4RW9A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw9A05
3AA2A 4FJMA 4DFMA 3KD1E 1T05B 3OS2A 4CFBA 4CJUA 3D0PA 2G8HA 3M8RA 3KOAA 3HKWA 4YR0A 3KKSA 4HUEA 3EPIA 4RNMA 2VWKA 3M8PA 4CEEA 2AGPA 2FC0A 4NLTA 5CYQA 4RUCA 3OJSA 4I2QB 2D3ZA 3H98A 2KZMA 4FZZA 4F50A 3GV7B 4URGA 5F8HA 2VA3A 4WE1B 3NKYA 3DYAB 2FLPA 3AVJA 3SNNA 1ZTWA 1IO2A 4DSIA 2V4RA 4TLRA 4RNHA 3K58A 4Y2CA 4M3WA 4OL8A 4HYKA 5J2MA 3I5CA 4K4XA 1XR5A 1BI4B 4WZMA 5F8LA 3OL9A 1ZBUA 3DLKA 4RNOA 5DGBA 3DOKB 1NNDA 3L3VA 4AH9A 3I8DA 2E9RX 5KFEA 1HPZB 4ZPDA 2VG5A 1EXQA 2PZSA 4C8KA 4G1QB 3T5HA 5EWEA 1Z26A 1NOZA 2D0CA 3S9HA 1QE1B 2IAJB 3V4IB 1TKXA 4KHNA 4F2SA 1DTTA 3ZT1A 3FRZA 4FM0A 4J2DA 3DOLA 5DG7A 1SH3A 4QPXA 4AHRA 3KIOA 4QAGA 1Q8IA 3ASMA 3U6FA 2J6TA 3FSIA 4M3UA 1D1UA 3JSMA 1S1UA 3CDWA 2B5JB 1FK9A 2ILZA 3MF5A 3K5MA 4YR2A 3QIOA 3AO3A 2HWIA 4O0JA 4HKQA 1U4BA 3ITHB 4LSLA 1KLMB 1Z4UA 4TYBA 5KFYA 3SPYA 2B4JA 1KTQA 4F2RA 1SKRA 3OVNA 3EZUA 4C8LA 4CHPA 3KHHA 1DLOA 4ZVGA 2A1RA 4KSEB 2HMIA 4CJKA 1S48A 3T5KA 1ZYQA 4ZPAA 4CK1A 4KTZA 4DTMA 3RBEA 3ZSYA 3NAEA 4JLHA 4HUFA 1T03A 3PHEA 3TR8A 3H2LA 3AVGA 3V6DA 4ZP9A 1C1CA 4B3OB 3O3HA 1EKEA 4DSFA 1DTQB 3LP1A 3MXMA 5KFBA 4ZPBA 3MECB 5KFCA 1BIUA 4I7FA 3QZ8A 4QWEA 3DRSB 2W9BB 3VN5A 1RT3B 2G8VA 4CFCA 4ZTFA 3NF6A 1KFDA 3SQ1A 4ELVA 5KFIA 3V1RA 1HRHA 2YNGB 4EO8A 3RMCA 2I1RA 2HNYA 5HRSA 3MEGB 3KLHB 3PY8A 3AVKA 4KO0A 5KFVA 4DU1A 5HROB 3TAEA 1LV5A 3IGVA 4YQWA 4QWCA 4K4ZA 3TABA 2X6SA 5J2QB 1LWCB 2R8IA 2FVCA 1GOAA 3DMJA 4JS5A 4EBCA 4Z4GA 4RW4A 2W7PA 3MEEA 4N41A 4DG1A 4IOBA 1QSSA 1CXUA 2FBXA 3H4DA 3LALA 2WOMA 4CE9A 5F8NA 2XY6A 4IG0A 4J9MA 1IKWA 2RDIA 3VQAA 3RBDA 3NBPA 4RZRA 1FKOA 2D41A 4E89A 1RT7A 4PQUB 5I3UA 4O3PA 5J2NA 4G3IA 4CIFA 2B6AA 2ATQA 1ZTTA 1VSLA 1VSKA 1XR7A 4B9NA 1SH2A 5C24B 2Z1GA 4EEYA 3M9OB 1RDAA 4CJ5A 1K6YA 1KVCA 4FJ8A 3OSPA 5C42B 3H08A 3EYZA 1ZBIA 4ECQA 3M8QA 5HRNA 4J9KA 3OYFA 1REVA 3KK1A 3KLVA 4K4TA 3V81B 2I5JB 3RR8A 1IG9A 2FJXA 3GILA 4NCAA 1B9DA 2UVUA 1X9SA 4QCLA 4GC7A 2VG6B 4R5PB 2CJQA 4TY8A 3KLFB 3AVBA 2HNZB 4NYZA 4FLWA 2YNFA 3VA0A 3MR3A 4ID5A 3PX6A 4NLXA 1FKPA 3CG7A 4IKFA 4ZMMA 3LWMA 2VWJA 3SFGA 2YV0X 1S1TB 4IRDA 2KFNA 3OL6A 2XWYA 3OHBA 4OGEA 4MKAA 4LQ9A 4N76A 2WHOA 4KHMA 3LANA 1BL3A 3BQ1A 4F4YA 4AHSA 1SV5A 1HYZA 2EHGA 1I39A 3MEDB 4KHRA 4ED8A 5I42B 3OYMA 4ZP6A 4IDKB 4ICLA 4U6PA 2G8UA 1BQMB 1WSHA 3HPGA 2BQUA 3MXIA 4EBEA 4J9LA 3QGHA 2W9CA 3OS0A 3B6PA 4BDZA 1B9FA 3TWHA 4KREA 3NGIA 1TV6A 1TK8A 4ZHRB 4WFZA 3L8BA 3G6VA 4CEBA 2XY7A 3DRPB 1C1AA 1OS5A 4NYFA 3UDLA 3DLEB 1T94A 1NJXA 3LAKA 3LP2B 3KK2B 1CXQA 4CJPA 5HBMA 4FZYA 2HWHA 3V1OA 3QEVA 1TKTB 5KRTA 3U3YA 1S9EB 3BJYA 3K57A 1JXBA 1LW2A 3IS9A 3PVXA 1NK4A 3AA4A 1ZBFA 3DM2A 1IKYB 1A5XA 1RTDA 2ASJA 1WAFA 4PUOB 4OJRA 5D3GA 3MXJA 1MU2B 1ITGA 3NF8A 1RBVA 4DTXA 1JLCA 1KCFA 5KGWA 3LDSA 3LP3A 4AHTA 5KFKA 1C1BB 1EP4B 2FLLA 3PO5A 5DLGA 3K2PA 4Z4FA 2XC9A 4ED7A 3G0ZA 2OPRA 3ISND 1U49A 4F8RA 1CLQA 2XI3A 4LSNA 3THVA 4BDPA 4EBDA 2O5DA 1RT1B 1RDRA 1NJYA 1KHWA 1S0NA 2RN2A 3FFIB 1VRUA 2AGQA 1B92A 2HVIA 3F73A 3PW7A 4M95A 3ZSZA 4H4OA 2DPJA 4LY7A 4E7IA 3RTVA 1C2PA 4O3NA 1WN7A 2HNDA 4UQGA 4B9MA 4KPYA 1CZ9A 4KB1A 4OKJA 3G6YA 1RA6A 4URQU 4E7HA 2HB5A 1S0OA 4AILC 5L1IA 3SQ2A 3E01B 3OHAA 4NZ0A 2OPPA 3T19A 3OY9A 2Y1IA 1JLAA 1R0AA 1ASUA 2DY4A 2XY8A 1HNVB 2RF2A 4F3OA 2XCPA 3OYAA 4CJLA 1RT5A 2IC3A 1WSIA 2QE5A 1W0HA 1U04A 4WFYA 3IN5A 3TAMA 1C0TA 3ZT4A 3E51A 2FJWA 3AVFA 1EX4A 4ED2A 4QOZB 4W5RA 2JC1A 2ASLA 4YMEA 4HCBA 4OLAA 5KG2A 1HYVA 1VSEA 3LZIA 3KJVA 2D7SA 1RBSA 1RYRA 5CZ2A 3CFPA 2DPIA 4B8AB 4K4UA 3C94A 3V6HA 5KFFA 3QIDA 3S3MA 4WE1A 3KMSA 3DYAA 2Y1JA 2BR0A 3QEPA 4CGDA 3V6KA 1TVRB 4B08A 4Q8FA 4AHCA 3HM9A 2YKNB 3KHLA 4KKOB 2G8WA 4DTRA 2AJQA 4MK9A 4FJJA 3SI8A 3TAGA 3DOKA 1BCOA 2W8KA 3N6NA 1X9MA 4NLUA 4ZVHA 4OKEA 5F8JA 1HPZA 1QAJA 3ICLA 2VA2A 5KG5A 5F8MA 3EPGA 3K5LA 4G1QA 3PX4A 4KAZA 4FBUA 5KI6A 3HO1A 4XPCA 1XI1A 1QE1A 2IAJA 2RKIA 3V4IA 5EUHA 3OL8A 4ECYA 1BIZA 1U47A 3NH2A 1Q9XA 2GC8A 4NLQA 3NL0A 4WXOA 4DFPA 1JLQB 4ED3A 1JX4A 4CEAA 1XC9A 3DRRB 5KFPA 1WAJA 3OYHA 1J54A 5FDLA 3HPOA 4E7KA 4KE5A 3LP0B 5KTQA 3IAYA 1TGOA 2B5JA 4IRKA 4ZPCA 4BE2A 1HARA 3BR9A 4M45A 1XHZA 3NDKA 4CJTA 1S1XB 1LAVA 1JLGA 3ITHA 4IFYB 4Y1CA 4CJWA 4O3RA 3QIPB 1RTIA 1HYSB 1RBTA 2HHSA 4XIUA 3OYBA 4ECXA 4FW2A 1SL2A 4DQPA 1BISA 4DWIA 4W5NA 3D5MA 4IG3B 4O55A 4EYIB 1BGXT 1W9HA 3CFOA 4WXWA 2BQ3A 1DTQA 2R2SA 2IOCA 3MECA 2C2RA 4Z0UA 5FRMA 3CQ8A 3PO4A 2J6SA 4M3RA 3AO4A 3UPFA 4DTOA 3DRSA 3HVWA 3RMAA 2W9BA 2O4GA 4RUAA 5DMRA 2AU0A 3SUPA 3RRHA 1RT6B 2YHBA 3V9XA 3S3NA 1TL3A 3QEXA 2YNGA 5KFOA 3NH0A 2BE2B 5HP1B 2OYQA 3MEGA 3KLHA 2E4LA 2Q3SA 4CJ4A 1WSGA 2FLNA 4WYLA 4H8KA 2KQ2A 3AVLA 2LSNA 4LD0A 4CHYA 1VSDA 3HSTB 1ZBHA 5J2QA 1LWCA 3KMQA 5HRRA 4CERA 3PUFA 2BANB 4O5BA 1GOBA 5J2PB 4CJ3A 3HP9A 3T5JA 3BDPA 2W42A 3NE6A 1LWEB 2HVHA 5CYMB 4J2EA 4CJQA 2FVSA 3ZSQA 4PA1A 4DFJA 3VQBA 4PQUA 4E7LA 2E9TA 1TL1B 1XHXA 4CECA 4Z4IA 4GVMA 4RW9B 4ED0A 3FQKA 1KSPA 5F9LA 3B6OA 4R8UB 2HHQA 3NH1A 4J9RA 3ZCMA 4JUZA 1T3NA 1TKZB 4CFAA 1J5OB 