2E5LK

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2e5lK00
3JAMO 4DR1K 5A2QO 4NXMK 5AJ3K 4DV1K 4DR7K 4CVNE 4JI0K 5LMNK 4JV5K 4DR5K 3T1HK 1FJGK 4GKKK 1I94K 1IBLK 4JI6K 2UXDK 4DV2K 1N33K 4GKJK 4AQYK 4DV6K 4LF5K 4DV7K 4DV0K 1XNQK 2F4VK 1J5EK 1XNRK 4X65K 4DUZK 4OX9K 4NXNK 5LL6Z 2UUBK 2E5LK 4LF7K 1HNXK 4LF6K 4LFCK 4JI4K 3J7YP 1XMQK 1IBMK 4JI3K 2VQFK 1XMOK 1IBKK 4DV3K 2VQEK 2UXCK 4B3TK 4LF8K 4B3RK 2UXBK 5LMUK 4DUYK 2UUCK 5IWAK 4JI1K 1N32K 4YHHK 1HR0K 2ZM6K 4CW7B 4DV5K 3OTOK 4LF4K 4K0KK 4JI7K 4JYAK 4DV4K 4X62K 4LFAK 1N36K 4DR3K 4X64K 4KHPK 4V19S 5BR8K 4B3SK 4LFBK 4YY3K 4B3MK 2UU9K 1N34K 1HNWK 5FLXO 5IT9O 1HNZK 4X66K 2HHHK 4JI8K 4JI5K 4LF9K 3J80O 4DR2K 4DR6K 3J81O 2UUAK 3T1YK 3J7AP 4JI2K 4DR4K
chains in the Genus database with same CATH superfamily
3AVIA 1M90O 4B9MA 1XC9A 2ZF5O 3CMEN 4FWRA 3HO1A 1ZC6A 2ZQBA 3M3ZA 4FK2A 1KAYA 2GBZA 1TUYA 2NLXA 1OVQA 1OH7A 5C0YA 2B5JA 5AZJA 5ADXA 4FLXA 3L6QA 1ZBHA 3ZYYX 3ZSZA 4CJTA 3AA3A 5TKWA 4YDUC 1YF5L 4JEPA 1S1UA 4K8ZA 3HOSA 3CM6A 3CQYA 3SAFA 1BCOA 1VSHA 1BUPA 4FO0A 4DF8A 3ULEB 4OO1J 4FWKA 4CJVA 1NGEA 3S41A 2UXBK 4FJJA 4EIAA 1J53A 4KRFA 3LWLA 3CYMA 4Z94A 4PKGA 3AVLA 2BH1A 4G9ZA 1NJIO 1JXBA 3SJHA 1YTUA 3CJCA 3I8BA 2EHGA 4CFAA 2E88A 1EWRA 4WQ5A 3BZKA 4KH6A 4X64K 4KH5A 5BRDA 3NF6A 3BF3A 3R9PA 3NGZA 1QQOA 1VQ5N 1EO1A 3RTVA 4CJRA 3DLGA 5FRMA 4LFBK 3SPYA 3HPGA 2UU9K 3A8YA 4CJWA 4BQLA 2ZE2A 2D5RA 4F3TA 1SKWA 2GX9A 4X66K 3SPZA 2KKZA 3MXIA 4I2QA 5J2NA 1S9EA 3VA3A 4JKCA 3SV3A 3NFAA 4DR6K 4FW1A 4M63C 3CC4N 3QFPA 4FWOA 3L4IA 1VQ8N 3Q7BA 3VA0A 4FOEA 4WQ4C 4Y0WA 4CK2A 4Z4EA 4JV5K 1TAQA 4BRPA 3G25A 3AGRA 1XQSC 1FJGK 3AGKA 4OGEA 4B8AB 3VF2A 2P9PB 3HYFA 1N6QA 4LF5K 3A5OC 4DWIA 5FPEA 1NOYA 3CJAA 1VQON 1HKCA 4J2AA 4JHDA 3N4PA 4E7HA 1U48A 4FOIA 3OYMA 4DSKA 3QINA 5I3UA 4ZHRA 4LF7K 3CJ1A 5AFUA 4Z4HA 1IKWA 3VQ6A 4OPKA 5M1KA 5SZTA 1IBMK 3VESA 3LDNA 1W7AA 4E0DA 4O0IA 3EE9A 4MDBA 1HNIA 2VG6A 4M42A 4NYNA 3ENOA 4B9VA 2PBDA 3LDSA 1DLOA 4DKWA 2A41A 1C1AA 4ISEA 1HR0K 1KLNA 3VGLA 3ZEUA 4CGFA 2ZGZA 4KB1A 3BUZB 3GOIA 3IUCA 1RDUA 4W5QA 4HCBA 5CYMA 3UKUB 4N76A 3CC2N 4CJQA 1NMNA 3A5MC 1C0MA 3DLKA 3HBTA 3OS2A 2KZMA 5CR4A 4JKHA 3VERA 4YOVA 3KZBA 3BGRA 4QCLA 3NCIA 2HNYA 3LALA 3CJ7A 4A2BA 3AAQA 2VWBA 3OBYA 1FK9A 4CGDA 4DR2K 1S9GA 1QSSA 3NGIA 1K9MO 4MO4A 4BRQA 3E66A 2P5GA 1E4GT 1RTJA 1ATNA 4DSFA 2G8VA 1YVUA 4FLZA 2P9UB 1SS6A 1VRUA 3C0BA 4DTUA 2YI1A 4OLAA 3S3NA 1IG8A 3TAGA 3KWGA 3UKRA 4CK3A 3O3FA 3OS0A 1UOCA 4AQYK 4CJSA 3PIOL 4DV6K 4C8LA 4FPBA 1K8AO 2ITGA 4KTZA 3PY8A 2YHYA 2WC9A 3BZCA 3OVNA 4DQPA 4F2RA 2VYPA 1L3SA 5AQUA 1L3VA 1Q7YO 3VEWA 4Q5VA 1U2VA 3RRGA 4EHUA 4FJGA 2AA4A 1S5JA 2BUPA 1VSEA 1LW2A 2O8EB 2E5LK 1HNXK 4CCHA 3ZSYA 1XMQK 3QIOA 2XY8A 1UA1A 1SZ2A 2V7YA 4GV6A 4DUYK 2NRWA 1JLEA 3MWTA 1DTTA 2Z1GA 3DLEA 3I33A 3WXLA 4GV9A 4CGHA 3K5LA 4M7XA 1VQ4N 4DU1A 1OKJA 5T7BA 2ZJQL 4CEFA 3QETA 4DFPA 4FW2A 5I42A 3TABA 2JWLA 3LPUA 3QEWA 4IJNA 4H5TA 1HJRA 3HRGA 4CIFA 4CZHA 2E2PA 3P39A 4BG9A 4YNQA 4CZJA 3CM5A 3ID6A 3G4SN 1RTHA 3SI6A 3SAGA 2KTQA 4M3RA 4KKOA 3AVMA 2QW9A 4CBWA 5M1PA 2KZZA 2W6LA 3FFIA 4K25A 4K43A 3M1FA 1NM1A 4HWIA 1GLBG 2QWMA 3BF1A 4RWTA 2VWJA 3Q7CA 1KD1O 3P1GA 1NOZA 5HROA 4DQIA 4CD3A 4FJMA 4LF9K 3SQ2A 1GLJO 3IRXA 2X74A 2UUAK 5GIPA 1B9DA 1J6ZA 4FWSA 1QZ5A 4KHWA 1ZBSA 4PA1A 4DR1K 5E41A 1D9DA 3TARA 2GUIA 3P31A 4CIGA 5LMNK 4B1UB 2X78A 2OTJN 4HUFA 2R7YA 1YUWA 3C6UA 2NUBA 2BANA 1QVGM 2NRVA 3BP8A 4CEZA 1ATRA 4C8KA 4I6MA 3R8EA 3ZSOA 2FBTA 3FLCO 1YJWN 2QKBA 2DFHA 4X65K 4CJEA 5AQZA 2A5XA 4F3OA 1NGHA 1U47A 1NK5A 3ZSXA 1BA0A 1Z26A 2AP1A 4MQ3A 3VQCA 3AVAA 1K8KB 3MN9A 3KD5E 2YHXA 1XMOK 1HRHA 1RILA 4QOZB 5FRNA 3DLLL 1HKBA 3U8XA 2QWLA 2A6AA 1S1VA 2XY6A 4H0TB 2VGMA 2FBVA 2ATQA 4GY2B 3SV4A 4BWMA 2QKKA 3K5MA 3ULDA 3MN7A 1C0GA 4BGAA 3PX0A 5JLHA 3JYTA 5BN9A 1CLQA 4F9OA 3SBGA 3OYKA 4BRFA 2HHTA 5AQPA 1BWFO 5J1EA 1WUAA 4BRDA 1HJOA 4B1WB 4KO0A 4BC4A 3VQBA 1VSIA 4BDZA 3NVMA 3WEEB 1KFDA 1MDUB 3CERA 4OKKA 1U6ZA 4JD2A 3VOVA 1VHXA 4B3OA 4MFBA 3R6MA 2P9LA 4AF1A 4CFDA 1FKOA 1IO2A 3FGUA 1VQNN 4JHDB 4JKGA 1B92A 2GTDA 1OVYA 2E8AA 3DRRA 3SNNA 4DS5A 2HHQA 1IV0A 3H6EA 4NXMK 3VEOA 3TI0A 5LJWA 5GAHP 2G8WA 3HM9A 1JXEA 3DI6A 3WNEA 4IFVA 4DV2K 3U9DA 1WSEA 4BREA 3CF5L 2A3ZA 4G1QA 3M8SA 4B9QA 3AVBA 3PSFA 5I9EB 5CY4A 4F8RA 3LZIA 4H4MA 3V9SA 3V9UA 2OANA 1P90A 2Z1HA 1L3UA 5KPZA 1J5EK 4CZGA 4DUZK 4DTOA 2HHVA 1I3AA 3HSCA 4N56A 4JRPA 4FVMA 4UY8O 1JCEA 2WFBA 1LOTB 3W3DA 3AO4A 1T7PA 4O0JA 4JI3K 4IOCL 2NRTA 2HW3A 1GLLO 3M8RA 3AO2A 1IBKK 4K8XA 1YITN 3EE8A 4IO8A 3FZHA 3ZETB 3MN6A 4DHYA 1U4BA 4PKIA 4FLVA 4B3TK 1H1VA 4EZ9A 4FJ7A 4JS4A 2WBNA 3PUFA 3AA5X 1VRTA 3VN5A 1VAZA 4YFUA 2ZM6K 1OH5A 1GOBA 3DAWA 4KBOA 2WTUA 3TWHA 4FYDA 2DPNA 2ZD1A 3H08A 1BI4A 3HTVA 2E2QA 3CD6N 4FLYA 3AVGA 2YHAA 4LF4K 4E89A 3DM2A 1BIUA 4NCAA 3VMFB 3KLIA 2G8UA 4UQGA 4DU4A 4LC9B 4DFKA 5AQJA 2HHWA 3K5NA 3E9OA 3VQPA 4XH1A 5AQWA 