1VRTA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 145
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vrtA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vrtA05
4M3XA 1BHLA 2PYLA 2YNGB 3DLRA 3RBEA 3MEGA 3FDSA 2XI2A 2XWYA 1NK9A 3AVAA 1IKXA 3G6VA 2BE2A 2LSNA 1KVCA 3QLHA 1I39A 2W9BB 1N6QB 4W5NA 3UPFA 5D3GA 2C2DA 2DFHA 4CFCA 1RBVA 1ASVA 1TL1B 1CZBA 3CFPA 3F9KA 2Y1JA 4ELVA 3LAKA 3FQKA 4DSEA 1EX4A 4ZP8A 2HNZB 1WAJA 3D0PA 4MIAA 2OZMA 3QGIA 4CEAA 1RTHA 1GOAA 3S3NA 4WYLA 4J9LA 4XO0A 1S97A 1YT3A 1KLNA 4YFUA 3OL8A 2ETJA 4IG3A 1J5OB 1S6PB 1QSLA 3PW0A 3OYAA 3LWLA 3CM6A 3SFGA 2O5DA 3OL9A 2XO7A 2DFEA 4NLXA 1S6QA 3ZT4A 1K1QA 4CEFA 3HPOA 4NLDA 3KLIA 1S5JA 1Z25A 4FYDA 5HRPA 3CO9A 3OYJA 1S0OA 4FJNA 1S9FA 3LP0B 4I9LA 3CDWA 3KMQA 3K59A 4LQ3A 3I5AA 2YNHB 1HNVA 1ASWA 1RT6B 3GV7B 4WZMA 4DFJA 3HK2A 4JV0A 3CFRA 2JLEA 4OLAA 1HQUB 4KB0A 3T19A 1S9GB 3V6DA 3PX6A 5KGXA 3H5SA 4CJFA 1TKZA 4CJUA 3M8PA 4ZHRB 1HMVB 4PUOA 5F8JA 3MXMA 3Q8RB 2C28A 4F4XA 1LV5A 4DFKA 1K6YA 1T05A 4KRFA 3FSIA 2Z1IA 3NAEA 4ZVHA 3KMSA 3TAMB 4QPXA 1TKXA 3SNNA 2R2SA 5KT6A 3OYFA 1U47A 2IC3A 4IR1A 1SUQA 3NBPA 2BRKA 5KG5A 1D9FA 2BQ3A 1XHXA 2HAIA 4KAIA 4DTPA 4MH8A 2D0BA 1SH2A 4BWMA 1WNSA 2YKNB 4IDKB 3EYZA 4IFVA 3T5LA 2W8KA 1WN7A 5DG9A 5KG6A 4OPKA 1KLMB 3KLVA 1DTQA 4DTUA 4N41A 1ZBHA 2X6SA 1S1VB 2D3UA 2O4GA 1B9FA 1C2PA 3L3VA 1LWFB 4IRDA 3KLHB 2HNDA 1SL0A 5JS1A 3RB3A 5SWMA 3VA3A 3D5MA 4C8KA 3HSTB 4CEZA 1FK9B 4F3OA 4I7FB 2AGPA 1KVAA 1JLFB 4DG1B 2AWZA 3PW4A 1WSJA 5F8GA 3HVRA 2FVRA 2G8HA 1D0EA 1KHWA 3RMDA 4CGDA 4I2QB 1S1UA 4IRKA 1QS4A 4B3OB 3ZCMA 3DI6A 1C0MA 4ZPAA 4B9NA 4IRCA 2HVIA 5E41A 1TL3A 2FBYA 3IGVA 4OVLA 2QK9A 4CFBA 1KTQA 4ZVGA 4ECQA 3QIPB 3NDKA 3NF9A 1QSSA 3K58A 2R2RA 3M8SA 2NUBA 4R5PB 1RBRA 4B8CA 3OYNA 4ED8A 1LAWA 3KD1E 4CEDA 4WFYA 2YNFA 1XC9A 1Q8IA 1IKWA 5L1JA 2HHSA 2VG6A 4Q45A 3TAFA 3DMJA 3QEIA 4YR3A 2XY5A 3BGRA 4CHYA 1X9WA 3AO2A 3SQ1A 3KLEB 3DRSB 4Q8FA 4M3RA 3KK3B 4TY8B 4NLQA 1TAUA 1EXQA 3AA4A 2OZSA 4M3UA 1VSKA 4AH9A 5DGAA 1BCMA 4YNQA 3K2PA 1J9AA 3VQ4A 4FK2A 4CF1A 3PV8A 3MECB 4MK7A 4ICLA 2HMIB 1SV5B 3GIKA 4WFXA 4ZP7A 3HKWA 4IH7A 2VA2A 3D28A 3K5OA 2IBKA 3NF8A 3N6LA 1SKRA 2XCAA 1U09A 3KLGB 1BQNA 3L2VA 3LP2A 2FBVA 3GYNA 2HHXA 4CE9A 1JLCA 3QZ8A 3SUQA 4JRPA 1C1AA 4J9PA 4IFYA 1NK8A 4AILC 2W7PA 2D5RA 4NLPA 5CZ2A 4KHSA 3PVXA 1JLBA 1S10A 3LZIA 3P83D 3V9XA 4LD0A 1JKHB 2GIQA 2IJFA 1RYSA 4CIEA 4U6PA 4CJTA 3Q8QB 4F2RA 3OLAA 2OPSB 2XCPA 3VQ5A 3M8RA 3IGNA 1CXUA 5C24B 3VA0A 2AGOA 2RDIA 1REVA 2D3ZA 3HVWA 2VWJA 3GILA 3QESA 3C6TB 4I9QA 1JLEB 1QUVA 4KHUA 4PA1A 4FXDA 4IR9A 3ITHA 1VSJA 3DOLB 3BDPA 1X9SA 4ED6A 5DQHA 4RW6B 4NLYA 3WNEA 1RILA 1JLAA 1UA0A 4C8LA 3NH0A 4FM0A 1RT3B 3H5UA 4CHNA 1SKSA 3HVTA 5C25B 4RZRA 5EWEA 1WSGA 4HUGA 5EWGA 4F3TA 2OA8A 4BWJA 3O3GA 1GOBA 1FKPA 1N5YA 3KKRA 3RRGA 2KFNA 2W8LA 5HLFB 1TK5A 2ZQBA 4KHWA 4JS5A 3EPIA 4OPJA 5HRNA 4LSNA 3S3MA 3HPHA 3SI6A 4CJSA 5J2NB 3D45A 2B5JB 4MK9A 4KV8A 2CJQA 2ASJA 4Z0UA 4ED7A 3FFIA 3H5XA 4K8XA 4TY9A 5L1IA 4BE0A 2B6AB 4OKEA 1RT1B 3JSMB 3LP3A 2YNIB 2IDOA 5EDWA 5KG1A 2JC0A 1C6VA 1U04A 2B4JA 3K5MA 1JX4A 2XHBA 3P5JA 3PJWA 5HP1A 4RW4B 4Y1DA 4DF4A 2Q3SA 1CSJA 1VRUB 3I0RB 2WRMA 1NKCA 4O44A 1L5UA 1Y97A 1RA6A 3AVMA 3E01A 2G8FA 3QEVA 1JL2A 3AVGA 3VQAA 3CWJA 2Y1IA 1S48A 3V1RA 1VK0A 1ITGA 1HARA 4NCGB 1T8EA 3MFIA 2FLNA 2WTFA 3OHAA 4RW8A 2F8SA 3LALA 3DOKB 3RRHA 3NFAA 1CLQA 2E9TA 5C5JA 1VSEA 3RAQA 2HB5A 5KRSA 5KFCA 4DWIA 1GOCA 3AVHA 1RTJA 4JS4A 3C94A 5CYMA 3ISND 2ZD1B 3L2WA 3KIOA 4Z4HA 4PY5A 4OGCA 5J2PA 3V9ZA 3IN5A 1WNEA 2WONA 5DG7A 1QE1B 1NNDA 4PQUA 4CGGA 2ASDA 5KFOA 2BQUA 3O3HA 3LWMA 3QO9B 1HYVA 3G86A 4Z4GA 5HRRA 3DYAA 2HHWA 4KFBA 4H54A 4KHRA 3MEDA 4G3IA 3BQ2A 4ED3A 4DL2A 1S1TB 5KG2A 3SFUA 4BDPA 3KK2B 3MEGB 4HKQA 4FW1A 5KFBA 1ZBFA 2OYQA 1KFDA 4ZVEA 2C22A 4DTSA 2KTQA 1CZ9A 4PWDB 4Y2AA 1RT7A 4FLXA 1IKXB 4WZQA 4KI4A 4URGA 1RDBA 4F4ZA 2RF2A 3AVBA 4EEYA 1HQEA 2E9ZA 5HBMA 4LQ9A 4HYKA 3QYYA 1U4BA 4ED2A 3KNAA 4RW9A 3MEEA 1RTIA 5KFLA 2ILYA 4WE1B 1YVFA 2OPPA 3RBDA 2F8TA 1T7PA 4FS1A 2WB4A 3OYCA 1NKBA 1W0HA 1QAIA 3IS9B 3V4IB 5KFQA 4E19A 3U3YA 4N5SA 4I2PB 4UQGA 1JLGB 3LP1A 3CDUA 1DTTB 3WNGA 4K4VA 2VA3A 3O3FA 3VQCA 5KFEA 1MU2B 4MFBB 3AVCA 3KJVA 3GIMA 4R8UA 2V0NA 1HNVB 3SUOA 5KG4A 4RNHA 4ID5A 4ECSA 2UVVA 3I8DA 3OSPA 3DLGA 3AVKA 1D9DA 3O4QA 1C1BB 3ZSYA 3V81B 1VSMA 4OGEA 2WCXA 3TABA 4QWAA 2YKMB 3T1AA 4ZPCA 3I0SB 2XRIA 4EBEA 5J2QB 4DSKA 5KFYA 3LPTA 4Z4IA 1EP4A 1CXQA 4QWDA 2WOMA 2W9CB 5J2MA 1C1CA 3DLEB 1BI4A 5J1EA 1LWCA 4W5RA 1T3NA 3QEWA 3BSAA 3CM5A 1B92A 3NGIA 4FJJA 5C42A 2E4LA 3LZJA 3ULDA 2QE5A 3H59A 4KO0B 4NLSA 4AHVA 1BISA 1WSFA 2P5GA 4O0JA 2JEIA 3TVKA 4OLBA 2RKIB 1VSIA 4KB1A 3O4NA 3MXJA 4RUCA 3SV4A 4O3RA 2FLLA 1RT4B 1TK8A 1HJRA 3EY1A 2J6SA 4C8OA 5CYQB 2YNGA 4L8RB 4ZPDA 4BACA 4DLEA 4DFPA 3THVA 3QZ7A 2R8GA 5EU7A 4CEOA 1NJXA 3QNOA 5KRTA 4M94A 1S9EB 3SPYA 4XPEA 1S1XB 5DQGA 4ZVFA 4H8KA 2ZKUA 2W9BA 1N6QA 3IG1B 3H4BA 1NK5A 4IH5A 3MF5A 4CJ4A 1TAQA 1TL1A 1VRTA 3CJ0A 3TQ1A 5DG8A 3NF7A 4KE5A 1QHTA 2ITGA 2QXFA 5L1KA 1B9DA 