4RW9A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw9A05
3DLGA 4IRCA 3PO5A 4OKKA 1C0UB 3MXIA 4YR3A 3K2PA 4J9RA 3HPHA 5KT3A 1ASWA 3PX0A 1S97A 5D3GA 1BIUA 4CEDA 4N56A 4DS5A 1LW2B 3PW7A 5KFRA 4E7IA 3NGZA 3ZSXA 1ASVA 4TSXA 1S9GA 5KFSA 5JS2A 3U6FA 2F96A 5KGWA 2UVWA 3LP0B 2D3ZA 1HYZA 4F4KA 1S1TA 1UWBA 4OPJA 3U3YA 2IAJA 3ZT1A 1B92A 1S1XB 4Q8FA 2WONA 4E89A 4WZMA 3KD5E 5DMRA 4J9SA 4CJ4A 3KTQA 4YNQA 1WSHA 2C2DA 4W5NA 4DU4A 4ZTJA 3CJ2A 3E01B 3D45A 3O4QA 3OS0A 3NGYA 4G1QB 1JIHA 3IGNA 4I9LA 2WHOA 1NK6A 5E41A 1IKYA 4O4GA 2XCAA 2XI3A 4DTNA 1C0TA 2VG6B 2IJNA 2R2UA 1N5YA 4QW8A 1HQEA 5C42B 4FLWA 3AA4A 4M3YA 4JV2A 3CFOA 1HMVA 4IKAA 1T94A 4CJSA 4O0JA 4FM2A 3I5AA 4CIEA 4KB7A 2J6UA 3KLFB 4ZVGA 1SKWA 3VQ8A 1K1SA 2HHQA 3OSPA 4J9NA 3RR8A 4Q44A 2R8KA 3AVHA 1TP7A 1C0UA 2FC0A 3ZT3A 1SUQB 2D3UA 2BGGA 3DDKA 4FW1A 3H40A 4NLDA 2AGOA 4O3RA 1VK0A 3RBEA 1S49A 3NAIA 3DRSA 5DG7A 2JEGA 2KZMA 4E7JA 2IM3A 3H5UA 5I3UA 4B3OB 4TY8A 2OPPA 3C95A 1LW0A 3S3OA 2BR0A 2OA8A 3DRPB 2FJXA 5HRRA 4RW6B 4DTJA 4Z4GA 4DWIA 1UOCA 4ED2A 3CJ5A 4ED1A 1Q9YA 2VWJA 5KT2A 3PVXA 5HLFA 1R0AB 3H98A 1X9SA 4IDKB 3QYYA 4K4WA 3CQ8A 1RDDA 4OGEA 3LP1A 5F8NA 4CK3A 2GC8A 4XPCA 3MEGA 1HYSB 3MR2A 1CZ9A 1HNIA 1RDRA 3TAEA 5KTQA 2QXFA 1NK5A 3V1OA 3CYMA 1L5UA 3IGVA 1HYVA 5JS1A 4IQXA 2DY4A 2O4GA 4DTXA 3NF7A 4CE9A 2P5OA 5KG0A 3MECB 2HHXA 4Z4EA 3QETA 2I1RA 1SL2A 1RT6B 3LAKA 4C8LA 5DQHA 5DK5A 3K57A 3V1QA 3LWLA 4FJ8A 1RT3B 1NNDA 3CO9A 1G15A 4U7CA 3SQ0A 2F8TA 3OL8A 1SV5B 1C1BB 2E6LA 3SNNA 3I8DA 1TL3A 1N4LA 5DLGA 3O3HA 3C94A 1N56A 4AHSA 1JLGA 1T03B 1ZBLA 5CY4A 2ATLA 3VQ4A 2KFNA 3OYHA 2OPQB 4I7FB 2XC9A 3AO1A 1WAFA 1QQCA 1VSKA 3UQSA 1RTJA 4K4ZA 4NLUA 2DPIA 1VSMA 4IFYB 4M94A 5HRNA 3DLKA 2J6SA 5J2NA 1LAWA 1TK5A 5FRNA 5HBMB 1JXLA 2HNZA 4EBCA 1DTQA 2EC0A 1KFSA 3RMCA 3FDSA 4O3SA 4LSLB 1U48A 4FJMA 1REVA 2RDIA 2ASJA 4B08A 2UVRA 3G10A 4ID5A 3KLGB 3MEDA 3I5BA 4KBIA 1Q8IA 5KFNA 2F8SA 4H4MB 4F2RA 4M3UA 3QEPA 1D9FA 1C1BA 2KW4A 3NH0A 3TAGA 1KHWA 5T14A 3DI6B 2VA3A 1VSEA 2JEFA 3NFAA 2QV6A 3TANA 1QSLA 1J53A 4CJUA 4I2PB 3KMQA 2DFEA 3KD1E 4Q0BA 4KHMA 4AHCA 4ECTA 1YTUA 4MFBB 1O1WA 2XI2A 2W9BB 5DQIA 4Z0UA 3K5OA 2ASDA 4RW4B 4F8RA 4O3QA 1U09A 2G8VA 4JRQA 1J5OB 5F9LA 3HVTA 4YP3A 4CHOA 3AVGA 3GIJA 4GC7A 1S0MA 2B43A 3DM2B 1VRUB 3NGDA 4O3NA 3M8QB 2DFHA 4O44B 1ZBUA 3OY9A 1CLQA 3NCIA 3G86A 1L3UA 4KHQA 1LWCA 2R8GA 3DLRA 4NCBA 2I5JA 5L9XA 1I6JA 4ZVHA 4R8UA 1JLBA 4CJFA 1LWEB 2PYLA 4W5QA 2VG5B 2UVVA 2V9WA 3LP2B 2Z1HA 3KNAA 2XY5A 4CERA 4RUCA 4K4XA 4QWEA 4Z4FA 4KKOA 3PX4A 1KVBA 4CEAA 1S1VA 3KK2B 3V9UA 4FJJA 4JS5A 2HNDA 1RBUA 3WNGA 4QW9A 4ECZA 5HRPA 3DI6A 4ELVA 5KFHA 4JV0A 3H4DA 2FLPA 3QINA 4KHNA 2AGQA 3ISND 4BWJA 4DSFA 2XY8A 2OYQA 1TL1B 1JL1A 4CFDA 2W9CA 3OYBA 3NF6A 3OYCA 4X2BA 2W8KA 1WSFA 3ZSWA 1DTTA 4DL6A 3RRHA 2ALZA 1KLMB 5C24B 4KB1A 1S0OA 3SFGA 4G3IA 3F73A 1T7PA 2WK4A 1NKEA 3NMAA 3RTVA 1K1QA 2YKNB 4Y2CA 3V6HA 2PY5A 1YT3A 4GMJB 3QEVA 3T5JA 4F4YA 2WB4A 1S5JA 1VRUA 1XR6A 4FJXA 4Z4CA 3U3GA 4UQGA 4IG0B 3SI6A 2D7SA 3ZT2A 4KSEB 4MH8A 3KK3B 4DL7A 3V4IB 3RB4A 3DMJB 3DRRA 1FKPB 4DSEA 2YV0X 1KLNA 2YNIB 5JXSA 3KK1A 3LP3A 5DGBA 1C1CB 1LWEA 1EXQA 4CEBA 3JYTB 3LANA 4OL8A 3TQ1A 1QUVA 4R5PA 2OPRA 2DPJA 1BCMA 4EO8A 3M9OB 3PZPA 4OGCA 1JLAA 2UUWA 3QERA 1S9EB 1LWFB 4J9QA 4IH7A 4NLSA 1DLOA 3TAMA 1RTHB 4IG3B 1GOCA 4OKEA 4BDZA 3AVNA 2WOMB 4M42A 4ZHRA 3BREA 1TL1A 2LSNA 4CJEA 4FZYA 2RF2B 3GIMA 4WXWA 1D9DA 5CYQB 1U04A 1RT1B 3ZT4A 1VRTB 3GIIA 2Z1GA 3DLGB 5T7BA 5KG7A 2R7YA 1S4FA 2G8HA 4Q43A 5DG8A 4IKFA 5KFUA 3AVIA 4DLGA 4MK7A 4MKBA 4RW7A 5KFZA 5D3GB 5KFAA 4LY7A 2QKKA 4O0IA 1W25A 1VSJA 3VQAA 4F4XA 4IG0A 2AQ4A 4FLUA 4DFJA 2JLEA 1S9GB 3DMJA 2Y1JA 1KVCA 1ASUA 4KTZA 3SUNA 3IRXA 4ZPDA 2ILZA 4CFBA 3L2UA 4HCCA 1S1TB 3RB0A 4N76A 3AO4A 4XIUA 4DU3A 2IAJB 2YNHA 2V4QA 2WONB 1EP4A 1CZBA 2WTFA 1RBRA 4M3WA 1TGOA 3BR9A 3BGRA 1RTIA 2C2EA 3DOKB 1RDBA 1S9EA 2WCXA 4IR1A 1LWFA 4O4GB 2B5JB 1C0TB 1NJZA 4JV1A 2IA6A 1EETA 3L2QA 1U45A 1HMVB 1IM4A 4FLVA 3Q8PB 3SQ4A 3VN5A 2C2RA 5CYQA 1KRPA 4OLAA 4C8OA 5DLFA 1XR5A 3SQ2A 3ZSOA 4TY9A 1QAIA 3B6PA 3CDUA 2IDOA 4ECYA 1YTAA 5DG9A 3K58A 4CFAA 4FLTA 4YR0A 4NYNA 2X74A 3HP6A 4CF2A 2HW3A 4CGGA 1JX4A 3DRSB 3HVAA 5KT6A 4CHQA 3KHHA 3ZSZA 3K5MA 3OJUA 4BDYA 5I3UB 1HJRA 4TY8B 2OPPB 2BDPA 1LW0B 3M8PA 3CIZA 4FK2A 2P51A 4B9LA 3Q8SB 4W5TA 1SH0A 4J9LA 4DL3A 1Z4UA 4JLHA 4CJ3A 2B6AB 2RN2A 3KHRA 3AVMA 1VSHA 3AVFA 3MEEA 5HLFB 2ILYA 3MFIA 3VA3A 2NUBA 1TQLA 3LP1B 4PWDA 1TKTA 2ASLA 3KKSA 4FZZA 3MEGB 3DOKA 3MTKA 3PJXA 2D0CA 3M8RA 1HNIB 3NKYA 3UR0A 2IM2A 1S9FA 1C1AA 5KFJA 2B5JA 3NL0A 5HRSA 3IG1A 3QGIA 3KMSA 2JC1A 5F8MA 3SZ2A 3G6VA 4FJGA 4RZRA 3AV9A 1RYRA 4BWMA 4WFYA 5KFBA 2D0BA 4ZP6A 1VSIA 2JEIA 5HROA 3NDKA 4EBEA 3TAFA 2HVIA 4CGJA 2ETJA 3KIOA 2HNYA 4URSA 4HHTA 1BI4A 4W5OA 4ECXA 5KG1A 3AVLA 1TL3B 1XHZA 1K6YA 4NYZA 3VQ6A 3OYLA 4ED6A 2IM0A 3KJVB 3I5CA 1JXEA 1S0NA 4YQWA 1JLGB 1TKZA 5CYMB 4CIGA 2E4LA 3HPGA 4OPKA 4KO0A 4PY5A 1WSIA 1QAJA 4R0EA 3OSNA 3M9NB 1RBVA 2B6AA 1VSLA 3SPZA 3TABA 4DTRA 1RTJB 4O55A 3HJFA 2YNGA 