1B92A

Mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
144
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGAVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (INTEGRASE)
publication title The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 53
structure length 144
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1b92A00
3SCXA 3HXMA 3NAEA 3D0PA 3G0ZA 1JLQA 3P83D 3NH1A 3K5NA 3OYDA 2XY7A 4FK2A 5I3UA 2Z1HA 1U45A 4PY5A 1RT1A 2Y1IA 3K5OA 5FRNA 3AVGA 3D45A 3AA3A 1VRUA 2JLEA 3DRSA 1NOYA 3RR8A 4N47A 3HVTA 3AV9A 2B4JA 4K8XA 1C1AA 2X6SA 3HVRA 4EZ9A 4M3WA 4DQPA 3NF6A 1NKEA 5K14A 3KKSA 3ALYA 3HYFA 5J2PA 5J2QA 3ZT2A 4W5OA 4OGCA 2HNDA 3TAFA 3MXMA 4CJ4A 1RT6A 1GOBA 1DTQA 3C95A 2VG7A 4O0JA 3ZSOA 1RDCA 3RTVA 4DF8A 3V6DA 5HLFA 1WSHA 4B3OA 1Z26A 3TANA 1HYSA 4CFAA 1ZBUA 1ASVA 3NHGA 2ZE2A 4E7IA 4DTUA 4H4MA 3KLFA 1SUQA 3ZSRA 5CYMA 3QNOA 2Y1JA 3P5JA 4LSLA 3LZJA 1LAWA 3AO2A 3VQPA 1BHLA 3MECA 2YKNA 4RW8A 1TAUA 3NCIA 4DLGA 3HPHA 4FLUA 4OPKA 1N5YA 2VG5A 1SKRA 1NOZA 4FXDA 1BI4B 2IGIA 4DSKA 4Z4IA 1QSSA 1VK0A 4NYNA 4HTUA 1LW0A 4KHYA 3DRPA 4B9UA 3DLGA 3V9XA 4DFPA 4HCBA 4E0DA 3FFIA 4CJSA 1CXUA 1GOAA 2RKIA 3HL8A 4CF0A 1IG9A 3NH0A 2P51A 1T05A 1WAJA 5J1EA 3NDKA 1KVAA 4BE2A 5D3GA 3AVAA 3WNHA 1C6VA 2OA8A 3MEEA 1I3AA 1SL2A 1K6YA 4AHUA 4DTOA 3VQEA 3OYMA 4CJEA 3V9SA 1YTUA 2G8IA 1S1TA 1TKZA 2KFZA 3TAPA 1G15A 2QKKA 4N76A 1S9EA 3V81A 4O44A 1KLMA 1S1VA 3A2FA 4EP5A 2PYLA 1ZBIA 3AVNA 1U4BA 4KKOA 2OPRA 4DSLA 4J2EA 3VQBA 3ZT4A 3O4QA 4FLXA 2HVHA 3SUOA 3KLIA 4PQUA 5CZ1A 4F8RA 3U3GA 2KZMA 2PZSA 1CLQA 1ASWA 3AVBA 1JXEA 3TWHA 4IG3A 4Z4HA 4W5QA 1RNHA 4E7HA 3SJJA 2YNHA 4ICLA 1YTAA 4AHVA 3ZSWA 2YKMA 2KW4A 1RCHA 4OKKA 5HP1A 1NJXA 2I5JA 3KLHA 4HUGA 2DTUA 2R7YA 1NK8A 4DMNA 2F8TA 1VSMA 1QE1A 2ZD1A 4DFJA 1CZ9A 3SQ1A 4KREA 4DU4A 4CCHA 3HP6A 5DK5A 4EZ6A 4CJ3A 4NYFA 3T1AA 4DS5A 4OVLA 4CEQA 1WN7A 2A1SA 1BQNA 2JGUA 1RBUA 2YNIA 4CEEA 3K58A 4Y1CA 1RT2A 1BCOA 4M45A 3SQ2A 1HPZA 5SZTA 2IC3A 2KQ2A 4CHQA 1TKTA 5HRPA 1UWBA 1T03A 4I9LA 3QEWA 4L8RB 1TKDA 1BIUA 3NGYA 3ZSYA 3K59A 4Q5VA 1GOCA 3O3FA 4B9VA 4Z4EA 2G8WA 2ITGA 3DOKA 1I39A 1BQMA 1HNIA 1QSYA 4FM1A 3OYFA 3LWMA 1RBRA 1DLOA 1HRHA 3TARA 4UQGA 2F8SA 1VSIA 1S6PA 4CGIA 2XO7A 1ZBHA 4DQIA 4RW4A 3OY9A 3E01A 2RPIA 3F9KA 4M3RA 3DLBA 4FJHA 1BCMA 4CF9A 4PUOA 1HQEA 2OPSA 2YV0X 1RT4A 1D5AA 3DLKA 1NK0A 4DSJA 3WNGA 3DYAA 3LZIA 4Y1DA 4RG8A 3ZSZA 1XHZA 4OJRA 1FXXA 4DSIA 1JXBA 1XHXA 1J53A 4KO0A 4CJUA 3TAEA 2G8KA 4EP4A 1VSJA 3OYKA 5J2NA 1LWCA 3QETA 2HMIA 2KFNA 4CJPA 1WAFA 4IG0A 1KVCA 3DI6A 3ULDA 3RMBA 1J5OA 3L2QA 3OS0A 1JL1A 4DS4A 3LDSA 3VQ4A 4FJJA 1VSHA 3QO9A 1RTJA 1S6QA 4AH9A 4M3XA 3HO1A 3HT3A 1ZBLA 3HJFA 3ZT0A 2E4LA 4W5RA 3OYLA 1QSLA 4JLHA 1IH7A 1S1XA 4DTXA 2ATQA 1RDDA 2Z1JA 3CFPA 2BDPA 3QNNA 1L3TA 4ZTJA 3AVJA 1EX4A 3OYCA 4DU1A 2OYQA 4F3TA 2A1RA 3SNNA 3S3MA 4IFYA 3VQCA 4DTRA 3WNEA 1LWFA 1U49A 2YNFA 4OKJA 4I9QA 2X74A 3VQ7A 2EHGA 1R0AA 1VSDA 4FW2A 2E6MA 2NUBA 5KI6A 3V9WA 3CYMA 1JLEA 3K5MA 4I7FA 4FZYA 2AJQA 3EY1A 3SYZA 3DLHA 1C1CA 4FM0A 1NK4A 1TK0A 2P1JA 4M3UA 2FBVA 2GV9A 1RBVA 1VRTA 2BE2A 4R5PA 4BACA 4DTMA 3TI0A 4KHWA 5CZ2A 4E3SA 4DFKA 4B9LA 3LP0A 1S5JA 4CJKA 3P1GA 3QESA 1TL3A 4DG1A 4FJKA 1TKXA 3LALA 4OGEA 3V1QA 4BE0A 3IG1A 2VWKA 2X6NA 4E89A 4CGJA 3RMAA 1VSFA 3VQDA 3L2WA 4FJGA 4JRQA 3VQ9A 4CEFA 1J9AA 5KGWA 1Y97A 4O4GA 1VSLA 4CIGA 1A5XA 4FJ5A 1NKBA 3MAQA 1BL3A 3OS2A 3F73A 2WONA 4CF1A 1ZBFA 4DQSA 1T8EA 3IAYA 5KRTA 1ITGA 3C94A 1BGXT 2HHWA 1NJWA 4CJTA 2O4GA 2X78A 4Z4FA 4KHNA 2OPPA 3MXIA 3BDPA 3SUPA 2B6AA 4E7KA 1VSKA 2IAJA 1JLGA 4CE9A 1Q8IA 3M8PA 4CK2A 3TAGA 3PX6A 4F2SA 3IS9A 1A5WA 4AHCA 5FDLA 1SKSA 4IFVA 4CHYA 4BWJA 5J2MA 1S9GA 1TGOA 3VQ8A 3AVLA 3MXJA 1X9WA 2DFEA 1TL1A 4CGFA 4HVJA 4FJ7A 4M41A 4OPJA 3CQ8A 1B9FA 3DMJA 2G8UA 3L3VA 3ASMA 3V4IA 5C25A 3I0SA 2G8VA 4ELTA 1BISA 1C1BA 2FC0A 4KV8A 4CK3A 1SL1A 3M8RA 1F21A 3AA4A 4M3TA 1Q9XA 4M3ZA 3OVNA 1JLAA 3AO5A 5CY4A 2HHXA 4CK1A 1HQUA 3LWLA 3UIQA 3NF9A 4FK4A 1LAVA 2W42A 2OPQA 1C0TA 1N6QA 3S3NA 5FROA 1U47A 3LP3A 3ZT3A 3EZ5A 4KAZA 5HROA 4KB0A 4LY7A 4ID5A 4BDYA 1TK8A 4K8ZA 2FBTA 4KTWA 1ZYQA 3OYEA 4KI4A 3VQ5A 4M42A 3C6TA 4Z4CA 3LP2A 3AVFA 4CGDA 3LANA 1TAQA 2FBXA 3QIOA 1X9MA 1BI4A 1WNSA 1KTQA 1O1WA 3AO4A 1WSGA 2RN2A 3C6UA 1NJYA 4KHUA 3U6FA 4CJWA 2HVIA 2KTQA 2XHBA 2QXFA 3OYIA 3U3YA 3L8BA 4ID1A 4N41A 3DLEA 4DTNA 2HHUA 4KI6A 2BANA 4FYDA 3V9ZA 2D0BA 3S9HA 1IKYA 1NK6A 4C8MA 1UAXA 3KKRA 4Q0BA 3M8QA 4E7LA 4CF2A 2Z1IA 5DMRA 3NGZA 3NBPA 4DQRA 3QERA 1UA0A 3LAMA 3OYGA 3TAQA 4W5TA 3PV8A 4ZTFA 1KVBA 4CFDA 4HUFA 3SUQA 1IKVA 2PY5A 4J2AA 1WSFA 5KRSA 3S3OA 3NGIA 4HUEA 4FJ8A 4CEOA 2HHTA 4CHOA 3KLEA 4B08A 3KTQA 4DLEA 1HYVA 1HJRA 3PO5A 3AVMA 1A5VA 4C8LA 4FLYA 4DSEA 3RRGA 4BWMA 2IOCA 3VN5A 4DTSA 2ETJA 1KRPA 4TSXA 1SL0A 2DFHA 2YHAA 1RT5A 2FBYA 1U04A 4CHNA 1KFSA 4CEAA 4B9SA 5HRSA 4LH5A 4BE1A 4F2RA 1B92A 3NFAA 2IS3A 2HB5A 4WE1A 3QLHA 1Z25A 5HRRA 5HBMA 2KZZA 2LSNA 5SWMA 1CZBA 2VWJA 3AVKA 2HNZA 1JLBA 4BDPA 3OYAA 4FCYA 3RMCA 4AILC 2OZMA 2D5RA 1UA1A 4H8KA 3AA2A 4DSFA 1L3VA 2DFFA 4E1NA 2XY6A 4FJXA 3O3GA 4JS5A 1FKOA 1S1WA 3PX0A 5CYQA 3AVCA 1YVUA 3TAMA 5C42A 3KJVA 2GUIA 4NCBA 1KSPA 4CEZA 4RW7A 4FJIA 3NE6A 4N56A 1KCFA 4HCCA 4YNQA 4KHQA 4H4OA 3AVIA 4FLZA 3SZ2A 3JSMA 3HSTB 4LD0A 1RBSA 1REVA 4IBNA 3HPOA 3SPZA 1NK7A 2VG6A 3ZSVA 4E1MA 3HM9A 4CGHA 1WSJA 5E41A 3TABA 4Z4GA 2E6LA 1YT3A 1W0HA 2GBZA 4YFUA 3OYJA 3VA3A 4OLBA 1FK9A 4AHTA 1L3SA 2HW3A 1TV6A 1RILA 1LV5A 4IDKA 4KHSA 2F96A 3CFRA 1NK5A 1WSIA 3VQQA 4B8AB 2OZSA 4G1QA 4CJLA 3HP9A 4DQQA 3B6OA 3EYZA 4DFMA 4PWDA 4CERA 3PO4A 3VA0A 1L5UA 3KK2A 4J2BA 4CHZA 1VSEA 4FM2A 3T3FA 4MQ3A 3AO3A 1TVRA 2EX3A 1LW2A 3IRXA 4C8OA 4F3OA 4DTJA 4CHPA 1QTMA 2D0CA 4FZXC 1B9DA 3DOLA 4E7JA 2XY5A 4FJNA 4B9TA 3SI6A 1KLNA 4FK0A 3AO1A 1TK5A 3OYBA 2P5GA 3KD5E 1EETA 3VQ6A 4DU3A 3RMDA 3HK2A 4KTQA 1MU2A 1RTIA 3I8DA 3CM5A 2YNGA 4HHTA 4C8KA 5KTQA 4F4KA 4FZZA 1IKXA 3LPTA 4DWIA 4ELUA 4KRFA 3OYNA 4M3YA 1HNVA 3G10A 4GMJB 4O5BA 3CFOA 1U48A 4CJ5A 1D9FA 3KK1A 4ZHRA 3M8SA 1RDBA 1QS4A 4PA1A 4O55A 5HRNA 1LWEA 3DM2A 4IKFA 1QHTA 4QAGA 3OJUA 1X9SA 2WOMA 3BGRA 4I2QA 3QEXA 3HPGA 4C8NA 2PYJA 2QK9A 2P5OA 4JRPA 3MEDA 3ISNC 1RT3A 4FLWA 2HNYA 1W9HA 2YHBA 1RTDA 4CESA 2HHSA 3VQAA 5I42A 4LSNA 1XC9A 4OLAA 2XRIA 4B8CA 4CEBA 3L2UA 4I2PA 3L3UA 4RW9A 4J2DA 1Q9YA 5T7BA 3L2RA 3RRHA 2XY8A 4FLTA 4NCGA 4KTZA 4DTPA 3SQ4A 4CJVA 3NH2A 1HMVA 1NKCA 3RR7A 1DTTA 2Z1GA 4B9NA 2HHQA 3QIPA 3OS1A 3MEGA 1SKWA 3KD1E 1KFDA 3ZSQA 3OYHA 5JS2A 3KK3A 2BGGA 1RDAA 4GVMA 4JS4A 1EXQA 1RBTA 2QKBA 1WLJA 4FJLA 4LH4A 4ELVA 2O4IA 4NCAA 1HYZA 3CM6A 3LPUA 4OKEA 3AA5X 4FJ9A 1RTHA 2D0AA 4N5SA 3O3HA 3PX4A 3SPYA 4KB1A 4MFBA 4CFBA 1NK9A 4KPYA 3DLRA 3V1RA 4QCLA 3WNFA 4FJMA 4CGGA 3PUFA 3KLGA 3OJSA 1JL2A 5C24A 3TR8A 3ZT1A 1XWLA 3I0RA 3T19A 3H08A 1UOCA 4E19A 4CFCA 2IDOA 4AHSA 3QEIA 3QINA 4FLVA 1BIZA 4Z0UA 3LAKA 1JKHA 4GW6A 3KIOA 3PY8A 1NJZA 3SUNA 1JLCA 4CEDA 2G8FA 3JYTA 2ZQBA 3NF8A 1C0UA 3ZCMA 1J54A 2DY4A 1IKWA 3V1OA 3O4NA 4CIEA 3RWUA 3ZSXA 1X1PA 4RW6A 1FKPA 4FVMA 1JLFA 4XIUA 1D8YA 1S1UA 4B9MA 4KFBA 4CJRA 4AHRA 3SQ0A 1RT7A 3QEPA 4CJQA 5KGXA 1QQCA 5JS1A 4QOZB 5EU7A 4CIFA 4W5NA 2B5JA 3CG7A 3NF7A 3SV4A 3V9UA 1CXQA 1IO2A 1EP4A 1C0MA 4CECA 1ASUA 1EKEA 1WSEA 3K57A 2HHVA 4O0IA 4CJFA 4CF8A 3DRRA 3L2VA 3K5LA 4BDZA 3AVHA 2RF2A 3B6PA 4DF4A 3QEVA 3SV3A 2G8HA 3LP1A 1D9DA 3K2PA 5FRMA 2Q3SA 1T7PA 1XI1A 1SV5A 3THVA 1L3UA 4FW1A 3ITHA
chains in the Genus database with same CATH superfamily
1BDGA 1W97L 3G0ZA 3NH1A 4JYAK 5AFUH 2A42A 2HBJA 2Z1HA 5I3UA 1U45A 1RT1A 2OANA 5FRNA 2JLEA 1NOYA 3GG4A 4N47A 1KAZA 2GEMA 3HVTA 3AV9A 4K8XA 4M3WA 3HVRA 3NF6A 1NKEA 4JI1K 3HSCA 3GDQA 5K14A 3KKSA 3ALYA 3HYFA 1U6ZA 4W5OA 2HNDA 3MXMA 4XH4A 1XNRK 5F2RA 3ZSOA 3RTVA 4DF8A 2HBMA 4IEIA 4GV3A 1M1KO 3NHGA 3CCLN 2ZE2A 4MDBA 4AM6A 4DR1K 2ASPA 4WQ4C 3ZSRA 1BHLA 2QWLA 1OH8A 2FXUA 4DLGA 3H3NO 2VG5A 4B1YB 4FWLA 2IGIA 4G9ZA 3CC2N 3LDQA 4CZGA 4NYNA 1LW0A 4BREA 2O8EA 3DLGA 4HCBA 4JKGA 4CJSA 1CXUA 3HL8A 3NH0A 1WAJA 4ISFA 5J1EA 4BRMA 1KVAA 4O8KA 2OTLN 3AVAA 3WNHA 3C7NB 1NNEA 4M7XA 3THYB 1HKCA 5AQHA 4JKHA 1G15A 5AQZA 4O44A 3CMAN 4BRCA 4BQLA 4DSLA 3ZT4A 4JKCA 3KLIA 2HBLA 3SUOA 5CZ1A 2IVPA 5C15A 5M1NA 5GIPA 4MLEA 3CD6N 3U3GA 4BG9A 3JAMO 3TWHA 4E7HA 1JJ2M 2YNHA 4AHVA 4FWOA 1NJXA 2I5JA 4FPAA 2ZD1A 1HNXK 3HP6A 4NXMK 4CJ3A 4CEQA 3VTIA 2YNIA 2KQ2A 4LF5K 3KZBA 1NGHA 3QEWA 2O8CA 4RCHA 2I7NA 1Z6RA 4B9VA 4Z4EA 2G8WA 4WFNL 1I39A 1HNIA 1YVNA 1QSYA 2ASMA 5EVZA 3LWMA 5H1SQ 3VTHA 1BWFO 2XO7A 5MLCQ 4RW4A 4BRGA 3F9KA 3DLBA 2OPSA 3K9KA 4FPBA 1NK0A 3WNGA 3FGUA 4Y1DA 1YHQN 4CJUA 3TAEA 1VSJA 3OYKA 2KFNA 1WAFA 1YF5L 1KVCA 1J5OA 3L2QA 3OS0A 1JL1A 3A5NC 4FJJA 3I56N 3ZEUA 4CZIA 3EZWA 3EE9A 5F1XA 2E4LA 3HOTA 2ZF5O 2IVOA 5GINA 4JLHA 4DV7K 1EX4A 3MCPA 1NGEA 4IFYA 4J8FA 1U49A 4OKJA 4BR2A 2O8DA 3VQ7A 1V4SA 3CHWA 1R0AA 3MN6A 1BOTO 4FW2A 2NUBA 3P38A 3WT0A 1TYQA 4I7FA 1QZ6A 3EY1A 3SYZA 1VQ7N 1C1CA 3DLHA 