4RW9A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw9A05
3TI0A 3QEXA 5FDLB 2FVCA 3M8SA 3GIIA 2ATQA 3TAQA 2Y1IA 4DSEA 5KG0A 2OZMA 1S9EB 1N6QB 3T5KA 1HYSA 4J2DA 1RTDA 4GC6A 4I9LA 4FJLA 2RF2B 3H4DA 3VQQA 1S0MA 1WSHA 4IFYA 3DMJA 5KFUA 3AVFA 2FJXA 5KFXA 2I5JA 1HNVA 3LDSA 3VQ9A 4CERA 3AO5A 1TKDA 1JL2A 3OJUA 3LP2A 2OPSA 3M8QB 3VQEA 4PQUA 4KB7A 1D9DA 4QW8A 2IS3A 1EP4A 3K5OA 1RYSA 2XO7A 1BIZA 2HB5A 3DM2B 2QKBA 4OLAA 3PHEA 4ECSA 3IAYA 5JUMA 4HTUA 1BI4A 4KBIA 4IFVB 1HNIB 2A1SA 2HAIA 3KK3A 4ECZA 1S48A 4ID5B 2B43A 1SH2A 3V4IB 2FVSA 3UDLA 3MR6A 4M3TA 3NF6A 4FYDA 2R8KA 1BQNA 3DYAB 4Q0BB 2P5GA 3RR8A 1S9GA 2ZD1B 4TN2A 3MFIA 4OPKA 1R0AB 4DLGA 4CFCA 2HMIB 2XCPA 3AA3A 4ID1A 1S10A 2YNHA 3QZ7A 5F8IA 3KHRA 1X1PA 3P1GA 4QWEA 1REVB 4RW9A 2W9BB 2D0BA 2IGIA 4DFJA 2ASLA 3MEEB 4CHYA 3NAHA 3JYTA 3PW4A 1ASUA 4CJEA 1IKXA 3I0RB 4LSNA 5KT5A 4ZHRA 3VQDA 1RAJA 4AHUA 2X6NA 3OVNA 4DU3A 2EC0A 4ECQA 4IR1A 4RZRA 3OSPA 4H4OB 2WONA 3QGHA 3QERA 4EZ9A 3I5BA 3TVKA 3HP6A 4RW7A 4F50A 4FJ7A 4M94A 1RA6A 4DFPA 4U7CA 3OL6A 1RDRA 1RILA 2GV9A 4O4GA 2R8GA 4DMNA 2RDIA 3SQ4A 5DMRA 3KTQA 4DTNA 1KSPA 2HW3A 1FKOB 4OKJA 2UVRA 3ICLA 3BGRA 4CF1A 4FLZA 3THVA 4MQ3A 1NK6A 4K4SA 5KGXA 4O3QA 3O3HA 4RW6A 2IDOA 3AVAA 1T94A 4RU9A 3LWMA 3DOKA 3DLKA 5CZ2A 4W5OA 1S1XA 2DFEA 5HRRA 1WN7A 3IN5A 3ZT4A 5C25B 3S3NA 3CWJA 4RW8B 3MR5A 4BWMA 1RT4A 1HJRA 1JLFA 4CJSA 3ZSWA 2KFZA 1MMLA 3QO9A 1N4LA 4ED6A 1RTIA 2ZQBA 3RB3A 3LP0A 4J9MA 3RMDA 1XI1A 2QE5A 4H4MA 1CXQA 3L8BA 2Z1IA 3EZUA 4CGIA 2Y1JA 4QOZB 1HYSB 1RTDB 4IR9A 4BE1A 5KFFA 5SZTA 3OYNA 1VSHA 4OL8A 3U3YA 4IFYB 3DMJB 1HPZA 2UVUA 1SH3A 5DK5A 4CF8A 2I5JB 2IA6A 3VQAA 1NJYA 1BCMA 4BACA 3LP2B 4ZTFA 2OPSB 3V1RA 4PQUB 1C1BA 3A2FA 2OPQA 4DL3A 1EP4B 1N5YA 4RNHA 3CDUA 4DL7A 4KHMA 4RNOA 4F8RA 5CYQA 3SJJA 5KG6A 1NOYA 3KKSA 4NLDA 4HUFA 3BQ0A 1BI4B 4Q8FA 1C0MA 1RDBA 4X2BA 1RBVA 1U45A 3G86A 2QK9A 5C24A 1KCFA 4M3RA 3KK3B 4NLQA 4UQGA 3OL9A 1ZBUA 4Z4EA 4DTOA 3MEDA 1NK5A 1BQNB 5KT6A 2YKNA 4KHNA 4J2BA 1C1AA 3H4BA 1KFDA 4CHNA 4ECYA 1LAWA 3H98A 4N56A 2G8IA 1S9GB 4CEQA 3DRPA 4J9PA 2D3UA 3KNAA 3QNOA 2HWHA 4MIBA 1I39A 2YNHB 5KFPA 4JRQA 2UVWA 4RW9B 4Q44A 2ATLA 3M8RA 4FJIA 4R5PA 1RT2B 4EO6A 1L3VA 1EX4A 1ZBHA 3AO4A 3JYTB 3TAPA 4DTRA 1IKXB 4LSNB 1JLEB 5KG3A 4Z4HA 3H40A 3VQBA 1HMVA 1QE1A 4FJJA 4FZXC 4PA1A 1JIHA 1VSMA 4B3OA 3AO2A 2WONB 3SI8A 2F8EX 2IC3A 1TK0A 3CVKA 4J2AA 4J9OA 1WSIA 1A5VA 2W8KA 2FJVA 4URQU 4O4GB 1TVRA 4E1NA 1TAQA 4IH5A 3DOLA 3HVWA 5KFJA 3HL8A 5KG2A 4W5TA 3H5SA 3CM5A 1C2PA 3BGRB 3CJ0A 4WFZA 3ISND 1MU2A 1T8EA 3P5JA 4WE1A 4RW6B 2WCXA 2OZSA 1XR6A 2ILZA 2WK4A 2A1RA 2W8LA 1JX4A 3NE6A 3E01A 4DS4A 4EO8A 3ITHA 3DOKB 1D9FA 1VRTA 3DLKB 3LAKA 4YR3A 1S1XB 3BJYA 4MK8A 1CSJA 2UUTA 1RT4B 4TY9A 4LY7A 4FXDA 3GILA 1JLFB 3QO9B 3KLHA 4PY5A 3C94A 1RTIB 3BSCA 3MFHA 3LP0B 5KFNA 4EYHB 1ASWA 1WNEA 4IQXA 1CZBA 4I9QA 4H4MB 2XY8A 2XC9A 4CJUA 1K6YA 4MIAA 1UWBA 4KKOA 3EPGA 3ZSXA 3SNNA 2YNIA 1S0OA 4FJHA 1UOCA 1LWFA 2F8TA 1N6QA 1JLBA 4DL2A 1HPZB 1SUQB 2EX3A 4Q43A 2GIQA 4I7FA 3LPTA 4JRPA 4DQSA 2OPQB 4YR2A 3OHBA 2FVQA 3LANA 3CDWA 1JLGA 1N5YB 5KFOA 3OYMA 4CJTA 3GIKA 5CYQB 4ELVA 3VN5A 4FZYA 4CJQA 4O3SA 3FQLA 4F4ZA 3SPYA 1TAUA 5C24B 4Z4GA 3NKYA 1NKEA 3VA3A 4URSA 1HARA 4IRDA 3MEDB 1LAVA 2YKNB 3T19A 4LSLA 3E51A 3S3MA 4TYBA 3ZT0A 1TL3A 5C42A 4ECTA 2ALZA 5KFSA 3DRPB 5SWMA 4B9NA 2VG7A 3NMAA 3KLIA 2O5DA 3OS0A 2IM3A 4K50A 2XWYA 3C6UA 4R5PB 2ASJA 3WNHA 2YHAA 4M3UA 2HMIA 3QNNA 4OPJA 2R2SA 5T7BA 1KFSA 2Q3SA 1QAJA 4FW2A 2JC1A 1HMVB 1KVBA 1Z26A 1QE1B 1SL1A 4Y1DA 4M42A 4E89A 2HVHA 1RTJA 5KFTA 3CO9A 4NYNA 4B3OB 3AVIA 3GV8B 4DQIA 1VRUA 3K5LA 4FM0A 2W7OA 3L3UA 1KHVA 4EBCA 3H2LA 1T3NA 3CG7A 4HHTA 1NK8A 2IC3B 2IBKA 4CECA 1Z25A 4TXSA 2GBZA 4DQPA 4Q8EA 3PR4A 3RBDA 2J6UA 2IM2A 4NCAA 2UVVA 4N47A 3RRHA 1TVRB 2E6LA 2EHGA 1LW2A 5E41A 3RRGA 3DOLB 3I8DA 3KLEA 3LAMA 3KD5E 1JKHA 1RBRA 1MU2B 5KG1A 1FKOA 3QEIA 1SL0A 4WE1B 4DFMA 3RMCA 3DDKA 3UPFA 4EP5A 1I3AA 2E9ZA 2GC8A 4ZVFA 3E01B 4B9MA 1C1CA 4DSIA 3ITHB 4FK2A 3Q8SB 1VRTB 3QEPA 1BL3A 1JXEA 2JEGA 1LWCA 1S9FA 3SFGA 4FW1A 3TQ1A 2J6TA 2VA3A 4K4TA 4C8LA 5KTQA 2OH2A 1ZYQA 4DSKA 4EP4A 4CJPA 1HQUA 3MF5A 5KFQA 4MH8A 3KLHB 4F2RA 2IAJA 4B9VA 2YNGA 3TAEA 1WNSA 1I6JA 3HK2A 5HRSA 1TQLA 4CHOA 1UWBB 4KKOB 3TANA 1SH0A 1WLJA 3AV9A 2YNIB 1LWFB 3VQ7A 4BDZA 3PX4A 2BE2A 2CJQA 2PYJA 1JLBB 4E1MA 4U6PA 2W9AA 2KTQA 4I7FB 1QHTA 1L3TA 1F21A 3DLEA 3O3FA 4FLUA 2AJQA 3LALA 2HHTA 3SUPA 3HJFA 4WXWA 4JLHA 3AVLA 1JLGB 4DL5A 3PY8A 3AA5X 1L3SA 3GYNA 3V6DA 2FVRA 2IMWP 5CZ1A 2BQRA 4BDPA 2E4LA 1RA7A 4YFUA 4QPXA 1XHXA 4YR0A 1RT5A 2DFFA 4CEFA 3OS2A 4J9RA 4E3SA 1S1WA 4LSLB 5J2MA 3H5UA 4WYLA 3DRRA 5HROA 1XR5A 4NLOA 1TL3B 2OYQA 5C42B 3SUQA 4DTPA 5DQIA 2VG7B 4O3OA 3K59A 1ZBLA 3KLIB 3SYZA 3OLBA 3ZSRA 3KK1A 3C6UB 4GMJB 3MEGA 2XY7A 2RN2A 4F3TA 2B6AA 4EYIB 2BQUA 1C0TA 4M95A 1RDDA 1RT2A 4HVJA 3T5HA 4KI6A 1RTJB 4I2QA 3RWUA 3QIDA 5L1IA 5FRMA 1JLEA 2C28A 3M9OB 1VRUB 3ALYA 2OA8A 4KB0A 3L2VA 4R8UA 1DTTA 4DSFA 4IKAA 4M45A 3UR0A 1ZETA 2B4JA 1NKBA 5EUHA 4NLXA 3KMQA 1LW2B 