2RKIA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase (RT) p66
total genus 153
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rkiA05
3BSNA 4CE9A 3L3VA 3SQ2A 5KG7A 4Y3CA 3RAQA 4R5PB 1N56A 3CFPA 1JXBA 1HQEA 3G6XA 2R8HA 3JSMA 1DTQB 3EYZA 2IM1A 3GILA 3KLGB 4CGHA 5EU7A 1NJWA 3PV8A 3TVKA 1ZBLA 1C1BB 1J5OA 3KK3B 3P83D 3O3HA 3KLIB 4CJ4A 4E7LA 4FK0A 5KFZA 1B9FA 1I39A 2R2RA 3BGRA 3NMAA 2W42A 2FLNA 3FQLA 4ELTA 1REVB 1Y97A 1TAQA 3UQSA 2R8GA 4IKFA 4NLOA 2C28A 3OHBA 1BQNA 4W5QA 4RW9A 2IBKA 1I3AA 3RWUA 4M42A 4ED2A 3DYAB 4NLXA 3ZCMA 2X6NA 4Y2AA 3LANA 4E19A 3AA2A 4IG3A 2C2RA 1Q9YA 3AO5A 3QO9B 3G0ZA 4E7KA 4EZ9A 4KI4A 1RDRA 4J2EA 1C0TA 3RMDA 3DI6B 4DL3A 1JLFB 4DTXA 1LAWA 1JLGB 3KD1E 3QETA 4CGFA 3SQ1A 4K4TA 3TAQA 1SL0A 4CHOA 1JL1A 2D41A 3I0SA 1NK4A 3H08A 4F2RA 1NNDA 3I0SB 5DG7A 1ZETA 2Q3SA 3OY9A 4YR0A 3GV5B 3KKRA 4MFBA 5KT6A 4DF8A 4CGJA 4WE1A 5E41A 2V4QA 3GIJA 4B9MA 3HPGA 5C42A 1FKOA 3TAFA 5KT2A 3HVTA 5JS2A 2FVRA 4ED3A 1S9GA 3O3GA 3IG1B 3V6JA 3I5BA 3M9MB 4WFXA 3Q8RB 3MEGB 4RW7A 2XI2A 3BQ2A 3QERA 1XR5A 1HYSB 1YVUA 4CFAA 2X74A 1BGXT 2OYQA 3QEPA 3MXMA 1L3UA 3NL0A 1WSFA 1S1XB 4J9MA 1TL1A 2WONB 3CG7A 4DQPA 2D3UA 5L1LA 3K5MA 3LPTA 1WNEA 3OYNA 3NKYA 4CHNA 2UUWA 4B3OB 1IM4A 1EP4A 1DLOB 1J54A 3N6LA 1NJYA 4NRTA 4FBUA 4FJJA 3KLGA 5DGAA 3BSOA 4Z4IA 4DQIA 4DTMA 2IDOA 3C6TA 2OA8A 3MR6A 3OYBA 5KFNA 3H98A 3ITHA 1BI4B 1LWCA 3ZT3A 4ECUA 4TSXA 2WRMA 2F8TA 3HVRA 1A5XA 4NYZA 3MFHA 2KQ2A 1FKPB 2W9CB 4N76A 2IM0A 1LW0A 1SV5A 5KFTA 4AHTA 3VN5A 3DOLA 1Q8IA 3CFRA 3AVIA 4OKKA 4CF1A 2PY5A 3NF6A 4FK4A 1RBVA 4N41A 3L2QA 1VSLA 1HARA 3CDEA 4RW6A 1IKWB 4M3UA 3CM5A 2YNGB 3SUQA 3TAGA 2JEGA 5D3GA 2O4GA 4ZVGA 4IOBA 1SKWA 2F8SA 2HWIA 2HW3A 4UQGA 3UR0A 1KFDA 1BCMA 4IDKB 1W0HA 2E4LA 4CGGA 4JV0A 3NFAA 2FJXA 2BANB 4O3PA 2FJVA 2DFFA 3VA3A 2FVQA 1C1CA 2JC1A 2YKMB 2VG6A 4CF0A 4EO8A 2IM2A 3NAIA 4ZP6A 4DL2A 4Y1CA 1S0MA 3ALYA 3DLKB 4HHTA 3K5OA 1S97A 3KLHA 4EZ6A 3H5UA 4KFBA 2Z1IA 3IRXB 4PWDA 1SUQB 4IRKA 4ECYA 3M8QA 2C2EA 2BRLA 1TL3B 3HHKA 4AHUA 2IC3B 1VK0A 4FLVA 3RMCA 1JLBB 3KHGA 1RDCA 4CGIA 3ISND 4KHWA 3T3FA 5KG1A 1JKHB 5T7BA 4C8KA 3KTQA 4PQUB 4CK3A 2VG5B 3ZSZA 5J1EB 4Z4EA 3M8SA 3B6PA 1EETA 2W9BB 1JLEB 4B9VA 2JEIA 2WTFA 5KFHA 1S6PA 3AVAA 3PW4A 4FJXA 4IQXA 1RT4B 2JLEA 1K6YA 5DG8A 4K4XA 2AX0A 2FBTA 2VA3A 3V6HA 3VQ9A 1TKXB 5HP1B 1TK0A 2YV0X 3OSNA 4ZPBA 4L8RB 1IKYB 2YHBA 3TAEA 2FC0A 1L3VA 1X9MA 5SZTA 4R0EA 4KO0B 5KFDA 4ZPAA 3UPFA 2QKBA 5KG0A 1XWLA 2P1JA 1HPZB 4LSLA 3TARA 4KRFA 2PZSA 1BL3A 4I7FB 5DQHA 4RNFA 2BQ3A 3NGIA 1C0TB 3PX4A 1U04A 2XI3A 1KFSA 3IS9B 3NH0A 4GMJB 4IRCA 4QW9A 3AO4A 4ECRA 1LWFB 5KG4A 3D5MA 1EX4A 2Z1HA 1YTAA 1LWFA 1G15A 2G8KA 2CKWA 4KHNA 2AGOA 4IG3B 3ISNC 4NLRA 3QEVA 1LW2A 4NLQA 4ECWA 1OS5A 1RA7A 3M8RA 3KHRA 3SPYA 2JEFA 3KLEB 4DSLA 3DLGA 1J53A 1RT7A 2HWHA 1RT7B 3DDKA 2XCAA 3AVKA 3H5YA 3ZSWA 1S1TA 4ZPDA 1GOBA 4R8UA 3OS0A 1GOCA 2ATQA 5C25A 3V6KA 3K59A 2E9RX 4CECA 3PW0A 3PUFA 4RW8B 2PYLA 4LH5A 3JSMB 2BQUA 2YNFA 2X78A 1Z26A 1RAJA 3QIPA 4DFMA 1IO2A 5KRTA 5KFMA 4WZQA 1LAVA 2KZMA 3AO3A 3DRRA 3IGNA 4K4YA 3MXJA 3KMQA 2W9AA 5DMRA 4ZMMA 5FROA 1QUVA 1ITGA 4DF4A 4LQ3A 3GIKA 1ZBFA 4Q8FA 4NCGA 4RU9A 3MFIA 4OJRA 5SWMA 4O44A 2B4JA 4BDZA 3V9SA 3ZSQA 3I0RA 2RKIB 4FM2A 3WNEA 1HRHA 4EO6A 5HBMA 4KSEB 3TQ1A 2FJWA 2E9ZA 2HMIA 1IKVB 5F8NA 4BDYA 2I5JA 4CJEA 5HLFB 2HNZA 3KK2B 3DLKA 4B9SA 3ZT1A 4FW1A 1SH3A 1RTHA 1N5YB 2W7PA 4FJ5A 4H4OA 2YKMA 4DTPA 5HRPA 4E89A 4DTRA 1C1CB 4Q8EA 4WFYA 1VRTA 1S6PB 4IFYB 3OL8A 2ZE2B 4RUAA 1RYRA 1JLQB 3MR2A 1BQMB 4FJHA 3DLHA 2DTUA 4Q45A 1JL2A 3HT3A 1MMLA 4E7HA 3LP2B 1HNIA 1RT2A 5I3UB 1ASWA 3SQ0A 3OYLA 4HYKA 4IR1A 4GC7A 4M3YA 4NLTA 4CFDA 3OYMA 3V1QA 5DLFA 1VSHA 4RG8A 3QNNA 1S9FA 4M94A 2FBVA 3DMJB 1D9FA 1JLQA 1IKXB 3ZT0A 2R2SA 1NK7A 1S6QA 5FRMA 1QAIA 4ECXA 4ELVA 4EBCA 3LDSA 3I5CA 5C24B 2KTQA 1HNVA 1JLAA 2VWKA 4E1MA 1WSHA 4OGCA 1JLAB 4KHRA 2WHOA 4GC6A 4KHQA 2I5JB 5KFOA 3KHLA 2KZZA 1X1PA 1WSEA 4OKEA 4B9NA 5CZ2A 4O3QA 1X9SA 3VQCA 2XC9A 1TKZB 3V6DA 1S0NA 4F50A 3D28A 3O4QA 2VG5A 4CEZA 2Y1IA 3H59A 1HMVA 1RNHA 3NHGA 2E9TA 4FLXA 1JLBA 3OYJA 2NUBA 4DSIA 5FRNA 3ZSOA 3U6FA 3DOLB 4HKQA 1SV5B 1HQUB 3LAKA 1B92A 1VSDA 4IG0A 4CESA 4PWDB 1BIZA 3V6DB 3IRXA 1UWBB 4KKOA 3HVTB 3HKWA 4K8XA 4NLDA 3ASMA 1QHTA 2BE2B 2YKNB 3AVNA 3NBPA 4LQ9A 3MEDB 2D0CA 2ASDA 4TYAA 3SUOA 4DG1B 2A1RA 4HTUA 3KLFB 3RMAA 5J2QB 2RKIA 1TVRA 4URSA 4IG0B 1QS4A 1A5WA 1HJRA 2BANA 4KBIA 1KCFA 1RA6A 1KVCA 4EYHB 2HNYB 4O4RA 3EPIA 4ED6A 3RBDA 4WFZA 4WYLA 4FK2A 5CYQB 4DS4A 2IA6A 3VA0A 3V9ZA 5L1KA 2B43A 3PX6A 4ZP7A 1HYZA 4KPYA 3DRRB 1T7PA 4FLUA 3B6OA 1N6QA 1XI1A 4DTSA 4WXWA 4ZPCA 2DPJA 1ZYQA 3BJYA 1U49A 4CHPA 2HVHA 4I7FA 2W9CA 4CEEA 3EZ5A 4IFYA 4FJ9A 4OVLA 4O4GA 3PW7A 5KFPA 1TVRB 2EX3A 1TKTB 1RT5B 4DSFA 1FK9B 1RT5A 5DK5A 4J9KA 4DG1A 3FSIA 4DFPA 4ZP9A 1IKXA 1SL1A 1EP4B 2ETJA 1IG9A 2BE2A 2I1RA 4B8CA 5F8IA 3L2VA 4HUGA 2XCPA 2IMWP 4RNOA 2R8KA 4KHUA 4NLWA 5EWEA 1Q9XA 4H54A 4O0IA 4M45A 1HNIB 4RW4A 3LP3A 3F73A 4ELUA 3U3YA 5F8LA 4K8ZA 4F3TA 3WNGA 5KFYA 3RB3A 5L1JA 3HSTB 