1VRTA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 145
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vrtA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vrtA05
3RAQA 5KG5A 2HW3A 1RTHB 3KLVA 5SWMA 4JUZA 5KG0A 4RNNA 4MKBA 4ZP9A 3GIKA 3KJVA 2QV6A 3GV5B 4N56A 3IN5A 2ILYA 2IC3B 3MECA 2P5OA 5F9LA 1RYSA 3KLFB 3Q8PB 3SI8A 4ED3A 2FJWA 4IG0B 3HHKA 3UIQA 1HQEA 4EP5A 2JC0A 4HTUA 5KFYA 4KB7A 3A2FA 2O4IA 1J5OA 3AO2A 1S1TA 1EP4B 2HNDA 3JYTB 4CJ4A 1TKXB 3GILA 4W5QA 2Z1HA 4URSA 3H40A 5KFAA 1D9DA 2V0NA 1DLOA 2JEIA 4DL2A 4MIAA 4ECSA 4ELVA 3FFIB 4C8OA 3DDKA 1RT2B 1C0MA 1R0AB 3V9ZA 4MFBA 3OYBA 4J2EA 4MH8A 1F21A 4PQUB 1ASVA 1S1XA 1U4BA 3VQBA 3I0RA 1RTJB 2HMIA 1SH0A 5KFNA 4DL6A 1HYVA 2ETJA 4KTQA 4DLGA 1IKYB 2F8TA 1LW0B 1RTIB 4E89A 1U09A 4QWDA 1D9FA 5HLFA 1T03B 3QO9A 3MAQA 1NK9A 2XRIA 5KG4A 2ZE2B 3BGRA 4CGGA 4WE1A 3H5YA 3PW4A 3PR5B 4WFZA 4QW9A 3RMAA 3V9SA 4DG1B 3MR6A 4Z0UA 1JL2A 1S97A 1TGOA 1L3UA 2FVPA 2AX1A 1A5VA 3SUPA 4DTRA 5FRMA 4K4WA 4CIEA 4B9VA 4U6PA 2CJQA 2OPQA 3HYFA 2G8FA 1RT6B 2WOMA 1FKOB 4DFMA 4FJGA 1IKXA 2W8LA 3TABA 1RT3A 3DOKB 3EZ5A 1I3AA 4JV0A 1ZBUA 3L2WA 4C8MA 4DWIA 3RB6A 3OYAA 4LSLB 4R8UB 5KFPA 5L1LA 1S1WB 1MU2B 3S9HA 1HYSB 4E7HA 2X78A 2IOCA 2V9WA 3ALYA 2G8IA 5EWGA 3TANA 3D28A 1RBRA 5KG6A 4DSIA 1RDAA 4CJPA 4QPXA 3DYAB 1JX4A 4GC6A 4FLVA 5CY4A 2FBYA 2ZD1B 1JLBA 3V1RA 5KGXA 3K57A 4TN2A 3L8BA 2DFEA 4CJ3A 5J2MB 1S4FA 3H59A 4BDYA 1IKXB 5J2NB 4HVJA 3CM5A 4CF0A 1RTDA 2YNHB 3KOAA 3WNHA 4G3IA 5C25A 2ZKUA 3DOLB 3E51A 1TKZB 3ZT4A 1S9EB 3DRSB 2WHOA 2BR0A 2ILZA 3BSOA 3LZJA 1JLFB 2F96A 4CGHA 3SUOA 1U47A 4MK9A 4IKAA 1SV5A 4KO0A 2IM1A 4I9QA 2FLNA 3K5NA 1K6YA 2IA6A 3U6FA 4CEDA 3VQDA 2VG6A 1NJXA 3HO1A 4LQ3A 3AO1A 4RW6B 3G6VA 1S0OA 5EDWA 3K2PA 1EKEA 4DTOA 2BQRA 3HPHA 5KG2A 2E6LA 1NK4A 4CHOA 3QNNA 2RKIA 1N48A 5KFEA 1JLCB 4PUOB 1HQUA 3CG7A 3U3YA 3PX4A 4K4XA 4YNQA 4KHSA 2D3ZA 4ED0A 4CGJA 3BDPA 3MEGB 2RF2A 4K4VA 1KTQA 3ITHA 1BGXT 2HHWA 2LSNA 1Z26A 3N6LA 5DMRA 5KFOA 4CJFA 4M3YA 4Q43A 3QLHB 1BQNA 4NRTA 3VQAA 2BDPA 1S48A 2W42A 3VA3A 3CJ4A 2W7OA 1Z25A 4DQIA 3BR9A 2YKNA 3DLKA 2XGQA 1BI4B 2HVIA 3DLGB 2W7PA 4W5TA 1C0TB 3QGIA 4IR9A 3SJJA 1W9HA 1QHTA 3ZSRA 2VWJA 3CFRA 2B5JB 2O5DA 1JLQB 2X74A 4HHTA 4CK3A 5F8LA 1N5YA 5C24A 3PW5A 3WNGA 4JS4A 1U49A 3RTVA 1RDCA 2AQ4A 3VQ4A 5KT7A 3PO4A 3OS0A 3KLGB 4KHRA 1VSHA 2UUWA 1S9GA 4TXSA 2AGPA 1TK5A 4KRFA 2UVWA 1VSIA 5FDLB 1TKTB 1XR5A 1JLFA 3QGHA 2GV9A 4FLYA 4DS4A 2OA8A 1QSLA 2XC9A 3AVJA 4WE1B 5F8GA 4CEFA 3HKWA 2IM3A 2R8JA 1TL3A 3AO3A 1D0EA 4O0JA 1FK9B 1D8YA 4F4ZA 4IKFA 3IS9B 1NHVA 3OVNA 1HYZA 3I5BA 5CYMA 4DLEA 1SUQB 4FJ5A 2HHVA 3DLEA 3IG1A 4CEBA 2J6SA 1ZBFA 4IH7A 4KKOB 4OVLA 4FLUA 1XHZA 4CHNA 4M3XA 2A1SA 2YNFB 4KSEB 3THVA 1TVRA 2KW4A 1BCOA 5F8JA 4NCGA 2JEJA 4PQUA 3NKYA 3IAYA 4FJJA 2J6TA 3KD5E 1X9WA 1OS5A 2R8HA 1UA1A 4DSEA 5L1JA 4PA1A 1EETA 1EX4A 2D0AA 3L2QA 4OKEA 4CECA 5HLFB 1T03A 2Y1IA 4HCBA 1CXQA 3LP0A 2J6UA 1IO2A 3SV3A 2YNIA 2BRKA 4E7KA 2A1RA 4CE9A 4TYBA 4O3QA 3T5HA 3S3NA 3OYMA 3AO5A 4K8ZA 3FRZA 4CJRA 4FJMA 3RB3A 1HRHA 3NH2A 2BE2B 3KJVB 1VSEA 3OYDA 4ECUA 3RWUA 3EPIA 2HHUA 3KK3B 3NE6A 3MEEA 1Z4UA 4B9TA 1Q8IA 1S9FA 1HNVA 1QAIA 3QERA 4HCCA 3ZSOA 4NLPA 3FQLA 4RUCA 2ASLA 3JYTA 4MK8A 1JLAA 4NLSA 1D5AA 2BANB 3V1QA 3OYJA 1RT2A 5I42B 5KFDA 4QCLA 2AU0A 3ZT1A 4CEEA 1TQLA 3QINA 4E7IA 1XR6A 3OYKA 5DQIA 1TK0A 4TQRA 4QWBA 4ZPBA 3LP2B 2KTQA 1GOAA 3KLHA 3NL0A 4M3TA 1JLBB 2ZD1A 3I0RB 4NYFA 3RBEA 4M42A 3K59A 4O44B 3QEWA 4DFKA 1IM4A 4Y1CA 3O3FA 3V9UA 4Y2AA 4H54A 2IDOA 4KE5A 2B6AB 5D3GA 2HWIA 4GC7A 3H4BA 5JS1A 3NH1A 3AVNA 2R2TA 3Q8QB 2FJVA 1VRTB 2Z1IA 4F4KA 3EZUA 3FSIA 3LP0B 4OKJA 4ZPDA 3VQQA 3AVKA 5KFXA 4IG0A 4CEZA 4Q45A 1RBUA 1UAXA 2OYQA 4BE1A 3MFHA 3HVTA 1S1TB 4ZHRB 2HVHA 4J9SA 3KLHB 3SYZA 3KLIA 3UPFA 4G1QB 1GX6A 1HNIB 4DEZA 4JRPA 4O44A 4NLGA 4ID5A 4KFBA 4QW8A 2QE5A 3QYYA 4ECQA 2BQUA 4I2QB 2D7SA 4IH5A 1LWEB 4NRUA 2BANA 1YT3A 3QLHA 3HM9A 3ZCMA 4F3OA 2YNGA 5DK5A 5CYQB 4RUAA 1GOBA 1FKPB 3JSMA 4FK2A 1WNSA 3PW7A 2FVRA 2XI3A 4NLQA 3Q8RB 2O4GA 4JRQA 1QQCA 1JKHB 3P1GA 3NAHA 3T5JA 4RU9A 5I3UB 5J2QB 3OLBA 1QE1A 3PZPA 3PY8A 5KFHA 2FJXA 4FM2A 1NOZA 2G8VA 4FJLA 2RDIA 3M8PB 3ZSXA 1MMLA 4RW8B 4LQ9A 5FDLA 4FBUA 4OL8A 4IRCA 5KFFA 4K4SA 2WOMB 2AJQA 1EP4A 5KFRA 1NK0A 1VRUA 4OPJA 3C6TB 3G86A 4E1NA 5KRTA 1S0NA 4CJSA 5KFIA 3VQ8A 3QEXA 3NDKA 1S9GB 3WNEA 5KI6A 1LWCA 3V4IB 5KFTA 3K5MA 4DTUA 4KB0A 3VQ9A 4FCYA 1SUQA 3V1OA 2RF2B 1LAWA 1XHXA 2IBKA 5KT2A 3OJUA 3TI0A 4DF4A 2R7YA 3P83D 3OYIA 2BGGA 1FK9A 2IJFA 3GIMA 4F4XA 1HPZA 3BSNA 2V4RA 3DMJB 2QXFA 3AVIA 1KVCA 1BHLA 1BISA 4OJRA 5CYMB 1SL1A 2VG5B 3EY1A 4JLHA 4RNMA 2YKNB 4FJ7A 3DLEB 3RRGA 4NLTA 5KFQA 3TWHA 1YVFA 3O4NA 3SUNA 1S9EA 1RTHA 3VQPA 2R8GA 3K5OA 1RT5A 2HHTA 4NCAA 4EBCA 1UWBB 2BRLA 4QWCA 4DTMA 3DLKB 2EHGA 2XHBA 3ULDA 2PY5A 4ZP8A 2KFZA 4K4YA 3KLGA 4DTSA 2GIRA 3H5XA 4M45A 3BQ1A 3M8QB 3IRXA 4Z4EA 4ICLA 2DFFA 5JS2A 5C24B 3AA5X 4J9PA 1NJZA 2EX3A 4W5RA 3RB4A 1KHVA 4YMEA 4OGCA 4R5PA 2VG6B 2UVRA 4FK0A 3ZT2A 3SI6A 5JXSA 3QIPB 4LSNA 1IH7A 4B3OB 4E7JA 3MEGA 