2E5LK

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2e5lK00
5AJ3K 4DR6K 1XNQK 4B3MK 4JI1K 4B3RK 2UU9K 2UXBK 4LF5K 2VQFK 4JI4K 1I94K 4DUYK 4JYAK 2ZM6K 4DV6K 2UXCK 4DR3K 4X62K 4V19S 4LF4K 4DR7K 4LFAK 4JI0K 1N34K 1IBLK 5A2QO 1IBKK 3T1YK 4K0KK 4YHHK 4CW7B 1IBMK 3OTOK 5BR8K 3J80O 4DV3K 4AQYK 1XMQK 4OX9K 4LFBK 4DV5K 5LMUK 4DR4K 2UXDK 4DV1K 2VQEK 5IT9O 4DUZK 4X64K 1N36K 4JI2K 4LF9K 1N32K 5LL6Z 1XNRK 3T1HK 4B3SK 4JI6K 4LF6K 2UUBK 2UUAK 4NXNK 4YY3K 4DV2K 1N33K 4CVNE 1HNXK 4DV0K 4LFCK 4LF8K 2F4VK 1HNZK 4DR5K 4JI7K 4DR2K 4DV7K 4GKJK 1J5EK 5FLXO 2E5LK 4X65K 4KHPK 5IWAK 4B3TK 4JV5K 4DR1K 2UUCK 4NXMK 3JAMO 3J7AP 1HR0K 5LMNK 4JI3K 2HHHK 4JI5K 1FJGK 4X66K 4GKKK 1HNWK 4DV4K 1XMOK 3J7YP 4LF7K 4JI8K 3J81O
chains in the Genus database with same CATH superfamily
3UKUA 1HNVA 1GLDG 4LSLA 1VQPN 4Q5VA 5F1XA 4F3TA 4CHPA 4J2BA 1X9JA 3A5LC 5KQDA 1HQUA 1QQOA 3VF6A 3C7NA 4FJXA 2DFFA 3ZSOA 4C1NI 4CFCA 4W5RA 2F7TA 4B1WB 2ZF5O 3TAGA 3IKMA 1LWCA 2P9IA 2GELA 4KTZA 4LFAK 2F9WA 3HSCA 2W42A 4WFNL 4BVOA 2HBMA 3LP0A 3AA4A 2ZGZA 3OBYA 3KLIA 2UYTA 5AQNA 3VEOA 1NG9A 1JLAA 3R1XA 1NU0A 3FGUA 4ISEA 3KKSA 4CE9A 4DF4A 4BY9C 1RTJA 5AQWA 4CJ5A 4ELVA 3NAEA 3BF3A 3T19A 3C65A 5GIOA 4KI4A 3CM5A 1P8ZA 4BRMA 1KXPA 1SKRA 4F2SA 1XWLA 4CEQA 2QEXN 4B08A 4DUZK 3E9PA 4J2AA 5KTQA 4AF1A 1YAGA 3LM9A 1HRHA 4Y1DA 4UY8O 2HHUA 1Z6RA 3QNOA 4FJKA 4FO0A 4FXDA 4IOAL 3LDOA 1S9GA 2RPIA 3CC7N 3L3UA 4KTQA 1Z25A 1HNXK 3LPTA 3SPYA 4KHUA 1MA9B 4JNEA 2HVHA 1MWKA 3HK2A 4KH6A 3VTIA 3K5NA 4DKWA 4PUOA 5HBMA 3CPWM 4BE0A 4CCHA 2GX9A 3E9OA 3HT3A 4DU4A 3THYB 2E6MA 3KJVA 2E2PA 2IC3A 4NXMK 3K58A 3AVNA 1RT4A 4FLUA 3TAQA 3SZ2A 4I6MB 4DQQA 5LMNK 1FJGK 3PV8A 1RDWX 1S22A 4NLBA 2P9LB 4IXCA 2G8WA 4ELUA 1VRTA 3SMPA 1NGJA 4CJVA 5AJ3K 2E2OA 3BP8A 4WQ4A 1SKWA 1SQKA 1P90A 3OHRA 4U67L 3VGMA 3AVAA 5KPZA 3UKRB 4B9UA 4M3XA 3LDLA 4B9TA 1BL3A 2Z1GA 2P9IB 2NRWA 5I42A 1KVAA 2GBZA 4FLYA 4JI0K 3OYAA 1LOTB 1JL2A 2W41A 5EY4A 4JN4A 4CJLA 1LAWA 3P4IA 4OPKA 4H5RA 4AHCA 1QHTA 1D5AA 1BIUA 3IDHA 4CEFA 3VQPA 4FWPA 5AQVA 4R5PA 2GWKA 4JRPA 3D2FB 3L4IA 2LSNA 4RW7A 1LV5A 3ZT4A 4DSFA 1GOAA 2D0AA 1ZXOA 2BDPA 1C0UA 2VQEK 1VQ4N 1JJ2M 3AVBA 3H45C 1VSHA 3EEQA 4JEPA 1TVRA 3OYBA 4B3OA 3ZSYA 3RMCA 3T7ZA 5EXWA 4CGGA 3RTVA 3QLHA 4FVMA 3AO1A 4RW9A 2RKIA 1C6VA 3TABA 4C1NK 4KRFA 2UUAK 4CK3A 1BQMA 5E26A 1HYSA 1N8RO 3OY9A 1HNZK 3P1GA 1YIJN 1DEJA 4GV6A 4NCBA 2VWBA 3QO9A 3SUNA 2QA4N 5GAGP 3CJBA 1NMNA 3MXIA 2V51B 2O4GA 4RW6A 1DKGD 2JWLA 4TSXA 2F9TA 5CYMA 4O5BA 4BR5A 1JCGA 4FK0A 4M7XA 3SQ4A 1HKBA 3VQ9A 3LDSA 2O8BB 4CZMA 1NGFA 4H5VA 4M7YA 3O80A 4FZYA 1RILA 2E2NA 3K9KA 2QWPA 1NK0A 4PKGA 5M1FA 2O8CA 2XY5A 5JS1A 3NH2A 3THYA 1O1WA 1VSKA 2X78A 4LF5K 3O4NA 1N5YA 4JI4K 3CJCA 4JKDA 3NGIA 4JYAK 4DV6K 1VSLA 2ZE2A 1G99A 2OPSA 5KPRA 4FJMA 3DJCA 4YOUA 2H3GX 3E01A 2CH5A 1WLJA 1XI1A 4FLZA 2O8FA 3M8QA 4HVJA 5AQPA 1IBLK 4JKGA 2QK9A 4K41A 4OPJA 4AHTA 1Q86O 4DFKA 4CHYA 2YJEA 2F8SA 1NK7A 4HCCA 5C15A 1S6PA 3KZBA 3O9SA 5AQFA 5MLCQ 4AQYK 3OS1A 4GV3A 4OX9K 1NGHA 4JD2A 4FLXA 3K5LA 2Q1NA 2EX3A 3CCEN 4DTOA 2DTUA 2UXDK 4BG8A 4HUGA 3SMSA 4X64K 4MLEA 3KWIA 1JLQA 4I2QA 1VQKN 3KK2A 5EX5A 1X1PA 1N36K 4DSEA 3DLBA 2G8IA 4DFJA 1XC9A 2P5GA 3K5MA 4IO8A 4E7KA 2D0PA 4W5NA 2Q36A 1QSYA 3KIOA 2RF2A 1VSMA 4E19A 3C6TA 1HQEA 4JKGB 4DR5K 1S1TA 1ZBSA 3N4PA 4H0TB 1W97L 4A57A 3SJJA 1GLJO 4HUEA 2Q0UA 2YHXA 4KHPK 4CF2A 2QWQA 5AQLA 1JXBA 3VQ4A 4JV5K 4MO4A 4C8KA 3JAMO 1RT5A 3VETA 1T03A 3FZLA 1NJYA 1DT9A 2P9NB 3HJFA 4PL7A 4HTLA 2OYQA 5DM6L 4LF7K 2Z1JA 3HP9A 5FPNA 3J81O 4PA1A 3SUOA 3DLGA 1TK8A 4IBNA 4BRNA 2V7YA 3KKRA 3QEIA 3HRGA 5C10A 4OKKA 3C95A 3DLLL 5KGXA 3KD1E 4OGEA 3W3DA 4H8KA 3K0SA 3RR8A 1VQ5N 1HX1A 1YF5L 4M3ZA 4JS4A 4LC9B 5LJWA 2NRVA 3IFRA 3FZKA 3OA9A 2P9KB 1S5JA 1DGKN 2DPNA 5BR8K 4E7JA 1WB9A 4DQSA 2XO7A 4BRQA 4O44A 3SAGA 1TUYA 4W5QA 3EE9A 5GAHP 5AQOA 2Z1HA 3A2FA 1QVGM 3M5RA 3OYCA 2Y1IA 3PX4A 4DMNA 3THXB 1ZC6A 4Z4CA 1SL0A 4BR4A 1UAXA 1KLMA 3VENA 1KRPA 4YOYA 3O4WA 1XC3A 4NYFA 1OH8A 3LP3A 2VGNA 1RT2A 4CIFA 4CGDA 3VGLA 3A5NC 3VN5A 2E88A 1NK6A 3BEXA 4LF6K 3L3VA 5AQGA 5JICA 2WTUA 1HJRA 2BGGA 1KSPA 3L2RA 4FYDA 2W40A 3V1OA 2HHSA 3CYMA 4BGBA 4FJ8A 1X3NA 4DV7K 3VGKA 4FPAA 1I3AA 3OBWA 3HM8A 1OH7A 2HW3A 2FSKA 4KB1A 4FK2A 1LAVA 2NLXA 3NH0A 1DLOA 4OLBA 3H3OB 4AH9A 2G8VA 4KV8A 3EZ5A 4E3SA 4FWLA 3V9UA 1C0MA 1FKOA 3CCVN 3AO3A 1M1KO 1WBBA 4FK4A 1H1VA 1A5WA 1LW0A 3CHWA 4FZZA 3ZX3A 1J53A 3NCIA 3HPHA 1CZ9A 4DB3A 4CZHA 4CJSA 3T69A 3MXJA 3OYIA 3H1QA 3H1VX 1VQ6N 2FLOA 3O5BA 4DR3K 4YOWA 1L5UA 3LL3A 4MQ3A 3F73A 3CQXA 1NGGA 1W2BM 1NLVA 1YTUA 4L3QA 5DMRA 5M1PA 4CJRA 5AZJB 1RT6A 3BF1A 5C42A 3CQ8A 1QSSA 3VQQA 4QAGA 1IBKK 1RDAA 4A5BA 3T1YK 3CFPA 3CM6A 3DYAA 5JLFA 4CI6A 1E4FT 2A1SA 5HP1A 2WBNA 4MO5A 3R9PA 4BRHA 3GL1A 3TAEA 4DS4A 5HRNA 4FWKA 3NGYA 1JCEA 1SS6A 2Q97A 3VQ5A 3UB5A 2E1YA 3MN7A 2KZZA 4DV1K 2G8FA 2HHVA 4BVPA 3QBXA 3ZT3A 4JK7A 1MDUB 2QWOA 