1S9GA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r120394.
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
543
structure length
543
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 141
structure length 543
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s9gA05
3SFGA 3H5XA 4HUGA 4DL3A 1L3VA 3DLBA 4FJGA 2W9AA 5KG2A 3RB3A 3KTQA 4ECQA 2HNYA 3MR5A 4Z4HA 1S1WA 1HNIB 3SQ4A 3G6XA 1C2PA 4I2PB 2YHAA 1TP7A 3MFIA 3B6PA 5KG4A 1XHZA 5JXSA 3PJXA 1S0NA 1T03A 1D5AA 3DMJA 4DS4A 4H4MB 1SH0A 1RDBA 4QWBA 3DM2A 4DTJA 1QE1A 1NJXA 1ZTWA 4Y3CA 2ILYA 2ZE2A 4U6PA 5F9LA 4TXSA 3SV3A 1B92A 4E19A 4W5NA 4DSKA 2G8WA 5DG7A 4CEFA 1TKXA 3ZSQA 2WCXA 2BQ3A 3HVAA 1VSEA 1WSIA 3E01B 4FZYA 3OHAA 3NF8A 2G8VA 1SV5A 4J9KA 1NKBA 1JLGB 2ASDA 2WOMA 1KFDA 4E7LA 1Q8IA 4HVJA 3I0RB 4F4ZA 3OLBA 3L3UA 3NL0A 3EY1A 2Z1JA 2F96A 4BWJA 1S49A 3KK1B 1W0HA 1S1WB 4DSJA 5K14A 4W5QA 5F8NA 4RW6A 4M45A 4MK9A 1QQCA 4CK1A 1N56A 3OYGA 4Y1DA 3KHGA 4AHTA 1I3AA 1T03B 4AHRA 3OYAA 4IRDA 2R8JA 2IMWP 2BGGA 1TKZA 4ZTFA 1LV5A 5KFXA 5HRSA 3U3GA 1U4BA 5KG1A 4KHUA 4RUAA 1TKXB 4O4GA 1HJRA 4CJTA 4NLDA 4H4OA 3ITHA 4FS2A 3KJVB 2G8HA 1S10A 4NCAA 3SYZA 1VSMA 1W9HA 4FJHA 4B08A 1D8YA 3MAQA 1QUVA 3IRXB 1XR6A 1C1CB 2KTQA 1C0TA 3H5UA 1K6YA 3SUQA 4O3NA 4LH5A 1WSFA 3C6UB 3NMAA 1HQEA 3DRSB 1JXEA 3HPOA 4KTZA 2OYQA 1RTIA 1HYSB 1S9FA 4KHWA 3OHBA 1S6PA 1Z4UA 4ZHRB 2QXFA 5HLFA 3BSAA 4TSXA 1R0AB 1S0OA 3IG1A 4F4XA 3CFOA 1C1BB 1VRUA 4J2BA 1J53A 1ZBUA 4ECZA 2B4JA 4J2AA 4DG1B 1Z25A 5KFSA 3M8PA 5CYQA 3N6LA 1SUQA 1BQNA 3AO4A 4HHTA 2OZSA 3CIZA 2RDJA 2IGIA 3PV8A 3HXMA 4O4GB 1HPZA 1JXLA 4DTOA 4DS5A 3SUNA 4EBCA 3ZT4A 4FW2A 2R2TA 1IKVA 2D5RA 1C1AA 1NK6A 3V81B 1S4FA 4FLVA 4FLUA 3KHRA 3HP6A 1NNDA 3UQSA 2C2DA 3V6KA 3KLEA 3DLGA 4CF1A 3OL6A 4FJLA 1KSPA 2JGUA 3L2RA 2X74A 1YTAA 4FJIA 2AX1A 4FJMA 2UVWA 1DTQB 3K5LA 5F8MA 3SJJA 2KZMA 1HNVA 1LWCB 4CHZA 1HQEB 2D3UA 1KRPA 4ZVHA 4R5PB 3ZSZA 4WYWA 4CHYA 4ID5B 1RTIB 3RTVA 2OPPA 2XY7A 2HW3A 1S6PB 4MK7A 4CF0A 3OLAA 3GV7B 2YHBA 4WE1A 3ASMA 4CGDA 3D45A 4O3SA 2D3ZA 3G10A 2XWYA 4ECRA 1IKWB 3IG1B 1SL2A 1HYVA 3AO1A 3MECA 5EUHA 3U6FA 4WZQA 4DFPA 2R8GA 1RYRA 3SPZA 1IKYB 3M8PB 5CYQB 5KFNA 1BQNB 5F8GA 2JEIA 5DG8A 3AVFA 4KHSA 4ID1A 1CXUA 2ALZA 1KHVA 3V4IA 4EO6A 4FVMA 3KLFA 4WFZA 1RBTA 3O3HA 3LZIA 3I0SA 4M3TA 3AVKA 3HVTA 3V6DB 4URSA 1YVUA 3LDSA 4QWCA 5EWEA 2W9CA 4J9NA 4EBDA 3G0ZA 4WXOA 2QKKA 2YNFA 4O3RA 3JYTA 5KT7A 2VA2A 3AVCA 4N5SA 4OL8A 4DTSA 1RNHA 4HUFA 4ELTA 4FZXC 4FJNA 5HP1A 3U3YA 2XCAA 2YNGB 3A2FA 4JRQA 4KV8A 1S6QA 4HYKA 4IKAA 1S1UA 1N5YB 3CDEA 3NBPA 4K4XA 3DLKA 3HYFA 4QWAA 3ZT1A 1NK7A 1TVRB 1WLJA 4J9PA 4WE1B 3TABA 4AH9A 4KE5A 3LPUA 1JLAA 4KSEB 1TL1A 3SNNA 4NCGA 3S3MA 1SL0A 1S1TA 2X6NA 1EXQA 2B6AA 4PUOA 4Q8FA 3BSCA 3KK2A 3KLIA 1CXQA 4RNFA 2J6UA 4Z0UA 3RAXA 3N6MA 3G6YA 1T05A 2E9RX 1U48A 4OGEA 5KRTA 1JLEB 3DOLB 4LSNB 5FROA 2QKBA 3I0SB 4PY5A 4EP5A 4CJKA 4RW8A 3HVTB 2Z1GA 1JXBA 5HBMA 3H08A 4LH4A 1IKXA 2W9CB 3S9HA 1QAJA 3L2UA 3VQ6A 3QGGA 1BIUA 1CSJA 2R8HA 1YTUA 4G1QB 2UUTA 1TK5A 2YNFB 4N41A 4IG3A 3ZSYA 1RTJA 4OKEA 4KO0A 4CJLA 2GBZA 3IGVA 4XIUA 5CY4A 1S1VB 4K50A 2YKMA 4DTUA 2OPSA 1UAXA 2VA3A 1BL3A 1D0EA 4OPJA 1LWEB 2BDPA 4E7KA 1U45A 3NBPB 1T3NA 4EZ9A 5J2MA 3EZ5A 5KFVA 4Z4CA 3PR4A 2XCPA 4CJEA 4IOBA 1XR7A 3QGHA 1BIZA 1JLAB 1JLBB 1BQMB 1TL1B 1D9FA 1S1TB 4R8UA 3ULDA 4PUOB 3QIPA 4ED8A 1SH2A 3KLIB 3BREA 3IN5A 3MR2A 4DL4A 4H8KA 2BR0A 4WXWA 1CLQA 4AHVA 4RW4A 3GILA 1XWLA 1BCMA 2BANA 4IH6A 4AILC 2FBTA 4OGCA 1GX5A 4CESA 4GC6A 4OKKA 1L3SA 1QSSA 2G8FA 3PW0A 4WFYA 1TL3A 3KK3A 1IKXB 4PQUB 1FK9A 3V9UA 1JIHA 2XO7A 4KI6A 4BDZA 4O3PA 5KT3A 1QTMA 5EWGA 3VQ9A 5KFZA 4DWIA 4PWDA 4KO0B 3ZSWA 4DSLA 2FBYA 4DQIA 5CZ1A 2OPSB 4YR3A 1KTQA 4E7JA 3MF5A 4E7HA 3E51A 1JLQA 1BCOA 3CYMA 4FW1A 3MEDA 4KAIA 1RYSA 4CJSA 5EDWA 2J6TA 2VG7A 4R8UB 2R2RA 3QIPB 2WRMA 4DLEA 4AHUA 4ED2A 3DLRA 3THVA 1NJYA 1WN7A 5I3UB 5DQGA 3T3FA 4NCBA 2A1RA 1VSJA 2QV6A 4BE2A 1FKPA 4RW4B 3DLEA 2BANB 1RT6B 4ZP7A 2D0AA 2AGPA 4CEDA 2OH2A 3G6VA 2ILZA 4ECWA 3OYHA 2FVCA 4K4WA 2ATLA 1S9EA 4OLBA 1MU2B 2R2UA 3RMCA 4GMJB 5SZTA 3HJFA 1TL3B 3KK3B 3KMSA 4FJKA 4H54A 3DLHA 1FK9B 4NLXA 1U04A 5CYMA 2V4QA 1HNIA 1HMVB 4I2PA 1WAFA 4JLHA 5L1IA 1Q9XA 1RT5A 1BGXT 1IO2A 4KB0A 5KFJA 3TARA 4B9TA 3SUPA 3CJ4A 3LP3A 2O4IA 4TLRA 1J5OB 2DFFA 4N76A 1JLQB 4XPEA 3QESA 5C42B 1KFSA 5KFPA 1D9DA 4QCLA 3GIIA 3TAMB 3FDSA 4N47A 3MEDB 1GX6A 1UOCA 4ZPDA 4FJ9A 1BI4B 3ALYA 4B8CA 2C28A 4F4YA 4E1NA 3G86A 4DTXA 1JLGA 4BDYA 1S0MA 4CIGA 5J2PB 1YVFA 3NH2A 3F73A 3DLEB 1SKRA 4M3YA 3I0RA 4KB7A 4NYFA 2W8LA 1O1WA 1S9EB 1ZBLA 3BGRB 4BWMA 1NKEA 2IOCA 3KK1A 4Y1CA 3M8SA 5CYMB 4TYBA 4Y34A 2I5JB 3OJSA 5I42A 3AVGA 1ZETA 4DU1A 3JSMB 1RT5B 4NLGA 2KW4A 4BDPA 3HO1A 4YR0A 1HYZA 5KFEA 1RT2B 2GV9A 4KHMA 4ZPCA 4FM2A 4KPYA 3H4DA 4MIAA 2BE2B 3BDPA 4J9OA 3QNOA 1TV6A 4CFCA 3VQ8A 4Q44A 3H4BA 5T7BA 4BE0A 4F3TA 4IH5A 2HHSA 4R0EA 5KT6A 2HVHA 3ZSOA 3KJVA 1HARA 3NGYA 3AVBA 3P83D 2G8KA 3AV9A 3LWLA 4FCYA 5KFRA 3NGZA 3IRXA 4QW8A 4CJPA 1C1CA 5HRNA 2YNIB 3ZCMA 4NRUA 1RA7A 1WAJA 1EETB 3GYNA 5KFYA 