2E5LK

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2e5lK00
4X62K 4AQYK 3JAMO 4DV2K 4X64K 2VQEK 2UU9K 5BR8K 4LFBK 2UXDK 4LF4K 4DV3K 4JI5K 2F4VK 1N32K 4B3SK 3T1YK 4CW7B 1XMOK 1HR0K 3OTOK 5LL6Z 4YHHK 4DUYK 4DR2K 2E5LK 4DR3K 3J7AP 5IWAK 1XNQK 2ZM6K 4CVNE 5FLXO 4GKKK 4LFCK 4JI8K 4YY3K 4JI3K 2UUCK 4OX9K 2UXBK 4KHPK 4LFAK 4JI2K 4NXNK 2VQFK 1FJGK 4LF9K 4LF6K 5IT9O 4DV5K 1N33K 4DR6K 4DUZK 5A2QO 4DV7K 4JI6K 1N36K 5LMUK 3J7YP 4X65K 4LF5K 4DR7K 4DV6K 2UXCK 1IBLK 4DV4K 4DV1K 4JYAK 1XMQK 4K0KK 1HNXK 4LF8K 3J81O 4GKJK 3T1HK 3J80O 4JI4K 4LF7K 4JI0K 4DR1K 5AJ3K 4B3MK 2HHHK 4NXMK 1HNZK 4V19S 1IBKK 4JV5K 4B3TK 4DV0K 1IBMK 4JI1K 4B3RK 5LMNK 4DR5K 2UUAK 1J5EK 4X66K 1N34K 4DR4K 1I94K 4JI7K 2UUBK 1XNRK 1HNWK
chains in the Genus database with same CATH superfamily
3M6GA 2BDPA 4Q0BA 5BPMA 2AP1A 1BGXT 4K8ZA 4H8KA 3C6UA 1QVFM 5KGWA 4RW9A 2O4IA 2GELA 2G8WA 3ZSWA 3MCAB 5BR8K 1DLOA 2ZWHA 2O8DA 4F3OA 2ZJQL 1VQLN 5HBMA 3HYFA 1N6QA 4OLBA 3WNGA 4M7XA 4DQQA 4CJ5A 1C1CA 1ZBSA 1QHAA 1LWEA 4XH5A 5FLXO 1IO2A 3NH2A 3MN7A 3NVMA 4QS8A 1YTUA 1MA9B 3C94A 4NO7A 2FXUA 3LZJA 3VQDA 5C2DA 3IRXA 2HVHA 3MEEA 3BUZB 3LWMA 5E84A 5AQRA 1X9MA 5FPNA 4DMNA 3U3YA 1IV0A 5AQJA 3CD6N 1JL1A 1XC3A 1FW6A 4KHQA 2VQFK 4O55A 1BHLA 3BY5A 3OS1A 3RVCA 1RT1A 2Q31A 3SZ2A 1SL0A 1FK9A 1XHZA 4M63C 2ASMA 3D7EO 4KHNA 1JLGA 3L4IA 1C0TA 4DV7K 3OBWA 1RTIA 1Q81O 2RKIA 5CR4A 4O0IA 4O0JA 4Z4IA 3CI5A 4CJTA 4CEFA 2B4JA 4CFAA 3ZYYX 3OYGA 1E4GT 3QEXA 4CK2A 3H6EA 4B3MK 1KC8O 2P9IA 3GOIA 3UB5A 4I7FA 2Y1JA 4DQPA 3CC4N 5J2PA 1MWMA 3AAPA 3CCEN 1UA1A 4FJJA 1GOAA 3CFOA 3TABA 2HMIA 4Z4CA 4WFAL 1WB9A 3KLGA 4B8CA 2RHKA 4KFBA 3M3ZA 2LSNA 4IZ9A 2HNYA 3WEEB 2A3ZA 3LDQA 3AGKA 3N4PA 4E7HA 5JVGL 4PY5A 3ZSZA 2ITMA 3QNNA 2A40A 3GG4A 4LF4K 1NBWA 2O8CB 4OVLA 4U7BA 3OA9A 4JKAA 1XMOK 3LDSA 3ZT3A 3DLGA 2YHAA 5C42A 3FFIA 5BR9A 3D6RA 1IKYA 3WUHA 4DR3K 3SUNA 3VQPA 4FJIA 4FPAA 3V9XA 4E3SA 2OA8A 1HRHA 1J5OA 1DT9A 2JLEA 4A61A 3SPYA 2IIRA 1C0GA 2FBVA 4ISEA 1MDUB 3THWA 4BY9C 3UKUA 3E9LA 4BRKA 3LP2A 1V4TA 2V52B 3UIQA 3VN5A 1E3MA 2E2QA 2OANA 1VSJA 3L3VA 3RSEB 4BROA 4NCAA 4H0OA 4B1VA 3L6QA 3ASMA 3TAPA 1NGHA 1ASWA 4FWSA 1XWLA 2HHUA 2P9IB 4DTPA 1RTDA 4BRGA 2XO7A 4FJGA 3H3OB 3HPOA 3VESA 1RT3A 1XC9A 1OVYA 1NGBA 1BI4B 1TAQA 3IMXA 1WSHA 2X6SA 4FJ9A 3JS6A 5BRHA 4PUOA 4JNEA 3SJJA 1CZ9A 3KD5E 5M1PA 4FW2A 2HOEA 3V1QA 2HHHK 1TL1A 4JHDB 4LC9B 3KK2A 4H03B 4CJQA 1K73O 2P9PA 3K59A 1NK9A 4KH4A 4GVMA 1VQMN 1QVGM 1ITGA 2KZMA 3HBTA 4CJWA 5LJWA 1J9AA 2A5XA 2P9KA 4BRQA 4B9TA 4BDYA 4CJFA 5FDLA 4CESA 4G1QA 5KPZA 4E7JA 4E7KA 1Y64A 3U6FA 2WONA 4I2PA 5BN9A 5BREA 4CJ7A 1RDCA 4WCEL 1NG9A 3THWB 4ELVA 4JKFA 4FVMA 1XQSC 1EETA 4B3SK 3KKRA 4CW7B 3M8QA 5CY4A 3IAYA 1YUWA 3U9DA 3PSFA 3CC2N 4DUYK 5AFUH 3SAGA 3CJCA 3T1AA 1XNQK 3O1WA 4B1UB 5HROA 4BRIA 3O4QA 1UA0A 4C8LA 1GLBG 2F8SA 3OYHA 4DTRA 3OVNA 3QFPA 1W0HA 4CF8A 1JCFA 4QS9A 2UXBK 2QWNA 1RNHA 4RWTA 4EP4A 5CYMA 1T03A 5J2MA 4DTXA 3RR8A 1GLAG 3AVFA 4LFAK 3KJVA 4DU1A 5EXWA 4E7LA 3DOLA 3V9WA 2GV9A 4CBWA 4DV5K 3CQ8A 3S3MA 3OYCA 2KTQA 3K5LA 1S3XA 3V1OA 1WNSA 3J7YP 2FSNA 4EAHD 3AA2A 3NVKA 1C0FA 4JEPA 3KK3A 4BRPA 3O9SA 2GX9A 2ATQA 4KTWA 4L8RB 5J1EA 4CEDA 3J80O 4N41A 3PIOL 3K9KA 2WUSA 1T6CA 3E9PA 3JSMA 3ISNC 4JLHA 3HK2A 3FR0A 3QLHA 4RW4A 2HHTA 3V4IA 3CMEN 4BG9A 4DSEA 2OZMA 2E2NA 4C8KA 4Y0WA 2IAJA 3VGKA 4JAXA 4JI1K 2VGNA 4OKJA 3VQEA 1L3UA 2HHSA 2Q36A 2FLOA 5AQYA 1T8EA 1I94K 3AO4A 4JS4A 1EWRA 3P38A 1VQ6N 2F9WA 4AQYK 2I7PA 3CJ7A 2VG6A 3JAMO 4FWNA 4IWVA 3IFRA 4CFCA 2UXDK 1JLCA 3MMVA 2UYTA 4Z4FA 4MO4A 3H08A 4PKIA 3VQ9A 2B6AA 3CERA 3TAFA 3CCJN 2O8BB 5C0YA 5T7BA 4FW1A 1K9MO 1VSEA 3V81A 4FLVA 4O44A 1YVNA 3WQUA 3CF5L 4FLTA 1IKVA 3THVA 1YTAA 2FSKA 3NDKA 2HB5A 4HCCA 1NGFA 1TV6A 4AF1A 4OKEA 1BWFO 1JLFA 2EHGA 3G4SN 1LAVA 4H4MA 5CE3A 4YFUA 2YNGA 3L4QA 3VEWA 5HRPA 1NGEA 1EX4A 4ISFA 4TSXA 3DWLA 4IO8A 4B9SA 5BRFA 2ASOA 1WAFA 3K57A 3K9JA 4BRNA 4B9UA 1JCGA 1VQPN 3CJ9A 4EHUA 1WSJA 3KD1E 1B9FA 5AQMA 4JKDA 4BE1A 2YKNA 2I5JA 4M7YA 3ULDA 2IGIA 3G10A 4ICLA 4H5WA 2AJQA 3I55N 5I42A 1RTJA 2QW9A 4BWJA 1HLUA 4CJSA 4A57A 3SNNA 1Q18A 2QKKA 2X74A 1NK7A 4YOUA 4JI4K 4OO1J 2QXFA 4O8UA 5EOYA 4AILC 3THXA 3HRGA 3P83D 4KBOA 1RFQA 1SAZA 1KAYA 4DTMA 2A6AA 4FM1A 3LPTA 3MX2A 2BGGA 1OH5A 4KTZA 3P5JA 4QOZB 3BP8A 3H46O 4B1YB 3EZ5A 3TANA 4B3OA 3AVJA 2I7NA 4CHNA 4IOCL 4B8AB 3K5MA 2UU9K 1U47A 1NK6A 3OYDA 5M1KA 4DV3K 1KLMA 3T1YK 3AVNA 3ZX2A 4DTJA 4B9MA 1NNEA 2HBKA 4YOTA 4CHOA 1LWFA 3VQBA 3BEXA 3ITHA 4H0YB 2E2OA 5AQKA 3HP6A 4F2SA 2O8EA 4FOIA 3ZT1A 3WNHA 2CGJA 4FPBA 1X9JA 3L2RA 1QE1A 4XEIA 3IKMA 1J54A 4IJNA 2QWLA 4J2BA 1VSFA 3QDKA 2OZSA 4E19A 3AVBA 2VCPA 2NRWA 3T7ZA 4CF0A 4NXNK 3SJHA 4CIGA 1T6DA 4B1XB 2G8HA 2KLAA 4JS5A 4MO5A 1RILA 4C1NI 1WBBA 2B5JA 1M90O 2NRVA 2YJEA 1WUAA 5JS1A 5A2QO 3SQ1A 5TKYA 4GMJB 5AQSA 3VQ8A 3L8BA 2HMPA 1GLFO 4MFBA 1KCFA 4C8OA 2GWKA 4JK7A 2WFBA 4JKGB 5M1OA 3ZT4A 4J2DA 