1S9GA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r120394.
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
543
structure length
543
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 141
structure length 543
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s9gA05
2VA3A 3KLGA 4XPEA 4PQUB 2GBZA 4N5SA 4ZMMA 1JLAB 5KG6A 2FJWA 4O44A 4CECA 3DMJB 4TY8B 2IDOA 3GIJA 4BDZA 1NJZA 5KG2A 4M95A 5I42B 4EEYA 4DL5A 1U04A 4JUZA 2HMIA 3NAIA 1KVCA 3PV8A 4E7IA 4NLWA 4DTSA 3B6OA 2XO7A 3AVBA 2GIRA 5KFXA 1BQNA 1KCFA 4ZP7A 3OS0A 1LWEB 3DOKB 3V9UA 4RG8A 4NLGA 3MEEA 4DL4A 2G8KA 1N4LA 4E0DA 1WSHA 3ZSVA 1TL1B 2IGIA 3KHGA 3BR9A 4BACA 3ICLA 4F4WA 3AVLA 2ZKUA 4GMJB 3FRZA 4DSIA 5J2MA 5I3UA 1S1WB 4ED2A 3MEDA 2WK4A 3LWMA 4CIGA 3O3HA 3EPIA 4DQPA 1RDAA 1RDBA 2IS3A 3QO9B 3AVHA 1RTJB 4ZP8A 1A5XA 4ID5A 4KE5A 2DTUA 2F8SA 1ZBFA 4J9KA 3ZT0A 5KG3A 3MXIA 2VG6B 4DEZA 3SV3A 4O0JA 3KLIB 4KV8A 3BJYA 4W5RA 1GOAA 3O3FA 3CJ4A 4KHUA 3LP1A 1KVAA 1REVB 1QAIA 2JEGA 3OYGA 3PJWA 4B9LA 2F8TA 4TSXA 2BDPA 1RT4A 1RT3B 1N6QB 3H4BA 3OYJA 2WCXA 2G8VA 3GIIA 4Y1DA 3VQ5A 3OL7A 4IKFA 3UPFA 4F4KA 5KFDA 4G3IA 3QEIA 1NOZA 1EKEA 5L1KA 4FLWA 1CLQA 1JXLA 3MR2A 4DSKA 2ATLA 4TYBA 2RN2A 3NFAA 1NKBA 4B9NA 1S1XA 5KFCA 3ISNC 4NCGA 1ZTWA 4FVMA 1KVBA 5HRNA 3TVKA 1BI4B 1KLMA 3MF5A 4KTWA 1L5UA 2PY5A 2OA8A 2GC8A 4B8CA 4KKOB 2YKMB 4C8NA 1KLNA 1YTUA 2HNDA 3B6PA 5KG5A 4K4YA 3IS9A 2UUWA 3AVMA 5KFQA 1D0EA 1HNIB 1JLAA 1X9WA 1NHVA 1VSFA 3TANA 1QTMA 4OL8A 3DRSB 3DMJA 4DU1A 1JLGB 4TY8A 3LWLA 5EU7A 3V81B 1S9EB 1CZBA 4ZHRB 4E1NA 4KHRA 4URSA 4TY9A 2XWYA 1VSLA 4RW7B 3L3UA 4FJKA 4RNHA 4IFVB 2WONB 4CEOA 5KFHA 4DMNA 3CG7A 3HVRA 3DRRB 5KG7A 1TAQA 1QE1B 2X6NA 4NLSA 2BE2B 4CEBA 5L1LA 1JLBB 3CM6A 4DSLA 4ED3A 4DTXA 1LAVA 3AV9A 2ASLA 2R2SA 4WFZA 3QESA 4KAZA 5C24B 5KT3A 2A1RA 2JEJA 4QAGA 3OL6A 3SI6A 2BQUA 4DQIA 2FLPA 2IC3B 5HRSA 3RMCA 4J9LA 4M3RA 3HVWA 4Z4CA 2OZSA 1WSJA 1TK5A 1KFSA 2FVQA 1VRUB 2R8HA 4L8RB 1T3NA 2D0AA 4TQRA 4BDYA 5F9LA 4PA1A 4KREA 4CHPA 3PUFA 1SL0A 1HPZB 3FFIB 3Q8SB 5KFGA 3V9XA 3GV8B 4LQ9A 4G1QB 2HWHA 3M9OB 3DRPB 3AA2A 4KO0B 1Y97A 5KFSA 4DS5A 3KLIA 1TVRB 4AHCA 1U09A 3NE6A 1HRHA 4CJ4A 4QCLA 1NK6A 4I9QA 3CJ2A 4YR0A 3KLEA 2OYQA 4RW6A 3SQ2A 4J9PA 4DSEA 2W8KA 4W5TA 2GUIA 2IJFA 4K4ZA 1RYSA 1RT3A 2B43A 1N6QA 4JS5A 5KFPA 2C22A 1WN7A 1S1UB 4BE0A 1XR6A 4E3SA 4B9UA 2VG7B 4Z4IA 2YNFA 1BCMA 2C2EA 3HPHA 1JLEA 1RTDB 4N56A 3H5XA 2ZD1A 4RZRA 3AVKA 3O4QA 1QAJA 1S1TB 3OYFA 2PYLA 1BHLA 4B9VA 1X1PA 3ZCMA 3MECA 2YNIA 4CFCA 3QETA 4DL7A 2DFHA 1LW0B 2G8HA 5FRMA 3PHEA 1QHTA 4ED6A 4RNMA 1TKTA 3OYLA 5KFOA 5T14A 2AJQA 4NLVA 5DG9A 4KKOA 2B5JB 3D0PA 1NK7A 2ASJA 4E89A 1GX5A 2D0CA 1RILA 1QQCA 1HNIA 2IJNA 3K2PA 2XCAA 3GILA 3VQ6A 1LWFA 4TLRA 1LWCB 3DRSA 4H4OB 2XRIA 1T7PA 3CFPA 3HVTB 4DU4A 3FQLA 4ED0A 3V81A 4W5OA 3BSNA 3KLFB 4ZHRA 3U3YA 2BRLA 2HNZB 3TAGA 4RW7A 4O55A 4DFMA 4IFVA 3AVCA 4ZTFA 4MK8A 5DGBA 4FLZA 4Q5VA 4ELUA 1BL3A 4IRKA 3RTVA 3DLBA 2KFZA 1TL3B 3DRRA 3M8PA 2XCPA 1QE1A 5J2QB 4LH5A 4CJSA 4IQXA 4DQRA 2BE2A 3CDEA 4RU9A 1W9HA 4E19A 1BCOA 3LANA 5D3GB 1JLBA 2BQ3A 1U49A 4AHSA 1SUQB 2IM2A 1RTIB 4CJ3A 3CIZA 5KG0A 4DL6A 3HPGA 2IBKA 3P5JA 5C24A 3HSTB 4BWMA 4F50A 3OYDA 5DG7A 1WSGA 2IC3A 4FZXC 3SJJA 2QKKA 5KT5A 4KHNA 4B9TA 3OYNA 3HHKA 3NF9A 2HVIA 1VRUA 4YQWA 4O3QA 4O3PA 4CHYA 3QGGA 2J6SA 4U7CA 2YNHB 2YKNB 3OL8A 4ECWA 2OPSB 3ITHB 3SNNA 1K1SA 4WXOA 3DLHA 4FJHA 1HPZA 3FFIA 3QNNA 1IG9A 4G1QA 3DRPA 3SCXA 4CFBA 2WB4A 3BREA 2XGQA 1D9DA 3NH0A 4KO0A 2W9BB 1KSPA 3QEWA 2KTQA 4F4ZA 1U4BA 4URGA 4IFYA 1TVRA 2XY8A 3KKSA 1HQUB 3KK1B 1K6YA 3OSPA 1RA7A 3ZSYA 5DLFA 1JL2A 4JV0A 2D7SA 2VA2A 4OPJA 5J2MB 3TQ1A 5I3UB 1D8YA 3MEDB 1S1UA 2RKIB 3IGVA 1KHVA 1JKHB 1RTDA 2D3UA 4YR2A 2AQ4A 1U47A 1S1TA 1IKYA 5JS1A 4WZQA 3QIPB 4FM0A 2QV6A 3UR0A 3DLKB 3HL8A 4NLXA 4KHQA 5FRNA 3HYFA 4ZVFA 4EBCA 1LW0A 3OS2A 4URQU 3LP1B 4FBUA 4OVLA 3LPTA 3M9MB 1RDCA 4EBDA 4IRCA 1A5VA 4KBIA 2B5JA 4RUCA 5SWMA 3K5OA 4U6PA 3VA3A 1IKWB 2RDIA 3EY1A 1HYZA 1WNSA 2YV0X 4KB0A 3I5AA 4FW2A 4CGHA 1LWCA 3M8QB 1UAXA 3SUOA 1A5WA 1S6PA 4I2QB 4ECYA 4CHZA 2IMWP 5CYQB 3WNFA 4N47A 4N41A 5JS2A 4MK9A 3M8RA 3KMSA 4KTQA 3NMAA 2HNZA 4CJQA 1VSMA 1B92A 1ZBLA 4K4VA 1FK9A 2R7YA 1S1XB 3L2UA 4NLDA 4TN2A 3GV7B 3MFHA 4ID1A 4E7JA 3KD5E 3L8BA 4OPKA 2E4LA 3HXMA 5C25B 2W9AA 4ZPAA 2Y1JA 5T7BA 2KQ2A 2OH2A 1UWBB 5J2QA 4J2AA 4EO8A 2J6TA 4AHUA 4ECZA 4CFAA 1FKOB 4ECQA 4B08A 5DGAA 2YHAA 1U48A 2WRMA 2OPPB 1RTIA 3VQSA 3TAPA 2HNDB 4K8ZA 3WNGA 3IS9B 1KFDA 1TKZA 2HNYB 2E9TA 2W8LA 1HQEB 3KK2B 4IG3A 4DQQA 3NDKA 3H5SA 2NUBA 3ZT4A 3OYEA 4DG1A 4NLQA 4CJWA 4LQ3A 1WSIA 2GIQA 4B9SA 2UVWA 5CY4A 4DQSA 2AWZA 2QK9A 2HWIA 4FJXA 4R5PB 4CEZA 2YNHA 4CEEA 2YKNA 1B9FA 3SFGA 2OPSA 3ITHA 5FDLB 3BDPA 4FK0A 1SH3A 2WOMB 4M94A 1S0NA 3LAKA 2W9BA 2BANB 4CJ5A 3AVNA 3T5LA 2RF2B 1NKCA 4E1MA 1S9GA 3BSOA 4ZPDA 2XC9A 1HQUA 4Z4FA 3KK1A 1NJXA 3G6VA 1J53A 3PVXA 4F8RA 3S3NA 3OL9A 4LY7A 4ZTJA 3KD1E 3KTQA 3RAXA 3K57A 5DG8A 3IG1A 4BE1A 2Z1JA 3RBEA 4OKKA 2E6MA 3DM2B 4RW8A 4FJIA 1WNEA 2HHSA 2RKIA 4KFBA 3GV5B 4IG0B 2YNGA 1C0UB 4CHNA 