4RW9A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw9A05
3OS2A 3C6TB 1JLCA 4NLOA 1REVB 4QCLA 1G15A 3SUOA 1QSLA 5J2NB 1CSJA 3G86A 3AO4A 4DSEA 4ZTJA 2KZZA 3QIOA 4F3TA 3ZT2A 3LP2A 3V9ZA 2I1RA 5F8LA 3KLEB 2FLPA 4ID1A 4MQ3A 2FLLA 3LALA 5KGXA 2RDIA 3H5UA 3BDPA 5J2MA 1RBUA 1ZBUA 3L3UA 4CF9A 3KD5E 4KO0A 4EYIB 1QTMA 1VSMA 5KTQA 1XR7A 3T1AA 4R5PB 4Z4GA 2E9RX 3DRSB 4RUAA 3SQ1A 3AA3A 3NF9A 3TQ1A 2Y1IA 3D0PA 2YNIA 4DMNA 3LPTA 2PY5A 4CJEA 4G1QB 3EPIA 2WHOA 4JV2A 3VA0A 2E6MA 3NH1A 4CF0A 2JEFA 4Q5VA 5F8HA 4KAIA 2YHAA 3K5MA 1SH2A 4B08A 2WONA 3I0SA 2WOMA 4GMJB 3ZCMA 4LSNA 4CK2A 4CJVA 4YR2A 4M3UA 1X9WA 2ZQBA 3DDKA 1RDCA 1ITGA 2IGIA 3O4QA 3NHGA 1BQNB 4M3XA 3H98A 2KZMA 5KGWA 3PO4A 4EP5A 4CF1A 4IOBA 2IBKA 3OL7A 3CWJA 3AVIA 3TVKA 3MEGB 1KHVA 1I3AA 1ZBFA 2D3UA 2IM1A 4W5OA 2W9CB 5KG7A 2JC0A 4NLQA 3DLGB 3L2UA 3CYMA 4O3SA 1QSYA 2VG7B 2CKWA 4M41A 1RA6A 3KLGB 3CDEA 1KVBA 1T03A 2RKIB 4YR3A 3JYTB 1NOYA 4MKBA 3DM2A 1TV6B 2R2SA 2XI3A 1RAJA 4ECZA 4HHTA 4ECUA 3TAGA 4ZHRA 4RW8B 2X6NA 2XCAA 1RBTA 4B9SA 3MXMA 4DTSA 3FDSA 4ECVA 3OS0A 2FJVA 4H4MA 4DL7A 4CJTA 1QE1B 4J9PA 1WNEA 5HROA 1KLMA 1XI1A 5T7BA 3IAYA 4WYLA 2GV9A 2JGUA 1L3VA 3TAEA 4TSXA 3V81B 4FJXA 2OPQB 1VSLA 3KLHA 1MU2A 4FM2A 3KK2A 1NK4A 2WK4A 1RT5B 4HVJA 1TGOA 2UVVA 2OZSA 3HVTA 4DWIA 4CFAA 4CECA 4UQGA 3CQ8A 4F4YA 1IKVA 3V4IA 4BACA 5KI6A 2V4RA 5CYQB 3Q8PB 4BE0A 3VQ9A 3CDWA 4URQU 4DFMA 2ZE2B 1FXXA 1DLOB 1XR6A 3MFIA 4CJFA 4IG0A 4KHYA 2HAIA 5DK5A 1DTTA 5F9NA 3LAMA 3QO9B 5KFYA 1VSDA 3H59A 2PYJA 1QHTA 4C8MA 2RN2A 1KRPA 4B9VA 1RBSA 1FKOA 2YNGA 4E3SA 2HHQA 3M8QB 3T5KA 4LD0A 1S6QB 3MEDA 1VRTA 1VRUA 4F4XA 3PX4A 3QETA 1EXQA 4LQ3A 4IQXA 2F8TA 4BDZA 3HHKA 2Q3SA 4RW7B 4FBUA 1D8YA 1IM4A 3WNHA 4CEOA 2FVRA 2GIRA 4EO8A 3VN5A 5HBMA 1JL1A 2W42A 1O1WA 3FFIB 4RW6B 1IKXB 1U4BA 5C42A 3K5OA 1NK6A 1K1QA 3DRPB 1U49A 3OSPA 5KFXA 2E9ZA 3P5JA 4ICLB 2HMIA 1RA7A 4Y34A 3V6DA 5C24B 4CFBA 3P1GA 1HNIB 4NYZA 1CZBA 4J2AA 4NLRA 1BL3A 4DFJA 1C0MA 2PYLA 1S6PA 1IKYA 2HNYB 4E89A 4ECSA 4OGCA 3AVMA 2OYQA 2BANB 3KTQA 3H5XA 3VQPA 4FJ7A 4HUFA 3DOKB 4M3TA 1RT2B 1U47A 1RT4B 2FJXA 2B43A 1BI4A 4PUOB 4FLZA 1N6QA 3GIIA 1NKBA 5FRNA 2VA2A 1LWEA 4B9NA 3K2PA 1N4LA 5F8JA 5KFGA 3KK3B 4DS5A 1WSGA 3V6JA 4Z4EA 3KOAA 3T5HA 2KW4A 4NLYA 3LWLA 5J2QA 1WAFA 3NAIA 2EC0A 2AWZA 4QW8A 3VQSA 2W9BA 4E7IA 1SL1A 1NJXA 3PW0A 1GX6A 2J6TA 4AH9A 4CGFA 4Z4FA 1C0TB 1RDDA 4QWAA 2I5JA 4MFBB 4YP3A 4F3OA 3BQ2A 1T8EA 3ICLA 3M8SA 2FBYA 4KB0A 3DYAA 3V1QA 3MTKA 4TQRA 4B8AB 4E1MA 2FLNA 5FROA 2NUBA 1LWCB 1JXLA 4TY8B 1KSPA 2D0BA 2W7PA 5KFLA 1S9FA 4XPEA 3E51A 3DLBA 1JLQA 5JS1A 3BQ0A 1SV5B 2AGOA 2V4QA 4Y1DA 5K14A 4Q8EA 5I42B 1RDRA 3AO5A 1IH7A 3B6OA 3HT3A 4DSFA 4HKQA 1JKHA 5KG0A 4BE1A 4H4OA 1ASVA 2BQUA 3HYFA 3VQ5A 1EETB 4CHYA 4ZVGA 4F2SA 3RRGA 5KFCA 5J1EB 4IH6A 1QAJA 1CXUA 2R8HA 1ZBLA 3K59A 1B9FA 1ASUA 2QKKA 1D9DA 2X74A 2IDOA 4I7FB 1D0EA 5KG6A 4O55A 1J54A 2EHGA 2XGQA 5EU7A 4WZMA 1GOCA 3T5JA 4QAGA 2B6AB 1S49A 2OPRB 4E7HA 3SQ2A 1S1VA 4LH5A 2WCXA 3PR4A 2VG5A 1SUQB 1S1UA 2D41A 4K50A 3PX6A 2QK9A 1TAUA 2F96A 3OL6A 4NCBA 3MF5A 4CGGA 1TKTB 3EYZA 5J2PB 1HYZA 2VG6B 2FJWA 3SV3A 1JLGB 3L2VA 1ZBIA 4EZ9A 2OPPA 3MR6A 1T3NA 1S9EA 1EP4B 3LP1B 1JLEB 4FBTA 4I2QB 3MXJA 3RB0A 3P83D 1SKWA 4OKJA 4N47A 4RW4A 4LSLA 4ZVHA 3ZT1A 4J9QA 4ED1A 4CIEA 2V9WA 2HWHA 4IR1A 1VSIA 3KMSA 2G8HA 4M3YA 3MAQA 4DF8A 4RW9A 3FRZA 1S9GA 3PW7A 4FCYA 1C1BA 4M3RA 1C1CA 1HMVA 3NBPA 2AGQA 5JUMA 5HLFA 2DPJA 4XIUA 2IMWP 4CJUA 2C28A 3CG7A 1NK8A 3I8DA 5KFUA 5FRMA 4J2EA 3AVFA 3OYLA 5KFOA 4FLVA 5DGAA 2FBXA 1A5VA 3SUPA 3QZ8A 3KLFB 4OL8A 4PY5A 2BE2B 2F8SA 3MEEA 4NLDA 5HRRA 3SFUA 3KLIA 4O4GB 2YKNB 3HK2A 2R8KA 1HYSB 1RTDB 4WFYA 4OPJA 1NK9A 3NDKA 3OYGA 4DL5A 1CLQA 1LW0A 3PW2A 1RBRA 1NJYA 4OLBA 2XRIA 2PZSA 4AHSA 3UIQA 1CZ9A 4B9MA 3HO1A 4K8XA 4NLGA 3I5AA 4EBCA 2X6SA 1WSJA 3NGIA 2DPIA 2BQ3A 1JLAA 1HNVB 2XWYA 5DMRA 4FM1A 1RTIA 4I2PA 3PVXA 3C6UA 1TK0A 3KHRA 3T19A 4IH5A 3OS1A 4DS4A 2C22A 4ECYA 4TXSA 3H40A 3QNOA 3KIOA 3NF8A 2DFEA 1ZTTA 3FSIA 3L2QA 4U6PA 1HPZA 1RTJA 3KK1B 4TQSA 1R0AB 2D0AA 4CHOA 2P51A 1JL2A 5C5JA 5DG7A 2ETJA 4KREA 4IFYB 2HVHA 3CIZA 4CGIA 4AHUA 3PW5A 3SUNA 4RNMA 2G8IA 3VQ6A 2KFZA 4CIFA 3FQKA 1ZBHA 4ZVEA 3S9HA 4B3OB 4IDKB 4DSIA 3M8PA 1WSFA 5KFFA 3F73A 3ZSRA 2CJQA 4X2BA 4KRFA 3DI6A 1S5JA 1WSEA 1S1XB 3AVHA 3NAHA 1Q9XA 1TL3A 4DLGA 1F21A 3BR9A 5I3UB 1LWFB 3KJVA 2YNFA 3T5LA 4L8RB 4EEYA 3OYFA 4BE2A 3OYDA 3AVJA 4ZPDA 4ECTA 2WRMA 3GILA 4DU1A 4FZXC 3OYIA 5DQGA 1TAQA 2IC3A 2C2EA 1S1WA 3HJFA 4OGEA 3ZSVA 3PUFA 1QS4A 1TKXB 2HNZA 3Q8QB 3EZ5A 3DMJA 3QEPA 1D1UA 1UAXA 2Z1IA 4BWMA 2FC0A 5KFEA 5L1JA 4MK8A 4URSA 4K4UA 3HVAA 4KHMA 4CF8A 4KI6A 4EBEA 1BIUA 2B5JB 4O5BA 3NKYA 1DTQB 4MH8A 5EWEA 4FJ5A 4CIGA 1N5YA 1A5XA 1YTUA 3DLRA 3QEXA 3MECA 1FK9A 4FS1A 4IRCA 2O5DA 3GV5B 4DG1B 3GV7B 1RDAA 3MR2A 1TP7A 4FK2A 1UA0A 3HL8A 4KBIA 3V6HA 4M45A 3BJYA 3PHEA 3QIPA 3S3NA 3N6MA 3IRXA 4PWDB 1WSHA 1KFSA 5FDLA 1WN7A 3WNGA 1LW2A 4CJKA 4CJ3A 3SQ0A 4PA1A 2HHSA 4B8CA 4M42A 4F8RA 4J9LA 2HNDB 4ED6A 5T14A 3AV9A 4NLWA 2P5OA 2W8KA 