2Q2RA 1GLCG 3VA0A 4YNQA 2Q0UA 4DV1K 4IOXA 2FBTA 3J81O 1X9SA 4DG1A 2OPQA 4GY2B 1NU0A 4DQRA 1D9DA 2A1RA 5DM7L 1U6ZA 4BRFA 3EZWA 3U4LA 4LSLA 3OS0A 1SQKA 1JL2A 3KKSA 1RBRA 3AGRA 3LP0A 4O5FA 3KTQA 4IXCA 2E20A 5AQVA 1VHXA 3O4NA 3C7NA 1SV5A 1IBMK 4NYFA 1J5EK 3DLHA 4I6MA 4CI6A 2HHWA 1RCHA 4BACA 3KZBA 3LDPA 4J2AA 1VQKN 3WT0A 4M3YA 3CCUN 3L2UA 2VQEK 2G8KA 1SL1A 5EVZA 3LALA 3PX6A 3TSPA 3P31A 4B9NA 4GNIA 3NE6A 4ZHRA 3PUFA 1ASVA 4E89A 2ZE2A 5JVHL 4WQ4C 4CGJA 3SI6A 1QQCA 5CZ1A 5F2RA 3QEPA 3J7ZO 1VSIA 3AVLA 2O8FA 4CVNE 4E7IA 4MQ3A 3EYZA 3LDNA 4KHWA 4JRPA 3I33A 2IVNA 2P1JA 2F8TA 1ZBUA 3EEQA 1IKXA 2V51B 3GDQA 4CZFA 3QFUA 2E4LA 3SQ0A 1K8KB 2XY8A 4YORA 3AAQA 4CGDA 3O6WA 5DM6L 4KH6A 4WQ5A 5AQXA 4HCBA 1D5AA 4CHZA 4Z4GA 4FJNA 3SLCA 3VEYA 2YNFA 3P4IA 4WYBA 3HP9A 4B9LA 4AHRA 4OLAA 4DQIA 4NLCA 3IUCA 5GAHP 3P39A 4H5NA 4A5AA 1U2VA 5M1QA 1W2BM 1G15A 4CJ3A 5C10A 4WF9L 2NRXA 1D8YA 5AQUA 3UKRB 4FJXA 3WNFA 3CCSN 1X9WA 4FSVA 4Y1CA 5KPTA 1S9EA 4AHCA 1U4BA 3I8BA 3CPEA 4MLHA 2CH5A 3D2EB 4M3ZA 2NRTA 4DSKA 4Q5VA 1H1VA 1QS4A 3CQXA 4FZXC 3NBPA 4ILGB 4BGBA 4B3TK 2D4WA 3DXKA 4QCLA 4CZGA 1TKZA 1U45A 5AQHA 3CM5A 4B3RK 4BG8A 1HJOA 2YJFA 2UUAK 1LW2A 3AVMA 3WXMB 3J8AA 4JI7K 1RDDA 1DTQA 4BWMA 4YOVA 1E4FT 3RMBA 4DSIA 1Q9YA 2QKBA 5CZ2A 3QB0A 3AO2A 2P9NA 5KRTA 3FGUA 3ENBA 3GBTA 3H3NO 2D0BA 4DF4A 1CZBA 3O9TA 2O8DB 5C12A 1VQ7N 1C1AA 3T69A 1S1VA 1BG3A 4E1MA 5I3UA 1TUUA 5KPRA 1J6ZA 5LY3A 2FSJA 2OYQA 4GKKK 2CGKA 4LFCK 4HUFA 1KQSM 4K43A 3ZSQA 4JI3K 3VTIA 1RDAA 3HM8A 4IOAL 2P9LA 3HI0A 4KRFA 4B1ZA 5MLCQ 4WQ4A 4JI2K 4H5TA 1WN7A 1L5UA 4FK2A 1HKBA 4HUEA 1FJGK 2IS3A 2DFEA 4CZMA 3MXIA 5KRSA 4Y1DA 3E66A 1GOBA 1OVQA 3OBYA 1RDBA 3DLEA 3LAKA 1UOCA 3G71N 3CCRN 4GW6A 2GWJA 1TKTA 3AA3A 1RDUA 5GAGP 3LP3A 4R5PA 3SUQA 1WLJA 3QNOA 4CZKA 1BA1A 3LDOA 5FPMA 3DLKA 4KPYA 2HHVA 4CEAA 3DM2A 4L3QA 2E6MA 4JI0K 4FJMA 4BC3A 2ZGZA 4JKHA 1X3NA 2BH1A 1Y97A 1YI2N 3V9ZA 3AVHA 4FCYA 1Q86O 1ZBLA 1JXBA 1UWBA 5DK5A 4CCHA 2AA4A 4X66K 2E6LA 4B9VA 5KQ8A 1VRUA 2YNHA 1W9HA 3MECA 1VSHA 4DV2K 3CYMA 4JKEA 4CJEA 2DY4A 5BN8A 1QZ6A 1JLBA 4DSJA 4CJRA 2P9UA 4WFBL 4FM2A 2XY5A 3KVGA 4KO0A 4DSFA 3RMAA 3OYAA 4LH4A 4LH5A 1N8RO 3SQ4A 2FF6A 4IJAA 1QQMA 2YHXA 5EX5A 1NJYA 1ATSA 4QS7A 4K25A 4CZLA 1NMNA 1QQOA 3ID8A 2XY6A 1S9GA 2RF2A 1C1BA 1Q8IA 3D0PA 2V7ZA 2R7YA 3C6HA 4KHPK 3VQ7A 3CM6A 3AVIA 3SMPA 3SUPA 3HO1A 3QEWA 2E1ZA 3EKSA 3UKUB 1B92A 2HF3A 3U9ZA 3IS9A 3KLEA 5HL7L 1L3SA 1R0AA 1HJRA 3VEXA 5HLFA 2QXLA 5IT9O 3C6TA 2IDOA 4DR6K 2P9SA 3AO5A 4AH9A 1REVA 4BE0A 2A41A 3H45C 4M45A 4KAZA 4KKOA 4CECA 4FLWA 2ZF5O 1BCMA 2A42A 2F7TA 2QWOA 5K14A 2HHQA 4CHYA 1ZYQA 4GKJK 4C1NK 2KQ2A 1QSYA 3G25A 5AJ3K 4DFKA 1VAZA 5EU7A 1N5YA 1NWKA 2D0AA 3CHWA 1W97L 4RW8A 3ZSRA 3SK3A 3VGLA 1DKGD 3HTVA 4KI6A 2P9PB 1VQNN 3NMUA 3SAFA 1C0MA 3V9SA 1KAXA 5CHIA 1KFDA 3ALYA 3FFKB 2JWKA 4FWRA 3EE9A 4FLYA 3RR7A 3ULEA 3O3GA 3VQCA 2D1KA 2P9KB 4IDKA 1ATNA 4OPJA 3HVTA 4H5RA 4BR0A 4F8RA 2E2PA 1YAGA 3O9RA 5M1NA 1O1WA 1HPZA 4WE1A 3TSQA 2F96A 1LV5A 4KHUA 1WSGA 4PKGA 4CEOA 4CIFA 4OPHA 1TYQA 4CHPA 3TPQA 1D4XA 2YX6A 4DWIA 4A2AA 4DSLA 3TARA 3EO3A 3K5OA 1F21A 1BQMA 5IWAK 4JK8A 3FZHA 4E1JA 1BA0A 4FWKA 1NGDA 5HRRA 3SV3A 3PV8A 3QERA 1KXPA 3ZX0A 4RTFD 1JJ2M 4FXDA 3CJ1A 3HVRA 4FLUA 1IG9A 1VQ8N 1GOCA 4CF2A 1EQYA 2HNDA 3ENHA 3CMAN 1T7PA 2QWQA 3DAWA 1WAJA 3F9MA 1KLNA 4BQLA 3N4QA 5GIPA 1TKXA 1HKCA 1RDWX 4A59A 3JXUA 3KLHA 3K58A 3CCQN 1GLDG 4B1WB 2OPRA 3T19A 2WOMA 3FZLA 4MLEA 5AQIA 4FL9A 2D0CA 3LP1A 1BL3A 4JRQA 2KFZA 3I0RA 3S41A 3V1RA 1QSSA 5AZJA 3LWLA 4N76A 4DR7K 1NJXA 2PY5A 3VF2A 1IBLK 2HSTA 2KW4A 1V4SA 3SBGA 4DU4A 2G8VA 4OJRA 1YT3A 4BRMA 4DTSA 3QETA 4LF7K 4E1NA 4HTLA 4BVPA 1P8ZA 1EP4A 3AVAA 1J53A 3KHYA 4CFDA 2YHWA 3G0ZA 3D2FA 1OH8A 5HP1A 4J2EA 4XH1A 4CEQA 4HWIA 4CE9A 1S6QA 1KD1O 1TYQB 5FROA 4KB1A 1JXEA 1NGCA 2J4RA 4N47A 2HBLA 4DTOA 3T3FA 1NK8A 3OYBA 3VETA 1XHXA 4DF8A 3F2KA 3S9HA 2OPSA 4BQZA 5KGXA 1SKRA 3R3LA 1ZBHA 1S6PA 2VWBA 3QMLA 2VG5A 4JI5K 1RT6A 3CFRA 4FJLA 4FVUA 1VK0A 1CXUA 3A5OC 5AQFA 3G6EN 5LL6Z 3CC7N 1G99A 1TK8A 1MWKA 4CBXA 5FRNA 1KAZA 4AM7A 3ZSOA 3OJSA 5AQZA 2BANA 3HZ6A 1NOZA 4M41A 4WFNL 4H4OA 4RW6A 2Y1IA 3VQAA 2DFHA 3F9KA 1LOTB 3MEGA 4H0TB 4YOWA 3ZEUA 3M8RA 4FWPA 4GV3A 4IEEA 3DI6A 1EKEA 4AHSA 1I39A 1P90A 3AO3A 1Q82O 3ATUA 3CFPA 3PIPL 3W3DA 1NGJA 1FKOA 4KH5A 1WBDA 3K2PA 3WNEA 5AQGA 1Q9XA 1R59O 4W5QA 2WBNA 3DXMA 3L3UA 4W5TA 1LAWA 4BDPA 3KK1A 3B8AX 3R9PA 1U04A 2PYJA 3HJFA 5FPDA 3CXCM 1KFSA 5ELZA 1A5XA 2HF4A 4JYAK 2YHBA 3HOTA 4AM6A 3ZT2A 3HT3A 2QWRA 4LF8K 4W5NA 5BPNA 3AO1A 4DR1K 4PKHA 2JWLA 3H1QA 3LDLA 4FLZA 3TU5A 4JD2A 1IBKK 2YI1A 3THXB 5E26A 1OH6A 3B6PA 1T05A 3OY9A 1HYVA 5BRDA 3CG7A 3M8SA 3GL1A 2KFNA 2KHOA 1NOYA 4A5BA 3SQ2A 4CJKA 4JK9A 3HPGA 3DLRA 3P1GA 4BREA 1TK0A 1IKWA 5TKWA 2PYLA 4OPKA 2F4VK 4F9OA 2P51A 3PY8A 2VYPA 1SZ2A 3O3HA 3LM2A 3EY1A 3A5LC 4FK0A 3J7AP 4DLEA 2D0PA 3QEVA 1IH7A 3DYAA 3IDHA 1ASUA 