1UA0A 1BQMA 1S9EA 2GIRA 3OL6A 1RDBA 5JUMA 2OH2A 4WZMA 5KFVA 3AVBA 4JV2A 3CYMA 1UAXA 4KO0A 3SNNA 1RT1B 3K2PA 4N47A 4FJLA 4J9QA 4DSEA 4M3TA 3UDLA 4ZHRA 3FRZA 2VG7B 3SV4A 5DGBA 4WE1B 3G86A 3GIMA 5J2QA 3MECA 3NCIA 1U47A 3NH1A 4C8OA 4FS1A 3ZT4A 1ASVA 3TI0A 3RR8A 3DLEB 2VG7A 2ASLA 4CJRA 4CCHA 2UVVA 4O44B 4O4GB 2GUIA 2VWJA 1GOAA 1S10A 4NRUA 1TK5A 1EETB 4O0JA 3V4IB 3HO1A 1L3TA 2OPPB 1S9EB 2HHSA 1W25A 4KHYA 1N6QB 2HNDB 4FLTA 4YR2A 1RBSA 4EBDA 2WK4A 4QCLA 4IH7A 2G8HA 1D0EA 4Y2CA 5F8GA 1NHVA 4ED8A 3RR7A 5KGXA 4Y34A 5CYQA 4EP4A 4RNNA 3NF8A 2E6LA 3TR8A 3UIQA 2IAJA 3DM2B 2D0AA 4U7CA 4M3ZA 3NAHA 4KFBB 3CJ5A 3EPGA 1RT3B 5J2PB 3MXIA 3S3OA 1IKYA 3OHAA 1KHWA 1BI4A 3P1GA 3RAXA 4O55A 4Z4HA 2R2TA 4CIGA 2D0BA 1TKXA 2OZMA 2PYJA 1LW2B 4CEQA 2AX1A 2B6AB 4F4KA 5HBMB 3VQSA 1RYSA 1K1SA 5KFSA 4Q5VA 3QGHA 1RT6B 3CO9A 2HVIA 2DPIA 4I2QB 3CQ8A 5KT5A 1S1XA 3SFUA 1F21A 1X9WA 4NLYA 4FLYA 4F3OA 3QIDA 3GQCA 3T19A 5KT3A 4I2QA 2D3ZA 5KFIA 3TABA 2ZE2A 2AU0A 3HJFA 4CJFA 4G1QA 3A2FA 4TN2A 2P5GA 3PO4A 3HM9A 4CEOA 3WNHA 3KLFA 2WCXA 4CF9A 1N5YA 4RW8A 3C6TB 4ZVFA 1KTQA 4FJIA 4KB7A 4QOZB 5T14A 4MK8A 3I8DA 1NK5A 4RZRA 5HRSA 3V81A 1CZBA 1UWBA 1TV6B 1U4BA 3KLVA 3MR3A 3T5LA 1N48A 3C95A 3D0PA 3DLGB 2XGPA 1JLEA 4H8KA 4URGA 2AJQA 1HQUA 5KFKA 5F8MA 4IDKA 1JKHA 5CZ1A 4KHMA 3N6NA 3RBEA 1T94A 4ECTA 4F4XA 4HVJA 4DL7A 4NLPA 1IKWA 5KFGA 1NOYA 4RW4B 3CVKA 4DL4A 4IBNA 5KFJA 1L5UA 3M9OB 2HNDA 2OPRA 2R8JA 3CM6A 4FLWA 4BE2A 2HHVA 4YR3A 1FXXA 3AO1A 4C8NA 4KTZA 3LP0B 4JLHA 2O4IA 3KLHB 1T8EA 5EDWA 2ILZA 3RTVA 2GIQA 1W9HA 5DQIA 3VQ5A 1O1WA 3AV9A 4O5BA 4R8UB 5K14B 4FZZA 2XWYA 2VG6B 1REVA 5F8HA 4FZXC 5JXSA 4QWBA 3OLAA 2G8IA 4B08A 3PJXA 4AH9A 3MECB 2V0NA 5EWFA 3JYTA 1R0AA 4LY7A 1LWEB 4NCGB 1RT4A 4DS5A 1LV5A 4J2BA 4G3IA 4I9QA 2YNGA 3KJVA 4XPCA 2QE5A 1SH2A 3LP2A 3OYDA 4CK1A 1HYSA 4JS5A 3PR4A 4X2BA 1KHVA 1T05B 2UVWA 1QQCA 5KRSA 1JX4A 3HPHA 3PW2A 3IG1A 4CEFA 3LZJA 3V9WA 3KNAA 4IH6A 1QSYA 3NE6A 4CFCA 5J2MA 1FKOB 1RTHB 1GX6A 4M3WA 1KVBA 2QK9A 1UOCA 2FVSA 1QE1B 2HHQA 1C0MA 2Y1JA 4ZVEA 4Z4FA 1QE1A 4O3SA 3BQ0A 3NDKA 1J5OB 4EBEA 4MK9A 2DFHA 2B5JA 4Q44A 3CFOA 4MH8A 3NF9A 3BR9A 4GVMA 4DLEA 3H4DA 1RT1A 4K4SA 3THVA 3QEXA 4DFJA 4DTJA 4FYDA 4NLSA 1S4FA 4IR9A 4JV1A 3DRPB 4CF8A 1Z25A 4PQUA 4FM0A 4CIFA 4B9LA 4LD0A 1WSIA 5KFCA 3K5NA 3MTKA 2CJQA 1NJZA 4M3RA 3H40A 3E01A 2E6MA 2X6SA 2KFNA 3EZUA 3NGYA 3V9XA 4Q0BB 1T3NA 2HB5A 1TKZA 2ZKUA 1BIUA 4N56A 4Z4CA 4HUFA 4DQSA 2JGUA 4DL6A 1GX5A 1XR7A 3V1OA 3KIOA 3OYIA 4MFBB 1VSFA 3G6VA 2P51A 3SUNA 3CJ4A 1LWCB 1RTJB 4XIUA 4CFBA 1NK0A 2W8LA 2O5DA 5HP1A 4CGDA 1C1AA 3FFIA 1RILA 5KG2A 2WB4A 4NLVA 3WNFA 3CDUA 4QW8A 1S0OA 5KFWA 1S5JA 1S6QB 3C6UA 4AHVA 2FVPA 1HQEB 3CWJA 4JUZA 1CSJA 2C2DA 2WOMB 4XO0A 2RPIA 4E0DA 4DSKA 1Z4UA 4CJWA 3VQPA 4CIEA 1ZTTA 2OPSA 5KG5A 3C94A 2HNYA 4TY8A 4BE0A 4TXSA 2F96A 2ASJA 3IAYA 1VRTB 4BE1A 3SYZA 1RTIB 4RUCA 3N6MA 4F2SA 1CLQA 2V9WA 4JS4A 1MU2B 4CJLA 4H4OB 1C2PA 4PA1A 4CJ5A 5JS1A 4DWIA 4GW6A 3AVLA 1XC9A 1IKVA 1S1VB 4URQU 2IJFA 4MIBA 5KGWA 1DTQA 4YFUA 4ECZA 4KKOB 1S49A 3HVWA 3DOKA 2GBZA 1QAJA 4ED0A 3BREA 3FFIB 3MEEB 2Z1JA 1RTJA 3ZSXA 4OPKA 3L2UA 3FQKA 1N4LA 3LZIA 3PZPA 3HPOA 3NGZA 4B9UA 4MQ3A 2HHWA 4DSJA 4OL8A 4Q0BA 4TQSA 3DLRA 2AGQA 5I3UA 4KHSA 5KG6A 4FXDA 3QIPB 4HCBA 3GV8B 3PR5B 1RBTA 4FW2A 3TAMA 5KT7A 2EHGA 1ZBUA 4DFKA 3M8PB 3EY1A 3HP9A 3NAEA 4RW9B 3VQEA 5KFAA 4ICLA 3H2LA 1TKDA 1VSJA 1RDDA 4F4ZA 1NK6A 1HNVB 2HNZB 3KK2A 3AVFA 4RNMA 1RBRA 2GV9A 4FCYA 2HMIB 5J2NB 4EEYA 5J2PA 2ZQBA 4ZP8A 4BWJA 4HUEA 3SPZA 1TGOA 4B8AB 2IOCA 1SL2A 3DM2A 4CJKA 3AVGA 3AVMA 4I2PA 4F4WA 1A5VA 2BDPA 3G6YA 2J6UA 1VSIA 3TAPA 1S1UA 1L3SA 1RT2B 2ALZA 3OYHA 4Z0UA 1TK8A 4DU3A 1BCOA 4ID5B 1TQLA 3QEWA 3OS2A 5KFRA 3TANA 4LSNB 3M9NB 2XY5A 1WAJA 2FLLA 4KB0A 2RDIA 4DU1A 1VRUB 3K57A 1C0UB 2OPQB 3NH2A 3RB4A 4AHSA 2YNHA 3DLEA 4DQRA 5HLFA 5C25B 4OKJA 3VQ7A 4WYWA 2BRKA 3SFGA 4BWMA 2KW4A 1XHZA 2F8EX 2QV6A 1DLOA 4CHYA 2RN2A 3I0RB 1CXUA 1NHUA 4K4VA 1WLJA 2YNIB 1U45A 2BR0A 3IN5A 2XY7A 3H4BA 3TWHA 4PUOA 3LALA 3SV3A 2QXFA 3GV7B 2ZD1B 1JLGA 4CJQA 1U48A 2EC0A 3CJ0A 4I9LA 3K58A 4O3OA 3QGGA 4Z4GA 4J9OA 2XY6A 4KV8B 2R8IA 1U09A 3D45A 4NCAA 3SJJA 4YNQA 3IS9A 4O3NA 4FZYA 4O3RA 2YNFB 1WAFA 3VQ4A 2AWZA 3AA5X 3VQBA 4J9PA 4FJGA 1ZTWA 4LSLB 1HPZA 5KFBA 3DRSB 4DTUA 4F4YA 3AVCA 1NKBA 4DTOA 2FVCA 1RBUA 3S3MA 3P5JA 1DTTA 1JXEA 1WN7A 2G8WA 2G8VA 4U6PA 3KLEA 1RDAA 2FBXA 4FVMA 5J2NA 2ILYA 3QYYA 1TP7A 4Y1DA 1S1VA 3AVJA 3OL7A 2XHBA 4ICLB 1JLFA 2FBYA 3OYGA 1WSGA 4DL5A 3KD5E 3OJSA 3M8PA 3VQDA 3BSAA 5KI6A 1MU2A 2YHAA 3KOAA 5KFLA 5D3GB 4KAZA 1KLMB 1YTUA 4LSNA 4TYBA 5KFQA 4QAGA 1YVFA 2IGIA 4KTWA 2IS3A 3RRHA 4HCCA 4ID5A 4W5RA 1EXQA 4M41A 3SZ2A 4K4ZA 1LW0B 3VQAA 1WNSA 3T5HA 4AILC 3QLHB 5KT4A 4MK7A 3MAQA 1ASUA 4QWAA 1T03B 5FDLA 4ECQA 2RF2B 2D5RA 1ZBIA 4CJVA 5F9NA 4IFVB 3U3GA 1NKEA 3NBPB 5F8JA 5KTQA 3SI8A 4DEZA 3IGVA 3PHEA 4YP3A 4JRPA 4QPXA 1SKSA 5KFUA 4B3OA 2W9BA 3RB0A 4K50A 3QEIA 4W5OA 1SKRA 1TL1B 2WONA 3KMSA 2UUTA 1K1QA 4H4MA 3QZ7A 4RNHA 4CEDA 4DQQA 1RT3A 4TLRA 5HRRA 1TAUA 5CYMA 