2E5LK

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2e5lK00
1HNXK 4YY3K 1IBLK 4JI4K 4LF8K 1XNQK 4CW7B 1HNZK 3J81O 4DR4K 4JI1K 4LF5K 4DV6K 4JI3K 2UXBK 1I94K 4LF4K 4YHHK 4DR7K 5A2QO 4GKJK 3J80O 5IT9O 4JI0K 3J7AP 4JI2K 4KHPK 2UUCK 2UXCK 4JV5K 4DV5K 4AQYK 1IBMK 3OTOK 3JAMO 5LMUK 4B3SK 4DV7K 4DUYK 2HHHK 4X62K 4X65K 4DV4K 4DR5K 4LF7K 4K0KK 4DV2K 4DUZK 4LFCK 4DV3K 5FLXO 4NXNK 1XNRK 5LL6Z 1HNWK 2UUBK 4OX9K 4DR6K 4CVNE 3J7YP 1N36K 3T1YK 4JI5K 4DV1K 5IWAK 3T1HK 4B3MK 2UXDK 1N33K 4JI6K 1N34K 4LF9K 4NXMK 4DR1K 4LFAK 4X64K 4DR3K 4B3TK 2UU9K 4JI7K 2E5LK 1FJGK 1J5EK 1N32K 4JI8K 4JYAK 4GKKK 5BR8K 1XMQK 5AJ3K 2F4VK 2ZM6K 4LFBK 2UUAK 4DR2K 1IBKK 2VQFK 1HR0K 4DV0K 4X66K 4LF6K 1XMOK 4B3RK 4V19S 5LMNK 2VQEK
chains in the Genus database with same CATH superfamily
2OPQA 4CIGA 4DTRA 5FPNA 1BA1A 1T44A 3DLGA 3DXKB 4MFBA 5DK5A 5CE3A 2OANA 3SNNA 1BCOA 2Q0UA 4BG9A 3RRGA 2CH5A 4JAXA 3NAEA 3DYAA 5C24A 2WOMA 1FKPA 3LZJA 1VSEA 3K5MA 3SQ1A 1RT3A 1NBWA 3DJCA 4KFBA 4RTFD 2F7TA 4BRNA 1A5XA 1UA1A 5CYQA 3TPQA 4IO8A 1HRHA 3OYCA 1QVFM 4XIUA 1YUWA 5BRDA 4CEOA 3HM8A 4FWSA 5FDLA 5HL7L 3VQCA 4A2BA 2X6NA 5HRNA 4FZXC 1DLOA 3ZT2A 1VHXA 2A1SA 3DLHA 4FSVA 1XI1A 3SAFA 3OJUA 3SPYA 3AVNA 3K58A 4A59A 4CGGA 2E4LA 3IG1A 3MX2A 3QFPA 2ASPA 3ASMA 3C7NB 4WE1A 3ID6A 1JCEA 2G8UA 3T1HK 1Q9YA 3QIPA 1WSHA 4ID5A 3EKUA 2XO7A 4B1WB 3O80A 3C0BA 2OZSA 1T3VA 2HB5A 3I33A 3SUOA 4BWJA 4TSXA 4CGDA 4DFJA 3R3LA 3OY9A 2FXUA 4EHTA 3SAGA 1GLAG 5I3UA 1NGIA 1Z26A 3GDQA 4YOYA 4DTUA 3V9XA 5AQUA 1P90A 4DTOA 1QZ5A 4BRAA 1FK9A 2OPRA 3O3GA 3SLCA 1UOCA 2VWKA 3L0QA 4LF6K 3PX6A 3DRRA 1VSDA 3LPTA 4CEAA 4MO4A 5AQOA 4CI6A 2I7NA 3V9ZA 3D7EO 4OJRA 4C8NA 2QEXN 3H08A 4AM6A 3CJ1A 2VWBA 4CF9A 5HRPA 4DV6K 2HBJA 3TARA 2P5GA 2H3GX 1TK8A 1HQEA 2QXLA 4HTLA 1RDDA 3U9ZA 2HNYA 3PSIA 3OYNA 3C6UA 3ULEA 3UB5A 3P31A 2ITMA 2RPIA 4I9QA 2VYPA 1VRTA 4CEDA 4JI0K 4CBUA 1KLMA 3F9KA 4KRFA 5C12A 4DV5K 4W5OA 4FM1A 3M3ZA 4KHQA 4XH4A 4CZHA 3MXMA 3QDKA 1JCGA 3QMLA 3AVGA 3O6WA 4KI4A 2J4RA 2Q3SA 3P38A 3CJ9A 4BE1A 5CYMA 3CMEN 3ZT3A 1RTDA 1RT1A 1VQLN 3UE5A 3VEOA 1MU2A 2HW3A 2P9UA 4PHTX 3SQ2A 4H5RA 1DTQA 3DXMB 4IDKA 4DR6K 1BDGA 3K5OA 3TAGA 5GAHP 3TTFA 1HKCA 1U04A 4JI5K 3OYHA 2NNWA 1O1WA 4OPHA 4FJ8A 4I6MB 4FLXA 3K57A 4JKBA 4Z4EA 2BGGA 3CCJN 4CK1A 4FJXA 3TAPA 5SWMA 3R1XA 3CQXA 5BRFA 2ZGYA 5EOYA 3D2FA 1S9GA 1KLNA 1BUPA 1IH7A 1ZBFA 4MLEA 4Y1DA 1N32K 5BPNA 1NGDA 3VF6A 4JYAK 1QSSA 5EY4A 5DM7L 1SL2A 1WSEA 4DSIA 1SQKA 3HSTB 4LFBK 1ZBIA 2G8VA 2W41A 2E6LA 4CFBA 4K42A 4CFCA 1RILA 2Q31A 1GOBA 2FF6A 3O4WA 1DGKN 3CFRA 4I2QA 4HUEA 4DTPA 3WQTA 3VTHA 4CHPA 1W97L 3O9TA 4KHUA 3NHGA 3WXMB 2Q0RA 1NGHA 4CJ7A 1S22A 1TUYA 2WBNA 3KD1E 3U3GA 4YHHK 5AFUH 4FLVA 4CHYA 3VTIA 3OYFA 4BY9C 3WQUA 3J7AP 2KTQA 5AQPA 1WN7A 5KPTA 1JLFA 2ASMA 3GBTA 3BY5A 3ZEUB 3PO5A 4ISEA 1CXUA 3CJCA 1NGFA 1XQSC 1U49A 3LL3A 3U8XA 2O8BB 2O4GA 5DM6L 4KHWA 1S1UA 3MMVA 1T6DA 1XHZA 4DFMA 4N41A 4M3RA 3IKMA 4WYBA 3DLEA 4CZIA 1NGCA 2OTJN 3TWHA 1VSLA 3G0ZA 5KI6A 4JHDA 4NYNA 1EP4A 2GWKA 4BR5A 3SCXA 1N36K 1Q86O 5AQFA 1ZBUA 4KREA 3HT3A 2HF3A 5KGWA 4A5AA 1A5WA 4K43A 3Q7BA 3KK2A 3TAFA 3CQ8A 4FLTA 3RMDA 1C0UA 3C94A 5C15A 5EVZA 4JI8K 1R0AA 3HBTA 4DFKA 2VWJA 2F4VK 5M1OA 4K8ZA 4ID1A 1L3SA 3ID8A 4DR2K 1YAGA 3QERA 4BR4A 4N76A 1RCHA 3NH1A 5M1KA 1B9DA 2O8EB 3NH0A 1NOYA 2JWKA 1NG9A 5BREA 2EWSA 5ADXA 4RCHA 4IZ9A 4BE0A 2W42A 1Y97A 3AAPA 4B1VA 4A2AA 4CESA 3VEZA 1NK8A 2E1YA 4BC4A 4LSNA 3FZLA 3OYDA 4LSLA 4GMJB 2P9UB 4MQ3A 1S3XA 3S3NA 5C42A 3KK1A 4FO0A 2PYJA 1WUAA 1SKSA 3OBWA 5IT9O 4M42A 1L3UA 1RT2A 3ZT4A 4PQUA 5BN9A 1VQ4N 1KVCA 4WQ5A 4K25A 3O5BA 2O4IA 1IO2A 4M3XA 3QEIA 1UWBA 3FZKA 3KLFA 4CFAA 1C1BA 2VG7A 1RGIA 2GBZA 3CCUN 3PLAA 3B6OA 3ALYA 4R5PA 3VQ7A 1IKWA 3IMXA 4B1YB 5K14A 4FZYA 3KIOA 4FWPA 1LAWA 2QWRA 4DF8A 4DV1K 3SZ2A 2Q1NA 1DEJA 3H1QA 4Q5VA 2HVIA 3LDSA 3R9PA 4IEEA 4XH5A 2A42A 1M90O 4IKFA 1NJXA 4JI6K 1K6YA 2QW9A 3VEXA 3SUPA 5C0YA 1CZ9A 1HX1A 1ZYQA 4QS7A 4OVLA 2OPPA 5AQNA 2A5XA 4KKOA 2WTUA 3RMAA 4Z4GA 4FWLA 1OH5A 2VG6A 3OYIA 2RF2A 4BRIA 4DQSA 1YJWN 1HUXA 2YNFA 5J2NA 4B9SA 3E01A 3V1OA 1VSHA 3SMPA 4B3RK 4H4MA 4V19S 2Z1GA 1K8AO 3F9MA 3O8MA 3SJHA 3C65A 4OKKA 1ATNA 4CJWA 2F8TA 1BWFO 4YY3K 3HOTA 5CHIA 1RTIA 4AF1A 1EX4A 1HPMA 3VEWA 1D9DA 4B1UB 3BEXA 4LF5K 1LAVA 2D0PA 1VSMA 1HYVA 1WAFA 4W5TA 4CECA 3O9QA 1LWEA 1UA0A 4ILHA 4BRFA 1QE1A 2QXFA 5E41A 4IJNA 3QEVA 1NKCA 1C0GA 3UKUA 3MK6A 4HWIA 1T8EA 5SZTA 4M7YA 2HHVA 1IBMK 4NCAA 1NGEA 3ZSOA 5HRRA 5BPMA 3K9JA 3FR0A 3HZ6A 1KRPA 4KB0A 3BGRA 3VESA 4E89A 4IOAL 2G8HA 4FK4A 4CD1A 1YHQN 1EO1A 1SZ2A 5GIOA 3LP3A 3LANA 4CCHA 2HHSA 1E3MA 5FLXO 5LL6Z 4BDPA 2HHTA 5EXWA 2O8FA 3D6RA 1ASVA 3LDLA 3T19A 3P1GA 4QS8A 5HROA 1U45A 3QEWA 1NK9A 5AQIA 4BDYA 2ZGZA 4LF9K 4Y1CA 4HCCA 5C2DA 5C25A 3UIQA 1TAQA 3I55N 1U47A 2BANA 3QFUA 3CPWM 1VQ7N 3VA3A 4FWKA 2W40A 1Z05A 2O8CB 4M3TA 2F8SA 1KAXA 4CZGA 3L2VA 4DQ8A 4M3WA 2WUSA 2KKZA 