1B92A

Mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
144
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGAVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTEGRASE)
publication title The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 53
structure length 144
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1b92A00
2OPQA 2EHGA 4FLWA 4DFKA 4KAZA 4KTWA 2PY5A 3MXJA 3HP9A 1XHXA 3HSTB 4RW9A 3I0SA 5FROA 4DQRA 3DLHA 3F73A 2VWJA 1L3UA 3OS0A 4OGEA 3LZIA 4ICLA 5D3GA 3AV9A 1LV5A 4EP5A 4FW2A 3U6FA 3QEXA 5FRNA 4DQIA 4OPKA 3AA5X 3OYDA 3OYLA 1S5JA 4CJ4A 4KHWA 4AH9A 4CJLA 2HHQA 1LAWA 4CIEA 4LY7A 2QXFA 1JXEA 1KRPA 1IG9A 1EX4A 1JLCA 4DF4A 2D0CA 2KTQA 2O4IA 4Z4FA 5HRPA 1J54A 3HM9A 4FCYA 4KB1A 1O1WA 4I2QA 3V1OA 1I39A 3I8DA 4W5RA 3PY8A 3SPZA 3HO1A 1RBSA 3VQQA 3AVHA 1RDAA 3OJSA 4F2SA 3JSMA 2B4JA 3AVIA 2QKKA 4HHTA 3C6TA 3MEDA 4DQPA 4M3YA 2ATQA 2IC3A 4F3OA 4IG0A 2PYLA 3AVBA 1CZBA 4BDZA 3KK3A 4CGHA 4FLTA 3UIQA 3LZJA 1KSPA 3OYAA 1DTTA 4CFAA 1ASUA 3OYEA 1HQUA 2YKMA 3DRRA 1NK0A 1RBTA 3VQ5A 4PUOA 2PYJA 4OJRA 4H4OA 1U04A 3IS9A 3I0RA 4UQGA 2XHBA 3KTQA 4KHNA 3ZT1A 5KGWA 4O5BA 5SWMA 1BI4A 3V6DA 2BGGA 2A1SA 4KHUA 5C25A 1SKRA 4KB0A 1JLFA 1S1UA 4OPJA 5J2MA 1UWBA 3AA4A 5EU7A 4ID1A 2PZSA 1WAFA 3QLHA 2GBZA 5CYMA 3SUOA 3QEPA 3V1RA 3HP6A 4KI6A 3CFRA 4CJSA 1TK5A 3V9XA 1NJZA 2RKIA 4FVMA 1CXQA 3KJVA 4O44A 4C8KA 3OYCA 2HHWA 2RF2A 3F9KA 3VQEA 3SPYA 3V9UA 3DLBA 1A5XA 1TV6A 4B3OA 1UOCA 4N47A 1RBRA 2DFEA 3WNHA 5J1EA 3RR7A 3DLKA 4RW6A 1TKXA 3ZSQA 4AHTA 4CHZA 3LWMA 4KKOA 2HHSA 3OS2A 2E6MA 3B6PA 4EZ9A 1IKYA 2YKNA 3ZCMA 5KTQA 2OZSA 1WSJA 1VSFA 2IS3A 4XIUA 3SQ4A 1I3AA 4E7KA 4DTUA 3THVA 1KLNA 4OKEA 1S1TA 4IFYA 3NAEA 1NKCA 5I3UA 3HJFA 1NK8A 3SJJA 5C24A 1ASVA 3V1QA 2IGIA 2W42A 4KV8A 4AHUA 3L2UA 3OYGA 1TGOA 3KD5E 2G8HA 3ZT3A 5HP1A 3AA3A 4KTZA 3HT3A 2JGUA 3LAMA 4Q5VA 1G15A 3M8RA 1LWCA 1QSLA 1WNSA 1CLQA 1J53A 3CM6A 4FJNA 2DY4A 1CXUA 1NKBA 1LW0A 3VQ6A 4N56A 4CJQA 4FXDA 3DRPA 4NCBA 3CFOA 3TANA 3ZT2A 4KHQA 1JLBA 1T03A 4RW8A 3L2RA 4DFMA 3C6UA 2O4GA 1VSJA 1NK6A 4DF8A 4OKKA 4Q0BA 2HW3A 1A5VA 1ZBUA 1IKXA 2AJQA 3AVMA 2HNZA 4NCGA 4CHQA 3HPGA 3D0PA 3SQ1A 4J2EA 2HHTA 2HB5A 4M42A 3WNGA 4C8OA 4J2AA 3SUQA 3NH0A 5CZ1A 1NOZA 4CEEA 3VQAA 3NH1A 1XC9A 1RDCA 2F96A 3DOKA 4F4KA 1VSLA 3OYJA 3DLGA 4CE9A 4E1NA 1C0MA 1XWLA 3KLHA 1KFDA 4FLZA 3DM2A 2KFZA 1Z25A 3O3FA 3KKSA 4ELVA 4FJJA 4DTSA 4LSNA 4NYFA 2Y1IA 3ISNC 1T05A 3IRXA 1JXBA 2X6SA 4Z4IA 3L2QA 3SCXA 4JS4A 1Y97A 4Y1CA 4CJVA 1RT2A 2HNDA 3AVKA 1JLGA 3ASMA 3AO1A 4C8NA 4KRFA 3HPHA 4HCCA 2X78A 3OJUA 3G10A 3ZSWA 2YHAA 3NF7A 4CK3A 4B9TA 4K8ZA 4Z4HA 4CIGA 1BHLA 3NGIA 3PO5A 4FZZA 3O4QA 4DS4A 2I5JA 4DTXA 1Q9YA 3OS1A 3HYFA 1SL2A 3OYHA 1JL1A 3DLRA 4CJKA 3U3YA 3SUPA 1QHTA 4YNQA 3TAQA 3M8QA 4DTNA 3QEWA 3T1AA 4OVLA 4DLGA 3EY1A 3AO5A 4DTMA 1C6VA 2KZZA 4C8LA 3RWUA 1KVCA 1REVA 2KFNA 4M3RA 1GOAA 1S1XA 3VQ9A 1UA1A 4I9QA 3NGYA 3D45A 4DTRA 2HVHA 4FJKA 3LWLA 5J2NA 3BDPA 2P51A 2Q3SA 3RMDA 3KLFA 4L8RB 1BQMA 1S1WA 1VSIA 3QERA 4ZTFA 1KTQA 4DQQA 4E89A 3AO3A 1U48A 1NK4A 1JLQA 2RPIA 2WONA 3AO4A 4M3XA 5FRMA 2EX3A 4Z4EA 3NFAA 1YT3A 3OYIA 4ID5A 3NE6A 3VQ4A 4HUEA 5J2PA 4FZXC 4IKFA 4B9MA 3NF6A 4CEDA 4CJTA 1TK0A 1X9MA 4HCBA 3L3VA 3V81A 4PY5A 5HROA 4K8XA 2RN2A 2FBVA 3MEEA 3QO9A 4BDYA 3HPOA 4F2RA 1F21A 2FBYA 3NH2A 3QETA 1RTDA 3QIPA 1LWFA 4PA1A 3QEVA 4B9UA 4FK2A 4GW6A 4CERA 3L2VA 1XHZA 2KZMA 4KPYA 3ZSVA 2D0AA 3PX6A 1LWEA 1BCOA 2BDPA 4F3TA 4KREA 2DTUA 1NJXA 3PX0A 2JLEA 3L8BA 1RTHA 4FJLA 2P1JA 1SKSA 2ZE2A 1HQEA 4BWJA 1RT4A 1VSDA 3LPTA 1SV5A 3TAMA 1TL3A 5K14A 1ASWA 4HVJA 3NCIA 3CFPA 3MXIA 2GV9A 3KLEA 5FDLA 4CFDA 3K5LA 5CY4A 1WSGA 2VG7A 5CYQA 1WAJA 1FK9A 2VWKA 2P5OA 5JS1A 4W5TA 2XY6A 1VSHA 1NOYA 1J9AA 4BACA 3AVAA 1Z26A 1QTMA 4BWMA 1C1AA 4M3UA 2Z1IA 2HVIA 2B5JA 1VSEA 3LP2A 4Z4GA 4IBNA 3RRGA 1S6PA 4CEQA 4CJ3A 3OY9A 1N6QA 4B08A 4DSLA 4DMNA 3NBPA 1HNVA 4LSLA 4CGDA 4MFBA 2HMIA 2GUIA 1HMVA 1RBUA 2E6LA 4I2PA 5J2QA 1Q8IA 5DMRA 4OKJA 3HVTA 3ZSOA 1VK0A 1DLOA 4FJIA 4N41A 1YTAA 3IG1A 3OYMA 1TAQA 3TAEA 1K6YA 4RW4A 3LAKA 3K5OA 2B6AA 1DTQA 4J2BA 4CGIA 4OLAA 4DSEA 3O3GA 3CG7A 3QNNA 1UA0A 1D9FA 4MQ3A 3KLGA 3LDSA 4E3SA 2G8VA 1JL2A 4DS5A 1ZBHA 1QQCA 4TSXA 4QOZB 1U45A 1YTUA 2Z1HA 2YHBA 3OVNA 3QIOA 1D9DA 2Z1GA 4JRPA 4CFBA 3DMJA 4CJWA 1IO2A 3V9WA 4FLXA 3AA2A 3OYFA 4FJGA 3VQCA 4B9NA 3S3OA 2D5RA 1RILA 3AVLA 3HXMA 1SKWA 1S6QA 2XY5A 3G0ZA 4CF0A 3RMAA 3VQ7A 4GVMA 4O0JA 2FBTA 3CYMA 1NK9A 1RNHA 4CJEA 3B6OA 5CZ2A 1IKVA 4CESA 4CF9A 4FM0A 3AVCA 1BQNA 3C94A 3VQPA 1BI4B 4FM2A 1UAXA 1RCHA 3LPUA 3O4NA 2XRIA 2A1RA 1VSKA 3QINA 4DSKA 4JRQA 4CGJA 4CHNA 1RDBA 1KFSA 1TKTA 4FJXA 2OZMA 3S3NA 2P5GA 4KTQA 1KLMA 4CK2A 3MXMA 4E7JA 1TKDA 3ITHA 4Z0UA 3SV4A 3PV8A 3OYBA 3AVFA 3KIOA 3EZ5A 5DK5A 4FLUA 2IAJA 5HBMA 4RW7A 1X9SA 3NGZA 4B9LA 4IDKA 1C0TA 2NUBA 4ELTA 4N76A 2G8WA 2WOMA 3PO4A 4FZYA 5E41A 3H08A 3VA3A 1L3SA 5HRNA 1TVRA 3SUNA 1QSYA 5KRTA 4BE1A 2HHXA 5T7BA 1KVBA 4H8KA 3CQ8A 4DWIA 3ZSZA 4YFUA 4CGGA 2G8KA 4FJ7A 4C8MA 4ZHRA 4FLYA 2QK9A 4KO0A 3LANA 2ZD1A 4DTJA 4CHPA 4ZTJA 3SZ2A 1R0AA 1U49A 2Z1JA 4B9SA 4FJ9A 1VRTA 3VQ8A 4CJ5A 4M3ZA 2ITGA 1HYSA 4CEOA 4AILC 4O0IA 4CFCA 1T7PA 3K57A 3DI6A 1SL0A 3M8SA 4B8AB 3KLIA 4RG8A 1RBVA 1X1PA 2OPPA 4CHOA 3AVJA 4E7HA 2KQ2A 1BISA 3AVGA 2YNIA 1QS4A 2HNYA 4I7FA 3AVNA 5SZTA 4DFPA 4FJ8A 4BDPA 2OPRA 1WN7A 4DSFA 3RMBA 3HK2A 4DG1A 2IDOA 4FLVA 1NKEA 4DSIA 3A2FA 3TAGA 3RR8A 1LW2A 3SYZA 3MECA 4E0DA 4NYNA 1HNIA 4LH5A 4EZ6A 5KI6A 3QEIA 5C42A 3KK1A 3HVRA 3RMCA 3FFIA 3L2WA 3SQ2A 1S9EA 4FW1A 4KFBA 4AHVA 1U47A 4NCAA 4CEBA 3SNNA 1W9HA 4CF1A 4KI4A 3TABA 2DFFA 3PX4A 1A5WA 2E4LA 4M45A 4N5SA 1XI1A 1D8YA 4HUFA 3HL8A 1RT1A 4CECA 3WNFA 1EXQA 4BE0A 4DU1A 3TARA 1SL1A 3P1GA 1N5YA 4CCHA 4DU4A 4CHYA 2XY7A 3TI0A 1RDDA 4CF8A 4DU3A 1GOBA 3S3MA 2XY8A 4FM1A 3C95A 4FK0A 1D5AA 2BE2A 3NF9A 4J2DA 3AO2A 2YNFA 1T8EA 1WSHA 1L3TA 1SUQA 4OGCA 2OA8A 3RRHA 4FYDA 4LH4A 1TL1A 3QNOA 3LALA 5KGXA 3T19A 3BGRA 4FJMA 4DFJA 4B9VA 1NJYA 1BL3A 3ULDA 4HTUA 1CZ9A 2ETJA 3ZSRA 3O3HA 3TR8A 4E19A 3IAYA 4JLHA 1WSEA 3JYTA 1J5OA 4W5OA 1VSMA 2OPSA 4QCLA 2YNGA 1U4BA 4DTOA 3L3UA 1ITGA 2BANA 3WNEA 4CK1A 4FJ5A 2F8SA 1BIZA 2FBXA 3K58A 1VRUA 1IH7A 1ZYQA 4PWDA 1HYVA 4QAGA 3KD1E 3K2PA 4B8CA 1BGXT 1L5UA 3LP1A 3E01A 4IFVA 1FXXA 3ZT0A 3PUFA 1C1BA 1RT6A 4DQSA 1Q9XA 1ZBIA 1TAUA 2FC0A 3CM5A 4AHSA 3SQ0A 2HHUA 1EETA 3MEGA 4LD0A 4R5PA 4DSJA 1JLAA 1FKOA 5HRRA 3QESA 4CJRA 3U3GA 4O4GA 3TAFA 4DTPA 4Y1DA 3M8PA 3P5JA 4WE1A 1HYZA 3DYAA 3K5MA 4E7LA 1TK8A 1WSIA 2LSNA 1ZBFA 3DRSA 3TWHA 1RTJA 2G8UA 3DLEA 1LAVA 3DOLA 2D0BA 4CF2A 1ZBLA 4M3WA 4KHYA 4Z4CA 3KK2A 4E7IA 4M41A 3EYZA 3V4IA 3VN5A 4CEZA 1X9WA 4GMJB 4W5QA 3ALYA 4O55A 2YV0X 3TAPA 1NJWA 3K59A 4W5NA 1RTIA 4CJPA 1HJRA 4BE2A 2OYQA 2G8IA 1B9FA 1WSFA 4KHSA 4CIFA 2QKBA 3K5NA 4PQUA 3V9SA 1KVAA 2YNHA 1RT3A 4JS5A 1TKZA 1S9GA 1QSSA 3P83D 5I42A 3OYKA 3NF8A 2DFHA 4AHRA 4H4MA 5KRSA 2G8FA 1QE1A 2HHVA 1C1CA 3ZSXA 1MU2A 2VG6A 3T3FA 1RT5A 2KW4A 3LP0A 1GOCA 4ELUA 3VQDA 4G1QA 3NDKA 4HUGA 5HRSA 4EP4A 1JLEA 2IOCA 2X74A 3VA0A 4CEFA 4OLBA 1HPZA 3ZSYA 1C0UA 3MAQA 3SI6A 4AHCA 4DLEA 3VQBA 2ZQBA 1HRHA 1FKPA 1YVUA 3LP3A 3RTVA 1NK5A 4CJUA 4F8RA 1S1VA 1B92A 1RT7A 3V9ZA 4FJHA 4M3TA 4E1MA 1NK7A 1L3VA 1IKWA 1EP4A 1EKEA 1KCFA 1BCMA 1JKHA 1WLJA 4CGFA 3OYNA 3NHGA 3SV3A 4I9LA 2X6NA 3ZT4A 2Y1JA 4CEAA 1BIUA 2R7YA 5HLFA 3KKRA 4FK4A 2VG5A 2XO7A 5JS2A 4IG3A 1B9DA 3S9HA 1W0HA 4CJFA 2F8TA
chains in the Genus database with same CATH superfamily
5GIOA 1CZAN 4KAZA 3ULEB 4CZMA 3HP9A 3HSTB 4RW9A 3F73A 2VWJA 1L3UA 4PKHA 4OGEA 5HOOA 4ICLA 5D3GA 3D2FB 3CC2N 4EP5A 4DQIA 2BTFA 4I6MB 3OYLA 4CJ4A 3DWLA 4KHWA 4YOWA 2HHQA 5B8HA 3O9RA 4CIEA 4LY7A 1JXEA 1KRPA 1IG9A 1EX4A 2D0CA 5I9EB 2ASMA 1O1WA 4I2QA 3V1OA 1I39A 3I8DA 4W5RA 2WTUA 1RBSA 3VQQA 1RDAA 4HWIA 4F2SA 3HRGA 2B4JA 2QKKA 3C6TA 3TU5A 4M3YA 3KHYA 4XH4A 2RE2A 1YITN 4WFBL 5JVHL 1WOQA 4YY3K 3OYEA 2YKMA 1NK0A 1RBTA 3VQ5A 2OTJN 1HKBA 1U04A 4KHNA 1FJGK 5KGWA 4X62K 3V6DA 4KHUA 5C25A 5BRHA 1UWBA 3E9PA 3CD6N 3HP6A 1GLEG 3EL2A 3CFRA 2O8BB 2UUCK 3A8YA 4IFEA 2QA4N 3F9KA 5AQUA 3VQEA 3F5TA 4CW7B 4IJNA 1A5XA 4B3OA 4N47A 3CIPA 1MWMA 3O4WA 5AQYA 4DV2K 3T1HK 4DR6K 2E6MA 2P9SA 1IKYA 5M1PA 5KTQA 1ESVA 4DTUA 3THVA 1NKCA 5I3UA 5BN9A 1NK8A 3SJJA 4BRFA 2IGIA 4KV8A 2E20A 3N4QA 4IO9L 3GG4A 5C2FA 4IDHA 2G8HA 4BQLA 4LFAK 5HP1A 3WQTA 5C2DA 1E4GT 3HT3A 1QSLA 2OANA 3LDNA 3CERA 3CM6A 1CXUA 2QWNA 3VQ6A 4N56A 4CJQA 4FXDA 4NCBA 3CFOA 2CGKA 3TANA 4E1JA 5HL7L 2NRWA 4IXCA 3K0SA 4DF8A 1X9JA 4Q0BA 2HW3A 2P9PB 3T1YK 5LJWA 3D0PA 2HB5A 4M42A 4J2AA 3SUQA 2J4RA 3DOKA 3OYJA 4CE9A 1C0MA 3KLHA 3DM2A 1VQON 2E1ZA 4LSNA 4NYFA 1T05A 3I56N 3L2QA 5AQRA 5AQFA 4JS4A 1Y97A 4DV7K 4BRPA 4O5FA 4KRFA 4HCCA 1IG8A 3VEVA 4YOTA 1T3VA 5AQSA 4DKWA 4CIGA 3CCRN 4DTXA 3OYHA 4LF5K 2HF3A 5E84A 3TAQA 1NGIA 3E9OA 3QEWA 3T1AA 1KD1O 3QBWA 1C6VA 4C8LA 4DR7K 1KVCA 1REVA 3O80A 4M3RA 3D45A 2E2NA 3LWLA 5FPEA 5J2NA 3KLFA 3QB0A 