1S1WB 4N5SA 1HMVB 1TL3A 3CDWA 5L1IA 3HYFA 3M8QB 3G10A 1SUQA 3LWLA 2XRIA 2OZSA 3AO2A 1S9GB 4NCBA 2IM3A 4F8RA 4KV8A 2BQRA 4IH5A 4FLZA 4MKBA 4KI6A 3CIZA 1JLCA 3HL8A 3F9KA 2OPPA 3V4IA 4CJUA 4B9TA 2DY4A 2ITGA 5HROA 2FLPA 5I42A 2DFEA 4C8MA 3Q8QB 2A1SA 1HYVA 2W8KA 3KHHA 3K5LA 4J9SA 3OYKA 5HRNA 3KK1B 3CJ2A 3T1AA 3DMJA 2HAIA 4FJ8A 2QKKA 1NOZA 2HHTA 4J9RA 1UA1A 4DTNA 4EYIB 3OSPA 2XGQA 3T5KA 4FJNA 4ZTFA 4E7IA 1WSJA 4WXOA 3S3NA 3H5SA 4QWDA 3OLBA 4J9NA 3O3FA 3L2WA 1T05A 1C6VA 1BHLA 3OVNA 1FKPA 4KAIA 1KLMA 4YMEA 4J9LA 4CK2A 2WOMA 3ZSRA 3ITHB 3OYAA 5C42B 3OJUA 5DQGA 3BQ1A 4I2PB 4CJTA 1KRPA 4CEBA 1KVAA 1NK9A 2YNIA 3BGRB 1LWEA 3QINA 3LP1B 2HHXA 1R0AB 1S48A 3KK3A 3KKSA 1C1BA 3LWMA 2G8FA 4NYFA 4XPEA 3KK1A 4E3SA 4MIAA 4K4UA 2J6SA 1FK9A 1TKTA 3QLHA 3LAMA 4BDPA 1C0UA 2OPQA 3I5AA 3DI6A 4BACA 4ED7A 3OS1A 3OYEA 1NKCA 3ZSVA 3QZ8A 4OGEA 3MEGA 4RW7B 3GIIA 3SUPA 4NZ0A 3H5XA 4CEAA 5EUHA 1YT3A 3DYAA 3FDSA 3KJVB 4NLUA 1SH0A 4QWEA 1EKEA 4FJ7A 4FS2A 2XY8A 4J2DA 1S1WA 1BQNB 2ZD1A 4H4MB 3HVAA 1S1TB 5KFXA 1QSSA 3OYFA 4YQWA 2Z1GA 3V1RA 5L9XA 4DMNA 3QGIA 4J2AA 3E51A 2P5OA 3V9UA 4FBTA 3HP6A 1D8YA 5I42B 2W7OA 4ED1A 3LP1A 2ATLA 5HROB 3Q8PB 3PO5A 3MEDA 4CHQA 1D9DA 4PY5A 3PVXA 2YKNA 1JLCB 3ULDA 2XO7A 4R5PA 5FDLB 5J2MB 1VRUA 4OLAA 4M95A 1XHXA 2J6TA 1B9DA 3BSCA 2RDJA 1VSEA 3QO9A 2AQ4A 2VA2A 4K4WA 2BGGA 2D7SA 3PY8A 2UVRA 4E1NA 4NYNA 3ZT2A 3LPUA 3SI6A 4MKAA 3L3UA 3HXMA 5KFEA 4DLGA 3RB6A 1S1UB 4C8LA 2R2UA 4KE5A 4KREA 3QIOA 4CJPA 1KLNA 4PUOB 4TQRA 3PX0A 4OLBA 4IRDA 3VQ8A 3KLIA 3AVHA 3MEEA 3JYTB 4M3XA 3DOKB 2GC8A 3BDPA 4E7JA 2G8UA 2B6AA 3T5JA 3PJWA 3RRGA 1NK8A 2AGPA 5KG3A 2R7YA 4ZTJA 4IFVA 4ECSA 3SCXA 5K14A 3DLBA 2RF2A 4QWCA 1IH7A 1T03A 1BISA 5J1EA 5C24A 1RTIA 4W5TA 4CHZA 1JIHA 4G1QB 4JRQA 1NJXA 1RCHA 3VQQA 3HK2A 4EP5A 4FJKA 3LP0A 3Q8SB 1ZBHA 4IKAA 4TY8B 1RTDA 3ICLA 3QESA 2IC3A 2OPRB 2IAJB 3DRSA 3GYNA 2UVUA 2KFZA 3O4NA 3MR5A 4ECVA 4LH4A 1VSMA 1XR6A 3NF7A 3S9HA 3E01B 1RTDB 3QNOA 5CYMB 3VQ6A 1J9AA 4AHCA 5EWGA 1QSLA 1CZ9A 4CERA 3OL9A 4AHRA 3CJ3A 1RT6A 2C22A 1QTMA 2V4RA 3DRPA 3OYCA 4FM1A 3C6UB 3NGDA 2LSNA 4KTQA 4FJMA 4W5NA 5DLGA 4DU4A 1TV6A 2JEJA 3RMBA 1JXLA 1D5AA 1KSPA 5DG9A 3L2RA 3V81B 1D1UA 2HHUA 3AA3A 4CJ3A 2B5JB 4TY9A 4CJSA 4Q43A 3MF5A 1DTTB 4ID1A 3PW5A 3TAMB 1CXQA 1I6JA 3L8BA 5CY4A 5C5JA 4ZVHA 4KB1A 2YNHB 2IJNA 3ZSYA 4ZHRB 4OPJA 1VSKA 4RW6B 2JC0A 3SQ4A 4NLGA 5F9LA 2OPSB 4CF2A 5KFFA 3AA4A
chains in the Genus database with same CATH superfamily
5AXMA 4F3QA 4MO4A 3CCEN 4CE9A 1RXOB 3RAQA 4R5PB 1N56A 3THWA 3CFPA 5IWAK 1HQEA 4BHQA 5M2RA 2ZM6F 4DR2K 2D0PA 1UMJA 4FP9A 3GILA 4NPOA 3KLGB 1XK8A 1NJWA 2DRDA 1C1BB 2FXUA 3O3HA 4U7BA 3KLIB 4E7LA 1B9FA 2QWLA 2V34A 3H25A 1REVB 2EFQA 4HACB 1BQNA 1FJGJ 4W5QA 2H48B 3TUZC 2ZVIA 1RWVB 1HHQA 2PI5A 2KLAA 1T9WA 3FZFA 4X4OA 2ZBRA 2X6NA 1WACA 3LANA 4M5KA 2HSEB 3AA2A 2P9LA 3AO5A 1OIAA 3QO9B 4DV6K 3EL2A 1F2HA 1U0HB 3QATA 4KI4A 3C3LA 2QL9B 4DTXA 1LAWA 4JHDB 3KD1E 3D6RA 2GFFA 3SQ1A 1PG5B 3I0SA 1NK4A 4Y0FA 2W24A 2RB7A 3TW0A 2YX7A 3I0SB 3T6BA 1IBKJ 4JKAA 4OHVA 3I56N 3GV5B 4BROA 4PG5A 2ACYA 1B0PA 1H38A 3SSSA 3U8XA 3BH6B 5AZJB 4P2XA 5E41A 2GJIA 4DR7K 3GIJA 2QXLA 4OYBA 5KT2A 4YHHF 2YQ3A 1NU4A 1HIYA 2IVFB 1S9GA 3IG1B 3D1HA 3BO4A 4OHZA 4OX9J 1A0OB 4RW7A 2XMJA 3QERA 1FERA 1N33F 4I69A 2LEBA 4TU9A 3MXMA 4OFZA 1HL6A 1L3UA 1WD6A 2K3IA 1WC1A 2D3UA 5DS7A 4ANDA 3K5MA 2L9NA 3KK7A 5JICA 4KHPJ 5F3ZA 2YKPA 4M7XA 4FWPA 1NSAA 5BREA 3JTNA 1EP4A 1VC5A 4MDAA 1NJYA 4X65K 4FBUA 4FJJA 1GXLA 1ZM2A 5DGAA 4DQIA 4UY85 4GV6A 5LXYA 2B8QA 2ZITA 3KFWX 6FD1A 2OGUA 3ZT3A 4ECUA 3DXMB 5LJVA 4TSXA 4CI6A 2WRMA 3QAUA 3ZTOA 2VPYB 3MFHA 2W9CB 1N36J 4JI5J 2P9UB 3FEYB 4KHPK 3PIOL 2XSJA 5KPTA 4X64J 3CFRA 2GVDB 3NF6A 3LQVA 1R6VA 3L2QA 4NXNK 3CJBA 3ID8A 3E3XA 3TAGA 5AE3A 2O4GA 1IBMF 2I7PA 1VIOA 4ZVGA 2CQDA 3TZWA 2QN6B 4EHTA 1KFDA 1BCMA 4CGGA 4U67Q 5GMEA 2B3TB 2AJ2A 4X66K 2CRLA 2FVQA 2JC1A 3IBWA 5LJ5Y 1NLVA 2IM2A 2C3PA 5AQFA 5JVGQ 5D4PA 5DETA 1IBKF 1ZH5A 5H9FJ 3H5UA 4PWDA 5F0UA 4BG9A 2RU3A 3C7NB 2C3YA 3HHKA 3PIPQ 1JLBB 3DLJA 4CGIA 3ISND 4OHWA 4LFBF 5IV3A 4KHWA 3OTDA 5T7BA 4BY9C 4CK3A 1LWXA 4Z4EA 3M8WA 1I1GA 3M8SA 3B6PA 1EETA 1WKJA 5BJRA 2WTFA 1S6PA 3MMAB 3PW4A 2EG2A 1WOSA 2GWKA 3R7SB 4JI7F 3DLLL 2VA3A 3HZEA 4FF1A 5DM7L 2VQEK 3QFHA 1HHTP 3J81O 2CJKA 2YV0X 4BR2A 3BPDA 4M5GA 3HFKA 3TAEA 4OHYA 5LT5A 2BM0A 1X9MA 3NGTA 5SZTA 4R0EA 4KO0B 1R59O 5D4OA 5B09A 3JB9k 2P1JA 3TARA 2YY3A 2J0QD 5C2DA 4I7FB 2PDAA 3P38A 2QGFB 3PX4A 2DTJA 2XI3A 3IS9B 4GMJB 3TUJC 1OPZA 4BRDA 1GXTA 1FVQA 1Z2ZA 3D3BJ 4FXVA 3RW6A 1G15A 4Y2MA 4J5OA 2CH6A 2CKWA 2G8KA 4PQAA 4ZK7M 3PYEA 2HZAA 3LO3A 1LW2A 4ECWA 3GE1A 1RA7A 3M8RA 1K73T 1UVNA 4DX7A 2JEFA 4UZBA 2IVYA 1RT7A 1Y3KA 5CAAA 1WOQA 3AVKA 5JMVA 1RWWB 1S1TA 4ZPDA 4FOIA 1GOCA 5C25A 1WI6A 5CA5A 5GAGU 4BVPA 5HOOA 4RW8B 3TSUA 4LH5A 1N8RT 1J5EF 2BQUA 3UKUB 4DFMA 4AE5A 5HI7A 3HHNB 4F0HA 2H5EA 1FWPA 1LAVA 2KZMA 3AO3A 1MN7A 3Q22A 4CZHA 3TVZA 1UVMA 5K8PA 3AD8C 3QWPA 3OT9A 3D66A 3B6BA 4LIRA 1N52B 4L73A 1RAHB 1KQFB 4YS2A 3MFIA 4O44A 2B4JA 4JI5F 