1S9GA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r120394.
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
543
structure length
543
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 141
structure length 543
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s9gA05
2X78A 4EP5A 4BDZA 3LANA 1TKTB 1IH7A 1S9EA 3PV8A 3VN5A 3NMAA 2ASJA 3KMQA 4I9QA 1JKHA 2HNZB 4JS4A 3DRPB 3Q8RB 5FROA 4B8CA 1C0TB 2KTQA 3GV7B 1J5OA 4DL6A 4DFJA 4ELVA 1BL3A 4KI6A 4PY5A 1NOYA 5KFWA 1J54A 4E3SA 2FVSA 4WE1A 1RDBA 1Q9YA 3QIPB 5DK5A 3RRGA 4H8KA 4KTZA 1BIUA 3ZT3A 2OYQA 1CXQA 4B9SA 4HKQA 2F8TA 2JC0A 3ZCMA 1WLJA 4RG8A 1S97A 1VSDA 1N4LA 2UUWA 1HNIA 3QINA 3OYIA 4MKBA 2FLPA 4CFCA 4NCAA 4DMNA 2BE2B 4WXOA 4LQ3A 4JS5A 4CF0A 1IKWA 3DI6B 1WNEA 1JLCB 3OLBA 2C22A 3CDEA 4AHCA 4H54A 3SPYA 2XWYA 1JXLA 1DTTB 4F3TA 1YTUA 4ID5A 3MFHA 4QWBA 4F4ZA 4E7JA 2KQ2A 5L9XA 3AVGA 3V6DB 3VQ6A 3HVWA 2WONA 4U7CA 3OL8A 5EUHA 4DTOA 2Y1JA 4O3OA 4I2QB 3VQBA 3I0RB 1RT1A 3SI8A 4C8NA 2WOMB 5EU7A 3H5YA 4O4GB 3ZSXA 5HBMB 3PO4A 1SKWA 4PQUA 1WN7A 1RYSA 2B5JA 4F3OA 4LSNB 3QZ7A 4K4YA 4FJ5A 2BQRA 3RMDA 3UIQA 2FVPA 3VQCA 4ZTFA 3EY1A 1BQMB 2CJQA 1TK5A 3QEIA 2AU0A 4C8OA 2HHQA 1S0MA 3QEWA 4ECZA 3HPOA 3KJVB 3UR0A 1RTDA 5KRSA 1TV6B 4E7LA 4MKAA 4FK4A 1TKXA 4W5OA 3PX0A 5KT2A 2JEIA 2IAJA 4CHPA 5CYMA 1QQCA 1IKYB 4M3TA 1N5YB 1MU2A 1QE1B 3GQCA 1UWBA 4HCBA 2VG7B 4OJRA 4XIUA 2AJQA 5KFVA 1RT5A 3NKYA 3ZT2A 2W8KA 3HP9A 3ZSYA 3OYBA 4DQSA 4NLVA 1VSMA 1GOBA 2QKBA 4K4VA 2BANB 4E7KA 1NK4A 1KVBA 4KAZA 4QCLA 4QOZB 4CEOA 2D3UA 1REVB 1Q8IA 4Q0BB 4OL8A 5KFXA 1CLQA 2XY6A 4C8LA 3UDLA 3DRSB 4AH9A 4C8MA 4NLSA 3MEGB 2G8IA 4RW4A 3PR4A 3AVBA 4I9LA 4FS1A 1S10A 1U4BA 3AO1A 3EPGA 3KNAA 1S9GA 1DLOA 2ZE2B 3ZT0A 3L2QA 3OYNA 2E6LA 3QLHB 3NF8A 4TY8A 2EC0A 4PUOA 3V6KA 4CJKA 1U49A 1GOCA 2R7YA 4Q45A 3QEVA 2AX1A 3QGIA 2J6UA 4Z4GA 3NGIA 1BCMA 1DTQB 1RT7B 4KHQA 1HNVB 3T3FA 1S1XB 3FQKA 4CESA 5FRNA 1C1CB 1TQLA 1C0UB 5JS1A 3QO9A 3PJWA 2I5JB 2C2RA 4F50A 2R8GA 2IM1A 4CHZA 4HHTA 4FLVA 1QAIA 3RB4A 2YKNB 3MFIA 3U3GA 4KPYA 1IKXB 3PVXA 1HPZB 1R0AA 4CIEA 1N6QB 4KKOA 4CERA 4KREA 3CYMA 2ILZA 2J6TA 1C6VA 4AHUA 5DG9A 2ASLA 1S1VA 5C24B 5KFSA 3CVKA 3L3UA 4QWDA 2PZSA 3KK2B 3SUOA 2RKIB 3VQ7A 1TVRB 3OYLA 1ZBHA 2XY5A 2GUIA 5I42A 5KFEA 2QK9A 5KFFA 1BQNB 3DYAA 5HLFB 4ZP6A 1BI4A 3CIZA 1T05A 4ELUA 4FJNA 4CJ3A 4IRDA 3QYYA 4CHNA 4TN2A 3RWUA 4FLXA 4CFDA 3GIIA 3M9NB 3TAEA 1TKZB 3DLRA 3OS1A 4NYFA 5F8IA 4H4MA 5K14B 5DQIA 1EETA 1YVUA 3LAKA 3K5LA 2P1JA 4NLWA 4F4XA 3EZUA 4FCYA 3OJUA 4BDYA 4RNOA 3NH1A 4F4WA 3G6YA 1OS5A 1Y97A 3DRRA 3BREA 3LZIA 3F9KA 5E41A 4FM0A 2Y1IA 4AHTA 1FK9A 4TYBA 4DQPA 4Y34A 4FM1A 5KG5A 3AV9A 1VSJA 4ZPDA 4J2EA 4WFZA 5KFZA 2YNGB 4GVMA 4CEZA 5DGBA 5L1LA 4FJXA 1B9DA 1EXQA 4Q43A 2WK4A 4ECUA 3AVMA 4DQRA 4CJQA 4PWDA 5HP1A 4M95A 4Q8EA 3KHHA 4FJHA 2D5RA 2DTUA 4KV8A 4CK1A 2VWJA 2FVQA 5KG4A 4OPKA 4I2PB 2XGQA 4O0JA 1GOAA 4DS5A 3NH0A 2B6AA 3I5AA 3JYTA 4ZPAA 1XHXA 2HHSA 2HHUA 4BDPA 3LZJA 3CJ3A 3DRPA 4LH4A 3QNNA 2IBKA 2ILYA 2VG6A 2DPIA 4R8UB 3WNHA 4CJSA 3T5KA 2FVRA 2HNYB 3HJFA 2GBZA 1JLBB 3V81A 1T8EA 3ISNC 3S9HA 5C25A 4IG3B 4ZVFA 3OY9A 3DLGB 1RTHA 4BWMA 1G15A 2J6SA 1ITGA 3DM2B 4N56A 2G8KA 4B9TA 4W5TA 4ZVHA 1YT3A 5KFGA 3AO5A 3CQ8A 2AGPA 3NL0A 1RT6B 3DI6A 3HVTB 4DTNA 1W25A 2XCAA 2XC9A 4J9OA 3NBPB 3PW4A 1FKOB 3KLFB 4JV0A 4CJVA 5KG6A 4WZMA 3AVAA 4MK7A 1F21A 1T03A 2YV0X 4I2QA 3RMBA 4K8XA 4CJEA 2E9ZA 5I3UB 2OPQB 1S1UB 3V1RA 1NJYA 4FZXC 2W9CB 4FK2A 4KAIA 1S0NA 4DSJA 1VSKA 3MEDB 4MK8A 3K57A 3PW0A 1TL1A 4XPCA 2ALZA 3NHGA 2W9BA 3LWMA 1L3VA 5KFKA 3ZSVA 4KB1A 4QWEA 4IFYA 4H4OA 2GV9A 2V9WA 1SKSA 1WNSA 1RBUA 3CO9A 2R8KA 1BGXT 4BACA 2HNDB 3I8DA 4OKEA 3AO4A 2RF2B 1TGOA 2P5OA 3RMCA 1NOZA 1RTJA 1RT4B 5EDWA 4JUZA 3IRXB 4FZZA 1WAJA 3PW7A 2G8HA 2FJWA 1JLQB 3KLIA 1VRTA 3OSNA 4ED8A 4I7FA 1HYSB 2W42A 4ECXA 3QEPA 3K58A 4OLBA 3FSIA 4AHSA 4ED2A 3SQ0A 4JRQA 1HMVB 4IH6A 3G6VA 3O3HA 1NKEA 3MR2A 1QE1A 1NK5A 3KD5E 3EYZA 3S3NA 2OPSB 3AVLA 4R0EA 2IDOA 3CDWA 2OPPB 5SZTA 1JXEA 1RBTA 4GW6A 3L8BA 1KRPA 3LAMA 3LP2B 4ID1A 3KLHB 4FW1A 2ZD1B 2HMIA 4IG0B 3KLEB 3MEEB 4KO0A 4O44B 1KFDA 4DTXA 4RW6B 1KHWA 5F8LA 3SNNA 1CZ9A 1KFSA 4OGEA 2HWHA 1S6PB 2R2RA 3V9XA 2ITGA 1REVA 3NF9A 3D0PA 4URQU 5F8GA 1ZTWA 1FKPA 4DL4A 3IS9B 3DRSA 2VG5B 4FLWA 1JL1A 3CFPA 1JLFB 4K4ZA 3H4DA 1HQEA 1J53A 3I0SB 3RB6A 2B4JA 2PYJA 3DDKA 2GIQA 5HRRA 4CJ5A 2QV6A 4EBDA 4U6PA 4YR0A 4DTPA 4DSEA 3KTQA 3BGRA 4F8RA 1JX4A 3QGGA 2HVIA 1S4FA 5D3GA 2BQUA 1XR6A 1S49A 3G0ZA 3VQQA 3KLGB 2IC3A 2VWKA 2OPRB 2FJXA 3THVA 4EO6A 3QEXA 1NJZA 2XRIA 3N6LA 1DTQA 1S1TB 1HNVA 3JSMB 3GIKA 4L8RB 2IOCA 4GC6A 4ECWA 1W0HA 1S1XA 4G1QB 4B9MA 4O4RA 5JUMA 3ALYA 1IG9A 4AHRA 2ZQBA 1HQUB 5DLGA 1I3AA 3DMJB 4QW8A 1GX5A 3NGDA 1SH0A 3WNGA 3V4IB 4ZHRB 4FJLA 1RILA 4ECVA 1WSJA 3I5CA 1HJRA 3KIOA 3UQSA 2XHBA 3LP3A 1D9DA 3TAMB 3OYAA 4ELTA 1L3UA 4NLQA 3BJYA 4CJUA 1IKVB 4CHOA 4DQIA 4DU3A 1KVCA 4FZYA 4NRTA 4RNNA 2YHAA 3DLEA 3MECB 2E9TA 4Y2AA 3CJ0A 3C95A 1CZBA 3HO1A 3ITHB 2XY7A 3QIOA 3GIMA 1S48A 5F8HA 4DSKA 1LV5A 1Z25A 1BQNA 3OYMA 5F9NA 4NLGA 