4DQQA 4E89A 3AO3A 4WYBA 1NK4A 5GIPA 1VQLN 4CZKA 4H5VA 3VQ4A 4HUEA 4JI6K 3FGUA 4HCBA 3L3VA 4IO8A 4H0XB 4K8XA 4BDYA 3THWB 3QETA 4FK2A 2KZMA 4A62A 1BCOA 2BDPA 4KREA 2DTUA 2P9UB 1NJXA 3ZEUA 1X3MA 2P1JA 2ZE2A 1SKSA 3UKRA 1RT4A 1VSDA 4DSKA 3CFPA 1TL3A 3H3OB 3MXIA 4B1UB 4AF1A 4IZ9A 4WQ4C 5FDLA 4DV5K 4BC5A 1FW6A 5CYQA 1FK9A 3D2EA 2P5OA 5BN8A 4W5TA 1NOYA 3I55N 1J9AA 4BWMA 1C1AA 3VEYA 5C0YA 1NU0A 4X64K 4QS7A 4CZFA 1VQ5N 1N6QA 4BR5A 2D0PA 1Q7YO 2UXCK 4CGDA 2HMIA 5J2QA 2H3GX 4XEIA 1K6YA 3K5OA 1DTQA 2P9LB 3PLAA 3LDSA 1JL2A 4WF9L 4QOZB 1U45A 1YTUA 4ILJA 4YDUC 1TUUA 2ZJQL 4CFBA 2FF6A 2YHXA 4FLXA 4FJGA 4JHDA 1NMNA 2CGLA 3MX5A 3AVLA 4CF0A 2A41A 4GVMA 4O0JA 4CJEA 3B6OA 3AVCA 4R79A 2BH1A 1YVNA 4CZLA 2XRIA 4B1ZA 5FPMA 4FJXA 2OZMA 3UKUA 3O1WA 3SV4A 5DM7L 3GL1A 1QQMA 1SQKA 2UUAK 4B9LA 4N76A 1Q18A 2WOMA 2HHXA 1TVRA 4B9QA 1ATNA 5GAHP 1ATSA 4BE1A 3SUNA 3CQ8A 3ZSZA 2Q2RA 4IWVA 2P9SB 2ZD1A 4CHPA 1BO5O 4BRLA 1VQ9N 3QDKA 3VQ8A 4M3ZA 2ITGA 5BPLA 3FZKA 4PHTX 1NGGA 5CE3A 4O0IA 5AQZA 4RTFD 3K57A 3M8SA 3VGLA 4JNEA 1RBVA 4CHOA 3AVJA 4DV1K 3AVGA 2YNIA 4FJ8A 4EHTA 3WEEA 3J8AA 4IOAL 4DG1A 3SAHA 2Q31A 1NKEA 3TAGA 3RR8A 4B1VA 3MECA 4M7YA 3MWPA 3VEZA 4EZ6A 3HVRA 4A5BA 3SQ2A 2V51B 4JKEA 4CEBA 3MN5A 4CF1A 4FO0A 4KI4A 4N5SA 5M1OA 1OVYA 2FF3B 4CECA 2E2PA 4CHYA 2XY7A 3TI0A 4DU3A 3S3MA 2XY8A 3C95A 4FK0A 1D5AA 3NF9A 1JCGA 2YNFA 4NXMK 1NWKA 3ULDA 4HTUA 1CZ9A 3ZSRA 3L6QA 4E19A 5KQDA 1OKJA 1WSEA 3JYTA 3R3LA 2YNGA 1U4BA 4DTOA 4C23A 1OH8A 4H5TA 4FJ5A 5C12A 1BIZA 2F8SA 4PWDA 1NGCA 3W3DA 3J80O 4B8CA 3GDQA 1BGXT 4O8UA 3E01A 3SQ0A 5BREA 4DSJA 4NLCA 3QESA 3U3GA 2A40A 5H1SQ 3D2FA 1T44A 2WFBA 4DTPA 4Y1DA 3M8PA 1U2VB 2ZM6K 2LSNA 2PBDA 3DRSA 2G8UA 2ASOA 3DOLA 3H1QA 4KHYA 4Z4CA 3ENHA 3U9ZA 4W5QA 3SAGA 2YV0X 2QM1A 2OYQA 1WSFA 3ZEUB 2QKBA 3UKRB 1OH5A 3M1FA 4GKJK 4CZJA 4JS5A 1S9GA 1YXQA 4H0PA 4IEEA 2G8FA 2VG6A 2WBNA 3T3FA 3J7YP 1BU6O 4ELUA 4EP4A 1JLEA 3VA0A 1GLFO 4FSVA 1P8ZA 3NVMA 3VQBA 4JKCA 1S1VA 1B92A 3V9ZA 4M3TA 4JYAK 1ILYA 4CD1A 3QICA 1WLJA 1KCFA 1BCMA 3OYNA 5CR4A 2Y1JA 3ENBA 3SV3A 4I9LA 2X6NA 1RFQA 1BIUA 4FWQA 2R7YA 5JLHA 4FK4A 3FZLA 2JWKA 4IG3A 1B9DA 3S9HA 4CJFA 1U6ZA 3MN9A 2EHGA 2HOEA 4BRDA 3MXJA 5FROA 1XHXA 3DLHA 3LZIA 1HNXK 1LV5A 4AM6A 1RDUA 3C0BA 4OPKA 4JI0K 3OYDA 4FL9A 1S5JA 2QWMA 4CJLA 2QXFA 4FOEA 4XH5A 2DPNA 1JLCA 4DF4A 2KTQA 1VQPN 2O4IA 4GV9A 3FFKB 4Z4FA 2UU9K 3HM9A 3HO1A 4ISGA 4LF4K 3OJSA 3QMLA 2YHYA 3MEDA 4PKIA 3UKUB 4IG0A 1HNZK 1KSPA 3OYAA 2UYTA 4Y0WA 2YCHA 1BA1A 3IS9A 4UQGA 2XHBA 2E8AA 3ZT1A 1BI4A 2BGGA 5MLCQ 4OPJA 5J2MA 3VGMA 4A5AA 5EU7A 4ID1A 5AQWA 3V1RA 5IT9O 4A2BA 2W6KA 4CJSA 1WBDA 3E9LA 3V9XA 1NJZA 2RKIA 3CCUN 1CXQA 4BY9C 3KJVA 1BOTO 3VTIA 4C8KA 1VQ4N 2RF2A 3CPWM 2AA4A 3SPYA 3V9UA 3DLBA 1RGIA 1TV6A 2O8FA 1UOCA 1RBRA 3WNHA 4LF9K 3RR7A 4RW6A 3WEEB 4MLEA 4DR4K 4EZ9A 3B6PA 2A42A 5ADXH 4WFNL 1T6DA 1WSJA 4FWLA 2IS3A 4XIUA 3SQ4A 1KLNA 4IFYA 3NAEA 1OVQA 5C24A 2YHWA 3CCSN 4DR5K 1HJOA 3L2UA 4B3SK 3OYGA 2O8DA 4CD3A 3LAMA 3P39A 3M8RA 1G15A 1CLQA 1SS6A 1WNSA 3O08A 5AQLA 2DY4A 1NKBA 2W6LA 1J5EK 3ZT2A 4WQ5A 2O4GA 1VSJA 4BG9A 3OBWA 1IKXA 2FXUA 3M3ZA 2HNZA 4CHQA 5ELZA 3HPGA 4DV3K 4J2EA 3U9DA 3WNGA 4C8OA 4M63C 2P9UA 3VQAA 5E26A 1VSLA 1KFDA 5AQJA 3S41A 2P9IA 3O3FA 3KKSA 4ELVA 4FJJA 4DTSA 4Z4IA 1JXBA 2KHOA 2X6SA 3VOVA 4Y1CA 3ZX3A 5BR9A 3P31A 1JLGA 3BF1A 3AO1A 3HPHA 3VF6A 2X78A 3OJUA 3H46O 4Z4HA 1BHLA 3PO5A 4DS4A 3E1YA 3SUPA 5TKWA 1QHTA 4YNQA 1W97L 3M8QA 2UXBK 1V4SA 4JV5K 4BQZA 4MLHA 5AQOA 2KZZA 4I9QA 1GOAA 1S1XA 2A3ZA 4DTRA 2P9LA 2WC9A 1TUYA 4JI1K 1VSIA 2E88A 4O8KA 4ZTFA 2NRTA 4BR9A 1U48A 3ZETA 1JLQA 3TPQA 1Q82O 3AO4A 4M3XA 5FRMA 2EX3A 1H1VA 1LCUA 3OYIA 1TK0A 3VF2A 5ADXA 3MCPA 2BUPA 2JWLA 1QZ5A 4JKBA 4PKGA 2FBYA 2A5XA 1RTDA 3QEVA 3O9SA 4B9UA 4CERA 1NNEA 4KPYA 2V7YA 2D0AA 4JN4A 3PX6A 4F3TA 4YOUA 3PSIA 4CZGA 3L8BA 1RTHA 4FJLA 4BWJA 4HVJA 1QHAA 5K14A 3KLEA 5CY4A 2QW9A 4J8FA 2HHHK 2VG7A 2VWKA 3OW2M 3CJ7A 5JS1A 2XY6A 1VSHA 1EO1A 4BACA 1Z26A 2P9NA 3AVAA 3DXKA 1VSEA 3LP2A 3RRGA 4CEQA 4CJ3A 4DSLA 5LL6Z 4DMNA 4H5NA 3NBPA 3MK6A 4MFBA 4KBOA 4I2PA 1RBUA 3C7NA 4FJIA 4N41A 3IG1A 1ZC6A 3TAEA 4RW4A 4CGIA 4OLAA 3EKUA 1UA0A 3KLGA 4E3SA 3SMSA 1QQCA 2Z1HA 3E66A 1NGFA 4K43A 4JRPA 1IBLK 4CJWA 1MA9B 3HTVA 1IO2A 3AA2A 3VMFB 1SAZA 2A6AA 4OO1J 3S3OA 4NLBA 3HXMA 2PAVA 1SKWA 2XY5A 4K0KK 2QI2A 3G0ZA 4LFBK 3TTFA 4X66K 1NK9A 1RNHA 5AZIA 1M1KO 4CF9A 2ZGZA 4FM0A 1BQNA 3C94A 3VQPA 1BI4B 4LF7K 3O4NA 4CHNA 1RDBA 1TKTA 4A2AA 2P5GA 4KTQA 3AAPA 3CQYA 2QWLA 1NBWA 5AQMA 4FLUA 3ID8A 5AJ3K 4JKFA 3NGZA 4PL8A 1C0TA 3PO4A 4JI2K 4H5RA 3H08A 5E41A 3EE9A 3VA3A 4OX9K 2O8FB 3WQUA 4H8KA 4DWIA 3QBXA 3VTHA 4CGGA 5DM6L 4YFUA 3CF5L 1XMQK 4C8MA 4KO0A 2HF4A 3LANA 2GTDA 3SZ2A 2Z1JA 1VRTA 5KPTA 1HYSA 2I7PA 4AILC 1T7PA 4CFCA 3DI6A 4RCHA 4RG8A 1OH6A 3TTDA 2OPPA 4E7HA 3BF3A 2KKZA 2O8DB 2P9KA 2HNYA 4I7FA 1ZXOA 4DFPA 1Y64A 4BDPA 2OPRA 3HK2A 4FLVA 1U2VA 4BRAA 1HNIA 3L4QA 2ZF5O 2VCPA 5BPMA 4KFBA 1U47A 4CJ7A 1W9HA 3TABA 3LM2A 3PX4A 1A5WA 1XI1A 1D8YA 3FE1A 4HUFA 3HL8A 4BE0A 1SL1A 4DU1A 3CCVN 4CCHA 2P9IB 1GOBA 1JCEA 2IVNA 1T8EA 5FLXO 4HTLA 3ZYYX 1L3TA 3ATUA 2ZJRL 3LDPA 3CCMN 2ASPA 3FLCO 1TL1A 3QNOA 5KGXA 3BGRA 2D0OA 3A0IX 4B9VA 3KWGA 1HKGA 2ETJA 3IAYA 1J5OA 1HKCA 4W5OA 2OPSA 4IOXA 4XH1A 3I8BA 1ITGA 2BANA 2FSJA 4CK1A 5GINA 3VPZA 1IH7A 4JKAA 1HYVA 4QAGA 3KD1E 1L5UA 3LP1A 4JI4K 4IFVA 1VQKN 3PUFA 1RT6A 3T7ZA 1ZBIA 4AHSA 1HR0K 3ZETB 3CETA 4CJRA 3EKSA 1NGJA 1HYZA 4E7LA 1TK8A 3GBTA 1WSIA 4CZEA 4CF2A 1ZBLA 4E7IA 4CEZA 4ISFA 4BC3A 3R6MA 3K59A 4CJPA 2NRXA 1IV0A 4KHSA 3K5NA 3V9SA 3A5NC 2YNHA 4BC2A 1TKZA 1Q86O 5I42A 3OYKA 3BUZB 4AHRA 4H4MA 5FPDA 5KRSA 1EQYA 3L0QA 3LP0A 1S22A 2PFUA 4HUGA 2P9NB 4LF8K 5HRSA 3DXKB 4CEFA 1HPZA 1C0UA 4C1NK 3ZX0A 4AHCA 4H0TB 1HRHA 3LP3A 3CJAA 1MDUB 3IKMA 4F8RA 4BVPA 1RT7A 4FJHA 1NJIO 3C7NB 3VETA 4CEAA 3KKRA 2VG5A 4H03B 4KHPK 2XO7A 1N33K 4DV0K 2PY5A 4DQRA 3CJCA 1N34K 3OS0A 3LM9A 5AR0A 3AV9A 3O6WA 3PIPL 5FRNA 3UB5A 4AH9A 2KLAA 1C0GA 3WXKA 5AQXA 4AQYK 3FZFA 5AZIB 3VGKA 1J54A 4FCYA 4KB1A 1N32K 3PY8A 4BROA 3AVHA 3JSMA 3JXUA 4DQPA 2IC3A 3HSCA 2D4WA 2YI1A 4YOXA 2HMPA 2QWRA 1DTTA 1HLUA 1ASUA 3VEWA 5F0XA 4PUOA 4H4OA 4IEIA 3I0RA 3KTQA 2RHKA 1YJNN 4O5BA 2A1SA 1N36K 4KB0A 4FWMA 1MWKA 3AA4A 2NZTA 1QQOA 3W0LA 5GAEP 1WAFA 3SUOA 5AQHA 5GADP 1TK5A 3EN9A 1C0FA 3MN7A 4O44A 2P9KB 4A61A 1Z05A 2IVPA 5BR8K 5KQ8A 5J1EA 2DFEA 5LY3A 4H0VB 4FPBA 3WXLA 1TKXA 3LWMA 2QEXN 4KKOA 3G4SN 1J6ZA 3O9UA 1HPMA 2YKNA 3ZCMA 1XQSC 1VSFA 5F2RA 1I3AA 1WUAA 4E7KA 1KQSM 1VQ8N 4OKEA 3HJFA 4EHUA 4BRCA 2Q1NA 1ASVA 5AQPA 3CC7N 4DUYK 1TGOA 3KD5E 3CCQN 3ZT3A 4KTZA 4X65K 2JGUA 3Q7CA 1LWCA 3MWTA 1DGKN 3VENA 1LW0A 5F1XA 3U4LA 3FZHA 4MO4A 1JLBA 1T03A 4DFMA 3L2RA 1VQ6N 3PSFA 3C6UA 2YJFA 4OKKA 3AVMA 2HHTA 2NRZA 2ZGYA 5CZ1A 4U7BA 3EE8A 3DXMB 4B3TK 5KPRA 2F96A 4BGBA 1XWLA 5BPNA 2KFZA 1Z25A 3AAQA 2Y1IA 3ISNC 1IJJA 3IRXA 3AVKA 4QS9A 4C8NA 3CMAN 3WXMB 5M1QA 3G10A 3ZSWA 5GAGP 2YHAA 5TKYA 4CK3A 4B9TA 3SMPA 2CH6A 3O4QA 5AZJA 3OS1A 2GEMA 5JICA 1JL1A 3DLRA 3U3YA 3QFUA 4DLGA 4CBWA 3AO5A 1P90A 2V52B 3RWUA 4GY2B 3VQ9A 2HVHA 3CJBA 3NGYA 4K41A 2CGJA 3BDPA 2VQFK 4L8RB 1BQMA 3JAMO 3P38A 4K25A 3T69A 2RPIA 3KVGA 5BRFA 1YT3A 3FZMA 5AQNA 3NE6A 3THYA 3C65A 3O9QA 4CJTA 3V81A 1VAZA 5HROA 2RN2A 3MEEA 1X3NA 3LL3A 3NH2A 3QIPA 3J7AP 4WQ5C 1XHZA 3ZSVA 4V19S 4Z94A 5A2QO 1NLVA 3LPTA 4F4KA 1SV5A 5AFUH 1JCFA 3BZCA 3U8XA 1IBMK 3TTCA 3ID6A 2NRRA 5JLFA 4OPAA 2NNWA 4M3UA 2Z1IA 2GWJA 3OY9A 4DHYA 1HNVA 4LSLA 1HMVA 2E6LA 3CCLN 1Q8IA 5DMRA 4OKJA 4BG8A 4DR2K 3GE1A 5M1NA 3HI0A 2B6AA 5AQTA 2GUPA 3VF4A 4J2BA 3MMVA 3K9JA 3QNNA 1D9FA 3C6AA 4MQ3A 3B8AX 4IJAA 4TSXA 3OVNA 3QIOA 1D9DA 3DMJA 3DAWA 5M1FA 4GV6A 2D5RA 1RILA 1S6QA 3RMAA 3VQ7A 3VERA 5LJVA 3JS6A 3CYMA 2CH5A 1GLBG 4K42A 4NO7A 4FM2A 1UAXA 3QINA 2Q0RA 2HBJA 3IFRA 4JRQA 3EEQA 2D1KA 3S3NA 3MXMA 3CJ9A 4E7JA 1TKDA 4FOIA 3KK7A 3PV8A 3OYBA 3AVFA 3BP8A 4DCHA 4ELTA 4JI5K 1R59O 2G8WA 2FSKA 4BRNA 1W7AA 1L3SA 4FZYA 1QSYA 1BWFO 1KVBA 2G8KA 4FJ7A 4ZHRA 1YF5L 2F9TA 4FLYA 1K8KA 1NGAA 4DTJA 4ZTJA 1U49A 4FJ9A 3WT0A 4BC4A 5AFUA 3UE5A 4LC9B 4G9ZA 4B8AB 3KLIA 1RDWX 1X1PA 1E4FT 5EXWA 4ILGB 1BISA 3ZX2A 3IMXA 3AVNA 1KXPA 1Q81O 4JD2A 1WN7A 4DSFA 2IDOA 2O8CA 3A2FA 5AQIA 1LW2A 3SYZA 2I7NA 4ILHA 4E0DA 4DV6K 1N8RO 4LH5A 5EX5A 3QEIA 5C42A 3KK1A 3FFIA 3L2WA 3K9KA 1S9EA 4NCAA 3HM8A 3TSQA 4AM7A 3SNNA 2DFFA 2E4LA 4M45A 2FSNA 1RT1A 1YAGA 1EXQA 3SLCA 3G6EN 5JMVA 2E1YA 4DU4A 1RDDA 4CF8A 4FM1A 1QQNA 1JJ2M 2BE2A 2O8EA 3CMEN 2IVOA 2OA8A 4OGCA 1OH7A 3RRHA 3LALA 1K9MO 3WUHA 1WBBA 1NJYA 1BL3A 5AZJB 3O3HA 3TR8A 4JLHA 3H3NO 1YUWA 4BRKA 1I94K 4RWTA 2NRVA 3WNEA 4QS8A 4PL7A 1HUXA 1ZYQA 5AQGA 5CHIA 3CHWA 4B3RK 4KH6A 3ZT0A 4DQSA 2E2OA 3R1XA 1Q9XA 2FC0A 1BUPA 3CM5A 2HHUA 1EETA 4LD0A 5HRRA 1FKOA 4JKDA 2UXDK 3TAFA 3THYB 3DJCA 3P5JA 3DYAA 3K5MA 4KH4A 1ATRA 1XMOK 1RTJA 1K73O 3DLEA 1G99A 1LAVA 2ZWHA 3VEOA 3V4IA 4M41A 4JI3K 4GMJB 3ALYA 4O55A 3MCAB 1RTIA 