1S9GA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r120394.
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
543
structure length
543
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 141
structure length 543
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s9gA05
1HQUA 3C95A 3FFIB 3ICLA 3S3NA 1TGOA 3V9ZA 2AQ4A 3TAMB 3V6DA 2C2DA 2ILYA 1EX4A 3OYDA 1EETA 4NLRA 4RW8A 4JRQA 4ZVGA 1CXQA 3ZT3A 3HP6A 2DY4A 1JLEA 3GV5B 1LWFA 4KV8B 1TP7A 4EO6A 1BQNB 4JLHA 2BGGA 1B9DA 1RBTA 4FLWA 1X9MA 1D8YA 2AX1A 2JGUA 2IJNA 2Z1IA 2ZQBA 4N5SA 2P1JA 4ZVEA 1S1UA 4ELTA 3KKSA 1RT1B 3UIQA 1HNVA 3OS0A 2HNYA 3CQ8A 4OKEA 4F3OA 5F8HA 3BQ2A 2BQUA 3G0ZA 4QWEA 1D0EA 2CKWA 4NLYA 4QWBA 3ITHB 3KK2B 3RR8A 2WOMB 5KFLA 3CVKA 1HPZB 3H2LA 4WFYA 1WLJA 4CHNA 4IDKB 4AHTA 4QOZB 2I1RA 4CJVA 4B9UA 4IRCA 3IRXB 3AVIA 1FKOB 3OYFA 2AJQA 3LP3A 2JC1A 4Z4GA 5L1IA 3NCIA 3QETA 2WONB 1SH2A 4ZPBA 4RW9B 5CZ1A 1QSYA 1YT3A 3K5MA 1LW2B 4O55A 4M3XA 3RBEA 4DU4A 1WSIA 4WXOA 2B6AB 4R5PA 3QYYA 2IM0A 4DSFA 3T1AA 3NGYA 3SUPA 4GW6A 3H40A 3BSNA 2IJFA 3L3UA 1KFSA 2DFHA 3LPUA 1IKXB 5KFHA 1J54A 1FK9A 3KK3B 2IGIA 4FZZA 1S1VB 2XCPA 4KB7A 1O1WA 2UVRA 1QUVA 4RW7B 3GQCA 1RDAA 2ASDA 2FLNA 4DSKA 1RYRA 3I5CA 2YHBA 3IAYA 2P51A 3T5HA 3WNEA 4Q8FA 4NYNA 3C94A 4IKFA 3ASMA 4CF1A 3V6KA 2QKBA 4YR2A 3Q8RB 3DRPA 2X6NA 4XPCA 1K1QA 4DMNA 4NRUA 1TVRB 1IM4A 1HYSA 3IGNA 3V1QA 3DRRA 1SH0A 1SUQB 5HBMB 3ZSYA 4Y3CA 1TL1A 3QLHA 5KFVA 4KHQA 4FJ8A 3OJUA 4F3TA 4DG1A 1JLBB 4OGCA 1S0OA 2FBVA 3AVLA 4R8UB 1RTHA 3V1OA 4CHZA 4Q0BB 4O44A 4YR0A 1KTQA 3NF6A 1C1CB 4GVMA 3AO5A 4URGA 1ASUA 1I6JA 5J1EB 4O3OA 1TL3B 1QS4A 4E1NA 4DU3A 4IR9A 1IKWA 4E7LA 3BREA 1QE1A 4W5RA 1IKYA 1NK7A 3KLVA 4HCCA 4I2PB 4F4WA 2WB4A 3RB4A 2HHVA 5J2MB 5SZTA 4IG3B 1TKTB 4Y2AA 4ED0A 2ILZA 4NLWA 3U6FA 1S48A 1J5OA 3LP1A 1RDRA 3NGZA 4CEZA 3S3OA 4ZMMA 1S1WB 4WFXA 2XY6A 3DRSB 4ID1A 3H4BA 5DG9A 3CJ5A 1NK4A 3PW5A 1JLQA 5KG3A 3LDSA 5KFZA 1DLOB 1YTAA 3SQ1A 4FJGA 4H8KA 1UWBA 1T7PA 2XY7A 4H4MB 3HPOA 5KG0A 4BDZA 4K50A 2AU0A 2R8GA 4FJHA 3PR5B 1KLMA 2O5DA 3IN5A 2OPRA 3PX0A 1RTDA 4CK1A 4KTQA 4R0EA 4FJKA 3I0SA 2E6LA 1RTJA 1VK0A 4DTMA 2WK4A 3IG1B 3LP2A 2ATQA 4O4RA 1S1TB 4B3OA 4AH9A 4DF4A 4U7CA 4J9LA 2G8WA 4U6PA 1REVB 4RG8A 4OPJA 4KO0A 4J9QA 3OYMA 1SL0A 4M3YA 4M94A 5I3UA 1NKEA 4FJJA 1N5YB 3QEVA 4M3WA 4LD0A 4HYKA 3AVHA 1S6QA 3RWUA 1DTTB 2QV6A 5DG8A 5KFGA 1RDDA 3E51A 3SI6A 1LWFB 5FDLA 4NZ0A 4HCBA 1N48A 3I0RA 4EEYA 4FCYA 4RZRA 2IM3A 4CEBA 2KZZA 2WHOA 4DTXA 1L3SA 3NAIA 3RMAA 2X6SA 1ASWA 1VSJA 3V81A 2J6TA 1BIZA 3SNNA 2R2TA 2HNYB 4IFYA 4K8ZA 4B8CA 3PW2A 2IDOA 1JLGA 1Q9YA 2W9BA 1U45A 5C42A 2IC3B 3PJXA 2OPQA 1VSIA 1A5XA 1RBVA 3AVNA 5KFFA 1ITGA 3VQ4A 1S1XB 1U47A 4LY7A 4NLGA 3OSPA 2BQ3A 1XWLA 4JV0A 4Q44A 3RMCA 2W9CA 5HP1A 5KFQA 5KFEA 1C1BB 3K59A 2HNZB 4DSLA 4CEOA 1SKWA 1TK8A 5D3GB 2YNFA 3SUOA 4NCAA 3HO1A 1BCMA 1T94A 5KGWA 4M3ZA 4MK7A 4QPXA 3KLFB 4K4UA 3KLGA 2HWHA 4C8LA 2P5GA 3NAHA 3MR6A 5KT3A 2JEJA 4NCGB 4KTZA 4RUAA 3SQ4A 3O4NA 1TKDA 5KG7A 4B9VA 3UPFA 3OL8A 3OL9A 5L1KA 5I42A 4PWDA 3PVXA 5J2QB 2D0AA 3PR4A 4URSA 1ZBFA 3MR2A 5KFNA 2Q3SA 3TR8A 3NF8A 1CLQA 3RMDA 3C6TA 1XR5A 2HAIA 1CZ9A 5KI6A 3LZJA 1VRUA 2R8IA 2B4JA 1W25A 4N41A 3T5LA 3H98A 4LQ9A 4CGIA 4NLDA 1JIHA 3VQAA 4KHUA 4FW1A 4J9MA 4TXSA 1XC9A 1HYSB 4WZQA 4CF9A 4CK3A 2YNIA 3KLIA 4ED3A 3PW4A 5FRNA 1N6QA 3AA2A 3A2FA 4O5BA 5F8IA 5DQHA 4DG1B 3HXMA 3AVKA 3ZSRA 2FVPA 4FJXA 1JLAA 1ZTWA 2RKIA 4J9OA 3CO9A 4WE1B 1BISA 1SKSA 2XY5A 3KK1A 3LPTA 3DM2A 3OSNA 2B5JA 4K4XA 4LH5A 3QGHA 1QSSA 4O0JA 2IM2A 1RYSA 3VQ9A 2XGQA 4ECXA 5KFIA 1JL2A 1QE1B 4F50A 4CECA 1ZBHA 2GBZA 2FC0A 3AVCA 4CEEA 5F8JA 4ZPDA 1C0UB 1QSLA 4ED6A 3MR3A 2ETJA 3L8BA 4CJLA 4NLVA 4AHVA 1J5OB 3NH0A 4FBTA 5CYQA 1LW0B 1TK0A 4OVLA 1RT7A 1NHVA 1JLQB 4KHMA 4CJ4A 2VG5A 1LWCB 5L1LA 3T5KA 5KFBA 4J9PA 4YP3A 3MF5A 2XI3A 1UWBB 3QIPA 4O3PA 1NJXA 3OYAA 2PY5A 4MKAA 3DOLB 2DFEA 3M9NB 4W5QA 2J6UA 1XHXA 4NLXA 4H54A 1FXXA 3AA3A 3VA0A 1BGXT 4Z4HA 3G6VA 3D45A 3SJJA 3KIOA 4FVMA 5K14B 3ZSXA 4CJWA 4OPKA 4FZXC 1WNSA 1X9SA 3SPZA 3I0SB 4Q43A 3SQ0A 1S9GB 4CGJA 2OPSB 4O4GB 3EYZA 4M42A 3LP2B 2F8SA 4DEZA 3CWJA 3SI8A 4MQ3A 4FM2A 1RDCA 4IG0A 4Y1CA 1SH3A 3LP0A 2JLEA 2FBYA 3B6OA 1X9WA 3MEDA 4PUOB 5I3UB 2VG6A 1TKZB 5HROA 4CF2A 3DLEB 3BSCA 1S6QB 3CDUA 1QQCA 3L2UA 1NNDA 2W9AA 4C8KA 4EBEA 4AHCA 5FDLB 3PHEA 2Y1IA 1RTIA 3I0RB 1Y97A 4KHSA 2RF2A 1DTQA 1SV5A 4MFBA 5C25A 4DU1A 1MU2B 2D3ZA 5DQGA 3K5NA 5F8MA 3CG7A 3L2WA 4FZYA 4CIEA 1LWEB 3HPHA 3H5UA 3K58A 1RT3A 3I5AA 3SPYA 3VQCA 1VSHA 4MIAA 2YKNA 3KLEA 1S6PA 4CFAA 2ZD1A 5JUMA 1L3UA 3RMBA 4QWDA 3OYEA 1HYVA 2ALZA 1JLGB 3EZ5A 3M8PB 2HMIA 5DLGA 1G15A 3DLKA 2W9BB 4I7FB 1ZTTA 5EWFA 2F8TA 4W5TA 4I2QA 4BWJA 3ZT0A 4AHSA 4K4YA 2YNHA 3N6MA 1KHVA 5HRNA 4CJKA 3KHHA 3PZPA 3PX6A 1S49A 3DOKA 2ZE2A 4E7HA 3I8DA 5KG4A 2W7PA 3ALYA 2HB5A 3TVKA 4TY8A 1NHUA 2ASLA 3KD1E 2X78A 2Z1JA 4W5NA 2EX3A 2DPIA 5EU7A 5CYMB 4DL6A 3M8QB 4NCBA 1WSEA 1KCFA 4IOBA 2OA8A 3KD5E 4K4VA 1GX5A 3QEXA 2RDJA 3ZSQA 4K4ZA 1TKXA 1IO2A 4L8RB 4CJTA 1NKBA 1WSFA 2XC9A 3LZIA 4ZP7A 4DTOA 4ECYA 