5T7BA 2EX3A 5C42A 2ZE2B 4DQSA 3OYLA 3AVCA 3V81A 2I5JA 2XGQA 1TKDA 4FLTA 4CF2A 3K5OA 1U48A 3QLHB 3MR5A 3V9ZA 3TAPA 3N6MA 2VG6A 5DG9A 3SJJA 3PW0A 4EZ6A 3KLFA 2HNZA 5KT2A 1XWLA 3CJ3A 2ATLA 3UQSA 1WSEA 1JLBB 1NHUA 2B43A 5E41A 4CJFA 4K8ZA 4KHWA 1RTHB 3C6TA 4DFKA 4FM2A 2E9ZA 1QHTA 4NRUA 1JXLA 2YNIB 4ID1A 5KFSA 1NK0A 3DI6A 3RAXA 1S1TA 3Q8QB 2C2DA 5KFRA 1QQCA 3IRXB 5SZTA 4I9LA 1BHLA 2JC0A 3F9KA 1QSLA 1S9FA 5KFNA 3VQDA 1D0EA 2PY5A 4QWBA 2ZD1B 4MH8A 3HVTB 2FBYA 3MEDA 3TQ1A 5I42A 4NLYA 2IGIA 4IDKA 3BSNA 3MTKA 4NLDA 4HVJA 4M3XA 4M41A 1BQMA 4FJIA 2FBVA 2QV6A 2AGOA 3M9NB 1Z25A 3PJWA 4O0IA 4ECZA 2DFEA 3PR4A 1D9DA 2AX1A 3QZ7A 1VSHA 1A5WA 1NK7A 1LW0B 2ZQBA 1TK0A 2YNHB 1JLFA 2W7OA 4ZHRA 2DFHA 2ASDA 4WZQA 1XR6A 3SI6A 3KLIB 3VQEA 3LP2A 3KK2A 4J9SA 5KFLA 4YNQA 2Z1JA 1DTTB 4DTPA 2ALZA 5KG6A 4J9OA 1TKTA 2WCXA 2Z1HA 4IH7A 2X78A 1G15A 4EP5A 3ISNC 1I3AA 1J53A 5JS2A 5KRSA 2IM0A 1IKYA 3OYIA 4B9SA 1RILA 4FBTA 2KTQA 1S1UB 4AHUA 4PUOA 3CDUA 5KGXA 2J6UA 3QINA 4FLZA 1MU2A 3L2RA 4BE1A 3KLEA 4KB7A 3UIQA 4TY9A 5HLFB 2FJVA 2EC0A 1C1BA 4RG8A 4Q0BB 2OPQB 4OGCA 5KFGA 5KFMA 2AWZA 2WRMA 3H5UA 1DLOB 3QNOA 4F4KA 2F8TA 1NJZA 1UWBB 4NLRA 4E1MA 3V1QA 5J1EA 1ASVA 1RT1A 3FFIA 1NK5A 3BQ2A 1IKXB 1C0MA 1T03B 3O4NA 3HHKA 3V6DB 1RTJB 3MR2A 4RU9A 1RCHA 3Q8PB 1S6QA 3LWLA 3OYGA 4I7FB 3AA3A 3VQPA 4CF1A 3TAQA 3DLHA 3E01A 4DU4A 4ELTA 3RB6A 4CJVA 4KBIA 3RB4A 4CEDA 3OYCA 4I2PB 3HP6A 3RB0A 3BGRB 1HNVA 2WK4A 3NHGA 3A2FA 4J9QA 5C25B 5F9NA 2DTUA 1BQNB 3VQQA 2BRLA 3KHRA 4FK0A 3I0SB 4J9PA 1GX6A 1QUVA 3VQCA 3HT3A 3QEWA 4B9VA 4FJKA 3VQ8A 3QYYA 4FVMA 1LAWA 1J9AA 3OL7A 4IFVA 3NGYA 5KT7A 2HW3A 3RRGA 3K5NA 3H5SA 3MEEB 3BSAA 2BGGA 4ZTJA 4CGFA 3P5JA 4URSA 2R2RA 4NCGB 2WOMB 5FRNA 4ECVA 4DSKA 5EDWA 3I5BA 3S3OA 2YKNA 4KKOA 4LH4A 3CJ4A 1KVAA 3ULDA 3WNGA 5F8GA 5I3UB 4Z4CA 4F3TA 3OYJA 1S0MA 2X6NA 2P51A 1N6QB 2UUTA 1S4FA 1RT4A 1S6PA 4KTWA 3KHGA 4FS2A 2X74A 4CIGA 4FJXA 4KI6A 1Y97A 1S9GB 5HRPA 3CM6A 4DSJA 3Q8SB 4K4SA 4BE0A 1REVB 2JEFA 1JLQA 3KK1B 5SWMA 4KHQA 1EETB 4B8CA 3TVKA 3DRRA 3PV8A 3HL8A 3QGGA 4DU3A 2UVWA 2FVRA 3DLRA 4DTSA 2C2EA 3KNAA 5KFUA 3AVIA 2GIRA 3RR7A 1L3UA 4B9LA 4EO6A 2XO7A 1JIHA 3WNEA 1S1XA 3TARA 3CVKA 4RNNA 3CJ2A 4IFYA 4CFDA 3H4BA 3PW2A 4KFBB 3QIPA 3H5YA 1IKVB 1HYSA 2ETJA 4EP4A 3KKRA 4GMJB 1RT2B 4O4GA 4CHOA 3OLBA 1JLEB 4E19A 2OPSB 2HHUA 3ZSXA 2VG7B 2FVPA 1T05A 2PYJA 2AX0A 4IG3A 4QW9A 1O1WA 3G6XA 5KG4A 1NKBA 1JKHB 4KHSA 5DLFA 1SV5B 2ZKUA 4WYWA 1SL1A 2IM2A 4I2QA 4CEFA 1SUQB 3AVNA 5KFJA 1K1SA 1QTMA 3HYFA 2CKWA 1RT6A 4DL6A 1HMVB 3GV8B 4FJGA 4CESA 4CEQA 4CGHA 3NGZA 4DTJA 3NAIA 4L8RB 2BE2A 5HP1A 2WTFA 1D5AA 3M9MB 1BI4A 2IMWP 4MFBB 4B9UA 3OSNA 5CZ1A 4KB0A 2JLEA 3QERA 1QS4A 4E7JA 2WONB 3LZJA 1NHVA 2GIQA 4CF9A 4QW8A 2BANA 5J2PA 3CYMA 3DM2B 3CWJA 2IBKA 1JL2A 3GV5B 5KFAA 5CY4A 4OPJA 4K4YA 1LWEA 5CYMA 4C8OA 2G8IA 1UA1A 4TXSA 2XGPA 1ZBLA 3NFAA 3NAHA 4TQSA 2IJNA 4RW9A 1CZBA 3V9UA 1NJWA 1C0UB 4KI4A 5K14B 4MQ3A 4W5OA 4O3QA 4RW6B 4XO0A 3CJ5A 4OVLA 2F96A 1KLMA 1TKZA 4FJ7A 1VSMA 5KT4A 2ZE2A 4NLWA 1TAQA 4Y1DA 2QK9A 2BQRA 4PWDB 2HAIA 1TAUA 2YKMB 4FXDA 2GUIA 4N56A 3BSOA 4IBNA 3IG1B 3MR6A 3DLGB 3OJUA 3QLHA 5FROA 4RW8B 4IKAA 5JUMA 4B3OA 1KLNA 3JYTB 4BWJA 3QESA 4NCBA 2XHBA 1TQLA 2OA8A 2IC3B 4K50A 4DMNA 3C6UB 4Y34A 1WSJA 3O3GA 4O44B 1D9FA 1RT3A 1RTHA 3SUQA 3NMAA 3TAMB 1C0TB 2YNIA 3OS1A 3QETA 4MK7A 3CFRA 4OPKA 1IM4A 3Q8RB 2JGUA 3KJVB 4H4MB 1QAIA 4FCYA 4NRTA 2KW4A 2D0AA 3IRXA 4Y2AA 4IH6A 3WNHA 3T3FA 5HROA 4DTUA 4K8XA 4CF0A 3QGIA 3KK3B 3VQ7A 2ZD1A 2V4QA 2R2UA 3HVTA 4DLEA 4Z4HA 1WNSA 5KFTA 4FM1A 3I0RB 3SPZA 4H54A 4ECTA 3NGDA 4YFUA 4RW7B 2XCAA 4CGIA 1YT3A 4KAIA 3SUNA 3KLGB 3CIZA 5KFZA 3ZSVA 3AVAA 3L2UA 1NK6A 1VRTB 4FYDA 4CHQA 1L3SA 1YTUA 3G86A 3H5XA 4TN2A 4E3SA 1HNIB 3N6LA 4FJHA 1S1VB 1LW0A 3GIJA 3U3GA 2YNHA 1N5YB 1X9WA 4XPEA 4KV8B 3SV3A 3KLIA 1L5UA 3ALYA 3VQ6A 2RKIB 5KFQA 3T5LA 4CCHA 5C24A 2OH2A 4CHNA 1NK8A 5EWFA 4C8MA 5FDLB 3OYDA 2JEIA 2R8JA 2UVVA 2A1SA 1F21A 2F8EX 4X2BA 3QO9B 1U09A 3ZSRA 4WFXA 4JS4A 3SCXA 4BWMA 3RB3A 4Q43A 1JLGB 1HQUB 1S1WB 3MAQA 3PW4A 4K4WA 5HLFA 4ELUA 4Q0BA 2OPQA 1LWFB 1HQEB 3GYNA 1RTIB 2RDJA 4R5PA 5KG3A 1UAXA 1RYSA 3V6JA 1UWBA 2JEGA 2P5GA 1A5VA 2DFFA 1IKXA 4DF4A 3ZT2A 3WNFA 4E1NA 1RTJA 4CEZA 4HUGA 3PW5A 4CK3A 3L3UA 3M8PB 5C5JA 3RMBA 4B9TA 5CYQB 4FS1A 3PZPA 5KT3A 4JV0A 1VK0A 3KTQA 3ZSWA 4TQRA 3OYNA 2ITGA 4I2PA 4FLXA 5KFWA 3BGRA 3CM5A 5F8IA 4CGGA 1TL3B 3VQ9A 1TP7A 2P1JA 3LPTA 3L2QA 1RNHA 5C25A 1BQNA 4M94A 4F4WA 5J2MB 3DLBA 4J2AA 3I0SA 2KZZA 3DLKB 3SV4A 4M3TA 5KG7A 3TANA 5T14A 2VG5B 5L1JA 3FDSA 4KTQA 5JS1A 3DRPA 5KT5A 3DLEA 3K59A 1TKXB 4NCGA 4JV1A 4KHUA 3GIIA 3DOLB 4R0EA 1L3VA 1S9EA 3OLAA 4E0DA 3L2WA 2V9WA 3JSMB 4K4VA 3GIMA 3H40A 1N6QA 1FK9B 1NOYA 4ECWA 3NF7A 4CF8A 1N48A 3PX0A 4CGJA 2QXFA 1YVFA 4CK2A 4FLVA 4PY5A 4LSLB 4J9NA 1EP4A 3LPUA 1S9GA 5L9XA 1BCMA 4DTNA 2G8KA 4O4RA 1I6JA 2V0NA 2HMIB 3VQ5A 4FK2A 3NF9A 4DF8A 3CO9A 1EETA 3EZ5A 4M3ZA 4TYAA 1SKWA 1W25A 1CSJA 3MFHA 4M42A 3QEIA 5KG1A 2GBZA 4ED1A 1C1CB 3AO1A 3SFUA 3CDEA 3KD5E 2FBTA 