4BRKA 2X6NA 4AHUA 4AHRA 3QERA 4CZMA 5GAGP 3O5BA 4HTUA 4AHCA 1S1TA 5C24A 2PZSA 1C0FA 2QWNA 4JAXA 4BR2A 5IT9O 2P9SA 1C1BA 2HF4A 3WXMB 1TYQB 2O8DA 2RE2A 4MLEA 2KFZA 2YKNA 1RT3A 4Z4GA 1C6VA 2QI2A 3L2VA 3QDKA 2RPIA 2VG5A 4DTSA 1QHAA 3TSUA 3QEPA 4CEEA 1RDCA 4WQ4A 3WXKA 4F4KA 4DR4K 3CFOA 2E2NA 4M3ZA 3HI0A 1OH8A 4DR7K 1NMDA 3O9SA 3T1HK 3DXMB 1S6QA 2VWKA 3D45A 4J2BA 1WSFA 3D2FA 1VSDA 2UXDK 3V6DA 2Z1JA 4CFCA 4JS5A 4BY9C 3P83D 4DSLA 3R3LA 4IDKA 3E9LA 4QS9A 3OYCA 1Q18A 4NCGA 3O80A 3CIPA 4CHZA 4EHTA 5C10A 4C1NI 2CGJA 3SUPA 4DSJA 3O1WA 4KFBA 2H3GX 2UUBK 4H5VA 4E19A 3THYA 2ZJRL 1RCHA 4JI4K 1HYSA 5M1NA 5AZJB 3V81A 3MMVA 4BR4A 1A5XA 3ZSVA 5EVZA 4B3RK 5AQRA 1VK0A 2D0CA 3SMPA 4WFBL 1J5OA 4YOXA 4FVUA 3TR8A 3PLAA 1Y97A 1X9JA 4OKEA 1BA1A 5KPRA 3UIQA 3KHYA 3THWA 4FL9A 1J54A 3MK6A 1W0HA 5JICA 1UWBA 4ZTJA 1RBRA 1VSKA 3CCJN 3QNOA 4OPHA 2FBYA 4Z0UA 3TAMA 4MDAA 3VPZA 3TAPA 3WQTA 3A5NC 3TSQA 1U45A 1SV5A 2RHKA 2YJFA 1S3XA 4CJFA 2OCEA 1WSGA 1JLCA 4CHYA 1HNVA 3QB0A 1X9WA 1LWEA 1GLFO 5HOOA 2RN2A 2OPQA 1LV5A 4LY7A 3RMBA 2E20A 3OHRA 1ESVA 2KHOA 4E7LA 4I2PA 3LP1A 3SUNA 3O9RA 4WQ5C 3VQ7A 3O3GA 4H03B 3DLHA 2DFFA 5F1XA 1EKEA 4HUGA 3V9WA 3OYNA 5GINA 1RT5A 1WAFA 3H3OB 4JK8A 2I7NA 2XHBA 1QS4A 4CVNE 3ZSQA 5EXWA 4DR5K 1WOQA 5AQIA 3CPWM 3FZMA 3K0SA 3OYEA 4FPAA 2QWOA 4MLHA 3FE1A 3HSTB 4BC2A 1N33K 3VQ9A 4IFEA 3NVKA 4N5SA 2QXFA 4WFNL 3I0SA 1GLAG 3C7NB 3AVHA 3K9JA 3CCEN 4R79A 1RBUA 2P9IB 3AY9A 5F0XA 1XNRK 4I7FA 1T3VA 4CEAA 3DRSA 4NLCA 2YJEA 3VTHA 4BRAA 1W97L 2V7ZA 5BN8A 3QEXA 2XRIA 3VETA 3OYHA 4GVEA 3LAKA 2PYJA 3IKMA 1SQKA 2O8BA 5DM6L 2F8TA 4C23A 4ZTFA 5M1QA 4BC3A 1N8RO 3FZLA 3MCPA 3ZX2A 3O6WA 3L4QA 4JI1K 3FR0A 3VEVA 4JD2B 3OYDA 1NK7A 1X3MA 4N41A 3R1XA 4B9SA 4BG8A 2JGUA 4JYAK 1IKVA 2I5JA 3F5TA 2D0BA 1QE1A 3C65A 4C1NK 2ZJPL 1T03A 3WNFA 2Q0RA 3QNNA 5AQKA 3OYJA 3ZT3A 3OYFA 1TKXA 1NU0A 4V19S 2XO7A 4PQUA 2DY4A 1TVRA 4IDHA 5JS1A 4FM0A 4KAZA 4LSNA 4CJ5A 4KV8A 3UKUA 3E01A 3RMCA 4IKFA 4BDPA 5AQGA 5HLFA 4HUEA 1S22A 3TAEA 4H5NA 5E26A 3G6EN 2XY5A 4CHNA 1RBSA 1RBTA 1RDBA 3IG1A 2GUPA 3GG4A 2LSNA 4IO9L 1KLMA 1CZ9A 3QO9A 3W0LA 1KQSM 4A57A 3QEIA 4DTRA 2JWKA 3ATVA 5DM7L 2F9WA 3SMSA 2O4GA 5H1SQ 2HVIA 5ADXH 4HTLA 2P9KA 3LP0A 1I39A 1G15A 3LL3A 4DQSA 4CECA 1JKHA 2IC3A 1K73O 4WF9L 3E9PA 2IVPA 3HP9A 4FJKA 4CD1A 1JCFA 1K6YA 1HPMA 1QQNA 1NGAA 1KAZA 3CCUN 3KIOA 1NK0A 4LFCK 3OJUA 3RRHA 3RMDA 3KWIA 4DMNA 1YAGA 3DRPA 1D9FA 4BRIA 3VTIA 3AVJA 4JKBA 4IG0A 2UXCK 1TL1A 4BRNA 2KLAA 3JXUA 4BR7A 3E1YA 3T3FA 1XHZA 3THXA 5IWAK 4CHQA 1TK8A 2G8KA 1SL1A 4ELUA 1ZBFA 3TU5A 1UAXA 3N4QA 3LWMA 3OTOK 1KTQA 1BO5O 1MWMA 4JI7K 4GNIA 4DV4K 4LFAK 4W5NA 2FC0A 2OZSA 1RFQA 4ICLA 4N47A 1DT9A 4ID1A 3VQEA 1REVA 1WBDA 1U04A 3M8QA 5GIOA 4B08A 3V9ZA 4BC5A 4L8RB 1VQ7N 4RW7A 4BE0A 4B3SK 2O8CB 3DXMA 1HQEA 4JK7A 4OKJA 5EU7A 5FLXO 2ASPA 2CH5A 3MAQA 3OBWA 2P5OA 3V4IA 3TTCA 1CXUA 4BRHA 2P9NA 3CXCM 3AO1A 5JVHL 1ZBLA 3IFRA 3I8DA 3LDOA 4AH9A 1T05A 1TKTA 3JAMO 4DV1K 1Q8IA 2YKMA 3KLEA 1WNSA 1L3TA 3ATUA 2Q31A 2PY5A 1TUUA 4DTXA 3B6PA 3SLCA 3JS6A 4CJ4A 4Q0BA 1V4SA 4DV7K 2IGIA 5AR0A 4FJ5A 1XNQK 4E1NA 3ENHA 5AQMA 3I56N 1IKYA 3DLBA 5AFUH 2IOCA 4CEDA 4CFBA 4BWJA 1QZ6A 2FSKA 4JK9A 2F8SA 3WNGA 4ISGA 1HPZA 5DMRA 2XY7A 3CQXA 3CHWA 4CJKA 4HVJA 1O1WA 4O8KA 1W2BM 2FF6A 1BCMA 3B8AX 4KH4A 2VQFK 3HK2A 2HVHA 4NO7A 3O9TA 1RT6A 3O4WA 2E2OA 4M41A 4FJNA 5CE3A 4O44A 5LY3A 1RBVA 2D0PA 4CERA 1ZBUA 2HBKA 4FSVA 3D2EA 4KHUA 3DMJA 3RSEA 3VF4A 3UE5A 1KVAA 1U2VB 4O5FA 3VF6A 4DV5K 4J2DA 4IFYA 4Z4CA 4NCBA 4IJAA 3O3HA 3L2WA 2WONA 4RTFD 3L0QA 3S3OA 4KREA 3AVNA 4FWQA 4LD0A 1NK9A 1YTAA 3SJJA 5BPMA 2NRHA 4PKHA 4PL8A 1D5AA 1NGGA 4E1MA 3THVA 3CJBA 4R5PA 3RMAA 3UB5A 1U49A 4JI8K 2PYLA 2P1JA 1C0UA 3U3GA 1KVCA 1RDWX 3J81O 4B8CA 5FROA 1ZBIA 2ZGYA 3HM8A 3NAEA 4WE1A 3T1YK 4FZXC 2O8EA 2QWRA 2OPRA 1MA9B 4CF8A 4E1JA 1IH7A 1T44A 1HYVA 3IDHA 5AJ3K 1BQNA 4CF9A 3KLFA 4U7BA 4CZEA 2NZTA 2RKIA 3A5LC 3HVRA 1NNEA 5K14A 3EL2A 3C95A 4JNEA 1ATSA 4DSIA 2E6LA 4BGBA 1E3MA 4DV0K 1LWFA 2HBLA 1EQYA 1W9HA 4M45A 1VSMA 4CZIA 2EX3A 5AQOA 4DTPA 1BL3A 5KGWA 4J8FA 1YT3A 1CZBA 3LP2A 4FJIA 4FJ8A 1X1PA 3AAPA 3T69A 2O8FB 1BGXT 5AZIA 1NGFA 3U4LA 1LAVA 5BRFA 3O9UA 4NB4A 3A2FA 3B6OA 4FWNA 3L2QA 4FJLA 4CBXA 2VG7A 4IXCA 1NJWA 5AQVA 4LH5A 2VQEK 3NHGA 1OH6A 1LCUA 3AVFA 3K58A 1NGJA 3CFRA 3CCSN 2Q3SA 4CZLA 4CJPA 1VQMN 3WQUA 3EZ5A 3CPEA 4CJ7A 4KHYA 4A2AA 2ASOA 4CW7B 5BRHA 1NJXA 3D0PA 1RT2A 2W42A 1NLVA 3ZT4A 1JLBA 3J8AA 4EAHD 1S6PA 5FPMA 2DFEA 4B1YB 3KK3A 3ZETA 4O5BA 2KFNA 4JKGB 3M8PA 4K41A 4RW4A 5AQXA 3ENBA 2P51A 1SKSA 4JKDA 2RF2A 5HRSA 4C8NA 1EX4A 5BR9A 1RT1A 3LANA 4OPAA 3FZKA 3KLGA 4I9LA 3DXKA 5FPDA 2YHWA 4A62A 4M3TA 4B9UA 3HL8A 3U3YA 2P9KB 5AQHA 3MWPA 1FW6A 1EETA 2E6MA 1T6DA 3J80O 5J2MA 1BIZA 4PUOA 3SQ1A 1TK5A 1IKXA 3PIPL 4FZYA 3P5JA 2WOMA 3RVCA 1WSJA 4NLBA 3V1RA 1TL3A 4FLUA 5J2PA 4KTQA 1MWKA 2D1KA 1VSFA 3K9KA 3ITHA 4LH4A 3CG7A 3U9ZA 