4E19A 1FKOA 1RT5A 3BQ0A 5KFMA 4L8RB 1ZBHA 3DLKB 5J2NB 4OJRA 4ZVEA 4DEZA 4NRUA 3KLHA 2HNZB 4FM1A 4Y1CA 1DTQB 3VQ7A 2IGIA 5FRMA 4KV8A 1CXQA 3H5YA 3PW5A 2RPIA 3OJSA 4FK0A 1REVB 1NKBA 4MKAA 3PR5B 2HWIA 5KI6A 4DF8A 3VA0A 4ID5B 4DU1A 4EP5A 2RKIA 2R2RA 3MEDB 3KHLA 4FK4A 4PA1A 3P1GA 4O4RA 4U6PA 3QLHB 4EBDA 4FVMA 4CHYA 4HUEA 4FS2A 4CGHA 2UVUA 2AGPA 2YKMA 5KG4A 2FBVA 4FLZA 1BHLA 3KJVA 2IS3A 4CJQA 5L1JA 4XO0A 5CYMA 2YHAA 4Q0BB 4F4WA 4WFXA 4IRDA 4ELUA 4NLOA 4C8NA 4CHNA 4Y3CA 1TV6A 3VQSA 3MF5A 3V6KA 5C5JA 4DG1A 4GC6A 4CF8A 2XY7A 4J2AA 1JLQA 3H2LA 5CZ1A 3PUFA 3OYAA 1QSSA 3OYEA 2HHVA 3HVTB 3V6DA 2Z1JA 3QIPA 2GUIA 3NAHA 4M41A 3OHBA 4CGIA 3ICLA 3H08A 3IAYA 3RWUA 4FLYA 3CDEA 4IR9A 1S6PA 4B9TA 3T3FA 2G8WA 3L2RA 4M45A 3S9HA 1JLEA 1KTQA 4ED8A 1LWCB 4URQU 2I5JB 4B8AB 1KHVA 3BSNA 1Z26A 3I0SB 4R8UB 1JLBB 5KFDA 5HP1B 4FXDA 1U4BA 2G8IA 3HP9A 4KAZA 3HYFA 2HHTA 4CFCA 3P5JA 1KFDA 3AVAA 4KKOB 2XGPA 1S1VB 1RBSA 1NK9A 2VG7A 1BGXT 5C25B 3QLHA 4ZP8A 3MAQA 2HNDB 3TI0A 4ID1A 4TYBA 1WNSA 2XGQA 3RRGA 2FLLA 3Q8RB 5J1EA 2IOCA 4WFZA 5J2QA 1L3VA 4M3ZA 1IKXA 4QWAA 4FS1A 2GBZA 2R2TA 1LV5A 2W9CB 4H54A 4CJ5A 4JRPA 5KFEA 1DTTB 4DSJA 1TK0A 1TVRB 4MK8A 1NK4A 4ZPCA 4YR2A 2JC0A 5J2PA 4FBTA 1UA0A 1BQMA 2JGUA 2GIRA 3N6MA 3H4BA 4YFUA 2VA2A 2G8UA 4DL2A 3H5XA 3CG7A 1FK9A 1SH3A 1GX5A 4AH9A 2PZSA 2BE2A 3A2FA 3MXMA 3GQCA 3ALYA 4OLBA 3LAMA 4F4ZA 3DRRB 1ITGA 2IM1A 2FVPA 4WE1A 3HL8A 4CK2A 2ATQA 4KPYA 3HM9A 2V4RA 4RU9A 4ZP7A 4AILC 4IH6A 3I0SA 3KK1B 5EWFA 2Z1IA 3O3GA 5HP1A 3JSMA 4R5PB 2OPRB 3CM5A 5KFPA 4F50A 1JKHA 5KFXA 1IG9A 1JLAB 1N6QB 3OS1A 4LQ9A 1WLJA 2XWYA 4LD0A 4DQPA 5C25A 1HARA 3C6UB 2HWHA 4EZ6A 4XPEA 1DLOB 4MK9A 3TAMB 3OYNA 4B9VA 3AVJA 4Z4IA 4M3RA 2BQRA 1RT7A 4HVJA 1BL3A 2FVSA 2IJFA 1RNHA 3ISNC 3PW4A 3AA2A 4CCHA 4ZHRB 4DTUA 4DFMA 2EX3A 4PUOA 4RNOA 4TLRA 4KHUA 1HRHA 4RW9A 1TVRA 2FJWA 3IS9B 1T3NA 2R8JA 3EYZA 4M3XA 3ITHB 2XO7A 3Q8QB 4BE0A 1TAUA 1C0MA 4RNMA 4WYLA 4O5BA 4RW7B 4J9KA 3VQBA 1RDCA 5JUMA 3T1AA 5EU7A 1X1PA 3ZSQA 4JS4A 3NHGA 4IFVA 4ECRA 3I0RA 4KTQA 4ZPAA 1FXXA 4CHZA 1YVFA 1SL1A 4CECA 1RA6A 4Y34A 3KLVA 5KFVA 3IRXB 1S48A 1HQUB 2HHSA 1QE1A 1XI1A 3KHGA 3OL9A 3IN5A 2YNHB 3ZCMA 2W7PA 4KB0A 1EP4B 3L3VA 3SV4A 3RMAA 2HHWA 1IH7A 1IKWA 3QNNA 4DL5A 4ZTFA 3BGRB 1RTIB 3BQ1A 1N6QA 4M95A 5KFLA 4KAIA 3BSAA 3C6UA 3KLEA 1D0EA 1SKSA 4NRTA 4NLGA 3LZJA 4IH5A 1EETB 4BDPA 4IBNA 1S6QB 5L1KA 3MFHA 4W5RA 4TQRA 4PQUA 3HPOA 3NGIA 4DFPA 4F2SA 3CVKA 1T05A 3VQEA 3FFIA 4ECUA 3IS9A 2FLNA 1BQNA 3ITHA 4KHSA 4LH5A 5EWGA 4DF4A 4KFBA 1EKEA 1GOAA 1A5WA 3RR7A 1IO2A 3L2VA 4NZ0A 1L3TA 3QEIA 3LZIA 3M8PB 1ZBFA 1S1WA 4DSKA 4Y2AA 1RILA 1HNVA 1ZBIA 2ZE2B 5KFTA 1T8EA 4E1MA 3ZSVA 1HQUA 3HO1A 2P5GA 3C6TA 3F9KA 3RMBA 3N6NA 1F21A 1MMLA 4KE5A 3MEEB 3VQCA 5KFCA 1QS4A 3O4NA 1JLCB 3T5LA 3MR3A 4PWDB 1UAXA 1TKTB 2FBYA 4HTUA 4OKJA 5F8JA 4ZMMA 5EUHA 1Z25A 1NJYA 3AA5X 3OS2A 3RB3A 5KG6A 4KHWA 1RCHA 3IG1B 4CK1A 2C28A 2HVHA 1J54A 4N47A 3RBDA 5KFGA 3VQ5A 4N5SA 2HHUA 5I42A 4TQSA 2X6NA 5KGXA 4KREA 1HPZA 1S1UA 4NLTA 2GIQA 1S6QA 4NLQA 2BRLA 3HSTB 2PYJA 4FJ9A 4E1NA 3LDSA 5KFYA 1WSGA 3QO9A 5HROB 4ELTA 4FM0A 4NLRA 5EDWA 2FVCA 4QPXA 4CJKA 3OYJA 3QZ7A 2IBKA 2HNYB 3OYFA 1BI4B 2UUTA 3TVKA 1SL0A 3EPGA 1WAJA 1TKXB 2AWZA 3V9XA 1RT4A 3GV8B 1JLFA 3AO3A 5L1IA 3NBPB 3T5HA 5KFWA 4M3TA 4F3TA 4Q45A 3AVBA 1QSYA 1TKZB 4AHVA 2XRIA 3T5KA 4NLXA 1RYSA 4KO0B 2ZE2A 5SZTA 3PW2A 3BJYA 4QWBA 4I2QA 1RT2A 3KLIA 3SPYA 4JUZA 4HUFA 3SFUA 3V81A 1RA7A 4QOZB 1JLCA 1I39A 3ASMA 2YNGB 2KTQA 1RTDA 5KT7A 2ZD1A 2Y1IA 3TAQA 4CEEA 1FKOB 1RT5B 3K5LA 2CJQA 4IRKA 3PO4A 5KT5A 2YNFA 4F3OA 3D28A 4K8XA 1RBTA 3KLHB 4CF1A 4FYDA 1GOBA 3HXMA 3OYGA 4TXSA 4KV8B 4B9MA 5KFIA 3LALA 2BQUA 4DSIA 4MIAA 3M9MB 4GW6A 4E7KA 3CM6A 4KI6A 3FQKA 2RKIB 4CF0A 4NCGA 4CJVA 4EO6A 4Y1DA 3B6OA 2QKBA 3CDWA 1BCOA 4B8CA 4DQQA 2KZZA 1MU2A 3WNHA 4DTMA 1XR7A 2W42A 1IKVA 4HKQA 5EWEA 3OYMA 1TKXA 4HUGA 2YKMB 4KI4A 2C22A 3LWMA 2XHBA 3NBPA 4LSNA 3CJ0A 3EZ5A 4ECQA 2A1RA 4E7LA 4TN2A 4CJLA 1CXUA 4RNHA 4FLXA 4ZPBA 4EP4A 3PHEA 4H8KA 4ZVFA 1TV6B 5L1LA 4B9SA 3GYNA 4DG1B 1D8YA 1XHXA 1NK7A 1LW2A 1JLQB 3KOAA 4HCBA 3WNFA 3K5NA 4K4TA 2Q3SA 1VSFA 3V6DB 3QIPB 4C8KA 4NLPA 3V9SA 3LP0A 2ZKUA 3CFRA 3DLEB 2XY6A 1S6PB 4LQ3A 1XC9A 3H59A 1S1XA 4E7HA 3LPTA 1JLEB 5DGAA 4QAGA 1XWLA 4EEYA 1SKRA 1U47A 3DYAB 3CJ3A 3E01A 4J2EA 5KG3A 4G1QA 3BSOA 2D0AA 3AVKA 3NF8A 2OPSB 1NJWA 5KG2A 4Q5VA 3T19A 2VG6A 5C42A 1ZTWA 2VG7B 4NLWA 4RW8B 5F8HA 3HKWA 3HK2A 3NE6A 3SYZA 3FRZA 3KLFA 2BANB 4YMEA 5J1EB 2IC3B 2W7OA 5J2QB 1WNEA 1ZYQA 1A5VA 2F8EX 3PW0A 1IKXB 2FJVA 1LAVA 3CFPA 4FZXC 1NOYA 2BRKA 3G0ZA 1SUQA 5K14B 3H5SA 4ICLB 5J2MB 2OZMA 4BE1A 4FJ5A 4B9UA 5J2PB 3QIOA 2G8KA 1BQMB 4Q8EA 3EPIA 4CEQA 4B3OA 1B9DA 4I9QA 4CJWA 5DQGA 1FK9B 1RDAA 2O4IA 3DRPA 1BIZA 2BE2B 3CJ4A 4RW6A 3DLEA 3ZSYA 4N41A 2AJQA 4WE1B 3P83D 1D1UA 3D5MA 1R0AA 2FVQA 4IDKA 2QK9A 1W0HA 3ZSRA 4BE2A 1RAJA 3V9ZA 3KKRA 3DYAA 2QE5A 5KRTA 3OLAA 1HYSA 2OPSA 3JSMB 4FCYA 1C2PA 1D5AA 3DOLB 1JKHB 2AX1A 4WXOA 4J2DA 3SUOA 3CWJA 4LH4A 2WRMA 4J9OA 4HYKA 4RW8A 