2E5LK

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2e5lK00
3T1HK 5LL6Z 1HNZK 1IBLK 4LF8K 4K0KK 3J7YP 4V19S 2UU9K 1IBMK 4LF6K 1HNXK 4LFAK 4JV5K 1N33K 2UUCK 5AJ3K 2UXBK 3JAMO 2VQFK 4DR1K 4DV0K 4B3TK 4DV4K 4JI4K 4YY3K 2VQEK 4DR4K 2UXDK 4DUZK 2UXCK 4YHHK 3J80O 4LF9K 4GKJK 4LFBK 4DV3K 4DR6K 3J81O 3T1YK 4X66K 1XNRK 1IBKK 2F4VK 4DR3K 4JI3K 5LMNK 4LF4K 4JI5K 4NXMK 4X64K 4NXNK 4LFCK 1J5EK 4B3SK 4JI7K 5BR8K 4JI1K 1XNQK 2E5LK 4DUYK 4DR2K 4JI0K 5LMUK 4B3RK 4DV6K 4GKKK 4DV7K 4DV1K 1FJGK 2ZM6K 4JYAK 4DR7K 1HR0K 1N34K 4KHPK 4X62K 1I94K 2HHHK 5A2QO 4JI2K 4CVNE 4JI6K 4DV2K 2UUAK 4DV5K 1N36K 5FLXO 3OTOK 4JI8K 4AQYK 2UUBK 4X65K 5IWAK 1HNWK 4OX9K 4DR5K 4B3MK 4LF5K 1XMOK 1N32K 4CW7B 1XMQK 3J7AP 4LF7K 5IT9O
chains in the Genus database with same CATH superfamily
2KFNA 5MLCQ 3CFPA 1J6ZA 3S41A 5HBMA 3RSEB 3ZX0A 4CEZA 5KQDA 3AY9A 4Y0WA 5LY3A 4B9LA 3BGRA 2YCHA 2UU9K 3LP0A 2YKMA 4N41A 4IOXA 1BUPA 3RWUA 3VEZA 4FJ9A 2EX3A 1N33K 1NNEA 3NF8A 4I2PA 3THWB 2QEXN 5KI6A 1VRUA 2GX9A 5AR0A 2KZZA 3OS1A 5E84A 4DU1A 3V9XA 1DLOA 4Y1DA 4KHSA 3HK2A 3ULDA 4H0OA 3QDKA 1TUUA 1BIZA 1NK8A 1YTUA 1EETA 2P9LB 4KTZA 4CBUA 1ZBSA 3NF9A 4U67L 4CGJA 4FJLA 4HCBA 1ZXOA 4M3YA 3H6EA 3OYEA 1GLFO 3DLRA 4I9LA 4A62A 4IFVA 4G1QA 4WFBL 3TTDA 4M3ZA 3MDQA 3HOSA 3ITHA 2QM1A 4BR0A 1LV5A 4C8MA 3DRSA 3PO5A 2D0BA 4CJWA 3NFAA 2FSKA 1UA1A 1FJGK 2F9WA 1ASWA 4FWKA 5C25A 1JL1A 3AVGA 1NGHA 1BA1A 4A5BA 3MWPA 1HR0K 5C10A 1EXQA 4B9NA 4PQUA 4DTUA 4CJKA 2E2PA 2D0PA 4BE1A 5ADXH 4CJQA 2HOEA 2J4RA 4JK9A 4JI6K 3KTQA 5AQNA 4BR4A 4WQ5C 3R3LA 1N36K 3TAEA 3MEEA 3NVMA 1BI4B 1X9JA 4RW7A 3SCXA 5BN9A 2IVOA 4DSIA 3WT0A 4E1JA 1HNWK 3TSQA 3R8EA 2YJEA 4CIFA 5BPLA 4JKEA 1SQKA 1T05A 2FF6A 4CGDA 4C8LA 4OO1J 4LF7K 5AQWA 2QWRA 1OH6A 4E7IA 5JLHA 1Z26A 4CGHA 3QESA 1GLDG 3LP2A 3I0SA 5SWMA 1X9MA 3EEQA 2YKNA 3HTVA 4DTRA 1HNXK 1T44A 4LFAK 3O8MA 3OYFA 3ZETB 2UXBK 4FWOA 4KHYA 3OBWA 4OLBA 3CJAA 4DTOA 4BACA 4KV8A 4JI4K 3CCVN 3MCAB 2P51A 1IKXA 1BGXT 3B6PA 3ZT3A 3NBPA 4H0PA 1DEJA 4W5QA 3B8AX 1ITGA 3SAHA 1VHXA 5M1QA 4PHTX 3SPYA 2RPIA 3CC2N 1S6QA 3HRGA 2ASOA 5HROA 4ZTJA 4KH6A 3SUOA 4G9ZA 2BE2A 5AQKA 5E26A 3TSUA 2YJFA 3K58A 3TAQA 3LM2A 3OVNA 5HRSA 5BN8A 4CK3A 1J9AA 1JLAA 4EZ9A 1NGDA 4DWIA 3OJSA 5HL7L 4FK0A 3MN9A 3AVNA 3FE1A 3VF2A 3ZX3A 3TPQA 4PL7A 3OYNA 1SS6A 1C1AA 2Q0RA 4FJ7A 3LP1A 3WXJA 1HQUA 4YNQA 3V1OA 4BGBA 3ISNC 3THXB 3SAGA 2ETJA 4NLCA 4YOWA 4FLXA 1NK7A 3LL3A 1EO1A 2FF3B 4CFAA 1EKEA 4PWDA 3DOKA 1HKCA 1NGAA 4JD2B 3QETA 4ISGA 4KI4A 4KH5A 4BE2A 4CZIA 3PSIA 1BOTO 4ELTA 1N8RO 3VF4A 4OX9K 1B92A 3PV8A 1NM1A 4CW7B 1TKDA 5AFUH 3NHGA 3J7AP 4DB3A 4CJRA 2O8BA 1GOBA 1L3UA 3CCQN 2FLOA 1VSEA 1KQSM 3J7YP 1REVA 1GLAG 3VTHA 3L8BA 3O4QA 5BRDA 3Q7BA 2GUIA 3WXLA 4E19A 3IKMA 4AHTA 4FWMA 2WUSA 1I3AA 1VSJA 3THYB 3SJHA 2NUBA 2XY8A 3ATVA 4DR4K 1D9DA 2HNDA 2GWKA 3CYMA 2ATQA 1CZBA 2O8CA 3KJVA 4DTPA 2A40A 4BRKA 2HF4A 1U04A 2IC3A 5AQXA 1JLGA 3QLHA 4YORA 4DR3K 4JI3K 4O55A 3ZSQA 2BH1A 2HHVA 1WSGA 2GTDA 3O3GA 4F3OA 4BRFA 2HHTA 4OKKA 3DRRA 1K73O 1ZBLA 1J5EK 1E3MA 3NCIA 2HBJA 1XNQK 4IXCA 3AAQA 1YTAA 1Y97A 4ILHA 3T69A 2QKBA 4JNEA 1U6ZA 5AQRA 4IBNA 5AZIB 3VQ8A 4WCEL 4EP4A 4E7HA 1Q7YO 1QQNA 3AVJA 1RTIA 4AHVA 3OYJA 2IDOA 4CBXA 3S3NA 4W5RA 1SL1A 4DTJA 3NH1A 5JVGL 5DK5A 2OZSA 1OKJA 5AQIA 2FBTA 1NGJA 4CVNE 3UKUA 1HYZA 5F2RA 1RTDA 2BDPA 1M90O 3VQQA 4RW6A 1KAYA 1VSHA 2AP1A 3E01A 2FBYA 2ZD1A 2KZMA 3A5LC 4X65K 4GV9A 3PSFA 4K43A 1P8ZA 2O8BB 5AQUA 1NGGA 3EY1A 3RMDA 2WBNA 4FL9A 3AO3A 3C7NA 3LAKA 5I9EB 1HNZK 3AVLA 3LZJA 1WNSA 2P9KA 4BC5A 5SZTA 4FWRA 3TABA 3VGLA 2HW3A 4LF6K 3QICA 2DPNA 5HRNA 3ID6A 2OPPA 2X6NA 3SAFA 3CCEN 2VQFK 4DQPA 2HNYA 2QW9A 4WYBA 4HVJA 3DLHA 4YY3K 2XHBA 4IWVA 4M3UA 4OPJA 4BWMA 4IDHA 3AARA 1LAVA 3J80O 4JKGA 5JLFA 2OCEA 3AA3A 2NLXA 1DTTA 3O9QA 3HVTA 5AQSA 1HRHA 4BROA 4LSNA 1UA0A 4MO4A 1IBKK 4N56A 5KGWA 2D1KA 3NGZA 3TARA 3KWGA 2OTLN 1JCEA 1YF5L 5BR8K 3KLHA 1HMVA 1YXQA 5J2PA 4CZHA 4FVUA 5GIOA 5CZ1A 1X1PA 2ZGZA 3HO1A 1Y64A 1T8EA 4FJMA 3J7ZO 4CJ3A 3ZT0A 3BUZB 4RWTA 3LDPA 5EOYA 2QA4N 1U2VA 2QWPA 3KK2A 3RMBA 3VF6A 4Q5VA 3UKUB 3Q7CA 2CGKA 3MCPA 3O9RA 4NCAA 3VA0A 5JS2A 4M3XA 3SMSA 5AZJA 5TKYA 1A5VA 1C0FA 1OH8A 2F96A 2YHYA 3UKRA 5CY4A 3OW2M 1MWMA 3JS6A 2X74A 3UE5A 4B3MK 1C1BA 3WXMB 1D8YA 3NVKA 2OA8A 4B1WB 1VRTA 1LOTB 3SUNA 3P39A 2O8DA 3P38A 1QSSA 2P9KB 1IJJA 4YOXA 4KB0A 1K8KA 1YJWN 2FBVA 2PYLA 2OPQA 5AFUA 2HSTA 3MN5A 1RTHA 4I9QA 3DXMB 3RRGA 3LZIA 3L3UA 3KLFA 2P9SB 3NF7A 1TK0A 3HXMA 4JKGB 1VQ7N 4B9TA 4E3SA 2Z1GA 4DSLA 3CJ7A 3I8BA 4RW8A 4W5NA 3SV4A 2P1JA 3OYIA 4DSKA 1S72N 3ZSVA 4Z4HA 4FJJA 3M3ZA 1KLMA 3IS9A 4CJVA 1RDAA 3RSEA 4BRHA 3D6RA 2FBXA 2VWKA 3S9HA 3E9LA 3F9MA 1RBSA 4O44A 3WNFA 4AHUA 3NMUA 4JI5K 2ZJRL 4H5TA 1ATSA 4CESA 1O13A 3RVCA 4BREA 3THWA 3AO1A 4MLEA 2W6LA 4AILC 4EZ6A 3GDQA 1NJWA 4OVLA 4IKFA 1Q81O 4ILGB 3O4NA 3THVA 2P9LA 1U2VB 1WB9A 5C2FA 2QTDA 5DM7L 5EX5A 1RT6A 3O6WA 