2FBXA 5KT3A 4DU3A 1RDAA 1S1TB 4KSEB 4WFZA 3CDEA 4G1QB 4CK3A 2JEFA 3VA3A 3K5LA 3PO4A 2ZD1B 1TV6A 5J2QA 2D41A 1S9GB 1D9FA 3SFUA 4KHWA 4TLRA 4KHQA 1RT5B 3RAXA 2XCAA 1KCFA 3BDPA 3HL8A 1NNDA 3ZSVA 1NHVA 3QIPA 3O3FA 3PO5A 4LSNA 2O4GA 1S6QA 2BE2A 2F8EX 3G0ZA 4Z4GA 1RBRA 1JXEA 4IQXA 4E89A 1RT2B 3G6YA 1S1XB 3AVGA 4JV1A 4DLGA 5K14A 1FKOB 1LAWA 1XR7A 5EWFA 3NF8A 3Q8QB 3KLIB 1YTAA 1EX4A 1IH7A 4C8LA 4H4MB 1RT1A 3FFIA 4Q0BA 3B6PA 5KG2A 5J2PA 1RCHA 3FRZA 4FW1A 3T1AA 2B43A 3ALYA 4Q0BB 3KLIA 3AA2A 4EP4A 4J9PA 4J9RA 4JLHA 4ED7A 4YQWA 3PW7A 3OYJA 3OLBA 4HHTA 1SKSA 4HTUA 3P83D 4Q5VA 1WSGA 1YT3A 3OS0A 1T94A 3KD1E 4DLEA 2ASDA 2HNYA 2C2EA 2G8VA 3RBDA 1EP4B 3H08A 5DQHA 1RBUA 3M8RA 3BQ1A 3V9UA 2JEGA 3V9WA 4KO0B 3V4IB 1TKTB 2WCXA 4J9SA 1HYZA 3IAYA 1U49A 5KFVA 4ED2A 1DTTA 4ED1A 1JLFA 2XGPA 4PUOA 4RW9B 4CGDA 5KFFA 4Z0UA 1K1QA 1HPZB 1ZBLA 4KHRA 3HVRA 4F4XA 4DQIA 3L2VA 1XHXA 4HCBA 3SUNA 5F8LA 3VN5A 4NZ0A 1HMVB 3MFIA 1TQLA 5C42A 4B3OB 4L8RB 2BRKA 4CGFA 4CJ5A 2DY4A 4DL5A 3NDKA 3DLKA 3NAHA 3JSMB 4IFYA 4W5QA 3KTQA 4YP3A 2W9CA 2UVRA 1RTHB 3AVHA 5FDLB 3GYNA 3QERA 3EPGA 4CIEA 4CF1A 4I7FA 3CJ4A 2RF2A 4ZVHA 4DG1A 4BE0A 1HNVB 4Y2CA 2BANB 2YNHA 4DQRA 4F4YA 3HP6A 4HKQA 4C8NA 5KFWA 3H98A 2RDIA 1N56A 4NLGA 4AH9A 4B9NA 4DTJA 5JS2A 2XGQA 4DMNA 2YNIB 1C0TA 3P1GA 1SKRA 2IJNA 1LW0B 3CM5A 5CYQB 4QAGA 3B6OA 2XWYA 2D3ZA 5EDWA 1KLMB 3FDSA 4GMJB 1D1UA 4OLBA 2HVIA 4FLWA 4DFPA 3C6UA 4NLQA 2EC0A 1VSEA 3MEDB 3Q8RB 1NKBA 2YKNA 3K5MA 3KLFB 3DM2B 5KG6A 4ZPAA 4CK1A 1HRHA 2PZSA 4CJQA 3CDWA 2R7YA 4DU4A 3G6XA 4F3OA 1S9GA 1JL1A 1KFSA 4KREA 2FLLA 3ZSZA 4KTZA 2FBTA 3SUPA 1NJYA 1S1TA 4R0EA 4Z4FA 3RBEA 5FRNA 3TQ1A 1RDDA 1EETB 5DMRA 1ZTTA 3HP9A 3DLEA 3RB0A 4OVLA 2FBVA 3Q8SB 1QSSA 3BJYA 4CJSA 5KFLA 2FJXA 3HKWA 1RYSA 2KW4A 5KFEA 4XPCA 4TQRA 4CEAA 3L2WA 2WRMA 3TAMA 4RW6A 4K4YA 1NKEA 3QO9B 2AWZA 4E1NA 4E7HA 3DRSB 4G3IA 4RNHA 4NLWA 3IG1B 2YNIA 3L2QA 3KLHA 4PWDB 4Z4IA 3QINA 1T3NA 2AJQA 3SUOA 3CFRA 5DGAA 4B9MA 4FLTA 2OPRB 2YNHB 4FJ9A 1SH3A 4ZP9A 2P51A 2BANA 2WHOA 3QIDA 1U47A 1JKHB 2RF2B 4I7FB 4O4GA 3NHGA 4FM2A 2HVHA 2IAJB 1ASUA 3NAIA 2XY8A 1TL3B 3BGRB 1JLGA 4F50A 2UVUA 2OZSA 1S4FA 3GIJA 4B9SA 3MEGA 1S5JA 1HYSB 1IKYA 3C94A 4GC6A 4MH8A 2R8JA 3DOKA 1IKXB 1UAXA 4ZP7A 4KHYA 1S9EA 3GIMA 3EZ5A 4MFBA 4FBUA 3KK1B 4Z4HA 4KO0A 3V4IA 4KV8A 3D5MA 3MR2A 3U3GA 3ITHB 1HQUB 3SQ2A 4WE1A 4U6PA 3BQ2A 3RAQA 5I3UA 2Z1JA 4FJ5A 3PZPA 4NLTA 4NRTA 4PWDA 1JLCA 3KMSA 2X6NA 3OSNA 3QEIA 1JL2A 3OL8A 4QWCA 4FLXA 3K59A 1IO2A 4R8UA 4CGJA 3HO1A 4O3RA 5KFSA 2O4IA 3CJ5A 3LP2A 1KVCA 3AVLA 5L1LA 4KB7A 4MIAA 5DQIA 4I9LA 2QKBA 1B9DA 2J6SA 4N56A 4W5NA 3QGIA 1ZETA 3OYKA 1REVB 4NLYA 3GILA 3V6KA 3DLHA 2IMWP 4BACA 2ZE2A 2OYQA 2A1SA 4Y34A 4AHRA 4NYNA 3AVKA 4YR2A 4WZQA 2AGOA 1TGOA 3AVCA 2VA3A 4QW8A 1B92A 2YHAA 1BCMA 3Q8PB 4QWBA 1G15A 1C0MA 4O4RA 3DOKB 1C1CB 4ECTA 4YFUA 1RTJA 5KFTA 3L2UA 1Q8IA 1RBTA 1IM4A 4J9NA 4Z4EA 4OKEA 1U4BA 4TXSA 4IKAA 2Z1HA 5C25A 3K5NA 1L3SA 4IRKA 1JLAA 3KHGA 3C6UB 3PR4A 4AHTA 1T05B 5J1EB 3LP1A 2F8SA 2IAJA 3OYGA 5L1JA 3I0SA 4LQ3A 4M3TA 4J9LA 4J2EA 4K4UA 4IBNA 2VG7A 4RUCA 1LWFB 4PA1A 1WLJA 4FJKA 5KFMA 2YNGA 2OPRA 4CF2A 1BL3A 1L3VA 2V4RA 2KQ2A 4B9VA 3LAMA 3L3UA 3HXMA 4KFBA 2J6UA 4CECA 4EYHB 3KLHB 4QOZB 4CFCA 3NH1A 5HRNA 3V6DB 2FVCA 4IG3B 1UWBA 3M9NB 1GX6A 4N41A 5DLGA 2W9BB 4ID1A 3AA3A 4WE1B 3CQ8A 2OPQB 1NK7A 4JS4A 3CM6A 3OYEA 4BDYA 1WAJA 4FJMA 4K8ZA 1KFDA 3AV9A 3ZT4A 1J5OA 1HARA 3KIOA 4HUEA 3CG7A 4DQQA 3LP0B 1NK4A 1VRTB 3L8BA 1BISA 4ICLB 1EXQA 4FVMA 2QXFA 4WYWA 1S1UA 3BSCA 1RA7A 4NCGA 4B9TA 4M3WA 2I5JA 3RR7A 2J6TA 4DTPA 4MKBA 1TL3A 2OZMA 1LWEB 1N48A 4DEZA 4CIGA 5F8NA 2G8WA 1CLQA 4ECUA 2HW3A 2YKNB 4DF4A 4FK2A 1N4LA 3QNOA 2R2RA 2B6AB 1HQEA 2YNFB 4KHSA 4CERA 1JXBA 2IM2A 3M8QA 1RAJA 3I5CA 1Z26A 4BE2A 5L1KA 3HSTB 4CJTA 5F8JA 5L1IA 4MQ3A 3SI6A 4IDKB 1A5VA 3V1QA 2JEJA 1VRUA 4BDPA 1HQUA 3CJ2A 4DSEA 4DTXA 1D9DA 3VQPA 4IOBA 1FK9B 1XR5A 1BGXT 1XHZA 3K58A 1JLEA 4QWDA 1IKXA 1X9WA 4B8CA 1RTJB 1RTHA 3PJXA 3M9OB 3THVA 1S0MA 4M42A 4URSA 1TK5A 3QEXA 1TKXA 1WNSA 2JGUA 4FJGA 3MEGB 1RTIB 1I39A 1S6QB 1IKVA 3MTKA 1HMVA 1KRPA 