3HJFA 3LP1B 4GW6A 4JRQA 4FZXC 4OLBA 4DQIA 3TAFA 4W5TA 4C8NA 1NKEA 2R7YA 5KT6A 5DQGA 4KFBA 3C6TB 4NLPA 5KFDA 1IKVA 3OYKA 3NCIA 4MK8A 5DQHA 1RT2A 4HTUA 2AQ4A 5KFHA 3AVMA 4IR9A 1KFSA 3DI6B 1N56A 4Q8EA 5L1LA 2R8GA 1JLEA 4NLVA 2OPSA 2HNYB 4M3YA 3C95A 2VG7A 4DSLA 3L2VA 4CIEA 2D5RA 4KO0B 5KG0A 2IS3A 1NKCA 5DK5A 4O3OA 1TK5A 3AA5X 2W9AA 3BSCA 3HXMA 3ZSOA 1JKHA 4J2BA 4FLUA 2R2TA 4AHVA 4ZP8A 4JRPA 3DMJB 2BDPA 1SUQA 1QSYA 4RW4B 3AO5A 4DG1B 2C28A 2XRIA 2YHAA 4FK4A 2ILYA 2GV9A 4HCCA 1HMVA 5EU7A 4ECUA 3P83D 1TVRA 1ZETA 1S10A 1KHVA 4ZVEA 4DS4A 4IG0B 4Y3CA 4HHTA 3GQCA 4MIBA 1YVUA 1IKWB 1JLFB 5EWGA 3NBPB 4MFBA 2D3UA 1VSJA 4KHYA 1FKOB 3PJXA 1RT7B 5J2NB 4DL2A 3LAMA 3V9WA 2B6AB 1U45A 2G8FA 1YTAA 2WONA 3FQLA 3BREA 2E6LA 2IM1A 1JXEA 2R8KA 1S97A 4W5QA 3I5AA 1S5JA 1RAJA 4ZP7A 3M8QB 3VQ4A 4KRFA 4F4XA 4CHZA 3O3FA 3KLEB 3T1AA 1WNEA 3ZT0A 1ASWA 3VQSA 1UA0A 3LP0A 4F4ZA 4N5SA 4NLSA 4BDYA 2RPIA 4FJNA 4DL5A 4QWAA 3G10A 1SL0A 4TY8B 3AV9A 4BACA 2YNFB 4DL7A 3GIKA 4MKBA 1C0UA 1GX5A 4ID5B 4DEZA 5J1EB 5K14A 3SZ2A 4RW6A 4N47A 3M8SA 1RDDA 1FKPB 1T7PA 3AVHA 1KVBA 2W8LA 3DDKA 2HHTA 5JXSA 1UOCA 3D45A 3H59A 4PWDA 1S6QB 2YKMA 4FLYA 4ECSA 4NLOA 4FW1A 2P5OA 3UR0A 4FJ5A 3IG1A 2OZMA 3DLGA 4ED6A 4DLGA 4IQXA 4RW8A 4NLGA 5DQIA 2UVRA 4IH5A 1IH7A 1VSIA 3JYTA 3ZT3A 3EY1A 4Q44A 2D0BA 4CJRA 4CJEA 4DQQA 4DQRA 4LH5A 2IM3A 4TSXA 4I9QA 1WLJA 1GOCA 4ECRA 3C6UA 4ICLB 4NYNA 4O44A 2OZSA 3O4QA 2QKBA 1KRPA 3V9SA 3SQ0A 2W9CB 1MMLA 3D28A 1RBUA 3IGNA 1S49A 3BQ0A 1TV6B 3HPHA 4H4MA 4IFVB 2UUWA 4Q5VA 1FXXA 1RBRA 2E6MA 1K1QA 3SUOA 4EYHB 3KK3A 5HBMB 5DG8A 4RNFA 5L1KA 1SH0A 3I0RA 4IR1A 1SKSA 3MFIA 1VSFA 4RW7A 4GC6A 1LW2B 4EZ9A 3IS9B 4CJSA 5DGAA 2QKKA 1C6VA 3KLGA 4MIAA 1VRTA 1RTDB 3HVRA 4ZVFA 4YP3A 4O3SA 5D3GB 4YR3A 4QWDA 1HNIA 4DL4A 1RT4B 1S6PB 3VA3A 4IRCA 1JLCB 1S1VA 3HVAA 1N5YA 1RDBA 2F8SA 3AO2A 2HHWA 1RA7A 4KV8A 3PR5B 2IA6A 3P1GA 4Z4EA 2KFZA 2IDOA 4DS5A 4OKKA 3QNNA 4U7CA 2OPRB 3TI0A 1TL1A 4LSNB 2BRKA 3SQ4A 2Z1IA 1D8YA 2FVQA 3HK2A 4R8UA 2HHVA 2R8HA 4Q45A 1Q9YA 1VRUB 4LQ3A 4DSEA 5KFXA 1J5OA 2XY5A 4JV2A 4DL3A 2C22A 4H4OB 1X1PA 1WSFA 3OYEA 1RDCA 2HNDB 4CEOA 3QO9A 2PYLA 1NK9A 4FJ9A 2WB4A 2HHXA 2JEJA 1HQUA 1T8EA 1S1WA 1N4LA 3RWUA 1HJRA 3RAQA 1LWFA 1HQEA 3CJ0A 2OPPB 1JL1A 2NUBA 1L3TA 2XI2A 1JLAB 1R0AB 4FJLA 2RF2B 3SYZA 4O4GB 2O4IA 1RT5B 2IJFA 1JLBA 3RMDA
chains in the Genus database with same CATH superfamily
2IVYA 2L9NA 3CJBA 3OS2A 2R42A 3CD7A 4CJUA 1HD0A 2QWNA 4HUEA 4DUZJ 1N33J 3DGPB 1H0HB 4FNHA 4NLTA 5IQ6A 2F4VF 2PGCA 4JI7J 4F50A 1IUJA 3HD2A 5GADI 3GV7B 4URGA 1X5OA 3FCVA 5K8OA 1KN6A 4EU0A 3O1LA 4IOAL 1HWIA 3SNNA 2FY8A 2V4RA 3CUNA 4DR6J 3OR2A 4RNHA 5J2MA 1VC6A 3PJ9A 3LGNA 4UY85 3IR7B 3CJTA 3QJLA 4WZMA 3OL9A 6FD1A 1GEHA 4LBPA 3N01A 3RU0A 2UU9F 4DV7F 1XMOJ 2AF6A 3PNIA 2FSNA 3BO4A 5KFEA 5AQXA 1HPZB 1WG1A 1SJRA 1EXQA 1IR2A 4LR9A 5M2RA 5F0WA 2XMJA 3MD3A 4AD6A 2HSTA 5GAHP 1QE1B 3S8SA 1RWKB 3QT8A 4EUVA 3MM7B 3DOLA 4QAGA 3MWTA 1UW9A 5FPNA 4U67L 2DEJA 2W2OP 3FSIA 4G6VB 4Q2LA 1X4BA 2HFOA 3OBYA 3JSMA 2CPDA 2BXJA 1M0SA 3G6EN 1ZM9A 2GVDA 3IR6B 4HKQA 4MLHA 1OIAA 2QYCA 1WHXA 2X51A 4UOGA 2B4JA 5IWAF 3SPYA 4F2RA 1SKRA 1Q5VA 3B8HA 4C8LA 3KHHA 4MDAA 2CWKA 4ZVGA 4CK1A 4ES1A 4DTMA 3O1WA 1VQ8S 1RHRB 4JLHA 4DV0J 3M6WA 3QMLA 2MZRA 3V6DA 1GLFO 3OUYB 4DSFA 3UVJB 2EWHA 3ZNUA 3MECB 5KFCA 1N5TA 3LF0A 3P31A 4YDXA 4OHZA 2Z2MA 1RT3B 2KVQE 5AJ3K 4KH4A 2OMOA 2XMKA 2P6TA 2NRWA 3SQ1A 4OJ1A 3GB0A 1KR4A 3I6PA 2B56A 1JNRB 2I1RA 3GONA 3UD4P 3MEGB 3AVKA 4CTAB 3H3OB 3GR0A 3R5DA 1YI2S 5DO2A 3PKYA 1J5EF 3R5JB 4AXIA 1LV5A 1MMNA 1NH7A 3CC2N 2HMPA 3AGKA 3GCXP 3O1BA 2PA8D 2W7PA 3MEEA 2M9KA 2VQEK 1QSSA 3ILOA 1P9YA 1CXUA 2FBXA 3A4TA 4ZLPA 3LALA 3H4DA 1NDPA 3J81O 3FUYA 2WSEC 4DR5K 4YOWA 1ROFA 3EVWA 2HOEA 1IKWA 2HLUA 4GV6A 3NBPA 1DT9A 5I3UA 4O3PA 1R8BA 2ATQA 1ZTTA 1R8HA 2BOPA 1VSKA 3NLCA 3NWRA 3HHLC 4C2MA 3D67A 2Z1GA 3CF5Q 3M9OB 4CJ5A 3EYZA 3CERA 4ECQA 5JICA 4ES2A 3M8QA 5HRNA 3MK6A 1H2TZ 5HQLA 5A6PA 4F0HA 3KLVA 4K4TA 3V81B 2J8SA 1D09B 4AL7A 3NVMA 3GILA 4GKJK 3Q8VA 4ILJA 2CJQA 4TY8A 5LXRA 3KVGA 4NYZA 4QS9A 2P9GA 3VGSA 5D0EA 3J7YP 4I6WA 3DGVA 2DXFA 4NLXA 4B3SK 4NASA 1YZ7A 4Z7YA 2JOQA 3LWMA 5ADXH 4JN4A 1PGZA 2VWJA 1OYEA 1RK8A 2V7YA 4JKFA 3GYXB 3OL6A 5IC4B 4MKAA 3NMRA 5ADZA 3J7AN 1WACA 4ZDNA 3ZTQA 4KHMA 1RAHB 2I8EA 4F4YA 1SV5A 2VYPA 1HYZA 1OKJA 1I39A 5BRFA 4ED8A 2YKPA 4ICLA 1YBUA 1BQMB 3N0VA 2RDDA 2Z2YB 3LQVA 2BQUA 4AM6A 2W9CA 2VC1A 2XNQA 3ID8A 2RS8A 1KD1O 2VFUA 3NGIA 4DI6A 2X1GA 1U6ZA 3FEXB 4CEBA 3IA0A 2B9XA 4GO5X 2BKPA 3UKUB 4L3NA 1T94A 2GFFA 3LP2B 1PBAA 3MPUB 1CXQA 4FZYA 3CCLN 3AB2B 5KRTA 1XMQF 4ZOSA 1NK4A 1RISA 3AA4A 1ZBFA 5AE1A 3HHDA 2C2MB 2ASJA 1WAFA 4OJRA 3MXJA 3MHYA 4LRAA 1RBVA 1N36K 1WC4A 2FLLA 3AXKA 2P8IA 3TUPA 1AW0A 2QWLA 1QM9A 5DLGA 3K2PA 3CHWA 4NYOA 3GU0A 3CJKB 1U1LA 2HRYA 1G6BA 1F6TA 3I9ZA 2NXUA 2AGQA 2HVIA 2QLJB 3PW7A 2BJDA 3O3LA 4LY7A 1H7XA 3RTVA 1WN7A 2HNDA 1JJHA 4OQJA 1CZ9A 4Y65A 3POTB 4WK3A 1RA6A 5B0AA 4AILC 1DQ9A 4TNOA 4IJAA 3CCJN 3C66A 1WC0A 3T19A 1JLAA 5AZIB 1ASUA 