4PL8A 2NZTA 4DQRA 4O4GA 3DM2A 1WSIA 2A41A 4B9UA 5C42A 4ID5A 1FKOA 4RW9A 3ID8A 3VQCA 1WSEA 5LJWA 4A59A 3BZKA 4JKDA 1LCUA 1WSFA 4DV2K 3DRPA 4AM7A 3LWLA 3CF5L 1SV5A 3PO4A 1Z6RA 2A42A 2G8FA 4YDUA 2A5XA 4BRPA 3VEOA 3V1RA 3OYCA 4FLTA 4JK8A 4PUOA 4A2BA 4DMNA 5GINA 3WUHA 4K25A 1VQ6N 3KIOA 1QZ6A 3LPTA 3FZMA 4K8ZA 4AHCA 1VQ5N 1Z25A 1P90A 4E7JA 3L2QA 1NK9A 4JEPA 4YOYA 2EHGA 1RBUA 2E6LA 4FJHA 2RHKA 4ZHRA 4FVMA 1BO5O 4CJFA 1TKZA 2PY5A 3AV9A 4H0YB 3BDPA 4BR5A 3TWHA 5GAHP 1R59O 2E20A 3KKRA 4DFJA 1O1WA 4CZLA 2GWJA 3EO3A 3J8AA 3K57A 2FC0A 4A5AA 4BC2A 4NLBA 1JXBA 3LDNA 3SNNA 1HNVA 3E1YA 4OLAA 1A5XA 4HUFA 3PLAA 4BDYA 2UXCK 4FM0A 2NRWA 1Q9XA 3A0IX 1OH5A 4CF8A 3GG4A 1DT9A 3TR8A 4BQLA 4CJUA 4DFKA 3NH2A 3HPOA 1RT4A 3MX5A 2YHWA 4FWLA 3ENBA 2ITMA 3U3GA 1YJ9N 4OPKA 3SPZA 4BRCA 3QFPA 1TYQB 1BCOA 4NXMK 3ZSWA 1BA0A 3K59A 2Q2RA 3FFKB 4IZ9A 3ZETA 3TU5A 4BC3A 4M41A 4E7LA 4DLEA 3KD1E 1C0MA 3ULEB 4C8OA 3OYBA 1CZAN 4BRIA 3V1QA 3AA4A 1ESVA 3EKSA 3EKUA 1NBWA 3A5MC 3P4IA 1NK6A 1Q18A 3I33A 4HWIA 3CCLN 1RT7A 4OGEA 2Q36A 3ZSXA 4L8RB 1TL1A 4M3WA 3SQ0A 3MN7A 3VGKA 1NK5A 1NK0A 3PY8A 4KHUA 2B6AA 1RTJA 1DGKN 1S1TA 1FW6A 3V81A 4JI2K 3OY9A 3HSCA 2V7ZA 2X78A 2QKKA 5KGXA 4JLHA 2OTJN 4DV5K 3G10A 3L3VA 4J2AA 3MK6A 3DLLL 2JWKA 4I6MB 3EZWA 4CHYA 1IO2A 1EWQA 3C95A 5IWAK 3FZKA 5AQMA 3CJ1A 4QCLA 1QQMA 2Q0UA 3P1GA 4EHUA 3DAWA 5H1SQ 5DM6L 4EFHA 4IJNA 3VTIA 1YVUA 4CF2A 5IT9O 4LF8K 2HBLA 3O80A 4HTUA 1N5YA 4BR2A 3THXA 3ATUA 1C0UA 3ZYYX 3MECA 3HT3A 4CZGA 3CCSN 1S1VA 1S1XA 1WLJA 1T7PA 4FLYA 3FR0A 4FCYA 3B6OA 4JD2A 3CQ8A 3QEPA 4B3TK 1BG3A 4JKHA 4BRNA 1QVGM 1QSLA 2IOCA 5KRTA 3D2EA 2UXDK 4ELUA 1NJYA 3KWIA 4DTSA 1TGOA 3K9KA 3NF6A 3WQTA 5CHIA 3BF3A 4E89A 1WBDA 3ENHA 4UY8O 3AVBA 3DJCA 3R1XA 2RF2A 4FJXA 4DS5A 1TAUA 3K5LA 5F0XA 4CF9A 2F4VK 1WUAA 2E4LA 2NRHA 2E1YA 2A6AA 3AVIA 4X64K 3EZ5A 4C8KA 3CETA 2HHUA 4IG0A 4CEQA 1W7AA 5BREA 3THYA 1VQMN 1HLUA 1T3VA 4JI1K 4FWNA 4WQ4A 3CMAN 5LMUK 3V6DA 4DV6K 3TAPA 1VSMA 1T03A 4F2SA 3H45C 2QWNA 1RCHA 4FW1A 2YHBA 1FK9A 2GV9A 3WXKA 3P31A 4HUGA 5FRMA 3TAFA 2HMIA 3MN6A 3TANA 1KVAA 2JLEA 4IEEA 4KHPK 3H3NO 4BVOA 2I7PA 3TSPA 1S5JA 4KO0A 3L2RA 3M1FA 3CC7N 1S6PA 2E2NA 1OVYA 2WOMA 4DU3A 1VQPN 3AA2A 5AZIA 4DSEA 2KFZA 1K6YA 4EAHD 4H0VB 1RDDA 3C6UA 4DCHA 3P83D 4Z4IA 4FSVA 4MQ3A 1NOZA 5T7BA 1RBTA 3ASMA 3ZCMA 3VQ4A 4MO5A 4KHQA 5I3UA 4CEAA 1RT1A 4CEDA 3IUCA 4YFUA 4FZZA 4OKJA 3D2EB 1XHZA 2P9NB 2W42A 3CXCM 2JGUA 1BQMA 1HKGA 5C0YA 2VQEK 4J8FA 2D0AA 4YHHK 4A61A 2DTUA 4CJ5A 3DLBA 3V9WA 2JWLA 3DI6A 2P5OA 1BHLA 1VSIA 1X3NA 1I39A 2YNFA 4EP5A 3C94A 4ILJA 3FGUA 1EP4A 1RDCA 3V4IA 4BVPA 4JK7A 3LDSA 4MDAA 3LANA 4NCBA 4H0XB 2NNWA 5BPNA 1Q86O 2H3GX 4CI6A 3C6TA 4MLHA 3QEVA 2QWOA 1RDWX 4KTQA 3R9PA 1NJXA 4B9SA 4B9MA 3S3MA 2VCPA 3BP8A 3VETA 4WF9L 3N4QA 5HRPA 4DU4A 2E8AA 1KVCA 3VGMA 4B8AB 4PA1A 3OYHA 3AVAA 4FJ8A 4PKHA 5A2QO 5C24A 2G8WA 2D0OA 1L3SA 3DWLA 1SL2A 4NCGA 3CPEA 4RG8A 3L4IA 2D5RA 1NGBA 3VMFB 4JI8K 3U6FA 4KHNA 2Q3SA 1QTMA 4K8XA 3KD5E 1SZ2A 4DR5K 5GADP 4QS8A 1BWFO 4W5TA 2DFFA 2HNZA 3WXIA 5FPEA 3W0LA 2F7TA 5AQYA 3AO4A 4CF1A 3PX6A 4NYFA 4FLVA 1HJOA 2V51B 2IVNA 5ADXA 3SJJA 1KSPA 4M3RA 3VQAA 4F8RA 3AVHA 3GL1A 1Q82O 1T6CA 2B4JA 3DXKB 4DV0K 2V7YA 1SL0A 4EIAA 4IFYA 3BZCA 4H03B 1YT3A 4CK2A 4CHQA 3JSMA 4FM2A 4LF9K 3CIPA 4FWSA 4JS4A 3SZ2A 4H5VA 4QAGA 5KPRA 4BRAA 2XY7A 3SMPA 3HJFA 1E4FT 2CGLA 5KRSA 4AM6A 3PIPL 5GAEP 3SUPA 5K14A 4ICLA 3QMLA 3DXMA 5F1XA 2P9SA 2ZGYA 5J1EA 4B3SK 2P5GA 2F8SA 3PX4A 1SKWA 4C8NA 4WQ5A 3F9KA 3RMAA 4H0TB 1VQ8N 3MEDA 4DF8A 3RR8A 3VEVA 4Q0BA 3CCUN 1VQNN 1C0TA 3CC4N 4DV1K 4Z4EA 2ZM6K 4LD0A 1GLBG 4KHWA 3S3OA 3I55N 4CK1A 2CH6A 3M8QA 3OA9A 2VWJA 5JS1A 4Z94A 4F4KA 5AQQA 3N4PA 3L0QA 3QFUA 3ZSYA 2HB5A 1SUQA 1JKHA 3I56N 1Q8IA 4B1XB 4FYDA 2P9IB 2O8EA 4JKFA 1HPMA 3LDOA 3P5JA 4AHRA 4R79A 5CYQA 1ATNA 1VSDA 3KVGA 5HOOA 4FLZA 5LL6Z 1GLLO 3M8SA 1IBLK 2YX6A 3E9OA 1NGEA 5KQ8A 3MWTA 3O08A 4M7XA 1NG9A 1LAWA 4V19S 4L3QA 3BEXA 3CCMN 4GV3A 3CPWM 3AGKA 1JCGA 4CGFA 3HYFA 3LDLA 2Y1JA 4DUZK 1D4XA 3AVCA 2EWSA 4CZKA 4BRLA 1S9EA 2RN2A 1KFDA 2DY4A 3J81O 4FLUA 4TSXA 2Q1NA 4CE9A 3T1YK 3ZT4A 2QK9A 2WTUA 3SI6A 4BRDA 3O3HA 2D0CA 1RILA 2I5JA 3QBWA 4H5WA 4XEIA 1KAZA 1Z05A 3H08A 1UOCA 4FJ5A 3A5OC 3LM9A 2B5JA 3UIQA 4M7YA 4C1NK 4CBWA 1MA9B 3K5NA 1JLBA 3AVMA 2YHAA 4Z0UA 4GNIA 2VGNA 1HPZA 3O5BA 4JN4A 4BE0A 1QZ5A 2VG6A 4K41A 5AQOA 1I94K 1TYQA 5BRFA 1EX4A 2BANA 2HHSA 1NGCA 3EYZA 1RBVA 3D7EO 3O9TA 3MXJA 2QXLA 3VEWA 4DQIA 2O8FB 1YI2N 1S9GA 4CECA 3ULEA 1BISA 2O8EB 1UAXA 4CEEA 3F5TA 1CLQA 3RTVA 3O1WA 3K2PA 3R6MA 2RKIA 5CZ2A 1XMOK 2PBDA 1QE1A 3CM6A 3UB5A 4FLWA 3ZX2A 1XMQK 2XY6A 2ZWHA 1K8AO 3CFRA 5J2MA 3WEEB 2E2OA 5J2QA 1JCFA 2VG7A 3AAPA 3CFOA 3EE8A 2IGIA 4O0IA 1V4TA 1LW0A 4DSFA 1NJZA 3E66A 4FJNA 4J2EA 2UUCK 4AF1A 1XHXA 4Y1CA 4DS4A 1YIJN 4I6MA 3KK3A 4FJIA 2A1SA 2OANA 1JLCA 1MDUB 1ZBUA 1KAXA 1S22A 1BL3A 4GKJK 2QWMA 1SAZA 4MDBA 4DR6K 