1VRTA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 145
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vrtA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vrtA05
1CZ9A 1UWBA 3IS9A 3KKRA 3V1OA 1U49A 5DMRA 4AH9A 4NCBA 3KLGB 4ECYA 1QSLA 1C0TA 2YV0X 4B9MA 1RDCA 1SH2A 4F2RA 1IKYB 4DWIA 3OYIA 3HM9A 3G0ZA 1RA7A 2GBZA 3CVKA 1NJWA 1WSIA 2I5JA 1BHLA 4IFVA 1WLJA 2ZE2B 2OYQA 4ZTJA 3SQ2A 2OZSA 1RBUA 1YVUA 1JKHB 3KK3B 4DEZA 3C6UB 2KW4A 3RB4A 4QCLA 4IH7A 5KFEA 4FZZA 4MIBA 3AVIA 3KK1B 1XR6A 4NLWA 2UVUA 4HCBA 3VN5A 3H2LA 4QWEA 1REVB 3V81B 2YKNA 4FJMA 3JSMB 4MFBA 1RDDA 1ASWA 4I9LA 1NNDA 3OHBA 4ED1A 2O4GA 3QEWA 3GYNA 4W5TA 4FLWA 1CSJA 2VWKA 4RNHA 4F4WA 3AO1A 4DSEA 4O3QA 1EETA 4GVMA 1WN7A 3BDPA 1TK5A 2BANB 1KHWA 1IH7A 1NKEA 4RW8B 3VQ4A 4TLRA 5EU7A 4ED2A 4BDYA 1C1CA 3EY1A 5HRPA 2YNGA 2ZKUA 2NUBA 4B8CA 3QIPA 2R2UA 2CKWA 3HVAA 4J2BA 5F8GA 4LSNB 1LV5A 4F3OA 4NLUA 1JLFB 4B9NA 4B9TA 1TAUA 4E1NA 4RW7B 1XI1A 4U6PA 3KHHA 5KFZA 1LWFA 4YQWA 3LALA 3OYJA 4DG1A 2X6NA 4B8AB 4BWJA 1O1WA 3IGVA 3T5JA 5CZ1A 3CJ3A 3IRXA 4RZRA 4W5OA 3LANA 4CESA 4FBTA 5DG7A 1EP4B 4EP4A 3DLGB 4FJXA 3CO9A 4ZHRB 2HNYB 3OJUA 3HHKA 3V9SA 4CEOA 1IKXB 2D7SA 3G10A 2AGOA 5HBMB 4KO0A 4M3ZA 4PA1A 2HW3A 1XHXA 3NDKA 4O3PA 3GIIA 5KGXA 2HVIA 3MFHA 2FVSA 3SQ0A 2X6SA 2KFZA 3S3MA 1DTQB 3KLFA 3OL7A 3BJYA 2IM1A 2IJNA 4ECSA 3V9ZA 3QEXA 4U7CA 1EKEA 3NF8A 4AILC 2HHSA 1VSJA 2YNIB 4DQQA 1CZBA 1WSEA 1JL2A 4KI6A 4O55A 4ZTFA 4IG3B 1N4LA 4Q43A 5F8HA 4TXSA 5KFGA 2C2DA 3K5OA 3RTVA 2WONB 4IQXA 4KHQA 3LP0A 2UVRA 2ZQBA 1BI4A 3AVKA 2FLNA 3PJXA 3VQEA 1NJZA 3TAFA 3KTQA 3ZSWA 3BQ2A 3M8PB 3PX0A 5F8MA 4NLSA 5C5JA 1TKDA 4E7LA 5KFAA 2QXFA 1WSFA 3DRSB 2GIQA 3HPOA 4FJ5A 3NF9A 3LWMA 2OZMA 4ZVEA 3PX4A 1QAIA 3K59A 5J2PA 1KVBA 3KK2A 3QLHA 3I0SA 4DTJA 2IGIA 4NYZA 2AWZA 4K8ZA 4FCYA 2XGPA 4KFBB 1NK0A 2ILYA 2XI2A 5KFRA 4RNFA 5KT3A 3S9HA 2QKBA 3V9UA 1ZBLA 1LW0A 2B6AB 3ZSQA 1T3NA 2R8IA 2V4QA 2PY5A 4EEYA 2RKIA 3IGNA 1LWCA 2XWYA 2R8KA 1VSEA 3NCIA 3C6UA 2A1SA 3DOLA 4K4TA 1Q9XA 1S0MA 4C8MA 5KG6A 1TK0A 3OYBA 4FJKA 4KSEB 3KLEB 4CHNA 4C8OA 1WSGA 3C6TB 1SKRA 4KHMA 3L8BA 2BRLA 2HNZB 1QSSA 2AQ4A 2OA8A 4L8RB 4CGJA 4EO8A 2HHQA 3OL6A 3H5UA 2Q3SA 1WSHA 1QE1B 2VG5A 4CF0A 5KFYA 4ZP8A 1KFDA 4CK3A 4YR2A 4RG8A 3DLKA 2F8EX 2FBVA 1LAVA 1Z25A 3CYMA 2G8UA 1S0OA 4CEQA 4F2SA 1ZBFA 3H5YA 4K50A 4K4SA 3T5LA 2YNFA 2E6LA 3KNAA 4BDZA 4ZP9A 4TYAA 1NHUA 4WFXA 2E9TA 3LAMA 3NHGA 4CHYA 4CJTA 3Q8QB 3KK2B 3V1QA 4KTZA 1U48A 1CLQA 3RMDA 3H40A 4FBUA 3M9OB 4LSLB 2FVRA 3G6VA 4DU1A 2WB4A 3RBDA 1JLFA 4RUAA 4HVJA 5F9NA 1A5XA 2AX0A 4NCGB 1N56A 4I2QA 3AVNA 1KHVA 4JUZA 5J2QA 2OPRB 4PY5A 4EZ9A 1S9FA 3L2UA 4R0EA 3BQ0A 1HNVB 4FJ8A 5KFVA 2DFHA 2IAJA 2FBYA 3PUFA 2Z1HA 2AGPA 3KLHB 2FJXA 4Q0BA 3M9NB 3NH2A 5KG7A 3T5HA 4URSA 3QINA 2HMIA 1HQUB 2QKKA 3VQDA 1ZBHA 1S4FA 5DGBA 3AA4A 1JIHA 5DG8A 4BE2A 1YTAA 4CECA 5K14B 4CHOA 4LH5A 4F8RA 1C0MA 3KLIB 4O3SA 4DF8A 3ITHA 1RCHA 3H98A 1RNHA 5KTQA 5F8NA 4CF2A 2J6SA 4J2EA 4WFZA 4IRDA 4CFAA 4I9QA 4KB0A 3RMCA 2F8SA 1CXQA 4CJWA 3HVWA 3O3HA 3DLRA 1TQLA 3FQKA 2UVVA 1TV6B 3ALYA 4ZP7A 1TK8A 1GOBA 4KB1A 2ITGA 2FVPA 1JXBA 1KLNA 4FW2A 2KTQA 5KFIA 4OL8A 4FJIA 1BGXT 4NCGA 3GIJA 1G15A 1NHVA 1S1XB 3V6DB 5FRNA 1UWBB 5HBMA 3C95A 4FW1A 4XIUA 1KVAA 5K14A 3VQ6A 4ZHRA 3M8QB 5J2MA 4QWCA 5KFQA 1MU2B 2WTFA 1RDBA 1C0UB 4NYFA 1MU2A 2D3ZA 4DL4A 4DTUA 4Q5VA 1HQEB 1R0AB 4WFYA 3ZCMA 3I0SB 4R5PA 4Y2CA 4IFYB 1W9HA 4FS1A 4AHVA 4I2PB 2AJQA 4N56A 3QO9B 1XR5A 4ID5A 4IDKA 4B9VA 1GX5A 2JC0A 4FJ7A 2XCPA 3Q8RB 1L3TA 3LPTA 3CFPA 4KPYA 2XY5A 1C1BB 3VQSA 3RAQA 1B9FA 4CJPA 2VA3A 4E7KA 4NZ0A 5SWMA 4CJ3A 2UVWA 4HYKA 4CGFA 4JS5A 4KTWA 3EZUA 4M3TA 5I3UB 4IG0B 1S9GA 5C42B 3UPFA 3IS9B 2P51A 3DI6B 4NLRA 1EP4A 4KREA 1T7PA 3CQ8A 3PW2A 3NGIA 1LAWA 5DG9A 4N41A 5KFWA 3BSAA 4FS2A 3VQCA 1BQMA 4ECTA 5J2MB 3JYTB 4FJ9A 1RTJB 2E4LA 4JV0A 5EDWA 2F8TA 2RF2B 1TKXB 3OYAA 2RF2A 1J9AA 2YHBA 3TAGA 1HPZA 5KFFA 5KFPA 3DLBA 3VQBA 2YNGB 4TYBA 3ZSVA 3HVRA 5F8IA 1JKHA 3NAIA 2X78A 3AVMA 1CXUA 4FK4A 1KVCA 4CEZA 3PVXA 3CJ5A 2R2RA 3CJ2A 1Q9YA 2D5RA 4WE1A 5KT4A 4FLYA 3LPUA 1UA0A 5C25A 2KZMA 3U3GA 4EYHB 3IRXB 4J9LA 4ED6A 3OYEA 3DOLB 3PR5B 2ZD1A 1RT6B 2OH2A 4KHYA 5HRNA 1TL3B 3NAEA 4F4YA 4O3RA 1D8YA 1A5VA 1KTQA 2WOMA 4ICLB 4QW9A 3IAYA 3HP9A 1S10A 2FBXA 3H5SA 4ECZA 3KHGA 2D0AA 5KRTA 1FXXA 3K2PA 1SH3A 4K4ZA 2EHGA 5EUHA 4QPXA 2BDPA 4JRQA 4F4ZA 1JXEA 3KLFB 3QNNA 4RW9A 1NK9A 4J9QA 3MR6A 3WNEA 5J2NA 1D9FA 4K4VA 3DYAB 4DS5A 3CDUA 2OPSA 3PY8A 4K4YA 3H5XA 4PWDB 5FRMA 3ZT4A 3D28A 5C25B 1RT4A 3MEDA 1S48A 3RBEA 1IKXA 2LSNA 3QNOA 1EXQA 1F21A 4OGCA 3RRGA 4KV8A 2B4JA 3LP0B 4CJLA 4CIGA 4KHSA 3HO1A 1TVRA 4J9PA 2JEJA 3MAQA 5KG5A 4RU9A 4YP3A 4O0IA 2BGGA 1XHZA 4RUCA 4KBIA 3OS0A 3DOKB 1QS4A 2WOMB 1ASVA 4CF1A 4G1QA 3MEGB 4ZPDA 5DQGA 1RT1A 1S1WA 2AGQA 3DLKB 1JLAA 1RT7B 1JLEA 4MKAA 3EPGA 2IC3B 1Z26A 3VA3A 4DSIA 4FYDA 1HNIA 5D3GB 3HVTB 4B9SA 3FSIA 4J9KA 5J2PB 1NKBA 1X1PA 4DL3A 3JYTA 4NYNA 3TWHA 1L5UA 3AA2A 3TQ1A 3AO3A 5KG3A 1I3AA 1SV5B 1TP7A 4O44B 1J53A 4URQU 4ED3A 3ZT0A 4RNOA 3FQLA 4O44A 