1B9FA 4CIFA 1KAXA 1RT3A 1QSSA 3NF8A 1C1CA 2YX6A 1RT5A 1GOCA 3Q7BA 1HX1A 1HNWK 5LMUK 3KZBA 3J81O 4OLBA 3MAQA 1FKPA 1YVUA 3TSPA 3O9TA 1NK5A 4NB4A 4B1YB 2F7TA 1IKWA 1EP4A 1EKEA 5JVGL 4CGFA 3ZT4A 4DQ8A 3CCEN 3BZKA 5JS2A 2VYPA 1YI2N 1W0HA 2V7ZA 2OPQA 4FLWA 5AQQA 4DFKA 4KTWA 3KWIA 3I0SA 1BDGA 3RVCA 3EZWA 4FW2A 3U6FA 3IUCA 5M1KA 3QEXA 2EWSA 3AA5X 4FWKA 3VEXA 1LAWA 2GELA 5EOYA 3AGKA 2NLXA 2Q36A 3O8MA 5HRPA 2F9WA 1QZ6A 4LFCK 4UY8O 3SPZA 3IDHA 3QFPA 3R8EA 3H1VX 3AVIA 4HHTA 1O13A 4H0YB 2ATQA 4F3OA 2PYLA 1VHXA 3AVBA 1CZBA 4YORA 3KK3A 4BDZA 1E3MA 4CGHA 4FLTA 3UIQA 3LZJA 1DEJA 4CFAA 1HQUA 3DRRA 2QTDA 1GLDG 4FWOA 2PYJA 4OJRA 3R9PA 2AP1A 1GLCG 5BRDA 4BRIA 5SWMA 5EVZA 3DXMA 1SKRA 1JLFA 1S1UA 1K8KB 2PZSA 3M6GA 3QLHA 2GBZA 5CYMA 3QEPA 1NMDA 4KI6A 1BA0A 3PIOL 3CQXA 4FVMA 2HHWA 3OYCA 3F2KA 3ATVA 2GWKA 4JD2B 3DLKA 3ZSQA 1D4XA 5EY4A 4AHTA 4CHZA 2HHSA 3OS2A 4CI6A 2O8CB 2OZSA 3D6RA 3RSEA 1S1TA 3NVKA 3SK3A 4U67L 3V1QA 1TYQA 2W42A 4AHUA 3H45C 3I33A 5C15A 3AA3A 1XUPO 4JK8A 3A5OC 4Q5VA 2Q97A 1J53A 4FJNA 4BRMA 3SAFA 1SZ2A 3DRPA 4KHQA 5AQVA 1XC3A 2O8EB 4RW8A 4A59A 1NK6A 1A5VA 1ZBUA 3C6HA 4BVOA 4NCGA 3SQ1A 4BGAA 3NH0A 1NOZA 4CEEA 4WQ4A 1GLAG 1WB9A 3NH1A 1KAYA 1RDCA 1YHQN 1XC9A 4FWPA 3BEXA 3DLGA 4FLZA 4E1NA 1YJ9N 1DT9A 3CC4N 2VQEK 3SCXA 4CJVA 1RT2A 2HNDA 2ZJPL 3ASMA 3TSUA 3GOIA 3ZLJA 4YOVA 3OA9A 3NF7A 3G25A 4K8ZA 2QWPA 4DUZK 3NGIA 4FZZA 2I5JA 2WUSA 3THXA 1Q9YA 5LMNK 3HYFA 1SL2A 2HSTA 4CJKA 4DTNA 1DKGD 4OVLA 3EY1A 4DTMA 4BRHA 2AJQA 4YDUA 2KFNA 1UA1A 4FJKA 4FPAA 2P51A 1GLJO 2Q3SA 3RMDA 1S1WA 4JI7K 3QERA 1KTQA 4MDAA 3AARA 4EAHD 2WONA 4Z4EA 3NFAA 4WFAL 4ID5A 3OHRA 5J2PA 4FZXC 2ITMA 4IKFA 4B9MA 3NF6A 4CEDA 4M7XA 4BR2A 1X9MA 5IWAK 3SBGA 4PY5A 3A5LC 2FBVA 3ENOA 3QO9A 4MDBA 3HPOA 4F2RA 1F21A 3O5BA 4YHHK 1NGEA 3CPEA 1LWFA 4PA1A 4YOYA 3N4PA 4GW6A 3L2VA 1LWEA 3O1BA 3VESA 3PX0A 2JLEA 1HQEA 2QWOA 3TAMA 1VQNN 1ASWA 3NCIA 2GV9A 3MX2A 4B3MK 4FVUA 4CFDA 3K5LA 1WSGA 1WAJA 4H5WA 1QVGM 2W41A 1QTMA 3HOTA 2B5JA 4Z4GA 4IBNA 1S6PA 3WXJA 3AGRA 4B08A 4JEPA 2GUIA 3ZSOA 3HVTA 1VK0A 1DLOA 1YTAA 3OYMA 1TAQA 3CI5A 4JKGA 3G71N 1W2BM 3LDLA 3LAKA 4JI8K 3NMUA 2W40A 5FPNA 1IBKK 4DSEA 3O3GA 3CG7A 2G8VA 4GV3A 1ZBHA 4DS5A 3CJ1A 1NG9A 4ISEA 4JAXA 3ULEA 2YHBA 2Z1GA 3V9WA 1T6CA 4NXNK 3OYFA 2FLOA 3CCJN 5C10A 3VQCA 4B9NA 4I6MA 4B1XB 4BR4A 3WXIA 1VQMN 1KAZA 2FBTA 3DLLL 1NGDA 1IKVA 5CZ2A 3OBYA 4CESA 4L3QA 4DB3A 3LDQA 1RCHA 2QWQA 3LPUA 4GNIA 2A1RA 1VSKA 4CGJA 1KFSA 2VGMA 1KLMA 4CK2A 3ITHA 4Z0UA 4DR1K 1YIJN 4FWRA 2F4VK 3KIOA 3D2EB 3EZ5A 5DK5A 2IAJA 5HBMA 4RW7A 1X9SA 4CBXA 1GLLO 4IDKA 1Z6RA 2NUBA 5HRNA 5AQKA 5KRTA 5T7BA 1NGBA 1M90O 3LDOA 2QK9A 1S72N 1R0AA 3RSEB 4B9SA 1NGHA 4CJ5A 4CEOA 2O8BA 4BRGA 1SL0A 1TYQB 2VWBA 2KQ2A 4F9OA 1QS4A 5SZTA 1S3XA 3J7ZO 4B1WB 4H0OA 1LOTB 4EFHA 3RMBA 1EWQA 4DSIA 4JHDB 4NYNA 4BR0A 5KI6A 3RMCA 4FW1A 4AHVA 3HBTA 4JKHA 4BR7A 1XNQK 3SBTA 2GX9A 3WNFA 3TARA 4WCEL 4BRQA 3P1GA 4LF6K 1N5YA 3SJHA 4MO5A 2E5LK 4J2DA 3AO2A 2E2QA 3HZ6A 1WSHA 4FWNA 1SUQA 3AY9A 1NM1A 2P9PA 2NRHA 4LH4A 4FYDA 2HBLA 3T19A 4C1NI 4FJMA 3HOSA 4DFJA 3THXB 4DV4K 3M5RA 4JK9A 4DR3K 1VSMA 4QCLA 3P4IA 4FWSA 3L3UA 2FBXA 3K58A 1VRUA 4A57A 4OPHA 3K2PA 3MN6A 4EIAA 1FXXA 3BY5A 1C1BA 2VGNA 1TAUA 4GKKK 2YJEA 4CVNE 4BREA 3MEGA 4R5PA 1JLAA 4O4GA 2Q0UA 3OTOK 4WE1A 4JK7A 1ZBFA 1ZBSA 3L4IA 3TWHA 2OCEA 1QVFM 2D0BA 4M3WA 3KK2A 1XNRK 3EYZA 3VN5A 4GVEA 1X9WA 2HBMA 1KC8O 3TAPA 1NJWA 1V4TA 3F9MA 4W5NA 1HJRA 4BE2A 2IIRA 2G8IA 4PQUA 4CZHA 1KVAA 3A5MC 3P83D 1BG3A 2DFHA 1QE1A 2HHVA 3ZSXA 1MU2A 3EO3A 2KW4A 3H6EA 2UUBK 4KH5A 3VQDA 4G1QA 3NDKA 3THWA 1K8AO 2IOCA 2X74A 3ZSYA 1EWRA 3SI6A 4DLEA 2ZQBA 3RTVA 3MDQA 3FR0A 4CJUA 4E1MA 1NK7A 1L3VA 4CBUA 2HVIA 1JKHA 1YJWN 2OTLN 3NHGA 3D7EO 4CZIA 4JKGB 5KPZA 2QXLA 5HLFA 3CXCM 1VQ7N 2HBKA 4IOCL 2F8TA
chains in the Genus database with same CATH topology
2OPQA 2EHGA 4FLWA 4DFKA 4KAZA 4KTWA 2PY5A 3MXJA 3HP9A 1XHXA 3HSTB 4RW9A 3I0SA 5FROA 4DQRA 3DLHA 3F73A 2VWJA 1L3UA 3OS0A 4OGEA 3LZIA 4ICLA 5D3GA 3AV9A 1LV5A 4EP5A 4FW2A 3U6FA 3QEXA 5FRNA 4DQIA 4OPKA 3AA5X 3OYDA 3OYLA 1S5JA 4CJ4A 4KHWA 4AH9A 4CJLA 2HHQA 1LAWA 4CIEA 4LY7A 2QXFA 1JXEA 1KRPA 1IG9A 1EX4A 1JLCA 4DF4A 2D0CA 2KTQA 2O4IA 4Z4FA 5HRPA 1J54A 3HM9A 4FCYA 4KB1A 1O1WA 4I2QA 3V1OA 1I39A 3I8DA 4W5RA 3PY8A 3SPZA 3HO1A 1RBSA 3VQQA 3AVHA 1RDAA 3OJSA 4F2SA 3JSMA 2B4JA 3AVIA 2QKKA 4HHTA 3C6TA 3MEDA 4DQPA 4M3YA 2ATQA 2IC3A 4F3OA 4IG0A 2PYLA 3AVBA 1CZBA 4BDZA 3KK3A 4CGHA 4FLTA 3UIQA 3LZJA 1KSPA 3OYAA 1DTTA 4CFAA 1ASUA 3OYEA 1HQUA 2YKMA 3DRRA 1NK0A 1RBTA 3VQ5A 4PUOA 2PYJA 4OJRA 4H4OA 1U04A 3IS9A 3I0RA 4UQGA 2XHBA 3KTQA 4KHNA 3ZT1A 5KGWA 4O5BA 5SWMA 1BI4A 3V6DA 2BGGA 2A1SA 4KHUA 5C25A 1SKRA 4KB0A 1JLFA 1S1UA 4OPJA 5J2MA 1UWBA 3AA4A 5EU7A 4ID1A 2PZSA 1WAFA 3QLHA 2GBZA 5CYMA 3SUOA 3QEPA 3V1RA 3HP6A 4KI6A 3CFRA 4CJSA 1TK5A 3V9XA 1NJZA 2RKIA 4FVMA 1CXQA 3KJVA 4O44A 4C8KA 3OYCA 2HHWA 2RF2A 3F9KA 3VQEA 3SPYA 3V9UA 3DLBA 1A5XA 1TV6A 4B3OA 1UOCA 4N47A 1RBRA 2DFEA 3WNHA 5J1EA 3RR7A 3DLKA 4RW6A 1TKXA 3ZSQA 4AHTA 4CHZA 3LWMA 4KKOA 2HHSA 3OS2A 2E6MA 3B6PA 4EZ9A 1IKYA 2YKNA 3ZCMA 5KTQA 2OZSA 1WSJA 1VSFA 2IS3A 4XIUA 3SQ4A 1I3AA 4E7KA 4DTUA 3THVA 1KLNA 4OKEA 1S1TA 4IFYA 3NAEA 1NKCA 5I3UA 3HJFA 1NK8A 3SJJA 5C24A 1ASVA 3V1QA 2IGIA 2W42A 4KV8A 4AHUA 3L2UA 3OYGA 1TGOA 3KD5E 2G8HA 3ZT3A 5HP1A 3AA3A 4KTZA 3HT3A 2JGUA 3LAMA 4Q5VA 1G15A 3M8RA 1LWCA 1QSLA 1WNSA 1CLQA 1J53A 3CM6A 4FJNA 2DY4A 1CXUA 1NKBA 1LW0A 3VQ6A 4N56A 4CJQA 4FXDA 3DRPA 4NCBA 3CFOA 3TANA 3ZT2A 4KHQA 1JLBA 1T03A 4RW8A 3L2RA 4DFMA 3C6UA 2O4GA 1VSJA 1NK6A 4DF8A 4OKKA 4Q0BA 2HW3A 1A5VA 1ZBUA 1IKXA 2AJQA 3AVMA 2HNZA 4NCGA 4CHQA 3HPGA 3D0PA 3SQ1A 4J2EA 2HHTA 2HB5A 4M42A 3WNGA 4C8OA 4J2AA 3SUQA 3NH0A 5CZ1A 1NOZA 4CEEA 3VQAA 3NH1A 1XC9A 1RDCA 2F96A 3DOKA 4F4KA 1VSLA 3OYJA 3DLGA 4CE9A 4E1NA 1C0MA 1XWLA 3KLHA 1KFDA 4FLZA 3DM2A 2KFZA 1Z25A 3O3FA 3KKSA 4ELVA 4FJJA 4DTSA 4LSNA 4NYFA 2Y1IA 3ISNC 1T05A 3IRXA 1JXBA 2X6SA 4Z4IA 3L2QA 3SCXA 4JS4A 1Y97A 4Y1CA 4CJVA 1RT2A 2HNDA 3AVKA 1JLGA 3ASMA 3AO1A 4C8NA 4KRFA 3HPHA 4HCCA 2X78A 3OJUA 3G10A 3ZSWA 2YHAA 3NF7A 4CK3A 4B9TA 4K8ZA 4Z4HA 4CIGA 1BHLA 3NGIA 3PO5A 4FZZA 3O4QA 4DS4A 2I5JA 4DTXA 1Q9YA 3OS1A 3HYFA 1SL2A 3OYHA 1JL1A 3DLRA 4CJKA 3U3YA 3SUPA 1QHTA 4YNQA 3TAQA 3M8QA 4DTNA 3QEWA 3T1AA 4OVLA 4DLGA 3EY1A 3AO5A 4DTMA 1C6VA 2KZZA 4C8LA 3RWUA 1KVCA 1REVA 2KFNA 4M3RA 1GOAA 1S1XA 3VQ9A 1UA1A 4I9QA 3NGYA 3D45A 4DTRA 2HVHA 4FJKA 3LWLA 5J2NA 3BDPA 2P51A 2Q3SA 3RMDA 3KLFA 4L8RB 1BQMA 1S1WA 1VSIA 3QERA 4ZTFA 1KTQA 4DQQA 4E89A 3AO3A 1U48A 1NK4A 1JLQA 2RPIA 2WONA 3AO4A 4M3XA 5FRMA 2EX3A 4Z4EA 3NFAA 1YT3A 3OYIA 4ID5A 3NE6A 3VQ4A 4HUEA 5J2PA 4FZXC 4IKFA 4B9MA 3NF6A 4CEDA 4CJTA 1TK0A 1X9MA 4HCBA 3L3VA 3V81A 4PY5A 5HROA 4K8XA 2RN2A 2FBVA 3MEEA 3QO9A 4BDYA 3HPOA 4F2RA 1F21A 2FBYA 3NH2A 3QETA 1RTDA 3QIPA 1LWFA 4PA1A 3QEVA 4B9UA 4FK2A 4GW6A 4CERA 3L2VA 1XHZA 2KZMA 4KPYA 3ZSVA 2D0AA 3PX6A 1LWEA 1BCOA 2BDPA 4F3TA 4KREA 2DTUA 1NJXA 3PX0A 2JLEA 3L8BA 1RTHA 4FJLA 2P1JA 1SKSA 2ZE2A 1HQEA 4BWJA 1RT4A 1VSDA 3LPTA 1SV5A 3TAMA 1TL3A 5K14A 1ASWA 4HVJA 3NCIA 3CFPA 3MXIA 2GV9A 3KLEA 5FDLA 4CFDA 3K5LA 5CY4A 1WSGA 2VG7A 5CYQA 1WAJA 1FK9A 2VWKA 2P5OA 5JS1A 4W5TA 2XY6A 1VSHA 1NOYA 1J9AA 4BACA 3AVAA 1Z26A 1QTMA 4BWMA 1C1AA 4M3UA 2Z1IA 2HVIA 2B5JA 1VSEA 3LP2A 4Z4GA 4IBNA 3RRGA 1S6PA 4CEQA 4CJ3A 3OY9A 1N6QA 4B08A 4DSLA 4DMNA 3NBPA 1HNVA 4LSLA 4CGDA 4MFBA 2HMIA 2GUIA 1HMVA 1RBUA 2E6LA 4I2PA 5J2QA 1Q8IA 5DMRA 4OKJA 3HVTA 3ZSOA 1VK0A 1DLOA 4FJIA 4N41A 1YTAA 3IG1A 3OYMA 1TAQA 3TAEA 1K6YA 4RW4A 3LAKA 3K5OA 2B6AA 1DTQA 4J2BA 4CGIA 4OLAA 4DSEA 3O3GA 3CG7A 3QNNA 1UA0A 1D9FA 4MQ3A 3KLGA 3LDSA 4E3SA 2G8VA 1JL2A 4DS5A 1ZBHA 1QQCA 4TSXA 4QOZB 1U45A 1YTUA 2Z1HA 2YHBA 3OVNA 3QIOA 1D9DA 2Z1GA 4JRPA 4CFBA 3DMJA 4CJWA 1IO2A 3V9WA 4FLXA 3AA2A 3OYFA 4FJGA 3VQCA 4B9NA 3S3OA 2D5RA 1RILA 3AVLA 3HXMA 1SKWA 1S6QA 2XY5A 3G0ZA 4CF0A 3RMAA 3VQ7A 4GVMA 4O0JA 2FBTA 3CYMA 1NK9A 1RNHA 4CJEA 3B6OA 5CZ2A 1IKVA 4CESA 4CF9A 4FM0A 3AVCA 1BQNA 3C94A 3VQPA 1BI4B 4FM2A 1UAXA 1RCHA 3LPUA 3O4NA 2XRIA 2A1RA 1VSKA 3QINA 4DSKA 4JRQA 4CGJA 4CHNA 1RDBA 1KFSA 1TKTA 4FJXA 2OZMA 3S3NA 2P5GA 4KTQA 1KLMA 4CK2A 3MXMA 4E7JA 1TKDA 3ITHA 4Z0UA 3SV4A 3PV8A 3OYBA 3AVFA 3KIOA 3EZ5A 5DK5A 4FLUA 2IAJA 5HBMA 4RW7A 1X9SA 3NGZA 4B9LA 4IDKA 1C0TA 2NUBA 4ELTA 4N76A 2G8WA 2WOMA 3PO4A 4FZYA 5E41A 3H08A 3VA3A 1L3SA 5HRNA 1TVRA 3SUNA 1QSYA 5KRTA 4BE1A 2HHXA 5T7BA 1KVBA 4H8KA 3CQ8A 4DWIA 3ZSZA 4YFUA 4CGGA 2G8KA 4FJ7A 4C8MA 4ZHRA 4FLYA 2QK9A 4KO0A 3LANA 2ZD1A 4DTJA 4CHPA 4ZTJA 3SZ2A 1R0AA 1U49A 2Z1JA 4B9SA 4FJ9A 1VRTA 3VQ8A 4CJ5A 4M3ZA 2ITGA 1HYSA 4CEOA 4AILC 4O0IA 4CFCA 1T7PA 3K57A 3DI6A 1SL0A 3M8SA 4B8AB 3KLIA 4RG8A 1RBVA 1X1PA 2OPPA 4CHOA 3AVJA 4E7HA 2KQ2A 1BISA 3AVGA 2YNIA 1QS4A 2HNYA 4I7FA 3AVNA 5SZTA 4DFPA 4FJ8A 4BDPA 2OPRA 1WN7A 4DSFA 3RMBA 3HK2A 4DG1A 2IDOA 4FLVA 1NKEA 4DSIA 3A2FA 3TAGA 3RR8A 1LW2A 3SYZA 