4AILC 5KG6A 2ASJA 3I5BA 2RN2A 3NKYA 3AA5X 1ZBLA 3S9HA 4WYWA 4LSLB 2FBXA 4XIUA 1VSDA 1RDBA 1RA7A 3PO5A 4IRDA 2W7OA 3DI6B 5F9LA 2AGQA 3SCXA 4B9LA 4Y34A 4XPEA 3OYNA 3DLGA 3E01A 1RT5B 2YKMA 4ICLB 4G1QA 4EBCA 2Y1JA 2IOCA 1TV6B 4UQGA 1RBSA 3MFHA 1GX6A 2YV0X 3OS1A 3PX4A 4C8OA 2R8HA 5KG5A 3CM5A 3V9SA 2E9ZA 4KB1A 3ZSVA 4CHOA 3OS2A 4PQUB 4MK8A 1CSJA 1RT6A 1S9EA 4IRKA 1BQMA 3SFGA 4ED7A 2YHAA 3QEWA 2EC0A 4IFVA 2BANA 1L3VA 3KMSA 4ELVA 3PUFA 4DL5A 4J9SA 4KHWA 3K5LA 4B9TA 5HLFA 5J2PB 3ZCMA 3RAQA 1BHLA 3PW0A 5KFMA 3HVAA 4BWMA 3KK1B 3U3GA 2XWYA 3SFUA 2OZSA 3MXMA 3OYLA 3HT3A 2XHBA 4ECZA 4KPYA 4ECUA 2AGOA 5HRPA 3OYIA 2IAJA 2X74A 1NJWA 2HW3A 5KG1A 2HHTA 5FRMA 4KHRA 2BDPA 3AO3A 4NRTA 1T8EA 4F4YA 4CFBA 1KFDA 2PYJA 4DTRA 2YNGB 3KHLA 4F8RA 3H59A 1JLCA 1QAIA 1ZBIA 4F2SA 4MK9A 1KRPA 2UVUA 1VRTB 3SV4A 2WTFA 4DF8A 3G6XA 2D3UA 3KMQA 1BI4B 5DG7A 3QIPB 4O3QA 4HHTA 3ZSWA 5KT2A 4DQPA 2BRLA 4FJNA 2KZMA 1UA1A 2HHWA 4O3RA 4FJ7A 3Q8SB 1RILA 3UR0A 1FKPA 3IS9B 4TQRA 4QAGA 4MIBA 3KJVA 1L5UA 4OLAA 4HKQA 1C2PA 2OH2A 4LSNA 4ECWA 3FSIA 2OYQA 4YQWA 4E19A 2CJQA 2NUBA 3BSAA 2JC0A 3QEIA 1D9DA 3WNFA 4FJMA 3F73A 2PYLA 1RT4B 1HQEA 1U09A 1RT2A 1R0AA 3HHKA 3EPIA 1T03A 2VG6B 2V4RA 5HROB 3C6UA 5F9NA 3NH2A 4Z4IA 4J9KA 5L1JA 2F96A 2A1RA 2G8KA 4KBIA 3CJ2A 4DSEA 3H5YA 1DTQB 4ID5B 3FQKA 1SV5B 3M8RA 4F4KA 2VA2A 3HVRA 3MEGB 1S97A 4Z4EA 4QW8A 1T3NA 2R8JA 4LH4A 3HVTB 1RT3B 3M9OB 1LAVA 1JKHA 4QWAA 3V4IB 4EYHB 4CJUA 2GUIA 2KW4A 3OY9A 2YKNB 3KLEB 1S6PB 4G3IA 4NLUA 4ZHRA 4WFZA 4ECTA 1GOCA 4JS5A 5DLFA 4CJSA 4J2DA 3OYCA 3JYTB 1HQUB 4CFCA 3VQEA 1L3TA 2VA3A 1CXUA 3NBPA 3V6DB 2XRIA 3RBDA 1D5AA 1K1SA 3V1RA 4M3RA 1EETB 4RW8B 4GMJB 4KFBA 5J2NA 2C2EA 3DMJA 5EUHA 4EZ6A 4FJIA 1JLEB 3F9KA 3DOKB 2ZE2B 2FVSA 1WN7A 3H08A 4DL2A 4J2BA 4FLVA 3QGIA 1N56A 5C24A 2VWKA 4C8MA 3GIMA 2G8UA 4ECVA 1EP4A 3OYHA 4ECQA 3JSMA 5JS2A 4ZVFA 3OHAA 1VSFA 4FJ9A 3QIDA 3GV7B 3AVJA 1S1UB 2I5JA 4KSEB 1HNVB 1QHTA 5KRTA 3LALA 5KFPA 4ZP8A 5KTQA 4FS2A 5KG2A 4FJLA 1I3AA 3L2RA 1KLNA 3WNHA 2B43A 2DPJA 2BE2A 3NH1A 4DQQA 4NYZA 3KHGA 1C0TA 5E41A 3PO4A 2C28A 3MECA 1J53A 4TLRA 4DLGA 3Q8PB 4RW6A 3Q8QB 3E01B 2W8LA 1TAQA 5DK5A 5KFJA 4CJEA 3TAMA 3MXJA 4ZVHA 1UA0A 4CEFA 1HNIA 4EZ9A 3MR5A 3RB6A 2JEFA 4R5PB 3LWLA 4ECRA 1ZETA 4KV8A 1Q8IA 4WXWA 2HHQA 2F8EX 1F21A 4CJ3A 2XY8A 1JXBA 1FK9B 3FQLA 3HL8A 3CYMA 4W5OA 3D0PA 2FVRA 4OL8A 1RT1A 4Z0UA 3MXIA 3QZ8A 2R8KA 5KFKA 2R7YA 3OLBA 4KRFA 1LV5A 1JXLA 2LSNA 3P83D 4FLUA 4N76A 2AWZA 4J9NA 3ITHA 2RDIA 2OPPA 3KK2A 2WOMA 1XHZA 3NGDA 4E1MA 1HPZA 4MH8A 3DRPB 4BDPA 4IDKA 3BQ1A 3V9UA 3OHBA 2D5RA 3EZUA 3V6JA 4CIFA 1FKOA 3CDWA 3DRRB 4K4WA 4RW4A 3OJSA 4RU9A 2BR0A 4ZPCA 5KFAA 3LAKA 1TL1B 3QLHB 4YMEA 4CEDA 5EDWA 1KVAA 1ZBUA 4KTWA 4RW9A 2AX0A 4B8AB 3KOAA 3NDKA 1LW2A 1W0HA 3AVMA 1K6YA 2V4QA 2GC8A 3CJ4A 3PY8A 3DYAA 1RTHB 3BJYA 1Q9XA 4CK2A 3N6NA 1S0NA 4OJRA 1IKXA 4O44B 3KK3A 4ELUA 4CF8A 3CDEA 1S0MA 1S1VA 2IA6A 1SL1A 1YVUA 4LSNB 4RW7A 4GC7A 4H4OA 1IKWB 1BCOA 1IKYB 4K4SA 4RNNA 2XO7A 2XGPA 3OL6A 3MAQA 2FJWA 1A5VA 4URQU 3LP1B 3GILA 1KVBA 1TVRA 5KFXA 2KFNA 5EWEA 4CJFA 4KHYA 4B9SA 3SQ2A 4JV1A 3VA3A 3H4DA 2D0CA 4OGEA 1SUQA 1OS5A 4FK4A 3EY1A 4DL3A 2QKKA 5HBMA 3LWMA 3V6HA 2V9WA 3SV3A 2XI2A 2IBKA 1KLMB 4KE5A 3ZSOA 2OPRB 4N56A 1RTDB 1JLBA 2UVWA 4CEQA 4ZHRB 4NLPA 2QE5A 1RTJB 3VQ7A 2W8KA 4R8UA 5HRSA 1S10A 4NLOA 4EP5A 4B3OB 5KFYA 4Q0BA 2G8FA 3NL0A 1C1CA 1CZBA 4KO0B 3DMJB 1TL3A 4RNFA 5JXSA 1JX4A 4DTSA 1I39A 3HJFA 4I9QA 3VQ8A 3QO9A 2FLLA 4B08A 4CGDA 4I2PA 2WRMA 1N4LA 4CFDA 5J2MA 3VN5A 4IG3A 1TKTA 2UUTA 3L3VA 3TWHA 4RUCA 3TI0A 4DSIA 4DS5A 3RRHA 3DRSA 4CJRA 3MTKA 4FK2A 3V81B 3NAEA 4IR1A 4YFUA 4K8XA 1DLOA 4IFYB 1VSEA 1IKVA 3KKRA 2QK9A 2J6SA 3SUQA 4BACA 4ZPAA 5C42B 4J9RA 3FRZA 2OPQB 4DSJA 4I9LA 4CEAA 1C0TB 3CJ3A 4K4TA 3MECB 5DGBA 3UDLA 5KT4A 2W9CB 5HP1B 1EXQA 2RPIA 3IG1A 4CGFA 4KHNA 1S1TA 1REVA 2YNFB 3CJ0A 4TSXA 4M95A 5HRRA 1HNIB 3KLGB 3PJWA 3QIOA 1N5YA 4ZP9A 5F8GA 4XO0A 1D9FA 1DTTA 4MKBA 5T14A 4FM1A 5DQIA 3VQ6A 4GC6A 2VWJA 4CF0A 3M8SA 3NMAA 5F8LA 5I42B 4PWDB 4ED2A 3GIKA 4EBDA 3DLBA 3G86A 5T7BA 2G8HA 3RB3A 1MMLA 2FVQA 2UUWA 4Y1DA 3C6TB 1HMVA 5KT6A 1VRUB 4CIGA 4TYAA 2OPPB 4CJ5A 2IC3A 3IGVA 4HUEA 3TANA 4KI6A 1RBRA 1S1XA 4KAIA 3ISND 4OKJA 3RTVA 4DFKA 4FBUA 4LQ3A 1C1BA 2HNZA 4RW4B 3MFIA 5KT5A 2YNIB 1HYZA 4IBNA 5D3GA 1BL3A 3KLIB 2PZSA 3KLFA 1N6QB 3TAFA 4M3TA 4NCGA 4F2RA 1C0MA 3NF7A 4QWCA 3BGRA 1JLAB 2RKIB 3FDSA 1C1AA 3O4QA 3DYAB 3AVFA 1NK6A 3AO4A 4J2AA 3DM2B 3TAGA 2B5JB 4JRPA 5J2QA 3VQQA 2D7SA 3QINA 4CHQA 3VQDA 4C8NA 4H4OB 3NF9A 1T05A 3PW7A 5KRSA 2P5OA 1VSMA 4IH6A 3CM6A 4IKAA 2ATLA 4TYBA 3N6LA 1RBUA 3QNOA 5KGXA 1NK0A 3UQSA 4HUFA 3ZT4A 3BR9A 5CYQB 1RT7B 3NGIA 4DTNA 1KVCA 2VG5B 3AA4A 3ZT1A 1XI1A 3MEEA 1S4FA 3VQPA 3T5JA 3P5JA 4JS4A 4YNQA 2Z1HA 1WAJA 1J9AA 1UAXA 1X1PA 2HVHA 3SYZA 4KB0A 4CCHA 2VG7A 2IM1A 4CE9A 3AVBA 3K2PA 3LANA 4WE1A 3THVA 4NLQA 1S5JA 4IG0B 3LP0B 4ZP6A 1U48A 3MEDB 5EWGA 2HHUA 3OL7A 2Z1GA 1JLFA 3P1GA 4RNOA 3QO9B 4CERA 3K57A 1RTIB 1XR6A 3D5MA 1SL2A 4N47A 2RF2B 1C0UA 4MFBB 5C25B 1Z25A 5KFOA 4HUGA 4EP4A 