1TVRA 2DFFA 2O8EB 4YY3K 1QQNA 3TAQA 3MWPA 1OH7A 3QEIA 1QZ5A 1RTHA 4KHYA 2ZD1A 1JLQA 4CGGA 2DPNA 3VERA 4FK4A 3A5MC 4O8KA 4PL7A 3NF6A 3EL2A 3A5NC 3U3GA 4AHVA 3NCIA 2EWSA 3K0SA 1NMDA 1A5WA 3VF6A 2W42A 1XUPO 3FLCO 3A0IX 3QIOA 4KTQA 3CCMN 3ID6A 3KWGA 5AQWA 1ATRA 4FWLA 4KV8A 5CYQA 4BRCA 2CH6A 3MN9A 4IG0A 3ZSVA 4FYDA 2Z1HA 1NM1A 3OS2A 4CZIA 3I0SA 2GEMA 2Z1IA 1XMQK 4K0KK 5KI6A 3RRGA 3C95A 2NRRA 3SV4A 2NRZA 5E41A 2XRIA 1HQEA 3HSTB 4JV5K 1NKBA 4EIAA 3BDPA 3CJBA 4LD0A 2GTDA 3TR8A 3C7NB 5LMNK 1FKPA 4FLXA 3FZMA 1N34K 1QSLA 1ZBFA 3SAHA 5H1SQ 4I6MB 3WEEA 1BIUA 4X62K 4B9QA 4BC2A 1L3TA 3PLAA 3TI0A 4XH4A 2YNIA 1NGAA 3QBXA 3OYMA 2E1YA 2O8CA 1KVCA 3BGRA 2W41A 4BRHA 4CF9A 3OYEA 4CZEA 3TAMA 3ZETA 4W5RA 2DTUA 5FRMA 4M3TA 3HM9A 4BRAA 5SWMA 4FJ7A 1LCUA 3L2WA 1HMVA 1JCEA 4ID5A 3QO9A 1BQNA 3LANA 3Q7CA 2O8FB 1JLAA 1A5VA 3WXJA 4CFBA 3HOSA 4AHUA 4OX9K 5F1XA 1WSIA 4A62A 4IEIA 4FO0A 2V7YA 3F73A 4GV9A 4CERA 3TWHA 3MN6A 3QICA 3RSEA 4M3WA 1CLQA 1VQ9N 4H0VB 2IVPA 5JMVA 5JLHA 5AR0A 4N56A 4PQUA 3AY9A 2HNZA 3HPHA 3AARA 1QTMA 2QA4N 1WOQA 4Z4EA 4ELUA 2Q97A 4IFEA 1YVUA 2QTDA 3VQ4A 2KKZA 5JLFA 3CQYA 2ZJPL 1LWCA 3DOKA 4ILJA 4MDAA 1N36K 4X65K 1BI4A 3LPUA 3VENA 1X3MA 4RW7A 1U2VB 4NCGA 4CJ4A 3QESA 2UXCK 4CHQA 3DLLL 3EKUA 3FZKA 5HRSA 2W40A 4YOXA 3KLIA 4JHDA 2XHBA 5EY4A 2HBJA 4XIUA 4V19S 1TKDA 2QWPA 1RT7A 3CJAA 1YF5L 5C15A 4PL8A 2HVIA 3VQ6A 3DXKB 3ZETB 4FJKA 5I9EB 4FJHA 2PBDA 1S1UA 2BUPA 2IC3A 2G8UA 1XNRK 3PSIA 4FOEA 1WSEA 1S1TA 4DCHA 4DQ8A 2FBXA 2X6NA 2QI2A 3WQTA 1SUQA 2G8IA 4DU3A 4BR5A 1C6VA 1NGIA 4CD1A 3VF4A 3NHGA 3R1XA 2P9NB 3DMJA 1HQUA 5C2FA 3ATVA 4JKBA 2ZGYA 3ENOA 3TTDA 3MAQA 4BE2A 5KQDA 3LM9A 2QEXN 3B6OA 4YHHK 2VWKA 1NK0A 4DR2K 3Q7BA 4BR9A 3V6DA 3PX4A 3RWUA 5AQNA 5DMRA 3VTHA 1NJIO 2CGLA 3CCVN 3VPZA 2P5GA 5J2QA 4KI4A 3CPWM 1RT4A 4K41A 1Q7YO 2E88A 4DFPA 1BISA 3NF9A 1C0UA 3LAMA 1KSPA 3EE8A 3A8YA 3HL8A 4ID1A 3C65A 2P9LB 4QAGA 1HYSA 3UE5A 5GADP 1TAUA 3TSUA 3OYJA 4EP5A 4O5BA 3R6MA 1HYZA 4BR7A 1ILYA 3MX5A 3ZCMA 1DEJA 4LSNA 2F9TA 1KRPA 2BTFA 3ZSXA 3O8MA 3DRPA 5JICA 4JI6K 3ZX3A 3SYZA 3O4WA 3M5RA 4YOYA 4UY8O 3VEVA 4UQGA 4U67L 4B08A 4CD3A 3E9OA 3NGZA 4I2QA 4CEZA 4DV6K 5AFUA 4IFVA 2Z1GA 2YCHA 1GLJO 1MU2A 4E0DA 3MCPA 3M1FA 4IBNA 2IVOA 1HNXK 4W5OA 3QIPA 4FZYA 1ZXOA 2OCEA 3RMCA 2VGMA 1M1KO 1YJ9N 4NCBA 3IG1A 3SUOA 3ZT0A 4OPAA 4CGHA 1HNIA 3V9UA 4RG8A 3WXIA 2Q3SA 4HTUA 3PO5A 4H0PA 4OGEA 3O3FA 2H3GX 4CIEA 4LY7A 2XY7A 5HRNA 2Q0RA 3NGIA 1S72N 1HNVA 4I9LA 2YHYA 2NUBA 2P5OA 3AVGA 2A1SA 4X64K 4CGFA 4BC4A 3THYA 1VQ5N 4EFHA 4A2BA 2P9UB 4FJ5A 1SKWA 4CJLA 4IDHA 2O8BA 4M3UA 1K6YA 4IFYA 4ZTJA 5ADXA 3OTOK 3SCXA 3DJCA 1BOTO 1BDGA 3R8EA 4C8MA 2E5LK 1EO1A 2VWJA 1NGGA 4PWDA 2ZQBA 4Z4HA 1HUXA 3FE1A 3NH1A 3EN9A 3O1BA 3I8DA 4JI8K 1B9DA 1VSKA 1JLEA 3O9QA 2OTLN 2PFUA 3VGMA 3C6AA 4GVEA 4PA1A 4R79A 5AQLA 5ADXH 2D5RA 1WSFA 4H0XB 2NLXA 3A2FA 2O4GA 3U8XA 1NK5A 3SPZA 1U48A 2WTUA 5HOOA 1N33K 2ASPA 3TTCA 1VSLA 2P9SB 2JGUA 3VOVA 4HVJA 3C0BA 1Z26A 3O08A 4CJPA 1JKHA 1DGKN 5LMUK 2RE2A 1QHTA 1BU6O 3OYLA 4KB0A 4JN4A 4CBUA 4DV4K 3VQ5A 1EWQA 3AV9A 1NJZA 4FJ8A 1HPMA 3QBWA 1YXQA 5BPLA 4DFMA 3O9UA 4OKKA 5FPEA 1NK4A 4M3XA 3JYTA 4RCHA 3NF7A 2NRHA 3S3NA 1CZAN 3DRSA 4NB4A 3THYB 3E01A 1TL3A 3LZIA 3L2VA 5AZIA 3VEOA 4DV0K 1X1PA 3ZSYA 3F5TA 3AA5X 4CZJA 4DR5K 4CK1A 3MXMA 4F4KA 4ELTA 1BCOA 1NJWA 2UUBK 1NLVA 2YKMA 1HNWK 3OYIA 3ULEB 3TTFA 1KVBA 1NKEA 3L2QA 1ZBIA 5GIOA 4CJUA 4CEBA 4CF1A 4IG3A 5AQQA 2QWMA 3WXKA 3NFAA 1N32K 2RPIA 4DTUA 2Q1NA 4DS4A 4EHTA 4PHTX 4YDUC 1GLEG 1HR0K 4DB3A 3OW2M 1VQ4N 3M8PA 4EZ9A 3FZFA 4FM0A 1T44A 2ZJRL 4BC5A 3NAEA 3RRHA 2ZM6K 1VSDA 4C8NA 4K8XA 1LW0A 1Z05A 2IOCA 3L0QA 1HX1A 3DLBA 2UUCK 1UAXA 3KWIA 4BRDA 3VMFB 5GINA 5KTQA 4JKCA 3MK6A 1OKJA 5JS2A 3DRRA 1IG8A 4CZHA 3SBTA 3OYFA 3O80A 2HW3A 4O4GA 1YJNN 2Z1JA 2ETJA 4DHYA 3KLFA 4NLBA 4EZ6A 4LF9K 3OHRA 3S3OA 4LF6K 4OGCA 2ITGA 1CXQA 5GAEP 2PAVA 3OYNA 4DUZK 2NNWA 3NH0A 3LL3A 2D0OA 1ZC6A 4JKGA 3MXJA 4LF5K 2OTJN 5AZIB 5AZJB 1S5JA 4BDZA 4G9ZA 3ZLJA 1HKGA 2KZZA 2BE2A 4MDBA 1GLLO 2NZTA 3T1HK 1O13A 4CEEA 1YHQN 4NXMK 3TAGA 1YIJN 1RBTA 3BF3A 1VSMA 4IO9L 5AQPA 5C25A 1RBUA 4C23A 2OPPA 3QINA 3D2FB 3MWTA 4M42A 4Z94A 4M3RA 3NGYA 4J8FA 2G8FA 4HUGA 1W7AA 5B8HA 1BIZA 3PX0A 4DKWA 1XI1A 1RBVA 4WQ5C 1RBSA 5AQTA 1YJWN 1BUPA 1TK5A 3HXMA 3MN5A 4CJVA 3OYKA 3AVCA 1Z25A 5C24A 4DFJA 3BZCA 4KHSA 3RMDA 4DTNA 4LFBK 2YV0X 1DTTA 4BRLA 4ZTFA 4DQSA 2GUIA 1BO5O 2X78A 3BZKA 1I3AA 2WC9A 4FWQA 1EXQA 3VQQA 4CGIA 1S1XA 4DS5A 4BVOA 2E8AA 2FC0A 1FXXA 1Z6RA 3CETA 4Z0UA 1RT5A 1IJJA 4NYNA 4GV6A 3D45A 3NF8A 4FZZA 2PZSA 2FF3B 3WXLA 5F0XA 3I56N 4F2RA 3KK7A 1ESVA 5M1FA 1K8KA 4BR4A 1T3VA 3MDQA 4YDUA 3ZEUB 5SZTA 1K8AO 3K5NA 1SL2A 1TUYA 5AQOA 4H5VA 4BGAA 2RN2A 3CCLN 4K42A 2QK9A 4HHTA 1VRTA 2HBMA 4KREA 3W0LA 2W6KA 2GBZA 3TAEA 5D3GA 2VG7A 1S1WA 1NKCA 3HSCA 3MEDA 3OJUA 5J2NA 4DLGA 3DXMB 3VA3A 3UKRA 1D9FA 2QM1A 4FWOA 3E1YA 1KVAA 2HHXA 3KIOA 3AA4A 4IKFA 3SMSA 4ILHA 1S22A 3D2EA 3PO4A 1HNZK 4N5SA 4CK3A 2FBYA 3GE1A 1U49A 5LJVA 4JD2B 3CIPA 4I9QA 2GUPA 4F3TA 1VQON 3VEZA 1RGIA 4ISGA 1SS6A 2EX3A 1KTQA 1YITN 4FWMA 3RTVA 3O5BA 1SKSA 1L3VA 4BR2A 3BF1A 4AHTA 1TGOA 4DR4K 1RT2A 3H1VX 3AVKA 2W6LA
