2RKIA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase (RT) p66
total genus 153
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rkiA05
3AVJA 2DFEA 5CYMA 3BSCA 1NNDA 4QW9A 3V1OA 4MFBB 1FK9B 1HRHA 4IKAA 4ELVA 1Q9XA 1JIHA 1FXXA 4NLGA 4LH5A 3U3YA 3EPGA 4BE1A 3OL7A 3AVFA 1HNIA 3SUOA 3LP1B 3NL0A 1VSFA 3V1RA 1T7PA 1XR7A 4FW2A 4AHUA 2UVUA 1QAIA 1CZ9A 1WAFA 4CF2A 3MR5A 3KK3B 3ULDA 3T5JA 4OKEA 4CFDA 1D9FA 4IFYA 3BQ1A 1XR6A 1U47A 3FQKA 4Q5VA 4J2DA 4FK4A 2I1RA 4DL6A 2W42A 3KLHA 3Q8PB 4IFVA 5KI6A 4M3YA 4ZPDA 2OPSA 2GBZA 4F4KA 4J9MA 4E7KA 3PX0A 2B4JA 1NKBA 3KD5E 5KRTA 2WOMA 2W9AA 3D5MA 1X9MA 3G10A 3SJJA 4RW8B 1S1WA 4NZ0A 3LWLA 1ASWA 1LW0A 3I0RA 2CJQA 2IS3A 4B9LA 1CZBA 4OKKA 3GIIA 2KQ2A 5KFWA 3P1GA 1ASVA 3NE6A 4Y1CA 2OPSB 1VSLA 4IFVB 4YFUA 4I9QA 5KT4A 2RPIA 1ZETA 1S1UB 4ZVHA 4H54A 3G0ZA 1RA6A 1N4LA 3AV9A 4CEFA 4O55A 1HMVA 4IRDA 2B5JB 2W9CA 2KW4A 2VWKA 4OJRA 4N5SA 3OYKA 4BACA 4CJ5A 3N6LA 2C2DA 3RRHA 3ITHB 2ZQBA 4TLRA 2XO7A 2VG6B 1RTIB 4CIGA 2FJXA 1DTTB 4R8UA 2PY5A 1RBSA 4DTXA 2J6UA 1Z25A 3DLRA 4Q8EA 4RW4B 4MQ3A 3NBPA 4Z4HA 4LQ3A 1BQNA 3VQ8A 2RF2B 1QUVA 2JEFA 1N6QA 2IAJB 3HM9A 1QTMA 3LP1A 4C8OA 1VSHA 4AHVA 1NJXA 3QNNA 2B6AB 1FKOA 2HNZB 3LP0A 5F8LA 4ECTA 3CDEA 1D5AA 2YKMB 3KK2A 4IFYB 3G6YA 1BI4A 5F8NA 4DQSA 3OS0A 4CFAA 3ZSWA 2XCAA 4ZHRA 2R8KA 3MEDA 4ECSA 4KO0A 1T94A 3RMDA 4G1QB 1HQEB 4KTWA 3KLFB 3KK1B 2J6SA 3SPYA 4R5PB 3H08A 3SZ2A 3QO9A 3RAQA 3L2VA 4WFZA 3FFIA 1RT2A 2KZZA 1XHZA 1KVAA 3NDKA 3O4NA 1HNVB 2IJFA 4CJSA 1LWCB 3TAMA 3IRXB 1J5OB 4O3NA 2BRKA 1JL2A 4F3OA 3Q8QB 1T8EA 4G3IA 5KG7A 2JGUA 1YTUA 3PW2A 4MKBA 1BGXT 1D0EA 1CXQA 4FYDA 3DMJA 3KJVB 4ZPAA 3LZIA 2I5JA 4ZMMA 4J9LA 3V6JA 5HBMA 4DTRA 4KHSA 4QW8A 5CZ1A 5EDWA 3DOKA 2BQRA 3CM6A 4DTUA 3S3MA 2DTUA 1S6PA 5KFJA 3NF6A 1VSKA 3BQ0A 5HRPA 4FW1A 3KLVA 3AVBA 4FJ9A 4KSEB 3SQ2A 4URQU 4F4YA 3Q8RB 4F2SA 3QETA 4F4XA 1REVA 4FJLA 3NAHA 4KTQA 4M3WA 3SCXA 4CIFA 2D0AA 2YNHB 5FDLB 4MK9A 1EX4A 3AVLA 4EP4A 3RR7A 3P5JA 1KCFA 3PJXA 4YMEA 2FBXA 3TARA 2A1RA 4JS5A 2BQ3A 1RT4A 4E7JA 2HVHA 1N56A 4DL4A 1NOZA 5KFKA 2HNDB 1BL3A 4HCBA 2FBVA 1JLQA 4NLTA 1RYRA 5CYQB 4ZPCA 4ECXA 1RBTA 2DFFA 1VSDA 3AO4A 3RRGA 2UVVA 1WSIA 5C42A 3FRZA 5F9NA 3M8PA 1BIUA 2WK4A 3AO5A 4I7FB 4DU3A 2QKBA 2D0CA 3DLKA 2B6AA 1NK9A 4FLZA 2OH2A 2XRIA 2B43A 3OL8A 4ECVA 3RB3A 1NK7A 4TYAA 2ZD1A 1HQUA 3OYBA 1BCOA 5DQHA 4RG8A 3V9UA 1GX6A 3ZSOA 3KHLA 2UUWA 3H5XA 4YNQA 4LSNA 4HUFA 4DQPA 4CHZA 4CHOA 3LAMA 4O5BA 1BQMB 2R2SA 2WONB 3DOKB 4FS1A 3NFAA 3SNNA 2D41A 4JRQA 1REVB 3FFIB 4CJEA 3ZT3A 4Y34A 2G8VA 2ZD1B 4CEAA 3PR5B 4R5PA 4J9QA 4MKAA 2BDPA 4ZPBA 4CJLA 4FLXA 4H4MB 4CHQA 5EWEA 4EZ9A 1KVCA 2OPRB 1JLBA 4WYWA 4DEZA 1NOYA 4ZVEA 5FRNA 4KV8A 3M8RA 3ITHA 1UWBA 4DU4A 4EO8A 3K5MA 4RNMA 2P5GA 3H5UA 4K8ZA 3DMJB 3DM2A 4CF1A 1S6QB 3V1QA 2RDJA 1I3AA 1S4FA 4KREA 3WNGA 1Y97A 3PW4A 4QWEA 1I39A 4YR0A 4QWAA 3GQCA 1TV6B 1KFDA 3HPHA 5HRRA 3DYAB 4I7FA 4EBCA 2FBTA 1TP7A 1LWFB 2IC3A 1UWBB 4M94A 4PWDB 3CFOA 1K6YA 3LP0B 2D7SA 2AQ4A 3OS1A 4FJJA 3CM5A 2R2UA 4J2AA 4RNNA 1N5YA 4FJKA 3L2QA 3JYTB 3LP2A 1DTQB 3VQ5A 1SL2A 1IKYA 2R7YA 4PQUB 2BRLA 3LPTA 1RT1A 1RTIA 3EPIA 1DTTA 3MEGB 4DFMA 3I0SB 3O3FA 1T05B 3BREA 2ASDA 3TAEA 4IG3A 4HUGA 4KRFA 4NLWA 4PQUA 4DF4A 1WSHA 4CE9A 1TGOA 3AO1A 4QWDA 2V4RA 3L2UA 5EWGA 2WOMB 4KB7A 5KT2A 3D28A 2HB5A 4KHUA 2IM1A 4TSXA 4URGA 5KFMA 4FJMA 4MFBA 4IQXA 1TKXB 2EHGA 2YV0X 3LPUA 4J9RA 5C42B 3QGIA 5KG3A 3TAQA 4HYKA 3UR0A 3V9ZA 3F9KA 2WRMA 3ZSZA 4WFXA 1EP4A 4NLQA 3KD1E 4FLUA 3PZPA 5FRMA 4FJIA 3MAQA 3KLEB 4IBNA 1TKXA 3WNEA 3HP9A 1FKPA 1KHVA 4FJHA 3LALA 4FJXA 4QCLA 3AVHA 4Q0BA 3CFPA 3LANA 3PHEA 2E6MA 4ECQA 3O4QA 3ZT1A 2G8WA 3NKYA 3DYAA 1EP4B 1GOAA 2E6LA 3MEEA 4OLBA 4ED1A 2Z1GA 4CEZA 3KKRA 1L3UA 4FXDA 2ZE2A 4QAGA 3PY8A 4ECZA 3F73A 3OYGA 4FK0A 5KFPA 3DDKA 4DTSA 4ED6A 3KLGB 4WXWA 4EEYA 4CJFA 4YR2A 1RBRA 2HNZA 2IMWP 3M8PB 1C0UA 3E01B 3AA3A 3KHRA 3IG1B 1SL0A 3JSMB 1VSMA 1C1BA 1WN7A 4W5TA 4OPJA 4PUOA 2HHTA 1NJYA 3M8QB 1TK0A 3OYCA 1HARA 4M3RA 3PO5A 1U09A 4RW4A 3V9WA 4NYNA 4FJ7A 5K14A 5J1EA 4CEQA 4CJUA 1TKZA 3AA2A 2W7PA 1HYVA 5KRSA 3IGVA 3RB6A 4IDKA 5HP1B 3QZ7A 1WAJA 3NGZA 1R0AB 2FVRA 3QGGA 3EYZA 4C8KA 1DTQA 3M8QA 4X2BA 4ED7A 5DG9A 3N6NA 5J2MB 3VQ9A 3RTVA 4DL7A 5KFOA 1HYSB 3RMAA 3QEIA 1IKVB 2FVQA 3DRPA 5EWFA 2BANA 4ZVFA 4KAZA 5JUMA 4FM0A 4KTZA 3ICLA 2R2RA 1BHLA 2ASJA 2LSNA 4EZ6A 1VK0A 5FROA 5KFFA 5DQIA 5DG7A 1T3NA 4KFBB 3QINA 4B9UA 2XWYA 2G8IA 3VQEA 4KHNA 4FVMA 4KHYA 4ICLB 2AX0A 2JC1A 3RAXA 3OYMA 1NHUA 5T7BA 2FVPA 2IDOA 4MK7A 4BDZA 1IG9A 3IS9A 2JEIA 4DG1A 2FC0A 3NGDA 4E7LA 1JLEB 4J9KA 1ZBLA 3M9MB 3OY9A 1TVRA 3QIPA 3TVKA 2FJWA 1Z4UA 2IAJA 2YNHA 5FDLA 3VQQA 3S9HA 1S1VB 4K4TA 2WHOA 1BQNB 2YHAA 3DOLB 3MR2A 1GOBA 3NH0A 2VA2A 1KLMA 4RNFA 1TKDA 1C0UB 4KV8B 3GYNA 2AJQA 4RW7A 3AO2A 2FLPA 1SKSA 4J9NA 4MK8A 3EZUA 1JLAA 4F4ZA 2OA8A 3ZSXA 4CGDA 1YVUA 2R2TA 3OYDA 2O4GA 4EYIB 4NRUA 5L9XA 1RTJB 5DLGA 3HPOA 3DLBA 2ATLA 4IDKB 1LW2A 4KBIA 1S48A 3MXMA 1WSJA 1BCMA 3O3GA 3Q8SB 4R8UB 4C8MA 1WNEA 1GOCA 3FQLA 4O0IA 4MIBA 3HPGA 4BWJA 