3C0BA 2HVIA 3DYAA 1KTQA 4BRGA 3SBTA 3CJBA 4CJLA 1XNRK 3HI0A 4BR7A 4C23A 3NDKA 1OVQA 3O9SA 3ZSOA 4LF4K 4O8KA 3QEWA 4DFPA 4LFCK 2FSJA 2W41A 1HNIA 2YNGA 4GVMA 1X9SA 1XQSC 4XIUA 4A57A 4CHPA 3SQ2A 1U49A 4FO0A 2G8HA 3HP6A 4BG9A 1KFSA 3KK7A 3TTFA 4HCCA 2DFEA 3C65A 3WQUA 2KTQA 1X3MA 2IIRA 2OPRA 3VOVA 5I42A 1XC9A 5EXWA 2YI1A 4A2AA 1YHQN 1NU0A 4CD1A 1UWBA 3D45A 4CHOA 4GW6A 4KAZA 1JLFA 2LSNA 1L3TA 3HPHA 3L4QA 3H46O 1RT5A 5CR4A 3OYDA 4X62K 3MAQA 3M6GA 1GOCA 2QWQA 3L6QA 4KH4A 1GLJO 3LPUA 4CJTA 1KCFA 5M1OA 4ID1A 3TAGA 2QI2A 5JMVA 1MU2A 5BRHA 1IV0A 5E41A 3FLCO 4AQYK 4I7FA 3KHYA 3I0RA 1HQEA 3RMCA 1TVRA 3KLGA 1VQ9N 1MWKA 1DKGD 3T1HK 5AQFA 3SYZA 1M1KO 3HZ6A 3KZBA 4K0KK 3A5NC 2YNHA 4JRPA 4FWQA 1ZC6A 4RCHA 4FJKA 2VGMA 3IFRA 3T3FA 5AJ3K 1WAFA 1C0GA 3C6AA 3JAMO 3HVRA 3V9UA 1RBRA 4M3TA 4FWPA 3NH0A 3NGYA 3LP3A 1JLEA 4B08A 3MXIA 2NRVA 3CM5A 2WONA 4FXDA 5AQPA 5CE3A 3TI0A 3OYKA 3QERA 3LALA 4CCHA 1LWFA 1D5AA 1LWCA 3VESA 2YV0X 4IOAL 1J53A 4LH5A 3QIOA 3FZHA 4HUEA 1IKWA 1KVBA 3AA5X 3U4LA 2Q97A 3QIPA 2P9NA 4FJGA 4JHDB 4JI7K 3CJCA 1LWEA 4BY9C 2P9PB 4LH4A 1S1UA 2HBMA 1IKVA 1W97L 3HBTA 5AQZA 2PAVA 3VQ6A 1QVFM 1OH7A 5KPZA 4BGAA 4Z4CA 3OYAA 5EU7A 4EHTA 1TKTA 3VQEA 1WSHA 4JS5A 4ZTFA 1E4GT 2HVHA 1RT2A 2V52B 2P9UA 2ZF5O 5FRNA 1KD1O 4FOIA 3VQBA 2QWLA 4CF0A 4IO8A 1YUWA 4M42A 3M8PA 4JKBA 1JL2A 3O4WA 4DSJA 4F9OA 1IKYA 1BIUA 4CJEA 4NO7A 1VQ4N 3G4SN 1GLEG 4UQGA 3F73A 1YVNA 4E0DA 2DFHA 3KKSA 4PKIA 1G15A 4KBOA 3IAYA 2KHOA 4I2QA 2HBKA 1WOQA 4QS9A 3HL8A 3GBTA 2I7NA 3GOIA 4PY5A 1YJNN 2NRRA 4OGCA 1S3XA 3QEIA 2E2QA 1QS4A 3MXMA 4XH4A 3ENOA 4DR1K 3VPZA 3VQDA 4BR9A 5ELZA 3SUQA 2RE2A 3WNGA 3SV3A 3CERA 1XI1A 2ITGA 1D9FA 2A3ZA 4E7KA 4O5BA 4HTLA 4IEIA 4OKEA 1U47A 2HHXA 4Z4FA 3NE6A 4K42A 3IMXA 3OS0A 3H1QA 4H4OA 4FZYA 3OHRA 2QXFA 2W6KA 1X9WA 4B9VA 2HMPA 3NAEA 5C15A 4XH1A 4LY7A 3ZT1A 3K9JA 4N76A 1U45A 4W5OA 5HLFA 5AQLA 1ATRA 3NGIA 1SKRA 4NXNK 3L2UA 3A2FA 1B9DA 1QQCA 2NRZA 3BF1A 4IO9L 2KKZA 3DXKA 4F3TA 2ASPA 2D4WA 3D2FA 4CZJA 2GEMA 1NGIA 4H5RA 4YOTA 4J2DA 1C6VA 3ZSZA 1U4BA 4BRQA 2KW4A 3KK1A 4FPBA 1YITN 4Z4GA 2P9UB 1IG8A 4AHSA 5TKWA 3ZT2A 1HKBA 4BWJA 3DLKA 3L2VA 3JYTA 1GOAA 4RTFD 5LJVA 1NOYA 2IS3A 1RNHA 1YAGA 4BG8A 4CJPA 1HX1A 3OYGA 3O1BA 3QO9A 4FK4A 3CHWA 4B1ZA 5HP1A 5KTQA 1CZ9A 3K5MA 5BPMA 3VQ5A 2Y1IA 2NRTA 4DTXA 4ISFA 4O8UA 4GMJB 5HRRA 3G71N 4BQZA 3HM8A 1ZBFA 3IG1A 1K9MO 4JAXA 3K0SA 1WBBA 1L5UA 4FZXC 2ZQBA 1W2BM 1HYVA 4FW2A 2BUPA 2W40A 2E6MA 2HHWA 1QQOA 1VQKN 1N32K 3AO2A 2PZSA 1VSKA 1BDGA 4FOEA 1VSLA 4KKOA 1W9HA 2ZE2A 4RW4A 1FKPA 3VERA 2G8VA 1LW2A 3HM9A 3VQPA 2VWBA 4BDZA 4JV5K 1XWLA 4YDUC 3ALYA 1KLNA 4DQ8A 1W0HA 1RDBA 3FZLA 1G99A 2Q31A 4B3OA 1VAZA 1QSYA 1L3VA 2Z1JA 3M8RA 1GLCG 3SQ4A 4U7BA 3OJUA 3RRHA 2P9IA 3SLCA 4IDKA 3G0ZA 2HF3A 3T1AA 1JJ2M 1TUYA 1V4SA 1HUXA 5M1FA 4CD3A 5AQTA 3VENA 5LMNK 3VA3A 4FM1A 1DTQA 2OZMA 4E1MA 1R0AA 4DTNA 3D2FB 1QHTA 1T6DA 1NMDA 3CCJN 3A8YA 1WAJA 1RFQA 1XC3A 2VYPA 4CGIA 2XO7A 4BDPA 4JI0K 4B3RK 4KRFA 3V9SA 3FFIA 2R7YA 4KB1A 4GKKK 4DQQA 1C1CA 4KREA 2PYJA 1NLVA 3U3YA 3LAMA 2O4IA 1H1VA 1CXUA 3QB0A 3TAMA 4H4MA 4DR7K 1TV6A 1JLQA 2UYTA 1FXXA 3DMJA 3WNEA 4GV6A 3ZLJA 4O5FA 3RR7A 3DOLA 5M1NA 2CH5A 4E1NA 5AQGA 1U48A 3CD6N 1VK0A 3MMVA 5JICA 1TK5A 2GELA 3CQYA 4IFEA 1TAQA 4OPAA 4CIGA 3TTCA 4CEBA 4H5NA 1RDUA 3QINA 2E1ZA 2WFBA 3AVKA 4IJAA 5FPDA 2XY5A 3EE9A 2AA4A 1NKEA 1BU6O 1WSJA 3E9PA 3VQ7A 4CERA 2O8CB 5C2DA 3G25A 2NRXA 5AQVA 4BC4A 2A1RA 3U9DA 4DFMA 2F9TA 3FZFA 2Z1IA 4QS7A 4M45A 1N6QA 5GIPA 3QNNA 4DG1A 4CFCA 3LWMA 1NGFA 4ISEA 2O4GA 1B9FA 4KFBA 1IBMK 2ZJPL 4MFBA 1NWKA 2YNIA 3T7ZA 3U9ZA 3VQ9A 1ZBHA 2O8FA 5FDLA 4DV4K 5DMRA 3F2KA 4DTMA 3PUFA 3ZSRA 2IAJA 4KTWA 4B1YB 3HSTB 4CIEA 4M63C 4B1UB 3CCRN 3D0PA 4QOZB 4LFBK 4XH5A 4DV3K 5FPMA 2AJQA 4JKCA 4CJ4A 1JXEA 4C1NI 5J2NA 2PFUA 4X66K 2G8IA 4R5PA 3DLGA 3WEEA 4KI6A 2WC9A 2ASMA 1NJIO 5GAGP 1RT3A 2YHXA 4GY2B 3HPGA 3H3OB 3EN9A 2KQ2A 4WE1A 5FROA 3WNHA 4J2BA 5M1KA 1EQYA 4CEOA 4CZFA 4JRQA 3DLEA 4JKAA 3KLEA 2KLAA 4DF4A 4F2RA 3U8XA 1SKSA 2E5LK 1TL3A 4DR2K 1ASUA 3JXUA 3O3FA 5AQJA 4CHZA 1QHAA 2BGGA 1F21A 3CJ9A 3AGRA 3AVFA 3GE1A 1HJRA 1S1WA 1NKCA 3C7NB 3CI5A 4DKWA 4CHNA 1VQON 2OPSA 4DHYA 3PX0A 4PKGA 1RGIA 1N34K 1VSFA 3CG7A 3IDHA 3AO5A 2HHHK 4WFAL 1A5WA 4HHTA 4FPAA 4YOUA 5M1PA 4H8KA 4WQ4C 4KPYA 3CMEN 5FLXO 1BCMA 3OTOK 4N47A 1ZYQA 4NYNA 4BRMA 2UUBK 1ZBIA 5B8HA 4LF5K 2FXUA 3PIOL 1ASVA 1XUPO 4ELVA 3VEXA 2F8TA 4CZMA 3OYLA 4OJRA 3HP9A 3ZEUA 1KC8O 1CXQA 2E88A 4IOCL 3QEXA 4CJ7A 2IVPA 4CEFA 4AH9A 3T19A 4NB4A 2XRIA 5D3GA 3V9ZA 3HOTA 5BR9A 4O0JA 3H1VX 1EWRA 5CYMA 4LSLA 2Z1HA 4OPHA 1J54A 4CGGA 3SQ1A 2GUPA 4WFNL 3QNOA 3OYMA 2CGJA 2HHQA 3MEGA 4CFDA 4IG3A 5EVZA 1BQNA 3VEYA 5AQHA 3SK3A 4GVEA 3G6EN 1IH7A 3QBXA 3EL2A 3SBGA 4CZEA 4N5SA 5KPTA 2GBZA 5AZJB 4CJSA 4DUYK 1NMNA 4FK2A 4B9QA 2OYQA 3UKRB 4YOVA 3O9UA 3VN5A 1IG9A 3MX2A 1TKXA 1KRPA 4DV7K 5EY4A 2O8DB 3L2WA 4JYAK 3LDQA 1VQLN 3C6HA 5JVHL 3W3DA 1TK8A 5FPNA 4CFBA 1K8KB 2BTFA 4B1VA 4LC9B 3K5OA 3KLIA 2G8KA 3OS2A 2ZJQL 4B8CA 3M5RA 2UUAK 4JHDA 1KXPA 3IRXA 2G8UA 2P9PA 1ILYA 1WN7A 1NKBA 4DLGA 3BY5A 1BI4A 1Q9YA 1J5OA 3I8DA 4DQSA 3OBYA 2X6SA 2VG5A 3ZEUB 2FSNA 1NK4A 5C12A 1HYSA 3CQXA