3MECA 4E0DA 4NYNA 1HNIA 4LH5A 4EZ6A 5KI6A 3QEIA 5C42A 3KK1A 3HVRA 3RMCA 3FFIA 3L2WA 3SQ2A 1S9EA 4FW1A 4KFBA 4AHVA 1U47A 4NCAA 4CEBA 3SNNA 1W9HA 4CF1A 4KI4A 3TABA 2DFFA 3PX4A 1A5WA 2E4LA 4M45A 4N5SA 1XI1A 1D8YA 4HUFA 3HL8A 1RT1A 4CECA 3WNFA 1EXQA 4BE0A 4DU1A 3TARA 1SL1A 3P1GA 1N5YA 4CCHA 4DU4A 4CHYA 2XY7A 3TI0A 1RDDA 4CF8A 4DU3A 1GOBA 3S3MA 2XY8A 4FM1A 3C95A 4FK0A 1D5AA 2BE2A 3NF9A 4J2DA 3AO2A 2YNFA 1T8EA 1WSHA 1L3TA 1SUQA 4OGCA 2OA8A 3RRHA 4FYDA 4LH4A 1TL1A 3QNOA 3LALA 5KGXA 3T19A 3BGRA 4FJMA 4DFJA 4B9VA 1NJYA 1BL3A 3ULDA 4HTUA 1CZ9A 2ETJA 3ZSRA 3O3HA 3TR8A 4E19A 3IAYA 4JLHA 1WSEA 3JYTA 1J5OA 4W5OA 1VSMA 2OPSA 4QCLA 2YNGA 1U4BA 4DTOA 3L3UA 1ITGA 2BANA 3WNEA 4CK1A 4FJ5A 2F8SA 1BIZA 2FBXA 3K58A 1VRUA 1IH7A 1ZYQA 4PWDA 1HYVA 4QAGA 3KD1E 3K2PA 4B8CA 1BGXT 1L5UA 3LP1A 3E01A 4IFVA 1FXXA 3ZT0A 3PUFA 1C1BA 1RT6A 4DQSA 1Q9XA 1ZBIA 1TAUA 2FC0A 3CM5A 4AHSA 3SQ0A 2HHUA 1EETA 3MEGA 4LD0A 4R5PA 4DSJA 1JLAA 1FKOA 5HRRA 3QESA 4CJRA 3U3GA 4O4GA 3TAFA 4DTPA 4Y1DA 3M8PA 3P5JA 4WE1A 1HYZA 3DYAA 3K5MA 4E7LA 1TK8A 1WSIA 2LSNA 1ZBFA 3DRSA 3TWHA 1RTJA 2G8UA 3DLEA 1LAVA 3DOLA 2D0BA 4CF2A 1ZBLA 4M3WA 4KHYA 4Z4CA 3KK2A 4E7IA 4M41A 3EYZA 3V4IA 3VN5A 4CEZA 1X9WA 4GMJB 4W5QA 3ALYA 4O55A 2YV0X 3TAPA 1NJWA 3K59A 4W5NA 1RTIA 4CJPA 1HJRA 4BE2A 2OYQA 2G8IA 1B9FA 1WSFA 4KHSA 4CIFA 2QKBA 3K5NA 4PQUA 3V9SA 1KVAA 2YNHA 1RT3A 4JS5A 1TKZA 1S9GA 1QSSA 3P83D 5I42A 3OYKA 3NF8A 2DFHA 4AHRA 4H4MA 5KRSA 2G8FA 1QE1A 2HHVA 1C1CA 3ZSXA 1MU2A 2VG6A 3T3FA 1RT5A 2KW4A 3LP0A 1GOCA 4ELUA 3VQDA 4G1QA 3NDKA 4HUGA 5HRSA 4EP4A 1JLEA 2IOCA 2X74A 3VA0A 4CEFA 4OLBA 1HPZA 3ZSYA 1C0UA 3MAQA 3SI6A 4AHCA 4DLEA 3VQBA 2ZQBA 1HRHA 1FKPA 1YVUA 3LP3A 3RTVA 1NK5A 4CJUA 4F8RA 1S1VA 1B92A 1RT7A 3V9ZA 4FJHA 4M3TA 4E1MA 1NK7A 1L3VA 1IKWA 1EP4A 1EKEA 1KCFA 1BCMA 1JKHA 1WLJA 4CGFA 3OYNA 3NHGA 3SV3A 4I9LA 2X6NA 3ZT4A 2Y1JA 4CEAA 1BIUA 2R7YA 5HLFA 3KKRA 4FK4A 2VG5A 2XO7A 5JS2A 4IG3A 1B9DA 3S9HA 1W0HA 4CJFA 2F8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPQ A;  2EHG A;  4FLW A;  4DFK A;  4KAZ A;  4KTW A;  2PY5 A;  3MXJ A;  3HP9 A;  1XHX A;  3HST B;  4RW9 A;  3I0S A;  5FRO A;  4DQR A;  3DLH A;  3F73 A;  2VWJ A;  1L3U A;  3OS0 A;  4OGE A;  3LZI A;  4ICL A;  5D3G A;  3AV9 A;  1LV5 A;  4EP5 A;  4FW2 A;  3U6F A;  3QEX A;  5FRN A;  4DQI A;  4OPK A;  3AA5 X;  3OYD A;  3OYL A;  1S5J A;  4CJ4 A;  4KHW A;  4AH9 A;  4CJL A;  2HHQ A;  1LAW A;  4CIE A;  4LY7 A;  2QXF A;  1JXE A;  1KRP A;  1IG9 A;  1EX4 A;  1JLC A;  4DF4 A;  2D0C A;  2KTQ A;  2O4I A;  4Z4F A;  5HRP A;  1J54 A;  3HM9 A;  4FCY A;  4KB1 A;  1O1W A;  4I2Q A;  3V1O A;  1I39 A;  3I8D A;  4W5R A;  3PY8 A;  3SPZ A;  3HO1 A;  1RBS A;  3VQQ A;  3AVH A;  1RDA A;  3OJS A;  4F2S A;  3JSM A;  2B4J A;  3AVI A;  2QKK A;  4HHT A;  3C6T A;  3MED A;  4DQP A;  4M3Y A;  2ATQ A;  2IC3 A;  4F3O A;  4IG0 A;  2PYL A;  3AVB A;  1CZB A;  4BDZ A;  3KK3 A;  4CGH A;  4FLT A;  3UIQ A;  3LZJ A;  1KSP A;  3OYA A;  1DTT A;  4CFA A;  1ASU A;  3OYE A;  1HQU A;  2YKM A;  3DRR A;  1NK0 A;  1RBT A;  3VQ5 A;  4PUO A;  2PYJ A;  4OJR A;  4H4O A;  1U04 A;  3IS9 A;  3I0R A;  4UQG A;  2XHB A;  3KTQ A;  4KHN A;  3ZT1 A;  5KGW A;  4O5B A;  5SWM A;  1BI4 A;  3V6D A;  2BGG A;  2A1S A;  4KHU A;  5C25 A;  1SKR A;  4KB0 A;  1JLF A;  1S1U A;  4OPJ A;  5J2M A;  1UWB A;  3AA4 A;  5EU7 A;  4ID1 A;  2PZS A;  1WAF A;  3QLH A;  2GBZ A;  5CYM A;  3SUO A;  3QEP A;  3V1R A;  3HP6 A;  4KI6 A;  3CFR A;  4CJS A;  1TK5 A;  3V9X A;  1NJZ A;  2RKI A;  4FVM A;  1CXQ A;  3KJV A;  4O44 A;  4C8K A;  3OYC A;  2HHW A;  2RF2 A;  3F9K A;  3VQE A;  3SPY A;  3V9U A;  3DLB A;  1A5X A;  1TV6 A;  4B3O A;  1UOC A;  4N47 A;  1RBR A;  2DFE A;  3WNH A;  5J1E A;  3RR7 A;  3DLK A;  4RW6 A;  1TKX A;  3ZSQ A;  4AHT A;  4CHZ A;  3LWM A;  4KKO A;  2HHS A;  3OS2 A;  2E6M A;  3B6P A;  4EZ9 A;  1IKY A;  2YKN A;  3ZCM A;  5KTQ A;  2OZS A;  1WSJ A;  1VSF A;  2IS3 A;  4XIU A;  3SQ4 A;  1I3A A;  4E7K A;  4DTU A;  3THV A;  1KLN A;  4OKE A;  1S1T A;  4IFY A;  3NAE A;  1NKC A;  5I3U A;  3HJF A;  1NK8 A;  3SJJ A;  5C24 A;  1ASV A;  3V1Q A;  2IGI A;  2W42 A;  4KV8 A;  4AHU A;  3L2U A;  3OYG A;  1TGO A;  3KD5 E;  2G8H A;  3ZT3 A;  5HP1 A;  3AA3 A;  4KTZ A;  3HT3 A;  2JGU A;  3LAM A;  4Q5V A;  1G15 A;  3M8R A;  1LWC A;  1QSL A;  1WNS A;  1CLQ A;  1J53 A;  3CM6 A;  4FJN A;  2DY4 A;  1CXU A;  1NKB A;  1LW0 A;  3VQ6 A;  4N56 A;  4CJQ A;  4FXD A;  3DRP A;  4NCB A;  3CFO A;  3TAN A;  3ZT2 A;  4KHQ A;  1JLB A;  1T03 A;  4RW8 A;  3L2R A;  4DFM A;  3C6U A;  2O4G A;  1VSJ A;  1NK6 A;  4DF8 A;  4OKK A;  4Q0B A;  2HW3 A;  1A5V A;  1ZBU A;  1IKX A;  2AJQ A;  3AVM A;  2HNZ A;  4NCG A;  4CHQ A;  3HPG A;  3D0P A;  3SQ1 A;  4J2E A;  2HHT A;  2HB5 A;  4M42 A;  3WNG A;  4C8O A;  4J2A A;  3SUQ A;  3NH0 A;  5CZ1 A;  1NOZ A;  4CEE A;  3VQA A;  3NH1 A;  1XC9 A;  1RDC A;  2F96 A;  3DOK A;  4F4K A;  1VSL A;  3OYJ A;  3DLG A;  4CE9 A;  4E1N A;  1C0M A;  1XWL A;  3KLH A;  1KFD A;  4FLZ A;  3DM2 A;  2KFZ A;  1Z25 A;  3O3F A;  3KKS A;  4ELV A;  4FJJ A;  4DTS A;  4LSN A;  4NYF A;  2Y1I A;  3ISN C;  1T05 A;  3IRX A;  1JXB A;  2X6S A;  4Z4I A;  3L2Q A;  3SCX A;  4JS4 A;  1Y97 A;  4Y1C A;  4CJV A;  1RT2 A;  2HND A;  3AVK A;  1JLG A;  3ASM A;  3AO1 A;  4C8N A;  4KRF A;  3HPH A;  4HCC A;  2X78 A;  3OJU A;  3G10 A;  3ZSW A;  2YHA A;  3NF7 A;  4CK3 A;  4B9T A;  4K8Z A;  4Z4H A;  4CIG A;  1BHL A;  3NGI A;  3PO5 A;  4FZZ A;  3O4Q A;  4DS4 A;  2I5J A;  4DTX A;  1Q9Y A;  3OS1 A;  3HYF A;  1SL2 A;  3OYH A;  1JL1 A;  3DLR A;  4CJK A;  3U3Y A;  3SUP A;  1QHT A;  4YNQ A;  3TAQ A;  3M8Q A;  4DTN A;  3QEW A;  3T1A A;  4OVL A;  4DLG A;  3EY1 A;  3AO5 A;  4DTM A;  1C6V A;  2KZZ A;  4C8L A;  3RWU A;  1KVC A;  1REV A;  2KFN A;  4M3R A;  1GOA A;  1S1X A;  3VQ9 A;  1UA1 A;  4I9Q A;  3NGY A;  3D45 A;  4DTR A;  2HVH A;  4FJK A;  3LWL A;  5J2N A;  3BDP A;  2P51 A;  2Q3S A;  3RMD A;  3KLF A;  4L8R B;  1BQM A;  1S1W A;  1VSI A;  3QER A;  4ZTF A;  1KTQ A;  4DQQ A;  4E89 A;  3AO3 A;  1U48 A;  1NK4 A;  1JLQ A;  2RPI A;  2WON A;  3AO4 A;  4M3X A;  5FRM A;  2EX3 A;  4Z4E A;  3NFA A;  1YT3 A;  3OYI A;  4ID5 A;  3NE6 A;  3VQ4 A;  4HUE A;  5J2P A;  4FZX C;  4IKF A;  4B9M A;  3NF6 A;  4CED A;  4CJT A;  1TK0 A;  1X9M A;  4HCB A;  3L3V A;  3V81 A;  4PY5 A;  5HRO A;  4K8X A;  2RN2 A;  2FBV A;  3MEE A;  3QO9 A;  4BDY A;  3HPO A;  4F2R A;  1F21 A;  2FBY A;  3NH2 A;  3QET A;  1RTD A;  3QIP A;  1LWF A;  4PA1 A;  3QEV A;  4B9U A;  4FK2 A;  4GW6 A;  4CER A;  3L2V A;  1XHZ A;  2KZM A;  4KPY A;  3ZSV A;  2D0A A;  3PX6 A;  1LWE A;  1BCO A;  2BDP A;  4F3T A;  4KRE A;  2DTU A;  1NJX A;  3PX0 A;  2JLE A;  3L8B A;  1RTH A;  4FJL A;  2P1J A;  1SKS A;  2ZE2 A;  1HQE A;  4BWJ A;  1RT4 A;  1VSD A;  3LPT A;  1SV5 A;  3TAM A;  1TL3 A;  5K14 A;  1ASW A;  4HVJ A;  3NCI A;  3CFP A;  3MXI A;  2GV9 A;  3KLE A;  5FDL A;  4CFD A;  3K5L A;  5CY4 A;  1WSG A;  2VG7 A;  5CYQ A;  1WAJ A;  1FK9 A;  2VWK A;  2P5O A;  5JS1 A;  4W5T A;  2XY6 A;  1VSH A;  1NOY A;  1J9A A;  4BAC A;  3AVA A;  1Z26 A;  1QTM A;  4BWM A;  1C1A A;  4M3U A;  2Z1I A;  2HVI A;  2B5J A;  1VSE A;  3LP2 A;  4Z4G A;  4IBN A;  3RRG A;  1S6P A;  4CEQ A;  4CJ3 A;  3OY9 A;  1N6Q A;  4B08 A;  4DSL A;  4DMN A;  3NBP A;  1HNV A;  4LSL A;  4CGD A;  4MFB A;  2HMI A;  2GUI A;  1HMV A;  1RBU A;  2E6L A;  4I2P A;  5J2Q A;  1Q8I A;  5DMR A;  4OKJ A;  3HVT A;  3ZSO A;  1VK0 A;  1DLO A;  4FJI A;  4N41 A;  1YTA A;  3IG1 A;  3OYM A;  1TAQ A;  3TAE A;  1K6Y A;  4RW4 A;  3LAK A;  3K5O A;  2B6A A;  1DTQ A;  4J2B A;  4CGI A;  4OLA A;  4DSE A;  3O3G A;  3CG7 A;  3QNN A;  1UA0 A;  1D9F A;  4MQ3 A;  3KLG A;  3LDS A;  4E3S A;  2G8V A;  1JL2 A;  4DS5 A;  1ZBH A;  1QQC A;  4TSX A;  4QOZ B;  1U45 A;  1YTU A;  2Z1H A;  2YHB A;  3OVN A;  3QIO A;  1D9D A;  2Z1G A;  4JRP A;  4CFB A;  3DMJ A;  4CJW A;  1IO2 A;  3V9W A;  4FLX A;  3AA2 A;  3OYF A;  4FJG A;  3VQC A;  4B9N A;  3S3O A;  2D5R A;  1RIL A;  3AVL A;  3HXM A;  1SKW A;  1S6Q A;  2XY5 A;  3G0Z A;  4CF0 A;  3RMA A;  3VQ7 A;  4GVM A;  4O0J A;  2FBT A;  3CYM A;  1NK9 A;  1RNH A;  4CJE A;  3B6O A;  5CZ2 A;  1IKV A;  4CES A;  4CF9 A;  4FM0 A;  3AVC A;  1BQN A;  3C94 A;  3VQP A;  1BI4 B;  4FM2 A;  1UAX A;  1RCH A;  3LPU A;  3O4N A;  2XRI A;  2A1R A;  1VSK A;  3QIN A;  4DSK A;  4JRQ A;  4CGJ A;  4CHN A;  1RDB A;  1KFS A;  1TKT A;  4FJX A;  2OZM A;  3S3N A;  2P5G A;  4KTQ A;  1KLM A;  4CK2 A;  3MXM A;  4E7J A;  1TKD A;  3ITH A;  4Z0U A;  3SV4 A;  3PV8 A;  3OYB A;  3AVF A;  3KIO A;  3EZ5 A;  5DK5 A;  4FLU A;  2IAJ A;  5HBM A;  4RW7 A;  1X9S A;  3NGZ A;  4B9L A;  4IDK A;  1C0T A;  2NUB A;  4ELT A;  4N76 A;  2G8W A;  2WOM A;  3PO4 A;  4FZY A;  5E41 A;  3H08 A;  3VA3 A;  1L3S A;  5HRN A;  1TVR A;  3SUN A;  1QSY A;  5KRT A;  4BE1 A;  2HHX A;  5T7B A;  1KVB A;  4H8K A;  3CQ8 