2DY4A 2RF2A 4CVNE 4A5BA 4F3OA 2XCPA 1BMQB 1X4FA 2EWSA 1RT5A 4WFBQ 2RSQA 1LFWA 3UKRB 1W0HA 3HD1A 2FPHX 3EZOA 4NZ7A 3E9PA 4WFYA 3TAMA 2XYGB 3E51A 3T1YJ 4U9RA 1ZM3A 1VC0A 1EX4A 1F9EB 3AVFA 4QOZB 2ASLA 4YMEA 3MAAB 2AZ1A 3O5TB 1ZBTA 3JSBA 4JKDA 3LPYA 2D7SA 1RBSA 1FT8A 2DPIA 3C94A 2E5HA 1RGIA 4WE1A 3KMSA 2KKHA 4FNIA 3V6KA 1WF2A 4P7VA 1TVRB 1KONA 2MJUA 3AJ1A 3UO0A 3SLCA 3HM9A 1F5BA 5DS7A 3RSEB 4BRMA 1B70B 2XEXA 2AJQA 1M5VC 4HEA9 3VWSA 4JI0K 1BOTO 1BCOA 3N6NA 3GCWP 2BE9B 1WC5A 1M1HA 2EKYA 4C7QA 1QAJA 3JSRA 5KG5A 5F8MA 3EPGA 1SQKA 4G1QA 3PX4A 4KAZA 4JV5F 3DN9A 2CJKA 4A8QA 2A41A 4M63A 3J8AA 2RKIA 3V4IA 5EUHA 1BIZA 1XQIA 3OD2A 3NH2A 4NLQA 4WXOA 1JLQB 1N5QA 2DR7A 4CEAA 2DHAA 1XC9A 3DOMA 5HMWA 5KFPA 1J54A 3ZETB 3HPOA 4KE5A 1LKZA 4IRKA 4ZPCA 3VESA 3HHLA 1XHZA 4CZLA 4HT7A 2A2CA 1RU2A 1LAVA 3RG6A 3LDNA 4MDBA 3IM8A 4ZN3A 5BR8K 1U8SA 1HBMB 2YPYA 4CO1A 3QIPB 1RTIA 1HYSB 1RBTA 4C3LA 4ECXA 1SL2A 4DR2J 2HURA 2Q0UA 2BX6A 2IVPA 3HSGA 4K5SA 3SMZA 3VF0B 5AQIA 2MTLA 3FJ2A 3WIUA 3D5MA 4KC5A 5AQFA 3W9IA 1BGXT 4WXWA 3ENVA 5M2PA 2KRBA 1I51B 2D74B 4M3RA 3RMAA 4DTOA 2O4GA 1P90A 3LA0A 4PXBA 1XNRK 1UTAA 2FC8A 5DMRA 3RRHA 3GL1A 2NCKL 3HDSA 1F3FA 1SS6A 4JP8A 2YWWA 4RBUA 1YK9A 1IM6A 2OYQA 1FRXA 3KLHA 2E4LA 2Q3SA 4LBIA 4CJ4A 1OH5A 2FLNA 2LA4A 4WYLA 3QBWA 1N34K 3MXHP 1H74A 2DNOA 3AVLA 4JI7K 4GKKK 4LD0A 3CULA 3DCAA 1VBXA 2M0GB 4L3QA 3KMQA 3RVCA 3U7JA 2VU5A 3DXKB 4O5BA 1GOBA 4DR6K 4X62F 3UCGA 5DDPC 3W0LA 3BDPA 1FO1A 5A8WA 4EWTA 3HBTA 3TTCA 1REGX 4YDDB 1QJHA 4JI5F 3RZAA 1ZOTA 3CJSA 4DX8H 1LWEB 1Q82T 2HVHA 2PMWA 4YN3B 5FJ4A 4CYUA 2NR0A 2FVSA 4QJVA 3HTVA 4WFAQ 3U8XA 4DMZA 2C2OB 3MWBA 4UY8O 1VQKN 2M8HA 3QRQA 4XH1A 3B6OA 4LR7A 2PT0A 3NP5A 4J9RA 1T3NA 3T1HJ 1J5OB 2EI5A 2JNJA 2Q6CA 3ZX3A 3VGVA 4DQSA 4LF9K 3OYLA 2MHNA 2NRVA 3FGVA 1VDHA 2HBRB 3QLHB 3CW2C 3F56A 2MDAA 2VG6A 2RQMA 3JXUA 3PW0A 4BRFA 3ZLJA 2PEBA 3KLFA 1XWLA 2BZ2A 5KQ8A 1VAZA 3T9NA 2HVEA 3IMQJ 2RRAA 4NOHA 4K8ZA 3HSJA 5ETRA 1YTYA 1RWUA 2HHHF 4NRUA 4ID1A 3ZZ0A 2FTRA 1NK0A 4M7YA 3DI6A 2OGUA 1S1TA 2AJFE 1WOOA 4BVOA 4ZVRB 1SAZA 2DNPA 4C97A 1QQCA 1VK3A 2C2KB 3F9KA 1QSLA 1S9FA 2L48A 1IBMK 3C16B 4F36A 5I42A 1VQSA 3AJDA 4IDKA 2HFVA 1R59O 2VICA 5BREA 2DY9A 2EFOA 2AIRB 2V68A 2D9OA 3VGTA 3U4LA 2AX1A 4B3MF 3QZ7A 1NK7A 2YNHB 4FF3A 2KT2A 4WZQA 4KGXB 2FHOB 3SI6A 5AQGA 1NMEB 1G1XA 2CQIA 3AT1B 4J9SA 5KFLA 4DTPA 2ALZA 2NXCA 5KG6A 1TKTA 4FOEA 1GLJO 3EE3A 3F5TA 2EK1A 5DDOC 2CJYB 1EJ7L 1BC6A 3MN5A 1NU4A 5JS2A 1RILA 3H46O 1PBUA 5KGXA 3VEZA 5AQVA 4FLZA 1M5OC 1MU2A 1T3OA 3L2RA 3KLEA 3D68A 3US5A 1NGGA 3THPA 2IY5B 1SPBP 4F7VA 1UETA 1I94K 4TY9A 5HLFB 2EC0A 5KFGA 5LMUJ 3JTNA 1AFJA 2AWZA 2WRMA 3H5UA 1DLOB 1QHAA 3AAPA 3QNOA 2F8TA 1UWBB 1S57A 4NLRA 4FO0A 3N4PA 2XS2A 2A6OA 1NK5A 1IKXB 1C0MA 4EI2A 2GX8A 3O4NA 1EKRA 3MR2A 1VQPN 4RU9A 5ETLA 5M1FA 1RCHA 2JLFA 1BA0A 4OYMA 2W01A 4CF1A 3W1YC 3TAQA 2O66A 2XZTB 1F2HA 3A2FA 2Q31A 2DTUA 2BRLA 3CC4S 1NGDA 3VEVA 4V19J 4B1UB 3BH7B 3I0SB 2XULA 1GX6A 2VBYA 2DK2A 1FCAA 2RMLA 1K8AO 3H2VE 3VR1A 3VQ8A 2E66A 1J9AA 1SIZA 2ZBPA 3ISZA 3NGYA 3R8YA 3RRGA 4WP8A 3R2CJ 4USIA 2BGGA 3W5YA 1FJGF 3I33A 3HCXA 2LQ5A 4J91A 2R2RA 4C6AA 3L3CA 5K8PA 4LF8J 3RYLA 3I5BA 2FHJA 2L9DA 4M5JA 3OBWA 3U1MA 3J80U 1HKAA 1N6QB 1HFEL 3D0GE 4OZ0A 5GAGI 2HQDA 2DEIA 3KHGA 2WW8A 2VOPA 4F67A 4FS2A 5B0GA 1Y97A 1S9GB 4DPTA 3L4IA 2P9PA 5HRPA 2QSWA 3QFUA 1VQ5S 3KK1B 1WOPA 5L39A 3TVKA 3DRRA 3PV8A 1BUXA 3QGGA 1X3MA 5ETNA 2F4VJ 3KNAA 3AVIA 2BACA 2GIRA 1JIHA 3WNEA 2HBYB 4TVAB 4RNNA 3VEOA 4USVA 1NLKL 3G6ES 1HBUA 2YJFA 1DBDA 3KKRA 5AQZA 2P6SA 3UFCX 4O4GA 4A8XA 4CHOA 4X4SA 3CEDA 2UU9J 1JLEB 2WZ1A 4E19A 3Q86A 4DV7J 2OPSB 2CNKB 1Q86T 2AX0A 2DNHA 3QT6A 3M4XA 2C3UA 4QW9A 5KG4A 4KHSA 1SKUB 5DLFA 4BBYA 3ENWA 4WYWA 1SL1A 2IM2A 2CNOB 5GAEU 1SUQB 3OVAA 2ASYA 3G9CA 3K89A 1SJ3P 1K1SA 5D4NA 2KT5A 1HMVB 4LREA 1LXNA 2DVIA 4CEQA 4CGHA 2FJBB 3NGZA 3T1YK 2BKOA 4I1TA 3M1FA 3M6XA 1JXVA 2IMWP 2GHPA 3OSNA 2D0PA 4IEIA 4KB0A 3OXFA 2JLEA 2RHSB 3ZEUB 5IWAJ 1GFWB 2H5JB 1NHVA 2LKZA 1YAGA 3PKMA 1E3MA 4CF9A 4QW8A 3VGMA 2BANA 2GMLA 4IUFA 1U2VA 1VQOS 2OFGX 3HT0A 4P52A 2I7PA 3ZZTA 5AR0A 1HWJA 5CY4A 2RHQB 3MM9A 3U27A 1U2FA 5GAHI 1IBCB 1S99A 1U1RA 2HGMA 4P10A 1WTFA 1S12A 1HBNB 2IYIA 2DGOA 2QL5B 2AJ2A 3V9UA 4KI4A 3NGUA 5K14B 3BKTA 2HG4A 4XO0A 2GV1A 1B0VA 1UVLA 4OVLA 1RZMA 1BQXA 1OVYA 3UNYA 4YOYA 4NLWA 1TAQA 4CDIA 1TAUA 3UWTA 4BR0A 4OX9F 3BSOA 4KRWA 3IG1B 1J5EJ 4CJ7A 3DLGB 4ZVUB 3OJUA 4RW8B 3HI9A 1HLWA 3PXGa 4ZCMA 4XDCA 4BWJA 1OQ6A 1WC3A 2RAQA 5ETPA 3OUYA 3BUZB 4X4OA 3HSCA 4JI3F 3EDQB 2KVIA 3C6UB 1WSJA 2OSRA 3O3GA 2MYFA 1NZ8A 1RT3A 1RTHA 2P9KB 1PCAA 3I87A 4RL1A 1IWGA 2ROPA 4A8OA 1IR1A 3P8BB 3RGIA 4GO7X 2MQOA 4NRTA 4CTAA 2KW4A 4N77A 4CLYA 4K8XA 4CF0A 3QGIA 2KT3A 3VQ7A 2ZD1A 2FHMA 2V4QA 3I82A 4DLEA 3MCPA 4FM1A 3I0RB 2ZH7A 4YFUA 2LFVA 4RW7B 4CGIA 2NUHA 4ALZA 4KAIA 3KLGB 3CIZA 2DHSA 1YJUA 5KFZA 3ZSVA 1VRTB 3WXJA 1RLDA 3G86A 4TN2A 2V6AA 5ETSA 3J7A1 2W25A 3DWLA 1HNIB 4NXMF 2HRUA 2I7NA 3AA8A 4KV8B 4DR7K 3KLIA 1MWMA 4JI8F 3MUVP 2QW9A 4UUWA 