4ED0A 2X6SA 4DLEA 4DTPA 4ZP9A 3MECA 2HMIB 2BANA 4FBUA 2FBTA 3SCXA 3SJJA 4K8ZA 1YVUA 4DS4A 1RT6A 2IC3A 1RT7B 3SUQA 3OLBA 3VQPA 2BQ3A 4AHRA 1RT3A 4FJHA 3OYKA 5K14A 4PUOB 3G6XA 4RUAA 1SV5A 3OYDA 4RW9B 4ICLA 4H4OB 5J2MA 4NCAA 4CHPA 3G6YA 2OZSA 1CSJA 3RB6A 3FSIA 3QZ8A 4CEZA 4ECVA 3HT3A 1SH2A 4IOBA 4K4VA 3RAXA 4KTWA 4RNFA 4DFKA 3SQ1A 1T03A 1ZTTA 4ECSA 3SV3A 3VQDA 4Z4HA 3PJWA 2OPQA 4DQIA 4I7FA 1NHUA 3L2WA 4IFVB 3I0RB 1I3AA 2W8LA 3FQLA 3M8SA 1Q9XA 1QHTA 3OYIA 3OL7A 1QE1B 3QEXA 1NHVA 4IFYA 4K4UA 1WSEA 2P1JA 3DOLA 1IKWB 2O5DA 3PR4A 3OL6A 4MIBA 5HBMA 4RG8A 1X9WA 4CJRA 2FBXA 4LSLA 3MR5A 3KLEB 3V9WA 4DL4A 4DSLA 2HMIA 4CGDA 3GIKA 4CJTA 4DQRA 4FJKA 3KLGA 1OS5A 2B4JA 4RNNA 1EX4A 1UA1A 4J9MA 3OHAA 4GVMA 4H4MA 2KQ2A 4PQUB 3QNOA 2CKWA 3VQ9A 1J9AA 3D0PA 1T05B 3FFIB 3S3MA 2E6MA 4H4OA 4CIFA 3V6JA 1BQNB 4FW2A 1ZETA 4I2PA 4KFBB 4TYAA 4OVLA 3QGHA 4DTOA 4E3SA 3LPUA 4KRFA 4MFBA 2AX0A 4KHYA 2W9BA 2OH2A 3AA3A 4J2BA 4QCLA 2D41A 1S1WB 3AVCA 3O3FA 4RW4A 1HNVB 3AO2A 5F9NA 3NF9A 3GILA 3NH2A 3TWHA 4QWDA 1J5OA 1TK8A 2DFFA 3C6TB 2X78A 2V0NA 1TKDA 2R8IA 3DM2A 1JXBA 4CEFA 3OVNA 1NOZA 3ZT0A 3M8QA 3AO5A 4O44A 2E9RX 4K4SA 4AHUA 1C6VA 5CZ2A 5KFOA 1N48A 2G8FA 4WZQA 1NJXA 2HAIA 2EHGA 3NH1A 5FROA 2GV9A 2AU0A 2J6TA 2KFZA 2E9TA 1VSDA 1Y97A 1BISA 4CF9A 2VG5A 3BSCA 3LP2A 3NAEA 3WNEA 5I42B 1HPZB 4AHTA 4FJLA 1S1UB 3MXJA 4BACA 3DLHA 1KVAA 1S10A 4C8MA 4DQSA 3L8BA 2HB5A 3HHKA 3KK2A 3GV7B 2FVRA 4K50A 1GX6A 4B9NA 3QO9B 5FDLB 4ED3A 3PV8A 1B9FA 3V1RA 5KRSA 4K4YA 3EZUA 2R2SA 3QGGA 1WN7A 4QWCA 5F8GA 4E0DA 5SWMA 1RT4B 2ITGA 1JLFB 4CGFA 3L3UA 1KLMA 3QIDA 5C24A 1NK0A 1NKCA 1QTMA 1KSPA 5KG5A 5KT4A 3THVA 2W9AA 4DMNA 2YKNA 3S3NA 2VWKA 4O3OA 3SUPA 4I2QB 1RT2B 3KLIB 4NLVA 3UPFA 3E51A 3K59A 2DTUA 2D5RA 3RMDA 4EYHB 5KFQA 3V81B 4DTSA 4FJ7A 1W9HA 3KK3A 5F8LA 3QEWA 3V4IA 4ED7A 2R8HA 1RTDB 3DLBA 2ZD1B 1FKPA 2YNFB 2YNIA 1UWBB 4NYFA 1A5XA 4FJIA 1C1CA 3BDPA 3JYTA 3VQQA 1NK8A 4MQ3A 4URGA 3BQ2A 4EYIB 4NLYA 3QESA 1TAQA 1X9MA 3UDLA 3RAQA 3HVRA 1L3SA 4ECWA 4J9PA 1JL2A 3TR8A 1KCFA 3UIQA 3TAPA 3EY1A 4CESA 3SI8A 3HVWA 1IKYB 4EZ9A 4NCGB 3PY8A 3PX6A 3TARA 5KFFA 2JEJA 3ULDA 5FDLA 2E9ZA 1RTHA 1N5YB 4CEOA 4KHRA 1HQEB 2IMWP 1MU2B 4IG3A 1WSJA 2XCPA 4WYWA 5F8IA 4FJNA 2WOMA 2ZQBA 2RDJA 1IKVB 1U49A 5KFKA 2RF2A 2YHBA 3GV5B 2A1SA 1RT1A 4CJPA 4O3PA 4LSNB 3MR6A 3N6LA 1VRTA
chains in the Genus database with same CATH superfamily
3D2FB 5HOOA 1RGVA 4OKKA 1C0UB 4U96A 1B0PA 4J9RA 4ZCKA 3P45B 1ASWA 1S97A 3A5MC 3OR1A 5A8WA 4BC9A 1BIUA 4CEDA 4N56A 4USMA 3PW7A 3GTYX 4FL9A 2QWRA 3RBXA 2E1MC 3Q8UA 1KOHA 4TSXA 5E7OB 3N79A 5JS2A 1FDDA 1GTEA 1VISA 5AXMA 2XLJA 4WQ5C 4EU0A 2KXFA 3U3YA 2IAJA 1NWKA 1M5SA 4J9SA 1RZMA 4C11A 2C2DA 4W5NA 4DU4A 4CH1A 3E01B 3D45A 3O4QA 4G1QB 1DRZA 5DM6L 3WXJA 2K1RA 2BEFA 2CUYA 5E41A 4JV5J 2L41A 3JAMU 4DTNA 3QRRA 4P75A 3BGUA 1HQEA 2E5LF 3AA4A 4JV2A 4BRPA 1X4BA 3KXDA 2E5LK 4IKAA 4FM2A 4KB7A 1VC5A 2J6UA 2LFVA 4BR7A 4YB5A 3WXMB 1GLJO 5AQHA 1SKWA 3D67A 5ADXA 1MN7A 1NBWA 4P7TA 4BS2A 4FF1A 2IVPA 3MM6A 2D3UA 4DR7J 4NLDA 3P4UB 1VK0A 3RBEA 4XH4A 3DHXA 3D1OA 4QS8A 1LEOA 1HJOA 4E7JA 3UO0A 1T6CA 5I3UA 4TY8A 3IAS9 2V7ZA 1LW0A 5A6WA 2BR0A 4LVNP 2R7TA 2EFOA 2W24A 2FJXA 3NY0A 1J5EF 2ZBRA 3FKBA 1J5EK 3MN7A 1UOCA 4ED2A 3CJ5A 1Q9YA 2VWJA 1CJUB 1YJWN 3QMLA 3UCUP 4K4WA 1TUYA 4RJVA 1IBMF 3GJQB 3PHTA 1IBMK 4XPCA 3IAM9 2DXDA 3MR2A 1S76D 1H2TZ 4PG7A 2LQJA 4E8UA 3TAEA 5RUBA 1AFJA 4X64J 1RWVB 3W7BA 3HOTA 1V6HA 3IGVA 4IQXA 1N0VC 2P5OA 4U7UD 5KG0A 3MECB 4Z4EA 3QETA 1HR0K 1SL2A 4PAAA 3D6TB 5BRDA 3V1QA 1NH8A 3F44A 1RT3B 3DC2A 2DHAA 1G15A 2ASMA 1GMWD 3AA8A 1TL3A 1N4LA 2W40A 3O3HA 1KAXA 4FDFA 4OZ0A 3C94A 2GA7A 1N56A 1BO5O 1Y5LB 5AE2A 3UVJB 1QZ5A 5CY4A 1ZAWA 2KFNA 2BMBA 2M70A 1ZPWX 3W63A 4FKYA 4PG6A 4LF5F 1QQCA 2KG0A 2DR5A 1FRKA 1VSKA 4R0JA 5D0RA 1Q86O 2GJIA 2CFXA 2AJ1A 5A2QO 1PGZA 4CLSA 4IFYB 5C2FA 1HKAA 1LAWA 4FWMA 2C42A 1K8AT 4WFAL 2C3YA 5HBMB 3CJCA 3MURP 1KFSA 5DM7Q 4OZ2A 2QC3A 3NCRA 2EG1A 2BUNA 1REVA 2DBBA 3GSIA 4MAKA 4WKYA 2JX2A 3G10A 4B1YB 4ID5A 5CYJA 5IM0B 4KBIA 2PI5A 4KGKA 5THWA 4LF9K 4WFNL 1D9FA 3HT0A 4UY8T 1K47A 3TAGA 4H5VA 2QI2A 3SAFA 2VA3A 1FRLA 3NFAA 1OPIA 2QV6A 2H65B 4CJUA 3NCPA 3EKSA 2VQEK 1EARA 4ECTA 2QMXA 2MQPA 1O1WA 5DQIA 4Z0UA 4HH0A 4CT9A 4X66F 4F8RA 2G8VA 1X4AA 2QL7B 2WVEA 2E20A 1EIYB 3HVTA 2FHOB 1J6ZA 2ZWOA 1S0MA 3CMEN 3NGDA 3AAQA 2QLFB 1CQMA 1CC8A 3OY9A 3H46O 3G86A 1JK9B 5LSLA 1JJHA 1QHAA 2YWGA 1QTNB 1XEZA 4NCBA 3BB5A 2ZH7A 1VQ4N 2PYLA 5ITHA 2V9WA 3IR5B 5B8HA 4F4AA 2KN4A 4CERA 4K4XA 1PCAA 5JVGQ 3WC0A 4DQ8A 2MGZB 4KKOA 4A59A 1UAWA 4CEAA 1S1VA 2RE1A 1W97L 3V9UA 2BJ9A 3MTJA 4ZIWA 3WNGA 3A3NB 3DLLQ 5KFHA 4AF1A 2UYTA 2BKPA 3WQTA 2CPIA 1Q53A 3A8JA 1TL1B 2WW8A 3PIOQ 4CFDA 2KB2A 3N9UC 1F9FA 1E6YA 3O8MA 4X2BA 1DTTA 2E5GA 2VICA 4ZKAA 4L3KA 1P6TA 3D9BA 4EFAC 2EC2A 2Z8QA 4V19S 1E4GT 5C24B 5CABA 4G3IA 1UFKA 1NKEA 4EHUA 2O67A 1IJEB 4OYWA 3ZX0A 3RTVA 2K3IA 2VASA 1Q81O 4PQAA 2DGWA 3V6HA 5B0FA 3KYLA 4OZ1A 5M1NA 3VV2B 2WB4A 1T6DA 3U3GA 2AEJA 4K59A 3ZT2A 4KSEB 4MH8A 2POKA 