1X9WA 2VGNA 4O8KA 1LW2A 2A3ZA 5BN8A 4FM2A 4FJIA 1OVQA 3OS2A 5AQZA 4MO5A 3ZT0A 1BQNA 1LWFA 2EX3A 4PUOA 4B9NA 4BR2A 4FLUA 2X6SA 4H4OA 2Q2RA 1N6QA 3SYZA 1VQPN 3ENBA 1X3MA 2HNZA 4FJHA 3MDQA 3PIOL 3ZSWA 2NRXA 4I7FA 3P39A 5B8HA 1WSIA 3H1VX 3MX5A 4L3QA 2VG5A 2NRTA 3E1YA 4LF4K 4IXCA 3LALA 2NRVA 1ATSA 3VQ9A 4E7LA 1FW6A 4FWRA 1S9EA 1BG3A 3H3NO 2YJEA 5GADP 1Q81O 4DB3A 3LWLA 3OS1A 3WEEB 1R59O 4CK3A 4KHPK 2LSNA 1M1KO 1S1WA 3IFRA 4AHRA 5AZIB 4QOZB 1CLQA 3QNNA 4B3SK 5FPDA 1DT9A 4DSEA 3L4QA 4X65K 3H3OB 1SKRA 2HBMA 3EL2A 1Q8IA 3H46O 5AQXA 3M8SA 4B9MA 4DLEA 2E6MA 3VETA 3VF4A 4A57A 4GVEA 1HKBA 1RBSA 1OH8A 4JS4A 1BIZA 2WFBA 3ZT1A 1YT3A 2FSJA 2OCEA 4IWVA 1TVRA 3OS0A 3TABA 1WBBA 5HP1A 2YHXA 3PY8A 5FROA 3SQ4A 3FLCO 4LH5A 5IWAK 1D9FA 2W6LA 2WC9A 3THVA 3D2EA 1YI2N 1NKBA 2P9LA 3LAMA 4FWMA 1BI4A 4H03B 2XY7A 4CEQA 3RSEA 1Q9XA 1W9HA 1Y64A 3O4NA 3BZKA 3U6FA 5FPMA 3MWPA 5KRTA 3ZLJA 4CZEA 2P5OA 3O1WA 3O9RA 3G10A 2PFUA 3KZBA 3L2WA 1S1TA 4ZHRA 3EZ5A 1TGOA 3HSCA 1NMDA 3EKSA 3UKUB 2UUAK 4PKIA 3S3MA 1OH6A 2Z1JA 3VQDA 4EFHA 2FBVA 4MDAA 3ENHA 3CXCM 1ZXOA 1W0HA 1T05A 3THXA 3HVTA 4IFVA 2IVPA 4H0OA 1LOTB 1KFDA 2X78A 4IDHA 3CETA 2ZD1A 3AA3A 4M45A 4CGIA 1IBLK 2GEMA 1UAXA 4ICLA 3M5RA 1HMVA 3HP6A 3NF6A 2GTDA 4CJSA 4CIFA 1IJJA 3AA4A 4OPKA 2QTDA 3AV9A 5AQRA 2B4JA 3TSPA 4AHCA 4FJKA 3QICA 2GX9A 3PIPL 4H0YB 2O8FB 4CGJA 1K8KB 1KD1O 4B9LA 4KI6A 4JKGA 3VQ5A 5AQYA 1BU6O 3HP9A 5KQDA 4FL9A 3D0PA 1J5OA 3OYKA 5CZ1A 1RT7A 4J2EA 3WNFA 4CF0A 1GOCA 3SBTA 2HHQA 1X3NA 4DUYK 1MDUB 1WOQA 3QLHA 2KFZA 3H45C 5JLHA 4DLGA 1BCMA 3VQ8A 4DV4K 1HNVA 4K0KK 2IGIA 3I0SA 3MN5A 4LFCK 1QSLA 2IIRA 2QWPA 3CCLN 2ZJPL 1XNRK 4H5WA 4Z4IA 3KTQA 3N4PA 2P9IA 3N4QA 3A5MC 4FWOA 1C1CA 4DMNA 4ILGB 3CERA 3CCSN 1J54A 1GLFO 2O8DA 5M1NA 1C0MA 3THYA 4FJ5A 2PAVA 1Q82O 4M7XA 1TV6A 1N8RO 1QHAA 1ATRA 4RG8A 3JS6A 3I0RA 2QKKA 4M3YA 3CC4N 1RBRA 4WQ5C 3L3UA 3NH2A 4WFAL 4BG8A 3C6TA 2ITGA 3P5JA 4MLHA 4RW6A 2GELA 1TKTA 2FSKA 1D8YA 3M8QA 5BR8K 2QWNA 4O5BA 4AHVA 2BH1A 1QQOA 3EY1A 3VGLA 3AO4A 4DQIA 3G4SN 4E1NA 3G71N 4DF4A 3FZMA 3A0IX 2DFHA 3ZX2A 1BL3A 3NE6A 3MWTA 3SAHA 4O44A 2DPNA 5D3GA 2ETJA 4O0IA 4A5BA 2XY5A 2F9TA 2QK9A 2B5JA 3VOVA 5EX5A 4KHNA 4PKHA 5MLCQ 4I9LA 4DR4K 3LM9A 3ZSRA 2YHWA 2YX6A 4LH4A 1OVYA 3C6HA 2GWJA 5E26A 4DQQA 4WQ4C 4AHUA 1XC9A 1T03A 3ZSXA 4RW4A 4F8RA 5AZJA 3FE1A 4GKJK 3JSMA 1QTMA 4JI2K 1D4XA 3MXJA 4IG3A 1VSKA 4KTWA 3VQPA 3MN6A 3HOSA 3NDKA 3EEQA 4AQYK 2OTLN 4OO1J 4G9ZA 3IDHA 3F5TA 5ADXH 4OPJA 1G15A 4Z4CA 4E7JA 1HYSA 4X62K 3SK3A 1LW0A 4DSFA 1SUQA 1EWRA 1EKEA 3GE1A 2YHBA 2PY5A 1WAJA 1T6CA 4CEEA 3ZSZA 1U2VA 3ZETA 4BRGA 3QNOA 4NLBA 3KD5E 3LDPA 4E7IA 1ASUA 4FLYA 4CVNE 3SQ0A 3DM2A 2CGLA 3J7YP 3THXB 1QS4A 4CHZA 4JRPA 2E8AA 3VEYA 4CZKA 3DOKA 4PL8A 4OGEA 4JKCA 1RFQA 4U7BA 1CXQA 3AO5A 3P83D 1A5VA 2Q36A 1YJ9N 1DTTA 4GVMA 4LD0A 4NCBA 4AHTA 2D4WA 2E2NA 4F3OA 1LV5A 2HBKA 2E88A 1VQMN 3LZIA 2DFEA 5KTQA 1FJGK 1U6ZA 1YXQA 3CJ7A 2ASOA 1RBTA 3SV4A 1JXBA 2IC3A 4BROA 5AJ3K 1S6QA 2G8FA 4AILC 3AA5X 4JKGB 4KV8A 3OYBA 1YITN 4I2PA 1OH7A 2R7YA 3EO3A 4FCYA 3E9LA 4N56A 1JJ2M 1RT5A 3SPZA 4DU1A 2E2OA 1C1AA 3NF8A 3WNEA 3ITHA 2XRIA 1LWCA 5LY3A 4E3SA 5J2QA 3WNHA 1S1XA 1CZAN 1XNQK 1QHTA 4KTQA 1RDCA 2FSNA 3ULEB 2AA4A 2ZJRL 4FM0A 1NGGA 4DQPA 4DSKA 3CC2N 5I9EB 1NOZA 5KPZA 4BR9A 1JL2A 4ISGA 3KJVA 4GY2B 4GNIA 1KQSM 3IS9A 5HOOA 4F2SA 2IDOA 3MCPA 2PZSA 3VERA 1IKXA 3KKSA 3OTOK 2QWQA 3CG7A 5JS2A 4DTNA 2CGJA 4EHUA 2F9WA 4ISFA 3Q7CA 3H6EA 4LF7K 3PSFA 2G8WA 4A62A 3VGMA 5AQHA 1JCFA 4FJLA 1WSGA 4FPAA 2FF3B 2IAJA 3VQ6A 3JYTA 4FJ7A 3VPZA 4DG1A 4DS4A 4DKWA 1KC8O 3DWLA 2HMIA 3CFPA 4FJGA 2BUPA 4BDZA 3DI6A 4JD2A 3HPGA 3PV8A 4AM7A 2V7ZA 4CF1A 5GIPA 2V51B 3VQAA 3D2FB 2V7YA 5J2MA 4CJ3A 2HSTA 1ZBSA 4H5VA 1DKGD 1RNHA 4B9QA 4LFAK 4H8KA 3CCRN 3B6PA 4DR3K 3CIPA 2UU9K 5TKWA 3K59A 1HYZA 3T69A 1J5EK 3A2FA 3I8DA 5KQ8A 4J2DA 5AZJB 2A6AA 1MA9B 3UKRA 3IRXA 3ZYYX 4J2AA 1KCFA 4MDBA 1YJNN 1IBKK 1NWKA 4X66K 2OZMA 4J2BA 3IUCA 5CR4A 1HJOA 5I42A 2YCHA 3NFAA 5LJVA 1YVNA 3OVNA 1NKEA 2FBTA 2P9NA 1NGAA 1VQON 3O08A 2AJQA 4W5RA 1SV5A 3LP0A 4YFUA 2UXBK 2JGUA 2AP1A 3AVLA 1NK4A 3VEVA 2YI1A 4CZJA 3SI6A 4JK7A 5AQGA 3DXKA 2OA8A 2IS3A 1NK0A 3W3DA 1JKHA 4EP5A 1I39A 1B9FA 1WB9A 4FOIA 5F0XA 3HI0A 1EQYA 4CJVA 2EHGA 5CZ2A 5EU7A 3CC7N 1JLCA 2KZMA 3CJBA 4JV5K 1T7PA 4FLZA 1B92A 5KRSA 3V4IA 4OGCA 3TAMA 3S9HA 5HLFA 3WXIA 1WSFA 4IO9L 4JKAA 1HKGA 3PX0A 3QBXA 4JHDB 4JLHA 3BZCA 3ZCMA 3L3VA 2Q97A 4FJJA 4CJ5A 4DTXA 4DFPA 3A5NC 1RTJA 4DHYA 3BF3A 3QEXA 1IKYA 4O4GA 3A5OC 4CZMA 4EZ6A 4C8OA 4FLWA 3NMUA 3HM9A 2YNHA 3FZHA 1E4FT 4WF9L 4GV6A 3S41A 1TAUA 3C7NA 4OKEA 4CHOA 2JWLA 5AQLA 5GAGP 2P9KA 1SAZA 4BVOA 3QIOA 3QETA 3NF7A 4CHQA 4W5NA 4FWQA 2ZM6K 4BACA 3K0SA 3O3HA 3IAYA 2HF4A 1VQ9N 3QBWA 1BHLA 1EXQA 1GLCG 2I7PA 1I3AA 4OPAA 2QWMA 3EE9A 4WFBL 4M3ZA 4C1NK 2OYQA 2BE2A 3HYFA 3J8AA 3TU5A 3QESA 3RRHA 3J81O 3SUNA 3WXJA 2E20A 3CCQN 4H0VB 1VSFA 