1NJYA 4X2BA 2BRKA 3QNNA 2G8VA 3GYNA 1RA6A 2A1SA 1B92A 4FLZA 1LW0A 3TAPA 3ULDA 3TAEA 4RNMA 3CFPA 1LWCA 2ZD1B 4DTJA 1IKVB 3K5OA 2E4LA 5SWMA 3GIIA 1Z26A 2HMIB 4JUZA 3DOLA 4O3SA 3DLKB 4Y2CA 4TQSA 5CZ2A 4I2QB 2GIQA 5KFRA 2YNHB 4DL4A 5K14A 3RAXA 1S9GA 2OPSA 4O4GA 2HWIA 2D0BA 1TK5A 2C2RA 1A5WA 1WSGA 4TY8B 4FXDA 1NK5A 2FJXA 4Z4CA 4E89A 4M3UA 3QGGA 4PUOA 4DQIA 4JV2A 1TKZA 2FJVA 2JEGA 5KFCA 4OLBA 4CESA 3DLEA 2WCXA 3BSOA 3KHRA 1W9HA 4YR3A 4CJPA 4FJ5A 1TKXB 4QCLA 4DL7A 4DQRA 4BE2A 3VQ5A 1RNHA 2R2SA 3ISNC 2HNDA 4O3NA 2JEIA 3TARA 3CIZA 3KLHA 4KKOA 4E7JA 1MU2A 3LAMA 1LWEA 4RNHA 3RB0A 4FYDA 4ED1A 2HHSA 1U4BA 1C6VA 3OYJA 4CHPA 2E9TA 1HMVB 3FFIA 3DLRA 2FVCA 3DLGB 3O3HA 4NLSA 2YKMB 3M8PA 4G1QB 4I7FA 4Z4FA 3OYBA 1D1UA 2O4GA 2KFZA 3GV8B 1NJZA 4M45A 1HJRA 3L2VA 1QAJA 4TN2A 4FLXA 5KFDA 2E9RX 1WAFA 1VSLA 1NOYA 4FLTA 2KTQA 5JS1A 1BQNA 1RT6B 1S9EB 4DWIA 1BQMB 3KTQA 3SZ2A 5L9XA 5CYMA 2QXFA 4IFVB 3M8QA 3OYGA 2BANB 2ZKUA 3RR7A 4PY5A 3M9MB 1SKRA 2EHGA 4Q5VA 3EPGA 1KSPA 5HLFB 4WYLA 3BGRB 3GIJA 1JXEA 4BE0A 3HKWA 1GOBA 2G8IA 3O3GA 3CFOA 4LSLA 3ZT2A 3DLHA 2AGPA 1NOZA 1UOCA 2UVVA 4FW2A 2HHXA 2W42A 4FS1A 4EO8A 3DI6A 1T05B 2D41A 2IAJB 4Q8EA 3QZ7A 4QW9A 3IRXA 3HK2A 1RT5A 4ICLA 2KQ2A 4IQXA 3QEPA 3B6PA 1TQLA 4CHYA 4TY9A 3O3FA 3G10A 5DMRA 2WONA 3SUNA 1TV6A 3HM9A 2OZMA 2IMWP 4DLEA 3NFAA 1JLCB 3D28A 3HPGA 4DQSA 3AVAA 4AHRA 3TAQA 3DDKA 4ECSA 4NLTA 2B6AA 2GIRA 2DFFA 3RRGA 2IS3A 4KAZA 2FLPA 1XR7A 4HTUA 4PQUA 1IH7A 1VSKA 4O0IA 3MEEB 4DTPA 2BQRA 4CGGA 1ASVA 5KT7A 1WSJA 3V9XA 2GV9A 1FKPB 3HYFA 3KJVB 4ZTJA 3T19A 5J2PA 4HVJA 3HVWA 3H5XA 2VG7B 4M41A 1Z4UA 4NYFA 3BQ0A 1LAWA 1B9FA 1HQEB 1RT2B 3ZSZA 4B9MA 1HRHA 1YVFA 1R0AB 3TABA 4B9NA 1T03B 4ED8A 1EKEA 3C6UB 1JLFB 1QTMA 4FM0A 4FK0A 4DFJA 5CY4A 5KFUA 1S9FA 1GOAA 4E3SA 4OKKA 4KI4A 4DTUA 5KFTA 1ZYQA 4BDYA 1U49A 2E6MA 2YNGA 1NKCA 4CJQA 5F8NA 4CGHA 2V0NA 1JKHB 5KFWA 1IG9A 2DTUA 1VRTA 3OLAA 2C22A 4BE1A 1BI4A 3NBPB 3H5SA 3TQ1A 3OVNA 3NE6A 4KFBB 3QERA 5J2NB 3IS9A 5J1EA 3HP9A 5KFSA 3AV9A 1RCHA 2R2UA 3AO2A 1WSHA 1NK9A 3BDPA 1U04A 5FROA 3AVGA 1JL1A 3QESA 1HARA 4FLYA 3T3FA 4DFPA 4KREA 5C24B 1RT4A 1BIUA 3CFRA 4DS4A 3U3YA 3OYKA 1TAUA 3WNGA 2HVIA 4E7KA 1EP4B 4F4ZA 3JSMB 3HSTB 2FBTA 3KNAA 3V9WA 1NK8A 5DGAA 4E7IA 4J2EA 1S1WA 2I5JB 1YTUA 5C5JA 4AHUA 2XCAA 3VQSA 3AO1A 4E0DA 3G6YA 2R2RA 4ID5A 2HNDB 1KHWA 1WNEA 3KLHB 4KKOB 3VQBA 1RAJA 3MEGA 4IH7A 4H4MA 2ITGA 4WZMA 4EYIB 4Q45A 2BE2B 3NHGA 3PV8A 3HVTA 4IH5A 4F4XA 2O4IA 3V4IA 4DFMA 4ZTFA 3L2QA 3S3MA 4PA1A 4RW6B 3JYTA
chains in the Genus database with same CATH superfamily
1CULB 3C95A 3V9ZA 2XMVA 1P8GA 3NG8A 2RAQA 3CCTA 3T1HK 4OYMA 1CXQA 2K2PA 3ZT3A 5M2UA 2Z2MA 3N28A 4ZOSA 4Y28C 4B02A 2HIQA 2DVIA 1LWFA 1IR1A 4EO6A 1UL3A 3BP8A 3EGNA 5M1PA 1VQ6N 3LM9A 4L73A 2V8HA 1YG0A 1RFQA 1B9DA 1D8YA 3DOMB 1LFWA 1VR6A 2Z1IA 2FY8A 3KKSA 2C3OA 3OS0A 1SQGA 1IG8A 3BQ2A 1NPKA 3KWMA 1D0EA 2CKWA 1WEXA 1UCNA 3TTCA 2WOMB 5KFLA 1VBYA 1HPZB 3H2LA 1WLJA 4CWBA 4IDKB 4XEIA 1IBMF 4P2FA 2E5LF 3UVJB 3RU0A 4QOZB 3FGVA 2I1RA 4CJVA 1N5SA 1FKOB 4Z4GA 1V3RA 2WW8A 3TSQA 3J8AA 5AXLA 2YX4A 2NUHA 1GTEA 5BPMA 2YPYA 4FXWA 4M3XA 4PG4A 1NO8A 3RBEA 4WXOA 2B6AB 1FX4A 1WSIA 4DR1J 3R5DA 2ZBPA 3SUPA 4GW6A 2HK3A 6FD1A 3WIVA 3LPUA 1IKXB 5KFHA 3KK3B 2XCPA 3HHLB 3T7ZA 3NLCA 3GQCA 2QTDA 1RP5A 3U1MA 5KPRA 2FLNA 4DSKA 1RYRA 4JI7F 4LF7F 3T5HA 4NYNA 1K8KA 4L3NA 2O01C 4AL6A 2NXNA 3J7ZT 2QKBA 2UXBK 4MLHA 4DMNA 4CLWA 4LRCA 4CO5A 1NSKL 1VBZA 3VAGA 1HYSA 3IGNA 3V1QA 4DR7K 1RBAA 4M5IA 5L9NA 2IYGA 4CZMA 1YZ6A 4Y3CA 3QLHA 2W4DA 5FPNA 4FF4A 4BGBA 3NNHA 3TZWA 2HRUA 3CJQA 4FWLA 3CC7N 5AQIA 2KKHA 1U6FA 3C3LA 3GR1A 4BC7A 3KWGA 3D6FB 4J7CA 3CB4A 5IS2A 3P4IA 1EX8A 2QWLA 1RTHA 2QSWA 4JV5F 3ELHA 4FKXA 3U9DA 4Q0BB 3NF6A 1C1CB 1HKCA 5GADI 1ASUA 3M4XA 1I6JA 1MWZA 2QSFA 1PYOB 4CO0A 4IR9A 4B9QA 1IKYA 5LT5A 1YJNN 4LFAK 3KLVA 4ID8A 1R27B 4FF3A 2WB4A 3Q8VA 3NGRA 5J2MB 5SZTA 4K25A 1TKTB 2ZH2A 1Y5NB 2ILZA 4NLWA 1RAFB 1S48A 2NZTA 5IM0A 2ADCA 4WFXA 2UXDJ 4NO7A 4QBUA 4PPZA 3CJ5A 2JNJA 1UW9A 2CGJA 1JLQA 5KG3A 5JVHQ 4LF6J 1YTAA 2KHOA 2KG0A 1T7PA 2XY7A 3RVCA 3W2VB 1VQ8N 2PIIA 1WWHA 1BU6O 4FJHA 1TUYA 3PR5B 1HNXF 1PJ5A 3IN5A 5FD1A 1RTDA 2ROEA 4R0EA 1JJCB 2E6LA 3EDRB 1K73T 1R8PA 1TUGB 2Q97A 4DTMA 1VCTA 4WCEL 2WK4A 3CCUN 1AFJA 3CQYA 2DGWA 4AH9A 4MTPA 4U7CA 1C4AA 1WBDA 3POTB 1REVB 5FPDA 2XYHB 3RAMA 2IPOB 4PWUA 4P10A 1NKEA 2YH0A 1FTRA 2NS1B 1S6QA 3LDLA 5DG8A 4KPCA 5KFGA 3E51A 5FDLA 5AQJA 3A8EA 4NZ0A 2WB1D 1K8AO 3I0RA 3GJTB 1ZA1B 3CEDA 4CEBA 1BQXA 3LDQA 2XZWA 4Y2KA 2A18A 4CZCA 1ASWA 1VSJA 1VJWA 2J6TA 3EGVA 2HNYB 4EHTA 4WFNQ 4MYUA 2HFOA 3PW2A 3A3OB 3MAHA 5B0AA 2JFKA 1Q9YA 3OR1A 3H1QA 2IC3B 2QLJB 1B99A 3PJXA 4A8WA 2OPQA 4JI6J 1VSIA 4JI4J 5KFFA 3VQ4A 1U47A 2VJVA 4LY7A 2W9CA 1Q1KA 3C19A 3FBEA 1C1BB 4QYRA 3SSSA 2MSSA 3M2VB 4X64F 3H1VX 1W7AA 4CEOA 1TK8A 5D3GB 2YNFA 2CADA 3HO1A 2ZDPA 4C11B 2COLA 5KGWA 4MK7A 2CZVC 2FGOA 4QPXA 4ANEA 4K4UA 3ZTOA 2HWHA 2NUUG 3RYLA 3L4QA 2P5GA 4G9ZA 3NAHA 4NCGB 3BKTA 3SQ4A 4B9VA 2WUSA 2CDRB 3UPFA 1VHFA 2F4VK 3OL8A 3QRQA 2B8QA 2GHVC 