3GE1A 3H1VX 3K57A 1F21A 3ZSWA 3DYAA 2GELA 3VEXA 5ELZA 4CF0A 3G71N 2HHXA 1N5YA 3KKRA 4B9TA 4DFJA 1X9SA 4FM2A 3SUQA 2HMIA 3S3MA 2ITMA 5J2QA 4BROA 3HOTA 2A40A 1T8EA 3J7YP 2OPPA 4B1VA 2OTLN 3SQ0A 1WN7A 3ZX3A 3BY5A 3I55N 4H4OA 4AHVA 3AVCA 4HHTA 5KI6A 4LF8K 4YDUA 1RNHA 4AILC 1ILYA 2O8CA 2YCHA 3PX6A 4KHQA 1N32K 1S1WA 4IEIA 4IEEA 4CESA 5C42A 3CCLN 1NK6A 2HSTA 1DKGD 2Q97A 1JLGA 4FLTA 2F96A 4ISFA 2ETJA 1XHXA 1LWCA 4DLEA 3NH2A 4JRQA 1NK4A 2NRRA 2E4LA 3EY1A 5C12A 2OPSA 3IS9A 3ULEA 3NF7A 2GV9A 1JJ2M 1NGBA 2Y1JA 3L2UA 3VQ5A 4YY3K 3LP3A 1KSPA 4ELVA 1VQ6N 4YOYA 1NJZA 3CCQN 5AQSA 4BRMA 4OLBA 4BR0A 4YOTA 1VQLN 1MU2A 3QICA 3SZ2A 4JI2K 5BPNA 4GW6A 3T19A 3F2KA 1DGKN 2D4WA 3O08A 4JI0K 1KAXA 3KK7A 4M3YA 3CETA 1IJJA 4PHTX 2W6KA 3QIPA 3ZLJA 4GKKK 4QS7A 1QHTA 1JLAA 5AQTA 1BG3A 1P8ZA 3P4IA 3MN5A 3ALYA 1RT7A 4CJ3A 2A1SA 2QA4N 3KD1E 3ISNC 1BU6O 1YXQA 3AA2A 1X9MA 2Q0UA 3ZSRA 1Q86O 1HMVA 3M6GA 1QQCA 5E84A 1YJ9N 1WSHA 2D0AA 3TTFA 4CGJA 4OX9K 2UYTA 3CC7N 2FBXA 4BR5A 4JN4A 4LSLA 3H45C 1Q9YA 4LF6K 2YNHA 4Z4FA 1XC3A 1SL0A 1NKEA 3C7NA 2G8FA 1WSIA 3TSPA 4U67L 2W41A 4K42A 3HXMA 4BDYA 3MXJA 3UKRB 3LDPA 5F2RA 2I7PA 4YOWA 3H1QA 5C2FA 4FM1A 4A59A 5JVGL 4IZ9A 1JLQA 4CZKA 1QSLA 3OS1A 3RWUA 4W5RA 3PO5A 1SKRA 3MEEA 1CXQA 4DCHA 1A5VA 1X3NA 3KK1A 3SK3A 2Q2RA 3OW2M 5JMVA 3PX4A 4FJHA 4EZ6A 4CHOA 5BR8K 2G8HA 1BI4B 3NF9A 2KW4A 2HBJA 4C8MA 3ZCMA 1HNZK 4ILHA 4BR9A 4OPJA 5LJVA 3GBTA 1VQKN 3OYAA 3ZT2A 1J9AA 4FXDA 1T6CA 4OJRA 1VSLA 5C15A 1XWLA 3CCMN 4FWPA 3L8BA 3WEEA 3EO3A 4CK1A 2P9PA 4AHSA 4E7IA 3P38A 1HQUA 2ASMA 4A5AA 5A2QO 2QWQA 4QAGA 3F73A 1TYQA 3EKUA 5AQLA 4KHNA 1NK8A 2VGNA 1NBWA 1I94K 4KI4A 1IBLK 1KCFA 3MECA 3CCRN 1HYZA 4RW6A 1D8YA 2FLOA 2O4IA 3NF8A 3AA4A 4GKJK 3EN9A 3VEZA 2DTUA 3TANA 3SAHA 1XI1A 4H0OA 3CJ9A 5B8HA 4FZZA 1RTIA 4KTWA 5EY4A 1SL2A 3KK2A 1TKZA 4NXNK 5AQNA 2P9UA 4DQ8A 4BRLA 4KB0A 2YV0X 4IOAL 1VQPN 1XUPO 3HZ6A 3CI5A 1NGCA 5KRTA 2BE2A 4XH5A 4E7JA 5BPLA 4AM6A 2ZWHA 3NMUA 3LM2A 3VQAA 1NGDA 4DB3A 3F9MA 4H0XB 2IDOA 3O9QA 4O4GA 3EKSA 3DOKA 3CMAN 4GMJB 5FDLA 3MEDA 1HUXA 2GEMA 3ZT0A 4CEQA 1M1KO 5GAEP 4H0YB 2YHBA 1KC8O 4RG8A 1WAJA 2QK9A 2P9SB 3J7ZO 1N36K 2HMPA 2W40A 1Q81O 4ELTA 4CHPA 1IG9A 1GOAA 5M1OA 1QSYA 3CFPA 3RR8A 4BVOA 4B9LA 1D4XA 3C6AA 4BRGA 2HNDA 3THWB 3DWLA 3TTDA 3QBWA 5JLFA 1NKBA 4BQZA 2HHSA 1Z05A 1HLUA 4FK4A 3NGYA 3C94A 5TKYA 5EX5A 4KHSA 2NRXA 2D0OA 2VCPA 5CZ2A 4AM7A 3A0IX 3KTQA 3SUOA 3J7AP 1G99A 3VQ4A 3DOLA 4O55A 4DG1A 3O4NA 3DLRA 2KQ2A 1VQ9N 3KJVA 4DU3A 2HF3A 4PY5A 3D6RA 4DTJA 3BEXA 2OA8A 4CBUA 5CHIA 1NKCA 1LAWA 4JI6K 4MO5A 1ASWA 4XIUA 2Q1NA 1TGOA 5FPNA 3MX2A 4B9NA 4CIEA 4JKFA 5AQFA 4CJLA 3SBTA 1FKPA 1BDGA 1V4TA 4AHTA 4DFMA 3OYBA 1C1CA 3LAMA 4A61A 2F4VK 4OVLA 3IMXA 4B1ZA 1B9FA 3OYLA 3H46O 4EP4A 2YNGA 4DF4A 3K59A 4A5BA 4Z4IA 3O4QA 2QXLA 4FWLA 3VQQA 3ZT1A 2B4JA 4Y1CA 3VQ8A 3LDQA 5KQ8A 5HRNA 3HPHA 4CF2A 5AQQA 1C0TA 1JL1A 5M1FA 4DQRA 2BGGA 1RDAA 3AO3A 3QBXA 1WLJA 5HP1A 3LZJA 4IG3A 3THYB 2V52B 1RTDA 5AZIB 1YVNA 1TK0A 3DJCA 4H5WA 3HT3A 1DTQA 3T1AA 3QFUA 3NDKA 2WUSA 1YJNN 4K0KK 2QEXN 4JKAA 1A5WA 2FF3B 2J4RA 4CGIA 5JS2A 3M5RA 1QTMA 2YX6A 3ID8A 3PSIA 1ASVA 2QTDA 3KKSA 5C2DA 1RDDA 4CZFA 1BOTO 3QMLA 1NJYA 3IAYA 3PO4A 4CI6A 1GLEG 4DTMA 2HHHK 3NH1A 4PWDA 2QM1A 3GL1A 4IOXA 4EFHA 3BDPA 3OA9A 4Y1DA 1KXPA 3L3UA 1KVBA 2IAJA 1YHQN 3AO5A 5HRRA 1UA0A 1KRPA 4GV3A 3V1OA 3QLHA 1QQMA 1ZYQA 2BTFA 1Z6RA 2HOEA 5D3GA 4QS8A 4DSEA 1YI2N 3VGMA 3WNHA 2YNFA 4WCEL 2A42A 2NNWA 5MLCQ 4BVPA 3QEVA 3K2PA 2HBMA 4H8KA 1ITGA 3FZFA 4M7YA 4H0VB 4XH4A 4GVMA 3WXJA 1GLCG 1RT4A 2P9LB 3L3VA 3MDQA 3NBPA 2OYQA 1TV6A 3GDQA 3SYZA 1BHLA 4OGCA 4DLGA 3KLHA 1KFSA 3ZX0A 2HB5A 5C25A 1WBBA 3I0RA 3MEGA 2FXUA 3VENA 4CE9A 1L5UA 2B6AA 4DV3K 1WB9A 2E1YA 2G8IA 5HRPA 2O8FA 3TAFA 3ASMA 3TPQA 5LMUK 3O1BA 5HL7L 3HPOA 2UUCK 4W5OA 1ZXOA 4YHHK 4FJXA 2GWJA 2IS3A 2Y1IA 4M3XA 2GWKA 5KRSA 4ID5A 3OY9A 3SQ4A 4B1XB 3VGKA 2F9TA 4IBNA 3FFKB 1CZAN 3LPTA 3KVGA 4X62K 3RR7A 4DR3K 4WFAL 1JL2A 2EWSA 1TKDA 1Y64A 4BE2A 4WYBA 4DTNA 2X6SA 1O13A 4CEOA 3MCAB 4B3MK 1N34K 4FJ9A 2FSNA 1HX1A 4RCHA 3OYGA 2E1ZA 3VEYA 2HNZA 3ZEUB 1NWKA 4RW9A 3C6TA 3AARA 4FK0A 3TAQA 4JI5K 4H5RA 5EOYA 3D2EB 4I9QA 4J2EA 4E7KA 2CGLA 4CF1A 4O8UA 4CGGA 1FXXA 4KI6A 3MXMA 4HCCA 4F2SA 1DEJA 4YORA 4M3WA 4I6MB 5BREA 4DS4A 3EYZA 4C8OA 2P9IA 1E4FT 3HP6A 4FWMA 1R0AA 1RGIA 1S1XA 2P9NB 4M3UA 2PFUA 2CGKA 3WXIA 3L2RA 3V9XA 4BACA 3EEQA 1JCGA 1K8KA 3T7ZA 5HBMA 1EP4A 3G10A 4TSXA 1QVFM 3HJFA 2O8BB 2A1RA 3RSEB 2V51B 1GLDG 4YOUA 3V1QA 4EP5A 3QESA 4JKEA 1Q9XA 4L3QA 1R59O 2IVOA 2YNIA 2Z1IA 1SAZA 5LL6Z 1EXQA 3OJSA 1LW0A 1TAUA 3WUHA 1Q82O 3THXB 2F7TA 4NYFA 3G0ZA 3OYIA 3LM9A 3HVTA 1JLFA 3LDLA 3D2FB 5KGXA 3SCXA 2NRZA 3C6HA 1NG9A 1HKGA 2BDPA 3VQDA 4XEIA 4BE1A 1YIJN 4FLWA 3DXKB 1SUQA 1Z25A 3CCVN 3U6FA 5DK5A 2FSJA 4PL7A 4W5TA 4BRCA 1BISA 3K5OA 4KPYA 1EWQA 1S72N 3PV8A 2IIRA 3AVKA 3S9HA 4IWVA 2IVNA 5GADP 2O8DB 5CYQA 2JLEA 4CJUA 4H0PA 3F9KA 2OZMA 4KHPK 4DQQA 3O8MA 3NH0A 4E3SA 1VSJA 5SWMA 2HHUA 1ASUA 3CQ8A 2PAVA 3AV9A 1BQMA 1HNWK 3JSMA 3D7EO 3H3NO 4FCYA 2AJQA 3NE6A 3WT0A 1GOCA 4CEBA 2CH6A 3EZWA 5KPTA 5AQYA 3MX5A 2Q36A 4RW8A 4ILJA 5CZ1A 1NGIA 4JLHA 5KQDA 5KTQA 2QWPA 4ILGB