4ED6A 1VRUA 3BQ2A 3NDKA 5J1EB 2C2DA 1JLEB 1BCOA 1JLAB 3RB3A 3VQSA 4KHRA 4FJJA 1SUQA 4CGHA 4M3WA 4F4YA 5K14A 1VSHA 4DG1A 4RUCA 4CEEA 5T7BA 1GX6A 4NCBA 3KK1B 3PUFA 2YNHB 4KHMA 2YNIA 3C6TB 2ATLA 4FYDA 1KLMB 4ECYA 3TAFA 4CJRA 4CK3A 5F9LA 4ECSA 3AVJA 1ASUA 3M8PA 2YKMA 4RW8B 3A2FA 1LW0B 5C42B 4CK2A 5DGAA 1XR7A 1WSGA 3H4BA 3PHEA 5J2NA 3M8QB 2YNFA 3BSAA 3ZSOA 1LW2B 3RAXA 4CHYA 4MFBA 3DLHA 5J2PB 4LY7A 4E0DA 1XWLA 5F8JA 4J9RA 2IJNA 3CG7A 4FW2A 3RRHA 3D45A 4ZPBA 4IFVA 4ECRA 1NK7A 3DOLB 4FLYA 5L1KA 1NHVA 3SUQA 3V1OA 4M3ZA 3SYZA 1VSIA 2RN2A 5DQHA 3OYGA 5KFHA 3KHLA 5KFNA 3H59A 5KFQA 4B9VA 4CEAA 3L2WA 4ICLA 5FRMA 4IDKA 5J2MB 4FLTA 3SCXA 3G10A 4IQXA 3TQ1A 4R5PB 4KFBB 1C0MA 1TL3A 2A1RA 2AX0A 3SQ1A 4R8UA 1FXXA 1UA1A 4OKJA 3ASMA 3RB0A 5KGXA 3LP1A 4LSLB 3VA3A 1JLBA 2HHXA 4DL2A 2UVRA 1S9EB 1C1AA 3PR5B 2JLEA 1JKHB 2P51A 4TQSA 4M41A 4HCCA 4URSA 4YR2A 1S1WA 5SWMA 3KMSA 4MIAA 4M3XA 2D0CA 3PX4A 3WNFA 2F8SA 4WE1B 2ASDA 4QPXA 3DOKB 2V4QA 3HSTB 3KK3B 5T14A 3SUPA 1LWCB 1RDCA 2OZSA 4MK9A 4Y2CA 2ATQA 2R8HA 2I1RA 3C6UA 1JLGA 3QZ8A 3OYJA 4K4WA 4FJIA 1RT2A 1HNIB 4B3OA 5KFOA 4KE5A 5CYQA 4DSLA 3TWHA 1U47A 2DPJA 2JEFA 1IKWB 3B6PA 5EWEA 2W9CA 1QS4A 2Q3SA 3MEDA 5KFCA 3T5LA 4DFPA 3AA5X 3S3OA 4ID5B 4CIFA 3E01A 4F2SA 4KHWA 4KHYA 4IKAA 4DL7A 3L3VA 4EZ9A 1VSFA 4FVMA 2XO7A 2IS3A 2QKKA 2RF2A 1RT1B 1RT3B 4DFMA 3HPHA 3OYFA 2R8JA 4HYKA 4M42A 2XGPA 4FLZA 2JEGA 4PQUB 3IAYA 4CIGA 3H08A 3GYNA 3N6MA 4ED1A 5DQGA 4J9PA 3AO2A 3SUNA 2XI2A 1W9HA 4NCGA 4EYIB 5KT4A 3PW5A 3V9WA 4RW7B 1U09A 4K4UA 3ZSRA 1SV5A 3RBDA 3OS2A 2OZMA 3AO3A 4KSEB 2G8UA 3I5BA 4ZP8A 3UPFA 4CEFA 5CY4A 3U3YA 1JIHA 3QIDA 4RW9A 2IAJB 4KRFA 1TAQA 4DTUA 2YHBA 2X74A 4O44A 2VA3A 4B8AB 1UWBB 2V0NA 1QHTA 3SI6A 4O5BA 1NKCA 3HKWA 1S6PA 3HHKA 4LD0A 4O3SA 3E51A 1RT5B 4K8ZA 4XPEA 3H2LA 3HL8A 4NRUA 2IMWP 4NLXA 3QNOA 4NLTA 1WSIA 2HB5A 4CEBA 3T19A 2W8LA 1TKTA 3MXIA 3CM6A 1Z26A 5F8NA 3LP0B 2HNZA 3KKSA 1RDAA 1C0TA 3O4QA 4EEYA 1A5XA 2HHTA 3P5JA 3BSOA 1KLNA 1RTIB 4RNMA 5KFAA 3NH2A 4BE2A 4Z0UA 4OLAA 4WFYA 2KW4A 4TLRA 4CGFA 3QIPA 1TK8A 2UUTA 1S6QB 3FRZA 4LQ9A 4ZVGA 3T1AA 1S9GB 1DLOB 4CFAA 1S1TA 4K4XA 3OL9A 4DU4A 3K59A 1K1SA 3MXJA 3MAQA 2UVUA 3D28A 1HQUA 2HAIA 4TSXA 4DSFA 4TY8B 1Q9XA 1JL2A 1EKEA 4CFBA 1TAUA 2BE2A 4ZHRA 2DFEA 4HVJA 4JV1A 1ZBLA 2Z1JA 4N41A 1JLCA 3DLKB 4RU9A 4PA1A 4YNQA 3KKRA 4DU1A 1DTTA 4Z4EA 1CXUA 2NUBA 4CE9A 3V6DA 4Q8FA 4NLPA 1NKBA 2AQ4A 3QO9B 4DTRA 4FK0A 1TKDA 2Z1GA 3I0RA 4ED3A 4B9NA 2WOMA 4RUAA 4CCHA 4N47A 4O4GA 5HBMA 4NYZA 4CF1A 1R0AB 2AWZA 3T5HA 2G8VA 5KFLA 4F4KA 4DEZA 1RDRA 2IM3A 4O3RA 3OVNA 3VQAA 3KOAA 4KKOB 1JLEA 4LSNA 1JLAA 4HUEA 3BQ1A 3HXMA 5KG1A 5J2QB 1S1VB 1S9FA 1BQMA 3B6OA 1RA7A 3CDUA 2YNHA 4WFXA 1I39A 4LH5A 4Z4HA 5I42B 2KFNA 1BI4B 2WB4A 3VQ5A 3PX6A 4IOBA 3KJVA 1ZYQA 1RBSA 4DTMA 1TV6A 4GC7A 4YQWA 1LWEB 1JXBA 2BRKA 4RW8A 1IO2A 3TAPA 1EETB 1IKYA 1N5YA 4J2DA 1S0OA 4NLUA 3AVNA 2VG7A 4E1NA 3RR8A 3OS0A 4EBEA 3DRRB 1SL1A 4IH7A 2HHWA 4OPJA 1FK9B 2BANA 4HTUA 2O4IA 4FBUA 4NLOA 3TABA 3K2PA 2HHVA 3VQ4A 1EX4A 4Q0BA 3TAGA 2UVVA 3V1QA 4DF8A 2XI3A 3MEGA 4PWDB 3KHGA 5HP1B 5J2MA 4CGIA 1B9FA 2O5DA 3AVFA 2Z1HA 1EP4B 5KFYA 3L2RA 1NHUA 3CJ4A 2ZE2A 1SL2A 1XC9A 2BGGA 3ISND 3MF5A 3QLHA 4LSLA 4DWIA 2B6AB 5HRNA 4NYNA 2HWIA 3U6FA 1X9WA 3JYTB 4FLUA 4M94A 2RDJA 3GIJA 2FBTA 3SJJA 3OL6A 2Z1IA 5KT3A 3V9UA 1VSLA 3QERA 1D5AA 4CJWA 1RT7A 3OYEA 2VG6B 2WRMA 4Z4FA 4BWJA 1X9SA 5CZ2A 1C1CA 1C0UA 4O55A 3Q8PB 3H5SA 3DOKA 3V81B 4CGDA 1HYVA 5C25B 3L2UA 4WYLA 2I5JA 5L1JA 4ECQA 3KK3A 1LWCA 5DG7A 4GMJB 1RTHB 4KHUA 4Z4CA 2IJFA 3FDSA 4IBNA 2YKNA 2IA6A 1IKXA 3MR5A 1HPZA 4IR9A 5JS2A 4YMEA 4ED7A 2DFHA 3M9OB 1N6QA 2RPIA 3HP6A 4EBCA 1ASWA 4EYHB 5KFMA 3HYFA 3AA3A 5C24A 3PZPA 3AVIA 3KK2A 2DY4A 2RKIA 1RBVA 4AILC 3BQ0A 3DLBA 1TVRA 4W5NA 3SV4A 5HLFA 2FLNA 3AVCA 3HM9A 3TAQA 3CJ5A 1L3SA 1UOCA 3NFAA 1T03B 1S5JA 3AVKA 1TKZA 1QSLA 1A5WA 1CSJA 1VK0A 1RT3A 4TXSA 3OYCA 2OH2A 1K1QA 2P5GA 1IM4A 1TL1B 3CFOA 3TVKA 2C2EA 2W9BB 4CJLA 4YP3A 3SQ4A 3HPGA 1RDDA 4IFYB 3L2VA 4H4OB 3S3MA 1WSEA 4IR1A 4KTQA 4K4TA 4CEQA 5FDLB 4KHSA 4B08A 4EZ6A 4RNHA 4CGJA 2R2TA 4O0IA 4JLHA 5HROB 2IM2A 3RR7A 1D1UA 4M45A 1SKRA 4FXDA 1RCHA 3AVHA 4RW7A 5KFDA 3FFIB 3NAIA 4NLDA 1SH3A 2F96A 1RTJB 4ECTA 3NAHA 3SV3A 4IKFA 3KHRA 3NGYA 1KVAA 4X2BA 3G86A 2ETJA 3ZT4A 3KLIB 3M8SA 1RBRA 2YNGA 2XY8A 3AA4A 5HRPA 1VRTB 3V6JA 3SFGA 4I7FB 1O1WA 3BR9A 3MR6A 2KZZA 3MTKA 4MQ3A 1SL0A 4WZQA 2BRLA 3H5XA 1VSEA 4E89A 4CJFA 1YVFA 4M3YA 3OYKA 1UA0A 5KFUA 4TYAA 5C5JA 1HYZA 3N6NA 4RNFA 4I2PA 5HRSA 1L5UA 4FJ8A 3QETA 1U04A 2OA8A 4KB7A 4N5SA 2ZKUA 3OL7A 3CJ2A 4TQRA 3RAQA 3MXMA 3VQEA 4CF2A 1C1BB 2O4GA 1U45A 2HMIB 2RDIA 4ED0A 3LP0A 3IG1B 4KO0B 1LWFB 2D41A 3GV5B 3KLVA 3HT3A 1ZTTA 1TP7A 2W7PA 4DLEA 4KB0A 3HK2A 4HUGA 1RTIA 4CJ4A 2HNYA 3VQDA 4RZRA 1KSPA 1FKPB 4FJ7A 1A5VA 3PW2A 1Z4UA 4IG3A 3TR8A 2G8WA 4NLRA 5EWGA 3O4NA 1XHZA 1S6QA 5KFBA 4KI4A 1HQEB 3NE6A 3DLGA 3TARA 1I6JA 1NJXA 3QGHA 1NNDA 2VA2A 3DM2A 4ZTJA 2BQ3A 3PJXA 1J5OB 3BGRB 2PY5A 4M3RA 4IRKA 2IGIA 1ZBUA 4KBIA 4J9NA 1T94A 5D3GB 1D0EA 4ZMMA 5KGWA 1RT6A 