2C22A 4AHSA 3TWHA 4CK2A 5KFBA 3KLEB 3KJVA 3ZSOA 1B9DA 1JKHB 3M9NB 4ECRA 5DG9A 3AA2A 4TYAA 3LZIA 1WSFA 3OHAA 1T7PA 4MK7A 3LP1A 1NHUA 4TY8B 2F96A 2QXFA 3QYYA 4IG0A 1C1CB 2C2DA 1NK0A 4AHRA 4KHRA 1UA0A 1LWCB 2W42A 4FJXA 2XY5A 4ED8A 3OYKA 2FC0A 3IGNA 5F8JA 3KIOA 4FVMA 3VQ8A 1ZBFA 3N6MA 3I0SA 5KFMA 2UUWA 1RNHA 3SUOA 5F8NA 1HQUB 2KQ2A 2P5OA 2V4QA 4NYFA 3K2PA 1NK4A 4C8NA 2IAJB 1NHVA 4LQ3A 5L1LA 3WNGA 4C8MA 4CK1A 1YVUA 4KHQA 3G6XA 3QLHA 2ETJA 2YNGB 4WZMA 4O3RA 4QWCA 4DTMA 3QZ8A 1QSSA 4I2PA 3L3VA 1TGOA 3IS9A 1B9FA 3PW2A 1N48A 4NCBA 2BE2B 2YV0X 3CYMA 2CKWA 3IRXA 4ZPBA 5HP1A 4CJWA 3DLEB 3NAIA 2B5JA 5I3UA 1QUVA 4RW4A 1SKRA 1SUQA 3VQPA 1JLQA 4N41A 2YNFA 4KV8A 3HKWA 3HHKA 4YP3A 5DGBA 3PVXA 1YTUA 1D5AA 1QS4A 3V6DB 2OPPA 4ZP7A 2E6MA 1RCHA 3PW7A 3BSNA 4ED2A 3IG1A 3L2QA 3HVTA 3V1QA 1RT5B 1BCOA 1QSYA 3VQ6A 2XHBA 3NGIA 1S1WB 3ZCMA 4GW6A 4L8RB 1S6PB 5KG5A 5J2MB 3DRRB 5HROB 4K4ZA 3PJWA 3AVCA 5T14A 4FJNA 1TKTA 4DG1A 3BQ1A 3B6OA 3KK1B 4IH6A 2C2EA 3MEGB 1ASVA 4CEZA 3NAEA 2V9WA 2B6AB 3NF7A 5EU7A 5DG8A 1C0TB 4KAZA 3LWLA 2V0NA 3C6TA 1RT6A 3QIOA 4I2QB 4QWAA 3PO4A 3NGYA 2QKKA 2JGUA 3NHGA 1QAIA 1S4FA 3MXIA 1U49A 4FS1A 2W7PA 3NGZA 4R8UB 1DTTB 1TL1A 2JC0A 4DTXA 2O4GA 1BHLA 4NLWA 3WNEA 4DU1A 4DWIA 5J2NA 5KFRA 1IKVA 4BE2A 4N76A 4HYKA 4RUCA 4B9UA 3KJVB 2DPIA 2W9CA 3BQ2A 1NKCA 4K4XA 5DGAA 3OYHA 1EKEA 3LP1B 4DF8A 4DEZA 3SV3A 4IG0B 4RUAA 1RT1A 4CFAA 1S97A 4DLEA 4IH7A 2KZZA 4ZVHA 4O44A 3DLGA 4Z0UA 4QAGA 3LPUA 2DY4A 3G6YA 2GIRA 2WRMA 3AVBA 3VQ4A 4FK4A 2RPIA 1OS5A 1TKZB 3I0SB 2VA2A 4ZP8A 3KMSA 4HUEA 1KHWA 3OY9A 3NH1A 3AVGA 3D28A 4BWJA 3AVJA 4B08A 3Q8QB 3OYGA 3QLHB 4O0JA 4CJLA 4CGJA 3HPOA 4AH9A 4FZZA 1XC9A 4I2PB 1NJWA 3DLRA 4KHSA 2AX0A 1TV6A 1S49A 4E7JA 4KE5A 3IS9B 4FLXA 3KOAA 1NJXA 2XRIA 3IRXB 2AGQA 2BDPA 2ZKUA 5HP1B 1T05A 4XPCA 3EZ5A 4FK0A 4ICLA 2B5JB 5I3UB 4RW4B 4NCGA 2LSNA 3FFIA 4MK9A 1JLQB 2YNFB 4ZPCA 4KV8B 2P51A 5KFDA 4DSLA 4CCHA 2AGPA 4PUOA 3KK2A 1UA1A 2ILYA 3ISNC 5D3GA 2D7SA 2OPPB 2R2RA 4OJRA 1FKPA 4QWDA 4EBEA 4O5BA 1QQCA 3EYZA 4TQSA 3IG1B 3HVTB 2XY6A 3CFPA 1VSLA 5KT4A 5KFHA 3HXMA 1JLAA 2FLPA 4CF9A 3NFAA 3I5AA 1TKXA 4CEDA 4E7LA 3ZSZA 3T5LA 1IKYA 2VG5A 1U4BA 4M3XA 3HVAA 2ZE2A 5J2QA 1TKTB 4DG1B 1U04A 4JUZA 2BR0A 2HHQA 3SZ2A 3H59A 4RNFA 1LWEA 3PJXA 4DSJA 1RBUA 2G8WA 4DL6A 1VK0A 3V1OA 3HO1A 5F8MA 4QWBA 1W0HA 4DL4A 2G8VA 4TLRA 3NL0A 4NLGA 3C6TB 1RT6B 5EDWA 5KGWA 1KLMA 3MECA 3L2UA 2AQ4A 3EPIA 4YMEA 4NYZA 4O3PA 2OPRA 3KLVA 5F8LA 3RB6A 1TL1B 3NF8A 4QCLA 3HSTB 4PWDA 1GX6A 4XO0A 1S1UA 5EWFA 3K58A 4DU4A 4CIFA 4W5QA 3MR3A 4CGDA 1N56A 1CZ9A 1S1VA 5J2NB 1IKVB 4DS5A 4ECVA 4J9QA 4FM1A 2R8JA 4AHTA 3DRSA 2F8SA 1W25A 1LV5A 3AVMA 3SFUA 2W9CB 4KTWA 3CJ5A 3OYBA 1WSJA 5CYMB 4KTZA 3NGDA 2AGOA 3HM9A 4FS2A 5FRNA 2FLNA 1RT1B 1RYRA 1YVFA 4ZVEA 5CY4A 2XI2A 4W5NA 3FRZA 4O44B 3DLGB 3VQ5A 4TY8A 3DLBA 3BSOA 3ZSYA 1HYVA 1JL1A 1NOZA 4LQ9A 4YQWA 4JV0A 4J9SA 1VSEA 4CIGA 1VSDA 4CJFA 1ZTWA 3RAXA 2GUIA 2NUBA 4ED0A 4NRTA 1DLOA 2JEJA 1HYZA 3KLFA 5KFYA 4O3NA 4NLUA 3KHLA 3GIJA 4DTJA 2KFNA 4G3IA 4FJGA 3I5CA 3QESA 1TV6B 3KHHA 2G8UA 2FBXA 3UIQA 3N6LA 1BQMB 4URGA 3V9SA 4TSXA 3RB4A 4JV1A 4E7IA 1FK9A 2R8HA 5KRTA 1T05B 4N5SA 3V9UA 1YT3A 3OYAA 4ICLB 1TK8A 5DG7A 5I42A 2IOCA 5HBMA 4NCGB 5HLFA 3FFIB 3M8PA 5KG4A 4K4UA 3AO1A 3U6FA 3HYFA 3DLHA 4LH4A 5DLFA 4FM2A 5DLGA 4PUOB 2HHUA 1D1UA 3KK2B 2BANA 4O0IA 4GVMA 4NRUA 5D3GB 2PY5A 3L2RA 4ZVGA 1FKPB 3V6HA 1XWLA 1HQEA 3QINA 5KG7A 1JLAB 4J9KA 3S3OA 1TKXB 1FXXA 4Z4FA 3PW0A 4CGFA 1IKYB 2WTFA 1GX5A 3ZSQA 4NLTA 2VG5B 1A5WA 3PO5A 3OJSA 2ZE2B 5J2QB 4YNQA 1S0NA 3QETA 1S6PA 5C5JA 4MKAA 2G8HA 3G10A 1U48A 1LWEB 1UAXA 3RMBA 4B9LA 1S5JA 4RNNA 1J54A 4KAIA 3SQ0A 3HT3A 3D5MA 4G1QA 3V9WA 1KLMB 3MECB 1Q9YA 5KFCA 4CFDA 1RDAA 3QIPA 3H5YA 3N6NA 4H8KA 4FLTA 2OPRB 3V81A 4KSEB 1WSGA 4CEOA 2Z1HA 3M9MB 4PWDB 2YKMA 1S6QA 3S9HA 2HNZA 1S1UB 4M3ZA 3G6VA 1VSKA 1CLQA 2XCAA 1X9SA 1S1VB 5HRPA 4OKEA 1K1SA 4WXOA 4B8AB 4B8CA 3DRSB 4XIUA 1Y97A 5KFVA 3HPHA 4IDKA 5KFAA 1C6VA 4WFYA 1KVAA 3Q8PB 4M3YA 5HRNA 4ED1A 4WYWA 4IOBA 2R7YA 4OKKA 2IM0A 1GOCA 4J9LA 2X6SA 1NK9A 2BRLA 2YHBA 4ZPAA 2Z1GA 4TQRA 1J53A 1RT3A 4Q5VA 4ZMMA 3AO3A 4K8XA 4K4VA 1XR7A 4NLVA 2D3ZA 2KZMA 4BE0A 4CEBA 4FBUA 1VSJA 4CHZA 1SKWA 4E19A 1TKZA 5F9LA 3SUNA 3HP9A 5KT3A 4F3OA 3O3GA 1DLOB 4FLWA 5K14A 3KLFB 3QEWA 4ZP9A 2WOMA 4FCYA 3MAQA 3V9XA 2R2TA 4K4WA 3ULDA 2HVIA 4KPYA 3OL7A 4JS5A 1RDCA 1IKWA 1BISA 4MKBA 1XHZA 4ECXA 4DQRA 5KFLA 4CIEA 1FK9B 4KREA 2QV6A 2C2RA 2FJWA 1D8YA 2HHVA 3TAMA 3OSNA 3QEVA 5I42B 5HBMB 5HLFB 3RB0A 4F4XA 3M8PB 1J9AA 4KTQA 3V6JA 1X9WA 3OS1A 2VG6A 2FVPA 3GQCA 2XI3A 4M41A 2BANB 3PW5A 2Z1JA 3V9ZA 1JXLA 2D41A 2XGQA 4AHCA 4BDYA 1G15A 2VWKA 1JXBA 5KT2A 3VQCA 1T03A 1HQEB 3P83D 1O1WA 4KO0A 3SPZA 3O4QA 5F9NA 4HUGA 3KLGA 3IGVA 1GOAA 3SQ2A 3DI6A 3RTVA 1VSIA 3MR2A 1EXQA 4LH5A 4ELUA 1HNVB 2X74A 3RR7A 5KFWA 4KFBA 2AU0A 1YTAA 1J5OA 1RT7A 3TARA 4Y3CA 4J9NA 4CJRA 1BIUA 4IRKA 2BGGA 4IKFA 1IO2A 2HNYA 3FDSA 3OYDA 4IRCA 5L1KA 4EEYA 4G1QB 3NF9A 4Y1CA 4O55A 3SI6A 4KB1A 4JV2A 5L9XA 4CEAA 