4DTJA 2HNZA 4WXWA 2DPIA 5CZ1A 2DTUA 1FKOB 4NRUA 3PW2A 3NMAA 1J53A 3OYEA 2FJVA 3VQ8A 1EETB 1VSDA 1YVUA 2IOCA 4QAGA 3VQBA 5KFPA 1TV6B 4ELTA 4FZXC 4FJKA 1S6PA 5JS2A 4DTXA 1Q9XA 1K1SA 4W5OA 1T03B 4NLWA 4MKBA 4B08A 3SV3A 4Y1CA 2VG6B 2F96A 4N56A 3OS2A 2CKWA 3LP0A 2KZZA 2YNHA 1R0AB 1RT6A 3IRXB 4FJ8A 4DTOA 5KFUA 3HPGA 4U7CA 3RMBA 3N6MA 3Q8PB 1HQUA 1S9GA 4B9TA 4EYIB 2GV9A 3QIOA 4CECA 4QCLA 2IMWP 1RCHA 3OLBA 4ZHRA 1JLQB 1HMVA 4B8AB 4AHUA 4WXOA 4IOBA 4J9OA 4NLOA 4NYFA 1MMLA 1RTDB 1XHZA 1IH7A 5KFZA 2X74A 2FVPA 3TAMA 1IKYB 1BCOA 4AHTA 3OYKA 4DQIA 1F21A 4CF8A 2AQ4A 1NK6A 4ECWA 3T5HA 4EYHB 3ZT1A 4ECUA 3VQSA 3AVLA 3TWHA 4DU4A 4NLRA 2XGPA 4ZTJA 2YKNA 3V6JA 4IDKA 2Z1GA 2BANB 4C8NA 3QNNA 4IBNA 1QSYA 4FLVA 2YV0X 3DLBA 1RDCA 1NJZA 1KLMA 3OJSA 3M8QA 4J2BA 4K8ZA 4Q44A 4O5BA 3G0ZA 3CIZA 1LWFA 3KLHA 3HVAA 4O3QA 4DSIA 4TYAA 4DL5A 1RBUA 5KFJA 3DM2B 4CJWA 2OH2A 1FK9A 1HNIB 4EO8A 1HPZB 1JLFA 4DG1A 1Z4UA 3NHGA 2ZE2B 5KFAA 4KBIA 4W5QA 2FJXA 1JXEA 4I2QA 4B3OA 4CEEA 1XR6A 4CF0A 3KK1B 2V9WA 4QOZB 4DTNA 1IM4A 1SH0A 4E7HA 4O4GB 3PJXA 4J9QA 4E7IA 3PO4A 2IJNA 3PY8A 3TAEA 4YP3A 3BREA 4R0EA 1U45A 3I5CA 4TN2A 4IKFA 2UVWA 3L2RA 4R5PA 2B43A 3SQ0A 4K50A 4DSFA 3P1GA 2ILZA 1G15A 4HCCA 2UVUA 3OYIA 3AO1A 1I6JA 3SUNA 2HHTA 1RDDA 1J54A 5KT2A 4G1QB 4ZP9A 2GBZA 4CK2A 1LW2B 4J9NA 4E1NA 4KKOB 3VQPA 3QINA 2HWIA 2FBXA 1NOYA 3DRSA 3KK3A 4NYNA 3H08A 2YHBA 2GC8A 3DRRB 4TY8A 4F50A 3EZUA 4FJ7A 3V6HA 4DL6A 3ZSXA 4Z4CA 1X1PA 1BQMB 1FXXA 4W5TA 4K4ZA 4FM1A 3QIDA 2V4QA 4FJIA 3MECA 2W42A 1YTUA 3DRPB 3AA2A 3HP9A 2HMIA 1SV5A 2UUWA 2VWKA 5K14B 4DU3A 4DTMA 3ISNC 2VG5B 2RN2A 4IG0B 2BGGA 2PYJA 3NE6A 1RDAA 3KLGA 1BL3A 1C0UB 1QQCA 3V9SA 3G6XA 3ICLA 4DF8A 3TAPA 3CJ2A 3KLFB 4BDYA 4DU1A 2AX0A 2AX1A 3FQLA 3LPUA 3HT3A 5DK5A 1TGOA 3UDLA 4WFZA 4B9MA 4RW7B 4FJXA 3K5LA 5HROB 1TKTA 1RT5B 2XY8A 1JKHA 1WSEA 3NAIA 5KT4A 4LSLB 2IM2A 1HYSB 4H4MA 2HNYB 2OPSA 3M9MB 2AJQA 5KFXA 1LWEB 5CYMB 4HHTA 3DLKA 5C24A 2PY5A 2V4RA 4DL7A 4DS5A 1RT2B 4EZ9A 3K57A 5T14A 3C6TA 5F9NA 1JLEA 4H4OB 3OVNA 2D0AA 3DYAB 4CHPA 4FLTA 4FCYA 2QKBA 3DOLA 4B9LA 4BE1A 3VN5A 1NK4A 4CGFA 1VSFA 3UR0A 4FLYA 2A1RA 4Q0BB 1QAJA 1TVRB 1RT3A 2P5OA 1Q9YA 5FDLB 5KFFA 4C8MA 3CYMA 2OPQB 5C25A 1YTAA 3NGDA 3NF6A 5DMRA 4CJQA 3SPZA 2Z1HA 2EX3A 2BQRA 1C0TB 1S1WB 3RB6A 4FW2A 1IKVB 4E7KA 1KHVA 4B9UA 4WYWA 5HLFA 2OPRB 4QWCA 2I5JB 2O4IA 5FRNA 5I3UB 3V6KA 2JEGA 5J2NA 3C6UB 2B5JA 3SQ2A 2IAJB 4FK0A 5FRMA 4ED1A 3KHRA 4CJKA 2WK4A 3NGYA 1D8YA 5I42B 4JLHA 2IA6A 2ALZA 3BQ1A 1NK0A 4DMNA 4J2AA 3V1OA 4CHQA 3RR8A 1SH3A 1ZTTA 2B6AA 1LW0B 3UQSA 1S0NA 4Z4FA 4KTWA 1RT1A 3JSMA 3ASMA 2IGIA 2YNIA 1IO2A 4OJRA 3ZSVA 3NCIA 4DQSA 1NJYA 4NLTA 4Y2CA 3TANA 1UWBA 4KAZA 3M9NB 4RW4A 4Q8EA 3U6FA 3AVIA 4BE2A 1LAVA 1DLOA 3MR2A 4AHRA 3I0RA 2BE2B 2JEFA 5KTQA 4HVJA 3PX0A 2VG7A 3KOAA 3QLHB 2HWHA 5EUHA 2AGQA 5D3GB 4EO6A 1TKDA 4ZPBA 4KTQA 1KRPA 4FJHA 3AA5X 4QW8A 4FJMA 2UVRA 4NCGA 3GIIA 4URSA 3SCXA 2BDPA 4FS2A 3GV5B 4KHYA 4K4YA 4KHQA 3DOKA 2FC0A 1RTHB 3MR3A 4NCAA 4FJ5A 2DPJA 1BIZA 1XWLA 3E51A 3A2FA 4IG3B 3M9OB 3OYBA 4URQU 4DTRA 3MXIA 3RTVA 4CK3A 3KHGA 2WHOA 2JGUA 3VQ9A 2ZD1A 1S6QB 2G8IA 1U48A 4CESA 3RB4A 4M95A 2E9RX 3KLIB 1XR7A 4CIFA 3KHHA 1QE1A 4CERA 3H4DA 5FROA 4CJRA 5KFTA 2YHAA 3QETA 3TR8A 1ZBIA 3QO9A 3BQ0A 4ECRA 5KFRA 4NLGA 4Q43A 4GC6A 5KT3A 1S1TA 3KD5E 3AVNA 4M41A 3G10A 4DQQA 1SKWA 3V6DB 5KT7A 1TKZB 3KK2A 3H2LA 2KQ2A 3LDSA 4HUFA 3V9UA 1D5AA 3M8PB 4PUOB 4M3TA 4PWDA 1TQLA 5KGWA 1T94A 4MKAA 4ECYA 2DFFA 4ZMMA 1T05B 5L1LA 4ECZA 2HVHA 3EPGA 2R8IA 1TKXB 4J2DA 4X2BA 4O0IA 2IC3B 3EZ5A 3NL0A 5KFKA 3PZPA 4KPYA 1SUQB 4FVMA 3NBPB 3HXMA 1VRTB 2BRLA 1NJWA 4TQSA 4KREA 3QGGA 5DQIA 4WE1A 4M42A 1HRHA 3KKSA 3F73A 3H98A 3U3GA 3SQ4A 4HCBA 4KSEB 2G8WA 3FRZA 4DL3A 1N48A 3CFOA 4IFVB 3IS9A 2QV6A 3TI0A 3L2QA 3V4IA 4NCBA 3PHEA 5F8IA 3VQ7A 3RR7A 4I2PA 4TYBA 4QWEA 1DTQB 1JLGA 3RB0A 3JYTA 1RNHA 4J9MA 4FBTA 4J9SA 5F8MA 4B9SA 1DTTA 4MQ3A 1WSIA 1O1WA 4KHNA 3SJJA 4ELUA 3UIQA 2HNDB 4ZTFA 4QWBA 1MU2A 3CJ3A 4MFBA 4KI6A 1SL1A 3TARA 2R2TA 4DS4A 3NH2A 3DDKA 4DL4A 4NLVA 2C2EA 4NZ0A 4FBUA 3PW7A 3V9WA 2KFZA 2ATQA 4CJVA 1JL1A 4LH5A 1C1BA 1BGXT 3V81A 3T5KA 1N56A 4M3ZA 1S1UB 2R2UA 4KB7A 1A5XA 3DI6B 2YKMA 3I0SA 1RYRA 5EWFA 5KFSA 1TL3B 4CJPA 5J2QA 4M45A 4F2SA 1X9MA 5F9LA 4K4UA 3V1QA 1RA7A 2W9CA 4DQPA 3DLEA 4KTZA 4ECVA 1EKEA 4CJEA 1RAJA 1J5OA 5F8LA 5DLFA 3PO5A 3I5BA 3ZSZA 3BSOA 4CFAA 2YNFB 3BSCA 3L2UA 4E0DA 1IKWB 4KO0A 3KTQA 5KFMA 4QW9A 2XY6A 3DMJB 3VQ6A 2RKIA 3AO5A 4LY7A 3BGRB 4CGJA 1A5VA 4F4YA 3CDEA 3M8QB 1S49A 3RAXA 1RT4A 5KG0A 5KG7A 1L3UA 1ZTWA 1I3AA 4CEQA 4CIGA 2EHGA 5CYQA 3QERA 3IAYA 1WLJA 4IQXA 4ECTA 2A1SA 2HW3A 4RU9A 2IS3A 3LAMA 3WNHA 4Q5VA 4RUAA 2J6TA 4N76A 1S9EA 4ICLB 1S1XA 4BDZA 3OS1A 3IG1A 2RDJA 2QKKA 4J9RA 1BQNB 5KFVA 3LP2B 4ID1A 4OL8A 2ATLA 3OL6A 2G8UA 4FK4A 3PX4A 5T7BA 4IH6A 1JLCB 3OYLA 5KFHA 3OHBA 3HP6A 1D1UA 1SL2A 1KFSA 1NK7A 4IFYB 4CFDA 1FKOA 2R8HA 3TAGA 1EETA 4Y34A 1TV6A 5KFIA 1JLBB 4RNFA 1S1VA 2Z1JA 4FM2A 3MFHA 3HHKA 3PUFA 2W9AA 4CJ5A 3T3FA 4E7JA 1T03A 3OYGA 3KHLA 1RBSA 