A;  4DWI A;  3ZSZ A;  4YFU A;  4CGG A;  2G8K A;  4FJ7 A;  4C8M A;  4ZHR A;  4FLY A;  2QK9 A;  4KO0 A;  3LAN A;  2ZD1 A;  4DTJ A;  4CHP A;  4ZTJ A;  3SZ2 A;  1R0A A;  1U49 A;  2Z1J A;  4B9S A;  4FJ9 A;  1VRT A;  3VQ8 A;  4CJ5 A;  4M3Z A;  2ITG A;  1HYS A;  4CEO A;  4AIL C;  4O0I A;  4CFC A;  1T7P A;  3K57 A;  3DI6 A;  1SL0 A;  3M8S A;  4B8A B;  3KLI A;  4RG8 A;  1RBV A;  1X1P A;  2OPP A;  4CHO A;  3AVJ A;  4E7H A;  2KQ2 A;  1BIS A;  3AVG A;  2YNI A;  1QS4 A;  2HNY A;  4I7F A;  3AVN A;  5SZT A;  4DFP A;  4FJ8 A;  4BDP A;  2OPR A;  1WN7 A;  4DSF A;  3RMB A;  3HK2 A;  4DG1 A;  2IDO A;  4FLV A;  1NKE A;  4DSI A;  3A2F A;  3TAG A;  3RR8 A;  1LW2 A;  3SYZ A;  3MEC A;  4E0D A;  4NYN A;  1HNI A;  4LH5 A;  4EZ6 A;  5KI6 A;  3QEI A;  5C42 A;  3KK1 A;  3HVR A;  3RMC A;  3FFI A;  3L2W A;  3SQ2 A;  1S9E A;  4FW1 A;  4KFB A;  4AHV A;  1U47 A;  4NCA A;  4CEB A;  3SNN A;  1W9H A;  4CF1 A;  4KI4 A;  3TAB A;  2DFF A;  3PX4 A;  1A5W A;  2E4L A;  4M45 A;  4N5S A;  1XI1 A;  1D8Y A;  4HUF A;  3HL8 A;  1RT1 A;  4CEC A;  3WNF A;  1EXQ A;  4BE0 A;  4DU1 A;  3TAR A;  1SL1 A;  3P1G A;  1N5Y A;  4CCH A;  4DU4 A;  4CHY A;  2XY7 A;  3TI0 A;  1RDD A;  4CF8 A;  4DU3 A;  1GOB A;  3S3M A;  2XY8 A;  4FM1 A;  3C95 A;  4FK0 A;  1D5A A;  2BE2 A;  3NF9 A;  4J2D A;  3AO2 A;  2YNF A;  1T8E A;  1WSH A;  1L3T A;  1SUQ A;  4OGC A;  2OA8 A;  3RRH A;  4FYD A;  4LH4 A;  1TL1 A;  3QNO A;  3LAL A;  5KGX A;  3T19 A;  3BGR A;  4FJM A;  4DFJ A;  4B9V A;  1NJY A;  1BL3 A;  3ULD A;  4HTU A;  1CZ9 A;  2ETJ A;  3ZSR A;  3O3H A;  3TR8 A;  4E19 A;  3IAY A;  4JLH A;  1WSE A;  3JYT A;  1J5O A;  4W5O A;  1VSM A;  2OPS A;  4QCL A;  2YNG A;  1U4B A;  4DTO A;  3L3U A;  1ITG A;  2BAN A;  3WNE A;  4CK1 A;  4FJ5 A;  2F8S A;  1BIZ A;  2FBX A;  3K58 A;  1VRU A;  1IH7 A;  1ZYQ A;  4PWD A;  1HYV A;  4QAG A;  3KD1 E;  3K2P A;  4B8C A;  1BGX T;  1L5U A;  3LP1 A;  3E01 A;  4IFV A;  1FXX A;  3ZT0 A;  3PUF A;  1C1B A;  1RT6 A;  4DQS A;  1Q9X A;  1ZBI A;  1TAU A;  2FC0 A;  3CM5 A;  4AHS A;  3SQ0 A;  2HHU A;  1EET A;  3MEG A;  4LD0 A;  4R5P A;  4DSJ A;  1JLA A;  1FKO A;  5HRR A;  3QES A;  4CJR A;  3U3G A;  4O4G A;  3TAF A;  4DTP A;  4Y1D A;  3M8P A;  3P5J A;  4WE1 A;  1HYZ A;  3DYA A;  3K5M A;  4E7L A;  1TK8 A;  1WSI A;  2LSN A;  1ZBF A;  3DRS A;  3TWH A;  1RTJ A;  2G8U A;  3DLE A;  1LAV A;  3DOL A;  2D0B A;  4CF2 A;  1ZBL A;  4M3W A;  4KHY A;  4Z4C A;  3KK2 A;  4E7I A;  4M41 A;  3EYZ A;  3V4I A;  3VN5 A;  4CEZ A;  1X9W A;  4GMJ B;  4W5Q A;  3ALY A;  4O55 A;  2YV0 X;  3TAP A;  1NJW A;  3K59 A;  4W5N A;  1RTI A;  4CJP A;  1HJR A;  4BE2 A;  2OYQ A;  2G8I A;  1B9F A;  1WSF A;  4KHS A;  4CIF A;  2QKB A;  3K5N A;  4PQU A;  3V9S A;  1KVA A;  2YNH A;  1RT3 A;  4JS5 A;  1TKZ A;  1S9G A;  1QSS A;  3P83 D;  5I42 A;  3OYK A;  3NF8 A;  2DFH A;  4AHR A;  4H4M A;  5KRS A;  2G8F A;  1QE1 A;  2HHV A;  1C1C A;  3ZSX A;  1MU2 A;  2VG6 A;  3T3F A;  1RT5 A;  2KW4 A;  3LP0 A;  1GOC A;  4ELU A;  3VQD A;  4G1Q A;  3NDK A;  4HUG A;  5HRS A;  4EP4 A;  1JLE A;  2IOC A;  2X74 A;  3VA0 A;  4CEF A;  4OLB A;  1HPZ A;  3ZSY A;  1C0U A;  3MAQ A;  3SI6 A;  4AHC A;  4DLE A;  3VQB A;  2ZQB A;  1HRH A;  1FKP A;  1YVU A;  3LP3 A;  3RTV A;  1NK5 A;  4CJU A;  4F8R A;  1S1V A;  1B92 A;  1RT7 A;  3V9Z A;  4FJH A;  4M3T A;  4E1M A;  1NK7 A;  1L3V A;  1IKW A;  1EP4 A;  1EKE A;  1KCF A;  1BCM A;  1JKH A;  1WLJ A;  4CGF A;  3OYN A;  3NHG A;  3SV3 A;  4I9L A;  2X6N A;  3ZT4 A;  2Y1J A;  4CEA A;  1BIU A;  2R7Y A;  5HLF A;  3KKR A;  4FK4 A;  2VG5 A;  2XO7 A;  5JS2 A;  4IG3 A;  1B9D A;  3S9H A;  1W0H A;  4CJF A;  2F8T A; 
#chains in the Genus database with same CATH topology
 5GIO A;  1CZA N;  4KAZ A;  3ULE B;  4CZM A;  3HP9 A;  3HST B;  4RW9 A;  3F73 A;  2VWJ A;  1L3U A;  4PKH A;  4OGE A;  5HOO A;  4ICL A;  5D3G A;  3D2F B;  3CC2 N;  4EP5 A;  4DQI A;  2BTF A;  4I6M B;  3OYL A;  4CJ4 A;  3DWL A;  4KHW A;  4YOW A;  2HHQ A;  5B8H A;  3O9R A;  4CIE A;  4LY7 A;  1JXE A;  1KRP A;  1IG9 A;  1EX4 A;  2D0C A;  5I9E B;  2ASM A;  1O1W A;  4I2Q A;  3V1O A;  1I39 A;  3I8D A;  4W5R A;  2WTU A;  1RBS A;  3VQQ A;  1RDA A;  4HWI A;  4F2S A;  3HRG A;  2B4J A;  2QKK A;  3C6T A;  3TU5 A;  4M3Y A;  3KHY A;  4XH4 A;  2RE2 A;  1YIT N;  4WFB L;  5JVH L;  1WOQ A;  4YY3 K;  3OYE A;  2YKM A;  1NK0 A;  1RBT A;  3VQ5 A;  2OTJ N;  1HKB A;  1U04 A;  4KHN A;  1FJG K;  5KGW A;  4X62 K;  3V6D A;  4KHU A;  5C25 A;  5BRH A;  1UWB A;  3E9P A;  3CD6 N;  3HP6 A;  1GLE G;  3EL2 A;  3CFR A;  2O8B B;  2UUC K;  3A8Y A;  4IFE A;  2QA4 N;  3F9K A;  5AQU A;  3VQE A;  3F5T A;  4CW7 B;  4IJN A;  1A5X A;  4B3O A;  4N47 A;  3CIP A;  1MWM A;  3O4W A;  5AQY A;  4DV2 K;  3T1H K;  4DR6 K;  2E6M A;  2P9S A;  1IKY A;  5M1P A;  5KTQ A;  1ESV A;  4DTU A;  3THV A;  1NKC A;  5I3U A;  5BN9 A;  1NK8 A;  3SJJ A;  4BRF A;  2IGI A;  4KV8 A;  2E20 A;  3N4Q A;  4IO9 L;  3GG4 A;  5C2F A;  4IDH A;  2G8H A;  4BQL A;  4LFA K;  5HP1 A;  3WQT A;  5C2D A;  1E4G T;  3HT3 A;  1QSL A;  2OAN A;  3LDN A;  3CER A;  3CM6 A;  1CXU A;  2QWN A;  3VQ6 A;  4N56 A;  4CJQ A;  4FXD A;  4NCB A;  3CFO A;  2CGK A;  3TAN A;  4E1J A;  5HL7 L;  2NRW A;  4IXC A;  3K0S A;  4DF8 A;  1X9J A;  4Q0B A;  2HW3 A;  2P9P B;  3T1Y K;  5LJW A;  3D0P A;  2HB5 A;  4M42 A;  4J2A A;  3SUQ A;  2J4R A;  3DOK A;  3OYJ A;  4CE9 A;  1C0M A;  3KLH A;  3DM2 A;  1VQO N;  2E1Z A;  4LSN A;  4NYF A;  1T05 A;  3I56 N;  3L2Q A;  5AQR A;  5AQF A;  4JS4 A;  1Y97 A;  4DV7 K;  4BRP A;  4O5F A;  4KRF A;  4HCC A;  1IG8 A;  3VEV A;  4YOT A;  1T3V A;  5AQS A;  4DKW A;  4CIG A;  3CCR N;  4DTX A;  3OYH A;  4LF5 K;  2HF3 A;  5E84 A;  3TAQ A;  1NGI A;  3E9O A;  3QEW A;  3T1A A;  1KD1 O;  3QBW A;  1C6V A;  4C8L A;  4DR7 K;  1KVC A;  1REV A;  3O80 A;  4M3R A;  3D45 A;  2E2N A;  3LWL A;  5FPE A;  5J2N A;  3KLF A;  3QB0 A;  4DQQ A;  4E89 A;  3AO3 A;  4WYB A;  1NK4 A;  5GIP A;  1VQL N;  4CZK A;  4H5V A;  3VQ4 A;  4HUE A;  4JI6 K;  3FGU A;  4HCB A;  3L3V A;  4IO8 A;  4H0X B;  4K8X A;  4BDY A;  3THW B;  3QET A;  4FK2 A;  2KZM A;  4A62 A;  1BCO A;  2BDP A;  4KRE A;  2DTU A;  2P9U B;  1NJX A;  3ZEU A;  1X3M A;  2P1J A;  2ZE2 A;  1SKS A;  3UKR A;  1RT4 A;  1VSD A;  4DSK A;  3CFP A;  1TL3 A;  3H3O B;  3MXI A;  4B1U B;  4AF1 A;  4IZ9 A;  4WQ4 C;  5FDL A;  4DV5 K;  4BC5 A;  1FW6 A;  5CYQ A;  1FK9 A;  3D2E A;  2P5O A;  5BN8 A;  4W5T A;  1NOY A;  3I55 N;  1J9A A;  4BWM A;  1C1A A;  3VEY A;  5C0Y A;  1NU0 A;  4X64 K;  4QS7 A;  4CZF A;  1VQ5 N;  1N6Q A;  4BR5 A;  2D0P A;  1Q7Y O;  2UXC K;  4CGD A;  2HMI A;  5J2Q A;  2H3G X;  4XEI A;  1K6Y A;  3K5O A;  1DTQ A;  2P9L B;  3PLA A;  3LDS A;  1JL2 A;  4WF9 L;  4QOZ B;  1U45 A;  1YTU A;  4ILJ A;  4YDU C;  1TUU A;  2ZJQ L;  4CFB A;  2FF6 A;  2YHX A;  4FLX A;  4FJG A;  4JHD A;  1NMN A;  2CGL A;  3MX5 A;  3AVL A;  4CF0 A;  2A41 A;  4GVM A;  4O0J A;  4CJE A;  3B6O A;  3AVC A;  4R79 A;  2BH1 A;  1YVN A;  4CZL A;  2XRI A;  4B1Z A;  5FPM A;  4FJX A;  2OZM A;  3UKU A;  3O1W A;  3SV4 A;  5DM7 L;  3GL1 A;  1QQM A;  1SQK A;  2UUA K;  4B9L A;  4N76 A;  1Q18 A;  2WOM A;  2HHX A;  1TVR A;  4B9Q A;  1ATN A;  5GAH P;  1ATS A;  4BE1 A;  3SUN A;  3CQ8 A;  3ZSZ A;  2Q2R A;  4IWV A;  2P9S B;  2ZD1 A;  4CHP A;  1BO5 O;  4BRL A;  1VQ9 N;  3QDK A;  3VQ8 A;  4M3Z A;  2ITG A;  5BPL A;  3FZK A;  4PHT X;  1NGG A;  5CE3 A;  4O0I A;  5AQZ A;  4RTF D;  3K57 A;  3M8S A;  3VGL A;  4JNE A;  1RBV A;  4CHO A;  3AVJ A;  4DV1 K;  3AVG A;  2YNI A;  4FJ8 A;  4EHT A;  3WEE A;  3J8A A;  4IOA L;  4DG1 A;  3SAH A;  2Q31 A;  1NKE A;  3TAG A;  3RR8 A;  4B1V A;  3MEC A;  4M7Y A;  3MWP A;  3VEZ A;  4EZ6 A;  3HVR A;  4A5B A;  3SQ2 A;  2V51 B;  4JKE A;  4CEB A;  3MN5 A;  4CF1 A;  4FO0 A;  4KI4 A;  4N5S A;  5M1O A;  1OVY A;  2FF3 B;  4CEC A;  2E2P A;  4CHY A;  2XY7 A;  3TI0 A;  4DU3 A;  3S3M A;  2XY8 A;  3C95 A;  4FK0 A;  1D5A A;  3NF9 A;  1JCG A;  2YNF A;  4NXM K;  1NWK A;  3ULD A;  4HTU A;  1CZ9 A;  3ZSR A;  3L6Q A;  4E19 A;  5KQD A;  1OKJ A;  1WSE A;  3JYT A;  3R3L A;  2YNG A;  1U4B A;  4DTO A;  4C23 A;  1OH8 A;  4H5T A;  4FJ5 A;  5C12 A;  1BIZ A;  2F8S A;  4PWD A;  1NGC A;  3W3D A;  3J80 O;  4B8C A;  3GDQ A;  1BGX T;  4O8U A;  3E01 A;  3SQ0 A;  5BRE A;  4DSJ A;  4NLC A;  3QES A;  3U3G A;  2A40 A;  5H1S Q;  3D2F A;  1T44 A;  2WFB A;  4DTP A;  4Y1D A;  3M8P A;  1U2V B;  2ZM6 K;  2LSN A;  2PBD A;  3DRS A;  2G8U A;  2ASO A;  3DOL A;  3H1Q A;  4KHY A;  4Z4C A;  3ENH A;  3U9Z A;  4W5Q A;  3SAG A;  2YV0 X;  2QM1 A;  2OYQ A;  1WSF A;  3ZEU B;  2QKB A;  3UKR B;  1OH5 A;  3M1F A;  4GKJ K;  4CZJ A;  4JS5 A;  1S9G A;  1YXQ A;  4H0P A;  4IEE A;  2G8F A;  2VG6 A;  2WBN A;  3T3F A;  3J7Y P;  1BU6 O;  4ELU A;  4EP4 A;  1JLE A;  3VA0 A;  1GLF O;  4FSV A;  1P8Z A;  3NVM A;  3VQB A;  4JKC A;  1S1V A;  1B92 A;  3V9Z A;  4M3T A;  