3OLAA 2C2DA 5F8IA 3THVA 5KFRA 4JS5A 1S48A 4KV8A 1C0UA 3IGVA 4M3WA 4GVMA 3LP0B 1JLBA 4K4WA 4KHNA 1JLCB 2YNHA 4ZPCA 1BCMA 4RW6A 2BRLA 4JUZA 3CFPA 3TR8A 4FJNA 3LP2B 3HVWA 2DY4A 2AJQA 1JXEA 4YFUA 5J2MB 1RT3A 4DL3A 3RMBA 4KO0B 1XC9A 3SNNA 3D28A 2D3ZA 1B92A 1BCOA 3K57A 5F8NA 1BHLA 2D0CA 3NE6A 1XHXA 4K4ZA 3M8RA 5KFZA 3BREA 3E01A 4CFDA 1XHZA 2YNIB 1IKWA 4W5RA 4I9LA 4G3IA 1L5UA 2Z1JA 4F2RA 3NH2A 1UA1A 1QUVA 4KE5A 1D5AA 1NKCA 5CYMA 2FVSA 1RT6A 3PJWA 3DOLA 3H5SA 4IRKA 3HXMA 3U6FA 4O3OA 2WONB 1HQUA 2QV6A 3I0SB 3ITHA 4J9OA 2HW3A 2WOMB 1U04A 5L9XA 4LSNB 2ZKUA 5KG1A 5DG9A 3SJJA 4WFZA 3RTVA 1TKZA 4NLVA 4FLWA 4OVLA 3D45A 3CFOA 2RF2A 4KHRA 5HP1A 2V0NA 2HHXA 3KLVA 1T05A 2ZD1A 3DLKA 5C25A 4IFVA 1SH3A 4ZP6A 1OS5A 1WAJA 3JSMA 2XI2A 4FYDA 3T3FA 3AVNA 1T03B 5D3GA 4C8OA 3DM2B 2JLEA 3TAMB 5KFQA 3BGRA 2EX3A 2IS3A 3M9MB 4K4SA 1WLJA 4XPCA 4EYHB 1TVRA 4H4MB 4GW6A 4M3ZA 5HROB 2R8IA 1KLMB 4DQPA 4H8KA 4K4VA 2Y1JA 4FW1A 3OJUA 3QERA 5KFTA 1RYRA 4ID5A 3RBEA 2HB5A 4ECWA 1GOAA 2HHTA 3K58A 3OYMA 3RB4A 4IG3A 3SYZA 1W0HA 4F4WA 4JRPA 4PQUA 2OPSA 1UWBA 1RT1A 3KLHB 1MU2B 3KK2B 4R8UB 4Q43A 3TARA 2G8FA 3HVTB 2KTQA 3AVGA 3OHBA 1C1AA 1IKVB 2YV0X 1RT7A 3V4IB 4LY7A 4ELVA 3CJ4A 2UUWA 2GUIA 3I0RA 3O3HA 3GV8B 3OL8A 3SI6A 2UUTA 1BISA 1RTHA 2OZMA 1VK0A 4IG0B 1SL2A 4WE1A 4GC7A 1BGXT 1DTTB 3NF7A 3Q8SB 2IM0A 3KMQA 4O44A 1W9HA 4MK7A 3H4DA 1ASWA 1FKOB 2P5GA 2YNGB 1TK8A 5KFBA 4FZZA 1Q9YA 3MEDB 3OYEA 1VRTB 4F4KA 1VRUB 1Z26A 4CEEA 4M95A 3O3FA 5F8GA 3DRRA 1SKSA 4N41A 4FS2A 4FXDA 4OKEA 4DU3A 1JLFA 2HWIA 3O3GA 3TABA 3AO2A 1NNDA 4CJRA 3K5LA 3AO3A 5KG5A 2J6SA 3MXIA 3TI0A 3GIJA 3GYNA 2WB4A 4KKOA 4Y3CA 4FLUA 2FVQA 2UVWA 1B9DA 5C42B 1EKEA 4J9NA 2ATQA 1J5OA 3TAFA 2HMIB 3TWHA 5CY4A 3ZSXA 3OJSA 3V6DB 1K1SA 2YKMA 5DQIA 3EZUA 4WZQA 4Z0UA 1KLNA 3UR0A 4Q45A 1S6PB 1IKYB 4ECQA 4N76A 4KFBA 4ED3A 3L3VA 1BI4B 4DL4A 1TL1A 5KT6A 1N6QB 3KKSA 2IA6A 4FLTA 4NCGA 1KTQA 3LWMA 4Z4HA 4O3PA 2LSNA 4CJPA 4DTPA 3HVRA 5EUHA 4J2BA 1LWEB 3CO9A 3IS9A 3VQ8A 2GC8A 2IAJA 4CJLA 4ZP7A 3OYJA 3QLHA 3MFHA 5J2QB 2E9TA 4FK4A 4NYFA 2W9BB 1S1TA 3ZT4A 2D5RA 3CJ5A 4E19A 4ELUA 2OA8A 3QGHA 3F9KA 3RMDA 4N5SA 4Q0BA 1U45A 1BQMA 1FKPA 4DTNA 2I5JB 3VQ4A 2JEIA 4LQ9A 4O4RA 3C6TA 4OPKA 2R8GA 4E0DA 2BDPA 2XY7A 3A2FA 4WXWA 1REVA 4Q44A 4CEAA 4CEDA 4JRQA 3RR7A 5J2NA 3DYAB 4LH4A 4H54A 3KLEA 2VA3A 5KFNA 2XY8A 4R0EA 1NJWA 3CDUA 1SH0A 4QPXA 1T94A 4FJGA 2IJFA 1JLQB 1HQEB 2ATLA 3LZJA 4RG8A 4F4ZA 2Z1HA 4RNNA 5K14B 3BSAA 3QESA 4IH7A 3H4BA 5KFIA 1X9SA 4R5PA 4FJMA 3SPZA 4DL6A 1JKHB 3H5YA 1XWLA 4H4OB 1S97A 3DRSA 1A5WA 3N6NA 3CJ0A 2XHBA 4G1QA 4AILC 3OYHA 3RAQA 2F8EX 3V9UA 3RAXA 3CM6A 3UQSA 3ZT3A 3IG1B 1TQLA 3OHAA 3OVNA 3VQQA 3RWUA 4DG1A 4FZYA 3HPOA 4KI4A 1ZETA 1WNSA 4Y2CA 3RR8A 1S1VB 2DFHA 3ASMA 4CGDA 5KT2A 5DQHA 1C6VA 5KFDA 3B6PA 2VG5B 1SL0A 1BQNA 1S1UB 3FQLA 2XC9A 3AA4A 4CCHA 4QWCA 5KFSA 3PJXA 5F9LA 3PR5B 4M94A 3MEGA 5KG4A 2W9CA 1QSSA 1KHWA 3NAEA 5KFHA 2OPPB 3G6YA 1S9EB 3DLGA 3QIDA 3QGGA 4QWDA 3QZ7A 4HUEA 3UPFA 3BSCA 4I9QA 3KKRA 2VG7A 3ULDA 4RW4B 4LSLB 5SWMA 3AVAA 4CGHA 1GX5A 3KLGA 1X9MA 4DTUA 2RKIA 2E6LA 3SCXA 3S3MA 3JYTA 3V9WA 1TV6A 4RW9B 3LZIA 3LAKA 1S9GB 4KSEB 4CJ4A 2ASJA 4RW8A 1C1BB 1JX4A 4HCCA 3H2LA 1C1CB 1HMVB 3NBPB 2W7OA 3DLEB 5HLFB 5KT5A 1Z4UA 4FJHA 3HM9A 4Q8FA 1QE1A 4CJQA 2ALZA 3RRHA 5EWFA 1GOBA 4JS4A 3AVLA 2GBZA 2UVUA 1NOZA 4KB7A 3OYAA 4J2DA 3MEEB 3U3GA 3V81A 2R2TA 5KT4A 3KLIB 2OPQA 3L8BA 4ZP9A 2E4LA 3V9XA 3D5MA 1RT5A 2RDJA 1S0NA 4TY9A 3ZSQA 4ZMMA 4DSKA 5CZ2A 2ASLA 2IOCA 4C8LA 4EBDA 1U48A 2FBTA 5CYQA 1LW0B 2R7YA 4KHUA 3NGYA 4CGJA 2DFFA 1J9AA 2ZE2A 4Y2AA 1DLOA 3RMCA 3C95A 4XO0A 1S0OA 4FLXA 1JLAB 4ED2A 4NLTA 4KB1A 1RTIB 4I2PB 3C6UB 2BR0A 3QO9A 3SV4A 4N56A 4K4YA 2A1RA 3G10A 4RNFA 1HPZB 1RTJB 3M8QA 2R8JA 4KTZA 4K8ZA 1S6QA 3IN5A 3ZSOA 4FJJA 2ILYA 4QWBA 4MKAA 3I5BA 3CVKA 3C94A 1NK0A 5L1KA 4RW7A 1IO2A 4DEZA 4Y1CA 3BQ1A 3LPUA 1W25A 2J6UA 2BGGA 1CXQA 1VSEA 3M8PB 3FFIA 4DU4A 2ASDA 3KHLA 4CK3A 1N48A 4ZP8A 1IKXA 4MIBA 3DI6B 4FJ8A 3LANA 3DRPA 1QQCA 1LV5A 1TL3B 3TAMA 4ICLA 2R2UA 1L3TA 3KJVB 2G8KA 1LAWA 2YNFB 3U3YA 5C24A 1HNIA 4WYWA 4NLPA 3NF6A 4BDPA 4W5QA 2FVPA 4ZPBA 4OJRA 4KHWA 5CZ1A 4OLAA 4WXOA 2HNYA 3BSNA 4GC6A 3HP9A 2BANA 3TAPA 4DTOA 1QAIA 2IC3B 2HHWA 3DOKA 3HKWA 5KFMA 1S1WB 1SKRA 1RT2A 1Z25A 2ITGA 3ZSWA 3VQCA 1RT4A 3SI8A 2HNZB 4CJWA 3DMJB 4YQWA 5HRPA 1T7PA 4AHTA 1RBVA 1KFDA 4PUOA 4C8NA 3S3OA 4NZ0A 5KFPA 4C8KA 3I5CA 2AGPA 4NLSA 4ZVFA 1Y97A 4R8UA 1RNHA 2XO7A 3PO5A 3KK3A 1JIHA 1EX4A 1N5YB 4NLXA 4ECXA 4HCBA 3MECB 1FK9B 3CFRA 3VQAA 1I39A 3QEWA 3GIKA 1HYVA 3UDLA 2W9AA 4YR0A 4CHZA 3QINA 4YNQA 3GQCA 4CERA 5KRSA 3QYYA 3QIPB 1C0TA 3IRXB 5FDLB 1NK5A 1LW2B 4MFBA 3ZSZA 4ELTA 4FJ9A 2ILZA 4K4TA 3TANA 4J9RA 4BWJA 3HSTB 4F50A 3RBDA 1S10A 5EDWA 3OLBA 4K4XA 4IKAA 3ZSYA 3HPGA 5KFWA 4ED0A 1LAVA 1LWCA 4TLRA 4TY8A 4KV8B 1C0UB 4J9SA 2O4GA 2G8WA 1SV5A 1N56A 1JLBB 2OH2A 4AHRA 4ZHRB 5I42A 3SPYA 4E7LA 2YNHB 3IGNA 1L3UA 4W5TA 3NFAA 3QNNA 4AHCA 3VQ7A 4CJ5A 5L1LA 4DF4A 4DL2A 1EETA 4CESA 4O3RA 1TK5A 3QEVA 3OYNA 3NCIA 