2IM1A 3CQ8A 3QIPB 1ITGA 2V4RA 1GOBA 4OGEA 2O4IA 5KFEA 3OYLA 3V81B 3NBPA 3OYCA 2ITGA 3ASMA 2YKMB 1S6QB 2HNZB 5J2PA 1L3UA 4F4YA 3QGGA 2FBYA 1JLCA 5FROA 3OYJA 2FLLA 2RKIA 3CJ2A 3NCIA 1SV5A 5L1JA 5JS1A 1LW0A 2P1JA 4F4KA 4IBNA 2WHOA 4ZHRB 1EETA 3H5XA 4IDKB 1HRHA 3K5NA 2BQ3A 4XPEA 4EBDA 3MXJA 3TAGA 3CJ3A 3MTKA 4KHYA 1U09A 3AVHA 3VA0A 1A5XA 5KFKA 1KTQA 5CYMA 1C0UA 3CIZA 4NLYA 4RW7B 3RAQA 4CJVA 2HHWA 2I1RA 3BSAA 2HWIA 1RT3B 4CF0A 2XGPA 2IJNA 5KFGA 1RTHA 3TR8A 4HKQA 5EWGA 2HNDA 3KKRA 3BREA 5K14B 3ZT2A 4MFBA 1Q9XA 3OYEA 2KW4A 3JSMA 2WOMB 4O4RA 3F73A 1D0EA 4AHVA 4CF2A 1IKWB 5J1EA 3LP3A 3BR9A 4KHWA 1CXUA 4E7KA 4E7HA 3K57A 4Q45A 4DQQA 1S1TA 3FQKA 2E9RX 3TAFA 4CK3A 4IG3A 1WAJA 3HVRA 1IG9A 2JLEA 3NH2A 1BQMA 1WAFA 3T1AA 3TAMB 3Q8RB 1NNDA 2R8IA 2WB4A 4FJMA 4Y34A 2VG6B 4CE9A 3WNFA 4ZP6A 3ZSVA 4CGGA 2VWJA 3PR5B 3CFOA 4KRFA 3C95A 3QGIA 3CFRA 1DTQA 2AX1A 3OYIA 4C8OA 3O4NA 1T03B 5FDLA 4KO0B 1VSFA 2HHXA 4RNMA 3KLGB 3EY1A 3DI6B 2DPJA 3OYFA 1S9EA 1RBTA 5DQGA 2JEFA 2G8FA 5KFZA 3ZT1A 1Z4UA 3T3FA 4B9TA 4KFBB 4RG8A 2RF2A 4NLPA 4NZ0A 4OGCA 3GV7B 4CHPA 1W9HA 1J5OB 3AA4A 1RT7B 2BRKA 1C1BB 2R2UA 4FJ5A 1ZTTA 3AVNA 3FSIA 4CJ5A 3PX6A 1IH7A 1B92A 2J6SA 4EZ6A 1QTMA 4M3WA 2FBTA 3M8QA 2HNYB 4W5RA 4KI4A 2DFHA 4FJKA 4ED7A 3G0ZA 4CJ4A 1NK7A 2IJFA 3DM2A 1ZBIA 1RBSA 4OLBA 2JEIA 3U3GA 3NH0A 4OVLA 4C8KA 3MXMA 4LD0A 2E9TA 4GC7A 4IFVA 4CFBA 1HNIA 3NBPB 1QSLA 4J2EA 5KI6A 3D0PA 2DTUA 4ID5A 3PV8A 3V4IA 4CHQA 5J2PB 4K4YA 3T5JA 4K8ZA 1JLCB 3UQSA 4E0DA 1TP7A 3DYAA 2G8KA 5JS2A 4Q0BA 2RKIB 4HCCA 1U47A 4QW9A 3SV4A 2ZD1A 4NLRA 3GIMA 2PZSA 1R0AA 1L5UA 1SV5B 1LW0B 4KHUA 2X78A 3PZPA 4F2SA 1X9MA 1EETB 1REVA 2W9BA 5KRSA 3MEEA 2D0CA 1KLNA 3TABA 1IM4A 3PUFA 3I0RA 4ECUA 3K5MA 3PX0A 4DTSA 4ECWA 5EWEA 4DF4A 1NJZA 1WSEA 1C0UB 4HCBA 5DQHA 4FBTA 3CM6A 3KD1E 4H4OA 3GV5B 4WFXA 4ZPDA 4NLSA 3LZJA 1KRPA 1RTHB 4B9SA 4R0EA 1TK5A 5JXSA 2FBVA 1BGXT 1Q8IA 5KFIA 2HNDB 4FJ9A 4CJKA 3CJ4A 4MFBB 5F8HA 3NDKA 1SKSA 3HPGA 4ED3A 3JSMB 2PYLA 3BDPA 3AVKA 2ASDA 3KHGA 3L2WA 4DTUA 5KT7A 3RBEA 1KVCA 3D45A 4WZQA 4CEEA 4CESA 2RDJA 2D0AA 3RMAA 1SL2A 2AWZA 5J1EB 3OL8A 3SQ1A 4CGHA 4ZTJA 4AILC 4DFKA 2HHSA 1K1QA 1S1TB 4IG3B 4Y2AA 4FJ8A 4H54A 4Z4CA 3F9KA 4FLVA 3VQSA 4CJ3A 3V6KA 3SCXA 4JS4A 5C25A 3OLAA 4RW8A 4F4WA 4ELTA 3CDEA 4Z4IA 1DTQB 5F8GA 4Y2CA 2D5RA 3ZT3A 3B6PA 3H08A 4FLYA
chains in the Genus database with same CATH superfamily
3MM9B 2Q3PA 1C0GA 3DLLL 5IT9U 2P9KA 3GIIA 4L72B 2ZUGA 3TAQA 2Y1IA 1A9NB 1QTNB 1N6QB 2D9PA 1VYAA 5I9EB 8ATCB 4EU0A 4QQBA 1HYSA 3TRGA 4KY3A 2NPIA 4USTA 4B02A 3LDSA 2LECA 4DR1F 3HFKA 4CERA 5ETMA 1DEJA 1JL2A 3M8QB 3HCXA 1YBAA 2HFNA 1D9DA 2IS3A 3EVMA 1BIZA 2HB5A 3G2XA 4TVAB 1BO5O 5AZJA 2VZ9A 4G1PA 2ZZNA 3GSIA 4KBIA 3QMQA 2A1SA 4AD6A 4AQYK 3IBWA 1S48A 5E3CA 4C1NI 2HOEA 2BVZA 3VZIA 3UDLA 3OTOJ 1BQNA 3D3CJ 4Q0BB 2P5GA 1OIAA 3MFIA 5FPMA 4DLGA 2XLKA 4CFCA 4ID1A 3KDOA 3KJNB 3KHRA 4DV7J 1X1PA 3P1GA 4RW9A 4JI6K 1UVMA 3LGNA 3UN2A 1ITPA 1CVJA 4LSNA 1NLKL 3VQDA 4DV0K 3CC2N 4LFCF 4UTGA 3ZC4A 1N34F 2RU3A 4DU3A 2EC0A 2DHHA 4RZRA 4P73A 1P9YA 1P1TA 3QGHA 1FX2A 4F3QA 2VASA 3UR3C 4EZ9A 3HP6A 5GIPA 4ZN3A 1RA6A 4DFPA 2DO4A 4DMNA 2MHNA 4BC4A 3SQ4A 2D3O1 3KTQA 1FKOB 1VMBA 2E5HA 2P2CB 3A5MC 5EN1A 2VODA 2OTLS 3C6AA 4C0OC 1UVNA 4O3QA 2XSFA 2DR8A 1MWMA 3R7NB 1SC3B 4RL1A 1D09B 1JXVA 3DLKA 5CZ2A 4XTTA 2XMWA 4DMZA 4M5IA 4WPAA 3SBGA 2P9UA 3HHEA 3CWJA 4RW8B 1KEKA 3BUZB 2RH3A 4B1UB 1F9HA 1HJRA 4BR5A 4BQZA 4CJSA 5GADU 4NE9C 3L95X 4UY8T 1M5SA 4CLWA 1U1OA 1PYOB 1U2FA 4LF1A 1RTIA 3UVJB 4F7VA 2OD4A 2W41A 3RMDA 3BKTA 2QE5A 2P9KB 3A3OB 4OI0A 2RRAA 3EMTA 3EZUA 4QOZB 1HYSB 3IBCB 3KHYA 2ZJQL 3HD2A 2UVUA 2IA6A 3S7RA 2CG8A 3LM9A 1BUPA 3T7ZA 4BACA 2MJUA 1W2BM 2DCLA 5THWA 1C1BA 4FPIA 4U9RA 4DL3A 4RNHA 2JFDA 4DL7A 5AZJB 2F9WA 3V2UC 4HWIA 1NOYA 1RABB 4NLDA 4QU6A 4CZLA 5JICA 1RBVA 1IQTA 2M52A 3G86A 4PG7A 2QK9A 2BJ3A 5C24A 2UUCF 1SJ3P 4UQGA 3OL9A 3KWGA 1ZBUA 3M6VA 1BQNB 3ZZZA 1LAWA 3I31A 5GAEP 2D3UA 1G6BA 4YHHJ 1I39A 4JI2F 4RW9B 4NZ6A 2LQJA 2ATLA 1L3VA 5GINA 5MLCQ 1NGFA 2GEMA 4DTRA 4LSNB 2AYEA 1VQ5S 4Z4HA 3H40A 1HMVA 4L73A 3UDEA 4PA1A 3VGSA 3DHWC 3AXKA 3NNHA 1HD0A 3D6RA 1VK8A 3AO2A 1RHRB 1TTHB 3U1MA 3FEZA 3OXLA 2UXCJ 2VOPA 3S1TA 5LMUK 4DUYK 2W8KA 3R5DA 2FJVA 5HSPA 3GYXB 4E1NA 2GHVC 2X51A 4IH5A 4I6AA 2Q43A 2IY5B 5KG2A 2IVMA 2XS7A 1H2TZ 2NUUG 3IO1A 4ISFA 4KGVB 3MM7A 2WK4A 2W8LA 2V50A 4PRFA 1WKLA 3ITHA 3L4IA 2YJEA 1VRTA 3DLKB 1SJ4P 4YR3A 3IR7B 4DL0C 1HNWJ 2P9UB 3DXSX 4OX8A 1X4CA 2RNEA 3VAHA 2BKOA 2OTLN 4LY7A 1Z6RA 2RB7A 2BABA 2OFGX 2HLUA 3OPKA 4FXDA 2O8FB 1SC1B 4NO7A 2UXBJ 4X84A 1R31A 1N36F 3C94A 5EOYA 1FERA 1RTIB 4BRAA 5DJBA 1JJ2R 4DR4F 5E3PA 1ZA2B 4I9QA 4ED5A 4ILGB 2XY8A 4O8UA 1VR6A 2PE8A 1WC6A 4CJUA 1R8HA 4EFHA 4MIAA 1HHQA 3W0LA 5IT9O 2X3GA 3AJ2A 3SNNA 4ZIVA 2FF3B 4Q43A 4P7VA 5LJVA 3GCWP 1ROFA 4X4QA 2GHWA 1NH7A 4NPOA 1E3MA 4LT6A 2F8HA 2FHJA 4KH1B 3J7ZO 3AJDA 3OYMA 2HGNA 2CUYA 5M1QA 4J7CA 4ELVA 4OI1A 4FZYA 3O5TB 4O3SA 3SPYA 5C24B 1V4SA 1HARA 2KH9A 4ANCA 3BBBA 5AQWA 1SC4B 3CC7N 3BZCA 