2IC3B 1RNHA 2R2SA 2JGUA 3DLKA 3HVTA 3BSNA 4K50A 2AGOA 4E7IA 4J9KA 2QE5A 4QW9A 4DTSA 1NK8A 3NBPA 2B43A 3V9SA 3C94A 5KFPA 4Y3CA 1FKOA 3TANA 4K4SA 3KLFA 4FM2A 3HVRA 3P83D 4ZPCA 4CJPA 3RTVA 5I3UA 2OPQA 1S1UA 4CHQA 3VA0A 3FQLA 3H40A 1NK0A 5DLFA 3G6XA 5L1IA 4YR3A 3LPUA 4DQQA 4IH5A 2W9AA 4WXWA 3ICLA 3K5MA 4DL3A 3OJSA 4O3QA 2WONB 1X9MA 2FVCA 1WSFA 3DLEB 5KT6A 5J2QA 1KHVA 2HNDA 2X6NA 3NAEA 3OHBA 4ZP9A 4J9SA 1RT4A 2F8EX 1QTMA 3IRXA 3GILA 4G3IA 2LSNA 1VRUB 4QWCA 4B9LA 2B5JB 2IM0A 1JLQA 2WHOA 3GV8B 1HYSA 4FS2A 4N76A 3MR3A 1LWEA 3T5JA 4DL5A 3QESA 1SUQB 4DG1B 1HMVA 4M3UA 1QAJA 4CECA 1XI1A 2OPSA 2YNIB 3EZ5A 1WAFA 2FC0A 2EX3A 2OPPA 2BR0A 4FJ9A 1RTDB 3VQ9A 1TK0A 4CJTA 3LP2A 2JEJA 1QSYA 4JV2A 1TKXB 2WTFA 3KLHA 1NK6A 4OVLA 3M8PB 2YKMB 2D3ZA 2ZD1A 4KTWA 4IG0A 5CYMB 3KLEA 3MEEA 3RMAA 1MU2B 4RW6A 5JXSA 5J2NB 2FBVA 1ZBIA 2GIRA 3SFUA 2YNFB 5DG8A 2A1SA 4FJMA 3LPTA 4MFBB 3ZSQA 1RA6A 2W7OA 1NJWA 3VQPA 3IS9A 2V4RA 2VG5A 2AGQA 2QXFA 5KT7A 4HUFA 4W5RA 1JLFA 3I0SA 1EP4A 1BISA 4IFVB 2FBYA 2PYLA 3AA2A 4EP4A 1ASVA 4IRCA 4Q5VA 1QSSA 2E9RX 4CF9A 3V6HA 3CWJA 4F2RA 5KG7A 2FLLA 3KLGA 4E19A 4ICLB 2OPRA 4IDKB 4RW4B 4C8KA 2HVHA 1U48A 3SZ2A 1L3TA 1TL3B 1D8YA 3JSMA 2G8FA 1J9AA 4G1QA 2D0AA 4DLGA 3NF6A 4BE0A 4Y1DA 3LP1B 3DMJA 1C2PA 4OKKA 4PUOB 1K6YA 1N48A 4J2BA 1MMLA 3V4IA 3OSPA 4J9QA 4DS4A 1HARA 4J9MA 3PO5A 3CM5A 1D9FA 5KFIA 1S1WB 2CKWA 1YTAA 4MH8A 3TAMA 4XO0A 2UVWA 4QAGA 4O3PA 1IKVA 4URGA 3OLAA 3LWLA 2DFFA 5KFTA 5KRTA 1BHLA 4CF8A 2FJVA 4W5QA 4NLYA 3MECA 3Q8QB 1KTQA 4CEDA 3IGNA 4WYWA 2R2UA 3ITHA 2BDPA 3Q8SB 2E4LA 4BE1A 2FBXA 4OGCA 3C6UB 1JLGB 2JC1A 2KFZA 2EHGA 1RT2B 4B3OB 1SH2A 4E7HA 5J1EA 3RBEA 5CYQB 1XR5A 1KCFA 4FBTA 2KZMA 4UQGA 5KFJA 3SPZA 3EPIA 4QWAA 1N56A 3NF7A 3IGVA 4AHVA 5KT5A 3KK1A 4J2AA 5KG0A 5EWFA 4Y1CA 4NZ0A 3ULDA 3C6TA 3SQ2A 3DYAB 2X6SA 3E01B 1T05B 1KLMA 3M8RA 3D5MA 4DF4A 3OYHA 4B9UA 5FDLA 3ZSWA 3H98A 2WCXA 3PY8A 3H5UA 4DSIA 3OYDA 5HROA 5KG2A 5CZ1A 4MIBA 4FJKA 5KTQA 4EO8A 4E1MA 3LALA 3ZSZA 4H4MB 1LW0A 5C42A 3FFIA 2R8IA 4TY9A 1X1PA 4Q44A 5F8MA 4JRPA 5KFRA 1T3NA 5DMRA 3M8QA 4KHNA 1LW2A 3LDSA 3KD1E 5J2PA 1QUVA 4ZVEA 3P1GA 2E6MA 4NCGB 3BDPA 1B92A 1LAWA 2D7SA 1HRHA 3V9ZA 3OHAA 4DTJA 5KI6A 1LAVA 3F73A 1ZETA 3DOLA 1SV5B 1ZBFA 2GC8A 1UAXA 3BSCA 3HVAA 2XCPA 2HW3A 3ZT1A 3O3GA 2C28A 3K5NA 3IN5A 1WSHA 3M9MB 1BIZA 3VQ8A 4O3NA 4RW9B 3NCIA 1C1BA 3TI0A 5KG3A 1RYRA 4YFUA 3IG1A 1LWFA 1T7PA 4CGGA 3NGZA 1RAJA 3WNEA 4FJGA 4R5PA 4DFKA 4KFBA 4J9LA 4KV8B 3O3FA 2D0BA 1NK9A 3CFRA 4Z4IA 4ZP7A 3K5OA
chains in the Genus database with same CATH superfamily
2D0OA 4RU2A 5B0DA 4EP5A 1VR6A 1TUGB 2HGLA 4BDZA 3LANA 3O3LA 2MHEA 3P3DA 5AQGA 2HZCA 1JKHA 3BS9A 4X4RA 1Q78A 1FEHA 3CC4N 1C0TB 2ZNYA 4DL6A 4CLPA 4DFJA 1H7XA 4KI6A 3FCWA 1FTRA 4P74A 4YOYA 3J7A1 3QIPB 5DK5A 3IR7B 4JB8B 1SJ4P 3C3LA 3MXHP 4DV7J 1CVJA 1CXQA 4B9SA 2F8TA 2H9ZA 3EE8A 4I69A 3P39A 5A8WB 1VSDA 1FWLA 2P9SB 1FX2A 1E6VA 1NM2A 3U02A 3OYIA 1FI4A 3EGZA 1FXLA 4HT7A 3DRXA 4NCAA 4CFCA 2CH6A 4WXOA 4IO9L 3EMTA 4BC9A 4V19X 4X4SA 3R8YA 2P9IB 2CYYA 1JXLA 1YTUA 4F4ZA 4E7JA 3CJ1A 4LF6K 4H0OA 2FHJA 4OI3A 3C7NB 1GMWA 4DTOA 2EPIA 4LF5J 3W3SA 3TTFA 3G4SN 4ER8A 2MGZA 3ZSXA 5HBMB 4MMOA 5IT9Y 3NS6A 1KQFB 2Q31A 4A59A 2PMZD 2BUNA 3CB4A 2YVSA 3OBIA 1FDDA 4K5RA 3UI3A 1XNQF 3UIQA 4ZTFA 2PFUA 5HJXA 1TK5A 1FKAF 2V8DA 1HR0J 3QEWA 5LL6Z 1OYDA 4EHUA 3HPOA 1O0PA 4JI4F 1RTDA 2CQ1A 3NP5A 2GELA 4W5OA 3GTYX 4USTA 2JEIA 4F26A 1IKYB 1V9OA 3CMES 3LDQA 1QE1B 3GQCA 4LVNP 1UWBA 4HCBA 3VPZA 3WIVA 4OJRA 3SSSA 4IO8A 1RT5A 2CQIA 4QPTA 1HWUA 3ZT2A 4P6QA 5LJVA 4NLVA 3VAGA 1GOBA 2MKCA 3WT0A 1M5OC 4P2MA 4DHYA 1NK4A 3D2FB 2LFVA 4FKXA 4ZVOB 5D0EA 4CZLA 2MZJA 2NSCA 4CEOA 2UUBF 4DR4K 2PAVA 3R5JB 4BRPA 4Y2KA 3UDLA 4L3KA 3DRSB 5JMVA 1EAYC 1WOSA 4UY8T 2AJ0A 2QLXA 2G8IA 3PR4A 2VBYA 1GLDG 3TQEA 1U4BA 2DHGA 1DLOA 3TJAA 2ZE2B 3ZT0A 3L3CA 3L2QA 1RWMB 2IRXA 3E9LA 1W26A 3KDNA 2RRBA 2EVZA 2M70A 2AMCB 4J37A 3W5YA 2J6UA 4Z4GA 2ALYB 3Q8UA 3NGIA 1XIQA 3UKRB 2YQ3A 2N3OA 4KY3A 1C1CB 4RBVA 2QMUB 1C0UB 2BW2A 4DR1K 3S01A 2XLIA 1C4CA 3J81Y 2R8GA 3M6VA 4C7QA 4HHTA 3VQTA 3WHIA 2MEWA 3U3GA 2MLZA 1UTAA 1IKXB 3FVYA 1S0VA 1KR4A 1R0AA 4OYZA 2EFPA 4CIEA 4B3SF 2G1DA 3HFVA 2ILZA 2J6TA 3K17A 3ZTQA 5GAGU 2EC2A 3G8TA 3KK2B 4KBOA 4E1JA 2RKIB 3M8ZA 1VJQA 2XY5A 3D1QA 5AFUH 5KFFA 1BQNB 4PQAA 3DYAA 5AJ3F 4CZMA 3CCMN 1RAIB 3F5TA 4CJ3A 1EX8A 1OY6A 3DKDA 3QYYA 4M5IA 4HR2A 3SSRA 4Y65A 3OS1A 1D8ZA 2AP6A 5F8IA 1HNXK 1RU2A 5B0GA 3LAKA 3K5LA 5M1QA 5D4NA 2XMWA 2VBWA 4BDYA 2K7KA 4JI0F 1Y3JA 3HI0A 2E1PA 2JZ5A 1VBXA 4RNOA 4F4WA 4CLWA 3OW2R 1Y97A 3H2VE 3HSGA 6AT1B 1F3FA 2Y1IA 1KKHA 4G65A 1R89A 3UCUP 3PTWA 1UP1A 1VSJA 3THWA 2RHSB 1ATRA 2D9PA 1X4HA 4WFZA 4LBPA 4CEZA 5DGBA 3ZTOA 3BN7A 4FJXA 4W4MA 4ZKAA 3SCLE 2ZDPA 3B4DA 4DQRA 2CGLA 4PWDA 4CJQA 4FJHA 3IA0A 2NRXA 3NCPA 2OTJN 3VAIA 2WB1D 2YTCA 3C46A 4OPKA 4Z7YA 1YX2A 2BYCA 4O0JA 4CLKA 1KC8O 1EZZB 1DQAA 2B6AA 3I5AA 1BUXA 2EI5A 3JYTA 2UXCF 3ZYYX 1FDAA 2WUSA 3VGLA 2MKIA 1F6TA 2D9OA 2ZUAA 3R27A 2ILYA 1CQMA 1PGZA 1CJKB 2V9KA 4R8UB 4CJSA 3UWTA 2HNYB 