1S9GA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r120394.
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
543
structure length
543
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
total genus 141
structure length 543
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s9gA05
3IS9A 3VQ4A 1X9WA 3V6JA 4PY5A 1RDRA 3Q8SB 3VQBA 4CHNA 2IA6A 3HVRA 3ZSYA 3RRHA 4TQSA 3LANA 2J6UA 4MH8A 2ILYA 4WE1B 3IN5A 4H4OA 3GV8B 4KHNA 1J54A 4AHTA 2GIRA 5HRRA 3T1AA 4OVLA 2F8SA 5D3GB 3H5SA 4OGCA 2OPQB 2ASDA 3NF7A 2HHQA 3B6OA 3V1RA 3QZ7A 3IRXA 2IM2A 2HMIB 3RMDA 3ITHA 5HBMA 4O0IA 3M9NB 3AO2A 3HSTB 1RCHA 4DMNA 3BGRA 1K1SA 4QCLA 2JC0A 3P83D 4IRKA 4O3QA 1C1BB 4RW4A 1B92A 3DRSB 4E0DA 2HNYA 1RT3B 5HRPA 1YTUA 3H4BA 3V1OA 5KFOA 2XY6A 2ZD1B 4CJUA 4W5RA 3DRRB 4OPJA 5DG7A 1RILA 3QEXA 4CK2A 4N5SA 4EZ9A 3NMAA 2G8HA 3V81B 4JV1A 1ZBUA 3DOKA 3PUFA 4JS5A 3SV4A 2VG7B 4Y1DA 3SQ4A 1MU2B 5KFIA 3L2UA 2HVHA 3LP0B 4CGJA 3GIJA 4NYZA 4B9NA 2P5GA 1S9EA 1D1UA 4I7FB 3RB0A 1DTTB 3BQ0A 4M45A 4W5NA 1IKXB 3G6YA 2YNIB 3TARA 3QNOA 5J2QB 5KT5A 3CDEA 1NK0A 4CJEA 3MR6A 4CJQA 4DL5A 1Z25A 4DL7A 4IFVB 3H5YA 2I1RA 1S6QB 3F9KA 2UUTA 1SL0A 1RT4A 5F8GA 1ASWA 4B3OA 1I3AA 4IRCA 2YKMB 2XY8A 1ZTWA 5DG9A 3AO4A 3KD5E 1RT1B 4N47A 4WZQA 4CF1A 5J2QA 3O3HA 3KLGB 1YVUA 4ELTA 1JIHA 4IH5A 3BR9A 2HNDB 3DLKA 5I3UA 3SV3A 5DMRA 4R8UB 4RUCA 2IBKA 5E41A 3KHLA 3AA3A 2P1JA 2YNHB 2D5RA 2CKWA 1HJRA 5J2NB 4NCBA 5L1KA 2RN2A 1UWBA 1JLAB 1TP7A 3KLGA 3SI6A 2RDIA 3G6VA 3K5OA 1S1VA 2FBXA 4KAIA 3DI6A 5L1JA 4E7HA 2O4GA 2Z1JA 1EXQA 1C2PA 3SFGA 3OYJA 3KLFA 3PW2A 2ILZA 4CJ5A 4WE1A 4BE0A 2HVIA 4C8KA 3PX6A 1KLMB 2XCAA 1X9SA 4IG3B 1FKOA 2Z1IA 5DLFA 2OZSA 1IKVA 2BANA 3PV8A 2FJVA 3OYIA 4M42A 4J2EA 3CYMA 3G0ZA 3SQ2A 4OL8A 1JXLA 5KFWA 4HUGA 3HVTA 4NYNA 2HHVA 5I3UB 3UIQA 3FRZA 4XIUA 3OL7A 3JSMB 3I0RB 1SKWA 3I0SA 1TL1B 2D0BA 2ETJA 5C42A 4IKAA 1VSIA 3DRSA 4CJLA 1ASVA 1VSHA 3AVCA 1DLOA 4ICLA 4Y1CA 4ECSA 2VG5A 3SQ0A 3IGVA 3KK2B 3L2RA 4IDKB 1X1PA 2VG7A 3SCXA 3RAQA 3DLEB 4O44A 3EY1A 4WXOA 4ECTA 4NLWA 3GIMA 4Z0UA 4H8KA 3RWUA 4JV2A 2I5JB 4ID5B 5F8MA 4K4TA 3HT3A 1TGOA 3CG7A 4KO0B 4M95A 1KFDA 1NOZA 3CJ4A 2ATQA 4EO8A 2Z1HA 1FKPB 4DF8A 4ED7A 4HCBA 2DTUA 1BQMA 3DOLA 1UAXA 4N56A 5D3GA 1ASUA 3SYZA 4ZTJA 4TY8A 4EO6A 1J9AA 1S9GA 4FZYA 3GV7B 1N6QB 2Q3SA 2DFFA 3OVNA 3OLAA 4K4VA 4GC7A 4X2BA 3O3GA 4KAZA 3LWMA 4FJIA 4EBEA 1IKXA 3JSMA 4KB0A 1N6QA 4O3SA 3VA0A 3K5LA 3DRPB 2OH2A 2XRIA 4KTWA 3JYTB 3OLBA 1A5WA 5T7BA 4MK7A 3N6LA 4E3SA 5KG1A 3AA2A 3BSOA 4CEEA 4JLHA 2W9CB 2PYJA 4BWMA 4AHRA 2OYQA 3CDWA 1S9GB 2JGUA 2KZMA 3CQ8A 3QO9A 3T5KA 3OSPA 1GOCA 4NRTA 3HXMA 4DU3A 4CE9A 1S48A 1RT6A 1TV6A 3MECB 5CYMB 1UA0A 4OKEA 3DLRA 1WSHA 3FSIA 4CGIA 2E6MA 3AO5A 4Q5VA 5JS1A 3VQPA 3VQCA 4MIAA 1RTDA 4Y2AA 2GUIA 1NJYA 1BI4A 3K2PA 3MEDA 5HROA 4CF8A 3FDSA 4FJLA 1S1XA 1RA6A 4CF0A 3FFIA 2DFHA 1GOAA 1D0EA 4H4MA 5F8NA 4FK0A 2QKBA 3OHBA 3OJUA 3L2VA 1BCMA 2V0NA 1KRPA 4Z4GA 5KFTA 1S1UB 4YQWA 4FM0A 3H2LA 1XC9A 4DFKA 4CJTA 4ELVA 1Q9YA 4CJKA 3IAYA 4RUAA 4JUZA 3V9UA 3IRXB 1LWCB 4K4SA 1KCFA 1S1TB 4IG0A 3GIKA 4Y2CA 4B9TA 4FXDA 4QPXA 1BQNB 4URGA 2XI3A 2XCPA 1Q8IA 1N5YB 4NLQA 4C8OA 4DTPA 4DQSA 3K58A 5HLFB 3SJJA 1QSSA 5T14A 4FJNA 5KG4A 1MU2A 1LWEB 3U3GA 5F8LA 1VSMA 2IOCA 4IOBA 2ZD1A 1TVRA 3VN5A 4ZP6A 1SV5B 3TWHA 2JLEA 2HHUA 1RA7A 2W8LA 5F8JA 1HYSA 4IQXA 1EKEA 3QEVA 1JL1A 4C8LA 1B9FA 3KLVA 2ZQBA 2D41A 1BHLA 1JLFA 4H54A 4DU1A 1XHZA 3ITHB 1T05A 4O3RA 5J2MA 4W5TA 1C1AA 1NOYA 5DGAA 1S97A 2KQ2A 1S6QA 3H98A 4EYHB 4UQGA 3T5JA 4QW8A 4ZP8A 1NHVA 4NYFA 3NGDA 4ZTFA 1VSKA 4PUOA 2W8KA 4Z4HA 1NJXA 4ZPDA 3K5NA 2XWYA 2F8EX 4CCHA 3OYDA 4QWCA 4KB7A 3T3FA 3GV5B 1RTHA 4R0EA 1JLFB 2FJXA 3RMAA 3KKSA 3RR8A 3NKYA 3TAPA 3O4NA 3NHGA 4AHCA 4FLWA 4BE2A 4F4WA 3OYKA 4ECYA 2OPRA 3LAMA 4NLXA 3V9SA 3TAFA 4NCGB 3Q8RB 2F8TA 1GOBA 3OL8A 2G8WA 4DQIA 2R8IA 5DQGA 2GV9A 4M3YA 4OKJA 3H4DA 1EETA 4O4GB 3MXIA 4C8MA 3OL9A 4CJSA 4DQQA 1RDCA 1T05B 3SFUA 5C25A 3MEDB 3QEPA 2YHAA 2VG5B 4TSXA 4F50A 4J2DA 2JEGA 4IH7A 3DOKB 4DFMA 4AHVA 3HVWA 4O5BA 3ZSZA 3THVA 1SH2A 4ZMMA 1KVAA 3DLEA 4O44B 4M3UA 1LWFB 1KHVA 1S1VB 4OLAA 4I2PB 4E7IA 4KV8B 4F2RA 4WFXA 2BDPA 2AGPA 4KHWA 4ID1A 3PW5A 3Q8PB 3QESA 5J2PB 4MFBB 5KT6A 4DWIA 1W9HA 4NCAA 2BE2B 4Q45A 2UVWA 1CZ9A 3LALA 3IG1A 3N6MA 1S5JA 2HNZB 3SUOA 3KJVB 4F3OA 1SH0A 3V6HA 1N5YA 3AA5X 3PZPA 4E1MA 3OYAA 1RT4B 1U48A 2IAJB 3K57A 1RTJB 3RTVA 1K6YA 1HNIB 4J2BA 2Y1JA 2LSNA 2XO7A 4N76A 4H4OB 5C5JA 4QOZB 4ZPBA 5DLGA 4RZRA 1DTTA 1VSDA 4FCYA 4F3TA 2W7PA 3HYFA 3MTKA 4CESA 3ZSOA 3SZ2A 4CK1A 3QIOA 3VQ6A 1S49A 3P5JA 2KFNA 4YP3A 5KG7A 4FLUA 4J9LA 1RBUA 2W7OA 3MFHA 3AVKA 1LW2A 2AJQA 1B9DA 1QE1A 4ID5A 2NUBA 1LAWA 3BJYA 2WONB 1JLAA 1JLBB 3CFOA 5EUHA 4CHPA 2IC3A 1S1XB 4DTSA 4MKAA 2IS3A 5CYQA 3M8QB 4G3IA 4NRUA 1KSPA 4NLSA 3NF9A 1JXEA 3LPUA 1IKWA 3KK2A 3M8PB 3QIPB 4CF2A 4E7KA 3M8QA 4NLRA 1BCOA 5FDLA 4IFYB 4HKQA 3MEEB 2W9CA 4CEOA 4DG1B 3QZ8A 1ZYQA 2BGGA 1XR5A 1IKVB 4HVJA 2IAJA 2X6SA 2EHGA 4KHQA 1REVB 3V1QA 1KTQA 3DLHA 3A2FA 5DQHA 1DTQB 1S4FA 3ISND 2HHTA 5CY4A 4KKOA 2ZE2B 3BSAA 