2RKIA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase (RT) p66
total genus 153
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rkiA05
3NGIA 3KMQA 1WSHA 5CYMB 1CXQA 3SNNA 5I3UA 3OL6A 4O4GA 4MFBB 1ASUA 3V1OA 4F3TA 3MECA 2XCPA 3CJ3A 3CJ0A 1EP4B 3KK3B 1NJZA 2OPQA 4HUGA 4L8RB 2FVCA 4PA1A 3PJXA 4TYAA 1VRUA 1RT1B 4TY9A 4DTSA 5FRMA 2C28A 3SPYA 2HMIB 2VG6B 1VK0A 4KHWA 3OYEA 5KG3A 3DOLB 1S9EB 2BANA 2F8EX 4FJ9A 5EWGA 1BIUA 4JLHA 4Q5VA 2ETJA 4EYHB 1A5VA 4IFVB 2R8GA 4M41A 3IS9B 3BGRA 4FS1A 3OYCA 4N41A 2VA3A 2G8UA 5J2MA 3H5XA 1ZTWA 4TYBA 2DPJA 5KFXA 4CCHA 3QIPB 2XRIA 1C0UA 3TQ1A 1HYZA 2BGGA 3BQ2A 3MR5A 2WTFA 1S97A 4GW6A 3CJ4A 1D9DA 4CJPA 4ZP9A 1IKYA 1TK5A 2IS3A 4FJLA 5EWFA 2HNZB 3JSMA 4J9OA 3K5MA 2WONA 2X78A 4G1QB 3M8PB 3DMJB 2OPPB 3I5BA 3M8PA 5KFOA 3BQ0A 4OKJA 4CK2A 1TKDA 2OPRA 2HVIA 1RTJB 5F8JA 2XY6A 3QO9A 3U3YA 1LWCA 4DLEA 3FFIB 3NE6A 3CQ8A 4HTUA 3M8RA 5KFYA 1X9MA 4DF4A 4K4VA 1VRTA 4DL5A 2PYJA 3AVIA 4CHPA 3V6DA 4DU3A 4DU4A 1ZBLA 4TY8B 3S3MA 1IG9A 5EWEA 5DK5A 2YKMA 1ZBIA 4NLVA 3KLHB 5KI6A 4K4XA 3RAXA 1S0MA 2AX1A 5CYQB 3DI6A 1I39A 4F2SA 4K8XA 1HMVA 1J9AA 3LP3A 3KHHA 1N6QA 1RA6A 5KFLA 2IC3A 3V6DB 3OYHA 1U47A 4B9SA 2E6MA 5KRSA 2ILYA 2ASLA 2WCXA 4BWJA 3OJSA 1TK8A 2F8TA 5HRSA 4CGFA 4NLYA 4JV1A 1BQNA 4B9MA 4CJTA 3FQKA 4O3NA 3M9NB 4H4MA 4KFBB 2D0BA 4K4WA 4H54A 1LWFA 1NJYA 4RW9A 4Y2CA 2BQ3A 3PR5B 3QEIA 4WZQA 4DTPA 1X9WA 2HHSA 2F96A 1KLMA 2P1JA 5L1KA 3L2VA 4URSA 1GX5A 2B43A 4B9LA 2W8KA 4FW1A 1S6QA 3KLFB 2G8FA 3H5YA 1Z26A 1B92A 1SL0A 2QKKA 1RT6A 2FVQA 5KFZA 1Z25A 3NMAA 4ZP7A 3LP2B 4JV0A 4YP3A 4IG0B 3Q8QB 3QGHA 4EBCA 4OLBA 3NGDA 1MU2A 3LZIA 4CIFA 2IM0A 4J9PA 2C22A 3SUPA 3EZ5A 2DFHA 1MU2B 5F8GA 2R8JA 4WFXA 1LAWA 1SUQB 4I2QA 4Y3CA 4RNHA 4HVJA 1VSMA 3NGZA 4QWEA 2OZMA 3FSIA 3RMAA 4FCYA 3NHGA 4ZHRB 3OYDA 3BQ1A 3HSTB 4HUEA 2HWIA 2YV0X 3DLEA 1DTTA 1SH0A 5I42A 3KJVA 2R8KA 1J5OB 4MQ3A 3G6VA 4ZPBA 2HNYA 1X1PA 2HHWA 3P83D 3NH0A 3SUOA 3CDEA 1TKTA 4DQIA 4RNOA 4CF2A 1RYSA 2UVUA 4KO0B 4DSJA 3DLHA 4KO0A 2XI3A 1L3UA 4CF9A 2FVRA 1LW2A 4FK0A 1NJWA 3AA5X 5DLGA 4IH6A 3JYTB 4EP4A 4AHTA 2AQ4A 1TVRB 3TAMA 2JC1A 1SV5A 4MKAA 1S9FA 3AO1A 1SV5B 3LDSA 5KFPA 2R2UA 2ZQBA 4E0DA 4FZZA 3QIDA 1HQEA 1REVB 3QO9B 2BR0A 3LAKA 3FFIA 5T14A 5J2PB 3K2PA 3RMBA 3HVWA 4ZVGA 2Z1HA 2XI2A 3DLRA 4KB0A 1Q8IA 1IKXB 3KK1B 1TQLA 4ZVHA 4DTUA 4C8LA 4OGEA 3WNGA 4RW8B 3QZ7A 1JIHA 4TXSA 4Q45A 2DFFA 2VG7B 4H4MB 4KHQA 4ECYA 4FJJA 3PJWA 4MKBA 4PWDA 4AHCA 4KB7A 1TL1A 2D7SA 3RB0A 2QKBA 4KBIA 4M3WA 5C24B 4DFMA 1FXXA 4FS2A 1KHVA 4CFAA 1IKXA 3KK1A 5C25B 5DG8A 3VQQA 4NCBA 3PUFA 4DL4A 5KT6A 1HARA 2JEIA 4KHNA 1BI4A 1NOYA 2JC0A 4TQRA 1U45A 3KD1E 1BI4B 4KE5A 2F8SA 4I7FA 1MMLA 1KCFA 2BRKA 1XHZA 4PWDB 4M3XA 1WSJA 4QWAA 1S0NA 1BHLA 3HYFA 1R0AB 5CZ1A 4BE1A 5HLFB 1C0TB 2RF2B 4BE2A 4Z0UA 4O3RA 4LQ9A 2O4GA 2ZD1B 1FKOB 4FLUA 4B9VA 3SYZA 4OL8A 1S49A 4IH7A 1HJRA 3OHBA 3NH2A 3TWHA 1VSFA 3H59A 4CGHA 4J9NA 3KNAA 3M8SA 4I9QA 3DLEB 4RW4B 5J2QB 4IG0A 2P51A 3OL7A 3HVTA 3OYGA 4TSXA 2OPSB 5KFSA 3MXIA 3VQDA 4DS5A 4IG3A 1W0HA 5KFIA 4Z4HA 4RUCA 4KI4A 3LP0A 4K4ZA 4FYDA 3NF8A 4MK8A 2IJNA 3M8QA 3VQEA 1RBSA 3ZSOA 4JS4A 4CGGA 3EY1A 3TI0A 5KFCA 4U6PA 1I3AA 2VA2A 1W25A 3NDKA 3HVRA 4J2EA 1NKBA 3IS9A 5EU7A 4X2BA 1IKWA 5D3GA 3KJVB 3ZCMA 5C42A 3QETA 3PR4A 3C6TB 1WSIA 3RAQA 4QWCA 4IG3B 5KGWA 1C0MA 2XY8A 4O3PA 4WZMA 1REVA 3NAHA 4CEFA 1A5XA 3AO3A 2UVRA 3NF9A 3DM2A 3L2UA 4J2DA 2FC0A 3H2LA 2QK9A 2J6TA 2IM1A 2G8IA 3MEDA 1WLJA 3TARA 2W9AA 5KFNA 3KKSA 4LQ3A 4OGCA 2IAJB 3G0ZA 4K4SA 4FM2A 3D45A 3PW7A 5KT4A 5KFQA 4OLAA 1XC9A 5SZTA 3PO4A 3ALYA 3NF7A 3T3FA 4OKEA 5L1LA 1JLQA 5KG7A 3T5HA 3DRRB 4M45A 4ED0A 4J9QA 3HXMA 1JXLA 4DWIA 4Q0BB 1LWFB 3BREA 2X6NA 3OYAA 4CF1A 2ZE2B 1TK0A 4DL7A 1TAQA 4KHSA 4ZMMA 1XHXA 2PYLA 3OL8A 3MEGA 3MEEA 4OJRA 1YVFA 3PW0A 2HAIA 2HMIA 3SPZA 4CJLA 5KFBA 4FJGA 3CJ2A 3AA4A 5JS1A 3AVAA 4R5PA 1GX6A 3QERA 1JLFA 1ZETA 4N5SA 3OSNA 4AHVA 2I5JB 4WFYA 4CF0A 3U6FA 4TN2A 3EPGA 3QZ8A 3MFHA 1T05A 3UR0A 3VQBA 4NZ0A 1RTIA 4URGA 4I2QB 1T05B 3LAMA 1JL2A 3VA3A 1NK0A 3WNFA 3SCXA 1C0UB 3DLKB 1JLFB 4JV2A 3O4QA 1IKVA 2QE5A 1S6PB 1IKVB 1RDDA 3I0RA 4ZVFA 3ZT3A 1S6PA 4B9TA 2GV9A 4CHOA 1RT7B 2KFZA 3HP9A 4O3QA 5KGXA 3HVTB 1RILA 1IKWB 3T19A 5D3GB 1BGXT 2EX3A 4BWMA 4CE9A 4J9LA 3G6YA 3C6TA 2G8KA 2HHVA 1YTAA 1TKTB 2GIQA 3E01A 2BDPA 5KFAA 3KIOA 1HQUA 2BANB 2FJVA 4CEQA 4DQPA 2FVPA 3V4IB 4J9KA 5DGBA 3SQ0A 4IFVA 1C1CA 4RG8A 4DTNA 3CDUA 1QQCA 1N5YA 4CFCA 4CGDA 2D3UA 3JYTA 4Y1DA 3QEWA 3FQLA 3ASMA 3UIQA 4O3OA 1YT3A 1HRHA 4CHYA 5I42B 1NK5A 2FBYA 4FXDA 4DTOA 3OYIA 4ELUA 3L2QA 4QCLA 2UUTA 1XWLA 3BSOA 3CFRA 4Q43A 4O3SA 3H98A 3G6XA 4CESA 2GUIA 4RNFA 3CM5A 5KFKA 1RA7A 4K4TA 2YKNB 3VQ6A 4IR9A 4C8NA 3M9OB 3SQ4A 4RNMA 1UWBB 3ZSVA 3TAMB 4YNQA 3MR3A 5L1IA 4QW9A 4M94A 2B5JB 2W8LA 3KK2A 1LWCB 3KHGA 3DOKB 1RTDA 1I6JA 3MXMA 4Z4FA 2IBKA 3S3OA 3KLGA 2E9ZA 4FLWA 3JSMB 3OJUA 1IH7A 3RB4A 3PHEA 1J53A 5CYMA 4W5OA 4CJ5A 2OH2A 1SL1A 2Y1IA 5KFVA 1R0AA 1S5JA 1C0TA 4CK1A 2HNDB 5K14B 5KT3A 3ZSZA 2YNGB 3T5JA 1ASWA 1BCOA 2QV6A 4XIUA 