2RKIA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase (RT) p66
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 153
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rkiA05
1BQMB 5KFEA 3PX6A 3UQSA 2BRLA 3L2VA 3V1RA 4W5QA 4K4YA 4CJTA 4DTUA 3EYZA 1C0UB 4KREA 4DLEA 4CERA 3AVGA 3OHBA 4CHPA 1T8EA 1NJZA 3QGHA 4PUOB 2ZQBA 1BI4A 1D9FA 3T3FA 4ZVHA 4RW4B 1KCFA 4OGCA 4IRCA 2VA2A 3IG1B 4KRFA 1CLQA 4F4YA 3V81B 1SUQA 5DGAA 4K4VA 4RW6B 1QSYA 4TY8A 3NAEA 4WZQA 3AVKA 3HXMA 5J2NB 1TKDA 2B43A 4LQ3A 3OSNA 1HYZA 4Q44A 3QO9A 4M3ZA 1BL3A 3MECB 2B5JA 4IG3A 1C1AA 2IJNA 5K14A 4KAZA 3IRXB 2UUWA 5KFYA 4RNNA 3V1OA 4DL5A 5KG2A 2G8UA 5FRNA 2JEIA 4CJRA 2FVRA 3KLGB 4LH5A 1T7PA 4FW1A 1HQEA 2UUTA 3M8SA 4Y2AA 1JLCA 2Z1IA 3DM2B 4URQU 4TY9A 2PZSA 3HP9A 3OYEA 1KHVA 4F4WA 2G8FA 4WYWA 4B9VA 1QTMA 4H4MA 4ZVFA 1S1TA 3RR8A 4FK0A 4MIBA 2XO7A 2HHWA 3FSIA 1ZTTA 2AWZA 4IQXA 3VQ9A 4CE9A 1FK9A 4M95A 2DFHA 5KFPA 4FLXA 3KMQA 1HNIB 3AO4A 1ZTWA 3MR2A 3OYLA 3OHAA 4CIFA 4CJ4A 1RYRA 2F8EX 2YKNA 3L2UA 3PO5A 5DK5A 4YFUA 2F8TA 2JEGA 4Q8EA 2CKWA 4B8CA 3K59A 2WOMA 4DS5A 2P5OA 3TABA 3VQDA 3AVBA 4ZHRA 3HKWA 3AA3A 5J2MB 1R0AB 2OPQA 3ICLA 5CZ2A 3DOKA 1RBTA 4NCGA 3KLHA 2D7SA 1F21A 3GIMA 4G3IA 2JEFA 2KZZA 3E01A 2GIRA 4AHTA 3RWUA 5KFDA 3PW4A 2BANB 4TXSA 1ZBUA 4HYKA 2ATLA 3KHHA 2BQUA 2NUBA 2QXFA 3PX4A 3DLKA 1XHXA 2O5DA 1WAJA 2GC8A 3PHEA 2BQRA 2ILZA 2DPJA 4FJKA 2FJXA 1DLOA 1HYSA 3BSAA 3ZSYA 2EC0A 2BE2B 3UPFA 4H4OB 3M8RA 4F2RA 5JS1A 4ECTA 3OL6A 4KKOB 2A1SA 3P1GA 4F8RA 3QZ8A 3SI6A 4M3YA 4M42A 3RRHA 2E6LA 3K2PA 1BQNA 3EZUA 4H54A 1CXQA 4G1QB 3V9XA 4NLYA 3GV8B 2EHGA 4CJFA 1HPZB 1TGOA 2FLPA 1N6QA 4J9NA 4YR0A 3D0PA 3M8QB 4AILC 2HNDA 1NHUA 5C25B 4O0JA 5EWFA 3MEEA 1RNHA 1T03B 4AHVA 4F4ZA 1JXEA 2R8IA 1T05A 3AO2A 1S5JA 3L2RA 2XY8A 4QCLA 5KT7A 3DRPA 3IS9A 1N56A 2OZSA 3DRSB 3AVLA 2JC1A 4DFMA 1IKYB 3EY1A 1D1UA 4FS2A 5I3UA 1S1VA 2HB5A 4FJIA 2B6AA 4IDKB 2KW4A 4CGHA 1S10A 3AVJA 3ZSZA 4RW8B 1NHVA 1B9FA 1TKTA 4Q0BB 4HCBA 2V4RA 1QAIA 5F8LA 2AU0A 5DG9A 4J9LA 3LAMA 2HNZA 2QKKA 4MIAA 4Z4IA 3LP2A 4FJ8A 2HVHA 2XC9A 2W42A 4ECSA 1JLGA 1DTQA 2WB4A 4FJ5A 1L3VA 4WXWA 4CESA 3DLBA 3AA2A 5F8HA 1ZBHA 4IFVA 3Q8QB 3V9ZA 5FDLA 1BI4B 1RBUA 4J2EA 3PR4A 3NF9A 4K4XA 2QV6A 3T5HA 2IGIA 4FJXA 2YV0X 3N6LA 4FM1A 5KRSA 4OLAA 4NLDA 4Z0UA 3CJ5A 3SI8A 1SUQB 5DLGA 5CY4A 1K1QA 2CJQA 4KAIA 4TY8B 3AA4A 3BR9A 5DQHA 4J9QA 2B4JA 4MH8A 1KHWA 2IDOA 4K4WA 4M3WA 1C0MA 4FM0A 1D8YA 4FLZA 2VG6A 2OPPA 3QO9B 4IR9A 4ICLA 3VQEA 1HMVA 2B5JB 3H08A 4IG3B 3KKRA 4CFAA 1SH2A 3BSOA 1QSLA 4M3XA 2J6TA 5K14B 1EKEA 1JL1A 5KFQA 4NLRA 2AX0A 4FJHA 3RRGA 1U04A 1NJYA 4R0EA 4IRDA 3QYYA 4BDZA 1VRUA 3V9WA 1GX5A 3SUQA 4CEDA 4LY7A 2C28A 4Q45A 4RU9A 1HQEB 1TP7A 4JRPA 4ZPDA 5KFHA 4NCBA 1JLCB 1BISA 1KVBA 5EWEA 4LD0A 4J2BA 5KFKA 3C95A 4TN2A 3RAXA 4KB7A 4NLPA 1EXQA 3DDKA 5KGWA 3B6PA 3OJSA 4K4UA 5KT6A 1Q8IA 4H4MB 3KIOA 4CHYA 1S1TB 4W5TA 4CGGA 1C0TA 4ECVA 2AX1A 1FK9B 3P83D 1TK5A 1C1CA 3K58A 3PY8A 5KFNA 2W7OA 2E9RX 4DTNA 1C2PA 2AGQA 5HROA 4TLRA 4ED2A 2YKNB 3EPGA 1X9WA 3RAQA 1NK6A 3VQBA 3V6DA 3H4DA 4I9LA 3GV5B 1W9HA 3LZJA 2WOMB 5HRNA 1RILA 3ZSQA 3PW0A 3KMSA 1HQUA 1EP4A 5KFAA 4ZHRB 3V9UA 3OLBA 3O4NA 4NLSA 4OKJA 1RTHA 4F2SA 5KFSA 5KFRA 3ITHA 4Y1DA 3LPUA 2OPQB 5KFCA 2IS3A 4RW7A 3MEDA 3DOKB 4NCGB 2IJFA 3KLHB 4NLGA 3C6UA 3G0ZA 2C2RA 3E01B 2YNFA 3CJ2A 4WZMA 3ZSRA 4DQQA 4QPXA 4EBEA 2GIQA 1NKEA 3CJ0A 2VWJA 3DLKB 3V6HA 5KFOA 4KTZA 3P5JA 1T94A 1DLOB 3KNAA 4Z4FA 1HYSB 3LP3A 4QWCA 2FC0A 4YNQA 3ALYA 1Q9YA 2AQ4A 1RA6A 3QNNA 1XR5A 3LANA 4CF9A 2P5GA 3DI6A 4FBUA 5L1IA 1TK8A 1BQNB 3V6JA 4BACA 3RBEA 2FVCA 4J9KA 4YP3A 4U6PA 4EBDA 2X6NA 2P1JA 3BSCA 1B92A 4FJMA 1ZYQA 3K5LA 3O3FA 2XI3A 4CEBA 2OPRA 1N6QB 5KTQA 2HNDB 3KJVA 1S9GA 3TVKA 3MEEB 2R2SA 3SQ4A 1LWCA 2EX3A 2FJWA 4DSJA 4DG1A 1T05B 4WYLA 1UOCA 3DRPB 3IS9B 1JLAA 3HJFA 2FBVA 4BWMA 5DGBA 5I3UB 1S1VB 4DTOA 3PUFA 2B6AB 4FLUA 3TARA 4CHOA 5DG7A 3VA3A 4WE1A 2HHQA 1TKTB 2IBKA 3LP0A 2AJQA 4JLHA 4RG8A 4K8ZA 4F3OA 2ZD1A 3KHLA 2HNZB 1X9MA 2JC0A 2AGOA 3U6FA 3LP2B 3SPYA 3RB3A 3MF5A 3QZ7A 1JLGB 4RNMA 1RTDA 4K8XA 3M8PA 3O3GA 1DTQB 4RNFA 2PY5A 4RZRA 3S9HA 1NK4A 2IA6A 1UA1A 4IFVB 1OS5A 4KSEB 5FDLB 2DTUA 3IGVA 5FRMA 4ZVEA 4IKAA 5KFTA 2PYLA 3CJ4A 2UVWA 4NRUA 2FLLA 4CJPA 2ZKUA 2R8JA 3SYZA 1KLNA 1K1SA 1S1UA 3SQ1A 2D3UA 4AHRA 4QW8A 1HARA 4PY5A 4NLOA 3AVCA 3V1QA 3H5YA 2VG6B 2OPPB 4ICLB 1HMVB 4DMNA 3OYCA 4CEFA 1LW2A 5EWGA 4FLVA 5KG4A 1Z26A 3QGIA 3GQCA 2D3ZA 2WCXA 4FK4A 4E0DA 1DTTA 4Z4HA 3Q8RB 1VRUB 2XGPA 3VQSA 3OYAA 3ISNC 4ID1A 3BSNA 3KK1A 4JV1A 4GMJB 4CHZA 4R8UA 4NRTA 5JUMA 4TQSA 2HW3A 2IMWP 3OL9A 4ZMMA 4DQIA 4ED6A 2X74A 4EP4A 4CFCA 1C0TB 3GIJA 5F8NA 4K4SA 2GV9A 4DSIA 5J2PA 1HJRA 1RT5A 3CFPA 1C1CB 3NGZA 4IG0A 1IH7A 1SH3A 2W9AA 2FBYA 3H59A 3JSMA 4CGJA 5HLFA 4B08A 1S1WA 1D9DA 1RBVA 3CDUA 4Z4CA 4TYAA 3QEIA 5EDWA 3MR3A 5HROB 1QSSA 2G8HA 5C24A 1XR6A 3KLFA 4JRQA 3V6DB 4WFXA 1SL1A 2W8KA 4QAGA 3Q8PB 3LWLA 1HQUB 1EP4B 4YR3A 1TKZA 1RT1A 4DSEA 3V4IA 4NLWA 1RTHB 3ITHB 4RW7B 3MEDB 5HBMA 3G86A 3CWJA 1SKWA 4O3PA 1JX4A 3C6UB 