3K5MA 4EP4A 3RRGA 2FLLA 3TABA 5KFEA 1DTQA 4DTRA 2AX1A 5KT2A 4HUFA 1JLEA 4XPEA 4PWDB 3RB6A 1JLQB 3CFPA 3ZT2A 1NK4A 1T03A 5KFMA 2QXFA 1WLJA 4YMEA 3V9WA 1BIZA 1REVA 1L3VA 4B08A 3CJ5A 3KD1E 2XI2A 4ZVFA 1S10A 3LP2B 5F8IA 2WB4A 3BREA 1CXUA 2YV0X 2WOMA 3D5MA 3VQAA 3FFIB 1JL2A 3GIIA 4ECXA 1T94A 3P1GA 3QIPA 4CGGA 2X74A 1KHWA 4K4WA 1TKTB 4B8AB 4URQU 2WTFA 1C0UA 4IFYA 2VA2A 1U47A 3M8PA 4NLGA 2A1SA 1LWCA 3KTQA 4F4YA 4E89A 5EWGA 3KLHB 3ZT4A 5FDLB 3KOAA 3HVTB 3MXMA 2B5JA 3HPHA 2DPJA 2OPPB 3I0RA 2R2TA 1R0AB 1VSJA 2HWIA 4KE5A 4EZ6A 1SUQB 5KFSA 2OA8A 4G1QB 4H4MB 4MIBA 3BQ1A 1TK0A 3CDUA 1Q9XA 2B6AB 4Z4EA 1JKHA 1NJZA 5L1IA 2RKIB 3NH1A 4KBIA 3NGIA 5EWEA 3L2WA 3FQLA 4J9RA 4CIEA 1HQEB 4TQRA 4F4KA 3E51A 3H40A 1QSYA 1RT6B 2GBZA 4DL2A 3MXJA 3LZIA 3HVAA 4ED3A 3UPFA 2FJWA 3D28A 3VA3A 3CJ2A 3T5LA 4DL4A 4Q43A 4NLYA 1ZBIA 5KRTA 3KLEB 3AVJA 3TAEA 4CFBA 4CJ4A 1TKXA 4HTUA 2JEIA 3RBEA 5EU7A 4DTUA 4ECRA 1CLQA 1T8EA 2KFZA 4K4UA 1RTHB 4DL6A 1EP4A 4CEFA 4QAGA 3ISNC 4YR3A 1N48A 3RB4A 1XI1A 3GILA 2WRMA 3LP1B 3VQ8A 1HMVA 5L9XA 1EP4B 3NFAA 4DSFA 1RT1A 1C1BA 1QTMA 4F4ZA 3O4QA 2YNFB 1FK9B 5C24B 1L5UA 4DSKA 1VK0A 3V6DA 4JRQA 5DQIA 1CZBA 4J9KA 4CGFA 2OPQA 3EPGA 1FK9A 3H5UA 5KI6A 1FXXA 3ZT1A 1EETB 4O4GA 2A1RA 3S3NA 1BI4B 3PJXA 2V4RA 4AHUA 2QE5A 4NLPA 1RT7A 3RAXA 3TAMB 4DFPA 1LV5A 3QEWA 2OPSB 2ALZA 4NLVA 3AVFA 3ZSRA 5KG2A 2E6LA 2AGQA 1HQEA 2FBTA 5HP1B 2O5DA 5KT4A 2X6NA 3DMJA 4RW9A 3DRPA 3LAKA 3V4IA 2D7SA 4ZVGA 1TKXB 5KT3A 2JEJA 4WFYA 1VSFA 3DMJB 4FZXC 2IM0A 3GYNA 2FLPA 4E7JA 3OYFA 3ZSQA 3VQQA 3NAHA 1FKPA 5KG6A 4DTJA 4KTZA 2C28A 4KFBA 3LP0A 3OYNA 3I5AA 1BIUA 2D0AA 2D0CA 4DFJA 4DG1A 1HNIA 4BWJA 3U6FA 4KFBB 3ZSVA 1SKRA 2BE2A 4FJ5A 1WSEA 1BISA 3OYMA 1S1TA 3DM2B 3TANA 2HNZA 3CO9A 4DSLA 3V9XA 1UA1A 4CJWA 1QAIA 3QIDA 4LSLB 4KKOB 4K4YA 3NGZA 2UUWA 4FLVA 2G8UA 1RBTA 2YNFA 3H5XA 2EX3A 4OJRA 2ZKUA 5KGWA 2C2EA 1JLGB 1TK8A 3S9HA 3AVGA 4RW8A 3K59A 3NH0A 3MEEA 5KFYA 1WNEA 3EZ5A 3WNGA 4ZHRB 5KG5A 5KT7A 3L2QA 1LAVA 3VQ9A 2RF2B 1LW0A 2E9RX 5KFPA 4CJFA 3JYTA 2W42A 4FK2A 2CJQA 3AO1A 3LP3A 4BACA 5FRNA 1DLOB 2B4JA 3M9MB 5KFKA 4B9MA 3KLEA 3NCIA 5F8HA 4ED2A 2W9AA 5HLFA 1RDBA 4QWEA 1HNVB 1RTJA 1RTIA 1QSLA 4WYLA 2F96A 3TAMA 4CIGA 1J53A 1TL3A 1Y97A 4WYWA 4RW7A 4MK8A 4RNFA 1W25A 3UDLA 4O4RA 2DPIA 2OPRB 3LPTA 3QGHA 4DL3A 4G1QA 3G10A 3DDKA 3AVMA 1SKSA 3HHKA 4M3RA 4KI6A 1JLCA 3ALYA 1NKBA 4I9LA 4Z4IA 4NLTA 5DGBA 4FBUA 4CHZA 1RTDB 3AA4A 4CJRA 1W0HA 2YHBA 5EWFA 1TKTA 3OYHA 4IDKA 5SZTA 3KLHA 3M8SA 1U45A 1NJWA 5DG8A 1QUVA 1S9EB 1IM4A 3CJ3A 4FZZA 3KLIA 4KRFA 2WHOA 4PA1A 1UOCA 2R2RA 3OS1A 3DM2A 3CM5A 2GIQA 3KHRA 3PO4A 2JC1A 3RB3A 3KKRA 2HHSA 1YT3A 2XY7A 2J6SA 2DFEA 2XC9A 4RW6A 3OSNA 4IKFA 4PWDA 1VSLA 3LP1A 1JLGA 3TAQA 4YR2A 4DTOA 4F2SA 1N4LA 2KTQA 3AVBA 3KK1A 5KFQA 1EX4A 3EZUA 4DS4A 4LH5A 4O3OA 3PVXA 2D3ZA 3VQ5A 2VWJA 2C22A 1YVFA 3F73A 2IGIA 2UVUA 1WSFA 2HW3A 1RT5B 1RNHA 2VWKA 4IFVA 4J9PA 1S1WA 4CFDA 4HCCA 3V81A 4CEAA 1T3NA 1RT7B 4CGDA 4EBDA 1HRHA 4M3XA 2I5JA 1D8YA 1I6JA 2YNIA 4LSNB 3MEGA 1RAJA 3KK1B 4AH9A 4DU4A 2R2SA 1D9DA 4L8RB 2AQ4A 3BDPA 3NDKA 2RF2A 5KFAA 2OPSA 4I2QB 4DTNA 2OPPA 3GQCA 4MQ3A 4F8RA 4GW6A 1G15A 3EYZA 4KHMA 3EPIA 1TAUA 1S0NA 1HQUA 3CFRA 1NK5A 4TYBA 4QWDA 3QINA 4W5OA 2XHBA 2E9TA 5F9LA 3QETA 1HQUB 1Z26A 4TY9A 4LY7A 2XGQA 4CHOA 4B9VA 4KHUA 4B3OB 1L3UA 5KFFA 5HBMB 1TL1A 4IRDA 1TK5A 3B6PA 5FROA 5I42A 3T5HA 4DS5A 1NKCA 4NZ0A 1S6PB 4B9UA 3DYAB 2HB5A 3QO9B 2D3UA 4DTXA 4DSIA 3HL8A 2FC0A 1RT2A 4YR0A 1WN7A 3PW0A 1IG9A 3QGIA 4J9MA 1NHUA 4KREA 1BQNA 1TQLA 4NLDA 4B8CA 1ZETA 3QGGA 4U7CA 3MEGB 1L3TA 4K4ZA 2BRKA 1XHXA 4YNQA 2R8GA 2JEFA 3ZSXA 1RBSA 4LD0A 3KJVA 3HP9A 3PJWA 3RBDA 3S3MA 1SL2A 4DSEA 4MK9A 3DYAA 4BDZA 3LWLA 4ED8A 4N41A 1J5OA 2DY4A 1RT2B 3SQ1A 4IG3A 1QAJA 3CJ0A 2YNGA 4FS1A 4RU9A 2G8VA 2Z1GA 4TY8B 3ZCMA 4AHSA 4TLRA 3HPOA 4I2PA 4Q0BB 3TI0A 5K14B 5KFGA 3C94A 1NK9A 3KMQA 3NF6A 2BQRA 1VSEA 1YTAA 5J2MB 5JUMA 1S0OA 4FVMA 2XY5A 1JX4A 1ZBLA 2HNDA 2XGPA 3AVAA 4M3ZA 1LWFA 3PX4A 1TKDA 3MECA 5CYMA 3CIZA 5KTQA 1TKZA 2FVRA 4M3TA 3PR5B 1QE1B 1SV5A 5KFVA 5C24A 1WNSA 5HRSA 1VRTA 3VQ7A 1JLCB 4RW7B 4Z4CA 3ICLA 1IKYA 4E19A 1IH7A 3MF5A 3MR5A 1HPZA 3KHGA 1KVCA 4ICLB 2V9WA 3PX0A 4Z4FA 4XO0A 4FLZA 1XR7A 4B9LA 4JV0A 5L1LA 1C0MA 3MAQA 4DSJA 5F9NA 2OZMA 3V4IB 3NBPA 3RMCA 2PYLA 1D5AA 2KW4A 1O1WA 4E7LA 5CZ2A 1RT5A 4QWAA 3OYEA 3KLIB 1FKOB 5KFBA 1U09A 1QQCA 3C6UB 3NAIA 5HROB 5KG3A 5J2PA 4RW6B 2E4LA 1KLNA 1LW0B 2IDOA 3SNNA 4IR1A 4B9SA 1JKHB 4O0JA 4FM2A 4DQPA 3VQSA 3KLFB 1C1CB 3E01B 4J9SA 3NE6A 1WSIA 1ZBHA 3UR0A 3PO5A 2HAIA 1JLEB 4DEZA 4GVMA 1S1UA 4FLYA 4RW4B 1U04A 3QYYA 3ZT3A 1RDAA 3AVHA 3WNHA 3KIOA 5JS2A 3DRRA 1OS5A 3CVKA 2BRLA 3D45A 4FJ8A 4O3PA 4MFBA 5KFCA 3C95A 4CJPA 4RG8A 1R0AA 1J5OB 5I42B 1L3SA 1KFSA 2O4IA 2BR0A 3I5BA 3G6XA 3DLBA 1HYVA 3QLHA 4EYIB 3PR4A 2HMIA 1WSGA 4FJ9A 3LZJA 4DLGA 4J9NA 4EBCA 3C6TA 1MMLA 4ED0A 5K14A 3QERA 4FYDA 2R2UA 4OKKA 2IMWP 3I8DA 4CIFA 2YKMA 4NCGA 2WK4A 3S3OA 4Q8FA 4JS4A 4WZMA 2Y1IA 1NKEA 4W5QA 1GX6A 1QS4A 2ZE2A 3M8RA 3OS2A 1I39A 4ED1A 4FBTA 2X78A 5JXSA 3BSNA 