1S1WB 5KGXA 3TAFA 3C6TA 3KHGA 2OPQA 2AGOA 3K59A 4ZTJA 4W5OA 2F8SA 3AVAA 4J9SA 1JLGA 3OYAA 2WTFA 1WLJA 2P5OA 3FDSA 2GUIA 1HNIB 3M8SA 3ISND 5C24B 4ZTFA 2IOCA 1QHTA 2XGPA 3DRRA 3ZSQA 4NCGA 3SV4A 2VG5A 3DLGA 1U48A 4O3RA 4CJWA 5HLFA 3H40A 3RB4A 3DLEB 1RDRA 1QSSA 3DRPB 5KFTA 1UAXA 4G1QA 4OVLA 4F3TA 1VSIA 4E7HA 3OYLA 2X6NA 4K4UA 4RW6B 1RTHA 2XY8A 4ZP8A 4M3TA 4N56A 1JLCB 3SQ4A 3DRSA 4PA1A 4ECRA 3HHKA 3KMQA 1N48A 1WNSA 4B3OA 1J5OA 3KLGA 2W8LA 4NRTA 3V4IA 4DFKA 5KFBA 1JLBB 4K4YA 3OYJA 3VQ6A 3EY1A 1RT6B 5F8HA 2BE2A 3KLIB 2AX1A 5DG8A 2E9ZA 4IH7A 5I42A 1RT7B 2IGIA 3B6OA 5DMRA 1VSEA 2JC0A 3NMAA 3D45A 4CJ4A 4YP3A 4E3SA 4IRKA 2J6TA 4O0JA 5KG0A 4W5QA 2YKNB 3TAGA 5K14B 5SZTA 2DPIA 4RW9B 3T5LA 2YKMA 3H98A 1ZBFA 2FLNA 4K4XA 4RW7B 4FJ8A 3KMSA 4FZYA 1S1VA 4NLRA 4DSIA 3RWUA 4Q8FA 2ZE2B 1S9GA 2XHBA 3AVGA 4KO0B 3DOLA 3C95A 3IGNA 1A5VA 3IRXA 3MXIA 3CVKA 5KT5A 4QOZB 4NLVA 4ZHRB 3NF8A 3E51A 1YTAA 3V81A 4JV0A 2OPPA 3SUQA 4LSNB 5L1LA 1RDBA 3SPZA 5KT3A 1SH0A 4FLTA 2EC0A 1HNVA 1S9EB 4ZP9A 4JLHA 4PUOB 4JV2A 2KZMA 4KB1A 2X6SA 3AVCA 4DSKA 4IR9A 3T5KA 1RT5B 3K57A 4FJ5A 4GW6A 3HKWA 4CJVA 4O4GB 2VG7A 3LP2B 4CF0A 4F50A 4FM2A 3NF7A 4B8CA 4K4WA 3DLHA 4NCAA 3CJ0A 3KK3A 4CCHA 2XCPA 1Q9YA 3QGHA 1QQCA 4Y2AA 1RT5A 2W9CB 2C22A 1U45A 1HQEA 4BDYA 1L3VA 2VA3A 3ASMA 2C2EA 1HJRA 1RTDB 3HK2A 4I2QB 4KKOA 1RT4B 4CF8A 3QIDA 4HKQA 4HUEA 2CKWA 1LWFA 2IC3B 2XI2A 1S1XB 1DLOA 2YKNA 5KFGA 4DLEA 3U6FA 3MECA 2QK9A 5J2PB 3CDWA 3BJYA 3VQBA 4RNHA 3VA3A 2W7OA 1RT1B 1C0TB 2VWJA 2YNIA 2HHSA 4LSLB 2RN2A 2XI3A 1UOCA 3RMBA 3NGIA 3I5AA 3I5BA 3GV7B 3BDPA 3H5SA 4IR1A 1RAJA 2D5RA 3VA0A 4I2PA 3GV5B 5J2MA 3CYMA 2P51A 3QEWA 2R8IA 4E0DA 3H2LA 5C25A 1QE1B 2FJVA 4CEDA 4CERA 4AHTA 3SFUA 1IKXB 4O44B 3OYEA 5E41A 1RT7A 3LAKA 5HP1A 2DFHA 3HJFA 2OPQB 4GMJB 5D3GA 1RBVA 1U4BA 1KVBA 3GIKA 1NK6A 4PWDA 4DU1A 1RYSA 4QWCA 1CXUA 2W9BA 2Q3SA 2BANB 1NHVA 2C28A 3L3UA 1TAUA 1RNHA 4JRPA 2X78A 4KPYA 4KKOB 1RBUA 4OLAA 4O3PA 1BISA 1KSPA 4DWIA 4KI6A 4CIEA 3C94A 3RBEA 1MU2A 4Q44A 3UPFA 1U04A 1NK8A 3SV3A 5J2NA 4M3XA 4ELUA 1Z26A 3QIPB 1K1QA 2D3UA 3GIMA 3UIQA 1T05A 3TWHA 2HHXA 4FBUA 4DL3A 4K4SA 3QO9B 3TAPA 3CJ2A 4W5RA 3CWJA 1ZTTA 4WYLA 4ED8A 1RDDA 5KG5A 3KLFA 4AH9A 3V6DB 2D3ZA 2WB4A 3V6KA 1D9DA 4I9LA 3VQ4A 2AGQA 3OYHA 4CFBA 3MECB 4TXSA 4J9PA 1VRTB 4JS4A 2IA6A 3PX6A 1LWCA 4BE2A 2NUBA 4XPEA 4EBDA 4YR3A 3OYNA 3OLBA 2WCXA 3I5CA 2V4QA 4C8LA 4N41A 4F2RA 2GV9A 2YHBA 4I2QA 4NLYA 1XR5A 3JSMA 3V6DA 5DGAA 2G8HA 4EP5A 4H4MA 1IKXA 3PR4A 3T1AA 4CGJA 4CK3A 4B9VA 4DSLA 2W9BB 3PW7A 4ECYA 3QIOA 5EU7A 4KHQA 3OL6A 4H4OB 1NJZA 4GC6A 2KFZA 4Q0BB 3GV8B 2P1JA 3I0RB 1FKOB 4B8AB 3U3GA 4LY7A 4CJQA 1ZBUA 4UQGA 2E9RX 4DF8A 3BGRB 4RZRA 2JEGA 4JV1A 4RUCA 3IAYA 3VQDA 5F8GA 1ZBHA 1R0AA 1UA0A 4CESA 2BR0A 5KFYA 3H4DA 3V6HA 4M3UA 1VRUA 1S10A 3ZT0A 4DLGA 4KHRA 4DL2A 1JXLA 5KT7A 4DSEA 2ITGA 4DTMA 2HNYB 2ILYA 1RA7A 3K58A 3ALYA 1RTJA 4QWBA 3T19A 1B92A 4ZP6A 4CHNA 5KTQA 1B9FA 1SV5A 4MH8A 4J2EA 1K1SA 1ASUA 4IG3B 1QSLA 2WONA 3HVTB 1FK9A 1A5XA 1S1TB 1EETA 1TVRB 2F8TA 2FVSA 5F8JA 1ITGA 1VRTA 4NCGB 3M9OB 2HWIA 1RT2B 3KLEA 3L3VA 2O4IA 2QE5A 1S6QA 3G6XA 3MFIA 3V9SA 3ZCMA 4CJPA 1L5UA 3ZSVA 3G86A 3SUPA 3BGRA 3FSIA 4NCBA 5F8MA 4WZMA 2FVCA 3IG1A 1EXQA 4Y1DA 1S1UA 1J54A 4B9TA 1SUQB 3NHGA 2JEJA 1WSGA 3KOAA 1S0NA 5KT6A 1SH2A 2AGPA 3NF9A 3OL9A 5HROA 2B5JA 1OS5A 4XIUA 4E7IA 3CIZA 1TV6A 4DMNA 4ID1A 4FLYA 3RR8A 4NYFA 3BQ2A 2I5JB 2IBKA 1T03B 4B9SA 2G8KA 1N6QB 4K50A 4CGIA 2XC9A 4DSFA 2GIRA 3NAEA 5KFNA 3QERA 2XY7A 2E4LA 1TKTB 4CGFA 2W8KA 3C6UB 5I3UA 4B08A 3G6VA 4HHTA 3MR3A 3KKSA 4JUZA 5CY4A 2Y1IA 1B9DA 5KG6A 2V9WA 4CJTA 4RU9A 1LW0B 4EBEA 1TAQA 2D0BA 2EX3A 1VRUB 1SKRA 1TL3A 4WFYA 3CO9A 5KFRA 2HHWA 3AVIA 4OKJA 4EO6A 3NH2A 4FLWA 3GIJA 1C1BB 3T3FA 1C1CB 3ISNC 3VN5A 4NLDA 3PO4A 3PVXA 3VQ7A 1S1TA 3LDSA 3CJ3A 4H4OA 4BDPA 1NJWA 3KJVA 4DTNA 4IRCA 2Z1HA 5KFDA 2HAIA 3HSTB 3PW5A 2YNFB 4K4VA 4NLPA 2IJNA 3TANA 4Q45A 4M42A 2OZSA 1JLEA 1JKHA 4ECWA 4B9NA 4TYBA 4J9OA 4AHRA 1SH3A 4TY9A 1LAVA 1RDAA 4OL8A 3GILA 4J2BA 3CJ4A 4H8KA 3OLAA 3DI6B 3CJ5A 1IKVA 4DS5A 3MF5A 4ECUA 4O3QA 3HL8A 1NK4A 2ATQA 2G8FA 4DQIA 4ED2A 1HQUB 1IH7A 3PUFA 4CJ3A 4RNOA 1SKWA 1JLGB 5J2NB 3DLKB 4ED0A 5I42B 3QYYA 4FZXC 1C0TA 4U7CA 2UVWA 3OJUA 3OVNA 4CEOA 3MEDB 2YNGB 4DFPA 3K5LA 3UDLA 2UUTA 3NH1A 3B6PA 3AA4A 3BSOA 2UVRA 4M3ZA 2OZMA 4FJGA 1D1UA 3P83D 4DL5A 4LH4A 4DQRA 4WXOA 1C0MA 2IM0A 3OYFA 4K4ZA 5DK5A 1X9SA 3BSNA 1NK0A 4ICLA 3JYTA 4NLXA 1WSEA 2ZKUA 4Y2CA 4IOBA 4E1NA 1JL1A 4HTUA 4E1MA 4I2PB 1W0HA 4QPXA 4EYHB 2O5DA 1S49A 4FZZA 1O1WA 1SL1A 3OYIA 4WE1A 3O3HA 2IM3A 4KE5A 1SUQA 1X9WA 1GX5A 5KFSA 4ELTA 3SI8A 3I0SA 3K5NA 5C24A 1W9HA 1C1CA 3MXJA 2F8EX 4O4GA 2GC8A 1WSFA 2KTQA 3OJSA 1TK5A 3VQAA 3SQ1A 3M9NB 2FBYA 5HROB 3LZJA 1QE1A 5DLFA 3AO3A 4DS4A 1ZYQA 3SFGA 4BWMA 4PY5A 3VQCA 3HP6A 3CFRA 4ID5B 2R8GA 3MR6A 1EETB 3KNAA 3AA5X 3OS2A 2PYLA 4E89A 4ZP7A 5CZ2A 3C6UA 2RDIA 1G15A 2XY5A 5DGBA 1JLCA 2HW3A 1BIZA 3KHHA 1IKYB 4OGCA 2BQUA 3HVRA 5KFVA 5L1KA 4URSA 3T5HA 4R0EA 5HRNA 3CDUA 1LWEA 3KIOA 4ID5A 4TN2A 