chains in the Genus database with same CATH topology
4X62K 4AQYK 3JAMO 4DV2K 4X64K 2VQEK 2UU9K 5BR8K 4LFBK 2UXDK 4LF4K 4DV3K 4JI5K 2F4VK 1N32K 4B3SK 3T1YK 4CW7B 1XMOK 1HR0K 3OTOK 5LL6Z 4YHHK 4DUYK 4DR2K 2E5LK 4DR3K 3J7AP 5IWAK 1XNQK 2ZM6K 4CVNE 5FLXO 4GKKK 4LFCK 4JI8K 4YY3K 4JI3K 2UUCK 4OX9K 2UXBK 4KHPK 4LFAK 4JI2K 4NXNK 2VQFK 1FJGK 4LF9K 4LF6K 5IT9O 4DV5K 1N33K 4DR6K 4DUZK 5A2QO 4DV7K 4JI6K 1N36K 5LMUK 3J7YP 4X65K 4LF5K 4DR7K 4DV6K 2UXCK 1IBLK 4DV4K 4DV1K 4JYAK 1XMQK 4K0KK 1HNXK 4LF8K 3J81O 4GKJK 3T1HK 3J80O 4JI4K 4LF7K 4JI0K 4DR1K 5AJ3K 4B3MK 2HHHK 4NXMK 1HNZK 4V19S 1IBKK 4JV5K 4B3TK 4DV0K 1IBMK 4JI1K 4B3RK 5LMNK 4DR5K 2UUAK 1J5EK 4X66K 1N34K 4DR4K 1I94K 4JI7K 2UUBK 1XNRK 1HNWK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 K;  4AQY K;  3JAM O;  4DV2 K;  4X64 K;  2VQE K;  2UU9 K;  5BR8 K;  4LFB K;  2UXD K;  4LF4 K;  4DV3 K;  4JI5 K;  2F4V K;  1N32 K;  4B3S K;  3T1Y K;  4CW7 B;  1XMO K;  1HR0 K;  3OTO K;  5LL6 Z;  4YHH K;  4DUY K;  4DR2 K;  2E5L K;  4DR3 K;  3J7A P;  5IWA K;  1XNQ K;  2ZM6 K;  4CVN E;  5FLX O;  4GKK K;  4LFC K;  4JI8 K;  4YY3 K;  4JI3 K;  2UUC K;  4OX9 K;  2UXB K;  4KHP K;  4LFA K;  4JI2 K;  4NXN K;  2VQF K;  1FJG K;  4LF9 K;  4LF6 K;  5IT9 O;  4DV5 K;  1N33 K;  4DR6 K;  4DUZ K;  5A2Q O;  4DV7 K;  4JI6 K;  1N36 K;  5LMU K;  3J7Y P;  4X65 K;  4LF5 K;  4DR7 K;  4DV6 K;  2UXC K;  1IBL K;  4DV4 K;  4DV1 K;  4JYA K;  1XMQ K;  4K0K K;  1HNX K;  4LF8 K;  3J81 O;  4GKJ K;  3T1H K;  3J80 O;  4JI4 K;  4LF7 K;  4JI0 K;  4DR1 K;  5AJ3 K;  4B3M K;  2HHH K;  4NXM K;  1HNZ K;  4V19 S;  1IBK K;  4JV5 K;  4B3T K;  4DV0 K;  1IBM K;  4JI1 K;  4B3R K;  5LMN K;  4DR5 K;  2UUA K;  1J5E K;  4X66 K;  1N34 K;  4DR4 K;  1I94 K;  4JI7 K;  2UUB K;  1XNR K;  1HNW K; 
#chains in the Genus database with same CATH topology
 3M6G A;  2BDP A;  4Q0B A;  5BPM A;  2AP1 A;  1BGX T;  4K8Z A;  4H8K A;  3C6U A;  1QVF M;  5KGW A;  4RW9 A;  2O4I A;  2GEL A;  2G8W A;  3ZSW A;  3MCA B;  5BR8 K;  1DLO A;  2ZWH A;  2O8D A;  4F3O A;  2ZJQ L;  1VQL N;  5HBM A;  3HYF A;  1N6Q A;  4OLB A;  3WNG A;  4M7X A;  4DQQ A;  4CJ5 A;  1C1C A;  1ZBS A;  1QHA A;  1LWE A;  4XH5 A;  5FLX O;  1IO2 A;  3NH2 A;  3MN7 A;  3NVM A;  4QS8 A;  1YTU A;  1MA9 B;  3C94 A;  4NO7 A;  2FXU A;  3LZJ A;  3VQD A;  5C2D A;  3IRX A;  2HVH A;  3MEE A;  3BUZ B;  3LWM A;  5E84 A;  5AQR A;  1X9M A;  5FPN A;  4DMN A;  3U3Y A;  1IV0 A;  5AQJ A;  3CD6 N;  1JL1 A;  1XC3 A;  1FW6 A;  4KHQ A;  2VQF K;  4O55 A;  1BHL A;  3BY5 A;  3OS1 A;  3RVC A;  1RT1 A;  2Q31 A;  3SZ2 A;  1SL0 A;  1FK9 A;  1XHZ A;  4M63 C;  2ASM A;  3D7E O;  4KHN A;  1JLG A;  3L4I A;  1C0T A;  4DV7 K;  3OBW A;  1RTI A;  1Q81 O;  2RKI A;  5CR4 A;  4O0I A;  4O0J A;  4Z4I A;  3CI5 A;  4CJT A;  4CEF A;  2B4J A;  4CFA A;  3ZYY X;  3OYG A;  1E4G T;  3QEX A;  4CK2 A;  3H6E A;  4B3M K;  1KC8 O;  2P9I A;  3GOI A;  3UB5 A;  4I7F A;  2Y1J A;  4DQP A;  3CC4 N;  5J2P A;  1MWM A;  3AAP A;  3CCE N;  1UA1 A;  4FJJ A;  1GOA A;  3CFO A;  3TAB A;  2HMI A;  4Z4C A;  4WFA L;  1WB9 A;  3KLG A;  4B8C A;  2RHK A;  4KFB A;  3M3Z A;  2LSN A;  4IZ9 A;  2HNY A;  3WEE B;  2A3Z A;  3LDQ A;  3AGK A;  3N4P A;  4E7H A;  5JVG L;  4PY5 A;  3ZSZ A;  2ITM A;  3QNN A;  2A40 A;  3GG4 A;  4LF4 K;  1NBW A;  2O8C B;  4OVL A;  4U7B A;  3OA9 A;  4JKA A;  1XMO K;  3LDS A;  3ZT3 A;  3DLG A;  2YHA A;  5C42 A;  3FFI A;  5BR9 A;  3D6R A;  1IKY A;  3WUH A;  4DR3 K;  3SUN A;  3VQP A;  4FJI A;  4FPA A;  3V9X A;  4E3S A;  2OA8 A;  1HRH A;  1J5O A;  1DT9 A;  2JLE A;  4A61 A;  3SPY A;  2IIR A;  1C0G A;  2FBV A;  4ISE A;  1MDU B;  3THW A;  4BY9 C;  3UKU A;  3E9L A;  4BRK A;  3LP2 A;  1V4T A;  2V52 B;  3UIQ A;  3VN5 A;  1E3M A;  2E2Q A;  2OAN A;  1VSJ A;  3L3V A;  3RSE B;  4BRO A;  4NCA A;  4H0O A;  4B1V A;  3L6Q A;  3ASM A;  3TAP A;  1NGH A;  1ASW A;  4FWS A;  1XWL A;  2HHU A;  2P9I B;  4DTP A;  1RTD A;  4BRG A;  2XO7 A;  4FJG A;  3H3O B;  3HPO A;  3VES A;  1RT3 A;  1XC9 A;  1OVY A;  1NGB A;  1BI4 B;  1TAQ A;  3IMX A;  1WSH A;  2X6S A;  4FJ9 A;  3JS6 A;  5BRH A;  4PUO A;  4JNE A;  3SJJ A;  1CZ9 A;  3KD5 E;  5M1P A;  4FW2 A;  2HOE A;  3V1Q A;  2HHH K;  1TL1 A;  4JHD B;  4LC9 B;  3KK2 A;  4H03 B;  4CJQ A;  1K73 O;  2P9P A;  3K59 A;  1NK9 A;  4KH4 A;  4GVM A;  1VQM N;  1QVG M;  1ITG A;  2KZM A;  3HBT A;  4CJW A;  5LJW A;  1J9A A;  2A5X A;  2P9K A;  4BRQ A;  4B9T A;  4BDY A;  4CJF A;  5FDL A;  4CES A;  4G1Q A;  5KPZ A;  4E7J A;  4E7K A;  1Y64 A;  3U6F A;  2WON A;  4I2P A;  5BN9 A;  5BRE A;  4CJ7 A;  1RDC A;  4WCE L;  1NG9 A;  3THW B;  4ELV