4EIAA 3GOIA 5KGXA 2IOCA 4B8AB 4K41A 4JD2B 1HPZA 2CGKA 1JLGA 3CM5A 2W6KA 2G8IA 1FKOA 3NGIA 2ZF5O 1BA0A 2FBYA 3GL1A 2QI2A 4LY7A 5GINA 1Z6RA 3LDOA 1TL1A 3FFIA 5AQMA 3VN5A 2HHHK 1SL1A 4CZLA 2UYTA 4DR5K 3EN9A 4BRCA 3KK3A 5HRSA 3K2PA 3UKRB 3LAKA 1QQMA 5JS1A 3K5LA 2QWOA 4RW8A 5LJWA 4QAGA 3VF2A 3M8PA 3O1BA 4IJAA 4NCGA 1NNEA 4C8LA 4CEBA 3HK2A 1SKWA 4CEFA 4BC3A 4KH6A 2NZTA 2XY6A 4KAZA 4E7HA 4Z0UA 2DY4A 1N34K 1JXEA 3KLHA 2QKBA 3K9KA 4H0PA 1TK0A 3MN7A 4RWTA 4KTZA 4X64K 3BDPA 1X9SA 1CZBA 4I6MA 4JKDA 4FZZA 4JI7K 2E5LK 2YNGA 3TSQA 4Z94A 1EETA 2A40A 4NLCA 3RVCA 4OLAA 4CERA 1W7AA 2KHOA 3MN9A 1JLAA 4Z4FA 4HVJA 3OBYA 3O3FA 3V9SA 3ISNC 1NGBA 4ELTA 2YHAA 3I8BA 4B3OA 2KFNA 3RWUA 1NK5A 2D5RA 2Y1IA 2HNDA 3J7ZO 1FXXA 3AVFA 1GOAA 4YDUA 4PKGA 3OA9A 4J8FA 3L2UA 1ASWA 1MWMA 4PY5A 3GG4A 3L4IA 3KWGA 3F2KA 1HNZK 3KWIA 4CE9A 3RR8A 2QM1A 3NVKA 3CJAA 4HCBA 2YNIA 4NB4A 3OW2M 2NRRA 3O4QA 3VQBA 5J2PA 4BRPA 3AA2A 3AVBA 2YJFA 1KFSA 3DLLL 3RR7A 2FBXA 1KAYA 4DU3A 3CI5A 4NYFA 1NK7A 4JKFA 4CJQA 1ZBHA 4NO7A 4IFEA 5AQTA 2HHXA 2P9PA 1NJZA 1EWQA 3AO2A 3BF1A 3DMJA 3DRPA 4CK2A 2RN2A 3HO1A 3PX4A 3ZEUA 4KHYA 3WUHA 3WNGA 1VQ5N 3V81A 3L6QA 4M41A 5AR0A 4WFNL 2P9KB 4B8CA 4F9OA 4H5TA 4DV2K 2HHWA 3BUZB 5TKYA 4DUZK 3VMFB 2O8BA 4C8MA 3KVGA 4YOTA 3OYMA 4NXNK 4M63C 5JLFA 2B6AA 1SS6A 4BRLA 4JKEA 4OX9K 4BREA 4EP4A 3MXIA 2D1KA 4XEIA 3CM6A 3HPHA 1S1VA 3WXLA 4E7KA 3M8RA 3LWMA 3P4IA 5BPLA 2HHUA 3C6AA 2D0OA 2P1JA 4DR1K 3KLIA 3KLEA 3V9UA 3PUFA 4BR7A 1X1PA 3QB0A 2IVOA 4BRKA 4PL7A 3KKRA 1IV0A 2YKNA 3TSUA 1S72N 4KH4A 4HUFA 3E9OA 3OJSA 1VQ8N 1XHXA 3MECA 2FC0A 1NU0A 1GLDG 1BQMA 4LC9B 4CGFA 3T7ZA 2HBLA 1RDWX 5LMNK 4B9VA 4FJ9A 2GV9A 1G99A 3FGUA 4JRQA 2G8KA 2DTUA 1RTHA 2O8EA 2RHKA 4IG0A 3CYMA 1RT6A 3ZSYA 4JI1K 4H0XB 5JMVA 4JI3K 3NF9A 3TI0A 1XUPO 1I94K 1VQKN 2E2QA 3HPOA 2ZWHA 1F21A 3TTCA 2DFFA 3KK7A 2D0CA 2ZJQL 3OYJA 4H5NA 2NRWA 3J80O 1HLUA 1GLBG 3AVHA 4E0DA 4YOUA 1VRUA 1P8ZA 1YVUA 3MAQA 4JN4A 3RMCA 3TAEA 3AARA 2KZZA 1NK6A 1Z25A 5JICA 4FW2A 2VGMA 3JAMO 3ATUA 4DV7K 5FRMA 3SV3A 1GLEG 4R79A 1IG8A 5M1FA 1JLQA 3NCIA 3WT0A 1WLJA 4DU4A 3E66A 3R6MA 3SJJA 2YHYA 3F73A 1VSJA 4CZFA 3HVRA 3I56N 3D2EB 2D0AA 2P9LB 1BI4B 5BR9A 3RSEB 4O5FA 2UXDK 2NRZA 3LDNA 1BOTO 4CJLA 4CJUA 4CJ4A 1C0TA 4FPBA 3QEPA 4NXMK 4KPYA 1VAZA 3TR8A 2V52B 4WCEL 5ELZA 4B3TK 1JL1A 2XHBA 3SBGA 1XC3A 3VA0A 3AVIA 5J1EA 1YTUA 1TUUA 3HRGA 5M1QA 1YIJN 1XMQK 1TK5A 1BO5O 3V9WA 2KW4A 3LM2A 3LP1A 3O9UA 4N5SA 4CIEA 1YTAA 2P9PB 1HR0K 5AQJA 3AVKA 4KH5A 2WONA 3L2RA 5FRNA 2ZQBA 4IEIA 2GUIA 4B1XB 1RBUA 2VQEK 3D45A 4CJRA 4HHTA 3A8YA 4DTSA 4BVPA 3T3FA 4GW6A 3W0LA 4EZ9A 1TYQA 1QZ6A 3FFKB 3ATVA 3TANA 3CF5L 4F4KA 4DCHA 3ULDA 4BR0A 2PBDA 3MCAB 3U4LA 5C10A 5JVHL 1NJWA 4KHSA 3TAQA 1KVAA 4BRDA 1REVA 3CFOA 3MEGA 1K9MO 3M6GA 3NVMA 3NGZA 3CHWA 1L3TA 3L8BA 1RDBA 2E2PA 3CCVN 3V1QA 4E1MA 2HOEA 4FYDA 5HBMA 1HJRA 4ELUA 1U4BA 2P9IB 3OYAA 2VCPA 4B1ZA 3CCMN 4Y0WA 5GAEP 3NBPA 2O8DB 4FK0A 3PO4A 3ZX0A 3THYB 4FVMA 1HNWK 3MEDA 1KVBA 3AVJA 3T1YK 1QQCA 2IVNA 1RDUA 4W5QA 4CGHA 4KBOA 2E1ZA 4F2RA 3VGKA 1Q7YO 3ENOA 3L2QA 3KLGA 2P51A 2Y1JA 1V4SA 4PWDA 1QSYA 1NLVA 2YV0X 1KAZA 1ZC6A 1JLBA 1YF5L 4H0TB 4BRHA 4OLBA 3DLKA 4QS9A 5C2FA 4O0JA 2QWLA 1GLJO 1OKJA 3LDQA 4DTJA 4FJNA 1J53A 5AFUA 2Z1HA 2ZE2A 3CPEA 2VQFK 4DSJA 1IG9A 2O8CA 4DV0K 4B08A 3QINA 1VK0A 3U9DA 1XMOK 4PA1A 1K73O 3AVCA 1IKVA 5AQSA 4E19A 1TKDA 2RE2A 1HNXK 4JI4K 3MEEA 3AY9A 3ZX3A 2P9SA 5E84A 2RKIA 4YOXA 4AH9A 1JLEA 3U3YA 1XWLA 4BRQA 4FJMA 4CJFA 4FWNA 4BGAA 4UQGA 1LCUA 3SMSA 3DOLA 5AQKA 5A2QO 4Q0BA 1RDAA 4IFYA 1WBDA 4DS5A 5T7BA 1N5YA 4QCLA 3A5LC 3AVMA 4CD3A 4JNEA 2UUCK 1J9AA 4E1JA 2UXCK 3VENA 4IBNA 1TL3A 4CJTA 3OYEA 1GLLO 1L3VA 4CEZA 3WEEA 1U2VB 3ZETB 4B9UA 3O9SA 3THWA 4F3TA 5AZIA 3V1RA 4EAHD 1L5UA 4YDUC 4WQ4A 3QO9A 2NUBA 5FPEA 3AVAA 4FK2A 4IOXA 4YOWA 4CJKA 3R8EA 1KXPA 4ELVA 4JK8A 3RMBA 3EE8A 3S3OA 5AQVA 1C0FA 2ATQA 1S6PA 3AGRA 4JEPA 5BRHA 4B9TA 4KB1A 3EYZA 4CF2A 1ESVA 3ZSQA 1ZBLA 1NJIO 4B3MK 4OKJA 4C1NI 1N33K 3OYLA 1NMNA 3HJFA 4JS5A 1TYQB 3FZFA 1U48A 5F1XA 3DLBA 1TKXA 4FOEA 4XH1A 3OYGA 3DRSA 3AGKA 4CFDA 5H1SQ 2BTFA 2OPSA 4GKKK 2JLEA 5AQQA 4CBXA 2X74A 2A41A 4L8RB 4CJEA 3RTVA 1S5JA 4FVUA 2XY8A 1HNIA 2Z1IA 3M1FA 4BWMA 3VQ4A 4GV9A 3DAWA 3CMAN 1ITGA 2NLXA 4GV3A 1C6VA 5KPRA 3CQYA 1KTQA 4CF8A 4LF8K 2CH6A 3E9PA 4BQLA 1Q18A 4K8XA 4CW7B 4JK9A 3ZSVA 1VSIA 3LP2A 4UY8O 3CD6N 3VQEA 3HL8A 4FW1A 2A1RA 2FLOA 3TTDA 3JXUA 4DR7K 2PYLA 2HVHA 3T1AA 1BGXT 1BISA 1WNSA 4A61A 4CJPA 1HQUA 1WSJA 1J6ZA 4U67L 1K8KA 1RBVA 4YNQA 1ILYA 5LMUK 2KQ2A 4RW7A 4N47A 1E4GT 3B8AX 4ILJA 4HUGA 3G25A 1V4TA 2I5JA 4DTMA 3VQQA 4ZTFA 3EZWA 1VQ6N 3CCEN 1SL0A 1TKZA 5F2RA 3HTVA 4DV3K 1O13A 4DWIA 2GUPA 4AHSA 1QQNA 4JKHA 2UUBK 1VQNN 5DMRA 4BGBA 4YOVA 4HTUA 1BIUA 3DLRA 4RW9A 3HXMA 1RT4A 1NGJA 1NM1A 3KHYA 5CY4A 4BQZA 1X9JA 2HMPA 4YORA 1QVGM 3WXKA 4ZTJA 4CHNA 2P9SB 4O8UA 1X9MA 1D5AA 4Z4HA 1W2BM 2KLAA 4C8KA 4BE2A 1H1VA 4BRMA 5JVGL 4C23A 4M3UA 2YKMA 3G6EN 4IOCL 4DQRA 3OHRA 4DSLA 4BC2A 2QA4N 2BDPA 3BP8A 3AO1A 3NGYA 3SUQA 4FXDA 3AAQA 4O55A 3K5NA 3C95A 1NJYA 2F96A 3DXMA 2NRHA 3V6DA 3AO3A 3LPUA 2P9NB 4KO0A 5AQWA 5M1PA 4CBWA 4G1QA 2D0BA 1KSPA 1MWKA 4BC5A 3THWB