5F8GA 4FJ8A 3OYMA 3OYFA 4ID5A 1JLGB 4ECVA 3BSAA 3IS9B 3VQ4A 3JYTB 3OHBA 3NH2A 3SPZA 4AHCA 5HLFB 3VQ5A 5HROA 1IKWA 4WZMA 4RW8A 2HNZB 3OHAA 4NLUA 3VQSA 3OL9A 4NLRA 3LP2B 5T14A 3ZT3A 4DS4A 1KLMA 2ZKUA 4E3SA 1JIHA 3I8DA 5CYQA 3SCXA 2GC8A 3QIOA 1N5YA 1VSHA 5F9LA 3V9ZA 3IGVA 3KNAA 4CHNA 3IRXB 2NUBA 2XRIA 1J53A 2FLPA 3KK1A 2GUIA 1FXXA 4O44B 3LP3A 3I0RB 1S1VB 5HRPA 2YV0X 1NHUA 1T7PA 4RW4A 4ECYA 2B5JA 4JRPA 4QCLA 4KAIA 5DG9A 2O5DA 4ZVFA 3E01A 2V4QA 1J54A 4F2RA 3VQCA 4JUZA 4BDZA 3DLGA 4TN2A 4BWMA 1IKVB 5HP1B 5C42B 4B3OA 4CFDA 4F8RA 4ZP6A 5DQGA 5EUHA 1CZ9A 1C1CA 2UVVA 1RTDA 3WNFA 2G8HA 4Y2AA 5KFNA 4J9MA 4XO0A 1FK9A 1YTUA 3NAEA 2HNDB 2AQ4A 1TK8A 4WYLA 1JX4A 3SYZA 1KTQA 3QIPB 2R2UA 4OKJA 3WNHA 5KT6A 1NK9A 2ZE2B 1KHVA 4TSXA 2HHTA 1BQNA 1LW0A 2DFHA 2XY7A 3SQ1A 4E19A 3NMAA 4ZTFA 2WTFA 2VG5B 3KMQA 5KFAA 5KTQA 4CHOA 2DTUA 1I6JA 3DOLA 4DF8A 2C2DA 3DRSA 2ATLA 3T19A 4XIUA 2YNFA
chains in the Genus database with same CATH superfamily
1I3OB 3M1FA 1T6DA 5DDOC 4QPXA 4L75A 3FFKB 4R0JA 4CYUB 2R2TA 2BVZA 4BRPA 3HHEA 3FQLA 4OJHA 4P7VA 4OI4A 1FJEB 1ZOTA 4PKIA 2PD1A 4QIWD 4PQUB 3ATVA 4K0KK 1U0HB 3TUIC 2DGUA 3D68A 3MMVA 1Q5YA 2AEMA 1U2VB 2RN2A 5AQIA 1RHJB 1TMMA 3BSNA 1KVJA 3K0JA 3KWIA 2RDDA 1LXJA 2NSBA 1FXRA 2G0CA 4UOHA 3DHXA 3GU0A 1KAZA 1X5OA 3CGIA 1H72C 1BQNB 4I0WA 3KK3A 2XCPA 2RDJA 2RS8A 3AB4B 2RJZA 3OVSA 2AU0A 2CGKA 4JYAF 2QL9B 4U7UD 3P5BP 2VQFF 1CG2A 3M7VA 1BIUA 4HUGA 2CPHA 2DGQA 4DR4F 1R0BG 3W0LA 3KXDA 3CCEN 4J37A 4GVEA 4OHYA 4I9QA 4OX7A 4BC5A 5GADP 3NOGA 4CCHA 2J7WA 4USMA 1RAFB 3I0SB 1HA1A 4PKHA 1S22A 2F9DA 1AUDA 2VPWB 2V51B 2NUUG 3NH0A 1K6YA 1S0NA 1VQKS 2O1PA 4OZNA 2ZNZA 3OPKA 5KFPA 2ROGA 4LIRA 3TTCA 2ZH4A 3B82A 2HMIB 2VWJA 4B3RJ 2W7PA 1BDGA 2FJWA 3OYAA 3SQOP 2CJYB 4LD0A 3Q8VA 1IBLK 4DR3J 1JCGA 3C19A 2JLEA 4CD3A 1P1LA 2MLZA 3WDOA 2DVIA 1MG7A 1CULA 4F3QA 1IVZA 3T5HA 4HCCA 4CH0S 3A5NC 2CQ2A 3CE8A 4X66F 4Q8EA 2P9PA 4I2PA 3W9IA 3CB4A 5KFDA 5DM6Q 3H5YA 3CC2S 2F63A 1RCOB 2EEYA 1ZM3A 4KH4A 2YTCA 4DX8H 1ZAVA 3WZ0A 3U8XA 4ZCKA 3KWMA 4JI4J 4EFAC 4DUZK 1KQFB 1BC6A 4FXWA 4UUWA 3TEHB 1NMNA 3S3OA 1X31C 4Q44A 1S1VA 1VQMN 3L7UA 1UW9A 2A6AA 4NXMF 4Y00A 1YITN 2W9CB 3F9MA 3C16A 4WK3A 1JLBB 1WSFA 3GWCA 4UY85 4K41A 4I56A 2KG0A 1OH5A 4DSLA 3RW7A 5TKWA 3MCPA 1VQ8N 2F4FA 5F0UA 1IXKA 3T1HK 1FESA 3ZZZA 4I2PB 1UJ5A 2FJVA 3MPYA 2FLNA 1S6OA 2HKEA 5EHHA 4BRIA 1TR0A 3W60A 1T44A 2QTWA 2K3KA 3ONQA 4B08A 1Q82O 2ZWPA 2MQPA 2DKOB 1FE0A 4ZPCA 4LFCF 3IN5A 5I42B 3WNEA 4M5JA 5I3PA 3R7NB 1QSLA 3GR1A 4G9ZA 3KKSA 3ZSQA 4O23A 4P10A 2Y8WA 3UD5A 2IC3A 4LIWA 5EWEA 1R8AA 1NJZA 1WI8A 4BRDA 1JK9B 3WHIA 2KXHA 2B5JB 3TNVA 1TUVA 2R2SA 3TANA 4M3YA 4IO9Q 3NGRA 3U1LA 3TUJC 5T7LB 1LW2A 4GKJK 1PAEX 3CCZA 1TYQA 3FQKA 3VGVA 4KC5A 4BR0A 1GMWD 2E66A 4DU7A 1RILA 4CBXA 1W25A 4P2SA 2KU7A 3T6BA 4MO5A 5LM7E 3LZIA 2V67A 4H4MA 4MDAA 3AO2A 3HTVA 4F04B 1JJHA 3CWJA 3CD7A 1RAEB 1VSDA 3EDQB 4RG8A 1IBCB 5A0YB 4IH5A 1D0EA 4M95A 2XBPA 4FYYB 2Y1JA 3MZIA 1WKKA 1UETA 1T9WA 1RTDB 1JNRB 1NDLA 5KFHA 3D0HE 3HI0A 1BCOA 2UXCF 3HT3A 4F4WA 2QGFB 1KC8O 4XDDA 1XN9A 1SQEA 4ZP8A 2P5GA 2PEHA 3K57A 3F0NA 4OX8A 2XMTA 5JS1A 3MPVA 4ILLA 2APOA 4G6VB 1J5EF 3ZTQA 4KHUA 3IFEA 2E1CA 2QLXA 5ETTA 3D2EA 4QS9A 3SUQA 3H4DA 1QQOA 3OTEA 4ZVRB 2V8VA 3OL7A 1HPMA 4YOVA 3PIOL 4RZRA 5J2NB 1KVBA 3QPIA 1HHQA 1YXQA 3RR8A 5AQHA 2WB1D 2B7CB 5HVHA 2CPFA 1VRUB 1RWKB 3M6XA 1ZH5A 3VETA 5K8OA 4CJPA 4CF8A 1SH2A 1RT4B 4DR1F 4LFCJ 3EPIA 2O67A 3KJVB 2YKPA 4H4KA 1NB7A 1Q7LB 2G8KA 2ITGA 2X1AA 1IBMF 5CXTA 3JTPA 2IYGA 1V9OA 3HVWA 4DTNA 3JS9A 5DJBA 3PR5B 2AYEA 3J7Z5 2IA6A 4YHHK 3KUHA 3M2UB 1Q86T 2HGLA 2XS2A 2FVSA 3QB0A 3ZNJ1 1YJ9N 2VU5A 4JI4F 5KG3A 2Z57B 1WKLA 4ZDNA 4ED5A 3M8PB 4F67A 2OPPB 3O9SA 4ZVGA 4NOHA 4UF4A 2W1BA 2AV5A 5KRSA 3UR3C 4U7CA 3LGNA 4NYZA 1RTIA 3AQPA 2DNMA 4LQ9A 1NNEA 1TELA 1NOZA 4K4VA 2IS3A 4ZTJA 1WN7A 1LFPA 4NYPA 2E5IA 4CYUA 4RWWA 5JVGQ 1ZPVA 4LSLB 1N6QA 2MMYA 1BOTO 3OT9A 3H25A 2JDJA 3SSSA 2E9TA 4RBTA 2D0AA 2B6AA 4N76A 2CKWA 3TQEA 4M45A 4Q45A 2VOOA 4M5IA 4CESA 3KKFA 4O3OA 2AGPA 1SL1A 4FJIA 4EHTA 4URQU 3HPHA 2YJEA 2J0WA 3KKRA 1FW6A 4K43A 