A;  4JKF A;  4FVM A;  1XQS C;  1EET A;  4B3S K;  3KKR A;  4CW7 B;  3M8Q A;  5CY4 A;  3IAY A;  1YUW A;  3U9D A;  3PSF A;  3CC2 N;  4DUY K;  5AFU H;  3SAG A;  3CJC A;  3T1A A;  1XNQ K;  3O1W A;  4B1U B;  5HRO A;  4BRI A;  3O4Q A;  1UA0 A;  4C8L A;  1GLB G;  2F8S A;  3OYH A;  4DTR A;  3OVN A;  3QFP A;  1W0H A;  4CF8 A;  1JCF A;  4QS9 A;  2UXB K;  2QWN A;  1RNH A;  4RWT A;  4EP4 A;  5CYM A;  1T03 A;  5J2M A;  4DTX A;  3RR8 A;  1GLA G;  3AVF A;  4LFA K;  3KJV A;  4DU1 A;  5EXW A;  4E7L A;  3DOL A;  3V9W A;  2GV9 A;  4CBW A;  4DV5 K;  3CQ8 A;  3S3M A;  3OYC A;  2KTQ A;  3K5L A;  1S3X A;  3V1O A;  1WNS A;  3J7Y P;  2FSN A;  4EAH D;  3AA2 A;  3NVK A;  1C0F A;  4JEP A;  3KK3 A;  4BRP A;  3O9S A;  2GX9 A;  2ATQ A;  4KTW A;  4L8R B;  5J1E A;  4CED A;  3J80 O;  4N41 A;  3PIO L;  3K9K A;  2WUS A;  1T6C A;  3E9P A;  3JSM A;  3ISN C;  4JLH A;  3HK2 A;  3FR0 A;  3QLH A;  4RW4 A;  2HHT A;  3V4I A;  3CME N;  4BG9 A;  4DSE A;  2OZM A;  2E2N A;  4C8K A;  4Y0W A;  2IAJ A;  3VGK A;  4JAX A;  4JI1 K;  2VGN A;  4OKJ A;  3VQE A;  1L3U A;  2HHS A;  2Q36 A;  2FLO A;  5AQY A;  1T8E A;  1I94 K;  3AO4 A;  4JS4 A;  1EWR A;  3P38 A;  1VQ6 N;  2F9W A;  4AQY K;  2I7P A;  3CJ7 A;  2VG6 A;  3JAM O;  4FWN A;  4IWV A;  3IFR A;  4CFC A;  2UXD K;  1JLC A;  3MMV A;  2UYT A;  4Z4F A;  4MO4 A;  3H08 A;  4PKI A;  3VQ9 A;  2B6A A;  3CER A;  3TAF A;  3CCJ N;  2O8B B;  5C0Y A;  5T7B A;  4FW1 A;  1K9M O;  1VSE A;  3V81 A;  4FLV A;  4O44 A;  1YVN A;  3WQU A;  3CF5 L;  4FLT A;  1IKV A;  3THV A;  1YTA A;  2FSK A;  3NDK A;  2HB5 A;  4HCC A;  1NGF A;  1TV6 A;  4AF1 A;  4OKE A;  1BWF O;  1JLF A;  2EHG A;  3G4S N;  1LAV A;  4H4M A;  5CE3 A;  4YFU A;  2YNG A;  3L4Q A;  3VEW A;  5HRP A;  1NGE A;  1EX4 A;  4ISF A;  4TSX A;  3DWL A;  4IO8 A;  4B9S A;  5BRF A;  2ASO A;  1WAF A;  3K57 A;  3K9J A;  4BRN A;  4B9U A;  1JCG A;  1VQP N;  3CJ9 A;  4EHU A;  1WSJ A;  3KD1 E;  1B9F A;  5AQM A;  4JKD A;  4BE1 A;  2YKN A;  2I5J A;  4M7Y A;  3ULD A;  2IGI A;  3G10 A;  4ICL A;  4H5W A;  2AJQ A;  3I55 N;  5I42 A;  1RTJ A;  2QW9 A;  4BWJ A;  1HLU A;  4CJS A;  4A57 A;  3SNN A;  1Q18 A;  2QKK A;  2X74 A;  1NK7 A;  4YOU A;  4JI4 K;  4OO1 J;  2QXF A;  4O8U A;  5EOY A;  4AIL C;  3THX A;  3HRG A;  3P83 D;  4KBO A;  1RFQ A;  1SAZ A;  1KAY A;  4DTM A;  2A6A A;  4FM1 A;  3LPT A;  3MX2 A;  2BGG A;  1OH5 A;  4KTZ A;  3P5J A;  4QOZ B;  3BP8 A;  3H46 O;  4B1Y B;  3EZ5 A;  3TAN A;  4B3O A;  3AVJ A;  2I7N A;  4CHN A;  4IOC L;  4B8A B;  3K5M A;  2UU9 K;  1U47 A;  1NK6 A;  3OYD A;  5M1K A;  4DV3 K;  1KLM A;  3T1Y K;  3AVN A;  3ZX2 A;  4DTJ A;  4B9M A;  1NNE A;  2HBK A;  4YOT A;  4CHO A;  1LWF A;  3VQB A;  3BEX A;  3ITH A;  4H0Y B;  2E2O A;  5AQK A;  3HP6 A;  4F2S A;  2O8E A;  4FOI A;  3ZT1 A;  3WNH A;  2CGJ A;  4FPB A;  1X9J A;  3L2R A;  1QE1 A;  4XEI A;  3IKM A;  1J54 A;  4IJN A;  2QWL A;  4J2B A;  1VSF A;  3QDK A;  2OZS A;  4E19 A;  3AVB A;  2VCP A;  2NRW A;  3T7Z A;  4CF0 A;  4NXN K;  3SJH A;  4CIG A;  1T6D A;  4B1X B;  2G8H A;  2KLA A;  4JS5 A;  4MO5 A;  1RIL A;  4C1N I;  1WBB A;  2B5J A;  1M90 O;  2NRV A;  2YJE A;  1WUA A;  5JS1 A;  5A2Q O;  3SQ1 A;  5TKY A;  4GMJ B;  5AQS A;  3VQ8 A;  3L8B A;  2HMP A;  1GLF O;  4MFB A;  1KCF A;  4C8O A;  2GWK A;  4JK7 A;  2WFB A;  4JKG B;  5M1O A;  3ZT4 A;  4J2D A;  2Q2R A;  1GLC G;  3VA0 A;  4YNQ A;  2Q0U A;  4DV1 K;  4IOX A;  2FBT A;  3J81 O;  1X9S A;  4DG1 A;  2OPQ A;  4GY2 B;  1NU0 A;  4DQR A;  1D9D A;  2A1R A;  5DM7 L;  1U6Z A;  4BRF A;  3EZW A;  3U4L A;  4LSL A;  3OS0 A;  1SQK A;  1JL2 A;  3KKS A;  1RBR A;  3AGR A;  3LP0 A;  4O5F A;  3KTQ A;  4IXC A;  2E20 A;  5AQV A;  1VHX A;  3O4N A;  3C7N A;  1SV5 A;  1IBM K;  4NYF A;  1J5E K;  3DLH A;  4I6M A;  4CI6 A;  2HHW A;  1RCH A;  4BAC A;  3KZB A;  3LDP A;  4J2A A;  1VQK N;  3WT0 A;  4M3Y A;  3CCU N;  3L2U A;  2VQE K;  2G8K A;  1SL1 A;  5EVZ A;  3LAL A;  3PX6 A;  3TSP A;  3P31 A;  4B9N A;  4GNI A;  3NE6 A;  4ZHR A;  3PUF A;  1ASV A;  4E89 A;  2ZE2 A;  5JVH L;  4WQ4 C;  4CGJ A;  3SI6 A;  1QQC A;  5CZ1 A;  5F2R A;  3QEP A;  3J7Z O;  1VSI A;  3AVL A;  2O8F A;  4CVN E;  4E7I A;  4MQ3 A;  3EYZ A;  3LDN A;  4KHW A;  4JRP A;  3I33 A;  2IVN A;  2P1J A;  2F8T A;  1ZBU A;  3EEQ A;  1IKX A;  2V51 B;  3GDQ A;  4CZF A;  3QFU A;  2E4L A;  3SQ0 A;  1K8K B;  2XY8 A;  4YOR A;  3AAQ A;  4CGD A;  3O6W A;  5DM6 L;  4KH6 A;  4WQ5 A;  5AQX A;  4HCB A;  1D5A A;  4CHZ A;  4Z4G A;  4FJN A;  3SLC A;  3VEY A;  2YNF A;  3P4I A;  4WYB A;  3HP9 A;  4B9L A;  4AHR A;  4OLA A;  4DQI A;  4NLC A;  3IUC A;  5GAH P;  3P39 A;  4H5N A;  4A5A A;  1U2V A;  5M1Q A;  1W2B M;  1G15 A;  4CJ3 A;  5C10 A;  4WF9 L;  2NRX A;  1D8Y A;  5AQU A;  3UKR B;  4FJX A;  3WNF A;  3CCS N;  1X9W A;  4FSV A;  4Y1C A;  5KPT A;  1S9E A;  4AHC A;  1U4B A;  3I8B A;  3CPE A;  4MLH A;  2CH5 A;  3D2E