3Q2SC 1RU1A 2E7WA 3B4DA 2KM8C 3AY0A 5GAHI 3NMAA 3KLIA 3AD9C 3WXIA 4K50A 3OS0A 3LDLA 2XWYA 2HMIA 3CCRN 4OPJA 2R2SA 4CT8A 2GO9A 2IVFB 1U1KA 2Q3SA 1QAJA 3MX5A 1HMVB 1X5OA 1KVBA 2NLWA 2IIRA 3PIPL 5AQFA 1SQGA 2MQMA 1M5HA 2HVHA 1RTJA 1R8BA 3M5RA 4DU7A 1SBRA 1Q86O 4A59A 3D6FB 1K44A 1KHVA 3CG7A 2HBLA 2GQCA 4CECA 3J7Z5 2F4VJ 4DQPA 4Q8EA 3PR4A 3LF0A 3WQPA 1HW8A 4NCAA 3RRHA 2E6LA 1VQ5N 1CULB 2AEMA 3DDNA 2YKOA 3MM6A 2H48B 7FD1A 2VPXB 3RUBL 2NXCA 5CHCB 3MUVP 1JKHA 2VHGA 1NDLA 3AY9A 1F2GA 5KG1A 3HHLD 1FWLA 3DDKA 4IYQA 3UPFA 1RHMB 2P8IA 3FZ2A 4EP5A 1S6OA 2GC8A 3R1HA 2UUBJ 3ITHB 1YZ6A 3Q8SB 1VRTB 1JXEA 2JEGA 1LWCA 4FWMA 2B8QA 2VQFF 3TQ1A 3GJRB 4K4TA 2JNJA 5KTQA 5B0CA 1ZYQA 2RHKA 2YPYA 4JI7J 4CO0A 4CJPA 2P5VA 4UOCA 3MF5A 1BHNA 4MH8A 2E5GA 1ZZNA 3EGVA 3DFEA 3RSEA 3EDRB 3BO3A 3R6MA 1IBKK 1T6DA 3KJFB 4X4PA 2B7CB 3C65A 2H54B 5HRSA 1MWYA 1V6HA 2GVZA 5LY3A 2QI2A 4AL5A 3PNIA 2CJQA 2PYJA 1GLBG 2P6TA 4CLFA 2BJ8A 2E5LK 1T3OA 3HSJA 2QMWA 5JJBA 5AQGA 1H98A 4JLHA 1UJ5A 4B1XB 5AXLA 1L3SA 4OJGA 3L4QA 3GYNA 3K9KA 1BMQB 2FVRA 2IMWP 2UXCK 2MZQA 2E4LA 4YFUA 2ZC3A 1XHXA 4YR0A 1RT5A 3FK4A 2M8DB 1S1WA 1XR5A 2NZTA 4DTPA 1IBMJ 1MNEA 4H03B 2QWMA 3DXMA 3MWBA 3OVSA 3KLIB 4HLBA 3ZSRA 3H2UB 1EX8A 2RN2A 4F3TA 2NYIA 5ADXH 1C0TA 2QLWA 4H5TA 3M4XA 4DV2F 1HI1A 3JTPA 1ESVA 4PWUA 3D3BJ 4V19J 1RTJB 4KI6A 5FRMA 1JLEA 3GB0A 1VLYA 3A12A 4RBTA 3ALYA 2HVZA 5JLFA 4KB0A 2QGFB 1UWAA 4IKAA 3ZTOA 2P9SA 4NXMK 1WHXA 5ETVA 1NKBA 2OD6A 3IFRA 3TWHA 2CVEA 3MM6B 4LF7K 1RACB 3KJVA 1JKHB 4ECRA 4X65F 3QAEA 3MOZA 1FRKA 3LZIA 1TL7A 2UYTA 2KLAA 1T7PA 4MK7A 1NEEA 1NHUA 2QXFA 4IG0A 3EE9A 3PFEA 4KHRA 3QBCA 1LWCB 2EK6A 3BO4A 4LF2A 2YWWA 2XY5A 4ED8A 5F8JA 3KIOA 5DM6Q 4CW7B 5MAOA 2IDEA 2UUWA 1RNHA 4PL7A 2P5OA 4A46A 4Q2LA 1YDLA 1JK9B 3TZWA 2JLGA 3RSEB 1NHVA 5L1LA 3WNGA 3GE9A 4CK1A 2ZC4A 4F25A 1LK5A 3G6XA 2ETJA 2XMVA 4WU3A 1Q95G 4DR5F 3GG1A 3RW7A 4DCPB 2HF4A 2DBBA 5M1FA 2J0QD 4LC9B 1L3KA 3IS9A 3K17A 1HQ2A 2GVZB 3A4TA 4C9DA 3PW2A 1Q8LA 1QDUB 3VAFA 4LJMA 1DBDA 3R7SB 5EX5A 2GWJA 2HQFA 5HP1A 4CNZA 4RW4A 1SUQA 1F6TA 3VQPA 3GLJA 1HJOA 4JI1K 5IQ6A 2YX6A 4ZOSA 1UJ6A 2LXFA 5DGBA 3PVXA 1S79A 3F5TA 4X66J 4F0HA 4ZP7A 3NS6A 2HS0A 2X1BA 2NSCA 1NRKA 1RT5B 3VGKA 3F44A 3O4WA 2EC2A 1QSYA 1SJFA 1S1WB 2CNOB 1VIXA 4GW6A 5KG5A 4K4ZA 2WBRA 1KC8O 3DXMB 3D7SB 2RE2A 2EPIA 3R1LA 2MTLA 2ZDOA 3R7BB 2PMWA 3QDKA 2MQOA 4WFAQ 3O9TA 1ZH5A 1ASVA 3NAEA 2V9WA 3NF7A 4GY2B 5EU7A 1C0TB 4CLPA 5DS7A 3DNCA 3QRRA 3LWLA 2V0NA 4B3MF 2PC6A 1OSDA 3MPUB 4JK8A 2Y9HA 3L0QA 4DHYA 3P49B 2QKKA 1OJ4A 5ADXA 3Q22A 3GFXA 1NGIA 1KQSM 1FWPA 2E1CA 2JC0A 2KFYA 5ETTA 1RU2A 2P9SB 3MXHP 4DWIA 1N33J 1AT1B 1Y5IB 3ENBA 2AHOB 3CCLS 5J2NA 3A8JA 5KFRA 1GXUA 1XNQF 4RUCA 2CJBA 3KJVB 3GL1A 1T9TA 1YGYA 1NKCA 1TL7B 1F2HA 4K4XA 1LQ9A 5DGAA 1NM2A 2G0IA 2V51B 4P7TA 3SV3A 4IG0B 1YIJS 3J7YP 1RE1B 1UPPA 5IT4A 5BRHA 4DLEA 4ES3A 1S97A 2KZZA 4ZVHA 1GXTA 3SMZA 4O44A 3DLGA 2DY4A 3G6YA 3Q7CA 2DNNA 1TKZB 4HUEA 2XYHB 3I8BA 4DR1K 2V8GA 2GO8A 1U2RA 4JKDA 2PMHA 2KL8A 1XC9A 4CI0B 1DGKN 1NJWA 3MWTA 4OYXA 4OHVA 1YKWA 2NLXA 1AW0A 4C3LA 3IS9B 2CQHA 1HIYA 2EK1A 3I87A 3H8YA 1NJXA 4LRCA 1AYEA 2AGQA 4DR4J 1OQ6A 5HP1B 2BM0A 4FK0A 4IXCA 4RW4B 3TPQA 3AOBA 2OGUA 4OHXA 2DHSA 5DDOC 4DSLA 3CC4S 4PUOA 2GQ2A 4GVEA 3ISNC 5D3GA 2D7SA 4UQTA 3VAIA 1TMJA 3IM8A 2R2RA 2J0XA 3VVUA 4MMOA 1VQOS 4LFCK 5KFHA 1N34K 1JLAA 1Q1KA 4PYAA 3I55S 4E7LA 2C2ZB 3AH6A 1IKYA 4M3XA 5ETKA 2LVWA 2ZE2A 2C3UA 2B4VA 1T9YA 4E2FB 5K8MA 1KAXA 1JJ4A 2HVDA 3SZ2A 1K73T 5IWAF 2LDYA 2QTDA 4USKA 1WOQA 1F3FA 1W0HA 3QNWB 3THTA 3A5LC 2J76E 4JI5F 1KLMA 3MECA 3FKBA 2HPUA 3L2UA 3EPIA 3BEXA 3CCJS 3NF8A 4F36A 4PWDA 4IEEA 1GX6A 3THWA 3K58A 2Y8YA 2YHWA 4HT5A 4ZVUB 4CIFA 2O8EA 2E1YA 3MR3A 3PRBA 1N56A 4MLEA 5J2NB 4HT7A 4KGKA 2IYIA 4ECVA 4FM1A 3BGLA 2A6MA 1H74A 2DY1A 4AHTA 2Q2RA 1KD1O 1AFJA 2W01A 3EDQB 3TYTA 3CHWA 3AVMA 2L41A 4ES2A 4BRKA 5HMZA 3N0VA 3HM9A 2FLNA 2C3MA 4PZVA 2RS2A 4W5NA 1YK9A 3FRZA 4O44B 3DLGB 3FZMA 4CZFA 3VQ5A 1IM6A 3WC2A 5M1NA 3GG0A 4DV6F 4L3NA 4LQ9A 4YQWA 2BM1A 3A8KA 4TU7A 3BGOP 3CE8A 3L7PA 3NMUA 1YI2N 1EARA 4NRTA 2VQFJ 1DQ8A 2ZUAA 4U96A 3QT7A 2RQCA 1HYZA 3KLFA 3ISZA 4G3IA 1DARA 1Y5NB 3KHHA 1VC6A 4OX7A 2G8UA 1M5PC 2V94A 5HANA 4W98A 3UIQA 3EE8A 2UUCK 3N6LA 1BQMB 5CXTA 5A0YA 3VALA 1OY9A 2RRNA 2PEHA 4JV1A 1IJFB 1TK8A 5DG7A 1VHIA 3M8PA 3U6FA 3DLHA 3HYFA 1YJNN 4O5FA 2NS1B 4ZLJA 5DLGA 2QEXS 3MCAB 4JI2K 4PUOB 1S3XA 2B0GA 3LPYA 2BANA 1AA1B 4NRUA 5D3GB 4ZK7M 1NDCA 3QFWA 2E20A 5IXUA 1NMNA 2DRAA 3U1LA 2O3DA 1JLAB 4HH1A 4CH7A 2AJ2A 3S3OA 2A40A 4K42A 4I1TA 4YOWA 1IKYB 2R3VA 3ZSQA 4FVCA 3CC4N 3OJSA 2ZE2B 4YNQA 1S0NA 3VCDA 1R3NA 2M2BA 4S0MA 1UJ4A 2Y1RI 3OR1A 3Q83A 3ENWA 4B9LA 4G65A 3D6MB 1VQON 3EWGA 2UXDJ 3SQ0A 3CF5L 3E9OA 3HZEA 3I55N 2GX8A 1KLMB 3MECB 1OKJA 3FE1A 1Q9YA 4CFDA 5B7WA 1IBCB 4Y28C 3QIPA 2QLFB 3H5YA 2HK3A 4H8KA 5KPZA 3V81A 4PWDB 2YKMA 2XMJA 1S6QA 3S9HA 3THWB 4WQ5C 1CLQA 1W97L 2O8EB 1F9FA 1X9SA 3I33A 5HRPA 2CQDA 5AQKA 2MQ8A 4DR3J 4LFAF 2MZTA 4NMXA 3ETOA 1X60A 1N36K 2J9EA 2CGJA 2QMXA 