5HOOA 3A5OC 4JI2K 1HYVA 1N32K 4LY7A 4CEOA 3P39A 3EE8A 3TAMA 5DM7L 5TKYA 3LWLA 2UUBK 4KB0A 1KFSA 3HPOA 5CE3A 5AQZA 4U7BA 2F4VK 1J54A 2VG6A 4JS5A 4JI7K 1ZBFA 1GLEG 2CGJA 4CJ3A 4IFVA 1JLBA 4K25A 5IWAK 2G8HA 4N5SA 1NGDA 1ITGA 1UA1A 3DOLA 1S1WA 4JI3K 4KREA 4XEIA 3RMBA 4OVLA 4KFBA 5M1OA 2NUBA 4GKKK 3WEEA 3QERA 2NRZA 2ETJA 3MECA 3L8BA 4QS9A 3L2VA 4IDHA 4DR6K 1FKPA 3AA5X 3DXMB 1J5OA 4F3OA 2UXBK 3VEYA 4BRDA 1OH5A 4IJAA 4W5OA 4H0OA 4FW1A 4FLVA 4GVMA 2A41A 2P51A 1QSLA 2A5XA 3CERA 4JKBA 2O8EA 4RW4A 4EIAA 4IJNA 4IG0A 4CF0A 4FJNA 3V9XA 1CLQA 5FPMA 5AFUH 4PHTX 5JVGL 4FM1A 2ZQBA 4B8AB 1IBMK 4I9QA 1B9FA 5BRHA 2Z1IA 3ULDA 3MWTA 4FW2A 2P9NA 4YFUA 4HTUA 3SPZA 1U2VB 4JKEA 2GTDA 5M1QA 1A5VA 4MLHA 1EX4A 2OTLN 3M8RA 3BUZB 3CCMN 4GNIA 1O13A 2OPPA 4CECA 3LAKA 2CGLA 5EU7A 2V7ZA 4CEAA 3OYEA 1C1CA 2XY6A 2GWJA 4O0JA 3SAHA 3AVFA 4AM6A 1XHXA 4CFBA 4H4MA 1TKDA 4M42A 5C2FA 3WNEA 4CVNE 4AHRA 5AQJA 4FJJA 3TSPA 3RSEA 4B9LA 3OYDA 3SV3A 4KH4A 1J5EK 1ESVA 5CYQA 4GV9A 3AGRA 4CFDA 3VQ6A 3AVCA 3D2EA 1BGXT 4GY2B 1E3MA 2QI2A 4B3TK 3CCRN 3SJHA 2IS3A 2HBKA 1K73O 3R6MA 4FLTA 2YI1A 1RGIA 1Y97A 4H0VB 4DQPA 3MXMA 3G25A 4H0PA 4A59A 5AZIB 4EP5A 3VF2A 2HNDA 3J7ZO 3H08A 4AHVA 4C8NA 4JI8K 5AQXA 4YOVA 3OYJA 4J8FA 5AQMA 4YOTA 4H5WA 3KLHA 3ENOA 4OJRA 4IO9L 2YNIA 3GOIA 1Q7YO 4FOEA 4BRFA 3RR7A 4XH4A 3P5JA 3CG7A 3FZFA 3BGRA 3V1RA 1TK5A 3CC2N 4JK8A 2ASOA 4WQ5C 4NCAA 3LP1A 3UKUB 3CFRA 5KRSA 3M3ZA 5EOYA 3J8AA 2Q3SA 4KI6A 2P9SB 2KFNA 4MDAA 3CJAA 4CGFA 4EFHA 2ITGA 4IWVA 5LJVA 5JMVA 2NNWA 1KCFA 1UA0A 3FFIA 3HYFA 2YNFA 2VYPA 1NBWA 1WSGA 4IFEA 4H5NA 3OVNA 3ZCMA 1S3XA 3DRPA 1GLFO 4RG8A 4NB4A 3RMAA 1RBVA 3DLHA 1BOTO 1RNHA 2A3ZA 4BC5A 1HKCA 4KHYA 5J2QA 2YHBA 3ULEB 5AQUA 1LW2A 2XHBA 1NJIO 2O8BA 2W6LA 4IOCL 4Z4HA 2RN2A 5C24A 3I0RA 2NZTA 2E6LA 2PYJA 4AM7A 4IOXA 3NF7A 4EAHD 3F2KA 3O1WA 4RWTA 5HRSA 2GUIA 3NFAA 2FF6A 4OKJA 5FROA 4CJEA 4WQ5A 3HVTA 3NF8A 3VQDA 1M90O 3MX5A 2A1RA 1SL2A 5M1NA 4JKFA 1VSIA 3HTVA 2E20A 4FWMA 4J2DA 4FWQA 3O9TA 3THXA 4E1MA 1BCMA 1BISA 1TL1A 1ASVA 3MAQA 1W0HA 1RBTA 1YITN 1WAJA 1I94K 3O9QA 3TARA 3U6FA 4HCBA 3R8EA 4BE1A 3S41A 4KHSA 1Z05A 4Z0UA 2UXCK 2W6KA 3MMVA 3FR0A 2HMPA 4F8RA 4V19S 3WXMB 5AZJA 4BDPA 3ZSRA 3QDKA 5DK5A 4FWNA 3ZSVA 4BQLA 4CESA 1JLFA 4FSVA 4B1ZA 3DMJA 3EKSA 1GOCA 4CW7B 3CFOA 4NYNA 2VCPA 4OLAA 2D0BA 4MFBA 2HHQA 5AQKA 5H1SQ 2X6SA 4YDUC 4B1YB 3PIOL 4LFBK 5HLFA 1YUWA 5ELZA 4Q0BA 4CHNA 2WONA 4FOIA 3P83D 1CXQA 1BWFO 1C1AA 1TKTA 4DTUA 2OCEA 2HB5A 3OS2A 3O08A 5BRFA 2RHKA 2E2QA 4FM2A 1JL1A 3C7NB 4H03B 1N33K 5ADXH 3VPZA 4EP4A 4CJ7A 1JKHA 1L3TA 2ZJRL 1EWQA 4GMJB 3LAMA 3LM2A 3AGKA 1S1XA 3HXMA 5E84A 2E5LK 3WQUA 3GDQA 1WSEA 1C1BA 1WAFA 1X9SA 1RBSA 3MCAB 1QE1A 3VF4A 2G8UA 1HR0K 2OTJN 1JLEA 4F9OA 3ZSZA 3CXCM 4CJUA 4YDUA 3H3NO 5HRRA 2HOEA 2AJQA 1IG8A 5BREA 3WXLA 1U47A 2QXLA 4A62A 1KVCA 2VWJA 3O3HA 1NJWA 3P31A 4F4KA 2O4IA 3C6AA 3NGZA 3K2PA 5BN8A 3KLGA 1EP4A 3Q7CA 3AO4A 2JWKA 1NGIA 2HF4A 3DXMA 3LDPA 1EO1A 5JS2A 3SK3A 5CHIA 1Q9YA 3P38A 2OA8A 2ZD1A 4J2EA 5FRMA 2ZJPL 3ZSXA 1C0GA 5E41A 4DSLA 4DCHA 3AVMA 2F8TA 2O8EB 3AO2A 1QS4A 4CZJA 2KTQA 3AO5A 4QS7A 3OJSA 3THWB 1BDGA 1TUUA 3ENBA 1K8KB 4CZIA 4ILHA 1BHLA 3OYKA 1L3VA 1NKBA 3C0BA 5KRTA 3I0SA 1VSFA 3KLEA 5GAEP 4AILC 4KHQA 3AVLA 4BRAA 2FC0A 2P9PA 3J80O 5FRNA 3U8XA 3RWUA 5BN9A 4B9MA 1RBRA 3E1YA 4A2AA 4FWOA 5HL7L 4OGCA 1IKWA 3JSMA 3DLEA 3LWMA 3FE1A 3SLCA 2ITMA 2BTFA 5C12A 4ID5A 3SQ1A 1BU6O 1VQ8N 3CQYA 4BRPA 1RT1A 1WSJA 4HUFA 4BACA 3D0PA 2BE2A 1QQMA 3L2QA 2DFHA 3AV9A 3DM2A 4Z4GA 1LWEA 3NVKA 4E1JA 1HJOA 4NCGA 3KK7A 4B9QA 4Z94A 1U49A 4DV0K 4JAXA 1I39A 3CCQN 1VHXA 1NKCA 2VG7A 4DR2K 5EVZA 5ADXA 4G1QA 2HNZA 1NOYA 4JKAA 5J2PA 3ZEUA 1NOZA 4CD3A 2UUCK 3LALA 1U04A 4IDKA 1ASWA 3OYFA 4KTWA 4DSIA 3DOKA 4B9NA 1XMOK 4CFAA 4I7FA 2P5OA 4IZ9A 3F5TA 3FFKB 3TAPA 1EWRA 3THWA 2E8AA 1VRUA 1KFDA 2VGMA 3ZETB 4L8RB 3TTFA 3OYLA 4B1VA 1QTMA 4DUYK 3QICA 3GE1A 2A42A 1U2VA 4PY5A 3TU5A 2P9PB 4E0DA 2Q31A 3AVIA 1SKSA 1B92A 1U45A 5A2QO 3BZCA 2PBDA 3OJUA 3SBGA 2D0OA 2QKBA 1IO2A 2QWMA 5JVHL 1GLCG 3PY8A 4DQ8A 1REVA 4ID1A 4QS8A 1VK0A 2A6AA 3S9HA 4HHTA 3KWGA 3DLKA 3H6EA 2ATQA 5J1EA 4DR4K 3TTCA 4CGIA 3U9ZA 4CGHA 1TYQB 2JGUA 3NF9A 4WFBL 3WNFA 3NH1A 4LH5A 5KGWA 4DTNA 2E4LA 4DTJA 4JHDB 4C8OA 4G9ZA 4CHQA 1C0TA 2EWSA 2VWKA 4DV2K 2Y1JA 3V9SA 4BRIA 2WUSA 2OANA 1UWBA 2F96A 4LFCK 2Q0RA 1JLGA 4WYBA 3C6UA 4FL9A 1HNIA 4PL8A 1T7PA 3DAWA 2DFEA 3ENHA 2BUPA 3ID8A 3E9LA 4AHUA 1WBDA 3M8SA 1YVUA 2HHXA 4FJ5A 3HVRA 4BDYA 1Q8IA 3J7AP 3SQ0A 3HI0A 4H0XB 3RRGA 3OYNA 3PSIA 2CH6A 1HNWK 2D0CA 4BGAA 1HYZA 1WSFA 3QIPA 1RTHA 4GVEA 4FM0A 2OPQA 1K8KA 4RW8A 2QW9A 1X9MA 3PX6A 3CMAN 3I33A 2ZJQL 2FBYA 1TKXA 3HO1A 1NMDA 4B3RK 2HBJA 3ZT1A 3DRRA 2VQFK 3ZETA 1CZBA 4BROA 2IIRA 3GBTA 3KK1A 1Q18A 2D1KA 4CEEA 1YJ9N 3SV4A 4E7LA 3QESA 4PKHA 1JCFA 4DLEA 1RTDA 4DTPA 4W5TA 3H46O 3ATVA 3ZX2A 3EYZA 3S3MA 4M3RA 1KLNA 4DU1A 1VSJA 3IMXA 1K6YA 