1S1XA 3D0PA 2YNGA 4FBTA 2HMIA 4DTJA 4DTOA 4NYZA 1KLNA 3MEGA 1CSJA 1RTHB 4O4RA 4K8XA 3DLGB 1HYSA 2YNIB 1NKEA 4CGGA 1J9AA 3RMCA 4FM1A 2YNFA 4FS2A 4TQSA 4IH5A 3AVMA 4CK1A 2IM2A 3I8DA 4O3SA 5HLFB 3TAMB 1RILA 1ZBIA 2ASLA 4FJNA 1X1PA 3MTKA 2DY4A 3QEPA 1XWLA 3QEVA 4HVJA 1RT3B 3ZSYA 1XC9A 2R8HA 3AVKA 1RTDA 5KFHA 2HNDA 4XPCA 3RB0A 1S9GB 3QEXA 3E01A 5L1JA 4IH6A 4DTPA 3VQPA 3EZ5A 1S0OA 4B3OB 3TQ1A 2ALZA 3KK2B 5KFUA 4DFJA 5KG4A 3CG7A 1S0MA 1JXEA 5CYMB 4KAIA 4Z4CA 4CFCA 2HWHA 3HT3A 2XGQA 4AHCA 3NCIA 1T03A 5KFQA 2QV6A 3H4BA 2QXFA 1RT6A 1RCHA 3HVWA 3MFHA 1UA1A 5KFIA 1QSYA 3DM2B 1JLFA 1S9EA 5I3UB 5KFZA 2X74A 4WE1B 4Z0UA 1LWEB 4TY8B 1TL1A 1BQMA 1YT3A 4M95A 3TR8A 1KRPA 2OPPB 1NK5A 4LD0A 3QLHB 3HVTA 3H5YA 5JXSA 1JLQB 2FLLA 4CEBA 5KFLA 1C6VA 5SWMA 1RDCA 3SI6A 1LV5A 1N5YB 4ED3A 4L8RB 1KHWA 4RUAA 3V4IB 1TKZB 2JLEA 3S3OA 3HXMA 4IKFA 2VG7B 3NAIA 4Y3CA 1Q8IA 1HPZB 4Z4EA 3V81B 3AVNA 2XY6A 3DRRB 5DQGA 3L2RA 4KHWA 4KHMA 5KGWA 2V0NA 3IN5A 1KFSA 3BSAA 3WNFA 3S3NA 3L2WA 5C5JA 3QNOA 2AWZA 2HHVA 1TL3B 3TI0A 4CGHA 1TKTA 1IO2A 2Z1JA 4CK2A 3PX4A 3NGYA 2VG6A 2GIQA 4KB0A 4RW6A 3HVAA 5HBMB 1ZTWA 4KI4A 4IG0A 3IS9B 1JX4A 3DRSB 4MIAA 1QS4A 3OSNA 2Z1IA 2DPJA 3H59A 2HHUA 3L8BA 1S9FA 1IKWA 4YQWA 3KTQA 4W5NA 3K2PA 5F8IA 4CF9A 4Z4IA 3A2FA 3K5OA 2E9TA 3SUNA 2Y1JA 1LW2B 5EUHA 1L3SA 3QESA 2HNYA 2RKIB 5L1IA 4CECA 5JS1A 1KTQA 4AHSA 4B9MA 1IKWB 2ETJA 2A1SA 4FLVA 1HMVB 3LWMA 2PZSA 5J2QA 3C6TB 1SV5B 4GC7A 4GVMA 3HO1A 4M41A 2HVIA 4TQRA 1CLQA 1W25A 1RT3A 1HPZA 2R8JA 4Q43A 5T14A 4RW9A 4M45A 4Z4FA 3TABA 3V9XA 2BGGA 3KLHB 4DSJA 5F9LA 1S97A 3SYZA 4RW8A 1JXBA 5J2QB 1U49A 5CYQA 1LAWA 4FCYA 3LP3A 3BR9A 1JLAB 3QZ8A 3DLEA 4CJRA 1YVFA 4C8NA 4WZQA 5KFAA 1TL1B 3VQSA 3ZT4A 3PJWA 1C2PA 4OPKA 1EKEA 4NLUA 1BI4B 1MMLA 1FKPB 4TY8A 2C2RA 4DG1B 1I6JA 4U6PA 1IM4A 1JLFB 4HCCA 4LSLA 5KG1A 5KFXA 1KLMB 4ZVGA 3KK1A 1HYZA 4AILC 4O3OA 3N6MA 5JS2A 5KG2A 1QAJA 3WNHA 4CHYA 2ILZA 1A5WA 3UQSA 3ZT2A 3PW0A 4BE0A 3ZSRA 1C1AA 3HYFA 1XHXA 1DLOB 1F21A 3OSPA 2HMIB 2KFNA 4Z4GA 4E19A 3PV8A 3RBDA 2HHQA 2VG5B 4FK2A 3SQ0A 4NLOA 1L3TA 1NKCA 2RF2A 4O44A 5HRSA 3OHBA 1S5JA 4CEEA 1J53A 4KFBA 5J2PA 1S6PB 4LQ9A 2F96A 5J1EB 4N76A 2OYQA 2OPRA 1TQLA 3CQ8A 2G8UA 2QKKA 5D3GB 4XO0A 3MEEB 3OHAA 1XI1A 5KFEA 1JKHB 3QLHA 3THVA 4CJKA 4F8RA 5KFCA 1MU2B 1D8YA 4IG0B 2BE2B 3KLIA 1VSJA 2PYJA 2AU0A 4CHPA 1TK8A 4OGEA 3NBPB 4NLSA 4N47A 4DQQA 5C25B 3DI6A 4F4WA 2RKIA
chains in the Genus database with same CATH superfamily
2IYGA 2DFEA 2NLWA 2IA0A 3BSCA 2KI2A 4MFBB 3V1OA 5AQHA 5F1XA 3P5TL 4OJ3A 4WFNQ 1FXXA 3OL7A 4W98A 3SUOA 1HNIA 2UUCF 2MZTA 3FZKA 1NSQA 1T7PA 1Q81O 3CGIA 4OKEA 4I6WA 4IFYA 3CJKB 3BQ1A 4ISEA 3RU0A 5DM7Q 5K8OA 3FQKA 1Y10A 3KWGA 2FLOA 3EDQB 3B78A 1LOTB 4GVBB 4CH7A 5B0EA 2WOMA 3GMGA 1RI7A 2RQKA 5M2UA 3W62A 2IS3A 4OKKA 3L9ZA 3MMBB 2QSFA 2KQ2A 2AMCB 2X51A 1ASVA 3NE6A 4FZVA 1NGCA 1X0FA 4LVOP 5BRDA 2EK1A 2L9WA 4ZVHA 1RZMA 1T9VA 1T6DA 4O55A 2GW8A 2VQEJ 2RRAA 1NDPA 1HMVA 2A40A 2B5JB 4OJRA 4N5SA 3C6AA 2L48A 3N6LA 2JL9A 2BEFA 3AB2B 2RDDA 1NMEB 2XO7A 5F0WA 3TSUA 2FJXA 3IM9A 4R8UA 2OMOA 2QA1A 3MPYA 1Z25A 1W7WA 3CJBA 4OHWA 1NGAA 4USHA 4YOXA 2JEFA 4CO0A 3UCZP 2ZM6K 2IAJB 1YQHA 3AFGA 4AQYK 4C3MA 2DR5A 2VBXA 5B08A 3E2EA 3LM9A 3M8ZA 2B6AB 1FKOA 4MKVA 3KK2A 3M6UA 3G6YA 1AFIA 3Q7BA 1UZDA 1AYEA 1BI4A 5F8NA 3FR0A 4AFFA 3PRVA 1FNMA 3MEDA 1LNQA 2NYHA 5LOQA 4X65J 4DV1J 5ELZA 2HVEA 4NXMK 4ZVTB 3OTEA 2A6AA 4P74A 5I4MA 3H08A 1TUGB 2LP4A 2I0XA 2AYBA 2Q66A 1HNVB 1EKSA 2IJFA 1RQ0A 4MIWA 1JL2A 2CZ9A 4IOCL 2ZC3A 3Q2SC 1YTUA 2P9IA 4L3KA 1MW7A 1YUWA 5EVZA 1UVLA 2KXFA 4DTRA 3I9V9 3N28A 4QW8A 4JKBA 3DOKA 2K06A 1RDWX 2DHAA 3UN5A 3AVBA 1SZ2A 3F56A 1RLDA 1JJ2R 4GO5X 2B4VA 3DXBA 3NAHA 1MLAA 3SCXA 2J8SA 5FDLB 4EP4A 4WBFA 1RWNB 2J7UA 2FBXA 1NO8A 3HHNB 4JS5A 3DGPB 4LUBA 2RVJA 5HMYA 5A2QY 2IVMA 4RCHA 5CE3A 1VC0A 1H74A 1WJ9A 1NOZA 3W2VA 4N8OA 3R5CA 2VBZA 2QWQA 1M5HA 3N9UC 1YBAA 3GFYA 1VSDA 2UVVA 1WSIA 5C42A 1TFYA 4B3SK 2AJ4A 3OR1B 4DV7F 4LF6J 2P9GA 2Q6CA 1BIUA 2IPOB 2CJ9A 3AO5A 2JHEA 2PDAA 1NK9A 3VGSA 2OH2A 2XRIA 4USWA 3LL3A 3D68A 4ZCIA 4ECVA 4FWPA 1FHTA 3LPEA 3V9UA 1BWEA 1IBKF 2V9KA 3ZSOA 3NP5A 4YNQA 2R7WA 2ZGZA 2RD5C 1BQMB 4CTAA 1N5VA 4FS1A 3SNNA 1UZHA 3O1LA 5E0OA 4X64F 5LMUF 2D41A 4JRQA 4HLBA 3FFIB 2KJVA 5TKWA 3VGMA 4XK8C 4FWMA 2ZUGA 2BDPA 3P39A 4QS9A 1GEHA 2OFHX 4CHQA 2MQLA 3NMRA 2VOPA 2OPRB 3B8HA 4WYWA 4DEZA 1NGJA 1NOYA 1ZZNA 2QXLA 4KV8A 2DGWA 5AXLA 2D3OR 4DU4A 4RNMA 1WOOA 2A3JA 1BUXA 1U1OA 1BOTO 3I55N 4O8KA 3V1QA 5AQOA 2BABA 5E3RA 4JI7F 3MM8B 1I39A 1KC8O 4YR0A 1VR6A 1IBCB 4EHTA 5HRRA 4I7FA 2FBTA 2IC3A 1UWBB 2P9EA 4PWDB 4JOUA 2WVCA 5E33A 2R2UA 8RUCA 4J2AA 4FJKA 4LBIA 3L2QA 3LP2A 5AQZA 1Z2LA 2WVFA 2BRLA 1SJ4P 1S22A 3FC9A 4GKKJ 2G2ZA 1Y11A 1OPIA 2QWOA 1R3NA 1L3KA 3I0SB 3MTJA 1SQKA 2AYMA 4JI3F 2HS4A 1T05B 2Q36A 1R6VA 2VASA 2ASDA 2DGSA 3IR5B 4OQJA 4IG3A 4KRFA 2J0SD 5E2QA 4E1JA 3CD6N 2CNNB 2AF6A 5H9FK 2VD3A 2DXDA 2F65A 3ID8A 3NMUA 2HB5A 4KHUA 3KZBA 1JJ2M 2KYXA 1TKXB 1J2VA 2Z2ZA 1K73T 2RUGA 4FSVA 1Q86T 1VQ4S 1SJQA 3TAQA 3THPA 