3OYMA 5JXSA 3LP1A 4FJNA 1I39A 1IKXA 4MFBA 2YNFB 3BGRA 4ZPBA 4I7FA 4CHQA 3BREA 1ZETA 2WTFA 4CECA 3KK2A 3UDLA 1LW0A 1S0MA 1VRTA 3FQKA 3RTVA 2RF2A 3OS2A 4ELVA 4C8OA 3VQPA 1QQCA 1WSJA 3ZT4A 4Z4EA 1XHZA 4CJLA 4NLQA 1RBSA 2YNIA 3OLAA 2HMIA 4O0IA 2G8VA 3L2QA 3DI6B 4B9UA 4N56A 5KT4A 3T1AA 4EO8A 3PW7A 4FZZA 4FM2A 1S97A 1TK0A 3CO9A 2YNHA 3G6YA 3VQ6A 4O55A 4E89A 5CYMA 4W5RA 2I1RA 3SUNA 2OPRB 3QETA 4U7CA 2XY7A 2FBXA 1SKSA 3QGGA 2X6SA 3SUPA 3KJVB 1S9GB 1RTIA 1SV5A 1NK9A 1JLBA 1LWCB 1S1XA 4PWDA 4DG1B 4CFDA 2VG7A 4E19A 1JLAB 4KO0A 3OYKA 3AVNA 4LH4A 1U45A 3MFHA 1WSGA 3OYGA 4TQRA 3SNNA 1WAFA 3DLEA 3MXIA 1XWLA 4OKEA 1S48A 4DL3A 4KTQA 1FXXA 4WE1B 1CSJA 2HHVA 1J53A 2C2DA 3LP0B 5KRTA 4X2BA 4FK2A 1RBRA 2ZD1B 5KG5A 5KFZA 1KFSA 3KOAA 3ASMA 1BIZA 3HL8A 3GIKA 3MR6A 1MMLA 2IC3A 4FJLA 4BE2A 1GOBA 1RTDB 4B9TA 3M8PB 1MU2A 1KSPA 2AGPA 4DLGA 2LSNA 1Z4UA 4HHTA 3NGYA 4NCAA 3H4BA 2VA3A 1CZ9A 3I5BA 5KFLA 1J54A 2I5JA 1IKVA 2OH2A 5KG0A 1ASUA 5HP1A 3NH0A 4PA1A 4IH7A 3BDPA 2Y1JA 2UVRA 1S1UB 3L8BA 2G8IA 4NYZA 4F4XA 3PW2A 3K57A 4XO0A 3KD1E 1IG9A 4BDPA 4DS4A 1EETA 2BRKA 1I3AA 1LW2B 5L9XA 2XCPA 3ZT1A 5F9LA 5CZ1A 3KLEA 4E1MA 3L3VA 4DF8A 4WFYA 1SL2A 4KBIA 1JLQA 4IH6A 1DTTB 3N6MA 1A5VA 1QUVA 1VSMA 4FYDA 1TAUA 4IH5A 3TAFA 3G6VA 4DSKA 3I8DA 1LAVA 5DQIA 3T19A 3OYFA 3TAQA 3KK1B 4ZTFA 3DYAA 1YTAA 4BE0A 4R8UB 4YMEA 1HYVA 4OJRA 2QKBA 1IM4A 1X1PA 3TI0A 4KFBA 2DY4A 4LSNA 3RB0A 5J2PB 3ZSOA 4EZ6A 1RDRA 1RT5B 2HNYA 3LWMA 4IG0B 3VQ8A 3PV8A 1N48A 1RTJA 4CEOA 3JSMB 5HRSA 5HLFB 1S1WB 4FJ9A 3GIIA 4EYHB 1RDBA 5C24B 3KLFB 4HKQA 4AHSA 5KFBA 1JLFA 2OZMA 4RNHA 4CK2A 2HHTA 3K5OA 3UIQA 4DTJA 2JLEA 5J1EA 1RA7A 5DLFA 1TKZB 1NOYA 1WSIA 3HM9A 4B9MA 1RT1B 3V4IB 1VK0A 1X9SA 2YKMA 4NLUA 4KHQA 5HBMB 4KHSA 1GX6A 3SQ0A 1REVA 3LP1B 3VA0A 2O4GA 1IKXB 4MFBB 2HVIA 3BGRB 4QWEA 3ZSWA 4I7FB 4BDYA 4W5OA 3KK2B 1LW0B 1VRTB 4EP5A 4FLTA 4CGIA 2RF2B 1KTQA 2J6UA 3TQ1A 2FVPA 5EUHA 3I5AA 2FLNA 2WHOA 2IM1A 1RCHA 4M41A 3ZT2A 4H8KA 3I0SA 4JV2A 4OKKA 4FXDA 2YNIB 1RYSA 1RT2A 2HMIB 1ZBFA 3NMAA 4YR2A 2IOCA 3KK3A 3GILA 4YQWA 4J2AA 4R5PA 1XC9A 4IBNA 3HVWA 4J9PA 1RDAA 2YNHB 5CYMB 1L3SA 1WSHA 1G15A 3JYTA 2XHBA 3M9OB 1RTIB 1SV5B 4ECUA 4B9NA 2HWHA 1JLBB 1S1XB 4PWDB 4N76A 3WNEA 4DFJA 2VG7B 5F8GA 4KO0B 4O3RA 1KVCA 3DLEB 3ISND 2IAJA 4EZ9A 3SCXA 4CJUA 5KFVA 4QWDA 3HHKA 3PR5B 5F8JA 4CCHA 3ZT3A 3FRZA 4KHUA 4DTRA 3OS0A 3DRRA 2ASDA 1FKPA 2W9BA 1FKOA 3EZ5A 1MU2B 2V9WA 5E41A 3HVTA 2DFFA 2D41A 3ZT0A 1J5OA 1WNEA 2C2EA 1CXUA 5KGXA 4DTXA 1HNVA 1ASVA 4E7JA 2I5JB 1IKVB 2QK9A 4ID5A 1BIUA 5KFGA 2ASJA 4DTSA 4GVMA 1U4BA 5HP1B 4CEQA 3HYFA 3MAQA 5KFXA 2UVUA 4ED8A 4IFYA 2KQ2A 4URGA 3SUOA 4BE1A 2WRMA 4M3TA 1C1BA 2O4IA 4O4GA 1N4LA 4MKBA 3KLVA 3G10A 1JIHA 1R0AA 4Q8FA 4E1NA 4CJWA 4WFZA 3VQ7A 1U09A 4XPCA 3H5UA 1EETB 3CM6A 4CJEA 4E7LA 1TL3A 3DLGA 4M3UA 3KLEB 3SFGA 4CJSA 4MK8A 4IR1A 4DL7A 1N5YA 4RUCA 1QE1A 1JLQB 5F9NA 1WSFA 1BGXT 4FS1A 1XI1A 3QEWA 3IAYA 3D45A 1LV5A 4B9LA 3DYAB 4JV0A 3QIOA 3PX0A 1ASWA 3G6XA 2E9TA 4J2DA 3OYIA 4DTPA 3QINA 3K5NA 3NGDA 3H2LA 4FJ7A 2R8HA 3OYHA 1JLEA 3CM5A 4LSLA 4KFBB 1JL2A 4DL6A 4ELUA 3LZIA 2C22A 3F73A 2YNGA 4LSNB 1UA0A 2HNYB 2D5RA 2UVVA 4DWIA 1KFDA 1RTJB 1BHLA 3AV9A 3THVA 2KFNA 5DG8A 3U3YA 4ED3A 1KLMA 5F8MA 3IGNA 1NKBA 4RUAA 5KT5A 3RMBA 3CDWA 1L3TA 2HHXA 1JLFB 2XWYA 3ZSVA 2ATQA 3QEXA 2ZE2A 5J1EB 3H40A 1NK5A 3VN5A 4DQPA 5KG7A 2YKMB 1NJXA 1B9DA 5KI6A 4J9OA 3VQCA 4MK9A 1REVB 4KI4A 3OSPA 5JS2A 2X78A 1RDDA 2E6MA 4MQ3A 4J9MA 3PVXA 4WXOA 4N5SA 1C6VA 4DU4A 1SL0A 4M3RA 3QIPA 1S6QA 2YHBA 4FVMA 3DMJA 4JUZA 4QWBA 1WSEA 1S4FA 4CF1A 1A5WA 4RW9A 2VG5A 4KHMA 4HUEA 1LWEA 1TVRA 4K50A 4B3OA 3I0SB 4EEYA 2E9ZA 5C5JA 2BGGA 3HPOA 1RT6A 3AO3A 1RT2B 3QEPA 5EU7A 3WNGA 3KLIA 1KRPA 3KK3B 4OL8A 4E7KA 2Z1HA 4R5PB 3AVHA 1S9FA 4QWAA 1D5AA 3O4QA 2RPIA 3E51A 4ED7A 4EBCA 3T5LA 5HRPA 1NK7A 1RT3A 2OPSA 4DQRA 4CF2A 5KG6A 3N6NA 4EYIB 4NYNA 3JYTB 3SV3A 4OLBA 3VQ5A 4DFPA 1VSKA 3AVIA 3AO1A 2G8WA 3AVMA 2IAJB 2FBTA 4FZXC 3FFIA 3KTQA 3CIZA 5T7BA 2RN2A 1ZBLA 1UAXA 4M45A 3OJUA 3SQ2A 5L1JA 1GOCA 1QHTA 2FJVA 4TYBA 2FVSA 3BQ0A 1RT4A 3OY9A 3DRRB 3AA5X 1FKPB 2GBZA 5F8IA 2W9BB 1YT3A 1FKOB 2HHUA 4O3NA 3QERA 3HVTB 4KB0A 4O3OA 1W25A 1NNDA 4CFBA 4CJ5A 1J5OB 3TWHA 1HNVB 4FJJA 4O3QA 1VSFA 5DMRA 4ID5B 3HPHA 3C6TA 4KV8A 2W9CA 1WNSA 3NF7A 3OL8A 1S9EA 4IFYB 5J2QA 4HCCA 1JKHA 1L5UA 4M94A 1C1BB 1VSDA 4O4GB 1TV6A 1D0EA 3MEGA 3NE6A 2BR0A 4HTUA 3DOLA 2KTQA 4PQUA 4QW9A 1XR7A 1VSIA 3TAMA 1VSLA 1TL3B 3DLGB 2RDIA 4CJ3A 4I2QA 3QLHA 3OVNA 4UQGA 3RMCA 4ZP8A 5CYQA 1ZBIA 3NKYA 4C8MA 3V6KA 1N5YB 1SKRA 2KFZA 1GOAA 1QE1B 1RDCA 3T5KA 4F50A 4MK7A 4CEEA 4TSXA 1NK8A 3A2FA 3M9MB 1TKXA 1RAJA 3H98A 3NBPA 4CF0A 3ULDA 3MXJA 4O5BA 4HUFA 3F9KA 2WK4A 4ZTJA 2ILYA 5KFWA 3I0RA 1EX4A 4AHCA 4Q43A 3K5MA 4C8KA 1IKWA 1JLEB 3NFAA 5C42A 4DSFA 4NLTA 3FDSA 4LSLB 2V0NA 5KT2A 2YNGB 1JXLA 2DFEA 2XGQA 2RDJA 4CJQA 3TR8A 4DSLA 2R8KA 1TL1A 2FVQA 4ZPCA 4F4KA 4N47A 4CF8A 2WONA 5DQGA 2Q3SA 4FW2A 1KLMB 1S6PA 1Z25A 2G8KA 4NLVA 4KB1A 4I2PA 2D0BA 3HVAA 1BCOA 3OS1A 4E7HA 1SH0A 5KFFA 3PZPA 4J9RA 