4GVBA 1T6CA 3L7OA 4CHNA 2N4CA 4CO5A 2R8JA 1PJ7A 2UVVA 2BW2A 2YX7A 2CADA 3M8WA 3CCLS 2F8EX 1EWRA 2XMVA 4X2BA 4PL8A 5H9EJ 5ETOA 4BWMA 2YWKA 3RB3A 1R3NA 1JLGB 3MAQA 4H4KA 3PW4A 1O8BA 2H65B 4M5IA 4QYZJ 2OPQA 5IT9U 1EARA 2RDJA 2APOA 2H4WB 3GLJA 1LEOA 3CPWM 1WDDA 4LUBA 4USMA 2XSJA 1CJUA 2JEGA 1YJVA 2W41A 3MD1A 5AXMA 1A5VA 1K9MO 3OVSA 4DF4A 3TYTA 1R89A 4AYBD 3ZT2A 3J7YI 3WEEA 4CQ1A 4QPTA 1VQ6N 5TKWA 3M8PB 1X4GA 5C5JA 3NXZA 3RRKA 2CZ9A 2VQFJ 1JJ2M 2ZGYA 5SUHA 1UEUA 3MURP 1DKGD 3OYNA 2A40A 3WXIA 2VDHA 4F04B 2V8VA 5GINA 3BGRA 3VHQA 1X5TA 3CM5A 3IXQA 2P1JA 3CCJS 2XHCA 3DLBA 4J2AA 1ZH5A 3DLKB 2IRXA 2JLGA 3SK3A 5E3CA 2L08A 3FBCA 1MA9B 3MCOA 1MN9A 2XBPA 5KG7A 5T14A 5LMNK 1EHWA 4OHVA 4KTQA 1YUWA 1R0BG 3Q8UA 4OJGA 3R2DJ 3THWB 4NCGA 4RTFD 4KHUA 2NXNA 2KB2A 2YHWA 4FXVA 2FD2A 3MCAB 2E1AA 2O8EB 3GTYX 3OBIA 4EHTA 4EAHD 4X4NA 3KXDA 3H40A 2FXUA 1O13A 1NOYA 3NF7A 4H5NA 4CF8A 1GMWA 5MLCQ 5B08A 1Q81T 2GNKA 2J0SD 2CPHA 2PAVA 1KBRA 4Y00A 4M5HA 1LQ9A 1BCMA 4LF7K 4HR2A 2F7VA 3CDAA 2V0NA 2HMIB 1Y7PA 1CEZA 3CO9A 4N8NA 1EETA 3KDNA 2FUG9 3OQ2A 1SKWA 5C10A 4DV5K 3MFHA 3HSZA 4M42A 4R79A 2ZH9A 2VZ9A 2GBZA 3D2FB 4LFAK 1C1CB 3AO1A 2CWXA 2P9IB 2KG1A 4NEYA 4GY2B 3CJ8A 2FBTA 4FZXC 2RILA 5GMKa 4OLBA 2QEXS 4QIVA 3WZ0A 4C8NA 1FERA 2R7YA 5KT6A 4MO5A 2HS3A 1Q8BA 3HFKA 5DQGA 1VBZA 2WTUA 4NLPA 2Z57B 5KFDA 1IKVA 3WUHA 2VUGA 3NCIA 2KJVA 5KFHA 4IR9A 2AEMA 4Q8EA 3UI3A 1T9WA 2VG7A 1PJ6A 5DM6L 1SZ2A 5KG0A 5EX5A 4X65K 5E26A 2MGZA 2QWPA 4J2BA 4JV5J 1RUSA 1N5SA 5CYJA 3J81U 3CCMS 2NRHA 1GAOA 2C28A 1H6KX 4YB6A 5AJ3F 3HM8A 5LL6d 3F9MA 1K73O 4CO0A 4MMOA 3ZTRA 3J7ZO 3P83D 2ASOA 1TVRA 1S10A 3PFOA 4ZVEA 4DHYA 4DS4A 3W3SA 1H73A 3GQCA 3X3UA 2X3DA 5EWGA 2MZTA 2D3UA 4MFBA 1Y5NB 1FKOB 1YJNN 1RT7B 2EBEA 2NREA 1H1VA 4CT9A 2QLXA 3V9WA 1U45A 2WONA 1VHIA 3QT7A 1S6UA 3BREA 2BUNA 1NPKA 1NPPA 4U7UD 4HHJA 2F9DA 1S97A 1SC6A 4LF6K 4W5QA 5HSPA 1HWUA 1QD1A 4ILRA 4P73A 2VQEF 5CQGA 1VQ9N 1YIJN 3DRYA 3VV2B 3ENOA 3HFZB 1J6ZA 1NGEA 2ZJPQ 1WNEA 4C8ZA 1ASWA 2V67A 4C98A 4F4ZA 3QGPA 4NLSA 3O6QA 4FJNA 3HHLD 2DISA 2DHGA 3BZQA 4DN9A 1E6YB 1F0XA 1MW7A 2YNFB 3GIKA 4FWLA 1MG7A 3VEYA 1HD1A 3DRXA 4LBHA 3M8SA 2A3JA 1VQKS 3DDKA 2ROGA 1RBAA 4BRNA 3WQUA 2F4VK 4PWDA 1U8WA 2YKMA 2LCWA 1T95A 4YB5A 4NLOA 3UR0A 1DGKN 2E88A 4FJ5A 2QMWA 1OWXA 2H48B 4DJBA 4ED6A 4ZIVA 2UVRA 1FJCA 4GKJF 3SSSA 3KJFB 3W60A 4CJRA 1XIQA 4HLBA 4X62J 4QR1A 4ECRA 3PIPQ 5FPEA 4JI5J 4O44A 2UU9K 4B3SF 3SQ0A 4IO9L 4OYAA 4L6V3 3D6HB 3PIOL 1KQKA 1MMLA 4B3RF 3BQ0A 5T41A 3IMXA 4IFVB 5H9FJ 3VCDA 3T9ZA 4CH7A 2YXLA 3DLLQ 4IOAQ 2VOOA 1S6OA 2ASMA 2PA3A 4EYHB 3KK3A 3BV8A 5DG8A 1HI1A 1FWKA 3L4BC 4TU9A 4RNFA 2ZVIA 5L1KA 1FDDA 1VSFA 3DXKA 4PWWA 4GC6A 1AUSL 2CJAA 4CJSA 1C6VA 4MIAA 3KYLA 1F2GA 3EE9A 5BYQA 2P9NA 4YP3A 4QWDA 2OMLA 1RT4B 3H45C 4IRCA 1JLCB 2M4MA 1ZAXA 3KWMA 5EHHA 3AJ2A 1RA7A 1PAEX 3GG4A 2EFQA 5M2UA 4DS5A 5DDRC 1R8CA 5E3PA 1D8YA 2HHHJ 3R1HA 2GWJA 4U67Q 1WHYA 1M5PC 3GFHA 2H4YB 2AV5A 1J5OA 2C22A 4H4OB 2VPZB 4CBXA 1X1PA 4H0YB 1WSFA 3CCEN 1DFDA 3OYEA 4CEOA 4HH1A 4FJ9A 2YPZA 3TW0A 3EE8A 4IWVA 4WF9L 2O8CA 4PKGA 2HHXA 1T8EA 1S1WA 1N36F 3RWUA 1HR0K 3RAQA 2MKCA 1HQEA 3CJ0A 2NUBA 2MLXA 4K2XA 2XI2A 3C15A 2M2BA 2XMWA 5AZJB 2CQ0A 1D4XA 8RUCA 1UPPA 3C8YA 4DFMA 4IEEA 1T05B 1Q4RA 1ICEB 1WELA 4YR0A 1NGFA 3MWPA 3FK4A 1RCXB 4C4WA 3D1QA 2VWKA 2AGPA 4LRCA 5CYQA 3D4JA 2KZMA 4FZZA 2AYEA 1VQPS 4MJKA 5F8HA 2VA3A 4ZCKA 3NKYA 1URNA 4JKAA 2EW9A 4OL8A 4HYKA 1XR5A 1BI4B 4G1IA 5F8LA 1ZBUA 3MM5B 2FJDB 3DOKB 4AH9A 2OJ3A 4A48A 5IQQA 2W6KA 3H3NO 2ZH5A 2H54B 4C8KA 2PZSA 4IOCL 2LU1A 3HRGA 3T5HA 4B3TK 5C2DA 2D0CA 2IAJB 2DYAA 4KHNA 5D78A 4K0KF 1H7WA 3FRZA 4FM0A 2ZOFA 4QPXA 3IC1A 3KIOA 3ASMA 3U6FA 3CD6N 2J6TA 3W2WB 4ETXA 3CDWA 2DNRA 1FK9A 3AOCA 4JI0F 5T7LB 2XLJA 3K5MA 4YR2A 5A8KB 4CLSA 2HWIA 2HVZA 3L4QA 3ITHB 2QN6B 6AT1B 1QVGR 2E2PA 3ILIA 1KLMB 3H2UB 2V2VA 3O9UA 4TYBA 5KFYA 3EZUA 4DOZA 4CHPA 1DLOA 5IV3A 2FYXA 2H3GX 4WCEQ 2F9JA 4KTZA 3RBEA 4O8KA 3NAEA 4RPFA 2MZSA 1H72C 3VALA 3PHEA 3OXGA 4K43A 2AEJA 3TR8A 1KOHA 3H2LA 3SJHA 3TJ9A 3HULA 1G4CA 3R1XA 1EKEA 3IUCA 1DTQB 2MLZA 5KFBA 2DNYA 1S59A 3LPEA 3QZ8A 2NYIA 3DRSB 4QWEA 3BEGB 4ID8A 3VN5A 2M8DB 1PC5A 2YX4A 2C3YA 2ZH1A 1GMUA 2XYPB 1GLDG 3NF6A 5BR8F 5KFIA 1J27A 2YNGB 3Q7CA 3BR8A 2HNYA 3NNAA 3MN7A 3GJQB 2EC2A 4DU1A 5HROB 4K59A 2HBMA 1S7IA 2E1RA 2CH5A 3CTRA 2KKZA 2I38A 3MMAB 2Q1LA 4YQWA 3TABA 2X6SA 5ETKA 1LWCB 3CMEN 3NOGA 3OR1B 1XMQK 5AQHA 2RQKA 3DMJA 1KD1T 2KFYA 4RW4A 2O8DB 3TZYA 3D9BA 3BO2A 2AKWB 4DV4K 4IOBA 5GMDA 3BZKA 4NO7A 1FFSB 3U02A 1XNRF 4A46A 4CE9A 2O8FB 2LQ8A 2MKYA 2F1FA 3TOQA 3PYFA 3RBDA 1VIXA 1TUUA 3ZZRA 4FOIA 2E1ZA 3CDBA 1N34F 1WJ9A 3UE5A 4FF1A 4ZS6A 2B6AA 3M32A 3EGZA 1VSLA 3W8GA 2J8AA 3A5NC 2LVWA 4GMKA 2DKOB 3IRWP 3VAMA 1KVCA 3OSPA 5C42B 1ZBIA 3KUGA 1CC8A 4DL0C 3KK1A 2I5JB 1FNOA 5AQQA 2FQQB 4NCAA 4P2MA 2E20A 2ERRA 4UZBA 1HW9A 3DU5A 5LXYA 2HNZB 1U1QA 2AA4A 2B9WA 2IVMA 1W2BM 4ID5A 3PX6A 1NZAA 1MNEA 4KPCA 2CDRB 2CQBA 1FKPA 4IKFA 3VGKA 5K8MA 2HZAA 3AD8C 4BR7A 4BQZA 1CS4A 3CMQA 5KAKA 