3H2UB 5K8OA 4BR7A 3M1FA 5L1KA 5DZ6A 1U0HA 3PVXA 1ZBFA 5B08A 3BGUA 3NF8A 4IO9Q 4EU0A 1CZ9A 4B3RJ 3P6YC 2RHQB 2J76E 5CYJA 4LQ9A 3R9PA 2XYGB 4DCJB 4DPOA 3VV2B 4Z7CA 3RBXA 2HBKA 2ASMA 1JIHA 4TXSA 1UW4A 1XC9A 5K20B 2PI5A 4CF9A 2QA1A 4I6YA 3KLIA 4JI0F 2BH1A 4DV4K 5FRNA 1CS4B 2EFPA 1VHIA 3PG9A 3MPWA 4NA2A 4DHVA 5EOYA 1ZTWA 1U6ZA 2JWKA 1YRXA 4PG6A 5HN0A 4WE1B 2MHNA 2CQ3A 1SZ2A 3DM2A 3NS6A 3KDOA 4K4XA 3SSRA 4H5TA 2KO1A 4LH5A 4O0JA 4LR8A 3BF1A 2V8VA 1RYSA 4DV3J 4KC5A 4KGMA 2CPHA 2RUSA 4CLTA 2PFFB 1Q86O 5F8JA 1S99A 3MM9B 4ED6A 1MMNA 3W5ZA 2CZ9A 1H98A 1K9MT 2O67A 1UZDA 1NCLA 5GVQA 2CPJA 2EG1A 4I6AA 4AHVA 4JI8F 3NH0A 4BR0A 3O9RA 1LW0B 2A0FB 3VTHA 4CJ4A 2RNEA 1LWCB 1RBLA 2EFQA 5L1LA 3T5KA 4J9PA 3PTWA 3C16A 4B1XB 3ULEB 1NJXA 3VGUA 3L3CA 2PY5A 4W5QA 2J6UA 5A6PA 4H54A 1FXXA 1VFJA 5A8RB 5MLCQ 3VA0A 3G6VA 1XNQF 4WWSA 3KIOA 4DV0F 4B3MF 1EARA 3DHXA 1X9SA 4YDUC 3I0SB 1S9GB 2KYXA 1F5AA 4CO3A 3LP2B 1KAXA 1KQFB 2YKAA 4K5RA 1RXOB 5HMXA 3TVZA 2ZBCA 4A8FA 4Y1CA 3HI0A 1N34J 1NB2A 3LP0A 3B6OA 2AJ1A 1OMSA 3MEDA 3WIUA 1CBKA 2QMWA 2RIJA 2Z2LA 1KKHA 4PQAA 1NBEB 4OLPA 4DUTA 3DGVA 4L76A 4CF2A 3JTOA 1UVMA 1GLLO 2PFUA 3BBCA 3CDUA 1QQCA 2W9AA 1VQNS 1YHQS 3HLUA 3Q7BA 3R1LA 1B64A 4DU1A 3HOTA 2D3ZA 1WEZA 1X4HA 1TU0B 2BEFA 1OYDA 3H5UA 3I5AA 3QMQA 3SPYA 4F0KA 4ES3A 1VSHA 1KQSM 1CJVA 4PRFA 3KLEA 2ZD1A 3OYEA 2JVRA 4JI1J 1GH8A 2HMIA 3DLKA 3KUEA 3GFYA 5EVZA 3FCWA 3QFWA 1KOOA 2OFGX 4AHSA 4CJKA 3O5TB 3PX6A 3DOKA 2V52B 2ZE2A 2HBYB 1VQLS 3TVKA 4AM6A 2ASLA 1DEJA 3VGKA 4W5NA 4I56A 2NYIA 2HS4A 3M8QB 1WSEA 5BR9A 3LDPA 3AOAA 4K4VA 2UP1A 2U2FA 3QEXA 2BABA 3TJAA 2CPXA 1G1XA 1SPBP 1VHXA 1HLWA 2O8FB 4WK1A 2DHXA 4AILC 2ASJA 1JXVA 2YH1A 5BN9A 3JAMO 2F4FA 5GADU 3GP9A 3S9HA 2FBXA 1FWKA 5HJYA 3A8KA 2B56A 3E66A 1VSDA 1UJ4A 1RDBA 3SCXA 3AXKA 3IP0A 3OYNA 3E01A 1F9FA 1SQFA 4EBCA 1RTZA 1T9WA 4B3TF 1IBLF 4UQGA 2GGPB 1SC4B 3AQPA 1QQNA 3PX4A 3CM5A 4KB1A 3ZSVA 2CPEA 3OS2A 3EDQB 1TFYA 3OTBA 4MK8A 3QFPA 1S9EA 3R5CA 3SFGA 3QEWA 2MY7A 2ZOMA 2H3EB 4IO1A 2N82B 1L3VA 4OI4A 4P72A 4DL5A 4Y2MA 2QFJA 1NLVA 2RUGA 2VYPA 2KDOA 1QAXA 3PW0A 4CZFA 4C98A 1R0CB 3KK1B 4L3QA 3U3GA 2XWYA 1IJEB 1BWEA 4BY9C 3DXBA 3OYLA 4JI2K 2JSXA 3PACA 3I87A 4OYAA 1MN7A 2XBPA 2AGOA 2O8EB 2W7AA 1NJWA 3K2YA 4LRBA 2HHTA 3JAMY 5H9FK 5E3QA 4TNOA 3N01A 4NRTA 5AR0A 4JKDA 4JKFA 4LF4K 3KHLA 1WUUA 3H59A 3SXLA 1KRPA 5JVGQ 3SV4A 5KQDA 2V67A 5AZIA 1KEKA 3R8EA 2Q36A 4K8RA 5DG7A 3QIPB 2B4VA 4O3QA 3ZSWA 5L39A 4I0WA 1UZHA 3H25A 1UA1A 4ZVRB 4O3RA 4FJ7A 3Q8SB 2GHWA 1UKUA 1L5UA 4HKQA 3S8SA 5LJWA 3CC2S 3GIRA 2NUBA 5E7OB 2DR9A 2JC0A 3WNFA 1EB0A 1P1LA 3F73A 2OTJS 3MAAA 4FJMA 1H6KX 1BLUA 3CD5A 2MJNA 1RT2A 2H48B 5A0YB 3B4MA 3MPUB 3HHKA 3OQ2A 4CBWA 3C6UA 2VWBA 5B0CA 5L1JA 4FDFA 3ZX3A 2F7TA 3PM9A 3W63A 5LMNJ 1FRIA 2KRRA 3D0GE 4CZEA 4ID5B 2MB0B 3MEGB 3T9NA 1S97A 1Q0NA 1CZAN 3FZFA 1T3NA 2R8JA 4HTJA 4LH4A 2EC2A 4IJNA 2DXDA 4DR6K 4Q2LA 4CJUA 1WHXA 3OY9A 3NRBA 3GPAA 4G3IA 4ECTA 1HR0F 4DCHA 1L3TA 3MD3A 3MN7A 3ZTPA 2XRIA 1Z6RA 3RBDA 4H5NA 1GLFO 4Z2XA 4CTAB 4CLFA 3IXQA 1Q79A 3H08A 2Y8WA 2W4PA 3CCSS 4FLVA 1Q7YT 4OYPA 1VBXA 4FWOA 3N9UC 3GIMA 4H0VB 2CJAA 3G82B 2NLWA 1WDTA 1EP4A 4X4QA 4YOEA 1AFIA 4ECQA 2IVNA 5AZJB 3KJFB 4ZVFA 4PZVA 2I5JA 2RS8A 3O3LA 3MM6A 1VQ7N 1I3AA 2J7KA 4F9OA 2B43A 2Q6BA 2V69A 2BE2A 2K7KA 3NVMA 4NYZA 3OFGA 5I4MA 4HTIA 3MECA 4OZ5A 4DLGA 4HACB 1BC6A 1CULA 3Q8QB 4C4WA 3O6QA 2W8LA 1TAQA 2HBLA 4PXCA 3MXJA 4OO1J 1NPPA 1HNIA 5JMNA 1FFGB 3HD2A 3NNAA 4YOVA 4R5PB 4J90A 3LWLA 1RAOA 4CNYA 3EVOA 4ER8A 3UN5A 2HHQA 2F8EX 3Q83A 2XY8A 4BRMA 4FVUA 3FQLA 2HZVA 3BEXA 2XWXA 4OL8A 4Z0UA 3SCIE 1NGBA 1U1OA 4XH1A 1VAZA 1ZBTA 2VPWB 2G0IA 5BRHA 3ZYYX 4ERDA 4FLUA 2AWZA 2M88A 2WOMA 2CQ0A 5AQGA 1MN9A 4U7UK 4E1MA 1HPZA 2DH8A 3DRPB 2YWFA 4IDKA 3UVJA 3V9UA 2FF6A 2ZEJA 3OTEA 2CNOB 5IV4A 1FKOA 5DRKA 3OJSA 2KFYA 4KGXB 2BR0A 3H8YA 5HSPA 1NU0A 5GAGP 3K17A 4YMEA 2ZOFA 1KVAA 2VL1A 2CNLB 2XS7A 2AX0A 4KTWA 4MO5A 4ZLJA 3KDNA 2Z58B 2HBQB 4AQYK 2DR8A 1K6YA 3MCNA 4HHJA 1ILYA 3D7SB 3CPWR 2R7UA 3WXLA 1Q9XA 3CC4S 3IKMA 1IKXA 4O44B 1NU4A 3KK3A 2CQ4A 5D4NA 4ELUA 3NGUA 3IRWP 3CDEA 4DV2F 3VAFA 2O8DB 1SJFA 3C7NB 3HT0A 1X5PA 4LSNB 5IZHA 4JI3K 5GMDA 1IKWB 5D0RA 1ROFA 4AXIA 1BCOA 4K4SA 1J5EK 4EHUA 4L3KA 1R8CA 3A4TA 2CQCA 4NEYA 1TYQB 1YBTA 3AY0A 3OL6A 4JB8B 2FJWA 3EJMA 4FSVA 4IQMA 1A5VA 1NGAA 1KVBA 3MMVA 4KGKA 4JKBA 5EX3A 4IDHA 5IWAF 4OGEA 3RUBL 2KM8B 1QTNB 3GLJA 3A5LC 1NSAA 2QW9A 3V6HA 2V9WA 2QC3A 1R3NA 3I96A 2LCWA 3H45C 1T9XA 2UVWA 1SJ3P 4BC4A 4BC9A 2OI2A 2DGUA 1R8BA 1H38A 3O80A 2GCFA 4HWIA 4Q0BA 4CLKA 3MZIA 2F4VF 1C1CA 2VIHA 4KO0B 4C7QA 3PXGa 1ZM3A 2BJ8A 3PEJA 3OV7A 1I39A 3IFEA 4B08A 4CGDA 2X1BA 3OA9A 5J2MA 1YXQA 1TKTA 2UUTA 1X5TA 4RUCA 2O8BB 2V2VA 1OY6A 4M7XA 4CJRA 1XBWA 4RU2A 5GINA 2E2OA 4DV5K 1VSEA 1XERA 2LXFA 3W2VA 5C42B 3FRZA 1C0TB 2KH9A 3BDEA 4K4TA 2VV5A 3PHTA 3NY0A 3CJTA 3N5BA 3TW0A 3QJLA 4M5KA 1EXQA 2OEKA 2RPIA 4A57A 1EQ0A 1SC1B 4ALZA 3POTA 1REVA 3FNNA 1MROB 2C2KB 4A8YA 1T9VA 1XNRJ 3UFCX 3KLGB 3MUVP 2F63A 4XO0A 1V4SA 1RE1B 2OLWA 4RTFD 4MKBA 4UZCA 4JI5K 1SJQA 