4YHHK 1YJNN 3U3YA 2DY4A 2PZSA 1RCHA 3ULEA 1NM1A 1KVBA 3C6HA 1TKZA 1J9AA 3QINA 4CEZA 3UIQA 1RTIA 1YVNA 5SWMA 3LDQA 4BR7A 2NRTA 4FCYA 2FBXA 4CGJA 1W7AA 1NNEA 4DQIA 2KHOA 4FWRA 2X74A 1TYQA 3MEGA 2P9LA 5CZ2A 3W0LA 1NWKA 1IH7A 1VQ7N 4DWIA 1F21A 3B6PA 3CF5L 3EZWA 4Z4IA 5LL6Z 1IKXA 3T1HK 3I8DA 1KAZA 4OPAA 3SQ2A 4DTSA 1K8AO 1FW6A 3KHYA 3TTDA 5KQ8A 4FLWA 3WXIA 3K57A 3CCSN 3DXKB 2G8KA 3KLFA 1YTAA 2YCHA 3EN9A 3L4QA 4N41A 2KQ2A 4M63C 3ZSQA 2IDOA 1NGCA 4M3WA 5BPMA 5J2MA 4CERA 5AQIA 4CHZA 2PYLA 3NMUA 4FVUA 5AQQA 1GLBG 2O8CB 1OH6A 1BIZA 2I7PA 4IKFA 1G15A 1KD1O 1QVFM 3HM9A 4NLCA 3VMFB 3VA0A 3MX2A 3V6DA 4K8ZA 3LPUA 3MK6A 2AP1A 3SCXA 1GLAG 4CEBA 3JYTA 3B6OA 3CJ7A 4BRLA 3WNHA 3NE6A 3MEDA 2OZSA 5C2DA 3RVCA 5SZTA 4DSKA 3M6GA 2HHTA 4CJWA 1D4XA 2QWRA 5JLHA 2OPRA 4K43A 3BZKA 3EL2A 3WQTA 3O3GA 4HWIA 4WFAL 5I9EB 2X6NA 1HMVA 2BANA 5HRPA 4DU3A 4GW6A 3S3NA 3SNNA 1HLUA 2FBTA 2WOMA 1Q9XA 2D5RA 4XH5A 1YJWN 4CBWA 3QEVA 1T6CA 3PO4A 3QEWA 3K59A 4CD1A 3QBWA 1ATSA 3TANA 3ZLJA 3VQEA 3LANA 3HL8A 5AR0A 3ID6A 3CIPA 1SZ2A 4DV3K 3KD5E 1VQMN 1NGEA 4CZGA 1TAQA 4PQUA 3MWPA 1BA0A 4BC2A 1A5XA 2V52B 4JD2B 4CK1A 1T6DA 2I7NA 4WQ4C 3L6QA 3HOSA 3TSUA 3MN9A 4M45A 5CY4A 3F9MA 5AQHA 1BUPA 4DTXA 4CF1A 3JXUA 4JI6K 4PWDA 1VSDA 3L2WA 1WUAA 1BO5O 3GG4A 3VQCA 2HHWA 4JKHA 1Z26A 5CZ1A 2PAVA 4BC4A 1SUQA 5F0XA 3VA3A 5T7BA 4LF8K 4BR0A 2YV0X 2NRRA 5FPDA 3V81A 4FJGA 1IKYA 4BDZA 4BWMA 2J4RA 1KAYA 2KLAA 3AARA 2P9KA 4EHUA 4ZTJA 4Y0WA 4X65K 3G0ZA 1BI4A 3FLCO 4DR1K 3M8PA 2IVPA 1U48A 4KPYA 4XIUA 2ZGYA 4CHOA 1EXQA 2JLEA 4H0YB 1HPMA 1BQNA 3AY9A 4ICLA 1Q81O 2IVOA 4DQRA 3WT0A 4LD0A 3ZT2A 5F2RA 3J7YP 4EZ6A 2IVNA 3IRXA 3G10A 3V4IA 1HKGA 4IFYA 4B3MK 4JI1K 3AVKA 4JKCA 3CPEA 3ZSWA 3PUFA 1L3UA 4OO1J 3L0QA 1XQSC 1S72N 4F2RA 1BCOA 3U3GA 1EKEA 4R79A 3DXKA 4DHYA 4B8CA 2YHYA 1IG9A 4A5AA 1OVQA 3VEVA 1KAXA 3O9RA 1V4SA 4ELTA 5J2NA 1YHQN 3DI6A 5FPEA 4CJTA 4B1XB 5C25A 3AVJA 1SV5A 3HOTA 1EETA 3K5OA 4I9LA 3O9UA 4AHSA 3V9ZA 2XY8A 1KC8O 4JHDA 3LDNA 4BG9A 4O0IA 3CMEN 4KAZA 4JLHA 3VOVA 5AQSA 4A2BA 3PSFA 2BH1A 4FPBA 3K9JA 3ISNC 3ASMA 1WNSA 4DTRA 4LF9K 5GADP 4BRKA 4FJ7A 1XNRK 2FSNA 4O5FA 1BG3A 3IG1A 2B5JA 3HZ6A 3NBPA 4N47A 1S1UA 1J6ZA 3HPGA 4EHTA 3PLAA 4BQZA 3D6RA 3TPQA 3SYZA 5FDLA 1ZBIA 1TGOA 4GKJK 3QB0A 3QEXA 1BI4B 2YNGA 3D45A 2WFBA 2P9SA 4BRGA 2GEMA 3CCUN 3QEPA 3OW2M 4E7IA 3T1AA 4K42A 4ZTFA 1DTTA 3C94A 4FJLA 4CEDA 1D9DA 3U9DA 2R7YA 3O1BA 1VQLN 4O8KA 3MN5A 1ZYQA 1VAZA 3CD6N 1T8EA 4ISGA 3VEXA 4CIEA 1V4TA 3IAYA 1E4GT 4WE1A 3KTQA 3NF6A 3ZEUB 1LWFA 2FSJA 4K8XA 4BR9A 2FF3B 2ZM6K 1GOBA 1LCUA 3LZIA 4LSNA 4QCLA 4O55A 3I56N 2ASMA 3TAFA 2YHAA 1TAUA 4ILJA 2EHGA 4NO7A 4JK9A 4OPHA 4O8UA 2XY7A 4KBOA 5BRDA 3ALYA 5I3UA 3G71N 4K0KK 4CJKA 4CBXA 4Z4EA 2P9UB 1WN7A 4YOXA 3V9WA 1WSHA 1C0FA 2YX6A 3SI6A 3IS9A 1S6QA 4CJPA 3BDPA 2QWLA 1VSEA 3NHGA 4UQGA 3PX0A 4E7HA 5M1KA 5LMUK 4KKOA 1K9MO 4FJIA 1IKVA 4XH1A 1ZBUA 3VQBA 4LH4A 1OVYA 3Q7BA 2FBVA 2KW4A 1B9DA 5GIPA 5AQTA 2D4WA 1SL1A 1CXUA 3TSQA 3CETA 1W9HA 3WUHA 4YORA 3PIPL 3AVHA 4I6MA 1U6ZA 4BC3A 3L2UA 4CIGA 2HMIA 3THVA 1R0AA 3DLRA 1KTQA 1MWMA 3QIOA 3RRHA 1FK9A 4N56A 3FZMA 4CJQA 3KVGA 3QNNA 1ZBLA 4YNQA 1RDCA 4CZFA 2FXUA 4WF9L 2QWNA 4M3UA 1S1VA 1QQNA 3I8BA 4JI5K 2HHHK 4IEEA 3TR8A 3VEZA 3SUPA 1YT3A 3D7EO 3ITHA 1HUXA 3KK3A 2NRXA 3RSEB 1L3SA 3CJ9A 1ATRA 1RDUA 1X3MA 4IG3A 1TL3A 1TK0A 3ATUA 2UU9K 4BE2A 2IGIA 4EZ9A 2XRIA 3D2EB 2QTDA 4KHWA 4DLGA 1FXXA 3MN6A 2KKZA 4E89A 3A5MC 2PY5A 1RT3A 3LZJA 1OKJA 5AQYA 1NKEA 2P1JA 4BREA 1ATNA 1WSIA 3MDQA 2NRHA 4DR7K 3M1FA 2ASPA 3NVMA 3ZT0A 1YI2N 4KO0A 2Q2RA 3FZHA 3HP6A 1RT7A 3NDKA 1Q82O 1IV0A 4C8MA 3CCLN 4M3TA 1RFQA 5BR9A 3AAPA 1D8YA 4C8LA 1CZAN 3WNGA 3WXJA 4CJ4A 3IUCA 2O8DB 3BY5A 4O4GA 2B4JA 2HF3A 3VESA 4DV5K 3I55N 1T44A 3WEEB 2KZMA 4CK2A 3VQ8A 1D9FA 3SUQA 5IT9O 3OYHA 3TWHA 2HVIA 2HNYA 3O4QA 5BPNA 3VQ7A 1T05A 2VG5A 2RE2A 4CF8A 3OYMA 1JXEA 4DS5A 4B3SK 1NJZA 4FWSA 2HSTA 3LP2A 1X9WA 4BWJA 1GLLO 4NXNK 4YY3K 1ASUA 5KI6A 5C0YA 2CGKA 4DG1A 3T3FA 4FZXC 3AA3A 5HROA 4KHNA 2HBLA 1Y64A 2B6AA 4H4OA 1ZBHA 3SAFA 4CZEA 2I5JA 1SAZA 3WXKA 3V1QA 1JLCA 1NK9A 4FJHA 1RDDA 3R3LA 2ZWHA 4DTMA 5LY3A 3HSTB 3O3FA 1IJJA 1MU2A 2E1ZA 2YNHA 2AA4A 2YJFA 3A8YA 3U4LA 3G4SN 3MEEA 4DV4K 4Y1CA 3OYGA 3CC4N 3VEWA 1XNQK 3N4QA 4B9VA 4KH5A 4MDBA 4RCHA 1QQCA 4ISFA 3PO5A 2IAJA 4B9SA 3O8MA 5B8HA 1RDBA 3VERA 1NK5A 3G6EN 1N6QA 3ZYYX 1R59O 3RMDA 3S3OA 1UOCA 4H5TA 4M41A 2O8FB 4PKIA 3EO3A 4X62K 2O8DA 4LF4K 5D3GA 4WCEL 1N34K 4CJFA 3MCPA 1EQYA 4ZHRA 2GUPA 3OS0A 4Z4FA 3E66A 4IEIA 4ILGB 2QM1A 2YKNA 3OTOK 1VQON 2PFUA 3HBTA 3QFUA 5TKWA 1VQNN 2OZMA 3ZX0A 3O6WA 1VQ9N 1QZ6A 1BA1A 3QFPA 5CR4A 1XMQK 4QOZB 4C23A 3A0IX 3VQAA 1NJXA 3CJ1A 4DFMA 2KFZA 5AQRA 4FJ9A 1NK4A 3SBTA 3UE5A 3AVGA 3AA2A 2IOCA 1ILYA 1S9EA 4M3YA 1QHAA 1T3VA 3UKRA 4E1NA 3B8AX 4B1UB 2P9UA 1YXQA 1QZ5A 2GV9A 3QETA 5AZIA 1TV6A 4CBUA 3CCJN 1HPZA 4CZKA 3JS6A 1KQSM 3CI5A 4BRCA 4DFPA 3VTHA 4CZLA 3TI0A 5FLXO 3AAQA 1NGBA 4A61A 1NK8A 5K14A 5KPTA 5AFUA 1RBUA 2QKKA 3QMLA 3F9KA 5GINA 3D2FA 1NGAA 1DTQA 2WC9A 4OKEA 4JRQA 3DRSA 3EKUA 4N76A 1WOQA 4CF9A 4X66K 5BPLA 2YKMA 2A40A 1XHZA 2YHWA 4BR2A 1U4BA 3DWLA 4DF8A 4RTFD 3EY1A 4DSJA 2QXFA 4I2PA 1XUPO