5J2QB 3NKYA 2P5GA 1FKOB 4O5BA 2HNYA 4ELUA 2V9WA 5FROA 3SUOA 3HKWA 1HYVA 4GW6A 2HNDB 1FK9B 1DLOA 4F50A 1LWFB 4HKQA 2Z1IA 3D5MA 4QWAA 2BQRA 2G8VA 4DG1B 5KFBA 4I2QB 5DQHA 4FJLA 1D1UA 4NLOA 3CJ0A 1FKPA 1RBVA 3PJWA 1JLGA 1S5JA 3OYCA 1U45A 1VSDA 2V4RA 5F8JA 1RT6A 5EWGA 3ICLA 4R8UA 3HPGA 4TY9A 3D0PA 2E9RX 2BR0A 1RAJA 1Z4UA 4H4MB 1C1CB 5KT2A 1XC9A 2RPIA 3O3FA 4RW8A 2IM2A 1T05A 3ZSXA 3KK3A 4ECUA 2R7YA 2WCXA 2R8JA 1VK0A 3TVKA 2JLEA 2OPQA 1JLQA 4WYWA 4IR1A 3L2VA 1JXLA 3K58A 3U3YA 3LZIA 4LY7A 3CFRA 4DF4A 3OLBA 1RBRA 3KJVB 3BSNA 4OLBA 4FJHA 4EZ6A 2KFNA 4MKBA 3VQPA 4R5PB 1VSFA 1S1VB 2QV6A 1TV6A 1RT2B 1DTTB 4CE9A 2C28A 1XWLA 3QO9A 2W7OA 4DLGA 2YHAA 4C8NA 1N6QB 3DLGA 2RDIA 3LWLA 1RTIA 2KZZA 5CYMA 4CCHA 1RT1B 3CIZA 1C2PA 2W9AA 4CJRA 5FDLA 1TL3A 4HTUA 4W5NA 2HNDA 2RN2A 4CEAA 3OL9A 3EPIA 3VQ9A 4CK1A 3OYKA 4G1QB 1TVRB 1TAQA 4IKFA 3S3NA 4DMNA 2V0NA 3RMBA 5F8LA 3M8RA 1VRUA 1IG9A 3V6KA 4TQRA 4M45A 1NK6A 2EX3A 3HK2A 4DQPA 3DRRA 1QE1A 3VQ8A 4DQIA 1NJYA 1EETB 4CEDA 1NOZA 3QEIA 5CZ2A 4CHZA 2XC9A 2UUTA 2W9CA 3QIDA 4E89A 5T7BA 3LP1B 2JGUA 1LWEB 3MXJA 3TAQA 4PWDA 3PO5A 1RTHB 3KMSA 2JEIA 4CERA 1UOCA 1LWCB 3S3OA 5KG1A 4CIFA 2G8HA 4QWBA 3DMJB 5L9XA 1L3VA 2YKMB 5KG0A 5DGAA 5KFDA 1HYSB 5HLFA 5CYMB 1RYSA 1J5OB 1RT2A 4MK7A 4KV8B 4FK0A 3TR8A 1K1QA 4CEBA 2W9BB 4OKKA 3V6DA 3TAEA 1S9EB 4HHTA 1GOAA 4HUFA 2D41A 4M41A 3U6FA 2GUIA 3HYFA 3PW7A 3PR4A 2HHXA 3AO2A 4O4RA 4FJNA 3LP1A 1ZTTA 2BE2A 4H4MA 3IG1B 3QERA 1JX4A 4ZMMA 4I7FA 1YT3A 3SNNA 1ITGA 2FVCA 3BGRB 3CDEA 5CYQB 5KFCA 3T19A 3NGYA 3SPZA 4MK8A 3HXMA 3P83D 3OYFA 4F4KA 2WONA 3OSNA 4CGDA 1S6PA 4KHWA 2ZD1B 4XPCA 1RDAA 3V6HA 3RAXA 3QZ8A 1RBSA 3PZPA 4OJRA 3SI6A 3LP2B 3UR0A 5KFJA 4N47A 4QAGA 3SUQA 3QEVA 2ETJA 4RW6B 2ILZA 2YNHB 3SV3A 2ATLA 2O4IA 1RT4B 4WXOA 3HP6A 4ZVHA 1TL1B 5C24A 2E6MA 4M94A 4CJFA 3L3VA 3V9WA 3DI6A 1ZETA 4Z4IA 3NBPB 2JC1A 2I5JB 4Z4HA 1S97A 4AHUA 3SYZA 3IG1A 1X9SA 5KT7A 4CJQA 3GIMA 5EWEA 1QSYA 3D45A 1ASUA 1HRHA 1HYZA 4DL5A 5KFKA 4PQUB 4NLDA 3HL8A 4EBDA 4OVLA 4IKAA 1YVFA 1JLAB 1C1BA 4I2PA 4JV2A 2FJWA 3B6OA 1SL2A 2C2RA 1NK8A 4O4GB 4ID1A 4CEFA 2R8HA 3OL8A 4YNQA 4KB7A 1RA6A 3L2WA 3SZ2A 4Q44A 1FKPB 4ZVGA 3V4IA 4CGIA 4DLEA 5DLFA 1ZBUA 4CFBA 4B08A 4O0JA 4FLXA 1X9WA 3KD5E 1SKSA 2R2TA 3ZSZA 3AVFA 3KKSA 5KFNA 3RMAA 2G8WA 4DU3A 3K5LA 4ED7A 2BQUA 2PZSA 4Z4FA 2AX1A 1S1TB 1D9DA 4E0DA 3G86A 2W9BA 1SV5A 2P5OA 1JLBB 3HVTA 4O3OA 4CIEA 1KCFA 2KQ2A 3CG7A 4KTQA 1OS5A 4RW9B 1T05B 5KGWA 3TAMA 5DK5A 3CFOA 3AVCA 4FLVA 1VRTB 4H54A 3QIOA 3ZSYA 4XO0A 4Z0UA 4NCAA 4DQSA 5KFMA 3B6PA 4E7JA 1QUVA 2YNIA 3T1AA 3M9MB 2HHUA 5HROA 4FLTA 5L1LA 4E3SA 4WZQA 1KFSA 4E1MA 2WRMA 1L3SA 1UA1A 3NAHA 3KD1E 3NE6A 3C94A 4EBCA 4KI4A 1N5YA 4GC6A 2VG6A 2C2EA 4N76A 4HUEA 4FVMA 3T5KA 1HNVA 4RW4A 3DLEB 1VSIA 4Z4EA 1HJRA 3RR7A 3SUPA 3QGIA 3OYMA 3ISND 2J6UA 1JL1A 2J6TA 3AVAA 4ECQA 3HSTB 1GOCA 3DRSA 4DQRA 2XY7A 2B5JA 4YR3A 3NGDA 1VRUB 1NK7A 3HT3A 3NBPA 1SKWA 1K1SA 3MR3A 3F73A 4R8UB 4Y34A 3AA3A 1VSHA 5KRSA 2B43A 3QZ7A 4DS4A 1R0AA 1BQNB 1SH0A 2R8GA 4IG3A 4RNNA 4B3OA 4W5QA 2DPIA 2YNFB 4J9MA 3V4IB 3AVBA 5CY4A 1TKZB 3DM2A 5F9LA 3LAKA 4B3OB 4RW7A 3QIPB 3AVLA 1UAXA 5EWFA 4LH4A 3CM6A 3BSCA 2XI3A 1SL1A 1N48A 2IA6A 5HLFB 1SUQB 1REVA 1RDRA 4DL6A 4NLGA 3KMQA 3NMAA 2AU0A 5I42A 3GV5B 3KK1A 4OPJA 3DYAA 4E7HA 1VSLA 5JUMA 4WE1B 1KLMA 1TKTB 1T03B 4O3NA 4C8LA 1Y97A 5KT6A 1S1TA 3K57A 3DLEA 1T03A 3ASMA 1IKVB 4Y3CA 2OPRA 4ECXA 3SQ1A 3NL0A 5C24B 4CFCA 4M3XA 4HUGA 3SI8A 1RT5A 4Q8FA 2FJVA 4KO0B 4M95A 3GV7B 3I5CA 4FM0A 4OLAA 2IBKA 2OPPB 1U4BA 4JLHA 4C8KA 4FJJA 3MXIA 3H08A 4CEEA 4Z4GA 4TY8B 3GIKA 2C22A 4JS4A 2HHVA 2D0BA 5L1KA 2Z1GA 1FK9A 3MR2A 3O3GA 5HROB 3TARA 4ZVFA 2ZE2A 3KLVA 1RTDB 4AHCA 4CGHA 4DTSA 3TAPA 3CJ4A 4I7FB 4DL2A 1S1VA 3CM5A 2FBTA 3ZSRA 1S1XA 1S9GB 1C1AA 4RNMA 1QQCA 3P5JA 4EYIB 2QE5A 4NLVA 4M3RA 3OY9A 3C6TA 3MEEB 3P1GA 2PYJA 4FLZA 4CF9A 5L1JA 3E51A 3KLHA 4IG0A 5HP1B 1IKYA 4TN2A 4DTPA 2W7PA 2BQ3A 1HNIB 3KHLA 3G6XA 3THVA 4Q45A 4QOZB 3DRPA 1TKXA 4RW4B 5JS2A 1KLMB 3AO5A 3F9KA 3I0RA 4H4OA 4IFYA 5KI6A 5L1IA 2YNHA 4FZYA 2FC0A 1BCMA 3GQCA 4MK9A 4ID5B 3SQ4A 4DL7A 4K8XA 4K4WA 1C0UA 4YMEA 1WAJA 3KOAA 4ZPBA 3K5MA 2ASLA 3EYZA 3DLHA 3PO4A 3KLIA 4ELVA 1RT5B 2FLPA 1DTTA 2RDJA 4J9NA 3NH1A 4W5RA 5J1EB 3Q8SB 3DMJA 1TGOA 1IKWA 3OSPA 3SUNA 2OPSB 4IH6A 3GILA 1MMLA 4ZPAA 4DFMA 1T94A 3MEEA 3RB3A 3MF5A 1B92A 3V1RA 1D0EA 2FVQA 5SZTA 5HP1A 1YTUA 2IAJB 2G8FA 2R2SA 2VG5B 3KIOA 4X2BA 1BISA 3OS2A 2GV9A 4J9RA 1RT3B 3RB0A 2G8IA 2A1RA 2HNZA 1L3UA 3TI0A 4FLUA 4OKJA 4KKOB 1T8EA 1IM4A 3OLAA 5KG4A 3BR9A 4CHQA 4DSFA 4IOBA 1D5AA 2VA2A 3NFAA 4IH5A 4NRTA 3ITHB 4PQUA 1BQNA 2W42A 1WNEA 4TSXA 3BGRA 3ULDA 1LW0B 3MTKA 4FK2A 1S49A 2ASJA 3SFUA 1JLCA 1K6YA 3NH0A 3LDSA 1HMVB 4DU4A 3LP3A 3NF6A 5KG2A 3AVGA 3H4DA 5KFOA 2XO7A 3QEPA 5T14A 1DLOB 4BE0A 4DTMA 3T3FA 2EC0A 1WSJA 2GIRA 3LZJA 5KT5A 5J2NB 3MEDB 4H8KA 1WAFA 1ZYQA 5HRSA 4KAZA 1BL3A 4CJUA 3WNFA 5KFUA 1C0TB 4JRPA 3JSMA 1BIUA 2HB5A 3IN5A 4CJ5A 2I1RA 3QETA 4BACA 3N6LA 3E01A 2HAIA 5D3GA 4ICLA 3VQ5A 3FFIB 3L2RA 4K4XA 4WYLA 