3IP0A 1WSJA 1NZAA 3V1RA 2BXJA 2W8KA 2P1JA 3CCJS 1Q9YA 3GL1A 3SPYA 3PEJA 2ZH1A 2HBYB 4E7JA 3V4MA 3KK2B 3MUVP 1RUSA 2B9YA 4UQTA 4FLVA 5KG1A 1VQ9S 4NEYA 1U48A 1CJVB 3GV8B 2YQ1A 5AT1B 3J80O 2AX1A 4U9RA 2ATQA 3CO9A 2C3OA 4WFNQ 1L3TA 3I0RA 1HLWA 4FXVA 2P9LB 3GJTB 3M4XA 3T1YK 5KGXA 1XERA 5IOLA 2DFEA 2ZGYA 3LGHA 1IN0A 3QFUA 2NSCA 2HHVA 4WFXA 1HBMA 2FF6A 3L3VA 4RNNA 4I2QA 3FBBA 4RNOA 3CETA 2KZMA 3EE9A 2W2QP 3AD7C 3NEKA 4X4VA 3W2VB 4KHNA 2I8EA 2J0XA 2FIUA 2RE1A 4W5OA 2DXDA 4C3KA 2I2YA 4AYBD 3VQ7A 4BRGA 3DLRA 4XH1A 2JLFA 5EWGA 3PG9A 1ZBFA 3HDSA 1I1GA 1NJIO 3MCSA 5KFZA 4CJLA 3C65A 1LK7A 4H0VB 2QX0A 3FK4A 4JI6K 4YR0A 4Q2MA 1EETA 3HHLA 3MM5B 2DY9A 2GQ2A 4UW2A 3OVNA 4OYIA 4E98A 2AEFA 2O3DA 5MLCQ 3M8PA 2UXDJ 1J9AA 2R7XA 4RW9A 1ZTWA 4WFAQ 3TAEA 1WOSA 5KFKA 3CCQS 4A8KA 2PMHA 4J9OA 4LFBK 1RBLA 2CNOB 4GVMA 3M2UA 1TUUA 4FW2A 3QATA 2RAQA 4ECZA 4K4WA 1MWQA 4B3TJ 4CDIA 3T5JA 2NYHA 4IUFA 3CVKA 4OMFG 2B4OA 2O8FA 1Y9OA 4OPJA 5F8IA 3OQ2A 1AT1B 3DI6A 1NGGA 1O5JA 2DJWA 2XTJP 4K50A 3C15B 4NEZA 1SJ4P 2QE5A 2V4JB 4DV2F 3OYCA 5FROA 4OI3A 5IQ6A 4CJEA 1U1MA 3N6NA 2XYPB 5B0DA 5FLXY 3DLKB 1ZS6A 4OX9K 5IT0A 4ZITA 4DQSA 4FM1A 1QVGR 3NGTA 1FWKA 4YUDA 3IM9A 1UEUA 1T3OA 3G6ES 3FBFA 2LLZA 1KONA 5CD4A 3SBTA 1ITPA 1F5AA 4OL8A 2XY6A 2E6LA 1JLFB 3QRPA 4URGA 4B3MF 4CEDA 1WSRA 5A76A 3AVIA 2XSFA 4C8OA 1VQMS 3EX7B 4RLEA 4IWVA 2MGZA 1IV0A 3CDUA 4KRFA 2DCLA 2AD9A 4PRFA 1TVRB 1SJ1A 2OKQA 4TY8A 4I6MA 1TL1A 1S97A 1M0SA 1IJEB 3V9XA 3I8BA 2V0NA 4PG4A 2GGPA 4IR9A 5KT2A 1X4GA 3BYRA 2V7ZA 1XUPO 4J90A 4YR3A 5ETNA 3AB2B 1DKGD 1S9EB 3TW0A 4Y0FA 1N36K 5A8RA 1SV5B 4M94A 5H9EJ 4KKOA 3I55N 2VONA 3CDBA 3HHLD 4H03B 1Z05A 3GE1A 1P90A 3P49B 3K2PA 1AXQA 3OFGA 1W2BR 3QJLA 2ETJA 1OH6A 1LOTB 3CC7S 3OYNA 4JI7F 1SCJB 2IBKA 1PYSB 2Q0RA 1Z2ZA 1BHNA 2QLJB 1VC5A 2DPJA 1L3UA 1NGCA 1JJ4A 4HLBA 2FC9A 2YWKA 4KFBB 2P9IB 2IVOA 4JV0A 1CQNA 2IA0A 1MWKA 4B1UB 3V5RA 1Z25A 2HWHA 3EWGA 3BF1A 1F21A 1Y10A 4AFFA 1FD2A 1OS5A 4A8MP 4M5NA 1GLFO 2IDEA 4FL9A 1S59A 3KHHA 5GAHI 1RHMB 2Y3YA 4YEAA 3O1WA 2CA9A 1VQ5S 5AQKA 2GUPA 3C6HA 4CJRA 4DV4F 3NGYA 2DXEA 1MMLA 3G6VA 4YNQA 4CTAB 3CPEA 2LDYA 3D54A 2KXNB 1NU4A 2CNLB 1OY8A 3LDOA 1D5AA 1WHWA 3HJVA 3HI9A 2XHWA 3S3NA 4O55A 1RLDA 4USVA 1N5VA 2B4UA 4E0DA 3KK2A 3MXJA 1RT7B 4OYXA 1VC6A 2HIQA 3MF5A 1VSMA 1JKHA 2BABA 2D4WA 4OHVA 5IWAJ 3AOBA 3CJ7A 3PV8A 1O8BA 2XNQA 3FR0A 3D0PA 1VI7A 2GVDB 5D0RA 5G0RA 3RSEA 2N3OA 2GV9A 4B9UA 1K47A 3PX4A 3FMWA 2NUHA 2UV8G 2RSQA 2VBYA 2ZH3A 1DQ8A 3DMJB 5KG0A 4USKA 3BSOA 5M2RA 1NGFA 2XLKA 2QRRA 1VJQA 3DDKA 1VLOA 2GO9A 4WFBQ 2F4VJ 1FTCA 1K8KA 3MM6A 4X4UA 3LPUA 4FWOA 1BI4A 4DUYK 2ZWOA 3AO5A 3K7RA 1SB6A 1MROA 4WQ5C 1U0SA 1OH8A 1HYSA 3P38A 5F1XA 2FDNA 5JXSA 4DL6A 5SZTA 1S4EA 4ATNA 1EB0A 3N28A 1VAZA 3RMBA 3VF2A 3DOMA 5DGBA 5HRRA 4K8XA 2W9AA 1QVGM 3JSRA 4IH6A 3EE8A 2PFDA 2C2RA 2HHHK 3CCUN 2QKKA 4PUOB 4CRJA 2QLBB 2VPXB 3VAJA 4NCBA 3FGVA 4DV4J 3BO2A 2A40A 4FPIA 4HHHA 1D8YA 3SV3A 3SBMA 3QZ7A 1N52B 1R0AA 3V6HA 4LF7J 2WBMA 4F26A 2P9SA 5F2RA 2ASMA 3W5YA 1DTQB 3S9HA 1RJJA 3KG4A 3ZTSA 3AY9A 4WK1A 4EZ9A 1X8DA 3D1OA 4LF9K 3WIVA 4ZVQB 3CFPA 4DG1B 2HLUA 3C7NA 1I94F 3CCRS 1HNWF 2OEMA 2E5LJ 2E9ZA 1L3KA 3KLVA 1RT4A 2R7RA 3V2UC 5FDLA 2X51A 5B0EA 4AT1B 2KT3A 3ULEA 5JMVA 3PW2A 2VDIA 3N6MA 2FVRA 2DT9A 2KFNA 3CCWA 1VSKA 5KT3A 4QIGA 5ETPA 1S1TB 4KSEB 2XZWA 4G1QB 2JH3A 4A2AA 3PO4A 2KHOA 3SFUA 5K8MA 2GHPA 3BZQA 4TLRA 5AQQA 5EVZA 2XCAA 3JQMA 5CCMA 3HL8A 1NNDA 1NHVA 4OYMA 5IZHA 2GWKA 2O4GA 3ILIA 5EOYA 1NJIT 1S6QA 2DBBA 1YZ6A 2F8EX 4ISGA 2HQIA 2DRAA 4LREA 1FRMA 4KR0B 3J80Y 2DHSA 2V2QA 1RT2B 2BKPA 3G6YA 3OR1B 2QI2A 4DLGA 5K14A 1FKOB 4LF8K 5AFUA 5EWFA 1VFJA 3NF8A 3CXCR 5AXNA 1GLJO 3KLIB 4H4MB 4ZVPB 3FFIA 4Q0BA 5KG2A 4ZCIA 3CULA 1ATSA 2FY8A 4FW1A 3RG6A 3RRKA 3MM6B 5GAEI 3OUYA 1UJ6A 3HSZA 2ZUAA 4H5RA 3ALYA 1YRXA 2QIFA 3J8AA 2X3GA 3J7ZT 1SKSA 2GVZA 3OLBA 3DXKA 4HTUA 2UUCF 3P83D 2L9WA 4DV0K 1YT3A 3L9ZA 1X4FA 3KD1E 5LMNF 2GVDA 1N36F 3CJ8A 4YN3B 4FWQA 4GO5X 5D78A 4J9SA 5E33A 4C3MA 5ADZA 2B9EA 3P3DA 2ADBA 5KOWA 4F4XA 4DQIA 3L2VA 1XHXA 2RHQB 5F8LA 4YB7A 3VN5A 2DYAA 4CLWA 5BR8J 