4QU7A 2R7YA 4LF8F 4DR4K 2I9SA 4DX5A 4J9LA 2G2ZA 1O51A 3VGUA 3SK3A 4X4NA 2QW9A 4OPAA 3W5ZA 4ZPAA 4K0KJ 4I4BA 1FXLA 4K8XA 4K4VA 4B1ZA 4BE0A 3O8MA 4UY8O 1XIQA 4ER8A 2QA4S 4E19A 4BR2A 1S12A 5KT3A 4RX6A 5ITHA 1KBRA 3O8WA 3KLFB 4IWVA 4IJNA 1G1XA 2WOMA 3MAQA 5KQ8A 4C11A 4K4WA 4MKYA 3CIMA 2HVIA 4FPBA 3JQJA 4IDHA 3OL7A 1W26A 2NCKL 2XQCA 1D9AA 1IKWA 2GA7A 2EFPA 4KREA 5AE3A 2FJWA 3CXCR 2QLXA 3VAGA 3M8PB 2UV8G 4JI0J 4X64J 1A0OB 1R0BG 1X9WA 1MMDA 2BACA 2OI2A 2BANB 3W64A 3PW5A 3CERA 2F40A 3CCVS 4PKGA 1BWFO 4CH1A 4HTIA 2NRRA 2W40A 4KO0A 3O4QA 2PI5A 4HUGA 3SQ2A 3RBZA 1GMVA 5HL7Q 3MR2A 2KJVA 4UY85 3U02A 1RHUB 4ELUA 4WFBL 2QEXN 5KFWA 4KFBA 5H9EK 3D0GE 5JMNA 2DR6A 4WYBA 4BY9C 1RT7A 3OR1B 3KVGA 2ZBRA 1T9VA 2BGGA 4IKFA 1U2CA 5LSLA 2HNYA 5AQPA 3W2VA 4FXWA 5L1KA 4Y1CA 1N54B 1HKAA 2QZ8A 4M7XA 1FKAF 4CEAA 3QIPB 3SCIE 2V4RA 1GOBA 2OCEA 5KFEA 3OYLA 3V81B 3D2WA 3OYCA 2OO4A 2G0CA 4I68A 2YKMB 1S6QB 3QAUA 2FHMA 2VQFK 1HBOA 4B3MJ 1CJVA 4WFNL 4BG8A 3A8IA 3CJ2A 4Z7CA 1WSVA 4BR7A 3NCIA 2LQ8A 1WDTA 2AZ1A 1LW0A 1O0PA 1DURA 5IOLA 4BRPA 1HRHA 4TU9A 1WEYA 2QA2A 4DV1F 2E8AA 2FIUA 2FHOB 5HN0A 4NLYA 4CF0A 2V68A 5K8NA 1B64A 1NWKA 4GKJJ 4U7UD 5CAAA 5EHHA 3OR2A 3ZNJ1 2RQ4A 3ZT2A 2J8SA 4JI4F 1RISA 5HVFA 3NVKA 3OYEA 3JSMA 5HO4A 2WOMB 4C11B 2Y0BB 5ELZA 4KR0B 2I2YA 1IKWB 5KOXA 1JNZB 3P38A 2QRRA 4KHWA 4Q7AA 2HBJA 4PG5A 4DQQA 1S1TA 3FQKA 2QA4N 2CQIA 4IG3A 3HVRA 4B3TJ 1ZS6A 1WAFA 3T1AA 2GX9A 2OIHA 1VCTA 3I9ZA 4CE9A 2E1PA 4ZP6A 3ZSVA 4CGGA 4V1Ak 4KGXB 3C95A 4B1VA 1X7VA 2IYGA 1XMOJ 4A8SA 1VOMA 5F2RA 6AT1B 4DV2K 4KO0B 3TR5A 1VSFA 4O0NA 1SS6A 1YVNA 2EG1A 5HK4A 4PWWA 5KFZA 3HFZB 2AJ0A 3T3FA 4KFBB 4RG8A 1TR0A 2ZJRQ 3CJCA 3GV7B 4PR6A 1W9HA 4JYAF 1RT7B 4ANEA 2ZH6A 3CCVN 1LWXA 2DNPA 3PX6A 3ZTQA 4TLQA 3VEVA 2HNYB 1CPZA 2DFHA 3CCUN 4CJ4A 3M8WA 1QQNA 4X65K 3NWRA 3CCZA 3NH0A 1KAZA 4LD0A 1YRTA 3VR1A 2M70A 2E9TA 5BRDA 2R9LA 1PC5A 1HNIA 5KI6A 3M1FA 4X4VA 3V4IA 2JJ4D 2CA9A 5D6GA 3C66A 3NNAA 3UW1A 1HBOB 3UQSA 3TX8A 1EQ0A 3DYAA 1CJVB 4JI5J 1CC8A 1MN7A 2LXIA 3L4BC 2AYBA 2KKHA 3CJSA 1U47A 2DEJA 2EBEA 3NOGA 3MEKA 3BP8A 2PZSA 1LW0B 1NMDA 4F2SA 2M8HA 4TKTA 4DR2F 1SJ1A 1GLCG 3VGMA 2D0CA 4UT4A 1KLNA 3IAS9 3PX0A 1G2EA 1GLLO 3BF1A 4DR5K 1NJZA 4BS2A 1WSEA 4HCBA 3UD4P 2XLJA 5AXKA 5DQHA 2YWFA 3HHNB 3KD1E 4H4OA 2NXUA 4JI8F 3GV5B 4ZPDA 4NLSA 2RQKA 4DPOA 1KRPA 2EBGA 2MXYA 3FBBA 5JXSA 1Q5YA 3OR2B 1Q8IA 2FHKA 3HSGA 3FEXB 3R5GA 3EL2A 3CCSN 3KUEA 3JSMB 4ZVOB 4DV6J 2PYLA 3I96A 3AVKA 1X31C 5K8OA 3L2WA 1E4GT 3JAMY 3R5BA 4HEA9 2BJ9A 3IAM9 4WZQA 2RDJA 1SAZA 5LJWA 3RMAA 3SQ1A 4ZTJA 2YCHA 4A8OA 1K1QA 1S1TB 3K8VA 3O9QA 1B0TA 4IG3B 4JN4A 3LUYA 3V6KA 2N3LA 3RG6A 4JS4A 4LF6J 5ETQA 1K8KA 3MPDA 3DU6A 4ZLNA 4ELTA 3OV7A 3B4MA 3FCHA 4WKRA 4R0JA 5F8GA 1TELA 3B6PA 1JMTA 1FVQA 1IXKA 2MKJA 2FVCA 4B3MK 3KUGA 3PTWA 3RBXA 3M8SA 2FSKA 1QVGM 4YDUA 2A6OA 4DSEA 5KG0A 2OZMA 2FJBB 2QMUB 4I9LA 3QT6A 3H4DA 1PBUA 1S0MA 1WSHA 2FJXA 1O13A 3AO5A 1JJHA 1FE0A 3TP2A 3MI7X 1X5TA 2XO6A 1XNQK 4KB7A 1FEEA 1EP4A 3R6LB 4ILLA 4CBWA 4HDHA 4OLAA 1X4GA 9RUBA 1I94J 1BI4A 3R2CJ 1HNIB 3WIVA 1D8ZA 3KK3A 1SH2A 3V4IB 2W6KA 4M3TA 4FYDA 2R8KA 2QG9B 3DYAB 3OFGA 1WHWA 1S9GA 4TN2A 4BR0A 4OPKA 3CD6S 3ENOA 2ZKTA 2XCPA 3H3OB 2D0BA 2IGIA 1RAOA 2KJWA 2ASLA 4AT1B 1SPBP 1ASUA 3F9MA 1CG2A 3FRYA 4Y2IA 4ZHRA 4C97A 3MMBA 4AHUA 3VOVA 1CZAN 3MPVA 3AB2B 2QM1A 3OSPA 4H4OB 2VJVA 4OQJA 2FHJD 3J7YU 5F41A 1CS4A 1WG5A 3I5BA 3TVKA 2VPZB 5BPLA 2GMLA 2KXHA 3DOMA 1T9WA 4FJ7A 3TOQA 4BRDA 1UVKA 4U7CA 3OL6A 1RDRA 5B0BA 2QL7B 5DDPC 1VJWA 2R8GA 1LOTB 3VGVA 3AFGA 3BH7B 3SEOA 1KSPA 2Q31A 3GFYA 3ICLA 3K0JA 5LL6d 4FLZA 4USHA 3THVA 1NCLA 2HQIA 3NGKA 4K4SA 3TA1A 5KGXA 4Z94A 3O3HA 2AIRB 2YX7A 3GCXP 3AVAA 3CDBA 2YXLA 3B78A 3SMPA 3DOKA 4QYZJ 1U0HA 2WW8A 2L3MA 2DFEA 3IN5A 4OLOA 1K8KB 4KJIA 3MR5A 4BWMA 1RT4A 3E2EA 2BZ2A 3TUJC 4JB8B 5IWAK 2PD1A 2DGTA 2KFZA 3QO9A 4CZHA 1N4LA 2UU9F 1U6BA 3VF0B 3T1HF 2G2YA 2ZWHA 1RWMB 5K5MA 4J9MA 3I4PA 3Q8VA 4QR0A 3RRKA 1WF1A 4JI5K 3K0SA 4WP8A 2E2PA 3B82A 4CGIA 2Y1JA 3MPWA 4IR9A 4BHQA 4BE1A 2JLFA 3M05A 2HHHF 5SZTA 3OYNA 2DTJA 3U3YA 1Z2ZA 1GLJO 3IMXA 2HBMA 3FLCO 3S41A 4CF8A 1RBLA 3TEHB 2N7YA 1BCMA 5C2GA 4IOCL 3EGZA 2D0OA 2C3YA 1IBLF 3NG8A 1EP4B 1KOHA 2QO3A 4DZ6A 5C2CA 3CDUA 2IA0A 4KHMA 4RNOA 4F8RA 5CYQA 1HLWA 1BI4B 3QMLA 5AJ3F 5JVHQ 4X2BA 1YBUA 4JP8A 1KCFA 2GMJA 2OEKA 3KK3B 2C3OA 4OX9J 4Z4EA 3HHLA 2YKNA 2AA4A 4DV6K 1KFDA 4ITSA 2RQMA 4DX8H 2B9WA 2XWXA 4ECYA 3H98A 4DOZA 1S9GB 1BXNA 3HT0A 4YY3F 3RYLA 3DRPA 4J9PA 2HWHA 4MIBA 4H0XB 3UDCA 2NRZA 2FTRA 5SUHA 3M8RA 4R5PA 4EO6A 4IO8A 1F5BA 5AQOA 1B70B 3W8GA 1EX4A 4AXIA 3W3DA 3AO4A 3TAPA 3EUNA 1LCUA 1QD1A 3Q8YA 3MMBB 5KG3A 5LMNF 2DR5A 3T1YJ 3PDNA 2VFSA 3CMAS 4B3RJ 3CULA 1CS4B 3AJ1A 3SI8A 2IC3A 3DOMB 1RAFB 1WSIA 1A5VA 2FZCB 1R27B 4URQU 2R7WA 4OHZA 1IWAA 2JFKA 1TVRA 1M5OC 2YWEA 3PLAA 5KFJA 3HL8A 2QC3A 4WFZA 2RAQA 3MOJB 3P5JA 4H0VB 2XMTA 3TUIC 5A6PA 3MAAA 1SQKA 2WCXA 1JX4A 3NE6A 3NCPA 2CPFA 3GIRA 4DS4A 1JQGA 4EO8A 3DOKB 1U0HB 1QQMA 3LAKA 3BJYA 3P4UB 1RT4B 3DRXA 3QFUA 3R27A 2HQGA 