5KG3A 4E7LA 4M3WA 1VSLA 4F4KA 2KW4A 4DSLA 3GQCA 4OKKA 1UAXA 3RMAA 4E89A 3MAQA 1R0AA 3QEXA 4I7FA 3IRXA 3QGHA 1REVB 3HM9A 2F8EX 3N6NA 3MR6A 1OS5A 4DQRA 3ITHB 4FLUA 1JLQA 1VSHA 1ZYQA 1Z26A 1JLAB 5HRSA 3BSNA 4Z4EA 3ZT0A 4NYZA 1RTDA 2RPIA 3AVJA 3OS0A 3QIPA 4EZ6A 5DLGA 2X6NA 3HVTB 4J2EA 1IKYA 3CQ8A 4RG8A 5DGBA 3L3UA 3SZ2A 4ZP6A 3OYHA 4RNMA 1FKPB 1N5YB 2G8VA 3OL7A 3MR5A 2JEJA 2BANA 4LSNB 1S4FA 4O4RA 3AO3A 3B6OA 3H40A 4GC7A 3ZT2A 3TAQA 4O55A 4TXSA 4KV8B 1RBTA 3KLEA 1TKTB 4ECXA 1N4LA 5CY4A 3FFIB 2D0CA 2R7YA 4XIUA 4FLWA 3CJ5A 1ZBLA 5F8HA 3SYZA 4H4MB 5KFDA 1UOCA 3DM2A 3ZSOA 2FLPA 1JIHA 5KFWA 1HNIA 3DLKB 3OYDA 3OJUA 1HPZA 3CG7A 4ED0A 3K5NA 5HP1B 2ZE2A 3PR5B 4K4SA 4EP4A 3AV9A 3GIJA 4M3YA 4IKAA 3RWUA 2IM3A 4LH4A 4B9VA 4CHZA 4O44B 4DEZA 1KSPA 3KK1A 2HHVA 3HO1A 2DY4A 3E01B 4EP5A 4CCHA 3OYMA 3NKYA 4O4GA 5KT5A 1NHUA 4Y3CA 3ZSWA 3OY9A 4TQRA 1L3TA 4F4WA 2AU0A 3AO4A 3AA3A 4TSXA 4FJ9A 4K4WA 1HYZA 4RW8B 4O3SA 1U49A 3CJ4A 5SZTA 3HJFA 3ALYA 4FZYA 4DSJA 1S0MA 4G1QA 1LW2A 1RTJB 4O3NA 4KKOA 1TK0A 4OKJA 3QEPA 2EC0A 2IM1A 5J2PB 2P51A 1JXBA 1KCFA 2GUIA 3H5YA 4FLZA 2WONB 4PQUB 2R8KA 3DRRA 4EBCA 3SUPA 2G8KA 1BIUA 2XC9A 4RNOA 4YR2A 1W25A 4JUZA 3BR9A 4CF9A 4KFBB 1BQMA 3LANA 3MEDB 4YR0A 4RW6A 3OSNA 1RDRA 2JC1A 2ASLA 3VQQA 2X78A 4GMJB 3PW5A 3DRPA 4FJGA 4GW6A 2FVCA 1UWBB 4DFMA 5K14A 2VG5A 2GIRA 3S3OA 4IG0A 1DLOB 1TP7A 1RT7B 3PR4A 1IG9A 4K4TA 4KHMA 2XI3A 4O3PA 2IM0A 2VG7B 1C0UA 3L8BA 2HHQA 2RF2B 2D7SA 1HQEB 1WSHA 5HBMB 4CGHA 2C2RA 3ZSQA 3KLFA 4MK8A 4DLGA 4RW9B 4K4XA 4GVMA 3MEEB 1XR5A 5KI6A 1RTIB 3VQEA 2XY7A 2UUTA 2OPPB 3C95A 3NGZA 4HUEA 2FBTA 4RW7A 3HYFA 2D41A 5HROA 4NLUA 1RT5A 2FJWA 4NRTA 5JXSA 4AHCA 2R8JA 4LSLA 1KVBA 1HYSA 4AHSA 2HNYA 4N47A 2W7OA 3GV8B 2J6UA 3LP1B 3HL8A 1LWEA 1GX5A 2FVQA 1WAFA 4CJLA 4RNNA 1ASUA 1RT2A 4O3OA 3KJVB 4R8UB 4TLRA 4H4OA 1W9HA 1VRUA 2E6LA 4ID5B 5KFNA 1ZBUA 3AVFA 3DLGB 4EBDA 4J9KA 4XPCA 4YQWA 3ZT3A 4E1MA 3CVKA 4CEBA 3MTKA 4Q0BA 4YMEA 1TVRA 4CHOA 5F8NA 4CJ3A 2PZSA 5FDLA 4CK1A 4FJLA 3SI8A 3NH1A 3VQDA 2OPQA 4MIBA 2FVSA 1EP4B 1XI1A 1QTMA 3S9HA 1GX6A 2WOMB 1C0TA 5J2MB 3Q8SB 1UA1A 1S1WA 3WNFA 4JV2A 1C1CB 5KFGA 4HTUA 1BI4B 1A5WA 3ZSRA 3RMCA 5J1EB 1LWCB 4JV1A 1IKVA 2OPRA 2I1RA 4JRQA 4CF2A 3DLHA 2I5JA 2E6MA 4FZZA 1NOZA 1L3VA 3NAHA 5C42B 5I3UA 5L9XA 1L3SA 3C6UA 4E3SA 2IAJA 3BJYA 4F8RA 3B6PA 5I42A 1NHVA 2HHUA 2KZMA 5JUMA 3G6YA 1NKEA 2BR0A 2XGQA 1LW0A 2P1JA 1JXLA 3T5JA 4CGIA 1ZETA 3JYTB
chains in the Genus database with same CATH superfamily
4M3XA 1OY8A 2NXJA 4I0WA 3SQOP 2YNGB 3B6BA 1IBMJ 3EDRB 1Y5NB 4CH1A 4XTTA 2H3EB 3MEGA 5E3RA 3DGPA 3D0GE 3K5PA 2BYCA 3BH6B 3KWMA 2DK2A 4DR1F 1NK9A 3AVAA 3CJBA 1X0PA 2NYIA 2LSNA 3MCMA 3SMSA 2CPYA 1GXLA 4C0OC 1HWKA 4W5NA 3T1YJ 4CFCA 4K25A 2X1BA 1CJUB 2N7CA 1LEOA 3JSBA 1HNXJ 3CFPA 5AQRA 2VIHA 5HQMA 2Y1LB 1FDDA 3FQKA 3AA8A 2VBXA 3GJQB 2HNZB 1WAJA 3QGIA 4CEAA 1RTHA 1YT3A 1YVNA 4DKWA 1F60B 1YHQN 3PW0A 3OYAA 3LWLA 3GMGA 4YOTA 3ZT4A 2HFNA 3N28A 3R5AA 2DXDA 2B4OA 4NLDA 2V2ZA 2DHSA 2VOOA 4YDUC 3HOSA 2NPIA 3OYJA 4FJNA 3LP0B 3KMQA 4LQ3A 1ZZNA 1HNVA 4TU9A 1AYEA 3BKUA 3UWTA 2Q36A 4ZJLA 4DUYJ 3CFRA 3TVYA 3V6DA 3PX6A 3RYLA 1URNA 2P9KB 5F8JA 1FRIA 3MXMA 1N34J 1LV5A 4WJBA 4FF4A 2H5JB 2Z1IA 4ZVHA 3KMSA 4QPXA 1TKXA 1X5PA 2I9SA 1U47A 2FC9A 1SUQA 1K8AT 3CE8A 4Z7CA 4JKDA 4H5RA 2HAIA 4DTPA 5ADXA 1SH2A 1RWNB 4QIWD 2HF4A 2QTDA 1WSVA 2YKNB 4HHJA 3EYZA 2W8KA 1WN7A 1NMNA 1E4GT 2LA4A 1DTQA 4DTUA 1ZBHA 2BTFA 2AYEA 3BDEA 3MDQA 4P74A 3T41A 4JI0K 3RBXA 1LWFB 3KLHB 2HNDA 1SPBP 3D5MA 2QMWA 1WDDA 3PACA 2AGPA 1YIJS 5U47A 3ZX0A 4CT8A 5F8GA 1QZ6A 1HPMA 3B78A 4IRKA 4FDFA 4JI2K 3FE1A 3DI6A 2YPZA 1C0MA 4B9NA 3IGVA 1KTQA 3N4WA 4ZVGA 3H6EA 3TX8A 4LRBA 3NDKA 4DV4J 3A3NB 1NLVA 2YY3A 1VGYA 4DCJB 3FVYA 3LL3A 4DX6A 3N79A 2MZQA 1LKZA 2YCHA 1KKHA 1R8AA 4QBUA 2XYHB 3WC0A 4CEDA 5CE3A 2ITMA 4QPTA 1Q8IA 2XYPB 5LMUF 4CH7A 2QG9B 2ZJQQ 3DMJA 4Z7YA 4OX8A 1E6VB 5JVHL 4I6YA 2Z4PA 2OMOA 4CRJA 2D4WA 4Q8FA 3R5JB 2E5LK 1NUEA 1EXQA 3SXLA 3I6PA 3D2EA 2F65A 5ITHA 3GP9A 2DGUA 4YNQA 1FKAF 3MGJA 1J9AA 5L46A 3VQ4A 3ZZZA 4NI2A 1SV5B 4NZ7A 1RAAB 1BHNA 2XBPA 4H0TB 2ZBQA 4GVBA 2XCAA 2MKYA 2ZH7A 1KQKA 3KLGB 2RT3A 4A46A 3L7OA 5BR8J 5HVFA 3O1LA 4B3TK 5LJWA 4BR5A 4KGKA 1C1AA 2MQLA 1HW8A 1S7HA 3J7YI 4J9PA 4CBWA 2B4UA 2W7PA 2DITA 3L9ZA 4BGAA 3BGOP 3H45C 3ENQA 2H3GX 3V9XA 3SJHA 4KGMA 1RYSA 1W7AA 1KQSR 4NE9C 4L72B 4CJTA 3KUGA 4ZDNA 2PSZA 4CLLA 3M2VB 1NGAA 2IFXA 2XCPA 3H2VE 3IGNA 4RU2A 1WUUA 3MX2A 1VQ9N 4DZ6A 1YG0A 5IT9Y 3HVWA 4JBCA 1VQ4S 3H90A 4JI6F 4IR9A 3BDPA 2V52B 1V4TA 4NLYA 1RILA 2CWKA 4GRSA 1BWVA 4M63C 3M2RB 2KI2A 2E1YA 1DKGD 2N4DA 3SDEB 3E9PA 3H5UA 1GFWB 1NGDA 3NNCA 3R6LB 2GNKA 3D3BJ 4F3TA 1U26A 5I3PA 3N0VA 1W2BM 1V3ZA 2VQFJ 1FKPA 3S6EA 2A1BA 1N5YA 2D1CA 3RRGA 3UN2A 3CCWA 4RWTA 1F3FA 3AODA 2X1FA 5KOWA 4TLQA 3EPIA 3ZX3A 4C2MA 5AE3A 3S3MA 2NZTA 4DV0K 5J2NB 1IR1A 2IA0A 4DPWA 2Z30B 3NG8A 4BRCA 1EKRA 4LF9F 4LF7F 4ED7A 3KWGA 3GL1A 5L1IA 1VQ7S 2B6AB 2W24A 4IXCA 4FPBA 3JSMB 3LP3A 2XO6A 1GTHA 2YNIB 2VFTA 1C6VA 1JX4A 2DNNA 4OYXA 1JMTA 4YOXA 3PJWA 