4MQ3A 1J5OA 4DFJA 4KKOA 3OHAA 1RT7A 3SJJA 4N5SA 2HWIA 2OPPA 2HVHA 1C6VA 4QW8A 4MIAA 3DOKA 3FRZA 3H4BA 3WNGA 2O5DA 4LSNA 3M8SA 1Q8IA 4AHTA 4J2DA 3RWUA 1J54A 1U47A 4O4GA 3NGZA 1FKOA 4DSLA 3QLHB 2DY4A 4NLYA 5CYQA 1LWEA 3VQAA 3A2FA 4F3TA 1HARA 2ALZA 2XY8A 4DFKA 1LW2A 3UIQA 3FDSA 1LW2B 4DTRA 3ISNC 1BCOA 3DDKA 4DTXA 3V81A 4IR9A 3V9XA 1I6JA 1ZBIA 2Y1JA 3OJSA 4CGGA 4AHSA 3FFIA 3MECB 2IM0A 3UDLA 4NLTA 4HCCA 1RTJA 3AV9A 2VG6B 4IRCA 4LD0A 3Q8PB 3AVJA 3AO4A 1S0NA 1HQEA 4NLQA 2HWHA 3QGHA 3RR8A 3K5NA 4J2AA 4WZMA 4TY8A 3QESA 5JS1A 2DTUA 5JXSA 2G8KA 4KFBA 2B5JB 3DRRB 4EO6A 3BQ1A 2W8KA 4J9SA 1RBTA 4FM2A 4IBNA 4FM1A 3KJVA 2ASDA 2VG7A 3KLEA 2W9CB 3O4QA 3WNHA 1TKTA 1ZTWA 3VA0A 5I3UA 4DFPA 1QAJA 2IDOA 2XRIA 5KFSA 1NK5A 3PV8A 4CF8A 4FXDA 1TL1A 1W0HA 4KRFA 4Y2AA 4OKEA 4J9OA 1NOYA 3I5AA 4MFBB 3M8PA 1BQMB 4RW6A 1S1UA 3OVNA 2QK9A 1U04A 2X74A 4NLPA 1NK4A 3M8QA 4KAIA 3ZSOA 3E01B 4DSJA 4JV1A 5C42A 5KFXA 2HMIB 4GMJB 3MECA 4Q8EA 3PW4A 5HRRA 1X9MA 4ED0A 3L3UA 3PW5A 3SV4A 2DFEA 4WXWA 3SFGA 3ZT1A 3DRPB 3TAMB 2GC8A 4GC7A 2CJQA 1RTHA 3KHRA 3RB6A 1JLQB 4FZXC 4BE1A 4PUOB 4Y1CA 3CWJA 4E19A 3VQ7A 2OPQB 4NLXA 2WHOA 2IMWP 4IRKA 5E41A 3BSOA 4CJKA 3SPYA 5I42B 4M3WA 3OYLA 1QTMA 4FJGA 1SUQA 4TQSA 2HHTA 1RTDA 4YFUA 3I8DA 4UQGA 4F4XA 1BI4B 4AHRA 4KE5A 4LQ9A 4LQ3A 3KLGA 1S6QA 4CHPA 2XY6A 4B9LA 2ATQA 4KHNA 4KHUA 2E9ZA 4NRUA 1RYRA 4CJVA 3H59A 1JLEB 4ECRA 1IO2A 2DPJA 1DTQA 5FDLB 3I5BA 2D0CA 4EBEA 3MEGA 3I0RB 4H4OB 3MR5A 1BIZA 4G3IA 4CK2A 3G6YA 4E7IA 2IS3A 1KRPA 4M3YA 3EZ5A 2Z1JA 2BE2B 1VRTA 3ZT2A 1JLBA 3OS1A 4DSKA 4Z4CA 2HHWA 4CJSA 3GV8B 3BREA 5DQIA 2D3UA 4URGA 3O4NA 3CDWA 2IC3A 3L2QA 4Y1DA 1VSKA 5KFHA 1HMVA 2PYLA 4PUOA 4ZPCA 2FLLA 1QHTA 4BDPA 1NJXA 5J1EA 2WK4A 2P1JA 4LSLA 3OYNA 3QGGA 2UUWA 4XPEA 2JEGA 4CJ4A 1GX6A 3QYYA 3PW0A 3TABA 2B6AA 1RTIB 1XR7A 1RILA 4ZP6A 3OYDA 1JLGB 2RKIB 3SCXA 1N6QA 4DTNA 4ELTA 4BWMA 3TANA 2IJFA 2DFFA 1S1WB 1S6PB 1S1UB 4K4UA 2IOCA 2W8LA 2YKMA 2F96A 3PX6A 2IM3A 1RT3A 3V6JA 3AVHA 3UQSA 3HJFA 4EP5A 4QWDA 3PHEA 1B9DA 4Q0BB 4M42A 3ZT3A 1NKCA 3OYGA 1HQUA 1IKVA 1S9EA 4CFDA 1EX4A 1WNSA 2JEFA 4CJEA 4IFVB 4MH8A 5KFLA 3MFIA 4ECWA 1VSMA 1KSPA 4OGEA 2BANA 2VG7B 4IDKB 1W25A 3HPHA 4ECVA 1I39A 1TKZA 1IKWB 3DM2B 2VWJA 3MXMA 5KFTA 3N6MA 4ED8A 1JLCB 4B9UA 3OYHA 1HPZB 1SL0A 2Y1IA 3RRHA 3AA5X 3NF7A 3N6NA 1A5WA 1U09A 2BRKA 1HYSA 2XCAA 4OPKA 2XHBA 1N5YB 4YR0A 3VQQA 5DLGA 4M3UA 4KHRA 3LP2A 4DTOA 2YKNB 2XGQA 1S6QB
chains in the Genus database with same CATH superfamily
5AQLA 1UWBA 3IS9A 2CFXA 2YWKA 2K1RB 4A46A 3V1OA 4ILHA 1KC8O 1RB0A 1U49A 2DNNA 3JSYA 4AH9A 3KLGB 2MKSA 1C0TA 1IBMF 2YV0X 1K9MO 1MWKA 4N8OA 3THWB 2BOPA 3CVKA 1BHLA 3ZX3A 4OZ0A 2LECA 1Q53A 4OYIA 2ZE2B 2OYQA 2F3JA 2W41A 5MLCQ 2XMAA 1YVUA 4JI8K 2CNNB 1JKHB 2D4WA 3C6UB 2KW4A 3HF5A 3MAHA 4DV0K 1MWYA 1H7XA 4IH7A 2Q0RA 3C14A 1LQ9A 3AOAA 2MY8A 3IBCB 4A8XA 3MPVA 3BPDA 3RGIA 4K43A 4NLWA 4OJGA 1OVQA 2LA4A 1O5JA 3Q8VA 1WHXA 4QWEA 1NU4A 3HRGA 4K5RA 4MFBA 1ASWA 2C3OA 1AROP 2B4VA 3QWUA 2FB0A 3J81U 2O4GA 3QEWA 3GYNA 4FLWA 2RQCA 5TKYA 1EETA 1WN7A 3BDPA 1KHWA 4RW8B 2ZH7A 4DUYK 4ED2A 4BC4A 5ADZA 1C1CA 3EGVA 5THWA 3EY1A 4NXNJ 4NXMJ 1ESVA 5HRPA 2YNGA 2ZKUA 2NUBA 5KOWA 3QIPA 2R2UA 4IJNA 3QJPA 4NLUA 2Y1RI 3RAMA 1Y4ZB 3TA0A 3PSFA 2WAQD 5KFZA 1GLCG 3TVYA 3LALA 4LIWA 2X6NA 5B0EA 4AUKA 4BWJA 4B3MF 3LDLA 1EIYB 4RZRA 4JI2F 1ZM2A 1EP4B 4EP4A 4AE5A 1ACMB 2GTDA 4DV0F 1IQZA 1XNQF 1NZ8A 4ES2A 3HHKA 4CEOA 3NGSA 4YOWA 1ZM9A 2ADCA 4X64J 1MW7A 1FFWB 3NEKA 1LOUA 4M5HA 2HW3A 4Z7CA 3GG4A 3U1MA 1RFQA 3FR0A 3U8XA 2LQJA 2ROGA 2ERRA 3PKMA 2YCHA 2CQ2A 2IM1A 4ECSA 3V9ZA 3QEXA 1H0HB 1Y7PA 2HHSA 3OA9A 3GR0A 2YNIB 4BROA 4TU9A 4O55A 4ZTFA 2E88A 2FC9A 3THYB 2O8BA 1SVDA 4CNYA 2GX8A 2E1RA 1NGFA 2JWLA 4UY8O 4IQXA 1ZXOA 3LP0A 2UVRA 4LF7J 2O01C 2DNKA 3HSJA 4LF5F 1WHYA 1LK5A 4C3KA 4AL5A 1K8AO 3M8PB 4HH1A 2CGJA 4BVOA 4ES3A 4NLSA 1TKDA 2HFUA 2WB1D 2QXFA 3QJJA 2BM1A 3MOZA 4X4VA 3A0IX 1AUDA 2F8HA 3MN6A 1T9WA 3NF9A 3UD3P 2J0SD 1QAIA 4NZ7A 2XMKA 4RUBA 2AWZA 2QYGA 3LDNA 4KFBB 2Y1LB 1JK9B 4DR5K 2XI2A 1OIAA 5FJ4A 2N3OA 4RNFA 5KT3A 3S9HA 3Q22A 2Z2ZA 1LW0A 2A41A 4NB4A 4KGXB 1HPMA 2R8IA 2PY5A 3PIPQ 3ILIA 3BO3A 1GLBG 2XWYA 2HLUA 2R8KA 4K4TA 1Q9XA 4FF3A 3E9PA 4C8MA 3TU5A 4KSEB 5JVGL 3VHQA 1WTFA 3AD8C 2XBPA 3A3OB 4CHNA 1WSGA 3C6TB 3CB4A 4KHMA 4LF8J 4YDUC 1CLFA 3E1YA 1M0SA 4L8RB 2DITA 4WU3A 4M5GA 1MROB 5M2RA 5CHCB 2EKYA 1T3VA 4ED4A 5KFYA 4ZP8A 4RUHA 3DLKA 4WP9A 2MXYA 2G8UA 1ZZNA 1RKJA 4ES1A 3R5GA 3ZNUA 3L95X 1BUXA 3H5YA 3W2WB 4K50A 5FLXO 3T5LA 3ZNJ1 3KNAA 4WU2A 3LM2A 3LAMA 2MQPA 3NHGA 5B0GA 4KTZA 4YUDA 2QA4G 1CLQA 3M9OB 2J8AA 3RBDA 1E6YA 3MURP 2AX0A 4NCGB 5FLXY 2KI2A 4BRIA 1KDNA 4KGKA 3AVNA 2LU2A 4K0KF 1CULB 2XLKA 4J9VA 2PDAA 4JUZA 3MX2A 2XZWA 4PCQA 1S9FA 3L2UA 4R0EA 4ISGA 3BQ0A 2FBYA 1FJ7A 3PUFA 3JAMY 2Y0SD 2PSZA 2FJXA 3M9NB 4PXEA 3O2IA 3KG0A 3T5HA 1HQUB 1ATSA 2AP6A 5DGBA 5JJBA 3C65A 1YJWN 4JN4A 5B0BA 4CECA 3G2XA 4YY3K 4O3SA 2AMCB 2KG0A 4DV5F 3WQUA 2F8SA 3K7RA 3TW0A 2HQGA 4JI8J 3HVWA 3JB9k 4ZA1A 3G6EN 4HACA 3IDHA 1U2VB 2XO6A 4ZP7A 