4FW1A 4FLTA 4BDPA 4YFUA 4ECZA 3SUNA 2QV6A 4ZVHA 1HNVA 4J9OA 1BL3A 1WSJA 4Q8EA 1HARA 2G8FA 2AWZA 1A5VA 4CGHA 3DLGA 4KHYA 3BSCA 3Q8QB 3WNEA 4I7FA 2B5JB 3SUQA 4RNNA 3IG1B 2QK9A 3CM6A 3OY9A 4R8UA 4HHTA 4J9QA 4ECWA 4XPCA 2WOMB 1XR6A 1ITGA 1JLBA 1Z4UA 2C2DA 4KB1A 2HHWA 1VRUA 1C6VA 3ZSWA 3PHEA 1S0MA 1WAFA 1TV6B 4LQ9A 4CFCA 1JLQA 3O3FA 3PY8A 1HYSB 4I2QA 4Y3CA 1NK8A 2BANB 3OL6A 3HM9A 4FLXA 4NLUA 3NGYA 4R5PA 2YNGB 3OJSA 1RBVA 4OPKA 2UVVA 4BDYA 4RNMA 3NL0A 5C42B 2BQUA 3MFIA 1LW2B 1CXQA 2G8IA 3CWJA 4Y34A 1XWLA 4NLOA 1QHTA 1RT3A 1N56A 3C6UA 1RTIB 5KGXA 5KFZA 2YKNA 1A5XA 4OLBA 2FVPA 1KLMA 1U4BA 4ZPAA 1KVBA 2E9ZA 5KFJA 1T7PA 3IS9B 4FJMA 2FLNA 3HO1A 5HP1A 1X9MA 5DK5A 4PQUA 4M3WA 1JXBA 3SPYA 4K8XA 3AVLA 4GMJB 2FBYA 4CECA 4ECVA 4M94A 2EC0A 2R8JA 4ED6A 1F21A 2B6AA 2P5OA 3G86A 2R8KA 1RYSA 2UVRA 1IKYB 4O55A 3ZT0A 4Q44A 3D0PA 3FQKA 2R8HA 3AVIA 5HRNA 1D9FA 4EEYA 4J2AA 2PY5A 3TR8A 3TAGA 2HNYB 4PQUB 4FK4A 5C25B 4O3NA 4OGEA 1S6PA 4QW9A 4LQ3A 1TKZB 2KZZA 3OS0A 4FJKA 3MR2A 2IM1A 3OHAA 3TVKA 2J6TA 2ATLA 4GC6A 4LSLA 4CEZA 3KK3B 1K1QA 3KNAA 4DQRA 3VQEA 4ECUA 4LH4A 3L3UA 4IBNA 1IO2A 3ASMA 4ELUA 1SH3A 5KFHA 4DLEA 4FJGA 1C0TA 1T03B 1RDDA 3LDSA 3PW4A 3I5CA 2YKNB 3HKWA 4DF4A 5KFXA 4CHQA 3QNNA 1WAJA 3LP2A 2RPIA 2IM3A 3NBPB 1GX5A 4KO0A 4EP5A 1NK6A 4F4XA 4KSEB 4CEDA 1CSJA 4U6PA 4RNOA 4FJHA 2FVSA 5KFDA 1BQMB 3DOLB 1UWBB 1C0TB 4ZPCA 1SUQA 4BE1A 1SL1A 4CEQA 4FW2A 1TAQA 3SPZA 4ECQA 3V6DB 3PW7A 3OYBA 4K8ZA 3BGRB 2HHXA 2ASLA 4KHRA 2B43A 1RBRA 3T19A 4PUOB 1RYRA 4CJ3A 2W9BB 4CERA 1VRTB 4ZP9A 5SWMA 2WONA 3U3YA 4KI4A 4CJVA 3DLKB 4ZVEA 3I0SB 3DI6B 1HPZB 1NK7A 2FVCA 4CK3A 5KFNA 2PZSA 4FS2A 4HYKA 1C0UB 4CEBA 2G8KA 4FJ7A 2YNHA 4URSA 4CHYA 2R7YA 1ZBFA 2C2RA 2VG6B 2W9BA 3KMSA 3HPGA 4WXWA 5KFUA 1LWEA 3UQSA 4E1NA 4CF9A 4RW9B 2AX0A 4I9QA 3M9OB 1HMVB 1TL3B 3MR3A 3C6TB 3V9ZA 1U49A 3HP6A 3QEIA 3BQ2A 4KHSA 2P51A 2IJFA 5KFRA 3AO3A 3ULDA 4DTMA 4KTQA 2RKIA 4IR9A 2AU0A 4RNHA 4TN2A 5J1EB 2FVQA 3L8BA 3AVNA 4C8NA 3OYLA 4R5PB 4WFZA 4AILC 3AV9A 4QWBA 4IG0B 4M41A 5J2NA 3OYCA 2FBVA 1BGXT 2BQ3A 3V6KA 4KV8A 4KPYA 2ITGA 3SUPA 3NH2A 4RW8B 3QLHB 3KHHA 2V4QA 1TVRB 4K4XA 1S9FA 3L3VA 2WCXA 3RR7A 4HUEA 4JRPA 5KRSA 4MKBA 3H08A 3KK3A 5EDWA 1IKWB 3HK2A 1VRUB 2VG6A 1HYZA 3RMBA 3NAEA 5KG0A 4K50A 3HJFA 2IC3B 4CFAA 4ZHRA 1ZTTA 5CYQB 2GC8A 5CZ1A 4TXSA 2VA3A 4FJXA 2ASJA 3TQ1A 4FJJA 3IGNA 2QKKA 3WNFA 5FRMA 2HWHA 4IH6A 3NF8A 4Q0BA 3SI8A 2RDJA 2IJNA 3H59A 1C1CA 3E01A 4LSNA 3VQDA 5J1EA 4ZP7A 3N6NA 1NNDA 3OYGA 2AGOA 1S1WB 4FM1A 4TYAA 3DLGB 5KFLA
chains in the Genus database with same CATH superfamily
3VGTA 4ZJOA 4U7UK 3M4XA 3C15A 4HL9A 4Y2MA 4MH8A 2J6UA 5CABA 1G3OA 2IY5B 3IN5A 1YWXA 3GV8B 2XNRA 2PE8A 2YKQA 3GFZA 3SDEB 3FZFA 2RE1A 4QPTA 3I82A 3HD1A 1CULA 1JK9B 1RCHA 4W4MA 3BGRA 5AQKA 1AB8A 1NMDA 4OJHA 4QCLA 4KH4A 1E6VB 4A59A 2GO9A 4RW4A 4E0DA 1Z2LA 1Y5LB 2KHDA 4BROA 5KFOA 4CJUA 4W5RA 3DRRB 2IRUA 3IWXA 4IDHA 5EX0A 4PPDA 2YX6A 1EX8A 3BEXA 2G8HA 1YJUA 3TQEA 1ZBUA 3PUFA 3EGNA 4B3TJ 2HFUA 1H38A 1MU2B 2G2YA 1KXPA 2XYPB 2Y8WA 4HH1A 4NYZA 4JKDA 4IOCL 4LF8K 2YKPA 1T44A 2BOAA 1WHYA 3VHQA 2V8HA 2GNKA 1DZ5A 5I9EB 1HD0A 2KT3A 2KXHA 4M45A 1NNEA 5IWAF 2RSQA 3AJ2A 3VGVA 2PMWA 3W62A 3QNOA 2LXUA 3MM7B 1NK0A 1RWMB 2XYGB 4JKEA 3HSGA 4OYPA 1R8BA 1S6QB 3NGSA 3F9KA 5ETKA 2HRTA 1VBZA 5M2RA 3SSQA 3SIPB 4M8LA 5DG9A 3OTCA 2QL9B 2OKQA 4CF1A 3NGKA 3DCAA 4LR9A 2VFRA 1JIHA 2OTJN 3VOVA 1Q5YA 2YQ3A 2V69A 2LECA 4NA1A 3D4JA 2ZVSA 5DMRA 4U95A 1RHUB 2DBBA 1JCEA 2R7SA 5E5NA 5DDOC 3AA3A 5DJBA 1CJVA 4ALZA 4RPFA 1HBNA 2YNHB 4JI1J 4TLQA 5J2NB 3HM8A 1HNWJ 5AT1B 5L1KA 1SJ3P 1NGDA 4BRHA 1JLAB 3TTFA 4NI2A 1QZ5A 1HR0F 3DGPB 1LKZA 1S1VA 3SEOA 3QRRA 1OH6A 4E7HA 2Z1JA 1S0VA 1S12A 3WIVA 1F9FA 2E88A 4WE1A 2HVIA 3LA0A 3JSRA 4ZJQA 2XCAA 3JTOA 3KFWX 4DV6J 1UVNA 3PRDA 4ZCKA 1IKVA 2HHHF 2BANA 5H9FK 2FJVA 2CH6A 2WSFC 4M42A 1U25A 4OL8A 4CYUA 4IJNA 3G9CA 3EN9A 4HUGA 5BXIA 4ZPTR 1GMUA 2ZH7A 4DV3K 4JK9A 5HMWA 2BMBA 2PI5A 3UIQA 3OL7A 5L38A 1VYAA 3MUMP 1TL1B 2Z58B 2D0BA 1NWKA 2IIRA 4H0OA 1Q0NA 1FVSA 1DLOA 4H03B 1R8AA 1N88A 5DDRC 3AY0A 5GMEA 4AFFA 2RMLA 4M5HA 4LF9K 4AM7A 1MNEA 4XEIA 1X1PA 2ZZTA 3DHXA 2DNGA 1M5VC 2UXCJ 2J7UA 3RG6A 3SMZA 3DLEB 3RJMB 2V8VA 3E1YA 4NLWA 2WSEC 3C3LA 3F41A 4LFCK 2MKCA 4GO5X 2Z1HA 3RW7A 4OQJA 4YHHK 4BRKA 2VICA 2NZTA 2ZBPA 4N56A 5D3GA 3LF0A 1ASUA 3R3LA 4EO6A 2UUBF 1HKCA 1IR1A 1BXNA 3OLAA 3O3GA 3LWMA 3THWA 4A8MP 3JSMA 3SSSA 2HWTA 1N6QA 3QSYB 1S79A 3K5LA 4NL5A 1HNXK 3DRPB 3EXYA 2XRIA 3I33A 4KTWA 3NS7B 2OD4A 1A5WA 5A6WA 3R5BA 4CEEA 3GFHA 1TR0A 3O80A 3QO9A 1WC1A 3HMJG 4NRTA 4A8QA 1U1OA 4CE9A 4AQYJ 3CC7S 4DUYK 1RT6A 4PL7A 5CQGA 2C3PA 1XUPO 1OY8A 1D09B 2GVDB 3DLRA 2PFDA 4Q5VA 5AQQA 1RTDA 1FERA 1BWVA 3MN9A 2P9NA 3SAGA 3FDSA 4FJLA 3PSFA 3GYGA 2DFHA 3BM7A 3M30B 1D0EA 2MLZA 3KNGA 3VGKA 1DARA 1WG5A 4CJTA 3P4IA 1D8ZA 4RUAA 1CC7A 3T1YJ 1FKAF 3ISZA 3J81O 2HF4A 3MMCB 4G1PA 4K25A 3VAMA 2NLXA 2H54B 1PGZA 1WG1A 4FXDA 2OP5A 4URGA 4DPYA 3I96A 2QWLA 1N5YB 4DXLA 4USUA 5HSPA 4ID8A 1TYQB 3K58A 4B9QA 2IVNA 2CIMA 3O9SA 4C98A 1ZXOA 4AD6A 3M8WA 