2HHUA 1RILA 4CE9A 5KRTA 3PY8A 3OYKA 1RT3B 5JS2A 2C2RA 5J1EA 5DG8A 4RNOA 4IBNA 4EP4A 2VWJA 4FJLA 1NHUA 3RB3A 4I7FA 3NL0A 3HP6A 3L2WA 4RNHA 3VA3A 4DLEA 1RDBA 4FJKA 3E01B 1YVUA 2B6AA 2OPRA 1IKWB 1S4FA 4DQRA 2G8UA 3G6VA 4OKKA 4FK0A 2A1SA 1SUQA 4HUGA 3EPGA 4DTMA 5KG3A 3WNFA 3M9NB 5CYMB 4NRTA 3V6KA 1MMLA 1RT6B 4NYNA 3DOLB 4EZ6A 1VSJA 1L3SA 1TKTA 5J2PA 2VG6A 1HQUB 1JLGA 4O0JA 3VQBA 3ITHB 5SZTA 1EP4A 3ISND 1JLEA 3LP1A 4I2QA 1NJZA 4J9KA 4Z4CA 3AA5X 4TN2A 2HVIA 1TKZB 3BSOA 3ALYA 3LDSA 2RF2B 4CJSA 1HRHA 4YMEA 4CK1A 1YTAA 3CM5A 3OL9A 5HP1B 4HYKA 1T05B 4CHNA 2ZD1B 3DLKB 3GIMA 5C25B 2JEJA 3VQEA 2D7SA 2JEGA 5HRNA 2XY6A 4IFVB 5KT3A 4CEQA 5HBMB 3JSMB 3ZT0A 1K6YA 4DFPA 3V1RA 5L1IA 1XR5A 1HARA 3OYBA 4DTXA 3AVKA 5D3GB 3O4NA 4B9LA 3MR5A 4RUCA 3PX0A 3KLFA 2AX0A 5KFKA 2YHBA 1HQEA 3KHHA 2BE2A 2UVRA 3L2RA 3AO1A 2R2RA 4B9UA 3BGRB 1D9FA 4RZRA 4O4GA 2YKNA 2QXFA 5KFVA 1HYSA 4FJIA 1WSIA 1RTDA 4MIAA 1ZYQA 1TVRB 4AHVA 3EY1A 2QE5A 2IJNA 3SUQA 4U7CA 4E1NA 1BIZA 4ID5B 2JC1A 1VSHA 4ED8A 2BRKA 4KHSA 4IG3B 3WNEA 4ZTFA 3RMAA 4O3QA 1VSFA 4IR9A 3OY9A 3NH0A 2X78A 4JV0A 4NRUA 4PQUB 2OPSB 2IM2A 1UWBB 1RT1B 1HNVA 1YVFA 3KNAA 3IG1A 1JXBA 5KT7A 4EO6A 4B9TA 2XGPA 1U09A 3PZPA 1RT7B 2DTUA 2FBVA 4DTRA 3G6XA 3CJ2A 4HTUA 2W8LA 4CEZA 5HRSA 1NK7A 1RCHA 3KK1A 4WFXA 4KHQA 3I0RB 4DQSA 1R0AA 4J9MA 1RTHB 4URGA 4IFYA 4DQIA 5DLFA 4WE1B 1ZTWA 2AQ4A 4FM0A 4CEFA 4CFCA 3MR3A 4O0IA 4O44B 3V9SA 3M9OB 4B3OA 4IDKA 2GIQA 4ECRA 5JXSA 1X1PA 4CHQA 4QOZB 4O3NA 3V1OA 3QGIA 4DSLA 5DLGA 3QEIA 4DFKA 1S1XA 2Z1GA 3SQ4A 2KFNA 3RB6A 1KVCA 3DRRB 2P1JA 4TYAA 4BDYA 3KHGA 5I3UA 1LWFA 3ISNC 4CF2A 1JLFB 1HJRA 5E41A 2HHVA 4MK9A 2RPIA 4Z4IA 3DLEA 1YT3A 4KTQA 4RU9A 4W5NA 3SFGA 3G0ZA 4KKOB 4E7JA 3N6LA 4QWEA 4IKFA 4DTJA 1S0MA 2KQ2A 4FLYA 1TKXA 3KD1E 4E7KA 1J5OB 5DGBA 1KCFA 3PW4A 3NGZA 3CJ3A 2XY5A 4DSJA 3Q8RB 2B5JA 3PV8A 4TYBA 1DTQA 5EWGA 4NLUA 2YKMB 3NGDA 3AA2A 4FVMA 1RYSA 4KFBB 4DQQA 2IM3A 3HPHA 4IRDA 4NCAA 4KAZA 4KTWA 2G8VA 3K5NA 3TAQA 1IG9A 1TL1B 2XCPA 2AX1A 3OSNA 3LP3A 4NCGB 2FVCA 1VSKA 5KFAA 2B4JA 1C2PA 4QW9A 2O4IA 4CEBA 3IS9B 4PWDA 4JV1A 3DLHA 2IAJB 4JLHA 3VQDA 2AU0A 4FW2A 1UOCA 3QLHB 2WTFA 2HNDA 3OYCA 4KPYA 2QKBA 3AVCA 3SZ2A 1S1TB 1NHVA 1NKEA 5F8MA 1I6JA 2VWKA 1KVAA 1TKDA 3NMAA 5KFJA 3H08A 4Q0BB 4CHPA 4ZPAA 5KG2A 3AVBA 1BQMB 4ED7A 1J53A 1Q8IA 2BQRA 1FKPB 3LP0A
chains in the Genus database with same CATH superfamily
3UCZP 4JI6J 4FWNA 5CAAA 1CSJA 2DHAA 1GXLA 4F3TA 1EZZB 4KBOA 2FLPA 4MQ3A 5KGXA 3H5UA 4ZN1A 2MMYA 3E1YA 3L3UA 4BRAA 3RW6A 3U27A 2E7WA 3KD5E 5GAHI 4KO0A 2Q1LA 1QTMA 5KTQA 2ZJRL 3T1AA 4JKFA 5M2UA 4YOVA 3TUJC 2P9PA 3V5RA 3AA3A 1WC1A 3TPQA 3D0PA 3CE8A 4DMNA 3LPTA 4G1QB 3MGJA 3NH1A 2RRNA 3W2VB 4CF0A 1RAFB 4Q5VA 3TJ8A 5A0YA 3TVYA 3IA0A 3K5MA 1FF2A 1VQLN 1VHIA 4NOHA 2F9DA 2MQPA 1I5OB 1FRKA 3CPWM 2Z2MA 2ZQBA 5H9FK 3C7NB 3N4PA 3FFKB 4Y0FA 1BMQB 4XEIA 4OZLA 5KGWA 4EP5A 4IOBA 3OL7A 3CWJA 1KHVA 1I3AA 4H0VB 1ZBFA 2IM1A 3L09A 1S59A 5KG7A 3C14A 4NLQA 1WOPA 2UUBJ 5BPMA 3FGUA 1KP6A 5C15A 1RWMB 1OSDA 3U02A 3DM2A 1RAJA 1U1MA 2HWTA 4ECUA 5E84A 2BJ8A 1NDKA 4DX6A 4ECVA 2EFQA 1FFGB 2FJVA 4H4MA 4DL7A 2F4VJ 4GVBB 4CLLA 2CNKB 1XI1A 4V19J 2SXLA 1TUYA 2A40A 5T7BA 3IAYA 3CMES 4QS7A 2XYHB 4CH7A 2BM1A 3M8ZA 4MYTA 1YJVA 2RD5C 1FXLA 3CC2N 3EGNA 3DLJA 1HFEL 1NNEA 3TSQA 2VQEK 4FJXA 3KLHA 1Y10A 3KK2A 1I3OB 2WK4A 2NRTA 4GV3A 1IN0A 1K8KA 1VQKS 1TGOA 3HVTA 4CFAA 4UQGA 2QA4G 4AE5A 1XN9A 4BACA 5CYQB 3Q8PB 4HI1A 4BE0A 2QLFB 2CGJA 4GKJF 4HI2A 4I68A 5IV3A 4GKKJ 4CJFA 1JJ2R 4JBCA 1R6VA 5HMWA 3SXLA 3PHTA 2JWLA 1SB6A 3J80Y 3ZEUA 1RU2A 1S99A 2RN2A 4IOCL 1KAXA 3HFZB 1WSVA 4E3SA 3EE3A 4LD0A 2CZ9A 1VRTA 1RAEB 4F4XA 3PX4A 1RWOB 2VZ9A 4LQ3A 4I64A 3H1QA 2E29A 4FBUA 1UZDA 1D8YA 3J81O 3P5BP 1KQGB 2P9KA 3VN5A 5GIPA 2KXHA 2DGQA 4ZCIA 1CC8A 5IT9U 3ULHA 1O1WA 3FFIB 2VPXB 4ER8A 1KAYA 1U4BA 3ZX3A 5C10A 3N9UC 7AT1B 3LDQA 1NK6A 1W97L 4M5GA 2VBZA 2E9ZA 2F5GA 3QT7A 2JL9A 1RA7A 2G2YA 4Y34A 4A8SA 4AD6A 1BL3A 4DFJA 2Q3PA 3K89A 2OANA 4KY3A 2HNYB 4E89A 3M3ZA 4H5WA 4OGCA 3KTQA 1O51A 1PJ6A 1VQ6S 3MPWA 2FJXA 1BI4A 2GVDB 4CM2A 4PUOB 1VS3A 4IZ9A 3GIIA 3O5BA 4CLZA 4FPBA 3GG1A 3HFKA 3KUHA 2KVQE 6FDRA 5F8JA 4DHYA 4IOXA 3V6JA 3T5HA 2HYIB 2KW4A 3KXDA 4CI6A 3LWLA 2E66A 2E1MC 5LJ5Y 2O8DA 1SL1A 3FBFA 1VCTA 2LU2A 1GX6A 1UVNA 1TR0A 3GTYX 4Z4FA 1GLFO 3D2EB 2F7TA 2JX2A 1N5VA 1RDDA 4ZS6A 1DQ8A 4YP3A 4DUYJ 1E4FT 1T8EA 2NZTA 1FT8A 4OZNA 2EBGA 3D0HE 1EWRA 3MCPA 5FROA 1JXLA 2BJ9A 5KFLA 5FPNA 4I6MA 2V4QA 3ZXWA 3HT0A 4X62J 5K14A 2CWXA 4PRFA 3B6OA 1BXNA 3QSYB 1JKHA 1HI8A 3BN4A 4H4OA 3VERA 4CLYA 3VQ5A 3T1YK 4M7XA 2DIUA 3PKMA 2RE1A 4F2SA 3IAM9 1SJ1A 5KFCA 2FHKA 1B9FA 1ASUA 1MMDA 2X74A 2IDOA 2A2DA 4V19X 3M2UB 5KG6A 2R7RA 2KXFA 3IKMA 1J54A 2FGOA 3W60A 4YHHF 3FLCO 2KYXA 2EFNA 3T5JA 1S49A 4YOTA 5IV4A 5FPDA 3BS9A 4DUZJ 3PR4A 1AT1B 2E1PA 4QJVA 4OI1A 3PSIA 3CCSN 3PX6A 2F96A 3LGNA 3FCVA 1VQ9S 4JI8J 1TKTB 3EYZA 3MCNA 5MAOA 5GAGP 2YQ1A 3VEWA 4DV7K 2ZVIA 3UO0A 4DZDA 4C3MA 4I2QB 3M8WA 3RB0A 2EWHA 4OKJA 4ZVHA 4BRMA 3ZT1A 3VVTA 1ZZFA 2ZOMA 