1K1QA 3A2FA 2JGUA 2P5GA 3BSAA 1ZBUA 4KTWA 4LH4A 4AHRA 5J1EA 1L3SA 1RT2B 1QAJA 2XGQA 4QAGA 4DSIA 1K1SA 4WYLA 4CJ3A 3PX4A 3AVFA 1XR7A 4LSLA 2D0AA 4LSLB 3CDWA 3SJJA 1UAXA 5FROA 2BQRA 1C2PA 1NJXA 1LWEA 3RMDA 4ECVA 4PQUA 4NLWA 4FLYA 1L5UA 1WN7A 3NAEA 1RT3A 4R8UA 2JLEA 1WNEA 4DG1B 3K58A 3T1AA 1N56A 4DFJA 3SUNA 4BDYA 4B9UA 4AH9A 4TLRA 1ZTTA 2AJQA 3NL0A 4EZ9A 3TANA 4LD0A 4N76A 4U7CA 4MFBA 3LWLA 1QTMA 3GIKA 3IRXB 5HROB 5KFRA 2V9WA 4CJUA 1VSIA 4AHUA 3PW4A 1O1WA 3KHRA 3WNHA 4JS5A 4KKOB 5DQIA 1JLAB 3QNOA 1HNVA 3IN5A 2W9CB 3V9XA 4F3OA 5F8HA 3NBPA 3SI8A 1NK7A 2HNZA 5I3UB 5KFUA 4K4UA 3MAQA 3DMJA 4CEZA 4RNNA 4YR2A 2A1RA 4FBTA 3I8DA 2G8WA 2RKIB 1LW0B 4FJHA 3I0RB 1CZBA 1D9FA 4FLZA 1L3VA 4FZXC 4O5BA 4CGJA 2C2RA 2WK4A 4NRTA 3AVKA 3PY8A 4CJVA 4Y34A 1S1VA 2E6LA 2Z1IA 3C95A 4IBNA 2Z1GA 3Q8RB 3MEDB 1K6YA 3BSCA 3F9KA 4KFBA 3OHAA 1YTUA 3TAGA 4M3TA 1IKYB 3T5LA 1JLEA 2D0CA 3AVHA 4CJRA 5JXSA 4E19A 1Y97A 4ZTFA 2OA8A 3UDLA 1Q9YA 4DTMA 4FZYA 3LPTA 4DF8A 3OYMA 4I9LA 1RTJA 3OYNA 3P1GA 2R7YA 4DSLA 4IDKB 3GIMA 3VQ8A 1VSLA 4BDZA 1HPZB 3DLBA 3E51A 3K5OA 2DPIA 3GV8B 1HPZA 3I5CA 2YNIB 3AVGA 3L3UA 4EYIB 3PO5A 3C6UB 4YQWA 3NGYA 5KT5A 5KG4A 4CEDA 1S9GB 3D28A 2D41A 2WONB 1BISA 4O44A 4FLTA 4AHSA 3V1RA 4MIAA 1C1BB 3HPHA 4FJMA 2VG7A 2XGPA 1C1BA 2KZMA 1OS5A 1HNIB 4K50A 4J2BA 3VQPA 4CJ4A 1EXQA 1N6QB 4PY5A 4FW2A 3IGVA 1HYSA 1S9GA 1BIZA 4B8CA 1NK9A 4DS4A 1HYSB 2DTUA 4LSNB 3KHLA 4NLQA 3GV5B 3AVLA 4LY7A 5DQGA 2AGOA 3H5SA 3NH1A 2ZD1A 3BDPA 2ALZA 4E7KA 1JLBB 4QW8A 3MECB 4YR0A 3H5UA 3NAIA 3VQ7A 3DRSB 3ISND 3LANA 5HLFA 1BQMB 4LH5A 1TV6A 3HJFA 1HYVA 3ZT1A 5JS2A 3CJ5A 5T7BA 1A5WA 1QE1B 3B6PA 4I2PA 1UA1A 4ZP8A 1UOCA 1WSGA 5KG2A 4I2PB 3GIIA 3ZT4A 3LP2A 5KTQA 3OLBA 3UQSA 1BQMA 4NCGA 3OY9A 1JLCB 4FBUA 3MFIA 1XR5A 4EO6A 5DLFA 1TVRA 4C8MA 1RDRA 4NLGA 4EP5A 4G3IA 3KLFA 2OYQA 1DLOB 4IFYB 3Q8PB 3AVJA 2IM3A 2VG5B 4Q0BA 1TKZA 3H4BA 1T94A 5J2PA 3AO5A 2V4RA 4EZ6A 4W5RA 2XY7A 2FBVA 4TY8A 4OPJA 3VQCA 3OS2A 3SZ2A 2XWYA 4IFYA 4M42A 4CHQA 1J54A 3KK2B 4O0IA 4CJFA 4JRPA 4CEAA 1DTQB 3PZPA 1VRTB 2E9RX 1HMVB 3KMSA 4N47A 4ZHRA 5F8IA 4KB1A 3C6UA 3OYBA 2ZE2A 5KFWA 3ZT0A 2IC3B 2CKWA 4DQSA 2HB5A 4NLUA 1RCHA 3SFGA 1U09A 4ELTA 1S1TA 1RT5B 2YHAA 2ASJA 3HPGA 2HNYB 3QEXA 3OYFA 4HCBA 3LWMA 2BQUA 1TL3A 5DGAA 4R5PB 2WOMB 4E89A 4IQXA 1SH3A 1SKWA 3LP1B 4CECA 2YHBA 1EETA 3O3GA 4EO8A 1RYRA 1S1WB 4NLTA 5CY4A 2UVVA 5KFDA 5KT2A 4WFZA 3HL8A 2RDIA 3QLHA 4FK2A 1RDAA 4KREA 4DG1A 5L1JA 3ISNC 3AO2A 3DOLA 4IRKA 1X9SA 3M8QB 1S9EA 3RB6A 2EHGA 2J6UA 3KLIB 5KG5A 3AA3A 4W5TA 3VA0A 1NK8A 4KTQA 4YFUA 3IG1B 2RDJA 4F4XA 2HHQA 4W5QA 2BE2B 4RZRA 3OLAA 5C42B 1N4LA 4CJEA 1GOAA 3DYAA 1WAFA 2BE2A 3VQ9A 1JKHB 1S6QB 4CJQA 4ECQA 3DLKA 2KQ2A 2OPQB 3MR2A 4W5NA 2YNIA 4ID1A 3E01B 4B9NA 1ZBHA 1BCMA 3HPOA 3SUQA 3QNNA 2XO7A 4GMJB 2KTQA 2YKNA 5J2NB 4E1NA 3OYKA 2R2RA 3AVBA 4HHTA 4Z4IA 3VQ4A 2FBXA 4GC6A 3BR9A 1J5OA 3SQ1A 4KHUA 1JKHA 5HROA 2ATLA 3OL9A 2FJXA 2B5JA 4ED8A 2ITGA 3H40A 5F8LA 1FK9B 3KD5E 1CZ9A 4RU9A 1KTQA 3NF6A 4QOZB 1RDBA 1C1CB 4GC7A 3LZJA 1RT1A 1LV5A 1KFDA 2B6AB 4FJ5A 3N6MA 1RAJA 3NBPB 4NYZA 1GOBA 4CK3A 5HP1B 4IRCA 3DRRA 3PW5A 5KFMA 4ZPDA 4FLVA 3WNEA 3V9ZA 2HW3A 4HUFA 4CEBA 3H08A 1LW0A 4KV8A 4ECUA 1RT4A 4CFBA 2X74A 2WRMA 4H4OA 1N5YB 4KAZA 1RT4B 1FKPA 3SV4A 1C6VA 2Y1JA 4IKAA 1F21A 3DRPB 1T7PA 1UWBA 3L2RA 4IOBA 5FDLA 4QPXA 3KLVA 3ZSXA 4RW8A 4ELVA 3THVA 4J9RA 1NKCA 4AILC 4M3YA 4FJNA 3ULDA 4ED1A 4CEEA 1S4FA 1VSHA 3TVKA 3AVCA 3V6JA 1SL2A 3LP1A 4DQQA 2UVWA 1EETB 1NKEA 4H8KA 4ID5B 1S10A 1UA0A 2ILZA 2NUBA 3QGIA 4BE0A 3ITHB 4ID5A 2W9BB 1S1XB 3NCIA 3ITHA 2AWZA 2FBTA 2W9BA 4DL2A 4E1MA 4Q8FA 5KG1A 1NNDA 3LALA 3DDKA 1JLGA 4ECTA 4FJ7A 2B4JA 2IDOA 1CXUA 3KLGB 3L8BA 4F4YA 1T03A 2LSNA 5FRNA 3RB3A 2AGPA 3VQAA 5KT7A 4ZP6A 5KFJA 3TR8A 2J6SA 1BQNB 3DYAB 1RBUA 4O4GB 4EBEA 4ZPCA 3GQCA 4DSKA 4GVMA 1ZYQA 4PQUB 3V81B 2Q3SA 1HNIA 4DL6A 2YNFA 3DLGB 3KLEB 2KFNA 4ECWA 4Z4EA 3GIJA 3LPUA 4CHNA 4ZTJA 2FLNA 4WE1B 1RDCA 4FK4A 5HRRA 3KLIA 4ECZA 3M9MB 3BGRB 3AO4A 3FDSA 1TP7A 3ZSYA 2FLPA 1LWEB 4C8KA 5KFHA 3TAFA 3OS1A 1RBRA 4M3RA 4DQRA 3QEPA 4DLGA 3GYNA 2PZSA 1RT6B 1C1AA 4DTRA 3TABA 4CIEA 4MH8A 4NCGB 4WYWA 3I0SB 4IKFA 4ECXA 4B8AB 1JXEA 3RTVA 4RW6A 1NOZA 3B6OA 5J2QA 3HHKA 1U49A 5J2NA 1KLMB 1CLQA 4WXWA 3QLHB 5KG6A 1YVUA 4DU1A 3AA2A 2OPRB 2YNHA 5DMRA 1RTHB 3CM6A 2HHXA 2I5JA 4JUZA 3NFAA 1RTHA 3RRGA 3CG7A 5KG0A 3CFOA 4TQSA 4CIGA 1U04A 3IG1A 2PY5A 4ED2A 4NLXA 2HHUA 2RN2A 5F9LA 4MK7A 2WB4A 2D5RA 1TAUA 3OYJA 4ICLA 2V0NA 2BRLA 3RBEA 5L9XA 5E41A 3TAPA 4OKKA 1BL3A 2YNHB 2VWKA 2W7PA 4IR1A 4CJWA 3V4IA 3QEVA 4E7IA 4NRUA 3AVNA 3QINA 5KFTA 2C2EA 1HNVB 3OSPA 3K5LA 3RMCA 1S1UB 5F8NA 4NYNA 1S1TB 1KRPA 1KHWA 4ED7A 3RBDA 2YKMB 4CEOA 5FDLB 4KAIA 1FKOA 1S1XA 1TKXA 3KLHA 4FJ8A 2W42A 1QSYA 1TKXB 2HWHA 1WNSA 1DTQA 2IAJA 2WOMA 3SI6A 1JLEB 2XHBA 4O0JA 3G86A 4N56A 3HP6A 3F73A 1U4BA 4F50A 4EBDA 2OPPA 3L2WA 3PVXA 3O3HA 2XCAA 3HO1A 2IMWP 3AVMA 5EDWA 4KHYA 1L3TA 2G8HA 2JEFA 3GILA 4H4OB 1JLGB 4RUAA 4KHRA 2E9TA 4E3SA 1VSKA 5C24A 4FM0A 4PUOB 2O4IA 2Z1JA 4RW7B 