3CXCR 2ZD1A 2MZQA 4QOTA 3TEHB 2VV5A 5GAGP 2JLEA 2W8LA 1UEKA 4NXMJ 5U47A 2ZQBA 3O1BA 4H54A 3ITHB 1P27B 1T05A 2FUG9 4RWTA 1Z6RA 1C1AA 4ZCIA 3GG0A 4DR4J 2BW7A 2D69A 4C8YA 3Q86A 2BTFA 3T5JA 4QW8A 3L4IA 3MM6B 4PUOA 4YORA 5CCLA 4ZPDA 5E2QA 4QWCA 2KI2A 3T3FA 3GV5B 4K0KJ 1JLFB 3CMEN 3TUPA 3KKSA 3RR8A 4UOCA 5BYQA 5GADU 3NHGA 2LA6A 4BE2A 2OGUA 2GGPB 4FVCA 4R79A 4BC3A 3JQKA 4NCGB 3B78A 1RP5A 2XEXA 1ATSA 2HIQA 2M9KA 1IBKJ 1RGVA 3CCUN 2DNHA 2GMJA 3SCKE 5H1SQ 1EETA 4O4GB 4RLEA 2FJAB 4M5DA 4FDFA 2XO6A 3MEDB 2YHAA 3FE1A 3A5MC 3T7ZA 4TSXA 2G13A 3BKFA 4XH5A 1B64A 2JEGA 1SKUB 4L73A 3HVWA 2HK3A 1KVAA 4O44B 4M3UA 3L7PA 4F67A 1JJ4A 2CDQA 4B1YB 2J9CA 3OR2A 4OLAA 3BF4A 2NYHA 4QYZK 4KV8B 2QTDA 3DXKB 2GZOA 3IR7B 5LSOA 5C12A 1GLAG 4ID1A 3PW5A 3Q8PB 5J2PB 4MFBB 3OT9A 5HI7A 3SBGA 2XMMA 4DWIA 2DH7A 1W9HA 2BE2B 2UVWA 1QM9A 4CP5A 2A18A 3CT9A 3OPKA 4KGKA 2P9KB 1K8AT 3V6HA 3AA5X 3HZ6A 3PZPA 4E1MA 3R2DJ 2EI5A 3RTVA 1R27B 1WHWA 2JLFA 5AFUA 4ZS6A 3WBZA 4J2BA 2Y1JA 5BRFA 4PKIA 3QJLA 1LCUA 2AZ1A 1FNMA 5KPTA 1NDKA 3K0SA 4DV7J 2P9LA 3PCOB 2DRDA 1DTTA 4FCYA 1F2HA 2W7PA 3SXLA 4CESA 3L95X 4XAKA 2GCFA 1XIQA 2PI4A 1S49A 3P5JA 3DXSX 4DR1F 1UVKA 5KG7A 4FLUA 1Q81O 2IYGA 1A0OB 3AFGA 4GRSA 3TA2A 1V3RA 3VEOA 3UW1A 4JV5F 1P8ZA 2NUBA 5AQHA 3BJYA 1JLAA 1VQ6N 3P8BB 2NQPA 4UT4A 2JSXA 4DTSA 1XNQK 4B3TF 2DHGA 4OX8A 4G3IA 4ITSA 5CYJA 1N54B 4WK1A 4NLSA 5CHCB 4KC5A 4CF2A 3QIPB 2RHKA 2FY1A 4NLRA 1OQ3A 3UKUA 5LMUJ 5FDLA 4KGZB 2CNKB 4BRGA 2P2CB 1BA1A 1B7FA 4LUBA 3DXBA 2BGGA 4QR0A 3I31A 1XR5A 2IMOA 3V1QA 2X51A 1QVGM 4BRLA 1S4FA 3JXOA 5ELZA 3BSAA 1V6HA 3J7YU 2E5LK 2J9DA 3RRGA 5B0DA 3TABA 1DTQA 4DV0F 1VFJA 5AQZA 4PWDB 3UCUP 3CFPA 1BWEA 4X64J 2QXFA 1ZM3A 4YMEA 3GYXB 4A8YA 1TL4A 3UNGC 2VU5A 4TU8A 1S10A 5F8IA 2B9YA 2KM8B 2OTLS 1NGBA 1NPPA 3UDCA 3J8AA 4B3RK 3GIIA 1RHKB 3BZKA 1RHQB 2KL8A 1K73T 4CLKA 2FHJA 3QIPA 2E7VA 4CGGA 1KHWA 3EMTA 3UCGA 9ATCB 4URQU 2MQLA 1HNWF 4WU2A 4OI6A 4BRNA 3NRBA 2B7CB 3M8PA 1MLAA 1IXKA 2A1SA 4F4YA 4E89A 5BR8J 3HX9A 5FDLB 3KOAA 3HVTB 3MXMA 4UTGA 2RS2A 3HPHA 2DPJA 2GFFA 3M8YA 4DR3F 4AM6A 1R0AB 2HWIA 4KE5A 4EZ6A 2OA8A 4G1QB 1EAYC 4MIBA 3BQ1A 4BBYA 1TK0A 4B1ZA 3CCLN 3CDUA 2AEJA 1Q9XA 2B4PA 4CZFA 1XMQF 3NH1A 4KBIA 4A8SA 3L2WA 2J5AA 4OYBA 1HQEB 5ETTA 4TQRA 2PIIA 3E51A 2YXLA 3H40A 2GBZA 3L09A 5E3PA 3DXMA 3LZIA 4USJC 3HVAA 1N33K 4JI8F 3MX2A 2FJWA 3GR0A 4Q43A 4Y65A 3TAEA 2GO8A 2E2QA 4C0HA 3BF1A 4CO4A 4HTUA 2YPYA 3CMES 2JEIA 1F60B 3RBEA 1L3KA 3O6WA 4ECRA 2MSTA 1T8EA 1MN7A 2KFZA 4KYZA 3TSUA 3KUEA 1RTHB 4AE5A 4YR3A 3CJ1A 3GFYA 5L9XA 1EP4B 4YB6A 4Q7AA 2XM3A 1HL6A 1QTMA 3O4QA 2HG4A 1ILYA 1RAFB 1KQFB 2AJ0A 5EHHA 1Q7YT 2DK2A 2MQNA 1CZBA 1PC5A 4FPBA 4IFEA 2OPQA 3AXKA 1PYTA 2NXNA 4UY85 3EPGA 2A1RA 1BI4B 2WBMA 3HFZB 2QE5A 3TA0A 6FDRA 2OPSB 2ALZA 3N4WA 2HLTA 4P71A 3AVFA 5T7LB 2AGQA 4USIA 2FBTA 5HP1B 3ADAC 4ISGA 2P9IA 1YZ6A 3G96A 3VAJA 3R8YA 3I56S 1TKXB 2IM0A 3GYNA 4E7JA 1ZOTA 1NJIT 3K0JA 3VQQA 1FKPA 2AYMA 4DTJA 4DR7F 4KTZA 2C28A 3LP0A 3OYNA 3JB9k 2W2MP 2GWKA 4BWJA 4BC2A 1QDUB 4CWBA 2P8IA 3BGUA 1WSEA 3OYMA 3DM2B 1H74A 2HNZA 3MN5A 4DSLA 3GCXP 2GHVC 4CJWA 3A4TA 1QAIA 4LSLB 3HOTA 1Y11A 2G8UA 2ZBIA 5EOYA 2ZKUA 4OHYA 1LFPA 1VQKN 4UUWA 3IP0A 2QX0A 1B0TA 1TK8A 3PACA 2HBRB 4RW8A 1TFYA 3ENBA 3NH0A 2Z8QA 3MD3A 5KFYA 1WNEA 4WBFA 3BN4A 4A8KA 1OPIA 2KB2A 2F9DA 3L2QA 4WYBA 1LAVA 2CXEA 2RF2B 4CZMA 2P9CA 2JZ5A 1VC0A 1HWUA 3BYPA 4U7UD 3AO1A 3LP3A 4WPAA 2COLA 2JFKA 4I6AA 2D3OR 5FPNA 5IS2A 3NCIA 5F8HA 2W9AA 5HLFA 3W5YA 3CGIA 2M4MA 4QWEA 3U1NA 2KT2A 1YQHA 1RTIA 4C4WA 4H4KA 2DGOA 1FJCA 5K8OA 4M5NA 3SCLE 1W25A 1EO1A 4QU7A 4OYZA 2OPRB 2EFNA 3DNCA 1BU6O 4G1QA 4DR6J 4H5TA 3DDKA 3HHKA 3R6MA 3N0VA 5AQOA 2NSCA 1JLCA 3ALYA 1NKBA 5ADXH 5A8WA 4Z4IA 4NLTA 2C3MA 2ATCB 2QMUB 3AA4A 2WFBA 2FY8A 3PLAA 3AH6A 3OYHA 4AYBD 9RUBA 1IM4A 2QA1A 1PC4A 4JI6K 4FZZA 3KLIA 4PA1A 3J7AN 3LGNA 3KJQB 4BLGA 4WIIA 2GIQA 3MN7A 3CC2S 2HHSA 3RB3A 3KKRA 1FRKA 2L08A 4P75A 3OSNA 4G9ZA 3ZZ0A 4PWDA 2ZM6F 1IBMF 1B4SA 3ZYYX 3HHDA 5MLCQ 2KTQA 4RL1A 7FDRA 2QRRA 5HN0A 5KFQA 4USTA 4DS4A 5AQJA 1NMEB 4PCQA 4LH5A 2GX8A 2NR0A 1UFWA 4LBPA 2ZH8A 2D3ZA 3MPDA 2G1HA 4ZPVR 1HNZF 2QFIA 3M2RB 4H0VB 1S1WA 3B54A 1T3NA 4CGDA 1NB2A 1KD1T 1HRHA 2HFVA 4NI2B 3J7A1 2YNIA 3HZEA 2A3ZA 4JOUA 4MIWA 4J37A 4BG8A 4YY3K 1D9DA 2JX2A 2OPSA 2DCLA 2CQPA 2OPPA 3H2UB 1FXDA 1WB9A 2DO0A 3E9LA 4FOEA 3EYZA 3EPIA 1TAUA 3FRYA 1TL5A 1S0NA 4FF2A 2J0WA 2J7WA 3DLJA 1RWNB 4QWDA 3QINA 2E9TA 1IQZA 2ZDOA 4F0HA 2ABYA 3IR5B 3MX5A 4LY7A 3J7YP 1TL1A 5FROA 2KKZA 4X62J 4DS5A 3DN9A 1S6PB 4DV7F 3HL8A 2FC0A 1TELA 1IG9A 3QGIA 1Q1KA 3IDHA 4B3MF 4KREA 1ZETA 2M8DB 2HEKA 4CTAB 3EZOA 2AV5A 2OJ3A 1XHXA 2ZGZA 3AY9A 4YNQA 2CJ9A 4WIQA 2JEFA 3ZSXA 4BRAA 2PGCA 3BB5A 3HP9A 3Q0AA 4JV5J 3ZX2A 2HURA 4DV4K 2LXIA 2YHXA 2DY4A 3TOQA 3THYB 1HBOA 1ZZFA 2GW8A 3DJCA 3FBBA 4YOWA 1WI6A 4FS1A 4CBUA 2G8VA 2Z1GA 4ETXA 3K8VA 2F4VJ 2FF6A 2QSWA 1XN9A 5IV3A 3ZCMA 2CNOB 4AHSA 4L76A 4UY8T 4TLRA 1Q81T 3TI0A 3KMQA 2QWOA 3NF6A 2YWWA 3Q2SC 1NLVA 1VSEA 5GMKa 3WIUA 4GKJK 4FVMA 4ZK7M 1PJ6A 1WUAA 3PX4A 1H2TZ 5CYMA 