3OYGA 4KTZA 4CFAA 3ITHB 3CJ5A 2E9RX 4DL3A 2FVQA 3D5MA 3LDSA 4ED8A 3TAQA 1JLCA 4PUOA 3AVHA 4N76A 2AGOA 1DTTB 4EO6A 1CZ9A 1CXUA 4KHWA 4IOBA 3L3UA 5DLGA 1YTUA 4FLWA 3IG1B 1SH3A 3HP6A 3V81B 4BE0A 4YP3A 1TVRB 3M9MB 1KVBA 4O4RA 4UQGA 1RDRA 4ECZA 4FZYA 4NYZA 4CJQA 4FJKA 4RG8A 2RDJA 4NLVA 4C8LA 4IR1A 2R2UA 4O5BA 3OYNA 1CZBA 5HP1B 3TAMB 5J2PB 3DOLA 1D1UA 4CK2A 2P5GA 4I9LA 5KT4A 4FK4A 4CJVA 3CFOA 3DI6B 3ZSVA 4MIBA 3UDLA 4DU3A 2VA2A 1SKRA 2HAIA 3DRSA 2JGUA 1GOCA 4OLBA 1RCHA 4FJIA 4DSKA 2F8EX 3KIOA 3FFIA 4FVMA 3M8QA 2YV0X 2D5RA 3LWLA 1TKXA 2VWKA 1W25A 5FROA 2Q3SA 2F8SA 3LAKA 1RA7A 4R8UA 2ASDA 2X6NA 1HYSA 4J2BA 4YR2A 2WONB 1S1XB 3IS9A 3RR7A 3RR8A 4FLXA 3EPGA 3ISNC 4DL7A 1QUVA 2E4LA 3LWMA 4LSNB 4KHYA 3CDWA 4BACA 3F73A 3O4QA 2WTFA 3QIDA 4EEYA 2YNFA 4O3PA 1TAUA 3TAFA 4EZ9A 3TVKA 1YVUA 4W5OA 2B4JA 5KTQA 4W5NA 4E7LA 4RW4A 5HRRA 4RNFA 2IGIA 3RMCA 4MKAA 1T3NA 5L1KA 1REVB 1W0HA 4B9UA 2DPJA 2PZSA 1XWLA 3BGRB 4AHUA 3AA4A 3CDUA 5KG3A 1RT4B 3V9XA 5L9XA 4YQWA 3OLAA 1KCFA 1VSMA 2AX0A 4J9LA 4XPEA 5J2QA 3SCXA 4FXDA 4CK1A 2HNZA 4NLRA 2XWYA 3CM6A 3HPGA 3QEIA 3O3HA 3SQ0A 3C94A 1NK7A 3OJSA 2OZSA 1A5WA 2OPRA 1EXQA 1SL2A 4CHQA 5KG1A 1MU2A 4ZP7A 4TY8A 4MFBB 4NLXA 3V6KA 1DTQA 1NK6A 3HVTB 4M3RA 3RMBA 3KHLA 3HVRA 3M8RA 1YTAA 2HNYA 3I0SB 4RW7B 2D0CA 1GX5A 3TQ1A 2IJNA 4IDKA 4J9QA 2XGPA 3ASMA 4F4YA 1B92A 4DSFA 1S6QB 4GW6A 4H4OA 4AILC 4FLTA 1RBTA 4DU4A 1BQMA 1VRUB 3C6TA 1N4LA 3CJ3A 2W9AA 2XI2A 1JXEA 4IRDA 4H4MB 2QK9A 4LD0A 1ZBIA 1WSHA 1HPZB 1JLEB 3KK1B 2YNGB 3OHAA 4F2RA 2IAJA 2HNZB 4DG1A 3RBDA 2VG7B 3UR0A 1XC9A 5F8HA 1VSDA 4KAIA 3NGIA 3LP2A 3VQCA 5CZ2A 2W9BA 3GIIA 4O4GA 3V6JA 1JKHA 1CSJA 3CYMA 1T8EA 2FVSA 1FKOA 2HHQA 4Z4HA 3VQ6A 3V6DB 1QS4A 3PJWA 2UVUA 2D3UA 4MQ3A 3NF8A 4ZTJA 1VRTA 4CIFA 4CCHA 1KLMA 4ZVHA 1S5JA 2KFNA 4FM1A 4Q0BB 4FW1A 2JC1A 1G15A 4ZMMA 4KFBB 2AWZA 3QETA 2FLLA 4EBDA 3KHGA 5KFSA 1BIUA 3KLIB 5KFWA 3ZSWA 5KRSA 4M3WA 4BWJA 5KFVA 4CJTA 3PO5A 1C0UA 2ASJA 5C42B 3NBPB 4KHUA 2C22A 2R8IA 2GBZA 3FDSA 1CLQA 2KQ2A 4M95A 4FLZA 3TARA 4EBEA 4Z4IA 4RW9B 4IRKA 1NKEA 3DRRB 3L2UA 4PWDA 4DTPA 5JUMA 4K4TA 3P5JA 1QSSA 4LH4A 3AVMA 4TLRA 1S1VB 2V4QA 4FS1A 4B9MA 1LV5A 4NCBA 4L8RB 4KHNA 3SFUA 3B6OA 4BDPA 1N5YB 3OL6A 4CHZA 2BE2A 4WYWA 1JLGB 4KTWA 2ZQBA 4DTNA 1SKSA 4C8KA 4DTXA 4G1QA 5K14A 3TAMA 1ZBHA 3E01A 5J2PA 1ITGA 3QGGA 3SQ4A 2HB5A 2PYLA 2R2SA 3AVAA 2P51A 3ZSZA 3L2RA 3LPTA 5CZ1A 1KFSA 1KFDA 5SZTA 1NJWA 2ZE2A 1JLAB 4TYAA 3F9KA 4CGIA 2BQ3A 1ZETA 4CESA 2WONA 1KLNA 1C1CA 4K4ZA 1WSIA 4AHTA 4AHSA 3NCIA 4Z4CA 3MXJA 4ECRA 3NF7A 5F8IA 3TAEA 1RT1A 4KPYA 4J2DA 3C6UA 4OKKA 1N6QA 1NKCA 3HK2A 4IQXA 3GQCA 3LZIA 3CFPA 3NGYA 5KFJA 4KHQA 3DM2A 4Q8EA 1T05A 1RT5B 3K5LA 2AGQA 3OSNA 2C2EA 1C0UB 1RBVA 4DQPA 1S6PA 3SQ2A 5J1EB 1NK5A 3V81A 4BDZA 4FYDA 4ZP6A 2ITGA 1S1UA 5DG9A 1VSKA 1C2PA 4M3UA 3OS2A 4H8KA 3KK2A 4F50A 5HRNA 2JEFA 3EYZA 3VQ7A 4NYNA 4AH9A 3HJFA 1RDDA 1REVA 1J54A 5F9NA 4CGDA 1RBSA 2RN2A 3OYLA 4I2PB 3DI6A 5HROB 4EO8A 2E9TA 3QEPA 3AVCA 2FBVA 3K58A 3TAPA 1WSGA 4N5SA 3VA0A 1RTDB 5KT5A 4IH6A 3N6MA 1IKWA 2YKMB 1X1PA 3OYCA 4CJLA 4O0IA 1ZYQA 4AHCA 4DQSA 4DSJA 4E3SA 1ASWA 1JXBA 4DS5A 1FXXA 2Y1JA 4Y2CA 3G10A 1HMVB 1HQEB 3KHRA 2FBTA 4CF8A 3S3MA 2I1RA 3T5KA 4CF2A 2WK4A 4R0EA 1KHWA 4WZQA 1C1AA 5DGBA 4CHYA 2C28A 3BJYA 5CYQA 3CWJA 2ATLA 1RT7A 1WAJA 4DF8A 4MK7A 2UVVA 4WXWA 4GVMA 2OPSB 1RILA 3VQ5A 1S10A 1T94A 2EC0A 4E0DA 2OPPB 5KT3A 1HARA 4O3OA 3HVAA 3I5CA 3H2LA 2D0BA 4CJWA 4FJNA 4X2BA 3IRXB 1BCMA 4DL4A 4WZMA 4Y1DA 3KLEB 3IGNA 4QWEA 4BWMA 4WFXA 4ZTFA 2G8WA 2IC3A 1RNHA 1LWFB 2YNHA 4IFYB 4FBTA 3OL9A 2KZZA 3HL8A 3MR2A 2FC0A 5DQHA 3LP3A 3QNOA 4F4WA 3MXMA 1NHUA 1VSLA 3PX6A 1HNIA 3CJ2A 1VK0A 1RT7B 4KI4A 3NH0A 4B3OA 3T1AA 3PR4A 3I0SA 4RW7A 3SUQA 1VSFA 3CQ8A 4IFVB 2R8KA 1RT6A 4RZRA 1KLMB 1LWEA 4FJ9A 3AVLA 2HNDB 3BREA 3NFAA 3MECB 1SH2A 1I6JA 3FQKA 1J53A 5EWFA 3HT3A 3KTQA 4J9KA 4E1MA 4AHRA 4J9NA 2W9CA 4HYKA 4KI6A 4M94A 5KFBA 3RRHA 2P1JA 3N6NA 5FRNA 2HHXA 4EZ6A 1JLEA 3KK1A 1ZTTA 5D3GB 4NZ0A 4CFBA 3DRPB 4ID1A 1Q9XA 3L3VA 3SPZA 2DFHA 3TR8A 1UWBA 3JSMB 4JS5A 4AHVA 3NBPA 3QO9B 3OHBA 3B6PA 1TKDA 4XIUA 1QE1B 1DLOB 4RNOA 3SNNA 2C2DA 1RT1B 2R2RA 1Y97A 5F8NA 3SQ1A 4IG3B 1WN7A 2ALZA 3MR3A 2W9BB 2G8HA 4Y3CA 4NLWA 1B9DA 3VQEA 5J2NA 3RMDA 3PV8A 4YFUA 3M8PA 4WXOA 4CFCA 1XR7A 5C5JA 5HRSA 4J2AA 1LWCB 2DTUA 3E01B 4QOZB 4BE2A 4Q0BA 1WSEA 2OPRB 4CHPA 4KAZA 4OPKA 2XCAA 4KB1A 3QZ8A 4F3TA 4K4UA 4TY8B 2OPQB 5KGWA 1WNEA 1J5OB 4O3NA 1L3VA 1I39A 4NLDA 2D41A 4DQRA 3SFGA 1FKPA 3LALA 3UQSA 4ECWA 2IAJB 4Q8FA 3IGVA 1S49A 5EWEA 3NHGA 1TL1B 3C95A 1RT3B 3DOKA 3QZ7A 5KFKA 3WNFA 1L5UA 5L1IA 3LP1B 5KFMA 5T7BA 2E9ZA 2VG7A 3AVBA 1WLJA 1TV6A 3V6DA 1UA0A 4RW9A 3CO9A 1KVAA 4URGA 3HSTB 3KKSA 1LW0A 3D0PA 3AO4A 3ISND 4ELUA 3NAEA 2WCXA 3ZSQA 2FLPA 5I42A 2HHSA 3H08A 4DMNA 5KFUA 1LW2B 2OH2A 4NLUA 3G6XA 4Z4FA 3DLGA 4JV1A 5C25B 4EYHB 3H5UA 4TY9A 4Y34A 1NJYA 4ZPAA 3RB0A 2X6SA 4I7FB 4DL5A 1TL1A 5KFLA 4HKQA 4XO0A 3NGZA 2B43A 3PX0A 2YNIB 2HNYB 2XY6A 3KLFA 4K8XA 3HVWA 4FZZA 4EP4A 1TV6B 4CJKA 4DFJA 3OY9A 3MEEB 