4FM0A 1VQON 1NK4A 1N33K 1VQMN 4M3UA 1K8AO 1C0GA 4DTMA 4KHWA 3TI0A 2UU9K 4CJKA 4DCHA 3VESA 1P8ZA 4DG1A 3THWA 4BRKA 1TKXA 2VWKA 4CGJA 4BC3A 3E9LA 4CEFA 1NMDA 4C1NK 1A5XA 3TTFA 3BY5A 4JKAA 3F73A 1ZXOA 1ITGA 3C94A 1BGXT 1U2VB 3BDPA 5JICA 3SUPA 2O8FB 1VSKA 1JLGA 4N41A 3RSEA 3M8PA 3TAGA 4BC2A 1A5WA 3ATUA 2WUSA 5AZJA 3MXJA 4X62K 4DV4K 5IT9O 4M41A 2NRVA 3IFRA 4KH6A 2UXDK 3V4IA 1GLBG 2G8VA 3DXMB 4ELTA 2CH5A 4O8UA 3BUZB 5ELZA 3M8RA 3HI0A 3B8AX 3ZLJA 4JKEA 3WXLA 4M3TA 3FFKB 2E2NA 4AQYK 2Q0RA 4CK1A 1HQUA 4I6MB 3NF9A 3J7ZO 2OPQA 2E1ZA 3ZT3A 3EZ5A 4KAZA 4KB0A 1TK8A 4HTLA 4RTFD 4LFBK 3OYEA 3KWGA 3R6MA 3LANA 3QIOA 3CQYA 5LJWA 4BR5A 5AQFA 2FSNA 4JD2B 4CJWA 3U3YA 3L8BA 4DTNA 2YX6A 3VEZA 1T6CA 3V9ZA 3CQXA 1YJNN 4C8MA 1UAXA 3M8QA 2Z1IA 3NBPA 3QERA 3LAMA 3TAQA 5AQSA 1SAZA 3O9SA 5LY3A 4HUEA 2HHTA 3KTQA 4H0XB 2P9NA 1HYVA 3DJCA 1NGGA 4Z94A 4BRHA 2CH6A 1A5VA 4BWMA 2ETJA 1KRPA 4TSXA 4M63C 1RT5A 4BE1A 4F2RA 5HRRA 2O8EB 1IV0A 1DEJA 4JKGB 3AVKA 4BRFA 3ENOA 2KLAA 2D5RA 1UA1A 4JS5A 1S1WA 3LDNA 1YVUA 3AVCA 5C42A 4NCBA 4A59A 4CEZA 4JV5K 3NE6A 4N56A 2UUBK 4NO7A 4YNQA 3J80O 3CMEN 4FLZA 3SZ2A 3JSMA 3HSTB 1RBSA 1Y64A 5CHIA 3VA3A 1YT3A 1W0HA 1W2BM 3L0QA 1TV6A 3OBWA 1IBMK 1WSIA 2WC9A 4B8AB 4JI2K 3U4LA 3HP9A 1YAGA 4DFMA 4PWDA 1H1VA 1MWKA 3VOVA 3KK2A 1VQLN 5TKWA 4CHZA 1OH7A 1TUYA 2EX3A 3SI6A 1KLNA 2O8CB 5AJ3K 1VQ6N 3OYBA 2P5GA 1NWKA 3HK2A 3RMDA 3I8DA 1RTIA 4LFCK 3CM5A 3F5TA 2A41A 4FZZA 2Q31A 4F4KA 3VERA 3LPTA 3U8XA 4MDAA 4M3YA 1RDWX 5F0XA 3CFOA 1D9FA 1NU0A 3KK1A 1E4GT 1QS4A 4O55A 1LWEA 3H45C 1XMQK 1Q81O 5C12A 2WOMA 4H0TB 4I2QA 3QEXA 5M1PA 2PYJA 2P5OA 2CGJA 5HL7L 5LMUK 4BRDA 4CESA 1E3MA 3VQAA 2EWSA 3TSQA 1XC9A 4B8CA 1GLAG 4I2PA 4RW9A 4EFHA 3L2RA 4X64K 3E66A 3RRHA 4B3TK 4FLTA 4BQZA 3ZEUB 3SQ4A 4DTPA 1HMVA 4A5BA 1DTTA 1EXQA 5BPLA 2QKBA 4FJLA 4ELVA 1HYZA 4A5AA 4GKKK 3SPYA 2D0AA 4N5SA 3O3HA 4QCLA 1QHAA 3WNFA 3KLGA 2O8DB 5C24A 3TR8A 4AM7A 3T19A 4AHSA 3CCMN 1GLJO 1JKHA 3KIOA 1NJZA 2G8FA 2VCPA 2E88A 4H0YB 3ZCMA 3VEXA 3O4NA 4CIEA 1YJ9N 4H5NA 1X1PA 3ZSXA 2Q36A 1FKPA 3EO3A 4CJRA 4K42A 2AA4A 4AHRA 3THWB 1QQCA 1D4XA 4QOZB 2B5JA 3CG7A 3NF7A 4EHUA 3U9DA 3MN7A 1IO2A 1N34K 3CCSN 4BG8A 1ASUA 1EKEA 1IJJA 3AARA 2HHVA 4JKFA 4CJFA 3TTCA 3AVHA 4DF4A 2G8HA 3LM9A 3QEVA 3BF1A 3ZETA 2D0PA 2ASOA 1XI1A 5AQNA 3THVA 4JK7A 2CGLA 3LDOA 1QQOA 3RSEB 5C2FA 3RVCA 4FK2A 5AZJB 2Y1IA 3K5OA 2VWBA 3AA3A 1VRUA 3DRSA 3EKSA 2X6SA 4DQPA 3F9MA 5C0YA 3S41A 4DV3K 5J2QA 4OGCA 3A5LC 3C95A 1RDCA 4FVUA 1Z26A 3TANA 3HOSA 1HYSA 4CZLA 4CFAA 1ZBUA 4DTUA 3KLFA 4OPHA 3P5JA 4IFEA 3LZJA 1K73O 1LAWA 3VQPA 1X3NA 2QWOA 1YITN 2ITMA 1N5YA 4FWKA 3FZMA 1SKRA 4H0VB 1QSSA 1VK0A 3A5OC 1NGFA 4KHYA 4L3QA 3FZLA 3I55N 1RDUA 1GOAA 1Q18A 2NRTA 3NDKA 4B3SK 4BE2A 1M90O 2QWNA 3J81O 4BR7A 2PFUA 1I3AA 4DR5K 4LFAK 1SL2A 4DTOA 3OYMA 3V9SA 3TAPA 4N76A 2QWPA 3V81A 1SZ2A 3VEYA 1S1VA 1ZBIA 4EP5A 3CF5L 4IJAA 2P9NB 3AVNA 2NNWA 3W0LA 1U4BA 4KKOA 2OPRA 4J2EA 4YOWA 4JI6K 4GY2B 4PQUA 2VQFK 3ZX0A 1DGKN 4W5QA 4ICLA 4OKKA 2KW4A 5KPTA 5HP1A 2A40A 1VSMA 4KREA 1MWMA 4CCHA 4OPAA 4NYFA 4Z4IA 1I94K 1RBUA 4H03B 3SQ2A 4M45A 1HPZA 5HRPA 1UWBA 4CBUA 5BPNA 3VETA 1GOCA 3O3FA 1BQMA 5AQYA 4FM1A 1RBRA 1DLOA 1HRHA 1WB9A 2F8SA 1BO5O 1S6PA 3OY9A 3E01A 4CF9A 4FWQA 1RT4A 1D5AA 3E1YA 1NBWA 3DYAA 4K25A 3I8BA 3LZIA 1XHZA 2KHOA 1JXBA 4KO0A 2G8KA 1JCEA 2HMIA 1QQMA 1OH5A 4CJPA 3RMBA 2HMPA 3LDSA 4H5RA 5AZIB 4BY9C 3SJHA 4AH9A 3HT3A 4DR3K 1ZBLA 2W6LA 4PKIA 5BREA 1IH7A 2ATQA 3CFPA 1L3TA 3QBWA 3AVJA 3UKUA 3CCQN 4DU1A 5C2DA 1IBKK 3SNNA 3S3MA 1LWFA 2X74A 3VEOA 2NRWA 3K0SA 2E6MA 3R9PA 1VQKN 2AJQA 1YUWA 3CYMA 3K5MA 4FZYA 4BRNA 3ENBA 2P1JA 2UXBK 4BACA 2V7YA 4E3SA 3O9QA 4IOXA 1NLVA 3CJCA 2P9UA 3V1QA 4EHTA 2OCEA 3EN9A 3RMAA 1K8KA 3VQDA 4WYBA 3VQ9A 5KGWA 3HRGA 4O4GA 2A5XA 5BR9A 4FJ5A 1NKBA 1BL3A 2GELA 2IIRA 2WONA 3QMLA 2O4GA 3D2EA 4Z4FA 2OPPA 3MXIA 1E4FT 2B6AA 4E7KA 3PX6A 4CK2A 1T6DA 4BGAA 4QS9A 1SKSA 4IFVA 2HHHK 4CHYA 3HZ6A 5J2MA 2E5LK 4ISGA 4CGFA 4HVJA 3H1QA 3CQ8A 2G8UA 3ASMA 3OBYA 2JWKA 5ADXH 1VQ8N 3CCVN 4KV8A 3AA4A 4JI7K 2QXLA 1BA1A 3OVNA 1JLAA 2HHXA 3O6WA 3LWLA 3EL2A 4GNIA 4FK4A 4BRAA 2W42A 3ZETB 1N6QA 3S3NA 4B1WB 1SS6A 5HROA 4LY7A 5LMNK 1ZYQA 4KI4A 4M42A 1Z05A 4CBWA 4CGDA 3ZX3A 1TAQA 4YOTA 3CIPA 1LCUA 1O1WA 3AO4A 2RN2A 2V52B 3C6UA 3D2FA 1S3XA 2HHUA 2BANA 4DR6K 3S9HA 1IKYA 3KKRA 4CBXA 4CF2A 3CCRN 3NGZA 3F2KA 1QVGM 2P9IA 4DR2K 5HOOA 4HUFA 1YXQA 2D0OA 4H0PA 3S3OA 3NGIA 4FJ8A 3SK3A 2P9KA 4NLBA 5AQMA 4DLEA 5AQOA 1HJRA 4DUYK 4C8LA 2NLXA 3RRGA 3AY9A 1SL0A 2YHAA 4PKGA 2FBYA 1KFSA 4HWIA 3CC7N 4XH1A 2DPNA 3NFAA 2HB5A 5HBMA 4DV6K 4DR4K 2KZZA 1EWRA 4LF4K 2HNZA 1OH6A 4BDPA 4FCYA 5EX5A 3RMCA 4JI8K 3PX0A 1OVQA 2YJFA 4FJIA 4HCCA 3JXUA 4KHQA 5CR4A 2VYPA 4JI3K 2HF3A 2F7TA 1REVA 4IBNA 4LD0A 2VG6A 3OA9A 4CGHA 2GBZA 3OYJA 4OLBA 4AHTA 4DQ8A 1L3SA 1RILA 2P9PA 3SMSA 3WUHA 4CJ7A 3CFRA 3H46O 5AQQA 2OZSA 3N4QA 4G1QA 4CJLA 3AGRA 2YHYA 1YJWN 4BR9A 1L5UA 4WCEL 4FM2A 3T3FA 2GTDA 3HBTA 4F3OA 4CHPA 2D0CA 1B9DA 1MDUB 4FK0A 3R3LA 3BZCA 3GBTA 3EKUA 3MMVA 4HHTA 1JCFA 3DWLA 5BPMA 2P9SA 2FLOA 5AFUA 1KC8O 1QZ5A 4GMJB 3G10A 4O5BA 3A8YA 4PA1A 1QHTA 2QWRA 3T1HK 3MEDA 4FLWA 2HNYA 2YHBA 3OTOK 1YIJN 1RTDA 4LSNA 4OLAA 4CEBA 3L3UA 1YI2N 3ATVA 4LF8K 4KTZA 1NKCA 3QIPA 3OS1A 3ZSQA 3OYHA 5JS2A 3KK3A 1S72N 2BGGA 3BF3A 4JS4A 4LH4A 2HF4A 3UKUB 3LPUA 4OKEA 3AA5X 3CETA 4FJ9A 1RTHA 4MFBA 4BROA 1NK9A 3V1RA 3AGKA 1VAZA 4CGGA 3PUFA 3OJSA 5AQLA 4R79A 3U9ZA 4Z0UA 5BRDA 5FLXO 2VGMA 5AR0A 2ZQBA 1C0UA 2DY4A 5FPMA 1IKWA 3V1OA 3MN9A 4X66K 1JLFA 4B9MA 3SQ0A 1RT7A 2P9UB 4ILHA 4CJQA 5KGXA 5JS1A 4U7BA 4NLCA 4CIFA 4W5NA 1HNWK 3V9UA 1CXQA 3CI5A 4EIAA 4O0IA 4CF8A 5DM6L 3L2VA 3K5LA 5GAHP 1VQNN 3SV3A 3CJ9A 3LP1A 4ILGB 3D2EB 5FRMA 1T7PA 5FPEA 4CZFA 1O13A 1OVYA 3HXMA 3SCXA 4BR4A 3NAEA 1JLQA 3OHRA 3K5NA 4MLHA 3PLAA 2VGNA 3WEEA 4YOYA 3AVGA 2Q0UA 3E9PA 1XNQK 1C1AA 4H5TA 4EZ9A 1NGIA 3QB0A 4JK8A 1HKBA 4CD1A 5J2PA 2J4RA 3CJ7A 3ZT2A 3CERA 1GLDG 1DTQA 4FWRA 3V6DA 3BZKA 3KWIA 4B3OA 1ASVA 4E7IA 5BN9A 4H4MA 5KPZA 4LF9K 3MX2A 2YKNA 2GWJA 3O4WA 1TAUA 4FLUA 3HPHA 4IXCA 4OPKA 3C0BA 2E2QA 3D2FB 1ATRA 3DRPA 4B9UA 3V9XA 4E0DA 5BRFA 3FFIA 2RKIA 4CF0A 4FWNA 2ZJPL 1T05A 2ZJRL 5D3GA 4FL9A 2OA8A 2P9IB 5AQGA 1HX1A 3VQEA 4CJEA 3P31A 1TKZA 2QKKA 1S9EA 3VEWA 1Q7YO 2PYLA 2P9KB 4ISEA 5JVGL 3Q7CA 4FLXA 1CZAN 1CLQA 2PZSA 3AVBA 1JXEA 4IG3A 4Z4HA 1D9DA 3VPZA 1YTAA 3ZSWA 2YKMA 3CPEA 4B1XB 2F8TA 4BC5A 5DK5A 4EZ6A 3C6AA 3K58A 4Y1CA 1RT2A 1TYQB 3ID6A 4CZHA 1T03A 3NGYA 3ZSYA 2V7ZA 4Q5VA 1ZC6A 1ATNA 4YOUA 2ITGA 3OYFA 1NGJA 3TARA 4UQGA 2UXCK 1VSIA 4CGIA 3CCUN 2RPIA 4M3RA 1N32K 2P9PB 1BCMA 4QS7A 4PUOA 1HQEA 1IG8A 3THYA 3P39A 3ZSZA 4OJRA 3EE8A 4DSIA 4FWPA 5AQKA 1VHXA 5J2NA 4IG0A 5LJVA 3DI6A 3ULDA 3VQ4A 1VSHA 5BN8A 1S6QA 5I9EB 1T3VA 3HJFA 3ZT0A 4YHHK 1QSLA 3SBTA 1S1XA 1RDDA 2P9SB 5KPRA 4JI5K 3MDQA 1S22A 4F3TA 3SLCA 1VQPN 3VQCA 4DTRA 4YDUA 1VSDA 4WQ5A 1XC3A 1JLEA 4DV5K 4NB4A 3J7AP 3FZKA 4JKBA 4BR0A 5B8HA 2GV9A 3VF6A 1BUPA 2BE2A 5C10A 4R5PA 1JCGA 2PAVA 3PIPL 4ILJA 2ZM6K 4B9LA 4LF6K 5M1KA 1NMNA 4K41A 3QESA 1TL3A 4BE0A 2RE2A 4OGEA 3IG1A 3WXMB 2F9WA 1VSFA 4YY3K 1W7AA 3SAHA 4JRQA 1J9AA 3R1XA 2QW9A 4FOEA 3ENHA 4A57A 3OS2A 4CF1A 1ZBFA 1T8EA 1WOQA 3N4PA 2HHWA 1NJWA 4O5FA 2YI1A 2X78A 4KHNA 2BUPA 4CE9A 1Q8IA 2E2PA 1XMOK 3IS9A 4BWJA 3C6HA 3VQ8A 1VQ5N 3AVLA 1X9WA 2DFEA 4DHYA 1BU6O 2HBKA 4OPJA 1B9FA 3I0SA 4CK3A 3LM2A 3DAWA 3QBXA 1ILYA 3AO5A 5CY4A 1WBDA 3UIQA 3BEXA 2NZTA 3O1BA 4MO5A 5FROA 1U47A 3LP3A 1GLFO 4K8ZA 4BDYA 2FBTA 2GUPA 3C6TA 3LP2A 3AVFA 1ZBSA 3WEEB 2FBXA 1X9MA 1BI4A 1NG9A 1WSGA 4KHPK 4CI6A 2HVIA 4QS8A 2KTQA 2NRRA 4B9QA 3OYIA 4KI6A 5FPDA 4IZ9A 1NK6A 4Q0BA 3GE1A 5DMRA 3OYGA 3CPWM 3PV8A 3A5MC 1IKVA 1U2VA 1WSFA 1V4TA 5AQUA 2O8FA 3TSUA 3G4SN 4CHOA 3KLEA 4B08A 3PO5A 3JS6A 1NGDA 3L6QA 4IOCL 3NVKA 3VN5A 3H1VX 4DTSA 2GWKA 4CHNA 4LC9B 2IVNA 1KAXA 3UE5A 4CEAA 4B9SA 5HRSA 1B92A 4WE1A 1Z25A 2A3ZA 5SWMA 2VWJA 5BR8K 3OYAA 3H3OB 3M3ZA 4OO1J 4AILC 1L3VA 2XY6A 4FJXA 2NRXA 1FKOA 3KJVA 3CC4N 1OKJA 2QEXN 5LL6Z 3VEVA 4FWSA 2E8AA 3DLLL 1KCFA 4RWTA 3AVIA 2FF6A 4JD2A 1XUPO 3SPZA 1NK7A 3ZSVA 4E1MA 4NXNK 3L4IA 3TABA 3IDHA 1LV5A 4IO9L 3THXA 3O1WA 2F96A 4KHSA 2QWMA 1NK5A 4K43A 2V51B 3CCEN 4DQQA 2WFBA 1C0FA 3B6OA 3EYZA 4CERA 2ZJQL 1FJGK 4CD3A 3AO3A 3OW2M 3IRXA 3M6GA 4E1JA 4JI4K 4C8OA 4FZXC 1G99A 1BA0A 4FWMA 1DKGD 3DOLA 2XY5A 4FJNA 4B9TA 4H5WA 3I33A 3MWTA 1NGBA 1LOTB 1MU2A 4PHTX 3LL3A 1IKXA 4DWIA 3QICA 3OYNA 3KVGA 4YOVA 4JAXA 3UB5A 4CJ5A 5FPNA 2YJEA 4ZHRA 1RDBA 5HRNA 3DM2A 2Q2RA 2NRZA 5M1OA 3OJUA 1X9SA 1NM1A 4JRPA 3ISNC 1RT3A 2WBNA 1W9HA 1WBBA 4GKJK 4KH4A 5I42A 2GX9A 5IWAK 2XRIA 4YORA 3L2UA 4A61A 1J5EK 3T69A 4A2AA 4JNEA 4CJVA 3NH2A 3RR7A 2Z1GA 2FSKA 3MEGA 2ZGYA 1SKWA 3KD1E 3KHYA 1KFDA 4BGBA 1NGAA 1RDAA 4GVMA 1RBTA 1WLJA 2O4IA 4NCAA 4YDUC 3CM6A 4WFAL 4OX9K 2BTFA 2OTJN 5AQTA 4WQ5C 3PX4A 4CFBA 1JL2A 4E19A 3I0RA 4K0KK 3H08A 3AAPA 1BIZA 3VMFB 3G6EN 4DKWA 3PY8A 