chains in the Genus database with same CATH topology
1HNXK 4YY3K 1IBLK 4JI4K 4LF8K 1XNQK 4CW7B 1HNZK 3J81O 4DR4K 4JI1K 4LF5K 4DV6K 4JI3K 2UXBK 1I94K 4LF4K 4YHHK 4DR7K 5A2QO 4GKJK 3J80O 5IT9O 4JI0K 3J7AP 4JI2K 4KHPK 2UUCK 2UXCK 4JV5K 4DV5K 4AQYK 1IBMK 3OTOK 3JAMO 5LMUK 4B3SK 4DV7K 4DUYK 2HHHK 4X62K 4X65K 4DV4K 4DR5K 4LF7K 4K0KK 4DV2K 4DUZK 4LFCK 4DV3K 5FLXO 4NXNK 1XNRK 5LL6Z 1HNWK 2UUBK 4OX9K 4DR6K 4CVNE 3J7YP 1N36K 3T1YK 4JI5K 4DV1K 5IWAK 3T1HK 4B3MK 2UXDK 1N33K 4JI6K 1N34K 4LF9K 4NXMK 4DR1K 4LFAK 4X64K 4DR3K 4B3TK 2UU9K 4JI7K 2E5LK 1FJGK 1J5EK 1N32K 4JI8K 4JYAK 4GKKK 5BR8K 1XMQK 5AJ3K 2F4VK 2ZM6K 4LFBK 2UUAK 4DR2K 1IBKK 2VQFK 1HR0K 4DV0K 4X66K 4LF6K 1XMOK 4B3RK 4V19S 5LMNK 2VQEK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX K;  4YY3 K;  1IBL K;  4JI4 K;  4LF8 K;  1XNQ K;  4CW7 B;  1HNZ K;  3J81 O;  4DR4 K;  4JI1 K;  4LF5 K;  4DV6 K;  4JI3 K;  2UXB K;  1I94 K;  4LF4 K;  4YHH K;  4DR7 K;  5A2Q O;  4GKJ K;  3J80 O;  5IT9 O;  4JI0 K;  3J7A P;  4JI2 K;  4KHP K;  2UUC K;  2UXC K;  4JV5 K;  4DV5 K;  4AQY K;  1IBM K;  3OTO K;  3JAM O;  5LMU K;  4B3S K;  4DV7 K;  4DUY K;  2HHH K;  4X62 K;  4X65 K;  4DV4 K;  4DR5 K;  4LF7 K;  4K0K K;  4DV2 K;  4DUZ K;  4LFC K;  4DV3 K;  5FLX O;  4NXN K;  1XNR K;  5LL6 Z;  1HNW K;  2UUB K;  4OX9 K;  4DR6 K;  4CVN E;  3J7Y P;  1N36 K;  3T1Y K;  4JI5 K;  4DV1 K;  5IWA K;  3T1H K;  4B3M K;  2UXD K;  1N33 K;  4JI6 K;  1N34 K;  4LF9 K;  4NXM K;  4DR1 K;  4LFA K;  4X64 K;  4DR3 K;  4B3T K;  2UU9 K;  4JI7 K;  2E5L K;  1FJG K;  1J5E K;  1N32 K;  4JI8 K;  4JYA K;  4GKK K;  5BR8 K;  1XMQ K;  5AJ3 K;  2F4V K;  2ZM6 K;  4LFB K;  2UUA K;  4DR2 K;  1IBK K;  2VQF K;  1HR0 K;  4DV0 K;  4X66 K;  4LF6 K;  1XMO K;  4B3R K;  4V19 S;  5LMN K;  2VQE K; 
#chains in the Genus database with same CATH topology
 2OPQ A;  4CIG A;  4DTR A;  5FPN A;  1BA1 A;  1T44 A;  3DLG A;  3DXK B;  4MFB A;  5DK5 A;  5CE3 A;  2OAN A;  3SNN A;  1BCO A;  2Q0U A;  4BG9 A;  3RRG A;  2CH5 A;  4JAX A;  3NAE A;  3DYA A;  5C24 A;  2WOM A;  1FKP A;  3LZJ A;  1VSE A;  3K5M A;  3SQ1 A;  1RT3 A;  1NBW A;  3DJC A;  4KFB A;  4RTF D;  2F7T A;  4BRN A;  1A5X A;  1UA1 A;  5CYQ A;  3TPQ A;  4IO8 A;  1HRH A;  3OYC A;  1QVF M;  4XIU A;  1YUW A;  5BRD A;  4CEO A;  3HM8 A;  4FWS A;  5FDL A;  5HL7 L;  3VQC A;  4A2B A;  2X6N A;  5HRN A;  4FZX C;  1DLO A;  3ZT2 A;  1VHX A;  2A1S A;  3DLH A;  4FSV A;  1XI1 A;  3SAF A;  3OJU A;  3SPY A;  3AVN A;  3K58 A;  4A59 A;  4CGG A;  2E4L A;  3IG1 A;  3MX2 A;  3QFP A;  2ASP A;  3ASM A;  3C7N B;  4WE1 A;  3ID6 A;  1JCE A;  2G8U A;  3T1H K;  1Q9Y A;  3QIP A;  1WSH A;  4ID5 A;  3EKU A;  2XO7 A;  4B1W B;  3O80 A;  3C0B A;  2OZS A;  1T3V A;  2HB5 A;  3I33 A;  3SUO A;  4BWJ A;  4TSX A;  4CGD A;  4DFJ A;  3R3L A;  3OY9 A;  2FXU A;  4EHT A;  3SAG A;  1GLA G;  5I3U A;  1NGI A;  1Z26 A;  3GDQ A;  4YOY A;  4DTU A;  3V9X A;  5AQU A;  1P90 A;  4DTO A;  1QZ5 A;  4BRA A;  1FK9 A;  2OPR A;  3O3G A;  3SLC A;  1UOC A;  2VWK A;  3L0Q A;  4LF6 K;  3PX6 A;  3DRR A;  1VSD A;  3LPT A;  4CEA A;  4MO4 A;  5AQO A;  4CI6 A;  2I7N A;  3V9Z A;  3D7E O;  4OJR A;  4C8N A;  2QEX N;  3H08 A;  4AM6 A;  3CJ1 A;  2VWB A;  4CF9 A;  5HRP A;  4DV6 K;  2HBJ A;  3TAR A;  2P5G A;  2H3G X;  1TK8 A;  1HQE A;  2QXL A;  4HTL A;  1RDD A;  3U9Z A;  2HNY A;  3PSI A;  3OYN A;  3C6U A;  3ULE A;  3UB5 A;  3P31 A;  2ITM A;  2RPI A;  4I9Q A;  2VYP A;  1VRT A;  4CED A;  4JI0 K;  4CBU A;  1KLM A;  3F9K A;  4KRF A;  5C12 A;  4DV5 K;  4W5O A;  4FM1 A;  3M3Z A;  4KHQ A;  4XH4 A;  4CZH A;  3MXM A;  3QDK A;  1JCG A;  3QML A;  3AVG A;  3O6W A;  4KI4 A;  2J4R A;  2Q3S A;  3P38 A;  3CJ9 A;  4BE1 A;  5CYM A;  3CME N;  3ZT3 A;  1RTD A;  1RT1 A;  1VQL N;  3UE5 A;  3VEO A;  1MU2 A;  2HW3 A;  2P9U A;  4PHT X;  3SQ2 A;  4H5R A;  1DTQ A;  3DXM B;  4IDK A;  4DR6 K;  1BDG A;  3K5O A;  3TAG A;  5GAH P;  3TTF A;  1HKC A;  1U04 A;  4JI5 K;  3OYH A;  2NNW A;  1O1W A;  4OPH A;  4FJ8 A;  4I6M B;  4FLX A;  3K57 A;  4JKB A;  4Z4E A;  2BGG A;  3CCJ N;  4CK1 A;  4FJX A;  3TAP A;  5SWM A;  3R1X A;  3CQX A;  5BRF A;  2ZGY A;  5EOY A;  3D2F A;  1S9G A;  1KLN A;  1BUP A;  1IH7 A;  1ZBF A;  4MLE A;  4Y1D A;  1N32 K;  5BPN A;  1NGD A;  3VF6 A;  4JYA K;  1QSS A;  5EY4 A;  5DM7 L;  1SL2 A;  1WSE A;  4DSI A;  1SQK A;  3HST B;  4LFB K;  1ZBI A;  2G8V A;  2W41 A;  2E6L A;  4CFB A;  4K42 A;  4CFC A;  1RIL A;  2Q31 A;  1GOB A;  2FF6 A;  3O4W A;  1DGK N;  3CFR A;  4I2Q A;  4HUE A;  4DTP A;  3WQT A;  3VTH A;  4CHP A;  1W97 L;  3O9T A;  4KHU A;  3NHG A;  3WXM B;  2Q0R A;  1NGH