B;  4M3Z A;  2NRT A;  4DSK A;  4Q5V A;  1H1V A;  1QS4 A;  3CQX A;  4FZX C;  3NBP A;  4ILG B;  4BGB A;  4B3T K;  2D4W A;  3DXK A;  4QCL A;  4CZG A;  1TKZ A;  1U45 A;  5AQH A;  3CM5 A;  4B3R K;  4BG8 A;  1HJO A;  2YJF A;  2UUA K;  1LW2 A;  3AVM A;  3WXM B;  3J8A A;  4JI7 K;  1RDD A;  1DTQ A;  4BWM A;  4YOV A;  1E4F T;  3RMB A;  4DSI A;  1Q9Y A;  2QKB A;  5CZ2 A;  3QB0 A;  3AO2 A;  2P9N A;  5KRT A;  3FGU A;  3ENB A;  3GBT A;  3H3N O;  2D0B A;  4DF4 A;  1CZB A;  3O9T A;  2O8D B;  5C12 A;  1VQ7 N;  1C1A A;  3T69 A;  1S1V A;  1BG3 A;  4E1M A;  5I3U A;  1TUU A;  5KPR A;  1J6Z A;  5LY3 A;  2FSJ A;  2OYQ A;  4GKK K;  2CGK A;  4LFC K;  4HUF A;  1KQS M;  4K43 A;  3ZSQ A;  4JI3 K;  3VTI A;  1RDA A;  3HM8 A;  4IOA L;  2P9L A;  3HI0 A;  4KRF A;  4B1Z A;  5MLC Q;  4WQ4 A;  4JI2 K;  4H5T A;  1WN7 A;  1L5U A;  4FK2 A;  1HKB A;  4HUE A;  1FJG K;  2IS3 A;  2DFE A;  4CZM A;  3MXI A;  5KRS A;  4Y1D A;  3E66 A;  1GOB A;  1OVQ A;  3OBY A;  1RDB A;  3DLE A;  3LAK A;  1UOC A;  3G71 N;  3CCR N;  4GW6 A;  2GWJ A;  1TKT A;  3AA3 A;  1RDU A;  5GAG P;  3LP3 A;  4R5P A;  3SUQ A;  1WLJ A;  3QNO A;  4CZK A;  1BA1 A;  3LDO A;  5FPM A;  3DLK A;  4KPY A;  2HHV A;  4CEA A;  3DM2 A;  4L3Q A;  2E6M A;  4JI0 K;  4FJM A;  4BC3 A;  2ZGZ A;  4JKH A;  1X3N A;  2BH1 A;  1Y97 A;  1YI2 N;  3V9Z A;  3AVH A;  4FCY A;  1Q86 O;  1ZBL A;  1JXB A;  1UWB A;  5DK5 A;  4CCH A;  2AA4 A;  4X66 K;  2E6L A;  4B9V A;  5KQ8 A;  1VRU A;  2YNH A;  1W9H A;  3MEC A;  1VSH A;  4DV2 K;  3CYM A;  4JKE A;  4CJE A;  2DY4 A;  5BN8 A;  1QZ6 A;  1JLB A;  4DSJ A;  4CJR A;  2P9U A;  4WFB L;  4FM2 A;  2XY5 A;  3KVG A;  4KO0 A;  4DSF A;  3RMA A;  3OYA A;  4LH4 A;  4LH5 A;  1N8R O;  3SQ4 A;  2FF6 A;  4IJA A;  1QQM A;  2YHX A;  5EX5 A;  1NJY A;  1ATS A;  4QS7 A;  4K25 A;  4CZL A;  1NMN A;  1QQO A;  3ID8 A;  2XY6 A;  1S9G A;  2RF2 A;  1C1B A;  1Q8I A;  3D0P A;  2V7Z A;  2R7Y A;  3C6H A;  4KHP K;  3VQ7 A;  3CM6 A;  3AVI A;  3SMP A;  3SUP A;  3HO1 A;  3QEW A;  2E1Z A;  3EKS A;  3UKU B;  1B92 A;  2HF3 A;  3U9Z A;  3IS9 A;  3KLE A;  5HL7 L;  1L3S A;  1R0A A;  1HJR A;  3VEX A;  5HLF A;  2QXL A;  5IT9 O;  3C6T A;  2IDO A;  4DR6 K;  2P9S A;  3AO5 A;  4AH9 A;  1REV A;  4BE0 A;  2A41 A;  3H45 C;  4M45 A;  4KAZ A;  4KKO A;  4CEC A;  4FLW A;  2ZF5 O;  1BCM A;  2A42 A;  2F7T A;  2QWO A;  5K14 A;  2HHQ A;  4CHY A;  1ZYQ A;  4GKJ K;  4C1N K;  2KQ2 A;  1QSY A;  3G25 A;  5AJ3 K;  4DFK A;  1VAZ A;  5EU7 A;  1N5Y A;  1NWK A;  2D0A A;  3CHW A;  1W97 L;  4RW8 A;  3ZSR A;  3SK3 A;  3VGL A;  1DKG D;  3HTV A;  4KI6 A;  2P9P B;  1VQN N;  3NMU A;  3SAF A;  1C0M A;  3V9S A;  1KAX A;  5CHI A;  1KFD A;  3ALY A;  3FFK B;  2JWK A;  4FWR A;  3EE9 A;  4FLY A;  3RR7 A;  3ULE A;  3O3G A;  3VQC A;  2D1K A;  2P9K B;  4IDK A;  1ATN A;  4OPJ A;  3HVT A;  4H5R A;  4BR0 A;  4F8R A;  2E2P A;  1YAG A;  3O9R A;  5M1N A;  1O1W A;  1HPZ A;  4WE1 A;  3TSQ A;  2F96 A;  1LV5 A;  4KHU A;  1WSG A;  4PKG A;  4CEO A;  4CIF A;  4OPH A;  1TYQ A;  4CHP A;  3TPQ A;  1D4X A;  2YX6 A;  4DWI A;  4A2A A;  4DSL A;  3TAR A;  3EO3 A;  3K5O A;  1F21 A;  1BQM A;  5IWA K;  4JK8 A;  3FZH A;  4E1J A;  1BA0 A;  4FWK A;  1NGD A;  5HRR A;  3SV3 A;  3PV8 A;  3QER A;  1KXP A;  3ZX0 A;  4RTF D;  1JJ2 M;  4FXD A;  3CJ1 A;  3HVR A;  4FLU A;  1IG9 A;  1VQ8 N;  1GOC A;  4CF2 A;  1EQY A;  2HND A;  3ENH A;  3CMA N;  1T7P A;  2QWQ A;  3DAW A;  1WAJ A;  3F9M A;  1KLN A;  4BQL A;  3N4Q A;  5GIP A;  1TKX A;  1HKC A;  1RDW X;  4A59 A;  3JXU A;  3KLH A;  3K58 A;  3CCQ N;  1GLD G;  4B1W B;  2OPR A;  3T19 A;  2WOM A;  3FZL A;  4MLE A;  5AQI A;  4FL9 A;  2D0C A;  3LP1 A;  1BL3 A;  4JRQ A;  2KFZ A;  3I0R A;  3S41 A;  3V1R A;  1QSS A;  5AZJ A;  3LWL A;  4N76 A;  4DR7 K;  1NJX A;  2PY5 A;  3VF2 A;  1IBL K;  2HST A;  2KW4 A;  1V4S A;  3SBG A;  4DU4 A;  2G8V A;  4OJR A;  1YT3 A;  4BRM A;  4DTS A;  3QET A;  4LF7 K;  4E1N A;  4HTL A;  4BVP A;  1P8Z A;  1EP4 A;  3AVA A;  1J53 A;  3KHY A;  4CFD A;  2YHW A;  3G0Z A;  3D2F A;  1OH8 A;  5HP1 A;  4J2E A;  4XH1 A;  4CEQ A;  4HWI A;  4CE9 A;  1S6Q A;  1KD1 O;  1TYQ B;  5FRO A;  4KB1 A;  1JXE A;  1NGC A;  2J4R A;  4N47 A;  2HBL A;  4DTO A;  3T3F A;  1NK8 A;  3OYB A;  3VET A;  1XHX A;  4DF8 A;  3F2K A;  3S9H A;  2OPS A;  4BQZ A;  5KGX A;  1SKR A;  3R3L A;  1ZBH A;  1S6P A;  2VWB A;  3QML A;  2VG5 A;  4JI5 K;  1RT6 A;  3CFR A;  4FJL A;  4FVU A;  1VK0 A;  1CXU A;  3A5O C;  5AQF A;  3G6E N;  5LL6 Z;  3CC7 N;  1G99 A;  1TK8 A;  1MWK A;  4CBX A;  5FRN A;  1KAZ A;  4AM7 A;  3ZSO A;  3OJS A;  5AQZ A;  2BAN A;  3HZ6 A;  1NOZ A;  4M41 A;  4WFN L;  4H4O A;  4RW6 A;  2Y1I A;  3VQA A;  2DFH A;  3F9K A;  1LOT B;  3MEG A;  4H0T B;  4YOW A;  3ZEU A;  3M8R A;  4FWP A;  4GV3 A;  4IEE A;  3DI6 A;  1EKE A;  4AHS A;  1I39 A;  1P90 A;  3AO3 A;  1Q82 O;  3ATU A;  3CFP A;  3PIP L;  