3PSIA 4CEDA 4CZMA 3NF8A 3HTVA 4F9OA 1J54A 4X65K 3T1YK 1KAYA 3SAFA 4RW6A 4FVMA 3D6RA 3ZX2A 4XIUA 4KFBA 2YHXA 4DV0K 2D1KA 4GVEA 5EU7A 1GLLO 3NVMA 3SV4A 2O8BA 4CECA 1MA9B 3TPQA 2YHWA 1WSEA 3K57A 4IOAL 4PL7A 1SQKA 4CW7B 4BDZA 2RF2A 3B6PA 2E20A 4KH5A 5AQIA 1SV5A 1L3UA 4DU4A 3ITHA 4KBOA 4IEEA 3D0PA 4PKHA 2E2OA 3P83D 3OYDA 2XY7A 3SMPA 4PY5A 3ID8A 3D45A 3RR8A 2B4JA 4BVPA 3GL1A 1HLUA 5AQWA 3TAFA 3MN5A 4CJ4A 1RT6A 1XQSC 1GOBA 4O0JA 2VG7A 5KQ8A 5HLFA 1WSHA 4JI0K 3WXJA 3VGKA 5CE3A 1SUQA 5CYMA 3QNOA 2Y1JA 3MWPA 4DR7K 4LSLA 3AO2A 3P4IA 4JK9A 1QQNA 3MECA 2WTUA 4RW8A 3NCIA 2VQEK 4FXDA 1NOZA 1BI4B 4DSKA 3FZHA 4HTUA 4BRQA 4H0OA 2UUAK 1DT9A 3O08A 3O9UA 4DFPA 3TTDA 1IG9A 1ESVA 2P51A 2AP1A 3PIOL 2F4VK 1C6VA 4V19S 3MEEA 1K6YA 3L4QA 4AHUA 2G8IA 1YTUA 1S1TA 4A62A 2KFZA 1KLMA 3A2FA 2F9TA 1TUUA 3VENA 2RHKA 5M1QA 3VQBA 3O4QA 2HVHA 5AQRA 3M5RA 4F8RA 2KZMA 1Q86O 3WXKA 1ASWA 3T7ZA 3A0IX 3MK6A 1RNHA 3SJJA 3KD5E 3NMUA 1RCHA 3KLHA 4HUGA 2DTUA 2R7YA 4JHDA 4DMNA 1NK8A 1QVFM 1QE1A 4DFJA 1CZ9A 3SQ1A 4DS5A 3T1AA 4OVLA 1WN7A 2A1SA 1BQNA 2JGUA 4CEEA 1VQ9N 3O9TA 3WQTA 1BCOA 5SZTA 2IC3A 4CHQA 1TKTA 4I9LA 3FZFA 4L8RB 1TKDA 1BIUA 2P9LA 3EEQA 3K59A 1EWQA 3BP8A 3DOKA 2HOEA 3DXKA 1P90A 4H5VA 1ZBHA 4DQIA 4UY8O 1ATSA 1K9MO 4FJHA 1K8KB 2YV0X 3DLKA 3THXB 2I7PA 1HR0K 4DSJA 5ADXA 3CJBA 4RG8A 1FXXA 1XHXA 1Q82O 1J53A 2ZGZA 2CGKA 4EP4A 1LWCA 2HSTA 3MX5A 3QETA 5GAGP 5DM7L 4XEIA 3ULEA 4BRPA 4GV9A 4DS4A 1HNZK 1R59O 3R8EA 3QO9A 3HO1A 1RTJA 1N36K 4M3XA 3E9OA 3LDPA 5AQJA 4DV2K 3IMXA 4AF1A 4BRLA 4W5RA 3OYLA 4DTXA 2Z1JA 2BDPA 3QNNA 3CJAA 4ZTJA 3OYCA 2OYQA 2A1RA 3GOIA 3FE1A 3FR0A 3IKMA 3WNEA 2YNFA 3CXCM 3VGMA 4I9QA 3VF2A 2EHGA 3V9WA 5KI6A 2JWLA 4B1VA 1TK0A 5E84A 4BVOA 2FBVA 1RBVA 1VRTA 4JEPA 3WQUA 1FW6A 5CZ2A 4DFKA 2QWQA 3LP0A 1S5JA 1HJOA 3P1GA 4FJKA 3LALA 1T44A 2X6NA 4C1NI 1NGCA 4E89A 4B3MK 3L2WA 2QA4N 4FJGA 3UKRA 4WFBL 1Y97A 1VSLA 4CIGA 2H3GX 3MAQA 3O8MA 4DQSA 3CCJN 3IAYA 5KRTA 2KKZA 1RFQA 2W41A 4M7YA 4CJTA 4YOXA 2QI2A 2FF3B 5AZIA 4A2BA 2IAJA 4F2SA 4AHCA 5FDLA 3Q7BA 5AQXA 1S9GA 3KK7A 1TGOA 4FOIA 4FJ7A 1TL1A 2NRHA 3DMJA 3L3VA 4IJNA 5C25A 1BISA 2UYTA 4CZJA 3J8AA 5TKYA 1C1BA 2Q97A 2FC0A 3C65A 1NJIO 2UUCK 2O8BB 1SL1A 1F21A 4CZKA 1Q9XA 4M3ZA 5KQDA 1LAVA 1C0TA 3SBGA 3PSFA 1GLEG 4ID5A 4C23A 4KTWA 3W3DA 3VQ5A 2YCHA 4Z4CA 1EO1A 3G25A 4WQ4A 1N8RO 1WNSA 1KTQA 4KHUA 1NJYA 3U6FA 5M1FA 2XHBA 2QXFA 4ID1A 3DLEA 4FYDA 1KQSM 2D0BA 3O80A 3LDLA 1HPMA 3J7YP 1RGIA 4E7LA 1X3MA 4DQRA 3C7NA 1UA0A 4DB3A 4W5TA 4ZTFA 1KVBA 4CFDA 3SUQA 2PY5A 4J2AA 4DV1K 5KRSA 3IUCA 4CEOA 4IO8A 3AVMA 4FLYA 4DSEA 2IOCA 3D7EO 2DFHA 1U04A 4JN4A 4Y0WA 4LH5A 3O5BA 2IS3A 3QLHA 2LSNA 1CZBA 4U67L 1JLBA 2A6AA 2OZMA 5GIOA 4H8KA 3AA2A 4DSFA 2DFFA 4E1NA 3O3GA 4MO4A 1BG3A 5CYQA 3TAMA 2E1YA 2GUIA 1KSPA 4RW7A 2BH1A 5AQPA 4H4OA 3HM8A 3AAQA 3HPOA 3QFUA 5EY4A 5BRHA 4JKDA 3HM9A 1WSJA 5E41A 4Z4GA 2E6LA 4YFUA 1FK9A 2HW3A 4EAHD 4IDKA 4JHDB 3VQQA 1VQ4N 4IWVA 3PO4A 3VA0A 4GV6A 5A2QO 4J2BA 1VSEA 4MQ3A 1TVRA 1LW2A 3CJ1A 4DTJA 1QTMA 4E7JA 3QFPA 2PBDA 3AO1A 1TK5A 1IBLK 2P9LB 3M1FA 1EETA 2W6KA 3H6EA 3VQ6A 4DU3A 4KTQA 3QDKA 1HKGA 5JVHL 2YNGA 4C8KA 5KTQA 3DXKB 4ELUA 1J6ZA 5E26A 5GADP 4KRFA 5EOYA 1HNVA 1U48A 1KXPA 3M8SA 2FSJA 5JMVA 4IKFA 4B1UB 4QAGA 4CZEA 3BGRA 2QK9A 3HPGA 4C8NA 2QM1A 2HHSA 3MCAB 4J2DA 1Q9YA 5T7BA 4B1ZA 2XY8A 3ULEB 5AQVA 4NCGA 2HHQA 4B9NA 2W40A 3FLCO 4XH5A 1X9JA 2Q1NA 5EXWA 4DUZK 4WF9L 4PL8A 4KB1A 4KPYA 3DLRA 3VGLA 4FJMA 1WUAA 3ZT1A 1XWLA 5JLFA 5JLHA 1UOCA 4CVNE 4CFCA 2IDOA 3QEIA 3QINA 3SAGA 4FLVA 3LAKA 4GW6A 1HUXA 1JLCA 3WXIA 3SUNA 3K9JA 3JYTA 3RWUA 3O9RA 5GAEP 4IDHA 1D8YA 1S1UA 2ZWHA 3QEPA 2QTDA 3DXMA 4LF7K 4BC4A 1EP4A 3UKRB 1C0MA 4FO0A 1KD1O 1EQYA 3VF4A 3ZYYX 2D4WA 4FSVA 3DRRA 4I6MA 1GLCG 3TSPA 3K2PA 4BRIA 2Q3SA 3G71N 3TU5A 4FW1A 4B3RK
chains in the Genus database with same CATH topology
3SCXA 3HXMA 3NAEA 3D0PA 3G0ZA 1JLQA 3P83D 3NH1A 3K5NA 3OYDA 2XY7A 4FK2A 5I3UA 2Z1HA 1U45A 4PY5A 1RT1A 2Y1IA 3K5OA 5FRNA 3AVGA 3D45A 3AA3A 1VRUA 2JLEA 3DRSA 1NOYA 3RR8A 4N47A 3HVTA 3AV9A 2B4JA 4K8XA 1C1AA 2X6SA 3HVRA 4EZ9A 4M3WA 4DQPA 3NF6A 1NKEA 5K14A 3KKSA 3ALYA 3HYFA 5J2PA 5J2QA 3ZT2A 4W5OA 4OGCA 2HNDA 3TAFA 3MXMA 4CJ4A 1RT6A 1GOBA 1DTQA 3C95A 2VG7A 4O0JA 3ZSOA 1RDCA 3RTVA 4DF8A 3V6DA 5HLFA 1WSHA 4B3OA 1Z26A 3TANA 1HYSA 4CFAA 1ZBUA 1ASVA 3NHGA 2ZE2A 4E7IA 4DTUA 4H4MA 3KLFA 1SUQA 3ZSRA 5CYMA 3QNOA 2Y1JA 3P5JA 4LSLA 3LZJA 1LAWA 3AO2A 3VQPA 1BHLA 3MECA 2YKNA 4RW8A 1TAUA 3NCIA 4DLGA 3HPHA 4FLUA 4OPKA 1N5YA 2VG5A 1SKRA 1NOZA 4FXDA 1BI4B 2IGIA 4DSKA 4Z4IA 1QSSA 1VK0A 4NYNA 4HTUA 1LW0A 4KHYA 3DRPA 4B9UA 3DLGA 3V9XA 4DFPA 4HCBA 4E0DA 3FFIA 4CJSA 1CXUA 1GOAA 2RKIA 3HL8A 4CF0A 1IG9A 3NH0A 2P51A 1T05A 1WAJA 5J1EA 3NDKA 1KVAA 4BE2A 5D3GA 3AVAA 3WNHA 1C6VA 2OA8A 3MEEA 1I3AA 1SL2A 1K6YA 4AHUA 4DTOA 3VQEA 3OYMA 4CJEA 3V9SA 1YTUA 2G8IA 1S1TA 1TKZA 2KFZA 3TAPA 1G15A 2QKKA 4N76A 1S9EA 3V81A 4O44A 1KLMA 1S1VA 3A2FA 4EP5A 2PYLA 1ZBIA 3AVNA 1U4BA 4KKOA 2OPRA 4DSLA 4J2EA 3VQBA 3ZT4A 3O4QA 4FLXA 2HVHA 3SUOA 3KLIA 4PQUA 5CZ1A 4F8RA 3U3GA 2KZMA 2PZSA 1CLQA 1ASWA 3AVBA 1JXEA 3TWHA 4IG3A 4Z4HA 4W5QA 1RNHA 4E7HA 3SJJA 2YNHA 4ICLA 1YTAA 4AHVA 3ZSWA 2YKMA 2KW4A 1RCHA 4OKKA 5HP1A 1NJXA 2I5JA 3KLHA 4HUGA 2DTUA 2R7YA 1NK8A 4DMNA 2F8TA 1VSMA 1QE1A 2ZD1A 4DFJA 1CZ9A 3SQ1A 4KREA 4DU4A 4CCHA 3HP6A 5DK5A 4EZ6A 4CJ3A 4NYFA 3T1AA 4DS5A 4OVLA 4CEQA 1WN7A 2A1SA 1BQNA 2JGUA 1RBUA 2YNIA 4CEEA 3K58A 4Y1CA 1RT2A 1BCOA 4M45A 3SQ2A 1HPZA 5SZTA 2IC3A 2KQ2A 4CHQA 1TKTA 5HRPA 1UWBA 1T03A 4I9LA 3QEWA 4L8RB 1TKDA 1BIUA 3NGYA 3ZSYA 3K59A 4Q5VA 1GOCA 3O3FA 4B9VA 4Z4EA 2G8WA 2ITGA 3DOKA 1I39A 1BQMA 1HNIA 1QSYA 4FM1A 3OYFA 3LWMA 1RBRA 1DLOA 1HRHA 3TARA 4UQGA 2F8SA 1VSIA 1S6PA 4CGIA 2XO7A 1ZBHA 4DQIA 4RW4A 3OY9A 3E01A 2RPIA 3F9KA 4M3RA 3DLBA 4FJHA 1BCMA 4CF9A 4PUOA 1HQEA 2OPSA 2YV0X 1RT4A 1D5AA 3DLKA 1NK0A 4DSJA 3WNGA 3DYAA 3LZIA 4Y1DA 4RG8A 3ZSZA 1XHZA 4OJRA 1FXXA 4DSIA 1JXBA 1XHXA 1J53A 4KO0A 4CJUA 3TAEA 2G8KA 4EP4A 1VSJA 3OYKA 5J2NA 1LWCA 3QETA 2HMIA 2KFNA 4CJPA 1WAFA 4IG0A 1KVCA 3DI6A 3ULDA 3RMBA 1J5OA 3L2QA 3OS0A 1JL1A 4DS4A 3LDSA 3VQ4A 4FJJA 1VSHA 3QO9A 1RTJA 1S6QA 4AH9A 4M3XA 3HO1A 3HT3A 1ZBLA 3HJFA 3ZT0A 2E4LA 4W5RA 3OYLA 1QSLA 4JLHA 1IH7A 1S1XA 4DTXA 2ATQA 1RDDA 2Z1JA 3CFPA 2BDPA 3QNNA 1L3TA 4ZTJA 3AVJA 1EX4A 3OYCA 4DU1A 2OYQA 4F3TA 2A1RA 3SNNA 3S3MA 4IFYA 3VQCA 4DTRA 3WNEA 1LWFA 1U49A 2YNFA 4OKJA 4I9QA 2X74A 3VQ7A 2EHGA 1R0AA 1VSDA 4FW2A 2E6MA 2NUBA 5KI6A 3V9WA 3CYMA 1JLEA 3K5MA 4I7FA 4FZYA 2AJQA 3EY1A 3SYZA 3DLHA 1C1CA 4FM0A 1NK4A 1TK0A 2P1JA 4M3UA 2FBVA 2GV9A 1RBVA 1VRTA 2BE2A 4R5PA 4BACA 4DTMA 3TI0A 4KHWA 5CZ2A 4E3SA 4DFKA 4B9LA 3LP0A 1S5JA 4CJKA 3P1GA 3QESA 1TL3A 4DG1A 4FJKA 1TKXA 3LALA 4OGEA 3V1QA 4BE0A 3IG1A 2VWKA 2X6NA 4E89A 4CGJA 3RMAA 1VSFA 3VQDA 3L2WA 4FJGA 4JRQA 3VQ9A 4CEFA 1J9AA 5KGWA 1Y97A 4O4GA 1VSLA 4CIGA 1A5XA 4FJ5A 1NKBA 3MAQA 1BL3A 3OS2A 3F73A 2WONA 4CF1A 1ZBFA 4DQSA 1T8EA 3IAYA 5KRTA 1ITGA 3C94A 1BGXT 2HHWA 1NJWA 4CJTA 2O4GA 2X78A 4Z4FA 4KHNA 2OPPA 3MXIA 3BDPA 3SUPA 2B6AA 4E7KA 1VSKA 2IAJA 1JLGA 4CE9A 1Q8IA 3M8PA 4CK2A 3TAGA 3PX6A 4F2SA 3IS9A 1A5WA 4AHCA 5FDLA 1SKSA 4IFVA 4CHYA 4BWJA 5J2MA 1S9GA 1TGOA 3VQ8A 3AVLA 3MXJA 1X9WA 2DFEA 1TL1A 4CGFA 4HVJA 4FJ7A 4M41A 4OPJA 3CQ8A 1B9FA 3DMJA 2G8UA 3L3VA 3ASMA 3V4IA 5C25A 3I0SA 2G8VA 4ELTA 1BISA 1C1BA 2FC0A 4KV8A 4CK3A 1SL1A 3M8RA 1F21A 3AA4A 4M3TA 1Q9XA 4M3ZA 3OVNA 1JLAA 3AO5A 5CY4A 2HHXA 4CK1A 1HQUA 3LWLA 3UIQA 3NF9A 4FK4A 1LAVA 2W42A 2OPQA 1C0TA 1N6QA 3S3NA 5FROA 1U47A 3LP3A 3ZT3A 3EZ5A 4KAZA 5HROA 4KB0A 4LY7A 4ID5A 4BDYA 1TK8A 4K8ZA 2FBTA 4KTWA 1ZYQA 3OYEA 4KI4A 3VQ5A 4M42A 3C6TA 4Z4CA 3LP2A 3AVFA 4CGDA 3LANA 1TAQA 2FBXA 3QIOA 1X9MA 1BI4A 1WNSA 1KTQA 1O1WA 3AO4A 1WSGA 2RN2A 3C6UA 1NJYA 4KHUA 3U6FA 4CJWA 2HVIA 2KTQA 2XHBA 2QXFA 3OYIA 3U3YA 3L8BA 4ID1A 4N41A 3DLEA 4DTNA 2HHUA 4KI6A 2BANA 4FYDA 3V9ZA 2D0BA 3S9HA 1IKYA 1NK6A 4C8MA 1UAXA 3KKRA 4Q0BA 3M8QA 4E7LA 4CF2A 2Z1IA 5DMRA 3NGZA 3NBPA 4DQRA 3QERA 1UA0A 3LAMA 3OYGA 3TAQA 4W5TA 3PV8A 4ZTFA 1KVBA 4CFDA 4HUFA 3SUQA 1IKVA 2PY5A 4J2AA 1WSFA 5KRSA 3S3OA 3NGIA 4HUEA 4FJ8A 4CEOA 2HHTA 4CHOA 3KLEA 4B08A 3KTQA 4DLEA 1HYVA 1HJRA 3PO5A 3AVMA 1A5VA 4C8LA 4FLYA 4DSEA 3RRGA 4BWMA 2IOCA 3VN5A 4DTSA 2ETJA 1KRPA 4TSXA 1SL0A 2DFHA 2YHAA 1RT5A 2FBYA 1U04A 4CHNA 1KFSA 4CEAA 4B9SA 5HRSA 4LH5A 4BE1A 4F2RA 1B92A 3NFAA 2IS3A 2HB5A 4WE1A 3QLHA 1Z25A 5HRRA 5HBMA 2KZZA 2LSNA 5SWMA 1CZBA 2VWJA 3AVKA 2HNZA 1JLBA 4BDPA 3OYAA 4FCYA 3RMCA 4AILC 2OZMA 2D5RA 1UA1A 4H8KA 3AA2A 4DSFA 1L3VA 2DFFA 4E1NA 2XY6A 4FJXA 3O3GA 4JS5A 1FKOA 1S1WA 3PX0A 5CYQA 3AVCA 1YVUA 3TAMA 5C42A 3KJVA 2GUIA 4NCBA 1KSPA 4CEZA 4RW7A 4FJIA 3NE6A 4N56A 1KCFA 4HCCA 4YNQA 4KHQA 4H4OA 3AVIA 4FLZA 3SZ2A 3JSMA 3HSTB 4LD0A 1RBSA 1REVA 4IBNA 3HPOA 3SPZA 1NK7A 2VG6A 3ZSVA 4E1MA 3HM9A 4CGHA 1WSJA 5E41A 3TABA 4Z4GA 2E6LA 1YT3A 1W0HA 2GBZA 4YFUA 3OYJA 3VA3A 4OLBA 1FK9A 4AHTA 