4JYA K;  1ILY A;  4CD1 A;  3QIC A;  1WLJ A;  1KCF A;  1BCM A;  3OYN A;  5CR4 A;  2Y1J A;  3ENB A;  3SV3 A;  4I9L A;  2X6N A;  1RFQ A;  1BIU A;  4FWQ A;  2R7Y A;  5JLH A;  4FK4 A;  3FZL A;  2JWK A;  4IG3 A;  1B9D A;  3S9H A;  4CJF A;  1U6Z A;  3MN9 A;  2EHG A;  2HOE A;  4BRD A;  3MXJ A;  5FRO A;  1XHX A;  3DLH A;  3LZI A;  1HNX K;  1LV5 A;  4AM6 A;  1RDU A;  3C0B A;  4OPK A;  4JI0 K;  3OYD A;  4FL9 A;  1S5J A;  2QWM A;  4CJL A;  2QXF A;  4FOE A;  4XH5 A;  2DPN A;  1JLC A;  4DF4 A;  2KTQ A;  1VQP N;  2O4I A;  4GV9 A;  3FFK B;  4Z4F A;  2UU9 K;  3HM9 A;  3HO1 A;  4ISG A;  4LF4 K;  3OJS A;  3QML A;  2YHY A;  3MED A;  4PKI A;  3UKU B;  4IG0 A;  1HNZ K;  1KSP A;  3OYA A;  2UYT A;  4Y0W A;  2YCH A;  1BA1 A;  3IS9 A;  4UQG A;  2XHB A;  2E8A A;  3ZT1 A;  1BI4 A;  2BGG A;  5MLC Q;  4OPJ A;  5J2M A;  3VGM A;  4A5A A;  5EU7 A;  4ID1 A;  5AQW A;  3V1R A;  5IT9 O;  4A2B A;  2W6K A;  4CJS A;  1WBD A;  3E9L A;  3V9X A;  1NJZ A;  2RKI A;  3CCU N;  1CXQ A;  4BY9 C;  3KJV A;  1BOT O;  3VTI A;  4C8K A;  1VQ4 N;  2RF2 A;  3CPW M;  2AA4 A;  3SPY A;  3V9U A;  3DLB A;  1RGI A;  1TV6 A;  2O8F A;  1UOC A;  1RBR A;  3WNH A;  4LF9 K;  3RR7 A;  4RW6 A;  3WEE B;  4MLE A;  4DR4 K;  4EZ9 A;  3B6P A;  2A42 A;  5ADX H;  4WFN L;  1T6D A;  1WSJ A;  4FWL A;  2IS3 A;  4XIU A;  3SQ4 A;  1KLN A;  4IFY A;  3NAE A;  1OVQ A;  5C24 A;  2YHW A;  3CCS N;  4DR5 K;  1HJO A;  3L2U A;  4B3S K;  3OYG A;  2O8D A;  4CD3 A;  3LAM A;  3P39 A;  3M8R A;  1G15 A;  1CLQ A;  1SS6 A;  1WNS A;  3O08 A;  5AQL A;  2DY4 A;  1NKB A;  2W6L A;  1J5E K;  3ZT2 A;  4WQ5 A;  2O4G A;  1VSJ A;  4BG9 A;  3OBW A;  1IKX A;  2FXU A;  3M3Z A;  2HNZ A;  4CHQ A;  5ELZ A;  3HPG A;  4DV3 K;  4J2E A;  3U9D A;  3WNG A;  4C8O A;  4M63 C;  2P9U A;  3VQA A;  5E26 A;  1VSL A;  1KFD A;  5AQJ A;  3S41 A;  2P9I A;  3O3F A;  3KKS A;  4ELV A;  4FJJ A;  4DTS A;  4Z4I A;  1JXB A;  2KHO A;  2X6S A;  3VOV A;  4Y1C A;  3ZX3 A;  5BR9 A;  3P31 A;  1JLG A;  3BF1 A;  3AO1 A;  3HPH A;  3VF6 A;  2X78 A;  3OJU A;  3H46 O;  4Z4H A;  1BHL A;  3PO5 A;  4DS4 A;  3E1Y A;  3SUP A;  5TKW A;  1QHT A;  4YNQ A;  1W97 L;  3M8Q A;  2UXB K;  1V4S A;  4JV5 K;  4BQZ A;  4MLH A;  5AQO A;  2KZZ A;  4I9Q A;  1GOA A;  1S1X A;  2A3Z A;  4DTR A;  2P9L A;  2WC9 A;  1TUY A;  4JI1 K;  1VSI A;  2E88 A;  4O8K A;  4ZTF A;  2NRT A;  4BR9 A;  1U48 A;  3ZET A;  1JLQ A;  3TPQ A;  1Q82 O;  3AO4 A;  4M3X A;  5FRM A;  2EX3 A;  1H1V A;  1LCU A;  3OYI A;  1TK0 A;  3VF2 A;  5ADX A;  3MCP A;  2BUP A;  2JWL A;  1QZ5 A;  4JKB A;  4PKG A;  2FBY A;  2A5X A;  1RTD A;  3QEV A;  3O9S A;  4B9U A;  4CER A;  1NNE A;  4KPY A;  2V7Y A;  2D0A A;  4JN4 A;  3PX6 A;  4F3T A;  4YOU A;  3PSI A;  4CZG A;  3L8B A;  1RTH A;  4FJL A;  4BWJ A;  4HVJ A;  1QHA A;  5K14 A;  3KLE A;  5CY4 A;  2QW9 A;  4J8F A;  2HHH K;  2VG7 A;  2VWK A;  3OW2 M;  3CJ7 A;  5JS1 A;  2XY6 A;  1VSH A;  1EO1 A;  4BAC A;  1Z26 A;  2P9N A;  3AVA A;  3DXK A;  1VSE A;  3LP2 A;  3RRG A;  4CEQ A;  4CJ3 A;  4DSL A;  5LL6 Z;  4DMN A;  4H5N A;  3NBP A;  3MK6 A;  4MFB A;  4KBO A;  4I2P A;  1RBU A;  3C7N A;  4FJI A;  4N41 A;  3IG1 A;  1ZC6 A;  3TAE A;  4RW4 A;  4CGI A;  4OLA A;  3EKU A;  1UA0 A;  3KLG A;  4E3S A;  3SMS A;  1QQC A;  2Z1H A;  3E66 A;  1NGF A;  4K43 A;  4JRP A;  1IBL K;  4CJW A;  1MA9 B;  3HTV A;  1IO2 A;  3AA2 A;  3VMF B;  1SAZ A;  2A6A A;  4OO1 J;  3S3O A;  4NLB A;  3HXM A;  2PAV A;  1SKW A;  2XY5 A;  4K0K K;  2QI2 A;  3G0Z A;  4LFB K;  3TTF A;  4X66 K;  1NK9 A;  1RNH A;  5AZI A;  1M1K O;  4CF9 A;  2ZGZ A;  4FM0 A;  1BQN A;  3C94 A;  3VQP A;  1BI4 B;  4LF7 K;  3O4N A;  4CHN A;  1RDB A;  1TKT A;  4A2A A;  2P5G A;  4KTQ A;  3AAP A;  3CQY A;  2QWL A;  1NBW A;  5AQM A;  4FLU A;  3ID8 A;  5AJ3 K;  4JKF A;  3NGZ A;  4PL8 A;  1C0T A;  3PO4 A;  4JI2 K;  4H5R A;  3H08 A;  5E41 A;  3EE9 A;  3VA3 A;  4OX9 K;  2O8F B;  3WQU A;  4H8K A;  4DWI A;  3QBX A;  3VTH A;  4CGG A;  5DM6 L;  4YFU A;  3CF5 L;  1XMQ K;  4C8M A;  4KO0 A;  2HF4 A;  3LAN A;  2GTD A;  3SZ2 A;  2Z1J A;  1VRT A;  5KPT A;  1HYS A;  2I7P A;  4AIL C;  1T7P A;  4CFC A;  3DI6 A;  4RCH A;  4RG8 A;  1OH6 A;  3TTD A;  2OPP A;  4E7H A;  3BF3 A;  2KKZ A;  2O8D B;  2P9K A;  2HNY A;  4I7F A;  1ZXO A;  4DFP A;  1Y64 A;  4BDP A;  2OPR A;  3HK2 A;  4FLV A;  1U2V A;  4BRA A;  1HNI A;  3L4Q A;  2ZF5 O;  2VCP A;  5BPM A;  4KFB A;  1U47 A;  4CJ7 A;  1W9H A;  3TAB A;  3LM2 A;  3PX4 A;  1A5W A;  1XI1 A;  1D8Y A;  3FE1 A;  4HUF A;  3HL8 A;  4BE0 A;  1SL1 A;  4DU1 A;  3CCV N;  4CCH A;  2P9I B;  1GOB A;  1JCE A;  2IVN A;  1T8E A;  5FLX O;  4HTL A;  3ZYY X;  1L3T A;  3ATU A;  2ZJR L;  3LDP A;  3CCM N;  2ASP A;  3FLC O;  1TL1 A;  3QNO A;  5KGX A;  3BGR A;  2D0O A;  3A0I X;  4B9V A;  3KWG A;  1HKG A;  2ETJ A;  3IAY A;  1J5O A;  1HKC A;  4W5O A;  2OPS A;  4IOX A;  4XH1 A;  3I8B A;  1ITG A;  2BAN A;  2FSJ A;  4CK1 A;  5GIN A;  3VPZ A;  1IH7 A;  4JKA A;  1HYV A;  4QAG A;  3KD1 E;  1L5U A;  3LP1 A;  4JI4 K;  4IFV A;  1VQK N;  3PUF A;  1RT6 A;  3T7Z A;  1ZBI A;  4AHS A;  1HR0 K;  3ZET B;  3CET A;  4CJR A;  3EKS A;  1NGJ A;  1HYZ A;  4E7L A;  1TK8 A;  3GBT A;  1WSI A;  4CZE A;  4CF2 A;  1ZBL A;  4E7I A;  4CEZ A;  4ISF A;  4BC3 A;  3R6M A;  3K59 A;  4CJP A;  2NRX A;  1IV0 A;  4KHS A;  3K5N A;  3V9S A;  3A5N C;  2YNH A;  4BC2 A;  1TKZ A;  1Q86 O;  5I42 A;  3OYK A;  3BUZ B;  4AHR A;  4H4M A;  5FPD A;  5KRS A;  1EQY A;  3L0Q A;  3LP0 A;  1S22 A;  2PFU A;  4HUG A;  2P9N B;  4LF8 K;  5HRS A;  3DXK B;  4CEF A;  1HPZ A;  1C0U A;  4C1N K;  3ZX0 A;  4AHC A;  4H0T B;  1HRH A;  3LP3 A;  3CJA A;  1MDU B;  3IKM A;  4F8R A;  4BVP A;  1RT7 A;  4FJH A;  1NJI O;  3C7N B;  3VET A;  4CEA A;  3KKR A;  2VG5 A;  4H03 B;  4KHP K;  2XO7 A;  1N33 K;  4DV0 K;  2PY5 A;  4DQR A;  3CJC A;  1N34 K;  3OS0 A;  3LM9 A;  5AR0 A;  3AV9 A;  3O6W A;  3PIP L;  5FRN A;  3UB5 A;  4AH9 A;  2KLA A;  1C0G A;  3WXK A;  5AQX A;  4AQY K;  3FZF A;  5AZI B;  3VGK A;  1J54 A;  4FCY A;  4KB1 A;  1N32 K;  3PY8 A;  4BRO A;  3AVH A;  3JSM A;  3JXU A;  4DQP A;  2IC3 A;  3HSC A;  2D4W A;  2YI1 A;  4YOX A;  2HMP A;  2QWR A;  1DTT A;  1HLU A;  1ASU A;  3VEW A;  5F0X A;  4PUO A;  4H4O A;  4IEI A;  3I0R A;  3KTQ A;  2RHK A;  1YJN N;  4O5B A;  2A1S A;  1N36 K;  4KB0 A;  4FWM A;  1MWK A;  3AA4 A;  2NZT A;  1QQO A;  3W0L A;  5GAE P;  1WAF A;  3SUO A;  5AQH A;  5GAD P;  1TK5 A;  3EN9 A;  1C0F A;  3MN7 A;  4O44 A;  2P9K B;  4A61 A;  1Z05 A;  2IVP A;  5BR8 K;  5KQ8 A;  5J1E A;  2DFE A;  5LY3 A;  4H0V B;  4FPB A;  3WXL A;  1TKX A;  3LWM A;  2QEX N;  4KKO A;  3G4S N;  1J6Z A;  3O9U A;  1HPM A;  2YKN A;  3ZCM A;  1XQS C;  1VSF A;  5F2R A;  1I3A A;  1WUA A;  4E7K A;  1KQS M;  1VQ8 N;  4OKE A;  3HJF A;  4EHU A;  4BRC A;  2Q1N A;  1ASV A;  5AQP A;  3CC7 N;  4DUY K;  1TGO A;  3KD5 E;  3CCQ N;  3ZT3 A;  4KTZ A;  4X65 K;  2JGU A;  3Q7C A;  1LWC A;  3MWT A;  1DGK N;  3VEN A;  1LW0 A;  5F1X A;  3U4L A;  3FZH A;  4MO4 A;  1JLB A;  1T03 A;  4DFM A;  3L2R A;  1VQ6 N;  3PSF A;  3C6U A;  2YJF A;  4OKK A;  3AVM A;  2HHT A;  2NRZ A;  2ZGY A;  5CZ1 A;  4U7B A;  3EE8 A;  3DXM B;  4B3T K;  5KPR A;  2F96 A;  4BGB A;  1XWL A;  5BPN A;  2KFZ A;  1Z25 A;  3AAQ A;  2Y1I A;  3ISN C;  1IJJ A;  3IRX A;  3AVK A;  4QS9 A;  4C8N A;  3CMA N;  3WXM B;  5M1Q A;  3G10 A;  3ZSW A;  5GAG P;  2YHA A;  5TKY A;  4CK3 A;  4B9T A;  3SMP A;  2CH6 A;  3O4Q A;  5AZJ A;  3OS1 A;  2GEM A;  5JIC A;  1JL1 A;  3DLR A;  3U3Y A;  3QFU A;  4DLG A;  4CBW A;  3AO5 A;  1P90 A;  2V52 B;  3RWU A;  4GY2 B;  3VQ9 A;  2HVH A;  3CJB A;  3NGY A;  4K41 A;  2CGJ A;  3BDP A;  2VQF K;  4L8R B;  1BQM A;  3JAM O;  3P38 A;  4K25 A;  3T69 A;  2RPI A;  3KVG A;  5BRF A;  1YT3 A;  3FZM A;  5AQN A;  3NE6 A;  3THY A;  3C65 A;  3O9Q A;  4CJT A;  3V81 A;  1VAZ A;  5HRO A;  2RN2 A;  3MEE A;  1X3N A;  3LL3 A;  3NH2 A;  3QIP A;  3J7A P;  4WQ5 C;  1XHZ A;  3ZSV A;  4V19 S;  4Z94 A;  5A2Q O;  1NLV A;  3LPT A;  4F4K A;  1SV5 A;  5AFU H;  1JCF A;  3BZC A;  3U8X A;  1IBM K;  3TTC A;  3ID6 A;  2NRR A;  5JLF A;  4OPA A;  2NNW A;  4M3U A;  2Z1I A;  2GWJ A;  3OY9 A;  4DHY A;  1HNV A;  4LSL A;  1HMV A;  2E6L A;  3CCL N;  1Q8I A;  5DMR A;  4OKJ A;  4BG8 A;  4DR2 K;  3GE1 A;  5M1N A;  3HI0 A;  2B6A A;  5AQT A;  2GUP A;  3VF4 A;  4J2B A;  3MMV A;  3K9J A;  3QNN A;  1D9F A;  3C6A A;  4MQ3 A;  3B8A X;  4IJA A;  4TSX A;  3OVN A;  3QIO A;  1D9D A;  3DMJ A;  3DAW A;  5M1F A;  4GV6 A;  2D5R A;  1RIL A;  1S6Q A;  3RMA A;  3VQ7 A;  3VER A;  5LJV A;  3JS6 A;  3CYM A;  2CH5 A;  1GLB G;  4K42 A;  4NO7 A;  4FM2 A;  1UAX A;  3QIN A;  2Q0R A;  2HBJ A;  3IFR A;  4JRQ A;  3EEQ A;  2D1K A;  3S3N A;  3MXM A;  3CJ9 A;  4E7J A;  1TKD A;  4FOI A;  3KK7 A;  3PV8 A;  3OYB A;  3AVF A;  3BP8 A;  4DCH A;  4ELT A;  4JI5 K;  1R59 O;  2G8W A;  2FSK A;  4BRN A;  1W7A A;  1L3S A;  4FZY