1SL2A 1JKHA 2AU0A 4NYFA 3SQ4A 2BR0A 4CEDA 3LPUA 3L2WA 4FLVA 4DLGA 3QIPA 1WAJA 2D0BA 1DLOA 5KFTA 2CJQA 1WLJA 3AA4A 3TAEA 5CYMB 3DLKA 4HKQA 4K8XA 4FLYA 2BQRA 3SUPA 4B3OB 3MFIA 3QEVA 3RAQA 1QSYA 4CJPA 4EP4A 4M3XA 3SFUA 1JX4A 3JSMA 3OHBA 3NL0A 2JLEA 3KJVA 2VG5A 2XY5A 4CF2A 5EWEA 1UA0A 1F21A 2E6LA 5DK5A 3KLEB 3CJ3A 5KT2A 4CF9A 4RW6B 1ZBHA 1W25A 5F8LA 1NHUA 2IOCA 1IKWA 1TKXA 4QWDA 3CWJA 1QSSA 2YNFB 3M8QA 4I2QA 4RNFA 4RNOA 1JLEB 2AX1A 1TV6B 4J9MA 2ZD1B 1L3UA 4ICLB 5CYQA 4KI6A 5HROB 3IAYA 2FVPA 3NGDA 3NF8A 5HLFB 5KFEA 3MECB 4KHYA 4GC7A 4WZMA 4Z4GA 2YNIB 3AVAA 4J9RA 4DL3A 2I1RA 3I5BA 2W7PA 3AO2A 5C25A 4F2SA 2AGOA 3P83D 1VRTB 3PX6A 1UWBA 2QXFA 1TKTB 3MXJA 1D1UA 1XC9A 1FKOA 3ZSZA 1XR7A 2OPPA 4IR1A 4E7HA 3OYKA 1NOYA 3MEGB 5DQIA 2HNYA 2EHGA 1C0MA 4OJRA 1S1VB 3AO1A 1LWFB 1HQEA 3KK2A 3CJ0A 3FDSA 4DL2A 2AGPA 3HP9A 3GIMA 4QWEA 3BQ2A 2ASDA 2GV9A 1ZBIA 4FLUA 1Z4UA 4XO0A 4FZYA 2UVRA 4Y34A 1T05B 4RW4B 2ILYA 4DF8A 3OYHA 4Y3CA 1K1QA 1RA6A 3ZSXA 4R5PA 3HP6A 3H40A 2IM1A 5FDLA 4Y2CA 3M8PB 4NLTA 1ZTTA 2DFEA 4ED8A 3D5MA 2WOMA 1UOCA 3I0SB 2BANA 5J2NB 2RF2A 4K4UA 3F9KA 1Z25A 5DMRA 3ULDA 4C8KA 4LSNB 2HHVA 3NBPB 3ALYA 4NRTA 4PUOA 5KFIA 4FBTA 4O0IA 2XY6A 4O3RA 4ECUA 3AO4A 3LAMA 1C1CB 4FLXA 4GW6A 4YP3A 3L2VA 3SZ2A 3PX4A 4ECSA 2UUTA 3DM2A 1HJRA 3NGIA 2P1JA 4LH4A 1ASVA 3H98A 4IG0A 1RBUA 1C0UA 3AVFA 3U6FA 2B6AB 4CGGA 1N48A 2ETJA 3NGZA 3QLHA 3NH2A 1ASUA 3K5LA 3VQ4A 5JXSA 4NLOA 4JRPA 4QWCA 5CYMA 4DLEA 1TK8A 1RT2A 4OGCA 4B3OA 2JC0A 4OKEA 4IFYB 1S0OA 3N6MA 3VQAA 4CJUA 1QUVA 2FVCA 1NK9A 3AA5X 2VWKA 5EWFA 3VQPA 3CFRA 3ZT3A 5HP1A 1EX4A 3SYZA 1BISA 4IDKB 1IO2A 4FJ8A 4K4XA 2UVVA 4QWAA 3CYMA 3KIOA 3RBDA 5KG1A 2X78A 2DPIA 4BWJA 5E41A 1S97A 4CJTA 4DTNA 3K58A 1J9AA 1C0TB 5KRSA 3NF7A 1TV6A 4IR9A 4ICLA 3A2FA 1IKYB 3QZ8A 5HROA 3HK2A 4FJGA 4BE2A 1CXUA 1SKWA 5HLFA 4EO6A 4NZ0A 4Q8EA 4CHOA 5J1EB 4NLUA 4IOBA 1I3AA 1DTQB 4Y1CA 1VRTA 1BGXT 2FVSA 3SPYA 3ZSWA 1RT5B 1SKRA 3KOAA 2QKBA 1IH7A 2FLNA 4CEFA 1IKVB 1B9DA 3MEGA 3T5KA 5EWGA 4HUEA 3AVGA 1S1VA 2HHUA 3HPOA 1RTHB 3BSCA 1YVFA 4H8KA 1T03B 1S5JA 1S6PB 5KFZA 4EZ6A 1Q9XA 2X6SA 2ZE2B 1NK0A 5DLGA 3MTKA 1T05A 4RW4A 1SV5B 4KHMA 4YNQA 4J9OA 3MXMA 1DTTA 3OLBA 1VSJA 3V1QA 2XGPA 1JLCB 3VQBA 1FK9B 4J2BA 4Q43A 4NLYA 2DFFA 3SUNA 5KFLA 4M45A 3P1GA 3VQEA 3BQ0A 3Q8QB 3V9SA 3DLGA 2HHWA 5KFWA 2DY4A 1FXXA 5L9XA 4DWIA 3I0SA 2HHTA 2R8JA 2C2DA 2EX3A 5J2NA 4KB7A 3KHRA 3ISND 2R8GA 3HVAA 4RNNA 1X9SA 4OKJA 4LSNA 3RWUA 1ZETA 3NBPA 3LDSA 4O4RA 1WSEA 1TKZB 4ECRA 3VQDA 4JS4A 4JV1A 4PWDA 3NHGA 1TKDA 4FZZA 2DPJA 2R2RA 3G6XA 4IG3B 4FCYA 4Q45A 1CXQA 1TK0A 4Z4EA 2HVHA 1OS5A 3E01B 4DG1B 1UA1A 1C1CA 1QSLA 3HM9A 5KT4A 2Z1HA 1RBVA 1KRPA 3H5YA 3KHLA 2KFNA 3N6LA 2V4QA 4DTOA 1N56A 2HW3A 4O4GB 3I0RB 4DFKA 3RRGA 2B6AA 3V4IB 5KFAA 4AHTA 4JLHA 1HARA 3PR4A 3TR8A 5KFKA 2ILZA 3NCIA 2D3ZA 4IRDA 3QINA 5SZTA 3T19A 2E9ZA 1CSJA 3VN5A 5KFBA 4EYIB 3QNOA 5KT7A 3OVNA 3TI0A 1S9GB 3H2LA 1Q8IA 3VQ9A 3D28A 2B4JA 2V4RA 4Z4HA 2ITGA 5CZ2A 3KK3B 1BIUA 5HBMB 4DTUA 4WYWA 4YMEA 4IDKA 2PYJA 4J9NA 4YFUA 3IG1B 4Y2AA 4RW8B 4B8AB 4KFBB 1C0TA 4O3SA 2YNGB 3HO1A 3GYNA 2O4GA 2LSNA 3NH1A 4DTRA 1I6JA 3PW5A 5HRPA 4CF0A 4DSFA 1DLOB 2W7OA 4B9MA 5KTQA 3K5MA 3OY9A 1N5YB 5J1EA 4ECXA 5F8HA 2VWJA 4KRFA 4F4YA 1DTQA 3JSMB 2YHBA 3TARA 1EXQA 4QPXA 4C8OA 3KJVB 2VG5B 4FJLA 1RT5A 4HYKA 3KHHA 4CF1A 1KHWA 3SQ1A 4FK2A 1IKVA 3DLEB 4IH5A 4YR3A 1TKXB 4GVMA 3RR7A 3C95A 2IAJB 4CGDA 4WFYA 1RTHA 3MR3A 1T03A 3VQ8A 2KZMA 2JEIA 3FQKA 4DTJA 3IN5A 3I5CA 1NK4A 2ZE2A 4CK3A 1RT7B 1SV5A 4CJFA 4ZPBA 1C1AA 1JLQB 3NKYA 1JLCA 4XIUA 1NJYA 1LAWA 4K4SA 4X2BA 4NCBA 4CCHA 1S48A 1NKEA 4DFJA 1XHZA 4AHRA 1WAFA 2OPQB 2D41A 4ECVA 1YTAA 4OGEA 4J2EA 4IBNA 2R8IA 3DYAB 2FVRA 5KG4A 3GQCA 1JXBA 2XI3A 3E01A 3RB0A 5DQGA 3PW7A 3OYBA 3UQSA 3JYTB 2XI2A 2A1SA 3LP0B 5EDWA 4EP5A 1L3SA 2FJXA 4CJVA 4O4GA 3LP3A 3NF6A 3I0RA 4FJMA 3V4IA 4ZVEA 4JRQA 3S3MA 3ZT1A 3TABA 4O5BA 3Q8RB 4AHVA 2X74A 4RW9A 1L3TA 3H4DA 4CK2A 3FSIA 2ALZA 4QW8A 3ZSQA 4Q8FA 3BGRA 3QERA 2BGGA 3C6TA 4PUOB 1RT6A 5KT6A 1S9FA 2FBXA 1LV5A 3PZPA 2Z1GA 1TAUA 3KK3A 4NLPA 4CFDA 5KGWA 5HBMA 1HNVB 3QZ7A 4CJKA 1RBSA 3RMDA 4DFPA 2JC1A 4H4MB 5KFJA 4W5NA 1MMLA 3G0ZA 3PW0A 4CIEA 2AGQA 4QOZB 3OSNA 3QYYA 3AVIA 4Q0BB 5KFFA 4I2PA 3QLHB 1VSIA 1O1WA 4M42A 1FKPB 1IKXB 3V6KA 1IM4A 2F8EX 4CJEA 1N5YA 2IM0A 3OYCA 3T5JA 1RT2B 3NAHA 4AH9A 4QW9A 3V6JA 3AVJA 4NYNA 3HT3A 4OLAA 4EYHB 4M3ZA 2HHQA 3O3GA 4HCBA 5C42B 4CGJA 4HUFA 5HP1B 4UQGA 5K14B 1SKSA 3DLEA 4H54A 2ZQBA 4HUGA 3VQ7A 4FJJA 3RMAA 2F96A 3QGIA 3D45A 3IGNA 2IAJA 3DOLA 3ZSRA 4ZP9A 4KPYA 3U3GA 2IM3A 1ITGA 1VSKA 3H5UA 4ED1A 1RT1B 3T3FA 3CDWA 3LZIA 1RT7A 3PJXA 1S6QA 5F8JA 3L2QA 4TXSA 4WE1B 3K59A 1JLQA 2P5OA 3CVKA 3TAFA 1VSDA 1C1BB 3HJFA 3V9WA 1RDRA 3O4NA 4Q44A 3OLAA 1XI1A 1TGOA 4ZVHA 3DI6B 1LW2B 3EYZA 2OPQA 4CIFA 3TAMA 2FLLA 1J5OB 1G15A 3RB6A 1YVUA 2FBTA 3CFOA 3ASMA 3QEPA 5KFYA 3F73A 4N76A 4NRUA 4DU3A 4TQSA 3DYAA 3KLVA 1TQLA 4CHQA 1RAJA 2XY7A 4FM2A 3IRXB 1Z26A 3JYTA 4ELVA 4J2DA 3LP0A 1DTTB 2AX0A 2I5JB 2R2TA 4FS2A 4PQUA 3CM5A 3QGHA 3CJ5A 3ZSOA 1EP4B 