4LF1A 1XQIA 3PR5B 2C3YA 4OYMA 2VJVA 4W90B 2NUUG 2DITA 3VQ7A 5A0YB 1K0TA 1GXLA 4UW2A 3ICLA 1IKYA 4DV0J 4E2FB 2VPYB 3LGHA 4M1KA 2V9WA 3PX0A 2GHWA 1RJJA 3ZTOA 2Q0RA 4LRFA 4FLZA 4B9LA 1YLXA 1RK8A 3IUCA 4JI2J 1U8WA 2VHGA 5L1LA 3FMBA 1C0MA 3MAQA 2IIHA 3HHLD 3RGIA 3V4IB 2CFXA 2PYLA 1U8SA 1IJJA 1D5AA 2KW4A 5CZ2A 1RT5A 1H98A 4QWAA 3U27A 3KLIB 4YB1P 1FKOB 5KFBA 1R59O 2J8SA 1QQCA 4ZJLA 3C6UB 4BGBA 2MZ1A 3TA1A 3DAWA 1LW0B 5GIPA 4I6YA 4B9SA 4DQPA 4MO5A 3VQSA 3KLFB 1C1CB 3C14B 3U9ZA 3Q7CA 3UR0A 1YXQA 3W63A 1FFSB 2HAIA 4DEZA 5BR8F 2P9KA 3QYYA 1ZA2B 3ZT3A 2M5YA 5JS2A 1KONA 3DRRA 2AZ3A 3BBCA 4X66J 1Z1ZA 1OVQA 3R5AA 4GKJJ 2IBOA 1JMTA 4MFBA 2DIVA 3C95A 2V2VA 1FW6A 1J5OB 2HS4A 4YHHF 3MDQA 2BR0A 4FPIA 2R7VA 3K9KA 1HYVA 1WC6A 2FHOB 1XMQJ 4EYIB 4BHQA 4DR2F 2Q6BA 3LZJA 4WTYA 2UUBK 3B4MA 2K2PA 1JNZB 2VYPA 1LWXA 2R2UA 2Q2RA 1AW0A 2IMWP 5LJ5Y 4JI8J 2YKMA 2XULA 2WBNA 3Q8VA 3CJSA 1Y10A 3DU5A 4NE9C 4W5QA 3VVTA 2QZ8A 2ZE2A 2WVFA 2LCWA 3T1HF 4FLTA 4NMXA 2N4DA 2PFFB 4JKCA 2JLGA 4CT8A 2Z2YB 1QQOA 3UKRA 5A8RA 3BSCA 3DGVA 4DV5K 1VCTA 4WFNL 4KGXB 2R7XA 3A8YA 3CM6A 4JAXA 3TYTA 2CADA 2E1PA 4ECWA 2WOMB 1ITGA 1P1LA 2V63A 1GLLO 2DR6A 3JTPA 2A6OA 4EK2A 1RWXB 4CZIA 1IN0A 3EGVA 2E1ZA 2UP1A 1C6VA 2LA4A 3ZSWA 3PHEA 1S0MA 3CQYA 1CJTA 3GJRB 4LQ9A 4CFCA 2D3O1 3PY8A 5LMNK 3EE8A 3PXGa 1SC1B 4NLUA 4DZDA 3K9JA 3I4HX 1U2FA 3AQPA 2OD6A 3KKFA 4O5FA 3OJSA 1RBVA 2UYTA 2R7QA 4RNMA 4DR7J 1G4CA 2BQUA 2V51B 2HLUA 1YBUA 1M5OC 3OTOF 5E7OB 4DKWA 2BJDA 1RTIB 5KFZA 1SVDA 3MD1A 4A5BA 1T9VA 1U4BA 4ZPAA 2E9ZA 5HVGA 4WF9Q 4Y2IA 2FLNA 3T1YK 3HO1A 5HP1A 3MURP 1X9MA 5DK5A 1FRMA 2C1EB 3SPYA 4YOYA 3AVLA 4GMJB 1PBAA 2RQKA 2EC0A 3QBXA 2MQ8A 3VGMA 5JVGL 3G86A 4V19X 1VISA 3LPEA 4O55A 3SQGB 4E98A 3D0PA 1IQTA 3OD2A 1D9FA 2VBZA 1FX4A 4JKBA 4J2AA 2PY5A 4C48A 2U1AA 2ADCA 4PZVA 4PQUB 4FK4A 4OGEA 1TKZB 5AQIA 2KZZA 3OS0A 2DGQA 2IM1A 2J6TA 3THPA 3BZCA 4LSLA 1NSKL 2GMLA 3FZMA 3ID6A 1YJNN 2R9LA 1X3MA 2BJ9A 3OFGA 1WOOA 1ROFA 4ECUA 3FNNA 2V8PA 5LL6d 2AW0A 4C0BA 1SH3A 2QT7A 3FZLA 4WF9L 3QFHA 3I5CA 1EZZB 3D66A 3W1YC 2YKNB 4HEA9 2LQ8A 3X3UA 5KFXA 4DR6F 3R1HA 1KQGB 3IM9A 1WAJA 2IFXA 5J1NA 2W2PP 3C0BA 3LDPA 1NK6A 4X65K 4RNOA 5AXKA 2YKOA 1JXVA 2FVSA 5KFDA 1BQMB 3DOLB 1VQON 4USKA 4ZPCA 3J80U 3G25A 1X4EA 4JKFA 2QWMA 1X5SA 1TAQA 4FW2A 4YY3J 2ZNYA 2Y1LB 4FYWB 3V6DB 3PW7A 2F65A 1BY9A 2HHXA 2A6AA 2ZBQA 1RYRA 4CERA 4RTFD 5ADZA 3Q2TC 3ZXWA 1ZA1B 2QA4N 4ZVEA 1F5BA 2BE9B 3DI6B 2VH7A 3EVWA 1HPZB 4JI5F 1YTYA 4CQ1A 1IBMJ 4FS2A 1Q5VA 2MSSA 5E84A 2J9DE 4CM2A 4CEBA 1U2VA 3OXGA 2ZJPL 1VLYA 3F5TA 3VVUA 2DNOA 2GEMA 2BE7D 1U1NA 4JD2B 4FWNA 4PKDB 2C2RA 1ZBFA 4EHTA 2VGMA 3MK6A 5JLFA 3HTVA 4WXWA 3UQSA 2HAFA 4I9QA 4P2XA 3M9OB 1N34F 2VPWB 4DV1K 3U8XA 5B7WA 2H3EB 1U49A 3MGJA 3IFRA 3AO3A 4RWXA 2VB6A 2RKIA 1H7WA 5D78A 4ISEA 4OX9K 4YOUA 4RNHA 4TN2A 2DXFA 2O8DB 5F2RA 1W7WA 4C8NA 1X4BA 1HBNB 3AV9A 4DV4J 2MTLA 4M41A 3OYCA 1NH7A 2FBVA 4B3TK 1I3OB 4KPYA 1EQYA 2KRRA 3VEXA 3MMAB 3QLHB 2V4QA 1TVRB 4FWSA 1S9FA 3CO0P 1O5JA 3CJBA 1PG5B 5CZXA 4MKBA 2OAUA 2VG6A 2IJRA 1YJ7A 3WX8A 2ROPA 4JNEA 3GJSB 1RB0A 2IC3B 5CYQB 2MZRA 5BN9A 2IA0A 3MMAA 2RU3A 2X1AA 4TXSA 5CZ1A 2MDAA 4FJXA 4WP9A 5DDPC 3ET6B 2QKKA 2GV1A 2JHEA 5KQ8A 3CMAS 1NGEA 3D3BJ 1C1CA 3C14A 4P7TA 2EG1A 4ZP7A 1QD1A 4LF8J 4PABA 2G9OA 1M1GA 1A7GE 4TYAA 5KFLA 1RT3B 4NYOA 1X9WA 3V6JA 4PY5A 1RDRA 3VQBA 4CHNA 3HVRA 1C4CA 2Y8YA 4TQSA 2F4VF 1U26A 4WE1B 1FT8A 1J54A 4AHTA 5HRRA 4OVLA 2EG2A 2F8SA 2AIRB 3H5SA 4OGCA 3NVMA 3CD5A 2ASDA 3MR7A 3U1MA 2HHQA 2V67A 2CAJA 3R5DA 3RMDA 3MAAB 5HBMA 4O0IA 5AQPA 3HSTB 2RRNA 3NCPA 2CNLB 2QC3A 1K1SA 3AQOA 1Y0HA 2MZJA 3SCIE 1C1BB 2BUNA 2H4WB 1B92A 2HNYA 2EWHA 1J5EK 2LEAA 1WEYA 3SAFA 2HFZA 2ZH5A 4OMFG 2ZFHA 3VERA 3OVSA 2EFOA 5M1FA 1W97L 3DOKA 3FGUA 2VG7B 4JI2F 3K5PA 5HQ8A 1RQ0A 3SQ4A 4MJKA 4ZDNA 5KFIA 1JJHA 2HVHA 3M32A 1S9EA 2P5GA 1EKSA 1LK7A 1DTTB 3BQ0A 3CJRA 1IKXB 3WEEA 2YNIB 2JL9A 3TARA 5KT5A 2E1CA 4YDXA 1Z25A 3D7EO 2HVEA 2W25A 2YTCA 1XMOJ 3R1LA 1RAGB 3ZX3A 3CB4A 1AZSB 1ASWA 3MM5B 1I3AA 3H20A 1WDTA 4YHHJ 4GO7X 1RT1B 2HGLA 4N47A 1AFIA 3KLGB 1YVUA 3LGMA 2EW9A 2E1RA 4YOXA 4FVUA 3BR9A 2HNDB 1DJ0A 5I3UA 2DGUA 2IRXA 3LL3A 1I94F 1KN6A 4WFAQ 2Y0BB 2XMAA 5E41A 2BA9A 1IM6A 1PYOB 3A3PB 4DI6A 4JP8A 1IBLK 3UI3A 2P9PA 3VEYA 4WQ5A 1U6ZA 2QTWA 4NCBA 3AB4B 3ID8A 2RN2A 1UWBA 4LR8A 1WORA 1TP7A 2PD1A 4Y0FA 2QXLA 4JI3K 3UDEA 3K5OA 2SXLA 2X1FA 3DI6A 4DPWA 2I8EA 3T1HJ 3SFGA 4QBUA 2LQ9A 2OUGA 3PW2A 3OYJA 2CQGA 2ILZA 3N9UC 3D0GE 1VHIA 1DEJA 4BE0A 4FYVB 1WI8A 4C8KA 3PX6A 4ZLNA 2P9UB 4JKAA 1B0PA 1ICEB 4MKVA 1UEVA 2EVZA 1VIXA 3PV8A 2YQ1A 1JXLA 1S6OA 4FWQA 2MQQA 1N5QA 2HF3A 4IOCQ 3FRZA 4XIUA 1SKWA 1KC8O 4DUZJ 2FXUA 5C42A 1P9QC 4IKAA 3DRSA 1VSIA 1DHMA 4CJLA 2OEKA 1VSHA 3AVCA 1N36K 2O8CB 3C19A 4BQZA 2V4JB 4B3SJ 1XK8A 2W2QP 3U02A 2ZH4A 3DDNA 1RBLA 4HR2A 4DHVA 3S8SA 3L2RA 4IDKB 5AQTA 4FPAA 4YEAA 3SCXA 1GLBG 2UU9F 2DY1A 2F7TA 3UN3A 4IO9L 1T9TA 4CLUA 2I5JB 4ID5B 1M1HA 2FSKA 4FF4A 4M95A 1FWKA 1KFDA 3CJ4A 1NOZA 4FP9A 4YS2A 4ZVQB 4EO8A 5FLXY 1FKPB 4HCBA 4B17A 4OPAA 1YBTA 2E1YA 2N4CA 