chains in the Genus database with same CATH topology
3T1HK 5LL6Z 1HNZK 1IBLK 4LF8K 4K0KK 3J7YP 4V19S 2UU9K 1IBMK 4LF6K 1HNXK 4LFAK 4JV5K 1N33K 2UUCK 5AJ3K 2UXBK 3JAMO 2VQFK 4DR1K 4DV0K 4B3TK 4DV4K 4JI4K 4YY3K 2VQEK 4DR4K 2UXDK 4DUZK 2UXCK 4YHHK 3J80O 4LF9K 4GKJK 4LFBK 4DV3K 4DR6K 3J81O 3T1YK 4X66K 1XNRK 1IBKK 2F4VK 4DR3K 4JI3K 5LMNK 4LF4K 4JI5K 4NXMK 4X64K 4NXNK 4LFCK 1J5EK 4B3SK 4JI7K 5BR8K 4JI1K 1XNQK 2E5LK 4DUYK 4DR2K 4JI0K 5LMUK 4B3RK 4DV6K 4GKKK 4DV7K 4DV1K 1FJGK 2ZM6K 4JYAK 4DR7K 1HR0K 1N34K 4KHPK 4X62K 1I94K 2HHHK 5A2QO 4JI2K 4CVNE 4JI6K 4DV2K 2UUAK 4DV5K 1N36K 5FLXO 3OTOK 4JI8K 4AQYK 2UUBK 4X65K 5IWAK 1HNWK 4OX9K 4DR5K 4B3MK 4LF5K 1XMOK 1N32K 4CW7B 1XMQK 3J7AP 4LF7K 5IT9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H K;  5LL6 Z;  1HNZ K;  1IBL K;  4LF8 K;  4K0K K;  3J7Y P;  4V19 S;  2UU9 K;  1IBM K;  4LF6 K;  1HNX K;  4LFA K;  4JV5 K;  1N33 K;  2UUC K;  5AJ3 K;  2UXB K;  3JAM O;  2VQF K;  4DR1 K;  4DV0 K;  4B3T K;  4DV4 K;  4JI4 K;  4YY3 K;  2VQE K;  4DR4 K;  2UXD K;  4DUZ K;  2UXC K;  4YHH K;  3J80 O;  4LF9 K;  4GKJ K;  4LFB K;  4DV3 K;  4DR6 K;  3J81 O;  3T1Y K;  4X66 K;  1XNR K;  1IBK K;  2F4V K;  4DR3 K;  4JI3 K;  5LMN K;  4LF4 K;  4JI5 K;  4NXM K;  4X64 K;  4NXN K;  4LFC K;  1J5E K;  4B3S K;  4JI7 K;  5BR8 K;  4JI1 K;  1XNQ K;  2E5L K;  4DUY K;  4DR2 K;  4JI0 K;  5LMU K;  4B3R K;  4DV6 K;  4GKK K;  4DV7 K;  4DV1 K;  1FJG K;  2ZM6 K;  4JYA K;  4DR7 K;  1HR0 K;  1N34 K;  4KHP K;  4X62 K;  1I94 K;  2HHH K;  5A2Q O;  4JI2 K;  4CVN E;  4JI6 K;  4DV2 K;  2UUA K;  4DV5 K;  1N36 K;  5FLX O;  3OTO K;  4JI8 K;  4AQY K;  2UUB K;  4X65 K;  5IWA K;  1HNW K;  4OX9 K;  4DR5 K;  4B3M K;  4LF5 K;  1XMO K;  1N32 K;  4CW7 B;  1XMQ K;  3J7A P;  4LF7 K;  5IT9 O; 
#chains in the Genus database with same CATH topology
 2KFN A;  5MLC Q;  3CFP A;  1J6Z A;  3S41 A;  5HBM A;  3RSE B;  3ZX0 A;  4CEZ A;  5KQD A;  3AY9 A;  4Y0W A;  5LY3 A;  4B9L A;  3BGR A;  2YCH A;  2UU9 K;  3LP0 A;  2YKM A;  4N41 A;  4IOX A;  1BUP A;  3RWU A;  3VEZ A;  4FJ9 A;  2EX3 A;  1N33 K;  1NNE A;  3NF8 A;  4I2P A;  3THW B;  2QEX N;  5KI6 A;  1VRU A;  2GX9 A;  5AR0 A;  2KZZ A;  3OS1 A;  5E84 A;  4DU1 A;  3V9X A;  1DLO A;  4Y1D A;  4KHS A;  3HK2 A;  3ULD A;  4H0O A;  3QDK A;  1TUU A;  1BIZ A;  1NK8 A;  1YTU A;  1EET A;  2P9L B;  4KTZ A;  4CBU A;  1ZBS A;  3NF9 A;  4U67 L;  4CGJ A;  4FJL A;  4HCB A;  1ZXO A;  4M3Y A;  3H6E A;  3OYE A;  1GLF O;  3DLR A;  4I9L A;  4A62 A;  4IFV A;  4G1Q A;  4WFB L;  3TTD A;  4M3Z A;  3MDQ A;  3HOS A;  3ITH A;  2QM1 A;  4BR0 A;  1LV5 A;  4C8M A;  3DRS A;  3PO5 A;  2D0B A;  4CJW A;  3NFA A;  2FSK A;  1UA1 A;  1FJG K;  2F9W A;  1ASW A;  4FWK A;  5C25 A;  1JL1 A;  3AVG A;  1NGH A;  1BA1 A;  4A5B A;  3MWP A;  1HR0 K;  5C10 A;  1EXQ A;  4B9N A;  4PQU A;  4DTU A;  4CJK A;  2E2P A;  2D0P A;  4BE1 A;  5ADX H;  4CJQ A;  2HOE A;  2J4R A;  4JK9 A;  4JI6 K;  3KTQ A;  5AQN A;  4BR4 A;  4WQ5 C;  3R3L A;  1N36 K;  3TAE A;  3MEE A;  3NVM A;  1BI4 B;  1X9J A;  4RW7 A;  3SCX A;  5BN9 A;  2IVO A;  4DSI A;  3WT0 A;  4E1J A;  1HNW K;  3TSQ A;  3R8E A;  2YJE A;  4CIF A;  5BPL A;  4JKE A;  1SQK A;  1T05 A;  2FF6 A;  4CGD A;  4C8L A;  4OO1 J;  4LF7 K;  5AQW A;  2QWR A;  1OH6 A;  4E7I A;  5JLH A;  1Z26 A;  4CGH A;  3QES A;  1GLD G;  3LP2 A;  3I0S A;  5SWM A;  1X9M A;  3EEQ A;  2YKN A;  3HTV A;  4DTR A;  1HNX K;  1T44 A;  4LFA K;  3O8M A;  3OYF A;  3ZET B;  2UXB K;  4FWO A;  4KHY A;  3OBW A;  4OLB A;  3CJA A;  4DTO A;  4BAC A;  4KV8 A;  4JI4 K;  3CCV N;  3MCA B;  2P51 A;  1IKX A;  1BGX T;  3B6P A;  3ZT3 A;  3NBP A;  4H0P A;  1DEJ A;  4W5Q A;  3B8A X;  1ITG A;  3SAH A;  1VHX A;  5M1Q A;  4PHT X;  3SPY A;  2RPI A;  3CC2 N;  1S6Q A;  3HRG A;  2ASO A;  5HRO A;  4ZTJ A;  4KH6 A;  3SUO A;  4G9Z A;  2BE2 A;  5AQK A;  5E26 A;  3TSU A;  2YJF A;  3K58 A;  3TAQ A;  3LM2 A;  3OVN A;  5HRS A;  5BN8 A;  4CK3 A;  1J9A A;  1JLA A;  4EZ9 A;  1NGD A;  4DWI A;  3OJS A;  5HL7 L;  4FK0 A;  3MN9 A;  3AVN A;  3FE1 A;  3VF2 A;  3ZX3 A;  3TPQ A;  4PL7 A;  3OYN A;  1SS6 A;  1C1A A;  2Q0R A;  4FJ7 A;  3LP1 A;  3WXJ A;  1HQU A;  4YNQ A;  3V1O A;  4BGB A;  3ISN C;  3THX B;  3SAG A;  2ETJ A;  4NLC A;  4YOW A;  4FLX A;  1NK7 A;  3LL3 A;  1EO1 A;  2FF3 B;  4CFA A;  1EKE A;  4PWD A;  3DOK A;  1HKC A;  1NGA A;  4JD2 B;  3QET A;  4ISG A;  4KI4 A;  4KH5 A;  4BE2 A;  4CZI A;  3PSI A;  1BOT O;  4ELT A;  1N8R O;  3VF4 A;  4OX9 K;  1B92 A;  3PV8 A;  1NM1 A;  4CW7 B;  1TKD A;  5AFU H;  3NHG A;  3J7A P;  4DB3 A;  4CJR A;  2O8B A;  1GOB A;  1L3U A;  3CCQ N;  2FLO A;  1VSE A;  1KQS M;  3J7Y P;  1REV A;  1GLA G;  3VTH A;  3L8B A;  3O4Q A;  5BRD A;  3Q7B A;  2GUI A;  3WXL A;  4E19 A;  3IKM A;  4AHT A;  4FWM A;  2WUS A;  1I3A A;  1VSJ A;  3THY B;  3SJH A;  2NUB A;  2XY8 A;  3ATV A;  4DR4 K;  1D9D A;  2HND A;  2GWK A;  3CYM A;  2ATQ A;  1CZB A;  2O8C A;  3KJV A;  4DTP A;  2A40 A;  4BRK A;  2HF4 A;  1U04 A;  2IC3 A;  5AQX A;  1JLG A;  3QLH A;  4YOR A;  4DR3 K;  4JI3 K;  4O55 A;  3ZSQ A;  2BH1 A;  2HHV A;  1WSG A;  2GTD A;  3O3G A;  4F3O A;  4BRF A;  2HHT A;  4OKK A;  3DRR A;  1K73 O;  1ZBL A;  1J5E K;  1E3M A;  3NCI A;  2HBJ A;  1XNQ K;  4IXC A;  3AAQ A;  1YTA A;  1Y97 A;  4ILH A;  3T69 A;  2QKB A;  4JNE A;  1U6Z A;  5AQR A;  4IBN A;  5AZI B;  3VQ8 A;  4WCE L;  4EP4 A;  4E7H A;  1Q7Y O;  1QQN A;  3AVJ A;  1RTI A;  4AHV A;  3OYJ A;  2IDO A;  4CBX A;  3S3N A;  4W5R A;  1SL1 A;  4DTJ A;  3NH1 A;  5JVG L;  5DK5 A;  2OZS A;  1OKJ A;  5AQI A;  2FBT A;  1NGJ A;  4CVN E;  3UKU A;  1HYZ A;  5F2R A;  1RTD A;  2BDP A;  1M90 O;  3VQQ A;  4RW6 A;  1KAY A;  1VSH A;  2AP1 A;  3E01 A;  2FBY A;  2ZD1 A;  2KZM A;  3A5L C;  4X65 K;  4GV9 A;  3PSF A;  4K43 A;  1P8Z A;  2O8B B;  5AQU A;  1NGG A;  3EY1 A;  3RMD A;  2WBN A;  4FL9 A;  3AO3 A;  3C7N A;  3LAK A;  5I9E B;  1HNZ K;  3AVL A;  3LZJ A;  1WNS A;  2P9K A;  4BC5 A;  5SZT A;  4FWR A;  3TAB A;  3VGL A;  2HW3 A;  4LF6 K;  3QIC A;  2DPN A;  5HRN A;  3ID6 A;  2OPP A;  2X6N A;  3SAF A;  3CCE N;  2VQF K;  4DQP A;  2HNY A;  2QW9 A;  4WYB A;  4HVJ A;  3DLH A;  4YY3 K;  2XHB A;  4IWV A;  4M3U A;  4OPJ A;  4BWM A;  4IDH A;  3AAR A;  1LAV A;  3J80 O;  4JKG A;  5JLF A;  2OCE A;  3AA3 A;  2NLX A;  1DTT A;  3O9Q A;  3HVT A;  5AQS A;  1HRH A;  4BRO A;  4LSN A;  1UA0 A;  4MO4 A;  1IBK K;  4N56 A;  5KGW A;  2D1K A;  3NGZ A;  3TAR A;  3KWG A;  2OTL N;  1JCE A;  1YF5 L;  5BR8 K;  3KLH A;  1HMV A;  1YXQ A;  5J2P A;  4CZH A;  4FVU A;  5GIO A;  5CZ1 A;  1X1P A;  2ZGZ A;  3HO1 A;  1Y64 A;  1T8E A;  4FJM A;  3J7Z O;  4CJ3 A;  3ZT0 A;  3BUZ B;  4RWT A;  3LDP A;  5EOY A;  2QA4 N;  1U2V A;  2QWP A;  3KK2 A;  3RMB A;  3VF6 A;  4Q5V A;  3UKU B;  3Q7C A;  2CGK A;  3MCP A;  3O9R A;  4NCA A;  3VA0 A;  5JS2 A;  4M3X A;  3SMS A;  5AZJ A;  5TKY A;  1A5V A;  1C0F A;  1OH8 A;  2F96 A;  2YHY A;  3UKR A;  5CY4 A;  3OW2 M;  1MWM A;  3JS6 A;  2X74 A;  3UE5 A;  4B3M K;  1C1B A;  3WXM B;  1D8Y A;  3NVK A;  2OA8 A;  4B1W B;  1VRT A;  1LOT B;  3SUN A;  3P39 A;  2O8D A;  3P38 A;  1QSS A;  2P9K B;  1IJJ A;  4YOX A;  4KB0 A;  1K8K A;  1YJW N;  2FBV A;  2PYL A;  2OPQ A;  5AFU A;  2HST A;  3MN5 A;  1RTH A;  4I9Q A;  3DXM B;  3RRG A;  3LZI A;  3L3U A;  3KLF A;  2P9S B;  3NF7 A;  1TK0 A;  3HXM A;  4JKG B;  1VQ7 N;  4B9T A;  4E3S A;  2Z1G A;  4DSL A;  3CJ7 A;  3I8B A;  4RW8 A;  4W5N A;  3SV4 A;  2P1J A;  3OYI A;  4DSK A;  1S72 N;  3ZSV A;  4Z4H A;  4FJJ A;  3M3Z A;  1KLM A;  3IS9 A;  4CJV A;  1RDA A;  3RSE A;  4BRH A;  3D6R A;  2FBX A;  2VWK A;  3S9H A;  3E9L A;  3F9M A;  1RBS A;  4O44 A;  3WNF A;  4AHU A;  3NMU A;  4JI5 K;  2ZJR L;  4H5T A;  1ATS A;  4CES A;  1O13 A;  3RVC A;  4BRE A;  3THW A;  3AO1 A;  4MLE A;  2W6L A;  4AIL C;  4EZ6 A;  3GDQ A;  1NJW A;  4OVL A;  4IKF A;  1Q81 O;  4ILG B;  3O4N A;  3THV A;  2P9L A;  1U2V B;  1WB9 A;  5C2F A;  2QTD A;  5DM7 L;  5EX5 A;  1RT6 A;  3O6W A;  4PL8 A;  2NZT A;  4DQR A;  4O4G A;  3DM2 A;  1WSI A;  2A41 A;  4B9U A;  5C42 A;  4ID5 A;  1FKO A;  4RW9 A;  3ID8 A;  3VQC A;  1WSE A;  5LJW A;  4A59 A;  3BZK A;  4JKD A;  1LCU A;  1WSF A;  4DV2 K;  3DRP A;  4AM7 A;  3LWL A;  3CF5 L;  1SV5 A;  3PO4 A;  1Z6R A;  2A42 A;  2G8F A;  4YDU A;  2A5X A;  4BRP A;  3VEO A;  3V1R A;  3OYC A;  4FLT A;  4JK8 A;  4PUO A;  4A2B A;  4DMN A;  5GIN A;  3WUH A;  4K25 A;  1VQ6 N;  3KIO A;  1QZ6 A;  3LPT A;  3FZM A;  4K8Z A;  4AHC A;  1VQ5 N;  1Z25 A;  1P90 A;  4E7J A;  3L2Q A;  1NK9 A;  4JEP A;  4YOY A;  2EHG A;  1RBU A;  2E6L A;  4FJH A;  2RHK A;  4ZHR A;  4FVM A;  1BO5 O;  4CJF A;  1TKZ A;  2PY5 A;  3AV9 A;  4H0Y B;  3BDP A;  4BR5 A;  3TWH A;  5GAH P;  1R59 O;  2E20 A;  3KKR A;  4DFJ A;  1O1W A;  4CZL A;  2GWJ A;  3EO3 A;  3J8A A;  3K57 A;  2FC0 A;  4A5A A;  4BC2 A;  4NLB A;  1JXB A;  3LDN A;  3SNN A;  1HNV A;  3E1Y A;  4OLA A;  1A5X A;  4HUF A;  3PLA A;  4BDY A;  2UXC K;  4FM0 A;  2NRW A;  1Q9X A;  3A0I X;  1OH5 A;  4CF8 A;  3GG4 A;  1DT9 A;  3TR8 A;  4BQL A;  4CJU A;  4DFK A;  3NH2 A;  3HPO A;  1RT4 A;  3MX5 A;  2YHW A;  4FWL A;  3ENB A;  2ITM A;  3U3G A;  1YJ9 N;  4OPK A;  3SPZ A;  4BRC A;  3QFP A;  1TYQ B;  1BCO A;  4NXM K;  3ZSW A;  1BA0 A;  3K59 A;  2Q2R A;  3FFK B;  4IZ9 A;  3ZET A;  3TU5 A;  4BC3 A;  4M41 A;  4E7L A;  4DLE A;  3KD1 E;  1C0M A;  3ULE B;  4C8O A;  3OYB A;  1CZA N;  4BRI A;  3V1Q A;  3AA4 A;  1ESV A;  3EKS A;  3EKU A;  1NBW A;  3A5M C;  3P4I A;  1NK6 A;  1Q18 A;  