3V9ZA 4LF8K 2VPZB 2V2ZA 3F9KA 3GJSB 3ENOA 4WFXA 1EP4A 4NLQA 2DH8A 4UY8T 4FLUA 3PZPA 3CF5L 4FJIA 3MAQA 3KUGA 5A8KA 5B0FA 1FE4A 4IFEA 1BQXA 3E9LA 1T3VA 1FKPA 4NYOA 1U1QA 3AVHA 2YWHA 4WF9L 3OTDA 3FGVA 1CULA 2G8WA 3DYAA 3IXQA 3TSQA 2FF3B 4A8QA 4CEZA 4JK9A 4QAGA 5HATA 2PAVA 4ECZA 5KFPA 4CZJA 4ED6A 2OO4A 1NM2A 4ZVRB 5IQ6A 2IMWP 2GHWA 2HQDA 4CO5A 1QZ6A 3E01B 3KHRA 3IG1B 1SL0A 3FSXA 5LMNF 5LXYA 1UFWA 3PO5A 2RUSA 3ZZOA 4NASA 3MI7X 4NYNA 4FJ7A 2QW9A 5ETRA 1X4DA 2F4VK 4Y6IA 3AA2A 2XHWA 4FVCA 2B9WA 3IGVA 1QAYA 2F9WA 3RB6A 3BBBA 2NRWA 2J4RA 1BO5O 4OI6A 1VQOS 1I3OB 2LLZA 3QWUA 1U8WA 4OZ2A 2DCLA 4DL7A 3RMAA 1HR0J 2FVQA 1EZZB 2ZH8A 4KAZA 5JUMA 2QLFB 4JI0F 3QJJA 2B4OA 3DLLQ 3FBFA 2LSNA 4XH5A 2BE9B 3CEDA 3NRBA 3RJMB 2HLUA 2V69A 5DG7A 4KFBB 2YKAA 1RHUB 3FK4A 4ILHA 4KHYA 2FY8A 1YTYA 3CMQA 4YN3B 4ETZA 3RAXA 3B4MA 1YZ7A 5T7BA 1YHQS 2JEIA 5AQNA 3TX0A 3NGDA 1HJOA 4B1XB 3G9CA 4E7LA 3ZX3A 2W24A 2BE7D 2LFVA 5BRFA 2QWLA 4DU7A 2CADA 2IAJA 5L46A 2WHOA 5M1PA 4ERDA 1BQNB 3T69A 3MR2A 1OY6A 2C42A 3NH0A 1VQ4N 2EFVA 3O6WA 1NJIO 2K7JA 4RW7A 1NGHA 4WQ5C 2EEYA 1SKSA 2FLPA 2G2YA 2HIYA 3BKFA 4C4WA 3CJ1A 3SAHA 5JLFA 5A6PA 5ETKA 4E8UA 3EZUA 1VQPS 3DDIA 1HR0K 4ILLA 3C7NB 1B7YB 4CGDA 5G4DA 2R2TA 2O4GA 2V51B 5L9XA 3CE8A 3DLBA 2ATLA 5F2RA 4RU2A 1TUYA 1DQ9A 2EWHA 1S48A 3IFEA 2DO4A 3QT8A 3Q8SB 3ET6A 1QJHA 1RAFB 4AXIA 3H90A 4MO4A 4MIBA 1NPRA 2ZC4A 4FYWB 3S8SA 1Y5NB 4BWJA 1HIYA 2OPQA 2YY3A 3K59A 4W5OA 4ZTJA 2F8SA 4X64K 5LMUK 1G1XA 2J0WA 1A0OB 1OQ6A 3FDSA 3THWA 3M8SA 3ISND 1SJ3P 3NCQA 2E1PA 2WB1D 3DCAA 1QHTA 4IJNA 3R5DA 4PG8A 3OR2B 2NZCA 1VQ7N 2H9ZA 2CQ4A 3N5BA 4PXBA 3NNAA 3DU6A 1RDRA 3DRPB 5AQJA 1UAXA 1VSIA 3R5BA 2HVZA 4QIVA 1TL4A 4M5IA 1WHXA 2KRRA 5HQLA 4K4UA 2X6NA 1XUPO 1R59O 1RTHA 4YHHF 2CDRB 2GX8A 1XMQF 3SQ4A 3BBFA 2CJXB 3H7HB 3HHKA 4WP8A 1REGX 1J5OA 2ALYB 4KIAA 4OZ0A 5CQGA 4JKGB 3CJ9A 3V4IA 3ZO7A 5KFBA 1NGBA 1YJUA 5F8HA 2BJDA 2PEBA 1O5JA 2EWSA 1U1NA 3B6OA 1UJ4A 3FNNA 4M5DA 5CAAA 3NMAA 4FNHA 3GB0A 1X7VA 4E3SA 4O0JA 2HK2A 4JN4A 2OI2A 2CQIA 1FDAA 3QFHA 3T5LA 2OSQA 4DCOB 4K4XA 4DV1K 3HD2A 1YJ7A 2N4CA 1VQ5N 4NLRA 4O0NA 3RWUA 1S9GA 3HMJG 2VCPA 1MWYA 4WP3A 1X4CA 3C95A 1A5VA 4CT8A 3CVKA 4UF4A 3E51A 1GAOA 3DFEA 4OJGA 4LSNB 2WFBA 3HHEA 3PRDA 3SPZA 4DPYA 3KHYA 1PAEX 1HBUB 1PAUB 2AIRB 5LMUJ 4X64J 4ZP9A 4PUOB 1SC3B 3G25A 2GV1A 2M3DA 1VDHA 4DV6K 3K57A 4X4SA 4RWTA 3CCEN 1M0SA 4BVOA 1RABB 2VGMA 3LP2B 4F50A 4OV1A 3NF7A 3SSRA 4B8CA 4K4WA 4M5LA 3DHWC 2JLGA 4PHTX 2RQMA 3SSQA 1FVQA 1VK3A 1HPMA 3CJ0A 3KK3A 3ZXWA 4CDIA 1M5SA 2Z0GA 4BC7A 4LR7A 1K8AT 1QQCA 3OTOF 1RT5A 5AQXA 1U1LA 2C2EA 1HJRA 3MMJA 1H38A 4I0WA 4B1VA 5ETSA 3CJ7A 4DR7K 4CW7B 1FW6A 4HUEA 3Q89A 1LWFA 1XMBA 4X84A 1S1XB 5K8PA 2ADBA 3P5BP 5KFGA 4KHPF 3BJYA 3VQBA 2M9KA 3VA3A 1C0TB 2DHGA 1VQ7S 3Q2TC 2XS2A 1BWFO 3A5LC 1LWXA 3UDVA 1YAGA 2ZH3A 4DV3F 4WFNL 2GZOA 3I5AA 3ZETB 3PJ9A 3I5BA 1RHKB 5JVGQ 3TJ8A 2W01A 1RAJA 4NA2A 5FPDA 4DR5K 5J2MA 4E0DA 4C11B 4ZA1A 4CERA 1IKXB 2A41A 1RT7A 1VQ9S 1YJVA 4I6YA 2DFHA 2OPQB 3PHTA 3ZZPA 4AUKA 4ILJA 1NGFA 2QLWA 1U4BA 4I1TA 4FN5A 3VALA 3ENAA 2DNLA 1YZ6A 2HQFA 4QWCA 1RCOB 4J37A 2CGKA 1NHVA 2C28A 2C1EB 4J91A 2N3OA 1RNHA 4KPYA 1RBUA 3J7ZO 4DWIA 4JI0K 4KI6A 4RKUC 2PA3A 3TA1A 3FCVA 4Q44A 4G1PA 1NK8A 3SV3A 2Q0UA 1X5SA 5THWA 1F9FA 1WWHA 4P2FA 1K1QA 3FCWA 2MQPA 4FBUA 3PNIA 1H2VZ 3J7ZT 3GG0A 1UVNA 5ADXH 3HCXA 2Q0RA 4LRDA 4CLPA 4Y65A 2BJ8A 3VTHA 1OMSA 3V6KA 5AQUA 3M2RA 3VQ4A 2VOOA 4CFBA 4D3GA 4A8SA 3MECB 2VBWA 4TXSA 4J9PA 4U8YA 1LWCA 4C0OC 1ESVA 2NUBA 4XPEA 2BVZA 1IV0A 3OYNA 4BR7A 3SEOA 2V8VA 4N41A 3P4IA 4LF4J 2CH5A 5B0CA 2N7CA 5DGAA 2G8HA 4EP5A 1FFWB 2DNZA 1XQIA 3CCJS 4B9VA 4CGJA 2QMUB 1OKJA 3QIOA 4I69A 4ILMA 4FOEA 1HLWA 1FKOB 1OYEA 3QDKA 4RZRA 3A5NC 2IVPA 1XBWA 2EW9A 2VIHA 3O08A 3VWSA 4FPRA 1R0AA 2BR0A 4CD1A 3V6HA 2H3GX 5GADU 3I56S 1MWKA 1WEYA 4DTMA 1RAEB 2HQCA 3UD5A 1YRTA 1B92A 1NRKA 2GIFA 1F5AA 1UFKA 4WF9Q 2HURA 4DUZJ 1SV5A 4MH8A 4J2EA 3LGHA 3UN2A 3PXGa 1LCUA 2CPDA 1U6FA 4DPTA 4B1WB 3CF5Q 1S1TB 5T7LB 2NRVA 1WI8A 2YJEA 1K0TA 2ATCB 4V19S 1HBNB 1YK9A 4MTPA 2KLAA 5LXRA 2ZH5A 1CLFA 1S6QA 3C15A 2H4YB 3ZSVA 3G86A 2GUPA 1WHWA 4DX7A 2FGCA 3MM7A 2LECA 3WXIA 4WZMA 4CO3A 3IG1A 4H5TA 1XIQA 4B9TA 2K7KA 2HFSA 2X3DA 1R27B 3KOAA 5FLXY 5KT6A 2F40A 1FO1A 2AGPA 3OL9A 5HROA 1WOQA 4DPXA 4E7IA 1TV6A 3QT7A 2A3ZA 4DMNA 3KWIA 4LF4F 1N32F 1K9MT 2I5JB 2HKEA 2IBKA 1N6QB 2XC9A 4DSFA 1P1LA 3E9OA 2DNMA 2GA7A 4CGFA 2W8KA 3M30A 3C6UB 1NMDA 3GBTA 2R3VA 5I3UA 3KKSA 5DM6L 1B9DA 3CC2N 1HA1A 2XWXA 4RU9A 1LW0B 4JKDA 2GO9A 1SKRA 3CCVS 1TL3A 3CCQS 2FZCB 4XH1A 1N0VC 1GLJO 2VU5A 4NZ7A 5AQKA 2VUGA 3QRQA 2DY1A 4IJAA 2B8QA 1C1BB 4NPOA 4JKEA 4CQ1A 4NLDA 4H4KA 4EFAC 1FDBA 4XDCA 1Y3KA 4XDDA 4NZ6A 3PVXA 3ZEUA 1KTVA 1FERA 3CJ3A 4H4OA 1YJWS 4BDPA 3ONQA 2MQMA 4IO8A 3HD1A 2LDYA 4ZKAA 4IRCA 2Z1HA 2MSSA 3HSTB 5LSLA 2P2CB 1ATNA 2YNFB 3OFGA 4K4VA 4NLPA 1SC4B 2K2PA 4Q45A 2OZSA 4ECWA 4UUWA 1CJKA 4TYBA 2KHDA 2CVIA 1UVJA 5ADZA 2DY9A 2E20A 2H5JB 3OBIA 3H6EA 4LF2A 2EC2A 4J2BA 1NDLA 3DI6B 1IKVA 4O3QA 2DGOA 2DNGA 3H42A 