3S1TA 4EGLA 3HJFA 4PKGA 1CJUB 3S9HA 4IG3B 4GKKK 4ZVFA 4AL7A 3OY9A 4L73A 4JK7A 1KAZA 1G15A 2MDAA 4OO1J 2VODA 3NVKA 1RKJA 2P9SA 4ZVHA 1TUYA 2M52A 4QQBA 3AO5A 3CQ8A 2CPYA 3EJMA 4BR5A 1IR1A 2H5IB 1VQLN 4DTNA 3R5CA 3EVMA 2XCAA 2F8HA 2HHHF 1YQHA 2KN4A 2HBQB 3DXMB 3NBPB 4G1IA 1VHFA 2UXBK 1FKOB 4JKFA 3KLFB 1I3OB 4JV0A 1IBKJ 3C7NA 4WZMA 3A13A 1F21A 1T03A 3VCDA 2ADBA 2HBMA 2E9ZA 5I3UB 2OPQB 1S1UB 3MEDB 4XH5A 3PW0A 3CJKA 4XPCA 4DXLA 1NSAA 3ZTPA 1L3VA 9ATCB 3ZSVA 4QWEA 3N0VA 3BEGB 4PKIA 4CT9A 2OKQA 5CCLA 1RBUA 1S6UA 3EGVA 3I8DA 4OKEA 2RF2B 3TTDA 1RTJA 4DR5F 3IRXB 3BGFA 4FZZA 3MOJB 3CJAA 2G8HA 1IBLJ 2GJ2A 3HHLB 2FJWA 2FJAB 3KLIA 2GX9A 1VRTA 4ED8A 2DRAA 3NS5A 1FX4A 2F5GA 3K58A 4ED2A 2O8CA 2DITA 3ZEUA 4JRQA 4NOHA 2JFKA 1U6ZA 4DV1K 1QE1A 4WP8A 3S3NA 3TX8A 4OYPA 2RD5C 2AW0A 2IDOA 2NUUG 3MUVP 3B8HA 4BG9A 4ED4A 1NCLA 4NEZA 2W1BA 4JD2A 1JXEA 2HFOA 3CDBA 3KLHB 2ZH9A 4KH4A 4KO0A 4HTJA 1H38A 1KFDA 4RBTA 3SNNA 1QHAA 1X60A 1CZ9A 4PR6A 1KFSA 2R2RA 4L72B 4D3GA 5F8GA 1FKPA 1HQ2A 3TZWA 4U95A 3DRSA 1UEVA 1GXUA 1TYQB 1I94F 1JL1A 4K4ZA 4H5VA 4FWNA 1HQEA 2HQ3A 1QZ6A 3JQJA 4U6PA 1ZPVA 1BO5O 3AGRA 1NAQA 3KTQA 3BGRA 3ATVA 4JI8K 3QGGA 4LFAK 5D3GA 5KPZA 4A8QA 1SQFA 4YB5A 1VIOA 3PEHA 2HRYA 2V2QA 2OPRB 2DVIA 2RU9A 1NU4A 2XRIA 3R5DA 5KOWA 1Q8KA 3IWLA 2HHPA 3T9NA 4G1QB 4B9MA 3MPWA 4O4RA 1DQ8A 3ALYA 5LY3A 3V4MA 4QW8A 1GX5A 1SH0A 1FNXH 2MLYA 4DR6J 1ZXOA 4CH0S 4NX9A 4O8KA 4ZHRB 4YDXA 4FJLA 2HKEA 3VAHA 1HWJA 4DV5K 1WSJA 2ACMA 3I5CA 2KFYA 4HI1A 3RSEA 3RW6A 3W9JA 1APSA 4ELTA 3TAMB 2HQCA 1UKUA 1HKBA 1KC8T 1P8ZA 3QMQA 3CCRN 4NRTA 2HZVA 4DL0C 3MECB 3M2VB 2AT1B 2E9TA 3M32B 1CZBA 4A8OA 3HKZD 4YDDB 3HO1A 3HM8A 3K0SA 3ITHB 3ENOA 2E7VA 3I6PA 3QIOA 5E5NA 1T6DA 4FF2A 3VEOA 4K59A 1BQNA 2QT7A 1WG4A 1SAZA 3SAFA 2VPZB 1V3SA 4QIFA 4O0NA 3RB3A 3VQSA 3PSIA 1Q18A 1SUQA 1VSHA 4DG1A 5T7BA 4YB7A 4NCBA 3PUFA 5EVZA 2MZQA 2B7BB 2VQEK 2ZVIA 2YNHB 4KHMA 5F41A 4JI7F 3RJMB 4DMZA 3D6MB 4CK3A 4KHPF 1VYAA 4ECSA 5H9EK 4N77A 3O5TB 5DGAA 2CH5A 1JCEA 1WSGA 1J27A 2PMHA 5DM7L 3VGVA 3RW7A 1CEZA 1PYSB 2IDLA 3N5FA 3BYPA 1T3OA 1T9XA 2MSTA 2UU9J 4E0DA 3K9KA 2LQ8A 3MM8A 5F8JA 3H25A 5CH7B 4B1WB 2CXEA 2I7PA 3LDPA 3RRHA 2PMWA 2VASA 1N88A 3PRDA 3TSPA 4FLYA 1FJGJ 3A8EA 1Z1ZA 2RN2A 3T1HJ 2RHKA 2W25A 1U2CA 2V34A 3I56N 2E5LK 2P9NB 3H59A 2YWEA 2FF6A 5AZJB 1EHWA 5IT4A 4EAHD 1X4DA 4CEAA 1X4CA 2AYEA 3L2WA 1YIJN 4JI5J 4ZN1A 5A0YB 2W6KA 3TQ1A 4R5PB 3IBFB 5IT0A 1CJKA 2IA0A 4R8UA 4LF9J 3TOQA 1LFWA 3WXLA 4OKJA 3ASMA 2XZWA 4ATNA 1VQPS 3RB0A 4RR5A 4LSLB 3R5AA 4CZGA 2UVRA 5DETA 3ATUA 3H1VX 1F0XA 5GIOA 2PFDA 4M41A 2CPXA 3KKFA 4HCCA 4YR2A 4AD6A 1S1WA 5SWMA 1LWXA 1M5SA 4MIAA 3F9MA 3WNFA 2LXFA 2CQPA 4C3MA 1QLNA 4BQLA 3KG0A 4WE1B 2ASDA 1HW8A 5H1SQ 1YTYA 3R5BA 4Y2CA 2ATQA 2R8HA 3I9V9 3VAJA 4DPWA 4CO1A 3DXMA 1Q7LB 7FD1A 3Q86A 3OYJA 4USVA 3VGKA 3CCTA 4LFBF 1VQ7S 4B3OA 4KE5A 5FPDA 1U47A 1Q1KA 2JEFA 1IKWB 4BRQA 1R59O 5EWEA 2HK2A 3CPWM 1QS4A 2Z2YB 3MEDA 5KFCA 5GINA 1FCAA 2HBJA 3S3OA 3E01A 4DL7A 3L3VA 4JKHA 4EZ9A 4ILLA 1RKIA 4U67L 2F9JA 4ZVQB 2M0GB 2RF2A 2ZWOA 1RT3B 3DOMA 2HQFA 2CIMA 1UW4A 2QSFA 2CPDA 3J80O 4FLZA 3IAYA 4KC5A 3UD3P 3SQGA 4BS2A 2LQBA 4PG6A 4DPXA 1NHKL 4EYIB 5GAHI 2QMWA 4K4UA 2ROPA 1QQMA 3RBDA 2X3GA 4BVPA 3OS2A 2VIHA 1HNWJ 2E5GA 4WCEQ 4X65J 2OZMA 4KSEB 2O1PA 3M05A 3BBCA 2F7VA 3I5BA 2YPYA 4CEFA 1U8SA 1XNRK 4CZEA 5HMWA 5E84A 3F41A 3R9PA 2YHBA 1A7GE 2F65A 2X74A 4DTUA 3D4JA 2VA3A 4B8AB 3AXKA 3ZNJ1 1WTBA 3GMGA 3JSBA 4LD0A 5GAEP 4USKA 4YORA 3HRGA 2IMWP 4Z94A 2G2OA 4NLXA 1Q7YO 1H72C 3SIPB 3E9OA 3FSXA 4E2FB 2HB5A 2W8LA 1Z26A 1S59A 4X64F 2E1ZA 3KKSA 3O4QA 1U1LA 3P5JA 3MCNA 5HMYA 4BCAA 3EKUA 3ET6B 1TUUA 4Z0UA 1B99A 3DDIA 4TLRA 4CGFA 3VGTA 3AJ2A 2QA2A 4LQ9A 4PPZA 1X4BA 4CFAA 5LMUJ 3I55S 1K1SA 3L7PA 5F3TA 2DXEA 3GJSB 1N33K 2FSJA 4L74A 3MAQA 2HAIA 2YCHA 2QSWA 4DSFA 4FYVB 1JL2A 4CFBA 1U0SA 2BE2A 3J7YU 4ZHRA 4JV1A 5M1KA 2VGNA 2Z1JA 1JLCA 4RU9A 1N32J 5CHIA 1OSDA 4PPDA 4OHYA 2J0SD 1MWYA 2DGWA 3D1OA 3P4IA 4DU1A 3BKFA 4Z4EA 4WU2A 3TX0A 4A5BA 3QJLA 5JVGQ 3V6DA 2LXIA 2V2VA 1NEEA 4BRIA 3L7UA 2YH0A 3RAMA 1TKDA 4IO1A 2NZCA 3I0RA 1RGIA 1Q53A 4B9NA 2WOMA 4RUAA 4CCHA 4N47A 4O4GA 2ZC4A 4NYZA 2B7CB 2AWZA 3D6FB 3OVNA 3KOAA 5LL6d 3H46O 2E7XA 1NNEA 2MZSA 4PYAA 3BQ1A 3MMAA 2L9NA 3HXMA 3O8MA 2VQFK 2QYGA 1VQNN 4WU3A 2CNKB 2J8SA 1S9FA 4L6V3 4FO0A 5AQTA 1XQIA 3G6EN 2YNHA 5DJBA 5IOLA 2P9CA 5B0CA 4G6VB 2KHCA 3T1YF 2WB4A 2WZ1A 3KJVA 1RBSA 4DTMA 2OEKA 2E2QA 1R8BA 1RJJA 2EKYA 4YQWA 2B51A 1U26A 5BPLA 1XMQJ 3TAPA 1EETB 1RSCA 1KAYA 2C2MB 2A3JA 3AVNA 4E1NA 3QT7A 3GL1A 3W64A 2RE1A 2OTLS 3OFFA 2HGNA 1YVNA 4OPJA 1FK9B 1VQ6S 2RE2A 1FRHA 1VOMA 4QYZJ 3M6XA 4FBUA 3J8AA 1UFWA 3CNQP 1I1GA 3C15A 4Q0BA 2GGPA 5AZJA 2AEJA 1ZA1B 2GHVC 3MN6A 2C3PA 3W1YC 1V6HA 2PFFB 3MEGA 5HP1B 5BRDA 2O5DA 3AVFA 1BC6A 2Z1HA 5FIIA 3L2RA 3CJ4A 3D66A 1SL2A 3QICA 2DNMA 1UFLA 4ANDA 1EKSA 3CJSA 5M1OA 1L3KA 1IBKK 2A0FB 2HSEB 3QLHA 3ENAA 4LSLA 4J9VA 2DB1A 2DNYA 4P72A 2FBTA 3SJJA 5M1FA 2CPIA 2RDDA 2FSNA 3L4BC 2YKPA 3LF0A 1FRXA 1RT7A 2VG6B 2MZ1A 1VQKN 5CR4A 1FXDA 1T95A 4AQYK 