A;  1QSY A;  1BWF O;  1KVB A;  2G8K A;  4FJ7 A;  4ZHR A;  1YF5 L;  2F9T A;  4FLY A;  1K8K A;  1NGA A;  4DTJ A;  4ZTJ A;  1U49 A;  4FJ9 A;  3WT0 A;  4BC4 A;  5AFU A;  3UE5 A;  4LC9 B;  4G9Z A;  4B8A B;  3KLI A;  1RDW X;  1X1P A;  1E4F T;  5EXW A;  4ILG B;  1BIS A;  3ZX2 A;  3IMX A;  3AVN A;  1KXP A;  1Q81 O;  4JD2 A;  1WN7 A;  4DSF A;  2IDO A;  2O8C A;  3A2F A;  5AQI A;  1LW2 A;  3SYZ A;  2I7N A;  4ILH A;  4E0D A;  4DV6 K;  1N8R O;  4LH5 A;  5EX5 A;  3QEI A;  5C42 A;  3KK1 A;  3FFI A;  3L2W A;  3K9K A;  1S9E A;  4NCA A;  3HM8 A;  3TSQ A;  4AM7 A;  3SNN A;  2DFF A;  2E4L A;  4M45 A;  2FSN A;  1RT1 A;  1YAG A;  1EXQ A;  3SLC A;  3G6E N;  5JMV A;  2E1Y A;  4DU4 A;  1RDD A;  4CF8 A;  4FM1 A;  1QQN A;  1JJ2 M;  2BE2 A;  2O8E A;  3CME N;  2IVO A;  2OA8 A;  4OGC A;  1OH7 A;  3RRH A;  3LAL A;  1K9M O;  3WUH A;  1WBB A;  1NJY A;  1BL3 A;  5AZJ B;  3O3H A;  3TR8 A;  4JLH A;  3H3N O;  1YUW A;  4BRK A;  1I94 K;  4RWT A;  2NRV A;  3WNE A;  4QS8 A;  4PL7 A;  1HUX A;  1ZYQ A;  5AQG A;  5CHI A;  3CHW A;  4B3R K;  4KH6 A;  3ZT0 A;  4DQS A;  2E2O A;  3R1X A;  1Q9X A;  2FC0 A;  1BUP A;  3CM5 A;  2HHU A;  1EET A;  4LD0 A;  5HRR A;  1FKO A;  4JKD A;  2UXD K;  3TAF A;  3THY B;  3DJC A;  3P5J A;  3DYA A;  3K5M A;  4KH4 A;  1ATR A;  1XMO K;  1RTJ A;  1K73 O;  3DLE A;  1G99 A;  1LAV A;  2ZWH A;  3VEO A;  3V4I A;  4M41 A;  4JI3 K;  4GMJ B;  3ALY A;  4O55 A;  3MCA B;  1RTI A;  1B9F A;  4CIF A;  1KAX A;  1RT3 A;  1QSS A;  3NF8 A;  1C1C A;  2YX6 A;  1RT5 A;  1GOC A;  3Q7B A;  1HX1 A;  1HNW K;  5LMU K;  3KZB A;  3J81 O;  4OLB A;  3MAQ A;  1FKP A;  1YVU A;  3TSP A;  3O9T A;  1NK5 A;  4NB4 A;  4B1Y B;  2F7T A;  1IKW A;  1EP4 A;  1EKE A;  5JVG L;  4CGF A;  3ZT4 A;  4DQ8 A;  3CCE N;  3BZK A;  5JS2 A;  2VYP A;  1YI2 N;  1W0H A;  2V7Z A;  2OPQ A;  4FLW A;  5AQQ A;  4DFK A;  4KTW A;  3KWI A;  3I0S A;  1BDG A;  3RVC A;  3EZW A;  4FW2 A;  3U6F A;  3IUC A;  5M1K A;  3QEX A;  2EWS A;  3AA5 X;  4FWK A;  3VEX A;  1LAW A;  2GEL A;  5EOY A;  3AGK A;  2NLX A;  2Q36 A;  3O8M A;  5HRP A;  2F9W A;  1QZ6 A;  4LFC K;  4UY8 O;  3SPZ A;  3IDH A;  3QFP A;  3R8E A;  3H1V X;  3AVI A;  4HHT A;  1O13 A;  4H0Y B;  2ATQ A;  4F3O A;  2PYL A;  1VHX A;  3AVB A;  1CZB A;  4YOR A;  3KK3 A;  4BDZ A;  1E3M A;  4CGH A;  4FLT A;  3UIQ A;  3LZJ A;  1DEJ A;  4CFA A;  1HQU A;  3DRR A;  2QTD A;  1GLD G;  4FWO A;  2PYJ A;  4OJR A;  3R9P A;  2AP1 A;  1GLC G;  5BRD A;  4BRI A;  5SWM A;  5EVZ A;  3DXM A;  1SKR A;  1JLF A;  1S1U A;  1K8K B;  2PZS A;  3M6G A;  3QLH A;  2GBZ A;  5CYM A;  3QEP A;  1NMD A;  4KI6 A;  1BA0 A;  3PIO L;  3CQX A;  4FVM A;  2HHW A;  3OYC A;  3F2K A;  3ATV A;  2GWK A;  4JD2 B;  3DLK A;  3ZSQ A;  1D4X A;  5EY4 A;  4AHT A;  4CHZ A;  2HHS A;  3OS2 A;  4CI6 A;  2O8C B;  2OZS A;  3D6R A;  3RSE A;  1S1T A;  3NVK A;  3SK3 A;  4U67 L;  3V1Q A;  1TYQ A;  2W42 A;  4AHU A;  3H45 C;  3I33 A;  5C15 A;  3AA3 A;  1XUP O;  4JK8 A;  3A5O C;  4Q5V A;  2Q97 A;  1J53 A;  4FJN A;  4BRM A;  3SAF A;  1SZ2 A;  3DRP A;  4KHQ A;  5AQV A;  1XC3 A;  2O8E B;  4RW8 A;  4A59 A;  1NK6 A;  1A5V A;  1ZBU A;  3C6H A;  4BVO A;  4NCG A;  3SQ1 A;  4BGA A;  3NH0 A;  1NOZ A;  4CEE A;  4WQ4 A;  1GLA G;  1WB9 A;  3NH1 A;  1KAY A;  1RDC A;  1YHQ N;  1XC9 A;  4FWP A;  3BEX A;  3DLG A;  4FLZ A;  4E1N A;  1YJ9 N;  1DT9 A;  3CC4 N;  2VQE K;  3SCX A;  4CJV A;  1RT2 A;  2HND A;  2ZJP L;  3ASM A;  3TSU A;  3GOI A;  3ZLJ A;  4YOV A;  3OA9 A;  3NF7 A;  3G25 A;  4K8Z A;  2QWP A;  4DUZ K;  3NGI A;  4FZZ A;  2I5J A;  2WUS A;  3THX A;  1Q9Y A;  5LMN K;  3HYF A;  1SL2 A;  2HST A;  4CJK A;  4DTN A;  1DKG D;  4OVL A;  3EY1 A;  4DTM A;  4BRH A;  2AJQ A;  4YDU A;  2KFN A;  1UA1 A;  4FJK A;  4FPA A;  2P51 A;  1GLJ O;  2Q3S A;  3RMD A;  1S1W A;  4JI7 K;  3QER A;  1KTQ A;  4MDA A;  3AAR A;  4EAH D;  2WON A;  4Z4E A;  3NFA A;  4WFA L;  4ID5 A;  3OHR A;  5J2P A;  4FZX C;  2ITM A;  4IKF A;  4B9M A;  3NF6 A;  4CED A;  4M7X A;  4BR2 A;  1X9M A;  5IWA K;  3SBG A;  4PY5 A;  3A5L C;  2FBV A;  3ENO A;  3QO9 A;  4MDB A;  3HPO A;  4F2R A;  1F21 A;  3O5B A;  4YHH K;  1NGE A;  3CPE A;  1LWF A;  4PA1 A;  4YOY A;  3N4P A;  4GW6 A;  3L2V A;  1LWE A;  3O1B A;  3VES A;  3PX0 A;  2JLE A;  1HQE A;  2QWO A;  3TAM A;  1VQN N;  1ASW A;  3NCI A;  2GV9 A;  3MX2 A;  4B3M K;  4FVU A;  4CFD A;  3K5L A;  1WSG A;  1WAJ A;  4H5W A;  1QVG M;  2W41 A;  1QTM A;  3HOT A;  2B5J A;  4Z4G A;  4IBN A;  1S6P A;  3WXJ A;  3AGR A;  4B08 A;  4JEP A;  2GUI A;  3ZSO A;  3HVT A;  1VK0 A;  1DLO A;  1YTA A;  3OYM A;  1TAQ A;  3CI5 A;  4JKG A;  3G71 N;  1W2B M;  3LDL A;  3LAK A;  4JI8 K;  3NMU A;  2W40 A;  5FPN A;  1IBK K;  4DSE A;  3O3G A;  3CG7 A;  2G8V A;  4GV3 A;  1ZBH A;  4DS5 A;  3CJ1 A;  1NG9 A;  4ISE A;  4JAX A;  3ULE A;  2YHB A;  2Z1G A;  3V9W A;  1T6C A;  4NXN K;  3OYF A;  2FLO A;  3CCJ N;  5C10 A;  3VQC A;  4B9N A;  4I6M A;  4B1X B;  4BR4 A;  3WXI A;  1VQM N;  1KAZ A;  2FBT A;  3DLL L;  1NGD A;  1IKV A;  5CZ2 A;  3OBY A;  4CES A;  4L3Q A;  4DB3 A;  3LDQ A;  1RCH A;  2QWQ A;  3LPU A;  4GNI A;  2A1R A;  1VSK A;  4CGJ A;  1KFS A;  2VGM A;  1KLM A;  4CK2 A;  3ITH A;  4Z0U A;  4DR1 K;  1YIJ N;  4FWR A;  2F4V K;  3KIO A;  3D2E B;  3EZ5 A;  5DK5 A;  2IAJ A;  5HBM A;  4RW7 A;  1X9S A;  4CBX A;  1GLL O;  4IDK A;  1Z6R A;  2NUB A;  5HRN A;  5AQK A;  5KRT A;  5T7B A;  1NGB A;  1M90 O;  3LDO A;  2QK9 A;  1S72 N;  1R0A A;  3RSE B;  4B9S A;  1NGH A;  4CJ5 A;  4CEO A;  2O8B A;  4BRG A;  1SL0 A;  1TYQ B;  2VWB A;  2KQ2 A;  4F9O A;  1QS4 A;  5SZT A;  1S3X A;  3J7Z O;  4B1W B;  4H0O A;  1LOT B;  4EFH A;  3RMB A;  1EWQ A;  4DSI A;  4JHD B;  4NYN A;  4BR0 A;  5KI6 A;  3RMC A;  4FW1 A;  4AHV A;  3HBT A;  4JKH A;  4BR7 A;  1XNQ K;  3SBT A;  2GX9 A;  3WNF A;  3TAR A;  4WCE L;  4BRQ A;  3P1G A;  4LF6 K;  1N5Y A;  3SJH A;  4MO5 A;  2E5L K;  4J2D A;  3AO2 A;  2E2Q A;  3HZ6 A;  1WSH A;  4FWN A;  1SUQ A;  3AY9 A;  1NM1 A;  2P9P A;  2NRH A;  4LH4 A;  4FYD A;  2HBL A;  3T19 A;  4C1N I;  4FJM A;  3HOS A;  4DFJ A;  3THX B;  4DV4 K;  3M5R A;  4JK9 A;  4DR3 K;  1VSM A;  4QCL A;  3P4I A;  4FWS A;  3L3U A;  2FBX A;  3K58 A;  1VRU A;  4A57 A;  4OPH A;  3K2P A;  3MN6 A;  4EIA A;  1FXX A;  3BY5 A;  1C1B A;  2VGN A;  1TAU A;  4GKK K;  2YJE A;  4CVN E;  4BRE A;  3MEG A;  4R5P A;  1JLA A;  4O4G A;  2Q0U A;  3OTO K;  4WE1 A;  4JK7 A;  1ZBF A;  1ZBS A;  3L4I A;  3TWH A;  2OCE A;  1QVF M;  2D0B A;  4M3W A;  3KK2 A;  1XNR K;  3EYZ A;  3VN5 A;  4GVE A;  1X9W A;  2HBM A;  1KC8 O;  3TAP A;  1NJW A;  1V4T A;  3F9M A;  4W5N A;  1HJR A;  4BE2 A;  2IIR A;  2G8I A;  4PQU A;  4CZH A;  1KVA A;  3A5M C;  3P83 D;  1BG3 A;  2DFH A;  1QE1 A;  2HHV A;  3ZSX A;  1MU2 A;  3EO3 A;  2KW4 A;  3H6E A;  2UUB K;  4KH5 A;  3VQD A;  4G1Q A;  3NDK A;  3THW A;  1K8A O;  2IOC A;  2X74 A;  3ZSY A;  1EWR A;  3SI6 A;  4DLE A;  2ZQB A;  3RTV A;  3MDQ A;  3FR0 A;  4CJU A;  4E1M A;  1NK7 A;  1L3V A;  4CBU A;  2HVI A;  1JKH A;  1YJW N;  2OTL N;  3NHG A;  3D7E O;  4CZI A;  4JKG B;  5KPZ A;  2QXL A;  5HLF A;  3CXC M;  1VQ7 N;  2HBK A;  4IOC L;  2F8T A; 
#chains in the Genus database with same CATH homology
 2OPQ A;  2EHG A;  4FLW A;  4DFK A;  4KAZ A;  4KTW A;  2PY5 A;  3MXJ A;  3HP9 A;  1XHX A;  3HST B;  4RW9 A;  3I0S A;  5FRO A;  4DQR A;  3DLH A;  3F73 A;  2VWJ A;  1L3U A;  3OS0 A;  4OGE A;  3LZI A;  4ICL A;  5D3G A;  3AV9 A;  1LV5 A;  4EP5 A;  4FW2 A;  3U6F A;  3QEX A;  5FRN A;  4DQI A;  4OPK A;  3AA5 X;  3OYD A;  3OYL A;  1S5J A;  4CJ4 A;  4KHW A;  4AH9 A;  4CJL A;  2HHQ A;  1LAW A;  4CIE A;  4LY7 A;  2QXF A;  1JXE A;  1KRP A;  1IG9 A;  1EX4 A;  1JLC A;  4DF4 A;  2D0C A;  2KTQ A;  2O4I A;  4Z4F A;  5HRP A;  1J54 A;  3HM9 A;  4FCY A;  4KB1 A;  1O1W A;  4I2Q A;  3V1O A;  1I39 A;  3I8D A;  4W5R A;  3PY8 A;  3SPZ A;  3HO1 A;  1RBS A;  3VQQ A;  3AVH A;  1RDA A;  3OJS A;  4F2S A;  3JSM A;  2B4J A;  3AVI A;  2QKK A;  4HHT A;  3C6T A;  3MED A;  4DQP A;  4M3Y A;  2ATQ A;  2IC3 A;  4F3O A;  4IG0 A;  2PYL A;  3AVB A;  1CZB A;  4BDZ A;  3KK3 A;  4CGH A;  4FLT A;  3UIQ A;  3LZJ A;  1KSP A;  3OYA A;  1DTT A;  4CFA A;  1ASU A;  3OYE A;  1HQU A;  2YKM A;  3DRR A;  1NK0 A;  1RBT A;  3VQ5 A;  4PUO A;  2PYJ A;  4OJR A;  4H4O A;  1U04 A;  3IS9 A;  3I0R A;  4UQG A;  2XHB A;  3KTQ A;  4KHN A;  3ZT1 A;  5KGW A;  4O5B A;  5SWM A;  1BI4 A;  3V6D A;  2BGG A;  2A1S A;  4KHU A;  5C25 A;  1SKR A;  4KB0 A;  1JLF A;  1S1U A;  4OPJ A;  5J2M A;  1UWB A;  3AA4 A;  5EU7 A;  4ID1 A;  2PZS A;  1WAF A;  3QLH A;  2GBZ A;  5CYM A;  3SUO A;  3QEP A;  3V1R A;  3HP6 A;  4KI6 A;  3CFR A;  4CJS A;  1TK5 A;  3V9X A;  1NJZ A;  2RKI A;  4FVM A;  1CXQ A;  3KJV A;  4O44 A;  4C8K A;  3OYC A;  2HHW A;  2RF2 A;  3F9K A;  3VQE A;  3SPY A;  3V9U A;  3DLB A;  1A5X A;  1TV6 A;  4B3O A;  1UOC A;  4N47 A;  1RBR A;  2DFE A;  