3W3D A;  1NGJ A;  1FKO A;  4KH5 A;  1WBD A;  3K2P A;  3WNE A;  5AQG A;  1Q9X A;  1R59 O;  4W5Q A;  2WBN A;  3DXM A;  3L3U A;  4W5T A;  1LAW A;  4BDP A;  3KK1 A;  3B8A X;  3R9P A;  1U04 A;  2PYJ A;  3HJF A;  5FPD A;  3CXC M;  1KFS A;  5ELZ A;  1A5X A;  2HF4 A;  4JYA K;  2YHB A;  3HOT A;  4AM6 A;  3ZT2 A;  3HT3 A;  2QWR A;  4LF8 K;  4W5N A;  5BPN A;  3AO1 A;  4DR1 K;  4PKH A;  2JWL A;  3H1Q A;  3LDL A;  4FLZ A;  3TU5 A;  4JD2 A;  1IBK K;  2YI1 A;  3THX B;  5E26 A;  1OH6 A;  3B6P A;  1T05 A;  3OY9 A;  1HYV A;  5BRD A;  3CG7 A;  3M8S A;  3GL1 A;  2KFN A;  2KHO A;  1NOY A;  4A5B A;  3SQ2 A;  4CJK A;  4JK9 A;  3HPG A;  3DLR A;  3P1G A;  4BRE A;  1TK0 A;  1IKW A;  5TKW A;  2PYL A;  4OPK A;  2F4V K;  4F9O A;  2P51 A;  3PY8 A;  2VYP A;  1SZ2 A;  3O3H A;  3LM2 A;  3EY1 A;  3A5L C;  4FK0 A;  3J7A P;  4DLE A;  2D0P A;  3QEV A;  1IH7 A;  3DYA A;  3IDH A;  1ASU A;  1TVR A;  2DFF A;  2O8E B;  4YY3 K;  1QQN A;  3TAQ A;  3MWP A;  1OH7 A;  3QEI A;  1QZ5 A;  1RTH A;  4KHY A;  2ZD1 A;  1JLQ A;  4CGG A;  2DPN A;  3VER A;  4FK4 A;  3A5M C;  4O8K A;  4PL7 A;  3NF6 A;  3EL2 A;  3A5N C;  3U3G A;  4AHV A;  3NCI A;  2EWS A;  3K0S A;  1NMD A;  1A5W A;  3VF6 A;  2W42 A;  1XUP O;  3FLC O;  3A0I X;  3QIO A;  4KTQ A;  3CCM N;  3ID6 A;  3KWG A;  5AQW A;  1ATR A;  4FWL A;  4KV8 A;  5CYQ A;  4BRC A;  2CH6 A;  3MN9 A;  4IG0 A;  3ZSV A;  4FYD A;  2Z1H A;  1NM1 A;  3OS2 A;  4CZI A;  3I0S A;  2GEM A;  2Z1I A;  1XMQ K;  4K0K K;  5KI6 A;  3RRG A;  3C95 A;  2NRR A;  3SV4 A;  2NRZ A;  5E41 A;  2XRI A;  1HQE A;  3HST B;  4JV5 K;  1NKB A;  4EIA A;  3BDP A;  3CJB A;  4LD0 A;  2GTD A;  3TR8 A;  3C7N B;  5LMN K;  1FKP A;  4FLX A;  3FZM A;  1N34 K;  1QSL A;  1ZBF A;  3SAH A;  5H1S Q;  4I6M B;  3WEE A;  1BIU A;  4X62 K;  4B9Q A;  4BC2 A;  1L3T A;  3PLA A;  3TI0 A;  4XH4 A;  2YNI A;  1NGA A;  3QBX A;  3OYM A;  2E1Y A;  2O8C A;  1KVC A;  3BGR A;  2W41 A;  4BRH A;  4CF9 A;  3OYE A;  4CZE A;  3TAM A;  3ZET A;  4W5R A;  2DTU A;  5FRM A;  4M3T A;  3HM9 A;  4BRA A;  5SWM A;  4FJ7 A;  1LCU A;  3L2W A;  1HMV A;  1JCE A;  4ID5 A;  3QO9 A;  1BQN A;  3LAN A;  3Q7C A;  2O8F B;  1JLA A;  1A5V A;  3WXJ A;  4CFB A;  3HOS A;  4AHU A;  4OX9 K;  5F1X A;  1WSI A;  4A62 A;  4IEI A;  4FO0 A;  2V7Y A;  3F73 A;  4GV9 A;  4CER A;  3TWH A;  3MN6 A;  3QIC A;  3RSE A;  4M3W A;  1CLQ A;  1VQ9 N;  4H0V B;  2IVP A;  5JMV A;  5JLH A;  5AR0 A;  4N56 A;  4PQU A;  3AY9 A;  2HNZ A;  3HPH A;  3AAR A;  1QTM A;  2QA4 N;  1WOQ A;  4Z4E A;  4ELU A;  2Q97 A;  4IFE A;  1YVU A;  2QTD A;  3VQ4 A;  2KKZ A;  5JLF A;  3CQY A;  2ZJP L;  1LWC A;  3DOK A;  4ILJ A;  4MDA A;  1N36 K;  4X65 K;  1BI4 A;  3LPU A;  3VEN A;  1X3M A;  4RW7 A;  1U2V B;  4NCG A;  4CJ4 A;  3QES A;  2UXC K;  4CHQ A;  3DLL L;  3EKU A;  3FZK A;  5HRS A;  2W40 A;  4YOX A;  3KLI A;  4JHD A;  2XHB A;  5EY4 A;  2HBJ A;  4XIU A;  4V19 S;  1TKD A;  2QWP A;  1RT7 A;  3CJA A;  1YF5 L;  5C15 A;  4PL8 A;  2HVI A;  3VQ6 A;  3DXK B;  3ZET B;  4FJK A;  5I9E B;  4FJH A;  2PBD A;  1S1U A;  2BUP A;  2IC3 A;  2G8U A;  1XNR K;  3PSI A;  4FOE A;  1WSE A;  1S1T A;  4DCH A;  4DQ8 A;  2FBX A;  2X6N A;  2QI2 A;  3WQT A;  1SUQ A;  2G8I A;  4DU3 A;  4BR5 A;  1C6V A;  1NGI A;  4CD1 A;  3VF4 A;  3NHG A;  3R1X A;  2P9N B;  3DMJ A;  1HQU A;  5C2F A;  3ATV A;  4JKB A;  2ZGY A;  3ENO A;  3TTD A;  3MAQ A;  4BE2 A;  5KQD A;  3LM9 A;  2QEX N;  3B6O A;  4YHH K;  2VWK A;  1NK0 A;  4DR2 K;  3Q7B A;  4BR9 A;  3V6D A;  3PX4 A;  3RWU A;  5AQN A;  5DMR A;  3VTH A;  1NJI O;  2CGL A;  3CCV N;  3VPZ A;  2P5G A;  5J2Q A;  4KI4 A;  3CPW M;  1RT4 A;  4K41 A;  1Q7Y O;  2E88 A;  4DFP A;  1BIS A;  3NF9 A;  1C0U A;  3LAM A;  1KSP A;  3EE8 A;  3A8Y A;  3HL8 A;  4ID1 A;  3C65 A;  2P9L B;  4QAG A;  1HYS A;  3UE5 A;  5GAD P;  1TAU A;  3TSU A;  3OYJ A;  4EP5 A;  4O5B A;  3R6M A;  1HYZ A;  4BR7 A;  1ILY A;  3MX5 A;  3ZCM A;  1DEJ A;  4LSN A;  2F9T A;  1KRP A;  2BTF A;  3ZSX A;  3O8M A;  3DRP A;  5JIC A;  4JI6 K;  3ZX3 A;  3SYZ A;  3O4W A;  3M5R A;  4YOY A;  4UY8 O;  3VEV A;  4UQG A;  4U67 L;  4B08 A;  4CD3 A;  3E9O A;  3NGZ A;  4I2Q A;  4CEZ A;  4DV6 K;  5AFU A;  4IFV A;  2Z1G A;  2YCH A;  1GLJ O;  1MU2 A;  4E0D A;  3MCP A;  3M1F A;  4IBN A;  2IVO A;  1HNX K;  4W5O A;  3QIP A;  4FZY A;  1ZXO A;  2OCE A;  3RMC A;  2VGM A;  1M1K O;  1YJ9 N;  4NCB A;  3IG1 A;  3SUO A;  3ZT0 A;  4OPA A;  4CGH A;  1HNI A;  3V9U A;  4RG8 A;  3WXI A;  2Q3S A;  4HTU A;  3PO5 A;  4H0P A;  4OGE A;  3O3F A;  2H3G X;  4CIE A;  4LY7 A;  2XY7 A;  5HRN A;  2Q0R A;  3NGI A;  1S72 N;  1HNV A;  4I9L A;  2YHY A;  2NUB A;  2P5O A;  3AVG A;  2A1S A;  4X64 K;  4CGF A;  4BC4 A;  3THY A;  1VQ5 N;  4EFH A;  4A2B A;  2P9U B;  4FJ5 A;  1SKW A;  4CJL A;  4IDH A;  2O8B A;  4M3U A;  1K6Y A;  4IFY A;  4ZTJ A;  5ADX A;  3OTO K;  3SCX A;  3DJC A;  1BOT O;  1BDG A;  