3I33 A;  4HWI A;  3CCL N;  1RT7 A;  4OGE A;  2Q36 A;  3ZSX A;  4L8R B;  1TL1 A;  4M3W A;  3SQ0 A;  3MN7 A;  3VGK A;  1NK5 A;  1NK0 A;  3PY8 A;  4KHU A;  2B6A A;  1RTJ A;  1DGK N;  1S1T A;  1FW6 A;  3V81 A;  4JI2 K;  3OY9 A;  3HSC A;  2V7Z A;  2X78 A;  2QKK A;  5KGX A;  4JLH A;  2OTJ N;  4DV5 K;  3G10 A;  3L3V A;  4J2A A;  3MK6 A;  3DLL L;  2JWK A;  4I6M B;  3EZW A;  4CHY A;  1IO2 A;  1EWQ A;  3C95 A;  5IWA K;  3FZK A;  5AQM A;  3CJ1 A;  4QCL A;  1QQM A;  2Q0U A;  3P1G A;  4EHU A;  3DAW A;  5H1S Q;  5DM6 L;  4EFH A;  4IJN A;  3VTI A;  1YVU A;  4CF2 A;  5IT9 O;  4LF8 K;  2HBL A;  3O80 A;  4HTU A;  1N5Y A;  4BR2 A;  3THX A;  3ATU A;  1C0U A;  3ZYY X;  3MEC A;  3HT3 A;  4CZG A;  3CCS N;  1S1V A;  1S1X A;  1WLJ A;  1T7P A;  4FLY A;  3FR0 A;  4FCY A;  3B6O A;  4JD2 A;  3CQ8 A;  3QEP A;  4B3T K;  1BG3 A;  4JKH A;  4BRN A;  1QVG M;  1QSL A;  2IOC A;  5KRT A;  3D2E A;  2UXD K;  4ELU A;  1NJY A;  3KWI A;  4DTS A;  1TGO A;  3K9K A;  3NF6 A;  3WQT A;  5CHI A;  3BF3 A;  4E89 A;  1WBD A;  3ENH A;  4UY8 O;  3AVB A;  3DJC A;  3R1X A;  2RF2 A;  4FJX A;  4DS5 A;  1TAU A;  3K5L A;  5F0X A;  4CF9 A;  2F4V K;  1WUA A;  2E4L A;  2NRH A;  2E1Y A;  2A6A A;  3AVI A;  4X64 K;  3EZ5 A;  4C8K A;  3CET A;  2HHU A;  4IG0 A;  4CEQ A;  1W7A A;  5BRE A;  3THY A;  1VQM N;  1HLU A;  1T3V A;  4JI1 K;  4FWN A;  4WQ4 A;  3CMA N;  5LMU K;  3V6D A;  4DV6 K;  3TAP A;  1VSM A;  1T03 A;  4F2S A;  3H45 C;  2QWN A;  1RCH A;  4FW1 A;  2YHB A;  1FK9 A;  2GV9 A;  3WXK A;  3P31 A;  4HUG A;  5FRM A;  3TAF A;  2HMI A;  3MN6 A;  3TAN A;  1KVA A;  2JLE A;  4IEE A;  4KHP K;  3H3N O;  4BVO A;  2I7P A;  3TSP A;  1S5J A;  4KO0 A;  3L2R A;  3M1F A;  3CC7 N;  1S6P A;  2E2N A;  1OVY A;  2WOM A;  4DU3 A;  1VQP N;  3AA2 A;  5AZI A;  4DSE A;  2KFZ A;  1K6Y A;  4EAH D;  4H0V B;  1RDD A;  3C6U A;  4DCH A;  3P83 D;  4Z4I A;  4FSV A;  4MQ3 A;  1NOZ A;  5T7B A;  1RBT A;  3ASM A;  3ZCM A;  3VQ4 A;  4MO5 A;  4KHQ A;  5I3U A;  4CEA A;  1RT1 A;  4CED A;  3IUC A;  4YFU A;  4FZZ A;  4OKJ A;  3D2E B;  1XHZ A;  2P9N B;  2W42 A;  3CXC M;  2JGU A;  1BQM A;  1HKG A;  5C0Y A;  2VQE K;  4J8F A;  2D0A A;  4YHH K;  4A61 A;  2DTU A;  4CJ5 A;  3DLB A;  3V9W A;  2JWL A;  3DI6 A;  2P5O A;  1BHL A;  1VSI A;  1X3N A;  1I39 A;  2YNF A;  4EP5 A;  3C94 A;  4ILJ A;  3FGU A;  1EP4 A;  1RDC A;  3V4I A;  4BVP A;  4JK7 A;  3LDS A;  4MDA A;  3LAN A;  4NCB A;  4H0X B;  2NNW A;  5BPN A;  1Q86 O;  2H3G X;  4CI6 A;  3C6T A;  4MLH A;  3QEV A;  2QWO A;  1RDW X;  4KTQ A;  3R9P A;  1NJX A;  4B9S A;  4B9M A;  3S3M A;  2VCP A;  3BP8 A;  3VET A;  4WF9 L;  3N4Q A;  5HRP A;  4DU4 A;  2E8A A;  1KVC A;  3VGM A;  4B8A B;  4PA1 A;  3OYH A;  3AVA A;  4FJ8 A;  4PKH A;  5A2Q O;  5C24 A;  2G8W A;  2D0O A;  1L3S A;  3DWL A;  1SL2 A;  4NCG A;  3CPE A;  4RG8 A;  3L4I A;  2D5R A;  1NGB A;  3VMF B;  4JI8 K;  3U6F A;  4KHN A;  2Q3S A;  1QTM A;  4K8X A;  3KD5 E;  1SZ2 A;  4DR5 K;  5GAD P;  4QS8 A;  1BWF O;  4W5T A;  2DFF A;  2HNZ A;  3WXI A;  5FPE A;  3W0L A;  2F7T A;  5AQY A;  3AO4 A;  4CF1 A;  3PX6 A;  4NYF A;  4FLV A;  1HJO A;  2V51 B;  2IVN A;  5ADX A;  3SJJ A;  1KSP A;  4M3R A;  3VQA A;  4F8R A;  3AVH A;  3GL1 A;  1Q82 O;  1T6C A;  2B4J A;  3DXK B;  4DV0 K;  2V7Y A;  1SL0 A;  4EIA A;  4IFY A;  3BZC A;  4H03 B;  1YT3 A;  4CK2 A;  4CHQ A;  3JSM A;  4FM2 A;  4LF9 K;  3CIP A;  4FWS A;  4JS4 A;  3SZ2 A;  4H5V A;  4QAG A;  5KPR A;  4BRA A;  2XY7 A;  3SMP A;  3HJF A;  1E4F T;  2CGL A;  5KRS A;  4AM6 A;  3PIP L;  5GAE P;  3SUP A;  5K14 A;  4ICL A;  3QML A;  3DXM A;  5F1X A;  2P9S A;  2ZGY A;  5J1E A;  4B3S K;  2P5G A;  2F8S A;  3PX4 A;  1SKW A;  4C8N A;  4WQ5 A;  3F9K A;  3RMA A;  4H0T B;  1VQ8 N;  3MED A;  4DF8 A;  3RR8 A;  3VEV A;  4Q0B A;  3CCU N;  1VQN N;  1C0T A;  3CC4 N;  4DV1 K;  4Z4E A;  2ZM6 K;  4LD0 A;  1GLB G;  4KHW A;  3S3O A;  3I55 N;  4CK1 A;  2CH6 A;  3M8Q A;  3OA9 A;  2VWJ A;  5JS1 A;  4Z94 A;  4F4K A;  5AQQ A;  3N4P A;  3L0Q A;  3QFU A;  3ZSY A;  2HB5 A;  1SUQ A;  1JKH A;  3I56 N;  1Q8I A;  4B1X B;  4FYD A;  2P9I B;  2O8E A;  4JKF A;  1HPM A;  3LDO A;  3P5J A;  4AHR A;  4R79 A;  5CYQ A;  1ATN A;  1VSD A;  3KVG A;  5HOO A;  4FLZ A;  5LL6 Z;  1GLL O;  3M8S A;  1IBL K;  2YX6 A;  3E9O A;  1NGE A;  5KQ8 A;  3MWT A;  3O08 A;  4M7X A;  1NG9 A;  1LAW A;  4V19 S;  4L3Q A;  3BEX A;  3CCM N;  4GV3 A;  3CPW M;  3AGK A;  1JCG A;  4CGF A;  3HYF A;  3LDL A;  2Y1J A;  4DUZ K;  1D4X A;  3AVC A;  2EWS A;  4CZK A;  4BRL A;  1S9E A;  2RN2 A;  1KFD A;  2DY4 A;  3J81 O;  4FLU A;  4TSX A;  2Q1N A;  4CE9 A;  3T1Y K;  3ZT4 A;  2QK9 A;  2WTU A;  3SI6 A;  4BRD A;  3O3H A;  2D0C A;  1RIL A;  2I5J A;  3QBW A;  4H5W A;  4XEI A;  1KAZ A;  1Z05 A;  3H08 A;  1UOC A;  4FJ5 A;  3A5O C;  3LM9 A;  2B5J A;  3UIQ A;  4M7Y A;  4C1N K;  4CBW A;  1MA9 B;  3K5N A;  1JLB A;  3AVM A;  