3DLRA 1S6QA 3LAMA 4H4OB 2IM0A 3MEDA 4N47A 4CJ5A 3Q8SB 1BQMB 3BSCA 2GC8A 3KNAA 3DLBA 3RAXA 4EYIB 1R0AA 4WFYA 3M8SA 3NAIA 2XY7A 1LW2A 2W8KA 3KK3A 4B9LA 3KMQA 4O3SA 2WRMA 5HP1A 1HNVB 3KKRA 2Z1JA 1S6PB 4Z4GA 4YR0A 3OL7A 3H4DA 4JV2A 4J9RA 4H4MA 1T7PA 4FZXC 2E6MA 3V9WA 4ZVFA 4KBIA 3H98A 4NCGB 2JEGA 1L3SA 3ICLA 1KSPA 2OPSA 5DG7A 1NNDA 3BQ2A 3AA3A 2IMWP 3I5AA 1JL1A 4HUGA 3KLEA 3QIPA 4CF1A 4YR3A 4K50A 5KT6A 1U04A 2OPPA 5HRPA 4CFDA 1LWFA 2B6AA 2B5JA 4B8AB 4TQSA 1X9SA 3MF5A 2XCPA 4J9MA 2UUTA 1TAQA 4OLAA 4KO0B 3AVFA 4HUFA 3NF6A 1JIHA 2XY5A 3ZT3A 3GV8B 4CEQA 1U48A 4IG3A 3SV4A 4ECXA 4B8CA 1VSJA 5HROA 3S3OA 1TKTA 3PW2A 4FM0A 2IS3A 2KZMA 1K1QA 4C8NA 1KRPA 3VQSA 4KV8B 3PW0A 3QESA 2RPIA 4IFVA 4LSLA 3O3GA 2QKKA 2DY4A 4DFPA 3OSPA 3SPYA 5C42A 4RW4B 1T05B 2JLEA 3CJ0A 3V6HA 1C1BB 1ZBLA 1BL3A 4XPCA 3OS1A 3GIJA 3ZT0A 5DG8A 1NOYA 5E41A 1QTMA 2I5JB 1IKYA 1J9AA 4CJEA 3HXMA 4HUEA 3SZ2A 4B08A 2YHAA 3L2VA 1BIZA 3AVGA 3QEVA 3LANA 2GUIA 5EUHA 4LY7A 1UOCA 2DPIA 1RTJA 1EETB 2HMIB 5F8MA 2W9CB 1A5XA 4ECVA 1IKVA 3NMAA 3NF9A 2QKBA 1QAJA 4ED6A 3OYFA 4DSLA 3V4IA 2YHBA 4RNHA 1RT4A 3PVXA 5K14B 5KFCA 1IG9A 1S1UB 3GV7B 1C0TA 2XO7A 4IBNA 1U45A 4KV8A 1QSYA 3KK2B 1RAJA 3MFIA 4Q5VA 4N41A 4ED2A 1RDBA 1BI4A 1NKBA 5HBMA 4CGFA 3G0ZA 1SKWA 5DGAA 2VG5A 2NUBA 3OYEA 3BQ0A 4IDKB 1Q9YA 2ATQA 1WSFA 3D45A 2IM2A 4ZPCA 4I2PA 1HMVA 5DQGA 4QWAA 1DTQB 1SV5B 3ZSYA 1S0MA 4WYLA 1S1WA 1K1SA 5I3UA 1TL3B 2YKMA 3KMSA 3KD1E 2OZMA 4ECTA 3DM2B 4RW6A 4NLOA 2VA3A 1XI1A 4I7FA 2WB4A 2RKIB 5KG7A 4J9OA 3HPOA 2PYJA 3TAGA 3OL8A 3NGDA 1C1CB 4F8RA 4ELTA 4R5PB 4CIGA 4GMJB 4DQQA 3C6UB 3BSAA 3VN5A 1C6VA 5J1EA 4FW2A 1TP7A 1L3TA 4QAGA 2Z1GA 2CKWA 1BQNB 3PHEA 4I2QA 4O55A 2I5JA 4O4GB 4IFYA 1RYRA 5J2MA 3I8DA 4CF9A 2GIQA 2XY8A 1HJRA 1B9FA 1DTTA 4E19A 3PJXA 3T3FA 3T19A 1JLGA 1IKVB 4PY5A 3DMJA 4NLYA 2G8KA 1TKZA 3OYHA 2FBXA 4O3RA 4DTJA 2G8UA 3MR5A 4DU1A 4FJXA 1WSJA 4OGEA 1ZTWA 4ED7A 4CERA 5KFGA 5DLFA 3GYNA 1ASUA 3CIZA 3QIOA 1X9MA 4ED1A 3PUFA 3H5SA 4ICLB 3MTKA 1IKWB 5HBMB 3HP9A 5EU7A 3KHHA 3CVKA 3M9OB 5T14A 4ID5B 3U3GA 4RW8A 1N6QB 4FS2A 1RA6A 4CEAA 3DYAA 1HQUB 3LPUA 4ZHRA 2C2RA 4Q44A 3DRRA 3T5LA 3DRPA 4TSXA 1TK8A 1N56A 3AV9A 5KFZA 1LAVA 2HWHA 4U7CA 4B9SA 4LH5A 1WAFA 4M3ZA 4CEOA 3MXIA 4M41A 3M9NB 1NK8A 3LP1A 4KKOA 4CJUA 4ECYA 4FJ8A 1RTIA 1O1WA 3MEDB 4ZVEA 4B9NA 1SL0A 4ZVGA 4PWDB 4KHMA 2FVCA 3AA2A 3G6YA 4KREA 1JLQA 4URQU 4F2SA 1S1VA 4FJHA 1C1BA 3CDEA 3DLHA 1JXLA
chains in the Genus database with same CATH superfamily
2P9GA 4CLYA 2PAVA 1U1KA 3ZX3A 1I94K 2O8CA 4JUZA 3BUZB 4OV1A 4O0NA 2EC2A 1WEXA 2QV6A 1ATSA 3HMJG 3CF5L 3H25A 2P5OA 3MTJA 3AJ2A 1ITPA 4LVOP 4MMOA 4EP5A 2JC0A 2J4RA 3GU0A 3AO2A 1EP4B 3VERA 4CJ4A 1YI2N 2WSEC 3OR2A 3GILA 2ZH5A 4W5QA 4DV5K 4URSA 4GVBB 4OX9F 5KFAA 4YOUA 4BVPA 4OJHA 2RUSA 2V0NA 4BR2A 4JV5K 1FRKA 3W7BA 1U1RA 4JI6F 2HBMA 3MMCA 1RZMA 4JN4A 4AQYF 1RT2B 3JAMY 2MKJA 3KG4A 4MH8A 4F36A 1F21A 4PQUB 5AQQA 1NB7A 2KB2A 2IRYA 2HMIA 1KEKA 1SH0A 3SK3A 1NJIO 3Q86A 4NZ7A 5LJ5Y 1FF2A 3NGKA 4DLGA 1UMJA 2F8TA 4QS7A 1IBLK 1D9FA 2NRTA 3M2VA 2QO3A 2B8QA 4WE1A 3H5YA 2DNZA 4JKBA 3UD3P 3RMAA 2FHJD 1T3VA 4Z2XA 1BOTO 2CZVC 2HAFA 5BRDA 2V50A 2BTFA 1A5VA 4OZLA 3SUPA 4DTRA 4PR6A 2YHWA 4CLZA 4B9VA 3E8OA 4XTTA 3U4LA 4XH1A 1U8WA 2OPQA 2RUGA 2NRXA 1RT6B 2EKNA 2GELA 2QMUB 4RUHA 4DFMA 2AEFA 3SDEB 1V4SA 1ZBUA 2HEKA 4ZLNA 2LEAA 3U02A 2CPEA 3S9HA 2WUSA 3QQCD 2X78A 1LEOA 4ZPVR 4EMDA 2EFPA 3H7HB 4NPOA 2V9WA 1WC5A 3LW5C 2Q6CA 3FZMA 2LXFA 6FD1A 4DHVA 1FJEB 1RDAA 2HBJA 3DYAB 4GC6A 4UF4A 2J0WA 2EBGA 2XNRA 2I8EA 2ZD1B 3L8BA 4K41A 3L9ZA 5J2NB 4DR1K 4CLWA 4CF0A 2VQFK 2MKSA 1I3OB 3KOAA 3WNHA 3PHTA 5C25A 2QZ8A 2MZJA 3E51A 1TKZB 4QYRA 4ES3A 2Y8WA 4O5FA 2V8PA 3ZLJA 3H2VE 3ZT4A 5E5NA 3DRSB 4DCJB 1VJWA 2ILZA 3LZJA 4P2FA 4OLOA 3TTDA 3ZTOA 1VQNN 4V19J 2AYGA 1U47A 3H42A 4ID8A 4BC3A 4IKAA 3RAMA 4Y2IA 1K6YA 3NNAA 3I9ZA 3VQDA 4A8OA 3CDBA 3HO1A 4LREA 4LQ3A 4RW6B 4U9RA 3R2DJ 2BQRA 2IVMA 3QNNA 2XS5A 4RUBA 2YX7A 2XULA 1SJQA 3PX4A 4YNQA 1VQYA 1PILA 1IBLJ 2DRBA 4CGJA 3MEGB 2QW9A 1XMBA 3ITHA 2A2DA 3K8VA 1URNA 2ACMA 2HHWA 2K06A 1Z26A 5KFOA 2BKNA 3QLHB 1S48A 2AYMA 1T9UA 2F9WA 2HQ3A 3DLJA 4LF6F 3Q0AA 3DLKA 2M8HA 1BI4B 1N8RO 1ZOTA 1UVJA 3ULHA 4JV5J 3ZC4A 4UY85 2W7PA 1SKUB 2KXHA 5D4OA 3KK7A 3QGIA 3UVJA 2CFXA 4HH1A 2VWJA 3CFRA 1JLQB 2IVFB 4K42A 2XWXA 5C24A 3WNGA 3CMEN 3VQ4A 2C2MB 2CPHA 1S9GA 2GW8A 1HR0J 2UVWA 1VSIA 1L3KA 3KJQB 2HBQB 1XR5A 3M05A 4FLYA 1F0XA 2OA8A 4WIIA 1QSLA 3VGUA 4JOUA 3RZAA 1R6VA 1TYQA 2IM3A 3KYLA 2RILA 2YCHA 4IKFA 5ADZA 3MMVA 3OVSA 3D7EO 4GO5X 4CLSA 4DLEA 2BA9A 1LOUA 4KGXB 3DLEA 3CJQA 3IG1A 1P9QC 1ZBFA 2YBVA 2Q36A 1NCLA 3ZXWA 2K3KA 4JI2F 4M3XA 4A8WA 1TVRA 4BRCA 5CHIA 4NCGA 4PQUA 4LF5J 1LFWA 2W01A 3NKYA 3AAWB 5ETTA 4YOTA 2GJ2A 3G96A 3W5YA 4RPFA 3QT6A 3JXOA 2R8HA 2BVZA 2AHOB 1S4EA 2FYXA 3MMCB 4BRHA 4DSEA 5L1JA 3KKFA 2D0AA 1NAQA 3DDNA 3PYGA 2I2YA 2ACYA 2F8MA 2Y1IA 1CXQA 2RHQB 3BN7A 3LP0A 3SV3A 3J81Y 4E7KA 2NSBA 4CE9A 3SIPB 2V6AA 3PEJA 4K8ZA 2GHVC 1QAXA 1UEKA 5GAGI 4USKA 4ZCLA 4DV0F 1NGIA 3IBFB 4CBWA 2YX6A 