4UOFA 1FJ7A 1UW9A 2GAHC 4CGDA 1VQYA 2BJ8A 1HYVA 1H2UX 1M0SA 2QWNA 2I5JA 2SXLA 4GMJB 2R7XA 3FDSA 3NLCA 2YKNA 2QFJA 2FXUA 1RAAB 4WPAA 5C2GA 2CJYB 4WIIA 2CQBA 1Q7YT 3LW5C 2GVZA 2RPIA 3CQYA 3VVUA 4EBCA 3J7Z5 3BH6B 2YKOA 2GVDB 5KFMA 3HYFA 5D6GA 1K44A 5C24A 1VQMN 3AVIA 1OMSA 2CJXB 2ZJRQ 2NRVA 3O9UA 3KJQB 4AILC 1VK3A 2OSRA 4CD3A 2QRRA 1R3NA 2K06A 3D7SB 4ZCLA 5HLFA 2FHOB 3HM9A 1ZA2B 3PEJA 4Q7AA 3AJDA 1L3SA 1UOCA 2Z58B 3NFAA 2VC1A 1S5JA 1QSLA 3DLJA 1RT3A 2VPYB 1YITN 3US5A 3VALA 3CIPA 3TEGA 4DR7J 1TL1B 3TVKA 2C2EA 3LDLA 3SQ4A 3JSRA 3H3OB 1XMOK 1R8CA 2EBGA 1WKLA 3NEKA 2F4VJ 4JI4J 4GNIA 4CGJA 5HROB 2IM2A 1Q4RA 3RR7A 4WCEL 3AVHA 5KFDA 2YWWA 2F96A 2NUHA 3NGYA 2V2KA 1F2GA 2DH9A 4X2BA 3W2VB 3ZT4A 3M8SA 2YNGA 5HRPA 2MQLA 3V6JA 3SFGA 2CUYA 1SL0A 2A10A 3I31A 1Y7PA 4CJFA 1YJWN 2QM1A 4DZDA 2H5JB 4CIOA 2KYZA 5KFUA 4OI6A 1XMBA 5C5JA 4PL8A 1RWNB 4I2PA 3IBCB 4NA2A 1YJNS 1L5UA 2UUBJ 1SC4B 1YJVA 4FJ8A 1KOHA 2ZKUA 4B3MF 2HEKA 2W24A 1U45A 2O4GA 4BQZA 1FWKA 3IG1B 1LWFB 3W66A 1ZTTA 4KQZA 1WEZA 1TP7A 2ZC3A 5HQMA 3R8EA 3HK2A 3VQDA 4RZRA 1E3MA 1CULB 3PW2A 4UUWA 4RKUC 1FHTA 5EWGA 1IJJA 1I6JA 2Q3PA 3QGHA 2RS8A 4P52A 1CJTB 4NXNJ 1WHYA 3H20A 4ZTJA 1J5OB 2Y3YA 1SS6A 5IQQA 1SQGA 2IGIA 1B4SA 3MM9A 5KGWA 3CPEA 1NGFA 2JGUA 3L09A 4DHVA 2CQHA 4MYTA 5HVFA 2O8BA 5M2RA 1WF1A 2QE5A 2O8DB 2B43A 5MLCV 3C94A 4B3SJ 3GB0A 3TANA 1QD1A 5AZIB 4LF4F 2YX1A 2PEHA 3L4IA 4NLBA 2G1HA 3RTVA 4CRJA 1BWEA 4ZPWR 1NK0A 4JI3F 1XERA 3G6XA 1RHUB 4YR3A 2V52B 2DPNA 1ZZNA 5AJ3J 5LM7E 3HD1A 2W9AA 3VVTA 3ICLA 1U8WA 3PNIA 3S8SA 4DDFA 3OJSA 1X9MA 3D7EO 3CD5A 2FVCA 5IWAJ 3QFUA 3GCXP 2MKSA 3FBFA 4LF7J 3JTPA 1JJ4A 4IEEA 2FPHX 5M1NA 2EFOA 1QTMA 3C16B 3T1HK 4JI0J 4V19S 4B9LA 2B5JB 1JLQA 4M5DA 4OYAA 4DL5A 3QESA 3CD0A 2KI2A 3QFWA 4CH1A 1HMVA 2DBBA 1QAJA 4ZA1A 3MPYA 4QIGA 3TJ8A 5ETVA 2EX3A 4OV6A 3W5ZA 3AY9A 1YZ7A 4JI6F 1AZSA 2WTFA 4DV0F 4OVLA 2YKMB 4AF1A 4OJ1A 4IG0A 1PYOB 1MU2B 2H65B 2KJVA 1PIEA 2QFIA 5DG8A 1BDGA 4MFBB 1NJWA 3Q23A 1HA1A 4N8NA 5E2QA 2AGQA 1K9MO 5KT7A 4HUFA 4NXMF 5AQRA 4K0KF 2G2ZA 1OH7A 3I0SA 4IFEA 3M2UA 1BISA 2J7KA 4OYXA 4ILJA 3AA2A 3D2EB 1UPMB 2FB0A 4GO7X 4EP4A 1ASVA 5DDOC 3CERA 1QSSA 2MLXA 2E9RX 1WKJA 1HFEL 2J4RA 2ZH7A 3LTOA 1BMQB 4C4WA 4E19A 1KQGB 3M8WA 4IDKB 4RW4B 2HVHA 4KH5A 1TL3B 2NRWA 3GJTB 3HOTA 4HDHA 3LP1B 3DMJA 1C2PA 2XMJA 4OKKA 3A5OC 4ZVRB 2XMMA 2KVQE 5T41A 4J2BA 3V4IA 2DY1A 1HARA 2XG8A 4J9MA 3BB5A 2GEMA 1GT8A 3O6WA 3MPDA 1D9FA 3CMAN 3GSDA 4CVNE 4OLOA 2HHHJ 1YTAA 4LFCJ 5FLXU 2Q1NA 2BM0A 2DFFA 1AFJA 2ZJRL 1BHLA 3LGNA 2VOPA 4NLYA 3NS7B 1VQ9N 3O9SA 2R2UA 1NDPA 3HJVA 3Q8SB 4DR3F 4OGCA 1JLGB 1G6BA 4X65K 2DGVA 1NMEB 2VZ9A 2EHGA 4QR2A 4P7VA 1SH2A 4E7HA 2R7OA 3HDSA 1KCFA 1WEXA 2NRTA 4NO7A 4X66J 2FYXA 5KFJA 3SPZA 4WK1A 1V3RA 3BEXA 4B9QA 4AHVA 2ZWPA 2Z0GA 4UQTA 4X4VA 2YJFA 4BR0A 1KLMA 3P96A 3OYHA 2ZZTA 3FCVA 4JNEA 3PY8A 5HROA 4MIBA 3UDVA 4EO8A 4GVEA 3ZSZA 4H4MB 2ZFHA 2N7YA 4JRPA 3W2VA 5ELZA 3EWGA 1T3NA 2W2PP 3K8WA 4C3LA 3AARA 3CD6N 2IVNA 2E6MA 1YHQN 1VQ4S 4NCGB 1SJ3P 3OHAA 3PG9A 3F73A 3QT8A 4BRAA 4DR2F 1T9UA 1O13A 2DYAA 1YSJA 2B9YA 1BE4A 4LF8F 2NSBA 3K5NA 1WSHA 1FJEB 3TI0A 2VPXB 1I94J 4X62K 1N32K 3Q89A 3IG1A 4D3HA 1LWFA 1NPKA 4KFBA 1M1HA 4J9LA 3ZTRA 2E5IA 4KV8B 1WC6A 2RQ4A 1ZM3A 3CFRA 5F0XA 2C2NA 3Q7BA 2X78A 5CYJA 4NWBA 1TKTB 3PV8A 5JJBA 3H8YA 2ASJA 4JS4A 2GJIA 2LEPA 3GV7B 1CJVB 3OR2B 1J5OA 4DN9A 1SBRA 1BL3A 4WKRA 4P2XA 1NOYA 4C0HA 4E3SA 4MT1A 1B7FA 1RDBA 3BH7B 5LMNF 2WC9A 2WBNA 1VLOA 5HSPA 2QA4N 1RCXB 3ZCMA 4IJNA 1WLJA 1XUPO 2KHOA 1S97A 3M1FA 1HNIA 5JLHA 2FLPA 1K9MT 3HT0A 3HZEA 4DMNA 4JS5A 4CF0A 1XMQK 3OLBA 1B0PA 3CDEA 4AHCA 3NGTA 1N5TA 2YX7A 1DTTB 2ACYA 4P71A 2DR9A 3GZ7A 3MFHA 8ATCB 5L9XA 3AVGA 5AR0A 3VQ6A 3HVWA 1UWAA 3J80Y 1NGAA 2P9LB 1RT1A 4BY9C 5EU7A 3H5YA 4QYZK 3HZ6A 2BBEA 3PO4A 1SKWA 4PQUA 4YHHF 1OJ4A 4OJGA 2B5JA 2DHHA 4WFNQ 4IOCQ 4OX9K 4CDIA 1Y5LB 4IUFA 4JOUA 4JV5K 4KHPJ 2FVPA 3VQCA 4K42A 2ZVSA 3EICA 4M8LA 1FRLA 4C8OA 3NRBA 3FK4A 2VGMA 5DZ7A 3UR0A 3WQUA 4FXWA 5HO4A 1H3DA 2IAJA 1HBMB 2M3DA 3C6AA 4DUYF 4M3TA 2LEBA 1N5YB 1MU2A 4JI1K 5EOYA 4O23A 1WDTA 1O8BA 1NPRA 4XIUA 1NGGA 1K0VA 5AQJA 2MTLA 2B4VA 3SCKE 4V19J 2F40A 2IFXA 2B8PA 1UEKA 2GJFA 1R8PA 3L6QA 3D2EA 1KVBA 5KPTA 5FPEA 4QCLA 3KYLA 4JKGA 2HLTA 1NGJA 1ELOA 5E26A 1ZC6A 4C8LA 4C8MA 5ETTA 3D1HA 3SXLA 4RW4A 4I9LA 2RUGA 1PAEX 3AO1A 3KNAA 3EZOA 3OYNA 5M2PA 3L95X 2BKPA 4TY8A 2XSJB 5CXTA 2W41A 1U49A 3DXKB 3MCPA 5IXUA 2R7YA 2NYHA 4Q45A 3PSFA 4YB6A 4Y2IA 3EDRB 3NG8A 3ZX2A 3AXMA 4DR7K 5L8RC 2LDYA 4A47A 2Y8WA 3T3FA 5GADP 4FWLA 4LFBJ 2F4VK 4JI4K 3QBCA 1TQLA 5M1PA 1PJ6A 4JYAF 5JS1A 3E1YA 3QO9A 3D0HE 4FLVA 4DV3F 4KPYA 3ZFVA 1HPZB 3U27A 5M2UA 3A12A 4FYWB 1N6QB 2OIHA 2OD6A 4CERA 4RUHA 5AE1A 2FJBB 2ZOMA 4FSVA 3CCZA 3QJPA 2O67A 2ASLA 2Y8YA 1T44A 3CVKA 3L9ZA 2KH9A 5GIPA 2NXEA 1TVRB 3OYLA 5I42A 5KFEA 2QK9A 1BI4A 3CIZA 4ELUA 2N82B 4FJNA 2NQPA 2LEAA 4TN2A 4CLUA 3RWUA 3ILJA 2KDOA 2XZDB 1UJ5A 3TAEA 1TKZB 1CZAN 3B82A 3D2WA 4NYFA 4H4MA 2P6SA 4NLWA 2WVDA 3EZUA 1IJEB 2LQ5A 5LJ3Y 2DH8A 4PXDA 3G6YA 4HACB 1OS5A 5IT9O 3BREA 