4JI0F 4OZJA 2UXDK 3U7JA 1CJKB 1H1VA 1XNRK 4C4WA 5E3AA 5AZIB 4IOAL 2OHDA 1WC3A 2DY4A 4TVAB 3NS7B 5DRKA 3C16B 3KTQA 2W9CA 1RTHB 3DFEA 1DBDA 2GZOA 3BH6B 4LR8A 1O0PA 3UCZP 4CF1A 4I7FA 3CJ4A 2HZCA 4Y2CA 4MYTA 4DV1K 4YOYA 1PGZA 2DNKA 3UD4P 4XAKA 4DQRA 4HKQA 5AE1A 4GKJF 2RDIA 1N56A 4JB8B 4AH9A 2V52B 4LR7A 1IUJA 4B9NA 4DTJA 3B8AX 4X64J 3QDKA 2YNIB 3P1GA 3W2WB 1EWQA 3CM5A 2D3ZA 4F0KA 1RWMB 4FN5A 4GMJB 4OLBA 2HVIA 4FLWA 4NLQA 3NMUA 1VSEA 3DGVA 3Q8RB 3DM2B 4ZPAA 4CK1A 1HRHA 3K8WA 4O8UA 4CJQA 5ADXH 4OZ3A 5GINA 1YWXA 3ZSZA 3D2FB 2EFOA 3ETOA 3RBEA 3BGOP 3T1HF 5DMRA 4KH0B 3HP9A 1NAQA 1VQ8S 4U95A 3QWPA 4OVLA 5AJ3K 1GLAG 4CLYA 1QVFR 3J7YI 4WF9L 3D1HA 1N54B 2GELA 7AT1B 2ZZTA 1F9HA 3L2WA 2WRMA 4RW6A 4K4YA 1IQZA 1RB0A 1ROFA 1AROP 4JI2K 4DV0F 3ENHA 3KLHA 3QINA 4HH1A 3ENOA 1T3NA 2AJQA 4JI3K 1RAIB 4I6AA 2ZH7A 1KS2A 2ZJPL 3ZYYX 1RE1B 2CVIA 4ZP9A 2P51A 4DR3K 3P8BB 2BM0A 1N33J 3PEHA 1FCAA 1BXNA 4FM2A 1RABB 4M1KA 3HFZB 2I7NA 5C0YA 1LOUA 4ES3A 4WP9A 4LF2A 3CO0P 4QOTA 3M6GA 3MEGA 3S6EA 2YHXA 1VJWA 3TJ8A 1YJNS 3C94A 4GC6A 2B51A 1WELA 1UAXA 3IO1A 1GTHA 2J9DA 3D6TB 3UKUA 3EICA 2Z2LA 4PAAA 2QG9B 2OD6A 4MFBA 4FBUA 1UVNA 3KK1B 4ID8A 4YOXA 4Z4HA 3U3GA 4KV8A 1HX1A 1OQ3A 2Z1JA 9RUBA 4FJ5A 4XK8C 3PDNA 4NLTA 2AYGA 2LEBA 3JQJA 3OSNA 4QWCA 3NCQA 4X84A 2E5LF 3K59A 3MCOA 1IO2A 5LT5A 1N32J 2OANA 1TUGB 2PFUA 4KB7A 4I9LA 3SLCA 2J6SA 3IFRA 2N82B 2HGMA 3AOAA 3M32B 3DLHA 2IMWP 2ZE2A 5HSPA 3IR6B 4JV5K 3UWTA 4YR2A 2ZUGA 2HQ3A 5M1OA 1BCMA 1G15A 1C0MA 3DOKB 4IOCQ 3AARA 2CDRB 2I6WA 4JI5J 4ECTA 3L2UA 1Q8IA 1RBTA 1ZZNA 1IM4A 4J9NA 4OJ3A 1JCEA 2ZVIA 2Z1HA 4IRKA 1F6TA 1SPBP 3TPQA 3C6UB 3PR4A 1T05B 5J1EB 2XYGB 2F8SA 2U2FA 3OYGA 4OZ1A 5AQWA 3BYPA 4MTPA 1M1GA 2AEJA 3MMAB 4LQ3A 4M3TA 1TU0B 4J2EA 3RJMB 4U8VA 1HBOB 4DV4K 2RS2A 3BBFA 5AQOA 1KQSR 3HXMA 1E6VA 4QZVB 3W2VA 2FLOA 1RHUB 3ILLA 4EYHB 2MXYA 1CJUA 3CTRA 2BH1A 4N41A 1GX6A 5E3PA 3SCLE 3R8YA 1U6BA 4ID1A 2OPQB 4BG8A 3GFHA 2RT3A 1U2RA 2VC1A 2YKAA 1X60A 1KFDA 4JEPA 1HR0F 4UZBA 3O9RA 2VKRA 3KIOA 3CG7A 3FJ2A 4HEA9 5HO4A 4CZEA 4ICLB 3MM9B 1NGIA 1EXQA 4A8XA 4BRNA 2LU1A 1ZM4A 4NCGA 2E7VA 4C11A 1GK8A 1VHFA 3W64A 4DHVA 2V9KA 2OZMA 5EX3A 2RQMA 1EHWA 4DR6K 1N48A 4CIGA 3K5PA 2OLWA 4KRWA 3QNOA 4FWNA 3KNGA 2R2RA 2E1AA 1HQEA 1GTEA 3SCJE 6AT1B 4LVNP 4CERA 1SQFA 1RAJA 3I5CA 4GO7X 5IT9U 3A3OB 3HSTB 5F8JA 5LSRA 2J9CA 4L6V3 2Q6BA 3O08A 1VCTA 2YQ3A 4GKJJ 2ZBPA 3A8IA 4C3LA 3VQPA 1VK3A 5A6WA 5JLFA 2DEIA 3FCHA 5AQVA 2CVEA 3DDNA 1XR5A 1BGXT 2RRBA 1IKXA 1X9WA 4E8UA 3IWNC 1RTJB 3SDEB 4KHPK 3CEDA 4CO0A 2FSJA 3THVA 1S0MA 2KN4A 4M42A 4URSA 3QEXA 4V19X 1WNSA 1NBEB 2PAVA 4FJGA 1UVMA 1RTIB 1I39A 5CQGA 2DHHA 4CM0A 3OYMA 4QR1A 4OV1A 3ADAC 4N8NA 5JLHA 3IS9B 5IM0B 3JYTB 4FZVA 3OHBA 4A8FA 4JK7A 4JHDB 5HROA 3G8TA 1H7XA 4JKDA 3FEZA 1P27B 4NLUA 1C4CA 4PR6A 2DR7A 5T14A 3ZT3A 2QA4S 4E3SA 4YOUA 1JIHA 3I8DA 5CYQA 2JOQA 3VTIA 2W4DA 4EGLA 4RBVA 4DV7J 4IEEA 3KNAA 3WEEB 2KYZA 3IRXB 1J53A 5HL7Q 2FLPA 4A62A 6FD1A 4EU0A 3WXMB 2VCPA 2M70A 2CFXA 4LF5K 2OMOA 1Q5VA 2A2CA 2F1FA 4KAIA 5DG9A 2HQFA 1SC4B 1U6FA 2O5DA 1R27B 1J54A 4JUZA 1YDLA 4BDZA 2GMJA 4TLQA 4LC9B 4DR5F 2EK1A 3R6GB 1IKVB 4ER8A 4CZJA 4B3OA 3OBWA 2CQGA 1UEVA 4IXCA 1DHMA 1JB0C 3DXMA 1VQKN 1U2FA 4Y2AA 4J9MA 2G1DA 3P4IA 1FK9A 1VC0A 2AQ4A 2D0OA 4NI2A 5D6GA 4WYLA 4P71A 1M90O 4OKJA 1UZHA 2E2NA 1AFIA 3BZCA 1RWPB 2X1FA 2XY7A 2DFHA 2C2MB 3NMAA 3KMQA 3W8GA 5KTQA 2J7UA 3G96A 2DTUA 4MIWA 5CCLA 3BEGB 3SCIE 1U1RA 2Q31A 3T19A 3M3ZA 3NGZA 5ELZA 2O8DA 4I6YA 1BQMA 2NXNA 3UN2A 2PYJA 3WXJA 2VB6A 2YWEA 3TSUA 3OYDA 3JSMA 3ITHA 4K0KJ 3FE1A 3QQCD 3DLEB 4OX9J 3NF7A 2UVWA 3THYB 4KAZA 2HHWA 5AXKA 2ZNYA 1RGVA 5J2MB 1F9FA 2M0GB 1SUQA 2EXUA 1Q79A 5GADU 4EBCA 3P5JA 2QWMA 3GFXA 4RUAA 3V81A 3L4BC 4DV5J 3G25A 3CJQA 2CRLA 3UI3A 4BRCA 4OX6A 4LH5A 3CJ0A 4FK4A 1Y0HA 1NU0A 3KHLA 3R1LA 3IAM9 3THXB 3PJ9A 2W9BA 1QHAA 2YWGA 3HYFA 3ZZYA 3ZTPA 2WTUA 5AQZA 3F9KA 3VQAA 3WQPA 3MURP 4BR2A 2HK2A 3QZ8A 4DR6J 4LF6J 3IGNA 1QSYA 3MHYA 2XO7A 4H5NA 3OTOJ 4JD2A 1XI1A 4O3PA 2BW7A 4NZ7A 2QK9A 3VTHA 1NPPA 4IFEA 3HBTA 3GP9A 3IG1A 2ILZA 2KO1A 3EUNA 1S6UA 2RQ4A 2DO0A 3W66A 