4IKFA 2ZE2B 4E3SA 1YTUA 3WNFA 1UWBA 3NAIA 5I42A 3IN5A 3TAGA 3S3MA 3KHGA 4EO6A 1ITGA 1JXBA 3LPTA 4N41A 2KZMA 3PJXA 4BWJA 3LAKA 1L3UA 3NH2A 4KHNA 4O44A 2XCAA 2GUIA 4HVJA 4GW6A 1LWFA 3QIPB 2R2RA 3EPIA 3MXMA 1S6QB 5D3GA 1T3NA 3DMJB 4DEZA 3MFIA 1NK0A 3S3NA 2Z1GA 4RW9B 2VG5B 5L1KA 3OYNA 1LWEB 4ECYA 1TVRB 4B3OB 2F96A 3SV4A 2BDPA 5KFJA 3PO4A 1RT6B 1U47A 4CJVA 2RKIA 4CGFA 3KLIB 2R2TA 4J9SA 1QAJA 2JGUA 3CQ8A 2PYJA 2OA8A 3AO5A 3SFUA 4XIUA 3QEVA 2JEJA 3QIDA 3BQ1A 3NGIA 1RT7A 1RT3B 3TANA 2OPSB 1BCMA 1NJWA 1YVFA 4Y3CA 2P51A 3RBDA 3V9SA 3OYDA 3U3GA 4NLXA 3FQLA 3S3OA 1TAQA 2A1RA 4I9QA 3RMAA 2ETJA 4OPKA 1BQMA 3OYBA 1Q9XA 4B8AB 1KVAA 3CJ3A 2D0AA 3HSTB 1C0UA 2J6SA 4MKAA 1VSJA 4FJGA 4DFKA 4K4TA 3PJWA 1HRHA 1S0NA 1VSEA 1CZBA 4PUOA 3FFIB 4KTWA 4RNOA 4ECZA 3PW5A 3RR7A 4RW4A 4B9SA 2HAIA 3GV7B 3IG1A 2HWIA 4ZP9A 3MR5A 3GYNA 4FBTA 2BQ3A 4KI6A 3V81A 5KFIA 3B6OA 1RT4B 4RW6A 4DL2A 2XY6A 4FZYA 3OL7A 5J2NA 3RMDA 3AVFA 4F3TA 4ZVGA 4DL4A 4CEAA 3AVAA 5T14A 3MECA 4O3SA 3RB6A 3C94A 4JS5A 4KHRA 4GC7A 1A5XA 3BQ2A 2ALZA 1U49A 3IRXA 2XI2A 4DTMA 3C6TB 4KV8B 2W9CB 4E7IA 4Y2CA 3KHRA 2E4LA 2Y1IA 1S9EB 5KG3A 3KD5E 3UR0A 5SZTA 1I6JA 5J2QB 3KLGA 1JKHB 4IRKA 3O3HA 1TV6B 3HT3A 3MEGB 5FROA 3QESA 3CG7A 3DOLB 3ZCMA 4PQUB 3DM2A 2W8LA 4CK3A 3TAMB 3SZ2A 2Z1JA 3L2WA 4I2QB 4ECQA 1U48A 3QLHB 3H5XA 4FLYA 5CYQB 4Y34A 4DQSA 3CFRA 1K6YA 5KT3A 4AHUA 3NAHA 3T5JA 2IC3B 4GC6A 3HVRA 2QE5A 1YVUA 3H5SA 5HRRA 4ECRA 4FLWA 1HNIA 4HUGA 2VWKA 1TKXB 2DPIA 4L8RB 3NH1A 3NBPB 1S49A 3D28A 3NDKA 3I0RB 1IO2A 3CYMA 2R7YA 3CVKA 3NF6A 1IKWB 5C42B 4OVLA 4KHYA 1Y97A 4ZP6A 2HHSA 2XY5A 5J2MA 4Y1CA 3HO1A 2IM2A 2OYQA 4ZP7A 4KE5A 1TL1B 2W7PA 3HPGA 5KFUA 4OPJA 4Z4GA 2WONB 3CFOA 3NF8A 1NKCA 4CEZA 2BANA 1S6PB 4FCYA 1LAWA 3MTKA 4URSA 4I2PB 1TQLA 4ED0A 2R2UA 1WLJA 4CIEA 1VSHA 2D0CA 5L1LA 3NCIA 3SJJA 1UWBB 4C8LA 1QS4A 3HP6A 2V4QA 4KHWA 1S0OA 3TAPA 3KKSA 5I42B 3VQQA 2ITGA 4NZ0A 2BE2A 3VQ4A 4CGDA 4H4OA 1O1WA 3DLHA 2ASLA 3ZSXA 4ZPAA 4KKOA 3LALA 4DU1A 3RB4A 4NYFA 4IOBA 3VQAA 4CIGA 2F8SA 4JS4A 5SWMA 4G1QA 3LDSA 4O44B 4C8NA 5KFMA 1LWFB 3OYJA 4Q5VA 5D3GB 4ECXA 4CK1A 4XPEA 1HPZA 4DF4A 2IM3A 1WN7A 5KG1A 4AH9A 4LQ9A 3BJYA 3M8QA 3CDEA 3SPZA 3I5CA 2R8GA 3DLRA 5C25A 4CJKA 4ELTA 2IM0A 1T03A 1J9AA 1NOZA 3HK2A 2XRIA 2RKIB 3DRSA 1W0HA 1IKYA 4OGEA 4ECWA 4IDKA 4RW8A 3WNHA 3L3UA 3TAEA 4DU3A 4ED1A 3M9NB 4CHNA 3NL0A 1RT7B 4Q0BA 3QNOA 2YHAA 4O4RA 3NHGA 3Q8SB 3D5MA 4KPYA 4QOZB 4W5NA 4K4ZA
chains in the Genus database with same CATH superfamily
1ILYA 2Y0SD 2FSNA 5KFEA 3W61A 3UQSA 3V1RA 1LQ9A 3Q86A 1KD1T 4DTUA 3CD6N 2CNLB 1M5OC 4DR4K 2LEPA 4DLEA 4JI6F 5K8NA 4CERA 2MQMA 3QGHA 1WDTA 1UTAA 1BI4A 3ULEA 2MKIA 1X4GA 2RIJA 2BW2A 4YDUC 2XMWA 4KRFA 4FPRA 3DLLL 5CHIA 1SUQA 1QSYA 4TY8A 3NAEA 4UW2A 4P74A 1LK7A 3R27A 1IBKK 4B3MJ 3QO9A 4NZ7A 5ADZA 3VF0B 3X3UA 3U9DA 4A57A 1BMQB 1RWNB 1HI8A 5KFYA 4UOGA 2HSTA 5KG2A 3NGSA 5FRNA 3MI7X 2JEIA 4CJRA 2KU7A 5D4OA 4LH5A 1PAUB 4ZN1A 3THYB 1Q81T 1HQEA 4Y2AA 3WC0A 4IO1A 4JI2K 4URQU 1KS2A 2J5AA 1RK8A 4TY9A 4CM2A 2VB6A 3J81Y 4HACB 2VASA 4F4WA 4B9VA 1QTMA 2HURA 4ZVFA 3V4MA 1V3RA 4MIBA 2XO7A 3FUYA 4BRCA 1VBYA 3CD5A 3SK3A 2RU3A 1WKJA 3PYEA 5EX0A 4FDFA 1VQ5S 1DEJA 4QS8A 4P2XA 5E3RA 2DY9A 3ENHA 3OHAA 4CJ4A 2BACA 2FJAB 2IRYA 1XMQF 1UETA 2AMCB 2F8EX 1BUXA 4DX6A 3BN7A 2ZBRA 1N8RT 2CKWA 3NY0A 2P2CB 5HJXA 5T7LA 2W01A 4B8CA 4P10A 4LF9J 3VQDA 4BG9A 3VF6A 3CQYA 1SI9A 3AA3A 2QG9B 2D7SA 5BRDA 1VFJA 2W4CA 3WQPA 4G3IA 2KZZA 3GSIA 3EKSA 1GTEA 2GIRA 3PW4A 3PIPL 2V4JB 2BANB 2MZQA 3U7JA 2I8EA 4U67L 3CGIA 3THWB 3SMPA 1HD0A 3ADAC 1XHXA 3ZZ0A 2GC8A 3PHEA 1CPZA 2AJ1A 2DPJA 4K0KJ 1DLOA 1HYSA 3BSAA 3BGOP 4B02A 4P71A 3ZSYA 5AQTA 1WEXA 2BE2B 3UPFA 3WZ0A 2HFUA 3M8RA 3M2UA 5JJBA 1IWGA 1KQGB 4IEEA 3QFHA 1VQ6S 1M5PC 4M3YA 2F9WA 2IA0A 1NSQA 3POTB 3VZIA 2P8IA 2E6LA 2LQ8A 2DHHA 2K3KA 3EZUA 2O8EA 2VQFF 1HNZJ 1WF1A 1KVIA 3MM8A 4C9DA 3GV8B 4ZLNA 3G6ES 1TGOA 3W8GA 3TQEA 4YR0A 1KTVA 3M8QB 2BYCA 1BUPA 3U4LA 4YHHJ 5C25B 1X31C 1PC5A 2EFGA 1RNHA 1TYQA 4X4VA 3MM5B 1JXEA 2OTJN 1T05A 1AA1B 3DRPA 3IS9A 3AVLA 2JC1A 4ZVUB 1D1UA 5I3UA 2HB5A 5EY4A 2G0CA 5A8KA 4Y65A 4NO7A 3TPQA 1NHVA 4WCEL 3D2EA 4HCBA 1C0FA 4H5VA 4MIAA 2G2YA 2XC9A 1RWXB 4ILGB 1VDHA 3SAGA 4FJ5A 1VJWA 2A3JA 1L3VA 1FJ7A 4WXWA 4CESA 1G6BA 3DLBA 2AYGA 3CPWM 3DXMA 1WUUA 1XEZA 2QRRA 5FDLA 1RBUA 3D7EO 3QJJA 1KVKA 4NA1A 4J2EA 1ZM2A 4K4XA 2QV6A 2XG8A 3T5HA 3WX4A 1NAQA 4GVBB 2OFHX 3CEDA 5KRSA 3CJ5A 3S01A 2CWXA 2RDDA 2C3PA 5CY4A 4JD2B 3BR9A 4J9QA 3HBTA 3HI0A 2P9NA 3Q8UA 2IDOA 3MN5A 1K47A 4CT9A 3HZEA 3A3PB 4IR9A 4ICLA 3VQEA 1HMVA 4CO0A 3H08A 3KKRA 1QSLA 4M3XA 3TSQA 2J6TA 3LUYA 2KJWA 4IOXA 4ED5A 1VLOA 1VQMS 5KFQA 2NRZA 4FJHA 3RVCA 1U04A 5T41A 3M2VB 4USMA 3QYYA 1NPPA 1VRUA 4X4QA 4JI0F 1GX5A 1N34K 3BKTA 2F9DA 2QFIA 4HTLA 4Q45A 4RU9A 4LF8K 4JRPA 4ZPDA 1FNXH 1JLCB 4Q2LA 3C95A 2WFBA 4P2MA 4KB7A 3L4BC 1V5IB 1U1QA 3NXZA 4OZ2A 4PXEA 4K4UA 2E8AA 5KT6A 4H4MB 1S1TB 4CGGA 3R7NB 1Q53A 4ECVA 1RABB 1VBKA 5B0EA 2QT7A 4GKJJ 1FK9B 3OBIA 4D3GA 4OZ3A 3IR5B 1YJNN 2M8HA 3A8JA 3QWPA 1HBNB 