4FM0A 3W7BA 1Q5YA 2P9EA 4WBFA 3WXKA 2GA7A 4DX5A 4TYBA 4NXNK 3BV8A 4DQPA 1AB8A 5AFUA 3OXFA 4RWWA 4PABA 5KFZA 1U2FA 3JTNA 2OEJA 3IR5B 4LSZB 1EXQA 4XDCA 4ECUA 2P9UB 3I9ZA 1FE0A 4BC2A 3KHHA 3MCOA 2D5RA 4KV8A 2W6LA 4X64J 2VWJA 1RWOB 2MXYA 2RRNA 4B3SK 5KG4A 2OANA 3MN9A 2XGQA 3FRYA 2LCWA 3LUYA 1TL7B 3NH0A 1P1TA 3NCRA 2MYFA 1XHXA 2HHSA 1OY8A 2LU1A 2HHUA 3JS6A 2HVEA 3OR2A 2QIFA 3KHYA 1HWLA 5AJ3K 2DPIA 4CZHA 4I6YA 3PIPQ 3T5KA 3CJCA 3QNWB 4P73A 5IWAK 2GBZA 1FDNA 3DRYA 3V81A 3ISNC 1NJIO 5C25A 1WORA 3W9IA 2Z4PA 4LF7K 4ETXA 2X1AA 4PG7A 1RTHA 2HIYA 3THYB 2UYTA 3BGUA 3DM2B 3A0IX 3D6TB 4N56A 2G8KA 4B9TA 4W5TA 3UE2A 4M5GA 2QLWA 1D3WA 3HI9A 4OHVA 5EHHA 4A2BA 3ENHA 3FKBA 2AGPA 2OELA 2V4JA 4USMA 5E3AA 3MGJA 4TVAB 3CCQN 1UETA 5BR8K 1IBMF 2XC9A 3GE9A 2LLZA 2XBPA 1CLFA 2PDAA 4BRCA 2CQDA 4BC7A 1VQ8N 4MK7A 2YV0X 4CZFA 1G1XA 1NJYA 1DQ9A 4FK2A 4O5FA 3U9ZA 3NNHA 4ZN3A 4JKCA 4DCJB 4WFNL 1X5OA 3G82B 1SC3B 4MK8A 3K57A 3QQCD 4WFBL 4IOCL 1REGX 2R7WA 4W92B 3NHGA 3LWMA 1NGBA 5KFKA 3T1YJ 4M5KA 1KD1O 1HBOA 2V9WA 2VKZG 3BR8A 1SKSA 3SQOP 4P2FA 3CO9A 2R8KA 1R6YA 2HNDB 2R7RA 1JJHA 2XWXA 1C0FA 5GMDA 4AL6A 1NOZA 2UV8G 1RT4B 4KGXB 1V4SA 2L08A 3PW7A 4ZPTR 4OIXA 2A2DA 4H03B 4I7FA 4B1XB 4ECXA 3GU0A 1WJ9A 4OLBA 3FSIA 4CLSA 2Q0UA 3BKUA 3KZBA 2I8EA 4IH6A 3G6VA 3QJJA 2IVPA 4ZVPB 1NK5A 2E2NA 1NB7A 2KRRA 1EQMA 2IYGA 1PKUA 5IS2A 2V69A 2K1RA 3W2WA 3CDWA 4LF6F 5AE2A 3LDOA 3O1WA 3HD2A 4GW6A 1T6CA 3L8BA 3UW1A 3LP2B 1YGYA 5T7LB 2BM1A 1UEUA 2VBXA 2JVRA 2ZD1B 3KLEB 3MEEB 3DDNA 4O44B 4RW6B 4ZVSB 4LFCK 5F8LA 3J7AP 1IXKA 4OGEA 4EMDA 3V9XA 1X5TA 2QWOA 4B3RK 3MCMA 3NOCA 4DL4A 2IRUA 4UOGA 2NLWA 2CFXA 3ID6A 3G71N 2VG5B 3CW2C 3CFPA 3G6ES 4BRFA 5LJWA 1M1KO 4CBXA 1J53A 2PYJA 3DDKA 1FA0A 1DZ5A 2GIQA 2Z2ZA 1U2VA 4KGVB 4DTPA 4DSEA 4F8RA 1UMJA 4M7YA 4X66K 4CBWA 3FZ2A 3DXKA 3VQQA 3KLGB 2VWKA 4H5NA 2FJXA 3THVA 1NJZA 3L0QA 1S1TB 4RBUA 3JSMB 2IOCA 1W0HA 2P9PA 3ZETB 1IG9A 3IMQJ 2ZQBA 3P45B 1FJCA 5BN8A 2AJ1A 1IN0A 3NGDA 1RDWX 2R3VA 3WNGA 2CQ0A 1RILA 1B7YB 1NB2A 4A8MP 5C10A 4C98A 4DV4J 1HJRA 2A42A 4NLQA 4LT6A 2EEYA 4OI2A 4CW7B 1BD6A 1RLDA 3G8SA 4FZYA 4CZKA 2YHAA 3LA0A 4Y2AA 3CJ0A 3E2EA 3C95A 2ERRA 1VAZA 4Q2MA 4NMLA 1SPBP 4I6MB 5F1XA 4JBCA 5F9NA 3CPWR 1VRUA 1VHXA 1KQSM 1JLEB 1S4EA 4ZS6A 1JLAB 1NJIT 4F02A 4CO2A 2M8HA 3CJBA 1DAXA 3AFGA 4WWSA 4M3WA 1GX6A 3KK1B 2MQ8A 4U8VA 3KWIA 2YNIA 1GLJO 4FYDA 2DRDA 2BJDA 2WSEC 4ECYA 1HWIA 3TAFA 1GTEA 4K5SA 5K20B 4DR1F 1ASUA 3KUEA 3M8PA 3A2FA 1RHMB 1LW0B 3VZIA 1XR7A 3PHEA 2ZH6A 3VGMA 3RBXA 3M8QB 2YNFA 1EARA 4A4JA 3UN2A 3I87A 3UCGA 3RAXA 3CJQA 5AXNA 2E1AA 3GFHA 1VQMS 5D4OA 1N34J 4MO4A 4A5AA 1RGVA 3ELHA 1H1VA 4FW2A 4EU0A 3D45A 4IFVA 2KYXA 1U7LA 4ECRA 1NK7A 3VF2A 3R7BB 5EX5A 5L1KA 3J7ZO 4ZCMA 2QA4G 3SYZA 1VSIA 1KD1T 3HTVA 4OI4A 1SQKA 3KG1A 2CVIA 5KFHA 1HBNB 2XMAA 3KHLA 5DO2A 5KFNA 1QVFM 3CCES 4EUVA 4GRSA 5I3QA 1OH8A 5FRMA 5J2MB 2RQMA 2X3DA 1HNXF 3DGVA 2QWRA 3SCXA 4I4BA 3CC2N 3ETMA 2O3DA 3CEDA 3R1XA 3TZZA 1FXXA 4DX8H 4MLEA 5KGXA 3DFEA 5IM0A 2U1AA 3VA3A 4DL2A 1IV0A 1BG3A 2BEFA 1C1AA 2JLEA 3THYA 2Y1LB 1JKHB 2A40A 2QGFB 4TQSA 3WX4A 1CS4B 1K47A 3MUMP 3SEOA 4AE5A 1WSVA 4HHHA 2EWSA 2QLJB 1ZH5A 3AAQA 2KKHA 2D4WA 4PL7A 4RPFA 3DOKB 4QPXA 4LF4J 4KHPK 1KWMA 3HSTB 3NVMA 3KK3B 1RDCA 1SJQA 1NGIA 5A8KA 3C6UA 3NMRA 4JI3J 1UCNA 4C0OC 4GVBA 2ZWHA 4K4WA 1OVYA 1HL6A 1RT2A 1E6VB 3QGPA 3PHTA 4CLFA 3JAMO 1M1KT 3B6PA 3SAHA 1VQ5S 5AXLA 3FBBA 1RWWB 2DGTA 2Q3SA 3HF5A 3BF3A 3JS9A 1YAGA 5F2RA 3OT9A 4CIFA 5HAOA 4KHYA 4IKAA 1KDNA 3CCUS 1Z2ZA 2E5HA 2CGKA 2XO7A 2QKKA 3N79A 3EL2A 4AYBD 1YI2S 1HHTP 4DFMA 2R7TA 4L3NA 4GKKF 3R9LA 4M42A 3D3BJ 5F0UA 4CIGA 2BX6A 3MM7B 3AO2A 2C3YA 3WEEA 1W9HA 3H2UB 3KFWX 1SJRA 4DV0J 4WIQA 3PW5A 7AT1B 1DKGD 2Y0SD 1U09A 5L38A 1SV5A 2J9DA 2QC3A 3OPKA 2K3IA 1OPZA 1E4FT 3AAPA 4ZLPA 5CD4H 3CCVS 1WUAA 1HWKA 3DJCA 3FFKB 9RUBA 2W4CA 2YXLA 1FVSA 5CY4A 1JIHA 3QIDA 3UKUB 1TAQA 4O44A 4DU7A 1UWBB 2HZAA 2P6TA 3SI6A 3P31A 3VF4A 3OTCA 4OHZA 4O3SA 2GS8A 3M4XA 1RT5B 4K8ZA 5A6WA 2VYPA 4XPEA 1U1QA 1QAXA 1V3ZA 2DCUB 3TA0A 3MD3A 2CADA 1TZ0A 1P6TA 3MXIA 2HFNA 5F8NA 1NGDA 3IMXA 2HNZA 3FCHA 2I0XA 1A5XA 4MKVA 2HHTA 4FF3A 1HJOA 1S57A 4YB1P 3NH2A 4PRFA 1NGCA 4C11A 3FRZA 4ZVGA 3AOCA 4OYMA 1X5SA 1DLOB 1S1TA 4DV1F 3FMWA 2GFFA 3THTA 8RUCA 2RS2A 3POTA 2QEXS 3RRKA 4MDBA 3D28A 5C12A 4TSXA 3Q7CA 5CQGA 4OI0A 2X7IA 1ZBSA 4PG8A 1TAUA 2JSXA 2FTRA 2JOQA 3O44A 3T6BA 2JX2A 3J7ZT 4DR3J 4C2MA 5AQYA 2A2CA 3TUPA 1NH7A 4NLPA 3MHYA 4Y0FA 3P38A 1YBUA 2G4BA 2YKQA 2HMPA 4FDFA 4HEA9 5CABA 2E1CA 4FWMA 4YY3K 3OFHA 4ED3A 4BRHA 2ZH2A 1RWXB 1OQ3A 4IQMA 1R0AB 2G8VA 3T5HA 3FMBA 1JLEA 2D74B 4LSNA 1JLAA 4L76A 1AUDA 4JI8F 3ZZYA 4HWIA 1ACMB 4LFAF 5J2QB 4CYUA 4B1ZA 1NSQA 1BQMA 3CI5A 2OMLA 1S7IA 2QW9A 1RA7A 3Q2TC 4A2AA 3I4PA 2AEFA 1I39A 2NNWA 2OSQA 3PX6A 5HQLA 1ZYQA 3GG1A 3WXIA 2DR5A 1TV6A 4BLGA 5HL7L 3MMBB 2V67A 1JXBA 2BRKA 2XMTA 1OKJA 1SB6A 4NLUA 3VOVA 2VG7A 2R42A 1XEZA 2XEXA 2W7AA 1GAOA 3DHXA 3Q22A 2E44A 1SL1A 4LF8J 5C15A 4IH7A 2BANA 2JVOA 1Y9OA 4HTUA 3THWB 2O4IA 3VWSA 2HHVA 4G9ZA 1AW0A 4GKJJ 3V1QA 