chains in the Genus database with same CATH topology
3JAMO 4DR1K 5A2QO 4NXMK 5AJ3K 4DV1K 4DR7K 4CVNE 4JI0K 5LMNK 4JV5K 4DR5K 3T1HK 1FJGK 4GKKK 1I94K 1IBLK 4JI6K 2UXDK 4DV2K 1N33K 4GKJK 4AQYK 4DV6K 4LF5K 4DV7K 4DV0K 1XNQK 2F4VK 1J5EK 1XNRK 4X65K 4DUZK 4OX9K 4NXNK 5LL6Z 2UUBK 2E5LK 4LF7K 1HNXK 4LF6K 4LFCK 4JI4K 3J7YP 1XMQK 1IBMK 4JI3K 2VQFK 1XMOK 1IBKK 4DV3K 2VQEK 2UXCK 4B3TK 4LF8K 4B3RK 2UXBK 5LMUK 4DUYK 2UUCK 5IWAK 4JI1K 1N32K 4YHHK 1HR0K 2ZM6K 4CW7B 4DV5K 3OTOK 4LF4K 4K0KK 4JI7K 4JYAK 4DV4K 4X62K 4LFAK 1N36K 4DR3K 4X64K 4KHPK 4V19S 5BR8K 4B3SK 4LFBK 4YY3K 4B3MK 2UU9K 1N34K 1HNWK 5FLXO 5IT9O 1HNZK 4X66K 2HHHK 4JI8K 4JI5K 4LF9K 3J80O 4DR2K 4DR6K 3J81O 2UUAK 3T1YK 3J7AP 4JI2K 4DR4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM O;  4DR1 K;  5A2Q O;  4NXM K;  5AJ3 K;  4DV1 K;  4DR7 K;  4CVN E;  4JI0 K;  5LMN K;  4JV5 K;  4DR5 K;  3T1H K;  1FJG K;  4GKK K;  1I94 K;  1IBL K;  4JI6 K;  2UXD K;  4DV2 K;  1N33 K;  4GKJ K;  4AQY K;  4DV6 K;  4LF5 K;  4DV7 K;  4DV0 K;  1XNQ K;  2F4V K;  1J5E K;  1XNR K;  4X65 K;  4DUZ K;  4OX9 K;  4NXN K;  5LL6 Z;  2UUB K;  2E5L K;  4LF7 K;  1HNX K;  4LF6 K;  4LFC K;  4JI4 K;  3J7Y P;  1XMQ K;  1IBM K;  4JI3 K;  2VQF K;  1XMO K;  1IBK K;  4DV3 K;  2VQE K;  2UXC K;  4B3T K;  4LF8 K;  4B3R K;  2UXB K;  5LMU K;  4DUY K;  2UUC K;  5IWA K;  4JI1 K;  1N32 K;  4YHH K;  1HR0 K;  2ZM6 K;  4CW7 B;  4DV5 K;  3OTO K;  4LF4 K;  4K0K K;  4JI7 K;  4JYA K;  4DV4 K;  4X62 K;  4LFA K;  1N36 K;  4DR3 K;  4X64 K;  4KHP K;  4V19 S;  5BR8 K;  4B3S K;  4LFB K;  4YY3 K;  4B3M K;  2UU9 K;  1N34 K;  1HNW K;  5FLX O;  5IT9 O;  1HNZ K;  4X66 K;  2HHH K;  4JI8 K;  4JI5 K;  4LF9 K;  3J80 O;  4DR2 K;  4DR6 K;  3J81 O;  2UUA K;  3T1Y K;  3J7A P;  4JI2 K;  4DR4 K; 
#chains in the Genus database with same CATH topology
 3AVI A;  1M90 O;  4B9M A;  1XC9 A;  2ZF5 O;  3CME N;  4FWR A;  3HO1 A;  1ZC6 A;  2ZQB A;  3M3Z A;  4FK2 A;  1KAY A;  2GBZ A;  1TUY A;  2NLX A;  1OVQ A;  1OH7 A;  5C0Y A;  2B5J A;  5AZJ A;  5ADX A;  4FLX A;  3L6Q A;  1ZBH A;  3ZYY X;  3ZSZ A;  4CJT A;  3AA3 A;  5TKW A;  4YDU C;  1YF5 L;  4JEP A;  1S1U A;  4K8Z A;  3HOS A;  3CM6 A;  3CQY A;  3SAF A;  1BCO A;  1VSH A;  1BUP A;  4FO0 A;  4DF8 A;  3ULE B;  4OO1 J;  4FWK A;  4CJV A;  1NGE A;  3S41 A;  2UXB K;  4FJJ A;  4EIA A;  1J53 A;  4KRF A;  3LWL A;  3CYM A;  4Z94 A;  4PKG A;  3AVL A;  2BH1 A;  4G9Z A;  1NJI O;  1JXB A;  3SJH A;  1YTU A;  3CJC A;  3I8B A;  2EHG A;  4CFA A;  2E88 A;  1EWR A;  4WQ5 A;  3BZK A;  4KH6 A;  4X64 K;  4KH5 A;  5BRD A;  3NF6 A;  3BF3 A;  3R9P A;  3NGZ A;  1QQO A;  1VQ5 N;  1EO1 A;  3RTV A;  4CJR A;  3DLG A;  5FRM A;  4LFB K;  3SPY A;  3HPG A;  2UU9 K;  3A8Y A;  4CJW A;  4BQL A;  2ZE2 A;  2D5R A;  4F3T A;  1SKW A;  2GX9 A;  4X66 K;  3SPZ A;  2KKZ A;  3MXI A;  4I2Q A;  5J2N A;  1S9E A;  3VA3 A;  4JKC A;  3SV3 A;  3NFA A;  4DR6 K;  4FW1 A;  4M63 C;  3CC4 N;  3QFP A;  4FWO A;  3L4I A;  1VQ8 N;  3Q7B A;  3VA0 A;  4FOE A;  4WQ4 C;  4Y0W A;  4CK2 A;  4Z4E A;  4JV5 K;  1TAQ A;  4BRP A;  3G25 A;  3AGR A;  1XQS C;  1FJG K;  3AGK A;  4OGE A;  4B8A B;  3VF2 A;  2P9P B;  3HYF A;  1N6Q A;  4LF5 K;  3A5O C;  4DWI A;  5FPE A;  1NOY A;  3CJA A;  1VQO N;  1HKC A;  4J2A A;  4JHD A;  3N4P A;  4E7H A;  1U48 A;  4FOI A;  3OYM A;  4DSK A;  3QIN A;  5I3U A;  4ZHR A;  4LF7 K;  3CJ1 A;  5AFU A;  4Z4H A;  1IKW A;  3VQ6 A;  4OPK A;  5M1K A;  5SZT A;  1IBM K;  3VES A;  3LDN A;  1W7A A;  4E0D A;  4O0I A;  3EE9 A;  4MDB A;  1HNI A;  2VG6 A;  4M42 A;  4NYN A;  3ENO A;  4B9V A;  2PBD A;  3LDS A;  1DLO A;  4DKW A;  2A41 A;  1C1A A;  4ISE A;  1HR0 K;  1KLN A;  3VGL A;  3ZEU A;  4CGF A;  2ZGZ A;  4KB1 A;  3BUZ B;  3GOI A;  3IUC A;  1RDU A;  4W5Q A;  4HCB A;  5CYM A;  3UKU B;  4N76 A;  3CC2 N;  4CJQ A;  1NMN A;  3A5M C;  1C0M A;  3DLK A;  3HBT A;  3OS2 A;  2KZM A;  5CR4 A;  4JKH A;  3VER A;  4YOV A;  3KZB A;  3BGR A;  4QCL A;  3NCI A;  2HNY A;  3LAL A;  3CJ7 A;  4A2B A;  3AAQ A;  2VWB A;  3OBY A;  1FK9 A;  4CGD A;  4DR2 K;  1S9G A;  1QSS A;  3NGI A;  1K9M O;  4MO4 A;  4BRQ A;  3E66 A;  2P5G A;  1E4G T;  1RTJ A;  1ATN A;  4DSF A;  2G8V A;  1YVU A;  4FLZ A;  2P9U B;  1SS6 A;  1VRU A;  3C0B A;  4DTU A;  2YI1 A;  4OLA A;  3S3N A;  1IG8 A;  3TAG A;  3KWG A;  3UKR A;  4CK3 A;  3O3F A;  3OS0 A;  1UOC A;  4AQY K;  4CJS A;  3PIO L;  4DV6 K;  4C8L A;  4FPB A;  1K8A O;  2ITG A;  4KTZ A;  3PY8 A;  2YHY A;  2WC9 A;  3BZC A;  3OVN A;  4DQP A;  4F2R A;  2VYP A;  1L3S A;  5AQU A;  1L3V A;  1Q7Y O;  3VEW A;  4Q5V A;  1U2V A;  3RRG A;  4EHU A;  4FJG