2YWKA 3CDBA 2RKIB 4U9RA 1IWAA 3VGTA 1NJIO 3VGSA 2F7VA 3WNEA 1HRHA 4AQYK 4YEAA 2V63A 3AXMA 2E9ZA 1IKVB 3D54A 3VAGA 3R5JB 2I5JA 3KK2B 1M5OC 1HBNB 3IBCB 3DLKA 5A8RB 1YVNA 4FW1A 1RTHA 4FJ5A 1RHMB 4OZLA 4BRFA 4E89A 1C1CB 4Q8EA 4WFYA 1M1GA 1S99A 1RYRA 4HHJA 4Q45A 1JL2A 1HBOB 4OX7A 3OTCA 2XG8A 3LP2B 3R1XA 5DZ7A 5I3UB 2CDRB 2HVDA 2B0GA 4PYAA 4NLTA 4USVA 4IJNA 4CFDA 3OYMA 4C1NI 1GT8A 3QMLA 1VSHA 1NG9A 1Q8KA 4OX9F 1CPZA 1M1HA 4CWBA 1JLQA 1QUPA 4ECXA 2E44A 4ELVA 3LDSA 2W41A 1HNVA 4NXNF 2ZH7A 3QB0A 1JLAA 2VWKA 1JLAB 1DURA 2WHOA 4GC6A 2FGCA 1NGFA 1YJNN 1WSEA 2XYPB 4OKEA 3WIUA 4B9NA 4N77A 3N28A 3TUPA 4FPIA 2VFTA 3VQCA 1FRXA 2G2ZA 5I3PA 1TKZB 3KUHA 5L8RC 3C6AA 3AOAA 3FBEA 2VG5A 1BDGA 1DGKN 5L38A 3S6EA 3H59A 4X62F 4A48A 3NHGA 1GAOA 4GKKJ 4FLXA 2OP5A 2CZ4A 1JLBA 1RUSA 3SLCA 3DOMB 3ZSOA 4HKQA 1B92A 2E66A 3VAIA 2VC1A 4IG0A 4CESA 4PWDB 1SBRA 4ZS6A 4TU7A 1S22A 1RGVA 3IRXA 2IYGA 1UWBB 3HKWA 4NLDA 3ASMA 1QHTA 2W2OP 2BE2B 1DARA 3FC9A 3VEVA 3KUGA 2XLKA 1HFEL 1H98A 4CLTA 2LFVA 2GJ2A 2RKIA 1I94K 1ZAVA 4A8SA 3A5NC 2V2KA 4IG0B 1WI8A 3CCMN 2BUNA 1KVCA 4O5FA 2CJBA 3HOTA 1Q82T 4FK2A 2HQFA 1RWMB 4I68A 4ZVOB 2B43A 4KPYA 1DEJA 1U0HA 1T7PA 3PRDA 2YX1A 3B6OA 4CLFA 3JTPA 2DPJA 3BJYA 4C98A 1U49A 1RU2A 3K17A 3TX8A 3CXCM 2ZVSA 2W9CA 4WIQA 1OQ3A 2O8CA 2JWLA 4JI2K 1TUVA 3D6TB 4OVLA 1HR0F 4O4GA 2CVEA 2E1CA 3PW7A 1FE4A 4H0OA 1TVRB 4P52A 1XMOJ 3MM8A 1D4XA 1RT5A 5DK5A 4J9KA 3VMFB 3WXJA 2AKWB 2ETJA 4CZLA 2BE2A 4DV5K 1OKJA 4HUGA 2XCPA 2DY1A 4RNOA 2CPXA 4JI1F 3M6UA 4NLWA 5EWEA 5GAEI 2X1GA 4A8FA 4ELUA 1TFWA 3SEOA 1UP1A 3RB3A 1UA0A 2GIRA 2VBXA 4EIAA 2QL7B 1QLNA 2UV8A 2M7SA 4GO7X 2M3DA 3SCJE 3SNNA 4H0XB 4B3MJ 3M2RA 2HFZA 3FRZA 1RAFB 3NXZA 3EJMA 5J2QA 3NCIA 5M2PA 1GLDG 3NH1A 2VZ9A 2A5XA 1RLCL 4DUYK 4OZ2A 4HHHA 3DLEB 1BLUA 5IT4A 3BPSP 4DUZF 4CJRA 1SQKA 3DWLA 3E9OA 4BR9A 4O4GB 1R8PA 2UU9K 2GZOA 1H2UX 5JLFA 3MAAB 2ASPA 2WBMA 4JHDA 2DVIA 3H8YA 1VI7A 3J7AN 1W25A 1AT1B 4EU0A 5A76A 2D1KA 2WK4A 2G8HA 1D0EA 1OYDA 2V52B 3IP0A 2AYMA 1PSDA 4Y34A 2BKOA 4RNNA 2E6LA 3B54A 2IAJA 2BJ1A 3HT0A 3EGWB 3EPGA 3MXIA 1IKYA 2CGJA 3N01A 4X4RA 4AM7A 4O55A 4C0HA 4Z4HA 2D0BA 4K41A 2NRHA 1FTRA 2HGMA 2EFPA 1LW2B 3MM7B 2ZZMA 4XEIA 3FSXA 1YK9A 1RYSA 2Y1RI 2Y9HA 1KOOA 1K1SA 4N8OA 3JSBA 4Q5VA 3CO9A 2H65B 3DDIA 3FEZA 2PEBA 4ALZA 3NNCA 4I2QB 2BV3A 1Y5IB 4UZCA 4USUA 2QI2A 2CVIA 2HBYB 3GSIA 4FLYA 1N8RO 2HRUA 2HQIA 3QIDA 3T19A 1T9XA 2QJ3A 2XSJB 1AFJA 2DITA 5KFIA 2DEJA 3D2EB 3TABA 3R5BA 3M1FA 3MGJA 1CEZA 2OTLN 3W9HA 3OTOK 2WCXA 4XDCA 3TVYA 4YB5A 1IJJA 4CF9A 4IOCL 4RW8A 3PCOB 2WW8A 3SQOP 4RZRA 3BUZB 3V81A 4YORA 3KLVA 1BUPA 3C95A 1SIZA 3D0PA 4UUWA 2DBBA 1EZZB 1ROFA 4WFAL 4H8KA 4URGA 2MEWA 3UVJB 4R0JA 1J2VA 5F8MA 4IDKA 2WVEA 3WQTA 4BRMA 3N6NA 4MKVA 3RBEA 1D09B 1ICEB 4F4XA 5BN9A 2BE7D 3R5CA 1G3OA 3W62A 4CZGA 4HVJA 3NP5A 1Q4RA 4JNEA 2XMAA 2XLIA 2O01C 5FIIA 1G4CA 1Y11A 1BO5O 3VVTA 1I94F 3M9OB 2OPRA 2R8JA 3CM6A 4DCOB 2KJVA 2HHVA 5E33A 2FC9A 4DZ6A 4C9DA 4LBIA 5DQIA 3UD3P 4PCQA 3N5BA 1HA1A 3VEXA 5KPZA 2HBJA 2XWYA 5F8HA 1EARA 2J0SD 5JXSA 3ULHA 4CZMA 3ZZZA 3G8SA 1TELA 1XQSC 5AQWA 3T7ZA 4J90A 4CQ1A 2MQLA 1HR0K 1DRZA 1UZHA 5HVGA 5AQLA 3VTIA 2A6AA 4GKKF 3KJVA 3W64A 3O2IA 2E20A 5L39A 3OYDA 5CXTA 3ET6A 4KGKA 1HYSA 2DEIA 1RHQB 3PR4A 3P45B 3GB0A 4U95A 1JX4A 3HPHA 2MLZA 3CPWR 3WBZA 4CEFA 2AJ4A 4WP8A 4C3LA 3LZJA 5J2MA 3PKYA 1KVBA 4ES3A 2PN6A 3QT7A 4ZVEA 4Z4FA 4A8OA 4HH0A 3M32B 3BQ0A 1NM2A 3NDKA 4EBEA 4IJAA 4EAHD 2HK2A 4MK9A 2HQGA 2E1MC 4H5TA 4DLEA 3VERA 3MEKA 3THVA 3QEXA 1WF2A 4DFJA 4FYDA 4NLSA 4IR9A 2IBOA 3DRPB 4PQUA 1HBUB 1VBZA 4CIFA 4B9LA 3JQKA 3MTKA 4U67L 2ZWHA 5M2UA 2G4BA 2C2NA 1ELOA 4I1TA 5D4LA 3FBBA 3EZUA 5HN0A 4B1ZA 3U27A 3BEGB 2HB5A 1TKZA 2JGUA 2DHHA 2Z2LA 1GX5A 1XR7A 3V1OA 3OYIA 1Z1ZA 1VSFA 5GAEP 3P8BB 1VQSA 1C0FA 1TL7A 2CJYB 1U1PA 3CJ4A 4CFBA 2W8LA 1DQ8A 4CGDA 3AB4B 2MQQA 2GS8A 2WB4A 3QSIA 4NLVA 1S0OA 5AJ3F 4QU6A 1T6DA 1S6QB 3LOUA 5EX5A 5LOQA 4DN9A 2EFVA 2R7VA 1S57A 4LT6A 2DD8S 3IM8A 4OZNA 4E0DA 4DSKA 2EBEA 2A10A 2P9IA 5E3CA 2BM1A 1VQKN 2ZZNA 4L72B 4B9QA 4B1YB 3NLCA 2EG1A 3T41A 4TY8A 4NLBA 4HDHA 3C7NA 1RCOB 4IEIA 2ASJA 2GUPA 4HACA 3RSEB 3U7JA 1MU2B 4CJLA 1R0CB 1C2PA 1RDWX 2FLOA 4DWIA 3DC2A 4CLYA 5AZJA 4GW6A 4W92B 3GL1A 2EC2A 1Q7YO 2JZ5A 3CJ8A 3MPWA 2IJFA 4MIBA 3T9NA 5KGWA 1QD1A 1DTQA 4YFUA 4FWRA 4OIXA 2X1FA 5BR8K 2RD5C 3SAGA 3OTOF 4F9OA 3CCES 2OFHX 1FF2A 4FPBA 1V9OA 3HPOA 3VPZA 3NGZA 2KG0A 5FPDA 1G6BA 4DSJA 3DJCA 1F9FA 1CJTA 1RBOB 3EVMA 2AGQA 2J0XA 2Z2YB 3A5LC 2ZBIA 3CCJS 5CZVA 1ATRA 2OSQA 2P6SA 3GV8B 2I9SA 5KT7A 2MJNA 1KD1T 3HP9A 5EVZA 3VQEA 2P9CA 2P9PA 3CUNA 4ICLA 1TKDA 1F9EB 1PAEX 2IRXA 5FD1A 1MNEA 3A8KA 5AQHA 4RNMA 2HHHK 4FCYA 2F4FA 2HMIB 3TJAA 1O0PA 1X0FA 3BGUA 1Q18A 4BVOA 4HUEA 5BYQA 3G4SS 2WB1D 3DM2A 3DXKB 5DDPC 1G1XA 2ITMA 3AVGA 5DRKA 3UCUP 3SMPA 4F4WA 1A5VA 1RHJB 4LFBJ 4H5WA 1L3SA 4BC9A 3N4WA 1R89A 4ID5B 4K43A 1FHTA 2FB0A 3VEOA 3OS2A 2CPEA 1VOMA 3UD4P 1U1MA 2FLLA 1BWFO 4DV0K 4DU1A 5AQYA 3R1LA 2OPQB 4ZLJA 3SAFA 2WVCA 4GKKK 4B3MK 3SFGA 2LQBA 1YTYA 3M6WA 3I33A 