2N4DA 3RB4A 4EIAA 2LA6A 1YF5L 1FRIA 3DRRA 5BPNA 1FKPB 3MCNA 4WCEQ 4A5BA 1KLNA 1RU2A 3KK1A 1RTZA 4CBWA 4M8LA 1C1CB 1LWEA 3LANA 5E84A 4Q2LA 5F3ZA 3SXLA 1LFPA 2JNJA 2WZ1A 2VONA 1RFQA 3M9OB 4OGCA 3FGUA 3L4IA 2HIYA 3R6GB 1LWFB 1U1OA 4PKIA 2MKJA 4HTJA 4NLSA 1DLOA 3CCUN 3EE3A 3TAMA 1VHXA 3LDOA 2LU2A 4BQLA 1OSDA 3NS5A 2J9DE 3OHRA 3I82A 4BDZA 2WVDA 5DRKA 4TVAB 2A3JA 3J8AA 2DIVA 1YIJN 3C15A 2DR9A 4FZYA 2JZ5A 4WXWA 3K7RA 2IYGA 2YJEA 3ZT4A 4CZKA 4DPTA 2ZWPA 2HSTA 2QRRA 2DNHA 1U7LA 3AVIA 1RSCA 3R5AA 3MPWA 2AJ0A 4MKBA 4RW7A 1HNZJ 3OR1B 4P6QA 5A8WB 1RHUB 2X3DA 5B7WA 1Q18A 2GTDA 3O6QA 2AQ4A 4FLUA 3K8VA 2NRHA 4DFJA 2KI2A 4JV5K 4FKXA 3C7NA 3I8BA 3L95X 2VH7A 3U7JA 4Y2KA 3IMQJ 3SUNA 3IRXA 4UF4A 4ZPDA 1HLUA 2W2MP 4N76A 4FWNA 2IAJB 2YNHA 4LF1A 3KJQB 3V2UC 4NOHA 1RBRA 3R7SB 2HQIA 3R7NB 3M30A 3P3DA 4LFBF 1RTIA 1FWKA 4OI4A 1X4GA 1FT8A 2K1RB 1R8PA 1C0FA 2WCXA 4IR1A 3B8HA 2IA0A 2B5JB 4DR7K 3W8PA 2B7BB 1SC1B 4N8OA 4GVLA 4JV1A 1EETA 5GIPA 1IM4A 3VEZA 1BE4A 4FLVA 2MJNA 2OP5A 3CCMS 2DO4A 4QIVA 5HMZA 2C2RA 5CYQA 1HPMA 5DLFA 1XR5A 1WI8A 4BRHA 3OXFA 3ZSOA 3BF4A 1QAIA 3B6PA 1RWXB 4ECYA 4ITSA 2DHGA 5H9FJ 1X5TA 1NZAA 3NGSA 3ZNUA 3HP6A 4HDHA 2KM8B 4CGGA 4CHQA 1VQOS 5AQVA 3ZSZA 5M1PA 5I3UB 1HJRA 4TY8B 4DKWA 2BDPA 3CJKA 1LW0B 4X64F 2ZJPL 2KG1A 1FFWB 5DO2A 3CIZA 1SQGA 4OYXA 1Q7YT 2CAJA 2MZTA 2NNWA 2B56A 4X64K 3Q8SB 2JRSA 1SH0A 3NGUA 4F9OA 4LRBA 3AVMA 1WSRA 3AVFA 4L3QA 1OIAA 3MEEA 3BS9A 2CQHA 3OBYA 3EDRB 2X7IA 4FPIA 4FZZA 3DOKA 3E9LA 3M8RA 1RAHB 3UR0A 2IRUA 2OLWA 2DCLA 2M8HA 2NYHA 2JVOA 3SZ2A 3VF0B 2WW4A 2QL9B 1VQNN 2KHCA 2UXBJ 5AQYA 4L72B 1RYRA 2J76E 3G4SS 2JEIA 4EAHD 1XNRJ 2HVIA 2UV8G 2VODA 4C23A 4YOUA 4CGJA 3OW2M 2DR7A 1CPZA 4HHTA 2AZ3A 2NRWA 4W5OA 2E5HA 4OYAA 4I6WA 3C6AA 3B82A 1HBOA 5KG1A 4WU2A 1TL3B 1K6YA 4NYZA 3KK7A 5ADZA 1NGEA 1HNWJ 1B99A 2Y1RI 3CW2C 4KO0A 4KPCA 4PXEA 2CH6A 2DRAA 3HD1A 5IQQA 1VSLA 2AP1A 5LMUF 1HBNA 1WG5A 5D15A 2BE9B 2MKCA 2VC0A 4BRAA 4OYOA 2HLUA 1FDAA 1ZBHA 1BUXA 3EGWB 3K0SA 3KLHA 3H5YA 4FK0A 1REVB 4J5OA 5HANA 4K7QA 3PR5B 2HWIA 2CNOB 5KI6A 3VA0A 1HHQA 4ID5B 3QFUA 4DU1A 4OI2A 4WTYA 5FJ4A 5HVFA 3PTWA 4FK4A 4OJGA 4GV6A 4PA1A 3CCJN 1UJ5A 1MLAA 1R8HA 4MDBA 1DQ8A 5AFUA 3VF2A 4CHYA 4NA3A 2AGPA 1SXLA 4C3MA 2FBVA 1VIXA 2LEPA 4FLZA 4U7UK 1BHLA 3KJVA 5SUHA 2BOAA 4F4WA 3OTOF 3DGVA 2VJUA 4DR3J 4CHNA 4Y3CA 4HT7A 1UP1A 2C2MB 3VQSA 2MQQA 3D2WA 3MF5A 4DX7A 4DG1A 3CMQA 4PPZA 1Y10A 1YG0A 2DNPA 4J2AA 3T6BA 3OYEA 3HVTB 1UL3A 3T41A 3X3UA 1UCNA 1HLWA 4LR9A 3JB9k 2GIFA 1FO1A 4OLOA 3P5BP 1K0TA 3NAHA 2A41A 2R7XA 3CDEA 4IR9A 4B9TA 5ELZA 1U02A 3T3FA 2G8WA 4M45A 2XSJA 2XMJA 3OFHA 4B8AB 3MAHA 1HI8A 3I0SB 1MA9B 4DL0C 1ZBTA 3U4LA 3CCQN 1K8AO 5KFDA 5HP1B 2DNQA 5FLXU 3J80Y 3GP9A 3E66A 2G8IA 1UEKA 2VKZG 1NDPA 4CLUA 2HHTA 4CFCA 2GVDA 1VC6A 3AVAA 4KKOB 3VETA 5CE3A 2P9LA 1WC0A 2HZAA 1S1VB 1NK9A 1BGXT 1RE1B 1B0TA 3FNNA 3TI0A 3QSIA 2XGQA 1XMQJ 1RP5A 3RRGA 5J1EA 2HQGA 5J2QA 2ZDOA 1WELA 1L3VA 4JI2J 4M3ZA 4UY8O 4QWAA 4FS1A 3GIRA 1U25A 4I69A 2VQFJ 1E6YB 4CJ5A 1DTTB 1NDLA 2H51B 1RWMB 1TK0A 1TVRB 1EQMA 4MK8A 1Y5NB 3MCOA 3SLCA 2DGTA 2HGNA 1YRXA 2D3O1 1BQMA 1CEZA 1FNOA 4PR6A 3VAJA 4H03B 4AH9A 3E9OA 4IWVA 2NZ4A 2BE2A 2NQPA 4NMLA 3MXMA 3GQCA 4HHHA 4OI0A 3ALYA 1WKJA 4OLBA 3A0IX 2BKOA 3DRRB 3I9V9 4WE1A 3HL8A 1TL4A 2ATQA 4KPYA 1YJTA 2V4RA 3CCWA 4AILC 5EWFA 3KK1B 3CERA 4WJBA 3UW1A 1JNZB 3E9PA 4BLGA 2KJWA 4ED5A 3THWA 3C14A 4RL1A 3PYEA 5KFXA 1N6QB 2CYYA 4LQ9A 5MAOA 4OZJA 2YX7A 2HWHA 1RWNB 4MLHA 4XPEA 1DLOB 1HNZF 3TAMB 4OHXA 3GJSB 3AVJA 1HNZK 4Z4IA 1RT7A 4ZJLA 4HVJA 3H2VE 1BL3A 1RBOB 2IJFA 3PW4A 4ZVRB 3C15B 2VWBA 3H3OB 1QVGM 4BRGA 3O9UA 2YJFA 1P1TA 4DX8H 3M8WA 1YJWS 2Q66A 4TNOA 2W2OP 4EMDA 1FJEB 2FJWA 2QTWA 3ETOA 1MWYA 3CE8A 3Q8QB 1KXPA 1N5SA 2E2OA 4ILJA 1YI2S 4RW7B 2YX6A 3OBWA 4C0BA 5EU7A 2V2ZA 3BZCA 4A8XA 3NHGA 1KKHA 2JVRA 4IFVA 3K89A 3BF3A 3TOQA 3WX4A 4CZGA 5AT1B 3C7NB 4CECA 2ZUGA 3BEGB 4CO3A 4C8ZA 3IRXB 2XMVA 1HQUB 1QE1A 1FKAF 3OL9A 3IN5A 2YNHB 2BJEA 2W7PA 3ZCMA 4DV0J 2MQLA 3RMAA 2HHWA 3QFHA 3QNNA 2NRRA 3M30B 4A8OA 3RW6A 1X5SA 1RTIB 1VI7A 4WYBA 4X62F 2AEMA 1S3XA 2ZVSA 5IOLA 4KAIA 4D3HA 2C2KB 5H9FK 2RMLA 3LZJA 4DN9A 1HFEL 4IH5A 4AQYK 1EETB 4QOTA 5CZXA 2QLWA 3ENAA 1FRJA 3HHLD 3W5XA 3HPOA 4DFPA 1I1GA 4A8YA 3CVKA 3HFZB 3VQEA 2F1FA 3NRBA 3O5TB 3ITHA 1Q4RA 1P27B 5EWGA 3P39A 3ZZUA 1UFLA 1F3VA 3WIVA 3KJNB 1A5WA 1Y00A 3RR7A 4LREA 3EWGA 1ZH5A 1L3TA 3CJKB 1S1WA 5GMEA 4DSKA 1HNVA 3KWMA 2ZE2B 1YBAA 3BZKA 3FZ2A 3UDCA 4K5RA 4CVNE 3F9KA 2UXBK 3RMBA 4KE5A 3MEEB 3VQCA 1WEYA 1QS4A 5ETNA 4DUZF 2AJ2A 3O4NA 1JLCB 3MR3A 1XNRK 4HTUA 5M1OA 3QGPA 2JFKA 5EUHA 1Z25A 3DAWA 1NJYA 3R9LA 3I56S 3MOJB 1H98A 4B17A 4CZJA 5HO4A 4PCQA 2GMHA 3RBDA 4Z94A 4HI1A 1HNWF 5I42A 5AZJA 1IBKF 1MROA 1ZPVA 2X6NA 1QY7A 4NLTA 1HNWK 2OO4A 1S6QA 2IFXA 2BRLA 4BC4A 3TVZA 2HFZA 4FYVB 3OW2R 3ENBA 1LQ9A 4NLRA 5K8MA 4QPXA 3U1MA 1EQ0A 3TU5A 3OYJA 1RUSA 3CMES 3WXLA 3FLCO 2B4UA 1PKUA 3OYFA 4USJC 1HBOB 3MPYA 1SL0A 1WAJA 3QB0A 2K06A 1XMOF 4RBUA 1JLFA 3T5HA 5L1IA 5KFWA 3MI7X 1N33J 3PIOL 