chains in the Genus database with same CATH topology
5AJ3K 4DR6K 1XNQK 4B3MK 4JI1K 4B3RK 2UU9K 2UXBK 4LF5K 2VQFK 4JI4K 1I94K 4DUYK 4JYAK 2ZM6K 4DV6K 2UXCK 4DR3K 4X62K 4V19S 4LF4K 4DR7K 4LFAK 4JI0K 1N34K 1IBLK 5A2QO 1IBKK 3T1YK 4K0KK 4YHHK 4CW7B 1IBMK 3OTOK 5BR8K 3J80O 4DV3K 4AQYK 1XMQK 4OX9K 4LFBK 4DV5K 5LMUK 4DR4K 2UXDK 4DV1K 2VQEK 5IT9O 4DUZK 4X64K 1N36K 4JI2K 4LF9K 1N32K 5LL6Z 1XNRK 3T1HK 4B3SK 4JI6K 4LF6K 2UUBK 2UUAK 4NXNK 4YY3K 4DV2K 1N33K 4CVNE 1HNXK 4DV0K 4LFCK 4LF8K 2F4VK 1HNZK 4DR5K 4JI7K 4DR2K 4DV7K 4GKJK 1J5EK 5FLXO 2E5LK 4X65K 4KHPK 5IWAK 4B3TK 4JV5K 4DR1K 2UUCK 4NXMK 3JAMO 3J7AP 1HR0K 5LMNK 4JI3K 2HHHK 4JI5K 1FJGK 4X66K 4GKKK 1HNWK 4DV4K 1XMOK 3J7YP 4LF7K 4JI8K 3J81O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 K;  4DR6 K;  1XNQ K;  4B3M K;  4JI1 K;  4B3R K;  2UU9 K;  2UXB K;  4LF5 K;  2VQF K;  4JI4 K;  1I94 K;  4DUY K;  4JYA K;  2ZM6 K;  4DV6 K;  2UXC K;  4DR3 K;  4X62 K;  4V19 S;  4LF4 K;  4DR7 K;  4LFA K;  4JI0 K;  1N34 K;  1IBL K;  5A2Q O;  1IBK K;  3T1Y K;  4K0K K;  4YHH K;  4CW7 B;  1IBM K;  3OTO K;  5BR8 K;  3J80 O;  4DV3 K;  4AQY K;  1XMQ K;  4OX9 K;  4LFB K;  4DV5 K;  5LMU K;  4DR4 K;  2UXD K;  4DV1 K;  2VQE K;  5IT9 O;  4DUZ K;  4X64 K;  1N36 K;  4JI2 K;  4LF9 K;  1N32 K;  5LL6 Z;  1XNR K;  3T1H K;  4B3S K;  4JI6 K;  4LF6 K;  2UUB K;  2UUA K;  4NXN K;  4YY3 K;  4DV2 K;  1N33 K;  4CVN E;  1HNX K;  4DV0 K;  4LFC K;  4LF8 K;  2F4V K;  1HNZ K;  4DR5 K;  4JI7 K;  4DR2 K;  4DV7 K;  4GKJ K;  1J5E K;  5FLX O;  2E5L K;  4X65 K;  4KHP K;  5IWA K;  4B3T K;  4JV5 K;  4DR1 K;  2UUC K;  4NXM K;  3JAM O;  3J7A P;  1HR0 K;  5LMN K;  4JI3 K;  2HHH K;  4JI5 K;  1FJG K;  4X66 K;  4GKK K;  1HNW K;  4DV4 K;  1XMO K;  3J7Y P;  4LF7 K;  4JI8 K;  3J81 O; 
#chains in the Genus database with same CATH topology
 3UKU A;  1HNV A;  1GLD G;  4LSL A;  1VQP N;  4Q5V A;  5F1X A;  4F3T A;  4CHP A;  4J2B A;  1X9J A;  3A5L C;  5KQD A;  1HQU A;  1QQO A;  3VF6 A;  3C7N A;  4FJX A;  2DFF A;  3ZSO A;  4C1N I;  4CFC A;  4W5R A;  2F7T A;  4B1W B;  2ZF5 O;  3TAG A;  3IKM A;  1LWC A;  2P9I A;  2GEL A;  4KTZ A;  4LFA K;  2F9W A;  3HSC A;  2W42 A;  4WFN L;  4BVO A;  2HBM A;  3LP0 A;  3AA4 A;  2ZGZ A;  3OBY A;  3KLI A;  2UYT A;  5AQN A;  3VEO A;  1NG9 A;  1JLA A;  3R1X A;  1NU0 A;  3FGU A;  4ISE A;  3KKS A;  4CE9 A;  4DF4 A;  4BY9 C;  1RTJ A;  5AQW A;  4CJ5 A;  4ELV A;  3NAE A;  3BF3 A;  3T19 A;  3C65 A;  5GIO A;  4KI4 A;  3CM5 A;  1P8Z A;  4BRM A;  1KXP A;  1SKR A;  4F2S A;  1XWL A;  4CEQ A;  2QEX N;  4B08 A;  4DUZ K;  3E9P A;  4J2A A;  5KTQ A;  4AF1 A;  1YAG A;  3LM9 A;  1HRH A;  4Y1D A;  4UY8 O;  2HHU A;  1Z6R A;  3QNO A;  4FJK A;  4FO0 A;  4FXD A;  4IOA L;  3LDO A;  1S9G A;  2RPI A;  3CC7 N;  3L3U A;  4KTQ A;  1Z25 A;  1HNX K;  3LPT A;  3SPY A;  4KHU A;  1MA9 B;  4JNE A;  2HVH A;  1MWK A;  3HK2 A;  4KH6 A;  3VTI A;  3K5N A;  4DKW A;  4PUO A;  5HBM A;  3CPW M;  4BE0 A;  4CCH A;  2GX9 A;  3E9O A;  3HT3 A;  4DU4 A;  3THY B;  2E6M A;  3KJV A;  2E2P A;  2IC3 A;  4NXM K;  3K58 A;  3AVN A;  1RT4 A;  4FLU A;  3TAQ A;  3SZ2 A;  4I6M B;  4DQQ A;  5LMN K;  1FJG K;  3PV8 A;  1RDW X;  1S22 A;  4NLB A;  2P9L B;  4IXC A;  2G8W A;  4ELU A;  1VRT A;  3SMP A;  1NGJ A;  4CJV A;  5AJ3 K;  2E2O A;  3BP8 A;  4WQ4 A;  1SKW A;  1SQK A;  1P90 A;  3OHR A;  4U67 L;  3VGM A;  3AVA A;  5KPZ A;  3UKR B;  4B9U A;  4M3X A;  3LDL A;  4B9T A;  1BL3 A;  2Z1G A;  2P9I B;  2NRW A;  5I42 A;  1KVA A;  2GBZ A;  4FLY A;  4JI0 K;  3OYA A;  1LOT B;  1JL2 A;  2W41 A;  5EY4 A;  4JN4 A;  4CJL A;  1LAW A;  3P4I A;  4OPK A;  4H5R A;  4AHC A;  1QHT A;  1D5A A;  1BIU A;  3IDH A;  4CEF A;  3VQP A;  4FWP A;  5AQV A;  4R5P A;  2GWK A;  4JRP A;  3D2F B;  3L4I A;  2LSN A;  4RW7 A;  1LV5 A;  3ZT4 A;  4DSF A;  1GOA A;  2D0A A;  1ZXO A;  2BDP A;  1C0U A;  2VQE K;  1VQ4 N;  1JJ2 M;  3AVB A;  3H45 C;  1VSH A;  3EEQ A;  4JEP A;  1TVR A;  3OYB A;  4B3O A;  3ZSY A;  3RMC A;  3T7Z A;  5EXW A;  4CGG A;  3RTV A;  3QLH A;  4FVM A;  3AO1 A;  4RW9 A;  2RKI A;  1C6V A;  3TAB A;  4C1N K;  4KRF A;  2UUA K;  4CK3 A;  1BQM A;  5E26 A;  1HYS A;  1N8R O;  3OY9 A;  1HNZ K;  3P1G A;  1YIJ N;  1DEJ A;  4GV6 A;  4NCB A;  2VWB A;  3QO9 A;  3SUN A;  2QA4 N;  5GAG P;  3CJB A;  1NMN A;  3MXI A;  2V51 B;  2O4G A;  4RW6 A;  1DKG D;  2JWL A;  4TSX A;  2F9T A;  5CYM A;  4O5B A;  4BR5 A;  1JCG A;  4FK0 A;  4M7X A;  3SQ4 A;  1HKB A;  3VQ9 A;  3LDS A;  2O8B B;  4CZM A;  1NGF A;  4H5V A;  4M7Y A;  3O80 A;  4FZY A;  1RIL A;  2E2N A;  3K9K A;  2QWP A;  1NK0 A;  4PKG A;  5M1F A;  2O8C