4NXMF 4ZDNA 3R2DJ 1HNXF 3TO8A 2QSWA 5A2QU 1IH7A 1SKWA 1JLGB 4CIOA 3N79A 5D4PA 3CUNA 4ED0A 5HVHA 2B9YA 2UVWA 4ZPWR 3OVNA 4CEOA 3K5LA 4EAHD 4JI4J 2KB2A 2ZOFA 4U96A 3AA4A 4FF4A 4DV3K 2YQ0A 2CNKB 1DHMA 4NXNK 2IM0A 1YHQN 4DR7J 3OYFA 2QJ3A 4K4ZA 3BSNA 1M90T 2U1AA 3BEGB 1JL1A 4HTUA 4JI2J 4I2PB 1LK5A 1LFWA 1SL1A 2DT9A 3OYIA 3O3HA 4U95A 1ZOTA 4KE5A 1SUQA 3HOSA 4ZLLA 3TX8A 3I0SA 2XULA 4RL1A 5A2QO 1MMDA 2G13A 2F8EX 4ZOSA 4CZEA 2LVWA 3BPDA 4NEZA 2WSCC 2DGTA 3LZJA 3QT5A 1TL7A 1UWAA 3ZZRA 4DS4A 3VGTA 3SBMA 4PY5A 3IM8A 4C8ZA 4GVEA 1OH5A 2F3JA 4NB4A 3ZETA 4ZP7A 3CCLS 2DCUB 3G6ES 1G15A 1K47A 3MM5B 1GMVA 4DPUA 2B4UA 3GG4A 5KFVA 1HHTP 1LWEA 3CCQN 3AD8C 3SJHA 2DRDA 1S1XA 4JK7A 2AA4A 2YNGA 2HMIA 1QQMA 4NYZA 4L76A 2E5LJ 3MEGA 1RTHB 4K8XA 2WBRA 4TNOA 4FWNA 1MWZA 4CGGA 2NRTA 1J9AA 3WQPA 5DDRC 1FI4A 3EZOA 4FS2A 2V7ZA 1F2HA 5KPRA 2Q3PA 2ROGA 3PM9A 4IH5A 1GFWB 3DLLL 5E7OB 3H3OB 1S7IA 4OYZA 3TAMB 2PI4A 1FXDA 2VGNA 1FF2A 4RR5A 1Q82O 1X1PA 2DY4A 2LCWA 3TUPA 4LFBF 4UZBA 3CCWA 5ETVA 3CCRN 4LVNP 1YX2A 2VZ9A 3FUYA 3D9BA 4IH6A 4GV9A 3VQPA 1HLUA 2OCEA 3EZ5A 2ALZA 2KT2A 4D3HA 3KK2B 4KAIA 2HWHA 3KUEA 3OVAA 2XGQA 3GYXB 1B64A 1FDNA 2QV6A 4CZMA 2XHCA 3WC2A 2KT3A 2LEBA 2QXFA 1RT6A 2ZH4A 2FJDB 1QSYA 3JAMO 2ZDPA 1VHFA 1B3TA 2X74A 4WE1B 1OQ3A 4EU0A 1W26A 4B02A 2D3O1 1Q7YT 4Z0UA 4ZJQA 1SIWB 2LU1A 2PIIA 1BUPA 3QLHB 3HVTA 1YG0A 5JXSA 1JLQB 2FLLA 4FOIA 3CD5A 3M5RA 1C6VA 3K7RA 5SWMA 5AXNA 2P9CA 1N5YB 3M3ZA 1Z1ZA 4RWXA 2B0GA 5HI7A 3ZX2A 3LO3A 2P9LB 2E1ZA 2JLEA 4IKFA 1KQFB 3GFZA 2VG7B 1HPZB 4L3NA 1ZH5A 1VJWA 4X4QA 3MWBA 2XY6A 2LQBA 4WQ4C 3DRRB 2OANA 3VEWA 2EFGA 3CO0P 3VAKA 1F3VA 5KGWA 2V0NA 1XJWB 1S7HA 1KFSA 1U7LA 3WNFA 3L2WA 3QNOA 2AWZA 3WHIA 3L4QA 3CCLN 3OD2A 3G6EN 5BR8F 1F60B 1IO2A 4A46A 1T44A 3NGYA 4HR2A 2VG6A 4KB0A 4RW6A 3WQUA 3HVAA 1ZTWA 3W2WA 4DZ6A 3IS9B 3DRSB 4JI1K 3F5TA 3H59A 4M5HA 3TRGA 1S9FA 4W5NA 1GXTA 5GADI 3L7UA 3L95X 5HMWA 5F8IA 2Q43A 3O4WA 4KY3A 2UUBJ 3U27A 1BHNA 1U2FA 2A1SA 3LWMA 2KM8C 4GRSA 4M41A 3VTIA 4BBYA 4JI7J 2FJAB 1WACA 1UETA 4M45A 3CQYA 3AJDA 2BGGA 2ASOA 2G0CA 1HNXJ 1Z2ZA 1S97A 3MEKA 4PG4A 4A59A 2WW4A 2NCKL 3AY0A 1LAWA 3LP3A 2CRLA 4M5JA 3C66A 2OHDA 4CZIA 3QZ8A 3DLEA 1DRZA 4C8NA 4WZQA 2HFUA 1NGGA 3PJWA 4OPKA 1MMLA 2GHPA 4P2MA 1F0XA 1F9EB 3VVUA 4JI6K 1ROFA 1XMOK 1YITN 5KFXA 1T9YA 2QYGA 4AILC 4WCEQ 4O3OA 5KG2A 1A5WA 4AM6A 2MZJA 4ENOA 3ZT2A 3ZSRA 3D1HA 1S72S 4A8XA 3KDNA 4B9QA 1EKRA 1HNZJ 1APSA 2KFNA 3D2EB 4E19A 3BEXA 3RBDA 3CPWM 2VG5B 3G4SN 4FPAA 3OQ2A 4JI4K 2VQFF 3GZ7A 2P9KA 3R7BB 4DV7K 4O44A 4YB5A 5HRSA 1GMWD 3VV2B 3MPVA 1U26A 1J53A 4DXLA 2KT5A 4LQ9A 3PEJA 3TA2A 2F96A 4ZITA 1FDDA 2HGNA 3CCJN 3J7YI 1NU4A 4R0JA 2OPRA 4BRLA 2QKKA 5D3GB 4EMDA 4RLEA 5IC6B 4DR4F 3QLHA 2VDHA 3WDOA 1TMMA 4ED4A 2CFXA 5GMDA 1VSJA 3O1BA 4DV4F 4OGEA 3WXJA 4USKA 3DI6A 1FKAF 1E6VB 4YB1P 7FD1A 1FK9B 5D4LA 1Q9XA 1JIHA 3TW0A 4WKRA 4EIAA 3U3YA 2CPYA 4LC9B 3NL0A 1VSFA 3V1RA 3A8JA 2IVFB 3PKMA 1IR1A 2V2QA 1M5OC 4FW2A 2UVUA 1QAIA 1CZ9A 3MM5A 3WBZA 5KOXA 1JCFA 3ULDA 3CD7A 1D9FA 3BV8A 1VAZA 1S57A 4Q5VA 4FK4A 2W42A 3WUHA 1LQ9A 5CZVA 4ZPDA 2OPSA 5HJXA 2GBZA 2NPFA 5IZHA 2PSZA 2ITMA 2NUUG 2DR9A 3W9JA 1NKBA 5KRTA 3BZKA 1T9UA 2CQ1A 2HBRB 2CZ4A 4JI8F 3G10A 3SJJA 4RW8B 3LWLA 3FBCA 1LW0A 4PRFA 3I0RA 2HS3A 3T6BA 4B9LA 3FSYA 4LF5J 4YHHJ 3EXCX 2LQ5A 1Y64A 1YF5L 4YFUA 1B0VA 4DV2F 3LQVA 3HKZD 4H54A 2VC0A 3K89A 1PG5B 2QMWA 2YWFA 2GWKA 3AV9A 2XZTB 2QEXS 1CQMA 2Y8WA 2HWTA 1KAZA 4IRDA 2W9CA 2VWKA 3OYKA 4ZK7M 2O8FA 1U2VB 1Q16B 1WHVA 2C2DA 1EAYC 3ITHB 2ZQBA 1Q4RA 4TLRA 1M5KC 1RTIB 4CIGA 4BRFA 5EX5A 4LF9K 2QL9B 1WKJA 2J6UA 5LJVA 1VRQC 2DK2A 4Q8EA 2V5HG 4F02A 4M5DB 2JJ4D 2KKZA 2NLXA 3VQ8A 2RF2B 1QUVA 3EKSA 1N6QA 3QGPA 4DR4J 4C8OA 3AAPA 2RS8A 4NYPA 2LXUA 4DBQA 3QNNA 4F3MA 3T1YK 5F8LA 4B1ZA 3CDEA 4IFYB 1VLYA 4OO1J 3NVMA 4CZFA 2J9EA 3I82A 2UUAJ 4CFAA 3ZSWA 4ZHRA 3CETA 1CJKB 1KD1O 4ECSA 1VIOA 1P8GA 1WC1A 4G1QB 4BC3A 1HQEB 4KTWA 2J6SA 4ISGA 5EOYA 3I96A 2HZAA 5B0BA 3QO9A 3RAQA 1G7CB 4CNZA 2V68A 2OKQA 5D0RA 3FFIA 2DNNA 3Q86A 3KWMA 4UOFA 1RT2A 2G9OA 2KZZA 1KVAA 3JTNA 5DS7A 1LWCB 3IR6B 1FRIA 3VZHA 3VF6A 3E3XA 5AZIA 1T8EA 2JGUA 1BGXT 3L7OA 4FYDA 1CXQA 3D66A 1PBAA 3KJVB 3FRYA 3OFEA 4ZPAA 4PKIA 1AUDA 2BW2A 3F9MA 3V6JA 5HBMA 1G6BA 4GV6A 1TYQB 4IOXA 2AYEA 4K7QA 3M6GA 4R79A 2IMOA 3BQ0A 5G0RA 3VF4A 1NDKA 1KWMA 4UQTA 2I6WA 2YTCA 4ZCLA 1IQTA 3ZFVA 4Z7CA 3WIVA 4URQU 4F4YA 2UUAF 3Q8RB 3O5BA 3I87A 3IUCA 5CR4A 2DR6A 4DR3K 2D0AA 4CRJA 3I31A 1KCFA 3PJXA 5I9EB 3C65A 4H0OA 2ZH6A 3RYLA 3TARA 3V5RA 2A1RA 1RLCL 1FX2A 1AW0A 1RT4A 1GLDG 2HVHA 3HOTA 2BZ2A 3EMTA 5DZ6A 3J80Y 4DL4A 1X31C 1WOPA 1BL3A 1FNOA 2A2CA 2FBVA 1UFLA 1HWJA 5A8RB 2D74B 4ZLPA 2ZKTA 5HVGA 2ZHAA 4CJ7A 3N5FA 2HOEA 2QEXN 3ZZ0A 3UWTA 4DV5F 2UUAK 2WK4A 4J7CA 5HAOA 3VAIA 3DLKA 3HZGA 5JMVA 2LXIA 1NK7A 4TYAA 1ILYA 2HPUA 1GX6A 2W2MP 1YBTA 2DR8A 2QG9B 3GDQA 3KHLA 2CQPA 2WTUA 2FD2A 2O8BA 1CULB 5LMNK 5FIIA 4O5BA 2N4DA 2F63A 3DOKB 4A8KA 3NFAA 1KNZA 4EGLA 1REVB 3D6RA 3GFHA 2Z57B 5C7PA 3ZT3A 1Q78A 4Y34A 2I2YA 1UW9A 5BXIA 2AP6A 3PR5B 