1TK8A 5M1FA 4O5FA 4KB1A 4JV5J 3I56S 1M90O 3OUYA 3AXKA 3T1HJ 1BGXT 3EGZA 1FJCA 3M4XA 2A6AA 1B7FA 2H48B 1NHVA 2HQIA 3V6DB 4QQBA 4X62J 3C95A 1OY6A 2MY7A 4ER8A 4I6AA 3CQYA 4ZVQB 4IOAL 1RDBA 1X4DA 1MU2A 2N3LA 1WC3A 2P9NA 4Q5VA 1HQEB 5ETTA 4WFYA 3ZETA 3THXB 4LFAK 4AHVA 4FS1A 4I2PB 2AJQA 5DM6Q 4ID5A 1GX5A 2B9EA 2KDOA 2DNHA 4FJ7A 3ZZPA 3Q8RB 2E2PA 5J1NA 5ADXA 4B3SK 3TTFA 5A2QO 2E2OA 4JV5K 3VERA 4C7QA 4MTPA 4AQYK 4ILJA 3OFGA 3MCAB 2DHGA 4LUBA 1TUYA 2UVWA 2HVZA 3F41A 3EZUA 2WUSA 4L6V3 3ENHA 3MPDA 3MCMA 3UPFA 3C6AA 4ITSA 2A5XA 2WSCC 2DNQA 4NMLA 1T7PA 2DVIA 4RPFA 5KFWA 2HBZB 2N4DA 3VQCA 5J2MB 3JYTB 2BX6A 1KONA 4JV0A 1TKXB 5AFUH 1X4CA 4MKYA 1NGGA 4DR6K 3AJ1A 1PO6A 4X4TA 5IT9U 4B3MJ 1R8CA 3TAGA 5KFFA 4J9UE 4CLFA 5KFPA 3DLBA 3VQBA 2LEBA 5F8IA 4L74A 1CXUA 3FZFA 4FK4A 4HL9A 5A0YA 3T1YJ 1J6ZA 4CEZA 3BN7A 4KBOA 4WE1A 5KT4A 2HZCA 4FLYA 1UA0A 5AXKA 2WW8A 2IIHA 3PACA 3CCTA 1RHRB 3EZOA 3OYEA 3DOLB 2FHJD 3UDEA 5F0XA 2G2ZA 1TL3B 1KOOA 3NAEA 5FD1A 4CT8A 3TZYA 1FD2A 4O3RA 2B51A 2NXJA 2XYPB 2LXUA 3NNHA 1Y10A 3HP9A 1S10A 3KG4A 3WEEB 1F2HA 1HQ2A 2LQ9A 2L9NA 4ECZA 1FXXA 4IZ9A 4JI0F 2MQMA 4K4ZA 2P9SA 4WQ5C 2ZBIA 5CZXA 5M2PA 1OQ6A 2J7UA 2ZJPL 3QNNA 4RW9A 2JLFA 5EVZA 2QZ8A 1N5VA 5J2NA 2W01A 3A1YG 1RDUA 3DYAB 2YWEA 1I51B 2EFOA 2A2CA 3CDUA 3MM5A 1YZ6A 3PY8A 4KHPF 3Q89A 4YHHK 2CZVC 1PSDA 2XS2A 1U2FA 5FRMA 3K2YA 5BPNA 3SK3A 1VQKS 3MEDA 4BQZA 1DURA 3KYLA 2E1AA 1G1XA 4KV8A 3EE9A 3UR3C 3LP0B 4CIGA 4KHSA 1XTZA 3HO1A 4J9PA 4A61A 2KKHA 4UY8T 2LDIA 3MAQA 1YUWA 1S57A 5KG5A 2BGGA 3CE8A 2Q97A 2WSEC 4GV6A 2J7KA 3OS0A 3DOKB 4M8LA 3HKZD 4G1QA 4ZPDA 2UYTA 1SJ3P 2W4DA 1KTVA 1RT1A 3KFWX 2AGQA 4K25A 1JLAA 6FDRA 4KGVB 4DSIA 5D3GB 3FSIA 3C6HA 1X7VA 1XBWA 2HBMA 5LSRA 3TWHA 1P9YA 1YF5L 1BY9A 3MPUB 3NWRA 3SSSA 4LF6J 1I3AA 3VZHA 1SV5B 5LXRA 4DV4F 3BO4A 4O44B 1S59A 2LMIA 2CUYA 4URQU 3ZT0A 2P9PB 1XMQK 2DGQA 5GMKa 3LDQA 1YRXA 1VQYA 4JI3J 3K5PA 2C3YA 4GW6A 2HNDB 3UCGA 4F50A 4ZVOB 3H2VE 5JICA 5HK4A 2Z1IA 4QWAA 1KOHA 2DEIA 4I2QB 1CS4A 3SQGB 2R3VA 3TUPA 1RBVA 3PJWA 1JLGA 1MN7A 1U45A 1UP1A 4MMOA 4IOCL 2W24A 1FE0A 5LMNK 2VC0A 3R3LA 1RT6A 4R8UA 3AHPA 1W97L 1VOMA 2BR0A 2B0GA 1HNXF 1Z4UA 4H4MB 4X4UA 3D3CJ 5KT2A 4GVEA 1XC9A 2RPIA 2B7BB 4LF6K 1GMWA 1FEEA 2IM2A 3BBCA 5E3RA 3KK3A 1VHXA 3B8AX 1LNQA 3ETMA 3K58A 1JNZB 3A4TA 3LZIA 4DF4A 1S5ZA 4KC5A 3G71N 4F0KA 4OLBA 3M2RB 4CYUA 3KJFB 3AT1B 2K06A 3FZKA 1DFDA 1S1VB 3F0NA 2QV6A 2WVBA 2C28A 1XWLA 1HWJA 3HD1A 3EE8A 4A5BA 1HI8A 3BR8A 4PABA 4CVNE 1V4SA 2ASMA 3LWLA 4CM2A 5BYRA 2NZTA 3ULEB 1RTIA 3R8EA 3VGMA 3CIZA 4CJRA 1ZM4A 2L41A 1CJUA 5LMNJ 2QTWA 3JSBA 4QIGA 3QT7A 4OJ3A 3R5CA 1SZ2A 3M32B 3GTYX 4FO0A 2HHHK 4OZLA 1N33F 2I0XA 4YB5A 5L38A 4USKA 3NGKA 4CT9A 3E3XA 2WBMA 4LFBK 3FEZA 1HNZF 1ZOTA 1IG9A 2YX1A 3V6KA 4M45A 3AXMA 5EX3A 3VEYA 2EX3A 3HK2A 3DRRA 2P9LB 3VQ8A 3U1LA 1EETB 1NJYA 3DLLQ 3AQOA 2MQQA 4OX6A 4USWA 5CZ2A 3O5TB 2XC9A 3J7YI 1HNXK 3QIDA 3THTA 4GO5X 3PFOA 1LWEB 3MXJA 3TAQA 4CERA 1LWCB 2WVEA 2V4JB 3S3OA 4TKTA 3W66A 3VGSA 5AQZA 5AE1A 5KG0A 5KFDA 4M1KA 2ASYA 8ATCB 4JNEA 5HLFA 1B0TA 4MDBA 5CYMB 2DR9A 3IO1A 3TSUA 4B3TJ 1H38A 3M2UB 4RX6A 4ZVRB 4MK7A 4ZVSB 3GP9A 4FK0A 1K1QA 4OYXA 3VMFB 1R43A 4OKKA 3V6DA 1S9EB 1S4EA 2E5HA 4H0TB 4IWVA 3U6FA 2KN4A 2HFNA 5DZ7A 1UJ6A 4BRGA 4LBHA 2VBXA 3LP1A 1U2CA 4P6QA 2ZNZA 3FZ2A 2BA9A 1TMMA 1YT3A 3SNNA 2PMWA 1EQ0A 1DARA 4MK8A 2ZJRQ 3P83D 2J5AA 3OSNA 3VAHA 3PHTA 4KGMA 2E1PA 1J5EJ 5I9EB 4DUTA 2ZD1B 3TEGA 3V6HA 3RAXA 3QZ8A 1KVKA 1WSRA 4E8UA 5HQ8A 4Z7YA 4OJRA 3SI6A 2XNQA 2ZJPQ 1WI6A 4DKWA 3LP2B 5KFJA 4N47A 2FLOA 5B08A 2VOPA 1A7GE 4RW6B 1LWXA 2WW4A 2NZCA 1Y5IB 2XULA 1R89A 3WUHA 3IRWP 1WEXA 2ATLA 1NLKL 3BDEA 4ZVHA 4L76A 2UUBF 4CJFA 3L3VA 4CZFA 3V9WA 1ZETA 2YPZA 2BH1A 3C16A 3RW6A 1S97A 1NJIT 4I6MA 2V8GA 1YZ7A 1G7CB 2CQ0A 3L7OA 4CJQA 2DYAA 1K44A 2Q6CA 4DL5A 3F5TA 5KFKA 3HL8A 1HBNA 3HHEA 1UAWA 4BREA 2C2RA 1IM6A 4OZ2A 1NK8A 4U9RA 3A5MC 3MM7B 2R8HA 2A10A 1NMNA 3FC9A 3M6UA 3GE9A 4KB7A 2VL1A 3SZ2A 2F4VK 2OFGX 2VIHA 4ZVGA 4JK9A 5DLFA 2DNYA 4CFBA 4I68A 3HFVA 4K41A 1CJTA 1X9WA 3KD5E 3CJKB 3ENVA 4XDCA 2OAUA 2VGNA 1NLVA 1VIOA 4IO1A 2DNMA 4DR2F 3EX7B 1M1KT 4KY3A 3RMAA 2HS3A 4JI6K 1KQKA 5CHIA 2G8WA 3D54A 3BPSP 4DU3A 4Z4FA 1S1TB 1URRA 1D9DA 3T1HF 1M5OC 4E0DA 3G86A 2W9BA 3ZTQA 1XQSC 2LKZA 3HVTA 4CIEA 1KCFA 2ZVIA 1VK8A 1RWUA 1SJQA 2POKA 3UWTA 3CFOA 4ZPTR 4H54A 2AF6A 4XO0A 3RW7A 3T1AA 3M9MB 3HI9A 4JOUA 2DR8A 3N79A 4HT5A 4WZQA 9RUBA 1JJCB 3NAHA 3NE6A 2CPJA 4KI4A 4F0HA 4LMZA 2C2EA 4MYUA 4N76A 2LLZA 4UZBA 1UPPA 2CPHA 3T5KA 2E7VA 4A8FA 1T9YA 2I8EA 3SUPA 3MN9A 1RCOB 3J80U 4BCAA 5H9FK 3ISND 4F3QA 8RUCA 2J6TA 2F9DA 4FYYB 4ALZA 3DRSA 2XY7A 4YR3A 1NK7A 3MR3A 3F73A 2CPEA 3QZ7A 2Z2YB 1R0AA 4J8FA 4O23A 4J9MA 3AVBA 3ILOA 1PGZA 3RUBL 4B3OB 4RW7A 3QIPB 3BO2A 4LH4A 4CZGA 3H42A 1FVQA 3ISZA 4X4RA 3E2EA 2MPUA 3GV5B 3TTCA 4OPJA 3DYAA 1VSLA 1T95A 1SAZA 4O3NA 1Y97A 1RABB 3A8EA 1U1NA 4Y3CA 4ECXA 1S3XA 3CCJS 1KEKA 1N32F 3Q83A 4CFCA 2FSKA 3TPQA 3O1WA 1XUPO 2JRSA 1U2RA 4LR7A 3GJSB 3DGPB 4KO0B 4BG8A 4M95A 4FM0A 4EGLA 2M88A 