2XHBA 3UPFA 4RUCA 3UR0A 5EWFA 3C6UA 3N6NA 2XY6A 3DRSA 5I42B 3GV8B 1JL2A 5KFIA 1HYSA 2HB5A 1XR5A 4FM0A 4ECYA 4U7CA 3VQBA 4ZHRA 3KLHB 4TN2A 4DTNA 4K4ZA 3HVRA 1YT3A 2E6LA 3LAMA 1R0AA 4DFMA 3OS2A 1A5XA 2IM1A 2UUWA 1C1BA 5KFOA 4DEZA 3M8RA 3BSOA 2FVPA 1Y97A 2OPRB 2P1JA 1TV6B 4DG1A 5DK5A 4RNNA 3GIKA 4IR9A 4B9NA 3OYCA 3CJ2A 3O4QA 4CEQA 2V9WA 1XI1A 1SKSA 1WSGA 3LPTA 3OVNA 3OSNA 3V81A 1RT3B 1RBVA 1RILA 3I5AA 2D41A 2ASJA 2NUBA 4DMNA 2ZD1B 4HCCA 2A1SA 1RT1B 4J9LA 4CGHA 4FLYA 1L5UA 1LW0A 3OYDA 4CJ3A 4O5BA 3GV5B 2P5OA 4CJVA 4KHNA 1DTQA 1KHWA 2RDIA 1WSJA 1ZBHA 3DOKA 4FLTA 1LWCA 5KI6A 5DLGA 3IS9B 4R5PA 3WNFA 1TAQA 4DL6A 4ID5A 4TY9A 4ED6A 3Q8SB 2AWZA 3VQQA 1X9SA 1W25A 2JC0A 1NJWA 4RW7B 1IKWA 5F9NA 3OYJA 2Y1JA 2E9TA 3OL9A 5KG6A 5DLFA 2EHGA 3TAFA 4TQRA 1U47A 1IKYA 1NOYA 2HNZA 2FBXA 1GOAA 4O3OA 3LP2A 1KVCA 1A5WA 2FBVA 3MXMA 5F8IA 4ZP6A 4EEYA 2GIQA 5DQHA 2IDOA 3QYYA 4FJ8A 3HKWA 3Q8PB 1QSYA 2AGQA 1JKHB 3AA4A 4N56A 4FK0A 5J2NA 4K8XA 3V6DA 3NH0A 4FLWA 4M3ZA 4YMEA 3P5JA 5KG3A 1TKTA 5C25B 1LW0B 4OJRA 3DRRB 3PW2A 3VQEA 3KOAA 2EC0A 2VG5A 2D0BA 5J1EB 3CDWA 1NOZA 3TAGA 4J9QA 2YKNB 1FXXA 3DOKB 1OS5A 2YNGA 3ZT3A 3PUFA 3ZSRA 1N5YA 4B8AB 3ZSXA 2HNDA 3OJUA 3KMQA 4Q5VA 3TR8A 1S1XA 2AQ4A 1TVRA 4DSIA 1IM4A 1JL1A 3VA3A 5C24A 2D0CA 2YV0X 2IA6A 1UWBB 4ZMMA 4CGIA 1RDDA 4CJRA 4Q0BB 3DDKA 1DLOA 3V9SA 2IJNA 3VQ4A 1RBRA 4OLAA 2HNZB 4I9LA 1CZBA 3NF9A 2G8IA 3LP2B 1TAUA 3PW4A 1JLEA 4F2SA 3DOLA 1ITGA 4LSNA 3KIOA 4GC7A 1QAIA 4J9RA 2FC0A 1JLFB 4MFBB 5J2NB 4WFXA 1LAWA 1A5VA 2HHVA 4I9QA 5FRNA 2PYLA 4JUZA 1X9WA 4ZVEA 4DSFA 1C0UA 3O3GA 1TKTB 3DRPB 4G1QA 4NLOA 3OSPA 3SI6A 4CFDA 2VG5B 3OYFA 1T7PA 3NAHA 1S1VA 2B43A 1U49A 3QERA 3TVKA 1NHUA 2F8TA 2JEJA 4HTUA 1LWEA 4E1MA 2WK4A 2HNDB 1BHLA 2FVRA 2R7YA 1RTHB 1SKWA 1S1XB 2DY4A 3QEIA 2VWJA 4C8OA 5C24B 1JLBA 1BQMA 4IDKB 2R8KA 1U09A 1VSIA 1DLOB 3PHEA 4JV0A 2HHWA 4CGFA 4FJJA 3LP1A 4URQU 5KFTA 4RNOA 4EO8A 3LALA 2R8IA 4KREA 4FJ7A 1WNEA 5KTQA 4OPKA 2BQUA 4NLUA 4DF4A 2C2EA 1J9AA 4Z4EA 2GIRA 3KNAA 4MKBA 4PQUA 1C0UB 5HRRA 3HPHA 1HQUB 3CM5A 3EYZA 1RTDA 2OZMA 3NHGA 4LQ9A 4ECXA 4QWEA 2LSNA 4DLGA 3TQ1A 3HVWA 4FK2A 4LSLB 3SFUA 2W7PA 3KD5E 2FLLA 1RDRA 4E89A 3T5JA 2XY8A 1NHVA 2R2SA 2FVQA 3ZSVA 3QIOA 3QNNA 5KG0A 2HHTA 3T19A 3AA3A 3MR6A 2OA8A 3CQ8A 4C8MA 3NF7A 2Q3SA 4CF8A 1KVAA 1L3TA 1T94A 5I3UA 2IC3B 3V6JA 1RT7B 3RBDA 3LP1B 4IFVB 2DPJA 2Z1IA 3IGNA 1RT6A 4CGJA 3OYBA 4O3QA 3Q8QB 1EX4A 1MU2A 3I5BA 3AVLA 3OYNA 1XC9A 5KT4A 2WHOA 3SPYA 3EPIA 3VQCA 4ZVFA 4RNHA 3RB0A 1ASUA 2IBKA 1HMVA 4OKJA 1VSFA 5JUMA 4X2BA 1RTDB 2PZSA 3RMBA 2HMIB 4J9SA 3I5CA 5KT2A 3HM9A 5KFUA 3OYKA 4NYNA 3QIDA 2OPQB 4JRPA 1J5OA 1EP4B 1NK0A 5C42A 3TAQA 4NYZA 3MR3A 5F8JA 1VRTB 2EX3A 3TAMA 2Z1HA 4CEAA 3S3NA 2RPIA 4CFAA 1JLCB 3AVNA 1BI4A 3QEPA 3RMDA 1LAVA 4FJ5A 2BRKA 4O4RA 2AJQA 3V1QA 3RB6A 5T14A 5J2PA 2ZQBA 5DMRA 4HKQA 3SCXA 1QHTA 4M95A 3CVKA 3HT3A 3T1AA 1F21A 3TI0A 4DFJA 3AA5X 3BGRA 4MK8A 3TWHA 3AO5A 4JS5A 1ASWA 1LW2B 3QETA 5F8HA 4K8ZA 1UA1A 2I5JA 3KHLA 2JEGA 3KD1E 4Z4GA 3MFHA 1N48A 3PW5A 2ASLA 3M9NB 1IG9A 3JSMA 4CF9A 3CDUA 3V9WA 4B9MA 2JC1A 3O4NA 1RAJA 1D1UA 3V1RA 4NLYA 1G15A 4AHSA 3QINA 4RZRA 1RT2A 4F50A 3H5SA 5KFKA 3LP0A 2P5GA 4EZ6A 4C8LA 2FJXA 2BE2A 4M41A 2W7OA 1TGOA 4FLZA 3KLGA 4ED0A 2RKIB 1I6JA 3MEGB 4ICLA 4ECTA 4CEOA 5KRSA 2VG6B 3K58A 3BQ0A 5KFWA 1TKDA 5L9XA 3RMAA 5J2QA 4KHQA 3K57A 4O55A 4PA1A 1EKEA 1XHXA 4Y2CA 4DQQA 4ZPAA 2IM0A 4NLRA 3H40A 2HWHA 4L8RB 4ZTJA 4DFKA 3CFRA 5KFMA 4ZPBA 2B5JA 1N4LA 2DFEA 4Z4IA 2YNIA 4CECA 5KFDA 3PX0A 3OYMA 4NLTA 1EETA 2XY5A 4YFUA 3QLHA 3OS1A 4K4UA 1MMLA 5FDLB 4LD0A 2FLPA 3K5OA 2V0NA 3BQ1A 2GUIA 3BQ2A 2F8EX 4K4TA 4KTQA 4M94A 3KLHA 2RF2A 2AU0A 3C94A 5HRPA 4BE1A 2XGQA 4KFBA 2VWKA 1FKOA 3LP0B 1N6QA 4O0IA 3NGIA 2E9ZA 4NLPA 4CJFA 2OPRA 4K4SA 4DF8A 5L1LA 1LWFB 3KLGB 5KFFA 1NK4A 3PO5A 5D3GB 4ICLB 4ED1A 3KHHA 4DL7A 3WNHA 4IRKA 4F8RA 4J2EA 3L3VA 2UVVA 5J2QB 3NE6A 3AVIA 1RT3A 1ASVA 2UVRA 4F3OA 2ZD1A 3S3OA 4ED3A 1RT1A 2P51A 3AO3A 1X1PA 4IG0B 1C6VA 3RWUA 4C8NA 2W42A 3PR5B 3MTKA 4RW9B 3SUOA 3FQKA 2B5JB 4CIEA 4ELUA 4M3UA 3BJYA 1QS4A 2W8KA 1HRHA 5F8LA 3QLHB 4F4KA 2KFNA 3AVAA 1UA0A 3IS9A 3PJWA 2IM3A 4KRFA 1DTTA 4QPXA 3B6OA 3VQAA 2YNHA 3MXIA 5DGBA 1RDCA 3V6HA 4YQWA 3OYLA 2RF2B 4RU9A 4RW7A 3KLVA 4KFBB 2KZZA 4KB1A 2HNYB 1FKOB 1N6QB 1VSLA 4DQPA 4NLQA 1BISA 3FFIA 3DMJB 3D5MA 4ZVGA 5KGXA 2O4GA 1RBSA 4JS4A 4W5OA 2QK9A 3FSIA 3RR7A 5KFLA 3DM2B 4HUEA 4B9SA 4EYIB 1CZ9A 1QE1B 3RAQA 1JKHA 3NFAA 2DPIA 2ZE2B 4DSEA 4KTWA 5KFHA 4ZP9A 1KLNA 1T8EA 5C25A 4QWDA 4CEEA 5KFCA 3DRRA 5DGAA 5JS2A 3NAIA 3RR8A 1SV5B 5J1EA 3FQLA 3V9ZA 3MXJA 1GOBA 4I2QA 3T5HA 1NK9A 2YKNA 4CK3A 3T5LA 3OYEA 4CJ5A 2WOMB 4W5RA 4J2DA 1ZBIA 2HVIA 4LY7A 4J9MA 4MKAA 1DTTB 4TQSA 3BSNA 4KBIA 2YNHB 4DU3A 4IFYA 3T5KA 4E3SA 3OL8A 5EU7A 5E41A 1WNSA 1ZBFA 3K2PA 5K14B 3D28A 1UWBA 2GC8A 1X9MA 4RW6B 4URGA 3CWJA 4Q0BA 2G8UA 4Q43A 4FM1A 2RN2A 3FFIB 4F2RA 1C0MA 2DFHA 3VQ7A 2HWIA 1Q9YA 1KCFA 1TKZB 3QZ8A 3RRHA 3LWMA 3ICLA 1JLFA 4MFBA 4CHNA 1SH3A 4KKOA 5KFGA 1K1SA 2XRIA 4O0JA 5KG7A 4F4WA 3CJ5A 3DRPA 2PYJA 