1NSQA 4DR1F 4IR1A 2QEXS 4M3YA 3MAQA 2OELA 4FCYA 3J7AP 2LKZA 1C1BA 3LGMA 3A8JA 1HNXJ 1T9YA 1YXQA 5JICA 2IMWP 1VISA 2C28A 1NK8A 4V19S 1DJ0A 5KFUA 3MN6A 5FRMA 2DCLA 2PMWA 2AJFE 3OYLA 4P10A 1AUDA 3EVWA 4G6VB 3QZ8A 3KLFB 3SUPA 2BX6A 4DR4F 1C4CA 4PY5A 1WKLA 3G6EN 3MEEA 1B0VA 4WWSA 1WKKA 5HRRA 4OPHA 3KLIA 1WBDA 2QLJB 4ISGA 4OHYA 3ULEA 1RWUA 3IWNC 4MLEA 3ZZZA 1LW0A 3AD8C 5F0WA 1RBRA 4PL7A 3UIQA 1CZ9A 4K8XA 1RLCL 1GK8A 3L9ZA 3FSYA 1QVFM 2BQ3A 1T44A 1NGFA 4LF8K 2VD3A 3A3OB 3VESA 3CETA 1RTIA 3PVXA 3W5XA 4JD2A 3C6UA 3W61A 5BRHA 1S77D 4KPCA 5C2CA 2C22A 5D4NA 5AXLA 3QNOA 3FSIA 3L2QA 4U6PA 1HPZA 3MMVA 5HMXA 1R0AB 3LDOA 1QDUB 4CHOA 5B0FA 5C5JA 5DG7A 2ASMA 1U2VA 1WC0A 2NUHA 5FLXY 3HSZA 2V4JB 3B6BA 4CGIA 4AHUA 3G8QA 3W3DA 2G8IA 4A47A 2IVPA 2ZH5A 3CF5Q 1YG0A 2HFZA 2JLFA 4WIQA 4USVA 3ZSRA 2HBLA 4LIWA 4X2BA 1GH8A 4AM6A 1R27B 2B9XA 1S5JA 1U2CA 2IPOB 2YBVA 2BKOA 3AVHA 2I7NA 1R8PA 3MXHP 3OTEA 4DLGA 4I69A 3M7VA 1F21A 3NGRA 5HQMA 3KJVA 4O8KA 3UD4P 4L8RB 3SQOP 4EEYA 3AHPA 3CD7A 2WTUA 4WP9A 3EX7B 5HSPA 2AIRB 3IAS9 1B70B 4C6AA 4BRDA 3E8OA 4WQ5A 5DQGA 4F02A 2X1AA 1PGZA 3MM8A 1TKXB 2HNZA 3EZ5A 2N4DA 2GJ2A 4Z7CA 4QR2A 4K4UA 2J9CA 4EBEA 4NI2A 5EWEA 4IQMA 4CIGA 3Q2TC 1A5XA 4ZJOA 3J81U 5E26A 4DR3K 5CQGA 5AQJA 2DR9A 4DG1B 2DISA 3GV7B 1RDAA 3AB4B 1Z2ZA 1VRQC 2XMKA 3J7ZO 1CBKA 1JJ4A 5H1SQ 4FK2A 3E66A 3BO4A 3BO3A 3PHEA 3QIPA 3S3NA 1WSHA 2CPDA 1HHTP 2OCEA 4K59A 4B8CA 4MO5A 2CXEA 4J9LA 2HNDB 4ZVOB 1HWLA 4W90B 2UYTA 4DR3F 1FHTA 4NLWA 4F0MA 1IXKA 2K06A 4PCQA 5F8IA 4L72B 5KFRA 4JS5A 1C0UA 3HHLD 3IGVA 2VC0A 2EG2A 2LECA 2E7VA 3OFFA 1ELOA 4RW6A 3MCSA 1YQHA 3CFPA 1EKRA 3D6FB 3TR8A 4FJNA 3LP2B 2RE2A 3LDPA 2YCHA 3HVWA 2DY4A 3QT5A 3VAMA 3PRBA 2I6WA 1JXEA 4X4UA 3VPZA 3WXJA 4JI1F 5IC4B 4DL3A 2NNWA 1XC9A 2V8VA 3D28A 5EGYA 5AE1A 1BHLA 2VJVA 1Y7PA 2D0CA 4NASA 4WQ4C 2GUPA 4DV3J 2Q79A 5KFZA 2VGNA 3VTHA 4Y00A 2UUCF 4A48A 5K5MA 1XNQF 5M1NA 4I67A 1L5UA 2DR5A 4F2RA 4KE5A 4RUBA 3TUPA 1SKUB 3FZFA 1RT6A 3PJWA 3HXMA 2GGPB 2QWMA 1U04A 1WC4A 1HR0K 2RQ4A 4LSNB 4F4AA 2ZKUA 3VMFB 4A5AA 4DR7J 3L6QA 2YJEA 1TKZA 4NLVA 2V8HA 3O5TB 1N34J 1VQ7S 4B3MF 3CFOA 1OY6A 2CQBA 2H5IB 4KH4A 2V0NA 4FYWB 1T05A 2ZD1A 3IBWA 3IC1A 4DR5K 1HD0A 4LF7J 4IFVA 3MUVP 4NMLA 4JI6F 4UT4A 3QBCA 1JQGA 1WF0A 3T3FA 5D3GA 2L9WA 3MM6B 1TYQB 5GMDA 4CT8A 2P9LB 3TAMB 3CCJS 3SAGA 3BGRA 2PA3A 3M6WA 3DN9A 1FEEA 4XPCA 3VCDA 1TVRA 4EYHB 5CABA 4M3ZA 5HROB 4DR5F 4CZMA 1KLMB 2BKPA 4ED5A 5I9EB 2P9IA 3OJUA 2P2CB 5M2PA 3RBEA 4ECWA 3VTIA 3AY9A 3RB4A 1W0HA 1XMOJ 2RIJA 3DLLQ 4OZ0A 3D0GE 5AE3A 1MU2B 4PZVA 3DXKB 3M2VA 4I6AA 2EPIA 3AVGA 3W64A 1RT7A 8RUCA 3S1TA 2MZRA 3Q8YA 2XLIA 4ELVA 2NXUA 1GLLO 2J7UA 4C8YA 2GO8A 2FTRA 2GUIA 4CZHA 3I0RA 4EHUA 2HRTA 2FLOA 1VK0A 1YIJS 1RHUB 1PBAA 5ETKA 1XTZA 2R7VA 2L41A 1M90T 2DO0A 2Z57B 1W9HA 4PPDA 1QY7A 4MKYA 2H5EA 3QWPA 4LRDA 1Q9YA 1MNEA 1WC5A 3PEHA 2CGKA 1VRUB 3ET6B 4M95A 4PG7A 1SKSA 4N41A 4FS2A 4DU3A 4P2MA 2ZH6A 2V67A 1F5BA 3AO2A 1VBKA 2MTLA 2MQQA 1FDBA 4OV6A 4BR2A 3ENOA 3MXIA 3TI0A 3GIJA 2F4VF 3EL2A 3D7SB 2PFDA 1B9DA 5A76A 3B8HA 1S7IA 1RBAA 2ATQA 2R7WA 1SIWB 1VJWA 4X66K 4MAKA 2HMIB 3TWHA 3R27A 2IIRA 1YJRA 1YJ9N 2KT5A 3D3BJ 2FF6A 1S6PB 4DR2K 4ECQA 1Q7LB 1RHRB 2VDHA 1WF1A 4RJVA 1FFWB 1OJ4A 1TFYA 3KKSA 3F0NA 4XDCA 2ZM6J 2W2NP 2FSJA 4BGBA 5GAGI 4GKKF 4Z4HA 4CJPA 2XO6A 5EUHA 4V1Ak 1S6OA 1LWEB 4LFAK 4MT1A 4H5VA 4BRHA 2GC8A 4DN0A 1PC4A 3BEXA 3CCTA 3MHYA 2W1BA 2M7SA 3ZX0A 2LQ9A 3MFHA 4K7QA 2E9TA 4NYFA 1DAXA 1CJKA 4UZBA 3ZT4A 3CJ5A 1UFLA 1NMDA 1KTVA 3F9KA 5CD4A 3O3LA 2ZZMA 4NMXA 2JVOA 4Q0BA 1FNOA 1U45A 2E7XA 3RBZA 2R7UA 1PBUA 2DNLA 2E1ZA 1FKPA 4DTNA 4CYUA 3THWA 4LQ9A 4OPKA 3C6TA 2R8GA 3PIOL 4USKA 4BS2A 3A2FA 1BY9A 4CEAA 5J2NA 1FA0A 2H48B 5GMEA 3J7Z5 4LFBK 2NXJA 2NRHA 3RGIA 5KFNA 4YUDA 4NZ6A 2A18A 1JLQB 2QMUB 2WVBA 4RG8A 1ZS6A 4BC5A 2V94A 2DT9A 3JXOA 1Y64A 2JSXA 4YS2A 5KFIA 1RZMA 1S97A 3AJDA 4DCJB 1IQZA 1YJUA 2M3DA 2XHBA 2APOA 2MGZA 3GSIA 3A8IA 5TKYA 4WP3A 1T02A 5AXMA 3UQSA 1VK8A 3CD0A 4MYUA 2OP5A 4OYBA 3EGZA 3IG1B 2P9SB 3VQTA 2RHQB 4RWTA 3C16B 4WU3A 1V4TA 4UQTA 1M1KO 3RWUA 1FCAA 2KN4A 1VQ8N 2KB2A 4KI4A 3L3CA 1BE4A 1RAAB 2DFHA 2VFTA 5D8HB 2GVZA 5DQHA 5KFDA 5HO4A 3OR2B 1SL0A 3SEOA 5AT1B 3SCKE 2M8DB 1VQYA 4H5RA 3IFRA 3G8TA 2XNRA 2XYGB 2AA4A 1F5AA 2HBJA 1N8RT 3MMCB 2YWHA 1QSSA 3CF5L 4DUYF 1GMWD 1IG8A 4OHWA 3G6YA 4K43A 1S12A 4HUEA 3KVGA 2VG7A 3ULDA 4RW4B 4KH1B 2VODA 5SWMA 3AVAA 1WUUA 4CM0A 2UXBK 2CQ4A 4BC7A 3QNWB 3JYTA 4RW9B 3RYLA 4BREA 4KSEB 4H5NA 5TKWA 5AQRA 1JX4A 1OMSA 4X62F 2W7OA 5KT5A 1P9QC 2B4UA 4RUHA 1QE1A 2PMHA 2ALZA 4AF1A 2X1GA 2OEJA 4HACB 2G0CA 2DNKA 2RS2A 3O08A 5L46A 2NR0A 1UEUA 2ZVSA 3M6VA 4UUXA 2OI2A 2QSFA 2UXBF 3U3GA 2R2TA 4DV2K 2ROGA 2AJ4A 1RT5A 5F0UA 4LF1A 3H7HB 4DSKA 4OI3A 1FDNA 5HJYA 4CZLA 4LR9A 2FBTA 4TLQA 4DKWA 1ESVA 3KFWX 3BUZB 4X65K 4KHUA 3NGYA 4CGJA 3THXB 2RB7A 3SCJE 4DUZF 2ZH4A 2NZCA 3LUYA 2MZJA 1JLAB 3IFEA 4EK2A 1RWNB 4X84A 3QO9A 3R5BA 3SV4A 3FUYA 4N56A 3MM7A 4K4YA 2MDAA 3B8AX 3OT9A 2O66A 3BF1A 4DI6A 4K8ZA 2WSEC 3IN5A 4JYAK 2E5JA 4FJJA 