4BRMA 4KHPK 2E9RX 3VEZA 1DGKN 4DTNA 1C2PA 1R43A 3MCNA 3HHLD 2YKNB 4IOCQ 1X9WA 3VQBA 4CYUB 3K0SA 2KG1A 5HOOA 4YOYA 1Q95G 1RAFB 1RILA 3UCZP 4LFCK 2RAQA 3O4NA 1N36F 4H4KA 3J81j 1RTHA 2OPQB 4PG7A 4NCGB 5D0EA 4NXNF 4NLGA 3NNAA 3C6UA 5IT9Y 2P9UB 4IFEA 3AGKA 1M1KT 3CJ2A 4CRJA 4WZMA 1RHUB 2I9SA 2H4WB 3FBFA 2OKQA 1OY9A 1Y10A 1X4DA 2DNMA 2EVZA 5H9FK 4K42A 1U1RA 1GT8A 1FXDA 5I3PA 3LP3A 2HPUA 2HZAA 1G3OA 2XMJA 4FYYB 2AQ4A 3EZOA 4QOTA 1XR5A 3LANA 2P5GA 1U0SA 3HSJA 1NJIO 4FBUA 1YSJA 1JCEA 3RBEA 4RR5A 4X65F 1FO1A 3BSCA 2BJ9A 3R9LA 3MCPA 2XZDB 3O3FA 2L9WA 1RAAB 2XI3A 2F4VJ 2E88A 2OPRA 1N6QB 2HNDB 3DCAA 2LCWA 5FD1A 2ATCB 4JYAK 1HBOA 2VYPA 4C8YA 4H0PA 2MGZB 4BWMA 2HBZB 5JLHA 2CQHA 2B6AB 3TARA 1YVNA 2HFVA 1H7XA 1AB8A 4WE1A 4CZIA 5IS2A 3LP0A 1M1HA 3IWLA 4LBHA 2ZD1A 4A8MP 2EEYA 3VEWA 4OI0A 2RQKA 2JC0A 1RBOB 3VAGA 3VGKA 2AGOA 1ACMB 2DPNA 3ENQA 3MF5A 2QA4N 4CO3A 2XSJA 3PIOL 1KC8O 3BDEA 4RZRA 4OX9F 4IFVB 2QEXS 1OS5A 5FRMA 4ZVEA 4IKAA 3MPYA 2UVWA 4DR3F 3D4JA 3SYZA 5MAOA 1E6VB 4Z7CA 1KLNA 4ZVPB 1QAYA 3SQ1A 2ZH8A 4QW8A 3SQGB 1HARA 4PY5A 2Q66A 3C7NA 4JNEA 3AVCA 3U9ZA 4DMNA 5K5MA 4DV6F 4CD1A 1LW2A 5CZVA 2DGTA 1RADB 5KG4A 1Z26A 2D3ZA 3DOMA 2WCXA 1LEOA 5ETVA 2DNLA 5C2DA 1DTTA 4Z4HA 4LVNP 2GFFA 3DDIA 2OI2A 2ZBCA 2KYXA 3TSPA 4V19S 4X4RA 4DJBA 2HRTA 2OD6A 3BSNA 4B1UB 4KQZA 2AYBA 2DISA 4BC7A 5I9EB 4DV0J 2ZH3A 3E9PA 4TQSA 2EI5A 4QZVB 5F3ZA 2M52A 3JSYA 3H90A 4ED6A 2X74A 1RP5A 7AT1B 4DSIA 3HFVA 3ATUA 2MKYA 3UVJA 1IH7A 4OYIA 4JI1F 1OJ4A 4DCPB 1NHKL 1U6ZA 1GTHA 4B08A 3CDUA 4Z4CA 4TYAA 1CJUB 2PGCA 4C8ZA 2W2OP 3MR3A 5HROB 1QSSA 1XR6A 1V4SA 3KLFA 3A5OC 4FN5A 3OVSA 1SQFA 4ISFA 3HF5A 5HN0A 3P49B 3LWLA 2ZC3A 2D3O1 1T9TA 2CQ3A 2VQEJ 1RACB 4YR3A 4YUDA 5BR8F 3ITHB 4RW7B 2MSSA 5M1FA 5HBMA 4I1TA 4CZCA 3LP1A 1WC0A 2N7CA 2KLAA 3W9JA 2YNFB 1U26A 4ZPBA 1AFIA 1ATRA 1GLAG 4CECA 3UDLA 3JTOA 3RTVA 2D1KA 1EQYA 4ELVA 4HI2A 3FEYB 4C8OA 4A62A 4CLSA 1XIQA 3MAAB 5DS7A 1U2VA 4N77A 5F0WA 2ZM6J 2V2VA 3BO4A 4XDDA 5BXIA 4IZ9A 1W97L 3I8BA 3DRYA 4C3LA 2G8VA 3SCIE 3T1AA 4EO8A 2K2PA 1WSVA 5DM7L 2NRRA 3OT9A 2P9SB 2DR6A 1XMOJ 3VQ6A 4OPAA 4O55A 1TUWA 3U1LA 2XY7A 3WBZA 2V2ZA 2X6SA 1S4EA 3BGLA 1NB2A 1SV5A 4BGAA 3FCHA 1JLBA 1S1XA 4PWDA 4WFAL 5L8RC 3WXIA 2RNEA 4E19A 3QRPA 2DRBA 4H5TA 3MUVP 2GELA 3SNNA 4A8YA 4H0VB 3ZETB 1J53A 2C2DA 4JKCA 3R1LA 2ADCA 1RBRA 4LUBA 4K5RA 3KOAA 5E7OB 4A8OA 2VC1A 3N28A 2CZVC 3GIKA 1MMLA 4JOUA 2UUAK 4QBUA 1MG7A 2NSCA 3CHWA 1HW9A 2C2KB 1KQKA 4B9TA 2VFSA 4DLGA 2AGPA 1Z4UA 4HHTA 2WBRA 3I9ZA 2AV5A 4JI8F 1N32F 1NO8A 3GBTA 1FRXA 3I5BA 4Y00A 4M5MA 2OH2A 5JMNA 1HBUB 5C2CA 1HR0F 5KG0A 3N4WA 1TZ0A 4IH7A 4JI6K 4OZNA 3RGIA 1PYOB 3T6BA 2G8IA 4NYZA 3BKUA 5B0GA 3K57A 1HD1A 4BDPA 3PSFA 3CETA 4DV1J 2M3DA 2FGOA 2QL7B 3KLEA 4WYBA 1H2TZ 2VKZG 1NU0A 3ILOA 2EK1A 2ZC4A 1FRMA 4KBIA 2FQQB 4IH6A 3ILJA 3N6MA 5CD4A 1QUVA 1VSMA 3QRRA 2DO0A 4IH5A 3PIPQ 2A6MA 3I8DA 2ITMA 3LPYA 3VV2B 4U67Q 1YTAA 1F5BA 3MMVA 1WBDA 2DNNA 1U7LA 4F36A 5IM0A 3L95X 4EZ6A 4DV7F 3LWMA 3KZBA 2V51B 4DUTA 4M1KA 3M6GA 3LH2S 2HQ3A 4CEOA 4CZEA 5HRSA 5HLFB 1S1WB 4FZVA 2I6WA 4EGLA 3LGNA 5A2QO 2LEAA 1R0BG 4RNHA 3LDLA 4Y2MA 3K5OA 3UIQA 1XMQK 1NOYA 3HM9A 2W6LA 3E66A 1HLWA 1KVJA 3CJKB 2GAHC 4NLUA 4QIVA 1GX6A 1REVA 3JAMY 2E1AA 1WKLA 4C98A 2HLUA 3VEYA 4W5OA 2PMZD 3KK2B 1LW0B 1VRTB 4CGIA 1LKZA 2V2QA 5H9EK 3BYPA 2W2PP 5M2PA 3TQ1A 2FHMA 5G0RA 4WFNL 4NL5A 3TVZA 2W40A 4H8KA 3CMAN 8AT1B 1OH6A 4FXDA 2YNIB 2HMIB 2MKCA 3W3DA 3NMAA 2D3OR 1YQHA 3KK3A 2EFNA 1F5AA 4J2AA 4IBNA 2AD9A 1KNZA 3A8EA 2YKOA 2YNHB 4EFAC 5CYMB 4LFBJ 5I3QA 3CC7S 1L3SA 4DV4J 1WSHA 1YITN 2VQFK 1G15A 2M0GB 2ZWPA 1T02A 3CCSN 3M9OB 4M5LA 3SMZA 1BDGA 5GINA 5F8GA 4O3RA 2F4FA 3SCXA 3MGJA 4L75A 2DY1A 5LL6Z 3GE1A 1BXNA 3PG9A 3HHKA 3PYGA 2MKJA 1G4CA 2IDEA 1GEHA 2HK3A 2HS0A 4A2BA 4J8FA 1YJRA 2OIHA 2NYHA 2DIVA 2P9IA 4QPTA 4L76A 2CH6A 3JSBA 3EZ5A 4AF1A 1XQIA 3N9UC 1CZAN 1SXLA 1FDBA 3J7AN 1NDCA 3ZT0A 1J5OA 1HIYA 3HRGA 5ETNA 4GKKF 3I31A 4QIEA 1T3OA 1OMSA 4JV5F 3EX7B 1PJ5A 1U4BA 1Z2LA 2GHVC 5KFXA 2QA4G 4G1PA 2UVUA 4ED8A 4I64A 5IC4B 4MKBA 3G10A 3CCLS 2EXUA 1XJWB 4CLTA 2ZVSA 1FT8A 3VQ7A 3KWIA 3K89A 1YJWS 4BR7A 3CM6A 4CJEA 1O13A 4E7LA 1TL3A 3E9LA 3IBWA 2DNZA 1Q4RA 4WPAA 3CXCM 4ZCLA 3IWXA 1RAHB 4XK8C 2RU9A 2B3TB 4CJSA 1N5TA 2OLWA 4OHXA 3DJCA 1NSKL 2L9NA 1QE1A 1JLQB 1TUVA 1V9OA 1WSFA 3L09A 1NB7A 2WVDA 3NWGA 1BQXA 1VHIA 3QEWA 1FVSA 1X4FA 3BY5A 4JK9A 4DUZJ 4EK2A 2QMWA 3OHRA 3QIOA 3PX0A 2ZH1A 1FFSB 5A8WB 4J2DA 4JI0K 4NEYA 1PKUA 3K5NA 5DDQC 1YAGA 2RVJA 3O9TA 4JHDB 4ELUA 1MDUB 1VQ9N 2HZVA 4KJIA 4LSNB 4JKGB 2HNYB 3UN5A 3O5TB 1DURA 1BHLA 2K06A 2KFNA 3ZTSA 3U3YA 5KT5A 3CD6S 1EX8A 3NS6A 2HLTA 3ZSVA 3QEXA 2GJIA 1FDAA 2MMYA 2BJ8A 3GOIA 1B0PA 4RBTA 4J9VA 2PEHA 2QYCA 2XMAA 1X4HA 4DQPA 3NEKA 1JNZB 2YKMB 1HWIA 2Q3PA 3M8YA 4MK9A 2UXDJ 4RKUC 3HCXA 4DR1F 2X78A 2IIHA 2AZ3A 1N36K 2VONA 2FC9A 4NXNK 3C16B 3UD4P 3R3TA 4YS2A 1BO5O 3AJDA 4QWBA 3N4PA 2YJFA 2UUBF 1EKSA 3QICA 2FYXA 1A5WA 2VG5A 4HUEA 1H73A 3VQTA 1LWEA 1S72N 1TVRA 2V8PA 3I0SB 3MUMP 4EEYA 4HVZA 5DO2A 2QA2A 2E9ZA 2J9DA 