1L3SA 2HW3A 1TV6A 1RILA 1LV5A 4IDKA 4KHSA 2F96A 3CFRA 1NK5A 1WSIA 3VQQA 4B8AB 2OZSA 4G1QA 4CJLA 3HP9A 4DQQA 3B6OA 3EYZA 4DFMA 4PWDA 4CERA 3PO4A 3VA0A 1L5UA 3KK2A 4J2BA 4CHZA 1VSEA 4FM2A 3T3FA 4MQ3A 3AO3A 1TVRA 2EX3A 1LW2A 3IRXA 4C8OA 4F3OA 4DTJA 4CHPA 1QTMA 2D0CA 4FZXC 1B9DA 3DOLA 4E7JA 2XY5A 4FJNA 4B9TA 3SI6A 1KLNA 4FK0A 3AO1A 1TK5A 3OYBA 2P5GA 3KD5E 1EETA 3VQ6A 4DU3A 3RMDA 3HK2A 4KTQA 1MU2A 1RTIA 3I8DA 3CM5A 2YNGA 4HHTA 4C8KA 5KTQA 4F4KA 4FZZA 1IKXA 3LPTA 4DWIA 4ELUA 4KRFA 3OYNA 4M3YA 1HNVA 3G10A 4GMJB 4O5BA 3CFOA 1U48A 4CJ5A 1D9FA 3KK1A 4ZHRA 3M8SA 1RDBA 1QS4A 4PA1A 4O55A 5HRNA 1LWEA 3DM2A 4IKFA 1QHTA 4QAGA 3OJUA 1X9SA 2WOMA 3BGRA 4I2QA 3QEXA 3HPGA 4C8NA 2PYJA 2QK9A 2P5OA 4JRPA 3MEDA 3ISNC 1RT3A 4FLWA 2HNYA 1W9HA 2YHBA 1RTDA 4CESA 2HHSA 3VQAA 5I42A 4LSNA 1XC9A 4OLAA 2XRIA 4B8CA 4CEBA 3L2UA 4I2PA 3L3UA 4RW9A 4J2DA 1Q9YA 5T7BA 3L2RA 3RRHA 2XY8A 4FLTA 4NCGA 4KTZA 4DTPA 3SQ4A 4CJVA 3NH2A 1HMVA 1NKCA 3RR7A 1DTTA 2Z1GA 4B9NA 2HHQA 3QIPA 3OS1A 3MEGA 1SKWA 3KD1E 1KFDA 3ZSQA 3OYHA 5JS2A 3KK3A 2BGGA 1RDAA 4GVMA 4JS4A 1EXQA 1RBTA 2QKBA 1WLJA 4FJLA 4LH4A 4ELVA 2O4IA 4NCAA 1HYZA 3CM6A 3LPUA 4OKEA 3AA5X 4FJ9A 1RTHA 2D0AA 4N5SA 3O3HA 3PX4A 3SPYA 4KB1A 4MFBA 4CFBA 1NK9A 4KPYA 3DLRA 3V1RA 4QCLA 3WNFA 4FJMA 4CGGA 3PUFA 3KLGA 3OJSA 1JL2A 5C24A 3TR8A 3ZT1A 1XWLA 3I0RA 3T19A 3H08A 1UOCA 4E19A 4CFCA 2IDOA 4AHSA 3QEIA 3QINA 4FLVA 1BIZA 4Z0UA 3LAKA 1JKHA 4GW6A 3KIOA 3PY8A 1NJZA 3SUNA 1JLCA 4CEDA 2G8FA 3JYTA 2ZQBA 3NF8A 1C0UA 3ZCMA 1J54A 2DY4A 1IKWA 3V1OA 3O4NA 4CIEA 3RWUA 3ZSXA 1X1PA 4RW6A 1FKPA 4FVMA 1JLFA 4XIUA 1D8YA 1S1UA 4B9MA 4KFBA 4CJRA 4AHRA 3SQ0A 1RT7A 3QEPA 4CJQA 5KGXA 1QQCA 5JS1A 4QOZB 5EU7A 4CIFA 4W5NA 2B5JA 3CG7A 3NF7A 3SV4A 3V9UA 1CXQA 1IO2A 1EP4A 1C0MA 4CECA 1ASUA 1EKEA 1WSEA 3K57A 2HHVA 4O0IA 4CJFA 4CF8A 3DRRA 3L2VA 3K5LA 4BDZA 3AVHA 2RF2A 3B6PA 4DF4A 3QEVA 3SV3A 2G8HA 3LP1A 1D9DA 3K2PA 5FRMA 2Q3SA 1T7PA 1XI1A 1SV5A 3THVA 1L3UA 4FW1A 3ITHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SCX A;  3HXM A;  3NAE A;  3D0P A;  3G0Z A;  1JLQ A;  3P83 D;  3NH1 A;  3K5N A;  3OYD A;  2XY7 A;  4FK2 A;  5I3U A;  2Z1H A;  1U45 A;  4PY5 A;  1RT1 A;  2Y1I A;  3K5O A;  5FRN A;  3AVG A;  3D45 A;  3AA3 A;  1VRU A;  2JLE A;  3DRS A;  1NOY A;  3RR8 A;  4N47 A;  3HVT A;  3AV9 A;  2B4J A;  4K8X A;  1C1A A;  2X6S A;  3HVR A;  4EZ9 A;  4M3W A;  4DQP A;  3NF6 A;  1NKE A;  5K14 A;  3KKS A;  3ALY A;  3HYF A;  5J2P A;  5J2Q A;  3ZT2 A;  4W5O A;  4OGC A;  2HND A;  3TAF A;  3MXM A;  4CJ4 A;  1RT6 A;  1GOB A;  1DTQ A;  3C95 A;  2VG7 A;  4O0J A;  3ZSO A;  1RDC A;  3RTV A;  4DF8 A;  3V6D A;  5HLF A;  1WSH A;  4B3O A;  1Z26 A;  3TAN A;  1HYS A;  4CFA A;  1ZBU A;  1ASV A;  3NHG A;  2ZE2 A;  4E7I A;  4DTU A;  4H4M A;  3KLF A;  1SUQ A;  3ZSR A;  5CYM A;  3QNO A;  2Y1J A;  3P5J A;  4LSL A;  3LZJ A;  1LAW A;  3AO2 A;  3VQP A;  1BHL A;  3MEC A;  2YKN A;  4RW8 A;  1TAU A;  3NCI A;  4DLG A;  3HPH A;  4FLU A;  4OPK A;  1N5Y A;  2VG5 A;  1SKR A;  1NOZ A;  4FXD A;  1BI4 B;  2IGI A;  4DSK A;  4Z4I A;  1QSS A;  1VK0 A;  4NYN A;  4HTU A;  1LW0 A;  4KHY A;  3DRP A;  4B9U A;  3DLG A;  3V9X A;  4DFP A;  4HCB A;  4E0D A;  3FFI A;  4CJS A;  1CXU A;  1GOA A;  2RKI A;  3HL8 A;  4CF0 A;  1IG9 A;  3NH0 A;  2P51 A;  1T05 A;  1WAJ A;  5J1E A;  3NDK A;  1KVA A;  4BE2 A;  5D3G A;  3AVA A;  3WNH A;  1C6V A;  2OA8 A;  3MEE A;  1I3A A;  1SL2 A;  1K6Y A;  4AHU A;  4DTO A;  3VQE A;  3OYM A;  4CJE A;  3V9S A;  1YTU A;  2G8I A;  1S1T A;  1TKZ A;  2KFZ A;  3TAP A;  1G15 A;  2QKK A;  4N76 A;  1S9E A;  3V81 A;  4O44 A;  1KLM A;  1S1V A;  3A2F A;  4EP5 A;  2PYL A;  1ZBI A;  3AVN A;  1U4B A;  4KKO A;  2OPR A;  4DSL A;  4J2E A;  3VQB A;  3ZT4 A;  3O4Q A;  4FLX A;  2HVH A;  3SUO A;  3KLI A;  4PQU A;  5CZ1 A;  4F8R A;  3U3G A;  2KZM A;  2PZS A;  1CLQ A;  1ASW A;  3AVB A;  1JXE A;  3TWH A;  4IG3 A;  4Z4H A;  4W5Q A;  1RNH A;  4E7H A;  3SJJ A;  2YNH A;  4ICL A;  1YTA A;  4AHV A;  3ZSW A;  2YKM A;  2KW4 A;  1RCH A;  4OKK A;  5HP1 A;  1NJX A;  2I5J A;  3KLH A;  4HUG A;  2DTU A;  2R7Y A;  1NK8 A;  4DMN A;  2F8T A;  1VSM A;  1QE1 A;  2ZD1 A;  4DFJ A;  1CZ9 A;  3SQ1 A;  4KRE A;  4DU4 A;  4CCH A;  3HP6 A;  5DK5 A;  4EZ6 A;  4CJ3 A;  4NYF A;  3T1A A;  4DS5 A;  4OVL A;  4CEQ A;  1WN7 A;  2A1S A;  1BQN A;  2JGU A;  1RBU A;  2YNI A;  4CEE A;  3K58 A;  4Y1C A;  1RT2 A;  1BCO A;  4M45 A;  3SQ2 A;  1HPZ A;  5SZT A;  2IC3 A;  2KQ2 A;  4CHQ A;  1TKT A;  5HRP A;  1UWB A;  1T03 A;  4I9L A;  3QEW A;  4L8R B;  1TKD A;  1BIU A;  3NGY A;  3ZSY A;  3K59 A;  4Q5V A;  1GOC A;  3O3F A;  4B9V A;  4Z4E A;  2G8W A;  2ITG A;  3DOK A;  1I39 A;  1BQM A;  1HNI A;  1QSY A;  4FM1 A;  3OYF A;  3LWM A;  1RBR A;  1DLO A;  1HRH A;  3TAR A;  4UQG A;  2F8S A;  1VSI A;  1S6P A;  4CGI A;  2XO7 A;  1ZBH A;  4DQI A;  4RW4 A;  3OY9 A;  3E01 A;  2RPI A;  3F9K A;  4M3R A;  3DLB A;  4FJH A;  1BCM A;  4CF9 A;  4PUO A;  1HQE A;  2OPS A;  2YV0 X;  1RT4 A;  1D5A A;  3DLK A;  1NK0 A;  4DSJ A;  3WNG A;  3DYA A;  3LZI A;  4Y1D A;  4RG8 A;  3ZSZ A;  1XHZ A;  4OJR A;  1FXX A;  4DSI A;  1JXB A;  1XHX A;  1J53 A;  4KO0 A;  4CJU A;  3TAE A;  2G8K A;  4EP4 A;  1VSJ A;  3OYK A;  5J2N A;  1LWC A;  3QET A;  2HMI A;  2KFN A;  4CJP A;  1WAF A;  4IG0 A;  1KVC A;  3DI6 A;  3ULD A;  3RMB A;  1J5O A;  3L2Q A;  3OS0 A;  1JL1 A;  4DS4 A;  3LDS A;  3VQ4 A;  4FJJ A;  1VSH A;  3QO9 A;  1RTJ A;  1S6Q A;  4AH9 A;  4M3X A;  3HO1 A;  3HT3 A;  1ZBL A;  3HJF A;  3ZT0 A;  2E4L A;  4W5R A;  3OYL A;  1QSL A;  4JLH A;  1IH7 A;  1S1X A;  4DTX A;  2ATQ A;  1RDD A;  2Z1J A;  3CFP A;  2BDP A;  3QNN A;  1L3T A;  4ZTJ A;  3AVJ A;  1EX4 A;  3OYC A;  4DU1 A;  2OYQ A;  4F3T A;  2A1R A;  3SNN A;  3S3M A;  4IFY A;  3VQC A;  4DTR A;  3WNE A;  1LWF A;  1U49 A;  2YNF A;  4OKJ A;  4I9Q A;  2X74 A;  3VQ7 A;  2EHG A;  1R0A A;  1VSD A;  4FW2 A;  2E6M A;  2NUB A;  5KI6 A;  3V9W A;  3CYM A;  1JLE A;  3K5M A;  4I7F A;  4FZY A;  2AJQ A;  3EY1 A;  3SYZ A;  3DLH A;  1C1C A;  4FM0 A;  1NK4 A;  1TK0 A;  2P1J A;  4M3U A;  2FBV A;  2GV9 A;  1RBV A;  1VRT A;  2BE2 A;  4R5P A;  4BAC A;  4DTM A;  3TI0 A;  4KHW A;  5CZ2 A;  4E3S A;  4DFK A;  4B9L A;  3LP0 A;  1S5J A;  4CJK A;  3P1G A;  3QES A;  1TL3 A;  4DG1 A;  4FJK A;  1TKX A;  3LAL A;  4OGE A;  3V1Q A;  4BE0 A;  3IG1 A;  2VWK A;  2X6N A;  4E89 A;  4CGJ A;  3RMA A;  1VSF A;  3VQD A;  3L2W A;  4FJG A;  4JRQ A;  3VQ9 A;  4CEF A;  1J9A A;  5KGW A;  1Y97 A;  4O4G A;  1VSL A;  4CIG A;  1A5X A;  4FJ5 A;  1NKB A;  3MAQ A;  1BL3 A;  3OS2 A;  3F73 A;  2WON A;  4CF1 A;  1ZBF A;  4DQS A;  1T8E A;  3IAY A;  5KRT A;  1ITG A;  3C94 A;  1BGX T;  2HHW A;  1NJW A;  4CJT A;  2O4G A;  2X78 A;  4Z4F A;  4KHN A;  2OPP A;  3MXI A;  3BDP A;  3SUP A;  2B6A A;  4E7K A;  1VSK A;  2IAJ A;  1JLG A;  4CE9 A;  1Q8I A;  3M8P A;  4CK2 A;  3TAG A;  3PX6 A;  4F2S A;  3IS9 A;  1A5W A;  4AHC A;  5FDL A;  1SKS A;  4IFV A;  4CHY A;  4BWJ A;  5J2M A;  1S9G A;  1TGO A;  3VQ8 A;  3AVL A;  3MXJ A;  1X9W A;  2DFE A;  1TL1 A;  4CGF A;  4HVJ A;  4FJ7 A;  4M41 A;  4OPJ A;  3CQ8 A;  1B9F A;  3DMJ A;  2G8U A;  3L3V A;  3ASM A;  3V4I A;  5C25 A;  3I0S A;  2G8V A;  4ELT A;  1BIS A;  1C1B A;  2FC0 A;  4KV8 A;  4CK3 A;  1SL1 A;  3M8R A;  1F21 A;  3AA4 A;  4M3T A;  1Q9X A;  4M3Z A;  3OVN A;  1JLA A;  3AO5 A;  5CY4 A;  2HHX A;  4CK1 A;  1HQU A;  3LWL A;  3UIQ A;  3NF9 A;  4FK4 A;  1LAV A;  2W42 A;  2OPQ A;  1C0T A;  1N6Q A;  3S3N A;  5FRO A;  1U47 A;  3LP3 A;  3ZT3 A;  3EZ5 A;  4KAZ A;  5HRO A;  4KB0 A;  4LY7 A;  4ID5 A;  4BDY A;  1TK8 A;  4K8Z A;  2FBT A;  4KTW A;  1ZYQ A;  3OYE A;  4KI4 A;  3VQ5 A;  4M42 A;  3C6T A;  4Z4C A;  3LP2 A;  3AVF A;  4CGD A;  3LAN A;  1TAQ A;  2FBX A;  3QIO A;  1X9M A;  1BI4 A;  1WNS A;  1KTQ A;  1O1W A;  3AO4 A;  1WSG A;  2RN2 A;  3C6U A;  1NJY A;  4KHU A;  3U6F A;  4CJW A;  2HVI A;  2KTQ A;  2XHB A;  2QXF A;  3OYI A;  3U3Y A;  3L8B A;  4ID1 A;  4N41 A;  3DLE A;  4DTN A;  2HHU A;  4KI6 A;  2BAN A;  4FYD A;  3V9Z A;  2D0B A;  3S9H A;  1IKY A;  1NK6 A;  4C8M A;  1UAX A;  3KKR A;  4Q0B A;  3M8Q A;  4E7L A;  4CF2 A;  2Z1I A;  5DMR A;  3NGZ A;  3NBP A;  4DQR A;  3QER A;  1UA0 A;  3LAM A;  3OYG A;  3TAQ A;  4W5T A;  3PV8 A;  4ZTF A;  1KVB A;  4CFD A;  4HUF A;  3SUQ A;  1IKV A;  2PY5 A;  4J2A A;  1WSF A;  5KRS A;  3S3O A;  3NGI A;  4HUE A;  4FJ8 A;  4CEO A;  2HHT A;  4CHO A;  3KLE A;  4B08 A;  3KTQ A;  4DLE A;  1HYV A;  1HJR A;  3PO5 A;  3AVM A;  1A5V A;  4C8L A;  4FLY A;  4DSE A;  3RRG A;  4BWM A;  2IOC A;  3VN5 A;  4DTS A;  2ETJ A;  1KRP A;  4TSX A;  1SL0 A;  2DFH A;  2YHA A;  1RT5 A;  2FBY A;  1U04 A;  4CHN A;  1KFS A;  4CEA A;  4B9S A;  5HRS A;  4LH5 A;  4BE1 A;  4F2R A;  1B92 A;  3NFA A;  2IS3 A;  2HB5 A;  4WE1 A;  3QLH A;  1Z25 A;  5HRR A;  5HBM A;  2KZZ A;  2LSN A;  5SWM A;  1CZB A;  2VWJ A;  3AVK