1ICEB 4P6QA 4YY3K 1APSA 5JLFA 1AFJA 4P75A 2A1BA 3I5BA 3C94A 4B3SJ 3S41A 2DRBA 4Y1CA 2FDNA 2MZQA 2Q2RA 3AJ1A 9ATCB 4EFHA 1OPIA 2FUG9 1VSEA 1VQ4N 2ASDA 2DK2A 4CZFA 4CK3A 1KOOA 1IKXA 4BC2A 3DI6B 3CJTA 4GRSA 3W7BA 3LANA 3G71N 3DRPA 1TELA 1QQCA 4O8UA 4X4RA 2PSZA 2P9NA 4JKDA 3MDQA 1K73O 4ICLA 3GR0A 1L3TA 1Q8BA 1LAWA 2YH0A 1HNIA 4WYWA 3ZZYA 2FVPA 1U0HA 4FNIA 4KHWA 3OBWA 2DNRA 1UEKA 3BSNA 3HP9A 3UI3A 4DQ8A 2BANA 5CHIA 3TAPA 3BF3A 2HHWA 3DOKA 1F5CA 1S1WB 1RT2A 3Q7CA 1Z25A 2HZVA 3VQCA 2IVYA 3SI8A 3I55S 2HIQA 2AGPA 1B0PA 4R8UA 3NS5A 4GO7X 1RNHA 4RO0A 3PO5A 3ISZA 3CI5A 4JI2J 3H42A 3MPUB 3GDQA 3VAFA 1S0VA 4ECXA 3C0BA 4OIXA 2YWFA 1FTRA 3D2WA 2BW2A 3UDLA 3T6JA 3Q7BA 1JJ2M 2O8BB 5KRSA 2KJWA 4JI7K 3IR5B 4PXCA 2CJYB 2D69A 1ZXOA 3QRQA 1R8CA 3DDNA 1NK5A 1LW2B 2ILZA 1YJWN 5EDWA 3IMQJ 4K4XA 4IKAA 4U7UD 3OUYA 4FXWA 4KR0B 1PO6A 2Y1LB 1YKWA 1LWCA 1NBWA 4FPAA 4TY8A 2O4GA 2X7IA 2G8WA 1LFPA 1SV5A 2OH2A 4AHRA 4H0TB 4E7LA 2DRAA 2GQQA 1MDUB 1RK8A 2JZ5A 5L9NA 1T6CA 3NFAA 1VAZA 4AHCA 2VQFJ 3VQ7A 3R97A 4CJ5A 2MQ8A 4OFZA 4B1XB 4DL2A 3BKUA 1IJFB 2O8EA 1WHVA 4CE9A 2RS8A 4X4VA 4RNOA 5DG8A 3CUNA 3DLLL 4IBNA 4EP4A 1OYEA 1GTHA 1NHUA 1CEZA 4BRLA 4I7FA 1SC1B 4ANEA 1FJGK 1RDBA 2KKZA 3I96A 2GW8A 2ADCA 2G8UA 3PIPQ 2J0SD 2Z4PA 5BYSA 4DTMA 3W2WA 3WNFA 1S7HA 1RWXB 2LA6A 1Q5YA 1MMLA 2W7AA 3EO3A 4Y28C 3MM5A 2VG6A 1JLGA 3VQBA 1HBOB 3EWGA 5SZTA 3NGTA 3ISND 2A42A 3AA5X 4TN2A 5SUHA 3BSOA 3ALYA 2IVNA 3R3TA 5CZXA 4L74A 4DV5J 3CM5A 3OL9A 2UXCJ 4HYKA 1YRXA 3GIMA 4ZLNA 1LNQA 1YK9A 1R89A 3O44A 2XY6A 5LJ3Y 1F3VA 5KT3A 4CWBA 1K6YA 1HIYA 1AYEA 3DXMA 3QFWA 1F0XA 1HARA 4B9LA 1VGYA 3NWRA 1VC5A 2LDYA 2YHBA 3OD2A 3KHHA 2UVRA 4O4GA 2K1RB 1HYSA 5T7LB 1WSIA 1U8WA 4DOZA 2QE5A 3ATUA 2UXDJ 4MMOA 1ATSA 1R8HA 4YDUA 3G4SN 4DV3F 2V7YA 2BRKA 2ZEJA 4KHSA 4IG3B 3WNEA 2YWWA 3OQ2A 1BA0A 1VSFA 3OY9A 4QIGA 2QMXA 3VOVA 3CDBA 1TUGB 2MLZA 4ID8A 2VICA 1JXBA 3PLAA 1PKUA 1WF2A 4XH4A 2QTDA 4X4SA 3G6XA 3CJ2A 2W8LA 5HRSA 2RUGA 1EKSA 3GP9A 5M1KA 2ZUGA 1YI2S 2MJUA 4IFYA 1N34F 2FXUA 3PRDA 4WE1B 1ZTWA 3TA1A 4UOFA 2VOPA 3MR3A 2CPYA 4ZCMA 4O44B 4Z7YA 3DJCA 1B4SA 4LF7F 3CMQA 4CHQA 4AL5A 5D77A 1QHAA 5E7OB 4U8VA 3SQ4A 2KFNA 4J8FA 1NBEB 4YDDB 1LWFA 3CMEN 3BDEA 1WC3A 5A8WB 3J7YU 1VLOA 1WG4A 1A9NB 4OYIA 3CCUN 4IDHA 2IHR1 3PNIA 3N6LA 4IKFA 5E3PA 1UP1A 1VQKN 2KQ2A 3KD1E 4C3KA 1QM9A 2FJDB 3DGVA 1U1OA 3A12A 2W4CA 3CJ3A 2XY5A 1KAZA 2B5JA 2NXNA 3VGKA 4TYBA 1DTQA 2I0XA 3T1HK 1ZM9A 3PXGa 1ATNA 3KWIA 1SQFA 4DQQA 2DD8S 3ZTPA 2XEXA 1RHKB 4MDBA 3ID6A 2WVDA 4KTWA 2G8VA 4HL9A 4CTAA 2AX1A 1LK7A 1SCJB 5CYJA 2V52B 2FVCA 3CTRA 3BF4A 5DZ6A 2BJ7A 2D3OR 1C2PA 2CJAA 2BA9A 4PG8A 1YJTA 3IS9B 4PWDA 4JV1A 1S4EA 3DLHA 4K25A 1YLXA 3BV8A 3W62A 3GG0A 3BO2A 2WTFA 4C9DA 6AT1B 1NPRA 3SZ2A 1NHVA 1NKEA 2LEPA 5F8MA 2VWKA 1X0PA 1TKDA 4B1VA 4DV4J 4CHPA 5KG2A 3AVBA 3ZC4A 3HD2A 3OS2A 4HHJA 1X3MA 1REVB 2OTJS 1VQMS 3OXLA 1QSLA 4ZTJA 2KZZA 4FF2A 1Q8KA 3V9ZA 1GTEA 4LFCK 5F8LA 2FLLA 1HNZJ 5ADZA 3PFEA 5J2MA 1K8AO 1YWXA 1DQAA 3NMRA 1VQ6N 4EYIB 2HS3A 3C66A 5GADP 1LWXA 2IFXA 2W2QP 1XR7A 2ZOFA 3T6BA 4R5PB 4CRJA 2E9RX 3MUTP 4L76A 4W98A 4K8RA 4USUA 1YBTA 2YNIA 5AQLA 4KIAA 5AQKA 1K44A 4XH5A 1DHMA 2CG4A 3ZX2A 1HNWK 3CJCA 2A2CA 3S6EA 4W92B 2E6MA 2DGVA 5EHHA 1U1LA 3WDOA 1F60B 3RRKA 1SC6A 2BOPA 4CD1A 2M8HA 2KT2A 5IC6B 5GVQA 2VPZB 5FD1A 4KAIA 2YHAA 4LBPA 3I0SA 2VUGA 2WOMA 4X64J 2J5AA 3IM8A 5GAHU 1CPZA 3P4UB 1XUPO 4CK2A 4CJVA 1G1XA 4YR2A 1R31A 2PN6A 3CPWR 3U1LA 1P1TA 5AQYA 3DDKA 3M2RA 1ITGA 3NHGA 1BQNB 2IBKA 4ANCA 3TVKA 2YH1A 2Y0BB 2B56A 5T41A 4LF5J 2ACYA 2BW7A 5CZVA 4BR4A 3DLGB 3L2UA 1OQ6A 5BR8K 4WFNQ 1RB0A 2MB0B 3CDEA 5IOLA 1KVBA 3Q8VA 1CULA 2RKIB 4YR3A 1U6FA 1P27B 1NXIA 2ATCB 3SSRA 4ECZA 1H2TZ 3TAGA 4RW8B 2XCAA 2JNJA 1RBTA 1V9OA 2EBEA 3UN2A 4OI6A 2KDOA 3JSRA 4CJTA 4J9PA 4P2XA 5J1PA 3T7ZA 1RDWX 3TUZC 1HBNB 4WYLA 3F41A 1O13A 2CJKA 4BG8A 2VBWA 2GV9A 1KQSM 5L8RC 3V81B 4JV5F 2CJXB 4OI0A 3FVYA 4A62A 2KRBA 4DJBA 4JI3F 4JAXA 4B3RJ 4RR5A 1IBMK 1AXQA 4B1YB 2ZKTA 4HHUA 4F4YA 1IKVA 2QWQA 3V4IA 4HT7A 4NA2A 3VQ9A 3CDWA 2PC6A 4CO2A 1DLOB 1XR6A 1GT8A 3AARA 3UWTA 1CJUB 2IIHA 4ZLJA 5ETTA 3CCZA 3MMJA 3WX4A 2NLWA 3R1HA 2DNYA 1DTTA 1SJRA 3LAMA 2LEBA 2QEXN 2PYJA 3BYPA 1QHTA 3L4IA 1QZ6A 4HTIA 1KRPA 3FSXA 3R7BB 3TJ9A 2HRUA 1O0PA 3R7SB 4B9VA 3HSCA 1FKOA 4Y2MA 2YNGA 1RBSA 2VKRA 1UJ5A 4BLGA 1S6QB 3K17A 2WSCC 3FCWA 3QETA 2V2QA 4ZITA 4IQXA 4WIIA 3MAAA 3UD5A 4BVOA 4RX6A 4ISFA 3IXQA 1Q78A 3WNHA 1NHKL 3UN5A 1KVIA 2GIRA 4EO8A 4A8XA 1VQPN 1RQ0A 4A8OA 3C8YA 4ZVUB 4A8KA 1JL1A 3GE1A 4ZIWA 5EY4A 4RW6B 3BBFA 2XSJA 5C42A 2L9NA 3PYDA 5C0YA 4B3TK 5KFXA 8AT1B 2XZDB 1C4AA 4F3MA 4CFBA 2HEKA 1HD1A 2B4VA 1C0MA 3ENHA 5E3RA 2ZGZA 1Q82T 1KD1T 2GZOA 4M3TA 2ZBQA 1H1VA 1RT4B 5DJBA 3SDEB 3PIPL 1NKBA 4FOIA 5FRNA 2HBKA 2VA2A 4B3TF 5IWAK 4B9NA 1N4LA 3C6HA 3LH2S 1EQYA 3Q0AA 1NGEA 3KOAA 1HBMB 4NLYA 2WSFC 3VVUA 2AWZA 2DNHA 2W9BA 1KDNA 3FNNA 1NJXA 2HQGA 3VGVA 3DHWC 3ADAC 3FC9A 4C8ZA 1NG9A 5AQVA 2UU9K 1SQKA 5MLCV 1X60A 1KEKA 4P72A 2I5JA 4MFBB 4QWAA 5GMKa 3CJBA 4F3OA 3BQ2A 