1FWLA 3D67A 2ZJPL 3EUNA 2HHUA 5I9EB 3DC2A 4UTGA 4B9TA 1Q8IA 1UZHA 1FFGB 2RDDA 1BD6A 1Q86T 3ZSOA 1YHQN 1CC7A 2ASLA 2QSFA 1WKLA 2YHYA 4MK8A 2BANB 3RGIA 3OYJA 1VQ6N 3TSPA 4LF9J 3K0SA 2CNOB 4A8YA 1DARA 2EI5A 3KZBA 1EZZB 4QCLA 4OZ3A 1HKBA 1E3MA 2CXEA 1HL6A 4E7IA 1XR6A 4IOAL 4A8FA 4TQRA 4QWBA 3U27A 4ZPBA 2Z56B 3LP2B 1WOOA 3KLHA 2CWXA 3N4QA 3GJQB 1XNQF 2CDRB 4PPZA 3TZZA 3K59A 3WQUA 3QEWA 4NYOA 3IAM9 4DFKA 4YOEA 4Y1CA 4D3HA 1ELOA 2IDOA 1GAOA 2HWIA 4GC7A 3I96A 3NH1A 2OD4A 3ILLA 5GAEI 3PM9A 3E66A 3MM5B 4CBXA 4CH0S 4B3SK 5HMXA 5AQPA 3EZUA 1HBNB 3GG4A 3L4IA 2YQ0A 2H5EA 5FPDA 2E7WA 4WPAA 4WYBA 4I6AA 2D9PA 5IT9O 4WIQA 4IG0A 4CEZA 2Q97A 3CJAA 3ZZZA 2OYQA 3Q8UA 1VBZA 4BE1A 3HVTA 1R0BG 1S1TB 4ZHRB 3E3XA 3KLIA 2NYIA 3UPFA 3LM2A 1HNIB 3GCWP 1HW8A 2WB1D 3C15B 2LXUA 2CAJA 3L7PA 1VQNS 5IWAF 4JYAK 1VS3A 3VAMA 2P9SA 2DXDA 1GMUA 2BQUA 2XB2D 4FYYB 3QLHA 1LXJA 1BWEA 5DK5A 3UCUP 1GOBA 3THYA 2X1GA 5JMNA 3ZTSA 4EHUA 1O0PA 3PW7A 5BREA 1Q5YA 2XMWA 4FVUA 2V4JB 1F2GA 2AA4A 1JKHB 3P1GA 1MWMA 1Q86O 3QT5A 4DX8H 4RU9A 5J2QB 3PZPA 3MHYA 2ROEA 4A47A 1PIEA 2BJEA 2J0XA 5HQ8A 1KWMA 4FWOA 1T9WA 3ZSXA 4BHQA 1UJ5A 4OL8A 4IRCA 1S7HA 3LGMA 1XN9A 3C7NA 4NB4A 1VRUA 4OPJA 1U2CA 3G86A 2JVOA 1YTYA 4WF9L 4NXMJ 4P7TA 4CJSA 4DB3A 3VQ8A 2E5LK 3QEXA 3NDKA 4OHYA 1HR0F 1X0PA 1U1PA 4EAHD 3CCSS 4X4SA 4DTUA 3B8AX 1W7AA 1G7CB 1A6LA 2Z0GA 4F4XA 4P6QA 3BSNA 4OMFG 4FN5A 2NXJA 4AL6A 2O8BB 3AARA 2QXFA 4KT0C 1BHLA 2ZEJA 1SL1A 4X64J 4JLHA 4RNMA 2YKNB 4FJ7A 3RRGA 2OFGX 3FBEA 3SUNA 2R8GA 2KT5A 4NCAA 1QUPA 2CQ1A 2BRLA 1S57A 2B4PA 4ERDA 3T6BA 2J9DA 2A6OA 4DR3F 1MROB 2GZOA 3H3NO 3I82A 1AUDA 3M8QB 1KOHA 3E9PA 3G4SN 4P9SA 3IRXA 4DUYK 2J76E 3A13A 5CHCB 2QWLA 1NGAA 1N32K 2DVIA 2HF4A 4FOEA 2FGOA 1CLFA 2VQEF 2UVRA 3SCKE 3ZT2A 3SI6A 2UUCJ 4FK0A 5JXSA 3QIPB 4LSNA 2ITMA 3W60A 3THTA 2LQJA 1M5PC 2H4WB 1YRXA 4OYMA 4CFAA 3CJ5A 2E9RX 4PHTX 3ENHA 3J7AP 5D6GA 2XMTA 5E3CA 3C7NB 4AFFA 4CO0A 2G1HA 1KNZA 2CVIA 1FRHA 1WD6A 4PCQA 1N34F 1FFWB 3ZEUB 2V8HA 4Z7CA 3HP6A 4JK8A 3RVCA 1SCJB 1NLVA 1F1BB 4NEYA 4NYZA 4CJQA 4FJKA 2RDJA 1Q0NA 1S72N 4NLVA 3M2RB 1UW9A 1TUWA 4O5BA 4WFAQ 5AZJB 1IJFB 1D1UA 3CJTA 5LSOA 2P5GA 3R5GA 1R89A 4F4AA 4GNIA 3QB0A 4CJVA 4AF1A 3DI6B 3EMTA 4JK7A 1F3FA 2J5AA 3R2CJ 1TU0B 3ZZYA 1YIJS 1CJUB 2ZC4A 1QHAA 2F8EX 1HBUB 4Q7AA 2YV0X 2RS8A 3UNYA 4ZLPA 1RA7A 2ASDA 2X6NA 2ZOGA 4J2BA 3OW2R 3S01A 1F6TA 3RR7A 3RR8A 3R7NB 2PO4A 5AQTA 2E4LA 2E29A 4RWXA 1LCUA 4AQYK 4FXVA 2RMLA 4KHYA 2VZ9A 2AJ4A 3PXGa 1BDGA 3QIDA 3T1YK 3PYFA 4KH4A 3L7OA 4ZPTR 1HI8A 2B4JA 2CH6A 4W5NA 1FJ7A 4RW4A 5HRRA 3RMCA 3EWGA 2E1CA 4FPAA 1REVB 3BPDA 5ETQA 2DPJA 2PZSA 1XWLA 4IEIA 5KG3A 1F2HA 1GLJO 5L9XA 3VR1A 1ZPWX 3QJJA 2AX0A 2FUG9 1FDBA 2LP4A 4J9LA 3CERA 4KGVB 1IQTA 4FXDA 1IBKJ 3CC4N 4CK1A 2XWYA 3HI9A 3QEIA 2U1AA 1NU4A 3O3HA 3P49B 1NK7A 3OTOJ 1OO0B 1SL2A 4CHQA 2LXIA 5LMNK 4QIFA 1SB6A 1WHVA 3HVTB 4M3RA 4RW7B 1I1GA 4P73A 2UUBK 2C42A 5F41A 1X0FA 1FHTA 3ASMA 2O67A 1OJ4A 1FNOA 2GAGC 1B92A 4DSFA 1FJGF 3DWLA 1S6QB 3QBXA 1RQ0A 2FSNA 2HMPA 2VBXA 4FWKA 2DKOB 3NGUA 4ISEA 2PEBA 2W9AA 1JXEA 2XI2A 4C8YA 4LD0A 1CQMA 3QRPA 3M1FA 2NZTA 3Q8VA 2UUCK 1WSHA 1HPZB 2BABA 4F2RA 4ZKAA 3C66A 3MPWA 2KH9A 3QT8A 4K5SA 1JXVA 5J1PA 3KXDA 2CVEA 3NGIA 4CLPA 1FVQA 2NXUA 2HBKA 2W9BA 3V6JA 2GMJA 2F9DA 2MQMA 3ENVA 4C0BA 5EVZA 1U2RA 4LR8A 5MLCV 2YJFA 3V6DB 1ZXOA 1NDLA 4LFBK 4CI6A 1NG9A 3VQTA 2DEJA 3CE8A 2UXBJ 4HACA 4DR4K 2RH3A 5HQMA 3NF8A 4ZTJA 4PAAA 2DISA 9ATCB 1HWJA 4DMZA 1GLAG 2KFNA 3RU0A 1HKGA 4FM1A 1RCOB 2JC1A 4RX6A 2QA4G 4KFBB 5F1XA 3QETA 3ATUA 2F9JA 3R1XA 2UZAA 3J81U 4M3WA 4BWJA 4CJTA 5H1SQ 3PO5A 4KHUA 1NXIA 1HI0P 2W24A 1WOSA 3MM7B 2R8IA 1HPMA 2GBZA 1VMBA 4M95A 3TARA 2CNNB 5ELZA 1WKJA 3W9JA 1H38A 1X3MA 4BRGA 3W5ZA 2BJ9A 4K2XA 5ETVA 4IRKA 2ZHBA 4BC4A 3VZHA 3V2UC 4DTPA 4K4TA 1E4GT 4OYZA 3P5BP 3P5JA 2V4QA 3O80A 1U6FA 1LV5A 1ATNA 4CO1A 2GVDA 1AZSB 3GE1A 3FBFA 4FNHA 3UN2A 1HKAA 2ZZMA 3MM5A 3UKRB 1DKGD 3Q89A 1UFLA 3SBGA 3D2WA 3ZTRA 2ZITA 3O1LA 3GCXP 4IOCL 4G1QA 5K14A 3TAMA 1ZBHA 2PYLA 1P90A 3EM1A 1KC8T 4LF6K 2ZDOA 3LPTA 1IUJA 1KFDA 3EE3A 1AROP 3HD2A 3W9HA 1JLAB 3JAMU 4CGIA 3SAHA 1Y7PA 1YQHA 5D4NA 1C1CA 4B3RF 4AHTA 1OY6A 4B3SF 4ECRA 3VEVA 4J2DA 3C6UA 3Q22A 5TKWA 1N6QA 3HK2A 3FGUA 1XEZA 3QFPA 4WFNL 1G99A 5KFJA 2OMOA 1RT5B 1P8GA 3OFHA 2CJAA 3AB2B 2V51B 3OSNA 1OKJA 5CE3A 1Q8BA 1YKWA 4DPXA 4JKFA 3BGOP 5J1EB 3BN4A 3EGWB 1NK5A 2DT9A 1VQ7S 3CCQS 4BDZA 4G1IA 2ITGA 3HCXA 1B99A 1VSKA 1C2PA 2QFIA 5ETLA 4H8KA 4F50A 5HRNA 1NDPA 1DHMA 4OIXA 3HJFA 5F9NA 1IXKA 5BYSA 5F0XA 4I2PB 2B51A 3K89A 2ZNZA 1TUUA 5LOQA 3TAPA 1WSGA 3VA0A 3HSCA 3IBCB 1X1PA 4O0IA 1NZ8A 3Q23A 4DS5A 1FXXA 5M1KA 3G10A 1U2VB 1OSDA 1H7XA 2I1RA 3T5KA 2DNOA 3HOTA 3U9ZA 4CD1A 1KHWA 4ZJQA 1H2VZ 1C1AA 4CHYA 3GWCA 4IXCA 1P9YA 5CYQA 4MT1A 2C1EB 3HFVA 2GQ2A 4GVMA 2OPSB 5LY3A 4G6VB 5DZ7A 1T94A 2EC0A 4CM0A 2ZJQQ 1WJ9A 3ULEA 3DJCA 3GJSB 2D0BA 2KRBA 2MPUA 3KLEB 3IGNA 3GOIA 1RHKB 1WDDA 3FCHA 1DQ9A 1GH8A 4WFXA 5IS2A 4FF1A 2XQCA 1LWFB 2YNHA 3TP2A 2W2QP 1GLEG 2FC0A 3LP3A 3KUEA 3P3DA 2IA0A 1VSLA 