2YH0A 5C5JA 2BGGA 3AO3A 3QEPA 5LMUF 4OYZA 3KLIA 2YPZA 4OL8A 2V69A 1S12A 3AVHA 4QWAA 3O4QA 1F60B 5AZJB 1KDNA 4DQRA 2YI1A 5LT5A 3N6NA 1NXIA 3OUYB 2HF4A 1KD1O 4AM6A 3NRBA 3JYTB 4C1NI 4X65K 4OLBA 3VQ5A 4DFPA 5FLXY 3ENBA 3RJMB 1M0SA 4I56A 3AVMA 2FBTA 4DOZA 3AOCA 3IAM9 2KH9A 3Q22A 3FFIA 3DC2A 1CBKA 5T7BA 1ZBTA 3OJUA 4KH1B 3TWZA 1GOCA 6FDRA 2FJVA 3PEJA 3OY9A 3H20A 1X0PA 1RBLA 4E8UA 2GBZA 3IM9A 4O3NA 4ZJQA 2P9PA 4KB0A 1PJ6A 4CZHA 4FJJA 4O3QA 4ILMA 4ID5B 3PYDA 4LRFA 3CD7A 1Q81O 3OL8A 3CF5L 4OX9K 1JKHA 1P9YA 3R2DJ 2NLWA 1NGAA 2KTQA 4JB8B 2NPFA 4DV2J 4DR3K 1J27A 5IZHA 2CQIA 1XR7A 3TAMA 3QDKA 4I2QA 3QLHA 1EARA 1CJVB 3Q8YA 3W5YA 3NKYA 1YJTA 3V6KA 1K8KA 4ED4A 1SKRA 4OV6A 3MTJA 3DXKA 3QT8A 2HVZA 2XLJA 4DV6K 3VHQA 1C4CA 5KAKA 4TSXA 1LK5A 3A2FA 3M9MB 1RAJA 3H98A 3NBPA 1S99A 5A0YB 4CF0A 5HI7A 3MXJA 3MWBA 4HUFA 5KFWA 1WUAA 3I0RA 4BHQA 4PPDA 5DETA 4BVPA 4FWRA 3NGUA 5C42A 1XK8A 3FJ2A 4LSLB 3P5BP 3R5BA 4DN9A 5KT2A 2OAUA 2DFEA 4DR2F 4FF2A 2Q97A 3TR8A 4N47A 4CF8A 5L9NA 1WORA 2Q3SA 2YWKA 3I55N 1KXPA 2MSTA 3D2FA 2G8KA 3GJSB 5TKYA 4NLVA 4IEIA 4KB1A 2OFGX 4I2PA 3OS1A 4JI1K 1K9MT 3KUHA 1YWXA 3PZPA 1NEEA 3WNFA 1UWBA 2RSQA 4D3HA 3MCAB 4UZBA 3A8KA 4Y0FA 3TAGA 3S3MA 1ITGA 5GMKa 1JXBA 2WVCA 2KZMA 1SPBP 1E4FT 3NMRA 2V9KA 4B1XB 4BLGA 4BWJA 5C7PA 4JP8A 4U7UD 1U24A 2J0SD 3N5BA 5BR8K 3LAKA 5DDRC 4GNIA 1Q5VA 1GLJO 4KPCA 4ISEA 3NH2A 2PE8A 3W9IA 2GVDA 2XCAA 2DEIA 1NWKA 4GW6A 4IJAA 4ZLJA 3G8QA 3DMJB 4DEZA 4OX8A 3S3NA 2ABYA 4BR9A 3W2VB 1WJ9A 4DMZA 2E7WA 4DPOA 2BDPA 5D8HB 2BE9B 4HDHA 3G82B 2CPHA 1PC4A 1QAJA 3CQ8A 2PA8D 2OA8A 3AO5A 3AOBA 4XIUA 3QEVA 1UEVA 3M32A 3TANA 4M5IA 1B3TA 1U1KA 2V67A 4Y3CA 3RBDA 2P51A 5HMYA 4YY3J 2QSFA 3RMAA 1FERA 1BQMA 3OYBA 4Q2MA 4BRGA 1YJNS 3E1YA 2D0AA 4PHTX 3LGMA 1GLEG 3K9JA 2E5GA 1CG2A 1OQ3A 3MWTA 3M1VB 4DFKA 1YIJN 3NOCA 4OJGA 3OVBA 2DHGA 4KTWA 1PIEA 3RR7A 1T6CA 1YTYA 4W98A 3L7UA 4JK7A 2J9EA 4HI1A 1AFJA 1UFLA 2BQ3A 2HQIA 1C4AA 3V81A 4RW6A 4USJC 4DX8H 4AQYF 5E2QA 2CQ0A 1A7GE 1PYTA 3AVFA 3WT0A 3W3SA 3AVAA 4ALZA 4PR6A 4LF6J 3RB6A 3P39A 1A5XA 1RAGB 4N7TA 3IRXA 2BMBA 4DTMA 2YWEA 1J5EJ 2Z2YB 4KV8B 3EZWA 4V19J 3BYRA 2Y1IA 4JI8K 3KD5E 1N32K 2LFVA 4UF4A 3BEXA 3IDHA 1HR0K 3MEGB 2CJ9A 4C48A 4JKAA 1ICEB 2JVRA 2MEWA 3ET6B 4OI2A 3DM2A 4DL0C 2V34A 2M9KA 1H6KX 3GIRA 1BU6O 1Y3KA 4W92B 3L2WA 4ECQA 2P9CA 5CYQB 3HD2A 3CFRA 2E7VA 4JKDA 4EAHD 4WBFA 4OHWA 5GVQA 2QE5A 5FPDA 3H2VE 5AQIA 4DB3A 2BX6A 4ECRA 1CVJA 4P73A 3J7ZT 2VWKA 4I4BA 1YF5L 3BS9A 3MCMA 3NCRA 4WF9Q 4ES3A 2D0OA 3NDKA 2VJUA 3CYMA 3CVKA 3NF6A 4J90A 1IKWB 1HWJA 1GXTA 1RCXB 4DR6F 1TL1B 4B3MF 2F40A 4Z4GA 1NSPA 4BR2A 1S6PB 5B0DA 1IBLF 4L3NA 2UUCF 3D54A 4WFBQ 4DR7F 5LXYA 3KDOA 5AQUA 1VSHA 3NCIA 5AXKA 3TAPA 3KKSA 5I42B 3OQ2A 3VQQA 2ITGA 2MQOA 4M5DA 4CGDA 4FWMA 3MM7A 5EOYA 3DLHA 2X3DA 4PABA 1YJ9N 3LALA 4PWUA 3RB4A 4NYFA 1GMVA 4H5NA 4O8UA 3TEHB 1WTBA 4ZVRB 2UV8A 3MMAB 3M5RA 4DUYJ 2F8SA 5SWMA 4G1QA 2KHCA 4O44B 1WDDA 2HRYA 1CEZA 3M8ZA 3O6WA 1H98A 1HPZA 4F0MA 3CCRN 4CO4A 4DR4J 3BJYA 3C3LA 3SPZA 2E66A 2FZKB 3CXCR 2CNKB 1T03A 5HMWA 1DFDA 3O9RA 2HWTA 5KPZA 3IA0A 1UL3A 1SJRA 4CJ7A 3DRSA 3MD3A 2Y3YA 1IKYA 4OGEA 3OW2M 3KJFB 4CTAA 4LF9F 1ZA1B 4ECWA 4IDKA 4YEAA 3ZNUA 5CE3A 3DAWA 3F41A 4K59A 2MB0B 2DT9A 2W6KA 2K3IA 3M9NB 4WIIA 3NL0A 4CHNA 2GCFA 4Q0BA 3QNOA 4O4RA 4YOUA 3NHGA 5A2QY 5AQYA 1B64A 5HMXA 2IFXA 4QOZB 4K4ZA 4NXMF 3SBGA 2BRLA 3L2VA 2VICA 4W5QA 2WBNA 1C0UB 3C46A 4KY3A 3AVGA 2BOAA 1UFKA 4CHPA 1FRIA 1NJZA 2CZ4A 4PUOB 3T3FA 2AP1A 1KCFA 4IRCA 2XBPA 2NXUA 2VA2A 4NOHA 3IG1B 4NX9A 4CBUA 3ETOA 3ENOA 2BUNA 2IJRA 4JI2J 3GU0A 3OTDA 4IOAL 4WZQA 1Q8KA 3IRWP 3R5AA 3AVKA 3HXMA 5J2NB 3OSNA 1K0TA 3ULHA 1HYZA 2NRWA 4P6QA 1BL3A 3K17A 2ASOA 3ZZYA 1HNWJ 2UUWA 3V1OA 1WC3A 4DL5A 3EMTA 2E1RA 2XLKA 2P5VA 2HBLA 1T7PA 2Q0UA 2CGLA 4GKKK 4FW1A 3CCTA 4JEPA 1DBDA 2KG0A 4JV5K 2UUTA 1BHNA 4LIRA 2YKAA 3K5PA 5AQMA 2E1CA 5D4PA 4EUVA 2HIYA 2G8FA 4WYWA 5KQDA 3SDEA 4OV1A 3CULA 3VQ9A 5KQ8A 4CE9A 3UKRA 3HM8A 4USIA 4FLXA 1FD2A 2AA4A 1HNIB 2ZBQA 1ZTWA 2YX6A 1RGIA 3L0QA 4CIFA 2LU2A 3ZZRA 5DK5A 4YFUA 3K59A 2WOMA 2DCUB 3TRGA 1F2HA 3LTOA 4ZHRA 4JKFA 3MPDA 5M2UA 3JTPA 5GADU 3TSUA 2HG4A 1WOQA 5F3TA 1L3KA 3GIMA 3P45B 3E01A 4AHTA 2J7WA 5C2FA 1JJHA 4H0OA 3MAHA 4HYKA 2BH1A 1YRUA 1HHSA 2R9LA 2BQUA 4ZPTR 5EHHA 3CC4N 3PX4A 3DLKA 3J7A1 1WAJA 2FD2A 4HHJA 2BQRA 5LOQA 1MWMA 3FE1A 3TUPA 2KFYA 3Q2TC 5DDPC 4H4OB 1W2BM 1S3XA 2OANA 2A1SA 4RL1A 4X4OA 1ZAWA 3QZ8A 3SI6A 3UFCX 3ZO7A 1BQNA 4H54A 2RRBA 1R0CB 2XZWA 5HQLA 1E4GT 1UJ5A 4LF4K 4AYBD 3OTOJ 3HLUA 4NLYA 4RUHA 1VRQC 5LSRA 5B09A 5ETMA 2CPJA 4DR1K 4J9NA 3D0PA 4AILC 1Y7PA 1NHUA 1RWUA 2R7VA 4AHVA 1WBBA 1D09B 1RXOB 3MPUB 4QCLA 5CYJA 5B0FA 2UUBK 5ELZA 3EY1A 1S1VA 1S10A 3AVJA 3ZTPA 1Y3JA 1FHTA 1TKTA 4V19X 3ZZTA 2QO3A 5LMUK 1QAIA 5F8LA 4HDGA 2LQ9A 4J9LA 3KFWX 4KH4A 3I96A 3KJNB 3PLAA 3ZYYX 4FJ8A 3KUGA 1SJ3P 1CJTB 1RHRB 2YBVA 2G1DA 4ECSA 1JLGA 4JI5F 4OIXA 5LJWA 2WB4A 3ISZA 1AZSB 3CCUN 3BGUA 3Q8QB 3HHLA 4IO9L 5L38A 3G9CA 4DR5F 1CULA 1RWPB 4ANCA 4OJ1A 2VU5A 5M1PA 3PR4A 1X8DA 4MO4A 4FM1A 