5DQIA 3LM2A 3T9ZA 2VWJA 1B0TA 2HQCA 3NMAA 2LU1A 2E5IA 2JOQA 2KRBA 4PWDB 3DLBA 4OX9F 3G86A 1OVQA 5T7BA 1B7YB 3PSIA 1MMLA 1GXTA 2FVQA 4K41A 5H1SQ 1RKIA 4GKJF 4OI1A 2WSEC 2BX6A 2IC3A 1A9NB 4PXDA 1WOSA 2WVEA 4FF1A 2GIFA 5A6WA 2FHJD 4HT5A 3ISND 4BRQA 4OYOA 4WKYA 3NMUA 4CLSA 2F3JA 4AL7A 3RTVA 1C1BA 3H20A 3MOJB 3MFIA 5KT5A 2VH7A 4DU8A 5D3GA 4MJKA 5IV3A 4C11A 3IR5B 2CJKA 2PZSA 5GAHP 2VZ9A 4RO0A 3AAPA 2D1CA 2BE9B 4W92B 4NCGA 3PRDA 3PIOL 3WZ0A 1OH5A 3ZZZA 4QWCA 4M7YA 1JLAB 1WG5A 3FDSA 2Q31A 4XDCA 3O4QA 5F1XA 2VBXA 3I9ZA 5C12A 3AVFA 2MZQA 3WX8A 3AO4A 4J2AA 2OEMA 3P5TL 1PBAA 1WI8A 1M5HA 2ASPA 3US5A 4PXBA 4GV9A 2DJWA 3RJMB 3P39A 1U1QA 1T05A 3PW7A 4CO4A 1VSMA 4DR5K 3K5PA 4IKAA 2B8PA 1CPZA 3AAQA 3N6LA 3LGNA 4F04B 5M2PA 4OI6A 3QNOA 1D09B 3VAJA 2XTJP 1NK0A 1HBUA 3BBFA 4OHYA 1KR4A 5CYQB 1RT7B 2HOEA 4DTNA 4JI2J 4QZVB 1BD6A 4UUWA 4PG7A 1YK9A 2ZH1A 2CG4A 1XI1A 5HMYA 3T5JA 3P5JA 3D1QA 5DM6Q 3CF5Q 5H9FJ 4DPTA 1CS4A 1UAXA 2ZM6F 2HVHA 1X1PA 2YJEA 4LF4J 3UCGA 3O1BA 3CCRS 3ILLA 2J4RA 3T6BA 1FJ7A 1GT8A 4K0KK 4WE1A 3QQCD 3ETMA 1RAHB 4WIQA 2LP4A 2X3DA 4ZJQA 2F9JA 3W3DA 2H1YA 2B7CB 3FC9A 3MK6A 3IBFB 1QJHA 4IOXA 2Z1GA 3PFOA 4DR1F 2AHOB 1U2CA 1PIEA 2VD3A 4CERA 2P9UB 1FCAA 4ZJOA 4DV6F 1SL2A 2F65A 4N47A 3IWNC 2RF2B 1T3VA 4R0JA 2HRTA 1NUEA 4LSZB 5HVFA 4HUGA 4EP4A 3L0QA 1FXDA 2GO9A 3UDCA 2G8VA 3GYNA 1RA6A 5GMKa 2MZ1A 2OKQA 2GW8A 5DETA 4M8LA 3MM7A 1LW0A 2RS2A 4CJ7A 1VS3A 3KG4A 5GAGI 1LWCA 4DTJA 1IKVB 2WVFA 2ZJQQ 3SBGA 3DRXA 1Z26A 4JUZA 4CYUB 3W9IA 1RUSA 2ADBA 5CZ2A 5A8RA 1IV0A 2GQQA 1VQYA 4ZVPB 3VZIA 2M2BA 4ILJA 1R6VA 4ILLA 1S9GA 3DU6A 1F9EB 3MTJA 3FLCO 2FJDB 3NNCA 1A5WA 2YXLA 1AXQA 3C66A 2KHCA 1FRLA 4CLZA 2H5JB 3QGGA 4OMFG 3HOSA 5CHIA 8ATCB 3BO4A 5KFCA 4BRIA 3DLLL 1CC7A 1AUDA 1W9HA 4FJ5A 1TKXB 4DQRA 5G0RA 4D3HA 4U8VA 2R7WA 1RNHA 2W41A 3HMJG 1HD1A 4KKOA 3IAS9 3O9UA 2DCUB 4M5DB 3RB0A 2H9ZA 2ZUGA 4ED1A 1VQNN 1YHQN 3FE1A 3H3NO 2E9TA 4ZKAA 2E5GA 2WSCC 2GWJA 2YKMB 3GOIA 1YITN 4BC5A 1N5QA 3BR8A 2K8GA 3GE9A 1VQ5N 5AQQA 2UXDF 4NL5A 3I56S 2KFZA 4IWVA 4PHTX 3GV8B 5F0WA 4L74A 4M45A 3L2VA 1QAJA 2XMKA 5B0BA 3AAWB 1MWYA 2JL9A 3RSEB 1VSLA 5JS1A 4DWIA 4ZVSB 4U8YA 3BYPA 3SZ2A 2CA9A 2D3O1 3M8QA 4GVLA 4OQJA 5F41A 1R8AA 3M9MB 2EHGA 4Q5VA 2MQOA 1T02A 4WYLA 1YJ9N 1JXEA 4OI3A 4DV7J 4JN4A 1RDUA 3ZT2A 2AGPA 1UOCA 4ED4A 2UVVA 4FW2A 3DWLA 2W42A 1FRHA 4WFAQ 1FWLA 3R97A 4ZN1A 2IAJB 4Q8EA 4QW9A 1HUXA 3FEYB 1FRKA 3QEPA 3B6PA 2HQ3A 1Q5VA 4TY9A 4DJBA 5EGYA 3O3FA 3G10A 2WONA 3G8QA 2RSQA 2GGPA 2OZMA 2J7WA 1JLCB 1OQ6A 5A2QO 4DQSA 2FDNA 3HSDA 1XMOK 4AHRA 3JS6A 4ECSA 2KVIA 2GIRA 1BG3A 1P90A 1IH7A 1VSKA 4OPAA 4NX9A 3THWB 3MEEB 4DTPA 4CGGA 4JI6F 4JI4F 4YY3F 3W7BA 5KT7A 3O5BA 3V9XA 2AYEA 1RWVB 1X4GA 2GV9A 3CTRA 1FKPB 4ZTJA 1EQYA 3T19A 2OJ3A 1RSCA 3ZZRA 2R7RA 3H5XA 2VG7B 3BQ0A 3UE2A 1SQEA 4UTGA 3I31A 4AQYJ 4BVOA 1HQEB 2A5XA 3F2KA 1HW9A 4CDIA 2PA8D 4ED8A 2AD9A 2F5GA 3PDNA 4LFCF 1JLFB 2QWNA 2O8EA 4FM0A 4FK0A 3MUTP 1YTYA 4WP9A 4USTA 2E2PA 4JI3J 4H0XB 3VEVA 2EBGA 1J5EJ 1XTZA 4C2MA 4P7TA 2DEIA 1JJ2R 1U49A 2LQ9A 3AA8A 1GLDG 3ET6B 4DR4K 2D9PA 4CJQA 4CGHA 1NDCA 4BS2A 2HGMA 1S79A 4K43A 5AQNA 2I0XA 2QGFB 3OW2R 2DTUA 1FD8A 3K9KA 3OLAA 1EQMA 3ENQA 4EK2A 2DTJA 3QT6A 5D0HA 2N3OA 2MKYA 3OVNA 3NE6A 1HBNB 5A2QY 2BJ1A 3D1HA 5J2NB 5ADXA 5JMVA 1RCHA 1V3ZA 3AO2A 3BDPA 3QESA 3PIPQ 1WDDA 4FLYA 1TUVA 3P38A 4O0NA 3UO0A 1N33F 1QVFR 5C24B 1BUXA 1TAUA 2O3DA 3WNGA 2PEBA 5A0YA 1X3NA 1HD0A 4F4ZA 3HSTB 1U26A 3QT7A 3KNAA 1KONA 3JB9k 4E7IA 4J2EA 1S1WA 3R5BA 2MQNA 2OTJN 2ZGZA 4E0DA 2LEAA 4IOAL 4WK3A 5HL7Q 5MAOA 4ID5A 2NXJA 2HNDB 3MEGA 2ITGA 1WBBA 3J80O 4I69A 1IR2A 4F4XA 2O4IA 4OYXA 2DGQA 3NWRA 5FJ4A 3S6EA 1ESVA 3FFIB 3ICLA 1YBAA 3SMZA 1OH6A 4DCPB 4ZLLA 3TAMB 5M1QA 3A0IX 3HFVA 3R3LA 3BZKA 1P9YA 2NZ4A 2WFBA 3OYDA 1Y9OA 4YOYA 2WTUA 3MGJA 4QIVA 3MCPA 2F9WA 2DY4A 4CTAA 5AE1A 2RRNA 3JAMU 4NA1A 4QJVA 4KV8B 2JWLA 5E0OA 3E3XA 4EFAC 1RB0A 4A8OA 3G82A 2ZNYA 2WVCA 4JLHA 3BB5A 2Q1LA 2MXYA 1X9MA 1RBTA 4FLWA 1QM9A 2IJNA 4N5SA 3OBWA 1SVDA 4ZVEA 4ELTA 1HBMB 3IA0A 4KHPJ 1CEZA 1RACB 1N34F 3C14B 3PSFA 5HMZA 4JI5J 3RR8A 4JK7A 2GWKA 4MLEA 2DITA 5BREA 3UW1A 6AT1B 2E7WA 1KS2A 4HACA 2Z2ZA 3ZZ0A 4WTYA 4J9VA 3J80Y 1KD1T 2WBRA 4V19S 3QETA 5ETQA 4X62K 4L75A 1HQ2A 1SH2A 4MO4A 4ZPBA 5E26A 1Q8BA 3JQKA 1QSYA 3K5MA 3VVTA 4O55A 5GAGU 4R5PA 3MM8A 3QYYA 2HZAA 2IM0A 4JI1F 3L3UA 3GYXB 5CCLA 4CIOA 1KFSA 1QVGR 2OCEA 4C23A 4LF8K 4ANDA 4DR2F 4FZZA 3QATA 3TPQA 1I94K 1QUVA 1FDNA 3KXDA 2HPUA 3PFEA 4C3MA 4M5GA 3EEQA 1KWMA 1X4BA 1S7HA 2QJ3A 3C94A 4I67A 4KBOA 3MWBA 1RLCL 1M90O 4RWXA 3B8HA 3ZZUA 3CPWM 3DRPA 1EKRA 1P1TA 1V5IB 1TVRB 1KP6A 4AF1A 5MLCV 5CZXA 2FSKA 3VWSA 1XMBA 3ZNUA 1SH0A 1SUQB 5BYSA 4MT1A 2BJ7A 4C9DA 5HBMB 2UUAK 3QAUA 2PMZD 2WC9A 4DR5J 4FJ8A 1TL5A 3AA9A 5CQGA 2DB1A 1RAIB 3OFFA 1JLBB 3SCJE 3R6GB 2RT3A 3CD6N 4ETZA 1UWAA 4AD6A 4R8UB 3UDVA 2GQCA 4CHZA 4PCQA 4O44A 2VQFF 1KTQA 2KYZA 4YN3B 4X66K 3AO5A 4OX8A 5FLXU 2O8DA 2B7BB 4RPFA 1WD6A 3C7NA 1I1GA 4OZ3A 4DU3A 1VIOA 1IKWA 1FFWB 4W5RA 2C2MB 3PYFA 4HCCA 4U67Q 2K3IA 4X4RA 4I2PB 3K0JA 3GB0A 