1QD1A 4CI6A 1SIZA 4CJLA 4QR2A 5EWEA 4FWSA 1KVCA 1JLBA 2DRAA 2QM1A 5FRNA 3M8RA 3ITHA 2E5IA 3WT0A 2QTDA 3H5UA 2MGZA 1KOHA 1OIAA 3PG9A 2RDJA 1S4FA 5DDPC 3CCUN 3RZAA 3MCMA 4DR2K 4QWAA 5L38A 4H0XB 3HPHA 5F41A 1Q18A 3S6EA 1S59A 2CQ3A 1BE4A 2A5XA 4F36A 3CFOA 1K6YA 3BGFA 2CJKA 3CC7S 4JV5F 5SUHA 3R97A 4CYUB 3JS9A 1KQSM 5FD1A 1N5YA 5GVQA 1IM6A 3JYTB 1DTQB 1SL2A 1R6YA 1GLFO 1IKYA 3QB0A 4JHDB 2B7CB 1RE1B 2I8EA 2FSJA 4OLOA 4GVLA 3LPTA 2MKHA 2AP1A 2J9CA 1DTTA 1CEZA 4DKWA 4GKKF 3O3FA 4YOEA 2UXCJ 3TZZA 2NXNA 1E6VA 4CLZA 4NLWA 4JD2B 3DXKA 1Q8KA 1U6BA 1WSHA 4CE9A 3WXLA 3AO1A 4QWDA 3K8WA 1ZS6A 2V4JA 4K42A 2HSTA 2XYHB 4RWWA 1R31A 3DXMA 5JLHA 2MKKA 2QT7A 2HBKA 4FJMA 5U47A 4IQXA 3J7AN 3QBWA 3LDQA 4NLCA 1LOUA 1HHSA 3W5YA 1VQNS 5C12A 2EHGA 2KHCA 5CZXA 3WXMB 2ZBPA 4FYXB 1LXNA 1DQ8A 4C3KA 1IWAA 3TUIC 2WRMA 3DXKB 1NLVA 2QYCA 3ETOA 5AFUH 1WHYA 2GELA 1H72C 3VHQA 2LXFA 3KLEB 2FPHX 4IBNA 5AQQA 1TKXA 2UUBK 4OFZA 3LALA 4FJXA 4IEEA 3PSFA 2FF6A 3ZZUA 4P2XA 2CG8A 1EP4B 1CG2A 4OJ1A 2ZE2A 1V4TA 4JYAK 3PY8A 4QOTA 4DUYK 1FEEA 1R7IA 4CO1A 4EEYA 2E7VA 4IZ9A 1WDTA 4K59A 3A1YG 2HNZA 5H1SQ 5M1QA 5IC4B 1AZSA 4PKHA 1SCJB 1Z6RA 1SPBP 1VSMA 1NJYA 2O01C 1TK0A 2VQFJ 3N01A 3V9WA 5AZJA 3HLUA 5K14A 5J1EA 4PG5A 4CEQA 4F67A 1Y7PA 1W2BR 1TKZA 2W7PA 1HYVA 5KRSA 2JRSA 4BRNA 1S6OA 3TPQA 5AQWA 4DX8H 4A61A 2KXNB 5HP1B 2PD1A 3T1YJ 2FVRA 2J7WA 3QGGA 3EYZA 4X2BA 3SBTA 2MQQA 5DG9A 3N6NA 5J2MB 3VQ9A 2YWEA 3SSSA 1IJEB 1RAIB 3QEIA 2VWBA 4PPDA 3FFKB 3DRPA 2FHOB 2BANA 5CYJA 3L4IA 4HHJA 4M63C 1VYAA 4HTLA 4FM0A 2CH6A 5DQIA 4NLBA 3QINA 1NNEA 3ZX0A 2P9UB 2ACYA 3G82A 4B3MK 1S76D 4KHNA 4ICLB 3CNQP 1UCNA 4DR5J 1NHUA 3O9QA 1VGYA 1ZPVA 2DBBA 2E88A 4FWKA 3LDOA 4FWRA 4KJIA 2VC1A 2DJWA 4J9KA 1ZBLA 3CB4A 5DJBA 3M9MB 3TVKA 4UT4A 2FJWA 3M1VA 3SXLA 3S9HA 5B09A 4YHHK 1S1VB 4WFAL 1XNRK 5IT0A 5JVHL 4JYAJ 1GOBA 1N33J 3THXB 2VA2A 1KLMA 1TKDA 1YI2S 1C0UB 5DDQC 1H0HB 3SMSA 4H0YB 4A48A 5BJRA 2BA9A 4MK8A 1JLAA 2C2KB 1RBOB 1NZAA 2PFFB 3HFVA 2WSFC 1GMUA 2AEMA 2ZOMA 1Y9OA 1FRJA 1YVUA 3HSJA 2V52B 2NXCA 1RTJB 3FEYB 4O23A 3K5PA 4IDKB 3ZZZA 1WSJA 4DR4K 1GOCA 3KJNB 4O0IA 4F3QA 1Q5YA 2DR7A 2L9NA 4CLKA 2JH3A 3UCUP 3TAFA 3C6TA 4DV2J 4PR6A 1DBDA 4E2FB 4J9SA 5FPEA 1MSWD 2P5OA 4CNYA 1HNIB 2PO4A 4ANCA 1DEJA 2HQIA 2XGPA 2ZBIA 1HBOA 3W8PA 2PMZD 4EI2A 1E4FT 5HLFA 3ENQA 3H40A 2MY7A 4BRIA 3E9PA 2ZNYA 1O6XA 2VQEF 1QSSA 5KFTA 3OA9A 3MN9A 3R1HA 3OYLA 1RAOA 4IYQA 1CC7A 3KJFB 2XY8A 4M3TA 1V5VA 4LR8A 1FTCA 3A8KA 1TUVA 1WNSA 3RG6A 2CPZA 2GCFA 1Z05A 1JLBB 3PYGA 3EY1A 2BE2A 2CNLB 3J80O 1MWQA 2E9ZA 4IH7A 2P5VA 5I42A 1R43A 1NBEB 1U02A 2HFNA 2Y1LB 3TP2A 5GINA 2JC0A 1JJHA 4CJ4A 2UUCK 2D69A 4YP3A 3GR1A 4IRKA 2J6TA 1NCLA 4X4UA 4BRDA 3TAGA 5K14B 5SZTA 3C46A 1UTAA 4A8MP 3R6GB 1RU1A 3KMSA 5GIPA 3SCJE 2XHBA 3FBBA 3WIUA 3DOLA 2P6SA 2R7TA 3MXIA 4P72A 3PDNA 4QOZB 4NLVA 4ZHRB 3NF8A 5GAEP 1YTAA 3JAMY 1CPZA 1VQ6N 3V81A 4YB7A 2LQJA 2OPPA 4H5RA 1FXLA 3I6PA 1RDBA 3C0BA 3W3DA 3QQCD 3AXMA 2EC0A 2FY1A 5HO4A 4V19J 2FC9A 2CUYA 3OT9A 4YDUC 1MN7A 4OHVA 2X6SA 4IR9A 3T5KA 1ZBTA 1XMOF 1ATRA 2YWWA 1HI8A 2IRYA 2J0XA 4CJVA 1HNXK 2Z2LA 4MMOA 3V4MA 5AZIB 2J5AA 1SQGA 1N36K 2ZH2A 1N88A 3DLHA 3EE9A 4OZ5A 5CCLA 2B9XA 3F44A 3SMZA 2XCPA 1Q9YA 4BLGA 3VZIA 3QGHA 5A8WA 2W2NP 1HQEA 2EVZA 2YX1A 5AJ3J 1QY7A 4I2QB 4KKOA 1RT4B 4K2JA 5M1OA 1RJJA 2WBMA 4CF8A 1CJUA 1PSDA 3KG4A 1DQAA 2ZHBA 4KPCA 4DMZA 2IC3B 2XI2A 2DIVA 1DT9A 1DGKN 1DLOA 3QFUA 1OYDA 5GAHP 2UZAA 2QK9A 1U24A 4ZJLA 5J2PB 3CDWA 2FSKA 3OFHA 4DV0J 4CP5A 4C1NI 1YRXA 3IP0A 2HHSA 4LSLB 1VQYA 2XI3A 4WPAA 4C7QA 2VKRA 2O8CA 5J1PA 4KR0B 4K8RA 3UKUA 2RS2A 2W1BA 2V67A 1J5EK 2CQ2A 1HNWF 3UVJB 4IR1A 2E7XA 1GMWA 1OY8A 3GSDA 4I2PA 4C0BA 3F2KA 1VQKS 3UDCA 4CEDA 4AHTA 1VMBA 4GMJB 1F5CA 2B51A 1KVBA 4JKFA 3GIKA 1NK6A 2ZJQQ 4DU1A 2HSEB 1Q8BA 2W9BA 2Q3SA 3MDFA 1XMQK 3L3UA 4JI0J 4JRPA 3FMWA 4U67L 4IEIA 4CZCA 1KSPA 2YHYA 1GXUA 2NNWA 1N52B 1ZAWA 2VFTA 3TEHB 1U04A 4HL9A 2XZDB 5J2NA 3GJQB 2PT0A 2FQQB 3LDLA 1Z26A 2PMWA 2D3UA 3OXFA 3W60A 5GAHU 4M5KA 3B8AX 3CI5A 3BKUA 1GH8A 4DL3A 5A76A 1ZTTA 4ED8A 4WU2A 3MM9A 2ZFHA 5KG5A 3KLFA 4AH9A 1G4CA 1CS4B 1SJRA 3V6DB 1D9DA 4ZN3A 4I9LA 2AGQA 1IR0A 5AE3A 4ES3A 3ZZTA 4CYUA 1RKIA 1OPZA 4OI0A 3GJRB 4LFCF 2FB0A 1MNEA 2O67A 5LY3A 1Q82T 4BROA 4F2RA 2YHBA 5GAGP 2GQCA 4I2QA 2H3EB 3SCKE 3V6DA 1PJ5A 2E1AA 2NRZA 5I3QA 4QPTA 1IKXA 4CLUA 3PW7A 4ECYA 4KHQA 3OL6A 4H4OB 2MKIA 4IO1A 2FZKB 3BF3A 4Q0BB 3CCUS 2P1JA 2HIQA 2XS7A 2MLYA 2PFDA 1ZBUA 4UQGA 3NWRA 2EFPA 3Q0AA 3L3CA 5F0UA 3UFCX 4RUCA 2A18A 2R7QA 3P8BB 3IO1A 5KFYA 3H4DA 2Z56B 4M3UA 2WVDA 1S10A 2NRXA 3ZT0A 4PG7A 4DL2A 4KHPJ 5IT9O 3BF4A 2ITGA 2OLWA 3CW2C 1RTJA 2ZZNA 4QWBA 4TVAB 4CHNA 2AYGA 1B9FA 2Y3YA 2RU9A 3VEOA 2BJEA 3TR5A 1NMNA 3BR8A 4IG3B 2IVNA 2MZSA 1QSLA 2J9DA 3MCAB 1AT1B 3HVTB 1FK9A 2QWMA 2C3YA 4MLHA 2PE8A 4AL7A 5BRHA 1VC5A 3ZTOA 1EETA 4HACB 4N77A 3CQXA 2F5GA 4KRWA 2O3DA 5F8JA 3X1LB 2OUGA 1EQMA 3KLEA 3CC4N 1W7AA 2QE5A 2O4IA 3G6XA 1MWMA 3MFIA 1HD1A 3ZCMA 2A42A 4DX5A 4DUYJ 3D2FB 2BXJA 3N0VA 2Y8YA 4BGBA 3SUPA 1PCAA 3BGRA 3O80A 