4DZDA 3PX6A 1M90O 1JJ2M 3CJ2A 1WKKA 2GUPA 4KI4A 2NXCA 2Z2ZA 4B3OA 4NXNJ 1B0TA 4RW7A 1KDNA 2H3EB 5H9FJ 2R8KA 4RZRA 2DNQA 4F3MA 2ZM6J 3D2EA 1SH2A 3KTQA 2HFUA 5CH7B 2W9CA 2H1YA 2NREA 4KI6A 5KFBA 3N6NA 1PC4A 4EZ6A 4QIVA 1KQSR 1AUSL 4ID1A 3L3VA 2J7KA 2ZGZA 2MQQA 4DL0C 1MSWD 4XK8C 1DLOB 3SNNA 4EK2A 3CD6N 3HSZA 4B3MJ 1FRLA 2VU5A 2XLKA 5CR4A 4IG3B 1WN7A 2MKKA 4LFCJ 1IBKK 3CNQP 4Y3CA 4DR2K 1Q78A 2DH9A 1JWWA 4A2AA 1B9DA 3VQEA 5J2NA 4DV1J 3M8PA 1DRZA 4CFCA 2A42A 2NUUG 4GMKA 5HRSA 4YY3J 3IO1A 2DTUA 2O8EB 4BE2A 4Q0BA 4LF7J 2XCAA 1N5VA 1CC8A 3N4PA 3NS6A 5KGWA 2Z4PA 4CZLA 2BM0A 2BX6A 3KG0A 3M30B 4C7QA 3J7AN 3O5TB 3DXMA 4ZVOB 2VGMA 1XNRJ 5HK4A 4GKJJ 3NHGA 4WKYA 4C0HA 3D6RA 3F9MA 2PMHA 2PI5A 3EN9A 3HJVA 4DPYA 1L5UA 4C23A 3KVGA 1FEEA 5U47A 2E9ZA 3NLCA 2VG7A 1TV6A 3P8BB 4RW9A 4ES1A 1KVAA 1OH6A 4URGA 3HSTB 4NMXA 3AO4A 3SSRA 3MAHA 2YJEA 3UCGA 4IDHA 2HWTA 4B1WB 3CMAN 4DMNA 5KFUA 2LU2A 4ES2A 2BUNA 3G82A 4FYXB 2HLUA 5BRFA 5C25B 1X4CA 3H5UA 2ZJRQ 4ZPAA 3RB0A 1NGHA 3PACA 2CDQA 4I7FB 2CQGA 7FD1A 4LBHA 1NGFA 2CQ2A 2RHSB 3NGZA 3PX0A 2UU9F 3KLFA 1RACB 3HVWA 4Y2MA 4EP4A 3DU6A 4LFBJ 4CJKA 4DFJA 2QA1A 3MCOA 3B6BA 3DLRA 3OR1B 2IM0A 4JI1J 2HBLA 3D1OA 1TL5A 3DLBA 3EO3A 3ZZRA 4YOYA 1U0HA 4DV6J 2F7TA 1LW2A 4B9LA 3TUPA 2QTDA 1RWVB 3KMQA 4JYAJ 1RADB 1Z05A 2B4VA 2Z1JA 1S6PB 2W7AA 3O8WA 5A2QO 2VFUA 2E2NA 4HR2A 3GFHA 3H4DA 4JV2A 1U1QA 4J9RA 4FZXC 2VV5A 3V9WA 3ENBA 4DR5F 4ZVFA 3ULEB 4KBIA 4NCGB 1L3SA 2OPSA 3AA3A 5FLXO 3BQ2A 5KPTA 2OD6A 4TNOA 5KT6A 4K50A 2A2CA 3C14B 4KH6A 2OPPA 1WF2A 3H20A 3GFYA 2C3UA 2B6AA 4B8AB 3R6LB 3O08A 2E1PA 4L73A 4IWVA 1TAQA 1U0HB 4KO0B 3R9LA 2MJUA 2M5YA 1CZAN 3AVFA 5DRKA 3NF6A 3QDKA 2CPYA 3GV8B 3POTA 4CEQA 1U48A 2B4OA 4FO0A 1VSJA 5HROA 3WBZA 1K1QA 4PYDA 4B3TJ 4ZOSA 2RPIA 2QKKA 5C42A 4RW4B 4OZ5A 4Y0FA 1XK8A 4HT5A 4XPCA 3BH7B 4JI3J 5DG8A 5E41A 1QTMA 3JS6A 3HXMA 5M2PA 1J9AA 4CJEA 4HUEA 3SZ2A 3L2VA 2VQEJ 5L9NA 5EUHA 1UOCA 2HMIB 5F8MA 1A5XA 4ECVA 2HPUA 3NMAA 3WXJA 5A8KA 2QKBA 1QAJA 4ED6A 3P6YC 2B9XA 3IUCA 3OBWA 5LL6Z 3O6WA 4OX7A 5KFCA 3NMRA 3GV7B 2RHKA 1VQKS 4MTPA 4KV8A 2DB1A 2C3YA 5KPZA 4OYPA 2QG9B 3DCAA 4U96A 3ETOA 1NKBA 1BI4A 3H2UB 1EKRA 1Q79A 3G0ZA 4BQZA 3CQXA 2NUBA 3Q7CA 2L08A 2ATQA 4ED4A 4ZPCA 1T0TV 2YI1A 4MKYA 4QWAA 3ZSYA 4DV6K 5ETSA 3O3LA 2BYCA 5I3UA 2P9NA 1TL3B 2YKMA 3KMSA 5K8OA 1CS4B 5AT1B 4DR5J 1TUGB 2X7IA 2I0XA 1XI1A 3UN3A 4I7FA 2LA4A 2FSJA 2O8FB 3OL8A 1ZM2A 3M2UA 2HGMA 1VBKA 5IC6B 4JI8F 4QIGA 4CTAA 1R8BA 1U8SA 2FLOA 3PHEA 3MXHP 4IFYA 1YK9A 8RUCA 2MYFA 2PFDA 3BKUA 1U1NA 2AYBA 2GIQA 2XY8A 4I67A 3BO3A 1VJQA 4TLQA 1JLGA 2E8AA 4AXJA 1KXPA 1XIQA 2IRXA 3HM8A 2J9CA 4DTJA 3KWGA 2XMMA 4DU1A 2GVZA 5BPLA 3GYNA 2OTLN 3CIZA 3QIOA 1ZBTA 2HKEA 4I68A 1M5SA 4PPDA 1IKWB 2A3ZA 2F4FA 3CXCR 4KQZA 4FWPA 1N0VC 3CVKA 1OQ6A 4LSZB 3MWTA 2F40A 2QLJB 5T14A 4DV5F 1FD8A 2ZJRL 2K8GA 3MN5A 1HNXF 5K8NA 3VGSA 3ZX2A 1HQUB 3LPUA 5B0GA 3D4JA 3T5LA 3DRPA 4TSXA 1OY8A 3DHXA 1QVFM 3AV9A 2RIJA 1LAVA 1JK9B 4B9SA 2ZUGA 2KHOA 2V9KA 5DM6L 3PYDA 1NK8A 2OTJN 3LP1A 4KKOA 1O1WA 3MEDB 4ZVEA 4Y28C 2GMHA 1PAEX 2VYPA 3DXSX 3AA2A 3G6YA 4KREA 1QTNB 2XHCA 4F2SA 2VD3A 1FWKA 1YBTA 3R5DA 1R8AA 3DLHA 1QJHA 4JI5J 3PSIA 5KG5A 1FD2A 2HW3A 4FWMA 1YSJA 1XC3A 4HLBA 5SWMA 1U1LA 5KG0A 4MKBA 1XNQJ 1XQSC 5ETOA 3S7RA 2ZOFA 2ZH3A 1S77D 2AMCB 3R6GB 2HBYB 1TZ0A 1B70B 3BYRA 2MEWA 3GPAA 1TMJA 2XEXA 3Q8PB 4FWNA 3HHKA 3UIQA 4OHXA 4HTUA 3TUZC 1X5SA 2O4IA 2O66A 4XAKA 3JYTB 1PG5B 1TKXB 2CA9A 3IKMA 4A2BA 3H40A 3S1TA 3EZOA 1KTVA 4LF7K 3P38A 4YY3K 2G0IA 2JEIA 4K7QA 3FFIB 4C8OA 3GJRB 4BR5A 3V9ZA 5IT4A 2GGPA 4J2EA 4I4BA 2GX9A 4A8MP 1U4BA 2FSKA 4ER8A 1EARA 4DL6A 3OA9A 1HWUA 3W2WA 1Y5LB 2BMBA 1VQLN 1T03B 3MM9A 3MAQA 5KG4A 2GJIA 1ZAWA 2ZBQA 4NLBA 2CRLA 2HHPA 3PR5B 4WFZA 4QW9A 3MUTP 4OZ1A 1S22A 3F5TA 3V9SA 4DG1B 2DGWA 4Z0UA 1S97A 3MN9A 1L3UA 2AX1A 3R8YA 4F3QA 2DNLA 2EBEA 2F8HA 4NI2B 4CIEA 4U6PA 5AZIA 5B08A 3J7YP 2CGKA 2L41A 1FKOB 4L3QA 1MMDA 3TABA 5CZVA 3EZ5A 1I3AA 4JV0A 1XMQF 1FCAA 1WG1A 3J81O 2MDAA 2OEMA 1BUPA 3CCUN 1AT1B 3OTOF 5D77A 4QQBA 3OYAA 4LSLB 4R8UB 5L1LA 3UE2A 3QJPA 3ONQA 4E7HA 4JBCA 4I6MA 2IOCA 3LO3A 3CCTA 1VQ9S 4MYUA 3ALYA 5EWGA 3RSEB 3RUBL 3TJAA 5M1QA 1OYEA 4DSIA 3JSYA 1IM6A 4QPXA 3KJFB 2ZBRA 4LIRA 4DV5J 4NA1A 3NWRA 5A8RB 4FLVA 4AUKA 2FY1A 2FBYA 5KGXA 4X64K 1RHJB 4JI8K 2P9KB 1UJ6A 4CJ3A 1S4FA 2ZH2A 4BDYA 1IKXB 1Q4RA 4QIWD 4HVJA 3CM5A 1RTDA 3BF4A 4DDFA 3S6EA 5C7PA 4G3IA 2F4VK 4L75A 1U7LA 2WHOA 5HMWA 1HNWF 1U6BA 2H51B 5JVHL 3SBMA 4QS9A 2HIYA 3M8ZA 1DGKN 4KHPK 3G6ES 2WSCC 4WQ4C 2CPJA 2XS2A 3T41A 5CABA 4I9QA 2FLNA 3K5NA 2IA6A 4CVNE 3LGNA 1BLUA 1NJXA 3BBBA 2XZDB 3AO1A 4DV3F 2RJZA 1S0OA 1EKEA 2HG4A 2E6LA 1WC3A 5AQOA 1N48A 5KFEA 1R8PA 4I6YA 5AXLA 3LQVA 2BEFA 3ZZTA 1BHNA 3U3YA 3CC2S 1RKJA 3H3OB 4I56A 5EHHA 1YJ9S 4ED0A 3PDNA 5D0HA 3X3UA 2CGLA 4JI0K 1KTQA 2LSNA 3N6LA 2CQPA 4CJFA 2BDPA 3QRRA 3CJ4A 3CCLS 3VA3A 4J5OA 3QFWA 1FX4A 4CTAB 2H48B 3MAAA 3FBCA 2XGQA 4DR6J 1FVSA 5JICA 1K73T 2LU1A 2MKHA 1J5EK 4FNIA 4RTFD 4PRFA 1IN0A 4W5TA 1C0TB 2QWOA 2HVEA 3NP5A 4RLEA 3ZSRA 4DUYJ 