2YHA A;  4Z0U A;  4GNI A;  2VGN A;  1HPZ A;  3O5B A;  4JN4 A;  4BE0 A;  1QZ5 A;  2VG6 A;  4K41 A;  5AQO A;  1I94 K;  1TYQ A;  5BRF A;  1EX4 A;  2BAN A;  2HHS A;  1NGC A;  3EYZ A;  1RBV A;  3D7E O;  3O9T A;  3MXJ A;  2QXL A;  3VEW A;  4DQI A;  2O8F B;  1YI2 N;  1S9G A;  4CEC A;  3ULE A;  1BIS A;  2O8E B;  1UAX A;  4CEE A;  3F5T A;  1CLQ A;  3RTV A;  3O1W A;  3K2P A;  3R6M A;  2RKI A;  5CZ2 A;  1XMO K;  2PBD A;  1QE1 A;  3CM6 A;  3UB5 A;  4FLW A;  3ZX2 A;  1XMQ K;  2XY6 A;  2ZWH A;  1K8A O;  3CFR A;  5J2M A;  3WEE B;  2E2O A;  5J2Q A;  1JCF A;  2VG7 A;  3AAP A;  3CFO A;  3EE8 A;  2IGI A;  4O0I A;  1V4T A;  1LW0 A;  4DSF A;  1NJZ A;  3E66 A;  4FJN A;  4J2E A;  2UUC K;  4AF1 A;  1XHX A;  4Y1C A;  4DS4 A;  1YIJ N;  4I6M A;  3KK3 A;  4FJI A;  2A1S A;  2OAN A;  1JLC A;  1MDU B;  1ZBU A;  1KAX A;  1S22 A;  1BL3 A;  4GKJ K;  2QWM A;  1SAZ A;  4MDB A;  4DR6 K;  3C0B A;  2HVI A;  3DYA A;  1KTQ A;  4BRG A;  3SBT A;  3CJB A;  4CJL A;  1XNR K;  3HI0 A;  4BR7 A;  4C23 A;  3NDK A;  1OVQ A;  3O9S A;  3ZSO A;  4LF4 K;  4O8K A;  3QEW A;  4DFP A;  4LFC K;  2FSJ A;  2W41 A;  1HNI A;  2YNG A;  4GVM A;  1X9S A;  1XQS C;  4XIU A;  4A57 A;  4CHP A;  3SQ2 A;  1U49 A;  4FO0 A;  2G8H A;  3HP6 A;  4BG9 A;  1KFS A;  3KK7 A;  3TTF A;  4HCC A;  2DFE A;  3C65 A;  3WQU A;  2KTQ A;  1X3M A;  2IIR A;  2OPR A;  3VOV A;  5I42 A;  1XC9 A;  5EXW A;  2YI1 A;  4A2A A;  1YHQ N;  1NU0 A;  4CD1 A;  1UWB A;  3D45 A;  4CHO A;  4GW6 A;  4KAZ A;  1JLF A;  2LSN A;  1L3T A;  3HPH A;  3L4Q A;  3H46 O;  1RT5 A;  5CR4 A;  3OYD A;  4X62 K;  3MAQ A;  3M6G A;  1GOC A;  2QWQ A;  3L6Q A;  4KH4 A;  1GLJ O;  3LPU A;  4CJT A;  1KCF A;  5M1O A;  4ID1 A;  3TAG A;  2QI2 A;  5JMV A;  1MU2 A;  5BRH A;  1IV0 A;  5E41 A;  3FLC O;  4AQY K;  4I7F A;  3KHY A;  3I0R A;  1HQE A;  3RMC A;  1TVR A;  3KLG A;  1VQ9 N;  1MWK A;  1DKG D;  3T1H K;  5AQF A;  3SYZ A;  1M1K O;  3HZ6 A;  3KZB A;  4K0K K;  3A5N C;  2YNH A;  4JRP A;  4FWQ A;  1ZC6 A;  4RCH A;  4FJK A;  2VGM A;  3IFR A;  3T3F A;  5AJ3 K;  1WAF A;  1C0G A;  3C6A A;  3JAM O;  3HVR A;  3V9U A;  1RBR A;  4M3T A;  4FWP A;  3NH0 A;  3NGY A;  3LP3 A;  1JLE A;  4B08 A;  3MXI A;  2NRV A;  3CM5 A;  2WON A;  4FXD A;  5AQP A;  5CE3 A;  3TI0 A;  3OYK A;  3QER A;  3LAL A;  4CCH A;  1LWF A;  1D5A A;  1LWC A;  3VES A;  2YV0 X;  4IOA L;  1J53 A;  4LH5 A;  3QIO A;  3FZH A;  4HUE A;  1IKW A;  1KVB A;  3AA5 X;  3U4L A;  2Q97 A;  3QIP A;  2P9N A;  4FJG A;  4JHD B;  4JI7 K;  3CJC A;  1LWE A;  4BY9 C;  2P9P B;  4LH4 A;  1S1U A;  2HBM A;  1IKV A;  1W97 L;  3HBT A;  5AQZ A;  2PAV A;  3VQ6 A;  1QVF M;  1OH7 A;  5KPZ A;  4BGA A;  4Z4C A;  3OYA A;  5EU7 A;  4EHT A;  1TKT A;  3VQE A;  1WSH A;  4JS5 A;  4ZTF A;  1E4G T;  2HVH A;  1RT2 A;  2V52 B;  2P9U A;  2ZF5 O;  5FRN A;  1KD1 O;  4FOI A;  3VQB A;  2QWL A;  4CF0 A;  4IO8 A;  1YUW A;  4M42 A;  3M8P A;  4JKB A;  1JL2 A;  3O4W A;  4DSJ A;  4F9O A;  1IKY A;  1BIU A;  4CJE A;  4NO7 A;  1VQ4 N;  3G4S N;  1GLE G;  4UQG A;  3F73 A;  1YVN A;  4E0D A;  2DFH A;  3KKS A;  4PKI A;  1G15 A;  4KBO A;  3IAY A;  2KHO A;  4I2Q A;  2HBK A;  1WOQ A;  4QS9 A;  3HL8 A;  3GBT A;  2I7N A;  3GOI A;  4PY5 A;  1YJN N;  2NRR A;  4OGC A;  1S3X A;  3QEI A;  2E2Q A;  1QS4 A;  3MXM A;  4XH4 A;  3ENO A;  4DR1 K;  3VPZ A;  3VQD A;  4BR9 A;  5ELZ A;  3SUQ A;  2RE2 A;  3WNG A;  3SV3 A;  3CER A;  1XI1 A;  2ITG A;  1D9F A;  2A3Z A;  4E7K A;  4O5B A;  4HTL A;  4IEI A;  4OKE A;  1U47 A;  2HHX A;  4Z4F A;  3NE6 A;  4K42 A;  3IMX A;  3OS0 A;  3H1Q A;  4H4O A;  4FZY A;  3OHR A;  2QXF A;  2W6K A;  1X9W A;  4B9V A;  2HMP A;  3NAE A;  5C15 A;  4XH1 A;  4LY7 A;  3ZT1 A;  3K9J A;  4N76 A;  1U45 A;  4W5O A;  5HLF A;  5AQL A;  1ATR A;  3NGI A;  1SKR A;  4NXN K;  3L2U A;  3A2F A;  1B9D A;  1QQC A;  2NRZ A;  3BF1 A;  4IO9 L;  2KKZ A;  3DXK A;  4F3T A;  2ASP A;  2D4W A;  3D2F A;  4CZJ A;  2GEM A;  1NGI A;  4H5R A;  4YOT A;  4J2D A;  1C6V A;  3ZSZ A;  1U4B A;  4BRQ A;  2KW4 A;  3KK1 A;  4FPB A;  1YIT N;  4Z4G A;  2P9U B;  1IG8 A;  4AHS A;  5TKW A;  3ZT2 A;  1HKB A;  4BWJ A;  3DLK A;  3L2V A;  3JYT A;  1GOA A;  4RTF D;  5LJV A;  1NOY A;  2IS3 A;  1RNH A;  1YAG A;  4BG8 A;  4CJP A;  1HX1 A;  3OYG A;  3O1B A;  3QO9 A;  4FK4 A;  3CHW A;  4B1Z A;  5HP1 A;  5KTQ A;  1CZ9 A;  3K5M A;  5BPM A;  3VQ5 A;  2Y1I A;  2NRT A;  4DTX A;  4ISF A;  4O8U A;  4GMJ B;  5HRR A;  3G71 N;  4BQZ A;  3HM8 A;  1ZBF A;  3IG1 A;  1K9M O;  4JAX A;  3K0S A;  1WBB A;  1L5U A;  4FZX C;  2ZQB A;  1W2B M;  1HYV A;  4FW2 A;  2BUP A;  2W40 A;  2E6M A;  2HHW A;  1QQO A;  1VQK N;  1N32 K;  3AO2 A;  2PZS A;  1VSK A;  1BDG A;  4FOE A;  1VSL A;  4KKO A;  1W9H A;  2ZE2 A;  4RW4 A;  1FKP A;  3VER A;  2G8V A;  1LW2 A;  3HM9 A;  3VQP A;  2VWB A;  4BDZ A;  4JV5 K;  1XWL A;  4YDU C;  3ALY A;  1KLN A;  4DQ8 A;  1W0H A;  1RDB A;  