4OJHA 4Y1DA 1S1UA 1J54A 2ZWOA 2JEJA 4FXVA 4IDHA 1RACB 1SH2A 1FEHA 3TTFA 3CIZA 4JP8A 4ID1A 9ATCB 4NYFA 2YQ1A 1T03B 3C7NA 4CGIA 4BC5A 5BR9A 2GIRA 3NAEA 3CT9A 2XY7A 2E4LA 1TKTB 1XNQJ 2RIJA 3GE9A 5BREA 4LF8F 3G6VA 2XMJA 2CGLA 3ET6B 5KG6A 4YORA 1HI0P 2VPXB 1TAQA 1VRUB 3CJ8A 4DN9A 3MOJB 3C2PA 1UVKA 3SAFA 2HHWA 2BM1A 1FJGJ 4OKJA 4EO6A 3PFOA 1HNZF 1ZA1B 4FLWA 4G6VB 3DOMB 2ZUAA 3GIJA 3VAGA 3T3FA 2CPHA 1S77D 3THTA 1WELA 3PO4A 1DY3A 1N36F 1F6TA 3QSIA 1S1TA 3KDOA 5GAHI 5A0YB 1NJWA 1JMTA 1QDUB 1D4XA 1A6LA 3O44A 4ZN1A 2F7VA 2IJNA 5AE1A 4Z37A 1VBZA 1CS4A 3T1YF 1AFJA 1M1KO 3DXSX 4TY9A 1RDAA 3GILA 2QTWA 2DNOA 2FZGB 2KRBA 3CJ4A 3CCZA 1KVJA 1KAYA 4EHUA 4DS5A 1UEKA 2FHJA 4ECUA 4A8YA 1NK4A 2G8FA 1WF0A 4DQIA 4CD3A 5A8KB 6FDRA 3J7YP 2YKPA 5C2GA 4U7CA 3OJUA 3M6VA 2G4BA 5M1KA 5D15A 3W3SA 2Q31A 3UDLA 1JB0C 2UUTA 4DV3J 4JAXA 4M3ZA 2OZMA 1D1UA 4DL5A 1H1VA 4LH4A 4YEAA 5HQMA 4ATNA 3BF1A 4DV0F 3T6JA 4DU8A 2GGPA 4OI3A 2F4VF 1N36J 1X9SA 1X4BA 3IFRA 2BV3A 4BC9A 1IQZA 1ZBSA 4ICLA 3JYTA 5CD4H 2ZKUA 1WSEA 2E2OA 3QAEA 3MK6A 4EYHB 2O5DA 1X5TA 1O1WA 1NUEA 4NI2B 1X9WA 5KFSA 4ELTA 1FWLA 3A4TA 3SI8A 3ULEB 3ADAC 4LRBA 4DR2J 2PN6A 3R8YA 1NU0A 3UO0A 5DM6Q 1W9HA 1C1CA 4BR4A 2GC8A 3NGKA 1TK5A 5AQIA 2XZWA 2FBYA 4H0VB 1N5SA 4JI6F 4PQAA 1P1TA 5DLFA 3AO3A 2VJUA 3SFGA 1KOOA 3VQCA 5IV4A 1H7WA 4ID5B 2ZBQA 3THYB 1EETB 3AA5X 2B4PA 3UKRB 4PABA 4E89A 2RDIA 5EX3A 2Z4PA 4RPFA 1BIZA 3KHHA 5MLCV 1HW8A 2X1FA 5HQ8A 4BRKA 2BQUA 2L41A 3OTOJ 1I94J 1QQOA 1T3OA 1R8BA 4FBTA 4DTJA 1UPMB 3MUTP 4DTOA 1KLNA 2F4FA 3M8WA 1HYSA 1NKEA 3UNGC 1VBXA 1IUJA 1S3XA 2BYCA 4MYTA 3GFXA 1VHXA 4GKKK 4CK1A 3RRKA 2IHR1 3GTYX 5DDOC 5HLFB 3IMQJ 4MLEA 4XTTA 3D54A 4FJNA 2MJNA 3KNGA 1V9OA 1S12A 4BQZA 2G2OA 5FJ4A 3M2VB 3AODA 1XWLA 4C6AA 4CWBA 2VV5A 2R8HA 3AVKA 1RTDA 3EEQA 3DLJA 4XPCA 2J7KA 3QEXA 3E01A 4U67Q 1OVYA 3CCSN 2W40A 1S0OA 5K20B 3M8YA 3O3LA 3TQ1A 3CG7A 2GNKA 3L0QA 1SC1B 4FPIA 4AHCA 2COLA 2DGXA 4LRCA 1FVSA 4PL7A 3NG8A 2LA6A 3JQMA 2MZRA 3H4BA 3HVWA 3FLCO 4B3RF 2V2KA 1J5EF 2ASPA 2JNJA 2MJUA 5I3UB 5KFZA 2MKJA 2A6OA 1Y00A 2ZWHA 2CG4A 1LWEB 3R7NB 3POTB 2YX7A 1BQMA 4CTAB 2JVOA 4LIWA 4YOUA 3ATVA 1U2VA 4Q2LA 4CZGA 1MG7A 2KDOA 1NK5A 1KRPA 5BN9A 1YIJS 4LD0A 2L08A 2QRRA 1VQ6S 4IO9L 4LFCK 2JZ5A 2ZM6J 4L75A 4X4PA 1TELA 4X66F 3UE2A 1JNRB 3A8EA 5JJBA 2QA4G 1S0VA 4KH5A 5HVFA 1FD8A 3T7ZA 4L8RB 2AD9A 4H4KC 4JKGA 2ZH7A 1KHWA 3V4IB 4J9UE 1X4FA 1Q7LB 3OBYA 4Y2KA 4F0MA 2N3LA 2QLJB 2DD8S 1IJFB 2YKQA 1QVFR 4YOWA 3AVNA 3G8QA 1TUWA 3CMAS 1Q86O 4KHMA 3BGUA 4TLQA 1T6CA 3ULHA 4KHPK 4Q7AA 1X0PA 2CPIA 1N34F 1WUAA 4N8NA 5D4OA 3O9SA 1ZM4A 1IBLJ 1SAZA 3DJCA 4CK2A 2GIQA 2QA4N 5HBMB 2OAUA 4KI4A 2RILA 1QS4A 2XLIA 2P9PA 1OWXA 1IKWA 2LYVA 3G71N 1UL3A 2R7UA 3K2PA 2DHXA 5ETMA 4CF9A 1KC8T 4JI2F 1AA1B 3A2FA 4PXEA 3K0SA 3UB5A 3K5OA 3HSZA 3R8EA 3SUNA 4PEOA 1ZXOA 2DNYA 2GJIA 2Q97A 2RKIB 3FVYA 2JWKA 4ZS6A 4AHSA 4B9MA 2HVDA 1H2UX 4FLVA 1QTNB 2PZSA 3C6TB 1SV5B 1ZPWX 1KQSR 3ISZA 2HVIA 2EKNA 1W25A 3OTOK 4NXNF 1XERA 2GQQA 3E8OA 2R8JA 4Q43A 4RW9A 3EGVA 1VQSA 3LTOA 4PKGA 4DSJA 2P9LA 1CQNA 1RWVB 4RW8A 3PLAA 4UOHA 1JJ4A 3VGVA 4YY3J 2P9IB 4OYBA 4C11A 5GAEI 4WIQA 2PMHA 3AJ2A 4ZLNA 3GCWP 9RUBA 5KFAA 1K0VA 2CJAA 2DB1A 4PPZA 3VQSA 4NLUA 4TY8A 1FKPB 4OX8A 4DG1B 1I6JA 3CJRA 1JLFB 2F4VJ 3I9ZA 4DV6F 1C0FA 3NXZA 1FRKA 1IBKK 3Q23A 3QFPA 1E6YA 4ZVGA 3KK1A 3N6MA 1NSPA 4YOTA 2PI5A 3UQSA 3T1HJ 2R7OA 4BE0A 2XBPA 5KPTA 4QU7A 3OTCA 1F21A 3IMXA 2HMPA 1HNZK 1HX1A 3EWGA 3SLCA 5ETTA 3TYTA 3JSRA 3SQ0A 1NLKL 2V6AA 2FHKA 2A2DA 1RGVA 3IBWA 1EHWA 5KQDA 3OHBA 1QVFM 1WEZA 3T9ZA 3R5AA 1I1GA 1X3NA 1VQPN 1S6PB 1H98A 3BBCA 1ZAXA 1M90O 2ZWPA 4ED5A 4FXWA 1NXIA 4DCHA 2OYQA 2GEMA 1TQLA 1PIEA 3MMAA 4P7TA 2OSRA 4O8UA 3MEEB 4I67A 1Y3JA 4F8RA 1MU2B 4IG0B 1UVMA 3KLIA 3D6TB 1ACMB 4NLSA 4DQQA 5C25B 4F4WA 4KQZA 2RKIA 3AVJA 5CYMA 4V19X 3BB5A 1NNDA 4PKDB 2JFDA 1HRHA 2GVDB 4IKAA 4YOVA 3HULA 3G71S 1YJRA 2XMWA 4ELVA 2MYFA 4LH5A 3EPGA 3AVFA 3TTDA 3LP1B 4P2SA 1SB6A 5E26A 3KFWX 4M1KA 1H7XA 3RW7A 4OYOA 1WAFA 4CF2A 3KK3B 3EM1A 4BGAA 2OD4A 2BJ1A 3HSDA 4J2DA 4OI2A 3VPZA 2I1RA 4DL6A 3KLHA 4M3YA 4IFVA 4F4KA 3DN9A 1IBLK 2IVYA 2YKOA 2B4JA 3LGMA 3KD5E 4U7BA 2P9PB 2P9KB 3AD9C 2IRXA 4NZ0A 2F1FA 1ASWA 3MR7A 3MMVA 2CJQA 3CC4S 4W4MA 5IT4A 5KFWA 3P1GA 3UKUB 2OPSB 1VSLA 2UXDF 4IFVB 4X4NA 1NEEA 4I9QA 3M32B 1ZETA 2HQ3A 2YI1A 4JKHA 3G0ZA 1N4LA 1QZ5A 4CEFA 3WEEA 1U1KA 3J8AA 3D2FA 4BACA 4CJ5A 3H45C 2ZOGA 1XK8A 3P3DA 3LDNA 1NH7A 5D77A 2VG6B 2CPFA 2C2NA 1DZ5A 2PY5A 5A8RA 3DLRA 2FJBB 4RW4B 3NBPA 4Z4HA 4QIWD 5C2CA 2O8DB 1QTMA 2E5HA 1VSHA 3VVTA 1I51B 1NJXA 1EIYB 1N33F 3LP0A 4ECTA 2V8PA 1FFSB 2FUG9 3FBEA 3TUZC 2KHOA 4DQSA 4HVZA 2P8IA 2XCAA 2R8KA 3OR1A 5D0EA 2F8MA 3OVSA 3RMDA 2CYYA 3G82B 3MAAB 3KLFB 3KK1B 3SPYA 4R5PB 2NYIA 3UN3A 4JV5K 2KVQE 1DFDA 3L2VA 4WFZA 1BD6A 1FESA 2ZITA 1HBNA 3IA0A 3O4NA 1U2CA 1VFJA 3TAMA 1U0HB 3IRXB 1J5OB 3QBCA 4O3NA 3O6QA 2BRKA 1EWQA 4F3OA 3Q8QB 4B3SJ 5F3TA 4K0KF 3PW2A 1D0EA 1ZC6A 5E5NA 3DMJA 3O5TB 4FF3A 1R0CB 5D0HA 3LZIA 3NNCA 4FKXA 4ER8A 1I94F 4K5SA 4DTUA 3S3MA 