4EBEA 1ZTTA 3AVMA 1KLMA 2UVUA 4H4OB 3ITHB 3SQ0A 3ISNC 4I2QB 3V9XA 2E4LA 2O5DA 3SQ2A 2ETJA 3OS0A 4E7IA 4DL2A 1VSKA 1S97A 3H98A 3HPGA 1RTHA 3VQSA 4IFYB 3PO4A 3NF6A 1C0TB 3GIMA 4DL5A 4CCHA 3L8BA 2HHUA 3I8DA 2X6SA 3K5NA 4IDKA 1JX4A 2F8SA 1GOCA 3ISND 2IS3A 4QAGA 4FYDA 3EPGA 5HLFB 1S9GA 2DTUA 4MQ3A 1S5JA 4JV2A 3CG7A 4W5TA 2XI2A 1VRUB 4ECSA 1TK8A 1RCHA 3QEVA 4C8KA 2FJVA 3V1OA 4KKOB 4M3WA 3L2VA 4DU4A 3M9OB 4B9UA 5JS1A 1SUQB 4Q45A 4DQSA 4FBTA 3UIQA 1HPZB 1HQUA 3QGIA 2AGOA 4KI4A 1NKCA 3H2LA 3Q8RB 2IJFA 2JLEA 1IKVB 1KLMB 4ELVA 3QO9A 4MH8A 3BR9A 3TAEA 4LSLA 2E6MA 3KLEB 4YNQA 3DLGB 4FZZA 1ZYQA 4Q8EA 3CM6A 4QOZB 4NRTA 4K4VA 3H59A 3OYIA 5L1JA 3PX4A 3C6TA 3QEWA 1HNVB 3PZPA 4IH7A 3CFPA 1REVA 4CEZA 3WNEA 2J6SA 5DQIA 4QW9A 3KKSA 2OPPB 2IC3A 1RT7A 3PW7A 4IFVA 1S48A 2D7SA 3L2QA 2FVSA 5DG9A 4CK2A 4FBUA 2FLNA 4IQXA 1S9GB 4CF2A 4DTPA 3HSTB 1NK5A 3TAPA 2FJWA 1RA6A 3L2WA 3MECB 4G3IA 3DYAA 3HK2A 3OY9A 2HAIA 1VK0A 3AA2A 1WSHA 4FLXA 3HP9A 3SV4A 2CKWA 4B9LA 3V4IB 3C95A 4LQ3A 3KLFB 4AHCA 3M8QA 1NK8A 4ECVA 4RNMA 3FRZA 2HMIA 4CJQA 4KHYA 3WNGA 3MEEA 3PVXA 3VN5A 3QO9B 4KHRA 2C2RA 2OPQA 3NAEA 1EP4A 3D0PA 1RT4A 1WSEA 3JYTB 1VRTA 4ECUA 3HHKA 3VQPA 4JV1A 4FK4A 3H5YA 2IAJA 3IAYA 1JLCA 4IRCA 4RG8A 4B3OA 5HP1B 3C6TB 4Z4FA 1REVB 5L1KA 1I39A 4KV8B 4K4YA 1S6QB 1B9FA 3UDLA 2AX0A 1S1UB 3CJ3A 3DLKB 3NDKA 3TANA 4CEBA 5SWMA 2XC9A 2XGPA 1NJZA 4DTRA 3PX6A 2X78A 4NCGB 4CE9A 3QZ7A 2HHXA 3DYAB 4OVLA 3RBEA 2B6AB 3ZT2A 3DI6A 3KK2B 1LW2A 1QSLA 2W9BA 5HROA 3OL7A 4YP3A 5C5JA 4GVMA 3CJ0A 3NKYA 1VSDA 4CJWA 1T05B 3PY8A 3M8QB 5KFBA 4CJUA 2ZKUA 3MEEB 4O44A 4TY8A 2WONA 4RW8B 5KG5A 5HBMB 5KT5A 3O3FA 4TYAA 3ZT0A 1VSHA 4NLSA 3F9KA 3NGDA 3P1GA 2KQ2A 4MIBA 3KKRA 1RT4B 1K1QA 4IG3B 1RDAA 1RTJB 4WZMA 2IAJB 4E0DA 2RKIA 3MEGA 2CJQA 3K59A 2VG6A 2YKMB 4B3OB 4I7FA 3RRGA 4HCBA 4BACA 2I1RA 3LANA 5J2MB 1SL1A 5KGWA 2WTFA 2ATQA 4M42A 4IKFA 3LAKA 4WYLA 3AO2A 4NZ0A 2Y1IA 3DI6B 3M9MB 4CHOA 4CHQA 4NLWA 3HL8A 2KFZA 2W9BB 4CFBA 5HROB 4UQGA 2QE5A 4M3RA 3SQ1A 4CIFA 5FDLA 4XPCA 2XI3A 4EP4A 2HHQA 4DTMA 3GIJA 4KAZA 2V4RA 4O44B 4TY8B 2WONB 3SI8A 3RB4A 4ZP8A 1TQLA 3VQ5A 4DQRA 1J54A 2JEFA 3LZJA 4CERA 1RBUA 4IR1A 2IM2A 3QEXA 4IBNA 2BRLA 4PWDB 4B9VA 1B9DA 1LWFA 1TK0A 5D3GA 3NCIA 4GW6A 4H4MA 3VA0A 4CGGA 5KFAA 2PY5A 3CO9A 4I7FB 5KFQA 4M3XA 4CJ4A 5CZ2A 1Z26A 1IH7A 4IG0A 5FRMA 4Y2AA 3AVHA 4EYHB 3NH1A 4RW9A 2C22A 4FS1A 1L3UA 3E01A 3AVJA 4CHPA 2VG7B 4FXDA 3GQCA 2ITGA 4XO0A 3EZUA 2BQRA 4FJXA 4NLVA 3K5MA 3VQDA 1KVBA 1FKPB 4YR2A 2WB4A 3SZ2A 4ED7A
chains in the Genus database with same CATH superfamily
5M2RA 1YJTA 3Q22A 4DL3A 1L3VA 2NRTA 3J80U 4DV2F 3RB3A 3KTQA 4ECQA 1S1WA 2OD4A 3O8WA 1C2PA 2YHXA 3IMXA 1TUUA 5KG4A 3ATVA 3MCNA 3WQUA 2LQJA 3O9TA 3SXLA 5JXSA 1J6ZA 5B0FA 4DS4A 3UKUA 4ISEA 3DHWC 2E5LF 3EZWA 4Y3CA 2CPXA 4U6PA 3MUTP 3SV3A 5BN9A 1REGX 3CCRS 4XEIA 4DSKA 2G8WA 2WUSA 1SJFA 3HVAA 2CJKA 4DCJB 1DRZA 4DHVA 3PYFA 2WOMA 2DGTA 1GXTA 4HVJA 3I0RB 4KH0B 2Q6CA 3VCDA 2J7KA 3MPWA 4GVEA 4DV7K 4LF8F 5TKYA 3L3UA 2GO9A 1FDDA 2QI2A 3EY1A 2F96A 4BWJA 4H0PA 4U67L 5E2QA 4DPYA 1MN9A 1XIQA 4DSJA 4W5QA 3Q83A 3SSSA 3R6MA 4MK9A 3T69A 1ATNA 1XMQJ 1I3AA 2FY1A 1T03B 3OYAA 2VICA 3J7YP 2IDLA 1TKZA 2C3YA 1RWWB 1IR0A 3EX7B 2RUGA 1H73A 2DR5A 1A6LA 3CMQA 1CQNA 4QS8A 1U4BA 1YVNA 1WC6A 4KBOA 4IYQA 3CULA 4O4GA 1S4EA 4CJTA 4HWIA 3OW2R 5JJBA 4FS2A 3KJVB 2G8HA 2VFSA 1KONA 3PRBA 2ZHOA 3O44A 1VSMA 4B08A 1BOTO 3GYGA 3D3CJ 1HFEL 5HOOA 5LM7E 3H20A 2E2PA 1EKSA 4J9VA 4ZVOB 4DPOA 4PYAA 1RWUA 3FSYA 1AROP 4O3NA 1S99A 3TOQA 3VVTA 2BA9A 4LH5A 2X51A 3AA9A 3NMAA 3DRSB 3HF5A 1NB7A 4CYUA 2WZ1A 2I9SA 4KHWA 2H3EB 2JH3A 4ZHRB 2V7ZA 2M5YA 5CZXA 4TSXA 1R0AB 1S0OA 3IG1A 3DOMB 3PCOB 3JAMO 1C1BB 1VRUA 5CAAA 4ED5A 3GBTA 1X4HA 2XMAA 5AR0A 3PDNA 5CYQA 3N6LA 4LFCF 3AO4A 2HG4A 5KOXA 4EIAA 4GNIA 4HHTA 2RDJA 2LEAA 2IGIA 2VONA 4DTOA 5HJXA 4X4SA 4DS5A 4IEEA 2XBPA 4EBCA 1IKVA 2LDIA 1S4FA 1OO0B 2Y8WA 3O9QA 1WF0A 4C0HA 3MM7B 1NNDA 1OMSA 1UAWA 1VQLN 3V6KA 1F3VA 4OLOA 1KSPA 3FMWA 4P7TA 3T1YF 3SJJA 2KZMA 1LWCB 2D3UA 1KRPA 4WYWA 1OYDA 4CH0S 4B3TF 3Q2SC 1XEZA 4ZA1A 3QATA 3OLAA 2YHBA 4O3SA 2D3ZA 3Q8YA 3G10A 2E88A 3C0BA 3AO1A 3RJMB 5K9FA 2R8GA 1RYRA 4DV6K 2ZH1A 2HBYB 4MTPA 2F4VK 4GMKA 2W6KA 5KFNA 2M70A 3AHPA 5F8GA 4KHSA 3AVFA 4WFBL 1RAIB 4EO6A 5LXYA 4HVZA 2L9DA 3QAEA 1VC6A 4USHA 3HT0A 2MQOA 5RUBA 2H3GX 1N8RO 3LDSA 5EWEA 3P38A 3QNWB 3G0ZA 4FWQA 4WXOA 2NRZA 2CVIA 4N5SA 2ASPA 3T6BA 4DU7A 1ILYA 4Y0WA 4FJNA 5HP1A 3U3YA 3TPQA 5M1PA 3MCAB 4JRQA 3MOJB 1N5YB 2W4CA 3B6BA 4M8LA 3R1HA 1FWKA 2DRAA 2P9SA 2P9EA 2E1PA 4QWAA 1TVRB 5FPEA 4HDHA 3EWGA 1UWAA 3LPUA 1JLAA 3IFEA 3MUVP 2X6NA 3M6GA 3VPZA 3PSFA 3MTJA 4DV0J 4DUYF 2WVDA 4WIIA 4F4AA 4RNFA 5DS7A 3TSUA 5BYRA 5CHCB 4M5LA 4RWWA 5DRKA 3OT9A 1J27A 5KRTA 2UXDK 4LSNB 2KM8B 2VQEF 3I0SB 4WQ5A 4CJKA 5I3QA 1Q78A 2Z1GA 3QBCA 4YDXA 3S9HA 2GJFA 1UZDA 4U8YA 3QGGA 1YIJS 1OQ3A 4YUDA 3GJSB 5GAGU 3JSRA 3MM9A 4OI1A 2YNFB 1TK5A 3F0NA 1TL7A 3ZSYA 1RTJA 4P10A 4BRHA 2GBZA 3IGVA 4XIUA 3T1HF 3W8PA 4K50A 5A76A 1I1GA 2L9WA 5DM7L 1N36F 2VA3A 1BL3A 1NGJA 