4F4XA 3OYMA 2IA6A 3DLGB 3PO4A 2FJVA 3C6UB 5I42A 2O5DA 3LP2B 3PR5B 3V6DB 3QIDA 4CF8A 4O3NA 1WSFA 4IH6A 1RBTA 4CERA 1MU2B 2C28A 5KFNA 1RBRA 4FK4A 1S0MA 3UDLA 4PWDB 3MR6A 3EPGA 2O4IA 4ECTA 4LSLB 3T1AA 2OZMA 3C94A 1HNVA 3V6HA 4FXDA 2PZSA 1LWEA 3DOKA 4H4MA 3N6NA 2JEFA 4MFBB 1RDDA 4KHWA 1NK5A 4CJLA 3T5HA 4HCCA 3RB4A 3S3OA 4J9SA 1R0AB 3BSAA 4Q0BA 1TL1A 2JGUA 2P51A 1SH2A 1FKPA 4K4TA 1IKXA 4W5QA 4FLTA 4FS1A 1S1WA 4J9QA 2RDJA 2D5RA 4OLBA 2WTFA 2Y1IA 1JXEA 3QO9A 3WNEA 2KZZA 1RTJA 5DQHA 4CE9A 1NJWA 4FJ7A 5KRTA 4DTMA 5C42A 5KFUA 1BIZA 5L1IA 3EZ5A 4HHTA 4KI4A 5K14A 4MH8A 2VG6A 2G8IA 4R0EA 3LZJA 2HHXA 4F2RA 4M3TA 2C2RA 2HB5A 4M3YA 1REVA 4GC6A 2BRKA 1RT1A 4K4WA 1ASWA 3AO3A 3ZT2A 1TP7A 1NNDA 4WE1A 4LD0A 1U45A 4DSJA 5HRRA 4E7KA 1EETB 3M9NB 1C1BA 1GOCA 5C5JA 1T8EA 2HAIA 4R8UB 1HMVB 3PO5A 5F8GA 1JL1A 2FBVA 4C8LA 3DI6A 4KHSA 1HYVA 1LW2A 2OPRB 1ZBUA 4BDPA 1L3VA 4JV2A 3DLRA 1J5OA 4M3WA 1JLFB 4IH7A 3MR5A 3BQ1A 3AA3A 2W9CB 3QIOA 1BI4A 2WHOA 1CZ9A 4F3TA 4I7FB 1XR5A 2KW4A 4KSEB 5EUHA 4MK7A 3OYAA 1C2PA 1S4FA 3GIKA 3IRXA 3S9HA 2YKMA 1VSEA 2I5JA 1BQMB 4M3UA 4F3OA 2Q3SA 4CESA 4NCAA 3M8SA 1EP4A 5J2PB 2V9WA 3DDKA 1JLGA 4DF4A 1HYSB 3UIQA 4FJ5A 1S9EA 3C6UA 4XPCA 4ED7A 2Z1IA 4HTUA 3LP2A 5KFRA 3KLHB 3V6DA 4CK1A 3OJSA 2J6UA 1D9FA 2WONA 1YT3A 4PY5A 3QEXA 1MU2A 2R2UA 3G10A 3E51A 4LSLA 4FYDA 3Q8PB 3WNHA 3HKWA 4WFXA 4MFBA 3CQ8A 2G8WA 4MIBA 4CJRA 4WYLA 3OYIA 4CEQA 4Z0UA 2UVUA 2R8KA 3KNAA 3KLGB 4CGFA 3V1RA 3VQQA 1R0AA 2EC0A 3EZUA 4ELTA 4ZPCA 1JIHA 1QS4A 4O44B 4MIAA 2V0NA 2G8FA 4CEAA 3PY8A 1GOBA 5KI6A 4RW9B 3NAEA 4MKBA 1RCHA 2HMIB 3SUQA 3TAQA 3BGRB 3TWHA 4MKAA 2G8UA 4RUAA 3C6TB 1RT6B 3SPZA 4ZP6A 4KB1A 3OS1A 4DS4A 1W0HA 1XHXA 4QWBA 1VSHA 1ZYQA 1BQNB 3VQCA 4CGIA 3MAQA 1RYRA 4O3OA 5CZ1A 3V9ZA 4I9LA 3MEEB 3OHAA 3L3VA 1C6VA 3L2RA 2E9RX 1I39A 4I2PB 4NYZA 3PW4A 4FJNA 3RRHA 2FBYA 1VK0A 1EETA 2VG7A 3RR8A 1D5AA 4R8UA 4K50A 1HMVA 4ID5B 1GX6A 3SQ0A 2OPRA 4MQ3A 1KTQA 2XHBA 3RMBA 3G86A 1JLFA 1XWLA 2P5GA 4DTPA 2FC0A 2W9CA 5F8NA 4NLRA 4KV8B 3DOLB 3V1OA 4E7LA 4KTZA 4I7FA 3NGYA 4EZ9A 4FJ9A 3SI8A 3K5NA 1X9MA 4EBEA 2ATQA 5F8MA 5KGXA 3THVA 1S6QB 1RT4B 3AO5A 1Q9YA 4IKAA 1BQMA 4HVJA 2RPIA 5KFVA 4FM1A 1T94A 3PW2A 5J2PA 4H4OA 4FW1A 3HVTA 3KKRA 3PX0A 3KMQA 1HYSA 1SL1A 5L1JA 3KLFA 2W42A 3G6YA 3KLHA 1S10A 4C8MA 4WXWA 5FROA 3TAMB 3RB3A 4AILC 4KAIA 5F8IA 4NCGB 1NK8A 3SV4A 5JUMA 1TL3A 1KLMB 3I8DA 2QE5A 3CDUA 1RNHA 4TYAA 1SH0A 4M41A 3VA0A 5F9NA 3OJUA 5D3GA 5KFMA 3H59A 4ZVGA 1S49A 3H08A 1SUQA 1J54A 3CO9A 2CKWA 3LALA
chains in the Genus database with same CATH superfamily
2XYHB 3BF3A 1ATSA 3GFXA 4BRPA 4N5SA 2KU7A 2HS4A 1EZZB 1T44A 5HN0A 2IDOA 5RUBA 3GIJA 3I96A 2F8HA 2DNHA 3HM8A 2OD4A 3HRGA 3TU5A 5I42B 2N3OA 4EEYA 1HW8A 4DL5A 5DZ7A 3NAIA 1KVCA 4HWIA 3DN9A 3EZWA 1YXQA 3AA9A 4BGBA 3B8AX 2V4JB 2YWFA 1EO1A 2M2BA 4DR3K 4BR5A 4NLGA 3MEEA 4HEA9 2ADCA 4NI2B 4DV5J 1HBUA 3ZSVA 2IGIA 4JB8B 4BACA 1IXKA 4OZLA 3CD6N 2C2NA 2ZKUA 3MM5B 4OZ3A 1S1WB 4BR4A 2UXCF 3O3HA 3EPIA 4KGKA 4OX9K 3CJQA 1RDBA 3EGVA 5AZJB 1RTJB 4I6AA 2WTUA 2DTUA 1WI8A 1GK8A 4ATNA 3E9OA 5GAEP 3UFCX 3MXIA 2VGNA 3G96A 4DV5K 3I87A 5L8RC 4YOWA 4OQJA 1PBAA 3BKFA 4E98A 1FCAA 2JEGA 1QAIA 3OYGA 4FYXB 3PJWA 3HSJA 1WSRA 2U2FA 2W2OP 1RT4A 1RT3B 2Y8WA 2FYXA 2G8VA 1VQ5S 4Y1DA 3L4BC 1WACA 3OL7A 4IKFA 2GS8A 3UPFA 5KFDA 3UKUA 4G3IA 4IZ9A 3VOVA 1CJTB 5L1KA 5M1KA 1T9YA 2E20A 2R7SA 4TYBA 2RN2A 2RVJA 4ZPTR 3L7PA 3ISNC 1NEEA 2GA7A 5HQMA 4BRCA 5HRNA 3NNHA 2HVDA 1BI4B 1IR0A 5ETRA 4KTWA 1GLBG 2OA8A 3LDNA 3V4MA 4X84A 4C8NA 2XMMA 2EFQA 2GW8A 1YRTA 4DX8H 3IS9A 1X0PA 4ZITA 1JLAA 3MCAB 1NHVA 1VSFA 3HD1A 1GLDG 4OL8A 3DRSB 4TY8A 2R3VA 3QBCA 3LWLA 3V81B 1RBLA 1S9EB 1CZBA 4ZHRB 2BJ3A 2D69A 4E1NA 4KHRA 3QICA 2L9NA 2XB2D 4IFVB 2WONB 4LF8J 5KFHA 1ZS6A 4DV1J 1YJ9N 3HVRA 2M3DA 1ZAWA 1ZM4A 2GMLA 4ER8A 3MM9A 2W4DA 3W1YC 2CQ3A 3NVMA 4CEBA 2H9ZA 5L1LA 1X3MA 3SCIE 4H5VA 3CM6A 5E3PA 3GWCA 3AQOA 2L08A 1LAVA 3TUJC 2YQ1A 1GXUA 1QQMA 3QESA 1RGVA 2X1GA 2BQUA 2GMHA 2IC3B 3HVWA 3ENWA 4BQZA 1LOUA 1WSJA 2Q79A 4ZIVA 4TQRA 4PA1A 1SL0A 3FFIB 3VEYA 1UWAA 3GV8B 4OX6A 5AE3A 1DURA 3EL2A 4DS5A 2OCEA 2RJZA 1NJIO 2D3OR 3OFGA 2MZ1A 1V3SA 4DR7F 3NE6A 2JJ4D 1L3KA 4CJ4A 2QLJB 4YR0A 3L3CA 3F2KA 2OYQA 3CCMS 4IYQA 2W7AA 2JVRA 1UPPA 1EKSA 4K4ZA 4WFNL 1WN7A 1S1UB 4BE0A 4ZDNA 4B9UA 3W9JA 2MQMA 1BCMA 2Q6BA 4KRWA 3HPHA 2FDNA 1RTDB 3H5XA 4RZRA 2A41A 3AVKA 4A57A 1S1TB 3OYFA 4B9VA 1BHLA 1X1PA 3EDQB 1X5SA 4F04B 1WG5A 5E7OB 4CRJA 1KD1T 2RMLA 2AZ3A 3QETA 3WZ0A 2OTJN 3VF2A 3NGRA 5LT5A 5IT9Y 4RNMA 3OYLA 2M5YA 5KFOA 1P9QC 5T14A 3THXB 3U27A 3E9LA 4NLVA 4EU0A 4KKOA 2AIRB 1B3TA 1AUSL 2ZFHA 2DJWA 2UV8G 2Z58B 2ASJA 4JI4J 4E89A 2V94A 1R7IA 3SCKE 2QTWA 2V52B 2VFSA 1XMQF 2KYXA 2YQ0A 4H4OB 2XRIA 4Y2KA 2F5GA 4IOXA 4X62F 4ED0A 3RGIA 3KLFB 1UVNA 3HTVA 2BRLA 3BF4A 4H5RA 5JICA 3P8BB 3TAGA 2ZWHA 2V34A 4HACB 4RW7A 3AVCA 1HD0A 3TYTA 5DGBA 2NPFA 2RRAA 4Q5VA 1BL3A 3IR7B 1DQAA 2KFZA 3KWIA 3KXDA 2I9SA 4JI4K 2FIUA 3PKYA 1BWVA 4LH5A 4CJSA 2BE2A 3MM8B 4LFAJ 3FK4A 1NMNA 1U49A 4WU2A 2PMWA 2IM2A 3DJCA 3TZWA 2EK6A 