A;  2HNZ A;  1JLB A;  4BDP A;  3OYA A;  4FCY A;  3RMC A;  4AIL C;  2OZM A;  2D5R A;  1UA1 A;  4H8K A;  3AA2 A;  4DSF A;  1L3V A;  2DFF A;  4E1N A;  2XY6 A;  4FJX A;  3O3G A;  4JS5 A;  1FKO A;  1S1W A;  3PX0 A;  5CYQ A;  3AVC A;  1YVU A;  3TAM A;  5C42 A;  3KJV A;  2GUI A;  4NCB A;  1KSP A;  4CEZ A;  4RW7 A;  4FJI A;  3NE6 A;  4N56 A;  1KCF A;  4HCC A;  4YNQ A;  4KHQ A;  4H4O A;  3AVI A;  4FLZ A;  3SZ2 A;  3JSM A;  3HST B;  4LD0 A;  1RBS A;  1REV A;  4IBN A;  3HPO A;  3SPZ A;  1NK7 A;  2VG6 A;  3ZSV A;  4E1M A;  3HM9 A;  4CGH A;  1WSJ A;  5E41 A;  3TAB A;  4Z4G A;  2E6L A;  1YT3 A;  1W0H A;  2GBZ A;  4YFU A;  3OYJ A;  3VA3 A;  4OLB A;  1FK9 A;  4AHT A;  1L3S A;  2HW3 A;  1TV6 A;  1RIL A;  1LV5 A;  4IDK A;  4KHS A;  2F96 A;  3CFR A;  1NK5 A;  1WSI A;  3VQQ A;  4B8A B;  2OZS A;  4G1Q A;  4CJL A;  3HP9 A;  4DQQ A;  3B6O A;  3EYZ A;  4DFM A;  4PWD A;  4CER A;  3PO4 A;  3VA0 A;  1L5U A;  3KK2 A;  4J2B A;  4CHZ A;  1VSE A;  4FM2 A;  3T3F A;  4MQ3 A;  3AO3 A;  1TVR A;  2EX3 A;  1LW2 A;  3IRX A;  4C8O A;  4F3O A;  4DTJ A;  4CHP A;  1QTM A;  2D0C A;  4FZX C;  1B9D A;  3DOL A;  4E7J A;  2XY5 A;  4FJN A;  4B9T A;  3SI6 A;  1KLN A;  4FK0 A;  3AO1 A;  1TK5 A;  3OYB A;  2P5G A;  3KD5 E;  1EET A;  3VQ6 A;  4DU3 A;  3RMD A;  3HK2 A;  4KTQ A;  1MU2 A;  1RTI A;  3I8D A;  3CM5 A;  2YNG A;  4HHT A;  4C8K A;  5KTQ A;  4F4K A;  4FZZ A;  1IKX A;  3LPT A;  4DWI A;  4ELU A;  4KRF A;  3OYN A;  4M3Y A;  1HNV A;  3G10 A;  4GMJ B;  4O5B A;  3CFO A;  1U48 A;  4CJ5 A;  1D9F A;  3KK1 A;  4ZHR A;  3M8S A;  1RDB A;  1QS4 A;  4PA1 A;  4O55 A;  5HRN A;  1LWE A;  3DM2 A;  4IKF A;  1QHT A;  4QAG A;  3OJU A;  1X9S A;  2WOM A;  3BGR A;  4I2Q A;  3QEX A;  3HPG A;  4C8N A;  2PYJ A;  2QK9 A;  2P5O A;  4JRP A;  3MED A;  3ISN C;  1RT3 A;  4FLW A;  2HNY A;  1W9H A;  2YHB A;  1RTD A;  4CES A;  2HHS A;  3VQA A;  5I42 A;  4LSN A;  1XC9 A;  4OLA A;  2XRI A;  4B8C A;  4CEB A;  3L2U A;  4I2P A;  3L3U A;  4RW9 A;  4J2D A;  1Q9Y A;  5T7B A;  3L2R A;  3RRH A;  2XY8 A;  4FLT A;  4NCG A;  4KTZ A;  4DTP A;  3SQ4 A;  4CJV A;  3NH2 A;  1HMV A;  1NKC A;  3RR7 A;  1DTT A;  2Z1G A;  4B9N A;  2HHQ A;  3QIP A;  3OS1 A;  3MEG A;  1SKW A;  3KD1 E;  1KFD A;  3ZSQ A;  3OYH A;  5JS2 A;  3KK3 A;  2BGG A;  1RDA A;  4GVM A;  4JS4 A;  1EXQ A;  1RBT A;  2QKB A;  1WLJ A;  4FJL A;  4LH4 A;  4ELV A;  2O4I A;  4NCA A;  1HYZ A;  3CM6 A;  3LPU A;  4OKE A;  3AA5 X;  4FJ9 A;  1RTH A;  2D0A A;  4N5S A;  3O3H A;  3PX4 A;  3SPY A;  4KB1 A;  4MFB A;  4CFB A;  1NK9 A;  4KPY A;  3DLR A;  3V1R A;  4QCL A;  3WNF A;  4FJM A;  4CGG A;  3PUF A;  3KLG A;  3OJS A;  1JL2 A;  5C24 A;  3TR8 A;  3ZT1 A;  1XWL A;  3I0R A;  3T19 A;  3H08 A;  1UOC A;  4E19 A;  4CFC A;  2IDO A;  4AHS A;  3QEI A;  3QIN A;  4FLV A;  1BIZ A;  4Z0U A;  3LAK A;  1JKH A;  4GW6 A;  3KIO A;  3PY8 A;  1NJZ A;  3SUN A;  1JLC A;  4CED A;  2G8F A;  3JYT A;  2ZQB A;  3NF8 A;  1C0U A;  3ZCM A;  1J54 A;  2DY4 A;  1IKW A;  3V1O A;  3O4N A;  4CIE A;  3RWU A;  3ZSX A;  1X1P A;  4RW6 A;  1FKP A;  4FVM A;  1JLF A;  4XIU A;  1D8Y A;  1S1U A;  4B9M A;  4KFB A;  4CJR A;  4AHR A;  3SQ0 A;  1RT7 A;  3QEP A;  4CJQ A;  5KGX A;  1QQC A;  5JS1 A;  4QOZ B;  5EU7 A;  4CIF A;  4W5N A;  2B5J A;  3CG7 A;  3NF7 A;  3SV4 A;  3V9U A;  1CXQ A;  1IO2 A;  1EP4 A;  1C0M A;  4CEC A;  1ASU A;  1EKE A;  1WSE A;  3K57 A;  2HHV A;  4O0I A;  4CJF A;  4CF8 A;  3DRR A;  3L2V A;  3K5L A;  4BDZ A;  3AVH A;  2RF2 A;  3B6P A;  4DF4 A;  3QEV A;  3SV3 A;  2G8H A;  3LP1 A;  1D9D A;  3K2P A;  5FRM A;  2Q3S A;  1T7P A;  1XI1 A;  1SV5 A;  3THV A;  1L3U A;  4FW1 A;  3ITH A; 
#chains in the Genus database with same CATH topology
 1BDG A;  1W97 L;  3G0Z A;  3NH1 A;  4JYA K;  5AFU H;  2A42 A;  2HBJ A;  2Z1H A;  5I3U A;  1U45 A;  1RT1 A;  2OAN A;  5FRN A;  2JLE A;  1NOY A;  3GG4 A;  4N47 A;  1KAZ A;  2GEM A;  3HVT A;  3AV9 A;  4K8X A;  4M3W A;  3HVR A;  3NF6 A;  1NKE A;  4JI1 K;  3HSC A;  3GDQ A;  5K14 A;  3KKS A;  3ALY A;  3HYF A;  1U6Z A;  4W5O A;  2HND A;  3MXM A;  4XH4 A;  1XNR K;  5F2R A;  3ZSO A;  3RTV A;  4DF8 A;  2HBM A;  4IEI A;  4GV3 A;  1M1K O;  3NHG A;  3CCL N;  2ZE2 A;  4MDB A;  4AM6 A;  4DR1 K;  2ASP A;  4WQ4 C;  3ZSR A;  1BHL A;  2QWL A;  1OH8 A;  2FXU A;  4DLG A;  3H3N O;  2VG5 A;  4B1Y B;  4FWL A;  2IGI A;  4G9Z A;  3CC2 N;  3LDQ A;  4CZG A;  4NYN A;  1LW0 A;  4BRE A;  2O8E A;  3DLG A;  4HCB A;  4JKG A;  4CJS A;  1CXU A;  3HL8 A;  3NH0 A;  1WAJ A;  4ISF A;  5J1E A;  4BRM A;  1KVA A;  4O8K A;  2OTL N;  3AVA A;  3WNH A;  3C7N B;  1NNE A;  4M7X A;  3THY B;  1HKC A;  5AQH A;  4JKH A;  1G15 A;  5AQZ A;  4O44 A;  3CMA N;  4BRC A;  4BQL A;  4DSL A;  3ZT4 A;  4JKC A;  3KLI A;  2HBL A;  3SUO A;  5CZ1 A;  2IVP A;  5C15 A;  5M1N A;  5GIP A;  4MLE A;  3CD6 N;  3U3G A;  4BG9 A;  3JAM O;  3TWH A;  4E7H A;  1JJ2 M;  2YNH A;  4AHV A;  4FWO A;  1NJX A;  2I5J A;  4FPA A;  2ZD1 A;  1HNX K;  3HP6 A;  4NXM K;  4CJ3 A;  4CEQ A;  3VTI A;  2YNI A;  2KQ2 A;  4LF5 K;  3KZB A;  1NGH A;  3QEW A;  2O8C A;  4RCH A;  2I7N A;  1Z6R A;  4B9V A;  4Z4E A;  2G8W A;  4WFN L;  1I39 A;  1HNI A;  1YVN A;  1QSY A;  2ASM A;  5EVZ A;  3LWM A;  5H1S Q;  3VTH A;  1BWF O;  2XO7 A;  5MLC Q;  4RW4 A;  4BRG A;  3F9K A;  3DLB A;  2OPS A;  3K9K A;  4FPB A;  1NK0 A;  3WNG A;  3FGU A;  4Y1D A;  1YHQ N;  4CJU A;  3TAE A;  1VSJ A;  3OYK A;  2KFN A;  1WAF A;  1YF5 L;  1KVC A;  1J5O A;  3L2Q A;  3OS0 A;  1JL1 A;  3A5N C;  4FJJ A;  3I56 N;  3ZEU A;  4CZI A;  3EZW A;  3EE9 A;  5F1X A;  2E4L A;  3HOT A;  2ZF5 O;  2IVO A;  5GIN A;  4JLH A;  4DV7 K;  1EX4 A;  3MCP A;  1NGE A;  4IFY A;  4J8F A;  1U49 A;  4OKJ A;  4BR2 A;  2O8D A;  3VQ7 A;  1V4S A;  3CHW A;  1R0A A;  3MN6 A;  1BOT O;  4FW2 A;  2NUB A;  3P38 A;  3WT0 A;  1TYQ A;  4I7F A;  1QZ6 A;  3EY1 A;  3SYZ A;  1VQ7 N;  1C1C A;  3DLH A;  4FM0 A;  1VQO N;  1NK4 A;  1N33 K;  1VQM N;  4M3U A;  1K8A O;  1C0G A;  4DTM A;  4KHW A;  3TI0 A;  2UU9 K;  4CJK A;  4DCH A;  3VES A;  1P8Z A;  4DG1 A;  3THW A;  4BRK A;  1TKX A;  2VWK A;  4CGJ A;  4BC3 A;  3E9L A;  4CEF A;  1NMD A;  4C1N K;  1A5X A;  3TTF A;  3BY5 A;  4JKA A;  3F73 A;  1ZXO A;  1ITG A;  3C94 A;  1BGX T;  1U2V B;  3BDP A;  5JIC A;  3SUP A;  2O8F B;  1VSK A;  1JLG A;  4N41 A;  3RSE A;  3M8P A;  3TAG A;  4BC2 A;  1A5W A;  3ATU A;  2WUS A;  5AZJ A;  3MXJ A;  4X62 K;  4DV4 K;  5IT9 O;  4M41 A;  2NRV A;  3IFR A;  4KH6 A;  2UXD K;  3V4I A;  1GLB G;  2G8V A;  3DXM B;  4ELT A;  2CH5 A;  4O8U A;  3BUZ B;  5ELZ A;  3M8R A;  3HI0 A;  3B8A X;  3ZLJ A;  4JKE A;  3WXL A;  4M3T A;  3FFK B;  2E2N A;  4AQY K;  2Q0R A;  4CK1 A;  1HQU A;  4I6M B;  3NF9 A;  3J7Z O;  2OPQ A;  2E1Z A;  3ZT3 A;  3EZ5 A;  4KAZ A;  4KB0 A;  1TK8 A;  4HTL A;  4RTF D;  4LFB K;  3OYE A;  3KWG A;  3R6M A;  3LAN A;  3QIO A;  3CQY A;  5LJW A;  4BR5 A;  5AQF A;  2FSN A;  4JD2 B;  4CJW A;  3U3Y A;  3L8B A;  4DTN A;  2YX6 A;  3VEZ A;  1T6C A;  3V9Z A;  3CQX A;  1YJN N;  4C8M A;  1UAX A;  3M8Q A;  2Z1I A;  3NBP A;  3QER A;  3LAM A;  3TAQ A;  5AQS A;  1SAZ A;  3O9S A;  5LY3 A;  4HUE A;  2HHT A;  3KTQ A;  4H0X B;  2P9N A;  1HYV A;  3DJC A;  1NGG A;  4Z94 A;  4BRH A;  2CH6 A;  1A5V A;  4BWM A;  2ETJ A;  1KRP A;  4TSX A;  4M63 C;  1RT5 A;  4BE1 A;  4F2R A;  5HRR A;  2O8E B;  1IV0 A;  1DEJ A;  4JKG B;  3AVK A;  4BRF A;  3ENO A;  2KLA A;  2D5R A;  1UA1 A;  4JS5 A;  1S1W A;  3LDN A;  1YVU A;  3AVC A;  5C42 A;  4NCB A;  4A59 A;  4CEZ A;  4JV5 K;  3NE6 A;  4N56 A;  2UUB K;  4NO7 A;  4YNQ A;  3J80 O;  3CME N;  4FLZ A;  3SZ2 A;  3JSM A;  3HST B;  1RBS A;  1Y64 A;  5CHI A;  3VA3 A;  1YT3 A;  1W0H A;  1W2B M;  3L0Q A;  1TV6 A;  3OBW A;  1IBM K;  1WSI A;  2WC9 A;  4B8A B;  4JI2 K;  3U4L A;  3HP9 A;  1YAG A;  4DFM A;  4PWD A;  1H1V A;  1MWK A;  3VOV A;  3KK2 A;  1VQL N;  5TKW A;  4CHZ A;  1OH7 A;  1TUY A;  2EX3 A;  3SI6 A;  1KLN A;  2O8C B;  5AJ3 K;  1VQ6 N;  3OYB A;  2P5G A;  1NWK A;  3HK2 A;  3RMD A;  3I8D A;  1RTI A;  4LFC K;  3CM5 A;  3F5T A;  2A41 A;  4FZZ A;  2Q31 A;  4F4K A;  3VER A;  3LPT A;  3U8X A;  4MDA A;  4M3Y A;  1RDW X;  5F0X A;  3CFO A;  1D9F A;  1NU0 A;  3KK1 A;  1E4G T;  1QS4 A;  4O55 A;  1LWE A;  3H45 C;  1XMQ K;  1Q81 O;  5C12 A;  2WOM A;  4H0T B;  4I2Q A;  3QEX A;  5M1P A;  2PYJ A;  2P5O A;  2CGJ A;  5HL7 L;  5LMU K;  4BRD A;  4CES A;  1E3M A;  3VQA A;  2EWS A;  3TSQ A;  1XC9 A;  4B8C A;  1GLA G;  4I2P A;  4RW9 A;  4EFH A;  3L2R A;  4X64 K;  3E66 A;  3RRH A;  4B3T K;  4FLT A;  4BQZ A;  3ZEU B;  3SQ4 A;  4DTP A;  1HMV A;  4A5B A;  1DTT A;  1EXQ A;  5BPL A;  2QKB A;  4FJL A;  4ELV A;  1HYZ A;  4A5A A;  4GKK K;  3SPY A;  2D0A A;  4N5S A;  3O3H A;  4QCL A;  1QHA A;  3WNF A;  3KLG A;  2O8D B;  5C24 A;  3TR8 A;  4AM7 A;  3T19 A;  4AHS A;  3CCM N;  1GLJ O;  1JKH A;  3KIO A;  1NJZ A;  2G8F A;  2VCP A;  2E88 A;  