3KKRA 3H4DA 1TV6B 1NK4A 3MEGB 3MEEB 4RW7A 4ED6A 1D1UA 2R2SA 2P5OA 3HVAA 3P5JA 4WXOA 5DG9A 4E7LA 4XPCA 1SUQA 4CGIA 3VQSA 4ED3A 5SWMA 3G10A 1JLBA 4KTZA 5CYQA 3CYMA 4DTJA 1EP4A 3KK3A 2R2TA 4HKQA 3MF5A 4DL3A 4NCAA 3KOAA 3BJYA 3DLGA 3KLEA 1SH2A 1WAJA 1T8EA 4KPYA 2VWJA 4WE1A 1T3NA 4DMNA 1QS4A 5KFEA 4R0EA 5DG7A 1S0OA 1D0EA 3MTKA 1RT2A 1LAVA 4F4ZA 5JUMA 4FM1A 4NLOA 1KLNA 1NHVA 2IOCA 1TKZB 1VRUB 3ICLA 4LSNA 2C2DA 1B9FA 1G15A 3HKWA 1IM4A 3EYZA 3DM2B 3N6NA 1S1VB 4OPKA 2W7OA 1D5AA 4FJKA 3ZSRA 2A1SA 2QXFA 3U3GA 3DRSA 4NLRA 1RBTA 4M95A 5KRTA 3SFUA 1JLCA 5F8MA 4NLDA 2FJWA 3CIZA 3KTQA 3D5MA 3PX6A 3QIOA 1D8YA 1NK6A 2GIRA 2XC9A 3CFPA 3S3NA 5F9NA 4JRQA 4QWBA 1CSJA 3ZT2A 2WHOA 4MK9A 5EUHA 3LP0B 3SV3A 2CJQA 1U48A 2DY4A 1HQEB 1JLAA 4KKOA 3QYYA 1KFSA 1QHTA 1TL1B 3HK2A 3IAYA 3VQ5A 3V6HA 1Q9XA 4DSFA 1QSLA 4F4KA 5HBMB 4CERA 2KW4A 3IRXA 1RT5A 3O3FA 4XO0A 4E7HA 3D0PA 4J9MA 4IDKA 4FVMA 4I7FB 4FLXA 2X6SA 1SKRA 2FLLA 4Y2AA 3PV8A 1VSEA 2UUWA 2W9CA 5KFGA 2HNDA 4ICLB 5K14A 3RR7A 2YNGA 2ASDA 1RNHA 1JL1A 4FJXA 5CZ2A 1S48A 3CWJA 1KVBA 3S9HA 2R8HA 1TL3B 2IJFA 4K8ZA 2JEJA 2FVSA 4RW9B 2G8VA 4J2AA 2KZZA 1WSFA 3MXJA 5C25A 1T03B 4NYFA 1RT7A 4XPEA 4Z4GA 4YMEA 1IO2A 1QE1A 3I5AA 4DFKA 3EZUA 4F4WA 4IH5A 1TGOA 4HYKA 3V81A 3QIPA 3MR6A 2AU0A 2YNFB 3QGGA 1B9DA 5KFFA 2XY5A 4K4YA 5HRNA 4O44B 4RW4A 4KSEB 3Q8SB 3EPIA 1RTIB 5HRPA 4NLSA 4Q8EA 1ASVA 3RRHA 3V9SA 3GV7B 1DLOA 4ECRA 1GOCA 4B08A 4F2RA 1ITGA 2EC0A 3QESA 4PUOA 1FK9A 3V9WA 1SKSA 4CJSA 1KSPA 4RW6B 1DTTB 3L3VA 2E4LA 4CHZA 1JXBA 2OPSA 1JX4A 5J2MB 2D3ZA 4ZPAA 2VG6A 2R8IA 3K5NA 2RPIA 4C8OA 1EX4A 3FRZA 5HP1A 4O4RA 1EKEA 3PX0A 1KVCA 1HQUB 4CFDA 4BDPA 3HM9A 1W9HA 1ZBFA 3DI6B 4DFPA 2VG5A 1N48A 3PW2A 3RWUA 2HVHA 1RTDB 3C94A 4YR3A 3ZSQA 2GBZA 2B6AA 3ZSWA 3NKYA 2HHTA 4F8RA 5C5JA 5HBMA 1RBVA 4DEZA 1FKPB 3TAQA 3IGNA 4J9SA 3DRPA 4NLPA 3UPFA 3SQ2A 2ZKUA 4B3OA 2RKIA 3OVNA 4Z4CA 3VN5A 2I1RA 3CO9A 2GC8A 2DFEA 3K57A 4EEYA 3T5KA 4MIBA 3OS0A 4E7JA 4DTXA 1KVAA 4ECSA 1LW2B 3BSNA 4O55A 1S1UA 2O5DA 1XR6A 3V6KA 4CF8A 4BACA 4M3UA 2IA6A 3AV9A 4IRDA 4G1QA 1S1WA 1QSSA 2IM2A 1JLQB 3CVKA 3TAEA 4HCCA 4B3OB 3OYLA 2AGQA 4OVLA 4KV8B 4CJKA 2ATQA 4Q44A 5J1EB 4FJIA 4QWDA 2JEGA 1Z4UA 4KRFA 1NHUA 4UQGA 3V1QA 2AX0A 1XI1A 4Y1CA 1VSDA 1QUVA 2OZSA 3O4NA 3K59A 1QAIA 5DQHA 4URQU 4KI6A 4ZVEA 1WSEA 1VSJA 4DSEA 2V4QA 1RT3B 4R8UB 3DOKA 3V9UA 3N6LA 4M3ZA 3RR8A 2IGIA 4KHMA 3I0SA 2RF2A 3HT3A
chains in the Genus database with same CATH superfamily
1R8PA 3KMQA 2MJUA 3B4MA 1CXQA 5ETMA 2HFUA 4JI2F 1VAZA 4MIWA 4O4GA 1NGDA 3V1OA 4FXWA 3MECA 3CJ0A 3KK3B 4A8FA 4BRMA 4Y00A 4ZVOB 1FRXA 2E8AA 4A8QA 3GDQA 4G9ZA 2FVCA 3PJXA 3MCPA 4TKTA 2EBEA 4JI2J 2ZHOA 2MQ8A 3JAMY 1VK0A 4KHWA 2DISA 3JSRA 3M6WA 3NNHA 1KR4A 3S01A 2F8EX 2VODA 1H7WA 3TEHB 3VF6A 5EWGA 2V8GA 2ETJA 4EYHB 2EC2A 2HVDA 4OZ2A 4M41A 3IS9B 3OYCA 2HS0A 2W01A 1WUAA 5J2MA 4PXDA 4TLQA 2BJDA 3AQPA 3L7UA 3D6HB 4CCHA 1WF0A 3QIPB 4F25A 2N3OA 3RBZA 2EWHA 3CJ4A 3A3NB 3UB5A 4ZPVR 5A0YB 1IKYA 1TK5A 3L4QA 2E5JA 3MX2A 2X78A 3M8PB 4DBQA 3DMJB 2AKWB 1W2BR 1TKDA 2HVIA 3ENBA 2XY6A 2JJ4D 3OBYA 5LXYA 4DLEA 2JX2A 4DN9A 2NSBA 1VRTA 4H5WA 3D7EO 2BW2A 1TUUA 2LEAA 3V6DA 2L9WA 4DU4A 3SCLE 2VU5A 5E5NA 4NLVA 3QJJA 3KLHB 4JKFA 2CVEA 4H0PA 5C2GA 2ADBA 1T3VA 2AX1A 1D4XA 5AE3A 2ZC4A 2DGSA 3W62A 1GLBG 4K8XA 4ILMA 2I2YA 2I7PA 3DLJA 3KHHA 1N6QA 2IC3A 2KXNB 1ZA1B 2E6MA 2ASLA 5JLHA 4J9UE 2KM8C 1XERA 4JV1A 1BQNA 2B8QA 4B9MA 2VJUA 2DR5A 2EBGA 2RS8A 2AJFE 2PSZA 4QU7A 1HNWK 2HF3A 2ZWPA 3VEZA 4RW9A 4Y2CA 1I1GA 3OD2A 2DNLA 3HRGA 2P1JA 1MMDA 2COLA 1M1HA 4BQLA 1X4BA 4XDDA 4B1ZA 4N8NA 4AYBD 4FW1A 1KD1O 2G13A 3KLFB 2DNKA 2QKKA 1S5ZA 4EMDA 5AQUA 2FVQA 3NMAA 4FYYB 3N01A 1PG5B 2IPOB 1X5TA 4LBIA 4EBCA 2V2KA 2N3LA 1MU2A 4CIFA 3L0QA 1FRIA 3SUPA 4PYDA 1H7XA 1FJGF 1W2IA 2EW9A 4CZJA 4HVJA 1VSMA 1FWPA 3FSIA 2BUNA 1M5KC 3NNAA 1PBUA 1NSKL 3BQ1A 3CE8A 4KC5A 3LF0A 1DTTA 1SH0A 4DR3K 4GKJK 2HRUA 4O8KA 4UTGA 4MQ3A 4ZPBA 2I38A 3BEXA 2HHWA 1SCJB 4CF2A 2ZDPA 1BG3A 1BHNA 2YWWA 5FIIA 2VKZG 3DLHA 1Q1KA 3HZ6A 2BUPA 2CQGA 3CCMS 5DETA 1FO1A 4H4KC 4IH6A 4AHTA 3GZ7A 5K20B 2FZGB 1WTFA 3TAMA 1Y10A 3CJBA 2E20A 2RT3A 5KFPA 2R2UA 1S22A 4E0DA 4FZZA 3DRYA 3QIDA 2K7JA 3RGIA 2BR0A 2EFNA 1J5EJ 1PYSB 2GMHA 3FFIA 1SC4B 2JVRA 5T14A 3RMBA 1Z2ZA 4K42A 2M7SA 2LU1A 3GBTA 5F41A 1N33J 2Z1HA 4DTUA 1K73T 3WNGA 4RW8B 4MO4A 4K8RA 3MM5A 2A6OA 2DFFA 2DGVA 1BMQB 4H4MB 4KHQA 2BVZA 1QD1A 1AXQA 1U0SA 2V94A 5E7OB 4M3WA 5KOXA 3CC4N 1YITN 2J0QD 1KHVA 1BC6A 5DG8A 1U2RA 4K59A 4DL4A 1Z6RA 1J2VA 5KT6A 2UU9F 3IC1A 5F0XA 4KHNA 4OYMA 1BI4B 1J6ZA 5THWA 2V68A 2GNKA 4Y0FA 4CNZA 2BYCA 2R7VA 1XMBA 2ZBRA 4DR7J 4BE2A 3P3DA 4Z0UA 1NZAA 2MB0B 5M1PA 3ZZYA 5ADZA 2RUGA 4B3TF 3IR5B 1D3WA 3RG6A 2FXUA 4IH7A 1HJRA 3NH2A 2YTCA 1QVFM 1DEJA 2Q31A 1N33K 4CGHA 2P9NB 2VJVA 4AE5A 2AP1A 3M8SA 3KNAA 4I9QA 4IG0A 4BY9C 3M2VA 4TSXA 2CPFA 1UJ5A 3AOCA 3KZBA 3MXIA 2W4PA 4E1JA 3UD4P 1NWKA 1W0HA 1L3KA 4Z4HA 3S7RA 4K4ZA 1RJJA 2IJNA 1IR0A 3EKSA 2FJAB 2BZ2A 3TJAA 4HLBA 2W40A 2VD3A 3K5PA 4L76A 1UVMA 2E2QA 3CD6S 4M8LA 2PMZD 