1QUPA 1VQ4S 2Z2MA 4NLXA 2IYIA 4KO0B 2YH0A 3EXYA 5SZTA 1OY9A 2CJ9A 3BJYA 4QWBA 3ATUA 3MM8A 1Q7YO 4OZNA 4YB7A 1HBNB 2CQ1A 1RA7A 3HRGA 2E5IA 2GNKA 2KT3A 4W92B 2OUGA 2KTQA 1RTDA 5K5MA 2QFJA 3K5LA 3LW5C 4IRKA 1VLYA 3JSBA 3D28A 4F3OA 2MKYA 4FF4A 3KLHB 5E26A 4FYDA 4LF6J 4CF1A 3OYGA 2DNMA 2DNGA 5JMNA 1YAGA 3LALA 2BQUA 1RACB 2A1BA 4MIAA 4GW6A 1WUAA 3CM6A 4OI1A 4KI6A 3FQKA 1IN0A 4DR2J 2XHWA 4BC5A 1EJ7L 3CETA 4DR3K 3B6OA 2GHWA 3TZXA 4DV5J 2R9LA 3BH6B 1F2GA 1G3OA 2P9IA 4DCHA 4WK1A 4LSNA 3CJ0A 2WFBA 4JK9A 2XM3A 2Q97A 4E7LA 4CJLA 1YHQN 1CXUA 1HL6A 4QQBA 2V8GA 5M1KA 3PHEA 5I3QA 4PWUA 2WSCC 1F6TA 3F0NA 3DXSX 4DG1B 3OXGA 1LW2A 4OFZA 1WUUA 3KOAA 2H5EA 2FY1A 2VPZB 1V5IB 5M2RA 2ZC4A 3CCUS 4QIGA 3TEHB 2Q3SA 4WP3A 4DXLA 2EKYA 4JHDA 4M5KA 3PRVA 5BXIA 2XZDB 2HS4A 2WVFA 1DJ0A 3OR2A 1XC9A 2MQ8A 3H59A 4E7HA 2K8GA 2XSJB 3A8IA 1XMQK 5DGAA 4KHPJ 1FFSB 4QAGA 4JI2F 1XWLA 4EEYA 4OYIA 3CJ3A 4JI2K 3AVKA 3NF8A 2O8FA 5KG2A 2VQFK 1SIWB 4PYAA 1PYSB 4UOHA 2GVDB 2ATCB 2DH7A 3CD5A 1ZTWA 1FE0A 4AYBD 3HKWA 3IFRA 3KLFA 4A8KA 4DV4J 3CMAS 5J1EB 5J2QB 1U1RA 1ZYQA 2F8EX 2C2ZB 1Q1KA 1LAVA 2PEBA 3TUZC 4F0MA 1T9UA 3DWLA 1N36J 4CT8A 2L48A 4K0KF 2IVMA 2B7CB 4QIWD 4BGAA 3QIOA 4MKYA 2OELA 3VEWA 1RKIA 1BQMB 3EZWA 1KR4A 3R6LB 4NLBA 5DQGA 4BVOA 4OO1J 4ZCMA 2BE2B 1S6OA 2BYCA 4NB4A 2J0XA 4K25A 1TL7B 4YOYA 4CO0A 1S4EA 3GZ7A 2AJQA 4WE1B 1D1UA 1X4FA 1Q8LA 4IDKA 4BE2A 3D2EB 1RAJA 4WQ4A 4CNYA 2OPSA 4FCYA 3NGRA 3AGKA 2GEMA 3MGJA 4RX6A 4ZVQB 1FE4A 1YX2A 2AX1A 3THWB 1HHTP 4LH4A 1VQPN 2FF6A 3BBFA 3G82A 4ED0A 4RW8A 2X6SA 2HFOA 3JQJA 4ZP9A 3Q7BA 2Q0UA 4A2BA 2BANA 5FD1A 2FBTA 3SJJA 1M5OC 1YVUA 2IC3A 5LL6d 1RT7B 4H0XB 3SUQA 2RVJA 1BUPA 3HCXA 1NLKL 2G2OA 3G6XA 4RUAA 2QM1A 2QWMA 2R7RA 4DV0F 3W60A 3J80U 3MR7A 4CEZA 4DV0K 4DR4J 2PAVA 1SH2A 3SQ1A 3PIPQ 1T03A 1ZTTA 3W3DA 2QG9B 3VQDA 9RUBA 2RS8A 2CJAA 3PJWA 4I7FA 1NHUA 1VQSA 4IFVB 4GKJJ 1VQNS 3FMBA 2HFUA 4I6MA 2ZOGA 1RHRB 3FGVA 1XMBA 5EX3A 1WEZA 2PMHA 1GLBG 3I31A 2VB6A 1QE1B 1ZAXA 4OJHA 3O9RA 4H5RA 2P1JA 2CWXA 4MIBA 4XDDA 1LKZA 2P9UA 4RG8A 5GVQA 1X9WA 4CJRA 2ZH8A 3DN9A 2LXUA 1IUJA 3MR5A 2F3JA 3NCQA 3DJCA 4DDFA 3V9WA 4AUKA 4CJTA 1DQAA 2JWNA 3KLGA 2B4JA 1CC7A 4RNNA 3OHAA 2QJ3A 4USHA 1ELOA 4BBYA 2KQ2A 3TTFA 1VQ6N 3B4DA 3S01A 2QO3A 4EWTA 1J9AA 5HAOA 2ZZTA 4RUBA 2E6MA 4H4OA 4KIAA 1EKSA 1G6BA 3R7BB 2DITA 3S6EA 3ID6A 2WAQD 3TPQA 3KUGA 5AQMA 2XNQA 3HBTA 4RPFA 2W9BA 3AAWB 2OH2A 3AA3A 1S1WB 4C0HA 1HNVB 3TWHA 4QWDA 1TK8A 3HTVA 2DFFA 2OSQA 2V0NA 4KH0B 3GR0A 1UVJA 3CCJS 1M5KC 1NOZA 3M8QA 4O44A 1GXTA 3CCLS 5F0XA 4USKA 2IJRA 3D4JA 2HQCA 1TUUA 1OVYA 3I96A 3ILOA 5FROA 2QW9A 5BRFA 4OQJA 1QM9A 2HGLA 4XK8C 3LP2A 1WI6A 4F7VA 5I42B 5AZJB 1FXDA 3G71S 1N33F 3G8SA 2V8PA 1CJTA 4J7CA 4N77A 4C8MA 1S10A 1N33K 4K50A 1YJ7A 1MSWD 3BBBA 5IS2A 2FSJA 3V1RA 1VDHA 4K4YA 2OJ3A 1WN7A 1X5OA 3VESA 4QWCA 1O0PA 4IFEA 2FC8A 5SWMA 3I33A 4ATNA 4M7XA 1JLFB 2VF3A 5LXRA 2E44A 3L3UA 4D3GA 1JJCB 1KWMA 3CCQS 2UV8A 1WBBA 1BG3A 1NKCA 4LF6F 2QLJB 2MKIA 1QTMA 1Z05A 4LF6K 2M9KA 5KT4A 3S3NA 2W9AA 4DMNA 2YKNA 4CZHA 2VWKA 2LQ8A 3TO8A 1CULA 3MM8B 1YSJA 2D5RA 1K73T 3NVKA 2EBEA 3TUJC 1W9HA 3KK3A 2VBXA 1I94J 4DR2K 3W65A 4ED7A 3PLAA 1RTDB 4ZCLA 4DV5F 2YNIA 4JI8J 4A46A 1UWBB 3VR1A 1A5XA 3VQTA 4DV5K 1UTAA 3BDPA 3O5BA 3UDLA 3RAQA 4FNHA 1L3SA 2HG4A 4PG8A 3W9IA 1AROP 1KCFA 2DEJA 1IG8A 3SI8A 3GG4A 3GE9A 2JOQA 3ENQA 3G8TA 5AQUA 3PY8A 3G2XA 3PX6A 2JEJA 3ULDA 3JSRA 3R5GA 4KHRA 3QDKA 3BBCA 3NS7B 2RDJA 4UZCA 1HWLA 2GV1A 1ATSA 5AQKA 5KFKA 4OYPA 2RF2A 2YHBA 2P9IB 4JKFA 1OH8A 4CJPA 4LSNB 3MR6A 3N6LA 3CJBA 3MD1A 3DLGA 3MXIA 4YR3A 1JJ2R 3CHWA 3PX0A 4KHPK 2CJXB 1X3MA 3RUBL 4DS5A 1LW2B 5JMVA 4E7IA 1U0HA 4OYZA 3DHWC 2E2PA 3NGZA 4PXCA 3QICA 5E3AA 1F9EB 4GY2B 2XTJP 3EGVA 4DZ6A 4E1JA 5LMNF 4JHDB 2F96A 1CLFA 3ZTQA 4B1VA 1HBUA 2D3ZA 3T6JA 1HYZA 1AYEA 2R42A 1FVQA 4OI6A 2EFQA 3OR2B 4Z37A 4DV4F 2WONA 2RHSB 4WZMA 1KEKA 4DV4K 3MWTA 4CJ4A 3KTQA 3A13A 1J2VA 4KT0C 4ZTJA 2CPJA 2FGOA 3IGNA 1N36F 2O8FB 3ULEA 2ACMA 3EMTA 4O4GA 2XI3A 1C0TA 4CZFA 8RUCA 3HZ6A 1PYTA 1N5YA 2P9NB 1XN9A 3I55S 1R27B 3ZEUA 3LQVA 4LFCF 3QQCD 5A2QY 1ZZFA 3KLFB 3L4QA 3Q7CA 4I4BA 5HSPA 2AJFE 1YWXA 3OSPA 2MEWA 3VALA 3RR8A 2A6MA 3AVHA 4F26A 4LF4J 1VQ8N 1TP7A 4YN3B 1RABB 3ZT3A 2UUAJ 3DDKA 2MDAA 2DGUA 4ILGB 5I3PA 1YJNN 3MHYA 4I6YA 1OVQA 2ZFHA 2IM3A 3H5UA 3D66A 1NMEB 1NLVA 4GO7X 3C95A 5CCLA 2Q6BA 2QN6B 3VAKA 1GAOA 5HATA 1WOOA 3KDOA 3OD2A 1NAQA 3EL2A 1YJRA 4ED1A 3H98A 4IDKB 3QYYA 1YJ9N 1RDDA 2MYFA 4ZVPB 3VEOA 3F5TA 1GMWA 2XMUA 1RDRA 4DV2J 2QXFA 4U95A 1NK5A 4IDHA 1S59A 3K5PA 1LNQA 5CH7B 4DPXA 2W6KA 3G82B 1RWUA 3T1YF 4NEZA 4DR4K 2BE7D 5AJ3J 3RAMA 1V9OA 2I1RA 3Q83A 4C8LA 3NEKA 2WSEC 3CNQP 3UFCX 5DQHA 3RRKA 4GKJF 4HACA 1D09B 3LWLA 4FJ8A 3MMVA 4GKJK 3GWCA 3WUHA 1NNDA 3CO9A 3HFVA 5AXNA 3SQ0A 2F8TA 3Q8VA 4ILRA 4P52A 1C1BB 4FWOA 3SNNA 5HI7A 4JI0J 2N7CA 2W6LA 3I32A 2E1CA 4PRFA 4AHSA 1P8GA 1T03B 3NVMA 2K2PA 4QYRA 3CXCR 5BRHA 3KG1A 4I7FB 2XC9A 3L0QA 4PG4A 4CLYA 2FSNA 4I6MB 3CCVN 2RSQA 3CEDA 1M5PC 1XQIA 2XZTB 2YHWA 3W1YC 1VQ7N 1FXRA 