1AA1B 2VU5A 2MLYA 4X4PA 4ETZA 4ETXA 1Y97A 3QBCA 4DV4K 3VF2A 3SCIE 3E01A 4KY3A 3QGPA 1KVIA 1NPRA 3V1RA 3HTVA 4NCGB 4RTFD 4FPRA 2FLNA 4DV5K 1P8ZA 1H38A 3K17A 2WTFA 2YWFA 4DR7F 3RRHA 4QU6A 3VQTA 5C5JA 5C15A 3CC7N 4JD2B 2HB5A 3FNNA 1TFYA 3IUCA 1GOCA 1CJVB 5EX0A 4A59A 4LT6A 4JS4A 1MWYA 1PC4A 3CCQN 3ISND 1M5HA 3KIOA 2ZEJA 4PY5A 3V9ZA 4OYWA 3IN5A 1QE1B 4X62F 1R89A 4PKGA 1GMVA 4Z4GA 1WELA 3DYAA 3CCUN 4M1KA 4G3IA 1S1TB 1CVJA 4DR4F 2DO4A 1E3MA 3AHPA 5KFBA 3Q22A 3AAQA 5LMUJ 2MY8A 1CZ9A 5HI7A 2MQMA 1RDBA 2B7CB 3AVBA 4PWWA 4DBQA 2AP6A 5HBMA 2QX0A 3HD2A 3QYYA 5LJ3Y 4JKHA 4I56A 4DR1K 1RTIA 5KFLA 1YVFA 2OPPA 3RBDA 5BJRA 4FS1A 2DGQA 2WB4A 3PSFA 1N88A 2LQ9A 3OYCA 3ET6A 4OYZA 3IS9B 4DL0C 2ZM6F 3U3YA 4JI4F 1XQSC 3BYPA 1VFJA 3UI3A 3CDUA 1DTTB 1NM1A 2QWNA 4DN0A 2ZKTA 4K4VA 2VA3A 2WVFA 4ZN3A 5KFEA 2YKAA 4LFAF 2IVMA 3KJVA 2UU9K 2FDNA 2FYXA 2V0NA 5KG4A 5AQSA 4ID5A 4USHA 4IJNA 3OUYA 3I8DA 3OSPA 3HF5A 2CJXB 3CD0A 3I4HX 1PJ5A 1F2GA 1C1BB 3ZSYA 1SIWB 5ETRA 2F7TA 2WCXA 2AIRB 4HEA9 3OTBA 1SXLA 5DDRC 1RBLA 2OEMA 2ZJQL 5J2QB 5KFYA 3LPTA 4Z4IA 1MDUB 2ZGYA 4OZ2A 4A61A 5AZJB 5J2MA 1OYEA 2MPUA 2IYGA 2F8MA 4RL1A 1KXPA 2NYHA 3JXUA 1B99A 4C1NI 4HL9A 3CC2S 3DWLA 1DBDA 4JI6J 1P8GA 4AT1B 4DCHA 5B09A 3H59A 2HBRB 3HSDA 2BUNA 1BISA 2CPHA 1WSFA 5LL6d 2P5GA 2HYIB 3QRRA 1DT9A 4DMZA 3A8YA 3H1QA 3O4NA 4O8UA 3W1YC 3OXLA 2HZCA 1F3VA 3K9JA 1YK9A 3HMJG 2CDRB 1SC3B 5CYQB 2YNGA 2UXBF 2PD1A 1X4FA 2HGNA 4EI2A 4BACA 1U1OA 2W40A 2KO1A 3QZ7A 2R8GA 5EU7A 4CEOA 5KRTA 2F4VF 1RWXB 3QMLA 1S9EB 2DR9A 4LR8A 4XPEA 1S1XB 1SI9A 2KKZA 3GFXA 4LF9J 3MF5A 2YTCA 3TQ1A 3L7PA 2Y8WA 1HWJA 4GKJF 1QHTA 2AT1B 4QR2A 2QXFA 1QAXA 2M52A 1UMJA 2OI2A 1VS3A 2HNZA 4WXWA 5M1OA 2DTUA 3CJ1A 1FKOB 4M8LA 1J53A 2FJVA 3VQ8A 1EETB 4ELTA 1YVUA 2IOCA 4QAGA 4FJKA 3GYXB 4FZXC 1RU2A 4YOVA 2AZ3A 2EFPA 3B8AX 5JS2A 4MDAA 1UETA 1OY6A 1WKLA 2AEMA 3HRGA 2H54B 2XLJA 4LVOP 4B08A 1EWRA 3IFRA 2VG6B 2FHJA 2ZVIA 3LP0A 3CDBA 3F0NA 4P2XA 2E29A 1Q18A 2KG1A 3ZXWA 3HPGA 4U7CA 5LMUK 3J80U 1TUWA 4B9TA 4QCLA 2IMWP 1RHMB 4V19J 2P9KA 2U2FA 3OLBA 3D9BA 1J5EJ 2C42A 2HGLA 4IOBA 4NLOA 1RTDB 2OHDA 4CTAB 4C1NK 3NGUA 1BCOA 2QWLA 3OYKA 2AQ4A 3MM6B 3OBYA 4DDFA 4X62J 2FHJD 1ILYA 4JYAK 3VQSA 3TWHA 3IWNC 4M5KA 4RPFA 2R7XA 2XGPA 2YKNA 4YN3B 4DR4J 1Y3KA 2BANB 4C8NA 2PI5A 3QNNA 4IBNA 3RGIA 1T44A 2V67A 4J2BA 3CEDA 1YBAA 5BYSA 3AB4B 3G0ZA 4C98A 3CIZA 4X4RA 3ZNJ1 1LWFA 2NXUA 2MZSA 3KLHA 3AXKA 5KFJA 1X4BA 3FBFA 1AZSB 1DGKN 3ZZPA 2OH2A 1HNIB 4EO8A 2BW2A 4KRWA 3GE1A 1V5IB 1A9NB 2ZE2B 1X5OA 5KFAA 1VQNN 4X4SA 3OPKA 2HBZB 1PC5A 4CEEA 2ZM6J 2VASA 4QOZB 2G13A 4DR3J 2CIMA 4DTNA 4USJC 2Z56B 1PAUB 5E7OB 5IV4A 4ID8A 4J9QA 1VQLS 4JI6K 3KNGA 3O44A 4DR5J 3BN7A 4TN2A 1FRMA 4IKFA 3L2RA 5B0CA 2MZRA 2B43A 2BOAA 1NJIT 1I6JA 2FB0A 3MM5B 3I96A 1RDDA 2G0JA 4H0XB 1UFLA 5KT2A 4G1QB 4CK2A 1S12A 5IWAJ 4E1NA 4KKOB 1E6VA 3OR2B 4M5IA 2FBXA 2MKCA 2DY1A 4NYNA 1CC7A 3GPAA 2GC8A 3DRRB 4ZIWA 1PIEA 1Q7YT 2CH5A 1KN6A 2LA6A 4OX6A 1YITS 4FM1A 3VAKA 1MMNA 1KOHA 2QLFB 3AOAA 2CVIA 3QIDA 4FJIA 4LF9K 3K89A 2VOPA 5ETNA 4M7YA 4JI5J 3DDIA 4LF7K 1SV5A 2AV5A 2PAVA 5C0YA 4PL7A 2EXUA 2VG5B 4LF8J 1U6ZA 1XTZA 4ZVTB 2MTLA 2VGNA 4HHUA 3KLGA 2E1ZA 2B0GA 2IRUA 3S7RA 3QWUA 4A8QA 3THYB 3TAPA 4L76A 3KLFB 4BDYA 2VPXB 1SJ1A 2DNMA 2AX0A 1X31C 3MWPA 3HT3A 3LPUA 5DK5A 1D8ZA 2VICA 1TGOA 5L8RC 1VQ8N 5EVZA 3K5LA 1RT5B 1I5OB 3P4UB 3WX8A 3ZNUA 3NAIA 2K3IA 5KT4A 3MUVP 2IM2A 3EXYA 4PG6A 3M2VA 3GG1A 4X65F 4EFHA 4JHDB 4Y2KA 2VCPA 2KN4A 1LWEB 4DR7K 1RACB 4HHTA 1RHQB 5DM7Q 4KH0B 3K0SA 3FZLA 2XZDB 4P2SA 4K0KF 1LFWA 2O3DA 4OYOA 3ZZ0A 3OVNA 5BRDA 5AQXA 4NL5A 5LMNJ 4JI3J 3MMBB 2QKBA 4B9LA 2C2MB 3VN5A 4MO4A 2KRRA 3MX5A 3U1MA 1NK4A 3DN9A 3M2RA 3C66A 3SDEA 3TZXA 3W8GA 4X62K 2C2KB 2ZZTA 4A2BA 2OPQB 4C8YA 2HVDA 3VVTA 5DMRA 1KQGB 3GE9A 2Z1HA 3U1LA 2N7YA 3HHLC 4DR4K 4U8YA 2A41A 4B9UA 4WYWA 4QWCA 4A5AA 2I5JB 3DFEA 3V6KA 5J2NA 5D6GA 3CMQA 3SQ2A 1YX2A 5FRMA 1P9YA 1VMBA 1M90O 1NB2A 2NXEA 3IM9A 5I42B 4IWVA 5HVGA 4TVAB 3ZTQA 2B6AA 4K5SA 1LW0B 2MJNA 4YB7A 1RKJA 4Z4FA 4OHZA 4KTWA 3G2XA 3JSMA 7AT1B 3ASMA 1UFKA 2YNIA 4OJRA 2KVQE 3NCIA 2UUAF 1UWBA 2ROEA 2ZM6K 3AVIA 4CT9A 4JI4K 2QA4G 2UXDF 1DLOA 4BC2A 1N5SA 3GFZA 5M2UA 3TZYA 4AHRA 5AQTA 2JEFA 3PX0A 3F2KA 1BMQB 3V4MA 4LFAK 2BJEA 5IC4B 3AA5X 4FJMA 3R2CJ 4NCGA 2O66A 2XMMA 4K4YA 4UY85 1G3OA 2QA2A 2O8CB 2DPJA 1TUVA 4JD2A 3E51A 3M9OB 3D0IE 1TUYA 1CJVA 3NGSA 3RTVA 2APOA 4L73A 3VQ9A 1U48A 4CESA 2ACMA 1JB0C 1XR7A 4U7BA 4ZS6A 3W3SA 1QE1A 4DPYA 3H4DA 2GV1A 5ETSA 2XTJP 4QIFA 3FZKA 2PA8D 3P31A 4NLGA 1GLEG 5HATA 4PHTX 4G1IA 1S1TA 4DQQA 3O08A 3QFPA 2CG8A 2QLWA 4CIOA 3LDSA 2ZUAA 1DZ5A 3MEKA 1JJ2R 1XQIA 1VQON 3J81U 1T05B 2FGCA 2UXBK 3A4TA 1U2RA 3QT6A 2IC3B 3EZ5A 3NL0A 4FF1A 3J7ZO 3F44A 3HXMA 3BYRA 5BRFA 2F4VK 4TQSA 3UCUP 2P6TA 3GFYA 2MQPA 3O9TA 4HCBA 4KSEB 3W8PA 1WC0A 4EAHD 3CFOA 5GAGU 3IS9A 5DDOC 2QV6A 3L2QA 1H74A 3THXB 3PHEA 1WHXA 4GKJK 3VQ7A 4OHXA 3RR7A 3HI0A 1VRQC 2W4DA 4QWEA 3QNWB 4J9MA 4U7UD 4PXCA 3AQOA 1DTTA 5BYQA 1WSIA 2RRBA 2KH9A 4XEIA 1NBWA 4OI2A 4QWBA 3LF0A 