4X2BA 4X4UA 3QETA 2NNWA 2PA8D 1UEVA 2ALYB 2QA4N 4WZMA 1REVA 2HLUA 2JRSA 4JKGB 3NAHA 2HAFA 4ANDA 2IIHA 4HI1A 1QUPA 5E2QA 3DM2A 1BO5O 1Q18A 2IM1A 1WC0A 1G7CB 2KG1A 2W9AA 5B0BA 4BRAA 2ZH3A 1VRQC 5K8OA 3G0ZA 3D2FB 3EEQA 3D45A 4YHHF 2KYZA 3PW7A 4B1UB 2E44A 3SAGA 4L3KA 1OY8A 3J80U 5SZTA 3PO4A 1KC8T 3MOZA 3T3FA 3FBBA 1UW4A 4DPWA 5L1LA 1JLQA 2LU2A 1U2FA 4B3MJ 3HXMA 1H6KX 4DWIA 3HFKA 3BREA 1OIAA 2UUCK 3CMQA 3R3TA 3OYAA 4CF1A 1XHXA 3MEGA 3PW0A 2Y8WA 2HMIA 4L6V3 2R7TA 4YOXA 3SPZA 4CJLA 1VQ7S 2ROGA 4IO9Q 3D1HA 3CQYA 1RGIA 3EE9A 4LVNP 3AVAA 3QGPA 3QERA 4QBUA 4CF0A 3UW1A 4TN2A 2ZH4A 1KONA 2XZDB 1YBUA 1FRMA 4FN5A 3EDQB 1RTIA 1FVSA 4NPOA 3C15B 3VA3A 2V2VA 3WNFA 3ONQA 3W3SA 3DLKB 3BEGB 3D2EB 4JV2A 3O4QA 2QE5A 1CC7A 1F2HA 4C6AA 1IKVB 2FY1A 3GFYA 4ZVFA 3QATA 1R6VA 1RUSA 3HP9A 4O3QA 3CCJS 2KM8B 3WIUA 2VPZB 1QTNB 3ENQA 3UD3P 3OPKA 2L41A 3BB5A 4CE9A 2HHVA 2Z2ZA 5KPRA 2BANB 2EKNA 3A8IA 3P45B 5DGBA 3SQ0A 5K8MA 4RG8A 1PJ5A 1I94J 4CFCA 1DHMA 4M5DB 3GP9A 3JYTA 2ZHBA 3FQLA 3ASMA 3UIQA 2CPDA 1HRHA 1YT3A 2E5LJ 4H0VB 3MN5A 1GFWB 4ELUA 4L3NA 4JI2K 3L2QA 4CZCA 2P9GA 4QCLA 3ILJA 2UUTA 5F2RA 3CFRA 3QRQA 2OUGA 3LQVA 4CH0S 5AQVA 2X3GA 1FCAA 3W1YC 2DRAA 2FIUA 1FWKA 4W92B 2V2ZA 3VQ6A 3EWGA 3O6QA 2BE9B 3CCRS 2M9KA 4RNMA 3ZSVA 2OELA 3CDBA 2W41A 1U02A 3ISZA 2E7VA 3KK2A 1LWCB 2ACMA 4OLOA 4FOIA 1OH6A 5LMUK 3C16B 3KYLA 3S3OA 2RAQA 4KGKA 4DR1K 3H7HB 3OTOJ 3MD3A 3TJ8A 1NDKA 2BACA 4JKGA 3OVBA 2DB1A 2L9NA 2Y1IA 1N34F 3D0HE 4DR5K 1R0AA 2X1AA 4ED4A 2J4RA 4A8YA 1C0TA 3P38A 3C0BA 4CK1A 2ZH5A 2QXLA 1P8ZA 3VWSA 2UZAA 3PRBA 3ILOA 1TUVA 4OZ1A 3UKUB 2NUHA 1BE4A 2D0PA 3OQ2A 4FPBA 2RNEA 5GMDA 5MAOA 1MMNA 3A2FA 2MKJA 3BSAA 1N36K 1U1PA 3FZ2A 2AF6A 4KTWA 4AHRA 3NLCA 1FE0A 4BRDA 1K1SA 2O66A 4CYUA 4WYLA 2I7NA 2QEXS 2R7XA 4C11A 4B3SK 4ZJLA 2D0AA 3SJJA 3KVGA 4PQUA 3J7AN 4FLYA 2NREA 1L5UA 1PJ7A 1WN7A 1Q7YO 1RT3A 3US5A 4DG1B 1I5OB 4A5BA 3SMSA 3NGRA 3EN9A 3SUNA 2VBYA 4KH5A 4I6MB 2VDHA 4TLRA 3G4SS 4LD0A 1VISA 2BOAA 2DJWA 1QTMA 3FZBA 3QMQA 2LA4A 5HROB 2O3DA 4BC7A 3NXZA 1DURA 5AQIA 2LQ5A 3QFHA 1WC6A 2C3UA 4X65F 5DQIA 4EUVA 2D3O1 3CULA 1RXOB 3IMQJ 2Z0GA 2IDLA 4JP8A 2EKYA 5F8HA 4NA1A 4L3QA 3W65A 4LC9B 1XK8A 1YTYA 5EHHA 2HNZA 5KFUA 1ZAXA 4K4UA 1TFWA 3V4MA 4F0KA 2A1RA 2RQMA 3WXKA 3I8DA 3C14B 2G8WA 4FJHA 1UMJA 4ZVSB 4NEZA 1VJWA 4FZXC 3JB9k 2NSCA 4GKJF 4CJVA 1R0BG 2Z1IA 3JXUA 3LM2A 3TRGA 1MWMA 3Q8RB 2MKSA 3MCNA 3IWXA 1XJWB 3VTIA 6FD1A 1ZBTA 4NZ7A 2IRUA 5HN0A 5AQRA 4KFBA 1KS2A 4ES2A 1WTBA 1HIYA 2FHOB 1IKYB 1JLEA 1RHUB 2D9OA 4CI6A 4USJC 3L7OA 5JXSA 1Y97A 5JVHL 2OA8A 4C8ZA 2CDQA 3UDLA 4FZYA 3MR7A 3VF0B 1AZSA 4DF8A 4K25A 3OYMA 3WBZA 2QWLA 2B9WA 3OYNA 4DSLA 1VSLA 3NS5A 3DLBA 2O8BA 2BW7A 2HBJA 3K5OA 2YNIB 2ASOA 4EYIB 1FNXH 2PEHA 1S9GB 4LF6F 1MWYA 1X4GA 3BF3A 5M1OA 3PFOA 4PWWA 4AHSA 4NXMK 5LY3A 2EG2A 2IJRA 4DPYA 1UL3A 1HNIB 4K50A 1HNWJ 1OVQA 1FI4A 3VF4A 1BIZA 4B8CA 2FGOA 3CT9A 4DS4A 3W2WA 2PAVA 5DQGA 1WG5A 3PIPL 3IM9A 4IYQA 1JLBB 2QWRA 3GL1A 3UCUP 4BRKA 3NAIA 2WFBA 5I4MA 1RAGB 3R5BA 3JSYA 2G1DA 3BDEA 3CJ5A 5T7BA 3BGLA 1AA1B 1QE1B 2XHWA 3S8SA 4F3QA 3PEHA 4DR7K 1WWHA 4WFAQ 1UOCA 1FNOA 1IBMF 1GH8A 3ZT4A 3LP2A 4P75A 1BQMA 4DV4J 3LA0A 3MM7A 1N34K 3JAMO 1IWAA 1JLCB 2MKHA 2KN4A 4BRHA 3MMAB 2D4WA 5DLFA 2DNGA 3V2UC 4IWVA 3KG4A 2R7SA 1DY3A 1VQPS 2CJBA 4IFYB 2DHAA 1H1VA 4F36A 2C3MA 4LF7F 3O2IA 2IM3A 2MTLA 4L74A 4X64J 3H4BA 4HTLA 3GG1A 2KH9A 5J2PA 3DOMB 1QQOA 1YJRA 2FSNA 3FMWA 4W5RA 2XY7A 2HHHK 1YVNA 4TY8A 3U8XA 3OS2A 2J0SD 1CS4A 3CCVS 4M42A 4QQBA 2A2CA 3PZPA 1VRTB 2V6AA 1UKUA 3GFXA 3OYBA 4HACB 1A6LA 3RUBL 1S1TA 1RT5B 2OI2A 3CTRA 4JOUA 3FEYB 2KT3A 1LOTB 2BQUA 1KAXA 1TL3A 4UZBA 2XLKA 4DUZJ 5CE3A 4JHDB 4R5PB 3ZTPA 5D15A 4IQXA 3Q7BA 1VC5A 3OR1A 3LP1B 1M5OC 2YHBA 1YBTA 3NG8A 3UN5A 3O3GA 2H65B 4OZLA 5E26A 1YJ9S 2H54B 2JWLA 2UVVA 1MW7A 4WFZA 3SQOP 4USTA 2RDIA 3QLHA 4FK2A 3QWUA 5LMUJ 1U0HB 3M8QB 4G65A 1KOOA 3RB6A 2J6UA 4W5TA 3AA3A 1NK8A 2CFXA 4YFUA 3IG1B 2VQFJ 4RBVA 3WIVA 3M8ZA 1K9MT 2BE2B 4RZRA 5C42B 3BR8A 3BM7A 3VQ9A 5BJRA 4M5HA 2M70A 4ECQA 2CNLB 2YNIA 4WQ5A 3ZETB 1BCMA 2WBNA 2MQPA 3QNNA 4NXNK 4YOTA 1VLOA 4E1NA 5DDPC 4Z4IA 2CZ4A 4GVBA 4GC6A 3BBBA 4OV1A 4OHZA 1NDPA 2QRRA 5TKWA 3H40A 4ZPWR 2G0CA 4RU9A 1C1CB 4GC7A 2DK2A 1RACB 3EX7B 1RT1A 4NI2A 4FJ5A 1ITPA 4LRFA 4I69A 1NGEA 2Z30B 4LT6A 4XH4A 3NMUA 1OSDA 3DRRA 1X4DA 4FO0A 5FJ4A 4PKDB 2BMBA 4FPAA 4YB7A 5AQTA 3W2VA 1G1XA 4DV7F 4A8OA 1VHXA 2GVZB 4KAZA 4BR2A 2R7OA 3BF1A 3SV4A 2WVCA 4H5TA 1T95A 5AQLA 3PIOL 1T7PA 3M30A 1B7YB 4USIA 1G6BA 3THVA 1Q7LB 4AILC 2BH1A 1VSHA 1IR2A 2GHPA 5AQNA 3V6JA 5IWAJ 3ENHA 2Z56B 3MMAA 1EETB 4ILJA 1OY6A 4ID5A 3NCIA 3ITHA 2W9BA 4DL2A 5G0RA 3HHNB 5KG1A 3LALA 3DDKA 1R27B 4ECTA 3TZYA 3EJMA 1RLDA 2B4JA 2KL8A 4PCQA 3QT7A 3L8BA 1VQMN 2AGPA 1KKHA 4FWSA 5KFJA 2XMAA 5AR0A 2YWHA 2E29A 2MLXA 3TUPA 3KDNA 3QBXA 3AAPA 4EGLA 2Q3SA 3Q24A 3SBTA 5HATA 1PO6A 2ATCB 4YY3F 4ECWA 4WTOB 4Z4EA 4DR6K 1T9TA 2VCPA 3KLIA 4DV3K 2CG4A 4AUKA 1W7AA 3J81j 4LVOP 1VQ6N 2AZ3A 2EWSA 4ZK7M 1U1QA 1RBRA 4M3RA 2PN6A 1HBMA 4BR4A 1HW9A 1VBZA 