3FNNA 4N8OA 3UNGC 2JLGA 5CA5A 4ECQA 3HFKA 4A47A 3ZX0A 2H48B 2H3GX 2F4VK 4PABA 3P6YC 4HDHA 2AJFE 4IYQA 5KG4A 2Y1IA 5FPDA 2Z4PA 2HG4A 4X65F 2F3JA 3GE9A 2NRTA 1S57A 1T6CA 4IFVB 4FNHA 2HHPA 1RWWB 2G8UA 3T1YF 4O3NA 4Y6IA 4ED6A 4IFVA 1FJCA 3QGHA 2CZ9A 1S6PB 4EZ6A 1S48A 1ZYQA 4JI8J 3MEDA 1NJWA 2ZD1A 1KOHA 3AO4A 2P9NB 1FDNA 2W01A 4W5RA 2C2ZB 3M05A 3KLEA 2IVNA 4CJFA 1YJRA 4YHHF 1YAGA 2OTLS 1Q1KA 3KHRA 2W7AA 3VCDA 4KHPJ 4NLPA 2Q3PA 4CP5A 4FPBA 3PX6A 3UDCA 1RBOB 1B70B 2I7PA 1MW7A 2EX3A 5GMEA 3JB9k 4WF9Q 4OGCA 1XNQF 4OZ0A 1N34F 4DL2A 4H4OA 3D6RA 1REGX 2CDQA 3MN6A 3GCWP 4DR6F 2JVRA 1Q0NA 3NGDA 3HULA 3M8QB 2C3PA 4AHSA 5KFXA 4H8KA 4YMEA 3JSYA 3UDLA 3A5OC 1J5EK 4PKGA 2ZQBA 4PPZA 3QT7A 4OLAA 2P6TA 4B3SF 3VVUA 3CCRN 1GNKA 3V81B 4DU1A 3TZXA 1F2HA 1NK6A 2GEMA 3UCGA 1YK9A 3G4SS 2HNYB 2ZBRA 1E4GT 5F0XA 4LUBA 3BDEA 3O9TA 2OEKA 2DHAA 3L7OA 3O3HA 2CGLA 1U2VA 2HBLA 3SJJA 4JYAJ 1C0UA 4X4NA 1APSA 5GMKa 4FM0A 3R27A 1ZAWA 3L0QA 1WTFA 1FNOA 3VQTA 3CCQN 1QDUB 1HNXK 4TYBA 4JI7J 4ELVA 1I94J 1HNWJ 2EG1A 1KHWA 4OPAA 4HYKA 3LL3A 4MK9A 2KTQA 1QTMA 1KP6A 1IJJA 2LQBA 2G9OA 3BM7A 3E8OA 2ALYB 2XO6A 4AD6A 2X3DA 3ZSOA 2OCEA 3OJUA 3FZFA 4MO4A 4HL9A 3DRYA 1X4AA 2W8LA 3PIPL 3VOVA 3EXYA 4WFNL 2ZKTA 4CLPA 4LSNB 5E41A 3TP2A 3C14B 5LSOA 2MQQA 3P31A 4FJXA 1F5CA 1X4HA 2OPSA 4LFCK 3OTCA 4BS2A 2UUAK 3IMQJ 2D0CA 2BE9B 3BBBA 2NRVA 3GV5B 5DG8A 4CBUA 1VYAA 5J2QB 2ROPA 5H9EK 4HVJA 1VQ4N 5HP1A 3THWA 4LRCA 1N34J 3C95A 2P9UA 2V5HG 4ALZA 1NGEA 2VASA 3QGGA 3SSRA 2VYPA 3IRXA 3QNNA 3CJKB 1B0PA 1RBSA 2HQCA 3HHLC 4IR1A 4X2BA 4AXJA 4BWJA 2HB5A 4YY3F 1FEEA 1WG1A 4P9SA 3I6PA 4FLYA 4ZLNA 3ET6B 1X9MA 1S49A 3T1HJ 2AW0A 4KGZB 5E5NA 4ZCMA 1ZAXA 2WW8A 4OZLA 3G8SA 1Q81O 5HBMB 5GAGP 2WONA 1LWEA 5B7WA 3ZT0A 1UVLA 1RWVB 3SMSA 2VG6B 4QWEA 1VQYA 1RAAB 4Q7AA 3CIZA 3GJQB 2Q1NA 3DKDA 2RU9A 4YB6A 4RW8B 4QS7A 4X62F 1P9QC 1H98A 3MM8B 4EUVA 3VQ6A 3H1VX 3O80A 4CI0B 2QWLA 3M6WA 5KG5A 1U1OA 3VZIA 2GFFA 5F8HA 4HHJA 5C24B 2CJXB 1TK0A 2QWPA 4ECSA 3DLGB 4DV1F 2A1RA 2PA8D 4B9LA 1RDBA 1H0HB 4C23A 4R5PA 4K4TA 1ZBSA 2HFUA 4NASA 3ATUA 3K17A 3HVTA 1MDUB 5KFRA 2NXEA 4CJ3A 1R8BA 4RU9A 1PKUA 3MAQA 2CPDA 4B3SJ 4JI2J 4GV9A 2UYTA 5KFQA 4OLOA 1MU2B 1GH8A 3IA0A 2ABYA 1SC1B 2OGUA 3ZETB 4LY7A 2QA1A 5C7PA 1Y97A 4DUZF 3PIOQ 3Q22A 3FLCO 5KT4A 1LWCA 3TR8A 4FYXB 4PWWA 1U02A 1XQIA 3MM8A 2E7XA 3GCXP 5IS2A 4ID5B 3CF5L 2VD3A 3SMPA 2M52A 4U7UK 4WKYA 2W6KA 2MKCA 4PEOA 4ANDA 1F60B 4X66K 1U7LA 2OPQA 3CJ3A 5T7BA 2MJNA 3V9SA 2Y9HA 5FD1A 3HFVA 2GIQA 4A4JA 2ZM6K 1BA1A 4HI2A 3G87A 5BPMA 2WONB 2ZWHA 3WQTA 2IHR1 2LXFA 4ECXA 3OYBA 1WB9A 1T11A 4ZHRB 4CH1A 2UUBJ 2IVMA 4JOUA 2QWOA 3HJFA 1CPZA 4FJLA 1KWMA 5I4MA 4NA3A 3OA9A 1IBLF 2F5GA 2FC8A 3QGPA 4OZ2A 3AO3A 3RWUA 3H4BA 1IM6A 2Q43A 1FKPB 1NSPA 3KD5E 2XC9A 3CT9A 4WJBA 2FVQA 4WTOB 3U1NA 2HVZA 5GADI 1RU2A 3QO9A 2J4RA 3TAPA 1T05A 3O5TB 2A3JA 1NLKL 1S72N 4JI0K 3M8SA 1Z1ZA 3BR9A 4OHWA 3W3SA 3NY0A 4AM7A 4C1NI 3D6MB 4F02A 3KJQB 1IR0A 5KFGA 4MKVA 1R6VA 1IBMJ 1WD6A 1YJ7A 2V34A 1SC3B 1BA0A 3GQCA 2O8CB 5C2FA 3BGRA 2CXEA 1EJ7L 3PKMA 1SVDA 2F65A 5JICA 1FXDA 2OTJS 1J5OB 2AJ0A 3EGNA 2N7CA 3CC7N 3C6TA 1Q16B 5F3TA 3ULDA 2WSFC 3NBPA 3U02A 5D3GA 3THPA 3DC2A 3QLHB 2P9KA 1JJCB 4LF9F 2K1RA 2YWHA 2WZ1A 5M1KA 3NCIA 3A8EA 3J81j 2F8HA 5IFMA 1V3RA 1WC1A 1WBBA 2EPIA 4DR4J 5J1PA 1HBNB 3NBPB 3VALA 4N7TA 4AM6A 2VA2A 2VG7B 1A7GE 1X5SA 3RBXA 1IKWB 2HBQB 1NH8A 4LFAJ 2UXBF 2ZH9A 1RT1B 3VR1A 2ZC3A 3R5BA 2H1YA 4TU9A 4YORA 4KTWA 4KH5A 3IBFB 3J80U 2GA7A 4ZLJA 3SEOA 1IKYB 1HYVA 2EWHA 1S7HA 4EWTA 4FWSA 4DUYF 1YITS 3NL0A 5LJVA 2Z58B 5CYJA 2VWBA 1GOBA 4W5TA 2VFUA 3CXCM 4Z7YA 3CPWR 3D2WA 5C5JA 1VOMA 1EIYB 3FCVA 4TY9A 2GS8A 3IDHA 3KOAA 3TO8A 3L3CA 4X4RA 5DK5A 2HEKA 2OFGX 1REVA 1W26A 3OD2A 3KLGB 3FC9A 3DDIA 3CCLN 3MPWA 4IRCA 3SJHA 1R0CB 4H4OB 4KE5A 1I94K 3W9HA 1HNWK 2L9NA 3FVYA 3ILJA 4HH0A 4R8UB 4ERDA 2VKZG 3V1OA 4MMOA 2FC0A 4NLSA 7FD1A 4FOEA 3CCJN 3H20A 3D0GE 4OYBA 3H1QA 3MPUB 4DTMA 2MHNA 3A8YA 3UR0A 4A2BA 3MMCA 5M1FA 2CPZA 2HGNA 4N77A 1D8ZA 3SI8A 1QJHA 4CGGA 3FZBA 4BRLA 3MR7A 3RMAA 5EX5A 2YHBA 3NF9A 3M30A 1RU1A 3H59A 2MJUA 1HNZJ 