1JJCB 3JS9A 2HMPA 1S72S 2MQLA 3K9JA 2FBYA 2OLWA 3WEEB 1M5SA 2QWPA 3DYAA 2VC1A 3MTKA 4JI0J 4TQRA 3I8BA 4B8AB 1RCXB 2NUBA 5LM7E 4JK7A 2YPYA 4BBYA 1FI4A 4X4OA 1S9FA 3E51A 2MYFA 3RSEA 2WZ1A 5I42B 3HT3A 4HKQA 2F9WA 3KUEA 1NU4A 2BQUA 3TWZA 3ID8A 3UVJB 2GJIA 2QZ8A 2NXEA 1P6TA 5J1EB 2IVFB 5HQ8A 3UKUA 2DB1A 2ZWHA 1ZBLA 3OR1B 2ROPA 3K59A 1AZSB 5A8KA 2HBZB 3HTVA 2B4OA 2RH3A 3M2VB 1ZZNA 4JKAA 4JI2F 4O55A 2EHGA 3W66A 4AL6A 2DGOA 4WZMA 4C1NK 1FNMA 2PEHA 2B6AB 2OPRB 1IV0A 1S1VA 2J9DE 4LH5A 4CQ1A 2VG5A 3M32A 1S1UA 1O5JA 4PG4A 3H0PA 2D41A 2QK9A 1TAUA 4B1WB 5HAOA 4CGGA 4PWWA 3M1VB 1NPPA 5J2PB 2C3PA 5IXUA 2YWGA 3ENBA 5I4MA 3L2VA 3NGSA 3MM9A 1T3NA 1Q16B 3LP1B 2CH6A 3MXJA 1ZM4A 3U9DA 3HZ6A 2J9EA 3D2FA 3WXMB 2QTWA 2GQCA 2H51B 2V9WA 2C2NA 2HWHA 3HHLA 1N36K 2PO4A 3FGVA 3BKFA 5F0XA 3FRZA 1S9GA 3PW7A 2Y9HA 3CJKB 1TL7B 2XULA 4M3RA 1HMVA 1JJHA 3BY5A 2AGQA 3CG7A 2EC2A 4RTFD 3C15A 2VQFF 2OHDA 5KFOA 3UW1A 1XERA 3HOTA 2FBXA 1A5VA 1VOMA 5H9FJ 3WUHA 2RMLA 5B0GA 2BE2B 3MTJA 3Q83A 4NLDA 1P9YA 3SFUA 3O9SA 1V3RA 2CQDA 1N36F 4RBUA 2YKNB 1RFQA 4KGZB 4FF3A 3HX9A 4WFYA 2AEMA 4OPJA 1QQOA 3P4IA 2OGUA 3PW2A 4AHSA 3R8EA 4B9MA 3I5AA 1QVFR 1WSJA 3NGIA 2CZVC 2ASPA 1K9MO 3CHWA 1HNVB 3NNCA 4DU7A 1JCEA 5LMNK 4M5HA 3JB9k 4I2PA 1SZ2A 1M1HA 3KHRA 5BPNA 3MWPA 2VBYA 1NJIO 1D4XA 5HL7L 1FESA 3OS1A 4ECYA 4TXSA 3L7PA 3J80O 3P96A 1RTJA 2XG8A 2Q0UA 3CD6S 1ZH5A 2P51A 1JL2A 3VEYA 3CIZA 9RUBA 2IVOA 3MN7A 2VQEJ 4DV5F 1FRIA 2Q1NA 2UXCF 2HK2A 1VQOS 3S9HA 4B3OB 3TEHB 2GWJA 2IJRA 3CXCR 3ILIA 5KFFA 3CCJN 3HHDA 3KYLA 3ZZOA 3F73A 3AODA 1NMNA 5GADI 5ETMA 4PHTX 3NAHA 2B9EA 3TR5A 3BR9A 5I3UB 1XC3A 1SPBP 3CQYA 1U2RA 2YNFA 4TKTA 3T5LA 3OYFA 4BE2A 3BM7A 5FJ4A 3VAJA 2VDIA 5G0RA 4ECTA 1HKGA 2WRMA 5IM0A 4FZXC 2ZDPA 2IC3A 1RE1B 2G0JA 3HJFA 3ZSVA 3PUFA 3Q8QB 3UB5A 3DMJA 2NZ4A 1BWFO 2Z1IA 1SS6A 4TVAB 5KFEA 1BIUA 4WPAA 2ZJRQ 2HURA 4BC3A 4MH8A 1EARA 1N5YA 4YORA 5AZJA 4HVZA 1LCUA 1FK9A 4EFAC 2VCPA 1V3SA 2VOOA 4YOYA 1U1NA 4A59A 1TP7A 1RAIB 3HL8A 4KBIA 3V6HA 4M45A 3QQCD 4OI4A 2CG8A 4DL0C 3N6MA 3IRXA 2JLGA 5LMUK 1Z05A 3O1LA 1R8AA 5ELZA 3U7JA 5AQZA 4C97A 4ED6A 4WFNL 3AV9A 2E2PA 1WEYA 5AJ3K 2HFNA 2AD9A 2AEJA 4KRWA 1GLDG 4LRCA 4M3WA 1KVJA 2FYXA 4K4WA 4KHNA 1JLCB 1FX2A 2CUYA 2BRLA 4M5LA 2GO9A 4WF9Q 3SBGA 4NXNK 1X8DA 4USTA 3RJMB 2Y3YA 1MROB 4GO5X 1SAZA 4OX6A 2B9YA 3MOZA 5AJ3F 1G99A 1GEHA 3SAFA 2D3ZA 3K57A 3NE6A 2BVZA 3FZMA 4UY8O 2Q36A 1XHXA 4K4ZA 2IMOA 3E01A 1XHZA 3UCGA 3EZWA 5LOQA 4NXNF 1WG1A 1TTHB 4RKUC 5AXNA 3CMAS 1IBKK 1QUVA 1UVJA 3SCIE 3HDSA 3DOLA 3H5SA 4IRKA 3QMLA 4L3NA 2QA1A 2I8EA 3U6FA 2WONB 2QW9A 2W4DA 1HQUA 4YHHJ 1F2HA 3ITHA 1TL5A 4DMZA 1E6VB 3HHEA 5L9XA 2I7PA 3T1YJ 4N77A 5KG1A 1G7CB 4UOCA 2MJNA 5A8RB 2NRZA 2P9UA 3SJJA 1W7AA 2CNOB 1XQSC 3TU5A 4OVLA 4ZLPA 4A46A 3OTBA 4E1JA 1E4GT 2OSQA 4XAKA 5HP1A 4P74A 5C25A 2F1FA 4ZP6A 1OS5A 5A2QY 1PYTA 3LF0A 2W2OP 5ADXA 3VAIA 3JTNA 3VAHA 3ATVA 3AVNA 1T03B 5GAEP 2R7OA 3K5PA 1HNZF 1Q81T 3GE9A 2F8MA 2GTDA 2B7CB 3H8YA 3GPAA 3RAMA 4JI5K 1F1BB 2ZBRA 2DH7A 3M9MB 3Q8UA 3SSSA 2A3JA 5HVHA 4DV7J 2EFPA 4M5MA 2R8IA 4DQPA 4U7BA 1HQ2A 3SCLE 5KFTA 4JKGB 2HHTA 1GOAA 3C2PA 3OYMA 4YDXA 3CJ1A 3TEGA 3SYZA 5AZIB 4CZCA 2OPSA 2QXLA 6FD1A 2ZH9A 4OO1J 1T9VA 3R3LA 3BPDA 3PEJA 4R8UB 2L9DA 3TARA 4JI5F 3M30A 4FYYB 4HDHA 2FIUA 2P6SA 3JSYA 1C1AA 1CJTB 4JB8B 4DV6K 4BC9A 4LSZB 4X64F 4LY7A 3D6TB 1HJOA 2OMOA 2UUWA 3GV8B 2F9JA 3SI6A 2NRRA 2YQ3A 4IG0B 2X1FA 1GMWA 1Q18A 1X4GA 3KMQA 4JKEA 4DPWA 3W8PA 4MK7A 4LF5F 4PPZA 3H4DA 1TZ0A 4BC4A 3GMGA 5C12A 5KFBA 1LOTB 3MEDB 3OYEA 4CEEA 5KPZA 4C0BA 4DB3A 1C0GA 5F8GA 1JK9B 1JLFA 2DXEA 4LF8J 1DEJA 2HWIA 1NNDA 3AO3A 2M70A 1QVGR 2CPXA 2L08A 5A6PA 5AQHA 3D1OA 4JKBA 4TNOA 4FLUA 2FVQA 2UVWA 4EAHD 2JJ4D 1TMJA 4DR6K 3L4BC 2EFVA 1J5OA 3TAFA 3J80U 5CY4A 2OUGA 3V6DB 2C2MB 3I32A 4CLFA 1RSCA 2LQBA 4U95A 2YKMA 3FBCA 4KGKA 4B3RF 1IKYB 2J7WA 4KFBA 1T11A 4M5DA 3CC2S 1RU1A 2NCKL 4PEOA 3BZQA 3L3VA 1N6QB 3ZLJA 4FLTA 4NCGA 4O3PA 4DTPA 3HVRA 4J2BA 2ZWOA 5IT9O 5K20B 4WQ5C 4CNZA 2VGMA 4CJLA 2V8PA 3OYJA 2LU1A 3QLHA 4YB1P 1ZPVA 5J2QB 1H74A 4NEZA 2KH9A 3DAWA 1S22A 2OA8A 2MKJA 3HZGA 3A8KA 3K2YA 2N3LA 4F9OA 1BQMA 1VDHA 1UL3A 3FBEA 5JMNA 1GQEA 2JEIA 4E0DA 2BDPA 2XY7A 1E3MA 4CJ7A 4WXWA 5GAGU 4DR3J 4OLPA 1M5OC 4CO4A 1JNZB 4H54A 2F3JA 2BE9B 1NSAA 4OYOA 1NJWA 4QPXA 1T94A 2AMCB 4WFBQ 2Y1RI 2Z58B 3H90A 4RNNA 4ANDA 3MCAB 1QQMA 3H4BA 3I55N 5C7PA 2HS0A 4DHVA 4LJMA 1A5WA 3BBCA 4QS8A 1D9AA 1REGX 4LR8A 4KQZA 1WKJA 4G1QA 1U6ZA 2XMWA 3OYHA 3RAQA 4MTPA 3RAXA 3G87A 4WU2A 3CM6A 3JSBA 3MMBB 3W2VA 2XLKA 3G2XA 3VEXA 2HZCA 1TQLA 2VKZG 3OHAA 2QT7A 3VQQA 1XNQJ 1WNSA 3RR8A 3ASMA 2YX6A 3C7NA 3B4MA 5L39A 1NDLA 3B6PA 3QICA 2RT3A 3FQLA 4ZJLA 1QTNB 3PJXA 5F9LA 3AH6A 4M94A 4UY85 2GELA 5KG4A 1KHWA 3A3NB 3NAEA 5KFHA 2OPPB 1S9EB 2LYVA 4I9QA 1RLDA 4A2AA 3NWGA 3P8BB 4LSLB 4CGHA 4XTTA 4JI0F 5AQMA 1PJ5A 2E6LA 5HVGA 1BG3A 2JH3A 2QWNA 4CJ4A 2ASJA 3AQPA 1C1CB 1N0UA 3NBPB 5HLFB 2WBMA 3OFHA 2CQCA 4CLKA 3A8EA 3HM9A 4Q8FA 2DH8A 2GAGC 4GVBA 3DOMB 1HR0J 3AD7C 1Q1KA 4FKXA 1GOBA 