3ZYYX 3TZZA 2PC6A 1T9UA 4LF9F 5IOLA 4OGEA 4ZK7M 3QWPA 4LQ9A 4N76A 2WHOA 3LANA 1SJQA 1YG0A 1YGYA 3BQ1A 4AHSA 5IT4A 3W61A 4CLUA 4TU7A 1MROB 2EHGA 2QWRA 3OYMA 2LEAA 4U6PA 4DCJB 4CIOA 2YQ1A 4PG6A 3OS0A 3MUTP 3TWHA 1YSJA 4BRDA 4LF5K 1X7VA 2FIUA 4ZHRB 3L8BA 3ET6A 1C1AA 1OS5A 4NYFA 2KHOA 3P49B 1RAAB 1NJXA 1YJWN 4WPAA 5HBMA 2HWHA 5EN1A 1IBMF 4CRJA 2ZZTA 3BJYA 2YCHA 3V5RA 3IS9A 2DGVA 2VFRA 1OMSA 3GE1A 4Z7CA 1IKYB 4OX9J 1RTDA 1VMBA 4BG8A 4PUOB 1Y3KA 5D3GA 3L7PA 4DTXA 3A8YA 2QA1A 1UPMB 2N82B 3NY0A 3LP3A 4C1NI 1WD6A 4AHTA 2J0XA 2MHEA 3M2RB 1U49A 4OX7A 4RR5A 3HJVA 4BDPA 1RT1B 1RDRA 1UFWA 2RN2A 2VPYB 3W5XA 3NGTA 2DRBA 5JMVA 1NJIO 4E7IA 4UQGA 4B9MA 2DNZA 2ZC3A 5ETQA 1VLYA 1TYQA 1WB9A 2DNNA 4ED4A 3SQ2A 1S77D 1MWKA 1I94F 2V51B 2OPPA 3EWGA 5FPMA 3QAEA 3T6BA 3OY9A 1R0AA 2XY8A 3CCQS 3OYAA 4CJLA 1C0GA 3E9OA 1YI2N 5JVGQ 1A9NB 1NMDA 4HH0A 4NXMJ 4ED2A 1M5HA 2JC1A 3LDLA 4HCBA 2NLWA 4DCPB 2GJFA 4WU2A 2YJEA 3VAGA 1VSEA 4X62K 1M1GA 4W90B 2NLXA 5F0XA 2F65A 5CZ2A 3CFPA 1NBWA 4B8AB 1KC8O 3V6HA 5CE3A 4XDDA 5KFFA 2N7CA 2GW8A 3DYAA 3G82B 2Y1JA 3QEPA 3MMCA 1UFLA 2HSEB 4PG7A 1CBKA 1WEZA 1QAXA 4FKXA 3KHLA 4QIEA 4H0XB 2WSFC 1LCUA 2W8KA 4PG5A 1X9MA 1AFIA 2QX0A 3WQPA 2FY1A 2LECA 2GJ2A 3ICLA 4PXEA 4NA3A 4FBUA 4XPCA 2EPIA 3G8TA 1IVZA 4ECYA 4B1VA 5GMEA 1FE4A 4DFPA 2ZITA 4LRDA 4UY8T 1ILYA 1WI6A 2ZDPA 2VCPA 1IR0A 1WAJA 3SMPA 4BRPA 3LP0B 5KTQA 1R6YA 2KG0A 4JAXA 2BABA 2B5JA 3A8KA 4J7CA 3FBBA 4CBUA 2E7WA 2DNGA 4QZVB 1JLGA 4OI2A 2UUCJ 4IFYB 4Y1CA 1WORA 4O3RA 3KWGA 1R43A 3NCPA 2HHSA 4XIUA 3OYBA 3CSKA 4FW2A 2JZ5A 1RDUA 1HKBA 1QVFM 1QLNA 2PDAA 4LF4F 4JK8A 4BC5A 4BGBA 4H5TA 3TEHB 1TZ0A 2VBWA 5LT5A 3D2EA 5ITHA 3B4DA 1RHJB 2XSFA 2V63A 2J6SA 2C1EB 1NGIA 2W9BA 4BQLA 3M2VB 1UP1A 2AU0A 1DY3A 3SUPA 1Z1ZA 1NEEA 3TUZC 1RT6B 4B3MK 3V9XA 1Y00A 4ERDA 3S3NA 3QEXA 1NAQA 2BE2B 5HP1B 4YOTA 1SQGA 3MZIA 1JCEA 4H8KA 4AQYK 5DRKA 2G13A 4ZVTB 4V19S 1Q7LB 4CHYA 5J2QA 1RU1A 1RLCL 5LL6Z 4X4PA 5HRRA 1FWPA 1IBKK 1APSA 5G0RB 5J2PB 1FRIA 4BY9C 1H2UX 1JWWA 3HP9A 3THWA 3K5PA 1JB0C 1MSWD 5JLFA 5GAEP 4YUDA 2HPUA 3NNCA 4PA1A 4DFJA 4OPHA 4PQUA 4ZN1A 2FJAB 4DCOB 3RJMB 4ED0A 2ADCA 3FQKA 5CHIA 1YJNS 5AQSA 5F9LA 1R8PA 3MAHA 2J7KA 2E5LF 3ZCMA 4JUZA 2D1KA 4I4BA 2ZH4A 1TKZB 4CFAA 4FWSA 2ZE2B 3MDFA 2B8QA 1Z05A 4DV1F 3K5OA 3DU6A 2HRTA 2MKJA 3TX8A 3D7EO 1W7WA 3D7SB 1VQ9S 3MR5A 2EFNA 3TAPA 3V9ZA 5DG9A 3SJJA 1NSPA 2ATLA 4W92B 1D9AA 5F2RA 2DJWA 2HBLA 2LDYA 5AJ3J 1NHUA 2ZWHA 4CJFA 1PIEA 3CXCR 2N3LA 4EMDA 4FM2A 1XTZA 2E9ZA 3VVTA 1PAUB 1QHTA 2YNIB 3ZX2A 1NHKL 3Q8QB 2C2DA 4FN5A 3LDQA 1FJGK 1TR0A 3FGUA 4EFHA 2A3ZA 5KFNA 1UJ5A 2RU9A 1D0EA 2PY5A 3QJPA 4QWBA 2HGNA 4ZVOB 2LXFA 2E1PA 1K8AT 3MEDA 3TQ1A 4BC9A 4BC2A 2IGIA 2VQEJ 4NLDA 4M3XA 1YKWA 4FJIA 2QV6A 3PJWA 4O0IA 4DR5J 2DRAA 3PR4A 4ZPVR 2ZWOA 3H1QA 3KJQB 3F0NA 1LW0B 1TK0A 2ZQBA 2FSJA 3EO3A 2DFHA 4CD1A 2ASDA 2P5VA 1DAXA 3SBMA 1M90O 2GJIA 3KK2A 4YNQA 3WHIA 3IDHA 3R1LA 2WCXA 2P9SA 1IJEB 2LXIA 1G15A 4EP5A 3ISNC 5LSRA 1I3AA 3FEYB 2IM0A 2KTQA 4JI1K 1S1UB 4CZGA 2RIJA 3CDUA 2J6UA 3QINA 2BJ9A 2DH9A 2PMHA 3I55S 4DX7A 4GKJJ 2FJVA 1C1BA 4Q0BB 3FMBA 3HOSA 1CVJA 1N8RO 4LT6A 3M6GA 2VFSA 2PFDA 4NL5A 2I9SA 4DR7F 3EXCX 5A76A 4B3SJ 3V1QA 1CZAN 1HNZK 3C14B 3FFIA 4DV3F 1T03B 4DHVA 1MWZA 3A8JA 4YB1P 4PCQA 4FF4A 3MCSA 3TPQA 3LWLA 3MM6B 2GVZB 3NS6A 3FCHA 3A3OB 3TUIC 3DLHA 3E01A 4ZCIA 2BEFA 4KBIA 2W6LA 3OYCA 2DCLA 3F41A 4LF2A 1JMTA 1HNVA 3IFEA 3QFPA 2HS0A 2YBVA 1HBOB 5AE2A 3FRYA 4OJ3A 2NZTA 2H5IB 2V4JA 3O80A 2HIYA 2DNLA 1NDKA 4PQAA 2MY8A 3QEWA 3TVZA 4B9VA 4A8KA 4C8YA 1LAWA 4HACA 4IFVA 1HLUA 1CJVB 1ATNA 1ULRA 3VTIA 2HW3A 2G4BA 1RHMB 3BSAA 1LK5A 4URSA 3AARA 5AQJA 2OANA 2WOMB 2DNQA 3ENAA 3SCKE 2V2KA 3AOAA 3H6EA 2VWBA 3K0JA 5EDWA 2HS4A 2YKNA 5BJRA 2ZEJA 2GTDA 4KKOA 4ZCLA 2D69A 3CJ4A 1KVAA 2O01C 4JI6K 3AOBA 3ULDA 5CD4A 3WNGA 3K8VA 4A4JA 3CF5L 1S0MA 1N36J 2P51A 1Q78A 3S41A 3C7NB 1RT4A 5DZ6A 5F41A 1GTEA 1WG4A 1TFWA 1EQYA 2X74A 1YWXA 4HDHA 2WAQD 4JHDA 4K25A 5LY3A 1TTHB 3VF2A 1WI8A 5LMNF 1VHFA 4A59A 4WQ4A 1SXLA 3CM6A 4BE0A 4OX9K 2QA4G 3EZWA 4WK1A 1REVB 1O51A 4B8CA 4ENOA 4QR0A 2NZCA 3HL8A 3ZO7A 4DU3A 2UVWA 4QOTA 4E98A 2OTLS 4NX9A 5C0YA 2C2EA 4JI3K 4FWKA 3R5AA 3IBWA 1X0PA 2XO7A 4BR9A 1S1XA 4ZJQA 3TZWA 3TARA 1T3VA 2RT3A 3CVKA 4CFDA 3CPWR 2ZZNA 4ILLA 1Y10A 4KFBB 2UUAF 1SCJB 2NRTA 3BN4A 5LSOA 3SQGB 4LF7F 4LJMA 4MIWA 1FI4A 3CJ7A 3E3XA 1VISA 2HHUA 2MY7A 4X66F 2O8BA 2FVPA 1T05A 3R6LB 3ZC4A 4PKHA 2RHKA 1YJ9S 1X0FA 1HNWF 4IG3A 2W4DA 4DU7A 1QDUB 4H0TB 1NKBA 4LFAF 2FHKA 2ZKUA 2HQFA 2BTFA 3MN6A 4CEFA 5KFJA 4K0KJ 3CCZA 2CKWA 1U2RA 4DL6A 3CJ1A 2F7TA 4JKHA 5IM0B 2XTJP 3N5BA 4NWBA 1WKJA 4XTTA 4L8RB 1DQAA 2WTFA 1D5AA 3AH6A 1U1KA 4JI0J 2BJ8A 3M9MB 1R6VA 1BI4A 4JI8K 1GLLO 5CZ1A 1RADB 2V2ZA 4X65F 2EFGA 1RHKB 2O3DA 5AE3A 2ACYA 4U7BA 2GIQA 3Q2TC 2G0CA 4BR4A 4JOUA 2DB1A 3CYMA 2NYHA 3CWJA 4BHQA 5AQPA 2FJEB 4DV6K 4OPJA 4K4YA 2XB2D 2YI1A 3QICA 5CYMA 2M52A 4C8OA 2P9LB 1V3ZA 2RD5C 1UZDA 4TXSA 4O8UA 1XMBA 4A8MP 2XGPA 1IBLF 3M1VA 4YDUC 3HZEA 1Q5YA 4RBTA 4CP5A 4RW9A 4DN0A 