A;  2AA4 A;  1S5J A;  2BUP A;  1VSE A;  1LW2 A;  2O8E B;  2E5L K;  1HNX K;  4CCH A;  3ZSY A;  1XMQ K;  3QIO A;  2XY8 A;  1UA1 A;  1SZ2 A;  2V7Y A;  4GV6 A;  4DUY K;  2NRW A;  1JLE A;  3MWT A;  1DTT A;  2Z1G A;  3DLE A;  3I33 A;  3WXL A;  4GV9 A;  4CGH A;  3K5L A;  4M7X A;  1VQ4 N;  4DU1 A;  1OKJ A;  5T7B A;  2ZJQ L;  4CEF A;  3QET A;  4DFP A;  4FW2 A;  5I42 A;  3TAB A;  2JWL A;  3LPU A;  3QEW A;  4IJN A;  4H5T A;  1HJR A;  3HRG A;  4CIF A;  4CZH A;  2E2P A;  3P39 A;  4BG9 A;  4YNQ A;  4CZJ A;  3CM5 A;  3ID6 A;  3G4S N;  1RTH A;  3SI6 A;  3SAG A;  2KTQ A;  4M3R A;  4KKO A;  3AVM A;  2QW9 A;  4CBW A;  5M1P A;  2KZZ A;  2W6L A;  3FFI A;  4K25 A;  4K43 A;  3M1F A;  1NM1 A;  4HWI A;  1GLB G;  2QWM A;  3BF1 A;  4RWT A;  2VWJ A;  3Q7C A;  1KD1 O;  3P1G A;  1NOZ A;  5HRO A;  4DQI A;  4CD3 A;  4FJM A;  4LF9 K;  3SQ2 A;  1GLJ O;  3IRX A;  2X74 A;  2UUA K;  5GIP A;  1B9D A;  1J6Z A;  4FWS A;  1QZ5 A;  4KHW A;  1ZBS A;  4PA1 A;  4DR1 K;  5E41 A;  1D9D A;  3TAR A;  2GUI A;  3P31 A;  4CIG A;  5LMN K;  4B1U B;  2X78 A;  2OTJ N;  4HUF A;  2R7Y A;  1YUW A;  3C6U A;  2NUB A;  2BAN A;  1QVG M;  2NRV A;  3BP8 A;  4CEZ A;  1ATR A;  4C8K A;  4I6M A;  3R8E A;  3ZSO A;  2FBT A;  3FLC O;  1YJW N;  2QKB A;  2DFH A;  4X65 K;  4CJE A;  5AQZ A;  2A5X A;  4F3O A;  1NGH A;  1U47 A;  1NK5 A;  3ZSX A;  1BA0 A;  1Z26 A;  2AP1 A;  4MQ3 A;  3VQC A;  3AVA A;  1K8K B;  3MN9 A;  3KD5 E;  2YHX A;  1XMO K;  1HRH A;  1RIL A;  4QOZ B;  5FRN A;  3DLL L;  1HKB A;  3U8X A;  2QWL A;  2A6A A;  1S1V A;  2XY6 A;  4H0T B;  2VGM A;  2FBV A;  2ATQ A;  4GY2 B;  3SV4 A;  4BWM A;  2QKK A;  3K5M A;  3ULD A;  3MN7 A;  1C0G A;  4BGA A;  3PX0 A;  5JLH A;  3JYT A;  5BN9 A;  1CLQ A;  4F9O A;  3SBG A;  3OYK A;  4BRF A;  2HHT A;  5AQP A;  1BWF O;  5J1E A;  1WUA A;  4BRD A;  1HJO A;  4B1W B;  4KO0 A;  4BC4 A;  3VQB A;  1VSI A;  4BDZ A;  3NVM A;  3WEE B;  1KFD A;  1MDU B;  3CER A;  4OKK A;  1U6Z A;  4JD2 A;  3VOV A;  1VHX A;  4B3O A;  4MFB A;  3R6M A;  2P9L A;  4AF1 A;  4CFD A;  1FKO A;  1IO2 A;  3FGU A;  1VQN N;  4JHD B;  4JKG A;  1B92 A;  2GTD A;  1OVY A;  2E8A A;  3DRR A;  3SNN A;  4DS5 A;  2HHQ A;  1IV0 A;  3H6E A;  4NXM K;  3VEO A;  3TI0 A;  5LJW A;  5GAH P;  2G8W A;  3HM9 A;  1JXE A;  3DI6 A;  3WNE A;  4IFV A;  4DV2 K;  3U9D A;  1WSE A;  4BRE A;  3CF5 L;  2A3Z A;  4G1Q A;  3M8S A;  4B9Q A;  3AVB A;  3PSF A;  5I9E B;  5CY4 A;  4F8R A;  3LZI A;  4H4M A;  3V9S A;  3V9U A;  2OAN A;  1P90 A;  2Z1H A;  1L3U A;  5KPZ A;  1J5E K;  4CZG A;  4DUZ K;  4DTO A;  2HHV A;  1I3A A;  3HSC A;  4N56 A;  4JRP A;  4FVM A;  4UY8 O;  1JCE A;  2WFB A;  1LOT B;  3W3D A;  3AO4 A;  1T7P A;  4O0J A;  4JI3 K;  4IOC L;  2NRT A;  2HW3 A;  1GLL O;  3M8R A;  3AO2 A;  1IBK K;  4K8X A;  1YIT N;  3EE8 A;  4IO8 A;  3FZH A;  3ZET B;  3MN6 A;  4DHY A;  1U4B A;  4PKI A;  4FLV A;  4B3T K;  1H1V A;  4EZ9 A;  4FJ7 A;  4JS4 A;  2WBN A;  3PUF A;  3AA5 X;  1VRT A;  3VN5 A;  1VAZ A;  4YFU A;  2ZM6 K;  1OH5 A;  1GOB A;  3DAW A;  4KBO A;  2WTU A;  3TWH A;  4FYD A;  2DPN A;  2ZD1 A;  3H08 A;  1BI4 A;  3HTV A;  2E2Q A;  3CD6 N;  4FLY A;  3AVG A;  2YHA A;  4LF4 K;  4E89 A;  3DM2 A;  1BIU A;  4NCA A;  3VMF B;  3KLI A;  2G8U A;  4UQG A;  4DU4 A;  4LC9 B;  4DFK A;  5AQJ A;  2HHW A;  3K5N A;  3E9O A;  3VQP A;  4XH1 A;  5AQW A;  4BRK A;  2X6N A;  4AHU A;  4AHR A;  3QER A;  4CZM A;  5GAG P;  3O5B A;  4HTU A;  4AHC A;  1S1T A;  5C24 A;  2PZS A;  1C0F A;  2QWN A;  4JAX A;  4BR2 A;  5IT9 O;  2P9S A;  1C1B A;  2HF4 A;  3WXM B;  1TYQ B;  2O8D A;  2RE2 A;  4MLE A;  2KFZ A;  2YKN A;  1RT3 A;  4Z4G A;  1C6V A;  2QI2 A;  3L2V A;  3QDK A;  2RPI A;  2VG5 A;  4DTS A;  1QHA A;  3TSU A;  3QEP A;  4CEE A;  1RDC A;  4WQ4 A;  3WXK A;  4F4K A;  4DR4 K;  3CFO A;  2E2N A;  4M3Z A;  3HI0 A;  1OH8 A;  4DR7 K;  1NMD A;  3O9S A;  3T1H K;  3DXM B;  1S6Q A;  2VWK A;  3D45 A;  4J2B A;  1WSF A;  3D2F A;  1VSD A;  2UXD K;  3V6D A;  2Z1J A;  4CFC A;  4JS5 A;  4BY9 C;  3P83 D;  4DSL A;  3R3L A;  4IDK A;  3E9L A;  4QS9 A;  3OYC A;  1Q18 A;  4NCG A;  3O80 A;  3CIP A;  4CHZ A;  4EHT A;  5C10 A;  4C1N I;  2CGJ A;  3SUP A;  4DSJ A;  3O1W A;  4KFB A;  2H3G X;  2UUB K;  4H5V A;  4E19 A;  3THY A;  2ZJR L;  1RCH A;  4JI4 K;  1HYS A;  5M1N A;  5AZJ B;  3V81 A;  3MMV A;  4BR4 A;  1A5X A;  3ZSV A;  5EVZ A;  4B3R K;  5AQR A;  1VK0 A;  2D0C A;  3SMP A;  4WFB L;  1J5O A;  4YOX A;  4FVU A;  3TR8 A;  3PLA A;  1Y97 A;  1X9J A;  4OKE A;  1BA1 A;  5KPR A;  3UIQ A;  3KHY A;  3THW A;  4FL9 A;  1J54 A;  3MK6 A;  1W0H A;  5JIC A;  1UWB A;  4ZTJ A;  1RBR A;  1VSK A;  3CCJ N;  3QNO A;  4OPH A;  2FBY A;  4Z0U A;  3TAM A;  4MDA A;  3VPZ A;  3TAP A;  3WQT A;  3A5N C;  3TSQ A;  1U45 A;  1SV5 A;  2RHK A;  2YJF A;  1S3X A;  4CJF A;  2OCE A;  1WSG A;  1JLC A;  4CHY A;  1HNV A;  3QB0 A;  1X9W A;  1LWE A;  