3W61A 3GILA 1K8AT 2OELA 1RUSA 2MZSA 5D0HA 2AEJA 3QO9B 3KLHA 4PY5A 3BSCA 5KFNA 4EYHB 1YXQA 1PYTA 2DHAA 4FYWB 1ASWA 2CH6A 2F4FA 1WNEA 4IQXA 1CZBA 2W25A 3THXA 1YJ9S 3FMBA 3ILIA 4JKCA 3WQUA 2W4CA 3UO0A 1UWBA 1X5PA 3ZSXA 2YNIA 3LTOA 1K73O 2EX3A 1ZPWX 4F26A 2HEKA 2VDHA 4GKKJ 3TJ8A 3U9ZA 4I7FA 3LPTA 3WXLA 1S7HA 4DQSA 1T6CA 2AT1B 3OHBA 4MO4A 3CMQA 3LANA 2C3PA 4LFAK 4CJTA 4KQZA 5CYQB 1XJWB 2ADBA 1X4FA 3VN5A 2LA6A 1U1NA 4LF8K 3EXCX 4F4ZA 1TAUA 3NKYA 1NKEA 2PN6A 3HHLB 2YKNB 3FZFA 3S3MA 1IJEB 3ZT0A 1TL3A 5D4LA 4XEIA 1RBAA 4BGAA 2ALZA 3DRPB 3Q8UA 3GE1A 5SWMA 4B9NA 2HVEA 4QBUA 2G1HA 4YUDA 2IM3A 2DISA 3VEWA 3C6UA 4R5PB 2ASJA 3WNHA 2YHAA 3VMFB 3W9HA 4M3UA 3QNNA 1IR1A 2QJ3A 4NASA 1OPZA 3JTNA 4GO5X 1SL1A 4Y1DA 5HI7A 5I3PA 3CO9A 4NYNA 3AVIA 3OXGA 1GT8A 3K5LA 1RZMA 2QLBB 3ILJA 2W7OA 4B9QA 4OZ3A 4EBCA 4RKUC 2IC3B 1OSCA 1Z25A 2QL5B 5GMKa 1TVRB 1V5VA 1QVFM 3RRGA 2CWKA 3BEGB 3I8DA 1U1MA 3LAMA 1VQ7S 4FVUA 4CBUA 3KD5E 5H9FJ 3CMAN 4RUBA 3ATVA 4ZVTB 3QEIA 1ULRA 1HI8A 3MAAB 3B54A 1SL0A 4DFMA 1SIWB 2E9ZA 3BY5A 4NWBA 4YOUA 4DSIA 3VF4A 4FK2A 3UWTA 1BL3A 1WACA 1FDAA 4FW1A 2BOPA 2VA3A 1YF5L 3ELHA 1X0FA 4C8LA 2OH2A 6FD1A 2ZH9A 2HRYA 1FJGF 4DSKA 1HQUA 4OZLA 1NG9A 3KLHB 2YHXA 5B0FA 3C6HA 4AYBD 3NS7B 4JHDA 3JAMU 5AFUH 3DGVA 4LF9J 3TAEA 1I6JA 2RILA 3THXB 2WSFC 3HK2A 4BCAA 5E33A 1TQLA 1PIEA 1UWBB 5I3QA 3AV9A 2YNIB 4GV3A 3VQ7A 4BDZA 2E2QA 3KG4A 4FSVA 4I7FB 2F7VA 1L3TA 3OW2M 3DLEA 2AJQA 3QB0A 1KXPA 3O1LA 1V5IB 3UNGC 4WXWA 1TMMA 3AVLA 5DM6L 3CJ8A 1YJ9N 3PY8A 3NOCA 3A5OC 1P1LA 2ZJPQ 2BQRA 1BY9A 1HUXA 1UFWA 2K7KA 4DV1K 2GELA 3GYGA 4QPXA 2DFFA 1BE4A 3K9JA 1C0FA 1NUEA 1H38A 4LRDA 5J2MA 4BBYA 2CZ4A 3I32A 4LFBF 1TL3B 4QOTA 3J8AA 4BRLA 2W24A 2ZNZA 5AQHA 1ZBLA 3SYZA 2N7CA 2GQQA 1PGZA 3OLBA 3C6UB 4GMJB 4FYYB 2MKKA 2XY7A 2KXFA 4RBVA 2AKWB 1XN9A 2BQUA 4JI4K 4M95A 5HVHA 2LQBA 3O3LA 3CD7A 4JD2A 1RT2A 4EWTA 3DC2A 2EG2A 1FNMA 4BVOA 3T5HA 5A8RA 3QIDA 2C28A 3CQYA 1HBMA 3VGLA 4ID8A 3K5PA 1J5EJ 4A8MP 1HKBA 1ZM3A 2ASMA 3CB4A 5D4PA 4M45A 4XDCA 4E1JA 3UR0A 4DCJB 3KMQA 1XERA 3LGHA 1K0TA 4AHSA 1FW6A 4CK2A 5GAEI 4Y2MA 4M5GA 4QIFA 3CJBA 2W2QP 3FBCA 3AA2A 3DLLQ 3UN3A 3GONA 1WSFA 2W2PP 2IRYA 2HBQB 3LP1A 2M0GB 2F96A 3EICA 4JNEA 1U2VA 4RUHA 2GIFA 4XH1A 4CNYA 1NK0A 4AHRA 3P6YC 3WT0A 1UA0A 4FP9A 3DKDA 5AE2A 1ATRA 2W42A 4A8WA 2VOOA 1RWXB 3VQ8A 2B4PA 4BRMA 3I0SA 1VQ7N 2VBZA 3SUOA 4JYAK 2DK2A 1HQUB 2DNLA 5F0XA 9ATCB 2A1BA 2V4JA 3K2PA 1NK4A 4C8NA 4JHDB 1M1KT 4LQ3A 2WVBA 5F1XA 4C8MA 1F3VA 1YVUA 3QLHA 5FPEA 4WZMA 4A57A 3BGUA 3G82A 4DTMA 3DAWA 1QSSA 4I2PA 4ZPWR 1U1LA 5AFUA 2UU9J 1RB0A 3T1HJ 3D66A 1HD1A 2U1AA 3W3SA 4OYWA 3EJMA 4JKAA 3U1NA 3DLEB 3H20A 2B5JA 1FXRA 3MCMA 1QUVA 2V2VA 2KDOA 1JLQA 4YP3A 3J80U 1XUPO 4IO9L 4DR2K 1B0VA 5IZHA 2NRHA 2KT3A 1QS4A 2WB1D 1RCHA 3R5CA 1I1GA 3M8YA 5BR8F 4PEOA 2NUHA 3BSNA 3SQGA 3HSCA 4WK3A 2O01C 4NX9A 3BF3A 3AAQA 3NGIA 3D9BA 2WVCA 1S6PB 5J2MB 4JI8K 2YQ1A 1PYSB 3AVCA 1HLUA 1VRQC 5T14A 4FJNA 5E3AA 4DG1A 5H9FK 3IMQJ 3Q23A 3SJHA 1KR4A 2LEPA 3MMJA 3ET6A 2BYCA 2CGKA 2V7ZA 4MKVA 4JKFA 3U7JA 5KOWA 5DG8A 3BBFA 4KAZA 4JD2B 2KT2A 2HSTA 1RT6A 3QIOA 5A8RB 1Q7LB 3PO4A 2GNKA 3NGYA 1YJ7A 1HBMB 1S4FA 1U49A 2W7PA 4BVPA 3NGZA 2JRSA 1QHAA 4ISGA 3CPWR 2VONA 4DU1A 2HS4A 1QLNA 4GV6A 3N4WA 4BE2A 5HQLA 3O1WA 4HI1A 4LF4F 2B51A 1SXLA 2CPIA 3P96A 4OFZA 2DPIA 2W9CA 2QT7A 4FOEA 2OJ3A 2CWXA 1HW9A 2DH9A 3LP1B 2WUSA 1MWZA 4DEZA 1U2VB 2HZVA 1RT1A 1BC6A 4IH7A 3ZZTA 3ZETA 2IHR1 2ZJQQ 1XQIA 4N8OA 2GIRA 4OV1A 1HHTP 3VQ4A 4FK4A 2N4DA 2QSFA 4AQYJ 1OS5A 5J1NA 3I0SB 1S72S 3OA9A 4YOTA 3C3LA 5BREA 2OFHX 3ULEA 5CCMA 1ZBSA 1N32F 2V4JB 3HX9A 4YDUC 2HQ3A 1HL6A 4C3KA 1QZ6A 2J9CA 3QLHB 4BRGA 3LGMA 4GMKA 1VQ8S 3G82B 3E1YA 4FZZA 3A5NC 4I2PB 4JI6J 3JAMO 1TV6A 1ICEB 4KE5A 1EKRA 4MYUA 4DV0J 3KOAA 1CEZA 3BPDA 1ILYA 5IS2A 3Q86A 3W9IA 1LK7A 4FPAA 2BDPA 2ZKUA 2HGMA 2HRUA 2B5JB 4MK9A 3SCLE 2V8PA 1JLQB 3D0HE 5KFDA 3KK2A 2ILYA 1WKJA 3O6QA 1WOSA 1ZAWA 1FKPA 4EBEA 4O5BA 1W7AA 4TQSA 3SQGB 1CC7A 4I6YA 2XY6A 3CFPA 5BPNA 4P74A 1UL3A 3NFAA 2E66A 4CEDA 1FRLA 3H6EA 3ZSZA 3MX2A 1Q5VA 3T5LA 2F9TA 2VG5A 4NXNF 1GTEA 5HMYA 3HVAA 4A8QA 4DG1B 4LF5F 2IBOA 1TUUA 2R7OA 3ET6B 5IC4B 1RBUA 1VK0A 2GS8A 5F8MA 2ZHAA 4QWBA 2G8VA 4TLRA 3NL0A 3EVWA 1OQ3A 1RT6B 5EDWA 5KGWA 2UUAF 3R9LA 1Y0HA 4PXDA 3D7EO 4DUZF 2YKQA 4NYZA 4WJBA 3NWGA 4PCQA 3HZ6A 2OPRA 3SAHA 2G1DA 2HK2A 3HSTB 1K9MT 1ELOA 4W5QA 5ETSA 1CZ9A 4CO1A 5BJRA 4J8FA 2VQEF 4ISEA 3FJ2A 1W25A 4K5RA 1LV5A 5B0AA 2W9CB 3LDPA 3T1HK 3CJ5A 4DPYA 3OYBA 2NSBA 1WSJA 4KTZA 3NGDA 4P2XA 2AGOA 1GTHA 4BQLA 1RT1B 2K3KA 1RYRA 2DIVA 3ZETB 2YKPA 2XI2A 2GGPA 4TY8A 3BSOA 3ZSYA 4XH5A 2E5JA 4KIAA 2D9OA 2HHHK 3M7VA 4IJAA 5CHIA 3IRWP 4J9SA 2NRXA 4WF9L 2DGSA 3AGKA 4CLLA 1HA1A 3ULEB 3CJQA 3MCNA 3O44A 5AQZA 2L9DA 3RAXA 2GUIA 4BRNA 2NUBA 1N5SA 2QA1A 4NL5A 4ED0A 2MKYA 2W2MP 1IBLK 2YX4A 2JEJA 3WXMB 4ERDA 4K8RA 3GIJA 4K2XA 4DTJA 2KFNA 1FJGJ 5DM7L 4FJGA 3QESA 1TV6B 2ZDPA 5AJ3K 1S72N 4DV3F 4URGA 1U1QA 1PC4A 1RGIA 2R8HA 4OZ1A 3IBFB 2P9PA 3OYAA 5CZVA 2NYHA 4K4UA 4YY3K 3AO1A 