1GTEA 4DLGA 2PZSA 1S72S 1B64A 5A6PA 4DTRA 2KXHA 2JFDA 4ATNA 2DEJA 4NCGB 4ECXA 3RTVA 1NOZA 3KDOA 4WKYA 2A1BA 2AYMA 1CLQA 1KOHA 3OTOK 3UE2A 3P96A 1YVUA 4DU1A 2YNHA 4JI8J 1RTHB 2R4FA 3NFAA 3RRGA 4KPCA 1KP6A 2JH3A 5ETSA 2MXYA 2BM0A 2RN2A 3P49B 3OYJA 4ZITA 3NRBA 2BX6A 3RBEA 3I32A 1FRJA 3H45C 3CCWA 1FKAF 1HBNA 2LXUA 4CZHA 3THYA 3V4IA 3QEVA 4FL9A 4LFBJ 3OFGA 2C42A 3QINA 3TPQA 5KFTA 3BGFA 3ZX3A 3IP0A 3OSPA 3K5LA 5CD4H 3SCKE 3G2XA 1KRPA 3RBDA 5FDLB 1TKXA 2V52B 4NO7A 2W42A 1W7WA 2W25A 1QSYA 3DJCA 2HWHA 1IBMJ 3Q8UA 5F3ZA 5AZIB 5AQJA 3A8JA 2XULA 3CF5L 4K5RA 1N36F 1WJ9A 4O0JA 4RWTA 1RFQA 3HP6A 3MUVP 4F50A 3WQPA 1RADB 2XLJA 4ZVRB 1X7VA 1S76D 3L2WA 3A12A 4BRIA 1R0CB 2IMWP 2RVJA 3ID6A 4X4RA 1XMOK 4CQ1A 4KHYA 2AYBA 4OI3A 2JEFA 3GILA 1JLGB 4F67A 1M5SA 2FHJD 3JQKA 2O4IA 4DUYF 3ENVA 3MEGB 2MQNA 1LXNA 3HVAA 1IBLK 3M6GA 1SUQA 3FVYA 2HBMA 3G10A 3E9LA 1WOPA 2RE1A 4DL3A 2CJ9A 4NCAA 2OCEA 1HL6A 3SAFA 1WAJA 1FE4A 1T8EA 1WHVA 1NB7A 2Y0SD 5J1NA 1TZ0A 1PIEA 5KFEA 2YKQA 1ZZNA 3MCAB 3MUTP 1QVFR 3I4PA 2D74B 4M1KA 3ULEB 3B82A 4CT9A 3HCXA 4BREA 4F4ZA 1GMWD 3A8KA 3PKYA 4EIAA 5EVZA 1WI6A 1VRUB 4LSNA 2F65A 4HT5A 3TA1A 1G15A 2MQQA 4YB1P 3DFEA 1IM4A 3CJTA 2MGZA 3DHXA 2W7OA 4AXJA 3M1VA 1S79A 2WSCC 4FJKA 5H1SV 2WVEA 4OMFG 1P9QC 2PGCA 2HPUA 3MAHA 2FHJA 1RBTA 5KRTA 4XEIA 4N7TA 3T1HJ 5F8MA 4P7TA 2CPXA 3ETMA 3PSFA 2XS7A 3Q89A 3PX6A 1WOSA 1D8YA 1OMSA 3NMRA 3CFPA 2O1PA 3ZT2A 2UV8G 5EUHA 3TQEA 3SV3A 4OI2A 4PPZA 2GJ2A 5BPMA 3MTJA 5CQGA 5IS2A 1RHJB 4PG6A 3WX4A 4H03B 3CPWR 1QHTA 1FVQA 4LFAF 3HK2A 1JXVA 3VQ5A 3V6HA 1Q9XA 3IAYA 4DSFA 1QSLA 4F4KA 2KW4A 1Q78A 2E1PA 3UN2A 5DZ6A 3A13A 4PR6A 3D0PA 2WSEC 4FLXA 3TO8A 1SKRA 5E3CA 2FLLA 1VSEA 2CQIA 5JJBA 4ICLB 5ELZA 4PYAA 3HHLB 5CZ2A 2HBYB 1S48A 1PILA 3CWJA 1KVBA 3W60A 2FF6A 2R8HA 4USHA 3TX0A 3W66A 3HLUA 3H2UB 2UUCF 1IXKA 2ZJQQ 1RAFB 2VUGA 2JEJA 1EQMA 2KZZA 1QZ6A 4J37A 1XNRK 3H3OB 3OTCA 1IM6A 4DFKA 3EZUA 4WCEL 4RJVA 4GV9A 4IH5A 3C65A 2CQCA 2XHCA 3U4LA 2RDDA 1TGOA 4H0TB 4OYAA 4IJNA 2CXEA 5AJ3K 2J9EA 3QGGA 3DWLA 3DXSX 5HRNA 1VIXA 2O8FA 4O44B 5HMYA 3Q8SB 2PDAA 3EPIA 1RTIB 3QAEA 1TR0A 4V19S 3RRHA 2AW0A 3V9SA 1U6FA 1IBLJ 3EO3A 2L48A 1YITS 4HVZA 1DLOA 4NLCA 1GOCA 3VPZA 3O9TA 4PUOA 1SKSA 2DNPA 5AQPA 1KN6A 3DXKB 1HI0P 1DTTB 1SC1B 1JXBA 3K5NA 2FF3B 1GEHA 4C8OA 2PEBA 1EX4A 4JYAK 5BRHA 2NRRA 1HQUB 5HMWA 2ACYA 2O8CA 2VPXB 2ZGZA 4CFDA 4ISEA 2WVDA 1SQEA 2VG5A 3O8MA 2BKNA 4DU8A 3C94A 2V69A 3ZSWA 4DV3F 5C5JA 5HBMA 4DEZA 1VBYA 1FKPB 2XMMA 3IGNA 1GLFO 3SCIE 5E3PA 1F9EB 4OFZA 5A2QY 1Y3KA 3QMLA 4DPTA 2RKIA 3PM9A 3R5JB 1TUYA 3K57A 4EEYA 3BSNA 1S1UA 3V6KA 4UT4A 1OH5A 4AL6A 1VQ5S 2IM2A 1ZOTA 3IMXA 4CD3A 3TSUA 4JI6K 1FFWB 3WXLA 2RHSB 3FCVA 2AGQA 4KY3A 4AL7A 1SC3B 2YH1A 4CJKA 4Q44A 5J1EB 2JEGA 2OSRA 4YUDA 4DHVA 4U8YA 3VAIA 5BYSA 1QY7A 1VSDA 1OY9A 3OFFA 1XNRJ 2UUAJ 5LSLA 1XMQK 4XK8C 2HBRB 4WF9L 2GHVC 1S7HA 3QQCD 2V4QA 2UV8A 4R8UB 1Y5NB 4LF8F 4M3ZA 3N79A 3RR8A 2M2BA 2M8HA 2LEPA 4DR3J 3I0SA 3NGTA 1DZ5A 2XLIA 1WSHA 3H3NO 1RAOA 4BC3A 3HSJA 2CADA 5I3UA 3OL6A 2EFQA 4MFBB 1YJVA 4JI1F 5BR8F 2XCPA 1EP4B 3D1OA 3MM9A 4AFFA 1RSCA 5AXMA 3UKRB 4TYAA 2OIHA 3M2UA 4JI3F 4C23A 2OSQA 2CNKB 4DTSA 5FRMA 1YDLA 2Y0BB 4HT7A 2VICA 1HWLA 3A8YA 4FF4A 1HBUB 4OI1A 3QJPA 3QRPA 2IRYA 3OYEA 4NMXA 3NOGA 2Z2MA 2BANA 4V1Ak 3ZTQA 2UXBF 3ZFVA 1NUEA 4IFVB 2ZM6F 2QWMA 2BV3A 1XQIA 4WKRA 2FQQB 2WB1D 4LR9A 4N41A 1GLDG 2GHWA 2KT5A 2AYGA 3H5XA 4KH4A 3BZKA 2ROEA 4TYBA 1O6XA 2EK6A 2XRIA 2V8HA 4HHJA 1GLAG 4BCAA 1DQ8A 4ZLNA 1EB0A 3ET6A 2J0WA 3CC2S 1D9DA 4ZP9A 2NZTA 4DCOB 3LDOA 4CLWA 4QPTA 3MGJA 2DGQA 2Q2RA 2EXUA 2HNZB 3HF5A 4G1QB 2OPPB 3BQ0A 4C3MA 4OKJA 1PAEX 1XIQA 1NG9A 1LWCA 3BN4A 3FFIB 3CQ8A 2RRNA 3NNCA 2GZOA 5KFYA 3AODA 4DF4A 4K4VA 2BTFA 4DL5A 4M63A 3MDFA 4G6VB 2V4JB 4CHPA 5L39A 4JK7A 3M5RA 2PC6A 2RUSA 2ZH7A 1H72C 1T9WA 1B0VA 2YI1A 5DK5A 1ZBIA 1YRXA 4RR5A 4OJ3A 1MN7A 3RAXA 4B3RK 3QFUA 4JI7F 1S0MA 5CYQB 3K17A 4F2SA 1J9AA 3BO4A 4JAXA 1RA6A 3V6DB 1U47A 3OYHA 2MLZA 3OJSA 5GADU 4CGFA 3Q22A 1WSRA 4O3NA 1X9JA 1KEKA 2YJFA 3I31A 3M9NB 4KFBB 4FP9A 3EL2A 4H54A 4ZCIA 3QT5A 5A8RA 4CT8A 1MSWD 1BU6O 2BQ3A 1E6YA 3VHQA 2FHMA 2NRVA 5HVGA 1AFJA 2F96A 1XBWA 3L2VA 2OTLS 1UVIA 2E5LK 2W6KA 4B9LA 1S6QA 3K7RA 5EGYA 4WQ4A 2CNOB 5FPMA 4MYTA 2C2ZB 3H5YA 4GV6A 1SL0A 1FJGK 2HWTA 1Z25A 3FKBA 5GAEI 4JV0A 1HBOA 2PIIA 4YP3A 3THWA 2XS2A 3B54A 4JI4F 2IM0A 3JTPA 1T02A 3P5TL 2AA4A 1MU2B 4WFXA 1LAWA 3HD1A 4Y3CA 4RNHA 4OYXA 4ENOA 4JKEA 4OHVA 2C2OB 2XMKA 2Z58B 4FCYA 4ZHRB 3OYDA 4QR1A 3HSTB 4BBYA 1B0TA 3DLEA 4RWXA 1FESA 2DIUA 4YDDB 4FF1A 1MN9A 2DR7A 2YX4A 3PIOQ 4HHHA 3NH0A 3CDEA 1RYSA 2UVUA 1QLNA 3PEJA 2B7CB 2GJIA 1NGIA 2XI3A 4CF9A 1NJWA 1N5TA 2YH0A 3AA5X 3WHIA 3B78A 1VK8A 4GVEA 2YKAA 2F63A 5AQWA 2NRWA 3BZQA 1NU0A 5HL7L 3LDSA 1IBKJ 1YQHA 2ZQBA 1YHQN 1HQEA 5DM6L 3ZZUA 2OEMA 2UUCJ 2Q0RA 3K2PA 1LFWA 2MQMA 1H2TZ 3TYTA 5B0EA 2N82B 4QYZJ 2XYGB 2ZZNA 2XO6A 3UDVA 2XTJP 3MPUB 2CH5A 3CD0A 5BYQA 4X64F 1JIHA 4Q45A 2VG7B 5JVGL 1P27B 9ATCB 3PJWA 1IUJA 2IVOA 3LTOA 2OKQA 4KB7A 2LFVA 3T1HF 5C24B 4DFMA 