3GG4A 4M7XA 2AT1B 4ATNA 2CJQA 3AA4A 3DRXA 4TVAB 3MMBA 1HW8A 4K4WA 1ZAXA 4USHA 3G8SA 1W2IA 2BM1A 3C15A 5E84A 2KM8B 2B5JB 1BA1A 4FWKA 1RWKB 4IG3B 1SH2A 3BSOA 5K14B 5D15A 2G2ZA 2B8PA 2AX0A 4KHPJ 3RRGA 4XH4A 4BRKA 5CXTA 3LA0A 2CPIA 4OI6A 4CEDA 4CQ1A 4CH7A 3FMBA 1F9FA 5KFHA 3NOGA 3LL3A 1Y5IB 1BISA 5EWEA 1V3SA 5KFKA 4LFCJ 3RAXA 3UKUB 1T6DA 1QVFR 2VD3A 3P6YC 3G71N 1C0TA 1O0PA 2QLFB 3H2UB 2YHYA 2VOOA 3D3BJ 3D0GE 2AX1A 5AE3A 1FXRA 3ZEUB 1TK5A 1R27B 4PG6A 1YITS 3VWSA 3O9UA 5AXNA 5KFNA 1SBRA 2Z8QA 2AGQA 3ZFVA 1S6OA 4LSZB 3TJ8A 3V6DA 3D66A 4I9LA 2RHKA 3LZJA 5HRNA 2BXJA 3FRYA 3KMSA 1HQUA 1EP4A 1KQSM 1VQSA 3PCOB 3HSZA 3EDQB 3LPUA 4KGXB 3MEDA 3DOKB 2HOEA 3KLHB 4M5GA 4KGVB 2GQQA 2PO4A 2C2RA 2FSJA 4CLFA 4MKVA 2FXUA 1DAXA 2ZUAA 4DR2K 4U9RA 1T3VA 1FXLA 5ADXH 2VWJA 3O4WA 5KFOA 4JYAJ 4KTZA 2XS7A 2E20A 4QWCA 4YNQA 2OD4A 1YRTA 1RA6A 3S7RA 4CF9A 3RG6A 3G8TA 4TU8A 1TK8A 3KK7A 3V6JA 4YP3A 4EBDA 2J7KA 2P1JA 3LDNA 2DNOA 2NUUG 1B92A 2YWGA 4FJMA 1ZYQA 1VQNN 2O8BB 3Q23A 3DGPA 4HH1A 1Q7YT 5KTQA 3MM6A 2E2NA 4KYZA 2E5HA 3KG4A 3TVKA 3MEEB 2E5LF 2HFOA 3SQ4A 1LWCA 2EX3A 2FJWA 4DG1A 2QMUB 1UOCA 1JLAA 2FBVA 1IBCB 1BC6A 4DTOA 3BH6B 3BB5A 2W24A 4CHOA 1SZ2A 3D0IE 3VA3A 2IBKA 3JXUA 5GADP 4JLHA 4BR4A 3J80Y 4K8ZA 3DN9A 4F3OA 2QI2A 2HNZB 2YH1A 1MWKA 3FEZA 1RHQB 1ELOA 2ROGA 2MKKA 3MUTP 3LP2B 1VQ9S 4O5FA 3RB3A 4MIWA 1FRKA 4K2JA 3QZ7A 5C15A 4ERDA 4RNMA 2UXCJ 3M8PA 3V5RA 1YBUA 1DTQB 2PY5A 3C66A 4NYPA 4B3SJ 2FF3B 2IA6A 1UJ6A 2XYPB 2YX1A 4A5AA 3IGVA 1XNQF 4M5NA 3CCQN 2PYLA 3SSSA 2KXNB 4NRUA 2FLLA 4CJPA 2QTWA 3UCGA 4OYWA 3CW2C 4CLUA 4FO0A 1SQEA 4NLOA 2B4PA 1HLUA 2R7UA 4FWQA 1JQGA 1TU0B 2K7JA 3E8OA 2VG6B 2OPPB 1XMOF 1HA1A 2Y9HA 5EWGA 2W2NP 3HZGA 1SIWB 3TUIC 4K7QA 3OYAA 4OPHA 3ISNC 5CCLA 3KK1A 4NLCA 4R8UA 2ZH9A 2B51A 3L7OA 5FPMA 1HL6A 1Q8LA 3THXB 2HW3A 1FWPA 1VQ8N 1EQMA 5AQOA 3AJ1A 3OW2R 3GIJA 4Z37A 5F8NA 2QXLA 1C1CB 1FJGJ 3JTNA 3H59A 3JSMA 1D9DA 5AQHA 3MM9A 4MMOA 5C24A 1RDWX 3J7AP 4JRQA 4WFXA 4JKEA 2W8KA 3R97A 1MWQA 4DZDA 1BY9A 4B3TF 1TKZA 2WVEA 1HKCA 2GQCA 2FTRA 1SKWA 1KAZA 2O1PA 1XTZA 1IKXA 4OQJA 4MTPA 4CVNE 3UDVA 3KXDA 1ZETA 2WTFA 1GLDG 4DR6K 4B3MK 3NVKA 3FZLA 1IR1A 4OX6A 4NI2B 3GONA 1TMJA 1RI7A 2EW9A 2GIFA 2F5GA 1IBLK 2UUCK 1WSJA 4Z4EA 4DR7K 1XHZA 3Q83A 2CDRB 4NLQA 4ZITA 2ZHBA 2KT3A 3OLAA 4A59A 2J8SA 3DI6B 3RBZA 4B9UA 5KT4A 1X60A 3WEEB 3PW7A 4FZZA 2ACYA 3O1LA 3CT9A 2UUAJ 3CDBA 1RLCL 2A2DA 4ZVTB 1H7WA 4IOAQ 3P96A 1SKSA 2FBXA 3QGGA 5J1NA 1N33F 3KJVB 1S9GB 1WOSA 3EWGA 4FWOA 1NK9A 3PXGa 4DCHA 1UVLA 1PBAA 3AVNA 3OYGA 3H7HB 1B7FA 4JI6J 3DLEA 3MXIA 2ZZMA 4CO1A 4DL3A 1NNEA 2HHVA 4A8KA 4LF9K 5KG5A 2E7XA 4OFZA 2GWJA 3ASMA 1BIZA 3HL8A 3PJ9A 4FJLA 2BE7D 4BE2A 3JQKA 1GOBA 1RTDB 1MU2A 3AH6A 3KKFA 2K1RB 1EB0A 2MJUA 2LSNA 2H51B 3OTEA 2HBMA 4NCAA 3H4BA 1QVGR 2R7XA 4PXCA 1FTRA 1S77D 4NXMK 3O9QA 2ZJPQ 5AFUA 1H0HB 5HP1A 3NH0A 2QGFB 3BDPA 2Y1JA 3UD3P 1R8HA 1SAZA 2UVRA 1S1UB 1YHQS 2NRTA 3FKBA 4F4XA 1T95A 2DH8A 3L6QA 4XO0A 3KD1E 1IQZA 4DS4A 1EETA 2BRKA 5CHCB 3QFPA 1FJEB 1I3AA 3M30A 3KDNA 5L9XA 3HZ6A 4E1MA 2BEFA 3KYLA 4ITSA 5THWA 4DF8A 4WFYA 1X5OA 2V52B 1RU1A 1WD6A 3G6VA 4B1VA 3T19A 3OYFA 2CVEA 3QB0A 4ZTFA 4C4WA 5HSPA 3DYAA 3W5XA 4BE0A 3HMJG 2VH7A 1XMQJ 3CSKA 3EE3A 2VBZA 2ZH6A 3HI9A 4BG8A 4EU0A 4OJRA 1IM4A 1X1PA 4CLZA 4IO8A 5AZIB 3QATA 4IOCL 3NS7B 5J2PB 1IXKA 3ZSOA 1RT5B 4JN4A 5F0XA 4IG0B 1VOMA 2VBWA 2QFJA 4P52A 3VQ8A 2RILA 1N48A 2JJ4D 4C0OC 1VQ4N 5D0RA 4HHHA 4A8SA 5H9EJ 3CJ7A 1K9MO 2MY8A 3EE9A 4FWPA 3KG0A 1P8GA 1DRZA 3M2RA 3HOTA 1YIJS 4CK2A 2JLEA 3NNHA 1SIZA 2I7NA 4H0YB 4FVUA 1MROB 1Q7LB 4RX6A 1RT1B 3V4IB 1VK0A 3K9KA 1JJ2M 4KHQA 4CWBA 3W65A 3SQ0A 3QT7A 3VA0A 4MFBB 4PXDA 3BGRB 5F2RA 2HYIB 4I7FB 4BDYA 1FE0A 3T7ZA 4JBCA 2VQFJ 1FWLA 2OSRA 3BBBA 4M5KA 3TZYA 2MKHA 2RF2B 1KTQA 2J6UA 2HGLA 3SSQA 5EUHA 3I5AA 2O8FB 2IM1A 4B3RF 4GVEA 3VTHA 1BE4A 3CTRA 4DKWA 3AQPA 4Q7AA 5CQGA 2RQCA 2V94A 4IO9Q 4YR2A 2IOCA 3GILA 3L4IA 3AXKA 1XC9A 3GSDA 3I82A 2GGPA 3RSEA 2D74B 4PG4A 4C0BA 4BRFA 1ULRA 3US5A 1CS4A 2NNWA 2UXBJ 4Y6IA 2CPXA 1V3ZA 1RTIB 4ECUA 2GZOA 3LW5C 1Y64A 2CWKA 4LC9B 4DFJA 3W2WA 3PFEA 2VG7B 2R7RA 1CJKA 4KO0B 2H1YA 5BR9A 4EZ9A 2CJYB 4CLYA 2VGMA 1B99A 2CG8A 4TU9A 1LFPA 1IWAA 1QAXA 4BC3A 3IBFB 1UEKA 3VAJA 4Z2XA 5LSOA 1PILA 4F3QA 3OS0A 2L48A 3EDRB 5A8RA 4AM7A 1V4TA 2YQ1A 5HVFA 2DFFA 1YK9A 5BPMA 5IWAF 1LXJA 2RD5C 4YB5A 1PBUA 4DTXA 2I5JB 1IKVB 1NCLA 4JI5K 2QK9A 1BIUA 5KFGA 4OYOA 3HYFA 2ASYA 1ZM4A 4IFYA 1F3VA 2C1EB 4URGA 3SUOA 4JI0J 1N4LA 2DNKA 4DR5K 3KLVA 1JIHA 4Q8FA 4CJWA 3CE8A 2LMIA 4DV3F 5IOLA 5IV4A 1S6UA 3RAMA 4M3UA 3P8BB 5CH7B 4F0HA 2DRDA 4DL7A 1N5YA 3J7ZO 2P9LA 1FNOA 3CJTA 4RUCA 5ETLA 4RWWA 2VPXB 2CUYA 3HFZB 2NR0A 5JVGQ 2FY8A 3IAYA 2IPOB 4ZPVR 2J0WA 4U96A 4JV0A 1GMWD 2HSEB 4LF1A 1PAEX 1PYSB 2DXFA 3QINA 4OZ1A 3NGDA 4WP3A 3OYHA 3I4PA 3LM9A 4KFBB 3MMCB 3E2EA 1UA0A 1VR6A 2JNJA 1GLCG 1X0FA 2OUGA 1N36J 2D5RA 1J6ZA 3GYGA 3FGUA 3EJMA 1RTJB 3THVA 4BGBA 4NXNJ 4PG5A 1KLMA 5F8MA 1KEKA 2AJ2A 3CDWA 2IVMA 2NCKL 4OZ0A 1JLFB 2XWYA 2ATQA 1HNXF 2ZE2A 2Z4PA 1FFGB 2G9OA 