3O4WA 4JLHA 4C8KA 4CEEA 4Z4GA 4TY8B 3KWGA 1XEZA 3J80O 4BBYA 4HHUA 3RRKA 2UUCJ 5IOLA 1RACB 1RWWB 1F9HA 3GYXB 3FNNA 4ZKAA 2ZE2A 4PG6A 4ANEA 3TAPA 1U1PA 1RBOB 4I7FB 1Y0HA 4USMA 2V8HA 4LFCF 4ZPWR 4ZCLA 1S1XA 3HHDA 5HI7A 4M3RA 3OY9A 2Z56B 2ZNYA 1VISA 3IFRA 3MEEB 1NSPA 2RILA 5GADI 4DTPA 4QYZK 4BRMA 2XM3A 3KHLA 4XH5A 4RCHA 2D9PA 3DRPA 1TKXA 5JS2A 5BN9A 5HSPA 1U1KA 5L1IA 2YNHA 5D6GA 4FZYA 4C0OC 3O6WA 1QVGR 3C8YA 5B0DA 3VEZA 3VOVA 2HYIB 2EFNA 1IBKF 2HBJA 1WAJA 3JSRA 4HH0A 4U67L 5A8RB 1F9FA 4NYOA 4PG4A 3EYZA 2J7WA 3RG6A 3PO4A 3MTJA 4ELVA 4P52A 4P2SA 2FLPA 4NX9A 1DTTA 4J9NA 4H0OA 1UEVA 5M1OA 1TGOA 1IKWA 3UNYA 2KG1A 3SUNA 2OPSB 4DFMA 3WX8A 3MEEA 3MF5A 1ROFA 1X4HA 1HBUB 3TYTA 2IAJB 2R2SA 3TP2A 3CJ8A 3KIOA 4JKCA 1WF2A 3MM9B 1BISA 3OS2A 2HAFA 3FBEA 1VQPN 2A1RA 4B3SF 4OPAA 4JKBA 3EUNA 1XNRF 1RU2A 3G96A 3I6PA 4AD6A 4JYAJ 2CGKA 2RQKA 5A6PA 4BR0A 5KG4A 3BR9A 1U02A 1OWXA 2HFOA 1D5AA 3NFAA 3P5TL 2V67A 2VFVA 1EJ7L 3FCVA 1KQGB 1DGKN 4JI1K 4OHYA 1U25A 2G0CA 4FK2A 1FE4A 4DU8A 3LDSA 3T69A 4DU4A 1V3SA 2P8IA 2XO7A 1S6UA 4H5VA 2P9LA 5T14A 1DLOB 3T3FA 2GIRA 3LZJA 3HOSA 3GU0A 5J2NB 1ZYQA 5HRSA 5BJRA 1NGEA 5AQUA 1BL3A 3LQVA 1H2VZ 5AE2A 1C0TB 2M52A 1RGIA 4JI5F 4BACA 2OI2A 2HAIA 3DDNA 3FFIB 3TUZC 2PMZD 1PCAA 3OHAA 3GFYA 3M1VA 4N5SA 1YRUA 4B1UB 2HVHA 2GS8A 2LXFA 2V2VA 1W26A 3WNGA 2CWXA 1H3DA 1Q8IA 3DXMA 4AHTA 1U47A 4IOAQ 3MCSA 1FKOA 2DY4A 3UB5A 4CLLA 5IZHA 4LF7K 1Q78A 3EM1A 2WBRA 3OFEA 2HVDA 3OXFA 2HBRB 4QR0A 3FDSA 7FD1A 2A6OA 2ALYB 1ZZFA 4DTXA 2QWRA 3V81A 4HHJA 5TKWA 3OJSA 2UXCK 4KQZA 4CGGA 3FFIA 3MECB 4XDDA 4F4AA 4HCCA 2OTLN 2VG6B 2NPFA 1HHSA 4I69A 3QGHA 3K5NA 4NXMK 4UF4A 1OY9A 4BGAA 2DY9A 3FBFA 4P71A 3SMSA 3L7UA 3BQ1A 3KWIA 3JTOA 2X1GA 4RWWA 3AY9A 1CJVB 2IVNA 2ZGZA 2Z30B 2XB2D 2AJ4A 2ASDA 1X31C 3O4QA 2CG8A 3WNHA 1QQOA 2VQFF 4DFPA 2PEBA 2CQGA 1QAJA 2IDOA 5KFSA 1HX1A 3PV8A 5F2RA 4CF8A 5JLFA 3S7RA 3Q7CA 5H9EJ 4OKEA 4J9OA 1S12A 3CJQA 2N4CA 3DN9A 2QK9A 4OZ5A 2XLJA 5IC4B 3CCQN 4USJC 3R7BB 4CLZA 1WD6A 1KD1O 4Z37A 1FKAF 3MECA 1X9MA 2OHDA 1GK8A 3VF4A 4WXWA 5GAEP 3TAMB 2GC8A 3H45C 5AJ3F 3M05A 1RTHA 2DNLA 2JHEA 4OPHA 1VQPS 2GELA 4DHYA 1HL6A 2KXNB 1VQ7N 5AQPA 4C2MA 2OPQB 3MMAB 4AM7A 4NLXA 3NS6A 4CJKA 3D1OA 2P9GA 2JFDA 3MMCA 1NMEB 1N32J 2FZKB 4OZNA 5D0RA 4JI4F 4FJGA 2HRTA 2QMXA 2HHTA 5BRHA 4YFUA 4UQGA 4LVNP 4F4XA 1BI4B 2GCFA 3C7NB 1S6QA 3M2VA 3UKUB 2ATQA 3VALA 4KHUA 2E9ZA 1JLEB 2M8DB 2PAVA 2D0CA 3ENQA 3MEGA 4H4OB 3I9ZA 4CK2A 4Y2MA 2H5EA 4E7IA 4M3YA 4JI2J 2RMLA 2GGPB 1S6OA 2APOA 5FPNA 2R7OA 3ILLA 3G4SN 4Z4CA 1ZAXA 3B82A 1MA9B 4PRFA 2AJ0A 3CCLN 3LH2S 1RLDA 1CC8A 3BREA 3H7HB 4PKHA 4DQ8A 2NXEA 3O4NA 1VGYA 4WJBA 4DV2J 4X4PA 4QYRA 3GR1A 1WUAA 3GG0A 4PUOA 2JZ5A 1QHTA 3D1QA 1QVGM 2J9DE 4B3RF 4LSLA 4NEYA 2RHQB 4CJ7A 4J91A 4M5DA 4RBUA 1HI1A 3OYDA 2V94A 1GXTA 3SCXA 1N6QA 5H1SV 2DFFA 1IBKJ 3MMCB 3FE1A 4C0HA 3SMPA 4LFAJ 3KUEA 4DV6J 1VQ4S 5GMEA 1NKCA 3R7NB 2ZGYA 1YJNS 4KIAA 3MMVA 3KNGA 1P8ZA 1WNSA 1VQNN 3R97A 2JEFA 1K0TA 2VODA 1RI7A 1VQ9N 4DN9A 3NGTA 5KPTA 4ECVA 1I39A 1M1GA 2QJ3A 3D0GE 3MXMA 3SJHA 2G13A 3TZZA 4ED8A 2QT7A 4X62K 1JLCB 3N4PA 3OYHA 1SL0A 3MM6B 3RRHA 3GBTA 5FLXU 3N6NA 4WIIA 2ZM6J 4IDHA 4M3UA 4KHRA 4B02A 3OFFA 2XGQA 4DPXA 5K20B 1HHTP 2Z2LA 2XWXA 3K9KA 5IT4A 3VVUA 2RAQA 3D6FB 2FJDB 2V5HG 3HHLA 1NM2A 3FGUA 1SH2A 4F2RA 4LSZB 2Q36A 4FWMA 1FRIA 1H2TZ 4DWIA 1G3OA 2P9CA 3CPWM 4DR5J 3CIPA 2UUAK 4DV3F 1NJWA 2BM0A 2I5JA 4F36A 3W64A 5M1NA 5CD4H 1X5OA 5DDPC 3AQPA 3M30B 3SQ2A 2OZSA 2V7ZA 4MYTA 1WELA 4UZCA 3EDQB 3KK3B 3FBCA 5AQFA 4F26A 1U0HB 1YDLA 1U8WA 4MLHA 4FZZA 4BG9A 1XR6A 4I67A 4ZIVA 2G0IA 3H2LA 3ZZ0A 2O8EA 3V81B 2YKNA 2K3KA 3VF0B 3OXGA 4I9LA 3O3LA 2ZH3A 1NNDA 3CDAA 3GWCA 4ED1A 1J2VA 3HM8A 5ELZA 4W5TA 3VEOA 1CSJA 1QD1A 3I55N 6FD1A 5HMYA 4F4WA 3AO1A 1FXLA 4A8SA 2HFVA 2ZC3A 2BANB 3VQ4A 4TLRA 2RU9A 5DO2A 4M5KA 1F3FA 4YDDB 1MN9A 4J2BA 2KHCA 1N36J 2ZZNA 2HMPA 1JLFB 4A4JA 4B9TA 4B1WB 3KHHA 4YQWA 3TNVA 3OYJA 4AT1B 4DG1A 2JNJA 5CZ1A 3CJ3A 3IRXA 4W5OA 4DCOB 4CESA 4FBTA 3R2DJ 4A8MP 4ZIWA 2QWMA 2GVDA 4OJ1A 4O8UA 1CPZA 4ZHRB 1U0SA 1IKXB 2D1KA 2XMTA 2AGOA 4Q7AA 4KO0A 3NDKA 3GIIA 2HVIA 5LY3A 2X1BA 3W65A 3GJQB 2MZJA 3BV8A 4ZCKA 3S3MA 3BF4A 4IEEA 1S76D 2FF3B 1CJKA 3I32A 2IJNA 3G8SA 4U7CA 1EKEA 2H4WB 1KC8T 1XQIA 1P6TA 3WBZA 3D66A 3OR1B 4U7UD 1R8PA 4HHHA 2WVDA 5CH7B 3CJ7A 2ZM6K 5GAHU 4OI0A 1N4LA 4Q43A 4DV3K 5C15A 3UDCA 3I33A 4TXSA 3BF1A 5IT9O 3J7AN 4Q2LA 1Y9OA 4KHQA 1AFJA 2ZQBA 3ATVA 3AVKA 2FLNA 3PJXA 4FKYA 3VQEA 1CVJA 3KTQA 3BQ2A 4J37A 2CZ9A 3QSIA 1H6KX 5F8MA 3AD9C 4UOCA 5C5JA 4E7LA 3OR2A 2BKOA 1WC6A 1WSFA 3DRSB 1VQ5N 4HVZA 4JB8B 4FJ5A 2OZMA 3MI7X 4ZVEA 3PX4A 3K59A 1NGDA 5J2PA 1KVBA 3D9BA 4OX9J 1N8RO 2FQQB 2IVMA 3AAQA 3X3UA 4X66J 3GG1A 4DV2K 3P6YC 2IYIA 2QMUB 4DR1K 3JS6A 1ZBLA 2B6AB 1T3NA 3EE3A 4EEYA 1VSEA 3DRXA 5GAHI 1VJQA 2DGWA 3TRGA 1RADB 2CQPA 5KG6A 1TK0A 2FSNA 3OYBA 4FJKA 2NS1B 1N34F 3N9UC 3R6MA 3UVJB 3BZKA 3KLEB 4UUXA 2HBQB 5LJ5Y 5K5MA 4LRDA 2C2MB 3J81j 3M6XA 2OA8A 4DDFA 1NJIO 2HEKA 2HHQA 3OL6A 1Q5VA 3TO8A 3H5UA 3CMQA 3OVAA 1O0PA 1KFDA 