1FXXA 1K8AT 1VBXA 2HQDA 5C25B 3VQQA 1U25A 4NCBA 3O1LA 4RKUC 1YAGA 2KHDA 2NXCA 5F3TA 2JEIA 1K44A 2IVMA 1V4TA 1NOYA 2UXBJ 1U45A 2EG1A 4WFBL 1FXDA 3UDEA 4I7FA 1MMLA 5BRDA 3M7VA 4JKAA 4QWAA 1S0NA 2IDEA 4BE1A 1K0VA 1PCAA 1C0TB 3T1YK 3I55S 4QU6A 5BYRA 3D66A 2Z2LA 4LQ9A 3TSPA 4FLUA 1UP1A 3GWCA 4OL8A 2GAGC 5D78A 1S49A 2HFOA 3J7A1 1WOQA 3W63A 2IBOA 3H90A 2VBWA 4JI3J 1MG7A 1EQYA 1O0PA 3PTWA 5J2QB 2P51A 3OUYA 3OL7A 4RBUA 1TFYA 1VC6A 3TZXA 4JBCA 2OPSB 2CWXA 3GE1A 2MKYA 5KFIA 1X4EA 4FYDA 4MK8A 3M8QA 4E2FB 3ZSOA 1LOUA 3EY1A 3TI0A 2DNHA 4OZ0A 1MDUB 3LO3A 3IS9A 2CJKA 1UVJA 3EZWA 3G87A 3EE8A 2FLOA 5GAGU 1WEYA 5C42A 1MNEA 3PR4A 3D6RA 2CPYA 2UUBK 3RAQA 4QWCA 3VAKA 5KGWA 5CCLA 1C0MA 4O3PA 3AD7C 1CQMA 4CEFA 4C4WA 2VBZA 3MM7B 1BA0A 4DR6J 3DXKA 1GLLO 3WC2A 3NF9A 5ITHA 1SIWB 5EN1A 2BA9A 3L2UA 4LF5K 3H2LA 1YUWA 2QK9A 3VENA 3CCSN 5HOOA 2G8IA 3RW6A 5B09A 3TARA 2K06A 5T7LA 3HD2A 5A76A 1RP5A 4LQ3A 4CI0B 3KKSA 1SJ1A 5C2FA 4FM2A 3M3ZA 2QO3A 1WC3A 1W26A 4OLAA 1R43A 1T0TV 4GV3A 2YX7A 1XC9A 3AT1B 1RHMB 3NF7A 4OKEA 1VQ4S 1OQ6A 4M45A 1RCOB 3AD8C 3WQUA 4F02A 1HLWA 2HQCA 3CPWM 5GAEP 1TK0A 5AZJA 3MN9A 3MMCB 2CPEA 1R8CA 2HAIA 3UR3C 2RRAA 2EFGA 4JV5J 5KFBA 4QIWD 2EEYA 3CJ2A 1JQGA 1GX6A 1JLFA 4N5SA 1ZETA 4OJHA 2MKCA 4AHVA 4WFYA 4AD6A 1E4GT 3D0GE 2YQ0A 3EPGA 4DUYK 2L9DA 3X1LB 1OYEA 3W5XA 2M4MA 4CO3A 3QZ8A 2OMOA 2G1HA 3VQBA 4GKJJ 1XMOJ 4DV6F 1NK0A 2WAQD 1C0UB 2HQIA 3FCHA 4M5MA 3I0RA 3ZT3A 1RT7B 1QQMA 3LPYA 2X51A 1YG0A 4FZVA 1IKWB 3T19A 5D3GB 2EX3A 4J9LA 3G6YA 1T9VA 3L6QA 3LM9A 5HMZA 3E01A 2UUBJ 1WHYA 3PYFA 3Q83A 4TVAB 1C4AA 5KFAA 2FJVA 5G4DA 2FY8A 4CWBA 1C1CA 4DTNA 1QQCA 1N5YA 4CGDA 1BQXA 4MKVA 1W2BM 5IFMA 3CC4S 5B0FA 4JN4A 2P8IA 5AE1A 3BSOA 5HO4A 3H98A 2HQGA 1N34J 2QA2A 4DR4F 4QOTA 4DR1J 4OYPA 2QL7B 4K4TA 3MD1A 3ZC4A 2YKNB 1YBAA 3WX8A 3FSYA 4IR9A 1OSCA 1PAUB 4C8NA 4CTAA 5F0UA 4DR2J 1UWBB 3TAMB 3CCUN 3VMFB 3VEVA 4QW9A 4M94A 2B5JB 1NXIA 1X5PA 3KJNB 4YY3J 4Z4FA 2IBKA 1OVYA 5AT1B 2E9ZA 5IM0A 4FLWA 3JSMB 1IH7A 2PFDA 4ZVTB 4DV2K 4W5OA 3GSDA 2G2ZA 4CO2A 1Q81O 2Q43A 5IOLA 1Q53A 2VWBA 4ZIWA 1EKSA 1SL1A 4UY8O 1NU4A 4LRCA 2D9PA 4ZA1A 3D1QA 2KVQE 4PPDA 2V4JA 3KG0A 1N54B 2AJ0A 4W90B 3ZSZA 3J7Z5 2YNGB 2WBMA 1VQNS 3OA9A 3T5JA 1Y00A 3MMBB 2D3OR 4IJAA 2FPHX 2QV6A 3SXLA 3GCWP 3F0NA 4I6WA 4J90A 4LH4A 2ERRA 1LQ9A 5J1EA 2VFSA 1QAJA 2XGQA 4QAGA 1AB8A 4Q2LA 4YOEA 4CLUA 2WC9A 4ZJOA 2V7YA 4CJ3A 4B3TJ 3W7BA 2QL9B 1XR7A 2D1KA 4FKYA 2DIVA 4USUA 1C2PA 1NJXA 2H1YA 4GKKJ 4NLWA 3MWBA 1ZM4A 2B8PA 3LDNA 1M5VC 2R7RA 4LF5F 4LF2A 4PG5A 2MZJA 2XS5A 3HSCA 2XSJB 2NRTA 2AZ1A 1ZTTA 1CULB 4EZ9A 2AJQA 4DUTA 1Y3JA 4JB8B 4MFBA 3LWLA 3PDNA 3IRXB 2MZSA 4DV1F 2MZQA 4NXMF 5J1PA 2HFNA 3R97A 1CJVB 2KRBA 2LYVA 3NP5A 2AT1B 4AHUA 3A5NC 3OVAA 2EFPA 1O1WA 5M1NA 1JLAB 3EGWB 2P9EA 1HFEL 1YK9A 4EK2A 2HZCA 2W9CB 4FDFA 2VFRA 4F3OA 2HS3A 2XZWA 4I0WA 3J81Y 3SI8A 1NK7A 1N33F 4X62J 5I3UB 3BP8A 3DMJA 3QT8A 3DGVA 1S4EA 3IBCB 2QIFA 4AXIA 3I0RB 2CQ4A 1CZBA 3D2FA 4B3TK 1URNA 1L3VA 4OO1J 2CDRB 2BJ9A 1SS6A 6FDRA 1WUUA 5BREA 4U95A 2C2RA 4NRTA 1FDAA 4Y34A 2E6LA 2Z1GA 2ZFHA 2X1BA 3MPWA 1NAQA 3LDPA 3M8YA 5K8PA 1YTUA 3TAGA 3DU6A 3ZZTA 1YSJA 4E19A 4X4OA 3J7ZO 2A6MA 3U02A 1Q9YA 5LMNK 3K8WA 1EQ0A 5D4PA 2FUG9 1HHSA 1HWIA 2R7YA 4IDKB 3GIMA 1HPZB 3E51A 1RQ0A 3I5CA 3AVGA 2Y8YA 3PO5A 2JLFA 1K8KB 2VKRA 4YQWA 3Q7CA 3T1HK 1EWQA 3MPYA 3KNGA 4PL8A 2WONB 3ID8A 2JDJA 1EIYB 2UUBF 1ZC6A 1FDDA 1C1BB 3HPHA 4FJMA 2GCFA 2ZWHA 2XGPA 4MKYA 4DR2K 2DHSA 1KQSR 4MDBA 1B3TA 4HTJA 1F5CA 4CJ4A 3CUNA 2XB2D 3I56N 4FW2A 1U6ZA 1NH8A 5CAAA 4ED5A 1UEKA 1NK9A 3JQMA 1HYSB 2KLAA 3KHLA 3VQTA 3AVLA 2H5EA 3VEWA 2AGOA 3H5SA 3BDPA 1RZMA 2H3EB 4QW8A 1CJUB 1OO0B 3GG0A 1BDGA 5K5MA 4YR0A 5EY4A 2IYGA 3MUMP 5KAKA 3DRSB 3SCJE 3GJQB 4LH5A 1TV6A 2NRZA 2LQ8A 1NLVA 1HYVA 3ZT1A 5JS2A 1GLCG 1HNZJ 4USVA 3SIPB 1A5WA 2IVPA 1CQNA 4CZIA 5JLFA 3GIIA 4DV4F 5KTQA 4A57A 2AMCB 2QG9B 3OLBA 1F1BB 5MLCQ 4NCGA 1RWMB 1B7FA 1VQ5N 2C3YA 4EO6A 1TVRA 4NLGA 3O80A 4EP5A 2HKEA 1JJHA 3MM5B 4UW2A 2MQLA 1G3OA 2E7WA 2ZH1A 4CM0A 2XSJA 4PXEA 4HEA9 1YWXA 3HOSA 4OZNA 2UXCJ 2NYIA 3NS7B 3VAMA 4EZ6A 3NCRA 5GADI 1FEEA 2GO8A 4OPJA 3NOCA 3PG9A 1YJNN 2HIQA 3G82A 5BRFA 2GS8A 4CHQA 2C2MB 2DGOA 2DNOA 4U96A 4CJFA 4CEAA 3EICA 4LF8J 3KMSA 4JK8A 1I94F 4ZHRA 3AJDA 5F8IA 3C6UA 4F04B 2UXDF 2ZE2A 2CKWA 2ZEJA 4DQSA 2HB5A 1RCHA 3SFGA 1U09A 1DARA 3VV2B 3HPGA 4LR8A 1F6TA 3PIPQ 1RB0A 1YZ6A 2GMJA 1ULRA 3LWMA 4CO1A 4ZLLA 2V7ZA 4DL0C 4EI2A 4CECA 1S1WB 3C15A 1K0TA 3P8BB 4CBWA 4DX6A 1RDAA 4DG1A 3VGLA 3QICA 4DR5J 3ISNC 1YJWN 3DOLA 4IRKA 1X9SA 2K7KA 1S9EA 4P2FA 1E6YB 1N5SA 1JJCB 2QT7A 4IOAL 1ZM3A 5SUHA 2RDJA 4F4XA 2VONA 1N4LA 1FF2A 1GOAA 2DO4A 3DYAA 1WAFA 2BE2A 3ULHA 1XTZA 1S6QB 1LXJA 2RU3A 4LF9F 3AY9A 2OPQB 3JS6A 4JD2B 4P73A 4ID1A 4B9NA 1VK3A 4R0JA 3CCLS 2H4WB 4CM2A 5A2QO 2YCHA 4NB4A 3LGMA 4U7BA 2KTQA 2GWJA 4HHTA 1FT8A 3VQ4A 2PD1A 1X4FA 1GXUA 3NGUA 4NEYA 2OP5A 2ATLA 2FJXA 3H1QA 2GV1A 3AQOA 1FK9B 4X65J 1U1NA 3WEEB 2RRBA 2RJZA 1X4HA 2B6AB 1KXPA 5JMVA 2DHHA 2KJVA 2RHQB 4RLEA 3N6MA 4NYZA 3NBPB 4CK3A 