3DU6A 4UOGA 2CPYA 1NHUA 2Y1LB 3UR3C 2XMTA 3CCQN 4CDIA 1DFDA 4HLBA 1IJEB 2BR0A 3H4BA 3ETOA 3TWHA 5C0YA 3SV3A 4CLUA 4NEYA 2QXFA 1WC6A 4JI8F 3GV7B 2ZD1B 1U48A 3L4IA 4J7CA 2EC0A 3CJ0A 2QYCA 1U6FA 2F8HA 3GU0A 1T0TV 3QGGA 4ZVSB 4J9OA 2PA3A 1RBLA 3VF2A 3GSDA 2QSWA 3EEQA 3CT9A 4YNQA 4MLEA 1TL5A 4TVAB 1EQYA 3VQBA 4OYPA 4J9PA 2XZTB 4FJGA 1ZTWA 4AM6A 2R7OA 5HMZA 1PJ7A 3BP8A 1YZ6A 2H9ZA 1VQ5N 2BJ7A 3TP2A 4DTOA 3ZFVA 2FVCA 3H1VX 2KXNB 1ULRA 4FKYA 5D0EA 1RDAA 3UDVA 2ILYA 1WF1A 1S1VA 5LY3A 3FBCA 3N9UC 4IO8A 4ICLB 1JLFA 2FHJD 3PG9A 1MLAA 4A8YA 1PKUA 1ZS6A 1VYAA 4EMDA 3BSAA 1TYQB 1B7FA 1HLUA 3THTA 2QIFA 4LR8A 1KLMB 2E5JA 1IG8A 4QAGA 5BR9A 2O8EA 4DI6A 2IS3A 2VODA 4AFFA 4HCCA 3VEZA 3UN5A 4CNYA 1EXQA 1GLAG 2HF4A 2FQQB 3VR1A 4H5NA 3OTBA 1X7VA 1W7WA 5AFUA 4DV3K 1PO6A 2YTCA 5FDLA 4WU3A 1EQ0A 2FPHX 4CJVA 2R3VA 3EDQB 4OJ1A 3R6MA 2LDYA 5F8JA 3W0LA 1LCUA 3W2VA 3IGVA 4RLEA 2QC3A 4NASA 3LH2S 5I3QA 4B3OA 4ID8A 4K50A 3D6MB 1SKRA 1G7CB 2NRXA 5B0DA 4BC5A 1K1QA 3QZ7A 4CEDA 3D68A 5CYMA 4NYPA 4N5SA 4LBPA 3CDWA 3HYFA 1KAZA 3TZXA 4JOUA 1XNQJ 1QQMA 3G10A 4L3QA 1X5TA 2BA9A 3AO2A 2P9IB 4NCBA 2VKRA 2BQRA 2J7WA 4DV5F 2CPZA 1FWKA 1JLCA 3JS9A 3F9KA 2CJ9A 3V4IA 1T9UA 3CJRA 4JI1K 3RGIA 2FLPA 2FZKB 2F8MA 3W2VB 2MYFA 3E2EA 3ENOA 4H03B 5IM0A 2LMIA 4UUXA 2KM8B 1SKUB 2HHTA 4ISFA 1WDTA 2ATCB 4EYIB 2XGQA 4KYZA 5KQ8A 3CQXA 4ZTFA 2DHGA 3AAWB 2HG4A 3H45C 1VQ8N 1ACMB 2B9EA 4AQYJ 3OLBA 4DPUA 1YJ7A 3L2WA 1FKPA 4UOFA 3S1TA 1LK7A 3ENVA 2BYCA 3THPA 3U9ZA 3BGOP 4CK2A 3TO8A 3ZSRA 1HI0P 5CHIA 2WFBA 3MMCA 3EWGA 5B7WA 2UU9F 5C42B 2ACMA 3ILLA 3BQ1A 3JXOA 4CJTA 1KRPA 4N7TA 1NK9A 2YNIA 2NUUG 2YKAA 3QINA 3TUIC 4I6WA 1KAXA 2HHXA 3WX8A 3A8EA 3A0IX 3KKSA 3GR0A 4B3SK 2LXFA 5G0RA 3SMSA 3KK1A 1VQMN 3BGFA 1RB0A 3VAJA 4BRGA 4DV0F 3ILJA 3PFOA 2J6SA 2ZHAA 5AQRA 2CG8A 2Q79A 1NKCA 1R8AA 1KBRA 2IPOB 2HBLA 4J9VA 2R7TA 4LFCF 4X64F 4U8YA 2X1AA 1FEEA 5JVGL 3M3ZA 3DYAA 2E1ZA 4TKTA 3KJVB 4NLUA 4WPAA 1N5SA 1H73A 4M63C 3HVAA 2GA7A 1LNQA 3Q7CA 4HL9A 2Z1GA 5M1FA 3V1RA 5L9XA 2RUSA 2P5OA 2QWOA 5E2QA 2W7OA 4IO9Q 4ISGA 3SXLA 4WU2A 2XS5A 1JLCB 4C48A 2XO7A 1SAZA 3T9ZA 1VRUA 1XHXA 2J6TA 3HD1A 2RDJA 4AUKA 2UXBF 5JVHQ 1U2FA 3B82A 2UVRA 1KQSM 2WC9A 1FESA 2XWXA 3LPUA 2KU7A 1GEHA 2B56A 4DV6J 1BY9A 3L3UA 2EFNA 3RB6A 2W4DA 2ZH1A 4IEEA 1CS4B 4KREA 4CJPA 3EKSA 3J7Z5 4ZCKA 2KO1A 3A3OB 1Y64A 1I51B 3DGPB 4USJC 3VQ8A 3KLIA 3MEEA 3TA2A 3GG4A 1REGX 3R7BB 1EHWA 3IR5B 2GC8A 4YOWA 4L6V3 2D3OR 3PJWA 2YKQA 1FW6A 4B3RK 3RRGA 2HMPA 5MLCQ 2CQBA 5HMWA 3NS6A 2IDLA 4AXIA 1RCHA 1BOTO 3VQQA 4BRLA 2FC8A 5CD4A 4FJKA 3LP0A 4LSZB 1HNZF 4ZOSA 2VD3A 4LH4A 2R42A 3CF5L 3S9HA 1SIWB 1ZZNA 3CMEN 1KS2A 3E01B 1FXDA 1RTDB 2KHOA 2MY8A 4JYAJ 3RG6A 1J9AA 2VBZA 1TYQA 4NWBA 2PMZD 1OO0B 5FJ4A 2LU2A 4CERA 3PYDA 1HKBA 5DDRC 3MM5A 2NXCA 3L09A 5GMDA 4CO0A 3VVUA 4FJMA 2GAGC 2VUGA 1JXLA 1KSPA 3L2RA 1YWXA 2HS3A 3ZTSA 1S12A 2HHUA 2HLUA 3CD7A 3ZZTA 3AA3A 4CJSA 4I6AA 5A8RA 1GNKA 4Q43A 3MF5A 3TJ8A 4FKXA 3JSRA 1DJ0A 3PW5A 2GQQA 3TAMB 4WWSA 4CO3A 1I6JA 4GVBA 2Z0GA 4KB1A 4DDFA 3TRGA 2YNHB 4DPOA 1KAYA 4DCPB 2JC0A 4NLGA 4JP8A 2UUAF 3CC4N 3BV8A 5A8KA 2E5GA 4QJVA 2ROEA 2UXDJ 4YOYA 3OFFA 1CJVA 5KG7A 2XULA 4Y3CA 3I4PA 3L9ZA 2R8HA 3EYZA 2KVIA 2DNZA 2B4OA 1FJGF 4B1UB 2R7QA 1TUYA 4LFCJ 3ZETA 4CH0S 4DR4F 2P9GA 4NX9A 3KK3B 1JJHA 2V2VA 4B1VA 1HI1A 1JQGA 4CJ4A 5KFZA 2P9KA 2AJFE 1I39A 3NMAA 2VGMA 3H1QA 5K5MA 4WTOB 1TAQA 4NLOA 3HSCA 4A59A 2OD6A 4RW9A 2IBKA 3RWUA 2Y0BB 2CNOB 3MCNA 1IBLJ 3ZCMA 1ITPA 2EKYA 4Y2AA 5F41A 1ZPWX 1KQGB 1S72N 1Q9YA 4DV1K 3G0ZA 4LIWA 3VGLA 4OZJA 3CC2S 4F67A 1PYOB 2NZ4A 2L9WA 3RMDA 5M1NA 4DL3A 1JLFB 2PMWA 5HANA 1JLGB 4IDHA 3TNVA 3TPQA 4CGFA 4OLPA 5ETQA 1SL0A 1Q81T 4CHOA 2FTRA 1XNRK 4ILHA 3H08A 1ZETA 5DG7A 2Q3SA 2XB2D 2AHOB 4JKDA 1C4CA 3LPEA 4MFBA 2QZ8A 2MSSA 5KT6A 2CQGA 3NVKA 4WE1A 1AA1B 4B9MA 3PXGa 1FKOA 1J6ZA 2O8CB 4DR2F 2ZM6K 5JS2A 5FPNA 2FVRA 2FDNA 3JQJA 4ED3A 3BH7B 2M8DB 3V6JA 2FIUA 2QFJA 2Q1NA 1LFWA 2IVPA 4WFXA 3MEGB 3U1LA 4ZIWA 3SCKE 2XEXA 5H9EK 5IS2A 4CFAA 5C7PA 2OYQA 2WTUA 3QEPA 2IA0A 4FF4A 4KC5A 1TMJA 3WX4A 3NL0A 4LVOP 2E7WA 2POKA 4X4UA 3NOCA 4J9MA 3CG7A 3I96A 4NL5A 1WNEA 4DV3J 4CHNA 2QTWA 1DLOB 3K89A 4LR9A 3OBIA 3BBCA 2VB6A 2F9WA 4PG6A 3IWXA 2G9OA 3BSOA 2IDOA 2VDIA 4ZJOA 3N0VA 1X4DA 3C6TA 2OA8A 3MR6A 3OYBA 5KFNA 4R25A 1YSJA 4ZVPB 3HVRA 2DO4A 4JV5J 1GMUA 3D7EO 3W3DA 2NRTA 3KWGA 5KFTA 4AHTA 3AVIA 4EK2A 3F5TA 2RNEA 5HL7L 4FK4A 3UFCX 4GVEA 5B0CA 3J80Y 1KXPA 2KFYA 3CDEA 2HHHF 4RW6A 4M3UA 1S7IA 2X1BA 2YNGB 3SIPB 3SUQA 2D4WA 4JI3F 4OYOA 4DOZA 2ASYA 4IOBA 1FWLA 4DR7F 2AJ0A 3JXUA 2K7JA 2HWIA 2HW3A 4UQGA 3BZKA 3MPDA 1X3MA 1IV0A 4C3MA 2YWFA 4JV0A 4LF6K 2UXBJ 2FJXA 2BANB 4O3PA 1VQ9S 2FJVA 3GFZA 3VA3A 2JRSA 4KR0B 1S79A 1IQTA 2VG6A 1KN6A 4EO8A 2V5HG 4FSVA 4DL2A 4Y1CA 3UDEA 4HHTA 3K5OA 3HSGA 5AQQA 4CD3A 3KLHA 3MMVA 3O08A 3MN7A 1X60A 2M9KA 4E98A 3IR6B 2O8FA 4IRKA 1TL3B 4AHUA 4K2XA 3E9LA 1VK0A 5C12A 3LGMA 4HI2A 4ILRA 3RMCA 2JHEA 1VQ7S 2BW7A 3ULEB 5KG1A 1JKHB 3KTQA 4X4NA 3ZSZA 2W25A 5J1EB 3QPIA 2Z57B 3Q0AA 2E2OA 4K5RA 2VL1A 