4CK3A 4RG8A 2FBVA 3BGLA 4C98A 1V9OA 2OP5A 4LF1A 3UE2A 2YNFA 2E6LA 1PC5A 4BDZA 1PILA 1XNRK 2IVYA 2OELA 2E9TA 1NHUA 4WFXA 3TJ8A 3TUJC 2CNLB 1S99A 3V1QA 1U48A 4JHDA 4FBUA 3KDNA 2FVRA 3R3TA 3HJVA 3D6RA 1TL7B 3UKRA 2NYHA 5F9NA 3IMQJ 2IIRA 3BP8A 5AQHA 2YX4A 2Y3YA 3R5BA 1KHVA 2WTUA 3QRRA 2OPRB 4PY5A 2R7VA 3O9SA 4EZ9A 2DH9A 4C8ZA 1LXJA 4FKXA 1JCFA 4MLEA 4EHTA 2R9LA 1RJJA 2AGPA 3CCVS 3TSQA 5A8KA 2JOQA 2VICA 4Q0BA 1ZA1B 3WIVA 3EVWA 2PFUA 1RWKB 4URSA 1C4CA 3TVZA 1NDPA 2QKKA 1S4FA 2ZF5O 1JIHA 2B9XA 2C2KB 5DG8A 2B7CB 3ITHA 4CO4A 3RBXA 2EWSA 2J6SA 1R59O 2YH0A 3TZXA 4NE9C 4KB0A 5K8PA 5BREA 4B1ZA 1CXQA 2M5YA 2DEJA 3DLRA 3DXBA 4CI6A 1UTAA 3CXCM 2UXCJ 3FQKA 2G1DA 3ALYA 1BC6A 2EG2A 7FDRA 2NRWA 4JD2B 4JKGA 1HKCA 2DNRA 3MMAA 5KFIA 1YQHA 3CCMN 2BBEA 5AZIA 4NCGA 3FCHA 5D4PA 1H72C 1TR0A 1G15A 2D74B 1UWBB 4XIUA 1KVAA 3LDPA 2MDAA 4CRJA 5J2MA 2HKEA 5KFQA 4YS2A 3LPYA 5ETRA 2WTFA 3N28A 4M63A 2CPIA 4NYFA 2D3ZA 1R31A 4DTUA 3ZCMA 3I0SB 2VKRA 4Y2CA 1W9HA 3FVYA 2GFFA 2MSSA 4IDKA 4ILLA 2MKKA 2LEAA 5L46A 1L3TA 4DV4K 3PCOB 2ZH9A 1FJGF 4KPYA 5AZJA 2VFSA 4LF2A 1A0OB 3HX9A 3VQSA 4CJPA 4DCPB 1UW4A 3ZZRA 2COLA 4CJ3A 5EX5A 4CGFA 2N82B 4HYKA 5IC6B 3OQ2A 5I3UB 1YJVA 4C1NI 2HHPA 3T7ZA 2P51A 3DI6B 1MLAA 5L9NA 3O9QA 2KT2A 2HG4A 3NGIA 3I8BA 3OTDA 3BSAA 2UV8A 2P9KB 4ECTA 1RTJB 1T3OA 2DHSA 1LKZA 2F8TA 3UO0A 2RF2B 3OYAA 1O13A 4OLPA 4DUZJ 2F63A 2KXHA 3IBFB 5DM7Q 1J9AA 4XAKA 4FZVA 2YNGB 3ZSVA 3IAS9 1JMTA 3BGOP 1JKHA 3A5OC 2X78A 5IM0A 3AVMA 1KVCA 2UXDK 4YY3F 2KO1A 2D5RA 4DPYA 4WTYA 1SC1B 2KZMA 3D67A 1SJFA 3CT9A 4EYHB 4X65J 3IRXB 4J9LA 3WHIA 4DV7J 4JI2K 3CCWA 1Q7YT 1HW9A 2ZWOA 2HS4A 2ZD1A 1KD1T 5HRNA 4F4YA 1VQ6N 2E5LK 4QW9A 4BRNA 3HZ6A 1OQ3A 2FBXA 2ZBCA 1BDGA 2NREA 1Y00A 3GJTB 5KRTA 3K2PA 1N32K 3SCJE 3SEOA 1EKRA 4DR5F 4HTLA 2ABYA 3D7EO 1JXEA 1NSAA 3C19A 3GL1A 3T9NA 4RWTA 5F3ZA 4YDXA 1HBOB 2V7YA 5HANA 5T7LB 5B8HA 2KHDA 2R7SA 4DR4J 3VGVA 4K4VA 3I9V9 4IO8A 3D6MB 1FERA 4K4YA 3TWZA 5JVHQ 5KPRA 2ZKTA 5FPDA 1EZZB 1T9UA 2DRAA 3ZT4A 4LT6A 3D28A 5C25B 1RT4A 3BS9A 3RBEA 2LSNA 3U27A 4F9OA 1EWRA 3QNOA 2HSEB 3P31A 2Q31A 3RRGA 2V9KA 4I0WA 2B4JA 1LEOA 3ETOA 5A2QU 2JEJA 4P75A 1FJGJ 2QLBB 4RU9A 4YP3A 4DPWA 1CS4B 4KBIA 4K0KJ 2N7YA 3PTWA 1MG7A 4NI2A 2J0QD 5ETMA 1DT9A 2HZVA 3MAAB 3DLKB 2YBVA 4NXNK 1VQ6S 2IC3B 2WSFC 3E9LA 3VA3A 4FYDA 4B9SA 4J9KA 5J2PB 1F5BA 1NKBA 4DL3A 3JYTA 4NYNA 4CLWA 3VF6A 1ZPVA 4LIRA 2WVCA 1TTHB 5KG3A 2H9ZA 3EGWB 3G8QA 4L3KA 1IBKK 4AF1A 2DIVA 3NKYA 2P5GA 1FKOB 2HNYA 3AD7C 4JP8A 4C48A 4ELUA 2AP1A 4WIQA 3SUOA 3HKWA 1XMQF 1DLOA 3BEGB 1YIJN 2D1CA 2QGFB 3DXKA 4HKQA 3D5MA 3MM8B 2GJFA 2G8VA 4TU7A 2NSBA 2FHJA 3HTVA 4NLOA 1Q18A 2QRRA 3ET6A 3H0PA 2X7IA 5F8JA 5EWGA 3P96A 3HPGA 4TY9A 2E9RX 2P9NB 1XMBA 3NRBA 3A13A 3CCUS 5E33A 4RW8A 4F0MA 1UKUA 3ZSXA 1WJ9A 3AOCA 2DH7A 1YJ7A 1NBWA 2WCXA 2R8JA 3OTEA 3POTB 1FRMA 4WYWA 4IR1A 3U3YA 3UN5A 3CFRA 3OLBA 1HNZJ 1RBRA 3KJVB 3BSNA 4KYZA 1LOTB 2V51B 2KFNA 4MKBA 3MX5A 3VQPA 4R5PB 4P10A 5DM7L 4DN0A 4CE9A 3CCZA 2G9OA 2W7OA 1QHAA 1JWWA 1N6QB 3DLGA 4L73A 3IWXA 2RDIA 3CC7N 4LRCA 1T6DA 1VQ8N 5CYMA 1RT1B 5I3QA 2YY3A 3TSPA 1WC5A 3CC2N 2HNDA 1YJ9S 2RN2A 1RHJB 3P49B 3VQ9A 2CQ4A 4CK1A 2FJBB 3RBZA 1WHVA 1TAQA 2G1HA 3SQGA 2V0NA 3RMBA 2DRBA 5F8LA 5C2FA 3M8RA 1OMSA 1SIWB 3W3SA 4TQRA 5HMWA 3SBTA 1Q81T 2PA3A 1QE1A 1XIQA 4DQIA 1HNZK 4CEDA 4W4MA 4CHZA 1HKGA 2UUTA 4DMZA 1B7YB 2DNGA 3LP1B 4H03B 1RTHB 3J7YU 2EG1A 2OEKA 2FJEB 4CIFA 2G8HA 2YXLA 4P9SA 1Q1KA 4DPOA 2YKMB 4PQAA 2QC3A 2R7TA 1HYSB 2F65A 2EI5A 4R0JA 4DR6J 1U1RA 2P6SA 1WC4A 2VQFJ 1Q7YO 1KAYA 3PSIA 4QS7A 5D0EA 1SCJB 3TA2A 2ZHBA 4CO3A 2YHXA 3O9RA 3ZYYX 5GAGP 3TAEA 1OJ4A 3FGVA 3PJ9A 3J80Y 1GOAA 4QIWD 2GUIA 3HYFA 2QFJA 1Y5NB 4Y65A 2HHXA 4FJNA 1ZS6A 4I1TA 2HHHJ 2I2YA 3QERA 2ZWPA 4F7VA 4JI5K 4LBIA 1ITGA 3BGRB 1RK8A 3CDEA 5CYQB 5KFCA 1Q7LB 4LVOP 3FZHA 5AJ3K 2OTJN 3SPZA 2H1YA 4CTAA 4F4KA 1SQFA 4HACB 2ZHAA 4CGDA 1S6PA 1OH5A 4KHWA 3G71S 2A3ZA 2XSFA 3CCSN 1RBSA 1YLXA 3MM8A 2G0JA 3EKSA 3UR0A 4CLSA 2ETJA 4IOXA 1JXVA 4HDHA 3SV3A 4ZVPB 4ISEA 3DKDA 2V34A 2E6MA 1TL1B 1F9EB 2QSFA 2XLIA 3GFXA 4Z4IA 3SDEA 2JC1A 1CZAN 2CJYB 4TU8A 3PIOQ 3A8IA 3K17A 1VS3A 3SYZA 5DRKA 3IG1A 5HMZA 5KT7A 2DD8S 3D45A 2FHMA 3QT6A 1HRHA 1HYZA 3B54A 5BRDA 1F1BB 4PQUB 4NLDA 4EBDA 4OVLA 4ID8A 4IKAA 4KH0B 2R7RA 1YVFA 1C1BA 2CH6A 1FRHA 3EJMA 4JYAF 3B6OA 4QIFA 1SL2A 4H4KC 1QDUB 2D69A 3EGNA 4QIEA 1SIZA 2HF3A 2ZUAA 3OL8A 2AIRB 4YNQA 3M2UA 1RA6A 4WQ4C 3L2WA 4X4NA 4Q44A 1FKPB 3GZ7A 1ZBUA 4OZJA 5G0RA 3US5A 4CTAB 2QWOA 4O0JA 4OYOA 1NRKA 4E1JA 4LRAA 3O1LA 2R2TA 3ZSZA 5GMDA 4F3MA 3I56N 3KKSA 2RT3A 5KFNA 2DGOA 4C8YA 1K8KB 3K5LA 2PZSA 4DR2K 3DXMB 2VZ9A 1K9MT 2MKJA 3CI5A 1OS5A 2W4PA 4RW9B 5KGWA 2BE7D 2DNPA 3O9UA 3NOCA 4FLVA 1VRTB 2R7QA 3QIOA 3H1QA 4NCAA 3OTBA 3B6PA 1QUVA 1N0UA 5BYQA 2HHUA 2BJEA 4IFEA 2V63A 4FYWB 3BGFA 4LF9F 1JCGA 2Q66A 1B4SA 3T1YF 4E3SA 1ILYA 2QO3A 4FPAA 5C12A 3JQMA 1UA1A 2QEXS 1CG2A 1BOTO 2GMLA 2P9UA 2M3DA 4BR7A 4GC6A 4MAKA 1PJ6A 4HUEA 4UW2A 4ZITA 2J8SA 1WOQA 1HNVA 3W8GA 4RW4A 3LM9A 2E20A 4Z4EA 1HJRA 2DXFA 2J0WA 