2DTUA 1S6PA 2JVRA 5KFJA 2XLJA 5HRPA 3GYGA 1T11A 4UUXA 1WTBA 4C98A 4FW1A 3KLVA 3Q22A 3BO2A 4FJ9A 5AQYA 2HAFA 4FO0A 3SQ2A 2ZDOA 4F4XA 5LSOA 4M3WA 4LR9A 4MK9A 2XSFA 2Q2RA 2VHGA 2J9DE 4CLFA 1VQ9N 2GO8A 1DAXA 2BQ3A 3S7RA 4E7JA 1RBLA 1Q1KA 2ZJRL 2OEKA 2ZH9A 5KFKA 1J27A 2HNDB 4KGMA 3DU5A 4Y00A 3HSCA 2RH3A 1JLQA 2ZH1A 4C3LA 1V3ZA 1P27B 5CYQB 3J7AP 1GK8A 4ECXA 1RBTA 2FSNA 2DFFA 3LOUA 3PSIA 2BJ7A 3ILIA 2HK3A 3QWPA 3CJTA 5F9NA 2W2PP 3VESA 3GL1A 4DU3A 4I7FB 2QKBA 2LEPA 2ZGYA 4FLZA 3OL8A 3RB3A 3AJ1A 3A12A 2ZD1A 1HQUA 4NO7A 1BCOA 2ABYA 5DQHA 4RG8A 2HEKA 2OTJS 3D0GE 2UU9F 4UY8O 5E3QA 4G65A 2UUWA 1UJ5A 2KH9A 3H5XA 2I38A 4USVA 2FHMA 2E1YA 4K43A 2HBLA 3ELHA 5AE2A 4CHZA 4CHOA 3LAMA 2WONB 1TYQA 2OELA 5AQSA 2MXYA 5KPZA 2G8VA 2ZD1B 4QR0A 4CEAA 4R5PA 2KJWA 5D78A 2WVEA 2XMMA 3K2YA 1WC0A 1BWVA 1AUSL 3C16A 2IYIA 3H3NO 4ZVEA 4A57A 5DRKA 2BUNA 3ENVA 5ETOA 3MGJA 4JKAA 4RTFD 1CBKA 4XEIA 4K8ZA 3DMJB 4FL9A 3EUNA 1S6QB 3C15B 2A6MA 3S1TA 4QS7A 2CJYB 4QWEA 1BU6O 2YWKA 4J8FA 3GQCA 1KFDA 3R3LA 5RUBA 5EXWA 3DYAB 4EBCA 1TP7A 4BC4A 1O51A 1HL6A 5IWAJ 1VQON 4CM0A 3LP0B 1BXNA 1W97L 2D7SA 2ZJRQ 4FJJA 4OYIA 3AGKA 4RNNA 3CCSS 4DV5K 2OD6A 2G1DA 2E44A 3VQ5A 3BYRA 2R7YA 4PQUB 4PZVA 4X65K 3MAAA 4FF2A 3P38A 3NCRA 2BTFA 2YHXA 2ZVIA 3JAMU 3TZWA 4QJVA 3EPIA 1OJ4A 2GX9A 3MEGB 2UXDJ 1SXLA 1P9YA 2RHSB 2O8BB 3C3LA 4HUGA 3NY0A 1KD1T 3VQTA 4K5RA 3I4PA 2V4RA 3L2UA 5EWGA 2WOMB 4KB7A 2JX2A 1YIJN 1IR2A 1RWXB 4UOGA 2IM1A 4TSXA 1R8HA 4DI6A 2RHQB 2AZ1A 1RHMB 3ZEUB 5ETQA 2AZ3A 4WK1A 3C6HA 2E8AA 3TJAA 3LPUA 1K73O 1VQMS 3VR1A 3PYEA 4C2MA 3NS7B 4HYKA 3UR0A 4DZDA 1PJ6A 3ZSZA 1RK8A 4C8YA 3D6FB 4C23A 5FRMA 2DYAA 5HJYA 1Y4ZB 4CLLA 3PYFA 2HHHJ 3WNEA 3HP9A 4LF4K 1PYTA 1KHVA 3TOQA 4QCLA 2A0FB 4B3MF 2OTJN 3CFPA 3UE5A 4JI8K 4ECQA 3DRYA 3ZT1A 3T41A 3NKYA 5GAGI 1EQYA 1GOAA 5H9EK 5IT9Y 4OLBA 4ED1A 4NA1A 1RU2A 1L3UA 4DR7F 2C2OB 3CCVN 1IBMJ 3F73A 4WP9A 3DDKA 3MX2A 5IWAK 4DTSA 4WXWA 2CQDA 2V94A 1SVDA 4YR2A 1TMJA 4BQLA 3VAFA 1RWMB 2VFVA 3OBWA 4ZVPB 1BG3A 3JSMB 3HF5A 3OHRA 3JB9k 5AQTA 2HHTA 2F7TA 3OYCA 4JD2A 1HARA 4M3RA 1U09A 1R8PA 4RW4A 2A10A 1YJWN 1PC4A 1FNXH 3I55S 4DR5F 4IWVA 4CJUA 2ASMA 4X62J 4AQYJ 1OH8A 1FXRA 2YJFA 3RBXA 3QZ7A 6AT1B 1SI9A 2GMLA 1PKUA 4ED7A 2HBZB 2CNOB 2H65B 4LIRA 3RTVA 4NE9C 4OHYA 1RXOB 5KFOA 2WW8A 4OI4A 3HHLC 4QIGA 1K8KA 5EWFA 5M2PA 1LKZA 3QJLA 4DR2F 4LT6A 2R2RA 4YUDA 1I94K 2K1RB 4EZ6A 5FROA 4USJC 4AE5A 3MCNA 4YOYA 4DR6J 2XWYA 1SQEA 4FVMA 5AQVA 2XSJB 2CIMA 3I4HX 2AX0A 5AQMA 2JC1A 4Y2IA 3A8IA 2R7SA 3H46O 2FVPA 2JWNA 2VYPA 2IDOA 1OY9A 3IS9A 3R1XA 4DG1A 1PJ7A 3CD6S 4BR0A 1TVRA 1YVNA 4C1NK 1Z4UA 4K0KJ 2YNHA 1E6YB 4K4TA 2ASYA 3W2VB 2YHAA 2IDLA 1SJFA 4F4AA 1IBLF 2DISA 4RNFA 1EQ0A 4KV8B 3JS6A 1TUUA 3PCOB 3AO2A 5AQRA 4FYYB 1SC6A 5M2RA 1MDUB 4F4ZA 2QX0A 4DUTA 3U1LA 5D8HB 1KDNA 5BPLA 4B17A 1KVKA 3OYDA 4MKYA 4EYIB 4NRUA 5DLGA 4JI1F 1HHQA 4U9RA 4JBCA 3CERA 4KBIA 3MXMA 3FEZA 3O3GA 1BCMA 4R8UB 4C8MA 5BYQA 4OHXA 4WQ4A 3FCHA 5KGXA 2B7BB 2CQGA 2K3IA 3KHGA 2ZM6F 2GAGC 2AGOA 2AKWB 2NZTA 2VFRA 1JLGA 2YH0A 2WTFA 1O0PA 2C3OA 2GUIA 3JXUA 1KKHA 4ZTFA 1ATSA 3DRRA 1Q0NA 4NCGA 3AARA 2VG5A 2LQ9A 3DLGA 1PBUA 4NMLA 2VPWB 2KU7A 4NXMJ 4CJWA 3RB4A 2LU2A 3HI0A 5H1SV 4DUZK 5M1FA 4H0PA 4HWIA 4LFAK 2IDEA 2QLXA 4OVLA 2JLFA 3M1VB 4DR3J 2M52A 2JSXA 5GAGU 4RW6B 1WF1A 4ZP8A 4N56A 1ITPA 3DRSA 4ECRA 3KMQA 4A8OA 1N48A 4B1YB 3CCRS 4B3OA 1B0TA 1PGZA 2J0QD 2Q1LA 4ANDA 4DV4K 4NRTA 4K0KK 2V34A 3RGIA 3VQ6A 4KGZB 2J76E 5E3AA 3D6HB 1RT7B 2IGIA 3H0PA 1HI1A 3OFFA 1VSEA 3D45A 3QNWB 1Y0HA 2H54B 5B0GA 2DGUA 2YKNB 4F7VA 2YPZA 2DPIA 1WG5A 4RW9B 2O8FB 2HGLA 4CLWA 5FLXO 2YKMA 4FP9A 3H98A 1ZBFA 1Q53A 3KKFA 4JI3K 4FJ8A 1QM9A 4FZYA 3DC2A 4DSIA 2QI2A 1RB0A 3KG0A 4KO0B 3ZYYX 3PKYA 7FDRA 3IRXA 3Q83A 4CZLA 1VOMA 3DHXA 5L1LA 1WG1A 1K8KB 5KT3A 3IKMA 2LKZA 4LMZA 1S9EB 3IBFB 2D0PA 2E29A 4JV2A 2KZMA 5K5MA 2XEXA 4XAKA 4KB1A 1T02A 3AVCA 3M7VA 3VAHA 3FMBA 2IJRA 2DNPA 5A0YA 5L8RC 4PAAA 2R4FA 4CF0A 2HF4A 1TL5A 4CM2A 3IWNC 4FM2A 4KH0B 4IQMA 2GFFA 1XNRF 2XLKA 1NB7A 4OX9K 1RAHB 3FZ2A 4IUFA 3VF2A 4ZJOA 4F0HA 1V3SA 4CCHA 3MX5A 3D7SB 4X66K 1ELOA 3CIMA 2W9CB 2W2OP 1GT8A 2RMLA 4BDYA 3BZCA 1L3VA 3ASMA 4PCQA 5H9EJ 1RHJB 1WC4A 2BJ9A 4A62A 3MHYA 1RKJA 2E5GA 3QIDA 3AA9A 4HKQA 1H3DA 1FT8A 4DR1K 2VICA 5HL7L 2CKWA 2DEJA 2P9NB 3H25A 3VETA 4UOCA 2M70A 3MECA 2EBGA 3OVBA 2W7AA 3I56N 4J90A 3AH6A 2W7OA 3MUVP 2YNIA 4LF9J 4JHDA 4QYZK 5DZ7A 1UOCA 4RBUA 3QJPA 3RMBA 1HKCA 2V7YA 2AV5A 3NGIA 1X4HA 3CCTA 3BDPA 3I8BA 2OP5A 4RJVA 2D5RA 1EB0A 2CZVC 4ZCKA 3QBXA 2IIHA 1QE1B 3GP9A 3SFUA 4OZLA 4CLSA 1OVQA 4O44B 1RFQA 1E4GT 3LAKA 3HHLD 3HJFA 1U0SA 2RQCA 3WX4A 2YH1A 5C2FA 4P75A 2QL7B 1LXJA 3AHPA 5B8HA 4P6QA 3UVJA 4PWDA 5DETA 2FTRA 1RYSA 1WBDA 1TU0B 1WKLA 4CH1A 4P73A 1TAUA 4BG9A 2NS1B 1D09B 2X78A 4OLAA 4O3PA 1BISA 4U8VA 4NL5A 1YSJA 4CIEA 3RBEA 3N4QA 2MZ1A 4M3XA 4ELUA 4CLTA 3QIPB 4CZHA 5G0RB 1BC6A 1K44A 3GIMA 1UPPA 1T05A 1M5PC 3U9DA 3UDEA 4WYLA 4U7UK 2X7IA 1NG9A 3GONA 2KXHA 2D3ZA 2WB4A 1QQNA 3CC2S 2Q1NA 2DVIA 1IWGA 3J81U 4LF8J 4DR1J 1VRTB 1AB8