5K20B 4DL6A 1NGIA 3P5JA 3HSTB 3J8AA 2RUSA 2OFHX 1TUWA 1FO1A 4IFEA 4X4SA 2QKKA 1JJ2M 2CPJA 4LF1A 2HVIA 3NF9A 4YQWA 2MSTA 4TU9A 3SCLE 4H0XB 4V19X 5AFUH 2YNHB 3OL8A 2OPSB 3ULHA 1VRQC 1X5PA 4DV2F 1K1SA 3I8BA 1H7XA 3DLHA 3RW7A 2W4PA 4G1QA 4OLPA 3W2VA 5D0HA 2K7KA 1WC3A 2BZ2A 1N36F 3D6RA 5AQLA 4URGA 4IFYA 2XY8A 1HHTP 3SCJE 1K73O 3CCQS 2GWJA 3KK1B 1LEOA 3NRBA 4UOGA 1XMOK 3H20A 3GFHA 4Y2IA 3F56A 4YOEA 2UUAJ 3T6BA 4XDCA 2E44A 4WFBQ 3A8YA 2RKIB 2NCKL 1KHVA 3MDQA 1JKHB 3IP0A 2ZH1A 3W2WA 2AQ4A 5C10A 1IKYA 1KOOA 3N4QA 2FHJD 4FM0A 3EGWB 4F4AA 2E1MC 3C66A 2QV6A 1D3WA 3UR0A 3D2WA 4WP8A 1Q7YO 3ETMA 3HL8A 4NLXA 3C2PA 2NUUG 1NDLA 3U7JA 3OS2A 1NZAA 4OVLA 2UUAK 4ZVSB 4IRCA 3AA8A 2LP4A 4C11B 4RUCA 4YDUA 1U1QA 4DUZJ 3ENOA 3I5AA 4FW2A 4CGHA 2B9WA 1LWCA 3M8QB 3SUOA 1GMWA 1N8RO 2Y9HA 2G13A 1GLCG 4N47A 3VF6A 1NG9A 4KTQA 1M5SA 2EFVA 5D0EA 4K4VA 2QI2A 2R7YA 4JAXA 4NLDA 2VFVA 1S5ZA 1VFJA 4LREA 2JHEA 3KD5E 3O1BA 3JQJA 1T11A 3ILIA 4IOCQ 3QT6A 4M5HA 2FY8A 2VFTA 1UWBB 3L7OA 4ECZA 4DUZK 4XAKA 3AHPA 3D66A 4FKYA 2WRMA 1RTIA 3TAPA 3WNGA 3R6MA 3IS9B 1FWLA 1KFDA 2IJRA 3IR6B 1FESA 4IG3A 4DQQA 2RE1A 2JLGA 3H5SA 3GYXB 2NUBA 3ZT4A 1RAHB 3O9SA 4CD1A 4LQ3A 2FGCA 3C6HA 2KHCA 3M6WA 1T9UA 4DQSA 2AWZA 4R5PB 2FZCB 1KONA 4CM0A 4DV4J 1RWMB 3ITHA 5GAGU 1B4SA 3H46O 5FDLB 4DL0C 4FK0A 3UVJA 5A2QU 2JSXA 2W9BA 2GVZB 2BANB 1BE4A 4CJ5A 3T5LA 5THWA 1QHAA 5AFUA 1LWXA 2DHHA 1HQUA 1ZM9A 4BC9A 3DRYA 3G6VA 2H4YB 3D1OA 1WSVA 4DV7J 3EUNA 4L3KA 3O44A 4J37A 2ZDOA 3JQMA 3RAXA 2UUCF 4FDFA 1FX4A 2MDAA 3FVYA 4RW8A 4FJIA 1WNEA 2HHSA 1K47A 4KFBA 2RB7A 2YNGA 1JCFA 2H54B 2OMOA 2BR0A 3L2WA 3VAKA 4AM6A 4CLFA 1IQTA 3QIPA 2UP1A 1QUPA 2ZVSA 4KH4A 2FUG9 3AA4A 2HHHF 1HI1A 2JOQA 1NM1A 3BB5A 5B7WA 1JWWA 3VETA 1CPZA 3ATUA 4NLBA 3J7YP 4DV7K 3I4HX 4ZN1A 3NL0A 3KJVA 3MPYA 4CF2A 1VQ4N 3CB4A 2E6LA 1Y3KA 2Z8QA 3TJ9A 4USUA 1W25A 4F0KA 1HL6A 4OHXA 1IKWA 4LVNP 2HFUA 1TKXA 3P4UB 3PYEA 3ZTSA 3LDLA 4NXMF 3MCMA 2CPXA 3OFHA 3M30A 4RNOA 1VQON 1TV6B 3TR5A 3OBIA 4H0TB 5CYQA 2V6AA 5HROB 5BXIA 3IAYA 2CFXA 1SJFA 1VAZA 5EGYA 2QEXS 2Z30B 2G0IA 2JWNA 5KFEA 1BOTO 4GV6A 4Z4GA 2A5XA 2NRHA 3AAWB 3VENA 5EVZA 2FB0A 4Y0WA 3WDOA 5FLXO 3AO2A 5C25A 1SI9A 3R5BA 5E3CA 1H6KX 3PX6A 3O9TA 2QXFA 1TR0A 1FKOA 3ZYYX 2ZC4A 3ZSZA 1XR7A 2OPPA 3EXCX 4IR1A 1TL4A 4E7HA 3OYKA 1HLWA 5DQIA 2HNYA 2ROEA 2HIQA 3K2YA 2YH0A 4JI0J 3CJRA 4ANCA 5I4MA 2Y3YA 1ZBIA 4FLUA 1YJVA 5A76A 4ED5A 4DF8A 3VGLA 2NRTA 2DH8A 4JHDA 5IC4B 1HWIA 2UXBF 5LMNF 3ZSXA 4LF4F 4DR6J 4BVPA 1X4FA 3HP6A 4LF6J 1YIJS 4I6YA 2VC1A 2MTLA 3HDSA 2GEMA 2R9LA 2DNMA 4U95A 5B8HA 2EXUA 3QJLA 2VPWB 2YJEA 3I0SB 4DCPB 3CMAS 3B8HA 2CNKB 1HR0J 1SXLA 2QRRA 5DMRA 4JI0K 3ULDA 4CP5A 1K0VA 4Z7CA 3DOMB 2XY6A 3EICA 2CG8A 4O3RA 2HBYB 4DR6K 3AO4A 4LF6K 2DGXA 4FWSA 1N54B 5HQLA 3PX4A 4ECSA 4RWTA 3DM2A 3ET6A 3HKZD 3OFEA 3NXZA 4LH4A 2HYIB 5ETNA 4IG0A 1RBUA 2VIHA 1C0UA 3BDEA 2B6AB 1S22A 1HR0K 2ETJA 4QYRA 3K5LA 5DJBA 3LGHA 1H3DA 1M0SA 5CYMA 4KGVB 2IIHA 4DR2J 2DNNA 4OGCA 2I7PA 3VEVA 4IFYB 5C7PA 2DBBA 1LXJA 1SIZA 1CZAN 3QMLA 2FJEB 4CJUA 3J81U 2FVCA 3AA5X 2VWKA 5EWFA 3A1YG 5HP1A 4NZ6A 3DXKA 5AQFA 1C4CA 3T9NA 1IO2A 2EFOA 4DV3K 4MTPA 4H5NA 5KG1A 1S97A 3CHWA 4JKBA 3SSQA 2B8PA 4CZCA 3NF7A 3TUZC 2D1CA 1IKYB 3HK2A 4P2SA 1SKWA 1G2EA 1YUWA 1ILYA 3NMRA 4JKDA 4RTFD 1BXNA 1Q4RA 2XLJA 4IOBA 3ENQA 4WK1A 4WK3A 3SPYA 3G6ES 3PYDA 5B0AA 4GVBA 3KOAA 2QKBA 2FLNA 4YB1P 3VMFB 5HK4A 1IKVB 1IM6A 3LM9A 1B9DA 3AVGA 2P9NB 2QO3A 5GADI 3B54A 1S1VA 4HT5A 5HVGA 3MMVA 2HHUA 2YKOA 1T03B 5KFZA 1PYTA 1NGFA 4DCOB 1NK0A 1T05A 1SV5B 4KHMA 1NZ8A 3V1QA 3W60A 4JI1J 3VQBA 4CT8A 2O66A 1Z2ZA 3AXMA 5DM7Q 2DFFA 5KFLA 3RBXA 3VQEA 1VQSA 5A8KA 3Q8QB 3DLGA 2HHWA 1FXXA 5L9XA 2R8JA 4UW2A 2EX3A 5J2NA 4KB7A 2BTFA 2JH3A 2B9YA 2IRXA 4A47A 2R7RA 4RNNA 4LSNA 4O4RA 3DHXA 1WSEA 2CH5A 1RBAA 4USVA 3VQDA 2DR8A 1TFWA 5AQVA 1TKDA 3JTNA 4ZLPA 4FZZA 4IG3B 4Y28C 4Q45A 2HVHA 1CXQA 4JI1K 1B7YB 4TU7A 1C1CA 4USWA 3HM9A 5DDQC 5KT4A 2Z1HA 4OIXA 2V4QA 4MYTA 1UZHA 4O4GB 3MCOA 4WKRA 3V4IB 1X4EA 5KFAA 3ZTQA 3H25A 3E9PA 2L3MA 1HARA 3W63A 3PR4A 3GMGA 2VBYA 1HNZF 3M2VA 2D3ZA 3EJMA 3MWPA 2E9ZA 1CSJA 2MKYA 4XH4A 5KT7A 3OVNA 3MWTA 3GYGA 4DV0F 5DM6Q 3AAPA 3VQ9A 2V4RA 4Z4HA 4PPZA 1QQOA 4D3GA 4YDUC 3CJKA 1KVJA 1U0SA 3J7A1 2PYJA 4J9NA 2EFGA 2VBZA 4PYDA 4R79A 3IM8A 4M63C 3L9ZA 4RW8B 3AGKA 1F9EB 2XMWA 2K8GA 4KFBB 3FR0A 1C0TA 1CC7A 4O3SA 2YNGB 5ETSA 1FE0A 4OZ5A 2HVZA 2O4GA 3FZ2A 2LSNA 2UYTA 4DTRA 3PW5A 4OYAA 3BYPA 5EY4A 1V3RA 5J1EA 3THYA 2VWJA 4KRFA 2PT0A 5JLHA 1DTQA 3O6QA 2DO4A 4C8OA 1QQNA 3KJVB 4FJLA 1KHWA 4PABA 1O8BA 2W40A 1GXTA 2DGWA 1GLAG 2P8IA 1TKXB 2VQFJ 4GVMA 3J81O 3C95A 4WFYA 1NH8A 3FE1A 4C48A 3M30B 5AQZA 4DXLA 3QFUA 3FQKA 4DTJA 3F41A 1NK4A 1RT7B 2QL5B 4ZCMA 1KC8T 2A40A 2XBPA 4U67Q 1C1AA 3NKYA 3SDEA 2ZVIA 1JLCA 4XIUA 2P9PB 4H4KC 4X2BA 4NCBA 2G1HA 1NKEA 2Q0UA 2A3ZA 1WBBA 4ETZA 2VQFK 4ISFA 3HSCA 1ZZFA 4HTIA 5DM6L 3MZIA 1N5QA 2A0FB 4DZ6A 2VONA 2B9EA 1APSA 5IV3A 2RQCA 4KH5A 3UCUP 4ZVOB 1YJRA 2BMBA 1UPMB 2W2MP 3PW7A 1OIAA 3JYTB 4R25A 5DETA 1TFYA 2DNLA 3I56N 4DU8A 1L3SA 5DS7A 