4JI8K 3ENQA 4IQXA 3CF5Q 2JLEA 4W98A 3WEEB 1OVQA 1K6YA 4LF8J 3DAWA 1FCAA 3VZHA 4AL6A 5CE3A 1KKHA 1E3MA 1LK5A 5HP1B 1FTCA 1TK0A 3OSNA 2HPUA 4ZPBA 5B0BA 3AJ2A 1K73O 2CAJA 2YHBA 2CQHA 3AAQA 4DR4J 1IBMJ 2PI4A 2FC0A 2MKIA 2E1PA 2UYTA 2D9OA 5KFDA 4WIIA 1IUJA 2IYIA 4IOAL 1XWLA 3EE8A 4JBCA 3TA0A 4DR6K 5DQHA 2YQ0A 3D6HB 1KFSA 3NH0A 4ETXA 1H1VA 2Z1HA 3U4LA 3RAMA 2KT2A 3IKMA 3QEVA 4F3MA 1RFQA 4JK9A 1NBWA 3O1LA 3W5YA 1ZZFA 1XQIA 3SPYA 4DSLA 3DLGA 1QDUB 4NXMK 1NMDA 3ZNJ1 2HWHA 1RT7B 2QA4G 1J27A 4CIOA 1GOBA 1WWHA 4LVNP 1RWNB 4R8UA 2JSXA 3V6KA 3MD1A 1N88A 2E9RX 2DXDA 1WBDA 2PGCA 4CBWA 2K2PA 3PUFA 5BPLA 2X7IA 1GTEA 4A8MP 3CJAA 3D1OA 2YNFA 1L3KA 3QIPA 3MCPA 1IO2A 2DNGA 3BBFA 5KFMA 4DR2J 1DQAA 2VFSA 3DRRA 3FZ2A 4K4YA 2DR9A 2DH8A 1RLDA 3KMQA 5FROA 4F4AA 1RACB 4DF4A 3GIKA 2MGZA 1ZBFA 4PXCA 4Q8FA 1S6OA 4BDZA 3I0RA 2CGKA 2HK3A 3Q8VA 3BBBA 1QHAA 1Y00A 5CZXA 4NZ7A 1UJ6A 2HMIA 1NMEB 4O0NA 4X4QA 3NGSA 3SJHA 3BF4A 1JXVA 2W7PA 1N5YB 2YPYA 1WTBA 3HLUA 3FFKB 2YKMA 2M2BA 2NLWA 2ZGYA 3JAMY 4MT1A 4LFAJ 1PBUA 3W60A 4RUAA 2IRUA 2W6KA 2BXJA 3MR2A 2QA2A 3HT3A 4E7HA 1CC7A 2E29A 2NYIA 3CCTA 1HNIA 4PKGA 1RT2A 4OPAA 2RQMA 4P72A 3PJ9A 3MTJA 4IR1A 2V2ZA 4JI6F 3NY0A 3V1QA 3M8ZA 1X5SA 4DL0C 4RG8A 1X31C 1YJNS 3CCVN 1S9FA 4M94A 3R9LA 1J5EK 2FBVA 1IKXB 4CP5A 3ZT0A 4A8QA 2R2SA 1NK7A 4OLOA 1NPRA 3UN3A 1VFJA 2HGNA 2CQCA 3I5CA 4ZN3A 4E1MA 4YOTA 4OGCA 3T6JA 2V6AA 4JI3K 2RT3A 4KHQA 3C19A 2I5JB 4JKFA 2ZH2A 5JMNA 2KZZA 1N5QA 3VF0B 3SDEB 4LF6F 4ZPWR 1S0NA 1TUGB 3G2XA 3H46O 5HATA 5JLHA 4ZVUB 4AQYF 2Y1IA 2MZRA 3RVCA 5A2QY 2HURA 4BQZA 1VRQC 2NUBA 5AQNA 5AQOA 4FDFA 4DSIA 5FRNA 2UXDK 4HTIA 2HFUA 3HZGA 3DOLB 3CCSS 3EO3A 2MKKA 1BHNA 1SV5B 1HQUB 2MQMA 1U6ZA 2LEAA 1BIZA 2FJBB 1HW9A 3PFEA 2N7YA 2MJUA 3BYRA 1N36K 2YKNB 4LFCK 3WQUA 3MEDB 3G6ES 3R1HA 4X64K 2D0CA 1VQPS 3SUOA 5J2QB 1WG1A 2YVSA 4IOXA 3T69A 1VK3A 4OX9K 4NI2B 1HJRA 1KCFA 3J7YP 3I87A 4QU7A 2XNQA 2N3LA 4WFZA 1B64A 1YBUA 3L7PA 5J1NA 4DU7A 3DLLQ 3VA0A 3SBTA 2YBVA 2ZBPA 4ZP7A 3DRRB 1Q86O 3T1HK 3HX9A 4M5JA 2DGOA 2AIRB 1N6QA 1CULA 1NLKL 2QLJB 2BABA 2MKHA 4WXWA 1ZYQA 3W9JA 2HVHA 4CHPA 3GG1A 1KWMA 2CNNB 2GEMA 3W2WA 2DR5A 2UUBK 3J81Y 1GFWB 1EB0A 4P2FA 5GADI 4LRAA 3NS7B 2BJ8A 2QT7A 3LGHA 4FO0A 2CNKB 1FDBA 3ZTRA 2AP6A 3ENAA 3NRBA 3FSIA 2OI2A 1B7YB 1YAGA 1IKXA 2HS0A 3MURP 1SL1A 2MZTA 3KVGA 1RSCA 4ZA1A 2I1RA 2K7KA 2A1BA 3A8JA 4DUYJ 1PC5A 2IMWP 4CRJA 1VISA 2LQ9A 1HWKA 2VQFK 2R8KA 5AQGA 2F4VJ 4NXMF 1F6TA 1VQ5S 2OIHA 4DPTA 1RAEB 3LP3A 5C2FA 2OEMA 3OXLA 4K8ZA 3CCSN 4F3TA 3AA9A 4Q7AA 5L1JA 1H72C 1FJ7A 1BQMA 1RDBA 1RZMA 2GELA 4WZMA 5KFVA 3VTHA 3CYMA 1UAXA 1Y5NB 2FJEB 3K2PA 4N47A 5GIPA 4M3TA 3AXKA 2AD9A 5KOWA 4H0TB 2BJ9A 3ZC4A 4WE1B 5ETPA 1K8AO 3PTWA 2YWGA 2G0CA 2XMWA 1ASVA 2F1FA 5HAOA 4CLLA 1WF0A 2VG7A 2XS7A 2W01A 1H7WA 4P74A 1B3TA 2PMHA 2MHNA 2VWJA 5IT9O 5EX3A 2DR6A 4M8LA 2ROPA 4DR5K 1TK5A 2OPPB 1S9EB 4KHYA 1N6QB 4FLTA 3Q83A 1RBSA 3C14B 5F8GA 4BRAA 1T02A 3N79A 4ISEA 3NF8A 3L6QA 4ZDNA 2CADA 3DM2B 2D0AA 5AQZA 2G1HA 2I6WA 5J2PB 3S3OA 4YDXA 5BYRA 1KHWA 4MTPA 1FVSA 2NYHA 3SQGB 3G71S 5H9FK 3A8IA 3HRGA 4LF7F 2PT0A 4CEQA 1VBXA 5T7LA 1R8HA 4DCHA 4F4KA 2CA9A 5HBMB 5IC4B 3LPYA 2HLTA 3VHQA 2UUAJ 1R27B 4QR1A 1RT6B 3O1WA 2QSFA 2DPNA 3G9CA 3ZX2A 3F44A 1RHKB 3CJQA 3CQ8A 2L08A 4A62A 3SFUA 2QA4S 1F21A 4BRHA 3CI5A 5H1SQ 1XC3A 3CMAN 1KP6A 2D3ZA 4EFHA 4ES2A 5ADZA 2NXEA 3B8AX 2F9TA 1GMWA 4G1QA 4TN2A 2EW9A 3KLFA 2HFSA 2W40A 1Q7YT 3C6TB 2NPIA 4ZVFA 4FJIA 1WKLA 4QOZB 3QBWA 3CCQS 3NCRA 3WDOA 2FSKA 3NCQA 3AGKA 3M6VA 1CZBA 2DNLA 4PKDB 3ZZ0A 3MR3A 2CPHA 3T5LA 2DR7A 4USHA 3F9MA 2F3JA 4FYVB 3IXQA 4IUFA 2ADCA 1N36F 1T94A 3GFXA 2AW0A 1B0TA 4DL7A 2YCHA 5KFGA 2P9NA 1NGEA 5DJBA 1XMQJ 3WZ0A 2NS1B 5L9NA 5KFJA 1CQMA 2HNDA 2FHOB 2VFVA 4BE2A 1FXXA 4HT7A 4C8NA 2DHAA 3LP0B 3GPAA 3KLHB 2VFRA 4BCAA 2ZFHA 4KPCA 4ILMA 1W9HA 4L76A 4IFEA 3QQCD 5DDQC 1O1WA 3H2VE 4ZITA 4CZCA 1KVIA 2VG6B 3T1HF 4NXMJ 2F4VF 2V69A 4I64A 4B08A 3PJXA 4EWTA 2DNKA 4AH9A 2H4WB 2LVWA 2MMYA 2NPFA 2DJWA 3JYTA 1RHUB 2Q97A 2VHGA 3IFEA 1VQOS 3MPVA 1FRMA 1RT4A 4DS5A 1MWYA 4G3IA 3T1YK 3CPEA 4I9QA 2L9DA 1NSKL 3AB2B 4XPCA 2JVRA 1SCJB 3CNQP 2E5IA 1EWQA 1T05B 2QEXN 3HTVA 1JCEA 3KNAA 4IH6A 1VQMS 1T44A 1YRTA 1I94J 1RTHB 4P75A 2LDIA 2X3GA 4M3WA 2ROGA 4RU2A 2YWEA 1ZOTA 3RW7A 1G2EA 1VQ4S 2QWPA 4CTAB 4CVNE 1C0MA 4P71A 2XSFA 3FCVA 3MM8B 1SJ1A 4Y0WA 4FWQA 2DFHA 2B5JA 4Q44A 3CFOA 5D77A 2DNHA 5A8WB 3TYTA 1NM1A 2LA4A 2MY7A 5CYJA 2KG1A 1Z25A 4LD0A 4OYWA 1QY7A 2CJQA 5KAKA 3W5XA 1NJZA 4M3RA 4H4KC 4MJKA 5EN1A 1VQ6N 3R5DA 2DHSA 1KR4A 4C3KA 1Y0HA 3V9XA 1YRUA 1URNA 4N56A 3MM9B 2W7AA 4HUFA 1A7GE 2MQOA 3O8WA 3VAKA 4MFBB 2P51A 4LRDA 1AB8A 3UNYA 3EVWA 1YF5L 3D9BA 1LWCB 1NK0A 4XIUA 4XH1A 1MW7A 5HP1A 1C1AA 4K0KJ 1P8ZA 2V2QA 1PAUB 5JJBA 4QW8A 3D2FA 1ZBTA 3R7NB 4PXBA 1EWRA 3EGNA 4USWA 1SJFA 4LJMA 1HQEB 2PIIA 4LF7J 2CGLA 3E9PA 1Q95G 2WOMB 4XO0A 2ZBCA 2LA6A 4WCEL 2V51B 2OPSA 2RRBA 4E8UA 5C15A 3VOVA 1H6KX 2ZGZA 2F96A 3KG0A 1FRHA 3GJTB 1VRTB 2DXEA 4WKRA 3SYZA 1K9MO 1RTIB 1WG5A 4RUCA 3N6MA 5A2QU 4F2SA 4JS4A 