5AXKA 4MQ3A 5BR8J 4W5OA 4O3QA 2BMBA 2MQ8A 3CJ5A 1KLMA 1BWFO 4DPYA 3H7HB 1FEEA 5KT4A 4LF6F 3CJAA 4A61A 3P5BP 4Y1DA 3ATUA 2DTJA 2HAIA 2QZ8A 5KQDA 2ACMA 3BZCA 2Q1NA 4IBNA 4ZA1A 3BGOP 2IRUA 3VAFA 1RAFB 5FROA 4WFBL 5HQMA 4KJIA 1K9MT 1CG2A 2V2QA 1KLNA 3JYTB 1FX2A 3CC4N 4NCBA 2XHBA 2OA8A 2LEPA 2IC3B 1XNRJ 3AA9A 2QC3A 3SUQA 5HQ8A 1C0TB 1RWMB 4OZ5A 4ISFA 1RAEB 1VQLN 3ZNJ1 3CFRA 4OPKA 4HHHA 5E3RA 1N34J 1RAIB 3KJVB 4H4MB 4GRSA 4FCYA 4L72B 4OYOA 1NDLA 2D0AA 4GKKJ 3BM7A 3IRXA 3WNHA 3T3FA 5HROA 2A2DA 4JD2A 1RSCA 3HVTA 2W1BA 3OR1A 1B99A 4TKTA 3SXLA 1HIYA 2HLTA 3D0IE 4USTA 4FL9A 3AVAA 3L2UA 3Q22A 1L3SA 4DKWA 1B7YB 4E3SA 3U9ZA 3M6UA 4B1ZA 1MN7A 3KUHA 4CW7B 4C11A 1KOOA 3U3GA 1UKUA 4XPEA 1VQ5N 4RWWA 3SV3A 5AT1B 3S7RA 1L5UA 4P74A 4JKCA 2NQPA 3E8OA 3EN9A 4CCHA 1YJWS 1NK8A 2ZJQL 3EL2A 4F25A 4C8MA 2XYHB 2JEIA 4LF9J 4C0OC 3PRDA 2GX9A 5CZXA 3T7ZA 3QO9B 3FFKB 2RQCA 4JS4A 5A6WA 4Q43A 1K8KA 3HZGA 4K4WA 3EGVA 4ELUA 3ZZZA 3MMBB 1LWFB 1CULB 1VQMS 2QO3A 1RYSA 3OV7A 2VC0A 3V6JA 2XZWA 3LTOA 2AYBA 2P5GA 3CT9A 2PEHA 4X4RA 2CQGA 3DHXA 2HBZB 3FBEA 3WNFA 4HUGA 1RTJA 4H0OA 5GADP 3RMBA 5AFUA 4DB3A 2UXCF 1HPMA 4FS1A 2ZHOA 3SSRA 1V5VA 3K8WA 5MLCV 3KTQA 1VK0A 4XH4A 1IBMJ 1V6HA 1HR0F 1IXKA 4I2PA 4KR0B 1X4HA 3QBCA 5F8IA 1FF2A 2QFJA 2PO4A 1PYSB 2MPUA 1EKSA 3LPTA 3L2QA 3OR2B 5C25A 1BQNA 1WF0A 4M94A 2EG1A 5J2MB 4CM0A 4F4WA 2CPYA 3KWIA 1FTRA 2CVIA 2ZNYA 2M7SA 4WTOB 1GNKA 4YS2A 1VQON 3J7ZT 2W2MP 1A7GE 1E6VB 4M3TA 4OHYA 4WP9A 5JS1A 3B82A 2DGSA 3GOIA 1XC3A 3KK7A 4GV9A 5KOWA 3H8YA 3DOLB 4YY3F 4I6MA 2DCUB 2IIHA 3OLAA 3JSMB 4K4VA 4X64K 3GIMA 2P9UA 1FJEB 4ECWA 1N48A 3DFEA 1I94J 4CK2A 2N4DA 1XMOF 4FLVA 1SC1B 4J9NA 5A8RA 3BO3A 3LPUA 5L9XA 4DTNA 4J90A 2G8KA 5JVHL 1I6JA 3U1LA 4B3TF 3NF9A 2GEMA 1N5VA 1W7AA 3R5BA 4M5LA 4MT1A 3UN3A 4M3ZA 4TYAA 3SDEA 2V34A 3QEIA 2L9WA 2D1CA 4NA1A 3I8BA 2N7YA 3KD5E 3HJFA 3HFVA 4PABA 4ANCA 4GW6A 4JRQA 2DR6A 2A0FB 3PRVA 4W5TA 3LH2S 3UW1A 1U02A 2H9ZA 2Z4PA 3EEQA 2X3GA 4FYYB 4FPAA 1EQMA 3BDEA 4QQBA 1YHQN 1X5PA 5DQHA 2LEBA 1RT2A 4B3RK 3AVMA 3IAS9 1KFSA 2UUBK 1N0UA 1Z6RA 4NLVA 4H5RA 2WW4A 2HZCA 4M3YA 4L75A 2D5RA 2B4PA 2JDJA 3TSUA 2H1YA 3A13A 1TK5A 2HQCA 3GDQA 3AA5X 3IAM9 1T44A 3HXMA 2HAFA 1JKHA 4X84A 5JLHA 2V52B 2PE8A 3AD7C 2W4CA 5GIPA 3AO5A 2YHXA 3PIOQ 2BKNA 4FK4A 2ILYA 5LOQA 3G82A 1T9YA 1ZETA 2V7ZA 1FEHA 1KHVA 4C23A 1UVKA 4G65A 4BR2A 3KNGA 3MGJA 1IKWB 1I5OB 3NBPB 2AJ1A 1VSJA 4KHYA 2OEKA 3J81j 1Y9OA 4DL2A 1G2EA 1UCNA 3LAMA 5H1SQ 2GGPA 2MQLA 2Z2ZA 4TU8A 4PWUA 3PDNA 3Q0AA 5HI7A 2E6LA 1U6BA 1UFKA 3ZTOA 3A12A 1K47A 3A3NB 1RAJA 4LF4J 4A62A 3SAFA 2A1BA 3M8QB 3VQ4A 2LQJA 4DV4F 4F4XA 3M8YA 4ATNA 3K17A 3O3FA 3T1AA 3JSYA 3DDIA 4WQ5C 2DBBA 2ZH3A 2DXEA 3LP0A 4N5SA 4ETZA 4DR3F 1B64A 2RPIA 4JK7A 4QWAA 4OLOA 4TY8B 3P4UB 3IBCB 2LA6A 1C0UA 1GX5A 2PN6A 5KPZA 4DEZA 4M5NA 3SCLE 4RW6A 4N47A 1KAYA 2E29A 2GQCA 4JI4F 3H59A 1GTHA 2EK6A 1LXJA 2POKA 2P5OA 3THYB 2GO9A 5DQIA 4JKBA 3EXYA 1IH7A 3ZT3A 3EY1A 5B7WA 4Q44A 3OFEA 2CGJA 3H1VX 3PRBA 4DQRA 4I9QA 1MDUB 2JFKA 1GOCA 1WKKA 4ICLB 2QL7B 5CHCB 4QIWD 3O4QA 2QKBA 1KRPA 4FPIA 3V9SA 2W9CB 1L3KA 3MMVA 3G4SS 2GHVC 4PYAA 3VZIA 3BN7A 4ZVQB 3CIPA 3RUBL 3UR3C 5JMNA 1WC1A 3I31A 2E5LJ 2M3DA 4K0KK 2YH0A 2JVOA 1B0TA 3O4WA 1X60A 4GVEA 2CIMA 4CO3A 5HVGA 2J76E 3OHRA 4UQTA 5HVFA 2MKSA 3OFFA 1S6PB 4IOCQ 1S1VA 1SC4B 2AEFA 1WC6A 1P6TA 3HVAA 1N5YA 3CCSS 2F8SA 3AO2A 1U1NA 4LF5F 2IA6A 2F8MA 2IDOA 2R7WA 4U7CA 5GAEI 5EY4A 3R3TA 4OZLA 5IXUA 3GBTA 2IYGA 3VTHA 4C1NK 5CD4H 4WJBA 4LQ3A 3L0QA 3ULEA 4DSEA 3BS9A 2XY5A 2QEXN 4DL3A 2PBDA 2KHDA 1HHQA 2HNDB 5DZ7A 2WFBA 4MKVA 4GVLA 2XHWA 2JEJA 1HQUA 1UWAA 4FWPA 3ZTPA 1F9FA 1W2BR 1HJRA 1RDWX 4DV2K 4QU6A 1FESA 4CLWA 1YBTA 1WTBA 1JL1A 2QRRA 3GJTB 2Z8QA 2B8PA 2I0XA 1BO5O 1JLAB 1QZ5A 4FJLA 2RF2B 2NSBA 3SYZA 2GCFA 3MM8B 2O4IA 1CJKA 2G2ZA 1AZSA 1RT5B 4UOFA 2V8PA 4KBOA 4FJMA 2K1RB 2RRBA 2DR8A 2G8HA 1EX8A 3KOAA 4JI2F 3KKSA 4RUHA 3CCMN 3E1YA 4CEEA 2FC0A 3FVYA 4RUCA 1WDTA 4FYVB 2D3ZA 3PACA 4PRFA 1O6XA 3Q8YA 4FF2A 4WE1B 4WIIA 4QYRA 4NLCA 3NCRA 3AVJA 4DSIA 2CPXA 1HHTP 2P9EA 4TLRA 3M30A 1AROP 1XNQK 2XZDB 4K4XA 4RJVA 3M3ZA 3I8DA 2E9RX 2HEKA 5A0YA 2VG5A 2NNWA 4DR7J 4G1QB 3WXLA 1EIYB 4XEIA 3S9HA 3V4IB 4DV3J 3A8IA 1TKXA 4F2SA 4WBFA 5J1NA 5F3TA 3DOMB 5CA5A 1VLOA 3TJAA 1D1UA 1S1UA 5E3QA 2UXBK 2R3VA 4CM2A 1BA1A 3MF5A 3OTOK 3K9KA 2ZH2A 3QIOA 4HT5A 4Q7AA 4O0JA 1U4BA 3HX9A 2OP5A 4LSLA 4RKUC 4BC4A 4AM7A 2JJ4D 3M8ZA 2MLYA 3OVNA 4YEAA 2VHGA 3M2UA 4WQ5A 4CJKA 1S48A 3T5KA 1ZYQA 4PHTX 5LJ5Y 4HUFA 5HVHA 1T03A 1OYDA 3AVGA 3FEZA 3ELHA 4B3OB 4I68A 2CVEA 3LP1A 3EKUA 4ZPBA 1VQYA 2J7UA 1BIUA 1X4AA 3V4MA 3EICA 4PR6A 4ANDA 2G8VA 4H0VB 1I3OB 3R6MA 1KFDA 2LU2A 4CLZA 4ELVA 3WBZA 1HRHA 2IRYA 4EO8A 1XJWB 1KDNA 3KLHB 3PY8A 2K8GA 4KO0A 4DPUA 3CC7S 5DETA 1J2VA 3FKBA 2VB6A 3F44A 2MQQA 2DO0A 1WSRA 3THXA 3TJ8A 3TAEA 3IGVA 4QWCA 5LMNJ 5BPLA 1VQ4N 2R8IA 3O8WA 4B1YB 2FVCA 1GOAA 4KH1B 2CQ3A 3QNWB 4N41A 4DG1A 5A8WB 2IMOA 2KXHA 3SBGA 2WOMA 2F40A 2KU7A 3AAQA 2ZGZA 4IG0A 4CLLA 4J9MA 2RDIA 2ZHAA 2D41A 1SQFA 5J2NA 4G3IA 