1KVIA 1GLCG 3UCZP 3IMQJ 3NBPB 1T3NA 4EZ9A 2CJYB 5HMWA 4JYAJ 2QFIA 3QGPA 2W6LA 2O8BB 3C16B 1NLVA 3B4MA 4JI7J 3OTCA 4KYZA 1R6VA 4EAHD 2P9UA 3ULDA 1WUUA 4PUOB 3QIPA 4ED8A 2DHXA 3BREA 3IN5A 2DNYA 4H8KA 4WXWA 4AHVA 5GAEU 1BCMA 2BANA 4RPFA 2EPIA 3G96A 5HAOA 2ZOMA 4OI3A 2HHHJ 2FBTA 3VWSA 1Y64A 1GX5A 2M7SA 3KK3A 4PQUB 3CJKB 1U7LA 3A13A 1UEVA 4DPUA 5KT3A 3U02A 1VK8A 4N8NA 1AYEA 2OTLS 3VQ9A 2A41A 2COLA 4DWIA 1SB6A 2DY1A 1GH8A 3ZSWA 2DNKA 4DQIA 1F6TA 5CZ1A 4DR3J 3LDOA 3ENWA 2QC3A 4P2SA 1NZ8A 1R8PA 3E51A 4DPXA 3HSJA 2EFGA 1KTVA 4DKWA 4LFBK 1APSA 4LR8A 2RS2A 3TSQA 5IV4A 2QWRA 1HBOA 3SSRA 2R2RA 1KKHA 4U7UD 4HI2A 2WRMA 1NJYA 2YX7A 5E3PA 2A1RA 1VSJA 1WDDA 2DHHA 4ZP7A 2AGPA 2W2NP 2ILZA 1WOSA 2KI2A 3ZEUA 3AT1B 1IBKJ 4BQLA 2KRBA 4GO7X 4NA3A 5A8WA 4WYBA 4FJKA 3C15B 3BP8A 4YS2A 2V8PA 2HZCA 3TX0A 1HNIA 2ZDOA 1TU0B 3VAJA 1PJ6A 2POKA 5L1IA 3Q7CA 2QMWA 1IO2A 4X4RA 3SQGB 3SUPA 3LP3A 1T3VA 5GINA 2GEMA 1E6YB 4N76A 1KFSA 2MQPA 1ITPA 2J9DA 2PGCA 3TAMB 2R4FA 4N47A 3MEDB 1LXNA 2B7BB 3NNCA 3SBMA 2ZOFA 3G4SN 5EY4A 4F4YA 4BGAA 4OHYA 4DTXA 5A2QY 4JKAA 3KVGA 1JLGA 1S0MA 1YVFA 2LQ8A 3SJHA 3NOCA 3F73A 3TSPA 4AF1A 4EU0A 2LMIA 1D8ZA 3L4QA 1CC7A 4NYFA 1O1WA 2HFNA 5AQLA 1ACMB 4JI1J 1NKEA 2IOCA 2R7XA 3KK1A 3M8SA 5CYMB 1FJEB 2DRBA 1QVFM 4DU1A 4CBXA 3POTA 4E1JA 2MKKA 3I9V9 4U67Q 2BKNA 2NXNA 2DNGA 4L72B 3AY9A 1S77D 3I4HX 4CNYA 2E5HA 5AFUA 2QSWA 2RQCA 3OBIA 1VBKA 4J9OA 1NWKA 3VQ8A 4OPAA 5EX3A 4KH5A 2HFSA 1JJ2M 2KHDA 4F7VA 5ADZA 4USVA 3C8YA 2ASOA 2HK2A 5C2CA 3NGYA 3AVBA 2V51B 3UKRA 3P83D 3AV9A 1MA9B 1ZPWX 5EXWA 2WSFC 1C1CA 2GW8A 2QG9B 1RA7A 1WAJA 4KJIA 4I67A 1UETA 3SCIE 2NRWA 3UPFA 4RUCA 3EMTA 3UR0A 1X31C 3R8EA 4WPAA 2VPXB 4A2BA 5KFIA 4IUFA 3O1BA 2VH7A 3ILJA 4CZCA 4ECYA 4U7CA 2M0GB 2L41A 1FTCA 1H1VA 3LAMA 1X4AA 2O8FA 3DXBA 3I82A 2IM1A 1IJEB 2ZHBA 4LF5F 5HVGA 2CZ4A 5KFOA 4DCOB 2QWQA 1Y97A 2M2BA 4ID8A 4ILJA 4HTLA 1OPZA 3O4QA 4LF5K 2Q3PA 2RD5C 3LPTA 1LXJA 2IVOA 3OSNA 4PKGA 3MMBA 3V81A 1EX8A 2KN4A 1FXDA 2BOAA 4RUHA 4A5BA 3I5AA 2ASJA 2NUBA 4HCCA 1U6BA 1QUPA 1RT1B 4J9LA 4AM6A 4ZLLA 3EE3A 4F3MA 1TFWA 1DTQA 1KHWA 3MMCB 2RDIA 3FEYB 1ZBHA 4FLTA 1FRXA 5E3RA 4LF7J 1GXLA 2XHWA 5DLGA 4DR5K 1HR0K 4R5PA 2A2DA 1DEJA 1T9VA 5HVHA 1Z05A 3MN9A 4PXDA 2H4YB 4ED6A 2EK1A 4R0JA 3VQQA 3A8JA 2P6TA 1N8RT 2GWKA 1IKWA 1OSDA 2ZJPL 2Y1JA 5DLFA 2PA3A 4ZIWA 4TQRA 1IKYA 1NOYA 1F60B 1F9EB 1GOAA 4O3OA 2FBVA 3MXMA 5F8IA 2DVIA 3E2EA 1NJIO 2PSZA 3Q8PB 1K47A 1QSYA 4OMFG 4FK0A 2B7CB 1NDCA 3NH0A 3ZTSA 4OX9F 3PKMA 3P5JA 5KG3A 2N7CA 3W2VA 3DRRB 3PW2A 3VQEA 3KOAA 5AJ3J 1NOZA 2YKNB 3DOKB 2WFBA 1OS5A 2QWOA 4FN5A 3ZSRA 3ZSXA 3D3BJ 3OJUA 3CXCM 1B64A 1FX4A 3G9CA 2VUGA 4IDHA 4K2XA 4WKYA 3OR2A 5KQ8A 2UUCK 2IA6A 3R1LA 3TZWA 1WUAA 1RDDA 4CGIA 3B78A 3NOGA 3AODA 3V9SA 1RBRA 2B4PA 1U02A 5DETA 3NF9A 1H72C 1ZAVA 5LMNF 3TNVA 1TAUA 5B0DA 3SDEB 3RZAA 1HL6A 3V4MA 1W7WA 3PW4A 1WHXA 1JLEA 3DOLA 5E3QA 1LAWA 3K5PA 4U95A 2XSJA 3MZIA 2J4RA 4DV2J 4DSFA 1C0UA 2OEMA 2AA4A 3BO4A 3LA0A 2E1YA 3O3GA 3FZHA 4NASA 3NNHA 2IHR1 2NS1B 4IWVA 3NEKA 4A59A 1FWPA 4JI3K 3TVKA 1FDNA 3BEGB 5HVFA 4FVCA 4U7UK 4JHDB 4KH6A 2E5LJ 4E1MA 2WK4A 2RSQA 2FVRA 3T41A 3WC2A 3R5BA 3G6ES 1VAZA 2XMVA 2R8KA 2UUBF 3NGKA 3NVKA 5KFTA 2FC8A 5A6PA 1SC1B 1WNEA 3AY0A 3I4PA 5KTQA 4CLFA 2BQUA 4DR4F 2VJUA 3FKBA 2HIQA 2C2EA 2WBNA 3D0IE 2UUBK 4ISFA 1IWGA 3HBTA 3DXMA 4JKHA 1DQ8A 5IT9U 5AZJB 2CQHA 1HQUB 2GS8A 6AT1B 1M5VC 4ECXA 2KU7A 5AQHA 2BOPA 2IYGA 2LSNA 4DLGA 3TQ1A 4LSLB 2RU9A 2CPIA 2FHJA 3BUZB 2H48B 2CYYA 4LRAA 1CULA 2CQCA 5D6GA 4GO5X 1FRKA 4BR2A 2R2SA 1X7VA 3DDIA 3QNNA 1UFKA 3JTNA 2ACYA 4JI6K 1WC3A 3T9NA 1T94A 1NSQA 1RT7B 2FC9A 2KKHA 1ZH5A 3CC7N 5H9EJ 1I94K 1RT6A 5T7LB 4CD1A 4PQAA 4JK8A 3Q8QB 3EEQA 4C0BA 5D0RA 2P9PB 1MU2A 3MXHP 1LFPA 3OYNA 2WHOA 5D0GA 2MQNA 1RTDB 1RJJA 3RMBA 3I5CA 5KT2A 3HM9A 2W41A 3OYKA 2OPQB 4JRPA 1FDAA 2DNZA 3UW1A 4FWRA 1Q81O 3D0GE 1M1KO 4LFCJ 3DHXA 4TLQA 3TZYA 2A1BA 2H5EA 4DN0A 2YH1A 3CIPA 3SSQA 4CLUA 2BRKA 3V1QA 2P9KA 5T14A 2Z8QA 2ZQBA 2AYGA 3J81Y 4RU2A 5DMRA 1WC0A 1QHTA 4M95A 3CVKA 4BROA 3HT3A 1NPPA 3TI0A 2ERRA 1X0FA 5GAHU 3AA5X 3PM9A 4H5WA 1TL4A 2OP5A 5FLXY 1SJ1A 3QETA 4ZVQB 1SQGA 1UA1A 3T1YJ 2I5JA 2DPNA 2ZKTA 3MFHA 1N48A 1A0OB 4B9MA 1IG9A 2JC1A 1RAJA 4B3TJ 4CLSA 1G15A 4M7YA 4RZRA 3W0LA 3J80Y 3MD3A 1HHTP 4C7QA 3OHRA 4X4VA 2OSRA 2FJXA 1PGZA 3H46O 2W7OA 4DR7J 3R3TA 4FLZA 1H74A 1I6JA 3GE1A 3KXDA 1NNEA 5A2QO 1DJ0A 3K58A 3BQ0A 2MEWA 3AJ2A 2MQQA 1Y9OA 2B9WA 1V3RA 1QY7A 2EWHA 2XMWA 3VEVA 2JJ4D 4DJBA 3UN5A 4OHZA 2B5JA 2OD6A 5A8KA 2CNLB 1N4LA 1P1TA 3JXOA 4YOVA 3C14B 4YFUA 4YOWA 3SK3A 3OS1A 4K4UA 3OA9A 4JV5F 1Z1ZA 2ZH6A 5HATA 3R9PA 2P6SA 4L76A 3D1OA 4K4TA 5D77A 4AL7A 3KLHA 3HSDA 2RF2A 1H2UX 4FWKA 1HKCA 2XZTB 1NGHA 2QXLA 1Y3JA 1EZZB 2CQ3A 4DUYJ 5KFFA 1LWFB 3KLGB 1GMWD 2MSSA 3MM8A 1NK4A 4C4WA 4DL7A 3WNHA 4J2EA 5J2QB 2KXHA 4I68A 4TU9A 3Q8VA 3WQTA 1FEEA 3N79A 1RT3A 1ASVA 4M5GA 2VQEJ 2CPHA 2ZD1A 4QS7A 5D0EA 2GFFA 2VV5A 1C6VA 3RWUA 5E0OA 4FVUA 3MTKA 1KQKA 3AD7C 3FQKA 4CIEA 4M3UA 4YORA 2OFHX 3BJYA 1QS4A 4A57A 2F65A 1WHVA 1N33F 3T1HJ 3A8IA 