4KT0C 3AVLA 4KB7A 4ZPTR 3B78A 3EGWB 3QJJA 4LBIA 3O80A 1FDDA 2AYBA 1Q95G 3L8BA 3GFXA 4ZP9A 1NCLA 4BCAA 4DR5J 2RDJA 5KOWA 2EI5A 4GV9A 2ASLA 1Z2LA 2IOCA 4EBDA 2Z30B 5CYQA 4BR7A 4IXCA 2R7YA 4TU8A 3O9TA 3IWXA 3BH7B 3Q24A 5M1OA 2DNGA 3ENVA 1G4CA 3FK4A 4JI4K 3NCPA 1H73A 4F67A 3VHQA 1J6ZA 2GHVC 3CJ7A 1WOSA 2OFHX 2HHHK 2J0WA 4QR1A 4RNFA 1ZAWA 3ZSOA 3I87A 1GMUA 3MZIA 5LSOA 2WBRA 3E9LA 4QWBA 3R1XA 2ZHAA 3W8GA 1GLBG 3CVKA 1EWQA 1NK0A 5B0EA 1YTYA 4LR7A 3J7A1 3ENAA 1WSRA 4GV6A 3QJLA 4X4QA 2J6UA 3TYTA 2QA4S 2WFBA 3M8PB 1ZAVA 3FFIA 2W6LA 4DU4A 2VB6A 3KHLA 4WF9L 1HHSA 4ZP8A 2QJ3A 4MIBA 2ZH7A 4AUKA 2G4BA 4OYWA 2XMMA 3CCLS 1B0TA 1TL3B 5LL6Z 3RW7A 1Y11A 3U3YA 4NLPA 4FO0A 2KU7A 2K3IA 4BDPA 2VBXA 4BRGA 4PG5A 2HNYA 3BGLA 5JLHA 4DTOA 4LF9K 1SKRA 2GFFA 2FJAB 2FHOB 1ATRA 5FLXU 2GVDA 5HRPA 1T7PA 2VF3A 5LSRA 1RBVA 4PUOA 5KFPA 2IDEA 1UPMB 1VYAA 1LKZA 3R2DJ 2QI2A 3VAKA 3BGUA 4M5KA 3GONA 1YI2N 3E9PA 2DPNA 1R7IA 3MECB 1RCOB 3CCWA 3VQAA 1J27A 3DRYA 1I39A 3GIKA 1HYVA 4QU6A 4DV1K 3IM9A 1W2IA 4CO5A 3QINA 4YNQA 3GQCA 2GA7A 1PILA 3DXBA 4X66J 3L4QA 3WXLA 3D2EA 3MX2A 3EXYA 4CDIA 3DFEA 5FDLB 2VQEF 4K4TA 3ZTRA 2DCUB 5GAEI 3HSTB 4F50A 4DR2J 4KH0B 4K0KK 1S10A 2MZTA 2CVEA 2MKCA 5ADXH 2R7QA 3KK7A 4OZ5A 1BWEA 3LO3A 5KFWA 1HKCA 3HPGA 3MURP 1X4FA 2DHGA 4DV1F 4TLRA 3L7UA 4KV8B 4JK8A 1NZ8A 1P90A 3MMAA 1XIQA 4FOEA 1N56A 4LFAJ 1JLBB 2A6AA 4WCEL 1FD8A 1WDTA 2B9WA 3SPYA 2YNHB 3IGNA 1L3UA 1XNRK 4W5TA 1NGJA 2CPIA 2AJ1A 2VPYB 1RBOB 1T6DA 3MUMP 4O3RA 2EKNA 5D4LA 1TK5A 4Q2MA 1CG2A 3OYNA 3LDLA 3NCIA 1RILA 3PY8A 2J7KA 1RT3B 4ES3A 5LJWA 3NL0A 3IBCB 2DITA 4RNHA 5EX5A 2CNLB 4LFBJ 2P8IA 1IKWB 4DQRA 2GEMA 1VIOA 1A7GE 2HFVA 3Q89A 4YB5A 3EPGA 1N5QA 3M9NB 5CYMB 3A3PB 4NYNA 4EZ6A 1VSJA 1TKTA 1OH5A 2PDAA 3GU0A 4O0JA 2PMZD 1GLCG 2GAHC 2RRBA 1NJZA 4I2QA 4J9KA 4LF6K 4BRIA 1U1KA 3M1FA 4PABA 2JWNA 2OTJN 1Y00A 2MKSA 1VQMN 1VQNS 2QWLA 3CW2C 2RF2B 4CJSA 1KOHA 4A61A 3JTPA 2KRRA 4OHVA 3DLKB 3TTDA 3VQEA 4ZCKA 5DDQC 4ZCLA 4CEQA 4IEEA 3JSMB 1UVIA 5M2RA 2QWRA 3DHXA 3V1RA 2ZH1A 3T41A 4TU7A 4B9QA 3HSGA 3O4NA 4RUCA 1XQIA 3D66A 4LF6F 3KLFA 4A8YA 1VR6A 3PSFA 3L2RA 2FZCB 2ZGYA 1OY8A 3AO1A 2R2RA 5G4DA 4RZRA 2ZHBA 3NGUA 4NPOA 2VPWB 2QXFA 3LL3A 2AZ1A 3QRPA 1YBAA 4AHVA 1MG7A 3AOAA 4R25A 4ID5B 4DX8H 4ED8A 3AB2B 4F04B 3BGFA 3QT6A 2UXBJ 4O3QA 4IR9A 1VC6A 3NH0A 4PQUB 1UWBB 5BXIA 2FC9A 1RT1B 2NPFA 2VFVA 3U1MA 4ILGB 1CJVB 2XGPA 1U09A 2Q0RA 3PZPA 1DKGD 3WC2A 3D9BA 3GYGA 4UW2A 2EFGA 2IBOA 4HTUA 4BQLA 3ZZTA 3T1YF 3NCRA 4KHQA 2UV8G 3SQGB 2GMJA 1U0SA 1R0AA 4J90A 4K5RA 1RTHB 2Q6BA 4URGA 2G1HA 5DLFA 2XHWA 2NSBA 2Y8WA 3PTWA 2V4JA 2AQ4A 4DV2J 4FM0A 3P45B 1EAYC 4CFCA 4H0YB 2WBNA 3A4TA 4RWWA 3M9OB 3F9MA 4ECRA 3R1LA 5JXSA 2E5LK 4DX5A 4U9RA 4O3NA 3DGPB 3V1OA 4EUVA 4JOUA 4U67Q 4LF4K 4F3QA 4X65J 4WFAQ 4FDFA 5DLGA 2ZJPQ 2V68A 1H38A 3POTB 1N88A 4NA1A 3DRRB 1FEHA 4TYAA 4BDYA 1UFWA 1HJRA 4WFBL 3FE1A 3PIOQ 2RPIA 1ZAXA 1FVQA 4JK9A 3DLEA 1OVYA 2MQOA 1TUUA 2MHEA 1N52B 4RU9A 4W5NA 3CD5A 3K8VA 1V3ZA 4KKOB 2JRSA 3I9V9 4DV7F 5HQLA 1QD1A 1IR1A 4DTJA 2E5LF 1S0MA 1CVJA 4FLYA 1TKXA 3NEKA 2YX1A 4CO1A 4QBUA 4JYAJ 4E7KA 1HI1A 5DGBA 1KCFA 2CJ9A 4YY3J 2JHEA 2C42A 4DSJA 3Q8RB 3TSPA 3HOSA 2MPUA 1NGHA 4C11B 1FE4A 3RUBL 4BG9A 2X1BA 3JQJA 1R3NA 3TRGA 3CJAA 1VLYA 3UKRB 5M1PA 4ZDNA 1IG9A 1TL1B 2XCPA 3OSNA 4DCPB 2B4JA 5AXKA 2HQIA 4QW9A 2ZH8A 1WWHA 2O4IA 1I94K 2W24A 2IYIA 2IAJB 3VR1A 4DV0K 3THYB 3SMSA 5D0HA 1G3OA 2YHYA 2OAUA 2HNDA 3OYCA 1FW6A 2QKBA 3AVCA 1P8GA 5CCLA 1S1TB 2GV1A 3D54A 1ZA1B 4OX9K 1MSWD 2EWSA 1U1PA 3ZTOA 2WVCA 1OH7A 2BQRA 2FC8A 1U7LA 3SIPB 4LF8F 4N8NA 4OYMA 3G8SA 4NLOA 2VJUA 2DR6A 1G15A 3SUOA 3CXCM 4USWA 4DSEA 3ZT2A 3LP2A 3KLEB 4ID1A 4RL1A 5E2QA 4AXJA 2MLXA 1BLUA 1NH7A 1ZBUA 4JI7J 4C1NI 5HANA 2E5HA 1LXJA 4ERDA 5E3QA 2A5XA 1VSMA 3BPSP 2YWEA 3R6GB 1NLVA 1NGAA 2UUAK 3DRSB 5ITHA 4KC5A 2Y1IA 2PY5A 4CJEA 1YHQN 1OIAA 2QRRA 2DY1A 5BRFA 2JEFA 3KNGA 1NM2A 2ZZTA 5F8HA 2FGCA 4IO1A 3P3DA 3TTCA 1LQ9A 1SH2A 4B08A 2GGPA 3KKFA 1OYDA 4GMJB 3MCMA 4HEA9 3LDNA 4LSNA 4M3UA 1X9WA 1RHMB 3DDIA 2O8CB 1S3XA 1YAGA 1S72N 2IGIA 1RDCA 3O4QA 2HLTA 2JFDA 4J9VA 3H98A 4ES1A 2KZMA 1H2VZ 2ZBIA 3PO4A 4CF1A 4RBVA 3AVIA 3MEGB 2FPHX 4KYZA 3A5NC 2W9CB 3CJSA 4ZVTB 2A3ZA 1X4EA 3VETA 4PXBA 3A1YG 2VU5A 3WHIA 1FJGJ 4P2SA 3R5GA 4O3SA 4IFEA 1QSYA 2KI2A 5L38A 2CKWA 4M41A 2NRWA 1RA6A 3KLGB 4ETZA 3MM6A 1TYQA 2O8FB 4FWPA 2P9LA 4CO3A 1TV6B 1VQ5S 4HHTA 2AT1B 3NP5A 4ZHRA 3TX0A 3AY0A 2X6NA 4B9SA 1PYOB 2MXYA 2XS5A 1M90O 3DU6A 1LK5A 5HROA 1KLMA 1JWWA 4PYDA 2B0GA 2XZWA 3J7AN 3U8XA 3WXKA 4P52A 3OBYA 3PM9A 2DNQA 4OZ3A 4IEIA 4FWSA 4DCHA 4M8LA 1KQSR 1HWUA 2JGUA 2ZJQL 2RRAA 1GAOA 3KJFB 2XMTA 1XMBA 3QAEA 2OPQB 1VSLA 1MU2A 4FM2A 1H2UX 1PAUB 3RBXA 2KLAA 2QFIA 2J4RA 3DXKA 3CJ9A 5HATA 2OZSA 2J8SA 4DWIA 2K3KA 2CYYA 4ALZA 5KI6A 2V4RA 1X5OA 4URQU 4ES2A 4IOAQ 2ZE2B 1RABB 1GXUA 1FXXA 3MFIA 2POKA 2HS4A 1H6KX 2CVIA 2JDJA 2HFUA 5F9NA 4YDUC 1VQ8S 3C65A 3H59A 2LP4A 5GINA 1YZ7A 4C8MA 2LVWA 3CCQS 3QJPA 3M8QB 2F4FA 3HZEA 3T5KA 4JHDB 3X1LB 1FTCA 2HQCA 1VRUA 3US5A 1YUWA 