4CLWA 4IOCQ 2E5LF 3OTEA 3AVLA 2R4FA 1XC9A 2PD1A 1S1VB 2UV8G 4CLSA 4ECZA 4KKOB 1RCXB 3OXGA 4DX8H 1WKKA 3DOKA 1SJQA 4DV2J 1N5TA 2LKZA 1VLYA 3FQKA 1N4LA 3LZIA 1E6YB 4B9UA 4MQ3A 4ER8A 4PG7A 2MZJA 3DFEA 4V19J 4ANEA 2J8AA 1XMBA 5KG6A 5EOYA 4OI2A 2ZJPL 3UKRB 1HBOA 1P90A 4Q2MA 2BJEA 3PR5B 2O67A 3PYGA 1NSPA 1ZBUA 4DFKA 3M8PB 3DDNA 3G96A 3NNAA 4FVUA 3NAEA 5D0GA 4CW7B 3US5A 1VSJA 3FCHA 2FSNA 3L4BC 1NK6A 3AVFA 1WOOA 2QA1A 2GV9A 1O5JA 1D8ZA 5J2NB 1J5EJ 1TGOA 4B8AB 2C2KB 1SL2A 4DU8A 4M5LA 3ZETB 1SZ2A 5IWAF 3IBFB 1SPBP 4KIAA 3AVMA 4F0MA 2BDPA 2J6UA 1Q1KA 1P27B 2Q6CA 3HHLB 3MMBA 1Q8LA 4CNZA 4AF1A 1RT2B 2F4VK 2ALZA 3OYHA 4Z0UA 1TK8A 4DU3A 1BCOA 3FEXB 3CCUS 3BM7A 1DBDA 4G6VB 2GHVC 3QEWA 4FWKA 5KFRA 5BR8F 3GMGA 2ZJQL 1N32F 4OV6A 3UWTA 1C0UB 4LRCA 2YNHA 3P5TL 2DT9A 3CSKA 2ALYB 5HLFA 4NMXA 5CCLA 2BRKA 2ZH4A 3OFEA 2EKNA 3THXB 4PXEA 4BWMA 2KW4A 1JJCB 4DR3J 2I0XA 1CVJA 3I0RB 1CXUA 1OH8A 4K4VA 3X1LB 2YNIB 2ABYA 1U45A 2XY7A 3LALA 4DJBA 4AD6A 4CBUA 4MYUA 1T11A 4CJQA 3R27A 3QJJA 3MM5B 1PILA 4LRBA 2RRAA 2XY6A 4KV8B 2R8IA 1U09A 4NCAA 3SJJA 2YNFB 3SCIE 3GP9A 1P8GA 3CULA 1XNQK 1AXQA 1FDDA 4RWXA 4YHHK 4LF5F 3AVCA 5BRDA 3P5BP 1UVKA 3THYB 1JXEA 1WN7A 3RJMB 4OHXA 5ETLA 4CH7A 2A2DA 3NGRA 4FVMA 2VPWB 2OD4A 5LSLA 5AJ3J 3QYYA 2CQ4A 4Y1DA 2UXDF 3AVJA 1TFYA 2FBYA 3D1QA 2AP1A 4C11A 1RWOB 2VDHA 3VQDA 3KOAA 1U6BA 1MROA 4KAZA 4LF8K 4LSNA 4U7UK 3NWGA 4TYBA 5MLCV 5KFQA 2DRAA 2UZAA 1UKUA 2IGIA 5LSOA 3RRHA 3KG1A 2OHDA 1VAZA 4W5RA 3SZ2A 3BYPA 4M41A 1UEUA 3PIPL 4RX6A 2ZDOA 3T5HA 4FOEA 1LKZA 4AILC 3H0PA 5E3PA 1TU0B 4QWAA 1T03B 5ETSA 1ZBIA 1NKEA 1R8CA 3NBPB 4RWWA 1HR0J 2YH0A 2HIQA 3PHEA 4YP3A 3F0NA 4B3SJ 4QPXA 1SJ4P 3J7YU 5KFUA 3QEIA 4DUTA 4KGMA 4D3GA 3CC7S 4A46A 4MMOA 3VGVA 4DQQA 4TLRA 5HRRA 2FD2A 5GAGP 3W63A 2N7CA 1S1WB 3FCWA 4KGXB 1TL3A 2NREA 4YOUA 4A57A 1HNXF 3RBZA 2IMOA 2XRIA 4ZCMA 2RS8A 1Q7LB 1H2TZ 1WHXA 2CPDA 5B08A 2P9UA 1NH7A 4IH5A 1IVZA 1NGCA 3HL8A 5BPNA 4JI0F 4CJUA 2DY4A 3WT0A 2CG4A 5HROA 2NRZA 4GVLA 4C8MA 4FWSA 3KHHA 4YOVA 2Q2RA 3K5LA 4G1IA 1P9YA 2BH1A 1B70B 5HRNA 4QYZK 1S4EA 3MOJB 2HAIA 2QKKA 3K2YA 3KJNB 4H0YB 4J9RA 1UA1A 3KZBA 3OSPA 4OZ5A 2F65A 5CHCB 4Z37A 4QWDA 5HVFA 4J9NA 4NA2A 3EXYA 3IMQJ 4B3TF 4BR4A 2UUCJ 1C6VA 1VLOA 2OFGX 4KAIA 2N3OA 1WUAA 3CC7N 1X5PA 2YWHA 5B0FA 2DCLA 5GAEU 2VJUA 8RUCA 1BU6O 3VCDA 1VQ8S 4QIEA 3OJUA 4DR5F 1CG2A 5D0RA 1KVAA 4H0VB 3JTOA 2OLWA 1M1KT 4BS2A 1S48A 3KK3A 1CBKA 2K1RA 5AFUH 4KQZA 4EFAC 1OH5A 5E3RA 5BN8A 2V8VA 1SB6A 3QLHA 1RI7A 3LAMA 3ZZUA 5D8HB 2RE2A 2OPQA 3GWCA 2HWTA 4ZVRB 3DI6A 2MSTA 3CQYA 1NEEA 3EMTA 2AYEA 3J7A1 1BC6A 1KTVA 2K3KA 2AJ1A 4NZ0A 4GV9A 3PEHA 1RAAB 2JWNA 2XMVA 1YT3A 3CHWA 2E2NA 3D4JA 3MMJA 4QWEA 1EKEA 4FJ7A 4FS2A 3OW2M 5HL7Q 1V3RA 1S1TB 5GIOA 4HT5A 3OYFA 3OD2A 1V3ZA 4J8FA 4DMNA 2OSRA 3IAS9 4P7VA 3PKMA 4YDUA 5E0OA 1D8YA 1X3NA 3LP1A 5HROB 1NAQA 4TU8A 3TSPA 4OYZA 3HHLC 4F25A 3Q8PB 3PO5A 1D9DA 2YH1A 1JJ2M 3THWB 3E8OA 5J2MB 1YUWA 2HRYA 4AL7A 2ERRA 3TTCA 2NRVA 3D2EA 1KNZA 3EVOA 1AZSA 3ZT2A 3HOSA 3CCLN 3SI6A 4PG8A 2APOA 3HXMA 4DLGA 2NXUA 3W3SA 4KE5A 4WFNL 1KLNA 3O8MA 3PX0A 4CYUA 4BR5A 1WOPA 4KT0C 4EGLA 4JAXA 3MPUB 1HJOA 2VICA 4M3XA 3SDEA 4BC2A 1BQXA 1C0GA 4E7JA 2B6AA 4BRIA 5B0EA 5KG3A 4WQ4C 2DHXA 5E5NA 4A2BA 3D0HE 2R7YA 1GTHA 4IFVA 2A3JA 5DDOC 5D78A 2RF2A 5D6GA 2KVQE 4M5HA 1LXJA 3CGIA 2I8EA 2COLA 4JRQA 4G1QB 1NJXA 3RSEA 1YJUA 3Q2SC 3HK2A 1IQZA 4EP5A 2RDDA 3Q8SB 1ZBHA 1RJJA 1NGJA 3M1VA 3F2KA 3QESA 3GYNA 2IAJB 2KFZA 4ENOA 3SMZA 4DHVA 4S0MA 1BD6A 1VSMA 7FD1A 1F3VA 2QWQA 3NF7A 1LQ9A 2H51B 4CZKA 2GW8A 1K0VA 5IFMA 2W2MP 3VESA 1FD2A 3VQ6A 4RCHA 4AHCA 3BB5A 5EWGA 1QSLA 3HBTA 1E6YA 2C22A 3OYCA 2LSNA 4X62K 1HNWF 3HZ6A 3FKBA 1UJ4A 5I9EB 5KPRA 5DG9A 3V81B 5LSRA 1XIQA 3RU0A 1SJ3P 2W1BA 4CJ3A 2B5JB 2J9CA 4QIFA 3O9RA 3GJRB 2H5IB 1NGBA 3LF0A 3L8BA 4ZVHA 1OH7A 2B7CB 1SQEA 1IJFB 1VSKA 4P6QA 2IFXA 4X62J 2D69A 1FFWB 2GVDA 4L75A 5F9LA 3W1YC 2OPSB 3C14A 1ILYA 3BSNA 4M5NA 3L3VA 3EKUA 2DGVA 3C15B 2QWRA 2FF3B 1JXBA 2CJAA 2BJ3A 3CC4S 3JSMA 2I2YA 1DTQB 1MWMA 5JVHL 1MMNA 4CGHA 3TVKA 1ZBLA 2X3DA 1B99A 3WXIA 1WB9A 4FK0A 3BGRA 3SK3A 2V68A 3EM1A 5FPEA 1OY6A 4ELTA 1Y4ZB 1Y97A 3K0JA 3UQSA 2R8GA 2VKZG 4IKFA 2C28A 3OHBA 1I3AA 4M42A 4ED2A 2AEJA 4V19X 4ZJQA 2A2CA 3MR7A 1X4BA 4NLXA 1BA1A 1MSWD 3A12A 3NGKA 4E19A 2C2RA 3O1BA 3KWMA 2QLFB 2BX6A 3K0SA 4E7KA 3QT6A 2IVNA 3HHLA 1RDRA 1YHQN 4CBXA 4FL9A 1RBAA 3GBTA 3DI6B 3ILIA 4DMZA 3G82A 3EXCX 3MAAA 3QETA 4BGBA 2BVZA 3LDPA 4DXLA 2R7RA 4K4TA 3TAQA 3OUYB 2RQCA 2D41A 2CNLB 2FHKA 3ENBA 3VENA 4F2RA 1NNDA 2VPXB 5DM6Q 2OKQA 3OY9A 3CD0A 1YDLA 5LMUK 1WUUA 2MZQA 1X4EA 4DF8A 4CGJA 1RKIA 3ADAC 1MA9B 1IR0A 3HVTA 3WEEA 2H3GX 3O3GA 4DUYF 4DR6J 1HKCA 1SXLA 1XR5A 3JSYA 4NA1A 2X74A 1BGXT 3DOMA 3JS6A 4OPHA 1PCAA 4XH5A 2VPZB 1BWEA 5TKWA 2LEPA 2H1YA 1VC0A 1VGYA 1TL1A 2WONB 5CABA 4DQPA 3LPTA 4C4WA 3NKYA 2UUWA 4LF4J 4B3OB 2AYGA 4HTLA 3G8QA 3C16B 3HFVA 3V5RA 3W8GA 1IM4A 4UOCA 4USKA 5A0YA 3A8YA 3KLGA 2YXLA 3MM6B 4BLGA 1WHYA 4WP3A 4Z4IA 4DTMA 2D3O1 2U2FA 3HI0A 1XN9A 1XMQK 2DYAA 4A4JA 2MKYA 