4DU7A 3UD5A 1KDNA 5JJBA 4K4ZA 2ITMA 1Q8BA 2ROEA 1Y9OA 5J2NA 2VFUA 3GJTB 1EB0A 3CQYA 2MZRA 1JXLA 2UXDJ 2F9JA 2P9UB 3K9KA 4QS7A 4CZMA 1DTQA 2EC0A 4OZLA 4O3SA 1VQLN 2C3UA 3CGIA 4FJMA 3GPAA 3SCJE 2R3VA 5HMXA 3ZC4A 2EEYA 4IJNA 3KLGB 3GYXB 4JK7A 3I5BA 2F8SA 3OA9A 2B51A 1DBDA 3QRPA 1X9JA 1H38A 4M3UA 2BJ3A 2GAHC 2KW4A 3NH0A 1NU4A 3DI6B 2BX6A 1NBEB 5HN0A 4M5HA 3VTHA 3KMQA 2DNLA 3HSGA 5H1SV 2DFEA 3KD1E 4Q0BA 2ZWHA 2OTJN 1Y3JA 2XI2A 2W9BB 3GFZA 5BR8J 2ERRA 3K5OA 3HHNB 3IP0A 1ROFA 3AVGA 2XMMA 4GC7A 3GONA 2DD8S 1VRUB 3ZFVA 3GBTA 1H74A 3ET6A 1AFIA 3M8QB 4O44B 2W1BA 2ZJQL 4GMKA 3I87A 2MZ1A 4NO7A 1WHWA 2UU9F 2DPNA 1QAYA 1E6VA 1U24A 4JN4A 1I6JA 4K42A 1JLBA 4CJFA 2LA4A 4LF2A 1YHQS 3LP2B 4ZPTR 2XY5A 4QPTA 4QWEA 5D4LA 3ZX2A 1YITN 5DZ7A 3PX4A 1CJTB 1FTCA 3W66A 1KONA 2NS1B 4CYUB 4YB1P 4JS5A 4QW9A 2DHHA 1TZ0A 4ECZA 5HRPA 4KH6A 2HFVA 1RADB 4K2JA 3H4DA 3QINA 1ZC6A 3W9JA 4OI3A 2OYQA 4NL5A 1JL1A 1VJWA 2W9CA 1I94K 4HLBA 1H0HB 4DL6A 2OCEA 1EQYA 4JOUA 3MZIA 3RRHA 1YUWA 4JKGA 1GMUA 3P8BB 4JI8F 4YOWA 2ZBPA 3GYGA 3ADAC 3ZZOA 3SFGA 4H0VB 2WK4A 1PJ6A 2GFFA 5D0HA 1K1QA 3W2VA 2YKNB 4Y2CA 3VOVA 1RHJB 4MYTA 1NGBA 1YT3A 1CULB 4GMJB 3T5JA 4F4YA 1T9YA 4I6AA 4RCHA 4B3RJ 4MIWA 4UQGA 2F40A 2D7SA 3KK3B 1UVLA 3DMJB 1OH5A 1NSPA 3H0PA 3H42A 4DSEA 2UUCJ 4OV1A 4W4MA 2YV0X 2YNIB 5JXSA 2PGCA 3CC7N 4ZDNA 3WQPA 5DM6Q 5B08A 4R5PA 2OPRA 2DPJA 3GL1A 1T95A 2E1AA 3VAIA 1GEHA 2XYGB 1JLAA 2UUWA 1ITPA 2H54B 1WF0A 3WZ0A 1RCXB 3A3OB 2KHDA 4J9QA 4IH7A 1GOCA 3L4BC 1HBMA 3A12A 2XLIA 3KNGA 4UTGA 4AL6A 2XWXA 4CJEA 2RF2B 3Q23A 3GIMA 4OX6A 2CADA 1VQ9S 1NJIT 5AQFA 2YX4A 1UFWA 3K2YA 3DLGB 3AJ2A 2G8HA 4Q43A 2N4CA 4PG5A 2WSFC 3O1LA 4P2SA 5KFUA 4DLGA 4LRAA 3R8EA 4CO2A 2XLKA 2QSWA 4Z7CA 4NI2A 1VOMA 4LF7K 4ZOSA 3M2VB 4LIWA 4CZCA 3J81Y 2N3OA 1W25A 3VQAA 1U0HB 4IG0A 1VC0A 4NYOA 2DGSA 1U2VA 1K73O 2RRBA 3D54A 1HBUB 2UUBJ 3L2UA 4HCCA 3BGLA 3R6MA 2F7VA 5DETA 3ZXWA 1JXVA 1WC6A 2WONB 4FZVA 1EP4A 4BR4A 4NXMJ 1TGOA 3BR9A 2CVEA 3ZZRA 1ATRA 4LF4F 2IVNA 4JYAF 4B3SJ 2UUAF 3HMJG 4LF4K 2V6AA 3ULEB 1S9EA 4C2MA 2UUAK 4O4GB 4MJKA 4CQ1A 1C0TB 2P6TA 2MKKA 4MLEA 2O8EB 3ZEUB 1IXKA 2OMOA 5BN9A 4DMZA 1UZDA 4B1UB 3Q8PB 3HZEA 4OLAA 4C8OA 2VIHA 4TY9A 4ISEA 4L73A 4WF9Q 2IDOA 5FPDA 5ETSA 2CQDA 4CFAA 4QJVA 2GELA 4MT1A 2X74A 2G0JA 4CF2A 1BY9A 3BKFA 2HW3A 2P9SB 3HVAA 3K5MA 1OO0B 1NGIA 1V4SA 3NMUA 3LDLA 1W7WA 4DV2K 1VQYA 2M4MA 4B9LA 3EE9A 2VDHA 4PL8A 2VYPA 3TSUA 4JLHA 2B6AB 2RN2A 5L46A 3CJ7A 2DRDA 2ILYA 5AJ3K 1TQLA 3M2UA 3M4XA 1FX4A 4WFAQ 5GADP 1TKTA 2ASLA 3QT6A 5K8OA 3PJXA 1RDUA 1S9FA 2M52A 3OVSA 2I0XA 4O0NA 4OZ3A 4FNIA 2P2CB 4JI0K 5E3QA 4F0HA 4RZRA 4ZVOB 5IT9O 1R8BA 4BWMA 3MMBA 1HNXJ 4WFNQ 2MXYA 5DDOC 4HACB 1TUWA 4Y2MA 2AZ1A 4ED4A 3KIOA 2GO8A 3KUHA 4URSA 5J1NA 4CBXA 1NXIA 2Q3PA 1QLNA 4BRDA 2YQ0A 4ED6A 2YI1A 1MN9A 2IM0A 3I5CA 1G4CA 1TKZA 5CYMB 3OFGA 1KQSM 1LXJA 4A8MP 4OPKA 2UXDK 1QAJA 5A2QU 2HAFA 1RBVA 3LGMA 4RO0A 3BZQA 3UD3P 2F4FA 3MMJA 3AH6A 4X4VA 2XZWA 2HBLA 1RGIA 4AL7A 4DTRA 3FSYA 3TABA 2AEFA 1X7VA 1RT5A 4I56A 3ZZTA 4WPAA 1TMJA 1BMQB 5J2NB 5AQWA 4DEZA 4FM1A 3EXCX 1DTQB 3HOSA 4KV8A 1CXQA 3PW5A 2KLAA 3OJSA 1IQZA 4FWLA 4DF8A 4B02A 3ZETB 1B3TA 2R2RA 1P9YA 2RUSA 1N32K 3P1GA 3M05A 3LL3A 5BR8K 4U6PA 3QLHB 4FVMA 4DPYA 1MNEA 2YKAA 1PBAA 3RJMB 1PJ5A 2NXUA 2F4VJ 2ZDPA 4QR1A 2UVUA 2CQIA 4YY3F 2H3GX 2WUSA 4X65F 4JI7K 5KG4A 3TYTA 1YDLA 2MQMA 4NA1A 1HW8A 4TU7A 4AT1B 4YHHJ 2DRBA 5LSRA 4Q0BB 4IRDA 3BYPA 4NLOA 3FZBA 1KBRA 4C8NA 1TV6A 2B9YA 5G0RB 2XY7A 4CF8A 4GVEA 1JLQA 3PUFA 4RWXA 1QSSA 3R8YA 2HHVA 3V6DA 3QIPA 4IYQA 1Q86T 3ET6B 3IAYA 4ZVTB 2Y8WA 3TA2A 2AHOB 3S9HA 2P9KA 1WF1A 1U8SA 2LYVA 3FJ2A 3C46A 1JLBB 1ZM3A 2ZBQA 1U4BA 4DV1J 1RB0A 4KQZA 4CLPA 3P5JA 4LF8J 1O13A 2XGPA 3AY0A 1RBSA 3HKZD 2Z2YB 2VG7A 4JKAA 5C25B 1VYAA 4DR1K 3A4TA 4TYBA 5A6PA 1WNSA 4WTOB 4EGLA 5AE1A 1Y4ZB 3Q8RB 4WFZA 4U67Q 3MM5A 1SC4B 4B3RK 5TKWA 2B3TB 1LV5A 4IZ9A 3EEQA 2RJZA 2W9CB 4JRPA 2UUCF 3SMSA 2RH3A 4JKGB 5BYSA 2UUCK 1F3FA 1NK4A 3O8WA 2J0WA 1UA0A 1WC4A 3JXUA 1HW9A 3FC9A 3CG7A 3W61A 4ETXA 2K7KA 4B3TF 3A2FA 3C65A 1U26A 1RK8A 1B64A 2J8AA 4F4ZA 2IM1A 4CK2A 1W2IA 4CIOA 1TFWA 1VQ8S 1VQMN 5KOXA 5AQQA 4R5PB 2OPRB 3CM5A 5KFPA 1JKHA 4O8KA 4ZJQA 4DV3F 1YJNS 1FHTA 2FTRA 5EVZA 1IG9A 1JLAB 1M1HA 1VQON 2XWYA 3U9DA 4CTAA 1RU1A 3C6UB 3S1TA 5U47A 2DNNA 4MK9A 4BRLA 2KT5A 5GAEI 4B9VA 3T1HJ 4GVBB 2G1DA 1E4FT 3ZZYA 2FVSA 5GAEU 1MW7A 3ISNC 4CCHA 3AA2A 3FEYB 2KYXA 3WBZA 4USWA 5D4NA 4RNOA 4TLRA 3P4IA 4FPBA 2NRXA 1HRHA 1H6KX 1YQHA 2UUBF 2CQ0A 2R8JA 3NWRA 3PXGa 4A48A 3VZIA 3O9SA 2UUBK 2DH8A 5I4MA 4BRQA 1TAUA 3N4WA 1C0MA 4NXMF 4RNMA 4NI2B 3SSSA 4J9KA 3VQBA 1RDCA 3T1AA 4NXMK 2GGPA 2ZJPQ 4JD2A 3PSFA 4A62A 1H2UX 1X1PA 4IQMA 2CG8A 3T69A 1PC4A 4B3SK 4ZS6A 1D9AA 3GFXA 1YVFA 2PT0A 4LF9J 3G4SN 1GXLA 4K43A 5AFUH 2V4JB 1S48A 3HHLA 3BUZB 3T7ZA 4UOFA 3MDFA 1WDTA 2A6OA 1EP4B 1R8CA 3SV4A 1IH7A 4MMOA 4DL5A 4ZTFA 2E29A 3VGUA 3BQ1A 2ZITA 4M95A 4B3MJ 3QJLA 3KLEA 1SKSA 2HHHF 1BA0A 1WTFA 4USIA 1IR1A 2MPUA 2DO0A 1H7WA 4IBNA 1IBCB 2HSEB 5C2DA 4W5RA 4TQRA 