4CLSA 1KBRA 5EX5A 4KI6A 1QQMA 3TARA 4ZKAA 3AD9C 3UR3C 2R2TA 3DDNA 1SQEA 3CPEA 5B0DA 1JL1A 1C1BA 1OO0B 3VGLA 1N56A 1S1UB 2IVNA 3NWRA 1FDBA 5IM0A 5EWFA 5J2QA 1PBAA 2AA4A 2WVDA 5AZJA 1SJ3P 2EPIA 4DCOB 1GT8A 3VF0B 1WBDA 3O9UA 1DFDA 1VCTA 5IT4A 5DLFA 4IUFA 2IYIA 1H73A 1SJFA 3ZSZA 1NB7A 4G1PA 4CFAA 4E0DA 3BSCA 3R8YA 1VIOA 2MGZB 3M8ZA 3HT0A 3BGRB 3CCEN 3CDEA 2KB2A 3VAHA 5KG0A 4CIGA 1WHWA 2EHGA 3Q0AA 5CYQA 2R7TA 3QERA 2F1FA 4LBHA 2A1SA 2HW3A 2LEPA 4JI8J 3QFUA 4LBPA 5LSOA 3WNHA 4Q5VA 5BPMA 5D4NA 2EI5A 4CZLA 1S9EA 2VDIA 3UCZP 1S1XA 1GMUA 1EB0A 3OS1A 5EN1A 3P4IA 2RDJA 4PAAA 2QKKA 1BQNB 3LP2B 4L3NA 4CD3A 2RHQB 5T7BA 3OYLA 4D3GA 2QXLA 1OH8A 3P5BP 1D1UA 2QJ3A 4UY8T 5DM7L 2HMPA 2BJ8A 1YJRA 4AL7A 5E2QA 4CFDA 1FKOA 1VK3A 2GMLA 2K06A 2ZDOA 3TAGA 1EETA 5E3QA 2UXDJ 1M1GA 4ILRA 1MW7A 3OVSA 1TR0A 2Z1JA 4FM2A 3HHKA 4Y28C 3TA0A 4OYIA 2DPNA 5KG3A 4M3WA 1NGIA 4F4KA 1T3VA 3EKSA 2AMCB 4OKKA 3OQ2A 3RMAA 2X51A 2LU2A 2ALYB 3QEXA 4I7FA 1N52B 1T9WA 1SVDA 3HM9A 3PFEA 3O1WA 4DR2J 1OS5A 3ITHB 4FLUA 2RU9A 1VSHA 2E1RA 4ZPVR 4USVA 1NU0A 4NYZA 1RTDA 4CTAA 2VD3A 2P9UB 2OLWA 3G96A 4CZIA 3JAMY 1RBOB 2N3LA 2RH3A 4ATNA 4J2EA 3MMAA 3O4WA 2DYAA 2DR6A 5DGBA 1B0TA 3MM6A 3R5DA 3L3UA 3SQGB 4RNMA 1KC8O 1HBUB 4CO4A 4ES3A 3Q89A 2LXUA 2OD4A 3ENAA 2MHNA 4U9RA 2BANA 5HQLA 3TPQA 4CO3A 4M5GA 2E1PA 4GC7A 4QR1A 1HNZF 4ZJQA 1YRUA 4K2JA 1B7YB 2JOQA 4KV8B 1WACA 3KG0A 1TFWA 3KLEA 1TKTB 4ECXA 4CNZA 3VF4A 2LU1A 2O8BA 1ZPWX 1TZ0A 2R7YA 4FLWA 4B3SF 4CM0A 4H4MB 5GAHI 1UOCA 2BUPA 4QIEA 1AZSA 1WORA 5KFWA 1HNIA 3G6ES 5HO4A 1WBBA 2M4MA 3CNQP 4F3QA 3JXOA 1FNMA 3GR1A 3K5NA 2ZE2A 5D78A 1SJ4P 5EX3A 4X65K 3D1OA 1S0VA 1N32F 2HHVA 2ZH9A 1HI8A 3HO1A 2K3KA 3NKYA 1NHUA 4K0KK 3ZSWA 3U4LA 4F4WA 5F3TA 2AU0A 4TSXA 1NGEA 1FA0A 1TELA 3IAM9 1W26A 2N82B 4RW8B 2EC2A 2DT9A 3CC2N 3PEJA 4OI6A 4GNIA 3MM5A 5GVQA 2BA9A 3ISZA 3IM8A 3NS5A 2L9NA 5L39A 4G1QA 4ISGA 2ZH4A 4CI6A 2DISA 5LJVA 2VBYA 4NPOA 4KKOA 1TK0A 1H2UX 3OR2A 2HLTA 1XNRJ 5J2PB 3NGRA 2YX1A 1JXBA 3M7VA 1KCFA 1TL7B 4FLZA 2WONB 4PQUB 3DCAA 3DRRA 3R1HA 5AQIA 1W25A 4JUZA 2DXEA 2EBEA 3PIPQ 1NH8A 4RW6A 4J8FA 1RDRA 3ILIA 2ASLA 1YUWA 2G2OA 2FVCA 5H9EJ 3CCSN 1T9VA 2E1MC 2VG5A 1PKUA 3IBCB 1GQEA 4ZITA 3FZHA 1IJJA 3L0QA 4K4TA 1NHKL 4WQ5C 2XI3A 1M1KT 4KH5A 1S6OA 3TX0A 1FRLA 2HHQA 2L41A 2BM1A 2D7SA 2ASPA 2UUAK 4NXMF 4LF5J 1N8RO 3LPEA 3M05A 3THYA 3ZSQA 3KLFA 5HMYA 2UXDK 5FJ4A 4R0JA 1U0SA 3HD1A 4DLGA 4B3MF 1XR5A 2XY7A 2UUTA 3ZZTA 2PBDA 4U95A 2OFGX 4HUEA 2NZ4A 2FBTA 3HYFA 2D41A 2PO4A 1RT5A 2G4BA 3FKBA 4PKHA 3ZO7A 5E84A 1HWIA 1Z6RA 2ZBCA 2MXYA 1KVBA 3EGVA 3UDCA 4AHSA 4CZEA 3PG9A 5ETLA 4HLBA 3GV8B 1LWEA 4CO0A 4LFCF 2HHPA 5ETOA 3O80A 3CIPA 1TMMA 4USWA 1RB0A 1O6XA 2JVRA 1OVYA 4R8UB 8RUCA 3GJTB 2J76E 3MMBA 2ZH3A 1X9JA 4UOGA 4HDGA 4YQWA 4E1MA 4WCEQ 5HSPA 1Z2LA 1O8BA 3W5XA 2DNHA 3Q86A 2FUG9 1VQMS 2PZSA 3S8SA 4FJLA 3GTYX 3FC9A 2GO8A 2VF3A 3NH1A 2OPQA 2D3O1 3MM8B 4MIBA 1QTMA 1XI1A 3S9HA 2AYBA 2V8PA 4ZCIA 1GX6A 1UA1A 3MUTP 2HQCA 4YHHJ 1XEZA 2HSEB 3P38A 3AFGA 1B7FA 1LWCB 1EO1A 5IXUA 4JRQA 2I5JA 3WIUA 2E6MA 2ZITA 5L9XA 5DO2A 5ETPA 3BJYA 2G9OA 3B6PA 3I82A 5I42A 1IBLF 4QS9A 1NKEA 5D4PA 2BR0A 4DN9A 2XB2D 4USUA 1LW0A 4N7TA 4WIIA 1JXLA 1VQ5S 2QWOA 4Z4CA 5T7LB 3RBEA 3CQYA 1V3SA 2B51A 4A8SA 2XI2A 2YPYA 2DGOA 1MN9A 1Q8LA 3T9ZA 1NRKA 1RE1B 1EAYC 3IC1A 3G6VA 2HPUA 1HNZJ 2H4WB 1KVCA 1I39A 2DH7A 3SSRA 2J9DA 2C2DA 1UW4A 2PFFB 4LC9B 1LK7A 4JI1F 1LQ9A 1CZBA 2Y1JA 2NXCA 1EX4A 4ZP8A 3DRYA 2Q0RA 2Z57B 3KYLA 2OZMA 3JTOA 3W66A 2PI4A 1GOAA 4WYLA 4RBTA 4J9LA 4ZPTR 3KJFB 4YFUA 2O8CA 1IJEB 1QDUB 2DVIA 1S6PB 5IC6B 3Q23A 2O5DA 2XO7A 2DFEA 4USKA 2L3MA 1N32J 4NLXA 4BG8A 1K1QA 1KAZA 4FYDA 5HRPA 1S9FA 3O9SA 3IR7B 4I9LA 5KPZA 3CDWA 3I5AA 3GV7B 3RUBL 4WZMA 1VDHA 1MWZA 5H9EK 3HK2A 4JV0A 1VJWA 2JLEA 1F5AA 1EX8A 2V5HG 1S9GB 4CJFA 4P73A 2ZH2A 4CJUA 4ZHRB 3H0PA 4P2FA 2EG2A 3Q8RB 2W2OP 1RADB 2GTDA 3AXMA 1T05A 1N5QA 4LF6J 4AM6A 4J91A 1TMJA 1Q8KA 1P1TA 4CD1A 3TAMB 3PYFA 1QVGR 2M7SA 3A3PB 2IC3A 4YY3F 3E66A 2BRKA 5KG5A 1D9FA 1XHXA 2MDAA 4K59A 1R59O 2NUHA 4MH8A 1W97L 4BWMA 3A12A 1IBCB 2H5EA 2C3PA 3NVMA 3T5LA 3K0JA 3QICA 1GXTA 3THXA 4OPKA 1VBXA 1KLMB 3KG1A 1FESA 2QA4S 2X6SA 2FF3B 2MLXA 4JK8A 2GMJA 4NXMJ 2QA1A 2CZ9A 1SL0A 4B17A 5SWMA 3I55N 2NSBA 4C8KA 1VQPS 4B3MJ 3HSTB 4RWXA 1KVAA 1JLFB 2AWZA 3NOGA 1EKSA 1WSJA 4USTA 1U1MA 4BRFA 4CGDA 1S1UA 4ZPAA 1YJWS 3CCLS 4IRCA 1LCUA 1U24A 1MMDA 4OVLA 2QK9A 1NSPA 1GLLO 4ECQA 4ZVOB 4LFCJ 1G1XA 2U1AA 4QOTA 3SEOA 2GGPB 3W5YA 1HHQA 1UVNA 2M5YA 1R43A 4FF3A 4B8CA 2QL9B 5IT0A 2PC6A 4ED8A 1ZPVA 3FMWA 1LAWA 1IUJA 2Q3PA 1NSKL 5GIPA 3PIPL 1R8HA 1XC9A 2K7JA 5L1JA 3UB5A 1FJCA 1VLYA 4QIVA 3BO3A 1KVJA 4Q45A 2E1AA 4GV6A 2MGZA 2BE9B 5M2RA 3UFCX 1BC6A 4YR3A 2XY5A 3BGRA 4CHYA 3KDOA 5AFUH 3KK3B 2NLWA 4TY8B 2OZSA 2KM8C 2CJKA 4M3UA 1R0CB 1VSKA 2A2DA 4YORA 5DGAA 1HNZK 3WQPA 1Y64A 4RWWA 4KGXB 3P96A 2VQEF 2Y8YA 1LOTB 3VR1A 4P7TA 4B3SK 3D28A 3DHWC 3NF8A 1M1HA 4WBFA 2YQ3A 1BQNA 3L2VA 3LP2A 1H2VZ 3GU0A 4CYUB 2HHXA 1JJ2M 4CE9A 5D15A 2J0WA 1OWXA 4KHPF 1UEKA 2J7WA 2H9ZA 4UQTA 