4HHTA 3I4PA 3CJKB 5F8LA 3CI5A 3RTVA 2AQ4A 3HKZD 4KHRA 1VSHA 4M8LA 1TK5A 2KI2A 4BR4A 5FDLB 3QGHA 1JLFA 4DPUA 4JD2B 3T1YJ 3OQ2A 5D0RA 5CCMA 4GKKJ 4CEFA 3A8JA 1NJIT 3AO3A 2PMWA 4O0JA 3IS9B 4JKGA 2JL9A 3HOSA 5DM7Q 4FJ5A 1X4FA 2KN4A 2HYIB 2NRWA 4DR1F 1UWAA 1XHZA 1E6YA 4CHNA 2RVJA 5AQGA 2A1SA 4KSEB 2P8IA 2H65B 1VDHA 2DIVA 2C3PA 3IAYA 4FJJA 1WHYA 2EG1A 3V4MA 5L46A 1UA1A 1W97L 3ZX0A 2DYAA 4PKHA 2E44A 3NGSA 3CJCA 2YWHA 4CECA 1KQSM 2K1RB 1T03A 3FZHA 3PIOQ 1SC4B 3PTWA 1IO2A 2BM1A 2A1RA 4QIEA 4TYBA 1EWRA 3PEHA 1X8DA 1YITS 3AO5A 5HQLA 1K8KB 3MX5A 1VHIA 4OYAA 1UETA 2YH0A 1HRHA 3NH2A 3KJVB 2YKOA 3OYDA 3CULA 2JRSA 2UXDF 3EPIA 3OBIA 4HWIA 5LXRA 3MEEA 1Z4UA 1QAIA 1D8ZA 2V2VA 1JJ2R 3ILOA 2A1BA 2UXCF 4JHDA 2J0QD 1N54B 4PXDA 3GSIA 1XMQJ 1CJKB 3TO8A 3BGLA 2QN6B 1HR0K 2OIHA 4XDDA 1QVGM 1V5VA 1RFQA 2QEXN 4ZDNA 2UUBF 2OLWA 2X1FA 3ZT1A 1LKZA 1TL7B 4X4RA 1S99A 1CG2A 3FZFA 3O9SA 2KTQA 4OZ0A 4B1YB 4M3TA 1VK3A 1JLBB 3VVUA 3I0RB 2IY5B 3MM7A 1ZAVA 4CT8A 2C3OA 4O44B 4CRJA 4H5TA 4JI2J 3O3FA 3V9UA 3HHDA 4JI7J 4H54A 4KE5A 2B6AB 4ILRA 1ZM9A 5JS1A 1VQOS 3B8HA 1YJ9N 4CNYA 3AVNA 5I4MA 3OW2M 4ZIWA 4OX6A 4OKJA 1RLDA 3TVZA 4F25A 5KFXA 3CJRA 4Q45A 2FHOB 1UAXA 3I56S 4DPTA 4BGBA 2KU7A 2YQ1A 1FKAF 2ZUAA 2W1BA 5E3AA 4ZVUB 4J9SA 4YB5A 7FDRA 5HL7L 4MAKA 4JRPA 2LDIA 3H6EA 5IV3A 3QYYA 2YKPA 1X5TA 4I2QB 3LPYA 1HW9A 4GY2B 1T3OA 2YNGA 3TOQA 3A5LC 4BBYA 2MLXA 1FKPB 3JSMA 4J9UE 4V19S 3LDLA 3T9NA 3PKYA 2DHGA 3NGTA 2MKYA 2ZWHA 3Q8RB 3SQGA 4AXIA 3CT9A 4DR7K 3D2FA 1NLKL 3UR3C 2C2ZB 4EFHA 3RJMB 4UQTA 1IWGA 3F56A 2PEHA 2OP5A 2V2QA 3OLBA 2KG0A 3HHLB 1R43A 3NGRA 3UKUA 4FM2A 3NS7B 4WK1A 3W2VB 3M8PB 2V34A 4ZCIA 5EX5A 4USUA 3VOVA 5IQ6A 4FBUA 4PG4A 2CPZA 5KFFA 4K4SA 1RUSA 2AJQA 2CJKA 1O5JA 4FF4A 5BPMA 2IMOA 2F3JA 3IRWP 4DV7K 3WNEA 4ETZA 2J7UA 3V4IB 1KAYA 3K5PA 1XHXA 1EHWA 3OJUA 3TI0A 4N8NA 3OYIA 4X66J 1NDCA 2C2KB 5FLXU 2O3DA 2MTLA 4OJRA 3VAKA 3EY1A 2MSTA 1UEVA 3SSQA 4BRDA 3CMAS 1YVFA 3OXFA 5GMKa 3O4NA 4OI0A 3DXBA 4EBCA 1UWBB 3KUHA 3FVYA 3TWZA 4QWCA 4DTMA 5BYRA 3CPWM 2P2CB 3ZZOA 5KAKA 4WFBL 4DUZJ 3WQPA 4CH7A 2E2OA 2KFZA 5IM0A 4DBQA 4DR6K 2GIRA 2XNQA 3BQ1A 3R97A 1CEZA 4JK9A 4ICLA 2DFFA 3M6GA 3C16A 3HHNB 4JI3F 3I33A 5JS2A 2HSTA 4LIWA 4J9PA 2IVNA 2EX3A 1YIJN 4JI8J 1WELA 3RB4A 3LA0A 4YMEA 3T7ZA 7AT1B 2VG6B 4YS2A 2RNEA 3L09A 2EFQA 3MEGA 2GCFA 1NGDA 1UVMA 3ITHB 1YDLA 4BQLA 1JJHA 1P6TA 2QYCA 2H54B 2YHXA 4I6MB 3GBTA 4JI0J 2BKOA 1BMQB 1HD0A 3MM8B 2NRZA 4BY9C 3E9LA 3PSFA 4NX9A 4HTJA 1YBAA 3B82A 1J27A 3T9ZA 3QFUA 3V81B 1K0TA 1O51A 1TVRB 3QSIA 3M9MB 1YWXA 3JXUA 3SXLA 4O4RA 1WTFA 2Z30B 1RDRA 3CB4A 3C65A 5B09A 3A8IA 3CCEN 4IR1A 4AYBD 2V67A 1EQ0A 3CXCM 4ZIVA 3OYNA 5IT0A 3TAMB 1GLLO 2AIRB 4CK2A 3CJ8A 2HOEA 4FK4A 3CFOA 4E98A 5F3ZA 4X4QA 4WQ5C 1SKRA 2HAIA 3ELHA 3VPZA 3DRSA 2JGUA 1GOCA 1Y0HA 1RWPB 1NNEA 3NVMA 4FJIA 4GVEA 1TUVA 3KIOA 3FFIA 1CQNA 2CPFA 2GS8A 3M8QA 1IJEB 3FCVA 5H9EJ 4QS8A 5FROA 2Q3SA 3MMAB 2MQNA 1SIZA 3K9JA 2V68A 2WONB 1NMEB 2WVEA 1HHTP 1S1XB 5H9FK 3FNNA 2PN6A 3LWMA 4AD6A 1Y4ZB 3F73A 3KHYA 3R27A 1D9AA 1NO8A 1I51B 3TAFA 4EZ9A 1YVUA 2CIMA 1HFEL 1O13A 5K9FA 3MM8A 5K20B 1T3NA 4P71A 2PFFB 1M90T 4U95A 1Q5VA 3G82B 1WC4A 4MO5A 2NCKL 3IM9A 3BGRB 2BOPA 1HNWK 1RT4B 2DJWA 2M4MA 3V9XA 1SZ2A 3FEYB 3CCES 1SJRA 4L3KA 1FRXA 1YJWN 2Q0UA 4OHVA 2QX0A 4NLRA 3HPGA 1PJ7A 2DBBA 2VJUA 5EGYA 2W2NP 3OJSA 1W26A 2OPRA 4BRQA 4WWSA 2VFRA 3FK4A 4TY8A 4NLXA 3V6KA 1HBOB 1RGVA 4Z7YA 1NK6A 1KD1T 1UAWA 4LJMA 3TYTA 3M8RA 2HNYA 4USJC 1K0VA 4DV3J 1UEUA 4J9QA 4DV2J 4F4YA 3MD3A 2QLXA 2UXCK 4H4OA 4LFBF 1WHXA 4LBPA 3MOJB 2R7SA 1UP1A 3MCNA 4IRDA 4H4MB 3DLLL 1W2BR 2FJBB 2Y3YA 1JLEB 3KK1B 3OHAA 4DXLA 2K7JA 3RBDA 4C3MA 1XC9A 3VGKA 2ZWPA 2MQOA 4C11B 3J7Z5 1HLWA 1T8EA 2FVSA 4NWBA 1FKOA 2MKCA 3TSQA 1FTRA 2HHQA 3SCIE 4Z4HA 3DRYA 4L6V3 4OYIA 3VQ6A 3M1VB 4PKIA 3WIVA 1BE4A 2OJ3A 4X84A 4MQ3A 1Y5IB 1VRTA 3VMFB 1KLMA 4ZVHA 2ZZTA 1P1LA 1U0SA 4Q0BB 1RBLA 2MXYA 2YWKA 1G15A 4ZMMA 2AWZA 1N36K 3NRBA 2AT1B 5KFSA 1BIUA 3JB9k 3WXKA 5KRSA 3GZ7A 3TEGA 3GONA 2ASJA 5C42B 1XNRF 2WSFC 6FDRA 4LF8K 3DGPB 4PABA 1G2EA 5AXNA 2KQ2A 1UVIA 3ID8A 4FLZA 1T9YA 4LRCA 1FNMA 3ADAC 2VHGA 1R59O 1NKEA 1HNZF 4PWDA 3WX8A 5JUMA 4DOZA 1RTZA 3AVMA 4KH5A 3RBZA 4FS1A 2PE8A 1WDTA 4ANCA 2DGTA 4KHNA 2B7CB 2Z57B 3B6OA 3OL6A 5LMUF 4DV7J 2Q1LA 3T69A 2QWQA 2BE2A 3GG1A 3RW7A 4CZIA 4DTNA 1HLUA 1SKSA 5D4PA 4G1PA 5AZJA 1F9FA 3QGGA 3SQ4A 2R2SA 3AVAA 2A5XA 3L2RA 3UWTA 2YTCA 2JWKA 2CNKB 1NEEA 1S72S 2VC1A 3MMAA 1RSCA 3F9KA 2W2MP 2YPZA 1Z6RA 1WSIA 3NCIA 3ZFVA 3MXJA 2OHDA 2X3GA 4ATNA 5F8IA 3TAEA 1RT1A 4USWA 1FXLA 3LH2S 1FEHA 2HQIA 3N0VA 3A8KA 1DY3A 3PG9A 2MQPA 3CFPA 2JWNA 5L38A 4Y0WA 1JCEA 4PXBA 3NGYA 3ET6A 3SCJE 4DZ6A 4Q8EA 5A8WA 3K5LA 3W3DA 1C0UB 3MCMA 1RBVA 3IFEA 4HHJA 4DQPA 4KJIA 4KR0B 3VVTA 3V81A 1S1UA 4BRKA 4M3UA 4ZVTB 2MZSA 3EYZA 3THXB 2F7VA 1EB0A 2JOQA 2E5GA 4NYNA 3G4SS 2QLWA 3C14A 4GKKF 3OD2A 1LXNA 3DOMB 4UOHA 2RN2A 3L3CA 3DI6A 2E9TA 1MNEA 3D0IE 3ZZPA 2FBVA 3K58A 5AQHA 3WC0A 4N5SA 3BO4A 1MWZA 1RTDB 2PMZD 4IH6A 3N6MA 3OYCA 1ZYQA 4AHCA 4DQSA 4DSJA 