3ZEUA 5AT1B 3OR1A 4B17A 3J7ZO 3DHWC 1FKPB 2IM0A 4KH0B 1SV5A 1U8SA 3DOLA 1XNRF 4Z7YA 1GLLO 2PY5A 1RBVA 4N41A 1LEOA 1VSLA 1MWQA 3CM5A 2DRBA 3BY5A 3QFPA 5BRFA 5D3GA 1FDNA 1SKWA 2F8SA 4CLKA 4K8RA 2ZC3A 3K8VA 1C1CA 4PKIA 2GJFA 2J8SA 4CF0A 3NAIA 2VC0A 4ZP6A 2BMBA 1S0MA 3DLKB 1S97A 4CO4A 2A3ZA 4KFBA 3IRXB 4ECYA 3M8QA 2C2EA 4JI2J 2BRLA 4YB1P 5AQJA 5ELZA 1RDCA 1ZA1B 2QA4N 4XDDA 3GONA 4QZVB 3AARA 4C8KA 2VG5B 5IOLA 2A6MA 3M4XA 2H5JB 1JLEB 4Y00A 3L3CA 5ADXH 1T3OA 5KFHA 3AVAA 1HD1A 3QJPA 4ZCLA 4K4XA 3UI3A 5C10A 3MN6A 1F2GA 2FBTA 3M30A 3VQ9A 3A5OC 4JI3J 2NCKL 2GVZA 4ITSA 4LR7A 4QBUA 4W90B 2QYGA 1W2IA 2DO0A 4L8RB 2G2OA 3VAFA 4N8NA 5GADU 4TLQA 3UB5A 2ZUGA 1NUEA 3UPFA 4OYAA 5KG0A 1WORA 1HPZB 4LSLA 1DAXA 4RNFA 3ATVA 1C0TB 1WSRA 3QSYB 3BZQA 4IRCA 4QW9A 2A40A 3AO4A 4CZIA 4ECRA 5KG4A 2L3MA 1YTAA 3A1YG 2WSEC 4IG3B 2AEFA 3ISNC 4NLRA 3MDFA 1VCTA 2VV5A 3NMRA 3DCAA 3P96A 4NLQA 1OS5A 3KJFB 3EZOA 3KHRA 1RAOA 3LGNA 3VAMA 1J53A 2JX2A 2V8DA 1FRLA 2LCWA 3I6PA 3DDKA 2XCAA 5E84A 3ZSWA 3CTRA 4OX8A 3K59A 5IWAJ 3VF4A 3PW0A 2MPUA 2ZUAA 4MDBA 2K06A 1QVGM 1IR1A 1Z26A 1RAJA 2V4JA 2C2OB 3QAEA 4GKJJ 5KRTA 1KVKA 4GMKA 5DMRA 2W9AA 3HHDA 4ZMMA 1FNOA 4USIA 2M8HA 1ITGA 1SVDA 2J7UA 4LQ3A 5AQTA 2OAUA 4NCGA 4RU9A 3V9SA 3UCGA 3ZSQA 5BPMA 4J37A 3FMWA 3PDNA 4EO6A 3TJ9A 1U2VA 2W4CA 1Q5YA 4BC3A 4CJEA 3NCPA 1HNXK 4B9SA 3ZT1A 1FD8A 1SH3A 4ED4A 2YJEA 5DZ6A 5HRPA 4BR0A 4DTRA 2A18A 1OSDA 2ZE2B 1FX4A 1EQMA 1U1QA 3DLHA 2DTUA 4JKBA 4YDDB 1R8BA 2M52A 4JD2A 4KH1B 2KYXA 1PBAA 2PFFB 2B8PA 3HHEA 1UVJA 4FWOA 3EGVA 4B1XB 3JAMO 4DN0A 2V7YA 5DLFA 4FNIA 3ISZA 1WHWA 4K0KK 1QJHA 2CUYA 3DMJB 1XBWA 3BR8A 3H3OB 1S6QA 2KL8A 2ZM6J 3ILOA 1QAIA 4EBCA 2KB2A 5C24B 2G0JA 3CCWA 1YJ9N 1WSHA 4AL5A 1FRKA 3M2UA 4B3TK 5KFOA 3KHLA 1TMMA 1X1PA 3UD5A 3Q8UA 2XMMA 3IO1A 3CXCR 4IZ9A 1N54B 3M2VA 4O3QA 5CZ2A 3V6DA 1VIXA 3M2RB 4PL8A 3DRXA 4F50A 3D28A 3GR1A 4X84A 4WFNQ 2P6TA 2VQFJ 2Q6BA 1NPPA 3B4DA 2R9LA 1HMVA 1NGGA 1RNHA 1VS3A 3IR7B 3OYJA 4JD2B 1QZ6A 1R43A 2C42A 2O8DA 2JVOA 3U6FA 1H7XA 1FXRA 3LAKA 1VSDA 1RABB 4DX5A 4PABA 3PM9A 1DKGD 4IO1A 2VCPA 3HVTB 1WC5A 3M7VA 3HKZD 2R7SA 3NBPA 3TX0A 4EHUA 4G65A 4PWWA 2MXYA 1WG4A 4DG1B 2Q31A 1WEZA 3KLFB 3RMAA 1TVRA 4URSA 1QS4A 1NZAA 2MHEA 1OQ6A 3BO2A 2IIRA 1YI2S 1E4GT 2HNYB 3EPIA 4ED6A 3RBDA 1X0PA 4WYLA 4DR5J 4DS4A 2IA6A 1HQ2A 3DRYA 3V9ZA 5L1KA 3PX6A 1IXKA 3UNGC 5BXIA 1HYZA 4FLUA 1VR6A 1XI1A 4DTSA 3A4TA 3O5TB 2C3OA 3OTOJ 4ZPCA 4CEEA 1JJ4A 4IFYA 1K0TA 3HULA 5FLXU 3HJVA 6AT1B 3M6GA 3SQGA 5KFPA 1TKTB 4DSFA 1FK9B 1ZAXA 5HQMA 2XMUA 1KQSR 4DG1A 1S77D 2NSBA 4DFPA 3UE2A 4DV4K 4DV6F 1EP4B 4C7QA 1IG9A 2YI1A 4B8CA 5IT9U 8AT1B 4DHYA 3W2WB 2JLFA 3FRYA 3EICA 2YX4A 4PXDA 2DB1A 3M05A 2MDAA 1PJ5A 1VQKS 4KHUA 1WDDA 1FFSB 3CO0P 1UFLA 4L3KA 2U1AA 1HKGA 3WUHA 4O0IA 3L7UA 4RW4A 3AQPA 1UL3A 3TEGA 3F73A 2ZWOA 4Z94A 3MD3A 3D67A 5KFYA 3HSTB 1S9EA 4RWTA 4FWLA 1Q81O 5JUMA 1GLFO 1CJUA 4DPXA 1HPMA 3OXFA 4KO0A 3UVJA 4FJLA 4J9QA 3J8AA 3UDLA 5FLXO 1UWAA 4ZHRA 3W61A 2VG7B 5DGBA 3G86A 2GO9A 3Q8YA 3DNCA 3GIMA 3MECA 2YHWA 4FS1A 3ZT4A 1B0VA 1HLWA 4ZCIA 3RUBL 1W7AA 3TI0A 1APSA 2ASLA 1N33K 4O44B 1F1BB 2H3EB 2V94A 1W26A 2UP1A 1TUUA 3IDHA 2B4UA 1EETB 2IRYA 3V4IB 4C6AA 3HO1A 4OYMA 2HHSA 2IJRA 2HNDB 4YR2A 2JNJA 4CZEA 2P9NB 1GMWD 3N4PA 4YDUC 4Y2CA 4X65F 4NOHA 1NHVA 3D0IE 4ED8A 2ZJRL 3RR7A 3WXMB 5IT9Y 3C2PA 1N33J 4YB7A 5KGXA 1Q8BA 3TR8A 3CE8A 2NSCA 2MLYA 4U7CA 3NAHA 4KFBB 4ATNA 3W66A 3CJ5A 4RL1A 1RT3B 1X4AA 3OHAA 3MAHA 1EJ7L 1BI4A 3RAXA 2O8BB 2E1YA 4CIGA 3G4SN 1TKXA 3IAM9 3H42A 2OZMA 2PYJA 3MCAB 2VASA 3BN7A 2AX1A 2B6AB 5M1PA 3VQSA 4K0KF 2GMJA 2BW2A 1Y7PA 2XZDB 3OR2A 1FNMA 4U96A 2P2CB 5KT5A 4X66F 1S1XA 1X9WA 4NLYA 3CDAA 5AXKA 2L41A 3I8BA 1XEZA 1NNEA 2M0GB 2JLGA 1AZSB 1RWXB 1QVGR 4NI2A 4WK3A 2AU0A 2VF3A 2GIFA 4CJFA 1O13A 3A2FA 2V4JB 2P5GA 1IBLF 3PO4A 3FVYA 3UKUA 4QS8A 4CEOA 3WNHA 4A8WA 4WBFA 1SS6A 1N5YA 5A2QO 2DKOB 2J9EA 2VYPA 1E6VA 3FBFA 4PZVA 1NK5A 5HRSA 3QRPA 1U4BA 1JLEA 2MB0B 3EGZA 2AMCB 4YY3F 1HQUA 5KFKA 3BEXA 1DZ5A 1T9VA 5CZ1A 4KHMA 1PGZA 3FNNA 4JV5F 1BG3A 2LLZA 5BYSA 4NLPA 2IVMA 1IKWA 4RW4B 3OR2B 3P4UB 4DL4A 1PYSB 4IBNA 1L5UA 4K5SA 4FLWA 4YR3A 4JLHA 1KQKA 2O4IA 3D3CJ 2WUSA 4RBUA 1T8EA 2KRRA 5EDWA 2MKCA 2ILZA 3RTVA 2DNQA 2GIQA 2QWNA 2CPFA 4PWUA 3AV9A 4O5BA 4R8UB 4FZZA 3BKUA 4B1WB 3R2CJ 4DB3A 2YX6A 4FZXC 3QBXA 4BQLA 4QWBA 1RWUA 3OLAA 2G8IA 3MWTA 2O66A 2WSFC 3NGUA 3WC0A 3MXHP 3MPYA 5EWFA 3QNWB 1KVJA 4NCGB 4CYUB 3G82B 4C8YA 2OUGA 3BF3A 1LV5A 2UXCJ 4J2BA 2Q0UA 4ZN1A 3CMAS 4UOHA 2RQ4A 1SH2A 3IWNC 4X66J 1EAYC 1VQNN 3JAMU 4CK1A 4DV4F 3W5ZA 4JS5A 4RPFA 3GJSB 1KHVA 1Z2LA 1S5ZA 1XMQF 1VQON 3PW2A 3BKTA 4H5VA 1RWPB 1QSYA 4DR1F 1NDCA 3NE6A 4CFCA 2PEHA 1FKOB 1GX6A 4E2FB 5CD4H 2QK9A 4WK1A 2Q1LA 2KH9A 2HHQA 2Y1JA 3MM6A 1QE1A 3AD9C 4KGZB 4MH8A 3NF9A 1O51A 1NZ8A 2ZJPQ 1RADB 3H4DA 4QS9A 4K4SA 2W4PA 4V19S 1S4FA 2DNPA 1UTAA 5EXWA 4JV1A 3QICA 4FYWB 4JI4F 3IMXA 1WHVA 4OI6A 2RHQB 1LFPA 5E3AA 1X5OA 4FM0A 1CULB 3TWZA 3IWLA 2B4VA 3K5NA 5KFCA 1WSIA 3GIRA 1HWIA 3ETMA 2Q43A 4DV0J 3AQOA 3E01A 3H40