3O2IA 2D5RA 1JWWA 4LREA 1VHXA 2YJFA 5MAOA 1N32K 4NLPA 2CWXA 3CUNA 4PXBA 4KHSA 3J81Y 1S10A 1V4SA 1PYTA 2BABA 4LD0A 2GIQA 3P5TL 4CIEA 4WCEL 2QLJB 3KVGA 3Q8QB 2IRXA 3BF4A 2FJBB 4YB5A 1I94F 3TJ9A 2DCUB 3CSKA 1KC8T 1X7VA 2O67A 3NMUA 2HBLA 4MJKA 2H48B 3BPSP 1RUSA 2AGOA 5A2QY 4BRHA 5CCMA 4AXIA 3C6TB 4FXDA 2J0SD 4PA1A 4DR6F 3ITHA 2R7RA 1VSJA 4HVZA 1RSCA 4ANEA 4DZDA 3Q24A 3ILJA 1X9SA 4ED6A 5DQHA 1KWMA 1OH5A 1UA0A 2P9UA 4C8LA 1B0PA 5GAGP 1X0FA 4BRLA 4CLPA 1Q0NA 1NGCA 1WSGA 3J80O 4A62A 5EWGA 1XBWA 3GCXP 1ZA2B 3SQGA 2WBNA 1Y9OA 4DU8A 5H9FK 5CXTA 5IS2A 2KFNA 2XZTB 1ATSA 2AJFE 5HLFB 1LXJA 1WKJA 3HJVA 3HSCA 4OPJA 2Z0GA 5JMNA 3CERA 5HRNA 2DIUA 2P9GA 3HM8A 2B5JB 4KV8A 3O5BA 2CJQA 4Z0UA 1WEZA 3FEZA 1IBKF 1SZ2A 3G82B 4LSZB 3CXCM 1HKGA 2WAQD 3FZMA 4JV5F 2JC0A 2V68A 4EK2A 2XHBA 1E4FT 3W64A 4RW4B 5AJ3F 1GLFO 3I56N 2Q3SA 1RTZA 3VWSA 3ZC4A 4ZIVA 3ID6A 5A8KB 1AT1B 3I0RB 2DNZA 4LFCK 3G8SA 1FWKA 2Q1NA 1RAGB 5BYRA 3M6UA 1JL2A 2JX2A 5C7PA 2WZ1A 3NOCA 2Y1IA 4FWOA 2OANA 4DV7F 5EY4A 3M32B 3OHAA 4RW8A 2F8SA 3CMAN 3I9V9 3EE3A 5GADI 3WC2A 1FWLA 3NFAA 2E9TA 1F6TA 2FSKA 4ED4A 3CCVN 4G9ZA 5CHIA 3WX4A 2DNGA 4DWIA 3AVHA 3AJ2A 3H2UB 3C94A 3EVOA 2GAGC 3L2WA 3LDQA 4LFBF 5J2PA 3FEYB 3LO3A 1TL7A 2WONA 5CR4A 2KT2A 4PQUA 2ZGZA 3EMTA 5KFOA 3O3HA 2YKQA 2E66A 3LWMA 2HHWA 4H54A 3BQ2A 4ED3A 1H72C 2YJEA 5KG2A 4NWBA 3MI7X 3SFUA 4EMDA 4BDPA 3MEGB 1BY9A 4FW1A 1IBLK 1KFDA 3DC2A 4K42A 4ZVEA 2C22A 2LXFA 2KTQA 2JRSA 2XSJB 2V50A 4PWDB 1FEEA 2Q66A 4WZQA 4URGA 3ZTRA 1X4GA 1NCLA 2KHCA 1REGX 3OW2M 3BKTA 1PSDA 1X4EA 4BREA 2RHSB 1K9MO 4LRAA 1N0VC 1Z05A 3KNAA 2EBGA 4WE1B 2Q6BA 2F8TA 1T7PA 1HX1A 1GLCG 1M5PC 2UUCF 4JI1K 3MPWA 3V4IB 3CD7A 2DBBA 3VAGA 2QN6B 2VYPA 2QL5B 4NYOA 4OX9J 3OD2A 4PCQA 3P45B 4BR4A 4WPAA 1I3OB 4CZHA 3UD4P 4ZVSB 3AVCA 3AJDA 2KLAA 3GIMA 4R8UA 2DB1A 1IQTA 1HNVB 2VZ9A 4ECSA 1XUPO 1UJ5A 1SQGA 4CLUA 5CD4H 3LM9A 3O4QA 1K0VA 5LT5A 3V81B 5HJYA 3WDOA 1IV0A 1UCNA 4QWAA 5SUHA 2YKMB 5K9FA 4ZPCA 2EFNA 4DSKA 3FJ2A 3HULA 3MM8A 1CXQA 5EOYA 2IIRA 4K41A 1JCEA 2DGWA 1LWCA 2JHEA 3GG4A 3VCDA 2X3DA 4DR6J 3CD6N 2EWSA 4Y2IA 2QE5A 4AHVA 2CRLA 2LMIA 2RVJA 4YY3K 1P9QC 1VR6A 1FWPA 5E26A 5AQHA 3EGWB 3AB2B 2HGMA 1VSIA 4KB1A 2AHOB 3MXJA 3X3UA 1N54B 4A8XA 1RLCL 3SV4A 3DAWA 2Z2YB 2GAHC 1RT4B 1TK8A 2FLLA 3CETA 2J6SA 4C8OA 5T7LA 4P10A 5D0EA 4OI1A 5I3QA 2ABYA 4USIA 4ZPDA 4L8RB 3LM2A 1QZ5A 1NJXA 3MAHA 2A3ZA 2HS0A 4PKIA 1K8AO 4M94A 1ZZFA 1T9UA 3QBWA 3ENHA 5DQGA 2H65B 4JP8A 5B8HA 1N0UA 3BZKA 2P9PB 1NK5A 1FFSB 2V63A 1IBKJ 3NF7A 4KE5A 2WBMA 5L1KA 3T6JA 1S72S 3GG0A 4MLHA 3B54A 4JV5J 2DPIA 4ILLA 5CZ1A 3VAJA 3VTHA 2COLA 4N8NA 3NMAA 3PIOQ 1KONA 5AJ3J 2Y0BB 2JFDA 1VSDA 4B3RF 1TV6B 4FN5A 1S6PA 3QFHA 1XN9A 4DPOA 2P9CA 4LBIA 5DJBA 4LUBA 2NRHA 2V8HA 1YZ7A 2UXCJ 1T03B 4W5OA 1HD1A 3IO1A 3SV3A 4Y1CA 1SC6A 5GINA 2F96A 4F36A 4QS7A 2GQ2A 1AROP 4K2XA 1R0AB 4DV7J 1T6CA 4FJ8A 1Y00A 4DTOA 3N6MA 1S9GA 3QIOA 2GV9A 4ZHRA 2EFGA 4P2MA 4WXOA 3OBWA 4J9OA 1VBZA 1B4SA 4BROA 5ETKA 4LFBJ 3N4PA 2MKIA 2FVPA 3TAMA 1IKYB 1IWGA 2FGOA 2HS4A 4AHTA 2J7KA 4DQIA 2HZAA 1ZAWA 4QR0A 5AT1B 3T5HA 1HR0J 4EYHB 4ECUA 2VQEK 4F67A 3C65A 1S5ZA 5AXKA 3I9ZA 1XMQF 3MMVA 3V6JA 3OR1A 1NSQA 3V5RA 3DOMB 2FZKB 3EO3A 3UKRB 4XAKA 2OCEA 1QSYA 4L74A 4FLVA 1KLMA 4KHPK 3OTCA 3QSIA 5CAAA 1X4CA 4FVUA 4DSIA 5AQLA 2VPYB 4DL5A 3TUPA 5A6WA 3DM2B 1HBMB 2VONA 2A6MA 2DHAA 2FTRA 1JLFA 5HMZA 2HZVA 1Z4UA 1UPMB 1F1BB 1QY7A 2DH9A 3DJCA 3NHGA 1YI2S 4KBIA 2FJXA 4A4JA 1I94K 2UUCJ 3M5RA 1AFIA 3SAGA 3EVMA 1SH0A 4JOUA 4O4GB 3PY8A 3MPUB 4YP3A 3BREA 3W0LA 2GGPA 3I5CA 1ULRA 2PDAA 3C15B 4JKFA 1AUDA 2VC1A 4F7VA 4P71A 2NRXA 2A5XA 2OFHX 2UZAA 2B4PA 4HCCA 3GB0A 3OYIA 4JI7F 4FPIA 4MO5A 3IA0A 3VAIA 1LW2B 3IRWP 4J9NA 2GCFA 4FWNA 3QINA 2PA3A 2NSCA 3KK3A 3F56A 4TY8A 4F50A 1ACMB 2B3TB 4NX9A 2GJIA 2CQGA 1BQMB 4JEPA 1SKUB 1FXXA 4W5TA 4K7QA 1U02A 4K4ZA 3R1XA 1YJNS 2R7UA 3VGKA 2W42A 3DRPB 3AA2A 4B3TF 2CPJA 1SQKA 5K14B 3D54A 3ISNC 3M6GA 2K1RB 4IG0B 2HIYA 5K8MA 1GLDG 3HSGA 2PYJA 4JV5K 1C0UB 4CYUA 3G8TA 3U9DA 5LJ5Y 3ICLA 1GLAG 4DF8A 4FOIA 1FT8A 5AJ3K 3CJ2A 3MCPA 2VFSA 3UNYA 1UVMA 3BB5A 4BC7A 1FRJA 2MQQA 3FQLA 1QVGM 3W3DA 4WFZA 4WU2A 4GO5X 2DHHA 2XY8A 1TU0B 2XLIA 4KIAA 5LXYA 2W7AA 5FLXU 3O8WA 1HWLA 1EQ0A 3AY0A 2KU7A 2YHXA 1U6BA 3DLKA 5BN8A 1HA1A 2HK2A 1RT2B 1HBOB 4EZ9A 2ZWOA 4X64F 5T14A 3C6TA 5F9NA 4DX8H 3ZFVA 3DYAB 3D6TB 4LFBK 2HS3A 4OZJA 3UR0A 4FLYA 5B0BA 4X4OA 1APSA 1XC3A 3HFZB 1Q9YA 4BRKA 2Y0SD 4BCAA 2HBQB 2LLZA 1QLNA 3FCVA 1RWMB 4J9VA 1YTAA 1FXDA 4DV0F 2QIFA 1R31A 1YZ6A 3RB6A 4IFEA 2G2ZA 1CQNA 4FW2A 3MK6A 5HLFA 1CC8A 1M5SA 3J7YU 4PL8A 3JSRA 5FRNA 5I3UB 2B5JA 1YSJA 3O6WA 4ED1A 2WK4A 4X4QA 2IA6A 2ALZA 3BQ1A 1NK0A 4ZVRB 4J2AA 4CHQA 5ELZA 3G82A 3U1NA 1YJ9S 1UP1A 2DNYA 5AXMA 1VQKS 3ZSVA 3VEWA 1NJYA 4NLTA 4Y2CA 4PG5A 3PDNA 3CJAA 4RW4A 1XMQJ 3U6FA 2DD8S 1YWXA 5A8KA 3PIOL 3I0RA 2BE2B 4AQYF 1RAHB 2ZBIA 5KTQA 4HVJA 2VG7A 3QLHB 2X1AA 3MWTA 2DRAA 4I64A 5D3GB 2BKNA 4QYZK 3PYGA 2Z58B 4KTQA 3OFEA 3AOCA 4QW8A 1LOUA 3NRBA 4OPHA 4URSA 4JI2J 3SCXA 2BDPA 4FS2A 3M32A 4KHYA 3D6HB 