A;  4CJ7 A;  1S22 A;  1TUY A;  2WBN A;  3KD1 E;  3U3G A;  4YHH K;  5AFU H;  4FLV A;  4CHY A;  3VTI A;  3OYF A;  4BY9 C;  3WQU A;  3J7A P;  2KTQ A;  5AQP A;  1WN7 A;  5KPT A;  1JLF A;  2ASM A;  3GBT A;  3BY5 A;  3ZEU B;  3PO5 A;  4ISE A;  1CXU A;  3CJC A;  1NGF A;  1XQS C;  1U49 A;  3LL3 A;  3U8X A;  2O8B B;  2O4G A;  5DM6 L;  4KHW A;  1S1U A;  3MMV A;  1T6D A;  1XHZ A;  4DFM A;  4N41 A;  4M3R A;  3IKM A;  4WYB A;  3DLE A;  4CZI A;  1NGC A;  2OTJ N;  3TWH A;  1VSL A;  3G0Z A;  5KI6 A;  4JHD A;  4NYN A;  1EP4 A;  2GWK A;  4BR5 A;  3SCX A;  1N36 K;  1Q86 O;  5AQF A;  1ZBU A;  4KRE A;  3HT3 A;  2HF3 A;  5KGW A;  4A5A A;  1A5W A;  4K43 A;  3Q7B A;  3KK2 A;  3TAF A;  3CQ8 A;  4FLT A;  3RMD A;  1C0U A;  3C94 A;  5C15 A;  5EVZ A;  4JI8 K;  1R0A A;  3HBT A;  4DFK A;  2VWJ A;  2F4V K;  5M1O A;  4K8Z A;  4ID1 A;  1L3S A;  3ID8 A;  4DR2 K;  1YAG A;  3QER A;  4BR4 A;  4N76 A;  1RCH A;  3NH1 A;  5M1K A;  1B9D A;  2O8E B;  3NH0 A;  1NOY A;  2JWK A;  1NG9 A;  5BRE A;  2EWS A;  5ADX A;  4RCH A;  4IZ9 A;  4BE0 A;  2W42 A;  1Y97 A;  3AAP A;  4B1V A;  4A2A A;  4CES A;  3VEZ A;  1NK8 A;  2E1Y A;  4BC4 A;  4LSN A;  3FZL A;  3OYD A;  4LSL A;  4GMJ B;  2P9U B;  4MQ3 A;  1S3X A;  3S3N A;  5C42 A;  3KK1 A;  4FO0 A;  2PYJ A;  1WUA A;  1SKS A;  3OBW A;  5IT9 O;  4M42 A;  1L3U A;  1RT2 A;  3ZT4 A;  4PQU A;  5BN9 A;  1VQ4 N;  1KVC A;  4WQ5 A;  4K25 A;  3O5B A;  2O4I A;  1IO2 A;  4M3X A;  3QEI A;  1UWB A;  3FZK A;  3KLF A;  4CFA A;  1C1B A;  2VG7 A;  1RGI A;  2GBZ A;  3CCU N;  3PLA A;  3B6O A;  3ALY A;  4R5P A;  3VQ7 A;  1IKW A;  3IMX A;  4B1Y B;  5K14 A;  4FZY A;  3KIO A;  4FWP A;  1LAW A;  2QWR A;  4DF8 A;  4DV1 K;  3SZ2 A;  2Q1N A;  1DEJ A;  3H1Q A;  4Q5V A;  2HVI A;  3LDS A;  3R9P A;  4IEE A;  4XH5 A;  2A42 A;  1M90 O;  4IKF A;  1NJX A;  4JI6 K;  1K6Y A;  2QW9 A;  3VEX A;  3SUP A;  5C0Y A;  1CZ9 A;  1HX1 A;  1ZYQ A;  4QS7 A;  4OVL A;  2OPP A;  5AQN A;  2A5X A;  4KKO A;  2WTU A;  3RMA A;  4Z4G A;  4FWL A;  1OH5 A;  2VG6 A;  3OYI A;  2RF2 A;  4BRI A;  4DQS A;  1YJW N;  1HUX A;  2YNF A;  5J2N A;  4B9S A;  3E01 A;  3V1O A;  1VSH A;  3SMP A;  4B3R K;  4H4M A;  4V19 S;  2Z1G A;  1K8A O;  3F9M A;  3O8M A;  3SJH A;  3C65 A;  4OKK A;  1ATN A;  4CJW A;  2F8T A;  1BWF O;  4YY3 K;  3HOT A;  5CHI A;  1RTI A;  4AF1 A;  1EX4 A;  1HPM A;  3VEW A;  1D9D A;  4B1U B;  3BEX A;  4LF5 K;  1LAV A;  2D0P A;  1VSM A;  1HYV A;  1WAF A;  4W5T A;  4CEC A;  3O9Q A;  1LWE A;  1UA0 A;  4ILH A;  4BRF A;  1QE1 A;  2QXF A;  5E41 A;  4IJN A;  3QEV A;  1NKC A;  1C0G A;  3UKU A;  3MK6 A;  4HWI A;  1T8E A;  5SZT A;  4M7Y A;  2HHV A;  1IBM K;  4NCA A;  1NGE A;  3ZSO A;  5HRR A;  5BPM A;  3K9J A;  3FR0 A;  3HZ6 A;  1KRP A;  4KB0 A;  3BGR A;  3VES A;  4E89 A;  4IOA L;  2G8H A;  4FK4 A;  4CD1 A;  1YHQ N;  1EO1 A;  1SZ2 A;  5GIO A;  3LP3 A;  3LAN A;  4CCH A;  2HHS A;  1E3M A;  5FLX O;  5LL6 Z;  4BDP A;  2HHT A;  5EXW A;  2O8F A;  3D6R A;  1ASV A;  3LDL A;  3T19 A;  3P1G A;  4QS8 A;  5HRO A;  1U45 A;  3QEW A;  1NK9 A;  5AQI A;  4BDY A;  2ZGZ A;  4LF9 K;  4Y1C A;  4HCC A;  5C2D A;  5C25 A;  3UIQ A;  1TAQ A;  3I55 N;  1U47 A;  2BAN A;  3QFU A;  3CPW M;  1VQ7 N;  3VA3 A;  4FWK A;  2W40 A;  1Z05 A;  2O8C B;  4M3T A;  2F8S A;  1KAX A;  4CZG A;  3L2V A;  4DQ8 A;  4M3W A;  2WUS A;  2KKZ A;  1X9W A;  2VGN A;  4O8K A;  1LW2 A;  2A3Z A;  5BN8 A;  4FM2 A;  4FJI A;  1OVQ A;  3OS2 A;  5AQZ A;  4MO5 A;  3ZT0 A;  1BQN A;  1LWF A;  2EX3 A;  4PUO A;  4B9N A;  4BR2 A;  4FLU A;  2X6S A;  4H4O A;  2Q2R A;  1N6Q A;  3SYZ A;  1VQP N;  3ENB A;  1X3M A;  2HNZ A;  4FJH A;  3MDQ A;  3PIO L;  3ZSW A;  2NRX A;  4I7F A;  3P39 A;  5B8H A;  1WSI A;  3H1V X;  3MX5 A;  4L3Q A;  2VG5 A;  2NRT A;  3E1Y A;  4LF4 K;  4IXC A;  3LAL A;  2NRV A;  1ATS A;  3VQ9 A;  4E7L A;  1FW6 A;  4FWR A;  1S9E A;  1BG3 A;  3H3N O;  2YJE A;  5GAD P;  1Q81 O;  4DB3 A;  3LWL A;  3OS1 A;  3WEE B;  1R59 O;  4CK3 A;  4KHP K;  2LSN A;  1M1K O;  1S1W A;  3IFR A;  4AHR A;  5AZI B;  4QOZ B;  1CLQ A;  3QNN A;  4B3S K;  5FPD A;  1DT9 A;  4DSE A;  3L4Q A;  4X65 K;  3H3O B;  1SKR A;  2HBM A;  3EL2 A;  1Q8I A;  3H46 O;  5AQX A;  3M8S A;  4B9M A;  4DLE A;  2E6M A;  3VET A;  3VF4 A;  4A57 A;  4GVE A;  1HKB A;  1RBS A;  1OH8 A;  4JS4 A;  1BIZ A;  2WFB A;  3ZT1 A;  1YT3 A;  2FSJ A;  2OCE A;  4IWV A;  1TVR A;  3OS0 A;  3TAB A;  1WBB A;  5HP1 A;  2YHX A;  3PY8 A;  5FRO A;  3SQ4 A;  3FLC O;  4LH5 A;  5IWA K;  1D9F A;  2W6L A;  2WC9 A;  3THV A;  3D2E A;  1YI2 N;  1NKB A;  2P9L A;  3LAM A;  4FWM A;  1BI4 A;  4H03 B;  2XY7 A;  4CEQ A;  3RSE A;  1Q9X A;  1W9H A;  1Y64 A;  3O4N A;  3BZK A;  3U6F A;  5FPM A;  3MWP A;  5KRT A;  3ZLJ A;  4CZE A;  2P5O A;  3O1W A;  3O9R A;  3G10 A;  2PFU A;  3KZB A;  3L2W A;  1S1T A;  4ZHR A;  3EZ5 A;  1TGO A;  3HSC A;  1NMD A;  3EKS A;  3UKU B;  2UUA