3I0RA 4BROA 3D1QA 2XYPB 5IXUA 4JRQA 3GE9A 2R42A 2VFUA 4DV5F 4O5BA 5AT1B 4ZVQB 3Q8RB 1VIXA 4AHVA 1OWXA 4GY2B 3FSIA 2VB6A 5BN9A 2OANA 3HHLD 3EO3A 5FD1A 3TO8A 2BGGA 2YX1A 1RT6A 1S9FA 2FBXA 2MKIA 2V8GA 3KK3A 5CZXA 3L7UA 5KGWA 2HBLA 3GSIA 3VAHA 2JC1A 2YTCA 4NZ7A 3CDBA 3CQYA 2NSBA 2AGQA 1XMBA 5BRFA 4I2PA 4CQ1A 1WB9A 1IM4A 3E66A 4F3MA 1N5YA 2IM0A 4CO1A 3OYCA 4FWPA 1UEKA 2ZITA 1YJWN 4PG6A 1JXVA 2AP6A 3O3GA 5IT9U 3CCTA 3THTA 4ID8A 4CGJA 3R6LB 2LDIA 5HP1B 1FXRA 5K14B 3CT9A 3MD1A 5F0WA 3DLEA 4H54A 2ZJPL 3LGMA 2F96A 3QGIA 4LFBJ 2FJBB 3D45A 3IGNA 3TX0A 2IAJA 3DOLA 5JVGQ 3NS5A 4B3TK 1JB0C 1NH7A 1GLJO 3CC7S 2IM3A 1RT1B 2EC2A 3OTOJ 1Q8KA 4AFFA 2UU9J 2CZVC 2P5OA 3TAFA 1VSDA 2DCLA 1RDRA 3CCJN 1OH6A 1U1PA 3TZXA 4LFBK 2ITMA 2OPQA 3POTA 1RCXB 2FLLA 1J5OB 4D3HA 2YJFA 3M4XA 2LXFA 4MIWA 4TQSA 2QZ8A 1NSAA 3OTOK 4LF8F 3O9QA 2Z2ZA 5MLCV 3N5BA 4FKXA 4DV1F 1YJNS 4FM2A 4L72B 4MKYA 3D0HE 3VZIA 2XYGB 3BGLA 4Y00A 2R2TA 1Z6RA 1U2VA 3P4IA 2HK3A 2ZZNA 3OYMA 4P10A 2BW2A 2IA6A 1S72N 3DLGB 4WBFA 3ID8A 2ZWPA 3ZNJ1 5ETLA 3C6UB 1JK9B 4L75A 1NGBA 1WSFA 3QAEA 4IH6A 3ENAA 1S0MA 2ZNYA 2X1AA 3MR6A 3EPGA 2AF6A 3NGTA 2OZMA 4ZVUB 2XO6A 2HPUA 5HATA 2E1PA 2Y0BB 4I6MA 4FXDA 1MSWD 1PJ7A 3N6NA 1URNA 5MAOA 4MFBB 2HKEA 2CPIA 1V6HA 4KHWA 1ZOTA 2P9IA 4HCCA 2P9EA 3BSAA 2P51A 1RUSA 4FS1A 3BGFA 2KZZA 3DXBA 1NJWA 1WD6A 1MWZA 5EX5A 2OKQA 2GQ2A 3O1LA 4DU7A 4DTMA 3QT5A 3KJFB 5KFUA 1BIZA 3W5XA 2A42A 3EZ5A 3IM9A 4F3QA 3CJKB 3MUVP 4MH8A 2ZGZA 2VG6A 5BREA 2OELA 3AOCA 2G8IA 2KT5A 1WDTA 2HHXA 4M3TA 1FTRA 3MX2A 4DUYK 4LBHA 3DC2A 1REVA 4DR5F 3D1HA 1HQ2A 4GC6A 4K4WA 1ASWA 1NNDA 4WE1A 2EFPA 1Q78A 4M5KA 4E7KA 2F7TA 4QOTA 1IUJA 4O0NA 1T8EA 4ZJLA 3PO5A 2B8QA 2JWKA 2LECA 2FBVA 4KHSA 1D8ZA 4GKKJ 1LW2A 1ZBUA 5FPNA 3MN9A 3DLRA 4M3WA 1JLFB 2ASOA 4ES1A 4OFZA 2XULA 1VLOA 5IT9O 1UZDA 4F7VA 1H2UX 4DR1K 2LCWA 1Q0NA 3P5TL 2O8DB 3SMPA 3GIKA 1RWWB 4FYWB 4WWSA 3S9HA 4LFAF 2PC6A 2I5JA 1YITS 4WF9L 1BQMB 4GKKK 2Q3SA 1F6TA 1SBRA 3VCDA 5J2PB 2V9WA 5HJYA 2F9WA 1JLGA 4DF4A 4FJ5A 1YKWA 1HFEL 4K5RA 2X3GA 3LP2A 2V9KA 2LQ9A 2DPNA 2QMUB 5BPMA 3QEXA 4FPIA 2MKHA 3BUZB 4CLUA 4I0WA 1WORA 4ZJOA 4GVEA 4LSLA 3S7RA 2E7WA 2E1ZA 3WNHA 3UE2A 3HKWA 5CABA 1WHVA 2QXLA 2ASMA 1JJCB 1Y4ZB 1RWOB 3CQ8A 4CJRA 4WYLA 1ZZNA 2DGQA 1KQFB 1ATNA 3VQQA 4AUKA 1VQPS 1JIHA 3Q0AA 2J9EA 1WTBA 4HHJA 5KI6A 3JB9k 3KUGA 4CI0B 2VU5A 3QATA 2UUAF 1RCHA 1M5HA 2HMIB 3I31A 4MKAA 4ES2A 1RT6B 3SPZA 1KQSR 2VZ9A 5AQSA 4FSVA 3QDKA 2MYFA 4QWBA 4K8RA 1H2TZ 1ZYQA 1BQNB 2MZJA 4CGIA 2EVZA 1RYRA 4I9LA 3OHAA 1KAZA 1C6VA 3VGMA 3L2RA 4K42A 1FRLA 4PKGA 2N82B 4I2PB 3L4IA 3FC9A 4NYZA 2NRRA 3D67A 2G0CA 1S3XA 3JSRA 4K50A 1HMVA 2BXJA 2WSFC 4DUZF 1HA1A 3MMCB 2CZ9A 1GX6A 5EHHA 2CJBA 2OPRA 1B70B 3N79A 1CJKA 3WUHA 2VC0A 2XHBA 4DV6J 3MWBA 1K0TA 1XWLA 4DTPA 2FC0A 1HW9A 2W9CA 5F8NA 4KV8B 3DOLB 4NO7A 1PIEA 4E7LA 3NGYA 1Z2LA 1X9MA 2CQHA 3O80A 4CJ7A 1N33J 1QTNB 1Q9YA 4HVJA 2RPIA 4H0OA 3JXUA 3J81j 2KG0A 4DUTA 4HL9A 4QPTA 4C0OC 2J0WA 2W42A 5CD4H 2F40A 3WX4A 5GADU 1S10A 1TUYA 4O8UA 1NSQA 5FROA 3WIUA 2AHOB 3KDNA 1XEZA 4NCGB 1NK8A 4ETXA 3R3TA 5F1XA 5JUMA 1IJEB 3R9LA 1KLMB 1N33K 2CIMA 4DV4F 4M7XA 2PIIA 3VA0A 3H59A 4DCHA 1ROFA 3FNNA 2CKWA 1Q5YA 5LXYA 2ZM6J 1X5OA 2GBZA 1PO6A 5ETQA 5KG6A 4CTAA 4O44A 4ZPWR 3SQGB 3DMJB 3PKMA 4FXVA 4JI5J 4L6V3 1NJZA 2MHNA 4DV7F 2QMXA 1WEZA 2HF3A 3HI0A 4BG8A 4ILRA 1I51B 4PXEA 1ZAXA 3G82A 3ATVA 4NLWA 3W7BA 1LXNA 1G1XA 1TELA 3B6OA 2XO7A 2ZM6K 5JVHQ 3T69A 1Y9OA 5AQMA 3Q2SC 1UJ4A 5DRKA 4ZP7A 3MMBA 3E1YA 4I6MB 3HFZB 3M2RB 4JI5K 3QJPA 2M4MA 5C12A 2ERRA 1CLFA 2G8KA 1N4LA 4E0DA 4BR0A 3FCHA 3KHGA 4FN5A 4BRNA 1SQGA 2GCFA 4GMJB 4DSIA 5I3UA 4ED2A 4KHPJ 2HLTA 3C65A 2ASPA 2AKWB 3KWGA 4CIGA 1GLEG 3MM6A 2G2OA 3DRXA 4DPOA 4ZP8A 4XTTA 3GE1A 1VISA 4TKTA 4J9KA 1VC5A 3VGSA 2OGUA 1VQMN 2KM8C 5KG3A 3PTWA 3F5TA 2WC9A 3R7SB 2VG6B 4CLSA 3CCRS 2Q31A 4O0JA 2H65B 1FXDA 3FZBA 2X51A 1W7AA 1GMUA 2ZH2A 3CPWR 4M5JA 4KHUA 3UO0A 4OI1A 4KHPK 4M5MA 2IVMA 2QLBB 2OTLN 1KVAA 1REVB 3G9CA 2D0PA 4HR2A 2F8TA 5GINA 2BDPA 1N6QB 2Y1RI 2W01A 4LF5J 2HBRB 1IR2A 2CPHA 4CO5A 4P6QA 1FNXH 4F4KA 3QEIA 1EKEA 1LOTB 1CLQA 3RZAA 4JI0F 4DSKA 1UFLA 1KVIA 3F44A 3AARA 3NFAA 5HMYA 4OI3A 4TLQA 2FJAB 4BRQA 1S1XA 1TL7A 1ZTWA 1UVIA 4FVMA 4LRAA 5E0OA 3M6VA 4KGXB 5A8RA 3MF5A 4LF6F 1YZ6A 5CD4A 3JTOA 2PY5A 2ATCB 2GC8A 4TU8A 1YTUA 2IDEA 2ZBIA 5AE1A 1HR0F 2VBXA 5KG5A 1VGYA 2DHGA 2UUWA 4K4YA 3UE5A 1X9WA 4YEAA 5M2UA 2NLWA 4PL7A 1JLGB 2BJ1A 3VWSA 2COLA 2LEPA 1J27A 3C19A 1AFIA 4USJC 4I4BA 3HSGA 5DDPC 3THWB 2XWYA 3PHTA 1VHXA 4NYOA 3Q8UA 4CEOA 2FHOB 4DMNA 1P27B 3CG7A 3AD7C 4CI6A 3OW2R 4HHUA 2RRBA 1TUUA 1JLBB 4BRDA 3CEDA 4DTXA 4DR2F 3UD4P 4KAZA 5C24B 6FDRA 1DHMA 1E6YA 1S72S 3OL6A 4DQIA 4J9LA 5BYSA 3DU6A 2OZSA 4H0YB 3BR8A 7FDRA 1TK5A 1KFSA 3OR2B 2FVQA 4BCAA 4L8RB 3NCPA 4WP9A 3NVKA 1RJJA 2MKJA 3LL3A 2RH3A 2FC9A 4V19J 3KZBA 4OHVA 3M9OB 1CQMA 3QSIA 2ZBCA 4GKJJ 1Y97A 3KLIA 1K8KA 2B4UA 1TVRB 1CJVA 4P9SA 3DXMB 3M6XA 2Z2MA 2RD5C 4DX6A 3PDNA 3KLEA 3P45B 4J9PA 1F9FA 2YKQA 3UDEA 3A8IA 2GUIA 3WC0A 3MHYA 4JS5A 1YI2S 1XR6A 4E3SA 