2GO9A 2WUSA 3PW5A 2B4VA 2P9KB 1SJRA 5KFMA 4ZPDA 3WNEA 2HW3A 4CEBA 3H08A 3ET6B 4NLBA 1LW0A 4KV8A 1YRUA 2X74A 4H4OA 1RT4B 4U67Q 4KR0B 2H51B 3K2YA 1QM9A 4UOGA 3BPSP 3CD6N 5LT5A 5FDLA 4QPXA 3HI9A 4FYVB 1XC3A 3ZSXA 3BPDA 4CNYA 3MX5A 4DX8H 1NKCA 4JV5F 4M3YA 1FJCA 4ED1A 5DDQC 4DUZK 3OVSA 3AVCA 2KDOA 4DQQA 4B1VA 1NKEA 3VCDA 3LH2S 4CH1A 2ILZA 3D6MB 2NUBA 4LF4K 3QGIA 3ITHB 2W9BB 3R5CA 3CCEN 2FBTA 2HRYA 1CEZA 1NPRA 4DV0K 1JJ2M 4JI4J 1NNDA 3CCRN 1JLGA 2GGPB 4QIFA 4FPIA 4FJ7A 5KQDA 3MWTA 1GLJO 2YJEA 5FLXY 4F4YA 1MROA 3AA8A 4OQJA 3O4WA 4ZP6A 3M1FA 2J6SA 4W4MA 1ZYQA 4OHWA 2HBQB 3V81B 1YJ7A 5AZJB 1Q4RA 3VGUA 3LPUA 1X3MA 2FHKA 1VLYA 4NXNJ 4A5AA 1NJIO 1ZM9A 4Y0WA 3FDSA 4C8KA 1G99A 1MLAA 3THXB 1DRZA 1YJ9N 3TABA 4CIEA 2QTWA 4WYWA 3PXGa 3I0SB 3R6LB 3BUZB 5J2NA 1X4CA 2YKOA 2G2OA 3FJ2A 1DGKN 2OPRB 2R7UA 4H5VA 5DMRA 2ZBIA 2I5JA 4JUZA 1RTHA 5GINA 4WP3A 2B3TB 1VHIA 1AFIA 4TQSA 2F1FA 4NLXA 3VAHA 4LREA 2GIFA 2CH6A 3KWMA 3HOTA 2WB4A 1TAUA 5HK4A 2BRLA 2V8DA 5HSPA 2PI5A 1IG8A 2IFXA 3QBCA 4DI6A 4YB5A 2EFVA 4CBXA 3R1LA 1BL3A 2VWKA 2W7PA 1DFDA 2YVSA 4E7IA 3C66A 3N4WA 3AH6A 2C2EA 5F1XA 1RU1A 2OD6A 4WIQA 2MHEA 3EVMA 5GAHP 1KD1T 4WU2A 1YIJN 4CEOA 1X0PA 5IT9U 1VYAA 1YHQS 1WNSA 4RCHA 2Q97A 4FWOA 2C2NA 1DTQA 2WOMA 3SI6A 3UN3A 3EXYA 1Q86T 4J91A 2Y9HA 4DV5J 4N56A 5F0WA 3I55N 3IAS9 4FYWB 3S1TA 5D6GA 3T9ZA 4HACA 2OPPA 1MWZA 3O3HA 4DPUA 1AW0A 4CH7A 4DV0J 2XMJA 4FWQA 1IQZA 2QX0A 4FPRA 4H4OB 4KHRA 2E9TA 5C24A 4FF2A 1O5JA 2HS4A 4RW7A 4ED6A 1TYQB 2R2SA 3P5JA 4E7LA 2YWGA 8ATCB 4CGIA 5SWMA 5I9EB 4BR7A 1X5SA 3UFCX 1FDNA 1EP4A 3MF5A 4HKQA 1FJEB 1Y64A 3BJYA 4MT1A 3DXMA 2JHEA 3ZEUA 1ZZFA 4JK9A 1TL5A 2KU7A 4DMNA 1QS4A 4OYZA 2ROPA 2OANA 5DG7A 3RVCA 1CZAN 3NEKA 2L3MA 3RW7A 2MGZB 1S0OA 2ZVSA 4KRWA 3DNCA 4KQZA 2O67A 4LSZB 2KVIA 4NLOA 4MJKA 3MM9B 1R8HA 3ZETA 4CVNE 1TKZB 1MROB 3ICLA 2C2DA 4JI5F 1KAYA 1B9FA 2NRHA 4BVPA 2HVZA 2NLWA 2MYFA 3HKWA 3SDEB 3EYZA 5AFUA 3N6NA 5ETRA 1YJUA 1HJOA 3ZSRA 2HYIB 2DCLA 2DNYA 1XNRF 1RBAA 2N4CA 3BO3A 5FPNA 4DV1J 3VEYA 3I9ZA 5CZVA 3ZNJ1 4QR0A 2V63A 4USMA 1NM1A 3SFUA 1JLCA 1HHQA 1ICEB 2RMLA 3CIZA 2HHHF 2A10A 5GVQA 3KTQA 3D5MA 2YHYA 1VQ4N 3G71S 1LKZA 3GJSB 3MM8A 3S3NA 2YX6A 3Q2TC 2GQQA 1HQ2A 4DV7J 3LP0B 1U48A 2DY4A 1HQEB 1K9MO 4KKOA 3CB4A 3QYYA 4AT1B 4MMOA 3FEXB 2ZBCA 5HBMB 1RT5A 4P2SA 1VIOA 4XO0A 4C0HA 3NCQA 4J9MA 3GYGA 2RU9A 3ZZZA 1U0HA 1NSPA 4DZDA 3WXIA 5C7PA 2UUWA 4NASA 2W9CA 1OH8A 3JSBA 2E5LF 2HNDA 5K14A 1VBKA 5M1FA 4Y6IA 2YY3A 2ASDA 1U8SA 2NXEA 2IIRA 1RNHA 3W5YA 3S9HA 3QPIA 4XH5A 1TL3B 3E2EA 2O8DA 3RBXA 5EX5A 2QMUB 4A48A 1VQLN 1QHAA 1T9UA 2Z8QA 2XZTB 3A8EA 3MXJA 5K8NA 1T03B 4NYFA 4XPEA 1CG2A 3ENAA 4ZIVA 4YMEA 2DTJA 2SXLA 4Z4GA 5LJWA 3A5LC 4I1TA 1QE1A 3I5AA 1VJQA 4F4WA 5U47A 1VQON 3CJKB 3MR6A 3BV8A 3QWPA 3I56S 2E5IA 1FXRA 3M2UB 3PSIA 2XY5A 4C3KA 4O5FA 4HL9A 2VQEF 4EAHD 5C10A 4KSEB 2HBLA 1WI8A 1K73O 1ASVA 4CLKA 3GV7B 1NMEB 2VHGA 3BS9A 3MHYA 3SBMA 1TUGB 1BWEA 1HWKA 2EC0A 3FE1A 4ES1A 4C9DA 2IVFB 4DKWA 2GVZA 1CULA 2C2KB 2VV5A 3L3VA 1VC0A 1JX4A 1CC8A 1GXTA 2VG6A 2R8IA 2V50A 4JI8F 3FK4A 3W3DA 1RBLA 3FBFA 2RQKA 3PX0A 4JNEA 1KVCA 3OTOF 2BEFA 4BDPA 3DI6B 2XMUA 4M5IA 1LK7A 2ZJQL 1RTDB 1UFKA 3CJRA 5LMNF 1KAZA 2IVNA 4OI0A 3NKYA 2HHTA 4F8RA 3HDSA 4ILRA 1SIZA 3LPEA 3UPFA 5I3QA 2ZM6K 3RU0A 5HJXA 1WC4A 3SQ2A 2ZKUA 4Q2MA 3G8TA 4B3OA 3P39A 1KVKA 4Z4CA 3LDLA 2VOOA 3ENOA 4L75A 2I1RA 1T3OA 5EX3A 1EARA 4MIBA 3OS0A 3IO1A 4E7JA 4DTXA 1KVAA 4ECSA 2MHNA 2WZ1A 3CIMA 1BUPA 1XR6A 3QT6A 2BM1A 2EI5A 3CVKA 3UKUA 1PGZA 1HKAA 4HCCA 1RDUA 1SJ3P 4KV8B 2ATQA 1WEZA 5GAHI 2PFUA 4FJIA 4QWDA 1Y0HA 3CO0P 3VEXA 3I9V9 1NHUA 4UQGA 2WW8A 5BPLA 5ADXH 2UUAF 4Y1CA 1RWWB 4P2XA 3O4NA 4H0OA 5IQQA 3K59A 3T7ZA 3NGSA 3CERA 3J80O 4V19J 1HNXK 1R8BA 5EXWA 2MZ1A 2YWKA 4J8FA 2ZH9A 3N6LA 2E2PA 1XMQF 1I51B 4KHMA 4BG8A 3GTYX 3NGIA 3B8HA 5CYMB 1T9XA 3SNNA 1ASUA 2GX8A 4F3TA 1D9AA 3CJ3A 4DHYA 2VPYB 4U8VA 1J5EF 4HUGA 5CA5A 4L8RB 2DXFA 1VRUA 3T9NA 1UZHA 1RT1B 5M2PA 3K9KA 1Q8KA 4Z2XA 2C28A 1JJ2R 1EAYC 3SPYA 4YORA 4DUYJ 3A1YG 2FTRA 3PYEA 6AT1B 3AA9A 3DOLB 2G2YA 1I94K 2CPIA 1S9EB 2BJ1A 4DR6F 4ZS6A 4DCPB 1S6UA 5AQSA 3CNQP 5GAGP 2VL1A 5D0RA 3UI3A 4KH1B 1DAXA 2R8GA 4C1NI 4MO5A 4J7CA 4KH0B 3UNGC 3BGRA 2AEMA 4FS1A 2JL9A 5IT0A 1ZTWA 4BGAA 2DPJA 4JI4K 5KFXA 5CXTA 1C0UA 3HHLC 3TQ1A 2BGGA 3BKTA 3MR5A 2WTFA 3W2VB 4WF9Q 4LF4J 3ELHA 4NZ6A 4IXCA 3ZYYX 1NGFA 2GQCA 2QYCA 3JAMU 4FJLA 1PBAA 2DO0A 4J9OA 2G0IA 2MSTA 4F9OA 3TP2A 5KFOA 3IWNC 5AQMA 2OPRA 5EOYA 1RTJB 4GKKK 5F8JA 4ZLJA 3U3YA 2PI4A 4DQ8A 1ATRA 3TTCA 2FJDB 3M8RA 1FDBA 3H46O 4DV4K 2B4OA 3DU5A 2MZRA 4AM7A 2ZJRQ 3AVIA 3FGUA 4PKIA 1F3VA 3HHLA 3SSSA 2E1ZA 2UYTA 3S3MA 5EWEA 2YKMA 3A4TA 5T7LB 3DI6A 5B0GA 1I39A 3CMAS 3ZLJA 5IV4A 1CPZA 2CJYB 4BGBA 5KFLA 2YBVA 4L73A 4B9SA 2CQPA 4ZVPB 4BVOA 2WCXA 2LQJA 1TK8A 5HRSA 3J7AP 2NZCA 3M2VB 1KQKA 2P9KA 4X66J 4NMLA 3AB2B 2A5XA 3FBEA 2IYIA 4Y2IA 2KRRA 3WT0A 3ZZ0A 1NJYA 3PYDA 4OPAA 1FW6A 3G6ES 5ETLA 1HBOB 2FZKB 3EUNA 3GR1A 1F2GA 1X9WA 4DTPA 3THWB 2G4BA 5L1KA 2E1AA 4URSA 4ILLA 2B43A 4ER8A 2W8KA 