2GAHC 4WFBQ 3RR7A 2F4VJ 3MM9A 2PD1A 2B4OA 3QFPA 5C2CA 4BR2A 4RBVA 1JL1A 1OKJA 4YOEA 2XEXA 5DS7A 4EK2A 5AE3A 1GOCA 2BXJA 4V19S 3MAAA 3NGDA 2GO9A 2ACMA 1VQOS 1SKWA 1EKSA 3ELHA 4DV1F 1VLOA 2YHYA 1K73T 4L72B 1BQNB 2MTLA 4IG3A 3V4IB 2K7JA 5CY4A 1TKZB 3DM2A 2PO4A 5F9LA 3AVLA 4HWIA 1UAXA 3O1BA 2EEYA 3R27A 4JBCA 1E3MA 2XI3A 4RWXA 1FO1A 2IA6A 2ZZMA 5DDRC 2YTCA 2IVPA 2GJ2A 2QLJB 5I42A 2OIHA 1BWVA 1YJ9N 4OI4A 4WE1B 3TX0A 1KLMA 3M8YA 4DV6K 4PG8A 2P6TA 1WTBA 5KT6A 6AT1B 1S1TA 3K57A 1DBDA 3TUIC 5ETOA 1QAXA 3C46A 3ASMA 3VGUA 3MCOA 1WOSA 2VF3A 4DPUA 4U96A 1NBEB 2J76E 5C24B 4OV1A 1WEZA 5D78A 2H3GX 3QMQA 1RT5A 3VWSA 2ZZTA 3I5CA 3D6TB 1VCTA 2RE2A 2IBKA 4YOVA 2OPPB 1W2BM 3WQPA 1IUJA 4FPIA 4NXMF 4YOYA 3DHWC 4CZJA 2D0BA 1FK9A 3MR2A 2CYYA 3W63A 5LL6d 3N5FA 3TARA 5HROB 2DCUB 3KLVA 4AHCA 4CGHA 4DTSA 4JI7J 1E6VA 3GONA 1AZSB 4J5OA 1TFYA 3QWPA 1S1VA 2PFFB 2Z8QA 3DDIA 4USIA 2QE5A 4LF4F 3C6TA 4LFCK 4FP9A 3OD2A 5BN8A 5L1JA 1AB8A 4IG0A 1GTHA 3M32A 3SBMA 1AFIA 2BQ3A 1HNIB 3DFEA 3THVA 4Q45A 2BJ9A 2VH7A 2MZSA 2MYFA 2XG8A 3WXKA 4N8NA 2RB7A 2MB0B 5KI6A 1S7HA 2KM8C 1WEYA 4MK9A 3QPIA 2MZQA 4ZPBA 3EVOA 2MZRA 4GKKK 4ZCIA 4LREA 4DZDA 4A8KA 4ETXA 4B1YB 3NH1A 2LA6A 3DMJA 4C4WA 3AH6A 1DJ0A 2CJAA 4IH6A 3GILA 1T94A 3IUCA 1B92A 4QPTA 2FVQA 1ZA2B 5SZTA 2JL9A 1OSCA 3A3NB 2VG5B 4X2BA 2M8HA 1RT3B 3CJBA 4RJVA 2LQ5A 1L3UA 2DKOB 4CNZA 4KKOB 1SC4B 1T8EA 5BRFA 5HJXA 1IM4A 3P4UB 2FY1A 4DSFA 3T6BA 2W1BA 1X9JA 3ITHB 4PQUA 1BQNA 2GHPA 4TSXA 4DR4F 4OI1A 3MTKA 5AXMA 3MMBB 1JLCA 1K6YA 3NH0A 4RTFD 2YQ3A 3LP3A 3NF6A 5KG2A 3H4DA 2NRZA 4YN3B 4CYUB 4W92B 4BRLA 1PKUA 4ZN3A 4Y0WA 2MQOA 5EY4A 2OGUA 3ADAC 3W2VA 1ELOA 5T7LA 2HIYA 3HMJG 1IBLJ 5AQTA 4KAZA 3B4DA 5IV3A 1RWOB 4JRPA 2IBOA 3JSMA 3AGKA 3IN5A 3CETA 4ATNA 3CC2S 1WUUA 1TUUA 2DGVA 3E01A 4ICLA 3VQ5A 4K4XA 4DFJA 1UVLA 4MQ3A 1RT7A 3SJJA 3WQTA 4EAHD 1V4TA 2DXDA 1NXIA 1SS6A 3RJMB 2OPPA 5LM7E 3IWNC 4JI6F 4FNHA 3DOKA 4E2FB 4GVBA 4WP3A 3EO3A 1IVZA 1FF2A 4LSNA 2JWKA 4J2DA 4WWSA 3RWUA 5EOYA 4DBQA 2DTJA 3QLHB 2VFTA 4BC9A 3NOGA 4F3TA 2G2YA 1HARA 4CIOA 2ALZA 3IP0A 2SXLA 4C11A 1LW2A 2KM8B 2Y8WA 3VAGA 2KYZA 4DTRA 3ISNC 4U7BA 1BCOA 5IT9Y 3V9XA 1I6JA 1PIEA 1ZBIA 4IOCQ 4CZIA 4PG7A 4AHSA 2EFVA 2VBWA 3BZCA 3UDLA 3EDRB 2RQ4A 3PRVA 3Q8PB 1S0NA 5RUBA 3OFHA 3U7JA 4EIAA 2HWHA 1V3RA 1GLFO 3A5LC 3SCIE 1JQGA 4J2AA 5C0YA 2VKZG 2O8DB 4Y28C 1SQEA 3F2KA 2B5JB 3BUZB 2YKAA 1UETA 2NCKL 4WQ5A 3DWLA 3NVMA 4E98A 5ETSA 1UW9A 1Q86O 1PJ7A 4FM1A 4DX5A 3KLEA 2W9CB 2J9EA 3ONQA 1Q86T 1XNQK 1FX2A 2VBYA 3Q2TC 3OTOJ 1NK5A 4FXDA 1TL1A 2E66A 1TUWA 4JI3K 4Y2AA 5IXUA 2BJ7A 5F3TA 1JB0C 3IM8A 1J27A 1BQMB 2CRLA 2E44A 1D8ZA 3HBTA 1VIXA 3SIPB 2KH9A 2X74A 2IFXA 3IR6B 2AYGA 2Q3PA 3M8QA 3BM7A 1S79A 2CQCA 4JV1A 1QZ5A 3DJCA 4GMJB 3C66A 1RAIB 3EN9A 4CI0B 4ED0A 3SV4A 2CGLA 1PAUB 3SFGA 2C42A 3B4MA 2V50A 2CJQA 3KHRA 3RB6A 2WC9A 5GAGU 2IY5B 2GMHA 3LPEA 2P9EA 3CCEN 1NM1A 2BKPA 4BRPA 4DU7A 2MJUA 5LT5A 3GSIA 1REGX 1I3OB 5E41A 3SPYA 5KQ8A 5IM0B 2QI2A 1QTMA 1RTDA 4PKGA 4NPOA 5AQSA 3U4LA 4AHRA 1T9VA 3ZZOA 3UCZP 2KVIA 2E5LJ 1Q8LA 3LGNA 3RZAA 4KHNA 2ZVSA 1RYRA 3TZWA 1RHUB 1DTQA 3OPKA 3DLJA 3RVCA 5KAKA 4G3IA 2KRRA 5IWAF 2MKHA 4CZMA 2Z4PA 1VRTA 1HHQA 3ZT2A 2BOAA 5CCMA 5FPEA 3OS1A 2M2BA 4HTIA 4CJSA 4A57A 3M8WA 2QL7B 2QA2A 1NEEA 2E1MC 4ZCMA 4URGA 2PN6A 4Y1DA 4ZPCA 4ILMA 4OHVA 5MLCV 1HBMB 3TABA 2VPXB 1RTIB 2JWNA 1XR7A 3R1XA 1RILA 2HRUA 4LR8A 3W7BA 4BRHA 1NAQA 4DTNA 4CH1A 4ELTA 4JV5F 1S1WB 1S6PB 1HWIA 2CA9A 1S1UB 2AJFE 4K4UA 2W8LA 1V5IB 3PX6A 2IM3A 4NLBA 3V6JA 4JKHA 4EP5A 1PBUA 1UEUA 1GLJO 3HSGA 1U6FA 4DPTA 4I56A 4M42A 3ZT3A 1HQUA 3O6QA 1WDTA 4YOUA 1S9EA 4CFDA 4X84A 2VFRA 4JI0J 3OXLA 3PYGA 3WZ0A 1RWXB 1B70B 1TU0B 1M90T 2FD2A 5KFLA 3MFIA 2XHWA 1VSMA 1KSPA 4OGEA 4OYZA 1OY8A 5AQQA 1FEHA 4PG5A 4A47A 1VI7A 2DK2A 4BHQA 1NPRA 3B6BA 3NGRA 2UUCF 4WFNL 1U1LA 5KFTA 4H5WA 3N6MA 1X5SA 4B9UA 2EW9A 4OX8A 1FTCA 2YWGA 3UN3A 5B0FA 2QA1A 4OFZA 4CWBA 1FDAA 3NF7A 2OKQA 1I94K 1HYSA 4OPKA 1VR6A 1CJUB 2YKNB 4MKVA 1DZ5A 2FGCA 1W7AA 1R3NA 3D1HA 1H73A 3O80A 3KKRA 1NDKA 3HT0A 1RHMB 1ZAVA 2MEWA 3O08A 4NCBA 3W2WA 4ECYA 1QSLA 1T44A 5ETQA 2G2OA 3VAMA 2XS7A 3WT0A 3GE1A 5IWAJ 4B9MA 1RDCA 1NGHA 1NUEA 1SJ1A 1NSQA 1O8BA 3CCRN 2LEPA 3G0ZA 1RA7A 3T1HK 5A8KB 1FRLA 2VCPA 2M7SA 3EMTA 4IFVA 2P5VA 1WLJA 2J9DA 1OH7A 3QNWB 3VF2A 4AXJA 2NR0A 4DV2F 2RNEA 2ZH5A 4XEIA 4JKFA 4DV7K 4QCLA 5AQVA 3AVIA 2O8BB 3KK1B 1VQMS 1GLLO 4H0VB 4HCBA 1VQON 1W2BR 1REVB 3IA0A 1WF0A 1B0VA 3D3BJ 1N34K 2UUCK 3HHLC 1TZ0A 4FJMA 2V4JA 1RDDA 4M5DB 1KWMA 4FWOA 4CLYA 3CCVN 2L3MA 4WK1A 1VC0A 3V2UC 2BE9B 4XH4A 5GINA 4GVMA 4DUYF 4HI2A 5AZIB 1NMDA 4ZDNA 5EU7A 4BDYA 5C7PA 4PR6A 5IT0A 2IDLA 3ZX0A 4JEPA 3R7SB 3R6GB 3HVAA 5F8GA 1LV5A 4F3OA 1RGVA 2XHCA 1YRTA 4WCEQ 2F9TA 4BC3A 1FD8A 1TAUA 1XI1A 1LWFA 2I9SA 2KFYA 4DR4K 4YB1P 3P5BP 4B8AB 2BEFA 1O1WA 2ZEJA 3QICA 3IGVA 3LOUA 3I55S 3CSKA 3VV2B 2LCWA 3LANA 3I4HX 3DLGB 3CO9A 2HNYB 4L75A 3V9SA 4LC9B 3S1TA 3VAKA 3C15A 2HPUA 2OUGA 2LQ8A 5HBMB 1MWMA 3H8YA 1F60B 4PA1A 2YQ1A 3C16B 4O3PA 1GTEA 3NCQA 5KGXA 2A1BA 