4E3SA 4DUYF 2DGVA 1ASWA 3NY0A 4Z37A 2VQEK 1O6XA 2HHHF 2FY8A 2I6WA 4R0EA 1VC6A 3HHLD 2ATLA 1RT7A 5AQIA 1UFWA 4DF8A 3AH6A 2UVVA 4WXWA 1RILA 2QA4S 2IHR1 3RSEA 3IA0A 1S10A 4J90A 3WQTA 1F60B 1Q82O 4YB1P 5KT3A 3I5CA 3H2LA 3D68A 4X2BA 1SPBP 1NUEA 2P9LB 1QZ5A 5HAOA 2DNRA 1X3NA 4QWEA 3CTRA 1J5EF 3NS5A 4R0JA 5ETPA 2FDNA 3DN9A 2IC3A 1RNHA 1WEYA 1ICEB 4PWUA 3JQJA 3SJHA 2ADBA 2HQCA 1NMNA 3NNCA 4HI1A 5MLCQ 4X4VA 2JFKA 2ZVSA 1HWIA 5DQHA 3WUHA 3K7RA 3IC1A 4LFAF 1GMWD 1HNZJ 2MQ8A 5RUBA 3GFXA 1UL3A 1VFJA 1VK0A 1UCNA 3IFRA 3I0SA 3SUQA 1PSDA 1TMMA 4HDHA 4IFVB 3ZNUA 3ZEUA 4WF9Q 4NA2A 2HNDB 3BREA 1I6JA 2DRDA 1J53A 5EWFA 2GQCA 3MURP 4J9KA 2VKRA 2HS0A 2Z8QA 5KQ8A 2Q43A 2P1JA 1Y9OA 2HHXA 3T1HK 1JLEA 3KK1A 1ZTTA 5D3GB 3J7ZT 2ZHOA 4Y65A 3SPZA 2ZWOA 2DFHA 2D0PA 3MPDA 1EIYB 5T41A 1TKDA 3B6PA 4B3RK 4XIUA 1QE1B 4ANDA 2EVZA 3T1HF 1SQKA 2C2DA 4R25A 4ZVPB 3J7ZO 3HZ6A 1TR0A 1T02A 2R2RA 1Y97A 5AXKA 5A8RA 2XG8A 4DX6A 3MR3A 2W9BB 5AQKA 4FP9A 2V52B 1N88A 3CPWR 5KOXA 3RMDA 2B8PA 4DHYA 1HBOA 1F3VA 1KVJA 2FD2A 4OI1A 3EX7B 4GO7X 2IVYA 3FMBA 1LOTB 1LWCB 4KAZA 4CHPA 2OPRB 1Z2LA 1SJFA 2FPHX 5CD4H 4LFAK 3KFWX 3B78A 3EDQB 2XZTB 1J5OB 4O3NA 4I64A 1U1OA 4CDIA 3VETA 1I39A 1MA9B 2D41A 4DQRA 2YPYA 1FKPA 2JH3A 2EFGA 1M1GA 4CI0B 4RCHA 2IDEA 2HVZA 3IGVA 1RAGB 3DNCA 2B56A 3WXLA 1RT3B 4DV4J 2XMUA 3KG1A 3QZ7A 4AE5A 2KVQE 2HK2A 1YI2S 2UU9K 3BKFA 3LP1B 5T7BA 2UXCJ 3V6DA 4DV2K 1ZM3A 4YOVA 5GMEA 1WC6A 3EVWA 4PXCA 2ZJQL 3ISND 1GLBG 2A40A 1RHQB 3BGFA 1NGJA 2OH2A 4CLTA 2ZM6F 2L9NA 3CC7N 5IV4A 1NJYA 5A0YA 2QEXS 3MN6A 4PKGA 5K5MA 1K44A 2RRBA 1RHRB 1TL1A 5KFLA 4X4OA 4XO0A 2J8AA 2B43A 1KAZA 1YJNS 4FZZA 4KH1B 4TVAB 1TV6B 4YY3F 1VLYA 4FOIA 3VEZA 2VDHA 3VALA 3MEDA 4CH1A 2BV3A 4N47A 4O8UA 2GEMA 1BQMB 2L9DA 3BSCA 4CLLA 1K8AO 1R0AA 4C11A 4HTLA 2DR5A 4LFCF 3M8SA 2XY7A 2W8KA 2WRMA 5MAOA 1VQ4N 3J81j 5A2QU 4YR0A 2AJFE 4DQ8A 3OL7A 3CCMS 1T7PA 3QAEA 2E6MA 3H98A 3KWIA 2HFVA 5E26A 3H1QA 4Q2LA 2KKHA 2JEGA 3G25A 4LF2A 1NSKL 1YXQA 4LR7A 2HQFA 3TEHB 3GTYX 5DG7A 1VQKN 1O8BA 3SMSA 4U8VA 1U04A 5DETA 2AW0A 4OX9J 5D4LA 2P9KA 4YORA 1YJUA 3H90A 4TQSA 1X9SA 2XCPA 4JI2K 4ZCMA 3PIPQ 1YRUA 2UUTA 2NLXA 3R8EA 4BRIA 3W0LA 2VB6A 1JIHA 1B0PA 4U7UK 4IG3A 1NH7A 4ECXA 4JKGB 4M5MA 4ZLJA 3F41A 4A57A 1TKTA 3ZO7A 4C8NA 1WF1A 3PW0A 2G0JA 3U1NA 4LF9K 4LSLA 2DY4A 4DFPA 3SPYA 4P74A 1T05B 2FHMA 4OYOA 1C0FA 4A8XA 1ZC6A 2JLEA 2BKPA 4BREA 3O6QA 3ZT0A 1SC1B 1NOYA 2DGOA 1IKYA 4BRNA 1TL4A 4CO2A 5TKYA 1EQMA 3LANA 1CVJA 4LY7A 2F63A 1RTJA 2W9CB 3FBBA 4RJVA 3A3PB 2VFTA 3FEZA 1CS4A 4TU9A 5K8MA 4A48A 1KAXA 5E3QA 4EGLA 3V4IA 2XHWA 4RNHA 3OT9A 1IG9A 5K14B 1S1UB 2XO7A 3IMQJ 1U45A 1QSYA 3KK2B 1M5VC 3UKRA 3EZWA 1FW6A 1RDBA 2AJ0A 3ATVA 1JB0C 1URRA 5F2RA 4M5JA 5B0AA 2OTLS 3BQ0A 4XH4A 3VESA 2CADA 4CZJA 1WSFA 3FGVA 4JP8A 2YWFA 3SQGB 4LR9A 4USVA 1SV5B 2HZCA 5E3RA 2ASMA 2AV5A 1JJ4A 1Y5NB 3CCVS 3KD1E 2WVDA 5A8WB 2HS4A 1FERA 3RBXA 5KG7A 4ILGB 2D0OA 4LF8F 4BRFA 1S6UA 2VQFF 4F8RA 3RW6A 1H73A 4R5PB 1DJ0A 4CIGA 2NXNA 3HDSA 1EWQA 3C6UB 4LF4K 1MN9A 4FW2A 3DGVA 4BG9A 4CM2A 5HVGA 1S12A 4O4GB 3G2XA 3I8DA 4CF9A 4K5RA 1FT8A 2DO0A 3PJXA 4B3TF 1M0SA 3T19A 3TUJC 3DLLQ 3DMJA 1VIOA 5A76A 3LTOA 4B3MK 5AQMA 1KONA 3NG8A 4C6AA 4FJXA 3VAIA 1WORA 1ZTWA 4ED7A 2NZCA 2HRUA 1ASUA 1J2VA 3PUFA 4A62A 3LDQA 2AEMA 3MTKA 3KHHA 2VBZA 1BWFO 2YY3A 1CULA 2F9TA 1MN7A 1OIAA 3LM9A 3QJLA 4RW8A 2N7CA 3NWGA 4CEAA 2DD8S 1U24A 2GGPB 1NBWA 1TK8A 3O9RA 2HZVA 2GMLA 3UB5A 2DNNA 4CEOA 4FSVA 2OGUA 4YB7A 4DR2J 1U6ZA 1A0OB 3UN5A 4FJ8A 1YJRA 5FIIA 1SJ1A 4B9NA 4KHMA 4H03B 2FVCA 4WFNQ 3E9OA 2AP6A 2OSRA 2PA3A 2E5LF 3O9TA 3GIRA 4DU7A 2QL7B 3QBCA 3J7YU 3SAGA 3R5JB 3RAQA 3P39A 1D09B 2MHEA 4BS2A 2BJ7A 3BZCA 3DXKA 1K8KA 1BUXA 4ANEA 4RNNA 1RHMB 4ZP9A 2Q66A 3CCUS 3KJVA 3NCRA 3GV5B 2BJ8A 2QWNA 2ILYA 3AA8A 3ZNJ1 2IC3B 1UVKA 5F9LA 1RYSA 2XMJA 5GAHU 3FJ2A 4ED3A 2MQLA 2FJWA 1HQEA 3W2WB 5CYJA 3R1LA 1MW7A 4C9DA 2E2PA 1IQZA 5KFYA 3P96A 4KB7A 2HGNA 2G2ZA 3EXCX 1S1TA 2LQ9A 4IO9L 2GAHC 5BXIA 1NSAA 3B4DA 3BB5A 2Z1HA 3SQOP 5BN8A 3KDNA 1HUXA 1XQIA 4HI2A 2BBEA 2VOPA 5BR8J 1DLOA 4DL2A 4GVLA 5IWAJ 1U26A 4ECSA 3AOAA 2DR6A 3DDKA 4KYZA 1C0MA 5A6WA 1VHXA 1T9XA 3HSGA 2HIQA 3BR8A 1ASVA 1S1XA 1B3TA 3I0RA 1V6HA 1T11A 5KFNA 1N33K 2P9EA 3MZIA 1HYVA 1KR4A 3BKTA 2ZF5O 2O1PA 4OHZA 3EL2A 1RTIB 5AR0A 4E89A 1WEZA 1U09A 3HD1A 4QWDA 3QO9A 3IMXA 3A4TA 3L7UA 4JKEA 3PW4A 5BPNA 1FJCA 4GVBA 4UT4A 3R5CA 4OYBA 4JI0F 3QGPA 1OY9A 2KM8B 4LF4F 3W62A 2FJAB 2FVPA 5D15A 3OTCA 3HTVA 4K4WA 3NMUA 1NPPA 2JSXA 3P5TL 4DV1F 1RE1B 3HYFA 4X65J 2K2PA 1X5OA 2OMLA 2NUHA 3EGNA 4WTYA 3DOKB 3C8YA 3ILJA 3L2WA 1IG8A 4C1NI 4C8MA 2Y1RI 4DWIA 3RB6A 3JS9A 5KFPA 1S1WB 1MU2B 1HYSB 1RGIA 4FL9A 1DT9A 1YAGA 2KJWA 4F04B 1EO1A 4CYUA 2LFVA 4L3NA 2APOA 2JLGA 3TANA 1IBCB 4Y00A 3GDQA 3I56N 4CJPA 2Q2RA 3C2PA 4OJ3A 1LQ9A 1JX4A 3KUGA 5ADXH 1JLBA 3K57A 3V1RA 4TN2A 1W2BM 2UP1A 1RWOB 2P5VA 2QTWA 5GADI 2UXDK 1Q81T 4EIAA 3CPEA 2POKA 3H8YA 2ZKUA 3DOLB 4MYTA 2DNMA 1A7GE 3EVMA 3BSOA 2F96A 2GVZB 2HFZA 1ATRA 3QWPA 3FZKA 2FB0A 4MK9A 1SV5A 3UE5A 1GTEA 1WOQA 