3FZL A;  1G99 A;  2Q31 A;  4B3O A;  1VAZ A;  1QSY A;  1L3V A;  2Z1J A;  3M8R A;  1GLC G;  3SQ4 A;  4U7B A;  3OJU A;  3RRH A;  2P9I A;  3SLC A;  4IDK A;  3G0Z A;  2HF3 A;  3T1A A;  1JJ2 M;  1TUY A;  1V4S A;  1HUX A;  5M1F A;  4CD3 A;  5AQT A;  3VEN A;  5LMN K;  3VA3 A;  4FM1 A;  1DTQ A;  2OZM A;  4E1M A;  1R0A A;  4DTN A;  3D2F B;  1QHT A;  1T6D A;  1NMD A;  3CCJ N;  3A8Y A;  1WAJ A;  1RFQ A;  1XC3 A;  2VYP A;  4CGI A;  2XO7 A;  4BDP A;  4JI0 K;  4B3R K;  4KRF A;  3V9S A;  3FFI A;  2R7Y A;  4KB1 A;  4GKK K;  4DQQ A;  1C1C A;  4KRE A;  2PYJ A;  1NLV A;  3U3Y A;  3LAM A;  2O4I A;  1H1V A;  1CXU A;  3QB0 A;  3TAM A;  4H4M A;  4DR7 K;  1TV6 A;  1JLQ A;  2UYT A;  1FXX A;  3DMJ A;  3WNE A;  4GV6 A;  3ZLJ A;  4O5F A;  3RR7 A;  3DOL A;  5M1N A;  2CH5 A;  4E1N A;  5AQG A;  1U48 A;  3CD6 N;  1VK0 A;  3MMV A;  5JIC A;  1TK5 A;  2GEL A;  3CQY A;  4IFE A;  1TAQ A;  4OPA A;  4CIG A;  3TTC A;  4CEB A;  4H5N A;  1RDU A;  3QIN A;  2E1Z A;  2WFB A;  3AVK A;  4IJA A;  5FPD A;  2XY5 A;  3EE9 A;  2AA4 A;  1NKE A;  1BU6 O;  1WSJ A;  3E9P A;  3VQ7 A;  4CER A;  2O8C B;  5C2D A;  3G25 A;  2NRX A;  5AQV A;  4BC4 A;  2A1R A;  3U9D A;  4DFM A;  2F9T A;  3FZF A;  2Z1I A;  4QS7 A;  4M45 A;  1N6Q A;  5GIP A;  3QNN A;  4DG1 A;  4CFC A;  3LWM A;  1NGF A;  4ISE A;  2O4G A;  1B9F A;  4KFB A;  1IBM K;  2ZJP L;  4MFB A;  1NWK A;  2YNI A;  3T7Z A;  3U9Z A;  3VQ9 A;  1ZBH A;  2O8F A;  5FDL A;  4DV4 K;  5DMR A;  3F2K A;  4DTM A;  3PUF A;  3ZSR A;  2IAJ A;  4KTW A;  4B1Y B;  3HST B;  4CIE A;  4M63 C;  4B1U B;  3CCR N;  3D0P A;  4QOZ B;  4LFB K;  4XH5 A;  4DV3 K;  5FPM A;  2AJQ A;  4JKC A;  4CJ4 A;  1JXE A;  4C1N I;  5J2N A;  2PFU A;  4X66 K;  2G8I A;  4R5P A;  3DLG A;  3WEE A;  4KI6 A;  2WC9 A;  2ASM A;  1NJI O;  5GAG P;  1RT3 A;  2YHX A;  4GY2 B;  3HPG A;  3H3O B;  3EN9 A;  2KQ2 A;  4WE1 A;  5FRO A;  3WNH A;  4J2B A;  5M1K A;  1EQY A;  4CEO A;  4CZF A;  4JRQ A;  3DLE A;  4JKA A;  3KLE A;  2KLA A;  4DF4 A;  4F2R A;  3U8X A;  1SKS A;  2E5L K;  1TL3 A;  4DR2 K;  1ASU A;  3JXU A;  3O3F A;  5AQJ A;  4CHZ A;  1QHA A;  2BGG A;  1F21 A;  3CJ9 A;  3AGR A;  3AVF A;  3GE1 A;  1HJR A;  1S1W A;  1NKC A;  3C7N B;  3CI5 A;  4DKW A;  4CHN A;  1VQO N;  2OPS A;  4DHY A;  3PX0 A;  4PKG A;  1RGI A;  1N34 K;  1VSF A;  3CG7 A;  3IDH A;  3AO5 A;  2HHH K;  4WFA L;  1A5W A;  4HHT A;  4FPA A;  4YOU A;  5M1P A;  4H8K A;  4WQ4 C;  4KPY A;  3CME N;  5FLX O;  1BCM A;  3OTO K;  4N47 A;  1ZYQ A;  4NYN A;  4BRM A;  2UUB K;  1ZBI A;  5B8H A;  4LF5 K;  2FXU A;  3PIO L;  1ASV A;  1XUP O;  4ELV A;  3VEX A;  2F8T A;  4CZM A;  3OYL A;  4OJR A;  3HP9 A;  3ZEU A;  1KC8 O;  1CXQ A;  2E88 A;  4IOC L;  3QEX A;  4CJ7 A;  2IVP A;  4CEF A;  4AH9 A;  3T19 A;  4NB4 A;  2XRI A;  5D3G A;  3V9Z A;  3HOT A;  5BR9 A;  4O0J A;  3H1V X;  1EWR A;  5CYM A;  4LSL A;  2Z1H A;  4OPH A;  1J54 A;  4CGG A;  3SQ1 A;  2GUP A;  4WFN L;  3QNO A;  3OYM A;  2CGJ A;  2HHQ A;  3MEG A;  4CFD A;  4IG3 A;  5EVZ A;  1BQN A;  3VEY A;  5AQH A;  3SK3 A;  4GVE A;  3G6E N;  1IH7 A;  3QBX A;  3EL2 A;  3SBG A;  4CZE A;  4N5S A;  5KPT A;  2GBZ A;  5AZJ B;  4CJS A;  4DUY K;  1NMN A;  4FK2 A;  4B9Q A;  2OYQ A;  3UKR B;  4YOV A;  3O9U A;  3VN5 A;  1IG9 A;  3MX2 A;  1TKX A;  1KRP A;  4DV7 K;  5EY4 A;  2O8D B;  3L2W A;  4JYA K;  3LDQ A;  1VQL N;  3C6H A;  5JVH L;  3W3D A;  1TK8 A;  5FPN A;  4CFB A;  1K8K B;  2BTF A;  4B1V A;  4LC9 B;  3K5O A;  3KLI A;  2G8K A;  3OS2 A;  2ZJQ L;  4B8C A;  3M5R A;  2UUA K;  4JHD A;  1KXP A;  3IRX A;  2G8U A;  2P9P A;  1ILY A;  1WN7 A;  1NKB A;  4DLG A;  3BY5 A;  1BI4 A;  1Q9Y A;  1J5O A;  3I8D A;  4DQS A;  3OBY A;  2X6S A;  2VG5 A;  3ZEU B;  2FSN A;  1NK4 A;  5C12 A;  1HYS A;  3CQX A; 
#chains in the Genus database with same CATH homology
 3T1H K;  5LL6 Z;  1HNZ K;  1IBL K;  4LF8 K;  4K0K K;  3J7Y P;  4V19 S;  2UU9 K;  1IBM K;  4LF6 K;  1HNX K;  4LFA K;  4JV5 K;  1N33 K;  2UUC K;  5AJ3 K;  2UXB K;  3JAM O;  2VQF K;  4DR1 K;  4DV0 K;  4B3T K;  4DV4 K;  4JI4 K;  4YY3 K;  2VQE K;  4DR4 K;  2UXD K;  4DUZ K;  2UXC K;  4YHH K;  3J80 O;  4LF9 K;  4GKJ K;  4LFB K;  4DV3 K;  4DR6 K;  3J81 O;  3T1Y K;  4X66 K;  1XNR K;  1IBK K;  2F4V K;  4DR3 K;  4JI3 K;  5LMN K;  4LF4 K;  4JI5 K;  4NXM K;  4X64 K;  4NXN K;  4LFC K;  1J5E K;  4B3S K;  4JI7 K;  5BR8 K;  4JI1 K;  1XNQ K;  2E5L K;  4DUY K;  4DR2 K;  4JI0 K;  5LMU K;  4B3R K;  4DV6 K;  4GKK K;  4DV7 K;  4DV1 K;  1FJG K;  2ZM6 K;  4JYA K;  4DR7 K;  1HR0 K;  1N34 K;  4KHP K;  4X62 K;  1I94 K;  2HHH K;  5A2Q O;  4JI2 K;  4CVN E;  4JI6 K;  4DV2 K;  2UUA K;  4DV5 K;  1N36 K;  5FLX O;  3OTO K;  4JI8 K;  4AQY K;  2UUB K;  4X65 K;  5IWA K;  1HNW K;  4OX9 K;  4DR5 K;  4B3M K;  4LF5 K;  1XMO K;  1N32 K;  4CW7 B;  1XMQ K;  3J7A P;  4LF7 K;  5IT9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...