1J9AA 1HBUA 3C46A 3CMQA 3D2FB 4HTJA 2H5IB 3FBEA 3GV7B 1N6QB 2DIUA 4K4VA 5K20B 5E3RA 4I6MB 1GMVA 3C16A 1RSCA 1IKXA 3C7NB 2K8GA 2QYGA 3R7SB 4X4QA 4MK7A 3M05A 4E3SA 3LOUA 3AA2A 2YH0A 3BSOA 2KFYA 1TYQA 7FD1A 4BWMA 2P9PB 4AHRA 1Y3KA 4PXDA 5A2QO 1GOCA 3QAUA 2OIHA 3A3NB 2C2MB 3MECB 3GU0A 1UA0A 4G65A 4OKEA 1NPKA 3PYDA 2P9GA 2E6MA 3VQTA 1Q8KA 2HK2A 3VQCA 2DNKA 2GUIA 3KG4A 2CGKA 1P6TA 1BI4A 2AYGA 1QQMA 3O3LA 1S1XA 5F8NA 3L2VA 4YQWA 1HKGA 5K8NA 4BR5A 3ZTQA 2DR7A 4DFKA 1N5TA 4ELVA 1YJ9N 4CO0A 3POTA 2OTJS 1CQMA 5FPDA 3U4LA 3N5FA 5ETNA 4LMZA 3V9UA 3IRXB 4L3QA 4QS9A 1LWCB 4X4NA 2OFGX 4IZ9A 1CLFA 4IG0A 2DNPA 4Y2CA 5K8MA 1E3MA 2Q3PA 4MTPA 2XQCA 1HD1A 1NLKL 1K8KA 3T9NA 3P96A 1U2RA 4HWIA 2DJWA 4UZBA 4YY3F 4H5NA 4S0MA 2D1CA 3R5CA 3FSXA 1QSSA 1YVNA 4FJNA 2APOA 1XBWA 5KG4A 4EHUA 3QT7A 1IBKK 2ZWHA 3ZTPA 5K5MA 3WQPA 5IC6B 4JI5J 3BO3A 1ZC6A 1Y4ZB 3PEJA 2ZHOA 1IR0A 5F8JA 4IQXA 1I5OB 2O1PA 1EKEA 3QEVA 4EMDA 4C8LA 4NA3A 1BHLA 2HQIA 3HHEA 1RWOB 1XHZA 4A47A 2L48A 2XS2A 2AYEA 4ZA1A 3G6ES 1S97A 1S6QA 1MDUB 1S5ZA 4JI0K 5E3QA 2M0GB 1NHVA 4NYFA 4Q2MA 4LFAK 2DGTA 3IBWA 4FKYA 3D6TB 4CCHA 3OYDA 1Q18A 2ZBRA 1RTHA 3PDNA 4R0EA 3HSDA 1GAOA 4CJ7A 5CAAA 3NKYA 3O5TB 1HR0K 3TAPA 3O4NA 4I56A 4GKKK 4DV4F 2M2BA 4FLWA 3OYKA 4ECYA 5ETLA 2G0JA 2HKEA 1FRHA 1GLEG 5C2DA 4NLXA 1NSPA 3Q8RB 2F8TA 2RDDA 2R8IA 5HQMA 4OKJA 3D68A 1K44A 2X3GA 2X7IA 1BOTO 4WFAL 1O51A 4OZ1A 4CJSA 1YJTA 4DQQA 1ZAWA 2N7YA 3MHYA 1FI4A 3O9QA 4J2DA 1VRQC 3DOKB 4O5BA 3H1VX 3R6GB 3S01A 4ZMMA 4EU0A 1DT9A 3TR5A 1S1VB 4I2PB 4E7IA 3TUJC 3QRQA 4LF9F 3W2WB 4M5DB 2ZWOA 4KHWA 4Z2XA 3QESA 3ZZOA 5KT6A 2HBKA 4Q45A 1Z05A 1G99A 4ZLPA 2G1DA 3N6MA 3VALA 4F3OA 1SH0A 3KJFB 3W8GA 1U48A 1RTJB 3K8WA 2CRLA 2GVZA 3US5A 4CO3A 2XO7A 5BPLA 1DURA 4QOZB 2ZH1A 5AFUH 3E9OA 3TZWA 3M6GA 4RZRA 5GADP 3LO3A 4DV6F 2YI1A 3J81U 3M3ZA 2JNJA 5AE1A 3MTKA 4XDCA 4X4UA 2KFNA 2DD8S 3SMSA 4ZITA 1RBUA 3AAQA 2W7OA 3HFKA 2AJQA 1B9DA 4X4VA 1VC5A 4NXNJ 1QE1A 1UPPA 1P8GA 3CFOA 5EUHA 3KWIA 3VV2B 1V4TA 2IC3A 1S1XB 4MKAA 1V3SA 3PJ9A 5CYQA 3OBIA 3R9PA 4P74A 3GSDA 4RX6A 4OZ5A 2UXCF 5GAEU 2V7YA 1HLWA 2C2OB 1CULB 3P4UB 2OTLN 1UPMB 2A0FB 3GCWP 4HKQA 3MEEB 2W9CA 4KPCA 4FL9A 3H3OB 3QZ8A 3GLJA 2EBEA 4HVJA 2X6SA 4KHQA 1REVB 2C2NA 4PEOA 3H2VE 2NRXA 3R9LA 1OPZA 4KKOA 3KG1A 2MHEA 1AXQA 4DTRA 1Y9OA 5KT2A 4X4RA 4HUFA 5HJXA 3ZT2A 1T03A 1AROP 5G0RA 3W64A 1N33J 1FXLA 1WLJA 1BIZA 2RJZA 4B08A 4OYWA 3CJ5A 2XI2A 2MXYA 5BPMA 3BREA 1I94J 3SBTA 4UY8O 3QQCD 4PYDA 2FLOA 4JKGA 1KAYA 3J80Y 5DM6Q 2GHPA 3OTEA 1QAYA 1PJ7A 1OYDA 4AQYF 4LRDA 1YUWA 4IFYA 1VDHA 3PKYA 4DX6A 2B3TB 2VA2A 4BQLA 1U47A 4NLGA 2EFVA 1LWCA 3H46O 3KTQA 2GTDA 3TWZA 3I0RA 3Q23A 1VSJA 2AMCB 1SUQB 5KFSA 4LSZB 3TU5A 4JI7K 4Z4EA 1JKHA 1NJZA 5L1IA 3GL1A 1VIOA 2NXCA 5EWEA 3T1YF 1PILA 5BR9A 4F4KA 3G4SN 1FJGF 1FDNA 4PPZA 2R7UA 1R8HA 3MMBB 3UPFA 3D28A 1OIAA 4WWSA 1ZBIA 5KRTA 3DHWC 3R5GA 2P9IB 4KGVB 1K9MO 2VPZB 4DTUA 4FN5A 3GDQA 4DL6A 1EP4A 4ILGB 1XI1A 3MM9B 1M90T 1HMVA 3C16B 3J7Z5 4DSFA 1SC6A 1RT1A 1KAZA 3CCUS 1FK9B 5C24B 1L5UA 4DSKA 4CM0A 2HZVA 3OR1B 2A2DA 4J9KA 3AXMA 2XLJA 2ALYB 4JKGB 1FK9A 5DRKA 1H1VA 2X3DA 4FO0A 5KI6A 3QT6A 4DR4F 1FXXA 4ILLA 3S3NA 3PJXA 4NLPA 3SSRA 3TAMB 4DFPA 4NWBA 4NLVA 4YOTA 3ZSRA 3UNYA 2E6LA 2K7JA 3AD8C 1HQEA 4XK8C 4MDBA 2QJ3A 2X6NA 2VDIA 3V4IA 2FIUA 3KDNA 1VSFA 2J9EA 3M1VA 2VOPA 2RH3A 3CF5L 4NOHA 2MKKA 5K8PA 3OTBA 3NAHA 3ZFVA 4V19J 3KVGA 1Q86T 3SK3A 3TX0A 3K17A 2VODA 2JJ4D 1HNIA 1BMQB 3U6FA 3ZSVA 3WC0A 1SKRA 3THWB 1BISA 3BUZB 1ZZNA 1UA1A 2WAQD 2HBJA 3TX8A 2UXBK 1UZDA 4KKOB 4QIWD 2VBXA 2UUWA 1WSVA 4DR1K 2CG4A 4FLVA 4GVBA 1RBTA 4BRQA 2YNFA 3H5XA 2EX3A 4JI4K 5A2QY 5KGWA 2C2EA 2DXDA 2V68A 4GV6A 1KOOA 2QWPA 1TUGB 1GLJO 2FD2A 3GG4A 3MEEA 4DHYA 3EZ5A 1YBAA 2AP1A 1XNQF 5AXMA 3WNGA 4ZHRB 3GB0A 3VF0B 2KLAA 3CF5Q 1NMNA 3ZEUB 3VQ9A 1F3FA 3U1LA 4IQMA 3JYTA 3D7SB 4OI0A 3PKMA 5LMUK 2U2FA 2UUCF 4BACA 4CT9A 1DLOB 5IQQA 4DR5K 5KFKA 3IKMA 3UE2A 4FF3A 3SLCA 2UV8A 4ED2A 1RDBA 2DT9A 4H0XB 4PAAA 1RTJA 3ENQA 2F96A 4YDDB 4WYWA 4MK8A 3WEEB 3W9JA 3BKUA 4LF5F 1SC4B 1SKSA 4QIVA 1O6XA 1UVJA 2BJEA 5M1QA 1LXNA 4I9LA 3OA9A 5DGBA 2QWRA 4CHZA 2LEPA 1UJ6A 1CJUA 3VENA 3I32A 4CLPA 1T0TV 5EWFA 1TKTA 4CO5A 1OKJA 2FHMA 2IVFB 2MKHA 1NJWA 4UOFA 1BLUA 1S9EB 3RZAA 2IDEA 2BJ7A 4BRPA 5I3QA 3HSCA 2J0SD 3VWSA 2B4VA 4QIFA 1U7LA 2V5HG 5AXLA 3KHRA 2I9SA 4NEYA 2JC1A 4K2XA 1HI0P 2Q1NA 2MKIA 3VAHA 3JS9A 2B9EA 2K3IA 4QIEA 2NCKL 5D4OA 5D0EA 2VF3A 2YWHA 4LREA 3ULHA 5HJYA 4KH5A 1VSLA 2HYIB 3LP1A 5EVZA 4DR3K 4OPHA 1JLGA 4YR2A 1Q8BA 4F2SA 1GQEA 2J0XA 2F4VK 3TP2A 3FEYB 4FZVA 1YRUA 3NCQA 5KOXA 4ZLJA 4OZNA 3FZBA 1VQ9N 1PYSB 3PVXA 2YJEA 4JHDB 2PBDA 1PO6A 1YVFA 3F73A 4DDFA 4CZHA 2CQ4A 1RT5B 3MPWA 1ZAVA 2YH1A 4J9PA 4CFDA 2XMWA 4CEAA 1RT7B 2PT0A 1YAGA 4M3XA 2I0XA 4X64F 2QA2A 3W61A 5AE2A 3H1QA 3GJTB 1FJEB 4W92B 1SQGA 2OANA 5M1NA 4QQBA 4F0MA 1M5PC 4AH9A 4BC4A 4DU4A 2R2SA 1K0VA 4JD2A 4L8RB 2I38A 2AQ4A 1J5EJ 3NDKA 5KAKA 4I2QB 4LF9J 4DTNA 1K8AO 4F8RA 2FJDB 3RSEA 4J90A 1CJKA 3PIPL 1TMMA 4Z7YA 1BA0A 1HQUA 2EFQA 3TRGA 1CJKB 2XMJA 2FJEB 4IO8A 