1Q0NA 3AVAA 4AQYF 3IS9A 2IM3A 4B1UB 1DTTA 4QPXA 2FSJA 1NJIT 1EHWA 2YNHA 5DGBA 4P71A 2YWWA 4YQWA 4C0OC 3W66A 4RU9A 1KQSM 4RW7A 3G82A 1HKGA 1U2FA 1FJCA 1N5SA 2HNYB 4OI6A 3VGTA 2A10A 2B9YA 1IBLK 2NUHA 1XTZA 4IFEA 1BISA 1DKGD 3DMJB 2XS7A 2LQ5A 3RR7A 3DM2B 3CC2S 2MYFA 1K8AO 3RAQA 3W60A 2ZJPQ 3NFAA 1HNXF 4DSEA 4KTWA 1KLNA 1T8EA 5C25A 1NGIA 4CEEA 2NRHA 1VLOA 5DGAA 3CC2N 1EQMA 3NAIA 1BC6A 2RRBA 4DL0C 3RR8A 5J1EA 3FQLA 3V9ZA 3OXFA 1HNXK 3BYRA 1GOBA 4I2QA 5C2FA 4J2DA 2ZM6K 1ZBIA 2HVIA 3M8YA 3LUYA 4KBIA 4DU3A 2VOOA 4CO4A 4IFYA 4QR0A 2ZH5A 2YXLA 4DV5F 3BKUA 3OL8A 1TUWA 3K2PA 2HHPA 1UWBA 2GC8A 1WC5A 4Q43A 2ASYA 3MM6A 4MYTA 4DV5K 3VQ7A 1KCFA 4OZNA 4DV3F 1OQ6A 3VF0B 4YN3B 1JLFA 1SH3A 4KKOA 3I96A 1K1SA 3MPUB 3M05A 2XRIA 4O0JA 2CQIA 5KPTA 1NDLA 4F4WA 1N88A 1BMQB 1A9NB 2YX6A 4EBEA 2B4UA 3FCVA 1GLFO 4FNIA 3ISNC 1VOMA 3V9XA 2E4LA 3CB4A 4ALZA 2H5IB 4LRFA 5FJ4A 1KQGB 3GIMA 2HHUA 3A5NC 5LSOA 2MLZA 1F5AA 5T41A 1FXLA 1JX4A 2P9CA 1GOCA 1X5PA 5D15A 3ETMA 2IS3A 1Y3KA 2AT1B 2PFUA 4H0XB 3PXGa 4UZCA 2SXLA 4MQ3A 1RABB 5BXIA 2AJ2A 2PD1A 5ETMA 1IJJA 1RU2A 2E29A 4C8KA 2FJVA 2ROPA 3V1OA 3L2VA 5JS1A 2Q0RA 1M1HA 1YHQS 1IXKA 2FUG9 3H2LA 2BUPA 1KLMB 4ELVA 4DR1F 2MZ1A 4TNOA 2J5AA 1U1LA 3N4QA 1ELOA 4ITSA 1JB0C 4Q8EA 4ZLJA 4DR2F 4EK2A 3KDNA 4N8OA 1NBEB 3GMGA 3U1LA 1YQHA 1DHMA 1FJGF 3C6TA 3QEWA 3PZPA 2DHGA 2VYPA 2J6SA 4LIWA 3KKSA 2IC3A 1NSAA 5DG9A 1KS2A 4FBUA 4IQXA 3HSTB 2PBDA 3TAPA 2FJWA 4WFNQ 1URNA 3HHNB 4IJNA 3HK2A 1HJOA 1Q81T 3PG9A 1PJ5A 3RAMA 4RBTA 1ULRA 4WBFA 1M1KT 3HP9A 3B8AX 1HPMA 3KLFB 3FRZA 1PBUA 3WNGA 3MEEA 4I4BA 4X64F 2MKHA 1SJ3P 3P45B 2FXUA 4K59A 3GSDA 5CCLA 3CCMN 1IJFB 2O8CB 4LRCA 4ECUA 3ID6A 3HHKA 1VJQA 4JV1A 3H5YA 1C4CA 2IAJA 3PNIA 1JLCA 1GLDG 4IRCA 4G9ZA 1NMNA 2P9IB 5L1KA 1Q8BA 1S6QB 3WXJA 1B9FA 5A6WA 1S1UB 2NPIA 5G0RA 3QICA 4KHPF 1RCOB 4RJVA 1FDBA 4RL1A 2XGPA 2WVBA 1YX2A 3PYDA 3PX6A 5IV3A 4F9OA 1HI8A 2A2CA 2HHXA 3ZT2A 1KEKA 2BYCA 1LW2A 5AQWA 1RBAA 2W9BA 5HROA 4YP3A 4QBUA 5C5JA 4LT6A 3CJ0A 5JMNA 2QLXA 4BRCA 2JFKA 4K5SA 3OD2A 4P72A 1YUWA 2ZF5O 2IRXA 5ETKA 3M2UB 1R59O 2YQ3A 2YWKA 4E98A 4TY8A 4RW8B 5KT5A 2VBWA 2NXCA 1D09B 3ENOA 3W2WB 3G8TA 4NLSA 3HHEA 1ZA1B 4MIBA 3KKRA 2RNEA 1RT4B 2P9GA 1RDAA 4WZMA 3J81j 4E0DA 2BJDA 2QWPA 3MEGA 2PEHA 2CJQA 2VG6A 4KGKA 5MLCV 3CJRA 1FESA 3J81O 4HCBA 1XMOF 3WC0A 2R7TA 3H3NO 2WTFA 3I56S 4M42A 4CO0A 4OX9J 5ELZA 2HBLA 4QYZJ 5FLXO 3FBCA 2QGFB 3EGVA 2Y1IA 2IVPA 3M9MB 4NLWA 5ETLA 2KFZA 4CFBA 1VBYA 3I56N 3SQ1A 5HANA 2VOPA 2MHEA 1TZ0A 1U2RA 4I56A 3IUCA 4KAZA 3J80O 1E3MA 3E3XA 3VGKA 3QJJA 2QA1A 4K0KF 1RAEB 1AZSA 2JEFA 2YCHA 1RBUA 2IM2A 1S0VA 2K3IA 4IBNA 4B9VA 4K25A 1B9DA 3FR0A 4GW6A 4TU8A 4H4MA 5LMNJ 5L38A 4CGGA 5KFAA 5I4MA 2J8SA 5LY3A 2WVFA 2ZC4A 1JK9B 2NSBA 3BV8A 4X62J 5GAGI 4J7CA 4FPBA 3VEOA 3MM5B 5FRMA 4CZFA 5CHIA 4EYHB 4RW9A 3NWGA 2C2OB 1BQXA 1CJKA 5CH7B 1NO8A 3EZUA 4UQTA 4OZ5A 4NLVA 2JWKA 3VZIA 3VQDA 5LJ5Y 4YR2A 1HNWF 4OI2A 2WB4A 4C6AA 5D4NA 5DJBA 4WU3A 3J7AP 4ED7A 4DUZF 5A8RB 2F1FA 1K8AT 3HLUA 4FJGA 2GVDA 3EXYA 4ZJQA 2NLWA 3DU6A 4KGXB 2DNOA 1YITN 3G6XA 2YHAA 4JKBA 2QJ3A 4DUZK 5GAEI 3EDRB 1OVQA 3A4TA 4AL5A 4FWNA 1SIWB 3CCVS 4FWSA 4GVBB 1OH8A 4C97A 1AUSL 1RDBA 1BA0A 4QWBA 2QSFA 4DR4J 2KKZA 1NJXA 1ZTWA 4WWSA 2ZE2A 1RB0A 4KGZB 2BW7A 1B92A 4E19A 3ET6B 5DG7A 5HMXA 1TKXA 4CEFA 2WCXA 2BQ3A 1XK8A 3E01B 4FZYA 4B1ZA 3OHAA 3OQ2A 4A46A 4J9KA 2ASDA 4ZK7M 3G25A 1Q8IA 3GZ7A 5I9EB 3OW2M 2RIJA 3GR1A 3UNYA 4BR0A 4NYPA 2AHOB 3OLBA 2EKYA 1NBWA 1LKZA 2Z1JA 4RWTA 5B0AA 3VAMA 3T6JA 1W0HA 4WK3A 3EN9A 1S1WB 2VPWB 1YJRA 1GEHA 1MWZA 2MKYA 4NMXA 4RW6A 4M45A 1WC1A 1NMDA 1QQCA 2E5IA 3UVJB 2QWNA 4Y1DA 2YKOA 4AHTA 4LF9J 1X8DA 3OV7A 1JNRB 4CO2A 4PG6A 1URRA 4IRDA 1ZA2B 2R8JA 4AT1B 2OTJN 2BGGA 3GP9A 3O9UA 3NGSA 4X4PA 3HZEA 2LLZA 5C15A 1VQ5N 5KG1A 4KHUA 5CXTA 4IOXA 2CH6A 2J76E 3I33A 4RUAA 4LFAF 1HJRA 2MGZA 2G9OA 2E44A 1E4GT 2BJ3A 4H4OA 1SVDA 1BLUA 3DLJA 2QLFB 1M5PC 4DV1F 1NSKL 2NQPA 4FJHA 2EKNA 3H45C 2DIUA 1D8YA 4YB5A 4FKYA 3MWTA 3IRXB 2Z2YB 2GV1A 3M32A 3D7EO 3AB4B 2UV8A 2GGPA 5HJYA 1K6YA 1LWXA 1WSFA 3CO0P 3C6UB 3HPOA 1HQEA 4FF2A 5M1FA 2K7JA 5DDPC 3FZBA 3P8BB 1UVKA 1S9FA 3OHBA 4H4KA 1RI7A 4KY3A 2QXFA 2MZJA 2QT7A 2MXYA 1S5ZA 2VPZB 4YB7A 1A7GE 2G0IA 1G6BA 1J53A 1ZBUA 3A5LC 3M8PA 3IP0A 3M2VA 2OZSA 4HT7A 3CIZA 4O4GB 3ZT4A 4FW2A 2D5RA 1YJNN 1NK6A 3JS9A 4X84A 4LUBA 1FNOA 4H0TB 3UQSA 2PT0A 4WTYA 5H9FJ 1Y5LB 3KLEA 3DLGA 4CF1A 3OL6A 1QLNA 4FJLA 4JD2A 3L2RA 4GKJF 2X74A 1NDKA 1YTAA 3OTBA 2AX1A 4I6MB 4FJMA 4B3RF 2VGMA 3CD0A 3K5LA 3WIVA 4CZGA 3KJFB 1HNVA 3MPVA 4CHZA 2YHWA 2LKZA 1YJWS 3ZSZA 1P8GA 4X65F 4CHYA 2BVZA 3NLCA 4HDGA 2OELA 4MK7A 4B3RK 4WE1A 4R25A 3ASMA 4CGDA 5M2PA 2XWYA 4ECRA 2D0OA 3IG1B 1W7AA 5HMZA 2GHWA 4CNZA 4WZQA 4BVPA 1UCNA 3PYGA 5CYQB 4XH1A 3M30A 1KHVA 4FVMA 4OFZA 1KOHA 1RBTA 4DQ8A 1UEKA 1OJ4A 2HVDA 3MX2A 2W9CA 4ILMA 4NYOA 5BRFA 5IT9Y 1HI0P 1V3SA 1ZOTA 2ZGYA 4JI8F 4DTSA 2XM3A 4FZXC 1HBMA 2XCAA 1RLDA 3O6WA 4HYKA 4QS9A 1W2BR 4JK7A 4HACB 1CZAN 2Y8YA 4K4XA 3DLKA 1NK7A 4J9PA 3R1XA 3W5ZA 4KE5A 4KSEB 1R43A 3SNNA 5JLFA 4NCGA 