1S1XA 1WORA 5GIOA 1PYTA 1CXUA 3K0SA 1KD1O 4M7XA 2JZ5A 4IH7A 4Y1CA 1C1AA 3G2XA 4QS8A 3EY1A 3MUMP 1WOPA 2UUWA 1W0HA 4CQ1A 3BF4A 1FF2A 4NWBA 2C28A 3ENBA 5SUHA 3SBGA 1P6TA 1NBWA 3FSYA 1YX2A 4FBTA 3G8QA 4PXEA 4ZPBA 4JRQA 3ZSYA 2IVFB 5CZ1A 3JSBA 1U09A 3GR0A 4CHQA 4CJUA 3EGVA 4HR2A 1A0OB 5ITHA 2CQHA 4WTYA 3NE6A 3VQEA 3X1LB 3LM9A 2HHUA 5D8HB 1GOCA 1UOCA 1LFWA 2PC6A 4HACB 3LP1B 2FHKA 3O3GA 4J91A 2ACYA 4ILRA 4JD2B 5K20B 2DISA 1UFKA 1T03A 2HHQA 4ECRA 3LPYA 4OPHA 4ILJA 3J7YP 4IFYB 5EX0A 1H2TZ 3EGWB 3PHEA 4ZKAA 4BE1A 1WOQA 5A2QO 1WG4A 4A5BA 4GKKK 2PDAA 5D77A 3BV8A 4NO7A 2OELA 3HMJG 3OTBA 3RW6A 4JKBA 1SKWA 2K7KA 4OKKA 1HPZA 4M3XA 5HMYA 3RB6A 3OW2R 1U04A 1BD6A 1BG3A 1YSJA 3NCRA 4UTGA 5IC4B 2I1RA 4YB1P 3B8HA 2HVEA 4CIFA 2F7TA 3DXKB 4LF4F 2ZFHA 4N47A 4BCAA 3POTA 3ELHA 2WOMB 1NK0A 2LSNA 3THYA 1C0TB 1Q7YT 1UA1A 4CEZA 3BREA 1X9SA 1HKBA 4K5SA 3VQDA 3BKTA 2HYIB 2OAUA 2QWQA 3GOIA 1NDPA 2ASLA 2P9EA 3FFIB 1MMDA 1RKIA 4FKYA 2R7TA 5JVHQ 5MLCV 3I32A 4KI6A 3EJMA 4CFAA 2W4PA 5LJ3Y 2NLXA 4NPOA 5M2PA 3IMXA 4X66J 5G4DA 2A5XA 2WOMA 3A3NB 3UQSA 3B4MA 2DHGA 2XI2A 3ID8A 1NK8A 4ECWA 4UUXA 4HI1A 4QWAA 5SWMA 3RGIA 3PW0A 5D4LA 5JJBA 3KLFA 3QICA 3F44A 1EKEA 2IIRA 4BC9A 2KHDA 4J2BA 4A59A 1S10A 1S1UB 1JQGA 3UPFA 2VFVA 1PAUB 1U45A 4O0IA 3H40A 4ISEA 2FGOA 4K4SA 4ED8A 2CH5A 1F5BA 4Q8FA 3OXGA 3CCUS 3GDQA 2YKOA 2QEXS 4DTSA 3TAMB 1WJ9A 5L9NA 4HDGA 4PYAA 4OYAA 4IRDA 4S0MA 3I31A 1ZBTA 3OJSA 3KZBA 1XR6A 3WNGA 4Y1DA 4LFBF 1SJQA 1FI4A 2NRXA 1RISA 1GLLO 4DN9A 1M5HA 3U3YA 4KB1A 1TP7A 1VSFA 4JK9A 4BVPA 4DTUA 3IC1A 4KHMA 3NNCA 2FTRA 4W90B 3N4WA 5ETMA 1P9YA 3WXLA 5DZ7A 2C3MA 3KUGA 2D41A 1D9FA 1HWUA 2N3LA 3LW5C 4OQJA 2A41A 4KHWA 2KI2A 5LMNJ 3RAXA 1KCFA 5M1QA 3QIPA 4BC3A 1GLBG 4BRKA 1CS4A 2BE2A 2LEPA 3PSIA 4JP8A 1RBRA 4IQXA 4I64A 3B6BA 4E89A 4ZOSA 2NQPA 1S1XB 3AVGA 1B0VA 1S76D 1LAWA 2PGCA 4CW7B 3Q8QB 1YTAA 1MWMA 4X4QA 4JAXA 3H46O 5J2PA 3MMCB 2ZH6A 2V6AA 5ETVA 3T1AA 4BR4A 5EY4A 2B43A 3VZHA 4EI2A 4J9PA 5HAOA 2UUCJ 3W63A 4HHTA 2GQCA 3OYJA 1ULRA 1URNA 3W61A 5BXIA 2F8MA 4A57A 4RPFA 2JVOA 1WSGA 1LNQA 4E1JA 2H4WB 1Y3KA 4LSZB 1P1TA 4DV6F 4U96A 3RBDA 1EP4B 5DQHA 4CM2A 4BRHA 5GMDA 3V9WA 4KO0B 1TKTB 2WCXA 2ZF5O 2MSTA 2CPIA 3CJCA 2YH1A 4CGDA 3VPZA 3PRVA 1K1QA 3QBWA 3ISZA 1TMJA 3R1HA 2HQGA 2OP5A 3ENAA 4HCBA 1NGBA 3BUZB 3SCKE 4L8RB 2BRKA 8AT1B 4CGFA 4CJ5A 5A8WA 4DL5A 4W5QA 1Q86O 3AVHA 3QERA 3EPGA 4CIEA 2Z2ZA 1CJUB 1WC4A 4ZVHA 4L72B 2WVBA 5HQMA 1EKRA 2BANB 2M88A 3TA2A 3UKRA 1LEOA 4F4YA 1HBNA 2I38A 2EBEA 5KFWA 1W2BM 1Y11A 4WCEQ 2OIHA 4AXIA 3A1YG 4DQ8A 4WU3A 2XGQA 3FSXA 4DMNA 3HSGA 2UP1A 1XNRJ 2B8PA 4Z94A 3KJFB 4QAGA 2BMBA 5HJYA 1KLMB 5EDWA 3CJ1A 3DLLQ 4WP3A 3C6UA 1N32K 2VBWA 4U7BA 2PFFB 2W24A 3A5MC 2DXFA 2YKNA 3IRWP 4D3GA 3CDWA 1KKHA 3SIPB 4DU4A 3G6XA 4B3SK 1JL1A 3MN9A 3KFWX 2LXIA 2C2KB 5DS7A 2FBTA 4R0EA 3KK7A 4M5KA 2KHCA 3PFEA 1QVFM 2O8CA 1SIWB 1RDDA 1N0VC 2D1KA 3KG1A 4EIAA 4IOAQ 4RX6A 3CNQP 3O6QA 3DLEA 3O6WA 2FBVA 1HNZK 3BJYA 5M1NA 5KFLA 1RYSA 4OLPA 1FNXH 1HFEL 3MUTP 2DTJA 5K5MA 4CEAA 4DV6K 3TAMA 4ES1A 1NKEA 3QO9B 2AWZA 2HRUA 4E1NA 1QQNA 2ZH2A 2YKQA 2U1AA 2CJBA 4WKRA 3BKFA 2HURA 3L2QA 3NGKA 3CFRA 1RAGB 3E1YA 3C6AA 4FLTA 1HHTP 2OPRB 1SH3A 2BANA 2WHOA 3D6HB 4USTA 4A8QA 1FE4A 3Q86A 3NHGA 3BBCA 5HQ8A 1ASUA 4JKFA 2J7KA 3BGRB 1V3ZA 2R4FA 2UVUA 5A8WB 2ZC4A 2YBVA 4CO4A 4BR5A 2CQPA 1IJFB 5E3CA 1NPRA 3BN7A 1UW4A 2XZTB 4V19J 2R8JA 3VF6A 1KEKA 2YJFA 1VQPS 3MMBA 3VGLA 4ZP7A 1KTVA 2VC0A 2O8BB 2D9PA 3EZ5A 4HTLA 2VBXA 4KO0A 1HQUB 4WE1A 2YHYA 3BQ2A 3ENQA 4CLTA 5I3UA 3NP5A 4DUZJ 4DR1J 1B7FA 3FEYB 2FSKA 2J76E 3O1BA 1MA9B 3VGSA 4DV6J 4A8YA 3R1XA 2MPUA 5AQNA 2ATCB 5F0WA 1JL2A 1Z2LA 1YI2N 3CF5Q 3CD5A 4RKUC 1VBKA 4BREA 2CYYA 4RUBA 4CGJA 2V8HA 2KRBA 3CJ5A 2W2PP 3PRBA 3AVLA 5L1LA 3FEXB 2CIMA 1UPPA 4BY9C 5DQIA 2D74B 2HBZB 3KDNA 4U8YA 4N56A 4NLYA 1FRXA 4YY3J 2KRRA 3GILA 5IM0A 3V6KA 4ZVOB 4AHRA 4EHUA 2IRXA 4NYNA 4RTFD 1FFWB 3MAAB 3AVKA 2EKYA 2AGOA 2SXLA 2VPZB 4QW8A 1B92A 1RDUA 4YS2A 3IWXA 1C1CB 2B56A 1CEZA 1RTJA 2NZCA 3G82B 3SDEA 4DPOA 4E2FB 4C9DA 2PEBA 4Z4EA 3HZ6A 4TXSA 5C25A 3OTDA 1CS4B 1TL4A 3K5NA 