K;  4PKI A;  3S3M A;  1OH6 A;  2Z1J A;  3VQD A;  4EFH A;  2FBV A;  4MDA A;  3ENH A;  3CXC M;  1ZXO A;  1W0H A;  1T05 A;  3THX A;  3HVT A;  4IFV A;  2IVP A;  4H0O A;  1LOT B;  1KFD A;  2X78 A;  4IDH A;  3CET A;  2ZD1 A;  3AA3 A;  4M45 A;  4CGI A;  1IBL K;  2GEM A;  1UAX A;  4ICL A;  3M5R A;  1HMV A;  3HP6 A;  3NF6 A;  2GTD A;  4CJS A;  4CIF A;  1IJJ A;  3AA4 A;  4OPK A;  2QTD A;  3AV9 A;  5AQR A;  2B4J A;  3TSP A;  4AHC A;  4FJK A;  3QIC A;  2GX9 A;  3PIP L;  4H0Y B;  2O8F B;  4CGJ A;  1K8K B;  1KD1 O;  4B9L A;  4KI6 A;  4JKG A;  3VQ5 A;  5AQY A;  1BU6 O;  3HP9 A;  5KQD A;  4FL9 A;  3D0P A;  1J5O A;  3OYK A;  5CZ1 A;  1RT7 A;  4J2E A;  3WNF A;  4CF0 A;  1GOC A;  3SBT A;  2HHQ A;  1X3N A;  4DUY K;  1MDU B;  1WOQ A;  3QLH A;  2KFZ A;  3H45 C;  5JLH A;  4DLG A;  1BCM A;  3VQ8 A;  4DV4 K;  1HNV A;  4K0K K;  2IGI A;  3I0S A;  3MN5 A;  4LFC K;  1QSL A;  2IIR A;  2QWP A;  3CCL N;  2ZJP L;  1XNR K;  4H5W A;  4Z4I A;  3KTQ A;  3N4P A;  2P9I A;  3N4Q A;  3A5M C;  4FWO A;  1C1C A;  4DMN A;  4ILG B;  3CER A;  3CCS N;  1J54 A;  1GLF O;  2O8D A;  5M1N A;  1C0M A;  3THY A;  4FJ5 A;  2PAV A;  1Q82 O;  4M7X A;  1TV6 A;  1N8R O;  1QHA A;  1ATR A;  4RG8 A;  3JS6 A;  3I0R A;  2QKK A;  4M3Y A;  3CC4 N;  1RBR A;  4WQ5 C;  3L3U A;  3NH2 A;  4WFA L;  4BG8 A;  3C6T A;  2ITG A;  3P5J A;  4MLH A;  4RW6 A;  2GEL A;  1TKT A;  2FSK A;  1D8Y A;  3M8Q A;  5BR8 K;  2QWN A;  4O5B A;  4AHV A;  2BH1 A;  1QQO A;  3EY1 A;  3VGL A;  3AO4 A;  4DQI A;  3G4S N;  4E1N A;  3G71 N;  4DF4 A;  3FZM A;  3A0I X;  2DFH A;  3ZX2 A;  1BL3 A;  3NE6 A;  3MWT A;  3SAH A;  4O44 A;  2DPN A;  5D3G A;  2ETJ A;  4O0I A;  4A5B A;  2XY5 A;  2F9T A;  2QK9 A;  2B5J A;  3VOV A;  5EX5 A;  4KHN A;  4PKH A;  5MLC Q;  4I9L A;  4DR4 K;  3LM9 A;  3ZSR A;  2YHW A;  2YX6 A;  4LH4 A;  1OVY A;  3C6H A;  2GWJ A;  5E26 A;  4DQQ A;  4WQ4 C;  4AHU A;  1XC9 A;  1T03 A;  3ZSX A;  4RW4 A;  4F8R A;  5AZJ A;  3FE1 A;  4GKJ K;  3JSM A;  1QTM A;  4JI2 K;  1D4X A;  3MXJ A;  4IG3 A;  1VSK A;  4KTW A;  3VQP A;  3MN6 A;  3HOS A;  3NDK A;  3EEQ A;  4AQY K;  2OTL N;  4OO1 J;  4G9Z A;  3IDH A;  3F5T A;  5ADX H;  4OPJ A;  1G15 A;  4Z4C A;  4E7J A;  1HYS A;  4X62 K;  3SK3 A;  1LW0 A;  4DSF A;  1SUQ A;  1EWR A;  1EKE A;  3GE1 A;  2YHB A;  2PY5 A;  1WAJ A;  1T6C A;  4CEE A;  3ZSZ A;  1U2V A;  3ZET A;  4BRG A;  3QNO A;  4NLB A;  3KD5 E;  3LDP A;  4E7I A;  1ASU A;  4FLY A;  4CVN E;  3SQ0 A;  3DM2 A;  2CGL A;  3J7Y P;  3THX B;  1QS4 A;  4CHZ A;  4JRP A;  2E8A A;  3VEY A;  4CZK A;  3DOK A;  4PL8 A;  4OGE A;  4JKC A;  1RFQ A;  4U7B A;  1CXQ A;  3AO5 A;  3P83 D;  1A5V A;  2Q36 A;  1YJ9 N;  1DTT A;  4GVM A;  4LD0 A;  4NCB A;  4AHT A;  2D4W A;  2E2N A;  4F3O A;  1LV5 A;  2HBK A;  2E88 A;  1VQM N;  3LZI A;  2DFE A;  5KTQ A;  1FJG K;  1U6Z A;  1YXQ A;  3CJ7 A;  2ASO A;  1RBT A;  3SV4 A;  1JXB A;  2IC3 A;  4BRO A;  5AJ3 K;  1S6Q A;  2G8F A;  4AIL C;  3AA5 X;  4JKG B;  4KV8 A;  3OYB A;  1YIT N;  4I2P A;  1OH7 A;  2R7Y A;  3EO3 A;  4FCY A;  3E9L A;  4N56 A;  1JJ2 M;  1RT5 A;  3SPZ A;  4DU1 A;  2E2O A;  1C1A A;  3NF8 A;  3WNE A;  3ITH A;  2XRI A;  1LWC A;  5LY3 A;  4E3S A;  5J2Q A;  3WNH A;  1S1X A;  1CZA N;  1XNQ K;  1QHT A;  4KTQ A;  1RDC A;  2FSN A;  3ULE B;  2AA4 A;  2ZJR L;  4FM0 A;  1NGG A;  4DQP A;  4DSK A;  3CC2 N;  5I9E B;  1NOZ A;  5KPZ A;  4BR9 A;  1JL2 A;  4ISG A;  3KJV A;  4GY2 B;  4GNI A;  1KQS M;  3IS9 A;  5HOO A;  4F2S A;  2IDO A;  3MCP A;  2PZS A;  3VER A;  1IKX A;  3KKS A;  3OTO K;  2QWQ A;  3CG7 A;  5JS2 A;  4DTN A;  2CGJ A;  4EHU A;  2F9W A;  4ISF A;  3Q7C A;  3H6E A;  4LF7 K;  3PSF A;  2G8W A;  4A62 A;  3VGM A;  5AQH A;  1JCF A;  4FJL A;  1WSG A;  4FPA A;  2FF3 B;  2IAJ A;  3VQ6 A;  3JYT A;  4FJ7 A;  3VPZ A;  4DG1 A;  4DS4 A;  4DKW A;  1KC8 O;  3DWL A;  2HMI A;  3CFP A;  4FJG A;  2BUP A;  4BDZ A;  3DI6 A;  4JD2 A;  3HPG A;  3PV8 A;  4AM7 A;  2V7Z A;  4CF1 A;  5GIP A;  2V51 B;  3VQA A;  3D2F B;  2V7Y A;  5J2M A;  4CJ3 A;  2HST A;  1ZBS A;  4H5V A;  1DKG D;  1RNH A;  4B9Q A;  4LFA K;  4H8K A;  3CCR N;  3B6P A;  4DR3 K;  3CIP A;  2UU9 K;  5TKW A;  3K59 A;  1HYZ A;  3T69 A;  1J5E K;  3A2F A;  3I8D A;  5KQ8 A;  4J2D A;  5AZJ B;  2A6A A;  1MA9 B;  3UKR A;  3IRX A;  3ZYY X;  4J2A A;  1KCF A;  4MDB A;  1YJN N;  1IBK K;  1NWK A;  4X66 K;  2OZM A;  4J2B A;  3IUC A;  5CR4 A;  1HJO A;  5I42 A;  2YCH A;  3NFA A;  5LJV A;  1YVN A;  3OVN A;  1NKE A;  2FBT A;  2P9N A;  1NGA A;  1VQO N;  3O08 A;  2AJQ A;  4W5R A;  1SV5 A;  3LP0 A;  4YFU A;  2UXB K;  2JGU A;  2AP1 A;  3AVL A;  1NK4 A;  3VEV A;  2YI1 A;  4CZJ A;  3SI6 A;  4JK7 A;  5AQG A;  3DXK A;  2OA8 A;  2IS3 A;  1NK0 A;  3W3D A;  1JKH A;  4EP5 A;  1I39 A;  1B9F A;  1WB9 A;  4FOI A;  5F0X A;  3HI0 A;  1EQY A;  4CJV A;  2EHG A;  5CZ2 A;  5EU7 A;  3CC7 N;  1JLC A;  2KZM A;  3CJB A;  