3S3MA 2YWHA 1S1TA 1Q5VA 1EXQA 4P9SA 3BSCA 3HHLB 3KK2A 3KLIA 1CXQA 2LXUA 1N33J 1U2VB 2J6UA 4Z0UA 2VBYA 3N6MA 2E9RX 2RT3A 4AQYJ 4OGEA 5AQZA 5E5NA 4LF4F 3PRVA 4P73A 2QKBA 4MKYA 3SAHA 5HBMA 3H08A 2R7WA 4LH4A 3THYA 4YOXA 4CTAA 4USJC 1QAJA 4ZN1A 4ZITA 1CSJA 2R8HA 2UUTA 4N41A 4FWLA 4OKEA 4KO0A 1FFSB 4MO5A 2HSTA 4CLYA 3NS5A 2YKMA 4OJ1A 2NSCA 3CJSA 4AXIA 1D0EA 1UVJA 3BKTA 1LWEB 2BDPA 4ZPVR 1U45A 1J5EJ 2YJEA 3EZ5A 2P9SB 5KFVA 4Z4CA 4IOBA 1XR7A 3QGHA 1JLAB 1FXRA 1BQMB 3OR1B 3MAAB 4K5RA 2OSQA 4WF9Q 1SH2A 1NM1A 2IYIA 2NZCA 2OGUA 2OJ3A 2BJ9A 2HBQB 1H7WA 4BG8A 4FKXA 4RW4A 4MKVA 3GILA 3GFZA 3OBWA 4AILC 2CJ9A 4NXNJ 2AKWB 4GRSA 1XMQK 1L3SA 2G8FA 2H65B 1TL3A 1JIHA 5M1KA 3QFWA 2HQDA 3G2XA 4PWDA 3M7VA 1UL3A 3FBFA 4DSLA 3CMAS 2FBYA 4IO8A 5ITHA 2QLJB 4OYWA 4QYRA 1PC4A 3U1NA 4MLEA 4BC2A 2V4JB 4DV3J 4C3KA 4BRQA 1JLQA 2Z4PA 2BZ2A 3CYMA 2E1ZA 3CNQP 5KPZA 2KFYA 2HBKA 1FA0A 4ETZA 1RYSA 3CJTA 3PFOA 3VGSA 1ZZNA 4IO1A 5EDWA 2J6TA 2VG7A 1NSPA 2KM8C 2P9UB 3QIPB 3THVA 2HBMA 5I3UB 3RSEB 2HVEA 2QV6A 1FKPA 3DLEA 2BANB 4C48A 2OH2A 3G6VA 3HHLD 5IZHA 1G1XA 3BGUA 2FVCA 1XNRF 4V19X 1S9EA 2R2UA 4UUWA 3HJFA 3KK3B 3KMSA 1NEEA 3OVBA 4NLXA 2V67A 2OMLA 3LGMA 5IC4B 1HMVB 1VQ9N 1WAFA 2DTJA 2W24A 2XMUA 1RT5A 1BGXT 5LMUF 5BR9A 2DT9A 3RVCA 4CZJA 2MKSA 3CJ4A 4TLRA 5HQ8A 2C2ZB 5KFPA 1D9DA 4QCLA 5AQKA 2XNRA 2GUPA 2U2FA 3VEZA 4FJ9A 1BI4B 4B8CA 3CCWA 3IWLA 1OH5A 1B3TA 4DR1J 1LQ9A 1VFJA 3I0RA 4KB7A 1PYSB 3ZEUB 1AT1B 3O08A 3BGRB 3KWGA 4DR2J 2EVZA 5A8WB 4GV9A 3N01A 2YWEA 4Y1CA 2R7VA 3U27A 2ZJQQ 3CCES 1FJGJ 1WG1A 2W2MP 4CZMA 3AVGA 2HBRB 3JSMB 2DEIA 4NLGA 3QSYB 2MZRA 3O9SA 4OV1A 3MR7A 3D1QA 4OYOA 1RT2B 2DB1A 1V5IB 1X3NA 3CJBA 1RHKB 4KPYA 3BF4A 1BWVA 4CLTA 2XMTA 3N4PA 4HT5A 4MIAA 2BE2B 1YBUA 2QN6B 4N7TA 2VD3A 4HTJA 4P74A 1CEZA 4DUTA 4BC4A 4F3TA 4A8YA 4R0EA 1VQMS 1G99A 3IKMA 2LQ9A 3BBFA 2HVHA 3THPA 3KJVA 4F26A 3TTFA 4EHUA 4X64J 1N54B 2PFDA 2DXEA 3F5TA 4FCYA 1UTAA 2O8EA 3HD2A 2IBOA 4QQBA 4QW8A 4AUKA 4ZIVA 1MDUB 2YNIB 4NRUA 2BXJA 3GPAA 2RJZA 4DCPB 2F9DA 3GYNA 5KFYA 2XHBA 4BRNA 5A0YA 3CD6S 3N6NA 2XY6A 3DRSA 1V6HA 3GR0A 2WSCC 3BEXA 4DV0K 1XR5A 3R8YA 3QJLA 4ZHRA 4TN2A 4KHPJ 1WF1A 2E1RA 4K4ZA 2G0CA 5GAHI 3RU0A 3HVRA 2E6LA 2NZ4A 1R0AA 4A5AA 4CJ7A 3F56A 1CJVB 1C1BA 2RU3A 2BKOA 2FVPA 3MURP 2O67A 2WBRA 2E20A 2ROGA 3TO8A 3OYCA 2CQBA 1BHNA 2V9WA 2K2PA 5CCMA 1WSGA 1HNZJ 5AQUA 1WJ9A 1YI2N 3MM7A 2D41A 2W1BA 1YAGA 1P9QC 2RHSB 3C7NB 1J2VA 3D67A 2XZWA 4PWUA 4JBCA 4K8RA 2IIHA 1LW0A 4CJ3A 3K17A 3LW5C 3R6LB 4O5BA 2H1YA 1K8KA 4JYAK 2P5OA 3CERA 1MROB 3ISZA 1FVQA 4YDDB 4DR6F 2CPDA 2DO4A 1FD8A 4JI7K 3VEYA 1LWCA 2VC0A 5KI6A 4UUXA 5GVQA 4DI6A 4OX7A 3GB0A 3QRPA 3PACA 1SJQA 2F3JA 3JSBA 2BEFA 3OYJA 2HHHK 2NLXA 5KG6A 3R9LA 2EHGA 3TAFA 5SUHA 4A8SA 2JVRA 1WKLA 2HNZA 1FNMA 2ZH8A 5D4PA 5MLCQ 4AD6A 5CA5A 1FFWB 5DQHA 3QYYA 2CG8A 3HKWA 1NGEA 3AA4A 5J2NA 1ATRA 5B8HA 4K8XA 1FNXH 3ILLA 4FLWA 4M3ZA 4YMEA 3R7NB 1HA1A 1VQ8N 4DR3K 2MJNA 4K0KJ 3H2VE 4OJRA 2B3TB 1H2VZ 2EC0A 2D0BA 2D9PA 1GT8A 4J9QA 3ZT3A 1T6DA 3PUFA 4CZKA 1N5YA 2GA7A 1SIZA 3GOIA 4F02A 3KMQA 1S1XA 1QZ6A 2AQ4A 1TVRA 1O5JA 3TA2A 1JL1A 5IOLA 5C24A 2E1CA 2YV0X 2DHSA 4ZMMA 1EQ0A 3CJ9A 4X4OA 3DDKA 1DLOA 1IBKK 2W25A 2PI4A 4OLAA 4HHUA 2A3ZA 2G8IA 4H0VB 1HNWJ 2QRRA 3NWRA 2K8GA 1ITGA 2CGLA 4LSNA 4GC7A 1X4FA 5FRNA 4B1WB 4YOTA 5D8HB 1B0VA 1UFWA 4OI4A 2C1EB 1KAYA 3WXLA 3L09A 3W2VB 2KXFA 4CFDA 1BUPA 2ZH7A 3OYFA 1T7PA 3NAHA 2CPFA 3DNCA 1DAXA 2CDRB 2VIHA 1Q53A 3N9UC 3K89A 1FO1A 1NHUA 3MEKA 3CF5L 1TL5A 1BHLA 1FF2A 1SKWA 1RTHB 2VWJA 4C8OA 1S7IA 3C16A 3OFGA 1UW4A 2GAGC 3A3OB 4IDKB 3OR2B 2HQFA 1X0PA 2Y1LB 1P27B 2BE7D 1VSIA 3PHEA 1C0FA 4GV3A 4RWXA 1IVZA 1PYOB 4JI1K 1GQEA 3U7JA 5K20B 5IS2A 4D3HA 4RNOA 3UFCX 2NRXA 4X4QA 3EICA 4EO8A 4KREA 3KUHA 4OO1J 3TWZA 3NS6A 3SCLE 4ZJLA 4B3SK 2Q43A 1ZZFA 1J9AA 3GLJA 3EO3A 2XSJB 2V50A 4MKBA 4PQUA 3P31A 1C0UB 4MO4A 1IUJA 5AQSA 2J0SD 2QYGA 3HPHA 4NA1A 3CM5A 3R7SB 2Z2MA 3EYZA 3Q23A 4KT0C 1EARA 2OZMA 3NHGA 1AUDA 2Y0SD 4QWEA 1FT8A 1Q1KA 1WC4A 1P9YA 2W7PA 2P2CB 3KD5E 5JVGL 1RDRA 4E89A 4PKDB 1NHVA 3CCUS 3AAQA 4JKGB 3CJAA 2J9EA 3QIOA 3T19A 3D1HA 4LVNP 1RP5A 3ZO7A 2DIVA 3CQ8A 4C8MA 3NF7A 2Q3SA 1JXVA 1P90A 4CLLA 1I51B 5IFMA 1RWXB 2Z1IA 3ZTRA 3H1VX 4DV1J 5AQMA 3OYBA 4UY8O 5CZVA 2DGXA 3BGOP 1BY9A 3I5BA 1OH7A 2RAQA 3SPYA 3EPIA 1XNQF 3DXMB 1UVMA 1NGAA 4RNHA 3TJAA 5JUMA 1K9MO 2W2QP 3TA0A 2HMIB 2N3OA 3ULEB 4FF4A 3CC4S 3OFEA 4CZEA 3SQGA 3AJ1A 3QIDA 1CULB 5GMEA 4XH5A 1E6YA 1EP4B 1NK0A 3TAQA 4BRIA 4NWBA 3TAMA 2B4OA 2Z1HA 2XHCA 4CEAA 4JI4F 2X3DA 4CFAA 2PDAA 2QA4S 2E2QA 2RHKA 4OZ0A 5E26A 1LAVA 4FJ5A 2GAHC 3OTOF 4J37A 1QAYA 3RB6A 2CFXA 1EQYA 4HKQA 4DV4F 2HVZA 3WXMB 3ENHA 2AW0A 2MB0B 3PIOL 4LF7K 4AM7A 4MK8A 3JSYA 2IRYA 4JS5A 1VK3A 1ASWA 3A12A 5M1OA 1DBDA 3CCLN 3DXKB 5F8HA 3IRWP 2FJDB 4RCHA 4RTFD 3KD1E 2JEGA 3PW5A 4FPIA 2QLWA 3CCSS 4X65J 2MQLA 4NLYA 4YB1P 4FZVA 2M8HA 4AHSA 2VWBA 4U7BA 1CJUB 3LP0A 3KG4A 2P5GA 4C8LA 2BX6A 3P5TL 1U6FA 4F67A 2R7SA 2RKIB 4ICLA 5KRSA 1XBWA 1HHQA 3RMAA 3I31A 2WVEA 1GMUA 5AJ3K 4A4JA 4CZIA 1XHXA 1VQ6N 2NYHA 