5AXLA 3HHEA 3EX7B 3LA0A 1BLUA 2BX6A 2JH3A 2R7WA 1X4DA 1X5SA 3OYBA 4IG3B 4URQU 1K44A 2KXNB 2E8AA 1W2IA 4KGZB 3QT7A 2NPFA 3KHGA 2WBRA 1S6QB 1QAYA 2NZCA 2E9RX 1XMOF 5FROA 1G6BA 1CEZA 3BQ0A 5EGYA 2P9SB 3EICA 2R7QA 5KFRA 2DNQA 3VGTA 1WG4A 2WC9A 2QRRA 4OYPA 3KD5E 3AVNA 1SKWA 4M41A 5JLFA 3H2LA 1CS4B 2KQ2A 3W2WB 1RCXB 2E5LJ 3M8PB 4JI7J 3ULEB 2MQOA 4DUZF 4PUOB 4WFAQ 2XSJA 4PWDA 4KT0C 5C12A 1UTAA 2ZUGA 4ECYA 2RRAA 5F0XA 1NWKA 1RHJB 4ECZA 2NXNA 4FWSA 2CA9A 3EPGA 2W2MP 2R8IA 4O0IA 1D4XA 4KPYA 3CJKB 3NBPB 2ZF5O 4RO0A 2BRLA 3IAS9 2EK6A 1NJWA 4WE1A 1FERA 4OQJA 3TUIC 3KKSA 4ZVUB 2FZGB 3H98A 3U3GA 2QZ8A 1VAZA 2G8WA 3FRZA 3TO8A 3G71N 4IFVB 4B3TJ 3V4IA 2HBYB 4UZBA 5LXRA 4NCBA 1BUXA 5JMVA 2UU9F 2HHHF 1DQ8A 3MPYA 2Q31A 1RNHA 3JYTA 5F8MA 1QVFM 4B9SA 4MQ3A 1O1WA 3MPVA 2QSWA 1YJVA 4KHNA 3SJJA 4ELUA 3BGFA 1YTYA 4LRCA 4BRMA 3AGRA 3ZEUB 1SL1A 4B3RK 3FFKB 4DS4A 4DL4A 1JK9B 3N5FA 1NPKA 2C2EA 3CMEN 4FBUA 4B1YB 3PW7A 2KFZA 1RGIA 1S99A 2MKJA 5HAOA 3V81A 3T5KA 3LDPA 2R2UA 3CCJS 4KB7A 1A5XA 2GX9A 3MWBA 2YKMA 3QMQA 3GFHA 1LK5A 1RYRA 5KFSA 1U1NA 3JB9k 2QWQA 1BA1A 2W1BA 2QEXN 4M45A 4F2SA 1X9MA 4OZ1A 5F9LA 3V1QA 2MLZA 2K8GA 2LYVA 4KTZA 4ECVA 4M5DB 4FKYA 1J5OA 3VGMA 5ETQA 3PO5A 5I4MA 4CW7B 3BSOA 4F02A 1V3RA 3A3OB 3H1VX 2MY7A 3G8QA 1RWOB 1FRKA 4QW9A 2D1KA 5KPTA 2XMWA 3MCNA 3VQ6A 1F9HA 3AO5A 3PNIA 1DEJA 4GV3A 1S49A 1RT4A 5KG7A 3AAPA 1ZTWA 4ILGB 4DV0J 1NXIA 1XMQK 1UAWA 1DURA 1BD6A 3ZLJA 2GWJA 1WLJA 4IQXA 4ECTA 2OELA 1Q82T 4RU9A 2GIFA 4I67A 3SMZA 2J6TA 1YJTA 3CD5A 4ICLB 2DNLA 3CGIA 3DLJA 2OAUA 1RZMA 3VETA 2P9PA 2BKPA 2RHKA 4J9RA 3RVCA 4ID1A 3NVKA 2ATLA 3OL6A 2WSCC 2G8UA 1ITPA 1VBKA 4K5RA 5KFHA 3HP6A 3LDLA 2HQIA 3GBTA 1KFSA 4IFYB 6AT1B 4RUHA 4FWMA 3VENA 1TV6A 3SK3A 2F7VA 3MN5A 3CF5Q 1JLBB 4RNFA 3E8OA 1S1VA 1UFWA 1BA0A 4DV5J 3PUFA 2W9AA 4CJ5A 2LFVA 3ZTOA 3T3FA 1T03A 4FP9A 5M1FA 1ZH5A 2LKZA 3MDFA 4DSLA 3GQCA 1R3NA 3G25A 3NGTA 1IWAA 1R0AA 3D4JA 2VWBA 2ZWHA 3QGHA 1RISA 1YXQA 4JI7K 1REVB 4HI1A 2WSEC 4H5NA 2F8EX 4DQRA 1FX2A 1ZYQA 3N5BA 4Y6IA 1U1LA 1Z26A 1JLAB 4ZCLA 4JYAF 3QIPA 1NJIO 1ZS6A 3U27A 1CG2A 2X6NA 5DZ6A 1IKYA 2D74B 4DPUA 4RG8A 5A6PA 3SZ2A 4LIRA 3JSYA 3H8YA 5CHCB 3TW0A 2G8VA 1ZA1B 1YHQS 2JNJA 1WD6A 1WOSA 2N3OA 3OL7A 1HUXA 2F9JA 4YOWA 2JEJA 1EJ7L 1Q7YO 4LSNB 3DOMA 3UKRA 3AO3A 3B6OA 1FFGB 3ZT2A 5MLCQ 2BXJA 3THTA 4DR1J 4AL5A 1FE0A 2YWEA 4DV2F 4EFAC 2HURA 3Q2TC 5CY4A 2OTJN 1N36K 2J5AA 3SBTA 3FFIB 3R6GB 1Q4RA 4XIUA 3CJ5A 2DRDA 2P8IA 3DM2A 1HBMA 1WDTA 2W01A 1JIHA 3OYDA 2GHPA 1OH7A 4P72A 4K4SA 3AV9A 1D3WA 2QMUB 4IKAA 1OJ4A 3RWUA 1FEHA 1TYQB 3AY9A 4PYDA 2UU9J 2DY4A 3CULA 3LW5C 3U9ZA 4CM2A 3EZOA 4X64K 4O4GA 2HRUA 3QAUA 4Y3CA 3BS9A 3IBWA 3OBIA 3E2EA 1L3TA 4H03B 4YS2A 3CJRA 1PYOB 3C15A 1VYAA 3AO4A 3HCXA 4K4WA 4PYAA 4UOHA 4DHVA 3IDHA 1FJGF 2YH1A 1U49A 2E20A 5SZTA 5IZHA 1HKBA 3ALYA 4I68A 2IVYA 1S0MA 5LM7E 3T7ZA 2MYFA 1LW2A 3PCOB 2XSFA 4WFAL 4KBOA 3SCKE 2B8PA 2EC0A 4F4AA 2QI2A 3DXKB 2IVPA 1H1VA 2R8KA 3SUPA 2G8KA 4USMA 4CLZA 2XC9A 2OTLN 1HL6A 1BQMA 1D9AA 3LANA 3ETMA 5LL6Z 5E0OA 4NO7A 4KGVB 3VQQA 5GAEI 3DRPA 3L3CA 4BRPA 1UWBB 5K14A 4AXJA 2GIRA 1ATNA 2K1RA 4IG0A 1DLOB 2MB0B 3HKZD 6FDRA 1RT7B 1XERA 1IG9A 1RDUA 4OZNA 3C46A 1IJFB 1C0UA 2PMWA 2YX4A 2C2RA 3I8BA 3D3CJ 2KJWA 4MK8A 4K4XA 5KI6A 3MEEB 3KXDA 4NLBA 2E5IA 2QL7B 4AQYK 4YOYA 1MROB 1NPPA 4H4KA 4K8RA 2FJWA 2CPFA 2I8EA 4XH1A 2KT5A 3TOQA 4Z37A 1UW9A 5AQKA 3ETOA 4BC5A 1WC1A 2MHEA 1SJRA 8AT1B 1ASUA 3GLJA 3W9HA 1RT2A 1HBOA 4CNYA 4O3OA 3W9JA 4TLRA 1W9HA 1VRUA 3UKUB 1GH8A 2JWNA 3ENOA 5J1NA 3CVKA 4CEBA 1XMOK 4K43A 2BM0A 4L75A 4NA1A 4CK1A 2LP4A 2GEMA 4Y0WA 3SI8A 2DY9A 2DKOB 1EP4B 2E5GA 2V6AA 1ZXOA 2VFUA 1IQZA 3BM7A 3C16B 1JNRB 5BPLA 4HTUA 3ZSRA 4JV1A 4DUZK 3D68A 2QO3A 2XEXA 4CF2A 1NDLA 4FZZA 2Q97A 5IFMA 5IQ6A 1L3VA 3NAHA 5I3UA 5B0AA 2GZOA 4E3SA 3ENWA 4YDXA 4F8RA 1EZZB 2ZDPA 2OMLA 4JYAJ 1NGJA 2QC3A 2HHUA 4YB1P 2ASMA 4PXDA 4WQ4A 2P1JA 3L4IA 4CGIA 1VQ9S 2HOEA 4EU0A 2FZCB 3Q8YA 5E3PA 2O01C 2YKPA 2R42A 3DGVA 4JAXA 3UE5A 3IKMA 2HHHK 2LEBA 3H25A 1XNQF 4FKXA 1IKXA 2BE2A 4P7VA 5HQ8A 3QLHA 1RP5A 3CF5L 1N6QB 2QLXA 5D3GA 3CJTA 2DFHA 1HIYA 3VAMA 1ASVA 1T9YA 4OI3A 4JKBA 5IM0B 4F0MA 1JXVA 1YJ7A 1SQFA 4MTPA 3BZCA 3F9KA 4ISEA 4ELVA 4NA2A 3R7SB 4DSEA 3A1YG 5C2DA 5IT9U 3D0PA 1QD1A 3CCRN 3OXGA 1H98A 4XO0A 1ZC6A 1S97A 1KLNA 2VB6A 4IG3A 3R3TA 5F3ZA 4BY9C 4A48A 2RS2A 1QSLA 4FSVA 3KJNB 3M30B 4C0BA 4AM7A 1S6QA 3HPOA 1UJ6A 1WTBA 2B9YA 1Z25A 1Y10A 3ZTSA 1DQ9A 2CQ2A 3K59A 2HF3A 1WF0A 2YNHB 2P9SA 3F41A 1RT6B 3R7NB 4OMFG 4DFJA 1KP6A 3D1HA 2RQCA 4E1JA 4OLAA 1FJGJ 4KB0A 3T19A 5KGXA 2RE2A 1CS4A 1ZAXA 3W2WA 5A76A 5LSRA 4GVEA 3M8PA 3ULEA 3ZX2A 4PUOA 4R25A 4F4XA 1FXRA 4WIQA 3RU0A 1NLKL 1K6YA 2LXIA 2P9IB 4KRFA 3FSIA 4JK7A 3GSIA 3SNNA 3BKFA 2R2SA 2DR7A 4IO8A 3CJKA 4C7QA 4IR1A 4LF7J 4XH4A 3NBPA 1S76D 3TP2A 2VFVA 2AJ1A 3CTRA 2D0BA 3CC7S 1WNSA 2YKOA 4IFVA 2WW4A 1R27B 1K73T 3CCQS 2R3VA 3MMJA 4PEOA 3KLVA 4N41A 3A5MC 2HBKA 1B9FA 5GIOA 1C2PA 5AQUA 4IRDA 1B0VA 3WXIA 4BVPA 2J4RA 5JS1A 3A5NC 2IVOA 3ZEUA 3LOUA 1VC5A 2OIHA 4CEZA 