4JV5 K;  1T7P A;  4FLZ A;  1B92 A;  5KRS A;  3V4I A;  4OGC A;  3TAM A;  3S9H A;  5HLF A;  3WXI A;  1WSF A;  4IO9 L;  4JKA A;  1HKG A;  3PX0 A;  3QBX A;  4JHD B;  4JLH A;  3BZC A;  3ZCM A;  3L3V A;  2Q97 A;  4FJJ A;  4CJ5 A;  4DTX A;  4DFP A;  3A5N C;  1RTJ A;  4DHY A;  3BF3 A;  3QEX A;  1IKY A;  4O4G A;  3A5O C;  4CZM A;  4EZ6 A;  4C8O A;  4FLW A;  3NMU A;  3HM9 A;  2YNH A;  3FZH A;  1E4F T;  4WF9 L;  4GV6 A;  3S41 A;  1TAU A;  3C7N A;  4OKE A;  4CHO A;  2JWL A;  5AQL A;  5GAG P;  2P9K A;  1SAZ A;  4BVO A;  3QIO A;  3QET A;  3NF7 A;  4CHQ A;  4W5N A;  4FWQ A;  2ZM6 K;  4BAC A;  3K0S A;  3O3H A;  3IAY A;  2HF4 A;  1VQ9 N;  3QBW A;  1BHL A;  1EXQ A;  1GLC G;  2I7P A;  1I3A A;  4OPA A;  2QWM A;  3EE9 A;  4WFB L;  4M3Z A;  4C1N K;  2OYQ A;  2BE2 A;  3HYF A;  3J8A A;  3TU5 A;  3QES A;  3RRH A;  3J81 O;  3SUN A;  3WXJ A;  2E20 A;  3CCQ N;  4H0V B;  1VSF A;  4EIA A;  3GOI A;  5KGX A;  2IOC A;  4B8A B;  4K41 A;  4JD2 B;  1HPZ A;  2CGK A;  1JLG A;  3CM5 A;  2W6K A;  2G8I A;  1FKO A;  3NGI A;  2ZF5 O;  1BA0 A;  2FBY A;  3GL1 A;  2QI2 A;  4LY7 A;  5GIN A;  1Z6R A;  3LDO A;  1TL1 A;  3FFI A;  5AQM A;  3VN5 A;  2HHH K;  1SL1 A;  4CZL A;  2UYT A;  4DR5 K;  3EN9 A;  4BRC A;  3KK3 A;  5HRS A;  3K2P A;  3UKR B;  3LAK A;  1QQM A;  5JS1 A;  3K5L A;  2QWO A;  4RW8 A;  5LJW A;  4QAG A;  3VF2 A;  3M8P A;  3O1B A;  4IJA A;  4NCG A;  1NNE A;  4C8L A;  4CEB A;  3HK2 A;  1SKW A;  4CEF A;  4BC3 A;  4KH6 A;  2NZT A;  2XY6 A;  4KAZ A;  4E7H A;  4Z0U A;  2DY4 A;  1N34 K;  1JXE A;  3KLH A;  2QKB A;  3K9K A;  4H0P A;  1TK0 A;  3MN7 A;  4RWT A;  4KTZ A;  4X64 K;  3BDP A;  1X9S A;  1CZB A;  4I6M A;  4JKD A;  4FZZ A;  4JI7 K;  2E5L K;  2YNG A;  3TSQ A;  4Z94 A;  1EET A;  2A40 A;  4NLC A;  3RVC A;  4OLA A;  4CER A;  1W7A A;  2KHO A;  3MN9 A;  1JLA A;  4Z4F A;  4HVJ A;  3OBY A;  3O3F A;  3V9S A;  3ISN C;  1NGB A;  4ELT A;  2YHA A;  3I8B A;  4B3O A;  2KFN A;  3RWU A;  1NK5 A;  2D5R A;  2Y1I A;  2HND A;  3J7Z O;  1FXX A;  3AVF A;  1GOA A;  4YDU A;  4PKG A;  3OA9 A;  4J8F A;  3L2U A;  1ASW A;  1MWM A;  4PY5 A;  3GG4 A;  3L4I A;  3KWG A;  3F2K A;  1HNZ K;  3KWI A;  4CE9 A;  3RR8 A;  2QM1 A;  3NVK A;  3CJA A;  4HCB A;  2YNI A;  4NB4 A;  3OW2 M;  2NRR A;  3O4Q A;  3VQB A;  5J2P A;  4BRP A;  3AA2 A;  3AVB A;  2YJF A;  1KFS A;  3DLL L;  3RR7 A;  2FBX A;  1KAY A;  4DU3 A;  3CI5 A;  4NYF A;  1NK7 A;  4JKF A;  4CJQ A;  1ZBH A;  4NO7 A;  4IFE A;  5AQT A;  2HHX A;  2P9P A;  1NJZ A;  1EWQ A;  3AO2 A;  3BF1 A;  3DMJ A;  3DRP A;  4CK2 A;  2RN2 A;  3HO1 A;  3PX4 A;  3ZEU A;  4KHY A;  3WUH A;  3WNG A;  1VQ5 N;  3V81 A;  3L6Q A;  4M41 A;  5AR0 A;  4WFN L;  2P9K B;  4B8C A;  4F9O A;  4H5T A;  4DV2 K;  2HHW A;  3BUZ B;  5TKY A;  4DUZ K;  3VMF B;  2O8B A;  4C8M A;  3KVG A;  4YOT A;  3OYM A;  4NXN K;  4M63 C;  5JLF A;  2B6A A;  1SS6 A;  4BRL A;  4JKE A;  4OX9 K;  4BRE A;  4EP4 A;  3MXI A;  2D1K A;  4XEI A;  3CM6 A;  3HPH A;  1S1V A;  3WXL A;  4E7K A;  3M8R A;  3LWM A;  3P4I A;  5BPL A;  2HHU A;  3C6A A;  2D0O A;  2P1J A;  4DR1 K;  3KLI A;  3KLE A;  3V9U A;  3PUF A;  4BR7 A;  1X1P A;  3QB0 A;  2IVO A;  4BRK A;  4PL7 A;  3KKR A;  1IV0 A;  2YKN A;  3TSU A;  1S72 N;  4KH4 A;  4HUF A;  3E9O A;  3OJS A;  1VQ8 N;  1XHX A;  3MEC A;  2FC0 A;  1NU0 A;  1GLD G;  1BQM A;  4LC9 B;  4CGF A;  3T7Z A;  2HBL A;  1RDW X;  5LMN K;  4B9V A;  4FJ9 A;  2GV9 A;  1G99 A;  3FGU A;  4JRQ A;  2G8K A;  2DTU A;  1RTH A;  2O8E A;  2RHK A;  4IG0 A;  3CYM A;  1RT6 A;  3ZSY A;  4JI1 K;  4H0X B;  5JMV A;  4JI3 K;  3NF9 A;  3TI0 A;  1XUP O;  1I94 K;  1VQK N;  2E2Q A;  3HPO A;  2ZWH A;  1F21 A;  3TTC A;  2DFF A;  3KK7 A;  2D0C A;  2ZJQ L;  3OYJ A;  4H5N A;  2NRW A;  3J80 O;  1HLU A;  1GLB G;  3AVH A;  4E0D A;  4YOU A;  1VRU A;  1P8Z A;  1YVU A;  3MAQ A;  4JN4 A;  3RMC A;  3TAE A;  3AAR A;  2KZZ A;  1NK6 A;  1Z25 A;  5JIC A;  4FW2 A;  2VGM A;  3JAM O;  3ATU A;  4DV7 K;  5FRM A;  3SV3 A;  1GLE G;  4R79 A;  1IG8 A;  5M1F A;  1JLQ A;  3NCI A;  3WT0 A;  1WLJ A;  4DU4 A;  3E66 A;  3R6M A;  3SJJ A;  2YHY A;  3F73 A;  1VSJ A;  4CZF A;  3HVR A;  3I56 N;  3D2E B;  2D0A A;  2P9L B;  1BI4 B;  5BR9 A;  3RSE B;  4O5F A;  2UXD K;  2NRZ A;  3LDN A;  1BOT O;  4CJL A;  4CJU A;  4CJ4 A;  1C0T A;  4FPB A;  3QEP A;  4NXM K;  4KPY A;  1VAZ A;  3TR8 A;  2V52 B;  4WCE L;  5ELZ A;  4B3T K;  1JL1 A;  2XHB A;  3SBG A;  1XC3 A;  3VA0 A;  3AVI A;  5J1E A;  1YTU A;  1TUU A;  3HRG A;  5M1Q A;  1YIJ N;  1XMQ K;  1TK5 A;  1BO5 O;  3V9W A;  2KW4 A;  3LM2 A;  3LP1 A;  3O9U A;  4N5S A;  4CIE A;  1YTA A;  2P9P B;  1HR0 K;  5AQJ A;  3AVK A;  4KH5 A;  2WON A;  3L2R A;  5FRN A;  2ZQB A;  4IEI A;  2GUI A;  4B1X B;  1RBU A;  2VQE K;  3D45 A;  4CJR A;  4HHT A;  3A8Y A;  4DTS A;  4BVP A;  3T3F A;  4GW6 A;  3W0L A;  4EZ9 A;  1TYQ A;  1QZ6 A;  3FFK B;  3ATV A;  3TAN A;  