5CD4H 4A8XA 4ZTJA 1H0HB 4ZPBA 2ZGZA 2HIYA 4P52A 2DFEA 4Z4IA 3D6FB 1CS4A 2BJEA 4LF2A 5GMDA 3OYMA 1U1NA 3QLHA 4JI8J 1TYQB 1WTBA 1RAGB 2CQ0A 4K41A 5FDLB 3K5OA 3CQXA 2GUIA 3BQ2A 1VS3A 2GIFA 3QFHA 2RE1A 2AU0A 3C94A 4BE1A 4KFBA 2FD2A 3ZZYA 2PO4A 3W64A 4P2MA 3UE2A 1N6QA 3D2FB 3NGIA 3NY0A 3ZX2A 4NLPA 3CE8A 2XNQA 1YJ9S 4DV2K 4ED1A 3VGMA 1RGIA 1OPIA 2YI1A 4WFAQ 3CHWA 4P7VA 1MW7A 2UYTA 4R79A 3AD8C 1RCXB 1TUVA 1WORA 1MSWD 4LF4J 4F3OA 2BW2A 4ED3A 1RT1A 2P51A 1GLJO 2QWMA 3AGRA 3R6GB 3JB9k 4ILLA 4C8NA 2W42A 4QIFA 2V2ZA 3KDOA 2B5JB 3WDOA 4B17A 2AJ1A 2E5LK 2GJ2A 3EUNA 2D69A 2VU5A 5F8LA 3U9DA 4JB8B 2XS2A 2KFNA 4ZKAA 4AYBD 3CCRN 2DYAA 1UA0A 4JI2J 3PJWA 3B6OA 3MXIA 2AP1A 1RDCA 2A0FB 3OYLA 2RF2B 1YWXA 2KZZA 4KB1A 3W1YC 1UVIA 4BRGA 1VSLA 5AQPA 5CR4A 3HZ6A 4NLQA 1NGBA 1WHYA 5F41A 4LF8K 2UXBF 3QT6A 4CT8A 5AQFA 3FFIA 3D5MA 2O4GA 4W5OA 2QK9A 4OI0A 3FSIA 4RBVA 3MMAB 1OWXA 4PG7A 4EYIB 1CZ9A 1QE1B 1C4AA 4MLHA 4Z94A 5GADP 2RS8A 1NCLA 5KFHA 1Q16B 3DGPB 2ADCA 1VQKS 4OLPA 3AAPA 4BHQA 5KFCA 3DRRA 3BR8A 1PKUA 1YTYA 2D74B 1SV5B 1BD6A 3T5HA 2YKNA 1NLKL 4CK3A 3KNGA 3T5LA 3OYEA 4DX8H 1RAHB 4W5RA 1VQKN 3PFEA 2KB2A 4J9MA 1DTTB 4TQSA 4O8KA 3BSNA 2YNHB 2UXCF 2HPUA 2M4MA 4E3SA 5H9EK 2Z0GA 5EU7A 2BKPA 4YHHF 5K14B 2OKQA 1K73O 1PG5B 3R3LA 2Z56B 1R0CB 4URGA 1OKJA 4XK8C 2CJAA 2RMLA 4DX5A 4H0YB 2RN2A 3S8SA 4F2RA 2B8QA 1Q9YA 3R27A 2DXFA 2QWLA 4PXEA 1RWVB 1XNRJ 2LXFA 3I32A 1RHMB 3M4XA 5KFGA 3FZLA 2D1KA 5BYSA 2HS0A 2MY7A 4QR1A 3AH6A 5KG7A 3CJ5A 2J0XA 4L6V3 2PYJA 2E5GA 1ZTTA 3KJNB 2R7QA 3ITHB 4OYMA 2EW9A 1KVJA 4I2QB 5LMUJ 2O5DA 2K7KA 3SQ2A 4LFCK 3W5YA 4JI5J 2OEJA 2ETJA 1GNKA 3OS0A 4X4TA 4JHDA 2FPHX 1S97A 3H98A 3VQSA 4IFYB 3AFGA 5C7PA 1C0TB 4CCHA 3L8BA 1IWAA 5LOQA 4A48A 3K5NA 3H6EA 4HTIA 3C6HA 3FBEA 2K1RB 2F8SA 3BZQA 2LA6A 3CF5Q 4QAGA 4F0MA 4LBPA 4XDDA 1KNZA 4EGLA 4FYDA 2AF6A 5HLFB 3T1YK 1S9GA 3VTHA 1S5JA 1HD0A 2VQFF 2XI2A 1RCHA 3A3PB 4B3TK 4FYYB 4DR7F 4KKOB 4IOAL 1B4SA 3M9OB 4B9UA 1SUQB 1HLWA 1QQMA 5AZJA 1M90O 2JLFA 2DGQA 1HPZB 2AGOA 1HQUA 3AA8A 3QGIA 5B0CA 1WD6A 3ONQA 4JKDA 4DR7K 2A3JA 3AQPA 1TFYA 4LSLA 2J0QD 1VQ7S 1ATSA 2C3UA 2E6MA 4YNQA 4UY8T 4ES3A 1ZYQA 4OYXA 3CM6A 4QOZB 4M1KA 4LC9B 4NRTA 5LSRA 3HOSA 3H59A 4L74A 3W65A 3BZCA 2V68A 4IH7A 1REVA 1P1LA 4UOFA 4CEZA 2OUGA 1K9MT 3AXMA 1WELA 4QW9A 2D4WA 3M2RA 2OPPB 1RT7A 2RE2A 4KQZA 2Q6BA 3L2QA 2F9JA 4XH4A 2FLNA 1ZM2A 5T7LA 3LPEA 4ZOSA 3TP2A 3TR5A 3MECB 2P9PA 4G3IA 3DYAA 1TUYA 3OY9A 3MCSA 3MUMP 1VMBA 2KT3A 3AA2A 4ILGB 1QD1A 4BVOA 1WSHA 2X7IA 3M6VA 3V4IB 2D1CA 3M8QA 1QQNA 4PL8A 4RNMA 3WEEB 4KHYA 1JJ4A 3WHIA 4DUYK 3MD1A 3SCJE 1VRQC 4LBHA 4AFFA 4Y00A 2OPQA 4M5DB 3NAEA 1VI7A 1RISA 2UUAF 1H98A 3H1QA 2V94A 2VKZG 3JYTB 5IWAF 2VQEK 3VQPA 4FK4A 2DISA 1RDUA 3TUZC 2WSEC 1NM2A 4RG8A 1Q95G 5AZIB 1HQ2A 4B3OA 3C6TB 1RAOA 4Z4FA 1YIJN 5EX5A 4KV8B 2LVWA 3CJ3A 1N32F 2JNJA 1H7XA 3SQOP 2FHMA 3LOUA 3T1HK 4NMLA 2D3O1 5SWMA 2XC9A 1NJZA 3F2KA 3OUYA 1N36K 2V2KA 1VQPS 1QHAA 3B82A 2E1AA 3RBEA 2B6AB 2Y9HA 1QSLA 4LMZA 3OL7A 3MK6A 1AA1B 4DR6J 1S72S 1T05B 4DOZA 2I0XA 4G1IA 5KFBA 3PIOQ 4K7QA 3R2CJ 4ZCLA 3MEEB 4AE5A 4F36A 4H5TA 1AXQA 4TYAA 4OZJA 1S72N 3NGDA 3P1GA 4JI0F 1Q7LB 2KH9A 4IG3B 4M5NA 2FGOA 5AQJA 2IAJB 5FPMA 2DXDA 1PCAA 4I7FA 1R8AA 2ZJRL 3GL1A 2HKEA 1RBLA 2OTLN 3LANA 5J2MB 1SL1A 1R8CA 2ATQA 1ESVA 1HKBA 3LAKA 1T44A 3CD5A 1RHUB 1V5VA 1YSJA 1GTEA 1H2TZ 1BO5O 3HL8A 3OPKA 2MMYA 3C14A 2W9BB 5HROB 4UQGA 2QE5A 3VR1A 3ZYYX 2EWSA 2HHQA 1DT9A 2CNKB 4KPCA 3M1VB 4TY8B 3NGUA 2FYXA 3DN9A 4C98A 1TQLA 2N7YA 1J54A 2QL5B 4IR1A 3QEXA 2ZVIA 1LWFA 3C2PA 1MWMA 1RAFB 3CCQS 3NCIA 3FE1A 3FEXB 3VA0A 2PY5A 3CO9A 5KFQA 2XLKA 1M5OC 4M3XA 2HZAA 1N34F 4USKA 1Z26A 4NOHA 2C22A 3AD9C 3AVJA 4FXDA 2CQGA 2ITGA 1VJWA 3VGUA 1TR0A 2KDOA 2RDDA 3K7RA 3SZ2A 2VFVA 5AXLA 4NO7A 3H5XA 3QMLA 3DLBA 5AQTA 1CLFA 2W9AA 4YOYA 4BLGA 2HNYA 1IQZA 1AZSB 3SQ4A 4I2PB 4PR6A 3PJXA 1D5AA 3DMJA 2HEKA 4PXCA 4H4MB 3A5OC 1SH0A 2P9NB 4GV6A 3MWPA 1VYAA 3DM2A 4DTJA 1BXNA 1FRMA 2VASA 5KAKA 3VGVA 5F9LA 3CIMA 3D4JA 2X3GA 4TXSA 4FXVA 2AEFA 2VZ9A 5BPNA 3ZSQA 3LL3A 1RHRB 1VSEA 5K8NA 4CLZA 1K73T 1KQFB 3NF8A 2G8VA 3P5BP 1NKBA 2JFDA 1VQSA 4E7LA 3L4IA 3FZ2A 3J7A1 4MAKA 2UU9J 3NL0A 2GVDB 2AV5A 1S49A 1JCEA 2R7OA 4ANCA 1UKUA 2GMJA 4NX9A 3PJ9A 1TMMA 4L3QA 5LXRA 1ZAXA 2YTCA 3OYGA 3KHGA 1RGVA 3B54A 3IBFB 4NZ7A 4AHRA 2GHVC 5AQYA 3ADAC 1XN9A 1H6KX 4CIOA 2CQ4A 2IMWP 3SIPB 4ZTFA 3P4IA 1EO1A 3KUGA 2KHOA 3HDSA 1VR6A 5E3AA 3PEJA 3R5DA 1XNQJ 2M88A 1Q82O 3E9LA 1YRUA 1TKXB 3AXKA 4NLDA 3WIUA 4O5FA 5BJRA 3GJQB 4BG9A 1ZBSA 4NCAA 3W3SA 1W9HA 3ZNUA 3MAQA 2QIFA 2E7XA 3HTVA 3H42A 3IA0A 1D4XA 3E66A 2Q1LA 3RYLA 3CT9A 3GWCA 3H5UA 4JI4J 3Q8UA 1IM6A 1S12A 1M90T 1JXEA 1YRXA 3EVMA 4QR2A 1AFJA 1NGDA 3AOCA 3CJCA 2CUYA 1RTIA 1HYSB 2CPEA 2P5VA 3OTOJ 2PEBA 1S6PA 1Z4UA 2IPOB 4OHXA 3HM8A 4NE9C 3BSAA 1PJ7A 2GTDA 2ZITA 4DV4J 3PKYA 2GQ2A 3P39A 1RXOB 4F4XA 2FF3B 4NI2B 4J2AA 5EOYA 3U4LA 4F25A 1HLUA 2NNWA 1RSCA 4DG1B 1Z25A 3L95X 4ERDA 1BQNA 1YJVA 3HXMA 1JXLA 3E8OA 3SUNA 2R2TA 3TZZA 2P9LB 3HSGA 3ZX0A 3HP6A 3DXSX 4IOAQ 2W2PP 3U1MA 2JGUA 