4H0Y B;  3ZCM A;  3VEX A;  3O4N A;  4CIE A;  1YJ9 N;  4H5N A;  1X1P A;  3ZSX A;  2Q36 A;  1FKP A;  3EO3 A;  4CJR A;  4K42 A;  2AA4 A;  4AHR A;  3THW B;  1QQC A;  1D4X A;  4QOZ B;  2B5J A;  3CG7 A;  3NF7 A;  4EHU A;  3U9D A;  3MN7 A;  1IO2 A;  1N34 K;  3CCS N;  4BG8 A;  1ASU A;  1EKE A;  1IJJ A;  3AAR A;  2HHV A;  4JKF A;  4CJF A;  3TTC A;  3AVH A;  4DF4 A;  2G8H A;  3LM9 A;  3QEV A;  3BF1 A;  3ZET A;  2D0P A;  2ASO A;  1XI1 A;  5AQN A;  3THV A;  4JK7 A;  2CGL A;  3LDO A;  1QQO A;  3RSE B;  5C2F A;  3RVC A;  4FK2 A;  5AZJ B;  2Y1I A;  3K5O A;  2VWB A;  3AA3 A;  1VRU A;  3DRS A;  3EKS A;  2X6S A;  4DQP A;  3F9M A;  5C0Y A;  3S41 A;  4DV3 K;  5J2Q A;  4OGC A;  3A5L C;  3C95 A;  1RDC A;  4FVU A;  1Z26 A;  3TAN A;  3HOS A;  1HYS A;  4CZL A;  4CFA A;  1ZBU A;  4DTU A;  3KLF A;  4OPH A;  3P5J A;  4IFE A;  3LZJ A;  1K73 O;  1LAW A;  3VQP A;  1X3N A;  2QWO A;  1YIT N;  2ITM A;  1N5Y A;  4FWK A;  3FZM A;  1SKR A;  4H0V B;  1QSS A;  1VK0 A;  3A5O C;  1NGF A;  4KHY A;  4L3Q A;  3FZL A;  3I55 N;  1RDU A;  1GOA A;  1Q18 A;  2NRT A;  3NDK A;  4B3S K;  4BE2 A;  1M90 O;  2QWN A;  3J81 O;  4BR7 A;  2PFU A;  1I3A A;  4DR5 K;  4LFA K;  1SL2 A;  4DTO A;  3OYM A;  3V9S A;  3TAP A;  4N76 A;  2QWP A;  3V81 A;  1SZ2 A;  3VEY A;  1S1V A;  1ZBI A;  4EP5 A;  3CF5 L;  4IJA A;  2P9N B;  3AVN A;  2NNW A;  3W0L A;  1U4B A;  4KKO A;  2OPR A;  4J2E A;  4YOW A;  4JI6 K;  4GY2 B;  4PQU A;  2VQF K;  3ZX0 A;  1DGK N;  4W5Q A;  4ICL A;  4OKK A;  2KW4 A;  5KPT A;  5HP1 A;  2A40 A;  1VSM A;  4KRE A;  1MWM A;  4CCH A;  4OPA A;  4NYF A;  4Z4I A;  1I94 K;  1RBU A;  4H03 B;  3SQ2 A;  4M45 A;  1HPZ A;  5HRP A;  1UWB A;  4CBU A;  5BPN A;  3VET A;  1GOC A;  3O3F A;  1BQM A;  5AQY A;  4FM1 A;  1RBR A;  1DLO A;  1HRH A;  1WB9 A;  2F8S A;  1BO5 O;  1S6P A;  3OY9 A;  3E01 A;  4CF9 A;  4FWQ A;  1RT4 A;  1D5A A;  3E1Y A;  1NBW A;  3DYA A;  4K25 A;  3I8B A;  3LZI A;  1XHZ A;  2KHO A;  1JXB A;  4KO0 A;  2G8K A;  1JCE A;  2HMI A;  1QQM A;  1OH5 A;  4CJP A;  3RMB A;  2HMP A;  3LDS A;  4H5R A;  5AZI B;  4BY9 C;  3SJH A;  4AH9 A;  3HT3 A;  4DR3 K;  1ZBL A;  2W6L A;  4PKI A;  5BRE A;  1IH7 A;  2ATQ A;  3CFP A;  1L3T A;  3QBW A;  3AVJ A;  3UKU A;  3CCQ N;  4DU1 A;  5C2D A;  1IBK K;  3SNN A;  3S3M A;  1LWF A;  2X74 A;  3VEO A;  2NRW A;  3K0S A;  2E6M A;  3R9P A;  1VQK N;  2AJQ A;  1YUW A;  3CYM A;  3K5M A;  4FZY A;  4BRN A;  3ENB A;  2P1J A;  2UXB K;  4BAC A;  2V7Y A;  4E3S A;  3O9Q A;  4IOX A;  1NLV A;  3CJC A;  2P9U A;  3V1Q A;  4EHT A;  2OCE A;  3EN9 A;  3RMA A;  1K8K A;  3VQD A;  4WYB A;  3VQ9 A;  5KGW A;  3HRG A;  4O4G A;  2A5X A;  5BR9 A;  4FJ5 A;  1NKB A;  1BL3 A;  2GEL A;  2IIR A;  2WON A;  3QML A;  2O4G A;  3D2E A;  4Z4F A;  2OPP A;  3MXI A;  1E4F T;  2B6A A;  4E7K A;  3PX6 A;  4CK2 A;  1T6D A;  4BGA A;  4QS9 A;  1SKS A;  4IFV A;  2HHH K;  4CHY A;  3HZ6 A;  5J2M A;  2E5L K;  4ISG A;  4CGF A;  4HVJ A;  3H1Q A;  3CQ8 A;  2G8U A;  3ASM A;  3OBY A;  2JWK A;  5ADX H;  1VQ8 N;  3CCV N;  4KV8 A;  3AA4 A;  4JI7 K;  2QXL A;  1BA1 A;  3OVN A;  1JLA A;  2HHX A;  3O6W A;  3LWL A;  3EL2 A;  4GNI A;  4FK4 A;  4BRA A;  2W42 A;  3ZET B;  1N6Q A;  3S3N A;  4B1W B;  1SS6 A;  5HRO A;  4LY7 A;  5LMN K;  1ZYQ A;  4KI4 A;  4M42 A;  1Z05 A;  4CBW A;  4CGD A;  3ZX3 A;  1TAQ A;  4YOT A;  3CIP A;  1LCU A;  1O1W A;  3AO4 A;  2RN2 A;  2V52 B;  3C6U A;  3D2F A;  1S3X A;  2HHU A;  2BAN A;  4DR6 K;  3S9H A;  1IKY A;  3KKR A;  4CBX A;  4CF2 A;  3CCR N;  3NGZ A;  3F2K A;  1QVG M;  2P9I A;  4DR2 K;  5HOO A;  4HUF A;  1YXQ A;  2D0O A;  4H0P A;  3S3O A;  3NGI A;  4FJ8 A;  3SK3 A;  2P9K A;  4NLB A;  5AQM A;  4DLE A;  5AQO A;  1HJR A;  4DUY K;  4C8L A;  2NLX A;  3RRG A;  3AY9 A;  1SL0 A;  2YHA A;  4PKG A;  2FBY A;  1KFS A;  4HWI A;  3CC7 N;  4XH1 A;  2DPN A;  3NFA A;  2HB5 A;  5HBM A;  4DV6 K;  4DR4 K;  2KZZ A;  1EWR A;  4LF4 K;  2HNZ A;  1OH6 A;  4BDP A;  4FCY A;  5EX5 A;  3RMC A;  4JI8 K;  3PX0 A;  1OVQ A;  2YJF A;  4FJI A;  4HCC A;  3JXU A;  4KHQ A;  5CR4 A;  2VYP A;  4JI3 K;  2HF3 A;  2F7T A;  1REV A;  4IBN A;  4LD0 A;  2VG6 A;  3OA9 A;  4CGH A;  2GBZ A;  3OYJ A;  4OLB A;  4AHT A;  4DQ8 A;  1L3S A;  1RIL A;  2P9P A;  3SMS A;  3WUH A;  4CJ7 A;  3CFR A;  3H46 O;  5AQQ A;  2OZS A;  3N4Q A;  4G1Q A;  4CJL A;  3AGR A;  2YHY A;  1YJW N;  4BR9 A;  1L5U A;  4WCE L;  4FM2 A;  3T3F A;  2GTD A;  3HBT A;  4F3O A;  4CHP A;  2D0C A;  1B9D A;  1MDU B;  4FK0 A;  3R3L A;  3BZC A;  3GBT A;  3EKU A;  3MMV A;  4HHT A;  1JCF A;  3DWL A;  5BPM A;  2P9S A;  2FLO A;  5AFU A;  1KC8 O;  1QZ5 A;  4GMJ B;  3G10 A;  4O5B A;  3A8Y A;  4PA1 A;  1QHT A;  2QWR A;  3T1H K;  3MED A;  4FLW A;  2HNY A;  2YHB A;  3OTO K;  1YIJ N;  1RTD A;  4LSN A;  4OLA A;  4CEB A;  3L3U A;  1YI2 N;  3ATV A;  4LF8 K;  4KTZ A;  1NKC A;  3QIP A;  3OS1 A;  3ZSQ A;  3OYH A;  5JS2 A;  3KK3 A;  1S72 N;  2BGG A;  3BF3 A;  4JS4 A;  4LH4 A;  2HF4 A;  3UKU B;  3LPU A;  4OKE A;  3AA5 X;  3CET A;  4FJ9 A;  1RTH A;  4MFB A;  4BRO A;  1NK9 A;  3V1R A;  3AGK A;  1VAZ A;  4CGG A;  3PUF A;  3OJS A;  5AQL A;  4R79 A;  3U9Z A;  4Z0U A;  5BRD A;  5FLX O;  2VGM A;  5AR0 A;  2ZQB A;  1C0U A;  2DY4 A;  5FPM A;  1IKW A;  3V1O A;  3MN9 A;  4X66 K;  1JLF A;  4B9M A;  3SQ0 A;  1RT7 A;  2P9U B;  4ILH A;  4CJQ A;  5KGX A;  5JS1 A;  4U7B A;  4NLC A;  4CIF A;  4W5N A;  1HNW K;  3V9U A;  1CXQ A;  3CI5 A;  4EIA A;  4O0I A;  4CF8 A;  5DM6 L;  3L2V A;  3K5L A;  5GAH P;  1VQN N;  3SV3 A;  3CJ9 A;  3LP1 A;  4ILG B;  3D2E B;  5FRM A;  1T7P A;  5FPE A;  4CZF A;  1O13 A;  1OVY A;  3HXM A;  3SCX A;  4BR4 A;  3NAE A;  1JLQ A;  3OHR A;  3K5N A;  4MLH A;  3PLA A;  2VGN A;  3WEE A;  4YOY A;  3AVG A;  2Q0U A;  3E9P A;  1XNQ K;  1C1A A;  4H5T A;  4EZ9 A;  1NGI A;  3QB0 A;  4JK8 A;  1HKB A;  4CD1 A;  5J2P A;  2J4R A;  3CJ7 A;  3ZT2 A;  3CER A;  1GLD G;  1DTQ A;  4FWR A;  3V6D A;  3BZK A;  3KWI A;  4B3O A;  1ASV A;  4E7I A;  5BN9 A;  4H4M A;  5KPZ A;  4LF9 K;  3MX2 A;  2YKN A;  2GWJ A;  3O4W A;  1TAU A;  4FLU A;  3HPH A;  4IXC A;  4OPK A;  3C0B A;  2E2Q A;  3D2F B;  1ATR A;  3DRP A;  4B9U A;  3V9X A;  4E0D A;  5BRF A;  3FFI A;  2RKI A;  4CF0 A;  4FWN A;  2ZJP L;  1T05 A;  2ZJR L;  5D3G A;  4FL9 A;  2OA8 A;  2P9I B;  5AQG A;  1HX1 A;  3VQE A;  4CJE A;  3P31 A;  1TKZ A;  2QKK A;  1S9E A;  3VEW A;  1Q7Y O;  2PYL A;  2P9K B;  4ISE A;  5JVG L;  3Q7C A;  4FLX A;  1CZA N;  1CLQ A;  2PZS A;  3AVB A;  1JXE A;  4IG3 A;  4Z4H A;  1D9D A;  3VPZ A;  1YTA A;  3ZSW A;  2YKM A;  3CPE A;  4B1X B;  2F8T A;  4BC5 A;  5DK5 A;  4EZ6 A;  3C6A A;  3K58 A;  4Y1C A;  1RT2 A;  1TYQ B;  3ID6 A;  4CZH A;  1T03 A;  3NGY A;  3ZSY A;  2V7Z A;  4Q5V A;  1ZC6 A;  1ATN A;  4YOU A;  2ITG A;  3OYF A;  1NGJ A;  3TAR A;  4UQG A;  2UXC K;  1VSI A;  4CGI A;  3CCU N;  2RPI A;  4M3R A;  1N32 K;  2P9P B;  1BCM A;  4QS7 A;  4PUO A;  1HQE A;  1IG8 A;  3THY A;  3P39 A;  3ZSZ A;  4OJR A;  3EE8 A;  4DSI A;  4FWP A;  5AQK A;  1VHX A;  5J2N A;  4IG0 A;  5LJV A;  3DI6 A;  3ULD A;  3VQ4 A;  1VSH A;  5BN8 A;  1S6Q A;  5I9E B;  1T3V A;  3HJF A;  3ZT0 A;  4YHH K;  1QSL A;  3SBT A;  1S1X A;  1RDD A;  2P9S B;  5KPR A;  4JI5 K;  3MDQ A;  1S22 A;  4F3T A;  3SLC A;  1VQP N;  3VQC A;  4DTR A;  4YDU A;  1VSD A;  4WQ5 A;  1XC3 A;  1JLE A;  4DV5 K;  4NB4 A;  3J7A P;  3FZK A;  4JKB A;  4BR0 A;  5B8H A;  2GV9 A;  3VF6 A;  1BUP A;  2BE2 A;  5C10 A;  4R5P A;  1JCG A;  2PAV A;  3PIP L;  4ILJ A;  2ZM6 K;  4B9L A;  4LF6 K;  5M1K A;  1NMN A;  4K41 A;  3QES A;  1TL3 A;  4BE0 A;  2RE2 A;  4OGE A;  3IG1 A;  3WXM B;  2F9W A;  1VSF A;  4YY3 K;  1W7A A;  3SAH A;  4JRQ A;  1J9A A;  3R1X A;  2QW9 A;  4FOE A;  3ENH A;  4A57 A;  3OS2 A;  4CF1 A;  1ZBF A;  1T8E A;  1WOQ A;  3N4P A;  2HHW A;  1NJW A;  4O5F A;  2YI1 A;  2X78 A;  4KHN A;  2BUP A;  4CE9 A;  1Q8I A;  2E2P A;  1XMO K;  3IS9 A;  4BWJ A;  3C6H A;  3VQ8 A;  1VQ5 N;  3AVL A;  1X9W A;  2DFE A;  4DHY A;  1BU6 O;  2HBK A;  4OPJ A;  1B9F A;  3I0S A;  4CK3 A;  3LM2 A;  3DAW A;  3QBX A;  1ILY A;  3AO5 A;  5CY4 A;  1WBD A;  3UIQ A;  3BEX A;  2NZT A;  3O1B A;  4MO5 A;  5FRO A;  1U47 A;  3LP3 A;  1GLF O;  4K8Z A;  4BDY A;  2FBT A;  2GUP A;  3C6T A;  3LP2 A;  3AVF A;  1ZBS A;  3WEE B;  2FBX A;  1X9M A;  1BI4 A;  1NG9 A;  1WSG A;  4KHP K;  4CI6 A;  2HVI A;  4QS8 A;  2KTQ A;  2NRR A;  4B9Q A;  3OYI A;  4KI6 A;  5FPD A;  4IZ9 A;  1NK6 A;  4Q0B A;  3GE1 A;  5DMR A;  3OYG A;  3CPW M;  3PV8 A;  3A5M C;  1IKV A;  1U2V A;  1WSF A;  1V4T A;  5AQU A;  2O8F A;  3TSU A;  3G4S N;  4CHO A;  3KLE A;  4B08 A;  3PO5 A;  3JS6 A;  1NGD A;  3L6Q A;  4IOC L;  3NVK A;  3VN5 A;  3H1V X;  4DTS A;  2GWK A;  4CHN A;  4LC9 B;  2IVN A;  1KAX A;  3UE5 A;  4CEA A;  4B9S A;  5HRS A;  1B92 A;  4WE1 A;  1Z25 A;  2A3Z A;  5SWM A;  2VWJ A;  5BR8 K;  3OYA A;  3H3O B;  3M3Z A;  4OO1 J;  4AIL