1DQ8A 4ZLLA 4ISFA 2HGNA 2M7SA 1Z26A 5AE3A 1W7AA 4QJVA 2XGQA 4CHOA 1VQKS 3MMVA 4CO2A 4KHUA 4B3OB 1TK5A 3B6PA 4DR3J 1EWRA 3T5HA 2QL7B 3CCEN 3DYAB 8ATCB 2HB5A 4ILMA 4DSIA 4DTXA 4LF2A 1NU4A 3CTRA 3OW2M 1WN7A 4J9MA 4B8CA 3VZHA 3QGGA 4U7CA 2QMXA 2R8GA 1RBSA 1HBUB 2LXFA 3IWLA 2GWJA 2DR5A 4LD0A 3KJVA 4NXNF 3S3MA 4BDZA 3LWLA 1HUXA 4HI2A 3SQ1A 1VBXA 1AUDA 5IT0A 4OYXA 3CJ0A 4JYAJ 4TY8B 3HDSA 4EFHA 2FZCB 3CPWR 3JQJA 3B8AX 5K14B 3ETOA 2CQDA 4CH1A 2VPXB 1S0OA 2V94A 3POTB 4ES1A 1ZBLA 2IVMA 5CD4A 2CQHA 3NGUA 4ZKAA 5KTQA 1RXOB 2FVRA 3CULA 2I6WA 1X4GA 4BRDA 5M1KA 4YOEA 5HRSA 1UJ4A 3EUNA 3W5XA 2HSTA 4YN3B 2DNQA 4Z4CA 3IMQJ 4E19A 1HPZA 3KHGA 3E9PA 4ICLB 4Z4FA 1CS4A 1WC3A 1Q79A 2DVIA 1H73A 4F02A 4K43A 2NRTA 2FGOA 2F40A 1WKKA 2YHWA 5F9NA 3RBXA 1TMJA 3MN6A 2PEBA 5LOQA 3VR1A 3RRKA 1G6BA 3VESA 4NASA 5C2FA 5KG3A 5J2PA 1WELA 2E4LA 2IDOA 1JKHB 1YKWA 4B02A 4O0JA 4FM2A 4KJIA 1WSIA 1F0XA 1JLEB 3BPSP 4GVMA 2E2NA 1U04A 1RI7A 2Y3YA 5T41A 3WNHA 5A8KB 2BRLA 4FJ8A 4O3PA 5KFCA 1MWYA 1FDBA 1QVFM 1NGFA 4LF6F 3PIOL 3DWLA 2FJBB 3I5BA 5AZJA 3ENOA 3PR4A 2HMIA 2F3JA 4DLGA 3C6TA 1MMLA 2KXFA 1GMWA 1N52B 3QERA 2EK6A 3MM9A 3I8DA 1HNXF 2RUGA 2NPFA 4NCGA 2WK4A 2B9WA 4Q8FA 4J91A 1UWAA 4WZMA 2VQFF 2W41A 1NKEA 2H65B 1IBMK 2DEJA 1QS4A 4J7CA 2FGCA 5GAGI 1F6TA 3L0QA 3HSJA 5JXSA 1SS6A 4FW1A 4Y6IA 4DCJB 4H0PA 3SUNA 5D4NA 4ZVHA 4J9OA 1BL3A 3TZXA 4HTLA 1R31A 4Q8EA 2BKNA 2DGVA 3D2FA 3DLGA 1RKIA 4LF7F 4U8YA 4I7FA 2QK9A 3SCJE 4RUBA 4J9QA 1Z4UA 3VGLA 2C2DA 5GAHI 4KB1A 1Q78A 2KDOA 4BRIA 3QBCA 1RLDA 3ZO7A 3CD0A 3CCMS 1MWKA 2JVOA 2ZKTA 2JFDA 1M5SA 2EFGA 1HYSB 4I2QA 1WEZA 3PFEA 5ETRA 2BANB 2DNRA 3O9TA 4FLXA 4R5PA 5JJBA 2RAQA 2CPZA 2YNGB 3NMUA 3BBFA 1S99A 1T9WA 3P31A 2W24A 4OV1A 2PMHA 3NL0A 5C42B 3MFIA 1LW2B 2ZM6J 2DNLA 3QJPA 2G8IA 4X62K 4D3HA 4Y34A 4NLOA 1M5KC 1QHTA 1RT3A 1N56A 1A5XA 1F3VA 1KVBA 3VAFA 4B1UB 5KFJA 1T7PA 4B3MK 5FD1A 3IS9B 4FJMA 3I56N 2CGJA 3NXZA 3PYGA 1HNZJ 3WXJA 1RAAB 1XMBA 4K8XA 5MAOA 3VAKA 2HSEB 3VAGA 1ZS6A 2B6AA 1WOSA 1OVYA 3ZT0A 4Q44A 1XNQJ 3CCSS 2WSCC 3NVKA 3TR8A 5GADI 4UF4A 2RIJA 1VJQA 2H48B 5LL6Z 3R27A 4LQ3A 2CDRB 2ROEA 1JCFA 3MR2A 2B8QA 3TVKA 2E7XA 1TUWA 4R25A 4CEZA 2KJVA 5BREA 1RGIA 3KK3B 2EC2A 3KNAA 4P52A 3CCRS 1Y5IB 1M5HA 3VQEA 1NM2A 2P9SA 4M5JA 3CERA 3ENAA 3W7BA 4DLEA 2GIFA 2VJUA 1C0TA 1T03B 5J1PA 1IJFB 2RILA 3PW4A 1H2VZ 4AL7A 4DF4A 4OI4A 3AAWB 4CHQA 3QNNA 1YG0A 2ROGA 3MM7A 4B3MJ 3CCSN 2XSJA 5ETVA 2A2CA 2IM3A 2XBPA 2E1MC 3O8MA 3O8WA 1FD2A 4U6PA 3IA0A 2CPXA 2ACMA 4O8UA 1C0TB 3KXDA 3BH6B 4BE1A 1FEEA 3IXQA 4USHA 3HJVA 1HIYA 4K8ZA 3BGRB 2ASLA 3NMRA 2ZH9A 2VKZG 1EJ7L 4HHUA 3R8EA 2W9BB 4ZP9A 2LKZA 2YWFA 3QGPA 3BDEA 2OMOA 3IBCB 4KBOA 2YPZA 3I0SB 3WQUA 3TJ9A 1NK7A 4CK3A 2RQ4A 1BQXA 3CCQS 2OSQA 5K9FA 2YNHA 5M1OA 3TO8A 1NXIA 2HZCA 4FPRA 2VG6B 3HHLC 2W9BA 4IEEA 4CVNE 2N3LA 3MM8B 1SCJB 1K8KB 3N01A 2BXJA 4E1NA 4RW9B 3A12A 5M1PA 1YX2A 1HBMB 3L7UA 4FKXA 3CC4S 1TL3B 4BVPA 3MR3A 4PKGA 3BQ2A 4BR9A 1NSAA 4IR9A 4LJMA 5GAHP 2CQ3A 2E20A 2HBZB 1NGHA 3L8BA 1MMDA 3DGPA 5D0GA 4R5PB 4JV5K 4IG0B 4HHJA 2KVQE 3N28A 1RWUA 1FF2A 4DPUA 5J2NA 3ENVA 2B4UA 2BQ3A 2ZGYA 1FRJA 3V6KA 4KV8A 1Y5NB 3HHNB 2VD3A 3AD9C 3KHHA 2UXCK 4K4XA 2AJ4A 2DO4A 4CLLA 3RR7A 4FXVA 5KRSA 1MWMA 3KHYA 2HS3A 3KK3A 2CQBA 3HK2A 1VRUB 4X66F 1PAUB 4P10A 1HYZA 4Y2KA 3D2EB 1MMNA 2YBVA 4EWTA 4GVEA 5KG0A 3R7BB 1NZAA 4WQ5C 4L3NA 3R97A 3MI7X 4ZHRA 4CFAA 2GC8A 3WQTA 4X84A 1N8RO 3TQ1A 4FJJA 1H7XA 3IGNA 1X4FA 4F36A 2YCHA 2IVOA 2HWHA 1SQFA 1OY6A 1UFKA 2WZ1A 4IWVA 2NRHA 3E01A 3VQDA 2QSFA 5J1EA 4LBHA 2AGOA 1S1WB 4FM1A 3O1LA 4B1XB 3IS9A 3VF2A 3W2VA 3HSZA 5AJ3F 3Q8SB 1CQNA 4K41A 2IA6A 4B3RF 4JYAF 5JICA 3ZSYA 5E0OA 1QVGR 2JVRA 4KHNA 2GIRA 4B1WB 4AQYK 3T1AA 4FYXB 5BYRA 1VAZA 3G8SA 2XG8A 3J7AP 1HWKA 1WUUA 3B6OA 3V1RA 3QZ7A 3IRXA 2IM2A 3PTWA 5H9EJ 3DRYA 3ITHA 1YHQS 3OFEA 1VQ7N 2CQIA 1KTVA 2VFUA 4O3QA 4QIGA 4FWMA 1YTUA 3DRSB 5HRPA 3QT5A 2QIFA 3H4BA 2XTJP 3V1OA 2ZD1B 1KQSR 4ZN1A 4I69A 1FRXA 4E1JA 5DG7A 3BPDA 1RILA 1LK5A 4CK2A 4N5SA 4EZ9A 3CJCA 1U1KA 1VQ8N 3FCWA 3V81B 4ILRA 4BS2A 3O44A 5C2CA 4M5IA 1M1KO 4Y1DA 2O8CA 3L2UA 4CGJA 3GIJA 3CSKA 5L46A 4B9NA 1CC8A 3BGOP 4I7FB 3RB0A 3O9RA 1YK9A 4W5NA 3G6YA 3MPUB 1BG3A 4RUHA 5J2QB 3CDEA 3QAEA 4CJEA 3VMFB 4IYQA 3MR6A 2MKYA 1RU1A 1EWQA 3NG8A 4DL7A 4IFVB 4A57A 1XTZA 1SL0A 1FD8A 1PAEX 3GWCA 1V5VA 2FB0A 3H90A 5AQVA 3M2UB 3PM9A 4IRCA 2XY8A 3G8QA 3B82A 1ZTWA 3AO4A 3KD5E 1YRTA 4WZQA 5IM0A 5J2QA 1ZPVA 1NBWA 4ELTA 3M5RA 3ZNUA 4IH5A 2W6LA 3DLKA 2CPFA 2ZH3A 3LPYA 1RAIB 1HI1A 4RUCA 3KWGA 1N32F 3KHLA 2BM1A 3F56A 3MM5A 3PEHA 2P1JA 5CD4H 1DRZA 3V5RA 4A48A 3PRBA 5D15A 1HJRA 3ZZPA 2VQFJ 3KLGA 5EX5A 3SI6A 2RDIA 8RUCA 1U2CA 4LRCA 4Y00A 2FBXA 5JMNA 5L1JA 3DC2A 1X4DA 3CPEA 1C2PA 2FTRA 2CWKA 4FWKA 2F1FA 5FLXO 4ZVTB 1KVJA 1KLMB 3M6WA 3M2UA 1XERA 4IG3B 2WW4A 2Z1IA 5DLFA 2OZSA 1N34K 3MMJA 4DV1F 3CJTA 1FRIA 2E8AA 3OYIA 3E8OA 5KFWA 4M5KA 3HVTA 4NYNA 2HHVA 2UZAA 3ZZTA 1S4EA 2QMWA 2ZHAA 2KHCA 5I3UB 3JSMB 3I0RB 1SIZA 1RBAA 3MCPA 4DPXA 4G1IA 4ES2A 2ETJA 2MYFA 2DNNA 2Q79A 1ASVA 4ICLA 3X1LB 4WTOB 4Y1CA 