4Z4IA 2YNFA 1E3MA 4GKJK 4LR9A 3ZX3A 2XLIA 1QAJA 5K5MA 1CJKB 2P9LB 2M0GB 1K44A 2HK2A 3BH6B 2P9CA 3MECA 2Q0RA 1SKUB 3KNGA 6FD1A 4DL7A 1RHJB 4JI1F 1QHTA 1X4AA 4ED6A 1NGDA 3CMES 5CCMA 2PBDA 3MI7X 3GL1A 4YDDB 1NK7A 4CVNE 2AMCB 1SJ4P 5CXTA 2RHSB 7FD1A 1DRZA 4B3RJ 1RILA 1HNIA 4AM7A 3VQ6A 1LWFA 4CYUB 4FF3A 1Q1KA 4IO9Q 4J91A 2ZH3A 4W5OA 3BSNA 2UZAA 1CVJA 2HNZB 1K8AO 4OZ0A 3OR1A 1ESVA 4ZTFA 3IKMA 1IBLJ 4MK8A 3CC2N 4FLZA 3WEEA 4ELUA 1TYQB 1YG0A 3DRRA 4OI4A 3VEZA 1QE1A 1X4GA 5J2QB 4Q2LA 4DQRA 4IQXA 3LO3A 4B3RK 1NAQA 1ZPWX 5HL7Q 2R7OA 3D68A 1BCOA 3LANA 2BQ3A 8RUCA 5EX0A 3OTCA 3VEWA 1LQ9A 4PXBA 3J7ZO 3N4WA 4CTAB 4A8OA 2ZUGA 3SSSA 2QN6B 1IBLK 4DJBA 2E29A 2B51A 3MN7A 1I1GA 1RXOB 1VRUA 2BKNA 1PGZA 4CHYA 3CJBA 1J5EF 3G4SN 2YKNB 4ECWA 1FRHA 4FJHA 1HPZA 5LXRA 4JYAJ 1XMQK 3DRPA 3HHDA 4CFBA 2WB4A 1D9DA 4KO0A 4HHHA 1KSPA 1M1KO 3QEWA 4C98A 2KTQA 3MMBB 1VQ9N 1SCJB 3BZQA 3BS9A 3TZYA 4WJBA 3ZSYA 2ZF5O 5DLFA 4JV0A 4CZMA 4B9QA 3TQ1A 5I3UB 1D8YA 2DB1A 2KKHA 5EOYA 4JYAK 2QJ3A 1M5OC 3K9KA 4DV2J 3Q2TC 3CJ7A 3VTHA 2J0QD 4F26A 2NYHA 2VCPA 2XMUA 1YX2A 1HNWJ 2OP5A 1DAXA 3E3XA 3DLKB 2DNOA 1HBNB 4IXCA 4ZVFA 1LW0A 5M2PA 3T1HJ 4URQU 3K8WA 1V3ZA 4G65A 3M9MB 4EBDA 1I3OB 1A5VA 1J6ZA 1AW0A 4KBIA 2B5JA 4DV2K 3K5OA 2EKNA 3VA3A 2NRZA 3EY1A 1WDDA 3HJVA 1HYZA 1R0BG 2GX9A 1HNWK 3IBWA 1A5WA 1S6PA 2FGOA 3NWGA 4I2QB 3V2UC 2B3TB 1AFJA 4FNHA 4N41A 3ISZA 3PIPQ 4M5GA 3T1HK 2VV5A 1VQ6N 1ZBLA 1FK9A 3GFZA 5FPEA 1S1XB 4DB3A 1U1OA 3MFHA 3ULEA 1SJQA 3C16A 4QYZJ 4NLCA 3L8BA 4OPKA 4BRFA 2E4LA 3HXMA 3HSZA 5T7BA 3EGNA 2KQ2A 4PG5A 4J2AA 2XSJB 1HBMA 2J6TA 4AHUA 1WOOA 4CFAA 4ECQA 5DGAA 1U48A 2W6KA 1TKZA 1YLXA 3OPKA 2R7VA 4OI2A 2PEHA 2AP1A 1NXIA 2VOOA 3KK2B 1AB8A 4FP9A 2E1AA 4V1Ak 1HI0P 1IBMJ 4BLGA 4CJWA 2KJVA 4QYZK 1YAGA 1NHKL 4IJNA 1RB0A 3JSYA 5IM0B 5CY4A 2QK9A 4ZJQA 4LRDA 4FJXA 4CEEA 1BC6A 3UD5A 3VGUA 1HJOA 1MROA 3H6EA 1N5VA 2OUGA 1S9GA 1IBMK 3WBZA 3BN7A 3VGVA 3D7SB 1D9AA 2B7BB 2HSEB 1ZM2A 2XEXA 1B99A 1X8DA 4OPHA 1T0TV 4ZTJA 4LIWA 3KD1E 2VL1A 5CHIA 3KTQA 1EJ7L 3K57A 5DG8A 4K7QA 4ZIWA 1R43A 3IG1A 1FRMA 2Z1JA 2HBKA 1U8WA 3RUBL 5CQGA 2E6MA 1WHWA 1FVSA 1Q8LA 4LFBF 1IN0A 2BJEA 2AU0A 4NYFA 5FPMA 3SQ4A 3KK7A 4FLVA 2P9KA 4DLGA 5HMWA 3MPWA 1N32J 2D0BA 1WLJA 1NB2A 4OYBA 5AR0A 4K8XA 3QB0A 3OTOF 2BQRA 4B3OB 3MFIA 3QEVA 3SFUA 2UU9F 1JX4A 3JSMA 1RAEB 3IWXA 1XIQA 1NRKA 5GADP 3KLEB 3CJ3A 4PXDA 2P9SA 1FA0A 3EX7B 4QJVA 3VAJA 3WHIA 3DDIA 1GMWD 4AYBD 5E5NA 4WU3A 3MOJB 4UZCA 1WHYA 3CWJA 1QSSA 1N32K 3H2VE 2YNFB 4OZ1A 2KRRA 3UDVA 1W2BR 3SBMA 4NA1A 2FVPA 4HLBA 5HLFB 3MECB 3LW5C 4WZMA 3QMQA 4X66J 3IMQJ 3D0GE 4DL3A 1RKIA 2DEJA 3U8XA 4HTLA 1VRTB 1OQ3A 4RBVA 3LH2S 1D1UA 3HZGA 2XMJA 4K0KJ 1SB6A 3UB5A 3G25A 1P6TA 1DBDA 2FQQB 3HSDA 1NOYA 4OJRA 3AO1A 1LWFB 3OFFA 1HQEA 3FDSA 4DL2A 3HP9A 2QWRA 2Q2RA 5LJWA 2ASDA 2Q3PA 2GV9A 1Z4UA 4X66K 4LMZA 4Y34A 4P52A 2J0SD 5IQ6A 2ILYA 1AYEA 3OYHA 1R8PA 4Y3CA 2QFJA 1RA6A 3MPVA 1E4GT 5MLCQ 1R27B 4K0KK 3M6GA 4NXMK 5CHCB 4Y2CA 4M7YA 2ZZMA 2WOMA 5EXWA 2QMWA 2RF2A 4K4UA 1XBWA 3KDOA 2UV8A 2HHVA 4KGZB 4JI3F 2EG2A 1PJ6A 4NWBA 4FBTA 1YGYA 1MWKA 3ZX2A 1QAXA 1RTZA 3VZHA 4EWTA 4ECUA 2D9PA 2YPZA 2UXBJ 4NEZA 4NXNJ 4CZJA 3SZ2A 3MXHP 4CO2A 5HSPA 3H98A 2O8EB 1VJWA 1WWHA 1FRXA 4OZ2A 4N7TA 1FD2A 3ZLJA 4CGGA 1HWJA 3NGZA 3VQ4A 3RRKA 2BJ8A 4DLEA 1RT2A 4PG7A 3M1FA 1E6VA 2HRYA 5KPTA 1S0OA 2XMKA 3A13A 3TP2A 1WC4A 2UXBK 3PLAA 5AQQA 5LMNK 5BRDA 4NXNK 3BZKA 2E5GA 5A2QY 3OD2A 3HF5A 1K73T 1VBKA 1EX4A 3BV8A 3HHLB 4GKKF 1BISA 2CQBA 2KO1A 3CC4S 1V4TA 5C0YA 3KIOA 2G2YA 4LRCA 3RBDA 2X78A 2A6AA 3K58A 4XDDA 2R7XA 4IR9A 4ICLA 5T7LA 3FSXA 3QZ8A 1WG4A 3SMZA 1XTZA 3GR1A 3WXKA 4PXCA 3TW0A 5E84A 3CF5L 5IV4A 4NLUA 2KT2A 1NB7A 4S0MA 1Q7YT 2FVSA 2BM1A 3ZSWA 1NGEA 3PFEA 1YBUA 1Y5NB 3UCGA 4CEFA 5M1QA 3GR0A 3W3DA 3MEGA 2V7ZA 2DY9A 4X4TA 1RTHB 3BSCA 1S5JA 1S6PB 4H03B 1Q9XA 4EK2A 3GOIA 5DLGA 4RW4A 1UEVA 4YNQA 1NWKA 2CPEA 1DTTA 4IO1A 3Q7BA 1N8RT 1FK9B 2PA8D 2M9KA 4NLYA 2ZZTA 2P2CB 4E8UA 4DWIA 1IJFB 1HBMB 2C2DA 4W98A 4PZVA 1X9SA 1C4AA 1ZETA 2CJAA 3NBPA 2CNOB 1HI8A 1PJ5A 1TKZB 4ECRA 1XERA 3D54A 4JS4A 4CD3A 3NHGA 3QBWA 4FCYA 3C7NA 1VQ8S 3G8TA 2AW0A 4Z4EA 1TK0A 1ICEB 3E01B 1UA1A 1VQKN 3BPSP 1U1MA 2I7NA 3IBCB 1KRPA 4M5DA 1N56A 5L9NA 3IR5B 4QIEA 3HULA 3DLLQ 3TR8A 3GCXP 2ILZA 3NCIA 4IRDA 3QINA 1OH7A 2MY8A 2MB0B 4C6AA 2GTDA 3EM1A 3U1MA 1H74A 3QNOA 5C2FA 3TI0A 1S9GB 3H2LA 1KTVA 1RGIA 1UL3A 2ZC3A 4UZBA 2J4RA 1RAAB 3HZ6A 1CBKA 2B4JA 2GGPA 4KPCA 2WB1D 3ZTRA 2YWEA 3D2FA 4IDKA 3GB0A 4YFUA 3AODA 3IG1B 4DV6F 4GV3A 2MPUA 2BEFA 5C2CA 4R0JA 3JTPA 4BQLA 3G4SS 1HNZJ 1VQLS 4ALZA 5AZIA 2MGZB 2O8FA 1R31A 1B7FA 1I6JA 5HRPA 1YWXA 5ADXH 2F4FA 3FFKB 4B9MA 5K8OA 3K5MA 3OY9A 1N34J 4IWVA 2GVDB 4ECXA 2WVDA 4F4YA 3TWZA 3JSMB 3PIOL 2MHEA 5B0FA 2GJ2A 2DXDA 5AQUA 1FWPA 1RT5A 1G99A 4H0VB 2J5AA 2CVIA 2P9SB 1HNZK 4IH5A 3UKRA 2AA4A 3Q22A 4W4MA 4CGDA 4HDHA 4JD2A 3MR3A 3UN3A 2QWNA 4DV0K 4N8NA 1T6DA 4ILHA 3WXLA 2OFGX 3I5CA 2ZE2A 1S12A 4CK3A 4Q2MA 4ZPBA 3M3ZA 1NDCA 3FCWA 1HLUA 1ZBTA 3DLLL 3TOQA 2ZM6F 4K4SA 1LAWA 1N88A 1Q18A 4CCHA 3TPQA 