A;  2XY5 A;  5JS1 A;  3NH2 A;  3THY A;  1O1W A;  1VSK A;  2X78 A;  4LF5 K;  3O4N A;  1N5Y A;  4JI4 K;  3CJC A;  4JKD A;  3NGI A;  4JYA K;  4DV6 K;  1VSL A;  2ZE2 A;  1G99 A;  2OPS A;  5KPR A;  4FJM A;  3DJC A;  4YOU A;  2H3G X;  3E01 A;  2CH5 A;  1WLJ A;  1XI1 A;  4FLZ A;  2O8F A;  3M8Q A;  4HVJ A;  5AQP A;  1IBL K;  4JKG A;  2QK9 A;  4K41 A;  4OPJ A;  4AHT A;  1Q86 O;  4DFK A;  4CHY A;  2YJE A;  2F8S A;  1NK7 A;  4HCC A;  5C15 A;  1S6P A;  3KZB A;  3O9S A;  5AQF A;  5MLC Q;  4AQY K;  3OS1 A;  4GV3 A;  4OX9 K;  1NGH A;  4JD2 A;  4FLX A;  3K5L A;  2Q1N A;  2EX3 A;  3CCE N;  4DTO A;  2DTU A;  2UXD K;  4BG8 A;  4HUG A;  3SMS A;  4X64 K;  4MLE A;  3KWI A;  1JLQ A;  4I2Q A;  1VQK N;  3KK2 A;  5EX5 A;  1X1P A;  1N36 K;  4DSE A;  3DLB A;  2G8I A;  4DFJ A;  1XC9 A;  2P5G A;  3K5M A;  4IO8 A;  4E7K A;  2D0P A;  4W5N A;  2Q36 A;  1QSY A;  3KIO A;  2RF2 A;  1VSM A;  4E19 A;  3C6T A;  1HQE A;  4JKG B;  4DR5 K;  1S1T A;  1ZBS A;  3N4P A;  4H0T B;  1W97 L;  4A57 A;  3SJJ A;  1GLJ O;  4HUE A;  2Q0U A;  2YHX A;  4KHP K;  4CF2 A;  2QWQ A;  5AQL A;  1JXB A;  3VQ4 A;  4JV5 K;  4MO4 A;  4C8K A;  3JAM O;  1RT5 A;  3VET A;  1T03 A;  3FZL A;  1NJY A;  1DT9 A;  2P9N B;  3HJF A;  4PL7 A;  4HTL A;  2OYQ A;  5DM6 L;  4LF7 K;  2Z1J A;  3HP9 A;  5FPN A;  3J81 O;  4PA1 A;  3SUO A;  3DLG A;  1TK8 A;  4IBN A;  4BRN A;  2V7Y A;  3KKR A;  3QEI A;  3HRG A;  5C10 A;  4OKK A;  3C95 A;  3DLL L;  5KGX A;  3KD1 E;  4OGE A;  3W3D A;  4H8K A;  3K0S A;  3RR8 A;  1VQ5 N;  1HX1 A;  1YF5 L;  4M3Z A;  4JS4 A;  4LC9 B;  5LJW A;  2NRV A;  3IFR A;  3FZK A;  3OA9 A;  2P9K B;  1S5J A;  1DGK N;  2DPN A;  5BR8 K;  4E7J A;  1WB9 A;  4DQS A;  2XO7 A;  4BRQ A;  4O44 A;  3SAG A;  1TUY A;  4W5Q A;  3EE9 A;  5GAH P;  5AQO A;  2Z1H A;  3A2F A;  1QVG M;  3M5R A;  3OYC A;  2Y1I A;  3PX4 A;  4DMN A;  3THX B;  1ZC6 A;  4Z4C A;  1SL0 A;  4BR4 A;  1UAX A;  1KLM A;  3VEN A;  1KRP A;  4YOY A;  3O4W A;  1XC3 A;  4NYF A;  1OH8 A;  3LP3 A;  2VGN A;  1RT2 A;  4CIF A;  4CGD A;  3VGL A;  3A5N C;  3VN5 A;  2E88 A;  1NK6 A;  3BEX A;  4LF6 K;  3L3V A;  5AQG A;  5JIC A;  2WTU A;  1HJR A;  2BGG A;  1KSP A;  3L2R A;  4FYD A;  2W40 A;  3V1O A;  2HHS A;  3CYM A;  4BGB A;  4FJ8 A;  1X3N A;  4DV7 K;  3VGK A;  4FPA A;  1I3A A;  3OBW A;  3HM8 A;  1OH7 A;  2HW3 A;  2FSK A;  4KB1 A;  4FK2 A;  1LAV A;  2NLX A;  3NH0 A;  1DLO A;  4OLB A;  3H3O B;  4AH9 A;  2G8V A;  4KV8 A;  3EZ5 A;  4E3S A;  4FWL A;  3V9U A;  1C0M A;  1FKO A;  3CCV N;  3AO3 A;  1M1K O;  1WBB A;  4FK4 A;  1H1V A;  1A5W A;  1LW0 A;  3CHW A;  4FZZ A;  3ZX3 A;  1J53 A;  3NCI A;  3HPH A;  1CZ9 A;  4DB3 A;  4CZH A;  4CJS A;  3T69 A;  3MXJ A;  3OYI A;  3H1Q A;  3H1V X;  1VQ6 N;  2FLO A;  3O5B A;  4DR3 K;  4YOW A;  1L5U A;  3LL3 A;  4MQ3 A;  3F73 A;  3CQX A;  1NGG A;  1W2B M;  1NLV A;  1YTU A;  4L3Q A;  5DMR A;  5M1P A;  4CJR A;  5AZJ B;  1RT6 A;  3BF1 A;  5C42 A;  3CQ8 A;  1QSS A;  3VQQ A;  4QAG A;  1IBK K;  1RDA A;  4A5B A;  3T1Y K;  3CFP A;  3CM6 A;  3DYA A;  5JLF A;  4CI6 A;  1E4F T;  2A1S A;  5HP1 A;  2WBN A;  4MO5 A;  3R9P A;  4BRH A;  3GL1 A;  3TAE A;  4DS4 A;  5HRN A;  4FWK A;  3NGY A;  1JCE A;  1SS6 A;  2Q97 A;  3VQ5 A;  3UB5 A;  2E1Y A;  3MN7 A;  2KZZ A;  4DV1 K;  2G8F A;  2HHV A;  4BVP A;  3QBX A;  3ZT3 A;  4JK7 A;  1MDU B;  2QWO A;  5HOO A;  3A5O C;  4JI2 K;  1HYV A;  1N32 K;  4LY7 A;  4CEO A;  3P39 A;  3EE8 A;  3TAM A;  5DM7 L;  5TKY A;  3LWL A;  2UUB K;  4KB0 A;  1KFS A;  3HPO A;  5CE3 A;  5AQZ A;  4U7B A;  2F4V K;  1J54 A;  2VG6 A;  4JS5 A;  4JI7 K;  1ZBF A;  1GLE G;  2CGJ A;  4CJ3 A;  4IFV A;  1JLB A;  4K25 A;  5IWA K;  2G8H A;  4N5S A;  1NGD A;  1ITG A;  1UA1 A;  3DOL A;  1S1W A;  4JI3 K;  4KRE A;  4XEI A;  3RMB A;  4OVL A;  4KFB A;  5M1O A;  2NUB A;  4GKK K;  3WEE A;  3QER A;  2NRZ A;  2ETJ A;  3MEC A;  3L8B A;  4QS9 A;  3L2V A;  4IDH A;  4DR6 K;  1FKP A;  3AA5 X;  3DXM B;  1J5O A;  4F3O A;  2UXB K;  3VEY A;  4BRD A;  1OH5 A;  4IJA A;  4W5O A;  4H0O A;  4FW1 A;  4FLV A;  4GVM A;  2A41 A;  2P51 A;  1QSL A;  2A5X A;  3CER A;  4JKB A;  2O8E A;  4RW4 A;  4EIA A;  4IJN A;  4IG0 A;  4CF0 A;  4FJN A;  3V9X A;  1CLQ A;  5FPM A;  5AFU H;  4PHT X;  5JVG L;  4FM1 A;  2ZQB A;  4B8A B;  1IBM K;  4I9Q A;  1B9F A;  5BRH A;  2Z1I A;  3ULD A;  3MWT A;  4FW2 A;  2P9N A;  4YFU A;  4HTU A;  3SPZ A;  1U2V B;  4JKE A;  2GTD A;  5M1Q A;  1A5V A;  4MLH A;  1EX4 A;  2OTL N;  3M8R A;  3BUZ B;  3CCM N;  4GNI A;  1O13 A;  2OPP A;  4CEC A;  3LAK A;  2CGL A;  5EU7 A;  2V7Z A;  4CEA A;  3OYE A;  1C1C A;  2XY6 A;  2GWJ A;  4O0J A;  3SAH A;  3AVF A;  4AM6 A;  1XHX A;  4CFB A;  4H4M A;  1TKD A;  4M42 A;  5C2F A;  3WNE A;  4CVN E;  4AHR A;  5AQJ A;  4FJJ A;  3TSP A;  3RSE A;  4B9L A;  3OYD A;  3SV3 A;  4KH4 A;  1J5E K;  1ESV A;  5CYQ A;  4GV9 A;  3AGR A;  4CFD A;  3VQ6 A;  