1GLF O;  5HOO A;  2RN2 A;  2OPQ A;  1LV5 A;  4LY7 A;  3RMB A;  2E20 A;  3OHR A;  1ESV A;  2KHO A;  4E7L A;  4I2P A;  3LP1 A;  3SUN A;  3O9R A;  4WQ5 C;  3VQ7 A;  3O3G A;  4H03 B;  3DLH A;  2DFF A;  5F1X A;  1EKE A;  4HUG A;  3V9W A;  3OYN A;  5GIN A;  1RT5 A;  1WAF A;  3H3O B;  4JK8 A;  2I7N A;  2XHB A;  1QS4 A;  4CVN E;  3ZSQ A;  5EXW A;  4DR5 K;  1WOQ A;  5AQI A;  3CPW M;  3FZM A;  3K0S A;  3OYE A;  4FPA A;  2QWO A;  4MLH A;  3FE1 A;  3HST B;  4BC2 A;  1N33 K;  3VQ9 A;  4IFE A;  3NVK A;  4N5S A;  2QXF A;  4WFN L;  3I0S A;  1GLA G;  3C7N B;  3AVH A;  3K9J A;  3CCE N;  4R79 A;  1RBU A;  2P9I B;  3AY9 A;  5F0X A;  1XNR K;  4I7F A;  1T3V A;  4CEA A;  3DRS A;  4NLC A;  2YJE A;  3VTH A;  4BRA A;  1W97 L;  2V7Z A;  5BN8 A;  3QEX A;  2XRI A;  3VET A;  3OYH A;  4GVE A;  3LAK A;  2PYJ A;  3IKM A;  1SQK A;  2O8B A;  5DM6 L;  2F8T A;  4C23 A;  4ZTF A;  5M1Q A;  4BC3 A;  1N8R O;  3FZL A;  3MCP A;  3ZX2 A;  3O6W A;  3L4Q A;  4JI1 K;  3FR0 A;  3VEV A;  4JD2 B;  3OYD A;  1NK7 A;  1X3M A;  4N41 A;  3R1X A;  4B9S A;  4BG8 A;  2JGU A;  4JYA K;  1IKV A;  2I5J A;  3F5T A;  2D0B A;  1QE1 A;  3C65 A;  4C1N K;  2ZJP L;  1T03 A;  3WNF A;  2Q0R A;  3QNN A;  5AQK A;  3OYJ A;  3ZT3 A;  3OYF A;  1TKX A;  1NU0 A;  4V19 S;  2XO7 A;  4PQU A;  2DY4 A;  1TVR A;  4IDH A;  5JS1 A;  4FM0 A;  4KAZ A;  4LSN A;  4CJ5 A;  4KV8 A;  3UKU A;  3E01 A;  3RMC A;  4IKF A;  4BDP A;  5AQG A;  5HLF A;  4HUE A;  1S22 A;  3TAE A;  4H5N A;  5E26 A;  3G6E N;  2XY5 A;  4CHN A;  1RBS A;  1RBT A;  1RDB A;  3IG1 A;  2GUP A;  3GG4 A;  2LSN A;  4IO9 L;  1KLM A;  1CZ9 A;  3QO9 A;  3W0L A;  1KQS M;  4A57 A;  3QEI A;  4DTR A;  2JWK A;  3ATV A;  5DM7 L;  2F9W A;  3SMS A;  2O4G A;  5H1S Q;  2HVI A;  5ADX H;  4HTL A;  2P9K A;  3LP0 A;  1I39 A;  1G15 A;  3LL3 A;  4DQS A;  4CEC A;  1JKH A;  2IC3 A;  1K73 O;  4WF9 L;  3E9P A;  2IVP A;  3HP9 A;  4FJK A;  4CD1 A;  1JCF A;  1K6Y A;  1HPM A;  1QQN A;  1NGA A;  1KAZ A;  3CCU N;  3KIO A;  1NK0 A;  4LFC K;  3OJU A;  3RRH A;  3RMD A;  3KWI A;  4DMN A;  1YAG A;  3DRP A;  1D9F A;  4BRI A;  3VTI A;  3AVJ A;  4JKB A;  4IG0 A;  2UXC K;  1TL1 A;  4BRN A;  2KLA A;  3JXU A;  4BR7 A;  3E1Y A;  3T3F A;  1XHZ A;  3THX A;  5IWA K;  4CHQ A;  1TK8 A;  2G8K A;  1SL1 A;  4ELU A;  1ZBF A;  3TU5 A;  1UAX A;  3N4Q A;  3LWM A;  3OTO K;  1KTQ A;  1BO5 O;  1MWM A;  4JI7 K;  4GNI A;  4DV4 K;  4LFA K;  4W5N A;  2FC0 A;  2OZS A;  1RFQ A;  4ICL A;  4N47 A;  1DT9 A;  4ID1 A;  3VQE A;  1REV A;  1WBD A;  1U04 A;  3M8Q A;  5GIO A;  4B08 A;  3V9Z A;  4BC5 A;  4L8R B;  1VQ7 N;  4RW7 A;  4BE0 A;  4B3S K;  2O8C B;  3DXM A;  1HQE A;  4JK7 A;  4OKJ A;  5EU7 A;  5FLX O;  2ASP A;  2CH5 A;  3MAQ A;  3OBW A;  2P5O A;  3V4I A;  3TTC A;  1CXU A;  4BRH A;  2P9N A;  3CXC M;  3AO1 A;  5JVH L;  1ZBL A;  3IFR A;  3I8D A;  3LDO A;  4AH9 A;  1T05 A;  1TKT A;  3JAM O;  4DV1 K;  1Q8I A;  2YKM A;  3KLE A;  1WNS A;  1L3T A;  3ATU A;  2Q31 A;  2PY5 A;  1TUU A;  4DTX A;  3B6P A;  3SLC A;  3JS6 A;  4CJ4 A;  4Q0B A;  1V4S A;  4DV7 K;  2IGI A;  5AR0 A;  4FJ5 A;  1XNQ K;  4E1N A;  3ENH A;  5AQM A;  3I56 N;  1IKY A;  3DLB A;  5AFU H;  2IOC A;  4CED A;  4CFB A;  4BWJ A;  1QZ6 A;  2FSK A;  4JK9 A;  2F8S A;  3WNG A;  4ISG A;  1HPZ A;  5DMR A;  2XY7 A;  3CQX A;  3CHW A;  4CJK A;  4HVJ A;  1O1W A;  4O8K A;  1W2B M;  2FF6 A;  1BCM A;  3B8A X;  4KH4 A;  2VQF K;  3HK2 A;  2HVH A;  4NO7 A;  3O9T A;  1RT6 A;  3O4W A;  2E2O A;  4M41 A;  4FJN A;  5CE3 A;  4O44 A;  5LY3 A;  1RBV A;  2D0P A;  4CER A;  1ZBU A;  2HBK A;  4FSV A;  3D2E A;  4KHU A;  3DMJ A;  3RSE A;  3VF4 A;  3UE5 A;  1KVA A;  1U2V B;  4O5F A;  3VF6 A;  4DV5 K;  4J2D A;  4IFY A;  4Z4C A;  4NCB A;  4IJA A;  3O3H A;  3L2W A;  2WON A;  4RTF D;  3L0Q A;  3S3O A;  4KRE A;  3AVN A;  4FWQ A;  4LD0 A;  1NK9 A;  1YTA A;  3SJJ A;  5BPM A;  2NRH A;  4PKH A;  4PL8 A;  1D5A A;  1NGG A;  4E1M A;  3THV A;  3CJB A;  4R5P A;  3RMA A;  3UB5 A;  1U49 A;  4JI8 K;  2PYL A;  2P1J A;  1C0U A;  3U3G A;  1KVC A;  1RDW X;  3J81 O;  4B8C A;  5FRO A;  1ZBI A;  2ZGY A;  3HM8 A;  3NAE A;  4WE1 A;  3T1Y K;  4FZX C;  2O8E A;  2QWR A;  2OPR A;  1MA9 B;  4CF8 A;  4E1J A;  1IH7 A;  1T44 A;  1HYV A;  3IDH A;  5AJ3 K;  1BQN A;  4CF9 A;  3KLF A;  4U7B A;  4CZE A;  2NZT A;  2RKI A;  3A5L C;  3HVR A;  1NNE A;  5K14 A;  3EL2 A;  3C95 A;  4JNE A;  1ATS A;  4DSI A;  2E6L A;  4BGB A;  1E3M A;  4DV0 K;  1LWF A;  2HBL A;  1EQY A;  1W9H A;  4M45 A;  1VSM A;  4CZI A;  2EX3 A;  5AQO A;  4DTP A;  1BL3 A;  5KGW A;  4J8F A;  1YT3 A;  1CZB A;  3LP2 A;  4FJI A;  4FJ8 A;  1X1P A;  3AAP A;  3T69 A;  2O8F B;  1BGX T;  5AZI A;  1NGF A;  3U4L A;  1LAV A;  5BRF A;  3O9U A;  4NB4 A;  3A2F A;  3B6O A;  4FWN A;  3L2Q A;  4FJL A;  4CBX A;  2VG7 A;  4IXC A;  1NJW A;  5AQV A;  4LH5 A;  2VQE K;  3NHG A;  1OH6 A;  1LCU A;  3AVF A;  