2PN6A 3WXJA 1XHZA 2PEBA 1FTCA 2WSCC 4RUBA 4JI5F 2AEMA 4J9UE 3C0BA 2KL8A 4JKCA 3J7Z5 3SSRA 3CPEA 4CH0S 4RLEA 2NRWA 1WF1A 2KT3A 3GJTB 2CQ2A 3GQCA 1JXBA 1H7WA 3I55N 3CCSN 1DKGD 5DQGA 3M2UA 4B3SF 1PG5B 3UQSA 2F9TA 2A1SA 1VQNN 3NF6A 3PACA 4FJMA 3KG4A 4K5SA 3W66A 4H5WA 3TABA 2KDOA 1WEXA 2X74A 2GMJA 1SQFA 3H4DA 3BN4A 4KHPF 1VC6A 1V4SA 3KWMA 4QW8A 3ZSQA 4Q8FA 4FWLA 2RILA 3QERA 2WUSA 2PO4A 3S41A 3G71N 5KT6A 4XK8C 4GVLA 2MKCA 2Z1GA 1CULA 1QDUB 5HBMA 2P9GA 4A8WA 4C23A 4LC9B 1HNVB 1KQGB 2UUBJ 4PKIA 3VEXA 4DFPA 4LR7A 2H1YA 5A0YA 1MMLA 2YWKA 3G0ZA 4OJ1A 1KDNA 4QOZB 3OSNA 1F2GA 1F2HA 3AVIA 4Q0BB 5KFFA 1F9HA 1VSIA 3KYLA 1FKPB 4DKWA 3V6KA 2F8EX 4CJEA 1F5AA 2HS3A 2CQ0A 5GMDA 3T5JA 3D7EO 1RT2B 1E6VB 4LF5F 3NAHA 1SC4B 4AL6A 2DCUB 4OLAA 3HT3A 2DGSA 4FNIA 4M3ZA 2HHQA 5ADXA 2UUBK 3M32B 4WQ5A 4HCBA 1I5OB 5C42B 4HUFA 4UQGA 1OVYA 4A8SA 1SKSA 3VQ7A 5T41A 4FJJA 3PEJA 3IRWP 2C3OA 1U1LA 4ZP9A 1U6ZA 3H90A 4KPYA 2ZNZA 4C8ZA 5GAHP 1I94J 3D6MB 3FZMA 3U3GA 3IBFB 1P1TA 1RZMA 4WCEL 3T3FA 1LFPA 2GJFA 1S6QA 1GTHA 3L2QA 1RAOA 3CETA 2ZOMA 4EAHD 4NMLA 1JLQA 2K1RB 2HF4A 1C1BB 3CCVS 3V9WA 4ILGB 2ZBQA 2O8BA 1DQ8A 1TU0B 2V2QA 4QR2A 1TGOA 4ZVHA 3FLCO 4AF1A 4X4PA 2I6WA 3RB6A 1HHQA 1I94K 2FBTA 3FMWA 4A5AA 2WAQD 4N76A 4DU3A 3VVUA 2C2OB 3DYAA 1NSPA 2VODA 4YOVA 2WBNA 3IRXB 1Z26A 4MLEA 4J2DA 2Y8YA 3LP0A 1DTTB 1UP1A 4FS2A 1EARA 3CM5A 1IWAA 3QGHA 4NOHA 3GTYX 2I2YA 4F25A 1T6CA 1DQ9A 2AJFE 4C3LA 1S99A 4CNYA 2FJVA 4U8VA 3I32A 2M8DB 2O5DA 5E3AA 3PR5B 3SMSA 3QIDA 3PEHA 1V5VA 2WZ1A 4O3NA 2OO4A 3W0LA 3U1LA 1W26A 1MU2B 4MO4A 5KFNA 2DT9A 2O4IA 4BRLA 1P1LA 2NYIA 3J7AP 2H48B 3T1AA 1FRJA 1YTYA 3C7NB 3BP8A 5KOXA 4EI2A 3V6HA 2RNEA 1M90O 2PZSA 1LWEA 4H4MA 5BR8J 4GKJF 4M5DB 3P3DA 4CJLA 3T5HA 5KAKA 1KWMA 4J9SA 1R0AB 1TL1A 2RS8A 3LF0A 1SH2A 4K4TA 1IKXA 5G4DA 1RAFB 4LF8K 5LJVA 1EKRA 5BPNA 2D5RA 4OLBA 4DV1K 2XS5A 1ACMB 3QO9A 3WNEA 1WC5A 3TRGA 1XC3A 4FJ7A 2ZGYA 5KRTA 5BR8K 1X3NA 4A46A 3SK3A 2HLUA 3D2FB 1ELOA 1X9JA 4R0EA 2CJ9A 1IG8A 4AXJA 3RSEB 4QR0A 2BRKA 3BPDA 1BY9A 2R7WA 5KPZA 2XHCA 3PSFA 2WSEC 4WKYA 3N4PA 3ILOA 3M9NB 2V8HA 2IVPA 4R8UB 1HBOB 4B3RF 4DX7A 3J80Y 3GCWP 1JL1A 3C3LA 3DI6A 1HYVA 1U02A 3CD0A 2DRBA 1FJCA 1L3VA 1V9OA 1R8CA 5KPRA 3T7ZA 4UOHA 1VK3A 3UKRB 4DR5J 4PWUA 1IBLF 1BA1A 1YBAA 4JD2B 4F3TA 4KSEB 5G0RB 4YS2A 5EUHA 4MK7A 2D1KA 3OYAA 3CCLS 3H45C 5AQGA 4C1NI 4F0HA 1VSEA 3M1VA 4JKFA 4M3UA 3GJRB 4F3OA 4CESA 1EP4A 1Y5LB 2KXFA 4DN9A 4LFCJ 2E5IA 1HYSB 4YY3J 3C46A 3L09A 3UN2A 1RU1A 4DR5K 5KFRA 1WI6A 3KLHB 5D0GA 3V6DA 4CK1A 1CS4A 3A12A 4N8OA 3DDNA 3OUYB 3OJSA 2QL7B 2J6UA 1YJ7A 4OYXA 1PSDA 1YT3A 2IPOB 2B9XA 4ZPVR 3VAMA 5D15A 1BA0A 3E51A 4FYDA 2FJDB 3UD3P 3Q8PB 4JYAF 1LFWA 2YX4A 3GPAA 4WFXA 3TZZA 4LFCK 4HTJA 2YBVA 2HRTA 3OYIA 4Z0UA 3KNAA 4CGFA 3V1RA 2MLXA 2CJKA 1Y64A 2YHWA 4ZPCA 3R7NB 1QS4A 1VI7A 2G0JA 2DRAA 1GOBA 1FNOA 3NAEA 1WOPA 3DKDA 1GFWB 4LFAK 2RQMA 2A2DA 4GO7X 2G8UA 2VKRA 3D9BA 3OS1A 4FPRA 5M2RA 1W0HA 2AD9A 3CNQP 3CMQA 3MAQA 3BBCA 2YQ3A 1HNWF 4LRFA 1XNQJ 2PFUA 2I38A 4FWOA 3D4JA 3O4WA 3MEEB 2BE7D 1RKJA 1OSCA 2BJ7A 1HBUB 3T1HF 2EKYA 3PW4A 1FERA 2WVBA 4IOAQ 3O3LA 3M5RA 1EETA 3U4LA 5FPDA 4FWRA 4IO8A 2FZGB 3EKSA 2GAGC 2Z0GA 1XNQK 5JJBA 2LU2A 4PG8A 1YHQN 4A8KA 1VQ7N 2HIYA 5AJ3J 2X1BA 3RMBA 3G86A 3NOCA 2P5GA 3GJQB 2ZBRA 1NO8A 1H0HB 4ZLLA 4BR2A 4KTZA 4I7FA 4Z7YA 4FJ9A 2QA4S 5GAEU 4LIRA 5KGXA 3THVA 1S6QB 2DYAA 1RT4B 5H9EJ 5ETVA 4IKAA 5AXKA 2ROGA 5KFVA 2W2QP 1RADB 2MQOA 3OTDA 3UKUB 4IJAA 2O8BB 4M63A 4C0BA 1R8HA 1SL1A 5AJ3K 4U96A 4LR8A 3WQUA 1EAYC 3ZC4A 1IBMF 3FZLA 4C8MA 2DNPA 3PCOB 3RB3A 2EBGA 1UETA 4AILC 4KAIA 4JK8A 2OI2A 1DEJA 5JMVA 2CWKA 5H9EK 3I8DA 2J8SA 2QTDA 3CDUA 5M1NA 1RNHA 4TYAA 3R3LA 1H38A 1N5TA 2HZVA 1W2IA 5F9NA 5D3GA 3OJUA 4A59A 1S49A 2XMVA 4DMZA 3T41A 3QT8A 4K41A 4EFAC 3FCVA 2ZBPA 2QWPA 2VWBA 2HFNA 3L6QA 5LSLA 2VA3A 2PSZA 3KLGA 4XPEA 2E7VA 4LSZB 4ZMMA 1JLAB 2YKAA 1OVQA 3BM7A 4Z94A 2Q36A 5K9FA 5ETMA 2YWWA 4TY8B 3TEHB 4BDZA 2OJ3A 1VCTA 3D3CJ 3FEXB 3FKBA 4DN0A 3MM7A 5KG2A 4WFBL 1Q81O 5B0GA 4LF7J 4KGMA 2RAQA 4WQ5C 3PV8A 4ZVRB 2J9DA 4E7IA 4OMFG 5AXMA 3WC2A 4H4KA 3MM9B 4CW7B 3AVBA 1WF2A 2GIRA 5KFXA 1G3OA 1N32F 3TA0A 2B4VA 1LWEB 1T95A 4RG8A 3TTFA 3PYGA 4DL4A 1GQEA 2U1AA 2KJWA 1TL1B 3BR9A 3ICLA 4F4WA 1RP5A 3AVLA 2HQGA 4LF7K 1RCOB 3FRZA 3ILJA 5J2MA 3CULA 2WK4A 4DV4K 4DQPA 1RDAA 1VQ5N 3QO9B 3W61A 2V67A 4CO4A 2V5HG 4ID5A 4KE5A 4JKHA 1R6VA 5ETKA 5D4LA 4CLWA 1P8ZA 1ZBFA 5F3TA 3PXGa 4PG4A 5IS2A 3ZT0A 5B0BA 5A6WA 1WOQA 1R0CB 1JNZB 2C3YA 3AXKA 3O3FA 1GOAA 4IOCL 2LQJA 4X66F 2YWGA 1S7HA 5LSOA 4I64A 3CD6S 2CQ4A 4B9LA 2HMPA 3H4BA 4K0KF 4B1WB 2CPFA 3GIIA 2IYIA 3VQ5A 2MMYA 2CXEA 2JWLA 2GFFA 2LVWA 4FLWA 4OJGA 3MR2A 2Z56B 1A0OB 1FJGJ 3IAM9 2PD1A 1X31C 2L41A 5I9EB 4WP3A 1DGKN 2P6TA 1SS6A 4KKOB 4FYVB 1KLNA 2EG1A 2HNDA 3B6PA 3M1VB 3X3UA 3AVMA 4X65J 5KFQA 4FOIA 1QTMA 3WT0A 1VBXA 3CJCA 3AJ1A 3FSYA 1F60B 2LA4A 1CS4B 4URSA 4QBUA 5BJRA 1HNXF 4GV9A 5ETPA 1VSLA 4RW7B 3L3UA 4FJKA 4NXNF 2MQLA 1CG2A 4NA3A 4BC7A 2PGCA 3MDFA 1PC5A 4NLSA 2BE2B 3IMXA 1TL5A 2FSKA 1RAGB 1UJ6A 2Y0SD 2JNJA 