2DNNA 4WFBQ 3DRXA 2YPZA 4DX7A 4FJIA 1WEXA 5F8MA 1Y00A 2YH0A 1WG4A 4OX9K 1HQEB 4QYZK 2R7RA 4ZVHA 4NLCA 2YHYA 4ID5B 4BRMA 3TEGA 2XY7A 2HW3A 3HZGA 1DFDA 2FQQB 2QTDA 3D45A 3M3ZA 1W2BM 1UVLA 1U1KA 3T9ZA 1HYVA 5EUHA 3U6FA 3IAM9 4DFPA 1ZXOA 5ADXH 3M8PB 2YY3A 7FD1A 1W97L 2BBEA 2C42A 3KJQB 4ID1A 2CPJA 1Y7PA 2LYVA 3KLFA 4WFZA 1O13A 1X60A 3PHTA 3O3HA 4X62F 3LZIA 4M3TA 2M8DB 1VQOS 3HVTA 3V6DB 2PA8D 4QWCA 4FSVA 5LMNK 2DH7A 4J9NA 4LREA 4JD2B 3UE5A 5M1NA 2QKKA 4O3RA 4X62K 1CJTA 3IR5B 2VA2A 4HUFA 1Y11A 5ETSA 2P9IA 2YNGB 2IA0A 3A2FA 3UNGC 1S6QA 4IKAA 1S1UA 3CDEA 1GLEG 3UB5A 3HYFA 3ZT1A 2ZBRA 4WE1B 3TABA 3ZZZA 1YRTA 1TL1A 2GVZB 1CC8A 1SPBP 5DM7Q 4ZCMA 4CO3A 4NXMF 1RADB 3RAXA 5AXMA 3M30B 3G6EN 1U48A 5DM6L 3IO1A 3M2UA 1KAZA 4PEOA 4PG4A 4RW8A 1IKXA 2W9CB 3W2WA 5FPNA 3L2UA 3ILOA 1BIUA 3WXKA 4DR4K 1WBBA 1NGGA 4G1QB 1JNZB 4DPWA 4C8ZA 2UXBJ 4KR0B 1S1VB 2OPSA 5LL6d 1UAXA 3IDHA 2ASMA 3CCJS 2IJRA 4I6YA 4TKTA 3QMQA 2YPYA 2XCPA 3VESA 4CJEA 2Q66A 1PAEX 1T02A 1YLXA 1JLBB 3L6QA 4YY3J 1D9FA 4PWWA 1MMDA 3VAFA 1S1TB 2HZVA 3ZETA 2DR6A 2CZVC 4R8UA 2BE9B 3KLIB 4LF9F 3F44A 3MR2A 3H2UB 2ZJRQ 4K2JA 4FPAA 4IZ9A 2IMOA 3GG4A 4OGCA 1FRHA 4QIVA 2MKJA 1I5OB 4OKKA 4IJAA 2UXCJ 5HI7A 3ENAA 4B02A 1QSSA 4LF9K 3PW0A 4ANDA 3THYB 1WKJA 4CTAB 1FK9A 4CM0A 3V9UA 4YHHJ 4O3PA 4K42A 4MDBA 2KJVA 1UJ5A 2LECA 5EWGA 4ZN3A 3KWMA 4KO0B 1G4CA 3HX9A 5CE3A 4YR3A 2IVMA 1KTQA 1HHSA 4E7JA 4E7HA 1NG9A 3HHLC 2APOA 2QL7B 1YDLA 3ELHA 5AQQA 1BCOA 4S0MA 4GY2B 2RHQB 2VDHA 4FW1A 4KAIA 4QIWD 3O1LA 4PPDA 2B9XA 3DRYA 3GU0A 4X66F 3I8BA 2CQ1A 4AHUA 2NRVA 4ED2A 3VF6A 3O5BA 1VC0A 3T3FA 4NCBA 3THTA 1IBMJ 4RW4B 3L7PA 2D0AA 2BM1A 2I8EA 4O23A 4ECWA 3GJRB 3OYHA 5THWA 4K4WA 2ATLA 3UWTA 2KRRA 4OLBA 3NRBA 3RMCA 3R5CA 5SZTA 2FB0A 1TL3B 4H54A 4Q2LA 3QWPA 3FZMA 2OFGX 2F9TA 2V4QA 3EE8A 4Z7YA 3FMBA 4XDCA 4JLHA 1VCTA 3J8AA 1I3OB 4CLWA 1Q9XA 2Y0BB 3R7BB 4KB0A 3TARA 4GVBA 4LF6F 2FZKB 2CDQA 1J5OB 3LDNA 2DFFA 1GTHA 2ZNZA 1JLQB 2VQFJ 3QESA 8RUCA 5C42B 2IFXA 3FDSA 4OYAA 3VF4A 1GX6A 2HSEB 4U9RA 1UOCA 3BY5A 5H9FK 4GKKF 3U8XA 3FCWA 1Q8LA 5C10A 1Y5NB 4JKFA 4WQ5C 4OZLA 3VETA 2DKOB 4FYXB 1RKJA 4BDYA 4CIGA 1U1PA 5J2PB 3B8HA 3DLEB 5LSLA 1SKRA 2WBMA 1YJUA 2W8LA 1RE1B 1S9EB 4ZPTR 2OEKA 4BWMA 3WBZA 2FJAB 2WB1D 2VFUA 5FIIA 1S59A 3S7RA 3QDKA 4Y34A 4PZVA 5HN0A 3OJSA 1Q82T 5I42A 1JWWA 3IM9A 4JP8A 4FOIA 4PXBA 3UVJA 3OFHA 2DEJA 1RT5B 2ZVSA 1M0SA 5DZ7A 2PN6A 4BDPA 5IT4A 3HO1A 1HYZA 2GV9A 3UD5A 2VPYB 4ZPCA 1XUPO 4JV5K 3AQOA 3EZOA 2JOQA 2DITA 3BDPA 1TV6A 3NG8A 4J9UE 4Q44A 4BE0A 2HFVA 1NXIA 4IH5A 1MNEA 4OYZA 2QA4G 3SBTA 3AB2B 4DV7F 1IBCB 2NCKL 1NH8A 2KO1A 2XMMA 3Q0AA 2F40A 3N0VA 3THXB 3W9JA 2G8KA 4LSZB 3LWLA 5KFRA 4CWBA 3IRXA 2UUAJ 2AYMA 1SI9A 1XMBA 5HRNA 3ZCMA 5IWAJ 2HF4A 4U96A 1EETB 3TYTA 3C6UA 2ZNYA 3QRRA 4X4NA 3GV8B 3KG0A 1JL2A 2HB5A 1Y0HA 2QL9B 4OHVA 3UDVA 1N32J 3VQBA 4UF4A 1N33K 2G2YA 3RW7A 3EGZA 2KT2A 1A5XA 5LJVA 1OH6A 2JLGA 2UUWA 4AQYK 3FZKA 5KQDA 3NXZA 2OHDA 3BSOA 2OPRB 2P1JA 4BC3A 5DK5A 4RNNA 4USMA 4B9NA 4IR9A 4H5RA 4E2FB 4B3MJ 2HQIA 3G71S 4DZDA 1XI1A 1SKSA 2OO4A 5GIOA 4USWA 1YBTA 1J5EF 3JQJA 5B0GA 1RBVA 1RILA 2BM0A 4DMNA 1NPKA 2A1SA 2LEBA 4CGHA 4FLYA 3O80A 2MLYA 2O8EB 2I6WA 3G71N 3OYDA 2ZUGA 4PHTX 4P2XA 2GWJA 4JI0J 1J5EK 1Q7YO 4I6MA 4CJVA 2BUNA 4MJKA 1WSJA 3TJ8A 5A0YB 1X9JA 3WX4A 3OBYA 1TAQA 1WI8A 3M6XA 4NXNF 3OTDA 4C11A 2FF6A 3Q8SB 2AWZA 1X9SA 4DB3A 3SEOA 1L3KA 1BU6O 5BR8J 3L3CA 3NNAA 4Y2KA 4DX6A 2KLAA 4NXNK 1PC5A 3BN7A 1EWRA 2VODA 3D6TB 4OJHA 1VQLS 3LP2A 2Y3YA 4ZP6A 2CJXB 2AGQA 1JKHB 3DWLA 1WSVA 1QVGR 1OVYA 2D0PA 2CGJA 2CGKA 1QAXA 1NHKL 1TKTA 3DFEA 4DV3K 1LW0B 1K8KB 2VG5A 3CDWA 3TAGA 4M63C 1WEZA 3UI3A 2KT5A 2YWFA 3BH6B 4HACA 2HNDA 3ZXWA 4Q5VA 4DV6F 4ZVRB 1N34J 2F4VF 5F0WA 1KR4A 4A8OA 3VA3A 2R9LA 4FF1A 5F3TA 3L7OA 4RBUA 4CJRA 2V8GA 3L0QA 4Q0BB 3HHLA 3VQ4A 2HNZB 1U2VA 5FD1A 1CZBA 3VAKA 3M6WA 1G2EA 1YXQA 1B0PA 1RKIA 3KIOA 2GHPA 1QAIA 1SAZA 3W9IA 3QFPA 4MFBB 5J2NB 2HHVA 4JNEA 2PYLA 3IBCB 4JUZA 3ENQA 1T9YA 1RU1A 1X9WA 1OYEA 4AXJA 3DRPB 4ZVUB 2EG1A 4NLOA 3HSZA 4OJGA 5DM6Q 4CZHA 2Q97A 2B43A 1U49A 1HBNA 3QERA 2F8TA 3VQTA 2X1AA 2JEJA 5LL6Z 4ES2A 1KP6A 4HTUA 2KL8A 1YHQN 1LWEA 1S1XB 2DY4A 4CBWA 4DR1K 4OZ1A 5B08A 3EVOA 5C24B 3CJ8A 1BQMA 2AJFE 3OR1A 2MTLA 3MAAA 1U09A 3LGNA 2UXDF 1DLOB 4JV0A 4DR2K 3N4WA 2MJUA 4FJJA 3LP1A 2ZFHA 4MT1A 3JS6A 2NXEA 3LALA 2R8IA 4FJ7A 1FJGK 1SS6A 1SC3B 4DF4A 1PYTA 2HQGA 2EG2A 4Z7CA 2RQ4A 2YKQA 2JWNA 4Z4EA 4EI2A 5IC6B 4W92B 3KNAA 4USIA 5AQGA 1PO6A 5HRRA 2B8PA 4D3GA 4QU7A 2DBBA 5EX0A 2AEJA 3MCMA 4A8QA 2N3LA 3FSXA 3I87A 4BR4A 3TW0A 2V4JA 1S7HA 2FLLA 3T5JA 2VGNA 4BC9A 1WB9A 4X64K 3GG0A 2VF3A 5KG0A 1S22A 2N82B 3NCPA 1KD1O 3X3UA 3AA3A 3MR6A 2XSFA 4CF8A 4PRFA 2N4DA 3ZTQA 3THWA 3CDBA 5I3UA 3V6JA 3RSEA 3RBDA 4IFVB 1UMJA 2DPJA 3LDQA 3IGNA 2LU1A 3OXGA 3GG1A 3JQMA 3HOTA 2MDAA 4WP9A 4O3QA 2K06A 1EX4A 4Q2MA 1RHQB 1XC9A 4M5KA 2DNHA 5KT4A 4KHPK 4M5HA 1JMTA 3EGWB 5ETVA 3B4DA 5AXNA 4DU8A 5BN8A 3RB0A 1ASUA 2IBKA 1HMVA 3DJCA 4OKJA 4X2BA 1HNZF 2PZSA 3K8WA 4J9SA 4LIRA 5CD4A 4QIGA 4LFBF 1Q5YA 5KFUA 4NYNA