5J1EB 3H40A 1NK5A 4BREA 2WVBA 3G96A 1E3MA 2QIFA 1Z1ZA 4NWBA 4XTTA 4ER8A 1LWXA 4EFHA 5KI6A 4J9OA 4CI6A 4IYQA 2VFVA 3VQCA 2HFNA 1RDDA 2O66A 1XNRF 4WXOA 2Q31A 4DU4A 2UV8G 1SL0A 1RKIA 1PJ7A 3QIPA 4X65J 4OJHA 4WU2A 2BJEA 2EWHA 2V8GA 1JCGA 2LP4A 3C0BA 1WSEA 3QGPA 5KPTA 4RW9A 1RLDA 2KDOA 1R6YA 1WTFA 3HPOA 1RT2B 2YX7A 3HHEA 3WNGA 4ZPWR 4PAAA 1KRPA 1T9UA 4E7KA 2Z1HA 4R5PB 1S9FA 4M5HA 3VF4A 4YDXA 5AQGA 2HHPA 5HRPA 1NK7A 5LMNF 2R7SA 3H0PA 1IVZA 2OPSA 5AT1B 2VFRA 5LL6d 2DRAA 2GQ2A 5ETSA 1UW9A 2HHHF 2MZRA 3SV3A 3A12A 2JSXA 7FDRA 3B4MA 2KYZA 3RYLA 1IBMF 2IAJB 1VGYA 4OX9J 3EM1A 1E6YB 2E5LK 2AZ1A 3KTQA 1WF0A 2RN2A 2E1MC 4M45A 4PKIA 3SQ2A 4ANDA 4CBWA 4BROA 2IVOA 5L1JA 3M6UA 1QHTA 4DR3J 4CBXA 2FVSA 1RT4A 4FF1A 4EHTA 3MXHP 3DRRB 4ISGA 1FKPB 5F8IA 2W9BB 1FKOB 5CD4H 2HHUA 3M1FA 3QERA 1X5SA 2G0JA 3HVTB 3VGVA 1PO6A 4O3OA 2FPHX 4CFBA 3BP8A 4A8QA 4A8FA 3TWHA 4DV6J 1FVQA 3Q89A 2X7IA 1HNVB 1ZPWX 4C2MA 1TL7A 4EIAA 3CC4S 3HPHA 1K73O 3C6TA 3NF7A 2IVNA 2JX2A 5FIIA 5J2QA 4HCCA 4M94A 1C1BB 1VSDA 4O4GB 1XNQK 2AEJA 2BR0A 4HHUA 1VQOS 3AAWB 4PQUA 4A8XA 4QW9A 1VSIA 1VSLA 3DLGB 2RDIA 3OVNA 4ZP8A 1HBMA 3TA1A 3OA9A 2J8AA 4X4PA 5DZ6A 2NRVA 2P9KA 2YQ3A 3OR1B 2KFZA 1GOAA 1RDCA 3CIPA 3SIPB 3T5KA 2ZJRL 1WI8A 4B1YB 1XMOK 4MK7A 4CEEA 3AAPA 4JI1J 4YOXA 1WC5A 1WC6A 3HKZD 3WXLA 2GTDA 2PDAA 3ULDA 1UAWA 3WUHA 3A3OB 2H65B 1IR0A 4ZTJA 1EX4A 3W64A 4AHCA 2O8CB 4PKHA 3SXLA 1JLEB 5B8HA 1MNEA 2HMPA 2YNGB 2GO8A 4AXIA 2PSZA 2R8KA 2PFUA 5BR8J 2MYFA 3VETA 3TJAA 2WONA 2VIHA 3HHDA 4OZJA 4L72B 4FW2A 3OXLA 3FFKB 1NUEA 4LR8A 3G6EN 3FSXA 1QUPA 2MZ1A 2D0BA 1CC8A 2YWFA 8ATCB 2YX4A 1SH0A 2KVQE 2N4CA 2JOQA 3PTWA 4J9RA 3R6LB 2ZDOA 2LU1A 4E3SA 1SJ1A 2NUHA 4P7VA 1F0XA 3Q7CA 2SXLA 2N7YA 4H0XB 2FHKA 3HSGA 3SBTA 3ZTQA 3PJXA 4B3TK 1EO1A 2ZVIA 2MHEA 3AT1B 4X4UA 4KHNA 3MCSA 2RHQB 3O3LA 1LWFA 3D6HB 1RHJB 2R2RA 3MXMA 1S6QB 5D3GA 1T3NA 1NK0A 2OGUA 1GAOA 4CLLA 1U0HA 3CC2N 2MZSA 2J4RA 3AARA 2EWSA 4ECYA 2EBEA 3QMLA 4B3OB 1KWMA 5KFJA 1RT6B 4RBVA 1ROFA 2RKIA 2R2TA 3CJRA 3OV7A 2QYGA 2LXUA 3OFGA 4C0HA 1RISA 5ETOA 2O8DA 3C65A 4RWXA 3AD7C 3BQ1A 1RT3B 2JFDA 1BCMA 4ZVOB 5L46A 2VBYA 3G71S 4LT6A 2JWKA 4CZLA 3V9SA 1PG5B 1TAQA 2IIRA 4I9QA 4JI7F 1FDDA 1UJ4A 3R5JB 2BV3A 1KVAA 3O8WA 3CCVN 2GJFA 2IYIA 1VQMN 3VVUA 4K4TA 4JI8J 1CZBA 1N33K 1N32J 4GV6A 1OO0B 3BF4A 3I87A 3TUJC 2CPFA 1BWFO 2HAIA 3CERA 4ZVQB 1HR0J 1WKKA 1WEYA 2HWIA 3MZIA 4CM0A 3SCKE 3TA0A 5KFIA 5GMEA 2NQPA 5KOXA 4DL2A 2Z2ZA 4BRPA 3OL7A 3RMDA 3LGHA 2BKOA 3H3OB 1Y9OA 2ZJQQ 1JJ2R 4O3SA 3C94A 4JS5A 4KGMA 1GK8A 3BQ2A 1U49A 1Z2ZA 3BV8A 2W9CB 3H1QA 3KHRA 1S9EB 5KG3A 5SZTA 2VWBA 2ROEA 3OFFA 4IRKA 3O3HA 3ENWA 4JKHA 3THYA 1TV6B 4GV9A 3O9SA 2C3MA 3HT3A 3BGFA 1UZHA 3DOLB 2AYEA 3QSYB 3ZCMA 2GEMA 2APOA 3IMQJ 4CK3A 4HACA 4CIOA 4RCHA 3E3XA 3C2PA 4OHYA 4Y34A 1K6YA 3OD2A 3D6TB 2PIIA 5EVZA 1YVUA 3H5SA 5HRRA 4DV7J 4BC2A 4BCAA 2DTJA 4CLWA 1TKXB 4F7VA 4L8RB 4X62F 1WB9A 4FYVB 1OY8A 2QL9B 2CFXA 1KC8T 1OYDA 2YJEA 5M2RA 4YOTA 1XQSC 3F5TA 4OVLA 3W66A 3H45C 2Z57B 4ZP6A 2HHSA 4FNHA 1BWEA 5FJ4A 1WG5A 2IM2A 3DHWC 4ZP7A 3AFGA 2OYQA 4KE5A 3HPGA 4A61A 2CPEA 3CDAA 4OPJA 5HQMA 1KP6A 2X1AA 5JVHQ 1VQPS 3QJPA 3GMGA 1NKCA 4K5SA 4G6VB 1YI2S 2V4JA 2BANA 2BBEA 2ZH4A 2XYGB 3THWA 2QC3A 2QLBB 4RLEA 1TQLA 3MOZA 4ED0A 2R2UA 4BC5A 3C8YA 1NLVA 3CCQS 3SJJA 1QS4A 1Q5YA 3VR1A 4NZ0A 2BE2A 3VQ4A 5CAAA 1NPKA 1O1WA 1O6XA 3ZX0A 2QL5B 1GFWB 5GIPA 3ZSXA 4K8RA 1OSDA 2XLIA 3U27A 2YPYA 3POTA 4CIGA 4DV5F 4NZ6A 4UY8O 2GVZB 4JS4A 3LDSA 3FSYA 1Q7YO 3O44A 2HGNA 2UYTA 5KFMA 3OYJA 4Q5VA 1MMDA 3GP9A 2O01C 4CK1A 4JI4F 2CXEA 4X84A 1Z6RA 4TU7A 4GY2B 3M8QA 3A13A 3I5CA 2R8GA 3DLRA 5C25A 4JKBA 1FFWB 3GL1A 2HQFA 3MM5A 2MPUA 3G25A 2XRIA 3VGTA 4QYZK 2I0XA 5AR0A 2GUPA 4B3RK 2A1BA 2IMOA 4BC4A 3ELHA 1XERA 1RT7B 2F65A 1VQ8S 4IDHA 3Q8SB 3TYTA 5E3PA 4KPYA 2DXDA 1UVJA 4CJTA 4I6MB 1TTHB 4LR9A 3OHBA 1T8EA 1TL5A 4I0WA 2KHOA 2ZQBA 1IR2A 1Y5LB 1NG9A 1NZ8A 2KB2A 4GKKJ 4ZVHA 4RW4B 3FVYA 4OGCA 2DIUA 4JV5J 4GVBA 1CLQA 1HWLA 4JD2A 5E26A 3L4QA 2QN6B 2VPWB 3NGKA 2MQ8A 4P2FA 1TKDA 3OTOF 5EN1A 5TKWA 3C14B 3MECB 2XTJP 1X5TA 2IJNA 2CJBA 2CA9A 2KKZA 2MDAA 3U8XA 1T44A 2IRXA 2W1BA 3F56A 1M90O 2FVRA 3M2VA 4BRQA 3KLGB 4C3KA 5IWAK 2B0GA 1RWVB 1WEZA 1VK8A 1JLCA 3W8PA 5JLFA 3OPKA 4TNOA 2GX9A 3HP9A 4H4KC 1X4BA 1ZBSA 4KBOA 4H4MA 4E2FB 1S1TA 1U2CA 3RR8A 4FK0A 4OYAA 5HO4A 3FSIA 1NM2A 2AWZA 3NGTA 4DV3K 4C1NK 2LVWA 5K8OA 1FK9A 4M95A 4YOWA 2DFHA 2LECA 2POKA 2FIUA 4LRBA 3QBCA 4HEA9 1HBNA 2LA4A 1EIYB 3OYLA 3AGRA 4C7QA 1RYRA 3WXJA 2U2FA 1TUYA 2KXHA 2YKNA 3L2UA 3PO5A 4CYUA 2RMLA 1YKWA 4Q8EA 5D0GA 4C11B 5AQPA 4DS5A 3TABA 5IT9O 4LF7F 3HKWA 3IXQA 1MWZA 5J2MB 4KC5A 5D6GA 2OPQA 3ICLA 2CQDA 4NCGA 3VEVA 4X64F 2XHWA 2JEFA 2P9UA 3SCLE 3M7VA 2DNGA 3QFWA 3RWUA 4TXSA 2BTFA 1O51A 2ATLA 3KHHA 3OR2B 1FD8A 2NUBA 1I5OB 2O5DA 3N01A 1NH8A 2V63A 3EXYA 3T9ZA 3FLCO 4FJKA 2FJXA 3EICA 3OXFA 4PL7A 4M8LA 2XMTA 4DX5A 4F2RA 3DWLA 3N79A 4ECTA 4PWWA 1HNXK 4KKOB 3P1GA 4PKDB 4QQBA 3CJ9A 1NDPA 2AEMA 2HQCA 2W7AA 1CXQA 2KXFA 3V9XA 2YVSA 1TUGB 2DEJA 2EHGA 1V5VA 2FLPA 