4WFZA 2FSJA 4FPBA 2DEIA 3H0PA 2G4BA 4KIAA 2V68A 4QAGA 3SI6A 2J76E 3PRVA 2KHDA 3RMCA 4BS2A 4O23A 3CCMN 1R59O 2VYPA 2MQNA 3ENVA 2QFIA 1O6XA 3EE3A 1NM2A 3SBGA 1NUEA 2R8HA 4Y2MA 5AZJA 1T3NA 2D0AA 4BDYA 5F9LA 1YJ9S 3VHQA 4KREA 3AOBA 4CHPA 2LQBA 3Q8SB 1H72C 5KFGA 3V9XA 4G1QB 1S76D 2V51B 2N7YA 3W2VB 2LXIA 3AA2A 5AQJA 2CVEA 2LEBA 1YVNA 5K8PA 1JJHA 1U09A 3QBXA 2QG9B 1HRHA 4G1IA 3FZHA 5A2QO 3CJAA 5IT4A 2HSTA 1OY9A 4RW6A 3SQ2A 2OSQA 3HD2A 4A5BA 2V50A 2VPYB 2DVIA 2IJFA 2PMZD 2UXDF 1RT3A 2B43A 4NL5A 3AD8C 3AY0A 1WKJA 4QIGA 3OXLA 2G1DA 4ZVTB 3PFOA 4DR2K 1CJTA 2ZD1A 3W2WB 5B08A 5HQ8A 1DARA 4OV6A 3HBTA 3ZCMA 1Y3JA 1RDWX 3VQTA 2X3DA 3H3OB 3OXGA 3DCAA 4M5NA 2G8HA 2X1FA 3PHEA 1UFWA 1RWVB 4PAAA 2YI1A 1ZBSA 1TKTA 2ZH5A 5DO2A 2AJQA 4MJKA 3D0PA 4JI8J 2EK1A 3ZO7A 5J1PA 1Q95G 2D0CA 2F9JA 1DJ0A 1QQCA 1X7VA 1SPBP 2XCAA 4WQ4A 1LWCB 3DRSA 1T7PA 1Q82O 2JX2A 3CFPA 3EXYA 3W65A 4DU4A 2BOPA 3V81A 2QWOA 1XK8A 3TSUA 4ZHRA 2RE2A 4WTYA 3K5PA 3I33A 3U3YA 1AA1B 4DFMA 1RISA 4IFVA 2MQ8A 4FYYB 3ZFVA 4X4QA 2C3MA 2OTJS 4G1PA 5GMKa 3H3NO 3HHLC 3R2DJ 4JI8K 2HEKA 1WC6A 3OXFA 3CDEA 1HWKA 4RU9A 3NS7B 1MNEA 5D3GB 3DHWC 1RTIB 1S77D 5KG0A 3HPGA 2IBKA 2RT3A 3CCQN 3M7VA 4BWMA 2F1FA 1NGJA 2BKPA 4F50A 3OYDA 2FZKB 2IC3A 4FZXC 2NXUA 1WKLA 3MX5A 5KT5A 4KHNA 3MM7B 2NZCA 4JI6F 2K3IA 2V8DA 4O3QA 1QAYA 5AQNA 4DPTA 1A9NB 3ITHB 3SNNA 4WXOA 3FFIA 3WXMB 3UVJB 5LJ5Y 3LPEA 2XGQA 3BREA 2W9BB 3CCUN 3FBCA 2A2CA 3EVOA 1OY8A 1FJEB 2IVYA 2P6SA 1N34F 1HQUB 1OJ4A 3OSPA 4ISEA 1RA7A 1RI7A 2KVIA 3R8EA 1WEYA 2E1YA 2HFOA 4A8YA 1JL2A 2D7SA 2JVOA 2VA2A 4OPJA 3P96A 5J2MB 1S1UA 2NREA 2FF3B 4BC2A 1J5EJ 2XM3A 4FPAA 3IGVA 2QIFA 3VALA 4BRHA 1RTDA 2D3UA 2L9DA 1S1TA 2DR9A 5JS1A 4WZQA 3QIPB 3W9IA 4PR6A 3TA1A 5DM7L 1NPRA 1TMMA 3T1YJ 2HFVA 3HYFA 3NWRA 3ZEUA 2RIJA 3LPTA 1RDCA 4ZKAA 3THXA 1J5EK 2CADA 2MY7A 5JMNA 1PAUB 2KN4A 2CDRB 2VBWA 4P7TA 3Q24A 1IKWB 2RDIA 1F0XA 2Z2LA 2AYMA 4JV5F 1GLLO 2N4CA 1B0TA 3CD5A 1FRIA 1U26A 4ECYA 3TQEA 3J7YU 2JZ5A 4CHZA 5CYQB 2V2KA 3WNFA 2POKA 2HZAA 3ADAC 5JS2A 2J0XA 3KMSA 3NMAA 2DNKA 1UEUA 3TNVA 1VSMA 4HACA 1B92A 3L2UA 3GV7B 4TN2A 2NLXA 1FT8A 2NPIA 4YOYA 5DZ6A 5C25B 1JMTA 4ZPAA 4TNOA 2GWKA 1ZPVA 2OH2A 1EWQA 1Y10A 1UKUA 3MM8A 1FKOB 1JJ4A 4B08A 4QZVB 1WC0A 2OPPB 3P49B 3VQSA 1VS3A 2HNDB 4K8ZA 1NBWA 2DNQA 4KH1B 1MW7A 2HNYB 4MO5A 3WX8A 2W8LA 4JKAA 3R5DA 4DR3J 2EW9A 1WHXA 5L38A 1XNRJ 4NLQA 2E8AA 1Q86O 3R2CJ 1WSIA 2GIQA 2UVWA 4JHDB 2UUBF 1GEHA 2F3JA 4RJVA 4CEZA 2YNHA 2NXEA 5D4PA 3SFGA 2OPSA 1CEZA 4X64J 4OX9J 2MEWA 4QIVA 3BDPA 3NS6A 2CQIA 2HRUA 3OVSA 2DTJA 3LAKA 4YB7A 4A8MP 1FFGB 4RL1A 2FHKA 2LQ5A 2E5LJ 1NKCA 4BVOA 3ZTOA 3BSOA 4ZPDA 1XNRK 4Z4FA 3KK1A 1NJXA 2E5JA 1J53A 2C2MB 1NGCA 3OL9A 4LY7A 4WYBA 1NPKA 1Q16B 3GLJA 4OYOA 1H1VA 5LSRA 4RO0A 4OKKA 4X64K 5FIIA 3DM2B 3ET6B 2OEKA 2RKIA 3P31A 2K3KA 4IG0B 1UTAA 1C0UB 1JKHA 5BR9A 1QJHA 3TVYA 3LPUA 3J80U 2E5LK 4NEYA 4U67L 1WAJA 1I94F 2YHXA 1DLOA 3E2EA 5KFTA 1RWPB 2ZHOA 4L74A 3TAEA 5CYMB 2IHR1 2QEXN 4FLYA 2KHOA 1ZH5A 2CQ1A 5AQIA 4M3XA 2IYGA 4W90B 1KR4A 1S79A 2MLZA 2DHXA 2CGKA 3OHBA 5AQPA 5CZVA 5BYQA 5EWEA 1UA0A 5DK5A 4CF9A 4RW6B 4C11A 3EE8A 4CBWA 1NHUA 3DXKB 2GV1A 2DIVA 3CQXA 3NG8A 4PPDA 1FF2A 2QA4G 4QWDA 4F9OA 3M8QA 3L95X 4FWQA 2ZD1B 1CQNA 2B7CB 2B4PA 4B02A 2GHWA 5CAAA 2WBRA 4KHYA 4GC7A 4G6VB 5EX3A 3A0IX 2CNLB 1XQSC 1OPZA 2I1RA 3I5BA 2W7PA 1YIJN 2AGOA 1VQ4S 1FVQA 1UWBA 3BKTA 3VAGA 1TKTB 4GVBB 2R7TA 3CMAN 4USKA 3K89A 2H5EA 3CDAA 2CNNB 1OYDA 5GAGP 4I6WA 1C0MA 4WFNQ 1S1VB 1VQOS 1UAWA 2AGPA 2X7IA 4OI6A 3CCEN 2UU9K 4JI7F 4QWEA 4ITSA 4XO0A 5E2QA 2ZWOA 4FZYA 2UVRA 2BA9A 1T05B 1G4CA 1K1QA 1SC1B 4NASA 4R5PA 1NPPA 1B64A 5BR8F 3VESA 3H40A 3H42A 1WKKA 5FDLA 5C2GA 5A8KB 1K8AT 3R97A 3LGNA 2ZH4A 1ZTTA 4ED8A 3ENHA 2GVZA 2BANA 3DWLA 5J2NB 3OVAA 2YX7A 1Z25A 1BQXA 1NMDA 4C8KA 4LSNB 2AJ4A 4HDGA 3ALYA 4NRTA 5KFIA 4O0IA 2XS2A 1H73A 3GZ7A 3Q23A 3IA0A 3EGZA 2V63A 3J7ZT 1C1CB 3CERA 5JVGL 4FLXA 3IAS9 2HURA 1IR1A 4YP3A 4L76A 3L2VA 2UUTA 1NMEB 3DU5A 3NGIA 2P1JA 1ASVA 4U7BA 3TUPA 4PKDB 3QLHA 3MUMP 3NH2A 1ASUA 2B56A 3M2VB 2PFFB 4NLOA 4QWCA 4U8YA 1KEKA 5D0RA 4DPUA 4BR7A 4JI3J 3A5LC 1RHKB 2W6LA 4OKEA 4A62A 3S8SA 4JK9A 3VQAA 1M1KT 3W8GA 1QUVA 2EWSA 1NK9A 2ZUAA 3CFRA 3G6EN 3OBYA 2GHVC 2DISA 2KG1A 4WQ4C 3GIRA 4HT7A 4FJ8A 4QWAA 3CYMA 3AB4B 4JI2J 1MN9A 4BWJA 2DPIA 4IEIA 4CJTA 1J9AA 1C0TB 2G9OA 1TV6A 4JI3K 5GVQA 1NGGA 2NSCA 3GG4A 1SIWB 4U7UD 5HROA 4BE2A 1CXUA 4EO6A 4Q8EA 5M1OA 5J1EB 3THYB 4DDFA 4CLYA 3J80O 3Q89A 1FHTA 1NSKL 1DTQB 3ZEUB 3MUTP 1AUDA 1U0HA 4LFCF 4JI2K 4YY3F 1SKRA 1RQ0A 1IH7A 4EIAA 4OO1J 3QRRA 1HKCA 2OIHA 3LDOA 3HPOA 3MAHA 4H8KA 3MCNA 2P9UA 1X4CA 3S1TA 4O8KA 1AXQA 4P74A 3MXMA 1VSJA 2NXJA 1JNRB 3SDEB 5AQXA 4BC4A 1JLCB 2RHQB 3BBFA 3NEKA 4Q43A 1YK9A 2YVSA 4M45A 3BQ0A 3V9SA 1DT9A 4B1UB 1V5IB 5KFWA 2DY4A 3I0SA 2HHTA 4DR4J 3ISND 2J7UA 3FUYA 2QX0A 3GJSB 3EWGA 3UWTA 1FDDA 1YZ7A 2AT1B 3O8MA 3DOMA 5E3QA 2H5IB 3KG1A 4PWDA 3IO1A 3US5A 2R2RA 2Q6CA 2DD8S 1Y7PA 1QSLA 1OY6A 1XMOJ 2KFNA 3KHLA 4PRFA 4DBQA 2HW3A 1KQSM 3I0RB 2FTRA 1XNQF 3DFEA 2B6AA 4DR4K 5D8HB