3TZZA 3NGIA 1N34J 1VQ7S 4JKBA 1FF2A 3MK6A 1R0CB 3DRXA 3IS9A 4XEIA 4KHSA 1NRKA 1GH8A 4H0PA 4WBFA 1NJIO 2VPWB 1RCOB 4FYXB 1LFWA 3EGNA 1GOAA 1VQLS 3T9NA 1FWPA 3LZIA 1ZBFA 4ILHA 1M5VC 2VV5A 4Y2AA 1RILA 4OPAA 3UKUA 4E1MA 1ZA2B 2P5GA 3OV7A 1I51B 1QAXA 3KJFB 3N6NA 5HJYA 3S41A 3LM2A 2A40A 3TA0A 4UT4A 1AXQA 4FWRA 1X31C 3T5LA 3M2UB 1HNXK 1TKTB 2X51A 2VFRA 3F56A 4ZMMA 3QT5A 4R25A 3CD6N 3R1LA 3RB3A 3J7ZO 2H4WB 4KHWA 2W4DA 2C28A 4FVUA 4N47A 1J54A 2HHUA 2OTJS 5KGXA 1HPZA 2D9OA 2GIQA 2MHNA 1BQXA 5CQGA 2M0GB 4DOZA 1ZOTA 3HSTB 5M2UA 4ZJOA 5KFYA 4C8YA 1WC1A 3V5RA 2QA2A 4U7BA 2NPFA 2YVSA 5F0UA 5C0YA 3QZ7A 2QWOA 3NWGA 3O2IA 4KH5A 3TVKA 4JI6J 3EPGA 4WQ5A 4ILMA 1RT4A 2V52B 3LUYA 3NBPB 3HJVA 4M3TA 3SQGA 3TUIC 1ZM2A 1QSYA 3LDPA 1TKZB 2XRIA 4AM6A 3PW2A 1YITS 4ANDA 3SFUA 3WDOA 3SQOP 3V81A 1XJWB 2DY9A 3I4HX 2JL9A 3MCMA 4CEEA 1RT5B 2YXLA 1HD1A 2C3OA 5KT5A 3MMCA 1K8KA 3M7VA 3C6HA 3O08A 3K17A 1BWVA 1RBTA 3QJPA 4FSVA 3HXMA 2F4VK 3N0VA 4YOEA 4TXSA 4KV8B 2H5IB 5KFIA 4OHYA 2PBDA 2HVEA 3VPZA 3NG8A 4YHHK 2QXLA 4FXVA 4B1XB 4NCGA 3W2WA 3E8OA 4IEIA 4Y1DA 4CO5A 3CDWA 4B8CA 2M3DA 2LP4A 4DQQA 1MU2A 1FESA 3EICA 5AQTA 3WNHA 4DTMA 2VHGA 2ROGA 4IO9L 1IKVA 1UVMA 1FXLA 5EWEA 1TKXA 4HUGA 4LBPA 2D1KA 3FRYA 3OTEA 2YH1A 3EKUA 4ZVUB 1H2VZ 4F67A 2NUHA 8ATCB 3CC7S 3FZMA 4DV6K 2HBQB 4ZVFA 3R2DJ 1TV6B 3KFWX 3SBMA 4JI5J 2HBYB 1NK7A 3CI5A 1JLQB 4HCBA 3K5NA 4DV1F 4K4TA 2BM0A 3Q86A 1M90O 4DV1K 3MCSA 3V6DB 3QIPB 3R97A 1WBDA 4LF8K 1DT9A 3LP0A 2ZKUA 2B8PA 2YWHA 3DLEB 3PRDA 4LQ3A 3LPTA 4AXJA 2CZVC 5JLHA 2J7UA 2P9KB 4Z7YA 1SKRA 2Z2LA 4QBUA 2L9WA 1VBYA 1T9WA 5BREA 1Q7LB 1GT8A 3HSCA 2BABA 4I67A 3PSIA 1YI2N 3T19A 1WACA 3A8EA 1DAXA 3CC4N 2HQFA 2VG7B 1YRTA 4L3NA 4NLWA 1HR0F 1ILYA 2HBJA 3OTCA 3HK2A 3SYZA 3FRZA 1SB6A 1H7XA 2MHEA 4HT5A 1WNEA 3M2RA 3MM5B 1FNXH 4FZXC 1NOYA 3H6EA 2Z2ZA 2BRKA 1SUQA 5GMKa 5K14B 2V9KA 1SCJB 4CLKA 5J2MB 4WF9L 2OZMA 5GADI 4BE1A 4FJ5A 3AJDA 2LXIA 5GADU 2G8KA 4C3KA 4Q8EA 2ABYA 4JKEA 1KQKA 1SQFA 5E3PA 4CJWA 3CJQA 2A10A 3DDNA 5LXYA 2QWLA 5H1SQ 1KC8O 1WHYA 3UN3A 3DRPA 1FD2A 1BIZA 2QMWA 3TX0A 4PWWA 3VAMA 1RDWX 4OYBA 2ZUAA 2K7JA 3P83D 2J0QD 3IWNC 1V5VA 4H0OA 2FVQA 3QAUA 2I9SA 1W0HA 3T1HK 2DXFA 2WBNA 4V1Ak 3V9ZA 3AJ1A 2F5GA 3DYAA 2Z56B 4RBVA 3OLAA 1PC5A 2EKNA 3QFPA 3D7EO 2LKZA 4QU7A 1C2PA 1NPPA 1VMBA 1D5AA 3DOLB 1JKHB 5BR9A 4J9UE 4J2DA 3MWPA 2CJKA 2ZH3A 2MZQA 2Y0SD 4CTAB 1OMSA 4M7YA 4J9OA 5AE3A 4I0WA 5E0OA 2G1HA 3QRQA 2V68A 4FBUA 1KVJA 4K8ZA 4DS4A 2PC6A 4I64A 3VGKA 2KO1A 4AHRA 4FJHA 2A2DA 4LF9F 3OYKA 3IBFB 5ETPA 4ICLA 1NH7A 3I56N 3HT3A 2VQEF 4O5FA 5T7LA 3RAXA 4KTWA 4DFKA 2GGPB 5B0EA 4JD2B 5JVHL 4ZPVR 4B3MF 1FD8A 2YWEA 3GR1A 2OPQA 4B3MK 5E2QA 1I3AA 3L6QA 2EI5A 3BN4A 3FQLA 3M8SA 3PRBA 1Q9XA 3HHLB 2KXNB 4C6AA 3AQPA 1NSQA 3HHDA 2B9EA 3AGRA 1WSEA 3J7Z5 3J7AN 3PEHA 1N34K 3CCES 2V34A 1F2HA 2GVZA 2NXNA 2A18A 2FBXA 4JKDA 4DPOA 3KLEB 4X84A 4J91A 5F0WA 4DL4A 3MM7A 4YDUA 3VVUA 3MPDA 2HMIA 3GIKA 4UUWA 3IR7B 1EX4A 3FZFA 3PFEA 4CBUA 5CXTA 2DGXA 3H7HB 5H9EJ 3EDQB 2HOEA 1U8WA 3V6JA 2VOOA 2L3MA 2BJDA 4LT6A 4BC7A 4I2PA 4TYAA 4ES1A 4OVLA 3UNGC 2E1PA 4DTOA 4LFAJ 4YDUC 4Y0FA 4UQTA 4MFBA 3SCIE 5EXWA 4KHYA 2UXCJ 2IVFB 3W8GA 1HD0A 3AVCA 3O3FA 4RW4A 3AO2A 1KS2A 3GILA 3UKUB 3NH2A 2HKEA 4CWBA 2OIHA 2ZKTA 1ZM4A 1I5OB 1TKDA 3BO3A 4CEFA 1TUVA 2PO4A 2FJAB 2E9RX 5C15A 1SJ3P 4P73A 3NH1A 4ZVSB 3J81j 2KFZA 1TFYA 4M63C 3LDQA 1BISA 4NWBA 1JQGA 4P74A 4CF9A 3BSCA 4JI6K 1HPZB 4FJLA 4BACA 5AQGA 1WB9A 1KVAA 4DQSA 3F2KA 2HMPA 2HB5A 1F1BB 3BV8A 2FVRA 1KD1O 1T3VA 3QWUA 2VPXB 2ZJRQ 2OEKA 4KGXB 3D6RA 1SC6A 2N7YA 2W7AA 3ZNJ1 3KVGA 2ZBIA 4L6V3 1BU6O 1HA1A 2FHMA 1X4DA 3EZUA 2R2SA 1DZ5A 5F8GA 3UKRA 5BPLA 1RT4B 4U67L 2IDEA 3JQKA 3SQGB 4CGFA 2A6AA 1NK0A 2FY8A 2VL1A 4FYWB 2NZCA 1QQNA 3R3LA 4S0MA 3U27A 5KG5A 3MN6A 3THVA 3SUPA 4Y6IA 3I4PA 2QIFA 3UPFA 2XBPA 3E51A 1OY8A 3ETMA 4L75A 3MDQA 2H5JB 4MO5A 4JV5F 3V81B 4FJ7A 2COLA 3VGMA 3V4IA 3QBCA 3I6PA 3CMAN 3R3TA 3CIMA 2LQ5A 4BGBA 3MMCB 1K8KB 3N4QA 4FJIA 3JYTA 4CLZA 4URGA 3QESA 1X9MA 4C11B 2R4FA 4ECWA 4BR0A 4ZLPA 2VU5A 4NASA 3D6MB 3ENWA 4L74A 4X4RA 1K9MT 3EY1A 3UE2A 4DR7F 1RAFB 4KH1B 1ATNA 4NCGB 4Q2MA 3W2WB 3TARA 5FDLA 4JI5F 1HQEB 4JI3J 1MU2B 3D1QA 4JI5K 1KQFB 3TSQA 2ZQBA 1IKVB 3JQMA 3VWSA 1HQ2A 4PKGA 2RAQA 1UWAA 1RT1A 1VRTA 3IA0A 3PO5A 4IRCA 4GRSA 3MM6B 3K2PA 1VQMS 2G13A 4BRKA 3G9CA 3HPHA 2DNYA 4AQYJ 1Q95G 5D3GA 1TYQA 4QR2A 5KFRA 5EN1A 3U6FA 3O9TA 5KGWA 3LP0B 1S1TA 3ZT1A 1B92A 3CCZA 4Q8FA 4E89A 3KD5E 5DMRA 1NMNA 1Z2LA 4RWTA 1WSHA 2XMAA 3CJ2A 3OS0A 2V2VA 1JIHA 2AYBA 3CQXA 4I9LA 2DKOB 5IT0A 1IKYA 3K9JA 5EGYA 5IWAJ 2WBRA 3PM9A 1FDNA 2XSFA 3IBWA 1HMVA 2CWKA 2FIUA 3N28A 4V19J 3J81O 2M7SA 2HHQA 3NGKA 4J9NA 3NMRA 1G1XA 3D2FA 2R7SA 1IBLJ 2YBVA 1C0UA 2DR8A 1L3KA 1SUQB 3H40A 4FPAA 4O3RA 1S99A 1S49A 2HRYA 3DRSA 2EWHA 2RILA 2JEGA 2KZMA 2V7YA 2OPPA 4IJAA 5B0CA 4ERDA 2DY1A 3DRPB 1O8BA 4YUDA 3MEKA 4BRNA 4DTJA 4DWIA 5KT2A 3PVXA 5HLFA 3QBXA 1X9SA 1U1QA 2NPIA 5LT5A 3OUYA 4A8FA 4OGEA 2LLZA 4CK3A 2GC8A 3CJ1A 3MEGA 1CZ9A 2H4YB 2ZH4A 1XQSC 