3AVC A;  3D2E A;  1BGX T;  4GY2 B;  1E3M A;  2QI2 A;  4B3T K;  3CCR N;  3SJH A;  2IS3 A;  2HBK A;  1K73 O;  3R6M A;  4FLT A;  2YI1 A;  1RGI A;  1Y97 A;  4H0V B;  4DQP A;  3MXM A;  3G25 A;  4H0P A;  4A59 A;  5AZI B;  4EP5 A;  3VF2 A;  2HND A;  3J7Z O;  3H08 A;  4AHV A;  4C8N A;  4JI8 K;  5AQX A;  4YOV A;  3OYJ A;  4J8F A;  5AQM A;  4YOT A;  4H5W A;  3KLH A;  3ENO A;  4OJR A;  4IO9 L;  2YNI A;  3GOI A;  1Q7Y O;  4FOE A;  4BRF A;  3RR7 A;  4XH4 A;  3P5J A;  3CG7 A;  3FZF A;  3BGR A;  3V1R A;  1TK5 A;  3CC2 N;  4JK8 A;  2ASO A;  4WQ5 C;  4NCA A;  3LP1 A;  3UKU B;  3CFR A;  5KRS A;  3M3Z A;  5EOY A;  3J8A A;  2Q3S A;  4KI6 A;  2P9S B;  2KFN A;  4MDA A;  3CJA A;  4CGF A;  4EFH A;  2ITG A;  4IWV A;  5LJV A;  5JMV A;  2NNW A;  1KCF A;  1UA0 A;  3FFI A;  3HYF A;  2YNF A;  2VYP A;  1NBW A;  1WSG A;  4IFE A;  4H5N A;  3OVN A;  3ZCM A;  1S3X A;  3DRP A;  1GLF O;  4RG8 A;  4NB4 A;  3RMA A;  1RBV A;  3DLH A;  1BOT O;  1RNH A;  2A3Z A;  4BC5 A;  1HKC A;  4KHY A;  5J2Q A;  2YHB A;  3ULE B;  5AQU A;  1LW2 A;  2XHB A;  1NJI O;  2O8B A;  2W6L A;  4IOC L;  4Z4H A;  2RN2 A;  5C24 A;  3I0R A;  2NZT A;  2E6L A;  2PYJ A;  4AM7 A;  4IOX A;  3NF7 A;  4EAH D;  3F2K A;  3O1W A;  4RWT A;  5HRS A;  2GUI A;  3NFA A;  2FF6 A;  4OKJ A;  5FRO A;  4CJE A;  4WQ5 A;  3HVT A;  3NF8 A;  3VQD A;  1M90 O;  3MX5 A;  2A1R A;  1SL2 A;  5M1N A;  4JKF A;  1VSI A;  3HTV A;  2E20 A;  4FWM A;  4J2D A;  4FWQ A;  3O9T A;  3THX A;  4E1M A;  1BCM A;  1BIS A;  1TL1 A;  1ASV A;  3MAQ A;  1W0H A;  1RBT A;  1YIT N;  1WAJ A;  1I94 K;  3O9Q A;  3TAR A;  3U6F A;  4HCB A;  3R8E A;  4BE1 A;  3S41 A;  4KHS A;  1Z05 A;  4Z0U A;  2UXC K;  2W6K A;  3MMV A;  3FR0 A;  2HMP A;  4F8R A;  4V19 S;  3WXM B;  5AZJ A;  4BDP A;  3ZSR A;  3QDK A;  5DK5 A;  4FWN A;  3ZSV A;  4BQL A;  4CES A;  1JLF A;  4FSV A;  4B1Z A;  3DMJ A;  3EKS A;  1GOC A;  4CW7 B;  3CFO A;  4NYN A;  2VCP A;  4OLA A;  2D0B A;  4MFB A;  2HHQ A;  5AQK A;  5H1S Q;  2X6S A;  4YDU C;  4B1Y B;  3PIO L;  4LFB K;  5HLF A;  1YUW A;  5ELZ A;  4Q0B A;  4CHN A;  2WON A;  4FOI A;  3P83 D;  1CXQ A;  1BWF O;  1C1A A;  1TKT A;  4DTU A;  2OCE A;  2HB5 A;  3OS2 A;  3O08 A;  5BRF A;  2RHK A;  2E2Q A;  4FM2 A;  1JL1 A;  3C7N B;  4H03 B;  1N33 K;  5ADX H;  3VPZ A;  4EP4 A;  4CJ7 A;  1JKH A;  1L3T A;  2ZJR L;  1EWQ A;  4GMJ B;  3LAM A;  3LM2 A;  3AGK A;  1S1X A;  3HXM A;  5E84 A;  2E5L K;  3WQU A;  3GDQ A;  1WSE A;  1C1B A;  1WAF A;  1X9S A;  1RBS A;  3MCA B;  1QE1 A;  3VF4 A;  2G8U A;  1HR0 K;  2OTJ N;  1JLE A;  4F9O A;  3ZSZ A;  3CXC M;  4CJU A;  4YDU A;  3H3N O;  5HRR A;  2HOE A;  2AJQ A;  1IG8 A;  5BRE A;  3WXL A;  1U47 A;  2QXL A;  4A62 A;  1KVC A;  2VWJ A;  3O3H A;  1NJW A;  3P31 A;  4F4K A;  2O4I A;  3C6A A;  3NGZ A;  3K2P A;  5BN8 A;  3KLG A;  1EP4 A;  3Q7C A;  3AO4 A;  2JWK A;  1NGI A;  2HF4 A;  3DXM A;  3LDP A;  1EO1 A;  5JS2 A;  3SK3 A;  5CHI A;  1Q9Y A;  3P38 A;  2OA8 A;  2ZD1 A;  4J2E A;  5FRM A;  2ZJP L;  3ZSX A;  1C0G A;  5E41 A;  4DSL A;  4DCH A;  3AVM A;  2F8T A;  2O8E B;  3AO2 A;  1QS4 A;  4CZJ A;  2KTQ A;  3AO5 A;  4QS7 A;  3OJS A;  3THW B;  1BDG A;  1TUU A;  3ENB A;  1K8K B;  4CZI A;  4ILH A;  1BHL A;  3OYK A;  1L3V A;  1NKB A;  3C0B A;  5KRT A;  3I0S A;  1VSF A;  3KLE A;  5GAE P;  4AIL C;  4KHQ A;  3AVL A;  4BRA A;  2FC0 A;  2P9P A;  3J80 O;  5FRN A;  3U8X A;  3RWU A;  5BN9 A;  4B9M A;  1RBR A;  3E1Y A;  4A2A A;  4FWO A;  5HL7 L;  4OGC A;  1IKW A;  3JSM A;  3DLE A;  3LWM A;  3FE1 A;  3SLC A;  2ITM A;  2BTF A;  5C12 A;  4ID5 A;  3SQ1 A;  1BU6 O;  1VQ8 N;  3CQY A;  4BRP A;  1RT1 A;  1WSJ A;  4HUF A;  4BAC A;  3D0P A;  2BE2 A;  1QQM A;  3L2Q A;  2DFH A;  3AV9 A;  3DM2 A;  4Z4G A;  1LWE A;  3NVK A;  4E1J A;  1HJO A;  4NCG A;  3KK7 A;  4B9Q A;  4Z94 A;  1U49 A;  4DV0 K;  4JAX A;  1I39 A;  3CCQ N;  1VHX A;  1NKC A;  2VG7 A;  4DR2 K;  5EVZ A;  5ADX A;  4G1Q A;  2HNZ A;  1NOY A;  4JKA A;  5J2P A;  3ZEU A;  1NOZ A;  4CD3 A;  2UUC K;  3LAL A;  1U04 A;  4IDK A;  1ASW A;  3OYF A;  4KTW A;  4DSI A;  3DOK A;  4B9N A;  1XMO K;  4CFA A;  4I7F A;  2P5O A;  4IZ9 A;  3F5T A;  3FFK B;  3TAP A;  1EWR A;  3THW A;  2E8A A;  1VRU A;  1KFD A;  2VGM A;  3ZET B;  4L8R B;  3TTF A;  3OYL A;  4B1V A;  1QTM A;  4DUY K;  3QIC A;  3GE1 A;  2A42 A;  1U2V A;  4PY5 A;  3TU5 A;  2P9P B;  4E0D A;  2Q31 A;  3AVI A;  1SKS A;  1B92 A;  1U45 A;  5A2Q O;  3BZC A;  2PBD A;  3OJU A;  3SBG A;  2D0O A;  2QKB A;  1IO2 A;  2QWM A;  5JVH L;  1GLC G;  3PY8 A;  4DQ8 A;  1REV A;  4ID1 A;  4QS8 A;  1VK0 A;  2A6A A;  3S9H A;  4HHT A;  3KWG A;  3DLK A;  3H6E A;  2ATQ A;  5J1E A;  4DR4 K;  3TTC A;  4CGI A;  3U9Z A;  4CGH A;  1TYQ B;  2JGU A;  3NF9 A;  4WFB L;  3WNF A;  3NH1 A;  4LH5 A;  5KGW A;  4DTN A;  2E4L A;  4DTJ A;  4JHD B;  4C8O A;  4G9Z A;  4CHQ A;  1C0T A;  2EWS A;  2VWK A;  4DV2 K;  