1HNWJ 1K8AT 3MFHA 2FVSA 2JDJA 2CNKB 3ZO7A 4JI0K 1M5HA 2A40A 3VCDA 2VPZB 4ZLJA 3P3DA 1AW0A 4DR3J 5DZ6A 1VK3A 2JLGA 1ZPWX 4JI7K 3OL7A 4FDFA 3DRYA 4USUA 3NF8A 4AILC 1VSJA 4DQQA 1CZBA 1O6XA 3JXOA 4PKDB 4IEIA 4P7VA 1APSA 3PIPL 1RTZA 2E1YA 2DR7A 1BE4A 1FNMA 2YX7A 5AQNA 3MMJA 5F8HA 2QWNA 1Z6RA 2CVEA 1Q8BA 3BY5A 1KAZA 4BRFA 2L08A 1BI4A 3DXSX 1NHKL 3TAFA 1VQNS 2ZITA 4C6AA 3TJ9A 3PYFA 2P9IB 3ZSWA 3MD1A 1YJUA 2BW7A 5GADU 1N5TA 3J7ZO 1GFWB 1RDWX 1PJ5A 1Y5LB 2GIQA 5DJBA 1NWKA 1V3ZA 4K2XA 1HW8A 3KK2A 5CABA 1PYTA 1Y64A 3QLHA 2V2ZA 1I94F 3CNQP 4CDIA 2UU9F 1N33K 4FCYA 2XGPA 1NK0A 2ILYA 3TX8A 3CPWR 2ZJQL 1HIYA 4A8QA 2GUPA 4DR6F 3V9UA 2VOOA 2OD6A 3ZSQA 1MNEA 2O8FA 1FW6A 4S0MA 1BO5O 2RKIA 1CJKB 1LWCA 3PXGa 3FLCO 3HZEA 1JJ4A 1S0MA 5HOOA 3CD5A 3HSCA 3DLLL 1SKRA 3NVKA 3BBFA 2XS5A 2DXEA 2BRLA 2VC1A 2HNZB 3ID8A 2AQ4A 1VAZA 3L6QA 2MHNA 1CBKA 2HRYA 4EO8A 2B8PA 4DB3A 2DPNA 1VC5A 2VONA 2A6MA 2V68A 3D6HB 4RKUC 2Q3SA 2UV8G 1QE1B 2X1AA 4WFAL 3CCES 5JMNA 2F8EX 3QRPA 1LAVA 2AJ2A 1Z25A 3CYMA 1S0OA 2MGZA 3WX4A 2E5LF 3SCLE 4CO0A 4B3RJ 3QAUA 2XMMA 4U67Q 3WEEA 4ZP9A 1AT1B 4CJTA 1NGBA 3RMDA 3SQOP 2Z0GA 1S72N 5K9FA 4LSLB 3G6VA 4DU1A 2WB4A 1EO1A 4RUAA 3ZFVA 4HVJA 4FWNA 2OFHX 4ZJLA 2RHSB 2V2KA 1VRQC 1DQ8A 4I2QA 2DIUA 2J4RA 2QW9A 1TL4A 3J7ZT 3IR5B 1OSDA 5EGYA 3W2VB 5K8MA 1KBRA 2DFHA 3OT9A 3UVJA 3QBWA 4K5SA 3AOBA 3NH2A 4UTGA 2CQDA 2HMIA 2MKCA 3GCXP 3CIMA 1ZBHA 4HLBA 3AA4A 5C10A 1SPBP 4BE2A 1P27B 2HQDA 2UU9J 4LH5A 1C0MA 2FGOA 3NS5A 1RNHA 4CF2A 5C2GA 1I5OB 4WFZA 1EAYC 1YG0A 4IRDA 1F2GA 2CDRB 1UZHA 4I9QA 3TQEA 2EKNA 3RMCA 4OLOA 1NB7A 4NLCA 1WDDA 2ZH4A 4B3MK 5LSLA 2DHHA 4OV6A 1TQLA 3J7A1 2UVVA 1QVFM 1GOBA 1D09B 2FVPA 1KLNA 4FW2A 2KTQA 3T1YK 2ZDOA 2CNOB 5D4LA 4OL8A 4FJIA 3QFUA 4JK7A 1Q16B 4LF5K 1HNXJ 1ZBSA 3W5ZA 3GIJA 3JQJA 5CD4A 2ACYA 5FRNA 4FW1A 3NXZA 3ZX2A 1UL3A 2CPZA 3VQ6A 4ZHRA 2F4FA 3VAIA 1MU2B 2AW0A 4WFAQ 5E84A 4IFYB 3MK6A 3W9HA 1WC0A 3QO9B 1XR5A 1C4AA 2KU7A 2MLZA 4K7QA 4D3HA 2XCPA 3KDOA 2XY5A 1C1BB 3RAQA 2ZBQA 1B9FA 1IXKA 2VA3A 4BR5A 4E7KA 2F9WA 3NCPA 2CDQA 2NPIA 4I6YA 1RAFB 3DXKB 4UY85 4NZ0A 3QSYB 2W25A 1URNA 4JS5A 5CQGA 5A8WA 3PG9A 2HWTA 4EI2A 4F25A 4KHPJ 3AY0A 4IG0B 1T9XA 3IS9B 5A2QY 2H51B 4FWPA 2YJEA 3CQ8A 3PW2A 1LAWA 2C2ZB 1BQMA 2O1PA 4FJ9A 3R1LA 1U6ZA 2UXBK 2XSJA 2E4LA 5EDWA 4KR0B 5DETA 1XNQJ 5E3PA 1IR0A 3C0BA 3Q0AA 4DX7A 3WC0A 2YHBA 4KH4A 1HPZA 4P2MA 4CBWA 3IBWA 1N5QA 2GVZB 2GHVC 4N7TA 3OTCA 3OW2M 2PI4A 2WBNA 2DNOA 3PVXA 2R2RA 3EL2A 1UVIA 3CJ2A 2UP1A 3W1YC 1YI2S 3LPUA 3HLUA 5C25A 1DQ9A 2DGXA 2GW8A 4Y2IA 5AZJB 2BVZA 2PEHA 1SXLA 1RT6B 1NCLA 1VFJA 4LF9K 3MGJA 4A2BA 1D8YA 2UUBK 1KTQA 1NDLA 3ILJA 5LJVA 5AT1B 2VYPA 2PGCA 3UNGC 4BS2A 4B1XB 2O66A 3P39A 4QR2A 2BUNA 3KK7A 4QPXA 2IVOA 2BDPA 4JRQA 4JK8A 5MAOA 1EWQA 3MR6A 2D3OR 4YB7A 4KJIA 4IO9L 3Q8YA 2LVWA 4DS5A 2HSTA 2XYGB 3H5XA 4PWDB 5CAAA 1HR0J 2OO4A 2KT3A 4RL1A 4DJBA 3N0VA 3SLCA 1EXQA 5GADP 5HVHA 4PKIA 4FWLA 3H90A 2QM1A 3SAHA 1RLCL 4NA1A 5F41A 1FVSA 4CJLA 1TVRA 1AZSA 4ENOA 1XMOK 3G8TA 2BKNA 3EWGA 4V19J 4Q2MA 2BZ2A 4RUCA 1XHZA 4LF4K 3HDSA 1QS4A 2CPFA 3GLJA 2WOMB 1ASVA 4FF2A 3MEKA 2BJDA 2YPYA 5F1XA 4HTJA 3PM9A 2IDEA 1RT7B 4MKAA 4DCJB 3EPGA 1TMJA 1TELA 1Z26A 1HNIA 2HS0A 1H7WA 3W0LA 1ITPA 4DR3F 2FZCB 1WKKA 2MLYA 2C1EB 4JI6J 5A0YB 5D8HB 2H65B 2E5JA 3TQ1A 1ZM3A 2MKIA 2W4CA 1TP7A 1J53A 3PFEA 3A3PB 1WC1A 3V5RA 4RNOA 2L48A 3FQLA 4O44A 5J2QB 2CJ9A 3AAWB 2H5IB 1ULRA 4O5BA 4B1VA 2V9WA 1FK9B 1RE1B 1LWFB 3O8MA 1AYEA 4DG1B 2AEJA 5DQHA 1WG5A 1D1UA 3CJ0A 2ZH6A 2RRBA 4A8WA 1S5JA 3T41A 5ETPA 2C3PA 4DZ6A 1VSDA 2V4RA 3BEXA 3ICLA 3AB4B 3HD2A 2RE1A 4LFAF 4FL9A 4LFBJ 9ATCB 1HD0A 2K2PA 4XH1A 5HVFA 5ETNA 1T9TA 1T05A 1OYDA 1UFLA 1FWPA 4NOHA 2JLEA 2OPQA 2ZBRA 4LY7A 3QMLA 4B3TK 1EX8A 2XYHB 4FJHA 4EZ6A 5BYSA 2KL8A 2WFBA 4G1PA 1NB2A 3Q2SC 1RT2B 1DTTB 1SC3B 3MMBA 2OMOA 2VQEF 1UCNA 1FJEB 4JD2A 2YHAA 4C8NA 2XMUA 2VDIA 2W9AA 1C2PA 4NEZA 5FDLA 3M2VB 4CZKA 4HTUA 3LO3A 2UUBJ 1IWGA 4W5NA 4CEAA 4B17A 3EPIA 1WI8A 1XMQJ 4KRWA 2NRXA 1QVFR 3OYKA 2HK3A 4G1QB 3S3NA 3A8JA 4DMNA 1N8RT 2ZOGA 1VRUA 4MO5A 3K8VA 4TNOA 1NK6A 4B3SJ 3MHYA 3GFZA 5GAGI 3DAWA 2XNRA 5L39A 1VBZA 1BA0A 4PWDA 3PO5A 4ZJOA 1M5PC 3KMSA 2JEIA 2QG9B 4C1NK 5KG1A 3KUHA 4QWBA 1T11A 2CJKA 1RCXB 2YKPA 3IC1A 2AA4A 1FXDA 4CBXA 3IM9A 4FYVB 5JVHL 1RYSA 1J5OB 2WZ1A 1RT2A 4KV8B 1YHQS 3TR8A 3OBIA 5E3QA 2XZDB 3G82A 1YITN 4A2AA 3MWPA 2M4MA 1KP6A 4HUFA 4P74A 4M41A 3PW7A 2W6KA 4GKKJ 1W7WA 4FWQA 2VQEJ 4O4RA 1ZTTA 3KWMA 2BE2A 4MIWA 4H4MA 3IG1B 1JX4A 1B99A 3T19A 3NGYA 4ZVUB 3HXMA 3OYFA 4OX7A 2F8MA 2WONA 1FJGK 1S72S 4I64A 2IRUA 4CBUA 1SJ4P 1RDAA 3UCUP 3PZPA 1KS2A 2ZBPA 4A8OA 4X66F 2UXDF 1W2IA 1RWMB 4FWRA 3QEVA 3SSRA 2ILZA 5IS2A 1RT4B 5C24A 3DI6A 4GKJK 5LMUF 2KB2A 3MN5A 3NBPB 2DBBA 5DM6L 4Z4HA 4H5NA 3CMAN 4AHUA 3SDEB 1VHFA 3OHRA 1NO8A 1K8KA 4FF1A 3GIMA 5EWEA 1QSYA 1MMDA 3FRYA 3UD4P 3MM5B 3L3CA 3EXCX 4DUZF 1JLAB 4I2PA 5M1KA 3OTOK 4JV2A 2BJ8A 4GV9A 3MPWA 4O4GB 4ID1A 4CEFA 1UFWA 1Q82T 2F4VF 3L7PA 4K0KK 2M9KA 4ZLPA 4OZ1A 3THYA 4CZEA 2IYGA 2CIMA 3U02A 3D7SB 1SC6A 4IUFA