3SAGA 2WVDA 1TYQA 3HSGA 3AD8C 5M2RA 3U6FA 4M5MA 4K0KJ 1J5OA 1RDRA 3NEKA 3S3OA 4FPBA 2AP6A 4ATNA 2UU9F 1DLOB 1X7VA 1WORA 1ZPVA 1K47A 1UWBA 1RAGB 3UE5A 4K50A 2AU0A 4KQZA 1Q16B 2ZOGA 3PX0A 3CHWA 3M6XA 5FPMA 2CNKB 4O4RA 1AT1B 4J9LA 2G8WA 3PLAA 1X4CA 2ZVSA 1SIZA 2QI2A 1VQ6S 4FYYB 4OPJA 3BKUA 3FBFA 4KO0A 3OYMA 3L95X 4M3YA 3IAM9 5I3UA 5F2RA 4NOHA 2E5JA 3H6EA 1N5YB 4YOXA 4M3WA 1F6TA 3NS7B 5JLFA 2M52A 1NXIA 1X5SA 3OHRA 1DTTB 2D0OA 1RDDA 2CAJA 3NCRA 1LWFB 3SI6A 2C2NA 4HCBA 2V7ZA 2NRZA 4RZRA 4C1NI 4NI2B 2KZZA 3UR3C 2VFVA 4ILHA 2GA7A 2O8BA 2WHOA 3O4WA 5B0DA 3MOZA 3JXOA 3CIMA 1PG5B 1JNRB 1NAQA 4IFEA 2AZ3A 3PRVA 2C3YA 3VR1A 4DR3F 4A47A 2GQ2A 4DZ6A 1VK8A 2MZJA 2VICA 1U45A 2CWXA 5C42A 3BBBA 2FJBB 3DKDA 3CJKB 4FPRA 1A5XA 1HWIA 3AVNA 1RI7A 5LMNF 2Q66A 2BQ3A 3OTOK 1N0UA 4JV0A 5AQMA 1Q8KA 3UCUP 4NPOA 3VERA 3J7AN 5AJ3K 1F5BA 3UD4P 4C97A 1SKWA 5DO2A 3W65A 1RU1A 1MROA 2DNYA 4X65J 3KLGA 1YJUA 5KT3A 4ZIWA 2DEJA 3VMFB 4DV1F 1F3VA 4WU3A 3M8WA 3H42A 2Q0UA 4M63A 3OL9A 5E2QA 3VENA 4PWDA 4EMDA 4EGLA 4CLYA 2NXUA 3ZFVA 2ZJPL 4M5NA 5ADZA 2ACYA 3FR0A 2EFOA 2GJIA 2BV3A 2RB7A 2B4JA 2I38A 2NRHA 4N41A 2OELA 4X4NA 3MMBA 2J8SA 2J9CA 1UMJA 1WF0A 1Y5LB 3Q0AA 4KHUA 5G4DA 4FW1A 4J9MA 2BTFA 1HYSB 4CH0S 4CK3A 3D3BJ 3CUNA 4YHHJ 3VPZA 2SXLA 3HM8A 4PEOA 3PW4A 3CCMS 3A2FA 2BYCA 2E1RA 4NXMF 4B1VA 2XLJA 3HXMA 1HHSA 2FPHX 3ZZTA 2B4PA 4G1PA 1JLAA 4DN0A 2YKOA 1YJNS 3HKZD 2AF6A 3CO9A 1XMOJ 1OPZA 3A1YG 5B0FA 3HHEA 3LPTA 5K5MA 1AUSL 4OHZA 4U95A 1QSSA 2GVDA 3TRGA 4F50A 3OXFA 1ZBHA 4CEEA 3P45B 1WJ9A 1IR0A 4U7UD 1C0UB 1VQ8S 4CJLA 4WQ5A 3TUIC 3W0LA 1K44A 2A6MA 2YQ1A 2IVPA 5CYQA 4F4AA 1SBRA 1R6YA 4OVLA 1RT7A 4ZIVA 1JLQB 4QR2A 5L38A 4C48A 2DRDA 4MKAA 2V9KA 2DFEA 2J0XA 4PAAA 2KJVA 1M5PC 1IBMK 2E5LK 3D45A 1NNEA 3R5AA 2W25A 4OPKA 1WNSA 3QBCA 1UJ5A 5C10A 4M42A 1EJ7L 4DEZA 4WCEQ 3SI8A 4MQ3A 4OZ2A 3UKRB 2EBEA 1LNQA 2JLEA 3K7RA 1VC6A 4F3QA 4PUOB 2VG6A 4A8KA 3MMCB 2R7VA 5HROA 1R43A 3DLEB 2C3PA 3ILIA 1S6QB 2I6WA 2KL8A 2Q3PA 2ZUAA 1ZM2A 3L2UA 1NNDA 4AHCA 5FDLB 5KOXA 5JVHL 3Q2SC 3I0RB 3N0VA 4CW7B 4GO5X 4KHSA 2RF2A 2I2YA 1IXKA 2ZGYA 2UXCF 5DQGA 1GTHA 1LWEB 4CIEA 5IC4B 3K58A 2OIHA 2A3ZA 2OD6A 2GFFA 4KR0B 4MIAA 2YKNA 4JI7K 2CRLA 4LF7K 3S01A 1G7CB 4ILRA 4QWDA 4U7BA 3CD7A 4M63C 3EZ5A 1OQ3A 3M8PB 3M1VB 3OR1B 4CYUA 5DLGA 4ZVQB 3TU5A 2YHXA 5EWFA 3ZT0A 2JFDA 2MDAA 4K4YA 1KHVA 5BXIA 1KBRA 3FCHA 4NXNF 1F60B 3ALYA 1NHUA 2XMUA 1RDWX 3CSKA 2CJYB 3FFKB 2HURA 4OZLA 5EU7A 1H2TZ 5IT9U 1GXUA 4OI0A 3R2CJ 4DL6A 4NCBA 2OA8A 3CERA 3KD5E 3ZSQA 4JYAF 1TKXA 3QWUA 3W1YC 3LZIA 4JV5K 4OJ3A 4DUYJ 5KG6A 4YB5A 1URNA 2RN2A 2HVZA 4M5DA 2ALYB 1JJHA 1U0HB 3VGSA 4XIUA 1EKSA 3I4PA 1RA7A 4IRDA 3W64A 1LK5A 3TX0A 2O1PA 1IBCB 4XPEA 2QA2A 1RT5B 2YKMA 4ICLB 5ETKA 2CQ2A 1N5VA 1X9JA 2ZITA 1SB6A 1R0BG 2PC6A 3MFHA 4WFBL 2YVSA 2YV0X 3OS1A 4WP8A 2GUPA 3LQVA 1ZS6A 3D0HE 1YWXA 1M5OC 4CHOA 1VC0A 2YX6A 3RSEA 4PQUB 2Q0RA 2H54B 4IRKA 2FHJA 1GNKA 4ED7A 4WQ5C 2MGZA 1HNXK 2M5YA 3BN7A 3WXKA 2Z57B 3PUFA 4KHWA 3B54A 2AT1B 2DNLA 4IO9L 5KFMA 3HVAA 3CDAA 4TU8A 1OSDA 4BWMA 4CRJA 1XNRF 1FE0A 4BRAA 2OZSA 5KAKA 3FSXA 1QZ5A 4ECZA 4LF8J 5HRPA 3OYIA 1B3TA 2IAJA 4OI2A 2HW3A 5BR8F 1I94J 4KHRA 5B09A 1TUWA 2LVWA 1T8EA 4F4YA 3WUHA 3ILJA 1M1KO 1KFDA 2PYJA 5AQPA 2LLZA 4F8RA 3WXJA 1JLCA 1GLCG 4P7VA 3HTVA 4L6V3 2WTFA 3GMGA 2D3UA 4K2JA 3W9HA 2BMBA 2FC9A 1K9MO 3QSIA 4PL8A 2ZHBA 1Q86T 2MQ8A 3A3PB 3DNCA 1FDDA 2BRLA 4DQPA 2KZMA 2HHWA 4XDDA 2V34A 4BROA 4KH5A 1FKPA 4TQRA 3IS9B 2UUAJ 2OH2A 1JJ2M 4YQWA 3A5OC 4YOUA 4X64K 3W5YA 3BSAA 3OXLA 4OYZA 2FJEB 4X4SA 2P9GA 2HZCA 1WUAA 3OW2M 2MKSA 4ZLPA 2PYLA 1RT4B 4UUXA 2AA4A 5AXKA 1HQEA 3QNWB 2GNKA 2V4RA 4KH1B 5F9NA 2D3OR 1RHKB 4Z4IA 3ENBA 3Q7CA 4OHXA 2LECA 3R1HA 5DM7L 4XH4A 3R8YA 4DSEA 4F4KA 2B9WA 3VGVA 1S72S 2ZBQA 4JP8A 1DT9A 1QVFM 4X62F 4E98A 1H73A 2HKEA 3ID6A 4QWAA 5CA5A 4EYHB 3H0PA 1CVJA 3KLEB 4H0TB 4NLUA 4WFZA 1NHKL 3VALA 5DLFA 4CFCA 4HL9A 3F41A 3V6DB 1K1SA 1HBNA 5HI7A 4RW8B 5CABA 5J2NA 4EZ6A 4V19J 4FJIA 4QYZK 3HX9A 3J81j 1JLEB 3CJ1A 3F9KA 2LXUA 4PKIA 4WKRA 3DOKB 2ZE2B 1RCOB 3FJ2A 2FVSA 2ROPA 4HLBA 1QY7A 3WQUA 2C3UA 2FD2A 1N54B 2X7IA 3QGIA 4NZ7A 1N56A 5C24A 2YPZA 2I7PA 2VWKA 5H1SV 2VQEF 4JI0K 1N5TA 4I6WA 5JS2A 3H3OB 1VSFA 4FJ9A 3GV7B 1S1UB 3UCZP 3EO3A 2UUCF 1YGYA 2PO4A 5KFPA 1QZ6A 1YBUA 3VF0B 4JAXA 2D69A 1NH7A 4OYIA 4EWTA 3L2RA 1S6UA 3C6HA 1AYEA 1LXNA 2P6SA 2E8AA 4N7TA 2XSJB 4DQQA 3VCDA 5E41A 4RBUA 2QWQA 3O6WA 2CFXA 3QRRA 1XEZA 2ZWOA 4Z94A 2HSEB 3E01B 1LWXA 5KFJA 3TAMA 2O8CB 4W4MA 3ZTQA 4A2AA 4ZVUB 4ZVHA 1NGGA 1OJ4A 4JI8K 7FDRA 4CO1A 5E3PA 4AUKA 1U25A 4EZ9A 2EFGA 3RB6A 2ZH6A 3L4IA 2J7UA 1WC4A 1ZETA 4KV8A 1Q8IA 2PFDA 4WXWA 2CPFA 2IJRA 3HL8A 1XNQK 1RWMB 4CD3A 1H7XA 3CYMA 5AJ3J 3D0PA 4DV0K 4B3MK 3QBWA 2ZVIA 2Q43A 1HBMA 1UEKA 3E1YA 1UFLA 2CJ9A 2R8KA 5GADP 4UT4A 2A41A 4A62A 4LVNP 1JXLA 2YWWA 3CQXA 3C14A 4N76A 5DJBA 4O23A 2V8GA 3NGDA 4NYPA 1KNZA 1QVGM 4BDPA 1F2GA 4PWWA 2QRRA 2QEXN 3BQ1A 4LBIA 2ZDOA 4DUZF 2RQMA 3EZUA 2IIRA 1Y7PA 3V6JA 2ZH4A 3DRRB 4RU9A 4ZPCA 4FWRA 3LAKA 1ELOA 3U27A 2GV1A 3EKSA 4B8AB 