3R8E A;  4C8M A;  2E5L K;  1EO1 A;  2VWJ A;  1NGG A;  4PWD A;  2ZQB A;  4Z4H A;  1HUX A;  3FE1 A;  3NH1 A;  3EN9 A;  3O1B A;  3I8D A;  4JI8 K;  1B9D A;  1VSK A;  1JLE A;  3O9Q A;  2OTL N;  2PFU A;  3VGM A;  3C6A A;  4GVE A;  4PA1 A;  4R79 A;  5AQL A;  5ADX H;  2D5R A;  1WSF A;  4H0X B;  2NLX A;  3A2F A;  2O4G A;  3U8X A;  1NK5 A;  3SPZ A;  1U48 A;  2WTU A;  5HOO A;  1N33 K;  2ASP A;  3TTC A;  1VSL A;  2P9S B;  2JGU A;  3VOV A;  4HVJ A;  3C0B A;  1Z26 A;  3O08 A;  4CJP A;  1JKH A;  1DGK N;  5LMU K;  2RE2 A;  1QHT A;  1BU6 O;  3OYL A;  4KB0 A;  4JN4 A;  4CBU A;  4DV4 K;  3VQ5 A;  1EWQ A;  3AV9 A;  1NJZ A;  4FJ8 A;  1HPM A;  3QBW A;  1YXQ A;  5BPL A;  4DFM A;  3O9U A;  4OKK A;  5FPE A;  1NK4 A;  4M3X A;  3JYT A;  4RCH A;  3NF7 A;  2NRH A;  3S3N A;  1CZA N;  3DRS A;  4NB4 A;  3THY B;  3E01 A;  1TL3 A;  3LZI A;  3L2V A;  5AZI A;  3VEO A;  4DV0 K;  1X1P A;  3ZSY A;  3F5T A;  3AA5 X;  4CZJ A;  4DR5 K;  4CK1 A;  3MXM A;  4F4K A;  4ELT A;  1BCO A;  1NJW A;  2UUB K;  1NLV A;  2YKM A;  1HNW K;  3OYI A;  3ULE B;  3TTF A;  1KVB A;  1NKE A;  3L2Q A;  1ZBI A;  5GIO A;  4CJU A;  4CEB A;  4CF1 A;  4IG3 A;  5AQQ A;  2QWM A;  3WXK A;  3NFA A;  1N32 K;  2RPI A;  4DTU A;  2Q1N A;  4DS4 A;  4EHT A;  4PHT X;  4YDU C;  1GLE G;  1HR0 K;  4DB3 A;  3OW2 M;  1VQ4 N;  3M8P A;  4EZ9 A;  3FZF A;  4FM0 A;  1T44 A;  2ZJR L;  4BC5 A;  3NAE A;  3RRH A;  2ZM6 K;  1VSD A;  4C8N A;  4K8X A;  1LW0 A;  1Z05 A;  2IOC A;  3L0Q A;  1HX1 A;  3DLB A;  2UUC K;  1UAX A;  3KWI A;  4BRD A;  3VMF B;  5GIN A;  5KTQ A;  4JKC A;  3MK6 A;  1OKJ A;  5JS2 A;  3DRR A;  1IG8 A;  4CZH A;  3SBT A;  3OYF A;  3O80 A;  2HW3 A;  4O4G A;  1YJN N;  2Z1J A;  2ETJ A;  4DHY A;  3KLF A;  4NLB A;  4EZ6 A;  4LF9 K;  3OHR A;  3S3O A;  4LF6 K;  4OGC A;  2ITG A;  1CXQ A;  5GAE P;  2PAV A;  3OYN A;  4DUZ K;  2NNW A;  3NH0 A;  3LL3 A;  2D0O A;  1ZC6 A;  4JKG A;  3MXJ A;  4LF5 K;  2OTJ N;  5AZI B;  5AZJ B;  1S5J A;  4BDZ A;  4G9Z A;  3ZLJ A;  1HKG A;  2KZZ A;  2BE2 A;  4MDB A;  1GLL O;  2NZT A;  3T1H K;  1O13 A;  4CEE A;  1YHQ N;  4NXM K;  3TAG A;  1YIJ N;  1RBT A;  3BF3 A;  1VSM A;  4IO9 L;  5AQP A;  5C25 A;  1RBU A;  4C23 A;  2OPP A;  3QIN A;  3D2F B;  3MWT A;  4M42 A;  4Z94 A;  4M3R A;  3NGY A;  4J8F A;  2G8F A;  4HUG A;  1W7A A;  5B8H A;  1BIZ A;  3PX0 A;  4DKW A;  1XI1 A;  1RBV A;  4WQ5 C;  1RBS A;  5AQT A;  1YJW N;  1BUP A;  1TK5 A;  3HXM A;  3MN5 A;  4CJV A;  3OYK A;  3AVC A;  1Z25 A;  5C24 A;  4DFJ A;  3BZC A;  4KHS A;  3RMD A;  4DTN A;  4LFB K;  2YV0 X;  1DTT A;  4BRL A;  4ZTF A;  4DQS A;  2GUI A;  1BO5 O;  2X78 A;  3BZK A;  1I3A A;  2WC9 A;  4FWQ A;  1EXQ A;  3VQQ A;  4CGI A;  1S1X A;  4DS5 A;  4BVO A;  2E8A A;  2FC0 A;  1FXX A;  1Z6R A;  3CET A;  4Z0U A;  1RT5 A;  1IJJ A;  4NYN A;  4GV6 A;  3D45 A;  3NF8 A;  4FZZ A;  2PZS A;  2FF3 B;  3WXL A;  5F0X A;  3I56 N;  4F2R A;  3KK7 A;  1ESV A;  5M1F A;  1K8K A;  4BR4 A;  1T3V A;  3MDQ A;  4YDU A;  3ZEU B;  5SZT A;  1K8A O;  3K5N A;  1SL2 A;  1TUY A;  5AQO A;  4H5V A;  4BGA A;  2RN2 A;  3CCL N;  4K42 A;  2QK9 A;  4HHT A;  1VRT A;  2HBM A;  4KRE A;  3W0L A;  2W6K A;  2GBZ A;  3TAE A;  5D3G A;  2VG7 A;  1S1W A;  1NKC A;  3HSC A;  3MED A;  3OJU A;  5J2N A;  4DLG A;  3DXM B;  3VA3 A;  3UKR A;  1D9F A;  2QM1 A;  4FWO A;  3E1Y A;  1KVA A;  2HHX A;  3KIO A;  3AA4 A;  4IKF A;  3SMS A;  4ILH A;  1S22 A;  3D2E A;  3PO4 A;  1HNZ K;  4N5S A;  4CK3 A;  2FBY A;  3GE1 A;  1U49 A;  5LJV A;  4JD2 B;  3CIP A;  4I9Q A;  2GUP A;  4F3T A;  1VQO N;  3VEZ A;  1RGI A;  4ISG A;  1SS6 A;  2EX3 A;  1KTQ A;  1YIT N;  4FWM A;  3RTV A;  3O5B A;  1SKS A;  1L3V A;  4BR2 A;  3BF1 A;  4AHT A;  1TGO A;  4DR4 K;  1RT2 A;  3H1V X;  3AVK A;  2W6L A; 
#chains in the Genus database with same CATH homology
 4X62 K;  4AQY K;  3JAM O;  4DV2 K;  4X64 K;  2VQE K;  2UU9 K;  5BR8 K;  4LFB K;  2UXD K;  4LF4 K;  4DV3 K;  4JI5 K;  2F4V K;  1N32 K;  4B3S K;  3T1Y K;  4CW7 B;  1XMO K;  1HR0 K;  3OTO K;  5LL6 Z;  4YHH K;  4DUY K;  4DR2 K;  2E5L K;  4DR3 K;  3J7A P;  5IWA K;  1XNQ K;  2ZM6 K;  4CVN E;  5FLX O;  4GKK K;  4LFC K;  4JI8 K;  4YY3 K;  4JI3 K;  2UUC K;  4OX9 K;  2UXB K;  4KHP K;  4LFA K;  4JI2 K;  4NXN K;  2VQF K;  1FJG K;  4LF9 K;  4LF6 K;  5IT9 O;  4DV5 K;  1N33 K;  4DR6 K;  4DUZ K;  5A2Q O;  4DV7 K;  4JI6 K;  1N36 K;  5LMU K;  3J7Y P;  4X65 K;  4LF5 K;  4DR7 K;  4DV6 K;  2UXC K;  1IBL K;  4DV4 K;  4DV1 K;  4JYA K;  1XMQ K;  4K0K K;  1HNX K;  4LF8 K;  3J81 O;  4GKJ K;  3T1H K;  3J80 O;  4JI4 K;  4LF7 K;  4JI0 K;  4DR1 K;  5AJ3 K;  4B3M K;  2HHH K;  4NXM K;  1HNZ K;  4V19 S;  1IBK K;  4JV5 K;  4B3T K;  4DV0 K;  1IBM K;  4JI1 K;  4B3R K;  5LMN K;  4DR5 K;  2UUA K;  1J5E K;  4X66 K;  1N34 K;  4DR4 K;  1I94 K;  4JI7 K;  2UUB K;  1XNR K;  1HNW K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...