3BF4A 2XI3A 2ZBCA 4PWDB 3KHGA 5J2MA 1HD0A 3ZNUA 2VQEF 1XC9A 2IRYA 5D0HA 3JQMA 4QIVA 5CZVA 3MF5A 2Z2LA 3O9QA 4M5NA 4DWIA 2B6AB 3EGWB 4AM6A 5GAGP 3JYTB 3HMJG 2O8EA 1VQSA 2QA1A 4X4UA 1S3XA 2NCKL 5LMNJ 5KT3A 4NZ7A 4NZ6A 1CS4A 1FW6A 1U6BA 3OYEA 3LGHA 1DARA 2VDHA 5CZ2A 1RISA 4O55A 3DOKA 4HH0A 4M63A 4WFAQ 3L2UA 2DNZA 4GY2B 4WYLA 5L1JA 3KK3A 1YJ9S 4F67A 4KHUA 1RZMA 1BA0A 4IBNA 4H5RA 3EDQB 1CC7A 5JS2A 4ED7A 3M9OB 1FO1A 3AD8C 3CMEN 3PDNA 2IPOB 2CG4A 3MI7X 2E5LF 1PJ7A 2GHPA 2WVCA 4J9UE 1UPPA 2UZAA 4Y2MA 3CE8A 2HYIB 4KIAA 1VQOS 3AA8A 4I6WA 3SV4A 2MSSA 4YHHJ 2FLNA 3VGSA 3CJ5A 2HBLA 2AJFE 2YH1A 1T03B 1T9WA 3TUJC 4DUZK 1CSJA 4WP9A 3B4MA 3THPA 4XDDA 4C1NK 5FPNA 3BBFA 2MKJA 2HQIA 4U7UK 3CJKB 3A3OB 3CFOA 4CI0B 4JI2F 4CJLA 4YP3A 3MM7A 3HPGA 1RDDA 3L2VA 1HNZJ 3FEXB 2B9EA 4L75A 4K4TA 4CT8A 5FDLB 1F5BA 4KHSA 1YJRA 4O0IA 3D6RA 4DUYJ 3NAIA 4NLDA 1RTJB 4ECTA 4CNZA 4IKFA 5MAOA 3G86A 3CJTA 2ETJA 4P7TA 2J7UA 3KLIB 2XY8A 3AA4A 4WYBA 1VRTB 3BZKA 3ZLJA 1VS3A 1UZHA 2O8CB 1A9NB 3UKUA 3TW0A 3H5XA 3ZEUB 1IWAA 1ZM9A 4Y0WA 2FZKB 2R4FA 1YVFA 4M3YA 1JCGA 3OYKA 3U1LA 4PAAA 1MMDA 1HYZA 4RNFA 3OTDA 3J81U 3GSIA 1ZS6A 4ITSA 4JD2B 2OA8A 4U7UD 4N5SA 2UXDK 4A57A 4CZIA 3CJ2A 4TQRA 4LF2A 1Z6RA 1C1BB 4DV4K 4KO0B 1RHKB 2D41A 2CQGA 4PG5A 4ES2A 1HKAA 2DKOB 1WWHA 2F63A 2W01A 4CJ4A 3GCWP 1FKPB 4FJ7A 3MD1A 1J5EK 3QWPA 2WBMA 1RACB 2MKKA 2AEMA 4RCHA 4NLRA 3OV7A 2W2OP 4PXCA 4KI4A 1HQEB 3DLGA 5DZ6A 1NDKA 3O1BA 2C2OB 2L3MA 1NNDA 1MROA 1WF0A 5B0FA 3PJXA 3BGRB 1WC4A 3OTOK 4IRKA 4B1UB 3L7OA 5D3GB 4OYIA 4J91A 4JYAJ 2UUAK 1RT6A 4BR4A 3MN5A 1XNRF 4K41A 1YK9A 3HVTA 3W9HA 1DGKN 2AGOA 2DY9A 3GG0A 4DV3J 2KG1A 4J9KA 3THXA 1P8GA 2C3OA 1HX1A 4G1PA 3X3UA 2V51B 1NK8A 3V9SA 4USUA 5AQNA 3S7RA 1FEEA 1K73O 3P83D 2GHWA 4CJPA 1HBUA 4P75A 3RSEB 1HHSA 1KAXA 5DLFA 1G99A 1X4FA 5LJ5Y 1T9YA 4DQQA 2IVOA 4WXWA 3VF0B 1ESVA 4E8UA 3M30B 1N34K 1RLCL 5J2QA 1QJHA 5BXIA 2UP1A 3UFCX 1FRIA 2RUSA 1RE1B 4ZP9A 4J9SA 2F8EX 4J7CA 1VFJA 2BKNA 1N33F 3Q8YA 3WQPA 3GV8B 3NNCA 1HYSA 1UVNA 4N76A 3MMBA 1SUQB 3OQ2A 4DG1B 4X4OA 4M3UA 4KH6A 1MWMA 2OPSA 3N5BA 2LDIA 1CQNA 1LCUA 1WAFA 2LXUA 4LRAA 2OPPA 1BOTO 3VMFB 1RB0A 2E29A 1UJ6A 1FWPA 4IEIA 1QSYA 2D3ZA 3GE1A 3CCSS 3RMAA 5JXSA 2FBVA 4EWTA 3Q2SC 4FJMA 3CUNA 3MPVA 4YOXA 5DM7Q 1PBAA 4V1Ak 1U1NA 4LF4K 5GVQA 3IS9A 2V4RA 2VQFF 3MM8B 5AQSA 3QPIA 2D0PA 1JLFA 2Q2RA 2E7WA 5AQOA 3DU6A 1Y64A 5AQMA 2FBYA 3AAWB 2PYLA 3K0JA 2E2OA 1WF2A 4IRCA 5KOXA 3MAAA 1BU6O 4I56A 2WVEA 4F2RA 5DDPC 2BA9A 3ZXWA 2DEIA 3OXGA 1EIYB 3PRBA 2CPZA 2H51B 2XB2D 3ILOA 4CD1A 4UUXA 1MLAA 1N36K 3CHWA 4A8KA 1NM1A 1J9AA 4WFAL 2X51A 4DLGA 3NF6A 1WI8A 4A8SA 4Y1DA 2ZOGA 3UO0A 5I9EB 1RK8A 1NBEB 4PUOB 1K6YA 1VBZA 2JHEA 3CGIA 5E3CA 3CM5A 1RHJB 3PFOA 1S1WB 4MH8A 2LQ9A 5AXMA 4C23A 1IKVA 2YWGA 3GFXA 3LWLA 1ILYA 3SMPA 5KFTA 5KRTA 2HBRB 2HFZA 2FJVA 4MAKA 5D15A 1JCFA 3IGNA 4DV0K 1LXNA 2DGXA 4WTYA 4GV6A 3EE3A 1NWKA 3VEWA 3DWLA 4QS8A 4B3OB 1G3OA 5J1EA 3HHLD 1XR5A 2KZMA 2C1EB 1WOOA 2WVBA 1N56A 3DN9A 3FGVA 3UDCA 2RRAA 2HAFA 3H3NO 4NYPA 4OPHA 3ENQA 4OZ1A 2LA4A 3C6TA 2KO1A 2M2BA 4YOTA 3SQ2A 3E01B 3FSYA 1SXLA 3D5MA 1S5ZA 2OMOA 4B9UA 5FDLA 4AQYF 3H5UA 1S76D 4DSIA 3DOMB 4FJKA 5C42A 1UFKA 4FZVA 4DV2J 4U67Q 3MN7A 1Q8BA 3ENBA 4EK2A 3MWBA 3U7JA 1K73T 3FZBA 1LW2A 4LF6J 3LDSA 3SQGB 3KD1E 5J2PA 4ZVEA 3P1GA 2HFSA 2WVFA 1B92A 1LAWA 4CO5A 2AYGA 3TA1A 3V2UC 5KI6A 1ZETA 3DOLA 3ENWA 3CCJS 5B7WA 2R7QA 3BSCA 4DCHA 5IC4B 1RABB 4IOAL 3ZT1A 3O3GA 2DT9A 3M9MB 4KR0B 2GO8A 4O3NA 1C1BA 2H1YA 1D9AA 4C97A 1QZ5A 2ZNZA 1N0VC 4GV9A 4DPUA 4JHDA 1T9TA 3WNEA 2HRTA 5E7OB 4DFKA 3BM7A 3MURP 3O3FA 1URRA 3CCWA 1NK9A 5A76A 4ZP7A 2XZTB 1X4GA 5I3PA 2MQMA 3K9JA 1XMOF 5A2QU 1ULRA 2UUCK 4LBHA 1S9EA 3M1VB 3NMAA 4NLCA 2KL8A 4CI6A 4I9QA 3DRPB 1G2EA 3Q8RB 5FROA 2KTQA 1RHQB 3T9ZA 3OVBA 1NDCA 2QL5B 3VR1A 4JAXA 4PY5A 2FVSA 2LA6A 3RRGA 2G0JA 3ZT3A 2Y1RI 1AYEA 3NCQA 4F4AA 2JC0A 1U0HA 3JAMY 3FBCA 3NWGA 2ATCB 1N4LA 3C14B 4FWRA 2UUWA 4LVOP 3R7SB 2CPFA 5B0EA 2QO3A 1NRKA 2BE2B 4DKWA 1YKWA 5DDRC 4UZCA 4CWBA 1WNEA 1JLCB 2DNRA 2C22A 4TNOA 2MKHA 4H54A 4I64A 5E33A 3SPYA 2XWYA 2MKYA 4IDHA 4ID5A 2L9DA 4QWBA 1RWUA 2KQ2A 3TYTA 3V6DB 2X1GA 3OL8A 1VDHA 3M30A 1RAHB 1BQXA 5CA5A 4O3OA 2Y1JA 3VQBA 3I0RB 3FUYA 1WSRA 5E0OA 3EKSA 3VERA 3UNGC 3SI8A 3KWMA 2WOMB 4O4GB 3W8GA 5K8OA 2VJUA 3ZZTA 3G8QA 1IUJA 1WN7A 1RYSA 4GKJK 3JQKA 1WHXA 3QZ7A 3RZAA 3MMAB 2BQRA 3RMDA 4FYYB 1LKZA 1P27B 3EY1A 1VQPN 4CO4A 2E1YA 3QEIA 2AU0A 1WC3A 5KAKA 2G2YA 2HHQA 3O9TA 1FF2A 2I7NA 3FGUA 4ECZA 2CWXA 2IYIA 3KJVB 5KRSA 4E7LA 4MKAA 3PX0A 3CC7S 2NXCA 5KT2A 1KVJA 1MWQA 4KT0C 4CHPA 2P9KA 1NGHA 1X4EA 2O8FA 2EG1A 4NMXA 1FXRA 2J5AA 3OTBA 3NKYA 3P6YC 2W8KA 3Q24A 3OYBA 2VDIA 3CCLS 4DQSA 3J7YP 1VSMA 1NBWA 3CJ9A 1I51B 1VQ7N 2XS5A 2QKBA 4K4VA 4DV7K 3OFEA 1Q82O 4I67A 1HNXJ 2IIHA 4KAZA 1F9HA 4CLYA 3ADAC 2QI2A 4LRCA 3T1HF 2B9XA 2D3UA 5CZXA 1REVB 3C15B 4Q0BB 2GGPB 4OL8A 1VC5A 1CLQA 1ZAXA 2XY6A 1S79A 5LSRA 2RILA 2HQGA 2HS3A 3MEGB 4FS1A 2NLXA 1S10A 2P5VA 4EIAA 2GO9A 1S9GA 3Q0AA 3ILIA 4YHHK 3GYXB 3DXBA 3N28A 2XLJA 2BTFA 2OP5A 3QLHB 