1S4EA 2G0CA 1RHJB 1N32F 3KOAA 3E8OA 1W0HA 2U1AA 1DQAA 2E1CA 3VEWA 3VEOA 3BF3A 2GC8A 3PY8A 3N4PA 4CP5A 4OJRA 1VQPN 1S0MA 1NGJA 4XAKA 4GC7A 1DAXA 5AQKA 3W8GA 3V2UC 2IVMA 2FGCA 1X5OA 1HNWF 2N3LA 1TVRA 5JVGL 4LT6A 3WXMB 1XQSC 1N52B 4B9SA 4KHYA 1NEEA 3OTOF 3SQ2A 4DV7F 5HATA 1SUQA 1OS5A 2W6LA 4LR7A 4DL3A 4KH0B 5HBMA 4BC3A 1GEHA 4C0OC 2PD1A 6FDRA 4NB4A 3SV3A 1JLBA 3N4QA 4CEQA 4CZKA 4NLPA 1RTJB 3VQ7A 4R8UA 2E7XA 5HRSA 4EP5A 5KFYA 4B3TK 5EX0A 1IBLK 2C2OB 4A8QA 3I82A 1WB9A 5B0EA 2X51A 1ICEB 1ULRA 4ITSA 2ZH8A 3DJCA 3ENVA 4RNFA 1JX4A 1A6LA 3KJNB 1IBMJ 2E5LJ 4I2PA 1VQ7S 1N4LA 2KXFA 1WF1A 4ZPWR 3VN5A 1RHUB 3T1YJ 4DS5A 3AXMA 3WQPA 1SKUB 4USHA 4IEEA 3V81B 4IR1A 3ONQA 1M5SA 4DKWA 3U8XA 3MM6B 1DLOA 5ETOA 2QK9A 1B4SA 2J6SA 2HFUA 3SUQA 4ZPAA 2FZKB 4I9LA 3MECB 4FZVA 2GX8A 5KT4A 2A6AA 5HP1B 4KHNA 4CLPA 1LK7A 4Q2MA 4JI7J 4TSXA 5HRRA 3BKFA 4OHWA 3AJ2A 1HNIB 1N5YA 3VTIA 2OMLA 3R1XA 3TYTA 1FEHA 1DTTA 5AQRA 1R89A 1DHMA 2V50A 3NWGA 3SAFA 3M8SA 4NI2A 2RD5C 3I4HX 2I7NA 4B3SF 3GIKA 3LOUA 2RU9A 4HHHA 1QQOA 3RB3A 2IRUA 3QMLA 2UUWA 4H4KC 4Y1DA 2RU3A 3C6TB 1HMVA 5KT6A 1VRUB 4CIGA 4TYAA 2HS3A 2B3TB 1FXRA 3IGVA 3UN2A 4HUEA 1B0PA 4JV5J 1F2HA 3CJKA 2DIVA 4IZ9A 2P9SB 4OKJA 1RGVA 3OVSA 4DFKA 4HHUA 1ZM9A 5F3ZA 4IBNA 3OUYA 3MCOA 2VDIA 1SAZA 1N8RO 4XTTA 1N6QB 1WHYA 3A5MC 1GAOA 1FKAF 2XLIA 1HR0K 1BHNA 4PXEA 1ATRA 2RKIB 2E66A 2C3MA 2E1AA 2IFXA 1WHVA 3P96A 3SCKE 3TAGA 3JSRA 1WELA 3AY9A 2AYMA 5J1NA 3VQQA 5E33A 3GG4A 3QINA 4CHQA 4C8NA 1YF5L 3NF9A 3EVWA 2JHEA 4RL1A 5KRSA 3BGLA 1YRTA 1KOHA 4RX6A 9RUBA 2KU7A 2DNOA 3BH7B 3ZZYA 1RBUA 3FVYA 1RABB 3EE9A 3WC2A 4HUFA 4KHPF 3ZT4A 3MN6A 1EWQA 4IEIA 1MWQA 3NGIA 3ZTSA 1KVCA 2VG5B 3S1TA 4ZN3A 2VBYA 1X8DA 5E3AA 3VQPA 1T11A 2Z1HA 3RG6A 2Z56B 4UQTA 1YI2S 1UVNA 2A1BA 4LF9J 3SYZA 2APOA 2EW9A 2IM1A 4B1YB 2CPDA 3NOGA 4NLQA 3THVA 2K3KA 1XQIA 4R25A 3IFRA 3CCMN 5IOLA 5IFMA 3LW5C 2VOPA 1U48A 1X0FA 4P73A 5EWGA 2HHUA 4UOGA 2ZBRA 2EK6A 4MDBA 3K57A 1RTIB 3KUGA 3D5MA 1C0UA 4MFBB 4W90B 4JD2B 4X64J 3TA0A 5LMUF 2DGOA 4QIWD 3TAPA 4UZBA 4FLZA 4HTLA 1Y10A 3SLCA 5SWMA 1UPMB 3D0IE 5KQ8A 4O3SA 4RBVA 1Q7LB 2WZ1A 2GIQA 3HSZA 2YNHB 4DL4A 4JNEA 1YLXA 4IOCL 3RAXA 1FT8A 3EKUA 5AQZA 4LVOP 3I55N 4ZPVR 2QL5B 2C2RA 1R59O 4FXDA 3I33A 2A2CA 3R27A 3UKRA 3THPA 3DXKB 5ETSA 4M3UA 4PUOA 1G4CA 3AODA 3O1LA 3MMCA 4DQIA 4JV2A 1V6HA 4ZA1A 2JEGA 3M2UB 4CESA 3DLEA 3BSOA 3LTOA 2FLOA 5A76A 2Y3YA 4BE2A 4MYTA 4QYZJ 3PNIA 4O3NA 5EXWA 2AJ2A 1ZC6A 4DV2K 3QT8A 2Z8QA 5AXNA 3EGWB 1LWEA 4RNHA 4DPXA 3AD9C 3TA2A 1DQ9A 1J27A 4JI0J 4HDHA 2HHSA 2C1EB 1U4BA 3GG0A 2FTRA 4CHPA 4YDUA 3DLRA 2CQBA 4NLSA 3M8PA 3M1VA 1FVQA 2P9NB 4Z4FA 2OGUA 1D1UA 3G87A 2VONA 1EZZB 2OANA 1HI8A 3Q2TC 4FLXA 5IWAK 1YUWA 3GDQA 1FERA 2RH3A 3NVKA 3D6HB 2J0WA 1BQNA 1RT6B 2ERRA 4BLGA 3G71N 2WSFC 4PG5A 3JQJA 5M1OA 2VFSA 3BN4A 2BANB 3HI9A 5E3CA 4JI8J 1KSPA 4QS7A 5KPZA 5HLFB 3GIJA 4YOTA 4P9SA 1RZMA 3HKWA 3WDOA 3Q89A 2GTDA 4MMOA 4I4BA 3DLHA 1NOZA 5AQLA 1T05B 1XNQJ 4DV0J 4B3MJ 3IRXA 1PKUA 3HK2A 2MKKA 1RT5A 4ICLA 5H9EK 5FPEA 4IQXA 3QB0A 4CHYA 1F3FA 2A10A 1NZAA 2KN4A 4DX7A 3MCSA 2I8EA 1HBUB 3NFAA 3AOBA 3D28A 3ZC4A 2YQ0A 5L8RC 3R9LA 2DFFA 3MWPA 2BBEA 4USMA 2FLPA 1XR7A 4PQUA 4O0IA 4TVAB 2BQRA 2N7CA 1RKJA 2AYBA 4U96A 1JWWA 2W2NP 4C8ZA 2XULA 3LGMA 3HYFA 4YEAA 2DISA 3VAIA 3CXCR 2ZC3A 3CCEN 2QYGA 4HVJA 3HVWA 4M41A 3LDNA 1Z4UA 4NYFA 2ZZNA 2FC8A 3W60A 1U2VB 4X65F 2G2YA 1B9FA 4V1Ak 1B7FA 4H0OA 2P5VA 4P2SA 1R0AB 4B9NA 1T03B 3TA1A 3KFWX 3SIPB 5KFUA 2CJBA 3U9ZA 4E3SA 4JKEA 2M8DB 2E2NA 3R7BB 1BWVA 3CF5L 1WEYA 5KFTA 2D74B 4OX9K 4KGZB 1Q81O 1NKCA 3MM7B 5F8NA 1Y3KA 2V0NA 2DH9A 1FJGJ 5AXMA 2C22A 2VFRA 2DXEA 4GKJK 3MWTA 4BE1A 5F0UA 1U2FA 2PAVA 4LC9B 4F25A 5A8KB 3H5SA 3G96A 1WHWA 3IS9A 5J1EA 1T95A 3L09A 3AV9A 2EG2A 3IWXA 3MX5A 2R2UA 3DGPB 1NK9A 2MTLA 4DX5A 4YHHF 4KJIA 1HARA 1VI7A 1RCXB 1XMQF 1RT4A 1JMTA 1BIUA 3CFRA 4DS4A 1V4TA 3OTDA 3KJQB 2HVIA 2EI5A 5HAOA 1WACA 3PJ9A 4R79A 1NK8A 5DGAA 1IBLJ 4GO7X 2M9KA 4X4PA 3JXUA 4LRFA 5G0RB 2OFHX 2ZJQL 3ZX2A 1WNEA 3VQBA 4KKOB 4WPAA 4H4MA 1YITS 4WZMA 1B70B 4E2FB 4EYIB 2G1HA 1VQ5S 4IH5A 4GV6A 2NCKL 3L2QA 4RR5A 4RW6B 2HHPA 1TGOA 1O13A 2AQ4A 1S72N 3V6DA 2C2DA 2ILYA 1EX4A 1SCJB 2E88A 3ZLJA 3AD7C 4RW8A 4HR2A 4KYZA 2AYGA 4JK8A 4C0BA 4ZVGA 3LF0A 3HP6A 1TFWA 2NNWA 1JLEA 3OFHA 2OTLN 1FJEB 3GV5B 3U4LA 2C2ZB 1YJ9S 2CVIA 2HQIA 1UP1A 2WVBA 3NS5A 3FSYA 2ZM6K 2JGUA 2ZQBA 2CH5A 2P1JA 1S1UA 2PBDA 1YJVA 3T1HJ 2W2OP 3R7NB 4F3OA 5F8HA 4QWEA 1HNZF 4NLYA 4QWBA 3ITHB 3MPVA 3KK2B 3CVKA 1ZZFA 2XSJA 2ZJRQ 4WFYA 4DR1K 4OYWA 4CHNA 2P8IA 4ZCLA 5AQSA 2J9EA 3J81O 1G3OA 3P31A 2L48A 4DV6K 3AGRA 4IRCA 3AVIA 3MDQA 2AJQA 2QIFA 2O8CA 3SDEB 2WBNA 4DPYA 4A61A 1REGX 4CH7A 2WONB 4DZDA 2FHMA 4FPAA 1IWAA 3FZHA 5CZ1A 3IR6B 1BE4A 2B4OA 1YT3A 3KZBA 1LW2B 3T69A 3NGYA 2JWNA 4FPIA 2B9XA 3BSNA 2IJFA 1NSQA 1J54A 3KHYA 1RJJA 2JVOA 1U1RA 4TKTA 1S1VB 2VGMA 3U1NA 2UVRA 4WFAL 4IXCA 1CJKB 4DBQA 2YHBA 2V51B 3WNEA 4Q8FA 4IKFA 1HR0J 5M1KA 3R6MA 4CF1A 4YR2A 7AT1B 2FHOB 1PJ7A 1LQ9A 3CNQP 4P2XA 2X6NA 3BGFA 4K42A 1K1QA 1H2UX 4NRUA 1Q82O 1M5KC 