4QYRA 2B4UA 5DLFA 5LMUJ 2HBZB 2HHUA 3KK2B 2J7KA 4O0IA 4DUYJ 3IUCA 3M6XA 1XTZA 3L2RA 1PKUA 3HHLC 1FKPB 3PIPQ 3VWSA 4OHWA 3POTA 3EO3A 5LMNK 3EGNA 4Z4FA 5HATA 2VG5B 3PO5A 3QETA 5C5JA 2G8HA 3D54A 3NGUA 3AXMA 2Y0SD 1S5JA 4RNNA 1VQLS 3P39A 1NH8A 4JOUA 3U8XA 2MJNA 1O6XA 4G1QA 2ZGYA 3V9WA 1SCJB 2H3EB 2ZBQA 1RDAA 5JLHA 3E3XA 2OPRB 4KSEB 3UCZP 4M3ZA 3A3NB 3G6VA 3SXLA 1VSKA 3N4PA 3H90A 5HL7L 2AW0A 1IR2A 1J6ZA 4OLPA 3CSKA 1HPMA 1K1SA 4B8AB 3BF4A 1AB8A 5DRKA 5IFMA 2CPHA 5KFVA 3HPHA 4IDKA 5KFAA 1C6VA 3C15A 3Q8PB 1E6YB 4M3YA 2CQ1A 1EO1A 3MMVA 2YX1A 2V2QA 2PFFB 5LXRA 1FHTA 2BW7A 4JV5F 2EW9A 1NK9A 2C2NA 2GGPB 2BRLA 2HBRB 4ILMA 1CJKA 2Z1GA 4CZJA 4TQRA 1RT3A 4XDDA 2GTDA 4ZMMA 5D4NA 1NXIA 2D3ZA 4KH0B 2KZMA 4PPDA 3LO3A 1GH8A 2CYYA 3VEZA 1Q53A 4Y2KA 3EE3A 2ZOGA 1VSJA 1MWKA 4CHZA 2AP6A 1MG7A 4JKBA 4CZKA 1GNKA 2Z0GA 2P9NA 3O3GA 1RK8A 2R7SA 1FFWB 3PYFA 1NDPA 2CPZA 1KVKA 3M2UA 4L76A 1TFWA 3E9LA 1HWIA 5HJXA 1RDCA 2QLJB 5AQIA 3CNQP 3ZTPA 4EAHD 3J7YI 4ECXA 4YB7A 4XAKA 2QV6A 4P71A 1D8YA 2HHVA 2P9PB 4BLGA 4JKHA 2I8EA 4F4XA 4KTQA 2A5XA 4DQ8A 4Z2XA 3E66A 2XI3A 1R0CB 2E29A 1JXLA 5KPRA 4X4SA 4J5OA 4HHUA 1VHXA 4BDYA 1EWQA 4F3MA 3POTB 1JXBA 4DU8A 3I9V9 2KVQE 3OUYA 2KKZA 4JBCA 3KLGA 3RTVA 2CQ0A 3MCSA 3P4IA 5FIIA 1EXQA 1UMJA 3C7NA 3D2FA 3J7A1 2WVDA 2AU0A 3SDEA 3UCUP 3CC7S 2NNWA 3WQTA 2RUSA 1RWOB 1JCEA 2H1YA 4AF1A 2A2DA 4RWWA 4J9NA 3VTHA 4F04B 5AQVA 1BIUA 4OYIA 2H5JB 4IRCA 3MN7A 4G1QB 4O55A 3CCRS 4JV2A 4C0HA 3CQ8A 5GMEA 2VFTA 4LRBA 4FDFA 2O4IA 2FGCA 4BG9A 3ZFVA 3PKMA 3I6PA 5DZ7A 1IBKJ 2PEBA 2UP1A 2ZNYA 1CQMA 2MY7A 4EI2A 3ASMA 4H4KA 4A8KA 4HTLA 1H0HB 3QRQA 3PCOB 1L3UA 3U4LA 4DCHA 3QGGA 2DR7A 2MKSA 5B09A 1JLCA 4X4TA 1VQLN 4ZLLA 2OMOA 2ZH5A 3OYJA 2FLLA 2RKIA 3PHTA 1FJGK 2BJEA 1SV5A 5L1JA 1Q7YT 1IJJA 1BDGA 2E5LJ 4IBNA 1FTRA 2ZJRL 4IDKB 3ZXWA 3AOAA 3C15B 4CO4A 3GPAA 1VQKS 2FC8A 3R1XA 1RP5A 3HI9A 4KHYA 4NLBA 3JSYA 3SMSA 1NPPA 3HFVA 1BLUA 3NY0A 2AZ3A 5KFKA 4DCOB 5CYMA 1CJKB 4LIRA 4CJVA 2I1RA 3BSAA 2HWIA 1RT3B 2DH7A 4M5DA 1ZXOA 2IJNA 1FTCA 1T02A 2DO0A 1K8AO 1RTHA 1HR0F 4MT1A 1A7GE 4ZPTR 4HKQA 5FD1A 2HNDA 2P9NB 3KKRA 1WUUA 4K59A 2A41A 2POKA 2BW2A 2DITA 3CCMS 4O4RA 3D6TB 3M2UB 4B3SF 1D0EA 3EX7B 4F0MA 1OYEA 1VJQA 4E7KA 4E7HA 2WAQD 2RMLA 5DO2A 3K57A 3AHPA 3NH2A 4LFBK 2G9OA 4FJMA 4HL9A 5CA5A 4BC9A 5GADP 5RUBA 1JNRB 1EB0A 4KRFA 3PR5B 4NXMJ 3D4JA 3CUNA 4DV4F 3MWPA 3CFRA 1G3OA 1WELA 1R6YA 2AX1A 3ILLA 3O4NA 4YOVA 3NLCA 5FDLA 4LF7J 3MN6A 3OUYB 4AFFA 4RNMA 3KLGB 2K2PA 3UE2A 2KT5A 1RBTA 4DXLA 3GWCA 1VK3A 1RWVB 3C7NB 3ZT1A 3D2FB 4B9TA 2AD9A 3W5YA 2RF2A 4OGCA 3SDEB 1NDKA 2IVNA 2BRKA 1C1BB 2R2UA 1NZAA 4PHTX 4JKEA 4CJ5A 3M2RA 4WTYA 2DEIA 1QTMA 4M3WA 4ALZA 4FJKA 1SQEA 1NK7A 3DM2A 1NU0A 2JOQA 3MXMA 4M5KA 1EWRA 3PRDA 3MMCA 4GC7A 4CFBA 1QSLA 4CLTA 5EX0A 4ID5A 3WBZA 2RU9A 3H2VE 3F2KA 1FT8A 5AR0A 1JLCB 2FQQB 4E0DA 4OI2A 5JS2A 2RKIB 2KRRA 2R7TA 2UUAJ 4V19S 4NLRA 2RVJA 1R0AA 1SV5B 1RAHB 3HBTA 4E98A 3PZPA 3FZHA 3QFPA 1REVA 2F3JA 3IWXA 2W9BA 5DDQC 5AQSA 4FN5A 3K5MA 4CLSA 4JI1J 2VFRA 4DTSA 1T11A 2O67A 5EWEA 4DF4A 4K7QA 2IJRA 3AARA 2AMCB 3TZXA 4M5DB 3CM6A 4H5NA 5DZ6A 3AB4B 4LSZB 2IFXA 4A8FA 1RTHB 5CR4A 1VHFA 4R0EA 1UCNA 1VQKN 1BGXT 3KG0A 1WOPA 5KFIA 1NB7A 2HNDB 1FJEB 4FJ9A 3AQOA 2GWKA 4ED3A 3MM7B 3BDPA 1XMQF 1W7WA 1CLFA 3DDIA 3MUTP 4K41A 2HG4A 3RBEA 1W2BR 1ACMB 4F9OA 4ZCLA 3AD8C 2L9WA 5BR8K 2COLA 3OL8A 2LEBA 1URNA 4PXEA 4DFKA 3CO0P 3O1BA 1F60B 3N5FA 4FLVA 3VQSA 3E8OA 1RSCA 1XBWA 3J7AP 3SCXA 3OLAA 4X62F 3CCMN 2R4FA 2F1FA 1LEOA 2CFXA 2VFUA 4DV3J 3P45B 4L3QA 3CDEA 5D78A 3ZNUA 4Z4IA 3HULA 2DIUA 4Y0FA 3H08A 4FLYA 2ZEJA 3QEXA 2APOA 5FDLB 1Q0NA 1X4HA 2ZGZA 1HBUA 3NRBA 3T5KA 5IM0A 2DGOA 2JWNA 2DR9A 1RTDA 4GC6A 5F3ZA 4ZJLA 4FJLA 2YBVA 2RF2B 3VQQA 3MAHA 1UKUA 3DMJA 3JB9k 5KFUA 2NXEA 1RADB 2I5JA 1HNVA 4CBXA 1Q18A 3M2RB 4ZVRB 1WJ9A 2M88A 3QPIA 2OPSA 3VQEA 4PQUA 1X9JA 3CMES 3K5OA 4LF4K 1RYSA 2XO7A 4M63A 3DM2B 5CYJA 3CQXA 5KQDA 4DR1J 5EVZA 4D3GA 5BR9A 3OTOF 4KH5A 3MMCB 1FJ7A 2PI4A 1S5ZA 3CD0A 2HAIA 4DR7F 5T41A 2DNYA 3G9CA 4ID5B 2B43A 3GJSB 3MR6A 3W8PA 3NF6A 2XYPB 4DV7F 4OYPA 2B9YA 1UW9A 2YI1A 3A8EA 2VKZG 4MAKA 2LCWA 1R0AB 2HMIB 2J7WA 3QZ7A 4QWEA 1REVB 2W9BB 1N32K 3LL3A 4CHYA 2DGXA 4DPTA 2MLZA 3JYTA 3PW4A 1IQZA 4CJEA 1IKXA 1RAJA 2YH0A 1VS3A 4MLHA 5D0GA 3OVNA 4IR1A 1ZPVA 4ILJA 1Y10A 4CRJA 5M1KA 3QERA 2Q1LA 4LFCJ 3OTDA 1N34J 1FDDA 4RW7A 4FZVA 2QXLA 4M94A 4F02A 1RILA 1WDDA 1M1KO 4KHPF 4O4GA 2RDIA 5DMRA 1UFLA 1QJHA 2HW3A 4B1YB 4LR9A 4OKJA 4RJVA 3AD7C 5TKWA 4IEIA 3CGIA 3TNVA 3CW2C 1NK6A 3LPEA 1WTBA 5C10A 2A10A 1N5QA 2G0JA 4I69A 1T94A 2PGCA 3LWMA 5JVGL 4BC7A 4W5OA 3VAJA 2Z2YB 5HRRA 1WN7A 4NXNK 1G99A 3R3LA 3ZT4A 1FDBA 3S3NA 2AYMA 2J9DA 4LF5K 2MQNA 2ZH1A 3CF5Q 1YZ7A 1JJCB 1GK8A 3BV8A 4M5NA 5C7PA 3RB3A 2DGVA 3LP0A 1RBOB 1XI1A 1KDNA 2CJAA 2UUAK 2XS5A 1HBUB 3ID8A 3W1YC 1SB6A 5IM0B 2RHSB 4DUZK 2HQCA 3VZHA 4CVNE 1RTDB 1UEUA 1OPIA 1GMWD 1U24A 4C8YA 3DMJB 1HPZA 3PIOL 1SH3A 5DK5A 5FLXY 2I5JB 3HJVA 1SVDA 1BQXA 1RAAB 4ZTFA 2OPSB 4PQUB 2D74B 2VQEK 1ZOTA 3IA0A 