1H98A 1K8AO 1BHNA 2CZVC 2EC0A 4PUOA 3V6KA 4LF5K 4CJKA 5A8RA 3M5RA 3QEVA 2HOEA 3QGIA 3EZWA 2OD4A 1R0BG 5AQFA 3P49B 1DTQB 1RT7B 4KHQA 3VZHA 4FPBA 1HNZK 4OYBA 5FRNA 1B3TA 4ANEA 1TL5A 3PJWA 2I5JB 4F50A 1NZ8A 4CHZA 2RT3A 2YKNB 3MFIA 1HR0K 2VFSA 1S72S 1R0CB 4KKOA 4KREA 3NGKA 2GVZB 4CLZA 1C6VA 4AHUA 3EE9A 4C1NI 2GQCA 1GK8A 4LR9A 1S1VA 3U1MA 5C24B 3L3UA 4QWDA 2PZSA 3LDNA 4WQ4A 4UOCA 1K8KB 4K25A 3VQ7A 5HN0A 2E20A 1RAOA 2Z30B 3QBXA 1W7AA 1QQOA 5HLFB 4ZP6A 3DLLQ 3IRWP 3ID8A 5A2QO 3VESA 2CPEA 4OZ2A 4ENOA 2AJ2A 3GIIA 3UR3C 4CFDA 5K14B 5DQIA 2P1JA 4FCYA 3ULEB 2FJDB 3NH1A 3CIMA 3K5PA 3I55N 3DRRA 1T3VA 2E1RA 1MG7A 2BJEA 3F9KA 2LMIA 3VV2B 4AHTA 2GX8A 4GO5X 3M3ZA 4PKDB 2YHXA 3AV9A 4FF1A 4X65F 4ZPDA 3MCAB 4J2EA 2YNGB 4GVMA 3N9UC 2YX4A 4JYAK 1B9DA 2HFVA 2W4PA 2WK4A 5BPMA 5GAEI 5AQIA 4ZK7M 4Q8EA 2DTUA 4CK1A 2N7CA 1C0GA 4I2PB 5K8NA 1QDUB 4BROA 1GOAA 4TLQA 1PILA 4DS5A 2WFBA 5LT5A 1FFGB 2VCPA 5C7PA 1VJWA 3MEKA 2DNNA 3OVAA 3M1VA 3D54A 4RTFD 3DRPA 4LH4A 3QNNA 2IBKA 4OHWA 2VU5A 1HW9A 1LNQA 4JEPA 2OAUA 2CPJA 3M6UA 1NDLA 3TA2A 4BWMA 5EN1A 4B02A 3PIOQ 1XC3A 4LRBA 3T41A 2HVZA 3C14A 1IVZA 5U47A 1YT3A 2MZRA 4BRGA 3PRVA 1M5HA 4CBUA 3QATA 3MM9B 1XBWA 2BW7A 1Q82T 2H3EB 3KJFB 4X62F 2RSQA 1U24A 1N32F 2FC8A 2ZHOA 3AHPA 3FJ2A 2OTLN 5G0RA 1W25A 3DU5A 2O8BB 3VHQA 4J9OA 2DNOA 2YJEA 1NGEA 3PW4A 1VQ6N 1GLCG 5JLFA 3IAS9 2JNJA 5C2FA 4K8XA 3RMBA 4LFAJ 4A48A 3V1RA 4FZXC 2W9CB 4KAIA 4DSJA 5G4DA 3UVJB 1Y10A 2ALZA 2W9BA 2YHWA 4R79A 4C0BA 1K8AT 4KB1A 4IFYA 4H4OA 1VGYA 1VK8A 4KGMA 2E2PA 2GV9A 4H0XB 2ZUGA 4DV6J 2FZCB 2XYGB 4BACA 1KQSR 3AO4A 1JJ2M 3I4HX 1TGOA 3RMCA 3C0BA 1DEJA 3QFHA 4JUZA 1WAJA 2N4DA 1JLQB 4M5DB 2B0GA 3OSNA 2HPUA 2W42A 3K8VA 3RVCA 3UD5A 1XMQF 3SQ0A 3OXLA 1HMVB 2BE7D 4KRWA 3O3HA 3MR2A 2K3KA 1SCJB 3KD5E 3EYZA 4C8ZA 2HLUA 2MB0B 3AVLA 2WBRA 3IM9A 4PHTX 1ZAWA 1OVQA 1AZSB 3UN5A 2YWKA 2B4UA 5GMEA 5BYQA 4U8YA 2HMIA 4IG0B 4OQJA 3CETA 1U1KA 1KHWA 2GUPA 2B3TB 1S6PB 2EBEA 2GQQA 2ITGA 2DRBA 1REVA 3K89A 1EWQA 3D0PA 1ZTWA 1K0TA 4OX9F 3CXCM 2XS2A 4FLWA 5EX3A 4JV5F 1MW7A 5H9EJ 2HG4A 1QVFR 3H4DA 3O9RA 3I0SB 2Q43A 3M2UB 3IXQA 5H1SV 4CJ5A 4EBDA 1YJTA 1H7WA 3WQTA 4HLBA 2KT3A 4WP3A 2HVIA 1S4FA 1WG1A 2BQUA 2B8QA 4YOEA 1GEHA 2PSZA 3D68A 4KGKA 4L3QA 2IC3A 3QEXA 3T6JA 3MUTP 4JI1F 1DTQA 3BGOP 3MX5A 1JNZB 4M63C 3GIKA 1OH5A 4GMKA 4L8RB 1ZPWX 3QMLA 3PKMA 2P9GA 4MKYA 1I3AA 3DMJB 1RXOB 4Q2LA 2WW8A 2E5LJ 2D1KA 3V4IB 2X1BA 2KXFA 1AA1B 1VBYA 2CWKA 3BDEA 3R2DJ 4DV2K 3QRRA 3GJQB 1WUUA 1WG5A 2GAGC 1IBLK 1D9DA 1L3UA 5AQHA 5AQXA 4CJUA 4DQIA 3LM2A 4WQ5A 4RNNA 4F9OA 5C2CA 3DLEA 2RJZA 1YJNN 1JXVA 4GVLA 1GLEG 4C3KA 3DLLL 4RWTA 1K8KA 5F8HA 5LSLA 4JKAA 1LV5A 3OYMA 1ZBTA 4HHUA 4JI2J 3BF1A 4NLGA 2J9CA 2C2DA 4BR2A 1YWXA 4FXVA 1XNQJ 2BZ2A 3DCAA 4KHRA 3CC4S 4CGHA 4OFZA 4F4YA 5K14A 4RUCA 2JWKA 4CEEA 1X9JA 1EJ7L 2QZ8A 1U2RA 4FWPA 4DR7F 3ULEA 2ATLA 1XTZA 1KLMB 2L9WA 2Z8QA 4RL1A 2F4VF 4CJRA 3I8BA 4LR7A 3AVJA 1YZ6A 4KH0B 1FT8A 2D3O1 3HSDA 2K2PA 4RUBA 5J2NA 3GWCA 4RLEA 1KVKA 2GV1A 4KH1B 3ZSOA 4UW2A 8AT1B 3D6HB 3OVSA 4LY7A 1KTVA 2CQCA 2IJNA 3CG7A 5LXYA 3GLJA 3M2RA 2K8GA 4ZPBA 3BO3A 1DRZA 4OZNA 1KEKA 1NHVA 3MMCA 1VBKA 4JP8A 1HKGA 3SUQA 4M3ZA 2EFVA 4ZVUB 1RAEB 2C2KB 2PIIA 4YOVA 4DBQA 4DR6K 3SBGA 3VTHA 3G4SS 4IOXA 2KXHA 4B9VA 4FWKA 3C2PA 4ICLA 3FR0A 4FLTA 4IQXA 4KFBB 1WOPA 2KG0A 3JXOA 1C0MA 3SQ1A 3FZHA 2F8MA 1FERA 1S12A 2VV5A 2HHXA 3PKYA 1F9FA 5HJYA 3GFYA 3PIOL 3HOSA 4BRKA 3IDHA 1XNRJ 3PR5B 2RQKA 1SJFA 2QWQA 4NXNF 3KMSA 4M3XA 3ETOA 3PX4A 3S41A 3AT1B 3R97A 4DQ8A 5BREA 1EB0A 2F8SA 3FZFA 3EVWA 2PI5A 2H3GX 2V4QA 2F1FA 3SUPA 2OZSA 4MK9A 4J5OA 1X3NA 2I1RA 2ZZMA 2DNQA 3Q83A 5L39A 3QZ8A 1FD8A 3A5LC 1HNIB 3EUNA 3A4TA 5CYQA 3DNCA 4DSLA 2DNLA 2DPJA 3N4PA 2BV3A 3MTJA 2W9CA 2Q0RA 1KNZA 4ZJLA 4DFPA 3UVJA 1MWKA 3W62A 1X0PA 1Q79A 4LREA 1BLUA 2BOPA 3GOIA 1GNKA 4KHWA 1N33J 3M7VA 4F0HA 2UU9K 2ROGA 4FOIA 4DN0A 5IWAF 4FVMA 1VSFA 2IS3A 4K8RA 1RT1B 2IY5B 4LF7F 3OYFA 1P90A 1FJGK 3SCJE 1AT1B 4PQUB 3GYNA 4ED1A 1Y3KA 1FRJA 4BG8A 5DQGA 2M4MA 1WI6A 2PC6A 3DAWA 1OH6A 1RBLA 2XI2A 4JI5K 2AJ4A 2ZJPQ 5ADXH 2BUPA 5BR8F 4ZIWA 3ZSRA 3AJ1A 5HK4A 1ROFA 4BRLA 4LF9K 2DGOA 4OJ3A 2HFUA 2FIUA 3MPUB 3W3DA 2Y0BB 5SUHA 4CNYA 2OI2A 3TSUA 3UPFA 3MMJA 4ZLJA 3KVGA 2VQFJ 3M6WA 4RW9A 4CTAA 2IAJB 1HHQA 1AFIA 2UV8A 4HL9A 3VEVA 2V0NA 3TTCA 1QHTA 1NKCA 4O5BA 2NR0A 3HKWA 1S6PA 3PYGA 1MDUB 4QIWD 1DBDA 4JKEA 4H5WA 3SDEB 3NGRA 3QNOA 2IDEA 4M5JA 5D8HB 1WSIA 4H5TA 3T19A 4OZLA 2UXCJ 3ZTSA 5K8PA 3BKTA 3CCMS 3LP0B 1C0TA 3H6EA 4JKGB 4EEYA 5CD4A 3BSOA 1KLNA 2C3UA 3E9PA 1Z05A 1CC8A 1FRKA 4WFYA 3QIPA 4O8UA 3PYFA 2UUTA 5B8HA 3ZZOA 1S6QB 4CJ7A 1XN9A 1KONA 2LP4A 3TU5A 1HLWA 4ILGB 4NI2B 4OX8A 4S0MA 3OL9A 4DU4A 3K59A 5A8WA 1VC6A 5HVGA 3MXJA 2UVUA 2CZ4A 5RUBA 4TY8B 1NZAA 1V4TA 3T69A 3CJ7A 3ZC4A 5HI7A 3ZZRA 3A8YA 2N3LA 1ZBLA 1HI0P 2QJ3A 3LGMA 3KWGA 4PA1A 4YNQA 2VHGA 2P9IA 5BYSA 1VQ4N 1YLXA 4LFCF 1WHVA 2NUBA 3WXJA 4Q8FA 4B3RF 1NKBA 3QO9B 4FPAA 4DTRA 4FK0A 4BGAA 1HKCA 1XK8A 2OTJS 1TMJA 2KM8C 1X5PA 4ID8A 3KXDA 5B08A 5HBMA 2FGCA 2YBVA 4M5LA 1M5PC 4C9DA 4MO5A