4FWMA 4DUYF 1OY9A 3VETA 3DRRA 2KG1A 2M8HA 2M4MA 1N88A 3TTFA 3ZSYA 4RUBA 5KFVA 3WQTA 4GKKF 4KHQA 3GSIA 1N36F 4F3TA 4DG1A 3F0NA 1S0OA 2UXBJ 2X3GA 2MQLA 2GHPA 3AVLA 3D2WA 5AQFA 4YR0A 2UXDK 4GVMA 5AQTA 4URGA 2BKNA 4DR7J 3IM9A 1QS4A 3BZQA 4E7LA 3EWGA 4C6AA 1QE1A 4KRWA 4ZITA 1NK7A 4LF5F 1MWMA 5LSRA 2YBVA 2HHVA 4IG3B 1OO0B 3WX4A 4UY8O 2FIUA 2DRBA 2KXNB 2HEKA 3NGZA 5FLXO 1GMVA 4ZMMA 1S1WB 1N0VC 2XY6A 3H4BA 2DNPA 1NK4A 1KQKA 2HLTA 3PW5A 1FESA 3LDSA 4P2MA 3SQ1A 4FJGA 1I5OB 1HI0P 3HPOA 4LFAJ 4BDZA 3NCPA 1X31C 2J9DE 2R8GA 1M1GA 1WTFA 2O5DA 2P9PB 3P5BP 4RJVA 3EUNA 2QL7B 4CK1A 2LEPA 4FJKA 2DHSA 1RTJA 1VK0A 4Y2IA 3IG1B 1WC5A 2BUPA 4H0YB 2P9LA 2CJXB 3M3ZA 5AQVA 3IBWA 5M1FA 4M94A 4S0MA 3LPYA 2E29A 3CCLN 5JICA 5D4LA 3QEVA 2UYTA 1BA0A 3AVHA 4FWQA 4CM0A 2QV6A 2R9LA 1ZA2B 1N48A 3CGIA 2DPNA 4JI6K 1FXLA 4EEYA 4JI4K 4YY3K 1CQMA 4F0HA 4FCYA 3D6TB 3O08A 2IM3A 1HBOB 5LL6d 4JKHA 5AQUA 1E6VB 2DCLA 3NAIA 2V68A 2HVDA 3V81A 1BIZA 3SNNA 4K8ZA 4B8CA 4J5OA 2IDOA 1JLGA 2QT7A 2CVEA 2W9BA 4X4VA 5FLXY 2DXFA 1YDLA 5GAEP 3K0SA 4LFCK 1ITGA 3KG0A 3G6EN 4NLGA 4USWA 5CD4H 2RHKA 3A8JA 3RMCA 2YY3A 5HP1A 1AZSB 3IO1A 4PG8A 4BQZA 5KFEA 4TU9A 1MSWD 4DSLA 4RWTA 3BY5A 4NCAA 3SUOA 1T94A 2HQFA 4M3ZA 2YWKA 3JSYA 2DNKA 4Y0WA 3A8IA 2JEJA 3UI3A 4KTZA 4RUAA 3MM8B 2YQ3A 5IT0A 3UWTA 1UJ6A 1FRXA 3R5JB 5LXRA 5IWAJ 3VGLA 4W98A 2Y1LB 1NJIT 2D0AA 2YI1A 4URSA 3MR2A 2FHKA 2Q3SA 1N33K 3C6TA 2HAIA 2P6TA 1VRUA 2R8IA 1W25A 1F9HA 4QIFA 4M5HA 2G1DA 3T5LA 2NYHA 4HDGA 2F4VJ 2P9SA 3KVGA 3SBMA 3M30A 3OTCA 1ZAWA 2NR0A 3TZXA 3CD6S 3CMAS 3G25A 2HVEA 2DH7A 4LF2A 4ED3A 4J8FA 5J1PA 3C15B 4LFBF 5H9EJ 2HFVA 3MHYA 1N6QA 2MY8A 3AA2A 3LGHA 1VLOA 1M90T 1EIYB 1PILA 5DQHA 1JK9B 3ZSRA 4X4TA 2CQHA 3W5XA 2YKQA 2RKIA 1NM2A 2K06A 1BISA 2XY5A 3J7A1 2P9KB 3QGHA 2IM2A 1R8HA 3VQ9A 5KFIA 1JL2A 4DV4J 5E84A 1K0TA 1VQ4S 2CYYA 2GBZA 2FC0A 2PA3A 3TJ8A 4ZPDA 2FUG9 4CQ1A 1A7GE 2ETJA 4NEZA 1O6XA 1O8BA 4HI2A 3ZZPA 1TUUA 4G65A 1J5OB 3G4SS 4FBTA 4F3MA 4CI0B 1NHVA 4CZJA 3CJSA 4KHMA 1N34K 2R7TA 2VG5A 5KFBA 4YP3A 2XI3A 2V94A 1UWBB 4O3PA 2FSJA 3OYAA 1FNMA 4OJGA 4CLLA 3TUJC 4NLXA 3QDKA 2ZHAA 3AA3A 4Z4HA 4DDFA 1E3MA 4FVMA 3RRKA 3KNGA 5K14B 3ZSXA 4FNHA 1VBKA 3SPZA 4Q43A 4OX9J 4ILGB 3SQ0A 2L08A 2OPSB 4A48A 1EHWA 1SQKA 2HHHF 1GLEG 3PYGA 4AXJA 3AFGA 2F8SA 1RWPB 4FM2A 1SH3A 1NM1A 4GKJJ 2FBYA 1YI2N 2DYAA 2IMOA 5I3UB 2D9OA 3FBCA 4JOUA 2NSBA 2RQ4A 4JI1K 2XHWA 3QRPA 4RLEA 5HOOA 4EBEA 4FVCA 2Y1IA 1RTIA 2MKCA 4XH5A 3IC1A 1Y97A 1DTQA 1SV5A 4MFBA 2WBMA 1TL4A 5CE3A 3GFHA 4JD2A 4DR2K 2OAUA 5F8MA 1KAZA 1S77D 3P4UB 3HPHA 3EN9A 1RT3A 4QS9A 1T9TA 3VQCA 2VU5A 4B1UB 5AFUA 5CD4A 1S6PA 2PGCA 3RMBA 3W2WB 2ALZA 2FSNA 3FKBA 4WYBA 3MX2A 4I7FB 1ZTTA 2F8TA 1CC8A 1NGEA 2CQPA 4W5TA 4JKCA 4BWJA 2YNHA 3N6MA 3PZPA 1IBKF 2UUBF 1S49A 4OIXA 4E7HA 1HKGA 2W7PA 1F0XA 2HB5A 5HANA 2Z1JA 5BJRA 2EX3A 3DXKA 1LKZA 1UPPA 1UAWA 2NRWA 1KCFA 3M2UA 3M32B 2A3JA 1GX5A 2RDJA 1FD2A 2XNQA 4PYDA 4L8RB 4CJTA 1NKBA 3FZKA 4NMXA 4ZP7A 4DTOA 2MKJA 2LFVA 3EXCX 3GFXA 2CUYA 4ECYA 2H51B 2VQFK 2PE8A 3I5BA 5D6GA 2BJDA 2VPYB 3AA5X 1E6YB 5I3PA 2C42A 5IT9O 2ZJPQ 2EFNA 4B1WB 4ANCA 2QLWA 2AGQA 4B9LA 2ZM6J 4YS2A 3QICA 1URRA 2POKA 4ZVOB 5F0XA 2P9NA 2Y1JA 3M6VA 4A2BA 3T1YF 4BRDA 2QWOA 2IOCA 3MMBB 1TV6B 2A42A 1RBSA 1VISA 2GX9A 1GX6A 3KK7A 2A6OA 2R7XA 2R8HA 2UU9K 5KG5A 1HWKA 3NMRA 2E9ZA 3BO3A 1U1PA 1CSJA 3V5RA 1RT6A 4BC2A 2YHAA 4DV6J 4MDAA 1V5VA 3MDFA 2EC0A 2BANA 3TZYA 3AARA 4EUVA 2KI2A 2V4JB 2GMLA 3EVMA 2GJFA 5HLFA 3ZCMA 3RAQA 1HL6A 2D4WA 2F7VA 2DGVA 5K8NA 4USUA 1FNXH 1D4XA 2WAQD 1YJWS 3SFUA 4CZLA 1RADB 3VQTA 3MXMA 3CCQN 2GVDB 3GG1A 3HT3A 1PC5A 1YIJN 4ECUA 5CXTA 5BN8A 2X74A 5KG1A 1RWOB 4TLQA 4DB3A 3D6RA 2MPUA 3CXCM 4WF9L 3AO3A 5GAEI 4ZCKA 4AE5A 5IT9Y 3O8MA 2I9SA 2XMTA 4KT0C 2YNGB 3OR2B 1Q53A 2DO4A 4F2SA 2ABYA 1VRTB 4ILMA 4DR3K 4WIIA 2MZTA 3KMQA 3L7PA 1BI4B 4HVZA 1WKLA 4A5BA 5KT2A 1QD1A 5IT4A 2EEYA 4FJNA 3R5GA 1RILA 2FZGB 5LMNK 5IQ6A 3W8PA 3DXMB 2DR5A 2CIMA 3HULA 3FSIA 2OYQA 3I9V9 4MKYA 1FRMA 5ETRA 1D9DA 1YX2A 4BRNA 3VAMA 1SC6A 1PJ6A 4RKUC 1IJJA 1U2VA 3MUMP 3MN9A 1U09A 5D0GA 4P52A 1R0AA 1T03A 2VG6B 3CCZA 5HROB 3NH2A 9ATCB 4J9KA 4X4UA 4DV1K 2KKZA 1IUJA 2KB2A 4HH1A 3QGPA 2G8KA 4KBIA 3CJ2A 3H5YA 3N4WA 3FQKA 3HVRA 4Z4EA 2H65B 3J7AP 1LAVA 2ROGA 2NSCA 2D1KA 2KW4A 2YKNB 1Y5IB 4ZHRA 1GOCA 1HQUB 2HG4A 2VA3A 2NREA 1CXUA 5A8KA 4UY85 1D5AA 4M3RA 1EETB 4GMJB 4A5AA 3DMJA 3CDBA 2QL9B 3DGPA 2ASYA 4FWKA 5GMEA 5D4PA 3HRGA 4DR6J 2R7OA 3HSJA 5EN1A 4DL2A 3O44A 5HQMA 3ATUA 4C8MA 1X3MA 3ZETA 2DR7A 2GVZA 2HFSA 2AV5A 3OYHA 2GAGC 4NXMK 5ADXH 3SMPA 2HF3A 4Y65A 3OHAA 4LF9F 2F9DA 3ZXWA 1K0VA 4EIAA 2BOPA 1HNVB 1QHTA 4DXLA 2PT0A 4CT8A 5KTQA 1OIAA 4FJLA 2VFTA 2BVZA 3WNHA 2DPJA 1C0FA 3NH1A 3OD2A 1PSDA 1RWXB 2YWGA 4YY3J 3PO4A 2L41A 2L9WA 1QLNA 1FJCA 1PBUA 3Q8PB 4BREA 4RW6A 2RRAA 2HQGA 2OSQA 5D77A 2ITMA 2QZ8A 2VFUA 1SJRA 3H2VE 2H4WB 1SIWB 2W2PP 2VDHA 5JJBA 3MR7A 1MA9B 3NCQA 3UD3P 1XC3A 1UETA 1SC3B 4WFBQ 1APSA 4LF6F 2OMOA 4LFCJ 4ZLNA 4ECRA 2FXUA 4C8YA 4BR9A 1TMJA 1PC4A 3RBZA 1F21A 3K8VA 5C2GA 1JXBA 1FK9B 2MGZB