1N5YA 1VGYA 3KKSA 3P31A 3EKUA 2CXEA 2ASYA 1T9UA 5ETRA 2K8GA 3M2VA 4A5AA 4DTOA 3MEDA 4OYAA 5KT6A 1U02A 3HI0A 4G6VB 3I82A 3FR0A 1C1AA 3CMEN 2UUCJ 2G8IA 1RWWB 4CEQA 1ZBTA 1F9EB 3KNAA 3QNOA 1SZ2A 2RSQA 3ILOA 3DWLA 3N4QA 1ZAXA 4Q44A 2HURA 3H42A 2J7UA 2OHDA 3JYTB 2V34A 2E88A 1IKXB 4PKHA 2N4CA 2VBXA 1JLEB 5L46A 5KAKA 4JI2J 1VDHA 2MMYA 1WEXA 4NA1A 2E2NA 4FJJA 1ATSA 4PKDB 2HKEA 4DV3K 3VHQA 3H0PA 1NGJA 2F8EX 1TK0A 4J2AA 3FBFA 2OMLA 1WF0A 2OTJN 4O4GB 1GEHA 1V3ZA 6FDRA 2OKQA 3DOLA 1TL5A 3HVWA 2WSCC 4H0OA 3H5SA 3CM5A 1C2PA 3CJ0A 2NXNA 1YI2S 2GMHA 1MU2A 1T8EA 1HR0J 3SLCA 2MDAA 4WE1A 2OZSA 3PEHA 1XR6A 1HNWF 1KQFB 2XG8A 3E01A 4PPZA 1U6ZA 4WFBQ 1MSWD 3GJQB 2B56A 5C2FA 2UXBF 2LMIA 3CCES 4NB4A 5U47A 3D1OA 3FGUA 1ZA1B 1RAEB 4MK8A 1YBTA 2P9GA 4JI3F 2UUTA 4Y65A 2XZTB 4A62A 3WHIA 3KYLA 1YJNS 2DXEA 2HZCA 2IMOA 3LP0B 2RT3A 3DLJA 3TTDA 2J8AA 4IUFA 2O8CA 1YUWA 5C2DA 5A8WA 3UCGA 2L9NA 3TSQA 1Y9OA 1N36J 2CJKA 1EKSA 1K6YA 2CPDA 3ONQA 1S0OA 4FJHA 1TFYA 1UOCA 2F8TA 2VU5A 2W7AA 4WFNQ 4DI6A 1N6QA 1JLBA 1HPZB 1SUQB 5BN8A 3PYEA 4X4OA 2VBWA 3WZ0A 4JRPA 1GQEA 1S4EA 4G9ZA 2ROPA 5BYQA 2FVQA 1JLGA 1N5YB 3CCWA 5KFOA 2VGMA 1UFKA 4CI6A 1G4CA 4A2AA 2R7QA 4CJQA 3V5RA 2XTJP 1AFIA 1NPKA 3VV2B 1K9MO 5CD4H 4JV5K 3M2VB 2GVDA 4URSA 3MEDB 2HBYB 3O9UA 2C2KB 4B1WB 2GJIA 3T19A 4LSLA 4H0YB 2P9EA 2LEAA 2Z2LA 1Q8BA 2VG7A 2DXDA 2CNKB 1TU0B 2BX6A 5T7BA 3ZEUA 1P27B 1OY6A 2H4YB 1Z26A 2NRTA 4M42A 4UZCA 4ZJQA 3THPA 2E44A 2F4VF 3GV8B 2DRBA 4DQIA 4FM0A 3L3UA 2Z57B 4RWXA 4J9VA 1T3NA 3H2LA 2ITMA 4HHTA 1UEVA 2IBKA 4TXSA 4EUVA 1KKHA 2M3DA 4LBPA 2GBZA 3H1VX 2IM2A 4N47A 4PABA 5H9EJ 2PAVA 3QSYB 1LW2A 2WC9A 3DOLB 3NXZA 4KH6A 1HNZF 2UUBF 3SIPB 1RBRA 1MU2B 2GJ2A 3TWZA 1FKOA 1K47A 3BM7A 4WE1B 1LFWA 3Q89A 1OVQA 5A6WA 1U1RA 4B9MA 3E01B 1QAXA 1C1CA 2MZ1A 4FYXB 3VPZA 4JI7F 1DQ9A 1X0PA 5F0UA 3SFGA 2J6TA 2B7BB 1N0VC 2ASPA 2XHCA 3JS9A 5M2PA 2H3GX 2LQ5A 1QM9A 3F0NA 1CJTA 5C15A 4WWSA 2IAJA 3VENA 4A2BA 1WC4A 4BROA 2O8CB 5A8WB 2YNGA 3BGFA 2K06A 4X62J 1WEZA 1D4XA 3CCEN 2SXLA 2V2ZA 3MUMP 4CZIA 3D1QA 4JAXA 3A3PB 1X4AA 4DKWA 1JLBB 1FD2A 2JX2A 4U6PA 2W9AA 1KQSR 3MDQA 2HSEB 4IFEA 1ZC6A 4OZNA 4FLUA 3TSPA 3JQKA 3SUPA 5FPNA 1YQHA 1YWXA 4HI2A 4CO2A 1JLGB 4DL5A 5AQYA 3AA5X 4H4KC 2FY8A 3V6DA 5CZ1A 4BDPA 1RA7A 4PKIA 1IBMF 2GVDB 4CEFA 3OS2A 4J9RA 1HNXF 4LSLB 3H5UA 4WYLA 5HROA 2Z2ZA 4NLOA 2D0PA 5D0RA 4USWA 5CD4A 1BA0A 2VG7B 2FD2A 3K59A 1HR0K 1V3SA 2BOAA 1Q78A 4FF1A 3PM9A 5BRFA 4DR7J 3BKFA 3KJQB 2V6AA 1CQNA 5GAEU 1JJ2M 1RTZA 2LLZA 3MEGA 4FOIA 3ZEUB 2B6AA 4EYIB 2J4RA 4OYMA 2DPNA 4B3SK 4M1KA 3RWUA 2H9ZA 2RDDA 1TUGB 1VQMS 4WCEL 1HKCA 4DV2J 3OTEA 3L2VA 4R8UA 3G6EN 4I67A 2YWHA 3VEOA 3CIPA 3M3ZA 4NLXA 2KRBA 1LW2B 4ZPVR 3FC9A 2C22A 5KFBA 4ZKAA 3NGRA 4CD1A 4DV4K 5L8RC 1B9DA 4TYAA 4QIVA 2ZH7A 4AE5A 2R7XA 3EM1A 3QYYA 4KHPJ 3H1QA 2DVIA 1C1CB 2GAGC 2C2DA 3TTFA 3WDOA 4X65J 3R5JB 4RR5A 4J90A 2YVSA 3OFEA 2F7TA 1ZBFA 3N6MA 4U8VA 2C1EB 4C1NK 3O2IA 3AODA 2VH7A 5F8NA 1CJTB 1HI0P 2V4QA 4CT9A 4NYFA 4HACA 5M2UA 1AUSL 5LJ5Y 2IAJB 2O8FA 2E1MC 2MPUA 2YNGB 3GJTB 4PQAA 4A48A 4QWCA 3ENVA 5A0YB 1XK8A 3L3VA 3QT8A 1VQ9N 2C2OB 1B9FA 1N48A 2YV0X 4DR5J 3QJJA 4ZPBA 3T9ZA 1X4DA 4ZITA 1KVJA 3GBTA 2X3DA 3TEGA 5ADZA 3TA2A 2DRDA 5I3UA 4X66F 1SKRA 5A76A 1GLEG 4QIGA 1I3OB 1APSA 4KV8A 3HKWA 1SC6A 2ASOA 2JWLA 1KWMA 1KVIA 1HBNA 4CZCA 1YTUA 1D5AA 2KI2A 4FL9A 4FWQA 1F5AA 3V6DB 3A8YA 4DN9A 2OPPA 3PW7A 3CCUS 4EK2A 4ED2A 3L2QA 3HVTA 4ZDNA 4OZJA 3UKUA 1Q81T 4BRIA 3VF6A 4AM6A 5CE3A 3ZCMA 3LDNA 3JS6A 5HROB 1N5TA 5FLXU 5LT5A 1Q7YO 2HIYA 1QAYA 5E84A 1TKTA 4U8YA 1RLDA 3B6OA 4USUA 4U67L 4OI6A 4IH6A 3MEGB 4KBOA 2NREA 2B6AB 1J27A 3H3NO 3N28A 2Z4PA 2VB6A 1FNOA 1XMQK 4B17A 4PYDA 3PFOA 1OH8A 4NEZA 3QGPA 3NHGA 1DAXA 3P8BB 1N33F 4NOHA 3VAKA 2Y3YA 3MXIA 2Z8QA 3W63A 4FS1A 1RQ0A 3TO8A 1MMNA 1BG3A 5JMVA 4FKYA 4R8UB 1TL1A 5G4DA 4F0KA 2O4GA 1BHLA 1IV0A 4NLWA 1RWNB 3WNEA 4OJ3A 5LM7E 2BH1A 1M5KC 2FJEB 4X62K 3D2EA 2XNRA 1YJVA 4RWTA 5MLCV 4WKYA 4HYKA 2Q0RA 1H6KX 1CULA 1MLAA 1VQMN 3G87A 3DXKA 2BA9A 4WQ5A 3BQ2A 3HDSA 3CCSS 1WC5A 3OYHA 4IOAL 3AA9A 1XNQJ 4DF8A 2CJYB 2CDRB 4RUAA 4DPWA 3BZQA 1PCAA 5B08A 5EXWA 2BUNA 3DXBA 2KHOA 7FDRA 1F5CA 3AVBA 1G7CB 3BB5A 3L09A 1R89A 1RCXB 2VA2A 4IOCQ 4CLKA 2IVOA 3CI5A 4EMDA 3KMSA 2AJFE 2J5AA 1KHWA 1T44A 3OY9A 3NH1A 1LFPA 3AVGA 1ZAVA 4HACB 4BWJA 2CPEA 4JK7A 4B08A 3AVJA 3SSRA 3Q8QB 3OYGA 1KS2A 4CJLA 3VAMA 4CGJA 4AH9A 2KO1A 2KG1A 1UZDA 4JI3J 4AXJA 3OTOK 1S49A 4BR9A 1SQFA 4DR7K 3FCWA 4FLXA 4WIIA 3LQVA 1FI4A 1WOOA 3TJ9A 4DV7K 2A18A 3R3TA 2QWNA 3EZ5A 4M63C 5I3UB 1I5OB 3X3UA 2MEWA 4C48A 3FFIA 4ZPCA 4KV8B 1YX2A 1IUJA 2AGPA 1YJUA 1HKGA 1HBNB 1VI7A 4IQMA 3M6UA 2F9JA 2OPPB 1IG8A 5L9NA 3KK7A 1LXJA 4OJRA 1WC3A 3HVTB 2BJ1A 1TUWA 3UKUB 1S6UA 4BREA 3HXMA 2FLPA 2GUPA 5HVGA 4CF9A 1A6LA 3I5AA 3GR1A 1TKXA 4QR1A 1RI7A 2JH3A 1U4BA 3M6WA 5J2QA 1TKTB 1RKJA 3MGJA 4JUZA 4X4RA 2BR0A 2HHQA 2VCPA 2WBNA 4ETXA 4RNFA 2V7YA 2MQLA 2IRUA 3W2VB 1LWEA 4KHPK 2V5HG 4DSJA 2I7NA 2EKYA 2G8WA 5AXNA 4AUKA 4DL4A 4A4JA 4QZVB 4HH0A 5IWAJ 4LRFA 2CVI