3TU5A 3W61A 3MCSA 2QEXN 2CA9A 1Z26A 2XSFA 2B51A 5KFZA 4ZP7A 3LP2B 1K8KA 2JWNA 2V5HG 4W98A 2I0XA 3Q8QB 3QGHA 4IDHA 3LZIA 1YGYA 2PO4A 4J9PA 4LRBA 3EZ5A 2DFHA 5F8GA 2R8JA 2PT0A 2RB7A 1R7IA 2YHXA 2OZMA 3TUJC 4X66F 1KQSM 1HD0A 3KUGA 2HWIA 4CW7B 4HI2A 3TWZA 2LCWA 3KJVA 2R8KA 1GT8A 4LF1A 3CI5A 1J5OB 2NCKL 3P83D 3CCVN 2GX9A 4B02A 2GWKA 2E7XA 1T44A 3HSDA 1FWLA 2JNJA 4KO0B 1ZA2B 3O5BA 3KKFA 2WBRA 1FNMA 3S41A 2FVRA 2NXNA 2Z57B 4P2MA 5DLGA 2ZOMA 4EP4A 3KK7A 4Z7CA 4WWSA 1VQNN 3VESA 2P9UA 1TVRB 3JTNA 4M5GA 1NGAA 2QLFB 4MKAA 1IN0A 1S9FA 3AO1A 1SV5B 5C12A 4DV6J 2A3JA 3QO9B 2O8EA 3RRKA 3LAKA 4ANEA 1E4FT 3HVWA 2ZJPQ 3CCLN 1WD6A 4ZVGA 3DLRA 2XI2A 1Q8IA 3HFVA 3GFHA 1ZS6A 4JYAJ 2RQ4A 3L09A 1NB2A 2GMLA 5L46A 3L95X 4CD1A 1S77D 4ECYA 5A0YA 3OT9A 3K8VA 4KT0C 1TL1A 3J81U 3RB0A 2QKBA 4IOCL 4AQYJ 2F9JA 2UXDJ 1FHTA 1JK9B 3Q0AA 2GQ2A 1IKXA 3KK1A 2HEKA 4RX6A 3G25A 2J8SA 1HARA 2VYPA 2JC0A 3MWPA 3J7YP 5AQKA 1LK5A 4KE5A 3ULEA 2F3JA 2F8SA 2BRKA 1E6VA 4NA2A 4PWDB 1TELA 2VIHA 1UPPA 3GMGA 3HYFA 2A40A 2F8HA 1N36J 2DRDA 5HQLA 2QWQA 1XNQJ 2O4GA 2ZD1B 3ATVA 1FKOB 1FX2A 2OEJA 4B9VA 3M32A 1F9HA 4WJBA 3GONA 3OHBA 1VSFA 4P72A 2M88A 2UXCF 1KQFB 3DLEB 1RAHB 1P6TA 1NGJA 3OYGA 4DV2F 4OX7A 1C4CA 3M6XA 1IWGA 3M6VA 3VQDA 3M1VB 4DS5A 2J9CA 4LUBA 3P31A 1NGHA 2CNNB 4RUCA 3TTFA 3VQEA 3KG1A 2HOEA 1RBSA 2FDNA 1WKLA 4LR7A 5KFCA 4U6PA 3TSQA 3EVOA 1I3AA 3KUHA 1W25A 4F26A 4CZKA 3C16A 3HVRA 2ZNZA 4GNIA 5EU7A 4GY2B 3BO2A 4JI8K 4YB6A 1YXQA 3QDKA 4JI7J 1VDHA 2BKPA 1IKWA 5D3GA 3ZCMA 2CQBA 2F9TA 5IT9O 1ESVA 1XN9A 4V19X 1WSIA 2G0JA 4IG3B 2XY8A 2HF4A 3QNWB 4DPXA 4FOEA 3PCOB 1A5XA 3AO3A 2UVRA 4CTAB 1WHWA 2CGLA 4J2DA 2H5IB 2J6TA 3MEDA 1UTAA 1REGX 4BR9A 3DLLQ 5KFNA 1RISA 2IAJB 4K4SA 2DXDA 3SAHA 4U7UK 1HR0F 4WQ4C 4IO9L 5GIPA 4DR3F 4PG8A 3ALYA 1BY9A 2UXDK 4KIAA 5KG7A 2P9CA 3T5HA 1Y5IB 4ED0A 3M4XA 2DHGA 1JXLA 4Q0BB 1LWFB 2X6NA 3QSYB 4WFAL 1M90O 2ZE2B 1TAQA 4AF1A 4ZMMA 2FZCB 1KBRA 3AFGA 1U2CA 4ILGB 1KNZA 3MEEA 1YVFA 2W1BA 3POTB 5GAGI 2CQ2A 4P10A 3SQGA 2PMWA 1ZBSA 4QS7A 5H9FJ 4FJGA 3DRXA 3AA4A 3EXCX 3OSNA 4ILHA 3U6FA 1YKWA 2ZBQA 3D0IE 3G71N 3UR0A 1IR1A 4NZ0A 2M52A 4I2QB 1T05B 2MLYA 4NA3A 1IBKF 3CEDA 3BZCA 1RU2A 2HZAA 4FNIA 3LDQA 1JLFB 1NCLA 1HNWF 3U9DA 1S6PB 1Q81T 4X4SA 2GV9A 2KFZA 5KGXA 1GMUA 3HVTB 1S59A 3CJSA 3TEGA 4BWMA 3C6TA 2CVIA 4DDFA 1HR0K 1TKTB 4R79A 4ISFA 3NVKA 2BDPA 3L7PA 3KIOA 1HQUA 3C6HA 4CEQA 4DQPA 2FVPA 5D8HB 5A8WA 3V4IB 1NEEA 1JWWA 4IFVA 3THTA 4DX5A 3W9HA 3CDUA 3A3PB 1DT9A 2D3UA 1B70B 2ASYA 1RCXB 2LQBA 1H73A 4O3OA 4XTTA 5I42B 4AL5A 2AJ4A 2KG0A 1NK5A 2HFSA 3OV7A 4FXDA 2FBYA 3CIPA 3OYIA 2W2MP 4HR2A 1XWLA 4Q43A 4O3SA 2DH9A 1YIJS 2QYGA 3G6XA 3AJ2A 3U1MA 2ITMA 4JI6J 4IUFA 2GTDA 3GE9A 3CM5A 2F9DA 2P9PA 5KFKA 1RA7A 3THPA 2UP1A 1U2VB 4KYZA 1PJ6A 4ISGA 1Q86O 3SQ4A 3PFEA 2P5VA 4YNQA 5L1IA 4PABA 2FJEB 4FSVA 3ILIA 5L8RC 4C7QA 2UUAK 5C0YA 3QJLA 3UVJA 4GKKF 2Q36A 2V34A 2NQPA 3DOKB 1G2EA 1RTDA 5LMUF 3H2VE 3MXMA 3FEZA 4E8UA 2R7QA 5B08A 4BS2A 3OJUA 1S0VA 1J53A 4A2AA 3VVTA 2VC0A 4BR0A 1TMMA 3T69A 3OBWA 1AROP 2W6LA 1S5JA 1JNZB 1F9FA 3BH7B 4MAKA 1SAZA 1N32K 2HNDB 5K14B 4CIOA 4LBPA 5HJYA 2NUUG 4LRDA 1FRHA 1BCOA 2MEWA 3SSQA 4XIUA 4PEOA 2JGUA 2P5GA 4LFCJ 2KO1A 4K5SA 2QFIA 1ZBUA 1N88A 1V3SA 2VBXA 3FSXA 1RT2B 3TW0A 1B4SA 2AV5A 1UEUA 2MZTA 1NPKA 4DSIA 1U26A 4WBFA 1HI1A 1F3FA 3AVFA 3OR2B 4LSLB 3CDWA 1UAXA 3TX8A 2BQRA 1LWEA 3RMDA 3E9PA 2RILA 2KI2A 5LXRA 4NYOA 3NAEA 2DR6A 3THXA 2DHXA 1WNEA 1SB6A 3ZEUB 1D8ZA 4JKCA 5HAOA 1N56A 3FZLA 4DFJA 3D67A 4B9UA 2H9ZA 4KGMA 3KJFB 3R7SB 3H42A 2GA7A 3TANA 3LGNA 3VAGA 4N76A 3ZX0A 1UAWA 3CD5A 3GIKA 5LSRA 4ZPTR 5KFRA 3S6EA 4CJUA 3LW5C 3PW4A 5FLXU 3KHRA 2E2OA 3WNHA 4JS5A 2CJXB 2FD2A 3QNOA 5AQGA 3IN5A 2QWOA 3V9XA 1R6YA 3EGZA 3I4HX 3NBPA 3UO0A 3IA0A 1WBBA 4A47A 3MAQA 4CEZA 4RNNA 2DEIA 5ETTA 2RKIB 1LW0B 1NGBA 4X4QA 4BHQA 3HT0A 2QM1A 4YS2A 2I8EA 4O5BA 4CGJA 3D2WA 1NLKL 3R7BB 2LLZA 3R2DJ 2QLJB 3AVKA 2B9XA 2E1CA 4JI0K 2CRLA 1S1VA 2KKZA 2QA4S 3A5MC 2W2PP 1KDNA 3U7JA 3F9KA 1NJIT 2D0CA 4CJRA 2P6SA 3BYRA 5D4LA 4ZTFA 1UW9A 2APOA 4EHTA 4DTMA 4DXLA 3LPTA 3GJTB 4I9LA 1RTJA 3AHPA 3FUYA 3P1GA 3VQ8A 5JVHQ 3LL3A 1FRKA 1HPZA 2P9PB 2LDIA 2BABA 3PLAA 1XEZA 1TUWA 3WZ0A 3W9IA 3C6UB 1UJ6A 2X3DA 5AE2A 1VQLS 3AXKA 1IVZA 5CR4A 4O44A 3V1RA 4MIAA 1NMNA 1C1BA 2KZMA 3CJ7A 2F4VK 1AT1B 2X1FA 3VQPA 4YHHJ 1IV0A 3QRRA 2AJ2A 3TA2A 1N6QB 3EM1A 4PY5A 4M5KA 2YKPA 1HYSA 2HSEB 5HI7A 1W97L 4LSNB 4LJMA 2QI2A 2VPWB 2QA1A 5D0GA 3GV5B 1YJWS 4LY7A 5I3PA 3NH1A 1BOTO 2ALZA 4E7KA 1C0FA 1CJTA 3MECB 5AJ3F 3IUCA 4JD2A 5ETNA 2ZF5O 1IJJA 3ISND 3EGVA 2QLWA 4PKHA 4DV3J 4JI7K 2C3PA 1N5QA 5CZXA 3HJFA 2OGUA 3U1NA 1FJ7A 4OX6A 4OJGA 3SDEA 3B6PA 2QJ3A 2WSFC 3FZHA 4I2PA 1UA1A 1JNRB 1WSGA 5KG2A 4B3RJ 1NO8A 2E5GA 4J5OA 4DV6K 3WXMB 1YRTA 3OY9A 1YJTA 2BXJA 3M2RA 3IFRA 5AXKA 4O23A 3CCMN 1XR5A 1P9YA 4DOZA 4C8MA 4C48A 3JS9A 2DGWA 3KLFA 2OYQA 7FD1A 3PKMA 3IAM9 3U27A 3AVJA 3R1HA 1VQ9S 1TKZA 4GO7X 4HWIA 2V4RA 4LFBF 2K8GA 2VGNA 2BE7D 2FBVA 3VQCA 1LNQA 5BN8A 3TZZA 3SZ2A 1N5VA 3DHWC 2BBEA 5FD1A 1J54