3WNH A;  5J1E A;  3RR7 A;  3DLK A;  4RW6 A;  1TKX A;  3ZSQ A;  4AHT A;  4CHZ A;  3LWM A;  4KKO A;  2HHS A;  3OS2 A;  2E6M A;  3B6P A;  4EZ9 A;  1IKY A;  2YKN A;  3ZCM A;  5KTQ A;  2OZS A;  1WSJ A;  1VSF A;  2IS3 A;  4XIU A;  3SQ4 A;  1I3A A;  4E7K A;  4DTU A;  3THV A;  1KLN A;  4OKE A;  1S1T A;  4IFY A;  3NAE A;  1NKC A;  5I3U A;  3HJF A;  1NK8 A;  3SJJ A;  5C24 A;  1ASV A;  3V1Q A;  2IGI A;  2W42 A;  4KV8 A;  4AHU A;  3L2U A;  3OYG A;  1TGO A;  3KD5 E;  2G8H A;  3ZT3 A;  5HP1 A;  3AA3 A;  4KTZ A;  3HT3 A;  2JGU A;  3LAM A;  4Q5V A;  1G15 A;  3M8R A;  1LWC A;  1QSL A;  1WNS A;  1CLQ A;  1J53 A;  3CM6 A;  4FJN A;  2DY4 A;  1CXU A;  1NKB A;  1LW0 A;  3VQ6 A;  4N56 A;  4CJQ A;  4FXD A;  3DRP A;  4NCB A;  3CFO A;  3TAN A;  3ZT2 A;  4KHQ A;  1JLB A;  1T03 A;  4RW8 A;  3L2R A;  4DFM A;  3C6U A;  2O4G A;  1VSJ A;  1NK6 A;  4DF8 A;  4OKK A;  4Q0B A;  2HW3 A;  1A5V A;  1ZBU A;  1IKX A;  2AJQ A;  3AVM A;  2HNZ A;  4NCG A;  4CHQ A;  3HPG A;  3D0P A;  3SQ1 A;  4J2E A;  2HHT A;  2HB5 A;  4M42 A;  3WNG A;  4C8O A;  4J2A A;  3SUQ A;  3NH0 A;  5CZ1 A;  1NOZ A;  4CEE A;  3VQA A;  3NH1 A;  1XC9 A;  1RDC A;  2F96 A;  3DOK A;  4F4K A;  1VSL A;  3OYJ A;  3DLG A;  4CE9 A;  4E1N A;  1C0M A;  1XWL A;  3KLH A;  1KFD A;  4FLZ A;  3DM2 A;  2KFZ A;  1Z25 A;  3O3F A;  3KKS A;  4ELV A;  4FJJ A;  4DTS A;  4LSN A;  4NYF A;  2Y1I A;  3ISN C;  1T05 A;  3IRX A;  1JXB A;  2X6S A;  4Z4I A;  3L2Q A;  3SCX A;  4JS4 A;  1Y97 A;  4Y1C A;  4CJV A;  1RT2 A;  2HND A;  3AVK A;  1JLG A;  3ASM A;  3AO1 A;  4C8N A;  4KRF A;  3HPH A;  4HCC A;  2X78 A;  3OJU A;  3G10 A;  3ZSW A;  2YHA A;  3NF7 A;  4CK3 A;  4B9T A;  4K8Z A;  4Z4H A;  4CIG A;  1BHL A;  3NGI A;  3PO5 A;  4FZZ A;  3O4Q A;  4DS4 A;  2I5J A;  4DTX A;  1Q9Y A;  3OS1 A;  3HYF A;  1SL2 A;  3OYH A;  1JL1 A;  3DLR A;  4CJK A;  3U3Y A;  3SUP A;  1QHT A;  4YNQ A;  3TAQ A;  3M8Q A;  4DTN A;  3QEW A;  3T1A A;  4OVL A;  4DLG A;  3EY1 A;  3AO5 A;  4DTM A;  1C6V A;  2KZZ A;  4C8L A;  3RWU A;  1KVC A;  1REV A;  2KFN A;  4M3R A;  1GOA A;  1S1X A;  3VQ9 A;  1UA1 A;  4I9Q A;  3NGY A;  3D45 A;  4DTR A;  2HVH A;  4FJK A;  3LWL A;  5J2N A;  3BDP A;  2P51 A;  2Q3S A;  3RMD A;  3KLF A;  4L8R B;  1BQM A;  1S1W A;  1VSI A;  3QER A;  4ZTF A;  1KTQ A;  4DQQ A;  4E89 A;  3AO3 A;  1U48 A;  1NK4 A;  1JLQ A;  2RPI A;  2WON A;  3AO4 A;  4M3X A;  5FRM A;  2EX3 A;  4Z4E A;  3NFA A;  1YT3 A;  3OYI A;  4ID5 A;  3NE6 A;  3VQ4 A;  4HUE A;  5J2P A;  4FZX C;  4IKF A;  4B9M A;  3NF6 A;  4CED A;  4CJT A;  1TK0 A;  1X9M A;  4HCB A;  3L3V A;  3V81 A;  4PY5 A;  5HRO A;  4K8X A;  2RN2 A;  2FBV A;  3MEE A;  3QO9 A;  4BDY A;  3HPO A;  4F2R A;  1F21 A;  2FBY A;  3NH2 A;  3QET A;  1RTD A;  3QIP A;  1LWF A;  4PA1 A;  3QEV A;  4B9U A;  4FK2 A;  4GW6 A;  4CER A;  3L2V A;  1XHZ A;  2KZM A;  4KPY A;  3ZSV A;  2D0A A;  3PX6 A;  1LWE A;  1BCO A;  2BDP A;  4F3T A;  4KRE A;  2DTU A;  1NJX A;  3PX0 A;  2JLE A;  3L8B A;  1RTH A;  4FJL A;  2P1J A;  1SKS A;  2ZE2 A;  1HQE A;  4BWJ A;  1RT4 A;  1VSD A;  3LPT A;  1SV5 A;  3TAM A;  1TL3 A;  5K14 A;  1ASW A;  4HVJ A;  3NCI A;  3CFP A;  3MXI A;  2GV9 A;  3KLE A;  5FDL A;  4CFD A;  3K5L A;  5CY4 A;  1WSG A;  2VG7 A;  5CYQ A;  1WAJ A;  1FK9 A;  2VWK A;  2P5O A;  5JS1 A;  4W5T A;  2XY6 A;  1VSH A;  1NOY A;  1J9A A;  4BAC A;  3AVA A;  1Z26 A;  1QTM A;  4BWM A;  1C1A A;  4M3U A;  2Z1I A;  2HVI A;  2B5J A;  1VSE A;  3LP2 A;  4Z4G A;  4IBN A;  3RRG A;  1S6P A;  4CEQ A;  4CJ3 A;  3OY9 A;  1N6Q A;  4B08 A;  4DSL A;  4DMN A;  3NBP A;  1HNV A;  4LSL A;  4CGD A;  4MFB A;  2HMI A;  2GUI A;  1HMV A;  1RBU A;  2E6L A;  4I2P A;  5J2Q A;  1Q8I A;  5DMR A;  4OKJ A;  3HVT A;  3ZSO A;  1VK0 A;  1DLO A;  4FJI A;  4N41 A;  1YTA A;  3IG1 A;  3OYM A;  1TAQ A;  3TAE A;  1K6Y A;  4RW4 A;  3LAK A;  3K5O A;  2B6A A;  1DTQ A;  4J2B A;  4CGI A;  4OLA A;  4DSE A;  3O3G A;  3CG7 A;  3QNN A;  1UA0 A;  1D9F A;  4MQ3 A;  3KLG A;  3LDS A;  4E3S A;  2G8V A;  1JL2 A;  4DS5 A;  1ZBH A;  1QQC A;  4TSX A;  4QOZ B;  1U45 A;  1YTU A;  2Z1H A;  2YHB A;  3OVN A;  3QIO A;  1D9D A;  2Z1G A;  4JRP A;  4CFB A;  3DMJ A;  4CJW A;  1IO2 A;  3V9W A;  4FLX A;  3AA2 A;  3OYF A;  4FJG A;  3VQC A;  4B9N A;  3S3O A;  2D5R A;  1RIL A;  3AVL A;  3HXM A;  1SKW A;  1S6Q A;  2XY5 A;  3G0Z A;  4CF0 A;  3RMA A;  3VQ7 A;  4GVM A;  4O0J A;  2FBT A;  3CYM A;  1NK9 A;  1RNH A;  4CJE A;  3B6O A;  5CZ2 A;  1IKV A;  4CES A;  4CF9 A;  4FM0 A;  3AVC A;  1BQN A;  3C94 A;  3VQP A;  1BI4 B;  4FM2 A;  1UAX A;  1RCH A;  3LPU A;  3O4N A;  2XRI A;  2A1R A;  1VSK A;  3QIN A;  4DSK A;  4JRQ A;  4CGJ A;  4CHN A;  1RDB A;  1KFS A;  1TKT A;  4FJX A;  2OZM A;  3S3N A;  2P5G A;  4KTQ A;  1KLM A;  4CK2 A;  3MXM A;  4E7J A;  1TKD A;  3ITH A;  4Z0U A;  3SV4 A;  3PV8 A;  3OYB A;  3AVF A;  3KIO A;  3EZ5 A;  5DK5 A;  4FLU A;  2IAJ A;  5HBM A;  4RW7 A;  1X9S A;  3NGZ A;  4B9L A;  4IDK A;  1C0T A;  2NUB A;  4ELT A;  4N76 A;  2G8W A;  2WOM A;  3PO4 A;  4FZY A;  5E41 A;  3H08 A;  3VA3 A;  1L3S A;  5HRN A;  1TVR A;  3SUN A;  1QSY A;  5KRT A;  4BE1 A;  2HHX A;  5T7B A;  1KVB A;  4H8K A;  3CQ8 A;  4DWI A;  3ZSZ A;  4YFU A;  4CGG A;  2G8K A;  4FJ7 A;  4C8M A;  4ZHR A;  4FLY A;  2QK9 A;  4KO0 A;  3LAN A;  2ZD1 A;  4DTJ A;  4CHP A;  4ZTJ A;  3SZ2 A;  1R0A A;  1U49 A;  2Z1J A;  4B9S A;  4FJ9 A;  1VRT A;  3VQ8 A;  4CJ5 A;  4M3Z A;  2ITG A;  1HYS A;  4CEO A;  4AIL C;  4O0I A;  4CFC A;  1T7P A;  3K57 A;  3DI6 A;  1SL0 A;  3M8S A;  4B8A B;  3KLI A;  4RG8 A;  1RBV A;  1X1P A;  2OPP A;  4CHO A;  3AVJ A;  4E7H A;  2KQ2 A;  1BIS A;  3AVG A;  2YNI A;  1QS4 A;  2HNY A;  4I7F A;  3AVN A;  5SZT A;  4DFP A;  4FJ8 A;  4BDP A;  2OPR A;  1WN7 A;  4DSF A;  3RMB A;  3HK2 A;  4DG1 A;  2IDO A;  4FLV A;  1NKE A;  4DSI A;  3A2F A;  3TAG A;  3RR8 A;  1LW2 A;  3SYZ A;  3MEC A;  4E0D A;  4NYN A;  1HNI A;  4LH5 A;  4EZ6 A;  5KI6 A;  3QEI A;  5C42 A;  3KK1 A;  3HVR A;  3RMC A;  3FFI A;  3L2W A;  3SQ2 A;  1S9E A;  4FW1 A;  4KFB A;  4AHV A;  1U47 A;  4NCA A;  4CEB A;  3SNN A;  1W9H A;  4CF1 A;  4KI4 A;  3TAB A;  2DFF A;  3PX4 A;  1A5W A;  2E4L A;  4M45 A;  4N5S A;  1XI1 A;  1D8Y A;  4HUF A;  3HL8 A;  1RT1 A;  4CEC A;  3WNF A;  1EXQ A;  4BE0 A;  4DU1 A;  3TAR A;  1SL1 A;  3P1G A;  1N5Y A;  4CCH A;  4DU4 A;  4CHY A;  2XY7 A;  3TI0 A;  1RDD A;  4CF8 A;  4DU3 A;  1GOB A;  3S3M A;  2XY8 A;  4FM1 A;  3C95 A;  4FK0 A;  1D5A A;  2BE2 A;  3NF9 A;  4J2D A;  3AO2 A;  2YNF A;  1T8E A;  1WSH A;  1L3T A;  1SUQ A;  4OGC A;  2OA8 A;  3RRH A;  4FYD A;  4LH4 A;  1TL1 A;  3QNO A;  3LAL A;  5KGX A;  3T19 A;  3BGR A;  4FJM A;  4DFJ A;  4B9V A;  1NJY A;  1BL3 A;  3ULD A;  4HTU A;  1CZ9 A;  2ETJ A;  3ZSR A;  3O3H A;  3TR8 A;  4E19 A;  3IAY A;  4JLH A;  1WSE A;  3JYT A;  1J5O A;  4W5O A;  1VSM A;  2OPS A;  4QCL A;  2YNG A;  1U4B A;  4DTO A;  3L3U A;  1ITG A;  2BAN A;  3WNE A;  4CK1 A;  4FJ5 A;  2F8S A;  1BIZ A;  2FBX A;  3K58 A;  1VRU A;  1IH7 A;  1ZYQ A;  4PWD A;  1HYV A;  4QAG A;  3KD1 E;  3K2P A;  4B8C A;  1BGX T;  1L5U A;  3LP1 A;  3E01 A;  4IFV A;  1FXX A;  3ZT0 A;  3PUF A;  1C1B A;  1RT6 A;  4DQS A;  1Q9X A;  1ZBI A;  1TAU A;  2FC0 A;  3CM5 A;  4AHS A;  3SQ0 A;  2HHU A;  1EET A;  3MEG A;  4LD0 A;  4R5P A;  4DSJ A;  1JLA A;  1FKO A;  5HRR A;  3QES A;  4CJR A;  3U3G A;  4O4G A;  3TAF A;  4DTP A;  4Y1D A;  3M8P A;  3P5J A;  4WE1 A;  1HYZ A;  3DYA A;  3K5M A;  4E7L A;  1TK8 A;  1WSI A;  2LSN A;  1ZBF A;  3DRS A;  3TWH A;  1RTJ A;  2G8U A;  3DLE A;  1LAV A;  3DOL A;  2D0B A;  4CF2 A;  1ZBL A;  4M3W A;  4KHY A;  4Z4C A;  3KK2 A;  4E7I A;  4M41 A;  3EYZ A;  3V4I A;  3VN5 A;  4CEZ A;  1X9W A;  4GMJ B;  4W5Q A;  3ALY A;  4O55 A;  2YV0 X;  3TAP A;  1NJW A;  3K59 A;  4W5N A;  1RTI A;  4CJP A;  1HJR A;  4BE2 A;  2OYQ A;  2G8I A;  1B9F A;  1WSF A;  4KHS A;  4CIF A;  2QKB A;  3K5N A;  4PQU A;  3V9S A;  1KVA A;  2YNH A;  1RT3 A;  4JS5 A;  1TKZ A;  1S9G A;  1QSS A;  3P83 D;  5I42 A;  3OYK A;  3NF8 A;  2DFH A;  4AHR A;  4H4M A;  5KRS A;  2G8F A;  1QE1 A;  2HHV A;  1C1C A;  3ZSX A;  1MU2 A;  2VG6 A;  3T3F A;  1RT5 A;  2KW4 A;  3LP0 A;  1GOC A;  4ELU A;  3VQD A;  4G1Q A;  3NDK A;  4HUG A;  5HRS A;  4EP4 A;  1JLE A;  2IOC A;  2X74 A;  3VA0 A;  4CEF A;  4OLB A;  1HPZ A;  3ZSY A;  1C0U A;  3MAQ A;  3SI6 A;  4AHC A;  4DLE A;  3VQB A;  2ZQB A;  1HRH A;  1FKP A;  1YVU A;  3LP3 A;  3RTV A;  1NK5 A;  4CJU A;  4F8R A;  1S1V A;  1B92 A;  1RT7 A;  3V9Z A;  4FJH A;  4M3T A;  4E1M A;  1NK7 A;  1L3V A;  1IKW A;  1EP4 A;  1EKE A;  1KCF A;  1BCM A;  1JKH A;  1WLJ A;  4CGF A;  3OYN A;  3NHG A;  3SV3 A;  4I9L A;  2X6N A;  3ZT4 A;  2Y1J A;  4CEA A;  1BIU A;  2R7Y A;  5HLF A;  3KKR A;  4FK4 A;  2VG5 A;  2XO7 A;  5JS2 A;  4IG3 A;  1B9D A;  3S9H A;  1W0H A;  4CJF A;  2F8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...