3K58 A;  1NGJ A;  3CFR A;  3CCS N;  2Q3S A;  4CZL A;  4CJP A;  1VQM N;  3WQU A;  3EZ5 A;  3CPE A;  4CJ7 A;  4KHY A;  4A2A A;  2ASO A;  4CW7 B;  5BRH A;  1NJX A;  3D0P A;  1RT2 A;  2W42 A;  1NLV A;  3ZT4 A;  1JLB A;  3J8A A;  4EAH D;  1S6P A;  5FPM A;  2DFE A;  4B1Y B;  3KK3 A;  3ZET A;  4O5B A;  2KFN A;  4JKG B;  3M8P A;  4K41 A;  4RW4 A;  5AQX A;  3ENB A;  2P51 A;  1SKS A;  4JKD A;  2RF2 A;  5HRS A;  4C8N A;  1EX4 A;  5BR9 A;  1RT1 A;  3LAN A;  4OPA A;  3FZK A;  3KLG A;  4I9L A;  3DXK A;  5FPD A;  2YHW A;  4A62 A;  4M3T A;  4B9U A;  3HL8 A;  3U3Y A;  2P9K B;  5AQH A;  3MWP A;  1FW6 A;  1EET A;  2E6M A;  1T6D A;  3J80 O;  5J2M A;  1BIZ A;  4PUO A;  3SQ1 A;  1TK5 A;  1IKX A;  3PIP L;  4FZY A;  3P5J A;  2WOM A;  3RVC A;  1WSJ A;  4NLB A;  3V1R A;  1TL3 A;  4FLU A;  5J2P A;  4KTQ A;  1MWK A;  2D1K A;  1VSF A;  3K9K A;  3ITH A;  4LH4 A;  3CG7 A;  3U9Z A;  3GE1 A;  3H1V X;  3K57 A;  1F21 A;  3ZSW A;  3DYA A;  2GEL A;  3VEX A;  5ELZ A;  4CF0 A;  3G71 N;  2HHX A;  1N5Y A;  3KKR A;  4B9T A;  4DFJ A;  1X9S A;  4FM2 A;  3SUQ A;  2HMI A;  3S3M A;  2ITM A;  5J2Q A;  4BRO A;  3HOT A;  2A40 A;  1T8E A;  3J7Y P;  2OPP A;  4B1V A;  2OTL N;  3SQ0 A;  1WN7 A;  3ZX3 A;  3BY5 A;  3I55 N;  4H4O A;  4AHV A;  3AVC A;  4HHT A;  5KI6 A;  4LF8 K;  4YDU A;  1RNH A;  4AIL C;  1ILY A;  2O8C A;  2YCH A;  3PX6 A;  4KHQ A;  1N32 K;  1S1W A;  4IEI A;  4IEE A;  4CES A;  5C42 A;  3CCL N;  1NK6 A;  2HST A;  1DKG D;  2Q97 A;  1JLG A;  4FLT A;  2F96 A;  4ISF A;  2ETJ A;  1XHX A;  1LWC A;  4DLE A;  3NH2 A;  4JRQ A;  1NK4 A;  2NRR A;  2E4L A;  3EY1 A;  5C12 A;  2OPS A;  3IS9 A;  3ULE A;  3NF7 A;  2GV9 A;  1JJ2 M;  1NGB A;  2Y1J A;  3L2U A;  3VQ5 A;  4YY3 K;  3LP3 A;  1KSP A;  4ELV A;  1VQ6 N;  4YOY A;  1NJZ A;  3CCQ N;  5AQS A;  4BRM A;  4OLB A;  4BR0 A;  4YOT A;  1VQL N;  1MU2 A;  3QIC A;  3SZ2 A;  4JI2 K;  5BPN A;  4GW6 A;  3T19 A;  3F2K A;  1DGK N;  2D4W A;  3O08 A;  4JI0 K;  1KAX A;  3KK7 A;  4M3Y A;  3CET A;  1IJJ A;  4PHT X;  2W6K A;  3QIP A;  3ZLJ A;  4GKK K;  4QS7 A;  1QHT A;  1JLA A;  5AQT A;  1BG3 A;  1P8Z A;  3P4I A;  3MN5 A;  3ALY A;  1RT7 A;  4CJ3 A;  2A1S A;  2QA4 N;  3KD1 E;  3ISN C;  1BU6 O;  1YXQ A;  3AA2 A;  1X9M A;  2Q0U A;  3ZSR A;  1Q86 O;  1HMV A;  3M6G A;  1QQC A;  5E84 A;  1YJ9 N;  1WSH A;  2D0A A;  3TTF A;  4CGJ A;  4OX9 K;  2UYT A;  3CC7 N;  2FBX A;  4BR5 A;  4JN4 A;  4LSL A;  3H45 C;  1Q9Y A;  4LF6 K;  2YNH A;  4Z4F A;  1XC3 A;  1SL0 A;  1NKE A;  3C7N A;  2G8F A;  1WSI A;  3TSP A;  4U67 L;  2W41 A;  4K42 A;  3HXM A;  4BDY A;  3MXJ A;  3UKR B;  3LDP A;  5F2R A;  2I7P A;  4YOW A;  3H1Q A;  5C2F A;  4FM1 A;  4A59 A;  5JVG L;  4IZ9 A;  1JLQ A;  4CZK A;  1QSL A;  3OS1 A;  3RWU A;  4W5R A;  3PO5 A;  1SKR A;  3MEE A;  1CXQ A;  4DCH A;  1A5V A;  1X3N A;  3KK1 A;  3SK3 A;  2Q2R A;  3OW2 M;  5JMV A;  3PX4 A;  4FJH A;  4EZ6 A;  4CHO A;  5BR8 K;  2G8H A;  1BI4 B;  3NF9 A;  2KW4 A;  2HBJ A;  4C8M A;  3ZCM A;  1HNZ K;  4ILH A;  4BR9 A;  4OPJ A;  5LJV A;  3GBT A;  1VQK N;  3OYA A;  3ZT2 A;  1J9A A;  4FXD A;  1T6C A;  4OJR A;  1VSL A;  5C15 A;  1XWL A;  3CCM N;  4FWP A;  3L8B A;  3WEE A;  3EO3 A;  4CK1 A;  2P9P A;  4AHS A;  4E7I A;  3P38 A;  1HQU A;  2ASM A;  4A5A A;  5A2Q O;  2QWQ A;  4QAG A;  3F73 A;  1TYQ A;  3EKU A;  5AQL A;  4KHN A;  1NK8 A;  2VGN A;  1NBW A;  1I94 K;  4KI4 A;  1IBL K;  1KCF A;  3MEC A;  3CCR N;  1HYZ A;  4RW6 A;  1D8Y A;  2FLO A;  2O4I A;  3NF8 A;  3AA4 A;  4GKJ K;  3EN9 A;  3VEZ A;  2DTU A;  3TAN A;  3SAH A;  1XI1 A;  4H0O A;  3CJ9 A;  5B8H A;  4FZZ A;  1RTI A;  4KTW A;  5EY4 A;  1SL2 A;  3KK2 A;  1TKZ A;  4NXN K;  5AQN A;  2P9U A;  4DQ8 A;  4BRL A;  4KB0 A;  2YV0 X;  4IOA L;  1VQP N;  1XUP O;  3HZ6 A;  3CI5 A;  1NGC A;  5KRT A;  2BE2 A;  4XH5 A;  4E7J A;  5BPL A;  4AM6 A;  2ZWH A;  3NMU A;  3LM2 A;  3VQA A;  1NGD A;  4DB3 A;  3F9M A;  4H0X B;  2IDO A;  3O9Q A;  4O4G A;  3EKS A;  3DOK A;  3CMA N;  4GMJ B;  5FDL A;  3MED A;  1HUX A;  2GEM A;  3ZT0 A;  4CEQ A;  1M1K O;  5GAE P;  4H0Y B;  2YHB A;  1KC8 O;  4RG8 A;  1WAJ A;  2QK9 A;  2P9S B;  3J7Z O;  1N36 K;  2HMP A;  2W40 A;  1Q81 O;  4ELT A;  4CHP A;  1IG9 A;  1GOA A;  5M1O A;  1QSY A;  3CFP A;  3RR8 A;  4BVO A;  4B9L A;  1D4X A;  3C6A A;  4BRG A;  2HND A;  3THW B;  3DWL A;  3TTD A;  3QBW A;  5JLF A;  1NKB A;  4BQZ A;  2HHS A;  1Z05 A;  1HLU A;  4FK4 A;  3NGY A;  3C94 A;  5TKY A;  5EX5 A;  4KHS A;  2NRX A;  2D0O A;  2VCP A;  5CZ2 A;  4AM7 A;  3A0I X;  3KTQ A;  3SUO A;  3J7A P;  1G99 A;  3VQ4 A;  3DOL A;  4O55 A;  4DG1 A;  3O4N A;  3DLR A;  2KQ2 A;  1VQ9 N;  3KJV A;  4DU3 A;  2HF3 A;  4PY5 A;  3D6R A;  4DTJ A;  3BEX A;  2OA8 A;  4CBU A;  5CHI A;  1NKC A;  1LAW A;  4JI6 K;  4MO5 A;  1ASW A;  4XIU A;  2Q1N A;  1TGO A;  5FPN A;  3MX2 A;  4B9N A;  4CIE A;  4JKF A;  5AQF A;  4CJL A;  3SBT A;  