4HTIA 4ECSA 2VG5A 4KHPF 2HFOA 3IGVA 4WJBA 5AZJB 1Q16B 3P3DA 3KK2B 3TJ8A 1WKLA 3BF3A 1TL7B 3NWRA 2WVEA 1R0CB 4MYUA 3RAQA 3EY1A 2V6AA 1RAOA 2D9PA 3WXLA 4WXOA 4ECTA 3SAHA 4H8KA 3D1OA 4JV2A 1K73O 2LP4A 5F8MA 4K4TA 1U1QA 1WBBA 3HT3A 1Y64A 3CG7A 4KO0B 2F63A 5JVHL 2Y1RI 2ATQA 5GMDA 5HANA 4DF8A 4ED7A 1C0GA 4BREA 1LXJA 1UAXA 4A2AA 2CQ0A 3SYZA 4ZTJA 4TY8A 3AOCA 2QG9B 1Y3JA 2DH9A 1SXLA 1HHTP 2DFFA 5HVFA 4KAZA 4PG6A 3EKUA 4H5WA 2YWEA 2NRRA 2POKA 2MJUA 4CZKA 4KB0A 4O3SA 3VA0A 2OH2A 4DU8A 3CJQA 4A61A 2G4BA 3OLBA 5T7BA 3N6LA 1XQSC 1CS4B 2M3DA 2W9CB 1J2VA 2H5JB 3CDWA 1U1RA 1A6LA 4RBUA 4Z37A 3MOZA 4TU7A 3OSPA 2F8MA 3Q83A 4DU3A 1S48A 1TUVA 5EXWA 1TV6A 1KBRA 1BO5O 2L9WA 1WSHA 3FSIA 4CGIA 3G6EN 5JS1A 4MIAA 4FWLA 4Y2AA 2BEFA 3K2PA 4A2BA 5HROA 3I87A 2CA9A 4U9RA 4CF0A 3FFIA 2EKNA 2A10A 1GOAA 2QKBA 2KJWA 1HWIA 3OJUA 1BCMA 4Z4GA 1WTFA 5KFTA 1S1UB 4V19S 1T3OA 3OVBA 4FM0A 4RO0A 1U0HA 3H2LA 1XC9A 1HKBA 4CJKA 4JUZA 2ASPA 2E2OA 2XMTA 3VGSA 1VQ7S 3PSIA 2CPEA 4K4SA 1KCFA 4NZ7A 1OH8A 4DV0K 4N7TA 3WX4A 3LQVA 3GIKA 3TSQA 5IT9O 4QPXA 1KP6A 1X4CA 4LF8F 3ULEA 3AA9A 2QN6B 1UVLA 1U6FA 4DTPA 2P6TA 2P9EA 1UZHA 4GV3A 1MW7A 4JHDA 5T14A 5C7PA 2D0PA 1FXRA 3A5LC 4PWUA 3U3GA 5CHIA 1VSMA 2DR8A 1XMOK 4IOBA 4DV2J 1VOMA 1TVRA 4ZP6A 1SV5B 2ZOGA 1S77D 5AQUA 3TWHA 4NA2A 2RQCA 3H6EA 1RA7A 3WT0A 3LDQA 1HYSA 1JL1A 1X0FA 3KLVA 2L9NA 2D41A 3VTIA 4DU1A 4UQTA 2ZUGA 5J2MA 1GNKA 1FFGB 2LFVA 1NOYA 5EN1A 3UD3P 4I64A 3VETA 2KQ2A 4EYHB 2MY7A 2CQCA 4ZTFA 1VSKA 3HD2A 2W8KA 4Z4HA 1WHVA 4GVBB 1R8CA 2XSFA 2B56A 1NG9A 2R7TA 3GJQB 4KB7A 4JI1K 4N8NA 2R7OA 5F41A 4B1VA 3QFWA 4AHCA 1KWMA 4DOZA 4BRCA 2KH9A 1AUSL 4X4TA 2HQCA 2RHQB 1WF2A 3T41A 3LAMA 3TAFA 3ZZYA 3OL8A 1MWZA 2EXUA 4CTAA 3ELHA 4P6QA 1DFDA 2HQGA 4DV2K 3NLCA 3OL9A 2QO3A 3UVJB 2HFSA 4DCOB 1T05B 1Q53A 2P9LB 3QEPA 2VG5B 4DV3F 4CD3A 4LT6A 4F50A 1WJ9A 4OLOA 4DV5J 3HRGA 1E6YA 2DGXA 2ZVIA 4AHVA 4DUZK 4NB4A 4C1NK 1YRXA 5L39A 4CLTA 2UXDK 1LWFB 5GAGU 4B3SK 4CZCA 1KKHA 4F2RA 3OR2B 1VQMS 3HULA 2UUAJ 1JQGA 4WFXA 4CZLA 1FDDA 4J9UE 2BDPA 2AGPA 2H1YA 2NREA 1AT1B 1RABB 2Z56B 3D2WA 1CZ9A 3IG1A 1S5JA 4M7XA 3CD6S 4WQ4A 4R0JA 4XH4A 4LFCF 2QM1A 4EI2A 2BJ3A 3OYAA 1RT4B 2A3JA 2IAJB 1GXTA 3R7NB 3K57A 3H25A 1K6YA 1HNIB 3MMCA 1UVMA 1OQ6A 4O8KA 1WC0A 3P38A 4I6MA 4N76A 3OUYA 4F7VA 5GIOA 3LUYA 3WXKA 1X0PA 3MWPA 5E33A 5BR8K 4F3TA 2KVIA 3J81j 1P90A 3QIOA 4CK1A 4IEIA 1V4SA 2OHDA 4J9LA 1N5VA 3AA8A 4LF6K 3CUNA 3MFHA 1LW2A 1APSA 3HFVA 4DR2K 1QTNB 2WW8A 4P9SA 3J80O 3PFOA 3OVAA 4DUYJ 4NRUA 2UUAK 3H0PA 1IKWA 3KK2A 3HHLA 2UU9J 4E7KA 3M8QA 3DDIA 4ZPWR 1SI9A 4G6VB 3UD4P 4IFYB 1YITN 4M5LA 5IM0B 2IAJA 1RHMB 2EHGA 2IVPA 2RS8A 3DLHA 5C15A 4J5OA 3OV7A 1FHTA 3T1HK 3W2VB 5DQHA 1RDUA 1ZAXA 2GJ2A 4F3QA 4EP4A 3C6AA 4ER8A 2K1RB 4WQ4C 5KFEA 2AX1A 2PO4A 2JH3A 3JXUA 1VI7A 1WEXA 1JLEA 3RB6A 1HJOA 3C8YA 3R2CJ 1T02A 3MMBA 4L6V3 3THXB 2BABA 3GP9A 2KU7A 3V9WA 1L3VA 2L41A 4KR0B 3KD1E 2O67A 2JWKA 4ZVFA 2R7WA 2WB4A 3KK7A 4X65J 1CXUA 2WOMA 3VQAA 1UCNA 1N32J 4ECXA 1T94A 2YVSA 3P1GA 2VC0A 2MPUA 4AT1B 2X74A 4K4WA 1SBRA 4HDGA 4IO9Q 2Q31A 3WXIA 5T7LA 1TZ0A 2RE2A 2G0IA 3NWGA 4CO1A 1NO8A 3KLHB 1VQNS 2EWSA 3KYLA 4NXMK 1URNA 1BC6A 1S59A 2B5JA 5C2GA 2DNZA 5HMXA 2R2TA 4K8RA 1XNRK 3BBBA 3AHPA 4ZVOB 2BM0A 1YJWS 2DY9A 1CBKA 2ZDPA 2YWGA 1IJEB 3M6XA 3O4WA 1SQKA 1U02A 4J9RA 3VPZA 1NM1A 3S1TA 3GPAA 1RT6B 4DL2A 2GQCA 5A76A 4IOAQ 2CJAA 5BYSA 4ED3A 3EXCX 2GAHC 3VA3A 1YI2N 4DL4A 4NLYA 1EQ0A 3ZZRA 3KLEB 3AVJA 2DYAA 2NYIA 2WVBA 2VQEF 2FHKA 1TKXA 1R89A 3D3CJ 3D54A 1VS3A 1CLQA 1ACMB 1MG7A 1WHXA 4OLPA 2VOOA 1GLDG 3IAS9 4CEFA 3RB4A 2FC9A 3HBTA 2GMHA 3C65A 3TTCA 1GLCG 3K89A 3OXLA 2ZUAA 4NLBA 1TU0B 2LQ5A 3WUHA 1CJVB 2MQOA 1C1BA 4ANDA 5L8RC 2V7ZA 1GK8A 1VK0A 4D3GA 5DQIA 1VQ6S 5ETQA 1ZM2A 3H5UA 2AP6A 2OI2A 3E66A 1VQNN 3RAMA 2ZJRL 4DX8H 4RWWA 3RAXA 1RT7A 3UVJA 1LV5A 1RTZA 2ERRA 3FR0A 5KG2A 3MDFA 2O5DA 4TNOA 5KT4A 4C23A 1E6YB 3DMJA 4RW9A 3DRPA 3HKZD 3LAKA 1NCLA 3PHTA 3PRVA 2D7SA 2MGZA 4ZVGA 4DR5J 5KT3A 2FZKB 3TUIC 2FDNA 3DMJB 3CC2N 2OEMA 4ZVRB 4CW7B 2ZBCA 1VQMN 2FLPA 3KZBA 1KVKA 1F1BB 1SIWB 4CNZA 2ZC3A 3TUZC 1TUYA 4F3MA 1BIUA 2D0AA 2QWNA 4DFJA 3B4DA 4KFBB 4FJ5A 1UW9A 2BE2A 1A9NB 1S1TA 2HQ3A 3CO9A 4LFBF 5FPMA 1S6UA 3R5JB 4OYOA 2GQQA 3HI9A 2M88A 3I6PA 4LIWA 4K4YA 3NGZA 4USWA 3HT0A 4HI1A 5AXNA 5F0UA 4ZIWA 4CLZA 1VC6A 5CCMA 1JLGB 1D3WA 4OI3A 3CCWA 4ZVSB 1ITPA 5DM7L 1NPRA 3K59A 1RFQA 2ZJPQ 3T9ZA 2NXEA 3F44A 2XSJB 3D1QA 1F9HA 1LW0A 1VQPN 1RCXB 2W42A 2CJQA 1V9OA 2D1KA 3M9MB 1QJHA 1V5IB 2E29A 1M1KT 3I4PA 4MT1A 2CGLA 4MO4A 5F1XA 4KY3A 1HNVB 2FC8A 4BC7A 5EGYA 2KYXA 1GH8A 4CIGA 5LJVA 5ETOA 1F5AA 1TL3A 2HIYA 3VEZA 4RW7A 2DXEA 5IC4B 4O4RA 2DPIA 4EFAC 2PMZD 3G71S 3G10A 2HQFA 3AVMA 2OFHX 2P6SA 4M3RA 4KH0B 4KI6A 1NH8A 2ZH6A 3W8PA 1U1MA 1UW4A 1IBCB 4CZJA 3AD7C 5EX3A 1NGAA 1WBDA 1W0HA 3RU0A 2YHBA 1TL7A 4DZ6A 1BE4A 3JSYA 3M8SA 1U45A 5DG8A 1QUVA 5SUHA 2VZ9A 3CJ3A 1U0HB 4KRFA 2WHOA 1UOCA 1G2EA 3OS1A 3MCMA 3E2EA 4JK8A 3CM5A 3DLLL 3PO4A 1XEZA 3GR1A 5B8HA 2QL5B 3C66A 2XY7A 1RE1B 5FLXU 1SJ1A 3A13A 1DQAA 2DFEA 3LTOA 4BR2A