C;  1L3V A;  2XY6 A;  4FJX A;  2NRX A;  1FKO A;  3KJV A;  3CC4 N;  1OKJ A;  2QEX N;  5LL6 Z;  3VEV A;  4FWS A;  2E8A A;  3DLL L;  1KCF A;  4RWT A;  3AVI A;  2FF6 A;  4JD2 A;  1XUP O;  3SPZ A;  1NK7 A;  3ZSV A;  4E1M A;  4NXN K;  3L4I A;  3TAB A;  3IDH A;  1LV5 A;  4IO9 L;  3THX A;  3O1W A;  2F96 A;  4KHS A;  2QWM A;  1NK5 A;  4K43 A;  2V51 B;  3CCE N;  4DQQ A;  2WFB A;  1C0F A;  3B6O A;  3EYZ A;  4CER A;  2ZJQ L;  1FJG K;  4CD3 A;  3AO3 A;  3OW2 M;  3IRX A;  3M6G A;  4E1J A;  4JI4 K;  4C8O A;  4FZX C;  1G99 A;  1BA0 A;  4FWM A;  1DKG D;  3DOL A;  2XY5 A;  4FJN A;  4B9T A;  4H5W A;  3I33 A;  3MWT A;  1NGB A;  1LOT B;  1MU2 A;  4PHT X;  3LL3 A;  1IKX A;  4DWI A;  3QIC A;  3OYN A;  3KVG A;  4YOV A;  4JAX A;  3UB5 A;  4CJ5 A;  5FPN A;  2YJE A;  4ZHR A;  1RDB A;  5HRN A;  3DM2 A;  2Q2R A;  2NRZ A;  5M1O A;  3OJU A;  1X9S A;  1NM1 A;  4JRP A;  3ISN C;  1RT3 A;  2WBN A;  1W9H A;  1WBB A;  4GKJ K;  4KH4 A;  5I42 A;  2GX9 A;  5IWA K;  2XRI A;  4YOR A;  3L2U A;  4A61 A;  1J5E K;  3T69 A;  4A2A A;  4JNE A;  4CJV A;  3NH2 A;  3RR7 A;  2Z1G A;  2FSK A;  3MEG A;  2ZGY A;  1SKW A;  3KD1 E;  3KHY A;  1KFD A;  4BGB A;  1NGA A;  1RDA A;  4GVM A;  1RBT A;  1WLJ A;  2O4I A;  4NCA A;  4YDU C;  3CM6 A;  4WFA L;  4OX9 K;  2BTF A;  2OTJ N;  5AQT A;  4WQ5 C;  3PX4 A;  4CFB A;  1JL2 A;  4E19 A;  3I0R A;  4K0K K;  3H08 A;  3AAP A;  1BIZ A;  3VMF B;  3G6E N;  4DKW A;  3PY8 A;  3PSI A;  4CED A;  4CZM A;  3NF8 A;  3HTV A;  4F9O A;  1J54 A;  4X65 K;  3T1Y K;  1KAY A;  3SAF A;  4RW6 A;  4FVM A;  3D6R A;  3ZX2 A;  4XIU A;  4KFB A;  2YHX A;  4DV0 K;  2D1K A;  4GVE A;  5EU7 A;  1GLL O;  3NVM A;  3SV4 A;  2O8B A;  4CEC A;  1MA9 B;  3TPQ A;  2YHW A;  1WSE A;  3K57 A;  4IOA L;  4PL7 A;  1SQK A;  4CW7 B;  4BDZ A;  2RF2 A;  3B6P A;  2E20 A;  4KH5 A;  5AQI A;  1SV5 A;  1L3U A;  4DU4 A;  3ITH A;  4KBO A;  4IEE A;  3D0P A;  4PKH A;  2E2O A;  3P83 D;  3OYD A;  2XY7 A;  3SMP A;  4PY5 A;  3ID8 A;  3D45 A;  3RR8 A;  2B4J A;  4BVP A;  3GL1 A;  1HLU A;  5AQW A;  3TAF A;  3MN5 A;  4CJ4 A;  1RT6 A;  1XQS C;  1GOB A;  4O0J A;  2VG7 A;  5KQ8 A;  5HLF A;  1WSH A;  4JI0 K;  3WXJ A;  3VGK A;  5CE3 A;  1SUQ A;  5CYM A;  3QNO A;  2Y1J A;  3MWP A;  4DR7 K;  4LSL A;  3AO2 A;  3P4I A;  4JK9 A;  1QQN A;  3MEC A;  2WTU A;  4RW8 A;  3NCI A;  2VQE K;  4FXD A;  1NOZ A;  1BI4 B;  4DSK A;  3FZH A;  4HTU A;  4BRQ A;  4H0O A;  2UUA K;  1DT9 A;  3O08 A;  3O9U A;  4DFP A;  3TTD A;  1IG9 A;  1ESV A;  2P51 A;  2AP1 A;  3PIO L;  2F4V K;  1C6V A;  4V19 S;  3MEE A;  1K6Y A;  3L4Q A;  4AHU A;  2G8I A;  1YTU A;  1S1T A;  4A62 A;  2KFZ A;  1KLM A;  3A2F A;  2F9T A;  1TUU A;  3VEN A;  2RHK A;  5M1Q A;  3VQB A;  3O4Q A;  2HVH A;  5AQR A;  3M5R A;  4F8R A;  2KZM A;  1Q86 O;  3WXK A;  1ASW A;  3T7Z A;  3A0I X;  3MK6 A;  1RNH A;  3SJJ A;  3KD5 E;  3NMU A;  1RCH A;  3KLH A;  4HUG A;  2DTU A;  2R7Y A;  4JHD A;  4DMN A;  1NK8 A;  1QVF M;  1QE1 A;  4DFJ A;  1CZ9 A;  3SQ1 A;  4DS5 A;  3T1A A;  4OVL A;  1WN7 A;  2A1S A;  1BQN A;  2JGU A;  4CEE A;  1VQ9 N;  3O9T A;  3WQT A;  1BCO A;  5SZT A;  2IC3 A;  4CHQ A;  1TKT A;  4I9L A;  3FZF A;  4L8R B;  1TKD A;  1BIU A;  2P9L A;  3EEQ A;  3K59 A;  1EWQ A;  3BP8 A;  3DOK A;  2HOE A;  3DXK A;  1P90 A;  4H5V A;  1ZBH A;  4DQI A;  4UY8 O;  1ATS A;  1K9M O;  4FJH A;  1K8K B;  2YV0 X;  3DLK A;  3THX B;  2I7P A;  1HR0 K;  4DSJ A;  5ADX A;  3CJB A;  4RG8 A;  1FXX A;  1XHX A;  1Q82 O;  1J53 A;  2ZGZ A;  2CGK A;  4EP4 A;  1LWC A;  2HST A;  3MX5 A;  3QET A;  5GAG P;  5DM7 L;  4XEI A;  3ULE A;  4BRP A;  4GV9 A;  4DS4 A;  1HNZ K;  1R59 O;  3R8E A;  3QO9 A;  3HO1 A;  1RTJ A;  1N36 K;  4M3X A;  3E9O A;  3LDP A;  5AQJ A;  4DV2 K;  3IMX A;  4AF1 A;  4BRL A;  4W5R A;  3OYL A;  4DTX A;  2Z1J A;  2BDP A;  3QNN A;  3CJA A;  4ZTJ A;  3OYC A;  2OYQ A;  2A1R A;  3GOI A;  3FE1 A;  3FR0 A;  3IKM A;  3WNE A;  2YNF A;  3CXC M;  3VGM A;  4I9Q A;  3VF2 A;  2EHG A;  3V9W A;  5KI6 A;  2JWL A;  4B1V A;  1TK0 A;  5E84 A;  4BVO A;  2FBV A;  1RBV A;  1VRT A;  4JEP A;  3WQU A;  1FW6 A;  5CZ2 A;  4DFK A;  2QWQ A;  3LP0 A;  1S5J A;  1HJO A;  3P1G A;  4FJK A;  3LAL A;  1T44 A;  2X6N A;  4C1N I;  1NGC A;  4E89 A;  4B3M K;  3L2W A;  2QA4 N;  4FJG A;  3UKR A;  4WFB L;  1Y97 A;  1VSL A;  4CIG A;  2H3G X;  3MAQ A;  3O8M A;  4DQS A;  3CCJ N;  3IAY A;  5KRT A;  2KKZ A;  1RFQ A;  2W41 A;  4M7Y A;  4CJT A;  4YOX A;  2QI2 A;  2FF3 B;  5AZI A;  4A2B A;  2IAJ A;  4F2S A;  4AHC A;  5FDL A;  3Q7B A;  5AQX A;  1S9G A;  3KK7 A;  1TGO A;  4FOI A;  4FJ7 A;  1TL1 A;  2NRH A;  3DMJ A;  3L3V A;  4IJN A;  5C25 A;  1BIS A;  2UYT A;  4CZJ A;  3J8A A;  5TKY A;  1C1B A;  2Q97 A;  2FC0 A;  3C65 A;  1NJI O;  2UUC K;  2O8B B;  1SL1 A;  1F21 A;  4CZK A;  1Q9X A;  4M3Z A;  5KQD A;  1LAV A;  1C0T A;  3SBG A;  3PSF A;  1GLE G;  4ID5 A;  4C23 A;  4KTW A;  3W3D A;  3VQ5 A;  2YCH A;  4Z4C A;  1EO1 A;  3G25 A;  4WQ4 A;  1N8R O;  1WNS A;  1KTQ A;  4KHU A;  1NJY A;  3U6F A;  5M1F A;  2XHB A;  2QXF A;  4ID1 A;  3DLE A;  4FYD A;  1KQS M;  2D0B A;  3O80 A;  3LDL A;  1HPM A;  3J7Y P;  1RGI A;  4E7L A;  1X3M A;  4DQR A;  3C7N A;  1UA0 A;  4DB3 A;  4W5T A;  4ZTF A;  1KVB A;  4CFD A;  3SUQ A;  2PY5 A;  4J2A A;  4DV1 K;  5KRS A;  3IUC A;  4CEO A;  4IO8 A;  3AVM A;  4FLY A;  4DSE A;  2IOC A;  3D7E O;  2DFH A;  1U04 A;  4JN4 A;  4Y0W A;  4LH5 A;  3O5B A;  2IS3 A;  3QLH A;  2LSN A;  1CZB A;  4U67 L;  1JLB A;  2A6A A;  2OZM A;  5GIO A;  4H8K A;  3AA2 A;  4DSF A;  2DFF A;  4E1N A;  3O3G A;  4MO4 A;  1BG3 A;  5CYQ A;  3TAM A;  2E1Y A;  2GUI A;  1KSP A;  4RW7 A;  2BH1 A;  5AQP A;  4H4O A;  3HM8 A;  3AAQ A;  3HPO A;  3QFU A;  5EY4 A;  5BRH A;  4JKD A;  3HM9 A;  1WSJ A;  5E41 A;  4Z4G A;  2E6L A;  4YFU A;  1FK9 A;  2HW3 A;  4EAH D;  4IDK A;  4JHD B;  3VQQ A;  1VQ4 N;  4IWV A;  3PO4 A;  3VA0 A;  4GV6 A;  5A2Q O;  4J2B A;  1VSE A;  4MQ3 A;  1TVR A;  1LW2 A;  3CJ1 A;  4DTJ A;  1QTM A;  4E7J A;  3QFP A;  2PBD A;  3AO1 A;  1TK5 A;  1IBL K;  2P9L B;  3M1F A;  1EET A;  2W6K A;  3H6E A;  3VQ6 A;  4DU3 A;  4KTQ A;  3QDK A;  1HKG A;  5JVH L;  2YNG A;  4C8K A;  5KTQ A;  3DXK B;  4ELU A;  1J6Z A;  5E26 A;  5GAD P;  4KRF A;  5EOY A;  1HNV A;  1U48 A;  1KXP A;  3M8S A;  2FSJ A;  5JMV A;  4IKF A;  4B1U B;  4QAG A;  4CZE A;  3BGR A;  2QK9 A;  3HPG A;  4C8N A;  2QM1 A;  2HHS A;  3MCA B;  4J2D A;  1Q9Y A;  5T7B A;  4B1Z A;  2XY8 A;  3ULE B;  5AQV A;  4NCG A;  2HHQ A;  4B9N A;  2W40 A;  3FLC O;  4XH5 A;  1X9J A;  2Q1N A;  5EXW A;  4DUZ K;  4WF9 L;  4PL8 A;  4KB1 A;  4KPY A;  3DLR A;  3VGL A;  4FJM A;  1WUA A;  3ZT1 A;  1XWL A;  5JLF A;  5JLH A;  1UOC A;  4CVN E;  4CFC A;  2IDO A;  3QEI A;  3QIN A;  3SAG A;  4FLV A;  3LAK A;  4GW6 A;  1HUX A;  1JLC A;  3WXI A;  3SUN A;  3K9J A;  3JYT A;  3RWU A;  3O9R A;  5GAE P;  4IDH A;  1D8Y A;  1S1U A;  2ZWH A;  3QEP A;  2QTD A;  3DXM A;  4LF7 K;  4BC4 A;  1EP4 A;  3UKR B;  1C0M A;  4FO0 A;  1KD1 O;  1EQY A;  3VF4 A;  3ZYY X;  2D4W A;  4FSV A;  3DRR A;  4I6M A;  1GLC G;  3TSP A;  3K2P A;  4BRI A;  2Q3S A;  3G71 N;  3TU5 A;  4FW1 A;  4B3R K; 
#chains in the Genus database with same CATH homology
 3SCX A;  3HXM A;  3NAE A;  3D0P A;  3G0Z A;  1JLQ A;  3P83 D;  3NH1 A;  3K5N A;  3OYD A;  2XY7 A;  4FK2 A;  5I3U A;  2Z1H A;  1U45 A;  4PY5 A;  1RT1 A;  2Y1I A;  3K5O A;  5FRN A;  3AVG A;  3D45 A;  3AA3 A;  1VRU A;  2JLE A;  3DRS A;  1NOY A;  3RR8 A;  4N47 A;  3HVT A;  3AV9 A;  2B4J A;  4K8X A;  1C1A A;  2X6S A;  3HVR A;  4EZ9 A;  4M3W A;  4DQP A;  3NF6 A;  1NKE A;  5K14 A;  3KKS A;  3ALY A;  3HYF A;  5J2P A;  5J2Q A;  3ZT2 A;  4W5O A;  4OGC A;  2HND A;  3TAF A;  3MXM A;  4CJ4 A;  1RT6 A;  1GOB A;  1DTQ A;  3C95 A;  2VG7 A;  4O0J A;  3ZSO A;  1RDC A;  3RTV A;  4DF8 A;  3V6D A;  5HLF A;  1WSH A;  4B3O A;  1Z26 A;  3TAN A;  1HYS A;  4CFA A;  1ZBU A;  1ASV A;  3NHG A;  2ZE2 A;  4E7I A;  4DTU A;  4H4M A;  3KLF A;  1SUQ A;  3ZSR A;  5CYM A;  3QNO A;  2Y1J A;  3P5J A;  4LSL A;  3LZJ A;  1LAW A;  3AO2 A;  3VQP A;  1BHL A;  3MEC A;  2YKN A;  4RW8 A;  1TAU A;  3NCI A;  4DLG A;  3HPH A;  4FLU A;  4OPK A;  1N5Y A;  2VG5 A;  1SKR A;  1NOZ A;  4FXD A;  1BI4 B;  2IGI A;  4DSK A;  4Z4I A;  1QSS A;  1VK0 A;  4NYN A;  4HTU A;  1LW0 A;  4KHY A;  3DRP A;  4B9U A;  3DLG A;  3V9X A;  4DFP A;  4HCB A;  4E0D A;  3FFI A;  4CJS A;  1CXU A;  1GOA A;  2RKI A;  3HL8 A;  4CF0 A;  1IG9 A;  3NH0 A;  2P51 A;  1T05 A;  1WAJ A;  5J1E A;  3NDK A;  1KVA A;  4BE2 A;  5D3G A;  3AVA A;  3WNH A;  1C6V A;  2OA8 A;  3MEE A;  1I3A A;  1SL2 A;  1K6Y A;  4AHU A;  4DTO A;  3VQE A;  3OYM A;  4CJE A;  3V9S A;  1YTU A;  2G8I A;  1S1T A;  1TKZ A;  2KFZ A;  3TAP A;  1G15 A;  2QKK A;  4N76 A;  1S9E A;  3V81 A;  4O44 A;  1KLM A;  1S1V A;  3A2F A;  4EP5 A;  2PYL A;  1ZBI A;  3AVN A;  1U4B A;  4KKO A;  2OPR A;  4DSL A;  