1JLAA 2EG2A 3KHGA 2G2ZA 4CZKA 5ETOA 4GMKA 3DAWA 3LP1A 1CC8A 2IAJA 3NNHA 4CZLA 5L1JA 4J9LA 4P6QA 2GJIA 1LWFB 1V4SA 1WLJA 1MN7A 1PSDA 1BL3A 4P75A 4Y2IA 4YDXA 4J8FA 4OX9F 5GAGU 2H51B 3FZLA 1LXNA 2P9LA 5KAKA 4QOZB 5CAAA 3NH1A 2AJ2A 5HRNA 1J2VA 3OFEA 4DU8A 1KQSM 2FVCA 4IG3B 5DLGA 4B3TK 2QXLA 2RQCA 1RBAA 3BGUA 3IUCA 2QM1A 3HM8A 4LF6K 1NGAA 4WE1B 3SQGB 5CH7B 4LBHA 2P9UB 3OYEA 4YDUA 1G3OA 4FJMA 4K8ZA 3FRYA 3AV9A 4AQYK 2LEAA 4DR2J 2XS7A 1G4CA 3LP0B 2PA3A 5BREA 2B4PA 5LSLA 1RWXB 4M8LA 3QT6A 2QXFA 1IR2A 3DGPA 4WYWA 4FOIA 1S1UA 4PPDA 1RA7A 4M3WA 2I5JA 4KGVB 3OHRA 2WAQD 4WQ4A 2J6TA 1LWEB 3LQVA 5JVGL 4ECUA 4FK2A 4BLGA 2B6AB 2YNFB 4OI2A 1QY7A 3H45C 2QYCA 1X3MA 4DCOB 2IM2A 4BE2A 3LDQA 1HBOA 1WACA 2GJ2A 5L1KA 2Q79A 4CJTA 1PBAA 3L4IA 2BJ9A 4IDKB 1G99A 3R3LA 4MKYA 3R7BB 5LJ5Y 2B8QA 1HQUA 2BEFA 1TFWA 1Q78A 4BC2A 1XHZA 4B3RK 2N4CA 2HPUA 5B0AA 1WF1A 3M2RA 1K9MT 1FVQA 3M8YA 2MY8A 3VWSA 5M2UA 2JGUA 2VOPA 1S6QB 2QO3A 3UE5A 4DR7F 4L3KA 2G4BA 1VQ7N 1HMVA 1EQ0A 1KRPA 3OYFA 4ECVA 2XLIA 2HHHF 1KD1T 3GJRB 5KPTA 3SPZA 1SKUB 1I51B 4OYZA 1IKWA 2DO4A 2HFNA 3B78A 1WOOA 2HNZB 4KHPF 1VIOA 2J0QD 1WG5A 2KJVA 3OL9A 1PJ6A 3K8VA 4WIIA 2W4CA 5LMUJ 2WFBA 1KLMA 2QA2A 3CJSA 3NGSA 4PCQA 1T3VA 1UAWA 4LFBJ 1N5YA 3BKUA 1VQ6S 3T69A 1AYEA 1ICEB 5ETLA 2XRIA 1NMEB 3KK1A 1U2CA 3TUPA 1YUWA 5HRPA 2Q2RA 1NHUA 2BJ1A 3EKUA 4F2RA 2V4QA 1MNEA 3VQCA 3WC2A 3SK3A 3AOCA 3L09A 4TN2A 3NMRA 3M5RA 4BWMA 1DEJA 2VIHA 4ZP6A 3D4JA 1BE4A 5EUHA 1RTDA 3WNFA 4OI0A 4CZFA 1R3NA 2N4DA 1YTUA 2HNDB 1HJOA 1YQHA 2H9ZA 1TK8A 2NPIA 1OPZA 3SYZA 5HL7L 3RAMA 3I55S 3ZTOA 1RWUA 4FPRA 2K7JA 1RAHB 1VR6A 4W4MA 5D0EA 2KL8A 5KT6A 3TVZA 2LFVA 1NWKA 2HFSA 3ILOA 3LDNA 4TSXA 3PYFA 2HHTA 1FERA 3NNAA 2R3VA 5L38A 5KFAA 3WXKA 5BPLA 4G65A 2NXCA 1WDDA 1I6JA 4WBFA 1MROB 1Q53A 2IMOA 3C2PA 2MSSA 1K8KB 4XIUA 2YNFA 4USUA 3TSPA 2NXJA 4ZVTB 3HPOA 3HSDA 1TKZB 1H6KX 2EVZA 2BQ3A 5CZ2A 4O3SA 2OMLA 2MZ1A 4AL6A 1VBYA 2ZJRQ 2IYIA 2N7YA 3MECB 3AA5X 3R5GA 3MECA 2M8HA 3U4LA 4X4TA 5D15A 1S12A 2IC3B 2RKIA 2JFKA 2I5JB 3EDRB 4CF9A 2XHCA 3I82A 3E2EA 2GMLA 1D3WA 2GQQA 4BR7A 5I42A 4A61A 3N6LA 2ASJA 5U47A 3LP0A 1NDCA 4DFJA 5GAHP 2CWKA 4NXMJ 3F41A 4CJWA 1FHTA 3GYGA 1K73T 1LWCB 1QAIA 1AZSB 3LTOA 1HNIB 1WBDA 1FT8A 1Y5IB 4CFBA 4IG3A 2J9DE 4LRFA 4F9OA 1RWOB 4FXDA 1BQXA 4DV7K 1K9MO 3HVAA 1N33F 2MDAA 2IDOA 2DH8A 3MAHA 1RXOB 1ZA2B 4FWRA 2OJ3A 3A8KA 3ZZ0A 4F2SA 3OYLA 3CI5A 3BEXA 1Q82T 3MDFA 1NGDA 2CWXA 1V6HA 4DFMA 1B9FA 3DLBA 1ELOA 3PIPQ 1SJ3P 2WVDA 4QR2A 4KGKA 4DSKA 1RSCA 2IM1A 1QQMA 2NR0A 1H7WA 1VSIA 4BBYA 4CIOA 3VEYA 3W62A 4DL7A 3OR2A 2QZ8A 3PYGA 3TU5A 4O0NA 3N5BA 1HKAA 2DGTA 2R7UA 1N5YB 3OLAA 3NWRA 5ETRA 2BE2B 5F3ZA 3AO1A 3IWLA 3QYYA 4LRDA 3MAAA 3EO3A 4CHYA 3EZOA 3FUYA 2HLTA 2D5RA 3LM2A 1I5OB 1YJWS 2ZM6F 2MQOA 1BMQB 2Y1LB 4DSIA 4TQSA 3DRPA 2A1BA 1A5WA 4J9KA 2ITMA 4MKAA 1RAOA 2YKMB 1R89A 4EBEA 4M5DA 2AX0A 4AF1A 1PJ5A 5A8RB 3ZCMA 5FPEA 3EVMA 5HATA 2R8GA 4LFAF 3TABA 4DX7A 4P2FA 1R59O 5LOQA 2VHGA 4JI3F 1YG0A 4CO3A 5I3UB 3WBZA 3QAEA 3TWZA 1IBKJ 4JI2F 4BVOA 5A8KB 5KOXA 3NVKA 2AHOB 2YY3A 3MR3A 1GAOA 1LCUA 4EYIB 2VFTA 2ZOGA 1XNQJ 2HS0A 3WEEA 3VAHA 2CUYA 4TY8B 1SL0A 2AA4A 1TVRA 3PW5A 4Z7CA 3PSFA 1BUXA 2QA4G 4CLSA 4OJGA 1H2VZ 3TX8A 1RT3B 4FZXC 4RL1A 3C14A 3KK3B 3MX5A 3OBYA 2YKMA 4CGHA 4JKHA 1CZBA 4ED0A 3CC4S 2A0FB 5BRHA 3CCSN 2MQLA 3I56N 2P2CB 2AZ3A 3U9DA 2HQDA 5E3RA 3DLLL 2H4YB 3DXMB 1IG8A 3JYTA 2DNZA 1ASVA 3CIPA 3L4QA 4DPYA 1QLNA 4QR0A 4M3RA 4Q43A 1AW0A 4YDDB 1DQ9A 2Z1IA 5AQLA 4K4ZA 1OSCA 2A3ZA 3KJNB 2BJ3A 1L5UA 1OYEA 3IBWA 5KPRA 3ULEB 2GBZA 3JS6A 5LMUK 3I87A 4NLOA 4QIFA 2R9LA 2L3MA 4MIBA 4QBUA 3BR8A 1UL3A 3EZUA 4CJ7A 2LXUA 3E66A 4CF0A 4BG9A 3NG8A 4HVZA 2FQQB 3LGMA 3LH2S 2D3O1 1MU2A 4YOWA 3TVKA 4FJJA 2O8FB 1VQPN 3POTB 2VG5A 2FZGB 2V9WA 4RCHA 4BC4A 2FJEB 1V3SA 1DQAA 2QWNA 3GONA 2LQ8A 3DOLB 1ZM9A 1LWFA 2ZJRL 4E7KA 2L48A 4F36A 2PY5A 3F5TA 3LUYA 1FRHA 4CI6A 1RHQB 1HI1A 4NX9A 3GG4A 9ATCB 3WUHA 5C24A 4Y28C 4FF3A 4X4SA 2FHJD 1SH0A 1K8AO 2E1PA 1M1KO 3TARA 1X1PA 2R8HA 1ZA1B 1N33K 2RU3A 3OVBA 3HOSA 4NCAA 1RK8A 3ZFVA 1V4TA 2BKNA 1LV5A 1FRLA 3LAKA 2O8EA 