2Y1J A;  3V9S A;  4BRI A;  2WUS A;  2OAN A;  1UWB A;  2F96 A;  4LFC K;  2Q0R A;  1JLG A;  4WYB A;  3C6U A;  4FL9 A;  1HNI A;  4PL8 A;  1T7P A;  3DAW A;  2DFE A;  3ENH A;  2BUP A;  3ID8 A;  3E9L A;  4AHU A;  1WBD A;  3M8S A;  1YVU A;  2HHX A;  4FJ5 A;  3HVR A;  4BDY A;  1Q8I A;  3J7A P;  3SQ0 A;  3HI0 A;  4H0X B;  3RRG A;  3OYN A;  3PSI A;  2CH6 A;  1HNW K;  2D0C A;  4BGA A;  1HYZ A;  1WSF A;  3QIP A;  1RTH A;  4GVE A;  4FM0 A;  2OPQ A;  1K8K A;  4RW8 A;  2QW9 A;  1X9M A;  3PX6 A;  3CMA N;  3I33 A;  2ZJQ L;  2FBY A;  1TKX A;  3HO1 A;  1NMD A;  4B3R K;  2HBJ A;  3ZT1 A;  3DRR A;  2VQF K;  3ZET A;  1CZB A;  4BRO A;  2IIR A;  3GBT A;  3KK1 A;  1Q18 A;  2D1K A;  4CEE A;  1YJ9 N;  3SV4 A;  4E7L A;  3QES A;  4PKH A;  1JCF A;  4DLE A;  1RTD A;  4DTP A;  4W5T A;  3H46 O;  3ATV A;  3ZX2 A;  3EYZ A;  3S3M A;  4M3R A;  1KLN A;  4DU1 A;  1VSJ A;  3IMX A;  1K6Y A;  4YHH K;  1YJN N;  3U3Y A;  2DY4 A;  2PZS A;  1RCH A;  3ULE A;  1NM1 A;  1KVB A;  3C6H A;  1TKZ A;  1J9A A;  3QIN A;  4CEZ A;  3UIQ A;  1RTI A;  1YVN A;  5SWM A;  3LDQ A;  4BR7 A;  2NRT A;  4FCY A;  2FBX A;  4CGJ A;  1W7A A;  1NNE A;  4DQI A;  2KHO A;  4FWR A;  2X74 A;  1TYQ A;  3MEG A;  2P9L A;  5CZ2 A;  3W0L A;  1NWK A;  1IH7 A;  1VQ7 N;  4DWI A;  1F21 A;  3B6P A;  3CF5 L;  3EZW A;  4Z4I A;  5LL6 Z;  1IKX A;  3T1H K;  3I8D A;  1KAZ A;  4OPA A;  3SQ2 A;  4DTS A;  1K8A O;  1FW6 A;  3KHY A;  3TTD A;  5KQ8 A;  4FLW A;  3WXI A;  3K57 A;  3CCS N;  3DXK B;  2G8K A;  3KLF A;  1YTA A;  2YCH A;  3EN9 A;  3L4Q A;  4N41 A;  2KQ2 A;  4M63 C;  3ZSQ A;  2IDO A;  1NGC A;  4M3W A;  5BPM A;  5J2M A;  4CER A;  5AQI A;  4CHZ A;  2PYL A;  3NMU A;  4FVU A;  5AQQ A;  1GLB G;  2O8C B;  1OH6 A;  1BIZ A;  2I7P A;  4IKF A;  1G15 A;  1KD1 O;  1QVF M;  3HM9 A;  4NLC A;  3VMF B;  3VA0 A;  3MX2 A;  3V6D A;  4K8Z A;  3LPU A;  3MK6 A;  2AP1 A;  3SCX A;  1GLA G;  4CEB A;  3JYT A;  3B6O A;  3CJ7 A;  4BRL A;  3WNH A;  3NE6 A;  3MED A;  2OZS A;  5C2D A;  3RVC A;  5SZT A;  4DSK A;  3M6G A;  2HHT A;  4CJW A;  1D4X A;  2QWR A;  5JLH A;  2OPR A;  4K43 A;  3BZK A;  3EL2 A;  3WQT A;  3O3G A;  4HWI A;  4WFA L;  5I9E B;  2X6N A;  1HMV A;  2BAN A;  5HRP A;  4DU3 A;  4GW6 A;  3S3N A;  3SNN A;  1HLU A;  2FBT A;  2WOM A;  1Q9X A;  2D5R A;  4XH5 A;  1YJW N;  4CBW A;  3QEV A;  1T6C A;  3PO4 A;  3QEW A;  3K59 A;  4CD1 A;  3QBW A;  1ATS A;  3TAN A;  3ZLJ A;  3VQE A;  3LAN A;  3HL8 A;  5AR0 A;  3ID6 A;  3CIP A;  1SZ2 A;  4DV3 K;  3KD5 E;  1VQM N;  1NGE A;  4CZG A;  1TAQ A;  4PQU A;  3MWP A;  1BA0 A;  4BC2 A;  1A5X A;  2V52 B;  4JD2 B;  4CK1 A;  1T6D A;  2I7N A;  4WQ4 C;  3L6Q A;  3HOS A;  3TSU A;  3MN9 A;  4M45 A;  5CY4 A;  3F9M A;  5AQH A;  1BUP A;  4DTX A;  4CF1 A;  3JXU A;  4JI6 K;  4PWD A;  1VSD A;  3L2W A;  1WUA A;  1BO5 O;  3GG4 A;  3VQC A;  2HHW A;  4JKH A;  1Z26 A;  5CZ1 A;  2PAV A;  4BC4 A;  1SUQ A;  5F0X A;  3VA3 A;  5T7B A;  4LF8 K;  4BR0 A;  2YV0 X;  2NRR A;  5FPD A;  3V81 A;  4FJG A;  1IKY A;  4BDZ A;  4BWM A;  2J4R A;  1KAY A;  2KLA A;  3AAR A;  2P9K A;  4EHU A;  4ZTJ A;  4Y0W A;  4X65 K;  3G0Z A;  1BI4 A;  3FLC O;  4DR1 K;  3M8P A;  2IVP A;  1U48 A;  4KPY A;  4XIU A;  2ZGY A;  4CHO A;  1EXQ A;  2JLE A;  4H0Y B;  1HPM A;  1BQN A;  3AY9 A;  4ICL A;  1Q81 O;  2IVO A;  4DQR A;  3WT0 A;  4LD0 A;  3ZT2 A;  5F2R A;  3J7Y P;  4EZ6 A;  2IVN A;  3IRX A;  3G10 A;  3V4I A;  1HKG A;  4IFY A;  4B3M K;  4JI1 K;  3AVK A;  4JKC A;  3CPE A;  3ZSW A;  3PUF A;  1L3U A;  4OO1 J;  3L0Q A;  1XQS C;  1S72 N;  4F2R A;  1BCO A;  3U3G A;  1EKE A;  4R79 A;  3DXK A;  4DHY A;  4B8C A;  2YHY A;  1IG9 A;  4A5A A;  1OVQ A;  3VEV A;  1KAX A;  3O9R A;  1V4S A;  4ELT A;  5J2N A;  1YHQ N;  3DI6 A;  5FPE A;  4CJT A;  4B1X B;  5C25 A;  3AVJ A;  1SV5 A;  3HOT A;  1EET A;  3K5O A;  4I9L A;  3O9U A;  4AHS A;  3V9Z A;  2XY8 A;  1KC8 O;  4JHD A;  3LDN A;  4BG9 A;  4O0I A;  3CME N;  4KAZ A;  4JLH A;  3VOV A;  5AQS A;  4A2B A;  3PSF A;  2BH1 A;  4FPB A;  3K9J A;  3ISN C;  3ASM A;  1WNS A;  4DTR A;  4LF9 K;  5GAD P;  4BRK A;  4FJ7 A;  1XNR K;  2FSN A;  4O5F A;  1BG3 A;  3IG1 A;  2B5J A;  3HZ6 A;  3NBP A;  4N47 A;  1S1U A;  1J6Z A;  3HPG A;  4EHT A;  3PLA A;  4BQZ A;  3D6R A;  3TPQ A;  3SYZ A;  5FDL A;  1ZBI A;  1TGO A;  4GKJ K;  3QB0 A;  3QEX A;  1BI4 B;  2YNG A;  3D45 A;  2WFB A;  2P9S A;  4BRG A;  2GEM A;  3CCU N;  3QEP A;  3OW2 M;  4E7I A;  3T1A A;  4K42 A;  4ZTF A;  1DTT A;  3C94 A;  4FJL A;  4CED A;  1D9D A;  3U9D A;  2R7Y A;  3O1B A;  1VQL N;  4O8K A;  3MN5 A;  1ZYQ A;  1VAZ A;  3CD6 N;  1T8E A;  4ISG A;  3VEX A;  4CIE A;  1V4T A;  3IAY A;  1E4G T;  4WE1 A;  3KTQ A;  3NF6 A;  3ZEU B;  1LWF A;  2FSJ A;  4K8X A;  4BR9 A;  2FF3 B;  2ZM6 K;  1GOB A;  1LCU A;  3LZI A;  4LSN A;  4QCL A;  4O55 A;  3I56 N;  2ASM A;  3TAF A;  2YHA A;  1TAU A;  4ILJ A;  2EHG A;  4NO7 A;  