4J2E A;  3VQB A;  3ZT4 A;  3O4Q A;  4FLX A;  2HVH A;  3SUO A;  3KLI A;  4PQU A;  5CZ1 A;  4F8R A;  3U3G A;  2KZM A;  2PZS A;  1CLQ A;  1ASW A;  3AVB A;  1JXE A;  3TWH A;  4IG3 A;  4Z4H A;  4W5Q A;  1RNH A;  4E7H A;  3SJJ A;  2YNH A;  4ICL A;  1YTA A;  4AHV A;  3ZSW A;  2YKM A;  2KW4 A;  1RCH A;  4OKK A;  5HP1 A;  1NJX A;  2I5J A;  3KLH A;  4HUG A;  2DTU A;  2R7Y A;  1NK8 A;  4DMN A;  2F8T A;  1VSM A;  1QE1 A;  2ZD1 A;  4DFJ A;  1CZ9 A;  3SQ1 A;  4KRE A;  4DU4 A;  4CCH A;  3HP6 A;  5DK5 A;  4EZ6 A;  4CJ3 A;  4NYF A;  3T1A A;  4DS5 A;  4OVL A;  4CEQ A;  1WN7 A;  2A1S A;  1BQN A;  2JGU A;  1RBU A;  2YNI A;  4CEE A;  3K58 A;  4Y1C A;  1RT2 A;  1BCO A;  4M45 A;  3SQ2 A;  1HPZ A;  5SZT A;  2IC3 A;  2KQ2 A;  4CHQ A;  1TKT A;  5HRP A;  1UWB A;  1T03 A;  4I9L A;  3QEW A;  4L8R B;  1TKD A;  1BIU A;  3NGY A;  3ZSY A;  3K59 A;  4Q5V A;  1GOC A;  3O3F A;  4B9V A;  4Z4E A;  2G8W A;  2ITG A;  3DOK A;  1I39 A;  1BQM A;  1HNI A;  1QSY A;  4FM1 A;  3OYF A;  3LWM A;  1RBR A;  1DLO A;  1HRH A;  3TAR A;  4UQG A;  2F8S A;  1VSI A;  1S6P A;  4CGI A;  2XO7 A;  1ZBH A;  4DQI A;  4RW4 A;  3OY9 A;  3E01 A;  2RPI A;  3F9K A;  4M3R A;  3DLB A;  4FJH A;  1BCM A;  4CF9 A;  4PUO A;  1HQE A;  2OPS A;  2YV0 X;  1RT4 A;  1D5A A;  3DLK A;  1NK0 A;  4DSJ A;  3WNG A;  3DYA A;  3LZI A;  4Y1D A;  4RG8 A;  3ZSZ A;  1XHZ A;  4OJR A;  1FXX A;  4DSI A;  1JXB A;  1XHX A;  1J53 A;  4KO0 A;  4CJU A;  3TAE A;  2G8K A;  4EP4 A;  1VSJ A;  3OYK A;  5J2N A;  1LWC A;  3QET A;  2HMI A;  2KFN A;  4CJP A;  1WAF A;  4IG0 A;  1KVC A;  3DI6 A;  3ULD A;  3RMB A;  1J5O A;  3L2Q A;  3OS0 A;  1JL1 A;  4DS4 A;  3LDS A;  3VQ4 A;  4FJJ A;  1VSH A;  3QO9 A;  1RTJ A;  1S6Q A;  4AH9 A;  4M3X A;  3HO1 A;  3HT3 A;  1ZBL A;  3HJF A;  3ZT0 A;  2E4L A;  4W5R A;  3OYL A;  1QSL A;  4JLH A;  1IH7 A;  1S1X A;  4DTX A;  2ATQ A;  1RDD A;  2Z1J A;  3CFP A;  2BDP A;  3QNN A;  1L3T A;  4ZTJ A;  3AVJ A;  1EX4 A;  3OYC A;  4DU1 A;  2OYQ A;  4F3T A;  2A1R A;  3SNN A;  3S3M A;  4IFY A;  3VQC A;  4DTR A;  3WNE A;  1LWF A;  1U49 A;  2YNF A;  4OKJ A;  4I9Q A;  2X74 A;  3VQ7 A;  2EHG A;  1R0A A;  1VSD A;  4FW2 A;  2E6M A;  2NUB A;  5KI6 A;  3V9W A;  3CYM A;  1JLE A;  3K5M A;  4I7F A;  4FZY A;  2AJQ A;  3EY1 A;  3SYZ A;  3DLH A;  1C1C A;  4FM0 A;  1NK4 A;  1TK0 A;  2P1J A;  4M3U A;  2FBV A;  2GV9 A;  1RBV A;  1VRT A;  2BE2 A;  4R5P A;  4BAC A;  4DTM A;  3TI0 A;  4KHW A;  5CZ2 A;  4E3S A;  4DFK A;  4B9L A;  3LP0 A;  1S5J A;  4CJK A;  3P1G A;  3QES A;  1TL3 A;  4DG1 A;  4FJK A;  1TKX A;  3LAL A;  4OGE A;  3V1Q A;  4BE0 A;  3IG1 A;  2VWK A;  2X6N A;  4E89 A;  4CGJ A;  3RMA A;  1VSF A;  3VQD A;  3L2W A;  4FJG A;  4JRQ A;  3VQ9 A;  4CEF A;  1J9A A;  5KGW A;  1Y97 A;  4O4G A;  1VSL A;  4CIG A;  1A5X A;  4FJ5 A;  1NKB A;  3MAQ A;  1BL3 A;  3OS2 A;  3F73 A;  2WON A;  4CF1 A;  1ZBF A;  4DQS A;  1T8E A;  3IAY A;  5KRT A;  1ITG A;  3C94 A;  1BGX T;  2HHW A;  1NJW A;  4CJT A;  2O4G A;  2X78 A;  4Z4F A;  4KHN A;  2OPP A;  3MXI A;  3BDP A;  3SUP A;  2B6A A;  4E7K A;  1VSK A;  2IAJ A;  1JLG A;  4CE9 A;  1Q8I A;  3M8P A;  4CK2 A;  3TAG A;  3PX6 A;  4F2S A;  3IS9 A;  1A5W A;  4AHC A;  5FDL A;  1SKS A;  4IFV A;  4CHY A;  4BWJ A;  5J2M A;  1S9G A;  1TGO A;  3VQ8 A;  3AVL A;  3MXJ A;  1X9W A;  2DFE A;  1TL1 A;  4CGF A;  4HVJ A;  4FJ7 A;  4M41 A;  4OPJ A;  3CQ8 A;  1B9F A;  3DMJ A;  2G8U A;  3L3V A;  3ASM A;  3V4I A;  5C25 A;  3I0S A;  2G8V A;  4ELT A;  1BIS A;  1C1B A;  2FC0 A;  4KV8 A;  4CK3 A;  1SL1 A;  3M8R A;  1F21 A;  3AA4 A;  4M3T A;  1Q9X A;  4M3Z A;  3OVN A;  1JLA A;  3AO5 A;  5CY4 A;  2HHX A;  4CK1 A;  1HQU A;  3LWL A;  3UIQ A;  3NF9 A;  4FK4 A;  1LAV A;  2W42 A;  2OPQ A;  1C0T A;  1N6Q A;  3S3N A;  5FRO A;  1U47 A;  3LP3 A;  3ZT3 A;  3EZ5 A;  4KAZ A;  5HRO A;  4KB0 A;  4LY7 A;  4ID5 A;  4BDY A;  1TK8 A;  4K8Z A;  2FBT A;  4KTW A;  1ZYQ A;  3OYE A;  4KI4 A;  3VQ5 A;  4M42 A;  3C6T A;  4Z4C A;  3LP2 A;  3AVF A;  4CGD A;  3LAN A;  1TAQ A;  2FBX A;  3QIO A;  1X9M A;  1BI4 A;  1WNS A;  1KTQ A;  1O1W A;  3AO4 A;  1WSG A;  2RN2 A;  3C6U A;  1NJY A;  4KHU A;  3U6F A;  4CJW A;  2HVI A;  2KTQ A;  2XHB A;  2QXF A;  3OYI A;  3U3Y A;  3L8B A;  4ID1 A;  4N41 A;  3DLE A;  4DTN A;  2HHU A;  4KI6 A;  2BAN A;  4FYD A;  3V9Z A;  2D0B A;  3S9H A;  1IKY A;  1NK6 A;  4C8M A;  1UAX A;  3KKR A;  4Q0B A;  3M8Q A;  4E7L A;  4CF2 A;  2Z1I A;  5DMR A;  3NGZ A;  3NBP A;  4DQR A;  3QER A;  1UA0 A;  3LAM A;  3OYG A;  3TAQ A;  4W5T A;  3PV8 A;  4ZTF A;  1KVB A;  4CFD A;  4HUF A;  3SUQ A;  1IKV A;  2PY5 A;  4J2A A;  1WSF A;  5KRS A;  3S3O A;  3NGI A;  4HUE A;  4FJ8 A;  4CEO A;  2HHT A;  4CHO A;  3KLE A;  4B08 A;  3KTQ A;  4DLE A;  1HYV A;  1HJR A;  3PO5 A;  3AVM A;  1A5V A;  4C8L A;  4FLY A;  4DSE A;  3RRG A;  4BWM A;  2IOC A;  3VN5 A;  4DTS A;  2ETJ A;  1KRP A;  4TSX A;  1SL0 A;  2DFH A;  2YHA A;  1RT5 A;  2FBY A;  1U04 A;  4CHN A;  1KFS A;  4CEA A;  4B9S A;  5HRS A;  4LH5 A;  4BE1 A;  4F2R A;  1B92 A;  3NFA A;  2IS3 A;  2HB5 A;  4WE1 A;  3QLH A;  1Z25 A;  5HRR A;  5HBM A;  2KZZ A;  2LSN A;  5SWM A;  1CZB A;  2VWJ A;  3AVK A;  2HNZ A;  1JLB A;  4BDP A;  3OYA A;  4FCY A;  3RMC A;  4AIL C;  2OZM A;  2D5R A;  1UA1 A;  4H8K A;  3AA2 A;  4DSF A;  1L3V A;  2DFF A;  4E1N A;  2XY6 A;  4FJX A;  3O3G A;  4JS5 A;  1FKO A;  1S1W A;  3PX0 A;  5CYQ A;  3AVC A;  1YVU A;  3TAM A;  5C42 A;  3KJV A;  2GUI A;  4NCB A;  1KSP A;  4CEZ A;  4RW7 A;  4FJI A;  3NE6 A;  4N56 A;  1KCF A;  4HCC A;  4YNQ A;  4KHQ A;  4H4O A;  3AVI A;  4FLZ A;  3SZ2 A;  3JSM A;  3HST B;  4LD0 A;  1RBS A;  1REV A;  4IBN A;  3HPO A;  3SPZ A;  1NK7 A;  2VG6 A;  3ZSV A;  4E1M A;  3HM9 A;  4CGH A;  1WSJ A;  5E41 A;  3TAB A;  4Z4G A;  2E6L A;  1YT3 A;  1W0H A;  2GBZ A;  4YFU A;  3OYJ A;  3VA3 A;  4OLB A;  1FK9 A;  4AHT A;  1L3S A;  2HW3 A;  1TV6 A;  1RIL A;  1LV5 A;  4IDK A;  4KHS A;  2F96 A;  3CFR A;  1NK5 A;  1WSI A;  3VQQ A;  4B8A B;  2OZS A;  4G1Q A;  4CJL A;  3HP9 A;  4DQQ A;  3B6O A;  3EYZ A;  4DFM A;  4PWD A;  4CER A;  3PO4 A;  3VA0 A;  1L5U A;  3KK2 A;  4J2B A;  4CHZ A;  1VSE A;  4FM2 A;  3T3F A;  4MQ3 A;  3AO3 A;  1TVR A;  2EX3 A;  1LW2 A;  3IRX A;  4C8O A;  4F3O A;  4DTJ A;  4CHP A;  1QTM A;  2D0C A;  4FZX C;  1B9D A;  3DOL A;  4E7J A;  2XY5 A;  4FJN A;  4B9T A;  3SI6 A;  1KLN A;  4FK0 A;  3AO1 A;  1TK5 A;  3OYB A;  2P5G A;  3KD5 E;  1EET A;  3VQ6 A;  4DU3 A;  3RMD A;  3HK2 A;  4KTQ A;  1MU2 A;  1RTI A;  3I8D A;  3CM5 A;  2YNG A;  4HHT A;  4C8K A;  5KTQ A;  4F4K A;  4FZZ A;  1IKX A;  3LPT A;  4DWI A;  4ELU A;  4KRF A;  3OYN A;  4M3Y A;  1HNV A;  3G10 A;  4GMJ B;  4O5B A;  3CFO A;  1U48 A;  4CJ5 A;  1D9F A;  3KK1 A;  4ZHR A;  3M8S A;  1RDB A;  1QS4 A;  4PA1 A;  4O55 A;  5HRN A;  1LWE A;  3DM2 A;  4IKF A;  1QHT A;  4QAG A;  3OJU A;  1X9S A;  2WOM A;  3BGR A;  4I2Q A;  3QEX A;  3HPG A;  4C8N A;  2PYJ A;  2QK9 A;  2P5O A;  4JRP A;  3MED A;  3ISN C;  1RT3 A;  4FLW A;  2HNY A;  1W9H A;  2YHB A;  1RTD A;  4CES A;  2HHS A;  3VQA A;  5I42 A;  4LSN A;  1XC9 A;  4OLA A;  2XRI A;  4B8C A;  4CEB A;  3L2U A;  4I2P A;  3L3U A;  4RW9 A;  4J2D A;  1Q9Y A;  5T7B A;  3L2R A;  3RRH A;  2XY8 A;  4FLT A;  4NCG A;  4KTZ A;  4DTP A;  3SQ4 A;  4CJV A;  3NH2 A;  1HMV A;  1NKC A;  3RR7 A;  1DTT A;  2Z1G A;  4B9N A;  2HHQ A;  3QIP A;  3OS1 A;  3MEG A;  1SKW A;  3KD1 E;  1KFD A;  3ZSQ A;  3OYH A;  5JS2 A;  3KK3 A;  2BGG A;  1RDA A;  4GVM A;  4JS4 A;  1EXQ A;  1RBT A;  2QKB A;  1WLJ A;  4FJL A;  4LH4 A;  4ELV A;  2O4I A;  4NCA A;  1HYZ A;  3CM6 A;  3LPU A;  4OKE A;  3AA5 X;  4FJ9 A;  1RTH A;  2D0A A;  4N5S A;  3O3H A;  3PX4 A;  3SPY A;  4KB1 A;  4MFB A;  4CFB A;  1NK9 A;  4KPY A;  3DLR A;  3V1R A;  4QCL A;  3WNF A;  4FJM A;  4CGG A;  3PUF A;  3KLG A;  3OJS A;  1JL2 A;  5C24 A;  3TR8 A;  3ZT1 A;  1XWL A;  3I0R A;  3T19 A;  3H08 A;  1UOC A;  4E19 A;  4CFC A;  2IDO A;  4AHS A;  3QEI A;  3QIN A;  4FLV A;  1BIZ A;  4Z0U A;  3LAK A;  1JKH A;  4GW6 A;  3KIO A;  3PY8 A;  1NJZ A;  3SUN A;  1JLC A;  4CED A;  2G8F A;  3JYT A;  2ZQB A;  3NF8 A;  1C0U A;  3ZCM A;  1J54 A;  2DY4 A;  1IKW A;  3V1O A;  3O4N A;  4CIE A;  3RWU A;  3ZSX A;  1X1P A;  4RW6 A;  1FKP A;  4FVM A;  1JLF A;  4XIU A;  1D8Y A;  1S1U A;  4B9M A;  4KFB A;  4CJR A;  4AHR A;  3SQ0 A;  1RT7 A;  3QEP A;  4CJQ A;  5KGX A;  1QQC A;  5JS1 A;  4QOZ B;  5EU7 A;  4CIF A;  4W5N A;  2B5J A;  3CG7 A;  3NF7 A;  3SV4 A;  3V9U A;  1CXQ A;  1IO2 A;  1EP4 A;  1C0M A;  4CEC A;  1ASU A;  1EKE A;  1WSE A;  3K57 A;  2HHV A;  4O0I A;  4CJF A;  4CF8 A;  3DRR A;  3L2V A;  3K5L A;  4BDZ A;  3AVH A;  2RF2 A;  3B6P A;  4DF4 A;  3QEV A;  3SV3 A;  2G8H A;  3LP1 A;  1D9D A;  3K2P A;  5FRM A;  2Q3S A;  1T7P A;  1XI1 A;  1SV5 A;  3THV A;  1L3U A;  4FW1 A;  3ITH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...