3ET6A 1EXQA 4CZEA 2IRYA 2FZGB 2Q3SA 3OTCA 4RW7B 3DWLA 4CEOA 2FVRA 2OIHA 2VWBA 1WBBA 4PAAA 3CC4S 1HR0F 1FERA 1SIZA 2R9LA 3GCWP 3Q22A 3BH6B 4ZIVA 1K1QA 3IDHA 2BTFA 3CC7N 3P5JA 2HMIA 1XMQK 1FXRA 5C24B 3GFHA 3P1GA 3Q2SC 4NYZA 1CZBA 4UUWA 4J2AA 4NLRA 2PYLA 2F8HA 1S6PA 1AFIA 3AVMA 3H5XA 1T9UA 3R7NB 2PD1A 3K8WA 2B43A 3MR7A 3VF6A 1ZPWX 4YOUA 3T69A 1JMTA 4X4PA 4AM7A 4USHA 2AF6A 4HDGA 1LWEA 3K2PA 5KFGA 3KK3B 1TMMA 4OYZA 3CD6N 5MLCQ 1WSGA 1E6YB 1CZAN 3JAMY 1FXDA 3Q86A 3TA2A 2D1KA 2V2VA 4QW8A 2BUNA 5IQ6A 4I0WA 1UVMA 3PW0A 2YKAA 2H4YB 1VQON 2GWKA 4LVNP 4K2JA 2RAQA 4CGFA 5AQGA 1C0TB 3TZXA 2QM1A 1WHYA 3B82A 3P31A 2PFFB 2NRXA 3T1HJ 4L6V3 2HGMA 3QT8A 2CGLA 3M8SA 4KB0A 1QJHA 1X31C 1VBZA 1WJ9A 4NX9A 4FWKA 3V1QA 1WD6A 4IO9L 2KXNB 3OTOK 2WVEA 3W5YA 4HTJA 3DXSX 2XZTB 1KSPA 2D0BA 1DARA 2W7PA 1JLQA 2AHOB 2DEJA 3BQ0A 3LOUA 5JS1A 2IVMA 1DZ5A 2YHXA 4Q8EA 2JVRA 1RDRA 3FMBA 1QVGM 1HW9A 4MJKA 1RISA 4J7CA 1N8RO 1NZAA 3H45C 4DSFA 5KG0A 4AQYK 3IBFB 3R5DA 3G71S 2GIFA 1RAOA 1EETB 4BGAA 4QR0A 3G82B 4ZVGA 2MHNA 4RU2A 3FZLA 1NB7A 1XJWB 2XB2D 3RRGA 3D1HA 1UZHA 4IH6A 2CPHA 1HLWA 4YB7A 2QKKA 5M1FA 4OJHA 4LC9B 2P9SA 2HBRB 3M4XA 3TZWA 1VBYA 3C16A 3SJHA 3FEYB 1J5EK 5EU7A 2F7VA 1GOCA 4LFCJ 3JQKA 3OVSA 3V4MA 3SQ2A 4A8QA 2CQPA 2BV3A 4ZOSA 2Y8YA 1ZBSA 2WCXA 3OR2A 5HJXA 1SUQB 3EUNA 1RWWB 3KJNB 1Q7YT 4X66F 2AKWB 3ZETB 2ROEA 1HYZA 2FJWA 3SV3A 2XS2A 3KUGA 3MMCA 1KNZA 5H9EK 1ZBIA 2HQ3A 2A10A 4WTOB 3MR6A 4DR2F 3H46O 1EP4B 1JLEB 1O8BA 4FBTA 1WC6A 3QB0A 4UTGA 3P83D 4N47A 3ZYYX 4RW4A 4CI0B 4CIEA 4U67L 3PDNA 4WFAL 2ZJPL 1HNWJ 3UDCA 5DETA 1IR2A 4RW9A 3CCMS 3QFPA 4J91A 4LFAF 1UCNA 5JUMA 4OJ1A 4CJUA 2KFYA 1RTZA 4J2EA 2L3MA 3AVFA 2D9OA 4LIRA 4HACA 4FLVA 1WI8A 5DGAA 2C2KB 5A6WA 5KPTA 3SMPA 3QPIA 2JWKA 2F8SA 3BBBA 3D6RA 4E98A 3HK2A 2C3OA 1EB0A 1YGYA 2KVIA 2LMIA 4LBHA 1RTDB 3TX8A 3CMAN 5C2DA 3NDKA 2E2QA 1X4BA 3OYGA 5BR8J 3NLCA 3KJQB 1CLQA 2QO3A 4OLBA 2XRIA 4LFBF 3THXA 3HO1A 4JV5J 1UTAA 4EBCA 2DPIA 1GLJO 4P7VA 4JI3J 1JLAA 4AT1B 2XWYA 2EXUA 2M88A 1YITS 4I6YA 5EXWA 5F41A 4FM1A 2ZWPA 3AT1B 1F3FA 5HK4A 3N0VA 3T19A 4IH5A 1L3KA 2XMVA 4DS4A 1UWAA 3NF8A 1ZTTA 3THTA 3KK1B 1ZA2B 4KREA 2Z2LA 2HVHA 3W9HA 1RUSA 2QL9B 2G2OA 3SUNA 3MEKA 2KFZA 3VQ6A 1IBMJ 3FQKA 3AAQA 4B02A 2CWKA 4DSIA 4IDKB 2OD6A 1X5PA 1WSFA 5HI7A 2HQDA 1NDCA 3QMQA 2A6MA 2V2KA 2QLWA 2MLYA 3DI6A 1UVKA 3H6EA 1S1XB 4DBQA 1Q9XA 3OW2M 4KH5A 4KGXB 4PWUA 2ZITA 3A5MC 1HBUB 2HF4A 4ZPDA 1ULRA 1WELA 3NXZA 5KQDA 4WKYA 1H98A 1EJ7L 3EEQA 4C48A 4NB4A 1S1WA 4OGEA 4FWLA 1UAXA 2Q43A 5L1JA 5LXYA 1TUWA 4URSA 3HVAA 4KHMA 4KI6A 2P9EA 3NKYA 1U1QA 5B08A 3J8AA 3TOQA 5GADU 3G4SS 4CZJA 4BRPA 1YTUA 3DLRA 1CS4B 3GJRB 2FHMA 4PKIA 4IRCA 2O5DA 3WQTA 2BXJA 2WC9A 2O8BA 4B3TJ 3TO8A 4BROA 5KAKA 2XS7A 3BJYA 2XQCA 1RWKB 4FP9A 1KFSA 5AR0A 1WN7A 4DV2F 1LW2A 4CJKA 4CJ3A 3SQ0A 1KBRA 3TTFA 4M42A 4F8RA 2ZFHA 2HSEB 3AAPA 1ACMB 2XWXA 1WDDA 2P5OA 2W8KA 3OLAA 4X65F 4GNIA 1OO0B 4QQBA 1S48A 4DPYA 1N5SA 4GVMA 3LP0B 1GXTA 5IWAJ 4P71A 1X4CA 4JEPA 2C3YA 3L95X 1R8BA 1BA1A 2AW0A 3OFGA 4GKJK 4OYAA 4JYAF 1MWKA 4YY3F 2CQHA 3CCUS 1SJFA 2UU9J 3EDRB 4KO0B 2LCWA 3LPEA 3KG0A 2J0QD 3SNNA 1YJNS 3LQVA 2CA9A 4ILRA 1CQNA 1UJ4A 2P9PB 2HZAA 3WIVA 3IUCA 4IOAL 4I9LA 4G3IA 4IUFA 5K8NA 2Z1JA 2Z0GA 1UA1A 5M1QA 1T0TV 1NKCA 1IR0A 2OSRA 3A13A 5A0YB 3GJSB 4O3OA 1SC3B 2BJ1A 2QV6A 4J9OA 1HBOA 1IBLK 1OPZA 1D3WA 2CQIA 1MWZA 5DG9A 3RTVA 3TP2A 4NO7A 4ZA1A 1FWKA 2B7BB 4L3QA 4GVLA 5D0EA 3BB5A 4IYQA 2EK1A 3NCQA 2ADBA 3C14B 1WAJA 5C2GA 2F65A 2XI2A 2HBQB 1CLFA 1IBLF 2YWKA 4RPFA 3MI7X 2Z8QA 4G9ZA 4C8OA 3R5AA 3DM2B 1RBLA 4CT9A 4JI7F 1RWVB 3U1NA 2EK6A 5KFQA 2EX3A 3HI9A 2IS3A 2K1RA 3H3NO 5T7LA 4E8UA 2IYGA 4H4MB 5EVZA 3P6YC 3VZIA 4H8KA 4K4VA 3HHLC 2XHCA 4FW1A 1X4HA 3D6HB 2KM8B 1Q79A 2P9CA 3K58A 4IG3A 2J8AA 3P49B 2O67A 1N36J 1HWIA 3KLHB 2MY7A 1ZC6A 3KK2B 4ZVSB 3VGSA 1LFWA 4OX8A 4Q43A 1K8KB 2KJVA 3HVTB 1VI7A 5EX3A 2KTQA 1IUJA 1S6UA 4U8YA 1RHJB 3WBZA 4B1UB 4M63A 1FE0A 3OL8A 2UUTA 3MDFA 4WE1A 5E3CA 4GC7A 3SAHA 4FYXB 1P8ZA 3ZEUB 3Q8SB 2D4WA 4O44A 2P6TA 2KL8A 2E2NA 4BR0A 1X4AA 2H54B 4N7TA 2DR8A 1FJGF 1TK8A 4FZZA 1VRTB 2RHSB 3DCAA 1W7WA 2BMBA 4FXDA 4OKEA 1DURA 5A8WA 3TABA 3MMAB 5LMNJ 3K5LA 2GJFA 2P9KB 5KG5A 2J6SA 1HX1A 3KWMA 3CJRA 1DQ9A 4YHHK 2WB4A 4Y3CA 4QIVA 4KHPK 4J9NA 2HRYA 1K1SA 2M5YA 1EIYB 5DQIA 3EZUA 3BZKA 4WZQA 2H65B 3UR0A 4Q45A 3O8WA 2KG1A 4F36A 2E1RA 2RSQA 1UW4A 4Y2KA 1BC6A 4ED3A 1BI4B 4DL4A 1B3TA 4DR1K 5DS7A 3N4WA 2CQ1A 3CPEA 4KHPF 4ED4A 4H4KA 2LSNA 4RBTA 2V5HG 1H7WA 1RACB 2CQ0A 3N79A 2E5GA 3CO9A 3N4QA 3IS9A 2Z56B 3PKYA 1UFKA 3NS7B 1F2GA 4LRFA 4ZP7A 5K8PA 2I38A 4FK4A 2O8DB 1AROP 4YN3B 3PJ9A 3FZBA 4E19A 4DR4K 2QA4N 3EMTA 2NXCA 3RMDA 3GOIA 4OQJA 2QN6B 2KO1A 3VQ4A 3DKDA 3QRRA 1Y5NB 2ITMA 3CCLN 2X3DA 2RILA 3G9CA 1REVA 3GLJA 4Q44A 2F9TA 4CEDA 2FB0A 1OVQA 2G13A 3VGMA 4HLBA 3ZZUA 2VH7A 3CSKA 2PAVA 1N32K 3F44A 4LMZA 2KKHA 2LA4A 4R0EA 2VFRA 4WK3A 3CDUA 1VQPS 1SH0A 1W2BR 3EE9A 4FJGA 5BPLA 2HG4A 4I6MB 4CD3A 2Z1HA 5K14B 3BSAA 5LMUJ 3QESA 4CO0A 2CPFA 5D0RA 4FJMA 1X9SA</