4JK9 A;  4OPH A;  4O8U A;  2XY7 A;  4KBO A;  5BRD A;  3ALY A;  5I3U A;  3G71 N;  4K0K K;  4CJK A;  4CBX A;  4Z4E A;  2P9U B;  1WN7 A;  4YOX A;  3V9W A;  1WSH A;  1C0F A;  2YX6 A;  3SI6 A;  3IS9 A;  1S6Q A;  4CJP A;  3BDP A;  2QWL A;  1VSE A;  3NHG A;  4UQG A;  3PX0 A;  4E7H A;  5M1K A;  5LMU K;  4KKO A;  1K9M O;  4FJI A;  1IKV A;  4XH1 A;  1ZBU A;  3VQB A;  4LH4 A;  1OVY A;  3Q7B A;  2FBV A;  2KW4 A;  1B9D A;  5GIP A;  5AQT A;  2D4W A;  1SL1 A;  1CXU A;  3TSQ A;  3CET A;  1W9H A;  3WUH A;  4YOR A;  3PIP L;  3AVH A;  4I6M A;  1U6Z A;  4BC3 A;  3L2U A;  4CIG A;  2HMI A;  3THV A;  1R0A A;  3DLR A;  1KTQ A;  1MWM A;  3QIO A;  3RRH A;  1FK9 A;  4N56 A;  3FZM A;  4CJQ A;  3KVG A;  3QNN A;  1ZBL A;  4YNQ A;  1RDC A;  4CZF A;  2FXU A;  4WF9 L;  2QWN A;  4M3U A;  1S1V A;  1QQN A;  3I8B A;  4JI5 K;  2HHH K;  4IEE A;  3TR8 A;  3VEZ A;  3SUP A;  1YT3 A;  3D7E O;  3ITH A;  1HUX A;  3KK3 A;  2NRX A;  3RSE B;  1L3S A;  3CJ9 A;  1ATR A;  1RDU A;  1X3M A;  4IG3 A;  1TL3 A;  1TK0 A;  3ATU A;  2UU9 K;  4BE2 A;  2IGI A;  4EZ9 A;  2XRI A;  3D2E B;  2QTD A;  4KHW A;  4DLG A;  1FXX A;  3MN6 A;  2KKZ A;  4E89 A;  3A5M C;  2PY5 A;  1RT3 A;  3LZJ A;  1OKJ A;  5AQY A;  1NKE A;  2P1J A;  4BRE A;  1ATN A;  1WSI A;  3MDQ A;  2NRH A;  4DR7 K;  3M1F A;  2ASP A;  3NVM A;  3ZT0 A;  1YI2 N;  4KO0 A;  2Q2R A;  3FZH A;  3HP6 A;  1RT7 A;  3NDK A;  1Q82 O;  1IV0 A;  4C8M A;  3CCL N;  4M3T A;  1RFQ A;  5BR9 A;  3AAP A;  1D8Y A;  4C8L A;  1CZA N;  3WNG A;  3WXJ A;  4CJ4 A;  3IUC A;  2O8D B;  3BY5 A;  4O4G A;  2B4J A;  2HF3 A;  3VES A;  4DV5 K;  3I55 N;  1T44 A;  3WEE B;  2KZM A;  4CK2 A;  3VQ8 A;  1D9F A;  3SUQ A;  5IT9 O;  3OYH A;  3TWH A;  2HVI A;  2HNY A;  3O4Q A;  5BPN A;  3VQ7 A;  1T05 A;  2VG5 A;  2RE2 A;  4CF8 A;  3OYM A;  1JXE A;  4DS5 A;  4B3S K;  1NJZ A;  4FWS A;  2HST A;  3LP2 A;  1X9W A;  4BWJ A;  1GLL O;  4NXN K;  4YY3 K;  1ASU A;  5KI6 A;  5C0Y A;  2CGK A;  4DG1 A;  3T3F A;  4FZX C;  3AA3 A;  5HRO A;  4KHN A;  2HBL A;  1Y64 A;  2B6A A;  4H4O A;  1ZBH A;  3SAF A;  4CZE A;  2I5J A;  1SAZ A;  3WXK A;  3V1Q A;  1JLC A;  1NK9 A;  4FJH A;  1RDD A;  3R3L A;  2ZWH A;  4DTM A;  5LY3 A;  3HST B;  3O3F A;  1IJJ A;  1MU2 A;  2E1Z A;  2YNH A;  2AA4 A;  2YJF A;  3A8Y A;  3U4L A;  3G4S N;  3MEE A;  4DV4 K;  4Y1C A;  3OYG A;  3CC4 N;  3VEW A;  1XNQ K;  3N4Q A;  4B9V A;  4KH5 A;  4MDB A;  4RCH A;  1QQC A;  4ISF A;  3PO5 A;  2IAJ A;  4B9S A;  3O8M A;  5B8H A;  1RDB A;  3VER A;  1NK5 A;  3G6E N;  1N6Q A;  3ZYY X;  1R59 O;  3RMD A;  3S3O A;  1UOC A;  4H5T A;  4M41 A;  2O8F B;  4PKI A;  3EO3 A;  4X62 K;  2O8D A;  4LF4 K;  5D3G A;  4WCE L;  1N34 K;  4CJF A;  3MCP A;  1EQY A;  4ZHR A;  2GUP A;  3OS0 A;  4Z4F A;  3E66 A;  4IEI A;  4ILG B;  2QM1 A;  2YKN A;  3OTO K;  1VQO N;  2PFU A;  3HBT A;  3QFU A;  5TKW A;  1VQN N;  2OZM A;  3ZX0 A;  3O6W A;  1VQ9 N;  1QZ6 A;  1BA1 A;  3QFP A;  5CR4 A;  1XMQ K;  4QOZ B;  4C23 A;  3A0I X;  3VQA A;  1NJX A;  3CJ1 A;  4DFM A;  2KFZ A;  5AQR A;  4FJ9 A;  1NK4 A;  3SBT A;  3UE5 A;  3AVG A;  3AA2 A;  2IOC A;  1ILY A;  1S9E A;  4M3Y A;  1QHA A;  1T3V A;  3UKR A;  4E1N A;  3B8A X;  4B1U B;  2P9U A;  1YXQ A;  1QZ5 A;  2GV9 A;  3QET A;  5AZI A;  1TV6 A;  4CBU A;  3CCJ N;  1HPZ A;  4CZK A;  3JS6 A;  1KQS M;  3CI5 A;  4BRC A;  4DFP A;  3VTH A;  4CZL A;  3TI0 A;  5FLX O;  3AAQ A;  1NGB A;  4A61 A;  1NK8 A;  5K14 A;  5KPT A;  5AFU A;  1RBU A;  2QKK A;  3QML A;  3F9K A;  5GIN A;  3D2F A;  1NGA A;  1DTQ A;  2WC9 A;  4OKE A;  4JRQ A;  3DRS A;  3EKU A;  4N76 A;  1WOQ A;  4CF9 A;  4X66 K;  5BPL A;  2YKM A;  2A40 A;  1XHZ A;  2YHW A;  4BR2 A;  1U4B A;  3DWL A;  4DF8 A;  4RTF D;  3EY1 A;  4DSJ A;  2QXF A;  4I2P A;  1XUP O; 
#chains in the Genus database with same CATH homology
 5AJ3 K;  4DR6 K;  1XNQ K;  4B3M K;  4JI1 K;  4B3R K;  2UU9 K;  2UXB K;  4LF5 K;  2VQF K;  4JI4 K;  1I94 K;  4DUY K;  4JYA K;  2ZM6 K;  4DV6 K;  2UXC K;  4DR3 K;  4X62 K;  4V19 S;  4LF4 K;  4DR7 K;  4LFA K;  4JI0 K;  1N34 K;  1IBL K;  5A2Q O;  1IBK K;  3T1Y K;  4K0K K;  4YHH K;  4CW7 B;  1IBM K;  3OTO K;  5BR8 K;  3J80 O;  4DV3 K;  4AQY K;  1XMQ K;  4OX9 K;  4LFB K;  4DV5 K;  5LMU K;  4DR4 K;  2UXD K;  4DV1 K;  2VQE K;  5IT9 O;  4DUZ K;  4X64 K;  1N36 K;  4JI2 K;  4LF9 K;  1N32 K;  5LL6 Z;  1XNR K;  3T1H K;  4B3S K;  4JI6 K;  4LF6 K;  2UUB K;  2UUA K;  4NXN K;  4YY3 K;  4DV2 K;  1N33 K;  4CVN E;  1HNX K;  4DV0 K;  4LFC K;  4LF8 K;  2F4V K;  1HNZ K;  4DR5 K;  4JI7 K;  4DR2 K;  4DV7 K;  4GKJ K;  1J5E K;  5FLX O;  2E5L K;  4X65 K;  4KHP K;  5IWA K;  4B3T K;  4JV5 K;  4DR1 K;  2UUC K;  4NXM K;  3JAM O;  3J7A P;  1HR0 K;  5LMN K;  4JI3 K;  2HHH K;  4JI5 K;  1FJG K;  4X66 K;  4GKK K;  1HNW K;  4DV4 K;  1XMO K;  3J7Y P;  4LF7 K;  4JI8 K;  3J81 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...