1N6QA 5GAHU 3GCXP 2QJ3A 1ZPVA 1XNRK 2HNDA 3L3CA 3E9OA 5EWFA 3AO2A 1S0VA 5KT7A 1N56A 2NXEA 2MGZA 1UFWA 2HQDA 3GTYX 4RPFA 1RU2A 4MT1A 4FS2A 2CQBA 2B6AA 4A46A 4RW8B 1B9FA 1Q16B 2QM1A 3QT6A 2V4RA 1HHTP 1F5CA 2AU0A 2AEFA 5DG9A 4LRDA 3LAMA 1B70B 4DU8A 4Z4IA 2HVHA 2WB1D 2M88A 2W42A 1MLAA 5LMNK 3ATVA 4OLPA 3PEHA 5A6WA 1HJOA 3DDNA 5AQSA 2QLJB 1ZBHA 2HHHK 4IFVA 1ZM9A 1BI4B 3ULEB 4FOEA 2IVYA 3AB4B 2ZJRQ 3EVWA 3O08A 5ETPA 4I68A 2IGIA 1IBMK 2YV0X 5LM7E 2EKNA 4Z0UA 4PYDA 1SUQB 5DLGA 1YJUA 1TR0A 3SQGA 2KJVA 2EK6A 4KAIA 4TY8B 5DQHA 2B4JA 2YHXA 1T9YA 1KHWA 1OPZA 3CB4A 3B4DA 1C0MA 1D8YA 3LM2A 4FLZA 3QO9B 2HAFA 2DVIA 4ZK7M 1NRKA 5BPLA 2UU9F 1EKEA 2XNRA 2EC2A 1KQFB 1KOHA 2P6TA 3GFYA 4NLRA 1DJ0A 5GAEU 1OQ6A 4IRDA 1F6TA 4YOVA 2FSKA 1WSRA 3CPWR 4RWTA 5LSLA 4LY7A 3VGLA 2VC0A 2B56A 1HQEB 1TP7A 4YDUA 4LD0A 1KVBA 4TN2A 2VZ9A 3QBXA 2EFOA 3I9V9 1S5ZA 4NLPA 1EXQA 3B6PA 2ZKTA 3LF0A 2DR8A 2ALYB 1I94F 1OH7A 3JS9A 4WF9L 4WJBA 5FPEA 4DR2J 2UXCF 1NGGA 2HRUA 2LQJA 3I4HX 5HATA 3CCMN 4B3SF 3K58A 3FBEA 3PY8A 2PC6A 3UB5A 2W7OA 1CJUA 1HPMA 2XZTB 5HROA 4TLRA 3NGRA 2FJBB 3IP0A 3ZXWA 2KKHA 3H4DA 3GV5B 1SC6A 3A5NC 5T7LB 4KIAA 2H4YB 2YCHA 3ZSQA 4CNZA 3PW0A 5KFAA 3B8HA 3HJVA 4XAKA 2BOPA 2WSCC 4NLSA 1RZMA 1VISA 4WFBL 4OKJA 2IYGA 3ITHA 4Y1DA 4RW7A 5D4NA 5GIOA 3G0ZA 3VALA 2NSBA 1KAXA 2YNFA 1EHWA 6AT1B 1HX1A 2NS1B 4DQQA 3K2YA 4QPXA 2Z2MA 4EBEA 2GIQA 1RAOA 3QPIA 4PQAA 3Q8VA 4N8OA 2N3LA 3KNAA 1DLOB 1HYSB 2V2KA 3MAAA 2E1YA 4GO7X 2X1BA 3ALYA 1Q9YA 3M2UB 2VODA 3J7YU 3THTA 2PEBA 2P9EA 3BZCA 3AHPA 2O8EB 1N5QA 2DBBA 2FVCA 4J9KA 1YUWA 2VV5A 2X6NA 3R5CA 1PCAA 1RKJA 3MM8B 1SJFA 1VQKS 2P9SA 1FJGF 2L3MA 3OBWA 5AQXA 3M6WA 3OBYA 4DPUA 1FE4A 4ES2A 1TYQB 3FR0A 2R2SA 5AJ3F 1J2VA 1T05B 3DRPB 3IS9B 3T1YF 3N0VA 2DH7A 1F2GA 5DGBA 5I3UB 2YHWA 3PUFA 3ZETA 2KRRA 2QLXA 5A8KB 4U7BA 2HHQA 2Y8WA 3D2EB 2AJQA 1VC0A 3CCLN 4JI3F 4LFAF 1LOUA 5E33A 4WQ4C 3SPYA 3GZ7A 4AQYJ 1WELA 3PYFA 1SQGA 3TW0A 4K8XA 3J8AA 3UE2A 3S9HA 3DXMB 2DHAA 4J5OA 2C3OA 3CNQP 5FDLB 4JI7K 2DTUA 3I56N 5KFTA 4BQZA 1HBUA 3CJ4A 2ZHOA 1NMNA 1NBEB 4I6WA 1K1SA 4AHRA 3F0NA 2P9NB 3FK4A 3T6JA 3BO2A 3H5YA 3W63A 2XULA 3ZZUA 3J7Z5 5BYQA 4ICLB 1HMVB 4KGKA 3OYCA 4CEFA 4FLVA 3EGWB 1QDUB 3QGIA 3GQCA 4DUYK 3W0LA 5GAHP 3EO3A 3JQJA 4E0DA 2IHR1 3B78A 3Q8RB 1VRUB 2XGPA 3GYXB 3MCOA 5LJ5Y 5J1PA 5E0OA 3BBFA 4JV1A 1P9QC 4ZLLA 1WF2A 4CHZA 4LF4F 5JUMA 4ZS6A 2JRSA 4GVLA 5BN9A 3WC2A 4DQIA 2HBKA 3GB0A 4WKYA 4EP4A 4CFCA 2IVFB 3VERA 4B1WB 1D8ZA 4OYXA 4K4SA 2H5IB 3UNGC 3MEKA 2BZ2A 3B6BA 4DR6J 4AL5A 2BW7A 4PEOA 2FBYA 5HLFA 1S1WA 3UD5A 1RBVA 1XBWA 1HUXA 3QEIA 5EDWA 1U2RA 2CQ2A 2LXIA 2KRBA 1IBLJ 3LO3A 2UUCJ 3H46O 2JWNA 4DR7J 1NDKA 2WBMA 5BRHA 3Q8PB 5C10A 3CJBA 2B4OA 4X62K 3NS5A 3JAMO 4S0MA 1NGCA 4NLWA 2BA9A 1RTHB 3CJKA 2LQ5A 3C6UB 1I39A 2GHWA 3IR6B 3HX9A 4CHQA 3SMSA 3KK2A 1LW0A 1S0MA 1VRTA 3FQKA 3NLCA 4DXLA 4Z94A 1VYAA 5GAEP 2KHDA 3A8IA 1HNWK 2XMUA 2KO1A 4CJLA 2CJKA 4QIWD 3EN9A 4FL9A 2MQPA 3Q2SC 3ZZPA 3CCWA 2YNIA 4HT7A 4U7UK 2HMIA 3L2QA 3TZZA 2Q6CA 4N56A 4RO0A 3H8YA 4FM2A 1UVIA 4XDCA 2Y1LB 3NNCA 4ILJA 2HQGA 5MLCV 2YNHA 3G6YA 1NGFA 4Y28C 1VHFA 4E89A 5CYMA 2I1RA 3SUNA 2OPRB 4U7CA 4DV5K 4F02A 3SUPA 3D1QA 4QIFA 3TZWA 4NXMJ 2E44A 4AE5A 1HBOB 4CFDA 4JI4K 3DNCA 4E98A 2A10A 3VOVA 1Q78A 4TQRA 1WAFA 4OKEA 3FBCA 1S48A 1WACA 4KTQA 1VHXA 1FXXA 4WE1B 5B0BA 4U8VA 1YBTA 3LP0B 5KRTA 1YJ7A 4X2BA 1Q18A 2BJ1A 3TUZC 4X66J 4FK2A 2ZD1B 4FOIA 3MR6A 1D9AA 2DGSA 5HVHA 1UEUA 2XSJB 2VDIA 1KSPA 1VIOA 1XMBA 1N8RO 2VA3A 1CZ9A 2CZ9A 2OELA 2OTJS 1EAYC 2GHPA 3BPDA 4FSVA 1J54A 1T9XA 3D2WA 5BPNA 2CDQA 2DKOB 2HFSA 5BREA 4WTYA 1YBAA 3J7YP 2V5HG 1FJCA 1DZ5A 4MDAA 2CNOB 3C7NB 2DXEA 3EVOA 3TVYA 1P27B 4LF5F 3UI3A 5DM6Q 3ENAA 4I69A 1LW2B 5CZ1A 2NRXA 3L3VA 3DOMB 2UXBF 1DQAA 4YB1P 3OTOK 1JLQA 1DTTB 1A5VA 2ZHAA 4UOCA 5D78A 1TAUA 3TAFA 3CC2S 5DQIA 1IJEB 4EI2A 1KR4A 2Y8YA 2ZH2A 4L3KA 4ZIWA 5A8WA 4F25A 4WQ5C 3JB9k 3O1WA 3CO0P 4JHDA 1AROP 1SVDA 2DY4A 4LSNA 4JKGA 3UVJB 3RB0A 5AQJA 4OI3A 1RDRA 2HNYA 3PV8A 1CC7A 2GX8A 4C23A 3R5DA 3MOJB 3P4UB 3GIIA 1VS3A 4EYHB 1NMDA 3KLFB 3CCVS 5KFBA 3MWPA 2OZMA 3AD8C 2HHTA 2M70A 4C6AA 1H1VA 5DLFA 1FF2A 1WSIA 3ZTRA 5M1KA 4B9MA 4H5RA 3CUNA 2V68A 1X9SA 2YKMA 4I67A 4XH1A 5HBMB 4KHSA 2KM8C 3T1HF 3LP1B 2NYIA 1EKRA 2O4GA 4LF7K 3KVGA 4L6V3 2HVIA 4QWEA 3MX2A 2D69A 5ETRA 4X64K 3A5MC 3C16A 2ZEJA 1P6TA 4FLTA 2JLFA 2ZBPA 1R31A 2FVPA 5AQRA 2MZTA 2G4BA 3NCPA 1U2VB 1K44A 4IUFA 1RCHA 4W4MA 4M41A 1RAEB 3ZT2A 3KUEA 3I0SA 1UKUA 4JV2A 3FZBA 4OKKA 1RYSA 1R7IA 1ZBFA 3IUCA 1TUUA 3MK6A 4HT5A 5BRFA 2ZWOA 4NPOA 5C2GA 2ZOFA 5AZJA 1RDAA 2Z0GA 2ZH5A 5FLXO 3AY0A 1URNA 5H1SV 3R1HA 3OUYA 2DGQA 2CNNB 3AQOA 3JYTA 2XHBA 4MLEA 1SV5B 2HS4A 4B9NA 3VAFA 2HWHA 1JLBB 1S1XB 4PWDB 1R59O 3AJ2A 4N76A 3WNEA 3MDQA 4JI5J 2OHDA 4FYWB 1SKUB 1KVCA 3ISND 1NPRA 2D4WA 1GMWA 4CZJA 4CJUA 4QWDA 3AB2B 4DN0A 3PR5B 4DR5J 5F8JA 3EL2A 4CCHA 3D1HA 2BJ7A 3KNGA 3BZKA 4F26A 3FRZA 3EVMA 7FD1A 4KHUA 2ASDA 4IJNA 4BR5A 2XB2D 4NMXA 2RE2A 4PKGA 3EXCX 3I6PA 2D41A 2RQ4A 1WNEA 2C2EA 1CXUA 1ASVA 4G1IA 3IWNC 4ID5A