1FKP A;  1BDG A;  1V4T A;  4AHT A;  4DFM A;  3OYB A;  1C1C A;  3LAM A;  4A61 A;  2F4V K;  4OVL A;  3IMX A;  4B1Z A;  1B9F A;  3OYL A;  3H46 O;  4EP4 A;  2YNG A;  4DF4 A;  3K59 A;  4A5B A;  4Z4I A;  3O4Q A;  2QXL A;  4FWL A;  3VQQ A;  3ZT1 A;  2B4J A;  4Y1C A;  3VQ8 A;  3LDQ A;  5KQ8 A;  5HRN A;  3HPH A;  4CF2 A;  5AQQ A;  1C0T A;  1JL1 A;  5M1F A;  4DQR A;  2BGG A;  1RDA A;  3AO3 A;  3QBX A;  1WLJ A;  5HP1 A;  3LZJ A;  4IG3 A;  3THY B;  2V52 B;  1RTD A;  5AZI B;  1YVN A;  1TK0 A;  3DJC A;  4H5W A;  3HT3 A;  1DTQ A;  3T1A A;  3QFU A;  3NDK A;  2WUS A;  1YJN N;  4K0K K;  2QEX N;  4JKA A;  1A5W A;  2FF3 B;  2J4R A;  4CGI A;  5JS2 A;  3M5R A;  1QTM A;  2YX6 A;  3ID8 A;  3PSI A;  1ASV A;  2QTD A;  3KKS A;  5C2D A;  1RDD A;  4CZF A;  1BOT O;  3QML A;  1NJY A;  3IAY A;  3PO4 A;  4CI6 A;  1GLE G;  4DTM A;  2HHH K;  3NH1 A;  4PWD A;  2QM1 A;  3GL1 A;  4IOX A;  4EFH A;  3BDP A;  3OA9 A;  4Y1D A;  1KXP A;  3L3U A;  1KVB A;  2IAJ A;  1YHQ N;  3AO5 A;  5HRR A;  1UA0 A;  1KRP A;  4GV3 A;  3V1O A;  3QLH A;  1QQM A;  1ZYQ A;  2BTF A;  1Z6R A;  2HOE A;  5D3G A;  4QS8 A;  4DSE A;  1YI2 N;  3VGM A;  3WNH A;  2YNF A;  4WCE L;  2A42 A;  2NNW A;  5MLC Q;  4BVP A;  3QEV A;  3K2P A;  2HBM A;  4H8K A;  1ITG A;  3FZF A;  4M7Y A;  4H0V B;  4XH4 A;  4GVM A;  3WXJ A;  1GLC G;  1RT4 A;  2P9L B;  3L3V A;  3MDQ A;  3NBP A;  2OYQ A;  1TV6 A;  3GDQ A;  3SYZ A;  1BHL A;  4OGC A;  4DLG A;  3KLH A;  1KFS A;  3ZX0 A;  2HB5 A;  5C25 A;  1WBB A;  3I0R A;  3MEG A;  2FXU A;  3VEN A;  4CE9 A;  1L5U A;  2B6A A;  4DV3 K;  1WB9 A;  2E1Y A;  2G8I A;  5HRP A;  2O8F A;  3TAF A;  3ASM A;  3TPQ A;  5LMU K;  3O1B A;  5HL7 L;  3HPO A;  2UUC K;  4W5O A;  1ZXO A;  4YHH K;  4FJX A;  2GWJ A;  2IS3 A;  2Y1I A;  4M3X A;  2GWK A;  5KRS A;  4ID5 A;  3OY9 A;  3SQ4 A;  4B1X B;  3VGK A;  2F9T A;  4IBN A;  3FFK B;  1CZA N;  3LPT A;  3KVG A;  4X62 K;  3RR7 A;  4DR3 K;  4WFA L;  1JL2 A;  2EWS A;  1TKD A;  1Y64 A;  4BE2 A;  4WYB A;  4DTN A;  2X6S A;  1O13 A;  4CEO A;  3MCA B;  4B3M K;  1N34 K;  4FJ9 A;  2FSN A;  1HX1 A;  4RCH A;  3OYG A;  2E1Z A;  3VEY A;  2HNZ A;  3ZEU B;  1NWK A;  4RW9 A;  3C6T A;  3AAR A;  4FK0 A;  3TAQ A;  4JI5 K;  4H5R A;  5EOY A;  3D2E B;  4I9Q A;  4J2E A;  4E7K A;  2CGL A;  4CF1 A;  4O8U A;  4CGG A;  1FXX A;  4KI6 A;  3MXM A;  4HCC A;  4F2S A;  1DEJ A;  4YOR A;  4M3W A;  4I6M B;  5BRE A;  4DS4 A;  3EYZ A;  4C8O A;  2P9I A;  1E4F T;  3HP6 A;  4FWM A;  1R0A A;  1RGI A;  1S1X A;  2P9N B;  4M3U A;  2PFU A;  2CGK A;  3WXI A;  3L2R A;  3V9X A;  4BAC A;  3EEQ A;  1JCG A;  1K8K A;  3T7Z A;  5HBM A;  1EP4 A;  3G10 A;  4TSX A;  1QVF M;  3HJF A;  2O8B B;  2A1R A;  3RSE B;  2V51 B;  1GLD G;  4YOU A;  3V1Q A;  4EP5 A;  3QES A;  4JKE A;  1Q9X A;  4L3Q A;  1R59 O;  2IVO A;  2YNI A;  2Z1I A;  1SAZ A;  5LL6 Z;  1EXQ A;  3OJS A;  1LW0 A;  1TAU A;  3WUH A;  1Q82 O;  3THX B;  2F7T A;  4NYF A;  3G0Z A;  3OYI A;  3LM9 A;  3HVT A;  1JLF A;  3LDL A;  3D2F B;  5KGX A;  3SCX A;  2NRZ A;  3C6H A;  1NG9 A;  1HKG A;  2BDP A;  3VQD A;  4XEI A;  4BE1 A;  1YIJ N;  4FLW A;  3DXK B;  1SUQ A;  1Z25 A;  3CCV N;  3U6F A;  5DK5 A;  2FSJ A;  4PL7 A;  4W5T A;  4BRC A;  1BIS A;  3K5O A;  4KPY A;  1EWQ A;  1S72 N;  3PV8 A;  2IIR A;  3AVK A;  3S9H A;  4IWV A;  2IVN A;  5GAD P;  2O8D B;  5CYQ A;  2JLE A;  4CJU A;  4H0P A;  3F9K A;  2OZM A;  4KHP K;  4DQQ A;  3O8M A;  3NH0 A;  4E3S A;  1VSJ A;  5SWM A;  2HHU A;  1ASU A;  3CQ8 A;  2PAV A;  3AV9 A;  1BQM A;  1HNW K;  3JSM A;  3D7E O;  3H3N O;  4FCY A;  2AJQ A;  3NE6 A;  3WT0 A;  1GOC A;  4CEB A;  2CH6 A;  3EZW A;  5KPT A;  5AQY A;  3MX5 A;  2Q36 A;  4RW8 A;  4ILJ A;  5CZ1 A;  1NGI A;  4JLH A;  5KQD A;  5KTQ A;  2QWP A;  4ILG B; 
#chains in the Genus database with same CATH homology
 3JAM O;  4DR1 K;  5A2Q O;  4NXM K;  5AJ3 K;  4DV1 K;  4DR7 K;  4CVN E;  4JI0 K;  5LMN K;  4JV5 K;  4DR5 K;  3T1H K;  1FJG K;  4GKK K;  1I94 K;  1IBL K;  4JI6 K;  2UXD K;  4DV2 K;  1N33 K;  4GKJ K;  4AQY K;  4DV6 K;  4LF5 K;  4DV7 K;  4DV0 K;  1XNQ K;  2F4V K;  1J5E K;  1XNR K;  4X65 K;  4DUZ K;  4OX9 K;  4NXN K;  5LL6 Z;  2UUB K;  2E5L K;  4LF7 K;  1HNX K;  4LF6 K;  4LFC K;  4JI4 K;  3J7Y P;  1XMQ K;  1IBM K;  4JI3 K;  2VQF K;  1XMO K;  1IBK K;  4DV3 K;  2VQE K;  2UXC K;  4B3T K;  4LF8 K;  4B3R K;  2UXB K;  5LMU K;  4DUY K;  2UUC K;  5IWA K;  4JI1 K;  1N32 K;  4YHH K;  1HR0 K;  2ZM6 K;  4CW7 B;  4DV5 K;  3OTO K;  4LF4 K;  4K0K K;  4JI7 K;  4JYA K;  4DV4 K;  4X62 K;  4LFA K;  1N36 K;  4DR3 K;  4X64 K;  4KHP K;  4V19 S;  5BR8 K;  4B3S K;  4LFB K;  4YY3 K;  4B3M K;  2UU9 K;  1N34 K;  1HNW K;  5FLX O;  5IT9 O;  1HNZ K;  4X66 K;  2HHH K;  4JI8 K;  4JI5 K;  4LF9 K;  3J80 O;  4DR2 K;  4DR6 K;  3J81 O;  2UUA K;  3T1Y K;  3J7A P;  4JI2 K;  4DR4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...