5TKYA 2F8HA 4AQYF 1KVJA 2B0GA 2UUAJ 1XR7A 4LF7J 1IBKF 4EEYA 3OTBA 4ER8A 1RDAA 1K6YA 3H08A 4M5DA 3IO1A 4X66J 2NRXA 3N79A 4DV5J 1REVA 2R7OA 3KG0A 2UXDK 3MOJB 3SAHA 4LFAJ 4CNYA 1X9SA 4QCLA 4HI2A 4GC7A 1YVNA 1ZAWA 2VG6B 1RABB 1DQ8A 2XO6A 3KLFB 3AVBA 4FLWA 2LQBA 2BE7D 3MR3A 1R31A 3GE9A 3O9QA 1QVFR 4ILHA 3TZXA 1RE1B 1UL3A 1SJ4P 2AZ3A 1NM2A 1FFGB 1DURA 2D0OA 1TUYA 3T1HF 1S1TB 2V5HG 4X65J 3MDQA 3OHBA 4YOVA 1KVKA 2JX2A 3C6HA 4OZJA 1S5ZA 1BL3A 5F1XA 4XAKA 2O67A 2DGUA 3T69A 3VGLA 4BLGA 4KHRA 2KL8A 5I42B 2CYYA 4IDKB 1FFWB 3PFEA 2G8UA 1NPRA 1WSHA 3SBTA 1FVSA 2D3OR 3OTDA 4BRHA 3HPGA 2GS8A 5AFUH 3MXIA 1KC8T 4EBEA 3QGHA 5M1PA 2DGQA 1MWQA 3B6PA 5K8NA 3CD0A 1OY6A 4BDZA 2Q97A 3TP2A 4JKGB 4KREA 3QQCD 1TV6A 3ZZOA 1VQLS 4FYXB 1TK8A 4GNIA 1EZZB 2XY7A 1NSQA 2R7VA 3UDLA 1CJTA 3LM2A 3SQOP 3HF5A 3LAKA 2PI4A 4CJPA 3QEVA 3P6YC 1TKTB 4LF6J 4KGVB 3GSIA 1LW2A 3D1OA 1X4DA 4HI1A 2ZJRQ 1TL7A 3W2VB 2DITA 1MU2B 3NF8A 3JTPA 1FNXH 1KCFA 2P9LA 3LDSA 1LOUA 3B6BA 3U9DA 4Z4FA 1PYOB 2OPRA 3ISND 4F8RA 2HQIA 2XI3A 1CLQA 4LSNA 3THVA 4LF4K 1VHXA 4EBDA 2O5DA 1EAYC 4USJC 1NJYA 1KHWA 3ILJA 1N54B 1VRUA 1Y5LB 1B92A 3F73A 4M95A 4FSVA 3EJMA 1VI7A 2DPJA 3PG9A 1C2PA 4OPAA 4JI1F 1UJ6A 4KPYA 4KB1A 2KI2A 4K7QA 1ZM2A 2HB5A 2HVDA 1FD8A 1K44A 2IHR1 5L1IA 3UDEA 2YX6A 1HNXK 2R7RA 4NPOA 1FRLA 2Y1IA 2DO4A 4ZLJA 1OY9A 2IC3A 1WSIA 4AF1A 4C0BA 1HNZF 2YQ0A 4XH5A 4PEOA 2HYIB 3IN5A 1C0TA 3ZT4A 4EGLA 2H3EB 1JJ4A 4H0PA 3AGRA 1E4FT 1NM1A 4OLAA 5KG2A 3OTEA 1HYVA 3DGPA 1YZ6A 3KJVA 3ETMA 1RYRA 1R7IA 1LOTB 2W7AA 2CJ9A 1FA0A 3S3MA 2B4VA 1YITS 2C2NA 4USHA 4BRAA 5DM7L 4CGDA 4B08A 1RQ0A 4DU8A 3OPKA 3QFHA 5GAGP 3O6WA 1Q0NA 4IOXA 4MK9A 3KUEA 5D4OA 2X1AA 3FC9A 1CLFA 1BXNA 1WBBA 2OELA 4ZVHA 2E5LK 2A6AA 1HPZA 3Q7BA 3FNNA 2RS2A 1YLXA 2VA2A 3M7VA 3K5LA 5E5NA 2ZJPL 3IFRA 3CNQP 3HO1A 3G71N 3ZXWA 1QE1A 3OL8A 3SCIE 2EFVA 2K3KA 1Q9XA 2GC8A 3NL0A 1OY8A 3MM7A 5I3PA 4DV1K 2ZC4A 1TL4A 3DRRB 1NRKA 5A2QY 1E4GT 2Q79A 1AT1B 4E7KA 1BUPA 4CWBA 1TU0B 4JI6F 3NDKA 5HMZA 5AQRA 2VIHA 1HR0J 1SQEA 1JK9B 2UP1A 3L95X 4CJWA 1HBUB 1SI9A 1SJ1A 4WFNQ 2BOAA 2MZ1A 4DQPA 3R27A 5FIIA 4CO4A 3M5RA 1BISA 4BCAA 4W98A 3PIPL 4O55A 4EYIB 1W9HA 3JTOA 3CFOA 2BQ3A 2R2SA 3UVJA 1V3SA 1UVJA 2YWHA 1JQGA 3MECA 3C6AA 2ZH6A 3CQ8A 3PO4A 4X4QA 3HVWA 3VGUA 1NUEA 4Z94A 3RW7A 1YXQA 4YY3J 3DLLL 2EBGA 4LFCF 2FDNA 2R4FA 5KFOA 1YHQS 3MEGA 1RHQB 2I2YA 1WSGA 3ENBA 2GQ2A 1KAZA 4M8LA 1RWXB 3DNCA 2FB0A 2Z58B 2FZCB 2HZVA 1E6VA 4CZEA 4CERA 3PUFA 5ELZA 2BANB 2G1DA 4B3TJ 1U2VB 4CJ3A 1YJTA 1FW6A 3Q23A 1M90T 3C0BA 1RXOB 1V4SA 3NE6A 3MM9B 4M1KA 3NGSA 2HGLA 5EXWA 1DARA 3TA1A 1XEZA 4FZVA 2P2CB 1TL1B 4Z4IA 1KQSR 2BA9A 4DV3K 4MAKA 4R8UB 1HW8A 3PYEA 5T7BA 3WX8A 2FC9A 1N8RT 4OHWA 3MX5A 3NVKA 3PM9A 1A0OB 3V81A 2XGQA 1G3OA 4DV6F 4CF2A 2E44A 3CCQN 4CZMA 2GMHA 2CUYA 4UZCA 4K8RA 2DHXA 4PPDA 4EZ6A 3LUYA 3MOZA 3UQSA 5AQMA 1WOSA 1S79A 2B43A 2DNMA 4KHPK 1RTHB 3DAWA 1JXLA 5LM7E 2J4RA 2DRDA 3RAXA 1WOQA 3TVYA 1W26A 3QRPA 2JC0A 3VQDA 1XMQJ 3X1LB 3N4WA 2ZD1B 2F9WA 4CZKA 2FBYA 3UCUP 4NLYA 4DV4J 4PYDA 1FRMA 3BSNA 3SMSA 3MTKA 2Q3PA 1R27B 1GH8A 1BQMA 3GP9A 1V4TA 1Z25A 3MUMP 2DFEA 3NRBA 5HMYA 4DR3J 4M63C 3QWUA 2ZM6F 1NNEA 4J37A 1XR6A 3JAMY 3OA9A 3UKUA 1MLAA 4OIXA 3KLIB 1VRQC 1IQZA 3LP2A 1SIWB 4GVBB 1DTTB 4JI4J 3FZFA 2ZBQA 1Y4ZB 4J9OA 2Z1HA 4IH7A 2X78A 4JYAF 4LIWA 3EVMA 2QT7A 3OYIA 4AHUA 4EFAC 1U7LA 2D4WA 2IDEA 4YHHK 3PYDA 4BE1A 4KB7A 1KNZA 3UIQA 4DR1K 2UUAK 2AYMA 4WCEL 2M5YA 1GLBG 4RG8A 2OPQB 3NEKA 2XS5A 5KFMA 3GG0A 5B0EA 3CJKA 1BDGA 4X66K 2XSJB 1CJUB 1ASVA 2ZBRA 1HNWK 3OVBA 3CCTA 1Q95G 3HHKA 3W64A 3CD5A 3KKFA 1C4AA 3WEEB 2QWQA 3POTA 3OYGA 1PJ5A 4I7FB 4DUYK 2W4PA 3VQPA 3LW5C 3THYA 1SC3B 4DU4A 4ELTA 4FDFA 4MYUA 4CEDA 1GXUA 5AZIA 1G7CB 1UW4A 2RVJA 3BGRB 3NHGA 2GIFA 1U2CA 5F9NA 4UOHA 3UKRA 1R0CB 4N7TA 4QR2A 3QBXA 3KHRA 5FLXY 2DT9A 3P4IA 3EX7B 3TSPA 1QUVA 4OFZA 3MAAA 4FJKA 4J9VA 3QYYA 4LF5J 3RW6A 2MZQA 1ZA1B 1FDAA 5KPRA 4CLFA 1TELA 5KT7A 1N32K 1S0VA 2A6MA 3BH6B 3D6RA 2ZHBA 2NZ4A 2KH9A 4CGFA 4AL5A 2VQFF 1GK8A 5BPNA 4NCGB 3P38A 1IBLK 2QLWA 3RSEA 4A8YA 4BG9A 4BRKA 2KRRA 2UUTA 1PC4A 3IM9A 1S6PA 2XMTA 3GZ7A 4KH0B 4IO8A 4OYZA 5D0HA 4F9OA 1X8DA 2E1YA 4KI6A 3O44A 4ZVSB 3GYGA 1VBKA 3CJ9A 1EB0A 5L38A 2R7SA 1QTNB 4DSJA 3Q8SB 5M1NA 1QVGM 1JLQA 2RUGA 2VBXA 1EETB 1IG8A 4OJHA 5BYSA 3BBCA 4JI2J 4WIQA 2Q0RA 3ZETA 3DLRA 1CPZA 4LFBF 2BV3A 4DTSA 4OI1A 2CA9A 2LXUA 4X64F 3EMTA 4EO6A 4UW2A 4L73A 4RBVA 4ILGB 1KWMA 2R7XA 2GA7A 2WC9A 3CJ2A 2IIRA 3H90A 1HBMA 4OO1J 2W24A 3QIPA 4BRCA 3H5YA 1IKVB 1HYSA 2OUGA 2ETJA 4EP4A 4GMJB 1RGVA 3MM8A 2VF3A 5M1QA 1ACMB 3OLBA 4B17A 3ZSXA 2VG7B 2LDIA 4Y28C 2K1RA 2PYJA 3WC2A 2MGZB 2R9LA 3CIMA 2Y9HA 3G6XA 4I67A 2MKKA 1DHMA 2OI2A 3D6MB 4Q2MA 1QTMA 1H2VZ 3BB5A 3NAIA 3OTCA 2UUBF 2Q2RA 4JKEA 4WYBA 2DGXA 5HOOA 4MFBB 3BF3A 4B9UA 2IVFB 3HMJG 1GXLA 3QERA 4NXNK 1QS4A 4E7JA 2WONB 2E1MC 1Q7YO 5IS2A 1VJQA 3EGWB 1FKAF 3I55N 2DR5A 3DM2B 3RBXA 1VQ4S 3N4QA 1NH8A 5KFAA 3CCVS 4NYPA 1LWEA 2Q43A 1UA1A 5FD1A 1ZBLA 3NFAA 4DR4K 4J8FA 4TQSA 3JS6A 2QWOA 3HI0A</