4CEDA 2VG6A 1I94J 3G6VA 4BC9A 4LF5F 3L95X 4DTOA 3OTEA 1NK4A 4CHOA 2WZ1A 3G87A 4LF9F 2RKIA 4EU0A 5AQUA 1SC3B 1KQFB 3B4MA 5B0BA 4HL9A 5BYQA 1GQEA 5C0YA 4K4VA 2ZZNA 1NMDA 1MLAA 5DMRA 4USHA 1YGYA 4Q43A 1HX1A 4NRTA 5IXUA 2W42A 1N8RT 2W7OA 4DQIA 2VGNA 4AL5A 4MLEA 3C46A 5BN9A 1GFWB 1NPKA 4OFZA 2QLFB 5IWAK 1DURA 3AY9A 1BA0A 4UUXA 4M7YA 1HNXK 1LK7A 1QHTA 5JMVA 2O5DA 2X74A 2Q6BA 4CK3A 4IFEA 4JS4A 1KQKA 5KT7A 1I5OB 3IM8A 3VAHA 2VBYA 4R79A 1OH8A 4ENOA 1QAYA 4TXSA 2F4VJ 1WUAA 4YB6A 2DPNA 1OPZA 3D3BJ 4ZPWR 4A46A 5M1PA 2DGXA 2XC9A 1PGZA 4USMA 3HKWA 3A5NC 2R8JA 1RBAA 1FK9B 5HVHA 2FTRA 1NHVA 2WW4A 2DR9A 3DOMA 4IYQA 3QT7A 3OVNA 1TFYA 4GV9A 5CYMA 1YF5L 1SUQB 3WHIA 2HHVA 2E1MC 1N36F 4UY8O 4CEBA 4IH7A 4OVLA 4FLUA 2MZ1A 4J91A 3THVA 2KHCA 2MZRA 1T6DA 4IO9Q 1NGCA 4IJNA 4KBOA 5AJ3K 4LMZA 1XMOK 5B0CA 5F8JA 2JEJA 1AXQA 2JLFA 3WC2A 3LDPA 3KD5E 3IR6B 2XTJP 3FMWA 5EX3A 1X9WA 4ED5A 4OYXA 3ENWA 4DCHA 1M5HA 4PA1A 3I32A 3OVBA 4OKEA 2VUGA 4B3SJ 3NVKA 2RQCA 5CZXA 4F0MA 2J6UA 2YNIA 2FF3B 4IOXA 1ACMB 4O3QA 4W92B 3T5HA 5CXTA 3BEXA 3S3NA 3HSDA 1OH7A 3FRZA 4PG6A 4RO0A 4CJRA 4YOXA 4FJMA 3D66A 1KVIA 2BE2B 1VSEA 4ECUA 3KK3B 3NE6A 4LRFA 4RL1A 3OPKA 3D0GE 2H3GX 5LMNJ 3QERA 1FXRA 2AD9A 4HCCA 2NRRA 4NLPA 2R42A 3FQLA 5GVQA 3VZIA 1ZS6A 5KQDA 1D5AA 4MJKA 3V1QA 2ZJPQ 1RT2A 5IC4B 3CQYA 2JFDA 5KFDA 1Z2ZA 2A6MA 4TU7A 2AU0A 4CEEA 3AD9C 1TQLA 3DU5A 1Y10A 1P8ZA 1X4AA 2QA2A 3CJ7A 1WG5A 2E5JA 2VBWA 1TK0A 4XH5A 4PG5A 3D1QA 1GOAA 2N7YA 2KLAA 4N8OA 3RBEA 1CJVB 2YXLA 1VQ4S 4PKDB 1IM4A 4OO1J 2A0FB 4OHWA 2ZH6A 5D3GA 2BOAA 2W41A 1HKCA 2ZH4A 3OHRA 2GNKA 3Q8QB 1VRTB 2Z1IA 3BV8A 4F4KA 2K3IA 1FTCA 2J0SD 1SIWB 2VF3A 4H5NA 1CJUA 2RD5C 2VKZG 3AVKA 4X62F 4C2MA 4DJBA 4NI2A 1M5KC 1RBUA 3W8PA 3OTDA 2ATCB 1V3ZA 3MFHA 1RDUA 5G0RB 3KLHB 3SYZA 4G1QB 2LMIA 3TZXA 5D8HB 4B1VA 4O44A 3CD6S 1CULB 1XJWB 2Z2LA 3DRXA 3FFKB 3M6VA 2VCPA 3JTOA 1UPMB 2D7SA 3AQPA 3TRGA 3R3LA 1LWEB 3BM7A 2E7VA 2CH5A 1UZDA 2BANA 4OZJA 4FWRA 3I31A 4QZVB 3TZWA 2R9LA 3VEOA 4FK2A 1WNSA 2Z58B 4WQ4A 1E6VA 2FVRA 2XI3A 1DFDA 2O4GA 4PZVA 5AE3A 4JRQA 3HBTA 2HBRB 3LF0A 1ZH5A 2FQQB 5LXYA 3PIPL 3FLCO 2XLIA 3NAHA 4J9VA 4MDAA 5I3UB 1RAFB 3PY8A 2FJXA 2LQBA 4JI4F 3FRYA 1NOZA 3A3NB 1YZ7A 1M1KT 3PFOA 2UV8A 2WVFA 1PO6A 1MMLA 1SC6A 2VH7A 4RW8B 5FDLA 4QJVA 5AQJA 4DCPB 1VIXA 4TKTA 4KHPF 4DPWA 3OUYA 2V94A 5KFRA 4E1JA 4E1NA 4WK3A 5CAAA 5AXMA 1HWKA 5KFIA 3PLAA 1IVZA 4LC9B 1FJGK 2F4VF 1MROA 2X1BA 5KI6A 1LWCA 2M70A 1VC0A 3K5MA 3VQ9A 3MPYA 2RF2B 1A9NB 3PCOB 4X64F 2IBKA 2MY7A 4BR7A 4DF4A 2R7YA 5A6PA 2BGGA 4PL8A 3GIMA 1HPZA 1FDDA 1OVQA 2WTUA 1K9MO 4JI7K 2V4RA 3DMJB 3R6MA 3AVIA 1KVCA 3VGTA 1BC6A 4KC5A 3PFEA 3DLEB 1FX2A 5DJBA 1RTHA 3MOZA 3M8WA 4AT1B 4OPHA 1SAZA 2EHGA 4NEZA 3ULDA 4WQ5A 1NM2A 3AQOA 5E33A 1Q7YT 3BH6B 4ZP8A 3KLGA 3JAMO 3CC2N 4DTSA 3H5XA 1Y64A 4M45A 2N3LA 4Z4EA 1RI7A 4I0WA 4P2MA 2IBOA 1IBMK 1J5EJ 5C24B 1PKUA 3C19A 1YJTA 3L6QA 4W5RA 1KHVA 3A8YA 1UPPA 2UYTA 1IH7A 4DR2F 5M1FA 3OYGA 4KTZA 2MMYA 3UI3A 4DL3A 1KN6A 4CNZA 5A2QY 3QBWA 3LDSA 4ED8A 1JLCA 4PUOA 5HL7Q 3N4WA 2CZ9A 5F0UA 4EO6A 2I7PA 1T6CA 4ZJOA 5BJRA 1CXUA 4KHWA 3PRBA 1QM9A 4IOBA 3L3UA 1YTUA 4FLWA 3IG1B 2D74B 1SH3A 3HHLC 4BE0A 3Q2TC 3O8MA 5BRHA 4YP3A 2SXLA 5B0EA 4UQGA 1KVBA 5LMUK 2FHKA 4C4WA 4FZYA 2DY1A 2O8BA 3HFZB 2R2UA 3TR5A 5HP1B 1VR6A 1N34J 5C15A 1DBDA 2GIFA 2EWHA 3O9UA 1VQPS 3BZKA 4WP9A 4I9LA 5KT4A 2FJDB 3NCPA 1RWUA 3ZSVA 4DU3A 2VA2A 3AA9A 3QAUA 4OLBA 4NOHA 2XMKA 4DSKA 5A0YB 4OLPA 4FVMA 1V5IB 2D5RA 3LWLA 1W25A 2VWKA 2F8SA 4H0XB 2DHSA 3W64A 4DR3J 1PCAA 4YR2A 3IS9A 4NA3A 3M2RA 3EPGA 3ISNC 3LL3A 5AQYA 2DTJA 3TTFA 4CLUA 1G3OA 4JI1F 3CDWA 3AOCA 2N4DA 4P75A 4EEYA 2DK2A 2YNFA 3GJTB 4O3PA 5DDRC 3TVKA 1DAXA 5EY4A 4JI3K 2VPWB 4RNFA 5KPRA 2QL5B 2DGUA 2IGIA 4RBUA 1GK8A 3D7SB 1GMWA 1W0HA 3MM9B 1EQYA 4B9UA 5I3QA 2M52A 1P27B 4AHUA 3AA4A 3CDUA 2QMXA 2M7SA 3OFGA 2H5JB 4YHHF 5E2QA 3U7JA 1YITN 3OLAA 4NYPA 2VFVA 3BGUA 4XPEA 5J2QA 2GJFA 1KD1O 4DX5A 3CM6A 3R7SB 2DCLA 3SQ0A 1S3XA 2OZSA 3EKSA 5KG1A 3W63A 1MU2A 4MFBB 1SBRA 5SUHA 5C2DA 3BBFA 3KHLA 3HVRA 3HHLA 3UKUB 1YTAA 2QC3A 2FHJA 2D0CA 1GX5A 3TQ1A 1YJNN 2XGPA 1NRKA 3M7VA 4FLTA 1RBTA 3GFZA 4DU4A 1UKUA 2ZC3A 3C6TA 1N4LA 1BA1A 3CJ3A 4F26A 2V2ZA 2QK9A 2K7KA 2ZNYA 2Q31A 2VL1A 2YNGB 4LFAJ 2HNZB 2NS1B 1XMQK 5F8HA 1VSDA 3QWUA 4KAIA 3MDQA 2J9EA 3F0NA 3VQCA 2IYGA 3GIIA 4O4GA 1GTHA 3GYGA 1CSJA 1QZ6A 5ADXA 2P9CA 1VQON 2DXEA 3US5A 1H3DA 1PYOB 2AKWB 2UVUA 5IQQA 3JQKA 2D3UA 3SMZA 3JSRA 1WTBA 2JNJA 2V7ZA 1V3SA 4CIFA 2CQIA 5THWA 5AQLA 3ZYYX 5GMDA 1OSCA 2ADCA 1S5JA 2JWLA 4L72B 4FW1A 1YJWS 4QYZK 1R3NA 2QI2A 4EBDA 2VFSA 4DV4K 4K43A 4JV5F 5HMYA 2DH7A 2DY9A 4JI4K 1C0UA 2NPFA 4PG8A 3W1YC 2VOOA 2C22A 3FDSA 2QFJA 3TTCA 1WB9A 3A5OC 4RW9B 3WZ0A 3NOGA 5HVFA 3D6HB 5AFUA 3DRRB 2FIUA 3L4BC 2DHHA 3OVAA 1S7IA 1PYSB 3ID6A 1X4GA 1EKSA 1QSSA 5DS7A 4LH4A 2BE7D 3VV2B 3UVJB 4B9MA 1VBXA 5FPNA 2QWRA 3SFUA 3A3OB 4CHZA 2RE1A 1TYQB 2HF3A 3I8BA 4ILJA 2A41A 2CQHA 4UY8T 4RBTA 1JLGB 4KTWA 2J9DE 4DX7A 3T1YF 3C0BA 4DTXA 4DV0J 3E01A 1ITGA 2HB5A 2ZH1A 1IBKF 1YZ6A 3ZSZA