2CQPA 1HNIA 1QDUB 2C2NA 2J7KA 1DHMA 1R7IA 1VK8A 1GFWB 2DGOA 1ZXOA 2OEJA 5K20B 4DTXA 3NF7A 4CE9A 3PDNA 4PKDB 2BXJA 1LK7A 3IRWP 3ZYYX 4F36A 3OFFA 2WC9A 3UCZP 5DK5A 2ROPA 2NREA 1YK9A 2HVDA 3DU5A 1WC5A 1XC3A 2CPHA 1PJ7A 3LA0A 3OQ2A 4U7CA 3CCLN 2CPFA 5DLGA 3GDQA 3CD6S 2LQ9A 5T7LB 1JLGA 3THYA 1ZBLA 4M5NA 2MKHA 3SBGA 3JSYA 3EVMA 3G71N 2OPQB 2H48B 3NNCA 1BHNA 4H5TA 3H1QA 4ANCA 1WAFA 4QU6A 2I7PA 3UQSA 2RQMA 4NLUA 3THXA 2DYAA 3DKDA 1D3WA 2VUGA 5B09A 1URRA 1CVJA 5ETVA 1M5HA 2J6SA 5E5NA 5H9EK 3PEJA 2QA4G 1TK5A 5FRNA 2HNZA 4EBCA 1CS4A 1VJQA 1IR0A 1Y11A 2GVZB 2Q1NA 3RMCA 3FDSA 1OQ6A 2NRTA 2F7TA 4B08A 2ASJA 3W64A 2UVRA 2R7VA 4KC5A 1REGX 4PZVA 3C8YA 3KG0A 3VHQA 4LFAK 3MEDA 1Q8IA 5KFNA 5FPEA 2UXCK 3M8ZA 2E7WA 2ASOA 4F2RA 3QEPA 2VFVA 2LDIA 2V8VA 1NDKA 4XTTA 4A5AA 2DK2A 3AB4B 1VSEA 5CR4A 3B6BA 1QSLA 3FBFA 1J53A 2OKQA 4I2PB 4HHUA 4LR7A 4AHCA 2SXLA 4MFBB 5CHIA 1OWXA 1M1KO 4DB3A 5HK4A 4C98A 5GAHP 3H45C 2ASDA 3W5ZA 4NZ7A 4RW4B 4O3QA 2PI4A 1N5VA 3TEGA 4YP3A 2N3LA 3GIJA 5I9EB 2B43A 3ZTPA 4CRJA 4O3NA 3WEEA 1CLQA 2ZM6K 3G6EN 3NLCA 4KHQA 3DLRA 5L9XA 4DHVA 4BG8A 4R8UA 4LF5J 1LWEB 1Q0NA 4W5QA 2Q79A 2QX0A 2UVVA 3N5FA 3KNAA 4RUCA 5DDQC 4Z4FA 1HHSA 1KVBA 2BM1A 2FXUA 4WP8A 5AQRA 2HNDA 3UWTA 4G1IA 1RBUA 4G65A 4ELVA 3OFEA 2FLPA 4X4UA 4KHNA 2AGQA 3ISND 4DSFA 1SIZA 1S5ZA 3N4PA 2MY8A 2NRZA 3UKRB 4OMFG 2V63A 3OYBA 3NF6A 3OYCA 1WSFA 2FSKA 3ZSWA 1VS3A 5C10A 3FZHA 2NXCA 2HBMA 2CJBA 1F0XA 4USVA 1T7PA 3Q2TC 4ZITA 3NMAA 3VEYA 3AA9A 3I55N 3CC4S 1PAUB 2V67A 4FJXA 4Z4CA 3SI6A 4GNIA 1RHKB 5T41A 3V4IB 1WG4A 2GQQA 2VC1A 4JI3F 1SBRA 2EW9A 2P5VA 4JI3K 3SAHA 3LP3A 4E2FB 4CEBA 3JYTB 1X4CA 4X66J 4P71A 4OL8A 5B0GA 2LDYA 1XUPO 1BCMA 2FHJD 3SCKE 3UCGA 2FJEB 3PZPA 1A0OB 2ZGZA 1CQNA 2YWWA 4AQYF 1BC6A 3TP2A 2FYXA 4LC9B 4OKEA 3AVNA 2I7NA 1CJKA 4KR0B 3M6GA 4M42A 4ZHRA 3BREA 1TL1A 1WOPA 2LSNA 4WFBL 2YKQA 5D4OA 4H0TB 1LWXA 2XEXA 5CYQB 4LBHA 2CQ3A 1U04A 4XH1A 1RT1B 4TU9A 3AD7C 1VRTB 1U6FA 3GIIA 2Z1GA 2X1AA 5KG7A 2R7YA 1S4FA 5DG8A 2NSCA 2VFSA 2FGCA 4NLCA 1N0UA 5IT9Y 3DFEA 4CD1A 5D3GB 4DCPB 5KFAA 4LY7A 1QJHA 3R27A 3GFHA 1AT1B 1VSJA 4AFFA 5F2RA 2BJ7A 3L7UA 2HFSA 5IWAF 3BR8A 2JLEA 2XYHB 2Y3YA 5IWAK 2V51B 2VZ9A 3QAEA 2Y1JA 1ASUA 2UXBF 4CFBA 1S1TB 1R8AA 3EJMA 1RWWB 3QT8A 2VOPA 2KU7A 3J7YP 2AF6A 1XNRF 4F04B 2NYIA 2WTFA 1P90A 3BGRA 4DI6A 2ZH9A 1IBLF 3IMXA 1ZS6A 3DOKB 1IBLK 1A7GE 3GE1A 2IIRA 5DS7A 1RDBA 3WXKA 2PMWA 1LWFA 1RAOA 1HIYA 1NJZA 4UOCA 1K9MO 2IA6A 3L2QA 1HMVB 3OXLA 5EY4A 2PSZA 3S8SA 2CPDA 1Q5YA 2OTLN 4NZ6A 1KRPA 1RAEB 3SQ2A 3WHIA 5EHHA 3FBEA 1JB0C 3K58A 2QWQA 2QTDA 3B8AX 4FLTA 2CIMA 4FO0A 4AE5A 1S0VA 2ZH1A 1WOQA 1JX4A 3DRSB 5KT6A 4BDYA 2OPPB 4LMZA 5FPMA 3CO0P 4DR6J 2RQKA 2P51A 3DGPA 1UW9A 4J9LA 4CJ3A 5M1FA 3TNVA 4FYYB 5HMYA 2DTJA 1B7FA 3ZTOA 1VSHA 1U2FA 4FVCA 5ETMA 5HLFB 3FVYA 1NM1A 2NUBA 3OUYB 4PWDA 3MUMP 3MEGB 2D0CA 5KOWA 1HKCA 2E88A 4BC2A 1HNIB 3NKYA 2HF3A 2IM2A 3ONQA 5KFJA 2CQBA 2B5JA 1FJCA 4C1NI 3G6VA 1NGCA 3LGNA 3NXZA 3ULHA 4FJGA 5E3CA 1ZZNA 3AV9A 3LPYA 1WHVA 4WFYA 4ZP6A 1FI4A 2J9DA 4DR3F 3NDKA 4EBEA 3TAFA 1NGFA 3GG0A 1Y7PA 4LFBJ 2AYEA 2ETJA 2ZJRL 3LH2S 1BI4A 3R5DA 4ECXA 5LJWA 1IVZA 3O1WA 3VQ6A 1FRMA 3KJVB 1JXEA 2KVQE 3TJ8A 4CZLA 3BH7B 1S0NA 1JLGB 3THYB 4N8NA 3E3XA 2KFYA 4JBCA 1FX2A 1YLXA 4R0EA 1JCGA 2IHR1 3OSNA 2DNKA 2NLWA 2HBRB 1O51A 3R5BA 2YQ3A 1P1LA 3CJTA 3LM9A 3SPZA 1FVSA 2ZJQQ 4CW7B 3THXB 4E19A 3LPEA 1B70B 5MLCQ 1Q82O 4CLFA 2LECA 3BQ0A 1FKOA 1ULRA 5KFMA 3A3PB 2KM8C 1UVIA 4Y28C 4OJRA 4ZVEA 1XMQF 4A8WA 3W9HA 4BREA 2HNZB 1CS4B 3VQ7A 4C3LA 5FRMA 3EX7B 2VKRA 2QLXA 2O3DA 4QIFA 2VQFF 2Q2RA 3MEDB 1U1LA 2P9LB 4EHTA 3SSQA 3R1HA 4O4RA 4OJ3A 1LCUA 4ETZA 4OHZA 4HUEA 3Q24A 4FS2A 2PA3A 2F9WA 2YKMA 2ZZMA 4LIRA 1IQTA 4P2XA 4CJQA 2AIRB 4XO0A 2YHAA 5FLXY 2DHXA 3POTA 2KHOA 1FEEA 4ELUA 2WB1D 3P49B 1RBLA 1A9NB 4LF5K 5KQDA 1M1GA 5BPMA 4XDCA 2FZKB 5AQNA 2Z1JA 4V19X 1RAAB 3U1NA 1G2EA 3OHBA 1V4TA 1SZ2A 3RWUA 3WEEB 1F60B 1S6PA 4L76A 3L2RA 4Y65A 1JLEA 1KTQA 4H5WA 1VQ9N 4URQU 3A8KA 3CJAA 3FEXB 1SC3B 1KHVA 1TL5A 4R8UB 2CQCA 5A8RA 1NM2A 2P9GA 2RHQB 2JHEA 3FR0A 4QZVB 4M5LA 5LMUJ 5F1XA 2XG8A 2NLXA 4KAZA 1KFDA 3C14B 1PBUA 3VENA 4ZP8A 2HNDB 4ID1A 5TKYA 2FLLA 2OANA 3GFYA 3CJ8A 2IOCA 2FDNA 1QVGR 1IKXA 2IY5B 1BOTO 1JCFA 2EG2A 1NPKA 5KFEA 4HI2A 2LU1A 4DSJA 2I8EA 1PIEA 5IC6B 4ZPCA 3TTDA 1KVKA 3RW7A 5J2PA 4FBTA 2RE2A 3CC2S 1TMMA 2JGUA 2Y9HA 2HRTA 4LRCA 2GIRA 3N6MA 2D0OA 3H4BA 4X66K 4YFUA 2AMCB 2Q43A 2G8UA 5FPNA 3H5XA 1F5AA 1FK9A 1GX5A 1UJ6A 3HM8A 1GLAG 2GJ2A 2Z58B 2GQ2A 2Y0BB 3QWPA 1ITGA 3MM9A 3OTOJ 4HTIA 3HM9A 2YWFA 3H2UB 4YOXA 4ZP7A 1S7IA 2Z1IA 3I0SA 3D3BJ 3O3GA 3ZX3A 5HP1A 1IM6A 2M5YA 2XO6A 1TR0A 3OS1A 2QEXN 2YPZA 1HARA 3DU6A 3ILLA 5AQJA 4EZ6A 5D0GA 3OYNA 1APSA 2BQRA 5AQLA 1CJKB 4K41A 3ISZA 5HL7Q 4ZHRB 2JFDA 1EKRA 5LM7E 3C16A 4KHUA 5GMDA 3L9ZA 4RW9A 1TVRA 4NX9A 3EYZA 2C2OB 4M5GA 3ITHB 3MXHP 2XO7A 3RYLA 1N54B 2FHKA 4YB6A 3BPDA 2CQ4A 1EAYC 2HS0A 3D1HA 2NRVA 3ZSQA 3C19A 3B4MA 2WVCA 4KTQA 1VLOA 3AD9C 2ACYA 1RA6A 3KLVA 1PSDA 3PACA 1FNMA 4TLQA 5KFVA 2AA4