3B4MA 4I7FB 1YJUA 1FTCA 2CPXA 1EWQA 1FJEB 3PW4A 1MSWD 3HVRA 3CC4N 4DR7J 1WOOA 2H4YB 1D0EA 3ZTPA 3RMDA 3VMFB 4BRGA 1QS4A 4B3OB 4TKTA 4R79A 4UY8O 3J7YP 5J1PA 3ZCMA 2NRVA 5AFUA 4ALZA 1J2VA 2HVIA 1PAEX 2FBYA 1GLBG 2A6AA 1BOTO 2DGSA 3NF9A 3MMAB 1QSSA 2UUBF 2P2CB 3K58A 3M8SA 1RBRA 3B8HA 4M5DA 3OYNA 2V7YA 4DV1F 3U7JA 3KD1E 2HHSA 1NU4A 3TAFA 3WXKA 2NNWA 1X9WA 1WF2A 3SQ1A 3KLEB 3DRSB 2GMHA 2O8BB 3AA4A 3HDSA 3VEYA 3R5GA 5JJBA 3K2PA 1SC4B 3PV8A 4CF1A 5G4DA 4MK7A 4ICLA 4DV2K 2ZWPA 3GIKA 4WFXA 1F0XA 1WHVA 2VA2A 2BKOA 3K5OA 2IBKA 4RBVA 3N6LA 3NWGA 1GTEA 1HFEL 1SJQA 1U09A 2VUGA 2LQJA 2FBVA 3BZQA 3QBXA 4JI4J 3GYNA 1IBMF 4X84A 3MR7A 3QZ8A 2KYXA 1RAFB 3BEGB 3G4SN 4IFYA 2GHVC 1S3XA 4AILC 1EQMA 4BR7A 2B4VA 1AUSL 4LFAJ 3R8EA 2XS2A 4ZJOA 3VALA 1Q1KA 3T1YF 3PVXA 1JLBA 3P83D 2NLXA 1FDNA 2IJFA 1HNXF 3OTOF 4U6PA 4U8VA 3UO0A 4F2RA 1CLFA 2DXFA 3OLAA 2OPSB 5IQQA 4MIWA 3VQ5A 4CH0S 4P6QA 1FJGK 3M8RA 1CXUA 2CGJA 3VA0A 2ASOA 2RDIA 3R1LA 1REVA 3HFKA 1M5KC 2RIJA 1A6LA 3TUZC 5EHHA 3OA9A 3QESA 3P8BB 1Q81T 1JLEB 1QUVA 4KHUA 2PFDA 3DOLB 4MYTA 1FHTA 5D0HA 4RW6B 3WNEA 1JLAA 1S4EA 3NH0A 2HQDA 1ZM3A 2J9CA 4ER8A 1RWPB 4DHYA 3ZETA 4GV9A 3CW2C 3MCOA 1KDNA 4RZRA 4HUGA 4DUYF 2OA8A 3O3GA 3SLCA 3D7SB 4Y2MA 3MZIA 2CPEA 2HQ3A 2J0XA 3QQCD 3US5A 1TK5A 2UXBJ 1Y4ZB 2ZQBA 3KHYA 4NB4A 4O0NA 2POKA 1N34F 4PWUA 4LSNA 3HPHA 3D45A 3O1BA 3W2VB 2JJ4D 2F4VJ 4U7UK 3D6RA 1HJOA 2PMZD 3FFIA 3PEHA 3H5XA 4K8XA 4TY9A 2Y3YA 1KS2A 1RT1B 2HG4A 5KG1A 3PRVA 4GKJJ 2XG8A 3J7A1 2F5GA 1R0BG 2XM3A 1M1KO 2B4JA 3K5MA 2W6LA 2P9EA 3J7AN 4B1UB 3UE2A 3IWXA 1TYQA 5F2RA 2V2VA 1NKCA 1PJ6A 3LGHA 1RXOB 3AVMA 3AVGA 3VQAA 3CWJA 4ILMA 1VK0A 5F41A 2E5JA 4WFNQ 1T8EA 1YRTA 1NGFA 1ZM2A 4C3KA 4FOEA 2KVIA 2XQCA 4KJIA 3MCSA 4HH0A 3DOKB 2HFOA 4PRFA 3WQUA 2JLGA 1VSEA 1OMSA 1ELOA 5KRSA 5KFCA 2H5IB 3CPWM 4DPTA 1UEVA 5CYMA 1B3TA 4HR2A 1KD1T 2YX6A 4Z4HA 2XULA 1NZAA 4OGCA 3DXKA 1RLDA 5FPEA 4CGGA 3DU6A 2BQUA 2CJ9A 3D6MB 1HYVA 5HRRA 5GAHU 4PQAA 2CYYA 2HAFA 4B1WB 4KHRA 2CQ0A 2L9WA 1VQNS 1X4AA 3KK2B 9RUBA 1NEEA 1YIJN 2OYQA 3LDOA 5D77A 3PYEA 1JCGA 4DTSA 2CQPA 3C14B 3ATUA 2RB7A 3R97A 3BP8A 3CCMS 4Y2AA 3GSDA 1RT7A 5AE2A 1HQ2A 3TJ8A 2CZ4A 3M3ZA 1FNXH 1DHMA 2DIVA 2E9ZA 3FRYA 2QWMA 4IOAQ 2F8HA 4LQ9A 2PN6A 5CYJA 4HYKA 2RAQA 2KDOA 3BGUA 1XNQK 3C8YA 3VGSA 1Q8BA 3MEEA 5CD4A 2ILYA 2C2ZB 4NLCA 5DDQC 3PRDA 4PPDA 5K8NA 1Z2ZA 1MROA 1NKBA 1QAIA 4FF2A 1R8BA 3NGKA 3A5OC 3M8YA 3MHYA 5BR8F 4I2PB 4UQGA 4ZN1A 1JLGB 3NS6A 3MM7B 1FD2A 3WNGA 3M1VB 2Y1RI 3R3LA 4DXLA 1U8SA 2RQ4A 3BY5A 4X4NA 3O3FA 2NREA 4ZPWR 4ANDA 2AJ2A 3CJ9A 3SUOA 3UKUA 1AFJA 1O13A 4JB8B 1IR0A 5FLXO 3AVKA 1TUGB 5I9EB 2DGXA 1D9DA 2CNOB 4YUDA 5K5MA 3CJCA 5HOOA 1VSMA 2UV8G 4UUWA 2UYTA 1UJ4A 3AQPA 3P6YC 3OTOJ 3T1AA 3PTWA 2ZC3A 4J37A 1EP4A 5A8RB 4QWDA 1WHYA 5F0UA 2ZH8A 2BACA 2W9CB 4A57A 2C3UA 3C16A 2G2YA 3E3XA 1T3NA 3BSAA 1QTNB 5C10A 1VQ8S 2W41A 2EKYA 1A0OB 2E4LA 5HL7Q 3LZJA 4IEEA 2ZOFA 3ULDA 1EARA 2ZHBA 3HLUA 4O0JA 2JEIA 3TVKA 2VQFF 3A0IX 2D0OA 3THWB 3MAAB 1RHUB 1HJRA 3KK7A 4IOXA 1UVIA 2YQ0A 3O8MA 2R7SA 2H51B 2GJ2A 2XMUA 3HHNB 5E33A 1VQ4N 4XH5A 2GFFA 1T11A 1KEKA 4W90B 4H8KA 3SCJE 2ZKUA 5M1PA 1X3MA 1N6QA 3IG1B 3H4BA 2NCKL 2BBEA 3MD1A 4MLEA 3BBCA 1V6HA 1VRTA 4NASA 4DX7A 2JDJA 4JKCA 3RSEB 2ITGA 4X65J 2E44A 4QS8A 4NRUA 4MKVA 1UKUA 4K0KJ 2CUYA 3ILOA 2VPZB 2CNNB 3HZGA 3WUHA 2NS1B 3M30A 4DTXA 2WVCA 1K1SA 1Q9XA 4MKYA 1YAGA 1ESVA 4NLWA 4MKBA 3CXCR 2UUBK 3OTEA 2W4CA 2O1PA 4CO1A 4N56A 2CKWA 2KZZA 1X60A 4DV1K 3MD3A 2YNHA 1RT6A 1VQ7N 5A8WB 5KFUA 3RMBA 1RBAA 3UNGC 1QJHA 3VGVA 1N33F 2HK3A 4EYIB 4CECA 1H2TZ 4HT5A 5C2GA 1WTFA 1VK8A 4AHUA 4NYFA 2IY5B 1Q86T 1VI7A 1U8WA 2P9IA 2HEKA 4ZOSA 1U25A 2LQBA 1IM6A 1X3NA 1RGVA 2E7WA 4J90A 1F21A 4CF8A 3NMRA 5AR0A 4FYXB 5AQJA 2HFSA 1Q95G 2E88A 3T9NA 4NLRA 2ZVSA 4C97A 2RSQA 2Z1GA 2UUAJ 3OT9A 1VQSA 3FBBA 1NO8A 1HHTP 3DLBA 1IBMK 1RDCA 1NJZA 2FJDB 1R8CA 4RBUA 3M8QA 1U7LA 4K8ZA 4Q44A 2HRYA 4O5BA 3TU5A 3JQKA 4WK1A 2OEKA 3HVAA 4O3QA 3BO2A 3EM1A 1CJTB 2M8DB 3GZ7A 4WFNL 3CDAA 3T1YK 2J9DE 1G2EA 3EDQB 1HPZB 2FD2A 1JNZB 1HNXK 4JNEA 4PG8A 3OTOK 1NNEA 3WIVA 3CJ8A 5TKWA 1T6DA 1VQOS 1S22A 4B3OA 3UD3P 4EHUA 2HFVA 3OW2R 1FTRA 2ZNYA 3KWIA 3KK1B 2V9WA 2WVEA 2BJ3A 4RKUC 1HBNB 1C4CA 1D09B 5CH7B 2IJNA 4NOHA 4R0EA 1U45A 1JJHA 2Q0UA 3CCZA 2UVWA 2F3JA 4O23A 4FO0A 2BW7A 3JQMA 3W65A 4E2FB 2UVUA 5GMDA 3SUNA 4NMXA 1J54A 4C3MA 4DUYK 4CLWA 1H7XA 3VEZA 3VQPA 4BG9A 2EEYA 1CPZA 1NOYA 3DRSA 3H08A 4MDBA 1RAEB 3OV7A 4FJ7A 1N34K 4DL6A 3ZSXA 4IOAL 1X1PA 4UTGA 1VISA 1PJ7A 4F26A 2V4QA 1YTUA 1OQ6A 1FD8A 4FVCA 2RN2A 1MWKA 4OZ5A 4OZ0A 2BGGA 1RDAA 1BL3A 1W7WA 3G9CA 1U1KA 4ILHA 1QQCA 2ZOGA 3V9SA 3W5ZA 2ZHOA 4IYQA 2F9DA 2BJDA 3THPA 2XWXA 1WWHA 3TZZA 4DU1A 4BQZA 2AX1A 4ED5A 2AZ1A 5CZXA 2FF6A 2N4CA 3KUHA 4FJXA 3B4DA 5HROB 2MMYA 5AQMA 2B9XA 1C0GA 4LSLB 3CCES 1NSAA 1R7IA 2HNYB 2OPSA 3M9MB 4X66F 2AJQA 1KOOA 2WFBA 3TSUA 3H3OB 4CLFA 2PY5A 4DL7A 2MZ1A 1EQYA 2ZJRQ 1NDKA 3K57A 3UDVA 5BR9A 2A18A 1G99A 3VZIA 1JLEA 4H4OB 1YBUA 2D0AA 4CHPA 4FLTA 1MN7A 4FCYA 3RZAA 3DOLA 4BE1A 3HX9A 5AQGA