4RW4B 1RLCL 4B1WB 2XG8A 3IAS9 4RU2A 4H0XB 3WXIA 4RNFA 3FZMA 2KZZA 2MB0B 2RKIB 1JJ2M 2HHXA 1JCFA 1GEHA 3LDSA 3LWLA 1QQCA 1TL5A 1XTZA 1WSIA 5T41A 3GPAA 3NS5A 4EMDA 3T9ZA 3Q89A 2UV8A 2CG8A 4BRFA 2A42A 3H5UA 3LPTA 4UZCA 3EM1A 1GOAA 1YBUA 2NYIA 1YHQS 3CD6S 4HWIA 2C22A 3O4NA 4WXOA 1S9FA 1A5XA 4UOCA 5CD4H 1TUYA 1TKTA 2CJ9A 4KPYA 5BR8K 3OFHA 3MXHP 1JXVA 4WWSA 4FYWB 1FJGK 1IG9A 3I5BA 5AQPA 1X9JA 2WSEC 4EP5A 1XIQA 1IBKK 2VPYB 4AQYJ 4B9QA 4JI3J 4OO1J 4NLBA 4ZPWR 3MMBB 1TKXB 3PY8A 3V6JA 4IO9L 2BTFA 4C8KA 3VESA 1YJUA 3ENVA 3O9UA 3M8ZA 2PI5A 3T1YJ 4ZLLA 2HVDA 4JI6J 4U67L 2MZRA 2FJBB 3PXGa 2NZTA 2PYLA 4USIA 3SNNA 4DS5A 1H3DA 4DFKA 1WNEA 1JLEB 3X3UA 1GLCG 2I9SA 4Z2XA 3VHQA 2XHBA 5AQYA 2UXCJ 1P8ZA 3AJDA 3DN9A 3K2YA 4QYZK 4PY5A 4CEOA 1JLQA 2E2OA 4WQ5A 2LKZA 4CJ4A 4LSLA 1K1SA 4FWKA 3CSKA 3UD3P 4RWTA 4CD1A 3OXLA 3WX8A 1N34K 4KH1B 3KLGA 2YWWA 3SFGA 1HNZF 2JFDA 2X7IA 2RPIA 2HOEA 2PIIA 2XMJA 3ID6A 2ZZNA 5HOOA 4FCYA 5C2GA 2VGMA 3I5AA 4X4OA 1HBUA 4CE9A 2XMMA 1OKJA 2HNZA 1NRKA 4O0JA 1RWNB 2OUGA 3CJRA 4LH4A 3DHWC 1BU6O 4J2DA 3HD2A 1W9HA 4JI1J 3OYIA 4JK8A 3PUFA 4KKOB 1X5PA 1U8WA 5B0FA 3S41A 3SXLA 2E1RA 4FJNA 1U1QA 2FVPA 2E5LK 3CCLS 1T0TV 3H2LA 5JMNA 4WFBL 5JVHL 4PKDB 3THTA 1WAFA 2J8AA 5AE3A 1Q95G 2IRYA 1BQMB 2IVYA 5KI6A 5L39A 3NLCA 3I9ZA 1TL1B 4CVNE 3KJVA 3MXMA 4IDKA 3QLHA 2F40A 3TZYA 2BDPA 3JQKA 5KG7A 2ZBQA 5KFYA 2P5VA 1QD1A 2UUTA 2P9GA 4C2MA 2MGZB 2E2QA 3QEWA 2WK4A 1GX5A 2CNKB 5J2NA 2PO4A 3AVAA 2FF3B 1XMQJ 1LQ9A 3MK6A 4MFBB 1VQSA 1WEYA 4M3ZA 2ALZA 3CHWA 4ZHRA 1R31A 4QJVA 2JWLA 3EKSA 1OIAA 3A13A 4H0YB 4GV6A 3DYAB 4F4KA 3ISND 4CK2A 2CQ4A 4K59A 3ZSWA 2KYXA 3TA0A 4PG5A 4CLLA 5AQMA 4CEBA 2ZJQL 2VJUA 3O4QA 5BPNA 1T9XA 3S01A 4ZVEA 2AF6A 3I56S 4WP8A 2MKHA 3H7HB 1KQGB 3HHDA 5KT7A 2VH7A 3T5KA 2GIFA 3JXUA 2JC0A 3M2RB 3D2FA 3AVJA 5GAHU 1KVAA 1FWPA 1G7CB 5IV3A 4F3TA 1RBVA 2IM3A 3AJ1A 3DM2A 2DRDA 1RDRA 4I1TA 3MFHA 3FGUA 3UE2A 1T95A 1UKUA 3CMQA 4OPKA 3RYLA 2B9WA 1EP4A 1YZ7A 3TYTA 1TAUA 3VQBA 2DPIA 2HAIA 4NXMK 4DR2F 3NCPA 2QWRA 4JI8K 2ZH5A 3A0IX 4ILMA 2V2ZA 3OVAA 2V7YA 2R8KA 1S72S 2WUSA 3MM7B 3RB3A 2F8TA 2JL9A 4LF1A 2CNNB 3CMEN 4LFAK 4R5PB 1J6ZA 4YOEA 4P2XA 4RO0A 5J2PB 4OI1A 4DUTA 5LL6d 5LXYA 5C25B 1KNZA 3QEPA 3CCVS 3UN5A 3EVOA 3G82A 4ZMMA 2FBYA 1S0OA 4USJC 4MDBA 4W92B 3W5ZA 1ATNA 3SQGA 4GC7A 2Q36A 2B3TB 3G86A 1MN9A 1VQNN 1EWRA 8ATCB 3THXA 3J81U 2HF3A 3U27A 1RA6A 2LA6A 1YKWA 3TJAA 3LDLA 3AODA 1BHLA 2LQJA 3VGMA 3ZTRA 1V5IB 5F9NA 3R6LB 4H54A 3VVTA 1JLBA 3ZC4A 3MM7A 2DNNA 2DB1A 2M7SA 2MEWA 2DITA 1MLAA 1HLUA 2JEIA 3N5FA 4DCJB 1XMOK 2E5JA 5KGWA 1V5VA 5D0GA 1SZ2A 2QL7B 2ZBIA 1C2PA 1BWEA 3F2KA 2GAGC 4YDUC 3VGKA 1HKCA 3TAFA 1JLAB 4C11B 2GAHC 4ILHA 2QT7A 3K5OA 3BGFA 3EYZA 2POKA 2XWXA 1B99A 4J9QA 1O1WA 2VQFK 2R42A 3MR6A 3NKYA 1RT2A 2VFSA 1T8EA 3TA1A 2W7OA 1WF0A 2CPYA 2FZKB 1C6VA 3E3XA 2UUCK 3MCNA 5B09A 1CULB 3PM9A 4USHA 3MWBA 3AVBA 2DFFA 2HBMA 3ULHA 3OFFA 2KFZA 4PXDA 2VBZA 3Q0AA 2CPJA 2KVIA 1FTRA 3DYAA 2ILYA 5HBMA 3LANA 4DMZA 5AQRA 1YRUA 3QAUA 4P73A 1Y5LB 4DR7J 1PC4A 4DSJA 4AHVA 1E6VB 4ZN3A 3TAQA 4DL3A 3DJCA 1RT3A 2HHSA 2ERRA 5DG7A 2GVZB 1M5PC 4DXLA 5EGYA 1HJRA 3I9V9 3G4SN 2RD5C 4B3MJ 1VIXA 4NMLA 3RB4A 3A4TA 4NLDA 4H5WA 2KKZA 3AD8C 4LF4K 4DQPA 2O8BA 2DIUA 5HI7A 3N9UC 1FKOA 2D3OR 2HBKA 2B9XA 1X0PA 3MD1A 1HQ2A 4ZJLA 3KG0A 4PWUA 2OI2A 2C1EB 3IBCB 3FSIA 1HWJA 4P2MA 2JWKA 1SAZA 3CPWM 3IXQA 2P9CA 2LQ5A 4GKKF 2ZJQQ 2LDIA 4KTQA 1FXLA 3PYDA 1OVQA 3ZT2A 2AT1B 5AFUH 1K73O 3D3CJ 4ZPDA 1HWLA 1GMWA 3DRPB 3BO4A 2E5HA 1EQYA 3MXIA 1TAQA 5HROB 2A6OA 4C8MA 3VF4A 3TOQA 4CJKA 3O4WA 3IS9A 1WTBA 4F4ZA 1VQ4S 2EW9A 5KFIA 4LF4J 4GY2B 1UMJA 2J5AA 1UTAA 2BQUA 1W97L 3OR2B 1T9YA 2HMPA 3J7A1 4E7LA 1JLQB 3F73A 3QSYB 2F9JA 1YJWN 4B02A 5CHCB 1SBRA 3R5AA 3L6QA 4DJBA 4RNMA 2P5OA 3ZSRA 3UFCX 3H3NO 4ELTA 2OA8A 4MK7A 2MHEA 4NLVA 1VK8A 2M8DB 3PACA 3EMTA 5HN0A 4A8WA 2IGIA 3A2FA 2QSFA 3CCMS 2P9NA 1NJXA 4DHYA 1F2GA 5CZXA 4UY8T 1GLEG 3RRHA 2Z1GA 4NXNK 1WI6A 3CYMA 1TV6B 2PMWA 4OHXA 4DR7K 1RHRB 2JC1A 1M5SA 3E9OA 2J0SD 4XH4A 4KI4A 3PW4A 3DU5A 1FRJA 4O8KA 2X74A 4ZPTR 1RT6B 2MY7A 2VZ9A 1SXLA 2V8GA 4HTJ