3CF5 L;  4F4K A;  4DCH A;  3ULD A;  4BR0 A;  2PBD A;  3MCA B;  3U4L A;  5C10 A;  5JVH L;  1NJW A;  4KHS A;  3TAQ A;  1KVA A;  4BRD A;  1REV A;  3CFO A;  3MEG A;  1K9M O;  3M6G A;  3NVM A;  3NGZ A;  3CHW A;  1L3T A;  3L8B A;  1RDB A;  2E2P A;  3CCV N;  3V1Q A;  4E1M A;  2HOE A;  4FYD A;  5HBM A;  1HJR A;  4ELU A;  1U4B A;  2P9I B;  3OYA A;  2VCP A;  4B1Z A;  3CCM N;  4Y0W A;  5GAE P;  3NBP A;  2O8D B;  4FK0 A;  3PO4 A;  3ZX0 A;  3THY B;  4FVM A;  1HNW K;  3MED A;  1KVB A;  3AVJ A;  3T1Y K;  1QQC A;  2IVN A;  1RDU A;  4W5Q A;  4CGH A;  4KBO A;  2E1Z A;  4F2R A;  3VGK A;  1Q7Y O;  3ENO A;  3L2Q A;  3KLG A;  2P51 A;  2Y1J A;  1V4S A;  4PWD A;  1QSY A;  1NLV A;  2YV0 X;  1KAZ A;  1ZC6 A;  1JLB A;  1YF5 L;  4H0T B;  4BRH A;  4OLB A;  3DLK A;  4QS9 A;  5C2F A;  4O0J A;  2QWL A;  1GLJ O;  1OKJ A;  3LDQ A;  4DTJ A;  4FJN A;  1J53 A;  5AFU A;  2Z1H A;  2ZE2 A;  3CPE A;  2VQF K;  4DSJ A;  1IG9 A;  2O8C A;  4DV0 K;  4B08 A;  3QIN A;  1VK0 A;  3U9D A;  1XMO K;  4PA1 A;  1K73 O;  3AVC A;  1IKV A;  5AQS A;  4E19 A;  1TKD A;  2RE2 A;  1HNX K;  4JI4 K;  3MEE A;  3AY9 A;  3ZX3 A;  2P9S A;  5E84 A;  2RKI A;  4YOX A;  4AH9 A;  1JLE A;  3U3Y A;  1XWL A;  4BRQ A;  4FJM A;  4CJF A;  4FWN A;  4BGA A;  4UQG A;  1LCU A;  3SMS A;  3DOL A;  5AQK A;  5A2Q O;  4Q0B A;  1RDA A;  4IFY A;  1WBD A;  4DS5 A;  5T7B A;  1N5Y A;  4QCL A;  3A5L C;  3AVM A;  4CD3 A;  4JNE A;  2UUC K;  1J9A A;  4E1J A;  2UXC K;  3VEN A;  4IBN A;  1TL3 A;  4CJT A;  3OYE A;  1GLL O;  1L3V A;  4CEZ A;  3WEE A;  1U2V B;  3ZET B;  4B9U A;  3O9S A;  3THW A;  4F3T A;  5AZI A;  3V1R A;  4EAH D;  1L5U A;  4YDU C;  4WQ4 A;  3QO9 A;  2NUB A;  5FPE A;  3AVA A;  4FK2 A;  4IOX A;  4YOW A;  4CJK A;  3R8E A;  1KXP A;  4ELV A;  4JK8 A;  3RMB A;  3EE8 A;  3S3O A;  5AQV A;  1C0F A;  2ATQ A;  1S6P A;  3AGR A;  4JEP A;  5BRH A;  4B9T A;  4KB1 A;  3EYZ A;  4CF2 A;  1ESV A;  3ZSQ A;  1ZBL A;  1NJI O;  4B3M K;  4OKJ A;  4C1N I;  1N33 K;  3OYL A;  1NMN A;  3HJF A;  4JS5 A;  1TYQ B;  3FZF A;  1U48 A;  5F1X A;  3DLB A;  1TKX A;  4FOE A;  4XH1 A;  3OYG A;  3DRS A;  3AGK A;  4CFD A;  5H1S Q;  2BTF A;  2OPS A;  4GKK K;  2JLE A;  5AQQ A;  4CBX A;  2X74 A;  2A41 A;  4L8R B;  4CJE A;  3RTV A;  1S5J A;  4FVU A;  2XY8 A;  1HNI A;  2Z1I A;  3M1F A;  4BWM A;  3VQ4 A;  4GV9 A;  3DAW A;  3CMA N;  1ITG A;  2NLX A;  4GV3 A;  1C6V A;  5KPR A;  3CQY A;  1KTQ A;  4CF8 A;  4LF8 K;  2CH6 A;  3E9P A;  4BQL A;  1Q18 A;  4K8X A;  4CW7 B;  4JK9 A;  3ZSV A;  1VSI A;  3LP2 A;  4UY8 O;  3CD6 N;  3VQE A;  3HL8 A;  4FW1 A;  2A1R A;  2FLO A;  3TTD A;  3JXU A;  4DR7 K;  2PYL A;  2HVH A;  3T1A A;  1BGX T;  1BIS A;  1WNS A;  4A61 A;  4CJP A;  1HQU A;  1WSJ A;  1J6Z A;  4U67 L;  1K8K A;  1RBV A;  4YNQ A;  1ILY A;  5LMU K;  2KQ2 A;  4RW7 A;  4N47 A;  1E4G T;  3B8A X;  4ILJ A;  4HUG A;  3G25 A;  1V4T A;  2I5J A;  4DTM A;  3VQQ A;  4ZTF A;  3EZW A;  1VQ6 N;  3CCE N;  1SL0 A;  1TKZ A;  5F2R A;  3HTV A;  4DV3 K;  1O13 A;  4DWI A;  2GUP A;  4AHS A;  1QQN A;  4JKH A;  2UUB K;  1VQN N;  5DMR A;  4BGB A;  4YOV A;  4HTU A;  1BIU A;  3DLR A;  4RW9 A;  3HXM A;  1RT4 A;  1NGJ A;  1NM1 A;  3KHY A;  5CY4 A;  4BQZ A;  1X9J A;  2HMP A;  4YOR A;  1QVG M;  3WXK A;  4ZTJ A;  4CHN A;  2P9S B;  4O8U A;  1X9M A;  1D5A A;  4Z4H A;  1W2B M;  2KLA A;  4C8K A;  4BE2 A;  1H1V A;  4BRM A;  5JVG L;  4C23 A;  4M3U A;  2YKM A;  3G6E N;  4IOC L;  4DQR A;  3OHR A;  4DSL A;  4BC2 A;  2QA4 N;  2BDP A;  3BP8 A;  3AO1 A;  3NGY A;  3SUQ A;  4FXD A;  3AAQ A;  4O55 A;  3K5N A;  3C95 A;  1NJY A;  2F96 A;  3DXM A;  2NRH A;  3V6D A;  3AO3 A;  3LPU A;  2P9N B;  4KO0 A;  5AQW A;  5M1P A;  4CBW A;  4G1Q A;  2D0B A;  1KSP A;  1MWK A;  4BC5 A;  3THW B; 
#chains in the Genus database with same CATH homology
 1HNX K;  4YY3 K;  1IBL K;  4JI4 K;  4LF8 K;  1XNQ K;  4CW7 B;  1HNZ K;  3J81 O;  4DR4 K;  4JI1 K;  4LF5 K;  4DV6 K;  4JI3 K;  2UXB K;  1I94 K;  4LF4 K;  4YHH K;  4DR7 K;  5A2Q O;  4GKJ K;  3J80 O;  5IT9 O;  4JI0 K;  3J7A P;  4JI2 K;  4KHP K;  2UUC K;  2UXC K;  4JV5 K;  4DV5 K;  4AQY K;  1IBM K;  3OTO K;  3JAM O;  5LMU K;  4B3S K;  4DV7 K;  4DUY K;  2HHH K;  4X62 K;  4X65 K;  4DV4 K;  4DR5 K;  4LF7 K;  4K0K K;  4DV2 K;  4DUZ K;  4LFC K;  4DV3 K;  5FLX O;  4NXN K;  1XNR K;  5LL6 Z;  1HNW K;  2UUB K;  4OX9 K;  4DR6 K;  4CVN E;  3J7Y P;  1N36 K;  3T1Y K;  4JI5 K;  4DV1 K;  5IWA K;  3T1H K;  4B3M K;  2UXD K;  1N33 K;  4JI6 K;  1N34 K;  4LF9 K;  4NXM K;  4DR1 K;  4LFA K;  4X64 K;  4DR3 K;  4B3T K;  2UU9 K;  4JI7 K;  2E5L K;  1FJG K;  1J5E K;  1N32 K;  4JI8 K;  4JYA K;  4GKK K;  5BR8 K;  1XMQ K;  5AJ3 K;  2F4V K;  2ZM6 K;  4LFB K;  2UUA K;  4DR2 K;  1IBK K;  2VQF K;  1HR0 K;  4DV0 K;  4X66 K;  4LF6 K;  1XMO K;  4B3R K;  4V19 S;  5LMN K;  2VQE K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...